2GWRA

Crystal structure of the response regulator protein mtra from mycobacterium tuberculosis
Total Genus 69
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
69
sequence length
227
structure length
225
Chain Sequence
DTMRQRILVVDDDASLAEMLTIVLRGEGFDTAVIGDGTQALTAVRELRPDLVLLDLMLPGMNGIDVCRVLRADSGVPIVMLTAKTDTVDVVLGLESGADDYIMKPFKPKELVARVRARLRRNDDEPAEMLSIADVEIDVPAHKVTRNGEQISLTPLEFDLLVALARKPRQVFTRDVLLEQVWGYRADTRLVNVHVQRLRAKVEKDPENPTVVLTVRGVGYKAGPP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Domain orientation in the inactive response regulator Mycobacterium tuberculosis MtrA provides a barrier to activation.
pubmed doi rcsb
source organism Mycobacterium tuberculosis
molecule tags Signaling protein
molecule keywords DNA-binding response regulator mtrA
total genus 69
structure length 225
sequence length 227
ec nomenclature
pdb deposition date 2006-05-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00072 Response_reg Response regulator receiver domain
A PF00486 Trans_reg_C Transcriptional regulatory protein, C terminal
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 2gwrA02
3.40.50.2300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 2gwrA01
3HXMA 2PN6A 1DPRA 1VLZA 4ZMSA 3L49A 5GQSA 4GPAA 3O74A 3TMYA 2IJLA 4HLXA 2W57A 4FX0A 1MVOA 2FSWA 3L2CA 4KA4A 2D1VA 4AIJA 1PNRA 1L5ZA 3RKWA 1FOKA 3TKYA 5FWYA 3KKEA 4RXTA 5FBKA 4IMJB 3KP6A 5CJ9A 4QYWA 4MR9B 4H3HB 3DLBA 4ZYEA 4MR8A 4OTZA 1XDUA 4FB4A 4YG2F 5DYMA 2QYOA 1KU7A 4WUTA 3T5XA 3TDUC 5HSGA 3EDCA 4HQEA 4G7ZF 3KG2A 2MBFA 3N97A 3KYIB 4F12A 2L01A 3T8RA 1I27A 5ILSA 3MZHA 4RGRA 2PMUA 3V8LA 3KTOA 3WE3A 1ODDA 4DADA 1RI7A 1K7AA 3I53A 3KZZA 3IWZA 3A0RB 3CTPA 1GVJA 5BPDA 2R25B 4G0QA 2EB7A 3CLKA 2H09A 4ZYGA 2XAJA 4GO1A 3H92A 1QMPA 2K27A 5FD5A 1ABFA 1ON2A 3B73A 2XV4S 4KV7A 1S3JA 2ZKZA 3HRSA 4EYKA 4HX8A 4CO8A 1Z16A 2FMKA 2RDPA 3CJNA 3HRTA 3HJFA 2YU3A 4OIOF 3I45A 1C0WA 1TNTA 1LEBA 3QEMB 4DQDA 5ICFA 2KIFA 1S7AA 3M1EA 2MYPA 2NNYA 1ZRDA 2E7WA 4IRXA 1B00A 1GXPA 3JSPA 3LQRA 5DCMA 4W5NA 3WE2A 1MB0A 4YCSA 5AIQA 4I0AA 1BVHA 1FQWA 5FGMA 3DGEC 3FFTA 2O20A 3QELB 3OQOA 3U1DA 1MJBA 5DCMB 1BDIA 1PDNC 4P1ZA 1XWWA 3RVNA 1O3TA 5LGUA 4ESJA 1ONVA 3BROA 1ZHFA 4HX7A 3QEKA 1L5YA 3DF8A 2D1HA 4TLLB 2WMYA 3F6VA 3Q7TA 3OM1A 3RVLA 3I5AA 3H75A 3OO1A 2P5VA 3T0YA 4MS3A 4EYGA 2OZUA 1HXDA 3L09A 5D5WB 5EWMB 3LTEA 2FQYA 1K66A 2KJCA 5TQJA 3SHFA 4EVSA 1F4KA 5D5UB 3LOPA 3SZPA 1S7OA 5EEHA 2XASA 5ICGA 4Q7EA 3DBIA 3K9TA 3MF4A 1NXWA 3VNAA 3BDDA 2IA1A 5CNMA 3WTYC 3EUHA 3SFZA 4RDCA 4MNUA 4AD9A 1NATA 4E7OA 1NXPA 1DCFA 3C1DA 4KICA 2G9WA 2HGCA 2STWA 1E6LA 2P4UA 2LPMA 4EJVA 4EQQA 3MCZA 3H6HA 4G86A 2HZTA 1FBQA 3NEUA 1JDNA 3P9KA 3FHZA 2E4VA 2FBHA 1LJ9A 3F8NA 3NBMA 2HFHA 4Z4IA 1D2AA 1L3LA 2YR2A 1K78A 4M9XA 1GXQA 1NXVA 4RB3C 2NT4A 1REPC 3M9WA 1S8NA 2TMYA 2LNBA 3KETA 4RXMA 5KC9A 1R23A 3IHUA 2Z99A 1J5YA 4JK1X 1BA2A 1Z7UA 2JVJA 4M6YA 1ZGZA 4XARA 1TQMA 2PL9A 5BRJA 4A0ZA 4WXHA 2QVOA 2L4AA 5KQLA 2IA2A 4KT5C 4QYMA 4EVQA 4EVRA 2RN7A 3KHTA 2P5LC 3TO7A 2XRNA 3R6SA 3BRSA 4DN6A 1Z91A 4LB5A 3H1EA 3HDGA 1TTYA 1ZYRF 1KU3A 1USGA 2Z9OA 1BIAA 4I98B 3F3XA 1EH7A 2FMFA 1HSTA 5D4SA 4W5TA 2A9OA 2CQKA 4Z2YA 3ZPLA 2RJNA 3V7SA 2QU7A 3GZ5A 3QEMA 4EJOA 1GLGA 4JA2A 3D8UA 3FX3A 2P6SA 5E20A 2OQRA 2QM3A 2F5FA 1NXOA 3OO0A 2F2EA 4L9TA 1E6MA 5IUJC 4HDVA 2MH2A 1E17A 2P7CB 1JF8A 4ZJPA 1HW1A 3FMQA 4YO7A 4A6EA 3LUDA 1MB3A 4GCVA 5HDKA 3FM3A 3HIFA 3GZ6A 2XKPA 3QX9A 3LAJA 1FSHA 1JFTA 3RH0A 2L02A 1XMKA 3PQJA 4EJWA 3N0XA 4YFKF 2W42A 1Q1HA 4LK1F 3CG0A 4G0ZA 3CUQA 4E7PA 2FBIA 2BYVE 1EWKA 4M88A 2WTEA 1P6RA 4L5JA 1PHRA 3BBLA 1QZYA 4UVBA 5TQ2A 3S99A 1K78B 4XSZF 5JVTA 1RIOH 1KYZA 4XSXF 5E8GA 1YTYA 1LDDA 1O7FA 2DPUA 5FWXB 4PCQA 3QX8A 3LQQA 3M8FA 2XIGA 5DUIA 2PUCA 1JWLA 2PUEA 3QP6A 4YS6A 4HF1A 3O1JC 3FZVA 3S2WA 5T7BA 1SD6A 2M1ZA 3I58A 1URPA 4OIQF 2CWDA 4LLNA 1YK1A 3GV0A 4TV7A 4CDGA 4Z0NA 4XXHA 4AWXB 1JXSA 4YIIA 2DO7A 1IN5A 1YW8A 1YG2A 4OBBA 1T39A 2QV0A 5LHGA 5E17F 3NNNA 1FPQA 1B1BA 3MQ0A 2ID7A 4JAVC 4KUMA 4ESFA 3WTWC 1KRWA 4HW0A 3WTZA 3CNBA 5A2QZ 2IDMA 2ZO4A 5I4CA 4KPYA 1LBHA 1SXIA 4ZZLA 3GXOA 4UHKA 5FO5A 4O6JA 5AONA 2GX6A 3KSMA 4MTDA 2G7UA 3IPAA 1V3FA 3G1WA 4U0VA 3HDVA 2CG4A 1P92A 4Y9TA 4YFNF 3CG4A 4N0QA 2AS5F 5H6QA 1W4MA 2H3HA 2E7XA 3QLTA 2PBIA 2VE9A 3O6BB 3ZMDA 3DXJF 3KEOA 1D5WA 4GYGA 2BBYA 1KU9A 1XSVA 1W5TA 3LFTA 4MS1B 3H1GA 2PLNA 2QXYA 2JRTA 5HS9A 5E18F 6CHYA 5K1YA 2BGCA 2CO5A 4CGZA 5D6FA 5C5CA 2ZAYA 4ZZDA 4KYWA 2LDUA 2DPDA 1T6SA 3PFIA 4MLCA 5BPIA 3TOBA 3RVMA 5IULC 1H9CA 1XHFA 2IPLA 4O5VA 4UXNA 1DBPA 1ZGGA 3KE2A 1FP2A 4RKRA 1GUDA 3GO5A 1BC7C 1IUYA 1TLFA 2AYXA 4RY9A 1J2XA 4Y13A 4RK1A 2P6TA 3ILYA 4BHCA 1HEYA 3CLOA 3QLVC 2FNAA 4LE1A 2QW1A 2PEXA 2PMCA 2XAGA 2JRLA 4RB0A 1Z6TA 5DEQA 2YX4A 1STZA 5HS7A 4LRQA 1ZREA 3QU3A 5FWYB 3OM0A 5FWXA 5JNSA 5CVJA 2EWNA 5EWLB 1LB2A 4BXUA 3FGZA 3H3ZA 1S6LA 3ECOA 1W7PA 3RVPA 4I2OA 4UHTA 5LBQA 3HS3A 2LSOA 2PJPA 3I4PA 2PUAA 5LRSA 3F8MA 4U0YA 2VOOA 1IW7F 3LA3A 1M2FA 2EFPA 5DD8A 3IC7A 4UNOA 3OLZA 1ZH2A 1M5TA 1R1TA 1OYIA 4ZYDA 3WGGA 1J75A 1AOYA 2K4JA 1IF1A 3TB6A 1GHCA 4B09A 1SXHA 2D2WA 1ULYA 2M45A 2PMHA 2PI0A 5H20A 2XHKA 4KMRA 3JTGA 3R60A 4PYRA 3D0SA 1LVAA 1DP7P 1BI0A 3ELKA 2RV8A 2VYCA 1A0OA 2RQPA 3JY6A 4UVAA 1DRJA 1VRVA 1JFVA 1MDMB 2DQRA 5IUNC 2ID9A 2VONA 1B9MA 3FXQA 2V9VA 3ZQ7A 4FT8A 1YO5C 2LP4Y 2PFBA 5T3YA 1IN4A 4HZFA 4LMYA 2FVYA 4KVFA 2O61A 4JQFA 4F7ZA 1Z12A 1BOAA 3RQIA 3G3ZA 1ZESA 3RJPA 3H5VA 3O2SB 4XLTA 4ENMA 3TO6A 3HM9A 4B8XA 3ZMZA 1SAXA 4N9IA 4L4UA 4RB2C 4RU1A 4P9FA 3UKJA 4NB5A 3M8EA 2MSWA 4N03A 3E3MA 2FEWB 3K9CA 1ZARA 4EGYA 2WV0A 2D45A 2Y0MA 2JB9A 3G73A 3A3KA 2PUGA 2IPNA 5DCFA 3HV2A 2BGGA 5GOTA 4Q6BA 2HQOA 1Z9CA 3ULQB 4WX9A 2QUFA 4Q4ZF 3Q7SA 3I64A 3NRVA 3BOQA 4MRMB 2DBBA 4Z4EA 2FXAA 2CFXA 1U3EM 3Q7RA 3TO9A 1QP4A 5HDNA 4M73A 3C6QA 4KZKA 3HK2A 4MYRA 3HZHA 4M72A 1LJUA 4HDUA 2NZUG 3K4HA 2QQAA 2IPMA 4GGGA 2RNJA 3WTSC 3OLXA 2FQXA 1QP7A 1BAPA 2IW5A 2VODA 2OU2A 3H5TA 1DDNA 2K86A 3SAJA 3IP5A 3GFJA 4G7OF 2NZVG 4IRHA 1NTRA 3T38A 1FFWA 3GYHX 3W6KB 3IL2A 2ADUA 4ENNA 1U2QA 4XASA 2ZMEB 4Q5SF 2OAZA 4RAZA 3I09A 1LEAA 1FWZA 1LNWA 5HKOA 3OLWA 4RZSA 3LA2A 3HUUA 2F8SA 3AAFA 1GUBA 4P9UA 5L3CA 4P96A 3QELA 3QLUA 4NQRA 2GIVA 3GFIA 3FWEA 5DGCA 2VT3A 1ZITA 3EODA 1G3YA 1U6GA 3FMRA 5HOOA 4PGGA 1T0FA 4DNCA 2GBPA 4WXEA 3GL9A 3HSRA 2TDXA 2A6HF 2V1XA 2PUFA 2W84A 4UV9A 2Z33A 4D6YA 1ZH5A 1F5TA 4RAYA 2FLWA 3GBPA 3H5IA 3VB2A 3LUJA 3IP9A 1TLHB 1R5HA 4LE0A 3A10A 5JNWA 4ON0A 2CD7A 2MYUA 4QICA 2EV5A 4Q47A 1QKKA 3CRNA 4HNQA 2NRAC 3WU0A 2J5PA 2EA4A 4WT7A 2P4WA 3O3KA 4WF2A 2GAUA 2K7LA 2HTSA 6PAXA 3MZYA 2A9PA 3I71A 3LUGA 3EDPA 2H27A 1I5ZA 4HNRA 3HO1A 1Z1DA 4JB2A 1USSA 3WG9A 3KP3A 1QGPA 5ERIA 2Y75A 2ESNA 2OBPA 1Y0UA 1I1SA 2XAQA 4BH9A 5BMZA 3BREA 4KRFA 4R8HA 3REOA 2IP2A 3I59A 4YP9A 4LLGF 1ZN2A 3EQ2A 4G0PA 1E2XA 1BJAA 4HYEA 1USIA 2VT2A 4EGZA 2Q5CA 4M71A 3CO6C 4G0YA 1Z17A 1IRGA 1TMYA 4BHBA 4XLNF 2L4MA 2HKOA 1XGOA 5FLXZ 2HKXA 4H0EA 1FZPB 3C3KA 4TLMB 1D4ZA 3GF2A 3LSTA 1ZG3A 1K79A 2PJUA 1ISSA 4I01A 5CNIA 1J56A 5EEGA 2HDCA 2H6BA 4HA8A 5DV5A 2FNPA 3QPHA 4LLLA 5FB2A 1U5TB 4ETNA 4MPTA 2ZNYA 1T98A 5JNRA 1KQ8A 1HKQA 2GI4A 2L18A 1U5TC 5B3JC 3JS5A 2JBAA 8ABPA 3VOEA 3DPLC 3KCCA 4JASB 2WY2D 1DC8A 1AWCA 1WETA 3J80K 5TPZD 4Z4FA 3RVSA 3MMNA 2JCGA 2F5EA 1RUNA 4G7HF 5E1XA 1SD5A 5TQ0B 2M1BA 3ZP5A 2IPAB 1TQPA 3VODA 1IAWA 3E97A 3DZDA 1RUOA 4F11A 1O3QA 5H6RA 2YX7A 3IRQA 4MQEB 2HQBA 2G7HA 5D8KB 1ZY2A 1FYMA 3EGCA 4OOIA 4HOBA 4EM2A 2K02A 3LFKA 5D5VB 3M6MD 4MQEA 2VBXA 3ROUA 3NNSA 1R7JA 3O21A 1SD4A 5CNKA 3NHMA 1RXIA 2F5DA 3F6PA 2MSLA 5JI6A 1MIHA 5JS2A 5EWLA 2FMIA 3N0WA 4K2EA 2A9QA 3ZMSA 3GEZA 3GX4X 3HHHA 5E3JA 5BRAA 3Q15C 1AB6A 1M2EA 2ESHA 3QK7A 2DK8A 2NNNA 5BOXA 4P5OA 1DG9A 4KNYA 3COAC 3T6KA 2LIVA 4EV0A 1P8AA 2Q0OA 2Z3YA 3A0UA 3LUKA 2VXZA 3I59B 3LUFA 2BEOA 2QWWA 4ML3A 4MGRA 3ERED 2CSOA 2E4YA 9ABPA 1EHCA 2R47A 2DT5A 2YSRA 4U0WA 2COMA 4OU0A 1R00A 1FT9A 3LKBA 2HWVA 1Z05A 2R3SA 5CNJA 2PUDA 2ELHA 1LQ1A 2HYGD 1YFHA 3MA0A 2W85A 3N53A 4IVNA 5L3EA 3BWGA 1D5VA 2RGYA 1MAVA 4YV7A 2A3SA 3R0JA 1P2FA 1LK0A 4BAYA 3IKTA 4IRGA 3E6MA 3HUGA 1DCKA 3K2ZA 2VUIB 1H0MA 5TQ2B 4A5MA 2OA4A 1IN7A 4R1HA 1Z25A 2E4XA 3JAMK 3TQNA 2E4ZA 4YGXB 3F73A 4Z99A 4EYOA 2H0AA 5KWSA 1QQAA 3CUOA 3BY6A 5IT3A 1KRXA 4PICA 3EYYA 1EAYA 4EUKA 4MGEA 2A5YB 5HDGA 4U7DA 1JYFA 2JBAB 4UUVA 4G94A 1KA8A 1IXRC 3E5QA 5PNTA 6ABPA 2VBWA 3DQVC 1C0EA 1JBEA 2EFNA 1WSUA 1MJAA 4XAQA 2PAFA 2ISZA 4LJZF 1TM2A 2VOPA 1USKA 3H1FA 2KKOA 3HCWA 3CU5A 1R1UA 4RK5A 3FF5A 1HQCA 4M6XA 2L3DA 1YS6A 5IT9Z 2O8XA 5BQ3A 1JHHA 1ZHHA 1TBXA 4WK8F 3BJAA 2JPCA 5TJJA 5ICCA 2EV6A 5IT9K 1DUXC 3ECHA 5HM6A 2STTA 2NYXA 4GYIA 3JAMZ 4I0BA 3TGNA 4RGUA 1D1PA 4O3MA 2FMHA 1I6XA 2XKOA 3HUTA 4A5NA 1WQ2A 3LMKA 2EK5A 5IBQA 4MR9A 3LWFA 3L6UA 1UDRA 4LFUA 5HLGA 3EETA 2JSCA 1XSXA 3N0RA 1VPWA 3O1HB 5LEKA 3F23A 4FE7A 4KIBA 1JHFA 4PDKA 4E70A 1P4AA 4RXUA 1R36A 1XN7A 2R48A 1OXKB 1R22A 3RVRA 5F6FA 4HF2A 1SFEA 5TPWA 1J0RA 3MYYA 1U04A 1RZ4A 5K5RA 2DAOA 3E6BA 2DFIA 4GNRA 3EAFA 4CYDA 5HLHA 3TD9A 3K1MA 1RZRD 1GCGA 4G8XA 1DJMA 3C97A 3T95A 1I3CA 4WWCA 2P9HA 4G97A 3E6CC 1P6UA 1HKTA 4H3KB 4DQ2A 2K4BA 2HQRA 4Z4HA 1DRKA 1YQAA 2NS0A 2VUHB 4MRMA 4TN5A 1E6KA 3KFWX 4XFKA 1BI1A 3RPQA 3K1NA 4G6DA 4M9ZA 4L0YB 2J5OA 1A2OA 3HOSA 1CGPA 2WWYA 2Q2EA 1LDKB 3DP7A 2BV6A 3Q5FA 1RXEA 4ASNA 5KI6A 4A2UA 2PKXA 5EWMA 5KK1A 4Q48A 1SFUA 3KCNA 3DKWA 4FHTA 1FYKA 1DCMA 1R8JA 2E1NA 2MA3A 5F64A 2MYNA 4S05A 4ESBA 1DBQA 4RK7A 4MEXF 3SG0A 3BJOA 3EYIA 3PQKA 3JPWA 4I02A 3JTEA 2LKPA 1UCRA 2HYFA 2QVCA 1OMIA 2XROA 3CKMA 2V0NA 1OR7A 5JNVA 3KJXA 4ENKA 2A9RA 4LDZA 2MC3A 4KQ9A 4L0ZB 4MQFB 1AB5A 4ETSA 2IRFG 5D4RA 3O2JA 2ZCWA 4IHSA 3SY8A 1TQIA 2R4QA 1R58A 2XVCA 5D2CA 4H60A 3E5UA 3CDHA 5FLXK 3KP2A 2RDMA 1HBXG 2L2QA 4YIFA 3JVDA 4IMIB 4EM0B 2CW0F 1BM9A 2X4HA 2PG4A 3WGHA 3LAPA 4G6QA 5DCLA 3BRQA 2EJRA 2FE3A 4O1HA 2PUBA 1ZG5A 1RNLA 4IJAA 3WTUC 4YLEA 2E4WA 3D02A 3BPVA 4HX4A 1ZH4A 2HQNA 5L3FA 2V1DA 5ABPA 1KQ0A 1XB4A 4G9YA 3OQMA 4QWQA 4IF4A 3H5OA 2H6CA 3BZ6A 3EQLF 1T2KA 1FY7A 1JDPA 3HOTA 4MR7B 2HEOA 2FMYA 3IP6A 3RVJA 4NHJA 4RY8A 1XD7A 3MM4A 3O75A 2WB4A 3OLYA 3Q9VA 4BYYA 3ABTA 3B02A 4OG2A 1JYEA 3V7CA 1NHAA 3K69A 3N4MA 3GW2A 3HHGA 1YMVA 3N8IA 4RWEA 2A68F 1JFSA 3F7NA 2FW0A 3NNDA 2A69F 2EA2A 2FEPA 4L85A 2FMLA 3O2PE 3CS3A 4A0YA 3C7JA 4N9HA 4AVPA 5CHYA 1OYYA 2GKGA 3LUHA 2W25A 4AIKA 4O5AA 2OD5A 1DP4A 5K5QA 3UUGA 4IHTA 2UWMA 3GYBA 5D5XB 5JNUA 5C5EA 4ZH4F 1U2PA 5IEBA 2KJBA 4KK4A 4WWHA 3L9FA 2LF7A 4MS4A 3M9AA 3K0LA 2HJ9A 3IRRA 4FX4A 4RS3A 3BPXA 4XRFA 2JVIA 3JSOA 2ZFWA 4HNSA 4KIFA 1PEYA 2MLKA 1EFAA 2ZWMA 2FU4A 2ISYA 4RK4A 1MGTA 2DQLA 2FOKA 1KQ9A 3MEXA 2QR3A 1IN6A 1W7PD 4Z4GA 1KGSA 4NQWA 4CZZA 3LUCA 4W5QA 2I6FA 2HTJA 1BC8C 1HSJA 3ZN0A 3HSYA 2F8TA 1JE8A 1EH6A 2J48A 4D74A 2ACJA 3MWMA 1DBWA 4EGSA 2IYNA 2FSPA 1U78A 2AYZA 5KQGA 2GA1A 1D8KA 4CXFA 1IXCA 4IXAA 5IUKC 1KMIY 3D5LA 3OQNA 3SNKA 3RKXA 1U8TA 1U5TA 5B3JA 1KYWA 4MHGA 1NXSA 1FSPA 4RKQA 3HSEA 3KLOA 5BS6A 3H6GA 3J81Z 1QP0A 2N9UA 4UVCA 1UB9A 3EULA 3HSFA 3WTXC 3FXUA 4OMZA 2E1CA 1YVUA 3URMA 2YPRA 1W9HA 1ZVVA 2LF8A 3DEUA 4W5OA 2FA5A 4ZMRA 2P8TA 4EJTA 1BBYA 4MEYF 2YHAA 2DK5A 3QRFF 5A2QK 1ISRA 4LGWA 2XAHA 3CUQC 3HRMA 4PE5B 2RGVA 5E1WA 1U0SY 4MS1A 1EWVA 4JB0A 1S29A 1R5GA 4LG0A 5J8FA 2ZMEA 4MS4B 3DFGA 5KQMA 2LUOA 4KREA 3KP4A 2IKSA 2FN8A 2MSKA 1SMYF 2JPBA 2XUBA 3E5XA 5L3BA 2GWRA 5ILVA 1TW3A 4M74A 3KP5A 4HQMA 4XBFA 4YWHA 2O03A 4BQAA 5CVIA 3J80Z 3R61A 2M5WA 1U2WA 2M8EA 5J6XA 2JK1A 2M98A 1EWTA 3V4GA 4BHPA 5FD6A 1OXBB 3F6OA 4FE4A 4JP1A 2RJOA 1T34A 1CF7B 3T8YA 4BNCA 5CYVA 5CVUA 1K6OA 4HBLA 4PZJA 4L18B 4M9SA 3CHYA 3GFMA 5AIPA 1F1ZA 4LD5A 3FMSA 3WU1B 1SFXA 3E3VA 1GCAA 1XGSA 1LJLA 2PLYA 4ETIA 4RY0A 1O7LA 2B4AA 4W5RA 2B0LA 1P4XA 3EQZA 2MLGA 1F4VA 5HLIA 5CVVA 2VE8A 3NHZA 4MAAA 1MD0A 5KQPA 5CVRA 2DU9A 2HS5A 1XGNA 3GLXA 2Q8KA 4GXOA 1VTNC 2VBYA 1C4WA 2DW4A 4YRZA 5FFZA 1UHMA 5CLSA 5JNTA 4F06A 3FM5A 1TJYA 1BDJA 1QNTA 2FRHA 1DPUA 3KP7A 5HVQC 4RGSA 4Z9AA 3GWZA 1XSDA 2UZKA 5DDGA 2VN2A 1FLIA 4MR8B 1CYEA 1FBUA 2C6YA 5ICEA 2QZJA 1QQIA 2PE5A 4NCBA 4N0PA 2OZ6A 2DLLA 2X0LA 1JL3A 1ZRFA 3GVAA 3C3MA 2F5CA 3ZMVA 4LG0B 3KYJB 3SQNA 4OMYA 4D6XA 2FF4A 1Z18A 1U8RA 3BP8A 1UHWA 5LRRA 1O57A 1IZ1A 2FEKA 2ZJ2A 4YFXF 2FQWA 1B6AA 5K5OA 3C18A 1IN8A 2VC0A 1ZRCA 3FFWA 4UV8A 2LBPA 3R4KA 2CWEA 2H94A 1JLKA 1EH8A 2M30A 2GA2A 2ZNZA 3JPYA 2IPQX 5JFRA 4LB6B 2FEZA 4KIGA 2FTKE 4Z4CA 1JX6A 3L7WA 5FBHA 1MKMA 3I0TA 1Z6RA 4EYQA 1M5UA 1W25A 1A04A 2QENA 3B2NA 5DKFA 4I09A 4D0PA 5LLQA 3H5WA 1XDSA 1ZGAA 1BIBA 2EFWA 3HRUA 2ETHA 3RIRA 4KFCA 3Q41A 5TPWB 1SD7A 3GBVA 1OPCA 4RS8A 3BJ6A 1G3TA 2NAZA 4WCGA 1RZRA 2OQGA 1PUXA 3NQOA 3K1PA 1VKRA 3KS9A 3U9GA 3SZTA 4R79A 3V7RA 1Z2EA 1X3UA 3E6DA 2WJWA 1QQBA 2Y48A 1QBJA 1OYWA 1QPMA 1YIOA 4Y15A 4LK0F 4KMFA 4QPJC 3L00A 2R7DA 2M87A 1YW9A 3QPTA 1YLFA 2PQ8A 1G3SA 3V8JA 1W5SA 4ETMA 4HV5A 1FC3A 2WRZA 2CYYA 2P7VB 1B59A 3C3WA 5JR3A 4KQCA 3QU6A 2Z5UA 1YW7A 2QQBA 3KEQA 4OIPF 3WTTC 4IILA 3JVIA 1SRRA 3GFLA 5KVRA 2VC1A 3CFYA 4JOQA 5LEJA 3GWGA 2W24A 3P9CA 2V6CA 1YYVA 4MLDA 4KN7X 3N75A 1WWXA 1Y1LA 3P7NA 1PNTA 3RVKA 4P98A 5L3DA 3TDZC 3I5UA 1XCVA 3I42A 2QZ8A 3OV8A 2EV0A 3W9SA 3MQ4A 1BI3A 1KU2A 4L9NA 2RKHA 3WTVC 1IXSB 4PZ0A 1B9NA 4MQFA 2V1UA 2IVMA 3JW4A 3RI4A 3BILA 2AXLA 5LHHA 3F22A 1ZLJA 5HS8A 3I54A 2L17A 1JHZA 2IT0A 4EMSA 1ZAYA 1SXGA 4A6DA 1D3YA 3HVRA 2CHEA 4NICA 4OINF 3FXRA 2GXGA 5DLEA 1Z15A 2GZWA 4IGAA 5D8LB 1H9GA 5IC5A 3P9YA 1J59A 4HV6A 4RB1A 5DUKA 3FFXA 1HW5A 3RYPA 1HW2A 2VBZA 3MAJA 4NCAA 1FX7A 3ROFA 2YHBA 1ON1A 4MTEA 2HR3A 3OMWA 3DLHA 3RKYA 4TMYA 4WZZA 3GRCA 3DGFC 5J8CA 5IX8A 2GXBA 1FP1D 4Z9BA 1P6QA 4MS3B 4OLBA 2FBKA 1JH9A 2X7XA 5F1RA 2QSJA 2KYRA 5LGTA 1ZG1A 4CHUA 3P9IA 2JT1A 1QO0D 4YR7A 2IOYA 4EY3A 4G0MA 3F8BA 4KN4X 4HLYA 3KLNA 4O1IA 1FBSA 2VK2A 4LX8A 5TE9A 3IP7A 2UXXA 2MD5A 3Q9SA 4PGHA 3VNBA 3QP5A 3F6CA 1CHNA 3OLVA 4PEVA 1ABEA 1R1VA 1Z2DA 3DPTA 3TX6A 2ZXJA 3RYRA 4XLPF 1CEYA 1DC7A 5BR1A 4KMUX 2A61A 1PP7U 3RDIA 1D8JA 1B4AA 3ML6A 4P55A 2QQ9A 3EJWA 1K68A 1FYLA 3VFZA 3V8KA 2HPHA 4L9JA 4N41A 3HYIA 3T8TA 2JTVA 2P5KA 1ZGJA 2O0YA 2L19A 3GA5A 1LDJA 1W7PB 5BQTA 4Q6WA 2O6GE 4MR7A 2EFOA 4QLCU 2NT3A 2V79A 4F8JA 2DI3A 4WXCA 2UXNA 4A0XA 3CUQB 2B1JA 3IDOA 2IA0A 1APBA 4NV3A 5FFXA 3IKVA 2QLZA 3J81K 4AIHA 2FLKA 1PP8F 3ROTA 3DV8A 1TNSA 1IIBA 2EFQA 1ZDMA 3RTRA 5EWJA 3CZCA 3LUAA 5DD4A 1WKMA 2A6EF 7ABPA 3FDFA 1V4RA 1QO0A 3HTUA 1Z13A 5ILUA 5EWJB 2XDYA 3HEBA 2CGPA 4Y17A 3JTHA 1UFMA 3F8FA 4N47A 2RC4A 5TRDA 2NUBA 3UK0A 3IPCA 2XGXA 4ZPJA 2WJAA 1YS7A 1XGMA 3W6JB 2HOEA 3ABUA 1PUEE 4KDPA 4LDAA 2CHFA 4G0OA 5TPZA 1MJ9A 2R7FA 2WWVD 1QZZA 4UHJA 3MFKA 3CTAA 2O3FA 3MIZA 5KC8A 3QLVA 1LBIA 3TOAA 5HQJA 3M7GA 1YK0A 4CBVA 3M9XA 5IEJA 1P4WA 2KIMA 1CF7A 5E1ZB 1I1GA 5JHUA 1ZAOA 3OOPA 2GQQA 4RSMA 4OATA 1IRFA 4EJUA 1NXXA 4RGXA 1USTA 4CICA 1WI9A 3FMVA 1FFSA 2QBYB 4EVIA 4WXMA 1FSEA 3KZYA 5ED4A 1XMAA 4EM1A 1J9IA 5TQ0A 5LHIA 1NXTA 4IRIA 3OMXA 3RVQA 4F3TA 3T1BA 4G0XA 1FFGA 2FKAA 1QNLA 2FN9A 4RK0A 4WXDA 5D6EA 2A07F 1YMUA 5DTEA 3QOPA 3LKVA 3E61A 1O3SA 3O1IC 1BI2A 2RVCA 2FQ3A 3H5LA 2JVKA 3O2QB 1XCBA 3GUDA 3CZ5A 1RPJA 1J7KA 1JGSA 2MH9A 4A12A 1MZBA 4LZLA 4JBAA 5E8IA 3IWFA 4RV5A 2MYTA 3SXYA 4ZYHA 4L5IA 4MQVA 4N0BA 3ZMUA 1DZ3A 3H3UA 2FXIA 4S04A 1QPZA 2PL1A 3WGIA 4ZYLA 4I7HA 3F8CA 1WRJA 1O3RA 1FNNA 4HF0A 1H9TA 3QLUC 1TW2A 2E4UA 3F72A 1SMTA 3WODF 4HAMA 3HTSB 1TVMA 3G85A 1L0OC 2DTRA 4MQ9F 1T38A 3U2RA 3LA7A 2HSGA 2L54A 3GT7A 3VEPA 5JS1A 3ILHA 3F21A 2BE5F 3ZN1A 2DRIA 1PEAA 1BDHA 1EV7A 2QBYA 1MDMA 3TO5A 4U88A 1HKSA 3J7AO 1ZLKA 3N6VA 1Z26A 3RPUA 5L3GA 3SM9A 1G3WA 1YTUA 3CO7C 4L9VA 1D1QA 2ZBKA 2WC2A 4U7BA 1F51E 4KK3A 4N76A 3ISPA 2QVGA 5LGNA 4OLAA 2OENG 1BN5A 4LE2A 1G6NA 3QAHA 4OIRF 1G4DA 1E2BA 1OKRA 4RK6A 1NY5A 3ZMTA 4IPAA 2KRFA 3RVOA 1F9NA 4ENJA 2XAFA 3R0AA 2KIUA 2JZYA 1XHEA
chains in the Genus database with same CATH superfamily
4TM7A 2R8YA 3HXMA 2DHRA 4TRMA 4PBTA 2H06A 4FD2A 1CZRA 5IK2A 1QHIA 3HY6A 1QKIA 4W6ZA 2WM3A 5C0OE 5F5LA 4O4HA 3O74A 2XWSA 1PGPA 3WG7H 2AZMA 3DL7A 2GHQA 1XNHA 3FOCA 3TMYA 3U7JA 1UKZA 3VC2A 3K16A 4KA4A 2HQ5A 3OZXA 2VSFA 4ID9A 5AKXA 5A0FA 3DJYA 4H4KC 1XNRB 3RKWA 1IV6A 1M2VB 3TKYA 2I3BA 3O8OA 1DAOA 2BH2A 3SLGA 1OXXK 4KFTA 4KR2A 4G4GA 5C31A 3UQYS 5E3NA 4YAKA 1X1RA 1U1IA 3UK6A 1DEXA 4QYWA 3ZR8X 1BE6A 3HBAA 3HKEB 4IO1A 3HL4A 4MR8A 1XDUA 3B6MA 2IHKA 2PGJA 1YKSA 4MLOA 1NIPA 2VDKB 3PA6A 1MRNA 5DTIA 4YRSA 3GMDA 4OGFA 3UGKA 2D1YA 5CPFA 4ADSG 1V43A 4WUTA 4ES6A 1KVSA 4F84A 5HSGA 4P36A 2XDQB 2IRWA 3NPAA 1EXWA 2NVOA 2QN6A 2IS6A 1YRNA 4MGHA 2ZU6A 3CLUC 3HM2A 4Q1BA 1KIAA 1Y48E 1ZGBA 1JXQA 4EG8A 4G7ZF 2O7RA 5BR4A 5SY9A 4GPZA 2W6NA 4FOSA 4N65A 2IIQA 3PX7A 5JAIA 2L01A 5ILSA 2M34A 3MRVA 3FBNB 4RGRA 2PQMA 3BXHA 2WKRA 3F7MA 1Q6YA 5BY2A 3GDOA 4A8PA 1RJFA 1V7ZA 1P4RA 2D4AA 1ODDA 3UUEA 4CL2A 1KI8A 4KXFB 3A6EA 1YZHA 2F7SA 4OYRA 3Q7EA 4DADA 4B4KA 5AM2A 4W63A 4UMFA 1YIAA 4PSCA 3ND5A 1HT2E 4ZIRB 3AP2A 2WSIA 4D9IA 1YH3A 4DB4A 1SD2A 3I53A 2LWIA 2OD7A 3O3MB 4UUBA 3C6ZA 2IUYA 3GQBA 1KORA 1PO7A 3L0BA 4LQLA 2FZ5A 2H11A 4KWTA 1P9NA 1YFKA 1GVJA 2LTPA 4G0QA 4WI1A 2H09A 4ZYGA 4GO1A 3G6EI 5C2JB 3H92A 1M8PA 3GTGJ 3RUFA 3RU3A 3SZLA 2JARA 2DOFA 3VI4B 2BFDA 4B3DA 4FHCA 3EH2A 2LK2A 2XGGA 1MG5A 521PA 5CB4F 4UQLA 4HXYA 2WW8A 3O31A 4ZV9A 3TOVA 4WOKA 4LZJA 1UDXA 1VGRA 1WXDA 2FG6C 2ZSHA 3BKXA 4PLYA 4EW2A 5LNK1 1EESA 2MR5A 2ZJPF 2BR4A 4DGQA 5AVZA 5FA6A 3O82A 4P86A 2V59A 3IVGA 3WB2A 1N7IA 4JXZA 1YE8A 4HX8A 4J6EA 4TKVB 4DLPA 4AG5A 2GJSA 2GNOA 4BNXA 2H65A 3GIDA 5KNLA 5KYTA 2F1RA 1HGXA 1MB2A 1MJHA 3D6AA 4IPTA 2M6KA 1XXHB 1Y42X 2AHOA 4UTXA 1HOMA 1JHRA 3BERA 5EE5B 1LEBA 5E95A 1LRKA 4RYDA 1DARA 3BMCA 4MPDA 3UAYA 4MYHA 4AIIA 4DQDA 2C7BA 1XTIA 3B6EA 4DQLA 2VHQA 5FYQA 3LW8A 4GMFA 1B00A 4KU4A 2DKFA 3BG9A 1K63A 4P3XA 2BW3B 3MUEA 4FYPA 4B3XA 2AC4A 2GAOA 3CX4A 4GLFA 4HZUB 1O9GA 4KQ2A 5BRNA 4DGWB 4G24A 5AICA 4LXGA 2VTDA 3RIEA 4ISCA 4F5YA 5J4LA 1DMRA 5M29A 2HCRA 4OXYA 4FB5A 3KR0A 1Y9JA 3KZKA 3PNSA 4JB8A 3U1VA 2IGNA 3SDBA 4RAGA 2OPTA 5DCMB 1QIFA 3NT5A 3WL5A 4DBQA 4AZ3B 3EPJA 1LB1B 1OA1A 2V7TA 5A0TA 2RQQA 1GL7A 1ONVA 2E2HJ 3L2UA 2LXNA 1CD5A 4B6RA 1U7PA 5JFOA 1IXZA 1GQFA 2RI1A 4A0FA 1XZHA 2BEKA 1MC4A 3DF8A 4Y6PA 4BJ6A 5JZSA 4XKVA 2P9EA 4U2KA 2WMYA 3F6VA 1SBZA 2FMXA 3G9ZA 5E6RA 2QV7A 2QUJA 3E8XA 2C2BA 5ES3A 5FTWA 3BR3A 5KCMA 3OO1A 3A9CA 1LPBB 4YJDA 5EHIA 1FP4B 3T1NA 4MS3A 4CI0B 1GAJA 3UUWA 2NPFA 3E03A 3AW8A 3GROA 1MABA 2JFYA 5D5WB 1GKUB 4RPIA 1AZWA 4ND8B 1E3DA 1JI0A 2R7MA 2KBFA 4XD2A 3EQ7A 2KJCA 4YA6A 2VP2A 1QHHB 4KG7A 1S7OA 1PDVA 2QLMA 3KB1A 3ENKA 1R3DA 1II8B 2OPHA 3I9FA 3G6WA 3Q9NA 3MF4A 5GJWC 1NXWA 3D0OA 2B20A 3DWGA 1D1TA 1Z5OA 3IPLA 5EJAA 5CCEA 5IH7A 2NU8A 4RSGA 3EUHA 3LQKA 4O3FA 2EC5A 4ARUA 2IYUA 1KVTA 3GRUA 3WIVA 4RDCA 2VJAA 1THMA 4N7MA 5E1OA 4E7OA 2R751 3RS2A 1NXPA 4D3DA 3U13A 1CNMA 4ZICA 5J3LA 3C1DA 1V16B 3G0OA 4AS2A 2G9WA 2HGCA 3A2MA 2FZWA 3DCNA 2LPMA 3G6KA 3OHMA 3V42A 5F0FA 1CV2A 4IFIA 4P33A 4EJVA 1I8TA 2YUTA 3HO8A 1JSCA 1M72A 4TRNA 4ZT3A 3SWWA 3OA0A 4OAQA 3KJNA 2QMUA 1JDNA 1LI4A 1FMJA 2A3NA 1VSQA 3II6X 4KVGA 3SXUB 1HYQA 2RHRA 1JXOA 3ESWB 4QEZA 1A96A 4LRXA 1P0IA 2GH1A 4H1TA 1OCOH 3LVRE 3THXA 1KO5A 3WAGA 2WK1A 3BMNB 3DKYA 1BMDA 3PUYA 4ESEA 1GGEA 2UZIR 1OC4A 1CF2O 1D2AA 1L3LA 3KTDA 1GYQA 1PV4A 4M9XA 1YHNA 3L77A 4IGKA 3WNCA 1NXVA 4RB3C 2JLWA 1S8NA 5JI2E 1GXSA 4GX0A 1SUCA 2IH5A 4D98A 1Z3YA 2C1ZA 2RHHA 3CSDA 2QRZA 1H1LB 2J3IA 2YYZA 4LZAA 1DC3A 2ECKA 1Z7UA 3KDSE 4PLHA 2XSJC 4RVDA 3OJ0A 2CF6A 5LUBA 1Z4MA 4ZYZA 5JZ9A 2B34A 5EPUA 3RR2A 2PL9A 2RG7A 4ZHSA 5KNCD 3IDZA 2DPXA 4WXHA 1W49A 2QVOA 2L4AA 2QT9A 3OCJA 5B1EA 1TL8A 2IA2A 1KMHB 4DA0A 3VWBA 5REQA 4EVQA 4GL4A 3L7NA 4AIRA 3KHTA 2JCXA 2P5LC 1W93A 3FNRA 5JASA 4OQ4A 4YREA 1PTKA 4XKBA 1SHKA 3NBXX 4TWZA 5EHXA 5BOVA 3BRSA 5BW4A 1PR1A 1Z91A 3WU2C 1MO3A 1ZN9A 5AW8A 4ZAZA 2FSVC 3CCBA 4HUTA 1GGHA 1USGA 4MKFA 1SANA 1SN7A 3NX4A 4XEUA 1EF4A 3DMNA 2EX4A 3L8CA 5K1ZA 4OVKA 4YV0A 1EH7A 3C7TA 3EVDA 1HSTA 1TWCJ 2C0PA 2G04A 2DHDA 2ODAA 2V7QD 3LT1A 3OOSA 4O2BA 2NU7B 3AB8A 5EPEA 4FP9A 4FFSA 5M04A 2CQKA 4Z2YA 3ZPLA 2HK9A 3V8NA 1CWUA 2QN1A 3HDTA 4HYYA 3E23A 2QU7A 3ZQIA 3H9GA 1FUYB 3LV8A 4IOKA 3S6JA 3LFHA 4E5PA 2Z8ZA 1WVIA 3HR4A 3PVSA 2DGDA 3IH3A 1Q44A 3FBGA 4CF3A 3BB4A 2IH2A 2L9RA 1Q7RA 3PV0A 1YV9A 2AHRA 2ZEJA 5AW1A 4FISA 1H6BA 4PLVA 5SICE 5K7SA 1BMFA 1V26A 4P81A 1WJCA 2DMQA 2NSDA 5H7XA 4NOKA 2QM3A 5DNDA 3UJDA 2QE6A 3V9AA 4L9TA 2C7PA 2BVMA 3DP9A 2MH2A 3LWDA 2CVPA 1PS8A 3CZ9A 4FZVA 4GI1A 4K40A 5EL0A 4BVAA 4RTKA 3KZIC 1F8XA 1HW1A 3FHJA 1YUBA 1XGKA 2CNOA 3EGEA 4M1TA 1ESNA 1JE0A 3TECE 4GKKB 2JAXA 3E05A 1GGMA 2XVAA 3R76A 4AXBA 4MVJG 4CJXA 5BW5A 2XOKD 1WJAA 4O4JF 5L95A 4BCCA 2ZBPA 1DINA 3BMQA 4J00A 3FNEA 4LMRA 4ZCTA 1PYVA 2XKPA 2PU5A 1GVDA 2F00A 3E2PA 4Y2HA 1OB5A 3AEYA 1DXQA 3F7OA 3PKIA 1T1RA 1KO1A 1DC5A 3RH0A 5HKAA 3ISJA 4D9CA 3N59A 2ORVA 4MV9A 1IPHA 2QW8A 4TTTS 3GZ4A 2J59A 1MQ9A 3N0XA 4L28A 4Y1EA 1EXDA 2L42A 4U1RA 4X1YA 4GPEA 3FBIB 5BNWA 4DREA 1N1EA 1AY0A 2IDKA 3UFXA 1JDJA 2CBXA 4L6CA 1GG8A 6YASA 5ILQA 4CQLA 4DUGA 2YIJA 9ANTA 2J7PD 2Q4RA 3V48A 2XUAA 3SYKA 1PHRA 1MGOA 3KBOA 2F9MA 3DE5X 4EWLA 4LNUA 3U7FB 1JB1A 3ZQFA 4TTAA 3CWCA 4G0VA 1Z22A 4QEDA 3RSFA 4L8GA 2IXTA 4UMDA 3S99A 5KOYA 4UTRA 1RI5A 4UB8C 1QHFA 3LMMA 4QASA 5BSEA 5B1BH 4D7NA 2OFPA 4WHMA 3TI7A 3OL4A 5E8GA 1J9GA 4YELA 2YWFA 2W0MA 2G28A 3ANMA 3BX1A 3LK7A 5EUBA 5JFTA 3GLIB 2D74A 2WMDA 1O7FA 5F0HA 3PFWO 1GVNB 2ILVA 1WH7A 4IXWA 1ODFA 4P54A 5HG0A 4TL9A 3SR0A 3AF5A 2IU0A 4MW5A 3M8FA 2QJOA 1UBJS 4D7MA 5DUIA 3IBSA 3TM4A 2PUCA 1OI4A 4YS6A 1NK3P 1NV9A 2Q5IA 5EA2A 1PL6A 1IG0A 3FZVA 1JIXA 1QC5A 2D00A 1SD6A 5EJ9A 4KQ1A 5T7BA 5EIXA 4C3JJ 4QUBA 1FK8A 3ZY3A 3MKLA 1KU0A 1P45A 2YHSA 1XG1A 2JA2A 4OEHA 1YR8A 4EECA 3CF4G 2W43A 3JCUC 1NWHA 2Q4EA 5GJVC 1J9EA 1R9JA 2X3FA 4IIUA 3T1QA 1IBRA 5LYJB 4ZEOA 3GLQA 1OROA 4PPFA 1BJZA 1E7MA 1YI8A 1ZNWA 2DWPA 2IXEA 4NFHA 4PSAA 4RD2A 1DOZA 1YWGO 3A2KA 1HQDA 3K32A 1L1QA 2WYIA 2PX8A 3OMLA 5DMHA 4XXHA 1AS2A 3GFRA 4PGMA 4JEUA 1KAGA 1WU7A 2ZK7A 1UBHS 1UPTA 3NH6A 5BT9A 5IMSA 3WLNA 3M3DA 2DO7A 4AYBN 4JUDX 5JYBA 1FSFA 2V9ZA 4OBBA 5AHOA 3TPZA 3O5AA 2NVYJ 1YSCA 4Z7OB 3WWYA 3U3ZA 2X48A 2KISA 1KZ6A 3EG9A 1QQ7A 3WSTA 1KSHA 1Q7EA 1B7GO 4ESFA 4OWRB 1Z29A 2ID7A 2XEDA 2XV1A 2ZI9A 3QOYA 4HUQB 4UUNA 3T1HB 3ENNA 2HN9A 3A37A 4RZQA 5EZHA 2GCEA 1GRCA 2ZRJA 3L93A 4JCOA 1I5RA 2R2AA 3LZCA 4Q1DA 4QDTA 4M0DA 4CM4B 4EFNA 2Q62A 1QR2A 5I8PA 5KOHA 4DSNA 1V6CA 1Y7LA 3BRCA 1YRBA 5AI9A 3OJXA 4ZZLA 3G4SI 3GXOA 1LWOA 5HIJA 3HG7A 5AONA 3ED5A 2C7RA 4ITVA 4TYQA 4MTDA 2G7UA 4FJ1A 4YRAA 1V3FA 5TDHA 4OQXA 1EX1A 1AX9A 2Q3DA 2CE7A 3C15C 3WYDA 4E94A 4RUKA 1OZ0A 2WF9A 2CG4A 3UMRA 1P92A 5KWJA 3CJQA 5ALGA 1EUQA 4HB4A 1FU7A 2G5PA 1GTSA 2F62A 4ALJA 5T4HA 1Q21A 2H3HA 5LA6F 2PBIA 2ZYDA 4GZ5A 2VE9A 4U7HA 1R5JA 3JZFA 2EJVA 1U1DA 3ZMDA 3KJHA 1J09A 5IBRA 4KPEC 4O25A 1LPMA 2DG2A 1Z0ZA 4LA4A 2VDPB 2GPYA 4RJJA 1LFDB 3LFTA 2XLBA 1T5LA 2JAHA 3ELYA 3VH4A 4EHHA 4JYAB 3ZOZA 1GAEO 2G72A 4EPXA 5LZ5A 1BX1A 1EA3A 3FWHA 1UEIA 2ZJ3A 2CU7A 1W6UA 2BGCA 3PEVA 3EEIA 1ZI6A 4PG4A 1K4KA 5H3CA 1I1NA 1G5TA 2PWAA 4ARAA 4LNHA 1ZA1A 4MFDA 4A3DJ 1XR3A 3OQHA 3D8TA 1T9GR 4OP2A 4ZZDA 2P0EA 3ADDA 5FI5A 4RTMA 2CB9A 3D6JA 4O2AB 2LDUA 4Y9SA 5I9SA 4PM4A 2CVFA 3L5KA 3U3RA 3JATB 3UWOA 4MLCA 2LD5A 1MOSA 2ERCA 2PZLA 4HVTA 5J2TA 3R3XA 4OJNA 3V2HA 3SICE 4UNNA 4PXSA 1JALA 2VDWB 1IYZA 5FTNA 3MKZA 2G5GX 1K7XB 4QGBA 3S2SA 1V3UA 2IPLA 4BTVA 1XCJA 2ZW9A 3QMMA 4DHEA 4EGQA 5JSZA 4UXNA 1PQYA 2APJA 2G09A 2PZKA 4TVKA 4E33A 1DBPA 1TO2E 1RKTA 2GHRA 1U1EA 1YQTA 1GY8A 2G1JA 2HK8A 1WVMA 2EEPA 2QP4A 1GUDA 3NIDB 1JJ7A 4H6VA 4DUZB 4DR6B 2A88A 1DTEA 2IOQA 2IYYA 3VPBA 2E1PA 1P75A 2PTGA 4ENPA 3GLUA 3JU3A 3DT9A 2XRLA 2AYXA 2ODBA 4CCAA 4LWZA 1X2MA 3LOUA 1VKHA 3TZBA 4BHCA 3CNNA 3MT7A 2OR3A 5A4KA 5AXCA 3K9LA 2CN1A 3SX0A 3LE8A 1Z0XA 1FZQA 4KX5A 4WNAA 3CLOA 5AW0A 2FNAA 2IY8A 1VPTA 3KOOA 1YZKA 5CQGA 2QW1A 3AONB 3DEZA 2OTLI 4KLRA 2XAGA 2O8FB 2DCUA 2DWCA 1BC5A 3OEYA 5DEQA 2DH6A 1ESEA 1W1WA 4IOJA 3ZHZA 3AUJB 1STZA 4OHUA 1Z62A 1OYOA 3WISA 5IOZA 5F2EA 1OKKA 3DVLA 1E3OC 2G1AA 3WIOA 4PN7A 1FY2A 4CXMA 5EZGA 4QPOA 1C9DB 3QU3A 1IG7A 5FWXA 5JNSA 4CG3A 4DBZA 2EWNA 1VP9A 2X9LA 3RU2A 1KIFA 1YR6A 1LB2A 1R5BA 5EWLB 3VZSA 1PD0A 1RW4A 4ARZA 3E27A 5I7OA 3MFQA 1XKTA 1WO8A 4B3SB 3R5JA 3G49A 1W46A 4ZVOA 1HZZA 4BE7B 1L1FA 4S24A 2Q07A 3CLUD 1K9SA 3GJSA 4KUEA 4UHTA 4XVRA 5F78A 1CY7A 2QG9A 3K4QA 4BFYA 1ACIA 2LSOA 2PWBA 4YMGA 3AKZA 2PUHA 5D00A 1IEXA 1Z7EA 2CZGA 4L3VA 3ZK8A 2PUAA 4RDUA 2Z6VA 3SKVA 1IW7F 5TEVA 1X9GA 3Q8MA 1CT9A 3MC1A 4OXRA 4TT3A 3V46A 5FULA 4AB1A 4MW9A 1RRKA 1E1CB 1Z0FA 1ZKMA 3GVXA 5E7MA 1O54A 2ME6A 3WL4A 5LQJA 4YN3A 1C9YA 1VQLI 3H16A 2CMPA 3OLZA 3OU2A 3TSOA 4D4IA 4GP6A 1R1TA 1OYIA 5JHFA 5FTMA 5LQCA 3JRAA 1L7DA 2E7ZA 1X1AA 2AG1A 2IITA 4ZYDA 5FF9A 4GAEA 3K20A 2K4JA 4BVFA 1EM6A 1EYZA 1JG2A 4CCWA 1E7YA 2XKBA 4CI9A 2R7NA 1VHTA 2OFOA 1UPCA 3QA9A 5DV9A 3TSAA 1TTTA 3ZDDA 4EGFA 4LOCA 2NM0A 2VPYA 3MJVA 2P4SA 3KE8A 1SXHA 1F2TA 4AUKA 1KJNA 4DMRA 5BN3A 5JMPA 3T3OA 4KMMA 3CB2A 2CJFA 4M21A 2PU7A 5BYKA 2JA5J 1PVOA 3IQEA 1MC1A 4CT4B 721PA 3ZXSA 4CKYA 2W0SA 3OX1A 2IGTA 4PG8A 2XHKA 1HF0A 4HNUA 3UG7A 4H4CA 1GNPA 2P2DA 3ETDA 5D3QA 1ORVA 3L9XA 4DRXA 5BVGB 1BI0A 3GA0A 1Z0KA 3CCSI 4J0EA 2XY4A 2XGEA 4CCLA 4TV8A 3X2EA 4BTEA 4TS3A 3A6ZA 2VJQA 4DC0A 2D3TA 3KD2A 4UVAA 1VE5A 2QL9A 4BEJA 3CKYA 1KEEB 1VRVA 1Z4NA 3E9QA 4Q9AA 2MHCA 1JFVA 1I2ZA 1ZCBA 4Y2JA 1EQAA 1OXSC 1QXSA 2VPPA 3FYHA 2ID9A 1VPDA 2B82A 3CCYA 1KDOA 3WKAA 3FYDA 3HEAA 4FT8A 1YO5C 3DKPA 2K5CA 4KOEC 2QD5A 5B1AH 1E3MA 4LCJA 2VK8A 3R7AA 2DTZA 2EFGA 2RGUA 3OP4A 5T3YA 5AJXA 1IN4A 2FVYA 4LMYA 2JHPA 2SECE 3HJFA 2OP1A 4W1RA 5IKMA 1RC0A 1SVNA 4U87A 3E9YA 3ORFA 3ZC3A 4ER0A 1TEVA 1UH5A 3GPCA 3H5VA 4MW1A 4QUEA 1V5IA 3ZMZA 3LKZA 1HDPA 2II6A 4L4UA 1FZTA 3WHKA 2PFSA 4OGKA 2AIRA 3CINA 3UKJA 4NB5A 1BD4A 3DTTA 4DW8A 3A6JA 3SP1A 1MEOA 5KBYA 3EPHA 2YVKA 4N03A 3K70D 2QWXA 2XPWA 2A5DA 4AVYA 3ZVNA 4EGYA 3C48A 3T7DA 4UHCA 2Y0MA 3KL4A 1U9CA 1N5LA 1L5LA 5SZHB 2JB9A 3FNGA 3NGLA 2Q1YA 3A3KA 4HVAA 1XAIA 4JKYA 5EMLA 1YVEI 2C2XA 4ZQEA 3U40A 4YUAA 4R2JA 1Y9EA 1E7RA 3AG1H 1A8SA 2HQOA 2ZSAA 4GP9A 2EIMH 3Q7SA 2XA9A 4N6OA 4HBGA 4HWOA 1E5VA 3VX4A 3D59A 3GTMJ 1ENZA 4WFQA 4ZDKA 2KP6A 3WTBA 3MGGA 3I4MJ 1DQUA 1Z35A 2XTJA 1JSXA 2FXAA 4HQNA 5COQA 1U3EM 3LWZA 3RABA 2C8LA 1I01A 5HDNA 1XEWY 3DTYA 4KZKA 4NHEA 4W5HA 3TR0A 1QP4A 3HK2A 1NYLA 4MYRA 2XB4A 4F6LA 3DKVA 3SC2A 2WJ4A 1WKBA 1R0KA 2RHMA 2EZLA 3V2GA 2QTWB 1ECGA 1TA9A 4J16A 3PDHA 2QQAA 2RBGA 4LRTB 1NR5A 3VR3D 5CFLA 1VJTA 3S1AA 2CLKB 3OYAA 3OLXA 3C87A 4W5WA 2GOMA 2IW5A 3K70C 2ASVA 4B4DA 3ICPA 2GBCA 4NONA 2OU2A 1G5QA 4C6TA 2UZ3A 4IMPA 1P1FA 3IP5A 5CB0A 4G7OF 3HEMA 1WCMJ 3P9XA 4F38A 1RWQA 4IKPA 1FIAA 1RLTA 3OCUA 3T38A 1WKCA 2PMFA 3GYHX 3DTVD 3LQYA 2ADUA 3F46A 3E0JB 4QJBA 4XASA 5IJZA 3HNRA 2PKEA 1O4XA 4RAZA 1TC1A 2EERA 3M4YA 4U7FA 5CT9A 3J7AC 2YWJA 1Z07A 3HSSA 2NSLA 5HKOA 2C4KA 5LBTA 4P22A 4ED9A 4FJ0A 3NARA 3AAFA 2X1LA 3DAHA 1FX0B 4P9UA 5L3CA 1ZM4A 4P96A 2EJTA 2GPAA 5GONB 5JXGA 5L45A 3GMTA 3C7CB 3QLUA 4HPJB 5KX5F 1SEVA 5GM1A 4QYIA 3USZA 1UK9A 2NAPA 1U9ZA 2MMCA 3A1CA 3EODA 4LS3A 1G3YA 1U6GA 1R27A 1ZPDA 3O8CA 1YBMA 2EW8A 2AO9A 5EJCA 4DNCA 2PH1A 1B0PA 3P7MA 3AM4A 1SY7A 1C7RA 2R8RA 4OMFG 4WXEA 1E3IA 3NHJA 4YMLA 2F6CA 3QOWA 5F21A 4BVHA 1TKCA 2VH1A 1Q0HA 3GW8A 4OBWA 4H0FA 4IWYA 4DRYA 1A5SB 1UMKA 3AFOA 2AUTA 2F9FA 1KAQA 2ZI3A 1NSYA 1XQWA 2V1XA 1BXKA 3KV3O 5ALOA 2W84A 4UV9A 3DDNA 3SOZA 2PUFA 3ZGNA 2K9NA 1UAYA 3DMGA 4KYUA 1ZH5A 1XELA 1HDRA 2GIZA 4RAYA 2RBEA 1JSLA 3GBPA 3VB2A 1JIIA 2ZAMA 3LUJA 3IP9A 3QVKA 1X1QA 3SBXA 4P8RA 3W7BA 5JSZB 1XS9A 2IXDA 5C1IA 1L4YA 1YFZA 5JNWA 3C74A 3NAMA 4QICA 3X3HA 3CX8A 2JVGA 3SYTA 4Q47A 1KEZA 2ZJ7A 3K0AB 4KE9A 4BXOA 1A9QA 1IAQA 3KT8A 1WABA 3OPXA 3GZTB 3GFQA 3WU0A 1FS6A 3HA3A 2J5PA 2HFJA 2WHRA 3EXG1 3PITA 4FFRA 1UMCB 3RYCA 1PYOA 4QOSA 2OCEA 4H1WA 3WSVA 4WF2A 1C50A 3T94A 1AQJA 2VKHA 1Y5RA 2H0RA 3N6RA 4RJIA 1GKIA 4NCHA 5UKDA 2A9PA 4JI2B 3ZQGA 5K3AA 1ADYA 3LUGA 5K2OA 3EDPA 1ONSA 3DOFA 3GTKJ 2RGXA 3ESRA 1XRNA 2PO7A 5CXSA 1PTJC 2OUKA 4CR8A 1FFXA 2RHOA 2RREA 1WGXA 5ILGA 4LIUA 2Y9PB 1BGVA 5MGBA 3QEAZ 2RGDA 1Z1DA 2R96A 2PNJA 3V7UA 4UULA 1G4AE 2P5TB 5AK5A 3ZNPA 1U9IC 2NXJA 3UXHA 1T26A 4JK3A 2ESNA 1ILWA 2DODA 2C59A 2AGVA 1P5RA 1U81A 4I19A 3L6OO 2OBPA 1TK9A 2EH3A 3F2IA 4BFUA 3UA3A 4KRFA 1OJ7A 3REOA 3I59A 1L8OA 3S1MJ 4LLGF 2NXNB 1NT2A 2QN2A 2VF7A 2V6MA 2REOA 3BF7A 4RF4A 3EPZA 1E58A 2ZT7A 2D1FA 1NU8A 3CUVA 2E35A 1CETA 2ST1A 3Q6NA 4OB8A 2QX8A 3RBVA 2R1TA 1BJAA 4HYEA 1OD6A 2HO5A 4FTWA 4EG4A 3KLMX 4YJ2A 1CK4A 2C7GA 4D45A 1NRXA 5LP6A 3FYSA 2J3JA 3AZPA 2PUVA 5IKXA 3CO6C 1H22A 2PS3A 3D8RA 1Z17A 3QPVA 2MINB 2PA0A 4KFUA 4XMYA 1BCRA 3A4NA 3PENA 3AG5A 2VP9A 2AN3A 4K6CA 4E7KA 3INNA 2HYIC 3G0HA 3PPIA 3G9UA 1EE2A 3CRW1 1MHPA 1CUXA 4JI1B 1FZPB 1SUDA 2GVDC 2BSXA 2WVAA 2ZJBA 4LWOA 2A8YA 2DDAA 3VR5A 3GF2A 4MSUA 4IV0A 4J9VA 4CKEB 1ZG3A 1M1XB 2I78A 2RGCA 4L8FA 1GJRA 4XRRA 3E0XA 4I01A 2EZIA 2VN8A 3FPLA 4IDPA 2XGDA 5EEGA 2H6BA 2UZ1B 2JIZA 3CP2A 2X8BA 4CNBA 3KC2A 4B6PA 1ETWA 5DV5A 2Q5EA 5FOQA 2FNPA 1E9DA 1T5DX 1J9ZA 1M0WA 4IHJB 2HZ7A 2BKAA 3ZK7A 4HSGA 3VSDA 2N8GA 5C4IA 4EL0A 2WMNB 4BPBA 3R7WA 3V1MA 2ZG6A 2PEYA 2VSQA 4B46A 5DN6D 1JKJA 1NBMA 1LE8B 3LSHA 2VH2A 1LI5A 4M99A 5JNRA 3VGJA 5MFZA 3EEOA 3JZIA 1ZRMA 8ABPA 2P1ZA 3SJCA 5KJ1A 1FFEA 2ELKA 3VOEA 3FAZA 1KMHA 4NBWA 5BSGA 2OV8A 4JASB 1CHDA 1TYZA 2PHZA 3WLEA 5I4BA 4GPD1 5REQB 1AWCA 2VDRB 3CN9A 2J0QA 3RWBA 1E8NA 1O95D 1WF6A 4DYCA 2WU8A 3GVHA 1DNPA 4MTLA 3FWZA 5AK6A 2QSYA 3PRKE 3GLKA 4QUGA 2WHXA 2YIVX 2KLHA 1TJ4A 3PLRA 4LGCA 2BGKA 1EKEA 3ZWPA 3VDNB 3KKKA 1UDCA 2ZAIA 4GM0A 4I0WB 5CM8B 2VWQA 1EFVB 3WLHA 4BLQA 3OZAA 2IPAB 1Y8CA 4J3FA 4TKLA 1ZXLA 4ZJZA 1VBFA 4YJKA 3D0RA 2ZRNA 4X8LA 3BGDA 1IAWA 2WNIA 4GKAA 5U4QA 4HAYA 3RF7A 3OQIB 2CXNA 4G1FA 4L75A 1S5LC 1A1VA 4BZPA 3KUCA 3DFZA 4W7IA 2QKYA 2XODA 5EZYF 1V1MA 2HQBA 1BOBA 5LZ2A 2CUJA 3V8VA 4DWJA 1AF7A 2FSFA 3LFKA 2EGGA 3GYGA 3PL5A 4KIWA 1J8FA 4NDZA 4QDZA 2QUBA 5E4YA 1J4AA 2ZUFA 1R7JA 5AKKA 4EABA 1X9IA 1RKWA 4WCDA 4M3NA 4D4MA 1AKMA 1WU8A 4G09A 1UOEA 4GOXA 3VYRB 4XNFA 3DBLA 4ARBA 4IKOA 1EP3B 2OEPA 3WBBA 2F5DA 2MSLA 2XBLA 4ZDWA 2H29A 3QY9A 1P4HA 4LF9B 3VHRA 1G2OA 5AKIA 3FA2A 3IP1A 1V2HE 2GN6A 2HQAA 2RH4A 2XI4A 3KZMA 2NTYC 4H1UA 1JPNA 5D7BA 5EWLA 4ARZB 4EA6A 3JQGA 5FPSA 3UAGA 3HZJA 3TP3A 3EZ2A 4L6IA 3RK4A 3DMFA 1PSDA 3GEZA 1FXWA 5GOZA 3W8EA 2OYRA 2C97A 5L4NA 2IQIA 1EJ6A 1JQJC 5E3JA 4PAGA 1TECE 1NQAO 2HJWA 3LI2A 2Q5HA 3JYQA 3VSEA 4ZP1A 3QPDA 4A0HA 2K85A 2DHEA 1RQ7A 2IYQA 5A04A 3C1UA 4NC6A 2DK8A 3LT5A 4Y2QA 4BMZA 3AQIA 1UEXC 2GEKA 3TW0A 4E2WA 1O94D 4YEJA 3HV0A 5H9VA 4I3FA 4KNYA 4BO8A 3JASB 4YLGA 821PA 3H2GA 3LXXA 4L5CA 3T6KA 5K8CA 1H4TA 4RTJA 3JQEA 2UUZA 1BJKA 4I50F 3ZD6A 3T3GA 1ENPA 2P9GA 4G6TB 3GJ3A 3RTAA 4HLNA 1UC8A 3A8TA 3LUFA 5EF6A 2HREA 2QWWA 1ZUNB 3M5PA 4X91A 4MGRA 5LXTF 3WYBA 3ELWA 1Z0IA 4DG9A 3S3OA 4HFJA 2OV2A 3OT5A 5EG5A 5LA6A 4D2IA 3NH9A 3DJFA 3RYFB 3RFVA 5BQPA 4ARIA 2YSRA 4DSUA 1O6CA 1JG6A 1R00A 4DNXA 1MBKA 4OB6A 5F3DA 4YUYA 2I6GA 5SZKB 5K0LA 4L2IB 4F3YA 4CCOA 1V8OA 5DT2A 4PLTA 1N2CA 1P81A 5JE8A 3WGZA 1YS9A 2VPLA 2VZLA 5THKA 1DGQA 1A95A 3MB8A 3W8NA 4MH0R 2HYGD 2R6AA 1FJLA 4GYWA 4MKIA 2HA3A 1JHDA 5C44J 2ZPTX 3MIIA 2H4WA 4NU5A 4PNEA 5I9MA 3K9BA 4AJOA 4CF5A 1BXZA 4DA9A 1NVWQ 1P2FA 4BAYA 1TVKB 2XRMA 4ZK6A 1IDN1 5JJ5A 1PZEA 4ZOLF 2ZR0A 3OZEA 2NP7A 2LKSA 1MO6A 3L82B 4DRZA 2OA4A 1RC9A 1IN7A 1QJ4A 1RWMA 3FETA 1H23A 1ORDA 3ICCA 1Z25A 3MD9A 2E4XA 2BZ0A 3FF4A 3PVZA 1NPTO 2ZUTA 5CBKA 3CYFA 4WZAA 2E4ZA 1E2UA 4MCIA 2WI8A 4C0JA 2H0AA 3CUOA 4QUJA 2PV0A 3BY6A 5IT3A 1DJNA 1M73E 3THOA 5HRCA 1F9AA 2VDVE 2ZBEA 3BZCA 3MJ4A 4EUKA 3BAZA 2SNIE 5FL3A 4RF2A 1Z3XA 1VCHA 4YIKA 3UPUA 5C7OO 4JX6A 2JBAB 4UUVA 4II2A 1WCIA 4NMLA 3GARA 1SMKA 2DFKB 4Q7LA 5HZKA 4LZWA 2GK4A 4C0LA 1IXRC 3E5QA 1CS0A 2NQ2C 3BCRA 5KNDA 2O9JA 1CUUA 1WH5A 3DKRA 3JTMA 4ZT2A 2QSZA 1WSUA 1YZVA 3HPQA 4NYJR 1GZHB 2ISZA 2RG1A 5BN5B 3RJTA 3C14C 1RKBA 5JO9A 3ZQ6A 1PFUA 3W2TA 3ZZNA 1FS5A 2FZEA 4UBJA 2GGSA 2VJBA 3QJ5A 4EKEA 3HCWA 1HYGA 3WO1A 5DW3A 1HQCA 1Q14A 2IZ1A 3FRJA 1M6VA 5I8WA 4LYAA 4ZRDA 1KJ8A 3P0RA 2ZXEA 2AI2A 1TFRA 5FFMA 4BQSA 2B1GA 1T4DA 1MMAA 1TBXA 1K83J 2ELJA 1JHOA 1G2IA 2V55B 3AI7A 2W2MA 3QBVA 2NS8A 3BJAA 3VR5D 3NWPA 1EA7A 3CXUA 3CLHA 4LTNA 3M2PA 2X42A 1A5ZA 1U0TA 2N47A 2WWTA 3ECHA 2HBZA 3DB1A 2VJOA 2STTA 4G1VA 3USES 2XAAA 3A02A 4DV5B 4R1NA 1Y80A 2VNIA 3V1TC 4DAOA 3A4CA 1PDOA 4TRJA 3KKPA 3KT0A 2XE4A 4WASA 1AGRA 2XF7A 3TGNA 1H94A 1P3Y1 1N3YA 2QQEA 3KPUA 1Z3CA 3UOWA 4AJIA 3UBMA 2ZYWX 4JLWA 4ZVMA 2B63J 2XCLA 3WK6A 5D01A 3DKKA 4ND2A 2ZQ5A 3RRYA 4UNPA 3HDQA 4MIYA 5JVDB 3S7ZA 3RU9A 1I6XA 1A4UA 3WI7A 4NJOA 5AQEA 1NUHA 1SQ5A 4K26A 3PEWA 3LMKA 5CDYA 4PHFA 1HEUA 4LJ5A 3T7CA 4M3GA 5LYYA 1ZK1A 3QWIA 3VAYA 2RGGA 5GWXA 2XF8A 4LFUA 3MNFA 4DGSA 4CEJA 5HLGA 3O9MA 2ZUDA 3SHOA 3K73O 1C9JA 2CB0A 1JNXX 1U02A 3EETA 3NKVA 4D9KA 1NN0A 1RKVA 5CG2A 1QRTA 4DLTA 2X7JA 2JSCA 1KHHA 1U4SA 3WWZA 5JQWA 1K88A 3NANA 4ZYWA 4U7PB 2CYBA 2DKOA 5ALDA 1YRNB 3LLSA 3PL8A 4NOMA 5HWSA 4WRRA 1KI9A 2V96A 2HU8A 2XE6A 3HRKA 4OK6A 2IEGA 5F1JA 1JDBB 1TJ3A 1P4AA 4Q7MB 4C0AC 5A9SA 3G79A 3H4MA 3C6XA 3REQB 1Q15A 5A6SA 3OSFA 1R0RE 2JL1A 2R48A 2Q6IA 2SICE 5EKSA 1OIWA 5C35A 2JLAA 4LZZA 5KO2A 3FTFA 4Q9IA 2R00C 5F6FA 2X86A 3RVRA 3KKNA 1ZD4A 3E81A 1THZA 2C03A 3U0BA 1N2ZA 4Q9DA 1N2JA 1SFEA 3HR8A 4Y2VA 5TPWA 4KR7A 2B4QA 1U3UA 2ZROA 2QB5A 2HYDA 5AW5A 5H9WA 5HIIA 5K5RA 2FOWA 3UT0A 1BW9B 3AHGA 3K2QA 4IIGA 4DF3A 4F9TA 5JHHB 3E6BA 2PLFA 4C05A 2DFIA 2ZYIA 1KKLA 2ONZA 1C14A 3E3OA 2R1UA 3I6IA 4GNRA 3UZUA 4IOMA 4EQ6B 1SCJA 3EAFA 4CYDA 4XFDA 4KPUB 1E3PA 1QYRA 3GQBB 4UCQA 4TOIA 4JVOA 4S0ZA 2O1XA 3OTOB 1SFOJ 3HWX1 3P0EA 4GPBA 3AHIA 2HA5A 1GCGA 2ODEA 3DO6A 1QGUB 2HMUA 1NH3A 4C4RA 2EL9A 4PC7A 4WWCA 2V0CA 4JBHA 4G97A 4Q9NA 4R9UC 1LLCA 3PBKA 4MUJA 4PAMA 5CJJA 3DBRB 3WQHA 1LBSA 1HKTA 1HYEA 4EHLA 7AT1A 2ORED 4GVXA 4H3KB 4B4WA 4OXKA 4E03A 4A0RA 3L0ZA 3PXCX 4KNVA 3QX7A 1CUAA 1YQAA 2NS0A 1NJGA 1BXRB 4IILA 2VUHB 2O2GA 3P0HA 4KBFA 4WFJA 3IEXA 4G4SP 5CLQA 5G3ZA 1ZNZA 2IHYA 2QUZA 4I99A 2BMDA 4WA8A 5HMMA 4GD3Q 1I7PA 5FPKA 4JJ8A 2ACWA 3RPQA 4G6DA 3GPDG 3LC0A 3OIGA 3QVLA 1CJBA 4HLDA 4Q05A 2PRKA 1F2DA 2V6JA 4L0YB 3EUFA 3GJRA 3IAM1 1UWKA 2J5OA 1Z5NA 2BHRA 3G89A 2PSDA 4FLFA 2FJ1A 1MORA 1XZGA 4UUSB 1K7CA 1OBVA 3GQVA 5TISC 1PR0A 2REQB 1YO6A 1KSGA 5I7SA 3U7RA 2YASA 5J1TB 1JEJA 1ZK2A 2CUZA 5HNFA 2GJAA 3IUEA 5BW6B 1V48A 5DZSA 1PFGA 2R7WA 1TJNA 1XZ8A 3ITKA 3N07A 3UWDA 1YVDA 4IQ4A 3BQYA 3BF8A 3L8EA 4X5OA 1W9MA 1SCDA 4KWHA 5KK1A 2OP0A 1XALA 1NU6A 4GI2A 5CIQA 3ZY5A 1FRFS 2IXFA 3PQEA 3HGGA 3GIWA 4FHTA 4MDEA 1U8FO 4YNBA 3IC5A 4ZU3A 1CB0A 1CUZA 3R1IA 3SEZA 4H7IA 3ZLVA 3KQQA 1KI6B 4BECA 2WADA 5F64A 2D2EA 2C88A 2MYNA 3GJXC 3HUEA 1O6GA 3L0SA 1T35A 2J09A 4RK7A 3GJ6A 3IT2A 1GZ3A 1HBJA 3H0EA 3BJOA 2GN9A 3BSWA 1JIQA 4PSVA 4F6RB 3JPWA 1CRPA 2Y27A 4I02A 3MUOA 3TQOA 1LFBA 1WRBA 3W06A 2HYFA 2J30A 2HVQA 2OO5C 3H6KA 1M2KA 3RRMA 3TNDA 1OMIA 3UENA 3CKMA 3FN4A 2XMSA 1KYVA 1T3SA 4OKNA 1TM5E 4HJRA 2AWNA 2XWJI 1OTHA 1A77A 1KEWA 4IFBA 1WPXA 3VVCA 2B83A 2LREA 2RI0A 3L79A 3G2IA 5IASA 1AMOA 3W2HA 5B2EA 5H59A 4MQFB 2WAQN 3AJAA 4RANA 4WKBA 4I55B 4DEVA 4ETSA 5IVPA 4YWJA 4WA7A 1Q1NA 1XQ9A 3UW3A 1UBOS 5A5FA 3Q0UA 3I4CA 1FMWA 2F5VA 2V4JC 2ZCWA 3PC3A 3SY8A 1XAHA 2DH5A 2JC3A 2R5YA 5C4GB 4I55A 4QWWA 3WLTA 2Z5VA 1BJTA 2GRAA 3ED1A 3FLEA 4LMAA 3BCHA 4U7TB 2BKLA 1XMVA 3JQ9C 2YIDA 1CZKA 3BLYA 3CJRA 4U2GA 4UVIA 1HYHA 3IDQA 121PA 2J3MA 4M83A 4QUAA 3S2GA 2DHCA 3FIWA 3BGSA 4GI3A 1CVRA 4DY6A 2RDMA 5ERXA 2OV7A 3AEUB 3CUTA 5DO9A 3HOZJ 5F5NA 2ZJ8A 3EZXA 1P0FA 3D8BA 1K86A 1ZR2A 3PCTA 4IXTA 4LOKA 4MKZA 4TMFA 1GGNA 3RRBA 3PXUA 1KI7A 4ZXPA 5EVJA 4AYXA 4HEA6 4KQWA 1WQ4A 4IHJF 3WK4A 2ZBUA 1EZ1A 3LAPA 1Q7TA 3EUKL 1KQPA 3HOXJ 1US8B 4H7JA 5DCLA 2O8BA 3K1YA 3PZRA 4BDTA 1Q0TA 4EG6A 2BXZA 1E3JA 2GEJA 3W3CA 1U3FA 1FMCA 3SYMA 3AHHA 1RQXA 3H86A 3PC4A 4CKWB 1RNLA 2BEWB 1QANA 2X58A 1ZXXA 3NUZA 1T9BA 4XVHA 4YLEA 4CEIB 3CLSD 1V5GA 3NRCA 2WTNA 5J58A 1TT5B 2ZR8A 4BGVA 2GN8A 1PGQA 3VA7A 4I5IA 4J4BA 2ZPUA 2RKBA 1MV5A 3CCRI 1WCV1 1WLSA 2H4FA 4DYQA 3L8HA 3Q11A 1M1UA 3PUKA 1RJDA 2VDJA 4QWQA 4FCYA 2A4KA 3I1JA 2NU9B 3HFSA 2YXEA 3G0BA 1AGXA 3H5OA 2EZUA 1PBNA 2ZT6A 3EQLF 3MTDA 4JEIA 1FY7A 4DM3A 5JS6A 1JDPA 1S01A 5K3FA 5ERGB 2HEOA 3UFXB 3TEJA 1AVTA 1NDQA 1U9YA 4NHJA 2DMRA 3FYUC 1P7CA 3I2KA 4H6PA 3RVJA 3WZLA 5EIFA 4EG5A 1L1EA 5CD9A 3VNUA 3GFGA 3MM4A 5DNWA 1YONA 4JEHA 2QM8A 3QKSA 4YQZA 3TOZA 5H3LA 1M2HA 1OCZH 4LNUB 2OBYA 3F71A 4KI0A 5T57A 1KSFX 3LK6A 4PHTA 4FIDA 2XOXA 3OIFA 1BX3A 1K6XA 4S0HB 1YQDA 3KJQA 3NZEA 4HNGA 4HWKA 2PKWA 4GU5A 1Z2OX 1O5TA 2G0AA 4I5GA 3SC6A 1L7VC 2A68F 5DIZA 1WNTA 4ZZ1A 2FW0A 2Q1ZB 2YVUA 3LNTA 2A69F 3CC7I 3FM9A 3HI6A 4MUHA 3S8YA 2OK8A 2LBFA 2FEPA 3CMMA 2P2CA 1KK3A 3KOYA 3ZJYA 4B76A 3MINA 1M8KA 1WUHS 3USCS 1CNFA 3P9RA 4DA6A 2QRLA 3RC9A 4TUYA 4U0KA 4A0YA 3W2VA 1CJVC 1J42A 4N9HA 1Q74A 1D6MA 3M5CA 4C1NA 5DASA 3VKHA 1VLLA 2G25A 3QPWA 4AIKA 2H2IA 5LOVF 4O5AA 3ZCXA 3M2TA 4MV6A 5DBFA 1D4AA 1DP4A 2Y76A 3UUGA 1Z6XA 3IBFA 1BCSA 3LF1A 4FNAA 3OYMA 4R8RA 3UTDA 1E3QA 3CY6A 4PS0A 4GHWA 4I4TF 3GELA 3VHXB 3X1XA 2JGKA 3NBZC 1JEAA 3G2OA 5LYJA 3B6IA 5C5EA 1U2PA 4K03A 4O4IA 5F2NA 1Q6ZA 3L9FA 1D8TA 4L9SA 2UV8A 4MS4A 1JJIA 1XV5A 4R51A 5DNCA 4XQ9A 2QAGC 2BMFA 4FX4A 2PGNA 2OWEA 3PD7A 4QAJA 1FJHA 3BPXA 4C4OA 1BE8A 4PVDA 2IYXA 3JSOA 1UJ2A 1CVLA 3DOIA 1T5HX 1WDWB 4KAAA 3UR3C 1ACMA 1XNGA 3RE1A 3VR6A 4MI1A 3A0BC 5JSQA 1S2IA 2PRZA 4NMHA 2V1NA 1VBMA 2AQKA 4BASA 4JC8A 4D0RA 3DS8A 4PPNA 4RK4A 5C1OA 3NXKA 3GRAA 4WDQA 1EQUA 2FOKA 1KQ9A 4BQEA 5IN5A 3MEXA 3BZUA 2GN4A 5FCDA 5D85A 4C2MJ 3I37X 2DBRA 2YJZA 2AW5A 3UNGC 3D6UA 4LOHA 1BD3A 1O95A 1RPAA 4NQWA 3BRWD 3JWJA 3RKUA 1UMQA 2JF0A 2V45A 5JH7B 3LUCA 1FFXB 5G1OA 2MCFA 4AZ0B 4W5QA 3KZOA 2C4HA 2IE8A 1HSJA 4DMFA 4KISA 4K9MA 4XH9B 2FR0A 1U3CA 2WWXA 2ONJA 5C1BA 2J48A 1AXGA 3H13A 4KE8A 1ZMTA 2HPIA 1VYUA 5KX5B 2B5VA 3MWMA 4GQBA 4RORA 2NO4A 3GAFA 3OEHA 4CLRA 2ZCJA 1YZGA 1ZTRA 1D07A 2IYNA 4EGSA 4HYTA 1YE9A 4CYCA 1D9ZA 3HCCA 1U78A 1ZRSA 1Z2NX 4XIYA 4C7OA 2BFEB 3KIPA 4BKOA 1IXCA 1F5NA 1LQUA 1XZLA 1XZPA 2BE9A 4KSBA 2L7FP 4AF8A 1I4DD 1U3DA 5EMHA 4CNQA 1KYYA 2P3LA 5HCIA 3OWXA 2AR9A 3W04A 2O48X 4X92A 3RKXA 1UK7A 3LCJA 5K3OA 1U5TA 4NCXA 4OOEA 4DLAA 1CEEA 1KYWA 4MHGA 1A4XA 1N5MA 4ESOA 4WLFA 2Q1TA 1IZ0A 3IEVA 4AS3A 2FEOA 3BHIA 1RYHA 2QI9C 1X38A 2QK4A 2WF7A 2CNWA 2XT9A 3P0JA 2QPOA 2AJLI 4B7XA 4BV8A 4MQLA 1UB9A 2WZQA 1NNI1 3WTXC 1EB8A 2GESA 1B8OA 3PRHA 4DEYA 2MINA 3FXUA 3KB2A 4BV3A 4OMZA 2E1CA 2HO4A 4DUGD 1P7IA 2QX7A 3NALA 4O63O 5FUQA 5IVHA 1BMTA 1W9HA 2OHJA 3IT3A 1IU9A 5AO9A 4O6VA 4C7BA 2LF8A 4PSWA 2F43A 5EIAA 1MNMC 4W5OA 2P8JA 3IV7A 4HRVA 2E60A 1W0TA 1QHHA 1LV7A 3ZHYA 5K05A 1RC8A 5BWOA 4YRDA 3H2IA 1RC1A 4X45A 4E32A 2YHAA 2RKWA 3JQAA 3N8NA 1UANA 1E5XA 3E82A 1BROA 1A9YA 1S3SA 2QUHA 2R7TA 1Z8HA 3R5KA 1ISRA 3K05A 2Q27A 4WKPA 2VUTA 4ZVKA 4FXOA 1MW9X 1CC1S 4FYKA 1CJUC 4I1RA 3GGSA 4PWZA 1Y7PA 2XKKA 1RQPA 1XQVA 5JYEA 3CUQC 3NBFA 1R4AA 2OHGA 3I05A 1LTHR 4R3UC 4R5HA 1SOVA 3V4FA 3ZWCA 1T9AA 5ALIA 4E5KA 2PH3A 5E1WA 4U8GA 3RHZA 1CQJB 5IAEA 3FSRA 1S29A 3U09A 3AIIA 1XX5A 3GA7A 1ODJA 3HCDA 4RPCA 4DR1B 1OH5A 1XMJA 2DFNA 4QECA 5ERYA 4WEQA 2JLVA 2LUOA 4NU6A 4PCAA 5AI8A 4EYSA 2KL4A 2G77B 3KP4A 1WB6A 2IKSA 4PZYA 1FP6A 3QUCA 3FOFC 1Y1PA 4JC0A 3ABSB 1SMYF 2JPBA 3UB4A 5KSYA 2I91A 2GWRA 2QEQA 3GNSA 1QHXA 3C85A 4BMXA 3CWZA 3KP5A 3RIGA 4RDHA 1LFAA 3RNLA 2OM2A 3RTBA 3JAMA 4YWHA 4EPTA 4RFSA 5GIPE 1ECJA 3HVIA 3PB3A 3U60B 4TYYA 2CDCA 3K7EA 3MN2A 1JT2A 5AMXA 2JCVA 5M5WJ 3CX7A 3I9OA 3M1AA 1PW7A 2HI3A 4G63A 4XONA 2JJQA 1U2WA 4HJXA 4YJ2F 3R7WB 4EB6B 2WY7Q 1JGTA 2M98A 2MT9A 5FD6A 1JKJB 2DC1A 4JP1A 2YBEA 3QVSA 1ZIYA 3FFAA 4IV5A 2WQ6A 1DO8A 3QFRA 1Q19A 5CYVA 3F5DA 2M4KA 2KRHA 1OLXB 4G5FA 5CVUA 3O26A 5DE3A 2OZEA 1K5GA 4US1R 2KMUA 2QDXA 5F08A 4BFSA 5HQ3A 5AVWA 3BHMA 4YIRX 3GAZA 1FNMA 3CHYA 4AJ2A 4QUKA 1F1ZA 4EDFA 1LRJA 2ZUCA 3WYNA 4H3SA 4CM8A 1FFBA 1SKBA 1VG9B 2EFEB 2H1FA 1DBRA 3K9QO 4PXAA 1DJOA 3T52A 1SXJC 4U2DA 3W79A 1ZIDA 1N1MA 4FQ5A 2PLYA 1IPFA 2CHUA 4R1UA 5DWQA 3CZ6A 3RC7A 3TQRA 2B0LA 4A23A 3JQGB 2VZ0A 1A9XA 1P4XA 1CUFA 1W1WE 3RAJA 3MWEB 3MT0A 1OY1A 1F4VA 1WJFA 5TIIA 1FYDA 2B98A 4HTFB 5HLIA 2VE8A 3ENWA 3IXLA 4QJ5A 1SKAA 5I7FA 2LKDA 1DKOA 2LDBA 5D7NA 1MD0A 4M3DA 2ZWAA 3L4SO 2H1SA 3UT6A 3TIFA 2HXSA 2E6UX 2HS5A 3JVUA 1SEUA 2JJ7A 3ET5A 3RG8A 2Q8KA 2IOFA 4GXOA 4CR7A 4BZXA 1QH0A 1EFRA 1J8YF 2C2WA 4E5NA 4GMKA 1KZ7B 4X8HA 3TLAA 1HZZC 1UCFA 5BNZA 1IJEA 4PPYA 5CG1A 3AERA 3R6LA 1WEHA 3E2IA 1Z3IX 1EUZA 4X00A 5ENDA 2GEUA 2A2ZA 4JX4A 3PO2J 1DPUA 3FKJA 2VATA 3F8TA 4JKIA 5C53B 4OP3A 4Z9AA 3BFVA 2YMPA 1XVIA 3AJDA 4CMIB 3CJTB 3U7QA 4XOPA 1D0IA 2P3QA 5KCZA 4DYRA 1QGYA 3R9XB 2WU0A 1IVYA 3PCRB 4FYMA 3MHPA 4PCLA 4B32A 1VGQA 2J46A 1FLIA 1FOWA 1EI9A 2EZ8A 1CE8A 2OESA 3K0FB 3EFHA 2RNGA 1O97D 2EFHB 2B3TA 2FWRA 3MWYW 1Z38A 2C6YA 3PU6A 4GVPA 4JIMA 5IDVA 1Z6QA 3WL7A 2QZJA 1QQIA 4ZO4A 3G2MA 2PE5A 4N0PA 1VIVA 4YASA 1E2FA 2Y05A 3NGMA 4H6XA 4B4OA 1CE8B 1OCCH 2ANBA 2ZVQX 4QBFA 5HZMA 1ODKA 1OPRA 5HVNA 3ZDBA 2XB9A 2IBSA 2VHXA 1NKTA 2J6BA 2Q3JA 4U5XA 1VQNI 1DKLA 2F5CA 2GO1A 2P3OA 3PS9A 3GLSA 4Q24A 4WGFA 4DQ0A 1CY8A 4OGGA 4L0MA 1LNQA 2OY0A 3D4BA 3GDHA 4NOJA 3TBHA 3WKCA 5CCXA 3AF6A 2FF4A 1Z18A 1U8RA 4KQEA 4K9LA 1UHWA 2PUJA 2BSAA 4XJVA 2C5SA 1KO4A 4Y7DA 2J9RA 1IZ1A 2VF4X 4MKHA 1QZEA 4KPFC 3VNRA 5IAOA 5K5OA 3MK31 2K4MA 3BWVA 1IN8A 1XI2A 2GM3A 3B48A 3CUEF 1Z06A 1U1FA 3IVRA 3LUBA 4UV8A 1Q2XA 1JH8A 1PVDA 1T1IA 3NJ8A 3PUIA 5CT8A 3UMF