1F43A

Solution structure of the mata1 homeodomain
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
61
structure length
61
Chain Sequence
KKEKSPKGKSSISPQARAFLEQVFRRKQSLNSKEKEEVAKKCGITPLQVRVWFINKRMRSK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Cooperative ordering in homeodomain-DNA recognition: solution structure and dynamics of the MATa1 homeodomain.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Transcription
molecule keywords MATING-TYPE PROTEIN A-1
total genus 14
structure length 61
sequence length 61
ec nomenclature
pdb deposition date 2000-06-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00046 Homeodomain Homeodomain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.60 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Homeodomain-like 1f43A00
2L7FP 2DA7A 1B72A 4M3BA 2FQ4A 2XB0X 4BY7J 5EG0A 2JA8J 1A5JA 1MBEA 1Z77A 2X6OA 2I10A 3M3YJ 5M5XJ 5EZHA 3S15J 1ZGWA 3OSGA 2FJ1A 1B8IB 1X2MA 1S7EA 4MFEA 1WH5A 1IRZA 2W48A 2JK3A 2NS7A 2NVYJ 2IBDA 3WHCA 3JRDA 3I4MJ 1LE8A 1UG2A 5IYDJ 1W0UA 3S16J 5F27A 2XB5A 4A3EJ 1ETKA 1MBJA 1JTYA 1WCMJ 4A3FJ 2YUSA 3PM1A 3DEWA 4XK4A 3CMYA 1ORKA 1H8AC 3GTJJ 1U9NA 5EG0B 2EZHA 4BBSJ 5EDNA 2DMTA 2FX0A 3JR9A 4DYRA 1AKHA 1JJ6C 1AU7A 1IGNA 2HOSA 1T33A 3A03A 1JKPC 3LSJA 1RKTA 4CYCA 5IP9J 1MBHA 4BXXJ 4FE4A 1MH4A 3BR3A 4A93J 1TWGJ 3NARA 4S0HB 3PO3J 3S1NJ 2MW8A 3A02A 5FKMA 3F0CA 2WAQN 1H88C 3GBGA 3I4NJ 1WH7A 5DTDA 2GM4A 2XSDC 4AYBN 1Q1VA 2E2HJ 4AC0A 2OF7A 1BA5A 3B6CA 3CCYA 2HQ5A 1U78A 5FLVA 3SFIA 1K83J 3LSRA 4RDUA 3VPRA 3M4OJ 1MBKA 4JX4A 1AHDP 2M0CA 2Y2ZA 4C3JJ 5EF6A 3IH2A 4DZJA 2DMNA 4JP0A 1POGA 4AUXA 1T56A 1MBGA 1JT6A 2LFBA 4FISA 2R92J 2E1OA 5EYRA 2VKVA 2CJJA 3QQAA 3S2HJ 1X2NA 5GPAA 5F04A 4RBOA 3A01A 4J19A 4FCYA 4A3KJ 1ZK8A 5EEAA 4NDLA 2H1KA 2JA5J 2D5VA 1Y1VJ 2EZIA 3PO2J 5C4JJ 3G1LA 3UKGA 3H3VK 2K40A 1BW6A 3BTIA 4MO7A 1JT0A 5EZGA 1RR7A 1RETA 3FK6A 2WV1A 4MIMA 4XRSA 3S1RJ 5IYBJ 3TP0A 1F43A 2HOAA 2XGDA 5E3NA 5M5WJ 1U8BA 3TEDA 4JX6A 3HDDA 3HOUJ 5C3EJ 3IV5A 4IEJA 3FISA 3W6VA 2XGEA 3RQIA 2QF7A 5IYCJ 1OFCX 2O7OA 2X48A 1JUPA 1I50J 1WGXA 1HOMA 1ZTRA 2R93J 4I6ZA 1UHSA 4A3BJ 2NVQJ 5GP9A 3WHBA 3MVPA 5DS9A 2K9NA 1ZQ3P 2L9RA 3GTOJ 3HM5A 5IP6A 3JRIA 4A3JJ 3BG5A 5K7FA 2DMUA 3IH4A 4B4CA 4B1RA 3BG9A 1JUMA 1BJZA 2Y30A 2TCTA 1GUUA 4IHWA 1QVUA 2CUEA 2DA2A 1IDYA 1ETQA 3OIOA 4MLOA 5HODA 2DJNA 4W1UA 2DN0A 2EZLA 4M3GA 4XIDA 3JRHA 4XRSG 3S17J 2EBIA 3Q0VA 1IUFA 5C44J 4D7NA 3C2BA 3ZQHA 2HDDA 2Y0SN 3BR6A 3BTLA 3S2DJ 1P7JA 1XS9A 3FIWA 2LY9A 1O4XA 5C4XJ 3O8HA 1MBFA 4CYCB 5JLWA 3GTQJ 4IHYA 4A3GJ 1QVTA 5IPAA 3S1MJ 5J3LA 3MKLA 1HF0A 4I76A 2CU7A 4M3DA 3BR2A 3G1MA 2DMQA 3LSPA 5FJ8J 2O8KA 1LFUP 4FE7A 4Y52J 3ZQGA 3ZOBA 3OSFA 3HOXJ 4A3DJ 3QPLA 1F36A 4BKXA 4BBRJ 5M5YJ 5M3MJ 1NK3P 1TWFJ 1ZR4A 1IDZA 2VKEA 4GFBA 3GTPJ 1GV2A 3DCFA 2N8GA 5F1JA 5M3FJ 3RZOJ 3BTCA 5K7ZA 2MGQA 3S14J 2O9LA 2DA1A 1IC8A 2VI6A 2AHQA 2TRTA 3ZQCA 2GBYA 2JA6J 2JMWA 1W0TA 2E2JJ 2LD5A 1VNDA 3HEFA 5E3MA 3HBLA 4DYCA 1Z0XA 2KT0A 1AKHB 1PUFA 1OCTC 2CUFA 3BR5A 5J1YA 5IOYA 3HOYJ 5EGOB 5FKOA 3L1PA 1XC5A 2ID6A 3HKZN 1WI3A 1A6IA 1JUSA 1P7IA 1HDPA 2HYJA 4L5EA 4V2FA 5E3LA 3JRFA 9ANTA 3TP3A 1X58A 1WPKA 1R9TJ 1APLC 2XPWA 1MSFC 2NS8A 1TC3C 2M34A 1NTCA 2CQQA 2ME0A 2HI3A 1YRNB 2X9DA 4MFDA 4BY1J 4V2GA 1ETXA 1B8IA 4M3FA 2DA4A 1LFBA 3BT9A 4JYKA 1GV5A 2PMZN 3ZQFA 2NVXJ 3K7AJ 3HGGA 2ECCA 1IV6A 3BTJA 1HCRA 3GTGJ 1RPWA 4IHXA 2G0EA 2IAIA 4D7MA 1IJWC 2LK2A 4A3CJ 3JRAA 5E3OA 3HOWJ 5IOZA 2ZB9A 2LP0A 3CQZJ 1ITYA 2L0KA 3JRBA 2K9QA 1H89C 2DA3A 4M6VA 5F0HA 2H8RA 5J1UA 1QPIA 2M8GX 1OJLA 3HB9A 3ZQLA 1XG1A 2E19A 1D5YA 4UUSB 5F08A 2LLKA 3Q0WA 2DA6A 1JTXA 2K9SA 3O8GA 1JGGA 2VUMJ 1TWCJ 1DU6A 1Y1WJ 1U9OA 3FK7A 4HNVA 1JJ8C 4LOCA 1HDDC 4QIWN 2JN6A 4A3IJ 2L7MP 3JRCA 4QSHA 3TW6A 4XICA 1FJLA 2OPTA 1OCPA 1FIAA 2JA7J 3FKIJ 2Y9ZA 1NK2P 3SJMA 1VI0A 1MNMC 2L7ZA 4A3MJ 4JX5A 2E2IJ 2B63J 1RKWA 2DMPA 1QRYA 5BNGA 1ETWA 1B72B 4UUSA 4UUTA 1ZR2A 2HOTA 2LR8A 2LVSA 3RZDJ 4XRMA 3NAUA 3RKQA 2GLOA 5FKNA 3Q0UA 1ENHA 2XGCA 3A01B 4D5FA 3ZQIA 4C3HJ 1HLVA 2CRGA 1BL0A 5F0FA 1MH3A 2Y9YA 1RESA 2CQXA 1ETVA 4QTRA 4C2MJ 2YU9J 2MG4A 2LTPA 1FTZA 3G1OA 2DTZA 2MSYA 2R5ZB 2JJ7A 3D1NI 3GTMJ 2HXIA 2R5YA 4EEFG 2ECBA 2XPVA 4G12A 3HOVJ 1DU0A 3BQYA 3JRGA 2HXOA 4X6AJ 3S1QJ 3CDLA 2R0QC 1PUFB 1ETOA 3GTLJ 3HOZJ 3E7LA 1JKRC 3BQZA 2QCOA 2VPRA 1VF9A 1GDTA 4B3AA 5J1RA 2FD5A 1E3OC 4D5CA 2EQRA 2P81A 1FIPA 2DA5A 4W97A 4ABZA 4A3LJ 1ZKGA 1IG7A 3LSGA 2R7ZJ 2LKXA 1GT0C 2JWTA 2XPUA 2M9HA 2YS9A 5IP7J 3K2AA 2EH3A 3SDGA 1JKQC 5FKLA 3IH3A 3GTKJ 3BR0A 3QPSA 1GVDA 2NVTJ 3JREA 1FTTA 3BR1A 1MSEC 5K7HA 3OOUA 5GPCA 2ME6A 3HGYA 3TW7A 1SFOJ 2ELKA 2M2EA 2IEKA 3BG3A 5JLXA 5EGOA 3B6AA 1I6HJ 2R5ZA 4DYQA 4FTHA 2XRLA 2RAEA 5FKKA 2AO9A 1TWHJ 4C3IJ 4A69C 1ETYA 2R5YB 3MN2A 2KDZA 3LNQA 1BW5A 1JKOC 2EZKA 3LOCA 3H0GJ 3Q3SA 2COBA 4DW6A 5F0CA 1YRNA 2NOGA 4IHVA 4DZPA 2ID3A 2Y31A 4X1EA 1EF4A 1G2HA 1FEXA 1CQTA 1TWAJ 5FLMJ 1LE8B 2WB1N 1UMQA 1VFCA 1SANA 1K61A 1I3QJ 4M3EA 4Y7NJ
chains in the Genus database with same CATH superfamily
3LMMA 3KP4A 3ERED 2JVGA 1RUNA 2XB0X 1WHUA 4ZDLA 2VLAA 1A5JA 1DGRM 2X6OA 4ZYDA 3M3YJ 2R7OA 5EZHA 3OSGA 3BP8A 1FPQA 1UAAA 2OZUA 2MFZA 1S7EA 1S72I 1WH5A 1VQMI 1X3ZB 2FU4A 4LFUA 3VEPA 1HSTA 1SFXA 3PFYA 3MZ8A 2Q0OA 4LGWA 1RRJA 1QNTA 1EKEA 5L3BA 3DQVC 2XB5A 4E7IA 3SZGA 3AFHA 1AA7A 1JTYA 4XKVA 3CD6I 3DEWA 4I01A 2LG4A 4EATA 1P9QC 2UV1A 5EDNA 4KMFA 2DMTA 1YW8A 2E60A 1AKHA 1TT0A 2VOPA 4CYCA 4UV9A 2Y75A 4Z2YA 2IXSA 3TDZC 3M1CA 3EPZA 4BS9A 3R60A 4PGHA 4M72A 1KU2A 3CJNA 4G7ZF 3A02A 4J00A 2IVMA 4II3A 2PMHA 2DYRH 3V7SA 2GM4A 3L9FA 4N0BA 1Q1VA 4AC0A 4BNCA 1R71A 2BGCA 2VQCA 1OYYA 2RGVA 3D5SC 3FX3A 4AIJA 3T1BA 2FEZA 2L3DA 4CCMA 3JAMZ 1W36C 2K5CA 2HDCA 1VQLI 2F48A 4JP0A 1RC9A 1UHMA 4G6TB 3REOA 4NC8A 3OYLA 1FP1D 2DOEA 1JT6A 2R7VA 2ELHA 2H27A 1LVAA 1BI1A 4N4NB 4OAYA 2KRFA 3FMSA 1X2NA 5GPAA 5F04A 4RBOA 5D5XB 2K7LA 3C2GA 3D5RC 3CO7C 2HOEA 5EEAA 4YFXF 3CLQA 4NDLA 3F9KA 1I1SA 5LEKA 1E2XA 1Y1VJ 5FFZA 1U5TC 1IAWA 2KJBA 4BDYA 3R4KA 3CF2A 2EFWA 3RYRA 3G1LA 2OAZA 4FX4A 2K40A 1D1BA 3TDUC 4MO7A 5EZGA 2EWNA 2K3FA 3HRSA 1RR7A 3OYIA 2DFFA 2YX7A 3AL0B 3K70D 2OQGA 1W5TA 2WV1A 2QEXI 2PJPA 1JI8A 2W57A 2HOAA 3LAJA 3GX4X 1YIJI 3TEDA 1XGSA 4CZCA 4RA2A 3UR3C 3E6DA 3ASNH 2V4JC 1YFHA 4S04A 1VZ0A 2QF7A 2NOJB 2VBXA 1OFCX 2IJLA 2FBIA 3ZRGA 5IYCJ 1JUPA 3OYKA 5DUIA 3K1MA 1XSVA 3GFIA 4KIBA 1HOMA 1ZTRA 4A5NA 2D1VA 2RC4A 4XLEA 2E1MB 3EYIA 1D0YA 3QOEA 4I6ZA 2NVQJ 2O5RA 4GGGA 2PN6A 5DS9A 2PX9A 5BQTA 2BY1A 2PJRA 2K9NA 1ZQ3P 3J81K 2JSPA 2L9RA 1MIJA 4A3JJ 1PP8F 1I39A 4UUVA 3G2BA 2LREA 2FF4A 3HOTA 4RGXA 4A2UA 4D1QA 1EA3A 2WA0A 4RAZA 1ZRDA 4LK1F 1BJZA 1GUUA 2WC2A 3O2PE 4IHWA 3BOQA 2WV0A 1N25A 2DA2A 2DODA 2EV6A 3OIOA 4MLOA 2IGOA 3BZCA 4BXUA 3BROA 2XAGA 1Z67A 3ZXSA 1Z6TA 2DN0A 3BPXA 2CFXA 4L18B 3HRUA 4XRSG 3MD2A 1MMGA 1BI0A 4F92B 4NC6A 1R4MB 2EBIA 1IUFA 3Q0VA 3S17J 1Z7UA 4I7HA 1O3TA 3RQ4A 1FLIA 3V8JA 2QBYB 5DCMB 2V6CA 3BTLA 2XASA 3DTEA 3U1DA 1C0WA 4OMZA 4IHSA 1O4XA 3O8HA 1MBFA 5CKTA 3OY9A 1YJNI 1MJBA 3LA2A 2D45A 2KISA 4IHYA 1OCZH 5IPAA 5D5UB 4LLNA 5E1WA 5L3FA 1FC3A 4BGDA 1S5LC 3MKZA 4BACA 3DLLF 2X85A 5DV5A 5FB2A 5FJ8J 2HQNA 1L0OC 3PIOF 2HFHA 1SMYF 2HPMA 3ZQGA 1UB9A 3TO6A 1QO0D 4YIFA 2KRHA 4FETA 3ESWB 4CZZA 3E1SA 3CCUI 5M3MJ 1IW7F 1TWFJ 1FZPB 1ZR4A 1IDZA 2CQNA 3TO7A 3KYDB 2Y69H 3DCFA 3GCMA 5M3FJ 3RZOJ 5LEJA 1ACIA 1TNTA 3CUQB 2AHQA 2AXLA 1HW2A 1GHCA 2JMWA 1BR2A 2UXXA 1GXPA 1H9GA 3HEFA 2BVMA 2VL8A 2D2WA 1Z0XA 4EV0A 3BZ6A 3H3ZA 4CCLA 3LAPA 1TNSA 2BZTA 1PVEA 5BMZA 2HR3A 4LLGF 2ZMEC 3HTSB 2V26A 4IRHA 5J1YA 2ELJA 2DT7B 3VODA 1R5GA 1QZYA 5CLSA 3QPTA 3HOYJ 3H5AA 4CXFA 3HKZN 1WI3A 2QVOA 5KVRA 1X1AA 1P7IA 3T8RA 1VQNI 4V2FA 5E3LA 3JRFA 2PBIA 4R1HA 1N75A 1WPKA 1APLC 2XPWA 3CF5F 3J7YJ 3V8LA 2FMLA 1TC3C 2HVRA 1ZHFA 2M34A 1LQ1A 2J5OA 2RV8A 3ECOA 2X9DA 5DYMA 4BY1J 1UELB 3E6MA 3PL8A 4M3FA 2VPLA 3DEUA 5LFAA 3GMEA 1R1UA 1XCVA 4XSXF 1MMSA 1ULYA 5E17F 1LVKA 2EFOA 4JYKA 2NVXJ 2VQGA 5CVRA 5DM7F 2DT6A 3I59B 3O6BB 2Y0MA 2QGUA 2X1EA 3HOWJ 3MQ0A 3RKWA 4B48A 2FUG2 2KMUA 4XN0A 4Y3OA 3CQZJ 2CV2A 2F6CA 4XNFA 5ICEA 2ETHA 2NYXA 2K9QA 3K2ZA 1OKRA 3QODA 4DBQA 3ABMH 3KP5A 2F5CA 3DLAA 2NNNA 3SDBA 2H8RA 2XIGA 2ISYA 4F91B 2M8GX 1OJLA 4N9IA 5F08A 4RMNA 3AG4H 1JTXA 3O3KA 3O8GA 1JGGA 1X3WB 2DLLA 4QPOA 2VUMJ 1A31A 1X3UA 3NWSA 2A61A 1JJ8C 3DPUA 4LOCA 4EM2A 1HDDC 3FXLA 2IRFG 1YX5A 3SZPA 3HSFA 4A3IJ 3ABLH 2L7MP 2CGPA 2EILH 2P8TA 3ONQA 2OPTA 2V1NA 1G3WA 2HVQA 2XSJC 1OYIA 3FKIJ 3MZYA 1ZG5A 1MNMC 1BI2A 1T38A 2K4JA 3CMAI 2KL4A 2DMPA 1ETWA 4XORA 1SMTA 4HNTA 4ESJA 2CWEA 3FHNA 2H8WA 4I02A 1R49A 1YITI 2LVSA 4LIUA 3RZDJ 3K9TA 3RJPA 2QQ8A 2AQEA 2V9KA 4BEHA 2E35A 3S32A 2FNAA 2A6TA 3RPQA 2A05A 4C3HJ 1BL0A 2R7DA 5F0FA 3WTTC 3DPTA 2MD0A 1VQ5I 1P2FA 2YU9J 1ZELA 1TP4A 1FTZA 2KDOA 2RN7A 1S9HA 2LDUA 2JJ7A 3D1NI 3FXKA 4HRIA 4RB0A 4G6DA 4Q5SF 1IXSB 3CUOA 3PIPF 2KIUA 4EEFG 2XPVA 3CCMI 5HLTA 2L9VA 1K6OA 2HXOA 4X6AJ 3CDLA 3COAC 4BE0A 3P7NA 2EV5A 4BHCA 5FRNA 1FWZA 1XB4A 4NBQA 3GLLA 3F22A 1JKRC 5IT9Z 3GZNB 3V7CA 2ZJ2A 3A1YA 2V7FA 1FYMA 2QCOA 5E8IA 1VF9A 4U0WA 5CQEA 3TMOA 4IKFA 3OWTA 4HBLA 5LGUA 4M6XA 5A2QK 1FIPA 2DA5A 2D1HA 2M9HA 2YS9A 3P9KA 1SD4A 1WQ2A 2VKDA 3K2AA 4R8HA 2VXZA 1HSJA 3L7WA 3HG9A 3L00A 3QPSA 2NVTJ 3JREA 3HKZA 1FTTA 3H35A 3S3OA 1MSEC 5K7HA 3ZQ7A 1XCBA 2P5VA 2ZMEA 4ZYAA 4E7ZA 5GPCA 1H9TA 2ELKA 4DGWB 3H9QA 4HZFA 3BG3A 2IA1A 2LSOA 3KZIC 1QPMA 3VOEA 4RS8A 4FTHA 4EM0B 3N05A 3CTAA 2HS5A 3UNGC 4EQQA 2PEXA 4UHTA 2AO9A 3LSHA 3P5JA 1Y8QB 5F6FA 1ETYA 2F5VA 3LNQA 1G3SA 2R7QA 2EZKA 3H0GJ 4EJVA 3Q3SA 5FLXZ 4HG2A 1Z7LA 3RDIA 3F8NA 5F0CA 1T2KA 4IHVA 4LB6B 1KQ0A 3ZMTA 3LSTA 4WF2A 1GXQA 1NG6A 2VBWA 1EF4A 3K10A 2QSGX 1FEXA 2QUFA 1G2HA 4QPQA 5KCMA 1FOXA 1LE8B 4XKBA 2PLYA 4PJ0C 1IV8A 2ESNA 3OYJA 1VFCA 2ZC2A 5ICGA 1XX5A 4Y7NJ 2L7FP 3OOPA 3C2HA 3L2QA 2E1NA 3E97A 5BS6A 1MBEA 2E1CA 3HOSA 4O3MA 1HW1A 4CDGA 1Y56A 4ENNA 2NS0A 3S15J 1B8IB 5HS9A 4HX8A 4MFEA 1Y6IA 2BY2A 3P9IA 5JI6A 1IRZA 2JK3A 4G94A 2BW3A 2E5NA 2NS7A 4J01A 1OMIA 2NVYJ 2IBDA 2ZFWA 3VYUB 1USSA 3WHCA 2L54A 3KLNA 3KP2A 1LE8A 3I4MJ 3IWZA 3S16J 3KFWX 4ESBA 2ISZA 3I56I 1ETKA 1MBJA 2H1LA 1BIAA 1WCMJ 3H1CA 5DD4A 3W3CA 1SVLA 1ORKA 1OPCA 2R4GA 1QZZA 4Y33A 3ECHA 1X4PA 3L2UA 3JR9A 2FX0A 2M45A 2R3SA 2Q1ZB 4ZJZA 4DYRA 1AU7A 2HOSA 1T33A 2FBHA 3A03A 4BYYA 3GYHX 1AOYA 5IP9J 3TL4X 1J0RA 3K4MA 3FMQA 4LD5A 2BXZA 4FX0A 1YHQI 3DF8A 3U9GA 5BPIA 3PNYA 4HYEA 3GZ6A 4A5MA 4NC7A 1XSDA 4YEJA 1BN5A 1VTNC 3CESA 4ZTFA 4RGSA 2B9SA 1H88C 3I4NJ 3I71A 4YELA 3H5RA 5DTDA 4DQ2A 2RNGA 4HEA2 4MHGA 4RB1A 2M1BA 1EH8A 2Z99A 4JBAA 3QYEA 5CVJA 2OF7A 1D1CA 1U2WA 2EB7A 1J59A 1E0EA 3CP2A 4HDVA 1U78A 1STZA 5FLVA 2WAQA 3LSRA 5E1XA 1S7AA 1T08B 3VPRA 3VSLA 1IRGA 1AHDP 2M0CA 2BHYA 3ZMVA 4PSXA 1OYWA 4C3JJ 5EF6A 3IH2A 4DZJA 1AWCA 2STTA 2LH9A 1POGA 2V9PA 1T56A 4AUXA 1X4OA 5HDGA 2LFBA 1P4XA 4CICA 4FISA 4ZH4F 4ZDPA 5EYRA 4EJOA 2VKVA 1X19A 2E5ZA 3SYTA 3ULQB 3QQAA 3S2HJ 1OQYA 3IUOA 1ZLJA 3A01A 2X1CA 2IS6A 2GOXB 1HKQA 1KQ9A 2BHZA 2VXDA 1LFPA 2F5FA 3DBLB 3IHUA 3ABTA 4A3KJ 1Z9CA 1YJWI 4QWQA 2H1KA 2JA5J 3JCUC 2K9LA 3R0JA 4M74A 2EZIA 2KIQA 3LA3A 2L7KA 2DTRA 5C4JJ 2RQPA 4CCOA 3UKGA 2ZNYA 3CC4I 2H94A 4IQJA 3FHZA 4AM3A 3LQRA 4JK1X 4IOCF 4MTEA 4Y4RA 2HU9A 1UFMA 2DCEA 2LNBA 5E3NA 5M5WJ 3LFUA 1U8BA 4R79A 1Z05A 2LMDA 2I8DA 3HDDA 4BXFA 3J7ZI 2VC1A 3MWMA 1X1BA 4FQGA 2A5WA 5C3EJ 3EETA 2DPDA 3RQIA 1ZRCA 1XMKA 3BG7A 4Y17A 1DP3A 2CW7A 3A0BC 3KP3A 5L3EA 3I4PA 4XKWA 4N4OB 4XKCA 3KZYA 4QLCU 1RZ4A 4RB2C 2VC0A 5FO5A 2BVLA 4HW0A 4EM1A 1O7LA 2KHMA 5IP6A 5LBQA 3CUQC 4KDPA 3BG5A 5K7FA 1OCOH 2DMUA 3IH4A 3K69A 2ZXWH 2FOKA 3DPLC 3OYMA 3BG9A 2K85A 2BY0A 2AQFA 2TCTA 3CJTB 1LEBA 1QVUA 1E3PA 2JUCA 1M1EB 5A2QZ 2R7SA 2IS1A 2WB1A 1ON2A 1R1TA 3CCJI 3OYBA 1T95A 2IS2A 1TQPA 4IX7A 3I58A 4KA4A 2L9SA 2OU2A 4ETSA 2FA5A 2QLZA 2NXNB 2XC7A 3IL2A 1T0FA 4M3GA 3JRHA 2CW8A 5LHGA 1MW7A 3BC8A 2CH0A 1TQMA 3VB2A 3QU6A 2VJ5A 3SHFA 1B59A 1BI3A 2LRDA 4XSZF 2ZBKA 2K02A 4IXAA 2GWRA 1P7JA 1TQIA 3WTVC 2LY9A 2JUGA 5EEGA 5C4XJ 2P5KA 5JLWA 5KAIC 1VQOI 3HJEA 3FMRA 5ERIA 3MKLA 1HQCA 1HF0A 1G8XA 3GF2A 5DCFA 3M8FA 4I76A 2CU7A 4PJJA 4AVPA 2DU9A 3BR2A 2KIFA 4YFKF 2F4IA 3SFZA 1DPRA 1LFUP 1T98A 3SEZA 2ACJA 4UNOA 3QPHA 2QA4I 4LG3A 3QPLA 5HDNA 1F36A 4CA0A 3CCSI 2L9NA 5HLIA 1I1GA 4RB3C 1RNLA 1GV2A 3DKYA 5ED4A 1YS6A 1GLNA 4HPQA 5K7ZA 3S14J 2O9LA 2GA1A 3R0AA 1IC8A 3ZQCA 4XONA 1W0TA 3DBHB 2E2JJ 2GXAA 2LD5A 1VNDA 5FFXA 4OMYA 3HBLA 4DYCA 4NHJA 6PAXA 3HTUA 4XN3A 3AG2H 2E1MC 3Q9SA 2UUZA 2GOMA 3RIRA 5EJCA 2M7BA 3ZMZA 1R5ID 1FX7A 2CV1A 2VBYA 4XLAA 2JQ7A 2O03A 3IAS2 5EGOB 3IAM2 5FKOA 3EUAA 4HDUA 1IRXA 1XC5A 1W5SA 1HDPA 4HQMA 2HYJA 3I0TA 1R9TJ 5DCMA 1XD7A 1MSFC 2Q2EA 2YSRA 3OIQA 4GXOA 1H0MA 2CO5A 2H6CA 2JRMA 3WGHA 3K0LA 2A69F 3W6JB 4XLFA 4V2GA 3NEUA 5TJJA 3LFKA 5JVTA 2DOFA 1B8IA 5DD8A 2DA4A 1LFBA 3ZQFA 5IT3A 3HGGA 1V4RA 4OU0A 4XOPA 2HPIA 5GADJ 1QA6A 2XF6A 1D0ZA 1BR1A 2V9VA 3JRAA 2XGXA 1XSXA 2BYVE 1VQ7I 2EA4A 2VB6A 1LUJB 3S8PA 3HHGA 4MEXF 3JTGA 1B6AA 1KGSA 2OCCH 2HZTA 2KJCA 2W82A 1W4MA 1RIOH 3JW4A 3VDXA 3JRBA 3M7GA 2DA3A 4M6VA 4EJTA 3QU3A 2O8XA 3TOBA 5DEQA 1QPIA 1IXRC 3F8FA 1XG1A 3U21A 2I5UA 3WGGA 3FM5A 2A6EF 2E7XA 4F7ZA 2K9SA 1FBUA 4ESFA 2H6BA 3JTHA 1TWCJ 2X1DA 3DWLE 1Y1WJ 3FK7A 2VQHA 1J9IA 2L5QA 5K1YA 1ON1A 1U8RA 1XDUA 1FY7A 3JRCA 4E7HA 4QSHA 3TW6A 2B0LA 1FJLA 1FIAA 2JA7J 2AXTC 1NK2P 1Z6RA 4I99C 4DJAA 3SJMA 2L7ZA 1VQKI 3RI4A 1HC8A 1OR7C 3EUKL 4XMYA 1IO2A 3CO6C 3U1KA 5BOXA 2C6YA 1S6LA 1MJ9A 4WXHA 3OYNA 2VONA 1YOVB 4UUSA 1ZR2A 2HOTA 5HDKA 3FZVA 4S05A 1SD5A 1PJRA 4XRMA 3NAUA 4G9YA 3Q0UA 2XGCA 3A01B 2JPBA 2EINH 4BQOA 2WBMA 3EYYA 5HS7A 4D5FA 3OV8A 3OR2C 1B9MA 1K78B 2CRGA 2JA2A 1MH3A 3GXOA 2CQXA 1ETVA 3VYTB 4QTRA 2ZKZA 2LTPA 1YYVA 1MNEA 3CDIA 3W6KB 2V1UA 3C3WA 5JHFA 3GTMJ 1VQPI 3X2QH 2DT5A 3IC7A 2R5YA 2R7FA 2ECBA 2W00A 3V8KA 1IN6A 1I27A 3QRFF 4XLPF 3E3VA 2RNJA 2LKPA 4CO8A 1FOKA 2R7RA 2YPRA 1TW2A 3I64A 4B8XA 4G7HF 3CCEI 1X1CA 3W2VA 3PNVA 3GTLJ 3TGNA 4ITVA 3E7LA 4GRIA 3WU1B 1ZLKA 4GO1A 4IZZA 1GDTA 2M7AA 2VJJA 4B3AA 5J1RA 4K2EA 2EQRA 3MMYB 5K5OA 1LEAA 2F5EA 4ABZA 4AVZA 1IG7A 1S29A 3TOAA 1XMXA 1SVOA 2JWTA 4MGRA 1MDMB 5IP7J 5HLHA 2MH9A 3OYDA 2EH3A 1FNNA 3K4JA 3IH3A 2W84A 3S2WA 1K79A 1OCRH 3BR0A 1EH6A 4XRFA 3VSKA 3BR1A 2DDAA 4BU2A 3F3XA 5H6RA 4Q47A 1W36D 4O6JA 3TO9A 1SFOJ 4BJ6C 5D8KB 2P7VB 2M2EA 3IKVA 2DFIA 3DTIA 1FMVA 1R1VA 3PFIA 2HZDA 4DYQA 3CP8A 2DYSH 2OA4A 1CGPA 3GUDA 3CCRI 2R7WA 1XPXA 1TWHJ 1IXCA 3WE2A 2KDZA 2MC3A 2PMZA 1B4AA 1K4TA 1FSEA 2LBFB 4O5VA 3F8BA 2XKOA 5ICFA 4JOMA 4X1EA 2VODA 4C30A 1FP2A 3I5UA 1OCCH 3HXLA 4NQWA 2WB1N 2M0MA 2W24A 4ZDOA 1FYLA 2M4GA 3R61A 2IGMA 2XV4S 1K61A 4M3EA 1G3TA 5HNHA 3IKTA 3FWEA 3PSIA 1BJAA 2IA0A 2HKXA 2DA7A 5ICCA 2FQ4A 1CF7A 4BY7J 4IVNA 2JA8J 1Z77A 2MABA 3I54A 2BOLA 1HA8A 2K27A 2Z9OA 1ZGWA 2Y48A 4EJWA 2KLOA 3WTUC 1BBYA 4YIIA 2W48A 3G73A 2FXAA 3OYFA 1U6GA 5K5QA 3JRDA 1V5EA 2LF7A 4YIRX 4A0YA 1SFEA 3SQNA 4A3FJ 3WTWC 2YUSA 1WVRA 3N97A 1D1AA 2FNPA 3PM1A 3KYLA 2XAFA 4WCGA 3CMYA 1MD0A 1H8AC 3M9AA 1U9NA 3KP7A 2EZHA 2ZCWA 4HX4A 2O61A 1OLTA 4P9FA 1JJ6C 4RM2A 1IGNA 5HVQC 1RKTA 3HRMA 4GYGA 1ODDA 4KIGA 3OYAA 3K4CA 4BXXJ 4P1WA 1IN5A 5CVVA 1R36A 4A93J 2GIZA 2JT1A 3FXOA 2JVHA 2MLGA 3BJ6A 3NARA 2FBKA 3PO3J 2MW8A 3DU6A 3F0CA 1SAXA 2WAQN 2ESHA 3GBGA 1XGOA 3F8CA 4IL6C 2H09A 4AWXB 4ZYGA 4XR6A 2DO7A 2R7XA 4B47A 4HV6A 2CQKA 4AYBN 2HEOA 2HVSA 4KN7X 4WWCA 2L4MA 1BA5A 3CCYA 2XVCA 3GFLA 1K83J 4DNCA 3ZN1A 3JSPA 3G6EI 4RDUA 4XBFA 3M4OJ 1FBSA 1MBKA 2OTLI 4JX4A 2DXIA 1JXSA 1QZEA 2DMNA 5KHDA 4CH7A 3WTXC 1MBGA 2DK8A 1F9NA 2A5YB 5FGMA 2UWMA 2E1OA 2W1OA 1UG0A 5B1AH 2VKHA 4J19A 4BEHB 2IW5A 3HSEA 2Z16A 1WFXA 4KNYA 3ZMSA 5J4VA 1V5FA 2D5VA 4X0GA 4PGGA 3F21A 4RGRA 2OCEA 3J81Z 3F23A 1ZYRF 1OISA 4B09A 1ZH5A 2W25A 3H3VK 3GEZA 2VN2A 1UJ8A 2M5WA 4NNJA 1Z1DA 3PQKA 4HA8A 2EIJH 3BPVA 1YX3A 2LYCA 2MA3A 3FK6A 4MIMA 4XRSA 3S1RJ 5IYBJ 3TP0A 1F43A 2BE5F 3GFMA 3J7AY 4AYBA 3W2AA 1JHHA 3HOUJ 5E79C 3IV5A 4IRGA 1E17A 1R7JA 2XGEA 2KP6A 4KITB 1BOBA 4IJAA 4Y13A 2XF5A 1ZN2A 2X6YA 1I6XA 1UHSA 3IP4B 4LB5A 4XLCA 4A3BJ 5GP9A 3MVPA 4F55A 4CSWA 4OAZA 4ZYEA 3GTOJ 3VYSB 3B73A 3HM5A 3JRIA 2P7CB 2MH2A 2F5DA 1WZ2A 2KKOA 4LG0B 4B44A 4KYWA 4B1RA 4E7JA 4PSWA 4MQ9F 1JUMA 2Y30A 4L5IA 4DIQA 1TBXA 3K6GA 4WK8F 1WSUA 3FKJA 3J7AO 2CUEA 3BCAA 4E7KA 4UV8A 1ETQA 4PCQA 2OQRA 1Y0UA 4E70A 5HODA 3QYBA 3EQLF 2M3AA 2DJNA 3FBNB 3PUFA 4W1UA 4XQFA 3FDYA 4OWRB 4XIDA 1TTYA 1VQ6I 2G9WA 1ZREA 3QYFA 4ON0A 4D7NA 3C2BA 3ZQHA 3KEYA 2XKPA 1W7PD 3HHHA 4BDZA 5B1BH 1IZ1A 4HAMA 3CCQI 3ZP5A 3BZKA 1QHHD 2MBFA 2CUJA 1R22A 3EUHC 3EUHA 2DPUA 3GTQJ 3SXYA 1R5HA 2PFBA 5K5RA 4A3GJ 2DOAA 3HUGB 3S1MJ 4OIQF 3ERMA 3DV8A 3LSKA 5E18F 5LD2C 4PJNA 5J3LA 4PFPA 3WU0A 2F4MB 3MFKA 5B3SH 4ZTJA 2EFQA 1V54H 3G1MA 2FMYA 5ILUA 2DMQA 4Q48A 5DUKA 3E5UA 4L9JA 1YTYA 5TRDA 1A04A 4EVIA 2LY2A 4FE7A 5D5WB 2XAJA 3ZOBA 3BY6A 3OSFA 4NUBA 3HOXJ 3LL7A 5AONA 1P4AA 3M8JA 2EFPA 2W4SA 1NK3P 3OYHA 1YQAA 2HYGD 1WI9A 5TGTA 3OIPA 3GTPJ 2XAUA 1QHGA 2N8GA 5F1JA 1A6QA 2KZGA 1ZAOA 3BTCA 1YW9A 2MGQA 2XAQA 5J4YA 2DA1A 2HQRA 4CCKA 4P9UA 5HLGA 4BE1A 2JA6J 2OBPA 1D8JA 1FOYA 1E3HA 1WJBA 2K3PA 3LSIA 4WXCA 4KUMA 3OYCA 5AIQA 2JRTA 4LK0F 4LIVA 4HSTA 2L02A 2X4HA 1OCTC 1ZRFA 1T6SA 2CUFA 4L0YB 3G4SI 2A3SA 1L3LA 3CLOA 1V5GA 2KZVA 4KFCA 3WTYC 1Q1HA 3L1PA 2ID6A 1REPC 2MYSA 2X0LA 2Y0SA 5IT9K 5J8FA 3ZR8X 3C1DA 2PJRB 3GVAA 1YIOA 1DGWY 1X58A 2A6HF 4BAYA 1VQ4I 1J7KA 3HSRA 1NTCA 2ME0A 1YLFA 3IRQA 2HI3A 4Q4ZF 5J47A 5ILVA 2XROA 4GDFA 3ZCOA 3MKYB 1ETXA 4YRVA 2VT2A 2DDBA 5DM6F 5LLQA 2RDPA 1GV5A 2PMZN 3ZN0A 2Z3YA 1O57A 2ECCA 1IV6A 3BTJA 2VE9A 3GTGJ 4RAGA 5KAFC 1RPWA 4IHXA 4D7MA 3AKZA 1IJWC 2LK2A 4LLLA 3ZGKA 2NAZA 1IN7A 2BY3A 2VQLA 1Y0NA 2LP0A 3WG7H 2UXNA 2ZJPF 3RPUD 5DDGA 3ELKA 2BBYA 1HKSA 2PMUA 4UY8I 3ISPA 4ZC3A 2QKMB 2VIXA 2VT3A 4II2A 5F1RA 1X1DA 1U3EM 2GIVA 5F0HA 4HLXA 4EGZA 2MD5A 1KQ8A 3F8MA 1JHFA 1RR8C 3SZTA 3TQNA 3ZQLA 1W7PB 1RUOA 3WE3A 2LLKA 3Q0WA 3S3MA 3K1PA 5IY5H 5FLXK 2CFOA 2IPQX 3HC7A 1VQ9I 1DU6A 1UZCA 1YE9A 4BH9A 2QZ8A 3G71I 3FBIB 5GAHJ 3AG3H 2WAEA 4M9ZA 2YU3A 4BL0B 1MDMA 1LDDA 2OTJI 2LKSA 4UXNA 3D5LA 3KETA 3F6OA 1OCPA 2WWYA 4OIPF 5FRMA 1VI0A 2YX4A 3L2CA 5L3CA 2E2IJ 3L2RA 3H9GA 1RKWA 2ZFUA 1FMWA 1QRYA 4MEYF 3F72A 2NNYA 1B72B 4PK4A 4UUTA 4ZYHA 2Q8KA 1YJ9I 2LR8A 2BXYA 1YW7A 1SD7A 2XRNA 2VBZA 3RKQA 1TW3A 2GLOA 1SC7A 3CUQA 1FSHA 4KT5C 1R23A 2LC2A 4I2OA 3OMYA 4I0AA 3ZMUA 3ZQIA 2OJED 2L2OA 5HNFA 1I3AA 5LGNA 1QGPA 1K78A 1XTAA 3GO5A 4A0XA 5HS8A 2GZWA 1B1BA 2MG4A 2E36A 3E6CC 3G1OA 5F64A 4C2TA 3A2KA 5B5EC 1DPUA 4L9VA 2HXIA 4RLFA 4KICA 5H2FC 1WJFA 5J6XA 1JGSA 3CDHA 3OS1A 3K4LA 2HQAA 4BJTA 4C2UA 1DU0A 1B9NA 2V79A 4MQVA 2KQRA 2UZKA 3HZJA 1PUFB 1G59A 2IT0A 1ETOA 3MZHA 1LKXA 4A6DA 4PZJA 2VPRA 2W85A 3LWFA 4HV5A 3H0DA 1HBXG 1E3OC 4RGUA 4JQFA 3I53A 4W97A 4A3LJ 1ZKGA 3L09A 2CYYA 2E71A 1D5VA 3LSGA 1MMDA 1GT0C 4HX7A 1G3YA 1KZHA 3IRRA 2QENA 2XF7A 1XGNA 4OOIA 1JKQC 2Q2EB 4M71A 3AG1H 3ZMDA 3GTKJ 3BCBA 1WJEA 1A35A 4KISA 1BC8C 5H6QA 3ZQQA 2PI0A 2WTEA 3M07A 2DFEA 3OOUA 2Z33A 2ME6A 1KU3A 2HGCA 3TW7A 4AU7A 4HF0A 2IEKA 2OD5A 5JLXA 1KU7A 3B6AA 1I6HJ 1W7PA 1EV7A 3HL2A 3FXUA 1J5YA 2R5ZA 1TL8A 4HNUA 1YI2I 4L9NA 1MJAA 3JSOA 4A69C 2R5YB 4E7SA 1LNWA 4CUGA 1JKOC 2COBA 4AIHA 1OR7A 2NOGA 5D4RA 2ID3A 2ZJQF 2LBFA 2M4KA 2Y31A 3OS2A 3PNTA 1XN7A 2JPCA 4WXDA 1TWAJ 2HDWA 5L3GA 2P6TA 2HKOA 5FLMJ 1Y39A 2ZMEB 5J40A 3M8EA 2KPMA 4NQWB 5BPDA 2ZSHB 3H3UA 4KMUX 3S3NA 3DKXA 3SEQA 1B72A 2E7WA 4M3BA 3PJRA 5EG0A 4KN4X 1TT5B 3WGIA 2W7NA 3RPUA 2HNHA 2DQLA 4C9YA 1EJ9A 4F93B 4G7OF 2I10A 1FYKA 5M5XJ 2BV6A 2FJ1A 1P6RA 3MCZA 3KEOA 3DKWA 3R6SA 4HF2A 3LA7A 4YFNF 1G4DA 1X2MA 4FHTA 4KIFA 1K7AA 2QKLB 2GAUA 4BUPA 2ZSIB 4UB8C 2EPFA 2CUZA 1ZGAA 3OYEA 1UG2A 3C7JA 5IYDJ 1SEUA 1W0UA 4HQEA 5F27A 4A3EJ 2K86A 4BHPA 4G6QA 3TKYA 3RKXA 1D3YA 4HLYA 4XK4A 1KONA 2P4WA 1QBJA 2JZYA 2DK5A 1KYWA 4OINF 3GTJJ 1O3SA 5EG0B 4BBSJ 4LITA 3DU5A 4IQ4A 1PUEE 4P96A 5D6FA 1Y8RB 4CGZA 2ADUA 2LY1A 3ASOH 5L3DA 3LSJA 4CYDA 2WY8Q 4ZZLA 1JKPC 1MBHA 5TISC 1S8NA 3ROUA 2YR2A 4PJMA 1O3RA 4FE4A 1MH4A 3PQJA 3BR3A 4TV7A 2M8EA 1TWGJ 3K4BA 4S0HB 5CYVA 3V42A 3ABUA 1SFUA 1BC7C 5FKMA 3S1NJ 4HSRA 3U2RA 2GQQA 1R4NB 1WH7A 1V3FA 1T8IA 1CF7B 4KJZA 4RLQA 4RAFA 2XSDC 2VJIA 2E2HJ 3K1NA 5CVIA 3CCVI 3B6CA 1ZG1A 2HQ5A 2QQ9A 1N77A 3SFIA 1ZGJA 1P92A 4XLNF 3CJQB 1W5CC 1WJAA 2ZXJA 1Z3XA 3T5XA 4A12A 2Y2ZA 3H9JA 3KYCB 4V19K 1BOAA 1SVMA 5JFRA 2PG4A 4DOZA 4DBRA 2R92J 1J09A 4CCJA 3FF5A 4ENJA 2CJJA 2QQBA 1MMNA 3PSFA 4Z6YA 3KP6A 1S3JA 5AIPA 5JHUA 3ML6A 4FCYA 5B66C 4UVBA 3J80K 1ZK8A 1UCRA 3KX2A 4M73A 3I55I 3S93A 2FRHA 3KEQA 3PO2J 3FM3A 4NB5A 4ZZDA 1MKMA 1G6NA 5FD6A 4ASNA 2P6SA 2FQ3A 1BW6A 3BTIA 1JT0A 2O0YA 2EK5A 3CMMA 3G3ZA 2IGNA 1RETA 3GFJA 2GA2A 1FT9A 1PP7U 3RSNA 1TLHB 2QWWA 5J8CA 2XGDA 3RTRA 3CZ6A 3NRVA 4AIDA 3QOPA 4JX6A 3IWFA 3KPHA 4M9XA 5LGTA 1ERDA 2EIKH 2L01A 3AL0C 2KRCA 3V7RA 2OV7A 4IEJA 3FISA 3W6VA 3M1EA 3KIOA 2O7OA 2X48A 4EMSA 1I50J 1F4KA 3E0JB 1WGXA 1U5TB 4L0ZB 2B7EA 3CCLI 3KLOA 3J80Z 3HUGA 2R93J 3RKYA 5LRRA 3WHBA 2XDVA 2RKHA 2RVCA 3E5XA 3I3LA 4B4CA 3AAFA 3K4KA 3ABKH 1I5ZA 1F5TA 2HTJA 2DAOA 3DTKA 2XHKA 1W1WE 1IDYA 2V1DA 1BIBA 2FE3A 3BDDA 5D5VB 5E1ZB 4M9SA 4BJ5C 4IRIA 5KNLA 2XAHA 2VASA 1QU3A 2EZLA 4GYIA 4UVAA 4Y15A 5C44J 3L2WA 2HDDA 1Z21A 1IN8A 1WJ5A 2Y0SN 3BR6A 3S2DJ 1WKMA 4UB6C 3BG6A 1XS9A 3FIWA 4A6EA 3DFGA 3OS0A 4CYCB 2L4AA 2DW4A 3VYRB 1D0XA 1QVTA 4LMYA 4KT6A 2QQAA 1S7OA 2R7UA 4ANJA 2ZXHA 4M3DA 5E20A 2AS5F 3LSPA 1FBQA 1XGMA 1ZARA 3E6BA 2O8KA 4HF1A 1T0FC 2X6XA 1U0JA 5EEHA 4Y52J 4BQQA 1DP7P 2HTSA 5KK1A 1HKTA 1O7FA 2COMA 3MAJA 1J75A 3JAMK 4A3DJ 3HIFA 3KZZA 3LQQA 4BKXA 4BBRJ 5M5YJ 4PJLA 1LJ9A 1NG7A 2VKEA 4XOTA 4GFBA 4L9TA 1MGTA 1WWXA 4A0ZA 3Q9VA 2IGKA 4M6YA 3H5NA 2CV0A 2CW0F 2VI6A 2TRTA 2WADA 2GBYA 3CC7I 4IF4A 4IPAA 5CJ9A 2P5LC 1KYZA 3WU2C 4RM3A 5E3MA 3C18A 2MLKA 4U0YA 2KT0A 4IHTA 2VJ4A 1AKHB 2G7HA 1PUFA 4EJUA 3NQOA 4HOBA 4U87A 1NH3A 2STWA 3I9V2 4BQAA 3BR5A 5IOYA 2EJRA 3KE2A 2VOOA 2IP2A 1ZG3A 1K6YA 3CJRB 4F3QA 1LB2A 4PUSA 3EDPA 4WX9A 1R00A 1A6IA 1JUSA 5LHIA 2WAFA 2M30A 4L5EA 3WODF 9ANTA 2HYFA 3TP3A 2QBYA 2EIMH 1X1PA 2NS8A 1UHWA 2CQQA 1WJCA 2DFHA 1R58A 3PUBA 1YRNB 4MFDA 2HWVA 3W2WA 2QYOA 3BWGA 4I0BA 3A0HC 3N4MA 2RQQA 4I09A 2V6EA 3BT9A 2GXGA 1NHAA 5ILSA 1WRJA 3K7AJ 4MTDA 1HCRA 4OIOF 2M87A 4ENKA 2G0EA 2IAIA 3B02A 4A3CJ 5JR3A 5E3OA 2DBBA 2DI3A 4U88A 4U7BA 4N9HA 5IOZA 2ZB9A 4P55A 4PFOA 2LF8A 4B43A 1Z91A 1ITYA 2CS3A 3OR1C 2EFNA 1K4SA 2L0KA 3HPGA 5GTIC 1EH7A 1H89C 1MMAA 3WG9A 2ZO4A 5J1UA 3QAHA 3TBIA 3DXJF 5GAGJ 3HB9A 1XDSA 2E19A 1D5YA 4UUSB 4G8XA 4RAYA 2DA6A 3DP7A 1FOWA 3GZ5A 3HPHA 2MC4A 2OC6A 3E5QA 2F2EA 2K9MA 5GAEJ 2J5PA 4F52A 1U9OA 4HNVA 4E4HA 2NVUB 1P4WA 4H0EA 4QIWN 4BHBA 2X6WA 2JN6A 5E8GA 4E6KG 1SD6A 1D8KA 3NWTA 1LPQA 1WJDA 4XICA 5D8LB 2KIMA 5FROA 2CQ7A 4CCNA 2Y9ZA 1YG2A 2BW3B 1YO5C 4XL9A 1PDNC 4A3MJ 4JX5A 3K70C 1MNDA 2B63J 4U7DA 2ICWG 3WTZA 3H36A 3HRTA 5BNGA 2EA2A 1F1ZA 2P0WA 4ENMA 2JTVA 3LSMA 3FXJA 2VE8A 4D0PA 1VQ8I 4IO9F 1T39A 4FASD 4LG0A 5FKNA 1GVJA 3BJAA 1ENHA 2TDXA 3QP6A 1IF1A 3FXQA 2LOOA 2R7TA 3OL4A 2QSFX 2OZ6A 3VWBA 1HLVA 3QWLA 1DQUA 3F6VA 1MZBA 2Y9YA 3D0SA 1RESA 4D9JA 5HOOA 2DJIA 3T8TA 3OL3A 4C2MJ 5GTHC 2DTZA 2MSYA 1KA8A 2R5ZB 2QSHX 2X51A 5LHHA 1SFKA 4H4KC 1A36A 2RREA 4FT8A 4AIKA 3DBRB 3Q5FA 4G12A 3HOVJ 3K4NA 3BQYA 3T0YA 2CG4A 4AD9A 3JRGA 2PQ8A 3V4GA 2O6GE 3CC2I 3S1QJ 4P5OA 1IN4A 2R0QC 1DUXC 3L2VA 4LJZF 2KFDA 3CMEI 3HOZJ 1BM9A 2NRAC 2F4OB 2Z2SB 4XM3A 3BQZA 2K4BA 1U5TA 3RCOA 3KCCA 5D4SA 2FD5A 1PYVA 4D5CA 2FOWA 1HXDA 4UVCA 2P81A 2XUBA 3FXRA 1KU9A 1V55H 1QQIA 2E34A 4GCVA 5CQGA 2LKXA 3ZPLA 1YS7A 2XPUA 2R7ZJ 1IRFA 4BE2A 1HW5A 1LDJA 5H20A 1R6RA 3BJOA 2QM3A 3SDGA 3BLYA 5FKLA 1TZLA 4XLHA 3FXMA 2BEOA 4I98B 1GVDA 2CMPA 1J2XA 1Z3YA 4CHUA 2EV0A 3HGYA 1ONVA 1DDNA 3P9CA 4U0VA 4YG2F 4MNUA 4IOAF 2OUMA 3GLXA 5EGOA 1JE8A 3I59A 1USTA 3MEXA 2CSOA 2XRLA 3A4CA 1XMAA 2RAEA 5FKKA 2IA2A 3H92A 5D6EA 4C3IJ 4E7LA 3MN2A 2Z5UA 5CVUA 1BW5A 3LOCA 3QP5A 4PDKA 2IS4A 3GW2A 4DW6A 3HYIA 1YRNA 5LRSA 4DZPA 1O3QA 4L5JA 4BQNA 1LDKB 1SAUA 1BR4A 2FSWA 2O3FA 2JSCA 3RYPA 1CQTA 1N78A 3GWZA 3VFZA 2A68F 2A07F 2Z1DA 5FD5A 1UMQA 2G7UA 2DQRA 2ZJRF 3WTSC 1IUYA 2ZXIA 5CPRB 3MKWB 2WY7Q 4EGYA 1SANA 2GXBA 5JVGF 1RI7A 2V1XA 1I3QJ 3DEEA 2ZNZA 4B3XA 3OYGA 4OIRF
chains in the Genus database with same CATH topology
2L7FP 2DA7A 1B72A 4M3BA 2FQ4A 2XB0X 4BY7J 5EG0A 2JA8J 1A5JA 1MBEA 1Z77A 2X6OA 2I10A 3M3YJ 5M5XJ 5EZHA 3S15J 1ZGWA 3OSGA 2FJ1A 1B8IB 1X2MA 1S7EA 4MFEA 1WH5A 1IRZA 2W48A 2JK3A 2NS7A 2NVYJ 2IBDA 3WHCA 3JRDA 3I4MJ 1LE8A 1UG2A 5IYDJ 1W0UA 3S16J 5F27A 2XB5A 4A3EJ 1ETKA 1MBJA 1JTYA 1WCMJ 4A3FJ 2YUSA 3PM1A 3DEWA 4XK4A 3CMYA 1ORKA 1H8AC 3GTJJ 1U9NA 5EG0B 2EZHA 4BBSJ 5EDNA 2DMTA 2FX0A 3JR9A 4DYRA 1AKHA 1JJ6C 1AU7A 1IGNA 2HOSA 1T33A 3A03A 1JKPC 3LSJA 1RKTA 4CYCA 5IP9J 1MBHA 4BXXJ 4FE4A 1MH4A 3BR3A 4A93J 1TWGJ 3NARA 4S0HB 3PO3J 3S1NJ 2MW8A 3A02A 5FKMA 3F0CA 2WAQN 1H88C 3GBGA 3I4NJ 1WH7A 5DTDA 2GM4A 2XSDC 4AYBN 1Q1VA 2E2HJ 4AC0A 2OF7A 1BA5A 3B6CA 3CCYA 2HQ5A 1U78A 5FLVA 3SFIA 1K83J 3LSRA 4RDUA 3VPRA 3M4OJ 1MBKA 4JX4A 1AHDP 2M0CA 2Y2ZA 4C3JJ 5EF6A 3IH2A 4DZJA 2DMNA 4JP0A 1POGA 4AUXA 1T56A 1MBGA 1JT6A 2LFBA 4FISA 2R92J 2E1OA 5EYRA 2VKVA 2CJJA 3QQAA 3S2HJ 1X2NA 5GPAA 5F04A 4RBOA 3A01A 4J19A 4FCYA 4A3KJ 1ZK8A 5EEAA 4NDLA 2H1KA 2JA5J 2D5VA 1Y1VJ 2EZIA 3PO2J 5C4JJ 3G1LA 3UKGA 3H3VK 2K40A 1BW6A 3BTIA 4MO7A 1JT0A 5EZGA 1RR7A 1RETA 3FK6A 2WV1A 4MIMA 4XRSA 3S1RJ 5IYBJ 3TP0A 1F43A 2HOAA 2XGDA 5E3NA 5M5WJ 1U8BA 3TEDA 4JX6A 3HDDA 3HOUJ 5C3EJ 3IV5A 4IEJA 3FISA 3W6VA 2XGEA 3RQIA 2QF7A 5IYCJ 1OFCX 2O7OA 2X48A 1JUPA 1I50J 1WGXA 1HOMA 1ZTRA 2R93J 4I6ZA 1UHSA 4A3BJ 2NVQJ 5GP9A 3WHBA 3MVPA 5DS9A 2K9NA 1ZQ3P 2L9RA 3GTOJ 3HM5A 5IP6A 3JRIA 4A3JJ 3BG5A 5K7FA 2DMUA 3IH4A 4B4CA 4B1RA 3BG9A 1JUMA 1BJZA 2Y30A 2TCTA 1GUUA 4IHWA 1QVUA 2CUEA 2DA2A 1IDYA 1ETQA 3OIOA 4MLOA 5HODA 2DJNA 4W1UA 2DN0A 2EZLA 4M3GA 4XIDA 3JRHA 4XRSG 3S17J 2EBIA 3Q0VA 1IUFA 5C44J 4D7NA 3C2BA 3ZQHA 2HDDA 2Y0SN 3BR6A 3BTLA 3S2DJ 1P7JA 1XS9A 3FIWA 2LY9A 1O4XA 5C4XJ 3O8HA 1MBFA 4CYCB 5JLWA 3GTQJ 4IHYA 4A3GJ 1QVTA 5IPAA 3S1MJ 5J3LA 3MKLA 1HF0A 4I76A 2CU7A 4M3DA 3BR2A 3G1MA 2DMQA 3LSPA 5FJ8J 2O8KA 1LFUP 4FE7A 4Y52J 3ZQGA 3ZOBA 3OSFA 3HOXJ 4A3DJ 3QPLA 1F36A 4BKXA 4BBRJ 5M5YJ 5M3MJ 1NK3P 1TWFJ 1ZR4A 1IDZA 2VKEA 4GFBA 3GTPJ 1GV2A 3DCFA 2N8GA 5F1JA 5M3FJ 3RZOJ 3BTCA 5K7ZA 2MGQA 3S14J 2O9LA 2DA1A 1IC8A 2VI6A 2AHQA 2TRTA 3ZQCA 2GBYA 2JA6J 2JMWA 1W0TA 2E2JJ 2LD5A 1VNDA 3HEFA 5E3MA 3HBLA 4DYCA 1Z0XA 2KT0A 1AKHB 1PUFA 1OCTC 2CUFA 3BR5A 5J1YA 5IOYA 3HOYJ 5EGOB 5FKOA 3L1PA 1XC5A 2ID6A 3HKZN 1WI3A 1A6IA 1JUSA 1P7IA 1HDPA 2HYJA 4L5EA 4V2FA 5E3LA 3JRFA 9ANTA 3TP3A 1X58A 1WPKA 1R9TJ 1APLC 2XPWA 1MSFC 2NS8A 1TC3C 2M34A 1NTCA 2CQQA 2ME0A 2HI3A 1YRNB 2X9DA 4MFDA 4BY1J 4V2GA 1ETXA 1B8IA 4M3FA 2DA4A 1LFBA 3BT9A 4JYKA 1GV5A 2PMZN 3ZQFA 2NVXJ 3K7AJ 3HGGA 2ECCA 1IV6A 3BTJA 1HCRA 3GTGJ 1RPWA 4IHXA 2G0EA 2IAIA 4D7MA 1IJWC 2LK2A 4A3CJ 3JRAA 5E3OA 3HOWJ 5IOZA 2ZB9A 2LP0A 3CQZJ 1ITYA 2L0KA 3JRBA 2K9QA 1H89C 2DA3A 4M6VA 5F0HA 2H8RA 5J1UA 1QPIA 2M8GX 1OJLA 3HB9A 3ZQLA 1XG1A 2E19A 1D5YA 4UUSB 5F08A 2LLKA 3Q0WA 2DA6A 1JTXA 2K9SA 3O8GA 1JGGA 2VUMJ 1TWCJ 1DU6A 1Y1WJ 1U9OA 3FK7A 4HNVA 1JJ8C 4LOCA 1HDDC 4QIWN 2JN6A 4A3IJ 2L7MP 3JRCA 4QSHA 3TW6A 4XICA 1FJLA 2OPTA 1OCPA 1FIAA 2JA7J 3FKIJ 2Y9ZA 1NK2P 3SJMA 1VI0A 1MNMC 2L7ZA 4A3MJ 4JX5A 2E2IJ 2B63J 1RKWA 2DMPA 1QRYA 5BNGA 1ETWA 1B72B 4UUSA 4UUTA 1ZR2A 2HOTA 2LR8A 2LVSA 3RZDJ 4XRMA 3NAUA 3RKQA 2GLOA 5FKNA 3Q0UA 1ENHA 2XGCA 3A01B 4D5FA 3ZQIA 4C3HJ 1HLVA 2CRGA 1BL0A 5F0FA 1MH3A 2Y9YA 1RESA 2CQXA 1ETVA 4QTRA 4C2MJ 2YU9J 2MG4A 2LTPA 1FTZA 3G1OA 2DTZA 2MSYA 2R5ZB 2JJ7A 3D1NI 3GTMJ 2HXIA 2R5YA 4EEFG 2ECBA 2XPVA 4G12A 3HOVJ 1DU0A 3BQYA 3JRGA 2HXOA 4X6AJ 3S1QJ 3CDLA 2R0QC 1PUFB 1ETOA 3GTLJ 3HOZJ 3E7LA 1JKRC 3BQZA 2QCOA 2VPRA 1VF9A 1GDTA 4B3AA 5J1RA 2FD5A 1E3OC 4D5CA 2EQRA 2P81A 1FIPA 2DA5A 4W97A 4ABZA 4A3LJ 1ZKGA 1IG7A 3LSGA 2R7ZJ 2LKXA 1GT0C 2JWTA 2XPUA 2M9HA 2YS9A 5IP7J 3K2AA 2EH3A 3SDGA 1JKQC 5FKLA 3IH3A 3GTKJ 3BR0A 3QPSA 1GVDA 2NVTJ 3JREA 1FTTA 3BR1A 1MSEC 5K7HA 3OOUA 5GPCA 2ME6A 3HGYA 3TW7A 1SFOJ 2ELKA 2M2EA 2IEKA 3BG3A 5JLXA 5EGOA 3B6AA 1I6HJ 2R5ZA 4DYQA 4FTHA 2XRLA 2RAEA 5FKKA 2AO9A 1TWHJ 4C3IJ 4A69C 1ETYA 2R5YB 3MN2A 2KDZA 3LNQA 1BW5A 1JKOC 2EZKA 3LOCA 3H0GJ 3Q3SA 2COBA 4DW6A 5F0CA 1YRNA 2NOGA 4IHVA 4DZPA 2ID3A 2Y31A 4X1EA 1EF4A 1G2HA 1FEXA 1CQTA 1TWAJ 5FLMJ 1LE8B 2WB1N 1UMQA 1VFCA 1SANA 1K61A 1I3QJ 4M3EA 4Y7NJ
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2L7F P;  2DA7 A;  1B72 A;  4M3B A;  2FQ4 A;  2XB0 X;  4BY7 J;  5EG0 A;  2JA8 J;  1A5J A;  1MBE A;  1Z77 A;  2X6O A;  2I10 A;  3M3Y J;  5M5X J;  5EZH A;  3S15 J;  1ZGW A;  3OSG A;  2FJ1 A;  1B8I B;  1X2M A;  1S7E A;  4MFE A;  1WH5 A;  1IRZ A;  2W48 A;  2JK3 A;  2NS7 A;  2NVY J;  2IBD A;  3WHC A;  3JRD A;  3I4M J;  1LE8 A;  1UG2 A;  5IYD J;  1W0U A;  3S16 J;  5F27 A;  2XB5 A;  4A3E J;  1ETK A;  1MBJ A;  1JTY A;  1WCM J;  4A3F J;  2YUS A;  3PM1 A;  3DEW A;  4XK4 A;  3CMY A;  1ORK A;  1H8A C;  3GTJ J;  1U9N A;  5EG0 B;  2EZH A;  4BBS J;  5EDN A;  2DMT A;  2FX0 A;  3JR9 A;  4DYR A;  1AKH A;  1JJ6 C;  1AU7 A;  1IGN A;  2HOS A;  1T33 A;  3A03 A;  1JKP C;  3LSJ A;  1RKT A;  4CYC A;  5IP9 J;  1MBH A;  4BXX J;  4FE4 A;  1MH4 A;  3BR3 A;  4A93 J;  1TWG J;  3NAR A;  4S0H B;  3PO3 J;  3S1N J;  2MW8 A;  3A02 A;  5FKM A;  3F0C A;  2WAQ N;  1H88 C;  3GBG A;  3I4N J;  1WH7 A;  5DTD A;  2GM4 A;  2XSD C;  4AYB N;  1Q1V A;  2E2H J;  4AC0 A;  2OF7 A;  1BA5 A;  3B6C A;  3CCY A;  2HQ5 A;  1U78 A;  5FLV A;  3SFI A;  1K83 J;  3LSR A;  4RDU A;  3VPR A;  3M4O J;  1MBK A;  4JX4 A;  1AHD P;  2M0C A;  2Y2Z A;  4C3J J;  5EF6 A;  3IH2 A;  4DZJ A;  2DMN A;  4JP0 A;  1POG A;  4AUX A;  1T56 A;  1MBG A;  1JT6 A;  2LFB A;  4FIS A;  2R92 J;  2E1O A;  5EYR A;  2VKV A;  2CJJ A;  3QQA A;  3S2H J;  1X2N A;  5GPA A;  5F04 A;  4RBO A;  3A01 A;  4J19 A;  4FCY A;  4A3K J;  1ZK8 A;  5EEA A;  4NDL A;  2H1K A;  2JA5 J;  2D5V A;  1Y1V J;  2EZI A;  3PO2 J;  5C4J J;  3G1L A;  3UKG A;  3H3V K;  2K40 A;  1BW6 A;  3BTI A;  4MO7 A;  1JT0 A;  5EZG A;  1RR7 A;  1RET A;  3FK6 A;  2WV1 A;  4MIM A;  4XRS A;  3S1R J;  5IYB J;  3TP0 A;  1F43 A;  2HOA A;  2XGD A;  5E3N A;  5M5W J;  1U8B A;  3TED A;  4JX6 A;  3HDD A;  3HOU J;  5C3E J;  3IV5 A;  4IEJ A;  3FIS A;  3W6V A;  2XGE A;  3RQI A;  2QF7 A;  5IYC J;  1OFC X;  2O7O A;  2X48 A;  1JUP A;  1I50 J;  1WGX A;  1HOM A;  1ZTR A;  2R93 J;  4I6Z A;  1UHS A;  4A3B J;  2NVQ J;  5GP9 A;  3WHB A;  3MVP A;  5DS9 A;  2K9N A;  1ZQ3 P;  2L9R A;  3GTO J;  3HM5 A;  5IP6 A;  3JRI A;  4A3J J;  3BG5 A;  5K7F A;  2DMU A;  3IH4 A;  4B4C A;  4B1R A;  3BG9 A;  1JUM A;  1BJZ A;  2Y30 A;  2TCT A;  1GUU A;  4IHW A;  1QVU A;  2CUE A;  2DA2 A;  1IDY A;  1ETQ A;  3OIO A;  4MLO A;  5HOD A;  2DJN A;  4W1U A;  2DN0 A;  2EZL A;  4M3G A;  4XID A;  3JRH A;  4XRS G;  3S17 J;  2EBI A;  3Q0V A;  1IUF A;  5C44 J;  4D7N A;  3C2B A;  3ZQH A;  2HDD A;  2Y0S N;  3BR6 A;  3BTL A;  3S2D J;  1P7J A;  1XS9 A;  3FIW A;  2LY9 A;  1O4X A;  5C4X J;  3O8H A;  1MBF A;  4CYC B;  5JLW A;  3GTQ J;  4IHY A;  4A3G J;  1QVT A;  5IPA A;  3S1M J;  5J3L A;  3MKL A;  1HF0 A;  4I76 A;  2CU7 A;  4M3D A;  3BR2 A;  3G1M A;  2DMQ A;  3LSP A;  5FJ8 J;  2O8K A;  1LFU P;  4FE7 A;  4Y52 J;  3ZQG A;  3ZOB A;  3OSF A;  3HOX J;  4A3D J;  3QPL A;  1F36 A;  4BKX A;  4BBR J;  5M5Y J;  5M3M J;  1NK3 P;  1TWF J;  1ZR4 A;  1IDZ A;  2VKE A;  4GFB A;  3GTP J;  1GV2 A;  3DCF A;  2N8G A;  5F1J A;  5M3F J;  3RZO J;  3BTC A;  5K7Z A;  2MGQ A;  3S14 J;  2O9L A;  2DA1 A;  1IC8 A;  2VI6 A;  2AHQ A;  2TRT A;  3ZQC A;  2GBY A;  2JA6 J;  2JMW A;  1W0T A;  2E2J J;  2LD5 A;  1VND A;  3HEF A;  5E3M A;  3HBL A;  4DYC A;  1Z0X A;  2KT0 A;  1AKH B;  1PUF A;  1OCT C;  2CUF A;  3BR5 A;  5J1Y A;  5IOY A;  3HOY J;  5EGO B;  5FKO A;  3L1P A;  1XC5 A;  2ID6 A;  3HKZ N;  1WI3 A;  1A6I A;  1JUS A;  1P7I A;  1HDP A;  2HYJ A;  4L5E A;  4V2F A;  5E3L A;  3JRF A;  9ANT A;  3TP3 A;  1X58 A;  1WPK A;  1R9T J;  1APL C;  2XPW A;  1MSF C;  2NS8 A;  1TC3 C;  2M34 A;  1NTC A;  2CQQ A;  2ME0 A;  2HI3 A;  1YRN B;  2X9D A;  4MFD A;  4BY1 J;  4V2G A;  1ETX A;  1B8I A;  4M3F A;  2DA4 A;  1LFB A;  3BT9 A;  4JYK A;  1GV5 A;  2PMZ N;  3ZQF A;  2NVX J;  3K7A J;  3HGG A;  2ECC A;  1IV6 A;  3BTJ A;  1HCR A;  3GTG J;  1RPW A;  4IHX A;  2G0E A;  2IAI A;  4D7M A;  1IJW C;  2LK2 A;  4A3C J;  3JRA A;  5E3O A;  3HOW J;  5IOZ A;  2ZB9 A;  2LP0 A;  3CQZ J;  1ITY A;  2L0K A;  3JRB A;  2K9Q A;  1H89 C;  2DA3 A;  4M6V A;  5F0H A;  2H8R A;  5J1U A;  1QPI A;  2M8G X;  1OJL A;  3HB9 A;  3ZQL A;  1XG1 A;  2E19 A;  1D5Y A;  4UUS B;  5F08 A;  2LLK A;  3Q0W A;  2DA6 A;  1JTX A;  2K9S A;  3O8G A;  1JGG A;  2VUM J;  1TWC J;  1DU6 A;  1Y1W J;  1U9O A;  3FK7 A;  4HNV A;  1JJ8 C;  4LOC A;  1HDD C;  4QIW N;  2JN6 A;  4A3I J;  2L7M P;  3JRC A;  4QSH A;  3TW6 A;  4XIC A;  1FJL A;  2OPT A;  1OCP A;  1FIA A;  2JA7 J;  3FKI J;  2Y9Z A;  1NK2 P;  3SJM A;  1VI0 A;  1MNM C;  2L7Z A;  4A3M J;  4JX5 A;  2E2I J;  2B63 J;  1RKW A;  2DMP A;  1QRY A;  5BNG A;  1ETW A;  1B72 B;  4UUS A;  4UUT A;  1ZR2 A;  2HOT A;  2LR8 A;  2LVS A;  3RZD J;  4XRM A;  3NAU A;  3RKQ A;  2GLO A;  5FKN A;  3Q0U A;  1ENH A;  2XGC A;  3A01 B;  4D5F A;  3ZQI A;  4C3H J;  1HLV A;  2CRG A;  1BL0 A;  5F0F A;  1MH3 A;  2Y9Y A;  1RES A;  2CQX A;  1ETV A;  4QTR A;  4C2M J;  2YU9 J;  2MG4 A;  2LTP A;  1FTZ A;  3G1O A;  2DTZ A;  2MSY A;  2R5Z B;  2JJ7 A;  3D1N I;  3GTM J;  2HXI A;  2R5Y A;  4EEF G;  2ECB A;  2XPV A;  4G12 A;  3HOV J;  1DU0 A;  3BQY A;  3JRG A;  2HXO A;  4X6A J;  3S1Q J;  3CDL A;  2R0Q C;  1PUF B;  1ETO A;  3GTL J;  3HOZ J;  3E7L A;  1JKR C;  3BQZ A;  2QCO A;  2VPR A;  1VF9 A;  1GDT A;  4B3A A;  5J1R A;  2FD5 A;  1E3O C;  4D5C A;  2EQR A;  2P81 A;  1FIP A;  2DA5 A;  4W97 A;  4ABZ A;  4A3L J;  1ZKG A;  1IG7 A;  3LSG A;  2R7Z J;  2LKX A;  1GT0 C;  2JWT A;  2XPU A;  2M9H A;  2YS9 A;  5IP7 J;  3K2A A;  2EH3 A;  3SDG A;  1JKQ C;  5FKL A;  3IH3 A;  3GTK J;  3BR0 A;  3QPS A;  1GVD A;  2NVT J;  3JRE A;  1FTT A;  3BR1 A;  1MSE C;  5K7H A;  3OOU A;  5GPC A;  2ME6 A;  3HGY A;  3TW7 A;  1SFO J;  2ELK A;  2M2E A;  2IEK A;  3BG3 A;  5JLX A;  5EGO A;  3B6A A;  1I6H J;  2R5Z A;  4DYQ A;  4FTH A;  2XRL A;  2RAE A;  5FKK A;  2AO9 A;  1TWH J;  4C3I J;  4A69 C;  1ETY A;  2R5Y B;  3MN2 A;  2KDZ A;  3LNQ A;  1BW5 A;  1JKO C;  2EZK A;  3LOC A;  3H0G J;  3Q3S A;  2COB A;  4DW6 A;  5F0C A;  1YRN A;  2NOG A;  4IHV A;  4DZP A;  2ID3 A;  2Y31 A;  4X1E A;  1EF4 A;  1G2H A;  1FEX A;  1CQT A;  1TWA J;  5FLM J;  1LE8 B;  2WB1 N;  1UMQ A;  1VFC A;  1SAN A;  1K61 A;  1I3Q J;  4M3E A;  4Y7N J; 
#chains in the Genus database with same CATH topology
 3LMM A;  3KP4 A;  3ERE D;  2JVG A;  1RUN A;  2XB0 X;  1WHU A;  4ZDL A;  2VLA A;  1A5J A;  1DGR M;  2X6O A;  4ZYD A;  3M3Y J;  2R7O A;  5EZH A;  3OSG A;  3BP8 A;  1FPQ A;  1UAA A;  2OZU A;  2MFZ A;  1S7E A;  1S72 I;  1WH5 A;  1VQM I;  1X3Z B;  2FU4 A;  4LFU A;  3VEP A;  1HST A;  1SFX A;  3PFY A;  3MZ8 A;  2Q0O A;  4LGW A;  1RRJ A;  1QNT A;  1EKE A;  5L3B A;  3DQV C;  2XB5 A;  4E7I A;  3SZG A;  3AFH A;  1AA7 A;  1JTY A;  4XKV A;  3CD6 I;  3DEW A;  4I01 A;  2LG4 A;  4EAT A;  1P9Q C;  2UV1 A;  5EDN A;  4KMF A;  2DMT A;  1YW8 A;  2E60 A;  1AKH A;  1TT0 A;  2VOP A;  4CYC A;  4UV9 A;  2Y75 A;  4Z2Y A;  2IXS A;  3TDZ C;  3M1C A;  3EPZ A;  4BS9 A;  3R60 A;  4PGH A;  4M72 A;  1KU2 A;  3CJN A;  4G7Z F;  3A02 A;  4J00 A;  2IVM A;  4II3 A;  2PMH A;  2DYR H;  3V7S A;  2GM4 A;  3L9F A;  4N0B A;  1Q1V A;  4AC0 A;  4BNC A;  1R71 A;  2BGC A;  2VQC A;  1OYY A;  2RGV A;  3D5S C;  3FX3 A;  4AIJ A;  3T1B A;  2FEZ A;  2L3D A;  4CCM A;  3JAM Z;  1W36 C;  2K5C A;  2HDC A;  1VQL I;  2F48 A;  4JP0 A;  1RC9 A;  1UHM A;  4G6T B;  3REO A;  4NC8 A;  3OYL A;  1FP1 D;  2DOE A;  1JT6 A;  2R7V A;  2ELH A;  2H27 A;  1LVA A;  1BI1 A;  4N4N B;  4OAY A;  2KRF A;  3FMS A;  1X2N A;  5GPA A;  5F04 A;  4RBO A;  5D5X B;  2K7L A;  3C2G A;  3D5R C;  3CO7 C;  2HOE A;  5EEA A;  4YFX F;  3CLQ A;  4NDL A;  3F9K A;  1I1S A;  5LEK A;  1E2X A;  1Y1V J;  5FFZ A;  1U5T C;  1IAW A;  2KJB A;  4BDY A;  3R4K A;  3CF2 A;  2EFW A;  3RYR A;  3G1L A;  2OAZ A;  4FX4 A;  2K40 A;  1D1B A;  3TDU C;  4MO7 A;  5EZG A;  2EWN A;  2K3F A;  3HRS A;  1RR7 A;  3OYI A;  2DFF A;  2YX7 A;  3AL0 B;  3K70 D;  2OQG A;  1W5T A;  2WV1 A;  2QEX I;  2PJP A;  1JI8 A;  2W57 A;  2HOA A;  3LAJ A;  3GX4 X;  1YIJ I;  3TED A;  1XGS A;  4CZC A;  4RA2 A;  3UR3 C;  3E6D A;  3ASN H;  2V4J C;  1YFH A;  4S04 A;  1VZ0 A;  2QF7 A;  2NOJ B;  2VBX A;  1OFC X;  2IJL A;  2FBI A;  3ZRG A;  5IYC J;  1JUP A;  3OYK A;  5DUI A;  3K1M A;  1XSV A;  3GFI A;  4KIB A;  1HOM A;  1ZTR A;  4A5N A;  2D1V A;  2RC4 A;  4XLE A;  2E1M B;  3EYI A;  1D0Y A;  3QOE A;  4I6Z A;  2NVQ J;  2O5R A;  4GGG A;  2PN6 A;  5DS9 A;  2PX9 A;  5BQT A;  2BY1 A;  2PJR A;  2K9N A;  1ZQ3 P;  3J81 K;  2JSP A;  2L9R A;  1MIJ A;  4A3J J;  1PP8 F;  1I39 A;  4UUV A;  3G2B A;  2LRE A;  2FF4 A;  3HOT A;  4RGX A;  4A2U A;  4D1Q A;  1EA3 A;  2WA0 A;  4RAZ A;  1ZRD A;  4LK1 F;  1BJZ A;  1GUU A;  2WC2 A;  3O2P E;  4IHW A;  3BOQ A;  2WV0 A;  1N25 A;  2DA2 A;  2DOD A;  2EV6 A;  3OIO A;  4MLO A;  2IGO A;  3BZC A;  4BXU A;  3BRO A;  2XAG A;  1Z67 A;  3ZXS A;  1Z6T A;  2DN0 A;  3BPX A;  2CFX A;  4L18 B;  3HRU A;  4XRS G;  3MD2 A;  1MMG A;  1BI0 A;  4F92 B;  4NC6 A;  1R4M B;  2EBI A;  1IUF A;  3Q0V A;  3S17 J;  1Z7U A;  4I7H A;  1O3T A;  3RQ4 A;  1FLI A;  3V8J A;  2QBY B;  5DCM B;  2V6C A;  3BTL A;  2XAS A;  3DTE A;  3U1D A;  1C0W A;  4OMZ A;  4IHS A;  1O4X A;  3O8H A;  1MBF A;  5CKT A;  3OY9 A;  1YJN I;  1MJB A;  3LA2 A;  2D45 A;  2KIS A;  4IHY A;  1OCZ H;  5IPA A;  5D5U B;  4LLN A;  5E1W A;  5L3F A;  1FC3 A;  4BGD A;  1S5L C;  3MKZ A;  4BAC A;  3DLL F;  2X85 A;  5DV5 A;  5FB2 A;  5FJ8 J;  2HQN A;  1L0O C;  3PIO F;  2HFH A;  1SMY F;  2HPM A;  3ZQG A;  1UB9 A;  3TO6 A;  1QO0 D;  4YIF A;  2KRH A;  4FET A;  3ESW B;  4CZZ A;  3E1S A;  3CCU I;  5M3M J;  1IW7 F;  1TWF J;  1FZP B;  1ZR4 A;  1IDZ A;  2CQN A;  3TO7 A;  3KYD B;  2Y69 H;  3DCF A;  3GCM A;  5M3F J;  3RZO J;  5LEJ A;  1ACI A;  1TNT A;  3CUQ B;  2AHQ A;  2AXL A;  1HW2 A;  1GHC A;  2JMW A;  1BR2 A;  2UXX A;  1GXP A;  1H9G A;  3HEF A;  2BVM A;  2VL8 A;  2D2W A;  1Z0X A;  4EV0 A;  3BZ6 A;  3H3Z A;  4CCL A;  3LAP A;  1TNS A;  2BZT A;  1PVE A;  5BMZ A;  2HR3 A;  4LLG F;  2ZME C;  3HTS B;  2V26 A;  4IRH A;  5J1Y A;  2ELJ A;  2DT7 B;  3VOD A;  1R5G A;  1QZY A;  5CLS A;  3QPT A;  3HOY J;  3H5A A;  4CXF A;  3HKZ N;  1WI3 A;  2QVO A;  5KVR A;  1X1A A;  1P7I A;  3T8R A;  1VQN I;  4V2F A;  5E3L A;  3JRF A;  2PBI A;  4R1H A;  1N75 A;  1WPK A;  1APL C;  2XPW A;  3CF5 F;  3J7Y J;  3V8L A;  2FML A;  1TC3 C;  2HVR A;  1ZHF A;  2M34 A;  1LQ1 A;  2J5O A;  2RV8 A;  3ECO A;  2X9D A;  5DYM A;  4BY1 J;  1UEL B;  3E6M A;  3PL8 A;  4M3F A;  2VPL A;  3DEU A;  5LFA A;  3GME A;  1R1U A;  1XCV A;  4XSX F;  1MMS A;  1ULY A;  5E17 F;  1LVK A;  2EFO A;  4JYK A;  2NVX J;  2VQG A;  5CVR A;  5DM7 F;  2DT6 A;  3I59 B;  3O6B B;  2Y0M A;  2QGU A;  2X1E A;  3HOW J;  3MQ0 A;  3RKW A;  4B48 A;  2FUG 2;  2KMU A;  4XN0 A;  4Y3O A;  3CQZ J;  2CV2 A;  2F6C A;  4XNF A;  5ICE A;  2ETH A;  2NYX A;  2K9Q A;  3K2Z A;  1OKR A;  3QOD A;  4DBQ A;  3ABM H;  3KP5 A;  2F5C A;  3DLA A;  2NNN A;  3SDB A;  2H8R A;  2XIG A;  2ISY A;  4F91 B;  2M8G X;  1OJL A;  4N9I A;  5F08 A;  4RMN A;  3AG4 H;  1JTX A;  3O3K A;  3O8G A;  1JGG A;  1X3W B;  2DLL A;  4QPO A;  2VUM J;  1A31 A;  1X3U A;  3NWS A;  2A61 A;  1JJ8 C;  3DPU A;  4LOC A;  4EM2 A;  1HDD C;  3FXL A;  2IRF G;  1YX5 A;  3SZP A;  3HSF A;  4A3I J;  3ABL H;  2L7M P;  2CGP A;  2EIL H;  2P8T A;  3ONQ A;  2OPT A;  2V1N A;  1G3W A;  2HVQ A;  2XSJ C;  1OYI A;  3FKI J;  3MZY A;  1ZG5 A;  1MNM C;  1BI2 A;  1T38 A;  2K4J A;  3CMA I;  2KL4 A;  2DMP A;  1ETW A;  4XOR A;  1SMT A;  4HNT A;  4ESJ A;  2CWE A;  3FHN A;  2H8W A;  4I02 A;  1R49 A;  1YIT I;  2LVS A;  4LIU A;  3RZD J;  3K9T A;  3RJP A;  2QQ8 A;  2AQE A;  2V9K A;  4BEH A;  2E35 A;  3S32 A;  2FNA A;  2A6T A;  3RPQ A;  2A05 A;  4C3H J;  1BL0 A;  2R7D A;  5F0F A;  3WTT C;  3DPT A;  2MD0 A;  1VQ5 I;  1P2F A;  2YU9 J;  1ZEL A;  1TP4 A;  1FTZ A;  2KDO A;  2RN7 A;  1S9H A;  2LDU A;  2JJ7 A;  3D1N I;  3FXK A;  4HRI A;  4RB0 A;  4G6D A;  4Q5S F;  1IXS B;  3CUO A;  3PIP F;  2KIU A;  4EEF G;  2XPV A;  3CCM I;  5HLT A;  2L9V A;  1K6O A;  2HXO A;  4X6A J;  3CDL A;  3COA C;  4BE0 A;  3P7N A;  2EV5 A;  4BHC A;  5FRN A;  1FWZ A;  1XB4 A;  4NBQ A;  3GLL A;  3F22 A;  1JKR C;  5IT9 Z;  3GZN B;  3V7C A;  2ZJ2 A;  3A1Y A;  2V7F A;  1FYM A;  2QCO A;  5E8I A;  1VF9 A;  4U0W A;  5CQE A;  3TMO A;  4IKF A;  3OWT A;  4HBL A;  5LGU A;  4M6X A;  5A2Q K;  1FIP A;  2DA5 A;  2D1H A;  2M9H A;  2YS9 A;  3P9K A;  1SD4 A;  1WQ2 A;  2VKD A;  3K2A A;  4R8H A;  2VXZ A;  1HSJ A;  3L7W A;  3HG9 A;  3L00 A;  3QPS A;  2NVT J;  3JRE A;  3HKZ A;  1FTT A;  3H35 A;  3S3O A;  1MSE C;  5K7H A;  3ZQ7 A;  1XCB A;  2P5V A;  2ZME A;  4ZYA A;  4E7Z A;  5GPC A;  1H9T A;  2ELK A;  4DGW B;  3H9Q A;  4HZF A;  3BG3 A;  2IA1 A;  2LSO A;  3KZI C;  1QPM A;  3VOE A;  4RS8 A;  4FTH A;  4EM0 B;  3N05 A;  3CTA A;  2HS5 A;  3UNG C;  4EQQ A;  2PEX A;  4UHT A;  2AO9 A;  3LSH A;  3P5J A;  1Y8Q B;  5F6F A;  1ETY A;  2F5V A;  3LNQ A;  1G3S A;  2R7Q A;  2EZK A;  3H0G J;  4EJV A;  3Q3S A;  5FLX Z;  4HG2 A;  1Z7L A;  3RDI A;  3F8N A;  5F0C A;  1T2K A;  4IHV A;  4LB6 B;  1KQ0 A;  3ZMT A;  3LST A;  4WF2 A;  1GXQ A;  1NG6 A;  2VBW A;  1EF4 A;  3K10 A;  2QSG X;  1FEX A;  2QUF A;  1G2H A;  4QPQ A;  5KCM A;  1FOX A;  1LE8 B;  4XKB A;  2PLY A;  4PJ0 C;  1IV8 A;  2ESN A;  3OYJ A;  1VFC A;  2ZC2 A;  5ICG A;  1XX5 A;  4Y7N J;  2L7F P;  3OOP A;  3C2H A;  3L2Q A;  2E1N A;  3E97 A;  5BS6 A;  1MBE A;  2E1C A;  3HOS A;  4O3M A;  1HW1 A;  4CDG A;  1Y56 A;  4ENN A;  2NS0 A;  3S15 J;  1B8I B;  5HS9 A;  4HX8 A;  4MFE A;  1Y6I A;  2BY2 A;  3P9I A;  5JI6 A;  1IRZ A;  2JK3 A;  4G94 A;  2BW3 A;  2E5N A;  2NS7 A;  4J01 A;  1OMI A;  2NVY J;  2IBD A;  2ZFW A;  3VYU B;  1USS A;  3WHC A;  2L54 A;  3KLN A;  3KP2 A;  1LE8 A;  3I4M J;  3IWZ A;  3S16 J;  3KFW X;  4ESB A;  2ISZ A;  3I56 I;  1ETK A;  1MBJ A;  2H1L A;  1BIA A;  1WCM J;  3H1C A;  5DD4 A;  3W3C A;  1SVL A;  1ORK A;  1OPC A;  2R4G A;  1QZZ A;  4Y33 A;  3ECH A;  1X4P A;  3L2U A;  3JR9 A;  2FX0 A;  2M45 A;  2R3S A;  2Q1Z B;  4ZJZ A;  4DYR A;  1AU7 A;  2HOS A;  1T33 A;  2FBH A;  3A03 A;  4BYY A;  3GYH X;  1AOY A;  5IP9 J;  3TL4 X;  1J0R A;  3K4M A;  3FMQ A;  4LD5 A;  2BXZ A;  4FX0 A;  1YHQ I;  3DF8 A;  3U9G A;  5BPI A;  3PNY A;  4HYE A;  3GZ6 A;  4A5M A;  4NC7 A;  1XSD A;  4YEJ A;  1BN5 A;  1VTN C;  3CES A;  4ZTF A;  4RGS A;  2B9S A;  1H88 C;  3I4N J;  3I71 A;  4YEL A;  3H5R A;  5DTD A;  4DQ2 A;  2RNG A;  4HEA 2;  4MHG A;  4RB1 A;  2M1B A;  1EH8 A;  2Z99 A;  4JBA A;  3QYE A;  5CVJ A;  2OF7 A;  1D1C A;  1U2W A;  2EB7 A;  1J59 A;  1E0E A;  3CP2 A;  4HDV A;  1U78 A;  1STZ A;  5FLV A;  2WAQ A;  3LSR A;  5E1X A;  1S7A A;  1T08 B;  3VPR A;  3VSL A;  1IRG A;  1AHD P;  2M0C A;  2BHY A;  3ZMV A;  4PSX A;  1OYW A;  4C3J J;  5EF6 A;  3IH2 A;  4DZJ A;  1AWC A;  2STT A;  2LH9 A;  1POG A;  2V9P A;  1T56 A;  4AUX A;  1X4O A;  5HDG A;  2LFB A;  1P4X A;  4CIC A;  4FIS A;  4ZH4 F;  4ZDP A;  5EYR A;  4EJO A;  2VKV A;  1X19 A;  2E5Z A;  3SYT A;  3ULQ B;  3QQA A;  3S2H J;  1OQY A;  3IUO A;  1ZLJ A;  3A01 A;  2X1C A;  2IS6 A;  2GOX B;  1HKQ A;  1KQ9 A;  2BHZ A;  2VXD A;  1LFP A;  2F5F A;  3DBL B;  3IHU A;  3ABT A;  4A3K J;  1Z9C A;  1YJW I;  4QWQ A;  2H1K A;  2JA5 J;  3JCU C;  2K9L A;  3R0J A;  4M74 A;  2EZI A;  2KIQ A;  3LA3 A;  2L7K A;  2DTR A;  5C4J J;  2RQP A;  4CCO A;  3UKG A;  2ZNY A;  3CC4 I;  2H94 A;  4IQJ A;  3FHZ A;  4AM3 A;  3LQR A;  4JK1 X;  4IOC F;  4MTE A;  4Y4R A;  2HU9 A;  1UFM A;  2DCE A;  2LNB A;  5E3N A;  5M5W J;  3LFU A;  1U8B A;  4R79 A;  1Z05 A;  2LMD A;  2I8D A;  3HDD A;  4BXF A;  3J7Z I;  2VC1 A;  3MWM A;  1X1B A;  4FQG A;  2A5W A;  5C3E J;  3EET A;  2DPD A;  3RQI A;  1ZRC A;  1XMK A;  3BG7 A;  4Y17 A;  1DP3 A;  2CW7 A;  3A0B C;  3KP3 A;  5L3E A;  3I4P A;  4XKW A;  4N4O B;  4XKC A;  3KZY A;  4QLC U;  1RZ4 A;  4RB2 C;  2VC0 A;  5FO5 A;  2BVL A;  4HW0 A;  4EM1 A;  1O7L A;  2KHM A;  5IP6 A;  5LBQ A;  3CUQ C;  4KDP A;  3BG5 A;  5K7F A;  1OCO H;  2DMU A;  3IH4 A;  3K69 A;  2ZXW H;  2FOK A;  3DPL C;  3OYM A;  3BG9 A;  2K85 A;  2BY0 A;  2AQF A;  2TCT A;  3CJT B;  1LEB A;  1QVU A;  1E3P A;  2JUC A;  1M1E B;  5A2Q Z;  2R7S A;  2IS1 A;  2WB1 A;  1ON2 A;  1R1T A;  3CCJ I;  3OYB A;  1T95 A;  2IS2 A;  1TQP A;  4IX7 A;  3I58 A;  4KA4 A;  2L9S A;  2OU2 A;  4ETS A;  2FA5 A;  2QLZ A;  2NXN B;  2XC7 A;  3IL2 A;  1T0F A;  4M3G A;  3JRH A;  2CW8 A;  5LHG A;  1MW7 A;  3BC8 A;  2CH0 A;  1TQM A;  3VB2 A;  3QU6 A;  2VJ5 A;  3SHF A;  1B59 A;  1BI3 A;  2LRD A;  4XSZ F;  2ZBK A;  2K02 A;  4IXA A;  2GWR A;  1P7J A;  1TQI A;  3WTV C;  2LY9 A;  2JUG A;  5EEG A;  5C4X J;  2P5K A;  5JLW A;  5KAI C;  1VQO I;  3HJE A;  3FMR A;  5ERI A;  3MKL A;  1HQC A;  1HF0 A;  1G8X A;  3GF2 A;  5DCF A;  3M8F A;  4I76 A;  2CU7 A;  4PJJ A;  4AVP A;  2DU9 A;  3BR2 A;  2KIF A;  4YFK F;  2F4I A;  3SFZ A;  1DPR A;  1LFU P;  1T98 A;  3SEZ A;  2ACJ A;  4UNO A;  3QPH A;  2QA4 I;  4LG3 A;  3QPL A;  5HDN A;  1F36 A;  4CA0 A;  3CCS I;  2L9N A;  5HLI A;  1I1G A;  4RB3 C;  1RNL A;  1GV2 A;  3DKY A;  5ED4 A;  1YS6 A;  1GLN A;  4HPQ A;  5K7Z A;  3S14 J;  2O9L A;  2GA1 A;  3R0A A;  1IC8 A;  3ZQC A;  4XON A;  1W0T A;  3DBH B;  2E2J J;  2GXA A;  2LD5 A;  1VND A;  5FFX A;  4OMY A;  3HBL A;  4DYC A;  4NHJ A;  6PAX A;  3HTU A;  4XN3 A;  3AG2 H;  2E1M C;  3Q9S A;  2UUZ A;  2GOM A;  3RIR A;  5EJC A;  2M7B A;  3ZMZ A;  1R5I D;  1FX7 A;  2CV1 A;  2VBY A;  4XLA A;  2JQ7 A;  2O03 A;  3IAS 2;  5EGO B;  3IAM 2;  5FKO A;  3EUA A;  4HDU A;  1IRX A;  1XC5 A;  1W5S A;  1HDP A;  4HQM A;  2HYJ A;  3I0T A;  1R9T J;  5DCM A;  1XD7 A;  1MSF C;  2Q2E A;  2YSR A;  3OIQ A;  4GXO A;  1H0M A;  2CO5 A;  2H6C A;  2JRM A;  3WGH A;  3K0L A;  2A69 F;  3W6J B;  4XLF A;  4V2G A;  3NEU A;  5TJJ A;  3LFK A;  5JVT A;  2DOF A;  1B8I A;  5DD8 A;  2DA4 A;  1LFB A;  3ZQF A;  5IT3 A;  3HGG A;  1V4R A;  4OU0 A;  4XOP A;  2HPI A;  5GAD J;  1QA6 A;  2XF6 A;  1D0Z A;  1BR1 A;  2V9V A;  3JRA A;  2XGX A;  1XSX A;  2BYV E;  1VQ7 I;  2EA4 A;  2VB6 A;  1LUJ B;  3S8P A;  3HHG A;  4MEX F;  3JTG A;  1B6A A;  1KGS A;  2OCC H;  2HZT A;  2KJC A;  2W82 A;  1W4M A;  1RIO H;  3JW4 A;  3VDX A;  3JRB A;  3M7G A;  2DA3 A;  4M6V A;  4EJT A;  3QU3 A;  2O8X A;  3TOB A;  5DEQ A;  1QPI A;  1IXR C;  3F8F A;  1XG1 A;  3U21 A;  2I5U A;  3WGG A;  3FM5 A;  2A6E F;  2E7X A;  4F7Z A;  2K9S A;  1FBU A;  4ESF A;  2H6B A;  3JTH A;  1TWC J;  2X1D A;  3DWL E;  1Y1W J;  3FK7 A;  2VQH A;  1J9I A;  2L5Q A;  5K1Y A;  1ON1 A;  1U8R A;  1XDU A;  1FY7 A;  3JRC A;  4E7H A;  4QSH A;  3TW6 A;  2B0L A;  1FJL A;  1FIA A;  2JA7 J;  2AXT C;  1NK2 P;  1Z6R A;  4I99 C;  4DJA A;  3SJM A;  2L7Z A;  1VQK I;  3RI4 A;  1HC8 A;  1OR7 C;  3EUK L;  4XMY A;  1IO2 A;  3CO6 C;  3U1K A;  5BOX A;  2C6Y A;  1S6L A;  1MJ9 A;  4WXH A;  3OYN A;  2VON A;  1YOV B;  4UUS A;  1ZR2 A;  2HOT A;  5HDK A;  3FZV A;  4S05 A;  1SD5 A;  1PJR A;  4XRM A;  3NAU A;  4G9Y A;  3Q0U A;  2XGC A;  3A01 B;  2JPB A;  2EIN H;  4BQO A;  2WBM A;  3EYY A;  5HS7 A;  4D5F A;  3OV8 A;  3OR2 C;  1B9M A;  1K78 B;  2CRG A;  2JA2 A;  1MH3 A;  3GXO A;  2CQX A;  1ETV A;  3VYT B;  4QTR A;  2ZKZ A;  2LTP A;  1YYV A;  1MNE A;  3CDI A;  3W6K B;  2V1U A;  3C3W A;  5JHF A;  3GTM J;  1VQP I;  3X2Q H;  2DT5 A;  3IC7 A;  2R5Y A;  2R7F A;  2ECB A;  2W00 A;  3V8K A;  1IN6 A;  1I27 A;  3QRF F;  4XLP F;  3E3V A;  2RNJ A;  2LKP A;  4CO8 A;  1FOK A;  2R7R A;  2YPR A;  1TW2 A;  3I64 A;  4B8X A;  4G7H F;  3CCE I;  1X1C A;  3W2V A;  3PNV A;  3GTL J;  3TGN A;  4ITV A;  3E7L A;  4GRI A;  3WU1 B;  1ZLK A;  4GO1 A;  4IZZ A;  1GDT A;  2M7A A;  2VJJ A;  4B3A A;  5J1R A;  4K2E A;  2EQR A;  3MMY B;  5K5O A;  1LEA A;  2F5E A;  4ABZ A;  4AVZ A;  1IG7 A;  1S29 A;  3TOA A;  1XMX A;  1SVO A;  2JWT A;  4MGR A;  1MDM B;  5IP7 J;  5HLH A;  2MH9 A;  3OYD A;  2EH3 A;  1FNN A;  3K4J A;  3IH3 A;  2W84 A;  3S2W A;  1K79 A;  1OCR H;  3BR0 A;  1EH6 A;  4XRF A;  3VSK A;  3BR1 A;  2DDA A;  4BU2 A;  3F3X A;  5H6R A;  4Q47 A;  1W36 D;  4O6J A;  3TO9 A;  1SFO J;  4BJ6 C;  5D8K B;  2P7V B;  2M2E A;  3IKV A;  2DFI A;  3DTI A;  1FMV A;  1R1V A;  3PFI A;  2HZD A;  4DYQ A;  3CP8 A;  2DYS H;  2OA4 A;  1CGP A;  3GUD A;  3CCR I;  2R7W A;  1XPX A;  1TWH J;  1IXC A;  3WE2 A;  2KDZ A;  2MC3 A;  2PMZ A;  1B4A A;  1K4T A;  1FSE A;  2LBF B;  4O5V A;  3F8B A;  2XKO A;  5ICF A;  4JOM A;  4X1E A;  2VOD A;  4C30 A;  1FP2 A;  3I5U A;  1OCC H;  3HXL A;  4NQW A;  2WB1 N;  2M0M A;  2W24 A;  4ZDO A;  1FYL A;  2M4G A;  3R61 A;  2IGM A;  2XV4 S;  1K61 A;  4M3E A;  1G3T A;  5HNH A;  3IKT A;  3FWE A;  3PSI A;  1BJA A;  2IA0 A;  2HKX A;  2DA7 A;  5ICC A;  2FQ4 A;  1CF7 A;  4BY7 J;  4IVN A;  2JA8 J;  1Z77 A;  2MAB A;  3I54 A;  2BOL A;  1HA8 A;  2K27 A;  2Z9O A;  1ZGW A;  2Y48 A;  4EJW A;  2KLO A;  3WTU C;  1BBY A;  4YII A;  2W48 A;  3G73 A;  2FXA A;  3OYF A;  1U6G A;  5K5Q A;  3JRD A;  1V5E A;  2LF7 A;  4YIR X;  4A0Y A;  1SFE A;  3SQN A;  4A3F J;  3WTW C;  2YUS A;  1WVR A;  3N97 A;  1D1A A;  2FNP A;  3PM1 A;  3KYL A;  2XAF A;  4WCG A;  3CMY A;  1MD0 A;  1H8A C;  3M9A A;  1U9N A;  3KP7 A;  2EZH A;  2ZCW A;  4HX4 A;  2O61 A;  1OLT A;  4P9F A;  1JJ6 C;  4RM2 A;  1IGN A;  5HVQ C;  1RKT A;  3HRM A;  4GYG A;  1ODD A;  4KIG A;  3OYA A;  3K4C A;  4BXX J;  4P1W A;  1IN5 A;  5CVV A;  1R36 A;  4A93 J;  2GIZ A;  2JT1 A;  3FXO A;  2JVH A;  2MLG A;  3BJ6 A;  3NAR A;  2FBK A;  3PO3 J;  2MW8 A;  3DU6 A;  3F0C A;  1SAX A;  2WAQ N;  2ESH A;  3GBG A;  1XGO A;  3F8C A;  4IL6 C;  2H09 A;  4AWX B;  4ZYG A;  4XR6 A;  2DO7 A;  2R7X A;  4B47 A;  4HV6 A;  2CQK A;  4AYB N;  2HEO A;  2HVS A;  4KN7 X;  4WWC A;  2L4M A;  1BA5 A;  3CCY A;  2XVC A;  3GFL A;  1K83 J;  4DNC A;  3ZN1 A;  3JSP A;  3G6E I;  4RDU A;  4XBF A;  3M4O J;  1FBS A;  1MBK A;  2OTL I;  4JX4 A;  2DXI A;  1JXS A;  1QZE A;  2DMN A;  5KHD A;  4CH7 A;  3WTX C;  1MBG A;  2DK8 A;  1F9N A;  2A5Y B;  5FGM A;  2UWM A;  2E1O A;  2W1O A;  1UG0 A;  5B1A H;  2VKH A;  4J19 A;  4BEH B;  2IW5 A;  3HSE A;  2Z16 A;  1WFX A;  4KNY A;  3ZMS A;  5J4V A;  1V5F A;  2D5V A;  4X0G A;  4PGG A;  3F21 A;  4RGR A;  2OCE A;  3J81 Z;  3F23 A;  1ZYR F;  1OIS A;  4B09 A;  1ZH5 A;  2W25 A;  3H3V K;  3GEZ A;  2VN2 A;  1UJ8 A;  2M5W A;  4NNJ A;  1Z1D A;  3PQK A;  4HA8 A;  2EIJ H;  3BPV A;  1YX3 A;  2LYC A;  2MA3 A;  3FK6 A;  4MIM A;  4XRS A;  3S1R J;  5IYB J;  3TP0 A;  1F43 A;  2BE5 F;  3GFM A;  3J7A Y;  4AYB A;  3W2A A;  1JHH A;  3HOU J;  5E79 C;  3IV5 A;  4IRG A;  1E17 A;  1R7J A;  2XGE A;  2KP6 A;  4KIT B;  1BOB A;  4IJA A;  4Y13 A;  2XF5 A;  1ZN2 A;  2X6Y A;  1I6X A;  1UHS A;  3IP4 B;  4LB5 A;  4XLC A;  4A3B J;  5GP9 A;  3MVP A;  4F55 A;  4CSW A;  4OAZ A;  4ZYE A;  3GTO J;  3VYS B;  3B73 A;  3HM5 A;  3JRI A;  2P7C B;  2MH2 A;  2F5D A;  1WZ2 A;  2KKO A;  4LG0 B;  4B44 A;  4KYW A;  4B1R A;  4E7J A;  4PSW A;  4MQ9 F;  1JUM A;  2Y30 A;  4L5I A;  4DIQ A;  1TBX A;  3K6G A;  4WK8 F;  1WSU A;  3FKJ A;  3J7A O;  2CUE A;  3BCA A;  4E7K A;  4UV8 A;  1ETQ A;  4PCQ A;  2OQR A;  1Y0U A;  4E70 A;  5HOD A;  3QYB A;  3EQL F;  2M3A A;  2DJN A;  3FBN B;  3PUF A;  4W1U A;  4XQF A;  3FDY A;  4OWR B;  4XID A;  1TTY A;  1VQ6 I;  2G9W A;  1ZRE A;  3QYF A;  4ON0 A;  4D7N A;  3C2B A;  3ZQH A;  3KEY A;  2XKP A;  1W7P D;  3HHH A;  4BDZ A;  5B1B H;  1IZ1 A;  4HAM A;  3CCQ I;  3ZP5 A;  3BZK A;  1QHH D;  2MBF A;  2CUJ A;  1R22 A;  3EUH C;  3EUH A;  2DPU A;  3GTQ J;  3SXY A;  1R5H A;  2PFB A;  5K5R A;  4A3G J;  2DOA A;  3HUG B;  3S1M J;  4OIQ F;  3ERM A;  3DV8 A;  3LSK A;  5E18 F;  5LD2 C;  4PJN A;  5J3L A;  4PFP A;  3WU0 A;  2F4M B;  3MFK A;  5B3S H;  4ZTJ A;  2EFQ A;  1V54 H;  3G1M A;  2FMY A;  5ILU A;  2DMQ A;  4Q48 A;  5DUK A;  3E5U A;  4L9J A;  1YTY A;  5TRD A;  1A04 A;  4EVI A;  2LY2 A;  4FE7 A;  5D5W B;  2XAJ A;  3ZOB A;  3BY6 A;  3OSF A;  4NUB A;  3HOX J;  3LL7 A;  5AON A;  1P4A A;  3M8J A;  2EFP A;  2W4S A;  1NK3 P;  3OYH A;  1YQA A;  2HYG D;  1WI9 A;  5TGT A;  3OIP A;  3GTP J;  2XAU A;  1QHG A;  2N8G A;  5F1J A;  1A6Q A;  2KZG A;  1ZAO A;  3BTC A;  1YW9 A;  2MGQ A;  2XAQ A;  5J4Y A;  2DA1 A;  2HQR A;  4CCK A;  4P9U A;  5HLG A;  4BE1 A;  2JA6 J;  2OBP A;  1D8J A;  1FOY A;  1E3H A;  1WJB A;  2K3P A;  3LSI A;  4WXC A;  4KUM A;  3OYC A;  5AIQ A;  2JRT A;  4LK0 F;  4LIV A;  4HST A;  2L02 A;  2X4H A;  1OCT C;  1ZRF A;  1T6S A;  2CUF A;  4L0Y B;  3G4S I;  2A3S A;  1L3L A;  3CLO A;  1V5G A;  2KZV A;  4KFC A;  3WTY C;  1Q1H A;  3L1P A;  2ID6 A;  1REP C;  2MYS A;  2X0L A;  2Y0S A;  5IT9 K;  5J8F A;  3ZR8 X;  3C1D A;  2PJR B;  3GVA A;  1YIO A;  1DGW Y;  1X58 A;  2A6H F;  4BAY A;  1VQ4 I;  1J7K A;  3HSR A;  1NTC A;  2ME0 A;  1YLF A;  3IRQ A;  2HI3 A;  4Q4Z F;  5J47 A;  5ILV A;  2XRO A;  4GDF A;  3ZCO A;  3MKY B;  1ETX A;  4YRV A;  2VT2 A;  2DDB A;  5DM6 F;  5LLQ A;  2RDP A;  1GV5 A;  2PMZ N;  3ZN0 A;  2Z3Y A;  1O57 A;  2ECC A;  1IV6 A;  3BTJ A;  2VE9 A;  3GTG J;  4RAG A;  5KAF C;  1RPW A;  4IHX A;  4D7M A;  3AKZ A;  1IJW C;  2LK2 A;  4LLL A;  3ZGK A;  2NAZ A;  1IN7 A;  2BY3 A;  2VQL A;  1Y0N A;  2LP0 A;  3WG7 H;  2UXN A;  2ZJP F;  3RPU D;  5DDG A;  3ELK A;  2BBY A;  1HKS A;  2PMU A;  4UY8 I;  3ISP A;  4ZC3 A;  2QKM B;  2VIX A;  2VT3 A;  4II2 A;  5F1R A;  1X1D A;  1U3E M;  2GIV A;  5F0H A;  4HLX A;  4EGZ A;  2MD5 A;  1KQ8 A;  3F8M A;  1JHF A;  1RR8 C;  3SZT A;  3TQN A;  3ZQL A;  1W7P B;  1RUO A;  3WE3 A;  2LLK A;  3Q0W A;  3S3M A;  3K1P A;  5IY5 H;  5FLX K;  2CFO A;  2IPQ X;  3HC7 A;  1VQ9 I;  1DU6 A;  1UZC A;  1YE9 A;  4BH9 A;  2QZ8 A;  3G71 I;  3FBI B;  5GAH J;  3AG3 H;  2WAE A;  4M9Z A;  2YU3 A;  4BL0 B;  1MDM A;  1LDD A;  2OTJ I;  2LKS A;  4UXN A;  3D5L A;  3KET A;  3F6O A;  1OCP A;  2WWY A;  4OIP F;  5FRM A;  1VI0 A;  2YX4 A;  3L2C A;  5L3C A;  2E2I J;  3L2R A;  3H9G A;  1RKW A;  2ZFU A;  1FMW A;  1QRY A;  4MEY F;  3F72 A;  2NNY A;  1B72 B;  4PK4 A;  4UUT A;  4ZYH A;  2Q8K A;  1YJ9 I;  2LR8 A;  2BXY A;  1YW7 A;  1SD7 A;  2XRN A;  2VBZ A;  3RKQ A;  1TW3 A;  2GLO A;  1SC7 A;  3CUQ A;  1FSH A;  4KT5 C;  1R23 A;  2LC2 A;  4I2O A;  3OMY A;  4I0A A;  3ZMU A;  3ZQI A;  2OJE D;  2L2O A;  5HNF A;  1I3A A;  5LGN A;  1QGP A;  1K78 A;  1XTA A;  3GO5 A;  4A0X A;  5HS8 A;  2GZW A;  1B1B A;  2MG4 A;  2E36 A;  3E6C C;  3G1O A;  5F64 A;  4C2T A;  3A2K A;  5B5E C;  1DPU A;  4L9V A;  2HXI A;  4RLF A;  4KIC A;  5H2F C;  1WJF A;  5J6X A;  1JGS A;  3CDH A;  3OS1 A;  3K4L A;  2HQA A;  4BJT A;  4C2U A;  1DU0 A;  1B9N A;  2V79 A;  4MQV A;  2KQR A;  2UZK A;  3HZJ A;  1PUF B;  1G59 A;  2IT0 A;  1ETO A;  3MZH A;  1LKX A;  4A6D A;  4PZJ A;  2VPR A;  2W85 A;  3LWF A;  4HV5 A;  3H0D A;  1HBX G;  1E3O C;  4RGU A;  4JQF A;  3I53 A;  4W97 A;  4A3L J;  1ZKG A;  3L09 A;  2CYY A;  2E71 A;  1D5V A;  3LSG A;  1MMD A;  1GT0 C;  4HX7 A;  1G3Y A;  1KZH A;  3IRR A;  2QEN A;  2XF7 A;  1XGN A;  4OOI A;  1JKQ C;  2Q2E B;  4M71 A;  3AG1 H;  3ZMD A;  3GTK J;  3BCB A;  1WJE A;  1A35 A;  4KIS A;  1BC8 C;  5H6Q A;  3ZQQ A;  2PI0 A;  2WTE A;  3M07 A;  2DFE A;  3OOU A;  2Z33 A;  2ME6 A;  1KU3 A;  2HGC A;  3TW7 A;  4AU7 A;  4HF0 A;  2IEK A;  2OD5 A;  5JLX A;  1KU7 A;  3B6A A;  1I6H J;  1W7P A;  1EV7 A;  3HL2 A;  3FXU A;  1J5Y A;  2R5Z A;  1TL8 A;  4HNU A;  1YI2 I;  4L9N A;  1MJA A;  3JSO A;  4A69 C;  2R5Y B;  4E7S A;  1LNW A;  4CUG A;  1JKO C;  2COB A;  4AIH A;  1OR7 A;  2NOG A;  5D4R A;  2ID3 A;  2ZJQ F;  2LBF A;  2M4K A;  2Y31 A;  3OS2 A;  3PNT A;  1XN7 A;  2JPC A;  4WXD A;  1TWA J;  2HDW A;  5L3G A;  2P6T A;  2HKO A;  5FLM J;  1Y39 A;  2ZME B;  5J40 A;  3M8E A;  2KPM A;  4NQW B;  5BPD A;  2ZSH B;  3H3U A;  4KMU X;  3S3N A;  3DKX A;  3SEQ A;  1B72 A;  2E7W A;  4M3B A;  3PJR A;  5EG0 A;  4KN4 X;  1TT5 B;  3WGI A;  2W7N A;  3RPU A;  2HNH A;  2DQL A;  4C9Y A;  1EJ9 A;  4F93 B;  4G7O F;  2I10 A;  1FYK A;  5M5X J;  2BV6 A;  2FJ1 A;  1P6R A;  3MCZ A;  3KEO A;  3DKW A;  3R6S A;  4HF2 A;  3LA7 A;  4YFN F;  1G4D A;  1X2M A;  4FHT A;  4KIF A;  1K7A A;  2QKL B;  2GAU A;  4BUP A;  2ZSI B;  4UB8 C;  2EPF A;  2CUZ A;  1ZGA A;  3OYE A;  1UG2 A;  3C7J A;  5IYD J;  1SEU A;  1W0U A;  4HQE A;  5F27 A;  4A3E J;  2K86 A;  4BHP A;  4G6Q A;  3TKY A;  3RKX A;  1D3Y A;  4HLY A;  4XK4 A;  1KON A;  2P4W A;  1QBJ A;  2JZY A;  2DK5 A;  1KYW A;  4OIN F;  3GTJ J;  1O3S A;  5EG0 B;  4BBS J;  4LIT A;  3DU5 A;  4IQ4 A;  1PUE E;  4P96 A;  5D6F A;  1Y8R B;  4CGZ A;  2ADU A;  2LY1 A;  3ASO H;  5L3D A;  3LSJ A;  4CYD A;  2WY8 Q;  4ZZL A;  1JKP C;  1MBH A;  5TIS C;  1S8N A;  3ROU A;  2YR2 A;  4PJM A;  1O3R A;  4FE4 A;  1MH4 A;  3PQJ A;  3BR3 A;  4TV7 A;  2M8E A;  1TWG J;  3K4B A;  4S0H B;  5CYV A;  3V42 A;  3ABU A;  1SFU A;  1BC7 C;  5FKM A;  3S1N J;  4HSR A;  3U2R A;  2GQQ A;  1R4N B;  1WH7 A;  1V3F A;  1T8I A;  1CF7 B;  4KJZ A;  4RLQ A;  4RAF A;  2XSD C;  2VJI A;  2E2H J;  3K1N A;  5CVI A;  3CCV I;  3B6C A;  1ZG1 A;  2HQ5 A;  2QQ9 A;  1N77 A;  3SFI A;  1ZGJ A;  1P92 A;  4XLN F;  3CJQ B;  1W5C C;  1WJA A;  2ZXJ A;  1Z3X A;  3T5X A;  4A12 A;  2Y2Z A;  3H9J A;  3KYC B;  4V19 K;  1BOA A;  1SVM A;  5JFR A;  2PG4 A;  4DOZ A;  4DBR A;  2R92 J;  1J09 A;  4CCJ A;  3FF5 A;  4ENJ A;  2CJJ A;  2QQB A;  1MMN A;  3PSF A;  4Z6Y A;  3KP6 A;  1S3J A;  5AIP A;  5JHU A;  3ML6 A;  4FCY A;  5B66 C;  4UVB A;  3J80 K;  1ZK8 A;  1UCR A;  3KX2 A;  4M73 A;  3I55 I;  3S93 A;  2FRH A;  3KEQ A;  3PO2 J;  3FM3 A;  4NB5 A;  4ZZD A;  1MKM A;  1G6N A;  5FD6 A;  4ASN A;  2P6S A;  2FQ3 A;  1BW6 A;  3BTI A;  1JT0 A;  2O0Y A;  2EK5 A;  3CMM A;  3G3Z A;  2IGN A;  1RET A;  3GFJ A;  2GA2 A;  1FT9 A;  1PP7 U;  3RSN A;  1TLH B;  2QWW A;  5J8C A;  2XGD A;  3RTR A;  3CZ6 A;  3NRV A;  4AID A;  3QOP A;  4JX6 A;  3IWF A;  3KPH A;  4M9X A;  5LGT A;  1ERD A;  2EIK H;  2L01 A;  3AL0 C;  2KRC A;  3V7R A;  2OV7 A;  4IEJ A;  3FIS A;  3W6V A;  3M1E A;  3KIO A;  2O7O A;  2X48 A;  4EMS A;  1I50 J;  1F4K A;  3E0J B;  1WGX A;  1U5T B;  4L0Z B;  2B7E A;  3CCL I;  3KLO A;  3J80 Z;  3HUG A;  2R93 J;  3RKY A;  5LRR A;  3WHB A;  2XDV A;  2RKH A;  2RVC A;  3E5X A;  3I3L A;  4B4C A;  3AAF A;  3K4K A;  3ABK H;  1I5Z A;  1F5T A;  2HTJ A;  2DAO A;  3DTK A;  2XHK A;  1W1W E;  1IDY A;  2V1D A;  1BIB A;  2FE3 A;  3BDD A;  5D5V B;  5E1Z B;  4M9S A;  4BJ5 C;  4IRI A;  5KNL A;  2XAH A;  2VAS A;  1QU3 A;  2EZL A;  4GYI A;  4UVA A;  4Y15 A;  5C44 J;  3L2W A;  2HDD A;  1Z21 A;  1IN8 A;  1WJ5 A;  2Y0S N;  3BR6 A;  3S2D J;  1WKM A;  4UB6 C;  3BG6 A;  1XS9 A;  3FIW A;  4A6E A;  3DFG A;  3OS0 A;  4CYC B;  2L4A A;  2DW4 A;  3VYR B;  1D0X A;  1QVT A;  4LMY A;  4KT6 A;  2QQA A;  1S7O A;  2R7U A;  4ANJ A;  2ZXH A;  4M3D A;  5E20 A;  2AS5 F;  3LSP A;  1FBQ A;  1XGM A;  1ZAR A;  3E6B A;  2O8K A;  4HF1 A;  1T0F C;  2X6X A;  1U0J A;  5EEH A;  4Y52 J;  4BQQ A;  1DP7 P;  2HTS A;  5KK1 A;  1HKT A;  1O7F A;  2COM A;  3MAJ A;  1J75 A;  3JAM K;  4A3D J;  3HIF A;  3KZZ A;  3LQQ A;  4BKX A;  4BBR J;  5M5Y J;  4PJL A;  1LJ9 A;  1NG7 A;  2VKE A;  4XOT A;  4GFB A;  4L9T A;  1MGT A;  1WWX A;  4A0Z A;  3Q9V A;  2IGK A;  4M6Y A;  3H5N A;  2CV0 A;  2CW0 F;  2VI6 A;  2TRT A;  2WAD A;  2GBY A;  3CC7 I;  4IF4 A;  4IPA A;  5CJ9 A;  2P5L C;  1KYZ A;  3WU2 C;  4RM3 A;  5E3M A;  3C18 A;  2MLK A;  4U0Y A;  2KT0 A;  4IHT A;  2VJ4 A;  1AKH B;  2G7H A;  1PUF A;  4EJU A;  3NQO A;  4HOB A;  4U87 A;  1NH3 A;  2STW A;  3I9V 2;  4BQA A;  3BR5 A;  5IOY A;  2EJR A;  3KE2 A;  2VOO A;  2IP2 A;  1ZG3 A;  1K6Y A;  3CJR B;  4F3Q A;  1LB2 A;  4PUS A;  3EDP A;  4WX9 A;  1R00 A;  1A6I A;  1JUS A;  5LHI A;  2WAF A;  2M30 A;  4L5E A;  3WOD F;  9ANT A;  2HYF A;  3TP3 A;  2QBY A;  2EIM H;  1X1P A;  2NS8 A;  1UHW A;  2CQQ A;  1WJC A;  2DFH A;  1R58 A;  3PUB A;  1YRN B;  4MFD A;  2HWV A;  3W2W A;  2QYO A;  3BWG A;  4I0B A;  3A0H C;  3N4M A;  2RQQ A;  4I09 A;  2V6E A;  3BT9 A;  2GXG A;  1NHA A;  5ILS A;  1WRJ A;  3K7A J;  4MTD A;  1HCR A;  4OIO F;  2M87 A;  4ENK A;  2G0E A;  2IAI A;  3B02 A;  4A3C J;  5JR3 A;  5E3O A;  2DBB A;  2DI3 A;  4U88 A;  4U7B A;  4N9H A;  5IOZ A;  2ZB9 A;  4P55 A;  4PFO A;  2LF8 A;  4B43 A;  1Z91 A;  1ITY A;  2CS3 A;  3OR1 C;  2EFN A;  1K4S A;  2L0K A;  3HPG A;  5GTI C;  1EH7 A;  1H89 C;  1MMA A;  3WG9 A;  2ZO4 A;  5J1U A;  3QAH A;  3TBI A;  3DXJ F;  5GAG J;  3HB9 A;  1XDS A;  2E19 A;  1D5Y A;  4UUS B;  4G8X A;  4RAY A;  2DA6 A;  3DP7 A;  1FOW A;  3GZ5 A;  3HPH A;  2MC4 A;  2OC6 A;  3E5Q A;  2F2E A;  2K9M A;  5GAE J;  2J5P A;  4F52 A;  1U9O A;  4HNV A;  4E4H A;  2NVU B;  1P4W A;  4H0E A;  4QIW N;  4BHB A;  2X6W A;  2JN6 A;  5E8G A;  4E6K G;  1SD6 A;  1D8K A;  3NWT A;  1LPQ A;  1WJD A;  4XIC A;  5D8L B;  2KIM A;  5FRO A;  2CQ7 A;  4CCN A;  2Y9Z A;  1YG2 A;  2BW3 B;  1YO5 C;  4XL9 A;  1PDN C;  4A3M J;  4JX5 A;  3K70 C;  1MND A;  2B63 J;  4U7D A;  2ICW G;  3WTZ A;  3H36 A;  3HRT A;  5BNG A;  2EA2 A;  1F1Z A;  2P0W A;  4ENM A;  2JTV A;  3LSM A;  3FXJ A;  2VE8 A;  4D0P A;  1VQ8 I;  4IO9 F;  1T39 A;  4FAS D;  4LG0 A;  5FKN A;  1GVJ A;  3BJA A;  1ENH A;  2TDX A;  3QP6 A;  1IF1 A;  3FXQ A;  2LOO A;  2R7T A;  3OL4 A;  2QSF X;  2OZ6 A;  3VWB A;  1HLV A;  3QWL A;  1DQU A;  3F6V A;  1MZB A;  2Y9Y A;  3D0S A;  1RES A;  4D9J A;  5HOO A;  2DJI A;  3T8T A;  3OL3 A;  4C2M J;  5GTH C;  2DTZ A;  2MSY A;  1KA8 A;  2R5Z B;  2QSH X;  2X51 A;  5LHH A;  1SFK A;  4H4K C;  1A36 A;  2RRE A;  4FT8 A;  4AIK A;  3DBR B;  3Q5F A;  4G12 A;  3HOV J;  3K4N A;  3BQY A;  3T0Y A;  2CG4 A;  4AD9 A;  3JRG A;  2PQ8 A;  3V4G A;  2O6G E;  3CC2 I;  3S1Q J;  4P5O A;  1IN4 A;  2R0Q C;  1DUX C;  3L2V A;  4LJZ F;  2KFD A;  3CME I;  3HOZ J;  1BM9 A;  2NRA C;  2F4O B;  2Z2S B;  4XM3 A;  3BQZ A;  2K4B A;  1U5T A;  3RCO A;  3KCC A;  5D4S A;  2FD5 A;  1PYV A;  4D5C A;  2FOW A;  1HXD A;  4UVC A;  2P81 A;  2XUB A;  3FXR A;  1KU9 A;  1V55 H;  1QQI A;  2E34 A;  4GCV A;  5CQG A;  2LKX A;  3ZPL A;  1YS7 A;  2XPU A;  2R7Z J;  1IRF A;  4BE2 A;  1HW5 A;  1LDJ A;  5H20 A;  1R6R A;  3BJO A;  2QM3 A;  3SDG A;  3BLY A;  5FKL A;  1TZL A;  4XLH A;  3FXM A;  2BEO A;  4I98 B;  1GVD A;  2CMP A;  1J2X A;  1Z3Y A;  4CHU A;  2EV0 A;  3HGY A;  1ONV A;  1DDN A;  3P9C A;  4U0V A;  4YG2 F;  4MNU A;  4IOA F;  2OUM A;  3GLX A;  5EGO A;  1JE8 A;  3I59 A;  1UST A;  3MEX A;  2CSO A;  2XRL A;  3A4C A;  1XMA A;  2RAE A;  5FKK A;  2IA2 A;  3H92 A;  5D6E A;  4C3I J;  4E7L A;  3MN2 A;  2Z5U A;  5CVU A;  1BW5 A;  3LOC A;  3QP5 A;  4PDK A;  2IS4 A;  3GW2 A;  4DW6 A;  3HYI A;  1YRN A;  5LRS A;  4DZP A;  1O3Q A;  4L5J A;  4BQN A;  1LDK B;  1SAU A;  1BR4 A;  2FSW A;  2O3F A;  2JSC A;  3RYP A;  1CQT A;  1N78 A;  3GWZ A;  3VFZ A;  2A68 F;  2A07 F;  2Z1D A;  5FD5 A;  1UMQ A;  2G7U A;  2DQR A;  2ZJR F;  3WTS C;  1IUY A;  2ZXI A;  5CPR B;  3MKW B;  2WY7 Q;  4EGY A;  1SAN A;  2GXB A;  5JVG F;  1RI7 A;  2V1X A;  1I3Q J;  3DEE A;  2ZNZ A;  4B3X A;  3OYG A;  4OIR F; 
#chains in the Genus database with same CATH homology
 2L7F P;  2DA7 A;  1B72 A;  4M3B A;  2FQ4 A;  2XB0 X;  4BY7 J;  5EG0 A;  2JA8 J;  1A5J A;  1MBE A;  1Z77 A;  2X6O A;  2I10 A;  3M3Y J;  5M5X J;  5EZH A;  3S15 J;  1ZGW A;  3OSG A;  2FJ1 A;  1B8I B;  1X2M A;  1S7E A;  4MFE A;  1WH5 A;  1IRZ A;  2W48 A;  2JK3 A;  2NS7 A;  2NVY J;  2IBD A;  3WHC A;  3JRD A;  3I4M J;  1LE8 A;  1UG2 A;  5IYD J;  1W0U A;  3S16 J;  5F27 A;  2XB5 A;  4A3E J;  1ETK A;  1MBJ A;  1JTY A;  1WCM J;  4A3F J;  2YUS A;  3PM1 A;  3DEW A;  4XK4 A;  3CMY A;  1ORK A;  1H8A C;  3GTJ J;  1U9N A;  5EG0 B;  2EZH A;  4BBS J;  5EDN A;  2DMT A;  2FX0 A;  3JR9 A;  4DYR A;  1AKH A;  1JJ6 C;  1AU7 A;  1IGN A;  2HOS A;  1T33 A;  3A03 A;  1JKP C;  3LSJ A;  1RKT A;  4CYC A;  5IP9 J;  1MBH A;  4BXX J;  4FE4 A;  1MH4 A;  3BR3 A;  4A93 J;  1TWG J;  3NAR A;  4S0H B;  3PO3 J;  3S1N J;  2MW8 A;  3A02 A;  5FKM A;  3F0C A;  2WAQ N;  1H88 C;  3GBG A;  3I4N J;  1WH7 A;  5DTD A;  2GM4 A;  2XSD C;  4AYB N;  1Q1V A;  2E2H J;  4AC0 A;  2OF7 A;  1BA5 A;  3B6C A;  3CCY A;  2HQ5 A;  1U78 A;  5FLV A;  3SFI A;  1K83 J;  3LSR A;  4RDU A;  3VPR A;  3M4O J;  1MBK A;  4JX4 A;  1AHD P;  2M0C A;  2Y2Z A;  4C3J J;  5EF6 A;  3IH2 A;  4DZJ A;  2DMN A;  4JP0 A;  1POG A;  4AUX A;  1T56 A;  1MBG A;  1JT6 A;  2LFB A;  4FIS A;  2R92 J;  2E1O A;  5EYR A;  2VKV A;  2CJJ A;  3QQA A;  3S2H J;  1X2N A;  5GPA A;  5F04 A;  4RBO A;  3A01 A;  4J19 A;  4FCY A;  4A3K J;  1ZK8 A;  5EEA A;  4NDL A;  2H1K A;  2JA5 J;  2D5V A;  1Y1V J;  2EZI A;  3PO2 J;  5C4J J;  3G1L A;  3UKG A;  3H3V K;  2K40 A;  1BW6 A;  3BTI A;  4MO7 A;  1JT0 A;  5EZG A;  1RR7 A;  1RET A;  3FK6 A;  2WV1 A;  4MIM A;  4XRS A;  3S1R J;  5IYB J;  3TP0 A;  1F43 A;  2HOA A;  2XGD A;  5E3N A;  5M5W J;  1U8B A;  3TED A;  4JX6 A;  3HDD A;  3HOU J;  5C3E J;  3IV5 A;  4IEJ A;  3FIS A;  3W6V A;  2XGE A;  3RQI A;  2QF7 A;  5IYC J;  1OFC X;  2O7O A;  2X48 A;  1JUP A;  1I50 J;  1WGX A;  1HOM A;  1ZTR A;  2R93 J;  4I6Z A;  1UHS A;  4A3B J;  2NVQ J;  5GP9 A;  3WHB A;  3MVP A;  5DS9 A;  2K9N A;  1ZQ3 P;  2L9R A;  3GTO J;  3HM5 A;  5IP6 A;  3JRI A;  4A3J J;  3BG5 A;  5K7F A;  2DMU A;  3IH4 A;  4B4C A;  4B1R A;  3BG9 A;  1JUM A;  1BJZ A;  2Y30 A;  2TCT A;  1GUU A;  4IHW A;  1QVU A;  2CUE A;  2DA2 A;  1IDY A;  1ETQ A;  3OIO A;  4MLO A;  5HOD A;  2DJN A;  4W1U A;  2DN0 A;  2EZL A;  4M3G A;  4XID A;  3JRH A;  4XRS G;  3S17 J;  2EBI A;  3Q0V A;  1IUF A;  5C44 J;  4D7N A;  3C2B A;  3ZQH A;  2HDD A;  2Y0S N;  3BR6 A;  3BTL A;  3S2D J;  1P7J A;  1XS9 A;  3FIW A;  2LY9 A;  1O4X A;  5C4X J;  3O8H A;  1MBF A;  4CYC B;  5JLW A;  3GTQ J;  4IHY A;  4A3G J;  1QVT A;  5IPA A;  3S1M J;  5J3L A;  3MKL A;  1HF0 A;  4I76 A;  2CU7 A;  4M3D A;  3BR2 A;  3G1M A;  2DMQ A;  3LSP A;  5FJ8 J;  2O8K A;  1LFU P;  4FE7 A;  4Y52 J;  3ZQG A;  3ZOB A;  3OSF A;  3HOX J;  4A3D J;  3QPL A;  1F36 A;  4BKX A;  4BBR J;  5M5Y J;  5M3M J;  1NK3 P;  1TWF J;  1ZR4 A;  1IDZ A;  2VKE A;  4GFB A;  3GTP J;  1GV2 A;  3DCF A;  2N8G A;  5F1J A;  5M3F J;  3RZO J;  3BTC A;  5K7Z A;  2MGQ A;  3S14 J;  2O9L A;  2DA1 A;  1IC8 A;  2VI6 A;  2AHQ A;  2TRT A;  3ZQC A;  2GBY A;  2JA6 J;  2JMW A;  1W0T A;  2E2J J;  2LD5 A;  1VND A;  3HEF A;  5E3M A;  3HBL A;  4DYC A;  1Z0X A;  2KT0 A;  1AKH B;  1PUF A;  1OCT C;  2CUF A;  3BR5 A;  5J1Y A;  5IOY A;  3HOY J;  5EGO B;  5FKO A;  3L1P A;  1XC5 A;  2ID6 A;  3HKZ N;  1WI3 A;  1A6I A;  1JUS A;  1P7I A;  1HDP A;  2HYJ A;  4L5E A;  4V2F A;  5E3L A;  3JRF A;  9ANT A;  3TP3 A;  1X58 A;  1WPK A;  1R9T J;  1APL C;  2XPW A;  1MSF C;  2NS8 A;  1TC3 C;  2M34 A;  1NTC A;  2CQQ A;  2ME0 A;  2HI3 A;  1YRN B;  2X9D A;  4MFD A;  4BY1 J;  4V2G A;  1ETX A;  1B8I A;  4M3F A;  2DA4 A;  1LFB A;  3BT9 A;  4JYK A;  1GV5 A;  2PMZ N;  3ZQF A;  2NVX J;  3K7A J;  3HGG A;  2ECC A;  1IV6 A;  3BTJ A;  1HCR A;  3GTG J;  1RPW A;  4IHX A;  2G0E A;  2IAI A;  4D7M A;  1IJW C;  2LK2 A;  4A3C J;  3JRA A;  5E3O A;  3HOW J;  5IOZ A;  2ZB9 A;  2LP0 A;  3CQZ J;  1ITY A;  2L0K A;  3JRB A;  2K9Q A;  1H89 C;  2DA3 A;  4M6V A;  5F0H A;  2H8R A;  5J1U A;  1QPI A;  2M8G X;  1OJL A;  3HB9 A;  3ZQL A;  1XG1 A;  2E19 A;  1D5Y A;  4UUS B;  5F08 A;  2LLK A;  3Q0W A;  2DA6 A;  1JTX A;  2K9S A;  3O8G A;  1JGG A;  2VUM J;  1TWC J;  1DU6 A;  1Y1W J;  1U9O A;  3FK7 A;  4HNV A;  1JJ8 C;  4LOC A;  1HDD C;  4QIW N;  2JN6 A;  4A3I J;  2L7M P;  3JRC A;  4QSH A;  3TW6 A;  4XIC A;  1FJL A;  2OPT A;  1OCP A;  1FIA A;  2JA7 J;  3FKI J;  2Y9Z A;  1NK2 P;  3SJM A;  1VI0 A;  1MNM C;  2L7Z A;  4A3M J;  4JX5 A;  2E2I J;  2B63 J;  1RKW A;  2DMP A;  1QRY A;  5BNG A;  1ETW A;  1B72 B;  4UUS A;  4UUT A;  1ZR2 A;  2HOT A;  2LR8 A;  2LVS A;  3RZD J;  4XRM A;  3NAU A;  3RKQ A;  2GLO A;  5FKN A;  3Q0U A;  1ENH A;  2XGC A;  3A01 B;  4D5F A;  3ZQI A;  4C3H J;  1HLV A;  2CRG A;  1BL0 A;  5F0F A;  1MH3 A;  2Y9Y A;  1RES A;  2CQX A;  1ETV A;  4QTR A;  4C2M J;  2YU9 J;  2MG4 A;  2LTP A;  1FTZ A;  3G1O A;  2DTZ A;  2MSY A;  2R5Z B;  2JJ7 A;  3D1N I;  3GTM J;  2HXI A;  2R5Y A;  4EEF G;  2ECB A;  2XPV A;  4G12 A;  3HOV J;  1DU0 A;  3BQY A;  3JRG A;  2HXO A;  4X6A J;  3S1Q J;  3CDL A;  2R0Q C;  1PUF B;  1ETO A;  3GTL J;  3HOZ J;  3E7L A;  1JKR C;  3BQZ A;  2QCO A;  2VPR A;  1VF9 A;  1GDT A;  4B3A A;  5J1R A;  2FD5 A;  1E3O C;  4D5C A;  2EQR A;  2P81 A;  1FIP A;  2DA5 A;  4W97 A;  4ABZ A;  4A3L J;  1ZKG A;  1IG7 A;  3LSG A;  2R7Z J;  2LKX A;  1GT0 C;  2JWT A;  2XPU A;  2M9H A;  2YS9 A;  5IP7 J;  3K2A A;  2EH3 A;  3SDG A;  1JKQ C;  5FKL A;  3IH3 A;  3GTK J;  3BR0 A;  3QPS A;  1GVD A;  2NVT J;  3JRE A;  1FTT A;  3BR1 A;  1MSE C;  5K7H A;  3OOU A;  5GPC A;  2ME6 A;  3HGY A;  3TW7 A;  1SFO J;  2ELK A;  2M2E A;  2IEK A;  3BG3 A;  5JLX A;  5EGO A;  3B6A A;  1I6H J;  2R5Z A;  4DYQ A;  4FTH A;  2XRL A;  2RAE A;  5FKK A;  2AO9 A;  1TWH J;  4C3I J;  4A69 C;  1ETY A;  2R5Y B;  3MN2 A;  2KDZ A;  3LNQ A;  1BW5 A;  1JKO C;  2EZK A;  3LOC A;  3H0G J;  3Q3S A;  2COB A;  4DW6 A;  5F0C A;  1YRN A;  2NOG A;  4IHV A;  4DZP A;  2ID3 A;  2Y31 A;  4X1E A;  1EF4 A;  1G2H A;  1FEX A;  1CQT A;  1TWA J;  5FLM J;  1LE8 B;  2WB1 N;  1UMQ A;  1VFC A;  1SAN A;  1K61 A;  1I3Q J;  4M3E A;  4Y7N J; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...