4DGWB

Crystal structure of the sf3a splicing factor complex of u2 snrnp
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
140
structure length
127
Chain Sequence
SRRDMEVIKLTARYYAKDKSIVEQMISKDGEARLNFMNSSHPLHKTFTDFVAQYKRVYSFTGQEIKKSKRTILDNCFERTQYWEFEKDKDREHDKLVELCKIQFAAIPWDKFTQVAKFDLEQMRLRR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Splicing
molecule keywords Pre-mRNA-splicing factor PRP9
publication title Structure and assembly of the SF3a splicing factor complex of U2 snRNP
pubmed doi rcsb
source organism Saccharomyces cerevisiae
total genus 33
structure length 127
sequence length 140
ec nomenclature
pdb deposition date 2012-01-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF01805 Surp Surp module
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.790 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Arc Repressor Mutant, subunit A 4dgwB01
1X4PA 1UG0A 2E60A 1X4OA 4DGWB 2DT7B 2E5ZA 2DT6A
chains in the Genus database with same CATH superfamily
3ZMZA 1GDTA 1OR7C 2MG4A 3G2BA 4XNFA 2O8XA 2WAFA 2FNPA 2YX4A 3CO6C 4BXXJ 2Z5UA 3TO7A 3N05A 4C30A 3QWLA 3NWTA 3M1EA 1WJAA 4NNJA 1LFPA 1WRJA 1FMVA 2EZIA 2DO7A 2OUMA 3EQLF 4D5FA 2E5NA 5BNGA 3FXJA 3O3KA 4M6VA 4KITB 1FLIA 3OR1C 5M3FJ 2DTZA 2XUBA 2O3FA 4IL6C 1LFBA 3L2RA 3PSFA 4P1WA 1G3YA 3BG9A 2NOGA 2FUG2 1WJ5A 4BBRJ 3HJEA 2B9SA 1JKQC 5E1ZB 3HRSA 1KU3A 2RDPA 4H0EA 4XICA 3IH4A 1ETVA 2P5VA 3OS2A 5HODA 5D5UB 3C3WA 4JOMA 1FOYA 3VB2A 4F93B 5E1XA 1H9TA 2DLLA 4IPAA 4RBOA 1Y8RB 1GXQA 4J01A 4AIDA 1TTYA 5HS7A 3LFUA 4ENNA 3OYAA 1ZYRF 2GAUA 1VQKI 1XMAA 3CF2A 3TOAA 3O8GA 5HLIA 3ZRGA 1O4XA 1XMKA 1HCRA 4DBQA 1LNWA 1N75A 4JX6A 3CP2A 2R7SA 2FE3A 3ZP5A 4OIQF 4BHBA 4OIOF 2UWMA 1SVOA 1UELB 4NC6A 2WV0A 1VZ0A 2Y9ZA 2CQKA 3IH3A 4D0PA 3I5UA 5IYBJ 5JHUA 2LKXA 2BYVE 2ZBKA 3FXRA 1YJ9I 1WH5A 3E6DA 2D1HA 3GCMA 4KT6A 2K9QA 1IXRC 3CP8A 3MZ8A 1NK3P 2H1KA 2Q8KA 3TGNA 4IHYA 1D1AA 3ECHA 2XRLA 4RB0A 3F23A 3Q3SA 3P9CA 5DV5A 2X6OA 3CCLI 4ASNA 3GTGJ 3JRHA 3BCBA 4CZCA 2LMDA 1ZGAA 3A2KA 3ERMA 3HUGA 3CTAA 1G3WA 4KMFA 3KLOA 3QOEA 1KU7A 2UUZA 3HOTA 3RKQA 3VYTB 1NTCA 1CQTA 4JQFA 5LHHA 1K4TA 2CGPA 4M71A 1YRNA 5BMZA 1ETQA 2JMWA 2HOAA 2HKXA 2HYGD 2P6TA 1VQLI 2NNYA 3HG9A 4E7IA 3HTSB 3GTMJ 5FO5A 3MZHA 1KGSA 2R7OA 4CCLA 4F3QA 2ME0A 1KZHA 2W85A 2CV2A 2NS7A 3S32A 1XPXA 2PG4A 1QZEA 4HRIA 2JA5J 1WPKA 3MWMA 2VBWA 5GAHJ 3LSIA 1SD5A 2A6HF 3T8RA 3Q0VA 1OPCA 2P5KA 3ELKA 4B48A 2E1MB 2CUEA 3TO9A 3GLLA 2BV6A 2MH2A 3BTLA 1S3JA 4L0ZB 4I7HA 5HVQC 3WU2C 4F52A 4BY7J 1B6AA 1W4MA 3C2BA 3M8FA 2EFNA 1Y39A 1DU0A 5JFRA 3V7SA 2HPIA 4LLLA 3VEPA 3JRFA 4NB5A 5K7HA 5DTDA 3BT9A 4AVZA 5A2QZ 3BZ6A 2EBIA 2Y9YA 3KP6A 4MEYF 3OOUA 4N4OB 1VTNC 2AS5F 1SMTA 4KIGA 4HNUA 1DP3A 3WTXC 3BTJA 3K70C 3DPLC 3HB9A 1FBQA 5DCMB 1ZG5A 2M7AA 2EFWA 4ESBA 3HSEA 3AKZA 3CO7C 1Z6RA 2ESNA 3J81Z 3Q0WA 2O5RA 3JTHA 5FB2A 1VNDA 2CFOA 5FKMA 2L4MA 4A6EA 2E19A 1Z77A 1OYIA 2OJED 3DKWA 3W2AA 3LSPA 1C0WA 2WB1N 1IZ1A 3HOWJ 2QKLB 5IT9K 2VB6A 4ETSA 2PMUA 3BZCA 2LH9A 3F72A 2OPTA 2DA1A 1RR7A 1UMQA 2D2WA 3OIQA 5HS9A 2HWVA 3S93A 2VLAA 1T0FC 4AD9A 5F6FA 3D0SA 2R7UA 2IGMA 3I56I 2DMPA 5GPAA 1DPRA 2DXIA 5FKLA 4UHTA 3F8FA 2F6CA 1MDMB 4BXFA 1MSFC 3KZZA 2VL8A 5EZGA 1XGSA 1VQMI 3SEZA 1FPQA 3LSGA 1YTYA 2MFZA 1L0OC 3IKVA 5ILSA 2BVMA 4AIJA 1POGA 2HVSA 1S8NA 4EJOA 1TNTA 1LPQA 1U9NA 4ZDPA 4D5CA 4KJZA 2CU7A 1QZZA 3HL2A 2HOSA 4WCGA 3DXJF 2BY2A 1MMNA 1ON1A 2VKEA 3JCUC 3CMYA 3A03A 2I10A 4BXUA 1FNNA 2DFFA 3BR5A 1D8JA 3ZN1A 2F5DA 2WC2A 4GFBA 4QPQA 1H8AC 4GXOA 2X1DA 1MJBA 4BYYA 2VKVA 4BQAA 2L4AA 2RVCA 2F5FA 2J5PA 1OR7A 2RREA 2KP6A 3ZMSA 5FD6A 3ZQHA 5CQGA 2P0WA 3KZIC 4Y17A 1U5TC 3BQYA 2R5YA 4HSRA 5IYCJ 4C9YA 2P6SA 4M3GA 1WKMA 2EH3A 1SD6A 2DMNA 2ECCA 4NDLA 3ZGKA 5DM7F 5K1YA 2K5CA 4I6ZA 3JAMK 2MLKA 2W24A 5K5QA 1S7AA 4I01A 1ZHFA 4XKWA 1KQ9A 1UG0A 5B5EC 3FK6A 2FQ4A 3GZ6A 4U0WA 3GMEA 2CUZA 5IPAA 4HQEA 1PUEE 2LTPA 4L5IA 2DFEA 4RM2A 1LQ1A 3ABKH 5JHFA 1XSDA 1CF7B 3QU6A 3HIFA 1WVRA 4G6QA 1X19A 1O3TA 2HPMA 1U0JA 4QIWN 2IW5A 2HYJA 4XRSA 3LA2A 3E6CC 4CICA 3RJPA 3NRVA 1X3WB 5ICCA 5K5OA 2Z99A 3CCRI 2JSPA 1MW7A 2W00A 4GYIA 3CJNA 2MD0A 1UHWA 5DCFA 1ZR4A 4Y4RA 3I58A 3LSJA 1MBKA 4KUMA 4W1UA 3JRIA 3G6EI 1CF7A 4UUSB 3J7ZI 1GV2A 1QO0D 1IUYA 3HKZA 3H3VK 1XC5A 1KA8A 4KICA 1VQPI 3F6OA 2Q2EA 2ZSHB 4A3LJ 1B72A 3LL7A 3OV8A 1ACIA 4HQMA 1MMDA 2IP2A 2CG4A 4BAYA 3MFKA 3RQ4A 4U0VA 4L5JA 1JHFA 2Z2SB 4B47A 2M1BA 1MD0A 4ZYGA 1VQ6I 2A68F 2VI6A 4U87A 4RMNA 3NAUA 4A2UA 4HYEA 3AL0C 1BM9A 2IGNA 5K7FA 2PMHA 3OL3A 2CUFA 2DT7B 2WY8Q 4IJAA 4X0GA 5L3DA 4UUTA 3SDGA 3TP0A 2KL4A 1IAWA 3FMRA 4BS9A 4GCVA 2DMQA 2DOAA 2NVXJ 2TCTA 4JX4A 1FBSA 2X85A 3DQVC 3WGHA 1TQPA 3GZNB 3MKZA 1XMXA 1W36C 5D8LB 5HLHA 4HV6A 1V5GA 1OISA 3DEWA 3PFYA 3TDZC 3ZOBA 1Y0UA 1BOAA 1D0ZA 1W0TA 4DBRA 2K3PA 3DP7A 5EJCA 3GO5A 3A01B 4OOIA 3BDDA 4UNOA 5DM6F 5F08A 3JRCA 3N97A 4IKFA 3GFIA 3S2HJ 1N78A 3T1BA 3GEZA 4PJMA 5TISC 2L5QA 2BY3A 3FIWA 4RB2C 3UKGA 5M3MJ 2RNGA 5L3EA 3CF5F 2JVGA 1ON2A 1IRZA 3BR0A 4BNCA 2B63J 2IS1A 1VI0A 2MGQA 1FP2A 2VT3A 2JA6J 5M5WJ 3FMQA 3LSTA 4CSWA 2R7WA 2W25A 2XGDA 4KIBA 3TQNA 4ZDOA 1U8BA 1XB4A 3ZQLA 1OCZH 2JUGA 1U6GA 2OU2A 1QPMA 1XX5A 2DQLA 2JJ7A 1ZTRA 2ZMEB 1HKQA 2EA2A 3I9V2 2BXZA 3L7WA 4ZZLA 3K4JA 1P7JA 2DDBA 2L7ZA 2UV1A 3DLAA 3BG5A 2XKPA 1JJ8C 1A6QA 5TGTA 1DP7P 1ZARA 1A04A 2YPRA 1LFUP 2RQPA 4C2TA 1Y56A 1P4AA 2CQ7A 3K4KA 3VFZA 3IL2A 3CUQB 5ERIA 3MQ0A 1E3PA 1G59A 1FBUA 2JN6A 2KZGA 1YJWI 2FBIA 4OIPF 3F0CA 2RKHA 2PFBA 3ASOH 1NH3A 2ZJQF 1SVLA 1OQYA 3WTWC 1SEUA 3HOSA 4E7HA 1TWCJ 3H9JA 1YOVB 1ETWA 3EUKL 3DKXA 4HX8A 2DAOA 2FA5A 5AIPA 2GIZA 4CH7A 1B4AA 4BACA 2KIFA 2M7BA 3VODA 3CCSI 2JQ7A 2G9WA 2HOEA 1HW1A 2EZKA 5BOXA 2EFOA 2QUFA 3KFWX 2ELKA 1QA6A 5F1RA 1AKHB 2O8KA 4RAFA 1RETA 2HZDA 5D6EA 2HI3A 5LEKA 4XKBA 1TNSA 4LG0B 2M8EA 4BEHA 3F9KA 4DYRA 3WTTC 1OLTA 1F4KA 5JVGF 4ZYHA 4NBQA 5L3FA 2JVHA 2LY9A 2ADUA 1J7KA 1D5VA 2R4GA 4C3JJ 2NVQJ 2MC3A 1SVMA 1T0FA 5GPCA 2FJ1A 3F8NA 1I6XA 3S1NJ 2FOKA 5LHGA 2GZWA 1IC8A 2DI3A 5JLXA 2VT2A 4A5NA 3MKWB 2XF6A 3GW2A 4LG0A 1W7PD 1J75A 2FX0A 5GADJ 2DJNA 4MFEA 1VQNI 1HKTA 2QSHX 4X6AJ 3OYNA 3CDHA 1X2MA 2L9RA 5J6XA 2RV8A 3WE3A 1YO5C 1YW9A 1LJ9A 3K1PA 3MZYA 4A3IJ 4Q48A 1E3OC 4Y52J 3LFKA 1IXCA 2A69F 4MFDA 3PQJA 5J8CA 2E1MC 3H9GA 4OINF 2D45A 3WTYC 2M34A 1G4DA 2E35A 1HC8A 3T0YA 3U9GA 1Q1VA 1RC9A 3PNYA 2XAFA 4ENMA 2QSGX 4M9XA 3CCYA 1GLNA 3G73A 3W3CA 3RPUA 2DBBA 3WTVC 1Y6IA 3JRBA 2QCOA 2R5ZA 3ABUA 2DN0A 2R7RA 4XR6A 4R8HA 3HEFA 4DIQA 5BQTA 2VE9A 3QPLA 2M0MA 3FXKA 4YFXF 3CCQI 4RGRA 4CYCB 1MBHA 2HYFA 4HF0A 3QPSA 4BJ5C 3CC4I 1JGSA 1T33A 2VBYA 1JT0A 2QZ8A 5C4JJ 4LIUA 4R1HA 2LOOA 1YQAA 1FJLA 2M4KA 1TWAJ 1TQIA 3DTKA 3S8PA 3CMEI 3JREA 1X3ZB 3QPTA 1DU6A 2V1UA 1PP7U 4YIRX 5J1YA 1X1AA 1R36A 1MJ9A 2F4MB 1HLVA 2CWEA 2A61A 1A35A 1V55H 2KRFA 2VUMJ 1WJEA 4UVBA 5HNHA 2QGUA 4CZZA 3IRQA 2L01A 4PFOA 5CJ9A 5EG0A 3RPQA 4PJ0C 1JTXA 4A69C 2BEOA 2EQRA 5E8GA 5DUIA 3QP6A 2R92J 3I64A 2JA2A 2YSRA 4CXFA 3GZ5A 2A3SA 4BHCA 2LR8A 4M73A 5LEJA 5L3GA 3DKYA 2F2EA 3EPZA 3HBLA 1GT0C 3A1YA 2LK2A 5LGUA 3G3ZA 2STTA 2IAIA 1QVUA 4E7ZA 2E71A 4KISA 2O6GE 3GUDA 3D5RC 2V6EA 5KAFC 1QU3A 3RI4A 1R6RA 2Y31A 1FOXA 2AQEA 3EDPA 3LSRA 1B1BA 4AYBA 1DQUA 2LBFA 4RLFA 4UB8C 5CQEA 3LSMA 4IEJA 3K4BA 1MSEC 4C2UA 2IS2A 1FEXA 3FX3A 4XBFA 2NAZA 1R4MB 2DU9A 2L7MP 3KEQA 3ZMVA 1ODDA 1BW5A 4HNVA 2TDXA 4Y3OA 2CH0A 5KCMA 2YUSA 3BG3A 2KT0A 4A3MJ 1WI9A 4B44A 2E34A 5D8KB 1WJCA 2BBYA 2VE8A 4HLXA 3U21A 1XTAA 3H5AA 2XAQA 2OC6A 2W1OA 4M6XA 4HLYA 1XD7A 3QYEA 4NHJA 1O3QA 3VPRA 4ZH4F 2A5WA 2MC4A 1O7LA 5F0HA 4Q47A 3F3XA 3FISA 3DPTA 5J3LA 4XM3A 2DOEA 3BP8A 1AWCA 3MKYB 2MW8A 5E1WA 5J47A 4XRSG 2CQNA 2HU9A 5J40A 2FF4A 3HOUJ 4HW0A 1J0RA 1T6SA 2EINH 2IS4A 3ZQIA 3ZMDA 3ECOA 3K2ZA 1R58A 2PMZN 1SFOJ 3EYIA 3CLOA 5IYDJ 4BE2A 2V26A 4MO7A 1IRFA 1RKTA 4XL9A 4L9TA 3K2AA 3FMSA 2V1NA 2M30A 3PO3J 2KLOA 2H1LA 2ZCWA 3RKYA 5F1JA 5JR3A 2IRFG 2ISZA 1Y1VJ 4BGDA 1Z1DA 2H09A 1UZCA 4XRMA 4BUPA 1BI1A 3HKZN 3VOEA 4DZPA 1GXPA 3K9TA 5H6QA 2E1NA 3LQQA 3TO6A 1F9NA 4WXHA 4OMZA 2P7VB 2JZYA 1S29A 3HZJA 3CLQA 4MQVA 2W4SA 4RAZA 2EIKH 3BTIA 4RAYA 2M5WA 1T2KA 3QAHA 5E3OA 3OYBA 1XGOA 3SZGA 5E3LA 4BDYA 3CDLA 5C44J 3J80Z 2XF5A 1FIAA 4BKXA 1IDZA 3TDUC 4F92B 1ULYA 1R4NB 1QZYA 2CJJA 3K4LA 2DA5A 5E18F 3TW6A 4DNCA 3HSFA 1GVDA 2VN2A 1ZLKA 5F04A 2QEXI 3JRGA 1UFMA 1X1CA 1PP8F 2H8RA 1ZLJA 3GBGA 3AG2H 4KFCA 4DYCA 4M3BA 4OAYA 4EJUA 2XRNA 2FNAA 3E1SA 4HNTA 1BI3A 3LMMA 3R6SA 3CCUI 4B3AA 2K27A 2ELHA 1AU7A 4A3DJ 1A5JA 2E5ZA 2ACJA 2HDCA 3RYRA 5F64A 1YX3A 1S9HA 2DMTA 3FXMA 4N9HA 3WTUC 5KAIC 4IQJA 3D5SC 3CCEI 1R9TJ 2BE5F 5IP6A 4MQ9F 3D5LA 2GQQA 2QSFX 2STWA 1EJ9A 1W7PB 1WI3A 2PJPA 2OCCH 1D8KA 2E7XA 1QRYA 4XIDA 1BC7C 1AA7A 2DFIA 4M9SA 3B73A 1Z3XA 3JR9A 1R5HA 2P8TA 3GFMA 3ZR8X 4EM0B 1R71A 1XS9A 1A36A 3I59B 4JP0A 4O5VA 1UAAA 1IDYA 1R22A 1X2NA 3LAPA 1S72I 2YU9J 1HW5A 3FWEA 4II2A 1LE8B 2DODA 3CC2I 4XOTA 4AVPA 3LOCA 3KYCB 2EV0A 2K9NA 1JUPA 5F0FA 2K85A 4FETA 3H1CA 5LGNA 4EJVA 2KIMA 1UHMA 4FT8A 1VQ5I 1WWXA 3DF8A 4LLNA 4F55A 1OCTC 1B8IB 4XSXF 1HOMA 2ZMEC 3ABTA 3K1NA 4FQGA 2KHMA 2JT1A 2WY7Q 3G1LA 5GTHC 1IN7A 1LE8A 4I09A 4MHGA 4XK4A 1TWHJ 1EF4A 2G7HA 3Q5FA 2F5VA 1IGNA 2W48A 3IV5A 3FK7A 5ILUA 2VJ4A 1JTYA 1DGWY 2R7ZJ 4PK4A 2K02A 1D3YA 3E7LA 1YS6A 2Z3YA 5LD2C 2H6BA 1WH7A 4ENJA 1M1EB 4HOBA 4I0BA 2LD5A 5IP7J 5AONA 1O3SA 3CJRB 1V3FA 1ZREA 2VOOA 3OMYA 4XOPA 4RS8A 5B3SH 2P7CB 3W6KB 3L1PA 2Y75A 1R5ID 4Z2YA 5DCMA 1MGTA 3ZQQA 2R7TA 2EILH 2K3FA 1K6OA 4HG2A 3K70D 2MH9A 2KJCA 2VPRA 3M07A 2E2HJ 4O6JA 1IXSB 1FX7A 4HAMA 2O9LA 2LYCA 4Y33A 1I1GA 3HTUA 5AIQA 4HSTA 3F21A 5ED4A 2A07F 4RGSA 3BR2A 2O0YA 1ETYA 2ZJ2A 3HGGA 3CDIA 4D1QA 1UG2A 2P5LC 3AFHA 3RYPA 1SFEA 1E3HA 2DT5A 5IP9J 5BS6A 2A6TA 3OYCA 3CCVI 1YJNI 1IJWC 2ZXIA 2ZC2A 2XSJC 2HVQA 3QP5A 1MDMA 2XHKA 1LUJB 3M1CA 5HLGA 4FHTA 3VSKA 4EV0A 4X1EA 1HBXG 1MBFA 3RTRA 2NS8A 4F91B 2A6EF 3W2VA 1KU2A 5DYMA 4ZTFA 1MH3A 4LJZF 4AC0A 3M4OJ 4HBLA 2PLYA 1GV5A 3KEOA 1WJDA 5LLQA 3MVPA 1UB9A 9ANTA 2ELJA 1MH4A 1HDPA 3O8HA 4ABZA 5B1BH 1P92A 2Y2ZA 1Z91A 5C4XJ 3NEUA 4ZZDA 5D4RA 4B3XA 1NHAA 3DTEA 3RPUD 5DEQA 3ZN0A 4OU0A 2V1XA 2HZTA 4HEA2 1Q1HA 2MABA 1X1PA 4ZC3A 2XIGA 3SEQA 4IVNA 3AG3H 4EEFG 1VQOI 2VODA 1D1BA 3LA7A 2QM3A 4E7SA 1T38A 3E5UA 4FCYA 1K78B 2NXNB 1GHCA 2N8GA 2XROA 1YFHA 1W5SA 5E17F 3W6JB 3EETA 2OTJI 2XGEA 4U7BA 4Y15A 1R00A 3BG7A 2FMYA 1XGMA 1BBYA 5FRNA 2V9PA 4B09A 5IOYA 2DW4A 1BR1A 4FX4A 3H35A 3WODF 2BVLA 5D5XB 3RKWA 2IA2A 4GRIA 3KP5A 2MD5A 4YEJA 4BQOA 1IO2A 2OAZA 2B7EA 1Z6TA 1JKPC 3CD6I 2WV1A 4J19A 5GAGJ 1QHHD 4E6KG 1K4SA 1ETOA 4XLEA 2P4WA 3BR6A 4FTHA 5K7ZA 1X1BA 3HC7A 1CGPA 3BC8A 2IBDA 4IRHA 3F8BA 2Y0SN 4RA2A 3SFZA 3JSPA 3SXYA 3OIOA 1XCBA 1Y8QB 5BPDA 3DU6A 4C2MJ 2H94A 4CCOA 3S1RJ 2HDWA 1FSEA 3C18A 5CVRA 4UUSA 3OYMA 2HQNA 3CCJI 3PJRA 4V19K 3DCFA 2HTSA 1SMYF 2ZSIB 2GWRA 4IHXA 2DMUA 2V9VA 2EA4A 1J59A 5B1AH 4RM3A 1DGRM 3CMAI 4P9FA 4Y7NJ 2V79A 5BPIA 4AWXB 2XC7A 1VQ9I 2ZO4A 5D4SA 3CJQB 5M5XJ 4EVIA 1MBEA 4PJJA 2IPQX 3LWFA 3G4SI 4CCKA 4DYQA 5HS8A 4Q5SF 4DW6A 4UVAA 5A2QK 2R7DA 5EGOB 3S15J 3IAM2 4ZYEA 4JK1X 1F5TA 5TJJA 3JSOA 4PZJA 2LVSA 1FMWA 2KRCA 3WE2A 2WTEA 1BI0A 1IV8A 2ZXWH 3RZDJ 3DFGA 2VC1A 1QPIA 1QHGA 3OYKA 1LVKA 2RN7A 2MSYA 4XLCA 2OZ6A 2HFHA 4QPOA 1JGGA 3CUOA 1ZRCA 4G12A 4TV7A 4IQ4A 2AXLA 4LIVA 2DQRA 2ZNYA 4HDVA 4A6DA 1W36D 2DK5A 3WGIA 1YIJI 2JTVA 2GIVA 3JW4A 2OD5A 3KPHA 3I53A 3A02A 5DDGA 2D1VA 3V8KA 3A01A 2CFXA 3S3OA 1SD7A 3FBIB 3QYBA 1VQ4I 2RQQA 3HOVJ 1Z3YA 1D0YA 4CHUA 3GTOJ 5KNLA 4XKCA 2FQ3A 4EQQA 2X51A 4WXDA 5H2FC 3FXOA 4II3A 4WK8F 5HOOA 3GTPJ 1KU9A 2NOJB 2QQ9A 2MLGA 2M3AA 4G8XA 3TMOA 1T08B 2R7XA 2ID6A 4XN0A 2CW8A 2UXXA 2ZMEA 1I3QJ 4DQ2A 2QKMB 2FXAA 2IA0A 5LRRA 3GX4X 2CRGA 1SAUA 3DBRB 2M0CA 4RGUA 4BQQA 2V9KA 4KNYA 1V4RA 2IEKA 4XLNF 2L54A 2XPWA 3CMMA 4PGHA 4RLQA 4EM2A 3GTQJ 4BHPA 2BW3B 2AQFA 3U1KA 3ZQ7A 3DLLF 3L2QA 3VYUB 3KP4A 1GVJA 1APLC 4LGWA 2IGOA 3CUQA 3LSHA 5E3MA 3E5QA 4GGGA 2XF7A 2DCEA 2NYXA 2V6CA 2BGCA 1D0XA 1YW8A 1QBJA 4A3CJ 1QGPA 1WGXA 3V42A 5ILVA 1WJBA 2FMLA 3EYYA 3QU3A 3CESA 4DGWB 4BY1J 2CW0F 3W2WA 3M9AA 2X4HA 5M5YJ 2HR3A 2VQGA 1U9OA 1FC3A 2XB5A 4HZFA 2L3DA 1T8IA 1WHUA 1PJRA 3K6GA 2BHYA 2DOFA 4JBAA 4WX9A 1AKHA 1Y1WJ 2OTLI 2XPUA 3HM5A 3R0JA 4OMYA 2HXOA 3HGYA 2WB1A 5J1RA 2QQAA 3AG1H 2XAHA 2VKHA 2WAEA 4LK0F 4NQWB 1KQ0A 2CV1A 4I2OA 1R23A 3QODA 2E1CA 1B9MA 2HKOA 1X1DA 1I1SA 1YX5A 3P9IA 1TWGJ 3BROA 2QVOA 4M6YA 4NC7A 1XSXA 3S2WA 1JT6A 2LG4A 1DDNA 2D5VA 3G71I 1B9NA 3JRDA 2MA3A 2VBZA 1A31A 1YIOA 4KN4X 4A3GJ 2BXYA 3LA3A 1MIJA 2AXTC 2VXZA 2R7QA 3M8JA 3AAFA 5DS9A 5IT3A 3BY6A 4B43A 4QTRA 5EEAA 1H9GA 1HXDA 1G3TA 1J5YA 4EJTA 1BL0A 1BOBA 4YIIA 1YITI 3ZMUA 4Y13A 3PO2J 4MNUA 2GBYA 4XKVA 4IHTA 4EMSA 3GFLA 4LD5A 1G6NA 3BPXA 4EGYA 2R7VA 1YYVA 5H20A 1BI2A 5CVIA 4V2GA 1MJAA 3GWZA 3K69A 4P55A 2ZXJA 2PJRB 4G7ZF 1J09A 4CYCA 4KT5C 4UUVA 2AO9A 1OKRA 3Q9SA 1EH6A 4NUBA 3H5RA 1SC7A 2WADA 3UR3C 2K4JA 1B59A 1TLHB 5GTIC 1YE9A 1R7JA 3CZ6A 2P81A 1LDDA 4MTDA 5CYVA 4E7LA 1MMAA 5FGMA 4A3EJ 5F27A 4DZJA 3V8JA 2OV7A 2IA1A 3HXLA 1SFXA 2OQRA 2JK3A 2TRTA 3PUFA 3PFIA 3OYLA 4HV5A 3PNVA 2VKDA 2PJRA 3DBLB 4PDKA 1TT5B 5D5VB 1TQMA 4RDUA 4P9UA 3ABMH 2NVYJ 2HGCA 5E8IA 5ICEA 2WAQA 3SYTA 1FTZA 3RZOJ 1BA5A 2OF7A 3OYGA 2CSOA 2M45A 4LB6B 2LFBA 5HLTA 3HPHA 3BLYA 1OYYA 2W82A 3COAC 2XAJA 3KEYA 3PIOF 3IAS2 3HHHA 1SFUA 2F4OB 5JLWA 2MBFA 1H88C 2QA4I 1SAXA 3DU5A 3HSRA 1JJ6C 5FLXK 3I4PA 5KVRA 3RIRA 1N77A 2JPBA 2PEXA 1W5TA 5ICGA 2HQ5A 4P5OA 4RGXA 5IT9Z 1LDKB 4S04A 2Z16A 2Y48A 2J5OA 3IC7A 4E4HA 4ESFA 1W5CC 4LLGF 4FE4A 4XLAA 3C2GA 4BE1A 4I99C 5F0CA 2PQ8A 1ONVA 5J8FA 3NQOA 5GAEJ 2E2JJ 2L7FP 1L3LA 2L7KA 2CQXA 1T56A 3SDBA 2H27A 1MKMA 1JKOC 2E60A 3S17J 3TKYA 4WWCA 3OR2C 1HSJA 5HDKA 1EV7A 2X0LA 2E36A 2XGXA 4ANJA 2WBMA 1FSHA 2ZNZA 1KYZA 2KDZA 3KZYA 2M8GX 2X1CA 3GF2A 1BIBA 2IS6A 5KHDA 2H6CA 2M9HA 5D5WB 2LY1A 4O3MA 3GVAA 4BL0B 2KMUA 1BJAA 3OYIA 2Z33A 4BBSJ 2LY2A 3EUAA 3PNTA 4GDFA 1ZQ3P 1IUFA 4BQNA 3S2DJ 2YS9A 2COBA 1TP4A 5FROA 1TW2A 1BJZA 2LKPA 2HQAA 3PIPF 4YG2F 3OS0A 3E6BA 3EUHC 3BOQA 3V7RA 3OYJA 2CQQA 3KYDB 1V5EA 2HS5A 2JA8J 2KPMA 3HRTA 3BJAA 2XSDC 1IRGA 3PQKA 2QQ8A 2LKSA 3H3UA 1FOKA 4IZZA 1EKEA 4D9JA 2KRHA 2GA2A 2ZFWA 1HSTA 2I5UA 3OYFA 5LBQA 1SD4A 3MEXA 5E79C 5J4VA 5E20A 5LHIA 3ML6A 2HVRA 2FRHA 4MIMA 3HOZJ 3BZKA 3L2VA 4LB5A 3JAMZ 3J7AO 4MLOA 2EFPA 1PDNC 1O7FA 1YW7A 2HTJA 2YX7A 2E1OA 2LLKA 1P6RA 3HUGB 2R3SA 3L00A 1RI7A 1BR2A 2NRAC 2L0KA 4CA0A 1T95A 4QLCU 3OSFA 2ID3A 4N4NB 1YRNB 4NC8A 2KISA 5FFZA 4J00A 3P7NA 3HOXJ 3GTLJ 1F36A 2K9LA 5H6RA 3IH2A 4H4KC 2W84A 3MMYB 3S1MJ 2G7UA 2ETHA 4G7OF 5DUKA 2X48A 2DK8A 1IN8A 2HOTA 4IRIA 4I02A 1ZELA 1OCRH 3T8TA 4AM3A 4YRVA 1K79A 3V4GA 6PAXA 5KK1A 3GTJJ 3K10A 2M4GA 3WTZA 2QBYB 2L9SA 2ZXHA 2F4IA 4ITVA 5EDNA 4LK1F 4KYWA 3ROUA 1TWFJ 4LOCA 3VDXA 3REOA 1K6YA 4JX5A 1HDDC 2I8DA 1W7PA 3I0TA 2XGCA 4F7ZA 1RESA 5JI6A 4IHVA 3DEUA 3ERED 2RAEA 4PCQA 1ZG3A 3I4MJ 4N0BA 1HQCA 3H9QA 2BOLA 4A0YA 3I59A 2QBYA 2IT0A 2QQBA 5C3EJ 4U7DA 2EFQA 1ORKA 2X9DA 4N9IA 5FFXA 3OYEA 1W1WE 4YFNF 4A12A 1YI2I 2DJIA 4IRGA 3BR1A 3NWSA 2E2IJ 3O2PE 3E6MA 3I4NJ 2NS0A 2K86A 3KX2A 2BHZA 4LMYA 3FDYA 4RAGA 4QSHA 2XPVA 3FKIJ 4OIRF 4G6TB 3H0DA 2KZVA 1FYKA 2EJRA 2DPUA 5E3NA 3I55I 1LDJA 1S7EA 2O03A 2E7WA 3IUOA 3MN2A 3E97A 1NG7A 3H0GJ 3SQNA 2VQCA 1TC3C 3ZXSA 1B8IA 2FOWA 3CUQC 1IG7A 3X2QH 2GXGA 4FE7A 3H5NA 1OCPA 1ZRFA 1HF0A 4Q4ZF 2QENA 2VC0A 2ICWG 4U88A 2CV0A 3N4MA 1QVTA 2GOXB 4HPQA 1S6LA 4W97A 3MAJA 1UCRA 2ZB9A 1WZ2A 1ZAOA 1LVAA 3H92A 2VONA 1WCMJ 2DA3A 2LC2A 3E0JB 2DPDA 3HYIA 4B1RA 3L2CA 1MNEA 1P4WA 2NNNA 3BJ6A 4M3EA 1NK2P 1VQ8I 4KMUX 2GXAA 3K4NA 4A0XA 1J9IA 2L9NA 1FOWA 3BG6A 4PJNA 2ECBA 3OL4A 1Z0XA 1X4PA 4M3FA 2V1DA 2M87A 1ZN2A 2VOPA 2G0EA 1DPUA 2ESHA 2Q0OA 5EEHA 3WG7H 2CMPA 1H0MA 1OMIA 4AIHA 4A3BJ 2V7FA 3VYSB 1OYWA 5FKKA 3WHBA 2W7NA 1MMGA 3S16J 3R0AA 5FRMA 1OJLA 2DFHA 3CQZJ 3HDDA 2HNHA 4IHSA 1F1ZA 2OCEA 3GFJA 3OY9A 2UZKA 4ESJA 1AOYA 2LREA 3TL4X 1HKSA 4AUXA 1Z21A 4A3KJ 3KP7A 1PUFB 2JSCA 4XMYA 5IY5H 4G6DA 1JUMA 4RB3C 3P5JA 3S14J 4L5EA 3CC7I 2KIQA 3PM1A 1LB2A 2AHQA 4M74A 1FWZA 2DA2A 1AHDP 3ONQA 3K1MA 2XASA 4L9NA 2WWYA 1ZR2A 4CYDA 3BCAA 4BJ6C 2YR2A 2FD5A 1KONA 1QNTA 1TT0A 1H89C 3UNGC 1BN5A 3IHUA 1PUFA 2X6XA 1ZKGA 3I3LA 1S5LC 5CVUA 2DYRH 1U78A 2HEOA 4UXNA 4ENKA 3FXLA 4R79A 3DWLE 2EPFA 2R5YB 1S7OA 4G94A 2JPCA 1TZLA 3CJTB 1A6IA 3GXOA 2XV4S 4ZDLA 3GYHX 1FT9A 4KDPA 1ITYA 1JKRC 1F43A 3CCMI 1SFKA 4XN3A 4IHWA 3AG4H 3TW7A 1P9QC 4YIFA 2EK5A 2BY1A 2XDVA 3J80K 2X6YA 1FTTA 2ZJPF 2F5EA 3HOYJ 4CCNA 2KDOA 3ULQB 4XLPF 1JI8A 2A05A 1FZPB 1LEAA 5CKTA 3PSIA 3L2WA 2L2OA 1X4OA 2VJJA 1RUOA 2GOMA 2B0LA 3T5XA 4XONA 3OS1A 2WA0A 2OA4A 2GA1A 2BY0A 1D5YA 3Q9VA 1ZGWA 1XN7A 4HA8A 3VWBA 1BW6A 3IKTA 4ZTJA 1O3RA 1YG2A 1EH7A 2F48A 2X1EA 4L0YB 1PVEA 4YFKF 3WHCA 2IGKA 3BR3A 1EH8A 2RGVA 3RCOA 1K78A 4G7HF 3BWGA 3QYFA 4AU7A 5K5RA 1YLFA 4FASD 2WAQN 2GM4A 1MBJA 4KIFA 2CYYA 1V5FA 2LRDA 3HPGA 1X3UA 2DA7A 3F8MA 3OWTA 3S3NA 1Z7UA 1P2FA 3I54A 5D6FA 2KIUA 1VQ7I 4PSWA 2EB7A 1Z67A 4AYBN 2RC4A 2PMZA 3U1DA 5B66C 3VYRB 2Q2EB 2VIXA 3D1NI 2IJLA 3C1DA 1JHHA 1WJFA 3M8EA 3WTSC 1B72B 5LRSA 2PI0A 4PUSA 3EUHA 5J1UA 3B6CA 4K2EA 2LNBA 3E3VA 1P7IA 2DA6A 1E2XA 1VF9A 2QF7A 4MEXF 4IXAA 1R49A 2GXBA 3FXUA 5HDGA 1BIAA 2LDUA 2R7FA 2Z9OA 2VBXA 2EV6A 2IXSA 4HX7A 2XVCA 2GLOA 3H3ZA 1N25A 4YELA 4PSXA 5DD4A 1JE8A 1IN4A 3QOPA 4DJAA 5LGTA 1G3SA 2VJIA 3V7CA 2CW7A 3OSGA 2COMA 3F8CA 4L9JA 2XAUA 3FZVA 5GP9A 3L9FA 3K7AJ 3P9KA 1J2XA 2ZKZA 4I0AA 3TP3A 1JXSA 5FLMJ 3JTGA 5ICFA 2FSWA 2KJBA 4A3JJ 3DBHB 3LSKA 4S05A 4XSZF 4EM1A 2VASA 4XQFA 1ZH5A 4IOAF 1D1CA 2KQRA 2QWWA 4HF1A 4U0YA 1K61A 4UV8A 1K7AA 1RPWA 4BU2A 1IW7F 3K0LA 4A3FJ 3KP3A 3R4KA 1RUNA 3C7JA 3FF5A 4KN7X 3GTKJ 2F5CA 2EIMH 1ERDA 2EIJH 1XG1A 2CUJA 3C2HA 4EJWA 2R93J 4PFPA 2A5YB 3F22A 3J81K 4XRFA 1G2HA 2IVMA 3DEEA 5EGOA 1TW3A 3KE2A 1UHSA 4BDZA 4LG3A 1USTA 3J7YJ 4EGZA 1SANA 2EWNA 4M72A 1MMSA 1T98A 4IF4A 3KETA 2V4JC 3A0BC 3SZTA 2EZLA 1RZ4A 2DTRA 2KKOA 3QQAA 3FXQA 1V54H 3ZCOA 1R1VA 5JVTA 2JRMA 3BJOA 3MKLA 4CDGA 3Q0UA 2LF8A 3ZQFA 1MZBA 3HRUA 2FEZA 1I6HJ 2H8WA 2QLZA 1E0EA 4UV9A 5FLXZ 4B4CA 3HRMA 2KFDA 2UXNA 2NVUB 2L02A 1BR4A 3KIOA 1IN5A 4D7MA 1TL8A 1VFCA 4ZYDA 5EYRA 3KP2A 3TBIA 1RR8C 1EA3A 2JA7J 3IRRA 2L9VA 1HW2A 2K7LA 3MD2A 3SZPA 2Y69H 3M3YJ 3K4CA 3KCCA 3OOPA 2W57A 4ZJZA 3H36A 2FBHA 4UB6C 5FD5A 3LAJA 3U2RA 2EZHA 4I76A 2DDAA 2OZUA 3A0HC 3W6VA 4P96A 4FISA 1PYVA 2LP0A 1WQ2A 4HDUA 4XLFA 2YU3A 4FX0A 1MBGA 3G1MA 2FU4A 1Z7LA 3PUBA 4EATA 1UJ8A 3L09A 4D7NA 4BEHB 3WG9A 1I5ZA 3FHZA 3IP4B 4V2FA 4I98B 2VXDA 3F6VA 5J4YA 3WU0A 1RKWA 2XAGA 5CVJA 3WGGA 2BW3A 2ISYA 5DD8A 4HX4A 4A0ZA 2VQLA 3R61A 2K40A 1U3EM 3B6AA 4M3DA 1STZA 4L18B 1P4XA 3SJMA 2Z1DA 3KLNA 4RB1A 1RRJA 4Z6YA 3IWZA 3OYHA 4ZYAA 2PX9A 3DTIA 3G1OA 3B02A 4CGZA 3R60A 4C3HJ 2X6WA 1XCVA 4XORA 2PBIA 5L3CA 3FHNA 3BPVA 5CPRB 3K4MA 3ZQGA 1JUSA 4CCMA 1WSUA 1ETXA 2CO5A 1ZG1A 1K83J 3DV8A 1GUUA 3HHGA 5CVVA 3L2UA 2Y30A 4OWRB 4KA4A 4BE0A 2ZJRF 4XLHA 2HDDA 1TBXA 2ME6A 3E5XA 4NQWA 1O57A 4A5MA 2VQHA 3JRAA 5EEGA 3WU1B 2R5ZB 4ON0A 1REPC 2HXIA 2Q1ZB 3O6BB 3KYLA 3TEDA 4HF2A 1FIPA 4JYKA 5LFAA 3VSLA 4MTEA 2HQRA 1OCOH 2K9SA 2XKOA 3TOBA 2MYSA 3SHFA 1QQIA 2VPLA 2DA4A 2K9MA 2QYOA 3SFIA 1U2WA 2M2EA 2CS3A 1RNLA 2LF7A 3ISPA 3ABLH 1Z9CA 3LQRA 3V8LA 4DOZA 5IOZA 2O61A 1XGNA 4CCJA 1USSA 2JRTA 1U5TB 3BTCA 3ZMTA 4B8XA 4CO8A 3J7AY 3RDIA 1NG6A 1W0UA 1DUXC 3OIPA 4A93J 1R1UA 2PN6A 5FJ8J 2FBKA 1I39A 2JWTA 4AIKA 1XDUA 4LFUA 3FM5A 2BZTA 4IOCF 1IRXA 4PGGA 1MNDA 2Y0MA 2LSOA 2K4BA 3QPHA 4PJLA 1XSVA 1Y0NA 2DT6A 2XB0X 1X58A 2RNJA 1ENHA 3BQZA 1U5TA 4IO9F 3RKXA 5HNFA 5EG0B 4L9VA 3RQIA 1I50J 5CLSA 3GLXA 3ESWB 3OYDA 4WXCA 3RSNA 1FYMA 1Z05A 4E7JA 1YS7A 5TRDA 3NARA 4LITA 2VJ5A 1MNMC 3A4CA 1I27A 4BH9A 1FYLA 3DPUA 1R5GA 2O7OA 3I71A 4GYGA 3IWFA 4GO1A 5EZHA 3FM3A 4C3IJ 2ZFUA 3ZPLA 1BC8C 1E17A 1KQ8A 1FY7A 3ASNH 5L3BA 1RIOH 2NVTJ 4E70A 4IX7A 1ZK8A 1KYWA 3FKJA 1WFXA 4S0HB 3PL8A 4OAZA 1R1TA 1LKXA 3FBNB 4UY8I 4CUGA 1IN6A 4M9ZA 1ZGJA 2LBFB 1U8RA 4UVCA 1LEBA 1IF1A 3QRFF 4E7KA 3S3MA 4QWQA 3LNQA 1XDSA 1ETKA 2OBPA 1ZRDA 2R0QC 1G8XA 4WF2A 5HDNA 1T39A 5FKOA 3S1QJ 3M7GA 1YHQI 1I3AA 5FKNA 2C6YA 4BJTA 3ZQCA 4MGRA 1HA8A 1OCCH 2OQGA 2JUCA 5EF6A 5FLVA 4G9YA 3AL0B 2DYSH 1OFCX 2EV5A 2Y0SA 1IV6A 3MCZA 1FP1D
chains in the Genus database with same CATH topology
4XKBA 1OR7C 3G2BA 4XNFA 4BEHA 3F9KA 4G6TB 3H0DA 2KZVA 2WAFA 1OLTA 1QHHD 3IUOA 2JVHA 4E6KG 1NG7A 4XLEA 2R4GA 2VQCA 3N05A 4C30A 3ZXSA 3NWTA 4NNJA 1WJAA 1LFPA 1FMVA 1X1BA 2OUMA 3HC7A 2E5NA 3BC8A 3H5NA 4KITB 3OR1C 2CV0A 3MKWB 2XF6A 2GOXB 4HPQA 3L2RA 3PSFA 3DU6A 4P1WA 4CCOA 2FUG2 3OYNA 1WJ5A 2HDWA 3OYMA 2LC2A 3E0JB 3PJRA 1MNEA 2ZSIB 3K4NA 3OS2A 2L9NA 3BG6A 2E1MC 3H9GA 4PJNA 4RM3A 1DGRM 3OL4A 1X4PA 2XC7A 4JOMA 4F93B 3PNYA 3CJQB 2CMPA 4PJJA 1GLNA 4CCKA 2V7FA 3VYSB 4J01A 3W3CA 1Y6IA 2W7NA 1MMGA 3IAM2 5FRMA 1FMWA 3LFUA 3OYAA 2HNHA 2R7RA 4XR6A 4DIQA 2KRCA 3OY9A 3CF2A 2M0MA 3ZRGA 1QHGA 2LREA 3OYKA 1LVKA 3TL4X 4XLCA 4BJ5C 1Z21A 4QPOA 1N75A 4DBQA 3CP2A 2R7SA 4XMYA 4LIUA 2LOOA 2UWMA 4IQ4A 1UELB 4LIVA 1VZ0A 1W36D 2M4KA 4KT6A 3DTKA 3S8PA 3CP8A 3ONQA 1D1AA 3BCAA 4BJ6C 3S3OA 1KONA 1TT0A 3FBIB 3UNGC 3QYBA 1X1AA 2RQQA 2X6XA 1Z3YA 3I3LA 1D0YA 3BCBA 4CZCA 5KNLA 1WJEA 4R79A 3A2KA 5HNHA 4XKCA 3DWLE 3QOEA 2UUZA 3HOTA 3VYTB 2X51A 1TZLA 4JQFA 4PFOA 4ZDLA 4II3A 5HOOA 2NOJB 2M3AA 1SFKA 3TMOA 4XN3A 2R7XA 1P9QC 4XN0A 2CW8A 2XDVA 3HG9A 2JA2A 2QKMB 2X6YA 4E7IA 1JI8A 4CCNA 2KDOA 3DKYA 5CKTA 2R7OA 3PSIA 4CCLA 2L2OA 1X4OA 4F3QA 3EPZA 3L2WA 2VJJA 3A1YA 1SAUA 2GOMA 4BQQA 4XONA 2V9KA 3OS1A 2CV2A 4E7ZA 2WA0A 3S32A 3CMMA 4RLQA 4HRIA 4KISA 2BW3B 2V6EA 3D5RC 2AQFA 3L2QA 3VYUB 3LSIA 1R6RA 3VWBA 1QU3A 2AQEA 4ZTJA 2X1EA 2IGOA 3LSHA 4AYBA 1DQUA 2LBFA 4RLFA 5CQEA 2IGKA 3LSMA 2XF7A 3K4BA 4C2UA 2IS2A 4B48A 2E1MB 2DCEA 3RCOA 1D0XA 3QYFA 4AU7A 4FASD 5HVQC 4Y3OA 2CH0A 5KCMA 3V42A 4F52A 1WJBA 1V5FA 2LRDA 4B44A 3HPGA 1WJCA 3CESA 3OWTA 4DGWB 3S3NA 3W2WA 3U21A 2HPIA 3H5AA 2VQGA 2OC6A 2W1OA 4PSWA 4AVZA 3QYEA 1PJRA 2PMZA 3K6GA 3VYRB 2Q2EB 2A5WA 2VIXA 2MC4A 1WJFA 3OOUA 4PUSA 3DPTA 4N4OB 4XM3A 2WB1A 4HNUA 1DP3A 3K70C 3DPLC 3MKYB 2M7AA 2VKHA 2WAEA 4NQWB 3AKZA 2HU9A 2CV1A 3QODA 2IXSA 2IS4A 1X1DA 2O5RA 4YELA 4PSXA 1YX5A 4DJAA 4NC7A 4BE2A 2CFOA 2VJIA 2CW7A 2LG4A 2V26A 4BQOA 2XAUA 4XL9A 2V1NA 3W2AA 2KLOA 2QKLB 2VB6A 4BGDA 2VXZA 2R7QA 3M8JA 2LH9A 3LSKA 4BUPA 2VASA 4XQFA 3OIQA 1D1CA 4B43A 2KQRA 3S93A 2VLAA 1T0FC 1BOBA 2R7UA 4BU2A 2IGMA 2DXIA 4XKVA 1ERDA 2F6CA 4BXFA 2W4SA 2CUJA 3C2HA 2VL8A 3OYBA 4PFPA 3SZGA 4BDYA 3SEZA 2R7VA 3LSGA 2XF5A 3DEEA 2MFZA 4BDZA 4LG3A 4F92B 3K4LA 2BVMA 2HVSA 2PJRB 1J09A 2V4JC 1X1CA 4NUBA 4ZDPA 3H5RA 3GBGA 4KJZA 3ZCOA 2WADA 3UR3C 1YE9A 3CZ6A 3HL2A 4E7LA 4OAYA 1MMAA 1MMNA 3E1SA 2OV7A 4HNTA 3LMMA 3HXLA 1E0EA 2E5ZA 3OYLA 1YX3A 1BR4A 2VKDA 3PNVA 2PJRA 1S9HA 4QPQA 2X1DA 4IQJA 3D5SC 3TBIA 1EA3A 3D5LA 2RREA 2KP6A 2WAQA 3MD2A 3SYTA 3K4CA 1AA7A 2P0WA 5CQGA 1Z3XA 4HSRA 4C9YA 4ZJZA 3OYGA 3ZR8X 3ZGKA 5HLTA 3HPHA 3BLYA 2W82A 2K5CA 1PYVA 1UAAA 4XLFA 3KEYA 3IAS2 4II2A 4XKWA 1Z7LA 1UG0A 3PUBA 4XOTA 4EATA 2CUZA 4BEHB 4FETA 3DU5A 4RM2A 3IP4B 5JHFA 2VXDA 1N77A 1X19A 2HPMA 1U0JA 4F55A 2BW3A 4P5OA 1LDKB 2Z16A 2VQLA 4E4HA 2KHMA 2WY7Q 4XLAA 2JSPA 3C2GA 4BE1A 1MW7A 2W00A 2MD0A 2Z1DA 2F5VA 4Y4RA 3OYHA 4ZYAA 3DTIA 2VJ4A 2L7KA 1DGWY 2X6WA 4XORA 4PK4A 3SDBA 2E60A 3HKZA 3OR2C 5LD2C 3FHNA 5CPRB 4ANJA 2WBMA 3K4MA 4CCMA 2ZSHB 3CJRB 3OMYA 4XOPA 3LL7A 2X1CA 2IS6A 5KHDA 3L2UA 1MMDA 4OWRB 4BE0A 2LY1A 4XLHA 3RQ4A 3ZQQA 2R7TA 4BL0B 2KMUA 2Z2SB 2VQHA 4HG2A 4B47A 3OYIA 3K70D 2LY2A 3EUAA 4U87A 4RMNA 3PNTA 3AL0C 4BQNA 2Q1ZB 2IGNA 3KYLA 3OL3A 5LFAA 2WY8Q 2DT7B 5FROA 3VSLA 4X0GA 2LYCA 4Y33A 2HQAA 3OS0A 2KL4A 2MYSA 3EUHC 4BS9A 2VPLA 2DOAA 4HSTA 2K9MA 3OYJA 2X85A 3DQVC 1V5EA 2KPMA 2CS3A 3MKZA 1W36C 1V5GA 4DOZA 3PFYA 4D1QA 4IZZA 4D9JA 2KRHA 4CCJA 1D0ZA 3J7AY 4DBRA 3AFHA 2K3PA 3OYFA 1NG6A 3OYCA 2A6TA 3OIPA 2ZXIA 4IKFA 2XSJC 2HVQA 2HVRA 1N78A 4PJMA 3M1CA 1IRXA 3VSKA 3L2VA 1MNDA 2L5QA 4MLOA 3RTRA 4F91B 2RNGA 2JVGA 4PJLA 3W2VA 4ZTFA 2IS1A 2DT6A 3HUGB 1BR2A 4CA0A 4CSWA 2R7WA 4ZDOA 1T95A 1WJDA 5HNFA 4N4NB 2JUGA 4NC8A 2ELJA 3OYDA 3RSNA 4J00A 4E7JA 2K9LA 3I9V2 3K4JA 4LITA 2VJ5A 3A4CA 4H4KC 2UV1A 3DPUA 3MMYB 3DLAA 2ZFUA 4B3XA 5TGTA 3DTEA 3RPUD 1ZELA 4IX7A 3FKJA 1WFXA 4YRVA 4HEA2 3PL8A 2MABA 4C2TA 1Y56A 4OAZA 3K4KA 3FBNB 1LKXA 3K10A 2M4GA 4CUGA 2L9SA 4ZC3A 2ZXHA 3SEQA 2F4IA 4ITVA 2LBFB 1D1BA 3VDXA 4E7SA 1G59A 1K6YA 4E7KA 3S3MA 2I8DA 1G8XA 3HOSA 4E7HA 3H9JA 4U7BA 3BG7A 3DKXA 3EUKL 4BJTA 5FRNA 4CH7A 3H9QA 2BOLA 4BACA 1HA8A 1BR1A 2M7BA 3H35A 3OYEA 2BVLA 3AL0B 2DJIA 3NWSA 4GRIA 2Y0SA 4YEJA 3KX2A 2HZDA 3FDYA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1X4P A;  1UG0 A;  2E60 A;  1X4O A;  4DGW B;  2DT7 B;  2E5Z A;  2DT6 A; 
#chains in the Genus database with same CATH topology
 3ZMZ A;  1GDT A;  1OR7 C;  2MG4 A;  3G2B A;  4XNF A;  2O8X A;  2WAF A;  2FNP A;  2YX4 A;  3CO6 C;  4BXX J;  2Z5U A;  3TO7 A;  3N05 A;  4C30 A;  3QWL A;  3NWT A;  3M1E A;  1WJA A;  4NNJ A;  1LFP A;  1WRJ A;  1FMV A;  2EZI A;  2DO7 A;  2OUM A;  3EQL F;  4D5F A;  2E5N A;  5BNG A;  3FXJ A;  3O3K A;  4M6V A;  4KIT B;  1FLI A;  3OR1 C;  5M3F J;  2DTZ A;  2XUB A;  2O3F A;  4IL6 C;  1LFB A;  3L2R A;  3PSF A;  4P1W A;  1G3Y A;  3BG9 A;  2NOG A;  2FUG 2;  1WJ5 A;  4BBR J;  3HJE A;  2B9S A;  1JKQ C;  5E1Z B;  3HRS A;  1KU3 A;  2RDP A;  4H0E A;  4XIC A;  3IH4 A;  1ETV A;  2P5V A;  3OS2 A;  5HOD A;  5D5U B;  3C3W A;  4JOM A;  1FOY A;  3VB2 A;  4F93 B;  5E1X A;  1H9T A;  2DLL A;  4IPA A;  4RBO A;  1Y8R B;  1GXQ A;  4J01 A;  4AID A;  1TTY A;  5HS7 A;  3LFU A;  4ENN A;  3OYA A;  1ZYR F;  2GAU A;  1VQK I;  1XMA A;  3CF2 A;  3TOA A;  3O8G A;  5HLI A;  3ZRG A;  1O4X A;  1XMK A;  1HCR A;  4DBQ A;  1LNW A;  1N75 A;  4JX6 A;  3CP2 A;  2R7S A;  2FE3 A;  3ZP5 A;  4OIQ F;  4BHB A;  4OIO F;  2UWM A;  1SVO A;  1UEL B;  4NC6 A;  2WV0 A;  1VZ0 A;  2Y9Z A;  2CQK A;  3IH3 A;  4D0P A;  3I5U A;  5IYB J;  5JHU A;  2LKX A;  2BYV E;  2ZBK A;  3FXR A;  1YJ9 I;  1WH5 A;  3E6D A;  2D1H A;  3GCM A;  4KT6 A;  2K9Q A;  1IXR C;  3CP8 A;  3MZ8 A;  1NK3 P;  2H1K A;  2Q8K A;  3TGN A;  4IHY A;  1D1A A;  3ECH A;  2XRL A;  4RB0 A;  3F23 A;  3Q3S A;  3P9C A;  5DV5 A;  2X6O A;  3CCL I;  4ASN A;  3GTG J;  3JRH A;  3BCB A;  4CZC A;  2LMD A;  1ZGA A;  3A2K A;  3ERM A;  3HUG A;  3CTA A;  1G3W A;  4KMF A;  3KLO A;  3QOE A;  1KU7 A;  2UUZ A;  3HOT A;  3RKQ A;  3VYT B;  1NTC A;  1CQT A;  4JQF A;  5LHH A;  1K4T A;  2CGP A;  4M71 A;  1YRN A;  5BMZ A;  1ETQ A;  2JMW A;  2HOA A;  2HKX A;  2HYG D;  2P6T A;  1VQL I;  2NNY A;  3HG9 A;  4E7I A;  3HTS B;  3GTM J;  5FO5 A;  3MZH A;  1KGS A;  2R7O A;  4CCL A;  4F3Q A;  2ME0 A;  1KZH A;  2W85 A;  2CV2 A;  2NS7 A;  3S32 A;  1XPX A;  2PG4 A;  1QZE A;  4HRI A;  2JA5 J;  1WPK A;  3MWM A;  2VBW A;  5GAH J;  3LSI A;  1SD5 A;  2A6H F;  3T8R A;  3Q0V A;  1OPC A;  2P5K A;  3ELK A;  4B48 A;  2E1M B;  2CUE A;  3TO9 A;  3GLL A;  2BV6 A;  2MH2 A;  3BTL A;  1S3J A;  4L0Z B;  4I7H A;  5HVQ C;  3WU2 C;  4F52 A;  4BY7 J;  1B6A A;  1W4M A;  3C2B A;  3M8F A;  2EFN A;  1Y39 A;  1DU0 A;  5JFR A;  3V7S A;  2HPI A;  4LLL A;  3VEP A;  3JRF A;  4NB5 A;  5K7H A;  5DTD A;  3BT9 A;  4AVZ A;  5A2Q Z;  3BZ6 A;  2EBI A;  2Y9Y A;  3KP6 A;  4MEY F;  3OOU A;  4N4O B;  1VTN C;  2AS5 F;  1SMT A;  4KIG A;  4HNU A;  1DP3 A;  3WTX C;  3BTJ A;  3K70 C;  3DPL C;  3HB9 A;  1FBQ A;  5DCM B;  1ZG5 A;  2M7A A;  2EFW A;  4ESB A;  3HSE A;  3AKZ A;  3CO7 C;  1Z6R A;  2ESN A;  3J81 Z;  3Q0W A;  2O5R A;  3JTH A;  5FB2 A;  1VND A;  2CFO A;  5FKM A;  2L4M A;  4A6E A;  2E19 A;  1Z77 A;  1OYI A;  2OJE D;  3DKW A;  3W2A A;  3LSP A;  1C0W A;  2WB1 N;  1IZ1 A;  3HOW J;  2QKL B;  5IT9 K;  2VB6 A;  4ETS A;  2PMU A;  3BZC A;  2LH9 A;  3F72 A;  2OPT A;  2DA1 A;  1RR7 A;  1UMQ A;  2D2W A;  3OIQ A;  5HS9 A;  2HWV A;  3S93 A;  2VLA A;  1T0F C;  4AD9 A;  5F6F A;  3D0S A;  2R7U A;  2IGM A;  3I56 I;  2DMP A;  5GPA A;  1DPR A;  2DXI A;  5FKL A;  4UHT A;  3F8F A;  2F6C A;  1MDM B;  4BXF A;  1MSF C;  3KZZ A;  2VL8 A;  5EZG A;  1XGS A;  1VQM I;  3SEZ A;  1FPQ A;  3LSG A;  1YTY A;  2MFZ A;  1L0O C;  3IKV A;  5ILS A;  2BVM A;  4AIJ A;  1POG A;  2HVS A;  1S8N A;  4EJO A;  1TNT A;  1LPQ A;  1U9N A;  4ZDP A;  4D5C A;  4KJZ A;  2CU7 A;  1QZZ A;  3HL2 A;  2HOS A;  4WCG A;  3DXJ F;  2BY2 A;  1MMN A;  1ON1 A;  2VKE A;  3JCU C;  3CMY A;  3A03 A;  2I10 A;  4BXU A;  1FNN A;  2DFF A;  3BR5 A;  1D8J A;  3ZN1 A;  2F5D A;  2WC2 A;  4GFB A;  4QPQ A;  1H8A C;  4GXO A;  2X1D A;  1MJB A;  4BYY A;  2VKV A;  4BQA A;  2L4A A;  2RVC A;  2F5F A;  2J5P A;  1OR7 A;  2RRE A;  2KP6 A;  3ZMS A;  5FD6 A;  3ZQH A;  5CQG A;  2P0W A;  3KZI C;  4Y17 A;  1U5T C;  3BQY A;  2R5Y A;  4HSR A;  5IYC J;  4C9Y A;  2P6S A;  4M3G A;  1WKM A;  2EH3 A;  1SD6 A;  2DMN A;  2ECC A;  4NDL A;  3ZGK A;  5DM7 F;  5K1Y A;  2K5C A;  4I6Z A;  3JAM K;  2MLK A;  2W24 A;  5K5Q A;  1S7A A;  4I01 A;  1ZHF A;  4XKW A;  1KQ9 A;  1UG0 A;  5B5E C;  3FK6 A;  2FQ4 A;  3GZ6 A;  4U0W A;  3GME A;  2CUZ A;  5IPA A;  4HQE A;  1PUE E;  2LTP A;  4L5I A;  2DFE A;  4RM2 A;  1LQ1 A;  3ABK H;  5JHF A;  1XSD A;  1CF7 B;  3QU6 A;  3HIF A;  1WVR A;  4G6Q A;  1X19 A;  1O3T A;  2HPM A;  1U0J A;  4QIW N;  2IW5 A;  2HYJ A;  4XRS A;  3LA2 A;  3E6C C;  4CIC A;  3RJP A;  3NRV A;  1X3W B;  5ICC A;  5K5O A;  2Z99 A;  3CCR I;  2JSP A;  1MW7 A;  2W00 A;  4GYI A;  3CJN A;  2MD0 A;  1UHW A;  5DCF A;  1ZR4 A;  4Y4R A;  3I58 A;  3LSJ A;  1MBK A;  4KUM A;  4W1U A;  3JRI A;  3G6E I;  1CF7 A;  4UUS B;  3J7Z I;  1GV2 A;  1QO0 D;  1IUY A;  3HKZ A;  3H3V K;  1XC5 A;  1KA8 A;  4KIC A;  1VQP I;  3F6O A;  2Q2E A;  2ZSH B;  4A3L J;  1B72 A;  3LL7 A;  3OV8 A;  1ACI A;  4HQM A;  1MMD A;  2IP2 A;  2CG4 A;  4BAY A;  3MFK A;  3RQ4 A;  4U0V A;  4L5J A;  1JHF A;  2Z2S B;  4B47 A;  2M1B A;  1MD0 A;  4ZYG A;  1VQ6 I;  2A68 F;  2VI6 A;  4U87 A;  4RMN A;  3NAU A;  4A2U A;  4HYE A;  3AL0 C;  1BM9 A;  2IGN A;  5K7F A;  2PMH A;  3OL3 A;  2CUF A;  2DT7 B;  2WY8 Q;  4IJA A;  4X0G A;  5L3D A;  4UUT A;  3SDG A;  3TP0 A;  2KL4 A;  1IAW A;  3FMR A;  4BS9 A;  4GCV A;  2DMQ A;  2DOA A;  2NVX J;  2TCT A;  4JX4 A;  1FBS A;  2X85 A;  3DQV C;  3WGH A;  1TQP A;  3GZN B;  3MKZ A;  1XMX A;  1W36 C;  5D8L B;  5HLH A;  4HV6 A;  1V5G A;  1OIS A;  3DEW A;  3PFY A;  3TDZ C;  3ZOB A;  1Y0U A;  1BOA A;  1D0Z A;  1W0T A;  4DBR A;  2K3P A;  3DP7 A;  5EJC A;  3GO5 A;  3A01 B;  4OOI A;  3BDD A;  4UNO A;  5DM6 F;  5F08 A;  3JRC A;  3N97 A;  4IKF A;  3GFI A;  3S2H J;  1N78 A;  3T1B A;  3GEZ A;  4PJM A;  5TIS C;  2L5Q A;  2BY3 A;  3FIW A;  4RB2 C;  3UKG A;  5M3M J;  2RNG A;  5L3E A;  3CF5 F;  2JVG A;  1ON2 A;  1IRZ A;  3BR0 A;  4BNC A;  2B63 J;  2IS1 A;  1VI0 A;  2MGQ A;  1FP2 A;  2VT3 A;  2JA6 J;  5M5W J;  3FMQ A;  3LST A;  4CSW A;  2R7W A;  2W25 A;  2XGD A;  4KIB A;  3TQN A;  4ZDO A;  1U8B A;  1XB4 A;  3ZQL A;  1OCZ H;  2JUG A;  1U6G A;  2OU2 A;  1QPM A;  1XX5 A;  2DQL A;  2JJ7 A;  1ZTR A;  2ZME B;  1HKQ A;  2EA2 A;  3I9V 2;  2BXZ A;  3L7W A;  4ZZL A;  3K4J A;  1P7J A;  2DDB A;  2L7Z A;  2UV1 A;  3DLA A;  3BG5 A;  2XKP A;  1JJ8 C;  1A6Q A;  5TGT A;  1DP7 P;  1ZAR A;  1A04 A;  2YPR A;  1LFU P;  2RQP A;  4C2T A;  1Y56 A;  1P4A A;  2CQ7 A;  3K4K A;  3VFZ A;  3IL2 A;  3CUQ B;  5ERI A;  3MQ0 A;  1E3P A;  1G59 A;  1FBU A;  2JN6 A;  2KZG A;  1YJW I;  2FBI A;  4OIP F;  3F0C A;  2RKH A;  2PFB A;  3ASO H;  1NH3 A;  2ZJQ F;  1SVL A;  1OQY A;  3WTW C;  1SEU A;  3HOS A;  4E7H A;  1TWC J;  3H9J A;  1YOV B;  1ETW A;  3EUK L;  3DKX A;  4HX8 A;  2DAO A;  2FA5 A;  5AIP A;  2GIZ A;  4CH7 A;  1B4A A;  4BAC A;  2KIF A;  2M7B A;  3VOD A;  3CCS I;  2JQ7 A;  2G9W A;  2HOE A;  1HW1 A;  2EZK A;  5BOX A;  2EFO A;  2QUF A;  3KFW X;  2ELK A;  1QA6 A;  5F1R A;  1AKH B;  2O8K A;  4RAF A;  1RET A;  2HZD A;  5D6E A;  2HI3 A;  5LEK A;  4XKB A;  1TNS A;  4LG0 B;  2M8E A;  4BEH A;  3F9K A;  4DYR A;  3WTT C;  1OLT A;  1F4K A;  5JVG F;  4ZYH A;  4NBQ A;  5L3F A;  2JVH A;  2LY9 A;  2ADU A;  1J7K A;  1D5V A;  2R4G A;  4C3J J;  2NVQ J;  2MC3 A;  1SVM A;  1T0F A;  5GPC A;  2FJ1 A;  3F8N A;  1I6X A;  3S1N J;  2FOK A;  5LHG A;  2GZW A;  1IC8 A;  2DI3 A;  5JLX A;  2VT2 A;  4A5N A;  3MKW B;  2XF6 A;  3GW2 A;  4LG0 A;  1W7P D;  1J75 A;  2FX0 A;  5GAD J;  2DJN A;  4MFE A;  1VQN I;  1HKT A;  2QSH X;  4X6A J;  3OYN A;  3CDH A;  1X2M A;  2L9R A;  5J6X A;  2RV8 A;  3WE3 A;  1YO5 C;  1YW9 A;  1LJ9 A;  3K1P A;  3MZY A;  4A3I J;  4Q48 A;  1E3O C;  4Y52 J;  3LFK A;  1IXC A;  2A69 F;  4MFD A;  3PQJ A;  5J8C A;  2E1M C;  3H9G A;  4OIN F;  2D45 A;  3WTY C;  2M34 A;  1G4D A;  2E35 A;  1HC8 A;  3T0Y A;  3U9G A;  1Q1V A;  1RC9 A;  3PNY A;  2XAF A;  4ENM A;  2QSG X;  4M9X A;  3CCY A;  1GLN A;  3G73 A;  3W3C A;  3RPU A;  2DBB A;  3WTV C;  1Y6I A;  3JRB A;  2QCO A;  2R5Z A;  3ABU A;  2DN0 A;  2R7R A;  4XR6 A;  4R8H A;  3HEF A;  4DIQ A;  5BQT A;  2VE9 A;  3QPL A;  2M0M A;  3FXK A;  4YFX F;  3CCQ I;  4RGR A;  4CYC B;  1MBH A;  2HYF A;  4HF0 A;  3QPS A;  4BJ5 C;  3CC4 I;  1JGS A;  1T33 A;  2VBY A;  1JT0 A;  2QZ8 A;  5C4J J;  4LIU A;  4R1H A;  2LOO A;  1YQA A;  1FJL A;  2M4K A;  1TWA J;  1TQI A;  3DTK A;  3S8P A;  3CME I;  3JRE A;  1X3Z B;  3QPT A;  1DU6 A;  2V1U A;  1PP7 U;  4YIR X;  5J1Y A;  1X1A A;  1R36 A;  1MJ9 A;  2F4M B;  1HLV A;  2CWE A;  2A61 A;  1A35 A;  1V55 H;  2KRF A;  2VUM J;  1WJE A;  4UVB A;  5HNH A;  2QGU A;  4CZZ A;  3IRQ A;  2L01 A;  4PFO A;  5CJ9 A;  5EG0 A;  3RPQ A;  4PJ0 C;  1JTX A;  4A69 C;  2BEO A;  2EQR A;  5E8G A;  5DUI A;  3QP6 A;  2R92 J;  3I64 A;  2JA2 A;  2YSR A;  4CXF A;  3GZ5 A;  2A3S A;  4BHC A;  2LR8 A;  4M73 A;  5LEJ A;  5L3G A;  3DKY A;  2F2E A;  3EPZ A;  3HBL A;  1GT0 C;  3A1Y A;  2LK2 A;  5LGU A;  3G3Z A;  2STT A;  2IAI A;  1QVU A;  4E7Z A;  2E71 A;  4KIS A;  2O6G E;  3GUD A;  3D5R C;  2V6E A;  5KAF C;  1QU3 A;  3RI4 A;  1R6R A;  2Y31 A;  1FOX A;  2AQE A;  3EDP A;  3LSR A;  1B1B A;  4AYB A;  1DQU A;  2LBF A;  4RLF A;  4UB8 C;  5CQE A;  3LSM A;  4IEJ A;  3K4B A;  1MSE C;  4C2U A;  2IS2 A;  1FEX A;  3FX3 A;  4XBF A;  2NAZ A;  1R4M B;  2DU9 A;  2L7M P;  3KEQ A;  3ZMV A;  1ODD A;  1BW5 A;  4HNV A;  2TDX A;  4Y3O A;  2CH0 A;  5KCM A;  2YUS A;  3BG3 A;  2KT0 A;  4A3M J;  1WI9 A;  4B44 A;  2E34 A;  5D8K B;  1WJC A;  2BBY A;  2VE8 A;  4HLX A;  3U21 A;  1XTA A;  3H5A A;  2XAQ A;  2OC6 A;  2W1O A;  4M6X A;  4HLY A;  1XD7 A;  3QYE A;  4NHJ A;  1O3Q A;  3VPR A;  4ZH4 F;  2A5W A;  2MC4 A;  1O7L A;  5F0H A;  4Q47 A;  3F3X A;  3FIS A;  3DPT A;  5J3L A;  4XM3 A;  2DOE A;  3BP8 A;  1AWC A;  3MKY B;  2MW8 A;  5E1W A;  5J47 A;  4XRS G;  2CQN A;  2HU9 A;  5J40 A;  2FF4 A;  3HOU J;  4HW0 A;  1J0R A;  1T6S A;  2EIN H;  2IS4 A;  3ZQI A;  3ZMD A;  3ECO A;  3K2Z A;  1R58 A;  2PMZ N;  1SFO J;  3EYI A;  3CLO A;  5IYD J;  4BE2 A;  2V26 A;  4MO7 A;  1IRF A;  1RKT A;  4XL9 A;  4L9T A;  3K2A A;  3FMS A;  2V1N A;  2M30 A;  3PO3 J;  2KLO A;  2H1L A;  2ZCW A;  3RKY A;  5F1J A;  5JR3 A;  2IRF G;  2ISZ A;  1Y1V J;  4BGD A;  1Z1D A;  2H09 A;  1UZC A;  4XRM A;  4BUP A;  1BI1 A;  3HKZ N;  3VOE A;  4DZP A;  1GXP A;  3K9T A;  5H6Q A;  2E1N A;  3LQQ A;  3TO6 A;  1F9N A;  4WXH A;  4OMZ A;  2P7V B;  2JZY A;  1S29 A;  3HZJ A;  3CLQ A;  4MQV A;  2W4S A;  4RAZ A;  2EIK H;  3BTI A;  4RAY A;  2M5W A;  1T2K A;  3QAH A;  5E3O A;  3OYB A;  1XGO A;  3SZG A;  5E3L A;  4BDY A;  3CDL A;  5C44 J;  3J80 Z;  2XF5 A;  1FIA A;  4BKX A;  1IDZ A;  3TDU C;  4F92 B;  1ULY A;  1R4N B;  1QZY A;  2CJJ A;  3K4L A;  2DA5 A;  5E18 F;  3TW6 A;  4DNC A;  3HSF A;  1GVD A;  2VN2 A;  1ZLK A;  5F04 A;  2QEX I;  3JRG A;  1UFM A;  1X1C A;  1PP8 F;  2H8R A;  1ZLJ A;  3GBG A;  3AG2 H;  4KFC A;  4DYC A;  4M3B A;  4OAY A;  4EJU A;  2XRN A;  2FNA A;  3E1S A;  4HNT A;  1BI3 A;  3LMM A;  3R6S A;  3CCU I;  4B3A A;  2K27 A;  2ELH A;  1AU7 A;  4A3D J;  1A5J A;  2E5Z A;  2ACJ A;  2HDC A;  3RYR A;  5F64 A;  1YX3 A;  1S9H A;  2DMT A;  3FXM A;  4N9H A;  3WTU C;  5KAI C;  4IQJ A;  3D5S C;  3CCE I;  1R9T J;  2BE5 F;  5IP6 A;  4MQ9 F;  3D5L A;  2GQQ A;  2QSF X;  2STW A;  1EJ9 A;  1W7P B;  1WI3 A;  2PJP A;  2OCC H;  1D8K A;  2E7X A;  1QRY A;  4XID A;  1BC7 C;  1AA7 A;  2DFI A;  4M9S A;  3B73 A;  1Z3X A;  3JR9 A;  1R5H A;  2P8T A;  3GFM A;  3ZR8 X;  4EM0 B;  1R71 A;  1XS9 A;  1A36 A;  3I59 B;  4JP0 A;  4O5V A;  1UAA A;  1IDY A;  1R22 A;  1X2N A;  3LAP A;  1S72 I;  2YU9 J;  1HW5 A;  3FWE A;  4II2 A;  1LE8 B;  2DOD A;  3CC2 I;  4XOT A;  4AVP A;  3LOC A;  3KYC B;  2EV0 A;  2K9N A;  1JUP A;  5F0F A;  2K85 A;  4FET A;  3H1C A;  5LGN A;  4EJV A;  2KIM A;  1UHM A;  4FT8 A;  1VQ5 I;  1WWX A;  3DF8 A;  4LLN A;  4F55 A;  1OCT C;  1B8I B;  4XSX F;  1HOM A;  2ZME C;  3ABT A;  3K1N A;  4FQG A;  2KHM A;  2JT1 A;  2WY7 Q;  3G1L A;  5GTH C;  1IN7 A;  1LE8 A;  4I09 A;  4MHG A;  4XK4 A;  1TWH J;  1EF4 A;  2G7H A;  3Q5F A;  2F5V A;  1IGN A;  2W48 A;  3IV5 A;  3FK7 A;  5ILU A;  2VJ4 A;  1JTY A;  1DGW Y;  2R7Z J;  4PK4 A;  2K02 A;  1D3Y A;  3E7L A;  1YS6 A;  2Z3Y A;  5LD2 C;  2H6B A;  1WH7 A;  4ENJ A;  1M1E B;  4HOB A;  4I0B A;  2LD5 A;  5IP7 J;  5AON A;  1O3S A;  3CJR B;  1V3F A;  1ZRE A;  2VOO A;  3OMY A;  4XOP A;  4RS8 A;  5B3S H;  2P7C B;  3W6K B;  3L1P A;  2Y75 A;  1R5I D;  4Z2Y A;  5DCM A;  1MGT A;  3ZQQ A;  2R7T A;  2EIL H;  2K3F A;  1K6O A;  4HG2 A;  3K70 D;  2MH9 A;  2KJC A;  2VPR A;  3M07 A;  2E2H J;  4O6J A;  1IXS B;  1FX7 A;  4HAM A;  2O9L A;  2LYC A;  4Y33 A;  1I1G A;  3HTU A;  5AIQ A;  4HST A;  3F21 A;  5ED4 A;  2A07 F;  4RGS A;  3BR2 A;  2O0Y A;  1ETY A;  2ZJ2 A;  3HGG A;  3CDI A;  4D1Q A;  1UG2 A;  2P5L C;  3AFH A;  3RYP A;  1SFE A;  1E3H A;  2DT5 A;  5IP9 J;  5BS6 A;  2A6T A;  3OYC A;  3CCV I;  1YJN I;  1IJW C;  2ZXI A;  2ZC2 A;  2XSJ C;  2HVQ A;  3QP5 A;  1MDM A;  2XHK A;  1LUJ B;  3M1C A;  5HLG A;  4FHT A;  3VSK A;  4EV0 A;  4X1E A;  1HBX G;  1MBF A;  3RTR A;  2NS8 A;  4F91 B;  2A6E F;  3W2V A;  1KU2 A;  5DYM A;  4ZTF A;  1MH3 A;  4LJZ F;  4AC0 A;  3M4O J;  4HBL A;  2PLY A;  1GV5 A;  3KEO A;  1WJD A;  5LLQ A;  3MVP A;  1UB9 A;  9ANT A;  2ELJ A;  1MH4 A;  1HDP A;  3O8H A;  4ABZ A;  5B1B H;  1P92 A;  2Y2Z A;  1Z91 A;  5C4X J;  3NEU A;  4ZZD A;  5D4R A;  4B3X A;  1NHA A;  3DTE A;  3RPU D;  5DEQ A;  3ZN0 A;  4OU0 A;  2V1X A;  2HZT A;  4HEA 2;  1Q1H A;  2MAB A;  1X1P A;  4ZC3 A;  2XIG A;  3SEQ A;  4IVN A;  3AG3 H;  4EEF G;  1VQO I;  2VOD A;  1D1B A;  3LA7 A;  2QM3 A;  4E7S A;  1T38 A;  3E5U A;  4FCY A;  1K78 B;  2NXN B;  1GHC A;  2N8G A;  2XRO A;  1YFH A;  1W5S A;  5E17 F;  3W6J B;  3EET A;  2OTJ I;  2XGE A;  4U7B A;  4Y15 A;  1R00 A;  3BG7 A;  2FMY A;  1XGM A;  1BBY A;  5FRN A;  2V9P A;  4B09 A;  5IOY A;  2DW4 A;  1BR1 A;  4FX4 A;  3H35 A;  3WOD F;  2BVL A;  5D5X B;  3RKW A;  2IA2 A;  4GRI A;  3KP5 A;  2MD5 A;  4YEJ A;  4BQO A;  1IO2 A;  2OAZ A;  2B7E A;  1Z6T A;  1JKP C;  3CD6 I;  2WV1 A;  4J19 A;  5GAG J;  1QHH D;  4E6K G;  1K4S A;  1ETO A;  4XLE A;  2P4W A;  3BR6 A;  4FTH A;  5K7Z A;  1X1B A;  3HC7 A;  1CGP A;  3BC8 A;  2IBD A;  4IRH A;  3F8B A;  2Y0S N;  4RA2 A;  3SFZ A;  3JSP A;  3SXY A;  3OIO A;  1XCB A;  1Y8Q B;  5BPD A;  3DU6 A;  4C2M J;  2H94 A;  4CCO A;  3S1R J;  2HDW A;  1FSE A;  3C18 A;  5CVR A;  4UUS A;  3OYM A;  2HQN A;  3CCJ I;  3PJR A;  4V19 K;  3DCF A;  2HTS A;  1SMY F;  2ZSI B;  2GWR A;  4IHX A;  2DMU A;  2V9V A;  2EA4 A;  1J59 A;  5B1A H;  4RM3 A;  1DGR M;  3CMA I;  4P9F A;  4Y7N J;  2V79 A;  5BPI A;  4AWX B;  2XC7 A;  1VQ9 I;  2ZO4 A;  5D4S A;  3CJQ B;  5M5X J;  4EVI A;  1MBE A;  4PJJ A;  2IPQ X;  3LWF A;  3G4S I;  4CCK A;  4DYQ A;  5HS8 A;  4Q5S F;  4DW6 A;  4UVA A;  5A2Q K;  2R7D A;  5EGO B;  3S15 J;  3IAM 2;  4ZYE A;  4JK1 X;  1F5T A;  5TJJ A;  3JSO A;  4PZJ A;  2LVS A;  1FMW A;  2KRC A;  3WE2 A;  2WTE A;  1BI0 A;  1IV8 A;  2ZXW H;  3RZD J;  3DFG A;  2VC1 A;  1QPI A;  1QHG A;  3OYK A;  1LVK A;  2RN7 A;  2MSY A;  4XLC A;  2OZ6 A;  2HFH A;  4QPO A;  1JGG A;  3CUO A;  1ZRC A;  4G12 A;  4TV7 A;  4IQ4 A;  2AXL A;  4LIV A;  2DQR A;  2ZNY A;  4HDV A;  4A6D A;  1W36 D;  2DK5 A;  3WGI A;  1YIJ I;  2JTV A;  2GIV A;  3JW4 A;  2OD5 A;  3KPH A;  3I53 A;  3A02 A;  5DDG A;  2D1V A;  3V8K A;  3A01 A;  2CFX A;  3S3O A;  1SD7 A;  3FBI B;  3QYB A;  1VQ4 I;  2RQQ A;  3HOV J;  1Z3Y A;  1D0Y A;  4CHU A;  3GTO J;  5KNL A;  4XKC A;  2FQ3 A;  4EQQ A;  2X51 A;  4WXD A;  5H2F C;  3FXO A;  4II3 A;  4WK8 F;  5HOO A;  3GTP J;  1KU9 A;  2NOJ B;  2QQ9 A;  2MLG A;  2M3A A;  4G8X A;  3TMO A;  1T08 B;  2R7X A;  2ID6 A;  4XN0 A;  2CW8 A;  2UXX A;  2ZME A;  1I3Q J;  4DQ2 A;  2QKM B;  2FXA A;  2IA0 A;  5LRR A;  3GX4 X;  2CRG A;  1SAU A;  3DBR B;  2M0C A;  4RGU A;  4BQQ A;  2V9K A;  4KNY A;  1V4R A;  2IEK A;  4XLN F;  2L54 A;  2XPW A;  3CMM A;  4PGH A;  4RLQ A;  4EM2 A;  3GTQ J;  4BHP A;  2BW3 B;  2AQF A;  3U1K A;  3ZQ7 A;  3DLL F;  3L2Q A;  3VYU B;  3KP4 A;  1GVJ A;  1APL C;  4LGW A;  2IGO A;  3CUQ A;  3LSH A;  5E3M A;  3E5Q A;  4GGG A;  2XF7 A;  2DCE A;  2NYX A;  2V6C A;  2BGC A;  1D0X A;  1YW8 A;  1QBJ A;  4A3C J;  1QGP A;  1WGX A;  3V42 A;  5ILV A;  1WJB A;  2FML A;  3EYY A;  3QU3 A;  3CES A;  4DGW B;  4BY1 J;  2CW0 F;  3W2W A;  3M9A A;  2X4H A;  5M5Y J;  2HR3 A;  2VQG A;  1U9O A;  1FC3 A;  2XB5 A;  4HZF A;  2L3D A;  1T8I A;  1WHU A;  1PJR A;  3K6G A;  2BHY A;  2DOF A;  4JBA A;  4WX9 A;  1AKH A;  1Y1W J;  2OTL I;  2XPU A;  3HM5 A;  3R0J A;  4OMY A;  2HXO A;  3HGY A;  2WB1 A;  5J1R A;  2QQA A;  3AG1 H;  2XAH A;  2VKH A;  2WAE A;  4LK0 F;  4NQW B;  1KQ0 A;  2CV1 A;  4I2O A;  1R23 A;  3QOD A;  2E1C A;  1B9M A;  2HKO A;  1X1D A;  1I1S A;  1YX5 A;  3P9I A;  1TWG J;  3BRO A;  2QVO A;  4M6Y A;  4NC7 A;  1XSX A;  3S2W A;  1JT6 A;  2LG4 A;  1DDN A;  2D5V A;  3G71 I;  1B9N A;  3JRD A;  2MA3 A;  2VBZ A;  1A31 A;  1YIO A;  4KN4 X;  4A3G J;  2BXY A;  3LA3 A;  1MIJ A;  2AXT C;  2VXZ A;  2R7Q A;  3M8J A;  3AAF A;  5DS9 A;  5IT3 A;  3BY6 A;  4B43 A;  4QTR A;  5EEA A;  1H9G A;  1HXD A;  1G3T A;  1J5Y A;  4EJT A;  1BL0 A;  1BOB A;  4YII A;  1YIT I;  3ZMU A;  4Y13 A;  3PO2 J;  4MNU A;  2GBY A;  4XKV A;  4IHT A;  4EMS A;  3GFL A;  4LD5 A;  1G6N A;  3BPX A;  4EGY A;  2R7V A;  1YYV A;  5H20 A;  1BI2 A;  5CVI A;  4V2G A;  1MJA A;  3GWZ A;  3K69 A;  4P55 A;  2ZXJ A;  2PJR B;  4G7Z F;  1J09 A;  4CYC A;  4KT5 C;  4UUV A;  2AO9 A;  1OKR A;  3Q9S A;  1EH6 A;  4NUB A;  3H5R A;  1SC7 A;  2WAD A;  3UR3 C;  2K4J A;  1B59 A;  1TLH B;  5GTI C;  1YE9 A;  1R7J A;  3CZ6 A;  2P81 A;  1LDD A;  4MTD A;  5CYV A;  4E7L A;  1MMA A;  5FGM A;  4A3E J;  5F27 A;  4DZJ A;  3V8J A;  2OV7 A;  2IA1 A;  3HXL A;  1SFX A;  2OQR A;  2JK3 A;  2TRT A;  3PUF A;  3PFI A;  3OYL A;  4HV5 A;  3PNV A;  2VKD A;  2PJR A;  3DBL B;  4PDK A;  1TT5 B;  5D5V B;  1TQM A;  4RDU A;  4P9U A;  3ABM H;  2NVY J;  2HGC A;  5E8I A;  5ICE A;  2WAQ A;  3SYT A;  1FTZ A;  3RZO J;  1BA5 A;  2OF7 A;  3OYG A;  2CSO A;  2M45 A;  4LB6 B;  2LFB A;  5HLT A;  3HPH A;  3BLY A;  1OYY A;  2W82 A;  3COA C;  2XAJ A;  3KEY A;  3PIO F;  3IAS 2;  3HHH A;  1SFU A;  2F4O B;  5JLW A;  2MBF A;  1H88 C;  2QA4 I;  1SAX A;  3DU5 A;  3HSR A;  1JJ6 C;  5FLX K;  3I4P A;  5KVR A;  3RIR A;  1N77 A;  2JPB A;  2PEX A;  1W5T A;  5ICG A;  2HQ5 A;  4P5O A;  4RGX A;  5IT9 Z;  1LDK B;  4S04 A;  2Z16 A;  2Y48 A;  2J5O A;  3IC7 A;  4E4H A;  4ESF A;  1W5C C;  4LLG F;  4FE4 A;  4XLA A;  3C2G A;  4BE1 A;  4I99 C;  5F0C A;  2PQ8 A;  1ONV A;  5J8F A;  3NQO A;  5GAE J;  2E2J J;  2L7F P;  1L3L A;  2L7K A;  2CQX A;  1T56 A;  3SDB A;  2H27 A;  1MKM A;  1JKO C;  2E60 A;  3S17 J;  3TKY A;  4WWC A;  3OR2 C;  1HSJ A;  5HDK A;  1EV7 A;  2X0L A;  2E36 A;  2XGX A;  4ANJ A;  2WBM A;  1FSH A;  2ZNZ A;  1KYZ A;  2KDZ A;  3KZY A;  2M8G X;  2X1C A;  3GF2 A;  1BIB A;  2IS6 A;  5KHD A;  2H6C A;  2M9H A;  5D5W B;  2LY1 A;  4O3M A;  3GVA A;  4BL0 B;  2KMU A;  1BJA A;  3OYI A;  2Z33 A;  4BBS J;  2LY2 A;  3EUA A;  3PNT A;  4GDF A;  1ZQ3 P;  1IUF A;  4BQN A;  3S2D J;  2YS9 A;  2COB A;  1TP4 A;  5FRO A;  1TW2 A;  1BJZ A;  2LKP A;  2HQA A;  3PIP F;  4YG2 F;  3OS0 A;  3E6B A;  3EUH C;  3BOQ A;  3V7R A;  3OYJ A;  2CQQ A;  3KYD B;  1V5E A;  2HS5 A;  2JA8 J;  2KPM A;  3HRT A;  3BJA A;  2XSD C;  1IRG A;  3PQK A;  2QQ8 A;  2LKS A;  3H3U A;  1FOK A;  4IZZ A;  1EKE A;  4D9J A;  2KRH A;  2GA2 A;  2ZFW A;  1HST A;  2I5U A;  3OYF A;  5LBQ A;  1SD4 A;  3MEX A;  5E79 C;  5J4V A;  5E20 A;  5LHI A;  3ML6 A;  2HVR A;  2FRH A;  4MIM A;  3HOZ J;  3BZK A;  3L2V A;  4LB5 A;  3JAM Z;  3J7A O;  4MLO A;  2EFP A;  1PDN C;  1O7F A;  1YW7 A;  2HTJ A;  2YX7 A;  2E1O A;  2LLK A;  1P6R A;  3HUG B;  2R3S A;  3L00 A;  1RI7 A;  1BR2 A;  2NRA C;  2L0K A;  4CA0 A;  1T95 A;  4QLC U;  3OSF A;  2ID3 A;  4N4N B;  1YRN B;  4NC8 A;  2KIS A;  5FFZ A;  4J00 A;  3P7N A;  3HOX J;  3GTL J;  1F36 A;  2K9L A;  5H6R A;  3IH2 A;  4H4K C;  2W84 A;  3MMY B;  3S1M J;  2G7U A;  2ETH A;  4G7O F;  5DUK A;  2X48 A;  2DK8 A;  1IN8 A;  2HOT A;  4IRI A;  4I02 A;  1ZEL A;  1OCR H;  3T8T A;  4AM3 A;  4YRV A;  1K79 A;  3V4G A;  6PAX A;  5KK1 A;  3GTJ J;  3K10 A;  2M4G A;  3WTZ A;  2QBY B;  2L9S A;  2ZXH A;  2F4I A;  4ITV A;  5EDN A;  4LK1 F;  4KYW A;  3ROU A;  1TWF J;  4LOC A;  3VDX A;  3REO A;  1K6Y A;  4JX5 A;  1HDD C;  2I8D A;  1W7P A;  3I0T A;  2XGC A;  4F7Z A;  1RES A;  5JI6 A;  4IHV A;  3DEU A;  3ERE D;  2RAE A;  4PCQ A;  1ZG3 A;  3I4M J;  4N0B A;  1HQC A;  3H9Q A;  2BOL A;  4A0Y A;  3I59 A;  2QBY A;  2IT0 A;  2QQB A;  5C3E J;  4U7D A;  2EFQ A;  1ORK A;  2X9D A;  4N9I A;  5FFX A;  3OYE A;  1W1W E;  4YFN F;  4A12 A;  1YI2 I;  2DJI A;  4IRG A;  3BR1 A;  3NWS A;  2E2I J;  3O2P E;  3E6M A;  3I4N J;  2NS0 A;  2K86 A;  3KX2 A;  2BHZ A;  4LMY A;  3FDY A;  4RAG A;  4QSH A;  2XPV A;  3FKI J;  4OIR F;  4G6T B;  3H0D A;  2KZV A;  1FYK A;  2EJR A;  2DPU A;  5E3N A;  3I55 I;  1LDJ A;  1S7E A;  2O03 A;  2E7W A;  3IUO A;  3MN2 A;  3E97 A;  1NG7 A;  3H0G J;  3SQN A;  2VQC A;  1TC3 C;  3ZXS A;  1B8I A;  2FOW A;  3CUQ C;  1IG7 A;  3X2Q H;  2GXG A;  4FE7 A;  3H5N A;  1OCP A;  1ZRF A;  1HF0 A;  4Q4Z F;  2QEN A;  2VC0 A;  2ICW G;  4U88 A;  2CV0 A;  3N4M A;  1QVT A;  2GOX B;  4HPQ A;  1S6L A;  4W97 A;  3MAJ A;  1UCR A;  2ZB9 A;  1WZ2 A;  1ZAO A;  1LVA A;  3H92 A;  2VON A;  1WCM J;  2DA3 A;  2LC2 A;  3E0J B;  2DPD A;  3HYI A;  4B1R A;  3L2C A;  1MNE A;  1P4W A;  2NNN A;  3BJ6 A;  4M3E A;  1NK2 P;  1VQ8 I;  4KMU X;  2GXA A;  3K4N A;  4A0X A;  1J9I A;  2L9N A;  1FOW A;  3BG6 A;  4PJN A;  2ECB A;  3OL4 A;  1Z0X A;  1X4P A;  4M3F A;  2V1D A;  2M87 A;  1ZN2 A;  2VOP A;  2G0E A;  1DPU A;  2ESH A;  2Q0O A;  5EEH A;  3WG7 H;  2CMP A;  1H0M A;  1OMI A;  4AIH A;  4A3B J;  2V7F A;  3VYS B;  1OYW A;  5FKK A;  3WHB A;  2W7N A;  1MMG A;  3S16 J;  3R0A A;  5FRM A;  1OJL A;  2DFH A;  3CQZ J;  3HDD A;  2HNH A;  4IHS A;  1F1Z A;  2OCE A;  3GFJ A;  3OY9 A;  2UZK A;  4ESJ A;  1AOY A;  2LRE A;  3TL4 X;  1HKS A;  4AUX A;  1Z21 A;  4A3K J;  3KP7 A;  1PUF B;  2JSC A;  4XMY A;  5IY5 H;  4G6D A;  1JUM A;  4RB3 C;  3P5J A;  3S14 J;  4L5E A;  3CC7 I;  2KIQ A;  3PM1 A;  1LB2 A;  2AHQ A;  4M74 A;  1FWZ A;  2DA2 A;  1AHD P;  3ONQ A;  3K1M A;  2XAS A;  4L9N A;  2WWY A;  1ZR2 A;  4CYD A;  3BCA A;  4BJ6 C;  2YR2 A;  2FD5 A;  1KON A;  1QNT A;  1TT0 A;  1H89 C;  3UNG C;  1BN5 A;  3IHU A;  1PUF A;  2X6X A;  1ZKG A;  3I3L A;  1S5L C;  5CVU A;  2DYR H;  1U78 A;  2HEO A;  4UXN A;  4ENK A;  3FXL A;  4R79 A;  3DWL E;  2EPF A;  2R5Y B;  1S7O A;  4G94 A;  2JPC A;  1TZL A;  3CJT B;  1A6I A;  3GXO A;  2XV4 S;  4ZDL A;  3GYH X;  1FT9 A;  4KDP A;  1ITY A;  1JKR C;  1F43 A;  3CCM I;  1SFK A;  4XN3 A;  4IHW A;  3AG4 H;  3TW7 A;  1P9Q C;  4YIF A;  2EK5 A;  2BY1 A;  2XDV A;  3J80 K;  2X6Y A;  1FTT A;  2ZJP F;  2F5E A;  3HOY J;  4CCN A;  2KDO A;  3ULQ B;  4XLP F;  1JI8 A;  2A05 A;  1FZP B;  1LEA A;  5CKT A;  3PSI A;  3L2W A;  2L2O A;  1X4O A;  2VJJ A;  1RUO A;  2GOM A;  2B0L A;  3T5X A;  4XON A;  3OS1 A;  2WA0 A;  2OA4 A;  2GA1 A;  2BY0 A;  1D5Y A;  3Q9V A;  1ZGW A;  1XN7 A;  4HA8 A;  3VWB A;  1BW6 A;  3IKT A;  4ZTJ A;  1O3R A;  1YG2 A;  1EH7 A;  2F48 A;  2X1E A;  4L0Y B;  1PVE A;  4YFK F;  3WHC A;  2IGK A;  3BR3 A;  1EH8 A;  2RGV A;  3RCO A;  1K78 A;  4G7H F;  3BWG A;  3QYF A;  4AU7 A;  5K5R A;  1YLF A;  4FAS D;  2WAQ N;  2GM4 A;  1MBJ A;  4KIF A;  2CYY A;  1V5F A;  2LRD A;  3HPG A;  1X3U A;  2DA7 A;  3F8M A;  3OWT A;  3S3N A;  1Z7U A;  1P2F A;  3I54 A;  5D6F A;  2KIU A;  1VQ7 I;  4PSW A;  2EB7 A;  1Z67 A;  4AYB N;  2RC4 A;  2PMZ A;  3U1D A;  5B66 C;  3VYR B;  2Q2E B;  2VIX A;  3D1N I;  2IJL A;  3C1D A;  1JHH A;  1WJF A;  3M8E A;  3WTS C;  1B72 B;  5LRS A;  2PI0 A;  4PUS A;  3EUH A;  5J1U A;  3B6C A;  4K2E A;  2LNB A;  3E3V A;  1P7I A;  2DA6 A;  1E2X A;  1VF9 A;  2QF7 A;  4MEX F;  4IXA A;  1R49 A;  2GXB A;  3FXU A;  5HDG A;  1BIA A;  2LDU A;  2R7F A;  2Z9O A;  2VBX A;  2EV6 A;  2IXS A;  4HX7 A;  2XVC A;  2GLO A;  3H3Z A;  1N25 A;  4YEL A;  4PSX A;  5DD4 A;  1JE8 A;  1IN4 A;  3QOP A;  4DJA A;  5LGT A;  1G3S A;  2VJI A;  3V7C A;  2CW7 A;  3OSG A;  2COM A;  3F8C A;  4L9J A;  2XAU A;  3FZV A;  5GP9 A;  3L9F A;  3K7A J;  3P9K A;  1J2X A;  2ZKZ A;  4I0A A;  3TP3 A;  1JXS A;  5FLM J;  3JTG A;  5ICF A;  2FSW A;  2KJB A;  4A3J J;  3DBH B;  3LSK A;  4S05 A;  4XSZ F;  4EM1 A;  2VAS A;  4XQF A;  1ZH5 A;  4IOA F;  1D1C A;  2KQR A;  2QWW A;  4HF1 A;  4U0Y A;  1K61 A;  4UV8 A;  1K7A A;  1RPW A;  4BU2 A;  1IW7 F;  3K0L A;  4A3F J;  3KP3 A;  3R4K A;  1RUN A;  3C7J A;  3FF5 A;  4KN7 X;  3GTK J;  2F5C A;  2EIM H;  1ERD A;  2EIJ H;  1XG1 A;  2CUJ A;  3C2H A;  4EJW A;  2R93 J;  4PFP A;  2A5Y B;  3F22 A;  3J81 K;  4XRF A;  1G2H A;  2IVM A;  3DEE A;  5EGO A;  1TW3 A;  3KE2 A;  1UHS A;  4BDZ A;  4LG3 A;  1UST A;  3J7Y J;  4EGZ A;  1SAN A;  2EWN A;  4M72 A;  1MMS A;  1T98 A;  4IF4 A;  3KET A;  2V4J C;  3A0B C;  3SZT A;  2EZL A;  1RZ4 A;  2DTR A;  2KKO A;  3QQA A;  3FXQ A;  1V54 H;  3ZCO A;  1R1V A;  5JVT A;  2JRM A;  3BJO A;  3MKL A;  4CDG A;  3Q0U A;  2LF8 A;  3ZQF A;  1MZB A;  3HRU A;  2FEZ A;  1I6H J;  2H8W A;  2QLZ A;  1E0E A;  4UV9 A;  5FLX Z;  4B4C A;  3HRM A;  2KFD A;  2UXN A;  2NVU B;  2L02 A;  1BR4 A;  3KIO A;  1IN5 A;  4D7M A;  1TL8 A;  1VFC A;  4ZYD A;  5EYR A;  3KP2 A;  3TBI A;  1RR8 C;  1EA3 A;  2JA7 J;  3IRR A;  2L9V A;  1HW2 A;  2K7L A;  3MD2 A;  3SZP A;  2Y69 H;  3M3Y J;  3K4C A;  3KCC A;  3OOP A;  2W57 A;  4ZJZ A;  3H36 A;  2FBH A;  4UB6 C;  5FD5 A;  3LAJ A;  3U2R A;  2EZH A;  4I76 A;  2DDA A;  2OZU A;  3A0H C;  3W6V A;  4P96 A;  4FIS A;  1PYV A;  2LP0 A;  1WQ2 A;  4HDU A;  4XLF A;  2YU3 A;  4FX0 A;  1MBG A;  3G1M A;  2FU4 A;  1Z7L A;  3PUB A;  4EAT A;  1UJ8 A;  3L09 A;  4D7N A;  4BEH B;  3WG9 A;  1I5Z A;  3FHZ A;  3IP4 B;  4V2F A;  4I98 B;  2VXD A;  3F6V A;  5J4Y A;  3WU0 A;  1RKW A;  2XAG A;  5CVJ A;  3WGG A;  2BW3 A;  2ISY A;  5DD8 A;  4HX4 A;  4A0Z A;  2VQL A;  3R61 A;  2K40 A;  1U3E M;  3B6A A;  4M3D A;  1STZ A;  4L18 B;  1P4X A;  3SJM A;  2Z1D A;  3KLN A;  4RB1 A;  1RRJ A;  4Z6Y A;  3IWZ A;  3OYH A;  4ZYA A;  2PX9 A;  3DTI A;  3G1O A;  3B02 A;  4CGZ A;  3R60 A;  4C3H J;  2X6W A;  1XCV A;  4XOR A;  2PBI A;  5L3C A;  3FHN A;  3BPV A;  5CPR B;  3K4M A;  3ZQG A;  1JUS A;  4CCM A;  1WSU A;  1ETX A;  2CO5 A;  1ZG1 A;  1K83 J;  3DV8 A;  1GUU A;  3HHG A;  5CVV A;  3L2U A;  2Y30 A;  4OWR B;  4KA4 A;  4BE0 A;  2ZJR F;  4XLH A;  2HDD A;  1TBX A;  2ME6 A;  3E5X A;  4NQW A;  1O57 A;  4A5M A;  2VQH A;  3JRA A;  5EEG A;  3WU1 B;  2R5Z B;  4ON0 A;  1REP C;  2HXI A;  2Q1Z B;  3O6B B;  3KYL A;  3TED A;  4HF2 A;  1FIP A;  4JYK A;  5LFA A;  3VSL A;  4MTE A;  2HQR A;  1OCO H;  2K9S A;  2XKO A;  3TOB A;  2MYS A;  3SHF A;  1QQI A;  2VPL A;  2DA4 A;  2K9M A;  2QYO A;  3SFI A;  1U2W A;  2M2E A;  2CS3 A;  1RNL A;  2LF7 A;  3ISP A;  3ABL H;  1Z9C A;  3LQR A;  3V8L A;  4DOZ A;  5IOZ A;  2O61 A;  1XGN A;  4CCJ A;  1USS A;  2JRT A;  1U5T B;  3BTC A;  3ZMT A;  4B8X A;  4CO8 A;  3J7A Y;  3RDI A;  1NG6 A;  1W0U A;  1DUX C;  3OIP A;  4A93 J;  1R1U A;  2PN6 A;  5FJ8 J;  2FBK A;  1I39 A;  2JWT A;  4AIK A;  1XDU A;  4LFU A;  3FM5 A;  2BZT A;  4IOC F;  1IRX A;  4PGG A;  1MND A;  2Y0M A;  2LSO A;  2K4B A;  3QPH A;  4PJL A;  1XSV A;  1Y0N A;  2DT6 A;  2XB0 X;  1X58 A;  2RNJ A;  1ENH A;  3BQZ A;  1U5T A;  4IO9 F;  3RKX A;  5HNF A;  5EG0 B;  4L9V A;  3RQI A;  1I50 J;  5CLS A;  3GLX A;  3ESW B;  3OYD A;  4WXC A;  3RSN A;  1FYM A;  1Z05 A;  4E7J A;  1YS7 A;  5TRD A;  3NAR A;  4LIT A;  2VJ5 A;  1MNM C;  3A4C A;  1I27 A;  4BH9 A;  1FYL A;  3DPU A;  1R5G A;  2O7O A;  3I71 A;  4GYG A;  3IWF A;  4GO1 A;  5EZH A;  3FM3 A;  4C3I J;  2ZFU A;  3ZPL A;  1BC8 C;  1E17 A;  1KQ8 A;  1FY7 A;  3ASN H;  5L3B A;  1RIO H;  2NVT J;  4E70 A;  4IX7 A;  1ZK8 A;  1KYW A;  3FKJ A;  1WFX A;  4S0H B;  3PL8 A;  4OAZ A;  1R1T A;  1LKX A;  3FBN B;  4UY8 I;  4CUG A;  1IN6 A;  4M9Z A;  1ZGJ A;  2LBF B;  1U8R A;  4UVC A;  1LEB A;  1IF1 A;  3QRF F;  4E7K A;  3S3M A;  4QWQ A;  3LNQ A;  1XDS A;  1ETK A;  2OBP A;  1ZRD A;  2R0Q C;  1G8X A;  4WF2 A;  5HDN A;  1T39 A;  5FKO A;  3S1Q J;  3M7G A;  1YHQ I;  1I3A A;  5FKN A;  2C6Y A;  4BJT A;  3ZQC A;  4MGR A;  1HA8 A;  1OCC H;  2OQG A;  2JUC A;  5EF6 A;  5FLV A;  4G9Y A;  3AL0 B;  2DYS H;  1OFC X;  2EV5 A;  2Y0S A;  1IV6 A;  3MCZ A;  1FP1 D; 
#chains in the Genus database with same CATH homology
 4XKB A;  1OR7 C;  3G2B A;  4XNF A;  4BEH A;  3F9K A;  4G6T B;  3H0D A;  2KZV A;  2WAF A;  1OLT A;  1QHH D;  3IUO A;  2JVH A;  4E6K G;  1NG7 A;  4XLE A;  2R4G A;  2VQC A;  3N05 A;  4C30 A;  3ZXS A;  3NWT A;  4NNJ A;  1WJA A;  1LFP A;  1FMV A;  1X1B A;  2OUM A;  3HC7 A;  2E5N A;  3BC8 A;  3H5N A;  4KIT B;  3OR1 C;  2CV0 A;  3MKW B;  2XF6 A;  2GOX B;  4HPQ A;  3L2R A;  3PSF A;  3DU6 A;  4P1W A;  4CCO A;  2FUG 2;  3OYN A;  1WJ5 A;  2HDW A;  3OYM A;  2LC2 A;  3E0J B;  3PJR A;  1MNE A;  2ZSI B;  3K4N A;  3OS2 A;  2L9N A;  3BG6 A;  2E1M C;  3H9G A;  4PJN A;  4RM3 A;  1DGR M;  3OL4 A;  1X4P A;  2XC7 A;  4JOM A;  4F93 B;  3PNY A;  3CJQ B;  2CMP A;  4PJJ A;  1GLN A;  4CCK A;  2V7F A;  3VYS B;  4J01 A;  3W3C A;  1Y6I A;  2W7N A;  1MMG A;  3IAM 2;  5FRM A;  1FMW A;  3LFU A;  3OYA A;  2HNH A;  2R7R A;  4XR6 A;  4DIQ A;  2KRC A;  3OY9 A;  3CF2 A;  2M0M A;  3ZRG A;  1QHG A;  2LRE A;  3OYK A;  1LVK A;  3TL4 X;  4XLC A;  4BJ5 C;  1Z21 A;  4QPO A;  1N75 A;  4DBQ A;  3CP2 A;  2R7S A;  4XMY A;  4LIU A;  2LOO A;  2UWM A;  4IQ4 A;  1UEL B;  4LIV A;  1VZ0 A;  1W36 D;  2M4K A;  4KT6 A;  3DTK A;  3S8P A;  3CP8 A;  3ONQ A;  1D1A A;  3BCA A;  4BJ6 C;  3S3O A;  1KON A;  1TT0 A;  3FBI B;  3UNG C;  3QYB A;  1X1A A;  2RQQ A;  2X6X A;  1Z3Y A;  3I3L A;  1D0Y A;  3BCB A;  4CZC A;  5KNL A;  1WJE A;  4R79 A;  3A2K A;  5HNH A;  4XKC A;  3DWL E;  3QOE A;  2UUZ A;  3HOT A;  3VYT B;  2X51 A;  1TZL A;  4JQF A;  4PFO A;  4ZDL A;  4II3 A;  5HOO A;  2NOJ B;  2M3A A;  1SFK A;  3TMO A;  4XN3 A;  2R7X A;  1P9Q C;  4XN0 A;  2CW8 A;  2XDV A;  3HG9 A;  2JA2 A;  2QKM B;  2X6Y A;  4E7I A;  1JI8 A;  4CCN A;  2KDO A;  3DKY A;  5CKT A;  2R7O A;  3PSI A;  4CCL A;  2L2O A;  1X4O A;  4F3Q A;  3EPZ A;  3L2W A;  2VJJ A;  3A1Y A;  1SAU A;  2GOM A;  4BQQ A;  4XON A;  2V9K A;  3OS1 A;  2CV2 A;  4E7Z A;  2WA0 A;  3S32 A;  3CMM A;  4RLQ A;  4HRI A;  4KIS A;  2BW3 B;  2V6E A;  3D5R C;  2AQF A;  3L2Q A;  3VYU B;  3LSI A;  1R6R A;  3VWB A;  1QU3 A;  2AQE A;  4ZTJ A;  2X1E A;  2IGO A;  3LSH A;  4AYB A;  1DQU A;  2LBF A;  4RLF A;  5CQE A;  2IGK A;  3LSM A;  2XF7 A;  3K4B A;  4C2U A;  2IS2 A;  4B48 A;  2E1M B;  2DCE A;  3RCO A;  1D0X A;  3QYF A;  4AU7 A;  4FAS D;  5HVQ C;  4Y3O A;  2CH0 A;  5KCM A;  3V42 A;  4F52 A;  1WJB A;  1V5F A;  2LRD A;  4B44 A;  3HPG A;  1WJC A;  3CES A;  3OWT A;  4DGW B;  3S3N A;  3W2W A;  3U21 A;  2HPI A;  3H5A A;  2VQG A;  2OC6 A;  2W1O A;  4PSW A;  4AVZ A;  3QYE A;  1PJR A;  2PMZ A;  3K6G A;  3VYR B;  2Q2E B;  2A5W A;  2VIX A;  2MC4 A;  1WJF A;  3OOU A;  4PUS A;  3DPT A;  4N4O B;  4XM3 A;  2WB1 A;  4HNU A;  1DP3 A;  3K70 C;  3DPL C;  3MKY B;  2M7A A;  2VKH A;  2WAE A;  4NQW B;  3AKZ A;  2HU9 A;  2CV1 A;  3QOD A;  2IXS A;  2IS4 A;  1X1D A;  2O5R A;  4YEL A;  4PSX A;  1YX5 A;  4DJA A;  4NC7 A;  4BE2 A;  2CFO A;  2VJI A;  2CW7 A;  2LG4 A;  2V26 A;  4BQO A;  2XAU A;  4XL9 A;  2V1N A;  3W2A A;  2KLO A;  2QKL B;  2VB6 A;  4BGD A;  2VXZ A;  2R7Q A;  3M8J A;  2LH9 A;  3LSK A;  4BUP A;  2VAS A;  4XQF A;  3OIQ A;  1D1C A;  4B43 A;  2KQR A;  3S93 A;  2VLA A;  1T0F C;  1BOB A;  2R7U A;  4BU2 A;  2IGM A;  2DXI A;  4XKV A;  1ERD A;  2F6C A;  4BXF A;  2W4S A;  2CUJ A;  3C2H A;  2VL8 A;  3OYB A;  4PFP A;  3SZG A;  4BDY A;  3SEZ A;  2R7V A;  3LSG A;  2XF5 A;  3DEE A;  2MFZ A;  4BDZ A;  4LG3 A;  4F92 B;  3K4L A;  2BVM A;  2HVS A;  2PJR B;  1J09 A;  2V4J C;  1X1C A;  4NUB A;  4ZDP A;  3H5R A;  3GBG A;  4KJZ A;  3ZCO A;  2WAD A;  3UR3 C;  1YE9 A;  3CZ6 A;  3HL2 A;  4E7L A;  4OAY A;  1MMA A;  1MMN A;  3E1S A;  2OV7 A;  4HNT A;  3LMM A;  3HXL A;  1E0E A;  2E5Z A;  3OYL A;  1YX3 A;  1BR4 A;  2VKD A;  3PNV A;  2PJR A;  1S9H A;  4QPQ A;  2X1D A;  4IQJ A;  3D5S C;  3TBI A;  1EA3 A;  3D5L A;  2RRE A;  2KP6 A;  2WAQ A;  3MD2 A;  3SYT A;  3K4C A;  1AA7 A;  2P0W A;  5CQG A;  1Z3X A;  4HSR A;  4C9Y A;  4ZJZ A;  3OYG A;  3ZR8 X;  3ZGK A;  5HLT A;  3HPH A;  3BLY A;  2W82 A;  2K5C A;  1PYV A;  1UAA A;  4XLF A;  3KEY A;  3IAS 2;  4II2 A;  4XKW A;  1Z7L A;  1UG0 A;  3PUB A;  4XOT A;  4EAT A;  2CUZ A;  4BEH B;  4FET A;  3DU5 A;  4RM2 A;  3IP4 B;  5JHF A;  2VXD A;  1N77 A;  1X19 A;  2HPM A;  1U0J A;  4F55 A;  2BW3 A;  4P5O A;  1LDK B;  2Z16 A;  2VQL A;  4E4H A;  2KHM A;  2WY7 Q;  4XLA A;  2JSP A;  3C2G A;  4BE1 A;  1MW7 A;  2W00 A;  2MD0 A;  2Z1D A;  2F5V A;  4Y4R A;  3OYH A;  4ZYA A;  3DTI A;  2VJ4 A;  2L7K A;  1DGW Y;  2X6W A;  4XOR A;  4PK4 A;  3SDB A;  2E60 A;  3HKZ A;  3OR2 C;  5LD2 C;  3FHN A;  5CPR B;  4ANJ A;  2WBM A;  3K4M A;  4CCM A;  2ZSH B;  3CJR B;  3OMY A;  4XOP A;  3LL7 A;  2X1C A;  2IS6 A;  5KHD A;  3L2U A;  1MMD A;  4OWR B;  4BE0 A;  2LY1 A;  4XLH A;  3RQ4 A;  3ZQQ A;  2R7T A;  4BL0 B;  2KMU A;  2Z2S B;  2VQH A;  4HG2 A;  4B47 A;  3OYI A;  3K70 D;  2LY2 A;  3EUA A;  4U87 A;  4RMN A;  3PNT A;  3AL0 C;  4BQN A;  2Q1Z B;  2IGN A;  3KYL A;  3OL3 A;  5LFA A;  2WY8 Q;  2DT7 B;  5FRO A;  3VSL A;  4X0G A;  2LYC A;  4Y33 A;  2HQA A;  3OS0 A;  2KL4 A;  2MYS A;  3EUH C;  4BS9 A;  2VPL A;  2DOA A;  4HST A;  2K9M A;  3OYJ A;  2X85 A;  3DQV C;  1V5E A;  2KPM A;  2CS3 A;  3MKZ A;  1W36 C;  1V5G A;  4DOZ A;  3PFY A;  4D1Q A;  4IZZ A;  4D9J A;  2KRH A;  4CCJ A;  1D0Z A;  3J7A Y;  4DBR A;  3AFH A;  2K3P A;  3OYF A;  1NG6 A;  3OYC A;  2A6T A;  3OIP A;  2ZXI A;  4IKF A;  2XSJ C;  2HVQ A;  2HVR A;  1N78 A;  4PJM A;  3M1C A;  1IRX A;  3VSK A;  3L2V A;  1MND A;  2L5Q A;  4MLO A;  3RTR A;  4F91 B;  2RNG A;  2JVG A;  4PJL A;  3W2V A;  4ZTF A;  2IS1 A;  2DT6 A;  3HUG B;  1BR2 A;  4CA0 A;  4CSW A;  2R7W A;  4ZDO A;  1T95 A;  1WJD A;  5HNF A;  4N4N B;  2JUG A;  4NC8 A;  2ELJ A;  3OYD A;  3RSN A;  4J00 A;  4E7J A;  2K9L A;  3I9V 2;  3K4J A;  4LIT A;  2VJ5 A;  3A4C A;  4H4K C;  2UV1 A;  3DPU A;  3MMY B;  3DLA A;  2ZFU A;  4B3X A;  5TGT A;  3DTE A;  3RPU D;  1ZEL A;  4IX7 A;  3FKJ A;  1WFX A;  4YRV A;  4HEA 2;  3PL8 A;  2MAB A;  4C2T A;  1Y56 A;  4OAZ A;  3K4K A;  3FBN B;  1LKX A;  3K10 A;  2M4G A;  4CUG A;  2L9S A;  4ZC3 A;  2ZXH A;  3SEQ A;  2F4I A;  4ITV A;  2LBF B;  1D1B A;  3VDX A;  4E7S A;  1G59 A;  1K6Y A;  4E7K A;  3S3M A;  2I8D A;  1G8X A;  3HOS A;  4E7H A;  3H9J A;  4U7B A;  3BG7 A;  3DKX A;  3EUK L;  4BJT A;  5FRN A;  4CH7 A;  3H9Q A;  2BOL A;  4BAC A;  1HA8 A;  1BR1 A;  2M7B A;  3H35 A;  3OYE A;  2BVL A;  3AL0 B;  2DJI A;  3NWS A;  4GRI A;  2Y0S A;  4YEJ A;  3KX2 A;  2HZD A;  3FDY A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...