2GWRA

Crystal structure of the response regulator protein mtra from mycobacterium tuberculosis
Total Genus 69
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
69
sequence length
227
structure length
225
Chain Sequence
DTMRQRILVVDDDASLAEMLTIVLRGEGFDTAVIGDGTQALTAVRELRPDLVLLDLMLPGMNGIDVCRVLRADSGVPIVMLTAKTDTVDVVLGLESGADDYIMKPFKPKELVARVRARLRRNDDEPAEMLSIADVEIDVPAHKVTRNGEQISLTPLEFDLLVALARKPRQVFTRDVLLEQVWGYRADTRLVNVHVQRLRAKVEKDPENPTVVLTVRGVGYKAGPP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA-binding response regulator mtrA
publication title Domain orientation in the inactive response regulator Mycobacterium tuberculosis MtrA provides a barrier to activation.
pubmed doi rcsb
source organism Mycobacterium tuberculosis
molecule tags Signaling protein
total genus 69
structure length 225
sequence length 227
ec nomenclature
pdb deposition date 2006-05-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00072 Response_reg Response regulator receiver domain
A PF00486 Trans_reg_C Transcriptional regulatory protein, C terminal
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 2gwrA02
3.40.50.2300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 2gwrA01
1YK0A 4I0AA 1LDJA 2MC3A 2L2QA 5KQGA 2F2EA 4MNUA 3LWFA 2IPAB 5LLQA 3M9WA 4M71A 4RB2C 2OZUA 1I1GA 4R8HA 1L0OC 2O3FA 3CNBA 2PLNA 4LDZA 3HS3A 1W5TA 4L18B 1AB6A 4A0XA 1JHFA 3DBIA 3CDHA 5BPIA 3F7NA 2FBKA 2ZMEA 5FB2A 2L4AA 2E4WA 1LJLA 2L17A 2DPDA 1T34A 1MB3A 1XGNA 1O3QA 2DRIA 3CUOA 2QYOA 3KP5A 1YK1A 3HTSB 2RKHA 1SD5A 2FSPA 2Y75A 4NQWA 4JAVC 3IRQA 1Z2DA 4R1HA 3COAC 2A69F 4UV9A 3BJ6A 1FYKA 5KC8A 4U0WA 2VE8A 2XAGA 3VFZA 5D5VB 5C5CA 3WGGA 2HQNA 1R23A 3FXUA 1XD7A 3LSTA 4EYQA 1YW7A 3P9CA 5DD4A 2H6CA 1P4XA 5B3JA 3TB6A 3RPQA 2IPLA 3OLYA 3NBMA 3HHHA 3N8IA 2WJAA 3I5AA 4L9NA 2LSOA 1IN7A 4G0XA 5FWXB 3E5UA 2O0YA 1D5VA 3ELKA 1U78A 4UVBA 5JR3A 3S2WA 3KP6A 3ROTA 4H60A 4FB4A 4CHUA 3B2NA 2A9QA 5K1YA 1MD0A 1T98A 1XMAA 2K02A 2YR2A 2IPQX 1BI1A 4I7HA 2JCGA 3H5LA 2ZJ2A 1VTNC 4LLLA 3J80Z 2IP2A 4KK3A 3GZ5A 1SRRA 4HQEA 1M2EA 5TPWA 3TD9A 3KE2A 3MEXA 1RIOH 3UUGA 3CU5A 4ZPJA 4RK7A 1UDRA 1E6LA 5JNVA 4H0EA 2HOEA 1DRKA 2HGCA 3GW2A 3DV8A 4Y15A 3CTAA 4WF2A 2RDMA 1SMYF 3MQ0A 4OIRF 3CUQA 1EH7A 3GYHX 1TNTA 1YMUA 2JTVA 5HQJA 5BMZA 3V7SA 4B8XA 2TDXA 1TJYA 1ZY2A 1KQ9A 1HKQA 1USTA 3F22A 4RY8A 3TO7A 3RVJA 3M9AA 2BE5F 4KA4A 4Z4CA 3MYYA 2XDYA 4A5MA 3FWEA 1FY7A 2VT3A 1WETA 3U2RA 2FLWA 2BEOA 3EQ2A 2JK1A 3E5QA 5EWLA 4RK4A 2OQGA 3F8BA 3GFJA 2QVCA 1XGMA 3Q9VA 1F4KA 5JS1A 1S8NA 3ZMDA 1DBQA 1SMTA 2PMCA 3GYBA 2IT0A 2PUEA 1KMIY 4P9UA 3L2CA 4XSXF 2YU3A 3I54A 1HBXG 1IF1A 1CF7A 5DUKA 4RK1A 2UZKA 4N0PA 1JX6A 4CBVA 4KK4A 2MLGA 1LQ1A 3Q7SA 1QPMA 5TQ2A 1LEAA 4L85A 2GXBA 2F5EA 4BH9A 3D02A 2Q2EA 1W9HA 3WTXC 3LUCA 5EWMB 1UHMA 4BNCA 2Q5CA 3SHFA 4I01A 4EGYA 5HDKA 1XMKA 2A9RA 3F8FA 3T5XA 4G0MA 3B02A 3KKEA 4P1ZA 1F1ZA 4MQFB 1KQ8A 2PAFA 1ULYA 4ZYGA 4IGAA 5IUNC 4Q7EA 1MJBA 1K78B 2Z9OA 2NUBA 1ZVVA 4IJAA 2IA2A 3MCZA 1MDMA 4PCQA 4WXDA 1NXXA 3O2SB 4EMSA 2M45A 4LLNA 3JW4A 2FEPA 2NYXA 2FXIA 3QX8A 3C3MA 2PE5A 5J6XA 2R48A 4AWXB 1TVMA 2MLKA 4RKQA 1U5TC 1ZGJA 1FFGA 3FDFA 4M9SA 4U0VA 2PQ8A 4A0YA 4IRGA 5TQJA 1GCGA 5T7BA 5D5WB 3E3VA 4M6XA 2VOPA 1BVHA 4EJTA 2QENA 3JVDA 4W5OA 3ILHA 4IMIB 5HLIA 4OIPF 4HZFA 1BA2A 3K1NA 1EAYA 3E6DA 1F5TA 1JYEA 3I42A 3IC7A 2A61A 1IUYA 3BP8A 2CWDA 3CZCA 1O57A 4WT7A 5DEQA 2VC1A 4GYIA 1FP2A 5KQPA 4OMYA 4W5TA 5DD8A 1JFVA 5DCLA 1FFSA 1ISSA 5FGMA 5CVJA 1BOAA 1ABFA 4G9YA 2P9HA 3WTSC 4LRQA 4F11A 1G4DA 2EJRA 3QLUC 1LJ9A 4L0YB 4GO1A 1IN4A 3KZYA 4CXFA 2QV0A 2GA2A 1MGTA 1HSTA 3EQZA 2C6YA 3HRMA 1KRXA 5DCMB 4XFKA 2ZAYA 4GXOA 3F73A 1DDNA 2YSRA 2ID7A 1I3CA 3M1EA 1SXGA 3MF4A 3HUTA 3IPCA 4QYMA 1ON1A 5AIPA 4BHBA 4KMFA 1QO0D 4EJWA 3JY6A 2JT1A 3PQJA 4P5OA 3LFTA 1KRWA 2EFNA 5CNMA 3HSYA 2HDCA 1C0WA 1EWVA 3DGFC 5DCFA 4CYDA 2MA3A 4RK5A 2EB7A 1Y0UA 3P9KA 3KZZA 1JFSA 2FKAA 4HNSA 3WU0A 5I4CA 2ISYA 3LAPA 1TLFA 2F5DA 2QQ9A 3LA7A 5FLXK 4FE7A 5FLXZ 2A9OA 3O1JC 1JDPA 1ZG3A 3GXOA 4N47A 1FPQA 3DP7A 3DPTA 1ISRA 5BQ3A 3NHZA 4UXNA 2W24A 2E4UA 4E7PA 3MMNA 1NHAA 3QAHA 5FWXA 2OAZA 2CSOA 2VUHB 3HRSA 4EVQA 1KYWA 3U9GA 1DPUA 3KJXA 5FWYA 1W7PD 3IP6A 1UCRA 3QK7A 3IWZA 4KN4X 4KZKA 4JOQA 1NXOA 3LUHA 3T6KA 4KMRA 3GRCA 3DQVC 3WTVC 2R4QA 3ZMZA 4MR7A 4KIFA 5IC5A 4Q6WA 3T8YA 3HSRA 1BI0A 1QPZA 3GVAA 2EFPA 4YFKF 5E20A 3CRNA 1QZZA 4RB1A 4FX4A 3F8NA 3IKVA 4M9XA 2DT5A 3GEZA 5JNUA 3A0UA 1TQPA 3CKMA 2XASA 4KIBA 1PDNC 5IULC 3D0SA 3R4KA 2VBZA 2XHKA 4MRMA 4ESFA 2FNAA 1QGPA 4U88A 4MPTA 2PN6A 4KRFA 3SG0A 3I45A 2RJNA 1MVOA 2FRHA 3JTGA 5E1WA 1PUXA 1TW2A 3R60A 3JS5A 1QO0A 1Z2EA 4EVSA 3WGHA 5CVVA 1I6XA 1IXRC 3QX9A 2NNYA 4G7HF 3RTRA 3WU1B 2V1XA 4XASA 2ZKZA 3RJPA 1H0MA 3H1EA 3HRTA 3BY6A 4XLNF 1IXCA 1XSXA 2W25A 3RKWA 3HHGA 2VONA 4EJOA 2H6BA 2KYRA 3EQLF 2PUDA 2F8SA 1XHFA 1XGSA 2GZWA 4AIHA 2V9VA 4WK8F 4GCVA 5ICCA 4GNRA 2W84A 3EYYA 1ZGGA 4HLYA 5DGCA 3RVSA 2JVIA 5JHUA 4WUTA 3C6QA 3ZN0A 4M72A 1ZRCA 1BAPA 5ERIA 4ZYDA 2EFWA 2FQXA 3M6MD 4WWHA 3HK2A 3CG0A 5FFXA 3GBPA 2OD5A 3EGCA 3KP2A 5F64A 1NTRA 3K1MA 2VT2A 2EK5A 4QLCU 4OIOF 3RVPA 4P96A 2M1BA 4MQFA 3IP9A 1GXQA 3D8UA 1HW2A 4O5AA 2E7WA 1UHWA 1V4RA 4BXUA 1K7AA 3HOSA 2KJBA 1K78A 4RGUA 2JB9A 3V7CA 4YIIA 2B4AA 5C5EA 1NXVA 5IUJC 2HSGA 3QP5A 2STWA 3MA0A 4W5NA 1W4MA 3EODA 3KLNA 3LMKA 4ZMSA 3KEOA 3N75A 4W5QA 2BV6A 3EUHA 4UHJA 1HW1A 1EV7A 4TV7A 2VK2A 3O3KA 9ABPA 1NATA 1D1QA 1ZHHA 1T0FA 3RVMA 3F23A 3WTZA 5IT9K 3EDCA 2Z99A 4HX7A 5IT9Z 1DP4A 4JASB 3ZP5A 1SFUA 4WXCA 5LHIA 4MQEA 1RZRD 5TRDA 1Z13A 5DDGA 5D4SA 3HSFA 1D4ZA 2M87A 1LK0A 4QICA 2K7LA 4OLBA 5H6QA 4Q47A 3TMYA 3B73A 2HEOA 3GBVA 1APBA 2UXNA 3MM4A 4N76A 4Z4FA 2XROA 1G6NA 4O6JA 4YP9A 3G3ZA 5FBHA 4D0PA 4CZZA 1K6OA 1MZBA 4S04A 2NT3A 1STZA 2IW5A 5CNJA 3N6VA 3C7JA 3SM9A 2A68F 5LEJA 2GWRA 2QQAA 4Q6BA 2HYFA 1FBQA 3I58A 1YYVA 3E97A 2HKXA 1HQCA 3IRRA 3HZHA 3OLXA 1YIOA 3Q9SA 1Z12A 1FYLA 1YMVA 5E18F 5JS2A 3O74A 5T3YA 2PBIA 4LE0A 5TE9A 4RGXA 2LF8A 3KCNA 2EA2A 4BQAA 2RC4A 1LJUA 4O1IA 3IP7A 4PZ0A 1CHNA 2LBPA 3VNBA 2O03A 3FM5A 3A10A 4KQCA 1CEYA 3LUGA 5D2CA 2PUCA 1J2XA 4Z4HA 3H5VA 1ZITA 3M8FA 3H6HA 4Y17A 3K9TA 1QBJA 1TTYA 5ILSA 2FNPA 1NXSA 5LGTA 1ZH2A 6PAXA 1S29A 2FE3A 4HYEA 2AS5F 3TDUC 2JSCA 4G0PA 2HTSA 1PP8F 3K69A 4A12A 4G0ZA 4RSMA 1O3SA 2VBXA 4L5JA 5AONA 2E7XA 3TOAA 1Z9CA 4G7OF 1U5TB 5B3JC 2FW0A 5ABPA 1ZAYA 5FD5A 3L9FA 4RU1A 4XSZF 1NY5A 3MZYA 4RXUA 3OQNA 3WGIA 5KC9A 3BWGA 1T2KA 4OATA 1OR7A 1RZRA 2GAUA 1XGOA 1QQAA 2PFBA 2Q0OA 2IPMA 4ZYHA 1Z15A 4HQMA 4Q4ZF 3H3UA 3ZMTA 1AOYA 1R5HA 5CJ9A 1IXSB 4KICA 2FLKA 1S3JA 2HFHA 1USKA 3H6GA 1FP1D 3H92A 2RJOA 1QMPA 1ZN2A 4LE1A 3SZTA 2M98A 3JTHA 1JHHA 5TQ0A 3V8LA 1DRJA 2ID9A 1UB9A 4BHPA 2XUBA 5LRRA 1D3YA 1P6RA 3KLOA 3DKWA 3BROA 1L5YA 2BBYA 4DNCA 5TPZA 1GLGA 2D2WA 4KN7X 4ZYLA 2HWVA 5LGUA 1Z25A 4XLTA 5D5XB 4RDCA 3LOPA 4U7DA 1OMIA 3CUQC 4D6XA 1XB4A 3I09A 3QLVA 2HYGD 1J0RA 5KQMA 3Q7RA 3J7AO 2FMIA 5TJJA 4LB6B 3GWZA 2HTJA 1GVJA 2HS5A 1A2OA 5H6RA 2IYNA 1ZREA 3QLTA 3HOTA 2VODA 3H5IA 4UHKA 4IILA 5L3EA 1O3RA 4IRXA 3DXJF 4WX9A 4RB3C 1RXIA 1FSPA 1SD4A 4HNQA 5HSGA 3LUFA 4N0QA 3LUAA 3F6OA 3R0JA 4YS6A 2ZCWA 5KQLA 3ZPLA 4PGHA 4KVFA 3N0RA 1BIAA 2WC2A 1XCBA 3F8MA 3QPHA 3SZPA 4ZZDA 5D8KB 4HF2A 1CGPA 3ZQ7A 4LB5A 1ZG1A 5EWJB 1U6GA 1R00A 4QWQA 4P98A 2QZJA 3WTWC 4IMJB 4DQDA 4XLPF 3HUUA 2E4VA 4RY9A 6CHYA 2NRAC 2H09A 2DK5A 3P7NA 3ROUA 1KU7A 1Z18A 1U04A 1YS7A 2A5YB 2O61A 2ELHA 1DCMA 2QXYA 4LGWA 3GX4X 2JVJA 2K4BA 2XRNA 3TOBA 4EV0A 4MHGA 2DK8A 1YO5C 2NNNA 4EQQA 1Z16A 1GHCA 1IRFA 3QOPA 1SD7A 2Y48A 3M7GA 4JB2A 3E6CC 5L3GA 1JFTA 4ENJA 3BRQA 1RPJA 3GT7A 4Z9BA 3SAJA 2D1VA 2JRTA 1X3UA 5ILUA 3WE3A 2W42A 4LX8A 1Z6TA 1QP0A 3JPYA 1O3TA 4MEYF 3T0YA 2O8XA 2JBAB 1ZLJA 2GA1A 1BN5A 3KSMA 2QVOA 4YGXB 4L9TA 3FFTA 2I6FA 3E6MA 1B9NA 1U3EM 1DC8A 2L01A 2H94A 2FVYA 3QEMB 1P4AA 4PEVA 1XN7A 4YFNF 4YG2F 3GFIA 2FN9A 4NICA 3T8RA 1FFWA 2JRLA 4FT8A 2FMYA 4LLGF 1ZRFA 4LZLA 1O7LA 1ZHFA 2G9WA 4AVPA 5BPDA 1YLFA 3KHTA 1GUDA 3SY8A 4WXMA 4HLXA 2YPRA 4BAYA 1K68A 3FFWA 2A6HF 1BM9A 4LJZF 1IN5A 4OTZA 2FN8A 3DGEC 5HOOA 4WWCA 2V79A 5JNTA 2PLYA 2ZNZA 1FLIA 5CNIA 2MSKA 4NCBA 4HV5A 3WG9A 1LVAA 3LQRA 1QQIA 1FOKA 2JPCA 1TM2A 4YCSA 2E1CA 2DW4A 4MYRA 3HJFA 1VLZA 1JWLA 1DG9A 3R6SA 4EYKA 4U7BA 1DCKA 2PUGA 4N41A 1XCVA 2FSWA 5E8IA 4YIFA 4L9VA 1G3SA 3ZMVA 1OXBB 3QELB 3RH0A 3Q7TA 4PGGA 1ZDMA 3L09A 2IKSA 4HAMA 1VKRA 2HQBA 3GL9A 4A6DA 3VNAA 1LNWA 2VBYA 5H20A 2X7XA 3FMVA 3LQQA 4L5IA 3H5WA 4RV5A 3JAMK 4MR9B 1S6LA 2JZYA 2E4XA 4KQ9A 3L00A 1J75A 2Z3YA 2LNBA 1IN6A 3MFKA 2QQBA 4Z4EA 4FHTA 1XHEA 3GO5A 3I0TA 3ABTA 4MTDA 4H3HB 3JTEA 3TX6A 2FQ3A 1YVUA 2HJ9A 2LPMA 5K5OA 3M8EA 4NB5A 1ODDA 2QVGA 4QPJC 3ECHA 1YFHA 2W85A 3IKTA 2R3SA 1FBUA 4I2OA 2PUFA 1NXPA 3JVIA 3H5TA 1BC8C 2VN2A 4MGEA 3O2PE 2L4MA 5J8CA 1HKTA 1FZPB 2B1JA 1USSA 3GF2A 3RVNA 2NT4A 4BHCA 4LG0B 3VB2A 3DZDA 1U8RA 2VC0A 5K5RA 1T38A 4Z4IA 3K4HA 3EULA 1ZYRF 3VEPA 1B4AA 5BQTA 2AYXA 4EYOA 1C4WA 2ZFWA 3BBLA 3SXYA 1VPWA 3OLZA 3SFZA 3WTUC 1HEYA 4F12A 5L3FA 4HX4A 1LBHA 2CHEA 3ZMSA 3ROFA 4ML3A 2XKPA 3D5LA 5D5UB 3FGZA 3KYJB 4NV3A 2ACJA 3E61A 4YRZA 5LRSA 1QNTA 4I09A 4MGRA 3CZ5A 5FO5A 2BGGA 1J9IA 3A3KA 1KU3A 2NAZA 3HEBA 1T6SA 3OM1A 3FXRA 3EAFA 3URMA 2FEKA 2HQOA 4MEXF 3I71A 1W25A 1R8JA 4JBAA 3SQNA 1EWTA 5L3CA 1HW5A 3F6PA 2FTKE 5HVQC 4ENKA 4D74A 2IDMA 4MLCA 2CO5A 2COMA 1TQIA 3T1BA 2PJPA 4ESJA 1Y1LA 4RK6A 1FWZA 3K2ZA 1E6KA 4O1HA 4Y13A 3FFXA 3C97A 5LHHA 3ILYA 3TDZC 3O6BB 5FD6A 4BYYA 4RY0A 4N03A 5GQSA 3CTPA 1R36A 4G0QA 1R1UA 4RWEA 1RZ4A 1TLHB 4RS8A 3TKYA 2J5PA 3K1PA 2WMYA 2IJLA 2XAJA 3CJNA 2PKXA 2ZXJA 4M73A 4EVIA 3V8KA 2FMHA 3N0WA 2MH9A 3H1GA 2DU9A 4W5RA 1J56A 4OU0A 1NXWA 5KWSA 3WE2A 3L7WA 2LUOA 4YLEA 2MH2A 2EFOA 2ETHA 3MQ4A 1I1SA 3RQIA 2B0LA 3P9YA 4G86A 3FM3A 3N97A 3CG4A 3C1DA 3R61A 4ENMA 2XIGA 1PEAA 3E3MA 4FE4A 4I98B 3RVOA 2OZ6A 1SXIA 4DN6A 1EHCA 1U2PA 5HKOA 2FMFA 3L49A 3BDDA 4HBLA 1H9TA 5KI6A 4MR8B 3N53A 3S99A 2NZUG 2IVMA 1D5WA 2ZBKA 2JPBA 2AYZA 3RVRA 2KJCA 1YQAA 2OENG 4TLLB 5ICGA 4M9ZA 5TPWB 1Z91A 2UXXA 2KIFA 4F7ZA 1QKKA 1W5SA 1ZLKA 2JBAA 2FQWA 4RGSA 5EWMA 4HA8A 1WRJA 3HRUA 3IDOA 1RNLA 4YR7A 1R1TA 1YG2A 1FBSA 3QU6A 2QU7A 3W6JB 2MYTA 1QQBA 1SFXA 1KGSA 4YO7A 3QEMA 4TMYA 1MAVA 3RKYA 1Z6RA 1DZ3A 1B59A 3F3XA 3K0LA 2WJWA 2WTEA 2MBFA 4A6EA 4D6YA 2P4UA 5PNTA 1DPRA 4KYWA 2WB4A 5ICFA 3BOQA 4L0ZB 1FSHA 3TO5A 1AWCA 2RGYA 2F8TA 3GZ6A 3HVRA 5DKFA 4XBFA 1IN8A 1RUOA 3LUDA 2FBHA 4AD9A 4KT5C 3LUKA 2FXAA 1G3TA 1E17A 4MS1B 1Z26A 1AB5A 1BBYA 1OPCA 4U0YA 3NQOA 2LIVA 5DV5A 4UNOA 4LK0F 3UKJA 3G85A 3J81K 4O3MA 2K4JA 4OINF 3OMXA 3J81Z 4GYGA 1B6AA 1URPA 5TQ2B 1E2XA 4OMZA 4YFXF 3QELA 1PHRA 2YHBA 4YV7A 3FZVA 2O20A 2RV8A 5TPZD 3A0RB 3HXMA 5ILVA 2RNJA 4P9FA 4RB0A 1FSEA 3GA5A 5DCMA 3W9SA 2FEWB 3FX3A 1L5ZA 3CLOA 4MR9A 3LUJA 4EGSA 1K66A 4LMYA 2QUFA 4RXMA 1IIBA 4KIGA 1OYYA 3PFIA 2DQLA 1G3WA 3BPXA 1GUBA 5E1XA 4MQVA 5LGNA 1S7OA 3OV8A 1B9MA 3MZHA 1KYZA 4YWHA 1QZYA 1TNSA 3HDVA 3EJWA 3DEUA 4OOIA 1H9GA 4M6YA 4Q48A 5HM6A 3Q5FA 5ED4A 1ZG5A 3DLHA 5EEGA 4HDUA 2PUBA 2MYNA 3BZ6A 1SXHA 4LD5A 2G7UA 3REOA 1HXDA 1BI2A 2VE9A 2HPHA 2VUIB 2MD5A 5AIQA 1D2AA 2ZWMA 4G0YA 2XAFA 4AIKA 4PYRA 5EEHA 2J5OA 2YX7A 3F6VA 3I5UA 3KEQA 4EUKA 2EWNA 4ETIA 2P5KA 5HDGA 1WI9A 3F6CA 3V7RA 1REPC 2EA4A 2W57A 1MKMA 1DJMA 4KREA 3TQNA 3H1FA 2PMUA 2DFIA 3RI4A 1SAXA 4L4UA 1C0EA 4CO8A 4ZYEA 2P4WA 2E1NA 1S7AA 3JSOA 4ZZLA 1XDSA 3RPUA 3O75A 1CYEA 5DUIA 3OQOA 2P7CB 2JVKA 1UFMA 4ZMRA 1TW3A 2R47A 4RKRA 4KV7A 3OLVA 3JPWA 1U2WA 3QLVC 4XRFA 4L9JA 1ZH4A 3DLBA 1U8TA 2STTA 4E7OA 1USIA 4IHSA 3NEUA 4PZJA 3IPAA 1ZESA 2EV5A 4XAQA 2IA1A 4GPAA 1QP4A 1GCAA 1D8KA 1FT9A 1P2FA 5IUKC 1P8AA 4UHTA 4M74A 1OXKB 1LEBA 3KG2A 3HSEA 4ZJPA 1M5TA 2DQRA 4IXAA 3AAFA 2GI4A 2LP4Y 3KYIB 3OO1A 4HOBA 1KQ0A 1V3FA 1DCFA 1ZAOA 2V1UA 4KFCA 3PQKA 4HNRA 2FEZA 1OYIA 2N9UA 1SD6A 3QRFF 2M30A 2RDPA 4NHJA 4O5VA 4LDAA 2HKOA 2TMYA 4MAAA 1VRVA 2J48A 3ECOA 3Q41A 1PP7U 3DF8A 2OA4A 5FWYB 5BOXA 3HDGA 4ETSA 1JBEA 5CVIA 4HF1A 4XXHA 1KA8A 2GKGA 2OBPA 1DUXC 2CGPA 4MR8A 1BDIA 2PJUA 3J80K 3CO7C 4MR7B 2QW1A 5LHGA 2Z5UA 2FBIA 2HZTA 1BIBA 3NRVA 4MTEA 2WRZA 5CYVA 2XV4S 2P8TA 4F06A 2V0NA 2L3DA 3TGNA 3HM9A 2FA5A 4HX8A 1WKMA 1MB0A 1DBWA 4G7ZF 2F5CA 3HYIA 4I02A 4MRMB 5E17F 4UV8A 4NCAA 3OOPA 1A0OA 4EVRA 1R7JA 1WQ2A 5K5QA 3TO6A 2CG4A 2A07F 3FXQA 2RQPA 2VOOA 1JHZA 4KMUX 2EV6A 2ZO4A 1IAWA 3FMQA 3H75A 4PDKA 4OLAA 1BDJA 3MIZA 3FF5A 2E4ZA 1E6MA 2X0LA 3I64A 3HO1A 2IA0A 2DLLA 1Z17A 2ISZA 1JH9A 2PEXA 1BI3A 5FBKA 4WCGA 2P6TA 3F8CA 3C18A 4MS1A 3EDPA 4JP1A 4WZZA 5CVRA 2DO7A 1R5GA 3HCWA 1ABEA 1ZGZA 5A2QK 4P55A 3ABUA 4UVCA 3F21A 3BREA 5A2QZ 1PNRA 4ZH4F 5BS6A 2G7HA 3LA2A 2UWMA 5E8GA 1PNTA 5DYMA 2QLZA 2MYPA 2M8EA 4GGGA 4RAYA 4MS4B 5JNRA 2MYUA 3WODF 3GUDA 4HDVA 4ENNA 4ESBA 1JXSA 4ASNA 2CWEA 4G97A 1G3YA 2PMHA 2XVCA 3GWGA 1EH8A 5BR1A 4B09A 2PI0A 1W7PB 4EM0B 3NHMA 1FC3A 1Z1DA 2E4YA 5CHYA 1R1VA 3H5OA 1ONVA 2CHFA 3KETA 4EM1A 4IHTA 5KK1A 2MSWA 4Z99A 3KFWX 4IF4A 4HV6A 2Z33A 2CFXA 3U1DA 3BILA 4CDGA 1OYWA 1PUEE 4QYWA 4EY3A 1D1PA 4H3KB 5HS9A 3G73A 2KIUA 4KPYA 2GX6A 1EWKA 4ON0A 2DI3A 1GXPA 2CD7A 3I53A 5IEBA 4MQEB 3EETA 1IZ1A 5E1ZB 1JE8A 1XWWA 1JDNA 3NNNA 4F3TA 2H0AA 4JK1X 5F1RA 1B1BA 1P6UA 2L54A 2HR3A 3DFGA 3MWMA 2R7FA 2GIVA 2F5FA 1ZRDA 4N0BA 1SFEA 2QBYB 1YTYA 2D1HA 2A9PA 4OIQF 2WWYA 3JAMZ 1U5TA 4A5NA 4Q5SF 4HW0A 3HUGA 3G1WA 2GXGA 1JYFA 4JQFA 1ON2A 2ESHA 3IWFA 5JNSA 2KKOA 2QZ8A 4IRIA 1Z7UA 2LKPA 1MJAA 3P9IA 1EFAA 4FX0A 3W6KB 1B00A 2L18A 2RGVA 2FU4A 5CNKA 1L3LA 1OKRA 2Y0MA 3HV2A 3CLKA 3I59B 1FNNA 2QM3A 4MQ9F 2R25B 3WTTC 2XAQA 4KNYA 2H27A 4LK1F 5L3DA 3VODA 3O2QB 3BJAA 1HSJA 4EM2A 1XSVA 1KU9A 2DAOA 3E6BA 2V6CA 1LB2A 4N9HA 1LBIA 2FOKA 3GFLA 3L6UA 3O2JA 3LFKA 4Z2YA 4G8XA 1F4VA 2CYYA 3NNSA 4UVAA 3QLUA 1MJ9A 3BJOA 4RZSA 5ICEA 2P7VB 3ML6A 4MS3B 2A3SA 1JLKA 5HLHA 3QU3A 3M9XA 2OQRA 1T39A 4LE2A 3GFMA 3ZMUA 4G6QA 1FQWA 2YX4A 3C3KA 1MIHA 3ULQB 7ABPA 3K9CA 4NQRA 5BRAA 2ZNYA 4KDPA 1O7FA 2P6SA 3QP6A 4MLDA 1WWXA 3VOEA 4PICA 3RVKA 2IRFG 2H3HA 4TN5A 1Z05A 4OG2A 4KUMA 4E70A 3OM0A 2ZMEB 2LF7A 3F72A 2L19A 1TBXA 1F9NA 3KP7A 2IOYA 5LEKA 1H9CA 4RXTA 4OBBA 2DTRA 1D8JA 1XDUA 5D4RA 2D45A 5BRJA 1TQMA 3KP4A 5GOTA 4IRHA 3T95A 2FF4A 3HIFA 3R0AA 2YHAA 5EWJA 1J5YA 4CGZA 3SNKA 2MSLA 2X4HA 2XAHA 4A0ZA 5HDNA 5DLEA 3E5XA 3LA3A 1R58A 1ZARA 2RN7A 2CQKA 4RGRA 2EFQA 3KCCA 2VBWA 3ERED 5TQ0B 5FFZA 5IEJA 3GLXA 4UUVA 1P6QA 5IT3A 3LAJA 2K86A 5LBQA 5JI6A 1DBPA 2AXLA 1YW9A 4IVNA 1J59A 2DPUA 3O1IC 2EV0A 5F6FA 1ZH5A 2L02A 2V1DA 2ESNA 3LTEA 4EYGA 1YTUA 3RYRA 3FMSA 1JF8A 2NS0A 1DC7A 5HS8A 3H3ZA 3UK0A 4R79A 1YW8A 4JB0A 4ETMA 4K2EA 1P4WA 3RKXA 4RK0A 5CVUA 5DTEA 3GV0A 3CFYA 3LKBA 2GBPA 1RI7A 1EH6A 2IPNA 2RVCA 4EGZA 1U2QA 3KS9A 4A2UA 1QP7A 1BJAA 4DADA 1ZGAA 1A04A 2R7DA 2VXZA 4AIJA 1NXTA 2QR3A 1E2BA 4PE5B 3CUQB 2K27A 4LFUA 5HLGA 3V8JA 2GQQA 4MS4A 4EJUA 4N9IA 4RAZA 1RXEA 3MAJA 5IX8A 3Q15C 4JA2A 2ADUA 1FYMA 4RS3A 1IW7F 3TO9A 1M2FA 1XSDA 6ABPA 5JFRA 3T38A 4EJVA 2M5WA 1W7PA 4G0OA 4XARA 5JVTA 3FHZA 3C3WA 5EWLB 4Y9TA 5D6FA 1QNLA 1I27A 3KTOA 5D6EA 3CS3A 3DPLC 1P92A 3V4GA 3CO6C 2VYCA 1CF7B 2NZVG 5JNWA 3BPVA 5E3JA 3T8TA 5D8LB 2XKOA 4HF0A 3RVQA 2P5VA 3O1HB 2Q8KA 3N0XA 1I5ZA 4TLMB 2WWVD 2WY2D 3IL2A 4DQ2A 2P5LC 4G6DA 5CLSA 2OU2A 1BDHA 1LDKB 3RVLA 3O21A 3RYPA 4Z0NA 2PUAA 3EYIA 1DP7P 3QPTA 2BGCA 5HS7A 4F8JA 2KRFA 5J8FA 3NNDA 2CW0F 5KVRA 3RIRA 8ABPA 3JSPA 1U0SY 2QBYA 1KU2A 2XGXA 4M88A 3N4MA 3I4PA 4CICA 2A6EF 2LDUA 3CHYA 2PG4A 1JGSA 2PL9A 2FMLA 3RDIA 2QSJA 2WV0A 1MDMB 1YS6A 3OLWA 2HQRA 1WSUA 3HTUA 4IPAA 2O6GE 4Z4GA 3FMRA 1F51E 1JL3A 3OMWA 4G94A 1HKSA 1RUNA 3I59A 1PEYA 2M1ZA 3ISPA 1TMYA 1USGA 1FX7A 2FQYA 1LDDA 3BRSA 3WTYC 2PL1A 2BYVE 3OO0A 3OQMA 2QWWA 3IHUA 5IBQA 4LG0A 1M5UA 2KIMA 3KP3A 2DBBA 4S05A 4WXHA 1BC7C 3ZN1A 1K79A 1IRGA 1R22A 4I0BA 5L3BA 1J7KA 4Z9AA 3QEKA 1Q1HA 4MS3A 4ETNA 2FMKA 3IP5A 4WXEA 3LKVA
chains in the Genus database with same CATH superfamily
3K15A 5B7GA 4PJMA 5CFRA 5C8VA 3CNEA 2Y93A 3M9WA 4MJLA 4IH4A 2PXCA 5BY2A 4X91A 4L2IA 1ST3A 2GHQA 3SDSA 3H18A 3QY0A 4C7JA 3HS3A 2QQ8A 2B99A 1OH6A 4MJXA 4XIYA 3F0CA 2ZBFA 4ZC3A 2PRIA 1YIAA 4E7ZA 1JECA 4RF2A 3ECSA 2VKEA 4N7RA 1UPAA 5EIEA 1ZH6A 4EKGA 1QZUA 4CTMA 2W2LA 3HTSB 1UKAA 2RKHA 1Z7YA 4G0VA 3AONB 3RUDA 4LBVA 3RCOA 1XLTC 2G1PA 2Z56A 4KBGA 4AX4A 1AKVA 4DMCA 2XYGA 2BDEA 4P34A 5C4IA 3WKBA 1DOAA 3PL8A 2VPLA 4JEUA 2IV3A 1II8A 2RHJA 4PSCA 4CM9A 4HWTA 3ZHYA 1I8TA 1GL7A 1I33A 4G01B 3MD9A 3T1TA 1UOEA 5L7WA 2V7WA 1V8FA 1ZO8A 4IKFA 3IOMA 1SRRA 3TD9A 1KMQA 1Y5LA 3OZWA 2WOOA 3E0JB 2DHCA 1JHXA 1Z45A 2BLNA 2JD0A 4XIIA 1KMHA 3MJHA 2B0JA 2I03A 3R8FA 2IYRA 4NBQA 3D54D 1VIYA 2TDXA 3EGDB 1TJYA 1OFHA 2QLNA 2JAQA 3G1TA 1J0EA 3FMFA 5EZ6B 1B6RA 1QA6A 4D9IA 3OKAA 1E5LA 3UXMA 2ZJQF 1SU7A 1NVAA 3F8BA 2ZDQA 5IF3A 1DBSA 3RRFA 1AMNA 3SOPA 1EX1A 4OHBA 2ZTSA 3HE3A 2WG2A 1QF6A 1NP7A 4L95C 4GX0A 4CM3A 3FUXA 1T0IA 2GNOA 4A8JB 3D6TB 1I0LA 3IGFA 2MSEB 1T1RA 1V8PA 5A0VA 5F98A 3QOXA 1E96A 4GOKA 2NSJA 4TS3A 1BW6A 1PQPA 5JMPA 4PQYA 1KZYC 2M3AA 5AW9A 4RUKA 5L4NA 1TCVA 1KQ8A 2XT0A 3HKDB 1E3QA 1T5LA 4Q1DA 1I1HA 2IA2A 5KSYA 4K9QA 4KDEA 5LCXA 4C3HJ 2C9MA 3VM6A 1W8IA 2OZLB 1ZGJA 2V4JC 3CMAI 1K5GA 2UZAA 2C8LA 4OO3A 4EHDA 4EJTA 5GPCA 1FSZA 4UMEA 4OXKA 4JSTA 1JYEA 3S3OA 3IQIX 3CZCA 3S3TA 1E3HA 3UYLA 3B3GA 521PA 1ML3A 1JP7A 1TF2A 5EINA 4E3ZA 4QOIA 2GHIA 1A7KA 4UQLA 3B5IA 1Y3IA 4G26A 2XE8A 4NH0A 2EG5A 1XNRB 3K70D 1BFUA 1G4DA 1FIUA 4OQDA 3F9KA 3R9KA 4F9GA 5FTWA 4QOGA 3N2IA 5B1EA 1DDNA 4XM3A 2BRUA 1Z7EA 3WBKA 4YRSA 5IDQA 1UC5B 4U39A 5BW8A 3RRJA 4N3GA 2QTBA 2Q3BA 5KMGA 4RK5A 4EOGA 1BVUA 3DO6A 3KQWA 5JXJA 4G5XA 1MABA 4NY1A 3B1XA 1Z37A 1NFRA 4BMDA 1VL1A 3KAPA 2AG1A 5FORA 1U5BB 4B6OA 4OFWA 3QPLA 2HU2A 3DPTA 1ISRA 5BQ3A 4DV4B 1U8YA 2XA9A 5AM4A 2OHHA 4I1UA 3C3XA 1R4ZA 2PYZA 3W6OA 3K70C 3AQ4A 4NU0A 1PS8A 2Z3WA 2R5FA 4HDSB 5BQXA 1CQWA 4KMRA 4EG8A 5GONA 2G5CA 4OHFA 1M2OA 4TL7A 2R8RA 2YCBA 1I6KA 3GVAA 4LX0A 4AN4A 4HATA 1PNVA 2X1DA 2LCIA 4JU9A 5KUTA 1TQPA 1TD9A 2HK9A 5T6MA 3WKAA 1ZM4A 4DLRA 1ZK0A 3ES9A 2X6YA 1QYVA 4F4JA 1EM8A 4G5QA 4DF3A 3EAQA 5KVSA 4RBOA 2WTXA 3DOEA 1P74A 2YN4A 4OGFA 2VN8A 1XSXA 5DRTA 5FKJA 4O4HB 2KYRA 1SHLA 1ZN7A 5EQDA 4F4UA 4AIHA 4BO3A 1V55H 5L3QA 2W84A 2PL3A 3F5MA 2VCEA 1ZRCA 1LF0A 4KVZA 5K0LA 3HO8A 2Q99A 2H52A 2ZM5A 1TYZA 3WKEA 2AB0A 3RG2A 5EXSA 5HKAA 1KTIA 5CDFA 2GBFA 4B3HA 1PUJA 4F3YA 3MS4A 1Y4AE 4JU8A 4BXUA 4PNHA 2IBMA 2AN4A 1LWOA 1NNI1 3FOCA 1U4NA 3I62A 2MABA 1OROA 3DR3A 4D9FA 9ABPA 3OH8A 4L0QA 3PJEA 5LHIA 4EX6A 4M0EA 1D6MA 1QHXA 1VJDA 3EQ9A 1G2HA 5H6QA 1PG0A 5IH7A 4XRRA 5DHRA 2CSUA 2IZ5A 2LVSA 4YP9A 4QPQA 1F0YA 2DCEA 5DGXA 2Z0MA 4GSYA 5C4JJ 4EHHA 1V71A 3Q9SA 4Y2TA 3HA7A 3O74A 4REQB 1M33A 2IYYA 2ZMEC 1U7UA 1Y82A 3KUXA 3CJTB 4MX8A 3E9ZA 1GNSA 3IAM1 3GC6A 2VCHA 1Z4QA 4CCYB 2W6CX 3VZRA 2HUPA 3JQGA 3SICE 1E3TA 2AS5F 3TDUC 1P5ZB 3CEJA 3ND5A 4XB2A 6Q21A 2VBXA 2J87A 1XK7A 3JQ6A 3QOEA 1Z9CA 5LXTF 4R2HA 1P0MA 3WICA 2ODWA 4RU1A 2Y66A 1NY5A 2BKVA 2KDZA 3TG8A 3DFFA 4DYDA 3LY9A 1ZSYA 4HSEA 2H0QA 3TI9A 3G23A 2VQCA 4JBNA 1IMOA 1KQOA 3JZIA 2B37A 5CEJA 2XAUA 3H92A 4GP9A 2M98A 5AMXA 1NJ2A 1UXOA 3W2WA 2R0QC 1A7JA 3KLOA 3DKWA 3BROA 5EIWA 3OIVA 2XMRA 1OXSC 2EERA 1I4OA 4MP3A 3GARA 4AMYA 3VR4A 5KQMA 3CDIA 1NVEA 5A2QA 3A0BC 3JAKA 1K7EB 3MXOA 3WS7A 3OCUA 1VDZA 3FXAA 4KGDA 4M86A 4LOLA 3HOXJ 3BM5A 5AW4A 1NA5A 3KJFA 3C3YA 5KQLA 1N7JA 3R0QA 1ZLYA 4R0MA 1ZG1A 2PKQO 1EFVB 2DU8A 5EKDA 2B8NA 4E5MA 1DIAA 5D5QA 3QVOA 1A3CA 1WPRA 1D1CA 4DQDA 1JIXA 3TUZC 4OGLA 2NRAC 3BCRA 3GLIA 4HAOA 2DY1A 5IBRA 2XRNA 2BI8A 4MQ6A 4YH1A 2IYUA 1DBRA 3UJ9A 3KSDO 1TJNA 3ND8A 2AW3A 3JQ9C 3FX2A 3OFNA 3V7NA 2LH9A 5ILUA 1J2JA 4PC1A 3EC1A 2CUTA 2GA1A 3IAS6 2I6FA 3AERB 4DQVA 5M3MJ 4JT9A 4J0KA 4YG2F 2W6QA 1GQQA 4PAWA 3EDOA 4AMVA 5EPOA 1CIJA 5AK6A 4EI7A 2KHZA 3H04A 1C9YA 1YFJA 1TT5B 3PNTA 4YJFB 1UMCA 1J5XA 2X0NA 1V1RB 1FSGA 2KMUA 3R6DA 4UE2A 3BGIA 1VQOI 1DIOB 1NNSA 4C7KA 4AYTA 2C3MA 2FWRA 5F1JA 5KTKA 2W6ID 2PDAA 5IXYA 1RTTA 3DDOA 2ZPAA 1VLZA 4K28A 2MMCA 2P1RA 4BB5A 5CXUA 4TKUA 1J8YF 1RRJA 1G4HA 1G3SA 3MINA 3RH0A 1XCGB 5KOHA 5KTRA 2ECPA 5H20A 2W22A 1SQFA 3OM8A 5CDFE 4UAGA 1TJ3A 1W6RA 4YRVA 4MRVA 2E4XA 1IHPA 1Z2AA 3CESA 5EJ8A 1T29A 4BX9A 1I9GA 3OZ7A 2IV7A 5JEEA 5K5OA 1H1TA 4QJ3A 1XVTA 5KX5A 3IKTA 5K0JA 4TM8A 1YJWI 3L8ZA 2Y9MB 2PJRB 4Y9DA 1USSA 2AZMA 1U8RA 3DH0A 4TKVA 2P27A 4YRDA 4LOCA 1U28C 2IRWA 2QRVB 1HLVA 1G9XA 3GUVA 1TMOA 3MTGA 3N8HA 4IXTA 3V4RA 3GW8A 4XA8A 4G81A 4P0TA 4EY6A 1QG0A 3OS0A 2VYNA 3WHPA 5JYBA 5COAA 3NANA 1QH8B 2GBLA 3HEBA 5BNGA 1KERA 2XA1A 2PMDA 4UZEA 2VHWA 3PQ6A 1Z4OA 1GM5A 2E34A 2IDMA 5JPIA 2IDJA 3G2JA 4OF4A 5FRNA 4MUAA 1VPEA 4FKBA 3N76A 1GQRA 4I9UA 3H16A 1OAAA 3T35A 5GQSA 4PQEA 4CQMB 1V11A 4G0QA 4CQLA 4LPSA 1CT9A 1GCIA 3R3ZA 5A9SB 3CJNA 2Q07A 1QCCA 4TSFD 4M73A 1BXRB 3N0WA 1NXWA 2EX0A 1Y7LA 3H97A 2MH2A 2EFOA 5M5XJ 3EXEB 2D6FA 3RU2A 4UUSB 4LYDA 4P5EA 3L0ZA 3U2QA 4G6ZA 3RFUA 3MWLA 4CKBA 2QGUA 2XI4A 4MR8B 3TNLA 4R2IA 5ITWA 1SVKA 4O33A 2OENG 2CJPA 3EUHC 2IIQA 1PK7A 2Q3EA 1W5SA 2IH4A 3AG2H 3PICA 1DEOA 3E8XA 3GPBA 3CX6A 5JSFA 3AEUA 3L7AA 2C7BA 4AC0A 3VR6D 5IYZA 3W6PA 2YYAA 5E8JA 3K0LA 4EH1A 3AI3A 5KU7A 4LQ4A 4K6MA 5BWLA 4CKWB 2HU8A 1GAJA 2RAEA 5LQRA 2XQJA 1AD2A 2VH2A 2FF7A 3QG1A 4KO2S 3C6MA 1CS0B 2K2WA 1KP3A 1WQ4A 3OAAD 3SQLA 1T95A 1R49A 1ZMTA 3L0PA 5DV5A 2ME6A 3EYWA 3GFRA 2HX1A 3P19A 5EG0B 4CHTA 1O6FA 1CUZA 2YHBA 4PYMA 4QGBA 4YV7A 1HURA 4PLTA 1ZL0A 5FHRA 5TPZD 5EYPA 4TZKA 5FBQB 3TB4A 4EKYA 4X0EA 3ZHRA 3GLIE 1P3Y1 3CLOA 4RQAA 1EUYA 3RI3A 1SPBS 4XTRA 1FX0A 4ZEOA 2CV0A 1NI5A 4Q48A 5ED4A 4CCSA 2XUQA 1PQ4A 3W5AA 4HDUA 4QKQA 4KGZA 3WGMA 2MD5A 4EY7A 2JGDB 1ZM3A 1T3LA 4FYHA 1WI9A 1K6EA 4F46A 4X7MA 2JK3A 2W57A 3KDPA 1HY3A 4L4UA 1LX7A 1XDSA 1T8SA 4PFPA 2ZKLA 2KPMA 5JCJA 1QCYA 3SQOA 1P19A 3H2SA 4L9JA 1V1JA 4LJ9A 2ZUCA 3CW9A 5LDHA 1KYTA 2BVLA 1V25A 3UFXA 4BAGA 1PFQA 5DGDA 3AP3A 1VKNA 3CXUA 2VI6A 3BCBA 1ESEA 2J9FB 2LP4Y 1UXHA 5BSGA 3SJCA 4RS4A 2FXVA 4KFCA 1UC8A 5AKZA 4C21A 2FEZA 1JLSA 3THWA 2EDAA 4AS3A 2XTJA 3Q41A 4C0BA 2YV1A 1QTRA 3UAXA 3DOFA 4K9DA 2BBOA 4OXYA 5A6VA 4RHTA 1XLTA 1V35A 4E2XA 5F7XA 2R5WA 2WAQN 3C43A 1N57A 2XMZA 2DVMA 1IAVA 4QHYA 1WF6A 3BB3A 2L9VA 5AVUA 2W5UA 4CDMA 5FT9A 3WA7A 1MXHA 1JTYA 2H2HA 3OOPA 3NDRA 4LN1A 3NDBB 1QG4A 2A07F 1Q0QA 2WVAA 2CNNA 2VOOA 5TY0A 1AO0A 2VAXA 2ZO4A 4PDKA 2CQ7A 4RY2A 3FDXA 4BU0A 1DIGA 2X0LA 1PDWA 4QZVA 2EPFA 4WV3A 4WBNA 2IYWA 5ALZA 3CVWA 2VUSA 3IAEA 2CUFA 2EATA 5J2TA 3AF6A 3EWSA 2Y1LA 2GPAA 5ALEA 1I7SB 3AJDA 3UHJA 4L7QA 1OXUA 1E9BA 3ICVA 1F7UA 3OIDA 1SXJD 3JQPA 2IY7A 1Y1SA 2J8ZA 3RBXA 4ASNA 2PMHA 4D0SA 4PUSA 4B09A 3MNFA 3LSMA 5UKDA 2RREA 4H6VA 2AR0A 5AICA 3KB1A 1L4EA 4Z99A 4XZ3A 3VBCA 1NQVA 1QRSA 4QYWA 3V80A 2JHAA 2YN0A 3KJIA 3BZWA 2XXJA 2XUKA 4O4IF 4HFRA 4CLHA 2IHUA 1P77A 4G9BA 2R7VA 5E1ZB 1NLUA 5DP2A 2X3FA 2QQGA 4JK1X 2QVBA 3D8RA 3DWLE 3U21A 3TW0A 2WHXA 5L3VA 3KOUA 1XAGA 3DEWA 4IV0A 1P1HA 1JTEA 4I1RA 2X19A 2O2YA 2KKOA 2VJLA 4HB3A 2BY0A 3BCUA 5G1PA 5LXTB 2PHZA 2GO1A 3C4VA 2VJ5A 3MCUA 3L8YA 2Y0MA 2H4XA 1TAGA 4DJFC 5KDDA 4P32A 4KNYA 4C7BA 2HCRA 2V59A 4WESA 3T9BA 2ZB4A 3DMYA 1LFUP 3ZEIA 4LOAA 3L6UA 3MZ8A 4UUAA 4U2EA 4HNVA 3FTPA 4UUPA 2QPOA 3ML6A 1QHGA 1E6EA 4PAGA 1X4OA 3VQTA 4C30A 1VL0A 4JZKA 5C52B 1LE8B 1U98A 4GP6A 4KDPA 4FI3C 3PP8A 4HD8A 2BKAA 3PSIA 4BFYA 3WL5A 2HV9A 2HNHA 3LBNA 5IM4A 3QVGB 5EUBA 3BQMB 4XKWA 1UBLS 3G0BA 3W34A 2IOYA 5LEKA 4TYMA 4J3NA 2DTRA 1E3WB 1Y3DE 5IYDJ 5ELXA 1DRVA 1IY1A 2YHAA 2N47A 2OXEA 1S9HA 1VQ4I 4CIBA 5E6UA 1L9XA 1PJ2A 2WE7A 3F5FA 3ERED 3A4LA 4TWJA 1ZMBA 5C1DA 4QEKA 5DN9A 4B4DA 4MV6A 1GN8A 1J23A 4J1QA 4MWBA 4X60A 1MORA 3UHPA 1APLC 4JBGA 3V4PB 3MOGA 4Q3BA 3PF9A 4XDGA 4RENA 2WV1A 1FYXA 1FP4A 4YAUA 1G8YA 3IEXA 1CETA 4YEJA 1RI7A 4ZHSA 4A9AA 1ZKGA 3MK31 1QU2A 1T35A 1RHQA 1X2BA 5BV7A 1A5TA 1I3MA 4AZ3B 5DNYB 4RAZA 1H94A 1H22A 3S1AB 3EZ6A 2A5FA 3LDUA 1P2VA 2BN4A 4HWKA 4QJ4A 4OLHA 3ANSA 1W46A 1Y80A 3F5DA 1CF7B 5TJHA 3ZWWA 3EZXA 4FEAA 1GDHA 5M29A 4ZVSA 1G20B 6NULA 3FRIA 4HRYA 3AM4A 1BSVA 3TDKA 4DNFA 5HS7A 2CW0F 3LWDA 4XOIA 4A0GA 4RCZA 1VCNA 4ALMA 4WMLA 4FBMA 3UUFA 3MMYB 3IBGA 4M1KA 4Q3NA 5IH3A 1A9OA 2PGIA 3UV6A 4E11A 3K96A 1WSUA 1AHHA 4ZVLA 4Z4GA 3ZHTA 4Z8YA 4BNJA 3DZKA 1BJKA 4WX2B 1JXOA 5AVQA 1LPQA 4D81A 3RIYA 2F48A 3A2KA 2KIMA 1RJDA 3X1DA 2XMPA 3GVIA 3FBTA 5F12A 1G21E 2P3QA 4ETNA 1RR7A 1NQUA 4L72A 5IJ9B 2PMZA 2HWKA 1HRDA 4YRGA 2SKEA 1Y3FE 4Z0TA 4RPKA 3DE2X 5KOJB 2AC4A 2RHLA 3WU2C 3TRJA 4GX2A 4LDZA 4L18B 2Y0SN 3TDNA 2C2BA 1Z8HA 3T3PB 4BGUA 3HMKA 2ZMEA 1C80A 5JSKA 1GNPA 3SLRA 1EBFA 3FKQA 8AT1A 2A0YA 4UU1A 3KEYA 1L1RA 1UJ2A 1X77A 3K6RA 3A3OA 2HQNA 3KFXA 3P9CA 4DJJA 1OH5A 5DD4A 5IKXA 2I99A 4KI7A 1XYVA 5JBNA 2LSOA 3D1VA 2WU3A 3WLMA 4KAXA 1PTKA 1L5LA 5BVHB 1ULBA 4LZWA 3H11A 4AKSA 4CHUA 3PS9A 1JT9A 2B4YA 2XMQA 3DVQX 2BSXA 4I9NA 1VTNC 1YO6A 4KK3A 2P2NA 4RJKA 2J30A 2O0LA 4EI8A 5JXHA 3VPFA 2PXXA 1N34B 2ZIWB 3LHIA 3QTTA 4BN5A 4NFHA 4LOKA 1ORVA 1RZVA 4C29A 3T1YB 2GN1A 4JJ7A 3G1MA 4M53A 5BORA 1ZY2A 3F22A 3TO7A 5AKKA 2XDYA 4A5MA 1A76A 4B3RB 4A1FA 3N86A 3QMMA 1AKUA 2JNWA 3TZEA 1K92A 4EA9A 3UK1A 2PMCA 1SMTA 3GLSA 2BGLA 5E7JA 4RK1A 5FDFA 1MIOB 4JZYA 4R16A 3LLCA 2B83A 2I6QA 2WB2A 3JAMA 4NENA 3B8EA 3L1PA 4BIIA 3D02A 2PT5A 3G82C 1PJTA 2X58A 1ECGA 2V5UA 2VP6A 3IAM2 4XN0A 1ORKA 3F8FA 2CCKA 3GROA 4LKOA 1ZNXA 1VYUA 3K4LA 1QF9A 3O2SB 2DPLA 3JQ9A 3VU1A 4HVLA 4AWXB 1NW8A 3X1MA 2L9SA 1ONBA 1GG5A 1GNQA 3WB2A 3DXFA 1T25A 4NLLA 2SKDA 5B1SA 5T4FA 4PSXA 3CR8A 2I8LA 5CGZA 2NU7A 4OIPF 2CDCA 3FTFA 3ONEA 3SIPA 5JS6A 3GEMA 1Y89A 3KFVA 2O8KA 3FPBA 2WAYA 5ER9A 1RCUA 2CDNA 1UELB 5FGMA 4B87A 3OI7A 5AO9A 2I3AA 5EA2A 3T1NA 1UT6A 4JUAA 2RGCA 3KJEA 2PH5A 1RAIA 3IV6A 3BIJA 4GXOA 1N6HA 1MQ9A 4TZ0A 5BOSA 2IGMA 3QYJA 5AIPA 3UH1A 4NJOA 2QTCA 4X6UA 2HQ5A 2PFKA 2MA3A 3EFOB 4UM7A 3BJEA 3M1IA 3C4QA 1ETHA 3OU6A 1LLFA 4Y0VA 6AT1A 1T0JB 2FPOA 4HNSA 2W6OA 4BLTA 4MUFA 3CVJA 1BJTA 2A9OA 3S2IA 3O1JC 3QMVA 2VZ8A 5DWQA 3VRHA 1CULC 4G07A 3PQEA 4D3ZA 2CJFA 2NU6A 1T5HX 5GMOA 2PNFA 4OK5A 3EIXA 4JS0A 1SU4A 4JI8B 2EP8A 1AX9A 4WCDA 5L7TA 2EKPA 2R4QA 2QL6A 4DW8A 2VPIA 3HRHA 2C2WA 4FOTA 1U7HA 2ZJ0A 2P9BA 2J4DA 5DTJA 2W0MA 3LS2A 4LJRA 1U28A 3E5RA 3GZNA 3W5IA 4XN3A 4IHJA 2A9KA 2XHKA 2QXTA 5K7FA 1XPXA 4L51A 4ZKEA 4CKEB 3RUEA 3WGHA 1VCHA 5BSRA 2QYTA 2O7VA 3DEJA 2YR0A 1SUBA 4ER5A 2POCA 3UK7A 3AVWA 4XLNF 5AQ1A 5I7OA 4Y6PA 4E88A 3WAKA 2F8SA 3N7UA 4GLOA 3JYPA 3N58A 2C3PA 1YJXA 1YDGA 3DHNA 4GQAA 2JVIA 4MVJF 3C6QA 3HJTA 1X7DA 5BVGA 2YHIB 3BR6A 2XE4A 1Q0SA 1S5PA 5EP3A 3OCZA 4BNWA 2LR8A 4KKVA 2C97A 1LRKA 1T9CA 2ZUDA 4TM7A 3R74A 4AJ4A 1M0EA 1C14A 3U49A 2DOAA 3RAEC 2F5VA 3UUWA 1LVHA 1E3JA 3QKRB 3HOSA 1P0FA 2DFKB 2G9QA 3GCXA 4DR2B 3JRIA 3QP5A 3KLNA 4FVTA 3EUHA 1H2XA 1HW1A 3ZU6A 1NATA 1KEUA 2WVJA 3RJ9A 2JLCA 1VJCA 1KYXA 1O94C 3DZCA 1UJNA 1M5RA 2QWXA 3T7SA 3P8ZA 3AG5A 1CV2A 5HM8A 4O4IB 3ZV4A 1LK0A 1FDVA 4I1IA 2IQIA 4TSFA 1M54A 4MB0A 2MSNA 2P9GA 1GNTA 4WZBB 3O8NA 2HEOA 1ZP6A 1H0KA 3RKUA 3RRYA 2DULA 4XPIB 3CUYA 5LLTA 3H83A 3FNRA 1STZA 1QQ6A 4PZLA 4UNQA 2HRZA 4S1OA 4US0R 2VRWA 2QQAA 4XONA 4EUNA 3VR4D 4MV4A 4CZCA 1P1KA 4LF8B 4YQZA 4C0AC 4BXXJ 2YY7A 2YZKA 1YIOA 1Z12A 3IUQA 5A3QA 2A67A 2GMWA 1RBYA 4OAZA 2EA2A 5HJ7A 1IH8A 1PL0A 5B3LA 4YC7A 2A78A 3A10A 5ANRB 1TADA 3VR6A 1T2DA 3WK8A 4BWFB 5ES3A 2WZBA 1Q1BA 3K69A 4A12A 2C59A 3O0DA 2CMHA 1O3SA 1TAUA 4I66A 1M2HA 3E22A 3N6RA 4RVUA 4G7OF 1U5TB 3L9FA 3HUDA 3KOYA 1KY2A 3DBVO 5EZ5A 5D85A 2SBTA 4FFRA 5KC9A 3OAAA 1E0KA 2CVZA 4PZZA 1VRWA 3EXIA 1NR1A 1XXLA 3CEPB 3L4EA 4TKLA 3OZIA 1IZYA 3WL7A 1TC1A 1FP1D 1GA6A 4X84A 3SZTA 5AJXA 3ZLJA 4FETA 3EVAA 3K4CA 4DLPA 1KI8A 1GT91 3JVVA 4JVLA 5REQB 3ZWQA 2VJKA 5TPZA 2VTEA 4D02A 3B1FA 3RREA 2D2WA 3UK2A 5U1PA 4LRYA 1U6JA 2FWNA 1J0RA 3FWNA 1Y1KE 4M3GA 3NG1A 1KK2A 2EW8A 3S2EA 2GCOB 1FSPA 5J1UA 1MPTA 1HOMA 2AQIA 3KJQA 4KVFA 2WC2A 3OC6A 1LH0A 1GPH1 2J5XA 3HP4A 4RVSA 3QVVA 1NYQA 2PFGA 4YUXA 1OX4B 4FNGA 1WPGA 2V6GA 2EHJA 4R1MA 4ZOBA 3G17A 4ME6A 1OTXA 1LSJA 4R4JA 2VDMB 3DYVA 1W4ZA 2D5LA 3HB7A 4PF1A 5K3FA 5JMWA 4RPLA 3AF2A 3OFSA 2Z16A 2XIQA 3DO8A 4ENQA 3QQAA 2Q27A 4HXGA 1H0SA 1EVJA 4MWSA 1R3DA 2VDKB 3QLEA 2A3RA 2NADA 4IWXA 3ZJTA 4EP1A 4ER0A 1KEVA 3FMPB 4CDNA 3SQXA 4OBXA 1L5KA 2R8ZA 3A9RA 3ZWNA 1G2OA 1Z77A 2X9NA 4X93A 4BYMA 1L7MA 1B9NA 1DC8A 4BEVA 3FGNA 5JUWA 3U9LA 5AW2A 4IUCS 3HJCA 1XZKA 3WZLA 4LLGF 1ZRFA 1C1DB 4ZVPA 1T2FA 4RA6B 5IBCA 1SFOJ 1CF9A 1EXWA 4CG3A 2Z57A 4M36A 1F5NA 4AY2A 1N6RA 2FN8A 3KZNA 1OQYA 2VYND 4IXNA 1YWGO 5CNIA 4HLDA 1N36B 2VEDA 5DISB 2ZJ1A 2NXJA 2RBGA 1PW7A 1OLSB 4G0NA 3HR8A 1TWHJ 3PNLA 1JWBB 4RLHA 2ZRIA 1OASA 3WLJA 4ZO8A 1XC5A 2VHUA 1KDTA 2JFGA 4L9VA 4KXQA 1BL0A 1GD1O 3ZMVA 2AZDA 2P1ZA 4RKFA 1E2MA 3STWA 4WFKA 1T8RA 3P9QA 4ZZ1A 2DTZA 3QFRA 3PGA1 4D9NA 2BEJA 4ZP1A 1YNOA 3QUTA 1IU9A 1D2RA 2XBMA 3GO5A 4TLEA 2AXPA 2VQHA 1SG9A 1HA8A 4Q9HA 1WDWB 4CG0A 1RWBA 2YWHA 1BX0A 5J4YA 5LZ9A 4Y2VA 5LP6B 4LG0B 1T6BY 3JW8A 5FHQA 1O96B 5EIBD 3HN7A 1E98A 4F12A 4DTIA 2O2IA 3PB3A 3D0RA 3S1NJ 5J2UF 1GGFA 4YRZA 3DEHA 1YB6A 1I4EB 3EZYA 3CZ5A 2JGNA 5AHWA 3M07A 1D9ZA 1RS0A 4HQ0A 1TM4E 5F51A 3ISTA 2ZUVA 3C48A 1YCDA 1R8JA 4KQWA 3KL2A 1S3SA 5IKMA 4RDIA 1FJLA 1FL9A 4IHVA 4ASUA 5FIUA 5AI8A 3K2ZA 1ADFA 2FG6C 4Z0PA 3FZQA 3TS1A 1ZCBA 3ODPA 4IJWA 1V7QA 3W5SA 4RHCA 1U1IA 4QU9A 1EFPA 1JMYA 3AVXA 2G0EA 4BO0A 3K92A 2KP6A 4AF6A 3PR1A 2E60A 2QUIA 3I6YA 5EIBC 4U6SA 4CDRA 1ZRHA 1JSRA 2LUOA 1T2UA 2KL4A 2H7YA 2P68A 1E20A 4DY4A 3SNHA 4NBRA 1XBTA 2PMKA 3C1DA 5K01A 3RSHA 1VFNA 1SXIA 5FTKA 5ALWA 5TGDA 4UB6C 5GJCA 3EF1A 2C8KA 1VP9A 1KEWA 4D3DA 2DJNA 1YJQA 5D1HA 1AQIA 4E4TA 5G4KA 3HKBA 4HA8A 1WRJA 3HRUA 1DO8A 3SZUA 2H48A 1RTKA 1YG2A 1IWBB 1ZD1A 2ZBQA 4DIMA 1JILA 1EUDA 3K94A 5I47A 4Q82A 3NHYA 3RKYA 1B59A 2HJGA 2GVZC 4HLUC 1RHJA 1VP3A 2X14A 1E1YA 4ZXPA 3UY4A 4C08A 3T5AA 2F43A 1VKZA 4BDZA 1Y4ZA 5H1YA 3OZAA 2FR1A 3LUDA 2ISQA 4FZJA 3CCYA 4ZVQA 1N1DA 2OPBA 4KT5C 5JCJD 3JWIA 4HG2A 3OIOA 4YT2A 4E4HA 1LDYA 3JASA 1J6UA 1H23A 1ZJ4A 3J81Z 4GYGA 4LSWA 3WGQA 1JKJB 1Q5PA 5C5DA 1KU6A 2OGZA 5JEDA 2A3NA 1IBLB 1PWHA 1V7CA 4R1SA 3VSEA 3GRYA 3W8NA 5LMCA 3GRPA 5IJ0B 4MR9A 3LUJA 4MYDA 3EHEA 2R00C 3Q5GA 4QOJA 1NGSA 4XOUA 2BGRA 1JTVA 4LCBA 3EFBA 3EXFA 1NMZA 1T5SA 2BEVB 3FETA 3WJ1A 5IVDA 2GK4A 1MLDA 1ILWA 3EAGA 3DL4A 1TMGE 3H8SA 2HLNA 5FWDA 5SYMA 3P9ZA 2BEWA 4LF5B 4ETIA 3WE7A 4JODA 4EPYA 2ZSJA 4XJXA 3TBHA 3TQNA 4IICA 4DJTA 3ZTWA 5K0FA 4GPD1 4LI3X 1CYEA 1XRRA 4F96A 2RK3A 1JG1A 1ZR2A 3A58B 1N8NA 1YZVA 3IALA 1TW3A 1YHZA 3PQ7A 2FN7A 2O2ZA 3V00A 4WA7A 1E4VA 2VHVA 2FZGA 3H3FA 3NEUA 2DMRA 1TYCA 1FSFA 3I1JA 4BO8A 2X0JA 3TUJC 9LDTA 5JPDA 3I2FA 4UHTA 3M81A 3MKLA 4LUCA 3F6BX 3HSEA 1N2ZA 3KVNA 1JNXX 3I1YA 3OO1A 2Y2VA 3K5WA 2DMUA 2YIVX 4OSEA 5IXSA 1FYDA 3BL8A 4PC6A 1SCJA 4L8VA 2WNHA 3ZTYA 2ZRBA 4Q01A 3A1VA 4C4YA 1NOKA 4N7MA 3K9WA 3GDOA 4HF1A 5L9AA 2WMOB 3DF9A 1E9RA 3PDUA 4CH7A 3PV0A 4CT0A 1E2EA 4IL6C 1D1TA 4EG4A 3ZWPA 4EPVA 3MERA 1KIFA 3ASOH 3BTJA 2GK7A 1YE9A 1SBHA 2QT1A 3OBBA 1SXJE 2V7VA 4V1CI 5KCZA 4QVGA 1HNXB 4EVRA 3VPBA 4KWTA 1VE7A 3TBKA 2JGLA 2RQPA 4PJ0C 1K2WA 2PLRA 4LY9A 4NJEB 1A1VA 2FR0A 5F04A 2XAAA 4EY4A 1T5TA 2EYUA 2PEXA 1VG9B 2EZ9A 4ZO4A 4P55A 3RCBA 5CW2A 5MGNA 3H1BA 4MO9A 4IVQA 1IC8A 3BWVA 4EHAA 6GPBA 1PNTA 2O2JA 4EUSA 5DYMA 1DAFA 1WS6A 3UPDA 1MMDA 3PZRA 4QFBA 2WIKA 4Q12A 1N77A 1S2IA 3H9BA 1KSJA 3G88A 2ID3A 2HK7A 3G7NA 4BGIA 4OA8A 2OPHA 2EFJA 2OJED 2PLWA 2E4YA 5JWOA 1HETA 4EM1A 4IHTA 5JXGA 3S3MA 1C9JA 4DBRA 2Q3DA 5HK9A 4IF4A 3GUHA 5JCZA 2VJBA 2AFHB 3H0DA 4U5XA 2NZYA 1Z74A 2HF7A 3BFPA 3TW8A 2KIUA 3SBDA 4FT2A 1A5SB 2AOUA 4WCFC 4RF3A 4F4HA 4MQEB 1JDNA 1Q17A 4JUDX 1P9QC 3MWMA 3NHSA 2GIVA 5KOIA 1ZRMA 3II6X 5EXEA 2O8BB 5D5PA 3D0QA 2UUZA 1OJLA 1DBIA 1E5QA 1RRGA 1B0UA 4F7WA 2BDTA 1X7ZB 1VFCA 4CL2A 4GSLA 3FN4A 2G6BA 4R7TA 1IB6A 3JATB 3H8VA 4OAPA 3HB0A 4I9GA 3G0HA 4B2PA 3O2QB 1EWRA 3Q0IA 4Y7DA 1XCOA 4GPTA 3Q88A 4CMGA 2FOKA 2KZVA 2JA7J 2CYYA 3CMEI 4Y18A 3GTPJ 2DOEA 2C94A 5ICEA 5IJAA 3FYCA 3GFGA 5K8UA 3QU3A 4CM4A 1L7XA 4DQXA 3GFMA 4FSHA 2EHDA 4PVDA 2H16A 1O7FA 4QIHA 4JKOA 1M1YA 4GLBA 4DJEC 3WYAA 3PKIA 1NF9A 2NTEA 3OSGA 4RZ3A 1TBXA 1YCHA 2NN3C 4XLZA 4E7HA 4QDZA 2ZE8A 5E9JA 2B0CA 2NU8A 2VTBA 1MP0A 3N28A 4CGZA 3ISJA 3MMSA 5DLEA 4BNTA 2BW3A 2ZANA 3V6MA 3OCWA 2P7IA 3P0JA 3FAZA 3GEGA 4UUNA 3QYEA 2F1OA 2H18A 4AQYB 3WIDA 4ILEA 4I6ZA 1Y7PA 2YVLA 1REQA 3JQEA 1Y8QB 4M54A 1RDFA 3LBIA 3RJZA 4RZUA 2JLQA 2RGXA 1Q1GA 3CCBA 3TXXA 2GYVA 3QMPA 5JHHB 2P8SA 3DS8A 1HLGA 5EE1A 1T4GA 4YMHA 5AM2A 3UK0A 2VQGA 4J0CA 1NLZA 2DP4E 1CLUA 4OQMA 4YR9A 3RAPR 4Q18A 3WISA 4AUMA 3B9PA 4UXIA 3A06A 4C5BA 3R0XA 3LSYA 1FPMA 4LFUA 3QIAA 3R3SA 5DI3B 2CUEA 1VHLA 5H5JA 3KT8A 2LWIA 4IX9A 4J76A 4W1SA 5JVTA 3C3WA 4L22A 1QTIA 2GILA 5K09A 1VLJA 1PR4A 1ULZA 3MWFA 2BMFA 3I4CA 4JYPA 3KSZO 4HXEB 5AJWA 4EB3A 3Q0TA 5JZVA 2DERA 4F93B 1G66A 4QLAA 3D3WA 3GFSA 4FHZA 3RYPA 2EL7A 1YCFA 1JIKA 2AK2A 2NYVA 1R4NA 3IV5A 3DCYA 1I4WA 4FJ2A 2FWMX 2K85A 1TYBE 3IA2A 3BA6A 1GV2A 2DJIA 1ZNQO 5DBOA 3RDIA 5LN1A 3F78A 5DM2A 1EP3B 5HA5A 1X2EA 4E5YA 3OMWA 4BO4A 1HKSA 3A3NA 2PMBA 3I92A 4LVNA 5A9RA 3BKWA 3NWSA 2VP2A 3OO0A 3VWBA 4P5DA 2PUTA 5ILOA 5DGHA 2Q7DA 3CMMA 4EHKA 2C98A 1SUFA 2JZCA 4HUQB 3WL4A 4ZAWA 4K46A 3A2MA 4BN4A 3FHOA 4PZUA 1AGPA 4KJZA 1Z56C 2W82A 3H6KA 5EKTA 2DOFA 1PN3A 1I94B 1MD9A 4RB2C 3R5TA 2BHRA 2I3BA 2WJJA 1DARA 1L0OC 2IX3A 2W71A 1FYWA 4HX2A 2IIPA 3OF2A 5J2UB 4A0XA 4TLDA 3KJHA 721PA 4MMZB 3ZD8A 2E4WA 2DPDA 2JRCA 2FX2A 3ZJYA 2VNIA 4IIEA 3F2VA 5ECGC 1AUPA 2FE1A 3T9FA 2GAIA 3COAC 7GPBA 3MKYB 4BNDB 1GZ5A 3OTIA 4B6EA 1XD7A 1KRHA 3GA7A 3LSTA 3MTEA 2WAOA 1QK4A 3K4KA 3TB6A 3D3QA 4EPTA 1VCMA 3KHUA 4L9NA 1L5RA 3K9GA 3RYCB 3IQFA 1RW4A 1HOXA 2O0YA 2ZETA 3QUQA 1YGYA 2CUZA 1JB9A 4M6WA 3KP6A 3ROTA 3AFHA 5JI2E 5K1YA 1MD0A 3ABMH 3KKPA 3PNMA 1OH7A 3WGYA 4RFSB 4TVKA 4DZJA 3ZLUA 3BUSA 4KHPB 5DYGA 3A1SA 3Q98A 2AOTB 1VPLA 2JFYA 4UTZA 1YASA 4JUBA 1L8LA 3C85A 1TNTA 3P9XA 1ZM9A 3ACBA 4DB4A 1N5JA 3HEFA 2XWSA 4HEJA 3FK6A 1WD7A 3TR5A 1X7GA 4BZWA 3BZUA 3U2RA 4Q24A 2P0WA 3OOSA 3FGOA 3I2GA 2OQGA 2QVCA 1M1YE 1XZMA 3A4IA 1P8JA 3W77A 2X9VA 3LVRE 3A6ZA 3QVTA 1XS9A 1A2KC 1Y1WJ 2ZBVA 2GDJA 3DZ8A 4GDMA 1VXRA 2P0EA 4JJFA 4M7WA 4MUKA 5AQEA 3T3NA 1XTBA 1LEAA 2ID8A 1CXZA 3NJ8A 2HJRA 3FZYA 3P2KA 3G1OA 4CCKA 1DKNA 2FRDC 5CM2Z 5CLJA 1C7RA 1PX2A 2E5NA 4ND7A 5G02A 2A9RA 4XFJA 4KMSA 4KQHA 1C1YA 1ADJA 1DKRA 4DNOA 2G8NA 3AUAA 2RD2A 1K78B 4Y2XA 4C7XA 4EMSA 4JXZA 4XVUA 1ZW6A 1H6BA 4C4RA 1P31A 5JSUA 3EX7C 4DV5B 1XMXA 4JI1B 4DB2A 2I6SA 1MBHA 5T4BA 3FOEC 2LYCA 2CNWD 3Q5EA 4I19A 2HLHA 2PG3A 3GDGA 1SBNE 2QSYA 3L6RA 1VBFA 3VMFA 3BDVA 1AKEA 4G5OA 1NW7A 1DEXA 1LC3A 1FW8A 3OL4A 1KY4A 4RPIA 3S1QJ 2CL6X 2ODNA 3PQ8A 1RKTA 3OQBA 1HSTA 4L8WB 4GSKA 3UG7A 3NBXX 4B7UA 3DOHA 3VAAA 1X3ZB 1WTAA 3VI4B 3OP1A 2AF4C 5I7VA 3ORSA 3BE8A 4TTJA 2XRYA 4UHDA 1NRIA 2G9ZA 3PKZA 4FGWA 3KZZA 1TGVA 1Q77A 4TX1A 1LGYA 2FRXA 1LLCA 1HSZA 4PG6A 1PZEA 1V5WA 4P54A 3NHZA 1CUCA 2BUAA 2CNBA 5EI5A 2P6MA 2OAZA 2CSOA 4X8MA 4EVQA 4PHFA 1XDWA 4WE3A 4OQXA 1ADBA 4ZAGA 4IZZA 4CLXA 4TYNA 4YRMA 1X1DA 4UATA 4R7GA 1ZONA 2BHSA 1BI0A 2BGIA 3DAPA 4LHXA 4O2LA 5E20A 3F5SA 2YMQA 3KVOA 4MRMA 1PWYE 3UWOA 3EVNA 4PX3A 1RFLA 3ESRA 2GETA 2XB4A 2YS7A 4MRAA 2FU5C 3S5UA 1TQDA 3R60A 4J91A 1JZQA 3PR2B 1QIDA 4UMVA 5JALA 1G8GA 5CVVA 5AI9A 5AVYA 1U1EA 3B3JA 2WF5A 3WU1B 4V0MA 4RVOA 3W8EA 2OBMA 4Y2HA 1IXCA 4R6XA 1LI7A 2LBFA 2H6BA 4ND4A 3RUHA 1XHFA 5MHTA 4WK8F 3EYYA 5LKAA 3EG9B 2HA2A 1S6YA 2I29A 4MV8A 2HDDA 3WQBA 3G4SI 3F5QA 4B1RA 1WBBA 4BX8A 4CYMA 3BCAA 1IBSA 4ZALA 3IP9A 3P2EA 3BG9A 2MSYA 1QO9A 1WY5A 2I71A 5FLMJ 1JPNA 1CQJB 4RNDB 2C03A 4NCHA 1TYAE 4WEQA 3S1SA 2RHTA 4S2EA 1WUJS 3DMFA 1XU9A 2JBWA 3HMQA 4DREA 3U4QB 2RONA 3EDCA 5IT9Z 4XWAA 5JSYA 5K3DA 1P1IA 3TLCA 3EGXA 5D4SA 4BY1J 1H2YA 5IBPA 1J9ZA 1TWAJ 1G41A 4P3PA 4EY5A 3QW2A 4WJLA 4HLUA 4TXNA 4OLBA 3PRJA 3AJ9A 3TMYA 4N6OA 3AUYA 1KFKB 3FVVA 3VNVA 3GBVA 3UJ3X 3RS8A 2HREA 5CDHA 1KS9A 3SHVA 5ALJA 3O8CA 3W3ZB 3PGKA 2P6OA 1UP7A 3GUZA 3LDGA 2XGGA 4AICA 2ZRLA 3HRIA 3N6VA 3SC2B 2Q6IA 1RBZA 2G09A 4Q6BA 3E3AA 3K32A 4OUDB 1QV7A 1F14A 2I4RA 2HKXA 3FMOB 2NNLD 1ZZGA 2IYZA 4LE0A 5ECYA 3L84A 5AYVA 2GEUA 3ABLH 2C7VA 4M1QA 4J1TC 4A93J 4EG1A 5DCYA 4PZ0A 5D84A 1U65A 4H17A 4J0JA 3VNBA 2OD9A 2B6HA 2PGOA 4G9GA 4RHUA 4MDHA 4XIJA 2C5BA 3H6HA 3VVMA 3Q9NA 2A1IA 3DEYX 2R00A 3QPVA 4BMSA 5A4MS 3AHIA 4EW1A 4X1KB 3QUAA 2A0FA 2FPPA 4FUQA 2BGUA 4RXUA 3OQNA 2JANA 3HXTA 1UKYA 4U8GA 2C3YA 2W4QA 5ALSA 2X1HA 2W2XA 3ZQUA 1QQAA 1Q0ZA 6REQA 2Q0OA 2O3JA 1Z15A 4E4RA 1IXSB 4KICA 1E2QA 3OVMA 2AQKA 2PQMA 4NF2A 4LE1A 4Q15A 1T13A 5B5EC 2BISA 3T0GA 3HDTA 2BBYA 2CXPA 5KNCD 2DGDA 3LO5A 4BUPA 3N3AC 3NAQA 3CLTD 2ZUBA 4I50A 5KYVA 4QM7A 1NVKA 4NZMA 3WMWA 1XWIA 4UW9A 5CLIA 3KKMA 4F9FA 2P79A 2EKBA 5D7NA 2YC2C 3KJGA 4WX9A 4O08A 4J7XA 2NVUB 4BMXA 3G2IA 3R7FA 2OFXA 3E27A 3G2MA 3SXPA 2BFFB 3QPHA 2R7WA 1XDGA 1IE3A 2HTEA 3H99A 3KR2A 2YN2A 2JFZA 2QI9C 2PUHA 2IS4A 2VQFB 4NC6A 3MWEA 3E70C 4F4CA 1QANA 1BW9B 4JLBA 3NTQA 2H3EA 3V1MA 3CLTC 5I9LA 1YO5C 4BEWA 2FUG1 1E9AA 3OQJA 1SD7A 1I2DA 2Y48A 4OP2A 2QX6A 2G88A 3NEYA 2QRLA 4XKBA 3EXG2 1BRMA 1T1SA 1TU3A 3TEDA 1KJ8A 3MJRA 4Z9BA 4YV1A 1GAWA 1RM0A 4DSAA 2GFIA 4Z1MA 1BN5A 2VRBA 4B2IA 1R18A 2XVXA 3GFIA 3VR2D 1LBSA 4TTAA 5FBWB 2XTAA 5CCBA 1L5NA 5BSFA 5BPDA 1KDYA 2OHIA 5CLFA 4ABZA 1GUDA 1RXCA 4EJFA 2W6JD 5JRJA 3R7AA 3DGEC 4TPKA 1UC4B 4BV2A 1R6XA 2WE8A 5LJLA 3DHVA 4LCJA 1DWOA 3ITKA 2FWPA 2YY5A 1BR1A 4JLWA 1Y63A 2QJWA 2GSWA 2DW4A 3UMMA 1GAQA 4ASUD 4JXXA 4CM1A 3UWMA 4X1YB 4UPVA 5ECDA 2BFDA 1UFVA 3Q7TA 5K20A 1BE8A 3OA0A 1JNYA 3PFYA 1RBMA 1V5GA 2ZJPF 2ZSHB 1ZEJA 1PR9A 2JIDA 1NF8A 1R6TA 3A27A 1NMYA 2GZMA 3KSRA 3IH2A 2LNBA 1J2EA 3AR7A 2VHCA 1NQAO 4MTDA 1PGNA 1WMFA 4WCFA 3E58A 2LPMA 2E48A 3PJDA 3SZOA 3MCWA 2QVGA 1Z34A 2FX3A 4HLQB 4BBAA 4X62B 3JVIA 1DX9A 3TLYA 5JRDS 2ADFA 1ORRA 1E64A 1OVGA 3NWBA 5BWCA 1PS9A 3EULA 2WP0A 5BQTA 1IB0A 1V3UA 1IVSA 1LV7A 3EVEA 5L3FA 1UZCA 3FR7A 7YASA 2C1ZA 1VCOA 5D5UB 2VYFA 4NV3A 2Z5FA 4UVDA 5FWAA 2NUTB 1QNTA 4I09A 4G37A 1SD2A 4ZYAA 3A3KA 3DDSA 3E84A 5C3MA 5I5GA 2JA6J 5CCXA 2HQOA 3TP3A 3SQNA 1EJ0A 3ROMA 2Q5LA 4YAFA 2CO5A 3R9XB 2PJPA 3JWGA 4GI7A 4O1HA 3FFXA 3ILYA 2GKSA 3KDSE 1ENYA 4GOLD 1JG7A 3GRUA 4TXJA 2WZDA 3DFKA 1Z6QA 2GRJA 1P3DA 4IOMA 4C3JJ 3C70A 3P0RA 5LQDA 4JBWA 1K7SN 4QPOA 4LXTA 5C3EJ 2BCJQ 3OY7A 3DO5A 2ZRMA 1VZ2A 1NZJA 4G86A 1DSSG 3VNUA 3RIEA 1U5AA 1A9YA 3PE6A 3BWEA 2OSVA 4OHRA 1GUAA 1KQ3A 3EPKA 1EQAA 4NYJR 3BXGA 4EG3A 3S99A 3DDZX 1PZFA 1QV9A 4BACA 1ZLKA 1DKOA 1XD9A 4PHTA 3SS8A 3WGJA 4PPNA 5EE3A 2JCSA 2QU7A 4YCCA 4KNVA 5CLGA 2KFDA 3CNLA 3DLPX 1LFPA 1Z6RA 3TRKA 2PZLA 1BS2A 1EZZA 3G1LA 1T2CA 4ALNA 1E9FA 4R8LA 1ZI6A 3WKCA 4CMKA 5IFLA 2NZ2A 4R98A 2G1UA 3X1ZA 4ZJYA 3CJQB 1A9RA 1AB5A 4UJ5A 5ALFA 4UNOA 2JHPA 1XYYA 2KBFA 1TIPA 2OKGA 2VQ6A 2O3QA 3BGSA 4AK9A 1UDAA 2RAPA 5EZYA 3A0RB 5DLDA 3NETA 2Q4OA 1U1CA 3C8ZA 3F96A 4IP0A 1EKEA 2BMAA 1Q1VA 4C2UA 4BU1A 2JAXA 5LVAA 3EJWA 1G1AA 3BIWA 5AM0A 2XYQA 3K9BA 3EDQA 4R9NA 2AR9A 2GVNA 3DCFA 3T9DA 1D2AA 1NMQA 1T56A 2O2HA 4GG1A 1UMDA 5HDGA 3KZOA 5E4TA 3PLAE 3TNJA 3LA8A 1FP6A 1OAOC 4UJ3A 1L2TA 4KSYA 4R2WA 3NBQA 2EFHB 4L6CA 2Z2XA 1WSAA 1I4TD 4KV7A 2VNSA 2GPJA 3ETCA 1SWVA 5IAAA 5EGNA 2C4MA 2H4JA 1J21A 1FMLA 4DC9A 5KSPA 1T4DA 1ZK3A 3PGJA 4FNOA 5FKNA 3U9SA 1J8FA 4GFDA 4QTTB 5IUKC 3UTCA 4M74A 1FFXB 3GG9A 1NHWA 4Q39A 1XA4A 5HNKA 1YOVA 5DOZA 4D82A 2OCCH 3QXSA 3NWEA 4KODA 2GI4A 1KQ0A 3NEPX 2JIOA 4A2WA 3LX4A 5J23A 2ZIXA 1XKQA 4MAAA 1QTQA 5IT4A 2OQIA 1USVA 3DDCA 3N39C 1KA8A 1BDIA 3CO7C 3QHPA 4EABA 3C7AA 1QYRA 4Y6GB 2IZOA 2WBMA 1GFSA 2LTAA 3C8MA 1S2LA 2P8TA 2PWZA 2GZ1A 1YV9A 1QV6A 3ZGLA 3SJZA 4XQEA 2Y1WA 4UC0A 3GFPA 2R7RA 4EG0A 4NCAA 1RIFA 1LPAB 4KCGA 4LHWA 4AO7A 3B6IA 1EJ2A 1KWGA 3KQHA 3WYDA 3ZU4A 3EY4A 1GVHA 3SZ3A 4RH0A 3CQ9A 1DLIA 3ABRB 3F9IA 4JC0A 5ADVA 3V8MA 4R8MA 1ZGZA 2B1IA 5EHXA 2VF4X 1IOVA 1LVKA 3OT1B 2IOFA 1I2AA 5HIIA 1J4AA 4KWIA 3S2ZA 1NVFA 1YHQI 4BIMA 2GCNA 1YDHA 8LDHA 2WLSA 2HNAA 3LF1A 3NHMA 2SHKA 3RUAA 4KDCA 4RTRA 2CHFA 4UNPA 3RS0A 3WXMA 1TRHA 3AF3A 1EGHA 4G1EB 4LJYA 2R7AA 4V2UA 1X1AA 3BILA 3PWTA 5AK3A 4K1LA 3W06A 2ODBA 3CZPA 1YUMA 4YYEA 2FRDA 4JP5A 3U7HB 3ZX4A 3KKLA 4MGIR 3WIVA 5K3EA 3UH0A 4R41A 4M38A 1QRDA 1U6IA 4M37A 5EL0A 3UAZA 3QF4B 3TTSA 4PLPA 1KOFA 2ORIA 3EEYA 1HE5A 3HUGA 3BAZA 4KX5A 1CP3A 2KW5A 3NBUA 4BLQA 2QLMA 4FX5A 3CINA 1JA0A 1Z0ZA 2D4AA 3C16C 3H2ZA 5LMZA 2ZS8A 3RADC 4MQ9F 3NT5A 1SCUB 4JP3A 1FMJA 1HG1A 2HEIA 2YKGA 5CM8B 3CH5A 4DCNA 1LB2A 4IS3A 1DU6A 1JXQA 3JQ8A 3O2JA 1K1EA 4C03A 1F4VA 1P33A 3I61A 1FW6A 2E0IA 4M8SA 1OFUA 1DC4A 3UG6A 2AZXA 4NU8X 4XVCA 4PLZA 4P08A 3K9CA 2CVHA 4YA6A 4CQJA 1NDQA 4RA9A 4UNNA 4D9GA 3ZVRA 4QDUA 4UU0A 4K0KB 5E6RA 4A82A 5E4FA 4OG2A 4FZ5A 1K75A 3ESBA 5GP1A 1P9RA 4IHAA 1Q7TA 3B6MA 3CLRC 4KUHA 2IYOA 3DKVA 3MSCA 2CNWA 4PZAA 2D5IA 5BRJA 4D8WA 3BEOA 5H70A 3WXBA 4CUGA 4YIRX 4JJAA 2XECA 4MUGA 4E14A 4LRWA 1JW9B 5CRIA 1FRZA 1JDUA 1VLLA 1U0TA 5EMLA 3U4HA 1QONA 4RFLA 4XIFA 3W2FA 5A4DA 1OZ0A 5IT3A 5DXAA 3QYBA 1TD1A 4AJJA 1YW9A 5C2JB 4W9RA 3UC5A 2QZ4A 2IPXA 3FFAA 1THGA 2L0KA 5F6FA 2KWIA 4C87A 1LF5A 2VB6A 2AG0A 3S29A 4Q4HB 1JT2A 2M0MA 2AE2A 3ZWOA 1WTCA 3UPUA 4QU0A 3OMYA 4R79A 1YW8A 4ZOCA 2X9GA 2X8LA 1HWYA 1QH1B 4FDTA 4DNXA 1O94D 2JARA 3BHMA 4P93A 4A2UA 4GC9A 1H2EA 1GGMA 5TEVA 5F0CA 1EDEA 2VXZA 1NXTA 1CUAA 3CUQB 5IHPA 1NQXA 3TSAA 3BG3A 5B3SH 1JA1A 5FEUA 2YW9A 2C4HA 3NXSA 1K7XB 1B6SA 2ZULA 3VPCA 5EHNA 3FR8A 4NIMA 2GK3A 2BM8A 2ZPTX 3NGXA 4HX5A 2L42A 1NTOA 2QYSA 1DQNA 4XRSA 4FTHA 2Q7XA 3OE7A 4H1VA 1R50A 2BGTA 4Y6SA 2WY2D 5FPTA 3I23A 2HPVA 4NECA 3PUIA 5CT8A 1HDXA 4M1WA 1WWKA 3W5BA 1L1EA 1V43A 3SSAA 3U7GA 1C0IA 2BY4A 3KPVA 3JSPA 3U44B 4G2TA 9MHTA 1V6CA 1YBFA 1JLMA 4UBKA