1F43A

Solution structure of the mata1 homeodomain
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
61
structure length
61
Chain Sequence
KKEKSPKGKSSISPQARAFLEQVFRRKQSLNSKEKEEVAKKCGITPLQVRVWFINKRMRSK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transcription
molecule keywords MATING-TYPE PROTEIN A-1
publication title Cooperative ordering in homeodomain-DNA recognition: solution structure and dynamics of the MATa1 homeodomain.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
total genus 14
structure length 61
sequence length 61
ec nomenclature
pdb deposition date 2000-06-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00046 Homeodomain Homeodomain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.60 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Homeodomain-like 1f43A00
1HDPA 3PM1A 1H88C 1TWCJ 1GV2A 1QRYA 2CQQA 1AKHB 2O7OA 5DTDA 4M3BA 5IYCJ 3GTMJ 1F36A 2G0EA 2TRTA 3LSJA 2MW8A 1ETQA 5FKOA 2AO9A 3A01A 2R5ZA 1JUMA 3HKZN 2CUFA 4A93J 4JX6A 3HBLA 4MIMA 3HGYA 2ECCA 2LP0A 4QSHA 3S1RJ 2LVSA 2FX0A 1BW5A 1JT0A 1I50J 3LNQA 2LFBA 2QCOA 2NVQJ 1WH5A 2DA6A 1MBEA 2GBYA 5J1UA 1B8IB 3LOCA 2XGDA 1QVUA 2DA3A 3IH2A 1NK3P 4IHYA 4M3FA 1OCPA 2X6OA 5FKNA 1BW6A 3BG3A 4G12A 5IP9J 2ECBA 2VKVA 2DMNA 1IV6A 3GTOJ 2XGEA 2HOSA 1QVTA 1NTCA 2DA5A 2NOGA 2L7ZA 3S17J 4I6ZA 4V2GA 3G1MA 3BR5A 2LTPA 3A02A 2IAIA 4D5FA 1U78A 3WHCA 5EG0B 2LY9A 1MBJA 3D1NI 2LLKA 2XPVA 4XICA 2Y0SN 1ETWA 2RAEA 2EQRA 2Y2ZA 4XIDA 3GTQJ 5DS9A 2HXOA 1K61A 4A3DJ 3FIWA 4D7NA 2R5YB 2NVXJ 3S16J 2FQ4A 1OFCX 3S1MJ 3JRGA 4X1EA 1RKTA 2M2EA 4C3JJ 3HB9A 3FK7A 4ABZA 2YU9J 4M3DA 5HODA 2XSDC 1Y1VJ 3HOUJ 1TWFJ 5EZHA 1JUPA 1Z77A 1SANA 5EYRA 4EEFG 5EF6A 1ZGWA 2HOTA 4A3KJ 4XRMA 1ENHA 3ZQFA 3OIOA 1W0TA 1PUFA 1G2HA 2OF7A 1H89C 3I4NJ 1TWAJ 1FEXA 4JX4A 4XRSA 3O8HA 5F0CA 4FCYA 5J1YA 3HDDA 1ORKA 3H3VK 1E3OC 2VI6A 2R92J 5BNGA 5F0FA 1ZTRA 3S14J 1JTXA 4AUXA 5JLWA 5C44J 1HF0A 2WB1N 1I6HJ 2K9NA 3F0CA 2E19A 5GP9A 1ITYA 4M3GA 3JREA 3JRIA 4QIWN 2H1KA 1JT6A 3ZQHA 2L0KA 2M34A 3IV5A 4B1RA 4MLOA 3TW6A 2Y9ZA 1JTYA 3RQIA 2XRLA 4MFEA 4C3HJ 4DZPA 2LK2A 4C2MJ 3TEDA 4A3IJ 5IYDJ 2OPTA 5M3FJ 1XS9A 4NDLA 1ZR4A 2JK3A 1IJWC 2JA5J 3C2BA 1RKWA 5IP6A 2E1OA 3LSRA 2TCTA 3DCFA 3OSFA 4BBRJ 1WH7A 1GV5A 1GUUA 3RZOJ 5F27A 1LFBA 2KDZA 3CDLA 2H8RA 2MSYA 2EZLA 2YUSA 4AC0A 4CYCA 2HXIA 3WHBA 2JJ7A 1VFCA 1SFOJ 2CU7A 4BY1J 1ETKA 3OSGA 2COBA 4X6AJ 1ETXA 1YRNB 2B63J 4B3AA 1MNMC 3JRAA 4LOCA 3PO2J 2JA7J 5EGOA 1D5YA 1WI3A 3HOZJ 2Y30A 3PO3J 1B72A 1BL0A 2XB5A 3K2AA 1ETVA 4B4CA 1WPKA 5IP7J 4IHXA 4Y7NJ 2DMQA 1VNDA 4FE4A 4XK4A 1JJ8C 3RKQA 3JRCA 3IH3A 1H8AC 5C4JJ 1X2MA 1Z0XA 5GPCA 3FK6A 1JKPC 3BQZA 2E2IJ 4GFBA 3HEFA 4BBSJ 3BQYA 3TP3A 4FE7A 4UUSA 3JRDA 1VI0A 3A01B 2R5ZB 3HOVJ 2YS9A 3QPLA 4DYRA 2XPWA 5J3LA 4BKXA 1IUFA 1F43A 3NARA 3SFIA 2DMPA 1EF4A 3HGGA 1BJZA 2ID6A 3TP0A 3CMYA 2X48A 2O8KA 2K9QA 1ZR2A 3GTPJ 5JLXA 5M3MJ 1JKRC 4A3CJ 3CCYA 3BR3A 3JRFA 3B6CA 4A3FJ 1XG1A 1UMQA 2DMUA 3BG9A 3UKGA 4M3EA 1RESA 1P7IA 4MFDA 4AYBN 1RR7A 2DA2A 2JA8J 2ME6A 4RBOA 2CRGA 3ZQIA 3JRHA 3Q0UA 2NVYJ 1JKOC 2EBIA 1TWGJ 3HOXJ 4DW6A 2DN0A 3HOWJ 3I4MJ 1A5JA 1LE8A 4IEJA 2E2HJ 2O9LA 4L5EA 5C3EJ 3S1NJ 3BR6A 4V2FA 2XPUA 3GTLJ 3K7AJ 3S2HJ 2CUEA 3Q3SA 4DYCA 2EZIA 4A3BJ 1UHSA 3S2DJ 5E3NA 3BTIA 5C4XJ 1IC8A 4W1UA 2HDDA 4DZJA 3JR9A 2LD5A 1OJLA 3FKIJ 1UG2A 3Q0WA 1NK2P 4M6VA 1TWHJ 2DA7A 3BR0A 3G1OA 1HOMA 1LFUP 5E3MA 1MH4A 4IHVA 2DJNA 1FIPA 1S7EA 2L7MP 3HOYJ 1PUFB 3G1LA 1AKHA 2DMTA 4RDUA 1WCMJ 2JN6A 3QQAA 1GVDA 3CQZJ 2EZHA 5M5YJ 2CJJA 1HDDC 3FISA 1APLC 1HLVA 3GBGA 2DA1A 1MBKA 2IBDA 4Y52J 5M5WJ 4A3EJ 1X58A 1P7JA 4A3JJ 3BG5A 2XGCA 1Y1WJ 1B8IA 9ANTA 2E2JJ 2FD5A 4A69C 3MKLA 5EEAA 1GDTA 2XB0X 3B6AA 1TC3C 2P81A 3E7LA 3MVPA 2WAQN 4BXXJ 3BT9A 2AHQA 4S0HB 4I76A 2DTZA 5EG0A 5IPAA 2MG4A 3BTCA 2WV1A 2W48A 1IRZA 4UUTA 1ETYA 3HM5A 5J1RA 3VPRA 4A3GJ 5K7ZA 3Q0VA 2R5YA 5IOZA 4XRSG 1JKQC 3DEWA 3QPSA 3A03A 3LSGA 1IG7A 5E3LA 3NAUA 2VKEA 3L1PA 3SJMA 4IHWA 1BA5A 1HCRA 1Q1VA 5FKLA 4DYQA 2ELKA 1OCTC 1MH3A 2GLOA 1U9NA 2EZKA 2NVTJ 2PMZN 2L7FP 2QF7A 2K40A 5F1JA 2JWTA 3GTJJ 2R7ZJ 1GT0C 1JUSA 4QTRA 2HYJA 4CYCB 2X9DA 4A3LJ 3GTGJ 3H0GJ 2MGQA 2IEKA 2NS7A 1IDZA 1X2NA 5FKMA 3BTLA 5F0HA 1MBHA 1T56A 1T33A 2ME0A 4FISA 2M0CA 2M9HA 3MN2A 5EGOB 5GPAA 2GM4A 1B72B 1RETA 1POGA 4JP0A 2ZB9A 1ZK8A 4HNVA 1AHDP 3JRBA 3ZQLA 1DU0A 2LR8A 3LSPA 3BTJA 1R9TJ 1FIAA 2JA6J 2HQ5A 1ZKGA 3M3YJ 1DU6A 1FTTA 2D5VA 5EZGA 2VUMJ 4MO7A 2HOAA 3BR2A 2CQXA 5K7HA 3W6VA 4UUSB 4W97A 1U9OA 1FTZA 3OOUA 1MSFC 3SDGA 4D5CA 1W0UA 2VPRA 2K9SA 3M4OJ 2L9RA 3GTKJ 3ZQCA 2R93J 1VF9A 5F04A 1XC5A 3RZDJ 5FLVA 2ID3A 1QPIA 3IH4A 5M5XJ 1U8BA 5EDNA 4C3IJ 1FJLA 5FKKA 1ZQ3P 5IOYA 3BR1A 2Y9YA 1IDYA 2M8GX 1AU7A 1MBFA 2HI3A 2R0QC 4A3MJ 3TW7A 5K7FA 1ETOA 1WGXA 2JMWA 1CQTA 2NS8A 1IGNA 1JJ6C 1I3QJ 1YRNA 3S15J 2FJ1A 3ZQGA 1LE8B 5E3OA 1O4XA 4J19A 5IYBJ 1MSEC 2N8GA 1K83J 3O8GA 2DA4A 1JGGA 4D7MA 5FJ8J 5FLMJ 2LKXA 4JYKA 3S1QJ 2KT0A 4FTHA 3ZOBA 1RPWA 1MBGA 1A6IA 2I10A 4BY7J 5F08A 2Y31A 4JX5A 2EH3A
chains in the Genus database with same CATH superfamily
3PM1A 2HZTA 1QRYA 3GWZA 1IRFA 2BBYA 3ZRGA 4A5NA 2E1CA 4M3BA 4M71A 5IYCJ 1F36A 2G0EA 1BI2A 2TRTA 1XMKA 2AO9A 3OIQA 5JR3A 4HDVA 3HKZN 1UAAA 3HGYA 4QSHA 1LVAA 4XOPA 1ON2A 2OBPA 3E0JB 2VLAA 3FHZA 3J7YJ 3LNQA 4L9TA 2ZBKA 1WH5A 4GYGA 2BOLA 4L5IA 1SAXA 4EMSA 1G3YA 2HVSA 2DA3A 2H6BA 4M3FA 1BW6A 5IP9J 2ECBA 1VQ8I 4LJZF 2DMNA 2CV1A 2IVMA 1YX3A 4G9YA 1IV6A 2GWRA 4O3MA 1QVTA 3J81Z 2NOGA 3S17J 1FP2A 1WJFA 3TO7A 4K2EA 2FSWA 2LTPA 3QPHA 2IAIA 1EJ9A 2VQLA 3BZCA 1W7PB 2XPVA 3M7GA 2KJCA 3CUQA 4LIVA 3FM5A 4BEHB 2EQRA 2Y2ZA 3K4LA 1K61A 3M8JA 4D7NA 2NVXJ 1X4OA 1DPUA 3KP4A 4KN7X 2L9NA 3KCCA 3H0DA 3VWBA 3OS1A 1OFCX 4RA2A 4UVBA 2VE9A 1RKTA 2M2EA 1V55H 1R7JA 2JA2A 2KQRA 3FK7A 3FMQA 4ABZA 4HF1A 2FU4A 2VQHA 4M3DA 4UB8C 3HOUJ 1TWFJ 2CQNA 4ZTJA 1SANA 5EYRA 5EF6A 3ZP5A 1ZGWA 4BE0A 4BS9A 4MEXF 2KPMA 1WSUA 2P5KA 4EJTA 4XLFA 1H89C 2EV5A 4JX4A 5BMZA 1SVOA 2LBFA 3O8HA 4U0YA 4IHSA 1ONVA 2DK8A 2XAJA 2Z2SB 1YJWI 2BW3B 3S14J 5ERIA 1JTXA 2OUMA 2PI0A 3OYHA 1I6HJ 2R3SA 2E19A 2ZMEB 5GP9A 4UHTA 1XD7A 3RIRA 4M3GA 3JRIA 4QIWN 2G7HA 2J5OA 5ILSA 3ABUA 1VQPI 1K4TA 1FBQA 2QENA 3KYLA 4B1RA 3U9GA 3NQOA 5FO5A 1JTYA 3DBHB 4WXHA 5FFXA 3U2RA 4U0VA 2X51A 3ZPLA 3K69A 4EV0A 5F64A 1T6SA 4CCLA 1UCRA 2GIZA 4H0EA 1BC8C 4G94A 1SFKA 3TEDA 4A3IJ 4LD5A 5IYDJ 2OPTA 2DLLA 2QYOA 5M3FJ 4F3QA 1XS9A 3PIPF 3ELKA 3G2BA 4YIFA 2JK3A 4RB1A 1P4XA 2A5YB 5GTHC 1IJWC 4QLCU 2JA5J 1R1TA 3C2BA 1RKWA 3E6CC 1MZBA 2D1VA 2E7WA 2P6SA 4BL0B 2KDOA 4JQFA 3LSRA 3OSFA 1DGRM 2CUJA 3GZ5A 4ZH4F 2KIQA 2XASA 4OIOF 2M1BA 3RZOJ 3I58A 3COAC 1BOAA 2DFIA 2KDZA 1G6NA 1D0ZA 2H8RA 3DPUA 4CYCA 1PYVA 2KZVA 2RNJA 1ZRCA 1VFCA 1R00A 3OSGA 2V4JC 3DLAA 2CW8A 4BJ5C 2W7NA 4LG0B 4XLEA 2B63J 2Q2EA 3F6OA 4AIDA 3OR1C 2KP6A 4LOCA 5ICFA 4M74A 2KL4A 1W7PA 4IOAF 3FMSA 2C6YA 4XN0A 1E0EA 2Y30A 1ZGAA 2WTEA 3MKZA 3CO7C 3K2AA 4EJOA 3DXJF 4IHXA 2DMQA 2E1MC 2QKMB 4KIFA 1CGPA 2VJIA 4I0BA 4XK4A 3JRCA 5C4JJ 2W24A 2BHYA 1QBJA 2V79A 3A2KA 1Z0XA 1K78B 2WAFA 1LQ1A 5GPCA 5K5RA 2JUGA 4C30A 3ZGKA 3V8LA 3J80K 3WTVC 1HKTA 3HEFA 2O3FA 1A36A 1QU3A 2K3FA 4FE7A 1PJRA 4HQMA 1T08B 3KP2A 2Q0OA 3GCMA 3GF2A 3OYNA 3JRDA 3R60A 1J7KA 4B43A 2PLYA 5LEJA 4L0ZB 3FMRA 4H4KC 5J3LA 2VC0A 3DPTA 4BYYA 5LLQA 1IUFA 2CO5A 5CVVA 1CF7A 1EF4A 2L3DA 1K79A 1ZRDA 4MQ9F 2JVHA 2ID6A 3HYIA 2K9QA 1ZR2A 4BHPA 2ZJRF 4PFPA 4OAYA 1MDMA 5K5OA 5TISC 4HW0A 3ERED 5HLTA 4M3EA 1RESA 2WY8Q 3MEXA 5FROA 3UR3C 2JA8J 3ZQIA 2WBMA 3JRHA 1ACIA 4FX4A 3C1DA 3V4GA 1TWGJ 3HKZA 2RDPA 2CWEA 2CW7A 4ZZDA 1E3HA 5ICEA 2UXXA 1RR8C 3LSHA 2E2HJ 2DBBA 1RZ4A 5C3EJ 1IXCA 1MW7A 3Q5FA 3ISPA 5LGTA 3QYEA 3S2DJ 5E3NA 3BTIA 1P4WA 2JTVA 3I59B 5ICCA 2DOAA 1KU3A 3F8MA 2PMUA 2M5WA 1RUOA 2HDDA 1D0XA 1R5GA 2LD5A 2P7VB 5FGMA 3VYUB 4V19K 1MMDA 1NK2P 2DA7A 1A04A 5E3MA 3MD2A 3JCUC 2DJNA 1S7EA 4PZJA 4U0WA 4CHUA 2X6WA 3QQAA 5J4VA 3OYMA 3ZN0A 5HS7A 2BY0A 4EQQA 1GVDA 2CV2A 5M5YJ 1HDDC 4LG0A 1APLC 1RIOH 2E35A 4ZYGA 1MBKA 3CCJI 2IBDA 4B09A 3ZMZA 1P7JA 1G59A 2FBIA 4NBQA 4LLGF 1UHMA 3DFGA 1EH7A 1UELB 3I5UA 5DCMA 1WHUA 3X2QH 2LREA 1IRXA 2FD5A 4ZZLA 3DKWA 3MKLA 5D5XB 1GDTA 1IN8A 1V5GA 4RMNA 3E7LA 3MVPA 4BXXJ 3BT9A 2BVLA 3CF5F 1FT9A 2STWA 4UY8I 1MNDA 1Z91A 1T8IA 1PUEE 2HDCA 2HPIA 4ZTFA 2R7FA 4OMZA 3OYKA 2HVQA 2WV1A 1XSDA 1TW3A 1WZ2A 1ETYA 4IPAA 1XN7A 2PJRA 1X3UA 3MZ8A 2DFFA 5K7ZA 1HW1A 3Q0VA 3CP8A 1DUXC 2R5YA 1JKQC 4XRSG 3WTSC 3KETA 4IHWA 4XNFA 4CYDA 4XSZF 1Q1VA 2L4MA 4DYQA 1TQIA 2AS5F 3FDYA 2KRFA 4IXAA 4ENMA 3LQRA 2HFHA 3HPHA 4ETSA 3GTJJ 1YLFA 2E1MB 2XGXA 3L2UA 2OTJI 3OR2C 3PNYA 3BTLA 4HRIA 4HNTA 1OR7C 3K1MA 2GAUA 2P0WA 1LNWA 4FISA 2BE5F 1Z1DA 4XBFA 3WU2C 4BE2A 1RUNA 3MN2A 2COMA 2FE3A 3ZQQA 4EVIA 3R6SA 3O6BB 2W85A 1W1WE 2XKOA 1B72B 1RETA 2E1NA 3CCMI 4JP0A 4KT5C 4HNVA 1AHDP 2PG4A 2W00A 2LR8A 4PFOA 3LA2A 4BQQA 4KYWA 5E79C 5DM7F 5AIPA 4AU7A 2IS6A 1QHHD 1R9TJ 1P4AA 1N75A 1YW8A 2UWMA 3BPXA 1DU6A 2A3SA 2VUMJ 2EFOA 1NH3A 1P9QC 1IF1A 1EH8A 3W6VA 4MHGA 4HG2A 4W97A 3DV8A 2DT5A 4E7ZA 3FBIB 4D5CA 3DWLE 3CCQI 2GOXB 2YR2A 2ZNZA 5CVRA 3B73A 4GGGA 2FXAA 3GTKJ 2DFEA 2R93J 1VF9A 2X85A 4I09A 3RZDJ 3K6GA 1ZG5A 1XGSA 4I7HA 4EM1A 1BR4A 1QPIA 2VJ5A 3H5AA 1X1AA 2LKPA 5M5XJ 1TT5B 5EDNA 3OY9A 2V1XA 1W36C 2I5UA 2OC6A 5IOYA 1MNEA 3PSIA 1IDYA 2GIVA 1U5TA 4RLQA 4B8XA 1LPQA 3OL3A 2HPMA 2M7AA 1O57A 3V7RA 1HXDA 4UXNA 4I98B 2NS8A 3IWZA 2A69F 3BWGA 3MKYB 3HRMA 2NS0A 3S15J 4ON0A 1MMNA 1IXRC 1HC8A 4BU2A 1WFXA 4LFUA 1O4XA 2DPDA 5EEHA 4J19A 5IYBJ 5D5UB 1FSHA 3VB2A 3QODA 2VB6A 1XTAA 4D7MA 4FASD 1LUJB 3HSEA 5FLMJ 1FMWA 1OYIA 1ZGJA 5JHFA 4JYKA 5DV5A 2M4KA 4XKCA 2VBWA 2AXTC 2K02A 3TOBA 3DLLF 1ODDA 4FTHA 3MKWB 1WQ2A 1A6IA 3FXUA 5E8IA 2GA1A 4L9NA 1UFMA 2I10A 3KP3A 1BC7C 1H88C 2CQQA 4CDGA 1DGWY 2F5DA 1AKHB 2FMLA 3QAHA 3MAJA 3N4MA 3GTMJ 3LSJA 2R7UA 2MW8A 1REPC 1ZRFA 2F2EA 3A01A 4JX6A 1Y8QB 3W2AA 4RB0A 2EIJH 3IWFA 2FX0A 3PUBA 4N4NB 3RQ4A 1TNSA 5J6XA 3OYLA 1BW5A 3RPQA 4UUVA 3M1EA 5E8GA 2R7DA 2QCOA 1TBXA 3IKTA 4PK4A 1ON1A 2GBYA 2NRAC 5J1UA 2EA4A 1GHCA 1S9HA 4KISA 3A0BC 1T95A 4BQNA 1JXSA 2M8EA 5FKNA 4R8HA 1HBXG 1J9IA 1BJAA 5HDKA 3GTOJ 2HOSA 3AG2H 2L7ZA 1OCZH 3BJAA 2K5CA 3G1MA 2PX9A 3M1CA 4BNCA 4IQJA 2MC3A 3TOAA 3DBRB 1ZYRF 3WHCA 4D5FA 5EG0B 5BPIA 4L9VA 3WU0A 1IV8A 1OKRA 1RI7A 2K27A 2LLKA 2Y0SN 2ELJA 1ETWA 3GTQJ 5HDNA 1V5EA 4CZZA 3G73A 2D45A 2F5EA 1SFEA 5D4SA 3CESA 4A3DJ 1Y8RB 2XHKA 3SYTA 3S16J 1I1SA 3ECHA 3U1DA 3IL2A 1J75A 2ISZA 2DAOA 5IT3A 3OV8A 5FD6A 4M72A 4KIBA 3OS0A 1I1GA 1Y6IA 3FXQA 2YU9J 3C2HA 3ASNH 3G4SI 3G71I 3PUFA 3REOA 5EZHA 1QA6A 1JUPA 5DM6F 4A3KJ 3I64A 3ZQFA 4ENNA 3QYFA 1QO0D 2MLGA 1PUFA 1G2HA 2P7CB 1SC7A 4RAYA 4A0ZA 3VOEA 3VYRB 2R4GA 2EFPA 2B7EA 4XRFA 3FXRA 1OYWA 3ZR8X 5J1YA 1LFPA 1MMAA 3WG7H 1E2XA 4OIPF 2R92J 5BNGA 2W57A 1G3WA 1WI9A 4AUXA 2L7KA 5KVRA 5JLWA 4FQGA 4AM3A 3L2VA 3HUGA 4J01A 1YW7A 2K9NA 3F0CA 5LBQA 2HWVA 4KUMA 2V9KA 3EPZA 1ITYA 1W7PD 5GTIC 1V54H 3MWMA 1JT6A 2HKOA 4HF0A 3U21A 2E7XA 3ULQB 3GMEA 2ZKZA 1HA8A 3K4CA 3CF2A 5FRMA 2DXIA 2ZSIB 1T0FA 3L09A 4AIKA 3TW6A 2Y9ZA 5KNLA 4PJMA 3R0JA 3VDXA 3RQIA 3CMEI 1Z21A 1O3QA 1FYMA 2LK2A 2L54A 4PDKA 2RV8A 2UV1A 3SHFA 3H3UA 1W5TA 1O3SA 1X1CA 3M8EA 1ZR4A 2HGCA 5IY5H 1TP4A 5L3GA 5J8CA 1EH6A 4RGRA 2DU9A 1VZ0A 2FNPA 4OINF 5E1XA 1MD0A 3CLQA 3HXLA 3CLOA 4BBRJ 2M30A 1WH7A 1GV5A 1GUUA 3J80Z 5F27A 4A0YA 1F5TA 2HOEA 1LFBA 1FX7A 2A6HF 3GFIA 3OMYA 3TL4X 4Z6YA 1EA3A 4A12A 4RM2A 2EZLA 3MCZA 1X1BA 3WHBA 2JJ7A 4BHBA 4BY1J 1ETKA 1BN5A 3MMYB 5CVUA 3T0YA 1ETXA 3IAS2 4XKWA 5DUKA 1T38A 2DCEA 2LRDA 1DPRA 3ONQA 5HOOA 1J2XA 2KIUA 1FZPB 5HS9A 2BVMA 2FOKA 2H09A 2QQAA 1W5SA 1BL0A 5FFZA 5J4YA 4B4CA 5TJJA 1X1DA 4S04A 1OYYA 4Y7NJ 3CMAI 2IRFG 1ERDA 2M87A 2LOOA 4CH7A 4FE4A 4HLYA 1JJ8C 1R36A 2WV0A 6PAXA 2CMPA 2UUZA 2O0YA 3W3CA 2GA2A 2XKPA 3I71A 2FBHA 4DOZA 3BQZA 3V42A 4LB5A 2LH9A 1WJ5A 2HDWA 4UUSA 4ZYAA 2R5ZB 3CCLI 3HOVJ 2YS9A 3OYCA 2F5CA 4JOMA 4DYRA 2IJLA 3JTHA 1TL8A 4IHTA 3TDUC 1F43A 3NARA 4AVZA 3I54A 3DQVC 2DMPA 1HKQA 3ZMVA 1NHAA 1B4AA 1BJZA 1SD5A 3TP0A 5JVGF 2ADUA 2V6CA 3K4MA 2O8KA 1FOWA 2IS4A 3GTPJ 5B5EC 5JLXA 4A3CJ 1N25A 3H9QA 3CCYA 1BI3A 2W84A 3BR3A 2IPQX 1X19A 4A3FJ 1Z05A 1UMQA 3I56I 1TTYA 3UKGA 4UB6C 2QGUA 4CUGA 2CRGA 1MMGA 2K3PA 2K9MA 1T2KA 4GRIA 1F1ZA 2OU2A 4ZC3A 2EBIA 2CYYA 3HOXJ 3OYBA 1N78A 4U88A 5KHDA 2FEZA 1Z67A 1LE8A 4B48A 3I53A 4M9XA 3W2VA 2BGCA 3BR6A 5GAEJ 4L0YB 1NG7A 2O61A 2L2OA 5GAGJ 1X3ZB 1YHQI 1UHSA 5AIQA 4QPQA 4RLFA 1SD4A 1T39A 3C3WA 3ASOH 1S29A 1FSEA 1Z3YA 2IGNA 4XM3A 2MD5A 3SDBA 4DZJA 4KA4A 4Q5SF 5GAHJ 2JRTA 3G6EI 4ESBA 4E7LA 3EUAA 3PNVA 4UV9A 4FETA 3RKXA 2QA4I 3BR0A 4BJ6C 4HQEA 1LFUP 2L7MP 2RVCA 2IT0A 2Y0SA 3G1LA 2DMTA 1B9MA 1R23A 1WCMJ 2HTJA 3F72A 4Y33A 2DO7A 2VBZA 3GUDA 3JAMZ 2NNYA 2W25A 3FISA 4E7IA 2JQ7A 3CCSI 2HKXA 2X1DA 4Y52J 5M5WJ 2XAGA 4A3EJ 2DOEA 1X58A 3P9IA 3RYRA 3RI4A 1H9GA 3QP6A 3ZXSA 2ACJA 2OA4A 4AIHA 3HHGA 4OU0A 3RYPA 2DK5A 4FX0A 3FZVA 3GFLA 5K1YA 4A69C 3CCUI 2XB0X 2WC2A 4BE1A 4DNCA 1ZG1A 4NHJA 1FC3A 1YYVA 2P81A 2QSHX 2R7RA 1Z6RA 3TO6A 3I0TA 1ZAOA 2FRHA 1SAUA 2M45A 2MG4A 2V26A 2HVRA 1WWXA 2W48A 4BEHA 3C2GA 1FOXA 2E60A 3HM5A 3VPRA 3K4KA 1BOBA 3DKXA 2BHZA 1FBUA 4PJJA 3BROA 3DEWA 3QPSA 1ZELA 4PUSA 2XF5A 4C9YA 1FMVA 1IG7A 3SJMA 2XF6A 2HR3A 2QQ9A 2XC7A 4KJZA 1LB2A 3SQNA 5FKLA 2ELKA 1OCTC 4HAMA 2NVTJ 3G3ZA 4BACA 2QF7A 1ULYA 3BCBA 1U6GA 5F1JA 3UNGC 2JWTA 1YI2I 2KLOA 5FLXZ 2MLKA 4GDFA 1JUSA 3A1YA 3GTGJ 5A2QK 4M6XA 1YO5C 3BY6A 2IEKA 3ERMA 4XONA 3WE2A 1GXQA 1IUYA 1IDZA 1X2NA 1JHHA 3KX2A 5F0HA 3EYYA 1VQ7I 1PP7U 4ESJA 1ZREA 3AAFA 3BG7A 2QVOA 4MNUA 3F8BA 1XX5A 2BW3A 1WJCA 5EGOB 2YSRA 4RAGA 2ZFWA 3WTZA 4CA0A 5H6RA 2PQ8A 3PL8A 2ZB9A 1WJDA 2DQLA 3JRBA 4KIGA 4L18B 2XSJC 2ZMEA 3BTJA 2E5ZA 2FBKA 2CG4A 1FIAA 4HV6A 1P92A 4DIQA 2HQ5A 1ZKGA 3M3YJ 5D5WB 1O7LA 1U3EM 1KQ8A 3ECOA 3OYDA 1MIJA 3NWSA 3SEQA 3DPLC 3V8JA 4XLHA 1YFHA 2CQXA 5H6QA 1W5CC 2IXSA 4GXOA 3F3XA 1BM9A 3IKVA 4RM3A 1U9OA 1V3FA 3E5UA 1USSA 5LGNA 1IRGA 3I9V2 5L3FA 2VPRA 2K9SA 3M4OJ 4XL9A 2H1LA 3J81K 2R7VA 3K4BA 3ZQCA 5F04A 2IS1A 3F22A 1EV7A 3LA7A 5FLVA 2ID3A 2IP2A 1G4DA 3VSLA 1R71A 1G3TA 3IH4A 2Z33A 2MH2A 2L4AA 4BH9A 3E5QA 5FKKA 1ZQ3P 3U1KA 3M07A 3KLOA 1R1VA 3C18A 5DUIA 5F1RA 1HW5A 4N4OB 2M8GX 2HI3A 2R0QC 1K7AA 2JSPA 3TW7A 1B59A 5K7FA 1ETOA 2JMWA 1H0MA 1AWCA 4ZJZA 4ENKA 1JI8A 1R5HA 1I3QJ 2LG4A 3WTUC 2EILH 3OL4A 2PBIA 4N9HA 5E3OA 1F9NA 1K83J 1QZZA 1BBYA 2R7OA 2EIMH 5J47A 4BUPA 3R4KA 5FJ8J 1H9TA 3LAPA 3KP6A 1IN6A 2PEXA 4PSWA 2LKXA 3IRRA 3LMMA 2MH9A 4R1HA 1I27A 3ZMTA 2VE8A 5E20A 4ASNA 2EFNA 3IHUA 3FWEA 3ZOBA 2FNAA 3L2CA 4Q4ZF 1GXPA 2K7LA 2KHMA 3PIOF 4UNOA 5EEGA 1GVJA 1XGMA 2TDXA 4HX7A 1K78A 2ZCWA 3TO9A 2VXZA 4RGUA 4BY7J 4M6YA 3CD6I 3KPHA 1HDPA 4YFNF 2ISYA 3CCRI 5DTDA 2QQ8A 4RB3C 2H6CA 5FKOA 4NB5A 2KZGA 3RCOA 2F4IA 2LP0A 2DJIA 3HTUA 3SFZA 1BIBA 5CYVA 4U7DA 1I50J 1VQOI 2QZ8A 3VYTB 2YX7A 2IS2A 3PNTA 2DA6A 1S6LA 2A6TA 3S3MA 1MKMA 1LDJA 3S93A 1B8IB 4IRHA 2XGDA 4BJTA 3WTWC 4ZDLA 5JVTA 2EINH 2X6OA 3HSFA 3K0LA 4Q47A 3R0AA 4EJVA 3L9FA 2LYCA 1U8RA 1Q1HA 3SEZA 1NTCA 4V2GA 1TT0A 2GOMA 3RPUA 2KKOA 1Z7LA 5B1BH 2OCEA 3V7SA 2XUBA 2VBYA 3E1SA 4IZZA 2KRHA 2LY9A 5LD2C 1MBJA 3D1NI 4B47A 3HRUA 3HIFA 4XICA 3ABTA 4ENJA 2VJJA 2VC1A 3LSTA 2RAEA 3F8NA 3L7WA 2ZXWH 2CH0A 4HLXA 4NC7A 1XB4A 3EUHC 2MC4A 3BZ6A 3R61A 3LWFA 3BJOA 3FM3A 3S1MJ 2F48A 3JRGA 2V6EA 4X1EA 2QLZA 3CCVI 3I59A 2QM3A 3HZJA 2L9VA 3CJRB 2Z1DA 2ZJ2A 4HOBA 2EB7A 5LFAA 1Z77A 2BXZA 1DDNA 2DYRH 4EEFG 1RC9A 2HOTA 4BDZA 4XRMA 4BHCA 3K70D 2H94A 1ENHA 1W0TA 4A6DA 3HC7A 3LA3A 3S2WA 2OF7A 2WADA 3DF8A 3S3OA 1X3WB 1O7FA 3I4NJ 1FEXA 3J7ZI 3QYBA 4FCYA 4G6TB 5CLSA 1ORKA 2PJPA 2VI6A 5F0FA 3HRTA 2V1UA 3LSIA 2BV6A 2A05A 1A35A 2JPBA 3WE3A 2K9LA 2RNGA 3KLNA 4TV7A 2VT2A 4HYEA 3QOEA 3HHHA 1X1PA 4P1WA 4U87A 3JREA 1SFUA 3FKJA 4G6DA 1WJBA 4DBRA 2CQKA 2X6YA 5D4RA 3CC4I 5H20A 3ZCOA 2BY1A 2A07F 3TMOA 4IOCF 3FF5A 4XKBA 2XRLA 4MFEA 4C3HJ 4RB2C 5CQGA 3H9GA 3T8TA 3KFWX 3KE2A 2W4SA 4C2MJ 5D8LB 3S8PA 1XMAA 4XKVA 2H8WA 3JTGA 5IP6A 4KDPA 1I5ZA 1Y0NA 4E70A 2DPUA 1D5VA 5B3SH 3DCFA 2ESHA 2VOOA 5HDGA 2BXYA 2CFOA 2R7SA 2Y75A 5B1AH 3NEUA 4MQVA 5CQEA 4WWCA 3WTYC 1L0OC 2GZWA 4XLAA 4AC0A 2YUSA 4CGZA 5KCMA 3HL2A 5BS6A 1SFOJ 1QZEA 4ZYHA 3DEUA 4X6AJ 1DP3A 1YRNB 1B1BA 4B3AA 4E7HA 1MNMC 1ZN2A 3JRAA 3PO2J 2AXLA 2JA7J 2CQ7A 2L02A 1D5YA 1WI3A 4L5JA 2ICWG 2VT3A 1YJNI 1B72A 4YIIA 1WPKA 4CZCA 5IP7J 1VQ6I 2X6XA 1YE9A 3KIOA 1W36D 1VQ9I 4U7BA 2FQ3A 3IUOA 1D1BA 1JHFA 2VPLA 3ML6A 2MFZA 3RKQA 3IH3A 1H8AC 2OQGA 1UHWA 3S32A 3V8KA 5JFRA 1ZH5A 3HOTA 3WGGA 3DU6A 5KK1A 3F6VA 4HNUA 3ABKH 5ILVA 5FD5A 4GFBA 3TP3A 2XAUA 3JW4A 3CJQB 1VI0A 5CPRB 3QPLA 2Z5UA 1Y0UA 4NC6A 1B6AA 4BKXA 3LL7A 2IA2A 1GLNA 3GVAA 3QRFF 3W6JB 2QSFX 1VQLI 3HGGA 4WXDA 3K2ZA 5HLHA 3CMYA 2X48A 3GFMA 3QU3A 3HOSA 1S72I 2M7BA 2R7WA 5M3MJ 3JRFA 2CW0F 1XG1A 4GYIA 1P7IA 1RR7A 2V1DA 1XDUA 2ME6A 4RBOA 3KP7A 4IKFA 2NVYJ 3KZYA 1JKOC 4B44A 4DW6A 2QSGX 1IXSB 3FXOA 4N0BA 4HF2A 1LDDA 2ZJPF 4BAYA 3I3LA 3HOWJ 1A5JA 4LGWA 5L3BA 2OCCH 5HVQC 2O9LA 3DEEA 3S1NJ 4V2FA 2QBYB 2P8TA 1IW7F 3K7AJ 2B0LA 2CUEA 2MD0A 3N05A 2EZIA 3Q3SA 3T8RA 3DKYA 4DYCA 1SFXA 2M0MA 4QWQA 5C4XJ 4W1UA 1FOKA 3JR9A 3WTXC 5CVIA 2EV6A 3F8FA 3FKIJ 2VXDA 2K85A 3VEPA 4BDYA 2DT7B 3Q0WA 2HZDA 4M6VA 3DTEA 1QZYA 1TWHJ 3G1OA 2GXGA 4D9JA 1HOMA 2XAQA 1BR2A 1YW9A 2K86A 3H35A 3BZKA 4CCOA 3HOYJ 5HNFA 1AKHA 2JN6A 3GEZA 2K4BA 2WA0A 3D5SC 4I02A 3HG9A 2KRCA 2LBFB 2AQEA 2CJJA 5E18F 1G8XA 1HLVA 2NYXA 3FXLA 1DQUA 5L3CA 2HYGD 1HSJA 3BG6A 1HW2A 1WJAA 4HEA2 2EV0A 3J7AO 2VN2A 3BG5A 5E1WA 9ANTA 2E2JJ 4B3XA 4RAFA 4CCKA 5B66C 4LB6B 3VFZA 3H9JA 1FYLA 3ZMDA 5IT9K 2X0LA 2Y0MA 1OMIA 1U2WA 3B6AA 1Y39A 2P6TA 1NG6A 1KYZA 2WAQN 4EGZA 2EFQA 3LAJA 3HRSA 3WGIA 2HU9A 5EG0A 1BI1A 1OQYA 2LDUA 4G7HF 5HLGA 4CO8A 3TQNA 5D6FA 1IRZA 4UUTA 3IRQA 4XLCA 2VQGA 3EETA 4HSTA 4I99C 1KONA 3KEOA 3H3ZA 2MBFA 2XROA 4PGGA 2IGOA 1OR7A 3A03A 3LSGA 2YX4A 3HTSB 5E3LA 1YS7A 2VKEA 3NAUA 4HA8A 4CCJA 1HQCA 3ROUA 3WODF 3T5XA 2MABA 3IC7A 4RGSA 2XVCA 3P7NA 2CGPA 2GLOA 1U9NA 1TW2A 2PMZN 3EUHA 3PFIA 1GT0C 4CYCB 3MQ0A 1DP7P 3CZ6A 4A3LJ 4RGXA 4NUBA 4IO9F 1XDSA 3OYEA 3H0GJ 2HS5A 4IRIA 2RGVA 5FKMA 1QPMA 1XGNA 2VKHA 1MBHA 2O5RA 2Z16A 2Q2EB 5LRRA 1T56A 1S8NA 2ME0A 2W1OA 3KP5A 4F93B 2M0CA 1XCBA 1VQ4I 3PQJA 3DTIA 2A5WA 5GPAA 2GM4A 2B9SA 1POGA 3FHNA 1ZK8A 4P5OA 1YIOA 2QBYA 3TBIA 5LHHA 1N77A 2MYSA 1MMSA 3GZNB 1ZARA 1Z7UA 2DTRA 3WG9A 4YELA 5DD4A 4HDUA 5D6EA 4E4HA 3OYAA 2VONA 4MO7A 2OZ6A 2IA1A 4M9ZA 1C0WA 3TDZC 2F5FA 3BR2A 5K7HA 5ILUA 1FLIA 2Q1ZB 4IX7A 3PSFA 3VYSB 3GLXA 2RC4A 1SVLA 3O2PE 4BQAA 2EJRA 4L9JA 3OYGA 3FX3A 1VQ5I 1W0UA 1A6QA 3H36A 4XQFA 1JE8A 2ZFUA 4DQ2A 2L9RA 2O6GE 2X4HA 2AQFA 1CF7B 2OZUA 2NXNB 2Z3YA 4OMYA 1T98A 3B02A 1SEUA 1JGSA 3K1NA 4KMFA 1MDMB 4E7SA 3BR1A 5FRNA 1FP1D 5EJCA 5DDGA 1MBFA 3T1BA 1MJ9A 4XMYA 3EUKL 1CQTA 1IGNA 1FNNA 3TKYA 4Y4RA 2FJ1A 1J59A 4P96A 2O03A 4G7OF 4PSXA 4PJNA 3BDDA 3RPUD 3QOPA 5DEQA 1MSEC 4ITVA 3ABLH 3F8CA 3O8GA 1Z6TA 1JGGA 4ZDOA 4BGDA 3LFUA 2E71A 4BXUA 2ZC2A 3S1QJ 2DYSH 2KT0A 3BPVA 1TZLA 5BPDA 2V7FA 1BIAA 1U5TC 3AFHA 1W4MA 2H27A 1RPWA 1MBGA 2PFBA 4YFXF 1J0RA 3WTTC 3ZMUA 2EWNA 2D5VA 3J7AY 2EH3A 1TWCJ 1GV2A 2O7OA 1SMYF 2VKDA 3KYDB 3L2QA 1ZHFA 3L2RA 1ETQA 2EA2A 2DT6A 2R5ZA 1JUMA 4A93J 2CUFA 1S5LC 3HBLA 4MIMA 3S1RJ 2ECCA 3H92A 4HZFA 1RRJA 2IA0A 2IGKA 2LVSA 4NQWB 2VODA 2VIXA 1JT0A 2R7XA 4MTEA 2LFBA 2NVQJ 2G9WA 1MBEA 2QWWA 2JSCA 3EDPA 2IW5A 4XOTA 3F23A 1VTNC 4DGWB 3LOCA 5K5QA 1QVUA 3IH2A 4RAZA 1NK3P 4IF4A 5DCMB 4IHYA 1D8JA 1SD6A 2F6CA 1OCPA 1P2FA 3BG3A 4G12A 3GLLA 5BQTA 2F4MB 2VKVA 3SZPA 2Y48A 2XGEA 4Y3OA 1I3AA 1OCOH 2DA5A 4CCMA 2GXAA 3JSPA 4I6ZA 2LC2A 1E17A 4N9IA 3BR5A 3QPTA 3MZHA 2A6EF 4OIQF 2WAEA 1V4RA 3A02A 3SZTA 1U78A 2KISA 2M4GA 3Q9VA 1RNLA 1XMXA 4XLPF 4XIDA 1L3LA 2L01A 4DBQA 2PJRB 1SMTA 2ZXIA 3VODA 3GO5A 5DS9A 3FXMA 2HXOA 4PCQA 2Z99A 3FIWA 3E3VA 3OYJA 2NOJB 2ELHA 2FQ4A 2R5YB 2P5LC 3CC2I 4I0AA 4F55A 1WVRA 4C3JJ 5DYMA 3HB9A 3EYIA 1XPXA 2GQQA 2O8XA 5HODA 3LSKA 2XSDC 5LGUA 1Y1VJ 2NNNA 4WK8F 2RKHA 3CJTB 2JRMA 3HJEA 2WAQA 2NVUB 4YIRX 3BLYA 4IQ4A 2L5QA 4JK1X 4LITA 2JUCA 5LHGA 3OIOA 2ETHA 2EPFA 4S05A 4OOIA 1R22A 4KT6A 1YITI 4KFCA 2CSOA 2ZNYA 1TWAJ 2BYVE 2BEOA 2FMYA 3GYHX 4E7KA 4XRSA 2DFHA 4PGHA 5F0CA 4BQOA 1ZLKA 3HDDA 1I39A 3H3VK 1E3OC 3BOQA 1O3TA 1WKMA 5CKTA 5TGTA 1ZTRA 4P55A 3DU5A 4D1QA 5C44J 1HF0A 2IGMA 2WB1N 5H2FC 2JZYA 4I2OA 1P6RA 3GFJA 2F5VA 2HQRA 2PMZA 1XSXA 1IZ1A 4YRVA 2V9PA 2H1KA 3ZQHA 2L0KA 4YFKF 2M34A 3IV5A 3IAM2 4MLOA 1K6YA 3A4CA 3Q9SA 2PMHA 4LIUA 5ICGA 3D5RC 2LSOA 2HQNA 4AIJA 4CSWA 1YJ9I 4F91B 4EM2A 4DZPA 2X1CA 4II2A 1IN5A 4ESFA 2DI3A 3CTAA 4XN3A 5J40A 1B9NA 3BP8A 2QQBA 4NDLA 1F4KA 3KYCB 4Y15A 4KMUX 1UB9A 1FY7A 3K1PA 3QU6A 1KYWA 3RKWA 4CICA 4IVNA 2DODA 4EM0B 2E1OA 4NQWA 3KEYA 2E34A 2TCTA 5E1ZB 2MA3A 1T0FC 1MJBA 2DDBA 2Z9OA 2ZXJA 2BZTA 5LEKA 2QKLB 3CDLA 2HQAA 2KJBA 3TGNA 3RDIA 2MSYA 2K4JA 1U5TB 2D2WA 2DDAA 2HXIA 3CC7I 2CU7A 1HSTA 3K10A 4PJ0C 2KMUA 2COBA 1FYKA 1LDKB 3OWTA 2CUZA 3CP2A 3P5JA 2LF7A 1YIJI 3K4JA 2I8DA 3AG3H 2V9VA 1XGOA 1OCCH 1XCVA 4MGRA 4XR6A 5ED4A 5EGOA 3K70C 3HOZJ 2ZSHB 3PO3J 4IL6C 5AONA 1ZLJA 2XB5A 1ETVA 4D0PA 1OISA 4UVCA 1K6OA 1YTYA 1VNDA 4YEJA 1YOVB 3PQKA 5LRSA 3M9AA 2VQCA 1J09A 1UJ8A 3IP4B 2OV7A 3BCAA 3JAMK 2WWYA 1X2MA 2R7QA 4O5VA 2OD5A 2BY2A 3FK6A 1R4MB 4O6JA 1JKPC 3RJPA 2E2IJ 2ESNA 2DOFA 2FA5A 3BJ6A 4DJAA 4BBSJ 3BQYA 3E5XA 3NWTA 3ZMSA 3P9CA 1LEAA 4MEYF 3BC8A 3A01B 3F21A 1R58A 1I6XA 1R1UA 4M9SA 1IO2A 3FXKA 4PJLA 3GZ6A 2XPWA 4UV8A 1SD7A 2RREA 4G8XA 2VJ4A 1TQMA 2FF4A 5HNHA 2VBXA 3H1CA 3SFIA 1R4NB 1LKXA 3LQQA 2FOWA 2Y69H 2VL8A 4WCGA 3RSNA 5D5VB 2L9SA 3LSMA 3P9KA 4GCVA 4OAZA 1JKRC 1Y56A 3DTKA 3CUQC 3B6CA 4A5MA 4R79A 2DMUA 3BG9A 4Q48A 1D1CA 3K9TA 4Y13A 5L3EA 4MFDA 2RQPA 2DA2A 4AYBN 2CV0A 3AL0C 2A68F 4G7ZF 1AOYA 3Q0UA 5F6FA 1KU2A 4KN4X 1IAWA 4C2TA 4LLNA 4A6EA 2DN0A 2QEXI 4WXCA 4AWXB 3QP5A 3I4MJ 2F4OB 2J5PA 4IEJA 1TNTA 4NC8A 5E17F 2G7UA 4L5EA 2KIMA 3DP7A 1MGTA 3L00A 2XPUA 5FLXK 3GTLJ 1G3SA 4EJUA 3S2HJ 2ZO4A 5IT9Z 1YX5A 4GO1A 1S7AA 4KICA 2HYFA 2JT1A 3H5NA 1IC8A 2UZKA 3CJNA 3RTRA 3CDIA 5CJ9A 4IRGA 1OJLA 1UG2A 1UG0A 3I4PA 2V1NA 1ZG3A 4IJAA 5KAIC 4EGYA 1OLTA 5TRDA 1VQNI 4KITB 4A2UA 1PP8F 1STZA 1MH4A 4IHVA 3SZGA 1FIPA 2EIKH 1Z3XA 2HNHA 1PUFB 1R5ID 3ZN1A 5D8KB 1R49A 2JPCA 4RDUA 4J00A 3CMMA 2DW4A 3KEQA 3CQZJ 2EZHA 3A0HC 4F7ZA 2OQRA 1D0YA 1SVMA 3EQLF 4LG3A 4P9FA 3PFYA 3GBGA 2STTA 1HKSA 2DA1A 2LY1A 1BR1A 5CVJA 4AD9A 2XV4S 1S7OA 4UVAA 3HUGB 4A3JJ 2XDVA 1QGPA 2XGCA 1Y1WJ 1B8IA 2XIGA 2WY7Q 1U0JA 1O3RA 4OWRB 1VQKI 5FB2A 1M1EB 2HEOA 3QWLA 1S3JA 4EATA 5EEAA 2LKSA 5KAFC 3GW2A 3OYIA 1KU9A 2X1EA 4HV5A 1TC3C 3O3KA 2OTLI 3KZZA 3ESWB 2XAHA 2AHQA 4S0HB 2HTSA 3AG1H 4I76A 4F52A 2DTZA 5IPAA 3E6BA 5GADJ 1AA7A 3BTCA 3LFKA 1LJ9A 2VASA 2BY3A 2JVGA 5J1RA 4A3GJ 4C2UA 4Z2YA 3KZIC 2WB1A 4XSXF 5IOZA 1TLHB 2M3AA 3NRVA 3E6MA 4LK1F 3L1PA 3CO6C 1BA5A 4A0XA 3N97A 4ZYDA 3OS2A 1TQPA 2EK5A 1HCRA 1MH3A 1BI0A 2EZKA 2ZXHA 2DQRA 2L7FP 3W2WA 2K40A 4LK0F 2UXNA 4HX8A 2XRNA 2R7ZJ 2KIFA 1UZCA 2GXBA 4QTRA 2HYJA 2X9DA 2MGQA 1D8KA 2NS7A 4KNYA 1YQAA 5L3DA 5JHUA 3ZQ7A 1LVKA 2A61A 3C7JA 4A3BJ 3E6DA 4MTDA 2E36A 1YS6A 3OYFA 1XSVA 1T33A 4BXFA 2P4WA 1QNTA 1A31A 2YPRA 3FXJA 2M9HA 5DCFA 4XLNF 2YU3A 1EKEA 1FPQA 5DD8A 1USTA 2LMDA 1V5FA 3D5LA 3HPGA 3ZQLA 1D1AA 3CCEI 1DU0A 3LSPA 4OIRF 2LNBA 4II3A 4I01A 4HSRA 2CFXA 4FHTA 2JA6J 2XF7A 4E6KG 3AG4H 1KZHA 1FTTA 5EZGA 4F92B 1PDNC 1LEBA 4JBAA 1QQIA 2HOAA 3FBNB 4G6QA 3AKZA 2EFWA 3CUQB 2CS3A 3I55I 5BOXA 4RS8A 4AVPA 2XAFA 1WJEA 2LF8A 2FUG2 2OJED 4UUSB 4XORA 3WGHA 4CCNA 3AL0B 2E5NA 1Z9CA 1FTZA 1IN7A 3HSRA 3OOUA 1MSFC 2W82A 3SDGA 3M8FA 2NAZA 3F9KA 4ZDPA 3V7CA 2ZMEC 1K4SA 3SXYA 2PN6A 4P9UA 3D0SA 4X0GA 1XC5A 2D1HA 1KQ9A 3RKYA 2KFDA 1R6RA 4WX9A 1FWZA 3ABMH 2VOPA 1FBSA 2Q8KA 3K4NA 3CDHA 1MJAA 4LMYA 3L2WA 1U8BA 3H5RA 4C3IJ 4CXFA 1FJLA 3PJRA 1KA8A 1D3YA 5J8FA 3JSOA 2Y9YA 3OOPA 4FT8A 1QHGA 5LHIA 1AU7A 1PVEA 2LY2A 4A3MJ 2RN7A 2ZJQF 5JI6A 1WGXA 1X4PA 5HS8A 3MZYA 5HLIA 3CUOA 3VSKA 1JJ6C 4WF2A 1YRNA 4M73A 4NNJA 3ZQGA 3GXOA 1LE8B 4ANJA 1J5YA 4HBLA 2QUFA 2R7TA 3MFKA 2N8GA 3GX4X 2DA4A 5A2QZ 3DBLB 3OIPA 1YG2A 1KGSA 4LLLA 1WRJA 4ZYEA 4YG2F 3E97A 4Y17A 4HX4A 1VQMI 1E3PA 2OAZA 4AYBA 1OCRH 1KU7A 1FOYA 4QPOA 3W6KB 4HPQA 1IN4A 4E7JA 1KQ0A 3WU1B 2RQQA 2P5VA 5F08A 4EJWA 2Y31A 1OPCA 4JX5A 3S3NA
chains in the Genus database with same CATH topology
1HDPA 3PM1A 1H88C 1TWCJ 1GV2A 1QRYA 2CQQA 1AKHB 2O7OA 5DTDA 4M3BA 5IYCJ 3GTMJ 1F36A 2G0EA 2TRTA 3LSJA 2MW8A 1ETQA 5FKOA 2AO9A 3A01A 2R5ZA 1JUMA 3HKZN 2CUFA 4A93J 4JX6A 3HBLA 4MIMA 3HGYA 2ECCA 2LP0A 4QSHA 3S1RJ 2LVSA 2FX0A 1BW5A 1JT0A 1I50J 3LNQA 2LFBA 2QCOA 2NVQJ 1WH5A 2DA6A 1MBEA 2GBYA 5J1UA 1B8IB 3LOCA 2XGDA 1QVUA 2DA3A 3IH2A 1NK3P 4IHYA 4M3FA 1OCPA 2X6OA 5FKNA 1BW6A 3BG3A 4G12A 5IP9J 2ECBA 2VKVA 2DMNA 1IV6A 3GTOJ 2XGEA 2HOSA 1QVTA 1NTCA 2DA5A 2NOGA 2L7ZA 3S17J 4I6ZA 4V2GA 3G1MA 3BR5A 2LTPA 3A02A 2IAIA 4D5FA 1U78A 3WHCA 5EG0B 2LY9A 1MBJA 3D1NI 2LLKA 2XPVA 4XICA 2Y0SN 1ETWA 2RAEA 2EQRA 2Y2ZA 4XIDA 3GTQJ 5DS9A 2HXOA 1K61A 4A3DJ 3FIWA 4D7NA 2R5YB 2NVXJ 3S16J 2FQ4A 1OFCX 3S1MJ 3JRGA 4X1EA 1RKTA 2M2EA 4C3JJ 3HB9A 3FK7A 4ABZA 2YU9J 4M3DA 5HODA 2XSDC 1Y1VJ 3HOUJ 1TWFJ 5EZHA 1JUPA 1Z77A 1SANA 5EYRA 4EEFG 5EF6A 1ZGWA 2HOTA 4A3KJ 4XRMA 1ENHA 3ZQFA 3OIOA 1W0TA 1PUFA 1G2HA 2OF7A 1H89C 3I4NJ 1TWAJ 1FEXA 4JX4A 4XRSA 3O8HA 5F0CA 4FCYA 5J1YA 3HDDA 1ORKA 3H3VK 1E3OC 2VI6A 2R92J 5BNGA 5F0FA 1ZTRA 3S14J 1JTXA 4AUXA 5JLWA 5C44J 1HF0A 2WB1N 1I6HJ 2K9NA 3F0CA 2E19A 5GP9A 1ITYA 4M3GA 3JREA 3JRIA 4QIWN 2H1KA 1JT6A 3ZQHA 2L0KA 2M34A 3IV5A 4B1RA 4MLOA 3TW6A 2Y9ZA 1JTYA 3RQIA 2XRLA 4MFEA 4C3HJ 4DZPA 2LK2A 4C2MJ 3TEDA 4A3IJ 5IYDJ 2OPTA 5M3FJ 1XS9A 4NDLA 1ZR4A 2JK3A 1IJWC 2JA5J 3C2BA 1RKWA 5IP6A 2E1OA 3LSRA 2TCTA 3DCFA 3OSFA 4BBRJ 1WH7A 1GV5A 1GUUA 3RZOJ 5F27A 1LFBA 2KDZA 3CDLA 2H8RA 2MSYA 2EZLA 2YUSA 4AC0A 4CYCA 2HXIA 3WHBA 2JJ7A 1VFCA 1SFOJ 2CU7A 4BY1J 1ETKA 3OSGA 2COBA 4X6AJ 1ETXA 1YRNB 2B63J 4B3AA 1MNMC 3JRAA 4LOCA 3PO2J 2JA7J 5EGOA 1D5YA 1WI3A 3HOZJ 2Y30A 3PO3J 1B72A 1BL0A 2XB5A 3K2AA 1ETVA 4B4CA 1WPKA 5IP7J 4IHXA 4Y7NJ 2DMQA 1VNDA 4FE4A 4XK4A 1JJ8C 3RKQA 3JRCA 3IH3A 1H8AC 5C4JJ 1X2MA 1Z0XA 5GPCA 3FK6A 1JKPC 3BQZA 2E2IJ 4GFBA 3HEFA 4BBSJ 3BQYA 3TP3A 4FE7A 4UUSA 3JRDA 1VI0A 3A01B 2R5ZB 3HOVJ 2YS9A 3QPLA 4DYRA 2XPWA 5J3LA 4BKXA 1IUFA 1F43A 3NARA 3SFIA 2DMPA 1EF4A 3HGGA 1BJZA 2ID6A 3TP0A 3CMYA 2X48A 2O8KA 2K9QA 1ZR2A 3GTPJ 5JLXA 5M3MJ 1JKRC 4A3CJ 3CCYA 3BR3A 3JRFA 3B6CA 4A3FJ 1XG1A 1UMQA 2DMUA 3BG9A 3UKGA 4M3EA 1RESA 1P7IA 4MFDA 4AYBN 1RR7A 2DA2A 2JA8J 2ME6A 4RBOA 2CRGA 3ZQIA 3JRHA 3Q0UA 2NVYJ 1JKOC 2EBIA 1TWGJ 3HOXJ 4DW6A 2DN0A 3HOWJ 3I4MJ 1A5JA 1LE8A 4IEJA 2E2HJ 2O9LA 4L5EA 5C3EJ 3S1NJ 3BR6A 4V2FA 2XPUA 3GTLJ 3K7AJ 3S2HJ 2CUEA 3Q3SA 4DYCA 2EZIA 4A3BJ 1UHSA 3S2DJ 5E3NA 3BTIA 5C4XJ 1IC8A 4W1UA 2HDDA 4DZJA 3JR9A 2LD5A 1OJLA 3FKIJ 1UG2A 3Q0WA 1NK2P 4M6VA 1TWHJ 2DA7A 3BR0A 3G1OA 1HOMA 1LFUP 5E3MA 1MH4A 4IHVA 2DJNA 1FIPA 1S7EA 2L7MP 3HOYJ 1PUFB 3G1LA 1AKHA 2DMTA 4RDUA 1WCMJ 2JN6A 3QQAA 1GVDA 3CQZJ 2EZHA 5M5YJ 2CJJA 1HDDC 3FISA 1APLC 1HLVA 3GBGA 2DA1A 1MBKA 2IBDA 4Y52J 5M5WJ 4A3EJ 1X58A 1P7JA 4A3JJ 3BG5A 2XGCA 1Y1WJ 1B8IA 9ANTA 2E2JJ 2FD5A 4A69C 3MKLA 5EEAA 1GDTA 2XB0X 3B6AA 1TC3C 2P81A 3E7LA 3MVPA 2WAQN 4BXXJ 3BT9A 2AHQA 4S0HB 4I76A 2DTZA 5EG0A 5IPAA 2MG4A 3BTCA 2WV1A 2W48A 1IRZA 4UUTA 1ETYA 3HM5A 5J1RA 3VPRA 4A3GJ 5K7ZA 3Q0VA 2R5YA 5IOZA 4XRSG 1JKQC 3DEWA 3QPSA 3A03A 3LSGA 1IG7A 5E3LA 3NAUA 2VKEA 3L1PA 3SJMA 4IHWA 1BA5A 1HCRA 1Q1VA 5FKLA 4DYQA 2ELKA 1OCTC 1MH3A 2GLOA 1U9NA 2EZKA 2NVTJ 2PMZN 2L7FP 2QF7A 2K40A 5F1JA 2JWTA 3GTJJ 2R7ZJ 1GT0C 1JUSA 4QTRA 2HYJA 4CYCB 2X9DA 4A3LJ 3GTGJ 3H0GJ 2MGQA 2IEKA 2NS7A 1IDZA 1X2NA 5FKMA 3BTLA 5F0HA 1MBHA 1T56A 1T33A 2ME0A 4FISA 2M0CA 2M9HA 3MN2A 5EGOB 5GPAA 2GM4A 1B72B 1RETA 1POGA 4JP0A 2ZB9A 1ZK8A 4HNVA 1AHDP 3JRBA 3ZQLA 1DU0A 2LR8A 3LSPA 3BTJA 1R9TJ 1FIAA 2JA6J 2HQ5A 1ZKGA 3M3YJ 1DU6A 1FTTA 2D5VA 5EZGA 2VUMJ 4MO7A 2HOAA 3BR2A 2CQXA 5K7HA 3W6VA 4UUSB 4W97A 1U9OA 1FTZA 3OOUA 1MSFC 3SDGA 4D5CA 1W0UA 2VPRA 2K9SA 3M4OJ 2L9RA 3GTKJ 3ZQCA 2R93J 1VF9A 5F04A 1XC5A 3RZDJ 5FLVA 2ID3A 1QPIA 3IH4A 5M5XJ 1U8BA 5EDNA 4C3IJ 1FJLA 5FKKA 1ZQ3P 5IOYA 3BR1A 2Y9YA 1IDYA 2M8GX 1AU7A 1MBFA 2HI3A 2R0QC 4A3MJ 3TW7A 5K7FA 1ETOA 1WGXA 2JMWA 1CQTA 2NS8A 1IGNA 1JJ6C 1I3QJ 1YRNA 3S15J 2FJ1A 3ZQGA 1LE8B 5E3OA 1O4XA 4J19A 5IYBJ 1MSEC 2N8GA 1K83J 3O8GA 2DA4A 1JGGA 4D7MA 5FJ8J 5FLMJ 2LKXA 4JYKA 3S1QJ 2KT0A 4FTHA 3ZOBA 1RPWA 1MBGA 1A6IA 2I10A 4BY7J 5F08A 2Y31A 4JX5A 2EH3A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1HDP A;  3PM1 A;  1H88 C;  1TWC J;  1GV2 A;  1QRY A;  2CQQ A;  1AKH B;  2O7O A;  5DTD A;  4M3B A;  5IYC J;  3GTM J;  1F36 A;  2G0E A;  2TRT A;  3LSJ A;  2MW8 A;  1ETQ A;  5FKO A;  2AO9 A;  3A01 A;  2R5Z A;  1JUM A;  3HKZ N;  2CUF A;  4A93 J;  4JX6 A;  3HBL A;  4MIM A;  3HGY A;  2ECC A;  2LP0 A;  4QSH A;  3S1R J;  2LVS A;  2FX0 A;  1BW5 A;  1JT0 A;  1I50 J;  3LNQ A;  2LFB A;  2QCO A;  2NVQ J;  1WH5 A;  2DA6 A;  1MBE A;  2GBY A;  5J1U A;  1B8I B;  3LOC A;  2XGD A;  1QVU A;  2DA3 A;  3IH2 A;  1NK3 P;  4IHY A;  4M3F A;  1OCP A;  2X6O A;  5FKN A;  1BW6 A;  3BG3 A;  4G12 A;  5IP9 J;  2ECB A;  2VKV A;  2DMN A;  1IV6 A;  3GTO J;  2XGE A;  2HOS A;  1QVT A;  1NTC A;  2DA5 A;  2NOG A;  2L7Z A;  3S17 J;  4I6Z A;  4V2G A;  3G1M A;  3BR5 A;  2LTP A;  3A02 A;  2IAI A;  4D5F A;  1U78 A;  3WHC A;  5EG0 B;  2LY9 A;  1MBJ A;  3D1N I;  2LLK A;  2XPV A;  4XIC A;  2Y0S N;  1ETW A;  2RAE A;  2EQR A;  2Y2Z A;  4XID A;  3GTQ J;  5DS9 A;  2HXO A;  1K61 A;  4A3D J;  3FIW A;  4D7N A;  2R5Y B;  2NVX J;  3S16 J;  2FQ4 A;  1OFC X;  3S1M J;  3JRG A;  4X1E A;  1RKT A;  2M2E A;  4C3J J;  3HB9 A;  3FK7 A;  4ABZ A;  2YU9 J;  4M3D A;  5HOD A;  2XSD C;  1Y1V J;  3HOU J;  1TWF J;  5EZH A;  1JUP A;  1Z77 A;  1SAN A;  5EYR A;  4EEF G;  5EF6 A;  1ZGW A;  2HOT A;  4A3K J;  4XRM A;  1ENH A;  3ZQF A;  3OIO A;  1W0T A;  1PUF A;  1G2H A;  2OF7 A;  1H89 C;  3I4N J;  1TWA J;  1FEX A;  4JX4 A;  4XRS A;  3O8H A;  5F0C A;  4FCY A;  5J1Y A;  3HDD A;  1ORK A;  3H3V K;  1E3O C;  2VI6 A;  2R92 J;  5BNG A;  5F0F A;  1ZTR A;  3S14 J;  1JTX A;  4AUX A;  5JLW A;  5C44 J;  1HF0 A;  2WB1 N;  1I6H J;  2K9N A;  3F0C A;  2E19 A;  5GP9 A;  1ITY A;  4M3G A;  3JRE A;  3JRI A;  4QIW N;  2H1K A;  1JT6 A;  3ZQH A;  2L0K A;  2M34 A;  3IV5 A;  4B1R A;  4MLO A;  3TW6 A;  2Y9Z A;  1JTY A;  3RQI A;  2XRL A;  4MFE A;  4C3H J;  4DZP A;  2LK2 A;  4C2M J;  3TED A;  4A3I J;  5IYD J;  2OPT A;  5M3F J;  1XS9 A;  4NDL A;  1ZR4 A;  2JK3 A;  1IJW C;  2JA5 J;  3C2B A;  1RKW A;  5IP6 A;  2E1O A;  3LSR A;  2TCT A;  3DCF A;  3OSF A;  4BBR J;  1WH7 A;  1GV5 A;  1GUU A;  3RZO J;  5F27 A;  1LFB A;  2KDZ A;  3CDL A;  2H8R A;  2MSY A;  2EZL A;  2YUS A;  4AC0 A;  4CYC A;  2HXI A;  3WHB A;  2JJ7 A;  1VFC A;  1SFO J;  2CU7 A;  4BY1 J;  1ETK A;  3OSG A;  2COB A;  4X6A J;  1ETX A;  1YRN B;  2B63 J;  4B3A A;  1MNM C;  3JRA A;  4LOC A;  3PO2 J;  2JA7 J;  5EGO A;  1D5Y A;  1WI3 A;  3HOZ J;  2Y30 A;  3PO3 J;  1B72 A;  1BL0 A;  2XB5 A;  3K2A A;  1ETV A;  4B4C A;  1WPK A;  5IP7 J;  4IHX A;  4Y7N J;  2DMQ A;  1VND A;  4FE4 A;  4XK4 A;  1JJ8 C;  3RKQ A;  3JRC A;  3IH3 A;  1H8A C;  5C4J J;  1X2M A;  1Z0X A;  5GPC A;  3FK6 A;  1JKP C;  3BQZ A;  2E2I J;  4GFB A;  3HEF A;  4BBS J;  3BQY A;  3TP3 A;  4FE7 A;  4UUS A;  3JRD A;  1VI0 A;  3A01 B;  2R5Z B;  3HOV J;  2YS9 A;  3QPL A;  4DYR A;  2XPW A;  5J3L A;  4BKX A;  1IUF A;  1F43 A;  3NAR A;  3SFI A;  2DMP A;  1EF4 A;  3HGG A;  1BJZ A;  2ID6 A;  3TP0 A;  3CMY A;  2X48 A;  2O8K A;  2K9Q A;  1ZR2 A;  3GTP J;  5JLX A;  5M3M J;  1JKR C;  4A3C J;  3CCY A;  3BR3 A;  3JRF A;  3B6C A;  4A3F J;  1XG1 A;  1UMQ A;  2DMU A;  3BG9 A;  3UKG A;  4M3E A;  1RES A;  1P7I A;  4MFD A;  4AYB N;  1RR7 A;  2DA2 A;  2JA8 J;  2ME6 A;  4RBO A;  2CRG A;  3ZQI A;  3JRH A;  3Q0U A;  2NVY J;  1JKO C;  2EBI A;  1TWG J;  3HOX J;  4DW6 A;  2DN0 A;  3HOW J;  3I4M J;  1A5J A;  1LE8 A;  4IEJ A;  2E2H J;  2O9L A;  4L5E A;  5C3E J;  3S1N J;  3BR6 A;  4V2F A;  2XPU A;  3GTL J;  3K7A J;  3S2H J;  2CUE A;  3Q3S A;  4DYC A;  2EZI A;  4A3B J;  1UHS A;  3S2D J;  5E3N A;  3BTI A;  5C4X J;  1IC8 A;  4W1U A;  2HDD A;  4DZJ A;  3JR9 A;  2LD5 A;  1OJL A;  3FKI J;  1UG2 A;  3Q0W A;  1NK2 P;  4M6V A;  1TWH J;  2DA7 A;  3BR0 A;  3G1O A;  1HOM A;  1LFU P;  5E3M A;  1MH4 A;  4IHV A;  2DJN A;  1FIP A;  1S7E A;  2L7M P;  3HOY J;  1PUF B;  3G1L A;  1AKH A;  2DMT A;  4RDU A;  1WCM J;  2JN6 A;  3QQA A;  1GVD A;  3CQZ J;  2EZH A;  5M5Y J;  2CJJ A;  1HDD C;  3FIS A;  1APL C;  1HLV A;  3GBG A;  2DA1 A;  1MBK A;  2IBD A;  4Y52 J;  5M5W J;  4A3E J;  1X58 A;  1P7J A;  4A3J J;  3BG5 A;  2XGC A;  1Y1W J;  1B8I A;  9ANT A;  2E2J J;  2FD5 A;  4A69 C;  3MKL A;  5EEA A;  1GDT A;  2XB0 X;  3B6A A;  1TC3 C;  2P81 A;  3E7L A;  3MVP A;  2WAQ N;  4BXX J;  3BT9 A;  2AHQ A;  4S0H B;  4I76 A;  2DTZ A;  5EG0 A;  5IPA A;  2MG4 A;  3BTC A;  2WV1 A;  2W48 A;  1IRZ A;  4UUT A;  1ETY A;  3HM5 A;  5J1R A;  3VPR A;  4A3G J;  5K7Z A;  3Q0V A;  2R5Y A;  5IOZ A;  4XRS G;  1JKQ C;  3DEW A;  3QPS A;  3A03 A;  3LSG A;  1IG7 A;  5E3L A;  3NAU A;  2VKE A;  3L1P A;  3SJM A;  4IHW A;  1BA5 A;  1HCR A;  1Q1V A;  5FKL A;  4DYQ A;  2ELK A;  1OCT C;  1MH3 A;  2GLO A;  1U9N A;  2EZK A;  2NVT J;  2PMZ N;  2L7F P;  2QF7 A;  2K40 A;  5F1J A;  2JWT A;  3GTJ J;  2R7Z J;  1GT0 C;  1JUS A;  4QTR A;  2HYJ A;  4CYC B;  2X9D A;  4A3L J;  3GTG J;  3H0G J;  2MGQ A;  2IEK A;  2NS7 A;  1IDZ A;  1X2N A;  5FKM A;  3BTL A;  5F0H A;  1MBH A;  1T56 A;  1T33 A;  2ME0 A;  4FIS A;  2M0C A;  2M9H A;  3MN2 A;  5EGO B;  5GPA A;  2GM4 A;  1B72 B;  1RET A;  1POG A;  4JP0 A;  2ZB9 A;  1ZK8 A;  4HNV A;  1AHD P;  3JRB A;  3ZQL A;  1DU0 A;  2LR8 A;  3LSP A;  3BTJ A;  1R9T J;  1FIA A;  2JA6 J;  2HQ5 A;  1ZKG A;  3M3Y J;  1DU6 A;  1FTT A;  2D5V A;  5EZG A;  2VUM J;  4MO7 A;  2HOA A;  3BR2 A;  2CQX A;  5K7H A;  3W6V A;  4UUS B;  4W97 A;  1U9O A;  1FTZ A;  3OOU A;  1MSF C;  3SDG A;  4D5C A;  1W0U A;  2VPR A;  2K9S A;  3M4O J;  2L9R A;  3GTK J;  3ZQC A;  2R93 J;  1VF9 A;  5F04 A;  1XC5 A;  3RZD J;  5FLV A;  2ID3 A;  1QPI A;  3IH4 A;  5M5X J;  1U8B A;  5EDN A;  4C3I J;  1FJL A;  5FKK A;  1ZQ3 P;  5IOY A;  3BR1 A;  2Y9Y A;  1IDY A;  2M8G X;  1AU7 A;  1MBF A;  2HI3 A;  2R0Q C;  4A3M J;  3TW7 A;  5K7F A;  1ETO A;  1WGX A;  2JMW A;  1CQT A;  2NS8 A;  1IGN A;  1JJ6 C;  1I3Q J;  1YRN A;  3S15 J;  2FJ1 A;  3ZQG A;  1LE8 B;  5E3O A;  1O4X A;  4J19 A;  5IYB J;  1MSE C;  2N8G A;  1K83 J;  3O8G A;  2DA4 A;  1JGG A;  4D7M A;  5FJ8 J;  5FLM J;  2LKX A;  4JYK A;  3S1Q J;  2KT0 A;  4FTH A;  3ZOB A;  1RPW A;  1MBG A;  1A6I A;  2I10 A;  4BY7 J;  5F08 A;  2Y31 A;  4JX5 A;  2EH3 A; 
#chains in the Genus database with same CATH topology
 3PM1 A;  2HZT A;  1QRY A;  3GWZ A;  1IRF A;  2BBY A;  3ZRG A;  4A5N A;  2E1C A;  4M3B A;  4M71 A;  5IYC J;  1F36 A;  2G0E A;  1BI2 A;  2TRT A;  1XMK A;  2AO9 A;  3OIQ A;  5JR3 A;  4HDV A;  3HKZ N;  1UAA A;  3HGY A;  4QSH A;  1LVA A;  4XOP A;  1ON2 A;  2OBP A;  3E0J B;  2VLA A;  3FHZ A;  3J7Y J;  3LNQ A;  4L9T A;  2ZBK A;  1WH5 A;  4GYG A;  2BOL A;  4L5I A;  1SAX A;  4EMS A;  1G3Y A;  2HVS A;  2DA3 A;  2H6B A;  4M3F A;  1BW6 A;  5IP9 J;  2ECB A;  1VQ8 I;  4LJZ F;  2DMN A;  2CV1 A;  2IVM A;  1YX3 A;  4G9Y A;  1IV6 A;  2GWR A;  4O3M A;  1QVT A;  3J81 Z;  2NOG A;  3S17 J;  1FP2 A;  1WJF A;  3TO7 A;  4K2E A;  2FSW A;  2LTP A;  3QPH A;  2IAI A;  1EJ9 A;  2VQL A;  3BZC A;  1W7P B;  2XPV A;  3M7G A;  2KJC A;  3CUQ A;  4LIV A;  3FM5 A;  4BEH B;  2EQR A;  2Y2Z A;  3K4L A;  1K61 A;  3M8J A;  4D7N A;  2NVX J;  1X4O A;  1DPU A;  3KP4 A;  4KN7 X;  2L9N A;  3KCC A;  3H0D A;  3VWB A;  3OS1 A;  1OFC X;  4RA2 A;  4UVB A;  2VE9 A;  1RKT A;  2M2E A;  1V55 H;  1R7J A;  2JA2 A;  2KQR A;  3FK7 A;  3FMQ A;  4ABZ A;  4HF1 A;  2FU4 A;  2VQH A;  4M3D A;  4UB8 C;  3HOU J;  1TWF J;  2CQN A;  4ZTJ A;  1SAN A;  5EYR A;  5EF6 A;  3ZP5 A;  1ZGW A;  4BE0 A;  4BS9 A;  4MEX F;  2KPM A;  1WSU A;  2P5K A;  4EJT A;  4XLF A;  1H89 C;  2EV5 A;  4JX4 A;  5BMZ A;  1SVO A;  2LBF A;  3O8H A;  4U0Y A;  4IHS A;  1ONV A;  2DK8 A;  2XAJ A;  2Z2S B;  1YJW I;  2BW3 B;  3S14 J;  5ERI A;  1JTX A;  2OUM A;  2PI0 A;  3OYH A;  1I6H J;  2R3S A;  2E19 A;  2ZME B;  5GP9 A;  4UHT A;  1XD7 A;  3RIR A;  4M3G A;  3JRI A;  4QIW N;  2G7H A;  2J5O A;  5ILS A;  3ABU A;  1VQP I;  1K4T A;  1FBQ A;  2QEN A;  3KYL A;  4B1R A;  3U9G A;  3NQO A;  5FO5 A;  1JTY A;  3DBH B;  4WXH A;  5FFX A;  3U2R A;  4U0V A;  2X51 A;  3ZPL A;  3K69 A;  4EV0 A;  5F64 A;  1T6S A;  4CCL A;  1UCR A;  2GIZ A;  4H0E A;  1BC8 C;  4G94 A;  1SFK A;  3TED A;  4A3I J;  4LD5 A;  5IYD J;  2OPT A;  2DLL A;  2QYO A;  5M3F J;  4F3Q A;  1XS9 A;  3PIP F;  3ELK A;  3G2B A;  4YIF A;  2JK3 A;  4RB1 A;  1P4X A;  2A5Y B;  5GTH C;  1IJW C;  4QLC U;  2JA5 J;  1R1T A;  3C2B A;  1RKW A;  3E6C C;  1MZB A;  2D1V A;  2E7W A;  2P6S A;  4BL0 B;  2KDO A;  4JQF A;  3LSR A;  3OSF A;  1DGR M;  2CUJ A;  3GZ5 A;  4ZH4 F;  2KIQ A;  2XAS A;  4OIO F;  2M1B A;  3RZO J;  3I58 A;  3COA C;  1BOA A;  2DFI A;  2KDZ A;  1G6N A;  1D0Z A;  2H8R A;  3DPU A;  4CYC A;  1PYV A;  2KZV A;  2RNJ A;  1ZRC A;  1VFC A;  1R00 A;  3OSG A;  2V4J C;  3DLA A;  2CW8 A;  4BJ5 C;  2W7N A;  4LG0 B;  4XLE A;  2B63 J;  2Q2E A;  3F6O A;  4AID A;  3OR1 C;  2KP6 A;  4LOC A;  5ICF A;  4M74 A;  2KL4 A;  1W7P A;  4IOA F;  3FMS A;  2C6Y A;  4XN0 A;  1E0E A;  2Y30 A;  1ZGA A;  2WTE A;  3MKZ A;  3CO7 C;  3K2A A;  4EJO A;  3DXJ F;  4IHX A;  2DMQ A;  2E1M C;  2QKM B;  4KIF A;  1CGP A;  2VJI A;  4I0B A;  4XK4 A;  3JRC A;  5C4J J;  2W24 A;  2BHY A;  1QBJ A;  2V79 A;  3A2K A;  1Z0X A;  1K78 B;  2WAF A;  1LQ1 A;  5GPC A;  5K5R A;  2JUG A;  4C30 A;  3ZGK A;  3V8L A;  3J80 K;  3WTV C;  1HKT A;  3HEF A;  2O3F A;  1A36 A;  1QU3 A;  2K3F A;  4FE7 A;  1PJR A;  4HQM A;  1T08 B;  3KP2 A;  2Q0O A;  3GCM A;  3GF2 A;  3OYN A;  3JRD A;  3R60 A;  1J7K A;  4B43 A;  2PLY A;  5LEJ A;  4L0Z B;  3FMR A;  4H4K C;  5J3L A;  2VC0 A;  3DPT A;  4BYY A;  5LLQ A;  1IUF A;  2CO5 A;  5CVV A;  1CF7 A;  1EF4 A;  2L3D A;  1K79 A;  1ZRD A;  4MQ9 F;  2JVH A;  2ID6 A;  3HYI A;  2K9Q A;  1ZR2 A;  4BHP A;  2ZJR F;  4PFP A;  4OAY A;  1MDM A;  5K5O A;  5TIS C;  4HW0 A;  3ERE D;  5HLT A;  4M3E A;  1RES A;  2WY8 Q;  3MEX A;  5FRO A;  3UR3 C;  2JA8 J;  3ZQI A;  2WBM A;  3JRH A;  1ACI A;  4FX4 A;  3C1D A;  3V4G A;  1TWG J;  3HKZ A;  2RDP A;  2CWE A;  2CW7 A;  4ZZD A;  1E3H A;  5ICE A;  2UXX A;  1RR8 C;  3LSH A;  2E2H J;  2DBB A;  1RZ4 A;  5C3E J;  1IXC A;  1MW7 A;  3Q5F A;  3ISP A;  5LGT A;  3QYE A;  3S2D J;  5E3N A;  3BTI A;  1P4W A;  2JTV A;  3I59 B;  5ICC A;  2DOA A;  1KU3 A;  3F8M A;  2PMU A;  2M5W A;  1RUO A;  2HDD A;  1D0X A;  1R5G A;  2LD5 A;  2P7V B;  5FGM A;  3VYU B;  4V19 K;  1MMD A;  1NK2 P;  2DA7 A;  1A04 A;  5E3M A;  3MD2 A;  3JCU C;  2DJN A;  1S7E A;  4PZJ A;  4U0W A;  4CHU A;  2X6W A;  3QQA A;  5J4V A;  3OYM A;  3ZN0 A;  5HS7 A;  2BY0 A;  4EQQ A;  1GVD A;  2CV2 A;  5M5Y J;  1HDD C;  4LG0 A;  1APL C;  1RIO H;  2E35 A;  4ZYG A;  1MBK A;  3CCJ I;  2IBD A;  4B09 A;  3ZMZ A;  1P7J A;  1G59 A;  2FBI A;  4NBQ A;  4LLG F;  1UHM A;  3DFG A;  1EH7 A;  1UEL B;  3I5U A;  5DCM A;  1WHU A;  3X2Q H;  2LRE A;  1IRX A;  2FD5 A;  4ZZL A;  3DKW A;  3MKL A;  5D5X B;  1GDT A;  1IN8 A;  1V5G A;  4RMN A;  3E7L A;  3MVP A;  4BXX J;  3BT9 A;  2BVL A;  3CF5 F;  1FT9 A;  2STW A;  4UY8 I;  1MND A;  1Z91 A;  1T8I A;  1PUE E;  2HDC A;  2HPI A;  4ZTF A;  2R7F A;  4OMZ A;  3OYK A;  2HVQ A;  2WV1 A;  1XSD A;  1TW3 A;  1WZ2 A;  1ETY A;  4IPA A;  1XN7 A;  2PJR A;  1X3U A;  3MZ8 A;  2DFF A;  5K7Z A;  1HW1 A;  3Q0V A;  3CP8 A;  1DUX C;  2R5Y A;  1JKQ C;  4XRS G;  3WTS C;  3KET A;  4IHW A;  4XNF A;  4CYD A;  4XSZ F;  1Q1V A;  2L4M A;  4DYQ A;  1TQI A;  2AS5 F;  3FDY A;  2KRF A;  4IXA A;  4ENM A;  3LQR A;  2HFH A;  3HPH A;  4ETS A;  3GTJ J;  1YLF A;  2E1M B;  2XGX A;  3L2U A;  2OTJ I;  3OR2 C;  3PNY A;  3BTL A;  4HRI A;  4HNT A;  1OR7 C;  3K1M A;  2GAU A;  2P0W A;  1LNW A;  4FIS A;  2BE5 F;  1Z1D A;  4XBF A;  3WU2 C;  4BE2 A;  1RUN A;  3MN2 A;  2COM A;  2FE3 A;  3ZQQ A;  4EVI A;  3R6S A;  3O6B B;  2W85 A;  1W1W E;  2XKO A;  1B72 B;  1RET A;  2E1N A;  3CCM I;  4JP0 A;  4KT5 C;  4HNV A;  1AHD P;  2PG4 A;  2W00 A;  2LR8 A;  4PFO A;  3LA2 A;  4BQQ A;  4KYW A;  5E79 C;  5DM7 F;  5AIP A;  4AU7 A;  2IS6 A;  1QHH D;  1R9T J;  1P4A A;  1N75 A;  1YW8 A;  2UWM A;  3BPX A;  1DU6 A;  2A3S A;  2VUM J;  2EFO A;  1NH3 A;  1P9Q C;  1IF1 A;  1EH8 A;  3W6V A;  4MHG A;  4HG2 A;  4W97 A;  3DV8 A;  2DT5 A;  4E7Z A;  3FBI B;  4D5C A;  3DWL E;  3CCQ I;  2GOX B;  2YR2 A;  2ZNZ A;  5CVR A;  3B73 A;  4GGG A;  2FXA A;  3GTK J;  2DFE A;  2R93 J;  1VF9 A;  2X85 A;  4I09 A;  3RZD J;  3K6G A;  1ZG5 A;  1XGS A;  4I7H A;  4EM1 A;  1BR4 A;  1QPI A;  2VJ5 A;  3H5A A;  1X1A A;  2LKP A;  5M5X J;  1TT5 B;  5EDN A;  3OY9 A;  2V1X A;  1W36 C;  2I5U A;  2OC6 A;  5IOY A;  1MNE A;  3PSI A;  1IDY A;  2GIV A;  1U5T A;  4RLQ A;  4B8X A;  1LPQ A;  3OL3 A;  2HPM A;  2M7A A;  1O57 A;  3V7R A;  1HXD A;  4UXN A;  4I98 B;  2NS8 A;  3IWZ A;  2A69 F;  3BWG A;  3MKY B;  3HRM A;  2NS0 A;  3S15 J;  4ON0 A;  1MMN A;  1IXR C;  1HC8 A;  4BU2 A;  1WFX A;  4LFU A;  1O4X A;  2DPD A;  5EEH A;  4J19 A;  5IYB J;  5D5U B;  1FSH A;  3VB2 A;  3QOD A;  2VB6 A;  1XTA A;  4D7M A;  4FAS D;  1LUJ B;  3HSE A;  5FLM J;  1FMW A;  1OYI A;  1ZGJ A;  5JHF A;  4JYK A;  5DV5 A;  2M4K A;  4XKC A;  2VBW A;  2AXT C;  2K02 A;  3TOB A;  3DLL F;  1ODD A;  4FTH A;  3MKW B;  1WQ2 A;  1A6I A;  3FXU A;  5E8I A;  2GA1 A;  4L9N A;  1UFM A;  2I10 A;  3KP3 A;  1BC7 C;  1H88 C;  2CQQ A;  4CDG A;  1DGW Y;  2F5D A;  1AKH B;  2FML A;  3QAH A;  3MAJ A;  3N4M A;  3GTM J;  3LSJ A;  2R7U A;  2MW8 A;  1REP C;  1ZRF A;  2F2E A;  3A01 A;  4JX6 A;  1Y8Q B;  3W2A A;  4RB0 A;  2EIJ H;  3IWF A;  2FX0 A;  3PUB A;  4N4N B;  3RQ4 A;  1TNS A;  5J6X A;  3OYL A;  1BW5 A;  3RPQ A;  4UUV A;  3M1E A;  5E8G A;  2R7D A;  2QCO A;  1TBX A;  3IKT A;  4PK4 A;  1ON1 A;  2GBY A;  2NRA C;  5J1U A;  2EA4 A;  1GHC A;  1S9H A;  4KIS A;  3A0B C;  1T95 A;  4BQN A;  1JXS A;  2M8E A;  5FKN A;  4R8H A;  1HBX G;  1J9I A;  1BJA A;  5HDK A;  3GTO J;  2HOS A;  3AG2 H;  2L7Z A;  1OCZ H;  3BJA A;  2K5C A;  3G1M A;  2PX9 A;  3M1C A;  4BNC A;  4IQJ A;  2MC3 A;  3TOA A;  3DBR B;  1ZYR F;  3WHC A;  4D5F A;  5EG0 B;  5BPI A;  4L9V A;  3WU0 A;  1IV8 A;  1OKR A;  1RI7 A;  2K27 A;  2LLK A;  2Y0S N;  2ELJ A;  1ETW A;  3GTQ J;  5HDN A;  1V5E A;  4CZZ A;  3G73 A;  2D45 A;  2F5E A;  1SFE A;  5D4S A;  3CES A;  4A3D J;  1Y8R B;  2XHK A;  3SYT A;  3S16 J;  1I1S A;  3ECH A;  3U1D A;  3IL2 A;  1J75 A;  2ISZ A;  2DAO A;  5IT3 A;  3OV8 A;  5FD6 A;  4M72 A;  4KIB A;  3OS0 A;  1I1G A;  1Y6I A;  3FXQ A;  2YU9 J;  3C2H A;  3ASN H;  3G4S I;  3G71 I;  3PUF A;  3REO A;  5EZH A;  1QA6 A;  1JUP A;  5DM6 F;  4A3K J;  3I64 A;  3ZQF A;  4ENN A;  3QYF A;  1QO0 D;  2MLG A;  1PUF A;  1G2H A;  2P7C B;  1SC7 A;  4RAY A;  4A0Z A;  3VOE A;  3VYR B;  2R4G A;  2EFP A;  2B7E A;  4XRF A;  3FXR A;  1OYW A;  3ZR8 X;  5J1Y A;  1LFP A;  1MMA A;  3WG7 H;  1E2X A;  4OIP F;  2R92 J;  5BNG A;  2W57 A;  1G3W A;  1WI9 A;  4AUX A;  2L7K A;  5KVR A;  5JLW A;  4FQG A;  4AM3 A;  3L2V A;  3HUG A;  4J01 A;  1YW7 A;  2K9N A;  3F0C A;  5LBQ A;  2HWV A;  4KUM A;  2V9K A;  3EPZ A;  1ITY A;  1W7P D;  5GTI C;  1V54 H;  3MWM A;  1JT6 A;  2HKO A;  4HF0 A;  3U21 A;  2E7X A;  3ULQ B;  3GME A;  2ZKZ A;  1HA8 A;  3K4C A;  3CF2 A;  5FRM A;  2DXI A;  2ZSI B;  1T0F A;  3L09 A;  4AIK A;  3TW6 A;  2Y9Z A;  5KNL A;  4PJM A;  3R0J A;  3VDX A;  3RQI A;  3CME I;  1Z21 A;  1O3Q A;  1FYM A;  2LK2 A;  2L54 A;  4PDK A;  2RV8 A;  2UV1 A;  3SHF A;  3H3U A;  1W5T A;  1O3S A;  1X1C A;  3M8E A;  1ZR4 A;  2HGC A;  5IY5 H;  1TP4 A;  5L3G A;  5J8C A;  1EH6 A;  4RGR A;  2DU9 A;  1VZ0 A;  2FNP A;  4OIN F;  5E1X A;  1MD0 A;  3CLQ A;  3HXL A;  3CLO A;  4BBR J;  2M30 A;  1WH7 A;  1GV5 A;  1GUU A;  3J80 Z;  5F27 A;  4A0Y A;  1F5T A;  2HOE A;  1LFB A;  1FX7 A;  2A6H F;  3GFI A;  3OMY A;  3TL4 X;  4Z6Y A;  1EA3 A;  4A12 A;  4RM2 A;  2EZL A;  3MCZ A;  1X1B A;  3WHB A;  2JJ7 A;  4BHB A;  4BY1 J;  1ETK A;  1BN5 A;  3MMY B;  5CVU A;  3T0Y A;  1ETX A;  3IAS 2;  4XKW A;  5DUK A;  1T38 A;  2DCE A;  2LRD A;  1DPR A;  3ONQ A;  5HOO A;  1J2X A;  2KIU A;  1FZP B;  5HS9 A;  2BVM A;  2FOK A;  2H09 A;  2QQA A;  1W5S A;  1BL0 A;  5FFZ A;  5J4Y A;  4B4C A;  5TJJ A;  1X1D A;  4S04 A;  1OYY A;  4Y7N J;  3CMA I;  2IRF G;  1ERD A;  2M87 A;  2LOO A;  4CH7 A;  4FE4 A;  4HLY A;  1JJ8 C;  1R36 A;  2WV0 A;  6PAX A;  2CMP A;  2UUZ A;  2O0Y A;  3W3C A;  2GA2 A;  2XKP A;  3I71 A;  2FBH A;  4DOZ A;  3BQZ A;  3V42 A;  4LB5 A;  2LH9 A;  1WJ5 A;  2HDW A;  4UUS A;  4ZYA A;  2R5Z B;  3CCL I;  3HOV J;  2YS9 A;  3OYC A;  2F5C A;  4JOM A;  4DYR A;  2IJL A;  3JTH A;  1TL8 A;  4IHT A;  3TDU C;  1F43 A;  3NAR A;  4AVZ A;  3I54 A;  3DQV C;  2DMP A;  1HKQ A;  3ZMV A;  1NHA A;  1B4A A;  1BJZ A;  1SD5 A;  3TP0 A;  5JVG F;  2ADU A;  2V6C A;  3K4M A;  2O8K A;  1FOW A;  2IS4 A;  3GTP J;  5B5E C;  5JLX A;  4A3C J;  1N25 A;  3H9Q A;  3CCY A;  1BI3 A;  2W84 A;  3BR3 A;  2IPQ X;  1X19 A;  4A3F J;  1Z05 A;  1UMQ A;  3I56 I;  1TTY A;  3UKG A;  4UB6 C;  2QGU A;  4CUG A;  2CRG A;  1MMG A;  2K3P A;  2K9M A;  1T2K A;  4GRI A;  1F1Z A;  2OU2 A;  4ZC3 A;  2EBI A;  2CYY A;  3HOX J;  3OYB A;  1N78 A;  4U88 A;  5KHD A;  2FEZ A;  1Z67 A;  1LE8 A;  4B48 A;  3I53 A;  4M9X A;  3W2V A;  2BGC A;  3BR6 A;  5GAE J;  4L0Y B;  1NG7 A;  2O61 A;  2L2O A;  5GAG J;  1X3Z B;  1YHQ I;  1UHS A;  5AIQ A;  4QPQ A;  4RLF A;  1SD4 A;  1T39 A;  3C3W A;  3ASO H;  1S29 A;  1FSE A;  1Z3Y A;  2IGN A;  4XM3 A;  2MD5 A;  3SDB A;  4DZJ A;  4KA4 A;  4Q5S F;  5GAH J;  2JRT A;  3G6E I;  4ESB A;  4E7L A;  3EUA A;  3PNV A;  4UV9 A;  4FET A;  3RKX A;  2QA4 I;  3BR0 A;  4BJ6 C;  4HQE A;  1LFU P;  2L7M P;  2RVC A;  2IT0 A;  2Y0S A;  3G1L A;  2DMT A;  1B9M A;  1R23 A;  1WCM J;  2HTJ A;  3F72 A;  4Y33 A;  2DO7 A;  2VBZ A;  3GUD A;  3JAM Z;  2NNY A;  2W25 A;  3FIS A;  4E7I A;  2JQ7 A;  3CCS I;  2HKX A;  2X1D A;  4Y52 J;  5M5W J;  2XAG A;  4A3E J;  2DOE A;  1X58 A;  3P9I A;  3RYR A;  3RI4 A;  1H9G A;  3QP6 A;  3ZXS A;  2ACJ A;  2OA4 A;  4AIH A;  3HHG A;  4OU0 A;  3RYP A;  2DK5 A;  4FX0 A;  3FZV A;  3GFL A;  5K1Y A;  4A69 C;  3CCU I;  2XB0 X;  2WC2 A;  4BE1 A;  4DNC A;  1ZG1 A;  4NHJ A;  1FC3 A;  1YYV A;  2P81 A;  2QSH X;  2R7R A;  1Z6R A;  3TO6 A;  3I0T A;  1ZAO A;  2FRH A;  1SAU A;  2M45 A;  2MG4 A;  2V26 A;  2HVR A;  1WWX A;  2W48 A;  4BEH A;  3C2G A;  1FOX A;  2E60 A;  3HM5 A;  3VPR A;  3K4K A;  1BOB A;  3DKX A;  2BHZ A;  1FBU A;  4PJJ A;  3BRO A;  3DEW A;  3QPS A;  1ZEL A;  4PUS A;  2XF5 A;  4C9Y A;  1FMV A;  1IG7 A;  3SJM A;  2XF6 A;  2HR3 A;  2QQ9 A;  2XC7 A;  4KJZ A;  1LB2 A;  3SQN A;  5FKL A;  2ELK A;  1OCT C;  4HAM A;  2NVT J;  3G3Z A;  4BAC A;  2QF7 A;  1ULY A;  3BCB A;  1U6G A;  5F1J A;  3UNG C;  2JWT A;  1YI2 I;  2KLO A;  5FLX Z;  2MLK A;  4GDF A;  1JUS A;  3A1Y A;  3GTG J;  5A2Q K;  4M6X A;  1YO5 C;  3BY6 A;  2IEK A;  3ERM A;  4XON A;  3WE2 A;  1GXQ A;  1IUY A;  1IDZ A;  1X2N A;  1JHH A;  3KX2 A;  5F0H A;  3EYY A;  1VQ7 I;  1PP7 U;  4ESJ A;  1ZRE A;  3AAF A;  3BG7 A;  2QVO A;  4MNU A;  3F8B A;  1XX5 A;  2BW3 A;  1WJC A;  5EGO B;  2YSR A;  4RAG A;  2ZFW A;  3WTZ A;  4CA0 A;  5H6R A;  2PQ8 A;  3PL8 A;  2ZB9 A;  1WJD A;  2DQL A;  3JRB A;  4KIG A;  4L18 B;  2XSJ C;  2ZME A;  3BTJ A;  2E5Z A;  2FBK A;  2CG4 A;  1FIA A;  4HV6 A;  1P92 A;  4DIQ A;  2HQ5 A;  1ZKG A;  3M3Y J;  5D5W B;  1O7L A;  1U3E M;  1KQ8 A;  3ECO A;  3OYD A;  1MIJ A;  3NWS A;  3SEQ A;  3DPL C;  3V8J A;  4XLH A;  1YFH A;  2CQX A;  5H6Q A;  1W5C C;  2IXS A;  4GXO A;  3F3X A;  1BM9 A;  3IKV A;  4RM3 A;  1U9O A;  1V3F A;  3E5U A;  1USS A;  5LGN A;  1IRG A;  3I9V 2;  5L3F A;  2VPR A;  2K9S A;  3M4O J;  4XL9 A;  2H1L A;  3J81 K;  2R7V A;  3K4B A;  3ZQC A;  5F04 A;  2IS1 A;  3F22 A;  1EV7 A;  3LA7 A;  5FLV A;  2ID3 A;  2IP2 A;  1G4D A;  3VSL A;  1R71 A;  1G3T A;  3IH4 A;  2Z33 A;  2MH2 A;  2L4A A;  4BH9 A;  3E5Q A;  5FKK A;  1ZQ3 P;  3U1K A;  3M07 A;  3KLO A;  1R1V A;  3C18 A;  5DUI A;  5F1R A;  1HW5 A;  4N4O B;  2M8G X;  2HI3 A;  2R0Q C;  1K7A A;  2JSP A;  3TW7 A;  1B59 A;  5K7F A;  1ETO A;  2JMW A;  1H0M A;  1AWC A;  4ZJZ A;  4ENK A;  1JI8 A;  1R5H A;  1I3Q J;  2LG4 A;  3WTU C;  2EIL H;  3OL4 A;  2PBI A;  4N9H A;  5E3O A;  1F9N A;  1K83 J;  1QZZ A;  1BBY A;  2R7O A;  2EIM H;  5J47 A;  4BUP A;  3R4K A;  5FJ8 J;  1H9T A;  3LAP A;  3KP6 A;  1IN6 A;  2PEX A;  4PSW A;  2LKX A;  3IRR A;  3LMM A;  2MH9 A;  4R1H A;  1I27 A;  3ZMT A;  2VE8 A;  5E20 A;  4ASN A;  2EFN A;  3IHU A;  3FWE A;  3ZOB A;  2FNA A;  3L2C A;  4Q4Z F;  1GXP A;  2K7L A;  2KHM A;  3PIO F;  4UNO A;  5EEG A;  1GVJ A;  1XGM A;  2TDX A;  4HX7 A;  1K78 A;  2ZCW A;  3TO9 A;  2VXZ A;  4RGU A;  4BY7 J;  4M6Y A;  3CD6 I;  3KPH A;  1HDP A;  4YFN F;  2ISY A;  3CCR I;  5DTD A;  2QQ8 A;  4RB3 C;  2H6C A;  5FKO A;  4NB5 A;  2KZG A;  3RCO A;  2F4I A;  2LP0 A;  2DJI A;  3HTU A;  3SFZ A;  1BIB A;  5CYV A;  4U7D A;  1I50 J;  1VQO I;  2QZ8 A;  3VYT B;  2YX7 A;  2IS2 A;  3PNT A;  2DA6 A;  1S6L A;  2A6T A;  3S3M A;  1MKM A;  1LDJ A;  3S93 A;  1B8I B;  4IRH A;  2XGD A;  4BJT A;  3WTW C;  4ZDL A;  5JVT A;  2EIN H;  2X6O A;  3HSF A;  3K0L A;  4Q47 A;  3R0A A;  4EJV A;  3L9F A;  2LYC A;  1U8R A;  1Q1H A;  3SEZ A;  1NTC A;  4V2G A;  1TT0 A;  2GOM A;  3RPU A;  2KKO A;  1Z7L A;  5B1B H;  2OCE A;  3V7S A;  2XUB A;  2VBY A;  3E1S A;  4IZZ A;  2KRH A;  2LY9 A;  5LD2 C;  1MBJ A;  3D1N I;  4B47 A;  3HRU A;  3HIF A;  4XIC A;  3ABT A;  4ENJ A;  2VJJ A;  2VC1 A;  3LST A;  2RAE A;  3F8N A;  3L7W A;  2ZXW H;  2CH0 A;  4HLX A;  4NC7 A;  1XB4 A;  3EUH C;  2MC4 A;  3BZ6 A;  3R61 A;  3LWF A;  3BJO A;  3FM3 A;  3S1M J;  2F48 A;  3JRG A;  2V6E A;  4X1E A;  2QLZ A;  3CCV I;  3I59 A;  2QM3 A;  3HZJ A;  2L9V A;  3CJR B;  2Z1D A;  2ZJ2 A;  4HOB A;  2EB7 A;  5LFA A;  1Z77 A;  2BXZ A;  1DDN A;  2DYR H;  4EEF G;  1RC9 A;  2HOT A;  4BDZ A;  4XRM A;  4BHC A;  3K70 D;  2H94 A;  1ENH A;  1W0T A;  4A6D A;  3HC7 A;  3LA3 A;  3S2W A;  2OF7 A;  2WAD A;  3DF8 A;  3S3O A;  1X3W B;  1O7F A;  3I4N J;  1FEX A;  3J7Z I;  3QYB A;  4FCY A;  4G6T B;  5CLS A;  1ORK A;  2PJP A;  2VI6 A;  5F0F A;  3HRT A;  2V1U A;  3LSI A;  2BV6 A;  2A05 A;  1A35 A;  2JPB A;  3WE3 A;  2K9L A;  2RNG A;  3KLN A;  4TV7 A;  2VT2 A;  4HYE A;  3QOE A;  3HHH A;  1X1P A;  4P1W A;  4U87 A;  3JRE A;  1SFU A;  3FKJ A;  4G6D A;  1WJB A;  4DBR A;  2CQK A;  2X6Y A;  5D4R A;  3CC4 I;  5H20 A;  3ZCO A;  2BY1 A;  2A07 F;  3TMO A;  4IOC F;  3FF5 A;  4XKB A;  2XRL A;  4MFE A;  4C3H J;  4RB2 C;  5CQG A;  3H9G A;  3T8T A;  3KFW X;  3KE2 A;  2W4S A;  4C2M J;  5D8L B;  3S8P A;  1XMA A;  4XKV A;  2H8W A;  3JTG A;  5IP6 A;  4KDP A;  1I5Z A;  1Y0N A;  4E70 A;  2DPU A;  1D5V A;  5B3S H;  3DCF A;  2ESH A;  2VOO A;  5HDG A;  2BXY A;  2CFO A;  2R7S A;  2Y75 A;  5B1A H;  3NEU A;  4MQV A;  5CQE A;  4WWC A;  3WTY C;  1L0O C;  2GZW A;  4XLA A;  4AC0 A;  2YUS A;  4CGZ A;  5KCM A;  3HL2 A;  5BS6 A;  1SFO J;  1QZE A;  4ZYH A;  3DEU A;  4X6A J;  1DP3 A;  1YRN B;  1B1B A;  4B3A A;  4E7H A;  1MNM C;  1ZN2 A;  3JRA A;  3PO2 J;  2AXL A;  2JA7 J;  2CQ7 A;  2L02 A;  1D5Y A;  1WI3 A;  4L5J A;  2ICW G;  2VT3 A;  1YJN I;  1B72 A;  4YII A;  1WPK A;  4CZC A;  5IP7 J;  1VQ6 I;  2X6X A;  1YE9 A;  3KIO A;  1W36 D;  1VQ9 I;  4U7B A;  2FQ3 A;  3IUO A;  1D1B A;  1JHF A;  2VPL A;  3ML6 A;  2MFZ A;  3RKQ A;  3IH3 A;  1H8A C;  2OQG A;  1UHW A;  3S32 A;  3V8K A;  5JFR A;  1ZH5 A;  3HOT A;  3WGG A;  3DU6 A;  5KK1 A;  3F6V A;  4HNU A;  3ABK H;  5ILV A;  5FD5 A;  4GFB A;  3TP3 A;  2XAU A;  3JW4 A;  3CJQ B;  1VI0 A;  5CPR B;  3QPL A;  2Z5U A;  1Y0U A;  4NC6 A;  1B6A A;  4BKX A;  3LL7 A;  2IA2 A;  1GLN A;  3GVA A;  3QRF F;  3W6J B;  2QSF X;  1VQL I;  3HGG A;  4WXD A;  3K2Z A;  5HLH A;  3CMY A;  2X48 A;  3GFM A;  3QU3 A;  3HOS A;  1S72 I;  2M7B A;  2R7W A;  5M3M J;  3JRF A;  2CW0 F;  1XG1 A;  4GYI A;  1P7I A;  1RR7 A;  2V1D A;  1XDU A;  2ME6 A;  4RBO A;  3KP7 A;  4IKF A;  2NVY J;  3KZY A;  1JKO C;  4B44 A;  4DW6 A;  2QSG X;  1IXS B;  3FXO A;  4N0B A;  4HF2 A;  1LDD A;  2ZJP F;  4BAY A;  3I3L A;  3HOW J;  1A5J A;  4LGW A;  5L3B A;  2OCC H;  5HVQ C;  2O9L A;  3DEE A;  3S1N J;  4V2F A;  2QBY B;  2P8T A;  1IW7 F;  3K7A J;  2B0L A;  2CUE A;  2MD0 A;  3N05 A;  2EZI A;  3Q3S A;  3T8R A;  3DKY A;  4DYC A;  1SFX A;  2M0M A;  4QWQ A;  5C4X J;  4W1U A;  1FOK A;  3JR9 A;  3WTX C;  5CVI A;  2EV6 A;  3F8F A;  3FKI J;  2VXD A;  2K85 A;  3VEP A;  4BDY A;  2DT7 B;  3Q0W A;  2HZD A;  4M6V A;  3DTE A;  1QZY A;  1TWH J;  3G1O A;  2GXG A;  4D9J A;  1HOM A;  2XAQ A;  1BR2 A;  1YW9 A;  2K86 A;  3H35 A;  3BZK A;  4CCO A;  3HOY J;  5HNF A;  1AKH A;  2JN6 A;  3GEZ A;  2K4B A;  2WA0 A;  3D5S C;  4I02 A;  3HG9 A;  2KRC A;  2LBF B;  2AQE A;  2CJJ A;  5E18 F;  1G8X A;  1HLV A;  2NYX A;  3FXL A;  1DQU A;  5L3C A;  2HYG D;  1HSJ A;  3BG6 A;  1HW2 A;  1WJA A;  4HEA 2;  2EV0 A;  3J7A O;  2VN2 A;  3BG5 A;  5E1W A;  9ANT A;  2E2J J;  4B3X A;  4RAF A;  4CCK A;  5B66 C;  4LB6 B;  3VFZ A;  3H9J A;  1FYL A;  3ZMD A;  5IT9 K;  2X0L A;  2Y0M A;  1OMI A;  1U2W A;  3B6A A;  1Y39 A;  2P6T A;  1NG6 A;  1KYZ A;  2WAQ N;  4EGZ A;  2EFQ A;  3LAJ A;  3HRS A;  3WGI A;  2HU9 A;  5EG0 A;  1BI1 A;  1OQY A;  2LDU A;  4G7H F;  5HLG A;  4CO8 A;  3TQN A;  5D6F A;  1IRZ A;  4UUT A;  3IRQ A;  4XLC A;  2VQG A;  3EET A;  4HST A;  4I99 C;  1KON A;  3KEO A;  3H3Z A;  2MBF A;  2XRO A;  4PGG A;  2IGO A;  1OR7 A;  3A03 A;  3LSG A;  2YX4 A;  3HTS B;  5E3L A;  1YS7 A;  2VKE A;  3NAU A;  4HA8 A;  4CCJ A;  1HQC A;  3ROU A;  3WOD F;  3T5X A;  2MAB A;  3IC7 A;  4RGS A;  2XVC A;  3P7N A;  2CGP A;  2GLO A;  1U9N A;  1TW2 A;  2PMZ N;  3EUH A;  3PFI A;  1GT0 C;  4CYC B;  3MQ0 A;  1DP7 P;  3CZ6 A;  4A3L J;  4RGX A;  4NUB A;  4IO9 F;  1XDS A;  3OYE A;  3H0G J;  2HS5 A;  4IRI A;  2RGV A;  5FKM A;  1QPM A;  1XGN A;  2VKH A;  1MBH A;  2O5R A;  2Z16 A;  2Q2E B;  5LRR A;  1T56 A;  1S8N A;  2ME0 A;  2W1O A;  3KP5 A;  4F93 B;  2M0C A;  1XCB A;  1VQ4 I;  3PQJ A;  3DTI A;  2A5W A;  5GPA A;  2GM4 A;  2B9S A;  1POG A;  3FHN A;  1ZK8 A;  4P5O A;  1YIO A;  2QBY A;  3TBI A;  5LHH A;  1N77 A;  2MYS A;  1MMS A;  3GZN B;  1ZAR A;  1Z7U A;  2DTR A;  3WG9 A;  4YEL A;  5DD4 A;  4HDU A;  5D6E A;  4E4H A;  3OYA A;  2VON A;  4MO7 A;  2OZ6 A;  2IA1 A;  4M9Z A;  1C0W A;  3TDZ C;  2F5F A;  3BR2 A;  5K7H A;  5ILU A;  1FLI A;  2Q1Z B;  4IX7 A;  3PSF A;  3VYS B;  3GLX A;  2RC4 A;  1SVL A;  3O2P E;  4BQA A;  2EJR A;  4L9J A;  3OYG A;  3FX3 A;  1VQ5 I;  1W0U A;  1A6Q A;  3H36 A;  4XQF A;  1JE8 A;  2ZFU A;  4DQ2 A;  2L9R A;  2O6G E;  2X4H A;  2AQF A;  1CF7 B;  2OZU A;  2NXN B;  2Z3Y A;  4OMY A;  1T98 A;  3B02 A;  1SEU A;  1JGS A;  3K1N A;  4KMF A;  1MDM B;  4E7S A;  3BR1 A;  5FRN A;  1FP1 D;  5EJC A;  5DDG A;  1MBF A;  3T1B A;  1MJ9 A;  4XMY A;  3EUK L;  1CQT A;  1IGN A;  1FNN A;  3TKY A;  4Y4R A;  2FJ1 A;  1J59 A;  4P96 A;  2O03 A;  4G7O F;  4PSX A;  4PJN A;  3BDD A;  3RPU D;  3QOP A;  5DEQ A;  1MSE C;  4ITV A;  3ABL H;  3F8C A;  3O8G A;  1Z6T A;  1JGG A;  4ZDO A;  4BGD A;  3LFU A;  2E71 A;  4BXU A;  2ZC2 A;  3S1Q J;  2DYS H;  2KT0 A;  3BPV A;  1TZL A;  5BPD A;  2V7F A;  1BIA A;  1U5T C;  3AFH A;  1W4M A;  2H27 A;  1RPW A;  1MBG A;  2PFB A;  4YFX F;  1J0R A;  3WTT C;  3ZMU A;  2EWN A;  2D5V A;  3J7A Y;  2EH3 A;  1TWC J;  1GV2 A;  2O7O A;  1SMY F;  2VKD A;  3KYD B;  3L2Q A;  1ZHF A;  3L2R A;  1ETQ A;  2EA2 A;  2DT6 A;  2R5Z A;  1JUM A;  4A93 J;  2CUF A;  1S5L C;  3HBL A;  4MIM A;  3S1R J;  2ECC A;  3H92 A;  4HZF A;  1RRJ A;  2IA0 A;  2IGK A;  2LVS A;  4NQW B;  2VOD A;  2VIX A;  1JT0 A;  2R7X A;  4MTE A;  2LFB A;  2NVQ J;  2G9W A;  1MBE A;  2QWW A;  2JSC A;  3EDP A;  2IW5 A;  4XOT A;  3F23 A;  1VTN C;  4DGW B;  3LOC A;  5K5Q A;  1QVU A;  3IH2 A;  4RAZ A;  1NK3 P;  4IF4 A;  5DCM B;  4IHY A;  1D8J A;  1SD6 A;  2F6C A;  1OCP A;  1P2F A;  3BG3 A;  4G12 A;  3GLL A;  5BQT A;  2F4M B;  2VKV A;  3SZP A;  2Y48 A;  2XGE A;  4Y3O A;  1I3A A;  1OCO H;  2DA5 A;  4CCM A;  2GXA A;  3JSP A;  4I6Z A;  2LC2 A;  1E17 A;  4N9I A;  3BR5 A;  3QPT A;  3MZH A;  2A6E F;  4OIQ F;  2WAE A;  1V4R A;  3A02 A;  3SZT A;  1U78 A;  2KIS A;  2M4G A;  3Q9V A;  1RNL A;  1XMX A;  4XLP F;  4XID A;  1L3L A;  2L01 A;  4DBQ A;  2PJR B;  1SMT A;  2ZXI A;  3VOD A;  3GO5 A;  5DS9 A;  3FXM A;  2HXO A;  4PCQ A;  2Z99 A;  3FIW A;  3E3V A;  3OYJ A;  2NOJ B;  2ELH A;  2FQ4 A;  2R5Y B;  2P5L C;  3CC2 I;  4I0A A;  4F55 A;  1WVR A;  4C3J J;  5DYM A;  3HB9 A;  3EYI A;  1XPX A;  2GQQ A;  2O8X A;  5HOD A;  3LSK A;  2XSD C;  5LGU A;  1Y1V J;  2NNN A;  4WK8 F;  2RKH A;  3CJT B;  2JRM A;  3HJE A;  2WAQ A;  2NVU B;  4YIR X;  3BLY A;  4IQ4 A;  2L5Q A;  4JK1 X;  4LIT A;  2JUC A;  5LHG A;  3OIO A;  2ETH A;  2EPF A;  4S05 A;  4OOI A;  1R22 A;  4KT6 A;  1YIT I;  4KFC A;  2CSO A;  2ZNY A;  1TWA J;  2BYV E;  2BEO A;  2FMY A;  3GYH X;  4E7K A;  4XRS A;  2DFH A;  4PGH A;  5F0C A;  4BQO A;  1ZLK A;  3HDD A;  1I39 A;  3H3V K;  1E3O C;  3BOQ A;  1O3T A;  1WKM A;  5CKT A;  5TGT A;  1ZTR A;  4P55 A;  3DU5 A;  4D1Q A;  5C44 J;  1HF0 A;  2IGM A;  2WB1 N;  5H2F C;  2JZY A;  4I2O A;  1P6R A;  3GFJ A;  2F5V A;  2HQR A;  2PMZ A;  1XSX A;  1IZ1 A;  4YRV A;  2V9P A;  2H1K A;  3ZQH A;  2L0K A;  4YFK F;  2M34 A;  3IV5 A;  3IAM 2;  4MLO A;  1K6Y A;  3A4C A;  3Q9S A;  2PMH A;  4LIU A;  5ICG A;  3D5R C;  2LSO A;  2HQN A;  4AIJ A;  4CSW A;  1YJ9 I;  4F91 B;  4EM2 A;  4DZP A;  2X1C A;  4II2 A;  1IN5 A;  4ESF A;  2DI3 A;  3CTA A;  4XN3 A;  5J40 A;  1B9N A;  3BP8 A;  2QQB A;  4NDL A;  1F4K A;  3KYC B;  4Y15 A;  4KMU X;  1UB9 A;  1FY7 A;  3K1P A;  3QU6 A;  1KYW A;  3RKW A;  4CIC A;  4IVN A;  2DOD A;  4EM0 B;  2E1O A;  4NQW A;  3KEY A;  2E34 A;  2TCT A;  5E1Z B;  2MA3 A;  1T0F C;  1MJB A;  2DDB A;  2Z9O A;  2ZXJ A;  2BZT A;  5LEK A;  2QKL B;  3CDL A;  2HQA A;  2KJB A;  3TGN A;  3RDI A;  2MSY A;  2K4J A;  1U5T B;  2D2W A;  2DDA A;  2HXI A;  3CC7 I;  2CU7 A;  1HST A;  3K10 A;  4PJ0 C;  2KMU A;  2COB A;  1FYK A;  1LDK B;  3OWT A;  2CUZ A;  3CP2 A;  3P5J A;  2LF7 A;  1YIJ I;  3K4J A;  2I8D A;  3AG3 H;  2V9V A;  1XGO A;  1OCC H;  1XCV A;  4MGR A;  4XR6 A;  5ED4 A;  5EGO A;  3K70 C;  3HOZ J;  2ZSH B;  3PO3 J;  4IL6 C;  5AON A;  1ZLJ A;  2XB5 A;  1ETV A;  4D0P A;  1OIS A;  4UVC A;  1K6O A;  1YTY A;  1VND A;  4YEJ A;  1YOV B;  3PQK A;  5LRS A;  3M9A A;  2VQC A;  1J09 A;  1UJ8 A;  3IP4 B;  2OV7 A;  3BCA A;  3JAM K;  2WWY A;  1X2M A;  2R7Q A;  4O5V A;  2OD5 A;  2BY2 A;  3FK6 A;  1R4M B;  4O6J A;  1JKP C;  3RJP A;  2E2I J;  2ESN A;  2DOF A;  2FA5 A;  3BJ6 A;  4DJA A;  4BBS J;  3BQY A;  3E5X A;  3NWT A;  3ZMS A;  3P9C A;  1LEA A;  4MEY F;  3BC8 A;  3A01 B;  3F21 A;  1R58 A;  1I6X A;  1R1U A;  4M9S A;  1IO2 A;  3FXK A;  4PJL A;  3GZ6 A;  2XPW A;  4UV8 A;  1SD7 A;  2RRE A;  4G8X A;  2VJ4 A;  1TQM A;  2FF4 A;  5HNH A;  2VBX A;  3H1C A;  3SFI A;  1R4N B;  1LKX A;  3LQQ A;  2FOW A;  2Y69 H;  2VL8 A;  4WCG A;  3RSN A;  5D5V B;  2L9S A;  3LSM A;  3P9K A;  4GCV A;  4OAZ A;  1JKR C;  1Y56 A;  3DTK A;  3CUQ C;  3B6C A;  4A5M A;  4R79 A;  2DMU A;  3BG9 A;  4Q48 A;  1D1C A;  3K9T A;  4Y13 A;  5L3E A;  4MFD A;  2RQP A;  2DA2 A;  4AYB N;  2CV0 A;  3AL0 C;  2A68 F;  4G7Z F;  1AOY A;  3Q0U A;  5F6F A;  1KU2 A;  4KN4 X;  1IAW A;  4C2T A;  4LLN A;  4A6E A;  2DN0 A;  2QEX I;  4WXC A;  4AWX B;  3QP5 A;  3I4M J;  2F4O B;  2J5P A;  4IEJ A;  1TNT A;  4NC8 A;  5E17 F;  2G7U A;  4L5E A;  2KIM A;  3DP7 A;  1MGT A;  3L00 A;  2XPU A;  5FLX K;  3GTL J;  1G3S A;  4EJU A;  3S2H J;  2ZO4 A;  5IT9 Z;  1YX5 A;  4GO1 A;  1S7A A;  4KIC A;  2HYF A;  2JT1 A;  3H5N A;  1IC8 A;  2UZK A;  3CJN A;  3RTR A;  3CDI A;  5CJ9 A;  4IRG A;  1OJL A;  1UG2 A;  1UG0 A;  3I4P A;  2V1N A;  1ZG3 A;  4IJA A;  5KAI C;  4EGY A;  1OLT A;  5TRD A;  1VQN I;  4KIT B;  4A2U A;  1PP8 F;  1STZ A;  1MH4 A;  4IHV A;  3SZG A;  1FIP A;  2EIK H;  1Z3X A;  2HNH A;  1PUF B;  1R5I D;  3ZN1 A;  5D8K B;  1R49 A;  2JPC A;  4RDU A;  4J00 A;  3CMM A;  2DW4 A;  3KEQ A;  3CQZ J;  2EZH A;  3A0H C;  4F7Z A;  2OQR A;  1D0Y A;  1SVM A;  3EQL F;  4LG3 A;  4P9F A;  3PFY A;  3GBG A;  2STT A;  1HKS A;  2DA1 A;  2LY1 A;  1BR1 A;  5CVJ A;  4AD9 A;  2XV4 S;  1S7O A;  4UVA A;  3HUG B;  4A3J J;  2XDV A;  1QGP A;  2XGC A;  1Y1W J;  1B8I A;  2XIG A;  2WY7 Q;  1U0J A;  1O3R A;  4OWR B;  1VQK I;  5FB2 A;  1M1E B;  2HEO A;  3QWL A;  1S3J A;  4EAT A;  5EEA A;  2LKS A;  5KAF C;  3GW2 A;  3OYI A;  1KU9 A;  2X1E A;  4HV5 A;  1TC3 C;  3O3K A;  2OTL I;  3KZZ A;  3ESW B;  2XAH A;  2AHQ A;  4S0H B;  2HTS A;  3AG1 H;  4I76 A;  4F52 A;  2DTZ A;  5IPA A;  3E6B A;  5GAD J;  1AA7 A;  3BTC A;  3LFK A;  1LJ9 A;  2VAS A;  2BY3 A;  2JVG A;  5J1R A;  4A3G J;  4C2U A;  4Z2Y A;  3KZI C;  2WB1 A;  4XSX F;  5IOZ A;  1TLH B;  2M3A A;  3NRV A;  3E6M A;  4LK1 F;  3L1P A;  3CO6 C;  1BA5 A;  4A0X A;  3N97 A;  4ZYD A;  3OS2 A;  1TQP A;  2EK5 A;  1HCR A;  1MH3 A;  1BI0 A;  2EZK A;  2ZXH A;  2DQR A;  2L7F P;  3W2W A;  2K40 A;  4LK0 F;  2UXN A;  4HX8 A;  2XRN A;  2R7Z J;  2KIF A;  1UZC A;  2GXB A;  4QTR A;  2HYJ A;  2X9D A;  2MGQ A;  1D8K A;  2NS7 A;  4KNY A;  1YQA A;  5L3D A;  5JHU A;  3ZQ7 A;  1LVK A;  2A61 A;  3C7J A;  4A3B J;  3E6D A;  4MTD A;  2E36 A;  1YS6 A;  3OYF A;  1XSV A;  1T33 A;  4BXF A;  2P4W A;  1QNT A;  1A31 A;  2YPR A;  3FXJ A;  2M9H A;  5DCF A;  4XLN F;  2YU3 A;  1EKE A;  1FPQ A;  5DD8 A;  1UST A;  2LMD A;  1V5F A;  3D5L A;  3HPG A;  3ZQL A;  1D1A A;  3CCE I;  1DU0 A;  3LSP A;  4OIR F;  2LNB A;  4II3 A;  4I01 A;  4HSR A;  2CFX A;  4FHT A;  2JA6 J;  2XF7 A;  4E6K G;  3AG4 H;  1KZH A;  1FTT A;  5EZG A;  4F92 B;  1PDN C;  1LEB A;  4JBA A;  1QQI A;  2HOA A;  3FBN B;  4G6Q A;  3AKZ A;  2EFW A;  3CUQ B;  2CS3 A;  3I55 I;  5BOX A;  4RS8 A;  4AVP A;  2XAF A;  1WJE A;  2LF8 A;  2FUG 2;  2OJE D;  4UUS B;  4XOR A;  3WGH A;  4CCN A;  3AL0 B;  2E5N A;  1Z9C A;  1FTZ A;  1IN7 A;  3HSR A;  3OOU A;  1MSF C;  2W82 A;  3SDG A;  3M8F A;  2NAZ A;  3F9K A;  4ZDP A;  3V7C A;  2ZME C;  1K4S A;  3SXY A;  2PN6 A;  4P9U A;  3D0S A;  4X0G A;  1XC5 A;  2D1H A;  1KQ9 A;  3RKY A;  2KFD A;  1R6R A;  4WX9 A;  1FWZ A;  3ABM H;  2VOP A;  1FBS A;  2Q8K A;  3K4N A;  3CDH A;  1MJA A;  4LMY A;  3L2W A;  1U8B A;  3H5R A;  4C3I J;  4CXF A;  1FJL A;  3PJR A;  1KA8 A;  1D3Y A;  5J8F A;  3JSO A;  2Y9Y A;  3OOP A;  4FT8 A;  1QHG A;  5LHI A;  1AU7 A;  1PVE A;  2LY2 A;  4A3M J;  2RN7 A;  2ZJQ F;  5JI6 A;  1WGX A;  1X4P A;  5HS8 A;  3MZY A;  5HLI A;  3CUO A;  3VSK A;  1JJ6 C;  4WF2 A;  1YRN A;  4M73 A;  4NNJ A;  3ZQG A;  3GXO A;  1LE8 B;  4ANJ A;  1J5Y A;  4HBL A;  2QUF A;  2R7T A;  3MFK A;  2N8G A;  3GX4 X;  2DA4 A;  5A2Q Z;  3DBL B;  3OIP A;  1YG2 A;  1KGS A;  4LLL A;  1WRJ A;  4ZYE A;  4YG2 F;  3E97 A;  4Y17 A;  4HX4 A;  1VQM I;  1E3P A;  2OAZ A;  4AYB A;  1OCR H;  1KU7 A;  1FOY A;  4QPO A;  3W6K B;  4HPQ A;  1IN4 A;  4E7J A;  1KQ0 A;  3WU1 B;  2RQQ A;  2P5V A;  5F08 A;  4EJW A;  2Y31 A;  1OPC A;  4JX5 A;  3S3N A; 
#chains in the Genus database with same CATH homology
 1HDP A;  3PM1 A;  1H88 C;  1TWC J;  1GV2 A;  1QRY A;  2CQQ A;  1AKH B;  2O7O A;  5DTD A;  4M3B A;  5IYC J;  3GTM J;  1F36 A;  2G0E A;  2TRT A;  3LSJ A;  2MW8 A;  1ETQ A;  5FKO A;  2AO9 A;  3A01 A;  2R5Z A;  1JUM A;  3HKZ N;  2CUF A;  4A93 J;  4JX6 A;  3HBL A;  4MIM A;  3HGY A;  2ECC A;  2LP0 A;  4QSH A;  3S1R J;  2LVS A;  2FX0 A;  1BW5 A;  1JT0 A;  1I50 J;  3LNQ A;  2LFB A;  2QCO A;  2NVQ J;  1WH5 A;  2DA6 A;  1MBE A;  2GBY A;  5J1U A;  1B8I B;  3LOC A;  2XGD A;  1QVU A;  2DA3 A;  3IH2 A;  1NK3 P;  4IHY A;  4M3F A;  1OCP A;  2X6O A;  5FKN A;  1BW6 A;  3BG3 A;  4G12 A;  5IP9 J;  2ECB A;  2VKV A;  2DMN A;  1IV6 A;  3GTO J;  2XGE A;  2HOS A;  1QVT A;  1NTC A;  2DA5 A;  2NOG A;  2L7Z A;  3S17 J;  4I6Z A;  4V2G A;  3G1M A;  3BR5 A;  2LTP A;  3A02 A;  2IAI A;  4D5F A;  1U78 A;  3WHC A;  5EG0 B;  2LY9 A;  1MBJ A;  3D1N I;  2LLK A;  2XPV A;  4XIC A;  2Y0S N;  1ETW A;  2RAE A;  2EQR A;  2Y2Z A;  4XID A;  3GTQ J;  5DS9 A;  2HXO A;  1K61 A;  4A3D J;  3FIW A;  4D7N A;  2R5Y B;  2NVX J;  3S16 J;  2FQ4 A;  1OFC X;  3S1M J;  3JRG A;  4X1E A;  1RKT A;  2M2E A;  4C3J J;  3HB9 A;  3FK7 A;  4ABZ A;  2YU9 J;  4M3D A;  5HOD A;  2XSD C;  1Y1V J;  3HOU J;  1TWF J;  5EZH A;  1JUP A;  1Z77 A;  1SAN A;  5EYR A;  4EEF G;  5EF6 A;  1ZGW A;  2HOT A;  4A3K J;  4XRM A;  1ENH A;  3ZQF A;  3OIO A;  1W0T A;  1PUF A;  1G2H A;  2OF7 A;  1H89 C;  3I4N J;  1TWA J;  1FEX A;  4JX4 A;  4XRS A;  3O8H A;  5F0C A;  4FCY A;  5J1Y A;  3HDD A;  1ORK A;  3H3V K;  1E3O C;  2VI6 A;  2R92 J;  5BNG A;  5F0F A;  1ZTR A;  3S14 J;  1JTX A;  4AUX A;  5JLW A;  5C44 J;  1HF0 A;  2WB1 N;  1I6H J;  2K9N A;  3F0C A;  2E19 A;  5GP9 A;  1ITY A;  4M3G A;  3JRE A;  3JRI A;  4QIW N;  2H1K A;  1JT6 A;  3ZQH A;  2L0K A;  2M34 A;  3IV5 A;  4B1R A;  4MLO A;  3TW6 A;  2Y9Z A;  1JTY A;  3RQI A;  2XRL A;  4MFE A;  4C3H J;  4DZP A;  2LK2 A;  4C2M J;  3TED A;  4A3I J;  5IYD J;  2OPT A;  5M3F J;  1XS9 A;  4NDL A;  1ZR4 A;  2JK3 A;  1IJW C;  2JA5 J;  3C2B A;  1RKW A;  5IP6 A;  2E1O A;  3LSR A;  2TCT A;  3DCF A;  3OSF A;  4BBR J;  1WH7 A;  1GV5 A;  1GUU A;  3RZO J;  5F27 A;  1LFB A;  2KDZ A;  3CDL A;  2H8R A;  2MSY A;  2EZL A;  2YUS A;  4AC0 A;  4CYC A;  2HXI A;  3WHB A;  2JJ7 A;  1VFC A;  1SFO J;  2CU7 A;  4BY1 J;  1ETK A;  3OSG A;  2COB A;  4X6A J;  1ETX A;  1YRN B;  2B63 J;  4B3A A;  1MNM C;  3JRA A;  4LOC A;  3PO2 J;  2JA7 J;  5EGO A;  1D5Y A;  1WI3 A;  3HOZ J;  2Y30 A;  3PO3 J;  1B72 A;  1BL0 A;  2XB5 A;  3K2A A;  1ETV A;  4B4C A;  1WPK A;  5IP7 J;  4IHX A;  4Y7N J;  2DMQ A;  1VND A;  4FE4 A;  4XK4 A;  1JJ8 C;  3RKQ A;  3JRC A;  3IH3 A;  1H8A C;  5C4J J;  1X2M A;  1Z0X A;  5GPC A;  3FK6 A;  1JKP C;  3BQZ A;  2E2I J;  4GFB A;  3HEF A;  4BBS J;  3BQY A;  3TP3 A;  4FE7 A;  4UUS A;  3JRD A;  1VI0 A;  3A01 B;  2R5Z B;  3HOV J;  2YS9 A;  3QPL A;  4DYR A;  2XPW A;  5J3L A;  4BKX A;  1IUF A;  1F43 A;  3NAR A;  3SFI A;  2DMP A;  1EF4 A;  3HGG A;  1BJZ A;  2ID6 A;  3TP0 A;  3CMY A;  2X48 A;  2O8K A;  2K9Q A;  1ZR2 A;  3GTP J;  5JLX A;  5M3M J;  1JKR C;  4A3C J;  3CCY A;  3BR3 A;  3JRF A;  3B6C A;  4A3F J;  1XG1 A;  1UMQ A;  2DMU A;  3BG9 A;  3UKG A;  4M3E A;  1RES A;  1P7I A;  4MFD A;  4AYB N;  1RR7 A;  2DA2 A;  2JA8 J;  2ME6 A;  4RBO A;  2CRG A;  3ZQI A;  3JRH A;  3Q0U A;  2NVY J;  1JKO C;  2EBI A;  1TWG J;  3HOX J;  4DW6 A;  2DN0 A;  3HOW J;  3I4M J;  1A5J A;  1LE8 A;  4IEJ A;  2E2H J;  2O9L A;  4L5E A;  5C3E J;  3S1N J;  3BR6 A;  4V2F A;  2XPU A;  3GTL J;  3K7A J;  3S2H J;  2CUE A;  3Q3S A;  4DYC A;  2EZI A;  4A3B J;  1UHS A;  3S2D J;  5E3N A;  3BTI A;  5C4X J;  1IC8 A;  4W1U A;  2HDD A;  4DZJ A;  3JR9 A;  2LD5 A;  1OJL A;  3FKI J;  1UG2 A;  3Q0W A;  1NK2 P;  4M6V A;  1TWH J;  2DA7 A;  3BR0 A;  3G1O A;  1HOM A;  1LFU P;  5E3M A;  1MH4 A;  4IHV A;  2DJN A;  1FIP A;  1S7E A;  2L7M P;  3HOY J;  1PUF B;  3G1L A;  1AKH A;  2DMT A;  4RDU A;  1WCM J;  2JN6 A;  3QQA A;  1GVD A;  3CQZ J;  2EZH A;  5M5Y J;  2CJJ A;  1HDD C;  3FIS A;  1APL C;  1HLV A;  3GBG A;  2DA1 A;  1MBK A;  2IBD A;  4Y52 J;  5M5W J;  4A3E J;  1X58 A;  1P7J A;  4A3J J;  3BG5 A;  2XGC A;  1Y1W J;  1B8I A;  9ANT A;  2E2J J;  2FD5 A;  4A69 C;  3MKL A;  5EEA A;  1GDT A;  2XB0 X;  3B6A A;  1TC3 C;  2P81 A;  3E7L A;  3MVP A;  2WAQ N;  4BXX J;  3BT9 A;  2AHQ A;  4S0H B;  4I76 A;  2DTZ A;  5EG0 A;  5IPA A;  2MG4 A;  3BTC A;  2WV1 A;  2W48 A;  1IRZ A;  4UUT A;  1ETY A;  3HM5 A;  5J1R A;  3VPR A;  4A3G J;  5K7Z A;  3Q0V A;  2R5Y A;  5IOZ A;  4XRS G;  1JKQ C;  3DEW A;  3QPS A;  3A03 A;  3LSG A;  1IG7 A;  5E3L A;  3NAU A;  2VKE A;  3L1P A;  3SJM A;  4IHW A;  1BA5 A;  1HCR A;  1Q1V A;  5FKL A;  4DYQ A;  2ELK A;  1OCT C;  1MH3 A;  2GLO A;  1U9N A;  2EZK A;  2NVT J;  2PMZ N;  2L7F P;  2QF7 A;  2K40 A;  5F1J A;  2JWT A;  3GTJ J;  2R7Z J;  1GT0 C;  1JUS A;  4QTR A;  2HYJ A;  4CYC B;  2X9D A;  4A3L J;  3GTG J;  3H0G J;  2MGQ A;  2IEK A;  2NS7 A;  1IDZ A;  1X2N A;  5FKM A;  3BTL A;  5F0H A;  1MBH A;  1T56 A;  1T33 A;  2ME0 A;  4FIS A;  2M0C A;  2M9H A;  3MN2 A;  5EGO B;  5GPA A;  2GM4 A;  1B72 B;  1RET A;  1POG A;  4JP0 A;  2ZB9 A;  1ZK8 A;  4HNV A;  1AHD P;  3JRB A;  3ZQL A;  1DU0 A;  2LR8 A;  3LSP A;  3BTJ A;  1R9T J;  1FIA A;  2JA6 J;  2HQ5 A;  1ZKG A;  3M3Y J;  1DU6 A;  1FTT A;  2D5V A;  5EZG A;  2VUM J;  4MO7 A;  2HOA A;  3BR2 A;  2CQX A;  5K7H A;  3W6V A;  4UUS B;  4W97 A;  1U9O A;  1FTZ A;  3OOU A;  1MSF C;  3SDG A;  4D5C A;  1W0U A;  2VPR A;  2K9S A;  3M4O J;  2L9R A;  3GTK J;  3ZQC A;  2R93 J;  1VF9 A;  5F04 A;  1XC5 A;  3RZD J;  5FLV A;  2ID3 A;  1QPI A;  3IH4 A;  5M5X J;  1U8B A;  5EDN A;  4C3I J;  1FJL A;  5FKK A;  1ZQ3 P;  5IOY A;  3BR1 A;  2Y9Y A;  1IDY A;  2M8G X;  1AU7 A;  1MBF A;  2HI3 A;  2R0Q C;  4A3M J;  3TW7 A;  5K7F A;  1ETO A;  1WGX A;  2JMW A;  1CQT A;  2NS8 A;  1IGN A;  1JJ6 C;  1I3Q J;  1YRN A;  3S15 J;  2FJ1 A;  3ZQG A;  1LE8 B;  5E3O A;  1O4X A;  4J19 A;  5IYB J;  1MSE C;  2N8G A;  1K83 J;  3O8G A;  2DA4 A;  1JGG A;  4D7M A;  5FJ8 J;  5FLM J;  2LKX A;  4JYK A;  3S1Q J;  2KT0 A;  4FTH A;  3ZOB A;  1RPW A;  1MBG A;  1A6I A;  2I10 A;  4BY7 J;  5F08 A;  2Y31 A;  4JX5 A;  2EH3 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...