4DGWB

Crystal structure of the sf3a splicing factor complex of u2 snrnp
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
140
structure length
127
Chain Sequence
b'SRRDMEVIKLTARYYAKDKSIVEQMISKDGEARLNFMNSSHPLHKTFTDFVAQYKRVYSFTGQEIKKSKRTILDNCFERTQYWEFEKDKDREHDKLVELCKIQFAAIPWDKFTQVAKFDLEQMRLRR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Pre-mRNA-splicing factor PRP9
publication title Structure and assembly of the SF3a splicing factor complex of U2 snRNP
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Splicing
total genus 33
structure length 127
sequence length 140
ec nomenclature
pdb deposition date 2012-01-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF01805 Surp Surp module
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.790 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Arc Repressor Mutant, subunit A 4dgwB01
1UG0A 2E5ZA 1X4OA 2E60A 1X4PA 2DT6A 2DT7B 4DGWB
chains in the Genus database with same CATH superfamily
2WTEA 3HUGB 3FDYA 3LFUA 3TMOA 1RKWA 4IHTA 1ZAOA 4ZZLA 4HX4A 5L3CA 1LE8B 4JK1X 1T33A 5FFZA 2LKXA 1FSHA 1X19A 2FEZA 3QP5A 4Y52J 3CCEI 2YPRA 3DPLC 3LWFA 1TWAJ 2G9WA 2L9SA 4KA4A 3LSKA 4CCKA 5HLTA 3VYTB 2FF4A 2CV1A 1J7KA 4WK8F 4LLGF 4DYCA 2O3FA 5HS9A 2KFDA 1VQNI 4BQOA 3S3NA 1GT0C 3GMEA 1IN5A 3IKVA 2DTZA 1DGRM 1ETKA 5J8CA 2JUGA 2NRAC 1OYIA 3SDGA 5DTDA 1WSUA 1X1DA 1FEXA 2COMA 4C3JJ 2JPBA 3AG2H 4G12A 3F0CA 3MQ0A 1G6NA 2O03A 3QP6A 4N9IA 4IO9F 4Y33A 3M1CA 1K7AA 2F6CA 3SHFA 4AIJA 2XPUA 2ME0A 5LGTA 2LK2A 4LJZF 4RDUA 3LNQA 3H9QA 1ZGAA 4Q4ZF 2KZGA 6PAXA 2VJ4A 1G59A 2M0MA 5EJCA 3ROUA 2MA3A 3I56I 1SMYF 3BT9A 5D8LB 3DQVC 2IEKA 4YEJA 5KK1A 3OYEA 1OCTC 4W1UA 1Y39A 3GFIA 4BXFA 3RTRA 2M3AA 1IRXA 1OFCX 1QZYA 3WODF 1SEUA 5ICFA 2EV6A 3CDLA 2Q2EA 1YQAA 4RM2A 1IUFA 4G6DA 2CW7A 3RIRA 2K02A 3GTKJ 3ZQFA 2K9LA 3CJTB 5DV5A 3MKWB 2B9SA 2HDDA 3WTSC 3HBLA 2ISYA 5EZGA 2P6SA 4BKXA 1A04A 3F8MA 4IRHA 1U9OA 2ZC2A 2H6BA 2K85A 3GEZA 3L00A 3LA2A 3QAHA 3QPSA 4NC8A 3RQIA 1K4TA 1MH3A 2KKOA 2WY8Q 3MD2A 4L0ZB 1SD5A 2I8DA 3AAFA 3OS2A 1NHAA 2DA6A 3S2WA 3OSFA 1EH8A 2IGMA 4BDYA 1BBYA 1QVTA 3GLLA 2E71A 4NNJA 1B72B 4M74A 4S0HB 5CVRA 2MYSA 2ZCWA 5J1UA 5J1RA 3QU6A 4ENJA 2ZMEC 3J7ZI 3JSOA 4G8XA 3S1QJ 2G0EA 2AXTC 4NDLA 4I98B 4L9VA 5LHIA 4CZZA 1XPXA 1HC8A 3KP6A 5KVRA 5LEJA 1Y56A 1QA6A 1IRGA 4EM1A 2MC3A 2H8WA 4L5IA 3HZJA 4PSXA 1HF0A 3ZQHA 3FMRA 3MAJA 4B8XA 4RM3A 4HQEA 2E7WA 2WV0A 1JHFA 3EPZA 4ZYGA 1S7AA 3DU5A 3PO3J 2X1DA 1UJ8A 1HDPA 4BQAA 3D1NI 3ZQGA 2UWMA 4EV0A 2V9PA 1VQPI 4PSWA 4UNOA 1LNWA 2ZXIA 3PFIA 3Q0UA 4OINF 4U0YA 3J7YJ 5EZHA 4EGYA 4IF4A 2DMPA 2VKVA 2EIMH 4B1RA 3KP2A 5EG0A 2LY1A 2OCCH 2E36A 3FK6A 4LMYA 2CMPA 2DFIA 5J1YA 2LF8A 3U1KA 1Z67A 4C2MJ 2YR2A 2VQHA 1U9NA 1ETXA 2F2EA 2I10A 4OAZA 4I0AA 1Z0XA 1D1AA 2ZXWH 3BDDA 4UXNA 3E6CC 3HG9A 1XDUA 5FKKA 2K3PA 1W0UA 4L9TA 4LOCA 1EV7A 3WHBA 3U21A 5J47A 5C3EJ 4Y3OA 3I53A 4M3FA 4I2OA 1U5TA 4KIBA 4UHTA 1FYLA 4N0BA 3WGIA 1IG7A 3FM3A 1YYVA 4JX4A 2ZB9A 1LKXA 3GZ5A 1P6RA 3H3UA 3ABUA 3S8PA 3MZ8A 1XC5A 3PSIA 4MLOA 5HDGA 4QPQA 1U6GA 3RYRA 3RJPA 1REPC 4NC6A 2XHKA 3AFHA 3L2QA 2GBYA 4QPOA 5D5WB 5FJ8J 5A2QZ 1QVUA 2IGOA 2OPTA 2VJ5A 4LITA 1MNMC 4GDFA 2HZTA 4B09A 4UUSA 1JTYA 3EETA 3IUOA 2XF5A 4MTDA 1Z6TA 3BG3A 5TJJA 2HTSA 1VNDA 1X1AA 2RGVA 5IT9K 1BI0A 1SMTA 2OTLI 5KAIC 3TEDA 2ID3A 4RA2A 4DJAA 5DM6F 2X9DA 1UELB 2YUSA 1H88C 2FOWA 3BPXA 4E7HA 1JTXA 3B6CA 2AQFA 1LDJA 2NNNA 4RGRA 3G71I 3S2DJ 5BQTA 3CUQA 2Q2EB 2VBWA 3CUQC 3BJAA 4P9UA 2X6XA 1Z77A 1ZKGA 3Q9SA 2WAQA 3KETA 2A05A 2HWVA 3ZQCA 3GX4X 4BE2A 1Y0NA 2EWNA 3DLAA 5FKMA 3A01A 2R7DA 1HDDC 3FHNA 4FQGA 2JA7J 2UZKA 2A61A 2VBZA 2GWRA 3F6OA 4LLLA 1YE9A 2XF6A 2DAOA 3GZNB 2DMUA 4I02A 2PMUA 2V7FA 3RPQA 2GOMA 3H5RA 1V4RA 1K78A 1MNEA 2HVQA 1KU9A 3E97A 2HNHA 3ESWB 2CH0A 2W7NA 1QZEA 1S3JA 3GTQJ 1JKRC 2VJJA 5E3MA 1V55H 2HU9A 1TZLA 2HOTA 1HBXG 4IQ4A 4MQ9F 3SEZA 1HLVA 2E1MC 2EPFA 2ACJA 3J80K 1OCOH 3QQAA 2STTA 4FE7A 2BV6A 3PNVA 2RQPA 2VL8A 4MNUA 1WJ5A 4LK0F 1A35A 2L2OA 3W6VA 1AKHA 1B9MA 4BAYA 5HVQC 2YX7A 3HOWJ 2W25A 1POGA 3P9IA 2QGUA 4UB6C 2VOOA 3CCMI 4MEXF 1P7IA 2XC7A 3GUDA 2JVGA 5BPDA 4I99C 2XSDC 1ZHFA 2BXZA 5FLVA 5JFRA 2RKHA 2JRTA 2HDWA 3P5JA 1P9QC 5EEGA 2BEOA 2NNYA 4BACA 2XB5A 4AUXA 3M8JA 2EZIA 2H8RA 1Z21A 3F8CA 3TO7A 1I1SA 2H94A 3KP3A 5EG0B 1Z7LA 1FJLA 2G7HA 4EJVA 5L3FA 2NOJB 2PLYA 4M72A 2W4SA 1V54H 2CYYA 3GFMA 2DCEA 4XKVA 4BU2A 5E79C 1F36A 2WWYA 2ELJA 2F5CA 2KJBA 2QM3A 1XG1A 2VKDA 2STWA 3PFYA 4XONA 4HEA2 1JI8A 2L7MP 2E34A 2ELKA 3BG7A 1U5TB 2DDBA 4CSWA 2IP2A 4EMSA 2KISA 2P6TA 4IOCF 3DWLE 3C1DA 4XN0A 4O3MA 1E17A 1L3LA 5CVJA 3DV8A 3QU3A 3A0HC 4S04A 2AXLA 3NARA 3BPVA 2ZSIB 3I0TA 3T5XA 3DP7A 1W4MA 1R4NB 1SANA 2HGCA 3K10A 4LG0A 3L2VA 2R7VA 3TQNA 2HR3A 1R9TJ 2MD0A 1IUYA 3FZVA 4HF0A 4LB6B 5DD4A 2BHYA 2DPUA 2XV4S 5E20A 2CQXA 4F91B 4UUSB 2LMDA 1BJZA 1O3TA 1ZRCA 2X6WA 3OYKA 5A2QK 3HTUA 2N8GA 3O8GA 2JA5J 3OIPA 4A69C 1IN7A 1R1VA 1JE8A 5C44J 1Z6RA 1PJRA 3IH4A 1U3EM 1ZG1A 1ZG5A 3EQLF 2QSHX 3DEEA 3FXMA 1ULYA 3LSRA 1AU7A 4HNTA 4LIVA 5HLHA 4DNCA 2WB1N 5ICGA 3Q9VA 3R61A 4UVBA 1ZARA 3CUQB 5DDGA 3K9TA 2V9VA 4HRIA 3LSPA 2VXZA 4A3EJ 1U2WA 1DPUA 2MLKA 1QPIA 5GAHJ 2DW4A 1VQ5I 2MBFA 1F9NA 4KISA 1EH6A 1RUNA 2OF7A 1RI7A 1BOAA 2A6TA 3A01B 1N25A 2EK5A 5M5WJ 2C6YA 2CQKA 2L3DA 3BR5A 3W3CA 1FNNA 5E18F 3LA3A 3HOVJ 3OSGA 1X2MA 3PO2J 2Y0MA 1IV8A 2FBIA 1R23A 2Q8KA 1O3RA 1OR7A 5EF6A 4PGGA 1CF7A 1K78B 3BQZA 4JX5A 1TC3C 3RPUA 3WE2A 1OR7C 1STZA 3KEYA 3KE2A 1TTYA 2DMNA 5FRMA 1QU3A 3CCQI 2KIMA 4BH9A 2RV8A 2JSCA 1VQ6I 2IGNA 5IP6A 2L4AA 2F5DA 2L4MA 3V7CA 5D4SA 3CC4I 4XLPF 2E1MB 2KRFA 1U8BA 1P2FA 2DPDA 3F21A 4FE4A 1APLC 4U7BA 1ETWA 4HLXA 1W5SA 1G3SA 4Y13A 4UUVA 5B3SH 2LOOA 2VT3A 3VWBA 1MH4A 2O8XA 2M8EA 5BMZA 3OYCA 3CDHA 4WCGA 2XAJA 5D5XB 3JRFA 1Z91A 1AKHB 1YX5A 4LK1F 3HDDA 2ME6A 4HF1A 2DJIA 4N9HA 2VLAA 1XCVA 3CF5F 2PBIA 2KPMA 1YITI 1XGSA 4BBSJ 2FA5A 1FT9A 3KPHA 5E8IA 4EQQA 1PP7U 4CGZA 1OCRH 2LBFA 3HPHA 3PNYA 1XMKA 3OOPA 1BI2A 2K9MA 5B1BH 3G6EI 4ZYEA 3HOYJ 2CUEA 2PQ8A 2R7SA 1NG7A 3CDIA 3M4OJ 2X6YA 2VKHA 1DP7P 4XRSG 4BHPA 4OMZA 2BY1A 3DPUA 2CQNA 5KNLA 3C3WA 2ZNZA 2FX0A 2Q1ZB 2A5YB 3KZIC 1GUUA 4ZZDA 4JOMA 1MMDA 4A3BJ 2GA2A 4YELA 3FXQA 4B47A 4QSHA 2P7VB 5EGOA 1OCZH 1S9HA 1YJ9I 3WTTC 1I50J 3FXUA 5E8GA 2HQ5A 3L2RA 1BC7C 2KDOA 1U78A 2E1OA 2FMYA 3HOZJ 2L7FP 4BNCA 3CCYA 1R6RA 1DQUA 1KA8A 1F5TA 3HRTA 2MW8A 4YIIA 1QHGA 2GXBA 3T0YA 5CVIA 4TV7A 2W84A 3OR2C 3JTGA 1E3HA 1FBUA 1SD4A 2JRMA 1FOXA 2X85A 2FXAA 4LG0B 1NG6A 3E6MA 4IRIA 1Y8QB 1LQ1A 3BG9A 3RKWA 1O57A 4ZYHA 2LP0A 4KYWA 2O8KA 2EJRA 3RKYA 1OKRA 1T6SA 4N4NB 2XAGA 1DUXC 1OCCH 1S29A 2V4JC 2W24A 4XKWA 3MFKA 3OY9A 2PI0A 2R93J 4NBQA 2ZJPF 5HOOA 3AG1H 4XM3A 4L5JA 4MTEA 1Z9CA 1FZPB 3CMYA 1FBSA 4BDZA 3F9KA 4MIMA 1YFHA 1JKQC 2JJ7A 3SFIA 4A5MA 1I39A 1XB4A 2HTJA 1UG2A 4LFUA 4U87A 2IVMA 3H0DA 1JT6A 2K40A 3F22A 1T08B 3EYIA 4XL9A 2Y75A 5J8FA 2WAFA 2KZVA 2W1OA 4F7ZA 3MKYB 2BYVE 2DFFA 5JI6A 1FOWA 4RAFA 2ECCA 3PNTA 2DMTA 1BIAA 3IV5A 3OYBA 1MJ9A 3MKZA 1D5VA 1VQ9I 1IN6A 1RETA 3A1YA 1TWGJ 3BY6A 2I5UA 3WGGA 3TGNA 3VPRA 2M34A 3KP5A 3OWTA 5F64A 4HDVA 3TOAA 2V6CA 2RDPA 4GYGA 1CF7B 2CU7A 3FMQA 4D0PA 5GADJ 1MIJA 1X58A 1YO5C 1WHUA 2QSFX 3OYIA 2E35A 2VBXA 2CUJA 2W00A 4IRGA 4X1EA 5EDNA 5D5VB 3U2RA 3HIFA 3HPGA 5F0FA 2FNPA 1K6OA 3HSRA 1R1TA 2HFHA 2LTPA 2CQ7A 2NOGA 4XLCA 1R7JA 5CKTA 2R7RA 1LDKB 1T8IA 1MJBA 1T38A 1YLFA 2VASA 3OIQA 4ZDLA 4EM2A 2R0QC 4BY7J 2K7LA 2M4GA 2BHZA 3SYTA 4JP0A 1TQPA 5HS8A 3H3VK 3IKTA 5K7HA 2X4HA 3H0GJ 3ZN1A 4XORA 3KYLA 1LB2A 3GTGJ 1MBEA 5E1XA 1R5HA 2VXDA 1XD7A 3IAM2 4BYYA 2V9KA 3A0BC 2EFPA 4AIKA 3TL4X 3K7AJ 2H1LA 2VONA 1I3AA 4OIPF 1H89C 4G6TB 1SFXA 5IOZA 3R4KA 4WXCA 3JCUC 4KICA 4G7HF 1BR4A 2X6OA 1DP3A 2LBFB 2MC4A 1O3QA 3VSLA 2K5CA 2ZJRF 4IZZA 4BY1J 2PG4A 2CUFA 2IGKA 3KZZA 5E1WA 1R00A 3OYGA 2O5RA 1BN5A 1OYWA 3OYJA 1JT0A 4HSTA 1XMXA 4F55A 1FWZA 4II2A 2Q0OA 2O7OA 4I76A 2LC2A 3TBIA 4RBOA 4A3JJ 1W36C 5C4XJ 1B9NA 2IXSA 4MQVA 5BNGA 4RB1A 3K4BA 4BBRJ 4A0YA 4CICA 3RKQA 3V42A 1G4DA 1Y6IA 4ZYAA 2JVHA 5FO5A 5EGOB 4MO7A 5IT9Z 4C2TA 2DFHA 1NH3A 1Y8RB 3OYAA 2VC1A 2F5VA 2MH9A 2CO5A 1C0WA 2YSRA 1KONA 2JA2A 4EGZA 1T95A 2DQLA 1F4KA 4F92B 5JHFA 2R7FA 4CYDA 2DA2A 3GTOJ 2Y48A 1ZGJA 1WWXA 2KIQA 3K4JA 2DLLA 2DBBA 3CC7I 5FLXK 5TGTA 2Z9OA 2FRHA 5K5QA 2CSOA 3VB2A 4E4HA 3GTLJ 3N05A 3ZR8X 4G94A 1CGPA 1E0EA 4ENNA 1J5YA 3N4MA 2ZFUA 2FUG2 3G4SI 2X51A 2VI6A 2WB1A 2HYGD 4B48A 2CQQA 2XAFA 3FXLA 1WH5A 2QA4I 2P8TA 4J00A 1O7FA 1QPMA 3DXJF 2QQ9A 3G1OA 1RC9A 3M8EA 3EUAA 3F8FA 3M07A 2B63J 1B1BA 4QTRA 2KIFA 1MBKA 3I71A 2W85A 3ISPA 2ZMEA 4GO1A 2HKXA 4PJJA 2CFXA 4C30A 2TCTA 3C2GA 1RPWA 3J80Z 3H5AA 4IOAF 2VE9A 1PVEA 1ACIA 2P5KA 2ISZA 2ID6A 1VQLI 4IL6C 1OQYA 3I59A 4IHSA 1RUOA 5D5UB 4RB0A 1MGTA 5GPAA 3JRIA 4RAZA 1WZ2A 2D45A 2M0CA 4M3DA 2ZJ2A 1FPQA 5GPCA 2E1NA 2HZDA 2XKOA 2NYXA 2M9HA 2UXNA 2BE5F 3CCJI 4RMNA 2EA2A 2Y9YA 2LY9A 2VB6A 2UUZA 4XK4A 5CQEA 2XRLA 2KIUA 4GGGA 2XF7A 4D5FA 4U0WA 2FE3A 1TW2A 5LEKA 3B73A 1VTNC 4OOIA 2OU2A 3CCLI 2M5WA 1H9GA 1QQIA 2WBMA 2VQLA 2GXAA 4IHVA 3U1DA 3GTPJ 1YS6A 3JW4A 3ZMZA 3DTEA 1FSEA 5H6RA 4XLHA 2DN0A 1HOMA 3LL7A 4RLQA 3HKZA 4CYCA 3H92A 3I3LA 3SJMA 4A6DA 3PQKA 3ASOH 2VC0A 5EEHA 1ENHA 2ZBKA 5CYVA 2D2WA 4OIOF 3ASNH 1YHQI 1BOBA 3D5RC 4A3FJ 3CLOA 3ZQ7A 4KUMA 4BEHA 1VQ7I 3N97A 1VFCA 3WGHA 1WJBA 5ED4A 4UVAA 1YX3A 4HBLA 1W1WE 3JRHA 2VN2A 3VOEA 1T56A 3ZMDA 5F0CA 1H0MA 5IYCJ 4ZTJA 2F4IA 3M8FA 3GLXA 1LVAA 2OA4A 4PJLA 3JREA 3QRFF 1V5GA 3GO5A 2F4MB 1FTZA 2XGEA 4H0EA 2R5ZA 2W57A 2QBYA 3PQJA 1RZ4A 5GP9A 3WTVC 4XLFA 3HTSB 1XX5A 3IL2A 2XUBA 5H2FC 4PK4A 2M1BA 4PJMA 1RESA 3ERMA 4FCYA 2PJPA 2IBDA 2HEOA 4HX7A 2O0YA 4DBRA 4DOZA 5CQGA 4YRVA 3OIOA 2O9LA 4XLNF 3S16J 1FP1D 4BQNA 2GLOA 3G73A 1HQCA 3KP7A 1HXDA 3ZQIA 1HKSA 4A5NA 2BXYA 2JA6J 3WU2C 1ZQ3P 2K9NA 1D0XA 2MD5A 5CJ9A 3BZKA 1HW5A 4UY8I 1ERDA 3VYUB 2DOEA 4M3BA 4MHGA 1HKTA 2EFOA 1ETOA 2Y0SN 3GBGA 1Z3XA 3W2WA 3CO6C 1VF9A 2K4JA 2VE8A 3BTJA 1USTA 3QYEA 2GZWA 1X3UA 3LSTA 5J6XA 1IGNA 5ILUA 3HC7A 3JRDA 4XSXF 1IRZA 1I5ZA 1KU7A 1MSFC 2RVCA 1BM9A 3EUKL 3EYYA 2J5PA 3MCZA 4BXXJ 3ONQA 3CQZJ 2K86A 2RAEA 5LGNA 5AIPA 1IXCA 2UV1A 4A3CJ 4NQWA 2ZMEB 4AYBN 2V6EA 1I6HJ 1LPQA 2E2JJ 3KLOA 1MBGA 1D0YA 2OV7A 4LG3A 3E7LA 1RKTA 3I59B 2EQRA 3HB9A 2ECBA 3BG5A 4JX6A 1FMWA 1UG0A 3L2WA 3DPTA 3P7NA 1E3PA 1T39A 5ICCA 2OQGA 3T8TA 2FBHA 5IT3A 2IT0A 2FBKA 4A3IJ 5FKOA 3S17J 2ICWG 2GOXB 5ILVA 4PJ0C 3FKIJ 3WG9A 4V19K 3KYDB 2DK8A 3K4LA 4XN3A 5D8KB 1MMGA 3KEOA 3H1CA 2TDXA 2PEXA 1DU0A 2IS4A 2O6GE 1UHMA 4XRSA 4A6EA 2E1CA 2E19A 4YIRX 4LD5A 4ASNA 2CFOA 1FOYA 2OD5A 2DMQA 1ETQA 1J9IA 2ZO4A 5FLMJ 3A03A 4HV5A 3G1LA 3LOCA 1Z7UA 2EV0A 2H6CA 2KT0A 4D5CA 3S1NJ 3PUFA 4ZC3A 5K1YA 2XVCA 1R22A 2D1HA 4M9SA 4CYCB 4U7DA 1JUMA 1K6YA 4ZJZA 2VQGA 4YFXF 1ZLJA 3FMSA 5LD2C 3CCUI 1J75A 3K2ZA 1ZK8A 3LSGA 2AO9A 4W97A 1QHHD 3Q5FA 4XIDA 4BEHB 1I3QJ 3CO7C 1LFUP 2BZTA 4CHUA 1R5ID 2JK3A 1O3SA 1VQMI 2PMZN 4E70A 2DXIA 3JRBA 2DODA 4A93J 2NXNB 5F08A 3I64A 2QZ8A 4CCLA 4R79A 3OYLA 1S8NA 3E5XA 4UUTA 3J7AO 2XDVA 2Z3YA 3V4GA 2R5ZB 1HSJA 1MZBA 2QVOA 2QBYB 2CW0F 2QKLB 3X2QH 1OCPA 2PMHA 3ZQLA 4AWXB 5CVVA 1R71A 1KU3A 1X1BA 2HVSA 3R0AA 2A69F 1UFMA 5J40A 2Y69H 4A3DJ 3K4MA 2D5VA 5JVGF 3GVAA 3OMYA 1VZ0A 1MBFA 3FK7A 3VFZA 2R7UA 5K7ZA 3K1MA 1YJNI 1IXSB 2CGPA 1UAAA 3RDIA 1EKEA 3BQYA 2QYOA 3BZCA 1FC3A 1OISA 4PZJA 4EJTA 4FASD 1ZELA 1JKPC 4R8HA 1PYVA 3H9GA 1EA3A 1MJAA 3H36A 1A6IA 2EINH 1JJ6C 2FNAA 4YIFA 3K1NA 3TOBA 1UCRA 1YIJI 2K9QA 5IP7J 3GWZA 4B3XA 1Z05A 1Y0UA 2VPLA 1X1CA 1D8JA 1G8XA 1FY7A 1TWFJ 3TDZC 2XPVA 4UB8C 3B02A 4Y17A 1OLTA 2A3SA 2DFEA 4CCNA 2VPRA 2K4BA 3RI4A 1B4AA 4OU0A 2V26A 2CRGA 2ZFWA 3NAUA 3V7SA 3CP2A 3CJRB 5EYRA 3SZPA 4G9YA 1FLIA 2WC2A 3IH2A 2DA5A 2EFWA 4NQWB 2HOSA 3I4MJ 4WXHA 2R7OA 3OV8A 3I58A 3ZQQA 4C3IJ 1ONVA 1YW8A 5D6EA 1R36A 1ZR2A 2OCEA 4A3GJ 2JZYA 3IRQA 4BE1A 5DS9A 2HQAA 3DKXA 1R4MB 1WQ2A 1R49A 1YJWI 4KMFA 2TRTA 1JGSA 2QQBA 3WTYC 1K79A 2K9SA 1HKQA 2JT1A 1Z3YA 3ABLH 1JUSA 2BY3A 5L3BA 3JR9A 3CC2I 2KL4A 2HDCA 1D1BA 3Q3SA 5F0HA 4UV8A 2EIKH 4P55A 2JA8J 2LF7A 4PCQA 4M73A 5E3NA 3NWTA 4PUSA 4BHCA 4KIGA 3DCFA 1IAWA 2O61A 2NAZA 1BI1A 1V5EA 2HOEA 1LUJB 1KZHA 4MGRA 4P96A 2ETHA 1SVOA 4JQFA 1RR8C 4KT5C 2EBIA 5ICEA 3HM5A 3S2HJ 4YFNF 1ON1A 4ANJA 3HGYA 2L5QA 2LKSA 2Z16A 3FF5A 5C4JJ 4HYEA 3K4NA 4HZFA 4ABZA 3TP3A 2LLKA 1TBXA 4CCOA 5D6FA 4CDGA 4O5VA 4DYRA 3ABMH 3RSNA 2DO7A 2LDUA 1KQ0A 4AIDA 1VQKI 3M9AA 1RR7A 4CH7A 2P81A 2X48A 4M6XA 1LFPA 3HRMA 3E6BA 3LQQA 1UHSA 3TO9A 2IA1A 3OYMA 3KYCB 1KQ8A 1TT5B 5ILSA 2ZXJA 3KFWX 2D1VA 4ESBA 3BLYA 1IXRC 1XDSA 1ZRFA 1FX7A 5IY5H 1W0TA 5FLXZ 3NEUA 3VSKA 2DT6A 2KLOA 3JAMK 3F8NA 1JXSA 2HYJA 3CCSI 3CCRI 2RNJA 4BS9A 4RGSA 2KJCA 1X4PA 3BR3A 1BA5A 2IS6A 1WJEA 3L09A 2M87A 3C2HA 5L3DA 4HA8A 2CJJA 2LD5A 1WJAA 1SD7A 1V3FA 1GV2A 4BUPA 1TQMA 1A31A 2K3FA 5CVUA 2F5FA 3S1RJ 4RLFA 2KDZA 1YG2A 4A0XA 5DM7F 3ULQB 3L7WA 5HODA 1BW5A 1GV5A 2EILH 4HG2A 2L7ZA 4O6JA 3TW6A 2GM4A 1S72I 1SVMA 3S3OA 2COBA 2M2EA 5FKNA 1JKOC 1IDZA 2Y0SA 3G2BA 4DZJA 4Y4RA 5FD6A 2DOFA 1LFBA 1YS7A 2VODA 4HNUA 4L0YB 4B43A 1BIBA 4CUGA 1V5FA 2F4OB 1M1EB 1S5LC 3HHHA 4HAMA 3JRGA 2DI3A 2IW5A 3CZ6A 1RRJA 2GIZA 2DT5A 3S32A 2BGCA 4G6QA 4HDUA 4ZTFA 2EIJH 3TO6A 1TT0A 3W6JB 3CMMA 4XKCA 4KNYA 4E7SA 3QODA 2ZNYA 3ZMTA 5B66C 2WY7Q 2X1EA 1TWCJ 2OJED 1IC8A 3WE3A 4HQMA 3CJQB 4KN7X 4KIFA 3K4KA 1QBJA 2Y30A 1XMAA 2LG4A 5HLIA 1WJFA 3RQ4A 3V8KA 1VQ8I 3LQRA 3EUHA 3CCVI 3HOUJ 1G3WA 2VOPA 1ON2A 5L3GA 3EUHC 5JVTA 2EFNA 2PFBA 4Y7NJ 3ZOBA 2KRCA 4XLEA 2XPWA 3MZYA 1Z1DA 3IWFA 5FROA 3G3ZA 1ZR4A 2IJLA 1X3ZB 3R0JA 2P5LC 3B6AA 2V1DA 3GFJA 4HOBA 3J81K 4LLNA 2OZUA 1P4AA 3S93A 5TRDA 3S1MJ 2MG4A 4PDKA 2GQQA 2M7BA 1NK2P 4ZDOA 1E2XA 5IPAA 4UVCA 2JUCA 3BR6A 1H9TA 1ZTRA 2L7KA 2RNGA 5M3FJ 2KMUA 2E5NA 1YOVB 5IP9J 3RPUD 2WV1A 4OWRB 2R4GA 3BZ6A 4DW6A 3VODA 2XGDA 4XR6A 2XAHA 4S05A 1E3OC 2L9NA 1W7PA 2VIXA 3V7RA 4A2UA 2OTJI 2LH9A 1FP2A 1VQOI 4PGHA 3UNGC 5TISC 1F1ZA 3FKJA 2BOLA 3A02A 5F1JA 3H9JA 4KJZA 1LEBA 3FM5A 3WTXC 4HNVA 1P92A 3K0LA 4MFEA 3NWSA 4KDPA 1PUEE 3BROA 1HCRA 3KP4A 4GCVA 4XSZF 2FQ3A 3KLNA 2E2IJ 3CESA 1RNLA 2DQRA 1OMIA 3SZGA 3CLQA 3WTWC 3S15J 1TLHB 1D0ZA 2LREA 5IOYA 4IVNA 2PMZA 2OUMA 4DYQA 3RYPA 2VKEA 2JN6A 4G7OF 4WX9A 3QYBA 5ERIA 3ZPLA 1TWHJ 2EH3A 3CMAI 3G1MA 4IHYA 2OBPA 2RREA 4L18B 1J2XA 3DKYA 1MBHA 1GVDA 2CUZA 2RN7A 3C2BA 1PDNC 4N4OB 1MDMA 2JWTA 3DFGA 5DUKA 4XQFA 1D8KA 2DA7A 2A07F 3TKYA 3DTKA 3DBLB 4E7ZA 2QENA 2DA3A 2XAUA 3OR1C 1KQ9A 1DDNA 2HQRA 1OYYA 1YTYA 2NVTJ 2DOAA 3HL2A 1A6QA 4BGDA 1EJ9A 2KQRA 3RKXA 1U0JA 3BWGA 2QWWA 2CG4A 4Y15A 4JYKA 5E3LA 4WWCA 2DYRH 2K27A 5F6FA 3BCBA 1ZN2A 4XLAA 1B59A 1OPCA 3MWMA 3WHCA 2Z2SB 4NHJA 1WVRA 5DCFA 4DZPA 4CA0A 5GTHC 1T98A 1BW6A 3GXOA 1R1UA 3FXKA 3M1EA 1O7LA 1X2NA 2W82A 5KAFC 4FX4A 4IQJA 4GXOA 1ZH5A 2H1KA 2EZKA 4U88A 3LAPA 1WGXA 2CV0A 4ENMA 1BR2A 4KT6A 4RAYA 3MEXA 5K7FA 5HLGA 3P9CA 3GTJJ 2CV2A 1A5JA 2QEXI 2LVSA 2NVXJ 1WJCA 4P9FA 1N77A 1MMSA 2B7EA 2EZLA 2HS5A 4A12A 3IAS2 1QRYA 2Y2ZA 2IA0A 3SDBA 1HW1A 1CQTA 3H3ZA 3F6VA 4UV9A 3BG6A 5M3MJ 3M7GA 1Q1HA 2V79A 5BPIA 4OAYA 3DU6A 5LRSA 3AG3H 2DA4A 1G2HA 3OL4A 4NB5A 3MKLA 5JLWA 3OS0A 4ETSA 4E6KG 3WTUC 2LYCA 4AIHA 3I4PA 3JSPA 2R5YA 4G7ZF 2NVQJ 1QNTA 1XSVA 3HHGA 4D9JA 4GFBA 3ABKH 2GA1A 4XRFA 2AS5F 3ZP5A 4M71A 5JR3A 3MN2A 3ZXSA 3I54A 3I9V2 3PIOF 3F8BA 1S7OA 5AIQA 1AWCA 3HRUA 4LIUA 3OYNA 5M5XJ 2MLGA 2E2HJ 1TL8A 3ZCOA 4IHXA 2YU9J 1UMQA 1W5CC 3ZRGA 2Z33A 4XOTA 1IRFA 1USSA 3VYRB 4WXDA 4RB2C 4EJOA 1LJ9A 1XGOA 4FHTA 2R3SA 1O4XA 1W7PB 5HNFA 3BR0A 3BJOA 2UXXA 3VYSB 5E3OA 3KIOA 3GYHX 1XGMA 2V1UA 3R60A 3ECHA 3IRRA 2FOKA 3K4CA 2QSGX 2IAIA 4KFCA 1IW7F 2LY2A 4IJAA 2P4WA 4KMUX 3FHZA 1XSDA 1AA7A 1BR1A 3KCCA 4II3A 5BS6A 1JUPA 2NVUB 4X0GA 1IJWC 4L9JA 1FIPA 3ZMUA 4Q47A 4ON0A 4AVPA 1SAXA 3L9FA 4I6ZA 4ZYDA 1W7PD 5HS7A 3LAJA 2XSJC 1WKMA 1KYWA 1U5TC 3E3VA 3K70C 2A5WA 3CJNA 3IC7A 2LRDA 2P7CB 5F1RA 1SFOJ 1GXPA 1WJDA 3BR1A 4BJTA 2DU9A 4M9ZA 3OYHA 2EB7A 1SC7A 2P0WA 4IHWA 5JLXA 2HOAA 2GIVA 2XASA 4F3QA 3D5LA 3HGGA 1DPRA 1FTTA 4BL0B 4A3LJ 3V8LA 4LB5A 2IS1A 2LR8A 3H35A 1W36D 3I4NJ 4QIWN 4HW0A 2L02A 2M7AA 3BP8A 4I01A 1MDMB 5GTIC 1J59A 1S7EA 3E0JB 5FGMA 1HSTA 1F43A 3W2AA 4WF2A 1IF1A 1YRNA 2ZSHB 1DU6A 1FMVA 2P5VA 2OAZA 1GHCA 1MD0A 2L9VA 1BJAA 1ITYA 3REOA 1MMAA 5DEQA 1JJ8C 4XKBA 4JBAA 1HA8A 1ZGWA 4HF2A 3OYDA 4AVZA 1D5YA 5E1ZB 5F04A 3Q0WA 2R7TA 2Y9ZA 3O6BB 3I55I 1IDYA 4XMYA 4R1HA 3IH3A 2QQAA 4AD9A 1IZ1A 2KRHA 3KEQA 3CTAA 1VI0A 1WI3A 4M3EA 4P1WA 2LFBA 3JRAA 4IX7A 3DLLF 3HSEA 5HNHA 4HLYA 1WRJA 3CD6I 3ZMSA 5GAGJ 4ZDPA 2A6EF 2R7WA 2VJIA 3W6KB 1ETYA 2FU4A 3K69A 2L01A 2QQ8A 2L0KA 3TP0A 2RC4A 4B44A 3WU0A 4ENKA 1I6XA 2QCOA 3PUBA 5LFAA 5BOXA 3RCOA 2LKPA 1BL0A 2QF7A 3OYFA 3DEUA 1P4XA 2F5EA 3QOEA 1P7JA 1TW3A 1B8IA 2YS9A 5K5OA 2WA0A 4GRIA 3JTHA 3S3MA 3MZHA 4Z6YA 4V2GA 1T0FA 4OIRF 1FOKA 1J0RA 1T0FC 2X0LA 1VQ4I 2R5YB 1UZCA 5L3EA 4ZH4F 1Q1VA 1MSEC 5KCMA 4FTHA 1GDTA 3CUOA 1Y1VJ 3LFKA 4I0BA 2JMWA 5AONA 4E7IA 2LNBA 4IXAA 4NUBA 1AOYA 4CO8A 1SFEA 4PFPA 2CW8A 1QO0D 2FQ4A 4J19A 1L0OC 4IPAA 3HOXJ 1FBQA 2EA4A 3DF8A 1D3YA 2JSPA 2IRFG 3HSFA 1MMNA 2E60A 2H27A 1TP4A 2PJRA 5F27A 1XN7A 2F48A 4M9XA 3RZDJ 2HXOA 1WCMJ 3VEPA 4DGWB 1LVKA 3L2CA 4EATA 2GAUA 4MEYF 4PFOA 1SD6A 3COAC 3FXOA 3JAMZ 1A36A 3GFLA 1QZZA 4BHBA 3T1BA 3CF2A 4XOPA 2BY2A 4ESFA 3PSFA 3ZN0A 2CS3A 1UHWA 3A2KA 4A3MJ 3LA7A 2XKPA 3SEQA 3GTMJ 5J4VA 1IN4A 2VBYA 3QOPA 1K4SA 3BTCA 4RAGA 4CCMA 3VDXA 9ANTA 2EFQA 3PIPF 5DD8A 3BJ6A 1MNDA 1YW7A 1I27A 4C9YA 1YIOA 4FT8A 1W5TA 4E7LA 5LHGA 1SFUA 4C2UA 3R6SA 2HYFA 3K6GA 2MSYA 5FB2A 5B1AH 3IHUA 2YU3A 3SFZA 3NRVA 4C3HJ 3HOSA 4I09A 2DDAA 2L9RA 3C7JA 1KYZA 1R58A 3ERED 2BW3A 4IKFA 1P4WA 3LSHA 3K70D 2V1XA 3ML6A 4IEJA 4CXFA 3ZGKA 1G3TA 2NS8A 1YRNB 1SAUA 3BR2A 3BOQA 4M6VA 2XB0X 3LSJA 3QWLA 3OS1A 1YI2I 4KN4X 5HDKA 2XRNA 4BJ5C 3E5QA 2NS0A 3DBHB 4CCJA 3HRSA 2WAEA 3AL0C 4F52A 4D7NA 5M5YJ 2MGQA 2JTVA 1U8RA 1XCBA 3O8HA 1X4OA 2AHQA 4OMYA 3PL8A 2RQQA 3WTZA 4AU7A 4DQ2A 2DA1A 2ZKZA 3CP8A 3LMMA 3PM1A 4EJUA 1LEAA 3J81Z 1BI3A 2XAQA 5HDNA 3FX3A 4D1QA 2L54A 2VUMJ 3ZMVA 4FX0A 4RGUA 4M3GA 2GXGA 2ESHA 5DCMA 4Z2YA 3FBIB 2Y31A 2HI3A 2HPIA 1HW2A 3O2PE 2KP6A 2A68F 2W48A 3FISA 3D0SA 3DEWA 3HOTA 5IYBJ 1D1CA 4LGWA 2X1CA 1J09A 3K2AA 3V8JA 3QPTA 4DIQA 1PUFA 2VT2A 4V2FA 3PJRA 2PN6A 1B8IB 4Q5SF 1TNSA 2IPQX 1FYMA 3MVPA 2MFZA 2DJNA 2DTRA 3DBRB 3GF2A 3NQOA 2JPCA 1IV6A 1K61A 2ADUA 2FJ1A 1MKMA 3IWZA 5LLQA 3P9KA 5JHUA 3SQNA 3ECOA 1IN8A 3C18A 2AQEA 3ELKA 2JQ7A 3HUGA 1TQIA 1RIOH 5KHDA 4NC7A 4YG2F 1LE8A 2Z99A 2QUFA 4XRMA 3IP4B 4QWQA 4B4CA 1QGPA 4A0ZA 4K2EA 5LRRA 3FWEA 1K83J 2BBYA 5FFXA 3UKGA 2H09A 5EEAA 4YFKF 1OJLA 4GYIA 2CWEA 2FSWA 2R7QA 3TW7A 2V1NA 2YX4A 2ZJQF 4HV6A 3J7AY 3WU1B 3D5SC 2XIGA 3HKZN 4EM0B 2BY0A 4L9NA 2PJRB 5B5EC 3JRCA 4MFDA 4DBQA 4KITB 2HQNA 2EZHA 1G3YA 3BCAA 4FISA 3EDPA 2M30A 2QLZA 2DT7B 1WH7A 2LSOA 4OIQF 1DGWY 2B0LA 4EVIA 5D4RA 3SXYA 2M8GX 1N78A 4AC0A 2MH2A 4Q48A 3UR3C 1ZRDA 1WI9A 1XSXA 2M45A 5DYMA 3SZTA 2Z1DA 5IYDJ 3FIWA 5H6QA 3T8RA 2G7UA 4X6AJ 3GCMA 3BC8A 3WG7H 4E7KA 2ESNA 2R92J 2XGXA 2FD5A 2XROA 2IS2A 1X3WB 4BXUA 1TNTA 4A3KJ 4E7JA 5J4YA 3O3KA 2OQRA 1XS9A 1XGNA 3ABTA 3HXLA 3GW2A 3LSIA 3MMYB 4PJNA 2HVRA 1X1PA 2ZXHA 4F93B 1WFXA 2OZ6A 1I1GA 2EV5A 1JHHA 3Q0VA 1IO2A 3I5UA 3F72A 2BW3B 3F23A 5GAEJ 1GVJA 1GXQA 1BC8C 2R7ZJ 1YW9A 4ITVA 1FIAA 3HEFA 4XICA 2HPMA 3F3XA 5LHHA 5FRNA 3FBNB 1NTCA 2E5ZA 5CLSA 3FXJA 2BVMA 4HX8A 1ZG3A 2MABA 1ZREA 2J5OA 1B72A 1GLNA 4AYBA 4EEFG 1NK3P 1JGGA 3AL0B 3LSMA 1T2KA 2DYSH 3U9GA 2WAQN 1ZYRF 1KU2A 4J01A 4H4KC 4BE0A 4ESJA 1UB9A 3E6DA 2ELHA 5LGUA 1WPKA 1N75A 1FYKA 3DKWA 3HYIA 5DUIA 3AG4H 4BJ6C 5E17F 4CZCA 1MBJA 2HXIA 2VQCA 3KZYA 5CPRB 5FKLA 4B3AA 5K5RA 3FXRA 4U0VA 3AKZA 2Z5UA 2A6HF 2R7XA 3M3YJ 4BQQA 2PX9A 1ORKA 1H8AC 3RZOJ 2OC6A 2DK5A 1ZLKA 1MW7A 5DCMB 4HPQA 4RB3C 3OOUA 1PP8F 2FMLA 3BTLA 5J3LA 4L5EA 3S14J 2BVLA 4M6YA 1ETVA 4EJWA 2WADA 2NVYJ 1R5GA 3E5UA 3QPLA 2E7XA 3OL3A 3QYFA 2KHMA 1SVLA 2HKOA 4D7MA 1PUFB 4AM3A 1S6LA 4XNFA 3BTIA 2QKMB 4P5OA 3GZ6A 1EF4A 4I7HA 1KGSA 4QLCU 2IA2A 3L2UA 3KX2A 2XGCA 1SFKA 3E1SA 3CMEI 1AHDP 4HSRA 5LBQA 3A4CA 1B6AA 2NS7A 5H20A 3L1PA 3QPHA 3K1PA 4XBFA 3HJEA 3DTIA 4FETA 4RGXA 4RS8A 5FD5A 3TDUC 1LDDA 1Y1WJ 1ODDA 1EH7A 1XTAA 2M4KA 3W2VA 3H5NA
chains in the Genus database with same CATH topology
3HUGB 3FDYA 3LFUA 3TMOA 5HNFA 3VYSB 4ZC3A 2LBFA 3HPHA 1X19A 3PNYA 2K9MA 3DPLC 3K4CA 1K6YA 4ZJZA 2L9SA 2VQGA 3LSKA 4CCKA 5HLTA 2LY2A 2R7SA 3VYTB 1NG7A 5LD2C 2X6YA 2VKHA 1AA7A 2CV1A 1BR1A 4II3A 3DPUA 5KNLA 3LSGA 1QHHD 4BEHB 2Q1ZB 4X0GA 4JOMA 4BQOA 3S3NA 1MMDA 4YELA 4B47A 1DGRM 2XSJC 2DXIA 2JUGA 1S9HA 3K70C 2A5WA 2LRDA 3L2RA 1X1DA 4CCLA 2KDOA 4R79A 3OYLA 1WJDA 4BJTA 2XDVA 3OYHA 2P0WA 1R6RA 1DQUA 4Y33A 3M1CA 2F6CA 2QKLB 1QHGA 4F3QA 3D5LA 4BL0B 3OR2C 3H9QA 2IS1A 1X1BA 3H35A 1W36D 2HVSA 2VJ4A 2M7AA 1G59A 2M0MA 2X85A 3E0JB 1NG6A 3K4MA 3W2AA 3DQVC 3OMYA 4YEJA 1VZ0A 3OYEA 2R7UA 2ZSHB 1UAAA 4BXFA 3RTRA 2M3AA 1IRXA 1FMVA 4N4NB 4FASD 1ZELA 4RM2A 2V4JC 4XKWA 2CW7A 3OY9A 1MMAA 1PYVA 3H9GA 1EA3A 2K9LA 5HOOA 3MKWB 4XKBA 4XM3A 1HA8A 3OYDA 4AVZA 4BDZA 3F9KA 4NC8A 4B3XA 2R7TA 2VPLA 1X1CA 1G8XA 4U87A 3H0DA 2WY8Q 3MD2A 4XMYA 2I8DA 1OLTA 3OS2A 4CCNA 4XL9A 2KRHA 2WAFA 2IGMA 2KZVA 2W1OA 4NNJA 3MKYB 4BDYA 2V26A 4P1WA 3CP2A 2MYSA 3CJRB 3PNTA 4IX7A 5HNHA 3OYBA 3MKZA 3A1YA 4ZDPA 2R7WA 2VJIA 4NQWB 2R7OA 3ZQQA 4B44A 3OWTA 3PUBA 1Y56A 5LFAA 3RCOA 4BE1A 3OYFA 2HQAA 3QOEA 4PSXA 3DKXA 2WA0A 4GRIA 3OYIA 2CUJA 2W00A 3S3MA 4RM3A 3HPGA 1Z3YA 1T0FC 3EPZA 3DU5A 2KL4A 2X1DA 1D1BA 4XLCA 5CKTA 2R7RA 1LDKB 5KCMA 2UWMA 2VASA 4PSWA 3OIQA 2ZXIA 4ZDLA 3NWTA 4PUSA 2M4GA 4E7IA 4NUBA 3SYTA 1V5EA 4PFPA 2LY1A 2CW8A 4JQFA 4XORA 2CMPA 3KYLA 2VXDA 2VQHA 3IAM2 2V9KA 4ANJA 2JSPA 4OAZA 2L5QA 3TL4X 1D1AA 1MMNA 2E60A 2Z16A 3K4NA 4G6TB 2PJRA 3HG9A 4DGWB 1LVKA 2K3PA 4CCOA 1BR4A 4EATA 1DP3A 4PFOA 2LBFB 2MC4A 3U21A 2K5CA 3RSNA 3VSLA 4IZZA 2IGKA 4Y3OA 3OYGA 2O5RA 3CF2A 4XOPA 4CH7A 3OYJA 3PSFA 1LFPA 2CS3A 4HSTA 4F55A 3A2KA 4II2A 3TBIA 2LC2A 1W36C 3SEQA 2IXSA 3OYMA 1LKXA 3K4BA 3S8PA 3BLYA 3V42A 1Y6IA 4ZYAA 2JVHA 4CCMA 3PSIA 4MLOA 4QPQA 3VDXA 4C2TA 3AFHA 1MNDA 3L2QA 3VSKA 2DT6A 2KLOA 4C9YA 3OYAA 4QPOA 2F5VA 4BS9A 4E7LA 2IGOA 2VJ5A 1KONA 1X4PA 2JA2A 4LITA 2IS6A 4C2UA 1T95A 1WJEA 3K6GA 3C2HA 1WJAA 4F92B 5JHFA 4BUPA 3IUOA 3HOSA 2XF5A 4RLFA 3K4JA 1X1AA 2BW3A 5TGTA 4IKFA 3LSHA 3K70D 4HG2A 4DJAA 1UELB 3ZGKA 4E4HA 3N05A 3ZR8X 3S3OA 1SAUA 3OS1A 1E0EA 4E7HA 2Y0SA 3G2BA 2ZFUA 2FUG2 2AQFA 4Y4RA 2X51A 2WB1A 4B48A 4BJ5C 4CCJA 2Q2EB 4HNUA 2WAEA 4B43A 4J00A 2X6XA 4CUGA 1V5FA 3AL0C 4F52A 2WAQA 3CZ6A 3EUAA 3S32A 4BE2A 3DLAA 4ZTFA 1TT0A 3CMMA 1X4OA 4XKCA 3FHNA 3PL8A 2RQQA 3QODA 4PJJA 4AU7A 4E7SA 2WY7Q 2X1EA 4C30A 1YE9A 2XF6A 3C2GA 3CP8A 3LMMA 3H5AA 3CJQB 3K4KA 2V7FA 2GOMA 3H5RA 4D1QA 1MNEA 2LG4A 2HVQA 1WJFA 2HNHA 3RQ4A 2CH0A 3FBIB 2W7NA 3EUHC 2HPIA 2VJJA 2HU9A 2KP6A 2KRCA 2HZDA 4XLEA 1TZLA 3HOTA 4IQ4A 1D1CA 3SEZA 2X1CA 1J09A 2E1MC 5FROA 4RMNA 4DIQA 3PJRA 2VB6A 2UUZA 5CQEA 3S93A 3PNVA 2XF7A 2VL8A 1WJ5A 2M7BA 4ZDOA 2L2OA 2MFZA 2WBMA 5HVQC 2VQLA 2L7KA 2RNGA 2KMUA 2E5NA 2AQEA 3RPUD 2XC7A 4OWRB 2R4GA 2JVGA 4XR6A 3DTEA 4XLHA 5KHDA 2L9NA 4NC7A 2VIXA 2HDWA 1P9QC 2LH9A 4BACA 3LL7A 3IP4B 3M8JA 4RLQA 3UNGC 1Z21A 3HKZA 3FKJA 3I3LA 2BOLA 1Z7LA 3H9JA 2NOJB 4KJZA 2R7QA 2W4SA 2V1NA 3NWSA 1BOBA 3D5RC 4XKVA 2DCEA 3J7AY 4BU2A 3D5SC 4BEHA 2PJRB 1WJBA 2ELJA 3CESA 1YX3A 2VKDA 3SZGA 4DBQA 4KITB 3PFYA 1D0ZA 2LREA 4XONA 4HEA2 2F4IA 4ZTJA 2PMZA 1JI8A 2OUMA 3BCAA 2DT7B 3BG7A 4PJLA 1DGWY 1V5GA 4CSWA 1N78A 3QYBA 3UR3C 3DWLE 4XN0A 4XLFA 2RREA 2Z1DA 2ZSIB 3DKYA 3BC8A 2CUZA 4E7KA 4PK4A 4N4OB 3K10A 4PJMA 4XQFA 3L2VA 2R7VA 3DTKA 2IS2A 4E7ZA 2MD0A 4E7JA 2XAUA 3OR1C 4DBRA 4DOZA 5CQGA 4YRVA 3LSIA 3HXLA 3MMYB 4PJNA 2HVRA 2DOAA 4BQNA 3HL2A 2ZXHA 4BGDA 4F93B 1WFXA 4F91B 2KQRA 1U0JA 2X6WA 3OYKA 3BCBA 3OIPA 4XLAA 1D0XA 2BW3B 2Z2SB 1PJRA 1ERDA 3VYUB 3DEEA 4ITVA 2HPMA 5FRNA 4HNTA 3GBGA 1Z3XA 3FBNB 4LIVA 2E5ZA 3W2WA 4CA0A 3QYEA 2BVMA 2W82A 4IQJA 2MABA 3HC7A 1GLNA 4AYBA 3AL0B 4HRIA 3LSMA 2CV0A 2VXZA 1BR2A 4KT6A 3EUKL 4J01A 4H4KC 4BE0A 3ONQA 4KISA 2CV2A 1N75A 2UV1A 2A6TA 1WJCA 1N77A 4BJ6C 4CZCA 2V6EA 3IAS2 2VQCA 5CPRB 3W3CA 3SDBA 3AKZA 3BG6A 2R7XA 1D0YA 2OV7A 4LG3A 4BQQA 4OAYA 3DU6A 2OC6A 3OL4A 1OR7C 1FMWA 1MW7A 3KEYA 4HPQA 1UG0A 3OOUA 3OS0A 4E6KG 3DPTA 3L2WA 5FRMA 1QU3A 2LYCA 2IGNA 2BVLA 2WADA 4D9JA 2GOXB 2E1MB 3OL3A 3QYFA 2KHMA 3K4LA 4XN3A 4XNFA 1MMGA 3ZXSA 3I9V2 4U7BA 2QKMB 4P5OA 4LIUA 3OYNA 3L2UA 2IS4A 3KX2A 2LOOA 1SFKA 3VWBA 3E1SA 3OYCA 4HSRA 3A4CA 1YX5A 3ZCOA 3DTIA 2DJIA 4FETA 3ZRGA 2CFOA 2VLAA 2M4KA 2KPMA 4XOTA 3VYRB 3W2VA 3H5NA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1UG0 A;  2E5Z A;  1X4O A;  2E60 A;  1X4P A;  2DT6 A;  2DT7 B;  4DGW B; 
#chains in the Genus database with same CATH topology
 2WTE A;  3HUG B;  3FDY A;  3LFU A;  3TMO A;  1RKW A;  4IHT A;  1ZAO A;  4ZZL A;  4HX4 A;  5L3C A;  1LE8 B;  4JK1 X;  1T33 A;  5FFZ A;  2LKX A;  1FSH A;  1X19 A;  2FEZ A;  3QP5 A;  4Y52 J;  3CCE I;  2YPR A;  3DPL C;  3LWF A;  1TWA J;  2G9W A;  2L9S A;  4KA4 A;  3LSK A;  4CCK A;  5HLT A;  3VYT B;  2FF4 A;  2CV1 A;  1J7K A;  4WK8 F;  4LLG F;  4DYC A;  2O3F A;  5HS9 A;  2KFD A;  1VQN I;  4BQO A;  3S3N A;  1GT0 C;  3GME A;  1IN5 A;  3IKV A;  2DTZ A;  1DGR M;  1ETK A;  5J8C A;  2JUG A;  2NRA C;  1OYI A;  3SDG A;  5DTD A;  1WSU A;  1X1D A;  1FEX A;  2COM A;  4C3J J;  2JPB A;  3AG2 H;  4G12 A;  3F0C A;  3MQ0 A;  1G6N A;  2O03 A;  3QP6 A;  4N9I A;  4IO9 F;  4Y33 A;  3M1C A;  1K7A A;  2F6C A;  3SHF A;  4AIJ A;  2XPU A;  2ME0 A;  5LGT A;  2LK2 A;  4LJZ F;  4RDU A;  3LNQ A;  3H9Q A;  1ZGA A;  4Q4Z F;  2KZG A;  6PAX A;  2VJ4 A;  1G59 A;  2M0M A;  5EJC A;  3ROU A;  2MA3 A;  3I56 I;  1SMY F;  3BT9 A;  5D8L B;  3DQV C;  2IEK A;  4YEJ A;  5KK1 A;  3OYE A;  1OCT C;  4W1U A;  1Y39 A;  3GFI A;  4BXF A;  3RTR A;  2M3A A;  1IRX A;  1OFC X;  1QZY A;  3WOD F;  1SEU A;  5ICF A;  2EV6 A;  3CDL A;  2Q2E A;  1YQA A;  4RM2 A;  1IUF A;  4G6D A;  2CW7 A;  3RIR A;  2K02 A;  3GTK J;  3ZQF A;  2K9L A;  3CJT B;  5DV5 A;  3MKW B;  2B9S A;  2HDD A;  3WTS C;  3HBL A;  2ISY A;  5EZG A;  2P6S A;  4BKX A;  1A04 A;  3F8M A;  4IRH A;  1U9O A;  2ZC2 A;  2H6B A;  2K85 A;  3GEZ A;  3L00 A;  3LA2 A;  3QAH A;  3QPS A;  4NC8 A;  3RQI A;  1K4T A;  1MH3 A;  2KKO A;  2WY8 Q;  3MD2 A;  4L0Z B;  1SD5 A;  2I8D A;  3AAF A;  3OS2 A;  1NHA A;  2DA6 A;  3S2W A;  3OSF A;  1EH8 A;  2IGM A;  4BDY A;  1BBY A;  1QVT A;  3GLL A;  2E71 A;  4NNJ A;  1B72 B;  4M74 A;  4S0H B;  5CVR A;  2MYS A;  2ZCW A;  5J1U A;  5J1R A;  3QU6 A;  4ENJ A;  2ZME C;  3J7Z I;  3JSO A;  4G8X A;  3S1Q J;  2G0E A;  2AXT C;  4NDL A;  4I98 B;  4L9V A;  5LHI A;  4CZZ A;  1XPX A;  1HC8 A;  3KP6 A;  5KVR A;  5LEJ A;  1Y56 A;  1QA6 A;  1IRG A;  4EM1 A;  2MC3 A;  2H8W A;  4L5I A;  3HZJ A;  4PSX A;  1HF0 A;  3ZQH A;  3FMR A;  3MAJ A;  4B8X A;  4RM3 A;  4HQE A;  2E7W A;  2WV0 A;  1JHF A;  3EPZ A;  4ZYG A;  1S7A A;  3DU5 A;  3PO3 J;  2X1D A;  1UJ8 A;  1HDP A;  4BQA A;  3D1N I;  3ZQG A;  2UWM A;  4EV0 A;  2V9P A;  1VQP I;  4PSW A;  4UNO A;  1LNW A;  2ZXI A;  3PFI A;  3Q0U A;  4OIN F;  4U0Y A;  3J7Y J;  5EZH A;  4EGY A;  4IF4 A;  2DMP A;  2VKV A;  2EIM H;  4B1R A;  3KP2 A;  5EG0 A;  2LY1 A;  2OCC H;  2E36 A;  3FK6 A;  4LMY A;  2CMP A;  2DFI A;  5J1Y A;  2LF8 A;  3U1K A;  1Z67 A;  4C2M J;  2YR2 A;  2VQH A;  1U9N A;  1ETX A;  2F2E A;  2I10 A;  4OAZ A;  4I0A A;  1Z0X A;  1D1A A;  2ZXW H;  3BDD A;  4UXN A;  3E6C C;  3HG9 A;  1XDU A;  5FKK A;  2K3P A;  1W0U A;  4L9T A;  4LOC A;  1EV7 A;  3WHB A;  3U21 A;  5J47 A;  5C3E J;  4Y3O A;  3I53 A;  4M3F A;  4I2O A;  1U5T A;  4KIB A;  4UHT A;  1FYL A;  4N0B A;  3WGI A;  1IG7 A;  3FM3 A;  1YYV A;  4JX4 A;  2ZB9 A;  1LKX A;  3GZ5 A;  1P6R A;  3H3U A;  3ABU A;  3S8P A;  3MZ8 A;  1XC5 A;  3PSI A;  4MLO A;  5HDG A;  4QPQ A;  1U6G A;  3RYR A;  3RJP A;  1REP C;  4NC6 A;  2XHK A;  3AFH A;  3L2Q A;  2GBY A;  4QPO A;  5D5W B;  5FJ8 J;  5A2Q Z;  1QVU A;  2IGO A;  2OPT A;  2VJ5 A;  4LIT A;  1MNM C;  4GDF A;  2HZT A;  4B09 A;  4UUS A;  1JTY A;  3EET A;  3IUO A;  2XF5 A;  4MTD A;  1Z6T A;  3BG3 A;  5TJJ A;  2HTS A;  1VND A;  1X1A A;  2RGV A;  5IT9 K;  1BI0 A;  1SMT A;  2OTL I;  5KAI C;  3TED A;  2ID3 A;  4RA2 A;  4DJA A;  5DM6 F;  2X9D A;  1UEL B;  2YUS A;  1H88 C;  2FOW A;  3BPX A;  4E7H A;  1JTX A;  3B6C A;  2AQF A;  1LDJ A;  2NNN A;  4RGR A;  3G71 I;  3S2D J;  5BQT A;  3CUQ A;  2Q2E B;  2VBW A;  3CUQ C;  3BJA A;  4P9U A;  2X6X A;  1Z77 A;  1ZKG A;  3Q9S A;  2WAQ A;  3KET A;  2A05 A;  2HWV A;  3ZQC A;  3GX4 X;  4BE2 A;  1Y0N A;  2EWN A;  3DLA A;  5FKM A;  3A01 A;  2R7D A;  1HDD C;  3FHN A;  4FQG A;  2JA7 J;  2UZK A;  2A61 A;  2VBZ A;  2GWR A;  3F6O A;  4LLL A;  1YE9 A;  2XF6 A;  2DAO A;  3GZN B;  2DMU A;  4I02 A;  2PMU A;  2V7F A;  3RPQ A;  2GOM A;  3H5R A;  1V4R A;  1K78 A;  1MNE A;  2HVQ A;  1KU9 A;  3E97 A;  2HNH A;  3ESW B;  2CH0 A;  2W7N A;  1QZE A;  1S3J A;  3GTQ J;  1JKR C;  2VJJ A;  5E3M A;  1V55 H;  2HU9 A;  1TZL A;  2HOT A;  1HBX G;  4IQ4 A;  4MQ9 F;  3SEZ A;  1HLV A;  2E1M C;  2EPF A;  2ACJ A;  3J80 K;  1OCO H;  3QQA A;  2STT A;  4FE7 A;  2BV6 A;  3PNV A;  2RQP A;  2VL8 A;  4MNU A;  1WJ5 A;  4LK0 F;  1A35 A;  2L2O A;  3W6V A;  1AKH A;  1B9M A;  4BAY A;  5HVQ C;  2YX7 A;  3HOW J;  2W25 A;  1POG A;  3P9I A;  2QGU A;  4UB6 C;  2VOO A;  3CCM I;  4MEX F;  1P7I A;  2XC7 A;  3GUD A;  2JVG A;  5BPD A;  4I99 C;  2XSD C;  1ZHF A;  2BXZ A;  5FLV A;  5JFR A;  2RKH A;  2JRT A;  2HDW A;  3P5J A;  1P9Q C;  5EEG A;  2BEO A;  2NNY A;  4BAC A;  2XB5 A;  4AUX A;  3M8J A;  2EZI A;  2H8R A;  1Z21 A;  3F8C A;  3TO7 A;  1I1S A;  2H94 A;  3KP3 A;  5EG0 B;  1Z7L A;  1FJL A;  2G7H A;  4EJV A;  5L3F A;  2NOJ B;  2PLY A;  4M72 A;  2W4S A;  1V54 H;  2CYY A;  3GFM A;  2DCE A;  4XKV A;  4BU2 A;  5E79 C;  1F36 A;  2WWY A;  2ELJ A;  2F5C A;  2KJB A;  2QM3 A;  1XG1 A;  2VKD A;  2STW A;  3PFY A;  4XON A;  4HEA 2;  1JI8 A;  2L7M P;  2E34 A;  2ELK A;  3BG7 A;  1U5T B;  2DDB A;  4CSW A;  2IP2 A;  4EMS A;  2KIS A;  2P6T A;  4IOC F;  3DWL E;  3C1D A;  4XN0 A;  4O3M A;  1E17 A;  1L3L A;  5CVJ A;  3DV8 A;  3QU3 A;  3A0H C;  4S04 A;  2AXL A;  3NAR A;  3BPV A;  2ZSI B;  3I0T A;  3T5X A;  3DP7 A;  1W4M A;  1R4N B;  1SAN A;  2HGC A;  3K10 A;  4LG0 A;  3L2V A;  2R7V A;  3TQN A;  2HR3 A;  1R9T J;  2MD0 A;  1IUY A;  3FZV A;  4HF0 A;  4LB6 B;  5DD4 A;  2BHY A;  2DPU A;  2XV4 S;  5E20 A;  2CQX A;  4F91 B;  4UUS B;  2LMD A;  1BJZ A;  1O3T A;  1ZRC A;  2X6W A;  3OYK A;  5A2Q K;  3HTU A;  2N8G A;  3O8G A;  2JA5 J;  3OIP A;  4A69 C;  1IN7 A;  1R1V A;  1JE8 A;  5C44 J;  1Z6R A;  1PJR A;  3IH4 A;  1U3E M;  1ZG1 A;  1ZG5 A;  3EQL F;  2QSH X;  3DEE A;  3FXM A;  1ULY A;  3LSR A;  1AU7 A;  4HNT A;  4LIV A;  5HLH A;  4DNC A;  2WB1 N;  5ICG A;  3Q9V A;  3R61 A;  4UVB A;  1ZAR A;  3CUQ B;  5DDG A;  3K9T A;  2V9V A;  4HRI A;  3LSP A;  2VXZ A;  4A3E J;  1U2W A;  1DPU A;  2MLK A;  1QPI A;  5GAH J;  2DW4 A;  1VQ5 I;  2MBF A;  1F9N A;  4KIS A;  1EH6 A;  1RUN A;  2OF7 A;  1RI7 A;  1BOA A;  2A6T A;  3A01 B;  1N25 A;  2EK5 A;  5M5W J;  2C6Y A;  2CQK A;  2L3D A;  3BR5 A;  3W3C A;  1FNN A;  5E18 F;  3LA3 A;  3HOV J;  3OSG A;  1X2M A;  3PO2 J;  2Y0M A;  1IV8 A;  2FBI A;  1R23 A;  2Q8K A;  1O3R A;  1OR7 A;  5EF6 A;  4PGG A;  1CF7 A;  1K78 B;  3BQZ A;  4JX5 A;  1TC3 C;  3RPU A;  3WE2 A;  1OR7 C;  1STZ A;  3KEY A;  3KE2 A;  1TTY A;  2DMN A;  5FRM A;  1QU3 A;  3CCQ I;  2KIM A;  4BH9 A;  2RV8 A;  2JSC A;  1VQ6 I;  2IGN A;  5IP6 A;  2L4A A;  2F5D A;  2L4M A;  3V7C A;  5D4S A;  3CC4 I;  4XLP F;  2E1M B;  2KRF A;  1U8B A;  1P2F A;  2DPD A;  3F21 A;  4FE4 A;  1APL C;  4U7B A;  1ETW A;  4HLX A;  1W5S A;  1G3S A;  4Y13 A;  4UUV A;  5B3S H;  2LOO A;  2VT3 A;  3VWB A;  1MH4 A;  2O8X A;  2M8E A;  5BMZ A;  3OYC A;  3CDH A;  4WCG A;  2XAJ A;  5D5X B;  3JRF A;  1Z91 A;  1AKH B;  1YX5 A;  4LK1 F;  3HDD A;  2ME6 A;  4HF1 A;  2DJI A;  4N9H A;  2VLA A;  1XCV A;  3CF5 F;  2PBI A;  2KPM A;  1YIT I;  1XGS A;  4BBS J;  2FA5 A;  1FT9 A;  3KPH A;  5E8I A;  4EQQ A;  1PP7 U;  4CGZ A;  1OCR H;  2LBF A;  3HPH A;  3PNY A;  1XMK A;  3OOP A;  1BI2 A;  2K9M A;  5B1B H;  3G6E I;  4ZYE A;  3HOY J;  2CUE A;  2PQ8 A;  2R7S A;  1NG7 A;  3CDI A;  3M4O J;  2X6Y A;  2VKH A;  1DP7 P;  4XRS G;  4BHP A;  4OMZ A;  2BY1 A;  3DPU A;  2CQN A;  5KNL A;  3C3W A;  2ZNZ A;  2FX0 A;  2Q1Z B;  2A5Y B;  3KZI C;  1GUU A;  4ZZD A;  4JOM A;  1MMD A;  4A3B J;  2GA2 A;  4YEL A;  3FXQ A;  4B47 A;  4QSH A;  2P7V B;  5EGO A;  1OCZ H;  1S9H A;  1YJ9 I;  3WTT C;  1I50 J;  3FXU A;  5E8G A;  2HQ5 A;  3L2R A;  1BC7 C;  2KDO A;  1U78 A;  2E1O A;  2FMY A;  3HOZ J;  2L7F P;  4BNC A;  3CCY A;  1R6R A;  1DQU A;  1KA8 A;  1F5T A;  3HRT A;  2MW8 A;  4YII A;  1QHG A;  2GXB A;  3T0Y A;  5CVI A;  4TV7 A;  2W84 A;  3OR2 C;  3JTG A;  1E3H A;  1FBU A;  1SD4 A;  2JRM A;  1FOX A;  2X85 A;  2FXA A;  4LG0 B;  1NG6 A;  3E6M A;  4IRI A;  1Y8Q B;  1LQ1 A;  3BG9 A;  3RKW A;  1O57 A;  4ZYH A;  2LP0 A;  4KYW A;  2O8K A;  2EJR A;  3RKY A;  1OKR A;  1T6S A;  4N4N B;  2XAG A;  1DUX C;  1OCC H;  1S29 A;  2V4J C;  2W24 A;  4XKW A;  3MFK A;  3OY9 A;  2PI0 A;  2R93 J;  4NBQ A;  2ZJP F;  5HOO A;  3AG1 H;  4XM3 A;  4L5J A;  4MTE A;  1Z9C A;  1FZP B;  3CMY A;  1FBS A;  4BDZ A;  3F9K A;  4MIM A;  1YFH A;  1JKQ C;  2JJ7 A;  3SFI A;  4A5M A;  1I39 A;  1XB4 A;  2HTJ A;  1UG2 A;  4LFU A;  4U87 A;  2IVM A;  3H0D A;  1JT6 A;  2K40 A;  3F22 A;  1T08 B;  3EYI A;  4XL9 A;  2Y75 A;  5J8F A;  2WAF A;  2KZV A;  2W1O A;  4F7Z A;  3MKY B;  2BYV E;  2DFF A;  5JI6 A;  1FOW A;  4RAF A;  2ECC A;  3PNT A;  2DMT A;  1BIA A;  3IV5 A;  3OYB A;  1MJ9 A;  3MKZ A;  1D5V A;  1VQ9 I;  1IN6 A;  1RET A;  3A1Y A;  1TWG J;  3BY6 A;  2I5U A;  3WGG A;  3TGN A;  3VPR A;  2M34 A;  3KP5 A;  3OWT A;  5F64 A;  4HDV A;  3TOA A;  2V6C A;  2RDP A;  4GYG A;  1CF7 B;  2CU7 A;  3FMQ A;  4D0P A;  5GAD J;  1MIJ A;  1X58 A;  1YO5 C;  1WHU A;  2QSF X;  3OYI A;  2E35 A;  2VBX A;  2CUJ A;  2W00 A;  4IRG A;  4X1E A;  5EDN A;  5D5V B;  3U2R A;  3HIF A;  3HPG A;  5F0F A;  2FNP A;  1K6O A;  3HSR A;  1R1T A;  2HFH A;  2LTP A;  2CQ7 A;  2NOG A;  4XLC A;  1R7J A;  5CKT A;  2R7R A;  1LDK B;  1T8I A;  1MJB A;  1T38 A;  1YLF A;  2VAS A;  3OIQ A;  4ZDL A;  4EM2 A;  2R0Q C;  4BY7 J;  2K7L A;  2M4G A;  2BHZ A;  3SYT A;  4JP0 A;  1TQP A;  5HS8 A;  3H3V K;  3IKT A;  5K7H A;  2X4H A;  3H0G J;  3ZN1 A;  4XOR A;  3KYL A;  1LB2 A;  3GTG J;  1MBE A;  5E1X A;  1R5H A;  2VXD A;  1XD7 A;  3IAM 2;  4BYY A;  2V9K A;  3A0B C;  2EFP A;  4AIK A;  3TL4 X;  3K7A J;  2H1L A;  2VON A;  1I3A A;  4OIP F;  1H89 C;  4G6T B;  1SFX A;  5IOZ A;  3R4K A;  4WXC A;  3JCU C;  4KIC A;  4G7H F;  1BR4 A;  2X6O A;  1DP3 A;  2LBF B;  2MC4 A;  1O3Q A;  3VSL A;  2K5C A;  2ZJR F;  4IZZ A;  4BY1 J;  2PG4 A;  2CUF A;  2IGK A;  3KZZ A;  5E1W A;  1R00 A;  3OYG A;  2O5R A;  1BN5 A;  1OYW A;  3OYJ A;  1JT0 A;  4HST A;  1XMX A;  4F55 A;  1FWZ A;  4II2 A;  2Q0O A;  2O7O A;  4I76 A;  2LC2 A;  3TBI A;  4RBO A;  4A3J J;  1W36 C;  5C4X J;  1B9N A;  2IXS A;  4MQV A;  5BNG A;  4RB1 A;  3K4B A;  4BBR J;  4A0Y A;  4CIC A;  3RKQ A;  3V42 A;  1G4D A;  1Y6I A;  4ZYA A;  2JVH A;  5FO5 A;  5EGO B;  4MO7 A;  5IT9 Z;  4C2T A;  2DFH A;  1NH3 A;  1Y8R B;  3OYA A;  2VC1 A;  2F5V A;  2MH9 A;  2CO5 A;  1C0W A;  2YSR A;  1KON A;  2JA2 A;  4EGZ A;  1T95 A;  2DQL A;  1F4K A;  4F92 B;  5JHF A;  2R7F A;  4CYD A;  2DA2 A;  3GTO J;  2Y48 A;  1ZGJ A;  1WWX A;  2KIQ A;  3K4J A;  2DLL A;  2DBB A;  3CC7 I;  5FLX K;  5TGT A;  2Z9O A;  2FRH A;  5K5Q A;  2CSO A;  3VB2 A;  4E4H A;  3GTL J;  3N05 A;  3ZR8 X;  4G94 A;  1CGP A;  1E0E A;  4ENN A;  1J5Y A;  3N4M A;  2ZFU A;  2FUG 2;  3G4S I;  2X51 A;  2VI6 A;  2WB1 A;  2HYG D;  4B48 A;  2CQQ A;  2XAF A;  3FXL A;  1WH5 A;  2QA4 I;  2P8T A;  4J00 A;  1O7F A;  1QPM A;  3DXJ F;  2QQ9 A;  3G1O A;  1RC9 A;  3M8E A;  3EUA A;  3F8F A;  3M07 A;  2B63 J;  1B1B A;  4QTR A;  2KIF A;  1MBK A;  3I71 A;  2W85 A;  3ISP A;  2ZME A;  4GO1 A;  2HKX A;  4PJJ A;  2CFX A;  4C30 A;  2TCT A;  3C2G A;  1RPW A;  3J80 Z;  3H5A A;  4IOA F;  2VE9 A;  1PVE A;  1ACI A;  2P5K A;  2ISZ A;  2ID6 A;  1VQL I;  4IL6 C;  1OQY A;  3I59 A;  4IHS A;  1RUO A;  5D5U B;  4RB0 A;  1MGT A;  5GPA A;  3JRI A;  4RAZ A;  1WZ2 A;  2D45 A;  2M0C A;  4M3D A;  2ZJ2 A;  1FPQ A;  5GPC A;  2E1N A;  2HZD A;  2XKO A;  2NYX A;  2M9H A;  2UXN A;  2BE5 F;  3CCJ I;  4RMN A;  2EA2 A;  2Y9Y A;  2LY9 A;  2VB6 A;  2UUZ A;  4XK4 A;  5CQE A;  2XRL A;  2KIU A;  4GGG A;  2XF7 A;  4D5F A;  4U0W A;  2FE3 A;  1TW2 A;  5LEK A;  3B73 A;  1VTN C;  4OOI A;  2OU2 A;  3CCL I;  2M5W A;  1H9G A;  1QQI A;  2WBM A;  2VQL A;  2GXA A;  4IHV A;  3U1D A;  3GTP J;  1YS6 A;  3JW4 A;  3ZMZ A;  3DTE A;  1FSE A;  5H6R A;  4XLH A;  2DN0 A;  1HOM A;  3LL7 A;  4RLQ A;  3HKZ A;  4CYC A;  3H92 A;  3I3L A;  3SJM A;  4A6D A;  3PQK A;  3ASO H;  2VC0 A;  5EEH A;  1ENH A;  2ZBK A;  5CYV A;  2D2W A;  4OIO F;  3ASN H;  1YHQ I;  1BOB A;  3D5R C;  4A3F J;  3CLO A;  3ZQ7 A;  4KUM A;  4BEH A;  1VQ7 I;  3N97 A;  1VFC A;  3WGH A;  1WJB A;  5ED4 A;  4UVA A;  1YX3 A;  4HBL A;  1W1W E;  3JRH A;  2VN2 A;  3VOE A;  1T56 A;  3ZMD A;  5F0C A;  1H0M A;  5IYC J;  4ZTJ A;  2F4I A;  3M8F A;  3GLX A;  1LVA A;  2OA4 A;  4PJL A;  3JRE A;  3QRF F;  1V5G A;  3GO5 A;  2F4M B;  1FTZ A;  2XGE A;  4H0E A;  2R5Z A;  2W57 A;  2QBY A;  3PQJ A;  1RZ4 A;  5GP9 A;  3WTV C;  4XLF A;  3HTS B;  1XX5 A;  3IL2 A;  2XUB A;  5H2F C;  4PK4 A;  2M1B A;  4PJM A;  1RES A;  3ERM A;  4FCY A;  2PJP A;  2IBD A;  2HEO A;  4HX7 A;  2O0Y A;  4DBR A;  4DOZ A;  5CQG A;  4YRV A;  3OIO A;  2O9L A;  4XLN F;  3S16 J;  1FP1 D;  4BQN A;  2GLO A;  3G73 A;  1HQC A;  3KP7 A;  1HXD A;  3ZQI A;  1HKS A;  4A5N A;  2BXY A;  2JA6 J;  3WU2 C;  1ZQ3 P;  2K9N A;  1D0X A;  2MD5 A;  5CJ9 A;  3BZK A;  1HW5 A;  4UY8 I;  1ERD A;  3VYU B;  2DOE A;  4M3B A;  4MHG A;  1HKT A;  2EFO A;  1ETO A;  2Y0S N;  3GBG A;  1Z3X A;  3W2W A;  3CO6 C;  1VF9 A;  2K4J A;  2VE8 A;  3BTJ A;  1UST A;  3QYE A;  2GZW A;  1X3U A;  3LST A;  5J6X A;  1IGN A;  5ILU A;  3HC7 A;  3JRD A;  4XSX F;  1IRZ A;  1I5Z A;  1KU7 A;  1MSF C;  2RVC A;  1BM9 A;  3EUK L;  3EYY A;  2J5P A;  3MCZ A;  4BXX J;  3ONQ A;  3CQZ J;  2K86 A;  2RAE A;  5LGN A;  5AIP A;  1IXC A;  2UV1 A;  4A3C J;  4NQW A;  2ZME B;  4AYB N;  2V6E A;  1I6H J;  1LPQ A;  2E2J J;  3KLO A;  1MBG A;  1D0Y A;  2OV7 A;  4LG3 A;  3E7L A;  1RKT A;  3I59 B;  2EQR A;  3HB9 A;  2ECB A;  3BG5 A;  4JX6 A;  1FMW A;  1UG0 A;  3L2W A;  3DPT A;  3P7N A;  1E3P A;  1T39 A;  5ICC A;  2OQG A;  3T8T A;  2FBH A;  5IT3 A;  2IT0 A;  2FBK A;  4A3I J;  5FKO A;  3S17 J;  2ICW G;  2GOX B;  5ILV A;  4PJ0 C;  3FKI J;  3WG9 A;  4V19 K;  3KYD B;  2DK8 A;  3K4L A;  4XN3 A;  5D8K B;  1MMG A;  3KEO A;  3H1C A;  2TDX A;  2PEX A;  1DU0 A;  2IS4 A;  2O6G E;  1UHM A;  4XRS A;  4A6E A;  2E1C A;  2E19 A;  4YIR X;  4LD5 A;  4ASN A;  2CFO A;  1FOY A;  2OD5 A;  2DMQ A;  1ETQ A;  1J9I A;  2ZO4 A;  5FLM J;  3A03 A;  4HV5 A;  3G1L A;  3LOC A;  1Z7U A;  2EV0 A;  2H6C A;  2KT0 A;  4D5C A;  3S1N J;  3PUF A;  4ZC3 A;  5K1Y A;  2XVC A;  1R22 A;  2D1H A;  4M9S A;  4CYC B;  4U7D A;  1JUM A;  1K6Y A;  4ZJZ A;  2VQG A;  4YFX F;  1ZLJ A;  3FMS A;  5LD2 C;  3CCU I;  1J75 A;  3K2Z A;  1ZK8 A;  3LSG A;  2AO9 A;  4W97 A;  1QHH D;  3Q5F A;  4XID A;  4BEH B;  1I3Q J;  3CO7 C;  1LFU P;  2BZT A;  4CHU A;  1R5I D;  2JK3 A;  1O3S A;  1VQM I;  2PMZ N;  4E70 A;  2DXI A;  3JRB A;  2DOD A;  4A93 J;  2NXN B;  5F08 A;  3I64 A;  2QZ8 A;  4CCL A;  4R79 A;  3OYL A;  1S8N A;  3E5X A;  4UUT A;  3J7A O;  2XDV A;  2Z3Y A;  3V4G A;  2R5Z B;  1HSJ A;  1MZB A;  2QVO A;  2QBY B;  2CW0 F;  2QKL B;  3X2Q H;  1OCP A;  2PMH A;  3ZQL A;  4AWX B;  5CVV A;  1R71 A;  1KU3 A;  1X1B A;  2HVS A;  3R0A A;  2A69 F;  1UFM A;  5J40 A;  2Y69 H;  4A3D J;  3K4M A;  2D5V A;  5JVG F;  3GVA A;  3OMY A;  1VZ0 A;  1MBF A;  3FK7 A;  3VFZ A;  2R7U A;  5K7Z A;  3K1M A;  1YJN I;  1IXS B;  2CGP A;  1UAA A;  3RDI A;  1EKE A;  3BQY A;  2QYO A;  3BZC A;  1FC3 A;  1OIS A;  4PZJ A;  4EJT A;  4FAS D;  1ZEL A;  1JKP C;  4R8H A;  1PYV A;  3H9G A;  1EA3 A;  1MJA A;  3H36 A;  1A6I A;  2EIN H;  1JJ6 C;  2FNA A;  4YIF A;  3K1N A;  3TOB A;  1UCR A;  1YIJ I;  2K9Q A;  5IP7 J;  3GWZ A;  4B3X A;  1Z05 A;  1Y0U A;  2VPL A;  1X1C A;  1D8J A;  1G8X A;  1FY7 A;  1TWF J;  3TDZ C;  2XPV A;  4UB8 C;  3B02 A;  4Y17 A;  1OLT A;  2A3S A;  2DFE A;  4CCN A;  2VPR A;  2K4B A;  3RI4 A;  1B4A A;  4OU0 A;  2V26 A;  2CRG A;  2ZFW A;  3NAU A;  3V7S A;  3CP2 A;  3CJR B;  5EYR A;  3SZP A;  4G9Y A;  1FLI A;  2WC2 A;  3IH2 A;  2DA5 A;  2EFW A;  4NQW B;  2HOS A;  3I4M J;  4WXH A;  2R7O A;  3OV8 A;  3I58 A;  3ZQQ A;  4C3I J;  1ONV A;  1YW8 A;  5D6E A;  1R36 A;  1ZR2 A;  2OCE A;  4A3G J;  2JZY A;  3IRQ A;  4BE1 A;  5DS9 A;  2HQA A;  3DKX A;  1R4M B;  1WQ2 A;  1R49 A;  1YJW I;  4KMF A;  2TRT A;  1JGS A;  2QQB A;  3WTY C;  1K79 A;  2K9S A;  1HKQ A;  2JT1 A;  1Z3Y A;  3ABL H;  1JUS A;  2BY3 A;  5L3B A;  3JR9 A;  3CC2 I;  2KL4 A;  2HDC A;  1D1B A;  3Q3S A;  5F0H A;  4UV8 A;  2EIK H;  4P55 A;  2JA8 J;  2LF7 A;  4PCQ A;  4M73 A;  5E3N A;  3NWT A;  4PUS A;  4BHC A;  4KIG A;  3DCF A;  1IAW A;  2O61 A;  2NAZ A;  1BI1 A;  1V5E A;  2HOE A;  1LUJ B;  1KZH A;  4MGR A;  4P96 A;  2ETH A;  1SVO A;  4JQF A;  1RR8 C;  4KT5 C;  2EBI A;  5ICE A;  3HM5 A;  3S2H J;  4YFN F;  1ON1 A;  4ANJ A;  3HGY A;  2L5Q A;  2LKS A;  2Z16 A;  3FF5 A;  5C4J J;  4HYE A;  3K4N A;  4HZF A;  4ABZ A;  3TP3 A;  2LLK A;  1TBX A;  4CCO A;  5D6F A;  4CDG A;  4O5V A;  4DYR A;  3ABM H;  3RSN A;  2DO7 A;  2LDU A;  1KQ0 A;  4AID A;  1VQK I;  3M9A A;  1RR7 A;  4CH7 A;  2P81 A;  2X48 A;  4M6X A;  1LFP A;  3HRM A;  3E6B A;  3LQQ A;  1UHS A;  3TO9 A;  2IA1 A;  3OYM A;  3KYC B;  1KQ8 A;  1TT5 B;  5ILS A;  2ZXJ A;  3KFW X;  2D1V A;  4ESB A;  3BLY A;  1IXR C;  1XDS A;  1ZRF A;  1FX7 A;  5IY5 H;  1W0T A;  5FLX Z;  3NEU A;  3VSK A;  2DT6 A;  2KLO A;  3JAM K;  3F8N A;  1JXS A;  2HYJ A;  3CCS I;  3CCR I;  2RNJ A;  4BS9 A;  4RGS A;  2KJC A;  1X4P A;  3BR3 A;  1BA5 A;  2IS6 A;  1WJE A;  3L09 A;  2M87 A;  3C2H A;  5L3D A;  4HA8 A;  2CJJ A;  2LD5 A;  1WJA A;  1SD7 A;  1V3F A;  1GV2 A;  4BUP A;  1TQM A;  1A31 A;  2K3F A;  5CVU A;  2F5F A;  3S1R J;  4RLF A;  2KDZ A;  1YG2 A;  4A0X A;  5DM7 F;  3ULQ B;  3L7W A;  5HOD A;  1BW5 A;  1GV5 A;  2EIL H;  4HG2 A;  2L7Z A;  4O6J A;  3TW6 A;  2GM4 A;  1S72 I;  1SVM A;  3S3O A;  2COB A;  2M2E A;  5FKN A;  1JKO C;  1IDZ A;  2Y0S A;  3G2B A;  4DZJ A;  4Y4R A;  5FD6 A;  2DOF A;  1LFB A;  1YS7 A;  2VOD A;  4HNU A;  4L0Y B;  4B43 A;  1BIB A;  4CUG A;  1V5F A;  2F4O B;  1M1E B;  1S5L C;  3HHH A;  4HAM A;  3JRG A;  2DI3 A;  2IW5 A;  3CZ6 A;  1RRJ A;  2GIZ A;  2DT5 A;  3S32 A;  2BGC A;  4G6Q A;  4HDU A;  4ZTF A;  2EIJ H;  3TO6 A;  1TT0 A;  3W6J B;  3CMM A;  4XKC A;  4KNY A;  4E7S A;  3QOD A;  2ZNY A;  3ZMT A;  5B66 C;  2WY7 Q;  2X1E A;  1TWC J;  2OJE D;  1IC8 A;  3WE3 A;  4HQM A;  3CJQ B;  4KN7 X;  4KIF A;  3K4K A;  1QBJ A;  2Y30 A;  1XMA A;  2LG4 A;  5HLI A;  1WJF A;  3RQ4 A;  3V8K A;  1VQ8 I;  3LQR A;  3EUH A;  3CCV I;  3HOU J;  1G3W A;  2VOP A;  1ON2 A;  5L3G A;  3EUH C;  5JVT A;  2EFN A;  2PFB A;  4Y7N J;  3ZOB A;  2KRC A;  4XLE A;  2XPW A;  3MZY A;  1Z1D A;  3IWF A;  5FRO A;  3G3Z A;  1ZR4 A;  2IJL A;  1X3Z B;  3R0J A;  2P5L C;  3B6A A;  2V1D A;  3GFJ A;  4HOB A;  3J81 K;  4LLN A;  2OZU A;  1P4A A;  3S93 A;  5TRD A;  3S1M J;  2MG4 A;  4PDK A;  2GQQ A;  2M7B A;  1NK2 P;  4ZDO A;  1E2X A;  5IPA A;  4UVC A;  2JUC A;  3BR6 A;  1H9T A;  1ZTR A;  2L7K A;  2RNG A;  5M3F J;  2KMU A;  2E5N A;  1YOV B;  5IP9 J;  3RPU D;  2WV1 A;  4OWR B;  2R4G A;  3BZ6 A;  4DW6 A;  3VOD A;  2XGD A;  4XR6 A;  2XAH A;  4S05 A;  1E3O C;  2L9N A;  1W7P A;  2VIX A;  3V7R A;  4A2U A;  2OTJ I;  2LH9 A;  1FP2 A;  1VQO I;  4PGH A;  3UNG C;  5TIS C;  1F1Z A;  3FKJ A;  2BOL A;  3A02 A;  5F1J A;  3H9J A;  4KJZ A;  1LEB A;  3FM5 A;  3WTX C;  4HNV A;  1P92 A;  3K0L A;  4MFE A;  3NWS A;  4KDP A;  1PUE E;  3BRO A;  1HCR A;  3KP4 A;  4GCV A;  4XSZ F;  2FQ3 A;  3KLN A;  2E2I J;  3CES A;  1RNL A;  2DQR A;  1OMI A;  3SZG A;  3CLQ A;  3WTW C;  3S15 J;  1TLH B;  1D0Z A;  2LRE A;  5IOY A;  4IVN A;  2PMZ A;  2OUM A;  4DYQ A;  3RYP A;  2VKE A;  2JN6 A;  4G7O F;  4WX9 A;  3QYB A;  5ERI A;  3ZPL A;  1TWH J;  2EH3 A;  3CMA I;  3G1M A;  4IHY A;  2OBP A;  2RRE A;  4L18 B;  1J2X A;  3DKY A;  1MBH A;  1GVD A;  2CUZ A;  2RN7 A;  3C2B A;  1PDN C;  4N4O B;  1MDM A;  2JWT A;  3DFG A;  5DUK A;  4XQF A;  1D8K A;  2DA7 A;  2A07 F;  3TKY A;  3DTK A;  3DBL B;  4E7Z A;  2QEN A;  2DA3 A;  2XAU A;  3OR1 C;  1KQ9 A;  1DDN A;  2HQR A;  1OYY A;  1YTY A;  2NVT J;  2DOA A;  3HL2 A;  1A6Q A;  4BGD A;  1EJ9 A;  2KQR A;  3RKX A;  1U0J A;  3BWG A;  2QWW A;  2CG4 A;  4Y15 A;  4JYK A;  5E3L A;  4WWC A;  2DYR H;  2K27 A;  5F6F A;  3BCB A;  1ZN2 A;  4XLA A;  1B59 A;  1OPC A;  3MWM A;  3WHC A;  2Z2S B;  4NHJ A;  1WVR A;  5DCF A;  4DZP A;  4CA0 A;  5GTH C;  1T98 A;  1BW6 A;  3GXO A;  1R1U A;  3FXK A;  3M1E A;  1O7L A;  1X2N A;  2W82 A;  5KAF C;  4FX4 A;  4IQJ A;  4GXO A;  1ZH5 A;  2H1K A;  2EZK A;  4U88 A;  3LAP A;  1WGX A;  2CV0 A;  4ENM A;  1BR2 A;  4KT6 A;  4RAY A;  3MEX A;  5K7F A;  5HLG A;  3P9C A;  3GTJ J;  2CV2 A;  1A5J A;  2QEX I;  2LVS A;  2NVX J;  1WJC A;  4P9F A;  1N77 A;  1MMS A;  2B7E A;  2EZL A;  2HS5 A;  4A12 A;  3IAS 2;  1QRY A;  2Y2Z A;  2IA0 A;  3SDB A;  1HW1 A;  1CQT A;  3H3Z A;  3F6V A;  4UV9 A;  3BG6 A;  5M3M J;  3M7G A;  1Q1H A;  2V79 A;  5BPI A;  4OAY A;  3DU6 A;  5LRS A;  3AG3 H;  2DA4 A;  1G2H A;  3OL4 A;  4NB5 A;  3MKL A;  5JLW A;  3OS0 A;  4ETS A;  4E6K G;  3WTU C;  2LYC A;  4AIH A;  3I4P A;  3JSP A;  2R5Y A;  4G7Z F;  2NVQ J;  1QNT A;  1XSV A;  3HHG A;  4D9J A;  4GFB A;  3ABK H;  2GA1 A;  4XRF A;  2AS5 F;  3ZP5 A;  4M71 A;  5JR3 A;  3MN2 A;  3ZXS A;  3I54 A;  3I9V 2;  3PIO F;  3F8B A;  1S7O A;  5AIQ A;  1AWC A;  3HRU A;  4LIU A;  3OYN A;  5M5X J;  2MLG A;  2E2H J;  1TL8 A;  3ZCO A;  4IHX A;  2YU9 J;  1UMQ A;  1W5C C;  3ZRG A;  2Z33 A;  4XOT A;  1IRF A;  1USS A;  3VYR B;  4WXD A;  4RB2 C;  4EJO A;  1LJ9 A;  1XGO A;  4FHT A;  2R3S A;  1O4X A;  1W7P B;  5HNF A;  3BR0 A;  3BJO A;  2UXX A;  3VYS B;  5E3O A;  3KIO A;  3GYH X;  1XGM A;  2V1U A;  3R60 A;  3ECH A;  3IRR A;  2FOK A;  3K4C A;  2QSG X;  2IAI A;  4KFC A;  1IW7 F;  2LY2 A;  4IJA A;  2P4W A;  4KMU X;  3FHZ A;  1XSD A;  1AA7 A;  1BR1 A;  3KCC A;  4II3 A;  5BS6 A;  1JUP A;  2NVU B;  4X0G A;  1IJW C;  4L9J A;  1FIP A;  3ZMU A;  4Q47 A;  4ON0 A;  4AVP A;  1SAX A;  3L9F A;  4I6Z A;  4ZYD A;  1W7P D;  5HS7 A;  3LAJ A;  2XSJ C;  1WKM A;  1KYW A;  1U5T C;  3E3V A;  3K70 C;  2A5W A;  3CJN A;  3IC7 A;  2LRD A;  2P7C B;  5F1R A;  1SFO J;  1GXP A;  1WJD A;  3BR1 A;  4BJT A;  2DU9 A;  4M9Z A;  3OYH A;  2EB7 A;  1SC7 A;  2P0W A;  4IHW A;  5JLX A;  2HOA A;  2GIV A;  2XAS A;  4F3Q A;  3D5L A;  3HGG A;  1DPR A;  1FTT A;  4BL0 B;  4A3L J;  3V8L A;  4LB5 A;  2IS1 A;  2LR8 A;  3H35 A;  1W36 D;  3I4N J;  4QIW N;  4HW0 A;  2L02 A;  2M7A A;  3BP8 A;  4I01 A;  1MDM B;  5GTI C;  1J59 A;  1S7E A;  3E0J B;  5FGM A;  1HST A;  1F43 A;  3W2A A;  4WF2 A;  1IF1 A;  1YRN A;  2ZSH B;  1DU6 A;  1FMV A;  2P5V A;  2OAZ A;  1GHC A;  1MD0 A;  2L9V A;  1BJA A;  1ITY A;  3REO A;  1MMA A;  5DEQ A;  1JJ8 C;  4XKB A;  4JBA A;  1HA8 A;  1ZGW A;  4HF2 A;  3OYD A;  4AVZ A;  1D5Y A;  5E1Z B;  5F04 A;  3Q0W A;  2R7T A;  2Y9Z A;  3O6B B;  3I55 I;  1IDY A;  4XMY A;  4R1H A;  3IH3 A;  2QQA A;  4AD9 A;  1IZ1 A;  2KRH A;  3KEQ A;  3CTA A;  1VI0 A;  1WI3 A;  4M3E A;  4P1W A;  2LFB A;  3JRA A;  4IX7 A;  3DLL F;  3HSE A;  5HNH A;  4HLY A;  1WRJ A;  3CD6 I;  3ZMS A;  5GAG J;  4ZDP A;  2A6E F;  2R7W A;  2VJI A;  3W6K B;  1ETY A;  2FU4 A;  3K69 A;  2L01 A;  2QQ8 A;  2L0K A;  3TP0 A;  2RC4 A;  4B44 A;  3WU0 A;  4ENK A;  1I6X A;  2QCO A;  3PUB A;  5LFA A;  5BOX A;  3RCO A;  2LKP A;  1BL0 A;  2QF7 A;  3OYF A;  3DEU A;  1P4X A;  2F5E A;  3QOE A;  1P7J A;  1TW3 A;  1B8I A;  2YS9 A;  5K5O A;  2WA0 A;  4GRI A;  3JTH A;  3S3M A;  3MZH A;  4Z6Y A;  4V2G A;  1T0F A;  4OIR F;  1FOK A;  1J0R A;  1T0F C;  2X0L A;  1VQ4 I;  2R5Y B;  1UZC A;  5L3E A;  4ZH4 F;  1Q1V A;  1MSE C;  5KCM A;  4FTH A;  1GDT A;  3CUO A;  1Y1V J;  3LFK A;  4I0B A;  2JMW A;  5AON A;  4E7I A;  2LNB A;  4IXA A;  4NUB A;  1AOY A;  4CO8 A;  1SFE A;  4PFP A;  2CW8 A;  1QO0 D;  2FQ4 A;  4J19 A;  1L0O C;  4IPA A;  3HOX J;  1FBQ A;  2EA4 A;  3DF8 A;  1D3Y A;  2JSP A;  2IRF G;  3HSF A;  1MMN A;  2E60 A;  2H27 A;  1TP4 A;  2PJR A;  5F27 A;  1XN7 A;  2F48 A;  4M9X A;  3RZD J;  2HXO A;  1WCM J;  3VEP A;  4DGW B;  1LVK A;  3L2C A;  4EAT A;  2GAU A;  4MEY F;  4PFO A;  1SD6 A;  3COA C;  3FXO A;  3JAM Z;  1A36 A;  3GFL A;  1QZZ A;  4BHB A;  3T1B A;  3CF2 A;  4XOP A;  2BY2 A;  4ESF A;  3PSF A;  3ZN0 A;  2CS3 A;  1UHW A;  3A2K A;  4A3M J;  3LA7 A;  2XKP A;  3SEQ A;  3GTM J;  5J4V A;  1IN4 A;  2VBY A;  3QOP A;  1K4S A;  3BTC A;  4RAG A;  4CCM A;  3VDX A;  9ANT A;  2EFQ A;  3PIP F;  5DD8 A;  3BJ6 A;  1MND A;  1YW7 A;  1I27 A;  4C9Y A;  1YIO A;  4FT8 A;  1W5T A;  4E7L A;  5LHG A;  1SFU A;  4C2U A;  3R6S A;  2HYF A;  3K6G A;  2MSY A;  5FB2 A;  5B1A H;  3IHU A;  2YU3 A;  3SFZ A;  3NRV A;  4C3H J;  3HOS A;  4I09 A;  2DDA A;  2L9R A;  3C7J A;  1KYZ A;  1R58 A;  3ERE D;  2BW3 A;  4IKF A;  1P4W A;  3LSH A;  3K70 D;  2V1X A;  3ML6 A;  4IEJ A;  4CXF A;  3ZGK A;  1G3T A;  2NS8 A;  1YRN B;  1SAU A;  3BR2 A;  3BOQ A;  4M6V A;  2XB0 X;  3LSJ A;  3QWL A;  3OS1 A;  1YI2 I;  4KN4 X;  5HDK A;  2XRN A;  4BJ5 C;  3E5Q A;  2NS0 A;  3DBH B;  4CCJ A;  3HRS A;  2WAE A;  3AL0 C;  4F52 A;  4D7N A;  5M5Y J;  2MGQ A;  2JTV A;  1U8R A;  1XCB A;  3O8H A;  1X4O A;  2AHQ A;  4OMY A;  3PL8 A;  2RQQ A;  3WTZ A;  4AU7 A;  4DQ2 A;  2DA1 A;  2ZKZ A;  3CP8 A;  3LMM A;  3PM1 A;  4EJU A;  1LEA A;  3J81 Z;  1BI3 A;  2XAQ A;  5HDN A;  3FX3 A;  4D1Q A;  2L54 A;  2VUM J;  3ZMV A;  4FX0 A;  4RGU A;  4M3G A;  2GXG A;  2ESH A;  5DCM A;  4Z2Y A;  3FBI B;  2Y31 A;  2HI3 A;  2HPI A;  1HW2 A;  3O2P E;  2KP6 A;  2A68 F;  2W48 A;  3FIS A;  3D0S A;  3DEW A;  3HOT A;  5IYB J;  1D1C A;  4LGW A;  2X1C A;  1J09 A;  3K2A A;  3V8J A;  3QPT A;  4DIQ A;  1PUF A;  2VT2 A;  4V2F A;  3PJR A;  2PN6 A;  1B8I B;  4Q5S F;  1TNS A;  2IPQ X;  1FYM A;  3MVP A;  2MFZ A;  2DJN A;  2DTR A;  3DBR B;  3GF2 A;  3NQO A;  2JPC A;  1IV6 A;  1K61 A;  2ADU A;  2FJ1 A;  1MKM A;  3IWZ A;  5LLQ A;  3P9K A;  5JHU A;  3SQN A;  3ECO A;  1IN8 A;  3C18 A;  2AQE A;  3ELK A;  2JQ7 A;  3HUG A;  1TQI A;  1RIO H;  5KHD A;  4NC7 A;  4YG2 F;  1LE8 A;  2Z99 A;  2QUF A;  4XRM A;  3IP4 B;  4QWQ A;  4B4C A;  1QGP A;  4A0Z A;  4K2E A;  5LRR A;  3FWE A;  1K83 J;  2BBY A;  5FFX A;  3UKG A;  2H09 A;  5EEA A;  4YFK F;  1OJL A;  4GYI A;  2CWE A;  2FSW A;  2R7Q A;  3TW7 A;  2V1N A;  2YX4 A;  2ZJQ F;  4HV6 A;  3J7A Y;  3WU1 B;  3D5S C;  2XIG A;  3HKZ N;  4EM0 B;  2BY0 A;  4L9N A;  2PJR B;  5B5E C;  3JRC A;  4MFD A;  4DBQ A;  4KIT B;  2HQN A;  2EZH A;  1G3Y A;  3BCA A;  4FIS A;  3EDP A;  2M30 A;  2QLZ A;  2DT7 B;  1WH7 A;  2LSO A;  4OIQ F;  1DGW Y;  2B0L A;  4EVI A;  5D4R A;  3SXY A;  2M8G X;  1N78 A;  4AC0 A;  2MH2 A;  4Q48 A;  3UR3 C;  1ZRD A;  1WI9 A;  1XSX A;  2M45 A;  5DYM A;  3SZT A;  2Z1D A;  5IYD J;  3FIW A;  5H6Q A;  3T8R A;  2G7U A;  4X6A J;  3GCM A;  3BC8 A;  3WG7 H;  4E7K A;  2ESN A;  2R92 J;  2XGX A;  2FD5 A;  2XRO A;  2IS2 A;  1X3W B;  4BXU A;  1TNT A;  4A3K J;  4E7J A;  5J4Y A;  3O3K A;  2OQR A;  1XS9 A;  1XGN A;  3ABT A;  3HXL A;  3GW2 A;  3LSI A;  3MMY B;  4PJN A;  2HVR A;  1X1P A;  2ZXH A;  4F93 B;  1WFX A;  2OZ6 A;  1I1G A;  2EV5 A;  1JHH A;  3Q0V A;  1IO2 A;  3I5U A;  3F72 A;  2BW3 B;  3F23 A;  5GAE J;  1GVJ A;  1GXQ A;  1BC8 C;  2R7Z J;  1YW9 A;  4ITV A;  1FIA A;  3HEF A;  4XIC A;  2HPM A;  3F3X A;  5LHH A;  5FRN A;  3FBN B;  1NTC A;  2E5Z A;  5CLS A;  3FXJ A;  2BVM A;  4HX8 A;  1ZG3 A;  2MAB A;  1ZRE A;  2J5O A;  1B72 A;  1GLN A;  4AYB A;  4EEF G;  1NK3 P;  1JGG A;  3AL0 B;  3LSM A;  1T2K A;  2DYS H;  3U9G A;  2WAQ N;  1ZYR F;  1KU2 A;  4J01 A;  4H4K C;  4BE0 A;  4ESJ A;  1UB9 A;  3E6D A;  2ELH A;  5LGU A;  1WPK A;  1N75 A;  1FYK A;  3DKW A;  3HYI A;  5DUI A;  3AG4 H;  4BJ6 C;  5E17 F;  4CZC A;  1MBJ A;  2HXI A;  2VQC A;  3KZY A;  5CPR B;  5FKL A;  4B3A A;  5K5R A;  3FXR A;  4U0V A;  3AKZ A;  2Z5U A;  2A6H F;  2R7X A;  3M3Y J;  4BQQ A;  2PX9 A;  1ORK A;  1H8A C;  3RZO J;  2OC6 A;  2DK5 A;  1ZLK A;  1MW7 A;  5DCM B;  4HPQ A;  4RB3 C;  3OOU A;  1PP8 F;  2FML A;  3BTL A;  5J3L A;  4L5E A;  3S14 J;  2BVL A;  4M6Y A;  1ETV A;  4EJW A;  2WAD A;  2NVY J;  1R5G A;  3E5U A;  3QPL A;  2E7X A;  3OL3 A;  3QYF A;  2KHM A;  1SVL A;  2HKO A;  4D7M A;  1PUF B;  4AM3 A;  1S6L A;  4XNF A;  3BTI A;  2QKM B;  4P5O A;  3GZ6 A;  1EF4 A;  4I7H A;  1KGS A;  4QLC U;  2IA2 A;  3L2U A;  3KX2 A;  2XGC A;  1SFK A;  3E1S A;  3CME I;  1AHD P;  4HSR A;  5LBQ A;  3A4C A;  1B6A A;  2NS7 A;  5H20 A;  3L1P A;  3QPH A;  3K1P A;  4XBF A;  3HJE A;  3DTI A;  4FET A;  4RGX A;  4RS8 A;  5FD5 A;  3TDU C;  1LDD A;  1Y1W J;  1ODD A;  1EH7 A;  1XTA A;  2M4K A;  3W2V A;  3H5N A; 
#chains in the Genus database with same CATH homology
 3HUG B;  3FDY A;  3LFU A;  3TMO A;  5HNF A;  3VYS B;  4ZC3 A;  2LBF A;  3HPH A;  1X19 A;  3PNY A;  2K9M A;  3DPL C;  3K4C A;  1K6Y A;  4ZJZ A;  2L9S A;  2VQG A;  3LSK A;  4CCK A;  5HLT A;  2LY2 A;  2R7S A;  3VYT B;  1NG7 A;  5LD2 C;  2X6Y A;  2VKH A;  1AA7 A;  2CV1 A;  1BR1 A;  4II3 A;  3DPU A;  5KNL A;  3LSG A;  1QHH D;  4BEH B;  2Q1Z B;  4X0G A;  4JOM A;  4BQO A;  3S3N A;  1MMD A;  4YEL A;  4B47 A;  1DGR M;  2XSJ C;  2DXI A;  2JUG A;  1S9H A;  3K70 C;  2A5W A;  2LRD A;  3L2R A;  1X1D A;  4CCL A;  2KDO A;  4R79 A;  3OYL A;  1WJD A;  4BJT A;  2XDV A;  3OYH A;  2P0W A;  1R6R A;  1DQU A;  4Y33 A;  3M1C A;  2F6C A;  2QKL B;  1QHG A;  4F3Q A;  3D5L A;  4BL0 B;  3OR2 C;  3H9Q A;  2IS1 A;  1X1B A;  3H35 A;  1W36 D;  2HVS A;  2VJ4 A;  2M7A A;  1G59 A;  2M0M A;  2X85 A;  3E0J B;  1NG6 A;  3K4M A;  3W2A A;  3DQV C;  3OMY A;  4YEJ A;  1VZ0 A;  3OYE A;  2R7U A;  2ZSH B;  1UAA A;  4BXF A;  3RTR A;  2M3A A;  1IRX A;  1FMV A;  4N4N B;  4FAS D;  1ZEL A;  4RM2 A;  2V4J C;  4XKW A;  2CW7 A;  3OY9 A;  1MMA A;  1PYV A;  3H9G A;  1EA3 A;  2K9L A;  5HOO A;  3MKW B;  4XKB A;  4XM3 A;  1HA8 A;  3OYD A;  4AVZ A;  4BDZ A;  3F9K A;  4NC8 A;  4B3X A;  2R7T A;  2VPL A;  1X1C A;  1G8X A;  4U87 A;  3H0D A;  2WY8 Q;  3MD2 A;  4XMY A;  2I8D A;  1OLT A;  3OS2 A;  4CCN A;  4XL9 A;  2KRH A;  2WAF A;  2IGM A;  2KZV A;  2W1O A;  4NNJ A;  3MKY B;  4BDY A;  2V26 A;  4P1W A;  3CP2 A;  2MYS A;  3CJR B;  3PNT A;  4IX7 A;  5HNH A;  3OYB A;  3MKZ A;  3A1Y A;  4ZDP A;  2R7W A;  2VJI A;  4NQW B;  2R7O A;  3ZQQ A;  4B44 A;  3OWT A;  3PUB A;  1Y56 A;  5LFA A;  3RCO A;  4BE1 A;  3OYF A;  2HQA A;  3QOE A;  4PSX A;  3DKX A;  2WA0 A;  4GRI A;  3OYI A;  2CUJ A;  2W00 A;  3S3M A;  4RM3 A;  3HPG A;  1Z3Y A;  1T0F C;  3EPZ A;  3DU5 A;  2KL4 A;  2X1D A;  1D1B A;  4XLC A;  5CKT A;  2R7R A;  1LDK B;  5KCM A;  2UWM A;  2VAS A;  4PSW A;  3OIQ A;  2ZXI A;  4ZDL A;  3NWT A;  4PUS A;  2M4G A;  4E7I A;  4NUB A;  3SYT A;  1V5E A;  4PFP A;  2LY1 A;  2CW8 A;  4JQF A;  4XOR A;  2CMP A;  3KYL A;  2VXD A;  2VQH A;  3IAM 2;  2V9K A;  4ANJ A;  2JSP A;  4OAZ A;  2L5Q A;  3TL4 X;  1D1A A;  1MMN A;  2E60 A;  2Z16 A;  3K4N A;  4G6T B;  2PJR A;  3HG9 A;  4DGW B;  1LVK A;  2K3P A;  4CCO A;  1BR4 A;  4EAT A;  1DP3 A;  4PFO A;  2LBF B;  2MC4 A;  3U21 A;  2K5C A;  3RSN A;  3VSL A;  4IZZ A;  2IGK A;  4Y3O A;  3OYG A;  2O5R A;  3CF2 A;  4XOP A;  4CH7 A;  3OYJ A;  3PSF A;  1LFP A;  2CS3 A;  4HST A;  4F55 A;  3A2K A;  4II2 A;  3TBI A;  2LC2 A;  1W36 C;  3SEQ A;  2IXS A;  3OYM A;  1LKX A;  3K4B A;  3S8P A;  3BLY A;  3V42 A;  1Y6I A;  4ZYA A;  2JVH A;  4CCM A;  3PSI A;  4MLO A;  4QPQ A;  3VDX A;  4C2T A;  3AFH A;  1MND A;  3L2Q A;  3VSK A;  2DT6 A;  2KLO A;  4C9Y A;  3OYA A;  4QPO A;  2F5V A;  4BS9 A;  4E7L A;  2IGO A;  2VJ5 A;  1KON A;  1X4P A;  2JA2 A;  4LIT A;  2IS6 A;  4C2U A;  1T95 A;  1WJE A;  3K6G A;  3C2H A;  1WJA A;  4F92 B;  5JHF A;  4BUP A;  3IUO A;  3HOS A;  2XF5 A;  4RLF A;  3K4J A;  1X1A A;  2BW3 A;  5TGT A;  4IKF A;  3LSH A;  3K70 D;  4HG2 A;  4DJA A;  1UEL B;  3ZGK A;  4E4H A;  3N05 A;  3ZR8 X;  3S3O A;  1SAU A;  3OS1 A;  1E0E A;  4E7H A;  2Y0S A;  3G2B A;  2ZFU A;  2FUG 2;  2AQF A;  4Y4R A;  2X51 A;  2WB1 A;  4B48 A;  4BJ5 C;  4CCJ A;  2Q2E B;  4HNU A;  2WAE A;  4B43 A;  4J00 A;  2X6X A;  4CUG A;  1V5F A;  3AL0 C;  4F52 A;  2WAQ A;  3CZ6 A;  3EUA A;  3S32 A;  4BE2 A;  3DLA A;  4ZTF A;  1TT0 A;  3CMM A;  1X4O A;  4XKC A;  3FHN A;  3PL8 A;  2RQQ A;  3QOD A;  4PJJ A;  4AU7 A;  4E7S A;  2WY7 Q;  2X1E A;  4C30 A;  1YE9 A;  2XF6 A;  3C2G A;  3CP8 A;  3LMM A;  3H5A A;  3CJQ B;  3K4K A;  2V7F A;  2GOM A;  3H5R A;  4D1Q A;  1MNE A;  2LG4 A;  2HVQ A;  1WJF A;  2HNH A;  3RQ4 A;  2CH0 A;  3FBI B;  2W7N A;  3EUH C;  2HPI A;  2VJJ A;  2HU9 A;  2KP6 A;  2KRC A;  2HZD A;  4XLE A;  1TZL A;  3HOT A;  4IQ4 A;  1D1C A;  3SEZ A;  2X1C A;  1J09 A;  2E1M C;  5FRO A;  4RMN A;  4DIQ A;  3PJR A;  2VB6 A;  2UUZ A;  5CQE A;  3S93 A;  3PNV A;  2XF7 A;  2VL8 A;  1WJ5 A;  2M7B A;  4ZDO A;  2L2O A;  2MFZ A;  2WBM A;  5HVQ C;  2VQL A;  2L7K A;  2RNG A;  2KMU A;  2E5N A;  2AQE A;  3RPU D;  2XC7 A;  4OWR B;  2R4G A;  2JVG A;  4XR6 A;  3DTE A;  4XLH A;  5KHD A;  2L9N A;  4NC7 A;  2VIX A;  2HDW A;  1P9Q C;  2LH9 A;  4BAC A;  3LL7 A;  3IP4 B;  3M8J A;  4RLQ A;  3UNG C;  1Z21 A;  3HKZ A;  3FKJ A;  3I3L A;  2BOL A;  1Z7L A;  3H9J A;  2NOJ B;  4KJZ A;  2R7Q A;  2W4S A;  2V1N A;  3NWS A;  1BOB A;  3D5R C;  4XKV A;  2DCE A;  3J7A Y;  4BU2 A;  3D5S C;  4BEH A;  2PJR B;  1WJB A;  2ELJ A;  3CES A;  1YX3 A;  2VKD A;  3SZG A;  4DBQ A;  4KIT B;  3PFY A;  1D0Z A;  2LRE A;  4XON A;  4HEA 2;  2F4I A;  4ZTJ A;  2PMZ A;  1JI8 A;  2OUM A;  3BCA A;  2DT7 B;  3BG7 A;  4PJL A;  1DGW Y;  1V5G A;  4CSW A;  1N78 A;  3QYB A;  3UR3 C;  3DWL E;  4XN0 A;  4XLF A;  2RRE A;  2Z1D A;  2ZSI B;  3DKY A;  3BC8 A;  2CUZ A;  4E7K A;  4PK4 A;  4N4O B;  3K10 A;  4PJM A;  4XQF A;  3L2V A;  2R7V A;  3DTK A;  2IS2 A;  4E7Z A;  2MD0 A;  4E7J A;  2XAU A;  3OR1 C;  4DBR A;  4DOZ A;  5CQG A;  4YRV A;  3LSI A;  3HXL A;  3MMY B;  4PJN A;  2HVR A;  2DOA A;  4BQN A;  3HL2 A;  2ZXH A;  4BGD A;  4F93 B;  1WFX A;  4F91 B;  2KQR A;  1U0J A;  2X6W A;  3OYK A;  3BCB A;  3OIP A;  4XLA A;  1D0X A;  2BW3 B;  2Z2S B;  1PJR A;  1ERD A;  3VYU B;  3DEE A;  4ITV A;  2HPM A;  5FRN A;  4HNT A;  3GBG A;  1Z3X A;  3FBN B;  4LIV A;  2E5Z A;  3W2W A;  4CA0 A;  3QYE A;  2BVM A;  2W82 A;  4IQJ A;  2MAB A;  3HC7 A;  1GLN A;  4AYB A;  3AL0 B;  4HRI A;  3LSM A;  2CV0 A;  2VXZ A;  1BR2 A;  4KT6 A;  3EUK L;  4J01 A;  4H4K C;  4BE0 A;  3ONQ A;  4KIS A;  2CV2 A;  1N75 A;  2UV1 A;  2A6T A;  1WJC A;  1N77 A;  4BJ6 C;  4CZC A;  2V6E A;  3IAS 2;  2VQC A;  5CPR B;  3W3C A;  3SDB A;  3AKZ A;  3BG6 A;  2R7X A;  1D0Y A;  2OV7 A;  4LG3 A;  4BQQ A;  4OAY A;  3DU6 A;  2OC6 A;  3OL4 A;  1OR7 C;  1FMW A;  1MW7 A;  3KEY A;  4HPQ A;  1UG0 A;  3OOU A;  3OS0 A;  4E6K G;  3DPT A;  3L2W A;  5FRM A;  1QU3 A;  2LYC A;  2IGN A;  2BVL A;  2WAD A;  4D9J A;  2GOX B;  2E1M B;  3OL3 A;  3QYF A;  2KHM A;  3K4L A;  4XN3 A;  4XNF A;  1MMG A;  3ZXS A;  3I9V 2;  4U7B A;  2QKM B;  4P5O A;  4LIU A;  3OYN A;  3L2U A;  2IS4 A;  3KX2 A;  2LOO A;  1SFK A;  3VWB A;  3E1S A;  3OYC A;  4HSR A;  3A4C A;  1YX5 A;  3ZCO A;  3DTI A;  2DJI A;  4FET A;  3ZRG A;  2CFO A;  2VLA A;  2M4K A;  2KPM A;  4XOT A;  3VYR B;  3W2V A;  3H5N A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...