4DGWB

Crystal structure of the sf3a splicing factor complex of u2 snrnp
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
140
structure length
127
Chain Sequence
SRRDMEVIKLTARYYAKDKSIVEQMISKDGEARLNFMNSSHPLHKTFTDFVAQYKRVYSFTGQEIKKSKRTILDNCFERTQYWEFEKDKDREHDKLVELCKIQFAAIPWDKFTQVAKFDLEQMRLRR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Pre-mRNA-splicing factor PRP9
publication title Structure and assembly of the SF3a splicing factor complex of U2 snRNP
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Splicing
total genus 33
structure length 127
sequence length 140
ec nomenclature
pdb deposition date 2012-01-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF01805 Surp Surp module
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.790 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Arc Repressor Mutant, subunit A 4dgwB01
2DT6A 1X4PA 2E5ZA 2DT7B 1UG0A 2E60A 4DGWB 1X4OA
chains in the Genus database with same CATH superfamily
1Y6IA 5JR3A 3IKTA 1B72B 5IP7J 3OYCA 3S1QJ 2LKXA 4OINF 1Z6TA 2Z3YA 5J1YA 1VQ6I 1LDJA 4PFPA 5BOXA 1NG6A 3WGHA 1RC9A 2DFFA 1WI9A 5DCMB 5FROA 2MYSA 3ZGKA 2HPIA 4PJNA 3QYFA 4BDYA 4A3IJ 3FKJA 2ESHA 4PFOA 1H9GA 1R00A 2LF8A 4IOCF 2JRTA 2XIGA 4RMNA 4WCGA 4RM2A 1U5TC 1ETOA 1E3PA 2E5ZA 3DKYA 5HS9A 1Y1WJ 2XGXA 3BG9A 2V4JC 2EJRA 1BW5A 4IHWA 1KQ8A 4M3BA 1TC3C 2O7OA 3J7ZI 3SEQA 3B73A 1ETYA 1X3UA 2EK5A 1R1UA 1HF0A 4IHXA 3OIOA 2LVSA 1FZPB 1HBXG 2HXOA 2X6YA 1MD0A 2Y69H 3PUFA 1A6QA 3QPHA 2IEKA 2MABA 2QBYB 1IV6A 4PCQA 1YITI 2W00A 4R1HA 3RIRA 3S2HJ 4HDUA 2KP6A 2DPUA 4HAMA 1IJWC 1ZHFA 4FETA 5LHHA 2LSOA 2DXIA 2JSCA 3LSMA 3MD2A 4I99C 4A69C 1LFPA 2HQNA 2UXXA 3ZCOA 1XSXA 4LK0F 4D1QA 3H9QA 2L7FP 1XCBA 3ASNH 4LB6B 4BE1A 3LFUA 3V8LA 2OTJI 5H20A 1SMYF 3QAHA 4YG2F 4DOZA 1VTNC 1IGNA 3ABUA 3HKZA 1F9NA 4DYRA 3FK6A 4F93B 2X48A 4YRVA 1OMIA 2GZWA 3E0JB 3DXJF 1HQCA 2ICWG 3DU5A 3FHNA 4WF2A 1W0TA 2Y30A 2FNAA 4BE0A 1JXSA 1WWXA 2PJPA 3C18A 4MEXF 3VFZA 2CQ7A 2WA0A 1WI3A 5AONA 4ABZA 5E3NA 2DTRA 4ZTJA 4HQEA 4YIIA 4B48A 4IVNA 3QODA 5ILVA 3I59A 2XHKA 4RLFA 3W6JB 4CCKA 3PSFA 1G2HA 2JSPA 3ASOH 4XRSA 3GEZA 2HQAA 3OYNA 2LK2A 1IN6A 3N05A 2P8TA 2VBZA 3S14J 2ISYA 4PSWA 4EM2A 4HSTA 5TJJA 1XDSA 4CZCA 3KETA 2XUBA 4ZYHA 1W0UA 2GXBA 3W2WA 1DGRM 1D0XA 5FFZA 1FSEA 2XDVA 2HGCA 4UUSA 4G8XA 4KIBA 2B63J 4BEHA 1O7LA 3KP7A 1IRXA 3C7JA 5ERIA 2LKSA 4XMYA 5FGMA 1LE8B 1R4NB 3SHFA 2KJCA 1R1VA 5EG0A 1G3WA 1SVOA 2ZMEC 4BHPA 1E0EA 2TCTA 3CCVI 3A2KA 1WCMJ 4UVAA 1VFCA 3DEUA 3AG3H 2O9LA 3GZNB 4OIRF 3L2RA 2W7NA 3L9FA 1S7OA 2E2IJ 2QSGX 1W7PA 1YI2I 3T5XA 4XM3A 3K69A 4V2GA 1D1CA 1OLTA 3I0TA 5DM6F 1Z05A 3GFMA 3K2AA 2QEXI 3S3MA 3F6OA 2FBIA 1ZREA 3LWFA 1SFKA 2A5WA 3PIPF 3UKGA 1G3YA 2NOGA 3K4JA 3OSGA 3I4NJ 3HG9A 1BW6A 1Y0UA 2K9SA 3JSOA 4C3IJ 4L0ZB 2L7MP 2QSFX 1ZELA 3F8CA 2VJIA 5LEJA 3HRUA 5K5RA 4I98B 4U7DA 3HDDA 3OYMA 5D4SA 2XV4S 1XGOA 2LF7A 4HX8A 1SVMA 2V9KA 2Y9YA 3GFIA 2X4HA 1YW9A 4A3JJ 4GYGA 2NS7A 4HA8A 1A36A 4IHSA 3I3LA 2R7QA 1DQUA 2H94A 1BC8C 3HRTA 1X2MA 3VB2A 3KEQA 4I09A 2PBIA 1R49A 1B9NA 4XOPA 2DO7A 4M9XA 1RR7A 2CS3A 4QPOA 2A69F 1MJBA 1Y0NA 1JJ8C 2NXNB 1WH5A 3Q3SA 2HDDA 1ETWA 2DYSH 3K1PA 2KJBA 4BAYA 4Y15A 4WX9A 4JYKA 3CCEI 2VLAA 4ZTFA 1V5EA 1O3QA 5GAGJ 1HKTA 5M3FJ 5L3GA 3LAPA 2M4GA 1SFUA 3E6DA 2IA0A 5E8GA 1HW1A 2P0WA 4P55A 1I3QJ 1QQIA 3JRHA 5BQTA 4OIQF 3E5UA 5CVJA 4L0YB 4BQQA 1K4TA 2F5DA 4ITVA 2VE9A 2L02A 2GQQA 3VYUB 4IO9F 2VL8A 1BC7C 1OJLA 4B1RA 2MD5A 5E3MA 4UB6C 2JVGA 2K4JA 4LIVA 3K4CA 1LB2A 2XASA 2A5YB 3BJAA 3MQ0A 2RQPA 4M9SA 2WTEA 1FPQA 2B9SA 3S16J 3H35A 4I7HA 3S3NA 2DK5A 3R61A 1Q1VA 1G4DA 1MMSA 4IEJA 5EYRA 3CC4I 1T39A 2ZFUA 3HC7A 1OYYA 2JJ7A 3A1YA 1ETQA 1OCTC 3FXMA 3DKXA 4BJ5C 4NC6A 3ML6A 4MEYF 2XAFA 4B43A 1OR7A 4FX4A 4CCNA 1NG7A 4BU2A 4ENNA 2FX0A 2LRDA 2OU2A 2QBYA 2DPDA 3C3WA 2RC4A 3WHCA 4R79A 1WJBA 1W5SA 2LKPA 1HSJA 2MG4A 3OSFA 1BR4A 1KU2A 1R36A 3K6GA 4HG2A 1RESA 2E34A 5J1RA 2IS4A 3DWLE 3OOPA 2VBWA 2TDXA 5DDGA 2HS5A 2VQCA 4KJZA 2VQGA 2DMPA 2M34A 3JSPA 2H8WA 5J6XA 1FSHA 1MH3A 4H0EA 3PO2J 4EM0B 3JRFA 3ZMVA 1FYLA 1BI0A 1HW5A 2X0LA 4ZJZA 4A3FJ 1XGMA 2FXAA 4RGXA 4PSXA 3BR5A 5L3BA 3B6AA 1T6SA 2KQRA 3CMMA 2MLGA 3HRMA 1IUFA 3HHGA 1U8RA 6PAXA 2E1CA 3GVAA 3G2BA 3A0HC 4BHCA 4RBOA 2G9WA 1Z1DA 3WGGA 4U0WA 1EA3A 3CCJI 1IRZA 2DN0A 4L5EA 3RSNA 4ZZDA 4NC8A 5CQGA 2R5YA 1B9MA 3FMRA 2H1LA 3ERED 2ESNA 4Y17A 3FMSA 4FQGA 3OS2A 3PQJA 2RNJA 2EINH 1XMAA 3ECHA 3TP3A 3CDHA 5FFXA 1TNSA 2BVMA 1P9QC 5K5OA 4TV7A 4XN3A 3TDZC 1G6NA 1N78A 4UY8I 3TOBA 1LQ1A 2OV7A 3IC7A 1TTYA 1USTA 4KMUX 4ON0A 3U9GA 4NUBA 1RI7A 3ROUA 2XPVA 2ELHA 2P6TA 1KA8A 1FYKA 3PUBA 3MMYB 2DT5A 4F52A 1PDNC 1UJ8A 4CGZA 2L2OA 3MKWB 4FISA 3CF5F 2EBIA 3CJQB 5FKLA 2YS9A 3A02A 1V5FA 2BOLA 2JZYA 3GTJJ 5D8KB 1BJZA 1KU3A 1D0ZA 2K40A 1D1BA 3CD6I 2RN7A 3SZGA 2KMUA 1NHAA 1AA7A 1MBGA 3E97A 2KDZA 2DLLA 1WJEA 4I02A 3FXKA 3NWTA 5E3LA 2R5ZB 3CUOA 3KZZA 2QLZA 1OISA 2PI0A 5FLXZ 4DYQA 1CQTA 3KYCB 3SJMA 4RB0A 2BY3A 1ZRCA 3D5RC 2GIZA 1MIJA 1BR1A 3H3VK 1SD5A 3GF2A 2UV1A 4XONA 4EJVA 3HSEA 4LD5A 4XLHA 4RAFA 1YS6A 1V5GA 2F4IA 2HYJA 5E18F 3M9AA 3GFLA 4CZZA 2CWEA 4HW0A 1QU3A 1RIOH 1SD7A 3RPUA 4HNTA 3M7GA 2X9DA 1SAXA 1J7KA 4A2UA 4CO8A 2JTVA 4UV9A 3DQVC 4LGWA 3G1OA 2DA5A 1LPQA 1IN7A 2WB1A 4CCMA 3M8EA 2EQRA 2M0CA 3J81K 1YYVA 2M9HA 1ZG1A 2Z1DA 5D5VB 1YIJI 1B8IA 4BACA 4KIFA 1ZGJA 2DMTA 1JUPA 4MHGA 3HOSA 5EEHA 2H8RA 2L01A 1MW7A 1J5YA 5GP9A 3F8NA 2FA5A 3HGGA 3R6SA 1YG2A 2R3SA 2D2WA 3PNVA 4UB8C 4B3AA 1S7EA 3O2PE 3E3VA 5D5WB 1A6IA 1K78B 4QSHA 2OZUA 5ICEA 3COAC 3Q5FA 2M4KA 3BR2A 3ONQA 2K85A 1ZYRF 1R5ID 2JA8J 2CFXA 3DTIA 5J8CA 1GDTA 5KVRA 3FBIB 1EKEA 3HRSA 1JTXA 2DOEA 3DV8A 3MEXA 2BW3A 4XOTA 1VI0A 2OAZA 4WK8F 1BN5A 1V55H 1T8IA 2PJRB 2OZ6A 2ID6A 1VQ9I 3RZOJ 2ELKA 3P9KA 3ABTA 4PGHA 4UUTA 4RGRA 4M6XA 4E7HA 1KGSA 3L1PA 4ENJA 2A07F 4J19A 3OS1A 1P92A 1VZ0A 1B6AA 3ABKH 1XSDA 4JX6A 3KP5A 1UELB 5FD5A 1J2XA 3R0AA 4Y13A 1VQKI 3WU0A 4RDUA 1IDZA 3O6BB 2E7XA 4XBFA 2VE8A 2K4BA 1DPUA 5E1ZB 3IH2A 4M6YA 1IN8A 5M5YJ 1O4XA 1BBYA 1XCVA 2F4OB 1T98A 1YOVB 1HXDA 4IXAA 2GAUA 1I1GA 3NARA 1QBJA 4HPQA 2HQRA 2BVLA 2QM3A 3BG6A 5E1WA 4MTEA 4NQWB 3TMOA 4WWCA 1AWCA 2A6EF 4IL6C 2W84A 3MZYA 3OYFA 4UUVA 5H2FC 3L2QA 2HVQA 3FMQA 4R8HA 3OYGA 4PDKA 1U78A 4OMZA 2LOOA 1R1TA 2ZO4A 5M3MJ 5KAFC 3K1MA 1WH7A 1MBHA 4E4HA 1Z7UA 5DV5A 2V1UA 1JGGA 2OD5A 3OV8A 1LVKA 1D3YA 3OOUA 2HYFA 3BLYA 1FLIA 4HF1A 3S15J 1QNTA 1UG2A 2BYVE 4A12A 2FOKA 3HPGA 1FJLA 3QP6A 1MBJA 5J47A 1QO0D 1YRNA 4RS8A 2VOOA 1HC8A 1OFCX 3GYHX 3OY9A 2R7RA 3J7YJ 5M5XJ 1RKTA 1X4PA 2ACJA 2QKLB 4OU0A 1VQ4I 2XVCA 2O6GE 4A0YA 3G1LA 3KEYA 4XLCA 2MA3A 2R4GA 4FHTA 4IRHA 2M8GX 5ILUA 2BXZA 1LFBA 4MTDA 2K02A 3HTUA 2DODA 2V26A 1LVAA 1D5YA 5JFRA 2J5PA 2PG4A 1YE9A 3U2RA 1E3HA 3S1RJ 3SXYA 2IS2A 2K27A 3HHHA 2OUMA 5EZGA 4EQQA 1W7PD 4BL0B 3F21A 1ZLKA 5LBQA 3BG7A 1YIOA 2CW7A 2EIKH 1APLC 3VEPA 4MFDA 3M07A 3IH4A 1MMDA 5IYDJ 2OA4A 3ABMH 2IS6A 1MJAA 1OYIA 4XIDA 5ICGA 2ZXHA 3FM5A 4C30A 4XICA 1ACIA 2JA6J 4LG0B 1OCCH 1XGNA 3ZQ7A 4B8XA 3ZQGA 3EQLF 3MKYB 2JUCA 5IPAA 2OJED 3FISA 1Z3XA 3OYKA 1ZARA 4BDZA 1H0MA 3BR6A 2JA2A 2Y75A 3L2UA 1SD4A 2CUEA 4G6QA 3GZ6A 1R71A 3CJNA 4L9VA 1FX7A 1T0FC 1VQOI 1DP3A 3K0LA 3E1SA 2N8GA 1MBKA 3OMYA 5FLVA 1BIAA 1Z77A 5DD4A 3Q0WA 2EIMH 1AKHA 3DEWA 5CYVA 3HYIA 5DTDA 4C2UA 2BY0A 3RI4A 2H6BA 2VQLA 5HNFA 2VI6A 4XSZF 2NOJB 2E1MC 3HSFA 1Q1HA 4A3KJ 3S17J 2D1HA 1YQAA 2YR2A 1WVRA 1W1WE 1U5TB 2L4MA 1QZEA 4HNVA 1TZLA 5DEQA 3A01B 4MIMA 2ZJQF 2XF7A 2ZNZA 3LSGA 2O5RA 3D5SC 2EWNA 4L9NA 2X51A 3DPLC 3OYJA 4Q47A 4XKCA 5K7FA 1REPC 5DUKA 4GXOA 1ZRFA 4LMYA 2CV0A 2CSOA 1HLVA 1PJRA 5F6FA 2YUSA 5GPCA 2HQ5A 3L7WA 2E5NA 2ZSHB 5LHIA 4XL9A 3BZ6A 3AG4H 5EEGA 2X6OA 2HXIA 3U1DA 2VJ5A 2P5VA 3ZQHA 4CHUA 5EDNA 2NS0A 3E7LA 5DUIA 1HSTA 1HDPA 2L54A 5IT9K 1Y39A 1NH3A 3H0GJ 1P4WA 2K5CA 2OC6A 2RGVA 1GLNA 4XKBA 3H36A 3KYLA 3FXLA 1ZLJA 4EGYA 1J9IA 2CQXA 1IXSB 4RA2A 4ANJA 3MFKA 1YX3A 4CSWA 3I5UA 5FRNA 1TNTA 2IA1A 2DA6A 2WAQN 4KN4X 1RKWA 4XRFA 2HWVA 2GLOA 1HOMA 1DUXC 3TOAA 2GIVA 3BY6A 3HGYA 3QYEA 5TGTA 4G6DA 1LKXA 2KDOA 4HOBA 5F27A 2XROA 1UHMA 1WJAA 1MJ9A 3DEEA 1ZK8A 2QQ8A 2R7WA 3E5QA 5GADJ 2QCOA 3DF8A 4L5JA 4NQWA 4PUSA 4II3A 3M8JA 4A6EA 1S5LC 3EETA 3LA3A 3B6CA 1FWZA 5FKMA 1M1EB 4M73A 4QTRA 2ZJRF 2VC0A 1ZG3A 2XF5A 2W24A 2AQEA 2B0LA 5EEAA 2V6EA 1E17A 3JW4A 4LG3A 4XKVA 2XPUA 2MGQA 2ZMEB 4BBRJ 2R7XA 1ULYA 2PQ8A 1QZZA 2M7AA 1OCPA 2CH0A 1PUFB 1YFHA 1AHDP 3U21A 4G6TB 2X1EA 3WTZA 3A4CA 3PO3J 2OQRA 2HNHA 3KCCA 3CCYA 4ZYEA 3JCUC 1VQNI 1UHSA 1U3EM 4KNYA 1YO5C 2LC2A 4NC7A 2DT6A 1QPIA 3ZQQA 3TL4X 3TEDA 1I6HJ 2P7CB 2JQ7A 1QGPA 5F0HA 4PJLA 2F5FA 3OR2C 5AIQA 3ZQCA 4ZDPA 2GA2A 1UCRA 4RM3A 1IN5A 1SEUA 1H88C 1FTTA 4WXDA 3SYTA 4HDVA 5TRDA 4HYEA 3BPXA 4RAYA 4YIRX 4Y3OA 3BCBA 2XSJC 4N0BA 3IHUA 1HKQA 3B02A 4AWXB 4EVIA 1NTCA 3IAM2 2HOSA 1BJAA 3EPZA 1RUNA 5CQEA 5LHGA 2XPWA 2DQLA 3KEOA 1P6RA 2BZTA 1RETA 5E17F 1T38A 4CDGA 2BGCA 3F8MA 5A2QK 1L0OC 2CFOA 1WFXA 5CKTA 1A04A 2HOAA 2E2JJ 1P4AA 2KIQA 4JP0A 4AVPA 3IRRA 3IUOA 2OQGA 4QLCU 4UVCA 5B66C 2IAIA 3KYDB 1PVEA 2M5WA 2O03A 4QWQA 3NAUA 4Y4RA 1X3WB 1WJDA 1ZKGA 2D5VA 3I9V2 4GDFA 3VYTB 2XAGA 3K4KA 2XAQA 4UHTA 1ZQ3P 2VUMJ 1VQ8I 1Z0XA 3FBNB 1K83J 4N4OB 5K7HA 2NNNA 1B4AA 1D0YA 1EH8A 1G3SA 1U5TA 2LFBA 4HEA2 5J4VA 3L2VA 2E1NA 2YX7A 1YJNI 3RPUD 3H0DA 3QRFF 3VPRA 1QZYA 4M3EA 2ADUA 2IRFG 2EA2A 3IL2A 1B72A 2EPFA 1BOBA 4KICA 3S2DJ 1F43A 2QSHX 4RLQA 2LREA 2PN6A 5CVRA 2NRAC 2BXYA 3K4MA 5E79C 1KU7A 1IW7F 1R58A 2JUGA 4FT8A 5DCMA 4CXFA 2EIJH 3DLLF 2A6TA 1HW2A 4UNOA 4DYCA 4YEJA 4RB3C 3WE2A 1DP7P 3GCMA 2DA2A 2LY2A 4W1UA 2QZ8A 3RCOA 3JAMK 2VOPA 3MVPA 3PSIA 2BV6A 1WKMA 3SZPA 3I4PA 5CLSA 3ZMUA 3RKQA 3C1DA 4BE2A 3CO7C 4A3DJ 4XKWA 2NS8A 3PIOF 5FRMA 3MZ8A 3I64A 2COMA 3HBLA 3L2CA 3M8FA 2HTJA 3ULQB 5FKNA 4HLXA 3OS0A 3I54A 2O0YA 3O8HA 4I0BA 2ZFWA 5D6EA 4AU7A 1BA5A 2VN2A 3E6BA 4ZYAA 3JR9A 3GUDA 4N9HA 4H4KC 2OPTA 1JKOC 2VASA 2KPMA 4O3MA 3F22A 4CCLA 4DZPA 4D9JA 5IP9J 4HV5A 3V7CA 1S3JA 4Z2YA 3W3CA 1MDMB 1XMXA 2H27A 4PJMA 1SFOJ 4B4CA 4DNCA 3ZQFA 2MC4A 2AQFA 1PP7U 2CV1A 1ON2A 2DFIA 2HFHA 3P5JA 4UXNA 1OQYA 2A6HF 2A3SA 3KLNA 5HDNA 2HZTA 5K5QA 1X1DA 2G0EA 2IS1A 4B44A 3VWBA 3AG2H 3FX3A 3QPLA 3ZQIA 4BH9A 3CMYA 1Z9CA 2XAUA 2LP0A 5HS8A 4BQNA 3CMAI 1B59A 2JA5J 2K7LA 2VJ4A 3R0JA 1MZBA 3U1KA 2UWMA 1YJ9I 2O61A 3FZVA 5HDKA 3VDXA 2XRNA 5CVVA 1QPMA 2ZSIB 1PUFA 1H89C 3M3YJ 4BXUA 5LRSA 1BIBA 4ZDLA 4A0ZA 2NNYA 2GM4A 4YFNF 4FCYA 1K79A 2NYXA 5FB2A 2VPLA 4A0XA 1ON1A 1OYWA 1OCZH 5F08A 1GVJA 3WTYC 3LSPA 1KYWA 1LEAA 2EFNA 2DAOA 3OYLA 2UUZA 3DBRB 1YJWI 2FBHA 3A0BC 1MSFC 1UB9A 1LE8A 4KDPA 3WU1B 3BZKA 3QPTA 2NVXJ 1S29A 1JUMA 4Q4ZF 3ZPLA 4XSXF 1MMGA 2E36A 5E1XA 5LEKA 3BC8A 4OOIA 1X1CA 3LAJA 2VB6A 2CV2A 1YW7A 2R7VA 3KFWX 5D5XB 2M87A 1MMAA 3E5XA 5IYCJ 2VT2A 2Z2SB 3D1NI 5HLGA 3BP8A 2IBDA 2CW0F 2QVOA 4B09A 3G71I 2E71A 2CU7A 1HCRA 1U8BA 1ONVA 2FRHA 2L5QA 3CTAA 1D5VA 2LD5A 5HOOA 2L0KA 3Q0VA 1D1AA 3WTSC 4LK1F 1QVTA 2VXDA 3IWFA 4X6AJ 2HDWA 4ASNA 3AL0C 3Q0UA 3ABLH 3P9IA 5D6FA 1MNEA 4D7MA 1FTZA 3J7AO 3S93A 1NK3P 3EDPA 5IYBJ 1FYMA 5ILSA 4B47A 1RPWA 1T56A 5FD6A 3GW2A 2LMDA 2ZBKA 4Q5SF 2M1BA 3KP4A 1FBSA 3CUQB 1DDNA 2PMZN 2ZCWA 1MNMC 3BQYA 2QYOA 4G7HF 4L9JA 3CO6C 4YFXF 1XD7A 3ZRGA 4XR6A 1R22A 2JVHA 1V4RA 2EFOA 2VXZA 3BROA 1FT9A 1CF7B 5F0CA 1J75A 1FMWA 4GRIA 2STWA 2CUFA 1UMQA 1SD6A 3QU6A 3CCLI 1TT5B 1ENHA 2DW4A 3LNQA 2QF7A 1WZ2A 4CH7A 1BI2A 2IGOA 3CC7I 1MNDA 2LY9A 2YU3A 2KIFA 4FE4A 2DYRH 3DFGA 4AIDA 2F5VA 3CUQC 4BJTA 1P7JA 4CCJA 2VIXA 5HVQC 3LA2A 4IRGA 4MQ9F 3L2WA 3NQOA 2MSYA 1W5CC 3GMEA 5E20A 4IHTA 4M9ZA 1HDDC 1YHQI 2XGEA 3BR1A 3H92A 4AD9A 1ZTRA 4XK4A 5FKKA 2JN6A 4CCOA 3ERMA 2Q2EB 2XKOA 5IY5H 3OR1C 1BR2A 5KHDA 2LBFB 4UV8A 4XRSG 2NVQJ 2XF6A 3CJRB 2FD5A 4Y7NJ 2R7FA 4E7LA 3K7AJ 2O8KA 5D4RA 1N75A 3AG1H 4RB1A 4PJ0C 4IKFA 2GOXB 4G94A 3EUAA 2KIUA 5H6QA 5K1YA 1ZH5A 3GX4X 1C0WA 2R7OA 2VKEA 3GTKJ 1TW2A 3VSLA 1WHUA 1PP8F 2F4MB 2FMYA 2DDAA 2PMZA 3SZTA 2EB7A 2X85A 1X4OA 3GTMJ 2CJJA 3MCZA 3PNTA 2UZKA 1OKRA 2DJNA 2X6WA 4F92B 3SFZA 3OYIA 3FXQA 2RDPA 5FO5A 2Z33A 1CGPA 3OIQA 3V8KA 1MDMA 2HPMA 4CICA 3LSTA 4OMYA 3QQAA 1I3AA 1R23A 5C4XJ 3TW7A 2WV0A 3H9GA 4AYBN 2V6CA 2FEZA 3CF2A 5B1AH 4V2FA 3DCFA 3HXLA 1IRFA 2HU9A 1SC7A 1N25A 3WODF 2JMWA 3N4MA 2FJ1A 2CW8A 2DT7B 1IN4A 1UG0A 2FMLA 3K2ZA 1O7FA 4L9TA 1MBEA 3LOCA 5D8LB 5J1UA 1UZCA 1X1BA 4ENMA 1FMVA 2Q1ZB 2DMNA 3J80K 3RKWA 1I50J 2V7FA 3HPHA 2BY2A 3OL4A 2HTSA 3K70D 1R5HA 2H6CA 2X6XA 3S1NJ 5J40A 5BS6A 5JVGF 1ETKA 1SAUA 2PEXA 3WG7H 4M3DA 9ANTA 3WTTC 1IUYA 4E70A 3RJPA 2IGMA 3AFHA 1VQ7I 1XTAA 1XDUA 4I01A 5HNHA 5BPIA 3K4BA 2JA7J 3P9CA 5JVTA 3F3XA 2KLOA 4KYWA 2ZXIA 1S7AA 1JHFA 2DFEA 2J5OA 4IJAA 1X1AA 1DU0A 3MAJA 4G9YA 1F36A 4A3MJ 4Q48A 1PYVA 2KFDA 3BG5A 1ORKA 1Z6RA 2Y0SN 4EMSA 4NDLA 2K9NA 3F72A 3GTLJ 1VQLI 1U9OA 2L4AA 5DCFA 2HVSA 2VKHA 1VQ5I 4JOMA 2V1XA 3H5AA 3J81Z 2ZKZA 4OAZA 4MFEA 3I59B 1RZ4A 2VONA 4HF2A 3RQ4A 3CLQA 2XB5A 3IV5A 1VNDA 3W6VA 3VOEA 2OCCH 5D5UB 1XMKA 2XGDA 5CVUA 2P5LC 2E19A 3BR0A 1QA6A 4KA4A 1IXRC 3TO9A 3K70C 3CZ6A 3S2WA 2COBA 1TWGJ 4UUSB 1TWFJ 5FLMJ 4BEHB 3KZYA 2OTLI 1F1ZA 3KLOA 3WTVC 3HZJA 2EV0A 3V42A 2R5ZA 2E35A 2O8XA 3QPSA 1Z7LA 5EG0B 3BZCA 2E1MB 2Y31A 1KZHA 2M7BA 1LNWA 1W36D 3TW6A 5FJ8J 2YX4A 2IW5A 1LEBA 1ZR4A 2EA4A 1WQ2A 4PJJA 5J4YA 1W7PB 1DPRA 4A6DA 4Y33A 3G1MA 2FUG2 2ECBA 5KNLA 3M4OJ 1PUEE 1CF7A 2FSWA 5KK1A 3EYYA 4YELA 2QUFA 3G73A 4ZZLA 2Y0SA 2X1DA 2V79A 4D5CA 2FU4A 4XNFA 3QOEA 4XLFA 5LD2C 4NB5A 2B7EA 3Q9VA 5ICCA 1GHCA 3J7AY 1HA8A 1VQPI 4FTHA 1X3ZB 5DYMA 3T8TA 1GT0C 3BJ6A 3I56I 4FASD 3GXOA 2VBYA 4A3GJ 4X1EA 2LH9A 5KCMA 2L7ZA 5F1RA 5JHFA 2CUZA 4KFCA 3MKZA 4IRIA 2Q2EA 4Y52J 4M3FA 4O6JA 3ZR8X 3BDDA 3CESA 1S9HA 2RAEA 5ED4A 4GFBA 1RR8C 1IRGA 1W36C 1GVDA 1K78A 3BPVA 2BY1A 2W48A 1JUSA 3E6MA 4U0VA 3JRDA 3S1MJ 3D5LA 1MMNA 3H9JA 1IZ1A 5CPRB 2LG4A 4DQ2A 3JTGA 2AHQA 2NVUB 2PLYA 1U9NA 2L9SA 2DBBA 1WJCA 2AS5F 1O3SA 3LQRA 1OPCA 3FK7A 3WTUC 1BL0A 1ODDA 4ZH4F 3HKZN 4IOAF 2IA2A 2PJRA 4FX0A 3DTKA 3GLLA 2RNGA 4U0YA 4KUMA 2M2EA 1QVUA 1FBQA 1TQIA 1WJFA 2MC3A 1FP2A 1FNNA 1XX5A 2DMUA 2ISZA 2BBYA 2W25A 3BQZA 1F4KA 2ME0A 4BQAA 4F7ZA 3VYSB 2V9VA 4M72A 4E6KG 2PX9A 3I53A 2EH3A 1TQMA 2E2HJ 5AIPA 2L7KA 3ZMZA 2QENA 4KT6A 2EFWA 2IP2A 4EATA 2Y9ZA 1X2NA 2Y48A 3F6VA 3GBGA 3R4KA 1KYZA 2JT1A 3NEUA 4ZYGA 2XAJA 4ENKA 1UHWA 5F64A 2F5CA 3FXRA 2C6YA 2VJJA 1VF9A 1K7AA 1FOYA 2AXTC 2KZGA 3LA7A 4II2A 2VQHA 1KU9A 2Z9OA 4HSRA 3IAS2 2ZXJA 3HOWJ 1BOAA 4F91B 3GO5A 3SFIA 3BCAA 2P81A 3IP4B 3LSKA 2V1DA 2OBPA 3PM1A 4G7OF 3H1CA 2CYYA 3ZOBA 2CUJA 3DKWA 2ZJ2A 3HSRA 1TQPA 3JRBA 1R7JA 3SQNA 2JWTA 4RAZA 1HKSA 3SDBA 3BTLA 2FNPA 3GZ5A 4RGSA 4C9YA 1OR7C 3HIFA 2ELJA 5CVIA 4C2TA 1Y8RB 5GTHC 5LFAA 3BTCA 2WAEA 2QWWA 2DA1A 4IQ4A 3JRAA 5ICFA 2HEOA 3VYRB 4U88A 1GXQA 4ZDOA 4L5IA 2KKOA 3TBIA 1XB4A 2V1NA 1LJ9A 1ZG5A 1WSUA 2VKVA 4XLAA 4I2OA 2RKHA 3CP8A 1VQMI 4A93J 2F5EA 4HBLA 2EZLA 1KQ9A 3PQKA 1A35A 4IHVA 1SFEA 2KT0A 4M3GA 1GUUA 2JPCA 4QPQA 2WAQA 3FDYA 3MZHA 1U2WA 3GLXA 5B5EC 5L3DA 2AO9A 4HRIA 3VSKA 5IOZA 1T0FA 2MH9A 3TO7A 1IG7A 2G7UA 5EZHA 3QYBA 3I4MJ 2W85A 3LSHA 1X19A 2EFPA 4G7ZF 2RV8A 1EH7A 3H5NA 4D5FA 4OIOF 4P9FA 3KZIC 1YTYA 4LG0A 2R5YB 1I5ZA 3TO6A 2XGCA 3LSJA 2R7UA 4OWRB 2F6CA 3A03A 3HOXJ 4GGGA 3T1BA 2RVCA 4HV6A 1QRYA 2M0MA 4C3JJ 4A3CJ 5F04A 4JBAA 5B3SH 2R7ZJ 2K9QA 1YS7A 3EUHA 5GAHJ 2Q8KA 4EJUA 5IT9Z 2HDCA 2O3FA 2ETHA 3S3OA 3V8JA 3TKYA 3WTWC 4WXHA 4ESBA 4S05A 4IPAA 2W4SA 4EJWA 2A68F 3PJRA 1RRJA 2NVTJ 3ECOA 3V7RA 4EJTA 2CO5A 2M45A 3F9KA 5C3EJ 2Z5UA 4N9IA 3E6CC 1FIPA 3HJEA 2ZB9A 4P1WA 2VT3A 3CP2A 1JGSA 2ZC2A 3KPHA 3F23A 1D8JA 2I8DA 2KIMA 3SDGA 3I71A 4HLYA 1FP1D 2DA7A 1G3TA 3AKZA 1L3LA 1IF1A 3A01A 3H3ZA 2DK8A 3CCQI 1XS9A 4DZJA 3KP3A 5LLQA 5E3OA 3HOUJ 1POGA 3FF5A 4DBRA 2HZDA 1Y1VJ 3H5RA 3GFJA 5HS7A 2WADA 4XLPF 2K86A 4BBSJ 2FBKA 5JLWA 3FWEA 5LGNA 5EGOB 3GTQJ 3ELKA 4EV0A 2KISA 1I27A 4W97A 4AC0A 3PFIA 4EGZA 3HEFA 3M1CA 3TDUC 3W2AA 2WAFA 5IT3A 1FBUA 2JK3A 2X1CA 2GA1A 4C3HJ 3G3ZA 3RTRA 4KN7X 3LSRA 1TT0A 3QU3A 2QQAA 4LITA 4P96A 1MGTA 1FY7A 2KRFA 1B8IB 2MH2A 3CJTB 3V4GA 1IV8A 1EV7A 3FXUA 2RREA 2HI3A 1TWCJ 2STTA 1MBFA 2GWRA 4MO7A 4S0HB 1IDYA 5LGTA 4P5OA 3CC2I 4MQVA 1G8XA 2XRLA 5GPAA 3WG9A 3FIWA 4A3BJ 1I6XA 3WTXC 5F0FA 5DM7F 1JKPC 4ETSA 2M3AA 5HLTA 1T2KA 1MKMA 4N4NB 2Z16A 2H1KA 2LY1A 3NWSA 2A05A 2Z99A 4MNUA 1GXPA 4KITB 2E1OA 3JTHA 1OCRH 2UXNA 2L9NA 2XAHA 5FLXK 3CCMI 3F8FA 2BW3B 4A5NA 4KIGA 1A31A 3BJOA 5HLHA 2ECCA 3UNGC 4U7BA 2R7TA 1YLFA 3ZXSA 5F1JA 3T8RA 2Y2ZA 1ERDA 5A2QZ 4IZZA 5JLXA 4M74A 5B1BH 1TBXA 1ETXA 2FF4A 4G12A 2ZMEA 3MN2A 3R60A 4XLEA 1JJ6C 4MGRA 5HODA 1E2XA 2EZIA 1P4XA 4HQMA 2OCEA 3F0CA 3WHBA 1Z21A 2IVMA 1BM9A 3LFKA 1FIAA 4LLNA 3OWTA 4LLLA 3QP5A 4EJOA 4CYCB 1ITYA 2EFQA 3C2HA 1UFMA 4JK1X 3PNYA 4UVBA 3M1EA 2IT0A 1IC8A 2CMPA 1N77A 3V7SA 4EM1A 2P4WA 4KT5C 4ZC3A 4D7NA 4CUGA 5CJ9A 4LLGF 4B3XA 3LQQA 3O8GA 2QA4I 2XB0X 1W5TA 1KQ0A 1FOKA 3S8PA 2WV1A 4CA0A 1STZA 3K4LA 2DI3A 2LTPA 3KP2A 4BUPA 1TLHB 2EZHA 3MKLA 3CCSI 2TRTA 4ESJA 3AL0B 2BE5F 3FXJA 4P9UA 1X58A 4OIPF 1FOWA 5BNGA 1B1BA 1JT0A 3WGIA 1LDDA 2CQQA 2EILH 2W82A 5HLIA 3L00A 3EYIA 4V19K 2Y0MA 4E7SA 1FC3A 4E7ZA 1H8AC 3JAMZ 1K6OA 2L3DA 1XSVA 2IPQX 1YRNB 4D0PA 2R92J 1A5JA 5GAEJ 1JE8A 2D1VA 2V9PA 3NRVA 2WB1N 1XG1A 5KAIC 1BI1A 1XC5A 2VBXA 4BY7J 3LMMA 2I10A 2ID3A 3W6KB 3GTOJ 2DOFA 4GCVA 4E7KA 1Z3YA 1S8NA 1DGWY 2JPBA 1P7IA 4Z6YA 2P7VB 2D45A 4BKXA 1TL8A 2DDBA 4M71A 2F48A 3HOZJ 2IGKA 2PMHA 3N97A 3PL8A 3OYAA 3QWLA 5DS9A 2XSDC 3SEZA 3ZQLA 3RYRA 4AIHA 2LNBA 3BTJA 2W57A 3ESWB 3HOTA 4WXCA 4J00A 4XRMA 3C2GA 2G7HA 2HVRA 3TGNA 3KIOA 2R93J 1IO2A 1JKRC 3O3KA 5HDGA 2MW8A 2NVYJ 3KP6A 1I39A 2LLKA 4O5VA 4JX5A 4YIFA 2XC7A 3TQNA 2AXLA 3G4SI 2CQNA 2DOAA 1JT6A 4ZYDA 3HM5A 3W2VA 4A5MA 3ZMTA 2ZJPF 2IGNA 3CDLA 1JTYA 2HKOA 2W1OA 3HUGB 5LGUA 1LFUP 3HOYJ 3JREA 1ZR2A 2YU9J 4PGGA 1H9TA 3FXOA 4DGWB 4BNCA 4PZJA 5IP6A 1S72I 5EGOA 1RNLA 1FOXA 2VODA 1EH6A 2I5UA 4IHYA 2ME6A 3CCUI 1AKHB 4FE7A 1Z67A 4HF0A 4LJZF 3REOA 3OYEA 1Y56A 1AU7A 4QIWN 3VODA 1R5GA 4MLOA 4BHBA 1K61A 2FQ3A 2NAZA 4AUXA 5EF6A 3K1NA 5BMZA 1Y8QB 3DLAA 4NHJA 4XLNF 2CQKA 3RYPA 2GOMA 3DPTA 2DFHA 2K3FA 5LRRA 5C4JJ 3OL3A 1WPKA 2L9RA 5L3CA 2HOTA 1AOYA 1SVLA 1USSA 1R9TJ 1GV5A 2L9VA 1J09A 1V3FA 3BOQA 5DD8A 4LB5A 5L3EA 1ZN2A 2LR8A 3RKYA 1XPXA 3RQIA 2FQ4A 1ZGAA 5EJCA 2GXGA 4BGDA 2LDUA 4BY1J 3C2BA 3RPQA 2GBYA 1ETVA 4IQJA 4LOCA 3GTGJ 2LYCA 1O3TA 5L3FA 3EUKL 1JHHA 2DCEA 1F5TA 2CG4A 2FE3A 3DPUA 1D8KA 1JKQC 4BQOA 1X1PA 2K9LA 3HB9A 4C2MJ 5K7ZA 3PFYA 1SFXA 4BXFA 3WE3A 2E60A 1WGXA 2YSRA 3ZMSA 2F2EA 5J8FA 2EV6A 1QHGA 3CCRI 1K4SA 3GWZA 2DU9A 4GYIA 3DU6A 4AIKA 3LSIA 3LL7A 1SMTA 2KZVA 2MD0A 5GTIC 1T95A 4OAYA 4KMFA 3OYBA 2PMUA 5BPDA 3DBLB 3CQZJ 2DTZA 2QGUA 3ISPA 3BTIA 3DTEA 3K10A 1XN7A 5JI6A 1TWAJ 2E7WA 2R7DA 2XKPA 3FKIJ 1TW3A 1R4MB 4HX4A 3ZN1A 4CYCA 2IJLA 3AAFA 1EJ9A 2HR3A 1G59A 4BXXJ 2DJIA 3IH3A 3KX2A 2MFZA 3ZMDA 4ESFA 5J3LA 4HX7A 3K4NA 2MBFA 2M30A 3H3UA 2KHMA 3T0YA 2A61A 1GV2A 2ZNYA 3JRIA 4KISA 4S04A 4E7IA 2CGPA 5H6RA 2Q0OA 3TP0A 3BR3A 3JRGA 4U87A 1KONA 2YPRA 2WY7Q 1XGSA 4YFKF 2WC2A 4LIUA 1J0RA 2CRGA 1TP4A 4JQFA 5TISC 1FEXA 4RAGA 4AYBA 3F8BA 1IXCA 1P2FA 2K3PA 4L18B 3BT9A 2QQ9A 4RGUA 4I76A 4M6VA 3I55I 4LFUA 3MWMA 4I0AA 1E3OC 4X0GA 2EZKA 4EEFG 3BWGA 2VKDA 1I1SA 4BYYA 1O57A 1BI3A 1LDKB 3CDIA 4DW6A 4A3LJ 4K2EA 3FHZA 1YW8A 1K6YA 2PFBA 2BEOA 3G6EI 4DJAA 1DU6A 3I58A 2P5KA 1QHHD 1EF4A 3RDIA 4NNJA 4CYDA 4PK4A 5M5WJ 5JHUA 3OYDA 1O3RA 2M8EA 2QQBA 1Z91A 4I6ZA 3K9TA 4J01A 4NBQA 3HOVJ 2HKXA 3CMEI 2DA3A 3CUQA 2FOWA 3P7NA 5C44J 3BG3A 2EV5A 3FM3A 4XORA 2JRMA 4A3EJ 4IX7A 3JRCA 3D0SA 1JI8A 1T33A 5FKOA 3HTSB 2BHYA 5IOYA 1S6LA 1W4MA 2KL4A 2DQRA 4F55A 4HNUA 4XN0A 1UAAA 3DBHB 2KRCA 1U0JA 4IF4A 1MH4A 2VPRA 2K9MA 1MSEC 2P6SA 1WJ5A 3ZN0A 1ZGWA 3CLOA 2WY8Q 1ZAOA 4GO1A 2R7SA 3IRQA 2R0QC 4AIJA 2OF7A 3OYHA 4RB2C 3HUGA 2HYGD 1LUJB 3KE2A 3QOPA 3Q9SA 1IAWA 4AVZA 2GXAA 2HOEA 3L09A 4DIQA 2WWYA 1J59A 4AM3A 1V54H 3GTPJ 3WU2C 2VC1A 1RUOA 1TWHJ 4BS9A 3DP7A 3IWZA 2H09A 3RKXA 4BJ6C 3OIPA 1U6GA 3J80Z 2DMQA 3UR3C 4F3QA 1YX5A 3X2QH 4XQFA 1NK2P 1T08B 2LBFA 2IXSA 1SANA 1ZRDA 4JX4A 4DBQA 3ZP5A 1WRJA 4E7JA 2ZXWH 4HZFA 2MLKA 2KRHA 3HL2A 2QKMB 2WBMA 2BHZA 5E8IA 3IKVA 2RQQA 1OCOH 3RZDJ 3EUHC 3S32A 1R6RA 2DA4A
chains in the Genus database with same CATH topology
1UELB 1Y6IA 3OYCA 1MMGA 3F9KA 3BC8A 4PFPA 1X1CA 1NG6A 2VB6A 2CV2A 4P1WA 5FROA 3CP2A 2R7VA 2MYSA 3ZGKA 2HPIA 1MMAA 4PJNA 3QYFA 4BDYA 2I8DA 3FKJA 2Z2SB 4PFOA 3AKZA 4RMNA 4RM2A 2E5ZA 3BG6A 2BVLA 3DKYA 4HPQA 3TMOA 4NQWB 3OYFA 2V4JC 3L2QA 2HVQA 3SEQA 4DBRA 3OYGA 2L5QA 2HZDA 2LOOA 5HOOA 4E4HA 1D1AA 3H5RA 2VXDA 2X6YA 2HDWA 2WADA 3AL0C 1LVKA 2MABA 3OOUA 2W00A 1MNEA 3BLYA 3S93A 2KP6A 3HPGA 4B47A 3M1CA 3W2AA 2WAFA 4FETA 2X1CA 2DXIA 3OY9A 2R7RA 3RTRA 3LSMA 1X4PA 1TT0A 2QKLB 3MD2A 4LITA 1LFPA 3ZCOA 4D1QA 3H9QA 3ZRGA 4XR6A 2JVHA 4BE1A 3LFUA 3KEYA 2VXZA 4XLCA 2RREA 2R4GA 4DOZA 1FMWA 4GRIA 2V26A 3HKZA 4F93B 4P5OA 1YE9A 4YRVA 2IS2A 1G8XA 4CH7A 3E0JB 2IGOA 2OUMA 1MNDA 3DU5A 4BL0B 3FHNA 3BG7A 4BE0A 2CW7A 2M3AA 5HLTA 4N4NB 2F5VA 2Z16A 4BJTA 5HVQC 2WA0A 1MMDA 2VIXA 4CCJA 4ZTJA 2LY1A 2IS6A 3L2WA 3NWSA 2ZXHA 4B48A 3QODA 4C30A 4RLFA 4KITB 4CCKA 2L9NA 3PSFA 2JSPA 4CCOA 2BW3B 2HQAA 2Q2EB 3OYNA 3OR1C 3N05A 1BR2A 5KHDA 3MKYB 4PSWA 2LBFB 1Z3XA 3OYKA 4HSTA 4BDZA 3UNGC 4U7BA 2R7TA 4CZCA 2XF6A 3CJRB 3ZXSA 2JA2A 3L2UA 3W2WA 1DGRM 1D0XA 1ERDA 4IZZA 1T0FC 4E7LA 1DP3A 3E1SA 2XDVA 3OMYA 4BEHA 1N75A 4IKFA 1IRXA 2GOXB 4XMYA 3EUAA 4XLEA 2R7OA 4C2UA 3VSLA 1E0EA 1Z21A 2PMZA 2VQLA 2X85A 1X4OA 5HNFA 3A2KA 2NOJB 2E1MC 3PNTA 3L2RA 2W7NA 2X6WA 3OWTA 4F92B 3OYIA 3C2HA 3OIQA 4XM3A 3S3MA 1D1CA 1OLTA 3PNYA 2HPMA 3PJRA 2CMPA 1N77A 1TZLA 4ZC3A 4CUGA 1SFKA 2A5WA 2XF7A 3LSGA 3K4JA 3H9GA 2O5RA 4B3XA 3HG9A 3D5SC 3CF2A 3S8PA 4CA0A 3K4LA 2X51A 3HXLA 3DPLC 1ZELA 4BUPA 2VJIA 2HU9A 3OYJA 3AL0B 4XKCA 3OYMA 2CW8A 2DT7B 1UG0A 2CV0A 2V9KA 2W82A 1PJRA 1X1BA 2E5NA 1FMVA 2ZSHB 4XL9A 3I3LA 2Q1ZB 2R7QA 4E7SA 4E7ZA 1DQUA 2V7FA 3HPHA 3OL4A 2VJ5A 3K70D 2X6XA 4XOPA 2CS3A 1SAUA 4QPOA 2IGMA 3AFHA 5HNHA 2K5CA 2OC6A 3K4BA 4ZTFA 2VLAA 1GLNA 3LMMA 1V5EA 4XKBA 2KLOA 4E7KA 1Z3YA 1DGWY 2ZXIA 3KYLA 2M4GA 1X1AA 4ANJA 1PYVA 1YX3A 2IGKA 4CSWA 2P0WA 3PL8A 3OYAA 5FRNA 3SEZA 2HVSA 2VKHA 4BQQA 4ITVA 3VYUB 3QYEA 2VL8A 3HOTA 5TGTA 4JOMA 4J00A 3C2GA 3H5AA 1LKXA 2KDOA 2JVGA 1WJAA 4OAZA 3DEEA 4LIVA 2HVRA 3K4CA 2R7WA 3RQ4A 4PUSA 4II3A 3M8JA 3H35A 3S3NA 2XC7A 2DOAA 2ZFUA 3HC7A 3W2VA 3A1YA 2IGNA 3DKXA 2W1OA 3HUGB 4BJ5C 4B43A 3K70C 3CZ6A 2XF5A 4CCNA 1NG7A 4BU2A 2AQEA 2LRDA 4DGWB 2V6EA 4BEHB 4LG3A 4XKVA 2R7XA 4R79A 1WJBA 3V42A 1Z7LA 1BR4A 2E1MB 2M7AA 2CH0A 2M7BA 3K6GA 4HG2A 1W36D 3U21A 3OYEA 4G6TB 1Y56A 2X1EA 2IS4A 3A4CA 3DWLE 2HNHA 4MLOA 4PJJA 4Y33A 2LC2A 2VQCA 4KJZA 2FUG2 2VQGA 4NC7A 2DT6A 5KNLA 3DLAA 3ZQQA 3TL4X 2GOMA 3DPTA 4YELA 2Y0SA 2X1DA 4PJLA 3OL3A 3OR2C 4XNFA 3QOEA 4XLFA 5LD2C 4ZDPA 4ZJZA 3J7AY 1HA8A 4RM3A 1J09A 4PSXA 3SYTA 4FASD 4BGDA 2KQRA 2LH9A 4Y3OA 5KCMA 3BCBA 3CMMA 2XSJC 3IAM2 5JHFA 4IQJA 2CUZA 3EPZA 5CQEA 2LYCA 3MKZA 3EUKL 2DCEA 3G2BA 3DPUA 3ZR8X 4BQOA 2K9LA 3CESA 3PFYA 4BXFA 1S9HA 2E60A 2CFOA 1WFXA 5CKTA 1W36C 1EA3A 1QHGA 3D5LA 1MMNA 3H9JA 3IUOA 3DU6A 5CPRB 3LSIA 2LG4A 3LL7A 2MD0A 2KZVA 3RSNA 2L9SA 1T95A 1WJCA 4OAYA 4NC8A 5CQGA 3OYBA 4Y4RA 1WJDA 3I9V2 3OS2A 3VYTB 3K4KA 3DTEA 3K10A 2PJRA 3DTKA 3FBNB 2BVMA 1P9QC 2RNGA 4N4OB 4XN3A 1G59A 1D0YA 2DJIA 3KX2A 4HEA2 1N78A 2MFZA 3L2VA 2OV7A 3RPUD 3H0DA 1WJFA 3K4NA 4NUBA 1BOBA 2KHMA 3PUBA 3VYSB 3MMYB 4F52A 4RLQA 2LREA 4KISA 2L2OA 4E6KG 3MKWB 4E7IA 3K4MA 3CJQB 1V5FA 2BOLA 4U87A 1KONA 2JUGA 2WY7Q 2L7KA 4KT6A 4LIUA 4EATA 1D0ZA 2A6TA 1D1BA 4YEJA 3SZGA 3GBGA 2KMUA 4JQFA 1AA7A 2LY2A 3RCOA 4AYBA 1WJEA 2VJJA 3NWTA 2K3PA 3PSIA 4II2A 2VQHA 4HSRA 4BE2A 3IAS2 4XKWA 4X0GA 5FRMA 2VKDA 4F91B 3D5RC 1BR1A 3BCAA 1LDKB 3IP4B 3LSKA 2UV1A 4XONA 4XLHA 1V5GA 2CUJA 1K6YA 2F4IA 3OS0A 4DJAA 1QHHD 3SDBA 4C9YA 4NNJA 1OR7C 4AU7A 2ELJA 4C2TA 4PK4A 1QU3A 3OYDA 4HNTA 5LFAA 4ZYAA 4H4KC 2WAEA 4IQ4A 4J01A 3VYRB 2VASA 3DQVC 4ZDOA 2KPMA 3TBIA 2V1NA 4CCLA 2WB1A 4CCMA 4D9JA 4XORA 4IX7A 3W3CA 2Z1DA 4XLAA 3CP8A 1JI8A 4PJMA 4BACA 3HOSA 2KL4A 2MC4A 4F55A 4HNUA 1MW7A 2AQFA 4XN0A 1UAAA 2CV1A 1U0JA 2KRCA 4QPQA 2WAQA 3FDYA 2K9MA 1WJ5A 2IS1A 1X1DA 2WY8Q 3PNVA 4B44A 3VSKA 3VWBA 4HRIA 2R7SA 3OYHA 2XAUA 3QYBA 3LSHA 1X19A 4BQNA 2M4KA 4AVZA 3ONQA 4DIQA 2VJ4A 3H5NA 2UWMA 3DTIA 4BS9A 4BJ6C 3FBIB 3OIPA 3VDXA 2R7UA 4XOTA 2BW3A 2F6CA 2ZSIB 4OWRB 3UR3C 4F3QA 1YX5A 2M0MA 4XQFA 2LBFA 2IXSA 2PJRB 4ZDLA 4DBQA 4E7JA 2VPLA 2KRHA 3HL2A 2QKMB 2WBMA 4E7HA 2RQQA 3OYLA 2UUZA 3EUHC 3S32A 3S3OA 1R6RA 3OS1A 1VZ0A 2W4SA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2DT6 A;  1X4P A;  2E5Z A;  2DT7 B;  1UG0 A;  2E60 A;  4DGW B;  1X4O A; 
#chains in the Genus database with same CATH topology
 1Y6I A;  5JR3 A;  3IKT A;  1B72 B;  5IP7 J;  3OYC A;  3S1Q J;  2LKX A;  4OIN F;  1Z6T A;  2Z3Y A;  5J1Y A;  1VQ6 I;  1LDJ A;  4PFP A;  5BOX A;  1NG6 A;  3WGH A;  1RC9 A;  2DFF A;  1WI9 A;  5DCM B;  5FRO A;  2MYS A;  3ZGK A;  2HPI A;  4PJN A;  3QYF A;  4BDY A;  4A3I J;  3FKJ A;  2ESH A;  4PFO A;  1H9G A;  1R00 A;  2LF8 A;  4IOC F;  2JRT A;  2XIG A;  4RMN A;  4WCG A;  4RM2 A;  1U5T C;  1ETO A;  1E3P A;  2E5Z A;  3DKY A;  5HS9 A;  1Y1W J;  2XGX A;  3BG9 A;  2V4J C;  2EJR A;  1BW5 A;  4IHW A;  1KQ8 A;  4M3B A;  1TC3 C;  2O7O A;  3J7Z I;  3SEQ A;  3B73 A;  1ETY A;  1X3U A;  2EK5 A;  1R1U A;  1HF0 A;  4IHX A;  3OIO A;  2LVS A;  1FZP B;  1HBX G;  2HXO A;  2X6Y A;  1MD0 A;  2Y69 H;  3PUF A;  1A6Q A;  3QPH A;  2IEK A;  2MAB A;  2QBY B;  1IV6 A;  4PCQ A;  1YIT I;  2W00 A;  4R1H A;  3RIR A;  3S2H J;  4HDU A;  2KP6 A;  2DPU A;  4HAM A;  1IJW C;  1ZHF A;  4FET A;  5LHH A;  2LSO A;  2DXI A;  2JSC A;  3LSM A;  3MD2 A;  4I99 C;  4A69 C;  1LFP A;  2HQN A;  2UXX A;  3ZCO A;  1XSX A;  4LK0 F;  4D1Q A;  3H9Q A;  2L7F P;  1XCB A;  3ASN H;  4LB6 B;  4BE1 A;  3LFU A;  3V8L A;  2OTJ I;  5H20 A;  1SMY F;  3QAH A;  4YG2 F;  4DOZ A;  1VTN C;  1IGN A;  3ABU A;  3HKZ A;  1F9N A;  4DYR A;  3FK6 A;  4F93 B;  2X48 A;  4YRV A;  1OMI A;  2GZW A;  3E0J B;  3DXJ F;  1HQC A;  2ICW G;  3DU5 A;  3FHN A;  4WF2 A;  1W0T A;  2Y30 A;  2FNA A;  4BE0 A;  1JXS A;  1WWX A;  2PJP A;  3C18 A;  4MEX F;  3VFZ A;  2CQ7 A;  2WA0 A;  1WI3 A;  5AON A;  4ABZ A;  5E3N A;  2DTR A;  4ZTJ A;  4HQE A;  4YII A;  4B48 A;  4IVN A;  3QOD A;  5ILV A;  3I59 A;  2XHK A;  4RLF A;  3W6J B;  4CCK A;  3PSF A;  1G2H A;  2JSP A;  3ASO H;  4XRS A;  3GEZ A;  2HQA A;  3OYN A;  2LK2 A;  1IN6 A;  3N05 A;  2P8T A;  2VBZ A;  3S14 J;  2ISY A;  4PSW A;  4EM2 A;  4HST A;  5TJJ A;  1XDS A;  4CZC A;  3KET A;  2XUB A;  4ZYH A;  1W0U A;  2GXB A;  3W2W A;  1DGR M;  1D0X A;  5FFZ A;  1FSE A;  2XDV A;  2HGC A;  4UUS A;  4G8X A;  4KIB A;  2B63 J;  4BEH A;  1O7L A;  3KP7 A;  1IRX A;  3C7J A;  5ERI A;  2LKS A;  4XMY A;  5FGM A;  1LE8 B;  1R4N B;  3SHF A;  2KJC A;  1R1V A;  5EG0 A;  1G3W A;  1SVO A;  2ZME C;  4BHP A;  1E0E A;  2TCT A;  3CCV I;  3A2K A;  1WCM J;  4UVA A;  1VFC A;  3DEU A;  3AG3 H;  2O9L A;  3GZN B;  4OIR F;  3L2R A;  2W7N A;  3L9F A;  1S7O A;  2E2I J;  2QSG X;  1W7P A;  1YI2 I;  3T5X A;  4XM3 A;  3K69 A;  4V2G A;  1D1C A;  1OLT A;  3I0T A;  5DM6 F;  1Z05 A;  3GFM A;  3K2A A;  2QEX I;  3S3M A;  3F6O A;  2FBI A;  1ZRE A;  3LWF A;  1SFK A;  2A5W A;  3PIP F;  3UKG A;  1G3Y A;  2NOG A;  3K4J A;  3OSG A;  3I4N J;  3HG9 A;  1BW6 A;  1Y0U A;  2K9S A;  3JSO A;  4C3I J;  4L0Z B;  2L7M P;  2QSF X;  1ZEL A;  3F8C A;  2VJI A;  5LEJ A;  3HRU A;  5K5R A;  4I98 B;  4U7D A;  3HDD A;  3OYM A;  5D4S A;  2XV4 S;  1XGO A;  2LF7 A;  4HX8 A;  1SVM A;  2V9K A;  2Y9Y A;  3GFI A;  2X4H A;  1YW9 A;  4A3J J;  4GYG A;  2NS7 A;  4HA8 A;  1A36 A;  4IHS A;  3I3L A;  2R7Q A;  1DQU A;  2H94 A;  1BC8 C;  3HRT A;  1X2M A;  3VB2 A;  3KEQ A;  4I09 A;  2PBI A;  1R49 A;  1B9N A;  4XOP A;  2DO7 A;  4M9X A;  1RR7 A;  2CS3 A;  4QPO A;  2A69 F;  1MJB A;  1Y0N A;  1JJ8 C;  2NXN B;  1WH5 A;  3Q3S A;  2HDD A;  1ETW A;  2DYS H;  3K1P A;  2KJB A;  4BAY A;  4Y15 A;  4WX9 A;  4JYK A;  3CCE I;  2VLA A;  4ZTF A;  1V5E A;  1O3Q A;  5GAG J;  1HKT A;  5M3F J;  5L3G A;  3LAP A;  2M4G A;  1SFU A;  3E6D A;  2IA0 A;  5E8G A;  1HW1 A;  2P0W A;  4P55 A;  1I3Q J;  1QQI A;  3JRH A;  5BQT A;  4OIQ F;  3E5U A;  5CVJ A;  4L0Y B;  4BQQ A;  1K4T A;  2F5D A;  4ITV A;  2VE9 A;  2L02 A;  2GQQ A;  3VYU B;  4IO9 F;  2VL8 A;  1BC7 C;  1OJL A;  4B1R A;  2MD5 A;  5E3M A;  4UB6 C;  2JVG A;  2K4J A;  4LIV A;  3K4C A;  1LB2 A;  2XAS A;  2A5Y B;  3BJA A;  3MQ0 A;  2RQP A;  4M9S A;  2WTE A;  1FPQ A;  2B9S A;  3S16 J;  3H35 A;  4I7H A;  3S3N A;  2DK5 A;  3R61 A;  1Q1V A;  1G4D A;  1MMS A;  4IEJ A;  5EYR A;  3CC4 I;  1T39 A;  2ZFU A;  3HC7 A;  1OYY A;  2JJ7 A;  3A1Y A;  1ETQ A;  1OCT C;  3FXM A;  3DKX A;  4BJ5 C;  4NC6 A;  3ML6 A;  4MEY F;  2XAF A;  4B43 A;  1OR7 A;  4FX4 A;  4CCN A;  1NG7 A;  4BU2 A;  4ENN A;  2FX0 A;  2LRD A;  2OU2 A;  2QBY A;  2DPD A;  3C3W A;  2RC4 A;  3WHC A;  4R79 A;  1WJB A;  1W5S A;  2LKP A;  1HSJ A;  2MG4 A;  3OSF A;  1BR4 A;  1KU2 A;  1R36 A;  3K6G A;  4HG2 A;  1RES A;  2E34 A;  5J1R A;  2IS4 A;  3DWL E;  3OOP A;  2VBW A;  2TDX A;  5DDG A;  2HS5 A;  2VQC A;  4KJZ A;  2VQG A;  2DMP A;  2M34 A;  3JSP A;  2H8W A;  5J6X A;  1FSH A;  1MH3 A;  4H0E A;  3PO2 J;  4EM0 B;  3JRF A;  3ZMV A;  1FYL A;  1BI0 A;  1HW5 A;  2X0L A;  4ZJZ A;  4A3F J;  1XGM A;  2FXA A;  4RGX A;  4PSX A;  3BR5 A;  5L3B A;  3B6A A;  1T6S A;  2KQR A;  3CMM A;  2MLG A;  3HRM A;  1IUF A;  3HHG A;  1U8R A;  6PAX A;  2E1C A;  3GVA A;  3G2B A;  3A0H C;  4BHC A;  4RBO A;  2G9W A;  1Z1D A;  3WGG A;  4U0W A;  1EA3 A;  3CCJ I;  1IRZ A;  2DN0 A;  4L5E A;  3RSN A;  4ZZD A;  4NC8 A;  5CQG A;  2R5Y A;  1B9M A;  3FMR A;  2H1L A;  3ERE D;  2ESN A;  4Y17 A;  3FMS A;  4FQG A;  3OS2 A;  3PQJ A;  2RNJ A;  2EIN H;  1XMA A;  3ECH A;  3TP3 A;  3CDH A;  5FFX A;  1TNS A;  2BVM A;  1P9Q C;  5K5O A;  4TV7 A;  4XN3 A;  3TDZ C;  1G6N A;  1N78 A;  4UY8 I;  3TOB A;  1LQ1 A;  2OV7 A;  3IC7 A;  1TTY A;  1UST A;  4KMU X;  4ON0 A;  3U9G A;  4NUB A;  1RI7 A;  3ROU A;  2XPV A;  2ELH A;  2P6T A;  1KA8 A;  1FYK A;  3PUB A;  3MMY B;  2DT5 A;  4F52 A;  1PDN C;  1UJ8 A;  4CGZ A;  2L2O A;  3MKW B;  4FIS A;  3CF5 F;  2EBI A;  3CJQ B;  5FKL A;  2YS9 A;  3A02 A;  1V5F A;  2BOL A;  2JZY A;  3GTJ J;  5D8K B;  1BJZ A;  1KU3 A;  1D0Z A;  2K40 A;  1D1B A;  3CD6 I;  2RN7 A;  3SZG A;  2KMU A;  1NHA A;  1AA7 A;  1MBG A;  3E97 A;  2KDZ A;  2DLL A;  1WJE A;  4I02 A;  3FXK A;  3NWT A;  5E3L A;  2R5Z B;  3CUO A;  3KZZ A;  2QLZ A;  1OIS A;  2PI0 A;  5FLX Z;  4DYQ A;  1CQT A;  3KYC B;  3SJM A;  4RB0 A;  2BY3 A;  1ZRC A;  3D5R C;  2GIZ A;  1MIJ A;  1BR1 A;  3H3V K;  1SD5 A;  3GF2 A;  2UV1 A;  4XON A;  4EJV A;  3HSE A;  4LD5 A;  4XLH A;  4RAF A;  1YS6 A;  1V5G A;  2F4I A;  2HYJ A;  5E18 F;  3M9A A;  3GFL A;  4CZZ A;  2CWE A;  4HW0 A;  1QU3 A;  1RIO H;  1SD7 A;  3RPU A;  4HNT A;  3M7G A;  2X9D A;  1SAX A;  1J7K A;  4A2U A;  4CO8 A;  2JTV A;  4UV9 A;  3DQV C;  4LGW A;  3G1O A;  2DA5 A;  1LPQ A;  1IN7 A;  2WB1 A;  4CCM A;  3M8E A;  2EQR A;  2M0C A;  3J81 K;  1YYV A;  2M9H A;  1ZG1 A;  2Z1D A;  5D5V B;  1YIJ I;  1B8I A;  4BAC A;  4KIF A;  1ZGJ A;  2DMT A;  1JUP A;  4MHG A;  3HOS A;  5EEH A;  2H8R A;  2L01 A;  1MW7 A;  1J5Y A;  5GP9 A;  3F8N A;  2FA5 A;  3HGG A;  3R6S A;  1YG2 A;  2R3S A;  2D2W A;  3PNV A;  4UB8 C;  4B3A A;  1S7E A;  3O2P E;  3E3V A;  5D5W B;  1A6I A;  1K78 B;  4QSH A;  2OZU A;  5ICE A;  3COA C;  3Q5F A;  2M4K A;  3BR2 A;  3ONQ A;  2K85 A;  1ZYR F;  1R5I D;  2JA8 J;  2CFX A;  3DTI A;  5J8C A;  1GDT A;  5KVR A;  3FBI B;  1EKE A;  3HRS A;  1JTX A;  2DOE A;  3DV8 A;  3MEX A;  2BW3 A;  4XOT A;  1VI0 A;  2OAZ A;  4WK8 F;  1BN5 A;  1V55 H;  1T8I A;  2PJR B;  2OZ6 A;  2ID6 A;  1VQ9 I;  3RZO J;  2ELK A;  3P9K A;  3ABT A;  4PGH A;  4UUT A;  4RGR A;  4M6X A;  4E7H A;  1KGS A;  3L1P A;  4ENJ A;  2A07 F;  4J19 A;  3OS1 A;  1P92 A;  1VZ0 A;  1B6A A;  3ABK H;  1XSD A;  4JX6 A;  3KP5 A;  1UEL B;  5FD5 A;  1J2X A;  3R0A A;  4Y13 A;  1VQK I;  3WU0 A;  4RDU A;  1IDZ A;  3O6B B;  2E7X A;  4XBF A;  2VE8 A;  2K4B A;  1DPU A;  5E1Z B;  3IH2 A;  4M6Y A;  1IN8 A;  5M5Y J;  1O4X A;  1BBY A;  1XCV A;  2F4O B;  1T98 A;  1YOV B;  1HXD A;  4IXA A;  2GAU A;  1I1G A;  3NAR A;  1QBJ A;  4HPQ A;  2HQR A;  2BVL A;  2QM3 A;  3BG6 A;  5E1W A;  4MTE A;  4NQW B;  3TMO A;  4WWC A;  1AWC A;  2A6E F;  4IL6 C;  2W84 A;  3MZY A;  3OYF A;  4UUV A;  5H2F C;  3L2Q A;  2HVQ A;  3FMQ A;  4R8H A;  3OYG A;  4PDK A;  1U78 A;  4OMZ A;  2LOO A;  1R1T A;  2ZO4 A;  5M3M J;  5KAF C;  3K1M A;  1WH7 A;  1MBH A;  4E4H A;  1Z7U A;  5DV5 A;  2V1U A;  1JGG A;  2OD5 A;  3OV8 A;  1LVK A;  1D3Y A;  3OOU A;  2HYF A;  3BLY A;  1FLI A;  4HF1 A;  3S15 J;  1QNT A;  1UG2 A;  2BYV E;  4A12 A;  2FOK A;  3HPG A;  1FJL A;  3QP6 A;  1MBJ A;  5J47 A;  1QO0 D;  1YRN A;  4RS8 A;  2VOO A;  1HC8 A;  1OFC X;  3GYH X;  3OY9 A;  2R7R A;  3J7Y J;  5M5X J;  1RKT A;  1X4P A;  2ACJ A;  2QKL B;  4OU0 A;  1VQ4 I;  2XVC A;  2O6G E;  4A0Y A;  3G1L A;  3KEY A;  4XLC A;  2MA3 A;  2R4G A;  4FHT A;  4IRH A;  2M8G X;  5ILU A;  2BXZ A;  1LFB A;  4MTD A;  2K02 A;  3HTU A;  2DOD A;  2V26 A;  1LVA A;  1D5Y A;  5JFR A;  2J5P A;  2PG4 A;  1YE9 A;  3U2R A;  1E3H A;  3S1R J;  3SXY A;  2IS2 A;  2K27 A;  3HHH A;  2OUM A;  5EZG A;  4EQQ A;  1W7P D;  4BL0 B;  3F21 A;  1ZLK A;  5LBQ A;  3BG7 A;  1YIO A;  2CW7 A;  2EIK H;  1APL C;  3VEP A;  4MFD A;  3M07 A;  3IH4 A;  1MMD A;  5IYD J;  2OA4 A;  3ABM H;  2IS6 A;  1MJA A;  1OYI A;  4XID A;  5ICG A;  2ZXH A;  3FM5 A;  4C30 A;  4XIC A;  1ACI A;  2JA6 J;  4LG0 B;  1OCC H;  1XGN A;  3ZQ7 A;  4B8X A;  3ZQG A;  3EQL F;  3MKY B;  2JUC A;  5IPA A;  2OJE D;  3FIS A;  1Z3X A;  3OYK A;  1ZAR A;  4BDZ A;  1H0M A;  3BR6 A;  2JA2 A;  2Y75 A;  3L2U A;  1SD4 A;  2CUE A;  4G6Q A;  3GZ6 A;  1R71 A;  3CJN A;  4L9V A;  1FX7 A;  1T0F C;  1VQO I;  1DP3 A;  3K0L A;  3E1S A;  2N8G A;  1MBK A;  3OMY A;  5FLV A;  1BIA A;  1Z77 A;  5DD4 A;  3Q0W A;  2EIM H;  1AKH A;  3DEW A;  5CYV A;  3HYI A;  5DTD A;  4C2U A;  2BY0 A;  3RI4 A;  2H6B A;  2VQL A;  5HNF A;  2VI6 A;  4XSZ F;  2NOJ B;  2E1M C;  3HSF A;  1Q1H A;  4A3K J;  3S17 J;  2D1H A;  1YQA A;  2YR2 A;  1WVR A;  1W1W E;  1U5T B;  2L4M A;  1QZE A;  4HNV A;  1TZL A;  5DEQ A;  3A01 B;  4MIM A;  2ZJQ F;  2XF7 A;  2ZNZ A;  3LSG A;  2O5R A;  3D5S C;  2EWN A;  4L9N A;  2X51 A;  3DPL C;  3OYJ A;  4Q47 A;  4XKC A;  5K7F A;  1REP C;  5DUK A;  4GXO A;  1ZRF A;  4LMY A;  2CV0 A;  2CSO A;  1HLV A;  1PJR A;  5F6F A;  2YUS A;  5GPC A;  2HQ5 A;  3L7W A;  2E5N A;  2ZSH B;  5LHI A;  4XL9 A;  3BZ6 A;  3AG4 H;  5EEG A;  2X6O A;  2HXI A;  3U1D A;  2VJ5 A;  2P5V A;  3ZQH A;  4CHU A;  5EDN A;  2NS0 A;  3E7L A;  5DUI A;  1HST A;  1HDP A;  2L54 A;  5IT9 K;  1Y39 A;  1NH3 A;  3H0G J;  1P4W A;  2K5C A;  2OC6 A;  2RGV A;  1GLN A;  4XKB A;  3H36 A;  3KYL A;  3FXL A;  1ZLJ A;  4EGY A;  1J9I A;  2CQX A;  1IXS B;  4RA2 A;  4ANJ A;  3MFK A;  1YX3 A;  4CSW A;  3I5U A;  5FRN A;  1TNT A;  2IA1 A;  2DA6 A;  2WAQ N;  4KN4 X;  1RKW A;  4XRF A;  2HWV A;  2GLO A;  1HOM A;  1DUX C;  3TOA A;  2GIV A;  3BY6 A;  3HGY A;  3QYE A;  5TGT A;  4G6D A;  1LKX A;  2KDO A;  4HOB A;  5F27 A;  2XRO A;  1UHM A;  1WJA A;  1MJ9 A;  3DEE A;  1ZK8 A;  2QQ8 A;  2R7W A;  3E5Q A;  5GAD J;  2QCO A;  3DF8 A;  4L5J A;  4NQW A;  4PUS A;  4II3 A;  3M8J A;  4A6E A;  1S5L C;  3EET A;  3LA3 A;  3B6C A;  1FWZ A;  5FKM A;  1M1E B;  4M73 A;  4QTR A;  2ZJR F;  2VC0 A;  1ZG3 A;  2XF5 A;  2W24 A;  2AQE A;  2B0L A;  5EEA A;  2V6E A;  1E17 A;  3JW4 A;  4LG3 A;  4XKV A;  2XPU A;  2MGQ A;  2ZME B;  4BBR J;  2R7X A;  1ULY A;  2PQ8 A;  1QZZ A;  2M7A A;  1OCP A;  2CH0 A;  1PUF B;  1YFH A;  1AHD P;  3U21 A;  4G6T B;  2X1E A;  3WTZ A;  3A4C A;  3PO3 J;  2OQR A;  2HNH A;  3KCC A;  3CCY A;  4ZYE A;  3JCU C;  1VQN I;  1UHS A;  1U3E M;  4KNY A;  1YO5 C;  2LC2 A;  4NC7 A;  2DT6 A;  1QPI A;  3ZQQ A;  3TL4 X;  3TED A;  1I6H J;  2P7C B;  2JQ7 A;  1QGP A;  5F0H A;  4PJL A;  2F5F A;  3OR2 C;  5AIQ A;  3ZQC A;  4ZDP A;  2GA2 A;  1UCR A;  4RM3 A;  1IN5 A;  1SEU A;  1H88 C;  1FTT A;  4WXD A;  3SYT A;  4HDV A;  5TRD A;  4HYE A;  3BPX A;  4RAY A;  4YIR X;  4Y3O A;  3BCB A;  2XSJ C;  4N0B A;  3IHU A;  1HKQ A;  3B02 A;  4AWX B;  4EVI A;  1NTC A;  3IAM 2;  2HOS A;  1BJA A;  3EPZ A;  1RUN A;  5CQE A;  5LHG A;  2XPW A;  2DQL A;  3KEO A;  1P6R A;  2BZT A;  1RET A;  5E17 F;  1T38 A;  4CDG A;  2BGC A;  3F8M A;  5A2Q K;  1L0O C;  2CFO A;  1WFX A;  5CKT A;  1A04 A;  2HOA A;  2E2J J;  1P4A A;  2KIQ A;  4JP0 A;  4AVP A;  3IRR A;  3IUO A;  2OQG A;  4QLC U;  4UVC A;  5B66 C;  2IAI A;  3KYD B;  1PVE A;  2M5W A;  2O03 A;  4QWQ A;  3NAU A;  4Y4R A;  1X3W B;  1WJD A;  1ZKG A;  2D5V A;  3I9V 2;  4GDF A;  3VYT B;  2XAG A;  3K4K A;  2XAQ A;  4UHT A;  1ZQ3 P;  2VUM J;  1VQ8 I;  1Z0X A;  3FBN B;  1K83 J;  4N4O B;  5K7H A;  2NNN A;  1B4A A;  1D0Y A;  1EH8 A;  1G3S A;  1U5T A;  2LFB A;  4HEA 2;  5J4V A;  3L2V A;  2E1N A;  2YX7 A;  1YJN I;  3RPU D;  3H0D A;  3QRF F;  3VPR A;  1QZY A;  4M3E A;  2ADU A;  2IRF G;  2EA2 A;  3IL2 A;  1B72 A;  2EPF A;  1BOB A;  4KIC A;  3S2D J;  1F43 A;  2QSH X;  4RLQ A;  2LRE A;  2PN6 A;  5CVR A;  2NRA C;  2BXY A;  3K4M A;  5E79 C;  1KU7 A;  1IW7 F;  1R58 A;  2JUG A;  4FT8 A;  5DCM A;  4CXF A;  2EIJ H;  3DLL F;  2A6T A;  1HW2 A;  4UNO A;  4DYC A;  4YEJ A;  4RB3 C;  3WE2 A;  1DP7 P;  3GCM A;  2DA2 A;  2LY2 A;  4W1U A;  2QZ8 A;  3RCO A;  3JAM K;  2VOP A;  3MVP A;  3PSI A;  2BV6 A;  1WKM A;  3SZP A;  3I4P A;  5CLS A;  3ZMU A;  3RKQ A;  3C1D A;  4BE2 A;  3CO7 C;  4A3D J;  4XKW A;  2NS8 A;  3PIO F;  5FRM A;  3MZ8 A;  3I64 A;  2COM A;  3HBL A;  3L2C A;  3M8F A;  2HTJ A;  3ULQ B;  5FKN A;  4HLX A;  3OS0 A;  3I54 A;  2O0Y A;  3O8H A;  4I0B A;  2ZFW A;  5D6E A;  4AU7 A;  1BA5 A;  2VN2 A;  3E6B A;  4ZYA A;  3JR9 A;  3GUD A;  4N9H A;  4H4K C;  2OPT A;  1JKO C;  2VAS A;  2KPM A;  4O3M A;  3F22 A;  4CCL A;  4DZP A;  4D9J A;  5IP9 J;  4HV5 A;  3V7C A;  1S3J A;  4Z2Y A;  3W3C A;  1MDM B;  1XMX A;  2H27 A;  4PJM A;  1SFO J;  4B4C A;  4DNC A;  3ZQF A;  2MC4 A;  2AQF A;  1PP7 U;  2CV1 A;  1ON2 A;  2DFI A;  2HFH A;  3P5J A;  4UXN A;  1OQY A;  2A6H F;  2A3S A;  3KLN A;  5HDN A;  2HZT A;  5K5Q A;  1X1D A;  2G0E A;  2IS1 A;  4B44 A;  3VWB A;  3AG2 H;  3FX3 A;  3QPL A;  3ZQI A;  4BH9 A;  3CMY A;  1Z9C A;  2XAU A;  2LP0 A;  5HS8 A;  4BQN A;  3CMA I;  1B59 A;  2JA5 J;  2K7L A;  2VJ4 A;  3R0J A;  1MZB A;  3U1K A;  2UWM A;  1YJ9 I;  2O61 A;  3FZV A;  5HDK A;  3VDX A;  2XRN A;  5CVV A;  1QPM A;  2ZSI B;  1PUF A;  1H89 C;  3M3Y J;  4BXU A;  5LRS A;  1BIB A;  4ZDL A;  4A0Z A;  2NNY A;  2GM4 A;  4YFN F;  4FCY A;  1K79 A;  2NYX A;  5FB2 A;  2VPL A;  4A0X A;  1ON1 A;  1OYW A;  1OCZ H;  5F08 A;  1GVJ A;  3WTY C;  3LSP A;  1KYW A;  1LEA A;  2EFN A;  2DAO A;  3OYL A;  2UUZ A;  3DBR B;  1YJW I;  2FBH A;  3A0B C;  1MSF C;  1UB9 A;  1LE8 A;  4KDP A;  3WU1 B;  3BZK A;  3QPT A;  2NVX J;  1S29 A;  1JUM A;  4Q4Z F;  3ZPL A;  4XSX F;  1MMG A;  2E36 A;  5E1X A;  5LEK A;  3BC8 A;  4OOI A;  1X1C A;  3LAJ A;  2VB6 A;  2CV2 A;  1YW7 A;  2R7V A;  3KFW X;  5D5X B;  2M87 A;  1MMA A;  3E5X A;  5IYC J;  2VT2 A;  2Z2S B;  3D1N I;  5HLG A;  3BP8 A;  2IBD A;  2CW0 F;  2QVO A;  4B09 A;  3G71 I;  2E71 A;  2CU7 A;  1HCR A;  1U8B A;  1ONV A;  2FRH A;  2L5Q A;  3CTA A;  1D5V A;  2LD5 A;  5HOO A;  2L0K A;  3Q0V A;  1D1A A;  3WTS C;  4LK1 F;  1QVT A;  2VXD A;  3IWF A;  4X6A J;  2HDW A;  4ASN A;  3AL0 C;  3Q0U A;  3ABL H;  3P9I A;  5D6F A;  1MNE A;  4D7M A;  1FTZ A;  3J7A O;  3S93 A;  1NK3 P;  3EDP A;  5IYB J;  1FYM A;  5ILS A;  4B47 A;  1RPW A;  1T56 A;  5FD6 A;  3GW2 A;  2LMD A;  2ZBK A;  4Q5S F;  2M1B A;  3KP4 A;  1FBS A;  3CUQ B;  1DDN A;  2PMZ N;  2ZCW A;  1MNM C;  3BQY A;  2QYO A;  4G7H F;  4L9J A;  3CO6 C;  4YFX F;  1XD7 A;  3ZRG A;  4XR6 A;  1R22 A;  2JVH A;  1V4R A;  2EFO A;  2VXZ A;  3BRO A;  1FT9 A;  1CF7 B;  5F0C A;  1J75 A;  1FMW A;  4GRI A;  2STW A;  2CUF A;  1UMQ A;  1SD6 A;  3QU6 A;  3CCL I;  1TT5 B;  1ENH A;  2DW4 A;  3LNQ A;  2QF7 A;  1WZ2 A;  4CH7 A;  1BI2 A;  2IGO A;  3CC7 I;  1MND A;  2LY9 A;  2YU3 A;  2KIF A;  4FE4 A;  2DYR H;  3DFG A;  4AID A;  2F5V A;  3CUQ C;  4BJT A;  1P7J A;  4CCJ A;  2VIX A;  5HVQ C;  3LA2 A;  4IRG A;  4MQ9 F;  3L2W A;  3NQO A;  2MSY A;  1W5C C;  3GME A;  5E20 A;  4IHT A;  4M9Z A;  1HDD C;  1YHQ I;  2XGE A;  3BR1 A;  3H92 A;  4AD9 A;  1ZTR A;  4XK4 A;  5FKK A;  2JN6 A;  4CCO A;  3ERM A;  2Q2E B;  2XKO A;  5IY5 H;  3OR1 C;  1BR2 A;  5KHD A;  2LBF B;  4UV8 A;  4XRS G;  2NVQ J;  2XF6 A;  3CJR B;  2FD5 A;  4Y7N J;  2R7F A;  4E7L A;  3K7A J;  2O8K A;  5D4R A;  1N75 A;  3AG1 H;  4RB1 A;  4PJ0 C;  4IKF A;  2GOX B;  4G94 A;  3EUA A;  2KIU A;  5H6Q A;  5K1Y A;  1ZH5 A;  3GX4 X;  1C0W A;  2R7O A;  2VKE A;  3GTK J;  1TW2 A;  3VSL A;  1WHU A;  1PP8 F;  2F4M B;  2FMY A;  2DDA A;  2PMZ A;  3SZT A;  2EB7 A;  2X85 A;  1X4O A;  3GTM J;  2CJJ A;  3MCZ A;  3PNT A;  2UZK A;  1OKR A;  2DJN A;  2X6W A;  4F92 B;  3SFZ A;  3OYI A;  3FXQ A;  2RDP A;  5FO5 A;  2Z33 A;  1CGP A;  3OIQ A;  3V8K A;  1MDM A;  2HPM A;  4CIC A;  3LST A;  4OMY A;  3QQA A;  1I3A A;  1R23 A;  5C4X J;  3TW7 A;  2WV0 A;  3H9G A;  4AYB N;  2V6C A;  2FEZ A;  3CF2 A;  5B1A H;  4V2F A;  3DCF A;  3HXL A;  1IRF A;  2HU9 A;  1SC7 A;  1N25 A;  3WOD F;  2JMW A;  3N4M A;  2FJ1 A;  2CW8 A;  2DT7 B;  1IN4 A;  1UG0 A;  2FML A;  3K2Z A;  1O7F A;  4L9T A;  1MBE A;  3LOC A;  5D8L B;  5J1U A;  1UZC A;  1X1B A;  4ENM A;  1FMV A;  2Q1Z B;  2DMN A;  3J80 K;  3RKW A;  1I50 J;  2V7F A;  3HPH A;  2BY2 A;  3OL4 A;  2HTS A;  3K70 D;  1R5H A;  2H6C A;  2X6X A;  3S1N J;  5J40 A;  5BS6 A;  5JVG F;  1ETK A;  1SAU A;  2PEX A;  3WG7 H;  4M3D A;  9ANT A;  3WTT C;  1IUY A;  4E70 A;  3RJP A;  2IGM A;  3AFH A;  1VQ7 I;  1XTA A;  1XDU A;  4I01 A;  5HNH A;  5BPI A;  3K4B A;  2JA7 J;  3P9C A;  5JVT A;  3F3X A;  2KLO A;  4KYW A;  2ZXI A;  1S7A A;  1JHF A;  2DFE A;  2J5O A;  4IJA A;  1X1A A;  1DU0 A;  3MAJ A;  4G9Y A;  1F36 A;  4A3M J;  4Q48 A;  1PYV A;  2KFD A;  3BG5 A;  1ORK A;  1Z6R A;  2Y0S N;  4EMS A;  4NDL A;  2K9N A;  3F72 A;  3GTL J;  1VQL I;  1U9O A;  2L4A A;  5DCF A;  2HVS A;  2VKH A;  1VQ5 I;  4JOM A;  2V1X A;  3H5A A;  3J81 Z;  2ZKZ A;  4OAZ A;  4MFE A;  3I59 B;  1RZ4 A;  2VON A;  4HF2 A;  3RQ4 A;  3CLQ A;  2XB5 A;  3IV5 A;  1VND A;  3W6V A;  3VOE A;  2OCC H;  5D5U B;  1XMK A;  2XGD A;  5CVU A;  2P5L C;  2E19 A;  3BR0 A;  1QA6 A;  4KA4 A;  1IXR C;  3TO9 A;  3K70 C;  3CZ6 A;  3S2W A;  2COB A;  1TWG J;  4UUS B;  1TWF J;  5FLM J;  4BEH B;  3KZY A;  2OTL I;  1F1Z A;  3KLO A;  3WTV C;  3HZJ A;  2EV0 A;  3V42 A;  2R5Z A;  2E35 A;  2O8X A;  3QPS A;  1Z7L A;  5EG0 B;  3BZC A;  2E1M B;  2Y31 A;  1KZH A;  2M7B A;  1LNW A;  1W36 D;  3TW6 A;  5FJ8 J;  2YX4 A;  2IW5 A;  1LEB A;  1ZR4 A;  2EA4 A;  1WQ2 A;  4PJJ A;  5J4Y A;  1W7P B;  1DPR A;  4A6D A;  4Y33 A;  3G1M A;  2FUG 2;  2ECB A;  5KNL A;  3M4O J;  1PUE E;  1CF7 A;  2FSW A;  5KK1 A;  3EYY A;  4YEL A;  2QUF A;  3G73 A;  4ZZL A;  2Y0S A;  2X1D A;  2V79 A;  4D5C A;  2FU4 A;  4XNF A;  3QOE A;  4XLF A;  5LD2 C;  4NB5 A;  2B7E A;  3Q9V A;  5ICC A;  1GHC A;  3J7A Y;  1HA8 A;  1VQP I;  4FTH A;  1X3Z B;  5DYM A;  3T8T A;  1GT0 C;  3BJ6 A;  3I56 I;  4FAS D;  3GXO A;  2VBY A;  4A3G J;  4X1E A;  2LH9 A;  5KCM A;  2L7Z A;  5F1R A;  5JHF A;  2CUZ A;  4KFC A;  3MKZ A;  4IRI A;  2Q2E A;  4Y52 J;  4M3F A;  4O6J A;  3ZR8 X;  3BDD A;  3CES A;  1S9H A;  2RAE A;  5ED4 A;  4GFB A;  1RR8 C;  1IRG A;  1W36 C;  1GVD A;  1K78 A;  3BPV A;  2BY1 A;  2W48 A;  1JUS A;  3E6M A;  4U0V A;  3JRD A;  3S1M J;  3D5L A;  1MMN A;  3H9J A;  1IZ1 A;  5CPR B;  2LG4 A;  4DQ2 A;  3JTG A;  2AHQ A;  2NVU B;  2PLY A;  1U9N A;  2L9S A;  2DBB A;  1WJC A;  2AS5 F;  1O3S A;  3LQR A;  1OPC A;  3FK7 A;  3WTU C;  1BL0 A;  1ODD A;  4ZH4 F;  3HKZ N;  4IOA F;  2IA2 A;  2PJR A;  4FX0 A;  3DTK A;  3GLL A;  2RNG A;  4U0Y A;  4KUM A;  2M2E A;  1QVU A;  1FBQ A;  1TQI A;  1WJF A;  2MC3 A;  1FP2 A;  1FNN A;  1XX5 A;  2DMU A;  2ISZ A;  2BBY A;  2W25 A;  3BQZ A;  1F4K A;  2ME0 A;  4BQA A;  4F7Z A;  3VYS B;  2V9V A;  4M72 A;  4E6K G;  2PX9 A;  3I53 A;  2EH3 A;  1TQM A;  2E2H J;  5AIP A;  2L7K A;  3ZMZ A;  2QEN A;  4KT6 A;  2EFW A;  2IP2 A;  4EAT A;  2Y9Z A;  1X2N A;  2Y48 A;  3F6V A;  3GBG A;  3R4K A;  1KYZ A;  2JT1 A;  3NEU A;  4ZYG A;  2XAJ A;  4ENK A;  1UHW A;  5F64 A;  2F5C A;  3FXR A;  2C6Y A;  2VJJ A;  1VF9 A;  1K7A A;  1FOY A;  2AXT C;  2KZG A;  3LA7 A;  4II2 A;  2VQH A;  1KU9 A;  2Z9O A;  4HSR A;  3IAS 2;  2ZXJ A;  3HOW J;  1BOA A;  4F91 B;  3GO5 A;  3SFI A;  3BCA A;  2P81 A;  3IP4 B;  3LSK A;  2V1D A;  2OBP A;  3PM1 A;  4G7O F;  3H1C A;  2CYY A;  3ZOB A;  2CUJ A;  3DKW A;  2ZJ2 A;  3HSR A;  1TQP A;  3JRB A;  1R7J A;  3SQN A;  2JWT A;  4RAZ A;  1HKS A;  3SDB A;  3BTL A;  2FNP A;  3GZ5 A;  4RGS A;  4C9Y A;  1OR7 C;  3HIF A;  2ELJ A;  5CVI A;  4C2T A;  1Y8R B;  5GTH C;  5LFA A;  3BTC A;  2WAE A;  2QWW A;  2DA1 A;  4IQ4 A;  3JRA A;  5ICF A;  2HEO A;  3VYR B;  4U88 A;  1GXQ A;  4ZDO A;  4L5I A;  2KKO A;  3TBI A;  1XB4 A;  2V1N A;  1LJ9 A;  1ZG5 A;  1WSU A;  2VKV A;  4XLA A;  4I2O A;  2RKH A;  3CP8 A;  1VQM I;  4A93 J;  2F5E A;  4HBL A;  2EZL A;  1KQ9 A;  3PQK A;  1A35 A;  4IHV A;  1SFE A;  2KT0 A;  4M3G A;  1GUU A;  2JPC A;  4QPQ A;  2WAQ A;  3FDY A;  3MZH A;  1U2W A;  3GLX A;  5B5E C;  5L3D A;  2AO9 A;  4HRI A;  3VSK A;  5IOZ A;  1T0F A;  2MH9 A;  3TO7 A;  1IG7 A;  2G7U A;  5EZH A;  3QYB A;  3I4M J;  2W85 A;  3LSH A;  1X19 A;  2EFP A;  4G7Z F;  2RV8 A;  1EH7 A;  3H5N A;  4D5F A;  4OIO F;  4P9F A;  3KZI C;  1YTY A;  4LG0 A;  2R5Y B;  1I5Z A;  3TO6 A;  2XGC A;  3LSJ A;  2R7U A;  4OWR B;  2F6C A;  3A03 A;  3HOX J;  4GGG A;  3T1B A;  2RVC A;  4HV6 A;  1QRY A;  2M0M A;  4C3J J;  4A3C J;  5F04 A;  4JBA A;  5B3S H;  2R7Z J;  2K9Q A;  1YS7 A;  3EUH A;  5GAH J;  2Q8K A;  4EJU A;  5IT9 Z;  2HDC A;  2O3F A;  2ETH A;  3S3O A;  3V8J A;  3TKY A;  3WTW C;  4WXH A;  4ESB A;  4S05 A;  4IPA A;  2W4S A;  4EJW A;  2A68 F;  3PJR A;  1RRJ A;  2NVT J;  3ECO A;  3V7R A;  4EJT A;  2CO5 A;  2M45 A;  3F9K A;  5C3E J;  2Z5U A;  4N9I A;  3E6C C;  1FIP A;  3HJE A;  2ZB9 A;  4P1W A;  2VT3 A;  3CP2 A;  1JGS A;  2ZC2 A;  3KPH A;  3F23 A;  1D8J A;  2I8D A;  2KIM A;  3SDG A;  3I71 A;  4HLY A;  1FP1 D;  2DA7 A;  1G3T A;  3AKZ A;  1L3L A;  1IF1 A;  3A01 A;  3H3Z A;  2DK8 A;  3CCQ I;  1XS9 A;  4DZJ A;  3KP3 A;  5LLQ A;  5E3O A;  3HOU J;  1POG A;  3FF5 A;  4DBR A;  2HZD A;  1Y1V J;  3H5R A;  3GFJ A;  5HS7 A;  2WAD A;  4XLP F;  2K86 A;  4BBS J;  2FBK A;  5JLW A;  3FWE A;  5LGN A;  5EGO B;  3GTQ J;  3ELK A;  4EV0 A;  2KIS A;  1I27 A;  4W97 A;  4AC0 A;  3PFI A;  4EGZ A;  3HEF A;  3M1C A;  3TDU C;  3W2A A;  2WAF A;  5IT3 A;  1FBU A;  2JK3 A;  2X1C A;  2GA1 A;  4C3H J;  3G3Z A;  3RTR A;  4KN7 X;  3LSR A;  1TT0 A;  3QU3 A;  2QQA A;  4LIT A;  4P96 A;  1MGT A;  1FY7 A;  2KRF A;  1B8I B;  2MH2 A;  3CJT B;  3V4G A;  1IV8 A;  1EV7 A;  3FXU A;  2RRE A;  2HI3 A;  1TWC J;  2STT A;  1MBF A;  2GWR A;  4MO7 A;  4S0H B;  1IDY A;  5LGT A;  4P5O A;  3CC2 I;  4MQV A;  1G8X A;  2XRL A;  5GPA A;  3WG9 A;  3FIW A;  4A3B J;  1I6X A;  3WTX C;  5F0F A;  5DM7 F;  1JKP C;  4ETS A;  2M3A A;  5HLT A;  1T2K A;  1MKM A;  4N4N B;  2Z16 A;  2H1K A;  2LY1 A;  3NWS A;  2A05 A;  2Z99 A;  4MNU A;  1GXP A;  4KIT B;  2E1O A;  3JTH A;  1OCR H;  2UXN A;  2L9N A;  2XAH A;  5FLX K;  3CCM I;  3F8F A;  2BW3 B;  4A5N A;  4KIG A;  1A31 A;  3BJO A;  5HLH A;  2ECC A;  3UNG C;  4U7B A;  2R7T A;  1YLF A;  3ZXS A;  5F1J A;  3T8R A;  2Y2Z A;  1ERD A;  5A2Q Z;  4IZZ A;  5JLX A;  4M74 A;  5B1B H;  1TBX A;  1ETX A;  2FF4 A;  4G12 A;  2ZME A;  3MN2 A;  3R60 A;  4XLE A;  1JJ6 C;  4MGR A;  5HOD A;  1E2X A;  2EZI A;  1P4X A;  4HQM A;  2OCE A;  3F0C A;  3WHB A;  1Z21 A;  2IVM A;  1BM9 A;  3LFK A;  1FIA A;  4LLN A;  3OWT A;  4LLL A;  3QP5 A;  4EJO A;  4CYC B;  1ITY A;  2EFQ A;  3C2H A;  1UFM A;  4JK1 X;  3PNY A;  4UVB A;  3M1E A;  2IT0 A;  1IC8 A;  2CMP A;  1N77 A;  3V7S A;  4EM1 A;  2P4W A;  4KT5 C;  4ZC3 A;  4D7N A;  4CUG A;  5CJ9 A;  4LLG F;  4B3X A;  3LQQ A;  3O8G A;  2QA4 I;  2XB0 X;  1W5T A;  1KQ0 A;  1FOK A;  3S8P A;  2WV1 A;  4CA0 A;  1STZ A;  3K4L A;  2DI3 A;  2LTP A;  3KP2 A;  4BUP A;  1TLH B;  2EZH A;  3MKL A;  3CCS I;  2TRT A;  4ESJ A;  3AL0 B;  2BE5 F;  3FXJ A;  4P9U A;  1X58 A;  4OIP F;  1FOW A;  5BNG A;  1B1B A;  1JT0 A;  3WGI A;  1LDD A;  2CQQ A;  2EIL H;  2W82 A;  5HLI A;  3L00 A;  3EYI A;  4V19 K;  2Y0M A;  4E7S A;  1FC3 A;  4E7Z A;  1H8A C;  3JAM Z;  1K6O A;  2L3D A;  1XSV A;  2IPQ X;  1YRN B;  4D0P A;  2R92 J;  1A5J A;  5GAE J;  1JE8 A;  2D1V A;  2V9P A;  3NRV A;  2WB1 N;  1XG1 A;  5KAI C;  1BI1 A;  1XC5 A;  2VBX A;  4BY7 J;  3LMM A;  2I10 A;  2ID3 A;  3W6K B;  3GTO J;  2DOF A;  4GCV A;  4E7K A;  1Z3Y A;  1S8N A;  1DGW Y;  2JPB A;  1P7I A;  4Z6Y A;  2P7V B;  2D45 A;  4BKX A;  1TL8 A;  2DDB A;  4M71 A;  2F48 A;  3HOZ J;  2IGK A;  2PMH A;  3N97 A;  3PL8 A;  3OYA A;  3QWL A;  5DS9 A;  2XSD C;  3SEZ A;  3ZQL A;  3RYR A;  4AIH A;  2LNB A;  3BTJ A;  2W57 A;  3ESW B;  3HOT A;  4WXC A;  4J00 A;  4XRM A;  3C2G A;  2G7H A;  2HVR A;  3TGN A;  3KIO A;  2R93 J;  1IO2 A;  1JKR C;  3O3K A;  5HDG A;  2MW8 A;  2NVY J;  3KP6 A;  1I39 A;  2LLK A;  4O5V A;  4JX5 A;  4YIF A;  2XC7 A;  3TQN A;  2AXL A;  3G4S I;  2CQN A;  2DOA A;  1JT6 A;  4ZYD A;  3HM5 A;  3W2V A;  4A5M A;  3ZMT A;  2ZJP F;  2IGN A;  3CDL A;  1JTY A;  2HKO A;  2W1O A;  3HUG B;  5LGU A;  1LFU P;  3HOY J;  3JRE A;  1ZR2 A;  2YU9 J;  4PGG A;  1H9T A;  3FXO A;  4DGW B;  4BNC A;  4PZJ A;  5IP6 A;  1S72 I;  5EGO A;  1RNL A;  1FOX A;  2VOD A;  1EH6 A;  2I5U A;  4IHY A;  2ME6 A;  3CCU I;  1AKH B;  4FE7 A;  1Z67 A;  4HF0 A;  4LJZ F;  3REO A;  3OYE A;  1Y56 A;  1AU7 A;  4QIW N;  3VOD A;  1R5G A;  4MLO A;  4BHB A;  1K61 A;  2FQ3 A;  2NAZ A;  4AUX A;  5EF6 A;  3K1N A;  5BMZ A;  1Y8Q B;  3DLA A;  4NHJ A;  4XLN F;  2CQK A;  3RYP A;  2GOM A;  3DPT A;  2DFH A;  2K3F A;  5LRR A;  5C4J J;  3OL3 A;  1WPK A;  2L9R A;  5L3C A;  2HOT A;  1AOY A;  1SVL A;  1USS A;  1R9T J;  1GV5 A;  2L9V A;  1J09 A;  1V3F A;  3BOQ A;  5DD8 A;  4LB5 A;  5L3E A;  1ZN2 A;  2LR8 A;  3RKY A;  1XPX A;  3RQI A;  2FQ4 A;  1ZGA A;  5EJC A;  2GXG A;  4BGD A;  2LDU A;  4BY1 J;  3C2B A;  3RPQ A;  2GBY A;  1ETV A;  4IQJ A;  4LOC A;  3GTG J;  2LYC A;  1O3T A;  5L3F A;  3EUK L;  1JHH A;  2DCE A;  1F5T A;  2CG4 A;  2FE3 A;  3DPU A;  1D8K A;  1JKQ C;  4BQO A;  1X1P A;  2K9L A;  3HB9 A;  4C2M J;  5K7Z A;  3PFY A;  1SFX A;  4BXF A;  3WE3 A;  2E60 A;  1WGX A;  2YSR A;  3ZMS A;  2F2E A;  5J8F A;  2EV6 A;  1QHG A;  3CCR I;  1K4S A;  3GWZ A;  2DU9 A;  4GYI A;  3DU6 A;  4AIK A;  3LSI A;  3LL7 A;  1SMT A;  2KZV A;  2MD0 A;  5GTI C;  1T95 A;  4OAY A;  4KMF A;  3OYB A;  2PMU A;  5BPD A;  3DBL B;  3CQZ J;  2DTZ A;  2QGU A;  3ISP A;  3BTI A;  3DTE A;  3K10 A;  1XN7 A;  5JI6 A;  1TWA J;  2E7W A;  2R7D A;  2XKP A;  3FKI J;  1TW3 A;  1R4M B;  4HX4 A;  3ZN1 A;  4CYC A;  2IJL A;  3AAF A;  1EJ9 A;  2HR3 A;  1G59 A;  4BXX J;  2DJI A;  3IH3 A;  3KX2 A;  2MFZ A;  3ZMD A;  4ESF A;  5J3L A;  4HX7 A;  3K4N A;  2MBF A;  2M30 A;  3H3U A;  2KHM A;  3T0Y A;  2A61 A;  1GV2 A;  2ZNY A;  3JRI A;  4KIS A;  4S04 A;  4E7I A;  2CGP A;  5H6R A;  2Q0O A;  3TP0 A;  3BR3 A;  3JRG A;  4U87 A;  1KON A;  2YPR A;  2WY7 Q;  1XGS A;  4YFK F;  2WC2 A;  4LIU A;  1J0R A;  2CRG A;  1TP4 A;  4JQF A;  5TIS C;  1FEX A;  4RAG A;  4AYB A;  3F8B A;  1IXC A;  1P2F A;  2K3P A;  4L18 B;  3BT9 A;  2QQ9 A;  4RGU A;  4I76 A;  4M6V A;  3I55 I;  4LFU A;  3MWM A;  4I0A A;  1E3O C;  4X0G A;  2EZK A;  4EEF G;  3BWG A;  2VKD A;  1I1S A;  4BYY A;  1O57 A;  1BI3 A;  1LDK B;  3CDI A;  4DW6 A;  4A3L J;  4K2E A;  3FHZ A;  1YW8 A;  1K6Y A;  2PFB A;  2BEO A;  3G6E I;  4DJA A;  1DU6 A;  3I58 A;  2P5K A;  1QHH D;  1EF4 A;  3RDI A;  4NNJ A;  4CYD A;  4PK4 A;  5M5W J;  5JHU A;  3OYD A;  1O3R A;  2M8E A;  2QQB A;  1Z91 A;  4I6Z A;  3K9T A;  4J01 A;  4NBQ A;  3HOV J;  2HKX A;  3CME I;  2DA3 A;  3CUQ A;  2FOW A;  3P7N A;  5C44 J;  3BG3 A;  2EV5 A;  3FM3 A;  4XOR A;  2JRM A;  4A3E J;  4IX7 A;  3JRC A;  3D0S A;  1JI8 A;  1T33 A;  5FKO A;  3HTS B;  2BHY A;  5IOY A;  1S6L A;  1W4M A;  2KL4 A;  2DQR A;  4F55 A;  4HNU A;  4XN0 A;  1UAA A;  3DBH B;  2KRC A;  1U0J A;  4IF4 A;  1MH4 A;  2VPR A;  2K9M A;  1MSE C;  2P6S A;  1WJ5 A;  3ZN0 A;  1ZGW A;  3CLO A;  2WY8 Q;  1ZAO A;  4GO1 A;  2R7S A;  3IRQ A;  2R0Q C;  4AIJ A;  2OF7 A;  3OYH A;  4RB2 C;  3HUG A;  2HYG D;  1LUJ B;  3KE2 A;  3QOP A;  3Q9S A;  1IAW A;  4AVZ A;  2GXA A;  2HOE A;  3L09 A;  4DIQ A;  2WWY A;  1J59 A;  4AM3 A;  1V54 H;  3GTP J;  3WU2 C;  2VC1 A;  1RUO A;  1TWH J;  4BS9 A;  3DP7 A;  3IWZ A;  2H09 A;  3RKX A;  4BJ6 C;  3OIP A;  1U6G A;  3J80 Z;  2DMQ A;  3UR3 C;  4F3Q A;  1YX5 A;  3X2Q H;  4XQF A;  1NK2 P;  1T08 B;  2LBF A;  2IXS A;  1SAN A;  1ZRD A;  4JX4 A;  4DBQ A;  3ZP5 A;  1WRJ A;  4E7J A;  2ZXW H;  4HZF A;  2MLK A;  2KRH A;  3HL2 A;  2QKM B;  2WBM A;  2BHZ A;  5E8I A;  3IKV A;  2RQQ A;  1OCO H;  3RZD J;  3EUH C;  3S32 A;  1R6R A;  2DA4 A; 
#chains in the Genus database with same CATH homology
 1UEL B;  1Y6I A;  3OYC A;  1MMG A;  3F9K A;  3BC8 A;  4PFP A;  1X1C A;  1NG6 A;  2VB6 A;  2CV2 A;  4P1W A;  5FRO A;  3CP2 A;  2R7V A;  2MYS A;  3ZGK A;  2HPI A;  1MMA A;  4PJN A;  3QYF A;  4BDY A;  2I8D A;  3FKJ A;  2Z2S B;  4PFO A;  3AKZ A;  4RMN A;  4RM2 A;  2E5Z A;  3BG6 A;  2BVL A;  3DKY A;  4HPQ A;  3TMO A;  4NQW B;  3OYF A;  2V4J C;  3L2Q A;  2HVQ A;  3SEQ A;  4DBR A;  3OYG A;  2L5Q A;  2HZD A;  2LOO A;  5HOO A;  4E4H A;  1D1A A;  3H5R A;  2VXD A;  2X6Y A;  2HDW A;  2WAD A;  3AL0 C;  1LVK A;  2MAB A;  3OOU A;  2W00 A;  1MNE A;  3BLY A;  3S93 A;  2KP6 A;  3HPG A;  4B47 A;  3M1C A;  3W2A A;  2WAF A;  4FET A;  2X1C A;  2DXI A;  3OY9 A;  2R7R A;  3RTR A;  3LSM A;  1X4P A;  1TT0 A;  2QKL B;  3MD2 A;  4LIT A;  1LFP A;  3ZCO A;  4D1Q A;  3H9Q A;  3ZRG A;  4XR6 A;  2JVH A;  4BE1 A;  3LFU A;  3KEY A;  2VXZ A;  4XLC A;  2RRE A;  2R4G A;  4DOZ A;  1FMW A;  4GRI A;  2V26 A;  3HKZ A;  4F93 B;  4P5O A;  1YE9 A;  4YRV A;  2IS2 A;  1G8X A;  4CH7 A;  3E0J B;  2IGO A;  2OUM A;  1MND A;  3DU5 A;  4BL0 B;  3FHN A;  3BG7 A;  4BE0 A;  2CW7 A;  2M3A A;  5HLT A;  4N4N B;  2F5V A;  2Z16 A;  4BJT A;  5HVQ C;  2WA0 A;  1MMD A;  2VIX A;  4CCJ A;  4ZTJ A;  2LY1 A;  2IS6 A;  3L2W A;  3NWS A;  2ZXH A;  4B48 A;  3QOD A;  4C30 A;  4RLF A;  4KIT B;  4CCK A;  2L9N A;  3PSF A;  2JSP A;  4CCO A;  2BW3 B;  2HQA A;  2Q2E B;  3OYN A;  3OR1 C;  3N05 A;  1BR2 A;  5KHD A;  3MKY B;  4PSW A;  2LBF B;  1Z3X A;  3OYK A;  4HST A;  4BDZ A;  3UNG C;  4U7B A;  2R7T A;  4CZC A;  2XF6 A;  3CJR B;  3ZXS A;  2JA2 A;  3L2U A;  3W2W A;  1DGR M;  1D0X A;  1ERD A;  4IZZ A;  1T0F C;  4E7L A;  1DP3 A;  3E1S A;  2XDV A;  3OMY A;  4BEH A;  1N75 A;  4IKF A;  1IRX A;  2GOX B;  4XMY A;  3EUA A;  4XLE A;  2R7O A;  4C2U A;  3VSL A;  1E0E A;  1Z21 A;  2PMZ A;  2VQL A;  2X85 A;  1X4O A;  5HNF A;  3A2K A;  2NOJ B;  2E1M C;  3PNT A;  3L2R A;  2W7N A;  2X6W A;  3OWT A;  4F92 B;  3OYI A;  3C2H A;  3OIQ A;  4XM3 A;  3S3M A;  1D1C A;  1OLT A;  3PNY A;  2HPM A;  3PJR A;  2CMP A;  1N77 A;  1TZL A;  4ZC3 A;  4CUG A;  1SFK A;  2A5W A;  2XF7 A;  3LSG A;  3K4J A;  3H9G A;  2O5R A;  4B3X A;  3HG9 A;  3D5S C;  3CF2 A;  3S8P A;  4CA0 A;  3K4L A;  2X51 A;  3HXL A;  3DPL C;  1ZEL A;  4BUP A;  2VJI A;  2HU9 A;  3OYJ A;  3AL0 B;  4XKC A;  3OYM A;  2CW8 A;  2DT7 B;  1UG0 A;  2CV0 A;  2V9K A;  2W82 A;  1PJR A;  1X1B A;  2E5N A;  1FMV A;  2ZSH B;  4XL9 A;  3I3L A;  2Q1Z B;  2R7Q A;  4E7S A;  4E7Z A;  1DQU A;  2V7F A;  3HPH A;  3OL4 A;  2VJ5 A;  3K70 D;  2X6X A;  4XOP A;  2CS3 A;  1SAU A;  4QPO A;  2IGM A;  3AFH A;  5HNH A;  2K5C A;  2OC6 A;  3K4B A;  4ZTF A;  2VLA A;  1GLN A;  3LMM A;  1V5E A;  4XKB A;  2KLO A;  4E7K A;  1Z3Y A;  1DGW Y;  2ZXI A;  3KYL A;  2M4G A;  1X1A A;  4ANJ A;  1PYV A;  1YX3 A;  2IGK A;  4CSW A;  2P0W A;  3PL8 A;  3OYA A;  5FRN A;  3SEZ A;  2HVS A;  2VKH A;  4BQQ A;  4ITV A;  3VYU B;  3QYE A;  2VL8 A;  3HOT A;  5TGT A;  4JOM A;  4J00 A;  3C2G A;  3H5A A;  1LKX A;  2KDO A;  2JVG A;  1WJA A;  4OAZ A;  3DEE A;  4LIV A;  2HVR A;  3K4C A;  2R7W A;  3RQ4 A;  4PUS A;  4II3 A;  3M8J A;  3H35 A;  3S3N A;  2XC7 A;  2DOA A;  2ZFU A;  3HC7 A;  3W2V A;  3A1Y A;  2IGN A;  3DKX A;  2W1O A;  3HUG B;  4BJ5 C;  4B43 A;  3K70 C;  3CZ6 A;  2XF5 A;  4CCN A;  1NG7 A;  4BU2 A;  2AQE A;  2LRD A;  4DGW B;  2V6E A;  4BEH B;  4LG3 A;  4XKV A;  2R7X A;  4R79 A;  1WJB A;  3V42 A;  1Z7L A;  1BR4 A;  2E1M B;  2M7A A;  2CH0 A;  2M7B A;  3K6G A;  4HG2 A;  1W36 D;  3U21 A;  3OYE A;  4G6T B;  1Y56 A;  2X1E A;  2IS4 A;  3A4C A;  3DWL E;  2HNH A;  4MLO A;  4PJJ A;  4Y33 A;  2LC2 A;  2VQC A;  4KJZ A;  2FUG 2;  2VQG A;  4NC7 A;  2DT6 A;  5KNL A;  3DLA A;  3ZQQ A;  3TL4 X;  2GOM A;  3DPT A;  4YEL A;  2Y0S A;  2X1D A;  4PJL A;  3OL3 A;  3OR2 C;  4XNF A;  3QOE A;  4XLF A;  5LD2 C;  4ZDP A;  4ZJZ A;  3J7A Y;  1HA8 A;  4RM3 A;  1J09 A;  4PSX A;  3SYT A;  4FAS D;  4BGD A;  2KQR A;  2LH9 A;  4Y3O A;  5KCM A;  3BCB A;  3CMM A;  2XSJ C;  3IAM 2;  5JHF A;  4IQJ A;  2CUZ A;  3EPZ A;  5CQE A;  2LYC A;  3MKZ A;  3EUK L;  2DCE A;  3G2B A;  3DPU A;  3ZR8 X;  4BQO A;  2K9L A;  3CES A;  3PFY A;  4BXF A;  1S9H A;  2E60 A;  2CFO A;  1WFX A;  5CKT A;  1W36 C;  1EA3 A;  1QHG A;  3D5L A;  1MMN A;  3H9J A;  3IUO A;  3DU6 A;  5CPR B;  3LSI A;  2LG4 A;  3LL7 A;  2MD0 A;  2KZV A;  3RSN A;  2L9S A;  1T95 A;  1WJC A;  4OAY A;  4NC8 A;  5CQG A;  3OYB A;  4Y4R A;  1WJD A;  3I9V 2;  3OS2 A;  3VYT B;  3K4K A;  3DTE A;  3K10 A;  2PJR A;  3DTK A;  3FBN B;  2BVM A;  1P9Q C;  2RNG A;  4N4O B;  4XN3 A;  1G59 A;  1D0Y A;  2DJI A;  3KX2 A;  4HEA 2;  1N78 A;  2MFZ A;  3L2V A;  2OV7 A;  3RPU D;  3H0D A;  1WJF A;  3K4N A;  4NUB A;  1BOB A;  2KHM A;  3PUB A;  3VYS B;  3MMY B;  4F52 A;  4RLQ A;  2LRE A;  4KIS A;  2L2O A;  4E6K G;  3MKW B;  4E7I A;  3K4M A;  3CJQ B;  1V5F A;  2BOL A;  4U87 A;  1KON A;  2JUG A;  2WY7 Q;  2L7K A;  4KT6 A;  4LIU A;  4EAT A;  1D0Z A;  2A6T A;  1D1B A;  4YEJ A;  3SZG A;  3GBG A;  2KMU A;  4JQF A;  1AA7 A;  2LY2 A;  3RCO A;  4AYB A;  1WJE A;  2VJJ A;  3NWT A;  2K3P A;  3PSI A;  4II2 A;  2VQH A;  4HSR A;  4BE2 A;  3IAS 2;  4XKW A;  4X0G A;  5FRM A;  2VKD A;  4F91 B;  3D5R C;  1BR1 A;  3BCA A;  1LDK B;  3IP4 B;  3LSK A;  2UV1 A;  4XON A;  4XLH A;  1V5G A;  2CUJ A;  1K6Y A;  2F4I A;  3OS0 A;  4DJA A;  1QHH D;  3SDB A;  4C9Y A;  4NNJ A;  1OR7 C;  4AU7 A;  2ELJ A;  4C2T A;  4PK4 A;  1QU3 A;  3OYD A;  4HNT A;  5LFA A;  4ZYA A;  4H4K C;  2WAE A;  4IQ4 A;  4J01 A;  3VYR B;  2VAS A;  3DQV C;  4ZDO A;  2KPM A;  3TBI A;  2V1N A;  4CCL A;  2WB1 A;  4CCM A;  4D9J A;  4XOR A;  4IX7 A;  3W3C A;  2Z1D A;  4XLA A;  3CP8 A;  1JI8 A;  4PJM A;  4BAC A;  3HOS A;  2KL4 A;  2MC4 A;  4F55 A;  4HNU A;  1MW7 A;  2AQF A;  4XN0 A;  1UAA A;  2CV1 A;  1U0J A;  2KRC A;  4QPQ A;  2WAQ A;  3FDY A;  2K9M A;  1WJ5 A;  2IS1 A;  1X1D A;  2WY8 Q;  3PNV A;  4B44 A;  3VSK A;  3VWB A;  4HRI A;  2R7S A;  3OYH A;  2XAU A;  3QYB A;  3LSH A;  1X19 A;  4BQN A;  2M4K A;  4AVZ A;  3ONQ A;  4DIQ A;  2VJ4 A;  3H5N A;  2UWM A;  3DTI A;  4BS9 A;  4BJ6 C;  3FBI B;  3OIP A;  3VDX A;  2R7U A;  4XOT A;  2BW3 A;  2F6C A;  2ZSI B;  4OWR B;  3UR3 C;  4F3Q A;  1YX5 A;  2M0M A;  4XQF A;  2LBF A;  2IXS A;  2PJR B;  4ZDL A;  4DBQ A;  4E7J A;  2VPL A;  2KRH A;  3HL2 A;  2QKM B;  2WBM A;  4E7H A;  2RQQ A;  3OYL A;  2UUZ A;  3EUH C;  3S32 A;  3S3O A;  1R6R A;  3OS1 A;  1VZ0 A;  2W4S A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...