3F8BA

Crystal structure of the multidrug binding transcriptional regulator lmrr in drug free state
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
105
structure length
101
Chain Sequence
PKEMLRAQTNVILLNVLKQGDNYVYGIIKQVKEASNGEMELNEATLYTIFKRLEKDGIISSYWGDGRRKYYRLTEIGHENMRLAFESWSRVDKIIENLEAN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of the transcriptional regulator LmrR and its mechanism of multidrug recognition.
pubmed doi rcsb
source organism Lactococcus lactis subsp. cremoris
molecule tags Transcription regulator
molecule keywords Transcriptional regulator, PadR-like family
total genus 37
structure length 101
sequence length 105
chains with identical sequence B
ec nomenclature
pdb deposition date 2008-11-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03551 PadR Transcriptional regulator PadR-like family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 3f8bA00
1UCRA 4YIIA 5D8KB 5LGTA 5LLQA 3CUQB 5CVJA 4QWQA 1O3QA 2WWYA 4OOIA 1KU3A 2FF4A 4ON0A 3TDZC 4HX7A 1S7AA 5BS6A 5IT9Z 2A68F 1XCBA 4LB5A 3E5XA 2COMA 4LLGF 2DQRA 2HGCA 3EETA 2ZNZA 2M45A 1WSUA 3KEQA 3CTAA 2IRFG 5FLXZ 2VT2A 3LA2A 5ICCA 5H6QA 2HWVA 2QZ8A 3LWFA 1G3SA 2GA2A 3WE2A 1LQ1A 1XN7A 4U0YA 4IF4A 4M6YA 4RB3C 5E17F 4YFNF 2FE3A 3KE2A 3JTHA 3TOBA 3DF8A 4M9SA 3IRQA 1WRJA 4OINF 2EJRA 2VE8A 3PQKA 2D1HA 4LGWA 2LKPA 3FMQA 3FMRA 2IPQX 1PDNC 4ENMA 1YO5C 4CXFA 2DLLA 2FXAA 1I6XA 1KU2A 2NAZA 2Z99A 3MEXA 1YW7A 1JHHA 3CO6C 3U9GA 4A12A 5DUIA 3K0LA 2DAOA 3LSTA 3MZHA 1FBSA 1RUOA 1FSEA 2RVCA 5L3GA 1T38A 4EVIA 3HRSA 2OA4A 4LFUA 3ABTA 3H92A 4HA8A 1LDKB 3F21A 3HTSB 3VODA 1W4MA 3IWFA 4Y13A 1IRFA 1W5TA 3KZYA 4HDUA 4BYYA 2KIMA 2A3SA 2FBIA 3C18A 5TJJA 4ENKA 2K86A 3QU6A 3KP4A 3L09A 2Z5UA 3JSPA 1JHFA 1U5TA 4UV9A 4HYEA 1IXSB 1GVJA 4MTEA 2E7XA 4HOBA 1HW1A 3I71A 4IRGA 1DDNA 4RGSA 4R8HA 5DDGA 3ERED 4PGHA 2PN6A 4I98B 4EM0B 2HEOA 2L01A 2QM3A 1U3EM 4K2EA 1W7PB 1O3TA 2FQ3A 2CSOA 2PG4A 4KIFA 4HF2A 2ADUA 3MQ0A 1C0WA 3FXUA 1Z05A 2VOPA 1NHAA 3GVAA 4OMZA 3E97A 2QENA 2OAZA 1UFMA 2DT5A 2ZKZA 1ODDA 1E17A 3ZMVA 4XBFA 3NEUA 1BI0A 1YG2A 3KCCA 4P55A 5FO5A 1Z7UA 3V4GA 1I1GA 4Q5SF 5DV5A 4BQAA 1P6RA 1ZGJA 1LEBA 4L0YB 3BWGA 3K1PA 2LSOA 3I54A 3U2RA 2ACJA 2BGCA 2PJPA 3WG9A 3K1MA 3M1EA 2KRFA 1OPCA 4IRHA 3V8JA 4FHTA 1U5TC 2Q0OA 3CO7C 1ZARA 4P5OA 3WE3A 1O7LA 4CDGA 1OYWA 2JT1A 2PBIA 3DEUA 2MLGA 1XGOA 4DNCA 1JGSA 3I59B 4I0AA 3BY6A 3WTUC 2GAUA 2JSCA 5IT9K 1XGMA 3DKWA 2GWRA 5EEHA 3ML6A 3R0JA 3F23A 1I1SA 3FM3A 3R0AA 5LHIA 4ZYEA 1TTYA 4KNYA 2Z3YA 4RAYA 3RKXA 2C6YA 1XB4A 4I0BA 3HSFA 2O0YA 4Q47A 3E6MA 1K78A 2UXNA 4E70A 4BHCA 2F5CA 1R22A 4P9FA 2VODA 2V9VA 1SAXA 4M9XA 1IXCA 4LB6B 1YLFA 2KKOA 1YW8A 3WGHA 4B8XA 2XGXA 3MFKA 4G7OF 5LRSA 2F5EA 2EFWA 4FT8A 3QOPA 3ZQ7A 3RKYA 1ZRFA 2W24A 2P5KA 3HRUA 4NHJA 1BIAA 2FMLA 2P5LC 5TRDA 1R1VA 3TQNA 1G6NA 3T1BA 1O3SA 4ENNA 2M87A 2W85A 5JHUA 2GQQA 3QAHA 4LMYA 1HBXG 3LAPA 1R5GA 3SHFA 4A0ZA 2O03A 1CF7B 2XAGA 5HVQC 2R3SA 3CUQA 3HOSA 3S2WA 2XRNA 4KMUX 1K6OA 5A2QZ 5LHGA 3BOQA 1XGSA 2IVMA 2HOEA 3BJOA 2UZKA 5D5UB 3PQJA 1LNWA 2K27A 3Q9VA 2PLYA 2Y48A 2OBPA 4RB1A 4KMFA 4EM1A 1L3LA 2P8TA 1Z1DA 3MCZA 2MH9A 2JZYA 1FP2A 4GO1A 3T0YA 2RKHA 4HQMA 1YW9A 2DPDA 2IP2A 2PFBA 1R5HA 3ZMUA 1E2XA 2B0LA 3ZP5A 4U0VA 3SXYA 4KIGA 2DI3A 2G9WA 3KP2A 2ZBKA 3M8FA 2HQNA 4NB5A 4Q4ZF 1DP7P 6PAXA 1OMIA 1J5YA 3TDUC 5L3DA 5D5XB 2CWEA 2Q2EA 5BPIA 1FYMA 1XDSA 1XSXA 2XKOA 2E1CA 1TQPA 1R1TA 3BJAA 2XAQA 2ZFWA 4L9JA 2MA3A 1B59A 4EM2A 4EQQA 2FU4A 1IAWA 1FLIA 3GZ5A 3JW4A 2QYOA 4EJUA 4HV6A 3V7SA 2F2EA 2EFQA 3WTVC 3IWZA 2HKOA 1ZLKA 2Z9OA 3VOEA 1G3YA 2J5OA 2IA1A 4OU0A 3W6KB 1XD7A 1IF1A 1ZRCA 4L9TA 2AXLA 2LF8A 2ZO4A 1IRGA 1QZZA 4LD5A 1X3UA 4ZYDA 3EYIA 2YU3A 1BBYA 2OD5A 2NRAC 4N0BA 4WCGA 2GIVA 3E3VA 1FSHA 4IVNA 4O5VA 2V79A 3HOTA 2A69F 2O3FA 2OQGA 1S6LA 3OOPA 1I27A 3BP8A 1FOKA 5FD5A 2XUBA 2FEZA 4LK1F 2O8XA 3G3ZA 5E8GA 3GFMA 1Z6TA 1ONVA 5L3EA 5AIQA 4F7ZA 1K79A 2PEXA 2VC0A 5KK1A 1ZLJA 3RKWA 4I2OA 3CDHA 3FMSA 1LDDA 3ECOA 4KA4A 5HLGA 1FC3A 2PI0A 1R23A 2E7WA 5DD8A 1USSA 1TW3A 3ABUA 4I02A 5HLHA 1FZPB 3SZTA 4CHUA 4KN4X 1GHCA 3CLOA 1MD0A 1FBQA 4WXDA 5FFZA 3RYRA 1REPC 5D6EA 1P92A 2CO5A 2DW4A 3ELKA 3FHZA 2H27A 1KQ0A 3LA3A 1YYVA 3CUQC 3E6BA 2OZUA 3ROUA 3O6BB 3GWZA 1B9MA 4O6JA 3J81Z 3IRRA 3KP6A 4UV8A 5F6FA 3GYHX 2IT0A 3T5XA 3TO6A 4GCVA 3ZPLA 1KU7A 2QQ9A 3B73A 4GXOA 5FGMA 5ED4A 1PP8F 2L4AA 1FT9A 2KJBA 5LRRA 5E20A 1IN5A 2ZCWA 4CYDA 3R4KA 2P7CB 2H94A 4KUMA 3SQNA 1RZ4A 3FX3A 3TKYA 2YSRA 2EB7A 4EGYA 5D4RA 1IN4A 1Z9CA 3WU0A 3I64A 2R7FA 3F6OA 4AIHA 2MD5A 3ZN0A 4MQVA 3BZ6A 4G6QA 1HSTA 5DCMA 3P7NA 2BV6A 3ZMSA 3LAJA 2Y0MA 2XV4S 2JTVA 3RPUA 2MLKA 4HW0A 4BNCA 2DTRA 3R60A 2EV6A 1ZAOA 3D0SA 1ZH5A 4AD9A 4HF1A 2RGVA 3LFKA 4OIOF 3KLOA 4XSZF 5CVRA 5D4SA 4ZZLA 5L3FA 4G8XA 4KT5C 3K1NA 3GFJA 2BBYA 2HYFA 3L9FA 4HLYA 2XHKA 4YG2F 1KYWA 2V1UA 4MEYF 1QQIA 2EFNA 2Q8KA 2FMYA 4N9HA 2ZMEB 4JK1X 2XIGA 1WQ2A 5ILSA 3O2PE 2BE5F 2M30A 3F72A 4OMYA 3F8NA 5HDNA 2FSWA 2G7UA 1L0OC 2RQPA 4G6DA 1MKMA 1W7PA 1K78B 3ZN1A 4L5IA 1P2FA 2CYYA 3E6DA 4OIRF 4ETSA 5JR3A 3HRMA 1U78A 1H9TA 2ESHA 4LG0A 5CVVA 4ASNA 1IN8A 2K02A 4G9YA 5H6RA 2W57A 1GXQA 4B09A 2HFHA 5ICFA 1IZ1A 5LGUA 4R1HA 4WXCA 3CJNA 1IN6A 2V1XA 3HHGA 5JVTA 3JTGA 2FA5A 3EYYA 5HLIA 4CGZA 4MEXF 3V7RA 3U1DA 1STZA 1EH7A 3J81K 1OYIA 3WODF 1LEAA 1WKMA 4NQWA 1GXPA 4Q48A 5AONA 3QPHA 5LGNA 1RUNA 2HKXA 2JPBA 4Z2YA 5HS7A 2CG4A 4EJWA 5E8IA 1O57A 3HSRA 3C3WA 4U7BA 3WTSC 5K5RA 4L5JA 2RC4A 2DPUA 1R36A 3KEOA 3HSEA 2VBYA 3GEZA 1FPQA 3L7WA 4D0PA 3I0TA 2NNNA 5IT3A 2L3DA 1J59A 3L00A 3V8KA 3Q9SA 3HYIA 2K7LA 3RTRA 1ZHFA 2RV8A 4LK0F 1FX7A 4QLCU 4UUVA 5FFXA 3FXRA 2A6EF 3IKVA 4IPAA 2OQRA 1OR7A 1WI9A 1EH8A 1Q1HA 4A2UA 1QGPA 1FBUA 2OU2A 4A0YA 2E1NA 3FXQA 2GA1A 1TBXA 2RDPA 2YR2A 4RB0A 3C1DA 3F8FA 2AS5F 4L0ZB 2GXGA 2IA2A 1XSDA 3QU3A 4KIBA 1TNTA 4M9ZA 4HDVA 1T0FA 3ZMZA 2O6GE 4A6EA 3DV8A 1SFUA 1V4RA 2PMUA 2TDXA 4M74A 4IHTA 3KP5A 5E1ZB 1KQ8A 4HZFA 3WTZA 3WTWC 4N9IA 5ERIA 2EFPA 3ULQB 5BQTA 2XKPA 3EUHA 3TO9A 1HSJA 1TNSA 3MWMA 1LJ9A 2IA0A 2CGPA 3COAC 3SFZA 1BJAA 2P6TA 5HS8A 3M8EA 1FWZA 1WWXA 3MAJA 4UVCA 4FX4A 3F22A 3T8RA 1V3FA 5K5QA 5KVRA 1W7PD 4CICA 3D5LA 2EFOA 1MJBA 5EEGA 3I5UA 4EJTA 2JRTA 4YFKF 4EJVA 2X4HA 5DCFA 2D2WA 2D45A 2R7DA 2MC3A 2EV5A 1D8KA 1G3WA 2GXBA 5L3BA 2DFIA 3K69A 1OYYA 4ESJA 4RAZA 5K1YA 2F5FA 1EH6A 2QQAA 4HLXA 5D8LB 1ON1A 1BC8C 2VOOA 2DO7A 3TGNA 4XLNF 1ZN2A 4JQFA 1MDMB 4XLPF 1IN7A 1P4XA 4KYWA 1YIOA 5JI6A 1AWCA 2V1DA 2Y75A 3W6JB 3RI4A 1USTA 2P4WA 4MQ9F 4ZYGA 3IL2A 3Q5FA 4LJZF 1XCVA 2CQKA 1KGSA 1QPMA 2DK8A 3P9IA 3GXOA 1J0RA 5E18F 1OKRA 3JAMZ 4L9VA 1MZBA 2XAJA 5ILVA 1H0MA 2STWA 2EWNA 1HW5A 1KYZA 3PFIA 3REOA 3QRFF 4I7HA 1FNNA 1BOAA 2L4MA 3GUDA 5CVUA 2K4JA 1UB9A 1ZGAA 3JSOA 4AWXB 3HIFA 4CO8A 1O3RA 1F4KA 5ILUA 1A04A 1YS7A 5E1WA 5ICEA 3IC7A 2CW0F 1SD7A 5F64A 3I58A 5CVIA 1Y0UA 3TOAA 4RGUA 1AOYA 2A61A 1IUYA 3QP6A 4UVBA 4FX0A 4ESBA 5DD4A 2QBYB 1FYLA 3RJPA 5FLXK 1Z91A 3H3ZA 4A5NA 3WTYC 1XMKA 5JFRA 5HDGA 1TLHB 5D5VB 4CZZA 1Z6RA 1B1BA 1JXSA 4RB2C 4EJOA 5HS9A 4A0XA 4GYGA 1D8JA 1J9IA 1XGNA 4RS8A 4R79A 5FB2A 1P4AA 4P9UA 3KP7A 2ZMEA 2VC1A 3E5UA 3RPQA 4ESFA 2EK5A 1HKTA 2HYGD 2VBZA 3WTTC 3KZZA 3BROA 2VONA 1XSVA 1QZYA 3HRTA 3K9TA 3T8TA 1FP1D 2EA4A 2XAFA 4UNOA 3J7AO 1BM9A 2YPRA 1F9NA 1HQCA 3N97A 2A07F 1BIBA 4KN7X 3I59A 4H0EA 3KP3A 4S04A 1R7JA 4WK8F 1ZRDA 4OIPF 1T2KA 3KFWX 4EGZA 2QLZA 5LEJA 4BXUA 1KU9A 3GFLA 1RIOH 5BMZA 1ZREA 5DEQA 2UWMA 4I09A 4WF2A 2G7HA 1T6SA 4S05A 4HBLA 1HW2A 4I01A 3JAMK 3NRVA 4Y17A 2WC2A 4EV0A 4MHGA 4IJAA 3I53A 4RGRA 4IXAA 3FWEA 2ZXJA 1SFXA 3GLXA 3ZMDA 2DBBA 5K5OA 1MJAA 1MJ9A 2DK5A 3DPLC 3GX4X 1T39A 1K7AA 3E5QA 3N4MA 1ZG5A 2KIUA 4Y15A 2IW5A 2HR3A 3V7CA 1G3TA 1LB2A 3NQOA 2HDCA 1ULYA 1SD6A 2UXXA 2FBKA 3V8LA 2WTEA 3WTXC 4G94A 4PCQA 4RGXA 2FOKA 2QUFA 1QO0D 2FNPA 1TQMA 1J7KA 1YQAA 3I4PA 4ZYHA 2RNJA 4A5MA 2H6CA 1F5TA 4DQ2A 1YFHA 1D3YA 4UXNA 2MBFA 3DXJF 3F8CA 2ISYA 4M73A 1QNTA 1DPRA 3FZVA 1UHMA 3J80K 2STTA 4U7DA 1HKSA 1LDJA 2DQLA 2EA2A 1TQIA 4AIJA 1BI1A 3VFZA 1MDMA 1U8RA 4BAYA 1SMYF 2VE9A 3HTUA 2LF7A 5H20A 4GYIA 2A5YB 1IXRC 3DPTA 4HX8A 3ECHA 5DCMB 3BPVA 2L54A 1ZYRF 1PUEE 3MZYA 4U0WA 4MTDA 3O3KA 3P9CA 4HV5A 4M72A 4KFCA 5J8FA 4ENJA 3L2CA 4L18B 2FBHA 4IRIA 3F3XA 1KQ9A 1BC7C 1U6GA 1J2XA 2F5DA 3QP5A 4MGRA 1VTNC 1FYKA 5LBQA 4HAMA 2K4BA 2YX7A 1J75A 2M1BA 4YIFA 2M5WA 1W5SA 1YS6A 1U5TB 4XSXF 2Z33A 3F8MA 2QVOA 2P5VA 3AAFA 3HHHA 5DUKA 3R6SA 3WGGA 2VBXA 1BN5A 1SD4A 2IJLA 3IHUA 4JBAA 4WXHA 1CGPA 1S29A 5ICGA 3E6CC 1RNLA 1ON2A 2XAHA 4M71A 3GFIA 2HTJA 2W25A 4HF0A 3P9KA 2HQRA 2VT3A 3SZPA 2P6SA 3ISPA 1BI2A 3M9AA 4G7ZF 2P7VB 4MNUA 3BJ6A 3FM5A 3B02A 1ZG3A 2VXZA 3LA7A 1R58A 2BYVE 2PQ8A 2XVCA 3F8BA 4IHSA 4PZJA 3GO5A 4EMSA 3HUGA 3BDDA 4LG0B 3FF5A 5DYMA 1S8NA 4HX4A 4UVAA 1XDUA 1XMAA 3DQVC 5D5WB 3WU1B 2JPCA 2D1VA 1T98A 3IKTA 1YTYA 4HQEA 1RI7A 5HOOA 1G4DA 4O3MA 1LVAA 4ZZDA 5L3CA 1QBJA 1R00A 2ZNYA 4G7HF 1SFEA 3VB2A 2ELHA 2WV0A 2J5PA 1UHWA 3GZ6A 2XASA 3EDPA 4AIKA 2YX4A 2XROA 1PP7U 2QWWA 3RDIA 3J80Z 2HTSA 2LDUA 2H6BA 2CFXA 4XRFA 4U88A 2ZJ2A 5CYVA 3TO7A 3WGIA 2V6CA 1MGTA 5LHHA 2ISZA 3VEPA 1IW7F 4AVPA 2NNYA 5F1RA 1KA8A 4M6XA 1H9GA 4L9NA 1DUXC 2ETHA 2W84A 3GF2A 2VBWA 4LLNA 1CF7A 2KIFA 2VN2A 4WWCA 4KDPA 1BI3A 1SD5A 2MH2A 3F6VA 4TV7A 5D6FA 3LQQA 2HS5A 3DP7A 1I5ZA 3H3UA 1JE8A 3EQLF 2OZ6A 2FRHA 3G73A 3M7GA 2L02A 4WX9A 3R61A 2HZTA 1ZG1A 4YFXF 1P4WA 5J8CA 5BOXA 3GW2A 2BEOA 4PGGA 1FY7A 2EV0A 3LQRA 1B9NA 2FNAA 2PMHA 2QQBA 3C7JA 4GGGA 4UHTA 5AIPA 5J6XA 4OIQF 4A6DA 5A2QK 2A6HF 5HDKA 1D5VA 3K2ZA 1R1UA 5E1XA 1O7FA 4LLLA 2O61A 5CLSA 2KJCA 3ZMTA 2LNBA 3CUOA 3RYPA 2DU9A 3KLNA 4ZH4F 1TW2A 1SMTA 5LEKA 3QPTA 5CJ9A 3BPXA 5FD6A 4BHBA 2GZWA 1EV7A 1DPUA 4BHPA 2QBYA 1B4AA 2M8EA 1U2WA 2NS0A 5BPDA 3RIRA 2ESNA 1HXDA 4PDKA 1B6AA 1HKQA 3OV8A 2NYXA 4BH9A 4P96A 3KETA 1S3JA 2H09A 1F1ZA 1S7OA 2X0LA 3DFGA 2RN7A 4KICA
chains in the Genus database with same CATH superfamily
1ORKA 1UCRA 4YIIA 2DA6A 4XLEA 5D8KB 3OMYA 5LGTA 5LLQA 3CUQB 5CVJA 4QWQA 2HZDA 1E3HA 3DTKA 4LITA 2DA2A 1DQUA 4OOIA 2WWYA 1O3QA 4PUSA 1KU3A 1QPIA 2DOFA 2FF4A 1I6HJ 4CH7A 3MZ8A 3SDGA 2VI6A 3OWTA 5GPAA 2VUMJ 4ON0A 1SC7A 3OSGA 3TDZC 2LFBA 4HX7A 4M6VA 4E7LA 1S7AA 2F6CA 3J7YJ 1UAAA 5BS6A 4RA2A 5IT9Z 2DOAA 1LFPA 2A68F 3OYGA 3K4KA 1XCBA 2HVRA 4ZYAA 4XONA 2NXNB 4LB5A 3E5XA 5CKTA 1MMSA 2COMA 2H8WA 4LLGF 2DQRA 2HGCA 3EETA 2CJJA 2M8GX 2ZNZA 3OIOA 1PUFA 2M45A 1WSUA 3KEQA 3CTAA 2EH3A 2IRFG 5FLXZ 1IC8A 2LD5A 2VT2A 3LA2A 5ICCA 5H6QA 2HWVA 4FQGA 2KMUA 2QZ8A 4A69C 4OAYA 3SDBA 3LSPA 4EEFG 2RNGA 2E35A 1SVOA 3IP4B 3LWFA 3A01B 1G3SA 2DA1A 2GA2A 4KISA 3V42A 3WE2A 1LQ1A 3H9JA 1XN7A 4Y4RA 2XSJC 3K7AJ 5M3MJ 5TGTA 3VSKA 4U0YA 4IF4A 4M6YA 2XRLA 4PK4A 4RB3C 5E17F 1QZEA 4YFNF 2O8KA 3L1PA 2FE3A 3KE2A 2CV0A 5HODA 1X4PA 3PNYA 1OCCH 3OYKA 1W0UA 2LREA 5HLTA 3JTHA 3TOBA 3DF8A 4YELA 4M9SA 2W82A 1MBKA 4YEJA 3IRQA 3H0DA 3SJMA 1WRJA 4OINF 2EJRA 2M34A 2VE8A 2DODA 3PQKA 2D1HA 2AQEA 1ETKA 3OYCA 4LGWA 2LKPA 3FMQA 1T8IA 3FMRA 2IGOA 2IPQX 1PDNC 3ZGKA 3OYBA 4ENMA 1YO5C 3OL4A 2X1DA 3ZQIA 4CXFA 2DLLA 2FXAA 2VPRA 4NC8A 1I6XA 5K7HA 2VKEA 1KU2A 2NAZA 2Z99A 2DOEA 3MEXA 1YW7A 1MBEA 1JHHA 4KJZA 4MFEA 1XG1A 2X6YA 3CO6C 3U9GA 2QSGX 4CCOA 2MSYA 3PIOF 4A12A 5DUIA 3K0LA 2DAOA 3LSTA 3MZHA 4G6TB 1FBSA 1RUOA 1FSEA 2RVCA 4D5FA 2IEKA 2BY1A 5L3GA 1T38A 4EVIA 5KNLA 2OPTA 3HRSA 2R7UA 2VIXA 2EZKA 2OA4A 2ZSHB 4LFUA 3ABTA 4RLFA 3HOVJ 4BACA 2YS9A 3H92A 4HA8A 1LDKB 3F21A 3HTSB 2LTPA 4BXXJ 3VODA 2JA8J 1W4MA 3IWFA 1U9OA 4Y13A 1IRFA 1W5TA 3KZYA 4HDUA 5EG0A 3OYNA 3NAUA 4BYYA 3H0GJ 5GP9A 4X6AJ 2KIMA 3S1MJ 2A3SA 4C2MJ 2FBIA 4Y3OA 2ECCA 1VQLI 3H5NA 3C18A 5TJJA 3LOCA 3OIPA 2X9DA 4ENKA 2K86A 3QU6A 3KP4A 2LOOA 3GBGA 1IO2A 3L09A 4D5CA 4D1QA 2Z5UA 3JSPA 1VQPI 2KT0A 1JHFA 3TBIA 1YJWI 2VQHA 1U5TA 1BOBA 4UV9A 2ZB9A 4HYEA 1IXSB 4HSTA 2EIKH 1GVJA 2QKMB 4EATA 4MTEA 2E7XA 4HOBA 2EBIA 1HW1A 1R4NB 3I71A 4IRGA 1DDNA 4RGSA 4R8HA 3ZQCA 3AKZA 5DDGA 1S5LC 1KZHA 3ERED 2XGDA 4PGHA 2M7AA 3HKZA 5F0CA 2EQRA 2PN6A 4I98B 4EM0B 2HEOA 2D5VA 2L01A 2QM3A 3E0JB 4V2GA 2BZTA 2CS3A 3AG1H 1U3EM 2FJ1A 3GTMJ 4IOAF 4K2EA 1R6RA 1W7PB 1WJDA 1VQKI 3HOZJ 1D0XA 1RR8C 1O3TA 2FQ3A 1RKTA 2CSOA 1DGRM 3HBLA 1ETVA 3U1KA 2PG4A 4KIFA 4HF2A 3E7LA 3BCAA 4PSWA 5BNGA 1D5YA 1DGWY 2PJRA 2OC6A 1BR2A 2F4OB 1NH3A 1EKEA 2ADUA 3MQ0A 1C0WA 3JRGA 1W0TA 3FXUA 1Z05A 2VOPA 1NHAA 3GVAA 4OMZA 1ETYA 3E97A 1SFOJ 2QENA 4XMYA 3LSIA 2OAZA 1UFMA 2DT5A 1VNDA 2ZKZA 1UZCA 1BR1A 2M9HA 1X1BA 1ODDA 2HPMA 3CDIA 1E17A 2K85A 2WBMA 3ZMVA 4XBFA 3S1QJ 3NEUA 4B43A 4DJAA 1BI0A 3ASNH 4AU7A 3L2WA 1YG2A 3KCCA 4P55A 3BG5A 5FO5A 4QTRA 5EF6A 4E7KA 3GTOJ 2WY8Q 1Z7UA 3V4GA 4AVZA 3H1CA 3VYRB 2HXIA 1I1GA 2DA5A 4A3EJ 4Q5SF 1MMNA 2X1CA 5DV5A 4BQAA 1P6RA 3G2BA 4JX5A 1ZGJA 2XGEA 1LEBA 2LK2A 4L0YB 3BWGA 3K1PA 2LSOA 3I54A 1OISA 3U2RA 2ACJA 2BVMA 2F48A 2BGCA 2PJPA 2EIJH 3ZQGA 3WG9A 3K1MA 3M1EA 2KRFA 3S17J 1JUPA 1OPCA 1TWAJ 3ZQLA 4IRHA 3V8JA 4FHTA 1U5TC 2L7MP 2Q0OA 4II2A 2IS2A 3CO7C 1ZARA 4P5OA 3WE3A 4IO9F 1O7LA 1FTTA 4CDGA 1OYWA 2JT1A 2PBIA 2CU7A 3DEUA 2MLGA 4F92B 3H3VK 2ID3A 1XGOA 2Y31A 4DNCA 1JGSA 3BTLA 3LSKA 1W36D 3I59B 4I0AA 2BY2A 3BY6A 1BR4A 3WTUC 4BE2A 3ZR8X 3ZOBA 2GAUA 2JSCA 3FK7A 3HPGA 2Z2SB 1AU7A 1TT0A 5B1AH 2K3FA 3M1CA 5IT9K 1XGMA 3DKWA 2GWRA 2VJ4A 1LE8B 1UHSA 2FQ4A 5EEHA 3JRBA 5H2FC 1OCZH 4KITB 1Y6IA 5FKOA 1T56A 3A4CA 1T95A 4BBSJ 3ML6A 1LVKA 1D0YA 3OYDA 3MKZA 3R0JA 3F23A 3BCBA 2R5YB 5DS9A 1I1SA 1X2MA 4P1WA 3FM3A 3R0AA 1SVMA 5LHIA 4ZYEA 1TTYA 2ZXIA 4HEA2 3S1RJ 4KNYA 2Z3YA 4I99C 4RAYA 2LKSA 3RKXA 1LE8A 2K9LA 2C6YA 1XB4A 1E3PA 4NC6A 4I0BA 3HSFA 2DYSH 2LY2A 2O0YA 4Q47A 3E6MA 2XB5A 4E6KG 1K78A 2UXNA 4E70A 4BHCA 4A3IJ 2F5CA 1R22A 4P9FA 1OR7C 2VODA 4ITVA 2JQ7A 5IP7J 2MGQA 3DPUA 3SEQA 3UNGC 4IZZA 4PJ0C 2R7QA 4C9YA 2V9VA 3HOXJ 1VQ6I 1SAXA 4M9XA 1NG6A 4E7HA 2DN0A 1HCRA 1IXCA 3BG7A 4BEHB 1FOWA 4LB6B 1YLFA 2KKOA 2HI3A 2BHYA 3LFUA 1E3OC 1YW8A 3WGHA 4B8XA 2XGXA 4F3QA 3MFKA 4RDUA 3HUGB 4G7OF 1QVTA 5LRSA 2F5EA 3BTIA 2EFWA 1D1AA 2N8GA 1VQNI 2ELKA 4FT8A 2ZJQF 5IPAA 1OFCX 3OYAA 3OYFA 3QOPA 3AL0B 4UB8C 2LVSA 3ZQ7A 4E7IA 4XLAA 3RKYA 1D1CA 3GLLA 2DYRH 1ZRFA 2W24A 2P5KA 1VI0A 4LIUA 3OY9A 2Y0SA 3HRUA 4NHJA 1BIAA 2FMLA 2P5LC 4FETA 5TRDA 2CUFA 1R1VA 2CRGA 3C2HA 4FE7A 2LY9A 2BOLA 3TQNA 1G6NA 1GLNA 3T1BA 4A3FJ 1O3SA 2IS4A 2Y2ZA 1R5ID 4ENNA 1RESA 2DFFA 2M87A 1HF0A 2W85A 2OTLI 5JHUA 2PMZA 4ZTFA 4M3EA 5M5XJ 3CC7I 2GQQA 3QAHA 4LMYA 1MIJA 1HBXG 2BW3A 1R5GA 3LAPA 2E1MC 3SHFA 1XC5A 2KPMA 1YJ9I 4A0ZA 5IOZA 9ANTA 3MD2A 1ACIA 2O03A 2MABA 1YX5A 1JUMA 1B72B 1CF7B 3VYTB 2JUGA 3K10A 2XAGA 5HVQC 2R3SA 3CUQA 2CV2A 3HOSA 3S2WA 2L9RA 2XRNA 4KMUX 1K6OA 5A2QZ 1Y1WJ 5LHGA 2LH9A 3AG3H 3BOQA 1XGSA 1YIJI 3FBIB 3S2HJ 3HC7A 4FE4A 1FMVA 2NOJB 5HNHA 1B8IA 3KPHA 2IVMA 2JWTA 2HOEA 3BJOA 2Y30A 2UZKA 5D5UB 3PQJA 3DWLE 4ANJA 2H1LA 1LNWA 1U9NA 2K27A 3Q9VA 2PLYA 2DMTA 3CC2I 1Y1VJ 2R92J 1A31A 2Y48A 1N77A 2H8RA 2QQ8A 3W6VA 1PJRA 2OBPA 2WAEA 4RB1A 4KMFA 4EM1A 4F55A 1L3LA 2P8TA 3LNQA 1Z1DA 3MCZA 2MH9A 2BXYA 1ENHA 2JZYA 2A6TA 1FP2A 4GO1A 3T0YA 2RKHA 4HQMA 1IUFA 1YW9A 2DPDA 2ZFUA 1X1PA 2BY3A 2IP2A 3A0BC 2PFBA 1R5HA 1QRYA 3ZMUA 1E2XA 1Y8QB 2XDVA 2B0LA 3ZP5A 1S72I 1WCMJ 4U0VA 3S93A 3SXYA 3H5RA 2HQAA 1ITYA 4BGDA 4KIGA 1ZKGA 2DI3A 2G9WA 4UB6C 3HL2A 3KP2A 4LG3A 5E3LA 5IOYA 2ZBKA 3M8FA 1SFKA 2HQNA 4NB5A 1A35A 4Q4ZF 1DP7P 2IGKA 4Y33A 6PAXA 3D1NI 2ZC2A 1MH4A 2QGUA 1OMIA 1J5YA 3TDUC 1UMQA 3PSFA 3JRAA 5L3DA 5D5XB 4CA0A 1IDZA 1LUJB 1R4MB 4E7SA 2CWEA 2Q2EA 5BPIA 4PJJA 2NVXJ 2HOTA 1FYMA 1XDSA 1XSXA 2XKOA 2ICWG 2E1CA 2Z1DA 1TQPA 1R1TA 3BJAA 2XAQA 2R93J 2ZFWA 4ZDPA 4BUPA 4L9JA 3P5JA 2MA3A 1WJBA 2EZIA 1B59A 4EM2A 4C2UA 4FCYA 3I56I 4CCMA 4EQQA 2FU4A 3AL0C 1IAWA 3S16J 1FLIA 3GZ5A 3JW4A 3DTIA 3G71I 1P9QC 2QYOA 4EJUA 3OS1A 4HV6A 5GAGJ 2M0CA 4FTHA 2KISA 3V7SA 2F2EA 1JTXA 2EFQA 3IWZA 3WTVC 2LRDA 2HKOA 1RR7A 5CPRB 1ZLKA 2Z9OA 1EF4A 4CCNA 2JN6A 3FBNB 4FASD 3DLLF 3VOEA 4IOCF 1G3YA 2J5OA 4BBRJ 2IA1A 4OU0A 2CW7A 3W6KB 1Z3YA 1XD7A 5B66C 2EPFA 2KZVA 1JUSA 4XOTA 3GTKJ 1IF1A 1ZRCA 3OR2C 3SEZA 4L9TA 2KZGA 2VLAA 2AXLA 1K6YA 2KIQA 4RM3A 2LF8A 2ZO4A 1IRGA 1QZZA 3MKYB 4LD5A 1X3UA 2IGMA 4ZYDA 1I3AA 1A6QA 2YUSA 5J1UA 3EYIA 2YU3A 1BBYA 2OD5A 4ZDOA 2NRAC 1MBJA 4LIVA 4N0BA 4WCGA 1OJLA 2GM4A 2GIVA 3E3VA 4N4NB 3CMEI 1FSHA 4IVNA 4O5VA 2Y9YA 2NVUB 2V79A 3M3YJ 4DZJA 3VYUB 4MIMA 1LKXA 3BTCA 3HOTA 1IG7A 2B63J 5J47A 3CCYA 1SAUA 4J00A 2NOGA 2A69F 2O3FA 2OQGA 2JK3A 1S6LA 4DW6A 3OOPA 1I27A 4A93J 3BP8A 1FOKA 5FD5A 2XUBA 2FEZA 4LK1F 2O8XA 3G3ZA 3DBRB 5E8GA 3GFMA 1Z6TA 3LSRA 1ONVA 3BG3A 5L3EA 5EGOB 5AIQA 4F7ZA 1K79A 1V5FA 4JP0A 4XLCA 4X1EA 3BC8A 2PEXA 1N75A 2EZHA 2VC0A 1V55H 2R7RA 5EZHA 3DLAA 5KK1A 1ZLJA 3WG7H 3RKWA 3CCUI 4I2OA 4BL0B 3CDHA 1YE9A 3FMSA 2ZXHA 2JVGA 4XIDA 5EG0B 1LDDA 4PJLA 5EEAA 3ECOA 4AYBN 2K9SA 4KA4A 1W36C 1WVRA 5HLGA 1T33A 2W7NA 2DMPA 3K70C 1FC3A 2M3AA 4A3GJ 2RQQA 2PI0A 1R23A 3S3NA 2E7WA 1MMGA 3A1YA 3BG6A 5DD8A 5IY5H 3H9QA 1SEUA 1USSA 1TW3A 3ABUA 4I02A 3I4NJ 5HLHA 1APLC 1FZPB 1T08B 3SZTA 2LYCA 2GLOA 4CHUA 4KN4X 1GHCA 2KDZA 3CLOA 3FXJA 1MD0A 3L2QA 2GIZA 1FBQA 4WXDA 4M3DA 5FFZA 3RYRA 1ETWA 4HNVA 3W2AA 3G1OA 2TRTA 4HNTA 1REPC 5D6EA 1A36A 2X85A 5M3FJ 1P92A 2CMPA 3PUBA 2CO5A 2DW4A 3ABKH 3FIWA 3CC4I 1JKQC 3AG4H 3ELKA 3FHZA 2DT6A 2H27A 1KQ0A 1JKPC 3LA3A 1YYVA 3CUQC 3E6BA 3QOEA 2OZUA 1G2HA 3ROUA 3K4BA 1SANA 5J3LA 3O6BB 2I8DA 2XPWA 4A3CJ 3GWZA 3SZGA 3ZQFA 4XNFA 3G6EI 1VQMI 1B9MA 2QKLB 4O6JA 5EGOA 1X4OA 3J81Z 3IRRA 3ZRGA 3KP6A 3RCOA 2R7XA 4UV8A 4ZDLA 5F6FA 1YJNI 3GYHX 2HXOA 3BR6A 3T5XA 2LR8A 2IT0A 4GDFA 2DFEA 5CQEA 4RAGA 3S2DJ 2HOAA 3TO6A 4GCVA 3ZPLA 2M4KA 1KU7A 1VQ5I 3GTGJ 1Q1VA 2QQ9A 3B73A 4GXOA 2VJJA 5FGMA 4BJTA 5ED4A 1PP8F 2L4AA 4D7MA 1FT9A 1Z67A 3GMEA 2KJBA 5LRRA 5E20A 3KIOA 1IN5A 2K9NA 5J1RA 2ZCWA 1FOXA 1U0JA 4CYDA 3R4KA 2X6OA 2P7CB 3FXMA 2ZJPF 2H94A 4KUMA 2DDBA 2OF7A 1RZ4A 2GOXB 3SQNA 3FX3A 3TKYA 5E3MA 3OYIA 2MG4A 2YSRA 2EB7A 4ABZA 4BXFA 4EGYA 1Z0XA 3KEYA 5D4RA 5E3OA 1IN4A 1Z9CA 2EILH 3BR2A 3JR9A 3PFYA 3WU0A 5F1JA 3I64A 2NVTJ 1R9TJ 2R7FA 2P0WA 3F6OA 4AIHA 4BU2A 1GT0C 1B72A 2MD5A 3ZN0A 3AG2H 4MQVA 3BZ6A 4UY8I 4G6QA 1HSTA 3HXLA 5DCMA 3P7NA 1NTCA 2BV6A 3ZMSA 3LAJA 5FRMA 1QHGA 2Y0MA 1YRNA 2XV4S 2JTVA 2BW3B 4A3JJ 2WAQN 3RPUA 3CCMI 4MO7A 2MLKA 4HW0A 4BNCA 2DTRA 3R60A 4AM3A 2DT7B 2ME6A 4AIDA 2E2JJ 3S15J 2EV6A 2AHQA 1ZAOA 4QPQA 3D0SA 3H35A 1ZH5A 2FD5A 4AD9A 4LOCA 1BA5A 4HF1A 1CQTA 2RGVA 2VXDA 3LFKA 4OIOF 3M07A 3KLOA 5KAIC 4XSZF 5CVRA 5D4SA 1WFXA 4ZZLA 5L3FA 4G8XA 4KT5C 3K1NA 3GFJA 3I4MJ 2BBYA 1EA3A 1WJ5A 2HYFA 3F9KA 5TISC 4BY1J 2HOSA 4CCLA 2R4GA 3K4JA 3L9FA 1JKRC 4HLYA 2XHKA 4YG2F 1O4XA 1KYWA 2COBA 2V1UA 4MEYF 1QQIA 4A3LJ 1K61A 2EFNA 2Q8KA 2FMYA 4N9HA 2KRHA 2ZMEB 3L2UA 4RM2A 2L7KA 4JK1X 2XIGA 1IRXA 1WQ2A 5ILSA 3O2PE 2BE5F 2CUZA 2KFDA 4N4OB 4CUGA 1F43A 2M30A 3F72A 1G59A 4GRIA 3E1SA 4OMYA 4NQWB 3F8NA 1NK2P 5HDNA 2LKXA 2FSWA 2G7UA 1L0OC 2PX9A 2RQPA 2B9SA 2E19A 1BW5A 1WPKA 1MNMC 2R7OA 3IUOA 3ONQA 4QPOA 4G6DA 1MKMA 1W7PA 4W1UA 3QWLA 3HOYJ 1K78B 3ZN1A 4L5IA 3S8PA 1P2FA 2CYYA 3E6DA 3DU5A 2XF5A 3Q0WA 4OIRF 3PSIA 4ETSA 5JR3A 3HRMA 3RQIA 1U78A 1H9TA 1VQ9I 1N25A 2IAIA 2K40A 2ESHA 4LG0A 2VQCA 5IYBJ 2W00A 3PL8A 5CVVA 4ASNA 2R5YA 1ZR2A 1IN8A 2K02A 4XORA 4G9YA 3CESA 5H6RA 2W57A 4BKXA 1GVDA 2O5RA 3K2AA 1GXQA 4B09A 1QHHD 1WHUA 2VJIA 1MH3A 4CCKA 2BXZA 3VWBA 2HFHA 2V1NA 5ICFA 1IZ1A 1W5CC 2QF7A 5LGUA 1X3ZB 1ZELA 4R1HA 2KRCA 3ABMH 4WXCA 1OLTA 3CJNA 4BQNA 1IN6A 2V1XA 2VB6A 3HHGA 4M3GA 5JVTA 3JTGA 2FA5A 4IX7A 1JJ6C 3EYYA 5HLIA 3EUKL 4CGZA 4MEXF 3V7RA 3DKXA 2VKHA 2F5VA 3U1DA 2LP0A 1I50J 1STZA 1LFBA 1Y0NA 1EH7A 3J81K 1OYIA 1H8AC 3WODF 1LEAA 1WKMA 4NQWA 5DM7F 1TZLA 1GXPA 2VPLA 1LPQA 1OCRH 4Q48A 1JJ8C 2EZLA 5AONA 3QPHA 5LGNA 5CQGA 2HKXA 1RUNA 4HSRA 1HDPA 2JPBA 2MYSA 3BQYA 1AHDP 5C4XJ 4XKCA 5K7ZA 4Z2YA 4DYQA 5HS7A 3CCRI 2LC2A 1AKHB 2CG4A 3CQZJ 4C3IJ 4EJWA 2LY1A 5E8IA 1O57A 3HSRA 3C3WA 4U7BA 4ZTJA 3WTSC 1ZGWA 5K5RA 2L9VA 2RAEA 4L5JA 4M3BA 2RC4A 2DDAA 1R36A 3KEOA 3HSEA 2DPUA 2VBYA 4V2FA 2VKVA 1X1DA 3GEZA 1FPQA 3L7WA 4D0PA 3I0TA 2NNNA 5IT3A 1ETQA 2MC4A 5FLMJ 2L3DA 1GV5A 1MMAA 3L00A 1J59A 2E36A 3V8KA 2WB1A 3Q9SA 2Y69H 5E3NA 5IP6A 3HYIA 2K7LA 1FTZA 3BLYA 3UKGA 3JREA 3RTRA 3HJEA 2QA4I 4OAZA 1ZHFA 2RV8A 4C3JJ 4LK0F 1FX7A 4QLCU 4UUVA 1MNEA 5FFXA 3FXRA 2A6EF 3IKVA 4IPAA 3GTJJ 1X19A 2OQRA 2BHZA 4BEHA 2KQRA 1WI3A 3PM1A 1OR7A 1WI9A 3O8HA 1EH8A 2R7VA 1Q1HA 4A2UA 2XF6A 4DBQA 2Z16A 3RSNA 1HA8A 4AUXA 2X1EA 2KP6A 1QGPA 5FKNA 4QIWN 1FBUA 3X2QH 3VSLA 3QPSA 3CCQI 2JUCA 3HB9A 1X2NA 2OU2A 4A0YA 2E1NA 3FXQA 2GA1A 1TBXA 2HQ5A 2RDPA 2YR2A 5JLWA 2JA6J 3FXOA 4BDYA 3S14J 1ETXA 3WHBA 4RB0A 5DM6F 3C1DA 3F8FA 2AS5F 1FIPA 3QYFA 4L0ZB 2GXGA 2IA2A 1XSDA 3QU3A 3QYBA 2M0MA 1UELB 4KIBA 2AQFA 1RETA 1TNTA 4M9ZA 4AYBA 3OS0A 4HDVA 2QCOA 3HOUJ 1T0FA 4IL6C 3ZMZA 2O6GE 4A6EA 5F08A 3FISA 3DV8A 3FHNA 2YU9J 4NC7A 4PJMA 2E34A 1SFUA 4GFBA 1V4RA 2PMUA 2TDXA 1YI2I 3CJQB 4D9JA 3A03A 4M74A 4IHTA 3KP5A 2DJNA 5E1ZB 1HDDC 3MKWB 5IYDJ 1ERDA 2UV1A 4UUSB 2CUJA 3IH4A 2E5NA 3A0HC 3FXLA 4HZFA 3WTZA 4V19K 2WADA 1KQ8A 3CP8A 3WTWC 4N9IA 5ERIA 2EFPA 3ULQB 5BQTA 2XSDC 2XKPA 3EUHA 3TO9A 2LMDA 4DZPA 1R71A 1Z3XA 3JRDA 1HSJA 1TNSA 3CCSI 4OWRB 4IQ4A 3MWMA 3OOUA 2JJ7A 2MW8A 1DU0A 1UG2A 1R49A 1LJ9A 2IA0A 5F0HA 2R7WA 4BE0A 1NK3P 2CGPA 1ZTRA 4XICA 2O9LA 4UUSA 2Q1ZB 2L7ZA 2CFOA 3COAC 3SFZA 1BJAA 3IH3A 2P6TA 3CP2A 5HS8A 3M8EA 1FWZA 1WWXA 1PYVA 3MAJA 4UVCA 1MNDA 1X1CA 3NWTA 3CCEI 2X51A 1I39A 4IKFA 1WJFA 4A3KJ 1LFUP 3BR0A 2ECBA 4FX4A 1F36A 3F22A 3VPRA 4XOPA 3SFIA 3T8RA 1V3FA 1X3WB 1E0EA 4BJ6C 1V54H 5KVRA 1W7PD 5K5QA 3D5RC 4CICA 3D5LA 2EFOA 1MJBA 1WJEA 5EEGA 3W2VA 1Z77A 3I5UA 2RREA 4EJTA 2JRTA 4YFKF 1ETOA 3EUHC 3PNTA 4L5EA 4YIRX 2DCEA 4EJVA 2X4HA 5DCFA 2D2WA 3OR1C 2D45A 2R7DA 1MBGA 2MC3A 2EV5A 1D8KA 1HOMA 1G3WA 2GXBA 5L3BA 2DFIA 3K69A 1OYYA 4ESJA 2M2EA 1P7IA 4RAZA 5K1YA 2F5FA 2JA7J 1EH6A 2QQAA 4HLXA 5J1YA 2HNHA 3U21A 3K4CA 5D8LB 2PJRB 3CF2A 1ON1A 1BC8C 4XN0A 2VOOA 2DO7A 3TGNA 1TWGJ 4DYCA 2R7SA 4XLNF 1ZN2A 4JQFA 4DIQA 1MDMB 4XLPF 1IN7A 2XPVA 5JLXA 1P4XA 1YIOA 5JI6A 1AWCA 1TC3C 4KYWA 2V1DA 2Y75A 3W6JB 3RI4A 4CYCA 1S9HA 1USTA 2GOMA 2P4WA 4MQ9F 4ZYGA 3IL2A 3Q5FA 2KDOA 4LJZF 2CQNA 5B3SH 1XCVA 2CQKA 2DA4A 2JA5J 1KGSA 1QPMA 5HNFA 2DK8A 2OJED 1N78A 2GXAA 2DXIA 3P9IA 3GXOA 1J0RA 5FKMA 1XTAA 3FKIJ 2DJIA 5E18F 3DBHB 1OKRA 5KCMA 1H89C 3JAMZ 4NBQA 4L9VA 1MZBA 2EIMH 2XAJA 5ILVA 1H0MA 2STWA 2EWNA 5M5WJ 3BZCA 2VKDA 1HW5A 3GCMA 1KYZA 3PFIA 3CCJI 3REOA 5FJ8J 4XKWA 3CF5F 3QRFF 4I7HA 2VJ5A 3HG9A 2EINH 1FNNA 2CUEA 2P81A 1J09A 2UUZA 1BOAA 2L4MA 3GUDA 4RMNA 5CVUA 2K4JA 1QA6A 3TP0A 1UB9A 3GTQJ 3OYHA 1ZR4A 1ZGAA 3JSOA 5C44J 1UJ8A 4AWXB 3HIFA 4XR6A 4CO8A 5FROA 1O3RA 3RPUD 1F4KA 5ILUA 3HDDA 3QYEA 4W97A 1A04A 1YS7A 3HM5A 5E1WA 2ME0A 5ICEA 3IC7A 2CW0F 3F0CA 1SD7A 3BT9A 3VDXA 5F64A 3I58A 2WAFA 5CVIA 1Y0UA 1AA7A 3TOAA 4RGUA 1JT6A 3W3CA 2A61A 1AOYA 1M1EB 3CLQA 2DA3A 1Z21A 1IUYA 3QP6A 4XM3A 3PJRA 4UVBA 4FX0A 4ESBA 3QPLA 5DD4A 3JRIA 2QBYB 1TT5B 1V5EA 5M5YJ 1OCOH 3BR5A 1FYLA 3IAS2 1VF9A 2FOWA 2L7FP 3RJPA 3B6CA 5FLXK 1VQ4I 5J4YA 2NVQJ 3H36A 3IV5A 2R0QC 4CSWA 3H3ZA 1Z91A 2OUMA 2V9KA 3WU2C 2X6WA 1IGNA 3PNVA 4A5NA 3WTYC 1XMKA 5JFRA 3M4OJ 5HDGA 1TLHB 3QODA 2BVLA 5D5VB 4S0HB 4CZZA 3H9GA 1Z6RA 1QVUA 1B1BA 1XMXA 1JXSA 4RB2C 4EJOA 5HS9A 4A0XA 5JVGF 3A2KA 4GYGA 3ZQQA 2LG4A 1D8JA 1J9IA 1XGNA 2HU9A 4RS8A 4R79A 1POGA 5FB2A 4G12A 1P4AA 4P9UA 1FIAA 3KP7A 2ZMEA 2VC1A 3S32A 3E5UA 4XKBA 3RPQA 2R5ZA 2ZSIB 1IV6A 2WY7Q 4ESFA 2EK5A 3RQ4A 1JKOC 1HKTA 2HYGD 3CJRB 3CDLA 2OCCH 2DA7A 4XN3A 3BR1A 2VBZA 5GAHJ 3WTTC 3KZZA 3BROA 3Q3SA 3QQAA 4NDLA 2VONA 1XSVA 1QZYA 3HRTA 3TW6A 3LSJA 4Y52J 3K9TA 4MFDA 2L5QA 3T8TA 1FP1D 2EA4A 2XAFA 3LSMA 4UNOA 3J7AO 5K7FA 1BM9A 2WB1N 1MMDA 2YPRA 1K4TA 1F9NA 1T0FC 1HQCA 3HEFA 1VQOI 5B1BH 5LFAA 3N97A 4ZC3A 1BIBA 4KN7X 3I59A 4HG2A 2A07F 1PUFB 4H0EA 4BS9A 3KP3A 4S04A 1R7JA 3PUFA 4WK8F 3BQZA 1ZRDA 4OIPF 3TMOA 1T2KA 3KFWX 3B6AA 4EGZA 1AKHA 2QLZA 5LEJA 1HC8A 5F04A 3Q0VA 4BXUA 1KU9A 3GFLA 3FK6A 3K4NA 1RIOH 3K6GA 5BMZA 2JMWA 4Z6YA 3I9V2 4IHXA 1ZREA 2HVQA 5DEQA 3JCUC 5FLVA 2MFZA 2O7OA 2UWMA 4E7JA 3OYMA 1D1BA 4I09A 4WF2A 2G7HA 1T6SA 4S05A 4HBLA 1HW2A 3KYCB 4I01A 5F0FA 3JAMK 3NRVA 3W2WA 1BL0A 3OS2A 1FEXA 4Y17A 2WC2A 1RC9A 2ELJA 4EV0A 3BZKA 4MHGA 4IJAA 4XLFA 2K9MA 4DOZA 3I53A 3C2BA 2E2HJ 4JX4A 4RGRA 1K83J 3FWEA 4IXAA 2IGNA 1RRJA 1U8BA 4ZJZA 2ZXJA 1SFXA 2WV1A 1W1WE 3GLXA 1X58A 3N05A 1H88C 3ZMDA 3CCLI 2DBBA 2FUG2 5F27A 5K5OA 3D5SC 1MJAA 1MJ9A 2DK5A 4B1RA 3DPLC 3GX4X 1T39A 2WA0A 4UUTA 3RZDJ 1K7AA 3GZNB 3E5QA 3H5AA 3N4MA 1ZG5A 1KONA 2A05A 2IS6A 2KIUA 2JA2A 4Y15A 4YRVA 2K9QA 2DTZA 2IW5A 4NNJA 4U87A 5J4VA 2HR3A 2XC7A 3GTPJ 4B48A 2QSHX 3V7CA 4XQFA 1Y39A 1YITI 1G3TA 1LB2A 4RBOA 3NQOA 3TL4X 4IHVA 3K4LA 2JRMA 2HDCA 5GTIC 2DFHA 2IBDA 3L2VA 3G1MA 1ULYA 1SD6A 2UXXA 2FBKA 3V8LA 2WTEA 4HNUA 3WTXC 4G94A 2E1MB 4PCQA 4C30A 2W4SA 4HRIA 3ESWB 4RGXA 2IS1A 2FOKA 2QUFA 4C3HJ 3OYJA 3JRFA 1QO0D 1OQYA 2FNPA 3DU6A 1TQMA 2W1OA 4IEJA 1J7KA 1WH7A 3TP3A 1YQAA 3I4PA 2XB0X 3RKQA 3HGYA 4ZYHA 2RNJA 4A5MA 2H6CA 3OYEA 4E4HA 4Y7NJ 1F5TA 1S7EA 3BTJA 4DQ2A 1YFHA 4RLQA 1D3YA 4UXNA 2MBFA 3DXJF 1YHQI 3HGGA 2ZJRF 5FKKA 3CZ6A 3F8CA 2ISYA 1V5GA 4M73A 1QNTA 2L2OA 3O8GA 4M3FA 4DYRA 1DPRA 3FZVA 1UHMA 3J80K 4XK4A 2STTA 4U7DA 1HKSA 1LDJA 2DQLA 1VFCA 2EA2A 1TQIA 4AIJA 2CQQA 1BI1A 3VFZA 3KYLA 3MVPA 1MDMA 3S3OA 1MSEC 1U8RA 1VQ8I 2F4IA 4BAYA 4QSHA 1SMYF 3DTEA 2VE9A 5FRNA 3OSFA 3HOWJ 3K70D 3HTUA 2LF7A 3CD6I 5H20A 1Y8RB 4GYIA 2A5YB 1IXRC 1WZ2A 2CH0A 3DPTA 4HX8A 4DGWB 3ECHA 2TCTA 5DCMB 2W48A 3BPVA 2L54A 1ZYRF 1A6IA 1PUEE 3MZYA 4U0WA 4MTDA 5DTDA 4JOMA 3O3KA 3P9CA 4HPQA 4HV5A 4M72A 4KFCA 2NS7A 5J8FA 4ENJA 1ZQ3P 3HKZN 3L2CA 4L18B 2FBHA 1PVEA 2FX0A 4IRIA 1JI8A 3PO2J 3F3XA 1KQ9A 1BC7C 1U6GA 3KX2A 3LL7A 1J2XA 5EZGA 2E5ZA 2F5DA 3QP5A 2V7FA 5KHDA 3GTLJ 5FKLA 4MGRA 4AC0A 1Y56A 2OCEA 1VTNC 4IHWA 1FYKA 2H1KA 2NVYJ 5LBQA 3M8JA 4CYCB 4HAMA 1YX3A 1TWCJ 3HPHA 2K4BA 2YX7A 5C4JJ 3RZOJ 5J40A 2I5UA 4PSXA 1IV8A 3NARA 1J75A 4CZCA 2M1BA 4YIFA 2M5WA 5C3EJ 2M4GA 4PFPA 1W5SA 4PFOA 1YS6A 1IJWC 1U5TB 4XSXF 2Z33A 1BW6A 3F8MA 3IH2A 2QVOA 4E7ZA 1YOVB 5GPCA 1RKWA 2P5VA 3AAFA 5GTHC 2DMQA 3HHHA 5DUKA 3R6SA 3WGGA 2VBXA 1BN5A 1SD4A 2B7EA 2IJLA 3IHUA 4JBAA 4WXHA 1S29A 3AFHA 4XRSG 5ICGA 1CGPA 1GDTA 1A5JA 3E6CC 3MMYB 1RNLA 1ON2A 2DMNA 2R7TA 2XAHA 3CMMA 4M71A 3GFIA 3I3LA 2E2IJ 5B5EC 1XX5A 2HTJA 4I76A 2W25A 1NG7A 4HF0A 3P9KA 5E79C 2HQRA 3MKLA 2VT3A 3JRCA 3SZPA 3L2RA 2P6SA 3NWSA 1GV2A 1VZ0A 3ISPA 4F93B 1BI2A 3M9AA 3DBLB 2HYJA 3S3MA 2HPIA 2P7VB 4G7ZF 2DMUA 1GUUA 4MNUA 3BJ6A 3FM5A 2GBYA 3B02A 1ZG3A 2VXZA 2XPUA 4F91B 1XPXA 2XGCA 3LA7A 1R58A 2BYVE 2PQ8A 2XVCA 2I10A 3BR3A 3F8BA 4A3MJ 2Q2EB 3CJTB 4IHSA 4PZJA 2LLKA 3GO5A 2WAQA 4CCJA 4EMSA 3ZCOA 3J7AY 3HUGA 3BDDA 4LG0B 4X0GA 5IP9J 3FF5A 1MBFA 5DYMA 3IAM2 1S8NA 4HX4A 2E71A 4UVAA 1X1AA 1XDUA 3G1LA 1TWHJ 1XMAA 3LMMA 3DQVC 5D5WB 4D7NA 3FDYA 1UG0A 3WU1B 2JPCA 5EDNA 2D1VA 1T98A 1MBHA 4I6ZA 4B44A 4J01A 3IKTA 1DP3A 1YTYA 1JT0A 2A5WA 4HQEA 1RI7A 2V4JC 5HOOA 1FMWA 4BE1A 1G4DA 1RPWA 1HLVA 4O3MA 1JTYA 1LVAA 4ZZDA 5L3CA 1QBJA 3KYDB 3S1NJ 1R00A 2ZNYA 1SVLA 4G7HF 2VASA 1SFEA 3VB2A 2ELHA 5LD2C 2WV0A 3ABLH 2J5PA 1UHWA 3GZ6A 1WJAA 2XASA 1VQ7I 1TWFJ 3DKYA 1TP4A 1XS9A 3EDPA 4AIKA 2YX4A 4C2TA 4A3DJ 2XROA 1PP7U 2MD0A 2QWWA 2V6EA 2V26A 3RDIA 3J80Z 2HTSA 2LDUA 4PJNA 2H6BA 2CFXA 4II3A 4XRFA 4U88A 2HDDA 2XF7A 4DBRA 3A01A 1D0ZA 3ERMA 2ZJ2A 4JYKA 5CYVA 4KT6A 3TO7A 2QEXI 4B47A 5GADJ 1MSFC 3WGIA 2V6CA 1MGTA 2CQXA 3LSGA 5LHHA 2AXTC 1P7JA 3BG9A 2ISZA 3VEPA 1B8IB 1IW7F 1DU6A 4AVPA 4XRSA 2NNYA 4BQQA 2K5CA 4IHYA 5F1RA 3ZXSA 1KA8A 4BY7J 4M6XA 1H9GA 4L9NA 2VQGA 1I3QJ 4BDZA 2ETHA 2W84A 1DUXC 3GF2A 2VBWA 4LLNA 2BY0A 2KIFA 1CF7A 3DEWA 2VN2A 4JX6A 2ZMEC 4WWCA 2OV7A 4KDPA 1YRNB 2JSPA 3EPZA 1BI3A 1OCPA 1SD5A 2IXSA 4B3AA 2MH2A 3MN2A 3F6VA 4MLOA 3DCFA 2QSFX 4XRMA 4TV7A 5D6FA 1IDYA 3LQQA 3VYSB 1MW7A 2HS5A 3DP7A 1I5ZA 2CW8A 3H3UA 4B4CA 3EQLF 2OZ6A 3CMYA 1JE8A 2NS8A 1WGXA 2K3PA 2FRHA 5KAFC 3G73A 3M7GA 2KLOA 2L02A 4WX9A 3R61A 2HZTA 2PMZN 1ZG1A 4YFXF 2E60A 2ZXWH 2R7ZJ 1P4WA 5J8CA 3FKJA 5BOXA 1WJCA 3GW2A 2BEOA 3EUAA 4PGGA 3G4SI 3SYTA 1FY7A 2EV0A 3LQRA 3TW7A 1B9NA 2L9SA 3C2GA 3CCVI 4RAFA 2FNAA 2PMHA 3ASOH 2Y0SN 2QQBA 2VL8A 3C7JA 2X6XA 5GAEJ 4GGGA 3DEEA 4UHTA 5AIPA 3I55I 2R5ZB 2LBFB 5J6XA 2X48A 4OIQF 4A6DA 1Z7LA 1FJLA 5A2QK 2V9PA 4B3XA 5EYRA 2A6HF 5HDKA 1D5VA 2XAUA 1OCTC 2JVHA 4BJ5C 3K2ZA 1IRZA 1R1UA 3K4MA 5E1XA 3OL3A 2HVSA 1O7FA 2OTJI 2ID6A 4LLLA 1BJZA 4H4KC 2O61A 5CLSA 2Y9ZA 2KJCA 1TL8A 1FOYA 3ZMTA 2LNBA 3CUOA 3ZQHA 4A3BJ 3RYPA 3A02A 3CMAI 3TEDA 3PIPF 2DU9A 1K4SA 2KL4A 1JGGA 3KLNA 3OYLA 3JRHA 4ZH4F 2LBFA 5IYCJ 3PO3J 4XL9A 2G0EA 1QU3A 3Q0UA 1TW2A 4F52A 1SMTA 4IQJA 2CQ7A 5LEKA 3KZIC 3QPTA 5CJ9A 4FISA 4XLHA 3BPXA 3FXKA 5FD6A 4BHBA 2M7BA 4NUBA 2GZWA 1EV7A 1DPUA 2KHMA 4BHPA 2QBYA 1B4AA 2M8EA 2F4MB 3OIQA 1U2WA 2NS0A 5BPDA 3RIRA 2L9NA 2ESNA 3LSHA 1ZK8A 1HXDA 3HZJA 4PDKA 2CV1A 1B6AA 2E1OA 1HKQA 5JHFA 4J19A 3OV8A 2NYXA 4BH9A 4P96A 3UR3C 3KETA 1S3JA 3J7ZI 1WH5A 2H09A 4BQOA 1EJ9A 1F1ZA 2HDWA 2L0KA 2AO9A 3WHCA 1S7OA 5EJCA 2X0LA 1G8XA 4XKVA 3DFGA 2RN7A 4KICA 2VQLA
chains in the Genus database with same CATH topology
1UCRA 4YIIA 5D8KB 5LGTA 5LLQA 3CUQB 5CVJA 4QWQA 1O3QA 2WWYA 4OOIA 1KU3A 2FF4A 4ON0A 3TDZC 4HX7A 1S7AA 5BS6A 5IT9Z 2A68F 1XCBA 4LB5A 3E5XA 2COMA 4LLGF 2DQRA 2HGCA 3EETA 2ZNZA 2M45A 1WSUA 3KEQA 3CTAA 2IRFG 5FLXZ 2VT2A 3LA2A 5ICCA 5H6QA 2HWVA 2QZ8A 3LWFA 1G3SA 2GA2A 3WE2A 1LQ1A 1XN7A 4U0YA 4IF4A 4M6YA 4RB3C 5E17F 4YFNF 2FE3A 3KE2A 3JTHA 3TOBA 3DF8A 4M9SA 3IRQA 1WRJA 4OINF 2EJRA 2VE8A 3PQKA 2D1HA 4LGWA 2LKPA 3FMQA 3FMRA 2IPQX 1PDNC 4ENMA 1YO5C 4CXFA 2DLLA 2FXAA 1I6XA 1KU2A 2NAZA 2Z99A 3MEXA 1YW7A 1JHHA 3CO6C 3U9GA 4A12A 5DUIA 3K0LA 2DAOA 3LSTA 3MZHA 1FBSA 1RUOA 1FSEA 2RVCA 5L3GA 1T38A 4EVIA 3HRSA 2OA4A 4LFUA 3ABTA 3H92A 4HA8A 1LDKB 3F21A 3HTSB 3VODA 1W4MA 3IWFA 4Y13A 1IRFA 1W5TA 3KZYA 4HDUA 4BYYA 2KIMA 2A3SA 2FBIA 3C18A 5TJJA 4ENKA 2K86A 3QU6A 3KP4A 3L09A 2Z5UA 3JSPA 1JHFA 1U5TA 4UV9A 4HYEA 1IXSB 1GVJA 4MTEA 2E7XA 4HOBA 1HW1A 3I71A 4IRGA 1DDNA 4RGSA 4R8HA 5DDGA 3ERED 4PGHA 2PN6A 4I98B 4EM0B 2HEOA 2L01A 2QM3A 1U3EM 4K2EA 1W7PB 1O3TA 2FQ3A 2CSOA 2PG4A 4KIFA 4HF2A 2ADUA 3MQ0A 1C0WA 3FXUA 1Z05A 2VOPA 1NHAA 3GVAA 4OMZA 3E97A 2QENA 2OAZA 1UFMA 2DT5A 2ZKZA 1ODDA 1E17A 3ZMVA 4XBFA 3NEUA 1BI0A 1YG2A 3KCCA 4P55A 5FO5A 1Z7UA 3V4GA 1I1GA 4Q5SF 5DV5A 4BQAA 1P6RA 1ZGJA 1LEBA 4L0YB 3BWGA 3K1PA 2LSOA 3I54A 3U2RA 2ACJA 2BGCA 2PJPA 3WG9A 3K1MA 3M1EA 2KRFA 1OPCA 4IRHA 3V8JA 4FHTA 1U5TC 2Q0OA 3CO7C 1ZARA 4P5OA 3WE3A 1O7LA 4CDGA 1OYWA 2JT1A 2PBIA 3DEUA 2MLGA 1XGOA 4DNCA 1JGSA 3I59B 4I0AA 3BY6A 3WTUC 2GAUA 2JSCA 5IT9K 1XGMA 3DKWA 2GWRA 5EEHA 3ML6A 3R0JA 3F23A 1I1SA 3FM3A 3R0AA 5LHIA 4ZYEA 1TTYA 4KNYA 2Z3YA 4RAYA 3RKXA 2C6YA 1XB4A 4I0BA 3HSFA 2O0YA 4Q47A 3E6MA 1K78A 2UXNA 4E70A 4BHCA 2F5CA 1R22A 4P9FA 2VODA 2V9VA 1SAXA 4M9XA 1IXCA 4LB6B 1YLFA 2KKOA 1YW8A 3WGHA 4B8XA 2XGXA 3MFKA 4G7OF 5LRSA 2F5EA 2EFWA 4FT8A 3QOPA 3ZQ7A 3RKYA 1ZRFA 2W24A 2P5KA 3HRUA 4NHJA 1BIAA 2FMLA 2P5LC 5TRDA 1R1VA 3TQNA 1G6NA 3T1BA 1O3SA 4ENNA 2M87A 2W85A 5JHUA 2GQQA 3QAHA 4LMYA 1HBXG 3LAPA 1R5GA 3SHFA 4A0ZA 2O03A 1CF7B 2XAGA 5HVQC 2R3SA 3CUQA 3HOSA 3S2WA 2XRNA 4KMUX 1K6OA 5A2QZ 5LHGA 3BOQA 1XGSA 2IVMA 2HOEA 3BJOA 2UZKA 5D5UB 3PQJA 1LNWA 2K27A 3Q9VA 2PLYA 2Y48A 2OBPA 4RB1A 4KMFA 4EM1A 1L3LA 2P8TA 1Z1DA 3MCZA 2MH9A 2JZYA 1FP2A 4GO1A 3T0YA 2RKHA 4HQMA 1YW9A 2DPDA 2IP2A 2PFBA 1R5HA 3ZMUA 1E2XA 2B0LA 3ZP5A 4U0VA 3SXYA 4KIGA 2DI3A 2G9WA 3KP2A 2ZBKA 3M8FA 2HQNA 4NB5A 4Q4ZF 1DP7P 6PAXA 1OMIA 1J5YA 3TDUC 5L3DA 5D5XB 2CWEA 2Q2EA 5BPIA 1FYMA 1XDSA 1XSXA 2XKOA 2E1CA 1TQPA 1R1TA 3BJAA 2XAQA 2ZFWA 4L9JA 2MA3A 1B59A 4EM2A 4EQQA 2FU4A 1IAWA 1FLIA 3GZ5A 3JW4A 2QYOA 4EJUA 4HV6A 3V7SA 2F2EA 2EFQA 3WTVC 3IWZA 2HKOA 1ZLKA 2Z9OA 3VOEA 1G3YA 2J5OA 2IA1A 4OU0A 3W6KB 1XD7A 1IF1A 1ZRCA 4L9TA 2AXLA 2LF8A 2ZO4A 1IRGA 1QZZA 4LD5A 1X3UA 4ZYDA 3EYIA 2YU3A 1BBYA 2OD5A 2NRAC 4N0BA 4WCGA 2GIVA 3E3VA 1FSHA 4IVNA 4O5VA 2V79A 3HOTA 2A69F 2O3FA 2OQGA 1S6LA 3OOPA 1I27A 3BP8A 1FOKA 5FD5A 2XUBA 2FEZA 4LK1F 2O8XA 3G3ZA 5E8GA 3GFMA 1Z6TA 1ONVA 5L3EA 5AIQA 4F7ZA 1K79A 2PEXA 2VC0A 5KK1A 1ZLJA 3RKWA 4I2OA 3CDHA 3FMSA 1LDDA 3ECOA 4KA4A 5HLGA 1FC3A 2PI0A 1R23A 2E7WA 5DD8A 1USSA 1TW3A 3ABUA 4I02A 5HLHA 1FZPB 3SZTA 4CHUA 4KN4X 1GHCA 3CLOA 1MD0A 1FBQA 4WXDA 5FFZA 3RYRA 1REPC 5D6EA 1P92A 2CO5A 2DW4A 3ELKA 3FHZA 2H27A 1KQ0A 3LA3A 1YYVA 3CUQC 3E6BA 2OZUA 3ROUA 3O6BB 3GWZA 1B9MA 4O6JA 3J81Z 3IRRA 3KP6A 4UV8A 5F6FA 3GYHX 2IT0A 3T5XA 3TO6A 4GCVA 3ZPLA 1KU7A 2QQ9A 3B73A 4GXOA 5FGMA 5ED4A 1PP8F 2L4AA 1FT9A 2KJBA 5LRRA 5E20A 1IN5A 2ZCWA 4CYDA 3R4KA 2P7CB 2H94A 4KUMA 3SQNA 1RZ4A 3FX3A 3TKYA 2YSRA 2EB7A 4EGYA 5D4RA 1IN4A 1Z9CA 3WU0A 3I64A 2R7FA 3F6OA 4AIHA 2MD5A 3ZN0A 4MQVA 3BZ6A 4G6QA 1HSTA 5DCMA 3P7NA 2BV6A 3ZMSA 3LAJA 2Y0MA 2XV4S 2JTVA 3RPUA 2MLKA 4HW0A 4BNCA 2DTRA 3R60A 2EV6A 1ZAOA 3D0SA 1ZH5A 4AD9A 4HF1A 2RGVA 3LFKA 4OIOF 3KLOA 4XSZF 5CVRA 5D4SA 4ZZLA 5L3FA 4G8XA 4KT5C 3K1NA 3GFJA 2BBYA 2HYFA 3L9FA 4HLYA 2XHKA 4YG2F 1KYWA 2V1UA 4MEYF 1QQIA 2EFNA 2Q8KA 2FMYA 4N9HA 2ZMEB 4JK1X 2XIGA 1WQ2A 5ILSA 3O2PE 2BE5F 2M30A 3F72A 4OMYA 3F8NA 5HDNA 2FSWA 2G7UA 1L0OC 2RQPA 4G6DA 1MKMA 1W7PA 1K78B 3ZN1A 4L5IA 1P2FA 2CYYA 3E6DA 4OIRF 4ETSA 5JR3A 3HRMA 1U78A 1H9TA 2ESHA 4LG0A 5CVVA 4ASNA 1IN8A 2K02A 4G9YA 5H6RA 2W57A 1GXQA 4B09A 2HFHA 5ICFA 1IZ1A 5LGUA 4R1HA 4WXCA 3CJNA 1IN6A 2V1XA 3HHGA 5JVTA 3JTGA 2FA5A 3EYYA 5HLIA 4CGZA 4MEXF 3V7RA 3U1DA 1STZA 1EH7A 3J81K 1OYIA 3WODF 1LEAA 1WKMA 4NQWA 1GXPA 4Q48A 5AONA 3QPHA 5LGNA 1RUNA 2HKXA 2JPBA 4Z2YA 5HS7A 2CG4A 4EJWA 5E8IA 1O57A 3HSRA 3C3WA 4U7BA 3WTSC 5K5RA 4L5JA 2RC4A 2DPUA 1R36A 3KEOA 3HSEA 2VBYA 3GEZA 1FPQA 3L7WA 4D0PA 3I0TA 2NNNA 5IT3A 2L3DA 1J59A 3L00A 3V8KA 3Q9SA 3HYIA 2K7LA 3RTRA 1ZHFA 2RV8A 4LK0F 1FX7A 4QLCU 4UUVA 5FFXA 3FXRA 2A6EF 3IKVA 4IPAA 2OQRA 1OR7A 1WI9A 1EH8A 1Q1HA 4A2UA 1QGPA 1FBUA 2OU2A 4A0YA 2E1NA 3FXQA 2GA1A 1TBXA 2RDPA 2YR2A 4RB0A 3C1DA 3F8FA 2AS5F 4L0ZB 2GXGA 2IA2A 1XSDA 3QU3A 4KIBA 1TNTA 4M9ZA 4HDVA 1T0FA 3ZMZA 2O6GE 4A6EA 3DV8A 1SFUA 1V4RA 2PMUA 2TDXA 4M74A 4IHTA 3KP5A 5E1ZB 1KQ8A 4HZFA 3WTZA 3WTWC 4N9IA 5ERIA 2EFPA 3ULQB 5BQTA 2XKPA 3EUHA 3TO9A 1HSJA 1TNSA 3MWMA 1LJ9A 2IA0A 2CGPA 3COAC 3SFZA 1BJAA 2P6TA 5HS8A 3M8EA 1FWZA 1WWXA 3MAJA 4UVCA 4FX4A 3F22A 3T8RA 1V3FA 5K5QA 5KVRA 1W7PD 4CICA 3D5LA 2EFOA 1MJBA 5EEGA 3I5UA 4EJTA 2JRTA 4YFKF 4EJVA 2X4HA 5DCFA 2D2WA 2D45A 2R7DA 2MC3A 2EV5A 1D8KA 1G3WA 2GXBA 5L3BA 2DFIA 3K69A 1OYYA 4ESJA 4RAZA 5K1YA 2F5FA 1EH6A 2QQAA 4HLXA 5D8LB 1ON1A 1BC8C 2VOOA 2DO7A 3TGNA 4XLNF 1ZN2A 4JQFA 1MDMB 4XLPF 1IN7A 1P4XA 4KYWA 1YIOA 5JI6A 1AWCA 2V1DA 2Y75A 3W6JB 3RI4A 1USTA 2P4WA 4MQ9F 4ZYGA 3IL2A 3Q5FA 4LJZF 1XCVA 2CQKA 1KGSA 1QPMA 2DK8A 3P9IA 3GXOA 1J0RA 5E18F 1OKRA 3JAMZ 4L9VA 1MZBA 2XAJA 5ILVA 1H0MA 2STWA 2EWNA 1HW5A 1KYZA 3PFIA 3REOA 3QRFF 4I7HA 1FNNA 1BOAA 2L4MA 3GUDA 5CVUA 2K4JA 1UB9A 1ZGAA 3JSOA 4AWXB 3HIFA 4CO8A 1O3RA 1F4KA 5ILUA 1A04A 1YS7A 5E1WA 5ICEA 3IC7A 2CW0F 1SD7A 5F64A 3I58A 5CVIA 1Y0UA 3TOAA 4RGUA 1AOYA 2A61A 1IUYA 3QP6A 4UVBA 4FX0A 4ESBA 5DD4A 2QBYB 1FYLA 3RJPA 5FLXK 1Z91A 3H3ZA 4A5NA 3WTYC 1XMKA 5JFRA 5HDGA 1TLHB 5D5VB 4CZZA 1Z6RA 1B1BA 1JXSA 4RB2C 4EJOA 5HS9A 4A0XA 4GYGA 1D8JA 1J9IA 1XGNA 4RS8A 4R79A 5FB2A 1P4AA 4P9UA 3KP7A 2ZMEA 2VC1A 3E5UA 3RPQA 4ESFA 2EK5A 1HKTA 2HYGD 2VBZA 3WTTC 3KZZA 3BROA 2VONA 1XSVA 1QZYA 3HRTA 3K9TA 3T8TA 1FP1D 2EA4A 2XAFA 4UNOA 3J7AO 1BM9A 2YPRA 1F9NA 1HQCA 3N97A 2A07F 1BIBA 4KN7X 3I59A 4H0EA 3KP3A 4S04A 1R7JA 4WK8F 1ZRDA 4OIPF 1T2KA 3KFWX 4EGZA 2QLZA 5LEJA 4BXUA 1KU9A 3GFLA 1RIOH 5BMZA 1ZREA 5DEQA 2UWMA 4I09A 4WF2A 2G7HA 1T6SA 4S05A 4HBLA 1HW2A 4I01A 3JAMK 3NRVA 4Y17A 2WC2A 4EV0A 4MHGA 4IJAA 3I53A 4RGRA 4IXAA 3FWEA 2ZXJA 1SFXA 3GLXA 3ZMDA 2DBBA 5K5OA 1MJAA 1MJ9A 2DK5A 3DPLC 3GX4X 1T39A 1K7AA 3E5QA 3N4MA 1ZG5A 2KIUA 4Y15A 2IW5A 2HR3A 3V7CA 1G3TA 1LB2A 3NQOA 2HDCA 1ULYA 1SD6A 2UXXA 2FBKA 3V8LA 2WTEA 3WTXC 4G94A 4PCQA 4RGXA 2FOKA 2QUFA 1QO0D 2FNPA 1TQMA 1J7KA 1YQAA 3I4PA 4ZYHA 2RNJA 4A5MA 2H6CA 1F5TA 4DQ2A 1YFHA 1D3YA 4UXNA 2MBFA 3DXJF 3F8CA 2ISYA 4M73A 1QNTA 1DPRA 3FZVA 1UHMA 3J80K 2STTA 4U7DA 1HKSA 1LDJA 2DQLA 2EA2A 1TQIA 4AIJA 1BI1A 3VFZA 1MDMA 1U8RA 4BAYA 1SMYF 2VE9A 3HTUA 2LF7A 5H20A 4GYIA 2A5YB 1IXRC 3DPTA 4HX8A 3ECHA 5DCMB 3BPVA 2L54A 1ZYRF 1PUEE 3MZYA 4U0WA 4MTDA 3O3KA 3P9CA 4HV5A 4M72A 4KFCA 5J8FA 4ENJA 3L2CA 4L18B 2FBHA 4IRIA 3F3XA 1KQ9A 1BC7C 1U6GA 1J2XA 2F5DA 3QP5A 4MGRA 1VTNC 1FYKA 5LBQA 4HAMA 2K4BA 2YX7A 1J75A 2M1BA 4YIFA 2M5WA 1W5SA 1YS6A 1U5TB 4XSXF 2Z33A 3F8MA 2QVOA 2P5VA 3AAFA 3HHHA 5DUKA 3R6SA 3WGGA 2VBXA 1BN5A 1SD4A 2IJLA 3IHUA 4JBAA 4WXHA 1CGPA 1S29A 5ICGA 3E6CC 1RNLA 1ON2A 2XAHA 4M71A 3GFIA 2HTJA 2W25A 4HF0A 3P9KA 2HQRA 2VT3A 3SZPA 2P6SA 3ISPA 1BI2A 3M9AA 4G7ZF 2P7VB 4MNUA 3BJ6A 3FM5A 3B02A 1ZG3A 2VXZA 3LA7A 1R58A 2BYVE 2PQ8A 2XVCA 3F8BA 4IHSA 4PZJA 3GO5A 4EMSA 3HUGA 3BDDA 4LG0B 3FF5A 5DYMA 1S8NA 4HX4A 4UVAA 1XDUA 1XMAA 3DQVC 5D5WB 3WU1B 2JPCA 2D1VA 1T98A 3IKTA 1YTYA 4HQEA 1RI7A 5HOOA 1G4DA 4O3MA 1LVAA 4ZZDA 5L3CA 1QBJA 1R00A 2ZNYA 4G7HF 1SFEA 3VB2A 2ELHA 2WV0A 2J5PA 1UHWA 3GZ6A 2XASA 3EDPA 4AIKA 2YX4A 2XROA 1PP7U 2QWWA 3RDIA 3J80Z 2HTSA 2LDUA 2H6BA 2CFXA 4XRFA 4U88A 2ZJ2A 5CYVA 3TO7A 3WGIA 2V6CA 1MGTA 5LHHA 2ISZA 3VEPA 1IW7F 4AVPA 2NNYA 5F1RA 1KA8A 4M6XA 1H9GA 4L9NA 1DUXC 2ETHA 2W84A 3GF2A 2VBWA 4LLNA 1CF7A 2KIFA 2VN2A 4WWCA 4KDPA 1BI3A 1SD5A 2MH2A 3F6VA 4TV7A 5D6FA 3LQQA 2HS5A 3DP7A 1I5ZA 3H3UA 1JE8A 3EQLF 2OZ6A 2FRHA 3G73A 3M7GA 2L02A 4WX9A 3R61A 2HZTA 1ZG1A 4YFXF 1P4WA 5J8CA 5BOXA 3GW2A 2BEOA 4PGGA 1FY7A 2EV0A 3LQRA 1B9NA 2FNAA 2PMHA 2QQBA 3C7JA 4GGGA 4UHTA 5AIPA 5J6XA 4OIQF 4A6DA 5A2QK 2A6HF 5HDKA 1D5VA 3K2ZA 1R1UA 5E1XA 1O7FA 4LLLA 2O61A 5CLSA 2KJCA 3ZMTA 2LNBA 3CUOA 3RYPA 2DU9A 3KLNA 4ZH4F 1TW2A 1SMTA 5LEKA 3QPTA 5CJ9A 3BPXA 5FD6A 4BHBA 2GZWA 1EV7A 1DPUA 4BHPA 2QBYA 1B4AA 2M8EA 1U2WA 2NS0A 5BPDA 3RIRA 2ESNA 1HXDA 4PDKA 1B6AA 1HKQA 3OV8A 2NYXA 4BH9A 4P96A 3KETA 1S3JA 2H09A 1F1ZA 1S7OA 2X0LA 3DFGA 2RN7A 4KICA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1UCR A;  4YII A;  5D8K B;  5LGT A;  5LLQ A;  3CUQ B;  5CVJ A;  4QWQ A;  1O3Q A;  2WWY A;  4OOI A;  1KU3 A;  2FF4 A;  4ON0 A;  3TDZ C;  4HX7 A;  1S7A A;  5BS6 A;  5IT9 Z;  2A68 F;  1XCB A;  4LB5 A;  3E5X A;  2COM A;  4LLG F;  2DQR A;  2HGC A;  3EET A;  2ZNZ A;  2M45 A;  1WSU A;  3KEQ A;  3CTA A;  2IRF G;  5FLX Z;  2VT2 A;  3LA2 A;  5ICC A;  5H6Q A;  2HWV A;  2QZ8 A;  3LWF A;  1G3S A;  2GA2 A;  3WE2 A;  1LQ1 A;  1XN7 A;  4U0Y A;  4IF4 A;  4M6Y A;  4RB3 C;  5E17 F;  4YFN F;  2FE3 A;  3KE2 A;  3JTH A;  3TOB A;  3DF8 A;  4M9S A;  3IRQ A;  1WRJ A;  4OIN F;  2EJR A;  2VE8 A;  3PQK A;  2D1H A;  4LGW A;  2LKP A;  3FMQ A;  3FMR A;  2IPQ X;  1PDN C;  4ENM A;  1YO5 C;  4CXF A;  2DLL A;  2FXA A;  1I6X A;  1KU2 A;  2NAZ A;  2Z99 A;  3MEX A;  1YW7 A;  1JHH A;  3CO6 C;  3U9G A;  4A12 A;  5DUI A;  3K0L A;  2DAO A;  3LST A;  3MZH A;  1FBS A;  1RUO A;  1FSE A;  2RVC A;  5L3G A;  1T38 A;  4EVI A;  3HRS A;  2OA4 A;  4LFU A;  3ABT A;  3H92 A;  4HA8 A;  1LDK B;  3F21 A;  3HTS B;  3VOD A;  1W4M A;  3IWF A;  4Y13 A;  1IRF A;  1W5T A;  3KZY A;  4HDU A;  4BYY A;  2KIM A;  2A3S A;  2FBI A;  3C18 A;  5TJJ A;  4ENK A;  2K86 A;  3QU6 A;  3KP4 A;  3L09 A;  2Z5U A;  3JSP A;  1JHF A;  1U5T A;  4UV9 A;  4HYE A;  1IXS B;  1GVJ A;  4MTE A;  2E7X A;  4HOB A;  1HW1 A;  3I71 A;  4IRG A;  1DDN A;  4RGS A;  4R8H A;  5DDG A;  3ERE D;  4PGH A;  2PN6 A;  4I98 B;  4EM0 B;  2HEO A;  2L01 A;  2QM3 A;  1U3E M;  4K2E A;  1W7P B;  1O3T A;  2FQ3 A;  2CSO A;  2PG4 A;  4KIF A;  4HF2 A;  2ADU A;  3MQ0 A;  1C0W A;  3FXU A;  1Z05 A;  2VOP A;  1NHA A;  3GVA A;  4OMZ A;  3E97 A;  2QEN A;  2OAZ A;  1UFM A;  2DT5 A;  2ZKZ A;  1ODD A;  1E17 A;  3ZMV A;  4XBF A;  3NEU A;  1BI0 A;  1YG2 A;  3KCC A;  4P55 A;  5FO5 A;  1Z7U A;  3V4G A;  1I1G A;  4Q5S F;  5DV5 A;  4BQA A;  1P6R A;  1ZGJ A;  1LEB A;  4L0Y B;  3BWG A;  3K1P A;  2LSO A;  3I54 A;  3U2R A;  2ACJ A;  2BGC A;  2PJP A;  3WG9 A;  3K1M A;  3M1E A;  2KRF A;  1OPC A;  4IRH A;  3V8J A;  4FHT A;  1U5T C;  2Q0O A;  3CO7 C;  1ZAR A;  4P5O A;  3WE3 A;  1O7L A;  4CDG A;  1OYW A;  2JT1 A;  2PBI A;  3DEU A;  2MLG A;  1XGO A;  4DNC A;  1JGS A;  3I59 B;  4I0A A;  3BY6 A;  3WTU C;  2GAU A;  2JSC A;  5IT9 K;  1XGM A;  3DKW A;  2GWR A;  5EEH A;  3ML6 A;  3R0J A;  3F23 A;  1I1S A;  3FM3 A;  3R0A A;  5LHI A;  4ZYE A;  1TTY A;  4KNY A;  2Z3Y A;  4RAY A;  3RKX A;  2C6Y A;  1XB4 A;  4I0B A;  3HSF A;  2O0Y A;  4Q47 A;  3E6M A;  1K78 A;  2UXN A;  4E70 A;  4BHC A;  2F5C A;  1R22 A;  4P9F A;  2VOD A;  2V9V A;  1SAX A;  4M9X A;  1IXC A;  4LB6 B;  1YLF A;  2KKO A;  1YW8 A;  3WGH A;  4B8X A;  2XGX A;  3MFK A;  4G7O F;  5LRS A;  2F5E A;  2EFW A;  4FT8 A;  3QOP A;  3ZQ7 A;  3RKY A;  1ZRF A;  2W24 A;  2P5K A;  3HRU A;  4NHJ A;  1BIA A;  2FML A;  2P5L C;  5TRD A;  1R1V A;  3TQN A;  1G6N A;  3T1B A;  1O3S A;  4ENN A;  2M87 A;  2W85 A;  5JHU A;  2GQQ A;  3QAH A;  4LMY A;  1HBX G;  3LAP A;  1R5G A;  3SHF A;  4A0Z A;  2O03 A;  1CF7 B;  2XAG A;  5HVQ C;  2R3S A;  3CUQ A;  3HOS A;  3S2W A;  2XRN A;  4KMU X;  1K6O A;  5A2Q Z;  5LHG A;  3BOQ A;  1XGS A;  2IVM A;  2HOE A;  3BJO A;  2UZK A;  5D5U B;  3PQJ A;  1LNW A;  2K27 A;  3Q9V A;  2PLY A;  2Y48 A;  2OBP A;  4RB1 A;  4KMF A;  4EM1 A;  1L3L A;  2P8T A;  1Z1D A;  3MCZ A;  2MH9 A;  2JZY A;  1FP2 A;  4GO1 A;  3T0Y A;  2RKH A;  4HQM A;  1YW9 A;  2DPD A;  2IP2 A;  2PFB A;  1R5H A;  3ZMU A;  1E2X A;  2B0L A;  3ZP5 A;  4U0V A;  3SXY A;  4KIG A;  2DI3 A;  2G9W A;  3KP2 A;  2ZBK A;  3M8F A;  2HQN A;  4NB5 A;  4Q4Z F;  1DP7 P;  6PAX A;  1OMI A;  1J5Y A;  3TDU C;  5L3D A;  5D5X B;  2CWE A;  2Q2E A;  5BPI A;  1FYM A;  1XDS A;  1XSX A;  2XKO A;  2E1C A;  1TQP A;  1R1T A;  3BJA A;  2XAQ A;  2ZFW A;  4L9J A;  2MA3 A;  1B59 A;  4EM2 A;  4EQQ A;  2FU4 A;  1IAW A;  1FLI A;  3GZ5 A;  3JW4 A;  2QYO A;  4EJU A;  4HV6 A;  3V7S A;  2F2E A;  2EFQ A;  3WTV C;  3IWZ A;  2HKO A;  1ZLK A;  2Z9O A;  3VOE A;  1G3Y A;  2J5O A;  2IA1 A;  4OU0 A;  3W6K B;  1XD7 A;  1IF1 A;  1ZRC A;  4L9T A;  2AXL A;  2LF8 A;  2ZO4 A;  1IRG A;  1QZZ A;  4LD5 A;  1X3U A;  4ZYD A;  3EYI A;  2YU3 A;  1BBY A;  2OD5 A;  2NRA C;  4N0B A;  4WCG A;  2GIV A;  3E3V A;  1FSH A;  4IVN A;  4O5V A;  2V79 A;  3HOT A;  2A69 F;  2O3F A;  2OQG A;  1S6L A;  3OOP A;  1I27 A;  3BP8 A;  1FOK A;  5FD5 A;  2XUB A;  2FEZ A;  4LK1 F;  2O8X A;  3G3Z A;  5E8G A;  3GFM A;  1Z6T A;  1ONV A;  5L3E A;  5AIQ A;  4F7Z A;  1K79 A;  2PEX A;  2VC0 A;  5KK1 A;  1ZLJ A;  3RKW A;  4I2O A;  3CDH A;  3FMS A;  1LDD A;  3ECO A;  4KA4 A;  5HLG A;  1FC3 A;  2PI0 A;  1R23 A;  2E7W A;  5DD8 A;  1USS A;  1TW3 A;  3ABU A;  4I02 A;  5HLH A;  1FZP B;  3SZT A;  4CHU A;  4KN4 X;  1GHC A;  3CLO A;  1MD0 A;  1FBQ A;  4WXD A;  5FFZ A;  3RYR A;  1REP C;  5D6E A;  1P92 A;  2CO5 A;  2DW4 A;  3ELK A;  3FHZ A;  2H27 A;  1KQ0 A;  3LA3 A;  1YYV A;  3CUQ C;  3E6B A;  2OZU A;  3ROU A;  3O6B B;  3GWZ A;  1B9M A;  4O6J A;  3J81 Z;  3IRR A;  3KP6 A;  4UV8 A;  5F6F A;  3GYH X;  2IT0 A;  3T5X A;  3TO6 A;  4GCV A;  3ZPL A;  1KU7 A;  2QQ9 A;  3B73 A;  4GXO A;  5FGM A;  5ED4 A;  1PP8 F;  2L4A A;  1FT9 A;  2KJB A;  5LRR A;  5E20 A;  1IN5 A;  2ZCW A;  4CYD A;  3R4K A;  2P7C B;  2H94 A;  4KUM A;  3SQN A;  1RZ4 A;  3FX3 A;  3TKY A;  2YSR A;  2EB7 A;  4EGY A;  5D4R A;  1IN4 A;  1Z9C A;  3WU0 A;  3I64 A;  2R7F A;  3F6O A;  4AIH A;  2MD5 A;  3ZN0 A;  4MQV A;  3BZ6 A;  4G6Q A;  1HST A;  5DCM A;  3P7N A;  2BV6 A;  3ZMS A;  3LAJ A;  2Y0M A;  2XV4 S;  2JTV A;  3RPU A;  2MLK A;  4HW0 A;  4BNC A;  2DTR A;  3R60 A;  2EV6 A;  1ZAO A;  3D0S A;  1ZH5 A;  4AD9 A;  4HF1 A;  2RGV A;  3LFK A;  4OIO F;  3KLO A;  4XSZ F;  5CVR A;  5D4S A;  4ZZL A;  5L3F A;  4G8X A;  4KT5 C;  3K1N A;  3GFJ A;  2BBY A;  2HYF A;  3L9F A;  4HLY A;  2XHK A;  4YG2 F;  1KYW A;  2V1U A;  4MEY F;  1QQI A;  2EFN A;  2Q8K A;  2FMY A;  4N9H A;  2ZME B;  4JK1 X;  2XIG A;  1WQ2 A;  5ILS A;  3O2P E;  2BE5 F;  2M30 A;  3F72 A;  4OMY A;  3F8N A;  5HDN A;  2FSW A;  2G7U A;  1L0O C;  2RQP A;  4G6D A;  1MKM A;  1W7P A;  1K78 B;  3ZN1 A;  4L5I A;  1P2F A;  2CYY A;  3E6D A;  4OIR F;  4ETS A;  5JR3 A;  3HRM A;  1U78 A;  1H9T A;  2ESH A;  4LG0 A;  5CVV A;  4ASN A;  1IN8 A;  2K02 A;  4G9Y A;  5H6R A;  2W57 A;  1GXQ A;  4B09 A;  2HFH A;  5ICF A;  1IZ1 A;  5LGU A;  4R1H A;  4WXC A;  3CJN A;  1IN6 A;  2V1X A;  3HHG A;  5JVT A;  3JTG A;  2FA5 A;  3EYY A;  5HLI A;  4CGZ A;  4MEX F;  3V7R A;  3U1D A;  1STZ A;  1EH7 A;  3J81 K;  1OYI A;  3WOD F;  1LEA A;  1WKM A;  4NQW A;  1GXP A;  4Q48 A;  5AON A;  3QPH A;  5LGN A;  1RUN A;  2HKX A;  2JPB A;  4Z2Y A;  5HS7 A;  2CG4 A;  4EJW A;  5E8I A;  1O57 A;  3HSR A;  3C3W A;  4U7B A;  3WTS C;  5K5R A;  4L5J A;  2RC4 A;  2DPU A;  1R36 A;  3KEO A;  3HSE A;  2VBY A;  3GEZ A;  1FPQ A;  3L7W A;  4D0P A;  3I0T A;  2NNN A;  5IT3 A;  2L3D A;  1J59 A;  3L00 A;  3V8K A;  3Q9S A;  3HYI A;  2K7L A;  3RTR A;  1ZHF A;  2RV8 A;  4LK0 F;  1FX7 A;  4QLC U;  4UUV A;  5FFX A;  3FXR A;  2A6E F;  3IKV A;  4IPA A;  2OQR A;  1OR7 A;  1WI9 A;  1EH8 A;  1Q1H A;  4A2U A;  1QGP A;  1FBU A;  2OU2 A;  4A0Y A;  2E1N A;  3FXQ A;  2GA1 A;  1TBX A;  2RDP A;  2YR2 A;  4RB0 A;  3C1D A;  3F8F A;  2AS5 F;  4L0Z B;  2GXG A;  2IA2 A;  1XSD A;  3QU3 A;  4KIB A;  1TNT A;  4M9Z A;  4HDV A;  1T0F A;  3ZMZ A;  2O6G E;  4A6E A;  3DV8 A;  1SFU A;  1V4R A;  2PMU A;  2TDX A;  4M74 A;  4IHT A;  3KP5 A;  5E1Z B;  1KQ8 A;  4HZF A;  3WTZ A;  3WTW C;  4N9I A;  5ERI A;  2EFP A;  3ULQ B;  5BQT A;  2XKP A;  3EUH A;  3TO9 A;  1HSJ A;  1TNS A;  3MWM A;  1LJ9 A;  2IA0 A;  2CGP A;  3COA C;  3SFZ A;  1BJA A;  2P6T A;  5HS8 A;  3M8E A;  1FWZ A;  1WWX A;  3MAJ A;  4UVC A;  4FX4 A;  3F22 A;  3T8R A;  1V3F A;  5K5Q A;  5KVR A;  1W7P D;  4CIC A;  3D5L A;  2EFO A;  1MJB A;  5EEG A;  3I5U A;  4EJT A;  2JRT A;  4YFK F;  4EJV A;  2X4H A;  5DCF A;  2D2W A;  2D45 A;  2R7D A;  2MC3 A;  2EV5 A;  1D8K A;  1G3W A;  2GXB A;  5L3B A;  2DFI A;  3K69 A;  1OYY A;  4ESJ A;  4RAZ A;  5K1Y A;  2F5F A;  1EH6 A;  2QQA A;  4HLX A;  5D8L B;  1ON1 A;  1BC8 C;  2VOO A;  2DO7 A;  3TGN A;  4XLN F;  1ZN2 A;  4JQF A;  1MDM B;  4XLP F;  1IN7 A;  1P4X A;  4KYW A;  1YIO A;  5JI6 A;  1AWC A;  2V1D A;  2Y75 A;  3W6J B;  3RI4 A;  1UST A;  2P4W A;  4MQ9 F;  4ZYG A;  3IL2 A;  3Q5F A;  4LJZ F;  1XCV A;  2CQK A;  1KGS A;  1QPM A;  2DK8 A;  3P9I A;  3GXO A;  1J0R A;  5E18 F;  1OKR A;  3JAM Z;  4L9V A;  1MZB A;  2XAJ A;  5ILV A;  1H0M A;  2STW A;  2EWN A;  1HW5 A;  1KYZ A;  3PFI A;  3REO A;  3QRF F;  4I7H A;  1FNN A;  1BOA A;  2L4M A;  3GUD A;  5CVU A;  2K4J A;  1UB9 A;  1ZGA A;  3JSO A;  4AWX B;  3HIF A;  4CO8 A;  1O3R A;  1F4K A;  5ILU A;  1A04 A;  1YS7 A;  5E1W A;  5ICE A;  3IC7 A;  2CW0 F;  1SD7 A;  5F64 A;  3I58 A;  5CVI A;  1Y0U A;  3TOA A;  4RGU A;  1AOY A;  2A61 A;  1IUY A;  3QP6 A;  4UVB A;  4FX0 A;  4ESB A;  5DD4 A;  2QBY B;  1FYL A;  3RJP A;  5FLX K;  1Z91 A;  3H3Z A;  4A5N A;  3WTY C;  1XMK A;  5JFR A;  5HDG A;  1TLH B;  5D5V B;  4CZZ A;  1Z6R A;  1B1B A;  1JXS A;  4RB2 C;  4EJO A;  5HS9 A;  4A0X A;  4GYG A;  1D8J A;  1J9I A;  1XGN A;  4RS8 A;  4R79 A;  5FB2 A;  1P4A A;  4P9U A;  3KP7 A;  2ZME A;  2VC1 A;  3E5U A;  3RPQ A;  4ESF A;  2EK5 A;  1HKT A;  2HYG D;  2VBZ A;  3WTT C;  3KZZ A;  3BRO A;  2VON A;  1XSV A;  1QZY A;  3HRT A;  3K9T A;  3T8T A;  1FP1 D;  2EA4 A;  2XAF A;  4UNO A;  3J7A O;  1BM9 A;  2YPR A;  1F9N A;  1HQC A;  3N97 A;  2A07 F;  1BIB A;  4KN7 X;  3I59 A;  4H0E A;  3KP3 A;  4S04 A;  1R7J A;  4WK8 F;  1ZRD A;  4OIP F;  1T2K A;  3KFW X;  4EGZ A;  2QLZ A;  5LEJ A;  4BXU A;  1KU9 A;  3GFL A;  1RIO H;  5BMZ A;  1ZRE A;  5DEQ A;  2UWM A;  4I09 A;  4WF2 A;  2G7H A;  1T6S A;  4S05 A;  4HBL A;  1HW2 A;  4I01 A;  3JAM K;  3NRV A;  4Y17 A;  2WC2 A;  4EV0 A;  4MHG A;  4IJA A;  3I53 A;  4RGR A;  4IXA A;  3FWE A;  2ZXJ A;  1SFX A;  3GLX A;  3ZMD A;  2DBB A;  5K5O A;  1MJA A;  1MJ9 A;  2DK5 A;  3DPL C;  3GX4 X;  1T39 A;  1K7A A;  3E5Q A;  3N4M A;  1ZG5 A;  2KIU A;  4Y15 A;  2IW5 A;  2HR3 A;  3V7C A;  1G3T A;  1LB2 A;  3NQO A;  2HDC A;  1ULY A;  1SD6 A;  2UXX A;  2FBK A;  3V8L A;  2WTE A;  3WTX C;  4G94 A;  4PCQ A;  4RGX A;  2FOK A;  2QUF A;  1QO0 D;  2FNP A;  1TQM A;  1J7K A;  1YQA A;  3I4P A;  4ZYH A;  2RNJ A;  4A5M A;  2H6C A;  1F5T A;  4DQ2 A;  1YFH A;  1D3Y A;  4UXN A;  2MBF A;  3DXJ F;  3F8C A;  2ISY A;  4M73 A;  1QNT A;  1DPR A;  3FZV A;  1UHM A;  3J80 K;  2STT A;  4U7D A;  1HKS A;  1LDJ A;  2DQL A;  2EA2 A;  1TQI A;  4AIJ A;  1BI1 A;  3VFZ A;  1MDM A;  1U8R A;  4BAY A;  1SMY F;  2VE9 A;  3HTU A;  2LF7 A;  5H20 A;  4GYI A;  2A5Y B;  1IXR C;  3DPT A;  4HX8 A;  3ECH A;  5DCM B;  3BPV A;  2L54 A;  1ZYR F;  1PUE E;  3MZY A;  4U0W A;  4MTD A;  3O3K A;  3P9C A;  4HV5 A;  4M72 A;  4KFC A;  5J8F A;  4ENJ A;  3L2C A;  4L18 B;  2FBH A;  4IRI A;  3F3X A;  1KQ9 A;  1BC7 C;  1U6G A;  1J2X A;  2F5D A;  3QP5 A;  4MGR A;  1VTN C;  1FYK A;  5LBQ A;  4HAM A;  2K4B A;  2YX7 A;  1J75 A;  2M1B A;  4YIF A;  2M5W A;  1W5S A;  1YS6 A;  1U5T B;  4XSX F;  2Z33 A;  3F8M A;  2QVO A;  2P5V A;  3AAF A;  3HHH A;  5DUK A;  3R6S A;  3WGG A;  2VBX A;  1BN5 A;  1SD4 A;  2IJL A;  3IHU A;  4JBA A;  4WXH A;  1CGP A;  1S29 A;  5ICG A;  3E6C C;  1RNL A;  1ON2 A;  2XAH A;  4M71 A;  3GFI A;  2HTJ A;  2W25 A;  4HF0 A;  3P9K A;  2HQR A;  2VT3 A;  3SZP A;  2P6S A;  3ISP A;  1BI2 A;  3M9A A;  4G7Z F;  2P7V B;  4MNU A;  3BJ6 A;  3FM5 A;  3B02 A;  1ZG3 A;  2VXZ A;  3LA7 A;  1R58 A;  2BYV E;  2PQ8 A;  2XVC A;  3F8B A;  4IHS A;  4PZJ A;  3GO5 A;  4EMS A;  3HUG A;  3BDD A;  4LG0 B;  3FF5 A;  5DYM A;  1S8N A;  4HX4 A;  4UVA A;  1XDU A;  1XMA A;  3DQV C;  5D5W B;  3WU1 B;  2JPC A;  2D1V A;  1T98 A;  3IKT A;  1YTY A;  4HQE A;  1RI7 A;  5HOO A;  1G4D A;  4O3M A;  1LVA A;  4ZZD A;  5L3C A;  1QBJ A;  1R00 A;  2ZNY A;  4G7H F;  1SFE A;  3VB2 A;  2ELH A;  2WV0 A;  2J5P A;  1UHW A;  3GZ6 A;  2XAS A;  3EDP A;  4AIK A;  2YX4 A;  2XRO A;  1PP7 U;  2QWW A;  3RDI A;  3J80 Z;  2HTS A;  2LDU A;  2H6B A;  2CFX A;  4XRF A;  4U88 A;  2ZJ2 A;  5CYV A;  3TO7 A;  3WGI A;  2V6C A;  1MGT A;  5LHH A;  2ISZ A;  3VEP A;  1IW7 F;  4AVP A;  2NNY A;  5F1R A;  1KA8 A;  4M6X A;  1H9G A;  4L9N A;  1DUX C;  2ETH A;  2W84 A;  3GF2 A;  2VBW A;  4LLN A;  1CF7 A;  2KIF A;  2VN2 A;  4WWC A;  4KDP A;  1BI3 A;  1SD5 A;  2MH2 A;  3F6V A;  4TV7 A;  5D6F A;  3LQQ A;  2HS5 A;  3DP7 A;  1I5Z A;  3H3U A;  1JE8 A;  3EQL F;  2OZ6 A;  2FRH A;  3G73 A;  3M7G A;  2L02 A;  4WX9 A;  3R61 A;  2HZT A;  1ZG1 A;  4YFX F;  1P4W A;  5J8C A;  5BOX A;  3GW2 A;  2BEO A;  4PGG A;  1FY7 A;  2EV0 A;  3LQR A;  1B9N A;  2FNA A;  2PMH A;  2QQB A;  3C7J A;  4GGG A;  4UHT A;  5AIP A;  5J6X A;  4OIQ F;  4A6D A;  5A2Q K;  2A6H F;  5HDK A;  1D5V A;  3K2Z A;  1R1U A;  5E1X A;  1O7F A;  4LLL A;  2O61 A;  5CLS A;  2KJC A;  3ZMT A;  2LNB A;  3CUO A;  3RYP A;  2DU9 A;  3KLN A;  4ZH4 F;  1TW2 A;  1SMT A;  5LEK A;  3QPT A;  5CJ9 A;  3BPX A;  5FD6 A;  4BHB A;  2GZW A;  1EV7 A;  1DPU A;  4BHP A;  2QBY A;  1B4A A;  2M8E A;  1U2W A;  2NS0 A;  5BPD A;  3RIR A;  2ESN A;  1HXD A;  4PDK A;  1B6A A;  1HKQ A;  3OV8 A;  2NYX A;  4BH9 A;  4P96 A;  3KET A;  1S3J A;  2H09 A;  1F1Z A;  1S7O A;  2X0L A;  3DFG A;  2RN7 A;  4KIC A; 
#chains in the Genus database with same CATH topology
 1ORK A;  1UCR A;  4YII A;  2DA6 A;  4XLE A;  5D8K B;  3OMY A;  5LGT A;  5LLQ A;  3CUQ B;  5CVJ A;  4QWQ A;  2HZD A;  1E3H A;  3DTK A;  4LIT A;  2DA2 A;  1DQU A;  4OOI A;  2WWY A;  1O3Q A;  4PUS A;  1KU3 A;  1QPI A;  2DOF A;  2FF4 A;  1I6H J;  4CH7 A;  3MZ8 A;  3SDG A;  2VI6 A;  3OWT A;  5GPA A;  2VUM J;  4ON0 A;  1SC7 A;  3OSG A;  3TDZ C;  2LFB A;  4HX7 A;  4M6V A;  4E7L A;  1S7A A;  2F6C A;  3J7Y J;  1UAA A;  5BS6 A;  4RA2 A;  5IT9 Z;  2DOA A;  1LFP A;  2A68 F;  3OYG A;  3K4K A;  1XCB A;  2HVR A;  4ZYA A;  4XON A;  2NXN B;  4LB5 A;  3E5X A;  5CKT A;  1MMS A;  2COM A;  2H8W A;  4LLG F;  2DQR A;  2HGC A;  3EET A;  2CJJ A;  2M8G X;  2ZNZ A;  3OIO A;  1PUF A;  2M45 A;  1WSU A;  3KEQ A;  3CTA A;  2EH3 A;  2IRF G;  5FLX Z;  1IC8 A;  2LD5 A;  2VT2 A;  3LA2 A;  5ICC A;  5H6Q A;  2HWV A;  4FQG A;  2KMU A;  2QZ8 A;  4A69 C;  4OAY A;  3SDB A;  3LSP A;  4EEF G;  2RNG A;  2E35 A;  1SVO A;  3IP4 B;  3LWF A;  3A01 B;  1G3S A;  2DA1 A;  2GA2 A;  4KIS A;  3V42 A;  3WE2 A;  1LQ1 A;  3H9J A;  1XN7 A;  4Y4R A;  2XSJ C;  3K7A J;  5M3M J;  5TGT A;  3VSK A;  4U0Y A;  4IF4 A;  4M6Y A;  2XRL A;  4PK4 A;  4RB3 C;  5E17 F;  1QZE A;  4YFN F;  2O8K A;  3L1P A;  2FE3 A;  3KE2 A;  2CV0 A;  5HOD A;  1X4P A;  3PNY A;  1OCC H;  3OYK A;  1W0U A;  2LRE A;  5HLT A;  3JTH A;  3TOB A;  3DF8 A;  4YEL A;  4M9S A;  2W82 A;  1MBK A;  4YEJ A;  3IRQ A;  3H0D A;  3SJM A;  1WRJ A;  4OIN F;  2EJR A;  2M34 A;  2VE8 A;  2DOD A;  3PQK A;  2D1H A;  2AQE A;  1ETK A;  3OYC A;  4LGW A;  2LKP A;  3FMQ A;  1T8I A;  3FMR A;  2IGO A;  2IPQ X;  1PDN C;  3ZGK A;  3OYB A;  4ENM A;  1YO5 C;  3OL4 A;  2X1D A;  3ZQI A;  4CXF A;  2DLL A;  2FXA A;  2VPR A;  4NC8 A;  1I6X A;  5K7H A;  2VKE A;  1KU2 A;  2NAZ A;  2Z99 A;  2DOE A;  3MEX A;  1YW7 A;  1MBE A;  1JHH A;  4KJZ A;  4MFE A;  1XG1 A;  2X6Y A;  3CO6 C;  3U9G A;  2QSG X;  4CCO A;  2MSY A;  3PIO F;  4A12 A;  5DUI A;  3K0L A;  2DAO A;  3LST A;  3MZH A;  4G6T B;  1FBS A;  1RUO A;  1FSE A;  2RVC A;  4D5F A;  2IEK A;  2BY1 A;  5L3G A;  1T38 A;  4EVI A;  5KNL A;  2OPT A;  3HRS A;  2R7U A;  2VIX A;  2EZK A;  2OA4 A;  2ZSH B;  4LFU A;  3ABT A;  4RLF A;  3HOV J;  4BAC A;  2YS9 A;  3H92 A;  4HA8 A;  1LDK B;  3F21 A;  3HTS B;  2LTP A;  4BXX J;  3VOD A;  2JA8 J;  1W4M A;  3IWF A;  1U9O A;  4Y13 A;  1IRF A;  1W5T A;  3KZY A;  4HDU A;  5EG0 A;  3OYN A;  3NAU A;  4BYY A;  3H0G J;  5GP9 A;  4X6A J;  2KIM A;  3S1M J;  2A3S A;  4C2M J;  2FBI A;  4Y3O A;  2ECC A;  1VQL I;  3H5N A;  3C18 A;  5TJJ A;  3LOC A;  3OIP A;  2X9D A;  4ENK A;  2K86 A;  3QU6 A;  3KP4 A;  2LOO A;  3GBG A;  1IO2 A;  3L09 A;  4D5C A;  4D1Q A;  2Z5U A;  3JSP A;  1VQP I;  2KT0 A;  1JHF A;  3TBI A;  1YJW I;  2VQH A;  1U5T A;  1BOB A;  4UV9 A;  2ZB9 A;  4HYE A;  1IXS B;  4HST A;  2EIK H;  1GVJ A;  2QKM B;  4EAT A;  4MTE A;  2E7X A;  4HOB A;  2EBI A;  1HW1 A;  1R4N B;  3I71 A;  4IRG A;  1DDN A;  4RGS A;  4R8H A;  3ZQC A;  3AKZ A;  5DDG A;  1S5L C;  1KZH A;  3ERE D;  2XGD A;  4PGH A;  2M7A A;  3HKZ A;  5F0C A;  2EQR A;  2PN6 A;  4I98 B;  4EM0 B;  2HEO A;  2D5V A;  2L01 A;  2QM3 A;  3E0J B;  4V2G A;  2BZT A;  2CS3 A;  3AG1 H;  1U3E M;  2FJ1 A;  3GTM J;  4IOA F;  4K2E A;  1R6R A;  1W7P B;  1WJD A;  1VQK I;  3HOZ J;  1D0X A;  1RR8 C;  1O3T A;  2FQ3 A;  1RKT A;  2CSO A;  1DGR M;  3HBL A;  1ETV A;  3U1K A;  2PG4 A;  4KIF A;  4HF2 A;  3E7L A;  3BCA A;  4PSW A;  5BNG A;  1D5Y A;  1DGW Y;  2PJR A;  2OC6 A;  1BR2 A;  2F4O B;  1NH3 A;  1EKE A;  2ADU A;  3MQ0 A;  1C0W A;  3JRG A;  1W0T A;  3FXU A;  1Z05 A;  2VOP A;  1NHA A;  3GVA A;  4OMZ A;  1ETY A;  3E97 A;  1SFO J;  2QEN A;  4XMY A;  3LSI A;  2OAZ A;  1UFM A;  2DT5 A;  1VND A;  2ZKZ A;  1UZC A;  1BR1 A;  2M9H A;  1X1B A;  1ODD A;  2HPM A;  3CDI A;  1E17 A;  2K85 A;  2WBM A;  3ZMV A;  4XBF A;  3S1Q J;  3NEU A;  4B43 A;  4DJA A;  1BI0 A;  3ASN H;  4AU7 A;  3L2W A;  1YG2 A;  3KCC A;  4P55 A;  3BG5 A;  5FO5 A;  4QTR A;  5EF6 A;  4E7K A;  3GTO J;  2WY8 Q;  1Z7U A;  3V4G A;  4AVZ A;  3H1C A;  3VYR B;  2HXI A;  1I1G A;  2DA5 A;  4A3E J;  4Q5S F;  1MMN A;  2X1C A;  5DV5 A;  4BQA A;  1P6R A;  3G2B A;  4JX5 A;  1ZGJ A;  2XGE A;  1LEB A;  2LK2 A;  4L0Y B;  3BWG A;  3K1P A;  2LSO A;  3I54 A;  1OIS A;  3U2R A;  2ACJ A;  2BVM A;  2F48 A;  2BGC A;  2PJP A;  2EIJ H;  3ZQG A;  3WG9 A;  3K1M A;  3M1E A;  2KRF A;  3S17 J;  1JUP A;  1OPC A;  1TWA J;  3ZQL A;  4IRH A;  3V8J A;  4FHT A;  1U5T C;  2L7M P;  2Q0O A;  4II2 A;  2IS2 A;  3CO7 C;  1ZAR A;  4P5O A;  3WE3 A;  4IO9 F;  1O7L A;  1FTT A;  4CDG A;  1OYW A;  2JT1 A;  2PBI A;  2CU7 A;  3DEU A;  2MLG A;  4F92 B;  3H3V K;  2ID3 A;  1XGO A;  2Y31 A;  4DNC A;  1JGS A;  3BTL A;  3LSK A;  1W36 D;  3I59 B;  4I0A A;  2BY2 A;  3BY6 A;  1BR4 A;  3WTU C;  4BE2 A;  3ZR8 X;  3ZOB A;  2GAU A;  2JSC A;  3FK7 A;  3HPG A;  2Z2S B;  1AU7 A;  1TT0 A;  5B1A H;  2K3F A;  3M1C A;  5IT9 K;  1XGM A;  3DKW A;  2GWR A;  2VJ4 A;  1LE8 B;  1UHS A;  2FQ4 A;  5EEH A;  3JRB A;  5H2F C;  1OCZ H;  4KIT B;  1Y6I A;  5FKO A;  1T56 A;  3A4C A;  1T95 A;  4BBS J;  3ML6 A;  1LVK A;  1D0Y A;  3OYD A;  3MKZ A;  3R0J A;  3F23 A;  3BCB A;  2R5Y B;  5DS9 A;  1I1S A;  1X2M A;  4P1W A;  3FM3 A;  3R0A A;  1SVM A;  5LHI A;  4ZYE A;  1TTY A;  2ZXI A;  4HEA 2;  3S1R J;  4KNY A;  2Z3Y A;  4I99 C;  4RAY A;  2LKS A;  3RKX A;  1LE8 A;  2K9L A;  2C6Y A;  1XB4 A;  1E3P A;  4NC6 A;  4I0B A;  3HSF A;  2DYS H;  2LY2 A;  2O0Y A;  4Q47 A;  3E6M A;  2XB5 A;  4E6K G;  1K78 A;  2UXN A;  4E70 A;  4BHC A;  4A3I J;  2F5C A;  1R22 A;  4P9F A;  1OR7 C;  2VOD A;  4ITV A;  2JQ7 A;  5IP7 J;  2MGQ A;  3DPU A;  3SEQ A;  3UNG C;  4IZZ A;  4PJ0 C;  2R7Q A;  4C9Y A;  2V9V A;  3HOX J;  1VQ6 I;  1SAX A;  4M9X A;  1NG6 A;  4E7H A;  2DN0 A;  1HCR A;  1IXC A;  3BG7 A;  4BEH B;  1FOW A;  4LB6 B;  1YLF A;  2KKO A;  2HI3 A;  2BHY A;  3LFU A;  1E3O C;  1YW8 A;  3WGH A;  4B8X A;  2XGX A;  4F3Q A;  3MFK A;  4RDU A;  3HUG B;  4G7O F;  1QVT A;  5LRS A;  2F5E A;  3BTI A;  2EFW A;  1D1A A;  2N8G A;  1VQN I;  2ELK A;  4FT8 A;  2ZJQ F;  5IPA A;  1OFC X;  3OYA A;  3OYF A;  3QOP A;  3AL0 B;  4UB8 C;  2LVS A;  3ZQ7 A;  4E7I A;  4XLA A;  3RKY A;  1D1C A;  3GLL A;  2DYR H;  1ZRF A;  2W24 A;  2P5K A;  1VI0 A;  4LIU A;  3OY9 A;  2Y0S A;  3HRU A;  4NHJ A;  1BIA A;  2FML A;  2P5L C;  4FET A;  5TRD A;  2CUF A;  1R1V A;  2CRG A;  3C2H A;  4FE7 A;  2LY9 A;  2BOL A;  3TQN A;  1G6N A;  1GLN A;  3T1B A;  4A3F J;  1O3S A;  2IS4 A;  2Y2Z A;  1R5I D;  4ENN A;  1RES A;  2DFF A;  2M87 A;  1HF0 A;  2W85 A;  2OTL I;  5JHU A;  2PMZ A;  4ZTF A;  4M3E A;  5M5X J;  3CC7 I;  2GQQ A;  3QAH A;  4LMY A;  1MIJ A;  1HBX G;  2BW3 A;  1R5G A;  3LAP A;  2E1M C;  3SHF A;  1XC5 A;  2KPM A;  1YJ9 I;  4A0Z A;  5IOZ A;  9ANT A;  3MD2 A;  1ACI A;  2O03 A;  2MAB A;  1YX5 A;  1JUM A;  1B72 B;  1CF7 B;  3VYT B;  2JUG A;  3K10 A;  2XAG A;  5HVQ C;  2R3S A;  3CUQ A;  2CV2 A;  3HOS A;  3S2W A;  2L9R A;  2XRN A;  4KMU X;  1K6O A;  5A2Q Z;  1Y1W J;  5LHG A;  2LH9 A;  3AG3 H;  3BOQ A;  1XGS A;  1YIJ I;  3FBI B;  3S2H J;  3HC7 A;  4FE4 A;  1FMV A;  2NOJ B;  5HNH A;  1B8I A;  3KPH A;  2IVM A;  2JWT A;  2HOE A;  3BJO A;  2Y30 A;  2UZK A;  5D5U B;  3PQJ A;  3DWL E;  4ANJ A;  2H1L A;  1LNW A;  1U9N A;  2K27 A;  3Q9V A;  2PLY A;  2DMT A;  3CC2 I;  1Y1V J;  2R92 J;  1A31 A;  2Y48 A;  1N77 A;  2H8R A;  2QQ8 A;  3W6V A;  1PJR A;  2OBP A;  2WAE A;  4RB1 A;  4KMF A;  4EM1 A;  4F55 A;  1L3L A;  2P8T A;  3LNQ A;  1Z1D A;  3MCZ A;  2MH9 A;  2BXY A;  1ENH A;  2JZY A;  2A6T A;  1FP2 A;  4GO1 A;  3T0Y A;  2RKH A;  4HQM A;  1IUF A;  1YW9 A;  2DPD A;  2ZFU A;  1X1P A;  2BY3 A;  2IP2 A;  3A0B C;  2PFB A;  1R5H A;  1QRY A;  3ZMU A;  1E2X A;  1Y8Q B;  2XDV A;  2B0L A;  3ZP5 A;  1S72 I;  1WCM J;  4U0V A;  3S93 A;  3SXY A;  3H5R A;  2HQA A;  1ITY A;  4BGD A;  4KIG A;  1ZKG A;  2DI3 A;  2G9W A;  4UB6 C;  3HL2 A;  3KP2 A;  4LG3 A;  5E3L A;  5IOY A;  2ZBK A;  3M8F A;  1SFK A;  2HQN A;  4NB5 A;  1A35 A;  4Q4Z F;  1DP7 P;  2IGK A;  4Y33 A;  6PAX A;  3D1N I;  2ZC2 A;  1MH4 A;  2QGU A;  1OMI A;  1J5Y A;  3TDU C;  1UMQ A;  3PSF A;  3JRA A;  5L3D A;  5D5X B;  4CA0 A;  1IDZ A;  1LUJ B;  1R4M B;  4E7S A;  2CWE A;  2Q2E A;  5BPI A;  4PJJ A;  2NVX J;  2HOT A;  1FYM A;  1XDS A;  1XSX A;  2XKO A;  2ICW G;  2E1C A;  2Z1D A;  1TQP A;  1R1T A;  3BJA A;  2XAQ A;  2R93 J;  2ZFW A;  4ZDP A;  4BUP A;  4L9J A;  3P5J A;  2MA3 A;  1WJB A;  2EZI A;  1B59 A;  4EM2 A;  4C2U A;  4FCY A;  3I56 I;  4CCM A;  4EQQ A;  2FU4 A;  3AL0 C;  1IAW A;  3S16 J;  1FLI A;  3GZ5 A;  3JW4 A;  3DTI A;  3G71 I;  1P9Q C;  2QYO A;  4EJU A;  3OS1 A;  4HV6 A;  5GAG J;  2M0C A;  4FTH A;  2KIS A;  3V7S A;  2F2E A;  1JTX A;  2EFQ A;  3IWZ A;  3WTV C;  2LRD A;  2HKO A;  1RR7 A;  5CPR B;  1ZLK A;  2Z9O A;  1EF4 A;  4CCN A;  2JN6 A;  3FBN B;  4FAS D;  3DLL F;  3VOE A;  4IOC F;  1G3Y A;  2J5O A;  4BBR J;  2IA1 A;  4OU0 A;  2CW7 A;  3W6K B;  1Z3Y A;  1XD7 A;  5B66 C;  2EPF A;  2KZV A;  1JUS A;  4XOT A;  3GTK J;  1IF1 A;  1ZRC A;  3OR2 C;  3SEZ A;  4L9T A;  2KZG A;  2VLA A;  2AXL A;  1K6Y A;  2KIQ A;  4RM3 A;  2LF8 A;  2ZO4 A;  1IRG A;  1QZZ A;  3MKY B;  4LD5 A;  1X3U A;  2IGM A;  4ZYD A;  1I3A A;  1A6Q A;  2YUS A;  5J1U A;  3EYI A;  2YU3 A;  1BBY A;  2OD5 A;  4ZDO A;  2NRA C;  1MBJ A;  4LIV A;  4N0B A;  4WCG A;  1OJL A;  2GM4 A;  2GIV A;  3E3V A;  4N4N B;  3CME I;  1FSH A;  4IVN A;  4O5V A;  2Y9Y A;  2NVU B;  2V79 A;  3M3Y J;  4DZJ A;  3VYU B;  4MIM A;  1LKX A;  3BTC A;  3HOT A;  1IG7 A;  2B63 J;  5J47 A;  3CCY A;  1SAU A;  4J00 A;  2NOG A;  2A69 F;  2O3F A;  2OQG A;  2JK3 A;  1S6L A;  4DW6 A;  3OOP A;  1I27 A;  4A93 J;  3BP8 A;  1FOK A;  5FD5 A;  2XUB A;  2FEZ A;  4LK1 F;  2O8X A;  3G3Z A;  3DBR B;  5E8G A;  3GFM A;  1Z6T A;  3LSR A;  1ONV A;  3BG3 A;  5L3E A;  5EGO B;  5AIQ A;  4F7Z A;  1K79 A;  1V5F A;  4JP0 A;  4XLC A;  4X1E A;  3BC8 A;  2PEX A;  1N75 A;  2EZH A;  2VC0 A;  1V55 H;  2R7R A;  5EZH A;  3DLA A;  5KK1 A;  1ZLJ A;  3WG7 H;  3RKW A;  3CCU I;  4I2O A;  4BL0 B;  3CDH A;  1YE9 A;  3FMS A;  2ZXH A;  2JVG A;  4XID A;  5EG0 B;  1LDD A;  4PJL A;  5EEA A;  3ECO A;  4AYB N;  2K9S A;  4KA4 A;  1W36 C;  1WVR A;  5HLG A;  1T33 A;  2W7N A;  2DMP A;  3K70 C;  1FC3 A;  2M3A A;  4A3G J;  2RQQ A;  2PI0 A;  1R23 A;  3S3N A;  2E7W A;  1MMG A;  3A1Y A;  3BG6 A;  5DD8 A;  5IY5 H;  3H9Q A;  1SEU A;  1USS A;  1TW3 A;  3ABU A;  4I02 A;  3I4N J;  5HLH A;  1APL C;  1FZP B;  1T08 B;  3SZT A;  2LYC A;  2GLO A;  4CHU A;  4KN4 X;  1GHC A;  2KDZ A;  3CLO A;  3FXJ A;  1MD0 A;  3L2Q A;  2GIZ A;  1FBQ A;  4WXD A;  4M3D A;  5FFZ A;  3RYR A;  1ETW A;  4HNV A;  3W2A A;  3G1O A;  2TRT A;  4HNT A;  1REP C;  5D6E A;  1A36 A;  2X85 A;  5M3F J;  1P92 A;  2CMP A;  3PUB A;  2CO5 A;  2DW4 A;  3ABK H;  3FIW A;  3CC4 I;  1JKQ C;  3AG4 H;  3ELK A;  3FHZ A;  2DT6 A;  2H27 A;  1KQ0 A;  1JKP C;  3LA3 A;  1YYV A;  3CUQ C;  3E6B A;  3QOE A;  2OZU A;  1G2H A;  3ROU A;  3K4B A;  1SAN A;  5J3L A;  3O6B B;  2I8D A;  2XPW A;  4A3C J;  3GWZ A;  3SZG A;  3ZQF A;  4XNF A;  3G6E I;  1VQM I;  1B9M A;  2QKL B;  4O6J A;  5EGO A;  1X4O A;  3J81 Z;  3IRR A;  3ZRG A;  3KP6 A;  3RCO A;  2R7X A;  4UV8 A;  4ZDL A;  5F6F A;  1YJN I;  3GYH X;  2HXO A;  3BR6 A;  3T5X A;  2LR8 A;  2IT0 A;  4GDF A;  2DFE A;  5CQE A;  4RAG A;  3S2D J;  2HOA A;  3TO6 A;  4GCV A;  3ZPL A;  2M4K A;  1KU7 A;  1VQ5 I;  3GTG J;  1Q1V A;  2QQ9 A;  3B73 A;  4GXO A;  2VJJ A;  5FGM A;  4BJT A;  5ED4 A;  1PP8 F;  2L4A A;  4D7M A;  1FT9 A;  1Z67 A;  3GME A;  2KJB A;  5LRR A;  5E20 A;  3KIO A;  1IN5 A;  2K9N A;  5J1R A;  2ZCW A;  1FOX A;  1U0J A;  4CYD A;  3R4K A;  2X6O A;  2P7C B;  3FXM A;  2ZJP F;  2H94 A;  4KUM A;  2DDB A;  2OF7 A;  1RZ4 A;  2GOX B;  3SQN A;  3FX3 A;  3TKY A;  5E3M A;  3OYI A;  2MG4 A;  2YSR A;  2EB7 A;  4ABZ A;  4BXF A;  4EGY A;  1Z0X A;  3KEY A;  5D4R A;  5E3O A;  1IN4 A;  1Z9C A;  2EIL H;  3BR2 A;  3JR9 A;  3PFY A;  3WU0 A;  5F1J A;  3I64 A;  2NVT J;  1R9T J;  2R7F A;  2P0W A;  3F6O A;  4AIH A;  4BU2 A;  1GT0 C;  1B72 A;  2MD5 A;  3ZN0 A;  3AG2 H;  4MQV A;  3BZ6 A;  4UY8 I;  4G6Q A;  1HST A;  3HXL A;  5DCM A;  3P7N A;  1NTC A;  2BV6 A;  3ZMS A;  3LAJ A;  5FRM A;  1QHG A;  2Y0M A;  1YRN A;  2XV4 S;  2JTV A;  2BW3 B;  4A3J J;  2WAQ N;  3RPU A;  3CCM I;  4MO7 A;  2MLK A;  4HW0 A;  4BNC A;  2DTR A;  3R60 A;  4AM3 A;  2DT7 B;  2ME6 A;  4AID A;  2E2J J;  3S15 J;  2EV6 A;  2AHQ A;  1ZAO A;  4QPQ A;  3D0S A;  3H35 A;  1ZH5 A;  2FD5 A;  4AD9 A;  4LOC A;  1BA5 A;  4HF1 A;  1CQT A;  2RGV A;  2VXD A;  3LFK A;  4OIO F;  3M07 A;  3KLO A;  5KAI C;  4XSZ F;  5CVR A;  5D4S A;  1WFX A;  4ZZL A;  5L3F A;  4G8X A;  4KT5 C;  3K1N A;  3GFJ A;  3I4M J;  2BBY A;  1EA3 A;  1WJ5 A;  2HYF A;  3F9K A;  5TIS C;  4BY1 J;  2HOS A;  4CCL A;  2R4G A;  3K4J A;  3L9F A;  1JKR C;  4HLY A;  2XHK A;  4YG2 F;  1O4X A;  1KYW A;  2COB A;  2V1U A;  4MEY F;  1QQI A;  4A3L J;  1K61 A;  2EFN A;  2Q8K A;  2FMY A;  4N9H A;  2KRH A;  2ZME B;  3L2U A;  4RM2 A;  2L7K A;  4JK1 X;  2XIG A;  1IRX A;  1WQ2 A;  5ILS A;  3O2P E;  2BE5 F;  2CUZ A;  2KFD A;  4N4O B;  4CUG A;  1F43 A;  2M30 A;  3F72 A;  1G59 A;  4GRI A;  3E1S A;  4OMY A;  4NQW B;  3F8N A;  1NK2 P;  5HDN A;  2LKX A;  2FSW A;  2G7U A;  1L0O C;  2PX9 A;  2RQP A;  2B9S A;  2E19 A;  1BW5 A;  1WPK A;  1MNM C;  2R7O A;  3IUO A;  3ONQ A;  4QPO A;  4G6D A;  1MKM A;  1W7P A;  4W1U A;  3QWL A;  3HOY J;  1K78 B;  3ZN1 A;  4L5I A;  3S8P A;  1P2F A;  2CYY A;  3E6D A;  3DU5 A;  2XF5 A;  3Q0W A;  4OIR F;  3PSI A;  4ETS A;  5JR3 A;  3HRM A;  3RQI A;  1U78 A;  1H9T A;  1VQ9 I;  1N25 A;  2IAI A;  2K40 A;  2ESH A;  4LG0 A;  2VQC A;  5IYB J;  2W00 A;  3PL8 A;  5CVV A;  4ASN A;  2R5Y A;  1ZR2 A;  1IN8 A;  2K02 A;  4XOR A;  4G9Y A;  3CES A;  5H6R A;  2W57 A;  4BKX A;  1GVD A;  2O5R A;  3K2A A;  1GXQ A;  4B09 A;  1QHH D;  1WHU A;  2VJI A;  1MH3 A;  4CCK A;  2BXZ A;  3VWB A;  2HFH A;  2V1N A;  5ICF A;  1IZ1 A;  1W5C C;  2QF7 A;  5LGU A;  1X3Z B;  1ZEL A;  4R1H A;  2KRC A;  3ABM H;  4WXC A;  1OLT A;  3CJN A;  4BQN A;  1IN6 A;  2V1X A;  2VB6 A;  3HHG A;  4M3G A;  5JVT A;  3JTG A;  2FA5 A;  4IX7 A;  1JJ6 C;  3EYY A;  5HLI A;  3EUK L;  4CGZ A;  4MEX F;  3V7R A;  3DKX A;  2VKH A;  2F5V A;  3U1D A;  2LP0 A;  1I50 J;  1STZ A;  1LFB A;  1Y0N A;  1EH7 A;  3J81 K;  1OYI A;  1H8A C;  3WOD F;  1LEA A;  1WKM A;  4NQW A;  5DM7 F;  1TZL A;  1GXP A;  2VPL A;  1LPQ A;  1OCR H;  4Q48 A;  1JJ8 C;  2EZL A;  5AON A;  3QPH A;  5LGN A;  5CQG A;  2HKX A;  1RUN A;  4HSR A;  1HDP A;  2JPB A;  2MYS A;  3BQY A;  1AHD P;  5C4X J;  4XKC A;  5K7Z A;  4Z2Y A;  4DYQ A;  5HS7 A;  3CCR I;  2LC2 A;  1AKH B;  2CG4 A;  3CQZ J;  4C3I J;  4EJW A;  2LY1 A;  5E8I A;  1O57 A;  3HSR A;  3C3W A;  4U7B A;  4ZTJ A;  3WTS C;  1ZGW A;  5K5R A;  2L9V A;  2RAE A;  4L5J A;  4M3B A;  2RC4 A;  2DDA A;  1R36 A;  3KEO A;  3HSE A;  2DPU A;  2VBY A;  4V2F A;  2VKV A;  1X1D A;  3GEZ A;  1FPQ A;  3L7W A;  4D0P A;  3I0T A;  2NNN A;  5IT3 A;  1ETQ A;  2MC4 A;  5FLM J;  2L3D A;  1GV5 A;  1MMA A;  3L00 A;  1J59 A;  2E36 A;  3V8K A;  2WB1 A;  3Q9S A;  2Y69 H;  5E3N A;  5IP6 A;  3HYI A;  2K7L A;  1FTZ A;  3BLY A;  3UKG A;  3JRE A;  3RTR A;  3HJE A;  2QA4 I;  4OAZ A;  1ZHF A;  2RV8 A;  4C3J J;  4LK0 F;  1FX7 A;  4QLC U;  4UUV A;  1MNE A;  5FFX A;  3FXR A;  2A6E F;  3IKV A;  4IPA A;  3GTJ J;  1X19 A;  2OQR A;  2BHZ A;  4BEH A;  2KQR A;  1WI3 A;  3PM1 A;  1OR7 A;  1WI9 A;  3O8H A;  1EH8 A;  2R7V A;  1Q1H A;  4A2U A;  2XF6 A;  4DBQ A;  2Z16 A;  3RSN A;  1HA8 A;  4AUX A;  2X1E A;  2KP6 A;  1QGP A;  5FKN A;  4QIW N;  1FBU A;  3X2Q H;  3VSL A;  3QPS A;  3CCQ I;  2JUC A;  3HB9 A;  1X2N A;  2OU2 A;  4A0Y A;  2E1N A;  3FXQ A;  2GA1 A;  1TBX A;  2HQ5 A;  2RDP A;  2YR2 A;  5JLW A;  2JA6 J;  3FXO A;  4BDY A;  3S14 J;  1ETX A;  3WHB A;  4RB0 A;  5DM6 F;  3C1D A;  3F8F A;  2AS5 F;  1FIP A;  3QYF A;  4L0Z B;  2GXG A;  2IA2 A;  1XSD A;  3QU3 A;  3QYB A;  2M0M A;  1UEL B;  4KIB A;  2AQF A;  1RET A;  1TNT A;  4M9Z A;  4AYB A;  3OS0 A;  4HDV A;  2QCO A;  3HOU J;  1T0F A;  4IL6 C;  3ZMZ A;  2O6G E;  4A6E A;  5F08 A;  3FIS A;  3DV8 A;  3FHN A;  2YU9 J;  4NC7 A;  4PJM A;  2E34 A;  1SFU A;  4GFB A;  1V4R A;  2PMU A;  2TDX A;  1YI2 I;  3CJQ B;  4D9J A;  3A03 A;  4M74 A;  4IHT A;  3KP5 A;  2DJN A;  5E1Z B;  1HDD C;  3MKW B;  5IYD J;  1ERD A;  2UV1 A;  4UUS B;  2CUJ A;  3IH4 A;  2E5N A;  3A0H C;  3FXL A;  4HZF A;  3WTZ A;  4V19 K;  2WAD A;  1KQ8 A;  3CP8 A;  3WTW C;  4N9I A;  5ERI A;  2EFP A;  3ULQ B;  5BQT A;  2XSD C;  2XKP A;  3EUH A;  3TO9 A;  2LMD A;  4DZP A;  1R71 A;  1Z3X A;  3JRD A;  1HSJ A;  1TNS A;  3CCS I;  4OWR B;  4IQ4 A;  3MWM A;  3OOU A;  2JJ7 A;  2MW8 A;  1DU0 A;  1UG2 A;  1R49 A;  1LJ9 A;  2IA0 A;  5F0H A;  2R7W A;  4BE0 A;  1NK3 P;  2CGP A;  1ZTR A;  4XIC A;  2O9L A;  4UUS A;  2Q1Z B;  2L7Z A;  2CFO A;  3COA C;  3SFZ A;  1BJA A;  3IH3 A;  2P6T A;  3CP2 A;  5HS8 A;  3M8E A;  1FWZ A;  1WWX A;  1PYV A;  3MAJ A;  4UVC A;  1MND A;  1X1C A;  3NWT A;  3CCE I;  2X51 A;  1I39 A;  4IKF A;  1WJF A;  4A3K J;  1LFU P;  3BR0 A;  2ECB A;  4FX4 A;  1F36 A;  3F22 A;  3VPR A;  4XOP A;  3SFI A;  3T8R A;  1V3F A;  1X3W B;  1E0E A;  4BJ6 C;  1V54 H;  5KVR A;  1W7P D;  5K5Q A;  3D5R C;  4CIC A;  3D5L A;  2EFO A;  1MJB A;  1WJE A;  5EEG A;  3W2V A;  1Z77 A;  3I5U A;  2RRE A;  4EJT A;  2JRT A;  4YFK F;  1ETO A;  3EUH C;  3PNT A;  4L5E A;  4YIR X;  2DCE A;  4EJV A;  2X4H A;  5DCF A;  2D2W A;  3OR1 C;  2D45 A;  2R7D A;  1MBG A;  2MC3 A;  2EV5 A;  1D8K A;  1HOM A;  1G3W A;  2GXB A;  5L3B A;  2DFI A;  3K69 A;  1OYY A;  4ESJ A;  2M2E A;  1P7I A;  4RAZ A;  5K1Y A;  2F5F A;  2JA7 J;  1EH6 A;  2QQA A;  4HLX A;  5J1Y A;  2HNH A;  3U21 A;  3K4C A;  5D8L B;  2PJR B;  3CF2 A;  1ON1 A;  1BC8 C;  4XN0 A;  2VOO A;  2DO7 A;  3TGN A;  1TWG J;  4DYC A;  2R7S A;  4XLN F;  1ZN2 A;  4JQF A;  4DIQ A;  1MDM B;  4XLP F;  1IN7 A;  2XPV A;  5JLX A;  1P4X A;  1YIO A;  5JI6 A;  1AWC A;  1TC3 C;  4KYW A;  2V1D A;  2Y75 A;  3W6J B;  3RI4 A;  4CYC A;  1S9H A;  1UST A;  2GOM A;  2P4W A;  4MQ9 F;  4ZYG A;  3IL2 A;  3Q5F A;  2KDO A;  4LJZ F;  2CQN A;  5B3S H;  1XCV A;  2CQK A;  2DA4 A;  2JA5 J;  1KGS A;  1QPM A;  5HNF A;  2DK8 A;  2OJE D;  1N78 A;  2GXA A;  2DXI A;  3P9I A;  3GXO A;  1J0R A;  5FKM A;  1XTA A;  3FKI J;  2DJI A;  5E18 F;  3DBH B;  1OKR A;  5KCM A;  1H89 C;  3JAM Z;  4NBQ A;  4L9V A;  1MZB A;  2EIM H;  2XAJ A;  5ILV A;  1H0M A;  2STW A;  2EWN A;  5M5W J;  3BZC A;  2VKD A;  1HW5 A;  3GCM A;  1KYZ A;  3PFI A;  3CCJ I;  3REO A;  5FJ8 J;  4XKW A;  3CF5 F;  3QRF F;  4I7H A;  2VJ5 A;  3HG9 A;  2EIN H;  1FNN A;  2CUE A;  2P81 A;  1J09 A;  2UUZ A;  1BOA A;  2L4M A;  3GUD A;  4RMN A;  5CVU A;  2K4J A;  1QA6 A;  3TP0 A;  1UB9 A;  3GTQ J;  3OYH A;  1ZR4 A;  1ZGA A;  3JSO A;  5C44 J;  1UJ8 A;  4AWX B;  3HIF A;  4XR6 A;  4CO8 A;  5FRO A;  1O3R A;  3RPU D;  1F4K A;  5ILU A;  3HDD A;  3QYE A;  4W97 A;  1A04 A;  1YS7 A;  3HM5 A;  5E1W A;  2ME0 A;  5ICE A;  3IC7 A;  2CW0 F;  3F0C A;  1SD7 A;  3BT9 A;  3VDX A;  5F64 A;  3I58 A;  2WAF A;  5CVI A;  1Y0U A;  1AA7 A;  3TOA A;  4RGU A;  1JT6 A;  3W3C A;  2A61 A;  1AOY A;  1M1E B;  3CLQ A;  2DA3 A;  1Z21 A;  1IUY A;  3QP6 A;  4XM3 A;  3PJR A;  4UVB A;  4FX0 A;  4ESB A;  3QPL A;  5DD4 A;  3JRI A;  2QBY B;  1TT5 B;  1V5E A;  5M5Y J;  1OCO H;  3BR5 A;  1FYL A;  3IAS 2;  1VF9 A;  2FOW A;  2L7F P;  3RJP A;  3B6C A;  5FLX K;  1VQ4 I;  5J4Y A;  2NVQ J;  3H36 A;  3IV5 A;  2R0Q C;  4CSW A;  3H3Z A;  1Z91 A;  2OUM A;  2V9K A;  3WU2 C;  2X6W A;  1IGN A;  3PNV A;  4A5N A;  3WTY C;  1XMK A;  5JFR A;  3M4O J;  5HDG A;  1TLH B;  3QOD A;  2BVL A;  5D5V B;  4S0H B;  4CZZ A;  3H9G A;  1Z6R A;  1QVU A;  1B1B A;  1XMX A;  1JXS A;  4RB2 C;  4EJO A;  5HS9 A;  4A0X A;  5JVG F;  3A2K A;  4GYG A;  3ZQQ A;  2LG4 A;  1D8J A;  1J9I A;  1XGN A;  2HU9 A;  4RS8 A;  4R79 A;  1POG A;  5FB2 A;  4G12 A;  1P4A A;  4P9U A;  1FIA A;  3KP7 A;  2ZME A;  2VC1 A;  3S32 A;  3E5U A;  4XKB A;  3RPQ A;  2R5Z A;  2ZSI B;  1IV6 A;  2WY7 Q;  4ESF A;  2EK5 A;  3RQ4 A;  1JKO C;  1HKT A;  2HYG D;  3CJR B;  3CDL A;  2OCC H;  2DA7 A;  4XN3 A;  3BR1 A;  2VBZ A;  5GAH J;  3WTT C;  3KZZ A;  3BRO A;  3Q3S A;  3QQA A;  4NDL A;  2VON A;  1XSV A;  1QZY A;  3HRT A;  3TW6 A;  3LSJ A;  4Y52 J;  3K9T A;  4MFD A;  2L5Q A;  3T8T A;  1FP1 D;  2EA4 A;  2XAF A;  3LSM A;  4UNO A;  3J7A O;  5K7F A;  1BM9 A;  2WB1 N;  1MMD A;  2YPR A;  1K4T A;  1F9N A;  1T0F C;  1HQC A;  3HEF A;  1VQO I;  5B1B H;  5LFA A;  3N97 A;  4ZC3 A;  1BIB A;  4KN7 X;  3I59 A;  4HG2 A;  2A07 F;  1PUF B;  4H0E A;  4BS9 A;  3KP3 A;  4S04 A;  1R7J A;  3PUF A;  4WK8 F;  3BQZ A;  1ZRD A;  4OIP F;  3TMO A;  1T2K A;  3KFW X;  3B6A A;  4EGZ A;  1AKH A;  2QLZ A;  5LEJ A;  1HC8 A;  5F04 A;  3Q0V A;  4BXU A;  1KU9 A;  3GFL A;  3FK6 A;  3K4N A;  1RIO H;  3K6G A;  5BMZ A;  2JMW A;  4Z6Y A;  3I9V 2;  4IHX A;  1ZRE A;  2HVQ A;  5DEQ A;  3JCU C;  5FLV A;  2MFZ A;  2O7O A;  2UWM A;  4E7J A;  3OYM A;  1D1B A;  4I09 A;  4WF2 A;  2G7H A;  1T6S A;  4S05 A;  4HBL A;  1HW2 A;  3KYC B;  4I01 A;  5F0F A;  3JAM K;  3NRV A;  3W2W A;  1BL0 A;  3OS2 A;  1FEX A;  4Y17 A;  2WC2 A;  1RC9 A;  2ELJ A;  4EV0 A;  3BZK A;  4MHG A;  4IJA A;  4XLF A;  2K9M A;  4DOZ A;  3I53 A;  3C2B A;  2E2H J;  4JX4 A;  4RGR A;  1K83 J;  3FWE A;  4IXA A;  2IGN A;  1RRJ A;  1U8B A;  4ZJZ A;  2ZXJ A;  1SFX A;  2WV1 A;  1W1W E;  3GLX A;  1X58 A;  3N05 A;  1H88 C;  3ZMD A;  3CCL I;  2DBB A;  2FUG 2;  5F27 A;  5K5O A;  3D5S C;  1MJA A;  1MJ9 A;  2DK5 A;  4B1R A;  3DPL C;  3GX4 X;  1T39 A;  2WA0 A;  4UUT A;  3RZD J;  1K7A A;  3GZN B;  3E5Q A;  3H5A A;  3N4M A;  1ZG5 A;  1KON A;  2A05 A;  2IS6 A;  2KIU A;  2JA2 A;  4Y15 A;  4YRV A;  2K9Q A;  2DTZ A;  2IW5 A;  4NNJ A;  4U87 A;  5J4V A;  2HR3 A;  2XC7 A;  3GTP J;  4B48 A;  2QSH X;  3V7C A;  4XQF A;  1Y39 A;  1YIT I;  1G3T A;  1LB2 A;  4RBO A;  3NQO A;  3TL4 X;  4IHV A;  3K4L A;  2JRM A;  2HDC A;  5GTI C;  2DFH A;  2IBD A;  3L2V A;  3G1M A;  1ULY A;  1SD6 A;  2UXX A;  2FBK A;  3V8L A;  2WTE A;  4HNU A;  3WTX C;  4G94 A;  2E1M B;  4PCQ A;  4C30 A;  2W4S A;  4HRI A;  3ESW B;  4RGX A;  2IS1 A;  2FOK A;  2QUF A;  4C3H J;  3OYJ A;  3JRF A;  1QO0 D;  1OQY A;  2FNP A;  3DU6 A;  1TQM A;  2W1O A;  4IEJ A;  1J7K A;  1WH7 A;  3TP3 A;  1YQA A;  3I4P A;  2XB0 X;  3RKQ A;  3HGY A;  4ZYH A;  2RNJ A;  4A5M A;  2H6C A;  3OYE A;  4E4H A;  4Y7N J;  1F5T A;  1S7E A;  3BTJ A;  4DQ2 A;  1YFH A;  4RLQ A;  1D3Y A;  4UXN A;  2MBF A;  3DXJ F;  1YHQ I;  3HGG A;  2ZJR F;  5FKK A;  3CZ6 A;  3F8C A;  2ISY A;  1V5G A;  4M73 A;  1QNT A;  2L2O A;  3O8G A;  4M3F A;  4DYR A;  1DPR A;  3FZV A;  1UHM A;  3J80 K;  4XK4 A;  2STT A;  4U7D A;  1HKS A;  1LDJ A;  2DQL A;  1VFC A;  2EA2 A;  1TQI A;  4AIJ A;  2CQQ A;  1BI1 A;  3VFZ A;  3KYL A;  3MVP A;  1MDM A;  3S3O A;  1MSE C;  1U8R A;  1VQ8 I;  2F4I A;  4BAY A;  4QSH A;  1SMY F;  3DTE A;  2VE9 A;  5FRN A;  3OSF A;  3HOW J;  3K70 D;  3HTU A;  2LF7 A;  3CD6 I;  5H20 A;  1Y8R B;  4GYI A;  2A5Y B;  1IXR C;  1WZ2 A;  2CH0 A;  3DPT A;  4HX8 A;  4DGW B;  3ECH A;  2TCT A;  5DCM B;  2W48 A;  3BPV A;  2L54 A;  1ZYR F;  1A6I A;  1PUE E;  3MZY A;  4U0W A;  4MTD A;  5DTD A;  4JOM A;  3O3K A;  3P9C A;  4HPQ A;  4HV5 A;  4M72 A;  4KFC A;  2NS7 A;  5J8F A;  4ENJ A;  1ZQ3 P;  3HKZ N;  3L2C A;  4L18 B;  2FBH A;  1PVE A;  2FX0 A;  4IRI A;  1JI8 A;  3PO2 J;  3F3X A;  1KQ9 A;  1BC7 C;  1U6G A;  3KX2 A;  3LL7 A;  1J2X A;  5EZG A;  2E5Z A;  2F5D A;  3QP5 A;  2V7F A;  5KHD A;  3GTL J;  5FKL A;  4MGR A;  4AC0 A;  1Y56 A;  2OCE A;  1VTN C;  4IHW A;  1FYK A;  2H1K A;  2NVY J;  5LBQ A;  3M8J A;  4CYC B;  4HAM A;  1YX3 A;  1TWC J;  3HPH A;  2K4B A;  2YX7 A;  5C4J J;  3RZO J;  5J40 A;  2I5U A;  4PSX A;  1IV8 A;  3NAR A;  1J75 A;  4CZC A;  2M1B A;  4YIF A;  2M5W A;  5C3E J;  2M4G A;  4PFP A;  1W5S A;  4PFO A;  1YS6 A;  1IJW C;  1U5T B;  4XSX F;  2Z33 A;  1BW6 A;  3F8M A;  3IH2 A;  2QVO A;  4E7Z A;  1YOV B;  5GPC A;  1RKW A;  2P5V A;  3AAF A;  5GTH C;  2DMQ A;  3HHH A;  5DUK A;  3R6S A;  3WGG A;  2VBX A;  1BN5 A;  1SD4 A;  2B7E A;  2IJL A;  3IHU A;  4JBA A;  4WXH A;  1S29 A;  3AFH A;  4XRS G;  5ICG A;  1CGP A;  1GDT A;  1A5J A;  3E6C C;  3MMY B;  1RNL A;  1ON2 A;  2DMN A;  2R7T A;  2XAH A;  3CMM A;  4M71 A;  3GFI A;  3I3L A;  2E2I J;  5B5E C;  1XX5 A;  2HTJ A;  4I76 A;  2W25 A;  1NG7 A;  4HF0 A;  3P9K A;  5E79 C;  2HQR A;  3MKL A;  2VT3 A;  3JRC A;  3SZP A;  3L2R A;  2P6S A;  3NWS A;  1GV2 A;  1VZ0 A;  3ISP A;  4F93 B;  1BI2 A;  3M9A A;  3DBL B;  2HYJ A;  3S3M A;  2HPI A;  2P7V B;  4G7Z F;  2DMU A;  1GUU A;  4MNU A;  3BJ6 A;  3FM5 A;  2GBY A;  3B02 A;  1ZG3 A;  2VXZ A;  2XPU A;  4F91 B;  1XPX A;  2XGC A;  3LA7 A;  1R58 A;  2BYV E;  2PQ8 A;  2XVC A;  2I10 A;  3BR3 A;  3F8B A;  4A3M J;  2Q2E B;  3CJT B;  4IHS A;  4PZJ A;  2LLK A;  3GO5 A;  2WAQ A;  4CCJ A;  4EMS A;  3ZCO A;  3J7A Y;  3HUG A;  3BDD A;  4LG0 B;  4X0G A;  5IP9 J;  3FF5 A;  1MBF A;  5DYM A;  3IAM 2;  1S8N A;  4HX4 A;  2E71 A;  4UVA A;  1X1A A;  1XDU A;  3G1L A;  1TWH J;  1XMA A;  3LMM A;  3DQV C;  5D5W B;  4D7N A;  3FDY A;  1UG0 A;  3WU1 B;  2JPC A;  5EDN A;  2D1V A;  1T98 A;  1MBH A;  4I6Z A;  4B44 A;  4J01 A;  3IKT A;  1DP3 A;  1YTY A;  1JT0 A;  2A5W A;  4HQE A;  1RI7 A;  2V4J C;  5HOO A;  1FMW A;  4BE1 A;  1G4D A;  1RPW A;  1HLV A;  4O3M A;  1JTY A;  1LVA A;  4ZZD A;  5L3C A;  1QBJ A;  3KYD B;  3S1N J;  1R00 A;  2ZNY A;  1SVL A;  4G7H F;  2VAS A;  1SFE A;  3VB2 A;  2ELH A;  5LD2 C;  2WV0 A;  3ABL H;  2J5P A;  1UHW A;  3GZ6 A;  1WJA A;  2XAS A;  1VQ7 I;  1TWF J;  3DKY A;  1TP4 A;  1XS9 A;  3EDP A;  4AIK A;  2YX4 A;  4C2T A;  4A3D J;  2XRO A;  1PP7 U;  2MD0 A;  2QWW A;  2V6E A;  2V26 A;  3RDI A;  3J80 Z;  2HTS A;  2LDU A;  4PJN A;  2H6B A;  2CFX A;  4II3 A;  4XRF A;  4U88 A;  2HDD A;  2XF7 A;  4DBR A;  3A01 A;  1D0Z A;  3ERM A;  2ZJ2 A;  4JYK A;  5CYV A;  4KT6 A;  3TO7 A;  2QEX I;  4B47 A;  5GAD J;  1MSF C;  3WGI A;  2V6C A;  1MGT A;  2CQX A;  3LSG A;  5LHH A;  2AXT C;  1P7J A;  3BG9 A;  2ISZ A;  3VEP A;  1B8I B;  1IW7 F;  1DU6 A;  4AVP A;  4XRS A;  2NNY A;  4BQQ A;  2K5C A;  4IHY A;  5F1R A;  3ZXS A;  1KA8 A;  4BY7 J;  4M6X A;  1H9G A;  4L9N A;  2VQG A;  1I3Q J;  4BDZ A;  2ETH A;  2W84 A;  1DUX C;  3GF2 A;  2VBW A;  4LLN A;  2BY0 A;  2KIF A;  1CF7 A;  3DEW A;  2VN2 A;  4JX6 A;  2ZME C;  4WWC A;  2OV7 A;  4KDP A;  1YRN B;  2JSP A;  3EPZ A;  1BI3 A;  1OCP A;  1SD5 A;  2IXS A;  4B3A A;  2MH2 A;  3MN2 A;  3F6V A;  4MLO A;  3DCF A;  2QSF X;  4XRM A;  4TV7 A;  5D6F A;  1IDY A;  3LQQ A;  3VYS B;  1MW7 A;  2HS5 A;  3DP7 A;  1I5Z A;  2CW8 A;  3H3U A;  4B4C A;  3EQL F;  2OZ6 A;  3CMY A;  1JE8 A;  2NS8 A;  1WGX A;  2K3P A;  2FRH A;  5KAF C;  3G73 A;  3M7G A;  2KLO A;  2L02 A;  4WX9 A;  3R61 A;  2HZT A;  2PMZ N;  1ZG1 A;  4YFX F;  2E60 A;  2ZXW H;  2R7Z J;  1P4W A;  5J8C A;  3FKJ A;  5BOX A;  1WJC A;  3GW2 A;  2BEO A;  3EUA A;  4PGG A;  3G4S I;  3SYT A;  1FY7 A;  2EV0 A;  3LQR A;  3TW7 A;  1B9N A;  2L9S A;  3C2G A;  3CCV I;  4RAF A;  2FNA A;  2PMH A;  3ASO H;  2Y0S N;  2QQB A;  2VL8 A;  3C7J A;  2X6X A;  5GAE J;  4GGG A;  3DEE A;  4UHT A;  5AIP A;  3I55 I;  2R5Z B;  2LBF B;  5J6X A;  2X48 A;  4OIQ F;  4A6D A;  1Z7L A;  1FJL A;  5A2Q K;  2V9P A;  4B3X A;  5EYR A;  2A6H F;  5HDK A;  1D5V A;  2XAU A;  1OCT C;  2JVH A;  4BJ5 C;  3K2Z A;  1IRZ A;  1R1U A;  3K4M A;  5E1X A;  3OL3 A;  2HVS A;  1O7F A;  2OTJ I;  2ID6 A;  4LLL A;  1BJZ A;  4H4K C;  2O61 A;  5CLS A;  2Y9Z A;  2KJC A;  1TL8 A;  1FOY A;  3ZMT A;  2LNB A;  3CUO A;  3ZQH A;  4A3B J;  3RYP A;  3A02 A;  3CMA I;  3TED A;  3PIP F;  2DU9 A;  1K4S A;  2KL4 A;  1JGG A;  3KLN A;  3OYL A;  3JRH A;  4ZH4 F;  2LBF A;  5IYC J;  3PO3 J;  4XL9 A;  2G0E A;  1QU3 A;  3Q0U A;  1TW2 A;  4F52 A;  1SMT A;  4IQJ A;  2CQ7 A;  5LEK A;  3KZI C;  3QPT A;  5CJ9 A;  4FIS A;  4XLH A;  3BPX A;  3FXK A;  5FD6 A;  4BHB A;  2M7B A;  4NUB A;  2GZW A;  1EV7 A;  1DPU A;  2KHM A;  4BHP A;  2QBY A;  1B4A A;  2M8E A;  2F4M B;  3OIQ A;  1U2W A;  2NS0 A;  5BPD A;  3RIR A;  2L9N A;  2ESN A;  3LSH A;  1ZK8 A;  1HXD A;  3HZJ A;  4PDK A;  2CV1 A;  1B6A A;  2E1O A;  1HKQ A;  5JHF A;  4J19 A;  3OV8 A;  2NYX A;  4BH9 A;  4P96 A;  3UR3 C;  3KET A;  1S3J A;  3J7Z I;  1WH5 A;  2H09 A;  4BQO A;  1EJ9 A;  1F1Z A;  2HDW A;  2L0K A;  2AO9 A;  3WHC A;  1S7O A;  5EJC A;  2X0L A;  1G8X A;  4XKV A;  3DFG A;  2RN7 A;  4KIC A;  2VQL A; 
#chains in the Genus database with same CATH homology
 1UCR A;  4YII A;  5D8K B;  5LGT A;  5LLQ A;  3CUQ B;  5CVJ A;  4QWQ A;  1O3Q A;  2WWY A;  4OOI A;  1KU3 A;  2FF4 A;  4ON0 A;  3TDZ C;  4HX7 A;  1S7A A;  5BS6 A;  5IT9 Z;  2A68 F;  1XCB A;  4LB5 A;  3E5X A;  2COM A;  4LLG F;  2DQR A;  2HGC A;  3EET A;  2ZNZ A;  2M45 A;  1WSU A;  3KEQ A;  3CTA A;  2IRF G;  5FLX Z;  2VT2 A;  3LA2 A;  5ICC A;  5H6Q A;  2HWV A;  2QZ8 A;  3LWF A;  1G3S A;  2GA2 A;  3WE2 A;  1LQ1 A;  1XN7 A;  4U0Y A;  4IF4 A;  4M6Y A;  4RB3 C;  5E17 F;  4YFN F;  2FE3 A;  3KE2 A;  3JTH A;  3TOB A;  3DF8 A;  4M9S A;  3IRQ A;  1WRJ A;  4OIN F;  2EJR A;  2VE8 A;  3PQK A;  2D1H A;  4LGW A;  2LKP A;  3FMQ A;  3FMR A;  2IPQ X;  1PDN C;  4ENM A;  1YO5 C;  4CXF A;  2DLL A;  2FXA A;  1I6X A;  1KU2 A;  2NAZ A;  2Z99 A;  3MEX A;  1YW7 A;  1JHH A;  3CO6 C;  3U9G A;  4A12 A;  5DUI A;  3K0L A;  2DAO A;  3LST A;  3MZH A;  1FBS A;  1RUO A;  1FSE A;  2RVC A;  5L3G A;  1T38 A;  4EVI A;  3HRS A;  2OA4 A;  4LFU A;  3ABT A;  3H92 A;  4HA8 A;  1LDK B;  3F21 A;  3HTS B;  3VOD A;  1W4M A;  3IWF A;  4Y13 A;  1IRF A;  1W5T A;  3KZY A;  4HDU A;  4BYY A;  2KIM A;  2A3S A;  2FBI A;  3C18 A;  5TJJ A;  4ENK A;  2K86 A;  3QU6 A;  3KP4 A;  3L09 A;  2Z5U A;  3JSP A;  1JHF A;  1U5T A;  4UV9 A;  4HYE A;  1IXS B;  1GVJ A;  4MTE A;  2E7X A;  4HOB A;  1HW1 A;  3I71 A;  4IRG A;  1DDN A;  4RGS A;  4R8H A;  5DDG A;  3ERE D;  4PGH A;  2PN6 A;  4I98 B;  4EM0 B;  2HEO A;  2L01 A;  2QM3 A;  1U3E M;  4K2E A;  1W7P B;  1O3T A;  2FQ3 A;  2CSO A;  2PG4 A;  4KIF A;  4HF2 A;  2ADU A;  3MQ0 A;  1C0W A;  3FXU A;  1Z05 A;  2VOP A;  1NHA A;  3GVA A;  4OMZ A;  3E97 A;  2QEN A;  2OAZ A;  1UFM A;  2DT5 A;  2ZKZ A;  1ODD A;  1E17 A;  3ZMV A;  4XBF A;  3NEU A;  1BI0 A;  1YG2 A;  3KCC A;  4P55 A;  5FO5 A;  1Z7U A;  3V4G A;  1I1G A;  4Q5S F;  5DV5 A;  4BQA A;  1P6R A;  1ZGJ A;  1LEB A;  4L0Y B;  3BWG A;  3K1P A;  2LSO A;  3I54 A;  3U2R A;  2ACJ A;  2BGC A;  2PJP A;  3WG9 A;  3K1M A;  3M1E A;  2KRF A;  1OPC A;  4IRH A;  3V8J A;  4FHT A;  1U5T C;  2Q0O A;  3CO7 C;  1ZAR A;  4P5O A;  3WE3 A;  1O7L A;  4CDG A;  1OYW A;  2JT1 A;  2PBI A;  3DEU A;  2MLG A;  1XGO A;  4DNC A;  1JGS A;  3I59 B;  4I0A A;  3BY6 A;  3WTU C;  2GAU A;  2JSC A;  5IT9 K;  1XGM A;  3DKW A;  2GWR A;  5EEH A;  3ML6 A;  3R0J A;  3F23 A;  1I1S A;  3FM3 A;  3R0A A;  5LHI A;  4ZYE A;  1TTY A;  4KNY A;  2Z3Y A;  4RAY A;  3RKX A;  2C6Y A;  1XB4 A;  4I0B A;  3HSF A;  2O0Y A;  4Q47 A;  3E6M A;  1K78 A;  2UXN A;  4E70 A;  4BHC A;  2F5C A;  1R22 A;  4P9F A;  2VOD A;  2V9V A;  1SAX A;  4M9X A;  1IXC A;  4LB6 B;  1YLF A;  2KKO A;  1YW8 A;  3WGH A;  4B8X A;  2XGX A;  3MFK A;  4G7O F;  5LRS A;  2F5E A;  2EFW A;  4FT8 A;  3QOP A;  3ZQ7 A;  3RKY A;  1ZRF A;  2W24 A;  2P5K A;  3HRU A;  4NHJ A;  1BIA A;  2FML A;  2P5L C;  5TRD A;  1R1V A;  3TQN A;  1G6N A;  3T1B A;  1O3S A;  4ENN A;  2M87 A;  2W85 A;  5JHU A;  2GQQ A;  3QAH A;  4LMY A;  1HBX G;  3LAP A;  1R5G A;  3SHF A;  4A0Z A;  2O03 A;  1CF7 B;  2XAG A;  5HVQ C;  2R3S A;  3CUQ A;  3HOS A;  3S2W A;  2XRN A;  4KMU X;  1K6O A;  5A2Q Z;  5LHG A;  3BOQ A;  1XGS A;  2IVM A;  2HOE A;  3BJO A;  2UZK A;  5D5U B;  3PQJ A;  1LNW A;  2K27 A;  3Q9V A;  2PLY A;  2Y48 A;  2OBP A;  4RB1 A;  4KMF A;  4EM1 A;  1L3L A;  2P8T A;  1Z1D A;  3MCZ A;  2MH9 A;  2JZY A;  1FP2 A;  4GO1 A;  3T0Y A;  2RKH A;  4HQM A;  1YW9 A;  2DPD A;  2IP2 A;  2PFB A;  1R5H A;  3ZMU A;  1E2X A;  2B0L A;  3ZP5 A;  4U0V A;  3SXY A;  4KIG A;  2DI3 A;  2G9W A;  3KP2 A;  2ZBK A;  3M8F A;  2HQN A;  4NB5 A;  4Q4Z F;  1DP7 P;  6PAX A;  1OMI A;  1J5Y A;  3TDU C;  5L3D A;  5D5X B;  2CWE A;  2Q2E A;  5BPI A;  1FYM A;  1XDS A;  1XSX A;  2XKO A;  2E1C A;  1TQP A;  1R1T A;  3BJA A;  2XAQ A;  2ZFW A;  4L9J A;  2MA3 A;  1B59 A;  4EM2 A;  4EQQ A;  2FU4 A;  1IAW A;  1FLI A;  3GZ5 A;  3JW4 A;  2QYO A;  4EJU A;  4HV6 A;  3V7S A;  2F2E A;  2EFQ A;  3WTV C;  3IWZ A;  2HKO A;  1ZLK A;  2Z9O A;  3VOE A;  1G3Y A;  2J5O A;  2IA1 A;  4OU0 A;  3W6K B;  1XD7 A;  1IF1 A;  1ZRC A;  4L9T A;  2AXL A;  2LF8 A;  2ZO4 A;  1IRG A;  1QZZ A;  4LD5 A;  1X3U A;  4ZYD A;  3EYI A;  2YU3 A;  1BBY A;  2OD5 A;  2NRA C;  4N0B A;  4WCG A;  2GIV A;  3E3V A;  1FSH A;  4IVN A;  4O5V A;  2V79 A;  3HOT A;  2A69 F;  2O3F A;  2OQG A;  1S6L A;  3OOP A;  1I27 A;  3BP8 A;  1FOK A;  5FD5 A;  2XUB A;  2FEZ A;  4LK1 F;  2O8X A;  3G3Z A;  5E8G A;  3GFM A;  1Z6T A;  1ONV A;  5L3E A;  5AIQ A;  4F7Z A;  1K79 A;  2PEX A;  2VC0 A;  5KK1 A;  1ZLJ A;  3RKW A;  4I2O A;  3CDH A;  3FMS A;  1LDD A;  3ECO A;  4KA4 A;  5HLG A;  1FC3 A;  2PI0 A;  1R23 A;  2E7W A;  5DD8 A;  1USS A;  1TW3 A;  3ABU A;  4I02 A;  5HLH A;  1FZP B;  3SZT A;  4CHU A;  4KN4 X;  1GHC A;  3CLO A;  1MD0 A;  1FBQ A;  4WXD A;  5FFZ A;  3RYR A;  1REP C;  5D6E A;  1P92 A;  2CO5 A;  2DW4 A;  3ELK A;  3FHZ A;  2H27 A;  1KQ0 A;  3LA3 A;  1YYV A;  3CUQ C;  3E6B A;  2OZU A;  3ROU A;  3O6B B;  3GWZ A;  1B9M A;  4O6J A;  3J81 Z;  3IRR A;  3KP6 A;  4UV8 A;  5F6F A;  3GYH X;  2IT0 A;  3T5X A;  3TO6 A;  4GCV A;  3ZPL A;  1KU7 A;  2QQ9 A;  3B73 A;  4GXO A;  5FGM A;  5ED4 A;  1PP8 F;  2L4A A;  1FT9 A;  2KJB A;  5LRR A;  5E20 A;  1IN5 A;  2ZCW A;  4CYD A;  3R4K A;  2P7C B;  2H94 A;  4KUM A;  3SQN A;  1RZ4 A;  3FX3 A;  3TKY A;  2YSR A;  2EB7 A;  4EGY A;  5D4R A;  1IN4 A;  1Z9C A;  3WU0 A;  3I64 A;  2R7F A;  3F6O A;  4AIH A;  2MD5 A;  3ZN0 A;  4MQV A;  3BZ6 A;  4G6Q A;  1HST A;  5DCM A;  3P7N A;  2BV6 A;  3ZMS A;  3LAJ A;  2Y0M A;  2XV4 S;  2JTV A;  3RPU A;  2MLK A;  4HW0 A;  4BNC A;  2DTR A;  3R60 A;  2EV6 A;  1ZAO A;  3D0S A;  1ZH5 A;  4AD9 A;  4HF1 A;  2RGV A;  3LFK A;  4OIO F;  3KLO A;  4XSZ F;  5CVR A;  5D4S A;  4ZZL A;  5L3F A;  4G8X A;  4KT5 C;  3K1N A;  3GFJ A;  2BBY A;  2HYF A;  3L9F A;  4HLY A;  2XHK A;  4YG2 F;  1KYW A;  2V1U A;  4MEY F;  1QQI A;  2EFN A;  2Q8K A;  2FMY A;  4N9H A;  2ZME B;  4JK1 X;  2XIG A;  1WQ2 A;  5ILS A;  3O2P E;  2BE5 F;  2M30 A;  3F72 A;  4OMY A;  3F8N A;  5HDN A;  2FSW A;  2G7U A;  1L0O C;  2RQP A;  4G6D A;  1MKM A;  1W7P A;  1K78 B;  3ZN1 A;  4L5I A;  1P2F A;  2CYY A;  3E6D A;  4OIR F;  4ETS A;  5JR3 A;  3HRM A;  1U78 A;  1H9T A;  2ESH A;  4LG0 A;  5CVV A;  4ASN A;  1IN8 A;  2K02 A;  4G9Y A;  5H6R A;  2W57 A;  1GXQ A;  4B09 A;  2HFH A;  5ICF A;  1IZ1 A;  5LGU A;  4R1H A;  4WXC A;  3CJN A;  1IN6 A;  2V1X A;  3HHG A;  5JVT A;  3JTG A;  2FA5 A;  3EYY A;  5HLI A;  4CGZ A;  4MEX F;  3V7R A;  3U1D A;  1STZ A;  1EH7 A;  3J81 K;  1OYI A;  3WOD F;  1LEA A;  1WKM A;  4NQW A;  1GXP A;  4Q48 A;  5AON A;  3QPH A;  5LGN A;  1RUN A;  2HKX A;  2JPB A;  4Z2Y A;  5HS7 A;  2CG4 A;  4EJW A;  5E8I A;  1O57 A;  3HSR A;  3C3W A;  4U7B A;  3WTS C;  5K5R A;  4L5J A;  2RC4 A;  2DPU A;  1R36 A;  3KEO A;  3HSE A;  2VBY A;  3GEZ A;  1FPQ A;  3L7W A;  4D0P A;  3I0T A;  2NNN A;  5IT3 A;  2L3D A;  1J59 A;  3L00 A;  3V8K A;  3Q9S A;  3HYI A;  2K7L A;  3RTR A;  1ZHF A;  2RV8 A;  4LK0 F;  1FX7 A;  4QLC U;  4UUV A;  5FFX A;  3FXR A;  2A6E F;  3IKV A;  4IPA A;  2OQR A;  1OR7 A;  1WI9 A;  1EH8 A;  1Q1H A;  4A2U A;  1QGP A;  1FBU A;  2OU2 A;  4A0Y A;  2E1N A;  3FXQ A;  2GA1 A;  1TBX A;  2RDP A;  2YR2 A;  4RB0 A;  3C1D A;  3F8F A;  2AS5 F;  4L0Z B;  2GXG A;  2IA2 A;  1XSD A;  3QU3 A;  4KIB A;  1TNT A;  4M9Z A;  4HDV A;  1T0F A;  3ZMZ A;  2O6G E;  4A6E A;  3DV8 A;  1SFU A;  1V4R A;  2PMU A;  2TDX A;  4M74 A;  4IHT A;  3KP5 A;  5E1Z B;  1KQ8 A;  4HZF A;  3WTZ A;  3WTW C;  4N9I A;  5ERI A;  2EFP A;  3ULQ B;  5BQT A;  2XKP A;  3EUH A;  3TO9 A;  1HSJ A;  1TNS A;  3MWM A;  1LJ9 A;  2IA0 A;  2CGP A;  3COA C;  3SFZ A;  1BJA A;  2P6T A;  5HS8 A;  3M8E A;  1FWZ A;  1WWX A;  3MAJ A;  4UVC A;  4FX4 A;  3F22 A;  3T8R A;  1V3F A;  5K5Q A;  5KVR A;  1W7P D;  4CIC A;  3D5L A;  2EFO A;  1MJB A;  5EEG A;  3I5U A;  4EJT A;  2JRT A;  4YFK F;  4EJV A;  2X4H A;  5DCF A;  2D2W A;  2D45 A;  2R7D A;  2MC3 A;  2EV5 A;  1D8K A;  1G3W A;  2GXB A;  5L3B A;  2DFI A;  3K69 A;  1OYY A;  4ESJ A;  4RAZ A;  5K1Y A;  2F5F A;  1EH6 A;  2QQA A;  4HLX A;  5D8L B;  1ON1 A;  1BC8 C;  2VOO A;  2DO7 A;  3TGN A;  4XLN F;  1ZN2 A;  4JQF A;  1MDM B;  4XLP F;  1IN7 A;  1P4X A;  4KYW A;  1YIO A;  5JI6 A;  1AWC A;  2V1D A;  2Y75 A;  3W6J B;  3RI4 A;  1UST A;  2P4W A;  4MQ9 F;  4ZYG A;  3IL2 A;  3Q5F A;  4LJZ F;  1XCV A;  2CQK A;  1KGS A;  1QPM A;  2DK8 A;  3P9I A;  3GXO A;  1J0R A;  5E18 F;  1OKR A;  3JAM Z;  4L9V A;  1MZB A;  2XAJ A;  5ILV A;  1H0M A;  2STW A;  2EWN A;  1HW5 A;  1KYZ A;  3PFI A;  3REO A;  3QRF F;  4I7H A;  1FNN A;  1BOA A;  2L4M A;  3GUD A;  5CVU A;  2K4J A;  1UB9 A;  1ZGA A;  3JSO A;  4AWX B;  3HIF A;  4CO8 A;  1O3R A;  1F4K A;  5ILU A;  1A04 A;  1YS7 A;  5E1W A;  5ICE A;  3IC7 A;  2CW0 F;  1SD7 A;  5F64 A;  3I58 A;  5CVI A;  1Y0U A;  3TOA A;  4RGU A;  1AOY A;  2A61 A;  1IUY A;  3QP6 A;  4UVB A;  4FX0 A;  4ESB A;  5DD4 A;  2QBY B;  1FYL A;  3RJP A;  5FLX K;  1Z91 A;  3H3Z A;  4A5N A;  3WTY C;  1XMK A;  5JFR A;  5HDG A;  1TLH B;  5D5V B;  4CZZ A;  1Z6R A;  1B1B A;  1JXS A;  4RB2 C;  4EJO A;  5HS9 A;  4A0X A;  4GYG A;  1D8J A;  1J9I A;  1XGN A;  4RS8 A;  4R79 A;  5FB2 A;  1P4A A;  4P9U A;  3KP7 A;  2ZME A;  2VC1 A;  3E5U A;  3RPQ A;  4ESF A;  2EK5 A;  1HKT A;  2HYG D;  2VBZ A;  3WTT C;  3KZZ A;  3BRO A;  2VON A;  1XSV A;  1QZY A;  3HRT A;  3K9T A;  3T8T A;  1FP1 D;  2EA4 A;  2XAF A;  4UNO A;  3J7A O;  1BM9 A;  2YPR A;  1F9N A;  1HQC A;  3N97 A;  2A07 F;  1BIB A;  4KN7 X;  3I59 A;  4H0E A;  3KP3 A;  4S04 A;  1R7J A;  4WK8 F;  1ZRD A;  4OIP F;  1T2K A;  3KFW X;  4EGZ A;  2QLZ A;  5LEJ A;  4BXU A;  1KU9 A;  3GFL A;  1RIO H;  5BMZ A;  1ZRE A;  5DEQ A;  2UWM A;  4I09 A;  4WF2 A;  2G7H A;  1T6S A;  4S05 A;  4HBL A;  1HW2 A;  4I01 A;  3JAM K;  3NRV A;  4Y17 A;  2WC2 A;  4EV0 A;  4MHG A;  4IJA A;  3I53 A;  4RGR A;  4IXA A;  3FWE A;  2ZXJ A;  1SFX A;  3GLX A;  3ZMD A;  2DBB A;  5K5O A;  1MJA A;  1MJ9 A;  2DK5 A;  3DPL C;  3GX4 X;  1T39 A;  1K7A A;  3E5Q A;  3N4M A;  1ZG5 A;  2KIU A;  4Y15 A;  2IW5 A;  2HR3 A;  3V7C A;  1G3T A;  1LB2 A;  3NQO A;  2HDC A;  1ULY A;  1SD6 A;  2UXX A;  2FBK A;  3V8L A;  2WTE A;  3WTX C;  4G94 A;  4PCQ A;  4RGX A;  2FOK A;  2QUF A;  1QO0 D;  2FNP A;  1TQM A;  1J7K A;  1YQA A;  3I4P A;  4ZYH A;  2RNJ A;  4A5M A;  2H6C A;  1F5T A;  4DQ2 A;  1YFH A;  1D3Y A;  4UXN A;  2MBF A;  3DXJ F;  3F8C A;  2ISY A;  4M73 A;  1QNT A;  1DPR A;  3FZV A;  1UHM A;  3J80 K;  2STT A;  4U7D A;  1HKS A;  1LDJ A;  2DQL A;  2EA2 A;  1TQI A;  4AIJ A;  1BI1 A;  3VFZ A;  1MDM A;  1U8R A;  4BAY A;  1SMY F;  2VE9 A;  3HTU A;  2LF7 A;  5H20 A;  4GYI A;  2A5Y B;  1IXR C;  3DPT A;  4HX8 A;  3ECH A;  5DCM B;  3BPV A;  2L54 A;  1ZYR F;  1PUE E;  3MZY A;  4U0W A;  4MTD A;  3O3K A;  3P9C A;  4HV5 A;  4M72 A;  4KFC A;  5J8F A;  4ENJ A;  3L2C A;  4L18 B;  2FBH A;  4IRI A;  3F3X A;  1KQ9 A;  1BC7 C;  1U6G A;  1J2X A;  2F5D A;  3QP5 A;  4MGR A;  1VTN C;  1FYK A;  5LBQ A;  4HAM A;  2K4B A;  2YX7 A;  1J75 A;  2M1B A;  4YIF A;  2M5W A;  1W5S A;  1YS6 A;  1U5T B;  4XSX F;  2Z33 A;  3F8M A;  2QVO A;  2P5V A;  3AAF A;  3HHH A;  5DUK A;  3R6S A;  3WGG A;  2VBX A;  1BN5 A;  1SD4 A;  2IJL A;  3IHU A;  4JBA A;  4WXH A;  1CGP A;  1S29 A;  5ICG A;  3E6C C;  1RNL A;  1ON2 A;  2XAH A;  4M71 A;  3GFI A;  2HTJ A;  2W25 A;  4HF0 A;  3P9K A;  2HQR A;  2VT3 A;  3SZP A;  2P6S A;  3ISP A;  1BI2 A;  3M9A A;  4G7Z F;  2P7V B;  4MNU A;  3BJ6 A;  3FM5 A;  3B02 A;  1ZG3 A;  2VXZ A;  3LA7 A;  1R58 A;  2BYV E;  2PQ8 A;  2XVC A;  3F8B A;  4IHS A;  4PZJ A;  3GO5 A;  4EMS A;  3HUG A;  3BDD A;  4LG0 B;  3FF5 A;  5DYM A;  1S8N A;  4HX4 A;  4UVA A;  1XDU A;  1XMA A;  3DQV C;  5D5W B;  3WU1 B;  2JPC A;  2D1V A;  1T98 A;  3IKT A;  1YTY A;  4HQE A;  1RI7 A;  5HOO A;  1G4D A;  4O3M A;  1LVA A;  4ZZD A;  5L3C A;  1QBJ A;  1R00 A;  2ZNY A;  4G7H F;  1SFE A;  3VB2 A;  2ELH A;  2WV0 A;  2J5P A;  1UHW A;  3GZ6 A;  2XAS A;  3EDP A;  4AIK A;  2YX4 A;  2XRO A;  1PP7 U;  2QWW A;  3RDI A;  3J80 Z;  2HTS A;  2LDU A;  2H6B A;  2CFX A;  4XRF A;  4U88 A;  2ZJ2 A;  5CYV A;  3TO7 A;  3WGI A;  2V6C A;  1MGT A;  5LHH A;  2ISZ A;  3VEP A;  1IW7 F;  4AVP A;  2NNY A;  5F1R A;  1KA8 A;  4M6X A;  1H9G A;  4L9N A;  1DUX C;  2ETH A;  2W84 A;  3GF2 A;  2VBW A;  4LLN A;  1CF7 A;  2KIF A;  2VN2 A;  4WWC A;  4KDP A;  1BI3 A;  1SD5 A;  2MH2 A;  3F6V A;  4TV7 A;  5D6F A;  3LQQ A;  2HS5 A;  3DP7 A;  1I5Z A;  3H3U A;  1JE8 A;  3EQL F;  2OZ6 A;  2FRH A;  3G73 A;  3M7G A;  2L02 A;  4WX9 A;  3R61 A;  2HZT A;  1ZG1 A;  4YFX F;  1P4W A;  5J8C A;  5BOX A;  3GW2 A;  2BEO A;  4PGG A;  1FY7 A;  2EV0 A;  3LQR A;  1B9N A;  2FNA A;  2PMH A;  2QQB A;  3C7J A;  4GGG A;  4UHT A;  5AIP A;  5J6X A;  4OIQ F;  4A6D A;  5A2Q K;  2A6H F;  5HDK A;  1D5V A;  3K2Z A;  1R1U A;  5E1X A;  1O7F A;  4LLL A;  2O61 A;  5CLS A;  2KJC A;  3ZMT A;  2LNB A;  3CUO A;  3RYP A;  2DU9 A;  3KLN A;  4ZH4 F;  1TW2 A;  1SMT A;  5LEK A;  3QPT A;  5CJ9 A;  3BPX A;  5FD6 A;  4BHB A;  2GZW A;  1EV7 A;  1DPU A;  4BHP A;  2QBY A;  1B4A A;  2M8E A;  1U2W A;  2NS0 A;  5BPD A;  3RIR A;  2ESN A;  1HXD A;  4PDK A;  1B6A A;  1HKQ A;  3OV8 A;  2NYX A;  4BH9 A;  4P96 A;  3KET A;  1S3J A;  2H09 A;  1F1Z A;  1S7O A;  2X0L A;  3DFG A;  2RN7 A;  4KIC A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...