3U1DA

The structure of a protein with a gntr superfamily winged-helix-turn-helix domain from halomicrobium mukohataei.
Total Genus 51
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
51
sequence length
148
structure length
148
Chain Sequence
MATQDRGERPNGFGDELERRRFVLHETRLDVLHQILAQPDGVLSVEELLYRNPDETEANLRYHVDELVDRGIVEKIPVPRAKSVDDPPTTFYAVTGEGIALLRAVSMYEEAAVWRSVYEQMERTDRIEAIENLETRPDVDYESRGATA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Structural genomics, unknown function
molecule keywords uncharacterized protein
publication title The structure of a protein with a GntR superfamily winged-helix-turn-helix domain from Halomicrobium mukohataei.
rcsb
source organism Halomicrobium mukohataei
total genus 51
structure length 148
sequence length 148
chains with identical sequence B
ec nomenclature
pdb deposition date 2011-09-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF12840 HTH_20 Helix-turn-helix domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 3u1dA00
1K78B 2ZCWA 1F9NA 2EFNA 4AIKA 4A0XA 5LGTA 2JRTA 3FX3A 5F6FA 1G6NA 3FXUA 4WXDA 1D8JA 1USSA 3MZHA 3CDHA 2FOKA 2JZYA 2BBYA 4H0EA 4UVAA 1J0RA 2DK8A 2NS0A 1MDMB 3L9FA 2Y48A 1KA8A 1X3UA 3WE3A 2ZNZA 3R4KA 4UNOA 4L5IA 5KVRA 3M9AA 3KE2A 3DQVC 1ZRFA 5IT9Z 1T98A 1EH6A 4KIBA 2IW5A 1MDMA 1S6LA 1HKQA 1LEAA 1EV7A 5IT9K 3J81Z 1BIBA 1U5TC 4OIOF 1SD5A 1ZARA 5EEGA 3LFKA 4U0WA 5E8IA 5J8CA 1XD7A 1U78A 1CGPA 2DT5A 2L02A 2H6CA 3DXJF 4HOBA 1GHCA 1FPQA 4EMSA 2QQ9A 5FFZA 3CO6C 1QZYA 3FMQA 2DO7A 2L01A 1ZG1A 4NHJA 4P9UA 1U5TA 4M9ZA 3QPHA 2LDUA 2XASA 2DU9A 4EVIA 2HEOA 2Q0OA 3G73A 4Q5SF 6PAXA 1QO0D 3KLNA 1ULYA 3WTXC 3SFZA 2WTEA 3K9TA 1PP8F 5JI6A 1ZG3A 2A61A 2M5WA 3T8RA 3EETA 4ETSA 1AWCA 1ZG5A 2K02A 1I1SA 2NAZA 5HDKA 1BN5A 2RDPA 2P5KA 2E1CA 3V7SA 4LK0F 1BOAA 3E6CC 2OAZA 2F5CA 5LHIA 4UHTA 2H6BA 2G9WA 3KLOA 4F7ZA 3RDIA 2F5DA 2OQRA 3GLXA 2DQLA 4D0PA 1ZGAA 5FD6A 1J75A 1F4KA 3O3KA 4GXOA 1JGSA 3O6BB 2QBYA 3RPQA 2Z3YA 4LLNA 2HDCA 1S7AA 4OIRF 2FNAA 1PUEE 2PI0A 1R22A 1MJBA 2ZJ2A 3GYHX 1C0WA 1AOYA 2DI3A 1PDNC 1IW7F 2VOOA 4Y15A 4HZFA 1QPMA 2L4AA 3GX4X 4EJUA 4EJOA 1EH8A 2E1NA 4LMYA 4RAZA 1HBXG 1W7PB 4RB2C 3TO7A 1SFEA 3VOEA 5J8FA 3R61A 2ETHA 3IKTA 1IN5A 1H9GA 2DW4A 1MJAA 1KYWA 1UHMA 4L9VA 1ZRDA 4A0ZA 1IUYA 1IN6A 1PP7U 2STWA 2V1XA 1TLHB 2QVOA 3ECHA 2E7WA 3GXOA 3WTTC 5ERIA 4ZH4F 3HHGA 5CVJA 3KEOA 3M1EA 4BYYA 5J6XA 1WRJA 2IA1A 1H9TA 2FBHA 4IXAA 2PN6A 2P7VB 2DTRA 4HAMA 4L0YB 2O61A 3HRUA 3KP7A 1T0FA 1JXSA 5TRDA 4KNYA 2IPQX 3ULQB 3F6VA 4HDUA 1BC7C 2GXGA 1TNSA 2FF4A 2JPBA 5ICCA 2EV5A 1B1BA 3BOQA 1J7KA 1U3EM 4CYDA 3AAFA 2AXLA 1O57A 3I58A 1H0MA 3DPLC 4BH9A 2LSOA 2QM3A 3CUQB 1J5YA 1FX7A 3IKVA 4CICA 1B9MA 4MTDA 4P96A 3NRVA 2IVMA 1WQ2A 3D0SA 2ZO4A 2WV0A 3ROUA 2Z99A 2ADUA 3Q5FA 4RAYA 5L3EA 2VN2A 3E5QA 4L9NA 1SD6A 1ZREA 2BE5F 2LF8A 1TW2A 4L5JA 1T2KA 2M8EA 1TQPA 3DEUA 4HF0A 4HX4A 1K79A 2LF7A 1KYZA 2UXXA 1YW8A 5H20A 4A6EA 4PGHA 3WTVC 2GWRA 5CVIA 3ABTA 2NNNA 2BGCA 5L3CA 1O3SA 3I71A 2GXBA 1A04A 2FBIA 2MD5A 2VOPA 3U2RA 3J7AO 1F1ZA 3CUOA 1HW2A 2R3SA 2L4MA 1YIOA 3KETA 1SD4A 4HBLA 2QQAA 3WG9A 2OQGA 1HW5A 2NRAC 5LRRA 1R1TA 1KGSA 4OOIA 2PBIA 3GFJA 3COAC 3U9GA 1QQIA 1G3YA 2PMHA 3QAHA 4CZZA 4LG0B 4CXFA 2XHKA 4XSZF 1W5TA 3M8FA 2KIUA 4I2OA 3W6KB 2H94A 5AONA 3JSPA 4M73A 1FSHA 4RGRA 3IL2A 4RB3C 5CYVA 4OMYA 2RQPA 3E6BA 2ZMEA 2ISYA 3BJ6A 1CF7A 3HSFA 3GFMA 4ENJA 2PFBA 4EM2A 4KYWA 1ON2A 3R60A 2XRNA 4IRHA 2MA3A 3JW4A 3IC7A 3ML6A 3I59A 1R1VA 4U7BA 3LQQA 2OZUA 4KUMA 5ICGA 4L9JA 3ECOA 3ZMSA 1XMKA 2HYFA 1OMIA 2X0LA 2NYXA 3F8CA 2VE9A 1WKMA 2YR2A 2DAOA 2MH9A 5HVQC 3P7NA 5HS8A 1U2WA 4WXHA 4ENMA 1RI7A 2C6YA 2CSOA 4G7HF 1KQ0A 1MGTA 3MWMA 3KEQA 1YQAA 2ISZA 3ELKA 4QWQA 2ELHA 4HA8A 3RJPA 2MLGA 4Y17A 2VODA 5CVUA 2W84A 1BJAA 3F3XA 1EH7A 5JHUA 2FA5A 1S7OA 3LA2A 5D4RA 3IRRA 3LQRA 2HTSA 4CHUA 3REOA 5FGMA 2OA4A 5DUKA 1YTYA 2P6TA 1KU9A 4WCGA 1FOKA 4ASNA 1WI9A 4OINF 3EYYA 4HQEA 1JE8A 2XIGA 1JHFA 5E1WA 2HZTA 4BAYA 2IA2A 2VT3A 2MC3A 1XSDA 3QRFF 5DDGA 1YS7A 3LWFA 4RGXA 2XAJA 3C7JA 5LBQA 4M71A 2DPDA 3RYPA 1Z6TA 2Z9OA 1V4RA 3FHZA 3O2PE 1DPUA 2FXAA 4IPAA 1MJ9A 2R7DA 4NB5A 5LGNA 1Z7UA 5BMZA 4GO1A 4R8HA 3I0TA 3VFZA 3FF5A 3B73A 1ODDA 4KT5C 1GXQA 4E70A 1ZHFA 2DPUA 2A3SA 4KA4A 5E20A 2FRHA 3GVAA 4UUVA 2EFOA 4O6JA 2FBKA 5DD8A 2ZXJA 3IWFA 3F21A 4I7HA 4WX9A 1U5TB 1ON1A 3HSEA 3Q9SA 1FT9A 3TO9A 4ESFA 4MQ9F 3J81K 1O3RA 3PQKA 3MCZA 4I02A 2RV8A 2HR3A 2EFQA 3WTZA 3EQLF 1P4AA 2DLLA 3I54A 3GZ5A 2XGXA 1P4WA 4A6DA 4AWXB 3LSTA 2XKPA 4U88A 1GVJA 4OIPF 1IZ1A 2K4JA 2VBZA 5FD5A 3EUHA 1UHWA 4HDVA 1TTYA 2P7CB 2CGPA 2G7HA 5K5RA 2Q8KA 4KFCA 1K6OA 5DD4A 1Q1HA 5ILUA 2Y75A 4S05A 1DUXC 4HF2A 3KFWX 2Z33A 2QZ8A 3HTUA 3F72A 4DQ2A 1W4MA 3F8MA 1SMTA 3FMRA 3BDDA 2QBYB 3GFIA 3T1BA 4GYIA 1QNTA 1IAWA 3NQOA 1BIAA 3ZQ7A 2FE3A 2ZFWA 5BPDA 3WU1B 2D1HA 3WE2A 1FBUA 2PJPA 1I27A 5EEHA 3R6SA 1LEBA 1W7PD 2UXNA 4L9TA 3LAJA 3TKYA 3KP2A 2VE8A 3L7WA 1LJ9A 3K69A 1G4DA 1RUNA 5DEQA 3MZYA 3KP4A 3DPTA 2A6HF 3HUGA 3OV8A 5DYMA 3E97A 1YW9A 1OYYA 1Z6RA 1U8RA 3QP5A 2CG4A 4IHSA 3SZPA 1UCRA 1P92A 4KIFA 3WTWC 5LLQA 4EJTA 2PEXA 2HTJA 2VXZA 3FXQA 1YYVA 5LHHA 3C18A 2CQKA 2GIVA 3S2WA 4B8XA 3SZTA 3RI4A 2W25A 2ESHA 1FSEA 4N9HA 5H6RA 5D6FA 1G3WA 1KQ9A 2XKOA 3V7RA 4XBFA 4EJVA 3HSRA 3FXRA 2K4BA 5BPIA 1KU7A 4I98B 4ZZDA 3VEPA 2HS5A 3RIRA 1L3LA 1XDSA 3TQNA 1SMYF 2VONA 4BQAA 3KZZA 4BNCA 1S3JA 3F23A 1P2FA 2KJCA 5HDGA 1IN4A 2DQRA 3E3VA 3I64A 3F6OA 4PCQA 4HYEA 1FBSA 5DCFA 1BBYA 1B4AA 4EV0A 4XRFA 2ACJA 2IRFG 4M9SA 2XROA 2IP2A 2CFXA 5E18F 1XGOA 4OU0A 5CVRA 1SD7A 4FX0A 1ZH5A 2IT0A 4YFNF 4RGUA 4AIJA 4HV6A 3TO6A 3QOPA 1YW7A 1BI0A 2RNJA 4GYGA 4A0YA 2YX4A 1HKTA 1FC3A 1REPC 5DUIA 1XCBA 1XSVA 3GO5A 4IVNA 4TV7A 1UB9A 2OU2A 3R0JA 2HOEA 2K7LA 3P9CA 2RVCA 4BHPA 2MH2A 4GCVA 1E17A 2UWMA 1ZLKA 4WWCA 4BHCA 4S04A 3SHFA 2P5LC 1B59A 2HQRA 3T5XA 2PG4A 4ZYEA 2W57A 3PFIA 4FHTA 3EDPA 1R36A 2VBYA 4IF4A 5BQTA 1VTNC 2KKOA 3JSOA 2HFHA 1T38A 5D8LB 2K86A 3V8JA 1R7JA 1TNTA 5E1ZB 5JR3A 1L0OC 1O7LA 3V8LA 3H3ZA 2KJBA 2TDXA 3WTSC 3BPVA 1O3TA 1WSUA 4G9YA 1QBJA 3HTSB 4M74A 3QP6A 2PQ8A 2JSCA 2G7UA 2KRFA 2ESNA 2H09A 1SAXA 1ZGJA 1RIOH 1LB2A 1LDJA 4P55A 1Z9CA 3BROA 3P9KA 2EV6A 2ZMEB 3C3WA 1CF7B 2GZWA 5D4SA 2Y0MA 4LLLA 3WU0A 2JT1A 5AIQA 2EWNA 4MTEA 4ZZLA 2YX7A 3TOBA 3JAMZ 1R5HA 1FLIA 5DCMA 1U6GA 4I0AA 2O3FA 2FNPA 1S29A 3I59B 2O8XA 2O6GE 3JAMK 2XAFA 1BI2A 4LGWA 1RZ4A 5HLIA 4G7OF 3K1PA 1OYIA 4Q4ZF 4B09A 2GQQA 4MQVA 4YIIA 2EJRA 2W85A 1B9NA 1J2XA 3KCCA 5JFRA 4EQQA 2A07F 3EYIA 2RGVA 3HOSA 3DKWA 4YFKF 4G8XA 2MLKA 4IJAA 4FX4A 3LA7A 3HIFA 4N0BA 1TQIA 1Z1DA 5LGUA 4LLGF 4CO8A 5HS7A 5L3BA 3P9IA 3W6JB 1P6RA 2KIFA 1BI1A 1FP2A 1KQ8A 3ISPA 3HRSA 4RS8A 5E17F 4WF2A 2A6EF 2QENA 2DBBA 2V6CA 2V1UA 3RYRA 4WK8F 4ENNA 1OYWA 4U7DA 1F5TA 2PMUA 2EB7A 5ICEA 2VC1A 3BY6A 2QLZA 2VBXA 5HLHA 3F8NA 3CTAA 2P5VA 1V3FA 2F5EA 3M8EA 1RUOA 3KP5A 4ENKA 4O3MA 1ZRCA 3R0AA 2V79A 3FM5A 2D2WA 3GUDA 1E2XA 4WXCA 1STZA 2FSWA 4CDGA 2HYGD 4KN7X 1IXCA 1MKMA 1ZLJA 3BJAA 1MZBA 3LA3A 3F8FA 4ZYHA 2HGCA 1SFXA 3HHHA 1UFMA 4UVBA 1R1UA 2EA4A 5ICFA 3MQ0A 4EGYA 3N97A 2OZ6A 1LNWA 1K78A 3T0YA 1FZPB 4MEYF 4HQMA 1OKRA 3DFGA 2DK5A 1HXDA 3NEUA 3E5UA 3FMSA 5DV5A 4G7ZF 5F64A 4LJZF 2EK5A 2XAQA 4N9IA 4JQFA 4A2UA 3C1DA 3ZMUA 3IRQA 5D8KB 1Y0UA 5D5VB 2FMYA 5L3FA 1XN7A 4OIQF 1BM9A 3ZMDA 1DDNA 2QWWA 1NHAA 2B0LA 2WWYA 4A12A 1YO5C 3BZ6A 2M87A 1TW3A 2V1DA 4MEXF 4LB5A 4JK1X 4G6QA 4AVPA 4HF1A 3ZPLA 1J9IA 2EFWA 3V4GA 1KU2A 4HW0A 5D5UB 1FP1D 1XGNA 1XGSA 3BP8A 1ZAOA 5E1XA 1DP7P 1HSJA 4YIFA 1D8KA 4ESJA 1O3QA 4ZYDA 1YS6A 5HS9A 5K1YA 3BPXA 4L0ZB 4AIHA 1LDDA 2BEOA 4UV9A 2CWEA 4GGGA 3VODA 1S8NA 5FO5A 5FB2A 2XAHA 1BI3A 1KU3A 1Z91A 2RKHA 1IXRC 1IN7A 2VT2A 3LAPA 3MFKA 3ZMZA 2ZKZA 3HRMA 2NNYA 2L54A 1ZYRF 2F2EA 4NQWA 2BYVE 2L3DA 2VBWA 4LD5A 1XCVA 4M72A 2MBFA 3WODF 4R79A 4ESBA 3V8KA 5CVVA 1XGMA 2DFIA 2J5OA 1HQCA 3DF8A 2QUFA 2XUBA 2FU4A 5H6QA 1YG2A 3T8TA 4RGSA 2PLYA 1W5SA 3JTGA 2LKPA 4I0BA 3ZP5A 3QU3A 2WC2A 2QQBA 2XVCA 2EA2A 2X4HA 3CJNA 3FWEA 4XLNF 3TDZC 5LRSA 1SFUA 3D5LA 5D5WB 3SQNA 3GEZA 1TQMA 4R1HA 5BS6A 2YSRA 3K1MA 2BV6A 3KP6A 1W7PA 5HDNA 3GFLA 3Q9VA 1IN8A 3FZVA 4JBAA 4CGZA 2RN7A 1G3TA 3OOPA 1HKSA 3M7GA 1R58A 3WTYC 4P5OA 1R5GA 1WWXA 4L18B 1FNNA 1T39A 4YG2F 5HOOA 5K5QA 4ZYGA 2GA1A 1LDKB 1T6SA 4KDPA 2OD5A 2CW0F 2XV4S 4LB6B 3TDUC 3I5UA 2O03A 3N4MA 1BC8C 4XLPF 4PGGA 3E5XA 4U0VA 5E8GA 3HRTA 4HLXA 4LFUA 2Z5UA 2D1VA 4YFXF 5FLXZ 2STTA 3CUQC 2K27A 3RKXA 4G6DA 4UV8A 2COMA 4UXNA 2P4WA 1O7FA 5FLXK 2J5PA 4KN4X 3CO7C 3ABUA 1Z05A 5L3GA 4G94A 2A5YB 3K1NA 4KICA 4Y13A 4IRGA 4I09A 3CUQA 1JHHA 1LVAA 5LEJA 2YPRA 3KZYA 1K7AA 1XB4A 3TOAA 3F22A 5IT3A 2V9VA 2EV0A 4EM1A 4K2EA 5D5XB 3FM3A 3GZ6A 2IA0A 2H27A 1XDUA 2ZNYA 1RNLA 3GW2A 3QPTA 5TJJA 5A2QZ 3GWZA 4HV5A 3TGNA 1G3SA 4AD9A 3ERED 3MEXA 1DPRA 1I6XA 5A2QK 3MAJA 2P8TA 1YFHA 2LNBA 3H92A 5KK1A 4MGRA 4LK1F 1XMAA 4BHBA 4KIGA 5LHGA 2JTVA 3I4PA 4Z2YA 2P6SA 3RKWA 2Q2EA 5L3DA 4MHGA 3WTUC 4PDKA 4I01A 3WGIA 2O0YA 3WGGA 4M6YA 2GA2A 4IRIA 3WGHA 1XSXA 4EJWA 3ZMTA 4RB0A 1HW1A 1B6AA 2XAGA 3L00A 2CO5A 1P4XA 2FEZA 5DCMB 3VB2A 2UZKA 1HSTA 3PQJA 1GXPA 1FY7A 3HYIA 1IF1A 3ZN1A 2EFPA 3KP3A 3F8BA 3L2CA 1I5ZA 5D6EA 1YLFA 1FYMA 1IRFA 3HOTA 1J59A 2AS5F 3CLOA 3E6MA 2OBPA 5FFXA 4A5NA 3SXYA 4KMUX 2RC4A 2A68F 3I53A 1USTA 3RKYA 2GAUA 4ON0A 3JTHA 4LG0A 4MNUA 2W24A 2E7XA 2IJLA 2YU3A 3E6DA 4M6XA 1D5VA 4Q48A 4HLYA 4IHTA 1FBQA 4P9FA 1LQ1A 2VC0A 5LEKA 4HX7A 5AIPA 1IXSB 4O5VA 1QGPA 2JPCA 2HQNA 3GF2A 3QU6A 5F1RA 4KMFA 3L09A 1R23A 4A5MA 1I1GA 1QZZA 4EGZA 2R7FA 4DNCA 5HLGA 4OMZA 1IRGA 4UVCA 1MD0A 3H3UA 1ONVA 4FT8A 2FMLA 4BXUA 3BWGA 4U0YA 1ZN2A 3DP7A 5K5OA 3J80Z 2HKOA 2M45A 4RB1A 1FYLA 4PZJA 2QYOA 3K2ZA 5ILVA 2M1BA 2M30A 2FQ3A 1OR7A 3J80K 3IWZA 5JVTA 2D45A 3G3ZA 1FWZA 4Q47A 4XSXF 4HX8A 2F5FA 3K0LA 2ZBKA 2CYYA 4EM0B 3IHUA 3RTRA 2HWVA 1OPCA 1TBXA 5BOXA 5CLSA 3ZN0A 5CJ9A 3DV8A 2KIMA 5ILSA 3V7CA 5ED4A 3B02A 3BJOA 3RPUA 2HKXA 1FYKA 2A69F 4QLCU 4M9XA 1D3YA 3ZMVA 1R00A 3U1DA
chains in the Genus database with same CATH superfamily
2M3AA 1K78B 2L9RA 2ZCWA 2CV0A 1JI8A 1F9NA 2EFNA 1RR8C 2F5VA 4AIKA 4A0XA 5LGTA 2JRTA 2BY2A 1UJ8A 3PIPF 3OYMA 3FX3A 5F6FA 1G6NA 3ASOH 4M3BA 2KDOA 3FXUA 1D0ZA 4WXDA 2LLKA 1D8JA 1USSA 3MZHA 3CDHA 2FOKA 2JZYA 2BBYA 4H0EA 4UVAA 3JRHA 1J0RA 2DK8A 2NS0A 1MDMB 3SJMA 4BE0A 3L9FA 1K61A 3DBHB 2Y48A 3QYEA 1KA8A 2JA7J 1X3UA 3WE3A 2ZNZA 3R4KA 4UNOA 4L5IA 5KVRA 3ZQGA 3IP4B 3M9AA 4KT6A 3KE2A 3GZNB 4NUBA 3ASNH 1A31A 4FCYA 2XDVA 3DQVC 1ZRFA 2E35A 2R7VA 1T98A 5IT9Z 1EH6A 4QIWN 4KIBA 4XOPA 1F36A 2IW5A 3LSMA 1MDMA 1S6LA 2ME6A 2L2OA 1HKQA 3RCOA 4C9YA 1LEAA 1EV7A 4YEJA 2V9PA 2V26A 2ID6A 3SEZA 5IT9K 3J81Z 1BIBA 1U5TC 4OIOF 1SD5A 4XRSA 2PJRB 1ZARA 5EEGA 5E3OA 3LFKA 4IQJA 4U0WA 5E8IA 2ZC2A 5J8CA 1XD7A 1IO2A 2CW8A 3CCLI 1U78A 4CA0A 1N77A 1CGPA 3RZOJ 2DA6A 1ETYA 3G4SI 2DT5A 2L02A 3LOCA 1Y8RB 2CS3A 2H6CA 3DXJF 4HOBA 4C2TA 3GTOJ 2MG4A 1GHCA 1FPQA 4EMSA 4IHWA 2QQ9A 5FFZA 3CO6C 2PJRA 1QZYA 2NS7A 3VPRA 3FMQA 2DO7A 2L01A 1ZG1A 4NHJA 1MBHA 1Y6IA 3IH2A 2JK3A 4P9UA 2AXTC 1U5TA 4M9ZA 3QPHA 1YRNB 5IP7J 2LDUA 1I6HJ 1W5CC 3JRIA 2XASA 3AG3H 3S3NA 3S14J 2DU9A 4EVIA 3AG2H 2HEOA 2Q0OA 2Y30A 3LMMA 3G73A 3BR3A 4Q5SF 6PAXA 1QO0D 3KLNA 2W4SA 3K6GA 3W2VA 1ULYA 4UY8I 3WTXC 4A69C 3SFZA 2WTEA 3K9TA 2E1MC 2M4KA 1PP8F 5JI6A 1ZG3A 1JJ8C 2A61A 2K85A 2M5WA 2ZXWH 2WB1N 3K4LA 3NWTA 3T8RA 3EETA 4ETSA 3I3LA 5FKNA 2E1MB 1AWCA 1ZG5A 2K02A 3H0DA 1X4OA 2I5UA 2Z2SB 1I1SA 2NAZA 4HRIA 5HDKA 1BN5A 1WH7A 2P5KA 2RDPA 2VB6A 1FTTA 1GLNA 2E1CA 3V7SA 2W00A 4LK0F 1BOAA 3E6CC 3S16J 5LFAA 3OIPA 1ZK8A 4C3IJ 4XM3A 1TC3C 2HDDA 2OAZA 2F5CA 5LHIA 4UHTA 2H6BA 2G9WA 3HBLA 4C2UA 4PJNA 2GM4A 3KLOA 4F7ZA 2AQFA 1TP4A 2F5DA 1V54H 2OQRA 3GLXA 2EZIA 3RDIA 5EG0B 4IL6C 2DQLA 4B3XA 1VQ8I 1OCRH 1U9OA 4D0PA 1ZGAA 5FD6A 3BTCA 4J00A 1J75A 4XLCA 1F4KA 4N4NB 4AM3A 1Y0NA 2EBIA 2XAUA 3O3KA 2DA7A 2VLAA 3HOYJ 3S2DJ 4GXOA 2OTJI 1JGSA 3O6BB 3HZJA 3HOZJ 4C30A 2BVMA 1XX5A 2QBYA 2GBYA 3RPQA 1ORKA 2Z3YA 4LLNA 2HDCA 2L7ZA 4IHYA 1S7AA 2LH9A 4OIRF 2FNAA 1PUEE 2PI0A 1DGWY 1R22A 2DA3A 3BR5A 4ZDOA 1MJBA 2L0KA 2ZJ2A 3GYHX 2E36A 1C0WA 1AOYA 1BL0A 2DI3A 1PDNC 1IW7F 2VOOA 2XF5A 1V5GA 4Y15A 4HZFA 1QPMA 1Z21A 2L4AA 3GX4X 1H89C 4YELA 2ZJRF 4EJUA 3KYLA 4EJOA 2K3FA 4UB8C 1EH8A 3LL7A 3OS1A 2E1NA 4LMYA 1SVMA 2MW8A 3CESA 4RAZA 1R4MB 5KAFC 2Y0SA 3BC8A 1HBXG 1W7PB 4RB2C 2XGDA 3TO7A 1XS9A 1SFEA 3VOEA 4DYCA 5IP9J 3E7LA 5J8FA 3IUOA 3R61A 3BG5A 2ETHA 4XLEA 1YJ9I 2UUZA 3IKTA 1IN5A 2H1KA 1H9GA 2DW4A 2JUCA 1MJAA 2IGNA 5BNGA 1RPWA 4XNFA 1KYWA 5E3MA 1UHMA 4L9VA 2NXNB 1ZRDA 1YX3A 4A0ZA 1IUYA 2XPVA 1IN6A 1PP7U 3H5NA 2STWA 3PUBA 5C4XJ 2V1XA 1TLHB 2QVOA 5C4JJ 2N8GA 2X6OA 3ECHA 3I4MJ 2BY0A 4XORA 3HC7A 2E7WA 3GXOA 2E5ZA 3WTTC 5ERIA 3H3VK 2CU7A 1MBJA 3F0CA 4ZH4F 2ZXIA 1T0FC 1J09A 2KDZA 3HHGA 4A3FJ 5CVJA 3KEOA 3M1EA 4JX4A 2DA4A 4BYYA 2IGKA 5J6XA 1WRJA 1MBEA 2BW3A 2IA1A 1UG2A 3NAUA 2A05A 1H9TA 2FBHA 3PIOF 4IXAA 2PN6A 2P7VB 2HVRA 2DTRA 1H8AC 3FBIB 4HAMA 4L0YB 2VQHA 2O61A 3HRUA 3HL2A 2FOWA 3KP7A 4RBOA 1T0FA 1JXSA 5GTIC 5TRDA 4KNYA 2IPQX 3ULQB 4DZJA 3F6VA 4HDUA 2X1EA 1BC7C 4OAYA 2DOFA 2GXGA 1TNSA 2FF4A 1E0EA 3OYIA 2ELJA 2JPBA 1U0JA 5ICCA 1UHSA 2EV5A 1B1BA 2NOJB 3BOQA 1J7KA 1U3EM 3H5AA 3CCJI 4DYQA 2FUG2 4PUSA 1MBFA 4HG2A 1SANA 4CYDA 3AAFA 3M1CA 2AXLA 1O57A 3I58A 1H0MA 3CD6I 3DPLC 4BH9A 5HODA 1U8BA 3K4BA 1WVRA 3HOWJ 2LSOA 2QM3A 3CUQB 4FE4A 1J5YA 1LVKA 1FX7A 3IKVA 1R6RA 2CUEA 1B9MA 4CICA 4P96A 4MTDA 3LSPA 3NRVA 1NH3A 2IVMA 1WQ2A 3D0SA 3S8PA 2ZO4A 2XC7A 2WV0A 3ROUA 4B47A 2Z99A 2ADUA 1EF4A 3DKYA 3OOUA 4E6KG 4Y7NJ 3Q5FA 4RAYA 1AKHB 5L3EA 2VN2A 3E5QA 4X0GA 4L9NA 1SD6A 4W97A 1ZREA 4BJ6C 3OYJA 2HVSA 1XMXA 3OIOA 4MFEA 2BE5F 3K4NA 3DBRB 1GUUA 2LF8A 5CQGA 1JKPC 1TW2A 4G12A 3SDGA 4L5JA 4XRSG 1SVOA 1T2KA 1JUPA 3GTGJ 2M8EA 5FKMA 4HNVA 2JA8J 1TQPA 3DEUA 2Y0SN 4HF0A 4HX4A 4LOCA 1K79A 2IS1A 2X48A 1V5EA 3I55I 2H8RA 2LF7A 1KYZA 2CW7A 4BXXJ 2UXXA 1YW8A 5H20A 4A6EA 4AU7A 3V42A 3BG3A 4PGHA 4XKBA 3ZR8X 2ZJPF 2DT6A 2OV7A 3BR2A 2GWRA 3BQZA 5J1UA 3WTVC 1G59A 2JA5J 2JWTA 5CVIA 4BE2A 1Y8QB 2DJIA 1IG7A 1OQYA 5DTDA 3HOXJ 3ABTA 2KP6A 2NNNA 2BGCA 4FTHA 1PUFB 5L3CA 4BY1J 1IDYA 5IOZA 1JT6A 1O3SA 3CCVI 1LFBA 3M3YJ 3I71A 4PJ0C 3HPHA 5B66C 1B8IA 4BGDA 1YJNI 2X6YA 2UV1A 2HZDA 3VYRB 2GXBA 3GMEA 1TZLA 1A04A 3UR3C 2FBIA 3C2BA 1PUFA 2MD5A 2Y31A 2QSHX 3U2RA 3FK7A 2VOPA 3J7AO 2ECCA 2AHQA 1I39A 1F1ZA 3CUOA 3LFUA 1HW2A 5K7HA 4XRMA 2R3SA 2L4MA 1YIOA 1MNDA 3KETA 2WY8Q 1D0XA 1YOVB 4M3GA 1SD4A 4HBLA 3ZXSA 3CDLA 2QQAA 4HPQA 1T8IA 1UAAA 1FOXA 3WG9A 3QPSA 1EKEA 2OQGA 3VYTB 3SDBA 1HW5A 2M0CA 3CCUI 5J47A 1X2NA 3JRGA 3OYBA 2NRAC 3ABKH 2R7UA 5LRRA 1XG1A 1R1TA 1KGSA 3E0JB 4OOIA 3TBIA 4ZTFA 3OSGA 2KPMA 4C3HJ 2PBIA 3GFJA 2ZMEC 3COAC 1AHDP 3QWLA 4XLHA 3U9GA 1QQIA 3HG9A 2JUGA 2X1CA 1G3YA 1JTXA 2PMHA 3QAHA 4CZZA 4LG0B 3N05A 2XHKA 4CXFA 4XSZF 4PK4A 1W5TA 1TT0A 3M8FA 3DWLE 2KIUA 3AG1H 3KYDB 4I2OA 3W6KB 2H94A 5AONA 2VIXA 3JSPA 5J40A 2EPFA 2DMUA 1G2HA 1LFUP 4M73A 4BY7J 1FSHA 2EINH 4RGRA 1T08B 3IL2A 1YX5A 5DM6F 2LVSA 5J1YA 5GPCA 5CYVA 4RB3C 4OMYA 5B3SH 1W0TA 2RQPA 3E6BA 2ZMEA 2ISYA 3BJ6A 2CQ7A 4RM3A 2AQEA 2MABA 1CF7A 3HSFA 1R71A 3FXJA 3GFMA 3FHNA 1SFOJ 3H1CA 3S93A 4ENJA 2PFBA 4EM2A 4KYWA 1ON2A 1G8XA 3R60A 2XRNA 3A01B 2IS6A 2IGOA 3BTLA 4N4OB 1VQ7I 2LBFA 3JRDA 4IRHA 2MA3A 2XB0X 3JW4A 3IC7A 5JLWA 4MFDA 1X1DA 3ML6A 1QZEA 3I59A 1NTCA 1R1VA 4U7BA 3CC4I 2FJ1A 3LQQA 1MMAA 2OZUA 4KUMA 5ICGA 3FKJA 3VYSB 4L9JA 3ECOA 4DW6A 3ZMSA 1ERDA 1XMKA 3CMYA 4CH7A 2HYFA 1R5ID 5CQEA 1OMIA 2X0LA 2IAIA 4NC6A 2NYXA 3F8CA 2VE9A 1WKMA 2A5WA 1QPIA 2YR2A 2DAOA 2XGEA 2R5ZB 2E5NA 2QGUA 2MH9A 5HVQC 1RESA 3A0BC 2WA0A 3RPUD 1YITI 2P81A 2BOLA 2R4GA 3FISA 3P7NA 5HS8A 4PJJA 3S15J 1U2WA 4WXHA 4ENMA 1RI7A 1HA8A 2C6YA 2CSOA 4G7HF 1KQ0A 1X1AA 1X2MA 3O8HA 2R5ZA 3U21A 1MGTA 3MWMA 3KEQA 1P7JA 2XSDC 1YQAA 2ISZA 2KHMA 3X2QH 4PSWA 3ELKA 4DOZA 4QWQA 2ELHA 4HA8A 3BLYA 1YJWI 3RJPA 1XPXA 4ABZA 4IQ4A 2MLGA 4Y17A 2VODA 1WCMJ 4JP0A 5CVUA 4HSRA 2W84A 2M7BA 4AC0A 1MW7A 1BJAA 3A2KA 3OMYA 1WJBA 3F3XA 1EH7A 2QSGX 5JHUA 2FA5A 1DQUA 2WBMA 4A3LJ 1GVDA 2R92J 1S7OA 3ZQFA 3EPZA 1HOMA 3W3CA 3LA2A 5D4RA 3IRRA 1BJZA 3LQRA 2E1OA 2HTSA 3Q3SA 4CHUA 3REOA 1IDZA 5FGMA 2OA4A 5DUKA 1YTYA 2P6TA 1KU9A 4WCGA 3MKWB 4XKCA 1GT0C 2M9HA 5K7FA 2GOXB 4BDZA 1FOKA 4ASNA 1WI9A 4OINF 1WJCA 1QHGA 3ERMA 3EYYA 1HLVA 4HQEA 4IKFA 2PMZA 1JE8A 1D1BA 2DCEA 2XIGA 5KHDA 1WH5A 1JHFA 1I3QJ 3CP8A 3FXKA 3BTIA 2COBA 5E1WA 2HZTA 1VQ4I 4IHVA 1S72I 4BAYA 2IA2A 2VT3A 2MC3A 2R5YA 1XSDA 2HQAA 3QRFF 5DDGA 1YS7A 3LWFA 4NBQA 1FIPA 3A1YA 3CP2A 4RGXA 1SAUA 2XAJA 3A4CA 3C7JA 5LBQA 4M71A 4BS9A 2DPDA 3RYPA 2JA6J 1Z6TA 2Z9OA 5GADJ 2K3PA 1V4RA 2O7OA 3FHZA 1LUJB 3O2PE 1DPUA 2FXAA 4IPAA 1UG0A 1MJ9A 2BZTA 2R7DA 4FASD 4NB5A 5LGNA 1Z7UA 4RMNA 2GLOA 1O4XA 2MFZA 4FQGA 5BMZA 3RQ4A 4GO1A 4R8HA 3I0TA 3VFZA 3J7ZI 1DU6A 2KFDA 3PL8A 3FF5A 3B73A 1ODDA 2DA1A 4KT5C 1GXQA 3DKXA 3DU6A 4E70A 3LSRA 2HPMA 1VQ9I 1ZHFA 1X1CA 2DPUA 4HNTA 4GRIA 2A3SA 4KA4A 4I99C 5E20A 2FRHA 3GVAA 3GTLJ 4ZC3A 4DBRA 1ZR4A 4UUVA 3OYKA 4ANJA 1YHQI 2EFOA 4O6JA 3P5JA 3BCAA 2FBKA 4DGWB 5DD8A 2ZXJA 3IWFA 3F21A 2CV2A 4I7HA 1MMDA 4RM2A 4BJ5C 4WX9A 4A3GJ 1YE9A 1U5TB 1ON1A 3HSEA 2DOAA 3Q9SA 1FT9A 4XQFA 3TO9A 2ICWG 4ESFA 4MQ9F 3J81K 4YIRX 2VJ5A 1O3RA 1Z77A 2KMUA 4BUPA 3ZRGA 2EIMH 2V4JC 3PQKA 2R7WA 3MCZA 2Y9ZA 4V2GA 4I02A 2RV8A 3K10A 2HR3A 3WU2C 4X6AJ 2BXZA 2EFQA 3WTZA 3EQLF 3OR2C 4IZZA 2BHYA 3EUHC 1P4AA 2DLLA 3I54A 1ENHA 2DTZA 3GZ5A 2VJIA 2BVLA 2XGXA 1P4WA 2DN0A 4BBSJ 1I50J 4OAZA 3CJTB 4Y33A 4XIDA 4A6DA 4AWXB 3LSTA 2IXSA 2JRMA 2XKPA 4U88A 3HEFA 1VQ6I 2M7AA 1GVJA 3ZQLA 4OIPF 1IZ1A 2K4JA 5EYRA 2VBZA 5FD5A 2X6XA 5HLTA 2ID3A 3EUHA 4H4KC 1UHWA 1JTYA 1ZQ3P 2QKLB 4HDVA 5J4YA 1TTYA 2P7CB 2GIZA 3KZIC 3FXOA 2DDBA 2MC4A 3NWSA 2G7HA 2CGPA 5K5RA 2Q8KA 4KFCA 3ZOBA 1K6OA 1OCOH 5DD4A 1Q1HA 5ILUA 2Y75A 4S05A 5TGTA 1Z7LA 1DUXC 2KISA 4EATA 4QTRA 1NG6A 3OYAA 4HF2A 3QYFA 3KFWX 2Z33A 1HDPA 2QZ8A 3HTUA 4E7IA 3F72A 2PMZN 4DQ2A 4NC7A 1SEUA 1W4MA 2FD5A 2HOTA 3TP0A 1NK3P 3F8MA 1SMTA 3FMRA 3ZQCA 3UNGC 3BDDA 2QBYB 3GFIA 3T1BA 1VF9A 2EILH 5B1BH 3CCRI 3S3MA 4DIQA 4GYIA 5GPAA 2P0WA 1QNTA 3Q0VA 1IAWA 3NQOA 1S5LC 1BIAA 4GDFA 1Z0XA 2XGCA 3ZQ7A 2FE3A 2ZFWA 5BPDA 3CMAI 3U1KA 3WU1B 2D1HA 3HGYA 1GDTA 3WE2A 1FBUA 2PJPA 2DA2A 1I27A 3CC2I 5EEHA 3R6SA 4XR6A 1LEBA 1W7PD 2DJNA 5FRMA 2UXNA 4L9TA 4UB6C 3LAJA 1TWGJ 5F04A 1WI3A 3TKYA 1AA7A 3KP2A 4YRVA 2VE8A 3L7WA 1FMVA 1LJ9A 2JVHA 1A6IA 1R9TJ 1IRZA 3K69A 3TL4X 1G4DA 1RUNA 5DEQA 1WFXA 3KP4A 3MZYA 2D5VA 3DPTA 2A6HF 3HUGA 4CCOA 1TL8A 1IC8A 3OV8A 2IS4A 1ETVA 5DYMA 3E97A 3H9QA 3MN2A 2LD5A 1YW9A 5KNLA 5FJ8J 1OYYA 1Z6RA 5FLVA 4E7HA 2I10A 2DODA 1U8RA 3QP5A 2CG4A 4IHSA 3SZPA 1UCRA 1P92A 2Y9YA 5FKKA 4GFBA 4KIFA 1TWFJ 1LPQA 2R7QA 5LLQA 5FKLA 3WTWC 3HB9A 1QA6A 4EJTA 2PEXA 2HTJA 4XN0A 2VXZA 2FX0A 2Y2ZA 3FXQA 1YYVA 5LHHA 3C18A 3WHBA 2CQKA 2CUZA 2GIVA 3S2WA 5FROA 3CC7I 4B8XA 1K4TA 3J7AY 3SZTA 1M1EB 4A3EJ 4ZTJA 3RI4A 2W25A 2ESHA 2HXOA 5HNFA 1FSEA 4N9HA 5H6RA 5D6FA 1G3WA 2VQLA 1KQ9A 1OCZH 1X3ZB 3OL4A 2IGMA 4KITB 2BW3B 2XKOA 1FMWA 3V7RA 4XBFA 1DP3A 4EJVA 1XC5A 3ZQHA 3HSRA 3FXRA 1W36D 2HDWA 2K4BA 3HM5A 5BPIA 1TT5B 1KU7A 4I98B 2DFHA 5HNHA 1N25A 4ZZDA 3LSKA 2DDAA 3VEPA 1WJEA 2HS5A 2VXDA 3RIRA 3ZQIA 1VQPI 5DM7F 4PFPA 1L3LA 3VDXA 1XDSA 3H0GJ 3TQNA 1SMYF 1P9QC 2HOAA 2VONA 4BQAA 3KZZA 1VQKI 1JUSA 4BNCA 1S3JA 3G6EI 3F23A 4V19K 1P2FA 4G6TB 1ACIA 2KJCA 5HDGA 1IN4A 4LITA 2X85A 4HSTA 4BL0B 2DQRA 3G1MA 3E3VA 3I64A 3F6OA 4PCQA 2LG4A 4HYEA 2M34A 1E3PA 2O8KA 1FBSA 5DCFA 1BBYA 1B4AA 4EV0A 4IEJA 2JA2A 4XRFA 2ACJA 2M0MA 2IRFG 2VPRA 2CUJA 4M9SA 3JREA 2K9NA 1MH3A 2XROA 2E2JJ 2IP2A 4L5EA 2CFXA 5E18F 1XGOA 4OU0A 4LIUA 1SD7A 5CVRA 4CCNA 4FX0A 4E4HA 2G0EA 1NK2P 1ZH5A 2IT0A 4YFNF 3QYBA 4RGUA 1B72B 3GTMJ 4PFOA 2L9SA 2CH0A 4AIJA 4HV6A 1OCCH 2MGQA 3TO6A 9ANTA 1UMQA 4XL9A 3AL0C 3QOPA 1YW7A 3PUFA 1BI0A 2RNJA 4GYGA 2VPLA 3LSHA 4A0YA 2YX4A 4BQOA 1HKTA 1FC3A 1REPC 1B72A 1JJ6C 5DUIA 2NVXJ 3TMOA 3A0HC 5F0FA 1TWHJ 1XCBA 3PSFA 4MO7A 1MNEA 1XSVA 3GO5A 4IVNA 3DEWA 4TV7A 2F6CA 4BKXA 2LFBA 1UB9A 2OU2A 4BU2A 1T33A 3CLQA 5C44J 3IH4A 2F48A 3R0JA 2EIKH 2HOEA 2K7LA 2LR8A 3P9CA 5GTHC 2RVCA 4BHPA 2MH2A 1BR2A 4GCVA 2WADA 5H2FC 1E17A 2UWMA 4M3FA 3MD2A 4F91B 1E3OC 1ZLKA 1MBKA 4OWRB 4WWCA 4BHCA 4S04A 2EZHA 1B8IB 2VJJA 3SHFA 2P5LC 4FETA 4CZCA 1B59A 4X1EA 2HQRA 3T5XA 2YUSA 1SVLA 1OCPA 3MMYB 2PG4A 4ZYEA 2HVQA 2MYSA 2W57A 3PFIA 4FHTA 3EDPA 5J3LA 1R36A 2VBYA 3BG6A 4IF4A 5BQTA 1K6YA 2M4GA 3TP3A 3L2RA 1W0UA 1H88C 1VTNC 2KKOA 3JSOA 2HFHA 1T38A 5D8LB 3OSFA 2K86A 1D1AA 4IOCF 3H35A 5EGOB 3V8JA 3DTEA 1R7JA 1TNTA 5E1ZB 5JR3A 2IBDA 5M3MJ 1RR7A 1L0OC 3S1NJ 4ZDPA 3H9GA 5K7ZA 2RNGA 1O7LA 3V8LA 3CF5F 3H3ZA 2OTLI 2KJBA 2TDXA 3WTSC 1A6QA 4XN3A 1BW6A 5EGOA 3BPVA 1O3TA 2F4MB 4FE7A 1WSUA 4G9YA 4BXFA 2DMPA 4DYRA 1QBJA 2DMQA 3HTSB 2H1LA 4M74A 3QP6A 2K40A 2PQ8A 5FLMJ 2JSCA 2G7UA 2KRFA 1F43A 2ESNA 2WAEA 1FEXA 3HOUJ 5JVGF 2H09A 1SAXA 1V5FA 4U87A 2ZB9A 1ZGJA 4D9JA 2CQXA 4Z6YA 3ABLH 1RIOH 1WHUA 1LB2A 1LDJA 4P55A 1Z9CA 3BROA 2BY3A 2ZXHA 3SEQA 1OCTC 3P9KA 3RSNA 2EV6A 2ZMEB 2ECBA 1ETWA 4A3DJ 3C3WA 1CF7B 2GOMA 2GZWA 5D4SA 3I56I 2Y0MA 4LLLA 1EA3A 5F08A 2JT1A 5AIQA 3WU0A 2EWNA 5J1RA 4MTEA 1GV5A 3QODA 4ZZLA 5IPAA 2YX7A 3DPUA 3BR0A 3B6AA 4M3DA 4BEHA 1WJ5A 3TOBA 3MKZA 2WAFA 3JAMZ 2LBFB 1R5HA 1FLIA 5DCMA 1U6GA 4I0AA 4HNUA 3D5SC 2O3FA 2FNPA 2XF6A 3FKIJ 1S29A 2CQQA 3I59B 2A6TA 4PJMA 2LOOA 2IEKA 2TRTA 2O8XA 2O6GE 3JAMK 3OYCA 2XAFA 1BI2A 4LGWA 1RZ4A 5HLIA 4CYCB 4AUXA 4A3BJ 4G7OF 2VASA 3K1PA 2B9SA 1OYIA 4Q4ZF 2VI6A 4F3QA 4B09A 2GQQA 4MQVA 2Q1ZB 3MKYB 3BT9A 4YIIA 3JR9A 2XB5A 2EJRA 1RKWA 2B7EA 2WY7Q 2W85A 3C2GA 4ZDLA 3CJRB 3TEDA 4IOAF 5JLXA 4UUSA 1JKOC 3MKLA 1B9NA 5IOYA 1J2XA 2OUMA 3FK6A 3KCCA 3RZDJ 3HJEA 5JFRA 4EQQA 1ETXA 4CYCA 2A07F 3EYIA 3G1LA 1YI2I 2RGVA 3HOSA 3DKWA 4YFKF 4G8XA 2MLKA 4IJAA 4FX4A 2DA5A 2E19A 2OPTA 3LA7A 3EUKL 3HIFA 1I3AA 2OJED 2V9KA 4N0BA 1TQIA 4LIVA 1BA5A 1Z1DA 4EEFG 5LGUA 4LLGF 3HXLA 2ZSIB 4CO8A 5M5WJ 3D5RC 5HS7A 2OF7A 2DMNA 5L3BA 4AVZA 2WV1A 3P9IA 3W6JB 2DOEA 1P6RA 1IUFA 2KIFA 3S32A 1BI1A 2VKVA 1Z3XA 4J19A 1FP2A 4I76A 1KQ8A 2LKSA 3ISPA 2HQ5A 3HRSA 4M6VA 4RS8A 3OS2A 5EJCA 5E17F 4WF2A 3CCEI 3AKZA 1CQTA 2A6EF 2QENA 2DBBA 3PM1A 1PVEA 3BCBA 3I9V2 1SFKA 3A03A 3DTKA 2V6CA 4A93J 3NARA 2V1UA 3RYRA 4RAFA 1RRJA 4WK8F 4ENNA 2DYSH 5F0HA 2BXYA 4MLOA 2EH3A 4E7JA 4RLQA 1ZGWA 3GTKJ 1OYWA 4U7DA 4AYBA 1F5TA 2PMUA 3GTPJ 1N75A 2EB7A 5ICEA 2VC1A 2LP0A 3BY6A 2QLZA 2VBXA 2X51A 5HLHA 2E2HJ 3CMEI 4D1QA 5LD2C 3F8NA 3CTAA 4F93B 1HDDC 2P5VA 2R5YB 1UZCA 1V3FA 2F5EA 2ZSHB 3M8EA 3G71I 3VWBA 3CQZJ 1RUOA 3KP5A 4ENKA 2KT0A 4BBRJ 4O3MA 1X58A 1ZRCA 3R0AA 1HC8A 3K70C 2V79A 3K7AJ 3FM5A 3L1PA 3JRAA 3ONQA 1Q1VA 1APLC 2W48A 1YIJI 3AG4H 1PYVA 2D2WA 2L7FP 1E2XA 3GUDA 2LKXA 1VQLI 4WXCA 1STZA 2FSWA 4CDGA 5EZGA 3VSKA 2ZJQF 2HYGD 4KN7X 3OYLA 3BR6A 1ETQA 5IYDJ 1IXCA 2QSFX 2DMTA 5GAHJ 1MKMA 2NVUB 4Y52J 1ZLJA 3BJAA 1FOWA 2KLOA 1FOYA 1MZBA 1QHHD 3OYEA 3LA3A 3F8FA 4ZYHA 2HGCA 5KAIC 1SFXA 3HHHA 1UFMA 4NDLA 4UVBA 4XLFA 2HXIA 1R1UA 2EA4A 2KQRA 5ICFA 3MQ0A 4EGYA 3VSLA 3OL3A 3N97A 2OZ6A 4RAGA 1W1WE 2V6EA 1MNMC 2DT7B 1D1CA 1LNWA 1R4NB 4NNJA 4D7NA 1K78A 3T0YA 1FZPB 3Q0UA 1QRYA 3WG7H 4MEYF 1Z3YA 2HI3A 4HQMA 3BG7A 1FTZA 1OJLA 1Y56A 1OKRA 2R7OA 5EF6A 3DFGA 2DK5A 3OYHA 4KISA 2NVTJ 2V7FA 4DZPA 1MMGA 1HXDA 1TWCJ 5M5YJ 5B5EC 3NEUA 3KEYA 3E5UA 2XSJC 3JRFA 3FMSA 5DV5A 4G7ZF 5F64A 4CCJA 4B3AA 3HDDA 4RDUA 3CF2A 3CDIA 4ITVA 4LJZF 5KCMA 2EK5A 2XAQA 4N9IA 4JQFA 3H5RA 2K9MA 5TISC 4A2UA 1DU0A 3C1DA 3ZMUA 1K83J 3IRQA 5D8KB 1ZELA 2O5RA 1Y0UA 5D5VB 2FMYA 2KIQA 5L3FA 1XN7A 4OIQF 2BHZA 1BM9A 1BR1A 3ZMDA 1DDNA 3QQAA 2QWWA 3DEEA 1JKQC 4D7MA 4C2MJ 1NHAA 2LTPA 2B0LA 3H9JA 3IH3A 2WWYA 4A12A 1YO5C 1ITYA 1IRXA 3IAS2 2R7XA 3BZ6A 2R7SA 2M87A 4DJAA 2GXAA 1BW5A 1TW3A 1BR4A 4JX6A 2DFFA 2V1DA 4C3JJ 3GBGA 3BR1A 3CCYA 4BQQA 2EQRA 4MEXF 1VFCA 4F92B 4AYBN 2ZFUA 4LB5A 3BG9A 4XKVA 4JK1X 2R7RA 4G6QA 3W2WA 4AVPA 4HF1A 3ZPLA 1J9IA 3G2BA 3VYUB 2EFWA 2OCCH 3V4GA 4S0HB 1X1BA 1KU2A 1T56A 4HW0A 5D5UB 1FP1D 2E71A 1YRNA 3BP8A 1XGNA 1XGSA 1ZAOA 3F9KA 5E1XA 4B1RA 2W1OA 1DP7P 2R7ZJ 5FRNA 2KZVA 5CPRB 1IGNA 1HSJA 3KPHA 4YIFA 3KIOA 3S2HJ 1D8KA 4FISA 3W6VA 4ESJA 1O3QA 4ZYDA 1YS6A 3OWTA 2L7KA 5HS9A 2EZLA 5K1YA 3BPXA 2EIJH 1ZKGA 4L0ZB 4AIHA 4BACA 1LDDA 2BEOA 2QEXI 4UV9A 2CWEA 2QKMB 2PX9A 2XPUA 4XLAA 2RREA 4GGGA 3OYNA 3VODA 4NQWB 1S8NA 2KL4A 5FO5A 3GTQJ 5FB2A 2XAHA 4B4CA 1BI3A 1KU3A 1Z91A 2RKHA 1IXRC 1WZ2A 3HUGB 5EDNA 1IN7A 2VT2A 3LAPA 3MVPA 2L9NA 3L2WA 3MFKA 1A35A 4XK4A 3L2VA 3RKQA 1OFCX 3ZMZA 2CRGA 1IV8A 3JRBA 2ZKZA 3HRMA 2NNYA 3M8JA 2L54A 1ZYRF 2F2EA 2X9DA 4NQWA 2BYVE 4QPOA 1HF0A 1QVTA 1HCRA 3B6CA 3FXLA 2L3DA 1R49A 3OYGA 2VBWA 3QOEA 4LD5A 3LSIA 1XCVA 1X1PA 5EG0A 2YU9J 1UELB 4M72A 2MBFA 3WODF 3RQIA 5DS9A 4R79A 1Y1WJ 4IHXA 1MBGA 4ESBA 3V8KA 2M8GX 5CVVA 3WHCA 1XGMA 4Y4RA 4CUGA 2JQ7A 2DFIA 2J5OA 3M4OJ 1HQCA 2JSPA 2VL8A 3DF8A 3DCFA 2QUFA 1MMNA 2XUBA 2FU4A 5H6QA 1YG2A 1LE8B 4PJLA 2XRLA 1RC9A 3T8TA 2RAEA 3PSIA 5JHFA 4JYKA 3CCSI 4LG3A 5F27A 4RGSA 1BOBA 2LY1A 2PLYA 2KZGA 1W5SA 2I8DA 3JTGA 4ZYAA 4A3JJ 3CCMI 2FQ4A 3CMMA 2LKPA 4I0BA 1FJLA 3K2AA 3ZP5A 3DLAA 3FIWA 3QU3A 2NS8A 2WC2A 1LE8A 2OCEA 2QQBA 5GP9A 2MSYA 1FIAA 2XVCA 3ZQQA 2EA2A 2X4HA 3CJNA 3FWEA 4XLNF 3TDZC 5LRSA 1SFUA 3D5LA 4B48A 5D5WB 3SQNA 2CJJA 3GEZA 1TQMA 4R1HA 2VQCA 5BS6A 2YSRA 3G1OA 3K1MA 3S1MJ 2RQQA 4A3IJ 2BV6A 4D5FA 2VQGA 3KP6A 5IY5H 1W7PA 5HDNA 3GFLA 2JMWA 3CJQB 1S7EA 3ZGKA 3Q9VA 1IN8A 3FZVA 1U9NA 4JBAA 4B43A 3DLLF 1VQMI 4CGZA 3S1QJ 4XMYA 2RN7A 1G3TA 3OOPA 2LREA 3D1NI 2IS2A 3CZ6A 1HKSA 3FDYA 3HKZA 3ZCOA 3M7GA 2O9LA 1LFPA 1R58A 3WTYC 4XKWA 3ABMH 3PFYA 1MH4A 2E2IJ 4P5OA 5F1JA 2HU9A 1R5GA 1WWXA 3O8GA 5E3LA 4L18B 3Q0WA 1FNNA 1T39A 1JGGA 1AU7A 4YG2F 5HOOA 5K5QA 3DU5A 3KX2A 4ZYGA 1RETA 1E3HA 2GA1A 1LDKB 1VQOI 3LSJA 1T6SA 1W36C 4KDPA 2OD5A 4JX5A 2CW0F 2XV4S 2BY1A 2NVYJ 2R0QC 2LY2A 4LB6B 3TDUC 1K4SA 4MIMA 3PO2J 3I5UA 1JT0A 2O03A 3N4MA 1D0YA 1S9HA 1BC8C 4XLPF 2M2EA 1X4PA 3OIQA 4PGGA 3E5XA 2KRHA 3K4CA 2OC6A 5IYCJ 4U0VA 5E8GA 1IJWC 3HRTA 4HLXA 4LFUA 2F4IA 2Z5UA 2D1VA 4YFXF 5FLXZ 2STTA 1V55H 2VUMJ 3CUQC 2K27A 2X6WA 1RKTA 3RKXA 4G6DA 3OY9A 2K9LA 2QA4I 3LSGA 2COMA 4UV8A 3HOVJ 4UXNA 4E7LA 3AL0B 2P4WA 1O7FA 5F0CA 5FLXK 5GAEJ 1X19A 2J5PA 4KN4X 3ABUA 3BQYA 4Y3OA 3CO7C 2B63J 1Z05A 5L3GA 5C3EJ 4E7KA 3OR1C 4G94A 2A5YB 2DXIA 3K1NA 1GV2A 5EEAA 4KICA 4Y13A 1VZ0A 2W7NA 4IRGA 3CCQI 4I09A 2TCTA 3CUQA 1VQNI 1JHHA 1EJ9A 4RA2A 5M5XJ 1LVAA 2JN6A 1MSFC 1ZR2A 3QPLA 5LEJA 3M07A 5IP6A 2YPRA 2CMPA 4IX7A 4A3KJ 2CFOA 3KZYA 1K7AA 2VKDA 1XB4A 3TOAA 3F22A 2CUFA 1MSEC 5IT3A 2HOSA 2V9VA 2L7MP 2EV0A 4EM1A 1AKHA 3KYCB 2WAQA 4K2EA 2JVGA 3FM3A 5D5XB 2IA0A 2XF7A 3GZ6A 3PO3J 3OS0A 2H27A 3K4JA 1XDUA 1POGA 2ZNYA 1RNLA 3GW2A 4XONA 1KONA 1KZHA 3QPTA 5TJJA 3K4KA 4QPQA 5A2QZ 3GWZA 4HV5A 3TGNA 1G3SA 2CV1A 4AD9A 3C2HA 3AFHA 2AO9A 2LK2A 3ERED 3MEXA 3SZGA 1OISA 2Q2EB 1DPRA 1I6XA 4ZJZA 3DTIA 5A2QK 2JJ7A 3MAJA 4KJZA 2DFEA 2P8TA 1YFHA 2LNBA 2K5CA 5B1AH 5M3FJ 3H92A 5KK1A 2DYRH 2HPIA 4MGRA 4LK1F 1XMAA 4BHBA 1QU3A 2KRCA 4KIGA 5LHGA 2JTVA 2XPWA 1NG7A 3I4PA 4Z2YA 2P6SA 3RKWA 2Q2EA 3HKZN 5L3DA 4MHGA 3FBNB 3DBLB 5IYBJ 3WTUC 2L9VA 4W1UA 1PJRA 2Z1DA 4PDKA 4I01A 4B44A 3WGIA 3IV5A 2O0YA 3WGGA 4M6YA 2GA2A 4IRIA 3WGHA 1XSXA 2LMDA 4EJWA 1MIJA 1JUMA 3ZMTA 4RB0A 1ETOA 3JRCA 3W2AA 3K4MA 1HW1A 3BZKA 1VNDA 3SFIA 4BEHB 4F55A 4D5CA 1B6AA 2XAGA 3J7YJ 3L00A 2CO5A 3GTJJ 1OLTA 1P4XA 2FEZA 5DCMB 3VB2A 2UZKA 4BDYA 1HSTA 3PNYA 2VJ4A 2VKEA 2V1NA 2LC2A 4IO9F 1LKXA 3PQJA 1GXPA 1FY7A 4PSXA 1MMSA 3HYIA 1IF1A 3ZN1A 2HYJA 3ESWB 2EFPA 3KP3A 2LY9A 3F8BA 3L2CA 1WGXA 1I5ZA 5D6EA 5E79C 2Z16A 1YLFA 1FYMA 4II2A 1IRFA 3HOTA 3FXMA 2QQ8A 4DBQA 1J59A 1WJAA 4AIDA 4CCKA 2AS5F 3CLOA 1QVUA 3E6MA 2OBPA 3UKGA 4RLFA 3S17J 5FFXA 4A5NA 3SXYA 2QCOA 3S3OA 1SC7A 4UUSB 4KMUX 4E7SA 2RC4A 2X1DA 3LNQA 2A68F 3I53A 1USTA 3JCUC 3RKYA 2GAUA 4ON0A 3JTHA 4XICA 4LG0A 4F52A 1Y39A 4MNUA 2W24A 1T95A 2E7XA 2IJLA 2YU3A 3E6DA 4M6XA 3EUAA 1D5VA 2LRDA 1DGRM 4Q48A 5CKTA 3OYFA 5EZHA 1A36A 4HLYA 4IHTA 4J01A 1VQ5I 1FBQA 4P9FA 3L2UA 1LQ1A 2MD0A 2VC0A 2QF7A 4HX7A 5LEKA 5AIPA 1IXSB 4O5VA 1WJDA 3HPGA 2E60A 3L2QA 1QGPA 1X3WB 2JPCA 2HQNA 2WAQN 1JKRC 1ZTRA 2ME0A 3GF2A 3QU6A 3A01A 2EZKA 5F1RA 4KMFA 3L09A 3IAM2 1R23A 3BTJA 3HGGA 4A5MA 2ELKA 3OYDA 1I1GA 4XOTA 1QZZA 4EGZA 2R7FA 5J4VA 4DNCA 5HLGA 4OMZA 1IRGA 2VKHA 1XTAA 4UVCA 1MD0A 3GLLA 3H36A 4I6ZA 4A3MJ 1P7IA 3H3UA 4II3A 1ONVA 4FT8A 1OR7C 2FMLA 4V2FA 3GCMA 4BXUA 3BWGA 4U0YA 1ZN2A 2NOGA 3I4NJ 3SYTA 3DP7A 1A5JA 3S1RJ 5K5OA 3J80Z 2HKOA 3MZ8A 2M45A 4JOMA 4RB1A 1FYLA 2L5QA 4PZJA 1IV6A 3PNVA 3K70D 1ETKA 2QYOA 3K2ZA 4P1WA 5ILVA 2CQNA 2M1BA 2M30A 2FQ3A 2NVQJ 1OR7A 3J80K 4A3CJ 3E1SA 4QSHA 3TW6A 3IWZA 5JVTA 2D45A 3G3ZA 1FWZA 4Q47A 4XSXF 2W82A 4CCMA 4HX8A 2H8WA 3A02A 1WJFA 2F5FA 4CSWA 4CCLA 4NC8A 3K0LA 1D5YA 5GAGJ 2ZBKA 4E7ZA 2CYYA 2E34A 2Y69H 2YS9A 4EM0B 2WB1A 2R93J 3IHUA 1Z67A 2LYCA 3RTRA 2HWVA 3TW7A 1OPCA 1TBXA 5BOXA 5CLSA 3ZN0A 5CJ9A 1TWAJ 3DV8A 2KIMA 1Y1VJ 2R7TA 5FKOA 5ILSA 4BE1A 3V7CA 4M3EA 3PNTA 4UUTA 5ED4A 5E3NA 3B02A 2F4OB 3BJOA 3RPUA 1WPKA 2HKXA 1FYKA 4BQNA 2A69F 4QLCU 4M9XA 1D3YA 1VI0A 3ZMVA 1N78A 1R00A 2K9QA 4HEA2 4BJTA 3PJRA 2HNHA 3U1DA 3BZCA 2K9SA
chains in the Genus database with same CATH topology
1K78B 2ZCWA 1F9NA 2EFNA 4AIKA 4A0XA 5LGTA 2JRTA 3FX3A 5F6FA 1G6NA 3FXUA 4WXDA 1D8JA 1USSA 3MZHA 3CDHA 2FOKA 2JZYA 2BBYA 4H0EA 4UVAA 1J0RA 2DK8A 2NS0A 1MDMB 3L9FA 2Y48A 1KA8A 1X3UA 3WE3A 2ZNZA 3R4KA 4UNOA 4L5IA 5KVRA 3M9AA 3KE2A 3DQVC 1ZRFA 5IT9Z 1T98A 1EH6A 4KIBA 2IW5A 1MDMA 1S6LA 1HKQA 1LEAA 1EV7A 5IT9K 3J81Z 1BIBA 1U5TC 4OIOF 1SD5A 1ZARA 5EEGA 3LFKA 4U0WA 5E8IA 5J8CA 1XD7A 1U78A 1CGPA 2DT5A 2L02A 2H6CA 3DXJF 4HOBA 1GHCA 1FPQA 4EMSA 2QQ9A 5FFZA 3CO6C 1QZYA 3FMQA 2DO7A 2L01A 1ZG1A 4NHJA 4P9UA 1U5TA 4M9ZA 3QPHA 2LDUA 2XASA 2DU9A 4EVIA 2HEOA 2Q0OA 3G73A 4Q5SF 6PAXA 1QO0D 3KLNA 1ULYA 3WTXC 3SFZA 2WTEA 3K9TA 1PP8F 5JI6A 1ZG3A 2A61A 2M5WA 3T8RA 3EETA 4ETSA 1AWCA 1ZG5A 2K02A 1I1SA 2NAZA 5HDKA 1BN5A 2RDPA 2P5KA 2E1CA 3V7SA 4LK0F 1BOAA 3E6CC 2OAZA 2F5CA 5LHIA 4UHTA 2H6BA 2G9WA 3KLOA 4F7ZA 3RDIA 2F5DA 2OQRA 3GLXA 2DQLA 4D0PA 1ZGAA 5FD6A 1J75A 1F4KA 3O3KA 4GXOA 1JGSA 3O6BB 2QBYA 3RPQA 2Z3YA 4LLNA 2HDCA 1S7AA 4OIRF 2FNAA 1PUEE 2PI0A 1R22A 1MJBA 2ZJ2A 3GYHX 1C0WA 1AOYA 2DI3A 1PDNC 1IW7F 2VOOA 4Y15A 4HZFA 1QPMA 2L4AA 3GX4X 4EJUA 4EJOA 1EH8A 2E1NA 4LMYA 4RAZA 1HBXG 1W7PB 4RB2C 3TO7A 1SFEA 3VOEA 5J8FA 3R61A 2ETHA 3IKTA 1IN5A 1H9GA 2DW4A 1MJAA 1KYWA 1UHMA 4L9VA 1ZRDA 4A0ZA 1IUYA 1IN6A 1PP7U 2STWA 2V1XA 1TLHB 2QVOA 3ECHA 2E7WA 3GXOA 3WTTC 5ERIA 4ZH4F 3HHGA 5CVJA 3KEOA 3M1EA 4BYYA 5J6XA 1WRJA 2IA1A 1H9TA 2FBHA 4IXAA 2PN6A 2P7VB 2DTRA 4HAMA 4L0YB 2O61A 3HRUA 3KP7A 1T0FA 1JXSA 5TRDA 4KNYA 2IPQX 3ULQB 3F6VA 4HDUA 1BC7C 2GXGA 1TNSA 2FF4A 2JPBA 5ICCA 2EV5A 1B1BA 3BOQA 1J7KA 1U3EM 4CYDA 3AAFA 2AXLA 1O57A 3I58A 1H0MA 3DPLC 4BH9A 2LSOA 2QM3A 3CUQB 1J5YA 1FX7A 3IKVA 4CICA 1B9MA 4MTDA 4P96A 3NRVA 2IVMA 1WQ2A 3D0SA 2ZO4A 2WV0A 3ROUA 2Z99A 2ADUA 3Q5FA 4RAYA 5L3EA 2VN2A 3E5QA 4L9NA 1SD6A 1ZREA 2BE5F 2LF8A 1TW2A 4L5JA 1T2KA 2M8EA 1TQPA 3DEUA 4HF0A 4HX4A 1K79A 2LF7A 1KYZA 2UXXA 1YW8A 5H20A 4A6EA 4PGHA 3WTVC 2GWRA 5CVIA 3ABTA 2NNNA 2BGCA 5L3CA 1O3SA 3I71A 2GXBA 1A04A 2FBIA 2MD5A 2VOPA 3U2RA 3J7AO 1F1ZA 3CUOA 1HW2A 2R3SA 2L4MA 1YIOA 3KETA 1SD4A 4HBLA 2QQAA 3WG9A 2OQGA 1HW5A 2NRAC 5LRRA 1R1TA 1KGSA 4OOIA 2PBIA 3GFJA 3COAC 3U9GA 1QQIA 1G3YA 2PMHA 3QAHA 4CZZA 4LG0B 4CXFA 2XHKA 4XSZF 1W5TA 3M8FA 2KIUA 4I2OA 3W6KB 2H94A 5AONA 3JSPA 4M73A 1FSHA 4RGRA 3IL2A 4RB3C 5CYVA 4OMYA 2RQPA 3E6BA 2ZMEA 2ISYA 3BJ6A 1CF7A 3HSFA 3GFMA 4ENJA 2PFBA 4EM2A 4KYWA 1ON2A 3R60A 2XRNA 4IRHA 2MA3A 3JW4A 3IC7A 3ML6A 3I59A 1R1VA 4U7BA 3LQQA 2OZUA 4KUMA 5ICGA 4L9JA 3ECOA 3ZMSA 1XMKA 2HYFA 1OMIA 2X0LA 2NYXA 3F8CA 2VE9A 1WKMA 2YR2A 2DAOA 2MH9A 5HVQC 3P7NA 5HS8A 1U2WA 4WXHA 4ENMA 1RI7A 2C6YA 2CSOA 4G7HF 1KQ0A 1MGTA 3MWMA 3KEQA 1YQAA 2ISZA 3ELKA 4QWQA 2ELHA 4HA8A 3RJPA 2MLGA 4Y17A 2VODA 5CVUA 2W84A 1BJAA 3F3XA 1EH7A 5JHUA 2FA5A 1S7OA 3LA2A 5D4RA 3IRRA 3LQRA 2HTSA 4CHUA 3REOA 5FGMA 2OA4A 5DUKA 1YTYA 2P6TA 1KU9A 4WCGA 1FOKA 4ASNA 1WI9A 4OINF 3EYYA 4HQEA 1JE8A 2XIGA 1JHFA 5E1WA 2HZTA 4BAYA 2IA2A 2VT3A 2MC3A 1XSDA 3QRFF 5DDGA 1YS7A 3LWFA 4RGXA 2XAJA 3C7JA 5LBQA 4M71A 2DPDA 3RYPA 1Z6TA 2Z9OA 1V4RA 3FHZA 3O2PE 1DPUA 2FXAA 4IPAA 1MJ9A 2R7DA 4NB5A 5LGNA 1Z7UA 5BMZA 4GO1A 4R8HA 3I0TA 3VFZA 3FF5A 3B73A 1ODDA 4KT5C 1GXQA 4E70A 1ZHFA 2DPUA 2A3SA 4KA4A 5E20A 2FRHA 3GVAA 4UUVA 2EFOA 4O6JA 2FBKA 5DD8A 2ZXJA 3IWFA 3F21A 4I7HA 4WX9A 1U5TB 1ON1A 3HSEA 3Q9SA 1FT9A 3TO9A 4ESFA 4MQ9F 3J81K 1O3RA 3PQKA 3MCZA 4I02A 2RV8A 2HR3A 2EFQA 3WTZA 3EQLF 1P4AA 2DLLA 3I54A 3GZ5A 2XGXA 1P4WA 4A6DA 4AWXB 3LSTA 2XKPA 4U88A 1GVJA 4OIPF 1IZ1A 2K4JA 2VBZA 5FD5A 3EUHA 1UHWA 4HDVA 1TTYA 2P7CB 2CGPA 2G7HA 5K5RA 2Q8KA 4KFCA 1K6OA 5DD4A 1Q1HA 5ILUA 2Y75A 4S05A 1DUXC 4HF2A 3KFWX 2Z33A 2QZ8A 3HTUA 3F72A 4DQ2A 1W4MA 3F8MA 1SMTA 3FMRA 3BDDA 2QBYB 3GFIA 3T1BA 4GYIA 1QNTA 1IAWA 3NQOA 1BIAA 3ZQ7A 2FE3A 2ZFWA 5BPDA 3WU1B 2D1HA 3WE2A 1FBUA 2PJPA 1I27A 5EEHA 3R6SA 1LEBA 1W7PD 2UXNA 4L9TA 3LAJA 3TKYA 3KP2A 2VE8A 3L7WA 1LJ9A 3K69A 1G4DA 1RUNA 5DEQA 3MZYA 3KP4A 3DPTA 2A6HF 3HUGA 3OV8A 5DYMA 3E97A 1YW9A 1OYYA 1Z6RA 1U8RA 3QP5A 2CG4A 4IHSA 3SZPA 1UCRA 1P92A 4KIFA 3WTWC 5LLQA 4EJTA 2PEXA 2HTJA 2VXZA 3FXQA 1YYVA 5LHHA 3C18A 2CQKA 2GIVA 3S2WA 4B8XA 3SZTA 3RI4A 2W25A 2ESHA 1FSEA 4N9HA 5H6RA 5D6FA 1G3WA 1KQ9A 2XKOA 3V7RA 4XBFA 4EJVA 3HSRA 3FXRA 2K4BA 5BPIA 1KU7A 4I98B 4ZZDA 3VEPA 2HS5A 3RIRA 1L3LA 1XDSA 3TQNA 1SMYF 2VONA 4BQAA 3KZZA 4BNCA 1S3JA 3F23A 1P2FA 2KJCA 5HDGA 1IN4A 2DQRA 3E3VA 3I64A 3F6OA 4PCQA 4HYEA 1FBSA 5DCFA 1BBYA 1B4AA 4EV0A 4XRFA 2ACJA 2IRFG 4M9SA 2XROA 2IP2A 2CFXA 5E18F 1XGOA 4OU0A 5CVRA 1SD7A 4FX0A 1ZH5A 2IT0A 4YFNF 4RGUA 4AIJA 4HV6A 3TO6A 3QOPA 1YW7A 1BI0A 2RNJA 4GYGA 4A0YA 2YX4A 1HKTA 1FC3A 1REPC 5DUIA 1XCBA 1XSVA 3GO5A 4IVNA 4TV7A 1UB9A 2OU2A 3R0JA 2HOEA 2K7LA 3P9CA 2RVCA 4BHPA 2MH2A 4GCVA 1E17A 2UWMA 1ZLKA 4WWCA 4BHCA 4S04A 3SHFA 2P5LC 1B59A 2HQRA 3T5XA 2PG4A 4ZYEA 2W57A 3PFIA 4FHTA 3EDPA 1R36A 2VBYA 4IF4A 5BQTA 1VTNC 2KKOA 3JSOA 2HFHA 1T38A 5D8LB 2K86A 3V8JA 1R7JA 1TNTA 5E1ZB 5JR3A 1L0OC 1O7LA 3V8LA 3H3ZA 2KJBA 2TDXA 3WTSC 3BPVA 1O3TA 1WSUA 4G9YA 1QBJA 3HTSB 4M74A 3QP6A 2PQ8A 2JSCA 2G7UA 2KRFA 2ESNA 2H09A 1SAXA 1ZGJA 1RIOH 1LB2A 1LDJA 4P55A 1Z9CA 3BROA 3P9KA 2EV6A 2ZMEB 3C3WA 1CF7B 2GZWA 5D4SA 2Y0MA 4LLLA 3WU0A 2JT1A 5AIQA 2EWNA 4MTEA 4ZZLA 2YX7A 3TOBA 3JAMZ 1R5HA 1FLIA 5DCMA 1U6GA 4I0AA 2O3FA 2FNPA 1S29A 3I59B 2O8XA 2O6GE 3JAMK 2XAFA 1BI2A 4LGWA 1RZ4A 5HLIA 4G7OF 3K1PA 1OYIA 4Q4ZF 4B09A 2GQQA 4MQVA 4YIIA 2EJRA 2W85A 1B9NA 1J2XA 3KCCA 5JFRA 4EQQA 2A07F 3EYIA 2RGVA 3HOSA 3DKWA 4YFKF 4G8XA 2MLKA 4IJAA 4FX4A 3LA7A 3HIFA 4N0BA 1TQIA 1Z1DA 5LGUA 4LLGF 4CO8A 5HS7A 5L3BA 3P9IA 3W6JB 1P6RA 2KIFA 1BI1A 1FP2A 1KQ8A 3ISPA 3HRSA 4RS8A 5E17F 4WF2A 2A6EF 2QENA 2DBBA 2V6CA 2V1UA 3RYRA 4WK8F 4ENNA 1OYWA 4U7DA 1F5TA 2PMUA 2EB7A 5ICEA 2VC1A 3BY6A 2QLZA 2VBXA 5HLHA 3F8NA 3CTAA 2P5VA 1V3FA 2F5EA 3M8EA 1RUOA 3KP5A 4ENKA 4O3MA 1ZRCA 3R0AA 2V79A 3FM5A 2D2WA 3GUDA 1E2XA 4WXCA 1STZA 2FSWA 4CDGA 2HYGD 4KN7X 1IXCA 1MKMA 1ZLJA 3BJAA 1MZBA 3LA3A 3F8FA 4ZYHA 2HGCA 1SFXA 3HHHA 1UFMA 4UVBA 1R1UA 2EA4A 5ICFA 3MQ0A 4EGYA 3N97A 2OZ6A 1LNWA 1K78A 3T0YA 1FZPB 4MEYF 4HQMA 1OKRA 3DFGA 2DK5A 1HXDA 3NEUA 3E5UA 3FMSA 5DV5A 4G7ZF 5F64A 4LJZF 2EK5A 2XAQA 4N9IA 4JQFA 4A2UA 3C1DA 3ZMUA 3IRQA 5D8KB 1Y0UA 5D5VB 2FMYA 5L3FA 1XN7A 4OIQF 1BM9A 3ZMDA 1DDNA 2QWWA 1NHAA 2B0LA 2WWYA 4A12A 1YO5C 3BZ6A 2M87A 1TW3A 2V1DA 4MEXF 4LB5A 4JK1X 4G6QA 4AVPA 4HF1A 3ZPLA 1J9IA 2EFWA 3V4GA 1KU2A 4HW0A 5D5UB 1FP1D 1XGNA 1XGSA 3BP8A 1ZAOA 5E1XA 1DP7P 1HSJA 4YIFA 1D8KA 4ESJA 1O3QA 4ZYDA 1YS6A 5HS9A 5K1YA 3BPXA 4L0ZB 4AIHA 1LDDA 2BEOA 4UV9A 2CWEA 4GGGA 3VODA 1S8NA 5FO5A 5FB2A 2XAHA 1BI3A 1KU3A 1Z91A 2RKHA 1IXRC 1IN7A 2VT2A 3LAPA 3MFKA 3ZMZA 2ZKZA 3HRMA 2NNYA 2L54A 1ZYRF 2F2EA 4NQWA 2BYVE 2L3DA 2VBWA 4LD5A 1XCVA 4M72A 2MBFA 3WODF 4R79A 4ESBA 3V8KA 5CVVA 1XGMA 2DFIA 2J5OA 1HQCA 3DF8A 2QUFA 2XUBA 2FU4A 5H6QA 1YG2A 3T8TA 4RGSA 2PLYA 1W5SA 3JTGA 2LKPA 4I0BA 3ZP5A 3QU3A 2WC2A 2QQBA 2XVCA 2EA2A 2X4HA 3CJNA 3FWEA 4XLNF 3TDZC 5LRSA 1SFUA 3D5LA 5D5WB 3SQNA 3GEZA 1TQMA 4R1HA 5BS6A 2YSRA 3K1MA 2BV6A 3KP6A 1W7PA 5HDNA 3GFLA 3Q9VA 1IN8A 3FZVA 4JBAA 4CGZA 2RN7A 1G3TA 3OOPA 1HKSA 3M7GA 1R58A 3WTYC 4P5OA 1R5GA 1WWXA 4L18B 1FNNA 1T39A 4YG2F 5HOOA 5K5QA 4ZYGA 2GA1A 1LDKB 1T6SA 4KDPA 2OD5A 2CW0F 2XV4S 4LB6B 3TDUC 3I5UA 2O03A 3N4MA 1BC8C 4XLPF 4PGGA 3E5XA 4U0VA 5E8GA 3HRTA 4HLXA 4LFUA 2Z5UA 2D1VA 4YFXF 5FLXZ 2STTA 3CUQC 2K27A 3RKXA 4G6DA 4UV8A 2COMA 4UXNA 2P4WA 1O7FA 5FLXK 2J5PA 4KN4X 3CO7C 3ABUA 1Z05A 5L3GA 4G94A 2A5YB 3K1NA 4KICA 4Y13A 4IRGA 4I09A 3CUQA 1JHHA 1LVAA 5LEJA 2YPRA 3KZYA 1K7AA 1XB4A 3TOAA 3F22A 5IT3A 2V9VA 2EV0A 4EM1A 4K2EA 5D5XB 3FM3A 3GZ6A 2IA0A 2H27A 1XDUA 2ZNYA 1RNLA 3GW2A 3QPTA 5TJJA 5A2QZ 3GWZA 4HV5A 3TGNA 1G3SA 4AD9A 3ERED 3MEXA 1DPRA 1I6XA 5A2QK 3MAJA 2P8TA 1YFHA 2LNBA 3H92A 5KK1A 4MGRA 4LK1F 1XMAA 4BHBA 4KIGA 5LHGA 2JTVA 3I4PA 4Z2YA 2P6SA 3RKWA 2Q2EA 5L3DA 4MHGA 3WTUC 4PDKA 4I01A 3WGIA 2O0YA 3WGGA 4M6YA 2GA2A 4IRIA 3WGHA 1XSXA 4EJWA 3ZMTA 4RB0A 1HW1A 1B6AA 2XAGA 3L00A 2CO5A 1P4XA 2FEZA 5DCMB 3VB2A 2UZKA 1HSTA 3PQJA 1GXPA 1FY7A 3HYIA 1IF1A 3ZN1A 2EFPA 3KP3A 3F8BA 3L2CA 1I5ZA 5D6EA 1YLFA 1FYMA 1IRFA 3HOTA 1J59A 2AS5F 3CLOA 3E6MA 2OBPA 5FFXA 4A5NA 3SXYA 4KMUX 2RC4A 2A68F 3I53A 1USTA 3RKYA 2GAUA 4ON0A 3JTHA 4LG0A 4MNUA 2W24A 2E7XA 2IJLA 2YU3A 3E6DA 4M6XA 1D5VA 4Q48A 4HLYA 4IHTA 1FBQA 4P9FA 1LQ1A 2VC0A 5LEKA 4HX7A 5AIPA 1IXSB 4O5VA 1QGPA 2JPCA 2HQNA 3GF2A 3QU6A 5F1RA 4KMFA 3L09A 1R23A 4A5MA 1I1GA 1QZZA 4EGZA 2R7FA 4DNCA 5HLGA 4OMZA 1IRGA 4UVCA 1MD0A 3H3UA 1ONVA 4FT8A 2FMLA 4BXUA 3BWGA 4U0YA 1ZN2A 3DP7A 5K5OA 3J80Z 2HKOA 2M45A 4RB1A 1FYLA 4PZJA 2QYOA 3K2ZA 5ILVA 2M1BA 2M30A 2FQ3A 1OR7A 3J80K 3IWZA 5JVTA 2D45A 3G3ZA 1FWZA 4Q47A 4XSXF 4HX8A 2F5FA 3K0LA 2ZBKA 2CYYA 4EM0B 3IHUA 3RTRA 2HWVA 1OPCA 1TBXA 5BOXA 5CLSA 3ZN0A 5CJ9A 3DV8A 2KIMA 5ILSA 3V7CA 5ED4A 3B02A 3BJOA 3RPUA 2HKXA 1FYKA 2A69F 4QLCU 4M9XA 1D3YA 3ZMVA 1R00A 3U1DA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1K78 B;  2ZCW A;  1F9N A;  2EFN A;  4AIK A;  4A0X A;  5LGT A;  2JRT A;  3FX3 A;  5F6F A;  1G6N A;  3FXU A;  4WXD A;  1D8J A;  1USS A;  3MZH A;  3CDH A;  2FOK A;  2JZY A;  2BBY A;  4H0E A;  4UVA A;  1J0R A;  2DK8 A;  2NS0 A;  1MDM B;  3L9F A;  2Y48 A;  1KA8 A;  1X3U A;  3WE3 A;  2ZNZ A;  3R4K A;  4UNO A;  4L5I A;  5KVR A;  3M9A A;  3KE2 A;  3DQV C;  1ZRF A;  5IT9 Z;  1T98 A;  1EH6 A;  4KIB A;  2IW5 A;  1MDM A;  1S6L A;  1HKQ A;  1LEA A;  1EV7 A;  5IT9 K;  3J81 Z;  1BIB A;  1U5T C;  4OIO F;  1SD5 A;  1ZAR A;  5EEG A;  3LFK A;  4U0W A;  5E8I A;  5J8C A;  1XD7 A;  1U78 A;  1CGP A;  2DT5 A;  2L02 A;  2H6C A;  3DXJ F;  4HOB A;  1GHC A;  1FPQ A;  4EMS A;  2QQ9 A;  5FFZ A;  3CO6 C;  1QZY A;  3FMQ A;  2DO7 A;  2L01 A;  1ZG1 A;  4NHJ A;  4P9U A;  1U5T A;  4M9Z A;  3QPH A;  2LDU A;  2XAS A;  2DU9 A;  4EVI A;  2HEO A;  2Q0O A;  3G73 A;  4Q5S F;  6PAX A;  1QO0 D;  3KLN A;  1ULY A;  3WTX C;  3SFZ A;  2WTE A;  3K9T A;  1PP8 F;  5JI6 A;  1ZG3 A;  2A61 A;  2M5W A;  3T8R A;  3EET A;  4ETS A;  1AWC A;  1ZG5 A;  2K02 A;  1I1S A;  2NAZ A;  5HDK A;  1BN5 A;  2RDP A;  2P5K A;  2E1C A;  3V7S A;  4LK0 F;  1BOA A;  3E6C C;  2OAZ A;  2F5C A;  5LHI A;  4UHT A;  2H6B A;  2G9W A;  3KLO A;  4F7Z A;  3RDI A;  2F5D A;  2OQR A;  3GLX A;  2DQL A;  4D0P A;  1ZGA A;  5FD6 A;  1J75 A;  1F4K A;  3O3K A;  4GXO A;  1JGS A;  3O6B B;  2QBY A;  3RPQ A;  2Z3Y A;  4LLN A;  2HDC A;  1S7A A;  4OIR F;  2FNA A;  1PUE E;  2PI0 A;  1R22 A;  1MJB A;  2ZJ2 A;  3GYH X;  1C0W A;  1AOY A;  2DI3 A;  1PDN C;  1IW7 F;  2VOO A;  4Y15 A;  4HZF A;  1QPM A;  2L4A A;  3GX4 X;  4EJU A;  4EJO A;  1EH8 A;  2E1N A;  4LMY A;  4RAZ A;  1HBX G;  1W7P B;  4RB2 C;  3TO7 A;  1SFE A;  3VOE A;  5J8F A;  3R61 A;  2ETH A;  3IKT A;  1IN5 A;  1H9G A;  2DW4 A;  1MJA A;  1KYW A;  1UHM A;  4L9V A;  1ZRD A;  4A0Z A;  1IUY A;  1IN6 A;  1PP7 U;  2STW A;  2V1X A;  1TLH B;  2QVO A;  3ECH A;  2E7W A;  3GXO A;  3WTT C;  5ERI A;  4ZH4 F;  3HHG A;  5CVJ A;  3KEO A;  3M1E A;  4BYY A;  5J6X A;  1WRJ A;  2IA1 A;  1H9T A;  2FBH A;  4IXA A;  2PN6 A;  2P7V B;  2DTR A;  4HAM A;  4L0Y B;  2O61 A;  3HRU A;  3KP7 A;  1T0F A;  1JXS A;  5TRD A;  4KNY A;  2IPQ X;  3ULQ B;  3F6V A;  4HDU A;  1BC7 C;  2GXG A;  1TNS A;  2FF4 A;  2JPB A;  5ICC A;  2EV5 A;  1B1B A;  3BOQ A;  1J7K A;  1U3E M;  4CYD A;  3AAF A;  2AXL A;  1O57 A;  3I58 A;  1H0M A;  3DPL C;  4BH9 A;  2LSO A;  2QM3 A;  3CUQ B;  1J5Y A;  1FX7 A;  3IKV A;  4CIC A;  1B9M A;  4MTD A;  4P96 A;  3NRV A;  2IVM A;  1WQ2 A;  3D0S A;  2ZO4 A;  2WV0 A;  3ROU A;  2Z99 A;  2ADU A;  3Q5F A;  4RAY A;  5L3E A;  2VN2 A;  3E5Q A;  4L9N A;  1SD6 A;  1ZRE A;  2BE5 F;  2LF8 A;  1TW2 A;  4L5J A;  1T2K A;  2M8E A;  1TQP A;  3DEU A;  4HF0 A;  4HX4 A;  1K79 A;  2LF7 A;  1KYZ A;  2UXX A;  1YW8 A;  5H20 A;  4A6E A;  4PGH A;  3WTV C;  2GWR A;  5CVI A;  3ABT A;  2NNN A;  2BGC A;  5L3C A;  1O3S A;  3I71 A;  2GXB A;  1A04 A;  2FBI A;  2MD5 A;  2VOP A;  3U2R A;  3J7A O;  1F1Z A;  3CUO A;  1HW2 A;  2R3S A;  2L4M A;  1YIO A;  3KET A;  1SD4 A;  4HBL A;  2QQA A;  3WG9 A;  2OQG A;  1HW5 A;  2NRA C;  5LRR A;  1R1T A;  1KGS A;  4OOI A;  2PBI A;  3GFJ A;  3COA C;  3U9G A;  1QQI A;  1G3Y A;  2PMH A;  3QAH A;  4CZZ A;  4LG0 B;  4CXF A;  2XHK A;  4XSZ F;  1W5T A;  3M8F A;  2KIU A;  4I2O A;  3W6K B;  2H94 A;  5AON A;  3JSP A;  4M73 A;  1FSH A;  4RGR A;  3IL2 A;  4RB3 C;  5CYV A;  4OMY A;  2RQP A;  3E6B A;  2ZME A;  2ISY A;  3BJ6 A;  1CF7 A;  3HSF A;  3GFM A;  4ENJ A;  2PFB A;  4EM2 A;  4KYW A;  1ON2 A;  3R60 A;  2XRN A;  4IRH A;  2MA3 A;  3JW4 A;  3IC7 A;  3ML6 A;  3I59 A;  1R1V A;  4U7B A;  3LQQ A;  2OZU A;  4KUM A;  5ICG A;  4L9J A;  3ECO A;  3ZMS A;  1XMK A;  2HYF A;  1OMI A;  2X0L A;  2NYX A;  3F8C A;  2VE9 A;  1WKM A;  2YR2 A;  2DAO A;  2MH9 A;  5HVQ C;  3P7N A;  5HS8 A;  1U2W A;  4WXH A;  4ENM A;  1RI7 A;  2C6Y A;  2CSO A;  4G7H F;  1KQ0 A;  1MGT A;  3MWM A;  3KEQ A;  1YQA A;  2ISZ A;  3ELK A;  4QWQ A;  2ELH A;  4HA8 A;  3RJP A;  2MLG A;  4Y17 A;  2VOD A;  5CVU A;  2W84 A;  1BJA A;  3F3X A;  1EH7 A;  5JHU A;  2FA5 A;  1S7O A;  3LA2 A;  5D4R A;  3IRR A;  3LQR A;  2HTS A;  4CHU A;  3REO A;  5FGM A;  2OA4 A;  5DUK A;  1YTY A;  2P6T A;  1KU9 A;  4WCG A;  1FOK A;  4ASN A;  1WI9 A;  4OIN F;  3EYY A;  4HQE A;  1JE8 A;  2XIG A;  1JHF A;  5E1W A;  2HZT A;  4BAY A;  2IA2 A;  2VT3 A;  2MC3 A;  1XSD A;  3QRF F;  5DDG A;  1YS7 A;  3LWF A;  4RGX A;  2XAJ A;  3C7J A;  5LBQ A;  4M71 A;  2DPD A;  3RYP A;  1Z6T A;  2Z9O A;  1V4R A;  3FHZ A;  3O2P E;  1DPU A;  2FXA A;  4IPA A;  1MJ9 A;  2R7D A;  4NB5 A;  5LGN A;  1Z7U A;  5BMZ A;  4GO1 A;  4R8H A;  3I0T A;  3VFZ A;  3FF5 A;  3B73 A;  1ODD A;  4KT5 C;  1GXQ A;  4E70 A;  1ZHF A;  2DPU A;  2A3S A;  4KA4 A;  5E20 A;  2FRH A;  3GVA A;  4UUV A;  2EFO A;  4O6J A;  2FBK A;  5DD8 A;  2ZXJ A;  3IWF A;  3F21 A;  4I7H A;  4WX9 A;  1U5T B;  1ON1 A;  3HSE A;  3Q9S A;  1FT9 A;  3TO9 A;  4ESF A;  4MQ9 F;  3J81 K;  1O3R A;  3PQK A;  3MCZ A;  4I02 A;  2RV8 A;  2HR3 A;  2EFQ A;  3WTZ A;  3EQL F;  1P4A A;  2DLL A;  3I54 A;  3GZ5 A;  2XGX A;  1P4W A;  4A6D A;  4AWX B;  3LST A;  2XKP A;  4U88 A;  1GVJ A;  4OIP F;  1IZ1 A;  2K4J A;  2VBZ A;  5FD5 A;  3EUH A;  1UHW A;  4HDV A;  1TTY A;  2P7C B;  2CGP A;  2G7H A;  5K5R A;  2Q8K A;  4KFC A;  1K6O A;  5DD4 A;  1Q1H A;  5ILU A;  2Y75 A;  4S05 A;  1DUX C;  4HF2 A;  3KFW X;  2Z33 A;  2QZ8 A;  3HTU A;  3F72 A;  4DQ2 A;  1W4M A;  3F8M A;  1SMT A;  3FMR A;  3BDD A;  2QBY B;  3GFI A;  3T1B A;  4GYI A;  1QNT A;  1IAW A;  3NQO A;  1BIA A;  3ZQ7 A;  2FE3 A;  2ZFW A;  5BPD A;  3WU1 B;  2D1H A;  3WE2 A;  1FBU A;  2PJP A;  1I27 A;  5EEH A;  3R6S A;  1LEB A;  1W7P D;  2UXN A;  4L9T A;  3LAJ A;  3TKY A;  3KP2 A;  2VE8 A;  3L7W A;  1LJ9 A;  3K69 A;  1G4D A;  1RUN A;  5DEQ A;  3MZY A;  3KP4 A;  3DPT A;  2A6H F;  3HUG A;  3OV8 A;  5DYM A;  3E97 A;  1YW9 A;  1OYY A;  1Z6R A;  1U8R A;  3QP5 A;  2CG4 A;  4IHS A;  3SZP A;  1UCR A;  1P92 A;  4KIF A;  3WTW C;  5LLQ A;  4EJT A;  2PEX A;  2HTJ A;  2VXZ A;  3FXQ A;  1YYV A;  5LHH A;  3C18 A;  2CQK A;  2GIV A;  3S2W A;  4B8X A;  3SZT A;  3RI4 A;  2W25 A;  2ESH A;  1FSE A;  4N9H A;  5H6R A;  5D6F A;  1G3W A;  1KQ9 A;  2XKO A;  3V7R A;  4XBF A;  4EJV A;  3HSR A;  3FXR A;  2K4B A;  5BPI A;  1KU7 A;  4I98 B;  4ZZD A;  3VEP A;  2HS5 A;  3RIR A;  1L3L A;  1XDS A;  3TQN A;  1SMY F;  2VON A;  4BQA A;  3KZZ A;  4BNC A;  1S3J A;  3F23 A;  1P2F A;  2KJC A;  5HDG A;  1IN4 A;  2DQR A;  3E3V A;  3I64 A;  3F6O A;  4PCQ A;  4HYE A;  1FBS A;  5DCF A;  1BBY A;  1B4A A;  4EV0 A;  4XRF A;  2ACJ A;  2IRF G;  4M9S A;  2XRO A;  2IP2 A;  2CFX A;  5E18 F;  1XGO A;  4OU0 A;  5CVR A;  1SD7 A;  4FX0 A;  1ZH5 A;  2IT0 A;  4YFN F;  4RGU A;  4AIJ A;  4HV6 A;  3TO6 A;  3QOP A;  1YW7 A;  1BI0 A;  2RNJ A;  4GYG A;  4A0Y A;  2YX4 A;  1HKT A;  1FC3 A;  1REP C;  5DUI A;  1XCB A;  1XSV A;  3GO5 A;  4IVN A;  4TV7 A;  1UB9 A;  2OU2 A;  3R0J A;  2HOE A;  2K7L A;  3P9C A;  2RVC A;  4BHP A;  2MH2 A;  4GCV A;  1E17 A;  2UWM A;  1ZLK A;  4WWC A;  4BHC A;  4S04 A;  3SHF A;  2P5L C;  1B59 A;  2HQR A;  3T5X A;  2PG4 A;  4ZYE A;  2W57 A;  3PFI A;  4FHT A;  3EDP A;  1R36 A;  2VBY A;  4IF4 A;  5BQT A;  1VTN C;  2KKO A;  3JSO A;  2HFH A;  1T38 A;  5D8L B;  2K86 A;  3V8J A;  1R7J A;  1TNT A;  5E1Z B;  5JR3 A;  1L0O C;  1O7L A;  3V8L A;  3H3Z A;  2KJB A;  2TDX A;  3WTS C;  3BPV A;  1O3T A;  1WSU A;  4G9Y A;  1QBJ A;  3HTS B;  4M74 A;  3QP6 A;  2PQ8 A;  2JSC A;  2G7U A;  2KRF A;  2ESN A;  2H09 A;  1SAX A;  1ZGJ A;  1RIO H;  1LB2 A;  1LDJ A;  4P55 A;  1Z9C A;  3BRO A;  3P9K A;  2EV6 A;  2ZME B;  3C3W A;  1CF7 B;  2GZW A;  5D4S A;  2Y0M A;  4LLL A;  3WU0 A;  2JT1 A;  5AIQ A;  2EWN A;  4MTE A;  4ZZL A;  2YX7 A;  3TOB A;  3JAM Z;  1R5H A;  1FLI A;  5DCM A;  1U6G A;  4I0A A;  2O3F A;  2FNP A;  1S29 A;  3I59 B;  2O8X A;  2O6G E;  3JAM K;  2XAF A;  1BI2 A;  4LGW A;  1RZ4 A;  5HLI A;  4G7O F;  3K1P A;  1OYI A;  4Q4Z F;  4B09 A;  2GQQ A;  4MQV A;  4YII A;  2EJR A;  2W85 A;  1B9N A;  1J2X A;  3KCC A;  5JFR A;  4EQQ A;  2A07 F;  3EYI A;  2RGV A;  3HOS A;  3DKW A;  4YFK F;  4G8X A;  2MLK A;  4IJA A;  4FX4 A;  3LA7 A;  3HIF A;  4N0B A;  1TQI A;  1Z1D A;  5LGU A;  4LLG F;  4CO8 A;  5HS7 A;  5L3B A;  3P9I A;  3W6J B;  1P6R A;  2KIF A;  1BI1 A;  1FP2 A;  1KQ8 A;  3ISP A;  3HRS A;  4RS8 A;  5E17 F;  4WF2 A;  2A6E F;  2QEN A;  2DBB A;  2V6C A;  2V1U A;  3RYR A;  4WK8 F;  4ENN A;  1OYW A;  4U7D A;  1F5T A;  2PMU A;  2EB7 A;  5ICE A;  2VC1 A;  3BY6 A;  2QLZ A;  2VBX A;  5HLH A;  3F8N A;  3CTA A;  2P5V A;  1V3F A;  2F5E A;  3M8E A;  1RUO A;  3KP5 A;  4ENK A;  4O3M A;  1ZRC A;  3R0A A;  2V79 A;  3FM5 A;  2D2W A;  3GUD A;  1E2X A;  4WXC A;  1STZ A;  2FSW A;  4CDG A;  2HYG D;  4KN7 X;  1IXC A;  1MKM A;  1ZLJ A;  3BJA A;  1MZB A;  3LA3 A;  3F8F A;  4ZYH A;  2HGC A;  1SFX A;  3HHH A;  1UFM A;  4UVB A;  1R1U A;  2EA4 A;  5ICF A;  3MQ0 A;  4EGY A;  3N97 A;  2OZ6 A;  1LNW A;  1K78 A;  3T0Y A;  1FZP B;  4MEY F;  4HQM A;  1OKR A;  3DFG A;  2DK5 A;  1HXD A;  3NEU A;  3E5U A;  3FMS A;  5DV5 A;  4G7Z F;  5F64 A;  4LJZ F;  2EK5 A;  2XAQ A;  4N9I A;  4JQF A;  4A2U A;  3C1D A;  3ZMU A;  3IRQ A;  5D8K B;  1Y0U A;  5D5V B;  2FMY A;  5L3F A;  1XN7 A;  4OIQ F;  1BM9 A;  3ZMD A;  1DDN A;  2QWW A;  1NHA A;  2B0L A;  2WWY A;  4A12 A;  1YO5 C;  3BZ6 A;  2M87 A;  1TW3 A;  2V1D A;  4MEX F;  4LB5 A;  4JK1 X;  4G6Q A;  4AVP A;  4HF1 A;  3ZPL A;  1J9I A;  2EFW A;  3V4G A;  1KU2 A;  4HW0 A;  5D5U B;  1FP1 D;  1XGN A;  1XGS A;  3BP8 A;  1ZAO A;  5E1X A;  1DP7 P;  1HSJ A;  4YIF A;  1D8K A;  4ESJ A;  1O3Q A;  4ZYD A;  1YS6 A;  5HS9 A;  5K1Y A;  3BPX A;  4L0Z B;  4AIH A;  1LDD A;  2BEO A;  4UV9 A;  2CWE A;  4GGG A;  3VOD A;  1S8N A;  5FO5 A;  5FB2 A;  2XAH A;  1BI3 A;  1KU3 A;  1Z91 A;  2RKH A;  1IXR C;  1IN7 A;  2VT2 A;  3LAP A;  3MFK A;  3ZMZ A;  2ZKZ A;  3HRM A;  2NNY A;  2L54 A;  1ZYR F;  2F2E A;  4NQW A;  2BYV E;  2L3D A;  2VBW A;  4LD5 A;  1XCV A;  4M72 A;  2MBF A;  3WOD F;  4R79 A;  4ESB A;  3V8K A;  5CVV A;  1XGM A;  2DFI A;  2J5O A;  1HQC A;  3DF8 A;  2QUF A;  2XUB A;  2FU4 A;  5H6Q A;  1YG2 A;  3T8T A;  4RGS A;  2PLY A;  1W5S A;  3JTG A;  2LKP A;  4I0B A;  3ZP5 A;  3QU3 A;  2WC2 A;  2QQB A;  2XVC A;  2EA2 A;  2X4H A;  3CJN A;  3FWE A;  4XLN F;  3TDZ C;  5LRS A;  1SFU A;  3D5L A;  5D5W B;  3SQN A;  3GEZ A;  1TQM A;  4R1H A;  5BS6 A;  2YSR A;  3K1M A;  2BV6 A;  3KP6 A;  1W7P A;  5HDN A;  3GFL A;  3Q9V A;  1IN8 A;  3FZV A;  4JBA A;  4CGZ A;  2RN7 A;  1G3T A;  3OOP A;  1HKS A;  3M7G A;  1R58 A;  3WTY C;  4P5O A;  1R5G A;  1WWX A;  4L18 B;  1FNN A;  1T39 A;  4YG2 F;  5HOO A;  5K5Q A;  4ZYG A;  2GA1 A;  1LDK B;  1T6S A;  4KDP A;  2OD5 A;  2CW0 F;  2XV4 S;  4LB6 B;  3TDU C;  3I5U A;  2O03 A;  3N4M A;  1BC8 C;  4XLP F;  4PGG A;  3E5X A;  4U0V A;  5E8G A;  3HRT A;  4HLX A;  4LFU A;  2Z5U A;  2D1V A;  4YFX F;  5FLX Z;  2STT A;  3CUQ C;  2K27 A;  3RKX A;  4G6D A;  4UV8 A;  2COM A;  4UXN A;  2P4W A;  1O7F A;  5FLX K;  2J5P A;  4KN4 X;  3CO7 C;  3ABU A;  1Z05 A;  5L3G A;  4G94 A;  2A5Y B;  3K1N A;  4KIC A;  4Y13 A;  4IRG A;  4I09 A;  3CUQ A;  1JHH A;  1LVA A;  5LEJ A;  2YPR A;  3KZY A;  1K7A A;  1XB4 A;  3TOA A;  3F22 A;  5IT3 A;  2V9V A;  2EV0 A;  4EM1 A;  4K2E A;  5D5X B;  3FM3 A;  3GZ6 A;  2IA0 A;  2H27 A;  1XDU A;  2ZNY A;  1RNL A;  3GW2 A;  3QPT A;  5TJJ A;  5A2Q Z;  3GWZ A;  4HV5 A;  3TGN A;  1G3S A;  4AD9 A;  3ERE D;  3MEX A;  1DPR A;  1I6X A;  5A2Q K;  3MAJ A;  2P8T A;  1YFH A;  2LNB A;  3H92 A;  5KK1 A;  4MGR A;  4LK1 F;  1XMA A;  4BHB A;  4KIG A;  5LHG A;  2JTV A;  3I4P A;  4Z2Y A;  2P6S A;  3RKW A;  2Q2E A;  5L3D A;  4MHG A;  3WTU C;  4PDK A;  4I01 A;  3WGI A;  2O0Y A;  3WGG A;  4M6Y A;  2GA2 A;  4IRI A;  3WGH A;  1XSX A;  4EJW A;  3ZMT A;  4RB0 A;  1HW1 A;  1B6A A;  2XAG A;  3L00 A;  2CO5 A;  1P4X A;  2FEZ A;  5DCM B;  3VB2 A;  2UZK A;  1HST A;  3PQJ A;  1GXP A;  1FY7 A;  3HYI A;  1IF1 A;  3ZN1 A;  2EFP A;  3KP3 A;  3F8B A;  3L2C A;  1I5Z A;  5D6E A;  1YLF A;  1FYM A;  1IRF A;  3HOT A;  1J59 A;  2AS5 F;  3CLO A;  3E6M A;  2OBP A;  5FFX A;  4A5N A;  3SXY A;  4KMU X;  2RC4 A;  2A68 F;  3I53 A;  1UST A;  3RKY A;  2GAU A;  4ON0 A;  3JTH A;  4LG0 A;  4MNU A;  2W24 A;  2E7X A;  2IJL A;  2YU3 A;  3E6D A;  4M6X A;  1D5V A;  4Q48 A;  4HLY A;  4IHT A;  1FBQ A;  4P9F A;  1LQ1 A;  2VC0 A;  5LEK A;  4HX7 A;  5AIP A;  1IXS B;  4O5V A;  1QGP A;  2JPC A;  2HQN A;  3GF2 A;  3QU6 A;  5F1R A;  4KMF A;  3L09 A;  1R23 A;  4A5M A;  1I1G A;  1QZZ A;  4EGZ A;  2R7F A;  4DNC A;  5HLG A;  4OMZ A;  1IRG A;  4UVC A;  1MD0 A;  3H3U A;  1ONV A;  4FT8 A;  2FML A;  4BXU A;  3BWG A;  4U0Y A;  1ZN2 A;  3DP7 A;  5K5O A;  3J80 Z;  2HKO A;  2M45 A;  4RB1 A;  1FYL A;  4PZJ A;  2QYO A;  3K2Z A;  5ILV A;  2M1B A;  2M30 A;  2FQ3 A;  1OR7 A;  3J80 K;  3IWZ A;  5JVT A;  2D45 A;  3G3Z A;  1FWZ A;  4Q47 A;  4XSX F;  4HX8 A;  2F5F A;  3K0L A;  2ZBK A;  2CYY A;  4EM0 B;  3IHU A;  3RTR A;  2HWV A;  1OPC A;  1TBX A;  5BOX A;  5CLS A;  3ZN0 A;  5CJ9 A;  3DV8 A;  2KIM A;  5ILS A;  3V7C A;  5ED4 A;  3B02 A;  3BJO A;  3RPU A;  2HKX A;  1FYK A;  2A69 F;  4QLC U;  4M9X A;  1D3Y A;  3ZMV A;  1R00 A;  3U1D A; 
#chains in the Genus database with same CATH topology
 2M3A A;  1K78 B;  2L9R A;  2ZCW A;  2CV0 A;  1JI8 A;  1F9N A;  2EFN A;  1RR8 C;  2F5V A;  4AIK A;  4A0X A;  5LGT A;  2JRT A;  2BY2 A;  1UJ8 A;  3PIP F;  3OYM A;  3FX3 A;  5F6F A;  1G6N A;  3ASO H;  4M3B A;  2KDO A;  3FXU A;  1D0Z A;  4WXD A;  2LLK A;  1D8J A;  1USS A;  3MZH A;  3CDH A;  2FOK A;  2JZY A;  2BBY A;  4H0E A;  4UVA A;  3JRH A;  1J0R A;  2DK8 A;  2NS0 A;  1MDM B;  3SJM A;  4BE0 A;  3L9F A;  1K61 A;  3DBH B;  2Y48 A;  3QYE A;  1KA8 A;  2JA7 J;  1X3U A;  3WE3 A;  2ZNZ A;  3R4K A;  4UNO A;  4L5I A;  5KVR A;  3ZQG A;  3IP4 B;  3M9A A;  4KT6 A;  3KE2 A;  3GZN B;  4NUB A;  3ASN H;  1A31 A;  4FCY A;  2XDV A;  3DQV C;  1ZRF A;  2E35 A;  2R7V A;  1T98 A;  5IT9 Z;  1EH6 A;  4QIW N;  4KIB A;  4XOP A;  1F36 A;  2IW5 A;  3LSM A;  1MDM A;  1S6L A;  2ME6 A;  2L2O A;  1HKQ A;  3RCO A;  4C9Y A;  1LEA A;  1EV7 A;  4YEJ A;  2V9P A;  2V26 A;  2ID6 A;  3SEZ A;  5IT9 K;  3J81 Z;  1BIB A;  1U5T C;  4OIO F;  1SD5 A;  4XRS A;  2PJR B;  1ZAR A;  5EEG A;  5E3O A;  3LFK A;  4IQJ A;  4U0W A;  5E8I A;  2ZC2 A;  5J8C A;  1XD7 A;  1IO2 A;  2CW8 A;  3CCL I;  1U78 A;  4CA0 A;  1N77 A;  1CGP A;  3RZO J;  2DA6 A;  1ETY A;  3G4S I;  2DT5 A;  2L02 A;  3LOC A;  1Y8R B;  2CS3 A;  2H6C A;  3DXJ F;  4HOB A;  4C2T A;  3GTO J;  2MG4 A;  1GHC A;  1FPQ A;  4EMS A;  4IHW A;  2QQ9 A;  5FFZ A;  3CO6 C;  2PJR A;  1QZY A;  2NS7 A;  3VPR A;  3FMQ A;  2DO7 A;  2L01 A;  1ZG1 A;  4NHJ A;  1MBH A;  1Y6I A;  3IH2 A;  2JK3 A;  4P9U A;  2AXT C;  1U5T A;  4M9Z A;  3QPH A;  1YRN B;  5IP7 J;  2LDU A;  1I6H J;  1W5C C;  3JRI A;  2XAS A;  3AG3 H;  3S3N A;  3S14 J;  2DU9 A;  4EVI A;  3AG2 H;  2HEO A;  2Q0O A;  2Y30 A;  3LMM A;  3G73 A;  3BR3 A;  4Q5S F;  6PAX A;  1QO0 D;  3KLN A;  2W4S A;  3K6G A;  3W2V A;  1ULY A;  4UY8 I;  3WTX C;  4A69 C;  3SFZ A;  2WTE A;  3K9T A;  2E1M C;  2M4K A;  1PP8 F;  5JI6 A;  1ZG3 A;  1JJ8 C;  2A61 A;  2K85 A;  2M5W A;  2ZXW H;  2WB1 N;  3K4L A;  3NWT A;  3T8R A;  3EET A;  4ETS A;  3I3L A;  5FKN A;  2E1M B;  1AWC A;  1ZG5 A;  2K02 A;  3H0D A;  1X4O A;  2I5U A;  2Z2S B;  1I1S A;  2NAZ A;  4HRI A;  5HDK A;  1BN5 A;  1WH7 A;  2P5K A;  2RDP A;  2VB6 A;  1FTT A;  1GLN A;  2E1C A;  3V7S A;  2W00 A;  4LK0 F;  1BOA A;  3E6C C;  3S16 J;  5LFA A;  3OIP A;  1ZK8 A;  4C3I J;  4XM3 A;  1TC3 C;  2HDD A;  2OAZ A;  2F5C A;  5LHI A;  4UHT A;  2H6B A;  2G9W A;  3HBL A;  4C2U A;  4PJN A;  2GM4 A;  3KLO A;  4F7Z A;  2AQF A;  1TP4 A;  2F5D A;  1V54 H;  2OQR A;  3GLX A;  2EZI A;  3RDI A;  5EG0 B;  4IL6 C;  2DQL A;  4B3X A;  1VQ8 I;  1OCR H;  1U9O A;  4D0P A;  1ZGA A;  5FD6 A;  3BTC A;  4J00 A;  1J75 A;  4XLC A;  1F4K A;  4N4N B;  4AM3 A;  1Y0N A;  2EBI A;  2XAU A;  3O3K A;  2DA7 A;  2VLA A;  3HOY J;  3S2D J;  4GXO A;  2OTJ I;  1JGS A;  3O6B B;  3HZJ A;  3HOZ J;  4C30 A;  2BVM A;  1XX5 A;  2QBY A;  2GBY A;  3RPQ A;  1ORK A;  2Z3Y A;  4LLN A;  2HDC A;  2L7Z A;  4IHY A;  1S7A A;  2LH9 A;  4OIR F;  2FNA A;  1PUE E;  2PI0 A;  1DGW Y;  1R22 A;  2DA3 A;  3BR5 A;  4ZDO A;  1MJB A;  2L0K A;  2ZJ2 A;  3GYH X;  2E36 A;  1C0W A;  1AOY A;  1BL0 A;  2DI3 A;  1PDN C;  1IW7 F;  2VOO A;  2XF5 A;  1V5G A;  4Y15 A;  4HZF A;  1QPM A;  1Z21 A;  2L4A A;  3GX4 X;  1H89 C;  4YEL A;  2ZJR F;  4EJU A;  3KYL A;  4EJO A;  2K3F A;  4UB8 C;  1EH8 A;  3LL7 A;  3OS1 A;  2E1N A;  4LMY A;  1SVM A;  2MW8 A;  3CES A;  4RAZ A;  1R4M B;  5KAF C;  2Y0S A;  3BC8 A;  1HBX G;  1W7P B;  4RB2 C;  2XGD A;  3TO7 A;  1XS9 A;  1SFE A;  3VOE A;  4DYC A;  5IP9 J;  3E7L A;  5J8F A;  3IUO A;  3R61 A;  3BG5 A;  2ETH A;  4XLE A;  1YJ9 I;  2UUZ A;  3IKT A;  1IN5 A;  2H1K A;  1H9G A;  2DW4 A;  2JUC A;  1MJA A;  2IGN A;  5BNG A;  1RPW A;  4XNF A;  1KYW A;  5E3M A;  1UHM A;  4L9V A;  2NXN B;  1ZRD A;  1YX3 A;  4A0Z A;  1IUY A;  2XPV A;  1IN6 A;  1PP7 U;  3H5N A;  2STW A;  3PUB A;  5C4X J;  2V1X A;  1TLH B;  2QVO A;  5C4J J;  2N8G A;  2X6O A;  3ECH A;  3I4M J;  2BY0 A;  4XOR A;  3HC7 A;  2E7W A;  3GXO A;  2E5Z A;  3WTT C;  5ERI A;  3H3V K;  2CU7 A;  1MBJ A;  3F0C A;  4ZH4 F;  2ZXI A;  1T0F C;  1J09 A;  2KDZ A;  3HHG A;  4A3F J;  5CVJ A;  3KEO A;  3M1E A;  4JX4 A;  2DA4 A;  4BYY A;  2IGK A;  5J6X A;  1WRJ A;  1MBE A;  2BW3 A;  2IA1 A;  1UG2 A;  3NAU A;  2A05 A;  1H9T A;  2FBH A;  3PIO F;  4IXA A;  2PN6 A;  2P7V B;  2HVR A;  2DTR A;  1H8A C;  3FBI B;  4HAM A;  4L0Y B;  2VQH A;  2O61 A;  3HRU A;  3HL2 A;  2FOW A;  3KP7 A;  4RBO A;  1T0F A;  1JXS A;  5GTI C;  5TRD A;  4KNY A;  2IPQ X;  3ULQ B;  4DZJ A;  3F6V A;  4HDU A;  2X1E A;  1BC7 C;  4OAY A;  2DOF A;  2GXG A;  1TNS A;  2FF4 A;  1E0E A;  3OYI A;  2ELJ A;  2JPB A;  1U0J A;  5ICC A;  1UHS A;  2EV5 A;  1B1B A;  2NOJ B;  3BOQ A;  1J7K A;  1U3E M;  3H5A A;  3CCJ I;  4DYQ A;  2FUG 2;  4PUS A;  1MBF A;  4HG2 A;  1SAN A;  4CYD A;  3AAF A;  3M1C A;  2AXL A;  1O57 A;  3I58 A;  1H0M A;  3CD6 I;  3DPL C;  4BH9 A;  5HOD A;  1U8B A;  3K4B A;  1WVR A;  3HOW J;  2LSO A;  2QM3 A;  3CUQ B;  4FE4 A;  1J5Y A;  1LVK A;  1FX7 A;  3IKV A;  1R6R A;  2CUE A;  1B9M A;  4CIC A;  4P96 A;  4MTD A;  3LSP A;  3NRV A;  1NH3 A;  2IVM A;  1WQ2 A;  3D0S A;  3S8P A;  2ZO4 A;  2XC7 A;  2WV0 A;  3ROU A;  4B47 A;  2Z99 A;  2ADU A;  1EF4 A;  3DKY A;  3OOU A;  4E6K G;  4Y7N J;  3Q5F A;  4RAY A;  1AKH B;  5L3E A;  2VN2 A;  3E5Q A;  4X0G A;  4L9N A;  1SD6 A;  4W97 A;  1ZRE A;  4BJ6 C;  3OYJ A;  2HVS A;  1XMX A;  3OIO A;  4MFE A;  2BE5 F;  3K4N A;  3DBR B;  1GUU A;  2LF8 A;  5CQG A;  1JKP C;  1TW2 A;  4G12 A;  3SDG A;  4L5J A;  4XRS G;  1SVO A;  1T2K A;  1JUP A;  3GTG J;  2M8E A;  5FKM A;  4HNV A;  2JA8 J;  1TQP A;  3DEU A;  2Y0S N;  4HF0 A;  4HX4 A;  4LOC A;  1K79 A;  2IS1 A;  2X48 A;  1V5E A;  3I55 I;  2H8R A;  2LF7 A;  1KYZ A;  2CW7 A;  4BXX J;  2UXX A;  1YW8 A;  5H20 A;  4A6E A;  4AU7 A;  3V42 A;  3BG3 A;  4PGH A;  4XKB A;  3ZR8 X;  2ZJP F;  2DT6 A;  2OV7 A;  3BR2 A;  2GWR A;  3BQZ A;  5J1U A;  3WTV C;  1G59 A;  2JA5 J;  2JWT A;  5CVI A;  4BE2 A;  1Y8Q B;  2DJI A;  1IG7 A;  1OQY A;  5DTD A;  3HOX J;  3ABT A;  2KP6 A;  2NNN A;  2BGC A;  4FTH A;  1PUF B;  5L3C A;  4BY1 J;  1IDY A;  5IOZ A;  1JT6 A;  1O3S A;  3CCV I;  1LFB A;  3M3Y J;  3I71 A;  4PJ0 C;  3HPH A;  5B66 C;  1B8I A;  4BGD A;  1YJN I;  2X6Y A;  2UV1 A;  2HZD A;  3VYR B;  2GXB A;  3GME A;  1TZL A;  1A04 A;  3UR3 C;  2FBI A;  3C2B A;  1PUF A;  2MD5 A;  2Y31 A;  2QSH X;  3U2R A;  3FK7 A;  2VOP A;  3J7A O;  2ECC A;  2AHQ A;  1I39 A;  1F1Z A;  3CUO A;  3LFU A;  1HW2 A;  5K7H A;  4XRM A;  2R3S A;  2L4M A;  1YIO A;  1MND A;  3KET A;  2WY8 Q;  1D0X A;  1YOV B;  4M3G A;  1SD4 A;  4HBL A;  3ZXS A;  3CDL A;  2QQA A;  4HPQ A;  1T8I A;  1UAA A;  1FOX A;  3WG9 A;  3QPS A;  1EKE A;  2OQG A;  3VYT B;  3SDB A;  1HW5 A;  2M0C A;  3CCU I;  5J47 A;  1X2N A;  3JRG A;  3OYB A;  2NRA C;  3ABK H;  2R7U A;  5LRR A;  1XG1 A;  1R1T A;  1KGS A;  3E0J B;  4OOI A;  3TBI A;  4ZTF A;  3OSG A;  2KPM A;  4C3H J;  2PBI A;  3GFJ A;  2ZME C;  3COA C;  1AHD P;  3QWL A;  4XLH A;  3U9G A;  1QQI A;  3HG9 A;  2JUG A;  2X1C A;  1G3Y A;  1JTX A;  2PMH A;  3QAH A;  4CZZ A;  4LG0 B;  3N05 A;  2XHK A;  4CXF A;  4XSZ F;  4PK4 A;  1W5T A;  1TT0 A;  3M8F A;  3DWL E;  2KIU A;  3AG1 H;  3KYD B;  4I2O A;  3W6K B;  2H94 A;  5AON A;  2VIX A;  3JSP A;  5J40 A;  2EPF A;  2DMU A;  1G2H A;  1LFU P;  4M73 A;  4BY7 J;  1FSH A;  2EIN H;  4RGR A;  1T08 B;  3IL2 A;  1YX5 A;  5DM6 F;  2LVS A;  5J1Y A;  5GPC A;  5CYV A;  4RB3 C;  4OMY A;  5B3S H;  1W0T A;  2RQP A;  3E6B A;  2ZME A;  2ISY A;  3BJ6 A;  2CQ7 A;  4RM3 A;  2AQE A;  2MAB A;  1CF7 A;  3HSF A;  1R71 A;  3FXJ A;  3GFM A;  3FHN A;  1SFO J;  3H1C A;  3S93 A;  4ENJ A;  2PFB A;  4EM2 A;  4KYW A;  1ON2 A;  1G8X A;  3R60 A;  2XRN A;  3A01 B;  2IS6 A;  2IGO A;  3BTL A;  4N4O B;  1VQ7 I;  2LBF A;  3JRD A;  4IRH A;  2MA3 A;  2XB0 X;  3JW4 A;  3IC7 A;  5JLW A;  4MFD A;  1X1D A;  3ML6 A;  1QZE A;  3I59 A;  1NTC A;  1R1V A;  4U7B A;  3CC4 I;  2FJ1 A;  3LQQ A;  1MMA A;  2OZU A;  4KUM A;  5ICG A;  3FKJ A;  3VYS B;  4L9J A;  3ECO A;  4DW6 A;  3ZMS A;  1ERD A;  1XMK A;  3CMY A;  4CH7 A;  2HYF A;  1R5I D;  5CQE A;  1OMI A;  2X0L A;  2IAI A;  4NC6 A;  2NYX A;  3F8C A;  2VE9 A;  1WKM A;  2A5W A;  1QPI A;  2YR2 A;  2DAO A;  2XGE A;  2R5Z B;  2E5N A;  2QGU A;  2MH9 A;  5HVQ C;  1RES A;  3A0B C;  2WA0 A;  3RPU D;  1YIT I;  2P81 A;  2BOL A;  2R4G A;  3FIS A;  3P7N A;  5HS8 A;  4PJJ A;  3S15 J;  1U2W A;  4WXH A;  4ENM A;  1RI7 A;  1HA8 A;  2C6Y A;  2CSO A;  4G7H F;  1KQ0 A;  1X1A A;  1X2M A;  3O8H A;  2R5Z A;  3U21 A;  1MGT A;  3MWM A;  3KEQ A;  1P7J A;  2XSD C;  1YQA A;  2ISZ A;  2KHM A;  3X2Q H;  4PSW A;  3ELK A;  4DOZ A;  4QWQ A;  2ELH A;  4HA8 A;  3BLY A;  1YJW I;  3RJP A;  1XPX A;  4ABZ A;  4IQ4 A;  2MLG A;  4Y17 A;  2VOD A;  1WCM J;  4JP0 A;  5CVU A;  4HSR A;  2W84 A;  2M7B A;  4AC0 A;  1MW7 A;  1BJA A;  3A2K A;  3OMY A;  1WJB A;  3F3X A;  1EH7 A;  2QSG X;  5JHU A;  2FA5 A;  1DQU A;  2WBM A;  4A3L J;  1GVD A;  2R92 J;  1S7O A;  3ZQF A;  3EPZ A;  1HOM A;  3W3C A;  3LA2 A;  5D4R A;  3IRR A;  1BJZ A;  3LQR A;  2E1O A;  2HTS A;  3Q3S A;  4CHU A;  3REO A;  1IDZ A;  5FGM A;  2OA4 A;  5DUK A;  1YTY A;  2P6T A;  1KU9 A;  4WCG A;  3MKW B;  4XKC A;  1GT0 C;  2M9H A;  5K7F A;  2GOX B;  4BDZ A;  1FOK A;  4ASN A;  1WI9 A;  4OIN F;  1WJC A;  1QHG A;  3ERM A;  3EYY A;  1HLV A;  4HQE A;  4IKF A;  2PMZ A;  1JE8 A;  1D1B A;  2DCE A;  2XIG A;  5KHD A;  1WH5 A;  1JHF A;  1I3Q J;  3CP8 A;  3FXK A;  3BTI A;  2COB A;  5E1W A;  2HZT A;  1VQ4 I;  4IHV A;  1S72 I;  4BAY A;  2IA2 A;  2VT3 A;  2MC3 A;  2R5Y A;  1XSD A;  2HQA A;  3QRF F;  5DDG A;  1YS7 A;  3LWF A;  4NBQ A;  1FIP A;  3A1Y A;  3CP2 A;  4RGX A;  1SAU A;  2XAJ A;  3A4C A;  3C7J A;  5LBQ A;  4M71 A;  4BS9 A;  2DPD A;  3RYP A;  2JA6 J;  1Z6T A;  2Z9O A;  5GAD J;  2K3P A;  1V4R A;  2O7O A;  3FHZ A;  1LUJ B;  3O2P E;  1DPU A;  2FXA A;  4IPA A;  1UG0 A;  1MJ9 A;  2BZT A;  2R7D A;  4FAS D;  4NB5 A;  5LGN A;  1Z7U A;  4RMN A;  2GLO A;  1O4X A;  2MFZ A;  4FQG A;  5BMZ A;  3RQ4 A;  4GO1 A;  4R8H A;  3I0T A;  3VFZ A;  3J7Z I;  1DU6 A;  2KFD A;  3PL8 A;  3FF5 A;  3B73 A;  1ODD A;  2DA1 A;  4KT5 C;  1GXQ A;  3DKX A;  3DU6 A;  4E70 A;  3LSR A;  2HPM A;  1VQ9 I;  1ZHF A;  1X1C A;  2DPU A;  4HNT A;  4GRI A;  2A3S A;  4KA4 A;  4I99 C;  5E20 A;  2FRH A;  3GVA A;  3GTL J;  4ZC3 A;  4DBR A;  1ZR4 A;  4UUV A;  3OYK A;  4ANJ A;  1YHQ I;  2EFO A;  4O6J A;  3P5J A;  3BCA A;  2FBK A;  4DGW B;  5DD8 A;  2ZXJ A;  3IWF A;  3F21 A;  2CV2 A;  4I7H A;  1MMD A;  4RM2 A;  4BJ5 C;  4WX9 A;  4A3G J;  1YE9 A;  1U5T B;  1ON1 A;  3HSE A;  2DOA A;  3Q9S A;  1FT9 A;  4XQF A;  3TO9 A;  2ICW G;  4ESF A;  4MQ9 F;  3J81 K;  4YIR X;  2VJ5 A;  1O3R A;  1Z77 A;  2KMU A;  4BUP A;  3ZRG A;  2EIM H;  2V4J C;  3PQK A;  2R7W A;  3MCZ A;  2Y9Z A;  4V2G A;  4I02 A;  2RV8 A;  3K10 A;  2HR3 A;  3WU2 C;  4X6A J;  2BXZ A;  2EFQ A;  3WTZ A;  3EQL F;  3OR2 C;  4IZZ A;  2BHY A;  3EUH C;  1P4A A;  2DLL A;  3I54 A;  1ENH A;  2DTZ A;  3GZ5 A;  2VJI A;  2BVL A;  2XGX A;  1P4W A;  2DN0 A;  4BBS J;  1I50 J;  4OAZ A;  3CJT B;  4Y33 A;  4XID A;  4A6D A;  4AWX B;  3LST A;  2IXS A;  2JRM A;  2XKP A;  4U88 A;  3HEF A;  1VQ6 I;  2M7A A;  1GVJ A;  3ZQL A;  4OIP F;  1IZ1 A;  2K4J A;  5EYR A;  2VBZ A;  5FD5 A;  2X6X A;  5HLT A;  2ID3 A;  3EUH A;  4H4K C;  1UHW A;  1JTY A;  1ZQ3 P;  2QKL B;  4HDV A;  5J4Y A;  1TTY A;  2P7C B;  2GIZ A;  3KZI C;  3FXO A;  2DDB A;  2MC4 A;  3NWS A;  2G7H A;  2CGP A;  5K5R A;  2Q8K A;  4KFC A;  3ZOB A;  1K6O A;  1OCO H;  5DD4 A;  1Q1H A;  5ILU A;  2Y75 A;  4S05 A;  5TGT A;  1Z7L A;  1DUX C;  2KIS A;  4EAT A;  4QTR A;  1NG6 A;  3OYA A;  4HF2 A;  3QYF A;  3KFW X;  2Z33 A;  1HDP A;  2QZ8 A;  3HTU A;  4E7I A;  3F72 A;  2PMZ N;  4DQ2 A;  4NC7 A;  1SEU A;  1W4M A;  2FD5 A;  2HOT A;  3TP0 A;  1NK3 P;  3F8M A;  1SMT A;  3FMR A;  3ZQC A;  3UNG C;  3BDD A;  2QBY B;  3GFI A;  3T1B A;  1VF9 A;  2EIL H;  5B1B H;  3CCR I;  3S3M A;  4DIQ A;  4GYI A;  5GPA A;  2P0W A;  1QNT A;  3Q0V A;  1IAW A;  3NQO A;  1S5L C;  1BIA A;  4GDF A;  1Z0X A;  2XGC A;  3ZQ7 A;  2FE3 A;  2ZFW A;  5BPD A;  3CMA I;  3U1K A;  3WU1 B;  2D1H A;  3HGY A;  1GDT A;  3WE2 A;  1FBU A;  2PJP A;  2DA2 A;  1I27 A;  3CC2 I;  5EEH A;  3R6S A;  4XR6 A;  1LEB A;  1W7P D;  2DJN A;  5FRM A;  2UXN A;  4L9T A;  4UB6 C;  3LAJ A;  1TWG J;  5F04 A;  1WI3 A;  3TKY A;  1AA7 A;  3KP2 A;  4YRV A;  2VE8 A;  3L7W A;  1FMV A;  1LJ9 A;  2JVH A;  1A6I A;  1R9T J;  1IRZ A;  3K69 A;  3TL4 X;  1G4D A;  1RUN A;  5DEQ A;  1WFX A;  3KP4 A;  3MZY A;  2D5V A;  3DPT A;  2A6H F;  3HUG A;  4CCO A;  1TL8 A;  1IC8 A;  3OV8 A;  2IS4 A;  1ETV A;  5DYM A;  3E97 A;  3H9Q A;  3MN2 A;  2LD5 A;  1YW9 A;  5KNL A;  5FJ8 J;  1OYY A;  1Z6R A;  5FLV A;  4E7H A;  2I10 A;  2DOD A;  1U8R A;  3QP5 A;  2CG4 A;  4IHS A;  3SZP A;  1UCR A;  1P92 A;  2Y9Y A;  5FKK A;  4GFB A;  4KIF A;  1TWF J;  1LPQ A;  2R7Q A;  5LLQ A;  5FKL A;  3WTW C;  3HB9 A;  1QA6 A;  4EJT A;  2PEX A;  2HTJ A;  4XN0 A;  2VXZ A;  2FX0 A;  2Y2Z A;  3FXQ A;  1YYV A;  5LHH A;  3C18 A;  3WHB A;  2CQK A;  2CUZ A;  2GIV A;  3S2W A;  5FRO A;  3CC7 I;  4B8X A;  1K4T A;  3J7A Y;  3SZT A;  1M1E B;  4A3E J;  4ZTJ A;  3RI4 A;  2W25 A;  2ESH A;  2HXO A;  5HNF A;  1FSE A;  4N9H A;  5H6R A;  5D6F A;  1G3W A;  2VQL A;  1KQ9 A;  1OCZ H;  1X3Z B;  3OL4 A;  2IGM A;  4KIT B;  2BW3 B;  2XKO A;  1FMW A;  3V7R A;  4XBF A;  1DP3 A;  4EJV A;  1XC5 A;  3ZQH A;  3HSR A;  3FXR A;  1W36 D;  2HDW A;  2K4B A;  3HM5 A;  5BPI A;  1TT5 B;  1KU7 A;  4I98 B;  2DFH A;  5HNH A;  1N25 A;  4ZZD A;  3LSK A;  2DDA A;  3VEP A;  1WJE A;  2HS5 A;  2VXD A;  3RIR A;  3ZQI A;  1VQP I;  5DM7 F;  4PFP A;  1L3L A;  3VDX A;  1XDS A;  3H0G J;  3TQN A;  1SMY F;  1P9Q C;  2HOA A;  2VON A;  4BQA A;  3KZZ A;  1VQK I;  1JUS A;  4BNC A;  1S3J A;  3G6E I;  3F23 A;  4V19 K;  1P2F A;  4G6T B;  1ACI A;  2KJC A;  5HDG A;  1IN4 A;  4LIT A;  2X85 A;  4HST A;  4BL0 B;  2DQR A;  3G1M A;  3E3V A;  3I64 A;  3F6O A;  4PCQ A;  2LG4 A;  4HYE A;  2M34 A;  1E3P A;  2O8K A;  1FBS A;  5DCF A;  1BBY A;  1B4A A;  4EV0 A;  4IEJ A;  2JA2 A;  4XRF A;  2ACJ A;  2M0M A;  2IRF G;  2VPR A;  2CUJ A;  4M9S A;  3JRE A;  2K9N A;  1MH3 A;  2XRO A;  2E2J J;  2IP2 A;  4L5E A;  2CFX A;  5E18 F;  1XGO A;  4OU0 A;  4LIU A;  1SD7 A;  5CVR A;  4CCN A;  4FX0 A;  4E4H A;  2G0E A;  1NK2 P;  1ZH5 A;  2IT0 A;  4YFN F;  3QYB A;  4RGU A;  1B72 B;  3GTM J;  4PFO A;  2L9S A;  2CH0 A;  4AIJ A;  4HV6 A;  1OCC H;  2MGQ A;  3TO6 A;  9ANT A;  1UMQ A;  4XL9 A;  3AL0 C;  3QOP A;  1YW7 A;  3PUF A;  1BI0 A;  2RNJ A;  4GYG A;  2VPL A;  3LSH A;  4A0Y A;  2YX4 A;  4BQO A;  1HKT A;  1FC3 A;  1REP C;  1B72 A;  1JJ6 C;  5DUI A;  2NVX J;  3TMO A;  3A0H C;  5F0F A;  1TWH J;  1XCB A;  3PSF A;  4MO7 A;  1MNE A;  1XSV A;  3GO5 A;  4IVN A;  3DEW A;  4TV7 A;  2F6C A;  4BKX A;  2LFB A;  1UB9 A;  2OU2 A;  4BU2 A;  1T33 A;  3CLQ A;  5C44 J;  3IH4 A;  2F48 A;  3R0J A;  2EIK H;  2HOE A;  2K7L A;  2LR8 A;  3P9C A;  5GTH C;  2RVC A;  4BHP A;  2MH2 A;  1BR2 A;  4GCV A;  2WAD A;  5H2F C;  1E17 A;  2UWM A;  4M3F A;  3MD2 A;  4F91 B;  1E3O C;  1ZLK A;  1MBK A;  4OWR B;  4WWC A;  4BHC A;  4S04 A;  2EZH A;  1B8I B;  2VJJ A;  3SHF A;  2P5L C;  4FET A;  4CZC A;  1B59 A;  4X1E A;  2HQR A;  3T5X A;  2YUS A;  1SVL A;  1OCP A;  3MMY B;  2PG4 A;  4ZYE A;  2HVQ A;  2MYS A;  2W57 A;  3PFI A;  4FHT A;  3EDP A;  5J3L A;  1R36 A;  2VBY A;  3BG6 A;  4IF4 A;  5BQT A;  1K6Y A;  2M4G A;  3TP3 A;  3L2R A;  1W0U A;  1H88 C;  1VTN C;  2KKO A;  3JSO A;  2HFH A;  1T38 A;  5D8L B;  3OSF A;  2K86 A;  1D1A A;  4IOC F;  3H35 A;  5EGO B;  3V8J A;  3DTE A;  1R7J A;  1TNT A;  5E1Z B;  5JR3 A;  2IBD A;  5M3M J;  1RR7 A;  1L0O C;  3S1N J;  4ZDP A;  3H9G A;  5K7Z A;  2RNG A;  1O7L A;  3V8L A;  3CF5 F;  3H3Z A;  2OTL I;  2KJB A;  2TDX A;  3WTS C;  1A6Q A;  4XN3 A;  1BW6 A;  5EGO A;  3BPV A;  1O3T A;  2F4M B;  4FE7 A;  1WSU A;  4G9Y A;  4BXF A;  2DMP A;  4DYR A;  1QBJ A;  2DMQ A;  3HTS B;  2H1L A;  4M74 A;  3QP6 A;  2K40 A;  2PQ8 A;  5FLM J;  2JSC A;  2G7U A;  2KRF A;  1F43 A;  2ESN A;  2WAE A;  1FEX A;  3HOU J;  5JVG F;  2H09 A;  1SAX A;  1V5F A;  4U87 A;  2ZB9 A;  1ZGJ A;  4D9J A;  2CQX A;  4Z6Y A;  3ABL H;  1RIO H;  1WHU A;  1LB2 A;  1LDJ A;  4P55 A;  1Z9C A;  3BRO A;  2BY3 A;  2ZXH A;  3SEQ A;  1OCT C;  3P9K A;  3RSN A;  2EV6 A;  2ZME B;  2ECB A;  1ETW A;  4A3D J;  3C3W A;  1CF7 B;  2GOM A;  2GZW A;  5D4S A;  3I56 I;  2Y0M A;  4LLL A;  1EA3 A;  5F08 A;  2JT1 A;  5AIQ A;  3WU0 A;  2EWN A;  5J1R A;  4MTE A;  1GV5 A;  3QOD A;  4ZZL A;  5IPA A;  2YX7 A;  3DPU A;  3BR0 A;  3B6A A;  4M3D A;  4BEH A;  1WJ5 A;  3TOB A;  3MKZ A;  2WAF A;  3JAM Z;  2LBF B;  1R5H A;  1FLI A;  5DCM A;  1U6G A;  4I0A A;  4HNU A;  3D5S C;  2O3F A;  2FNP A;  2XF6 A;  3FKI J;  1S29 A;  2CQQ A;  3I59 B;  2A6T A;  4PJM A;  2LOO A;  2IEK A;  2TRT A;  2O8X A;  2O6G E;  3JAM K;  3OYC A;  2XAF A;  1BI2 A;  4LGW A;  1RZ4 A;  5HLI A;  4CYC B;  4AUX A;  4A3B J;  4G7O F;  2VAS A;  3K1P A;  2B9S A;  1OYI A;  4Q4Z F;  2VI6 A;  4F3Q A;  4B09 A;  2GQQ A;  4MQV A;  2Q1Z B;  3MKY B;  3BT9 A;  4YII A;  3JR9 A;  2XB5 A;  2EJR A;  1RKW A;  2B7E A;  2WY7 Q;  2W85 A;  3C2G A;  4ZDL A;  3CJR B;  3TED A;  4IOA F;  5JLX A;  4UUS A;  1JKO C;  3MKL A;  1B9N A;  5IOY A;  1J2X A;  2OUM A;  3FK6 A;  3KCC A;  3RZD J;  3HJE A;  5JFR A;  4EQQ A;  1ETX A;  4CYC A;  2A07 F;  3EYI A;  3G1L A;  1YI2 I;  2RGV A;  3HOS A;  3DKW A;  4YFK F;  4G8X A;  2MLK A;  4IJA A;  4FX4 A;  2DA5 A;  2E19 A;  2OPT A;  3LA7 A;  3EUK L;  3HIF A;  1I3A A;  2OJE D;  2V9K A;  4N0B A;  1TQI A;  4LIV A;  1BA5 A;  1Z1D A;  4EEF G;  5LGU A;  4LLG F;  3HXL A;  2ZSI B;  4CO8 A;  5M5W J;  3D5R C;  5HS7 A;  2OF7 A;  2DMN A;  5L3B A;  4AVZ A;  2WV1 A;  3P9I A;  3W6J B;  2DOE A;  1P6R A;  1IUF A;  2KIF A;  3S32 A;  1BI1 A;  2VKV A;  1Z3X A;  4J19 A;  1FP2 A;  4I76 A;  1KQ8 A;  2LKS A;  3ISP A;  2HQ5 A;  3HRS A;  4M6V A;  4RS8 A;  3OS2 A;  5EJC A;  5E17 F;  4WF2 A;  3CCE I;  3AKZ A;  1CQT A;  2A6E F;  2QEN A;  2DBB A;  3PM1 A;  1PVE A;  3BCB A;  3I9V 2;  1SFK A;  3A03 A;  3DTK A;  2V6C A;  4A93 J;  3NAR A;  2V1U A;  3RYR A;  4RAF A;  1RRJ A;  4WK8 F;  4ENN A;  2DYS H;  5F0H A;  2BXY A;  4MLO A;  2EH3 A;  4E7J A;  4RLQ A;  1ZGW A;  3GTK J;  1OYW A;  4U7D A;  4AYB A;  1F5T A;  2PMU A;  3GTP J;  1N75 A;  2EB7 A;  5ICE A;  2VC1 A;  2LP0 A;  3BY6 A;  2QLZ A;  2VBX A;  2X51 A;  5HLH A;  2E2H J;  3CME I;  4D1Q A;  5LD2 C;  3F8N A;  3CTA A;  4F93 B;  1HDD C;  2P5V A;  2R5Y B;  1UZC A;  1V3F A;  2F5E A;  2ZSH B;  3M8E A;  3G71 I;  3VWB A;  3CQZ J;  1RUO A;  3KP5 A;  4ENK A;  2KT0 A;  4BBR J;  4O3M A;  1X58 A;  1ZRC A;  3R0A A;  1HC8 A;  3K70 C;  2V79 A;  3K7A J;  3FM5 A;  3L1P A;  3JRA A;  3ONQ A;  1Q1V A;  1APL C;  2W48 A;  1YIJ I;  3AG4 H;  1PYV A;  2D2W A;  2L7F P;  1E2X A;  3GUD A;  2LKX A;  1VQL I;  4WXC A;  1STZ A;  2FSW A;  4CDG A;  5EZG A;  3VSK A;  2ZJQ F;  2HYG D;  4KN7 X;  3OYL A;  3BR6 A;  1ETQ A;  5IYD J;  1IXC A;  2QSF X;  2DMT A;  5GAH J;  1MKM A;  2NVU B;  4Y52 J;  1ZLJ A;  3BJA A;  1FOW A;  2KLO A;  1FOY A;  1MZB A;  1QHH D;  3OYE A;  3LA3 A;  3F8F A;  4ZYH A;  2HGC A;  5KAI C;  1SFX A;  3HHH A;  1UFM A;  4NDL A;  4UVB A;  4XLF A;  2HXI A;  1R1U A;  2EA4 A;  2KQR A;  5ICF A;  3MQ0 A;  4EGY A;  3VSL A;  3OL3 A;  3N97 A;  2OZ6 A;  4RAG A;  1W1W E;  2V6E A;  1MNM C;  2DT7 B;  1D1C A;  1LNW A;  1R4N B;  4NNJ A;  4D7N A;  1K78 A;  3T0Y A;  1FZP B;  3Q0U A;  1QRY A;  3WG7 H;  4MEY F;  1Z3Y A;  2HI3 A;  4HQM A;  3BG7 A;  1FTZ A;  1OJL A;  1Y56 A;  1OKR A;  2R7O A;  5EF6 A;  3DFG A;  2DK5 A;  3OYH A;  4KIS A;  2NVT J;  2V7F A;  4DZP A;  1MMG A;  1HXD A;  1TWC J;  5M5Y J;  5B5E C;  3NEU A;  3KEY A;  3E5U A;  2XSJ C;  3JRF A;  3FMS A;  5DV5 A;  4G7Z F;  5F64 A;  4CCJ A;  4B3A A;  3HDD A;  4RDU A;  3CF2 A;  3CDI A;  4ITV A;  4LJZ F;  5KCM A;  2EK5 A;  2XAQ A;  4N9I A;  4JQF A;  3H5R A;  2K9M A;  5TIS C;  4A2U A;  1DU0 A;  3C1D A;  3ZMU A;  1K83 J;  3IRQ A;  5D8K B;  1ZEL A;  2O5R A;  1Y0U A;  5D5V B;  2FMY A;  2KIQ A;  5L3F A;  1XN7 A;  4OIQ F;  2BHZ A;  1BM9 A;  1BR1 A;  3ZMD A;  1DDN A;  3QQA A;  2QWW A;  3DEE A;  1JKQ C;  4D7M A;  4C2M J;  1NHA A;  2LTP A;  2B0L A;  3H9J A;  3IH3 A;  2WWY A;  4A12 A;  1YO5 C;  1ITY A;  1IRX A;  3IAS 2;  2R7X A;  3BZ6 A;  2R7S A;  2M87 A;  4DJA A;  2GXA A;  1BW5 A;  1TW3 A;  1BR4 A;  4JX6 A;  2DFF A;  2V1D A;  4C3J J;  3GBG A;  3BR1 A;  3CCY A;  4BQQ A;  2EQR A;  4MEX F;  1VFC A;  4F92 B;  4AYB N;  2ZFU A;  4LB5 A;  3BG9 A;  4XKV A;  4JK1 X;  2R7R A;  4G6Q A;  3W2W A;  4AVP A;  4HF1 A;  3ZPL A;  1J9I A;  3G2B A;  3VYU B;  2EFW A;  2OCC H;  3V4G A;  4S0H B;  1X1B A;  1KU2 A;  1T56 A;  4HW0 A;  5D5U B;  1FP1 D;  2E71 A;  1YRN A;  3BP8 A;  1XGN A;  1XGS A;  1ZAO A;  3F9K A;  5E1X A;  4B1R A;  2W1O A;  1DP7 P;  2R7Z J;  5FRN A;  2KZV A;  5CPR B;  1IGN A;  1HSJ A;  3KPH A;  4YIF A;  3KIO A;  3S2H J;  1D8K A;  4FIS A;  3W6V A;  4ESJ A;  1O3Q A;  4ZYD A;  1YS6 A;  3OWT A;  2L7K A;  5HS9 A;  2EZL A;  5K1Y A;  3BPX A;  2EIJ H;  1ZKG A;  4L0Z B;  4AIH A;  4BAC A;  1LDD A;  2BEO A;  2QEX I;  4UV9 A;  2CWE A;  2QKM B;  2PX9 A;  2XPU A;  4XLA A;  2RRE A;  4GGG A;  3OYN A;  3VOD A;  4NQW B;  1S8N A;  2KL4 A;  5FO5 A;  3GTQ J;  5FB2 A;  2XAH A;  4B4C A;  1BI3 A;  1KU3 A;  1Z91 A;  2RKH A;  1IXR C;  1WZ2 A;  3HUG B;  5EDN A;  1IN7 A;  2VT2 A;  3LAP A;  3MVP A;  2L9N A;  3L2W A;  3MFK A;  1A35 A;  4XK4 A;  3L2V A;  3RKQ A;  1OFC X;  3ZMZ A;  2CRG A;  1IV8 A;  3JRB A;  2ZKZ A;  3HRM A;  2NNY A;  3M8J A;  2L54 A;  1ZYR F;  2F2E A;  2X9D A;  4NQW A;  2BYV E;  4QPO A;  1HF0 A;  1QVT A;  1HCR A;  3B6C A;  3FXL A;  2L3D A;  1R49 A;  3OYG A;  2VBW A;  3QOE A;  4LD5 A;  3LSI A;  1XCV A;  1X1P A;  5EG0 A;  2YU9 J;  1UEL B;  4M72 A;  2MBF A;  3WOD F;  3RQI A;  5DS9 A;  4R79 A;  1Y1W J;  4IHX A;  1MBG A;  4ESB A;  3V8K A;  2M8G X;  5CVV A;  3WHC A;  1XGM A;  4Y4R A;  4CUG A;  2JQ7 A;  2DFI A;  2J5O A;  3M4O J;  1HQC A;  2JSP A;  2VL8 A;  3DF8 A;  3DCF A;  2QUF A;  1MMN A;  2XUB A;  2FU4 A;  5H6Q A;  1YG2 A;  1LE8 B;  4PJL A;  2XRL A;  1RC9 A;  3T8T A;  2RAE A;  3PSI A;  5JHF A;  4JYK A;  3CCS I;  4LG3 A;  5F27 A;  4RGS A;  1BOB A;  2LY1 A;  2PLY A;  2KZG A;  1W5S A;  2I8D A;  3JTG A;  4ZYA A;  4A3J J;  3CCM I;  2FQ4 A;  3CMM A;  2LKP A;  4I0B A;  1FJL A;  3K2A A;  3ZP5 A;  3DLA A;  3FIW A;  3QU3 A;  2NS8 A;  2WC2 A;  1LE8 A;  2OCE A;  2QQB A;  5GP9 A;  2MSY A;  1FIA A;  2XVC A;  3ZQQ A;  2EA2 A;  2X4H A;  3CJN A;  3FWE A;  4XLN F;  3TDZ C;  5LRS A;  1SFU A;  3D5L A;  4B48 A;  5D5W B;  3SQN A;  2CJJ A;  3GEZ A;  1TQM A;  4R1H A;  2VQC A;  5BS6 A;  2YSR A;  3G1O A;  3K1M A;  3S1M J;  2RQQ A;  4A3I J;  2BV6 A;  4D5F A;  2VQG A;  3KP6 A;  5IY5 H;  1W7P A;  5HDN A;  3GFL A;  2JMW A;  3CJQ B;  1S7E A;  3ZGK A;  3Q9V A;  1IN8 A;  3FZV A;  1U9N A;  4JBA A;  4B43 A;  3DLL F;  1VQM I;  4CGZ A;  3S1Q J;  4XMY A;  2RN7 A;  1G3T A;  3OOP A;  2LRE A;  3D1N I;  2IS2 A;  3CZ6 A;  1HKS A;  3FDY A;  3HKZ A;  3ZCO A;  3M7G A;  2O9L A;  1LFP A;  1R58 A;  3WTY C;  4XKW A;  3ABM H;  3PFY A;  1MH4 A;  2E2I J;  4P5O A;  5F1J A;  2HU9 A;  1R5G A;  1WWX A;  3O8G A;  5E3L A;  4L18 B;  3Q0W A;  1FNN A;  1T39 A;  1JGG A;  1AU7 A;  4YG2 F;  5HOO A;  5K5Q A;  3DU5 A;  3KX2 A;  4ZYG A;  1RET A;  1E3H A;  2GA1 A;  1LDK B;  1VQO I;  3LSJ A;  1T6S A;  1W36 C;  4KDP A;  2OD5 A;  4JX5 A;  2CW0 F;  2XV4 S;  2BY1 A;  2NVY J;  2R0Q C;  2LY2 A;  4LB6 B;  3TDU C;  1K4S A;  4MIM A;  3PO2 J;  3I5U A;  1JT0 A;  2O03 A;  3N4M A;  1D0Y A;  1S9H A;  1BC8 C;  4XLP F;  2M2E A;  1X4P A;  3OIQ A;  4PGG A;  3E5X A;  2KRH A;  3K4C A;  2OC6 A;  5IYC J;  4U0V A;  5E8G A;  1IJW C;  3HRT A;  4HLX A;  4LFU A;  2F4I A;  2Z5U A;  2D1V A;  4YFX F;  5FLX Z;  2STT A;  1V55 H;  2VUM J;  3CUQ C;  2K27 A;  2X6W A;  1RKT A;  3RKX A;  4G6D A;  3OY9 A;  2K9L A;  2QA4 I;  3LSG A;  2COM A;  4UV8 A;  3HOV J;  4UXN A;  4E7L A;  3AL0 B;  2P4W A;  1O7F A;  5F0C A;  5FLX K;  5GAE J;  1X19 A;  2J5P A;  4KN4 X;  3ABU A;  3BQY A;  4Y3O A;  3CO7 C;  2B63 J;  1Z05 A;  5L3G A;  5C3E J;  4E7K A;  3OR1 C;  4G94 A;  2A5Y B;  2DXI A;  3K1N A;  1GV2 A;  5EEA A;  4KIC A;  4Y13 A;  1VZ0 A;  2W7N A;  4IRG A;  3CCQ I;  4I09 A;  2TCT A;  3CUQ A;  1VQN I;  1JHH A;  1EJ9 A;  4RA2 A;  5M5X J;  1LVA A;  2JN6 A;  1MSF C;  1ZR2 A;  3QPL A;  5LEJ A;  3M07 A;  5IP6 A;  2YPR A;  2CMP A;  4IX7 A;  4A3K J;  2CFO A;  3KZY A;  1K7A A;  2VKD A;  1XB4 A;  3TOA A;  3F22 A;  2CUF A;  1MSE C;  5IT3 A;  2HOS A;  2V9V A;  2L7M P;  2EV0 A;  4EM1 A;  1AKH A;  3KYC B;  2WAQ A;  4K2E A;  2JVG A;  3FM3 A;  5D5X B;  2IA0 A;  2XF7 A;  3GZ6 A;  3PO3 J;  3OS0 A;  2H27 A;  3K4J A;  1XDU A;  1POG A;  2ZNY A;  1RNL A;  3GW2 A;  4XON A;  1KON A;  1KZH A;  3QPT A;  5TJJ A;  3K4K A;  4QPQ A;  5A2Q Z;  3GWZ A;  4HV5 A;  3TGN A;  1G3S A;  2CV1 A;  4AD9 A;  3C2H A;  3AFH A;  2AO9 A;  2LK2 A;  3ERE D;  3MEX A;  3SZG A;  1OIS A;  2Q2E B;  1DPR A;  1I6X A;  4ZJZ A;  3DTI A;  5A2Q K;  2JJ7 A;  3MAJ A;  4KJZ A;  2DFE A;  2P8T A;  1YFH A;  2LNB A;  2K5C A;  5B1A H;  5M3F J;  3H92 A;  5KK1 A;  2DYR H;  2HPI A;  4MGR A;  4LK1 F;  1XMA A;  4BHB A;  1QU3 A;  2KRC A;  4KIG A;  5LHG A;  2JTV A;  2XPW A;  1NG7 A;  3I4P A;  4Z2Y A;  2P6S A;  3RKW A;  2Q2E A;  3HKZ N;  5L3D A;  4MHG A;  3FBN B;  3DBL B;  5IYB J;  3WTU C;  2L9V A;  4W1U A;  1PJR A;  2Z1D A;  4PDK A;  4I01 A;  4B44 A;  3WGI A;  3IV5 A;  2O0Y A;  3WGG A;  4M6Y A;  2GA2 A;  4IRI A;  3WGH A;  1XSX A;  2LMD A;  4EJW A;  1MIJ A;  1JUM A;  3ZMT A;  4RB0 A;  1ETO A;  3JRC A;  3W2A A;  3K4M A;  1HW1 A;  3BZK A;  1VND A;  3SFI A;  4BEH B;  4F55 A;  4D5C A;  1B6A A;  2XAG A;  3J7Y J;  3L00 A;  2CO5 A;  3GTJ J;  1OLT A;  1P4X A;  2FEZ A;  5DCM B;  3VB2 A;  2UZK A;  4BDY A;  1HST A;  3PNY A;  2VJ4 A;  2VKE A;  2V1N A;  2LC2 A;  4IO9 F;  1LKX A;  3PQJ A;  1GXP A;  1FY7 A;  4PSX A;  1MMS A;  3HYI A;  1IF1 A;  3ZN1 A;  2HYJ A;  3ESW B;  2EFP A;  3KP3 A;  2LY9 A;  3F8B A;  3L2C A;  1WGX A;  1I5Z A;  5D6E A;  5E79 C;  2Z16 A;  1YLF A;  1FYM A;  4II2 A;  1IRF A;  3HOT A;  3FXM A;  2QQ8 A;  4DBQ A;  1J59 A;  1WJA A;  4AID A;  4CCK A;  2AS5 F;  3CLO A;  1QVU A;  3E6M A;  2OBP A;  3UKG A;  4RLF A;  3S17 J;  5FFX A;  4A5N A;  3SXY A;  2QCO A;  3S3O A;  1SC7 A;  4UUS B;  4KMU X;  4E7S A;  2RC4 A;  2X1D A;  3LNQ A;  2A68 F;  3I53 A;  1UST A;  3JCU C;  3RKY A;  2GAU A;  4ON0 A;  3JTH A;  4XIC A;  4LG0 A;  4F52 A;  1Y39 A;  4MNU A;  2W24 A;  1T95 A;  2E7X A;  2IJL A;  2YU3 A;  3E6D A;  4M6X A;  3EUA A;  1D5V A;  2LRD A;  1DGR M;  4Q48 A;  5CKT A;  3OYF A;  5EZH A;  1A36 A;  4HLY A;  4IHT A;  4J01 A;  1VQ5 I;  1FBQ A;  4P9F A;  3L2U A;  1LQ1 A;  2MD0 A;  2VC0 A;  2QF7 A;  4HX7 A;  5LEK A;  5AIP A;  1IXS B;  4O5V A;  1WJD A;  3HPG A;  2E60 A;  3L2Q A;  1QGP A;  1X3W B;  2JPC A;  2HQN A;  2WAQ N;  1JKR C;  1ZTR A;  2ME0 A;  3GF2 A;  3QU6 A;  3A01 A;  2EZK A;  5F1R A;  4KMF A;  3L09 A;  3IAM 2;  1R23 A;  3BTJ A;  3HGG A;  4A5M A;  2ELK A;  3OYD A;  1I1G A;  4XOT A;  1QZZ A;  4EGZ A;  2R7F A;  5J4V A;  4DNC A;  5HLG A;  4OMZ A;  1IRG A;  2VKH A;  1XTA A;  4UVC A;  1MD0 A;  3GLL A;  3H36 A;  4I6Z A;  4A3M J;  1P7I A;  3H3U A;  4II3 A;  1ONV A;  4FT8 A;  1OR7 C;  2FML A;  4V2F A;  3GCM A;  4BXU A;  3BWG A;  4U0Y A;  1ZN2 A;  2NOG A;  3I4N J;  3SYT A;  3DP7 A;  1A5J A;  3S1R J;  5K5O A;  3J80 Z;  2HKO A;  3MZ8 A;  2M45 A;  4JOM A;  4RB1 A;  1FYL A;  2L5Q A;  4PZJ A;  1IV6 A;  3PNV A;  3K70 D;  1ETK A;  2QYO A;  3K2Z A;  4P1W A;  5ILV A;  2CQN A;  2M1B A;  2M30 A;  2FQ3 A;  2NVQ J;  1OR7 A;  3J80 K;  4A3C J;  3E1S A;  4QSH A;  3TW6 A;  3IWZ A;  5JVT A;  2D45 A;  3G3Z A;  1FWZ A;  4Q47 A;  4XSX F;  2W82 A;  4CCM A;  4HX8 A;  2H8W A;  3A02 A;  1WJF A;  2F5F A;  4CSW A;  4CCL A;  4NC8 A;  3K0L A;  1D5Y A;  5GAG J;  2ZBK A;  4E7Z A;  2CYY A;  2E34 A;  2Y69 H;  2YS9 A;  4EM0 B;  2WB1 A;  2R93 J;  3IHU A;  1Z67 A;  2LYC A;  3RTR A;  2HWV A;  3TW7 A;  1OPC A;  1TBX A;  5BOX A;  5CLS A;  3ZN0 A;  5CJ9 A;  1TWA J;  3DV8 A;  2KIM A;  1Y1V J;  2R7T A;  5FKO A;  5ILS A;  4BE1 A;  3V7C A;  4M3E A;  3PNT A;  4UUT A;  5ED4 A;  5E3N A;  3B02 A;  2F4O B;  3BJO A;  3RPU A;  1WPK A;  2HKX A;  1FYK A;  4BQN A;  2A69 F;  4QLC U;  4M9X A;  1D3Y A;  1VI0 A;  3ZMV A;  1N78 A;  1R00 A;  2K9Q A;  4HEA 2;  4BJT A;  3PJR A;  2HNH A;  3U1D A;  3BZC A;  2K9S A; 
#chains in the Genus database with same CATH homology
 1K78 B;  2ZCW A;  1F9N A;  2EFN A;  4AIK A;  4A0X A;  5LGT A;  2JRT A;  3FX3 A;  5F6F A;  1G6N A;  3FXU A;  4WXD A;  1D8J A;  1USS A;  3MZH A;  3CDH A;  2FOK A;  2JZY A;  2BBY A;  4H0E A;  4UVA A;  1J0R A;  2DK8 A;  2NS0 A;  1MDM B;  3L9F A;  2Y48 A;  1KA8 A;  1X3U A;  3WE3 A;  2ZNZ A;  3R4K A;  4UNO A;  4L5I A;  5KVR A;  3M9A A;  3KE2 A;  3DQV C;  1ZRF A;  5IT9 Z;  1T98 A;  1EH6 A;  4KIB A;  2IW5 A;  1MDM A;  1S6L A;  1HKQ A;  1LEA A;  1EV7 A;  5IT9 K;  3J81 Z;  1BIB A;  1U5T C;  4OIO F;  1SD5 A;  1ZAR A;  5EEG A;  3LFK A;  4U0W A;  5E8I A;  5J8C A;  1XD7 A;  1U78 A;  1CGP A;  2DT5 A;  2L02 A;  2H6C A;  3DXJ F;  4HOB A;  1GHC A;  1FPQ A;  4EMS A;  2QQ9 A;  5FFZ A;  3CO6 C;  1QZY A;  3FMQ A;  2DO7 A;  2L01 A;  1ZG1 A;  4NHJ A;  4P9U A;  1U5T A;  4M9Z A;  3QPH A;  2LDU A;  2XAS A;  2DU9 A;  4EVI A;  2HEO A;  2Q0O A;  3G73 A;  4Q5S F;  6PAX A;  1QO0 D;  3KLN A;  1ULY A;  3WTX C;  3SFZ A;  2WTE A;  3K9T A;  1PP8 F;  5JI6 A;  1ZG3 A;  2A61 A;  2M5W A;  3T8R A;  3EET A;  4ETS A;  1AWC A;  1ZG5 A;  2K02 A;  1I1S A;  2NAZ A;  5HDK A;  1BN5 A;  2RDP A;  2P5K A;  2E1C A;  3V7S A;  4LK0 F;  1BOA A;  3E6C C;  2OAZ A;  2F5C A;  5LHI A;  4UHT A;  2H6B A;  2G9W A;  3KLO A;  4F7Z A;  3RDI A;  2F5D A;  2OQR A;  3GLX A;  2DQL A;  4D0P A;  1ZGA A;  5FD6 A;  1J75 A;  1F4K A;  3O3K A;  4GXO A;  1JGS A;  3O6B B;  2QBY A;  3RPQ A;  2Z3Y A;  4LLN A;  2HDC A;  1S7A A;  4OIR F;  2FNA A;  1PUE E;  2PI0 A;  1R22 A;  1MJB A;  2ZJ2 A;  3GYH X;  1C0W A;  1AOY A;  2DI3 A;  1PDN C;  1IW7 F;  2VOO A;  4Y15 A;  4HZF A;  1QPM A;  2L4A A;  3GX4 X;  4EJU A;  4EJO A;  1EH8 A;  2E1N A;  4LMY A;  4RAZ A;  1HBX G;  1W7P B;  4RB2 C;  3TO7 A;  1SFE A;  3VOE A;  5J8F A;  3R61 A;  2ETH A;  3IKT A;  1IN5 A;  1H9G A;  2DW4 A;  1MJA A;  1KYW A;  1UHM A;  4L9V A;  1ZRD A;  4A0Z A;  1IUY A;  1IN6 A;  1PP7 U;  2STW A;  2V1X A;  1TLH B;  2QVO A;  3ECH A;  2E7W A;  3GXO A;  3WTT C;  5ERI A;  4ZH4 F;  3HHG A;  5CVJ A;  3KEO A;  3M1E A;  4BYY A;  5J6X A;  1WRJ A;  2IA1 A;  1H9T A;  2FBH A;  4IXA A;  2PN6 A;  2P7V B;  2DTR A;  4HAM A;  4L0Y B;  2O61 A;  3HRU A;  3KP7 A;  1T0F A;  1JXS A;  5TRD A;  4KNY A;  2IPQ X;  3ULQ B;  3F6V A;  4HDU A;  1BC7 C;  2GXG A;  1TNS A;  2FF4 A;  2JPB A;  5ICC A;  2EV5 A;  1B1B A;  3BOQ A;  1J7K A;  1U3E M;  4CYD A;  3AAF A;  2AXL A;  1O57 A;  3I58 A;  1H0M A;  3DPL C;  4BH9 A;  2LSO A;  2QM3 A;  3CUQ B;  1J5Y A;  1FX7 A;  3IKV A;  4CIC A;  1B9M A;  4MTD A;  4P96 A;  3NRV A;  2IVM A;  1WQ2 A;  3D0S A;  2ZO4 A;  2WV0 A;  3ROU A;  2Z99 A;  2ADU A;  3Q5F A;  4RAY A;  5L3E A;  2VN2 A;  3E5Q A;  4L9N A;  1SD6 A;  1ZRE A;  2BE5 F;  2LF8 A;  1TW2 A;  4L5J A;  1T2K A;  2M8E A;  1TQP A;  3DEU A;  4HF0 A;  4HX4 A;  1K79 A;  2LF7 A;  1KYZ A;  2UXX A;  1YW8 A;  5H20 A;  4A6E A;  4PGH A;  3WTV C;  2GWR A;  5CVI A;  3ABT A;  2NNN A;  2BGC A;  5L3C A;  1O3S A;  3I71 A;  2GXB A;  1A04 A;  2FBI A;  2MD5 A;  2VOP A;  3U2R A;  3J7A O;  1F1Z A;  3CUO A;  1HW2 A;  2R3S A;  2L4M A;  1YIO A;  3KET A;  1SD4 A;  4HBL A;  2QQA A;  3WG9 A;  2OQG A;  1HW5 A;  2NRA C;  5LRR A;  1R1T A;  1KGS A;  4OOI A;  2PBI A;  3GFJ A;  3COA C;  3U9G A;  1QQI A;  1G3Y A;  2PMH A;  3QAH A;  4CZZ A;  4LG0 B;  4CXF A;  2XHK A;  4XSZ F;  1W5T A;  3M8F A;  2KIU A;  4I2O A;  3W6K B;  2H94 A;  5AON A;  3JSP A;  4M73 A;  1FSH A;  4RGR A;  3IL2 A;  4RB3 C;  5CYV A;  4OMY A;  2RQP A;  3E6B A;  2ZME A;  2ISY A;  3BJ6 A;  1CF7 A;  3HSF A;  3GFM A;  4ENJ A;  2PFB A;  4EM2 A;  4KYW A;  1ON2 A;  3R60 A;  2XRN A;  4IRH A;  2MA3 A;  3JW4 A;  3IC7 A;  3ML6 A;  3I59 A;  1R1V A;  4U7B A;  3LQQ A;  2OZU A;  4KUM A;  5ICG A;  4L9J A;  3ECO A;  3ZMS A;  1XMK A;  2HYF A;  1OMI A;  2X0L A;  2NYX A;  3F8C A;  2VE9 A;  1WKM A;  2YR2 A;  2DAO A;  2MH9 A;  5HVQ C;  3P7N A;  5HS8 A;  1U2W A;  4WXH A;  4ENM A;  1RI7 A;  2C6Y A;  2CSO A;  4G7H F;  1KQ0 A;  1MGT A;  3MWM A;  3KEQ A;  1YQA A;  2ISZ A;  3ELK A;  4QWQ A;  2ELH A;  4HA8 A;  3RJP A;  2MLG A;  4Y17 A;  2VOD A;  5CVU A;  2W84 A;  1BJA A;  3F3X A;  1EH7 A;  5JHU A;  2FA5 A;  1S7O A;  3LA2 A;  5D4R A;  3IRR A;  3LQR A;  2HTS A;  4CHU A;  3REO A;  5FGM A;  2OA4 A;  5DUK A;  1YTY A;  2P6T A;  1KU9 A;  4WCG A;  1FOK A;  4ASN A;  1WI9 A;  4OIN F;  3EYY A;  4HQE A;  1JE8 A;  2XIG A;  1JHF A;  5E1W A;  2HZT A;  4BAY A;  2IA2 A;  2VT3 A;  2MC3 A;  1XSD A;  3QRF F;  5DDG A;  1YS7 A;  3LWF A;  4RGX A;  2XAJ A;  3C7J A;  5LBQ A;  4M71 A;  2DPD A;  3RYP A;  1Z6T A;  2Z9O A;  1V4R A;  3FHZ A;  3O2P E;  1DPU A;  2FXA A;  4IPA A;  1MJ9 A;  2R7D A;  4NB5 A;  5LGN A;  1Z7U A;  5BMZ A;  4GO1 A;  4R8H A;  3I0T A;  3VFZ A;  3FF5 A;  3B73 A;  1ODD A;  4KT5 C;  1GXQ A;  4E70 A;  1ZHF A;  2DPU A;  2A3S A;  4KA4 A;  5E20 A;  2FRH A;  3GVA A;  4UUV A;  2EFO A;  4O6J A;  2FBK A;  5DD8 A;  2ZXJ A;  3IWF A;  3F21 A;  4I7H A;  4WX9 A;  1U5T B;  1ON1 A;  3HSE A;  3Q9S A;  1FT9 A;  3TO9 A;  4ESF A;  4MQ9 F;  3J81 K;  1O3R A;  3PQK A;  3MCZ A;  4I02 A;  2RV8 A;  2HR3 A;  2EFQ A;  3WTZ A;  3EQL F;  1P4A A;  2DLL A;  3I54 A;  3GZ5 A;  2XGX A;  1P4W A;  4A6D A;  4AWX B;  3LST A;  2XKP A;  4U88 A;  1GVJ A;  4OIP F;  1IZ1 A;  2K4J A;  2VBZ A;  5FD5 A;  3EUH A;  1UHW A;  4HDV A;  1TTY A;  2P7C B;  2CGP A;  2G7H A;  5K5R A;  2Q8K A;  4KFC A;  1K6O A;  5DD4 A;  1Q1H A;  5ILU A;  2Y75 A;  4S05 A;  1DUX C;  4HF2 A;  3KFW X;  2Z33 A;  2QZ8 A;  3HTU A;  3F72 A;  4DQ2 A;  1W4M A;  3F8M A;  1SMT A;  3FMR A;  3BDD A;  2QBY B;  3GFI A;  3T1B A;  4GYI A;  1QNT A;  1IAW A;  3NQO A;  1BIA A;  3ZQ7 A;  2FE3 A;  2ZFW A;  5BPD A;  3WU1 B;  2D1H A;  3WE2 A;  1FBU A;  2PJP A;  1I27 A;  5EEH A;  3R6S A;  1LEB A;  1W7P D;  2UXN A;  4L9T A;  3LAJ A;  3TKY A;  3KP2 A;  2VE8 A;  3L7W A;  1LJ9 A;  3K69 A;  1G4D A;  1RUN A;  5DEQ A;  3MZY A;  3KP4 A;  3DPT A;  2A6H F;  3HUG A;  3OV8 A;  5DYM A;  3E97 A;  1YW9 A;  1OYY A;  1Z6R A;  1U8R A;  3QP5 A;  2CG4 A;  4IHS A;  3SZP A;  1UCR A;  1P92 A;  4KIF A;  3WTW C;  5LLQ A;  4EJT A;  2PEX A;  2HTJ A;  2VXZ A;  3FXQ A;  1YYV A;  5LHH A;  3C18 A;  2CQK A;  2GIV A;  3S2W A;  4B8X A;  3SZT A;  3RI4 A;  2W25 A;  2ESH A;  1FSE A;  4N9H A;  5H6R A;  5D6F A;  1G3W A;  1KQ9 A;  2XKO A;  3V7R A;  4XBF A;  4EJV A;  3HSR A;  3FXR A;  2K4B A;  5BPI A;  1KU7 A;  4I98 B;  4ZZD A;  3VEP A;  2HS5 A;  3RIR A;  1L3L A;  1XDS A;  3TQN A;  1SMY F;  2VON A;  4BQA A;  3KZZ A;  4BNC A;  1S3J A;  3F23 A;  1P2F A;  2KJC A;  5HDG A;  1IN4 A;  2DQR A;  3E3V A;  3I64 A;  3F6O A;  4PCQ A;  4HYE A;  1FBS A;  5DCF A;  1BBY A;  1B4A A;  4EV0 A;  4XRF A;  2ACJ A;  2IRF G;  4M9S A;  2XRO A;  2IP2 A;  2CFX A;  5E18 F;  1XGO A;  4OU0 A;  5CVR A;  1SD7 A;  4FX0 A;  1ZH5 A;  2IT0 A;  4YFN F;  4RGU A;  4AIJ A;  4HV6 A;  3TO6 A;  3QOP A;  1YW7 A;  1BI0 A;  2RNJ A;  4GYG A;  4A0Y A;  2YX4 A;  1HKT A;  1FC3 A;  1REP C;  5DUI A;  1XCB A;  1XSV A;  3GO5 A;  4IVN A;  4TV7 A;  1UB9 A;  2OU2 A;  3R0J A;  2HOE A;  2K7L A;  3P9C A;  2RVC A;  4BHP A;  2MH2 A;  4GCV A;  1E17 A;  2UWM A;  1ZLK A;  4WWC A;  4BHC A;  4S04 A;  3SHF A;  2P5L C;  1B59 A;  2HQR A;  3T5X A;  2PG4 A;  4ZYE A;  2W57 A;  3PFI A;  4FHT A;  3EDP A;  1R36 A;  2VBY A;  4IF4 A;  5BQT A;  1VTN C;  2KKO A;  3JSO A;  2HFH A;  1T38 A;  5D8L B;  2K86 A;  3V8J A;  1R7J A;  1TNT A;  5E1Z B;  5JR3 A;  1L0O C;  1O7L A;  3V8L A;  3H3Z A;  2KJB A;  2TDX A;  3WTS C;  3BPV A;  1O3T A;  1WSU A;  4G9Y A;  1QBJ A;  3HTS B;  4M74 A;  3QP6 A;  2PQ8 A;  2JSC A;  2G7U A;  2KRF A;  2ESN A;  2H09 A;  1SAX A;  1ZGJ A;  1RIO H;  1LB2 A;  1LDJ A;  4P55 A;  1Z9C A;  3BRO A;  3P9K A;  2EV6 A;  2ZME B;  3C3W A;  1CF7 B;  2GZW A;  5D4S A;  2Y0M A;  4LLL A;  3WU0 A;  2JT1 A;  5AIQ A;  2EWN A;  4MTE A;  4ZZL A;  2YX7 A;  3TOB A;  3JAM Z;  1R5H A;  1FLI A;  5DCM A;  1U6G A;  4I0A A;  2O3F A;  2FNP A;  1S29 A;  3I59 B;  2O8X A;  2O6G E;  3JAM K;  2XAF A;  1BI2 A;  4LGW A;  1RZ4 A;  5HLI A;  4G7O F;  3K1P A;  1OYI A;  4Q4Z F;  4B09 A;  2GQQ A;  4MQV A;  4YII A;  2EJR A;  2W85 A;  1B9N A;  1J2X A;  3KCC A;  5JFR A;  4EQQ A;  2A07 F;  3EYI A;  2RGV A;  3HOS A;  3DKW A;  4YFK F;  4G8X A;  2MLK A;  4IJA A;  4FX4 A;  3LA7 A;  3HIF A;  4N0B A;  1TQI A;  1Z1D A;  5LGU A;  4LLG F;  4CO8 A;  5HS7 A;  5L3B A;  3P9I A;  3W6J B;  1P6R A;  2KIF A;  1BI1 A;  1FP2 A;  1KQ8 A;  3ISP A;  3HRS A;  4RS8 A;  5E17 F;  4WF2 A;  2A6E F;  2QEN A;  2DBB A;  2V6C A;  2V1U A;  3RYR A;  4WK8 F;  4ENN A;  1OYW A;  4U7D A;  1F5T A;  2PMU A;  2EB7 A;  5ICE A;  2VC1 A;  3BY6 A;  2QLZ A;  2VBX A;  5HLH A;  3F8N A;  3CTA A;  2P5V A;  1V3F A;  2F5E A;  3M8E A;  1RUO A;  3KP5 A;  4ENK A;  4O3M A;  1ZRC A;  3R0A A;  2V79 A;  3FM5 A;  2D2W A;  3GUD A;  1E2X A;  4WXC A;  1STZ A;  2FSW A;  4CDG A;  2HYG D;  4KN7 X;  1IXC A;  1MKM A;  1ZLJ A;  3BJA A;  1MZB A;  3LA3 A;  3F8F A;  4ZYH A;  2HGC A;  1SFX A;  3HHH A;  1UFM A;  4UVB A;  1R1U A;  2EA4 A;  5ICF A;  3MQ0 A;  4EGY A;  3N97 A;  2OZ6 A;  1LNW A;  1K78 A;  3T0Y A;  1FZP B;  4MEY F;  4HQM A;  1OKR A;  3DFG A;  2DK5 A;  1HXD A;  3NEU A;  3E5U A;  3FMS A;  5DV5 A;  4G7Z F;  5F64 A;  4LJZ F;  2EK5 A;  2XAQ A;  4N9I A;  4JQF A;  4A2U A;  3C1D A;  3ZMU A;  3IRQ A;  5D8K B;  1Y0U A;  5D5V B;  2FMY A;  5L3F A;  1XN7 A;  4OIQ F;  1BM9 A;  3ZMD A;  1DDN A;  2QWW A;  1NHA A;  2B0L A;  2WWY A;  4A12 A;  1YO5 C;  3BZ6 A;  2M87 A;  1TW3 A;  2V1D A;  4MEX F;  4LB5 A;  4JK1 X;  4G6Q A;  4AVP A;  4HF1 A;  3ZPL A;  1J9I A;  2EFW A;  3V4G A;  1KU2 A;  4HW0 A;  5D5U B;  1FP1 D;  1XGN A;  1XGS A;  3BP8 A;  1ZAO A;  5E1X A;  1DP7 P;  1HSJ A;  4YIF A;  1D8K A;  4ESJ A;  1O3Q A;  4ZYD A;  1YS6 A;  5HS9 A;  5K1Y A;  3BPX A;  4L0Z B;  4AIH A;  1LDD A;  2BEO A;  4UV9 A;  2CWE A;  4GGG A;  3VOD A;  1S8N A;  5FO5 A;  5FB2 A;  2XAH A;  1BI3 A;  1KU3 A;  1Z91 A;  2RKH A;  1IXR C;  1IN7 A;  2VT2 A;  3LAP A;  3MFK A;  3ZMZ A;  2ZKZ A;  3HRM A;  2NNY A;  2L54 A;  1ZYR F;  2F2E A;  4NQW A;  2BYV E;  2L3D A;  2VBW A;  4LD5 A;  1XCV A;  4M72 A;  2MBF A;  3WOD F;  4R79 A;  4ESB A;  3V8K A;  5CVV A;  1XGM A;  2DFI A;  2J5O A;  1HQC A;  3DF8 A;  2QUF A;  2XUB A;  2FU4 A;  5H6Q A;  1YG2 A;  3T8T A;  4RGS A;  2PLY A;  1W5S A;  3JTG A;  2LKP A;  4I0B A;  3ZP5 A;  3QU3 A;  2WC2 A;  2QQB A;  2XVC A;  2EA2 A;  2X4H A;  3CJN A;  3FWE A;  4XLN F;  3TDZ C;  5LRS A;  1SFU A;  3D5L A;  5D5W B;  3SQN A;  3GEZ A;  1TQM A;  4R1H A;  5BS6 A;  2YSR A;  3K1M A;  2BV6 A;  3KP6 A;  1W7P A;  5HDN A;  3GFL A;  3Q9V A;  1IN8 A;  3FZV A;  4JBA A;  4CGZ A;  2RN7 A;  1G3T A;  3OOP A;  1HKS A;  3M7G A;  1R58 A;  3WTY C;  4P5O A;  1R5G A;  1WWX A;  4L18 B;  1FNN A;  1T39 A;  4YG2 F;  5HOO A;  5K5Q A;  4ZYG A;  2GA1 A;  1LDK B;  1T6S A;  4KDP A;  2OD5 A;  2CW0 F;  2XV4 S;  4LB6 B;  3TDU C;  3I5U A;  2O03 A;  3N4M A;  1BC8 C;  4XLP F;  4PGG A;  3E5X A;  4U0V A;  5E8G A;  3HRT A;  4HLX A;  4LFU A;  2Z5U A;  2D1V A;  4YFX F;  5FLX Z;  2STT A;  3CUQ C;  2K27 A;  3RKX A;  4G6D A;  4UV8 A;  2COM A;  4UXN A;  2P4W A;  1O7F A;  5FLX K;  2J5P A;  4KN4 X;  3CO7 C;  3ABU A;  1Z05 A;  5L3G A;  4G94 A;  2A5Y B;  3K1N A;  4KIC A;  4Y13 A;  4IRG A;  4I09 A;  3CUQ A;  1JHH A;  1LVA A;  5LEJ A;  2YPR A;  3KZY A;  1K7A A;  1XB4 A;  3TOA A;  3F22 A;  5IT3 A;  2V9V A;  2EV0 A;  4EM1 A;  4K2E A;  5D5X B;  3FM3 A;  3GZ6 A;  2IA0 A;  2H27 A;  1XDU A;  2ZNY A;  1RNL A;  3GW2 A;  3QPT A;  5TJJ A;  5A2Q Z;  3GWZ A;  4HV5 A;  3TGN A;  1G3S A;  4AD9 A;  3ERE D;  3MEX A;  1DPR A;  1I6X A;  5A2Q K;  3MAJ A;  2P8T A;  1YFH A;  2LNB A;  3H92 A;  5KK1 A;  4MGR A;  4LK1 F;  1XMA A;  4BHB A;  4KIG A;  5LHG A;  2JTV A;  3I4P A;  4Z2Y A;  2P6S A;  3RKW A;  2Q2E A;  5L3D A;  4MHG A;  3WTU C;  4PDK A;  4I01 A;  3WGI A;  2O0Y A;  3WGG A;  4M6Y A;  2GA2 A;  4IRI A;  3WGH A;  1XSX A;  4EJW A;  3ZMT A;  4RB0 A;  1HW1 A;  1B6A A;  2XAG A;  3L00 A;  2CO5 A;  1P4X A;  2FEZ A;  5DCM B;  3VB2 A;  2UZK A;  1HST A;  3PQJ A;  1GXP A;  1FY7 A;  3HYI A;  1IF1 A;  3ZN1 A;  2EFP A;  3KP3 A;  3F8B A;  3L2C A;  1I5Z A;  5D6E A;  1YLF A;  1FYM A;  1IRF A;  3HOT A;  1J59 A;  2AS5 F;  3CLO A;  3E6M A;  2OBP A;  5FFX A;  4A5N A;  3SXY A;  4KMU X;  2RC4 A;  2A68 F;  3I53 A;  1UST A;  3RKY A;  2GAU A;  4ON0 A;  3JTH A;  4LG0 A;  4MNU A;  2W24 A;  2E7X A;  2IJL A;  2YU3 A;  3E6D A;  4M6X A;  1D5V A;  4Q48 A;  4HLY A;  4IHT A;  1FBQ A;  4P9F A;  1LQ1 A;  2VC0 A;  5LEK A;  4HX7 A;  5AIP A;  1IXS B;  4O5V A;  1QGP A;  2JPC A;  2HQN A;  3GF2 A;  3QU6 A;  5F1R A;  4KMF A;  3L09 A;  1R23 A;  4A5M A;  1I1G A;  1QZZ A;  4EGZ A;  2R7F A;  4DNC A;  5HLG A;  4OMZ A;  1IRG A;  4UVC A;  1MD0 A;  3H3U A;  1ONV A;  4FT8 A;  2FML A;  4BXU A;  3BWG A;  4U0Y A;  1ZN2 A;  3DP7 A;  5K5O A;  3J80 Z;  2HKO A;  2M45 A;  4RB1 A;  1FYL A;  4PZJ A;  2QYO A;  3K2Z A;  5ILV A;  2M1B A;  2M30 A;  2FQ3 A;  1OR7 A;  3J80 K;  3IWZ A;  5JVT A;  2D45 A;  3G3Z A;  1FWZ A;  4Q47 A;  4XSX F;  4HX8 A;  2F5F A;  3K0L A;  2ZBK A;  2CYY A;  4EM0 B;  3IHU A;  3RTR A;  2HWV A;  1OPC A;  1TBX A;  5BOX A;  5CLS A;  3ZN0 A;  5CJ9 A;  3DV8 A;  2KIM A;  5ILS A;  3V7C A;  5ED4 A;  3B02 A;  3BJO A;  3RPU A;  2HKX A;  1FYK A;  2A69 F;  4QLC U;  4M9X A;  1D3Y A;  3ZMV A;  1R00 A;  3U1D A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...