4DGWB

Crystal structure of the sf3a splicing factor complex of u2 snrnp
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
140
structure length
127
Chain Sequence
b'SRRDMEVIKLTARYYAKDKSIVEQMISKDGEARLNFMNSSHPLHKTFTDFVAQYKRVYSFTGQEIKKSKRTILDNCFERTQYWEFEKDKDREHDKLVELCKIQFAAIPWDKFTQVAKFDLEQMRLRR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Pre-mRNA-splicing factor PRP9
publication title Structure and assembly of the SF3a splicing factor complex of U2 snRNP
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Splicing
total genus 33
structure length 127
sequence length 140
ec nomenclature
pdb deposition date 2012-01-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF01805 Surp Surp module
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.790 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Arc Repressor Mutant, subunit A 4dgwB01
1UG0A 2DT6A 1X4PA 4DGWB 2E5ZA 1X4OA 2E60A 2DT7B
chains in the Genus database with same CATH superfamily
3KZYA 1W4MA 3F6OA 1Z77A 1I3AA 2CO5A 1DUXC 2H6BA 1FOXA 5GPAA 1I1SA 1KQ9A 4XICA 1BBYA 1P4AA 4ZYHA 1JGGA 1FTTA 1JTYA 2QQ9A 3BJAA 5GPCA 2CUZA 2MD0A 1D5YA 1U5TC 3CJQB 4EV0A 5LLQA 4XLEA 1AKHA 1P2FA 3H1CA 5KNLA 4P1WA 4PGGA 2BHZA 2WA0A 2EPFA 2UZKA 1UHSA 3TEDA 2CSOA 3CP2A 1TNSA 2V7FA 5LRRA 2I8DA 2DO7A 3C18A 5E8IA 5D5UB 3G71I 3O3KA 3TQNA 3FBNB 2EA2A 4A3KJ 2H8RA 4U0YA 2KRCA 2HDDA 3WTTC 2CW7A 5H20A 3HGYA 3OYEA 3C3WA 1SFEA 1O3TA 1HOMA 1X19A 3R6SA 3BZKA 5FKMA 1DDNA 2LH9A 1UAAA 5E3OA 4DYQA 2HNHA 3G4SI 1KU9A 3HRUA 2X1DA 2DA7A 4B8XA 3BR0A 3K69A 3RQIA 4E7SA 1XGMA 1GT0C 1LEAA 4BYYA 5CVIA 1SVMA 4I01A 4JOMA 5BMZA 4YELA 4CZCA 2HYGD 1BJAA 2P5LC 2P5VA 3ASOH 3RPQA 3HG9A 3KE2A 1J7KA 5HLIA 1RUOA 2D2WA 1R4MB 3DTIA 2E7WA 3T5XA 4YFKF 5H6RA 2DAOA 3ECOA 3IAS2 4NDLA 4GYIA 3CO6C 3RI4A 3K4BA 5FFXA 1U8BA 2CQXA 2HR3A 2XRLA 1JJ8C 2VI6A 3M8EA 1HSJA 1MNMC 1ETWA 1FSHA 2WAQA 1ZTRA 4IZZA 3F21A 2ESNA 2QBYB 2JRMA 1IG7A 4M3DA 1HA8A 2V6CA 2MGQA 2Y31A 4FASD 2HDCA 2PFBA 2CRGA 1NK3P 2JN6A 1EKEA 2A6EF 2DDBA 3FK7A 3BPVA 4LIVA 3HOZJ 4AU7A 3I56I 5FRMA 4GYGA 3DKXA 2Z99A 3OOUA 1VQMI 3A01A 2E5NA 2VJ4A 2R7VA 2YUSA 2L02A 1RESA 3BR3A 2ZNZA 2IGMA 2XPUA 3EYIA 3H35A 3G1LA 1V5GA 1YX3A 4PJMA 4JQFA 3Q0VA 5E3MA 1E3OC 3KP3A 4BQAA 4LLGF 5L3FA 1XGNA 1MMGA 4G6TB 4B4CA 4AYBN 4JK1X 1WJDA 4OOIA 1JUPA 1P9QC 2DFIA 3DPUA 1JT0A 1ZK8A 3CC2I 2JMWA 2ZXWH 1SMTA 5D5VB 2X1CA 4MTEA 1XCVA 2X6OA 1ZRFA 1WZ2A 2W25A 1I6XA 4A3JJ 2Q0OA 4ZYDA 5L3GA 4BGDA 1RETA 3BG7A 3HDDA 2JJ7A 1U5TB 1QQIA 5IT9K 4N4NB 5J8FA 4RGXA 1LFUP 1JGSA 1A31A 4LLNA 4BU2A 4QTRA 5FD5A 3DEUA 3ZQQA 2RGVA 3HPHA 3WODF 2GQQA 4G6DA 2QA4I 2EQRA 1R1VA 2E1CA 1SVOA 3SFIA 2ZFUA 2ZC2A 2MFZA 4M6YA 1GUUA 1SVLA 3J80Z 3Q9SA 1F36A 2HFHA 5BNGA 3BG6A 4F3QA 2M5WA 4E7JA 1K78A 1FYKA 5F04A 1YE9A 2VBXA 1ETYA 2VXDA 3OIPA 2IRFG 4ZJZA 4EGZA 2E60A 1JKOC 1YITI 3C2HA 5DCFA 1IZ1A 2K40A 1T33A 2FX0A 2IP2A 4HSTA 2OUMA 2VPRA 4L5EA 2ZMEA 3K4CA 5BPDA 1FP2A 4RAYA 3FXKA 2FOKA 4RB3C 4M9XA 1BI0A 2QVOA 5DD4A 1T38A 2L01A 1IXSB 2Y2ZA 1W7PA 5HDGA 5J6XA 4BDZA 3K4MA 1R9TJ 3WGGA 4A3LJ 2LY1A 4HRIA 1TT5B 2OQRA 2HOSA 3N05A 2F48A 3RYPA 1WJBA 3I59B 3T8TA 5M3MJ 3CCJI 5FO5A 3HSFA 1O3RA 1WJFA 1X1BA 2EFWA 1WH7A 2L4AA 3RCOA 1BA5A 1VQ7I 3I55I 4HNUA 3HSEA 3BP8A 2XF7A 5CVJA 4AVPA 4AM3A 3HRTA 1LDKB 1U6GA 2DFEA 5LEKA 5FKLA 5CVUA 2M7BA 3HYIA 3IV5A 4LB6B 1RPWA 5IOYA 4NHJA 2O9LA 2LY2A 2GIVA 4IO9F 3TO6A 3RPUA 2KQRA 3SEQA 2EILH 2GLOA 2TDXA 4LD5A 4I98B 1EH8A 2LLKA 4ENNA 3NQOA 2ETHA 4ENKA 2CUJA 2DQRA 1R49A 2Q2EB 2UXNA 1MBEA 1WJCA 3PUBA 4LJZF 3KEQA 4D7NA 1TWCJ 3L09A 4D7MA 3QPLA 1FZPB 9ANTA 3DXJF 1YQAA 2FA5A 1Y8QB 4HDVA 5IP9J 1B8IA 3K4NA 1VQ8I 2EFQA 2PQ8A 3FDYA 2OZ6A 4WXDA 1H9TA 4EJUA 1XG1A 4EM1A 4GXOA 1T8IA 1K83J 2EZHA 4BL0B 4KJZA 5DTDA 4KT6A 2R7RA 3ERMA 2DI3A 4ZDOA 4IL6C 3E5UA 4ETSA 3WG9A 3JREA 1IO2A 1D0XA 1HW1A 1MBKA 1Z3YA 2LNBA 3QP5A 3GFLA 4AD9A 1YJNI 2Z9OA 5DDGA 4U87A 1D8JA 3LSTA 4XKWA 3QYFA 1W0UA 2NRAC 2Q1ZB 3PO2J 3L00A 3PNVA 4V2FA 3H3VK 4CCLA 3GLLA 4IJAA 3HM5A 2XGDA 2HKOA 3LSHA 5H6QA 1B59A 1PVEA 2QZ8A 4CA0A 2YPRA 1A6IA 1RUNA 1ON1A 4BAYA 1HQCA 1XB4A 1RR8C 2PBIA 2NNNA 2RAEA 5LHIA 2XUBA 1U78A 4GO1A 2HQRA 2RKHA 1WJ5A 1X3ZB 1TWHJ 5J8CA 2EIJH 3J7AY 4CYCA 3W6VA 1ZGWA 2E34A 2GA2A 5E20A 2LYCA 4RGRA 2W82A 5E1XA 3BWGA 4BQQA 3ECHA 4EGYA 3V8JA 1IN5A 1HCRA 5E3NA 2QEXI 4WX9A 3OYMA 4KDPA 4XLFA 3KYDB 1JE8A 4QSHA 2E5ZA 1BJZA 2X6WA 3OYNA 3FXQA 2K3FA 3BG9A 1KONA 4XR6A 4C2MJ 2W00A 2Z5UA 2UWMA 2XSDC 4LITA 2JA7J 4FX0A 2DA1A 3ZOBA 3J7AO 2P7CB 3CUQB 4EMSA 4N9HA 3PM1A 5IYDJ 4UUSA 3J81K 5HLHA 4HX7A 2QKMB 1FBUA 2X1EA 4RM3A 3BT9A 1IW7F 2C6YA 1KGSA 3I54A 2XB5A 5CQEA 1I6HJ 2JSPA 1B9MA 3Q3SA 3WU2C 4L9NA 2CFOA 1TWFJ 3JRAA 5EYRA 1LPQA 1ZN2A 1HC8A 1OCCH 3KZZA 3LA3A 1OMIA 4XOTA 2W48A 1HKTA 4M3GA 3LNQA 3KETA 3Q0UA 2VODA 2DYSH 5LEJA 5BPIA 4XBFA 4BE1A 5FRNA 1R58A 4XRSA 3V4GA 4IHWA 3CDHA 3OR1C 1MH3A 4B3XA 5ED4A 1Y39A 3CESA 2DA3A 2FRHA 1IRZA 2ZJQF 4N9IA 1JKQC 2I5UA 1MZBA 4KN4X 3E0JB 1QGPA 3IRQA 4YFNF 5K5QA 4M3FA 4HF1A 2CV1A 1DPUA 2IS6A 3FHZA 2K4BA 2ICWG 4U7BA 1J9IA 1G3SA 2LP0A 1MSFC 3L9FA 2JK3A 4P9UA 4QPOA 1HXDA 3JRHA 3MWMA 3C2GA 1S3JA 3ZRGA 2BVMA 1HDDC 4HQMA 3FXJA 2VUMJ 1PP8F 3CMAI 1VQ4I 4TV7A 4CZZA 1UG2A 4DBQA 3K2AA 3JRCA 1QHHD 4UB6C 5EGOB 1PYVA 1YW8A 4J19A 2P6SA 3PFIA 3BJ6A 5FROA 2OD5A 3LFKA 2V1DA 1BN5A 1ZKGA 2HI3A 5IYBJ 2L5QA 1KZHA 1D1CA 3DU5A 3GTGJ 5AIPA 4MLOA 2N8GA 4WCGA 2CUFA 5ILSA 2BYVE 2IAIA 1LVKA 1PUEE 4BJTA 2XF6A 1X3WB 3Q0WA 1FBSA 2NVTJ 4B48A 4NBQA 1BR4A 5ERIA 5TRDA 5LHGA 1UCRA 4P9FA 1TWAJ 3L1PA 2YS9A 2XF5A 4A2UA 3P9IA 1FOKA 5LBQA 1VQ6I 1XMKA 3MZYA 1YO5C 1VQ5I 2K9QA 4NC6A 1MMDA 5KAIC 1L3LA 4LG0A 1YFHA 2JVGA 2NNYA 4XSZF 1BIBA 3D5LA 2KLOA 4PFPA 1QZZA 2VT3A 3WHBA 3FM3A 3EUHA 1X1CA 3ERED 4BNCA 1A35A 1LE8A 1FLIA 1DP3A 1OYWA 1R22A 4I09A 3UNGC 4DYCA 2HPMA 3RDIA 5HLTA 1NHAA 1B72A 4XKBA 1FX7A 5HODA 3FIWA 3HL2A 3PNYA 3S14J 4E7IA 2LTPA 4KMUX 2LG4A 3TP0A 4PSXA 5IP6A 2K9LA 3TDZC 2M30A 3HHGA 2A5YB 3T1BA 4NUBA 2LF7A 4II3A 5F1JA 1UB9A 4BQNA 1B9NA 2HOAA 1MIJA 5GAHJ 2DODA 1YIOA 4JYKA 2XAUA 1REPC 3BY6A 3M07A 2OPTA 3FX3A 4A5MA 2NS8A 2WAFA 3MN2A 5J3LA 2PMUA 1FIAA 1Y56A 3GLXA 2VB6A 3GW2A 3LFUA 4LK0F 3WG7H 2GAUA 2HEOA 2KIUA 4A3MJ 1D1AA 2MC3A 3EUAA 3KEYA 3S3NA 1IXCA 1G59A 4RB1A 3CCLI 2CWEA 3QOPA 1E0EA 3JAMK 4IF4A 1ETQA 1ENHA 5A2QZ 4BEHB 2W57A 4W1UA 2A3SA 3L2CA 2L9SA 2VN2A 4YEJA 1JHHA 3VDXA 1Z67A 3TDUC 1GDTA 5J40A 2ZO4A 5IPAA 5JVTA 3O8GA 2WC2A 1WFXA 4O6JA 1VZ0A 2O6GE 1QPIA 3SZTA 2X4HA 4XQFA 1HLVA 2BE5F 1B4AA 2L7MP 2MSYA 3HUGB 2KKOA 2WY8Q 2EZKA 4A5NA 3OS1A 2CGPA 2WY7Q 2HDWA 2NAZA 3IKTA 3EDPA 4BJ6C 1G6NA 3S16J 4GGGA 1OQYA 2BW3A 4G12A 2R7UA 2VE8A 2FBHA 3WTUC 3CO7C 1LVAA 2YU3A 2FE3A 4DZPA 3IWFA 1J59A 3S8PA 3MD2A 4RLFA 1S5LC 3OSFA 1GXQA 3C7JA 2IJLA 1ITYA 2BY1A 4ZZLA 3CJRB 3N97A 3F0CA 2R3SA 1T56A 4E70A 2VXZA 1LKXA 1PUFA 1ORKA 3MFKA 1Z1DA 2P81A 2IS2A 2OJED 2A69F 1OPCA 3OR2C 1SAUA 4RMNA 4C2TA 3IC7A 2XAJA 5D8KB 4FCYA 4Y52J 1R71A 1OFCX 1QVTA 2XAFA 4L9TA 2CMPA 3W2WA 1UHWA 3HJEA 4W97A 3FXMA 3DPTA 3G73A 3IHUA 4HAMA 1QHGA 4XONA 2K4JA 3RSNA 2K7LA 2P4WA 3P7NA 5ICEA 3F3XA 2X6YA 2DQLA 2QGUA 1P4WA 3FKIJ 3OOPA 3ZQIA 4DGWB 2F5FA 1T6SA 3U9GA 2LFBA 3ASNH 3QPSA 3ZN1A 3W2VA 5AIQA 2JQ7A 1MBHA 1R5GA 3CDIA 3LOCA 4J00A 4L5JA 1POGA 3DWLE 3BPXA 3I3LA 3BZCA 5EG0A 1BIAA 2Y0SA 3U2RA 2VBZA 2M0CA 1OISA 2VASA 3IH2A 2E1MB 4ZDLA 4CDGA 5B66C 5DM7F 3CMMA 2AQEA 3DEEA 3A0HC 1Z9CA 3HOUJ 2VOPA 1TT0A 1ON2A 3F9KA 2E19A 3K6GA 5J1YA 4U88A 4Y7NJ 2IXSA 1MDMA 4BBRJ 3BR5A 3DFGA 5FLMJ 1R5HA 5FLVA 1OCRH 1U8RA 1H89C 2MBFA 2FNPA 3VB2A 1SD5A 3MKZA 1X2NA 3ABTA 3FBIB 1UG0A 5E18F 2ZCWA 2R5ZB 2H1LA 2ZJPF 1USSA 4PGHA 3KIOA 3M4OJ 1BOAA 1YW9A 4RLQA 1DQUA 2BGCA 3R0JA 3LSIA 1ZGAA 4ZTJA 3NWTA 3TW6A 1D0ZA 1FTZA 3B73A 2FBIA 2Z3YA 1MNEA 2DYRH 1QA6A 2J5PA 3HPGA 1P92A 3R0AA 2ZMEC 1DU0A 4V19K 2M7AA 2K9NA 3E5QA 2MYSA 3VFZA 5KVRA 2KP6A 5D8LB 1IJWC 1EJ9A 2EV6A 4UXNA 1X2MA 2VBYA 4Z6YA 2BVLA 3MVPA 2H1KA 3LSKA 5GAEJ 1G8XA 3H3UA 4IPAA 1NH3A 5D5WB 1MW7A 4XLPF 4XKCA 5ICGA 1FWZA 4RS8A 2X6XA 2VKHA 4IHXA 1HDPA 4EEFG 2PX9A 2GOMA 1PJRA 1WRJA 5JHFA 3ZQCA 3LMMA 4H4KC 2GIZA 2LKXA 4ZDPA 1ZELA 1X4OA 5B5EC 2VKEA 4CXFA 5HNHA 1USTA 1XGSA 2JZYA 4WXHA 5B1AH 3ABKH 4BXUA 1KYZA 3HTSB 3D1NI 4EJTA 1T0FA 3BG5A 4II2A 1F43A 2LREA 4HDUA 2AHQA 2GOXB 2F5EA 2VLAA 5E8GA 3DBLB 4CGZA 3GZ6A 3SDGA 1U9NA 2L9VA 2V26A 1DU6A 3MKLA 4RAFA 3JRBA 3ZMDA 1N75A 3RKWA 2M9HA 3TKYA 2ELHA 3HBLA 3UKGA 1XSDA 2AXLA 2VQGA 2E1NA 4LLLA 1VNDA 3PL8A 1K4SA 3OV8A 3DLAA 1FSEA 2QWWA 3BTCA 3BZ6A 2QBYA 4QWQA 3OWTA 2BOLA 1DGRM 4HLXA 1QU3A 1JI8A 4I0AA 1WI3A 5DD8A 1TL8A 2MD5A 4H0EA 3DTEA 4DZJA 5M5YJ 3S1NJ 1Z21A 1K6OA 5DM6F 5AONA 4KFCA 3FM5A 2OTJI 4IRHA 1NG7A 1ZG5A 3K1NA 3IL2A 2VQCA 1VTNC 3C1DA 3TOBA 5C44J 1A36A 2V4JC 1O7LA 3CMYA 1FT9A 3CJNA 4OIQF 4RA2A 3M9AA 3CP8A 1SFXA 5D4SA 2V6EA 1X1PA 2DK5A 2DMPA 2EIMH 3DTKA 3QODA 1D1BA 3CCVI 2XVCA 5J1UA 5BOXA 4BHCA 3HEFA 1TW2A 3ZQ7A 6PAXA 2FUG2 1K78B 1MMSA 4DBRA 4B1RA 1IUFA 2IA1A 3FMSA 3ABLH 2Z1DA 3KCCA 1MH4A 3CMEI 3ZPLA 4OAYA 3WTZA 1H88C 4BXFA 1QPMA 4L18B 2R7TA 2PJRA 2CQNA 2ZMEB 2NYXA 3ROUA 2OCCH 1S7EA 4KNYA 4A3CJ 3VWBA 3FMQA 4UVCA 1QBJA 1DGWY 1FJLA 4FX4A 2IGOA 1KU2A 2JT1A 3GUDA 1W7PB 4JBAA 2KDZA 2EH3A 1SD7A 1STZA 3UR3C 2R7SA 5FKKA 5CYVA 2EFOA 2IA0A 2DMTA 4DIQA 2KPMA 4F91B 1OKRA 2XHKA 3QP6A 4DQ2A 4F93B 1IXRC 2DCEA 1XPXA 3GZNB 1VF9A 2CQQA 5EEGA 5F64A 1QO0D 2YX4A 5FGMA 3H9JA 2L9NA 1UJ8A 2X9DA 2ZFWA 2D45A 2EA4A 2F6CA 5F08A 4AIDA 3I64A 5H2FC 3H5AA 1P7IA 2STTA 3GTQJ 3ZQHA 2JSCA 1IRGA 2DA5A 3A2KA 2L3DA 4RGSA 2CJJA 3I4PA 2BXYA 3VEPA 4M72A 2QSGX 1XDSA 3BDDA 4Q47A 2QQ8A 4AC0A 2EZLA 3BOQA 4YFXF 1W7PD 1OR7A 1XSVA 1TC3C 3M3YJ 3F6VA 3WTVC 1X58A 2JA2A 4ESFA 3BTIA 3OYIA 2P7VB 2DDAA 1AHDP 3GTKJ 4RBOA 2FF4A 5IY5H 3AKZA 3OL4A 3ML6A 3J7YJ 2E7XA 1FMVA 1B8IB 1RZ4A 1U9OA 1X1DA 3ZMTA 3ONQA 1AOYA 2QSFX 1G3WA 2PMHA 1TBXA 3EPZA 5HS9A 1BI3A 1T95A 4DNCA 3PIOF 1CGPA 3NAUA 1GV2A 3OYHA 2WBMA 3ZN0A 1J0RA 3WE3A 3IP4B 3HB9A 2MC4A 1RR7A 1TW3A 2IEKA 4XLAA 5JVGF 5BS6A 3FZVA 3RPUD 3KP2A 4E7LA 2E36A 4C9YA 3ZGKA 3CLQA 2LVSA 3VYTB 1FYLA 2HYFA 4U0WA 4LFUA 5E79C 3MCZA 4HOBA 4A3DJ 1FNNA 4JX5A 2GXGA 5JLWA 3H9GA 2HVSA 5IT9Z 1XX5A 3IUOA 1R1TA 1S7OA 2BBYA 3HOVJ 4EATA 1BI2A 2OU2A 1ZLJA 2XGXA 4E7KA 1GHCA 4LG3A 2ZSIB 1APLC 3PUFA 3I53A 2DT7B 4UHTA 4B3AA 1W36C 2WWYA 3JRGA 2M8EA 1K79A 5EZGA 2QSHX 2VQHA 4ON0A 4AWXB 5GTIC 1J09A 2L54A 1QZEA 3ZMVA 3QPHA 3OYLA 1UZCA 4OIOF 3CJTB 2HVQA 3GYHX 4PUSA 3EUHC 1H8AC 2JA6J 2LMDA 1WWXA 3TW7A 4KIGA 1MMAA 3VPRA 4WWCA 1WJEA 2O8XA 2LOOA 4PCQA 2ELJA 2O0YA 4FETA 2K9MA 1LJ9A 1XGOA 4IRGA 5HDKA 5FLXK 1WGXA 2OTLI 3D0SA 4HZFA 4LB5A 1MBFA 4S05A 3CZ6A 1FPQA 2KHMA 1XTAA 4M9SA 2IA2A 4ESJA 3KP5A 1ZHFA 1ZARA 1PDNC 4B43A 2E2JJ 2R7OA 4KICA 1I27A 4KUMA 3SYTA 3WU1B 3W6KB 2ZB9A 4PSWA 2W84A 3GTMJ 2CW8A 3V7RA 2RN7A 2RNJA 5M5XJ 4D5CA 1ZH5A 2XDVA 2RQQA 4XSXF 4HV5A 3CTAA 3PSFA 2K02A 2WTEA 3ABMH 4F92B 2DOAA 1IF1A 1LFPA 2XAHA 2KJCA 3M7GA 3AL0C 3CUOA 3P5JA 3RTRA 3K4KA 3HOSA 1MD0A 2QUFA 3VOEA 1BC8C 5ILUA 5TJJA 2B0LA 3NRVA 3CUQA 2BZTA 2LBFA 1YRNB 2GXBA 3GFMA 3VODA 3K70C 3CC7I 1WPKA 4X0GA 4A3IJ 1F4KA 2VT2A 2CU7A 1ZG3A 2PMZN 3OYBA 2R7FA 4KT5C 1EH6A 2MLKA 4ZYAA 5CLSA 2FMYA 2GA1A 2Y0MA 2VIXA 2WB1A 3V42A 4Y4RA 5L3BA 2WADA 2FQ4A 1E3PA 2CFXA 3W2AA 1GVDA 3LWFA 4YIRX 2QCOA 4FHTA 5KK1A 2DA6A 4M73A 4U0VA 3ELKA 4I7HA 2X0LA 5DV5A 4BHPA 5EEHA 2LC2A 3SXYA 5C3EJ 1HW2A 4XORA 4KISA 3AG2H 2O5RA 4FQGA 2ESHA 2E2IJ 2EB7A 2FSWA 5EDNA 2HWVA 5M3FJ 3JSPA 2E2HJ 3M1CA 2TRTA 4C3IJ 3M1EA 2IVMA 5DEQA 2IGKA 3JSOA 1FEXA 4EM0B 4B47A 3M8JA 2M1BA 3K10A 3COAC 4DW6A 1BW5A 4O5VA 1YJ9I 3MMYB 2XV4S 4XKVA 4Z2YA 3FXUA 5EF6A 1N25A 3BG3A 2O3FA 3E6CC 4C3JJ 1CF7B 1LQ1A 1JJ6C 2LKPA 5EGOA 2CYYA 1XDUA 3BCAA 5HS7A 3OL3A 4A3GJ 4PJ0C 2JVHA 1VQPI 4LG0B 2FU4A 4D5FA 2Y75A 1E3HA 1XMAA 4IVNA 4EJVA 1T2KA 2M0MA 5HOOA 2GM4A 2YX7A 1ETKA 5HS8A 2F2EA 1SD4A 1SFKA 3TGNA 4G7OF 2IPQX 5JFRA 1LE8B 3Q9VA 3HOYJ 2UV1A 4UVBA 3EQLF 1Z05A 1WCMJ 1U0JA 2PG4A 3E3VA 3WE2A 1R5ID 3L2RA 3FK6A 2XGCA 4HW0A 1T98A 3A4CA 1W36D 4WXCA 1Z3XA 2KDOA 2PI0A 3FKJA 1L0OC 2W7NA 1YIJI 2BY0A 2KJBA 4JX4A 3J81Z 3R61A 4BHBA 4MIMA 1R7JA 2P0WA 5D5XB 3FXRA 2K5CA 4PK4A 2F5VA 3MZ8A 1NG6A 3JTGA 3PQJA 2FQ3A 4A0YA 3D5RC 3K2ZA 2BV6A 3S3MA 4OWRB 3LQQA 1O3SA 1SFOJ 3KP4A 4ANJA 2ECCA 3AL0B 3HTUA 3R4KA 3VYUB 3I9V2 2A5WA 2JUGA 2PMZA 1LEBA 2HPIA 1AWCA 3OYAA 4A3EJ 1Y1WJ 2P5KA 3U1KA 3T0YA 1MJBA 2FD5A 4MTDA 1LB2A 2Y0SN 1J2XA 2QLZA 3WHCA 1TZLA 4KN7X 4UUVA 2M45A 3CQZJ 4OMZA 3V7CA 4BKXA 2B7EA 1QNTA 2JTVA 4OMYA 1IDZA 5EJCA 3BJOA 4C2UA 2MW8A 3HC7A 1W1WE 1S8NA 3ZXSA 2DLLA 1QVUA 1TQMA 4OAZA 1TP4A 1OLTA 1J5YA 2JPBA 2R93J 2NVYJ 2DOEA 1WKMA 4ZTFA 3RQ4A 2ECBA 1W5TA 3JR9A 2O8KA 2R4GA 5GADJ 4RB0A 4P96A 4UY8I 4BUPA 3QOEA 2YR2A 1FOYA 1MKMA 1S6LA 3LSGA 4U7DA 2DT5A 2OCEA 1IRXA 3VYRB 3VSLA 1ZREA 1DP7P 3KZIC 1HW5A 2AS5F 1VQNI 4N4OB 2JUCA 5DUIA 2MG4A 2VKDA 3BTLA 2BW3B 4GFBA 1BOBA 2E35A 3F8MA 2V9KA 4IXAA 3K70D 1V5EA 1XSXA 3CF2A 3N4MA 4HF2A 2VOOA 1XD7A 4IHSA 1RC9A 4EM2A 1K4TA 2DBBA 4M6VA 4FE7A 1YS7A 3L2WA 3D5SC 4GDFA 3W3CA 4E4HA 1PUFB 2B63J 2ZXJA 4GRIA 4KIFA 1T0FC 1IV8A 4AIKA 3JW4A 3QQAA 2P6TA 5LGUA 2KMUA 2DA2A 2IGNA 5DS9A 2V9VA 2R5YA 3LAPA 3ZMZA 3AAFA 3G1MA 1S29A 2XRNA 4ENJA 5CKTA 4ZH4F 1JKPC 1MBGA 2V1UA 1T39A 2RQPA 1UHMA 5DCMA 3O8HA 2ACJA 3OYDA 3DCFA 2W1OA 4A3FJ 4BBSJ 4UV9A 4G8XA 3WTYC 3C2BA 3KYLA 1ZLKA 2LDUA 3OYGA 4NQWB 1ZYRF 3FISA 1LFBA 3V8KA 4WK8F 2ZBKA 4CUGA 1S72I 2DOFA 3G1OA 5EEAA 2EK5A 4Y17A 4G6QA 2UUZA 4XRSG 2XSJC 2X51A 3ULQB 5HDNA 5EG0B 1ZQ3P 2OBPA 4Y3OA 3I71A 1K6YA 2MA3A 2Y30A 3QU6A 5ICCA 4MQ9F 3H36A 4PFOA 4XLHA 1JT6A 4M74A 2HQ5A 5HVQC 3PNTA 1SFUA 2BHYA 2GZWA 1AKHB 2LR8A 2MLGA 2DU9A 2RC4A 3KFWX 4S04A 2NVQJ 4PJJA 3F8BA 5JR3A 3IH4A 2DMUA 2M4KA 1MGTA 3S17J 1R4NB 4A6DA 3F23A 1Z7LA 1Z91A 2K86A 2BXZA 1A5JA 3MAJA 4E6KG 5GTHC 5K7FA 1BL0A 5D4RA 2PJPA 3ZQFA 5LHHA 1I39A 1KU3A 5GP9A 3DPLC 3GWZA 4E7ZA 3WTSC 2IT0A 1BR2A 3HOXJ 3JAMZ 2EFPA 3P9KA 3E5XA 4ZYGA 4MHGA 2KIFA 4FTHA 3CC4I 1ACIA 1YLFA 4XLNF 1J75A 3J80K 3U21A 1IN6A 1V5FA 4ENMA 2D1VA 3HGGA 5K5OA 5KAFC 3ZP5A 4XN0A 1X4PA 2DK8A 2VJ5A 3I4MJ 2VPLA 2R5ZA 3OSGA 1ETXA 1ZAOA 3J7ZI 2A68F 3HOWJ 3G6EI 2BY3A 1LUJB 2KISA 2L7ZA 2OA4A 1F5TA 1TLHB 3O2PE 3RKXA 5LRSA 1XS9A 2CV2A 2E1OA 1R1UA 1P6RA 3LSJA 2G9WA 3FWEA 4PZJA 4FT8A 3PFYA 4IQ4A 4M6XA 4KYWA 3BCBA 3E6MA 1YS6A 2EBIA 3H0DA 3GBGA 1I3QJ 4G94A 4ESBA 4FISA 2QKLB 4IOCF 2D1HA 4QLCU 1XCBA 2K9SA 1HKSA 4XLCA 5JLXA 3WGHA 1VFCA 1AA7A 1B1BA 4IEJA 5LGNA 3TMOA 2EWNA 1IC8A 1ZRCA 2LK2A 2LRDA 2IS4A 5IOZA 2DXIA 3TO7A 3E97A 2M8GX 1TWGJ 4GCVA 2FEZA 2NOGA 1OR7C 1S9HA 2XPVA 3FHNA 3K9TA 2CQ7A 3ZQGA 1SANA 1ZG1A 2Z2SB 4B44A 2VJJA 2W85A 4IX7A 3B6AA 2QQAA 2F4OB 1ETVA 3A01B 3A0BC 3MZHA 2JWTA 4CCKA 4CH7A 1Z7UA 2FBKA 3S1MJ 3BQYA 1FBQA 1G4DA 3I4NJ 2R7XA 4BQOA 2PEXA 3V8LA 1WVRA 3AG1H 2VONA 1SC7A 2HTSA 4HSRA 2JRTA 1WI9A 2A07F 3BR1A 3LSRA 4L9VA 1HSTA 1Q1VA 4CHUA 2G0EA 4P55A 4XK4A 3GCMA 5EZHA 4OINF 3A02A 3S32A 2V79A 4AIHA 5M5WJ 3REOA 4LIUA 3CLOA 4N0BA 3QPTA 4G7ZF 1KU7A 1VI0A 5C4XJ 2HZTA 1UELB 1KYWA 2HGCA 3DQVC 2BEOA 4R79A 4M71A 4M3BA 2DFFA 5JI6A 2OV7A 1OJLA 1QRYA 3F8CA 5E1ZB 1OCPA 3QRFF 4L5IA 4PJLA 2ME6A 5D6EA 1XN7A 2LD5A 2CV0A 1FIPA 1ONVA 2CW0F 2L7KA 1V54H 3EUKL 5K1YA 1O57A 4DYRA 1MNDA 4M9ZA 1EH7A 2XAGA 3VSKA 4R8HA 3HRSA 4MO7A 4UV8A 5F1RA 4EQQA 3GTPJ 3IWZA 2FMLA 3KPHA 2HTJA 4CICA 2GXAA 1GV5A 4AVZA 2DMQA 3MEXA 2ZKZA 4NNJA 3RIRA 2CH0A 3BLYA 1YX5A 2PJRB 1IRFA 1P7JA 3GFJA 1U5TA 3LL7A 5K5RA 3OYJA 4IHYA 3WTWC 1CQTA 5B1BH 2QENA 3GX4X 2LY9A 3GXOA 3GEZA 1ODDA 4QIWN 4EVIA 2FJ1A 2HZDA 4BH9A 1UMQA 4F7ZA 2Z33A 3CF5F 4XOPA 2VC0A 1E2XA 3JRDA 1W5CC 4L0YB 3U1DA 2F5DA 4CO8A 3Q5FA 2DTZA 2JA5J 2XKOA 2HXOA 2DJNA 4BACA 2WV0A 1G3TA 2M4GA 4C3HJ 1R36A 3I0TA 3CCQI 2D5VA 3E6DA 4XIDA 3CCSI 3AG3H 2CQKA 1BW6A 3BC8A 3BQZA 3K0LA 2KRFA 4QPQA 2Y9ZA 1D0YA 4RB2C 2GBYA 5KHDA 2QM3A 4XNFA 3S1QJ 3K1PA 3DBRB 3F8NA 4BS9A 4HYEA 1N78A 4AIJA 2H27A 3OYCA 2OQGA 2XIGA 3QWLA 3NWSA 4CCJA 3I5UA 2OZUA 4UNOA 3P9CA 1HBXG 3DU6A 5FJ8J 3SJMA 1ZGJA 4NC7A 5IT3A 3R60A 3A03A 2L7FP 3SEZA 3RZDJ 3KX2A 3CUQC 2QQBA 3I59A 3F8FA 4MNUA 1IGNA 2M34A 2DPDA 3ISPA 1BM9A 4O3MA 5TISC 2M87A 3TOAA 2RREA 3SFZA 5E3LA 4OU0A 4LK1F 5F0CA 1U2WA 3W6JB 1QZYA 1VQOI 3ABUA 4PJNA 5FB2A 4HA8A 2XPWA 2COBA 2NS7A 3BROA 3NEUA 3OIOA 4IHTA 2F4MB 2I10A 2STWA 2VKVA 1R00A 4AYBA 4R1HA 1XMXA 4A3BJ 4BXXJ 2G7HA 4ASNA 2AXTC 2EV5A 2FNAA 2HXIA 3MKYB 4HQEA 2BY2A 4MEXF 4MFDA 4Y33A 5LGTA 1TTYA 2FOWA 2G7UA 3H9QA 5CPRB 4ITVA 2R7DA 3S1RJ 2WB1N 4A93J 2A61A 2Q2EA 4Q48A 4JX6A 3QYEA 3LA2A 5TGTA 4KITB 3L2UA 3CCYA 3M8FA 3ZCOA 1W0TA 4HX8A 2IBDA 3SDBA 1H9GA 3GZ5A 2MH2A 1LNWA 5LFAA 4L0ZB 1YG2A 3FXOA 2ZSHB 2H8WA 2QF7A 2E71A 2KL4A 1FMWA 2IW5A 1YI2I 1YW7A 1O3QA 4M3EA 2ELKA 2UXXA 3GFIA 3HOTA 4L9JA 2RNGA 2RDPA 2V1NA 4ABZA 3AFHA 3KYCB 4UB8C 5E1WA 2F5CA 3T8RA 1OCZH 2ISYA 3JRIA 2CS3A 2YSRA 4IQJA 2R7ZJ 2XKPA 3H5NA 2XROA 3OS0A 2KZGA 4CYCB 4V2GA 5C4JJ 3RKQA 2W24A 3OYKA 2PN6A 4BY7J 4A69C 4A0ZA 2DJIA 2ZXHA 1Y0UA 4IOAF 1Z6RA 1SAXA 1WHUA 2JPCA 2ZJ2A 3PIPF 2EZIA 1EV7A 3LSPA 2O7OA 2KIMA 1OYYA 3LAJA 2L0KA 3WGIA 3FMRA 4MGRA 1I1GA 4P5OA 2L9RA 1RI7A 1V3FA 4AUXA 4JP0A 1MSEC 1UFMA 3K1MA 4YIFA 5GAGJ 3KP7A 4IRIA 4UUSB 3S93A 5DYMA 2COMA 4HX4A 4BJ5C 3S2DJ 1JXSA 4G7HF 3JRFA 4I6ZA 4HPQA 2XASA 4YIIA 2WV1A 2EV0A 1W5SA 1GLNA 1WQ2A 3LSMA 4CCNA 1R6RA 3HZJA 4I2OA 1ZRDA 1LDJA 1SD6A 2XC7A 4XL9A 5F27A 5FD6A 3GTLJ 4YRVA 2VE9A 4BY1J 1V55H 1F9NA 1T08B 1RKWA 2H94A 4D1QA 3H0GJ 4XM3A 2V1XA 3LA7A 2LBFB 1RKTA 3S2HJ 4CCOA 2TCTA 1ERDA 3TL4X 2YU9J 2RVCA 1OCTC 1MMNA 3HIFA 4S0HB 4NC8A 4LOCA 3PQKA 1AU7A 5E17F 5LD2C 1RIOH 2HVRA 1FC3A 1S7AA 2B9SA 4BDYA 3I58A 2MABA 3BR2A 1O7FA 4BE0A 3S15J 2ID3A 1Z0XA 3IKVA 3B02A 4A6EA 1YHQI 5K7HA 1MBJA 1OCOH 5DUKA 2R7WA 3PSIA 3GTJJ 5CVVA 2M2EA 5A2QK 3KLNA 1R23A 2DA4A 4Y15A 1IAWA 5HLGA 1YRNA 3CCUI 3PJRA 2DT6A 4WF2A 3EETA 2KRHA 1IN4A 4MFEA 3L2VA 3DP7A 1Y6IA 1JHFA 1X1AA 3CDLA 3AG4H 1KQ8A 4Y13A 2PLYA 4X6AJ 4HBLA 2A6HF 5KCMA 3L7WA 1X3UA 4EJOA 3G3ZA 1G3YA 4RAGA 4HNTA 2R0QC 1TNTA 1PP7U 1FYMA 4I76A 1EA3A 2EINH 3BR6A 3FF5A 3SZGA 1WSUA 1M1EB 4E7HA 5L3DA 1WJAA 4OIRF 2R7QA 1ZR2A 3OY9A 2XB0X 3DKYA 1YTYA 2F4IA 1D5VA 2ADUA 2DW4A 1BR1A 1NTCA 2VBWA 3ZMSA 1KA8A 1IN8A 4PDKA 1U3EM 3F72A 3KEOA 2ISZA 4NB5A 3S3OA 1MJ9A 3A1YA 3S2WA 2EJRA 2ZXIA 4D0PA 2K3PA 1WH5A 4Q5SF 1MJAA 2QYOA 2HU9A 1FP1D 2HYJA 4MEYF 1EF4A 1YYVA 3DLLF 3GO5A 4XN3A 4XRMA 1B72B 2O03A 1CF7A 1GXPA 1ULYA 3HHHA 4IHVA 4Q4ZF 4HNVA 1KQ0A 5FLXZ 1SMYF 4KIBA 1NK2P 3F22A 1Y0NA 2CG4A 2KIQA 1HKQA 2VQLA 2XAQA 1TQPA 1VQKI 2NVXJ 2XGEA 3B6CA 1K7AA 1Z6TA 1I50J 3H3ZA 2P8TA 3LQRA 1V4RA 3E1SA 4LMYA 2L2OA 3H5RA 1JUSA 2VC1A 5ICFA 3L2QA 3E7LA 4D9JA 1E17A 1YOVB 1RNLA 2K27A 3KLOA 4G9YA 3OIQA 3GTOJ 3K4LA 3OYFA 4F52A 2JA8J 2HQNA 1LDDA 3HXLA 2Q8KA 1VQLI 3WTXC 4I02A 1FY7A 2A05A 2LSOA 4I99C 3SZPA 3MKWB 4BE2A 3PO3J 2AO9A 3G2BA 4C30A 4ZYEA 5L3CA 2HQAA 5IYCJ 1H0MA 1Y8RB 1Q1HA 4K2EA 4A0XA 4J01A 2H09A 2VJIA 2Z16A 2HOTA 4RAZA 4HEA2 1G2HA 1XC5A 1IN7A 4CYDA 1YJWI 2E1MC 3HKZN 5CVRA 3CCRI 1BI1A 5J4YA 4OIPF 4UUTA 4RM2A 4CCMA 5HNFA 2J5OA 3FXLA 1P4XA 2LKSA 2OC6A 3O6BB 2HKXA 1FOWA 4XRFA 1Y1VJ 4HV6A 1D3YA 2NS0A 5D6FA 2CUEA 4IKFA 4X1EA 2HOEA 2MH9A 3E6BA 2WAEA 1HF0A 1JKRC 2W4SA 2NXNB 3V7SA 5F0FA 3GF2A 2H6CA 3DBHB 2K85A 2DFHA 3GVAA 2ME0A 3JTHA 2NVUB 4BEHA 3EYYA 3IRRA 1OYIA 4EJWA 2KFDA 1C0WA 4UVAA 3SQNA 5F0HA 3DV8A 3KP6A 1A6QA 1F1ZA 5IP7J 1JUMA 2DPUA 4DOZA 3QYBA 2FXAA 5BQTA 4YG2F 4RGUA 1BC7C 5F6FA 1ZR4A 2NOJB 5CQGA 3K4JA 4F55A 5B3SH 5FFZA 4DJAA 3HUGA 2R5YB 4A12A 4HF0A 5K7ZA 1VQ9I 2L4MA 1A04A 3VYSB 3NARA 3X2QH 2ID6A 2ZNYA 3WU0A 3IH3A 5DCMB 1O4XA 3DEWA 2KT0A 3HRMA 3JCUC 4LGWA 4ZZDA 3GMEA 1K61A 4FE4A 4MQVA 3DKWA 3CCMI 3CD6I 4HLYA 2EFNA 2Y48A 3SHFA 1N77A 4XMYA 3BTJA 1I5ZA 4ZC3A 2OAZA 2X48A 3IAM2 3OS2A 3MQ0A 3H92A 1IUYA 3TP3A 2OF7A 2Y9YA 3ZQLA 3K7AJ 1TQIA 3ZMUA 2HS5A 5J47A 2DTRA 5JHUA 1IV6A 3ESWB 2M3AA 3DF8A 5L3EA 3CCEI 4CSWA 3TBIA 2R92J 2VL8A 2GWRA 2X85A 5J1RA 3RZOJ 3QU3A 3RJPA 3ZR8X 5FKNA 5J4VA 1B6AA 2AQFA 2WAQN 3RKYA 1D8KA 1DPRA 4KA4A 1JTXA 3QAHA 2RV8A 3OMYA 2DMNA 2KZVA 5ILVA 1GVJA 1IDYA 4RDUA 3TO9A 5CJ9A 2V9PA 4I0BA 4KMFA 1ETOA 2O61A 5FKOA 1MDMB 2LF8A 1RRJA 4NQWA 3HKZA 4B09A 3RYRA 4HG2A 2A6TA 2DN0A 2Y69H 3HSRA 1SEUA 2IS1A 2EIKH 2ZJRF
chains in the Genus database with same CATH topology
4NNJA 5HLTA 2HVQA 2CH0A 3BLYA 4PUSA 3EUHC 1YX5A 4XKBA 2PJRB 3OYJA 3LL7A 3HL2A 3PNYA 4E7IA 1MMAA 2LG4A 1WJEA 4PSXA 2LOOA 2ELJA 4FETA 2K9LA 2K9MA 2CUZA 2MD0A 4NUBA 2HZDA 3CZ6A 3CJQB 4II3A 4XLEA 2KHMA 4BQNA 5KNLA 4P1WA 4XOPA 2WA0A 2XAUA 4B43A 2R7OA 3CP2A 2V7FA 2I8DA 2WAFA 3SYTA 4PSWA 4BACA 2M4GA 2CW8A 1Y56A 3FBNB 2VB6A 3LFUA 2XDVA 2RQQA 2KRCA 2CW7A 3PSFA 1D1AA 3OYEA 3EUAA 3KEYA 3S3NA 1G59A 4F92B 3BC8A 1X19A 2DOAA 4QPQA 1LFPA 1D0YA 2LH9A 1UAAA 3AL0C 1E0EA 3RTRA 5KHDA 3K4KA 4XNFA 3HOSA 4BEHB 4BS9A 2HNHA 1N78A 3OYCA 2L9SA 2X1DA 2LBFA 3NWSA 4YEJA 3VDXA 4CCJA 3K70C 3DU6A 4E7SA 4X0GA 4NC7A 3SEZA 1WFXA 3KX2A 3OYBA 1VZ0A 4JOMA 4YELA 4CZCA 4ZYAA 4XQFA 3HG9A 2VIXA 2WB1A 3V42A 4Y4RA 2RREA 2WADA 3HUGB 2WY8Q 3OS1A 3W2AA 4PJNA 2WY7Q 2HDWA 3DTIA 4BJ6C 3IAS2 2BW3A 4KISA 2R7UA 2LC2A 3K4BA 4XORA 2O5RA 2WAQA 4AYBA 4IZZA 3S8PA 3MD2A 4RLFA 3M1CA 3MKYB 2IGKA 1HA8A 3CJRB 4B47A 3M8JA 4Y33A 4FASD 3K10A 2VXZA 1LKXA 3H9QA 5CPRB 4ITVA 4LIVA 2IS2A 4AU7A 4RMNA 3OR2C 1SAUA 4C2TA 5FRMA 3MMYB 3DKXA 4XKVA 3OOUA 3QYEA 2E5NA 2VJ4A 5TGTA 4KITB 3L2UA 2R7VA 3ZCOA 3SDBA 2IGMA 3H35A 5LFAA 2CMPA 1V5GA 3W2WA 3BCAA 1YX3A 4PJMA 3OL3A 2ZSHB 4JQFA 2KL4A 1FMWA 2JVHA 3DPTA 1MMGA 4G6TB 1WJDA 3HOTA 2RNGA 2V1NA 1P9QC 1QHGA 3AFHA 3DPUA 2M0MA 5HOOA 4XONA 3RSNA 1SFKA 2CS3A 4IQJA 2X1CA 3H5NA 2X6YA 3OS0A 4DGWB 3OYKA 3W2VA 2UV1A 4BGDA 3BG7A 4J00A 2DJIA 2ZXHA 1U0JA 3DWLE 3I3LA 4N4NB 3L2RA 2Y0SA 4BU2A 2VASA 3A4CA 2E1MB 4ZDLA 3ZQQA 3HPHA 1W36D 1Z3XA 3CMMA 2KDOA 3FKJA 2AQEA 2W7NA 3DEEA 2ZFUA 4P5OA 1TT0A 2MFZA 3F9KA 3K6GA 2P0WA 2IXSA 3BG6A 4F3QA 2K5CA 4E7JA 4HRIA 4PK4A 1YE9A 2F5VA 2VXDA 3S93A 3OIPA 4BJ5C 1NG6A 4ZJZA 3D5RC 2E60A 3MKZA 4HPQA 4OWRB 3C2HA 3S3MA 3FBIB 1UG0A 4ANJA 3AL0B 1GLNA 3VYUB 3I9V2 2A5WA 2JUGA 2PMZA 3LSMA 4CCNA 1R6RA 2HPIA 3OYAA 4HSTA 4RLQA 1DQUA 2XC7A 2OUMA 4XL9A 3K4CA 4YRVA 3LSIA 4ZTJA 3NWTA 1TZLA 1D0ZA 4D1QA 1MNEA 4XM3A 3HPGA 2LBFB 2M7AA 4BDZA 4C2UA 3HC7A 3K4MA 2MYSA 3ZXSA 4CCOA 1ERDA 2KP6A 3TL4X 2LY1A 4OAZA 1OLTA 1MMNA 3N05A 4NC8A 2BVLA 1WJBA 4ZTFA 3RQ4A 3LSKA 5LD2C 1G8XA 2R4GA 2HVRA 1MW7A 1WJFA 1X1BA 4XKCA 4BDYA 3RCOA 2MABA 3QOEA 4BUPA 4BE0A 4HNUA 2X6XA 2XF7A 3LSGA 2VKHA 3VYRB 1IRXA 3VSLA 1LDKB 2GOMA 4N4OB 1PJRA 5JHFA 3LMMA 4H4KC 2M7BA 2VKDA 4ZDPA 2R7WA 2BW3B 1BOBA 1ZELA 3PSIA 1X4OA 2LY2A 2V9KA 3K70D 1V5EA 5HNHA 3CF2A 3PJRA 2DT6A 2KRHA 2KQRA 3SEQA 3L2VA 1Y6IA 1X1AA 4II2A 2LREA 3L2WA 2GOXB 3D5SC 2VLAA 3W3CA 5KCMA 4E4HA 2CUJA 4GRIA 2Q2EB 1T0FC 1WJCA 3PUBA 2V26A 4HNTA 2KMUA 1EA3A 1N75A 2IGNA 3SZGA 3K4NA 3FDYA 4E7HA 2VQGA 1WJAA 5CKTA 2R7QA 3PL8A 3OY9A 3DKYA 2F4IA 3DLAA 1BR1A 3OWTA 2BOLA 1DGRM 4KJZA 4KT6A 4BL0B 2W1OA 3OYDA 2R7RA 1QU3A 1JI8A 4ZDOA 3DTEA 3KYLA 3S3OA 1Z21A 3OYGA 3A1YA 4NQWB 2ZXIA 1NG7A 2K3PA 1D0XA 1Z3YA 2VQCA 4CUGA 4U87A 2HU9A 2V4JC 2UUZA 4XKWA 3QYFA 2XSJC 2Q1ZB 4XN3A 2X51A 3PNVA 4CCLA 3CP8A 4Y3OA 3LSHA 1K6YA 2V6EA 4CA0A 3DTKA 3QODA 4PFOA 1D1BA 2VQLA 4XLHA 5HVQC 3PNTA 2FUG2 4PJJA 3E1SA 1WJ5A 4DBRA 2L2OA 3H5RA 2M4KA 3J7AY 1Z7LA 2Z1DA 3L2QA 2LYCA 4E6KG 2W82A 4OAYA 4BQQA 4D9JA 4BXFA 3OIQA 3K4LA 2R7TA 3OYFA 4F52A 2PJRA 3OYMA 3HXLA 3DPLC 4XLFA 4E7ZA 1BR2A 2E5ZA 2X6WA 3OYNA 3MKWB 4BE2A 3VWBA 3G2BA 1KONA 4C30A 4XR6A 2HQAA 2W00A 1DGWY 2UWMA 4LITA 2IGOA 4J01A 2VJIA 2Z16A 4HEA2 2E1MC 3UR3C 2R7SA 3U21A 4DIQA 1V5FA 2KPMA 2QKMB 4F91B 4F93B 2DCEA 4RM2A 2X1EA 4RM3A 4XN0A 1X4PA 4CCMA 2VJ5A 5HNFA 2OC6A 2VPLA 3H9JA 2L9NA 5CQEA 2F6CA 2JSPA 4IKFA 2CFOA 2WAEA 3H5AA 2CV2A 4XOTA 2W4SA 3PFYA 3A2KA 4IQ4A 5FRNA 3BCBA 4BE1A 3H0DA 3OR1C 3GBGA 4BEHA 4B3XA 3CESA 2QKLB 4XLCA 1AA7A 3E0JB 3TMOA 4DOZA 2JA2A 3QYBA 3OYIA 2LRDA 2CV1A 2IS4A 2IS6A 2DXIA 4U7BA 3AKZA 3OL4A 4QPOA 1OR7C 2NOJB 1S9HA 3FHNA 3C2GA 5CQGA 3K4JA 2Z2SB 3ZRGA 2VJJA 2BVMA 4B44A 4F55A 4IX7A 1FMVA 4DJAA 1X1DA 3ONQA 4DBQA 4CCKA 1QHHD 3VYSB 3EPZA 4CH7A 1T95A 1PYVA 2R7XA 3OYHA 2WBMA 4BQOA 3IP4B 5FROA 2MC4A 4HSRA 2L5QA 4XLAA 3RPUD 1D1CA 4E7LA 3DU5A 4C9YA 4MLOA 3ZGKA 1N77A 4XMYA 3S32A 4ZC3A 3IAM2 3OS2A 1LVKA 3VYTB 4LIUA 4BJTA 2XF6A 3H9GA 1UELB 4B48A 2HVSA 2M3AA 1BR4A 3DQVC 3IUOA 3TBIA 4CSWA 4EATA 2VL8A 2X85A 4R79A 2XF5A 4E7KA 4LG3A 2OV7A 2ZSIB 2DT7B 3ZR8X 2AQFA 1MMDA 4PJLA 2JVGA 1W36C 2CV0A 3OMYA 2KZVA 2L7KA 3D5LA 3EUKL 2KLOA 4PFPA 1MNDA 2VQHA 3VSKA 1X1CA 3HKZA 1J09A 4HG2A 2A6TA 1DP3A 3OYLA 3UNGC 4AVZA 2HPMA 2IS1A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1UG0 A;  2DT6 A;  1X4P A;  4DGW B;  2E5Z A;  1X4O A;  2E60 A;  2DT7 B; 
#chains in the Genus database with same CATH topology
 3KZY A;  1W4M A;  3F6O A;  1Z77 A;  1I3A A;  2CO5 A;  1DUX C;  2H6B A;  1FOX A;  5GPA A;  1I1S A;  1KQ9 A;  4XIC A;  1BBY A;  1P4A A;  4ZYH A;  1JGG A;  1FTT A;  1JTY A;  2QQ9 A;  3BJA A;  5GPC A;  2CUZ A;  2MD0 A;  1D5Y A;  1U5T C;  3CJQ B;  4EV0 A;  5LLQ A;  4XLE A;  1AKH A;  1P2F A;  3H1C A;  5KNL A;  4P1W A;  4PGG A;  2BHZ A;  2WA0 A;  2EPF A;  2UZK A;  1UHS A;  3TED A;  2CSO A;  3CP2 A;  1TNS A;  2V7F A;  5LRR A;  2I8D A;  2DO7 A;  3C18 A;  5E8I A;  5D5U B;  3G71 I;  3O3K A;  3TQN A;  3FBN B;  2EA2 A;  4A3K J;  2H8R A;  4U0Y A;  2KRC A;  2HDD A;  3WTT C;  2CW7 A;  5H20 A;  3HGY A;  3OYE A;  3C3W A;  1SFE A;  1O3T A;  1HOM A;  1X19 A;  3R6S A;  3BZK A;  5FKM A;  1DDN A;  2LH9 A;  1UAA A;  5E3O A;  4DYQ A;  2HNH A;  3G4S I;  1KU9 A;  3HRU A;  2X1D A;  2DA7 A;  4B8X A;  3BR0 A;  3K69 A;  3RQI A;  4E7S A;  1XGM A;  1GT0 C;  1LEA A;  4BYY A;  5CVI A;  1SVM A;  4I01 A;  4JOM A;  5BMZ A;  4YEL A;  4CZC A;  2HYG D;  1BJA A;  2P5L C;  2P5V A;  3ASO H;  3RPQ A;  3HG9 A;  3KE2 A;  1J7K A;  5HLI A;  1RUO A;  2D2W A;  1R4M B;  3DTI A;  2E7W A;  3T5X A;  4YFK F;  5H6R A;  2DAO A;  3ECO A;  3IAS 2;  4NDL A;  4GYI A;  3CO6 C;  3RI4 A;  3K4B A;  5FFX A;  1U8B A;  2CQX A;  2HR3 A;  2XRL A;  1JJ8 C;  2VI6 A;  3M8E A;  1HSJ A;  1MNM C;  1ETW A;  1FSH A;  2WAQ A;  1ZTR A;  4IZZ A;  3F21 A;  2ESN A;  2QBY B;  2JRM A;  1IG7 A;  4M3D A;  1HA8 A;  2V6C A;  2MGQ A;  2Y31 A;  4FAS D;  2HDC A;  2PFB A;  2CRG A;  1NK3 P;  2JN6 A;  1EKE A;  2A6E F;  2DDB A;  3FK7 A;  3BPV A;  4LIV A;  3HOZ J;  4AU7 A;  3I56 I;  5FRM A;  4GYG A;  3DKX A;  2Z99 A;  3OOU A;  1VQM I;  3A01 A;  2E5N A;  2VJ4 A;  2R7V A;  2YUS A;  2L02 A;  1RES A;  3BR3 A;  2ZNZ A;  2IGM A;  2XPU A;  3EYI A;  3H35 A;  3G1L A;  1V5G A;  1YX3 A;  4PJM A;  4JQF A;  3Q0V A;  5E3M A;  1E3O C;  3KP3 A;  4BQA A;  4LLG F;  5L3F A;  1XGN A;  1MMG A;  4G6T B;  4B4C A;  4AYB N;  4JK1 X;  1WJD A;  4OOI A;  1JUP A;  1P9Q C;  2DFI A;  3DPU A;  1JT0 A;  1ZK8 A;  3CC2 I;  2JMW A;  2ZXW H;  1SMT A;  5D5V B;  2X1C A;  4MTE A;  1XCV A;  2X6O A;  1ZRF A;  1WZ2 A;  2W25 A;  1I6X A;  4A3J J;  2Q0O A;  4ZYD A;  5L3G A;  4BGD A;  1RET A;  3BG7 A;  3HDD A;  2JJ7 A;  1U5T B;  1QQI A;  5IT9 K;  4N4N B;  5J8F A;  4RGX A;  1LFU P;  1JGS A;  1A31 A;  4LLN A;  4BU2 A;  4QTR A;  5FD5 A;  3DEU A;  3ZQQ A;  2RGV A;  3HPH A;  3WOD F;  2GQQ A;  4G6D A;  2QA4 I;  2EQR A;  1R1V A;  2E1C A;  1SVO A;  3SFI A;  2ZFU A;  2ZC2 A;  2MFZ A;  4M6Y A;  1GUU A;  1SVL A;  3J80 Z;  3Q9S A;  1F36 A;  2HFH A;  5BNG A;  3BG6 A;  4F3Q A;  2M5W A;  4E7J A;  1K78 A;  1FYK A;  5F04 A;  1YE9 A;  2VBX A;  1ETY A;  2VXD A;  3OIP A;  2IRF G;  4ZJZ A;  4EGZ A;  2E60 A;  1JKO C;  1YIT I;  3C2H A;  5DCF A;  1IZ1 A;  2K40 A;  1T33 A;  2FX0 A;  2IP2 A;  4HST A;  2OUM A;  2VPR A;  4L5E A;  2ZME A;  3K4C A;  5BPD A;  1FP2 A;  4RAY A;  3FXK A;  2FOK A;  4RB3 C;  4M9X A;  1BI0 A;  2QVO A;  5DD4 A;  1T38 A;  2L01 A;  1IXS B;  2Y2Z A;  1W7P A;  5HDG A;  5J6X A;  4BDZ A;  3K4M A;  1R9T J;  3WGG A;  4A3L J;  2LY1 A;  4HRI A;  1TT5 B;  2OQR A;  2HOS A;  3N05 A;  2F48 A;  3RYP A;  1WJB A;  3I59 B;  3T8T A;  5M3M J;  3CCJ I;  5FO5 A;  3HSF A;  1O3R A;  1WJF A;  1X1B A;  2EFW A;  1WH7 A;  2L4A A;  3RCO A;  1BA5 A;  1VQ7 I;  3I55 I;  4HNU A;  3HSE A;  3BP8 A;  2XF7 A;  5CVJ A;  4AVP A;  4AM3 A;  3HRT A;  1LDK B;  1U6G A;  2DFE A;  5LEK A;  5FKL A;  5CVU A;  2M7B A;  3HYI A;  3IV5 A;  4LB6 B;  1RPW A;  5IOY A;  4NHJ A;  2O9L A;  2LY2 A;  2GIV A;  4IO9 F;  3TO6 A;  3RPU A;  2KQR A;  3SEQ A;  2EIL H;  2GLO A;  2TDX A;  4LD5 A;  4I98 B;  1EH8 A;  2LLK A;  4ENN A;  3NQO A;  2ETH A;  4ENK A;  2CUJ A;  2DQR A;  1R49 A;  2Q2E B;  2UXN A;  1MBE A;  1WJC A;  3PUB A;  4LJZ F;  3KEQ A;  4D7N A;  1TWC J;  3L09 A;  4D7M A;  3QPL A;  1FZP B;  9ANT A;  3DXJ F;  1YQA A;  2FA5 A;  1Y8Q B;  4HDV A;  5IP9 J;  1B8I A;  3K4N A;  1VQ8 I;  2EFQ A;  2PQ8 A;  3FDY A;  2OZ6 A;  4WXD A;  1H9T A;  4EJU A;  1XG1 A;  4EM1 A;  4GXO A;  1T8I A;  1K83 J;  2EZH A;  4BL0 B;  4KJZ A;  5DTD A;  4KT6 A;  2R7R A;  3ERM A;  2DI3 A;  4ZDO A;  4IL6 C;  3E5U A;  4ETS A;  3WG9 A;  3JRE A;  1IO2 A;  1D0X A;  1HW1 A;  1MBK A;  1Z3Y A;  2LNB A;  3QP5 A;  3GFL A;  4AD9 A;  1YJN I;  2Z9O A;  5DDG A;  4U87 A;  1D8J A;  3LST A;  4XKW A;  3QYF A;  1W0U A;  2NRA C;  2Q1Z B;  3PO2 J;  3L00 A;  3PNV A;  4V2F A;  3H3V K;  4CCL A;  3GLL A;  4IJA A;  3HM5 A;  2XGD A;  2HKO A;  3LSH A;  5H6Q A;  1B59 A;  1PVE A;  2QZ8 A;  4CA0 A;  2YPR A;  1A6I A;  1RUN A;  1ON1 A;  4BAY A;  1HQC A;  1XB4 A;  1RR8 C;  2PBI A;  2NNN A;  2RAE A;  5LHI A;  2XUB A;  1U78 A;  4GO1 A;  2HQR A;  2RKH A;  1WJ5 A;  1X3Z B;  1TWH J;  5J8C A;  2EIJ H;  3J7A Y;  4CYC A;  3W6V A;  1ZGW A;  2E34 A;  2GA2 A;  5E20 A;  2LYC A;  4RGR A;  2W82 A;  5E1X A;  3BWG A;  4BQQ A;  3ECH A;  4EGY A;  3V8J A;  1IN5 A;  1HCR A;  5E3N A;  2QEX I;  4WX9 A;  3OYM A;  4KDP A;  4XLF A;  3KYD B;  1JE8 A;  4QSH A;  2E5Z A;  1BJZ A;  2X6W A;  3OYN A;  3FXQ A;  2K3F A;  3BG9 A;  1KON A;  4XR6 A;  4C2M J;  2W00 A;  2Z5U A;  2UWM A;  2XSD C;  4LIT A;  2JA7 J;  4FX0 A;  2DA1 A;  3ZOB A;  3J7A O;  2P7C B;  3CUQ B;  4EMS A;  4N9H A;  3PM1 A;  5IYD J;  4UUS A;  3J81 K;  5HLH A;  4HX7 A;  2QKM B;  1FBU A;  2X1E A;  4RM3 A;  3BT9 A;  1IW7 F;  2C6Y A;  1KGS A;  3I54 A;  2XB5 A;  5CQE A;  1I6H J;  2JSP A;  1B9M A;  3Q3S A;  3WU2 C;  4L9N A;  2CFO A;  1TWF J;  3JRA A;  5EYR A;  1LPQ A;  1ZN2 A;  1HC8 A;  1OCC H;  3KZZ A;  3LA3 A;  1OMI A;  4XOT A;  2W48 A;  1HKT A;  4M3G A;  3LNQ A;  3KET A;  3Q0U A;  2VOD A;  2DYS H;  5LEJ A;  5BPI A;  4XBF A;  4BE1 A;  5FRN A;  1R58 A;  4XRS A;  3V4G A;  4IHW A;  3CDH A;  3OR1 C;  1MH3 A;  4B3X A;  5ED4 A;  1Y39 A;  3CES A;  2DA3 A;  2FRH A;  1IRZ A;  2ZJQ F;  4N9I A;  1JKQ C;  2I5U A;  1MZB A;  4KN4 X;  3E0J B;  1QGP A;  3IRQ A;  4YFN F;  5K5Q A;  4M3F A;  4HF1 A;  2CV1 A;  1DPU A;  2IS6 A;  3FHZ A;  2K4B A;  2ICW G;  4U7B A;  1J9I A;  1G3S A;  2LP0 A;  1MSF C;  3L9F A;  2JK3 A;  4P9U A;  4QPO A;  1HXD A;  3JRH A;  3MWM A;  3C2G A;  1S3J A;  3ZRG A;  2BVM A;  1HDD C;  4HQM A;  3FXJ A;  2VUM J;  1PP8 F;  3CMA I;  1VQ4 I;  4TV7 A;  4CZZ A;  1UG2 A;  4DBQ A;  3K2A A;  3JRC A;  1QHH D;  4UB6 C;  5EGO B;  1PYV A;  1YW8 A;  4J19 A;  2P6S A;  3PFI A;  3BJ6 A;  5FRO A;  2OD5 A;  3LFK A;  2V1D A;  1BN5 A;  1ZKG A;  2HI3 A;  5IYB J;  2L5Q A;  1KZH A;  1D1C A;  3DU5 A;  3GTG J;  5AIP A;  4MLO A;  2N8G A;  4WCG A;  2CUF A;  5ILS A;  2BYV E;  2IAI A;  1LVK A;  1PUE E;  4BJT A;  2XF6 A;  1X3W B;  3Q0W A;  1FBS A;  2NVT J;  4B48 A;  4NBQ A;  1BR4 A;  5ERI A;  5TRD A;  5LHG A;  1UCR A;  4P9F A;  1TWA J;  3L1P A;  2YS9 A;  2XF5 A;  4A2U A;  3P9I A;  1FOK A;  5LBQ A;  1VQ6 I;  1XMK A;  3MZY A;  1YO5 C;  1VQ5 I;  2K9Q A;  4NC6 A;  1MMD A;  5KAI C;  1L3L A;  4LG0 A;  1YFH A;  2JVG A;  2NNY A;  4XSZ F;  1BIB A;  3D5L A;  2KLO A;  4PFP A;  1QZZ A;  2VT3 A;  3WHB A;  3FM3 A;  3EUH A;  1X1C A;  3ERE D;  4BNC A;  1A35 A;  1LE8 A;  1FLI A;  1DP3 A;  1OYW A;  1R22 A;  4I09 A;  3UNG C;  4DYC A;  2HPM A;  3RDI A;  5HLT A;  1NHA A;  1B72 A;  4XKB A;  1FX7 A;  5HOD A;  3FIW A;  3HL2 A;  3PNY A;  3S14 J;  4E7I A;  2LTP A;  4KMU X;  2LG4 A;  3TP0 A;  4PSX A;  5IP6 A;  2K9L A;  3TDZ C;  2M30 A;  3HHG A;  2A5Y B;  3T1B A;  4NUB A;  2LF7 A;  4II3 A;  5F1J A;  1UB9 A;  4BQN A;  1B9N A;  2HOA A;  1MIJ A;  5GAH J;  2DOD A;  1YIO A;  4JYK A;  2XAU A;  1REP C;  3BY6 A;  3M07 A;  2OPT A;  3FX3 A;  4A5M A;  2NS8 A;  2WAF A;  3MN2 A;  5J3L A;  2PMU A;  1FIA A;  1Y56 A;  3GLX A;  2VB6 A;  3GW2 A;  3LFU A;  4LK0 F;  3WG7 H;  2GAU A;  2HEO A;  2KIU A;  4A3M J;  1D1A A;  2MC3 A;  3EUA A;  3KEY A;  3S3N A;  1IXC A;  1G59 A;  4RB1 A;  3CCL I;  2CWE A;  3QOP A;  1E0E A;  3JAM K;  4IF4 A;  1ETQ A;  1ENH A;  5A2Q Z;  4BEH B;  2W57 A;  4W1U A;  2A3S A;  3L2C A;  2L9S A;  2VN2 A;  4YEJ A;  1JHH A;  3VDX A;  1Z67 A;  3TDU C;  1GDT A;  5J40 A;  2ZO4 A;  5IPA A;  5JVT A;  3O8G A;  2WC2 A;  1WFX A;  4O6J A;  1VZ0 A;  2O6G E;  1QPI A;  3SZT A;  2X4H A;  4XQF A;  1HLV A;  2BE5 F;  1B4A A;  2L7M P;  2MSY A;  3HUG B;  2KKO A;  2WY8 Q;  2EZK A;  4A5N A;  3OS1 A;  2CGP A;  2WY7 Q;  2HDW A;  2NAZ A;  3IKT A;  3EDP A;  4BJ6 C;  1G6N A;  3S16 J;  4GGG A;  1OQY A;  2BW3 A;  4G12 A;  2R7U A;  2VE8 A;  2FBH A;  3WTU C;  3CO7 C;  1LVA A;  2YU3 A;  2FE3 A;  4DZP A;  3IWF A;  1J59 A;  3S8P A;  3MD2 A;  4RLF A;  1S5L C;  3OSF A;  1GXQ A;  3C7J A;  2IJL A;  1ITY A;  2BY1 A;  4ZZL A;  3CJR B;  3N97 A;  3F0C A;  2R3S A;  1T56 A;  4E70 A;  2VXZ A;  1LKX A;  1PUF A;  1ORK A;  3MFK A;  1Z1D A;  2P81 A;  2IS2 A;  2OJE D;  2A69 F;  1OPC A;  3OR2 C;  1SAU A;  4RMN A;  4C2T A;  3IC7 A;  2XAJ A;  5D8K B;  4FCY A;  4Y52 J;  1R71 A;  1OFC X;  1QVT A;  2XAF A;  4L9T A;  2CMP A;  3W2W A;  1UHW A;  3HJE A;  4W97 A;  3FXM A;  3DPT A;  3G73 A;  3IHU A;  4HAM A;  1QHG A;  4XON A;  2K4J A;  3RSN A;  2K7L A;  2P4W A;  3P7N A;  5ICE A;  3F3X A;  2X6Y A;  2DQL A;  2QGU A;  1P4W A;  3FKI J;  3OOP A;  3ZQI A;  4DGW B;  2F5F A;  1T6S A;  3U9G A;  2LFB A;  3ASN H;  3QPS A;  3ZN1 A;  3W2V A;  5AIQ A;  2JQ7 A;  1MBH A;  1R5G A;  3CDI A;  3LOC A;  4J00 A;  4L5J A;  1POG A;  3DWL E;  3BPX A;  3I3L A;  3BZC A;  5EG0 A;  1BIA A;  2Y0S A;  3U2R A;  2VBZ A;  2M0C A;  1OIS A;  2VAS A;  3IH2 A;  2E1M B;  4ZDL A;  4CDG A;  5B66 C;  5DM7 F;  3CMM A;  2AQE A;  3DEE A;  3A0H C;  1Z9C A;  3HOU J;  2VOP A;  1TT0 A;  1ON2 A;  3F9K A;  2E19 A;  3K6G A;  5J1Y A;  4U88 A;  4Y7N J;  2IXS A;  1MDM A;  4BBR J;  3BR5 A;  3DFG A;  5FLM J;  1R5H A;  5FLV A;  1OCR H;  1U8R A;  1H89 C;  2MBF A;  2FNP A;  3VB2 A;  1SD5 A;  3MKZ A;  1X2N A;  3ABT A;  3FBI B;  1UG0 A;  5E18 F;  2ZCW A;  2R5Z B;  2H1L A;  2ZJP F;  1USS A;  4PGH A;  3KIO A;  3M4O J;  1BOA A;  1YW9 A;  4RLQ A;  1DQU A;  2BGC A;  3R0J A;  3LSI A;  1ZGA A;  4ZTJ A;  3NWT A;  3TW6 A;  1D0Z A;  1FTZ A;  3B73 A;  2FBI A;  2Z3Y A;  1MNE A;  2DYR H;  1QA6 A;  2J5P A;  3HPG A;  1P92 A;  3R0A A;  2ZME C;  1DU0 A;  4V19 K;  2M7A A;  2K9N A;  3E5Q A;  2MYS A;  3VFZ A;  5KVR A;  2KP6 A;  5D8L B;  1IJW C;  1EJ9 A;  2EV6 A;  4UXN A;  1X2M A;  2VBY A;  4Z6Y A;  2BVL A;  3MVP A;  2H1K A;  3LSK A;  5GAE J;  1G8X A;  3H3U A;  4IPA A;  1NH3 A;  5D5W B;  1MW7 A;  4XLP F;  4XKC A;  5ICG A;  1FWZ A;  4RS8 A;  2X6X A;  2VKH A;  4IHX A;  1HDP A;  4EEF G;  2PX9 A;  2GOM A;  1PJR A;  1WRJ A;  5JHF A;  3ZQC A;  3LMM A;  4H4K C;  2GIZ A;  2LKX A;  4ZDP A;  1ZEL A;  1X4O A;  5B5E C;  2VKE A;  4CXF A;  5HNH A;  1UST A;  1XGS A;  2JZY A;  4WXH A;  5B1A H;  3ABK H;  4BXU A;  1KYZ A;  3HTS B;  3D1N I;  4EJT A;  1T0F A;  3BG5 A;  4II2 A;  1F43 A;  2LRE A;  4HDU A;  2AHQ A;  2GOX B;  2F5E A;  2VLA A;  5E8G A;  3DBL B;  4CGZ A;  3GZ6 A;  3SDG A;  1U9N A;  2L9V A;  2V26 A;  1DU6 A;  3MKL A;  4RAF A;  3JRB A;  3ZMD A;  1N75 A;  3RKW A;  2M9H A;  3TKY A;  2ELH A;  3HBL A;  3UKG A;  1XSD A;  2AXL A;  2VQG A;  2E1N A;  4LLL A;  1VND A;  3PL8 A;  1K4S A;  3OV8 A;  3DLA A;  1FSE A;  2QWW A;  3BTC A;  3BZ6 A;  2QBY A;  4QWQ A;  3OWT A;  2BOL A;  1DGR M;  4HLX A;  1QU3 A;  1JI8 A;  4I0A A;  1WI3 A;  5DD8 A;  1TL8 A;  2MD5 A;  4H0E A;  3DTE A;  4DZJ A;  5M5Y J;  3S1N J;  1Z21 A;  1K6O A;  5DM6 F;  5AON A;  4KFC A;  3FM5 A;  2OTJ I;  4IRH A;  1NG7 A;  1ZG5 A;  3K1N A;  3IL2 A;  2VQC A;  1VTN C;  3C1D A;  3TOB A;  5C44 J;  1A36 A;  2V4J C;  1O7L A;  3CMY A;  1FT9 A;  3CJN A;  4OIQ F;  4RA2 A;  3M9A A;  3CP8 A;  1SFX A;  5D4S A;  2V6E A;  1X1P A;  2DK5 A;  2DMP A;  2EIM H;  3DTK A;  3QOD A;  1D1B A;  3CCV I;  2XVC A;  5J1U A;  5BOX A;  4BHC A;  3HEF A;  1TW2 A;  3ZQ7 A;  6PAX A;  2FUG 2;  1K78 B;  1MMS A;  4DBR A;  4B1R A;  1IUF A;  2IA1 A;  3FMS A;  3ABL H;  2Z1D A;  3KCC A;  1MH4 A;  3CME I;  3ZPL A;  4OAY A;  3WTZ A;  1H88 C;  4BXF A;  1QPM A;  4L18 B;  2R7T A;  2PJR A;  2CQN A;  2ZME B;  2NYX A;  3ROU A;  2OCC H;  1S7E A;  4KNY A;  4A3C J;  3VWB A;  3FMQ A;  4UVC A;  1QBJ A;  1DGW Y;  1FJL A;  4FX4 A;  2IGO A;  1KU2 A;  2JT1 A;  3GUD A;  1W7P B;  4JBA A;  2KDZ A;  2EH3 A;  1SD7 A;  1STZ A;  3UR3 C;  2R7S A;  5FKK A;  5CYV A;  2EFO A;  2IA0 A;  2DMT A;  4DIQ A;  2KPM A;  4F91 B;  1OKR A;  2XHK A;  3QP6 A;  4DQ2 A;  4F93 B;  1IXR C;  2DCE A;  1XPX A;  3GZN B;  1VF9 A;  2CQQ A;  5EEG A;  5F64 A;  1QO0 D;  2YX4 A;  5FGM A;  3H9J A;  2L9N A;  1UJ8 A;  2X9D A;  2ZFW A;  2D45 A;  2EA4 A;  2F6C A;  5F08 A;  4AID A;  3I64 A;  5H2F C;  3H5A A;  1P7I A;  2STT A;  3GTQ J;  3ZQH A;  2JSC A;  1IRG A;  2DA5 A;  3A2K A;  2L3D A;  4RGS A;  2CJJ A;  3I4P A;  2BXY A;  3VEP A;  4M72 A;  2QSG X;  1XDS A;  3BDD A;  4Q47 A;  2QQ8 A;  4AC0 A;  2EZL A;  3BOQ A;  4YFX F;  1W7P D;  1OR7 A;  1XSV A;  1TC3 C;  3M3Y J;  3F6V A;  3WTV C;  1X58 A;  2JA2 A;  4ESF A;  3BTI A;  3OYI A;  2P7V B;  2DDA A;  1AHD P;  3GTK J;  4RBO A;  2FF4 A;  5IY5 H;  3AKZ A;  3OL4 A;  3ML6 A;  3J7Y J;  2E7X A;  1FMV A;  1B8I B;  1RZ4 A;  1U9O A;  1X1D A;  3ZMT A;  3ONQ A;  1AOY A;  2QSF X;  1G3W A;  2PMH A;  1TBX A;  3EPZ A;  5HS9 A;  1BI3 A;  1T95 A;  4DNC A;  3PIO F;  1CGP A;  3NAU A;  1GV2 A;  3OYH A;  2WBM A;  3ZN0 A;  1J0R A;  3WE3 A;  3IP4 B;  3HB9 A;  2MC4 A;  1RR7 A;  1TW3 A;  2IEK A;  4XLA A;  5JVG F;  5BS6 A;  3FZV A;  3RPU D;  3KP2 A;  4E7L A;  2E36 A;  4C9Y A;  3ZGK A;  3CLQ A;  2LVS A;  3VYT B;  1FYL A;  2HYF A;  4U0W A;  4LFU A;  5E79 C;  3MCZ A;  4HOB A;  4A3D J;  1FNN A;  4JX5 A;  2GXG A;  5JLW A;  3H9G A;  2HVS A;  5IT9 Z;  1XX5 A;  3IUO A;  1R1T A;  1S7O A;  2BBY A;  3HOV J;  4EAT A;  1BI2 A;  2OU2 A;  1ZLJ A;  2XGX A;  4E7K A;  1GHC A;  4LG3 A;  2ZSI B;  1APL C;  3PUF A;  3I53 A;  2DT7 B;  4UHT A;  4B3A A;  1W36 C;  2WWY A;  3JRG A;  2M8E A;  1K79 A;  5EZG A;  2QSH X;  2VQH A;  4ON0 A;  4AWX B;  5GTI C;  1J09 A;  2L54 A;  1QZE A;  3ZMV A;  3QPH A;  3OYL A;  1UZC A;  4OIO F;  3CJT B;  2HVQ A;  3GYH X;  4PUS A;  3EUH C;  1H8A C;  2JA6 J;  2LMD A;  1WWX A;  3TW7 A;  4KIG A;  1MMA A;  3VPR A;  4WWC A;  1WJE A;  2O8X A;  2LOO A;  4PCQ A;  2ELJ A;  2O0Y A;  4FET A;  2K9M A;  1LJ9 A;  1XGO A;  4IRG A;  5HDK A;  5FLX K;  1WGX A;  2OTL I;  3D0S A;  4HZF A;  4LB5 A;  1MBF A;  4S05 A;  3CZ6 A;  1FPQ A;  2KHM A;  1XTA A;  4M9S A;  2IA2 A;  4ESJ A;  3KP5 A;  1ZHF A;  1ZAR A;  1PDN C;  4B43 A;  2E2J J;  2R7O A;  4KIC A;  1I27 A;  4KUM A;  3SYT A;  3WU1 B;  3W6K B;  2ZB9 A;  4PSW A;  2W84 A;  3GTM J;  2CW8 A;  3V7R A;  2RN7 A;  2RNJ A;  5M5X J;  4D5C A;  1ZH5 A;  2XDV A;  2RQQ A;  4XSX F;  4HV5 A;  3CTA A;  3PSF A;  2K02 A;  2WTE A;  3ABM H;  4F92 B;  2DOA A;  1IF1 A;  1LFP A;  2XAH A;  2KJC A;  3M7G A;  3AL0 C;  3CUO A;  3P5J A;  3RTR A;  3K4K A;  3HOS A;  1MD0 A;  2QUF A;  3VOE A;  1BC8 C;  5ILU A;  5TJJ A;  2B0L A;  3NRV A;  3CUQ A;  2BZT A;  2LBF A;  1YRN B;  2GXB A;  3GFM A;  3VOD A;  3K70 C;  3CC7 I;  1WPK A;  4X0G A;  4A3I J;  1F4K A;  2VT2 A;  2CU7 A;  1ZG3 A;  2PMZ N;  3OYB A;  2R7F A;  4KT5 C;  1EH6 A;  2MLK A;  4ZYA A;  5CLS A;  2FMY A;  2GA1 A;  2Y0M A;  2VIX A;  2WB1 A;  3V42 A;  4Y4R A;  5L3B A;  2WAD A;  2FQ4 A;  1E3P A;  2CFX A;  3W2A A;  1GVD A;  3LWF A;  4YIR X;  2QCO A;  4FHT A;  5KK1 A;  2DA6 A;  4M73 A;  4U0V A;  3ELK A;  4I7H A;  2X0L A;  5DV5 A;  4BHP A;  5EEH A;  2LC2 A;  3SXY A;  5C3E J;  1HW2 A;  4XOR A;  4KIS A;  3AG2 H;  2O5R A;  4FQG A;  2ESH A;  2E2I J;  2EB7 A;  2FSW A;  5EDN A;  2HWV A;  5M3F J;  3JSP A;  2E2H J;  3M1C A;  2TRT A;  4C3I J;  3M1E A;  2IVM A;  5DEQ A;  2IGK A;  3JSO A;  1FEX A;  4EM0 B;  4B47 A;  3M8J A;  2M1B A;  3K10 A;  3COA C;  4DW6 A;  1BW5 A;  4O5V A;  1YJ9 I;  3MMY B;  2XV4 S;  4XKV A;  4Z2Y A;  3FXU A;  5EF6 A;  1N25 A;  3BG3 A;  2O3F A;  3E6C C;  4C3J J;  1CF7 B;  1LQ1 A;  1JJ6 C;  2LKP A;  5EGO A;  2CYY A;  1XDU A;  3BCA A;  5HS7 A;  3OL3 A;  4A3G J;  4PJ0 C;  2JVH A;  1VQP I;  4LG0 B;  2FU4 A;  4D5F A;  2Y75 A;  1E3H A;  1XMA A;  4IVN A;  4EJV A;  1T2K A;  2M0M A;  5HOO A;  2GM4 A;  2YX7 A;  1ETK A;  5HS8 A;  2F2E A;  1SD4 A;  1SFK A;  3TGN A;  4G7O F;  2IPQ X;  5JFR A;  1LE8 B;  3Q9V A;  3HOY J;  2UV1 A;  4UVB A;  3EQL F;  1Z05 A;  1WCM J;  1U0J A;  2PG4 A;  3E3V A;  3WE2 A;  1R5I D;  3L2R A;  3FK6 A;  2XGC A;  4HW0 A;  1T98 A;  3A4C A;  1W36 D;  4WXC A;  1Z3X A;  2KDO A;  2PI0 A;  3FKJ A;  1L0O C;  2W7N A;  1YIJ I;  2BY0 A;  2KJB A;  4JX4 A;  3J81 Z;  3R61 A;  4BHB A;  4MIM A;  1R7J A;  2P0W A;  5D5X B;  3FXR A;  2K5C A;  4PK4 A;  2F5V A;  3MZ8 A;  1NG6 A;  3JTG A;  3PQJ A;  2FQ3 A;  4A0Y A;  3D5R C;  3K2Z A;  2BV6 A;  3S3M A;  4OWR B;  3LQQ A;  1O3S A;  1SFO J;  3KP4 A;  4ANJ A;  2ECC A;  3AL0 B;  3HTU A;  3R4K A;  3VYU B;  3I9V 2;  2A5W A;  2JUG A;  2PMZ A;  1LEB A;  2HPI A;  1AWC A;  3OYA A;  4A3E J;  1Y1W J;  2P5K A;  3U1K A;  3T0Y A;  1MJB A;  2FD5 A;  4MTD A;  1LB2 A;  2Y0S N;  1J2X A;  2QLZ A;  3WHC A;  1TZL A;  4KN7 X;  4UUV A;  2M45 A;  3CQZ J;  4OMZ A;  3V7C A;  4BKX A;  2B7E A;  1QNT A;  2JTV A;  4OMY A;  1IDZ A;  5EJC A;  3BJO A;  4C2U A;  2MW8 A;  3HC7 A;  1W1W E;  1S8N A;  3ZXS A;  2DLL A;  1QVU A;  1TQM A;  4OAZ A;  1TP4 A;  1OLT A;  1J5Y A;  2JPB A;  2R93 J;  2NVY J;  2DOE A;  1WKM A;  4ZTF A;  3RQ4 A;  2ECB A;  1W5T A;  3JR9 A;  2O8K A;  2R4G A;  5GAD J;  4RB0 A;  4P96 A;  4UY8 I;  4BUP A;  3QOE A;  2YR2 A;  1FOY A;  1MKM A;  1S6L A;  3LSG A;  4U7D A;  2DT5 A;  2OCE A;  1IRX A;  3VYR B;  3VSL A;  1ZRE A;  1DP7 P;  3KZI C;  1HW5 A;  2AS5 F;  1VQN I;  4N4O B;  2JUC A;  5DUI A;  2MG4 A;  2VKD A;  3BTL A;  2BW3 B;  4GFB A;  1BOB A;  2E35 A;  3F8M A;  2V9K A;  4IXA A;  3K70 D;  1V5E A;  1XSX A;  3CF2 A;  3N4M A;  4HF2 A;  2VOO A;  1XD7 A;  4IHS A;  1RC9 A;  4EM2 A;  1K4T A;  2DBB A;  4M6V A;  4FE7 A;  1YS7 A;  3L2W A;  3D5S C;  4GDF A;  3W3C A;  4E4H A;  1PUF B;  2B63 J;  2ZXJ A;  4GRI A;  4KIF A;  1T0F C;  1IV8 A;  4AIK A;  3JW4 A;  3QQA A;  2P6T A;  5LGU A;  2KMU A;  2DA2 A;  2IGN A;  5DS9 A;  2V9V A;  2R5Y A;  3LAP A;  3ZMZ A;  3AAF A;  3G1M A;  1S29 A;  2XRN A;  4ENJ A;  5CKT A;  4ZH4 F;  1JKP C;  1MBG A;  2V1U A;  1T39 A;  2RQP A;  1UHM A;  5DCM A;  3O8H A;  2ACJ A;  3OYD A;  3DCF A;  2W1O A;  4A3F J;  4BBS J;  4UV9 A;  4G8X A;  3WTY C;  3C2B A;  3KYL A;  1ZLK A;  2LDU A;  3OYG A;  4NQW B;  1ZYR F;  3FIS A;  1LFB A;  3V8K A;  4WK8 F;  2ZBK A;  4CUG A;  1S72 I;  2DOF A;  3G1O A;  5EEA A;  2EK5 A;  4Y17 A;  4G6Q A;  2UUZ A;  4XRS G;  2XSJ C;  2X51 A;  3ULQ B;  5HDN A;  5EG0 B;  1ZQ3 P;  2OBP A;  4Y3O A;  3I71 A;  1K6Y A;  2MA3 A;  2Y30 A;  3QU6 A;  5ICC A;  4MQ9 F;  3H36 A;  4PFO A;  4XLH A;  1JT6 A;  4M74 A;  2HQ5 A;  5HVQ C;  3PNT A;  1SFU A;  2BHY A;  2GZW A;  1AKH B;  2LR8 A;  2MLG A;  2DU9 A;  2RC4 A;  3KFW X;  4S04 A;  2NVQ J;  4PJJ A;  3F8B A;  5JR3 A;  3IH4 A;  2DMU A;  2M4K A;  1MGT A;  3S17 J;  1R4N B;  4A6D A;  3F23 A;  1Z7L A;  1Z91 A;  2K86 A;  2BXZ A;  1A5J A;  3MAJ A;  4E6K G;  5GTH C;  5K7F A;  1BL0 A;  5D4R A;  2PJP A;  3ZQF A;  5LHH A;  1I39 A;  1KU3 A;  5GP9 A;  3DPL C;  3GWZ A;  4E7Z A;  3WTS C;  2IT0 A;  1BR2 A;  3HOX J;  3JAM Z;  2EFP A;  3P9K A;  3E5X A;  4ZYG A;  4MHG A;  2KIF A;  4FTH A;  3CC4 I;  1ACI A;  1YLF A;  4XLN F;  1J75 A;  3J80 K;  3U21 A;  1IN6 A;  1V5F A;  4ENM A;  2D1V A;  3HGG A;  5K5O A;  5KAF C;  3ZP5 A;  4XN0 A;  1X4P A;  2DK8 A;  2VJ5 A;  3I4M J;  2VPL A;  2R5Z A;  3OSG A;  1ETX A;  1ZAO A;  3J7Z I;  2A68 F;  3HOW J;  3G6E I;  2BY3 A;  1LUJ B;  2KIS A;  2L7Z A;  2OA4 A;  1F5T A;  1TLH B;  3O2P E;  3RKX A;  5LRS A;  1XS9 A;  2CV2 A;  2E1O A;  1R1U A;  1P6R A;  3LSJ A;  2G9W A;  3FWE A;  4PZJ A;  4FT8 A;  3PFY A;  4IQ4 A;  4M6X A;  4KYW A;  3BCB A;  3E6M A;  1YS6 A;  2EBI A;  3H0D A;  3GBG A;  1I3Q J;  4G94 A;  4ESB A;  4FIS A;  2QKL B;  4IOC F;  2D1H A;  4QLC U;  1XCB A;  2K9S A;  1HKS A;  4XLC A;  5JLX A;  3WGH A;  1VFC A;  1AA7 A;  1B1B A;  4IEJ A;  5LGN A;  3TMO A;  2EWN A;  1IC8 A;  1ZRC A;  2LK2 A;  2LRD A;  2IS4 A;  5IOZ A;  2DXI A;  3TO7 A;  3E97 A;  2M8G X;  1TWG J;  4GCV A;  2FEZ A;  2NOG A;  1OR7 C;  1S9H A;  2XPV A;  3FHN A;  3K9T A;  2CQ7 A;  3ZQG A;  1SAN A;  1ZG1 A;  2Z2S B;  4B44 A;  2VJJ A;  2W85 A;  4IX7 A;  3B6A A;  2QQA A;  2F4O B;  1ETV A;  3A01 B;  3A0B C;  3MZH A;  2JWT A;  4CCK A;  4CH7 A;  1Z7U A;  2FBK A;  3S1M J;  3BQY A;  1FBQ A;  1G4D A;  3I4N J;  2R7X A;  4BQO A;  2PEX A;  3V8L A;  1WVR A;  3AG1 H;  2VON A;  1SC7 A;  2HTS A;  4HSR A;  2JRT A;  1WI9 A;  2A07 F;  3BR1 A;  3LSR A;  4L9V A;  1HST A;  1Q1V A;  4CHU A;  2G0E A;  4P55 A;  4XK4 A;  3GCM A;  5EZH A;  4OIN F;  3A02 A;  3S32 A;  2V79 A;  4AIH A;  5M5W J;  3REO A;  4LIU A;  3CLO A;  4N0B A;  3QPT A;  4G7Z F;  1KU7 A;  1VI0 A;  5C4X J;  2HZT A;  1UEL B;  1KYW A;  2HGC A;  3DQV C;  2BEO A;  4R79 A;  4M71 A;  4M3B A;  2DFF A;  5JI6 A;  2OV7 A;  1OJL A;  1QRY A;  3F8C A;  5E1Z B;  1OCP A;  3QRF F;  4L5I A;  4PJL A;  2ME6 A;  5D6E A;  1XN7 A;  2LD5 A;  2CV0 A;  1FIP A;  1ONV A;  2CW0 F;  2L7K A;  1V54 H;  3EUK L;  5K1Y A;  1O57 A;  4DYR A;  1MND A;  4M9Z A;  1EH7 A;  2XAG A;  3VSK A;  4R8H A;  3HRS A;  4MO7 A;  4UV8 A;  5F1R A;  4EQQ A;  3GTP J;  3IWZ A;  2FML A;  3KPH A;  2HTJ A;  4CIC A;  2GXA A;  1GV5 A;  4AVZ A;  2DMQ A;  3MEX A;  2ZKZ A;  4NNJ A;  3RIR A;  2CH0 A;  3BLY A;  1YX5 A;  2PJR B;  1IRF A;  1P7J A;  3GFJ A;  1U5T A;  3LL7 A;  5K5R A;  3OYJ A;  4IHY A;  3WTW C;  1CQT A;  5B1B H;  2QEN A;  3GX4 X;  2LY9 A;  3GXO A;  3GEZ A;  1ODD A;  4QIW N;  4EVI A;  2FJ1 A;  2HZD A;  4BH9 A;  1UMQ A;  4F7Z A;  2Z33 A;  3CF5 F;  4XOP A;  2VC0 A;  1E2X A;  3JRD A;  1W5C C;  4L0Y B;  3U1D A;  2F5D A;  4CO8 A;  3Q5F A;  2DTZ A;  2JA5 J;  2XKO A;  2HXO A;  2DJN A;  4BAC A;  2WV0 A;  1G3T A;  2M4G A;  4C3H J;  1R36 A;  3I0T A;  3CCQ I;  2D5V A;  3E6D A;  4XID A;  3CCS I;  3AG3 H;  2CQK A;  1BW6 A;  3BC8 A;  3BQZ A;  3K0L A;  2KRF A;  4QPQ A;  2Y9Z A;  1D0Y A;  4RB2 C;  2GBY A;  5KHD A;  2QM3 A;  4XNF A;  3S1Q J;  3K1P A;  3DBR B;  3F8N A;  4BS9 A;  4HYE A;  1N78 A;  4AIJ A;  2H27 A;  3OYC A;  2OQG A;  2XIG A;  3QWL A;  3NWS A;  4CCJ A;  3I5U A;  2OZU A;  4UNO A;  3P9C A;  1HBX G;  3DU6 A;  5FJ8 J;  3SJM A;  1ZGJ A;  4NC7 A;  5IT3 A;  3R60 A;  3A03 A;  2L7F P;  3SEZ A;  3RZD J;  3KX2 A;  3CUQ C;  2QQB A;  3I59 A;  3F8F A;  4MNU A;  1IGN A;  2M34 A;  2DPD A;  3ISP A;  1BM9 A;  4O3M A;  5TIS C;  2M87 A;  3TOA A;  2RRE A;  3SFZ A;  5E3L A;  4OU0 A;  4LK1 F;  5F0C A;  1U2W A;  3W6J B;  1QZY A;  1VQO I;  3ABU A;  4PJN A;  5FB2 A;  4HA8 A;  2XPW A;  2COB A;  2NS7 A;  3BRO A;  3NEU A;  3OIO A;  4IHT A;  2F4M B;  2I10 A;  2STW A;  2VKV A;  1R00 A;  4AYB A;  4R1H A;  1XMX A;  4A3B J;  4BXX J;  2G7H A;  4ASN A;  2AXT C;  2EV5 A;  2FNA A;  2HXI A;  3MKY B;  4HQE A;  2BY2 A;  4MEX F;  4MFD A;  4Y33 A;  5LGT A;  1TTY A;  2FOW A;  2G7U A;  3H9Q A;  5CPR B;  4ITV A;  2R7D A;  3S1R J;  2WB1 N;  4A93 J;  2A61 A;  2Q2E A;  4Q48 A;  4JX6 A;  3QYE A;  3LA2 A;  5TGT A;  4KIT B;  3L2U A;  3CCY A;  3M8F A;  3ZCO A;  1W0T A;  4HX8 A;  2IBD A;  3SDB A;  1H9G A;  3GZ5 A;  2MH2 A;  1LNW A;  5LFA A;  4L0Z B;  1YG2 A;  3FXO A;  2ZSH B;  2H8W A;  2QF7 A;  2E71 A;  2KL4 A;  1FMW A;  2IW5 A;  1YI2 I;  1YW7 A;  1O3Q A;  4M3E A;  2ELK A;  2UXX A;  3GFI A;  3HOT A;  4L9J A;  2RNG A;  2RDP A;  2V1N A;  4ABZ A;  3AFH A;  3KYC B;  4UB8 C;  5E1W A;  2F5C A;  3T8R A;  1OCZ H;  2ISY A;  3JRI A;  2CS3 A;  2YSR A;  4IQJ A;  2R7Z J;  2XKP A;  3H5N A;  2XRO A;  3OS0 A;  2KZG A;  4CYC B;  4V2G A;  5C4J J;  3RKQ A;  2W24 A;  3OYK A;  2PN6 A;  4BY7 J;  4A69 C;  4A0Z A;  2DJI A;  2ZXH A;  1Y0U A;  4IOA F;  1Z6R A;  1SAX A;  1WHU A;  2JPC A;  2ZJ2 A;  3PIP F;  2EZI A;  1EV7 A;  3LSP A;  2O7O A;  2KIM A;  1OYY A;  3LAJ A;  2L0K A;  3WGI A;  3FMR A;  4MGR A;  1I1G A;  4P5O A;  2L9R A;  1RI7 A;  1V3F A;  4AUX A;  4JP0 A;  1MSE C;  1UFM A;  3K1M A;  4YIF A;  5GAG J;  3KP7 A;  4IRI A;  4UUS B;  3S93 A;  5DYM A;  2COM A;  4HX4 A;  4BJ5 C;  3S2D J;  1JXS A;  4G7H F;  3JRF A;  4I6Z A;  4HPQ A;  2XAS A;  4YII A;  2WV1 A;  2EV0 A;  1W5S A;  1GLN A;  1WQ2 A;  3LSM A;  4CCN A;  1R6R A;  3HZJ A;  4I2O A;  1ZRD A;  1LDJ A;  1SD6 A;  2XC7 A;  4XL9 A;  5F27 A;  5FD6 A;  3GTL J;  4YRV A;  2VE9 A;  4BY1 J;  1V55 H;  1F9N A;  1T08 B;  1RKW A;  2H94 A;  4D1Q A;  3H0G J;  4XM3 A;  2V1X A;  3LA7 A;  2LBF B;  1RKT A;  3S2H J;  4CCO A;  2TCT A;  1ERD A;  3TL4 X;  2YU9 J;  2RVC A;  1OCT C;  1MMN A;  3HIF A;  4S0H B;  4NC8 A;  4LOC A;  3PQK A;  1AU7 A;  5E17 F;  5LD2 C;  1RIO H;  2HVR A;  1FC3 A;  1S7A A;  2B9S A;  4BDY A;  3I58 A;  2MAB A;  3BR2 A;  1O7F A;  4BE0 A;  3S15 J;  2ID3 A;  1Z0X A;  3IKV A;  3B02 A;  4A6E A;  1YHQ I;  5K7H A;  1MBJ A;  1OCO H;  5DUK A;  2R7W A;  3PSI A;  3GTJ J;  5CVV A;  2M2E A;  5A2Q K;  3KLN A;  1R23 A;  2DA4 A;  4Y15 A;  1IAW A;  5HLG A;  1YRN A;  3CCU I;  3PJR A;  2DT6 A;  4WF2 A;  3EET A;  2KRH A;  1IN4 A;  4MFE A;  3L2V A;  3DP7 A;  1Y6I A;  1JHF A;  1X1A A;  3CDL A;  3AG4 H;  1KQ8 A;  4Y13 A;  2PLY A;  4X6A J;  4HBL A;  2A6H F;  5KCM A;  3L7W A;  1X3U A;  4EJO A;  3G3Z A;  1G3Y A;  4RAG A;  4HNT A;  2R0Q C;  1TNT A;  1PP7 U;  1FYM A;  4I76 A;  1EA3 A;  2EIN H;  3BR6 A;  3FF5 A;  3SZG A;  1WSU A;  1M1E B;  4E7H A;  5L3D A;  1WJA A;  4OIR F;  2R7Q A;  1ZR2 A;  3OY9 A;  2XB0 X;  3DKY A;  1YTY A;  2F4I A;  1D5V A;  2ADU A;  2DW4 A;  1BR1 A;  1NTC A;  2VBW A;  3ZMS A;  1KA8 A;  1IN8 A;  4PDK A;  1U3E M;  3F72 A;  3KEO A;  2ISZ A;  4NB5 A;  3S3O A;  1MJ9 A;  3A1Y A;  3S2W A;  2EJR A;  2ZXI A;  4D0P A;  2K3P A;  1WH5 A;  4Q5S F;  1MJA A;  2QYO A;  2HU9 A;  1FP1 D;  2HYJ A;  4MEY F;  1EF4 A;  1YYV A;  3DLL F;  3GO5 A;  4XN3 A;  4XRM A;  1B72 B;  2O03 A;  1CF7 A;  1GXP A;  1ULY A;  3HHH A;  4IHV A;  4Q4Z F;  4HNV A;  1KQ0 A;  5FLX Z;  1SMY F;  4KIB A;  1NK2 P;  3F22 A;  1Y0N A;  2CG4 A;  2KIQ A;  1HKQ A;  2VQL A;  2XAQ A;  1TQP A;  1VQK I;  2NVX J;  2XGE A;  3B6C A;  1K7A A;  1Z6T A;  1I50 J;  3H3Z A;  2P8T A;  3LQR A;  1V4R A;  3E1S A;  4LMY A;  2L2O A;  3H5R A;  1JUS A;  2VC1 A;  5ICF A;  3L2Q A;  3E7L A;  4D9J A;  1E17 A;  1YOV B;  1RNL A;  2K27 A;  3KLO A;  4G9Y A;  3OIQ A;  3GTO J;  3K4L A;  3OYF A;  4F52 A;  2JA8 J;  2HQN A;  1LDD A;  3HXL A;  2Q8K A;  1VQL I;  3WTX C;  4I02 A;  1FY7 A;  2A05 A;  2LSO A;  4I99 C;  3SZP A;  3MKW B;  4BE2 A;  3PO3 J;  2AO9 A;  3G2B A;  4C30 A;  4ZYE A;  5L3C A;  2HQA A;  5IYC J;  1H0M A;  1Y8R B;  1Q1H A;  4K2E A;  4A0X A;  4J01 A;  2H09 A;  2VJI A;  2Z16 A;  2HOT A;  4RAZ A;  4HEA 2;  1G2H A;  1XC5 A;  1IN7 A;  4CYD A;  1YJW I;  2E1M C;  3HKZ N;  5CVR A;  3CCR I;  1BI1 A;  5J4Y A;  4OIP F;  4UUT A;  4RM2 A;  4CCM A;  5HNF A;  2J5O A;  3FXL A;  1P4X A;  2LKS A;  2OC6 A;  3O6B B;  2HKX A;  1FOW A;  4XRF A;  1Y1V J;  4HV6 A;  1D3Y A;  2NS0 A;  5D6F A;  2CUE A;  4IKF A;  4X1E A;  2HOE A;  2MH9 A;  3E6B A;  2WAE A;  1HF0 A;  1JKR C;  2W4S A;  2NXN B;  3V7S A;  5F0F A;  3GF2 A;  2H6C A;  3DBH B;  2K85 A;  2DFH A;  3GVA A;  2ME0 A;  3JTH A;  2NVU B;  4BEH A;  3EYY A;  3IRR A;  1OYI A;  4EJW A;  2KFD A;  1C0W A;  4UVA A;  3SQN A;  5F0H A;  3DV8 A;  3KP6 A;  1A6Q A;  1F1Z A;  5IP7 J;  1JUM A;  2DPU A;  4DOZ A;  3QYB A;  2FXA A;  5BQT A;  4YG2 F;  4RGU A;  1BC7 C;  5F6F A;  1ZR4 A;  2NOJ B;  5CQG A;  3K4J A;  4F55 A;  5B3S H;  5FFZ A;  4DJA A;  3HUG A;  2R5Y B;  4A12 A;  4HF0 A;  5K7Z A;  1VQ9 I;  2L4M A;  1A04 A;  3VYS B;  3NAR A;  3X2Q H;  2ID6 A;  2ZNY A;  3WU0 A;  3IH3 A;  5DCM B;  1O4X A;  3DEW A;  2KT0 A;  3HRM A;  3JCU C;  4LGW A;  4ZZD A;  3GME A;  1K61 A;  4FE4 A;  4MQV A;  3DKW A;  3CCM I;  3CD6 I;  4HLY A;  2EFN A;  2Y48 A;  3SHF A;  1N77 A;  4XMY A;  3BTJ A;  1I5Z A;  4ZC3 A;  2OAZ A;  2X48 A;  3IAM 2;  3OS2 A;  3MQ0 A;  3H92 A;  1IUY A;  3TP3 A;  2OF7 A;  2Y9Y A;  3ZQL A;  3K7A J;  1TQI A;  3ZMU A;  2HS5 A;  5J47 A;  2DTR A;  5JHU A;  1IV6 A;  3ESW B;  2M3A A;  3DF8 A;  5L3E A;  3CCE I;  4CSW A;  3TBI A;  2R92 J;  2VL8 A;  2GWR A;  2X85 A;  5J1R A;  3RZO J;  3QU3 A;  3RJP A;  3ZR8 X;  5FKN A;  5J4V A;  1B6A A;  2AQF A;  2WAQ N;  3RKY A;  1D8K A;  1DPR A;  4KA4 A;  1JTX A;  3QAH A;  2RV8 A;  3OMY A;  2DMN A;  2KZV A;  5ILV A;  1GVJ A;  1IDY A;  4RDU A;  3TO9 A;  5CJ9 A;  2V9P A;  4I0B A;  4KMF A;  1ETO A;  2O61 A;  5FKO A;  1MDM B;  2LF8 A;  1RRJ A;  4NQW A;  3HKZ A;  4B09 A;  3RYR A;  4HG2 A;  2A6T A;  2DN0 A;  2Y69 H;  3HSR A;  1SEU A;  2IS1 A;  2EIK H;  2ZJR F; 
#chains in the Genus database with same CATH homology
 4NNJ A;  5HLT A;  2HVQ A;  2CH0 A;  3BLY A;  4PUS A;  3EUH C;  1YX5 A;  4XKB A;  2PJR B;  3OYJ A;  3LL7 A;  3HL2 A;  3PNY A;  4E7I A;  1MMA A;  2LG4 A;  1WJE A;  4PSX A;  2LOO A;  2ELJ A;  4FET A;  2K9L A;  2K9M A;  2CUZ A;  2MD0 A;  4NUB A;  2HZD A;  3CZ6 A;  3CJQ B;  4II3 A;  4XLE A;  2KHM A;  4BQN A;  5KNL A;  4P1W A;  4XOP A;  2WA0 A;  2XAU A;  4B43 A;  2R7O A;  3CP2 A;  2V7F A;  2I8D A;  2WAF A;  3SYT A;  4PSW A;  4BAC A;  2M4G A;  2CW8 A;  1Y56 A;  3FBN B;  2VB6 A;  3LFU A;  2XDV A;  2RQQ A;  2KRC A;  2CW7 A;  3PSF A;  1D1A A;  3OYE A;  3EUA A;  3KEY A;  3S3N A;  1G59 A;  4F92 B;  3BC8 A;  1X19 A;  2DOA A;  4QPQ A;  1LFP A;  1D0Y A;  2LH9 A;  1UAA A;  3AL0 C;  1E0E A;  3RTR A;  5KHD A;  3K4K A;  4XNF A;  3HOS A;  4BEH B;  4BS9 A;  2HNH A;  1N78 A;  3OYC A;  2L9S A;  2X1D A;  2LBF A;  3NWS A;  4YEJ A;  3VDX A;  4CCJ A;  3K70 C;  3DU6 A;  4E7S A;  4X0G A;  4NC7 A;  3SEZ A;  1WFX A;  3KX2 A;  3OYB A;  1VZ0 A;  4JOM A;  4YEL A;  4CZC A;  4ZYA A;  4XQF A;  3HG9 A;  2VIX A;  2WB1 A;  3V42 A;  4Y4R A;  2RRE A;  2WAD A;  3HUG B;  2WY8 Q;  3OS1 A;  3W2A A;  4PJN A;  2WY7 Q;  2HDW A;  3DTI A;  4BJ6 C;  3IAS 2;  2BW3 A;  4KIS A;  2R7U A;  2LC2 A;  3K4B A;  4XOR A;  2O5R A;  2WAQ A;  4AYB A;  4IZZ A;  3S8P A;  3MD2 A;  4RLF A;  3M1C A;  3MKY B;  2IGK A;  1HA8 A;  3CJR B;  4B47 A;  3M8J A;  4Y33 A;  4FAS D;  3K10 A;  2VXZ A;  1LKX A;  3H9Q A;  5CPR B;  4ITV A;  4LIV A;  2IS2 A;  4AU7 A;  4RMN A;  3OR2 C;  1SAU A;  4C2T A;  5FRM A;  3MMY B;  3DKX A;  4XKV A;  3OOU A;  3QYE A;  2E5N A;  2VJ4 A;  5TGT A;  4KIT B;  3L2U A;  2R7V A;  3ZCO A;  3SDB A;  2IGM A;  3H35 A;  5LFA A;  2CMP A;  1V5G A;  3W2W A;  3BCA A;  1YX3 A;  4PJM A;  3OL3 A;  2ZSH B;  4JQF A;  2KL4 A;  1FMW A;  2JVH A;  3DPT A;  1MMG A;  4G6T B;  1WJD A;  3HOT A;  2RNG A;  2V1N A;  1P9Q C;  1QHG A;  3AFH A;  3DPU A;  2M0M A;  5HOO A;  4XON A;  3RSN A;  1SFK A;  2CS3 A;  4IQJ A;  2X1C A;  3H5N A;  2X6Y A;  3OS0 A;  4DGW B;  3OYK A;  3W2V A;  2UV1 A;  4BGD A;  3BG7 A;  4J00 A;  2DJI A;  2ZXH A;  1U0J A;  3DWL E;  3I3L A;  4N4N B;  3L2R A;  2Y0S A;  4BU2 A;  2VAS A;  3A4C A;  2E1M B;  4ZDL A;  3ZQQ A;  3HPH A;  1W36 D;  1Z3X A;  3CMM A;  2KDO A;  3FKJ A;  2AQE A;  2W7N A;  3DEE A;  2ZFU A;  4P5O A;  1TT0 A;  2MFZ A;  3F9K A;  3K6G A;  2P0W A;  2IXS A;  3BG6 A;  4F3Q A;  2K5C A;  4E7J A;  4HRI A;  4PK4 A;  1YE9 A;  2F5V A;  2VXD A;  3S93 A;  3OIP A;  4BJ5 C;  1NG6 A;  4ZJZ A;  3D5R C;  2E60 A;  3MKZ A;  4HPQ A;  4OWR B;  3C2H A;  3S3M A;  3FBI B;  1UG0 A;  4ANJ A;  3AL0 B;  1GLN A;  3VYU B;  3I9V 2;  2A5W A;  2JUG A;  2PMZ A;  3LSM A;  4CCN A;  1R6R A;  2HPI A;  3OYA A;  4HST A;  4RLQ A;  1DQU A;  2XC7 A;  2OUM A;  4XL9 A;  3K4C A;  4YRV A;  3LSI A;  4ZTJ A;  3NWT A;  1TZL A;  1D0Z A;  4D1Q A;  1MNE A;  4XM3 A;  3HPG A;  2LBF B;  2M7A A;  4BDZ A;  4C2U A;  3HC7 A;  3K4M A;  2MYS A;  3ZXS A;  4CCO A;  1ERD A;  2KP6 A;  3TL4 X;  2LY1 A;  4OAZ A;  1OLT A;  1MMN A;  3N05 A;  4NC8 A;  2BVL A;  1WJB A;  4ZTF A;  3RQ4 A;  3LSK A;  5LD2 C;  1G8X A;  2R4G A;  2HVR A;  1MW7 A;  1WJF A;  1X1B A;  4XKC A;  4BDY A;  3RCO A;  2MAB A;  3QOE A;  4BUP A;  4BE0 A;  4HNU A;  2X6X A;  2XF7 A;  3LSG A;  2VKH A;  3VYR B;  1IRX A;  3VSL A;  1LDK B;  2GOM A;  4N4O B;  1PJR A;  5JHF A;  3LMM A;  4H4K C;  2M7B A;  2VKD A;  4ZDP A;  2R7W A;  2BW3 B;  1BOB A;  1ZEL A;  3PSI A;  1X4O A;  2LY2 A;  2V9K A;  3K70 D;  1V5E A;  5HNH A;  3CF2 A;  3PJR A;  2DT6 A;  2KRH A;  2KQR A;  3SEQ A;  3L2V A;  1Y6I A;  1X1A A;  4II2 A;  2LRE A;  3L2W A;  2GOX B;  3D5S C;  2VLA A;  3W3C A;  5KCM A;  4E4H A;  2CUJ A;  4GRI A;  2Q2E B;  1T0F C;  1WJC A;  3PUB A;  2V26 A;  4HNT A;  2KMU A;  1EA3 A;  1N75 A;  2IGN A;  3SZG A;  3K4N A;  3FDY A;  4E7H A;  2VQG A;  1WJA A;  5CKT A;  2R7Q A;  3PL8 A;  3OY9 A;  3DKY A;  2F4I A;  3DLA A;  1BR1 A;  3OWT A;  2BOL A;  1DGR M;  4KJZ A;  4KT6 A;  4BL0 B;  2W1O A;  3OYD A;  2R7R A;  1QU3 A;  1JI8 A;  4ZDO A;  3DTE A;  3KYL A;  3S3O A;  1Z21 A;  3OYG A;  3A1Y A;  4NQW B;  2ZXI A;  1NG7 A;  2K3P A;  1D0X A;  1Z3Y A;  2VQC A;  4CUG A;  4U87 A;  2HU9 A;  2V4J C;  2UUZ A;  4XKW A;  3QYF A;  2XSJ C;  2Q1Z B;  4XN3 A;  2X51 A;  3PNV A;  4CCL A;  3CP8 A;  4Y3O A;  3LSH A;  1K6Y A;  2V6E A;  4CA0 A;  3DTK A;  3QOD A;  4PFO A;  1D1B A;  2VQL A;  4XLH A;  5HVQ C;  3PNT A;  2FUG 2;  4PJJ A;  3E1S A;  1WJ5 A;  4DBR A;  2L2O A;  3H5R A;  2M4K A;  3J7A Y;  1Z7L A;  2Z1D A;  3L2Q A;  2LYC A;  4E6K G;  2W82 A;  4OAY A;  4BQQ A;  4D9J A;  4BXF A;  3OIQ A;  3K4L A;  2R7T A;  3OYF A;  4F52 A;  2PJR A;  3OYM A;  3HXL A;  3DPL C;  4XLF A;  4E7Z A;  1BR2 A;  2E5Z A;  2X6W A;  3OYN A;  3MKW B;  4BE2 A;  3VWB A;  3G2B A;  1KON A;  4C30 A;  4XR6 A;  2HQA A;  2W00 A;  1DGW Y;  2UWM A;  4LIT A;  2IGO A;  4J01 A;  2VJI A;  2Z16 A;  4HEA 2;  2E1M C;  3UR3 C;  2R7S A;  3U21 A;  4DIQ A;  1V5F A;  2KPM A;  2QKM B;  4F91 B;  4F93 B;  2DCE A;  4RM2 A;  2X1E A;  4RM3 A;  4XN0 A;  1X4P A;  4CCM A;  2VJ5 A;  5HNF A;  2OC6 A;  2VPL A;  3H9J A;  2L9N A;  5CQE A;  2F6C A;  2JSP A;  4IKF A;  2CFO A;  2WAE A;  3H5A A;  2CV2 A;  4XOT A;  2W4S A;  3PFY A;  3A2K A;  4IQ4 A;  5FRN A;  3BCB A;  4BE1 A;  3H0D A;  3OR1 C;  3GBG A;  4BEH A;  4B3X A;  3CES A;  2QKL B;  4XLC A;  1AA7 A;  3E0J B;  3TMO A;  4DOZ A;  2JA2 A;  3QYB A;  3OYI A;  2LRD A;  2CV1 A;  2IS4 A;  2IS6 A;  2DXI A;  4U7B A;  3AKZ A;  3OL4 A;  4QPO A;  1OR7 C;  2NOJ B;  1S9H A;  3FHN A;  3C2G A;  5CQG A;  3K4J A;  2Z2S B;  3ZRG A;  2VJJ A;  2BVM A;  4B44 A;  4F55 A;  4IX7 A;  1FMV A;  4DJA A;  1X1D A;  3ONQ A;  4DBQ A;  4CCK A;  1QHH D;  3VYS B;  3EPZ A;  4CH7 A;  1T95 A;  1PYV A;  2R7X A;  3OYH A;  2WBM A;  4BQO A;  3IP4 B;  5FRO A;  2MC4 A;  4HSR A;  2L5Q A;  4XLA A;  3RPU D;  1D1C A;  4E7L A;  3DU5 A;  4C9Y A;  4MLO A;  3ZGK A;  1N77 A;  4XMY A;  3S32 A;  4ZC3 A;  3IAM 2;  3OS2 A;  1LVK A;  3VYT B;  4LIU A;  4BJT A;  2XF6 A;  3H9G A;  1UEL B;  4B48 A;  2HVS A;  2M3A A;  1BR4 A;  3DQV C;  3IUO A;  3TBI A;  4CSW A;  4EAT A;  2VL8 A;  2X85 A;  4R79 A;  2XF5 A;  4E7K A;  4LG3 A;  2OV7 A;  2ZSI B;  2DT7 B;  3ZR8 X;  2AQF A;  1MMD A;  4PJL A;  2JVG A;  1W36 C;  2CV0 A;  3OMY A;  2KZV A;  2L7K A;  3D5L A;  3EUK L;  2KLO A;  4PFP A;  1MND A;  2VQH A;  3VSK A;  1X1C A;  3HKZ A;  1J09 A;  4HG2 A;  2A6T A;  1DP3 A;  3OYL A;  3UNG C;  4AVZ A;  2HPM A;  2IS1 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...