3U1DA

The structure of a protein with a gntr superfamily winged-helix-turn-helix domain from halomicrobium mukohataei.
Total Genus 51
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
51
sequence length
148
structure length
148
Chain Sequence
MATQDRGERPNGFGDELERRRFVLHETRLDVLHQILAQPDGVLSVEELLYRNPDETEANLRYHVDELVDRGIVEKIPVPRAKSVDDPPTTFYAVTGEGIALLRAVSMYEEAAVWRSVYEQMERTDRIEAIENLETRPDVDYESRGATA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords uncharacterized protein
publication title The structure of a protein with a GntR superfamily winged-helix-turn-helix domain from Halomicrobium mukohataei.
rcsb
source organism Halomicrobium mukohataei
molecule tags Structural genomics, unknown function
total genus 51
structure length 148
sequence length 148
chains with identical sequence B
ec nomenclature
pdb deposition date 2011-09-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF12840 HTH_20 Helix-turn-helix domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 3u1dA00
2BBYA 4PGHA 3C18A 1EH6A 4KN4X 3EDPA 4HZFA 1BC8C 2K02A 3HTUA 1XSDA 4OMZA 2EV5A 2M45A 4CYDA 3HYIA 3SHFA 1FBUA 3BWGA 3Q9VA 1KYWA 2R7FA 4HDVA 2VOOA 5LHGA 3DPTA 5LGTA 4HF2A 4KYWA 4ESFA 5HOOA 3ZMVA 1U5TA 2O3FA 3K9TA 3TO6A 4A2UA 1SFXA 2XKPA 2M30A 1IRGA 4O5VA 3K2ZA 2V1DA 4GGGA 4G7HF 3R0JA 4PCQA 4R79A 5BPDA 2DW4A 1HW1A 4WWCA 1HKQA 1UB9A 4A5NA 4L9NA 2NRAC 4HOBA 2P7CB 2P4WA 3HHHA 2V9VA 3KP5A 2L01A 1LEAA 2EFWA 3R60A 4HLXA 2RGVA 3R4KA 4MTEA 5IT9Z 2WTEA 4HAMA 1T98A 3GEZA 1ZAOA 1TBXA 2CFXA 1H9TA 1GXQA 1PP7U 2WC2A 1IAWA 4U7BA 3T8RA 3ZP5A 4IVNA 5EEHA 6PAXA 1TLHB 4DQ2A 4KA4A 4XLNF 5IT9K 4MGRA 5DDGA 1YTYA 2BGCA 2Z5UA 5TJJA 1J5YA 5K5OA 3DQVC 1CGPA 3K69A 3WTTC 2PLYA 3F8MA 3O6BB 4BQAA 4OMYA 4HX8A 3LWFA 3CUQB 1FWZA 3WU0A 4U0YA 1KQ8A 1DPRA 4U0WA 3J80Z 4EV0A 2B0LA 3DPLC 2KJBA 1Y0UA 3REOA 3DF8A 5L3EA 3GFLA 2BEOA 2F5FA 1TW3A 3BPVA 3FX3A 3V8LA 2PFBA 4BNCA 3MZHA 3FM3A 1HW2A 1XGSA 3Q5FA 3BPXA 4MNUA 3GYHX 5BOXA 5AIQA 5LGNA 2E7WA 2HKXA 2O0YA 1IF1A 2HDCA 1Z05A 4P5OA 1K78B 3QOPA 1YO5C 4N9IA 3F22A 4XSXF 1ZG1A 3I59A 3V7RA 1R5GA 3V7SA 4BAYA 2LF7A 2L3DA 1YG2A 2FEZA 2PMUA 1RIOH 2FQ3A 3QU6A 3TKYA 2DLLA 5HDGA 4YFXF 4HDUA 5K5QA 3JTHA 3BOQA 4JQFA 5J8FA 2IRFG 4TV7A 3EYYA 2H09A 4ZZLA 2XAFA 2O6GE 1XSXA 2CGPA 3L00A 4Q5SF 1QNTA 3ABUA 4WXHA 3E5XA 5D8KB 4HA8A 3JSOA 4U7DA 2W24A 2W85A 1HW5A 2G7HA 3I58A 1ZHFA 2QQAA 4OOIA 1RUNA 2H27A 2Z33A 3JW4A 3SFZA 1KA8A 3IRRA 4EQQA 1HKSA 1RUOA 4PGGA 4IJAA 4KNYA 2XAJA 4UV8A 1YFHA 1REPC 2F5CA 4Y17A 2JT1A 1IXCA 5DEQA 4HV6A 1XDSA 2CO5A 1PDNC 1QGPA 1U2WA 2VBWA 4EM0B 4YFKF 1R5HA 1O3TA 3KP4A 2JPBA 5ED4A 1S29A 3M8EA 1FPQA 1FYMA 2EA4A 4OIRF 5ICCA 4BXUA 4I02A 1BI2A 4A12A 4GXOA 2IVMA 2YX7A 4LMYA 3TDZC 2MH9A 3ECOA 1R58A 2PJPA 4ON0A 1I5ZA 5F64A 4ZH4F 1V3FA 1H9GA 4Z2YA 5L3GA 3KZZA 3QPHA 2XVCA 2RVCA 5E1XA 2QQ9A 5LGUA 2EV0A 3G3ZA 3F72A 3LQRA 1P4XA 2NAZA 4EVIA 2ZO4A 3GUDA 1R1TA 3BP8A 5DD8A 2DQRA 4KMFA 4L9TA 1SMTA 3BDDA 3T5XA 4I0AA 5AONA 4E70A 4Q47A 2ZNZA 1K6OA 5ERIA 1SFEA 3RPUA 3DP7A 1SFUA 5CVVA 4LGWA 4G9YA 2GA1A 3WODF 2VE8A 3PQKA 3TO7A 4I01A 2A6HF 4S05A 3M8FA 3ZQ7A 1KU3A 2K4JA 1BIBA 5FO5A 2BE5F 3WTVC 2WWYA 2LKPA 4I0BA 4RGXA 1GXPA 4KFCA 1KQ0A 1T39A 4UVBA 2XAHA 1PUEE 5D4RA 2EWNA 2Z3YA 1MD0A 1WSUA 2IA2A 4CDGA 1O7FA 2R3SA 4G7ZF 1ZLKA 2L4AA 1YW9A 1JHHA 2EFOA 1J7KA 1D5VA 4YIFA 2EFPA 2UWMA 2TDXA 1R1VA 4HX7A 4BH9A 5DCMB 3EETA 3H92A 3LSTA 1HXDA 4G6DA 2BV6A 5A2QZ 3R6SA 3WGGA 3GZ6A 2XGXA 2CQKA 1XCVA 2MBFA 2O8XA 3K0LA 4RGUA 1Q1HA 4OIOF 2VT3A 1KQ9A 4G94A 3P9IA 5A2QK 4O3MA 2IA1A 4YFNF 3FXQA 1YYVA 1T0FA 2QM3A 3T1BA 4Y13A 1LJ9A 2DU9A 2X4HA 4GYIA 4L18B 3JAMK 2LNBA 3BJAA 1I6XA 1FBQA 3OV8A 1IXRC 1XSVA 4FHTA 2YU3A 3HSEA 1LNWA 2HEOA 4ZYDA 1QPMA 4WXDA 3DV8A 2VBZA 3FXUA 2QBYB 1J9IA 1JXSA 3O3KA 5DCFA 1ONVA 4UHTA 3HSFA 1QZYA 5EEGA 4IF4A 4G8XA 4EGZA 2EFNA 4EM2A 1R36A 1AOYA 1GHCA 1FP2A 3QRFF 4M72A 2VOPA 5TRDA 2MC3A 3RPQA 4M9ZA 3E6CC 1W5SA 1P4WA 3NRVA 3IRQA 4LG0B 1O57A 2XIGA 1YS6A 2UXNA 5JFRA 2Q8KA 3RYRA 1VTNC 2ELHA 1KYZA 2FXAA 2VT2A 3ML6A 1FYLA 1G3WA 5ICGA 2Y0MA 4ASNA 1BI1A 1TQPA 1MDMB 1LDDA 3TOAA 4Y15A 4M9XA 3QPTA 2ZFWA 4RB1A 4AIKA 5D5UB 4M74A 2VE9A 2FU4A 3F3XA 1E17A 2H6BA 3IWZA 1UFMA 3ERED 1YS7A 3GLXA 2G7UA 3HUGA 4LD5A 1G3YA 3J7AO 3F6OA 1FNNA 3U2RA 1IRFA 3F21A 1KGSA 1NHAA 3DKWA 2L02A 4LB6B 4KT5C 4L5IA 2EK5A 4EGYA 3CTAA 4UXNA 3PQJA 3HOTA 3N97A 1S7AA 2JPCA 2JRTA 3SXYA 1ODDA 5LHIA 2GIVA 2KKOA 3CUQC 1EH8A 4IHSA 2FNPA 2R7DA 3KP6A 3GF2A 3L2CA 3V8KA 2CWEA 1SD4A 2KIUA 3F23A 1P6RA 4M71A 4AIJA 1LQ1A 1XN7A 2P5VA 4M9SA 4CO8A 2C6YA 4M6XA 2K4BA 4UV9A 3ZPLA 2P7VB 5E8GA 1G6NA 3B73A 3EQLF 5D6EA 3E5UA 1ZRCA 3EYIA 1K79A 3WTUC 2ZXJA 5FLXK 3CLOA 4IRHA 5DYMA 3LA2A 5ICEA 4CHUA 4LJZF 4H0EA 2JSCA 1J59A 1Z6RA 1BIAA 3T0YA 4A0YA 2OQRA 3LFKA 3CUOA 2HTSA 3C3WA 4OIQF 2H6CA 5E1WA 5H6QA 1HSTA 3WU1B 2HWVA 3O2PE 2QQBA 2VN2A 2M8EA 3DFGA 1BC7C 3KEOA 3CJNA 3LQQA 2H94A 5KK1A 2OA4A 4HF0A 1ZLJA 1O7LA 4AIHA 3RJPA 5DCMA 4EJVA 5JHUA 2NYXA 1SD5A 3U1DA 3IL2A 3HRSA 3G73A 2IP2A 3GFMA 3S2WA 3IKTA 1TNSA 3ROUA 4GYGA 3E6MA 1Z1DA 1QQIA 3GFJA 5KVRA 3JSPA 3VEPA 3QU3A 3L7WA 2A3SA 2AXLA 4OINF 4UUVA 3W6KB 3BY6A 4FX0A 3KLOA 2P8TA 4P9FA 1XB4A 2ZMEB 4ZZDA 1XGOA 3H3UA 3SQNA 4CGZA 1FSEA 2VC0A 1FBSA 3HHGA 3FWEA 3L9FA 1OR7A 2Q2EA 1XGMA 4B8XA 2OD5A 3FF5A 2FOKA 3WE3A 3QP5A 3KETA 2QBYA 5LRSA 3I54A 3M7GA 1IW7F 1TQMA 3P7NA 5DUKA 2J5OA 1IXSB 2IPQX 4BYYA 1H0MA 2FF4A 1R23A 3HRTA 3ISPA 1ZH5A 3TOBA 1ZN2A 4IRGA 5H20A 5HS9A 1SMYF 4L9VA 3FZVA 3LAPA 1B4AA 1FLIA 3WTZA 3F8CA 4EJUA 1USSA 2RQPA 2GZWA 3TGNA 1DPUA 2RV8A 3KLNA 3EUHA 2F2EA 3FMSA 4UVAA 5CVUA 5FGMA 4CICA 1IN4A 1S7OA 4G7OF 1IN5A 1IN8A 4DNCA 5BPIA 5ILVA 3V4GA 3F8FA 2DBBA 1DUXC 3OOPA 4HYEA 1MJAA 1MDMA 1F4KA 1U5TB 2Y48A 1OYIA 4I98B 5LEKA 2FMLA 1SD6A 2LSOA 1J75A 1D8KA 3KP3A 3RI4A 2CG4A 3SZTA 2YR2A 1LDKB 2HOEA 2OU2A 1RI7A 4ENMA 3C7JA 3WTXC 4PDKA 1EH7A 2OZ6A 3WE2A 2ETHA 3MAJA 2PEXA 2YPRA 1F5TA 1BI3A 4AD9A 2EFQA 2DPDA 2CW0F 1G3SA 2DTRA 3FM5A 1KU2A 1W7PD 4ZYGA 1U8RA 2LDUA 3ZMTA 2VC1A 2MA3A 3QP6A 2K86A 1I27A 2GQQA 2V1UA 4OIPF 2DK5A 2CSOA 5D4SA 1TW2A 5BQTA 1GVJA 3IWFA 2HGCA 2D2WA 2NS0A 1UHMA 1B9MA 4P96A 1Z91A 2QLZA 3CUQA 3KEQA 3C1DA 2E1NA 5L3FA 1DDNA 1LB2A 1ON1A 4HW0A 2IA0A 4KN7X 2RC4A 2VBXA 1ZRFA 4RAZA 3ELKA 3J81Z 5E20A 4O6JA 2NNYA 2IT0A 3ZN1A 2YSRA 5HS7A 4WCGA 1IN7A 2W25A 4RGSA 4HQMA 4CXFA 1XDUA 3VODA 4NB5A 3HRUA 3J81K 3MEXA 3MQ0A 4PZJA 3GZ5A 4ENNA 1K78A 1R1UA 4MQVA 2QVOA 2A61A 4NQWA 1Z9CA 3HIFA 4KIBA 1BN5A 3IC7A 2JTVA 4LK0F 5F6FA 4GO1A 2ZJ2A 1L3LA 1HKTA 4I09A 3F8NA 1SAXA 1XMKA 2HQNA 4MEYF 3I53A 4L0ZB 1QO0D 1BBYA 3I0TA 3MZYA 3SZPA 3JAMZ 2XAGA 5HDNA 4N9HA 2O03A 1FX7A 5HLGA 4HV5A 3RKXA 5LRRA 4LB5A 5E8IA 2XKOA 5JR3A 2OAZA 5E18F 4A5MA 3F8BA 4CZZA 1C0WA 4UNOA 3NEUA 4IPAA 4QLCU 4BHPA 4JK1X 4IHTA 5CVJA 2V79A 5AIPA 2ZCWA 4ENKA 3I71A 4Q48A 2HFHA 4A0ZA 5LBQA 1DP7P 1G3TA 4MHGA 4KMUX 4AWXB 3K1MA 3KP7A 3WG9A 3KP2A 4L0YB 1OYYA 3RDIA 5D5XB 5K1YA 2QYOA 4KIFA 4D0PA 4FX4A 2QWWA 5D6FA 2FMYA 4L9JA 1D8JA 3HRMA 3I4PA 4M6YA 2LF8A 2PBIA 1W7PB 3KZYA 3ZMZA 4XLPF 3MCZA 1J2XA 3E6DA 2EB7A 1P92A 3H3ZA 2W57A 3LAJA 3BZ6A 1TNTA 3KE2A 3P9KA 1HSJA 1JHFA 2OBPA 1HQCA 4HBLA 1ZG3A 2D1HA 1LDJA 2HS5A 1S3JA 5JI6A 1E2XA 1MKMA 4EJTA 4HX4A 4GCVA 3V8JA 1T38A 1XGNA 4MTDA 1K7AA 1KU7A 4UVCA 3D5LA 1OPCA 5LEJA 3IHUA 4KIGA 2KIFA 4AVPA 1I1SA 5L3CA 1WI9A 3FMRA 3WGHA 1RNLA 2MD5A 2MH2A 4HF1A 1BM9A 1FSHA 5L3DA 2FBKA 1KU9A 4ZYEA 2ESNA 1TQIA 2PQ8A 4HLYA 3K1PA 2FE3A 3I64A 1RZ4A 2L54A 1O3QA 3Q9SA 2RKHA 3RIRA 1IN6A 2DQLA 1YIOA 1ZGAA 2ZBKA 2FNAA 1J0RA 2GXBA 2FBHA 2ADUA 1UCRA 5FLXZ 1V4RA 1YQAA 3TDUC 1IUYA 2KRFA 3GX4X 4P55A 2IW5A 5L3BA 4MEXF 2M5WA 3AAFA 2ACJA 1Z6TA 2KJCA 5IT3A 1MGTA 1STZA 4M73A 4RB0A 1FP1D 3LA7A 2ESHA 4ETSA 3MFKA 1ZARA 2EA2A 4WK8F 3E5QA 3HOSA 3GFIA 2XRNA 4XSZF 1T2KA 2HYGD 4WXCA 2HKOA 4WX9A 3FHZA 1WRJA 3WTWC 2MLGA 2VXZA 2VODA 1FC3A 5HDKA 4L5JA 5HS8A 2EV6A 3J80K 5LLQA 1OKRA 1ZG5A 2FA5A 2ZNYA 5D8LB 1XCBA 4KUMA 4YIIA 1W4MA 3VOEA 4A6EA 1USTA 1T6SA 3JTGA 2HZTA 4P9UA 3ZMUA 4I7HA 2V1XA 3QAHA 3CO6C 4EJOA 2VONA 1Z7UA 4F7ZA 1QBJA 2M87A 3RTRA 2KIMA 2BYVE 5FB2A 2J5PA 4R1HA 2WV0A 3ULQB 3M1EA 1ZRDA 3E3VA 3U9GA 5DUIA 3PFIA 3DXJF 1CF7B 2F5EA 1YW7A 3GO5A 1UHWA 3COAC 2XUBA 3KCCA 3M9AA 2HTJA 3N4MA 2PMHA 1MZBA 3WTYC 2A6EF 1P2FA 4LFUA 2DK8A 3ZMSA 3F6VA 1OYWA 1S8NA 1OMIA 4S04A 5DD4A 4ESBA 2QUFA 5F1RA 4RB3C 2DO7A 4EJWA 3P9CA 4FT8A 3E6BA 3ECHA 1O3SA 2P6TA 1PP8F 4RAYA 1B9NA 3CDHA 1WQ2A 2YX4A 1U78A 4YG2F 2A68F 3BJ6A 4U0VA 2CYYA 3TQNA 2ISZA 5LHHA 2VBYA 3ABTA 3R61A 4Q4ZF 1FYKA 3KFWX 2QZ8A 3RKYA 5FFXA 1F1ZA 3ZN0A 4MQ9F 5CVRA 2MLKA 4HQEA 2M1BA 4IRIA 4RGRA 2RN7A 2E1CA 1F9NA 2HR3A 3HSRA 1JE8A 1W7PA 3NQOA 4XBFA 4LG0A 1U5TC 1AWCA 2X0LA 4U88A 1FOKA 2STTA 1MJBA 4IXAA 2ISYA 4A0XA 5CVIA 2G9WA 4LLGF 2XAQA 2COMA 4KICA 4EM1A 5E1ZB 1EV7A 3GW2A 1BI0A 4LK1F 3BJOA 2P6SA 1YW8A 2PI0A 3K1NA 4NHJA 2D1VA 4ESJA 4I2OA 1I1GA 2A5YB 2XASA 2GAUA 2RDPA 2JZYA 4LLNA 1LEBA 1BJAA 1W5TA 1MJ9A 1A04A 3RKWA 3CO7C 2DT5A 1FY7A 2Q0OA 1G4DA 1ZREA 4KDPA 1XD7A 3L09A 2STWA 1IZ1A 2XROA 4XRFA 3D0SA 1D3YA 5DV5A 1HBXG 5HVQC 5CYVA 2FRHA 2EJRA 2HYFA 2L4MA 3I5UA 3E97A 1FT9A 2V6CA 2O61A 4R8HA 5FFZA 5CLSA 5H6RA 2OQGA 4BHBA 5D5VB 2FBIA 5BS6A 3RYPA 5HLHA 3DEUA 5ILSA 4WF2A 5D5WB 2XV4S 5CJ9A 2K7LA 4B09A 3B02A 1B1BA 2NNNA 2K27A 2D45A 3V7CA 1TTYA 3VFZA 5ILUA 4ZYHA 2DFIA 4LLLA 1R22A 2UZKA 5BMZA 3GWZA 1ZGJA 2DPUA 5E17F 3ZMDA 1XMAA 5J6XA 1R00A 2PG4A 2P5LC 2E7XA 3W6JB 4QWQA 2RNJA 3TO9A 2W84A 1YLFA 3MWMA 1WWXA 4ENJA 3GXOA 2HQRA 3IKVA 1ON2A 3BROA 1FZPB 4BHCA 1B59A 3HTSB 1S6LA 3WTSC 2F5DA 5ICFA 1U6GA 1JGSA 2DI3A 1ULYA 2UXXA 1LVAA 3VB2A 5FD5A 3T8TA 4JBAA 1SD7A 3FXRA 1B6AA 2A07F 1R7JA 5FD6A 2GXGA 3I59B 1CF7A 4OU0A 1BOAA 2PN6A 3GVAA 1QZZA 3WGIA 2ZMEA 2FSWA 2Y75A 4G6QA 1U3EM 3R0AA 2Z99A 3LA3A 2QENA 4N0BA 2A69F 5K5RA 4EMSA 1O3RA 2ZKZA 2Z9OA 1WKMA 2AS5F 5HLIA 2IJLA 3FMQA 2OZUA 4K2EA 4RS8A 4A6DA 1P4AA 2GWRA 1L0OC 2DAOA 2P5KA 1ZYRF 4RB2C 5JVTA 2GA2A 1X3UA 5J8CA 2XHKA
chains in the Genus database with same CATH superfamily
2ZXIA 2BBYA 4PGHA 2JMWA 3PL8A 2CRGA 2QKMB 3C18A 3C2BA 1EH6A 2WAQN 2X6XA 4IZZA 4KN4X 2M0CA 2ZXWH 1VQ8I 2CJJA 1TWCJ 3EDPA 2R0QC 4HZFA 1GUUA 4BJTA 1BC8C 3CC7I 1Y0NA 5EZHA 1XTAA 2K02A 3HTUA 1VFCA 3ZQIA 3MKZA 2WB1A 4HNTA 3PUFA 1XSDA 4OMZA 4QPOA 4F3QA 2EV5A 4IOAF 2M45A 2JSPA 4CYDA 3H1CA 4A3GJ 3TP0A 2E36A 3HYIA 3SHFA 3BC8A 2DA7A 3FKJA 4S0HB 4BEHA 1FBUA 3MD2A 3FBIB 3HL2A 3BWGA 2DA1A 3Q9VA 1SFKA 2JA8J 1KYWA 2DA3A 2R7FA 3BG3A 3OYBA 4XKWA 4HDVA 2VOOA 5LHGA 1QZEA 1UHSA 1XC5A 3DPTA 5LGTA 1BA5A 4HF2A 4KYWA 3BG9A 4ESFA 5HOOA 3CCYA 3ZMVA 1U5TA 2O3FA 1VQNI 1OCCH 3K9TA 3KIOA 3TO6A 4A2UA 1SFXA 2K85A 1OCZH 2XKPA 2X51A 2LYCA 2M30A 1OISA 1IRGA 2O5RA 4O5VA 3K2ZA 2LC2A 2V1DA 4GGGA 4G7HF 3R0JA 4PCQA 4I76A 3RZDJ 4R79A 5BPDA 3BTJA 2DW4A 2KLOA 1HW1A 4WWCA 4FISA 1W0UA 3OYJA 1K4TA 1KONA 2K9LA 1HKQA 1UB9A 4A5NA 3CCVI 3DBLB 4L9NA 3AKZA 2NRAC 4NC8A 4GDFA 4HOBA 2LY9A 3IH2A 2VASA 1WH7A 5EYRA 2P7CB 2P4WA 2B63J 3HHHA 2IEKA 2V9VA 4PJJA 4AM3A 3ERMA 1HDDC 1B8IB 3KP5A 3H0GJ 2W00A 2EZLA 2L01A 1DU6A 1LEAA 2EFWA 5FLMJ 3R60A 4HLXA 4EATA 2RGVA 4EEFG 2VKEA 1OCPA 3R4KA 1BJZA 4BBSJ 2HVQA 4MTEA 5FKLA 3RQIA 2BW3B 2Z1DA 5IT9Z 2WTEA 4HAMA 3L2VA 1T98A 2M2EA 2FD5A 3GEZA 1WJDA 1ZAOA 1TBXA 2CFXA 5KHDA 2R7VA 1A6QA 1H9TA 1GXQA 4XRSA 2OPTA 1D0ZA 1PP7U 4QPQA 2WC2A 1IAWA 4U7BA 3T8RA 2KL4A 1BR2A 3R6SA 2YS9A 3ZP5A 1NTCA 3HBLA 4IVNA 5EEHA 1N75A 3OYDA 6PAXA 3DEWA 1TLHB 4DQ2A 4KA4A 4XLNF 1MMDA 5IT9K 4MGRA 2VLAA 1LPQA 2L9SA 5DDGA 4NDLA 1YTYA 4C2TA 1YRNB 1WJ5A 2BGCA 4DJAA 3LMMA 2Z5UA 5TJJA 1V54H 4HEA2 1J5YA 3OYKA 2IAIA 5K5OA 2CU7A 1MMNA 2JUCA 3DQVC 1CGPA 3K69A 2HDDA 3WTTC 1D1AA 2I8DA 2PLYA 1MMGA 3F8MA 3O6BB 4BQAA 4OMYA 4HX8A 3LWFA 3CUQB 3FHNA 1S9HA 1FWZA 2BXYA 3WU0A 4U0YA 1KQ8A 1DPRA 4U0WA 1JUPA 3J80Z 4EV0A 2B0LA 2RREA 3DPLC 2KJBA 3P5JA 1Y0UA 3REOA 1ZR4A 3BTIA 3DF8A 3M8JA 4N4NB 5L3EA 3K7AJ 2Y0SA 3F0CA 3K4NA 2A05A 3GFLA 3PO2J 2BEOA 2LREA 2F5FA 5GTIC 1TW3A 3BPVA 3FX3A 2JVGA 1R6RA 2FUG2 2LLKA 2VPRA 1VF9A 4J00A 3HOZJ 3V8LA 3K70C 2XF7A 2F4MB 2PFBA 4BNCA 3MZHA 3FM3A 1SVOA 2DA5A 2E1MC 1HW2A 1XGSA 2FQ4A 1FIAA 3Q5FA 2HNHA 3BPXA 4GRIA 3GLLA 4DYRA 3OY9A 2O9LA 3KX2A 4MNUA 2VKVA 1FTZA 3GYHX 3CDLA 2VIXA 3BZCA 5BOXA 2KFDA 3A03A 1ETYA 5AIQA 5LGNA 1G59A 2E7WA 3D5SC 2HKXA 2O0YA 5GAGJ 1IF1A 5E3OA 3GTKJ 2HDCA 1Z05A 2DFEA 4P5OA 3Q0VA 1K78B 3LFUA 3QOPA 3OYCA 1YO5C 2OCEA 4N9IA 3F22A 2E1MB 2QF7A 3L1PA 4XSXF 1ZG1A 1NG7A 4ZYAA 2HPMA 3I59A 3V7RA 2E34A 4XLAA 1TT5B 5C4JJ 1R5GA 1TWHJ 3ABLH 3V7SA 4BAYA 2VL8A 2LF7A 2M4GA 3DTKA 2L3DA 1YG2A 2FEZA 2PMUA 2K9SA 4FTHA 2FQ3A 5CKTA 1RIOH 3QU6A 3TKYA 1BR1A 2DLLA 5HDGA 4YFXF 4HDUA 4B44A 2ZXHA 5K5QA 3LSJA 3G1OA 3BQZA 3HZJA 4RMNA 3JTHA 3LSPA 1MMAA 2VJJA 4HG2A 3BOQA 4JQFA 5J8FA 1MNMC 2IRFG 4IKFA 4TV7A 1PUFB 3E0JB 1WPKA 3EYYA 2E5NA 3GTMJ 2H09A 4ZZLA 2L7ZA 2XAFA 3MZ8A 2O6GE 2HVRA 1XSXA 2IBDA 2CGPA 4CUGA 5IOZA 3L00A 3ZQGA 3FXOA 3W2WA 4D5CA 4Q5SF 1QNTA 2XGCA 3ABUA 4X0GA 4XLFA 4WXHA 2XAUA 2XPVA 3E5XA 5D8KB 1SVLA 3FK6A 3PM1A 4A3CJ 4DBQA 1HC8A 4HA8A 3JSOA 4U7DA 2W24A 5C4XJ 2W85A 1HW5A 4CCOA 3CJTB 4B3AA 2G7HA 4C9YA 3BG7A 2EZHA 3I58A 3EPZA 1ZHFA 2QQAA 4B1RA 1Y1VJ 1QVTA 3VYUB 1TWAJ 4OOIA 3ZXSA 1RUNA 3JRAA 3OMYA 2Z33A 2H27A 3JW4A 3SFZA 1ENHA 1Y6IA 1KA8A 2EINH 3IRRA 1WCMJ 1WHUA 4EQQA 1X2NA 1HKSA 1RUOA 4L5EA 4PGGA 4IJAA 4FCYA 3CMMA 4KNYA 2XAJA 4UV8A 4CA0A 3CMYA 1YFHA 1REPC 4RBOA 3QPSA 2F5CA 4G6TB 4Y17A 1RRJA 2XB5A 2JT1A 4E7SA 3SDBA 1IXCA 5DEQA 3K4JA 1JKRC 4HV6A 1XDSA 2CO5A 1PDNC 1QGPA 2CH0A 3BCBA 1U2WA 2R7SA 2VBWA 4II2A 4EM0B 4YFKF 1ETWA 1R5HA 2KRHA 1O3TA 2KZVA 3KP4A 4BBRJ 2JPBA 1Z3YA 4DOZA 5ED4A 3JRCA 1S29A 3DCFA 4BDZA 3M8EA 4M3DA 1FPQA 1FYMA 2EA4A 3G1MA 3GTLJ 1W1WE 2JA7J 4OIRF 5ICCA 5F0CA 1F36A 3QODA 4A69C 4M3FA 1H89C 1MSEC 1X3WB 3HJEA 4M6VA 4BXUA 4I02A 1BI2A 1XG1A 4A12A 4GXOA 2IVMA 1ITYA 2YX7A 3ASNH 4LMYA 3TDZC 2MH9A 3ECOA 1R58A 2R92J 2PJPA 4ON0A 1I5ZA 5F64A 4ZH4F 2NS7A 1V3FA 4E7ZA 3AG2H 3KZIC 2K9MA 1H9GA 3B6CA 4F55A 4Z2YA 5L3GA 3KZZA 2MABA 3QPHA 2XVCA 3BR2A 2RVCA 3ASOH 3K6GA 5E1XA 2QQ9A 4M3GA 2L7FP 5LGUA 3H9JA 3WG7H 1JGGA 4HRIA 2HDWA 2EV0A 4KT6A 3G3ZA 3F72A 3H3VK 1X1BA 4BY7J 3LQRA 1BL0A 2F4IA 2R7ZJ 1AHDP 1P4XA 2KP6A 2E5ZA 2NAZA 4EVIA 4CYCB 2ZO4A 1K83J 3GUDA 4YIRX 1R1TA 3BP8A 3OIOA 1YX5A 5DD8A 2R7WA 2VJIA 4ZDPA 1JJ6C 2DQRA 1S72I 4KMFA 4L9TA 2ELKA 1SMTA 2IXSA 3BDDA 1W5CC 3T5XA 4I0AA 2TRTA 3W6VA 5AONA 4E70A 2IGNA 4Q47A 5M3MJ 2HPIA 2QSHX 2R5ZB 2ZNZA 1B72B 1YRNA 1Z67A 1XS9A 3AL0C 4MIMA 2VUMJ 1K6OA 3BR0A 2M9HA 5ERIA 1D1CA 1SFEA 1OQYA 3RPUA 3DP7A 1SFUA 4XLHA 3W2AA 3HOYJ 5CVVA 4LGWA 4G9YA 2GA1A 1DGRM 3WODF 2VE8A 3PQKA 3TO7A 4I01A 2A6HF 4S05A 3M8FA 3ZQ7A 2XSJC 2JK3A 1KU3A 2K4JA 1BIBA 1Y8RB 1V5GA 2H1LA 2QQ8A 4HPQA 1X1PA 5FO5A 2BE5F 3WTVC 2WWYA 2LKPA 4I0BA 4A3FJ 4XNFA 5KCMA 4RGXA 2Y30A 2WAEA 4X1EA 2W7NA 1GXPA 4KFCA 1KQ0A 1T39A 1IDZA 5FKOA 5F1JA 1JT6A 4XICA 4UVBA 2XC7A 3FXLA 4BJ5C 2HQAA 3LSHA 2XAHA 2QSGX 2TCTA 4BQNA 1PUEE 1HDPA 1FJLA 3DTIA 5D4RA 2EWNA 2Z3YA 3PFYA 1MD0A 2I5UA 2IA2A 3OYFA 1WSUA 1R49A 4NNJA 4QTRA 4CDGA 1O7FA 4GFBA 2R3SA 4G7ZF 1ZLKA 2L4AA 2IS1A 3D5RC 1YW9A 1JHHA 1D1BA 2EFOA 1J7KA 1D5VA 5IPAA 1XPXA 4YIFA 2CQ7A 4UUTA 2EFPA 4D1QA 3I4NJ 2UWMA 2TDXA 4A3JJ 1R1VA 5E3LA 2VJ5A 4HX7A 5DCMB 3SZGA 2VQGA 3EETA 3H92A 2JUGA 4BH9A 3LSTA 3DU5A 1HXDA 2CQNA 4RAFA 4G6DA 2VKDA 2M7AA 2BV6A 2LD5A 1LE8B 2CQXA 5A2QZ 2CUFA 1A5JA 2R7QA 4N4OB 2R4GA 3H5NA 2XGXA 3BCAA 3IAS2 2CQKA 1XCVA 3LSGA 2VQHA 3WGGA 4CCLA 2MBFA 5FLVA 3PO3J 4A93J 5DM6F 2O8XA 3K0LA 4RGUA 1Q1HA 3KYLA 4OIOF 2VT3A 1KQ9A 4A3DJ 4LIVA 3JR9A 4G94A 1TT0A 3P9IA 2DT7B 5A2QK 3OYGA 4E7JA 4O3MA 2IA1A 1YE9A 2ME0A 3FXQA 1T08B 3W2VA 4YFNF 1YYVA 2DODA 1H8AC 1HF0A 1T0FA 3ZQHA 2QM3A 3T1BA 1GVDA 4FETA 4Y13A 1LJ9A 2DU9A 2X4HA 4GYIA 4L18B 2P81A 3JAMK 2LNBA 2Q1ZB 1MBFA 1I6XA 3BJAA 1FBQA 5CPRB 2ELJA 3OV8A 1IXRC 1XSVA 4JX6A 4FHTA 3SYTA 2YU3A 3HSEA 1I50J 1WJCA 1QRYA 1LNWA 3A4CA 2HEOA 3FDYA 4ZYDA 3AG3H 2LVSA 3CCMI 1QPMA 5GP9A 3OYHA 1TWGJ 4WXDA 4OAZA 2ZJRF 3DV8A 1KZHA 2VBZA 3FXUA 5E3NA 2QBYB 1J9IA 4UY8I 1FTTA 1JXSA 2BY1A 1MBGA 3O3KA 4DZJA 3EUKL 1ONVA 5DCFA 4A3MJ 4XL9A 2Y9ZA 1G2HA 4UHTA 1GT0C 1ZK8A 3S3NA 3HSFA 1QZYA 5EEGA 3A1YA 1N25A 1SAUA 2NOJB 4IF4A 2LRDA 3HKZA 2L2OA 3BG5A 3EUHC 1CQTA 2AO9A 4G8XA 4EGZA 1V5FA 1MSFC 2DFHA 3OS0A 1IJWC 2EFNA 4EM2A 1W36D 1R36A 1AOYA 1GHCA 1FP2A 3QRFF 4M72A 4CCMA 3CZ6A 1HOMA 2VOPA 3BR5A 5TRDA 2MC3A 2HI3A 1WJBA 3RPQA 4M9ZA 3E6CC 1W5SA 2XPWA 1MBHA 1P4WA 3NRVA 3OL4A 3IRQA 2DXIA 4LG0B 1SC7A 5EF6A 5IOYA 3GTJJ 1O57A 2XIGA 1UMQA 1YS6A 2JWTA 1JTYA 2UXNA 5JFRA 3CF2A 2Q8KA 4FE7A 3RYRA 3EUAA 2ELHA 1VTNC 2O8KA 1KYZA 2LTPA 4XKBA 2FXAA 1I39A 2VT2A 4W1UA 3CCUI 3TEDA 2MSYA 3ML6A 4XKVA 2KMUA 4E7HA 2DJNA 1FYLA 1G3WA 3K4BA 5ICGA 2Y0MA 5GADJ 2HOTA 3G6EI 3CMEI 4ASNA 1BI1A 4ZJZA 1TQPA 1MDMB 1LDDA 3TOAA 3H0DA 2V7FA 4Y15A 4M9XA 3PSIA 4F93B 3LSMA 3QPTA 2ZFWA 2PX9A 4RB1A 4AIKA 5D5UB 1K4SA 1W0TA 4M74A 2VE9A 3N05A 4D7NA 2FU4A 4W97A 1Z7LA 3VYTB 2CMPA 2LK2A 3F3XA 1E17A 2X1DA 1EJ9A 2H6BA 3H5AA 3IWZA 1UFMA 3ERED 2AXTC 2LP0A 1QU3A 1YS7A 3GLXA 2G7UA 3HUGA 1ZR2A 4LD5A 3QYBA 2ZSIB 1G3YA 2EPFA 3GZ6A 2F4OB 3PNTA 3VYRB 1YHQI 3J7AO 3CCLI 3F6OA 5EG0B 5C44J 4E7KA 1WGXA 4HNUA 1FNNA 2M8GX 3S15J 5M5XJ 2UUZA 4XIDA 3U2RA 1IRFA 2AHQA 1AA7A 5IYBJ 3S1NJ 4Z6YA 3F21A 1ETKA 1KGSA 1NHAA 4CYCA 3DKWA 2L02A 2D5VA 2VB6A 1R4MB 4LB6B 4KT5C 4L5IA 2EK5A 4HSTA 4EGYA 3CTAA 3CCSI 4P1WA 4UXNA 3PQJA 3CJRB 3HOTA 3N97A 4BXXJ 5EJCA 1S7AA 2JPCA 2JRTA 3SXYA 2EIMH 1ODDA 3LSIA 3HC7A 2PMZA 5LHIA 2XB0X 2GIVA 2KKOA 3CUQC 1YI2I 1WJFA 2R5ZA 1EH8A 1B72A 4IHSA 1Z3XA 2FNPA 2R7DA 3KP6A 2QGUA 3GF2A 3QYFA 3L2CA 3V8KA 2CWEA 1SD4A 2KIUA 3F23A 2IGMA 4BE1A 1P6RA 2HU9A 1DU0A 4M71A 5HODA 4AIJA 1FIPA 1LQ1A 1XN7A 2P5VA 4M9SA 4II3A 4CO8A 2C6YA 1BOBA 4M6XA 4ZDLA 2E60A 1IUFA 4JP0A 2K4BA 4UV9A 3ZPLA 2JN6A 3MN2A 2P7VB 1D0YA 2LFBA 4XONA 1N77A 3K4CA 1M1EB 2DTZA 2XF5A 3RZOJ 5E8GA 3GCMA 1G6NA 3B73A 3EQLF 5D6EA 1ZGWA 3E5UA 1ZRCA 2IS6A 4Y52J 3EYIA 4ZC3A 5FKMA 3OS2A 4RA2A 2BZTA 1K79A 5B1BH 3WTUC 2ZXJA 5FLXK 3CLOA 4IRHA 2X6OA 2WAQA 4D5FA 5DYMA 3LA2A 5ICEA 2BHYA 4A3BJ 4CHUA 3K4MA 3A02A 4LJZF 4H0EA 2JSCA 1J59A 1Z6RA 1BIAA 3T0YA 4A0YA 2NXNB 2R7TA 3S1MJ 2OQRA 4FASD 3LFKA 1JJ8C 3CUOA 2EIKH 1MBEA 2HTSA 2V1NA 4AC0A 1WH5A 3C3WA 4OIQF 2H6CA 5E1WA 5H6QA 1HSTA 3WU1B 3ZQCA 2HWVA 1BR4A 3O2PE 1W36C 2QQBA 2VN2A 4FE4A 3WHBA 2M8EA 3DFGA 1BC7C 3PIPF 1MMSA 3KEOA 4B48A 3OSFA 3CJNA 2X85A 3LQQA 2H94A 5KK1A 3DPUA 2OA4A 4QSHA 4HF0A 2N8GA 3MKWB 1ZLJA 2X1EA 2EQRA 1O7LA 4AIHA 3C2HA 4XOPA 3RJPA 5H2FC 5DCMA 4EJVA 5JHUA 1OJLA 1SD5A 2NYXA 4PFOA 3U1DA 5GAHJ 3HRSA 4NQWB 4YEJA 3IL2A 3G73A 1P9QC 3S1QJ 2A5WA 1LE8A 2IP2A 3VSKA 3GFMA 1T0FC 3S2WA 3IKTA 1FMWA 3HGYA 5J40A 2CUEA 1IRXA 3A2KA 1TNSA 2H8RA 1NK3P 3ROUA 1OCOH 4GYGA 1LFPA 3NARA 2OJED 3E6MA 1Z1DA 3BZKA 3CP2A 3BTLA 1QQIA 3GFJA 2EBIA 5KVRA 2M7BA 3JSPA 3VEPA 3QU3A 4E7LA 3A0BC 3L7WA 3BG6A 2A3SA 3OYIA 2AXLA 4BE0A 2XGDA 4E6KG 3CF5F 1A31A 1HLVA 2LY2A 1YOVB 4OINF 2DT6A 3GTOJ 4UUVA 1P7IA 3S14J 3W6KB 3JREA 3BY6A 3DBRB 3KLOA 4FX0A 2P8TA 4P9FA 4B3XA 3K4KA 1XB4A 1X3ZB 2ZMEB 4ZZDA 1XGOA 3H3UA 4XORA 4ZDOA 3SQNA 2KDOA 3JRDA 4CGZA 1FSEA 3Q0WA 2KIQA 3H5RA 1VQPI 3O8HA 2VC0A 5FJ8J 1FBSA 3HHGA 3S2HJ 2YU9J 3CQZJ 1UZCA 3FWEA 1NG6A 2DMNA 4Y33A 3L9FA 1JUMA 1OR7A 2Q2EA 1XGMA 4B8XA 2OD5A 3OSGA 3F9KA 3FF5A 5TISC 2FOKA 1T8IA 3WE3A 3QP5A 3KETA 3PSFA 5LRSA 2QBYA 5FKNA 3I54A 3M7GA 1IW7F 3S16J 5IP6A 1TQMA 1SVMA 3P7NA 5DUKA 2J5OA 1X58A 1IXSB 2R7RA 4J19A 2IPQX 3H9QA 4BYYA 1H0MA 2JJ7A 2FF4A 1R23A 3HRTA 3ISPA 2VJ4A 2V6EA 1ZH5A 3TOBA 1ZN2A 4IRGA 2EH3A 1E3PA 5H20A 5HS9A 1SMYF 4L9VA 4RM2A 1IDYA 1UG0A 3ZOBA 2DMUA 3FZVA 1G8XA 3LAPA 2XGEA 1B4AA 4Y3OA 2L0KA 4BS9A 1FLIA 3WTZA 5M5YJ 3F8CA 2M34A 4EJUA 3HPHA 1USSA 3CMAI 1E0EA 2RQPA 2GZWA 3TGNA 1HA8A 1DPUA 2RV8A 3KLNA 1SFOJ 2L7KA 3EUHA 2F2EA 2BXZA 3FMSA 4UVAA 5CVUA 3I3LA 5FGMA 4CICA 1IN4A 3J7AY 1E3HA 1S7OA 4G7OF 1IN5A 3AG4H 1IN8A 3I9V2 4DNCA 5BPIA 2K3FA 4BL0B 1X2MA 5ILVA 3ABKH 3OL3A 1MBKA 4YELA 3V4GA 2CS3A 1TWFJ 5JLXA 3HOVJ 3F8FA 4IX7A 2DBBA 1WJEA 1QVUA 3OOPA 1DUXC 2DMPA 1MJAA 4HYEA 1JI8A 5B5EC 1MDMA 1F4KA 1U5TB 2K9QA 2Y48A 4DIQA 4E4HA 1OYIA 4I98B 5LEKA 2OTJI 1NK2P 2FMLA 2IS2A 1SD6A 2LSOA 2QCOA 3A01B 4PJMA 1R71A 3JRIA 1J75A 1D8KA 3KP3A 3RI4A 4BY1J 2CG4A 3NWTA 1B8IA 2K5CA 3SZTA 2YR2A 1LDKB 2JVHA 2HOEA 4XLCA 5LFAA 1NH3A 4AVZA 3D1NI 2QKLB 3FXKA 5J1YA 2HQ5A 2OU2A 1RI7A 4ENMA 3C7JA 1APLC 3WTXC 2L9VA 4ABZA 1ORKA 4PDKA 1EH7A 2OZ6A 5EG0A 3VPRA 2KT0A 4QIWN 4NUBA 4LG3A 3WE2A 3OYMA 3ZQQA 2ETHA 2ZJPF 3MAJA 2PEXA 2BW3A 2YPRA 1TP4A 1BI3A 1YJ9I 3OYLA 1F5TA 4IHVA 3RQ4A 4AD9A 2OTLI 2EFQA 1R4NB 2DPDA 2ID3A 2CW0F 4M3EA 2KRCA 2MW8A 1G3SA 2DTRA 3FM5A 1KU2A 2E71A 5GPAA 2YUSA 4H4KC 3TL4X 1W7PD 3B6AA 3S8PA 4ZYGA 1U8RA 2JQ7A 2LDUA 3ZMTA 2VC1A 2MA3A 3QP6A 2K86A 1I27A 2GQQA 2V1UA 4OIPF 2DK5A 2ECCA 1IG7A 2CSOA 5D4SA 1TW2A 1JKPC 5BQTA 1GVJA 2Z16A 1SEUA 5KNLA 3DKXA 2OUMA 3IWFA 2DDBA 2HGCA 2D2WA 2NS0A 1UHMA 2VQCA 3S32A 1B9MA 3OYNA 4P96A 2KZGA 5CQGA 1Z91A 4B4CA 2QLZA 2ME6A 3U1KA 2ZJQF 1YITI 5HNHA 4KITB 2MD0A 2B7EA 2COBA 3CUQA 2DYRH 3KEQA 3C1DA 1ZQ3P 2IGOA 1IRZA 1UG2A 2E1NA 5L3FA 2O7OA 1DDNA 4LIUA 1LB2A 3RSNA 1ON1A 1EA3A 3ONQA 4HW0A 2EILH 1I3QJ 1MBJA 1R5ID 4JYKA 4DW6A 3FIWA 2IA0A 4KN7X 3FKIJ 2RC4A 5J1UA 2JRMA 5J4YA 1XMXA 2VBXA 1ZRFA 2GLOA 4RAZA 3ELKA 3J81Z 1VNDA 5E20A 4O6JA 2NNYA 2IT0A 3ZN1A 2YSRA 5HS7A 4WCGA 1IN7A 1LUJB 1ETOA 3J7YJ 1RETA 2W25A 4UB8C 4RGSA 4HQMA 5K7FA 1OFCX 4CXFA 1J09A 1XDUA 3U21A 3VODA 4NB5A 3HRUA 1OLTA 1U9NA 2WY8Q 3J81K 3MEXA 3MQ0A 3O8GA 3GZ5A 4PZJA 4RLFA 4ENNA 4ZTJA 2L7MP 1K78A 3AG1H 1R1UA 2G0EA 2QVOA 3QWLA 4MQVA 3WHCA 3MKYB 2A61A 3FXJA 2BY3A 4NQWA 1Z9CA 3HIFA 4X6AJ 4ITVA 4KIBA 1BN5A 1WI3A 2JTVA 3IC7A 4LK0F 3G4SI 5F6FA 1GV5A 4GO1A 4M3BA 2ZJ2A 2HXOA 5DM7F 1L3LA 2RNGA 2F6CA 2V9KA 2CUZA 1HKTA 3LNQA 4I09A 3F8NA 4IOCF 1SAXA 5FRMA 1XMKA 2HQNA 4MEYF 3I53A 3JRGA 1QO0D 3OYAA 4L0ZB 1BBYA 3BLYA 3I0TA 3MZYA 2K3PA 4MFEA 3SZPA 1MH4A 4JX5A 1ZTRA 3IP4B 3JAMZ 2WBMA 2XAGA 5F04A 5HDNA 5M5WJ 2B9SA 4DYQA 4N9HA 1ZKGA 2BVLA 2O03A 2DN0A 1FX7A 5HLGA 4HV5A 3RKXA 2H1KA 1OR7C 2UV1A 5LRRA 4LB5A 5E8IA 2XKOA 4HNVA 4V2GA 2OAZA 5JR3A 5E18F 2VXDA 4A5MA 1PUFA 1V5EA 1PJRA 3F8BA 2GOXB 4CZZA 1C0WA 3MMYB 1UELB 3OYEA 4UNOA 3NEUA 4IPAA 1D5YA 4DGWB 4QLCU 4BHPA 3G1LA 2JA5J 2LOOA 4JK1X 2WV1A 3BTCA 3CESA 4IHTA 3BR3A 2QSFX 1Q1VA 3S93A 5CVJA 2V79A 1YJNI 5IY5H 5AIPA 2ZCWA 2KQRA 2LR8A 4ENKA 3I71A 4Q48A 5C3EJ 2HFHA 4A0ZA 5LBQA 1DP7P 4F52A 4PSXA 2CV0A 1G3TA 4AUXA 2CFOA 2W4SA 4BXFA 1E3OC 2DJIA 4MHGA 4KMUX 5IYDJ 2LKSA 2Y31A 4AWXB 5IYCJ 5E3MA 1P7JA 3K1MA 3KP7A 3WG9A 5GPCA 9ANTA 3KP2A 1VI0A 4L0YB 1OYYA 3RDIA 5D5XB 4RAGA 5K1YA 2BVMA 4IQ4A 2GXAA 3NAUA 2QYOA 3VSLA 1ACIA 2DCEA 2R5YB 1RPWA 3PJRA 3KEYA 1QA6A 4KIFA 4XMYA 4D0PA 4FX4A 2KISA 2QWWA 5D6FA 1IV8A 4CH7A 3LSKA 4PJLA 2FMYA 4L9JA 5F0HA 3RCOA 2Y0SN 5TGTA 5EGOB 3HRMA 3I4PA 4M6YA 3K70D 1D8JA 1AU7A 2LF8A 2NVTJ 1K61A 2PBIA 4C30A 2H8WA 3S3OA 1EF4A 1W7PB 3KZYA 3ZMZA 4XLPF 3MCZA 1J2XA 3E6DA 3H36A 2EB7A 1P92A 2W82A 3H3ZA 2X48A 2W57A 3LAJA 1VQ7I 3BZ6A 2MYSA 3E7LA 1TNTA 1VQ4I 2CW7A 3KE2A 3P9KA 5JVGF 1S7EA 4A3IJ 1HSJA 2CV1A 1JHFA 1JTXA 2OBPA 3RKQA 2XRLA 1HQCA 2DFFA 2OCCH 4HBLA 3IV5A 2P0WA 3S1RJ 4AIDA 1TL8A 2FJ1A 1ZG3A 2D1HA 1LDJA 2HS5A 3M1CA 1S3JA 3FK7A 5JI6A 4XQFA 3W3CA 1E2XA 2MC4A 1MKMA 4EJTA 3UR3C 2W1OA 4HX4A 4D9JA 2MFZA 1Y1WJ 2CV2A 4GCVA 3V8JA 4DYCA 5B1AH 1YIJI 1RKWA 4XN3A 3A01A 5B66C 2VKHA 1T38A 2HZDA 1HCRA 1XGNA 4C3HJ 3OWTA 5J1RA 4MTDA 1K7AA 3IH4A 1KU7A 1MW7A 1IGNA 4UVCA 3D5LA 1OPCA 5LEJA 3IHUA 4KIGA 2HOAA 3KYCB 1U0JA 2KIFA 3IUOA 4AVPA 2AQEA 1GV2A 1RR8C 2E2HJ 2KHMA 3ZCOA 5M3FJ 1I1SA 5L3CA 1WI9A 3FMRA 1DGWY 5BNGA 2JA2A 3HM5A 4BKXA 3WGHA 4NBQA 1ETQA 1RNLA 2MD5A 2MH2A 3KPHA 4CCJA 2KDZA 4HF1A 1FOXA 3QQAA 1BM9A 3M07A 1FSHA 1PYVA 2GIZA 5L3DA 3HGGA 2RAEA 2FBKA 1KU9A 3GZNB 4ZYEA 2ESNA 5DS9A 1TQIA 2PQ8A 4BUPA 4XOTA 4HLYA 3K1PA 2FE3A 2K9NA 1T56A 3L2QA 3I64A 1RZ4A 4Y7NJ 2L54A 1O3QA 3DU6A 2AQFA 3Q9SA 1JT0A 2RKHA 3RIRA 1XX5A 1IN6A 2DQLA 2ZBKA 1YIOA 1ZGAA 2FNAA 1J0RA 2IGKA 2GBYA 2GXBA 2FBHA 2V4JC 2ADUA 3BR1A 2VI6A 1UCRA 2DOEA 1POGA 3CC4I 5FLXZ 1V4RA 4AU7A 1YQAA 3TDUC 2NVQJ 1IUYA 2KRFA 3GX4X 3M3YJ 3QOEA 4P55A 3VYSB 1X4PA 2IW5A 2BY2A 5L3BA 4MEXF 2M5WA 3AAFA 4IO9F 2ACJA 1Z6TA 2KJCA 3TW7A 1MGTA 2DA4A 3CDIA 3PNVA 5IT3A 1STZA 2NOGA 4M73A 4RB0A 2HXIA 1FP1D 3MKLA 3LA7A 1MNEA 2L5QA 4BQOA 2ESHA 4ETSA 2NVYJ 3MFKA 4MO7A 1ZARA 2DOFA 4CCKA 2EA2A 4WK8F 3VWBA 3E1SA 3SFIA 4IEJA 3CJQB 3E5QA 3HOSA 3GFIA 2XRNA 2LBFB 4XSZF 1T2KA 1U9OA 2X6YA 2EZIA 2HYGD 4WXCA 2HKOA 4WX9A 4XRMA 1VQ9I 3KYDB 1WVRA 4MLOA 2Y9YA 1RESA 4C3JJ 3FHZA 4XKCA 1WRJA 1A36A 1F43A 2L9NA 3FXMA 3TMOA 2R7UA 2RQQA 3WTWC 2MLGA 2VXZA 1IO2A 3ZQFA 2VODA 1FC3A 5HDKA 1VQ5I 4L5JA 4XN0A 2BOLA 5EZGA 5EEAA 3SEZA 5HS8A 2EV6A 1AKHB 3J80K 5LLQA 3JRHA 4NC7A 2PJRB 3S3MA 1OKRA 4KJZA 1ZG5A 2FA5A 2ZNYA 2GOMA 2ZSHB 5D8LB 5JHFA 4UUSB 1XCBA 4KUMA 3OOUA 4YIIA 1W4MA 3VOEA 4A6EA 2NS8A 1USTA 1T6SA 1LFUP 2K40A 1TZLA 5F0FA 3JTGA 1D0XA 2HZTA 2ZC2A 4P9UA 3ZMUA 2XSDC 4I7HA 2OC6A 4U87A 2V1XA 3QAHA 1S5LC 3CO6C 3HOUJ 4EJOA 2VONA 1Z7UA 3J7ZI 4OAYA 4F7ZA 2F5VA 1QBJA 2M87A 1UAAA 3RTRA 2ZMEC 2KIMA 3S17J 2BYVE 3CP8A 4B47A 5FB2A 4A3LJ 2J5PA 4FQGA 4PFPA 4R1HA 2WV0A 3ULQB 1VQOI 5E79C 1Z0XA 4DZPA 2Z2SB 3M1EA 1X1AA 5KAIC 1ZRDA 3IAM2 2E19A 3E3VA 3U9GA 5DUIA 4IHYA 1PVEA 3PFIA 1N78A 3ZQLA 1BW5A 3DXJF 2LH9A 1DP3A 1QHHD 1CF7B 2F5EA 1YW7A 3GO5A 5HNFA 1UHWA 3COAC 2ZB9A 2XUBA 3KCCA 3I56I 1ETXA 3M9AA 2HTJA 4JX4A 3TBIA 3ABMH 3N4MA 2PMHA 1MZBA 2L9RA 3WTYC 5KAFC 3JRBA 2A6EF 2DYSH 1P2FA 4LFUA 1X1CA 2DK8A 3DTEA 3ZMSA 3F6VA 1OYWA 4BQQA 1S8NA 1OMIA 3TP3A 1X1DA 2W48A 4CSWA 1SANA 4S04A 1UJ8A 5DD4A 4ESBA 2QUFA 5F1RA 4XRSG 2DO7A 4RB3C 4EJWA 5CQEA 1VZ0A 2F48A 3P9CA 3WU2C 4FT8A 3M4OJ 1O4XA 4A3KJ 3E6BA 1ERDA 3ECHA 1O3SA 4PJ0C 2P6TA 1H88C 1PP8F 4RAYA 1B9NA 3CDHA 1WQ2A 2YX4A 1U78A 4YG2F 4A3EJ 3G71I 2A68F 2BHZA 3BJ6A 2CYYA 4U0VA 3TQNA 2ISZA 3HPGA 3JCUC 5LHHA 4KISA 2VBYA 2R93J 3ABTA 3R61A 3I55I 3GTGJ 5IP9J 4RDUA 1QHGA 4Q4ZF 4IQJA 3PUBA 2DMQA 1WFXA 1FYKA 3KFWX 2QZ8A 3RKYA 2LY1A 5FFXA 1F1ZA 2I10A 3ZN0A 1Y56A 2R5YA 4MQ9F 5CVRA 2MLKA 3L2WA 4HQEA 3HB9A 1I6HJ 3ZR8X 2E2JJ 2M1BA 4IRIA 3OR2C 4RGRA 2RN7A 2E1CA 2WA0A 1F9NA 5EDNA 5EGOA 2X9DA 2HR3A 3HSRA 2EIJH 1JE8A 1W7PA 3OIPA 3NQOA 4XBFA 4LG0A 1U5TC 2LG4A 2Y69H 1VQ6I 1AWCA 1OCRH 4G12A 4BE2A 2X0LA 1I3AA 3BR6A 4U88A 3SJMA 1FOKA 2STTA 4CZCA 1MJBA 1A35A 4IXAA 1TC3C 2ISYA 4BACA 4BEHB 5LD2C 2JA6J 2MGQA 4IHWA 3LOCA 3HOXJ 1YX3A 4LITA 4A0XA 2IS4A 1IC8A 1IV6A 2V26A 1VQMI 2XDVA 2CQQA 3CLQA 5CVIA 3CD6I 1VQKI 2G9WA 4LLGF 2XAQA 3BT9A 2COMA 4KICA 4EM1A 5E1ZB 1EV7A 2MG4A 3GW2A 2DMTA 1BI0A 1Y8QB 3A0HC 4LK1F 3BJOA 4AYBN 2P6SA 3GTQJ 2E2IJ 1YW8A 3CCQI 2E1OA 2PI0A 3K1NA 4CCNA 4NHJA 2D1VA 3JRFA 4ESJA 4I2OA 1I1GA 2ID6A 3LSRA 2A5YB 3V42A 1FMVA 2XASA 2GAUA 2RDPA 2JZYA 4LLNA 2LMDA 2WAFA 1Z77A 4LOCA 1LEBA 2Y2ZA 1BJAA 1W5TA 2R7OA 1MJ9A 1R9TJ 4I6ZA 4JOMA 1A04A 3RKWA 3Q3SA 3UNGC 3CO7C 3DBHB 2DT5A 2M0MA 1FY7A 2Q0OA 2ECBA 1FOWA 4DBRA 1G4DA 1ZREA 2FX0A 5K7HA 1Y39A 4KDPA 1XD7A 5J4VA 1LKXA 4PUSA 3VDXA 3HUGB 5J3LA 3FISA 4PSWA 3HXLA 3OS1A 3L09A 2DDAA 2STWA 3SDGA 4ANJA 1V55H 1IZ1A 4IHXA 2XROA 4XRFA 3D0SA 5FKKA 1D3YA 5DV5A 4XLEA 2VQLA 5IP7J 3NWSA 1HBXG 5HVQC 5CYVA 2FRHA 2NVUB 2EJRA 2HYFA 2L4MA 3I5UA 3E97A 1LVKA 2VPLA 2ICWG 1FT9A 2V6CA 2O61A 1T33A 4R8HA 4MFDA 2LKXA 3GMEA 5FFZA 5CLSA 1RR7A 4UB6C 4F92B 5H6RA 2OQGA 3TW6A 3CCJI 4BHBA 5D5VB 2FBIA 5JLWA 5BS6A 5HLTA 3RYPA 1RKTA 2XPUA 5HLHA 1BW6A 3DEUA 3HKZN 5ILSA 4WF2A 5J47A 3Q0UA 2XV4S 5CJ9A 2K7LA 5D5WB 4B09A 3B02A 4OWRB 1B1BA 2WB1N 4PJNA 2NNNA 2K27A 3X2QH 4B43A 2D45A 5GTHC 3V7CA 1TTYA 3VFZA 5ILUA 4ZYHA 2DFIA 2LBFA 4LLLA 2NVXJ 1R22A 2FOWA 2UZKA 2R7XA 4YRVA 5BMZA 3GWZA 1ZGJA 2DPUA 4C2MJ 5E17F 1JUSA 3ZMDA 1X19A 2WADA 4J01A 3AL0B 2BY0A 2M3AA 1XMAA 1R00A 2PG4A 2V9PA 4PK4A 5J6XA 2P5LC 2E7XA 1K6YA 3W6JB 2DOAA 2RNJA 4QWQA 3TO9A 2W84A 1YLFA 3MWMA 4E7IA 4C2UA 5K7ZA 1WWXA 3K2AA 3FBNB 1MIJA 1RC9A 2OF7A 3GXOA 2HQRA 4RLQA 4ENJA 3HDDA 3PIOF 3IKVA 5FRNA 1ON2A 3H35A 1DQUA 3BROA 4IL6C 1ZELA 4XR6A 4NC6A 3DLLF 1AKHA 3H9GA 1FZPB 3UKGA 2DA6A 4BHCA 3IH3A 4RM3A 2PJRA 4C3IJ 1MH3A 4UUSA 1B59A 3HTSB 1S6LA 2HVSA 4BDYA 3DLAA 3WTSC 1GDTA 2F5DA 5ICFA 1U6GA 1WZ2A 1JGSA 2HYJA 2QA4I 2DI3A 1ULYA 3OR1C 3HEFA 3AFHA 1A6IA 5F27A 3CCRI 1WJAA 2UXXA 1LVAA 3VB2A 5FD5A 3T8TA 3DKYA 3I4MJ 4JBAA 4ZTFA 1SD7A 3GTPJ 3FXRA 1B6AA 2A07F 4AYBA 1LFBA 3HOWJ 1R7JA 3OIQA 1X4OA 3SEQA 2GXGA 5FD6A 3RPUD 3I59B 3QYEA 3BQYA 3CCEI 1CF7A 4OU0A 2M4KA 3DEEA 4BGDA 1BOAA 2PN6A 5GAEJ 1JKOC 2DA2A 1T95A 3GVAA 1QZZA 3MVPA 3WGIA 2ZMEA 2FSWA 2KPMA 1QPIA 3GBGA 2Y75A 2HOSA 4BU2A 4G6QA 1U3EM 1FEXA 3R0AA 1MNDA 2Z99A 2PMZN 4V2FA 2QEXI 1JKQC 2A6TA 3LA3A 2CUJA 2QENA 1FOYA 4N0BA 2A69F 3DWLE 4D7MA 2X6WA 4I99C 4EMSA 5K5RA 2ZKZA 3PNYA 5DTDA 3L2RA 1O3RA 2Z9OA 1WKMA 3G2BA 2AS5F 3CC2I 3S2DJ 4HSRA 5HLIA 3ZRGA 3HG9A 3L2UA 4BJ6C 2E35A 2XF6A 2IJLA 3FMQA 3C2GA 2WY7Q 1YJWI 2EZKA 2OZUA 1GLNA 2OV7A 3ZGKA 4V19K 2CW8A 4Y4RA 1ETVA 2GM4A 3QPLA 1U8BA 4XM3A 4K2EA 4RS8A 4A6DA 1VQLI 1P4AA 1Z21A 2GWRA 1L0OC 4F91B 3ESWB 5FROA 2Q2EB 2X1CA 2DAOA 2ZFUA 4XK4A 2P5KA 1OCTC 1ZYRF 3LL7A 5F08A 4RB2C 3K10A 5JVTA 2GA2A 3K4LA 1X3UA 5J8CA 2XHKA 5B3SH 1EKEA
chains in the Genus database with same CATH topology
2BBYA 4PGHA 3C18A 1EH6A 4KN4X 3EDPA 4HZFA 1BC8C 2K02A 3HTUA 1XSDA 4OMZA 2EV5A 2M45A 4CYDA 3HYIA 3SHFA 1FBUA 3BWGA 3Q9VA 1KYWA 2R7FA 4HDVA 2VOOA 5LHGA 3DPTA 5LGTA 4HF2A 4KYWA 4ESFA 5HOOA 3ZMVA 1U5TA 2O3FA 3K9TA 3TO6A 4A2UA 1SFXA 2XKPA 2M30A 1IRGA 4O5VA 3K2ZA 2V1DA 4GGGA 4G7HF 3R0JA 4PCQA 4R79A 5BPDA 2DW4A 1HW1A 4WWCA 1HKQA 1UB9A 4A5NA 4L9NA 2NRAC 4HOBA 2P7CB 2P4WA 3HHHA 2V9VA 3KP5A 2L01A 1LEAA 2EFWA 3R60A 4HLXA 2RGVA 3R4KA 4MTEA 5IT9Z 2WTEA 4HAMA 1T98A 3GEZA 1ZAOA 1TBXA 2CFXA 1H9TA 1GXQA 1PP7U 2WC2A 1IAWA 4U7BA 3T8RA 3ZP5A 4IVNA 5EEHA 6PAXA 1TLHB 4DQ2A 4KA4A 4XLNF 5IT9K 4MGRA 5DDGA 1YTYA 2BGCA 2Z5UA 5TJJA 1J5YA 5K5OA 3DQVC 1CGPA 3K69A 3WTTC 2PLYA 3F8MA 3O6BB 4BQAA 4OMYA 4HX8A 3LWFA 3CUQB 1FWZA 3WU0A 4U0YA 1KQ8A 1DPRA 4U0WA 3J80Z 4EV0A 2B0LA 3DPLC 2KJBA 1Y0UA 3REOA 3DF8A 5L3EA 3GFLA 2BEOA 2F5FA 1TW3A 3BPVA 3FX3A 3V8LA 2PFBA 4BNCA 3MZHA 3FM3A 1HW2A 1XGSA 3Q5FA 3BPXA 4MNUA 3GYHX 5BOXA 5AIQA 5LGNA 2E7WA 2HKXA 2O0YA 1IF1A 2HDCA 1Z05A 4P5OA 1K78B 3QOPA 1YO5C 4N9IA 3F22A 4XSXF 1ZG1A 3I59A 3V7RA 1R5GA 3V7SA 4BAYA 2LF7A 2L3DA 1YG2A 2FEZA 2PMUA 1RIOH 2FQ3A 3QU6A 3TKYA 2DLLA 5HDGA 4YFXF 4HDUA 5K5QA 3JTHA 3BOQA 4JQFA 5J8FA 2IRFG 4TV7A 3EYYA 2H09A 4ZZLA 2XAFA 2O6GE 1XSXA 2CGPA 3L00A 4Q5SF 1QNTA 3ABUA 4WXHA 3E5XA 5D8KB 4HA8A 3JSOA 4U7DA 2W24A 2W85A 1HW5A 2G7HA 3I58A 1ZHFA 2QQAA 4OOIA 1RUNA 2H27A 2Z33A 3JW4A 3SFZA 1KA8A 3IRRA 4EQQA 1HKSA 1RUOA 4PGGA 4IJAA 4KNYA 2XAJA 4UV8A 1YFHA 1REPC 2F5CA 4Y17A 2JT1A 1IXCA 5DEQA 4HV6A 1XDSA 2CO5A 1PDNC 1QGPA 1U2WA 2VBWA 4EM0B 4YFKF 1R5HA 1O3TA 3KP4A 2JPBA 5ED4A 1S29A 3M8EA 1FPQA 1FYMA 2EA4A 4OIRF 5ICCA 4BXUA 4I02A 1BI2A 4A12A 4GXOA 2IVMA 2YX7A 4LMYA 3TDZC 2MH9A 3ECOA 1R58A 2PJPA 4ON0A 1I5ZA 5F64A 4ZH4F 1V3FA 1H9GA 4Z2YA 5L3GA 3KZZA 3QPHA 2XVCA 2RVCA 5E1XA 2QQ9A 5LGUA 2EV0A 3G3ZA 3F72A 3LQRA 1P4XA 2NAZA 4EVIA 2ZO4A 3GUDA 1R1TA 3BP8A 5DD8A 2DQRA 4KMFA 4L9TA 1SMTA 3BDDA 3T5XA 4I0AA 5AONA 4E70A 4Q47A 2ZNZA 1K6OA 5ERIA 1SFEA 3RPUA 3DP7A 1SFUA 5CVVA 4LGWA 4G9YA 2GA1A 3WODF 2VE8A 3PQKA 3TO7A 4I01A 2A6HF 4S05A 3M8FA 3ZQ7A 1KU3A 2K4JA 1BIBA 5FO5A 2BE5F 3WTVC 2WWYA 2LKPA 4I0BA 4RGXA 1GXPA 4KFCA 1KQ0A 1T39A 4UVBA 2XAHA 1PUEE 5D4RA 2EWNA 2Z3YA 1MD0A 1WSUA 2IA2A 4CDGA 1O7FA 2R3SA 4G7ZF 1ZLKA 2L4AA 1YW9A 1JHHA 2EFOA 1J7KA 1D5VA 4YIFA 2EFPA 2UWMA 2TDXA 1R1VA 4HX7A 4BH9A 5DCMB 3EETA 3H92A 3LSTA 1HXDA 4G6DA 2BV6A 5A2QZ 3R6SA 3WGGA 3GZ6A 2XGXA 2CQKA 1XCVA 2MBFA 2O8XA 3K0LA 4RGUA 1Q1HA 4OIOF 2VT3A 1KQ9A 4G94A 3P9IA 5A2QK 4O3MA 2IA1A 4YFNF 3FXQA 1YYVA 1T0FA 2QM3A 3T1BA 4Y13A 1LJ9A 2DU9A 2X4HA 4GYIA 4L18B 3JAMK 2LNBA 3BJAA 1I6XA 1FBQA 3OV8A 1IXRC 1XSVA 4FHTA 2YU3A 3HSEA 1LNWA 2HEOA 4ZYDA 1QPMA 4WXDA 3DV8A 2VBZA 3FXUA 2QBYB 1J9IA 1JXSA 3O3KA 5DCFA 1ONVA 4UHTA 3HSFA 1QZYA 5EEGA 4IF4A 4G8XA 4EGZA 2EFNA 4EM2A 1R36A 1AOYA 1GHCA 1FP2A 3QRFF 4M72A 2VOPA 5TRDA 2MC3A 3RPQA 4M9ZA 3E6CC 1W5SA 1P4WA 3NRVA 3IRQA 4LG0B 1O57A 2XIGA 1YS6A 2UXNA 5JFRA 2Q8KA 3RYRA 1VTNC 2ELHA 1KYZA 2FXAA 2VT2A 3ML6A 1FYLA 1G3WA 5ICGA 2Y0MA 4ASNA 1BI1A 1TQPA 1MDMB 1LDDA 3TOAA 4Y15A 4M9XA 3QPTA 2ZFWA 4RB1A 4AIKA 5D5UB 4M74A 2VE9A 2FU4A 3F3XA 1E17A 2H6BA 3IWZA 1UFMA 3ERED 1YS7A 3GLXA 2G7UA 3HUGA 4LD5A 1G3YA 3J7AO 3F6OA 1FNNA 3U2RA 1IRFA 3F21A 1KGSA 1NHAA 3DKWA 2L02A 4LB6B 4KT5C 4L5IA 2EK5A 4EGYA 3CTAA 4UXNA 3PQJA 3HOTA 3N97A 1S7AA 2JPCA 2JRTA 3SXYA 1ODDA 5LHIA 2GIVA 2KKOA 3CUQC 1EH8A 4IHSA 2FNPA 2R7DA 3KP6A 3GF2A 3L2CA 3V8KA 2CWEA 1SD4A 2KIUA 3F23A 1P6RA 4M71A 4AIJA 1LQ1A 1XN7A 2P5VA 4M9SA 4CO8A 2C6YA 4M6XA 2K4BA 4UV9A 3ZPLA 2P7VB 5E8GA 1G6NA 3B73A 3EQLF 5D6EA 3E5UA 1ZRCA 3EYIA 1K79A 3WTUC 2ZXJA 5FLXK 3CLOA 4IRHA 5DYMA 3LA2A 5ICEA 4CHUA 4LJZF 4H0EA 2JSCA 1J59A 1Z6RA 1BIAA 3T0YA 4A0YA 2OQRA 3LFKA 3CUOA 2HTSA 3C3WA 4OIQF 2H6CA 5E1WA 5H6QA 1HSTA 3WU1B 2HWVA 3O2PE 2QQBA 2VN2A 2M8EA 3DFGA 1BC7C 3KEOA 3CJNA 3LQQA 2H94A 5KK1A 2OA4A 4HF0A 1ZLJA 1O7LA 4AIHA 3RJPA 5DCMA 4EJVA 5JHUA 2NYXA 1SD5A 3U1DA 3IL2A 3HRSA 3G73A 2IP2A 3GFMA 3S2WA 3IKTA 1TNSA 3ROUA 4GYGA 3E6MA 1Z1DA 1QQIA 3GFJA 5KVRA 3JSPA 3VEPA 3QU3A 3L7WA 2A3SA 2AXLA 4OINF 4UUVA 3W6KB 3BY6A 4FX0A 3KLOA 2P8TA 4P9FA 1XB4A 2ZMEB 4ZZDA 1XGOA 3H3UA 3SQNA 4CGZA 1FSEA 2VC0A 1FBSA 3HHGA 3FWEA 3L9FA 1OR7A 2Q2EA 1XGMA 4B8XA 2OD5A 3FF5A 2FOKA 3WE3A 3QP5A 3KETA 2QBYA 5LRSA 3I54A 3M7GA 1IW7F 1TQMA 3P7NA 5DUKA 2J5OA 1IXSB 2IPQX 4BYYA 1H0MA 2FF4A 1R23A 3HRTA 3ISPA 1ZH5A 3TOBA 1ZN2A 4IRGA 5H20A 5HS9A 1SMYF 4L9VA 3FZVA 3LAPA 1B4AA 1FLIA 3WTZA 3F8CA 4EJUA 1USSA 2RQPA 2GZWA 3TGNA 1DPUA 2RV8A 3KLNA 3EUHA 2F2EA 3FMSA 4UVAA 5CVUA 5FGMA 4CICA 1IN4A 1S7OA 4G7OF 1IN5A 1IN8A 4DNCA 5BPIA 5ILVA 3V4GA 3F8FA 2DBBA 1DUXC 3OOPA 4HYEA 1MJAA 1MDMA 1F4KA 1U5TB 2Y48A 1OYIA 4I98B 5LEKA 2FMLA 1SD6A 2LSOA 1J75A 1D8KA 3KP3A 3RI4A 2CG4A 3SZTA 2YR2A 1LDKB 2HOEA 2OU2A 1RI7A 4ENMA 3C7JA 3WTXC 4PDKA 1EH7A 2OZ6A 3WE2A 2ETHA 3MAJA 2PEXA 2YPRA 1F5TA 1BI3A 4AD9A 2EFQA 2DPDA 2CW0F 1G3SA 2DTRA 3FM5A 1KU2A 1W7PD 4ZYGA 1U8RA 2LDUA 3ZMTA 2VC1A 2MA3A 3QP6A 2K86A 1I27A 2GQQA 2V1UA 4OIPF 2DK5A 2CSOA 5D4SA 1TW2A 5BQTA 1GVJA 3IWFA 2HGCA 2D2WA 2NS0A 1UHMA 1B9MA 4P96A 1Z91A 2QLZA 3CUQA 3KEQA 3C1DA 2E1NA 5L3FA 1DDNA 1LB2A 1ON1A 4HW0A 2IA0A 4KN7X 2RC4A 2VBXA 1ZRFA 4RAZA 3ELKA 3J81Z 5E20A 4O6JA 2NNYA 2IT0A 3ZN1A 2YSRA 5HS7A 4WCGA 1IN7A 2W25A 4RGSA 4HQMA 4CXFA 1XDUA 3VODA 4NB5A 3HRUA 3J81K 3MEXA 3MQ0A 4PZJA 3GZ5A 4ENNA 1K78A 1R1UA 4MQVA 2QVOA 2A61A 4NQWA 1Z9CA 3HIFA 4KIBA 1BN5A 3IC7A 2JTVA 4LK0F 5F6FA 4GO1A 2ZJ2A 1L3LA 1HKTA 4I09A 3F8NA 1SAXA 1XMKA 2HQNA 4MEYF 3I53A 4L0ZB 1QO0D 1BBYA 3I0TA 3MZYA 3SZPA 3JAMZ 2XAGA 5HDNA 4N9HA 2O03A 1FX7A 5HLGA 4HV5A 3RKXA 5LRRA 4LB5A 5E8IA 2XKOA 5JR3A 2OAZA 5E18F 4A5MA 3F8BA 4CZZA 1C0WA 4UNOA 3NEUA 4IPAA 4QLCU 4BHPA 4JK1X 4IHTA 5CVJA 2V79A 5AIPA 2ZCWA 4ENKA 3I71A 4Q48A 2HFHA 4A0ZA 5LBQA 1DP7P 1G3TA 4MHGA 4KMUX 4AWXB 3K1MA 3KP7A 3WG9A 3KP2A 4L0YB 1OYYA 3RDIA 5D5XB 5K1YA 2QYOA 4KIFA 4D0PA 4FX4A 2QWWA 5D6FA 2FMYA 4L9JA 1D8JA 3HRMA 3I4PA 4M6YA 2LF8A 2PBIA 1W7PB 3KZYA 3ZMZA 4XLPF 3MCZA 1J2XA 3E6DA 2EB7A 1P92A 3H3ZA 2W57A 3LAJA 3BZ6A 1TNTA 3KE2A 3P9KA 1HSJA 1JHFA 2OBPA 1HQCA 4HBLA 1ZG3A 2D1HA 1LDJA 2HS5A 1S3JA 5JI6A 1E2XA 1MKMA 4EJTA 4HX4A 4GCVA 3V8JA 1T38A 1XGNA 4MTDA 1K7AA 1KU7A 4UVCA 3D5LA 1OPCA 5LEJA 3IHUA 4KIGA 2KIFA 4AVPA 1I1SA 5L3CA 1WI9A 3FMRA 3WGHA 1RNLA 2MD5A 2MH2A 4HF1A 1BM9A 1FSHA 5L3DA 2FBKA 1KU9A 4ZYEA 2ESNA 1TQIA 2PQ8A 4HLYA 3K1PA 2FE3A 3I64A 1RZ4A 2L54A 1O3QA 3Q9SA 2RKHA 3RIRA 1IN6A 2DQLA 1YIOA 1ZGAA 2ZBKA 2FNAA 1J0RA 2GXBA 2FBHA 2ADUA 1UCRA 5FLXZ 1V4RA 1YQAA 3TDUC 1IUYA 2KRFA 3GX4X 4P55A 2IW5A 5L3BA 4MEXF 2M5WA 3AAFA 2ACJA 1Z6TA 2KJCA 5IT3A 1MGTA 1STZA 4M73A 4RB0A 1FP1D 3LA7A 2ESHA 4ETSA 3MFKA 1ZARA 2EA2A 4WK8F 3E5QA 3HOSA 3GFIA 2XRNA 4XSZF 1T2KA 2HYGD 4WXCA 2HKOA 4WX9A 3FHZA 1WRJA 3WTWC 2MLGA 2VXZA 2VODA 1FC3A 5HDKA 4L5JA 5HS8A 2EV6A 3J80K 5LLQA 1OKRA 1ZG5A 2FA5A 2ZNYA 5D8LB 1XCBA 4KUMA 4YIIA 1W4MA 3VOEA 4A6EA 1USTA 1T6SA 3JTGA 2HZTA 4P9UA 3ZMUA 4I7HA 2V1XA 3QAHA 3CO6C 4EJOA 2VONA 1Z7UA 4F7ZA 1QBJA 2M87A 3RTRA 2KIMA 2BYVE 5FB2A 2J5PA 4R1HA 2WV0A 3ULQB 3M1EA 1ZRDA 3E3VA 3U9GA 5DUIA 3PFIA 3DXJF 1CF7B 2F5EA 1YW7A 3GO5A 1UHWA 3COAC 2XUBA 3KCCA 3M9AA 2HTJA 3N4MA 2PMHA 1MZBA 3WTYC 2A6EF 1P2FA 4LFUA 2DK8A 3ZMSA 3F6VA 1OYWA 1S8NA 1OMIA 4S04A 5DD4A 4ESBA 2QUFA 5F1RA 4RB3C 2DO7A 4EJWA 3P9CA 4FT8A 3E6BA 3ECHA 1O3SA 2P6TA 1PP8F 4RAYA 1B9NA 3CDHA 1WQ2A 2YX4A 1U78A 4YG2F 2A68F 3BJ6A 4U0VA 2CYYA 3TQNA 2ISZA 5LHHA 2VBYA 3ABTA 3R61A 4Q4ZF 1FYKA 3KFWX 2QZ8A 3RKYA 5FFXA 1F1ZA 3ZN0A 4MQ9F 5CVRA 2MLKA 4HQEA 2M1BA 4IRIA 4RGRA 2RN7A 2E1CA 1F9NA 2HR3A 3HSRA 1JE8A 1W7PA 3NQOA 4XBFA 4LG0A 1U5TC 1AWCA 2X0LA 4U88A 1FOKA 2STTA 1MJBA 4IXAA 2ISYA 4A0XA 5CVIA 2G9WA 4LLGF 2XAQA 2COMA 4KICA 4EM1A 5E1ZB 1EV7A 3GW2A 1BI0A 4LK1F 3BJOA 2P6SA 1YW8A 2PI0A 3K1NA 4NHJA 2D1VA 4ESJA 4I2OA 1I1GA 2A5YB 2XASA 2GAUA 2RDPA 2JZYA 4LLNA 1LEBA 1BJAA 1W5TA 1MJ9A 1A04A 3RKWA 3CO7C 2DT5A 1FY7A 2Q0OA 1G4DA 1ZREA 4KDPA 1XD7A 3L09A 2STWA 1IZ1A 2XROA 4XRFA 3D0SA 1D3YA 5DV5A 1HBXG 5HVQC 5CYVA 2FRHA 2EJRA 2HYFA 2L4MA 3I5UA 3E97A 1FT9A 2V6CA 2O61A 4R8HA 5FFZA 5CLSA 5H6RA 2OQGA 4BHBA 5D5VB 2FBIA 5BS6A 3RYPA 5HLHA 3DEUA 5ILSA 4WF2A 5D5WB 2XV4S 5CJ9A 2K7LA 4B09A 3B02A 1B1BA 2NNNA 2K27A 2D45A 3V7CA 1TTYA 3VFZA 5ILUA 4ZYHA 2DFIA 4LLLA 1R22A 2UZKA 5BMZA 3GWZA 1ZGJA 2DPUA 5E17F 3ZMDA 1XMAA 5J6XA 1R00A 2PG4A 2P5LC 2E7XA 3W6JB 4QWQA 2RNJA 3TO9A 2W84A 1YLFA 3MWMA 1WWXA 4ENJA 3GXOA 2HQRA 3IKVA 1ON2A 3BROA 1FZPB 4BHCA 1B59A 3HTSB 1S6LA 3WTSC 2F5DA 5ICFA 1U6GA 1JGSA 2DI3A 1ULYA 2UXXA 1LVAA 3VB2A 5FD5A 3T8TA 4JBAA 1SD7A 3FXRA 1B6AA 2A07F 1R7JA 5FD6A 2GXGA 3I59B 1CF7A 4OU0A 1BOAA 2PN6A 3GVAA 1QZZA 3WGIA 2ZMEA 2FSWA 2Y75A 4G6QA 1U3EM 3R0AA 2Z99A 3LA3A 2QENA 4N0BA 2A69F 5K5RA 4EMSA 1O3RA 2ZKZA 2Z9OA 1WKMA 2AS5F 5HLIA 2IJLA 3FMQA 2OZUA 4K2EA 4RS8A 4A6DA 1P4AA 2GWRA 1L0OC 2DAOA 2P5KA 1ZYRF 4RB2C 5JVTA 2GA2A 1X3UA 5J8CA 2XHKA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2BBY A;  4PGH A;  3C18 A;  1EH6 A;  4KN4 X;  3EDP A;  4HZF A;  1BC8 C;  2K02 A;  3HTU A;  1XSD A;  4OMZ A;  2EV5 A;  2M45 A;  4CYD A;  3HYI A;  3SHF A;  1FBU A;  3BWG A;  3Q9V A;  1KYW A;  2R7F A;  4HDV A;  2VOO A;  5LHG A;  3DPT A;  5LGT A;  4HF2 A;  4KYW A;  4ESF A;  5HOO A;  3ZMV A;  1U5T A;  2O3F A;  3K9T A;  3TO6 A;  4A2U A;  1SFX A;  2XKP A;  2M30 A;  1IRG A;  4O5V A;  3K2Z A;  2V1D A;  4GGG A;  4G7H F;  3R0J A;  4PCQ A;  4R79 A;  5BPD A;  2DW4 A;  1HW1 A;  4WWC A;  1HKQ A;  1UB9 A;  4A5N A;  4L9N A;  2NRA C;  4HOB A;  2P7C B;  2P4W A;  3HHH A;  2V9V A;  3KP5 A;  2L01 A;  1LEA A;  2EFW A;  3R60 A;  4HLX A;  2RGV A;  3R4K A;  4MTE A;  5IT9 Z;  2WTE A;  4HAM A;  1T98 A;  3GEZ A;  1ZAO A;  1TBX A;  2CFX A;  1H9T A;  1GXQ A;  1PP7 U;  2WC2 A;  1IAW A;  4U7B A;  3T8R A;  3ZP5 A;  4IVN A;  5EEH A;  6PAX A;  1TLH B;  4DQ2 A;  4KA4 A;  4XLN F;  5IT9 K;  4MGR A;  5DDG A;  1YTY A;  2BGC A;  2Z5U A;  5TJJ A;  1J5Y A;  5K5O A;  3DQV C;  1CGP A;  3K69 A;  3WTT C;  2PLY A;  3F8M A;  3O6B B;  4BQA A;  4OMY A;  4HX8 A;  3LWF A;  3CUQ B;  1FWZ A;  3WU0 A;  4U0Y A;  1KQ8 A;  1DPR A;  4U0W A;  3J80 Z;  4EV0 A;  2B0L A;  3DPL C;  2KJB A;  1Y0U A;  3REO A;  3DF8 A;  5L3E A;  3GFL A;  2BEO A;  2F5F A;  1TW3 A;  3BPV A;  3FX3 A;  3V8L A;  2PFB A;  4BNC A;  3MZH A;  3FM3 A;  1HW2 A;  1XGS A;  3Q5F A;  3BPX A;  4MNU A;  3GYH X;  5BOX A;  5AIQ A;  5LGN A;  2E7W A;  2HKX A;  2O0Y A;  1IF1 A;  2HDC A;  1Z05 A;  4P5O A;  1K78 B;  3QOP A;  1YO5 C;  4N9I A;  3F22 A;  4XSX F;  1ZG1 A;  3I59 A;  3V7R A;  1R5G A;  3V7S A;  4BAY A;  2LF7 A;  2L3D A;  1YG2 A;  2FEZ A;  2PMU A;  1RIO H;  2FQ3 A;  3QU6 A;  3TKY A;  2DLL A;  5HDG A;  4YFX F;  4HDU A;  5K5Q A;  3JTH A;  3BOQ A;  4JQF A;  5J8F A;  2IRF G;  4TV7 A;  3EYY A;  2H09 A;  4ZZL A;  2XAF A;  2O6G E;  1XSX A;  2CGP A;  3L00 A;  4Q5S F;  1QNT A;  3ABU A;  4WXH A;  3E5X A;  5D8K B;  4HA8 A;  3JSO A;  4U7D A;  2W24 A;  2W85 A;  1HW5 A;  2G7H A;  3I58 A;  1ZHF A;  2QQA A;  4OOI A;  1RUN A;  2H27 A;  2Z33 A;  3JW4 A;  3SFZ A;  1KA8 A;  3IRR A;  4EQQ A;  1HKS A;  1RUO A;  4PGG A;  4IJA A;  4KNY A;  2XAJ A;  4UV8 A;  1YFH A;  1REP C;  2F5C A;  4Y17 A;  2JT1 A;  1IXC A;  5DEQ A;  4HV6 A;  1XDS A;  2CO5 A;  1PDN C;  1QGP A;  1U2W A;  2VBW A;  4EM0 B;  4YFK F;  1R5H A;  1O3T A;  3KP4 A;  2JPB A;  5ED4 A;  1S29 A;  3M8E A;  1FPQ A;  1FYM A;  2EA4 A;  4OIR F;  5ICC A;  4BXU A;  4I02 A;  1BI2 A;  4A12 A;  4GXO A;  2IVM A;  2YX7 A;  4LMY A;  3TDZ C;  2MH9 A;  3ECO A;  1R58 A;  2PJP A;  4ON0 A;  1I5Z A;  5F64 A;  4ZH4 F;  1V3F A;  1H9G A;  4Z2Y A;  5L3G A;  3KZZ A;  3QPH A;  2XVC A;  2RVC A;  5E1X A;  2QQ9 A;  5LGU A;  2EV0 A;  3G3Z A;  3F72 A;  3LQR A;  1P4X A;  2NAZ A;  4EVI A;  2ZO4 A;  3GUD A;  1R1T A;  3BP8 A;  5DD8 A;  2DQR A;  4KMF A;  4L9T A;  1SMT A;  3BDD A;  3T5X A;  4I0A A;  5AON A;  4E70 A;  4Q47 A;  2ZNZ A;  1K6O A;  5ERI A;  1SFE A;  3RPU A;  3DP7 A;  1SFU A;  5CVV A;  4LGW A;  4G9Y A;  2GA1 A;  3WOD F;  2VE8 A;  3PQK A;  3TO7 A;  4I01 A;  2A6H F;  4S05 A;  3M8F A;  3ZQ7 A;  1KU3 A;  2K4J A;  1BIB A;  5FO5 A;  2BE5 F;  3WTV C;  2WWY A;  2LKP A;  4I0B A;  4RGX A;  1GXP A;  4KFC A;  1KQ0 A;  1T39 A;  4UVB A;  2XAH A;  1PUE E;  5D4R A;  2EWN A;  2Z3Y A;  1MD0 A;  1WSU A;  2IA2 A;  4CDG A;  1O7F A;  2R3S A;  4G7Z F;  1ZLK A;  2L4A A;  1YW9 A;  1JHH A;  2EFO A;  1J7K A;  1D5V A;  4YIF A;  2EFP A;  2UWM A;  2TDX A;  1R1V A;  4HX7 A;  4BH9 A;  5DCM B;  3EET A;  3H92 A;  3LST A;  1HXD A;  4G6D A;  2BV6 A;  5A2Q Z;  3R6S A;  3WGG A;  3GZ6 A;  2XGX A;  2CQK A;  1XCV A;  2MBF A;  2O8X A;  3K0L A;  4RGU A;  1Q1H A;  4OIO F;  2VT3 A;  1KQ9 A;  4G94 A;  3P9I A;  5A2Q K;  4O3M A;  2IA1 A;  4YFN F;  3FXQ A;  1YYV A;  1T0F A;  2QM3 A;  3T1B A;  4Y13 A;  1LJ9 A;  2DU9 A;  2X4H A;  4GYI A;  4L18 B;  3JAM K;  2LNB A;  3BJA A;  1I6X A;  1FBQ A;  3OV8 A;  1IXR C;  1XSV A;  4FHT A;  2YU3 A;  3HSE A;  1LNW A;  2HEO A;  4ZYD A;  1QPM A;  4WXD A;  3DV8 A;  2VBZ A;  3FXU A;  2QBY B;  1J9I A;  1JXS A;  3O3K A;  5DCF A;  1ONV A;  4UHT A;  3HSF A;  1QZY A;  5EEG A;  4IF4 A;  4G8X A;  4EGZ A;  2EFN A;  4EM2 A;  1R36 A;  1AOY A;  1GHC A;  1FP2 A;  3QRF F;  4M72 A;  2VOP A;  5TRD A;  2MC3 A;  3RPQ A;  4M9Z A;  3E6C C;  1W5S A;  1P4W A;  3NRV A;  3IRQ A;  4LG0 B;  1O57 A;  2XIG A;  1YS6 A;  2UXN A;  5JFR A;  2Q8K A;  3RYR A;  1VTN C;  2ELH A;  1KYZ A;  2FXA A;  2VT2 A;  3ML6 A;  1FYL A;  1G3W A;  5ICG A;  2Y0M A;  4ASN A;  1BI1 A;  1TQP A;  1MDM B;  1LDD A;  3TOA A;  4Y15 A;  4M9X A;  3QPT A;  2ZFW A;  4RB1 A;  4AIK A;  5D5U B;  4M74 A;  2VE9 A;  2FU4 A;  3F3X A;  1E17 A;  2H6B A;  3IWZ A;  1UFM A;  3ERE D;  1YS7 A;  3GLX A;  2G7U A;  3HUG A;  4LD5 A;  1G3Y A;  3J7A O;  3F6O A;  1FNN A;  3U2R A;  1IRF A;  3F21 A;  1KGS A;  1NHA A;  3DKW A;  2L02 A;  4LB6 B;  4KT5 C;  4L5I A;  2EK5 A;  4EGY A;  3CTA A;  4UXN A;  3PQJ A;  3HOT A;  3N97 A;  1S7A A;  2JPC A;  2JRT A;  3SXY A;  1ODD A;  5LHI A;  2GIV A;  2KKO A;  3CUQ C;  1EH8 A;  4IHS A;  2FNP A;  2R7D A;  3KP6 A;  3GF2 A;  3L2C A;  3V8K A;  2CWE A;  1SD4 A;  2KIU A;  3F23 A;  1P6R A;  4M71 A;  4AIJ A;  1LQ1 A;  1XN7 A;  2P5V A;  4M9S A;  4CO8 A;  2C6Y A;  4M6X A;  2K4B A;  4UV9 A;  3ZPL A;  2P7V B;  5E8G A;  1G6N A;  3B73 A;  3EQL F;  5D6E A;  3E5U A;  1ZRC A;  3EYI A;  1K79 A;  3WTU C;  2ZXJ A;  5FLX K;  3CLO A;  4IRH A;  5DYM A;  3LA2 A;  5ICE A;  4CHU A;  4LJZ F;  4H0E A;  2JSC A;  1J59 A;  1Z6R A;  1BIA A;  3T0Y A;  4A0Y A;  2OQR A;  3LFK A;  3CUO A;  2HTS A;  3C3W A;  4OIQ F;  2H6C A;  5E1W A;  5H6Q A;  1HST A;  3WU1 B;  2HWV A;  3O2P E;  2QQB A;  2VN2 A;  2M8E A;  3DFG A;  1BC7 C;  3KEO A;  3CJN A;  3LQQ A;  2H94 A;  5KK1 A;  2OA4 A;  4HF0 A;  1ZLJ A;  1O7L A;  4AIH A;  3RJP A;  5DCM A;  4EJV A;  5JHU A;  2NYX A;  1SD5 A;  3U1D A;  3IL2 A;  3HRS A;  3G73 A;  2IP2 A;  3GFM A;  3S2W A;  3IKT A;  1TNS A;  3ROU A;  4GYG A;  3E6M A;  1Z1D A;  1QQI A;  3GFJ A;  5KVR A;  3JSP A;  3VEP A;  3QU3 A;  3L7W A;  2A3S A;  2AXL A;  4OIN F;  4UUV A;  3W6K B;  3BY6 A;  4FX0 A;  3KLO A;  2P8T A;  4P9F A;  1XB4 A;  2ZME B;  4ZZD A;  1XGO A;  3H3U A;  3SQN A;  4CGZ A;  1FSE A;  2VC0 A;  1FBS A;  3HHG A;  3FWE A;  3L9F A;  1OR7 A;  2Q2E A;  1XGM A;  4B8X A;  2OD5 A;  3FF5 A;  2FOK A;  3WE3 A;  3QP5 A;  3KET A;  2QBY A;  5LRS A;  3I54 A;  3M7G A;  1IW7 F;  1TQM A;  3P7N A;  5DUK A;  2J5O A;  1IXS B;  2IPQ X;  4BYY A;  1H0M A;  2FF4 A;  1R23 A;  3HRT A;  3ISP A;  1ZH5 A;  3TOB A;  1ZN2 A;  4IRG A;  5H20 A;  5HS9 A;  1SMY F;  4L9V A;  3FZV A;  3LAP A;  1B4A A;  1FLI A;  3WTZ A;  3F8C A;  4EJU A;  1USS A;  2RQP A;  2GZW A;  3TGN A;  1DPU A;  2RV8 A;  3KLN A;  3EUH A;  2F2E A;  3FMS A;  4UVA A;  5CVU A;  5FGM A;  4CIC A;  1IN4 A;  1S7O A;  4G7O F;  1IN5 A;  1IN8 A;  4DNC A;  5BPI A;  5ILV A;  3V4G A;  3F8F A;  2DBB A;  1DUX C;  3OOP A;  4HYE A;  1MJA A;  1MDM A;  1F4K A;  1U5T B;  2Y48 A;  1OYI A;  4I98 B;  5LEK A;  2FML A;  1SD6 A;  2LSO A;  1J75 A;  1D8K A;  3KP3 A;  3RI4 A;  2CG4 A;  3SZT A;  2YR2 A;  1LDK B;  2HOE A;  2OU2 A;  1RI7 A;  4ENM A;  3C7J A;  3WTX C;  4PDK A;  1EH7 A;  2OZ6 A;  3WE2 A;  2ETH A;  3MAJ A;  2PEX A;  2YPR A;  1F5T A;  1BI3 A;  4AD9 A;  2EFQ A;  2DPD A;  2CW0 F;  1G3S A;  2DTR A;  3FM5 A;  1KU2 A;  1W7P D;  4ZYG A;  1U8R A;  2LDU A;  3ZMT A;  2VC1 A;  2MA3 A;  3QP6 A;  2K86 A;  1I27 A;  2GQQ A;  2V1U A;  4OIP F;  2DK5 A;  2CSO A;  5D4S A;  1TW2 A;  5BQT A;  1GVJ A;  3IWF A;  2HGC A;  2D2W A;  2NS0 A;  1UHM A;  1B9M A;  4P96 A;  1Z91 A;  2QLZ A;  3CUQ A;  3KEQ A;  3C1D A;  2E1N A;  5L3F A;  1DDN A;  1LB2 A;  1ON1 A;  4HW0 A;  2IA0 A;  4KN7 X;  2RC4 A;  2VBX A;  1ZRF A;  4RAZ A;  3ELK A;  3J81 Z;  5E20 A;  4O6J A;  2NNY A;  2IT0 A;  3ZN1 A;  2YSR A;  5HS7 A;  4WCG A;  1IN7 A;  2W25 A;  4RGS A;  4HQM A;  4CXF A;  1XDU A;  3VOD A;  4NB5 A;  3HRU A;  3J81 K;  3MEX A;  3MQ0 A;  4PZJ A;  3GZ5 A;  4ENN A;  1K78 A;  1R1U A;  4MQV A;  2QVO A;  2A61 A;  4NQW A;  1Z9C A;  3HIF A;  4KIB A;  1BN5 A;  3IC7 A;  2JTV A;  4LK0 F;  5F6F A;  4GO1 A;  2ZJ2 A;  1L3L A;  1HKT A;  4I09 A;  3F8N A;  1SAX A;  1XMK A;  2HQN A;  4MEY F;  3I53 A;  4L0Z B;  1QO0 D;  1BBY A;  3I0T A;  3MZY A;  3SZP A;  3JAM Z;  2XAG A;  5HDN A;  4N9H A;  2O03 A;  1FX7 A;  5HLG A;  4HV5 A;  3RKX A;  5LRR A;  4LB5 A;  5E8I A;  2XKO A;  5JR3 A;  2OAZ A;  5E18 F;  4A5M A;  3F8B A;  4CZZ A;  1C0W A;  4UNO A;  3NEU A;  4IPA A;  4QLC U;  4BHP A;  4JK1 X;  4IHT A;  5CVJ A;  2V79 A;  5AIP A;  2ZCW A;  4ENK A;  3I71 A;  4Q48 A;  2HFH A;  4A0Z A;  5LBQ A;  1DP7 P;  1G3T A;  4MHG A;  4KMU X;  4AWX B;  3K1M A;  3KP7 A;  3WG9 A;  3KP2 A;  4L0Y B;  1OYY A;  3RDI A;  5D5X B;  5K1Y A;  2QYO A;  4KIF A;  4D0P A;  4FX4 A;  2QWW A;  5D6F A;  2FMY A;  4L9J A;  1D8J A;  3HRM A;  3I4P A;  4M6Y A;  2LF8 A;  2PBI A;  1W7P B;  3KZY A;  3ZMZ A;  4XLP F;  3MCZ A;  1J2X A;  3E6D A;  2EB7 A;  1P92 A;  3H3Z A;  2W57 A;  3LAJ A;  3BZ6 A;  1TNT A;  3KE2 A;  3P9K A;  1HSJ A;  1JHF A;  2OBP A;  1HQC A;  4HBL A;  1ZG3 A;  2D1H A;  1LDJ A;  2HS5 A;  1S3J A;  5JI6 A;  1E2X A;  1MKM A;  4EJT A;  4HX4 A;  4GCV A;  3V8J A;  1T38 A;  1XGN A;  4MTD A;  1K7A A;  1KU7 A;  4UVC A;  3D5L A;  1OPC A;  5LEJ A;  3IHU A;  4KIG A;  2KIF A;  4AVP A;  1I1S A;  5L3C A;  1WI9 A;  3FMR A;  3WGH A;  1RNL A;  2MD5 A;  2MH2 A;  4HF1 A;  1BM9 A;  1FSH A;  5L3D A;  2FBK A;  1KU9 A;  4ZYE A;  2ESN A;  1TQI A;  2PQ8 A;  4HLY A;  3K1P A;  2FE3 A;  3I64 A;  1RZ4 A;  2L54 A;  1O3Q A;  3Q9S A;  2RKH A;  3RIR A;  1IN6 A;  2DQL A;  1YIO A;  1ZGA A;  2ZBK A;  2FNA A;  1J0R A;  2GXB A;  2FBH A;  2ADU A;  1UCR A;  5FLX Z;  1V4R A;  1YQA A;  3TDU C;  1IUY A;  2KRF A;  3GX4 X;  4P55 A;  2IW5 A;  5L3B A;  4MEX F;  2M5W A;  3AAF A;  2ACJ A;  1Z6T A;  2KJC A;  5IT3 A;  1MGT A;  1STZ A;  4M73 A;  4RB0 A;  1FP1 D;  3LA7 A;  2ESH A;  4ETS A;  3MFK A;  1ZAR A;  2EA2 A;  4WK8 F;  3E5Q A;  3HOS A;  3GFI A;  2XRN A;  4XSZ F;  1T2K A;  2HYG D;  4WXC A;  2HKO A;  4WX9 A;  3FHZ A;  1WRJ A;  3WTW C;  2MLG A;  2VXZ A;  2VOD A;  1FC3 A;  5HDK A;  4L5J A;  5HS8 A;  2EV6 A;  3J80 K;  5LLQ A;  1OKR A;  1ZG5 A;  2FA5 A;  2ZNY A;  5D8L B;  1XCB A;  4KUM A;  4YII A;  1W4M A;  3VOE A;  4A6E A;  1UST A;  1T6S A;  3JTG A;  2HZT A;  4P9U A;  3ZMU A;  4I7H A;  2V1X A;  3QAH A;  3CO6 C;  4EJO A;  2VON A;  1Z7U A;  4F7Z A;  1QBJ A;  2M87 A;  3RTR A;  2KIM A;  2BYV E;  5FB2 A;  2J5P A;  4R1H A;  2WV0 A;  3ULQ B;  3M1E A;  1ZRD A;  3E3V A;  3U9G A;  5DUI A;  3PFI A;  3DXJ F;  1CF7 B;  2F5E A;  1YW7 A;  3GO5 A;  1UHW A;  3COA C;  2XUB A;  3KCC A;  3M9A A;  2HTJ A;  3N4M A;  2PMH A;  1MZB A;  3WTY C;  2A6E F;  1P2F A;  4LFU A;  2DK8 A;  3ZMS A;  3F6V A;  1OYW A;  1S8N A;  1OMI A;  4S04 A;  5DD4 A;  4ESB A;  2QUF A;  5F1R A;  4RB3 C;  2DO7 A;  4EJW A;  3P9C A;  4FT8 A;  3E6B A;  3ECH A;  1O3S A;  2P6T A;  1PP8 F;  4RAY A;  1B9N A;  3CDH A;  1WQ2 A;  2YX4 A;  1U78 A;  4YG2 F;  2A68 F;  3BJ6 A;  4U0V A;  2CYY A;  3TQN A;  2ISZ A;  5LHH A;  2VBY A;  3ABT A;  3R61 A;  4Q4Z F;  1FYK A;  3KFW X;  2QZ8 A;  3RKY A;  5FFX A;  1F1Z A;  3ZN0 A;  4MQ9 F;  5CVR A;  2MLK A;  4HQE A;  2M1B A;  4IRI A;  4RGR A;  2RN7 A;  2E1C A;  1F9N A;  2HR3 A;  3HSR A;  1JE8 A;  1W7P A;  3NQO A;  4XBF A;  4LG0 A;  1U5T C;  1AWC A;  2X0L A;  4U88 A;  1FOK A;  2STT A;  1MJB A;  4IXA A;  2ISY A;  4A0X A;  5CVI A;  2G9W A;  4LLG F;  2XAQ A;  2COM A;  4KIC A;  4EM1 A;  5E1Z B;  1EV7 A;  3GW2 A;  1BI0 A;  4LK1 F;  3BJO A;  2P6S A;  1YW8 A;  2PI0 A;  3K1N A;  4NHJ A;  2D1V A;  4ESJ A;  4I2O A;  1I1G A;  2A5Y B;  2XAS A;  2GAU A;  2RDP A;  2JZY A;  4LLN A;  1LEB A;  1BJA A;  1W5T A;  1MJ9 A;  1A04 A;  3RKW A;  3CO7 C;  2DT5 A;  1FY7 A;  2Q0O A;  1G4D A;  1ZRE A;  4KDP A;  1XD7 A;  3L09 A;  2STW A;  1IZ1 A;  2XRO A;  4XRF A;  3D0S A;  1D3Y A;  5DV5 A;  1HBX G;  5HVQ C;  5CYV A;  2FRH A;  2EJR A;  2HYF A;  2L4M A;  3I5U A;  3E97 A;  1FT9 A;  2V6C A;  2O61 A;  4R8H A;  5FFZ A;  5CLS A;  5H6R A;  2OQG A;  4BHB A;  5D5V B;  2FBI A;  5BS6 A;  3RYP A;  5HLH A;  3DEU A;  5ILS A;  4WF2 A;  5D5W B;  2XV4 S;  5CJ9 A;  2K7L A;  4B09 A;  3B02 A;  1B1B A;  2NNN A;  2K27 A;  2D45 A;  3V7C A;  1TTY A;  3VFZ A;  5ILU A;  4ZYH A;  2DFI A;  4LLL A;  1R22 A;  2UZK A;  5BMZ A;  3GWZ A;  1ZGJ A;  2DPU A;  5E17 F;  3ZMD A;  1XMA A;  5J6X A;  1R00 A;  2PG4 A;  2P5L C;  2E7X A;  3W6J B;  4QWQ A;  2RNJ A;  3TO9 A;  2W84 A;  1YLF A;  3MWM A;  1WWX A;  4ENJ A;  3GXO A;  2HQR A;  3IKV A;  1ON2 A;  3BRO A;  1FZP B;  4BHC A;  1B59 A;  3HTS B;  1S6L A;  3WTS C;  2F5D A;  5ICF A;  1U6G A;  1JGS A;  2DI3 A;  1ULY A;  2UXX A;  1LVA A;  3VB2 A;  5FD5 A;  3T8T A;  4JBA A;  1SD7 A;  3FXR A;  1B6A A;  2A07 F;  1R7J A;  5FD6 A;  2GXG A;  3I59 B;  1CF7 A;  4OU0 A;  1BOA A;  2PN6 A;  3GVA A;  1QZZ A;  3WGI A;  2ZME A;  2FSW A;  2Y75 A;  4G6Q A;  1U3E M;  3R0A A;  2Z99 A;  3LA3 A;  2QEN A;  4N0B A;  2A69 F;  5K5R A;  4EMS A;  1O3R A;  2ZKZ A;  2Z9O A;  1WKM A;  2AS5 F;  5HLI A;  2IJL A;  3FMQ A;  2OZU A;  4K2E A;  4RS8 A;  4A6D A;  1P4A A;  2GWR A;  1L0O C;  2DAO A;  2P5K A;  1ZYR F;  4RB2 C;  5JVT A;  2GA2 A;  1X3U A;  5J8C A;  2XHK A; 
#chains in the Genus database with same CATH topology
 2ZXI A;  2BBY A;  4PGH A;  2JMW A;  3PL8 A;  2CRG A;  2QKM B;  3C18 A;  3C2B A;  1EH6 A;  2WAQ N;  2X6X A;  4IZZ A;  4KN4 X;  2M0C A;  2ZXW H;  1VQ8 I;  2CJJ A;  1TWC J;  3EDP A;  2R0Q C;  4HZF A;  1GUU A;  4BJT A;  1BC8 C;  3CC7 I;  1Y0N A;  5EZH A;  1XTA A;  2K02 A;  3HTU A;  1VFC A;  3ZQI A;  3MKZ A;  2WB1 A;  4HNT A;  3PUF A;  1XSD A;  4OMZ A;  4QPO A;  4F3Q A;  2EV5 A;  4IOA F;  2M45 A;  2JSP A;  4CYD A;  3H1C A;  4A3G J;  3TP0 A;  2E36 A;  3HYI A;  3SHF A;  3BC8 A;  2DA7 A;  3FKJ A;  4S0H B;  4BEH A;  1FBU A;  3MD2 A;  3FBI B;  3HL2 A;  3BWG A;  2DA1 A;  3Q9V A;  1SFK A;  2JA8 J;  1KYW A;  2DA3 A;  2R7F A;  3BG3 A;  3OYB A;  4XKW A;  4HDV A;  2VOO A;  5LHG A;  1QZE A;  1UHS A;  1XC5 A;  3DPT A;  5LGT A;  1BA5 A;  4HF2 A;  4KYW A;  3BG9 A;  4ESF A;  5HOO A;  3CCY A;  3ZMV A;  1U5T A;  2O3F A;  1VQN I;  1OCC H;  3K9T A;  3KIO A;  3TO6 A;  4A2U A;  1SFX A;  2K85 A;  1OCZ H;  2XKP A;  2X51 A;  2LYC A;  2M30 A;  1OIS A;  1IRG A;  2O5R A;  4O5V A;  3K2Z A;  2LC2 A;  2V1D A;  4GGG A;  4G7H F;  3R0J A;  4PCQ A;  4I76 A;  3RZD J;  4R79 A;  5BPD A;  3BTJ A;  2DW4 A;  2KLO A;  1HW1 A;  4WWC A;  4FIS A;  1W0U A;  3OYJ A;  1K4T A;  1KON A;  2K9L A;  1HKQ A;  1UB9 A;  4A5N A;  3CCV I;  3DBL B;  4L9N A;  3AKZ A;  2NRA C;  4NC8 A;  4GDF A;  4HOB A;  2LY9 A;  3IH2 A;  2VAS A;  1WH7 A;  5EYR A;  2P7C B;  2P4W A;  2B63 J;  3HHH A;  2IEK A;  2V9V A;  4PJJ A;  4AM3 A;  3ERM A;  1HDD C;  1B8I B;  3KP5 A;  3H0G J;  2W00 A;  2EZL A;  2L01 A;  1DU6 A;  1LEA A;  2EFW A;  5FLM J;  3R60 A;  4HLX A;  4EAT A;  2RGV A;  4EEF G;  2VKE A;  1OCP A;  3R4K A;  1BJZ A;  4BBS J;  2HVQ A;  4MTE A;  5FKL A;  3RQI A;  2BW3 B;  2Z1D A;  5IT9 Z;  2WTE A;  4HAM A;  3L2V A;  1T98 A;  2M2E A;  2FD5 A;  3GEZ A;  1WJD A;  1ZAO A;  1TBX A;  2CFX A;  5KHD A;  2R7V A;  1A6Q A;  1H9T A;  1GXQ A;  4XRS A;  2OPT A;  1D0Z A;  1PP7 U;  4QPQ A;  2WC2 A;  1IAW A;  4U7B A;  3T8R A;  2KL4 A;  1BR2 A;  3R6S A;  2YS9 A;  3ZP5 A;  1NTC A;  3HBL A;  4IVN A;  5EEH A;  1N75 A;  3OYD A;  6PAX A;  3DEW A;  1TLH B;  4DQ2 A;  4KA4 A;  4XLN F;  1MMD A;  5IT9 K;  4MGR A;  2VLA A;  1LPQ A;  2L9S A;  5DDG A;  4NDL A;  1YTY A;  4C2T A;  1YRN B;  1WJ5 A;  2BGC A;  4DJA A;  3LMM A;  2Z5U A;  5TJJ A;  1V54 H;  4HEA 2;  1J5Y A;  3OYK A;  2IAI A;  5K5O A;  2CU7 A;  1MMN A;  2JUC A;  3DQV C;  1CGP A;  3K69 A;  2HDD A;  3WTT C;  1D1A A;  2I8D A;  2PLY A;  1MMG A;  3F8M A;  3O6B B;  4BQA A;  4OMY A;  4HX8 A;  3LWF A;  3CUQ B;  3FHN A;  1S9H A;  1FWZ A;  2BXY A;  3WU0 A;  4U0Y A;  1KQ8 A;  1DPR A;  4U0W A;  1JUP A;  3J80 Z;  4EV0 A;  2B0L A;  2RRE A;  3DPL C;  2KJB A;  3P5J A;  1Y0U A;  3REO A;  1ZR4 A;  3BTI A;  3DF8 A;  3M8J A;  4N4N B;  5L3E A;  3K7A J;  2Y0S A;  3F0C A;  3K4N A;  2A05 A;  3GFL A;  3PO2 J;  2BEO A;  2LRE A;  2F5F A;  5GTI C;  1TW3 A;  3BPV A;  3FX3 A;  2JVG A;  1R6R A;  2FUG 2;  2LLK A;  2VPR A;  1VF9 A;  4J00 A;  3HOZ J;  3V8L A;  3K70 C;  2XF7 A;  2F4M B;  2PFB A;  4BNC A;  3MZH A;  3FM3 A;  1SVO A;  2DA5 A;  2E1M C;  1HW2 A;  1XGS A;  2FQ4 A;  1FIA A;  3Q5F A;  2HNH A;  3BPX A;  4GRI A;  3GLL A;  4DYR A;  3OY9 A;  2O9L A;  3KX2 A;  4MNU A;  2VKV A;  1FTZ A;  3GYH X;  3CDL A;  2VIX A;  3BZC A;  5BOX A;  2KFD A;  3A03 A;  1ETY A;  5AIQ A;  5LGN A;  1G59 A;  2E7W A;  3D5S C;  2HKX A;  2O0Y A;  5GAG J;  1IF1 A;  5E3O A;  3GTK J;  2HDC A;  1Z05 A;  2DFE A;  4P5O A;  3Q0V A;  1K78 B;  3LFU A;  3QOP A;  3OYC A;  1YO5 C;  2OCE A;  4N9I A;  3F22 A;  2E1M B;  2QF7 A;  3L1P A;  4XSX F;  1ZG1 A;  1NG7 A;  4ZYA A;  2HPM A;  3I59 A;  3V7R A;  2E34 A;  4XLA A;  1TT5 B;  5C4J J;  1R5G A;  1TWH J;  3ABL H;  3V7S A;  4BAY A;  2VL8 A;  2LF7 A;  2M4G A;  3DTK A;  2L3D A;  1YG2 A;  2FEZ A;  2PMU A;  2K9S A;  4FTH A;  2FQ3 A;  5CKT A;  1RIO H;  3QU6 A;  3TKY A;  1BR1 A;  2DLL A;  5HDG A;  4YFX F;  4HDU A;  4B44 A;  2ZXH A;  5K5Q A;  3LSJ A;  3G1O A;  3BQZ A;  3HZJ A;  4RMN A;  3JTH A;  3LSP A;  1MMA A;  2VJJ A;  4HG2 A;  3BOQ A;  4JQF A;  5J8F A;  1MNM C;  2IRF G;  4IKF A;  4TV7 A;  1PUF B;  3E0J B;  1WPK A;  3EYY A;  2E5N A;  3GTM J;  2H09 A;  4ZZL A;  2L7Z A;  2XAF A;  3MZ8 A;  2O6G E;  2HVR A;  1XSX A;  2IBD A;  2CGP A;  4CUG A;  5IOZ A;  3L00 A;  3ZQG A;  3FXO A;  3W2W A;  4D5C A;  4Q5S F;  1QNT A;  2XGC A;  3ABU A;  4X0G A;  4XLF A;  4WXH A;  2XAU A;  2XPV A;  3E5X A;  5D8K B;  1SVL A;  3FK6 A;  3PM1 A;  4A3C J;  4DBQ A;  1HC8 A;  4HA8 A;  3JSO A;  4U7D A;  2W24 A;  5C4X J;  2W85 A;  1HW5 A;  4CCO A;  3CJT B;  4B3A A;  2G7H A;  4C9Y A;  3BG7 A;  2EZH A;  3I58 A;  3EPZ A;  1ZHF A;  2QQA A;  4B1R A;  1Y1V J;  1QVT A;  3VYU B;  1TWA J;  4OOI A;  3ZXS A;  1RUN A;  3JRA A;  3OMY A;  2Z33 A;  2H27 A;  3JW4 A;  3SFZ A;  1ENH A;  1Y6I A;  1KA8 A;  2EIN H;  3IRR A;  1WCM J;  1WHU A;  4EQQ A;  1X2N A;  1HKS A;  1RUO A;  4L5E A;  4PGG A;  4IJA A;  4FCY A;  3CMM A;  4KNY A;  2XAJ A;  4UV8 A;  4CA0 A;  3CMY A;  1YFH A;  1REP C;  4RBO A;  3QPS A;  2F5C A;  4G6T B;  4Y17 A;  1RRJ A;  2XB5 A;  2JT1 A;  4E7S A;  3SDB A;  1IXC A;  5DEQ A;  3K4J A;  1JKR C;  4HV6 A;  1XDS A;  2CO5 A;  1PDN C;  1QGP A;  2CH0 A;  3BCB A;  1U2W A;  2R7S A;  2VBW A;  4II2 A;  4EM0 B;  4YFK F;  1ETW A;  1R5H A;  2KRH A;  1O3T A;  2KZV A;  3KP4 A;  4BBR J;  2JPB A;  1Z3Y A;  4DOZ A;  5ED4 A;  3JRC A;  1S29 A;  3DCF A;  4BDZ A;  3M8E A;  4M3D A;  1FPQ A;  1FYM A;  2EA4 A;  3G1M A;  3GTL J;  1W1W E;  2JA7 J;  4OIR F;  5ICC A;  5F0C A;  1F36 A;  3QOD A;  4A69 C;  4M3F A;  1H89 C;  1MSE C;  1X3W B;  3HJE A;  4M6V A;  4BXU A;  4I02 A;  1BI2 A;  1XG1 A;  4A12 A;  4GXO A;  2IVM A;  1ITY A;  2YX7 A;  3ASN H;  4LMY A;  3TDZ C;  2MH9 A;  3ECO A;  1R58 A;  2R92 J;  2PJP A;  4ON0 A;  1I5Z A;  5F64 A;  4ZH4 F;  2NS7 A;  1V3F A;  4E7Z A;  3AG2 H;  3KZI C;  2K9M A;  1H9G A;  3B6C A;  4F55 A;  4Z2Y A;  5L3G A;  3KZZ A;  2MAB A;  3QPH A;  2XVC A;  3BR2 A;  2RVC A;  3ASO H;  3K6G A;  5E1X A;  2QQ9 A;  4M3G A;  2L7F P;  5LGU A;  3H9J A;  3WG7 H;  1JGG A;  4HRI A;  2HDW A;  2EV0 A;  4KT6 A;  3G3Z A;  3F72 A;  3H3V K;  1X1B A;  4BY7 J;  3LQR A;  1BL0 A;  2F4I A;  2R7Z J;  1AHD P;  1P4X A;  2KP6 A;  2E5Z A;  2NAZ A;  4EVI A;  4CYC B;  2ZO4 A;  1K83 J;  3GUD A;  4YIR X;  1R1T A;  3BP8 A;  3OIO A;  1YX5 A;  5DD8 A;  2R7W A;  2VJI A;  4ZDP A;  1JJ6 C;  2DQR A;  1S72 I;  4KMF A;  4L9T A;  2ELK A;  1SMT A;  2IXS A;  3BDD A;  1W5C C;  3T5X A;  4I0A A;  2TRT A;  3W6V A;  5AON A;  4E70 A;  2IGN A;  4Q47 A;  5M3M J;  2HPI A;  2QSH X;  2R5Z B;  2ZNZ A;  1B72 B;  1YRN A;  1Z67 A;  1XS9 A;  3AL0 C;  4MIM A;  2VUM J;  1K6O A;  3BR0 A;  2M9H A;  5ERI A;  1D1C A;  1SFE A;  1OQY A;  3RPU A;  3DP7 A;  1SFU A;  4XLH A;  3W2A A;  3HOY J;  5CVV A;  4LGW A;  4G9Y A;  2GA1 A;  1DGR M;  3WOD F;  2VE8 A;  3PQK A;  3TO7 A;  4I01 A;  2A6H F;  4S05 A;  3M8F A;  3ZQ7 A;  2XSJ C;  2JK3 A;  1KU3 A;  2K4J A;  1BIB A;  1Y8R B;  1V5G A;  2H1L A;  2QQ8 A;  4HPQ A;  1X1P A;  5FO5 A;  2BE5 F;  3WTV C;  2WWY A;  2LKP A;  4I0B A;  4A3F J;  4XNF A;  5KCM A;  4RGX A;  2Y30 A;  2WAE A;  4X1E A;  2W7N A;  1GXP A;  4KFC A;  1KQ0 A;  1T39 A;  1IDZ A;  5FKO A;  5F1J A;  1JT6 A;  4XIC A;  4UVB A;  2XC7 A;  3FXL A;  4BJ5 C;  2HQA A;  3LSH A;  2XAH A;  2QSG X;  2TCT A;  4BQN A;  1PUE E;  1HDP A;  1FJL A;  3DTI A;  5D4R A;  2EWN A;  2Z3Y A;  3PFY A;  1MD0 A;  2I5U A;  2IA2 A;  3OYF A;  1WSU A;  1R49 A;  4NNJ A;  4QTR A;  4CDG A;  1O7F A;  4GFB A;  2R3S A;  4G7Z F;  1ZLK A;  2L4A A;  2IS1 A;  3D5R C;  1YW9 A;  1JHH A;  1D1B A;  2EFO A;  1J7K A;  1D5V A;  5IPA A;  1XPX A;  4YIF A;  2CQ7 A;  4UUT A;  2EFP A;  4D1Q A;  3I4N J;  2UWM A;  2TDX A;  4A3J J;  1R1V A;  5E3L A;  2VJ5 A;  4HX7 A;  5DCM B;  3SZG A;  2VQG A;  3EET A;  3H92 A;  2JUG A;  4BH9 A;  3LST A;  3DU5 A;  1HXD A;  2CQN A;  4RAF A;  4G6D A;  2VKD A;  2M7A A;  2BV6 A;  2LD5 A;  1LE8 B;  2CQX A;  5A2Q Z;  2CUF A;  1A5J A;  2R7Q A;  4N4O B;  2R4G A;  3H5N A;  2XGX A;  3BCA A;  3IAS 2;  2CQK A;  1XCV A;  3LSG A;  2VQH A;  3WGG A;  4CCL A;  2MBF A;  5FLV A;  3PO3 J;  4A93 J;  5DM6 F;  2O8X A;  3K0L A;  4RGU A;  1Q1H A;  3KYL A;  4OIO F;  2VT3 A;  1KQ9 A;  4A3D J;  4LIV A;  3JR9 A;  4G94 A;  1TT0 A;  3P9I A;  2DT7 B;  5A2Q K;  3OYG A;  4E7J A;  4O3M A;  2IA1 A;  1YE9 A;  2ME0 A;  3FXQ A;  1T08 B;  3W2V A;  4YFN F;  1YYV A;  2DOD A;  1H8A C;  1HF0 A;  1T0F A;  3ZQH A;  2QM3 A;  3T1B A;  1GVD A;  4FET A;  4Y13 A;  1LJ9 A;  2DU9 A;  2X4H A;  4GYI A;  4L18 B;  2P81 A;  3JAM K;  2LNB A;  2Q1Z B;  1MBF A;  1I6X A;  3BJA A;  1FBQ A;  5CPR B;  2ELJ A;  3OV8 A;  1IXR C;  1XSV A;  4JX6 A;  4FHT A;  3SYT A;  2YU3 A;  3HSE A;  1I50 J;  1WJC A;  1QRY A;  1LNW A;  3A4C A;  2HEO A;  3FDY A;  4ZYD A;  3AG3 H;  2LVS A;  3CCM I;  1QPM A;  5GP9 A;  3OYH A;  1TWG J;  4WXD A;  4OAZ A;  2ZJR F;  3DV8 A;  1KZH A;  2VBZ A;  3FXU A;  5E3N A;  2QBY B;  1J9I A;  4UY8 I;  1FTT A;  1JXS A;  2BY1 A;  1MBG A;  3O3K A;  4DZJ A;  3EUK L;  1ONV A;  5DCF A;  4A3M J;  4XL9 A;  2Y9Z A;  1G2H A;  4UHT A;  1GT0 C;  1ZK8 A;  3S3N A;  3HSF A;  1QZY A;  5EEG A;  3A1Y A;  1N25 A;  1SAU A;  2NOJ B;  4IF4 A;  2LRD A;  3HKZ A;  2L2O A;  3BG5 A;  3EUH C;  1CQT A;  2AO9 A;  4G8X A;  4EGZ A;  1V5F A;  1MSF C;  2DFH A;  3OS0 A;  1IJW C;  2EFN A;  4EM2 A;  1W36 D;  1R36 A;  1AOY A;  1GHC A;  1FP2 A;  3QRF F;  4M72 A;  4CCM A;  3CZ6 A;  1HOM A;  2VOP A;  3BR5 A;  5TRD A;  2MC3 A;  2HI3 A;  1WJB A;  3RPQ A;  4M9Z A;  3E6C C;  1W5S A;  2XPW A;  1MBH A;  1P4W A;  3NRV A;  3OL4 A;  3IRQ A;  2DXI A;  4LG0 B;  1SC7 A;  5EF6 A;  5IOY A;  3GTJ J;  1O57 A;  2XIG A;  1UMQ A;  1YS6 A;  2JWT A;  1JTY A;  2UXN A;  5JFR A;  3CF2 A;  2Q8K A;  4FE7 A;  3RYR A;  3EUA A;  2ELH A;  1VTN C;  2O8K A;  1KYZ A;  2LTP A;  4XKB A;  2FXA A;  1I39 A;  2VT2 A;  4W1U A;  3CCU I;  3TED A;  2MSY A;  3ML6 A;  4XKV A;  2KMU A;  4E7H A;  2DJN A;  1FYL A;  1G3W A;  3K4B A;  5ICG A;  2Y0M A;  5GAD J;  2HOT A;  3G6E I;  3CME I;  4ASN A;  1BI1 A;  4ZJZ A;  1TQP A;  1MDM B;  1LDD A;  3TOA A;  3H0D A;  2V7F A;  4Y15 A;  4M9X A;  3PSI A;  4F93 B;  3LSM A;  3QPT A;  2ZFW A;  2PX9 A;  4RB1 A;  4AIK A;  5D5U B;  1K4S A;  1W0T A;  4M74 A;  2VE9 A;  3N05 A;  4D7N A;  2FU4 A;  4W97 A;  1Z7L A;  3VYT B;  2CMP A;  2LK2 A;  3F3X A;  1E17 A;  2X1D A;  1EJ9 A;  2H6B A;  3H5A A;  3IWZ A;  1UFM A;  3ERE D;  2AXT C;  2LP0 A;  1QU3 A;  1YS7 A;  3GLX A;  2G7U A;  3HUG A;  1ZR2 A;  4LD5 A;  3QYB A;  2ZSI B;  1G3Y A;  2EPF A;  3GZ6 A;  2F4O B;  3PNT A;  3VYR B;  1YHQ I;  3J7A O;  3CCL I;  3F6O A;  5EG0 B;  5C44 J;  4E7K A;  1WGX A;  4HNU A;  1FNN A;  2M8G X;  3S15 J;  5M5X J;  2UUZ A;  4XID A;  3U2R A;  1IRF A;  2AHQ A;  1AA7 A;  5IYB J;  3S1N J;  4Z6Y A;  3F21 A;  1ETK A;  1KGS A;  1NHA A;  4CYC A;  3DKW A;  2L02 A;  2D5V A;  2VB6 A;  1R4M B;  4LB6 B;  4KT5 C;  4L5I A;  2EK5 A;  4HST A;  4EGY A;  3CTA A;  3CCS I;  4P1W A;  4UXN A;  3PQJ A;  3CJR B;  3HOT A;  3N97 A;  4BXX J;  5EJC A;  1S7A A;  2JPC A;  2JRT A;  3SXY A;  2EIM H;  1ODD A;  3LSI A;  3HC7 A;  2PMZ A;  5LHI A;  2XB0 X;  2GIV A;  2KKO A;  3CUQ C;  1YI2 I;  1WJF A;  2R5Z A;  1EH8 A;  1B72 A;  4IHS A;  1Z3X A;  2FNP A;  2R7D A;  3KP6 A;  2QGU A;  3GF2 A;  3QYF A;  3L2C A;  3V8K A;  2CWE A;  1SD4 A;  2KIU A;  3F23 A;  2IGM A;  4BE1 A;  1P6R A;  2HU9 A;  1DU0 A;  4M71 A;  5HOD A;  4AIJ A;  1FIP A;  1LQ1 A;  1XN7 A;  2P5V A;  4M9S A;  4II3 A;  4CO8 A;  2C6Y A;  1BOB A;  4M6X A;  4ZDL A;  2E60 A;  1IUF A;  4JP0 A;  2K4B A;  4UV9 A;  3ZPL A;  2JN6 A;  3MN2 A;  2P7V B;  1D0Y A;  2LFB A;  4XON A;  1N77 A;  3K4C A;  1M1E B;  2DTZ A;  2XF5 A;  3RZO J;  5E8G A;  3GCM A;  1G6N A;  3B73 A;  3EQL F;  5D6E A;  1ZGW A;  3E5U A;  1ZRC A;  2IS6 A;  4Y52 J;  3EYI A;  4ZC3 A;  5FKM A;  3OS2 A;  4RA2 A;  2BZT A;  1K79 A;  5B1B H;  3WTU C;  2ZXJ A;  5FLX K;  3CLO A;  4IRH A;  2X6O A;  2WAQ A;  4D5F A;  5DYM A;  3LA2 A;  5ICE A;  2BHY A;  4A3B J;  4CHU A;  3K4M A;  3A02 A;  4LJZ F;  4H0E A;  2JSC A;  1J59 A;  1Z6R A;  1BIA A;  3T0Y A;  4A0Y A;  2NXN B;  2R7T A;  3S1M J;  2OQR A;  4FAS D;  3LFK A;  1JJ8 C;  3CUO A;  2EIK H;  1MBE A;  2HTS A;  2V1N A;  4AC0 A;  1WH5 A;  3C3W A;  4OIQ F;  2H6C A;  5E1W A;  5H6Q A;  1HST A;  3WU1 B;  3ZQC A;  2HWV A;  1BR4 A;  3O2P E;  1W36 C;  2QQB A;  2VN2 A;  4FE4 A;  3WHB A;  2M8E A;  3DFG A;  1BC7 C;  3PIP F;  1MMS A;  3KEO A;  4B48 A;  3OSF A;  3CJN A;  2X85 A;  3LQQ A;  2H94 A;  5KK1 A;  3DPU A;  2OA4 A;  4QSH A;  4HF0 A;  2N8G A;  3MKW B;  1ZLJ A;  2X1E A;  2EQR A;  1O7L A;  4AIH A;  3C2H A;  4XOP A;  3RJP A;  5H2F C;  5DCM A;  4EJV A;  5JHU A;  1OJL A;  1SD5 A;  2NYX A;  4PFO A;  3U1D A;  5GAH J;  3HRS A;  4NQW B;  4YEJ A;  3IL2 A;  3G73 A;  1P9Q C;  3S1Q J;  2A5W A;  1LE8 A;  2IP2 A;  3VSK A;  3GFM A;  1T0F C;  3S2W A;  3IKT A;  1FMW A;  3HGY A;  5J40 A;  2CUE A;  1IRX A;  3A2K A;  1TNS A;  2H8R A;  1NK3 P;  3ROU A;  1OCO H;  4GYG A;  1LFP A;  3NAR A;  2OJE D;  3E6M A;  1Z1D A;  3BZK A;  3CP2 A;  3BTL A;  1QQI A;  3GFJ A;  2EBI A;  5KVR A;  2M7B A;  3JSP A;  3VEP A;  3QU3 A;  4E7L A;  3A0B C;  3L7W A;  3BG6 A;  2A3S A;  3OYI A;  2AXL A;  4BE0 A;  2XGD A;  4E6K G;  3CF5 F;  1A31 A;  1HLV A;  2LY2 A;  1YOV B;  4OIN F;  2DT6 A;  3GTO J;  4UUV A;  1P7I A;  3S14 J;  3W6K B;  3JRE A;  3BY6 A;  3DBR B;  3KLO A;  4FX0 A;  2P8T A;  4P9F A;  4B3X A;  3K4K A;  1XB4 A;  1X3Z B;  2ZME B;  4ZZD A;  1XGO A;  3H3U A;  4XOR A;  4ZDO A;  3SQN A;  2KDO A;  3JRD A;  4CGZ A;  1FSE A;  3Q0W A;  2KIQ A;  3H5R A;  1VQP I;  3O8H A;  2VC0 A;  5FJ8 J;  1FBS A;  3HHG A;  3S2H J;  2YU9 J;  3CQZ J;  1UZC A;  3FWE A;  1NG6 A;  2DMN A;  4Y33 A;  3L9F A;  1JUM A;  1OR7 A;  2Q2E A;  1XGM A;  4B8X A;  2OD5 A;  3OSG A;  3F9K A;  3FF5 A;  5TIS C;  2FOK A;  1T8I A;  3WE3 A;  3QP5 A;  3KET A;  3PSF A;  5LRS A;  2QBY A;  5FKN A;  3I54 A;  3M7G A;  1IW7 F;  3S16 J;  5IP6 A;  1TQM A;  1SVM A;  3P7N A;  5DUK A;  2J5O A;  1X58 A;  1IXS B;  2R7R A;  4J19 A;  2IPQ X;  3H9Q A;  4BYY A;  1H0M A;  2JJ7 A;  2FF4 A;  1R23 A;  3HRT A;  3ISP A;  2VJ4 A;  2V6E A;  1ZH5 A;  3TOB A;  1ZN2 A;  4IRG A;  2EH3 A;  1E3P A;  5H20 A;  5HS9 A;  1SMY F;  4L9V A;  4RM2 A;  1IDY A;  1UG0 A;  3ZOB A;  2DMU A;  3FZV A;  1G8X A;  3LAP A;  2XGE A;  1B4A A;  4Y3O A;  2L0K A;  4BS9 A;  1FLI A;  3WTZ A;  5M5Y J;  3F8C A;  2M34 A;  4EJU A;  3HPH A;  1USS A;  3CMA I;  1E0E A;  2RQP A;  2GZW A;  3TGN A;  1HA8 A;  1DPU A;  2RV8 A;  3KLN A;  1SFO J;  2L7K A;  3EUH A;  2F2E A;  2BXZ A;  3FMS A;  4UVA A;  5CVU A;  3I3L A;  5FGM A;  4CIC A;  1IN4 A;  3J7A Y;  1E3H A;  1S7O A;  4G7O F;  1IN5 A;  3AG4 H;  1IN8 A;  3I9V 2;  4DNC A;  5BPI A;  2K3F A;  4BL0 B;  1X2M A;  5ILV A;  3ABK H;  3OL3 A;  1MBK A;  4YEL A;  3V4G A;  2CS3 A;  1TWF J;  5JLX A;  3HOV J;  3F8F A;  4IX7 A;  2DBB A;  1WJE A;  1QVU A;  3OOP A;  1DUX C;  2DMP A;  1MJA A;  4HYE A;  1JI8 A;  5B5E C;  1MDM A;  1F4K A;  1U5T B;  2K9Q A;  2Y48 A;  4DIQ A;  4E4H A;  1OYI A;  4I98 B;  5LEK A;  2OTJ I;  1NK2 P;  2FML A;  2IS2 A;  1SD6 A;  2LSO A;  2QCO A;  3A01 B;  4PJM A;  1R71 A;  3JRI A;  1J75 A;  1D8K A;  3KP3 A;  3RI4 A;  4BY1 J;  2CG4 A;  3NWT A;  1B8I A;  2K5C A;  3SZT A;  2YR2 A;  1LDK B;  2JVH A;  2HOE A;  4XLC A;  5LFA A;  1NH3 A;  4AVZ A;  3D1N I;  2QKL B;  3FXK A;  5J1Y A;  2HQ5 A;  2OU2 A;  1RI7 A;  4ENM A;  3C7J A;  1APL C;  3WTX C;  2L9V A;  4ABZ A;  1ORK A;  4PDK A;  1EH7 A;  2OZ6 A;  5EG0 A;  3VPR A;  2KT0 A;  4QIW N;  4NUB A;  4LG3 A;  3WE2 A;  3OYM A;  3ZQQ A;  2ETH A;  2ZJP F;  3MAJ A;  2PEX A;  2BW3 A;  2YPR A;  1TP4 A;  1BI3 A;  1YJ9 I;  3OYL A;  1F5T A;  4IHV A;  3RQ4 A;  4AD9 A;  2OTL I;  2EFQ A;  1R4N B;  2DPD A;  2ID3 A;  2CW0 F;  4M3E A;  2KRC A;  2MW8 A;  1G3S A;  2DTR A;  3FM5 A;  1KU2 A;  2E71 A;  5GPA A;  2YUS A;  4H4K C;  3TL4 X;  1W7P D;  3B6A A;  3S8P A;  4ZYG A;  1U8R A;  2JQ7 A;  2LDU A;  3ZMT A;  2VC1 A;  2MA3 A;  3QP6 A;  2K86 A;  1I27 A;  2GQQ A;  2V1U A;  4OIP F;  2DK5 A;  2ECC A;  1IG7 A;  2CSO A;  5D4S A;  1TW2 A;  1JKP C;  5BQT A;  1GVJ A;  2Z16 A;  1SEU A;  5KNL A;  3DKX A;  2OUM A;  3IWF A;  2DDB A;  2HGC A;  2D2W A;  2NS0 A;  1UHM A;  2VQC A;  3S32 A;  1B9M A;  3OYN A;  4P96 A;  2KZG A;  5CQG A;  1Z91 A;  4B4C A;  2QLZ A;  2ME6 A;  3U1K A;  2ZJQ F;  1YIT I;  5HNH A;  4KIT B;  2MD0 A;  2B7E A;  2COB A;  3CUQ A;  2DYR H;  3KEQ A;  3C1D A;  1ZQ3 P;  2IGO A;  1IRZ A;  1UG2 A;  2E1N A;  5L3F A;  2O7O A;  1DDN A;  4LIU A;  1LB2 A;  3RSN A;  1ON1 A;  1EA3 A;  3ONQ A;  4HW0 A;  2EIL H;  1I3Q J;  1MBJ A;  1R5I D;  4JYK A;  4DW6 A;  3FIW A;  2IA0 A;  4KN7 X;  3FKI J;  2RC4 A;  5J1U A;  2JRM A;  5J4Y A;  1XMX A;  2VBX A;  1ZRF A;  2GLO A;  4RAZ A;  3ELK A;  3J81 Z;  1VND A;  5E20 A;  4O6J A;  2NNY A;  2IT0 A;  3ZN1 A;  2YSR A;  5HS7 A;  4WCG A;  1IN7 A;  1LUJ B;  1ETO A;  3J7Y J;  1RET A;  2W25 A;  4UB8 C;  4RGS A;  4HQM A;  5K7F A;  1OFC X;  4CXF A;  1J09 A;  1XDU A;  3U21 A;  3VOD A;  4NB5 A;  3HRU A;  1OLT A;  1U9N A;  2WY8 Q;  3J81 K;  3MEX A;  3MQ0 A;  3O8G A;  3GZ5 A;  4PZJ A;  4RLF A;  4ENN A;  4ZTJ A;  2L7M P;  1K78 A;  3AG1 H;  1R1U A;  2G0E A;  2QVO A;  3QWL A;  4MQV A;  3WHC A;  3MKY B;  2A61 A;  3FXJ A;  2BY3 A;  4NQW A;  1Z9C A;  3HIF A;  4X6A J;  4ITV A;  4KIB A;  1BN5 A;  1WI3 A;  2JTV A;  3IC7 A;  4LK0 F;  3G4S I;  5F6F A;  1GV5 A;  4GO1 A;  4M3B A;  2ZJ2 A;  2HXO A;  5DM7 F;  1L3L A;  2RNG A;  2F6C A;  2V9K A;  2CUZ A;  1HKT A;  3LNQ A;  4I09 A;  3F8N A;  4IOC F;  1SAX A;  5FRM A;  1XMK A;  2HQN A;  4MEY F;  3I53 A;  3JRG A;  1QO0 D;  3OYA A;  4L0Z B;  1BBY A;  3BLY A;  3I0T A;  3MZY A;  2K3P A;  4MFE A;  3SZP A;  1MH4 A;  4JX5 A;  1ZTR A;  3IP4 B;  3JAM Z;  2WBM A;  2XAG A;  5F04 A;  5HDN A;  5M5W J;  2B9S A;  4DYQ A;  4N9H A;  1ZKG A;  2BVL A;  2O03 A;  2DN0 A;  1FX7 A;  5HLG A;  4HV5 A;  3RKX A;  2H1K A;  1OR7 C;  2UV1 A;  5LRR A;  4LB5 A;  5E8I A;  2XKO A;  4HNV A;  4V2G A;  2OAZ A;  5JR3 A;  5E18 F;  2VXD A;  4A5M A;  1PUF A;  1V5E A;  1PJR A;  3F8B A;  2GOX B;  4CZZ A;  1C0W A;  3MMY B;  1UEL B;  3OYE A;  4UNO A;  3NEU A;  4IPA A;  1D5Y A;  4DGW B;  4QLC U;  4BHP A;  3G1L A;  2JA5 J;  2LOO A;  4JK1 X;  2WV1 A;  3BTC A;  3CES A;  4IHT A;  3BR3 A;  2QSF X;  1Q1V A;  3S93 A;  5CVJ A;  2V79 A;  1YJN I;  5IY5 H;  5AIP A;  2ZCW A;  2KQR A;  2LR8 A;  4ENK A;  3I71 A;  4Q48 A;  5C3E J;  2HFH A;  4A0Z A;  5LBQ A;  1DP7 P;  4F52 A;  4PSX A;  2CV0 A;  1G3T A;  4AUX A;  2CFO A;  2W4S A;  4BXF A;  1E3O C;  2DJI A;  4MHG A;  4KMU X;  5IYD J;  2LKS A;  2Y31 A;  4AWX B;  5IYC J;  5E3M A;  1P7J A;  3K1M A;  3KP7 A;  3WG9 A;  5GPC A;  9ANT A;  3KP2 A;  1VI0 A;  4L0Y B;  1OYY A;  3RDI A;  5D5X B;  4RAG A;  5K1Y A;  2BVM A;  4IQ4 A;  2GXA A;  3NAU A;  2QYO A;  3VSL A;  1ACI A;  2DCE A;  2R5Y B;  1RPW A;  3PJR A;  3KEY A;  1QA6 A;  4KIF A;  4XMY A;  4D0P A;  4FX4 A;  2KIS A;  2QWW A;  5D6F A;  1IV8 A;  4CH7 A;  3LSK A;  4PJL A;  2FMY A;  4L9J A;  5F0H A;  3RCO A;  2Y0S N;  5TGT A;  5EGO B;  3HRM A;  3I4P A;  4M6Y A;  3K70 D;  1D8J A;  1AU7 A;  2LF8 A;  2NVT J;  1K61 A;  2PBI A;  4C30 A;  2H8W A;  3S3O A;  1EF4 A;  1W7P B;  3KZY A;  3ZMZ A;  4XLP F;  3MCZ A;  1J2X A;  3E6D A;  3H36 A;  2EB7 A;  1P92 A;  2W82 A;  3H3Z A;  2X48 A;  2W57 A;  3LAJ A;  1VQ7 I;  3BZ6 A;  2MYS A;  3E7L A;  1TNT A;  1VQ4 I;  2CW7 A;  3KE2 A;  3P9K A;  5JVG F;  1S7E A;  4A3I J;  1HSJ A;  2CV1 A;  1JHF A;  1JTX A;  2OBP A;  3RKQ A;  2XRL A;  1HQC A;  2DFF A;  2OCC H;  4HBL A;  3IV5 A;  2P0W A;  3S1R J;  4AID A;  1TL8 A;  2FJ1 A;  1ZG3 A;  2D1H A;  1LDJ A;  2HS5 A;  3M1C A;  1S3J A;  3FK7 A;  5JI6 A;  4XQF A;  3W3C A;  1E2X A;  2MC4 A;  1MKM A;  4EJT A;  3UR3 C;  2W1O A;  4HX4 A;  4D9J A;  2MFZ A;  1Y1W J;  2CV2 A;  4GCV A;  3V8J A;  4DYC A;  5B1A H;  1YIJ I;  1RKW A;  4XN3 A;  3A01 A;  5B66 C;  2VKH A;  1T38 A;  2HZD A;  1HCR A;  1XGN A;  4C3H J;  3OWT A;  5J1R A;  4MTD A;  1K7A A;  3IH4 A;  1KU7 A;  1MW7 A;  1IGN A;  4UVC A;  3D5L A;  1OPC A;  5LEJ A;  3IHU A;  4KIG A;  2HOA A;  3KYC B;  1U0J A;  2KIF A;  3IUO A;  4AVP A;  2AQE A;  1GV2 A;  1RR8 C;  2E2H J;  2KHM A;  3ZCO A;  5M3F J;  1I1S A;  5L3C A;  1WI9 A;  3FMR A;  1DGW Y;  5BNG A;  2JA2 A;  3HM5 A;  4BKX A;  3WGH A;  4NBQ A;  1ETQ A;  1RNL A;  2MD5 A;  2MH2 A;  3KPH A;  4CCJ A;  2KDZ A;  4HF1 A;  1FOX A;  3QQA A;  1BM9 A;  3M07 A;  1FSH A;  1PYV A;  2GIZ A;  5L3D A;  3HGG A;  2RAE A;  2FBK A;  1KU9 A;  3GZN B;  4ZYE A;  2ESN A;  5DS9 A;  1TQI A;  2PQ8 A;  4BUP A;  4XOT A;  4HLY A;  3K1P A;  2FE3 A;  2K9N A;  1T56 A;  3L2Q A;  3I64 A;  1RZ4 A;  4Y7N J;  2L54 A;  1O3Q A;  3DU6 A;  2AQF A;  3Q9S A;  1JT0 A;  2RKH A;  3RIR A;  1XX5 A;  1IN6 A;  2DQL A;  2ZBK A;  1YIO A;  1ZGA A;  2FNA A;  1J0R A;  2IGK A;  2GBY A;  2GXB A;  2FBH A;  2V4J C;  2ADU A;  3BR1 A;  2VI6 A;  1UCR A;  2DOE A;  1POG A;  3CC4 I;  5FLX Z;  1V4R A;  4AU7 A;  1YQA A;  3TDU C;  2NVQ J;  1IUY A;  2KRF A;  3GX4 X;  3M3Y J;  3QOE A;  4P55 A;  3VYS B;  1X4P A;  2IW5 A;  2BY2 A;  5L3B A;  4MEX F;  2M5W A;  3AAF A;  4IO9 F;  2ACJ A;  1Z6T A;  2KJC A;  3TW7 A;  1MGT A;  2DA4 A;  3CDI A;  3PNV A;  5IT3 A;  1STZ A;  2NOG A;  4M73 A;  4RB0 A;  2HXI A;  1FP1 D;  3MKL A;  3LA7 A;  1MNE A;  2L5Q A;  4BQO A;  2ESH A;  4ETS A;  2NVY J;  3MFK A;  4MO7 A;  1ZAR A;  2DOF A;  4CCK A;  2EA2 A;  4WK8 F;  3VWB A;  3E1S A;  3SFI A;  4IEJ A;  3CJQ B;  3E5Q A;  3HOS A;  3GFI A;  2XRN A;  2LBF B;  4XSZ F;  1T2K A;  1U9O A;  2X6Y A;  2EZI A;  2HYG D;  4WXC A;  2HKO A;  4WX9 A;  4XRM A;  1VQ9 I;  3KYD B;  1WVR A;  4MLO A;  2Y9Y A;  1RES A;  4C3J J;  3FHZ A;  4XKC A;  1WRJ A;  1A36 A;  1F43 A;  2L9N A;  3FXM A;  3TMO A;  2R7U A;  2RQQ A;  3WTW C;  2MLG A;  2VXZ A;  1IO2 A;  3ZQF A;  2VOD A;  1FC3 A;  5HDK A;  1VQ5 I;  4L5J A;  4XN0 A;  2BOL A;  5EZG A;  5EEA A;  3SEZ A;  5HS8 A;  2EV6 A;  1AKH B;  3J80 K;  5LLQ A;  3JRH A;  4NC7 A;  2PJR B;  3S3M A;  1OKR A;  4KJZ A;  1ZG5 A;  2FA5 A;  2ZNY A;  2GOM A;  2ZSH B;  5D8L B;  5JHF A;  4UUS B;  1XCB A;  4KUM A;  3OOU A;  4YII A;  1W4M A;  3VOE A;  4A6E A;  2NS8 A;  1UST A;  1T6S A;  1LFU P;  2K40 A;  1TZL A;  5F0F A;  3JTG A;  1D0X A;  2HZT A;  2ZC2 A;  4P9U A;  3ZMU A;  2XSD C;  4I7H A;  2OC6 A;  4U87 A;  2V1X A;  3QAH A;  1S5L C;  3CO6 C;  3HOU J;  4EJO A;  2VON A;  1Z7U A;  3J7Z I;  4OAY A;  4F7Z A;  2F5V A;  1QBJ A;  2M87 A;  1UAA A;  3RTR A;  2ZME C;  2KIM A;  3S17 J;  2BYV E;  3CP8 A;  4B47 A;  5FB2 A;  4A3L J;  2J5P A;  4FQG A;  4PFP A;  4R1H A;  2WV0 A;  3ULQ B;  1VQO I;  5E79 C;  1Z0X A;  4DZP A;  2Z2S B;  3M1E A;  1X1A A;  5KAI C;  1ZRD A;  3IAM 2;  2E19 A;  3E3V A;  3U9G A;  5DUI A;  4IHY A;  1PVE A;  3PFI A;  1N78 A;  3ZQL A;  1BW5 A;  3DXJ F;  2LH9 A;  1DP3 A;  1QHH D;  1CF7 B;  2F5E A;  1YW7 A;  3GO5 A;  5HNF A;  1UHW A;  3COA C;  2ZB9 A;  2XUB A;  3KCC A;  3I56 I;  1ETX A;  3M9A A;  2HTJ A;  4JX4 A;  3TBI A;  3ABM H;  3N4M A;  2PMH A;  1MZB A;  2L9R A;  3WTY C;  5KAF C;  3JRB A;  2A6E F;  2DYS H;  1P2F A;  4LFU A;  1X1C A;  2DK8 A;  3DTE A;  3ZMS A;  3F6V A;  1OYW A;  4BQQ A;  1S8N A;  1OMI A;  3TP3 A;  1X1D A;  2W48 A;  4CSW A;  1SAN A;  4S04 A;  1UJ8 A;  5DD4 A;  4ESB A;  2QUF A;  5F1R A;  4XRS G;  2DO7 A;  4RB3 C;  4EJW A;  5CQE A;  1VZ0 A;  2F48 A;  3P9C A;  3WU2 C;  4FT8 A;  3M4O J;  1O4X A;  4A3K J;  3E6B A;  1ERD A;  3ECH A;  1O3S A;  4PJ0 C;  2P6T A;  1H88 C;  1PP8 F;  4RAY A;  1B9N A;  3CDH A;  1WQ2 A;  2YX4 A;  1U78 A;  4YG2 F;  4A3E J;  3G71 I;  2A68 F;  2BHZ A;  3BJ6 A;  2CYY A;  4U0V A;  3TQN A;  2ISZ A;  3HPG A;  3JCU C;  5LHH A;  4KIS A;  2VBY A;  2R93 J;  3ABT A;  3R61 A;  3I55 I;  3GTG J;  5IP9 J;  4RDU A;  1QHG A;  4Q4Z F;  4IQJ A;  3PUB A;  2DMQ A;  1WFX A;  1FYK A;  3KFW X;  2QZ8 A;  3RKY A;  2LY1 A;  5FFX A;  1F1Z A;  2I10 A;  3ZN0 A;  1Y56 A;  2R5Y A;  4MQ9 F;  5CVR A;  2MLK A;  3L2W A;  4HQE A;  3HB9 A;  1I6H J;  3ZR8 X;  2E2J J;  2M1B A;  4IRI A;  3OR2 C;  4RGR A;  2RN7 A;  2E1C A;  2WA0 A;  1F9N A;  5EDN A;  5EGO A;  2X9D A;  2HR3 A;  3HSR A;  2EIJ H;  1JE8 A;  1W7P A;  3OIP A;  3NQO A;  4XBF A;  4LG0 A;  1U5T C;  2LG4 A;  2Y69 H;  1VQ6 I;  1AWC A;  1OCR H;  4G12 A;  4BE2 A;  2X0L A;  1I3A A;  3BR6 A;  4U88 A;  3SJM A;  1FOK A;  2STT A;  4CZC A;  1MJB A;  1A35 A;  4IXA A;  1TC3 C;  2ISY A;  4BAC A;  4BEH B;  5LD2 C;  2JA6 J;  2MGQ A;  4IHW A;  3LOC A;  3HOX J;  1YX3 A;  4LIT A;  4A0X A;  2IS4 A;  1IC8 A;  1IV6 A;  2V26 A;  1VQM I;  2XDV A;  2CQQ A;  3CLQ A;  5CVI A;  3CD6 I;  1VQK I;  2G9W A;  4LLG F;  2XAQ A;  3BT9 A;  2COM A;  4KIC A;  4EM1 A;  5E1Z B;  1EV7 A;  2MG4 A;  3GW2 A;  2DMT A;  1BI0 A;  1Y8Q B;  3A0H C;  4LK1 F;  3BJO A;  4AYB N;  2P6S A;  3GTQ J;  2E2I J;  1YW8 A;  3CCQ I;  2E1O A;  2PI0 A;  3K1N A;  4CCN A;  4NHJ A;  2D1V A;  3JRF A;  4ESJ A;  4I2O A;  1I1G A;  2ID6 A;  3LSR A;  2A5Y B;  3V42 A;  1FMV A;  2XAS A;  2GAU A;  2RDP A;  2JZY A;  4LLN A;  2LMD A;  2WAF A;  1Z77 A;  4LOC A;  1LEB A;  2Y2Z A;  1BJA A;  1W5T A;  2R7O A;  1MJ9 A;  1R9T J;  4I6Z A;  4JOM A;  1A04 A;  3RKW A;  3Q3S A;  3UNG C;  3CO7 C;  3DBH B;  2DT5 A;  2M0M A;  1FY7 A;  2Q0O A;  2ECB A;  1FOW A;  4DBR A;  1G4D A;  1ZRE A;  2FX0 A;  5K7H A;  1Y39 A;  4KDP A;  1XD7 A;  5J4V A;  1LKX A;  4PUS A;  3VDX A;  3HUG B;  5J3L A;  3FIS A;  4PSW A;  3HXL A;  3OS1 A;  3L09 A;  2DDA A;  2STW A;  3SDG A;  4ANJ A;  1V55 H;  1IZ1 A;  4IHX A;  2XRO A;  4XRF A;  3D0S A;  5FKK A;  1D3Y A;  5DV5 A;  4XLE A;  2VQL A;  5IP7 J;  3NWS A;  1HBX G;  5HVQ C;  5CYV A;  2FRH A;  2NVU B;  2EJR A;  2HYF A;  2L4M A;  3I5U A;  3E97 A;  1LVK A;  2VPL A;  2ICW G;  1FT9 A;  2V6C A;  2O61 A;  1T33 A;  4R8H A;  4MFD A;  2LKX A;  3GME A;  5FFZ A;  5CLS A;  1RR7 A;  4UB6 C;  4F92 B;  5H6R A;  2OQG A;  3TW6 A;  3CCJ I;  4BHB A;  5D5V B;  2FBI A;  5JLW A;  5BS6 A;  5HLT A;  3RYP A;  1RKT A;  2XPU A;  5HLH A;  1BW6 A;  3DEU A;  3HKZ N;  5ILS A;  4WF2 A;  5J47 A;  3Q0U A;  2XV4 S;  5CJ9 A;  2K7L A;  5D5W B;  4B09 A;  3B02 A;  4OWR B;  1B1B A;  2WB1 N;  4PJN A;  2NNN A;  2K27 A;  3X2Q H;  4B43 A;  2D45 A;  5GTH C;  3V7C A;  1TTY A;  3VFZ A;  5ILU A;  4ZYH A;  2DFI A;  2LBF A;  4LLL A;  2NVX J;  1R22 A;  2FOW A;  2UZK A;  2R7X A;  4YRV A;  5BMZ A;  3GWZ A;  1ZGJ A;  2DPU A;  4C2M J;  5E17 F;  1JUS A;  3ZMD A;  1X19 A;  2WAD A;  4J01 A;  3AL0 B;  2BY0 A;  2M3A A;  1XMA A;  1R00 A;  2PG4 A;  2V9P A;  4PK4 A;  5J6X A;  2P5L C;  2E7X A;  1K6Y A;  3W6J B;  2DOA A;  2RNJ A;  4QWQ A;  3TO9 A;  2W84 A;  1YLF A;  3MWM A;  4E7I A;  4C2U A;  5K7Z A;  1WWX A;  3K2A A;  3FBN B;  1MIJ A;  1RC9 A;  2OF7 A;  3GXO A;  2HQR A;  4RLQ A;  4ENJ A;  3HDD A;  3PIO F;  3IKV A;  5FRN A;  1ON2 A;  3H35 A;  1DQU A;  3BRO A;  4IL6 C;  1ZEL A;  4XR6 A;  4NC6 A;  3DLL F;  1AKH A;  3H9G A;  1FZP B;  3UKG A;  2DA6 A;  4BHC A;  3IH3 A;  4RM3 A;  2PJR A;  4C3I J;  1MH3 A;  4UUS A;  1B59 A;  3HTS B;  1S6L A;  2HVS A;  4BDY A;  3DLA A;  3WTS C;  1GDT A;  2F5D A;  5ICF A;  1U6G A;  1WZ2 A;  1JGS A;  2HYJ A;  2QA4 I;  2DI3 A;  1ULY A;  3OR1 C;  3HEF A;  3AFH A;  1A6I A;  5F27 A;  3CCR I;  1WJA A;  2UXX A;  1LVA A;  3VB2 A;  5FD5 A;  3T8T A;  3DKY A;  3I4M J;  4JBA A;  4ZTF A;  1SD7 A;  3GTP J;  3FXR A;  1B6A A;  2A07 F;  4AYB A;  1LFB A;  3HOW J;  1R7J A;  3OIQ A;  1X4O A;  3SEQ A;  2GXG A;  5FD6 A;  3RPU D;  3I59 B;  3QYE A;  3BQY A;  3CCE I;  1CF7 A;  4OU0 A;  2M4K A;  3DEE A;  4BGD A;  1BOA A;  2PN6 A;  5GAE J;  1JKO C;  2DA2 A;  1T95 A;  3GVA A;  1QZZ A;  3MVP A;  3WGI A;  2ZME A;  2FSW A;  2KPM A;  1QPI A;  3GBG A;  2Y75 A;  2HOS A;  4BU2 A;  4G6Q A;  1U3E M;  1FEX A;  3R0A A;  1MND A;  2Z99 A;  2PMZ N;  4V2F A;  2QEX I;  1JKQ C;  2A6T A;  3LA3 A;  2CUJ A;  2QEN A;  1FOY A;  4N0B A;  2A69 F;  3DWL E;  4D7M A;  2X6W A;  4I99 C;  4EMS A;  5K5R A;  2ZKZ A;  3PNY A;  5DTD A;  3L2R A;  1O3R A;  2Z9O A;  1WKM A;  3G2B A;  2AS5 F;  3CC2 I;  3S2D J;  4HSR A;  5HLI A;  3ZRG A;  3HG9 A;  3L2U A;  4BJ6 C;  2E35 A;  2XF6 A;  2IJL A;  3FMQ A;  3C2G A;  2WY7 Q;  1YJW I;  2EZK A;  2OZU A;  1GLN A;  2OV7 A;  3ZGK A;  4V19 K;  2CW8 A;  4Y4R A;  1ETV A;  2GM4 A;  3QPL A;  1U8B A;  4XM3 A;  4K2E A;  4RS8 A;  4A6D A;  1VQL I;  1P4A A;  1Z21 A;  2GWR A;  1L0O C;  4F91 B;  3ESW B;  5FRO A;  2Q2E B;  2X1C A;  2DAO A;  2ZFU A;  4XK4 A;  2P5K A;  1OCT C;  1ZYR F;  3LL7 A;  5F08 A;  4RB2 C;  3K10 A;  5JVT A;  2GA2 A;  3K4L A;  1X3U A;  5J8C A;  2XHK A;  5B3S H;  1EKE A; 
#chains in the Genus database with same CATH homology
 2BBY A;  4PGH A;  3C18 A;  1EH6 A;  4KN4 X;  3EDP A;  4HZF A;  1BC8 C;  2K02 A;  3HTU A;  1XSD A;  4OMZ A;  2EV5 A;  2M45 A;  4CYD A;  3HYI A;  3SHF A;  1FBU A;  3BWG A;  3Q9V A;  1KYW A;  2R7F A;  4HDV A;  2VOO A;  5LHG A;  3DPT A;  5LGT A;  4HF2 A;  4KYW A;  4ESF A;  5HOO A;  3ZMV A;  1U5T A;  2O3F A;  3K9T A;  3TO6 A;  4A2U A;  1SFX A;  2XKP A;  2M30 A;  1IRG A;  4O5V A;  3K2Z A;  2V1D A;  4GGG A;  4G7H F;  3R0J A;  4PCQ A;  4R79 A;  5BPD A;  2DW4 A;  1HW1 A;  4WWC A;  1HKQ A;  1UB9 A;  4A5N A;  4L9N A;  2NRA C;  4HOB A;  2P7C B;  2P4W A;  3HHH A;  2V9V A;  3KP5 A;  2L01 A;  1LEA A;  2EFW A;  3R60 A;  4HLX A;  2RGV A;  3R4K A;  4MTE A;  5IT9 Z;  2WTE A;  4HAM A;  1T98 A;  3GEZ A;  1ZAO A;  1TBX A;  2CFX A;  1H9T A;  1GXQ A;  1PP7 U;  2WC2 A;  1IAW A;  4U7B A;  3T8R A;  3ZP5 A;  4IVN A;  5EEH A;  6PAX A;  1TLH B;  4DQ2 A;  4KA4 A;  4XLN F;  5IT9 K;  4MGR A;  5DDG A;  1YTY A;  2BGC A;  2Z5U A;  5TJJ A;  1J5Y A;  5K5O A;  3DQV C;  1CGP A;  3K69 A;  3WTT C;  2PLY A;  3F8M A;  3O6B B;  4BQA A;  4OMY A;  4HX8 A;  3LWF A;  3CUQ B;  1FWZ A;  3WU0 A;  4U0Y A;  1KQ8 A;  1DPR A;  4U0W A;  3J80 Z;  4EV0 A;  2B0L A;  3DPL C;  2KJB A;  1Y0U A;  3REO A;  3DF8 A;  5L3E A;  3GFL A;  2BEO A;  2F5F A;  1TW3 A;  3BPV A;  3FX3 A;  3V8L A;  2PFB A;  4BNC A;  3MZH A;  3FM3 A;  1HW2 A;  1XGS A;  3Q5F A;  3BPX A;  4MNU A;  3GYH X;  5BOX A;  5AIQ A;  5LGN A;  2E7W A;  2HKX A;  2O0Y A;  1IF1 A;  2HDC A;  1Z05 A;  4P5O A;  1K78 B;  3QOP A;  1YO5 C;  4N9I A;  3F22 A;  4XSX F;  1ZG1 A;  3I59 A;  3V7R A;  1R5G A;  3V7S A;  4BAY A;  2LF7 A;  2L3D A;  1YG2 A;  2FEZ A;  2PMU A;  1RIO H;  2FQ3 A;  3QU6 A;  3TKY A;  2DLL A;  5HDG A;  4YFX F;  4HDU A;  5K5Q A;  3JTH A;  3BOQ A;  4JQF A;  5J8F A;  2IRF G;  4TV7 A;  3EYY A;  2H09 A;  4ZZL A;  2XAF A;  2O6G E;  1XSX A;  2CGP A;  3L00 A;  4Q5S F;  1QNT A;  3ABU A;  4WXH A;  3E5X A;  5D8K B;  4HA8 A;  3JSO A;  4U7D A;  2W24 A;  2W85 A;  1HW5 A;  2G7H A;  3I58 A;  1ZHF A;  2QQA A;  4OOI A;  1RUN A;  2H27 A;  2Z33 A;  3JW4 A;  3SFZ A;  1KA8 A;  3IRR A;  4EQQ A;  1HKS A;  1RUO A;  4PGG A;  4IJA A;  4KNY A;  2XAJ A;  4UV8 A;  1YFH A;  1REP C;  2F5C A;  4Y17 A;  2JT1 A;  1IXC A;  5DEQ A;  4HV6 A;  1XDS A;  2CO5 A;  1PDN C;  1QGP A;  1U2W A;  2VBW A;  4EM0 B;  4YFK F;  1R5H A;  1O3T A;  3KP4 A;  2JPB A;  5ED4 A;  1S29 A;  3M8E A;  1FPQ A;  1FYM A;  2EA4 A;  4OIR F;  5ICC A;  4BXU A;  4I02 A;  1BI2 A;  4A12 A;  4GXO A;  2IVM A;  2YX7 A;  4LMY A;  3TDZ C;  2MH9 A;  3ECO A;  1R58 A;  2PJP A;  4ON0 A;  1I5Z A;  5F64 A;  4ZH4 F;  1V3F A;  1H9G A;  4Z2Y A;  5L3G A;  3KZZ A;  3QPH A;  2XVC A;  2RVC A;  5E1X A;  2QQ9 A;  5LGU A;  2EV0 A;  3G3Z A;  3F72 A;  3LQR A;  1P4X A;  2NAZ A;  4EVI A;  2ZO4 A;  3GUD A;  1R1T A;  3BP8 A;  5DD8 A;  2DQR A;  4KMF A;  4L9T A;  1SMT A;  3BDD A;  3T5X A;  4I0A A;  5AON A;  4E70 A;  4Q47 A;  2ZNZ A;  1K6O A;  5ERI A;  1SFE A;  3RPU A;  3DP7 A;  1SFU A;  5CVV A;  4LGW A;  4G9Y A;  2GA1 A;  3WOD F;  2VE8 A;  3PQK A;  3TO7 A;  4I01 A;  2A6H F;  4S05 A;  3M8F A;  3ZQ7 A;  1KU3 A;  2K4J A;  1BIB A;  5FO5 A;  2BE5 F;  3WTV C;  2WWY A;  2LKP A;  4I0B A;  4RGX A;  1GXP A;  4KFC A;  1KQ0 A;  1T39 A;  4UVB A;  2XAH A;  1PUE E;  5D4R A;  2EWN A;  2Z3Y A;  1MD0 A;  1WSU A;  2IA2 A;  4CDG A;  1O7F A;  2R3S A;  4G7Z F;  1ZLK A;  2L4A A;  1YW9 A;  1JHH A;  2EFO A;  1J7K A;  1D5V A;  4YIF A;  2EFP A;  2UWM A;  2TDX A;  1R1V A;  4HX7 A;  4BH9 A;  5DCM B;  3EET A;  3H92 A;  3LST A;  1HXD A;  4G6D A;  2BV6 A;  5A2Q Z;  3R6S A;  3WGG A;  3GZ6 A;  2XGX A;  2CQK A;  1XCV A;  2MBF A;  2O8X A;  3K0L A;  4RGU A;  1Q1H A;  4OIO F;  2VT3 A;  1KQ9 A;  4G94 A;  3P9I A;  5A2Q K;  4O3M A;  2IA1 A;  4YFN F;  3FXQ A;  1YYV A;  1T0F A;  2QM3 A;  3T1B A;  4Y13 A;  1LJ9 A;  2DU9 A;  2X4H A;  4GYI A;  4L18 B;  3JAM K;  2LNB A;  3BJA A;  1I6X A;  1FBQ A;  3OV8 A;  1IXR C;  1XSV A;  4FHT A;  2YU3 A;  3HSE A;  1LNW A;  2HEO A;  4ZYD A;  1QPM A;  4WXD A;  3DV8 A;  2VBZ A;  3FXU A;  2QBY B;  1J9I A;  1JXS A;  3O3K A;  5DCF A;  1ONV A;  4UHT A;  3HSF A;  1QZY A;  5EEG A;  4IF4 A;  4G8X A;  4EGZ A;  2EFN A;  4EM2 A;  1R36 A;  1AOY A;  1GHC A;  1FP2 A;  3QRF F;  4M72 A;  2VOP A;  5TRD A;  2MC3 A;  3RPQ A;  4M9Z A;  3E6C C;  1W5S A;  1P4W A;  3NRV A;  3IRQ A;  4LG0 B;  1O57 A;  2XIG A;  1YS6 A;  2UXN A;  5JFR A;  2Q8K A;  3RYR A;  1VTN C;  2ELH A;  1KYZ A;  2FXA A;  2VT2 A;  3ML6 A;  1FYL A;  1G3W A;  5ICG A;  2Y0M A;  4ASN A;  1BI1 A;  1TQP A;  1MDM B;  1LDD A;  3TOA A;  4Y15 A;  4M9X A;  3QPT A;  2ZFW A;  4RB1 A;  4AIK A;  5D5U B;  4M74 A;  2VE9 A;  2FU4 A;  3F3X A;  1E17 A;  2H6B A;  3IWZ A;  1UFM A;  3ERE D;  1YS7 A;  3GLX A;  2G7U A;  3HUG A;  4LD5 A;  1G3Y A;  3J7A O;  3F6O A;  1FNN A;  3U2R A;  1IRF A;  3F21 A;  1KGS A;  1NHA A;  3DKW A;  2L02 A;  4LB6 B;  4KT5 C;  4L5I A;  2EK5 A;  4EGY A;  3CTA A;  4UXN A;  3PQJ A;  3HOT A;  3N97 A;  1S7A A;  2JPC A;  2JRT A;  3SXY A;  1ODD A;  5LHI A;  2GIV A;  2KKO A;  3CUQ C;  1EH8 A;  4IHS A;  2FNP A;  2R7D A;  3KP6 A;  3GF2 A;  3L2C A;  3V8K A;  2CWE A;  1SD4 A;  2KIU A;  3F23 A;  1P6R A;  4M71 A;  4AIJ A;  1LQ1 A;  1XN7 A;  2P5V A;  4M9S A;  4CO8 A;  2C6Y A;  4M6X A;  2K4B A;  4UV9 A;  3ZPL A;  2P7V B;  5E8G A;  1G6N A;  3B73 A;  3EQL F;  5D6E A;  3E5U A;  1ZRC A;  3EYI A;  1K79 A;  3WTU C;  2ZXJ A;  5FLX K;  3CLO A;  4IRH A;  5DYM A;  3LA2 A;  5ICE A;  4CHU A;  4LJZ F;  4H0E A;  2JSC A;  1J59 A;  1Z6R A;  1BIA A;  3T0Y A;  4A0Y A;  2OQR A;  3LFK A;  3CUO A;  2HTS A;  3C3W A;  4OIQ F;  2H6C A;  5E1W A;  5H6Q A;  1HST A;  3WU1 B;  2HWV A;  3O2P E;  2QQB A;  2VN2 A;  2M8E A;  3DFG A;  1BC7 C;  3KEO A;  3CJN A;  3LQQ A;  2H94 A;  5KK1 A;  2OA4 A;  4HF0 A;  1ZLJ A;  1O7L A;  4AIH A;  3RJP A;  5DCM A;  4EJV A;  5JHU A;  2NYX A;  1SD5 A;  3U1D A;  3IL2 A;  3HRS A;  3G73 A;  2IP2 A;  3GFM A;  3S2W A;  3IKT A;  1TNS A;  3ROU A;  4GYG A;  3E6M A;  1Z1D A;  1QQI A;  3GFJ A;  5KVR A;  3JSP A;  3VEP A;  3QU3 A;  3L7W A;  2A3S A;  2AXL A;  4OIN F;  4UUV A;  3W6K B;  3BY6 A;  4FX0 A;  3KLO A;  2P8T A;  4P9F A;  1XB4 A;  2ZME B;  4ZZD A;  1XGO A;  3H3U A;  3SQN A;  4CGZ A;  1FSE A;  2VC0 A;  1FBS A;  3HHG A;  3FWE A;  3L9F A;  1OR7 A;  2Q2E A;  1XGM A;  4B8X A;  2OD5 A;  3FF5 A;  2FOK A;  3WE3 A;  3QP5 A;  3KET A;  2QBY A;  5LRS A;  3I54 A;  3M7G A;  1IW7 F;  1TQM A;  3P7N A;  5DUK A;  2J5O A;  1IXS B;  2IPQ X;  4BYY A;  1H0M A;  2FF4 A;  1R23 A;  3HRT A;  3ISP A;  1ZH5 A;  3TOB A;  1ZN2 A;  4IRG A;  5H20 A;  5HS9 A;  1SMY F;  4L9V A;  3FZV A;  3LAP A;  1B4A A;  1FLI A;  3WTZ A;  3F8C A;  4EJU A;  1USS A;  2RQP A;  2GZW A;  3TGN A;  1DPU A;  2RV8 A;  3KLN A;  3EUH A;  2F2E A;  3FMS A;  4UVA A;  5CVU A;  5FGM A;  4CIC A;  1IN4 A;  1S7O A;  4G7O F;  1IN5 A;  1IN8 A;  4DNC A;  5BPI A;  5ILV A;  3V4G A;  3F8F A;  2DBB A;  1DUX C;  3OOP A;  4HYE A;  1MJA A;  1MDM A;  1F4K A;  1U5T B;  2Y48 A;  1OYI A;  4I98 B;  5LEK A;  2FML A;  1SD6 A;  2LSO A;  1J75 A;  1D8K A;  3KP3 A;  3RI4 A;  2CG4 A;  3SZT A;  2YR2 A;  1LDK B;  2HOE A;  2OU2 A;  1RI7 A;  4ENM A;  3C7J A;  3WTX C;  4PDK A;  1EH7 A;  2OZ6 A;  3WE2 A;  2ETH A;  3MAJ A;  2PEX A;  2YPR A;  1F5T A;  1BI3 A;  4AD9 A;  2EFQ A;  2DPD A;  2CW0 F;  1G3S A;  2DTR A;  3FM5 A;  1KU2 A;  1W7P D;  4ZYG A;  1U8R A;  2LDU A;  3ZMT A;  2VC1 A;  2MA3 A;  3QP6 A;  2K86 A;  1I27 A;  2GQQ A;  2V1U A;  4OIP F;  2DK5 A;  2CSO A;  5D4S A;  1TW2 A;  5BQT A;  1GVJ A;  3IWF A;  2HGC A;  2D2W A;  2NS0 A;  1UHM A;  1B9M A;  4P96 A;  1Z91 A;  2QLZ A;  3CUQ A;  3KEQ A;  3C1D A;  2E1N A;  5L3F A;  1DDN A;  1LB2 A;  1ON1 A;  4HW0 A;  2IA0 A;  4KN7 X;  2RC4 A;  2VBX A;  1ZRF A;  4RAZ A;  3ELK A;  3J81 Z;  5E20 A;  4O6J A;  2NNY A;  2IT0 A;  3ZN1 A;  2YSR A;  5HS7 A;  4WCG A;  1IN7 A;  2W25 A;  4RGS A;  4HQM A;  4CXF A;  1XDU A;  3VOD A;  4NB5 A;  3HRU A;  3J81 K;  3MEX A;  3MQ0 A;  4PZJ A;  3GZ5 A;  4ENN A;  1K78 A;  1R1U A;  4MQV A;  2QVO A;  2A61 A;  4NQW A;  1Z9C A;  3HIF A;  4KIB A;  1BN5 A;  3IC7 A;  2JTV A;  4LK0 F;  5F6F A;  4GO1 A;  2ZJ2 A;  1L3L A;  1HKT A;  4I09 A;  3F8N A;  1SAX A;  1XMK A;  2HQN A;  4MEY F;  3I53 A;  4L0Z B;  1QO0 D;  1BBY A;  3I0T A;  3MZY A;  3SZP A;  3JAM Z;  2XAG A;  5HDN A;  4N9H A;  2O03 A;  1FX7 A;  5HLG A;  4HV5 A;  3RKX A;  5LRR A;  4LB5 A;  5E8I A;  2XKO A;  5JR3 A;  2OAZ A;  5E18 F;  4A5M A;  3F8B A;  4CZZ A;  1C0W A;  4UNO A;  3NEU A;  4IPA A;  4QLC U;  4BHP A;  4JK1 X;  4IHT A;  5CVJ A;  2V79 A;  5AIP A;  2ZCW A;  4ENK A;  3I71 A;  4Q48 A;  2HFH A;  4A0Z A;  5LBQ A;  1DP7 P;  1G3T A;  4MHG A;  4KMU X;  4AWX B;  3K1M A;  3KP7 A;  3WG9 A;  3KP2 A;  4L0Y B;  1OYY A;  3RDI A;  5D5X B;  5K1Y A;  2QYO A;  4KIF A;  4D0P A;  4FX4 A;  2QWW A;  5D6F A;  2FMY A;  4L9J A;  1D8J A;  3HRM A;  3I4P A;  4M6Y A;  2LF8 A;  2PBI A;  1W7P B;  3KZY A;  3ZMZ A;  4XLP F;  3MCZ A;  1J2X A;  3E6D A;  2EB7 A;  1P92 A;  3H3Z A;  2W57 A;  3LAJ A;  3BZ6 A;  1TNT A;  3KE2 A;  3P9K A;  1HSJ A;  1JHF A;  2OBP A;  1HQC A;  4HBL A;  1ZG3 A;  2D1H A;  1LDJ A;  2HS5 A;  1S3J A;  5JI6 A;  1E2X A;  1MKM A;  4EJT A;  4HX4 A;  4GCV A;  3V8J A;  1T38 A;  1XGN A;  4MTD A;  1K7A A;  1KU7 A;  4UVC A;  3D5L A;  1OPC A;  5LEJ A;  3IHU A;  4KIG A;  2KIF A;  4AVP A;  1I1S A;  5L3C A;  1WI9 A;  3FMR A;  3WGH A;  1RNL A;  2MD5 A;  2MH2 A;  4HF1 A;  1BM9 A;  1FSH A;  5L3D A;  2FBK A;  1KU9 A;  4ZYE A;  2ESN A;  1TQI A;  2PQ8 A;  4HLY A;  3K1P A;  2FE3 A;  3I64 A;  1RZ4 A;  2L54 A;  1O3Q A;  3Q9S A;  2RKH A;  3RIR A;  1IN6 A;  2DQL A;  1YIO A;  1ZGA A;  2ZBK A;  2FNA A;  1J0R A;  2GXB A;  2FBH A;  2ADU A;  1UCR A;  5FLX Z;  1V4R A;  1YQA A;  3TDU C;  1IUY A;  2KRF A;  3GX4 X;  4P55 A;  2IW5 A;  5L3B A;  4MEX F;  2M5W A;  3AAF A;  2ACJ A;  1Z6T A;  2KJC A;  5IT3 A;  1MGT A;  1STZ A;  4M73 A;  4RB0 A;  1FP1 D;  3LA7 A;  2ESH A;  4ETS A;  3MFK A;  1ZAR A;  2EA2 A;  4WK8 F;  3E5Q A;  3HOS A;  3GFI A;  2XRN A;  4XSZ F;  1T2K A;  2HYG D;  4WXC A;  2HKO A;  4WX9 A;  3FHZ A;  1WRJ A;  3WTW C;  2MLG A;  2VXZ A;  2VOD A;  1FC3 A;  5HDK A;  4L5J A;  5HS8 A;  2EV6 A;  3J80 K;  5LLQ A;  1OKR A;  1ZG5 A;  2FA5 A;  2ZNY A;  5D8L B;  1XCB A;  4KUM A;  4YII A;  1W4M A;  3VOE A;  4A6E A;  1UST A;  1T6S A;  3JTG A;  2HZT A;  4P9U A;  3ZMU A;  4I7H A;  2V1X A;  3QAH A;  3CO6 C;  4EJO A;  2VON A;  1Z7U A;  4F7Z A;  1QBJ A;  2M87 A;  3RTR A;  2KIM A;  2BYV E;  5FB2 A;  2J5P A;  4R1H A;  2WV0 A;  3ULQ B;  3M1E A;  1ZRD A;  3E3V A;  3U9G A;  5DUI A;  3PFI A;  3DXJ F;  1CF7 B;  2F5E A;  1YW7 A;  3GO5 A;  1UHW A;  3COA C;  2XUB A;  3KCC A;  3M9A A;  2HTJ A;  3N4M A;  2PMH A;  1MZB A;  3WTY C;  2A6E F;  1P2F A;  4LFU A;  2DK8 A;  3ZMS A;  3F6V A;  1OYW A;  1S8N A;  1OMI A;  4S04 A;  5DD4 A;  4ESB A;  2QUF A;  5F1R A;  4RB3 C;  2DO7 A;  4EJW A;  3P9C A;  4FT8 A;  3E6B A;  3ECH A;  1O3S A;  2P6T A;  1PP8 F;  4RAY A;  1B9N A;  3CDH A;  1WQ2 A;  2YX4 A;  1U78 A;  4YG2 F;  2A68 F;  3BJ6 A;  4U0V A;  2CYY A;  3TQN A;  2ISZ A;  5LHH A;  2VBY A;  3ABT A;  3R61 A;  4Q4Z F;  1FYK A;  3KFW X;  2QZ8 A;  3RKY A;  5FFX A;  1F1Z A;  3ZN0 A;  4MQ9 F;  5CVR A;  2MLK A;  4HQE A;  2M1B A;  4IRI A;  4RGR A;  2RN7 A;  2E1C A;  1F9N A;  2HR3 A;  3HSR A;  1JE8 A;  1W7P A;  3NQO A;  4XBF A;  4LG0 A;  1U5T C;  1AWC A;  2X0L A;  4U88 A;  1FOK A;  2STT A;  1MJB A;  4IXA A;  2ISY A;  4A0X A;  5CVI A;  2G9W A;  4LLG F;  2XAQ A;  2COM A;  4KIC A;  4EM1 A;  5E1Z B;  1EV7 A;  3GW2 A;  1BI0 A;  4LK1 F;  3BJO A;  2P6S A;  1YW8 A;  2PI0 A;  3K1N A;  4NHJ A;  2D1V A;  4ESJ A;  4I2O A;  1I1G A;  2A5Y B;  2XAS A;  2GAU A;  2RDP A;  2JZY A;  4LLN A;  1LEB A;  1BJA A;  1W5T A;  1MJ9 A;  1A04 A;  3RKW A;  3CO7 C;  2DT5 A;  1FY7 A;  2Q0O A;  1G4D A;  1ZRE A;  4KDP A;  1XD7 A;  3L09 A;  2STW A;  1IZ1 A;  2XRO A;  4XRF A;  3D0S A;  1D3Y A;  5DV5 A;  1HBX G;  5HVQ C;  5CYV A;  2FRH A;  2EJR A;  2HYF A;  2L4M A;  3I5U A;  3E97 A;  1FT9 A;  2V6C A;  2O61 A;  4R8H A;  5FFZ A;  5CLS A;  5H6R A;  2OQG A;  4BHB A;  5D5V B;  2FBI A;  5BS6 A;  3RYP A;  5HLH A;  3DEU A;  5ILS A;  4WF2 A;  5D5W B;  2XV4 S;  5CJ9 A;  2K7L A;  4B09 A;  3B02 A;  1B1B A;  2NNN A;  2K27 A;  2D45 A;  3V7C A;  1TTY A;  3VFZ A;  5ILU A;  4ZYH A;  2DFI A;  4LLL A;  1R22 A;  2UZK A;  5BMZ A;  3GWZ A;  1ZGJ A;  2DPU A;  5E17 F;  3ZMD A;  1XMA A;  5J6X A;  1R00 A;  2PG4 A;  2P5L C;  2E7X A;  3W6J B;  4QWQ A;  2RNJ A;  3TO9 A;  2W84 A;  1YLF A;  3MWM A;  1WWX A;  4ENJ A;  3GXO A;  2HQR A;  3IKV A;  1ON2 A;  3BRO A;  1FZP B;  4BHC A;  1B59 A;  3HTS B;  1S6L A;  3WTS C;  2F5D A;  5ICF A;  1U6G A;  1JGS A;  2DI3 A;  1ULY A;  2UXX A;  1LVA A;  3VB2 A;  5FD5 A;  3T8T A;  4JBA A;  1SD7 A;  3FXR A;  1B6A A;  2A07 F;  1R7J A;  5FD6 A;  2GXG A;  3I59 B;  1CF7 A;  4OU0 A;  1BOA A;  2PN6 A;  3GVA A;  1QZZ A;  3WGI A;  2ZME A;  2FSW A;  2Y75 A;  4G6Q A;  1U3E M;  3R0A A;  2Z99 A;  3LA3 A;  2QEN A;  4N0B A;  2A69 F;  5K5R A;  4EMS A;  1O3R A;  2ZKZ A;  2Z9O A;  1WKM A;  2AS5 F;  5HLI A;  2IJL A;  3FMQ A;  2OZU A;  4K2E A;  4RS8 A;  4A6D A;  1P4A A;  2GWR A;  1L0O C;  2DAO A;  2P5K A;  1ZYR F;  4RB2 C;  5JVT A;  2GA2 A;  1X3U A;  5J8C A;  2XHK A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...