2GWRA

Crystal structure of the response regulator protein mtra from mycobacterium tuberculosis
Total Genus 69
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
69
sequence length
227
structure length
225
Chain Sequence
DTMRQRILVVDDDASLAEMLTIVLRGEGFDTAVIGDGTQALTAVRELRPDLVLLDLMLPGMNGIDVCRVLRADSGVPIVMLTAKTDTVDVVLGLESGADDYIMKPFKPKELVARVRARLRRNDDEPAEMLSIADVEIDVPAHKVTRNGEQISLTPLEFDLLVALARKPRQVFTRDVLLEQVWGYRADTRLVNVHVQRLRAKVEKDPENPTVVLTVRGVGYKAGPP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA-binding response regulator mtrA
publication title Domain orientation in the inactive response regulator Mycobacterium tuberculosis MtrA provides a barrier to activation.
pubmed doi rcsb
source organism Mycobacterium tuberculosis
molecule tags Signaling protein
total genus 69
structure length 225
sequence length 227
ec nomenclature
pdb deposition date 2006-05-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00072 Response_reg Response regulator receiver domain
A PF00486 Trans_reg_C Transcriptional regulatory protein, C terminal
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 2gwrA02
3.40.50.2300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 2gwrA01
4H3HB 5AIPA 4JAVC 2R7DA 4HX8A 3D02A 2E7WA 3HRUA 3N0XA 3IP5A 4RXUA 1CF7A 3CUQB 3HRTA 2EFQA 4TMYA 2OBPA 2MSKA 2EB7A 5CVIA 3BROA 4O5VA 4YO7A 3LOPA 3FMRA 1ZGAA 5D4SA 4JB2A 2Y75A 1APBA 3E97A 3KP5A 4M6XA 5DDGA 3ROTA 3HRSA 5LRRA 3QLUC 4EMSA 2PFBA 4E7OA 1U2QA 2VXZA 5J8FA 3WGIA 1IN6A 1USIA 4KT5C 1LJUA 1Z26A 1JHFA 4G0PA 4ZYLA 3RVKA 5D5XB 4JK1X 4MQFA 5HDNA 3O6BB 3RH0A 4G7ZF 4CXFA 1QBJA 4BNCA 3N75A 1HKSA 5GQSA 1BI0A 4FT8A 4AD9A 3M8FA 3TO6A 4BXUA 3FF5A 3L9FA 3CTAA 2WJWA 5KK1A 1I27A 4KRFA 2OAZA 2UZKA 3R61A 2M45A 1FBSA 4KN4X 3Q15C 2JT1A 2PUEA 3B2NA 2GQQA 3FX3A 4EM0B 2ZFWA 3GVAA 3EUHA 1IAWA 4RK1A 3F3XA 2FNPA 1J2XA 2QXYA 3P9YA 3IKVA 3GWGA 3HZHA 5DUIA 3RKYA 5FWXB 2PAFA 3HTUA 5A2QK 3IWFA 4G0XA 2Y48A 2PQ8A 3HTSB 4XBFA 5JS2A 3GYHX 1OYYA 1D2AA 4KREA 3ILYA 2RC4A 2OQGA 2P4WA 3Q9SA 1ZGGA 3NRVA 4KPYA 2DI3A 1T0FA 1F51E 4YR7A 2R3SA 1P4WA 3NNSA 4G97A 4YWHA 4LLLA 4UVAA 2XAQA 3HSEA 3QK7A 1BC8C 4KIFA 4L5IA 3VB2A 2Q8KA 4WWCA 4O6JA 3I45A 2VONA 3QLVC 2PUCA 1ZH4A 2F2EA 1RUNA 2QW1A 4D6XA 3DFGA 3QPTA 4ZYHA 1IF1A 3QLUA 1LJ9A 3DLHA 4G0YA 4ENKA 3I71A 3MWMA 3HHHA 4FE4A 1DBPA 3RIRA 3ZMVA 1AWCA 4MS1B 2XRNA 2E4VA 3MZYA 3VOEA 2MD5A 2Q0OA 1FSHA 1FYMA 4MEXF 5DCMA 4I02A 3F8NA 4F3TA 1QQIA 1F4VA 1T38A 3MIZA 3LQQA 2Q5CA 2HWVA 3T8TA 3QELA 3BJ6A 1Z2EA 1ZDMA 3OQNA 4UV8A 1GUBA 2FE3A 3E5UA 1T39A 3EYIA 1GUDA 4MS4B 3QEKA 2K7LA 3I59A 2CW0F 4MS3B 1W7PA 1C0EA 2M30A 2YPRA 1YS7A 4KA4A 3SZTA 3LUAA 3FMSA 1YS6A 3B02A 2DPUA 1KRXA 2K02A 3TO7A 3O21A 3KFWX 4F11A 5PNTA 4ESJA 1YK1A 2JBAB 3KCNA 5C5EA 1YTUA 2HSGA 1TW3A 1R00A 1A04A 3MQ0A 2M1BA 1Z12A 3TGNA 3RYRA 3NQOA 4XLNF 3O75A 2LDUA 3E5QA 3TOBA 2MH9A 2HDCA 5EWMA 3V8JA 2XAGA 4FX4A 1USGA 5HQJA 2V1XA 2GXGA 2V9VA 1MDMA 2QWWA 3I0TA 3V8KA 3LAPA 2L4AA 3QLVA 3JTGA 2FVYA 3F6PA 1ABFA 4BHBA 5BOXA 2A5YB 2MC3A 4PGHA 1LK0A 3QAHA 2CQKA 2FMHA 5BR1A 4Q6WA 4WK8F 1FOKA 4RY8A 5K1YA 4G0ZA 4W5RA 1J7KA 1ZG1A 3CUOA 4IILA 1OKRA 4UHKA 2FNAA 2A61A 3I54A 3RVOA 4ENJA 2L17A 2RGYA 1SFXA 3QOPA 4N47A 3F7NA 3BJOA 1W7PD 5LEJA 2P7VB 2IPLA 3LKBA 4I0AA 3S2WA 4Z2YA 5K5RA 3CJNA 3KLNA 1CHNA 3CKMA 1U3EM 1YK0A 1EH6A 5BMZA 3HVRA 3S99A 4L0YB 3JAMZ 1BM9A 1LB2A 2HS5A 4LG0A 2XASA 4G94A 2ACJA 3BBLA 2A6HF 4WT7A 2CWEA 2EFNA 2JCGA 1ZH2A 5KC9A 3PFIA 2Z9OA 4HV5A 1ULYA 2NZVG 4HOBA 1PUXA 3O74A 3F21A 2WB4A 4RKQA 3T8YA 3HUUA 5LEKA 3ZN1A 4KIBA 3SFZA 3P9IA 5IEJA 1QP0A 4A0ZA 1EWVA 1W5SA 5E17F 3G73A 2FOKA 4N9HA 3ELKA 2PKXA 3GLXA 5ERIA 3UKJA 3K1PA 2M5WA 4LE2A 5KI6A 3U9GA 5TPZA 4W5TA 4HX7A 2ZAYA 4M71A 1YQAA 1C4WA 3HV2A 1P4XA 2HKOA 3A3KA 4MRMA 2HZTA 2VT2A 1USTA 1DG9A 3KE2A 1P6QA 5IUKC 2BGGA 2DK8A 4U88A 2PL1A 3CZ5A 1BAPA 1IN5A 4HQEA 2Q2EA 1EFAA 1XHFA 5LHGA 3BPXA 4LK1F 2GA2A 4GXOA 2D2WA 2D1VA 4HBLA 4LX8A 1FPQA 4RS3A 4OMYA 4XSXF 4JOQA 4OLBA 2M87A 4HZFA 5JNUA 3RKXA 1Y0UA 1ISSA 2CSOA 3EETA 2FMIA 2KJBA 5FBKA 4IF4A 5KWSA 3O2PE 3N4MA 3LAJA 1D5WA 3HUTA 1G3TA 1XHEA 4DN6A 2FF4A 2IOYA 4YIIA 4H3KB 3ZMSA 2B1JA 3F8BA 4Q5SF 2GWRA 2E4WA 2KRFA 3RPUA 4EYQA 1LEAA 2JPBA 5KQLA 3ECOA 2FEPA 2H6CA 4DADA 5D6FA 2DTRA 4L18B 3BDDA 5E1WA 5TPZD 3R4KA 5HS8A 2COMA 5ILVA 4MR8A 3MYYA 4HQMA 2H6BA 1MD0A 2YU3A 1O7FA 3I64A 1S29A 3QP5A 3J81Z 2OENG 1URPA 2HKXA 4MHGA 4GO1A 2P5LC 3JS5A 4WF2A 4XSZF 2RVCA 2Z3YA 1XMAA 3LUHA 2ZKZA 2RQPA 2O8XA 3L00A 4L9VA 2K4BA 1D1PA 3IC7A 2RDPA 1O3RA 2XAJA 1C0WA 2NNNA 4HNRA 5CNMA 2MBFA 2Z99A 1F1ZA 2QQBA 3DPLC 4XARA 3QLTA 4XAQA 1ZITA 1CF7B 1NXPA 2L18A 1GVJA 5EEGA 3H5OA 1XCBA 4IPAA 1PP7U 2VOOA 3NBMA 3JY6A 4U7BA 2UXNA 2YR2A 1D1QA 1PNTA 3BILA 1B9MA 4UUVA 1RXEA 3WE3A 4BYYA 3ZN0A 4RXMA 1DCFA 2LSOA 1ZAYA 4P5OA 1HW2A 4EVRA 2O20A 4ZZLA 2F8TA 2FLWA 1M2EA 3ULQB 1IN7A 1VPWA 1IRGA 3FDFA 3NHMA 3QX8A 4UXNA 5ICGA 2HQBA 4WXDA 4Q7EA 4WXEA 1GXPA 4MQFB 1BI3A 4PGGA 2FN9A 1S6LA 1MJBA 1MIHA 3LUJA 1SXHA 2EFPA 3M9XA 4MLCA 3OLXA 1ONVA 2UWMA 5IULC 3KKEA 2ADUA 1D8KA 3WG9A 3K4HA 1VRVA 4L4UA 5FWYA 1P6RA 1QNLA 5IT9K 2EV6A 2NRAC 1JDPA 4QWQA 4MGRA 4ETMA 1DPRA 1T6SA 3URMA 4OINF 3R0AA 4HDUA 3K1NA 2CD7A 1Z1DA 1GLGA 2STTA 2XKOA 4HLXA 3CDHA 1Z05A 4D0PA 2P7CB 5JFRA 5LBQA 4MEYF 2NS0A 1R7JA 3R6SA 1USKA 2XUBA 4LDAA 4RY0A 4YRZA 1ABEA 4KMFA 5L3EA 4CO8A 1CGPA 4ZMSA 1JFSA 1P4AA 4BAYA 5D5WB 3GUDA 1ZH5A 2M98A 1L3LA 1JGSA 3DZDA 1QQAA 4Y17A 3IKTA 2XKPA 4PCQA 1FP2A 2BGCA 2LNBA 2F5CA 3T95A 2MLKA 3T8RA 3OQMA 4HYEA 1BVHA 2FBHA 3OV8A 4KV7A 2PUBA 5F64A 5ABPA 3KP6A 4WXHA 3I4PA 1DBWA 5HM6A 2FXAA 3H1EA 1DC7A 1ZESA 1SFEA 3G85A 3O1HB 4I98B 1LDKB 2VBYA 2DRIA 2HTSA 2VODA 5GOTA 4RK5A 2STWA 2ZNYA 1VTNC 1BI2A 1U0SY 2E4ZA 2W42A 3JTHA 3DGFC 2EFWA 1XMKA 5DCLA 2W57A 4RY9A 4ZYDA 1NXTA 2RV8A 3OLVA 4MR7A 1WI9A 1MB0A 1O3QA 4Z4GA 5DCMB 2E7XA 1EWTA 2A9PA 5KQPA 3OLWA 3GFIA 2FU4A 1O7LA 3MF4A 4Z0NA 3H5VA 5BQ3A 1I5ZA 5B3JC 4N41A 3LUKA 1FBQA 4AIJA 5JHUA 4KN7X 3K9TA 1QO0D 3F23A 2A6EF 1XSDA 4EJWA 1ZRFA 5HLGA 4WZZA 2DQRA 4YV7A 2GA1A 3I59B 3N0RA 3V7SA 1W7PB 4W5QA 4L85A 1HSJA 3ZMZA 2ZCWA 3ROUA 2EA4A 1HKTA 3W9SA 2N9UA 4KQ9A 1IXCA 4UHJA 3DV8A 4A0YA 1SFUA 1JL3A 1TBXA 1BDJA 1KU2A 4A6DA 4KZKA 3H5IA 3TMYA 2CO5A 1EWKA 2QR3A 1L5YA 1M5TA 1XCVA 2R48A 1UHWA 3FMVA 2QBYA 2HFHA 5EWMB 3IHUA 5FGMA 2FMFA 3KP4A 3GXOA 3L7WA 1NY5A 1BOAA 2XVCA 3CNBA 1MDMB 4IRGA 4RGXA 1CYEA 4Z4HA 2HTJA 4RK6A 2RJOA 3H6HA 4GGGA 3RTRA 4HF1A 4KK4A 5ICCA 2YX7A 1PHRA 1WQ2A 4RDCA 2A9OA 1DUXC 1BI1A 2HEOA 5FLXK 3H92A 2QU7A 4EM1A 4N9IA 5KC8A 1J59A 1A2OA 3KTOA 5CNIA 1I1SA 4AIHA 5L3FA 4A6EA 1R22A 5IBQA 1FNNA 4LD5A 2V6CA 4DNCA 2RNJA 5B3JA 1K7AA 2ISZA 1E17A 1MB3A 4KQCA 1LQ1A 3N0WA 2MLGA 4PE5B 1ZY2A 4N76A 2IRFG 1RUOA 4LG0B 1STZA 4WXCA 5CYVA 3RKWA 3GF2A 5DLEA 4M72A 4IMIB 1D8JA 4A5NA 3ILHA 3H1GA 3CUQC 4RAYA 1QQBA 5CVRA 1L5ZA 2WTEA 3NNNA 3KCCA 3WGGA 2H09A 1ZN2A 3RQIA 3HO1A 4G8XA 1TW2A 5HDKA 5FB2A 2PUGA 2D45A 3HM9A 1K66A 4RB3C 4YS6A 3KEOA 1JWLA 2FMYA 4NV3A 3BZ6A 4WXMA 3TDZC 3NEUA 4ZYEA 1AB6A 1VKRA 3O1JC 2OZ6A 2HR3A 2GZWA 2ZNZA 2LF7A 3FHZA 2QVGA 1ZHFA 2DQLA 4M9ZA 5FFXA 5FLXZ 2WRZA 1R5HA 1UHMA 4ETIA 1BN5A 3WTWC 2NT3A 4P55A 3O3KA 1IW7F 2R7FA 4MLDA 2YX4A 4N0BA 2A07F 5F6FA 1Z18A 4O1HA 2JRTA 3GFJA 5D8LB 2OD5A 1ZG3A 3MM4A 3BWGA 1JDNA 2A9RA 3E61A 2IPQX 4ENMA 3JPWA 5DD4A 4MPTA 1R36A 2JPCA 4G6DA 4I7HA 1E6MA 5DUKA 4Z99A 1D5VA 1BBYA 1XN7A 4L9TA 2FEWB 2P5VA 4L9JA 1EAYA 3REOA 5ICEA 5LRSA 4Q48A 1JH9A 1TTYA 1QP4A 4RGRA 2GIVA 3RYPA 2IT0A 1DC8A 4CGZA 3BRQA 2OQRA 3OMXA 3KP7A 3ZMUA 3MAJA 4D74A 5E3JA 2IYNA 3CG4A 4Z9BA 1EH7A 2MYNA 3JAMK 3KYIB 4LGWA 2PMHA 4EV0A 4P98A 4OLAA 1MVOA 3K69A 4CICA 3T1BA 3KG2A 2LP4Y 1XD7A 4Y15A 4HAMA 3CUQA 5E8GA 4MR8B 4LDZA 2Z33A 2VC0A 1Z6RA 4L5JA 4ZPJA 2PMUA 4O5AA 1L0OC 5CLSA 1YMUA 1MAVA 3I5AA 1DZ3A 2LPMA 3BP8A 1JYEA 2EK5A 2MSLA 2CHEA 3LUGA 1P92A 3KP2A 3F22A 1MZBA 2FSWA 2EJRA 4ZJPA 3FGZA 2BV6A 1NHAA 1R5GA 1DRJA 2NZUG 2VC1A 2L01A 3A10A 3OM0A 3RVLA 1MJAA 3GFMA 4YG2F 2O3FA 3GFLA 1SRRA 5BRJA 1JYFA 5HLHA 5BS6A 3VODA 3WTUC 3IRQA 5E8IA 2O03A 3LQRA 1RZ4A 2XIGA 4H0EA 3JSOA 1P8AA 2FBKA 3IL2A 4RKRA 4ON0A 3RVQA 4EGSA 9ABPA 5HDGA 2I6FA 2EV5A 5DGCA 2PEXA 3OO0A 3E3VA 5D5VB 2AYZA 2B4AA 3HUGA 4W5NA 4LK0F 3QX9A 2QVCA 1FFSA 2VT3A 4CDGA 3IDOA 1XDUA 4RK4A 2PMCA 4E7PA 3SG0A 2J48A 2WMYA 4AWXB 3MEXA 2KIMA 3CS3A 4IRIA 3QRFF 1I1GA 4RGSA 2DT5A 4S04A 5FWYB 4UVCA 3VNAA 3EQ2A 2FSPA 3M6MD 3WU1B 1BC7C 4Z9AA 1MJ9A 2YHBA 1F5TA 5FFZA 1G3WA 1W25A 4KK3A 3IPAA 4U0WA 5HS9A 1ZHHA 2FQXA 2PG4A 1TNTA 1JBEA 4XRFA 3J81K 3QU6A 1GCGA 2VUIB 3D8UA 6ABPA 2V1UA 1R1VA 3TO9A 3FXRA 3CFYA 3EGCA 4QLCU 1K79A 1FX7A 1U2WA 4OIPF 2ELHA 4HW0A 1ZRCA 1FY7A 2E1CA 2RGVA 4W5OA 1WETA 4XASA 4UNOA 5C5CA 1JFTA 5KQGA 3WTTC 1SXIA 5E1XA 4Y13A 5HVQC 1MKMA 1OYIA 3U2RA 2E4XA 3RVJA 3L49A 3FXUA 2XROA 1T34A 3RPQA 4F7ZA 4GNRA 4MR9A 5IT3A 2VE8A 4ZYGA 2X7XA 3HRMA 2HYFA 1LDDA 2X0LA 1B1BA 1YIOA 1S3JA 1I3CA 2ID7A 3BY6A 2O6GE 1GCAA 4GPAA 3IPCA 4WUTA 1NXXA 1WSUA 1Z13A 2P9HA 1BJAA 4L9NA 3Q7RA 4IVNA 4LE1A 1KQ9A 1XGMA 3RVMA 1W4MA 5ILSA 1KYZA 2LF8A 1SXGA 3FFXA 3FFTA 3N53A 4XLPF 2J5PA 1SAXA 3CLKA 4E70A 4XXHA 2FTKE 4OIOF 1SD6A 3V4GA 4MR7B 1SMTA 2IVMA 3DXJF 4TLMB 2ZO4A 3HSYA 1YW9A 3H5LA 2KIUA 1RNLA 2L4MA 2JK1A 1TQMA 1OMIA 1SD4A 5BPDA 1TM2A 3RJPA 3PQKA 2GI4A 3DKWA 5T3YA 1XB4A 5EWLA 1KGSA 2ZMEB 3ERED 5L3CA 1FFWA 1SMYF 2L19A 3JW4A 1OPCA 4M73A 5TQ2A 3HOTA 5LGUA 1K68A 3KZYA 3SHFA 5D5UB 1OR7A 5T7BA 1V3FA 4D6YA 2KJCA 4KNYA 1FT9A 3KEQA 1QKKA 2J5OA 5KQMA 1UB9A 4LZLA 3K1MA 1HW5A 5JVTA 1NXSA 1Z15A 1WKMA 1YTYA 5JR3A 4KMRA 1F4KA 3EJWA 3EQLF 5AIQA 2CGPA 3TOAA 4G86A 3QEMA 1PDNC 4JQFA 4EJTA 3N97A 1FYLA 2LKPA 1EV7A 4OIRF 1G3SA 3DGEC 1U2PA 3H5TA 4EYKA 3FXQA 3M9WA 2PUFA 3EULA 1O3SA 2EV0A 1ZGZA 4YFKF 3KS9A 4NCAA 4QPJC 3A0RB 3Q9VA 2KYRA 2FEZA 1FSEA 1JHZA 4F06A 3VEPA 2Z5UA 4ZH4F 1YLFA 2VE9A 5TE9A 2VBXA 5TQ0A 2D1HA 1B59A 4EJUA 2M8EA 3J7AO 4QYWA 3UK0A 3DLBA 1ZAOA 2FMLA 5TPWA 1IZ1A 3MCZA 3CRNA 1Z9CA 3O2JA 4U7DA 3WTZA 1B4AA 1FQWA 4FX0A 1ZYRF 2DLLA 3R60A 1PP8F 4KICA 3HS3A 5D6EA 3K2ZA 3GA5A 3H5WA 1U5TC 3JPYA 1HSTA 4G9YA 2OZUA 3MZHA 1J0RA 1Z16A 1XWWA 3HJFA 2K4JA 1RZRA 3M1EA 4CZZA 5FD6A 2F5DA 2IJLA 5HSGA 1XSXA 5DKFA 1UCRA 4OU0A 2JVKA 2FXIA 3D5LA 3J80Z 1QNTA 1E2XA 2QENA 2V1DA 3ML6A 3V8LA 2K86A 2XHKA 5J8CA 3T5XA 2EWNA 3H6GA 1FC3A 3L6UA 3JSPA 4ML3A 4FHTA 1G3YA 4M74A 2VBZA 4EVSA 3F73A 3ZQ7A 4N03A 1J56A 3GBVA 4EUKA 3WTVC 1YW8A 3QU3A 1XSVA 4P9UA 2ISYA 2W25A 2G9WA 2DO7A 4R79A 4OBBA 5ED4A 5K5QA 3JVIA 1Z25A 5CVVA 4BQAA 3GZ5A 3Q7SA 1EHCA 3KJXA 4RS8A 6CHYA 3C18A 4XLTA 3I42A 3MMNA 3T0YA 3EYYA 2JSCA 2QQAA 2VK2A 4IHSA 3WTSC 3O1IC 3WTXC 4P9FA 1K78A 2IP2A 2F5EA 2CHFA 4R8HA 1PUEE 1J9IA 3F8FA 2FQYA 4F8JA 2MH2A 1CEYA 4YP9A 2R4QA 3QELB 5LHIA 4MAAA 2A3SA 2JRLA 3EODA 2IW5A 1Y1LA 3SY8A 2NAZA 4EVIA 3KSMA 3LUDA 4I0BA 4LLGF 3GBPA 1F9NA 1OXKB 4RB1A 3ISPA 2DW4A 2HQRA 1JXSA 2HOEA 2IA2A 1U5TA 5CNJA 3M9AA 4I01A 2QZ8A 3F6CA 2QYOA 3E6MA 2PN6A 4EYGA 3EAFA 1E6KA 3RVNA 2XAHA 4EYOA 2DK5A 6PAXA 4QICA 3ROFA 5KVRA 4KMUX 4HF2A 1TLFA 3C3MA 1R1TA 1IXRC 3P7NA 2JVIA 5D2CA 3GX4X 4RB2C 3TB6A 1XGSA 4NHJA 2O0YA 3MQ4A 4G0OA 2GAUA 4IMJB 3OLYA 3K9CA 2VUHB 4FE7A 3SM9A 7ABPA 4U0VA 3E5XA 2PLNA 4M9XA 3SZPA 1TLHB 2WY2D 1MGTA 4IHTA 2JB9A 3DEUA 4LFUA 4HNSA 1U6GA 2PUAA 1KYWA 4BHCA 5H6QA 2JVJA 2CYYA 4RK0A 4G0MA 2MYUA 1FYKA 2V79A 1M5UA 3C6QA 4HNQA 4EVQA 2KIFA 2EFOA 5CVUA 2LUOA 1NTRA 4ZMRA 4DQ2A 4KIGA 1XGNA 1QPZA 3ZP5A 2QZJA 5JS1A 3EDPA 5L3GA 3BRSA 5F1RA 3JVDA 3LMKA 3IP6A 1PNRA 3WODF 1LBIA 2E4UA 2DPDA 4ZZDA 4M9SA 4ASNA 3HIFA 2FQWA 4JBAA 4EJVA 1B00A 2NYXA 1SD5A 4Z4EA 4IGAA 2AXLA 2L3DA 3I53A 1KU7A 5TRDA 2GKGA 2ESNA 3U1DA 2PUDA 1LBHA 3N6VA 2WJAA 3VFZA 1QZYA 3SNKA 2X4HA 4GCVA 4G0QA 1G4DA 3HSFA 4NQRA 4HDVA 4HF0A 4PZ0A 3WTYC 1KMIY 4RU1A 2WC2A 4MRMB 1YG2A 1P2FA 1AOYA 3NNDA 1HXDA 2L54A 5L3BA 3TD9A 4GYGA 2XGXA 2FW0A 2IPNA 1M2FA 2HPHA 2VYCA 1AB5A 4EQQA 4NQWA 4Q6BA 4G6QA 1TJYA 1S7AA 2PJUA 5IEBA 2TDXA 1R1UA 4WWHA 1FZPB 4BH9A 1B6AA 5E18F 4Q47A 2RDMA 4RWEA 2E1NA 3C97A 3TX6A 3FMQA 1FWZA 1BIBA 3Q5FA 1A0OA 2WWVD 4OIQF 2W85A 2M1ZA 1LJLA 1ODDA 2H3HA 1IXSB 1Z6TA 4YFXF 4PYRA 4BHPA 1LVAA 4MR9B 2TMYA 2HJ9A 4MQEA 4G7OF 5K5OA 5A2QZ 3B73A 2FLKA 3HHGA 4A12A 3SXYA 2QLZA 2H0AA 4DQDA 1O57A 4Z4IA 5FO5A 3O2QB 5EWJA 2QVOA 3DF8A 3DBIA 3GL9A 2AYXA 1DBQA 3HOSA 3CHYA 1H9GA 3CO7C 1FFGA 5BQTA 3SAJA 2CWDA 4AIKA 2XDYA 1Z91A 1B9NA 5FD5A 5H20A 3F72A 3GV0A 3EQZA 5JNRA 4QYMA 3G1WA 1TQIA 4LMYA 1ZLJA 5CJ9A 3KLOA 2B0LA 2IDMA 3OM1A 3LFKA 1YMVA 5LGTA 5ICFA 3IP9A 2JZYA 2QM3A 4RAZA 4G7HF 3GZ6A 3A0UA 4A2UA 2WWYA 5ILUA 4IXAA 1KA8A 3ZPLA 5IC5A 3C3KA 4OMZA 2BEOA 1T98A 3W6JB 4EJOA 4AVPA 1Q1HA 4GYIA 4RZSA 1IIBA 2A68F 1YVUA 2MSWA 3CU5A 1WRJA 4LB6B 1DCMA 1RIOH 2PL9A 5EWLB 1DDNA 4MTEA 5JNWA 1S7OA 2EA2A 4PEVA 4M88A 5TQ2B 3KP3A 1ZARA 3ABTA 4N0PA 4CBVA 2FN8A 2KKOA 5BRAA 2BYVE 4EGYA 3LSTA 3DP7A 3FZVA 3Q41A 2BE5F 3KETA 1FBUA 3LKVA 1LDJA 3VNBA 1HQCA 4PZJA 3H75A 3CZCA 2P5KA 1LEBA 3QEMB 1YW7A 2XV4S 3GO5A 3SQNA 1TNSA 1Z2DA 5CVJA 1QGPA 1YFHA 3HDGA 2W84A 3HDVA 3KHTA 5FWXA 2IKSA 4MQ9F 3H3UA 4Q4ZF 3BPVA 3LFTA 3RDIA 1WWXA 1RI7A 4TV7A 1ZVVA 2XAFA 1X3UA 4MQVA 1V4RA 2MYPA 1JX6A 3MFKA 2VOPA 2LIVA 3P9CA 3T38A 2R47A 2C6YA 4YFNF 3HXMA 3H1FA 3TKYA 1U8RA 4Z4FA 1DRKA 1NATA 5TQ0B 3M8EA 1P6UA 5JNSA 1Z17A 1K6OA 4F12A 3BOQA 3QP6A 4MTDA 2QSJA 2YSRA 2RJNA 2ZWMA 3G3ZA 1NXWA 5TPWB 5HKOA 3C3WA 3C7JA 3HEBA 3LA2A 3OLZA 3F8CA 4OG2A 1DCKA 4LE0A 3GRCA 3F8MA 3TQNA 4B09A 3P9KA 2P6TA 2UXXA 3WU0A 4I09A 3E6DA 1HKQA 3DQVC 3EDCA 5DYMA 4CYDA 2YHAA 2DAOA 3RVRA 4KYWA 4MS1A 2A9QA 3HCWA 2P4UA 3KYJB 3QPHA 4NICA 4KFCA 4ENNA 4XFKA 4PICA 2MYTA 5IX8A 4ESBA 4IRXA 1KU3A 3WE2A 2FQ3A 2HYGD 2LBPA 2RKHA 4JA2A 3KZZA 1ZG5A 1Z7UA 2FBIA 2ID9A 4HX4A 4A5MA 4N0QA 1U78A 3RI4A 1DP7P 2O61A 5CHYA 3V7CA 3RVSA 5TJJA 3CO6C 4IJAA 1GXQA 2NNYA 4YGXB 4MS4A 5DCFA 4LRQA 2AS5F 1XGOA 4MS3A 2L2QA 2HGCA 3NHZA 1KRWA 1E6LA 1LNWA 2OU2A 2QV0A 1KQ0A 3FFWA 5JNTA 3Q7TA 2ESHA 3H3ZA 4WCGA 2R25B 4L0ZB 3IRRA 4JASB 3DPTA 3K0LA 2ZXJA 2G7HA 1JFVA 2G7UA 4LB5A 2JBAA 1K78B 1TQPA 1QPMA 1YYVA 4JP1A 4NB5A 3F6OA 1REPC 5DV5A 2IPMA 3L2CA 2K27A 4LLNA 5TQJA 3O2SB 2W24A 1HW1A 3OO1A 5IUJC 3ABUA 1OXBB 3TDUC 4OTZA 3W6KB 1ON1A 2FA5A 1GHCA 2PBIA 4TN5A 4ETSA 1DJMA 3GWZA 1IRFA 5FBHA 8ABPA 3L09A 2WV0A 1NXOA 2VBWA 3HYIA 4M6YA 1U04A 3UUGA 1U5TB 1QP7A 2FRHA 3LTEA 5IUNC 4P1ZA 4RGUA 1R23A 3ZMDA 3I09A 3OQOA 5DEQA 1YO5C 3LWFA 3M7GA 3D0SA 2QBYB 4O1IA 3J80K 2CG4A 2IPAB 1JE8A 1JF8A 1NXVA 1TVMA 5H6RA 1JHHA 3PQJA 1IUYA 4R1HA 1I6XA 2FMKA 5HLIA 4RB0A 1J5YA 5LGNA 4HLYA 1S8NA 1H0MA 1R58A 2ZBKA 5D8KB 4K2EA 4RXTA 4EY3A 5J6XA 1ZRDA 4HV6A 1U8TA 5E20A 4EGZA 1JLKA 4FB4A 5LHHA 1O3TA 4HA8A 5AONA 4UV9A 4Z4CA 3F6VA 1H9TA 3FM3A 3LA7A 4PDKA 1USSA 2L02A 4WX9A 1FLIA 2VN2A 4YIFA 1ZREA 3RVPA 4U0YA 5I4CA 3C1DA 4IRHA 4KUMA 2QUFA 1IN4A 3CLOA 1KQ8A 2BBYA 5HOOA 3MA0A 4LJZF 2F8SA 2A69F 3JTEA 1ISRA 2IA1A 1BDHA 1FP1D 1HEYA 3HSRA 4OATA 5EEHA 3OMWA 2PE5A 4YCSA 2E4YA 5JI6A 1OYWA 3GT7A 4O3MA 2ETHA 3FM5A 1W9HA 1BDIA 2NUBA 1UFMA 5L3DA 2GXBA 2QQ9A 4KVFA 1W5TA 3WGHA 4B8XA 4ETNA 3BREA 3E3MA 3GW2A 3HK2A 5JNVA 1QO0A 3E6BA 5E1ZB 5CNKA 4A0XA 1ZLKA 2DFIA 3LUCA 1UDRA 1BIAA 2P8TA 1J75A 2PLYA 2HQOA 4Y9TA 2MA3A 1BA2A 1IN8A 3I5UA 2CFXA 3I58A 3E6CC 1FSPA 2RN7A 2GBPA 4TLLB 3BJAA 4MGEA 2Y0MA 4JB0A 1DPUA 5DD8A 2F5FA 3N8IA 3CG0A 1H9CA 3IP7A 4RV5A 5LLQA 4KDPA 4ESFA 4EM2A 1SD7A 3AAFA 4RK7A 2NT4A 4UHTA 2V0NA 2DU9A 3GEZA 4OOIA 1G6NA 4MYRA 3TO5A 5IT9Z 1VLZA 1RPJA 4MNUA 3T6KA 1ON2A 2H94A 1QZZA 2IA0A 2ZJ2A 4I2OA 3GYBA 4H60A 1TMYA 2FEKA 3LUFA 1D3YA 1R8JA 2JTVA 5D4RA 3LA3A 5HS7A 5DTEA 1RZRD 3IWZA 1T2KA 1PEAA 1DP4A 1RXIA 3V7RA 3CTPA 3FWEA 3ZMTA 2PJPA 1D4ZA 2OA4A 2PI0A 5BPIA 4UVBA 2FKAA 4YLEA 1HBXG 4MQEB 2GX6A 4CHUA 1PEYA 1E2BA 1KU9A 1QMPA 3R0JA 4P96A 4NCBA 2P6SA 5EWJB 4S05A 1XDSA 2DBBA 4RSMA 2H27A 2ZMEA 3COAC 3OOPA 3ECHA 2HQNA 1EH8A 1ZGJA
chains in the Genus database with same CATH superfamily
1DE0A 3CZQA 5K2OA 4MRVA 2ZSBA 2EFQA 3O8QA 2OHGA 4BKUA 4YO7A 3W5HA 3SLRA 2QMEA 2WWGA 4EELA 4LUCA 4OYLA 5ILOA 2F1HA 5K4GA 4EMSA 3I9JA 3PYLA 5J8FA 3WK4A 3D6VA 1EFPA 1UOEA 2CSXA 5HDNA 2AIRA 2FK7A 4CXFA 3AM1A 5GQSA 5A1JA 1M7HA 4MQ6A 4TL7A 5KK1A 1ZKMA 2XQGA 5IMSA 2WP0A 2QP3A 2VATA 5ESWA 3FX3A 2AJCA 4G4JA 4WLOA 2DOKA 2P9EA 4J49A 5ELXA 1GNPA 1F2TB 1JA1A 4OXXA 3A0BC 4GC9A 2OQGA 1NPYA 4KPYA 5KTSA 4CQMB 1E9VA 1PR6A 3K96A 4AMGA 1P31A 3THWA 3GPBA 3NHYA 4DCMA 4CFSA 3AFOA 2Q0SA 3ZV4A 3ZLTA 4KLNA 1GQQA 3O91A 2VONA 4HVCA 2JCBA 4OHFA 3DEAA 3LXRA 1IBLB 2B7LA 4R1LA 5D3MA 4I3GA 4ENKA 3ZQ6A 1GD1O 3E3OA 3RIRA 3BH0A 1JAIA 1W9MA 2XRNA 2Q0OA 1FYMA 3AFMA 1N0WA 5H4HA 5IVDA 1J4AA 5I45A 2ZT8A 3TNYA 2HQSA 1UKBA 3I01M 1JQEA 1M7GA 1Z0AA 3MIZA 1H2EA 4B4CA 2M1XA 1Z83A 2JFVA 3SXUA 4BQQA 2EATA 4AJ4A 3OMYA 3E35A 1W7PA 4EFNA 5JFGA 3KKNA 4WDQA 2JJ1D 4G5SA 3O21A 1A4XA 2NTJA 4Q12A 3KCNA 3B38A 2Y1LA 4FIDA 3EEOA 5GTIC 4JLKA 3ASNH 2H4WA 1DVRA 3TGNA 2ISQA 3JZMA 3VPAA 1T8TA 2XCRB 2PD6A 2JJMA 4FMDF 2X1VA 3NARA 1SUFA 3V9PA 2GXGA 3U6KA 3K4LA 4QJBA 4RVCA 2YRFA 1F17A 3IMGA 4TTJA 2V4UA 2X86A 4E33A 4PLVA 3BR2A 3LX4A 1MENA 2IYLD 4G0ZA 1J7KA 3JQGA 4OLJA 1YZHA 2E60A 4YRMA 2FNAA 3RUEA 1RQNA 3RVOA 2QA5A 1PIWA 2H1KA 1A9XA 4KQKA 2UUZA 4A7PA 4ZFNA 3IODA 2Q5EA 4L0YB 1X38A 2WTXA 3F49S 2A9JA 1XMIA 4F2WA 2WM2A 2AVDA 1G8SA 1MHTA 4XVCA 4K3UA 2PT6A 1IONA 2DC1A 4QXOA 5BQFA 1P1FA 5CGZA 3TVYA 4DREA 4K05A 2BP7B 2B98A 2R00C 2LK2A 4Y6PA 1I5OA 4KQ2A 2ZYGA 2X4LA 2HKOA 2DP4E 621PA 1I14A 1P6QA 5THKA 1TQ6A 2F55A 1ZM3A 3B9QA 3PDIA 4ND2A 4LK1F 2RKWA 5G4KB 5ARBA 3KAJA 2M7AA 3OZEA 2G63A 1CUJA 1AJEA 4BLWA 3MHPA 3ZCPA 3CNHA 4GOND 1P5HA 3LL4A 3DB1A 4YIIA 1IH8A 3WJ7A 2E4WA 4DRZA 3A8TA 4MRRA 3HR7A 1XKQA 4OFZA 1Y89A 2NU7A 1JG1A 1H6DA 5EJ8A 1QFZA 2IZ0A 4BKOA 5I9LA 3HCPA 1KBQA 5JCJD 1C3VA 2H0RA 1P1RA 2HW8A 3W5SA 2VKEA 4HPWA 2V55B 1XMAA 1WMFA 1D0SA 5C5DA 1BU5A 1J20A 1P2GA 1EM8B 5K0LA 3LWNA 3TM5A 3CVOA 2DH5A 5F27A 4DNFA 1RP1A 1E7MA 1RWVA 5AVYA 3TYXA 1DJNA 2QX9A 1OWPA 1K4TA 1UQRA 1VPWA 3M6XA 1WTCA 3IEUA 3PL8A 3LCMA 1Q19A 3FGOA 1Y6GA 3UAYA 1VM6A 3T0FA 2H1IA 1GZ6A 3VPGA 4OHVA 3J7AC 3ZOBA 2EV6A 1JDPA 3VSBA 4GAEA 4L27A 5C8DA 3W7VA 1DPRA 5IJ0A 1FP6A 4NCKA 1UBUS 4KQEA 3Q98A 4X85A 3OG9A 2OD2A 5CIQA 1QM5A 3GTLJ 1GCOA 4RBOA 4MUYA 2ZB4A 1JECA 5EZ6B 4URWR 2M98A 4QE3A 2XMBA 1W1UA 1T5DX 3T8RA 5TGTA 1WDMA 2FSUA 2P35A 3DDHA 1GPMA 4LISA 3H1EA 1XC5A 4AZVA 2PKCA 1WX1A 3JTHA 1KF0A 1JI3A 1ZK8A 3NIWA 4P7BA 4DBLC 4AZ3A 2JHFA 1P7PA 4KQJA 4IW3B 3PIRA 1W1WA 3U1VA 2VASA 3O0DA 5EF6A 4CFYA 1ODLA 2R62A 4EJWA 3P9XA 1ZVMA 2Q1XA 4GOKA 4PPGA 4OPMA 2OLKA 1ETYA 4EGJA 4Q1DA 1XTQA 4Y0VA 2A9FA 4V0OA 3ZDXB 2CMDA 4A0YA 2VHWA 4QPZA 3N39C 1YS4A 4KIWA 1EA7A 2BZTA 4FFPA 4QSHA 1NDUA 1L3IA 2QBYA 1U8BA 3UWKA 2VT6A 2G80A 3C8UA 5HG0A 5I6DA 1WOYA 2UZ1A 3K4KA 1REQB 1RRPA 1CYEA 2V6IA 2HTJA 3U7FB 5K0BA 3UV7A 2ZSIB 3SS7X 1THMA 2O8BA 1DUXC 1W0CA 4RKWA 3B9RA 2F3RA 1KEWA 2GHTA 1C80A 3L8MA 1N9KA 4AIHA 1ZI8A 3FDYA 5L3FA 2OHOA 4DNCA 4KXYA 1O94C 2FDCA 1D9XA 3CW8X 1A71A 3R3JA 1WDLA 1R4MA 1V8DA 3CUQC 1W6RA 2CD9A 4OQEA 4AQYB 1QGAA 4C5BA 3NNNA 4EFKA 4LG1A 2H09A 5FRNA 1G2OA 2Y1WA 1B6TA 3HJRA 3VU0A 4QOFA 3RS3A 1E2UA 4Y7DA 2W2PA 4X62B 4DPMA 3GLLA 1DARA 1TCAA 1BN5A 1IOZA 5DI3A 3EOZA 2VPXA 1ADJA 3FCSB 3O3KA 1TKAA 1UZLA 5GV8A 2JRTA 2A0KA 4EMBA 4V2UA 1ZVQA 3IVAA 1LV8A 4A3JJ 3H1CA 5HBGA 2I03A 1WEHA 2Y1XA 2B69A 4RYDA 3GNLA 3UXHA 1TU4A 5K01A 3QQ5A 2JLXA 3LMMA 4WOBA 2MYNA 3M6VA 3KYIB 4N3BA 2XWJI 4TVOA 4CNQA 4EV0A 4P98A 3E9DA 2C98A 3A4YA 4LDZA 2G17A 2Z4TA 3PL5A 4R8MA 1EJ6A 5A1TA 4X1OA 1CEXA 3ESCA 3NKLA 4KODA 4OQLA 1R5BA 1T9CA 3JQAD 4TT3A 1GSIA 1WXFA 2EZ4A 3GO4A 1C81A 1SANA 1AS2A 2ZJBA 1MMGA 1IO2A 1RJEA 1O6FA 2ERXA 3AM4A 3P71T 1YBAA 4A3FJ 2ZIXA 5KYXA 2J5KA 3S29A 4KB5A 9ABPA 3GJ4A 3K2AA 5B2EA 5HDGA 3UHAA 2I6FA 4A03A 1R9GA 3UXEA 4F96A 5L6MB 1EJ9A 3RYIA 4K6HA 1ZPDA 3L79A 3QPCA 4HQFA 1UFVA 2B4TO 3LSHA 1C9KA 4RSHA 5AXCA 5CB4B 2OILA 3ZZMA 1U0GA 4BQOA 3CZ6A 2C58A 4ZHQB 2KWIA 5GZ1A 3EQ2A 3OQBA 2QG9A 3WLKX 1TL7C 2CNWA 2PPLA 4AX4A 3GUCA 5IY5H 1EDDA 5G4LA 1UMBA 2IXGA 3D8UA 1QBKC 1R1VA 3EXHA 5AVXA 5EERA 4OIPF 4LWPA 3NUZA 1JFTA 4LWQA 5BSMA 4QASA 1KAGA 2BKVA 3QNUA 3VOSA 1SC1A 1P18A 1SB9A 1TZMA 3T3IA 3RPQA 4F7ZA 2PQ2A 2YV2A 3L6BA 4O2BB 4FWBA 1IDYA 1EFHA 2DCUA 3D2BA 3KXKA 4GM4A 2W2NA 4GKBA 4DDHA 4L1KA 4B33A 2BELA 2HCRA 4I5GA 1WSUA 1U2RA 2QW8A 3BEDA 1YFZA 1G8GA 5CXXA 4OQMA 2C97A 3K4PA 4FYVA 1SD6A 1SMTA 2NACA 1PWZA 2IHZA 1TQMA 2ZZNA 4QVKA 2CSUA 4PFQA 1OIXA 3VJRA 1HC7A 4KYVA 2CFTA 2VNJA 1FFWA 1YMQA 3LQYA 3ZUPA 4BKQA 4URVR 4F60A 2I65A 4HZUA 4DMCA 4R2WA 2ZQZA 1V3FA 1ILEA 4KFTA 5L4LA 5KQMA 3DCFA 2HB6A 5TMPA 5CLLA 4FC6A 3M34A 2IU3A 2X6YA 3WV5A 1HORA 3WK7A 3W9YA 1XK6A 3Q0WA 4JBWA 2GZMA 1EX1A 3OECA 5C18A 4HNAB 5BPHA 2GVZC 2C4NA 1ZA2A 1UXIA 4QYWA 4QHSA 4DYQA 4PJMA 3U7IA 1AKVA 4RF4A 4TMTA 1E1MA 4DLZA 1NBAA 1PT5A 4DLKA 1HYHA 1M9NA 4IY1A 2AT1A 3S2ZA 2B7EA 3AETA 5F5XA 2GF0A 5AFSA 2EKQA 4IYRA 3IA2A 1XSXA 2CXNA 4AURA 4S1NA 1J21A 3I9MA 4R2JA 3OYCA 2Q3DA 3D5LA 3VRHA 5JLXA 3QVXA 5F73A 4LZAA 5KTKA 4DZTA 1ZUNB 1VJTA 3ABKH 1ULBA 4FDAA 5E2BA 3TUIC 1AZWA 3DT9A 3FRIA 2EQBA 3W6OA 4C4OA 4DSAA 3AB3A 4IYJA 1N7IA 4JQYA 5CVVA 5H80A 1Z21A 4DQXA 3I6YA 4ZQIA 4OEHA 3I42A 3COYA 4Q0MA 5A0VA 1JW9B 4JLAA 1UL1X 4H1WA 3IELA 3O1IC 5K9ZA 2IP2A 4PZYA 1PDVA 3JQAB 2CHFA 1HDCA 1PYOA 3UTCA 4BZXA 4ZIRA 5TF0A 4ENPA 3OJXA 3OSGA 1KJZA 3OQHA 5AP9A 4M1WA 1XTUA 3B51X 1A5TA 1QYIA 1LNZA 3BMQA 4N1AA 2NZ8A 2VAMA 1E1CA 1B6RA 4ZEVA 1ECBA 4XGNA 3M3DA 2Q4TA 3ZKAA 5J2UA 1UBTS 1R4NA 1U8YA 4FXOA 1SVMA 5GVRA 4JHXA 1YCGA 5FYDA 5AMXA 4IX9A 3ZX5A 3CVVA 2HCFA 1TLFA 1EEHA 3AJ9A 3DDNA 2JVIA 2BM1A 4GYJA 2JI9A 5U4XA 2YVKA 5HKBA 4Z9XA 3MQ4A 1XGSA 2YZMA 1D0XA 2NWQA 2XKBA 1ZWLA 4DLRA 3PCTA 3A01A 4D3XA 2DY0A 3UMRA 1LI7A 5I9IA 3Q3VA 5BQ5A 3WG7H 3SZPA 4ZAVA 1YI0A 3GOHA 5E6UB 1MGTA 2FPMA 1MJFA 1VG0B 4HDNB 3RC1A 2WTAA 3UYLA 1PW7A 1J49A 1N25A 5B5SA 4REQB 3OJFA 3E22A 1JRLA 4WZAB 2I8AA 2HN9A 2HMYB 2WW8A 1F0YA 4M9SA 2XA1A 4YO8A 3LT1A 4MCHA 3G49A 4JBAA 1SD5A 3TZQA 2QN6A 3NDRA 5DOZA 4GW3A 3E9QA 1P2UA 1QIEA 1V3VA 1Y82A 4R2HA 4AJ1A 4ND1A 1RFLA 1W46A 3FGPA 2JGIA 5CBPB 1QZYA 3W05A 5HOQA 4L5BA 3QUAA 4W9RA 3WLPA 3WYGA 1JPJA 1G5RA 3NBAA 5I48A 5JAPA 3ADKA 4S1VA 2HPHA 2HVRA 3QE2A 5AVQA 5JCPA 1O6ZA 4MI6A 4YRRA 3K70D 3G5UA 1FWZA 3BFKA 4FB5A 5B55A 1YRNB 3LKZA 1Z6TA 9MHTA 3T12A 3N2GB 5A2QZ 2VJCA 2H0AA 2XXAB 1O57A 1T4CA 2V5AA 1D9ZA 1QIFA 3RWMB 4MGKR 4LXGA 1KC1A 3U3DA 3HOSA 3U7JA 3BTSA 3GNQA 3ABQB 1OV4A 3IAEA 1V5EA 5H20A 3K4QA 1WZCA 3TGPA 3GZNB 3OS0A 3OIDA 4B4VA 4ARIA 1X7XB 1A4IA 2QM3A 2WWYA 3PHJA 3C3KA 1T98A 3HOVJ 3OIQA 1Q1HA 2BPOA 1AQYA 1E1RD 4MQ4A 4KW7A 1S7OA 1T3ZA 4O4LB 1IYZA 2C2OA 3Q8LA 4D9HA 3JWGA 3IV7A 4NZPA 2VA8A 3K0CA 2GBIA 4D2IA 3ETCA 1QGUA 3SQLA 2Z95A 1DAMA 2WHRA 2O0HA 2QGFA 2VI5A 4I3FA 4FR5A 2BHYA 5KSOA 3JQ9C 1X14A 3QVJA 5HR5A 5LBUA 3RDIA 1J42A 3JCUC 4FEGA 2XB9A 1GRNA 1AKWA 1KU6A 3BM5A 1T5LA 3HBMA 3HXMA 2QTHA 1VE1A 1VQ7I 2KP6A 4I5EA 2G04A 4NEQA 5BNIA 4JLWA 2Z6UA 3DU5A 3EZGA 1CNEA 1X1DA 3F8CA 4YC7A 1ZONA 1NVVQ 3Q6MA 3P9KA 1X9IA 3DZBA 4BC1A 3ZZUA 3TDKA 5JECA 3AF2A 4WQMA 1ZMBA 4LXYA 1E1LA 3SBOA 1TO6A 4M1SA 2YHAA 4WXYB 3RVRA 1ZOSA 2R8XA 4DV4B 2MTBA 1BMFD 2VZLA 4M22A 3GOQA 4QBKA 4KFCA 1EKXA 2RGAA 4PZAA 4IRXA 1XROA 2R7RA 4JA2A 4MW6A 2RGDA 1JHQA 3W34A 4B3CA 1PX2A 3ROMA 1TGVA 5KWJA 2O61A 1U9ZA 1Z6ZA 1GXQA 4YAKA 2I3ZA 1P3JA 4N12A 1KDPA 4RA6A 2ECQA 3M0EA 2X1LA 5EUQB 3NHAA 2QV0A 4DDVA 5IAGA 2PKQP 4WA8A 2CNKA 4IJUA 2OPHA 5ALKA 5DV5A 1GLNA 1T1SA 2ORIA 1LZKA 2G40A 5JVDB 3RTBA 1YI1A 1N6RA 3UGTA 1K63A 3IP4B 2N1BA 5EIAA 4RH1A 5TVKA 5LP6C 2BHTA 4M6YA 1U8XX 3I12A 1YRHA 1EVYA 1VHDA 5IUNC 4YMHA 1R4ZA 3F3SA 2OTJI 3QW4B 1U1IA 3QVLA 3PKIA 5IAEA 3HRIA 4PYOA 4TXLA 5H6RA 1TKCA 3QWFA 1KO5A 1XB2A 1XZ8A 3FXAA 5H2FC 1O3TA 2O2DA 5AONA 5JTUA 4Z4CA 1NK3P 5CDGA 1PJ4A 3ADPA 1YRAA 2XF7A 3QXSA 2Z5GA 1J9ZA 2R7KA 1PO7A 3EW9A 3P8ZA 4D9NA 3F4BA 3K70B 5CK5A 4XWYA 3EISA 2GXQA 3DT6A 4BO3A 1KZ4A 2ONYA 2HIHA 1KR5A 1GADO 4A3CJ 2CGEA 2ZUCA 1CB0A 2PCJA 4R9RA 2NOJB 1QX4A 1RQXA 3LUCA 3PP8A 1Q20A 5LP6F 4YRIA 1TQHA 3I9NA 5JSKA 4FILA 3N8IA 4NAVA 5LLQA 4KDPA 1CC1S 2WUDA 4LJYA 3TQSA 4XLCA 3CE6A 4ZYWA 3M6FA 2NUPB 2IYPA 1G291 1TL8A 3LA3A 2WV1A 4WDRA 3DUWA 3HCRA 2OA4A 5G02A 3W5BA 1QLHA 1L9XA 3A6FA 2FUG1 1AC5A 3FYSA 1Z0ZA 5ITZB 1BGXT 1GJRA 2PK3A 1IUOA 2JWTA 2DBBA 2VBFA 3DJYA 1W94A 4H16A 3KQNA 3ND7A 2QTAA 5GV7A 1SC7A 4RXUA 4DYHA 4BS9A 2FSGA 3ISJA 2WB1N 3VKGA 3WL7A 4JI5B 9LDBA 4TKUB 4B48A 3SE0A 1SO8A 2BMVA 1M6HA 1T0IA 3G68A 3PENA 3AF0A 2VXZA 1OZHA 1L7VC 1LJUA 1YBVA 5AVWA 3UAOA 4ARZB 2M32A 4MULA 4TT8A 3V97A 2WYUA 1BI0A 3OHSX 3PQ6A 3W79A 2UZKA 2OSVA 1POXA 1DIRA 4HEA1 2R7QA 2JC3A 4OGLA 1Z0UA 2R7AA 3W9UA 3DNFA 5HS6A 4OGKA 2FNPA 2WSSA 4QELA 1VXOA 4FNMA 4C78A 1G3UA 3WNQA 5KOYA 3MG9A 2P4WA 1LUJB 2R6DA 2OMEA 4DR2B 1P4WA 2P8SA 1SU6A 2VL8A 3HOXJ 3R77A 4UHBA 4J0HA 1GUFA 2C5GA 4IOJA 4DB4A 1UQTA 3L06A 3I45A 1DEOA 3E9YA 1ZH4A 1NT4A 4YRBA 4TVSA 3IT2A 4D6XA 3B3QA 4UUTA 4LZOA 2DQKA 2BMWA 1XVVA 2ZIUB 1DKOA 1S2IA 4E03A 3HVJA 1XJQA 5D1HA 2NTNA 3BT9A 3FZYA 3SJ7A 2WFLA 4QRHA 2D0IA 4UNSA 3LLUA 5AOAA 1FUYB 2NXNA 1ST2A 1N6HA 3C6KA 1MLDA 3C6BA 3GLFB 2FW7A 4XUCA 3CN7A 5C35A 1YS6A 1QH9A 3CMMA 1Q3HA 2JBAB 1DX4A 1QOPB 3CH5A 3CJQB 1PWYE 4RVFA 3EFOA 1BXRA 3HB0A 3NOXA 3INRA 3ROKA 1F1JA 3A9UA 2O0KA 3BXGA 2YBDA 3A9TA 4JFAA 4DLBA 2AVNA 5DBEX 4QEKA 3NHRA 4R7TA 1A7KA 1W5BA 4B87A 1QYWA 3J80A 3DM9B 3FBNB 4I5FA 6LDHA 2QE7D 3CJNA 1V5GA 2AX4A 3PPWA 3CKMA 1NMYA 5ALSA 1N0UA 1ZH0A 3JAMZ 3MN2A 1IJFA 1IMJA 4G94A 4CM8A 5EN4A 1TK3A 3KQVA 1XZBA 2WB4A 3DEYX 1JIXA 2A7QA 1C1XA 3FZGA 4FI3C 2R6FA 1F6DA 1ARZA 3H2IA 1EP2B 3HXQA 4M71A 4BLQA 4YMUA 3OYMA 5LA6F 2QCOA 3TOXA 3U9SA 3DZ8A 2AXPA 4PN3A 4EBBA 4DUYB 2NIPA 3QNWA 5CDHA 4KFSA 4CR6A 3HBNA 1C3LA 5CQGA 2X13A 1C9NA 2I99A 4G81A 3COWA 2ZYTX 4E2YA 3WZMA 4DR5B 3W5UA 2W0SA 1XTKA 1PQYA 2GM9A 1IWOA 4AVYA 3MJCA 5ALUA 5CA1F 5L9AA 3TL2A 3KTAB 2XUHA 2O2HA 5EKUA 3QM1A 4OF4A 3FHTA 1UJ8A 1JG7A 4D0GA 4ALJA 1SKQA 3HQ4O 1Y6FA 4O4IA 1UP6A 4BVLA 3SQWA 3QP5A 1OH8A 2EZLA 4MHGA 5AOCA 3GDWA 3JS5A 4GRAA 5I7RA 2RG7A 2ZKZA 2RQPA 2OP1A 3I83A 2K4BA 4QT0A 1RHKA 1C0WA 2XSDC 2R5ZA 4JV5B 1RYEA 4Q1AA 2L9VA 2MMCA 2QOEA 2ORED 3VKUA 3H5OA 4HDRB 3IKMB 1JEJA 4XCXA 2J5XA 3WWOA 3DVQX 4I1IA 1LRKA 4JQOA 1M2EA 1ULHA 4MTCA 2B1GA 1TC1A 1AUPA 10MHA 2QT1A 4WXEA 5IK2D 3ENQA 1XZDA 4N0DA 1ONVA 4WKOA 4UM9B 2VUSA 3JRGA 1H8ED 1FFXA 4Q24A 2QG6A 3IBFA 2Q5HA 4O4HF 2HHHB 4CG3A 4EG0A 5HK8A 4S0XA 5JRZA 4WTOA 3WSVA 2CHGA 3KYDB 1LA2A 2N42A 3TG2A 4YLGA 2C2HA 1GLGA 3GN2A 4Q1EA 2O48X 2XUBA 3UFBA 4YRZA 4YJ2F 2G09A 1FU7A 1CUZA 2AXNA 3KB2A 4EMTA 5IS2A 4FFDA 4PCQA 4JL8A 2BF4A 2NYVA 5HKKD 2O06A 2FZKA 3KP6A 2CL5A 3HPHA 4GM1A 3G85A 4P3OA 3CGGA 1YRLA 2V97A 3WLRA 4G85A 3WNDA 4DILA 2IXDA 1KJNA 3IAS1 3LOUA 2Q49A 3WFJA 4MR7A 4BKXA 2F43B 2AC7A 5DCMB 1EWTA 4XDYA 1SCKA 4CR7A 1O7LA 1DOAA 1A9TA 1V4BA 4UHEA 3ZOZA 3KDAA 1T25A 1R5OA 2BOVA 5LJLA 3ANTA 4G23A 3S28A 4BNUA 1NMQA 1JR3A 4RTNA 2B1IA 2HGSA 4LHEA 2ZCWA 4R69A 2PXHA 1HKTA 1NN5A 2NS8A 1TCUA 1AO0A 4KQ9A 1K5DA 4H7IA 1PFUA 3D7NA 3MCAA 1JIQA 1IAVA 2XDQB 3X1XA 4CDMA 2ABWA 3BD7A 3ZQLA 2QMQA 3W6UA 2XVCA 3ANMA 1LI5A 4BIMA 4ZYUA 2I7XA 4Y6QA 4JBYA 4LYJA 1TQ2A 4IXDA 5AVUA 4E94A 5FX2A 5A06A 4D8UA 1XFDA 2WJYA 4FBGA 3V8BA 1MJNA 3BL8A 3HGGA 2HIGA 3KTOA 4J1TC 3NYWA 4ER3A 2X6TA 1R22A 1G6Q1 4JK3A 3D5RC 1E17A 2YJTD 3N0WA 1SA0A 4IV0A 2F1RA 3RKWA 3BCAA 4M72A 4NDAA 1P2SA 5CVRA 1WV1A 1FS5A 3WGGA 3RQIA 5CVDA 4BV3A 4D3ZA 3HCNA 1MFPA 4PCLA 1Z82A 2I8LA 1OUMA 1VMAA 5JHGB 2AOTA 1G5FA 3GJQA 5A71A 1S2GA 2DQLA 1GQYA 1R5HA 4YCCA 4QATA 3CO0S 5IJWA 1FP4B 5I7OA 3F5DA 3A6DA 1PAUA 3ELBA 1Z18A 3BXOA 4PHGA 3KU4A 4ENMA 2CXXA 4JIMA 1EXWA 5TEWA 4AN0A 1UK7A 4EEXA 4IHQA 1T4MA 2WTBA 4EG7A 1EAYA 4MHTA 3DE0X 1GPBA 3SQDA 4RGRA 4TL9A 3HBFA 3L7AA 3CO5A 1HA8A 3BRQA 3D4OA 1WKVA 5AUQA 2Y1GA 3TQRA 2ZSKA 1KQPA 4AS2A 4B3AA 4BP3A 5JRJA 4ND8B 4AO8A 1RP7A 2CXOA 4EGFA 3H11A 4BRZA 4MB2A 4PG6A 1L8QA 2VP9A 1QUFA 2GHQA 2VLBA 3BP8A 1QG0A 2VDWB 1SOWA 2G88A 5F2NA 1BWPA 2KW5A 4YMSA 1A95A 3PXEA 2PDAA 3OM0A 4NKRA 4GL4A 5J58A 4G5YA 3INNA 4MKFA 1BKDR 2ZRMA 3B82A 4F5EA 3VODA 2EZUA 1HLFA 4WJZA 1DEAA 3JSOA 1JFFA 4JLUA 4DANA 1CUAA 1WSAA 3PF9A 2EV5A 5LDHA 4Z1OA 1HNWB 4HQKA 1M75A 2EFHB 1YJ8A 4CKZA 1DG3A 2HXOA 2VT3A 3RIEA 2ZIWB 4KMOA 4RL6A 3BWYA 5LQSA 2HDDA 1CUDA 2DWCA 2AUMA 4RGSA 3CUWA 1OAOC 2IS4A 1JLHA 2I91A 1NNI1 1YB7A 1NDHA 4UULA 1GV1A 4MA4A 2WTNA 1BJKA 3EZXA 3H8WA 2YJ6A 2W6JD 2ZJ1A 4V0RA 1TC2A 3QU6A 1DX6A 1SQ6A 3CFYA 4YJFA 3NWPA 2IDZA 4WX2B 1GWNA 4XASA 3N8GA 4K6KA 2EQRA 4HNHA 2PRZA 2RGUA 1XZJA 4FQ7A 5H82A 5FYQA 3O4GA 1FPMA 2UYQA 4MX8A 2DEUA 4DQVA 3AY7A 1Z13A 3FHOA 1L7QA 3R2JA 1OZGA 1NLZA 1TYDE 1GNVA 1BFUA 4XLPF 4E70A 5BN5A 1PVOA 2HRQA 3SYNA 3DBVO 4RPJA 3NVAA 2KIUA 1LTHR 1MT0A 3DDSA 3RJPA 3X0DA 5T3YA 2XB6A 5CTAA 1KGSA 2BEVB 1V7QA 5H7XA 5IH7A 1GKIA 5BSHA 2L19A 4CMKA 5CCDA 1MVNA 1SCUA 4UPVA 2E19A 1IULA 3STHA 1TZJA 2CC2A 2HF7A 3AINA 2CT8A 1I1HA 4XKCA 3EQLF 2ZI7A 1CVLA 2GN6A 4I55F 4HMPA 5AJYA 5J43A 1EV7A 2V4MA 3EPZA 3K09A 2HA3A 4C4XA 2ZKIA 2R8ZA 3NS7A 1T8SA 1WG8A 3O3CA 1RC0A 3P2OA 4QOIA 5CB0A 4YAFA 2G25A 4LWOA 1Y5LA 3DLBA 1OD6A 1JNXX 4YGYA 1L1FA 5A2QA 3ADCA 1U8AA 1JZSA 3HXTA 1N2CB 5BUCA 3K2ZA 1OFUA 2O5CA 3N2EA 5FD6A 2NXJA 1Z08A 1HQKA 2AV6A 4BJ5A 1MJGM 5GAHJ 4CM4B 4EVSA 5M3FJ 4ZK2A 1ZIXA 3CF2A 2D00A 1PJBA 3NOQA 5GGXA 4R79A 1K89A 3H9UA 3GJ6A 2IAIA 3Q7SA 4EH1A 3FYUA 3LVFO 5DBIA 4A93J 1XZMA 4YELA 1T1GA 2QRQA 1E92A 4XONA 1MIOB 5M5BA 2VK2A 4DBVO 4F55A 5KOJB 5ILGA 4BMXA 2JAUA 4OJQA 2AH5A 1PUEE 3AI2A 3Q3GE 3F8FA 2MH2A 2IQ5A 3AJEA 4IHWA 1MO6A 2IW5A 3I2JA 2O6LA 2WV7A 3N1UA 2IX9A 2WHEA 4N8DA 1FS4A 4DWOA 2F3SA 5B1SA 2MU1A 3QJ5A 4I0BA 4LLGF 1MMAA 2EJWA 2GR9A 4Y2VA 2HU8A 1VMEA 1S72I 1NV8A 3OM8A 3DDOA 3M9AA 3SF8B 2YXEA 2PN6A 3CLTD 3L0IB 4EYGA 2R6GA 2DK5A 1U94A 3I76A 1NUSA 4HF2A 1KXJA 5C2JB 2XNSA 3L8YA 5D2CA 5FF9A 2ETXA 1VYHA 1JR4A 3HZJA 1E77A 2PKWA 2QAIA 3H4MA 1II8A 2XUGA 3AJDA 2PZGA 4P86A 2HZ7A 3NDIA 3DEUA 4MVJM 3RTCA 4L16A 4BHCA 2ECCA 3DBHA 3UUWA 2FR1A 4G0MA 1WXIA 3C6QA 3VHXB 3FTDA 3OOEA 4DQ2A 2WAQA 3ZCOA 2INGX 2O2GA 4EITA 5IZ4A 4BB9A 4IAOA 2AD1A 1M2JA 2ZZMA 1I0ZA 3ELYA 3OPYB 1VB3A 4K26A 1YULA 4ZZDA 2QHXA 1KQGA 4C0JA 2W98A 2NVWA 1FA9A 1KDVA 4IGAA 3DCNA 5EG0A 3L4BC 4I4TB 1GGJA 1UM9A 3VFZA 3F9RA 4Q7LA 4G0QA 5BN3B 1JLLA 4HDVA 3UMBA 1Z22A 2G9UA 4KQMA 1E9AA 5ERYA 4EHBA 2V7FA 2FW0A 2IPNA 2VYCA 1SPXA 2VXBA 2WZQA 2GSWA 2HZBA 4LXIA 1S7AA 1NW3A 1O6GA 2Z16A 1JSCA 3RIYA 2E1NA 2D62A 3TSCA 5GIPE 3CV3A 2G4VA 4BKRA 4D3YA 1BIBA 1WZNA 3QY9A 4OXNA 2W85A 4PYRA 1QCZA 3NB0A 4MIMA 4MQEA 1R6RA 2C2YA 4JODA 3GAFA 3RT9A 3SXYA 3EA5A 1ZGBA 4DNQA 3DE3X 1FMFA 2XZDA 3GL9A 5HEKA 3QLEA 2CXHA 5IXYA 5BQTA 5IDVA 1XZGA 4UARA 3MT7A 3E4CA 4MXDA 1MRSA 3MIIA 3UC5A 3IP9A 2GVDC 4TKVB 4JLDA 1L5HB 1Q91A 4P0QB 4C4AA 4L9AA 2BEOA 4A1FA 1PJ2A 2K9LA 3CPEA 5JNWA 1DI0A 2W7TA 2HUNA 1OOEA 1XU9A 3KQYA 1SCNE 1R71A 3LSTA 1U3WA 3E03A 1NJ1A 4C4PA 4AO6A 3NBKA 2IHTA 4FR2A 4CL8A 1EK0A 3DFZA 2C57A 2AR7A 3UNGC 6PFKA 1UZMA 2VHZA 4H27A 4MQVA 5EMNA 1JSXA 3MFKA 3OEYA 2PXCA 1ZK0A 1HNNA 2ZXWH 2V65A 1MA0A 1J1ZA 5E3OA 1BJRE 2OD9A 5IWAB 5E7IA 3DEZA 3KOUA 5G1OA 5COAA 3GFGA 4V1CI 3OLZA 4B84A 1N1DA 3ZCRA 2DHRA 1GQFA 4BX2A 4ZI5A 4TYMA 1XCPA 3DL7A 1Y6ZA 4U5XA 1X19A 4BNFA 1N77A 5CPRB 4FD3A 3DW1X 3FPGA 2FBIA 1WH7A 1U78A 3RI4A 2YWJA 1M73E 1RRGA 2B25A 5CHYA 1OR8A 4IJAA 1DBIA 3HADA 4YRFA 4KXUA 4UREA 3H35A 2A2ZA 3H9QA 4CE6A 2GASA 3WIEA 4EF6A 3OYBA 2MDTA 3B1JA 4EDHA 3GLHE 1D07A 4H1VA 2XQKA 2AD5A 4JEHA 1HW1A 4X92A 4ZO8A 1G19A 2VA9A 4TN5A 5DHQA 1KAMA 1DC5A 2J0UB 3EBOA 3AG6A 4CIVA 2OCIA 1VBFA 4NK5A 2X41A 3ZMDA 3OQOA 2VF8A 3Q7IA 4EX6A 5FBVB 3GG9A 3IULA 1QFYA 3CLSC 3DHYA 2HGZA 3WJ2A 1RACA 3CH7A 1JE8A 1T4GA 2DA1A 2XGJA 4LXQA 2YV3A 3D7MA 2ZIGA 3GH3A 2Z1NA 3DONA 1Y6IA 5MN6A 1U2DC 5E20A 1DMRA 4B17A 4FB4A 2VO1A 5DULA 3GJXC 1K6XA 2YU9J 1QRDA 4WX9A 4E5SA 4R0MA 1RYHA 1J23A 1X6VA 4YIFA 2XMQA 4EG5A 4BJ1A 3EVBA 3T34A 3KFXA 3LBFA 1R8SA 1RKQA 5EE1A 1NJ6A 3W6NA 1H05A 3PSIA 2F8SA 2A69F 5E1OA 2HOSA 1J99A 3JTEA 2AOUA 3AHHA 3L05A 5EEHA 1HA3A 1ZD8A 1WJEA 3A4LA 4XNFA 3MTBA 1YL7A 4KR3A 1QCDA 2YHUA 2P65A 3HMQA 2AHOA 2J9FB 4RVNA 5JNVA 1KO8A 1QO0A 5E1ZB 1IRXA 1I6HJ 5LXTA 3TW0A 4BCDA 1BIAA 2WLSA 4CF3A 2A92A 3I5UA 1U4SA 4NOMA 1FIUA 3GRKA 4HG2A 5K8IA 1K98A 5AW9A 2RGWA 3DTYA 1V25A 2O0LA 1THZA 4EENA 1S2OA 3UJDA 5JJIA 4OOIA 3B78A 4LJ8A 4DQUA 1SKUA 1KR2A 3VPRA 2P27A 2WWTA 1R8JA 3LWBA 5GTDA 3KV3O 1KNQA 4EFDA 1Z5VA 4I4IA 1SKMA 2PI0A 1PLKA 5FKMA 2IXAA 1JHMA 4MWCA 4W8OA 4ZRNA 1IHDA 2NSJA 3TX2A 4Y98A 3OC0A 2P6SA 1T2VA 3H2HA 1SK8A 4EQ6B 1F60A 5CX1A 4RYLA 3TTUA 3WLNA 1ZGJA 5JH7B 2IKQA 2GPNA 2QVLA 5I8PA 1CF7A 3HRTA 4TMYA 2G0EA 3FMRA 5KCZA 3JVVA 1APBA 4GHWA 1FEXA 5DDGA 4ND3A 3OESA 2WT4A 3DO6A 2O2JA 1ZJ4A 1UCFA 1YRWA 3ZDCA 2AJ8A 5JXIA 1G3RA 1Y7IA 3GAZA 2OUIA 4AMYA 5JQGB 3IESA 1J09A 4YFVA 2H8WA 1PCXA 3PXUA 4O29A 2IP4A 2CV0A 2NW6A 1OHHA 1G66A 2RK4A 4XJTA 2GQQA 1PNOA 3UJCA 3DG9A 3HYLA 3H1BA 3RKYA 3E53A 3GNSA 1DDOA 3UW3A 4G0XA 1O2DA 3HJCA 5LL6P 2DYSH 5C81A 1ZL2A 1PX0A 1ZGGA 1T0FA 1IVYA 3ZGXA 4M83A 4WZBB 1KZ1A 2GN4A 3P1JA 4I19A 2DFVA 3OEHD 3PUHA 3UUEA 2D13A 4BBSJ 3QXHA 3ZLUA 1Y3BE 4XPIB 5J5AA 3RU2A 2ID4A 3QWLA 1HXHA 3S3OA 3MZ8A 5SYMA 5DK4A 2CNDA 4ZYHA 4LF9B 2QTFA 5A4DA 2QLFA 2GAJA 5E3HA 3LDHA 3SSOA 1CS0A 2IGKA 1FSHA 1TYAE 5LYYA 2FP4A 4MPPA 4TMWA 2Z98A 1NVBA 1F4VA 5DGXA 2YIDA 2ATIA 1ZNWA 3NYIA 1A9YA 5JWHA 3JAKB 1BH6A 4OIFA 5J2TA 4IQ0A 3EVEA 3UGQA 4EZBA 1FX0A 2SNIE 1NDQA 1SD1A 1YOBA 1F1BA 4NFYA 3UZUA 3PQFA 1NYTA 2CCGA 3A70A 3FMGA 2PM8A 4K1LA 3IB6A 1PEDA 4WLVA 3VU9A 3NPMA 1DQNA 2B9SA 1E3LA 5FUXA 3IUMA 4UB8C 2REQB 1BNCA 4FX4A 3D6NB 5CFLA 2ZE6A 3QLVA 3PEYA 4ICIA 4II2A 2JZOA 3KWMA 1RJGA 2RI1A 4YHBA 4M60A 2MC3A 4BMSA 1UPTA 4J0QA 4FE3A 2C8VA 4R81A 3RHSA 1NONA 2O1XA 1OKRA 4UHKA 1HE1C 2L17A 1V8BA 2G8LA 5ETJA 3EZ2A 4B4WA 2JIZD 4JQSA 1P19A 4H6XA 1BM9A 3FUCA 4B6GA 3BCSA 1E7RA 4WT7A 1ZH2A 4HSRA 1H5NA 1ULYA 5H83A 4J16A 5ALEA 2MR5A 5EMHA 4FYKA 5FOUA 1YZQA 3AO0B 3HDQA 3SFZA 3QJYA 5HJ7A 1KJYA 4UM5A 3V8NA 2FMTA 1BS2A 1E3PA 5A5EA 3OWOA 1CZHA 4IZOA 4L2IA 2I22A 3MT8A 3QTLA 3AUAA 5CLJA 5IKXA 1VE3A 1WF6A 1PZEA 4FZ3A 4PN7A 5IBPA 3JQ8A 1QE0A 4K88A 3T5AA 2GA2A 3FN4A 4GXOA 1VI5A 3UV6A 1XHLA 4M6WA 4AF8A 2GH1A 3EMVA 4MRNA 1VE7A 5CKTA 3LU1A 3WQRA 1V43A 4Y6RA 1E7QA 5A5GA 2BFEB 5E2AA 3G3EA 4QPPA 3L1IA 4NJOA 4UTPA 2KRFA 1KTVA 2M2IA 4NOJA 1MH1A 2FEPA 4PTYA 1ORKA 4WKBA 5BNZA 2FR8C 4BFCA 4UHDA 5FADA 2OENG 1NMXA 3NV9A 3KQWA 2I4NA 1B8OA 1ZUHA 1SAUA 3VR5D 4XSZF 3BE8A 1XEAA 3GLRA 3AJ8A 1R6AA 2XD4A 4EA8A 3V5NA 3AIOA 3H2ZA 1MMSA 3DE5X 2IE8A 2RDPA 5BYKA 1IHOA 1Z5OA 4NABA 3DPLC 1L4HA 2R44A 1HMYA 1HDIA 3N87A 3UHPA 2R6JA 5JLJA 3O26A 3JSAA 4YV0A 4OAZA 1H1LA 1J8MF 1VLMA 3EMDA 3HU3A 4BYYA 3R7LA 4EVRA 1QC5B 2E5NA 4Y9DA 4AWXA 4PJJA 2Z1MA 2Z8ZA 4MGYR 3BMXA 5C34B 4HK4A 2PHZA 3NC0C 1EX9A 2I9KA 3U7RA 3KE8A 1SVOA 3VVBA 2K87A 1FFYA 1QWOA 3TLCA 2DUNA 3QEBZ 1G7TA 3ZHVA 2OO7A 1G8FA 3R0AA 4HDUA 1JBKA 1L4EA 4MEYF 2XTNA 3RC2A 2C2ZA 4AKEA 2VPYA 3MGCA 3REQA 4YMGA 5L3SA 3DKYA 4RY0A 4KN5A 2HPVA 4KMFA 1NYQA 4IWNA 1DG1G 4EPTA 1JFSA 3RF6A 4FFNA 4MPRA 1ETVA 3OHMA 2Y77A 3GUDA 1JGSA 1U0NA 1CJBA 2IIVA 1P3Y1 3G0CA 2A0YA 2HXYA 1ODTC 1OQAA 2K9QA 1GPNA 1AKUA 1N5MA 1U7TA 1EVEA 5C8XA 4I1OA 4DLYA 1SWWA 2FPUA 1MMFB 4K87A 4J0FA 3NXSA 4FEYA 3WP0A 3QVTA 2X15A 2STWA 2BHSA 2GNPA 2ATVA 4YDHB 2QB5A 2LRDA 2ME6A 1TZ2A 3EVAA 4IEFB 4F5WA 1D1TA 3UNXA 1G7RA 1ZMTA 4X41A 3CR7A 4DLLA 3VPDA 3S2YA 2Q3EA 4UY8I 3EOBI 2J08A 3EEYA 4X8LA 1I3LA 1SBHA 1GUZA 3N0RA 4YXWD 1B3RA 1GGEA 1C2YA 3BDAA 1G38A 1Y80A 2VR1A 4Y33A 2AEFA 2O1WA 1NT2A 4LMAA 3CH4B 1A5BB 1E9DA 3ECCA 4ND7A 4RMJA 4BNYA 4OHUA 4CM5A 3C5CA 3KHSA 3S6JA 4HUQA 2HLHA 4QDOA 1YGYA 3LZCA 4IRGA 4A3LJ 3HFGA 2Q3HA 2SBTA 1U0EA 2PBRA 2HL6A 3V42A 3S70A 3T7IA 3PEVA 3WHCA 4C04A 4AYBN 1YD7A 3U17A 4U7GA 1NV9A 4OKIA 2XW6A 5CCBA 3ANXA 2FLVA 4UD2A 3KJGA 2BZSA 2QX6A 2CMGA 1TI7A 1IK4A 2JIQA 1N0IA 3KSRA 4WOKA 5EQJB 2M2EA 3N5CA 4BFTA 1WHTA 1PK7A 1MB3A 2Q5FA 2MWMA 1P0MA 1K75A 3IP3A 4WY8A 3WU2C 3R9WA 2ZCVA 2V3VA 2B8NA 3IAAA 3PVCA 5FB2A 1ZKGA 1BXGB 3RSHA 3FCUB 1LFUP 1AX9A 3OZTA 4P92A 1NQTA 1NA5A 2WRZA 1UHMA 1WMDA 4ETIA 3CN9A 1DWQA 1E1QD 3GA7A 2R7FA 4RZIA 2OD5A 1OY1A 1E5DA 4RETA 1ZG3A 1JDNA 1XA3A 2JKYA 5DD4A 4JP5A 4EJSB 1IJWC 1GCIA 2J9RA 2JPCA 1P0QA 2YZNA 1ZVKA 4M1QA 1AN0A 4RJIA 1U3VA 3CUYA 2A84A 2DPYA 1YVPA 1Z3IX 1GPLA 5J4YA 4GMGA 1XELA 1PUJA 2HHCA 4CCJA 2WU3A 4P2GA 1E2HA 4CHTA 2LKSA 1XPUA 3L8CA 3ZMUA 2ZYIA 1S4MA 3COJA 3RTEA 3RJMA 3ADDA 1POWA 5E3JA 3L2WA 1XZAA 1L1QA 1SUCA 5EESA 1U3CA 3DDWA 3K4MA 3P2EA 4I66A 2OTLI 4NG4A 4X1IB 2ZULA 1PYVA 4MCAA 3AG1H 3UHFA 2TCTA 2PMUA 3K0FB 3QE0A 2MSLA 1YIAA 1GNLA 3DQQA 5ECYA 2YJ3A 3EXHC 1P92A 4ID3A 5HE8A 1LKZA 3RVLA 5EGOB 4BE9A 4L9RA 1CRZA 5BRJA 2C99A 4D4MA 3WTUC 1G21A 4K9QA 3G9ZA 2XY4A 3IL2A 4DA7A 4M8LA 2QTRA 4W5NA 4KAFA 2NOAA 9ANTA 3ONDA 3HEMA 3UVEA 4RDXA 4I6ZA 2ZJOA 3LT4A 1DJLA 4JCCA 4Y2TA 2WSLA 1TA9A 2R4TA 3F6YA 3NIDB 3LDUA 1AF7A 3PWZA 4OHWA 2H1HA 3D7LA 4CLOA 1V3QE 3KD3A 2WT9A 4G09A 2EARA 3VNAA 5JCOA 1UBCA 4EZEA 4NJEA 3DLTA 5A0TA 2ID3A 2BVNA 2YHBA 2IOQA 2NU8B 5HS9A 1XK7A 4HWSA 2BY4A 2ADOA 1P4GA 2DVMA 4ZAYA 2Q1ZB 3PNOA 2R8EA 4M1KA 5EPOA 1K3UB 3I1IA 2ZE8A 2O9JA 4FMCB 3C4VA 2F1KA 2PZ8A 5H81A 4OUDB 3W7BA 5DM6F 2XROA 2Q0XA 5IT3A 5LZ9A 1NX9A 3ZK7A 2X7XA 5CDFA 1X7YA 1G20B 4E7IA 4PO1A 1JDVA 4JWKA 4AT1A 3QX3A 4WOCA 4D6PA 1IUNA 5EQDA 4B82A 4X93A 4QYSA 2B4RO 1KYZA 4WOPA 2C5EA 3LP6A 1BEUB 1KBOA 1FRNA 4XICA 1G9TA 1UFOA 3KKKA 1JMYA 4XD7D 5LYJA 5BPDA 3EASA 4ZANA 1CZLA 2P2GA 1TPYA 3OCVA 2ZMEB 3LVQE 5IASA 2W4SA 5K0EA 3V1LA 3QYAA 3QF4B 1WP9A 3SEFA 1Z07A 1T9DA 3EAQA 3NBXX 1F2UB 5A3JA 1KSJA 2QS9A 1LKXA 5H3CA 5ADVA 3BG9A 1YTYA 1PD0A 4KMRA 5L3VA 3TOAA 4D0NA 4XX1A 4EJTA 3BCRA 3N97A 2IW3A 4GVLA 4GMHA 2VDOB 3IIKA 4HTFA 5BPFA 3U62A 4YJHB 3HU5A 3ICWA 1C7JA 3UTDA 4TROA 2WD7A 1FFDA 1M8JA 1U8EA 3OIWA 5LZ7A 2DT7B 4F06A 3VEPA 3HJAA 3H0KA 3DL0A 2QRGA 3WJ1A 1FUUA 4Y6GB 2CE2X 1T8WA 5DNAA 1ZAOA 1AY0A 3NHJA 5HLTA 4CIAA 4PHHA 5DLDA 1GZ7A 1QCCA 3U0VA 2GPYA 4UMDA 1PKXA 5LQKA 5KVQA 3MZHA 1Z16A 4F38A 2QXTA 5IVPA 4OK6A 4NCNA 2F5DA 5AOBA 4LF6B 4B45A 1NTCA 1QVVA 3N8DA 5IM5A 3ML6A 3RFXA 2FFJA 4QYIA 2E48A 3FTFA 3H4TA 1X13A 3TOSA 2HR1A 1FC3A 2CJWA 5E4YA 4PSDA 3N3AC 2VHUA 2IS1A 3CWCA 3KL2A 3EIXA 4GSKA 4J3FA 3RRXA 3UOGA 3GLGB 1OI7A 3RBAA 3UJPA 4RTMA 1OLSB 1IUFA 1QGED 4NMHA 2ZS9A 1BN7A 3WTSC 3WTXC 1ZFNA 1V71A 1UZUA 4R1OA 4RH3A 2O2EA 1O5OA 2FQYA 4AD8A 4F8JA 2R4QA 4CL0A 5FT9A 1M6YA 2BFCA 2LGJA 4FX5A 2QDKA 2AFIB 1ZCAA 2DY1A 4EVIA 1NOIA 2XYVA 4IWXA 3JYLA 2H4JA 3LSMA 4MUGA 5CNJA 2X85A 3QA9A 1Z33A 1K08A 1V3UA 2G82A 4AP9A 3RVNA 3QUTA 2PVSA 2GYVA 5J2UF 1NI3A 4ZDLA 4RF5A 1MGOA 3N28A 4D44A 3TB6A 5E7QA 5ALHA 2EH3A 3WJAA 4FW8A 3K1AA 1A77A 4OM8A 1U6GA 1DKNA 2JVJA 5CU7A 2MYUA 1RTTA 2V98A 3VC2A 2ZIZA 4KJZA 4Z53A 2AXTC 1J2UA 3FTCA 5JS1A 2AI1A 1WUKS 1TAUA 2ODBA 3SKVA 4M3EA 4M1OA 1ADCA 2P2DA 1W4LA 4Q9LA 4I9GA 3HBLA 2Q9BA 4YALA 2P5SA 1VE5A 5JEDA 1NBHA 1SQSA 3K9BA 2LE0A 1U0FA 1RHJA 3MXOA 4J43A 4AECA 1KTIA 2L3DA 4EUSA 1JUMA 4A26A 3NJ4A 3EG5A 2KL4A 1JXOA 2JH9A 3HVHA 4G9GA 2C9DA 3EMBA 2VZ9A 4K9DA 5LNK6 4NC8A 4LOHA 2YHIB 5B4VA 2ZJRF 1GVHA 1ODFA 4I99A 3CP2A 3D3NA 4PHFA 5AICA 3F97A 4WWHA 3AF3A 4PIMA 1T2AA 4QGAA 2VXDA 3C97A 5DGTA 4QU5A 4Q4HB 3AP3A 3K7EA 4PLPA 3SF0A 4NPAA 2DFKB 3ANYB 1BWRA 4OIQF 1HE5A 4R9NA 4E22A 4Z1MD 1LVAA 4HRYA 4V0NA 3D4BA 4BVKA 1XQWA 4LF5B 1TWHJ 5JS7A 4FFBA 4QQNA 5BSGA 5IVHA 1IQPA 2ZAOA 2JLQA 3MS7A 4MYDA 4HYQA 1E2EA 3MHTA 3H19A 3WB2A 2Q21A 2I4LA 2OA0A 5CLIA 2WK1A 4RHTA 1IIBA 3A37A 3QMWA 3CZRA 1BW5A 5AVSA 1FXSA 1YRQA 2AEJA 1RBZA 2JDID 4LZWA 1PV4A 1U02A 5FJ8J 3DE1X 1SIBE 4LRTB 2KKOA 4EG4A 4UOZA 1J7JA 4ZICA 1XRQA 3U80A 1ZOPA 3A9RA 3FWPA 5BYAA 4KYTA 3O4JA 4BY7J 5LOVA 4NBUA 1M1YB 2QRVB 3VOTA 2VB6A 4AZSA 1C30B 2F8MA 1N2XA 3KHTA 4MQ9F 3DZJA 1AQJA 5FFMA 1ZVVA 5IT4A 2R2GA 1T91A 4BNIA 3LK7A 1QH1A 4CDNA 1VSVA 1C3OB 5CJJA 1XEWX 4N8SA 4TTSA 2XXJA 4Z4FA 3KT8A 1W75A 2JHCA 4MTDA 2YSRA 2CKMA 2ZRPA 4KN8A 1KVSA 2V9KA 3HEBA 4ADSG 3TQNA 3BC8A 4B44A 2YASA 4EUEA 3WU0A 2PTHA 1GYQA 3MTAA 1Q1GA 2OQIA 1UPFA 3JZFA 4I50B 2WWHA 3FBWA 3W2TA 3UBMA 4RC9A 1NJSA 3W3AD 2H57A 1H2AS 4B7XA 1T5HX 3QPHA 3P0HA 1HDGO 2VJ5A 3WE2A 3SICE 3TAHA 1Z7UA 2YMMA 4WK0B 2GFIA 3AH8A 4MS4A 3HCFA 1Y8QA 2DHEA 3FFWA 4C7VA 2ESHA 3H0EA 3FETA 5H0IA 3DYIA 3AHIA 2VYNA 4WN9A 4LB5A 4MVCA 3B7WA 1POGA 3FTEA 2EC5A 1J33A 3PDCA 3MYRA 5C53B 3QH4A 1Y3HA 4MZDA 2V6JA 4B80A 1GHCA 1WUHS 5IPAA 4F3RA 3FK6A 8GPBA 2G8NA 1SVWA 3IDSA 1B8VA 1U5TB 1FQJA 3LTEA 1PT8A 3W7AA 5E38A 4FFVA 2X6OA 2OFOA 1UWKA 1XT6A 1KK1A 1KEKA 3GCWA 2QTVA 1Y1QA 4HX5A 4HXFB 4L5YA 4HVTA 3FNFA 1GZ3A 4K2EA 4EY3A 4ZMBA 4DEXA 1CX9B 5HYVA 4HA8A 2GUWA 3KSUA 4CU5A 1SC3A 1XRJA 4LOAA 5MHTA 5IP7J 1RLJA 3KJHA 3CC4I 3FKQA 2YY6A 1Q57A 4QUKA 3AU8A 4IZIA 3GYGA 2O4UX 2PE5A 3AHFA 2FSIA 4B0OA 3FM5A 4P53A 2L42A 4QU8A 4K0KB 3C1OA 5CNKA 4NZMA 4XB6B 3U4IA 3PQDA 3M3HA 1Z4IA 4XGQA 2YL2A 1F3OA 3D1JA 1Z5UA 4V0ME 2HO5A 3LG2A 4IDOA 4BX0A 4UHTA 2PKEA 4F45A 4XIJA 2J3DA 4FNAA 4FQGA 3CCCA 4ZGGA 1ETKA 2AOXA 2K40A 2HV8A 1QZZA 4ISBA 4H60A 2JI4A 2NO9A 4OJNA 4US1R 4CT4B 2ODNA 2PLAA 2TMKA 4IJQA 4UVBA 2GX6A 4V3BA 4NSNA 3DE7X 5KDOA 4WH0A 3QI7A 4PO8A 1YZVA 3DKVA 2CLKB 3E7XA 2ORVA 2XJ4A 1OSNA 4CLXA 1CJMA 2MSKA 2QVXX 3P26A 2LCQA 4O5VA 3WRXA 4QYTA 1RR6A 2QD5A 2C54A 3IHWA 3W2FA 2OAEA 1ZU4A 5DIZA 4M6XA 3GZJA 3UHJA 4D56A 4B7CA 1AKTA 3WXMA 4X1KA 1WD5A 1N78A 4MJLA 4A0RA 2KI5A 3HKZN 5AVKA 2XB5A 2WI8A 3M8FA 2ZYWX 3L9FA 1I2BA 1VL5A 3BEOA 4LY9A 2NO6A 1IBSA 1RC8A 2J6IA 4BQRA 3UMYA 3P9YA 2CYCA 3IWFA 3RR2A 2OZVA 1GNSA 4ZT7A 1DC4A 4E21A 3ILYA 4E07A 2RC4A 3Q9SA 3PEUA 5DNEA 3ZK8A