3F8BA

Crystal structure of the multidrug binding transcriptional regulator lmrr in drug free state
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
105
structure length
101
Chain Sequence
PKEMLRAQTNVILLNVLKQGDNYVYGIIKQVKEASNGEMELNEATLYTIFKRLEKDGIISSYWGDGRRKYYRLTEIGHENMRLAFESWSRVDKIIENLEAN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of the transcriptional regulator LmrR and its mechanism of multidrug recognition.
pubmed doi rcsb
source organism Lactococcus lactis subsp. cremoris
molecule tags Transcription regulator
molecule keywords Transcriptional regulator, PadR-like family
total genus 37
structure length 101
sequence length 105
chains with identical sequence B
ec nomenclature
pdb deposition date 2008-11-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03551 PadR Transcriptional regulator PadR-like family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 3f8bA00
2F2EA 3RI4A 1YW9A 3HYIA 2FBKA 4UVAA 3WTZA 5LBQA 3WTYC 2XAJA 1FBSA 3MEXA 4KMUX 2M1BA 4LB6B 5LHGA 1OYYA 5CVJA 4GYGA 2EFPA 3K1NA 3LA2A 2RGVA 3CJNA 3KP5A 5D8LB 1XD7A 3V7CA 3EDPA 1IXCA 5ILVA 4F7ZA 5DCFA 3IWFA 3WGHA 4S05A 4GCVA 2K4JA 1IN4A 4U0YA 3JW4A 1HQCA 2G9WA 2FA5A 4PDKA 5FD5A 3G3ZA 1EH7A 3F6OA 3IKVA 1I1GA 4M72A 3F8FA 5EEHA 1SD4A 5E17F 2IJLA 3ZN1A 5AIPA 3K1PA 1CGPA 4HX8A 1UFMA 1YG2A 2VONA 5E8IA 3J81Z 1XSXA 2RVCA 4HDVA 3DP7A 1I6XA 1R58A 4HLXA 4E70A 2OAZA 1FZPB 3F6VA 2XROA 5HDKA 4OU0A 5LGTA 4Y13A 4DNCA 4KIGA 1T38A 5F1RA 4QLCU 3KZZA 2HZTA 5K5RA 3O2PE 3DV8A 5D5VB 4I2OA 3GWZA 4ENJA 1IN6A 4OIOF 4YG2F 3HTUA 4OIPF 1G3SA 4CGZA 4LLNA 3H3UA 3G73A 2DK5A 2V79A 2EFNA 1ZRCA 5ICFA 2MH9A 2XIGA 3DF8A 2YPRA 3HHHA 2HKXA 2CG4A 3P7NA 4I01A 2FU4A 3FXRA 3E6DA 1XDUA 3M7GA 1LJ9A 1ODDA 3GYHX 2DI3A 3KLOA 4EQQA 3RTRA 1XGMA 2XASA 1T0FA 1GVJA 2OQRA 3BJ6A 5D5XB 3PQJA 2BEOA 3GW2A 1QO0D 1MKMA 1U5TA 4U7DA 1YS7A 1HSTA 2MLKA 2EV6A 1MGTA 4G94A 3ZMZA 3I0TA 4I0BA 1FNNA 3K69A 3VOEA 5L3FA 3HHGA 2CWEA 2F5CA 1FBUA 1A04A 3E6CC 5BOXA 3ZQ7A 4YIIA 1CF7B 2BV6A 2QUFA 2HYFA 2VOPA 3NRVA 2CGPA 2OZ6A 1RIOH 2EV0A 2F5DA 3EETA 2WV0A 1HKTA 3I71A 2H27A 4ON0A 2KJCA 4L18B 5BMZA 2QQ9A 1I5ZA 2FRHA 1TQPA 2XRNA 4B09A 4BXUA 4RGRA 5CVRA 1JXSA 1K78B 2O8XA 2VC0A 2DK8A 1Z6TA 2LKPA 1TW2A 5K1YA 3M8EA 3N4MA 1SAXA 1MJ9A 1BIBA 3KFWX 4CHUA 4I0AA 2ZBKA 1H0MA 1S7AA 2PEXA 3IL2A 3K9TA 3MFKA 2VN2A 1ZLJA 4CO8A 3HSRA 1W7PD 3SZPA 3J81K 4L9TA 4ENNA 3TOBA 2NS0A 5LHHA 1T98A 4WK8F 2QVOA 1ONVA 4AIHA 4IHSA 2M87A 2CQKA 3B73A 2O0YA 4RB3C 1EV7A 4AWXB 1FOKA 1ZRFA 2A5YB 3C7JA 4L0ZB 2HKOA 4P55A 1R1TA 3IRRA 3TQNA 2E1CA 3GEZA 1ZG1A 1FYLA 2QENA 3ZPLA 1G3YA 5F64A 3COAC 2OQGA 3DPTA 2GXBA 2FSWA 2CSOA 3R60A 1GXQA 5ILUA 5LEKA 3I59A 4L9VA 3GFJA 2JTVA 1SMYF 4ETSA 5BPDA 1ZGJA 4WXDA 1U3EM 4EJWA 4Q48A 2OA4A 5TRDA 2P6TA 2QM3A 5HS8A 3SFZA 3V8JA 4AD9A 2A61A 4P96A 3RJPA 3GFLA 3RKXA 1TLHB 1MDMB 4M6YA 3IKTA 4HQEA 4HV6A 4KNYA 2NNNA 3B02A 1LEBA 3E97A 4A6EA 4YIFA 3BJOA 1Z05A 3M9AA 3E6BA 4HOBA 3IRQA 4U0VA 2ZJ2A 3FF5A 2UWMA 4Q47A 1OPCA 3JTHA 3I59B 3CUOA 4L5JA 3F21A 2AS5F 1I27A 3QP6A 2P6SA 4YFKF 2NYXA 3MWMA 5KK1A 1FWZA 1ZYRF 3JSPA 2VXZA 2O6GE 1AOYA 1W5TA 1O3TA 2JPBA 3MZYA 5D6EA 1F1ZA 3WTTC 1PP8F 2HEOA 3V7SA 5DD8A 2EFOA 1LDJA 1U8RA 1OYIA 4A6DA 4Q5SF 2ELHA 4JQFA 4YFXF 3GFMA 4O3MA 4I02A 4BAYA 5JR3A 4DQ2A 4G7HF 2P5KA 4AVPA 3L2CA 1YLFA 3HSEA 4RAYA 3SZTA 2IP2A 3R0AA 1IN8A 4IXAA 2QQAA 3NQOA 1E2XA 3V4GA 3RYPA 5FB2A 5DDGA 3Q5FA 2KKOA 1TNSA 2COMA 2MC3A 1XCVA 2G7UA 4KFCA 4OIQF 2IT0A 4KIFA 1KGSA 1Z9CA 4MNUA 4EM2A 2J5PA 2W84A 1KU2A 5K5QA 2HFHA 1XSVA 2GXGA 3F22A 3WGIA 2ADUA 4NQWA 2HTJA 5HVQC 3RPUA 1R1UA 2HTSA 3ZN0A 1J59A 2Q2EA 4U0WA 4ZZLA 1YQAA 3I54A 4HF0A 4N0BA 4HDUA 3WG9A 4MHGA 3FMSA 1SD5A 2W57A 2UZKA 2GQQA 3TDZC 1U2WA 4PCQA 1FPQA 3BZ6A 2HDCA 4FT8A 3FM5A 3D0SA 2A68F 3RPQA 1VTNC 2WC2A 1STZA 3CDHA 4IRIA 4IJAA 5EEGA 2RV8A 1MDMA 4TV7A 2W85A 3LQQA 1S3JA 5DUKA 5ERIA 4BQAA 2XV4S 1O7FA 4MTDA 3FM3A 5BS6A 2B0LA 1FBQA 5D8KB 4IRGA 2EJRA 4FX4A 1YIOA 2JT1A 3F8CA 2MLGA 1J2XA 4EM0B 4XSZF 5IT9Z 5D6FA 3HUGA 3P9IA 4WF2A 1ZG3A 2STWA 1F9NA 4HBLA 3V8KA 1Q1HA 1B6AA 2YX7A 2DU9A 1RZ4A 2KIFA 4G9YA 3ULQB 2VBXA 4EV0A 4M74A 1FP2A 5LRRA 3KP7A 2PG4A 4P9FA 2CO5A 5LLQA 1FLIA 3HIFA 1C0WA 1JHHA 3AAFA 1IAWA 2ISZA 2IVMA 1IW7F 1IXSB 2IRFG 1O3RA 4G6DA 4KT5C 2D45A 2H09A 4XLNF 1G3WA 1Z1DA 3P9CA 4I09A 4A12A 3RKYA 1WWXA 2ZNZA 4LLGF 1XN7A 3KEQA 4ASNA 3F8NA 2FXAA 5DD4A 3M8FA 2DFIA 4LLLA 1QNTA 2XHKA 2H94A 1LDKB 1EH8A 1ZARA 1WI9A 1ZG5A 1HW2A 2YSRA 2EA4A 4A0YA 2QLZA 1GXPA 4G8XA 1BOAA 1HW1A 4BNCA 4CICA 2EK5A 2W24A 3IWZA 4AIKA 1WRJA 5E20A 4ZYDA 1O3SA 2OBPA 1KA8A 1YW7A 5ICCA 1W7PB 1TBXA 2Q0OA 5HLHA 3VFZA 3ABUA 3T8TA 3MZHA 1HW5A 4M71A 4CYDA 2IA1A 2PI0A 3FXUA 1XMAA 1KQ9A 1OMIA 4CDGA 2VBZA 3R4KA 3C18A 1MD0A 4LG0A 1OKRA 1SFEA 4HYEA 3K2ZA 4M6XA 1YO5C 2E7XA 1HSJA 4M73A 2L4AA 4CXFA 1USTA 1NHAA 2A3SA 2IPQX 1HKQA 4EJOA 5HDNA 1B59A 4BHCA 5FLXZ 1H9TA 1ON2A 1ON1A 1R00A 3TOAA 2K7LA 3LAJA 3DQVC 1MZBA 2ETHA 2XGXA 2XUBA 1T2KA 1F5TA 1IRGA 1O7LA 1W4MA 2D2WA 3I53A 1QQIA 4Q4ZF 2M8EA 5IT3A 3KEOA 1B9MA 3E5QA 3F3XA 5ILSA 1P4AA 1QBJA 2VC1A 3W6KB 4U7BA 1P4WA 2Z3YA 1R36A 5FGMA 2LSOA 3WE2A 3IC7A 2DPUA 3BP8A 2AXLA 1UB9A 4HAMA 1LQ1A 1J9IA 2DQLA 3Q9SA 1HXDA 4MQVA 4WXCA 2VE8A 4P5OA 5DV5A 1H9GA 5K5OA 1LDDA 2BYVE 3TDUC 1XGOA 1D8KA 3GVAA 4H0EA 4ENMA 4G6QA 1T6SA 4N9IA 2JRTA 4RS8A 3C1DA 5KVRA 3GZ5A 4UNOA 1SD6A 3K0LA 3GZ6A 2WTEA 3KE2A 2XAFA 3T8RA 2YU3A 3EYYA 2WWYA 4LJZF 1F4KA 2DO7A 4KICA 1R22A 2QQBA 2UXNA 3O3KA 3OOPA 4HW0A 2ZMEB 2DBBA 3HRSA 1DDNA 2FBHA 1BJAA 2MA3A 3E5UA 1IF1A 5TJJA 3FHZA 1IN5A 2A69F 3BOQA 3F8BA 3S2WA 5E1ZB 3CUQB 3TGNA 4FX0A 1R5HA 1TTYA 4KDPA 3L9FA 1R7JA 2EFQA 3HRMA 3HSFA 2O03A 5F6FA 3ISPA 3I4PA 2VBYA 2ZKZA 3VODA 2LF7A 1WQ2A 5CVUA 3EQLF 5A2QK 5CLSA 2FE3A 1P6RA 2Y75A 2L02A 3RDIA 5AONA 3DPLC 4HF1A 4BYYA 2L4MA 5L3BA 1UCRA 4B8XA 2HOEA 4ZZDA 2O61A 2RKHA 5E8GA 5HOOA 5E18F 3BROA 4MTEA 1P2FA 2Z33A 5HDGA 5LHIA 1DPUA 5LEJA 2KRFA 5H6QA 1QPMA 1GHCA 1RNLA 2K86A 1FC3A 2GAUA 3FZVA 2Z99A 3RIRA 3EUHA 1D8JA 2HWVA 2OU2A 4ZH4F 2HQNA 5D4SA 3RKWA 4CZZA 3OV8A 2PQ8A 4RB2C 4EM1A 1LEAA 2VODA 3T5XA 2XAGA 3E6MA 4RGSA 4IF4A 1ULYA 3LFKA 4IVNA 5E1WA 3SHFA 2LDUA 1JHFA 2QBYB 3HOSA 1ZN2A 3D5LA 2IW5A 2KIMA 3QAHA 2O3FA 4EJVA 2VT3A 2FMYA 2KJBA 1U5TC 2E7WA 1USSA 4ESFA 3DEUA 2V1UA 4PGHA 2P7VB 2QZ8A 4GXOA 4UUVA 1KQ8A 2RDPA 4EVIA 1XB4A 3NEUA 5LGUA 5D5UB 3KP2A 3I64A 4O6JA 4LGWA 5D5WB 2DT5A 1TNTA 5CJ9A 2EFWA 2HYGD 4ZYHA 3WTWC 2NRAC 1FSHA 5HS7A 1R5GA 4GYIA 2NAZA 5L3GA 3V8LA 2TDXA 2P8TA 1TQIA 1ZGAA 2MD5A 1S8NA 4NB5A 2QWWA 2VE9A 3ROUA 2KIUA 5FFZA 2HS5A 3E5XA 1PUEE 4UXNA 2YR2A 4RGUA 1BI2A 5DEQA 2P7CB 4KYWA 2BBYA 3KETA 2VOOA 3GO5A 3MCZA 2A6EF 2BGCA 3GLXA 4KN7X 3RYRA 3F23A 2EA2A 4NHJA 4LK1F 1LB2A 4OMYA 2CW0F 4EMSA 3HTSB 4P9UA 4RGXA 3U9GA 1MJAA 4R8HA 3ML6A 3ECOA 4OMZA 1XGSA 2FMLA 2PN6A 4IPAA 1P92A 1ZRDA 4BH9A 3QPTA 1OR7A 3LA3A 2Z9OA 2UXXA 2QYOA 1IZ1A 1PDNC 2V9VA 2PMUA 1U6GA 4UV8A 4L0YB 2FQ3A 2OD5A 2Y48A 5JFRA 2FF4A 1Z6RA 4M9SA 1RI7A 1BC8C 4HLYA 2M5WA 5LGNA 3DFGA 5LRSA 5HLIA 3HRTA 4OOIA 1XSDA 3CLOA 3TO9A 4LB5A 2P4WA 4WX9A 3WTUC 1K6OA 1KU3A 1BM9A 3MAJA 3N97A 2MH2A 5HLGA 2C6YA 5FO5A 4IRHA 1FSEA 5A2QZ 1B4AA 2ZCWA 4O5VA 4IHTA 3WU1B 4ESBA 1EH6A 2F5FA 1B9NA 1UHWA 4XRFA 4PZJA 3PFIA 1BBYA 3CUQC 2DW4A 3FMRA 2HR3A 1RUNA 1V3FA 4KMFA 2DTRA 1V4RA 1KYWA 3VB2A 1SMTA 5L3CA 4XBFA 5JI6A 1XCBA 1RUOA 4WXHA 3JSOA 1YTYA 5ICGA 2DQRA 1J0RA 2RQPA 5DUIA 1W5SA 5L3DA 1L0OC 3H92A 1TQMA 2XAQA 1IN7A 2PFBA 3FXQA 4HV5A 1SD7A 4FHTA 1R23A 1TW3A 3LQRA 2D1VA 3R0JA 4YFNF 2ISYA 5H20A 2IA0A 2ZFWA 5H6RA 2M30A 2X4HA 3HOTA 4QWQA 1L3LA 1DPRA 3LAPA 3FWEA 2L01A 3JTGA 4MQ9F 1T39A 3QOPA 3I58A 4L5IA 1G4DA 2EB7A 2CFXA 1WSUA 3GF2A 3REOA 3P9KA 2CYYA 4HF2A 3WODF 3H3ZA 1IRFA 2PMHA 4ENKA 3KP6A 4KN4X 2DAOA 4G7ZF 3DKWA 3QU6A 3L7WA 3QRFF 1W7PA 3TO6A 1KU9A 3FMQA 4WWCA 3M1EA 2ESNA 3WTXC 2A07F 3JAMZ 5JVTA 3I5UA 4RB0A 2J5OA 2GIVA 3VEPA 2RC4A 4KIBA 4HX7A 1KQ0A 2ZMEA 3O6BB 1OYWA 6PAXA 2VT2A 4JBAA 3DXJF 1YW8A 1FX7A 5J6XA 5FLXK 4PGGA 2PLYA 2PBIA 3PQKA 1S7OA 1YFHA 1IUYA 1U5TB 5BPIA 5D4RA 2A6HF 3LA7A 2D1HA 1U78A 2Z5UA 4HX4A 2IA2A 1HKSA 1S6LA 1WKMA 3LSTA 3KZYA 1D3YA 2NNYA 1CF7A 3E3VA 4OINF 3ERED 2FBIA 5E1XA 2K27A 2GA1A 1DP7P 2ZNYA 4LK0F 3ZMDA 1J7KA 4R79A 4EJTA 4A2UA 1BN5A 4HA8A 1UHMA 1QZZA 1K79A 4D0PA 1PP7U 2MBFA 3HRUA 2P5VA 3ELKA 4XLPF 4UVBA 3KP3A 4R1HA 4BHPA 1ZH5A 2V6CA 5DCMA 3BY6A 4RB1A 2PJPA 2P5LC 4ZYEA 1I1SA 4MEYF 2HGCA 3GXOA 3WTSC 2LF8A 1Y0UA 2ZXJA 4MGRA 1P4XA 3R61A 1LVAA 4M9XA 2ESHA 1LNWA 2VBWA 2X0LA 2QBYA 3TKYA 1XMKA 3QU3A 5J8FA 3MQ0A 4Y15A 4N9HA 3ZMSA 2L3DA 2ZO4A 3ECHA 2W25A 4LMYA 1ZAOA 1B1BA 3ZP5A 1ZHFA 2FOKA 3L00A 1FYKA 2GZWA 4L9NA 2R7FA 3U2RA 1X3UA 1S29A 2V1DA 2EV5A 4KUMA 4EJUA 2R7DA 2XKOA 4ZYGA 3CO7C 3CO6C 1Z7UA 1JE8A 3T0YA 4GGGA 1FY7A 2FNAA 4G7OF 3WGGA 5DYMA 2F5EA 3J80Z 2JPCA 3IHUA 5CYVA 3ZMVA 2E1NA 3GX4X 3LWFA 4HZFA 3T1BA 1REPC 3ABTA 1SFXA 3EYIA 2GA2A 4K2EA 2Y0MA 4A0XA 4AIJA 2LNBA 1BI3A 1XGNA 5ED4A 2G7HA 2ACJA 5FD6A 4U88A 3CTAA 4A5NA 1YYVA 5AIQA 1K7AA 2RN7A 4I7HA 4XSXF 3GFIA 1SFUA 2OZUA 4EGYA 3F8MA 1J5YA 3KCCA 3U1DA 1HBXG 4L9JA 1KU7A 1FYMA 1JGSA 1E17A 4BHBA 2L54A 3JAMK 2YX4A 4HQMA 4JK1X 2R3SA 2FNPA 4UV9A 4A5MA 1YS6A 1BI0A 1FT9A 3WE3A 3K1MA 2K4BA 1IXRC 3GUDA 3TO7A 1G6NA 4A0ZA 4LFUA 4I98B 4Y17A 4S04A 3F72A 3CUQA 5JHUA 3V7RA 2XAHA 3FX3A 3Q9VA 3SXYA 1BI1A 2DPDA 4WCGA 4UHTA 4ESJA 5L3EA 2EWNA 4Z2YA 3ZMUA 3R6SA 1D5VA 2RNJA 3QPHA 1XDSA 3BDDA 3KLNA 5BQTA 3W6JB 1O57A 2GWRA 5J8CA 3BJAA 1K78A 4M9ZA 3WTVC 2K02A 4RAZA 3L09A 2DLLA 2FEZA 1ZREA 2JSCA 4UVCA 4MEXF 3BWGA 3KP4A 1DUXC 2Q8KA 4EGZA 1QZYA 2JZYA 2STTA 1BC7C 1ZLKA 5HS9A 3C3WA 3WU0A 4OIRF 3BPVA 1G3TA 1J75A 1R1VA 2BE5F 3ZMTA 5CVVA 2M45A 3SQNA 4LD5A 2H6BA 3J80K 1KYZA 4KA4A 1MJBA 5ICEA 3BPXA 1BIAA 5FFXA 4GO1A 3J7AO 2V1XA 2H6CA 5IT9K 1Z91A 1FP1D 1O3QA 5DCMB 3QP5A 2HQRA 2XVCA 5CVIA 1AWCA 1QGPA 2XKPA 4LG0B
chains in the Genus database with same CATH superfamily
1JTXA 2F2EA 4CH7A 3RI4A 2W00A 1YW9A 2NOGA 3HYIA 2FBKA 4UVAA 3FKJA 3WTZA 2LC2A 1JKPC 1A31A 5IY5H 2W7NA 5LBQA 2O8KA 3WTYC 3VWBA 2X6YA 2XAJA 1FBSA 3F0CA 3MEXA 4KMUX 4M3FA 4D5FA 4LITA 2M1BA 4LB6B 5LHGA 1OYYA 2M4GA 5CVJA 4GYGA 3TMOA 1RESA 2EFPA 3LMMA 3BZKA 3CMYA 2PMZA 4PJLA 1XS9A 5GAEJ 2DA6A 1WGXA 2QKLB 4CCOA 3K1NA 2W4SA 3LA2A 4HPQA 2RGVA 3CJNA 3KP5A 5D8LB 1XD7A 3V7CA 1IG7A 2E5NA 1AA7A 2Y9YA 3EDPA 1T95A 4PJJA 1IXCA 5ILVA 4F7ZA 1Y0NA 3MMYB 5DCFA 1SVMA 3IWFA 4BDZA 3WGHA 1P7IA 4NDLA 4GCVA 2BY1A 2K4JA 1IN4A 4JP0A 4S05A 2V4JC 2LKSA 4U0YA 3RPUD 3JW4A 1HQCA 1MH3A 1X1BA 4C30A 2M7AA 5FKKA 2G9WA 2R7UA 3HOXJ 2FA5A 3J7AY 2KZVA 2JA6J 4PDKA 2DYRH 3G3ZA 2Y2ZA 5FD5A 1B72B 3DWLE 1EH7A 4CCMA 4YELA 2BHZA 2ME0A 4QPQA 1MNMC 2M8GX 3F6OA 3IKVA 1OR7C 2M9HA 1I1GA 3MN2A 3RZOJ 1T56A 3CMMA 2WAQA 3FXKA 3F8FA 2DA7A 3IAM2 4M72A 5EEHA 1SD4A 5E17F 2IJLA 2IAIA 3Q0WA 3CCJI 3ZN1A 2Y0SN 1PYVA 3C2HA 4HNUA 1F36A 5AIPA 3K1PA 1CGPA 1E3PA 4HX8A 1UFMA 3PNVA 2OF7A 3H0DA 1YG2A 1OCOH 2HDWA 2EZHA 2VONA 3GTQJ 3PL8A 1VFCA 4KT6A 5E8IA 3J81Z 1XSXA 2RVCA 4HDVA 1MMSA 3DP7A 1I6XA 2L5QA 1R58A 5BNGA 3AL0B 1TT0A 4HLXA 4E70A 2OAZA 3JRIA 1FMVA 3MVPA 4CZCA 1FZPB 3S16J 2IXSA 3F6VA 3IH3A 4UB6C 5HDKA 5IP9J 2E36A 4OU0A 2XROA 5LGTA 3K6GA 4Y13A 4DNCA 1NG6A 4KIGA 1T38A 2K85A 5F1RA 5C4XJ 2KRHA 4QLCU 2H8WA 2XB5A 1O4XA 2JQ7A 3KZZA 2HZTA 1OCPA 5K5RA 3O2PE 3DV8A 5D5VB 1OISA 3H5AA 2Y0SA 3WHCA 2EZIA 5B1AH 4LIVA 2K9QA 1WPKA 4I2OA 3LOCA 3GWZA 4ENJA 2HOAA 1IN6A 4OIOF 4YG2F 3HTUA 3CCQI 4OIPF 1G3SA 4QIWN 3BG9A 2OTLI 1W36D 4CGZA 1Z7LA 1W1WE 4LLNA 1AKHA 3H3UA 3G73A 2DK5A 3EUKL 2V79A 4UUTA 1YX3A 2EFNA 1ZRCA 2I5UA 5ICFA 2MH9A 3FXLA 1Z21A 2XIGA 1K4TA 4UUSB 3D5SC 2NOJB 3DF8A 2YPRA 3HHHA 4IHVA 2HKXA 2QGUA 2CG4A 4E6KG 3LL7A 3P7NA 4I01A 4EEFG 2FU4A 3FXRA 3VSKA 2CUEA 3E6DA 1XDUA 3M7GA 1LJ9A 1ODDA 3HOYJ 3GYHX 5EG0B 3UR3C 2E5ZA 3F9KA 2DI3A 4XIDA 3KLOA 4EQQA 3CLQA 3RTRA 3IUOA 1XGMA 4B3AA 4HG2A 2RQQA 2WAFA 4RMNA 4A3MJ 1NTCA 2XASA 3BTJA 1T0FA 1GVJA 1RC9A 2OQRA 5J1UA 3BJ6A 2ECBA 2DMPA 5LD2C 3SEQA 5D5XB 1JI8A 3PQJA 1X58A 4ZDLA 2BEOA 2R4GA 3BQYA 4ANJA 3VYTB 3GW2A 3G71I 1QO0D 1MKMA 3CP2A 1U5TA 4U7DA 1YS7A 2V1NA 2R5ZA 3H0GJ 1HSTA 2MLKA 2EV6A 1YIJI 4F3QA 1MGTA 4G94A 2BXZA 3CQZJ 3ZMZA 3I0TA 4B3XA 1H8AC 1W36C 1ACIA 4I0BA 1FNNA 3K69A 5GAGJ 1X1AA 3DLLF 3HC7A 3VOEA 5L3FA 3HHGA 2CWEA 2LOOA 2DA5A 3MKWB 2LY9A 2MC4A 2F5CA 1FBUA 1R71A 1X1DA 4UUSA 3GTKJ 1A04A 3E6CC 3TP3A 3ZQ7A 4YIIA 4CCNA 4HNVA 5BOXA 1ZR2A 2IS2A 1X1CA 1CF7B 2BV6A 3PNYA 1MBFA 2R5YB 2PMZN 1HCRA 2HXIA 3CCRI 2QUFA 2UV1A 2HYFA 1S9HA 3DBRB 3HZJA 1IV6A 3CD6I 2CW7A 2VOPA 2VQGA 1Z0XA 3NRVA 2CGPA 2OZ6A 1RIOH 2EV0A 3A2KA 1HOMA 4BQOA 1D0XA 2EPFA 2F5DA 3EETA 2HZDA 2I8DA 2WV0A 3TW7A 3BG5A 3J7ZI 1HKTA 3I71A 1TWAJ 2ZJPF 1W0TA 2H27A 4ON0A 3D1NI 3DTKA 2KJCA 4BBSJ 2L2OA 4L18B 4KITB 2XRLA 1HC8A 5BMZA 2QQ9A 3PO3J 1I5ZA 2FRHA 1TQPA 2XRNA 4B09A 4BXUA 2HU9A 4RGRA 3BTCA 5CVRA 1JXSA 3LSIA 3ZRGA 2Y30A 1K78B 2E1OA 2VKEA 2O8XA 2XC7A 2VC0A 4RM3A 2DK8A 2KP6A 1MNEA 1NK2P 3K10A 4ZTJA 1Z6TA 2LKPA 1TW2A 5K1YA 1UAAA 1OLTA 3M8EA 1D0YA 1OJLA 1D5YA 3N4MA 1SAXA 1MJ9A 1BIBA 3KFWX 4CHUA 4I0AA 3GTMJ 1MMDA 5FRNA 1H89C 4Y52J 2ZBKA 1H0MA 4A3GJ 1VQOI 1S7AA 2PEXA 3IL2A 1WJDA 3PIPF 1VQ5I 1FEXA 5H2FC 1FOXA 3K9TA 3MFKA 4AVZA 2VN2A 5M5XJ 1ORKA 1ZLJA 4CO8A 3HSRA 1W7PD 3FBIB 2DOEA 2VKDA 4FASD 3S3MA 3FISA 1VZ0A 3SZPA 3CJRB 2B7EA 3J81K 3I56I 3BT9A 4L9TA 4B47A 3BTLA 3OWTA 2CJJA 4ENNA 3TOBA 2NS0A 3RQ4A 5LHHA 1T98A 4WK8F 2QVOA 3DLAA 4BE1A 2VJJA 1ONVA 4AIHA 3OY9A 4IHSA 5EZHA 2M87A 2CQKA 3B73A 1RKWA 3HEFA 1U9OA 3FBNB 2CUFA 2O0YA 2E2IJ 2DA1A 4RB3C 1EV7A 1E3OC 2XF7A 4AWXB 1FOKA 1ZRFA 2A5YB 3C7JA 4L0ZB 2HKOA 4P55A 1R1TA 2A05A 4V2FA 2EILH 3OYEA 3IRRA 1JKRC 2LMDA 3H36A 3TQNA 2E1CA 1Z67A 2IGMA 1GV2A 3GEZA 1ZG1A 5FRMA 3WU2C 1FYLA 2DTZA 3CESA 2QENA 3ZPLA 1G3YA 5J1YA 5F64A 3COAC 2OQGA 3DPTA 2GXBA 1YJWI 2XGCA 5B66C 2HXOA 2VJ4A 2LYCA 2FSWA 2EIKH 1YITI 3S2HJ 2CSOA 3R60A 1GXQA 3K4JA 2PJRA 5ILUA 5LEKA 1VQKI 3I59A 4L9VA 4JX4A 2LK2A 1VQ6I 3GFJA 2JTVA 1SMYF 4BJ6C 5M5YJ 3RSNA 4B48A 3ZCOA 4ETSA 5BPDA 1ZGJA 2CH0A 5EEAA 4WXDA 2LY1A 4CCJA 1MBKA 4EJWA 1U3EM 3QYEA 4Q48A 2OA4A 3KIOA 5M3FJ 3JRAA 5TRDA 2OPTA 2P6TA 2QM3A 5HS8A 1JGGA 4LIUA 3SFZA 2CV1A 5F04A 4D9JA 3V8JA 2A61A 4P96A 4AD9A 3RJPA 3GFLA 3RKXA 2LD5A 1TLHB 3W6VA 1MDMB 3FHNA 4M6YA 2GBYA 3IKTA 4HQEA 1A6QA 1MBJA 3DBHB 4M3GA 4BQNA 4HV6A 4KNYA 4XLEA 1A6IA 2NNNA 3ASNH 2HQAA 2JWTA 3B02A 5CQEA 5KNLA 2QF7A 1LEBA 3E97A 4A6EA 5C4JJ 4D7MA 4YIFA 1YJNI 3BJOA 1Z05A 3M9AA 3E6BA 4HOBA 3IRQA 3OYJA 4FE7A 4U0VA 2ZJ2A 5GAHJ 2L9SA 3FF5A 1GDTA 3KYLA 5EF6A 2UWMA 2M34A 4Q47A 5IPAA 3OYDA 1OPCA 3C2GA 3JTHA 1PUFA 3QODA 3KYCB 3NWTA 1B72A 1VQ8I 3I59B 4ZTFA 4U87A 1LKXA 3CUOA 4L5JA 3VYUB 5E3NA 3F21A 4J00A 3LSKA 3GTLJ 2COBA 2IEKA 2CFOA 2X6WA 2AS5F 2R5ZB 2JMWA 3A03A 4MIMA 1I27A 3QP6A 2PX9A 4IZZA 2HOSA 2P6SA 5F0HA 3JR9A 3OR1C 3H35A 4YFKF 1TWGJ 2NYXA 4A3JJ 1JT6A 3MWMA 3GMEA 5KK1A 1FWZA 1ZYRF 2X6XA 3JSPA 2VXZA 2YUSA 3ESWB 2HVRA 2O6GE 1AOYA 3B6CA 1W5TA 1O3TA 2JPBA 3MZYA 5D6EA 3K2AA 1F1ZA 3WTTC 1PP8F 1LE8A 2OUMA 2HEOA 4XKVA 5DM7F 2F5VA 3V7SA 4AC0A 1AHDP 5DD8A 3DTEA 1H88C 2EFOA 2DMTA 1J09A 1LDJA 1U8RA 1OYIA 1SEUA 3W2AA 3JRGA 3K7AJ 4A3FJ 2ZC2A 3OOUA 1VI0A 3G4SI 1EJ9A 4A6DA 4Q5SF 2ELHA 4JQFA 2XF5A 4FCYA 5KCMA 4YFXF 2ID3A 1ZGWA 5EZGA 3GFMA 4O3MA 1X3ZB 2QCOA 2E71A 2JVGA 4I02A 3U1KA 4BAYA 1N75A 5JR3A 4DQ2A 5CKTA 4G7HF 3FIWA 3HDDA 2P5KA 4AVPA 3L2CA 1YLFA 3HSEA 1NH3A 3HOUJ 4RAYA 3SZTA 2EIJH 2IP2A 3R0AA 1IN8A 4IXAA 1IJWC 4Y3OA 2QQAA 1JJ6C 3NQOA 2JUGA 1E2XA 3ABMH 3V4GA 1Y1WJ 3RYPA 5FB2A 5DDGA 5J4YA 3HKZA 1DP3A 3FXOA 2JJ7A 3Q5FA 2KKOA 4C2UA 4ZJZA 1SC7A 1TNSA 1Y56A 2LLKA 2COMA 2MC3A 1XCVA 1OCTC 2G7UA 4KFCA 5E3OA 4OIQF 1N25A 2IT0A 4KIFA 1KGSA 1Z9CA 4MNUA 1E0EA 5E3MA 3H9QA 3DBLB 4NC8A 1WFXA 4EM2A 3MZ8A 5CQGA 3DTIA 2J5PA 2W84A 1KU2A 3SZGA 5K5QA 2HFHA 3HBLA 1XSVA 2DMQA 2GXGA 3F22A 3WGIA 2ADUA 4NQWA 2HTJA 5HVQC 3RPUA 3CCMI 4RDUA 1JUPA 1R1UA 2HTSA 3ZN0A 2MGQA 4XN0A 3ZQFA 1J59A 2Q2EA 2DJNA 4U0WA 4ZZLA 1YQAA 3I54A 4HF0A 4N0BA 4HDUA 3WG9A 1ETQA 4MHGA 2X9DA 4XMYA 2WAQN 3FMSA 1OFCX 1BOBA 1SD5A 2VPRA 2M3AA 1Y8QB 2W57A 2UZKA 4BY1J 2GQQA 3TDZC 1U2WA 4IEJA 1MMAA 1SAUA 1TWFJ 4AUXA 1T08B 4PCQA 1FPQA 3BZ6A 2VQCA 2HDCA 4FT8A 3WG7H 1ETYA 1WJBA 3HB9A 3FM5A 3D0SA 1APLC 1WJEA 2A68F 2MFZA 3QYFA 3RPQA 1VTNC 2WC2A 1STZA 3CDHA 4IRIA 4N4NB 4IJAA 5EEGA 2RV8A 1MDMA 4TV7A 3GTPJ 2W85A 3LQQA 1UELB 1S3JA 5DUKA 2MSYA 2JA7J 3JRDA 2JK3A 5ERIA 4BQAA 2N8GA 3D5RC 2CV0A 4GDFA 4DYRA 2XV4S 3FDYA 1O7FA 4MTDA 2WB1A 5K7ZA 2LVSA 3FM3A 5BS6A 3OYGA 4XICA 2B0LA 1FBQA 5D8KB 4IRGA 2EJRA 1RR8C 4FX4A 1YIOA 1R6RA 2JT1A 2GXAA 3F8CA 2MLGA 5M3MJ 1J2XA 1MBGA 3H5RA 3CP8A 4EM0B 2JA2A 4A3DJ 3KZIC 4XSZF 2JN6A 2BXYA 1AKHB 2CUZA 4F91B 3QQAA 5IT9Z 5D6FA 3HUGA 3P9IA 4WF2A 1ETVA 4BGDA 4A3LJ 3TP0A 1ZG3A 2STWA 1F9NA 4HBLA 1IGNA 3V8KA 4JYKA 4E7JA 2ECCA 1Q1HA 2KMUA 2NVTJ 2VQLA 3I3LA 3MKLA 1B6AA 2YX7A 4KJZA 4A3BJ 2DU9A 2AHQA 1RZ4A 4CYCA 2KIFA 2IS1A 4G9YA 2QSHX 4BE2A 3ULQB 2VBXA 4EV0A 4M74A 1FP2A 5LRRA 2CW8A 2NS8A 3KP7A 2VKHA 4C3HJ 2PG4A 4P9FA 1I39A 1HA8A 4FISA 4XOPA 2FQ4A 1MSEC 2L9NA 2CO5A 2A6TA 5LLQA 1FLIA 3HIFA 1C0WA 2DA2A 4E7LA 1JHHA 3AAFA 3SEZA 4DIQA 1IAWA 2ISZA 3S93A 2IVMA 1IW7F 4IQ4A 3LSGA 1ETWA 2Z16A 1IXSB 2V7FA 2IRFG 4XL9A 1O3RA 1VNDA 4G6DA 4KT5C 2LG4A 2D45A 2H09A 4XLNF 1G3WA 1Z1DA 3P9CA 4I09A 4A12A 5FROA 3RKYA 2IGKA 4PUSA 4A69C 1WWXA 4XR6A 2ZNZA 4LLGF 1XN7A 5LFAA 3KEQA 4IL6C 2R7TA 4OAYA 4ASNA 3F8NA 4BBRJ 2DA4A 2FXAA 5DD4A 1TC3C 1IDYA 2BZTA 2TCTA 3M8FA 1X19A 2DFIA 1EKEA 2GOMA 4LLLA 1QNTA 3ZXSA 4IQJA 2XHKA 2H94A 2LH9A 1LDKB 1EH8A 1HDPA 2NVYJ 1ZARA 2LRDA 2KDOA 1WI9A 1ZG5A 4MFEA 1HW2A 2YSRA 3E7LA 5TISC 2EA4A 4A0YA 1A36A 3K70D 3RQIA 2BVLA 2QLZA 1GXPA 4G8XA 1BOAA 1HW1A 2XPVA 4CICA 4BNCA 3MKZA 2EK5A 2W24A 3IWZA 4AIKA 1WRJA 2VASA 5E20A 5DM6F 5GTHC 4ZYDA 1O3SA 2OBPA 1D1AA 4MFDA 2WY7Q 1KA8A 1YW7A 3GLLA 5ICCA 3J7YJ 1W7PB 1TBXA 4XRSA 2Q0OA 2W82A 5HLHA 2O5RA 3VFZA 2HDDA 1D1CA 3MD2A 3AG1H 3X2QH 3ABUA 3T8TA 1HW5A 4M71A 3MZHA 4CYDA 2IA1A 3ABKH 2IGNA 2PI0A 3FXUA 3OYBA 3QPLA 5KAFC 1XMAA 4FQGA 1KQ9A 1OMIA 2CQQA 4N4OB 4CDGA 2VBZA 3HOVJ 1X3WB 2VB6A 3R4KA 3C18A 1MD0A 4LG0A 1OKRA 1SFEA 3DU5A 4HYEA 3K4LA 1OCRH 2WA0A 3K2ZA 4M6XA 4XORA 1YO5C 2E7XA 1HSJA 2VJ5A 3AL0C 5GP9A 1IUFA 4M73A 2H1LA 2L4AA 1USTA 1XG1A 3BZCA 1EA3A 2VL8A 2HI3A 4CXFA 1NHAA 2A3SA 2IPQX 1HKQA 3W2VA 4EJOA 1M1EB 1WHUA 5HDNA 2KRCA 1B59A 5DS9A 5JVGF 2VPLA 4BHCA 5FLXZ 2WADA 2E19A 1UHSA 5GTIC 4ZC3A 1H9TA 1ON2A 3KX2A 3LSMA 3NAUA 4A3CJ 1ON1A 1R00A 3TOAA 2K7LA 2NVXJ 3LAJA 2KPMA 2XGDA 5GPAA 3DQVC 1MZBA 2ETHA 4UB8C 5JLWA 1FTZA 3DEEA 3BG7A 1ENHA 3S17J 2MW8A 2XGXA 5E3LA 2XUBA 1SVOA 3CC7I 1T2KA 2GIZA 4FETA 1F5TA 3BG3A 1Z77A 1IRGA 1O7LA 1W4MA 1BJZA 1QRYA 2D2WA 3I53A 3OYCA 1QQIA 4Q4ZF 2M8EA 5IT3A 2R7ZJ 3KEOA 1B9MA 3CC4I 1R9TJ 3E5QA 2NVUB 4D7NA 2F4OB 3F3XA 5ILSA 1DGRM 1P4AA 2WB1N 1QBJA 2VC1A 5DTDA 1ITYA 3W6KB 4Y4RA 3HKZN 2GOXB 4U7BA 3S14J 4I6ZA 1BW6A 1P4WA 2Z3YA 3WHBA 4QPOA 1R36A 3PUBA 5FGMA 4XQFA 1IDZA 2LSOA 2XB0X 3WE2A 2R7VA 3IC7A 3CMEI 1B8IB 1T0FC 2DPUA 4HEA2 5IOZA 1I6HJ 4PJ0C 3BP8A 2AXLA 3K4CA 1UB9A 4HAMA 1LQ1A 1J9IA 2DQLA 3Q9SA 3GZNB 1HXDA 4AM3A 4MQVA 4CCKA 2V9PA 4G6TB 4WXCA 2VE8A 4P5OA 5DV5A 4DZJA 1H9GA 5K5OA 1BW5A 1LDDA 2BYVE 3TDUC 1QHHD 2E60A 1XGOA 4YRVA 1D8KA 3GVAA 4H0EA 5EJCA 4ENMA 4X6AJ 4G6QA 1T6SA 2IBDA 4A3KJ 2R7RA 4BY7J 4N9IA 2Y31A 2X51A 4BU2A 2R5YA 2JRTA 3CF2A 3FK6A 1QPIA 2XPWA 3IV5A 4RS8A 1I3AA 4BL0B 3C1DA 5KVRA 3GZ5A 4UNOA 1SD6A 2AO9A 2L0KA 3K0LA 3Q0UA 4X0GA 3GZ6A 2WTEA 3KE2A 3H5NA 2XAFA 3T8RA 2RNGA 3BG6A 3E1SA 2YU3A 1QU3A 3FXJA 3EYYA 3JCUC 2ZSIB 3OYHA 2WWYA 3HPHA 4LJZF 1F4KA 2DO7A 4KICA 4NC7A 2BW3B 1IO2A 2XF6A 1R22A 2QQBA 2UXNA 3DKYA 3O3KA 3OOPA 2ZMEB 4HW0A 1XC5A 2DFHA 2DBBA 3HRSA 1DDNA 2P0WA 2FBHA 1BJAA 1UG0A 2UUZA 1S7EA 2MA3A 4C9YA 3E5UA 1FOYA 1IF1A 3BCAA 5TJJA 3FHZA 2XSJC 1ETXA 1IN5A 2A69F 4RM2A 1YOVB 1UMQA 3BOQA 3F8BA 3S2WA 5E1ZB 4HNTA 2NS7A 3CUQB 1VQNI 2Q2EB 3TGNA 4FX0A 3OYIA 1R5HA 1TTYA 1QHGA 4KDPA 2M4KA 3L9FA 1R7JA 3S3NA 3I9V2 1PUFB 2EFQA 3DKXA 3HSFA 2O03A 3HRMA 5F6FA 3RZDJ 1XPXA 3BR0A 3ISPA 3KEYA 4D1QA 2CQNA 3I4PA 2VBYA 1N77A 2ZKZA 3VODA 2LF7A 3LSPA 1WQ2A 5CVUA 2ZXWH 3EQLF 5A2QK 5CLSA 2XPUA 2FE3A 2ZMEC 3VPRA 1P6RA 2Y75A 2L02A 3RDIA 5AONA 4HSRA 2ELKA 4ZYAA 5EG0A 3DPLC 3CCVI 2K9LA 4HRIA 3HL2A 4HF1A 4BYYA 2L4MA 1WI3A 2WY8Q 5B5EC 5L3BA 1UCRA 4B8XA 2HOEA 4C3IJ 4ZZDA 2O61A 3N05A 2DODA 2RKHA 5E8GA 5HOOA 3CMAI 5E18F 3BROA 4NC6A 4IHYA 4XLAA 4MTEA 1P2FA 2Z33A 3OS1A 2KL4A 5HDGA 5LHIA 1U0JA 1DPUA 1BL0A 1OCZH 4XKBA 1WJAA 5F0CA 5LEJA 2BVMA 2KRFA 3BR2A 5H6QA 1QPMA 1P7JA 1GHCA 2Y9ZA 2ZJRF 1RNLA 2IS6A 3ZQCA 4F92B 2K86A 1IRZA 1FC3A 2GAUA 5J47A 3O8HA 2ICWG 3FZVA 2Z99A 4BJTA 2F6CA 2DDBA 3RIRA 2R7XA 3ONQA 3SDGA 5JLXA 3EUHA 1GT0C 3PJRA 1D8JA 2HWVA 2OU2A 4ZH4F 2FOWA 2HQNA 5D4SA 2OV7A 1NK3P 3RKWA 2HVSA 2QSGX 3S2DJ 4CZZA 3BR3A 2PQ8A 2KISA 3OV8A 1MNDA 4RB2C 5IYDJ 2O7OA 2BY2A 1I50J 4EM1A 2NVQJ 1LEAA 3PO2J 3ZQQA 2VODA 1ETKA 3T5XA 3L2QA 2XAGA 2BHYA 2RAEA 3E6MA 4RGSA 5K7FA 3UKGA 4IF4A 1ULYA 3LFKA 3UNGC 4IVNA 5E1WA 3SHFA 2LDUA 1JHFA 3HOSA 1BR1A 2QBYB 1ZN2A 5F27A 3VSLA 3M8JA 3D5LA 2IW5A 2KIMA 3QAHA 2O3FA 4EJVA 5KAIC 2VT3A 2FMYA 4NQWB 2KJBA 3GTOJ 1U5TC 4LOCA 2E7WA 3OS0A 1USSA 4Y33A 4ESFA 3HM5A 2BY0A 3DU6A 1Y1VJ 3A4CA 3TEDA 1HLVA 3DEUA 2V1UA 4PGHA 2P7VB 2QZ8A 4GXOA 4UUVA 2QKMB 1FOWA 1VQLI 1KQ8A 2RDPA 4EVIA 1XB4A 3NEUA 4JX6A 5LGUA 5GADJ 2R7OA 5D5UB 1F43A 3KP2A 3I64A 4O6JA 4ITVA 2L7KA 4LGWA 5D5WB 1X2NA 4IOAF 3HPGA 4I99C 2DT5A 3A01B 1TNTA 5CJ9A 2EFWA 2MYSA 1LFBA 2HYGD 3AG2H 4ZYHA 3CCUI 3WTWC 2FX0A 2NRAC 1T8IA 4JX5A 1FSHA 5HS7A 3OIOA 1R5GA 4GYIA 1VQMI 4BKXA 2DN0A 4XM3A 2NAZA 3ABLH 5L3GA 3V8LA 1FMWA 2TDXA 1YHQI 2DDAA 2P8TA 4B44A 1TQIA 1ZGAA 1CQTA 2MD5A 3OL3A 4CUGA 1MSFC 1S8NA 4NB5A 2QWWA 5K7HA 2VE9A 3ROUA 2DOAA 1WJ5A 1MMNA 1MBHA 1V5EA 1WVRA 2OCEA 2KIUA 5EDNA 2KLOA 5FFZA 1JTYA 2HS5A 4I76A 3W2WA 3E5XA 1A5JA 1PUEE 3GBGA 2X1EA 3OYAA 2DCEA 3C2BA 2KHMA 4UXNA 4RAFA 2YR2A 4RGUA 1BI2A 4BACA 4V19K 2ID6A 3TBIA 4C2TA 4FE4A 5DEQA 2P7CB 4BXXJ 3OMYA 4KYWA 2BBYA 3KETA 1ZELA 2CU7A 3ZR8X 2VOOA 3GO5A 1RPWA 3MCZA 2A6EF 2DFEA 1BR4A 4GFBA 2BGCA 3CCEI 3GLXA 4KN7X 5GPCA 3RYRA 3RCOA 1IRXA 1FJLA 1BA5A 3F23A 2EZLA 5HNFA 2EA2A 4NHJA 3BLYA 4LK1F 1LB2A 5HODA 1Y39A 4OMYA 2WV1A 2HPIA 1U9NA 3CF5F 3OL4A 1YI2I 2EBIA 4V2GA 3S1NJ 3ZQLA 2L7MP 2CW0F 3S15J 4RLFA 4EMSA 2KIQA 2JUCA 3B6AA 3HTSB 4XLFA 4P9UA 3E0JB 4RGXA 3U9GA 1MJAA 4R8HA 3BR6A 3ML6A 1JUMA 2DFFA 3OR2C 2K3PA 3ECOA 3GCMA 1MW7A 3ZOBA 3IAS2 4OMZA 2LKXA 2LY2A 1XGSA 2FMLA 2PN6A 4IPAA 1P92A 1ZRDA 2ME6A 3Q0VA 3SFIA 4BH9A 3QPTA 1OR7A 1MH4A 2R7SA 4XOTA 1DU6A 3LA3A 3S8PA 2QSFX 2Z9OA 3OYFA 1EF4A 2UXXA 2QYOA 1IZ1A 2M2EA 4BDYA 1PDNC 1D0ZA 1G59A 2V9VA 2PMUA 2MG4A 2H1KA 1U6GA 4RLQA 4UV8A 4L0YB 2FQ3A 2OD5A 1RETA 2Y48A 5JFRA 2FF4A 1Z6RA 4M9SA 1RI7A 4XLHA 1BC8C 1GVDA 2TRTA 4HLYA 2M5WA 5C3EJ 1V5GA 3I4MJ 3CCSI 5LGNA 1YE9A 2K5CA 3DFGA 1DGWY 1SFKA 3DEWA 5LRSA 3IH4A 5HLIA 3HRTA 5EYRA 4OOIA 1XSDA 4E4HA 3CLOA 2LTPA 3TO9A 3ASOH 4LB5A 2LR8A 4P1WA 2P4WA 4WX9A 4NBQA 1YRNA 2E2JJ 3BQZA 2JA8J 3WTUC 3H9JA 4II2A 1K6OA 2XSDC 4DBQA 1KU3A 1BM9A 3MAJA 1X4OA 2CRGA 4XNFA 2DMNA 3SYTA 3JRFA 2JRMA 2MH2A 3N97A 4BS9A 4BXFA 5F08A 2L7FP 1ZR4A 2XDVA 2CUJA 5HLGA 2C6YA 5FJ8J 5FO5A 1W0UA 3P5JA 3FKIJ 2E1MB 1Y6IA 4YEJA 5HLTA 4IRHA 3CDLA 1FSEA 4D5CA 1LFUP 3CDIA 2YS9A 1B4AA 2ZCWA 4O5VA 4XKCA 5A2QZ 2K9MA 4IHTA 2HNHA 2KFDA 3IH2A 3WU1B 2D5VA 1ETOA 4ESBA 1EH6A 3G1MA 1VQ9I 1V54H 2F5FA 1B9NA 2OC6A 1X1PA 1UHWA 4XRFA 4PZJA 5M5WJ 3PFIA 4PFPA 3BR5A 3AG3H 1BBYA 1TT5B 3CUQC 2CS3A 2DW4A 3H9GA 3FMRA 2HR3A 1RUNA 1V3FA 3KPHA 4KMFA 2DTRA 2X48A 1V4RA 1KYWA 1YX5A 1SANA 5F0FA 3BC8A 3VB2A 1RRJA 1SMTA 4C3JJ 2I10A 2OCCH 5L3CA 4XBFA 5JI6A 2GM4A 5E79C 1XCBA 2K3FA 2DT6A 1JJ8C 4WXHA 1RUOA 3JSOA 1YTYA 5ICGA 4CSWA 2DQRA 1J0RA 4LG3A 5JHFA 2RQPA 5DUIA 1W5SA 5L3DA 4DW6A 1L0OC 2M0MA 3I4NJ 3A0HC 1YJ9I 3H92A 1TQMA 2XAQA 3HG9A 4XKWA 4QSHA 3OSGA 4ZDPA 1IN7A 2E2HJ 1UJ8A 3JRCA 2PFBA 4BEHB 1ZK8A 3FXQA 4HV5A 1GUUA 1SD7A 4FHTA 1TW3A 1R23A 3LQRA 5B1BH 4XRMA 2D1VA 3R0JA 4YFNF 2R7WA 4DYCA 2LREA 2ISYA 5H20A 2IA0A 4W97A 1QA6A 2ZFWA 2LP0A 4HSTA 1D1BA 5H6RA 2M30A 2WBMA 2X4HA 3HOTA 4QWQA 3QWLA 1QVTA 1L3LA 1DPRA 1B8IA 3LAPA 3FWEA 2CMPA 3NWSA 3A1YA 3K4BA 1UZCA 2L01A 2ZJQF 3JTGA 5CPRB 4MQ9F 1V55H 1T39A 3FXMA 2JSPA 3QOPA 3I58A 1K61A 2R93J 4RAGA 4L5IA 1G4DA 1VF9A 3BCBA 2EB7A 3TL4X 2JA5J 2CFXA 1WSUA 3NARA 3GF2A 3REOA 3P9KA 2CYYA 2VKVA 3PIOF 2DA3A 3H3ZA 3WODF 4HF2A 1IRFA 2PMHA 4ENKA 3KP6A 4KN4X 2DAOA 4G7ZF 3DKWA 2EINH 4DGWB 3QU6A 3L7WA 2DXIA 2VUMJ 4J01A 4S0HB 3QRFF 2O9LA 2R92J 1K4SA 1W7PA 2WAEA 1LVKA 3TO6A 1KU9A 3FMQA 4WWCA 3M1EA 2ESNA 2BW3A 3WTXC 2A07F 3JAMZ 5JVTA 3I5UA 4RB0A 4XLCA 2J5OA 2GIVA 1LE8B 3L2RA 1IC8A 3VEPA 4M3DA 3Q3SA 3PUFA 1TL8A 2RC4A 4NUBA 4B4CA 2F48A 1XMXA 2ZFUA 4KIBA 4HX7A 3BTIA 3EPZA 4IX7A 1KQ0A 1VQPI 1QZEA 2ZMEA 3O6BB 1OYWA 3VYRB 6PAXA 2VT2A 2CQ7A 3GTJJ 4JBAA 3DXJF 1YW8A 1FX7A 4PK4A 3AFHA 2H8RA 5J6XA 1LPQA 5FLXK 5IP7J 4PGGA 2PLYA 2PBIA 1AU7A 2CQXA 3OYMA 3A0BC 3PQKA 1S7OA 1YFHA 2VI6A 1IUYA 1U5TB 4XONA 5BPIA 2K9NA 5D4RA 2A6HF 3LA7A 2D1HA 1U78A 4IHWA 1BR2A 2Z5UA 1I3QJ 2EH3A 4HX4A 2IA2A 1HKSA 1S6LA 3PSFA 2ZXIA 1WKMA 3LSTA 3K4NA 1R49A 3G1LA 3KZYA 2DT7B 1D3YA 5J4VA 4XRSG 2NNYA 5FLVA 3OIPA 1CF7A 3S1RJ 4GRIA 2AQEA 3E3VA 4OINF 3ERED 2X1DA 2FBIA 2EIMH 5E1XA 5HNHA 2MD0A 4CYCB 4RA2A 2K27A 2GA1A 1LFPA 1DP7P 2ZNYA 4LK0F 3ZMDA 1J7KA 4R79A 1DU0A 4EJTA 1Z3XA 4A2UA 1BN5A 3HGYA 4DYQA 1ERDA 4E7ZA 4HA8A 1UHMA 1QZZA 1LUJB 2HPMA 1JKQC 1K79A 4M3BA 4D0PA 1PP7U 3IP4B 2MBFA 3HRUA 2P5VA 3S32A 3VDXA 3BR1A 1X4PA 1TWHJ 3JRHA 3ELKA 5EGOA 5C44J 4XLPF 4UVBA 2E1MC 3KP3A 4R1HA 4BHPA 2EQRA 1ZH5A 2V6CA 1NG7A 5DCMA 4F52A 2W1OA 3BY6A 2L9RA 4RB1A 1G2HA 2Z2SB 2PJPA 2P5LC 4ZYEA 4J19A 1I1SA 3DCFA 4MEYF 2HGCA 3GXOA 5IYBJ 3OYKA 2BY3A 3WTSC 1FIPA 2G0EA 2LF8A 1Y0UA 2DJIA 2ZXHA 2ZXJA 4OAZA 4ABZA 2FUG2 4MGRA 1P4XA 2FD5A 2KQRA 1MBEA 3R61A 1G8XA 4YIRX 3M3YJ 3G1OA 1LVAA 4L5EA 3M4OJ 1Y8RB 4M9XA 2ESHA 1LNWA 2FJ1A 1E3HA 2VBWA 3EUAA 2F4MB 2X0LA 1S5LC 2QBYA 3TKYA 2B63J 1XMKA 3QU3A 4IHXA 5J8FA 3MQ0A 1VQ7I 3HOWJ 4Y15A 4CA0A 4N9HA 3ZQIA 3ZMSA 2L3DA 4JOMA 2ZO4A 4PJNA 3ECHA 2W25A 4LMYA 1OQYA 5FLMJ 3PSIA 1ZAOA 4MO7A 1B1BA 3ZP5A 1ZHFA 2DYSH 2FOKA 3L00A 5KHDA 2F4IA 2KDZA 2VQHA 4MLOA 1FYKA 2GZWA 4Z6YA 4L9NA 1WCMJ 1K6YA 4DJAA 3M07A 1WJCA 2R7FA 3U2RA 1X3UA 4A3IJ 4RBOA 1WH7A 2VJIA 1S29A 2V1DA 2EV5A 4KUMA 1GLNA 4EJUA 2R7DA 3JRBA 4PFOA 1MIJA 1HDDC 1V5FA 2XKOA 3K4KA 1XTAA 5J40A 5FKMA 4ZYGA 3EUHC 2Q1ZB 2VXDA 3CO7C 3A01A 2Y69H 3CO6C 3QOEA 3JREA 1Z7UA 3CZ6A 1W5CC 4Y7NJ 3RKQA 1JE8A 3T0YA 3L2WA 4GGGA 2OJED 3V42A 4X1EA 1FY7A 5FKOA 3K4MA 2QA4I 2FNAA 1N78A 1WJFA 1QVUA 1DQUA 1R4NB 2QEXI 4G7OF 3WGGA 5DYMA 2F5EA 3J80Z 2JPCA 3IHUA 5CYVA 3ZMVA 2E1NA 2JVHA 2B9SA 3GX4X 3LWFA 4HZFA 1HF0A 3T1BA 4F93B 2L9VA 5J1RA 2HVQA 2XGEA 3MKYB 3FK7A 4NNJA 1REPC 3ABTA 1SFXA 2RREA 2CV2A 1JKOC 2XAUA 2GA2A 4K2EA 2Y0MA 4CCLA 3EYIA 2K9SA 4A0XA 2E34A 2IGOA 4AU7A 4AIJA 2LNBA 1RR7A 3H3VK 1BI3A 4BJ5C 1XGNA 3LFUA 3S3OA 5ED4A 2G7HA 3M1CA 2ACJA 2AXTC 5FD6A 4IO9F 4U88A 3CTAA 3L2UA 4A5NA 1YYVA 5AIQA 3CC2I 3O8GA 3SDBA 4M3EA 1K7AA 2RN7A 2DMUA 4DBRA 1WZ2A 1U8BA 2A5WA 9ANTA 3LSHA 4I7HA 4XSXF 3LSRA 3GFIA 1XX5A 1SFUA 3W3CA 2OZUA 1PVEA 4EGYA 3F8MA 1J5YA 2P81A 3QYBA 3KCCA 4E7KA 2M7BA 3U1DA 1HBXG 4L9JA 1KU7A 1FYMA 2L7ZA 1JGSA 1E17A 1A35A 4BHBA 2L54A 4II3A 4F55A 2ZB9A 3JAMK 1S72I 2YX4A 2QQ8A 4HQMA 1ZTRA 4PSWA 4JK1X 2R3SA 3KYDB 2FNPA 4UV9A 4A5MA 1YS6A 3G2BA 1BI0A 3L2VA 1FT9A 3WE3A 3K1MA 2K4BA 1IXRC 3GUDA 3TO7A 1G6NA 4A0ZA 4PSXA 1JT0A 3HJEA 4LFUA 4I98B 2HYJA 4Y17A 1WH5A 2HOTA 2YU9J 3HUGB 4S04A 3OS2A 2HQ5A 4H4KC 5TGTA 1KZHA 3ZQHA 3F72A 1OCCH 3SJMA 3CUQA 4AIDA 4XK4A 5JHUA 3V7RA 2XAHA 1T33A 3OSFA 1X2MA 3FX3A 3Q9VA 4BUPA 3SXYA 2V6EA 2IS4A 1BI1A 2R7QA 2DPDA 4WCGA 1YRNB 3ZQGA 4UHTA 3LNQA 4ESJA 2M0CA 4XN3A 2PJRB 5L3EA 5IP6A 2EWNA 3HGGA 3HXLA 4Z2YA 3VYSB 1MMGA 3PFYA 3ZMUA 3R6SA 1RKTA 3GTGJ 2RNJA 2EZKA 2E35A 5J3LA 1D5VA 3OYLA 3QPHA 3K70C 1XDSA 3BDDA 2ZSHB 3G6EI 3KLNA 3S1MJ 3PM1A 5BQTA 4AYBN 4ZDOA 3ZGKA 2OTJI 3W6JB 1O57A 2ELJA 1TWCJ 5FKNA 2GWRA 5J8CA 5IOYA 2VLAA 3BJAA 1IV8A 1ZKGA 4BE0A 1K78A 4M9ZA 1TZLA 5FKLA 2V9KA 3WTVC 2K02A 1P9QC 4RAZA 2LBFA 3OIQA 1UG2A 2MABA 3L09A 2X6OA 2DLLA 3OYNA 3HOZJ 2FEZA 1PJRA 1ZREA 1FTTA 1GV5A 4B43A 4FTHA 2JSCA 4UVCA 3PNTA 3CCLI 3BWGA 3KP4A 4MEXF 4IOCF 1DUXC 3QPSA 2Q8KA 2GLOA 3A02A 4EGZA 4C2MJ 1QZYA 4A3EJ 4QTRA 2JZYA 4UY8I 4AYBA 1JUSA 2STTA 3CJQB 2DOFA 1BC7C 1Q1VA 1ZLKA 2VIXA 5HS9A 3C3WA 3WU0A 4E7SA 4DZPA 4W1UA 4BQQA 4OIRF 3BPVA 2AQFA 1G3TA 1K83J 3I55I 1R1VA 1J75A 1ZQ3P 2BE5F 3ZMTA 4DOZA 1SFOJ 5CVVA 2M45A 3SQNA 4E7IA 4EATA 4LD5A 4PJMA 4B1RA 2H6BA 1POGA 3J80K 5IYCJ 1KYZA 4KA4A 4KISA 2LFBA 2R0QC 1MJBA 5ICEA 3U21A 1SVLA 3AG4H 5B3SH 3BPXA 3DPUA 1BIAA 1Z3YA 5FFXA 3L1PA 4GO1A 4BEHA 3J7AO 3ERMA 2V1XA 2H6CA 1KONA 1VQ4I 1R5ID 2Z1DA 3LSJA 1Z91A 2NXNB 4E7HA 4M6VA 4A93J 5IT9K 2X85A 5EGOB 4G12A 2V26A 2KT0A 4IKFA 1FP1D 1O3QA 1FIAA 3H1CA 5F1JA 3AKZA 3S1QJ 5DCMB 1TP4A 3QP5A 2HQRA 2XVCA 2LBFB 4OWRB 2W48A 5CVIA 1AWCA 1R4MB 3CJTB 1QGPA 2KZGA 2K40A 2X1CA 3TW6A 2XKPA 4LG0B 2BOLA 3CCYA
chains in the Genus database with same CATH topology
2F2EA 3RI4A 1YW9A 3HYIA 2FBKA 4UVAA 3WTZA 5LBQA 3WTYC 2XAJA 1FBSA 3MEXA 4KMUX 2M1BA 4LB6B 5LHGA 1OYYA 5CVJA 4GYGA 2EFPA 3K1NA 3LA2A 2RGVA 3CJNA 3KP5A 5D8LB 1XD7A 3V7CA 3EDPA 1IXCA 5ILVA 4F7ZA 5DCFA 3IWFA 3WGHA 4S05A 4GCVA 2K4JA 1IN4A 4U0YA 3JW4A 1HQCA 2G9WA 2FA5A 4PDKA 5FD5A 3G3ZA 1EH7A 3F6OA 3IKVA 1I1GA 4M72A 3F8FA 5EEHA 1SD4A 5E17F 2IJLA 3ZN1A 5AIPA 3K1PA 1CGPA 4HX8A 1UFMA 1YG2A 2VONA 5E8IA 3J81Z 1XSXA 2RVCA 4HDVA 3DP7A 1I6XA 1R58A 4HLXA 4E70A 2OAZA 1FZPB 3F6VA 2XROA 5HDKA 4OU0A 5LGTA 4Y13A 4DNCA 4KIGA 1T38A 5F1RA 4QLCU 3KZZA 2HZTA 5K5RA 3O2PE 3DV8A 5D5VB 4I2OA 3GWZA 4ENJA 1IN6A 4OIOF 4YG2F 3HTUA 4OIPF 1G3SA 4CGZA 4LLNA 3H3UA 3G73A 2DK5A 2V79A 2EFNA 1ZRCA 5ICFA 2MH9A 2XIGA 3DF8A 2YPRA 3HHHA 2HKXA 2CG4A 3P7NA 4I01A 2FU4A 3FXRA 3E6DA 1XDUA 3M7GA 1LJ9A 1ODDA 3GYHX 2DI3A 3KLOA 4EQQA 3RTRA 1XGMA 2XASA 1T0FA 1GVJA 2OQRA 3BJ6A 5D5XB 3PQJA 2BEOA 3GW2A 1QO0D 1MKMA 1U5TA 4U7DA 1YS7A 1HSTA 2MLKA 2EV6A 1MGTA 4G94A 3ZMZA 3I0TA 4I0BA 1FNNA 3K69A 3VOEA 5L3FA 3HHGA 2CWEA 2F5CA 1FBUA 1A04A 3E6CC 5BOXA 3ZQ7A 4YIIA 1CF7B 2BV6A 2QUFA 2HYFA 2VOPA 3NRVA 2CGPA 2OZ6A 1RIOH 2EV0A 2F5DA 3EETA 2WV0A 1HKTA 3I71A 2H27A 4ON0A 2KJCA 4L18B 5BMZA 2QQ9A 1I5ZA 2FRHA 1TQPA 2XRNA 4B09A 4BXUA 4RGRA 5CVRA 1JXSA 1K78B 2O8XA 2VC0A 2DK8A 1Z6TA 2LKPA 1TW2A 5K1YA 3M8EA 3N4MA 1SAXA 1MJ9A 1BIBA 3KFWX 4CHUA 4I0AA 2ZBKA 1H0MA 1S7AA 2PEXA 3IL2A 3K9TA 3MFKA 2VN2A 1ZLJA 4CO8A 3HSRA 1W7PD 3SZPA 3J81K 4L9TA 4ENNA 3TOBA 2NS0A 5LHHA 1T98A 4WK8F 2QVOA 1ONVA 4AIHA 4IHSA 2M87A 2CQKA 3B73A 2O0YA 4RB3C 1EV7A 4AWXB 1FOKA 1ZRFA 2A5YB 3C7JA 4L0ZB 2HKOA 4P55A 1R1TA 3IRRA 3TQNA 2E1CA 3GEZA 1ZG1A 1FYLA 2QENA 3ZPLA 1G3YA 5F64A 3COAC 2OQGA 3DPTA 2GXBA 2FSWA 2CSOA 3R60A 1GXQA 5ILUA 5LEKA 3I59A 4L9VA 3GFJA 2JTVA 1SMYF 4ETSA 5BPDA 1ZGJA 4WXDA 1U3EM 4EJWA 4Q48A 2OA4A 5TRDA 2P6TA 2QM3A 5HS8A 3SFZA 3V8JA 4AD9A 2A61A 4P96A 3RJPA 3GFLA 3RKXA 1TLHB 1MDMB 4M6YA 3IKTA 4HQEA 4HV6A 4KNYA 2NNNA 3B02A 1LEBA 3E97A 4A6EA 4YIFA 3BJOA 1Z05A 3M9AA 3E6BA 4HOBA 3IRQA 4U0VA 2ZJ2A 3FF5A 2UWMA 4Q47A 1OPCA 3JTHA 3I59B 3CUOA 4L5JA 3F21A 2AS5F 1I27A 3QP6A 2P6SA 4YFKF 2NYXA 3MWMA 5KK1A 1FWZA 1ZYRF 3JSPA 2VXZA 2O6GE 1AOYA 1W5TA 1O3TA 2JPBA 3MZYA 5D6EA 1F1ZA 3WTTC 1PP8F 2HEOA 3V7SA 5DD8A 2EFOA 1LDJA 1U8RA 1OYIA 4A6DA 4Q5SF 2ELHA 4JQFA 4YFXF 3GFMA 4O3MA 4I02A 4BAYA 5JR3A 4DQ2A 4G7HF 2P5KA 4AVPA 3L2CA 1YLFA 3HSEA 4RAYA 3SZTA 2IP2A 3R0AA 1IN8A 4IXAA 2QQAA 3NQOA 1E2XA 3V4GA 3RYPA 5FB2A 5DDGA 3Q5FA 2KKOA 1TNSA 2COMA 2MC3A 1XCVA 2G7UA 4KFCA 4OIQF 2IT0A 4KIFA 1KGSA 1Z9CA 4MNUA 4EM2A 2J5PA 2W84A 1KU2A 5K5QA 2HFHA 1XSVA 2GXGA 3F22A 3WGIA 2ADUA 4NQWA 2HTJA 5HVQC 3RPUA 1R1UA 2HTSA 3ZN0A 1J59A 2Q2EA 4U0WA 4ZZLA 1YQAA 3I54A 4HF0A 4N0BA 4HDUA 3WG9A 4MHGA 3FMSA 1SD5A 2W57A 2UZKA 2GQQA 3TDZC 1U2WA 4PCQA 1FPQA 3BZ6A 2HDCA 4FT8A 3FM5A 3D0SA 2A68F 3RPQA 1VTNC 2WC2A 1STZA 3CDHA 4IRIA 4IJAA 5EEGA 2RV8A 1MDMA 4TV7A 2W85A 3LQQA 1S3JA 5DUKA 5ERIA 4BQAA 2XV4S 1O7FA 4MTDA 3FM3A 5BS6A 2B0LA 1FBQA 5D8KB 4IRGA 2EJRA 4FX4A 1YIOA 2JT1A 3F8CA 2MLGA 1J2XA 4EM0B 4XSZF 5IT9Z 5D6FA 3HUGA 3P9IA 4WF2A 1ZG3A 2STWA 1F9NA 4HBLA 3V8KA 1Q1HA 1B6AA 2YX7A 2DU9A 1RZ4A 2KIFA 4G9YA 3ULQB 2VBXA 4EV0A 4M74A 1FP2A 5LRRA 3KP7A 2PG4A 4P9FA 2CO5A 5LLQA 1FLIA 3HIFA 1C0WA 1JHHA 3AAFA 1IAWA 2ISZA 2IVMA 1IW7F 1IXSB 2IRFG 1O3RA 4G6DA 4KT5C 2D45A 2H09A 4XLNF 1G3WA 1Z1DA 3P9CA 4I09A 4A12A 3RKYA 1WWXA 2ZNZA 4LLGF 1XN7A 3KEQA 4ASNA 3F8NA 2FXAA 5DD4A 3M8FA 2DFIA 4LLLA 1QNTA 2XHKA 2H94A 1LDKB 1EH8A 1ZARA 1WI9A 1ZG5A 1HW2A 2YSRA 2EA4A 4A0YA 2QLZA 1GXPA 4G8XA 1BOAA 1HW1A 4BNCA 4CICA 2EK5A 2W24A 3IWZA 4AIKA 1WRJA 5E20A 4ZYDA 1O3SA 2OBPA 1KA8A 1YW7A 5ICCA 1W7PB 1TBXA 2Q0OA 5HLHA 3VFZA 3ABUA 3T8TA 3MZHA 1HW5A 4M71A 4CYDA 2IA1A 2PI0A 3FXUA 1XMAA 1KQ9A 1OMIA 4CDGA 2VBZA 3R4KA 3C18A 1MD0A 4LG0A 1OKRA 1SFEA 4HYEA 3K2ZA 4M6XA 1YO5C 2E7XA 1HSJA 4M73A 2L4AA 4CXFA 1USTA 1NHAA 2A3SA 2IPQX 1HKQA 4EJOA 5HDNA 1B59A 4BHCA 5FLXZ 1H9TA 1ON2A 1ON1A 1R00A 3TOAA 2K7LA 3LAJA 3DQVC 1MZBA 2ETHA 2XGXA 2XUBA 1T2KA 1F5TA 1IRGA 1O7LA 1W4MA 2D2WA 3I53A 1QQIA 4Q4ZF 2M8EA 5IT3A 3KEOA 1B9MA 3E5QA 3F3XA 5ILSA 1P4AA 1QBJA 2VC1A 3W6KB 4U7BA 1P4WA 2Z3YA 1R36A 5FGMA 2LSOA 3WE2A 3IC7A 2DPUA 3BP8A 2AXLA 1UB9A 4HAMA 1LQ1A 1J9IA 2DQLA 3Q9SA 1HXDA 4MQVA 4WXCA 2VE8A 4P5OA 5DV5A 1H9GA 5K5OA 1LDDA 2BYVE 3TDUC 1XGOA 1D8KA 3GVAA 4H0EA 4ENMA 4G6QA 1T6SA 4N9IA 2JRTA 4RS8A 3C1DA 5KVRA 3GZ5A 4UNOA 1SD6A 3K0LA 3GZ6A 2WTEA 3KE2A 2XAFA 3T8RA 2YU3A 3EYYA 2WWYA 4LJZF 1F4KA 2DO7A 4KICA 1R22A 2QQBA 2UXNA 3O3KA 3OOPA 4HW0A 2ZMEB 2DBBA 3HRSA 1DDNA 2FBHA 1BJAA 2MA3A 3E5UA 1IF1A 5TJJA 3FHZA 1IN5A 2A69F 3BOQA 3F8BA 3S2WA 5E1ZB 3CUQB 3TGNA 4FX0A 1R5HA 1TTYA 4KDPA 3L9FA 1R7JA 2EFQA 3HRMA 3HSFA 2O03A 5F6FA 3ISPA 3I4PA 2VBYA 2ZKZA 3VODA 2LF7A 1WQ2A 5CVUA 3EQLF 5A2QK 5CLSA 2FE3A 1P6RA 2Y75A 2L02A 3RDIA 5AONA 3DPLC 4HF1A 4BYYA 2L4MA 5L3BA 1UCRA 4B8XA 2HOEA 4ZZDA 2O61A 2RKHA 5E8GA 5HOOA 5E18F 3BROA 4MTEA 1P2FA 2Z33A 5HDGA 5LHIA 1DPUA 5LEJA 2KRFA 5H6QA 1QPMA 1GHCA 1RNLA 2K86A 1FC3A 2GAUA 3FZVA 2Z99A 3RIRA 3EUHA 1D8JA 2HWVA 2OU2A 4ZH4F 2HQNA 5D4SA 3RKWA 4CZZA 3OV8A 2PQ8A 4RB2C 4EM1A 1LEAA 2VODA 3T5XA 2XAGA 3E6MA 4RGSA 4IF4A 1ULYA 3LFKA 4IVNA 5E1WA 3SHFA 2LDUA 1JHFA 2QBYB 3HOSA 1ZN2A 3D5LA 2IW5A 2KIMA 3QAHA 2O3FA 4EJVA 2VT3A 2FMYA 2KJBA 1U5TC 2E7WA 1USSA 4ESFA 3DEUA 2V1UA 4PGHA 2P7VB 2QZ8A 4GXOA 4UUVA 1KQ8A 2RDPA 4EVIA 1XB4A 3NEUA 5LGUA 5D5UB 3KP2A 3I64A 4O6JA 4LGWA 5D5WB 2DT5A 1TNTA 5CJ9A 2EFWA 2HYGD 4ZYHA 3WTWC 2NRAC 1FSHA 5HS7A 1R5GA 4GYIA 2NAZA 5L3GA 3V8LA 2TDXA 2P8TA 1TQIA 1ZGAA 2MD5A 1S8NA 4NB5A 2QWWA 2VE9A 3ROUA 2KIUA 5FFZA 2HS5A 3E5XA 1PUEE 4UXNA 2YR2A 4RGUA 1BI2A 5DEQA 2P7CB 4KYWA 2BBYA 3KETA 2VOOA 3GO5A 3MCZA 2A6EF 2BGCA 3GLXA 4KN7X 3RYRA 3F23A 2EA2A 4NHJA 4LK1F 1LB2A 4OMYA 2CW0F 4EMSA 3HTSB 4P9UA 4RGXA 3U9GA 1MJAA 4R8HA 3ML6A 3ECOA 4OMZA 1XGSA 2FMLA 2PN6A 4IPAA 1P92A 1ZRDA 4BH9A 3QPTA 1OR7A 3LA3A 2Z9OA 2UXXA 2QYOA 1IZ1A 1PDNC 2V9VA 2PMUA 1U6GA 4UV8A 4L0YB 2FQ3A 2OD5A 2Y48A 5JFRA 2FF4A 1Z6RA 4M9SA 1RI7A 1BC8C 4HLYA 2M5WA 5LGNA 3DFGA 5LRSA 5HLIA 3HRTA 4OOIA 1XSDA 3CLOA 3TO9A 4LB5A 2P4WA 4WX9A 3WTUC 1K6OA 1KU3A 1BM9A 3MAJA 3N97A 2MH2A 5HLGA 2C6YA 5FO5A 4IRHA 1FSEA 5A2QZ 1B4AA 2ZCWA 4O5VA 4IHTA 3WU1B 4ESBA 1EH6A 2F5FA 1B9NA 1UHWA 4XRFA 4PZJA 3PFIA 1BBYA 3CUQC 2DW4A 3FMRA 2HR3A 1RUNA 1V3FA 4KMFA 2DTRA 1V4RA 1KYWA 3VB2A 1SMTA 5L3CA 4XBFA 5JI6A 1XCBA 1RUOA 4WXHA 3JSOA 1YTYA 5ICGA 2DQRA 1J0RA 2RQPA 5DUIA 1W5SA 5L3DA 1L0OC 3H92A 1TQMA 2XAQA 1IN7A 2PFBA 3FXQA 4HV5A 1SD7A 4FHTA 1R23A 1TW3A 3LQRA 2D1VA 3R0JA 4YFNF 2ISYA 5H20A 2IA0A 2ZFWA 5H6RA 2M30A 2X4HA 3HOTA 4QWQA 1L3LA 1DPRA 3LAPA 3FWEA 2L01A 3JTGA 4MQ9F 1T39A 3QOPA 3I58A 4L5IA 1G4DA 2EB7A 2CFXA 1WSUA 3GF2A 3REOA 3P9KA 2CYYA 4HF2A 3WODF 3H3ZA 1IRFA 2PMHA 4ENKA 3KP6A 4KN4X 2DAOA 4G7ZF 3DKWA 3QU6A 3L7WA 3QRFF 1W7PA 3TO6A 1KU9A 3FMQA 4WWCA 3M1EA 2ESNA 3WTXC 2A07F 3JAMZ 5JVTA 3I5UA 4RB0A 2J5OA 2GIVA 3VEPA 2RC4A 4KIBA 4HX7A 1KQ0A 2ZMEA 3O6BB 1OYWA 6PAXA 2VT2A 4JBAA 3DXJF 1YW8A 1FX7A 5J6XA 5FLXK 4PGGA 2PLYA 2PBIA 3PQKA 1S7OA 1YFHA 1IUYA 1U5TB 5BPIA 5D4RA 2A6HF 3LA7A 2D1HA 1U78A 2Z5UA 4HX4A 2IA2A 1HKSA 1S6LA 1WKMA 3LSTA 3KZYA 1D3YA 2NNYA 1CF7A 3E3VA 4OINF 3ERED 2FBIA 5E1XA 2K27A 2GA1A 1DP7P 2ZNYA 4LK0F 3ZMDA 1J7KA 4R79A 4EJTA 4A2UA 1BN5A 4HA8A 1UHMA 1QZZA 1K79A 4D0PA 1PP7U 2MBFA 3HRUA 2P5VA 3ELKA 4XLPF 4UVBA 3KP3A 4R1HA 4BHPA 1ZH5A 2V6CA 5DCMA 3BY6A 4RB1A 2PJPA 2P5LC 4ZYEA 1I1SA 4MEYF 2HGCA 3GXOA 3WTSC 2LF8A 1Y0UA 2ZXJA 4MGRA 1P4XA 3R61A 1LVAA 4M9XA 2ESHA 1LNWA 2VBWA 2X0LA 2QBYA 3TKYA 1XMKA 3QU3A 5J8FA 3MQ0A 4Y15A 4N9HA 3ZMSA 2L3DA 2ZO4A 3ECHA 2W25A 4LMYA 1ZAOA 1B1BA 3ZP5A 1ZHFA 2FOKA 3L00A 1FYKA 2GZWA 4L9NA 2R7FA 3U2RA 1X3UA 1S29A 2V1DA 2EV5A 4KUMA 4EJUA 2R7DA 2XKOA 4ZYGA 3CO7C 3CO6C 1Z7UA 1JE8A 3T0YA 4GGGA 1FY7A 2FNAA 4G7OF 3WGGA 5DYMA 2F5EA 3J80Z 2JPCA 3IHUA 5CYVA 3ZMVA 2E1NA 3GX4X 3LWFA 4HZFA 3T1BA 1REPC 3ABTA 1SFXA 3EYIA 2GA2A 4K2EA 2Y0MA 4A0XA 4AIJA 2LNBA 1BI3A 1XGNA 5ED4A 2G7HA 2ACJA 5FD6A 4U88A 3CTAA 4A5NA 1YYVA 5AIQA 1K7AA 2RN7A 4I7HA 4XSXF 3GFIA 1SFUA 2OZUA 4EGYA 3F8MA 1J5YA 3KCCA 3U1DA 1HBXG 4L9JA 1KU7A 1FYMA 1JGSA 1E17A 4BHBA 2L54A 3JAMK 2YX4A 4HQMA 4JK1X 2R3SA 2FNPA 4UV9A 4A5MA 1YS6A 1BI0A 1FT9A 3WE3A 3K1MA 2K4BA 1IXRC 3GUDA 3TO7A 1G6NA 4A0ZA 4LFUA 4I98B 4Y17A 4S04A 3F72A 3CUQA 5JHUA 3V7RA 2XAHA 3FX3A 3Q9VA 3SXYA 1BI1A 2DPDA 4WCGA 4UHTA 4ESJA 5L3EA 2EWNA 4Z2YA 3ZMUA 3R6SA 1D5VA 2RNJA 3QPHA 1XDSA 3BDDA 3KLNA 5BQTA 3W6JB 1O57A 2GWRA 5J8CA 3BJAA 1K78A 4M9ZA 3WTVC 2K02A 4RAZA 3L09A 2DLLA 2FEZA 1ZREA 2JSCA 4UVCA 4MEXF 3BWGA 3KP4A 1DUXC 2Q8KA 4EGZA 1QZYA 2JZYA 2STTA 1BC7C 1ZLKA 5HS9A 3C3WA 3WU0A 4OIRF 3BPVA 1G3TA 1J75A 1R1VA 2BE5F 3ZMTA 5CVVA 2M45A 3SQNA 4LD5A 2H6BA 3J80K 1KYZA 4KA4A 1MJBA 5ICEA 3BPXA 1BIAA 5FFXA 4GO1A 3J7AO 2V1XA 2H6CA 5IT9K 1Z91A 1FP1D 1O3QA 5DCMB 3QP5A 2HQRA 2XVCA 5CVIA 1AWCA 1QGPA 2XKPA 4LG0B
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2F2E A;  3RI4 A;  1YW9 A;  3HYI A;  2FBK A;  4UVA A;  3WTZ A;  5LBQ A;  3WTY C;  2XAJ A;  1FBS A;  3MEX A;  4KMU X;  2M1B A;  4LB6 B;  5LHG A;  1OYY A;  5CVJ A;  4GYG A;  2EFP A;  3K1N A;  3LA2 A;  2RGV A;  3CJN A;  3KP5 A;  5D8L B;  1XD7 A;  3V7C A;  3EDP A;  1IXC A;  5ILV A;  4F7Z A;  5DCF A;  3IWF A;  3WGH A;  4S05 A;  4GCV A;  2K4J A;  1IN4 A;  4U0Y A;  3JW4 A;  1HQC A;  2G9W A;  2FA5 A;  4PDK A;  5FD5 A;  3G3Z A;  1EH7 A;  3F6O A;  3IKV A;  1I1G A;  4M72 A;  3F8F A;  5EEH A;  1SD4 A;  5E17 F;  2IJL A;  3ZN1 A;  5AIP A;  3K1P A;  1CGP A;  4HX8 A;  1UFM A;  1YG2 A;  2VON A;  5E8I A;  3J81 Z;  1XSX A;  2RVC A;  4HDV A;  3DP7 A;  1I6X A;  1R58 A;  4HLX A;  4E70 A;  2OAZ A;  1FZP B;  3F6V A;  2XRO A;  5HDK A;  4OU0 A;  5LGT A;  4Y13 A;  4DNC A;  4KIG A;  1T38 A;  5F1R A;  4QLC U;  3KZZ A;  2HZT A;  5K5R A;  3O2P E;  3DV8 A;  5D5V B;  4I2O A;  3GWZ A;  4ENJ A;  1IN6 A;  4OIO F;  4YG2 F;  3HTU A;  4OIP F;  1G3S A;  4CGZ A;  4LLN A;  3H3U A;  3G73 A;  2DK5 A;  2V79 A;  2EFN A;  1ZRC A;  5ICF A;  2MH9 A;  2XIG A;  3DF8 A;  2YPR A;  3HHH A;  2HKX A;  2CG4 A;  3P7N A;  4I01 A;  2FU4 A;  3FXR A;  3E6D A;  1XDU A;  3M7G A;  1LJ9 A;  1ODD A;  3GYH X;  2DI3 A;  3KLO A;  4EQQ A;  3RTR A;  1XGM A;  2XAS A;  1T0F A;  1GVJ A;  2OQR A;  3BJ6 A;  5D5X B;  3PQJ A;  2BEO A;  3GW2 A;  1QO0 D;  1MKM A;  1U5T A;  4U7D A;  1YS7 A;  1HST A;  2MLK A;  2EV6 A;  1MGT A;  4G94 A;  3ZMZ A;  3I0T A;  4I0B A;  1FNN A;  3K69 A;  3VOE A;  5L3F A;  3HHG A;  2CWE A;  2F5C A;  1FBU A;  1A04 A;  3E6C C;  5BOX A;  3ZQ7 A;  4YII A;  1CF7 B;  2BV6 A;  2QUF A;  2HYF A;  2VOP A;  3NRV A;  2CGP A;  2OZ6 A;  1RIO H;  2EV0 A;  2F5D A;  3EET A;  2WV0 A;  1HKT A;  3I71 A;  2H27 A;  4ON0 A;  2KJC A;  4L18 B;  5BMZ A;  2QQ9 A;  1I5Z A;  2FRH A;  1TQP A;  2XRN A;  4B09 A;  4BXU A;  4RGR A;  5CVR A;  1JXS A;  1K78 B;  2O8X A;  2VC0 A;  2DK8 A;  1Z6T A;  2LKP A;  1TW2 A;  5K1Y A;  3M8E A;  3N4M A;  1SAX A;  1MJ9 A;  1BIB A;  3KFW X;  4CHU A;  4I0A A;  2ZBK A;  1H0M A;  1S7A A;  2PEX A;  3IL2 A;  3K9T A;  3MFK A;  2VN2 A;  1ZLJ A;  4CO8 A;  3HSR A;  1W7P D;  3SZP A;  3J81 K;  4L9T A;  4ENN A;  3TOB A;  2NS0 A;  5LHH A;  1T98 A;  4WK8 F;  2QVO A;  1ONV A;  4AIH A;  4IHS A;  2M87 A;  2CQK A;  3B73 A;  2O0Y A;  4RB3 C;  1EV7 A;  4AWX B;  1FOK A;  1ZRF A;  2A5Y B;  3C7J A;  4L0Z B;  2HKO A;  4P55 A;  1R1T A;  3IRR A;  3TQN A;  2E1C A;  3GEZ A;  1ZG1 A;  1FYL A;  2QEN A;  3ZPL A;  1G3Y A;  5F64 A;  3COA C;  2OQG A;  3DPT A;  2GXB A;  2FSW A;  2CSO A;  3R60 A;  1GXQ A;  5ILU A;  5LEK A;  3I59 A;  4L9V A;  3GFJ A;  2JTV A;  1SMY F;  4ETS A;  5BPD A;  1ZGJ A;  4WXD A;  1U3E M;  4EJW A;  4Q48 A;  2OA4 A;  5TRD A;  2P6T A;  2QM3 A;  5HS8 A;  3SFZ A;  3V8J A;  4AD9 A;  2A61 A;  4P96 A;  3RJP A;  3GFL A;  3RKX A;  1TLH B;  1MDM B;  4M6Y A;  3IKT A;  4HQE A;  4HV6 A;  4KNY A;  2NNN A;  3B02 A;  1LEB A;  3E97 A;  4A6E A;  4YIF A;  3BJO A;  1Z05 A;  3M9A A;  3E6B A;  4HOB A;  3IRQ A;  4U0V A;  2ZJ2 A;  3FF5 A;  2UWM A;  4Q47 A;  1OPC A;  3JTH A;  3I59 B;  3CUO A;  4L5J A;  3F21 A;  2AS5 F;  1I27 A;  3QP6 A;  2P6S A;  4YFK F;  2NYX A;  3MWM A;  5KK1 A;  1FWZ A;  1ZYR F;  3JSP A;  2VXZ A;  2O6G E;  1AOY A;  1W5T A;  1O3T A;  2JPB A;  3MZY A;  5D6E A;  1F1Z A;  3WTT C;  1PP8 F;  2HEO A;  3V7S A;  5DD8 A;  2EFO A;  1LDJ A;  1U8R A;  1OYI A;  4A6D A;  4Q5S F;  2ELH A;  4JQF A;  4YFX F;  3GFM A;  4O3M A;  4I02 A;  4BAY A;  5JR3 A;  4DQ2 A;  4G7H F;  2P5K A;  4AVP A;  3L2C A;  1YLF A;  3HSE A;  4RAY A;  3SZT A;  2IP2 A;  3R0A A;  1IN8 A;  4IXA A;  2QQA A;  3NQO A;  1E2X A;  3V4G A;  3RYP A;  5FB2 A;  5DDG A;  3Q5F A;  2KKO A;  1TNS A;  2COM A;  2MC3 A;  1XCV A;  2G7U A;  4KFC A;  4OIQ F;  2IT0 A;  4KIF A;  1KGS A;  1Z9C A;  4MNU A;  4EM2 A;  2J5P A;  2W84 A;  1KU2 A;  5K5Q A;  2HFH A;  1XSV A;  2GXG A;  3F22 A;  3WGI A;  2ADU A;  4NQW A;  2HTJ A;  5HVQ C;  3RPU A;  1R1U A;  2HTS A;  3ZN0 A;  1J59 A;  2Q2E A;  4U0W A;  4ZZL A;  1YQA A;  3I54 A;  4HF0 A;  4N0B A;  4HDU A;  3WG9 A;  4MHG A;  3FMS A;  1SD5 A;  2W57 A;  2UZK A;  2GQQ A;  3TDZ C;  1U2W A;  4PCQ A;  1FPQ A;  3BZ6 A;  2HDC A;  4FT8 A;  3FM5 A;  3D0S A;  2A68 F;  3RPQ A;  1VTN C;  2WC2 A;  1STZ A;  3CDH A;  4IRI A;  4IJA A;  5EEG A;  2RV8 A;  1MDM A;  4TV7 A;  2W85 A;  3LQQ A;  1S3J A;  5DUK A;  5ERI A;  4BQA A;  2XV4 S;  1O7F A;  4MTD A;  3FM3 A;  5BS6 A;  2B0L A;  1FBQ A;  5D8K B;  4IRG A;  2EJR A;  4FX4 A;  1YIO A;  2JT1 A;  3F8C A;  2MLG A;  1J2X A;  4EM0 B;  4XSZ F;  5IT9 Z;  5D6F A;  3HUG A;  3P9I A;  4WF2 A;  1ZG3 A;  2STW A;  1F9N A;  4HBL A;  3V8K A;  1Q1H A;  1B6A A;  2YX7 A;  2DU9 A;  1RZ4 A;  2KIF A;  4G9Y A;  3ULQ B;  2VBX A;  4EV0 A;  4M74 A;  1FP2 A;  5LRR A;  3KP7 A;  2PG4 A;  4P9F A;  2CO5 A;  5LLQ A;  1FLI A;  3HIF A;  1C0W A;  1JHH A;  3AAF A;  1IAW A;  2ISZ A;  2IVM A;  1IW7 F;  1IXS B;  2IRF G;  1O3R A;  4G6D A;  4KT5 C;  2D45 A;  2H09 A;  4XLN F;  1G3W A;  1Z1D A;  3P9C A;  4I09 A;  4A12 A;  3RKY A;  1WWX A;  2ZNZ A;  4LLG F;  1XN7 A;  3KEQ A;  4ASN A;  3F8N A;  2FXA A;  5DD4 A;  3M8F A;  2DFI A;  4LLL A;  1QNT A;  2XHK A;  2H94 A;  1LDK B;  1EH8 A;  1ZAR A;  1WI9 A;  1ZG5 A;  1HW2 A;  2YSR A;  2EA4 A;  4A0Y A;  2QLZ A;  1GXP A;  4G8X A;  1BOA A;  1HW1 A;  4BNC A;  4CIC A;  2EK5 A;  2W24 A;  3IWZ A;  4AIK A;  1WRJ A;  5E20 A;  4ZYD A;  1O3S A;  2OBP A;  1KA8 A;  1YW7 A;  5ICC A;  1W7P B;  1TBX A;  2Q0O A;  5HLH A;  3VFZ A;  3ABU A;  3T8T A;  3MZH A;  1HW5 A;  4M71 A;  4CYD A;  2IA1 A;  2PI0 A;  3FXU A;  1XMA A;  1KQ9 A;  1OMI A;  4CDG A;  2VBZ A;  3R4K A;  3C18 A;  1MD0 A;  4LG0 A;  1OKR A;  1SFE A;  4HYE A;  3K2Z A;  4M6X A;  1YO5 C;  2E7X A;  1HSJ A;  4M73 A;  2L4A A;  4CXF A;  1UST A;  1NHA A;  2A3S A;  2IPQ X;  1HKQ A;  4EJO A;  5HDN A;  1B59 A;  4BHC A;  5FLX Z;  1H9T A;  1ON2 A;  1ON1 A;  1R00 A;  3TOA A;  2K7L A;  3LAJ A;  3DQV C;  1MZB A;  2ETH A;  2XGX A;  2XUB A;  1T2K A;  1F5T A;  1IRG A;  1O7L A;  1W4M A;  2D2W A;  3I53 A;  1QQI A;  4Q4Z F;  2M8E A;  5IT3 A;  3KEO A;  1B9M A;  3E5Q A;  3F3X A;  5ILS A;  1P4A A;  1QBJ A;  2VC1 A;  3W6K B;  4U7B A;  1P4W A;  2Z3Y A;  1R36 A;  5FGM A;  2LSO A;  3WE2 A;  3IC7 A;  2DPU A;  3BP8 A;  2AXL A;  1UB9 A;  4HAM A;  1LQ1 A;  1J9I A;  2DQL A;  3Q9S A;  1HXD A;  4MQV A;  4WXC A;  2VE8 A;  4P5O A;  5DV5 A;  1H9G A;  5K5O A;  1LDD A;  2BYV E;  3TDU C;  1XGO A;  1D8K A;  3GVA A;  4H0E A;  4ENM A;  4G6Q A;  1T6S A;  4N9I A;  2JRT A;  4RS8 A;  3C1D A;  5KVR A;  3GZ5 A;  4UNO A;  1SD6 A;  3K0L A;  3GZ6 A;  2WTE A;  3KE2 A;  2XAF A;  3T8R A;  2YU3 A;  3EYY A;  2WWY A;  4LJZ F;  1F4K A;  2DO7 A;  4KIC A;  1R22 A;  2QQB A;  2UXN A;  3O3K A;  3OOP A;  4HW0 A;  2ZME B;  2DBB A;  3HRS A;  1DDN A;  2FBH A;  1BJA A;  2MA3 A;  3E5U A;  1IF1 A;  5TJJ A;  3FHZ A;  1IN5 A;  2A69 F;  3BOQ A;  3F8B A;  3S2W A;  5E1Z B;  3CUQ B;  3TGN A;  4FX0 A;  1R5H A;  1TTY A;  4KDP A;  3L9F A;  1R7J A;  2EFQ A;  3HRM A;  3HSF A;  2O03 A;  5F6F A;  3ISP A;  3I4P A;  2VBY A;  2ZKZ A;  3VOD A;  2LF7 A;  1WQ2 A;  5CVU A;  3EQL F;  5A2Q K;  5CLS A;  2FE3 A;  1P6R A;  2Y75 A;  2L02 A;  3RDI A;  5AON A;  3DPL C;  4HF1 A;  4BYY A;  2L4M A;  5L3B A;  1UCR A;  4B8X A;  2HOE A;  4ZZD A;  2O61 A;  2RKH A;  5E8G A;  5HOO A;  5E18 F;  3BRO A;  4MTE A;  1P2F A;  2Z33 A;  5HDG A;  5LHI A;  1DPU A;  5LEJ A;  2KRF A;  5H6Q A;  1QPM A;  1GHC A;  1RNL A;  2K86 A;  1FC3 A;  2GAU A;  3FZV A;  2Z99 A;  3RIR A;  3EUH A;  1D8J A;  2HWV A;  2OU2 A;  4ZH4 F;  2HQN A;  5D4S A;  3RKW A;  4CZZ A;  3OV8 A;  2PQ8 A;  4RB2 C;  4EM1 A;  1LEA A;  2VOD A;  3T5X A;  2XAG A;  3E6M A;  4RGS A;  4IF4 A;  1ULY A;  3LFK A;  4IVN A;  5E1W A;  3SHF A;  2LDU A;  1JHF A;  2QBY B;  3HOS A;  1ZN2 A;  3D5L A;  2IW5 A;  2KIM A;  3QAH A;  2O3F A;  4EJV A;  2VT3 A;  2FMY A;  2KJB A;  1U5T C;  2E7W A;  1USS A;  4ESF A;  3DEU A;  2V1U A;  4PGH A;  2P7V B;  2QZ8 A;  4GXO A;  4UUV A;  1KQ8 A;  2RDP A;  4EVI A;  1XB4 A;  3NEU A;  5LGU A;  5D5U B;  3KP2 A;  3I64 A;  4O6J A;  4LGW A;  5D5W B;  2DT5 A;  1TNT A;  5CJ9 A;  2EFW A;  2HYG D;  4ZYH A;  3WTW C;  2NRA C;  1FSH A;  5HS7 A;  1R5G A;  4GYI A;  2NAZ A;  5L3G A;  3V8L A;  2TDX A;  2P8T A;  1TQI A;  1ZGA A;  2MD5 A;  1S8N A;  4NB5 A;  2QWW A;  2VE9 A;  3ROU A;  2KIU A;  5FFZ A;  2HS5 A;  3E5X A;  1PUE E;  4UXN A;  2YR2 A;  4RGU A;  1BI2 A;  5DEQ A;  2P7C B;  4KYW A;  2BBY A;  3KET A;  2VOO A;  3GO5 A;  3MCZ A;  2A6E F;  2BGC A;  3GLX A;  4KN7 X;  3RYR A;  3F23 A;  2EA2 A;  4NHJ A;  4LK1 F;  1LB2 A;  4OMY A;  2CW0 F;  4EMS A;  3HTS B;  4P9U A;  4RGX A;  3U9G A;  1MJA A;  4R8H A;  3ML6 A;  3ECO A;  4OMZ A;  1XGS A;  2FML A;  2PN6 A;  4IPA A;  1P92 A;  1ZRD A;  4BH9 A;  3QPT A;  1OR7 A;  3LA3 A;  2Z9O A;  2UXX A;  2QYO A;  1IZ1 A;  1PDN C;  2V9V A;  2PMU A;  1U6G A;  4UV8 A;  4L0Y B;  2FQ3 A;  2OD5 A;  2Y48 A;  5JFR A;  2FF4 A;  1Z6R A;  4M9S A;  1RI7 A;  1BC8 C;  4HLY A;  2M5W A;  5LGN A;  3DFG A;  5LRS A;  5HLI A;  3HRT A;  4OOI A;  1XSD A;  3CLO A;  3TO9 A;  4LB5 A;  2P4W A;  4WX9 A;  3WTU C;  1K6O A;  1KU3 A;  1BM9 A;  3MAJ A;  3N97 A;  2MH2 A;  5HLG A;  2C6Y A;  5FO5 A;  4IRH A;  1FSE A;  5A2Q Z;  1B4A A;  2ZCW A;  4O5V A;  4IHT A;  3WU1 B;  4ESB A;  1EH6 A;  2F5F A;  1B9N A;  1UHW A;  4XRF A;  4PZJ A;  3PFI A;  1BBY A;  3CUQ C;  2DW4 A;  3FMR A;  2HR3 A;  1RUN A;  1V3F A;  4KMF A;  2DTR A;  1V4R A;  1KYW A;  3VB2 A;  1SMT A;  5L3C A;  4XBF A;  5JI6 A;  1XCB A;  1RUO A;  4WXH A;  3JSO A;  1YTY A;  5ICG A;  2DQR A;  1J0R A;  2RQP A;  5DUI A;  1W5S A;  5L3D A;  1L0O C;  3H92 A;  1TQM A;  2XAQ A;  1IN7 A;  2PFB A;  3FXQ A;  4HV5 A;  1SD7 A;  4FHT A;  1R23 A;  1TW3 A;  3LQR A;  2D1V A;  3R0J A;  4YFN F;  2ISY A;  5H20 A;  2IA0 A;  2ZFW A;  5H6R A;  2M30 A;  2X4H A;  3HOT A;  4QWQ A;  1L3L A;  1DPR A;  3LAP A;  3FWE A;  2L01 A;  3JTG A;  4MQ9 F;  1T39 A;  3QOP A;  3I58 A;  4L5I A;  1G4D A;  2EB7 A;  2CFX A;  1WSU A;  3GF2 A;  3REO A;  3P9K A;  2CYY A;  4HF2 A;  3WOD F;  3H3Z A;  1IRF A;  2PMH A;  4ENK A;  3KP6 A;  4KN4 X;  2DAO A;  4G7Z F;  3DKW A;  3QU6 A;  3L7W A;  3QRF F;  1W7P A;  3TO6 A;  1KU9 A;  3FMQ A;  4WWC A;  3M1E A;  2ESN A;  3WTX C;  2A07 F;  3JAM Z;  5JVT A;  3I5U A;  4RB0 A;  2J5O A;  2GIV A;  3VEP A;  2RC4 A;  4KIB A;  4HX7 A;  1KQ0 A;  2ZME A;  3O6B B;  1OYW A;  6PAX A;  2VT2 A;  4JBA A;  3DXJ F;  1YW8 A;  1FX7 A;  5J6X A;  5FLX K;  4PGG A;  2PLY A;  2PBI A;  3PQK A;  1S7O A;  1YFH A;  1IUY A;  1U5T B;  5BPI A;  5D4R A;  2A6H F;  3LA7 A;  2D1H A;  1U78 A;  2Z5U A;  4HX4 A;  2IA2 A;  1HKS A;  1S6L A;  1WKM A;  3LST A;  3KZY A;  1D3Y A;  2NNY A;  1CF7 A;  3E3V A;  4OIN F;  3ERE D;  2FBI A;  5E1X A;  2K27 A;  2GA1 A;  1DP7 P;  2ZNY A;  4LK0 F;  3ZMD A;  1J7K A;  4R79 A;  4EJT A;  4A2U A;  1BN5 A;  4HA8 A;  1UHM A;  1QZZ A;  1K79 A;  4D0P A;  1PP7 U;  2MBF A;  3HRU A;  2P5V A;  3ELK A;  4XLP F;  4UVB A;  3KP3 A;  4R1H A;  4BHP A;  1ZH5 A;  2V6C A;  5DCM A;  3BY6 A;  4RB1 A;  2PJP A;  2P5L C;  4ZYE A;  1I1S A;  4MEY F;  2HGC A;  3GXO A;  3WTS C;  2LF8 A;  1Y0U A;  2ZXJ A;  4MGR A;  1P4X A;  3R61 A;  1LVA A;  4M9X A;  2ESH A;  1LNW A;  2VBW A;  2X0L A;  2QBY A;  3TKY A;  1XMK A;  3QU3 A;  5J8F A;  3MQ0 A;  4Y15 A;  4N9H A;  3ZMS A;  2L3D A;  2ZO4 A;  3ECH A;  2W25 A;  4LMY A;  1ZAO A;  1B1B A;  3ZP5 A;  1ZHF A;  2FOK A;  3L00 A;  1FYK A;  2GZW A;  4L9N A;  2R7F A;  3U2R A;  1X3U A;  1S29 A;  2V1D A;  2EV5 A;  4KUM A;  4EJU A;  2R7D A;  2XKO A;  4ZYG A;  3CO7 C;  3CO6 C;  1Z7U A;  1JE8 A;  3T0Y A;  4GGG A;  1FY7 A;  2FNA A;  4G7O F;  3WGG A;  5DYM A;  2F5E A;  3J80 Z;  2JPC A;  3IHU A;  5CYV A;  3ZMV A;  2E1N A;  3GX4 X;  3LWF A;  4HZF A;  3T1B A;  1REP C;  3ABT A;  1SFX A;  3EYI A;  2GA2 A;  4K2E A;  2Y0M A;  4A0X A;  4AIJ A;  2LNB A;  1BI3 A;  1XGN A;  5ED4 A;  2G7H A;  2ACJ A;  5FD6 A;  4U88 A;  3CTA A;  4A5N A;  1YYV A;  5AIQ A;  1K7A A;  2RN7 A;  4I7H A;  4XSX F;  3GFI A;  1SFU A;  2OZU A;  4EGY A;  3F8M A;  1J5Y A;  3KCC A;  3U1D A;  1HBX G;  4L9J A;  1KU7 A;  1FYM A;  1JGS A;  1E17 A;  4BHB A;  2L54 A;  3JAM K;  2YX4 A;  4HQM A;  4JK1 X;  2R3S A;  2FNP A;  4UV9 A;  4A5M A;  1YS6 A;  1BI0 A;  1FT9 A;  3WE3 A;  3K1M A;  2K4B A;  1IXR C;  3GUD A;  3TO7 A;  1G6N A;  4A0Z A;  4LFU A;  4I98 B;  4Y17 A;  4S04 A;  3F72 A;  3CUQ A;  5JHU A;  3V7R A;  2XAH A;  3FX3 A;  3Q9V A;  3SXY A;  1BI1 A;  2DPD A;  4WCG A;  4UHT A;  4ESJ A;  5L3E A;  2EWN A;  4Z2Y A;  3ZMU A;  3R6S A;  1D5V A;  2RNJ A;  3QPH A;  1XDS A;  3BDD A;  3KLN A;  5BQT A;  3W6J B;  1O57 A;  2GWR A;  5J8C A;  3BJA A;  1K78 A;  4M9Z A;  3WTV C;  2K02 A;  4RAZ A;  3L09 A;  2DLL A;  2FEZ A;  1ZRE A;  2JSC A;  4UVC A;  4MEX F;  3BWG A;  3KP4 A;  1DUX C;  2Q8K A;  4EGZ A;  1QZY A;  2JZY A;  2STT A;  1BC7 C;  1ZLK A;  5HS9 A;  3C3W A;  3WU0 A;  4OIR F;  3BPV A;  1G3T A;  1J75 A;  1R1V A;  2BE5 F;  3ZMT A;  5CVV A;  2M45 A;  3SQN A;  4LD5 A;  2H6B A;  3J80 K;  1KYZ A;  4KA4 A;  1MJB A;  5ICE A;  3BPX A;  1BIA A;  5FFX A;  4GO1 A;  3J7A O;  2V1X A;  2H6C A;  5IT9 K;  1Z91 A;  1FP1 D;  1O3Q A;  5DCM B;  3QP5 A;  2HQR A;  2XVC A;  5CVI A;  1AWC A;  1QGP A;  2XKP A;  4LG0 B; 
#chains in the Genus database with same CATH topology
 1JTX A;  2F2E A;  4CH7 A;  3RI4 A;  2W00 A;  1YW9 A;  2NOG A;  3HYI A;  2FBK A;  4UVA A;  3FKJ A;  3WTZ A;  2LC2 A;  1JKP C;  1A31 A;  5IY5 H;  2W7N A;  5LBQ A;  2O8K A;  3WTY C;  3VWB A;  2X6Y A;  2XAJ A;  1FBS A;  3F0C A;  3MEX A;  4KMU X;  4M3F A;  4D5F A;  4LIT A;  2M1B A;  4LB6 B;  5LHG A;  1OYY A;  2M4G A;  5CVJ A;  4GYG A;  3TMO A;  1RES A;  2EFP A;  3LMM A;  3BZK A;  3CMY A;  2PMZ A;  4PJL A;  1XS9 A;  5GAE J;  2DA6 A;  1WGX A;  2QKL B;  4CCO A;  3K1N A;  2W4S A;  3LA2 A;  4HPQ A;  2RGV A;  3CJN A;  3KP5 A;  5D8L B;  1XD7 A;  3V7C A;  1IG7 A;  2E5N A;  1AA7 A;  2Y9Y A;  3EDP A;  1T95 A;  4PJJ A;  1IXC A;  5ILV A;  4F7Z A;  1Y0N A;  3MMY B;  5DCF A;  1SVM A;  3IWF A;  4BDZ A;  3WGH A;  1P7I A;  4NDL A;  4GCV A;  2BY1 A;  2K4J A;  1IN4 A;  4JP0 A;  4S05 A;  2V4J C;  2LKS A;  4U0Y A;  3RPU D;  3JW4 A;  1HQC A;  1MH3 A;  1X1B A;  4C30 A;  2M7A A;  5FKK A;  2G9W A;  2R7U A;  3HOX J;  2FA5 A;  3J7A Y;  2KZV A;  2JA6 J;  4PDK A;  2DYR H;  3G3Z A;  2Y2Z A;  5FD5 A;  1B72 B;  3DWL E;  1EH7 A;  4CCM A;  4YEL A;  2BHZ A;  2ME0 A;  4QPQ A;  1MNM C;  2M8G X;  3F6O A;  3IKV A;  1OR7 C;  2M9H A;  1I1G A;  3MN2 A;  3RZO J;  1T56 A;  3CMM A;  2WAQ A;  3FXK A;  3F8F A;  2DA7 A;  3IAM 2;  4M72 A;  5EEH A;  1SD4 A;  5E17 F;  2IJL A;  2IAI A;  3Q0W A;  3CCJ I;  3ZN1 A;  2Y0S N;  1PYV A;  3C2H A;  4HNU A;  1F36 A;  5AIP A;  3K1P A;  1CGP A;  1E3P A;  4HX8 A;  1UFM A;  3PNV A;  2OF7 A;  3H0D A;  1YG2 A;  1OCO H;  2HDW A;  2EZH A;  2VON A;  3GTQ J;  3PL8 A;  1VFC A;  4KT6 A;  5E8I A;  3J81 Z;  1XSX A;  2RVC A;  4HDV A;  1MMS A;  3DP7 A;  1I6X A;  2L5Q A;  1R58 A;  5BNG A;  3AL0 B;  1TT0 A;  4HLX A;  4E70 A;  2OAZ A;  3JRI A;  1FMV A;  3MVP A;  4CZC A;  1FZP B;  3S16 J;  2IXS A;  3F6V A;  3IH3 A;  4UB6 C;  5HDK A;  5IP9 J;  2E36 A;  4OU0 A;  2XRO A;  5LGT A;  3K6G A;  4Y13 A;  4DNC A;  1NG6 A;  4KIG A;  1T38 A;  2K85 A;  5F1R A;  5C4X J;  2KRH A;  4QLC U;  2H8W A;  2XB5 A;  1O4X A;  2JQ7 A;  3KZZ A;  2HZT A;  1OCP A;  5K5R A;  3O2P E;  3DV8 A;  5D5V B;  1OIS A;  3H5A A;  2Y0S A;  3WHC A;  2EZI A;  5B1A H;  4LIV A;  2K9Q A;  1WPK A;  4I2O A;  3LOC A;  3GWZ A;  4ENJ A;  2HOA A;  1IN6 A;  4OIO F;  4YG2 F;  3HTU A;  3CCQ I;  4OIP F;  1G3S A;  4QIW N;  3BG9 A;  2OTL I;  1W36 D;  4CGZ A;  1Z7L A;  1W1W E;  4LLN A;  1AKH A;  3H3U A;  3G73 A;  2DK5 A;  3EUK L;  2V79 A;  4UUT A;  1YX3 A;  2EFN A;  1ZRC A;  2I5U A;  5ICF A;  2MH9 A;  3FXL A;  1Z21 A;  2XIG A;  1K4T A;  4UUS B;  3D5S C;  2NOJ B;  3DF8 A;  2YPR A;  3HHH A;  4IHV A;  2HKX A;  2QGU A;  2CG4 A;  4E6K G;  3LL7 A;  3P7N A;  4I01 A;  4EEF G;  2FU4 A;  3FXR A;  3VSK A;  2CUE A;  3E6D A;  1XDU A;  3M7G A;  1LJ9 A;  1ODD A;  3HOY J;  3GYH X;  5EG0 B;  3UR3 C;  2E5Z A;  3F9K A;  2DI3 A;  4XID A;  3KLO A;  4EQQ A;  3CLQ A;  3RTR A;  3IUO A;  1XGM A;  4B3A A;  4HG2 A;  2RQQ A;  2WAF A;  4RMN A;  4A3M J;  1NTC A;  2XAS A;  3BTJ A;  1T0F A;  1GVJ A;  1RC9 A;  2OQR A;  5J1U A;  3BJ6 A;  2ECB A;  2DMP A;  5LD2 C;  3SEQ A;  5D5X B;  1JI8 A;  3PQJ A;  1X58 A;  4ZDL A;  2BEO A;  2R4G A;  3BQY A;  4ANJ A;  3VYT B;  3GW2 A;  3G71 I;  1QO0 D;  1MKM A;  3CP2 A;  1U5T A;  4U7D A;  1YS7 A;  2V1N A;  2R5Z A;  3H0G J;  1HST A;  2MLK A;  2EV6 A;  1YIJ I;  4F3Q A;  1MGT A;  4G94 A;  2BXZ A;  3CQZ J;  3ZMZ A;  3I0T A;  4B3X A;  1H8A C;  1W36 C;  1ACI A;  4I0B A;  1FNN A;  3K69 A;  5GAG J;  1X1A A;  3DLL F;  3HC7 A;  3VOE A;  5L3F A;  3HHG A;  2CWE A;  2LOO A;  2DA5 A;  3MKW B;  2LY9 A;  2MC4 A;  2F5C A;  1FBU A;  1R71 A;  1X1D A;  4UUS A;  3GTK J;  1A04 A;  3E6C C;  3TP3 A;  3ZQ7 A;  4YII A;  4CCN A;  4HNV A;  5BOX A;  1ZR2 A;  2IS2 A;  1X1C A;  1CF7 B;  2BV6 A;  3PNY A;  1MBF A;  2R5Y B;  2PMZ N;  1HCR A;  2HXI A;  3CCR I;  2QUF A;  2UV1 A;  2HYF A;  1S9H A;  3DBR B;  3HZJ A;  1IV6 A;  3CD6 I;  2CW7 A;  2VOP A;  2VQG A;  1Z0X A;  3NRV A;  2CGP A;  2OZ6 A;  1RIO H;  2EV0 A;  3A2K A;  1HOM A;  4BQO A;  1D0X A;  2EPF A;  2F5D A;  3EET A;  2HZD A;  2I8D A;  2WV0 A;  3TW7 A;  3BG5 A;  3J7Z I;  1HKT A;  3I71 A;  1TWA J;  2ZJP F;  1W0T A;  2H27 A;  4ON0 A;  3D1N I;  3DTK A;  2KJC A;  4BBS J;  2L2O A;  4L18 B;  4KIT B;  2XRL A;  1HC8 A;  5BMZ A;  2QQ9 A;  3PO3 J;  1I5Z A;  2FRH A;  1TQP A;  2XRN A;  4B09 A;  4BXU A;  2HU9 A;  4RGR A;  3BTC A;  5CVR A;  1JXS A;  3LSI A;  3ZRG A;  2Y30 A;  1K78 B;  2E1O A;  2VKE A;  2O8X A;  2XC7 A;  2VC0 A;  4RM3 A;  2DK8 A;  2KP6 A;  1MNE A;  1NK2 P;  3K10 A;  4ZTJ A;  1Z6T A;  2LKP A;  1TW2 A;  5K1Y A;  1UAA A;  1OLT A;  3M8E A;  1D0Y A;  1OJL A;  1D5Y A;  3N4M A;  1SAX A;  1MJ9 A;  1BIB A;  3KFW X;  4CHU A;  4I0A A;  3GTM J;  1MMD A;  5FRN A;  1H89 C;  4Y52 J;  2ZBK A;  1H0M A;  4A3G J;  1VQO I;  1S7A A;  2PEX A;  3IL2 A;  1WJD A;  3PIP F;  1VQ5 I;  1FEX A;  5H2F C;  1FOX A;  3K9T A;  3MFK A;  4AVZ A;  2VN2 A;  5M5X J;  1ORK A;  1ZLJ A;  4CO8 A;  3HSR A;  1W7P D;  3FBI B;  2DOE A;  2VKD A;  4FAS D;  3S3M A;  3FIS A;  1VZ0 A;  3SZP A;  3CJR B;  2B7E A;  3J81 K;  3I56 I;  3BT9 A;  4L9T A;  4B47 A;  3BTL A;  3OWT A;  2CJJ A;  4ENN A;  3TOB A;  2NS0 A;  3RQ4 A;  5LHH A;  1T98 A;  4WK8 F;  2QVO A;  3DLA A;  4BE1 A;  2VJJ A;  1ONV A;  4AIH A;  3OY9 A;  4IHS A;  5EZH A;  2M87 A;  2CQK A;  3B73 A;  1RKW A;  3HEF A;  1U9O A;  3FBN B;  2CUF A;  2O0Y A;  2E2I J;  2DA1 A;  4RB3 C;  1EV7 A;  1E3O C;  2XF7 A;  4AWX B;  1FOK A;  1ZRF A;  2A5Y B;  3C7J A;  4L0Z B;  2HKO A;  4P55 A;  1R1T A;  2A05 A;  4V2F A;  2EIL H;  3OYE A;  3IRR A;  1JKR C;  2LMD A;  3H36 A;  3TQN A;  2E1C A;  1Z67 A;  2IGM A;  1GV2 A;  3GEZ A;  1ZG1 A;  5FRM A;  3WU2 C;  1FYL A;  2DTZ A;  3CES A;  2QEN A;  3ZPL A;  1G3Y A;  5J1Y A;  5F64 A;  3COA C;  2OQG A;  3DPT A;  2GXB A;  1YJW I;  2XGC A;  5B66 C;  2HXO A;  2VJ4 A;  2LYC A;  2FSW A;  2EIK H;  1YIT I;  3S2H J;  2CSO A;  3R60 A;  1GXQ A;  3K4J A;  2PJR A;  5ILU A;  5LEK A;  1VQK I;  3I59 A;  4L9V A;  4JX4 A;  2LK2 A;  1VQ6 I;  3GFJ A;  2JTV A;  1SMY F;  4BJ6 C;  5M5Y J;  3RSN A;  4B48 A;  3ZCO A;  4ETS A;  5BPD A;  1ZGJ A;  2CH0 A;  5EEA A;  4WXD A;  2LY1 A;  4CCJ A;  1MBK A;  4EJW A;  1U3E M;  3QYE A;  4Q48 A;  2OA4 A;  3KIO A;  5M3F J;  3JRA A;  5TRD A;  2OPT A;  2P6T A;  2QM3 A;  5HS8 A;  1JGG A;  4LIU A;  3SFZ A;  2CV1 A;  5F04 A;  4D9J A;  3V8J A;  2A61 A;  4P96 A;  4AD9 A;  3RJP A;  3GFL A;  3RKX A;  2LD5 A;  1TLH B;  3W6V A;  1MDM B;  3FHN A;  4M6Y A;  2GBY A;  3IKT A;  4HQE A;  1A6Q A;  1MBJ A;  3DBH B;  4M3G A;  4BQN A;  4HV6 A;  4KNY A;  4XLE A;  1A6I A;  2NNN A;  3ASN H;  2HQA A;  2JWT A;  3B02 A;  5CQE A;  5KNL A;  2QF7 A;  1LEB A;  3E97 A;  4A6E A;  5C4J J;  4D7M A;  4YIF A;  1YJN I;  3BJO A;  1Z05 A;  3M9A A;  3E6B A;  4HOB A;  3IRQ A;  3OYJ A;  4FE7 A;  4U0V A;  2ZJ2 A;  5GAH J;  2L9S A;  3FF5 A;  1GDT A;  3KYL A;  5EF6 A;  2UWM A;  2M34 A;  4Q47 A;  5IPA A;  3OYD A;  1OPC A;  3C2G A;  3JTH A;  1PUF A;  3QOD A;  3KYC B;  3NWT A;  1B72 A;  1VQ8 I;  3I59 B;  4ZTF A;  4U87 A;  1LKX A;  3CUO A;  4L5J A;  3VYU B;  5E3N A;  3F21 A;  4J00 A;  3LSK A;  3GTL J;  2COB A;  2IEK A;  2CFO A;  2X6W A;  2AS5 F;  2R5Z B;  2JMW A;  3A03 A;  4MIM A;  1I27 A;  3QP6 A;  2PX9 A;  4IZZ A;  2HOS A;  2P6S A;  5F0H A;  3JR9 A;  3OR1 C;  3H35 A;  4YFK F;  1TWG J;  2NYX A;  4A3J J;  1JT6 A;  3MWM A;  3GME A;  5KK1 A;  1FWZ A;  1ZYR F;  2X6X A;  3JSP A;  2VXZ A;  2YUS A;  3ESW B;  2HVR A;  2O6G E;  1AOY A;  3B6C A;  1W5T A;  1O3T A;  2JPB A;  3MZY A;  5D6E A;  3K2A A;  1F1Z A;  3WTT C;  1PP8 F;  1LE8 A;  2OUM A;  2HEO A;  4XKV A;  5DM7 F;  2F5V A;  3V7S A;  4AC0 A;  1AHD P;  5DD8 A;  3DTE A;  1H88 C;  2EFO A;  2DMT A;  1J09 A;  1LDJ A;  1U8R A;  1OYI A;  1SEU A;  3W2A A;  3JRG A;  3K7A J;  4A3F J;  2ZC2 A;  3OOU A;  1VI0 A;  3G4S I;  1EJ9 A;  4A6D A;  4Q5S F;  2ELH A;  4JQF A;  2XF5 A;  4FCY A;  5KCM A;  4YFX F;  2ID3 A;  1ZGW A;  5EZG A;  3GFM A;  4O3M A;  1X3Z B;  2QCO A;  2E71 A;  2JVG A;  4I02 A;  3U1K A;  4BAY A;  1N75 A;  5JR3 A;  4DQ2 A;  5CKT A;  4G7H F;  3FIW A;  3HDD A;  2P5K A;  4AVP A;  3L2C A;  1YLF A;  3HSE A;  1NH3 A;  3HOU J;  4RAY A;  3SZT A;  2EIJ H;  2IP2 A;  3R0A A;  1IN8 A;  4IXA A;  1IJW C;  4Y3O A;  2QQA A;  1JJ6 C;  3NQO A;  2JUG A;  1E2X A;  3ABM H;  3V4G A;  1Y1W J;  3RYP A;  5FB2 A;  5DDG A;  5J4Y A;  3HKZ A;  1DP3 A;  3FXO A;  2JJ7 A;  3Q5F A;  2KKO A;  4C2U A;  4ZJZ A;  1SC7 A;  1TNS A;  1Y56 A;  2LLK A;  2COM A;  2MC3 A;  1XCV A;  1OCT C;  2G7U A;  4KFC A;  5E3O A;  4OIQ F;  1N25 A;  2IT0 A;  4KIF A;  1KGS A;  1Z9C A;  4MNU A;  1E0E A;  5E3M A;  3H9Q A;  3DBL B;  4NC8 A;  1WFX A;  4EM2 A;  3MZ8 A;  5CQG A;  3DTI A;  2J5P A;  2W84 A;  1KU2 A;  3SZG A;  5K5Q A;  2HFH A;  3HBL A;  1XSV A;  2DMQ A;  2GXG A;  3F22 A;  3WGI A;  2ADU A;  4NQW A;  2HTJ A;  5HVQ C;  3RPU A;  3CCM I;  4RDU A;  1JUP A;  1R1U A;  2HTS A;  3ZN0 A;  2MGQ A;  4XN0 A;  3ZQF A;  1J59 A;  2Q2E A;  2DJN A;  4U0W A;  4ZZL A;  1YQA A;  3I54 A;  4HF0 A;  4N0B A;  4HDU A;  3WG9 A;  1ETQ A;  4MHG A;  2X9D A;  4XMY A;  2WAQ N;  3FMS A;  1OFC X;  1BOB A;  1SD5 A;  2VPR A;  2M3A A;  1Y8Q B;  2W57 A;  2UZK A;  4BY1 J;  2GQQ A;  3TDZ C;  1U2W A;  4IEJ A;  1MMA A;  1SAU A;  1TWF J;  4AUX A;  1T08 B;  4PCQ A;  1FPQ A;  3BZ6 A;  2VQC A;  2HDC A;  4FT8 A;  3WG7 H;  1ETY A;  1WJB A;  3HB9 A;  3FM5 A;  3D0S A;  1APL C;  1WJE A;  2A68 F;  2MFZ A;  3QYF A;  3RPQ A;  1VTN C;  2WC2 A;  1STZ A;  3CDH A;  4IRI A;  4N4N B;  4IJA A;  5EEG A;  2RV8 A;  1MDM A;  4TV7 A;  3GTP J;  2W85 A;  3LQQ A;  1UEL B;  1S3J A;  5DUK A;  2MSY A;  2JA7 J;  3JRD A;  2JK3 A;  5ERI A;  4BQA A;  2N8G A;  3D5R C;  2CV0 A;  4GDF A;  4DYR A;  2XV4 S;  3FDY A;  1O7F A;  4MTD A;  2WB1 A;  5K7Z A;  2LVS A;  3FM3 A;  5BS6 A;  3OYG A;  4XIC A;  2B0L A;  1FBQ A;  5D8K B;  4IRG A;  2EJR A;  1RR8 C;  4FX4 A;  1YIO A;  1R6R A;  2JT1 A;  2GXA A;  3F8C A;  2MLG A;  5M3M J;  1J2X A;  1MBG A;  3H5R A;  3CP8 A;  4EM0 B;  2JA2 A;  4A3D J;  3KZI C;  4XSZ F;  2JN6 A;  2BXY A;  1AKH B;  2CUZ A;  4F91 B;  3QQA A;  5IT9 Z;  5D6F A;  3HUG A;  3P9I A;  4WF2 A;  1ETV A;  4BGD A;  4A3L J;  3TP0 A;  1ZG3 A;  2STW A;  1F9N A;  4HBL A;  1IGN A;  3V8K A;  4JYK A;  4E7J A;  2ECC A;  1Q1H A;  2KMU A;  2NVT J;  2VQL A;  3I3L A;  3MKL A;  1B6A A;  2YX7 A;  4KJZ A;  4A3B J;  2DU9 A;  2AHQ A;  1RZ4 A;  4CYC A;  2KIF A;  2IS1 A;  4G9Y A;  2QSH X;  4BE2 A;  3ULQ B;  2VBX A;  4EV0 A;  4M74 A;  1FP2 A;  5LRR A;  2CW8 A;  2NS8 A;  3KP7 A;  2VKH A;  4C3H J;  2PG4 A;  4P9F A;  1I39 A;  1HA8 A;  4FIS A;  4XOP A;  2FQ4 A;  1MSE C;  2L9N A;  2CO5 A;  2A6T A;  5LLQ A;  1FLI A;  3HIF A;  1C0W A;  2DA2 A;  4E7L A;  1JHH A;  3AAF A;  3SEZ A;  4DIQ A;  1IAW A;  2ISZ A;  3S93 A;  2IVM A;  1IW7 F;  4IQ4 A;  3LSG A;  1ETW A;  2Z16 A;  1IXS B;  2V7F A;  2IRF G;  4XL9 A;  1O3R A;  1VND A;  4G6D A;  4KT5 C;  2LG4 A;  2D45 A;  2H09 A;  4XLN F;  1G3W A;  1Z1D A;  3P9C A;  4I09 A;  4A12 A;  5FRO A;  3RKY A;  2IGK A;  4PUS A;  4A69 C;  1WWX A;  4XR6 A;  2ZNZ A;  4LLG F;  1XN7 A;  5LFA A;  3KEQ A;  4IL6 C;  2R7T A;  4OAY A;  4ASN A;  3F8N A;  4BBR J;  2DA4 A;  2FXA A;  5DD4 A;  1TC3 C;  1IDY A;  2BZT A;  2TCT A;  3M8F A;  1X19 A;  2DFI A;  1EKE A;  2GOM A;  4LLL A;  1QNT A;  3ZXS A;  4IQJ A;  2XHK A;  2H94 A;  2LH9 A;  1LDK B;  1EH8 A;  1HDP A;  2NVY J;  1ZAR A;  2LRD A;  2KDO A;  1WI9 A;  1ZG5 A;  4MFE A;  1HW2 A;  2YSR A;  3E7L A;  5TIS C;  2EA4 A;  4A0Y A;  1A36 A;  3K70 D;  3RQI A;  2BVL A;  2QLZ A;  1GXP A;  4G8X A;  1BOA A;  1HW1 A;  2XPV A;  4CIC A;  4BNC A;  3MKZ A;  2EK5 A;  2W24 A;  3IWZ A;  4AIK A;  1WRJ A;  2VAS A;  5E20 A;  5DM6 F;  5GTH C;  4ZYD A;  1O3S A;  2OBP A;  1D1A A;  4MFD A;  2WY7 Q;  1KA8 A;  1YW7 A;  3GLL A;  5ICC A;  3J7Y J;  1W7P B;  1TBX A;  4XRS A;  2Q0O A;  2W82 A;  5HLH A;  2O5R A;  3VFZ A;  2HDD A;  1D1C A;  3MD2 A;  3AG1 H;  3X2Q H;  3ABU A;  3T8T A;  1HW5 A;  4M71 A;  3MZH A;  4CYD A;  2IA1 A;  3ABK H;  2IGN A;  2PI0 A;  3FXU A;  3OYB A;  3QPL A;  5KAF C;  1XMA A;  4FQG A;  1KQ9 A;  1OMI A;  2CQQ A;  4N4O B;  4CDG A;  2VBZ A;  3HOV J;  1X3W B;  2VB6 A;  3R4K A;  3C18 A;  1MD0 A;  4LG0 A;  1OKR A;  1SFE A;  3DU5 A;  4HYE A;  3K4L A;  1OCR H;  2WA0 A;  3K2Z A;  4M6X A;  4XOR A;  1YO5 C;  2E7X A;  1HSJ A;  2VJ5 A;  3AL0 C;  5GP9 A;  1IUF A;  4M73 A;  2H1L A;  2L4A A;  1UST A;  1XG1 A;  3BZC A;  1EA3 A;  2VL8 A;  2HI3 A;  4CXF A;  1NHA A;  2A3S A;  2IPQ X;  1HKQ A;  3W2V A;  4EJO A;  1M1E B;  1WHU A;  5HDN A;  2KRC A;  1B59 A;  5DS9 A;  5JVG F;  2VPL A;  4BHC A;  5FLX Z;  2WAD A;  2E19 A;  1UHS A;  5GTI C;  4ZC3 A;  1H9T A;  1ON2 A;  3KX2 A;  3LSM A;  3NAU A;  4A3C J;  1ON1 A;  1R00 A;  3TOA A;  2K7L A;  2NVX J;  3LAJ A;  2KPM A;  2XGD A;  5GPA A;  3DQV C;  1MZB A;  2ETH A;  4UB8 C;  5JLW A;  1FTZ A;  3DEE A;  3BG7 A;  1ENH A;  3S17 J;  2MW8 A;  2XGX A;  5E3L A;  2XUB A;  1SVO A;  3CC7 I;  1T2K A;  2GIZ A;  4FET A;  1F5T A;  3BG3 A;  1Z77 A;  1IRG A;  1O7L A;  1W4M A;  1BJZ A;  1QRY A;  2D2W A;  3I53 A;  3OYC A;  1QQI A;  4Q4Z F;  2M8E A;  5IT3 A;  2R7Z J;  3KEO A;  1B9M A;  3CC4 I;  1R9T J;  3E5Q A;  2NVU B;  4D7N A;  2F4O B;  3F3X A;  5ILS A;  1DGR M;  1P4A A;  2WB1 N;  1QBJ A;  2VC1 A;  5DTD A;  1ITY A;  3W6K B;  4Y4R A;  3HKZ N;  2GOX B;  4U7B A;  3S14 J;  4I6Z A;  1BW6 A;  1P4W A;  2Z3Y A;  3WHB A;  4QPO A;  1R36 A;  3PUB A;  5FGM A;  4XQF A;  1IDZ A;  2LSO A;  2XB0 X;  3WE2 A;  2R7V A;  3IC7 A;  3CME I;  1B8I B;  1T0F C;  2DPU A;  4HEA 2;  5IOZ A;  1I6H J;  4PJ0 C;  3BP8 A;  2AXL A;  3K4C A;  1UB9 A;  4HAM A;  1LQ1 A;  1J9I A;  2DQL A;  3Q9S A;  3GZN B;  1HXD A;  4AM3 A;  4MQV A;  4CCK A;  2V9P A;  4G6T B;  4WXC A;  2VE8 A;  4P5O A;  5DV5 A;  4DZJ A;  1H9G A;  5K5O A;  1BW5 A;  1LDD A;  2BYV E;  3TDU C;  1QHH D;  2E60 A;  1XGO A;  4YRV A;  1D8K A;  3GVA A;  4H0E A;  5EJC A;  4ENM A;  4X6A J;  4G6Q A;  1T6S A;  2IBD A;  4A3K J;  2R7R A;  4BY7 J;  4N9I A;  2Y31 A;  2X51 A;  4BU2 A;  2R5Y A;  2JRT A;  3CF2 A;  3FK6 A;  1QPI A;  2XPW A;  3IV5 A;  4RS8 A;  1I3A A;  4BL0 B;  3C1D A;  5KVR A;  3GZ5 A;  4UNO A;  1SD6 A;  2AO9 A;  2L0K A;  3K0L A;  3Q0U A;  4X0G A;  3GZ6 A;  2WTE A;  3KE2 A;  3H5N A;  2XAF A;  3T8R A;  2RNG A;  3BG6 A;  3E1S A;  2YU3 A;  1QU3 A;  3FXJ A;  3EYY A;  3JCU C;  2ZSI B;  3OYH A;  2WWY A;  3HPH A;  4LJZ F;  1F4K A;  2DO7 A;  4KIC A;  4NC7 A;  2BW3 B;  1IO2 A;  2XF6 A;  1R22 A;  2QQB A;  2UXN A;  3DKY A;  3O3K A;  3OOP A;  2ZME B;  4HW0 A;  1XC5 A;  2DFH A;  2DBB A;  3HRS A;  1DDN A;  2P0W A;  2FBH A;  1BJA A;  1UG0 A;  2UUZ A;  1S7E A;  2MA3 A;  4C9Y A;  3E5U A;  1FOY A;  1IF1 A;  3BCA A;  5TJJ A;  3FHZ A;  2XSJ C;  1ETX A;  1IN5 A;  2A69 F;  4RM2 A;  1YOV B;  1UMQ A;  3BOQ A;  3F8B A;  3S2W A;  5E1Z B;  4HNT A;  2NS7 A;  3CUQ B;  1VQN I;  2Q2E B;  3TGN A;  4FX0 A;  3OYI A;  1R5H A;  1TTY A;  1QHG A;  4KDP A;  2M4K A;  3L9F A;  1R7J A;  3S3N A;  3I9V 2;  1PUF B;  2EFQ A;  3DKX A;  3HSF A;  2O03 A;  3HRM A;  5F6F A;  3RZD J;  1XPX A;  3BR0 A;  3ISP A;  3KEY A;  4D1Q A;  2CQN A;  3I4P A;  2VBY A;  1N77 A;  2ZKZ A;  3VOD A;  2LF7 A;  3LSP A;  1WQ2 A;  5CVU A;  2ZXW H;  3EQL F;  5A2Q K;  5CLS A;  2XPU A;  2FE3 A;  2ZME C;  3VPR A;  1P6R A;  2Y75 A;  2L02 A;  3RDI A;  5AON A;  4HSR A;  2ELK A;  4ZYA A;  5EG0 A;  3DPL C;  3CCV I;  2K9L A;  4HRI A;  3HL2 A;  4HF1 A;  4BYY A;  2L4M A;  1WI3 A;  2WY8 Q;  5B5E C;  5L3B A;  1UCR A;  4B8X A;  2HOE A;  4C3I J;  4ZZD A;  2O61 A;  3N05 A;  2DOD A;  2RKH A;  5E8G A;  5HOO A;  3CMA I;  5E18 F;  3BRO A;  4NC6 A;  4IHY A;  4XLA A;  4MTE A;  1P2F A;  2Z33 A;  3OS1 A;  2KL4 A;  5HDG A;  5LHI A;  1U0J A;  1DPU A;  1BL0 A;  1OCZ H;  4XKB A;  1WJA A;  5F0C A;  5LEJ A;  2BVM A;  2KRF A;  3BR2 A;  5H6Q A;  1QPM A;  1P7J A;  1GHC A;  2Y9Z A;  2ZJR F;  1RNL A;  2IS6 A;  3ZQC A;  4F92 B;  2K86 A;  1IRZ A;  1FC3 A;  2GAU A;  5J47 A;  3O8H A;  2ICW G;  3FZV A;  2Z99 A;  4BJT A;  2F6C A;  2DDB A;  3RIR A;  2R7X A;  3ONQ A;  3SDG A;  5JLX A;  3EUH A;  1GT0 C;  3PJR A;  1D8J A;  2HWV A;  2OU2 A;  4ZH4 F;  2FOW A;  2HQN A;  5D4S A;  2OV7 A;  1NK3 P;  3RKW A;  2HVS A;  2QSG X;  3S2D J;  4CZZ A;  3BR3 A;  2PQ8 A;  2KIS A;  3OV8 A;  1MND A;  4RB2 C;  5IYD J;  2O7O A;  2BY2 A;  1I50 J;  4EM1 A;  2NVQ J;  1LEA A;  3PO2 J;  3ZQQ A;  2VOD A;  1ETK A;  3T5X A;  3L2Q A;  2XAG A;  2BHY A;  2RAE A;  3E6M A;  4RGS A;  5K7F A;  3UKG A;  4IF4 A;  1ULY A;  3LFK A;  3UNG C;  4IVN A;  5E1W A;  3SHF A;  2LDU A;  1JHF A;  3HOS A;  1BR1 A;  2QBY B;  1ZN2 A;  5F27 A;  3VSL A;  3M8J A;  3D5L A;  2IW5 A;  2KIM A;  3QAH A;  2O3F A;  4EJV A;  5KAI C;  2VT3 A;  2FMY A;  4NQW B;  2KJB A;  3GTO J;  1U5T C;  4LOC A;  2E7W A;  3OS0 A;  1USS A;  4Y33 A;  4ESF A;  3HM5 A;  2BY0 A;  3DU6 A;  1Y1V J;  3A4C A;  3TED A;  1HLV A;  3DEU A;  2V1U A;  4PGH A;  2P7V B;  2QZ8 A;  4GXO A;  4UUV A;  2QKM B;  1FOW A;  1VQL I;  1KQ8 A;  2RDP A;  4EVI A;  1XB4 A;  3NEU A;  4JX6 A;  5LGU A;  5GAD J;  2R7O A;  5D5U B;  1F43 A;  3KP2 A;  3I64 A;  4O6J A;  4ITV A;  2L7K A;  4LGW A;  5D5W B;  1X2N A;  4IOA F;  3HPG A;  4I99 C;  2DT5 A;  3A01 B;  1TNT A;  5CJ9 A;  2EFW A;  2MYS A;  1LFB A;  2HYG D;  3AG2 H;  4ZYH A;  3CCU I;  3WTW C;  2FX0 A;  2NRA C;  1T8I A;  4JX5 A;  1FSH A;  5HS7 A;  3OIO A;  1R5G A;  4GYI A;  1VQM I;  4BKX A;  2DN0 A;  4XM3 A;  2NAZ A;  3ABL H;  5L3G A;  3V8L A;  1FMW A;  2TDX A;  1YHQ I;  2DDA A;  2P8T A;  4B44 A;  1TQI A;  1ZGA A;  1CQT A;  2MD5 A;  3OL3 A;  4CUG A;  1MSF C;  1S8N A;  4NB5 A;  2QWW A;  5K7H A;  2VE9 A;  3ROU A;  2DOA A;  1WJ5 A;  1MMN A;  1MBH A;  1V5E A;  1WVR A;  2OCE A;  2KIU A;  5EDN A;  2KLO A;  5FFZ A;  1JTY A;  2HS5 A;  4I76 A;  3W2W A;  3E5X A;  1A5J A;  1PUE E;  3GBG A;  2X1E A;  3OYA A;  2DCE A;  3C2B A;  2KHM A;  4UXN A;  4RAF A;  2YR2 A;  4RGU A;  1BI2 A;  4BAC A;  4V19 K;  2ID6 A;  3TBI A;  4C2T A;  4FE4 A;  5DEQ A;  2P7C B;  4BXX J;  3OMY A;  4KYW A;  2BBY A;  3KET A;  1ZEL A;  2CU7 A;  3ZR8 X;  2VOO A;  3GO5 A;  1RPW A;  3MCZ A;  2A6E F;  2DFE A;  1BR4 A;  4GFB A;  2BGC A;  3CCE I;  3GLX A;  4KN7 X;  5GPC A;  3RYR A;  3RCO A;  1IRX A;  1FJL A;  1BA5 A;  3F23 A;  2EZL A;  5HNF A;  2EA2 A;  4NHJ A;  3BLY A;  4LK1 F;  1LB2 A;  5HOD A;  1Y39 A;  4OMY A;  2WV1 A;  2HPI A;  1U9N A;  3CF5 F;  3OL4 A;  1YI2 I;  2EBI A;  4V2G A;  3S1N J;  3ZQL A;  2L7M P;  2CW0 F;  3S15 J;  4RLF A;  4EMS A;  2KIQ A;  2JUC A;  3B6A A;  3HTS B;  4XLF A;  4P9U A;  3E0J B;  4RGX A;  3U9G A;  1MJA A;  4R8H A;  3BR6 A;  3ML6 A;  1JUM A;  2DFF A;  3OR2 C;  2K3P A;  3ECO A;  3GCM A;  1MW7 A;  3ZOB A;  3IAS 2;  4OMZ A;  2LKX A;  2LY2 A;  1XGS A;  2FML A;  2PN6 A;  4IPA A;  1P92 A;  1ZRD A;  2ME6 A;  3Q0V A;  3SFI A;  4BH9 A;  3QPT A;  1OR7 A;  1MH4 A;  2R7S A;  4XOT A;  1DU6 A;  3LA3 A;  3S8P A;  2QSF X;  2Z9O A;  3OYF A;  1EF4 A;  2UXX A;  2QYO A;  1IZ1 A;  2M2E A;  4BDY A;  1PDN C;  1D0Z A;  1G59 A;  2V9V A;  2PMU A;  2MG4 A;  2H1K A;  1U6G A;  4RLQ A;  4UV8 A;  4L0Y B;  2FQ3 A;  2OD5 A;  1RET A;  2Y48 A;  5JFR A;  2FF4 A;  1Z6R A;  4M9S A;  1RI7 A;  4XLH A;  1BC8 C;  1GVD A;  2TRT A;  4HLY A;  2M5W A;  5C3E J;  1V5G A;  3I4M J;  3CCS I;  5LGN A;  1YE9 A;  2K5C A;  3DFG A;  1DGW Y;  1SFK A;  3DEW A;  5LRS A;  3IH4 A;  5HLI A;  3HRT A;  5EYR A;  4OOI A;  1XSD A;  4E4H A;  3CLO A;  2LTP A;  3TO9 A;  3ASO H;  4LB5 A;  2LR8 A;  4P1W A;  2P4W A;  4WX9 A;  4NBQ A;  1YRN A;  2E2J J;  3BQZ A;  2JA8 J;  3WTU C;  3H9J A;  4II2 A;  1K6O A;  2XSD C;  4DBQ A;  1KU3 A;  1BM9 A;  3MAJ A;  1X4O A;  2CRG A;  4XNF A;  2DMN A;  3SYT A;  3JRF A;  2JRM A;  2MH2 A;  3N97 A;  4BS9 A;  4BXF A;  5F08 A;  2L7F P;  1ZR4 A;  2XDV A;  2CUJ A;  5HLG A;  2C6Y A;  5FJ8 J;  5FO5 A;  1W0U A;  3P5J A;  3FKI J;  2E1M B;  1Y6I A;  4YEJ A;  5HLT A;  4IRH A;  3CDL A;  1FSE A;  4D5C A;  1LFU P;  3CDI A;  2YS9 A;  1B4A A;  2ZCW A;  4O5V A;  4XKC A;  5A2Q Z;  2K9M A;  4IHT A;  2HNH A;  2KFD A;  3IH2 A;  3WU1 B;  2D5V A;  1ETO A;  4ESB A;  1EH6 A;  3G1M A;  1VQ9 I;  1V54 H;  2F5F A;  1B9N A;  2OC6 A;  1X1P A;  1UHW A;  4XRF A;  4PZJ A;  5M5W J;  3PFI A;  4PFP A;  3BR5 A;  3AG3 H;  1BBY A;  1TT5 B;  3CUQ C;  2CS3 A;  2DW4 A;  3H9G A;  3FMR A;  2HR3 A;  1RUN A;  1V3F A;  3KPH A;  4KMF A;  2DTR A;  2X48 A;  1V4R A;  1KYW A;  1YX5 A;  1SAN A;  5F0F A;  3BC8 A;  3VB2 A;  1RRJ A;  1SMT A;  4C3J J;  2I10 A;  2OCC H;  5L3C A;  4XBF A;  5JI6 A;  2GM4 A;  5E79 C;  1XCB A;  2K3F A;  2DT6 A;  1JJ8 C;  4WXH A;  1RUO A;  3JSO A;  1YTY A;  5ICG A;  4CSW A;  2DQR A;  1J0R A;  4LG3 A;  5JHF A;  2RQP A;  5DUI A;  1W5S A;  5L3D A;  4DW6 A;  1L0O C;  2M0M A;  3I4N J;  3A0H C;  1YJ9 I;  3H92 A;  1TQM A;  2XAQ A;  3HG9 A;  4XKW A;  4QSH A;  3OSG A;  4ZDP A;  1IN7 A;  2E2H J;  1UJ8 A;  3JRC A;  2PFB A;  4BEH B;  1ZK8 A;  3FXQ A;  4HV5 A;  1GUU A;  1SD7 A;  4FHT A;  1TW3 A;  1R23 A;  3LQR A;  5B1B H;  4XRM A;  2D1V A;  3R0J A;  4YFN F;  2R7W A;  4DYC A;  2LRE A;  2ISY A;  5H20 A;  2IA0 A;  4W97 A;  1QA6 A;  2ZFW A;  2LP0 A;  4HST A;  1D1B A;  5H6R A;  2M30 A;  2WBM A;  2X4H A;  3HOT A;  4QWQ A;  3QWL A;  1QVT A;  1L3L A;  1DPR A;  1B8I A;  3LAP A;  3FWE A;  2CMP A;  3NWS A;  3A1Y A;  3K4B A;  1UZC A;  2L01 A;  2ZJQ F;  3JTG A;  5CPR B;  4MQ9 F;  1V55 H;  1T39 A;  3FXM A;  2JSP A;  3QOP A;  3I58 A;  1K61 A;  2R93 J;  4RAG A;  4L5I A;  1G4D A;  1VF9 A;  3BCB A;  2EB7 A;  3TL4 X;  2JA5 J;  2CFX A;  1WSU A;  3NAR A;  3GF2 A;  3REO A;  3P9K A;  2CYY A;  2VKV A;  3PIO F;  2DA3 A;  3H3Z A;  3WOD F;  4HF2 A;  1IRF A;  2PMH A;  4ENK A;  3KP6 A;  4KN4 X;  2DAO A;  4G7Z F;  3DKW A;  2EIN H;  4DGW B;  3QU6 A;  3L7W A;  2DXI A;  2VUM J;  4J01 A;  4S0H B;  3QRF F;  2O9L A;  2R92 J;  1K4S A;  1W7P A;  2WAE A;  1LVK A;  3TO6 A;  1KU9 A;  3FMQ A;  4WWC A;  3M1E A;  2ESN A;  2BW3 A;  3WTX C;  2A07 F;  3JAM Z;  5JVT A;  3I5U A;  4RB0 A;  4XLC A;  2J5O A;  2GIV A;  1LE8 B;  3L2R A;  1IC8 A;  3VEP A;  4M3D A;  3Q3S A;  3PUF A;  1TL8 A;  2RC4 A;  4NUB A;  4B4C A;  2F48 A;  1XMX A;  2ZFU A;  4KIB A;  4HX7 A;  3BTI A;  3EPZ A;  4IX7 A;  1KQ0 A;  1VQP I;  1QZE A;  2ZME A;  3O6B B;  1OYW A;  3VYR B;  6PAX A;  2VT2 A;  2CQ7 A;  3GTJ J;  4JBA A;  3DXJ F;  1YW8 A;  1FX7 A;  4PK4 A;  3AFH A;  2H8R A;  5J6X A;  1LPQ A;  5FLX K;  5IP7 J;  4PGG A;  2PLY A;  2PBI A;  1AU7 A;  2CQX A;  3OYM A;  3A0B C;  3PQK A;  1S7O A;  1YFH A;  2VI6 A;  1IUY A;  1U5T B;  4XON A;  5BPI A;  2K9N A;  5D4R A;  2A6H F;  3LA7 A;  2D1H A;  1U78 A;  4IHW A;  1BR2 A;  2Z5U A;  1I3Q J;  2EH3 A;  4HX4 A;  2IA2 A;  1HKS A;  1S6L A;  3PSF A;  2ZXI A;  1WKM A;  3LST A;  3K4N A;  1R49 A;  3G1L A;  3KZY A;  2DT7 B;  1D3Y A;  5J4V A;  4XRS G;  2NNY A;  5FLV A;  3OIP A;  1CF7 A;  3S1R J;  4GRI A;  2AQE A;  3E3V A;  4OIN F;  3ERE D;  2X1D A;  2FBI A;  2EIM H;  5E1X A;  5HNH A;  2MD0 A;  4CYC B;  4RA2 A;  2K27 A;  2GA1 A;  1LFP A;  1DP7 P;  2ZNY A;  4LK0 F;  3ZMD A;  1J7K A;  4R79 A;  1DU0 A;  4EJT A;  1Z3X A;  4A2U A;  1BN5 A;  3HGY A;  4DYQ A;  1ERD A;  4E7Z A;  4HA8 A;  1UHM A;  1QZZ A;  1LUJ B;  2HPM A;  1JKQ C;  1K79 A;  4M3B A;  4D0P A;  1PP7 U;  3IP4 B;  2MBF A;  3HRU A;  2P5V A;  3S32 A;  3VDX A;  3BR1 A;  1X4P A;  1TWH J;  3JRH A;  3ELK A;  5EGO A;  5C44 J;  4XLP F;  4UVB A;  2E1M C;  3KP3 A;  4R1H A;  4BHP A;  2EQR A;  1ZH5 A;  2V6C A;  1NG7 A;  5DCM A;  4F52 A;  2W1O A;  3BY6 A;  2L9R A;  4RB1 A;  1G2H A;  2Z2S B;  2PJP A;  2P5L C;  4ZYE A;  4J19 A;  1I1S A;  3DCF A;  4MEY F;  2HGC A;  3GXO A;  5IYB J;  3OYK A;  2BY3 A;  3WTS C;  1FIP A;  2G0E A;  2LF8 A;  1Y0U A;  2DJI A;  2ZXH A;  2ZXJ A;  4OAZ A;  4ABZ A;  2FUG 2;  4MGR A;  1P4X A;  2FD5 A;  2KQR A;  1MBE A;  3R61 A;  1G8X A;  4YIR X;  3M3Y J;  3G1O A;  1LVA A;  4L5E A;  3M4O J;  1Y8R B;  4M9X A;  2ESH A;  1LNW A;  2FJ1 A;  1E3H A;  2VBW A;  3EUA A;  2F4M B;  2X0L A;  1S5L C;  2QBY A;  3TKY A;  2B63 J;  1XMK A;  3QU3 A;  4IHX A;  5J8F A;  3MQ0 A;  1VQ7 I;  3HOW J;  4Y15 A;  4CA0 A;  4N9H A;  3ZQI A;  3ZMS A;  2L3D A;  4JOM A;  2ZO4 A;  4PJN A;  3ECH A;  2W25 A;  4LMY A;  1OQY A;  5FLM J;  3PSI A;  1ZAO A;  4MO7 A;  1B1B A;  3ZP5 A;  1ZHF A;  2DYS H;  2FOK A;  3L00 A;  5KHD A;  2F4I A;  2KDZ A;  2VQH A;  4MLO A;  1FYK A;  2GZW A;  4Z6Y A;  4L9N A;  1WCM J;  1K6Y A;  4DJA A;  3M07 A;  1WJC A;  2R7F A;  3U2R A;  1X3U A;  4A3I J;  4RBO A;  1WH7 A;  2VJI A;  1S29 A;  2V1D A;  2EV5 A;  4KUM A;  1GLN A;  4EJU A;  2R7D A;  3JRB A;  4PFO A;  1MIJ A;  1HDD C;  1V5F A;  2XKO A;  3K4K A;  1XTA A;  5J40 A;  5FKM A;  4ZYG A;  3EUH C;  2Q1Z B;  2VXD A;  3CO7 C;  3A01 A;  2Y69 H;  3CO6 C;  3QOE A;  3JRE A;  1Z7U A;  3CZ6 A;  1W5C C;  4Y7N J;  3RKQ A;  1JE8 A;  3T0Y A;  3L2W A;  4GGG A;  2OJE D;  3V42 A;  4X1E A;  1FY7 A;  5FKO A;  3K4M A;  2QA4 I;  2FNA A;  1N78 A;  1WJF A;  1QVU A;  1DQU A;  1R4N B;  2QEX I;  4G7O F;  3WGG A;  5DYM A;  2F5E A;  3J80 Z;  2JPC A;  3IHU A;  5CYV A;  3ZMV A;  2E1N A;  2JVH A;  2B9S A;  3GX4 X;  3LWF A;  4HZF A;  1HF0 A;  3T1B A;  4F93 B;  2L9V A;  5J1R A;  2HVQ A;  2XGE A;  3MKY B;  3FK7 A;  4NNJ A;  1REP C;  3ABT A;  1SFX A;  2RRE A;  2CV2 A;  1JKO C;  2XAU A;  2GA2 A;  4K2E A;  2Y0M A;  4CCL A;  3EYI A;  2K9S A;  4A0X A;  2E34 A;  2IGO A;  4AU7 A;  4AIJ A;  2LNB A;  1RR7 A;  3H3V K;  1BI3 A;  4BJ5 C;  1XGN A;  3LFU A;  3S3O A;  5ED4 A;  2G7H A;  3M1C A;  2ACJ A;  2AXT C;  5FD6 A;  4IO9 F;  4U88 A;  3CTA A;  3L2U A;  4A5N A;  1YYV A;  5AIQ A;  3CC2 I;  3O8G A;  3SDB A;  4M3E A;  1K7A A;  2RN7 A;  2DMU A;  4DBR A;  1WZ2 A;  1U8B A;  2A5W A;  9ANT A;  3LSH A;  4I7H A;  4XSX F;  3LSR A;  3GFI A;  1XX5 A;  1SFU A;  3W3C A;  2OZU A;  1PVE A;  4EGY A;  3F8M A;  1J5Y A;  2P81 A;  3QYB A;  3KCC A;  4E7K A;  2M7B A;  3U1D A;  1HBX G;  4L9J A;  1KU7 A;  1FYM A;  2L7Z A;  1JGS A;  1E17 A;  1A35 A;  4BHB A;  2L54 A;  4II3 A;  4F55 A;  2ZB9 A;  3JAM K;  1S72 I;  2YX4 A;  2QQ8 A;  4HQM A;  1ZTR A;  4PSW A;  4JK1 X;  2R3S A;  3KYD B;  2FNP A;  4UV9 A;  4A5M A;  1YS6 A;  3G2B A;  1BI0 A;  3L2V A;  1FT9 A;  3WE3 A;  3K1M A;  2K4B A;  1IXR C;  3GUD A;  3TO7 A;  1G6N A;  4A0Z A;  4PSX A;  1JT0 A;  3HJE A;  4LFU A;  4I98 B;  2HYJ A;  4Y17 A;  1WH5 A;  2HOT A;  2YU9 J;  3HUG B;  4S04 A;  3OS2 A;  2HQ5 A;  4H4K C;  5TGT A;  1KZH A;  3ZQH A;  3F72 A;  1OCC H;  3SJM A;  3CUQ A;  4AID A;  4XK4 A;  5JHU A;  3V7R A;  2XAH A;  1T33 A;  3OSF A;  1X2M A;  3FX3 A;  3Q9V A;  4BUP A;  3SXY A;  2V6E A;  2IS4 A;  1BI1 A;  2R7Q A;  2DPD A;  4WCG A;  1YRN B;  3ZQG A;  4UHT A;  3LNQ A;  4ESJ A;  2M0C A;  4XN3 A;  2PJR B;  5L3E A;  5IP6 A;  2EWN A;  3HGG A;  3HXL A;  4Z2Y A;  3VYS B;  1MMG A;  3PFY A;  3ZMU A;  3R6S A;  1RKT A;  3GTG J;  2RNJ A;  2EZK A;  2E35 A;  5J3L A;  1D5V A;  3OYL A;  3QPH A;  3K70 C;  1XDS A;  3BDD A;  2ZSH B;  3G6E I;  3KLN A;  3S1M J;  3PM1 A;  5BQT A;  4AYB N;  4ZDO A;  3ZGK A;  2OTJ I;  3W6J B;  1O57 A;  2ELJ A;  1TWC J;  5FKN A;  2GWR A;  5J8C A;  5IOY A;  2VLA A;  3BJA A;  1IV8 A;  1ZKG A;  4BE0 A;  1K78 A;  4M9Z A;  1TZL A;  5FKL A;  2V9K A;  3WTV C;  2K02 A;  1P9Q C;  4RAZ A;  2LBF A;  3OIQ A;  1UG2 A;  2MAB A;  3L09 A;  2X6O A;  2DLL A;  3OYN A;  3HOZ J;  2FEZ A;  1PJR A;  1ZRE A;  1FTT A;  1GV5 A;  4B43 A;  4FTH A;  2JSC A;  4UVC A;  3PNT A;  3CCL I;  3BWG A;  3KP4 A;  4MEX F;  4IOC F;  1DUX C;  3QPS A;  2Q8K A;  2GLO A;  3A02 A;  4EGZ A;  4C2M J;  1QZY A;  4A3E J;  4QTR A;  2JZY A;  4UY8 I;  4AYB A;  1JUS A;  2STT A;  3CJQ B;  2DOF A;  1BC7 C;  1Q1V A;  1ZLK A;  2VIX A;  5HS9 A;  3C3W A;  3WU0 A;  4E7S A;  4DZP A;  4W1U A;  4BQQ A;  4OIR F;  3BPV A;  2AQF A;  1G3T A;  1K83 J;  3I55 I;  1R1V A;  1J75 A;  1ZQ3 P;  2BE5 F;  3ZMT A;  4DOZ A;  1SFO J;  5CVV A;  2M45 A;  3SQN A;  4E7I A;  4EAT A;  4LD5 A;  4PJM A;  4B1R A;  2H6B A;  1POG A;  3J80 K;  5IYC J;  1KYZ A;  4KA4 A;  4KIS A;  2LFB A;  2R0Q C;  1MJB A;  5ICE A;  3U21 A;  1SVL A;  3AG4 H;  5B3S H;  3BPX A;  3DPU A;  1BIA A;  1Z3Y A;  5FFX A;  3L1P A;  4GO1 A;  4BEH A;  3J7A O;  3ERM A;  2V1X A;  2H6C A;  1KON A;  1VQ4 I;  1R5I D;  2Z1D A;  3LSJ A;  1Z91 A;  2NXN B;  4E7H A;  4M6V A;  4A93 J;  5IT9 K;  2X85 A;  5EGO B;  4G12 A;  2V26 A;  2KT0 A;  4IKF A;  1FP1 D;  1O3Q A;  1FIA A;  3H1C A;  5F1J A;  3AKZ A;  3S1Q J;  5DCM B;  1TP4 A;  3QP5 A;  2HQR A;  2XVC A;  2LBF B;  4OWR B;  2W48 A;  5CVI A;  1AWC A;  1R4M B;  3CJT B;  1QGP A;  2KZG A;  2K40 A;  2X1C A;  3TW6 A;  2XKP A;  4LG0 B;  2BOL A;  3CCY A; 
#chains in the Genus database with same CATH homology
 2F2E A;  3RI4 A;  1YW9 A;  3HYI A;  2FBK A;  4UVA A;  3WTZ A;  5LBQ A;  3WTY C;  2XAJ A;  1FBS A;  3MEX A;  4KMU X;  2M1B A;  4LB6 B;  5LHG A;  1OYY A;  5CVJ A;  4GYG A;  2EFP A;  3K1N A;  3LA2 A;  2RGV A;  3CJN A;  3KP5 A;  5D8L B;  1XD7 A;  3V7C A;  3EDP A;  1IXC A;  5ILV A;  4F7Z A;  5DCF A;  3IWF A;  3WGH A;  4S05 A;  4GCV A;  2K4J A;  1IN4 A;  4U0Y A;  3JW4 A;  1HQC A;  2G9W A;  2FA5 A;  4PDK A;  5FD5 A;  3G3Z A;  1EH7 A;  3F6O A;  3IKV A;  1I1G A;  4M72 A;  3F8F A;  5EEH A;  1SD4 A;  5E17 F;  2IJL A;  3ZN1 A;  5AIP A;  3K1P A;  1CGP A;  4HX8 A;  1UFM A;  1YG2 A;  2VON A;  5E8I A;  3J81 Z;  1XSX A;  2RVC A;  4HDV A;  3DP7 A;  1I6X A;  1R58 A;  4HLX A;  4E70 A;  2OAZ A;  1FZP B;  3F6V A;  2XRO A;  5HDK A;  4OU0 A;  5LGT A;  4Y13 A;  4DNC A;  4KIG A;  1T38 A;  5F1R A;  4QLC U;  3KZZ A;  2HZT A;  5K5R A;  3O2P E;  3DV8 A;  5D5V B;  4I2O A;  3GWZ A;  4ENJ A;  1IN6 A;  4OIO F;  4YG2 F;  3HTU A;  4OIP F;  1G3S A;  4CGZ A;  4LLN A;  3H3U A;  3G73 A;  2DK5 A;  2V79 A;  2EFN A;  1ZRC A;  5ICF A;  2MH9 A;  2XIG A;  3DF8 A;  2YPR A;  3HHH A;  2HKX A;  2CG4 A;  3P7N A;  4I01 A;  2FU4 A;  3FXR A;  3E6D A;  1XDU A;  3M7G A;  1LJ9 A;  1ODD A;  3GYH X;  2DI3 A;  3KLO A;  4EQQ A;  3RTR A;  1XGM A;  2XAS A;  1T0F A;  1GVJ A;  2OQR A;  3BJ6 A;  5D5X B;  3PQJ A;  2BEO A;  3GW2 A;  1QO0 D;  1MKM A;  1U5T A;  4U7D A;  1YS7 A;  1HST A;  2MLK A;  2EV6 A;  1MGT A;  4G94 A;  3ZMZ A;  3I0T A;  4I0B A;  1FNN A;  3K69 A;  3VOE A;  5L3F A;  3HHG A;  2CWE A;  2F5C A;  1FBU A;  1A04 A;  3E6C C;  5BOX A;  3ZQ7 A;  4YII A;  1CF7 B;  2BV6 A;  2QUF A;  2HYF A;  2VOP A;  3NRV A;  2CGP A;  2OZ6 A;  1RIO H;  2EV0 A;  2F5D A;  3EET A;  2WV0 A;  1HKT A;  3I71 A;  2H27 A;  4ON0 A;  2KJC A;  4L18 B;  5BMZ A;  2QQ9 A;  1I5Z A;  2FRH A;  1TQP A;  2XRN A;  4B09 A;  4BXU A;  4RGR A;  5CVR A;  1JXS A;  1K78 B;  2O8X A;  2VC0 A;  2DK8 A;  1Z6T A;  2LKP A;  1TW2 A;  5K1Y A;  3M8E A;  3N4M A;  1SAX A;  1MJ9 A;  1BIB A;  3KFW X;  4CHU A;  4I0A A;  2ZBK A;  1H0M A;  1S7A A;  2PEX A;  3IL2 A;  3K9T A;  3MFK A;  2VN2 A;  1ZLJ A;  4CO8 A;  3HSR A;  1W7P D;  3SZP A;  3J81 K;  4L9T A;  4ENN A;  3TOB A;  2NS0 A;  5LHH A;  1T98 A;  4WK8 F;  2QVO A;  1ONV A;  4AIH A;  4IHS A;  2M87 A;  2CQK A;  3B73 A;  2O0Y A;  4RB3 C;  1EV7 A;  4AWX B;  1FOK A;  1ZRF A;  2A5Y B;  3C7J A;  4L0Z B;  2HKO A;  4P55 A;  1R1T A;  3IRR A;  3TQN A;  2E1C A;  3GEZ A;  1ZG1 A;  1FYL A;  2QEN A;  3ZPL A;  1G3Y A;  5F64 A;  3COA C;  2OQG A;  3DPT A;  2GXB A;  2FSW A;  2CSO A;  3R60 A;  1GXQ A;  5ILU A;  5LEK A;  3I59 A;  4L9V A;  3GFJ A;  2JTV A;  1SMY F;  4ETS A;  5BPD A;  1ZGJ A;  4WXD A;  1U3E M;  4EJW A;  4Q48 A;  2OA4 A;  5TRD A;  2P6T A;  2QM3 A;  5HS8 A;  3SFZ A;  3V8J A;  4AD9 A;  2A61 A;  4P96 A;  3RJP A;  3GFL A;  3RKX A;  1TLH B;  1MDM B;  4M6Y A;  3IKT A;  4HQE A;  4HV6 A;  4KNY A;  2NNN A;  3B02 A;  1LEB A;  3E97 A;  4A6E A;  4YIF A;  3BJO A;  1Z05 A;  3M9A A;  3E6B A;  4HOB A;  3IRQ A;  4U0V A;  2ZJ2 A;  3FF5 A;  2UWM A;  4Q47 A;  1OPC A;  3JTH A;  3I59 B;  3CUO A;  4L5J A;  3F21 A;  2AS5 F;  1I27 A;  3QP6 A;  2P6S A;  4YFK F;  2NYX A;  3MWM A;  5KK1 A;  1FWZ A;  1ZYR F;  3JSP A;  2VXZ A;  2O6G E;  1AOY A;  1W5T A;  1O3T A;  2JPB A;  3MZY A;  5D6E A;  1F1Z A;  3WTT C;  1PP8 F;  2HEO A;  3V7S A;  5DD8 A;  2EFO A;  1LDJ A;  1U8R A;  1OYI A;  4A6D A;  4Q5S F;  2ELH A;  4JQF A;  4YFX F;  3GFM A;  4O3M A;  4I02 A;  4BAY A;  5JR3 A;  4DQ2 A;  4G7H F;  2P5K A;  4AVP A;  3L2C A;  1YLF A;  3HSE A;  4RAY A;  3SZT A;  2IP2 A;  3R0A A;  1IN8 A;  4IXA A;  2QQA A;  3NQO A;  1E2X A;  3V4G A;  3RYP A;  5FB2 A;  5DDG A;  3Q5F A;  2KKO A;  1TNS A;  2COM A;  2MC3 A;  1XCV A;  2G7U A;  4KFC A;  4OIQ F;  2IT0 A;  4KIF A;  1KGS A;  1Z9C A;  4MNU A;  4EM2 A;  2J5P A;  2W84 A;  1KU2 A;  5K5Q A;  2HFH A;  1XSV A;  2GXG A;  3F22 A;  3WGI A;  2ADU A;  4NQW A;  2HTJ A;  5HVQ C;  3RPU A;  1R1U A;  2HTS A;  3ZN0 A;  1J59 A;  2Q2E A;  4U0W A;  4ZZL A;  1YQA A;  3I54 A;  4HF0 A;  4N0B A;  4HDU A;  3WG9 A;  4MHG A;  3FMS A;  1SD5 A;  2W57 A;  2UZK A;  2GQQ A;  3TDZ C;  1U2W A;  4PCQ A;  1FPQ A;  3BZ6 A;  2HDC A;  4FT8 A;  3FM5 A;  3D0S A;  2A68 F;  3RPQ A;  1VTN C;  2WC2 A;  1STZ A;  3CDH A;  4IRI A;  4IJA A;  5EEG A;  2RV8 A;  1MDM A;  4TV7 A;  2W85 A;  3LQQ A;  1S3J A;  5DUK A;  5ERI A;  4BQA A;  2XV4 S;  1O7F A;  4MTD A;  3FM3 A;  5BS6 A;  2B0L A;  1FBQ A;  5D8K B;  4IRG A;  2EJR A;  4FX4 A;  1YIO A;  2JT1 A;  3F8C A;  2MLG A;  1J2X A;  4EM0 B;  4XSZ F;  5IT9 Z;  5D6F A;  3HUG A;  3P9I A;  4WF2 A;  1ZG3 A;  2STW A;  1F9N A;  4HBL A;  3V8K A;  1Q1H A;  1B6A A;  2YX7 A;  2DU9 A;  1RZ4 A;  2KIF A;  4G9Y A;  3ULQ B;  2VBX A;  4EV0 A;  4M74 A;  1FP2 A;  5LRR A;  3KP7 A;  2PG4 A;  4P9F A;  2CO5 A;  5LLQ A;  1FLI A;  3HIF A;  1C0W A;  1JHH A;  3AAF A;  1IAW A;  2ISZ A;  2IVM A;  1IW7 F;  1IXS B;  2IRF G;  1O3R A;  4G6D A;  4KT5 C;  2D45 A;  2H09 A;  4XLN F;  1G3W A;  1Z1D A;  3P9C A;  4I09 A;  4A12 A;  3RKY A;  1WWX A;  2ZNZ A;  4LLG F;  1XN7 A;  3KEQ A;  4ASN A;  3F8N A;  2FXA A;  5DD4 A;  3M8F A;  2DFI A;  4LLL A;  1QNT A;  2XHK A;  2H94 A;  1LDK B;  1EH8 A;  1ZAR A;  1WI9 A;  1ZG5 A;  1HW2 A;  2YSR A;  2EA4 A;  4A0Y A;  2QLZ A;  1GXP A;  4G8X A;  1BOA A;  1HW1 A;  4BNC A;  4CIC A;  2EK5 A;  2W24 A;  3IWZ A;  4AIK A;  1WRJ A;  5E20 A;  4ZYD A;  1O3S A;  2OBP A;  1KA8 A;  1YW7 A;  5ICC A;  1W7P B;  1TBX A;  2Q0O A;  5HLH A;  3VFZ A;  3ABU A;  3T8T A;  3MZH A;  1HW5 A;  4M71 A;  4CYD A;  2IA1 A;  2PI0 A;  3FXU A;  1XMA A;  1KQ9 A;  1OMI A;  4CDG A;  2VBZ A;  3R4K A;  3C18 A;  1MD0 A;  4LG0 A;  1OKR A;  1SFE A;  4HYE A;  3K2Z A;  4M6X A;  1YO5 C;  2E7X A;  1HSJ A;  4M73 A;  2L4A A;  4CXF A;  1UST A;  1NHA A;  2A3S A;  2IPQ X;  1HKQ A;  4EJO A;  5HDN A;  1B59 A;  4BHC A;  5FLX Z;  1H9T A;  1ON2 A;  1ON1 A;  1R00 A;  3TOA A;  2K7L A;  3LAJ A;  3DQV C;  1MZB A;  2ETH A;  2XGX A;  2XUB A;  1T2K A;  1F5T A;  1IRG A;  1O7L A;  1W4M A;  2D2W A;  3I53 A;  1QQI A;  4Q4Z F;  2M8E A;  5IT3 A;  3KEO A;  1B9M A;  3E5Q A;  3F3X A;  5ILS A;  1P4A A;  1QBJ A;  2VC1 A;  3W6K B;  4U7B A;  1P4W A;  2Z3Y A;  1R36 A;  5FGM A;  2LSO A;  3WE2 A;  3IC7 A;  2DPU A;  3BP8 A;  2AXL A;  1UB9 A;  4HAM A;  1LQ1 A;  1J9I A;  2DQL A;  3Q9S A;  1HXD A;  4MQV A;  4WXC A;  2VE8 A;  4P5O A;  5DV5 A;  1H9G A;  5K5O A;  1LDD A;  2BYV E;  3TDU C;  1XGO A;  1D8K A;  3GVA A;  4H0E A;  4ENM A;  4G6Q A;  1T6S A;  4N9I A;  2JRT A;  4RS8 A;  3C1D A;  5KVR A;  3GZ5 A;  4UNO A;  1SD6 A;  3K0L A;  3GZ6 A;  2WTE A;  3KE2 A;  2XAF A;  3T8R A;  2YU3 A;  3EYY A;  2WWY A;  4LJZ F;  1F4K A;  2DO7 A;  4KIC A;  1R22 A;  2QQB A;  2UXN A;  3O3K A;  3OOP A;  4HW0 A;  2ZME B;  2DBB A;  3HRS A;  1DDN A;  2FBH A;  1BJA A;  2MA3 A;  3E5U A;  1IF1 A;  5TJJ A;  3FHZ A;  1IN5 A;  2A69 F;  3BOQ A;  3F8B A;  3S2W A;  5E1Z B;  3CUQ B;  3TGN A;  4FX0 A;  1R5H A;  1TTY A;  4KDP A;  3L9F A;  1R7J A;  2EFQ A;  3HRM A;  3HSF A;  2O03 A;  5F6F A;  3ISP A;  3I4P A;  2VBY A;  2ZKZ A;  3VOD A;  2LF7 A;  1WQ2 A;  5CVU A;  3EQL F;  5A2Q K;  5CLS A;  2FE3 A;  1P6R A;  2Y75 A;  2L02 A;  3RDI A;  5AON A;  3DPL C;  4HF1 A;  4BYY A;  2L4M A;  5L3B A;  1UCR A;  4B8X A;  2HOE A;  4ZZD A;  2O61 A;  2RKH A;  5E8G A;  5HOO A;  5E18 F;  3BRO A;  4MTE A;  1P2F A;  2Z33 A;  5HDG A;  5LHI A;  1DPU A;  5LEJ A;  2KRF A;  5H6Q A;  1QPM A;  1GHC A;  1RNL A;  2K86 A;  1FC3 A;  2GAU A;  3FZV A;  2Z99 A;  3RIR A;  3EUH A;  1D8J A;  2HWV A;  2OU2 A;  4ZH4 F;  2HQN A;  5D4S A;  3RKW A;  4CZZ A;  3OV8 A;  2PQ8 A;  4RB2 C;  4EM1 A;  1LEA A;  2VOD A;  3T5X A;  2XAG A;  3E6M A;  4RGS A;  4IF4 A;  1ULY A;  3LFK A;  4IVN A;  5E1W A;  3SHF A;  2LDU A;  1JHF A;  2QBY B;  3HOS A;  1ZN2 A;  3D5L A;  2IW5 A;  2KIM A;  3QAH A;  2O3F A;  4EJV A;  2VT3 A;  2FMY A;  2KJB A;  1U5T C;  2E7W A;  1USS A;  4ESF A;  3DEU A;  2V1U A;  4PGH A;  2P7V B;  2QZ8 A;  4GXO A;  4UUV A;  1KQ8 A;  2RDP A;  4EVI A;  1XB4 A;  3NEU A;  5LGU A;  5D5U B;  3KP2 A;  3I64 A;  4O6J A;  4LGW A;  5D5W B;  2DT5 A;  1TNT A;  5CJ9 A;  2EFW A;  2HYG D;  4ZYH A;  3WTW C;  2NRA C;  1FSH A;  5HS7 A;  1R5G A;  4GYI A;  2NAZ A;  5L3G A;  3V8L A;  2TDX A;  2P8T A;  1TQI A;  1ZGA A;  2MD5 A;  1S8N A;  4NB5 A;  2QWW A;  2VE9 A;  3ROU A;  2KIU A;  5FFZ A;  2HS5 A;  3E5X A;  1PUE E;  4UXN A;  2YR2 A;  4RGU A;  1BI2 A;  5DEQ A;  2P7C B;  4KYW A;  2BBY A;  3KET A;  2VOO A;  3GO5 A;  3MCZ A;  2A6E F;  2BGC A;  3GLX A;  4KN7 X;  3RYR A;  3F23 A;  2EA2 A;  4NHJ A;  4LK1 F;  1LB2 A;  4OMY A;  2CW0 F;  4EMS A;  3HTS B;  4P9U A;  4RGX A;  3U9G A;  1MJA A;  4R8H A;  3ML6 A;  3ECO A;  4OMZ A;  1XGS A;  2FML A;  2PN6 A;  4IPA A;  1P92 A;  1ZRD A;  4BH9 A;  3QPT A;  1OR7 A;  3LA3 A;  2Z9O A;  2UXX A;  2QYO A;  1IZ1 A;  1PDN C;  2V9V A;  2PMU A;  1U6G A;  4UV8 A;  4L0Y B;  2FQ3 A;  2OD5 A;  2Y48 A;  5JFR A;  2FF4 A;  1Z6R A;  4M9S A;  1RI7 A;  1BC8 C;  4HLY A;  2M5W A;  5LGN A;  3DFG A;  5LRS A;  5HLI A;  3HRT A;  4OOI A;  1XSD A;  3CLO A;  3TO9 A;  4LB5 A;  2P4W A;  4WX9 A;  3WTU C;  1K6O A;  1KU3 A;  1BM9 A;  3MAJ A;  3N97 A;  2MH2 A;  5HLG A;  2C6Y A;  5FO5 A;  4IRH A;  1FSE A;  5A2Q Z;  1B4A A;  2ZCW A;  4O5V A;  4IHT A;  3WU1 B;  4ESB A;  1EH6 A;  2F5F A;  1B9N A;  1UHW A;  4XRF A;  4PZJ A;  3PFI A;  1BBY A;  3CUQ C;  2DW4 A;  3FMR A;  2HR3 A;  1RUN A;  1V3F A;  4KMF A;  2DTR A;  1V4R A;  1KYW A;  3VB2 A;  1SMT A;  5L3C A;  4XBF A;  5JI6 A;  1XCB A;  1RUO A;  4WXH A;  3JSO A;  1YTY A;  5ICG A;  2DQR A;  1J0R A;  2RQP A;  5DUI A;  1W5S A;  5L3D A;  1L0O C;  3H92 A;  1TQM A;  2XAQ A;  1IN7 A;  2PFB A;  3FXQ A;  4HV5 A;  1SD7 A;  4FHT A;  1R23 A;  1TW3 A;  3LQR A;  2D1V A;  3R0J A;  4YFN F;  2ISY A;  5H20 A;  2IA0 A;  2ZFW A;  5H6R A;  2M30 A;  2X4H A;  3HOT A;  4QWQ A;  1L3L A;  1DPR A;  3LAP A;  3FWE A;  2L01 A;  3JTG A;  4MQ9 F;  1T39 A;  3QOP A;  3I58 A;  4L5I A;  1G4D A;  2EB7 A;  2CFX A;  1WSU A;  3GF2 A;  3REO A;  3P9K A;  2CYY A;  4HF2 A;  3WOD F;  3H3Z A;  1IRF A;  2PMH A;  4ENK A;  3KP6 A;  4KN4 X;  2DAO A;  4G7Z F;  3DKW A;  3QU6 A;  3L7W A;  3QRF F;  1W7P A;  3TO6 A;  1KU9 A;  3FMQ A;  4WWC A;  3M1E A;  2ESN A;  3WTX C;  2A07 F;  3JAM Z;  5JVT A;  3I5U A;  4RB0 A;  2J5O A;  2GIV A;  3VEP A;  2RC4 A;  4KIB A;  4HX7 A;  1KQ0 A;  2ZME A;  3O6B B;  1OYW A;  6PAX A;  2VT2 A;  4JBA A;  3DXJ F;  1YW8 A;  1FX7 A;  5J6X A;  5FLX K;  4PGG A;  2PLY A;  2PBI A;  3PQK A;  1S7O A;  1YFH A;  1IUY A;  1U5T B;  5BPI A;  5D4R A;  2A6H F;  3LA7 A;  2D1H A;  1U78 A;  2Z5U A;  4HX4 A;  2IA2 A;  1HKS A;  1S6L A;  1WKM A;  3LST A;  3KZY A;  1D3Y A;  2NNY A;  1CF7 A;  3E3V A;  4OIN F;  3ERE D;  2FBI A;  5E1X A;  2K27 A;  2GA1 A;  1DP7 P;  2ZNY A;  4LK0 F;  3ZMD A;  1J7K A;  4R79 A;  4EJT A;  4A2U A;  1BN5 A;  4HA8 A;  1UHM A;  1QZZ A;  1K79 A;  4D0P A;  1PP7 U;  2MBF A;  3HRU A;  2P5V A;  3ELK A;  4XLP F;  4UVB A;  3KP3 A;  4R1H A;  4BHP A;  1ZH5 A;  2V6C A;  5DCM A;  3BY6 A;  4RB1 A;  2PJP A;  2P5L C;  4ZYE A;  1I1S A;  4MEY F;  2HGC A;  3GXO A;  3WTS C;  2LF8 A;  1Y0U A;  2ZXJ A;  4MGR A;  1P4X A;  3R61 A;  1LVA A;  4M9X A;  2ESH A;  1LNW A;  2VBW A;  2X0L A;  2QBY A;  3TKY A;  1XMK A;  3QU3 A;  5J8F A;  3MQ0 A;  4Y15 A;  4N9H A;  3ZMS A;  2L3D A;  2ZO4 A;  3ECH A;  2W25 A;  4LMY A;  1ZAO A;  1B1B A;  3ZP5 A;  1ZHF A;  2FOK A;  3L00 A;  1FYK A;  2GZW A;  4L9N A;  2R7F A;  3U2R A;  1X3U A;  1S29 A;  2V1D A;  2EV5 A;  4KUM A;  4EJU A;  2R7D A;  2XKO A;  4ZYG A;  3CO7 C;  3CO6 C;  1Z7U A;  1JE8 A;  3T0Y A;  4GGG A;  1FY7 A;  2FNA A;  4G7O F;  3WGG A;  5DYM A;  2F5E A;  3J80 Z;  2JPC A;  3IHU A;  5CYV A;  3ZMV A;  2E1N A;  3GX4 X;  3LWF A;  4HZF A;  3T1B A;  1REP C;  3ABT A;  1SFX A;  3EYI A;  2GA2 A;  4K2E A;  2Y0M A;  4A0X A;  4AIJ A;  2LNB A;  1BI3 A;  1XGN A;  5ED4 A;  2G7H A;  2ACJ A;  5FD6 A;  4U88 A;  3CTA A;  4A5N A;  1YYV A;  5AIQ A;  1K7A A;  2RN7 A;  4I7H A;  4XSX F;  3GFI A;  1SFU A;  2OZU A;  4EGY A;  3F8M A;  1J5Y A;  3KCC A;  3U1D A;  1HBX G;  4L9J A;  1KU7 A;  1FYM A;  1JGS A;  1E17 A;  4BHB A;  2L54 A;  3JAM K;  2YX4 A;  4HQM A;  4JK1 X;  2R3S A;  2FNP A;  4UV9 A;  4A5M A;  1YS6 A;  1BI0 A;  1FT9 A;  3WE3 A;  3K1M A;  2K4B A;  1IXR C;  3GUD A;  3TO7 A;  1G6N A;  4A0Z A;  4LFU A;  4I98 B;  4Y17 A;  4S04 A;  3F72 A;  3CUQ A;  5JHU A;  3V7R A;  2XAH A;  3FX3 A;  3Q9V A;  3SXY A;  1BI1 A;  2DPD A;  4WCG A;  4UHT A;  4ESJ A;  5L3E A;  2EWN A;  4Z2Y A;  3ZMU A;  3R6S A;  1D5V A;  2RNJ A;  3QPH A;  1XDS A;  3BDD A;  3KLN A;  5BQT A;  3W6J B;  1O57 A;  2GWR A;  5J8C A;  3BJA A;  1K78 A;  4M9Z A;  3WTV C;  2K02 A;  4RAZ A;  3L09 A;  2DLL A;  2FEZ A;  1ZRE A;  2JSC A;  4UVC A;  4MEX F;  3BWG A;  3KP4 A;  1DUX C;  2Q8K A;  4EGZ A;  1QZY A;  2JZY A;  2STT A;  1BC7 C;  1ZLK A;  5HS9 A;  3C3W A;  3WU0 A;  4OIR F;  3BPV A;  1G3T A;  1J75 A;  1R1V A;  2BE5 F;  3ZMT A;  5CVV A;  2M45 A;  3SQN A;  4LD5 A;  2H6B A;  3J80 K;  1KYZ A;  4KA4 A;  1MJB A;  5ICE A;  3BPX A;  1BIA A;  5FFX A;  4GO1 A;  3J7A O;  2V1X A;  2H6C A;  5IT9 K;  1Z91 A;  1FP1 D;  1O3Q A;  5DCM B;  3QP5 A;  2HQR A;  2XVC A;  5CVI A;  1AWC A;  1QGP A;  2XKP A;  4LG0 B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...