2GWRA

Crystal structure of the response regulator protein mtra from mycobacterium tuberculosis
Total Genus 69
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
69
sequence length
227
structure length
225
Chain Sequence
DTMRQRILVVDDDASLAEMLTIVLRGEGFDTAVIGDGTQALTAVRELRPDLVLLDLMLPGMNGIDVCRVLRADSGVPIVMLTAKTDTVDVVLGLESGADDYIMKPFKPKELVARVRARLRRNDDEPAEMLSIADVEIDVPAHKVTRNGEQISLTPLEFDLLVALARKPRQVFTRDVLLEQVWGYRADTRLVNVHVQRLRAKVEKDPENPTVVLTVRGVGYKAGPP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Domain orientation in the inactive response regulator Mycobacterium tuberculosis MtrA provides a barrier to activation.
pubmed doi rcsb
source organism Mycobacterium tuberculosis
molecule tags Signaling protein
molecule keywords DNA-binding response regulator mtrA
total genus 69
structure length 225
sequence length 227
ec nomenclature
pdb deposition date 2006-05-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00072 Response_reg Response regulator receiver domain
A PF00486 Trans_reg_C Transcriptional regulatory protein, C terminal
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 2gwrA02
3.40.50.2300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 2gwrA01
2UWMA 4EY3A 3OLXA 1XGOA 4LMYA 2EFWA 5KQGA 3JPWA 3KP3A 3CU5A 4E70A 3BILA 2NZVG 1OKRA 3KZZA 1U2PA 1EWTA 5F1RA 2IDMA 1GUDA 2RKHA 2W24A 2VT2A 3ROFA 1M2FA 1XDUA 2CW0F 1ZGJA 3ABTA 2DK8A 1XDSA 2Z9OA 4KZKA 2NYXA 4OIOF 1FWZA 5ILSA 2PUDA 4L0YB 5TJJA 1RXEA 5DYMA 1PNRA 5E1ZB 1XSXA 5B3JC 1FFGA 5L3FA 3W6JB 1U6GA 2IOYA 4RB0A 1K66A 1O3SA 4M72A 2QBYA 3RVNA 5F64A 3ULQB 1Z17A 3R4KA 4L9VA 4PYRA 2QENA 4NCAA 2H6CA 3HO1A 2M8EA 4XLPF 2Z99A 1B59A 2FQWA 3HHHA 2MSLA 4WWHA 3I58A 3T95A 2O61A 2O6GE 2YR2A 4MR7B 1B1BA 1FYKA 3ZMSA 4OINF 3N4MA 3SNKA 4R1HA 3WTYC 4WXCA 3ZQ7A 1J7KA 1DZ3A 3IPCA 1FYMA 5FWYB 4RDCA 2BYVE 1XGSA 2RNJA 2E4ZA 4EJUA 2QR3A 2HS5A 4KIGA 1R58A 4U88A 4B8XA 7ABPA 4A0YA 2MA3A 3GVAA 1OMIA 2UXXA 2A5YB 4AVPA 1GLGA 4ZYEA 4NHJA 1O57A 3M8FA 4UHKA 1BC7C 3V8KA 4RK5A 4UVBA 1DDNA 2JK1A 2JBAB 4KA4A 5IT9Z 1BDJA 2ETHA 1IF1A 1Z15A 3O1IC 4MS1A 5FBHA 5E18F 2VK2A 5D4RA 1KU3A 2FXAA 4Z9AA 2XAJA 5K5OA 4ZYDA 2PL1A 1OYIA 1XD7A 4Q7EA 1O7LA 1ODDA 2PG4A 1ZG1A 1TNTA 1F1ZA 2XUBA 2MYTA 2JSCA 2NUBA 5DLEA 2HTJA 4I09A 1SD4A 2X7XA 1KMIY 4AD9A 3HEBA 1O7FA 3J80Z 2DLLA 3EDPA 5FWYA 4WZZA 2FEZA 3F72A 4BHPA 1BAPA 1BDIA 1SXGA 3QEMA 4N0QA 4LE0A 2MYNA 1Z9CA 2ZJ2A 2F5DA 2QLZA 5GOTA 5C5EA 1JDPA 3HRMA 4UHTA 3E6CC 4E7PA 2VBZA 2I6FA 1MKMA 5EWJB 5CNIA 1RNLA 3VEPA 3CTPA 4KN7X 5BPDA 5L3BA 1UFMA 3ISPA 2AYXA 3CTAA 1G3YA 2FMLA 2IYNA 2GQQA 4YCSA 3HOTA 2ZCWA 2JT1A 3OQMA 4XLNF 2V1DA 3BREA 3V7RA 2FNAA 5TPWB 5BPIA 4IRIA 5HDNA 1R22A 4WWCA 3LFTA 1B9MA 1K68A 1BDHA 3HTUA 1D8KA 1U78A 3RIRA 3JVIA 2JCGA 4KFCA 2LBPA 4RK4A 4RWEA 1QPZA 3F8NA 3CG4A 1W4MA 2EWNA 5H6QA 3GF2A 2XROA 2J5OA 3BY6A 4PCQA 3HV2A 5HDKA 2HFHA 1ZYRF 4B09A 3WODF 3OO0A 3GLXA 1O3QA 2STWA 3Q5FA 1EFAA 1JYEA 4G0YA 2E1NA 1R00A 4Y13A 4WF2A 4IMIB 4XAQA 4N9HA 3I0TA 2IRFG 5LEKA 2FQ3A 3M7GA 4MTEA 2HOEA 3G85A 4P96A 4G7OF 2P7CB 1U5TC 1FLIA 3O2QB 1D4ZA 2R7DA 4U7DA 4FHTA 4O1HA 3L49A 5IEBA 1V3FA 1XGNA 2YX4A 3RKWA 4KQCA 3R61A 1OXBB 3K9TA 2CWDA 3F6CA 3E3VA 4XBFA 5FWXB 2ID9A 1XHFA 1AWCA 3SQNA 4HQMA 4EYKA 4WCGA 4Z4FA 4EM0B 3QOPA 1KYZA 3LSTA 2L18A 3QX8A 1JFTA 3QEMB 2XKOA 5ED4A 1P8AA 4O1IA 4ENKA 3DP7A 4L9TA 4RGXA 2WWYA 2ELHA 3CDHA 2VT3A 4MNUA 2D1VA 5JHUA 2GX6A 1XMAA 1UB9A 5A2QK 4IPAA 5B3JA 1W7PB 2HGCA 5HVQC 2HTSA 3RYPA 1DPUA 1Y1LA 1HW5A 1U2QA 1DUXC 4RAYA 3ECOA 2OA4A 1KU2A 2XAQA 3HZHA 2JVIA 4F8JA 1SFUA 4TMYA 3ELKA 5IC5A 1ZITA 3BP8A 1NATA 2PQ8A 2MD5A 3IL2A 2L3DA 2K86A 4JBAA 4TN5A 3F6VA 3AAFA 2A9PA 3FDFA 4BHCA 2H6BA 4HF0A 5GQSA 3COAC 3N0XA 3E6DA 5LBQA 1BI0A 3O1HB 2CGPA 2O8XA 2WMYA 3KETA 5E17F 3H5IA 4TLLB 3KCCA 1ZRDA 5IUJC 1I3CA 4HLYA 5BOXA 1M5TA 3BWGA 3F6OA 4KUMA 1QNTA 1MAVA 1IN5A 5ILUA 2O3FA 4BQAA 4OU0A 4CBVA 4PZJA 5JS1A 1W7PD 1XGMA 4CYDA 3GFIA 3KP6A 1G3WA 2ZKZA 3RH0A 3EULA 2RDMA 1K7AA 3N0RA 4NICA 1DBQA 5CVJA 3V7CA 4IVNA 1YTYA 1T38A 3QLVA 1BA2A 4RS3A 2VODA 3P9YA 3BPVA 4IRGA 1W7PA 3H3ZA 3NHMA 4WK8F 3GWGA 3KS9A 2EK5A 2ZXJA 1ZG3A 3H6GA 4QWQA 3GX4X 2FEPA 1BJAA 3MZHA 4EVIA 5BMZA 5FLXK 1QP7A 5CVUA 4F3TA 2L4MA 4NV3A 1MJBA 5ICFA 4XSXF 4MEYF 3J80K 1ZGAA 2A6HF 2A9RA 2E1CA 2OD5A 5FFZA 3K69A 6PAXA 4KMUX 1YS6A 3G3ZA 4RV5A 2J48A 3D5LA 4ZH4F 3LUFA 5EEGA 1XCBA 1OPCA 1PUEE 3TOBA 3HRTA 4ESJA 4MQVA 2J5PA 4LRQA 3HHGA 4G6DA 3Q41A 1ONVA 1JH9A 4S05A 1ULYA 3HS3A 1E2BA 3EYIA 2CHEA 3DPLC 1HW1A 2FN9A 2DT5A 3ILYA 2HQOA 4NCBA 3O21A 2PMHA 3Q7TA 2QWWA 3A10A 1Z13A 4CICA 5KVRA 5J8FA 3T6KA 1UHMA 5TQ2B 1FBUA 3FFXA 2RDPA 2M1BA 4A12A 3U1DA 3LUGA 4M9SA 1EWKA 4OIRF 3H1FA 5CVVA 3I64A 3HUGA 2XAFA 1S8NA 1MD0A 4MS1B 5DD8A 5AIQA 2D1HA 1RZ4A 4HZFA 1SFXA 2HR3A 1ON1A 1DBWA 2OZUA 3DGEC 5IBQA 3SG0A 3C3WA 3CUQA 4Q47A 2V1UA 2F8TA 4RY9A 4EVRA 2ADUA 3H92A 5D5XB 5EWMB 4ZMRA 4PDKA 1JBEA 1JFVA 4G0PA 1XN7A 5DTEA 4IXAA 3QP6A 1QO0A 3BPXA 1V4RA 1YK1A 3L6UA 3IC7A 4ZYGA 3TDZC 3ML6A 3NNSA 1BIAA 4M9XA 4LB6B 5K5QA 4I2OA 1CGPA 2EA4A 2PE5A 5L3CA 4EM1A 4AIJA 2H3HA 5ICEA 1BI3A 2L54A 4QLCU 1LJLA 4JQFA 3IPAA 5LRRA 3RYRA 1OR7A 1WETA 1YQAA 1EWVA 3MEXA 1FBQA 1C0EA 2F5EA 4KRFA 5DV5A 4PGGA 1E2XA 2LF8A 4ESFA 3ZMUA 8ABPA 3LMKA 1KU7A 2PUAA 1RZRA 1ZGGA 2B4AA 5TPWA 4I0AA 3ZMVA 2FRHA 3RQIA 1U5TA 2IPLA 2E4UA 3SXYA 1D5VA 1MDMA 5T3YA 3M9AA 2A69F 3OLWA 2OU2A 3DKWA 4RKQA 5TQJA 3JPYA 3O1JC 5IUKC 3HSEA 1ZRCA 1MVOA 4O5AA 3E5XA 2P6SA 1FYLA 4HV5A 1H9CA 1YTUA 1TQPA 4K2EA 2CWEA 4EUKA 1YS7A 1G3SA 1J0RA 2XVCA 4YFKF 3ZP5A 3M9XA 1NY5A 1DG9A 4MGEA 5IT3A 1QZYA 5DCFA 2G9WA 2D45A 5TRDA 1DPRA 1JGSA 4YIIA 2EB7A 1ZESA 2AYZA 1PP7U 4IRXA 1XSDA 4N9IA 4ML3A 3GXOA 4OOIA 4RK6A 2FNPA 5D6FA 4KREA 2CD7A 4EGYA 1I1SA 5J8CA 2PN6A 1SAXA 5IX8A 1FX7A 5HSGA 1U8RA 5HQJA 3P9IA 2FQXA 3FM3A 3F22A 3HXMA 4ETIA 3KLNA 3VFZA 2KKOA 2E4XA 4MR7A 2W42A 3K0LA 3OQNA 2A6EF 5CVIA 2F8SA 4U0WA 3C97A 4KMRA 2A9OA 3RVMA 2B0LA 3F8MA 1BVHA 4BHBA 1S7OA 3L09A 1UHWA 3QU3A 3U2RA 4Y15A 5CLSA 2OENG 3RVQA 4M73A 2HSGA 5E8GA 1USSA 2E7WA 2FA5A 2ESNA 3SM9A 1TTYA 1ZG5A 1K79A 4KK4A 3UUGA 3OLZA 3LA7A 3I53A 3FFTA 2V79A 1H9GA 3CG0A 3HIFA 1GHCA 2YX7A 2VOPA 4RXUA 3I71A 4QYMA 3FXQA 3LUCA 2MLGA 3Q15C 4OMZA 2ZAYA 4WXEA 4XSZF 3TOAA 1EAYA 3ZPLA 3T1BA 2RVCA 2Z5UA 1ISSA 3K4HA 3NNDA 5FB2A 1GCGA 3W9SA 1L3LA 4P5OA 4DNCA 1KGSA 3WTSC 3CO7C 2QVGA 3HDVA 4L85A 3TO5A 4W5OA 1P6QA 1DBPA 2CHFA 2Q5CA 5JNSA 2HYFA 3CRNA 2PEXA 4HDVA 3TB6A 3IKVA 2PJPA 3IWFA 2KYRA 1HKSA 1Y0UA 1CEYA 2LDUA 3Q7SA 5KI6A 1K78B 5ERIA 4JP1A 2M45A 4DQ2A 4YS6A 3BRSA 4A5MA 5T7BA 2VBYA 5H6RA 1MB3A 1E6KA 3O75A 1FP2A 2L02A 3W6KB 4N0BA 3I42A 3QLVC 3LUKA 2OQRA 3WTVC 4G8XA 2G7HA 1B6AA 3DPTA 3I59B 4OLBA 4P55A 4KIBA 4Z4CA 1EV7A 2QYOA 4IMJB 2JBAA 5ILVA 3MMNA 4UUVA 4EQQA 3S2WA 3PQJA 2COMA 1WKMA 1YVUA 2FQYA 3C1DA 2G7UA 4HV6A 4RB1A 3J81K 5LGNA 4RK1A 2MC3A 4RB3C 4N47A 1ZGZA 2A07F 2JPBA 5HKOA 2TDXA 2P9HA 1BM9A 4G0QA 2GZWA 3TDUC 4D74A 3HVRA 3F8CA 3DZDA 3IRQA 3D8UA 4LDZA 4LJZF 1UDRA 1IN6A 1JHZA 3QPHA 2XIGA 3LUJA 3CNBA 1FPQA 1RI7A 1J9IA 2R4QA 1TNSA 3MAJA 1ZRFA 2H27A 3BJAA 4A6EA 1AB5A 3RVRA 5TE9A 2ZNYA 3C3MA 3JAMK 2FMHA 4MTDA 4Y17A 4KN4X 1Z2EA 3EYYA 2EV5A 3EQ2A 3WTWC 3EUHA 3LKVA 4LFUA 1LVAA 4MQEA 3E97A 3GZ5A 5AIPA 3QELB 3V7SA 1DJMA 1Z12A 2EFNA 5IEJA 5A2QZ 1RZRD 3BROA 3GFMA 3T8YA 3CS3A 4YO7A 4MQFB 2DW4A 2PAFA 3HRSA 2F5FA 3B73A 4RB2C 3N53A 3QLTA 1ZVVA 4QICA 2BV6A 1B9NA 2L17A 3FGZA 3GBVA 1K6OA 1HKTA 3K1NA 2PI0A 3ZN1A 1S29A 1JE8A 4P98A 3HM9A 1Z1DA 5LGTA 4OIQF 5K1YA 1O3TA 3KEOA 3E3MA 2HEOA 3QRFF 5TPZA 3GEZA 3J81Z 4MRMB 1SD5A 4W5QA 1LEAA 4MQ9F 3JTGA 5EWLA 1OYWA 1P4WA 4TLMB 4AIKA 3WE3A 3ZMDA 4RXMA 5PNTA 1JX6A 3K2ZA 2BGCA 2Y75A 3WTTC 2E4YA 1IXSB 2FBHA 2ZBKA 5TQ0B 2VC0A 3EJWA 3SFZA 2IW5A 4Z9BA 2BGGA 3KTOA 4Q4ZF 4HA8A 5LGUA 1FC3A 3OLVA 1GXQA 1MGTA 2LF7A 3O2SB 3GYHX 2R7FA 3OM1A 3CJNA 5HS7A 4DN6A 4LGWA 2RJOA 3GYBA 1YK0A 2NNNA 3NNNA 5L3GA 1TM2A 3JVDA 4OATA 3GZ6A 3H3UA 3IHUA 1IZ1A 1DCFA 3K9CA 2CQKA 4G94A 3IP7A 2K02A 3VODA 5CHYA 4G7HF 1K78A 2H94A 3MIZA 4UV9A 1S7AA 2QM3A 3BOQA 2FMYA 4KV7A 1CHNA 5H20A 4IHTA 2FW0A 1NTRA 1YLFA 2DRIA 1QBJA 2MH9A 3QU6A 1FSHA 4BYYA 1O3RA 3BRQA 1F5TA 5HM6A 3DEUA 2K4JA 5JNRA 1MDMB 3LQRA 3F3XA 3ZMTA 2STTA 2VE9A 1AB6A 3R60A 4HF1A 2NT3A 2RGYA 2FXIA 4XRFA 3SY8A 3LA2A 1R36A 4YV7A 4M71A 4KVFA 1EH8A 3TQNA 4R8HA 3LTEA 5FBKA 2EFPA 2L4AA 1EH7A 4KDPA 2P6TA 1LEBA 3Q7RA 3MCZA 2FMFA 1QP0A 5EEHA 3H5VA 3NBMA 5KK1A 3RVPA 3EDCA 2V9VA 1ZLJA 3OQOA 1CYEA 5E3JA 3O74A 2P5LC 2MYUA 2OQGA 3H1GA 4RSMA 4HX7A 3L2CA 1BI2A 2RC4A 3K1PA 2P7VB 4YG2F 1DCMA 3I54A 4N41A 3BZ6A 4Q48A 1NXOA 4MR9A 1TLFA 3P9CA 4DADA 1GUBA 5DDGA 1I1GA 2P4UA 5JNVA 5BS6A 4OIPF 1Z2DA 4MS4A 5KQMA 1JL3A 1NXWA 1R5HA 3ABUA 1LJUA 2WJWA 2FEKA 1T98A 1NXVA 4LK1F 3HDGA 2RV8A 5DUKA 3BDDA 2XAGA 2LP4Y 3H6HA 4MR8B 4GYGA 3TO7A 3ZN0A 2JTVA 4F06A 1Z26A 2KIFA 1PHRA 3K1MA 2EFQA 4Q6BA 3RJPA 3FM5A 3U9GA 2Z33A 3JTEA 4LD5A 3KSMA 2PBIA 5BQ3A 4HX4A 4M74A 1AOYA 1G3TA 2PKXA 3DLBA 1IN4A 3TD9A 1XHEA 1D1QA 4MS3A 2A61A 3N97A 1KRXA 3LUHA 4TV7A 2A9QA 1ZLKA 4HYEA 5D8LB 1Z16A 3FXRA 3CUQC 3V8LA 3H5OA 4OG2A 1FNNA 3RVJA 4L4UA 3KYJB 1LDDA 3JSPA 4A0XA 4MRMA 2FMKA 3GL9A 4CGZA 2FLWA 4OLAA 3M1EA 1PEYA 5EWLB 4KNYA 2FBKA 3FMQA 2A68F 2WV0A 4I02A 3QAHA 1Z25A 3H5WA 1ZHFA 4A0ZA 3JTHA 1P2FA 3H5TA 4BXUA 3BJ6A 5FO5A 1YO5C 4G0ZA 1PNTA 3JS5A 1J75A 4KICA 4MYRA 5IT9K 4MLCA 2VXZA 2Y0MA 3DV8A 1ZDMA 4M9ZA 3R0AA 2EV6A 1QP4A 1GVJA 4KIFA 3MZYA 1T39A 3FZVA 4Z4HA 2VUHB 3GBPA 3FX3A 1KA8A 4EV0A 1J2XA 1OYYA 4MS4B 1QGPA 3J7AO 4IGAA 4LZLA 3HSYA 2V1XA 5D5WB 4JK1X 3N6VA 4M6YA 4WUTA 2CSOA 4MHGA 1U2WA 1JF8A 2R25B 1EH6A 1U5TB 4MR9B 1ZAOA 1IRGA 3TKYA 2HZTA 2PUGA 2EV0A 1TBXA 4H0EA 3MFKA 5DCMB 2LUOA 2VC1A 2O20A 1R1TA 4F12A 3I5AA 4RGSA 4YLEA 4YR7A 2M1ZA 1NXXA 1WI9A 1ON2A 2BE5F 1R5GA 2L19A 1T34A 3CHYA 2HPHA 4PE5B 2H09A 4EVQA 4O6JA 1D1PA 4EJWA 4Z4IA 5HS8A 3D0SA 3UKJA 1KRWA 2FMIA 4PGHA 4G0XA 2NNYA 1XCVA 2PFBA 1TQMA 4EMSA 1U8TA 5D5UB 3UK0A 2IA0A 4HF2A 3Q9SA 1W5TA 5BQTA 2LIVA 2VOOA 4OMYA 4BNCA 2FKAA 2IPAB 2PUCA 1A04A 3E6BA 2OZ6A 3D02A 3WTXC 3FMSA 4ZYHA 2B1JA 4JA2A 4RK0A 4CHUA 2PMCA 5JS2A 3IDOA 4LG0A 3RTRA 4RXTA 1YG2A 3O3KA 2YHBA 2FSWA 1CF7B 3HSRA 3LAPA 1IRFA 3CFYA 5KC8A 5LRSA 4EGZA 4I98B 4H60A 4EJOA 1I6XA 2ZWMA 1D5WA 4LX8A 1ZY2A 1B4AA 2JVJA 4GPAA 1IW7F 4U0YA 5FWXA 1WQ2A 2QW1A 4Y9TA 4A5NA 3E61A 1IN8A 1LDJA 4KYWA 1FFSA 3C3KA 5JVTA 3EETA 1RIOH 3JW4A 3KHTA 1KYWA 2MSWA 3N75A 1C0WA 4Q6WA 1QO0D 2ZMEB 3KZYA 3IP9A 2EFOA 2FU4A 2MBFA 1FBSA 3NRVA 4ZZDA 3VNBA 2CG4A 5ICGA 1QZZA 4ETSA 5DCMA 3RI4A 1MZBA 6CHYA 2XV4S 4M88A 3F8FA 4YRZA 1TW2A 1HSJA 1YYVA 4G97A 4M6XA 1R1UA 4O3MA 2ZNZA 3KP4A 2PLNA 3GW2A 2Q8KA 3WGGA 4GO1A 3ZMZA 5D2CA 5L3EA 1ZH2A 4RGUA 2LSOA 3N8IA 2F2EA 4XASA 2L2QA 4Q5SF 1NXSA 1BIBA 3Q9VA 4L0ZB 1SMYF 5KQLA 2X4HA 4FX4A 3WTZA 1LBHA 4FT8A 3HK2A 1USIA 1VTNC 4RY8A 3RDIA 5HDGA 3MA0A 4ZZLA 3S99A 2H0AA 4Z4GA 4FE7A 1TW3A 3TO6A 3GT7A 2VE8A 3NEUA 2IA1A 3R0JA 3CZ5A 1WWXA 5HS9A 3ROTA 3SZTA 1R23A 3PFIA 3LKBA 3C18A 3DQVC 3DXJF 3MF4A 2DO7A 3FWEA 3I59A 3WGHA 3L9FA 3HYIA 2PUBA 5DD4A 4BAYA 4HW0A 3T38A 4IF4A 2GKGA 1I5ZA 2XRNA 3KYIB 4U7BA 2HYGD 2X0LA 1URPA 4RK7A 1YIOA 2KJBA 1ZN2A 2XGXA 2JPCA 2DBBA 2EA2A 2FLKA 2W25A 3WU0A 5E20A 5JNTA 4ESBA 2M5WA 1DC7A 5CNKA 3E6MA 2WJAA 2OAZA 2VONA 1W25A 1HKQA 2E7XA 1MIHA 3LAJA 1NHAA 2PUFA 2A3SA 2F5CA 1D8JA 4KMFA 3LOPA 3M9WA 2P8TA 1SMTA 3OOPA 3SZPA 3HCWA 4MLDA 3LA3A 2GIVA 2ZFWA 5F6FA 4LLNA 2WRZA 3MQ4A 2NAZA 5CNJA 2HQBA 2QQBA 2GAUA 4YFNF 5C5CA 2IP2A 5HLIA 2QQ9A 3MQ0A 3G1WA 4L9JA 4Z2YA 4MQEB 1ZAYA 1DCKA 1L5ZA 3B2NA 1ZARA 3LUDA 4ZPJA 4WT7A 3WGIA 1FP1D 4RY0A 9ABPA 1FOKA 4L5JA 4W5RA 2PMUA 2FVYA 2FBIA 3O6BB 3EODA 4W5NA 4YP9A 1TLHB 3RPQA 1P6RA 1P6UA 1APBA 2WB4A 1QNLA 4PICA 3GV0A 1QKKA 3OV8A 2PL9A 4HNSA 3QK7A 4HDUA 2YSRA 2JRTA 3ECHA 5DUIA 1ABEA 2ZMEA 1DP4A 3QLUC 1KQ0A 4ASNA 1HQCA 3OO1A 4ENMA 1X3UA 1C4WA 3C6QA 1SXHA 4Z0NA 1Q1HA 3GUDA 5K5RA 1SXIA 4UHJA 4EJVA 4XLTA 1FY7A 1WSUA 1Z18A 4JB2A 2GXGA 3I4PA 3CUQB 4U0VA 4UV8A 1ABFA 1RPJA 1P92A 3RPUA 2IA2A 1ZHHA 1GCAA 4JOQA 3A3KA 4LLGF 1Z6RA 4MGRA 1IXCA 5HLGA 1NXTA 3H1EA 5HOOA 4NQRA 2IT0A 3V4GA 2LKPA 2YPRA 2LNBA 4O5VA 2NT4A 2PUEA 1E17A 4EYQA 4P9FA 1R7JA 3KP7A 4I01A 2CYYA 1DP7P 1P4XA 4KT5C 2YHAA 3M8EA 1ZH5A 3SAJA 5E1XA 3URMA 1Z7UA 5FD5A 1P4AA 1H0MA 3VNAA 3T8TA 2DQLA 3FF5A 4UNOA 4Z4EA 3B02A 4F11A 2ZO4A 1R1VA 3GO5A 2GWRA 1YW9A 1LNWA 1F4VA 5LHIA 1USKA 2JB9A 1VPWA 1S6LA 4LE2A 1B00A 2DQRA 1YMUA 3DBIA 1ISRA 4HQEA 1USGA 5D6EA 1H9TA 1SRRA 1SFEA 3LUAA 3O2PE 2M30A 1JYFA 3FFWA 5KQPA 3EGCA 2IJLA 4YFXF 3CLKA 5TQ0A 1FSPA 3KCNA 1S3JA 3KP2A 5FD6A 3EQLF 5CYVA 4L9NA 3PQKA 4D6YA 1LK0A 5ABPA 3OMXA 3T0YA 5FLXZ 1KU9A 5JNWA 4OBBA 3E5UA 4G6QA 2ESHA 4WXHA 3RKYA 3TX6A 3P9KA 1FT9A 4P1ZA 4XXHA 3MM4A 5DEQA 3MYYA 3CZCA 1J56A 1MB0A 2DFIA 1FQWA 2JRLA 4G86A 5CNMA 1KQ8A 2DPDA 6ABPA 1JHHA 3GFJA 3GFLA 4G7ZF 4BH9A 1BI1A 2DTRA 4N76A 3F73A 4MR8A 1E6LA 3WU1B 3E5QA 4NQWA 3TO9A 1PP8F 3RVKA 2DU9A 3EAFA 1JDNA 4LLLA 2KJCA 4YGXB 2KRFA 2P4WA 5E8IA 4QPJC 1W5SA 2VBWA 2DPUA 5TQ2A 4LDAA 2FEWB 5TPZD 3HTSB 3EQZA 2DI3A 4F7ZA 3JSOA 3F23A 2K27A 3DFGA 4EGSA 2MLKA 1FSEA 2QZ8A 2Q2EA 2IPQX 1MJAA 4IJAA 2Q0OA 1BC8C 4WXDA 5CJ9A 4ETMA 2R3SA 3GA5A 3HJFA 3REOA 4FB4A 4AIHA 1VRVA 3FMRA 2ISYA 2MSKA 1L5YA 3C7JA 2QUFA 5EWMA 2W84A 4EJTA 1JHFA 3R6SA 1Z6TA 1TQIA 1F4KA 1IAWA 4IRHA 2HQNA 1LQ1A 4DQDA 5KC9A 3NQOA 4W5TA 3H5LA 4ZYLA 2WWVD 1Z91A 1HW2A 1RUNA 3DLHA 2ID7A 2QBYB 3RVLA 4RS8A 4A2UA 1G6NA 3VB2A 1VKRA 4XFKA 3F7NA 3L00A 3CUOA 1T0FA 3GRCA 1FZPB 2D2WA 4PEVA 2WTEA 4GYIA 4H3KB 1QMPA 3G73A 3KG2A 1ZH4A 2JVKA 4OTZA 3N0WA 3CKMA 4JASB 2K7LA 1JFSA 1A0OA 1R8JA 3SHFA 4KQ9A 3ILHA 2IPNA 3ERED 4IHSA 5FGMA 3QLUA 5KWSA 1QQIA 2Y48A 2M98A 5CVRA 4N03A 5JR3A 2AXLA 4MQFA 1JLKA 4YIFA 2V6CA 3I5UA 3KJXA 3HUTA 2ISZA 4HBLA 2MH2A 2O0YA 5AONA 2FN8A 1BBYA 1YFHA 1IXRC 1EHCA 4RZSA 3KEQA 2P5VA 2IKSA 2RQPA 5LLQA 5ICCA 3HRUA 1HBXG 2E4WA 2P5KA 3FMVA 1KQ9A 5FFXA 1RUOA 2QVCA 1F9NA 4NB5A 2EJRA 1JWLA 4KPYA 2JZYA 5BR1A 2WY2D 1RXIA 3LFKA 1XWWA 5DCLA 2NZUG 2W85A 2VBXA 3IP5A 2QXYA 1T6SA 2XHKA 1T2KA 5DKFA 4G0MA 2GA1A 5D8KB 2XAHA 1A2OA 2HWVA 3KLOA 1Z05A 2GI4A 2VN2A 4CO8A 4HNQA 4WXMA 3I45A 4ENJA 3TMYA 2M87A 1IIBA 1SD6A 3DF8A 4HAMA 5EWJA 3L7WA 1BN5A 1WRJA 4CDGA 2VYCA 3KFWX 2HQRA 3RVSA 4S04A 4HOBA 4ZJPA 4AWXB 3A0RB 1REPC 3HUUA 2LPMA 2QSJA 4ON0A 3BBLA 3KKEA 3QELA 2QV0A 1J59A 3QP5A 1LB2A 1TMYA 3IRRA 1MJ9A 4HX8A 4MPTA 1D2AA 4EM2A 3BJOA 3FHZA 5I4CA 5LHHA 2HDCA 1PEAA 4MEXF 2HKOA 3FXUA 5HLHA 2FSPA 1QQAA 1BOAA 4UVCA 2DAOA 3JAMZ 3OMWA 2QZJA 3JY6A 2IVMA 4I0BA 3GWZA 3QPTA 2K4BA 4GXOA 2HKXA 4RU1A 1QQBA 4H3HB 2XDYA 3KE2A 3VOEA 3NHZA 1DC8A 2Z3YA 2FOKA 4EVSA 4JAVC 4QYWA 4FE4A 2XASA 4HNRA 2HJ9A 3M6MD 3F21A 5DGCA 1G4DA 2UZKA 4G0OA 3DGFC 2NRAC 2FF4A 2PJUA 5JI6A 1LBIA 4FX0A 2TMYA 4HLXA 2IPMA 1HXDA 4ETNA 4E7OA 4LG0B 2NS0A 3LWFA 3O2JA 1UCRA 1USTA 5J6XA 1CF7A 2XKPA 4D6XA 4UXNA 1PUXA 1YMVA 2UXNA 2DK5A 4UVAA 2CO5A 4LB5A 1XB4A 4A6DA 3HSFA 4LK0F 2R48A 2KIUA 4JB0A 1LDKB 3TGNA 4P9UA 3IP6A 3T5XA 4PZ0A 2MYPA 4G9YA 1L0OC 5E1WA 3WG9A 4GCVA 2VUIB 4XARA 1D3YA 4LE1A 1U3EM 3IWZA 4Z99A 5D4SA 1IN7A 5IUNC 3MWMA 2BEOA 1FFWA 2GBPA 1HEYA 5BRJA 4WX9A 1W9HA 2AS5F 2FE3A 3KP5A 3I09A 2W57A 4RKRA 3OLYA 4CZZA 2QU7A 1ZREA 4ZMSA 3ROUA 1VLZA 1I27A 3QX9A 2BBYA 3LQQA 2RN7A 4D0PA 3OM0A 1U04A 2YU3A 1XSVA 5JNUA 4GNRA 1J5YA 4ENNA 2RGVA 1JXSA 2CFXA 2C6YA 2FTKE 4N0PA 3A0UA 4L18B 4R79A 1TVMA 1U0SY 2E4VA 5LEJA 4YWHA 3IKTA 4MS3B 4KK3A 1M5UA 2V0NA 3H75A 1YW7A 1PDNC 2ACJA 5IULC 4RGRA 5JFRA 1F51E 3V8JA 5LHGA 5L3DA 2R47A 2GA2A 3QEKA 3CO6C 1HSTA 2L01A 3RVOA 3P7NA 1DRKA 3RKXA 1QPMA 1DRJA 1OXKB 2GXBA 1YW8A 2QQAA 4L5IA 2KIMA 4I7HA 2WC2A 2PLYA 1IUYA 1TJYA 4EYOA 1SD7A 1XMKA 3WTUC 2O03A 4MAAA 4IILA 2RJNA 2OBPA 3T8RA 1LJ9A 1M2EA 4GGGA 3WE2A 2QVOA 1STZA 3CLOA 3HOSA 4CXFA 3F6PA 4RAZA 5D5VB 1GXPA 2N9UA 3F8BA 1E6MA 1NXPA 4EYGA 5BRAA
chains in the Genus database with same CATH superfamily
4G9GA 3R77A 3U9LA 4UJ3A 2PMDA 3DDCA 2P65A 5D1HA 4AJ4A 4INZA 3T1VA 2ZREA 4UAUA 3JPWA 4HDNB 3B6JA 4WBNF 2I2CA 3G8YA 4X90A 2GZAA 5T4HA 4R8SA 4DUGD 1OKRA 2IELA 1TTTA 2X0RA 1MENA 4NL4H 5F1RA 4JSYA 5LVAA 4W5JA 4PM4A 4W6ZA 1A4RA 1XRLA 2PD6A 1FTNA 2I9PA 5HJ5A 4Q9IA 3VPRA 1GLVA 1M2FA 1NRIA 4FNOA 4BU2A 4D7NA 1FTGA 1SPXA 4N3GA 2CW0F 3FOCA 5HKKD 1ZGJA 1P2BA 4K1XA 1ONSA 3L0OA 4B7CA 3R7WB 4OF4A 1GUFA 4CI0B 4S1WA 3HH8A 3U3ZA 2OB1A 2Z9OA 3O83A 1RC9A 2NYXA 1A95A 2RB4A 3RSZA 4ER3A 5LJLA 3IS3A 1O0CA 4Y3UA 4MRNA 5TJJA 2I2FA 5DYMA 4JY7A 4OPMA 4QXQA 2OORC 1OB5A 4LQCA 3AEXA 4X1KA 1SN7A 3QEOA 5ALTA 4YPOA 2XXBA 2RGAA 4QOFA 3ZNOA 5CBPB 4WVFA 3WAJA 1GGMA 2IOFK 3VVCA 4EKIA 2P6PA 1Q1QA 2QTRA 4DWWA 5KSWB 3ABIA 4IMPA 3TLZA 3REGA 1LFUP 1Z4IA 3ZOZA 3KWJA 5GY7A 4M72A 4KQWA 2KMUA 2QBYA 5IYZF 2J3HA 2EZKA 1QKJA 3ZDRA 3DNMA 2O3QA 4PYRA 2WHPB 2VAXA 4LDJA 1BW6A 2GBLC 2ZPAA 2B4QA 2H08A 4EO7A 4NU0A 1HX7A 2JIPA 1Y1SA 3HHHA 2MSLA 5CVEA 1CUIA 3Q0UA 3T7JA 4D4HA 4E5KA 3KLBA 3OZVA 1P1IA 3BMCA 1WBDA 1TL8A 4MR7B 4XGIA 4N0DA 4WCFA 2VDNB 1B1BA 3KUKA 2JA8J 2A7QA 4OINF 4IHXA 2W6PA 2XVYA 4MKHA 5AI6A 5EJMA 1R5NA 2C00A 2ONZA 3U0BA 3PKZA 2BGTA 2R7AA 4XVCA 2XDWA 2QN1A 2QQ0A 2ZWIA 1N9ZA 3RJ5A 1J7KA 2H2IA 2XMGA 1YGPA 4L8WB 2DSTA 3DEKA 4XWAA 3UOWA 2EC5A 4H4CA 4RDCA 2C2WA 2ZDQA 4BATA 2M2IA 3K0CC 2R7XA 3GTGJ 1DQPA 3QKSB 2QN6A 4RHXA 5HGXA 3V8BA 2RNJA 3HXPA 2YYYA 5FX2A 2M0MA 3VNSA 2Y1EA 2BSXA 2D62A 4WI1A 4U88A 4C08A 1R58A 3H1TA 2PVCA 4E03A 2FR0A 1OH8A 3IH4A 5JHFA 1LTKA 1MB2A 2RH4A 4V24A 4YO8A 2ZB7A 1Y4UA 3FKSA 2UXXA 2EGHA 7MDHA 2A5YB 3GAMA 3ZWAA 4AVPA 4WXRA 4GXTA 2FJUA 1ORRA 4C30A 1JKIA 1JPNA 1RQLA 2HU7A 2JFYA 2X2OA 1O57A 3AM5A 1JIIA 2ZDGA 3VSDA 3M8FA 2VZEA 4TQAA 4UHKA 2JGDB 4QBTA 3T41A 4P5EA 1Y3IA 1U8XX 1WCYA 2VSQA 2X3YA 1C2TA 1C1DB 1ZRNA 2BISA 1U4SA 2Y66A 1NI4B 4KA4A 1KARA 3KO8A 1AZTA 3NYRA 4WRRA 1DV1A 1GR1A 4URYR 3O1IC 5IM4A 2WHYA 4MS1A 4Z3OA 3UW1A 4XM0A 1QRUA 3FXMA 1ID8A 2IXBA 2VK2A 4CODB 2GOMA 1RYBA 2LVBA 5KHDA 2XR1A 1HEIA 1I7LA 1KU3A 3KYCB 1JLLA 2C5GA 1RWKA 2CD9A 2B1QA 5K5OA 1K5PA 2B37A 2OOSA 3EIHA 2A88A 4ND4A 4G1MB 3UJAA 5JV5A 2X9QA 3DCYA 2C2BA 2IEIA 5K3FA 4AICA 2I55A 1GJRA 1WMAA 2G9RA 4CKEB 3UAOA 4G0NA 1GZ4A 2XB6A 2PZBA 2I5PO 4DBLC 1CJCA 1KQPA 1YZ3A 4EAAA 4JBHA 2QL7A 4NJOA 2QTCA 3G8DA 4N5MA 4O2AB 4TLBA 3HKEA 4I09A 3SF0A 2X7XA 5JMPA 4EX7A 3OTOB 2X0IA 1KJIA 3L7LA 3DTEA 2VTBB 4U2GA 4XFDA 2GA8A 4NY1A 1DPGA 5FWYA 2FEZA 1FNSA 3K73O 1NQXA 4JI8B 3F72A 4BHPA 1C0LA 3Q7PA 4ROSA 1DO0A 2HFKA 1SXGA 4GFBA 1Z6PA 2ZUBA 1NTOA 2QTZA 3GEMA 3VZBA 2DWPA 4LE0A 4B79A 4CFZA 3STWA 2P1RA 2IZ1A 1DQNA 2EBHX 3CV3A 4Y6SA 1T8WA 8OHMA 4YPVA 1SZPA 4ZV4A 2O2XA 2VQFB 1WDWB 1RQ7A 3BFKA 1CRQA 1HLGA 5C5EA 1ACIA 1JIKA 2HF9A 3F2VA 2FG7C 3UUEA 3CDLA 1HFKA 4QTXA 4I1SA 1KK1A 1FXUA 1PGJA 1NQWA 1SQ5A 1R0SA 2I6FA 2PZGA 2VF4X 4JUDX 4WOJA 1QVWA 4K6HA 2VKHA 5L3QB 1ZBQA 4RD6A 4D6PA 3MQ2A 1T9HA 3CEMA 2XKKA 1QHEA 5LR6A 1A5TA 3ISPA 3DPUA 1LLCA 4MO2A 2FVXA 3B7PA 3RLFA 5ITZB 1KTIA 4IXTA 1VC2A 1Q7CA 1DC4A 1L4FA 1NVGA 2D6FA 3N7UA 1V4BA 4Z4EA 2WICA 3TL6A 2GQQA 3ITNA 2XWQA 4GOMD 3TZBA 1I3LA 3AVWA 5EZ6B 2JT1A 1IE3A 3MS7A 4LN1A 5DRYA 4P0PB 4LXYA 3ET5A 3QMVA 4RKFA 3UNGC 3HB5X 3DYVA 2FNAA 3DUFA 1XELA 3LBHA 4FQGA 2QRPA 4WV3A 5HDNA 1YO6A 4WWCA 3K0BA 3KLPX 3LFTA 2BZ1A 4IQFA 2H5LA 5CFZA 1B9MA 4HPQA 5JQGF 1LDGA 2O59A 3WLHA 1K27A 2P9TA 4MB6A 3B9QA 4I50B 4KFCA 4NZZA 2OCYC 5C4IA 4NZYA 2P2YA 2PX8A 4ZHQF 4RWEA 1I5OA 1R9MA 3Q85A 2JGEA 2HB6A 4IZOA 2VEDA 1L6IA 3CG4A 2EWNA 1KPGA 3R0QA 5CH3A 4OAYA 5H6QA 3HPRA 3L8MA 3GF2A 1B73A 1GRQA 821PA 2Y6VA 3DE5X 4IRMA 1VI5A 1PGOA 4L6AA 3GGPA 4MVJE 5BV2P 1HFEL 3KX2A 1X77A 5J58A 3P19A 5EJ8A 1M2VA 1LNSA 1NSTA 5I3ZA 3O6VA 1JAIA 3HV2A 2XGEA 1Z74A 2Q5JA 3OSZA 3QMWA 2RK3A 1MH3A 5LZ5A 2H00A 1FNCA 5BT8A 3WODF 4P33A 4PO1A 3QG1A 2FWPA 1UL1X 1O3QA 2ZYAA 3BKWA 2HGZA 3FIJA 5A0FA 4F4JA 4HN2A 2X4LA 1UQTA 4PZEA 1GXSA 3V8VA 3PNBA 4YRSA 1WF3A 1JDUA 2DH5A 2Q3MA 2EGUA 2FDRA 2YJNA 3N8KA 4U7GA 4DAEA 3BE4A 3A4CA 4CCNA 1ZVJA 3AF1A 4FIDA 2ELJA 4ND6A 3ZZMA 1JR6A 4HDMB 2Q2VA 2EARA 3AEKA 4OJNA 4ZVLA 3L8CA 3ZH2A 5K8CA 4G7OF 4RIHA 4HXGA 1FVOA 2X4IA 3TXAA 1M7BA 5EJ2A 4CM7A 3TW8B 2IKQA 3AHFA 4DZJA 1FW8A 1TT0A 3PGA1 2ZJZA 3OA2A 4KV9A 5ALPA 4L5EA 1CZKA 4LI0A 1FXSA 2NUAA 1HZJA 2R7DA 2RG7A 2Z5LA 3FYUB 3HFRA 3QTLA 3CC4I 3FBNB 4H4DA 4JHLA 4MPDA 3I3OA 1QHGA 4FHTA 4GMXA 1QYIA 2CE7A 2FB9A 2GS9A 4O1HA 1JKMA 4LWQA 1NWCA 2RFLA 3S70A 4MV9A 2PRYA 1KYQA 4N5LA 2COEA 2I65A 3ON5A 1M2WA 1PLLA 3OIPA 4ZYUA 1OXBB 1OROA 3NT4A 3WOHA 3TQQA 1NJ6A 2H1RA 4QNRA 4JQOA 4EY7A 4M46A 5BWLA 2PSHA 3OQ6A 1YFLA 2X13A 4HSRA 2JKVA 4AKSA 2PT5A 4L6IA 1XHFA 2E1OA 3GUVA 4HGRA 1ZHOA 1GITA 3WYCA 4Z4FA 4EM0B 4WZAE 1GEGA 2CHUA 2ZIXB 4OFBA 2I6GA 4NCNA 3RG8A 2XKJE 4QPNA 5ESXA 4B2PA 3NVDA 1ZD3A 3DFUA 3QEMB 3GNTA 5TT1A 4C6HA 4H1WA 2XKOA 1ZGCA 4FYHA 4BGDA 4ENKA 1QUFA 2WWYA 3CDHA 2HOSA 4UEOA 4CKBA 4CUGA 2ZRGA 1L5GB 4ARCA 2PGDA 1KBQA 1RI5A 3A4IA 4MNUA 2FRDC 4WESA 3IO3A 3NGLA 1G2OA 4A7PA 1E1DA 1KETA 2C99A 4Q1DA 4AW9A 5FV4A 1GZUA 2TMKA 1J1ZA 5H1YA 4IUDS 4NDNE 1BA5A 4JR1A 2AQFA 3BKXA 4WVLA 5KREA 1O9GA 1T1GA 4BZXA 1RKXA 1AQUA 2HTSA 3PUKA 3RCOA 1JNYA 1C3JA 4P5DA 1HW5A 1FDOA 3LK6A 4PNPA 2YVQA 4RAYA 4PS0A 3SS7X 2H63A 3ECOA 4HZUA 1X9GA 2ZCVA 1KU2A 1GDDA 1SULA 3QFSA 1YZFA 5ALEA 3RARA 2JVIA 2G8NA 2C4TA 3RSGA 3WLLA 3FMGA 2ZETA 3RANA 3GEBA 1EM8B 4TMWA 1ETWA 1AF7A 3EXFB 3F6YA 3MYRA 2DB3A 1C1XA 1OXSC 1ZITA 1RYNA 2QGZA 2O5VA 4LNUA 1UFQA 4PZDA 2C3MA 3EJ6A 1QA6A 2OGUA 1WVGA 1BW9A 1X14A 4LMRA 4OMFG 4HB3A 2QN2A 3PX7A 1ECJA 5KYWA 2HHAA 2CLSA 3D8BA 3M49A 3FJOA 3P5BA 2MD5A 3IODA 1NUSA 4NAUA 5BY2A 1UMDA 3EVBA 2G63A 4X8MA 2Q29A 5E1OA 1YH3A 4BO8A 3U1TA 1T8UA 3FTPA 1NURA 3ENZA 3EVEA 4TN5A 4PLFA 2J9FB 2QKYA 3FDFA 4RZ3A 4B6EA 3TRJA 3BXOA 4IDGA 4S24A 1P39A 1PN3A 4IDPA 2XQKA 3HGMA 1YZKA 3M6UA 4XNFA 2NO5A 3ZD6A 2WZBA 3FUVA 2JFVA 3FBTA 3SIXA 3NHAA 3V8RA 1SKAA 3TQHA 2O8XA 1PK9A 2WMYA 4EHAA 2FSHA 3H5IA 3O9VA 4HLQB 1BS2A 1KYXA 4MROA 4QPPA 3OE5A 3TOSA 4ZJUA 4K9KA 2X1EA 1I3CA 2V7QA 3UWMA 4D9BA 1E4EB 5BOXA 4NYMQ 1TEZA 1KRHA 3BWGA 1X8LA 3A6HA 1FFEA 2P30A 3GHYA 4KUMA 3FROA 1QNTA 3IKJA 3HYNA 4J1NA 1KJNA 2J3IA 1P4RA 2ZIFA 4HEJA 1AN9A 1MAVA 2Z95A 4NOLA 5EUBA 1IN5A 5I9SA 3Q9LA 4BQAA 2H9AA 3M1LA 1H2AS 4PYJA 3BFXA 2BEJA 5IJ0B 4PZJA 1W7PD 3OD5A 4CYDA 1SQSA 3GFIA 4QIWN 2M32A 2VP4A 2XNKA 4HP8A 3IOBA 3HTXA 3FD8A 3LX4A 1GRRA 2YIJA 5FDFA 1K7AA 2G0NA 3PI6A 5DX1A 3V7CA 3CC2I 4IVNA 1OTXA 4J07A 3KU1A 1MMAA 1GNSA 4P2GA 4Q7JB 3UHJA 1T38A 1QHHB 1ETUA 2OCPA 3QLVA 4EITA 1L4LA 2NZXA 1UEJA 1FU4A 1QZUA 1UPCA 4C7JA 4ZI7A 2J5XA 1L1RA 1EDOA 2FDXA 2D1TA 3H97A 1X1SA 2PJRA 2I6XA 2NV6A 1GY8A 4HAVA 4I99A 2V9CA 5CH8A 2C4NA 3L04A 4MTLA 3H0EA 4RS3A 2VODA 1T15A 2EFCB 3ESRA 5HF9A 3ZUPA 2F6RA 4EJSB 2WKPA 3KZNA 1WD7A 5B1SA 4CG2A 4ND8A 1Y9DA 4FDMA 5EQTA 2R11A 4U7PB 4F4HA 1Z4JA 1V3VA 3JCUC 1EGAA 2OHXA 4BUPA 1GYQA 4JU8A 5K6AC 3OE7A 4EI9A 3I5XA 3PSFA 3KT0A 3QH4A 4MA5A 3DKRA 5B3SH 1ZG3A 3ONVA 4LY6A 3WXMA 1U7WA 1A5ZA 3OZEA 2FEPA 4I81A 1FNMA 1X80A 2AW3A 2O2CA 1CJUC 5LP1A 2M2EA 2RMKA 1N2GA 3MQFA 1JFRA 2IQ5A 4EVIA 4WNIA 1RRCA 3C3YA 4BLWA 1LPPA 3ICEA 1YRWA 2J0EA 2NSYA 5A1TA 2L4MA 1Z2CA 1FDIA 5BV0A 1MJBA 3LP8A 1KYIA 4IFTA 1XCOA 1E3MA 3IV6A 3G0OA 2GEDA 5ICFA 1EPUA 3PF9A 2OP1A 4MEYF 1PD0A 4KGVA 4KRYA 1V48A 4RVNA 4WFKA 2E1CA 3I0ZA 1X3WB 1T9GS 1MNAA 3W3AA 4G24A 4G5FA 3H18A 4HJRA 4CF7A 3K69A 6PAXA 3Q2IA 4OHYA 1L5QA 1YS6A 1G8YA 1U94A 2BFDB 4LWPA 1RRJA 4RV5A 4DKJA 3CCMI 1VP9A 3RC8A 4ZH4F 4HDKB 2LK2A 4J0FA 5EEGA 2VL8A 3NKLA 5ECYA 5MN4A 1PUEE 4TX1A 1Z62A 3W8EA 4QVIA 1ESZA 1XZPA 3CMCO 1BU5A 2Z4RA 4EA7A 1Q0ZA 3BWCA 4G6DA 5AW7A 5H83A 5FT9A 2VN8A 5SICE 1A4XA 1JH9A 4QGBA 4S05A 4KPFC 1A35A 1ULYA 2CJWB 3GR6A 3HS3A 3UMMA 4V0SA 3EYIA 5TVGA 5CQEA 1SQGA 1GAWA 2FN9A 3SEFA 1HG0A 3ELDA 3ILYA 1MMGA 2FZLA 2HQOA 1JPVA 1Q21A 1J7JA 2Q1XA 1OAAA 2VF5X 3I4CA 1XQVA 3O21A 4Q19A 4TRRA 3LHSA 3Q8LA 1Z13A 3THWB 4K40A 2H06A 1R5JA 1N7JA 4MCHA 3X2SA 4D3SA 4LJLA 4AJ1A 2KE5A 1VQMI 2BCJQ 3SMVA 4CQMD 2C61A 1UHMA 1S7EA 2V5UA 3LZDA 3QGMA 4OXKA 4Y2UA 2VYNA 3NHPA 3BT9A 1ORVA 3L01A 4HWRA 3FFXA 2M1BA 3HL2A 1GPWB 4X44A 2IT1A 4GMFA 3T1TA 3EGEA 4TKMA 2B20A 1UT8A 3WB9A 4M9SA 5F4BA 4IHWA 5ALLA 1UINA 3LHFA 5FO0A 3VAAA 3VOAA 3HY3A 2FZ5A 4G41A 2BGNA 2XAFA 2FK8A 1OYVA 1S8NA 2CVPA 4IQ0A 4YCBA 3BR5A 5DD8A 4MYCA 3MS2A 5FRDA 1IBCA 1Q1GA 1AM4D 2ZP1A 3IJRA 3ZQFA 5KWEA 1A1VA 2DJ5A 1R8QA 2MJLA 2XMPA 1SIBE 4WNYA 5H81A 1E9BA 1I1HA 3DHNA 2ET6A 4NCKA 1ON1A 3L1JA 3IV9A 1DBWA 1GDHA 7YASA 2CF6A 2ZIUB 3P0HA 3ONWA 4CEIB 3WHBA 5IBQA 5GZ3A 2G06A 4PSAA 1JB9A 1KQ3A 4OUDB 3CUQA 3PJRA 1K8YB 1Z7EA 2V1UA 1E61A 3GEHA 3HNOA 4YAIA 2ZRBA 3CX4A 1E4YA 3SC2A 5D5XB 3QVLA 4BASA 1MBKA 1GTRA 3TPCA 4GM1A 1LSJA 5BWOA 2VF8A 1N34B 3ZHTA 1JXOA 1PJ4A 1S7GA 1XN7A 2E7ZA 3DWIA 4KWCA 4JI6B 3IUNA 4O0MA 4M87A 1OWLA 1WUKS 2O0KA 3EVAA 1G9SA 3BQ9A 4FQ7A 4PR3A 1YK1A 1ZCFA 4Q15A 2JIZD 1ATIA 3T5GA 4Z54A 4YC7A 1P1CA 3L0ZA 5ELLA 2QEQA 2HPMA 3S1LA 3ZLTA 3QUSA 1BIAA 1Z45A 2ZRIA 3WKAA 1G5TA 1AKHB 2GXSA 3NOXA 2O8KA 3CX3A 4HDSA 4OA8A 5L3CA 4E22A 2QJRA 1VHWA 4RPGA 5BUCA 2H3HA 2HSEA 3A1NA 3EGDB 3EMVA 4UHFA 3AFGA 1BMQA 2V7FA 5AVYA 3PXGA 4X8HA 4QLCU 2BLLA 2WAMA 1LJLA 1TT5A 2HHLA 2V9KA 3Q2OA 3K2EA 1CJKC 1S8OA 2ORVA 3A1VA 3I6YA 4DBZA 3U16A 1WBBA 1MRZA 2XRLA 4ND7A 1NJ5A 4HV4A 4BDYA 1OPXA 1OR7A 3UCEA 4Z86A 2FX2A 4M9UA 3BH7A 4R71A 1ZD2P 1N8KA 2JLUA 1EWVA 1F2VA 1YB5A 4X1YB 2NLOA 1I33A 5DB4A 4KRFA 1ZELA 1IEWA 2G82A 4JK3A 1WTCA 1REQB 4PBSA 3M8JA 2CLHB 2G9QA 5REQA 2K3FA 3TVYA 2ECFA 2ONCA 1E2XA 4ESFA 1YBMA 3E7XA 2PUBA 3ZMUA 1QGED 2RGDA 3EFEA 1R9NA 4DVGA 5JASA 3LMKA 3BRWD 4XONA 1KU7A 2VJMB 4KAJA 3E2IA 2WYHA 2CS3A 4ZHQB 2ORYA 3K0AB 2PUAA 2J59A 1L5SA 2PJDA 2X15A 4FOOA 5DBFA 1NVXQ 4QASA 3V97A 1V0JA 4MUAA 1Y1RA 3SXYA 1KSHA 1MDMA 4R2JA 3BR1A 2QN3A 4A82A 5LLDA 4IL5A 2JFGA 1I94B 3ROGA 4CNBA 5FADA 2GNPA 2C4KA 3MGKA 1WV1A 3DBLB 5ITZA 3TNDA 3JPYA 3LCUA 4D8VA 1USUA 1NHGA 3LHIA 4ZYWA 2PPVA 1TECE 1W36B 2WJ6A 5IUKC 4IH9A 3WSVA 2AOWA 2B4RO 3OETA 4BP1A 4QYIA 4P36A 3E5XA 2DPGA 3EVFA 5FFMA 3RQ4A 1GQOA 2ZRFA 4C05A 4QJ3A 1JBQA 4XRGA 5FROA 4F04A 2RHOA 1GNVA 4HGQA 2V6EA 3WP0A 3WX0A 5LJIA 2K9LA 4B9AA 4QX6A 5IJZA 3ISVA 5KVSA 4UQOA 1YS7A 1WB6A 5AVUA 5JSFA 2BMAA 3SQOA 1M5RA 3OIGA 2WT4A 5LQNA 3N3BC 1MORA 1DHTA 3EOZA 4Q7KA 4YFKF 3M9XA 4N1AA 4N7RA 4PAMA 3IAM2 4XN0A 1E64A 1ZWKA 1UXKA 1D6JA 5DISB 3RM3A 3UXMA 1XP8A 3OZCA 3WL4A 2QTGA 4DWOA 5EIXA 1CZHA 3KHKA 5A4IS 1UFRA 1SD2A 3AKZA 4IIJB 3D6MA 2OLJA 5DCFA 1YU6A 4KQ6A 2D45A 2BKLA 2B0CA 4XQEA 3O8QA 4D0RA 5BUZA 3GUZA 1CB0A 1TA4A 3VYSB 2EB7A 1LLUA 2R6CA 2ZBQA 3DT8A 5G2OA 1XSDA 4Q9DA 4YK7A 1TQ2A 1EBUA 4ARVA 2CUTA 5JYCA 4DYQA 4MWOA 3UM9A 1SU8A 3W2FA 2JA1A 4ML3A 3GXOA 3QENA 4RK6A 2FNPA 4BHTA 1ULBA 4KREA 4EGYA 1UOEA 1DIHA 2AXNA 4KXUA 2PN6A 4JYPA 5JATA 5K0BA 1A6QA 1AXEA 3R44A 3TYXA 4OX9Y 3W0LB 5BYKA 2A6TA 4BYMA 2CUJA 3OIDA 1JKOC 2QKMB 2A0WA 2F43B 2IZ0A 2QTTA 4LZWA 5CGQB 3GTJJ 3GMDA 3S40A 1TAHA 1KJ8A 4P4UA 4YCDA 1NL3A 3ND7A 5TMDA 1USVA 5DN6D 1AX9A 3HXMA 1DHRA 1CR0A 1COWD 2E4XA 2KKOA 4AIDA 4MMZB 2DERA 5DBOA 2WP0A 4YRPA 4IX1A 1Z29A 4ODIA 4B0PA 4F6RA 3C97A 3HYCA 3LRPA 4NBKA 4KMRA 3NHBA 1AZLA 1L3IA 1R6UA 1W6RA 3FYUA 5P8WA 4P32A 3C24A 3MRTA 4EDFA 4TPKA 1P1FA 3QU3A 1NRWA 2AOUB 1ETXA 1E9FA 1RYEA 3U2RA 1S5LC 1WABA 1Z8FA 2XMZA 4LG1A 3SHVA 3V55A 4C7VA 1JEJA 4WKBA 4JP5A 2DT7B 3KJGA 2IVFA 2XB8A 3S5UA 2YQZA 1KFCB 3WHIA 4NBTA 4F7DA 2GCIA 1NVTA 5E8GA 1QAQA 1Z4MA 4O2LA 2BMDA 2PMZN 4QRDA 3NIWA 2FA5A 3AM4A 3V4PB 2ESNA 3VR6D 3QE4A 3AB3A 3N1UA 5HTKA 4WN9B 3ULKA 5KYTA 4KK4A 5CB4F 4ZRMA 5C3UA 4CW7A 1GT0C 1L5NA 3FRIA 1SEPA 3LA7A 3I53A 1RHUA 4DNXA 3CG0A 4YP0A 3W6UA 1U1IA 1YASA 1WQ1R 2P62A 3E8XA 4QTTB 1JHQA 3R3XA 3HCFA 5KNCA 1YJ5A 2VDKB 4JLSA 4RXUA 1W2HA 2OCDA 1EA7A 3NT2A 3T3HA 4QKQA 4QYMA 4LGYA 5AHWA 4C9BA 2HT6A 1SXJA 3GGSA 5AI4A 3L40A 3LBIA 3S5JA 3BG5A 1VOTA 3W2IA 4FBLA 1V96A 1X2NA 1Q17A 4V03A 3UMCA 3E7PA 4A2WA 3LY8A 3H6KA 2H8WA 3DR5A 3FVVA 2KBFA 3FYHA 4NOJA 4HI0E 1EAMA 1UXHA 2HXYA 1W35A 2O06A 3M70A 4WCFC 4DFDA 4CL0A 2RVCA 1V6SA 1W1UA 3CY6A 3NNDA 4PO9A 1TU0A 3ABZA 4QUEA 2C0CA 3KB1A 4GZ5A 1L3LA 4C2AA 4Z0TA 1TWGJ 4P5OA 3B2EA 3NH9A 4KKXB 3MBOA 5EXDA 4ZXPA 3HGQA 5B3LA 1NVUQ 3IQGX 2EZLA 1OCEA 4KXYA 4PXSA 2QX8A 4BU1A 1Z34A 4CYCA 1E94E 1UF9A 2GYVA 4C6SA 3R75A 2FGKA 2C9ZA 4LKOA 4OM7A 1XAIA 2CUNA 1D6SA 1WJFA 1K6IA 3AUAA 1DBPA 2W48A 4N3CA 4R2IA 3O8NA 4CCMA 5DLDA 2CHFA 2Q3BA 4XYMA 4B34A 4B75A 1F0YA 4DQXA 5BXYA 4MQ6A 2Y68A 1WPKA 2LTPA 3AYXB 3TB6A 3HR7A 3IKVA 1XQ9A 5KYWB 2PJPA 5LXTF 3IWFA 3KEYA 1XR3A 3KQQA 3OOYA 1POGA 1HKSA 4X6UA 1Y0UA 4NVRA 5H9VA 5M34A 1CEYA 2ZAGA 3Q7SA 3C6BA 1G63A 3PNYA 5CG1A 1KZ6A 1C50A 4JP1A 4YS6A 2X8JB 1GV5A 1XNHA 2EBWA 3BRSA 4BIMA 5A04A 5AW6A 4AY6A 3L93A 1N3IA 2R7SA 1R15A 3KB6A 2H1FA 4HAIA 3NKVA 1ISHA 1MB3A 1SXJC 4M21A 3O75A 4NZPA 3BR2A 3LIIA 2L02A 3FZGA 3LA6A 1V5WA 4N0BA 1S2GA 2D2XA 2G88A 3OPNA 3PC6A 3LUKA 2QL5A 4ALIA 1CCWA 2UUOA 4HGPA 4G8XA 2OFOA 3DPTA 1B6AA 5NLLA 1TWFJ 1YE8A 2P4HX 2N0SA 1AA7A 3FLAA 1W73A 2BD0A 2CVOA 4KUEA 1PJ8A 3AZPA 4YX9A 4US2R 3W1VA 1BOBA 1Y42X 4KIBA 2BM9A 4GUDA 5A4JA 5AVWA 1TJPB 1WKBA 1NNLA 1U5BA 4QJ4A 4BXOA 4PSWA 3GTPJ 1RJEA 4TMVA 1Z35A 3ZE6A 1DNPA 1F6DA 3E53A 4FONA 2XKBA 1FJGB 3Q3HA 3MMNA 4ZVOA 3BWVA 3CF6R 3HDTA 5EMLA 4D99A 4M1TA 2C29D 1T2NA 2YH2A 4QBGB 4YT4A 3QA9A 5LFAA 1C8KA 3D7MA 1NZDA 1A7KA 3L05A 1PIWA 1NE7A 2ZM6B 4R7GA 1LDMA 4NCXA 1IHPA 3T7RA 2F90A 4EHFA 1HBJA 3C1DA 3DKIA 3UMFA 1X15A 2JASA 4L8FA 5AI8A 5HBRA 4RB1A 4RORA 2RJ3A 3MWKA 3GLTA 4EMUA 3EUHC 1BJKA 2X4DA 4N47A 3BXGA 1QGDA 3FCXA 5JVGF 2NU9B 4G6TB 4EHBA 2JPBA 3DV0B 3FTEA 4G9BA 3LSPA 5HKOA 3HYSA 3WV5A 3D4IA 4HXEB 2PJRB 1GL7A 4C0LA 3IHWA 3UJ9A 3TDUC 1R4MB 1RI4A 3N2KB 3SYNA 2IGOA 1ZMBA 4R3WA 2WV7A 4YACA 4D74A 3F8CA 4M0KA 3HVRA 5ALSA 1CS4C 2Q50A 3SC6A 1FYWA 3CWQA 3F4BA 1IB6A 1KMCA 1PVDA 2Q3EA 3D8UA 1I6WA 1Y9EA 4LDZA 4XDZA 3S2IA 2LY2A 4RBOA 3G0CA 4EKDA 2Y0SA 4E5UA 1HM5A 1S8AA 2QD3A 2BY3A 1RI2A 3QPHA 2BH9A 1HL7A 3D3JA 2EBIA 2XIGA 1LV8A 1DIGA 3EQ6A 3G23A 2I71A 2PKQO 3JQBC 3T3PB 2HYIC 1YVPA 1J24A 5LP6F 4TL7A 1J9IA 4I76A 4HDMA 5IARA 5CEFA 3WY9A 5TVKA 5JAHA 4YELA 3MAJA 3BBPA 3BUSA 5KVAA 1N2CB 4DV5B 4PAOA 4X20B 1PQ4A 3JAKA 4G25A 4NC9A 1K89A 2WJPA 4QUHA 5TE9A 4DYRA 3RVRA 4B82A 4Y6QA 4PYLA 4N3BA 1NP6A 3A2KA 1RAGA 1SXJE 2X0NA 5GGYA 5L7WA 4IOMA 4X97A 3FUCA 4P2BA 4GX2A 4ND2A 1NYTA 4B33A 1XEWX 1YC5A 1RLMA 2ERCA 1G4HA 2EV5A 2F4NA 3W79A 3OIOA 2AQHA 4LTNA 3WTWC 2EX0A 2ORWA 1SCQA 3NYIA 1D9ZA 1TJ4A 4A91A 2IUTA 3K0EA 1ABBA 2JAQA 1PG0A 2O7NA 1Q15A 4NE9A 2J8ZA 4Y33A 3DEHA 1OUMA 4HYYA 4OU5A 4ADSG 3V7SA 3S14J 4KDEA 3AG2H 4DUZB 1QV6A 2Q7DA 4DMRA 5ALVA 5I7EA 1O0BA 5LB2A 2Q3CA 1AMNA 3UFXA 1UJ8A 2N1BA 4E1AA 5E6RB 1E1LA 5JAOA 1TM7E 3T8YA 5CXUA 5AVTA 1ZH0A 3AIIA 3CS3A 3N59A 4TS4A 5JOQA 1LTQA 3KOYA 4ZREA 4KVZA 4D0GA 3K6SB 4C14A 4ZZ3A 3EC1A 3PFHA 4TV9F 1KZGB 2J9XB 3A3NA 3H1PA 1H22A 2FF5A 3CLSC 4QODA 1H4QA 5B2ZA 1B9NA 4Y6GB 3U37A 3VPHA 3ABRB 3KOWA 4UHEA 1GT6A 3FGZA 1PZGA 3GBVA 5AVQA 5K0GA 2I6QA 4FFRA 5LMUB 4JENA 4BMOB 1JEOA 2ZCJA 2PI0A 3FXLA 1I4EB 3ZN1A 3DFZA 4NC8A 2C07A 2REBA 1HMYA 3C7DB 2Z6AA 1YQ9A 1Z0XA 1O3TA 4ZTJA 2E9SA 1B6TA 4Y18A 1FVXA 2A58A 2HA4A 5BYJA 3QPLA 4FI3F 1X8JA 2PWAA 4KSYA 4IEIA 1JKJA 2FKNA 3AKYA 3A1WA 4K8OA 4P4SB 4I8DA 3S6JA 1E4VA 2AJ8A 2QKLB 2X85A 2ODBA 3FYTA 3LH5A 4EA6A 4XYLA 3E9RA 2C88A 5ALUA 2R96A 4J43A 3J81Z 4NMWA 3W4KA 4YIRX 5AK5A 3OG9A 4ENTA 4C01A 3BK1A 1SD5A 1HSZA 1RHMA 4OGWA 4R8RA 4W5QA 1DC3A 5A7FA 1YE9A 3G1OA 1NHWA 2HIMA 2I8AA 4LE2A 3RJ9A 1OYWA 2Y92A 1II9A 2XOKD 5B5SA 1M2OB 3FWPA 3KE9A 1AK2A 1DXQA 2BJVA 1OF1A 3JRIA 4L15A 4BKQA 3WTTC 2Y8EA 1IXSB 2ZBKA 1VIDA 2DBVO 1A97A 3Q9UA 2GVNA 3ZGKA 2RHBA 5TQ0B 2BN4A 2Y30A 3EJWA 3JYNA 1JEQB 2C0QA 3SFZA 2DPYA 3HSSA 4S3MA 1NH3A 2WMOB 4CRWB 4GHWA 4Q18A 4AYWA 3O4RA 3P9ZA 3TTVA 3JQAA 3P20A 4G07A 1ZZEA 3QFCA 3OLVA 3ZTYA 3S1NJ 1VQKI 1LNQA 5FH9A 3TR6A 4CKCB 1S02A 1SZJG 2Z4TA 3GCXA 5KAIC 4DLPA 1R37A 4BJTA 1Q7EA 4MW4A 3WGQA 2PPLA 1NG7A 1T3HA 5B3AA 2VJOA 2LKSA 4M8NE 1ECGA 2K9QA 2ALJA 4K46A 1ADJA 1QYWA 5HS7A 1U3VA 2PQ2A 2CGEA 2BMVA 4LRWA 5AW1A 1O03A 2F62A 2NNNA 1XZFA 1G4UR 3KT3A 2J6BA 3FSGA 3KPHA 2Q1SA 5H3LA 4E6KG 1SBIA 2EWWA 1E6UA 2F3PA 3AWDA 1ITZA 3JVDA 1E5VA 1LS6A 1IZ1A 4JI7B 5BW5A 1LFDB 2JK3A 3J7TA 3IP7A 2ZATA 2BLNA 3WIVA 1PKXA 2OV2A 3THOA 4ZVVA 1W9MA 2DU8A 1K78A 1V3TA 4K5QA 3PWTA 3R9XA 1FOEB 1K6XA 3WL5A 1XV5A 4XOPA 2KFDA 3MIZA 4UV9A 1I3KA 2QM3A 2ST1A 1T9DA 1VIVA 1U8UA 2QM7A 2REXB 4O3FA 2ZWOA 2VRCA 5EZYB 5U4XA 2DWQA 4LZPA 3C2QA 4YMVA 3H05A 4D8UA 1XNQB 3D9QX 2R7NA 1CHNA 3TD6A 3CRW1 5JMWA 5H20A 4IHTA 2FW0A 2FSVA 2WZCA 1NTRA 1OZAA 2LCIA 2C98A 3F3YA 3FPAA 3K53A 1QHSA 3N9IA 4UQPA 5FJJA 4BNDB 4CYMA 4XWOA 5LNK6 2NTYC 2KRHA 2WUEA 2JD2A 4G36A 5JXGA 5BSRA 1PG2A 1CB7A 4ER7A 5CH5A 3U7GA 1RHRA 2E34A 2QF7A 3MHPA 5CW1A 4AKEA 3CLVA 4KN6A 4BQIA 4E7ZA 1KJYA 1HT3A 4QOGA 2QUJA 4QDUA 2VWQA 3KR0A 2PV0A 4X92A 4Y6RA 4PG8A 3ICVA 1CUFA 4BUZA 2QJFA 5E2IA 1JN0A 5EL0A 3PDIA 1MDMB 3P0EA 3BHNA 2YZ2A 3ZMTA 1ZR2A 5AVRA 1FFHA 3KXPA 4YRDA 1AB6A 3VPGA 1EXDA 3R60A 1E8NA 2ZT7A 2NT3A 3NPMA 3NALA 5CPRB 1YJ8A 4Q4HB 1ZTRA 1W94A 5DCUA 3WZLA 1CQIB 5AW2A 2HD4A 3ITKA 1ACLA 5EP4A 1PT8A 3FJ1A 3L1UA 3FPSA 1EH8A 1E1YA 2CMFA 4R8HA 2BZTA 3LTEA 3LW7A 4XEHA 1Y1TA 4O4IB 2EFPA 4BQSA 2OBFA 1PR4A 4EFLA 1T08B 1N9KA 2AHOA 2P6TA 4FILA 1YR8A 5FBQB 4ZT7A 3MCZA 3OYGA 4U2KA 4WY8A 5FUBA 5L6MB 1A8SA 4JCCA 1AHIA 4Q16A 2DA4A 3LM8A 1ZVQA 2N75A 2XCQA 3EDCA 2GYUA 2HJHA 3E9CA 1OISA 1UP7A 3E05A 1K4MA 2BM1A 3D3QA 1ZJ6A 2XTJA 3S8PA 5D5HA 4F71A 3E1SA 4BKXA 2BOVA 4HEQA 4IYJA 3O74A 4AC9A 4DS3A 4UTRA 3F3KA 1FSGA 2JLBA 3H1GA 4MRVA 1U3CA 2BHZA 4HX7A 4RSMA 5FB3A 2VPRA 3VBEA 1MDFA 1X1TA 2NVYJ 4BVGA 3J81k 1Q57A 2BFDA 4YRFA 3I54A 2DBZA 3ED5A 3QHPA 2ENWA 2YWRA 3RVBA 4MVJD 4MR9A 4QFBA 2FCAA 1ZP6A 2ZTSA 1EA5A 1UBHS 2ZB2A 1EG7A 5BS6A 1PF7E 1Z2DA 2GR9A 3I9NA 4C3JJ 4B3JA 4EF5A 4ZCIA 1R5HA 1E0KA 2V7QD 1WFXA 4BEHB 1GA1A 4P80A 5EJ9A 1JV2B 3UQZA 2QI9F 2LVSA 1HETA 3B3QA 5GPBA 1NDUA 1RP7A 2GK3A 3DUWA 4PJMA 2ILVA 3NARA 3HDGA 4GXNA 1RJGA 1SA0B 4H15A 3VZSA 1O89A 3BDDA 2XAGA 5CEEA 1U3WA 4C2MJ 1TXGA 2X6WA 4R98A 1LDNA 2UYOA 5C18A 4WQMA 1QH8A 3I4NJ 1K9VF 2JTVA 3E23A 2X1DA 4FEYA 2IHYA 4ATNA 2KIFA 1VB5A 3BTJA 4HX9A 3FJYA 1DU6A 2IOFA 4CPDA 4F4DA 1UK7A 1NUUA 2DCEA 3I56I 1L2TA 1Y3BE 3K1JA 3KSMA 3CCSI 1JHYA 1W0UA 1YSCA 1VE3A 2RONA 3DLBA 1G3TA 4A8PA 1I4WA 1YZUA 2AUNA 4K9QA 1GGFA 5C53B 3NEPX 3DVQX 3TD9A 1XHEA 3AV0B 1FDVA 4ECEA 3JWEA 3QZUA 5HM8A 2ZYUX 4PLVA 1QH9A 3QVWA 2RHGB 1M1XB 1VQ7I 2GHTA 3TW0A 2W4SA 1ZSYA 3DOUA 3G5UA 4FEEA 4PQEA 3B60A 4E30A 1DTSA 4BMSA 3PXCX 3FXRA 1ZM7A 3KUUA 1WR8A 3KZCA 3RJZA 2OL4A 1K86A 1FRZA 3A6GA 1W88A 3EEQA 3LZ6A 5BSFA 1AV6A 3L1KA 3NI2A 3WNBA 3CRRA 1DMSA 3KJQA 3I01M 3G7UA 3RROA 4F2PA 4FP9A 2SBTA 1SBNE 2C8VA 3FNRA 1NQTA 3FNFA 4GR9A 4A0HA 4DWVA 4RVFA 4BQRA 1M1YB 4PZZA 1XC5A 2CCJA 5IOZA 1PR9A 5AVZA 5HR5A 4LV6A 2FMKA 4MRMA 4DBVO 2HRDA 2G36A 2OSVA 2VUSA 2VNHA 3HRHA 3O8LA 4XR6A 3M1EA 4E7JA 1EE9A 2Q5QA 3CF4G 3R4VA 2O3RA 3DVSX 3I9LA 5BSUA 4DB4A 2FBKA 4C0XA 3FMQA 3VZDA 1H8ED 4EATA 2WV0A 1CP2A 1N5RA 4WK6A 2A5JA 5KYYA 1JHRA 3KR2A 3WICA 1P2FA 1Z5ZA 3EZ2A 4NEGA 4EEXA 5CB0A 1LB1B 3Q3VA 2FPGB 1BSVA 2CNWA 5DIFA 3MWDA 1QGYA 4G0ZA 1Q3KA 4U0KA 2FG5A 3OJLA 5C3MA 4CYCB 4NX2A 2PX0A 4MLCA 2VXZA 2HMWA 5EE5B 4Q7QA 1JWAB 1LLQA 3RAGA 3HCAA 3P45A 4M3GA 3C1UA 5LMCA 4JN6B 1QP4A 4B3AA 4KIFA 1YACA 2AFIA 4I5FA 4NDZA 3W8NA 3ZHCA 2DODA 4DLBA 1H6BA 3GBPA 2B4YA 4BE0A 1MC8A 4JEMA 4B8ZA 1OY1A 3OYLA 1RBMA 2PYZA 4G4GA 4KO1S 4X7PA 3OT4A 4MS4B 5AW8A 4MTCA 4E1VA 5DHRA 1JZQA 5ISMA 1R64A 1M0WA 4RMIA 5G0TA 3HSYA 1XLVA 4HN4B 2BR5A 5DBHX 2QE7A 3WLPA 1QS0B 2Z4SA 1TUBB 1Y39A 4IZHA 4IQJA 4QOIA 3QLEA 2GSWA 4D82A 1YOVA 4M0UA 1K06A 2B34A 4D9HA 1X58A 1S89A 4URVR 2G07A 5KYXB 3GNSA 1U6IA 2JLYA 1Y4DE 3DLTA 4HH4A 3ZVKA 1BU8A 3LDFA 4Y6PA 3HVUA 2B1GA 4KO4S 4LYAA 4OKIA 3UATA 1W8DA 5AW3A 3GNLA 4C1NA 3DDWA 3ETNA 1LI4A 1DGQA 2J33A 5HFNA 2LUOA 1NTCA 3H99A 4L4SA 4C4XA 2O20A 1R1TA 4F12A 1NKSA 2E5WA 2DY1A 1JPJA 2VZ0A 3NEYA 3U9TA 4CLHA 1CRLA 4RGSA 4HPWA 3UK6A 2IU0A 5TGZA 1CQIA 1SM4A 2AN5A 3M83A 3OHPA 1CY6A 2BEUA 1D0ZA 3FR8A 4FR0A 4LOIA 5EP1A 2G1KA 4ZEVA 1NXXA 1A69A 1JHXA 1WEHA 2XUIA 1ON2A 2BE5F 2YHIA 4N0MA 1R5GA 4OQYA 2JK0A 2Q21A 2B3DA 3PQFA 2L19A 4JKYA 4UBIA 3W2VA 5E3NA 1T34A 2ZSJA 1SUDA 2R6DA 3AL3A 3CHYA 3QP9A 4LDNA 4EJWA 4EVQA 2B61A 2JAUA 1J25A 5AOCA 3AUUA 3Q8WA 1R49A 1IBRA 1P5RA 5IY5H 2D5IA 2JH8A 4FKMA 4G1BA 3UC5A 4DQVA 5LBUA 4B6JA 1OW3B 1G8MA 1PFQA 4JVLA 3FNBA 1SXJD 4N18A 4CCLA 1DINA 1ZOIA 1W0KA 4FHFA 3SE7A 2W2MA 3CRZA 4S12A 5FNVB 3O8QB 5BUSA 2JUGA 1JR3A 2FWBA 3U7FB 1GQQA 1U8TA 5D5UB 1OILA 2HNBA 3AF2A 3ZY3A 2OR3A 3L0DA 4C4SA 3QPUA 1PZNA 3Q9SA 3OT1A 4GPD1 1E98A 3K05A 3K20A 1OBFO 3TEFA 2D5CA 2QT9A 5FA8A 4OMYA 1S4QA 3EH2A 3C16C 2A1UA 4M7OA 3WL8A 5BV7A 2PUCA 3VO9A 1G5HA 3P32A 3E3NA 2JWTA 3PLNA 4QOHA 1TDJA 1EXNA 2WJGA 4EZIA 1KS2A 3PP8A 3RNLA 2O6LA 4PF1A 3C2GA 5AXDA 4LITA 4HLUA 1NBOA 1A31A 4MW7A 4DRXA 4JEUA 3Q3CA 1O94D 2CXHA 3P71T 3GA0A 1QLHA 4QOSA 5K3CA 4B3GA 1XF9A 3BCSA 5FKMA 3GJ4A 4UBNA 1I4LD 1TIKA 2Q07A 3AY0A 3IDOA 3VHLB 3WDKA 4BKOA 4RXTA 1QIEA 1BMDA 4M0PA 4DA9A 4MYTA 1Y5IA 5T6MA 4BFVA 4RZQA 2E60A 4ACBA 3IVGA 4J03A 4RFVA 3W5HA 1D6NA 3WWZA 2VJIA 4I98B 1SOVA 5BN3A 1IUPA 4PSVA 3WVNA 1TYAE 2Q4OA 2EOAA 1VCMA 3BVPA 4LX8A 1L7EA 4LRUA 2JVJA 1NYRA 3NRJA 1IW7F 1RXWA 1KY3A 1JAXA 1JSLA 1ZOSA 1WQ2A 2IF0A 4RACA 5FF9A 3BRWA 3QPWA 1PK7A 3INGA 1T3LA 2O7QA 4Y9TA 1T5IA 1C7RA 3OM9A 4DR6B 1IN8A 1N7HA 4IH1A 2OD9A 5ER9A 5K3EA 1G66A 1ZOOA 3EZFA 5B3KA 1JECA 2YZ7A 4HPJB 1A6IA 1KI2A 2A05A 1E4OA 3KHTA 4JMLA 3PIIA 3WSTA 4HZIA 4ZZ0A 1N32B 2GKOA 4C2TA 4R3NA 1LXCA 5I8ZA 4WKNA 1KK3A 4BRWA 1FYDA 2PD4A 4YEDA 2MBFA 4IEJA 3HE3A 1E5LA 2R00C 4JX5A 1FBSA 1PBTA 3M1IA 3NAMA 2QGFA 4FHCA 1E6EA 5CB6A 4ZZDA 1OU0A 1WW3A 2QLLA 4J2OA 3I9FA 3EFOA 3VO1A 4FYMA 1VFPA 1V8ZA 4JBGA 4J3JA 4LXGA 3X0DA 1MZBA 1A72A 2ZYSA 4M88A 1F2TA 1G9XA 3VGJA 5DPMA 3F8FA 4GIBA 3T5PA 4HB2A 1TK3A 3UUWA 3KQNA 4MWTA 3RS4A 1YYVA 4BMNA 5FRNA 3K8ZA 3MB8A 3ABQB 1XJ5A 5JFGA 4M6XA 3ZHVA 3KP4A 5CLFA 2DPMA 1Z4OA 4XN3A 1UT5A 3WGGA 1ISMA 2PLNA 1TJNA 3PL8A 4GO1A 3WK4A 4ZVPA 4UNPA 2VZ8A 1TYCA 2H65A 1CEEA 4LMBA 2WLSA 3H65A 1GU7A 2EF1A 1KZ4A 1RE0A 3M5PA 1TJ5A 1YI2I 4LJ7A 2B1IA 1ANKA 4OHBA 5ESWA 1L5LA 3NGXA 3SR4A 1JJBA 3JXEA 1BN7A 2LSOA 1JHUA 4LQDA 4UZEA 1CDEA 1RZUA 2F2EA 1VJTA 2I4RA 2NZ2A 5CUQA 3SGLA 2XTNA 4DEYA 4OCZA 1GXSB 2L2QA 2WD7B 4ED9A 5L3SB 1MEOA 3ZY6A 2QRUA 4R1QA 1E2GA 3ESAA 1AKEA 4II2A 3FDYA 4FJ2A 1P1HA 3PDWA 1BIBA 1JG1A 2Z2KA 1HLFA 1QYCA 5A2GA 4YMGA 3U56A 5KQLA 4PZ9A 4FX4A 2ATVA 3WTZA 1LBHA 1XYVA 5DLPA 5K7SA 1VSTA 2H11A 1FLNA 1USIA 5TARA 4K6KA 4RY8A 4EUHA 3DEEA 2DA3A 5HDGA 3MA0A 1QG6A 2GGSA 4D25A 3GT7A 1EGHA 3NJ8A 2V7VA 4JXJA 4AJ2A 1CZOA 3JQFC 1WWXA 1P5HA 3ROTA 5J1YA 4MWGA 1YL6A 2C3PA 1VLHA 2NW6A 2FMTA 1XJ0A 3FDZA 3GARA 3DOIA 3OLQA 2G9VA 2TRTA 1UJBA 3AHJA 5CX4A 2DKNA 2B7EA 5HFAA 3U4HA 1F38A 5J1RA 2VTDA 3D4BA 4XLEA 3H9JA 1X86B 2BBTA 5KYKA 3DQVC 4MLOA 1A50B 1DKUA 3RFCA 1YCFA 1ULUA 2PMZA 2RSLA 1GR0A 4DDHA 2DO7A 2CDRA 3LPCA 1NNI1 4OK3A 3WK8A 1WDTA 3PHHA 3ER9A 3GVCA 4C2BA 4ZCTA 4PO8A 2OLEA 3IXLA 2JW5A 4IW3B 4PX9A 3T5DA 3H87A 1B93A 3VVLA 4AX4A 3I59A 1N1DA 1B0ZA 1QGUB 4IGIA 3HL0A 4CCAA 5IT4A 5B1IA 3CINA 1HC7A 3SLGA 5A4MS 3ZDDA 4GP7A 4KN5A 1KWKA 4BXOB 4EMBA 1YKGA 3A1DA 2IHKA 3L77A 3EARA 5DD4A 4PFOA 2A9JA 3U7EB 4MGYR 3EA5A 4AD8A 1UBOS 4E15A 1G8KA 1T2UA 3PNSA 3I1YA 4CV0A 3LT2A 3PFBA 3W8DA 2BDTA 3AFIA 3PFCA 3T38A 3K8QA 2XRNA 4MIEA 3HJUA 2W6ID 2CMPA 1D0IA 3KYIB 3QE9Y 1I6MA 1KO7A 2I1VB 2I67A 3RV3A 1UXOA 2ECQA 4MQ5A 1Z0JA 4Y0NA 2ZYVX 5IVIA 4BLSA 3K9QO 1KY5A 1URPA 3IAS6 1T6BY 1HE8B 2YY7A 1YJBA 5I48A 1CUHA 2ZE8A 2I80A 3DZBA 2VI6A 3G02A 2WG2A 4LOAA 3V5NA 1ZN2A 1QYRA 2XGXA 4MW5A 3PUIA 4BN0A 2VP2A 3IDAA 2BUCA 3GFOA 2HW8A 2Q62A 1V55H 3TBKA 2EA2A 3RFUA 1VDMA 2D7CA 3LLCA 4EHJA 1CUYA 5JNTA 3HBAA 4UBMA 3PC2A 5C1BA 3HYTA 5AQ1A 3E6MA 3E5MA 1FDWA 3CCLI 2P9CA 1IQ0A 4RA9A 4UTZA 1U0RA 3UTCA 1GVNB 1L3BA 2VXBA 1SHLA 3KJFA 5TC4A 1YIJI 4Y8VA 2F5CA 1HOTA 1NM5C 3ELUA 5C4XJ 4F5ZA 4KMFA 4H1UA 3CWCA 4K2HA 5AM0A 3S32A 3L2VA 1B6SA 3LOPA 4AKIA 5HILA 1PUFB 1NI5A 1Z07A 2O0JA 2H0RA 2TECE 1V16B 3OJ0A 2P8TA 1JIXA 1MJ5A 1JA0A 1TYBE 2KL4A 3MOSA 2ZRDA 2V7EA 4NE7A 3GRRA 3F8SA 2Y1WA 3HCWA 3LA3A 4GBMA 4Y98A 4YJ2F 1U1CA 2JDIA 3BQMB 4AUMA 2I1WA 4KFUA 3DZ8A 2G8LA 2Z0MA 4KQFA 1DV2A 3JWGA 1ENYA 2XZDA 2QQBA 4X7BA 2GAUA 2CFSA 3KEFA 3L0CA 3L02A 2IP2A 1VHQA 4BFTA 3B13B 4BLVA 1IG7A 1P7IA 3TQSA 4MHTA 2BEVA 3EUKL 1FYXA 2AEMA 3T61A 4RUKA 1YR1A 4MKGA 3BIWA 3BEDA 2FHSA 4OXRA 4HTAA 4DDTA 4ZCPA 4YT8A 1M74A 3AF3A 4X94A 1ZAYA 1J06A 3IDFA 2XYQA 2SNIE 3RWMB 5IAKA 3IULA 1QTRA 4E2FA 1RR6A 1EWQA 3ZQUA 3BR0A 4WT7A 2C4HA 5F3RA 1D1BA 2IY9A 3ZGXA 9ABPA 1FOKA 3NC0C 521PA 1AF4A 1I3OA 1NW4A 2OTJI 5IJ0A 1I1OA 1W30A 3ZJUA 5CYPA 4AF7A 4DCNA 4E14A 4TMZA 3T3IA 3ENNA 3IGFA 3O9MA 1HRDA 2XAAA 1GFWA 3LQ4A 4FHEA 3C14C 1LA2A 1CULC 4BX2A 2UXCB 4BQOA 3PTZA 1TLHB 2PKQP 2HEGA 5UKDA 2WKQA 4ZVRA 1GKYA 4F6LA 4A5OA 4R9VA 1N5OX 3QTTA 1ACJA 2QCOA 1CR4A 1EFVB 3O91A 2I6TA 3KXDA 5DFAA 3E2PA 1N75A 1MX5A 1E7MA 1QNLA 2BKUA 3M4XA 3SHTA 2QX7A 3OV8A 3WMEA 2PL9A 4HNSA 3QK7A 3ECHA 5DUIA 1KEEB 2E5NA 1R74A 3FLMA 1CQJA 3ZU2A 1UQUA 2VXDA 3WJ2A 3PJFA 3QLUC 4JI3B 4ASNA 4AY5A 1HQCA 2JVHA 4TYYA 3GP3A 1UMKA 3AF0A 1ZK0A 3G5MA 3GGCA 3QPBA 4ENMA 5KJEA 1C4WA 1NE2A 5JEDA 5C52B 1HTBA 4MQBA 1CUUA 1X70A 1D1TA 2BY4A 2AR7A 1SXIA 3CKYA 1FCJA 5M3BA 3MJFA 4GLJA 3OYJA 4UQLA 1EINA 2BHLA 1KGDA 3BSSA 3EG9B 4MI3A 4WASA 1YNSA 4GRIA 1EVJA 2HBQA 3NTLA 2BONA 4YJ3F 1RYFA 4JB2A 4OH7A 4NENA 1Z6AA 2O1EA 2GVZC 2HVSA 2H4HA 2NACA 3PDHA 1C81A 2W2LD 4OQDA 3JALA 1ABFA 4YWJA 3WRXC 1OV6A 4G4SP 5LNK1 1RJ9B 2YCBA 1CYD