2GWRA

Crystal structure of the response regulator protein mtra from mycobacterium tuberculosis
Total Genus 69
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
69
sequence length
227
structure length
225
Chain Sequence
b'DTMRQRILVVDDDASLAEMLTIVLRGEGFDTAVIGDGTQALTAVRELRPDLVLLDLMLPGMNGIDVCRVLRADSGVPIVMLTAKTDTVDVVLGLESGADDYIMKPFKPKELVARVRARLRRNDDEPAEMLSIADVEIDVPAHKVTRNGEQISLTPLEFDLLVALARKPRQVFTRDVLLEQVWGYRADTRLVNVHVQRLRAKVEKDPENPTVVLTVRGVGYKAGPP'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA-binding response regulator mtrA
publication title Domain orientation in the inactive response regulator Mycobacterium tuberculosis MtrA provides a barrier to activation.
pubmed doi rcsb
source organism Mycobacterium tuberculosis
molecule tags Signaling protein
total genus 69
structure length 225
sequence length 227
ec nomenclature
pdb deposition date 2006-05-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00072 Response_reg Response regulator receiver domain
A PF00486 Trans_reg_C Transcriptional regulatory protein, C terminal
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 2gwrA02
3.40.50.2300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 2gwrA01
1KU9A 1FX7A 2XAFA 3U9GA 5K5OA 3GRCA 3VOEA 3RJPA 1L5YA 3GWGA 2PG4A 2CFXA 3ZP5A 2BEOA 3RYPA 3OLYA 3QP6A 4ZZLA 3P9CA 5IULC 5KI6A 3N0RA 4KMRA 1HBXG 5BS6A 4EJUA 1WSUA 3IP5A 3O6BB 4ZZDA 2IPNA 3IC7A 4LRQA 1YMUA 4GYIA 2DU9A 2HPHA 1IIBA 4EGYA 3FFTA 5A2QZ 4KIBA 1Z15A 3IKTA 1ZHHA 4U0WA 2XASA 4S04A 1OYWA 2FNAA 2L02A 3E3VA 1FYLA 3HS3A 1SD4A 1U2QA 5FGMA 2ZAYA 5BMZA 3IP6A 1E6LA 4KT5C 3BY6A 5DTEA 1HW1A 3EULA 5CVJA 2QLZA 3ML6A 2E4VA 3NBMA 1EAYA 3HSRA 2WMYA 3OQOA 2IA0A 3I71A 1P4XA 2Z33A 1GXQA 1HEYA 3BDDA 4EYGA 5KQLA 1BVHA 3K2ZA 2FTKE 4I0AA 3ZN0A 2V1XA 5KQPA 3OM1A 4KIFA 4KZKA 5BR1A 3EDCA 2FLKA 4D6YA 5AIPA 1KYZA 1FSHA 2M30A 4NQRA 4OLAA 1IN8A 2VK2A 3SZTA 4U0YA 5TJJA 4PEVA 4TV7A 4YLEA 5JNTA 1D2AA 5A2QK 1PEAA 1LJ9A 3CTPA 2FMFA 1W7PD 4F06A 2FNPA 1Z25A 2YX4A 3OLVA 1B1BA 3IP9A 2O6GE 2FEPA 1J5YA 4MQVA 5D5WB 2F2EA 1XGSA 2RQPA 2P7CB 3C3MA 2DW4A 1U2PA 1TQIA 4G7OF 1HXDA 3C3KA 3M9AA 1ZRDA 4HF0A 1XSXA 1D5VA 4FE7A 5BOXA 4EJTA 2CHEA 3BREA 2A6EF 4EM1A 4HYEA 1ON2A 2PMUA 2M45A 2PI0A 4XRFA 2A9OA 2FN9A 3HUUA 4PGHA 3S99A 2H3HA 3BJOA 5JI6A 4DNCA 1IRFA 1YG2A 2E7XA 2CWDA 1RZRA 2P9HA 2PJUA 2L18A 4A0YA 4LB6B 1ISRA 3NRVA 4M71A 4IF4A 2Y0MA 3L09A 1PDNC 1RUOA 3H6GA 3T8YA 1UHMA 3KCCA 3HSEA 2NRAC 1OKRA 2K4JA 4Z99A 1ZAYA 1JBEA 3VNAA 4EM0B 3MZHA 1BI2A 2CD7A 4RV5A 1L0OC 4KQCA 4LK0F 5HLIA 2B4AA 2QR3A 2X0LA 4P1ZA 3QRFF 5LLQA 1XD7A 2R7DA 4EQQA 2M5WA 5IC5A 4EYKA 2VE8A 3J7AO 4UV9A 1I6XA 3VFZA 5HQJA 3LFTA 4Q6WA 2Q2EA 3URMA 2WTEA 4UHTA 3WU0A 4FX4A 1XMKA 2P5KA 3I58A 2X4HA 3FXUA 3B73A 2Q8KA 2L2QA 3H92A 3PFIA 4OU0A 1XGOA 3CLOA 3WTZA 2IPLA 2FQXA 2G7HA 3JS5A 2ZNYA 1P6RA 2QZ8A 1YW8A 2PJPA 4I7HA 1XSDA 2BV6A 4I98B 3KG2A 3KYJB 1BA2A 1MDMB 3ROUA 3F6OA 4UUVA 4OOIA 5JFRA 3PQKA 4OIRF 3E6DA 3RVMA 2JPBA 1CYEA 3SZPA 4RB2C 4WZZA 2E1NA 2PMHA 1BIAA 4ZPJA 3R6SA 5ED4A 2GI4A 4G6QA 2V1UA 2FOKA 5EEHA 1YIOA 3A0RB 3GLXA 4ZYEA 1O3SA 4TLMB 1B4AA 4P5OA 2MSWA 3CUQA 4M9SA 3HTUA 1G4DA 1WQ2A 2FEWB 4N47A 2MYPA 4LE1A 3SY8A 2R3SA 5E8IA 2E1CA 4O1IA 4NCBA 1FNNA 3KP6A 1Z13A 4F11A 2P8TA 5BPDA 1DDNA 3U1DA 1UFMA 2A61A 4KFCA 3QAHA 4NHJA 5TPWA 2LP4Y 3RDIA 2L17A 3R61A 3WTTC 3F22A 2QM3A 5GQSA 2BGCA 3SM9A 3KEQA 2XAJA 2HS5A 2LSOA 2FEKA 3HOTA 4LDZA 2FLWA 4YO7A 4MS3B 1QPZA 3KZZA 4YFXF 2WWYA 1K78A 3KFWX 2VBYA 1DCKA 3RQIA 1FYMA 2DK8A 4IVNA 1DCMA 1NXPA 1T0FA 3M9WA 3E97A 4KNYA 2VONA 3KS9A 2K4BA 1MD0A 3C18A 4N0QA 1EFAA 3RI4A 1SRRA 7ABPA 4IXAA 1PNTA 3P9IA 3ULQB 1Z05A 3ABTA 3LTEA 2KIMA 3BPXA 4RSMA 1FBSA 3CJNA 3ECOA 1CGPA 2X7XA 1MB3A 4Y13A 4RB1A 3RPUA 1Z2DA 3ECHA 1S29A 3HSFA 4P9FA 3DPLC 1HKSA 4MEXF 5HDKA 4M88A 4N41A 1T98A 3W6JB 2JVIA 5K1YA 2M1ZA 3CLKA 2QBYB 4JA2A 2LUOA 4QYWA 1U0SY 2BYVE 1JYFA 2RJNA 1FFWA 4D6XA 2K02A 1A0OA 1APBA 3SNKA 4N0PA 2HGCA 4LLLA 1F1ZA 3I5UA 4L5IA 2DPUA 4LDAA 3FF5A 1OR7A 1T6SA 2E4UA 4RGXA 3LQRA 3HUGA 1TQMA 3CHYA 3RKXA 3KSMA 4Z2YA 2ZMEA 4AWXB 4MR8B 1DBWA 1YVUA 3ISPA 4OG2A 5TE9A 3G1WA 1LJLA 2NS0A 4G97A 4ON0A 2KJBA 3KP5A 4I2OA 1LEBA 2PE5A 4F3TA 3T8TA 1D3YA 3V7RA 1ZYRF 4CBVA 4IHSA 3O1HB 4UNOA 4L0ZB 2ESHA 3WU1B 3HM9A 1BAPA 1R00A 2PUAA 1SFXA 3KKEA 1KQ0A 1U5TC 1DCFA 3WTXC 3LUHA 1ODDA 4MEYF 1RXIA 1NXSA 4L4UA 2QVCA 1J2XA 1QP4A 4RY8A 2MYUA 1E6KA 3WTYC 4IRXA 3LUDA 4YCSA 1J59A 3CS3A 4ENJA 1QBJA 3JAMK 1UB9A 2H09A 3LUKA 4L5JA 3HV2A 4MTEA 1JL3A 2ELHA 4WX9A 1VLZA 2DAOA 3HTSB 1SD7A 2AYXA 3NQOA 3G85A 3FX3A 1WKMA 3NEUA 3I0TA 4GCVA 3RKWA 3GA5A 4PCQA 4TLLB 3DPTA 1BBYA 1XCVA 4MQFA 3OOPA 3GX4X 1G6NA 3LAPA 3BWGA 1K68A 3F6VA 4LLNA 4U0VA 2UXXA 2VXZA 3RVKA 3HHHA 2CWEA 4MQEA 1ZH4A 2NT3A 5D6FA 3N75A 1U8RA 1U5TA 3GO5A 4XLNF 4ETMA 5FD5A 5KK1A 2ADUA 5I4CA 1ZN2A 3HOSA 1SD6A 4IMIB 2JPCA 1MDMA 4MLCA 4GYGA 1R5HA 1R1VA 3MFKA 3HDVA 1DJMA 2HFHA 2XAQA 3FWEA 5HOOA 4ASNA 3TDUC 5D8KB 4M72A 1LDJA 3RKYA 1LBIA 2UZKA 5BRAA 2V0NA 1PEYA 3BP8A 4HX8A 2PLYA 2HJ9A 3ZMDA 4XASA 1Z17A 3EJWA 1SFUA 1GHCA 1WRJA 4HA8A 1USGA 2PL9A 3JVIA 1RPJA 3GF2A 1WETA 3O2PE 4Q4ZF 3L6UA 5KVRA 4RB0A 3GVAA 2STWA 5FBKA 2UXNA 2XIGA 5JNRA 3F8BA 3WE3A 1EWTA 3ROTA 4EJWA 1FZPB 3IPCA 1Z18A 3NNDA 1T39A 1YK1A 3T1BA 5K5RA 4KA4A 4KN7X 1E2BA 4P9UA 2VOOA 4YR7A 2RV8A 4BH9A 1OXKB 1XGMA 4N0BA 2MYNA 1CHNA 2PL1A 2PUDA 4LG0A 3LUGA 3O3KA 4W5NA 1D5WA 5F1RA 2CYYA 2A69F 5IUJC 4LZLA 1PP8F 2MA3A 3TGNA 3BBLA 4HNQA 1QQBA 3L00A 5JHUA 4RZSA 1IN4A 1ZH5A 1JFVA 2HTJA 4WCGA 4FB4A 1R58A 2XAHA 5E17F 3RVQA 3LUFA 4MYRA 2FQ3A 1C0WA 2XROA 1OYIA 2YHAA 1H9TA 1MB0A 4H3KB 1I5ZA 2R25B 1SMYF 3DQVC 3DLBA 1ZHFA 4O6JA 5EEGA 3W9SA 4WWCA 3M9XA 1QNTA 2D1VA 2UWMA 5CVIA 5TQ2A 4A12A 2ZKZA 3FGZA 3WTVC 2IA1A 3SG0A 1LNWA 2V1DA 4H3HB 4UVBA 1ZAOA 2MBFA 3HRSA 1I1SA 4WXMA 3E5UA 1WI9A 1SXGA 1TTYA 3WODF 3BRQA 2GA2A 1B6AA 4TMYA 1GCAA 5LRSA 3KP7A 6CHYA 1ZGZA 4L18B 2ISZA 1XB4A 4HX7A 2RGVA 1XCBA 4RGSA 2YSRA 5E18F 1U8TA 1S7OA 3V8KA 2ZJ2A 2L01A 1SD5A 5DYMA 5D5VB 1P6QA 2P6TA 4RS8A 4EVQA 3MEXA 2EV0A 1EH8A 1QO0D 1D1PA 1BJAA 4HLYA 3HZHA 1SFEA 1EH6A 4HV5A 1W5TA 1URPA 1K6OA 1KYWA 1UCRA 3E5QA 3NHZA 5JNUA 3CUQB 2GX6A 3H6HA 2DTRA 3RPQA 2OBPA 1S8NA 2E4XA 3V7SA 4U7DA 1F51E 1P4WA 1BC8C 3DP7A 3R0AA 4OLBA 2H27A 2K86A 1FOKA 4PGGA 3ELKA 1P6UA 1FBUA 2NUBA 3I59A 2ZBKA 3TOBA 3Q7SA 2EFNA 4G94A 1T38A 3LAJA 1FLIA 5ILSA 3H1FA 5TPWB 1BDHA 4YV7A 4MS4A 3GXOA 3M8EA 1PP7U 5E8GA 1DRJA 4ML3A 2AXLA 3LUCA 1IAWA 2IP2A 3MAJA 2HYGD 3IDOA 1JGSA 3P9KA 5BPIA 4KICA 1RZRD 3HDGA 2AS5F 1Z2EA 4MHGA 4AIKA 1K78B 5JS2A 5BQTA 4OIOF 4NCAA 1SXIA 1TNSA 3C7JA 4HBLA 2GBPA 5LGNA 3JY6A 4M6YA 1UHWA 2BE5F 4R79A 3KLOA 4E7PA 4ENMA 1GUDA 4MQ9F 1JYEA 1SMTA 1ZH2A 3CDHA 4QPJC 2GAUA 3QP5A 3WTWC 3VNBA 1ZRCA 4B09A 1ZRFA 5E1ZB 4CYDA 1HSJA 1V3FA 5DUKA 4LJZF 2COMA 1ULYA 1FSEA 3I53A 1R1TA 4U7BA 4EVRA 3W6KB 3QU6A 3GYHX 1ZLJA 5KC9A 1TMYA 4R8HA 1ZLKA 2NZUG 4MNUA 4HQEA 2EFQA 1W4MA 5IT9Z 2D1HA 3QU3A 5CVRA 4ETIA 3DEUA 4IRGA 2O3FA 2VN2A 4ZYHA 1Q1HA 1IN6A 3I45A 2CSOA 5DLEA 3K0LA 4WXDA 3G73A 3M7GA 2E7WA 4I0BA 3TX6A 2V6CA 4OIPF 3WE2A 2ZMEB 5DCFA 5FB2A 1Z12A 3A0UA 4W5RA 5K5QA 3F8NA 3Q41A 2CO5A 5L3GA 2JZYA 3EUHA 2QV0A 4UHKA 5HLGA 1CF7B 1LK0A 3OLXA 3CKMA 2GZWA 3BPVA 2Z5UA 4MR9A 1J75A 4AIJA 4G8XA 3LOPA 4YFKF 2JB9A 5FO5A 3RVLA 2GXGA 1L3LA 3H5WA 4EJVA 3DF8A 5IT9K 2HSGA 2PFBA 2LF7A 2HZTA 1BN5A 4N9IA 4ENNA 3MIZA 1YW9A 4EJOA 3JPWA 3ZMTA 2ISYA 2FBHA 3GFIA 2VODA 2WY2D 3MWMA 5CVUA 1CEYA 3IWZA 5E3JA 3E61A 2WJWA 4CXFA 1LQ1A 2FE3A 3G3ZA 3LSTA 1DBPA 3DV8A 4G86A 4N03A 1Z1DA 5D2CA 5D6EA 5EWJA 2EA2A 4K2EA 2FVYA 4MQFB 1XHEA 3O1JC 2M87A 4HNSA 4WXEA 4OMYA 1ZGGA 3KTOA 1ZG3A 3NNSA 3N0WA 3TO9A 4I02A 1W9HA 2FQWA 4Z9BA 2OZ6A 1ZITA 4JBAA 4MQEB 3QK7A 1W25A 1HSTA 2IVMA 1U5TB 4A5MA 2IT0A 1B59A 4EVIA 4IJAA 3QX8A 4EMSA 4ESJA 3QX9A 3F6PA 5ICCA 1STZA 1LB2A 2GKGA 2A5YB 2VUIB 5IEBA 4L9TA 4CZZA 2FSWA 3OV8A 5J6XA 2PUEA 2DI3A 4A0XA 4YWHA 3UKJA 5T3YA 4IGAA 2MLKA 2F5EA 3VODA 2LNBA 5L3CA 1O3TA 2WB4A 2KIFA 1I1GA 4AIHA 5ERIA 5IBQA 2ESNA 2FN8A 1U2WA 1NXXA 1P8AA 2FW0A 2JRLA 4JP1A 1Z7UA 3FZVA 3M8FA 4AD9A 3F72A 2FU4A 1JXSA 4IHTA 2STTA 3N0XA 1ZESA 4UV8A 1ONVA 1YO5C 3KYIB 4ZYGA 1GVJA 2J5OA 2VUHB 1JFSA 4G9YA 2B0LA 5JNSA 4LG0B 2CHFA 3HCWA 5TPZA 4LLGF 3LA3A 1MGTA 3I4PA 3LA7A 1DC7A 4HW0A 2VBXA 2A68F 2EA4A 3CRNA 4MAAA 5JR3A 3LUAA 3EODA 4XFKA 3T6KA 3KJXA 4F12A 1Z6RA 4KK4A 1VKRA 4MRMB 2RDPA 5JVTA 2NNYA 2F5FA 3QELA 3KLNA 4RKRA 1KU2A 4ESFA 2WC2A 2HEOA 1QKKA 5FWXA 2QQ9A 4Z4EA 3S2WA 2FSPA 1ZGAA 4Q5SF 3Q7TA 2QSJA 3RVRA 5F64A 3MA0A 1KQ9A 5HS8A 3A3KA 2EB7A 3ZMZA 2DT5A 3EQZA 1KMIY 5TQ2B 3QOPA 4MPTA 1RZ4A 1JX6A 1C4WA 3LKBA 2E4YA 3Q7RA 4KV7A 4KN4X 4XLPF 3T8RA 1F4VA 1IF1A 2K27A 1L5ZA 2KYRA 3IPAA 4ZYLA 3GEZA 3JAMZ 2XHKA 2HOEA 1XWWA 1YQAA 1QZYA 1IUYA 3QEMA 2Q5CA 3F3XA 4PDKA 4NQWA 5DUIA 5L3EA 3EYIA 4OIQF 3DXJF 4I01A 2VOPA 2RN7A 1CF7A 4KIGA 3L49A 4ZJPA 3O2QB 1G3YA 3UK0A 4CDGA 3D02A 2H94A 2MSLA 2EWNA 2YHBA 3HVRA 5JNVA 3CFYA 5FWYB 2CQKA 1DP4A 5H6QA 4RS3A 4G0MA 3I5AA 2KJCA 3F21A 3ZMVA 4TN5A 5D4RA 4JB0A 1U78A 3COAC 1AOYA 1S7AA 4O1HA 3OQNA 2A9QA 3O74A 5CNJA 4OINF 2LBPA 3ILHA 5KQGA 3K9TA 4N9HA 4WT7A 3GZ5A 4M6XA 3VEPA 1BC7C 2M8EA 5AIQA 1FWZA 1U04A 5FD6A 2TMYA 3I59B 4D74A 2W25A 2RKHA 5FFXA 2ZFWA 2JVKA 1E2XA 3EQ2A 3C1DA 5KC8A 4A5NA 4MS4B 3F8FA 4IMJB 5ICFA 5J8FA 1ZARA 2M1BA 2M98A 1LJUA 4EUKA 2D2WA 3I42A 3E6CC 4KQ9A 4GXOA 4LE2A 3FDFA 2W85A 3REOA 5ILVA 4MS1A 3WTUC 1YMVA 1D4ZA 3BROA 4EGSA 2PUBA 1PHRA 1U3EM 3HSYA 2MH9A 2IA2A 1QNLA 3B02A 4L9JA 3SHFA 2JSCA 3TOAA 3SXYA 4O5VA 2GWRA 2Z9OA 4RGUA 3TO7A 4HX4A 2A3SA 4Y15A 5ICGA 3DGFC 4HV6A 4NB5A 2OQGA 5DCMA 1FFSA 3H1GA 1P92A 4UVAA 4S05A 1NXTA 2I6FA 2JTVA 2RNJA 3J80K 3RVNA 2DK5A 4KMFA 3CG4A 2O03A 3V8LA 2EFPA 2HKOA 4GNRA 1TLHB 2FF4A 3QLVC 2IJLA 3L7WA 2L54A 3JSPA 1DUXC 4UHJA 3TMYA 4LK1F 1K79A 3NHMA 2L19A 1BI0A 4Q6BA 2JBAB 3CZ5A 2OA4A 5KWSA 2O0YA 3CO7C 3EQLF 3R4KA 2QVGA 1OPCA 5HLHA 4OATA 1JHFA 3RTRA 1TJYA 2FMYA 3CTAA 3K1NA 2JK1A 1EWVA 2HQOA 3Q15C 2IKSA 1XGNA 1YS6A 4BAYA 1Z9CA 2O61A 2NAZA 4RK4A 3R0JA 3Q9SA 2EJRA 2HQBA 1TVMA 4MR9B 4G6DA 2JCGA 1TW3A 1JHZA 3GZ6A 3QLUC 4LFUA 2YU3A 4E7OA 4OTZA 4WWHA 4XAQA 3HRTA 5KQMA 1Y0UA 2P5VA 2V9VA 3MMNA 3GFJA 2PUGA 1WWXA 3H3UA 4MRMA 1J56A 3ROFA 2DRIA 2PN6A 1JF8A 5H6RA 2OAZA 1A2OA 2J48A 3FMQA 4PZ0A 2RC4A 3QLVA 4D0PA 3FM5A 1USIA 4RXMA 3GL9A 1JHHA 2WV0A 1H9GA 4RK0A 5L3BA 3N4MA 4HF1A 2PAFA 2QWWA 5D5XB 2R47A 3E5XA 2CG4A 1FBQA 1S6LA 4A0ZA 2MYTA 2W57A 5L3FA 1M2EA 4AVPA 3D0SA 1NHAA 5EWJB 5JS1A 3F23A 4IRHA 3D5LA 5IT3A 1B00A 4M73A 3P7NA 4KK3A 1KQ8A 3I64A 4ZYDA 3FXQA 4RY9A 4M9ZA 4BXUA 3M6MD 2H6CA 1J0RA 3HEBA 2PMCA 3F8MA 2P4UA 4KVFA 3MM4A 1TLFA 1XMAA 2E4ZA 3QLUA 1R8JA 4RXUA 4P55A 3JTGA 4PICA 4XSZF 2LKPA 2QENA 5TQJA 4YIIA 1QMPA 2XUBA 5B3JC 2MLGA 3IRRA 1DP7P 1XDUA 2Y75A 4JASB 3N97A 3GUDA 2GIVA 4ESBA 1M5TA 5FWYA 1D8KA 2F5CA 2LDUA 4IPAA 1R1UA 3HRMA 3H75A 4KPYA 1O7LA 1AWCA 3RH0A 4LGWA 3GBPA 2YR2A 4H60A 3QPTA 4L9NA 4Z0NA 2NYXA 3HHGA 3QEKA 8ABPA 2FMKA 4EV0A 2RVCA 1NXVA 1MAVA 2XAGA 1K66A 2Q0OA 4Z4FA 3KP4A 5LBQA 3UUGA 1NXWA 1OMIA 3ZMSA 2P4WA 2JRTA 1BM9A 3TO5A 4HZFA 2WRZA 5FLXZ 5LHHA 2KIUA 3K1MA 1SAXA 4PYRA 2ID9A 4DQ2A 2AYZA 3O1IC 3NNNA 3O2SB 1BDIA 5B3JA 2IPQX 1IXRC 1W5SA 2IPAB 1SXHA 1HKQA 3K1PA 3EAFA 1J9IA 1JDPA 3H3ZA 3I54A 4YP9A 5E20A 3KE2A 2QQBA 3TO6A 2IDMA 5LHGA 4GO1A 3SQNA 5EWLA 3V4GA 4A6DA 1YTYA 1I27A 1XN7A 5HKOA 2A6HF 3OMXA 3QELB 4M9XA 2GQQA 1LVAA 4RXTA 1NATA 4O5AA 1F4KA 1JFTA 1OXBB 3J81K 4WXCA 2C6YA 3A10A 5FWXB 3TB6A 2QVOA 1JWLA 2QQAA 5CJ9A 4G0YA 2CW0F 2N9UA 3R60A 2DLLA 1BDJA 1QPMA 1VTNC 1MJ9A 2G9WA 2PQ8A 3GFMA 3V7CA 2VC0A 2OZUA 5D5UB 2L3DA 3ERED 3TD9A 4A6EA 1GLGA 5FLXK 5TQ0A 4R1HA 4CICA 4P98A 1Z16A 1O3RA 4MR7A 3HRUA 1XDSA 3ZQ7A 4RK5A 2H6BA 5D8LB 3T5XA 3JTEA 1FP1D 3FFWA 4G0QA 1HW5A 4RU1A 1R7JA 1DRKA 2ZXJA 1ISSA 2JBAA 1QO0A 1DC8A 1O57A 3KETA 3LMKA 4XSXF 2IOYA 3QEMB 4ENKA 1TNTA 4I09A 3GWZA 4G0XA 3E6MA 3TKYA 3F8CA 4W5OA 2PLNA 1R5GA 3BRSA 2PUFA 1X3UA 3OMWA 4YS6A 2Z3YA 2W24A 5HM6A 3N53A 3T0YA 1KA8A 2VC1A 2P5LC 2RGYA 4BYYA 4ETNA 2BBYA 1R23A 4ZH4F 2Z99A 1MJAA 4XBFA 2IPMA 5HDNA 2DBBA 4JQFA 3LA2A 2VE9A 2A9PA 4RWEA 2MSKA 5LRRA 1YFHA 4O3MA 2EV5A 4CO8A 2NT4A 3K69A 1FP2A 1AB6A 5CYVA 2IYNA 2ZO4A 2HYFA 3I09A 3HK2A 2QXYA 2HTSA 1ZGJA 1RUNA 3GYBA 3CUOA 5BQ3A 3M1EA 3MZYA 3JPYA 4QICA 3CO6C 1LDDA 1RNLA 2ZNZA 1JLKA 2NNNA 3H5TA 4G0OA 3RVJA 2PKXA 3N8IA 4EGZA 3QPHA 2L4MA 4ZMRA 4FX0A 4RAZA 3LFKA 4OMZA 3IRQA 3JVDA 4W5QA 4H0EA 1XHFA 3KCNA 2R7FA 4L9VA 4RK7A 5TPZD 2EFWA 1YK0A 2ACJA 2F8TA 1USTA 1QZZA 3DZDA 3ZMUA 5C5CA 1EHCA 1AB5A 3EDPA 1VPWA 4JAVC 4MS1B 4YG2F 1V4RA 1G3WA 1HKTA 3CUQC 2XKOA 4M74A 4EVSA 4L0YB 4NICA 1MIHA 1O7FA 1W7PA 3F7NA 3GW2A 2A9RA 3CG0A 4YIFA 1ZVVA 3KZYA 4DADA 4RKQA 1TW2A 5EWMA 2G7UA 3BJ6A 1IN5A 1UDRA 3KP3A 3WGIA 2CGPA 4Q7EA 2OQRA 2IRFG 3HXMA 4LD5A 2OU2A 5DCMB 2EV6A 3IP7A 4HOBA 4YFNF 1PUEE 5ICEA 3WGHA 2FBIA 6PAXA 1QGPA 5ILUA 3H5LA 2PEXA 4F7ZA 2HDCA 2E4WA 4WF2A 5DGCA 1ABEA 3JTHA 1DPUA 4JB2A 2XDYA 3L2CA 1YLFA 2IW5A 4BHCA 4KREA 3JW4A 3CNBA 3P9YA 2O8XA 3HJFA 1JH9A 3RVPA 1MKMA 2W42A 1F9NA 2GA1A 5GOTA 1R36A 3TQNA 3IKVA 3VB2A 5CNIA 2MD5A 1TM2A 2O20A 5HSGA 3L9FA 5HVQC 3T95A 5ABPA 3FHZA 3KEOA 5LGTA 4NV3A 3WG9A 3ILYA 2OENG 1JE8A 1I3CA 1RI7A 3K4HA 2FKAA 4PE5B 2HQRA 2K7LA 2VBWA 3OO1A 1QQAA 4EM2A 1KU7A 4KYWA 5FFZA 3FFXA 3JSOA 4HNRA 3O21A 3B2NA 1F5TA 2XKPA 2DO7A 4E70A 4MLDA 3GT7A 1RIOH 3RYRA 3SFZA 1FC3A 2NZVG 3CZCA 5LEJA 1NXOA 1J7KA 4HAMA 1A04A 2MH2A 3DLHA 4DQDA 4UXNA 3MYYA 4LMYA 4YGXB 5DEQA 3U2RA 4KRFA 4MGRA 4UVCA 4B8XA 2FA5A 5C5EA 5IEJA 1YW7A 1ABFA 5DCLA 2FRHA 5AONA 2F5DA 3HO1A 4HQMA 1B9NA 3IWFA 2BGGA 1K7AA 2DQLA 2XVCA 3QLTA 2P7VB 2DFIA 6ABPA 1JDNA 1KRWA 2PUCA 5F6FA 1BI3A 2WWVD 4ZMSA 4BHPA 1S3JA 3EETA 2F8SA 1T2KA 2HR3A 1MVOA 3H5OA 4G0PA 5IX8A 1IN7A 2VT2A 1LBHA 4BQAA 3WGGA 1M5UA 1BI1A 3C97A 4FHTA 2R48A 3TDZC 3O75A 1IZ1A 1E17A 2YX7A 1IRGA 2QZJA 1MJBA 5IUKC 2VT3A 2RDMA 1IW7F 3IL2A 3Q9VA 4JOQA 1HW2A 1FYKA 4MTDA 1FFGA 4EYOA 3KP2A 3GBVA 1BOAA 3PQJA 5JNWA 4QLCU 2LPMA 1KU3A 4QYMA 2HQNA 4KDPA 4PZJA 4OBBA 2MC3A 4HF2A 1Y1LA 2QW1A 5D4SA 5BRJA 3H1EA 4KMUX 3H5IA 5CVVA 5FBHA 1P4AA 5PNTA 1TQPA 4Z4IA 3FMSA 3OM0A 1O3QA 4WK8F 1EV7A 3DBIA 3EYYA 1DPRA 2FQYA 4WUTA 1ZG1A 3HYIA 4Z4HA 3J80Z 3DFGA 4CHUA 1QP7A 1FY7A 1FSPA 3E3MA 1QQIA 3LQQA 4N76A 3ABUA 1FQWA 2FMIA 4HDVA 1E6MA 1P2FA 3ZN1A 1ZY2A 5DD4A 1T34A 5LHIA 2ZWMA 1ZREA 3AAFA 3IHUA 2QU7A 1ZG5A 1DBQA 4BNCA 5EWLB 3LKVA 1Z91A 5CLSA 1OYYA 4GGGA 5CNKA 1IXSB 2KKOA 4F8JA 1GCGA 3FMVA 3MCZA 3RIRA 3OLZA 1LEAA 2W84A 2D45A 4MGEA 2FBKA 4LX8A 4IILA 3KHTA 1FT9A 2FMLA 2JT1A 3RVOA 2JVJA 4Y17A 2P6SA 5DD8A 2VYCA 3O2JA 4RK6A 4KUMA 3SAJA 1EWKA 9ABPA 5TQ0B 1GXPA 4P96A 4G7ZF 4Q47A 1HQCA 2R4QA 5CNMA 4RB3C 4MR7B 4IRIA 5T7BA 2XGXA 1H0MA 5DDGA 3C6QA 1LDKB 4BHBA 4YRZA 5E1WA 1YYVA 4L85A 5DKFA 2DQRA 1ZDMA 4JK1X 4RGRA 3DKWA 2OD5A 3FM3A 4ETSA 4XARA 1MZBA 5E1XA 1NY5A 3MF4A 3BJAA 1XSVA 1FPQA 4FT8A 4LE0A 5H20A 3MQ4A 2FXIA 3OLWA 4QWQA 1USSA 2EK5A 4EY3A 4GPAA 4Q48A 3Q5FA 2HWVA 4U88A 5HS7A 4FE4A 4WXHA 3FXRA 4RAYA 2FEZA 2L4AA 2XRNA 1NTRA 4G7HF 2FMHA 2PBIA 2J5PA 1BIBA 3FMRA 3F73A 4RK1A 3BOQA 1DZ3A 1H9CA 2LF8A 4XXHA 3N6VA 2V79A 1DG9A 1IXCA 4MS3A 3LWFA 5CHYA 1C0EA 5IUNC 3WTSC 1G3TA 3LUJA 5HDGA 5L3DA 4Z4GA 3D8UA 2B1JA 3E6BA 5J8CA 5LGUA 2H0AA 3T38A 5HS9A 3BZ6A 1REPC 2TDXA 4Z4CA 4RDCA 2DPDA 5DV5A 3BILA 1KRXA 3OO0A 2WJAA 4Y9TA 3MQ0A 1EH7A 1TBXA 5TRDA 1Z26A 4G0ZA 1YS7A 4HLXA 4HDUA 2YPRA 2ZCWA 3F6CA 3GV0A 4RY0A 4Z9AA 1KGSA 1D1QA 3DGEC 5LEKA 1W7PB 4DN6A 1G3SA 4LB5A 2QBYA 1U6GA 1PUXA 1PNRA 1Z6TA 4A2UA 2KRFA 3GFLA 2RJOA 1R22A 5EWMB 1D8JA 3CU5A 3K9CA 3H5VA 1B9MA 3ZPLA 1M2FA 3RVSA 1VRVA 4XLTA 1USKA 2XV4S 4CGZA 2A07F 2ETHA 3HIFA 3OQMA 3V8JA 4W5TA 2EFOA 4EYQA 3EGCA 2LIVA 4MR8A 2QUFA 2GXBA 1QP0A 2FXAA 1GUBA 2HKXA 1ON1A 2Y48A 3C3WA 2QYOA 1RXEA 2ID7A 3HUTA 2VBZA 1YTUA 3J81Z
chains in the Genus database with same CATH superfamily
1MAAA 4Y2XA 3P4UA 3TVYA 4FASD 1CUFA 3FKJA 4KC0A 2OWEA 2X76A 5IULC 2X9VA 5L7YA 1LBTA 1I36A 2WTMA 5KKNB 3IC7A 4BO1A 3PS9A 2P8JA 4GYIA 3EQ7A 2YMQA 1XIVA 1ZHHA 3SC6A 5DTDA 1C0IA 2D2FA 3NAQA 2QTLA 5IDQA 2M6LA 5E4JA 2HQAA 3EULA 1C81A 1FTNA 2PU7A 2HJVA 2QMZA 5CITA 2E4VA 5K20A 5FL7D 2WMYA 2R1TB 4DLAA 4LJSA 3VSBA 1G4AE 1NR1A 2FP4A 4XWWA 3TP3A 4LJKA 4D6YA 1B16A 2GXQA 1RAFA 1RYYA 4U0YA 2WV1A 3TTUA 4PEVA 1D2AA 4LYAA 3CTPA 1QB8A 1B0PA 4OJQA 2HIMA 3E70C 3X3HA 3P2JA 3DTYA 4G7OF 4HF0A 1XSXA 3B9RA 2KMLA 1NG1A 1SC6A 3NOXA 1N2ZA 3WLTA 4M0LA 5CIWA 3S99A 1DUVG 3LWZA 3CXUA 2GGSA 3V1KA 1YONA 2PJUA 5J1YA 1FFYA 2PH5A 2WHRA 1BHQ1 2CD9A 3OWHA 2VDUE 3L09A 1X3WB 4BZZA 4Q7KA 1UHMA 5FXMA 1YWGO 4DV6B 1XQWA 3HYRA 1XPRA 3UK7A 2J33A 3O2NA 4K8RB 3PQ2A 5EIWA 2G3YA 2G9NA 1VI6A 3P26A 4TYWA 4P5EA 4DBZA 1P2TA 2P6UA 5HKLA 2AFRA 4DCNA 3B3GA 4H2DA 3AL2A 3NRJA 4D79A 4EP1A 2X4HA 3DNFA 2Z3VA 4I50A 1HT1E 4J2TA 3WLQA 1P6RA 2QZ8A 5FOWA 1N2IA 1R6VA 5EMMA 1J1IA 4JEHA 3OZVA 221PA 1ZAKA 4IV8A 1ELOA 2IYQA 3EXG2 5P21A 3F6OA 4OOIA 4E2XA 1KZHA 2WU1A 4RB2C 2X6YA 1H8AC 3R6SA 4ANJA 2V1UA 4CYCA 4KN5A 2BEUA 2A5DA 4BJ5C 4B3BA 2FEWB 5I6DA 3DONA 3KP6A 2JKVA 4H27A 3AIMA 4WHMA 4C4XA 1XVVA 4RABA 3GEHA 3KEQA 5F2NA 4IQ4A 2G5TA 3Q3VA 5DN9A 4WKGA 4Q1CA 4LDZA 4Q4JA 4MVJP 3T3MB 4PYOA 5KYTA 4R5HA 2HBYA 2XWPA 4PU0A 1H66A 4I55A 1SIOA 1JPUA 5KYYB 3DEWA 2M4KA 5HBRA 5F7ZA 4QARA 7ABPA 3SJBA 3HCCA 1U8UA 1DO0A 3ECOA 1MB3A 4CKEB 1TF2A 1NN0A 1Y80A 3EUFA 4HVTA 5LBIA 4N41A 2JVIA 1X1AA 4JA2A 5CDYA 1FFWA 2K02A 3UAYA 3MJRA 2XMQA 3S2FA 3DEKA 4W1UA 2B20A 3DEJA 4I9FA 3TI9A 3D4PA 4AWXB 2HCJB 3HQ4O 4F3TA 4BWYA 2VKDA 4NX2A 4JODA 1UBSB 4D7AA 2D06A 3ZWMA 4EX6A 2XB6A 1R4NA 3WBFA 2D8AA 3SIRA 5JROA 2IL1A 4Z1OA 4L4UA 2BF4A 4IZZA 3J80A 1I7NA 4IIGA 1NH3A 4J0HA 2AE2A 4NC8A 3RRZA 4NU5A 3REQA 4Q37A 1C7FA 1P0QA 5IBCA 4YT4A 3VHXB 3VSAA 2A58A 1P5FA 1Z0JA 3INNA 3FX3A 1WE2A 3K1YA 3GMTA 2HVSA 4CG0A 1E2HA 1DEHA 4ED9A 1VSUA 3QEAZ 2NVTJ 3HHHA 5KYNA 3WSWA 2D1RA 1U8RA 3MWEA 2AQIA 5KK1A 2LIPA 2DPHA 4Y8VA 3HOSA 3WGMA 3HDVA 5KHAA 1QDUA 2A78A 5CW1A 5HFNA 3RRNA 2NO9A 2UZ4A 1CZOA 2HJ9A 3CW9A 3MLAA 1I13A 1N2BA 4XN0A 4Q4ZF 1LFDB 3JYNA 5C7LO 4M2LA 3DVLA 3FNIA 3HGYA 4UCQA 1ZGWA 4DUGA 1IUPA 4RFSB 2ASEA 3NPAA 3PM1A 1ADGA 1C2YA 1V7ZA 4FT4A 4P9UA 3S3TA 1WO8A 3IAS1 3G8BA 1I2MA 4MAFA 3R40A 3IHLA 5C34B 1VRCA 4L16A 1IN4A 3Q2OA 1VPLA 1QRSA 4MTCA 2HTJA 4WOKA 2IC5A 3AY3A 4QTTB 2IYSA 4R2JA 2IHTA 1VG1A 3TKLA 2HLDA 1Y42X 2O5CA 3BMQA 4UPDA 4MYHA 3L8YA 1RJWA 3VZPA 2R25B 4PF1A 1SMYF 3ER6A 4KW7A 4XD7D 1BD4A 2LMDA 4Q1BA 1MIOB 3DWFA 3PX7A 3LE8A 4PFSA 2C5LA 5FKNA 2O3JA 3HRSA 1TTYA 2FJ0A 4ND7A 4KUEA 4DLLA 1JDVA 2Q4DA 3FNRA 2EFYA 5M04A 2AHRA 3CUWA 1T36A 4EYSA 4H4DA 4WUVA 2HZDA 1UPUA 3TZEA 4UD2A 1U8TA 1A35A 1PLKA 1ZN9A 2CMKA 1PL8A 4DLUA 4ZTBA 4TX1A 1RI2A 3AZQA 4ND8A 4NBUA 1WDWB 4H18A 2GSDA 4HQKA 1JG6A 2CFIA 1ISIA 4UTZA 4RHYA 1HDYA 3RS9A 3DUFA 5JNUA 4DG8A 5DM70 4PQFA 1PZMA 2QZ4A 2QG4A 3MK31 5ED0A 1LDMA 4N9WA 3ROGA 4J0DA 5GPAA 4FHFA 3U4AA 2IEGA 3UV7A 2YWFA 3SBXA 2BDUA 1U7PA 1X70A 3PLNA 1WHTB 1WRBA 1WSWA 1JVBA 4GI2A 2OV3A 2HEIA 3MSCA 4PFJA 3N8HA 2H5JA 1ZNWA 2ZAOA 5EPUA 4CF6A 3GHHA 2FMXA 3NV9A 1VSQA 4DZJA 3QVWA 4YJDA 3FW1A 4HWKA 4UUOA 3R7WB 4U6NA 3EUHC 1OI7A 5J2TF 3S8YA 3WTWC 3WP0A 4YCMA 5CDSA 5JYEA 4HUTA 2DA2A 5ULLA 2FW1A 1R0KA 1M1NB 2JFXA 1BOFA 3RD5A 3H3JA 3M4OJ 5FULA 1NM5C 5FFMA 2WICA 1YF3A 4BWVA 1SCBA 5JH7B 2FH5B 5CD1A 2UXDB 1EBBA 3RYHA 2WR8A 3OX2A 2RARA 4RZUA 5DLEA 4N01A 1ZVKA 3K0LA 1QZ3A 3HUGB 2AN4A 1LQ2A 3WE2A 1SUBA 4NS1A 5EZ6B 1LLQA 1NSFA 1P7VA 2PX9A 4CM5A 1MUUA 1QRAA 4JUIA 1SUDA 4MVYA 2DFLA 4PQYA 1IDOA 1TTQB 3LOPA 4QUBA 3W9UA 5AVQA 2VT6A 4JLOA 2JJ1D 2DERA 3JRFA 3VPRA 1WVGA 2YW2A 3L2RA 2BP7A 3HCBA 3TPCA 2IZ6A 2OFXA 3HEAA 4QLOA 2V3WA 1NA5A 2VNJA 1W75A 2HZTA 1ND5A 4ENNA 1M74A 3T4EA 4Q3AA 2WY2D 4R5MA 3LBAA 2CLKB 1JN0A 1W4CA 4OB8A 3I2FA 2FE3A 1KK0A 1X14A 1Y7IA 1GLNA 3PENA 4X60A 1ETUA 3JX9A 1DDGA 1QU3A 4KVGA 5BUQA 2Y9YA 3A2MA 1AKTA 5LP6C 5IN4A 4BUPA 3T9AA 2A0XA 4W9MC 5ALQA 1T2FA 3UV3A 3B9QA 2H65A 1NUPA 3SPXA 3LZCA 2PBFA 3IT1A 3S28A 3GRRA 3H1AA 5C9ZA 1UT8A 3QX8A 4ESJA 3F6PA 2B21A 3ZNPA 3OIWA 1F2UA 4BKOA 2GKGA 1E4OA 1ZJYA 4P2BA 2X8JA 4LJ6A 2HGSA 1L5FA 3TEMA 1I1GA 4C05A 4HMPA 4DJFC 1CY8A 1SKMA 1QRYA 1YL5A 3N0XA 1ZESA 1Q16A 4WK2B 4REMA 5IHXA 4IFTA 5B3AA 4N54A 3F0CA 1YRAA 4WZAE 3QUSA 4PNZA 2ZSHA 3TDMA 1KK3A 3DMDA 1KMCA 1KJZA 2IHYA 4GR9A 2YXDA 5ALIA 2C2YA 2WAOA 1FRZA 3KJEA 3KLNA 4HS9A 3C3DA 2DTXA 3NIFB 4QDUA 3P0JA 4PCAA 2DMPA 4B3MB 3ZCXA 1H1LA 4NBLA 3DMHA 3VSDA 2JLCA 3QENA 3M4XA 3IODA 1JX6A 3TK1A 1P61B 3K8QA 1ACJA 4FHDA 3QA3E 4O63O 4ARAA 4AZ0A 2ZTHA 2G1JA 4EELA 3II6X 4D3ZA 5L40A 2HOEA 5JAUA 3B6EA 1LSSA 2Z2KA 3U40A 1A71A 1DQUA 3A0HC 4NDZA 4Q1DA 1SY7A 4TTSA 5CYFA 4ZJPA 2B3TA 3X2FA 2WU4A 3TZLA 4XWGA 2WUGA 2Q6LA 2JA7J 1QA6A 4YALA 2J0VA 4OQYA 4UM8B 5JZOA 3VBEA 3RSNA 1W4ZA 5CX4A 3OQNA 1XAIA 4EAAA 1GFZA 3DB1A 3V34A 1N8TA 2P9EA 1TM4E 3L5OA 1YZQA 3FRIA 4L8WB 5KC8A 2PCJA 4D0LB 3O8DA 3PF8A 2QOEA 4BY7J 2D2WA 1XN1A 3I42A 1RQGA 1E7QA 3HBFA 2IUTA 4EGSA 3OPMA 3RIGA 1G63A 1WD7A 3HSYA 3JQQA 2Z8XA 5AHRA 3JAKA 1E3SA 1OW3B 1NPDA 2A3SA 4HV6A 2DA4A 1FFCA 3TLKA 1S8OA 2FFHA 4UVAA 1LI5A 3WKDA 3OPNA 1TLHB 4WTOA 1RC8A 2WUFA 1DUXC 1E9FA 4MYTA 3IP4B 3WB2A 1PJ2A 4K0RA 3NV7A 3O03A 5TT0A 4HGPA 4IDCA 2H48A 4Y9SA 3GNSA 4PGFA 3N2ZB 2NP6A 3KVYA 1Z36A 2O8VA 1ODCA 4U3JB 1SM4A 2VDVE 4PQGA 5JIBA 1V11B 1X9HA 2PZ8A 4WWHA 1Y0UA 1TGYA 2WYHA 3MWLA 4Q12A 5IWCA 4ILKA 4AZ3B 1ZC4A 1KEUA 2XWQA 4QFMA 2QB5A 1V0JA 5HJ2A 1LFAA 2PWZA 5FORA 4M73A 3AM1A 3WVNA 3AJ9A 3K4BA 1SFKA 1TIPA 2P4UA 3S5UA 5ENZA 3QLUA 3GDGA 4FYYA 2WJYA 3SKXA 1LB1B 2EPFA 3H99A 4KN9S 3R41A 2JGLA 2E49A 4BBPA 4FGUA 1BX3A 2Z08A 3QFTA 1XDUA 3G68A 4HXGA 1D0VA 3FMOB 3NHUA 1R88A 2PZKA 1VE6A 4RMJA 1SIWA 1U2SA 2Z09A 1XMSA 3MVEA 1UK8A 4MUNA 1QG6A 4L8GA 5KOIA 4ARUA 3DW1X 3N2GB 4BIIA 4AY2A 1LLCA 1K66A 5L4NA 1FNMA 1YKFA 4JH0A 3MTQA 3S8PA 3KZNA 2QAGB 1QK3A 4RJLA 4GGPA 3AV0B 5LHHA 2YHUA 3YASA 3I6BA 4PIPA 5AHXA 4KO1S 1W5SA 3VOSA 4E7LA 2X9DA 2BMEA 5LZ9A 3W5UA 1UZAA 2ACKA 3AWIA 3TO6A 3FCYA 1JKPC 1KY5A 1PGPA 4KR2A 1FDTA 5BY2A 2WMDA 5DYIA 1SEUA 5HK9A 3H8JA 2RI1A 3GCMA 4NEGA 2OG2A 1SAYA 1CY1A 3S15J 2VHWA 3NC0C 2ADFA 2L42A 1MRNA 3TQHA 4YV1A 3UNGC 2K7FA 2ZT8A 1Z16A 5LDHA 5BN3A 3E0XA 1AKHA 4MP3A 4CMAA 5AKXA 5EZQA 3JYPA 1R7JA 3QXHA 2RHDA 1AU9A 4XSXF 1ZQ1A 4I6EA 3AHDA 4UXHA 1XZAA 1RJ9B 3RNLA 1P75A 1KA8A 3UJ8A 5J2TA 2QW8A 4AY3A 3IJPA 1ATIA 5AKZA 3BR5A 1O95D 4RWEA 5LRRA 4CPDA 1GNLA 4HB3A 2BONA 1ZA1A 1W5AA 1LNQA 1FP2A 3K72B 2A1TR 4V2IA 2H4HA 1U2DA 1KSHA 1M75A 1JI0A 4II2A 1RYNA 4IDDA 3CA8A 4QG7A 1V1RA 4RAZA 2LYCA 4H0EA 2QRZA 4ISBA 1Q0PA 2RGCA 1Q7CA 1V3UA 3L46A 3GEGA 2XAAA 3BWVA 3LBYA 4A93J 5BT9A 1EEHA 2E85A 2A9RA 3L40A 5G2OA 1WKBA 5AK5A 1F0YA 5D5HA 2EEPA 3K94A 3T15A 3NEAA 1PW7A 2PVCA 1NVGA 3CGGA 5ILUA 3H5LA 4EPVA 1RHRA 4DMCA 2H2HA 3LC2O 3O92A 3SU8A 1QUFA 2EGHA 4HDSA 4C9YA 2GPNA 2BY1A 1JH9A 4M0PA 2XGOA 3FFBA 5BW8A 4R1QA 3I37X 2CNLA 4JLJA 3OPXA 4KWTA 1VPVA 3PXAA 3KQQA 1SKQA 3ACCA 1UFRA 4KFSA 1BKDR 3CLRC 4KFUA 2BN4A 4R98A 3TVTA 4JGGA 4R51A 3OTIA 2AFIE 4REOA 3KWJA 1GVHA 4RA6A 4EHLA 4KP7A 5FAKA 4XH9B 3G23A 3K4CA 3FYUC 3SC2A 1VHDA 4KEAA 1L0BA 2GLUA 3RAEC 2AFHE 3BMCB 2FA5A 3W1EA 3EUEA 4D6PA 4HDQB 3TE7A 3AEYA 2FRHA 1YI2I 1UAGA 3IWFA 4HADA 2XVCA 2OD2A 2QY9A 3ZBTA 1A2QA 4AQ7A 5JXGA 4BHPA 3OSGA 1UL1X 2HR3A 4HG2A 1MVOA 3MYRA 2HADA 4G0PA 4OHFA 1BI1A 3GQVA 3CVJA 3TDZC 1OJ7A 3V8PA 1J00A 3LZ6A 4DYDA 1YFKA 1DNPA 3IBTA 4N3CA 2XQVA 3HYNA 5KTMA 4FW8A 4KDPA 2WAQA 1X8JA 3VU9B 1Y1LA 2V7WA 3RB8A 4WBNB 4U2CA 3ITEA 3BR2A 2V3VA 4IUDS 1WF3A 5JWHA 3OTOB 3FMSA 4WK8F 1Y4AE 4LTNA 4B3GA 1MN6A 5IAKA 3IAHA 4IUCS 4XYMA 3W78A 3E3MA 3LQQA 1ETKA 3QBDA 2AC7A 4ZVRA 3H83A 3TTSA 4WW0A 4GGGA 5CNKA 3JVEA 3BF7A 1I94B 3IC5A 5DYWA 3M3PA 2WDPA 2ZYDA 3GELA 2D45A 1QHGA 2J0QA 5C8YF 4D9FA 1Y82A 5C35A 5K3AA 3WNVA 4AJ9A 4YJGB 1HG0A 4R41A 2VYCA 1YFLA 1YASA 1G4HA 2WYWA 1G3QA 1QYCA 3QVSA 4BDYA 4LGYA 2OCLA 4XOPA 2ZS9A 1ORKA 3L1JA 1ZDMA 2GZRA 3CF6R 1LBEA 3NHPA 3PVSA 4ZO8A 1PJTA 2WHPB 1OFUX 4EHFA 5SICE 2BGUA 5JZ9A 3FXRA 3AUFA 2IDZA 2IA5A 5JLJA 3WYDA 3TSWA 2V4MA 2JFZA 2PBIA 1BIBA 1P62B 3Q0TA 2HNBA 3NWBA 1GQSA 1I4EB 1IXCA 5AM0A 2ODQA 2ZJ4A 4V0RA 1X7YA 4RMIA 3PV0A 3EZNA 4CF7A 2NZ2A 3IIJA 3E6BA 5J8CA 2F1IA 3K9HA 3RRBA 3KPJA 1Q0ZA 3M5PA 2EP8A 5BV0A 1WLSA 4PXYA 1QHYA 2PS9A 1ZH6A 4BPRA 1KGSA 4XPIA 4RSRA 2FD5A 3K4PA 3FBGA 5DB4A 1TOAA 3KT3A 1DQPA 3AVXA 1TMKA 1J22A 3WGZA 1D8JA 5HS4A 1DKOA 3WADA 5L95A 4I99A 3ZWOA 3OQMA 10MHA 4OREX 4GRIA 1Y3DE 2BZ1A 2C5EA 2LIVA 4IS2A 2EIMH 1YDEA 1HDXA 4O25A 3VZDA 4L9SA 3MCAA 4CF3A 1HK7A 1BX0A 4OHCA 3C6BA 3PO2J 3G2MA 2EJUA 3JRIA 3NRCA 3MJDA 4DIFA 1AU7A 4PYKA 1FIUA 2CHGA 3DF7A 1I4DD 5BQFA 3JRAA 5DTQA 4ZC8A 4AMYA 4NOLA 2R5ZB 3WRYA 4XLFA 4AO7A 5BS6A 4HXYA 1UBFA 1VQ9I 4YTEA 4Q0MA 2HPHA 1G2OA 1FYLA 4II7A 3PQ6A 1U2QA 3WNBA 2CZGA 4FM9A 4HBGA 1P0FA 2WPNA 2WTXA 3JQ9A 1WH5A 4HNVA 3EEQA 3OX4A 1T0BA 4PLYA 2FTKE 5EINA 3I39X 4OMDA 3OOEA 1EVYA 2RHLA 5EEAA 2M30A 4ZK6A 3SZTA 2OY0A 2XYQA 4NDAA 5A06A 4JK3A 4EFLA 4HLCA 2C1XA 2GD2A 3DTNA 5GINE 4JX8A 1QMGA 3SQLA 2YX4A 3IP3A 2O6GE 4H7PA 2E82A 4ZT6A 4I4TA 4M8NE 2ZWVA 3LBNA 1CS0B 1ZR4A 2CUFA 3OE7D 1MJFA 3KB6A 4HYEA 2HO4A 2QAJA 1U31A 3HUUA 1WABA 3OT5A 5EF6A 1O54A 2QTWB 4DNCA 2HI3A 5K8UA 2GA8A 1DIGA 3X2SA 4ZALA 3ESCA 1PDNC 3ELYA 5FTLA 5CPFA 4EATA 1RUOA 5ALKA 1IHXA 3FI9A 1OKRA 2COKA 4IAOA 1AZSC 2WUVA 2QZ9A 3KEMA 5KOJB 2QGNA 4C6TB 3OQBA 1AKYA 1BO6A 2YVLA 3IMFA 4P3XA 5LLQA 1FCJA 5FOUA 5B66C 1ADCA 4J2HA 4YBRA 4UV9A 4DAEA 4UAVA 1T8SA 5HQJA 2R7OA 4C2AA 4RZXA 1X1SA 4LNUB 1RRPA 1Z4MA 1V5IA 3U7RA 2FZEA 4HDNA 3KEYA 2IPLA 1V6SA 4A23A 2XA9A 1MTOA 5H0IA 3URKA 3ESZA 4DV4B 1J70A 1BA2A 2F4IA 2HQ5A 4MWEA 4QL3A 1GQRA 4IICA 4ZQGA 5FYDA 4F2GA 2ODEA 1Y8RA 4PC7A 4E08A 2DWOA 5ED4A 4F93B 2JJ1A 3KJIA 3JASB 2PA3A 2QJOA 1JDBB 1ODSA 3ZGVA 4GG1A 4KQFA 2VRWA 3DLPX 4MJ7A 4AKGA 2E1CA 4O1IA 4BEVA 4BO9A 4QD3A 4LJ7A 4UBKA 1DDNA 2WF5A 2A61A 4JJIA 3LWDA 2JLAA 4RADA 2L17A 1Z37A 2VJ4A 5DHRA 1Q95A 2GBYA 3FOAA 3LUPA 1RMTA 1BCSA 4MUJA 3QOEA 3KLMX 1SELA 4C3HJ 1JHOA 1NTCA 1R2QA 2AMVA 5IAEA 1NJ6A 3KRTA 4FFLA 3D7KA 2K4BA 1JALA 5BSMA 1MD0A 2HCTA 1SRRA 3QV2A 4QBKA 3LTEA 1YRYE 2FOIA 3ZQJA 2JMWA 1U99A 1Z2DA 2OB1A 3KYLA 1IXZA 4B48A 2ZRCA 4US2R 3OIPA 3DPLC 4MEXF 4W1RA 4DR2B 3FB1A 5K1YA 3DFMA 4BP8A 2M1ZA 3C3BA 1JYFA 1NBIA 1A3CA 4XVUA 2ZVQX 2Z57A 3AIOA 3O4HA 4A3IJ 3CCMI 1B0ZA 1P1JA 1PBNA 2GHTA 4BXOA 1E2GA 1CQJB 1EK5A 3WHCA 3KZCA 2Z9CA 3LCJA 5D3ZA 3KQSA 2OXFA 2HDHA 3CC4I 3C3CA 1STOA 5E1OA 2HAEA 5B4TA 2O8DB 3FBIB 2H4FA 1FTGA 3HM9A 3QVKA 1NRIA 1U5TC 2DETA 3G2LA 1NXSA 3E22A 1QP4A 2XSZA 2VKTA 3D4OA 1UC9A 3WTYC 1XRLA 1J59A 4K40A 1SC7A 3DL7A 1Z8NA 4R7TA 4L5JA 3PIDA 1KQNA 3GFGA 5DT2A 1YL7A 1SXJC 4V2GA 1NE7A 3RKWA 4W99A 1KH1A 4HP8A 3ZY3A 3WLKX 3F3SA 3H5RA 3OOPA 2E2JJ 3UB2A 4MUGA 1G6NA 1VE1A 1XJ0A 5A7GA 2ZTSA 4Z9XA 4K81B 2O52A 2G0NA 1ZH4A 3DYBA 4BECA 3EZ2A 3D1LA 3GUZA 4O4IF 4NU6A 3SBDA 3SSAA 4DT1B 5T4HA 3UJAA 3LL7A 3NBAA 1Z2OX 3THWB 1RRKA 3NGLA 3K0EA 2HFHA 4N48A 1CQPA 2CK3D 3Q6MA 2XA2A 4BNWA 1HC8A 5I9LA 4PZ9A 4JLSA 2VO1A 2PLWA 1PZFA 4AW9A 4RVNA 3G6KA 4YMIA 3F8WA 1HE8B 4ABTA 1M0EA 3LK6A 2UU9B 3VPBA 1LC3A 2CLIB 4WLEA 4MYDA 1CLUA 3T1BA 1E2BA 4ZCMA 4K6CA 4PC1A 1E1LA 2C4NA 1BW9A 1O97D 5F1RA 5DTRA 1T8YA 4ZYZA 1HQKA 4RZSA 4EECA 3L8CA 1J09A 1FTSA 1JE1A 1M83A 2XROA 4GKBA 3M7IA 1H8HD 3MT8A 1YA8A 4BL5A 5EC8A 2O2JA 3QJGA 3R44A 3H86A 2UUZA 3IUBA 1B8VA 2Y1XA 1LNWA 1F38A 4H3HB 1PJRA 2Q2EB 2A0FA 4PIMA 5HF6A 4XX0B 3TRFA 2Z5VA 3GI1A 3AVWA 1ZCZA 4GWLA 3K4MA 2DWQA 1KMNA 4XM1A 1W0JD 3QBJA 4MRRA 4CEHB 1SD5A 4RTLA 5DBHX 1VMAA 1JWBB 7ADHA 5DMHA 4Q9DA 1H89C 3F6EX 4LMAA 2P40A 1W5TA 1A8QA 3Q0UA 4IIVA 1URPA 4EG0A 3KR0A 3D3QA 1P7ZA 4XKWA 4CLOA 5KYUA 2DTRA 3F5SA 1YZLA 1FFAA 3TJRA 4ZGGA 3GFOA 4ZKDA 5F12A 2VQDA 3JR3A 1P6UA 4AXXA 4ZTJA 3B12A 4Q9NA 4EG4A 4ER3A 1E66A 2B6NA 1WOMA 4IR7A 2AG5A 3R24A 3M8EA 5GZ3A 2WJZB 2WJJA 4UU8A 1PSDA 2XTMA 2WPDD 4L3WA 3BHIA 5JBQA 4EHHA 3E2MA 3V5NA 4X6UA 1PZXA 1TNSA 1D6SA 4W82A 1OLSA 4JFRA 5FWAA 1IVNA 4MMZB 1RMQA 2PM8A 5DW0A 4MQMA 1UBUS 4MV8A 1V3FA 2YXPX 1LGYA 4QEDA 4DLSA 4CNQA 2QYHA 2D4AA 3IUSA 2CUJA 5H68A 4YDHB 2R87A 5DNVA 3E7FA 2NVUB 1Q14A 2NQ2C 2Q5QA 2IBSA 2EL9A 2I03A 4BMDA 4DNFA 5D86A 4IHYA 4FGJA 1F43A 1RJEA 3QF7A 3SCZA 3HCPA 2O8FB 2YN4A 3S14J 2WLTA 1QVUA 3A0UA 2XF7A 2JZYA 2QV0A 4BE4A 1EGMB 4EZBA 4ZGBA 1NX9A 4A8PA 1N6IA 3P4YA 4C4PA 2GCGA 1TK3A 3THYB 1I24A 2P41A 4FDTA 4EJVA 2QRJA 1EX1A 4PN7A 5KZMB 4GSYA 1N2EA 3O8BA 2ZJ5A 3GK3A 3MIZA 3QYEA 1BCRA 4E07A 4EJOA 4WN9A 3T0FA 3KR1A 2EF0A 1DTSA 4RELA 3O82A 1IVYA 1HEIA 1VP3A 4O33A 3LSTA 1JMVA 1C2TA 4MQFB 4BY1J 4OMYA 1ZGGA 2XOKD 1ZG3A 6REQA 1BGVA 4HV4A 4I4LA 2ZRBA 1N6KA 3AF0A 4XKVA 3C45A 4KQ2A 3CLTD 1U9JA 1HSTA 4NXMB 1VG0B 1B59A 3UNXA 1BQ3A 2RIPA 3W5HA 1BZYA 3EMKA 1L8LA 1JHYA 3N28A 4CZZA 2DI3A 3T7DA 2MLKA 3NG1A 1O95A 3MUFA 1WY7A 3VH3A 3GG9A 2LNBA 4RYDA 3MD9A 3O8GA 4D44A 3HI4A 2FUG1 5J43A 3MCVA 3ZY5A 1M1YA 2OYRA 1LDBA 1VLMA 1MIJA 5KNCD 4LV8B 3CWZA 2FB9A 3KQHA 1MBFA 4JELA 4LLGF 1LDNA 5C37A 3SEFA 1V8ZA 4CQLA 1H1TA 1T95A 3SFVA 4ZDPA 1IE3A 3KJHA 5K01A 2QRQA 4GPIB 1JT9A 4MV0A 5IZCA 3ZCPA 3I9MA 4MWCA 4RKRA 3X1MA 3T3GA 1JU3A 4NG4A 2E4AA 1R8YA 3V1LA 3HLYA 5IOZA 4KVAA 1ABBA 2EB7A 2IUSA 2XLBA 1K0UA 3EVNA 4GC5A 3V2GA 4Q3OA 2G07A 5JAIA 3PDHA 3NIWA 4AU1A 3V3KA 4EGJA 3A3PA 2RGNC 2FDRA 2DLCX 4HQFA 5CDFE 4FSDA 1N7HA 1UJ2A 1TZKA 5KOHA 3DXJF 2VOPA 2WKRA 1CF7A 4D80A 2BFDB 2J09A 1L7MA 3KOOA 2CCJA 5F9FA 3A4IA 1A95A 3CMCO 4G12A 2DX7A 5K3DA 1RVDA 3ELUA 1SANA 3GJ4A 2ME0A 2C2KA 3LRXA 4XGKA 3ILHA 2V97A 5KQSA 4FCWA 1RXYA 2QX4A 2TMYA 3OX3A 2P79A 1MG5A 1ODKA 2IUYA 4BCDA 4KOEC 4B0OA 1JMKC 4A5NA 3RPEA 1N5MA 5ICFA 4R3NA 5KYXB 1R0YA 2C4WA 3UWSA 2W00A 4GXOA 1IBRA 2I55A 1PDOA 3BROA 1YHYA 5B58C 3R6LA 1J6UA 2AUMA 4N5IX 1W5BA 1IHOA 2Y2ZA 2VZ0A 5EMKA 1MAHA 3SXYA 3AUYA 2Q1XA 4JU8A 2CLEB 4QDOA 4L2IA 5DCMA 3ZWBA 1BMQA 1FXWF 2BFBA 5B1HA 4I1OA 2I4IA 3NBQA 4BV9A 3OZXA 5D1NA 3LVBA 4Y2SA 2FF4A 3THSA 4CN9A 2XD9A 2JZOA 3Q6IA 1ACIA 3LPLA 1JTEA 4X90A 4BKXA 3OYGA 1UBMS 1E4EA 3NHMA 3H9QA 1JNYA 4NCNA 2OA4A 3PNKA 3K8YA 3QKUA 3KAJA 3ANNA 4O4IA 5BXQC 4K2AA 5IXSA 3WYAA 3KD3A 3LXXA 1RWOA 3GFJA 2P6PA 3H3UA 1K89A 2X6WA 3GJ5A 1BDMA 3NWJA 2G5PA 3C14C 4NHEA 4P80A 1QHXA 1P17A 3AKDA 3QLVA 1XVIA 1VI2A 4UY8I 2QR2A 4YP7A 3TDKA 3OSZA 1KJYA 2Q6VA 4LX0A 1TYZA 4U7PB 5AJTA 1OBCA 4BU1A 1APLC 1NC3A 3L92A 2YBDA 1T43A 2WJHA 2DPLA 3OWTA 3GMDA 5AOCA 2QP4A 2H6CA 3LA8A 4MI1A 1R6TA 1G8YA 4XVRA 1VI0A 4RVUA 1UBHS 3EZFA 3DHNA 2J41A 3NUGA 4CL3A 1RKXA 2B92A 5JSQA 5C44J 3FHTA 1XXHB 3DTVB 4MK4A 4IPAA 4R8VA 4AMGA 3PHLA 3SVTA 3VDXA 1U0HC 4CM8A 2W6MA 3QG5A 2QGFA 3KZMA 5HM8A 5A7HA 4PG6A 3ZG6A 4JLAA 3ROZA 3QPTA 1JP7A 1JG4A 3ZDDA 4Z0NA 5EPEA 3HNOA 1JHQA 4MX8A 1NXVA 3TGWA 3NVAA 5F35A 3BMOB 5IP6A 1VL0A 1BM9A 1VRWA 5GP9A 4DSOA 5KKCA 2I10A 2G9UA 4CCAA 2WWGA 1Z6GA 2I6GA 5G40A 4ESHA 4OIMA 2QAIA 4PSUA 2PKQP 4GZLA 1Z38A 4X7PA 3IH3A 3CLVA 3QELB 1P60A 5FV4A 2C9OA 2DJ5A 4QRDA 4KAJA 1BWRA 1T5BA 2DLLA 1UUFA 4YI5A 4MO9A 1BDJA 2GTHA 2KPOA 2KPMA 3N70A 2Y2UA 5B7QA 3BL6A 4KUHA 5JLWA 3EXHC 4DM7A 4GAEA 4MGIR 3TZBA 2H6BA 5D8LB 2XKJE 3Q5DA 3EIHA 2QX7A 3JALB 4G0QA 3L0YA 3PIOF 4I1YA 1O57A 2JDID 5EJMA 2GHIA 3M0EA 4JUFA 1LK5A 2VK8A 4YRLA 4P36A 4DA0A 4NMWA 2Z99A 2VJPA 4PVCA 1HNWB 5GAJA 3FNBA 1MNQA 4MUFA 1W85A 2IU0A 3CLHA 4MQ5A 2JGAA 2ACEA 1YHQI 3S2ZA 4LHVA 3A01B 4NENB 5DXFA 3GYBA 1N3BA 3AGPA 3JQAD 2ZNZA 1JLKA 1XLTA 2OT3B 4YDSA 4K87A 5EP4A 3X1DA 2AV6A 2VJIA 2NU8A 2Y1FA 3A03A 3KCNA 3VYUB 3JQPA 4XCVA 4OF4A 3F46A 3BMNB 4JLNA 4N65A 2VF5X 1V4RA 1G3WA 4IIFA 2XKOA 4TKZA 5J3LA 3L7OA 1Z4IA 3NTLA 4R0VA 2W2XA 3KP3A 4Q7EA 4TV9B 2FWNA 2X7HA 1KRHA 3IS3A 3EMDA 2VHEA 2XXBA 4YFNF 3FZQA 5EE0A 1IY9A 2EZKA 3OE7A 2N8GA 3BB3A 4P7JA 4NYMR 2K4MA 4DV7B 1P33A 4NBKA 5CFLA 1R8SA 2MD5A 4NFLA 1L7AA 1HLGA 4OM7A 5JMTA 4ZEXA 5EI5A 1I3CA 1GKYA 1QIGA 3MKYB 3L7JA 3T5MA 3EPZA 3FFXA 2PX3A 2P9QA 5HCNA 4IQFA 2I1WA 4IIJA 2HX1A 3AQIA 1J7KA 2UZAA 4GYYA 1VFNA 5GWXA 4LWZA 2IKQA 4NRDA 3UW3A 4DBQA 5K1ZA 2VRBA 1GZ4A 4ZANA 2W4IA 1QSGA 3SQWA 2IX3A 4JKYA 1SZJG 4IJ6A 3B82A 3LSJA 5C32A 3R6WA 2C1ZA 4U63A 3RIMA 2QLFA 4LY3A 4NYJR 1W52X 3L8EA 1AGYA 1P5ZB 3ZWVA 3H5OA 1M5UA 2BMAA 4CJXA 2ZI3A 2I3GA 3O75A 2W98A 2C57A 1E17A 2IPOA 4E5YA 3KPYA 5ADHA 1LUAA 5DRTA 3KFXA 2WE7A 4MTDA 5I45A 4DOZA 4JBYA 3T3IA 4OBBA 2E2HJ 3VNQA 3CZMA 1FRNA 4IP0A 1IQPA 2XB0X 1XU7A 3NDBB 3W8EA 2VC2B 3ZS8A 1AK1A 4BCCA 1A76A 1Z5GA 4ZO6A 4UQPA 3OL4A 3A2KA 3OIUA 5LPNA 3OM0A 4HPXB 1EQ2A 1C7JA 2D3TA 2QMEA 3L4JA 3LX8A 3TNYA 3ASYA 1U28A 1FUKA 4KR3A 4JVSB 4X63A 2FHPA 5BSWA 4NCHA 2OLEA 5JXHA 2P1RA 4CCSA 4RGBA 1Z91A 5ER9A 1YZYA 5IRCD 3RC8A 2REQA 3SI7A 2DP4E 1LEAA 3HGMA 4A15A 2KQRA 2FBKA 1CULC 5TY0A 3KHTA 4KMOA 2Z43A 2PG3A 3DQQA 1RKBA 4D8TA 5TF0A 1HQCA 1OBHA 5B3LA 1YTLA 4EO9A 4EBFA 1XC5A 1EJ2A 5E1WA 2RHGB 4CR8A 2SCUB 4MAMA 2ZRIA 3D1JA 2HV8A 4ICIA 2Q3MA 1XMPA 3OZFA 2P9CA 4Z53A 4AMVA 3LO8A 1O94D 3IH2A 3U3DA 3D8TA 1CYDA 3FUCA 4US1R 4IQ8A 3ZK7A 3N2KA 3ZHQA 1OGIA 1TZBA 1Y33E 4PO9A 5ERXA 1RBQA 2XF8A 2R7SA 2R65A 4XYLA 1B73A 3VYSB 2DKOA 2R6ZA 3BOQA 4X1KA 1FXWA 5HDQA 3E5NA 3G0IA 3OJOA 5LJIA 2QTHA 3QPSA 2DUMA 1G3TA 4U0KA 2YRFA 4BKRA 3BQ9A 4D7MA 2OFOA 1W46A 2AO9A 3D6VA 3GMSA 4DQ0A 3DOUA 4W1PA 1AXRA 4E03A 3MRXA 4IHXA 5T67A 5TRDA 5B7GA 2AXEA 3CNLA 4HLXA 3MTEA 4B6QA 4Z9AA 4URFA 3PX2A 7REQA 1X7ZA 2PANA 3ICWA 3WHPA 4CG1A 2WFAA 4JI8B 1LEHA 3W6PA 2HT6A 4DMKA 1TCVA 3PQ7A 4NABA 3S2DJ 3H2BA 4H1WA 3U4GA 4WX2B 4EJ2A 3IMGA 4D57A 4XEHA 4J6FA 2YY5A 2BHLA 2Y1EA 4DC9A 2CMDA 3BG3A 2IWHA 2VKQA 3TTXA 2JLUA 4E5DA 2YR0A 4CFZA 1BMDA 2XQKA 3ZK9A 5HGJA 2OZLB 4YT2A 3GWGA 1R6DA 3VC7A 4ZQFA 2DH5A 1X9IA 4FFNA 1DAFA 3E23A 5C80A 5F9MA 5KYWA 1H8HA 3I4LA 4IEJA 4GQIA 3U7FB 3IP5A 5MGNA 2XUZA 2PMDA 2LLKA 1KIFA 5SYMA 2O3RA 1QXSA 1PJLA 2P2ZA 2DEUA 5JVDB 4DQXA 4AP6A 2ZB4A 1WXQA 1ESZA 1OH8A 2R6GA 1YE9A 2YXEA 3FLAA 4PJJA 4DQKA 1BN6A 2VWHA 5ECGC 1E6UA 1UWLA 4YRRA 1W0JA 3FTDA 2YV5A 2AL7A 3NVDA 4IOKA 5KQPA 3PX3A 1EUDB 2FLKA 2K3PA 1ONOA 1Q57A 1C8BA 4QREA 4MUAA 3OQHA 3DAYA 4NBSA 3HJUA 1FX1A 2LWIA 4DYRA 4HRIA 1MC4A 1NHWA 4WASA 1R74A 4Z3OA 3DEAA 3PC3A 4AU7A 4Y1EA 4GBJA 5BOXA 2W4MA 4U5QA 3CCEI 2H31A 4Q4HA 3R8FA 3K2BA 3F7TA 2IXFA 1DT5A 3DE4X 1OPRA 3OJCA 2FF7A 2WM3A 3IELA 1ZOOA 1RWWA 1QJ4A 3G17A 4MA4A 4PLCA 2H1IA 1ZAYA 4ZCTA 1FA9A 4PHCA 4EM0B 3MZHA 1L0OC 1SCJA 1N9ZA 1IL0A 3B9BA 3ZE8A 5AK3A 4OFXA 4ER6A 2M5WA 3B3AA 1C7QA 4POOA 2KJQA 4UTXA 4ON9A 4UAGA 2XAUA 1G291 4L5BA 2P5KA 1UXJA 1QUEA 2L2QA 1E18A 1XGOA 2G7HA 2LV8A 4HCJA 4X45A 4WXYB 4F38A 1WB9A 3LXMA 4GP7A 1QHIA 2NG1A 4F5EA 4LJYA 5JFRA 3LI2A 4OXKA 3PSHA 2I1VB 4GOXA 2SECE 5EEHA 1O6CA 1BA3A 3WG7H 5HIMA 2YUTA 3MTAA 3QFFA 3JWHA 2HW8A 1YB7A 1R0ZA 1B4AA 2V6EA 4M7WA 3FHJA 3ZE6A 2HIHA 5G4KA 2V5VA 4B74A 4KQEA 4KI0A 2EOAA 1SEVA 1Z13A 1YZUA 2WP0A 1GZDA 4AG5A 1O9GA 3VMFA 4MMYB 2LP4Y 3UJDA 3WTTC 1DIAA 3DBLB 2GJSA 1DAPA 1W581 2XOKA 5L9AA 4MS3B 1CETA 1BR2A 4W1SA 3U39A 1XDGA 4DBVO 3ZWDA 5KNCH 1OWOA 4BRSA 5IJ9A 4FMCB 3O38A 3M9WA 4BQNA 1H5UA 2GAAA 2YFHA 1EFRD 1H4SA 3R76A 3G9UA 2K6GA 3ECHA 4A16A 4BHTA 4LC9A 1M2JA 5G1NA 1VDZA 3RM3A 4L76A 4A3EJ 2CXRA 1XTZA 2O7SA 2LUOA 1GSAA 4NPHA 2G80A 2L69A 5CPRB 3UMFA 1M3SA 4IWXA 2E5ZA 1PX0A 3VUEA 4XW2A 3M81A 1UK9A 1SC4A 1ISMA 2QD4A 1TQMA 3UMRA 1ZD8A 3USES 5KNCA 5ILGA 2ONYA 3A36A 3TZCA 1A97A 4OYHA 4AI6A 1JBKA 1XZ8A 4GWGA 2JA6J 1BXKA 5F1OA 4F46A 4GX0A 1QG2A 3KKEA 3NAZA 3V2UA 4GPD1 1G16A 3LUHA 2JCXA 1P4HA 3V6LA 1XRNA 2GF9A 2MYUA 4JR2A 3CUSA 4B4OA 4EG3A 2J3IA 4ENJA 4XQFA 5BO5A 3JAMK 2AK2A 3OJFA 1DUSA 3DVQX 4BNHA 3OYMA 3L7MA 2JI6A 1UM8A 2H17A 1GSIA 4LF9B 1FU4A 4GCVA 4IFEA 3PWKA 2E2IJ 2YVUA 5C5IA 4FGSA 2ORWA 1L4LA 1L5VA 2PX2A 2QJTA 2C42A 3D5EA 1E0EA 2I6TA 2SKDA 3HKEA 4LYGA 3WMRA 2EZTA 5ALOA 3CJQA 5A1TA 3GZTB 4KN8A 5F5LA 2ADUA 4EH1A 3A6HA 2JPCA 4B3FX 2UAGA 2GCIA 3GLTA 2PS0A 3MJTA 1P3JA 2R7LA 5JSZA 5D8KB 3RKYA 4CG2A 4UHEA 2PUJA 3ZLJA 3EJWA 5TMEA 3B5JA 4DHWA 1HTWA 3WY9A 3GLGE 5KVRA 2STWA 4LIPD 3KQUA 1ZBDA 5AQ1A 3I76A 2DT7B 1I3OA 1OXKB 3EF1A 1GZUA 3FXJA 3IMEA 1E1KA 1KEKA 2A69F 2YHIB 3BBLA 4HNQA 4TWRA 4OHYA 1MO2A 1TEVA 3TR6A 2AG1A 4UAUA 4ACBA 2OFFA 1NQVA 1L1QA 5H9WA 3A7EA 3OIGA 2Y66A 4C07A 4F2DA 5JZSA 4HNAB 1JQKA 4IGIA 1TD1A 3KKKA 1KI6A 3ZE1B 5GAGJ 1U7XA 3EFEA 1VJRA 4E21A 5FPKA 2Z83A 3B48A 1D2EA 5HE9A 5G1OA 1N6LA 2BVNA 1QF6A 2ISZA 2HVQA 4KWEA 3GBSA 2PTHA 3A25A 4RJTA 5K99A 3VJRA 1M2KA 1S7OA 2R7MA 1HO3A 5BSUA 4YQFA 2Y05A 1T4MA 5C8XA 5B3KA 3OQIA 3WLIA 3EXFB 2CJFA 4MWGA 3BC8A 5COAA 3U49A 2G6BA 4ALIA 4JJ4A 2PXAA 1RZVA 1LZKA 5D87A 2ZTUA 3R0AA 1T5DX 2OKCA 4PSVA 3C48A 3GB9A 1BFDA 5FCDA 4L5YA 3QPBA 3DE6X 3GLUA 3ZWWA 1PP7U 4ZCQA 5LNK1 4E7IA 1AN9A 3MAJA 3DR3A 1U7DA 5AUOB 4DQVA 3MBIA 2C96A 3NETA 2C58A 2YJ5A 5AJVB 2X1CA 4PFOA 2I7TA 2J9ZB 4RIIA 5AVTA 3A1YA 4OY3A 5DIZA 2JAUA 4OYRA 1U02A 1HNXB 4NJEA 1NUHA 1LV7A 3CR3C 3B51X 3OI7A 4LF8B 2XZPA 1JIQA 5BMOA 4K9LA 3P9SA 5KC9A 3P27A 4Q1VA 5HZMA 3AZPA 1U0EA 3X0DA 3AR3A 3QU3A 1NVFA 4INPA 4A3BJ 1XEWY 1NQUA 1XCPA 3H4MA 4ZEVA 1KAGA 3PB3A 1KJ8A 4LVCA 4NQWB 5FB2A 3QKRB 4RTJA 1Q0LA 2VP3A 4W5RA 4QJIA 1GV1A 4RQTA 1RE1A 2X1HA 1O5IA 4KE9A 1JVNA 1G9TA 3UMJA 3GJQA 4C4RA 3GD7A 3ANYB 3A28A 4I8XA 3L4BA 2GPWA 3U1KA 2VH1A 5FOXA 3Q9NA 5IT9K 3MLEA 4CKZA 4ISCA 1YR3A 2RAVA 1F06A 4G07A 1CQIB 1U7ZA 1E2KA 1GVDA 2VODA 1NLFA 4L3OA 3I3SR 4EG1A 2XKKA 3TSAA 4TLDA 4ZCIA 2BUCA 1S0UA 5FL7A 2FPIB 2P5TB 3BVPA 4G1UC 4EPXA 4OA8A 5D2CA 3WAKA 4PANA 3EXAA 3GC6A 2XRYA 3PGVA 2O5RA 3RUDA 1LW6E 5IAJA 1SOWA 2HMTA 4I4NA 4MQEB 5EJ5A 4DIQA 2O9LA 4CIBA 4DBRA 4A5MA 2XCUA 2JDIA 3AETB 4XIJA 3VU8A 3WSTA 4RL4A 2NTJA 3QX9A 5C1PA 4ZV7A 4DMRA 5BN4A 1S8FA 3RPUD 1A4RA 1SIUA 2AXPA 2B69A 1X1TA 4HAXA 2VZLA 1KI3A 4R7GA 4C4YA 1S4QA 2HA7A 3FOBA 3B38A 4OAOA 4G1EB 3EEYA 4N6OA 3DS8A 3D2BA 3JARA 3Q2IA 5A0TA 1JXSA 1D5CA 3AUSA 4P5PA 2HJWA 1AKRA 1JHPA 5A9SB 1ZI9A 4UM5A 2D2VA 3GLVA 3A4TA 3QLEA 4HW0A 2DSTA 5AW4A 3OSFA 3CRNA 3F4LA 3EODA 2R6AA 2YRXA 3T3DA 2BHRA 4PBSA 3BZBA 1SK9A 1JJ8C 2JFWA 4F56A 3IQWA 4JI5B 4K1LA 5K8JB 4Q5SF 3DMNA 3NTXA 2W4QA 4OI2A 2XKAA 3ZMZA 3QXCA 2XQGA 2VTEA 3RSCA 3Q8LA 4MW6A 2C84A 1N5OX 3R5HA 4YCDA 3QW2A 3ZZMA 2VJDA 3CNEA 4AM3A 5IKPA 1IHYA 5IPAA 1MX1A 5JD4A 3EPHA 3BTVA 8LDHA 1PVVA 1V5FA 2RGUA 2BFPA 3U0BA 3WGOA 1XXHE 2XSDC 1E2PA 1I7DA 3D02A 2MSLA 1WCIA 2M34A 3AM3A 1J7JA 4BN0A 4JEUA 3OLQA 2HGZA 2IYVA 3FUTA 4JB0A 4QPQA 4ZC1A 2UZ3A 5LWQA 4FFSA 2WNIA 1ETYA 4JLVA 3VEPA 2M8EA 2IEYA 3CQ9A 1MG0A 2Q5OA 1CIVA 1KJWA 4CZ2A 1EDBA 4UHHA 5FFXA 4QO8A 3S7TA 3NALA 1Z2AA 1XX5A 1E2XA 1SCUB 3R6GA 4MS4B 1JZQA 1TKCA 1GUZA 4D4GA 1FFXB 4UHDA 3INRA 2YUSA 1RQPA 3C4VA 1RM0A 5LZ7A 4KQ9A 4B81A 4G9BA 3WTUC 1D4ZA 1EZ1A 1W4RA 4A69C 3WTCA 1PFGA 2IY9A 4WK6A 3B02A 3CT6A 3HL0A 2ALJA 4URUR 4X1IB 2WUEA 4ZVUA 4XKBA 1WB5A 4ZDWA 1GCUA 2OCAA 3HKCB 2RHTA 3FCCA 4I1UA 3RVNA 3IUEA 4E1BA 1YDMA 1QIEA 2JGDB 3O4GA 4DCOA 4B6SA 2ZBQA 3SQOA 1YRLA 3RU2A 4B3CA 1WU8A 2AOXA 1E1QD 1EWVA 2HQOA 3PXXA 4N0MA 1TUBA 4RBNA 2OV2A 1Z9CA 1R16A 1RQLA 2ZK7A 3OPYB 2H1VA 3AF2A 1FSGA 1IPHA 4TS1A 3D4IA 1S2NA 2A92A 3EIFA 3FUXA 5KQMA 5MGBA 2WHQA 2IBDA 1N6RA 1RI4A 2NNLD 1J56A 4YJFA 4FU0A 4WZBA 2IW3A 4MVJD 1JHHA 4DGQA 2NU7B 4RC9A 3FKSD 2HRBA 2XLCA 1NW4A 4RLSA 3FMGA 4GE3A 4NXNB 2XXAB 4GEGA 1FNCA 3M70A 3L79A 3Q12A 2ZRAA 4BXUA 1TE2A 4UDOA 5FHQA 2R6FA 1L1FA 4ZRMA 3HWX1 3PR3A 1OOEA 3DQZA 2UV8A 4P55A 1LDYA 1FX0A 4IWYA 5TQJA 4OK5A 1RBZA 2YIVX 1O94A 4WV3A 4X1YA 2X1MA 2CNNA 1A5ZA 3DD1A 4X6AJ 1Z0KA 3A8TA 4ND3A 3FOZA 3OT1B 3LLCA 2FJ1A 3HWSA 3TOSA 1Y1TA 3O9ZA 2YR2A 2JQ7A 2FE4A 2HT1A 3HHGA 1CRPA 1MPTA 5AKJA 2PZJA 5K8IA 2XAGA 1TU0A 3SYLA 2Q1TA 4Z4FA 2NS8A 3Q8WA 4G1VA 3O8HA 3LA6A 1QKIA 1E2MA 2WRZA 4YECA 4RLHA 2O05A 2NZXA 3QPVA 2CKDA 4P4SB 4AZSA 1KI2A 4IDNA 4XD7A 2BWJA 5C0OE 3OKPA 3H3ZA 1LD3A 3MT9A 4AY4A 1DVRA 1Q7GA 1VA4A 1K3UB 3ZCVA 4WXCA 3CINA 1KDOA 3C6YA 4LBZA 1ZU5A 4O08A 5ECWA 3I52A 1E9AA 2OZUA 2PPLA 1D1TA 2DOFA 3TQIA 1CE8A 5GGXA 2L9VA 4OFZA 2ZUTA 4LZNA 3FFWA 1VA5A 1YT5A 1MFPA 1GKKA 2IOYA 1DC4A 4I1SA 4HI0E 5TLSA 2L9RA 5DLQC 1WPXA 2Y6UA 2VP4A 4WFJA 2QTVA 1U8EA 3KWMA 2BBYA 2C4KA 1OCPA 3D6NB 4NCIA 2IPMA 1T8WA 5CU7A 2A9PA 2YYZA 3ICQB 3H3VK 1D4OA 3FK7A 3DJFA 4GSLA 2RCYA 1S02A 1FMJA 2DFHA 3M1EA 1U65A 4MV5A 1AK9A 1NX6A 4ALMA 2NO0A 1G5IA 3OEWA 2L4MA 1BHJA 1VMDA 4E7ZA 4ARIA 4YAFA 4PIVA 4PBTA 1YK0A 3ZOZA 4RTPA 4POAA 5B57C 1E3WB 2D5VA 4AIRA 1QPIA 4JAVC 4MO2A 1Q2UA 5CT4A 2ECCA 4L0YB 3K15A 4DUPA 3PIIA 3OU6A 4ZVPA 4O4HF 2BFMA 1OVGA 1T8TA 4RKQA 2ZXEA 5DDIP 1T9AA 2PKQO 3LL4A 3I2GA 2B4TO 2WTBA 4JS0A 3DV2A 3BZKA 1B93A 3U31A 4WCFC 2PBLA 3AR5A 1QGPA 1Z7YA 3JTHA 1W29A 4JB2A 1L6RA 3RWBA 4B3RB 4BGIA 1C3OA 3RVPA 1MKMA 1V2GA 4K46A 1HRKA 3HKZA 4ZVLA 1UBJS 4JYBA 5ALZA 1D2NA 1QKJA 1TC3C 3H36A 2H2GA 5BQPA 1VIMA 2Q99A 3C7DB 1EXVA 1QO7A 3PDIA 2VKEA 3ZCOA 3MS4A 4BRZA 3U5TA 2VDRB 2ID6A 4N3GA 2P0AA 1BJRE 2XKPA 3B8EA 3CC7I 3B2QA 4ODIA 1OKKD 2DG2A 5FI3A 3NU1A 2VUUA 2F90A 4DDKA 5H4GA 3D8RA 3ZQGA 3BN3A 5B12A 4AX4A 4KRFA 4MGRA 1H1DA 4WKNA 1G5QA 5EGOB 2OAEA 1N5DA 3J7AC 3SJMA 2R7QA 2BGGA 3KSZO 2DQLA 2ZR0A 5FUMA 3LQKA 4K9DA 4HQOA 3BEOA 2DFIA 3V48A 2DOAA 4I08A 1AX9A 2BY2A 3EETA 5D51S 4UATA 2RBGA 3ZNQA 4DMFA 3KSRA 3C97A 3UAGA 1FFEA 1N0UA 3BWMA 1CZRA 3Q9VA 4K9NA 2IOQA 3E9MA 4KKXB 4GP6A 1FFGA 3LKDA 3LZDA 2LBFB 2I2BA 3ZK8A 4QVGA 5FBWB 4KL8S 5D4SA 5ADVA 5CVVA 4G8CA 1RXWA 1ZRSA 3O8NA 4AJNA 5I48A 3ZQLA 3UT5B 3I9V2 3ONDA 2AUTA 3VX4A 5FROA 2H7YA 4EW2A 5CPBA 1DO2A 1SOMA 1MAUA 3A1UA 4JL6A 1EFRA 2I66A 3SVZA 3PPVA 1XTAA 4CVNA 4I5EA 2YJ3A 2C99A 4DSNA 4D5FA 3TFOA 3MQ2A 1YIJI 3F47A 3KYDB 3MCZA 3OLZA 1RP1A 4NR0A 3BR3A 3D3WB 1GRVA 1Z6XA 4PJMA 1GL7A 3K0AB 6PFKA 2C7PA 1RLOA 5M34A 4F4CA 1WIWA 2P6SA 3UCEA 2R4QA 4RKWA 2VATA 5E7QA 5I9SA 4NMXB