3U1DA

The structure of a protein with a gntr superfamily winged-helix-turn-helix domain from halomicrobium mukohataei.
Total Genus 51
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
51
sequence length
148
structure length
148
Chain Sequence
MATQDRGERPNGFGDELERRRFVLHETRLDVLHQILAQPDGVLSVEELLYRNPDETEANLRYHVDELVDRGIVEKIPVPRAKSVDDPPTTFYAVTGEGIALLRAVSMYEEAAVWRSVYEQMERTDRIEAIENLETRPDVDYESRGATA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The structure of a protein with a GntR superfamily winged-helix-turn-helix domain from Halomicrobium mukohataei.
rcsb
source organism Halomicrobium mukohataei
molecule tags Structural genomics, unknown function
molecule keywords uncharacterized protein
total genus 51
structure length 148
sequence length 148
chains with identical sequence B
ec nomenclature
pdb deposition date 2011-09-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF12840 HTH_20 Helix-turn-helix domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 3u1dA00
1S7AA 5CYVA 1CGPA 4LLLA 5IT9K 2QQ9A 3QPTA 4XBFA 3RIRA 2PBIA 2L3DA 4U0VA 3ZMDA 2HOEA 3MQ0A 3COAC 1V3FA 3E6CC 4YG2F 2DW4A 3H92A 3KP6A 1XB4A 1L3LA 2FNAA 3K1NA 2ADUA 4A0XA 2ZBKA 1T39A 4EVIA 1FYMA 2QLZA 4OMZA 4FX4A 3C3WA 3JTHA 1B4AA 1U2WA 2R7FA 3BWGA 1K78B 3LQRA 1R36A 3P7NA 2IPQX 3M9AA 3W6KB 1OYWA 5LGTA 3IKTA 3DP7A 2L54A 1QBJA 2VODA 3C18A 1BI0A 3BJ6A 1MGTA 1BI3A 1SD7A 2WC2A 2EK5A 3GUDA 3BZ6A 5IT9Z 4KN7X 4ESBA 2JPBA 5BS6A 4BHCA 1T38A 2BEOA 1ZYRF 2CFXA 3GZ5A 5EEGA 4A5NA 3PFIA 3I53A 2V1XA 1MJAA 1T98A 4AIKA 1G3WA 2VT3A 2HEOA 2HYFA 4XSZF 1O7FA 2STWA 2UZKA 1FBSA 1YW9A 3I4PA 1S29A 3PQKA 4RGXA 5FGMA 4ETSA 3DXJF 1WI9A 2TDXA 2XASA 2ETHA 2E1CA 1KYWA 1U3EM 4P9UA 2D45A 1OMIA 2Z99A 2Z5UA 2MH2A 3K69A 1WKMA 3OV8A 2P5VA 4KFCA 1TQPA 3P9IA 3L9FA 4IJAA 3GZ6A 3HSFA 2FE3A 3K1MA 2H27A 4OU0A 3TO9A 3ECOA 3MAJA 4LLNA 3KFWX 3LSTA 1YQAA 1SFUA 2EFOA 2PEXA 2QENA 5HDKA 3ELKA 1PP8F 1IRGA 3VFZA 1IXSB 4U7DA 3WTZA 3DEUA 2HKOA 5CJ9A 3ULQB 1FYKA 3E5XA 3KCCA 2XV4S 1Y0UA 4GGGA 1W5TA 3T8TA 2EB7A 3DKWA 2QWWA 5LEKA 1U78A 1IXRC 2FRHA 2UXXA 2ZO4A 5DD8A 2LNBA 1YS6A 1OR7A 2IA2A 1GXQA 1LB2A 3CO6C 3WTYC 5BPIA 3WG9A 1REPC 1J59A 1MDMB 1TTYA 2H6BA 5D5WB 4KMUX 3T1BA 5E8GA 1HQCA 3JSPA 1DP7P 2W24A 4KIGA 3MFKA 3RTRA 2W57A 2QUFA 5KK1A 4XLNF 1ZG5A 3VB2A 3ZP5A 2F5EA 1BN5A 1W7PD 4UV8A 2STTA 2JPCA 2K7LA 2OZUA 4UVBA 5J8CA 3QU6A 2LF8A 3WODF 2EV5A 2IP2A 1XSVA 1DPRA 5FB2A 1J2XA 2HGCA 3GO5A 3QU3A 5HDGA 1IXCA 2GZWA 3FM5A 1XSXA 4A0ZA 3ECHA 2VBZA 2YU3A 1QZYA 5K5RA 1HKQA 3BROA 1HW2A 3HTSB 4BH9A 3QOPA 4G94A 3HTUA 5CVRA 5ILUA 3RI4A 1WRJA 2E1NA 4ESJA 2YPRA 5FLXZ 5D5UB 2P5LC 5E20A 3PQJA 1FBQA 4ZH4F 3RYRA 5DCMB 2CWEA 1QGPA 2FOKA 1WWXA 4LGWA 3D0SA 4DQ2A 1J9IA 2CG4A 2VE9A 2JSCA 2FMLA 1FT9A 1FP2A 1UCRA 3GXOA 2A69F 2HQRA 4CZZA 2XRNA 3OOPA 3E5QA 2NYXA 2VOPA 1B59A 2VOOA 1SFXA 3WTXC 1T0FA 2M87A 3R0AA 2O3FA 1OYYA 3KP4A 1P4AA 4UUVA 2IVMA 4EGYA 1YIOA 3FF5A 1IZ1A 2FBKA 1KQ8A 5LHIA 3F23A 3F8BA 1BIAA 5E1WA 1IAWA 3GLXA 3VOEA 2ISYA 4S05A 3I58A 1IF1A 1P2FA 3LA3A 2LKPA 2P7VB 3GFIA 1JGSA 1UB9A 3BY6A 1ZAOA 4BHPA 3TO6A 3WE3A 4KYWA 1T2KA 2YR2A 1W7PA 4LB6B 4WF2A 1ZG1A 3REOA 3HUGA 4U88A 3N97A 2VBXA 4EQQA 4A0YA 2D1VA 2RVCA 3WE2A 1ZHFA 4IHSA 1AOYA 4HV5A 1XN7A 1SD4A 3KETA 3JAMK 2JTVA 2BYVE 2XHKA 1G4DA 3LQQA 2NAZA 3WTUC 4R79A 2ZFWA 1R1TA 4UNOA 2VONA 3LFKA 4ZYHA 1XD7A 1LQ1A 5CVJA 1Z05A 1S6LA 2F5DA 3HOTA 1WSUA 3TOBA 1R22A 2O0YA 4UXNA 5K5OA 1AWCA 3F6VA 3F8CA 4ENJA 1QZZA 4XLPF 3BOQA 2ESHA 2EA2A 1SMTA 4PGGA 3I54A 4HX4A 2UXNA 2VE8A 4EM2A 3B73A 3O2PE 4UVAA 4JK1X 2RQPA 4G9YA 2FEZA 3GVAA 4BHBA 1RUOA 4LD5A 2W25A 5AONA 1OKRA 1ON2A 1D3YA 5AIPA 4L9TA 2YSRA 1NHAA 3RKWA 1HW1A 1XCVA 3J81Z 2IA1A 5ILSA 4GXOA 3KE2A 4HW0A 1FP1D 4A5MA 1XDUA 2KIUA 2UWMA 4RB3C 2B0LA 2MLGA 1Z6TA 3F8FA 1ZRCA 1W4MA 2DT5A 4LJZF 3CUOA 3KLNA 3S2WA 4JBAA 5HS9A 4I0BA 4N0BA 4MEYF 4KICA 1ZLKA 1VTNC 1Z9CA 3IL2A 3E6MA 2BE5F 5E18F 1USSA 3EETA 2CSOA 1O3RA 3M7GA 5CVUA 3T5XA 2ZMEA 4O3MA 2K02A 3KZZA 3T0YA 1JHHA 5ERIA 3D5LA 1LDJA 3G73A 5DV5A 1UHWA 4CHUA 2HWVA 2A07F 3HHGA 3W6JB 3I59B 4AD9A 2DO7A 4ENMA 4Y13A 1UHMA 4M9ZA 4MEXF 2PMUA 1I1SA 4HDUA 3WTVC 4A6EA 4N9IA 3WGIA 2GXBA 1FPQA 2A6EF 3I71A 6PAXA 4HLYA 1XMAA 3RPUA 2A61A 2FSWA 3H3ZA 1R58A 3F8NA 3G3ZA 3GX4X 4EM1A 1BI2A 1R00A 4PZJA 2W84A 2EFQA 2DTRA 1O3QA 1RUNA 2ESNA 2GXGA 1LVAA 2DAOA 3I5UA 4RB2C 3VODA 2JZYA 1SFEA 3TQNA 2LDUA 2EFPA 5DUIA 3J80K 2QBYA 5K5QA 2XVCA 2PI0A 1O7LA 1FNNA 1ZN2A 3FM3A 2Q2EA 1D5VA 4CICA 4EJOA 2PLYA 5FLXK 1KGSA 3NQOA 3R60A 4F7ZA 1Z7UA 1HXDA 3FXUA 3WTSC 4U0YA 3BJAA 2KKOA 1EH7A 3K2ZA 4BYYA 1DDNA 4RGUA 1KU7A 5BQTA 4ASNA 2WWYA 1IUYA 4P96A 2VBYA 4M74A 1U6GA 1BOAA 3FZVA 2JRTA 2JT1A 2FBHA 5D4RA 4CYDA 1A04A 2IW5A 2FQ3A 1HBXG 4I2OA 3DPTA 4CDGA 3SZTA 2OQRA 5A2QZ 4Y15A 3JW4A 1GXPA 2VC1A 1TQMA 2GIVA 4LG0A 3TKYA 1IN4A 1YFHA 2F5CA 5HLHA 4EGZA 5FFXA 3Q5FA 1LDDA 1XMKA 1PDNC 2ZJ2A 5HS8A 4A6DA 2DPDA 3TO7A 4ON0A 2PN6A 3H3UA 1V4RA 3R0JA 4BQAA 2K4JA 2KJCA 4IRGA 1QQIA 4R1HA 1FYLA 2K4BA 4KN4X 4UHTA 3RPQA 4EMSA 1H9GA 3B02A 3HRSA 2MBFA 2GQQA 4I01A 2CW0F 4A12A 4M73A 4HBLA 2DQLA 2MLKA 5E1ZB 1RIOH 3WTTC 3L2CA 1ONVA 4IPAA 2XKPA 1ZRDA 3IHUA 1G3YA 2PG4A 4HDVA 4OIOF 5FD5A 3O3KA 1I27A 1K79A 2VC0A 4I0AA 4HLXA 2HQNA 2OD5A 1RZ4A 2PFBA 1S3JA 3VEPA 4NB5A 4OIQF 2XAJA 4M72A 4RGSA 4LLGF 5LLQA 4B09A 1F4KA 3E3VA 2M45A 2HTSA 5HLIA 1YW7A 3EDPA 1U8RA 2FU4A 2IJLA 5ICGA 3IRRA 2PQ8A 4KIBA 4QWQA 2MH9A 3L7WA 4M9XA 2EJRA 2X0LA 3CUQC 4IF4A 4HV6A 2P6SA 3Q9SA 2V1UA 3GWZA 2HFHA 4NHJA 3LA7A 2EV0A 3L09A 4CGZA 4OIPF 1TNSA 3IKVA 4I02A 1FSEA 3R6SA 2G7UA 4IXAA 4PDKA 3ZMUA 1R1VA 3FMQA 3BPVA 4CO8A 3K0LA 4Q4ZF 1TW3A 3L00A 2CYYA 4EJVA 3J7AO 4AIJA 2VN2A 2R3SA 2DBBA 4CXFA 3J81K 2VT2A 4HA8A 3M8EA 3ABTA 4LMYA 5CVVA 1D8JA 2RGVA 2M8EA 5DUKA 5J8FA 1LEAA 2ACJA 1K78A 1P4WA 4KT5C 3RKXA 3EQLF 4PCQA 1MZBA 1LNWA 2IRFG 4ZZLA 4RB0A 1F9NA 1ZARA 1ZGAA 5JVTA 4Z2YA 2RNJA 2Y0MA 3NRVA 2XGXA 5E17F 3TOAA 1U5TB 4HYEA 2IT0A 4L0ZB 4Y17A 5A2QK 3V8KA 2QVOA 1STZA 2QQAA 2P5KA 3V7CA 4MQVA 4Q47A 4HQEA 4IRHA 3K1PA 3FX3A 2P4WA 1Z1DA 2BGCA 3LAJA 1XGMA 4GYGA 3RKYA 3WTWC 3WU1B 5LHGA 1E2XA 1FOKA 2H6CA 2X4HA 2F5FA 2Z33A 2FMYA 1DUXC 2GA2A 2KIMA 2O8XA 3GFMA 4XSXF 1Q1HA 5CLSA 5DCFA 1KQ0A 2CGPA 2AS5F 2RKHA 3CLOA 2NNYA 4PGHA 4GYIA 1O3TA 5IT3A 5FFZA 2L4MA 2XAFA 2KJBA 1ODDA 2A6HF 3ISPA 3QP6A 1ZLJA 1T6SA 2HS5A 3MCZA 3CJNA 3GFLA 3KP2A 3O6BB 2V9VA 2NS0A 2O61A 5F6FA 3M1EA 4MQ9F 2HDCA 1DPUA 4AVPA 1CF7A 5HS7A 1MD0A 2COMA 1BIBA 2OQGA 1W5SA 3R4KA 1LJ9A 2DLLA 5LGNA 1FY7A 3SHFA 5DEQA 3BDDA 5JI6A 2RDPA 3N4MA 4AIHA 5ICCA 1KU2A 1QNTA 1FWZA 2IA0A 4TV7A 2RN7A 1EH6A 4RAYA 3JAMZ 4RB1A 2M1BA 1KU3A 4YIFA 3CDHA 1I1GA 1EV7A 5F1RA 1TNTA 1UFMA 1R7JA 3V8LA 4L9VA 4YFKF 1J7KA 2G7HA 4WX9A 1L0OC 3E5UA 3CUQA 3JTGA 4MGRA 5LRSA 2M5WA 1XGOA 4R8HA 1P6RA 5CVIA 2A68F 2OU2A 4L0YB 2K27A 3GEZA 1H9TA 5L3FA 3TDZC 2D2WA 1LEBA 3HRMA 3AAFA 4KIFA 2XROA 1YTYA 4WXDA 4D0PA 2KIFA 3TDUC 1YYVA 2AXLA 2GAUA 4WCGA 5KVRA 5ICFA 4L5IA 3IRQA 1YLFA 2L4AA 3ERED 4M9SA 3ZPLA 4FHTA 4A2UA 4L9JA 5BPDA 1EH8A 4S04A 5D6FA 1KA8A 3F3XA 2DPUA 4GCVA 1XCBA 3EUHA 2QQBA 1BM9A 1FX7A 5FO5A 4HF0A 1IW7F 4O6JA 2NNNA 2YX7A 2E7WA 4LK0F 1U5TC 2Z9OA 1S8NA 1XGSA 1HKSA 3E6BA 5D5XB 1CF7B 1BBYA 4UV9A 3EYIA 3EYYA 1YO5C 4UVCA 1KQ9A 3ZMVA 2W85A 3QPHA 2GWRA 3IWFA 2OZ6A 2HTJA 4M6YA 3GYHX 3BJOA 5L3CA 4KMFA 3Q9VA 1MJ9A 3BP8A 3KP5A 1QPMA 2FXAA 2XAGA 2ZNYA 5L3BA 1XSDA 3C1DA 1R5HA 3U9GA 4I98B 1TBXA 3DQVC 2D1HA 3U2RA 2VXZA 2HYGD 2XUBA 4OMYA 3J80Z 1WQ2A 2EV6A 3V7RA 4FT8A 4ZZDA 1IN8A 1TW2A 3DFGA 1O57A 3KEOA 4LG0B 1BC7C 1OYIA 1GVJA 3FXRA 2LF7A 3ML6A 2H09A 1ZGJA 1P4XA 2HZTA 3SXYA 3ZMTA 4ENKA 3KP7A 5DCMA 1U5TA 1ULYA 4G7ZF 4WWCA 3F21A 1PP7U 1B1BA 1F5TA 4RAZA 4Q48A 4BNCA 5BMZA 2ZKZA 5D6EA 5DD4A 2EFNA 2Q0OA 5BOXA 3HSRA 5H6RA 3ABUA 2ZCWA 3FMSA 5JR3A 1SD6A 1S7OA 5D8LB 3CUQB 1FLIA 3C7JA 3ZQ7A 5FD6A 2NRAC 1G3TA 2FF4A 4KUMA 1FBUA 4OINF 1LDKB 5K1YA 2QBYB 5E1XA 3HIFA 4HOBA 5LEJA 5DDGA 3SFZA 4G7HF 4NQWA 2MA3A 3V8JA 2DI3A 1ON1A 4YFXF 4YIIA 1YS7A 4YFNF 1ZH5A 4BXUA 5J6XA 3WGHA 4JQFA 2V79A 3ZN0A 1E17A 1K6OA 4L9NA 1B6AA 4HX7A 2M30A 4AWXB 4LB5A 5TJJA 4HX8A 3CO7C 2PMHA 2CQKA 1B9NA 3HYIA 1RI7A 2K86A 4LFUA 4G6QA 1ZG3A 1X3UA 3V4GA 1KU9A 3F72A 1I6XA 4HQMA 4B8XA 2E7XA 5L3DA 4FX0A 2XAHA 3FHZA 4E70A 5L3EA 1OPCA 3MWMA 1HKTA 3R61A 3QAHA 4O5VA 3HSEA 2XAQA 2DK5A 3RJPA 3DF8A 1HSTA 1GHCA 4Q5SF 2VBWA 3F22A 2V1DA 2HR3A 1HSJA 1P92A 3MEXA 1R1UA 3FXQA 2L01A 4I09A 5HLGA 1W7PB 1MKMA 4KNYA 2Y75A 4HZFA 4L5JA 3LAPA 5LBQA 3LA2A 4EJTA 3K9TA 4GO1A 5ED4A 4P9FA 4MNUA 1BC8C 2XIGA 4EJWA 1D8KA 2Y48A 2QZ8A 5F64A 3SQNA 4LK1F 1YW8A 4IHTA 5D5VB 3I64A 3KLOA 4MTEA 2PJPA 1R5GA 4HF2A 1JHFA 2KRFA 1K7AA 4MTDA 1TQIA 3WU0A 2A3SA 3BPXA 2DFIA 1MJBA 5TRDA 2P8TA 3P9CA 3KP3A 1IN6A 5HOOA 2RV8A 3QP5A 3I0TA 2R7DA 4N9HA 4IRIA 2ZXJA 2MD5A 1MDMA 2EFWA 4RGRA 1TLHB 5L3GA 3MZHA 2Z3YA 1J0RA 4WXCA 4U7BA 2L02A 3ZMSA 4P55A 1FSHA 4I7HA 4H0EA 5JHUA 4G6DA 1FC3A 2ZMEB 5LHHA 5H20A 4KDPA 3IWZA 4U0WA 3RYPA 1ZRFA 5ILVA 1USTA 2CO5A 3V7SA 1FZPB 2OA4A 1ZREA 2ISZA 2LSOA 5H6QA 4ZYEA 4XRFA 1IN7A 2V6CA 3ROUA 2J5PA 3HHHA 3CTAA 4EM0B 1J5YA 1R23A 3MZYA 1JE8A 3GF2A 3HOSA 2FA5A 1XGNA 4P5OA 5D4SA 1HW5A 4K2EA 3TGNA 5EEHA 3FWEA 3KEQA 4MHGA 4HAMA 3RDIA 1SD5A 3WGGA 4WK8F 2QM3A 2ZNZA 4DNCA 2YX4A 2FBIA 1BI1A 2P7CB 2O6GE 2OBPA 2OAZA 1SMYF 4ZYDA 3ZN1A 1KYZA 5LGUA 2BBYA 2HKXA 4EV0A 5LRRA 1BJAA 4ESFA 3E97A 3P9KA 1Z6RA 4HF1A 4WXHA 2GA1A 1G6NA 4G7OF 3DPLC 2H94A 4L18B 1PUEE 2BV6A 2XKOA 3KZYA 2O03A 5DYMA 5ICEA 3GW2A 3DV8A 2DU9A 3E6DA 1YG2A 2G9WA 4OIRF 1I5ZA 3NEUA 4BAYA 2C6YA 1O3SA 2MC3A 4KA4A 3F8MA 3I59A 3HRTA 4OOIA 2ELHA 1IN5A 4ENNA 1JXSA 3HRUA 1B9MA 3LWFA 5HDNA 5HVQC 1G3SA 3M8FA 3QRFF 1QO0D 4RS8A 4M71A 4ZYGA 4M6XA 1Z91A 3F6OA 2A5YB 5E8IA 1RNLA 2P6TA 2WTEA 3T8RA 2RC4A 2FNPA 5JFRA 2DQRA 3GFJA 2WV0A 2J5OA 4EJUA 2Q8KA 1F1ZA 1IRFA 3ZMZA 2F2EA 2DK8A 1C0WA 1XDSA 3IC7A 1SAXA 4IVNA 1H0MA 4QLCU 3FMRA 2EA4A 5AIQA 1J75A 3SZPA 2EWNA 5D8KB 2QYOA 4G8XA 3U1DA 3JSOA
chains in the Genus database with same CATH superfamily
1K6YA 1S7AA 5CYVA 5E3MA 1CGPA 4XK4A 4LLLA 1R4MB 5M5XJ 3DU6A 5IT9K 3KEYA 2QQ9A 3QPTA 4XBFA 4F91B 1OCZH 2R5YB 1YRNA 3RIRA 3RKQA 2PBIA 2L3DA 4KT6A 4U0VA 3ZMDA 2HOEA 4FCYA 3MQ0A 3COAC 1V3FA 3E6CC 4F52A 3DEWA 4YG2F 2DW4A 3H92A 3KP6A 3G4SI 1XB4A 1TWFJ 1L3LA 2FNAA 2XF7A 3LL7A 4AUXA 3OSGA 2HYJA 3K1NA 2ADUA 1TWCJ 4A0XA 2ZJRF 2ZBKA 2L9SA 1T39A 1LE8B 1RRJA 2QSGX 4EVIA 1FYMA 2R7QA 2QLZA 4HPQA 4OMZA 1VQOI 2AO9A 3JR9A 3Q3SA 4FX4A 1VQ9I 5E3LA 3C3WA 3JTHA 1B4AA 1U2WA 3RZOJ 2R7FA 3BWGA 1AA7A 5KNLA 1K78B 3LQRA 5B5EC 1R36A 3W2VA 2WY7Q 3P7NA 2IPQX 3M9AA 3W6KB 1OYWA 1E3HA 1GV2A 1X2NA 5LGTA 3H9JA 3IKTA 4IZZA 1K61A 3DP7A 2KZVA 2L54A 4CYCA 1QBJA 3HOYJ 2H8WA 2VODA 4HSRA 3C18A 3OIOA 1BI0A 1MBJA 3BJ6A 1MGTA 2XSJC 1BI3A 3G6EI 1SD7A 2WC2A 5E3OA 2EK5A 3GUDA 3BZ6A 3CCLI 4KN7X 5IT9Z 3IH3A 4ESBA 2JPBA 5BS6A 4BHCA 4PSXA 1T38A 1K4TA 2BEOA 1ZYRF 2CFXA 4FETA 1IGNA 3GZ5A 5EEGA 2YS9A 4A5NA 5KAIC 3PFIA 3I53A 2V1XA 2X1EA 1MJAA 1T98A 4OAYA 4AIKA 2CUZA 1G3WA 3BG7A 1SVOA 2VT3A 2HEOA 3JCUC 2HYFA 4XSZF 4J00A 1O7FA 3CMMA 2STWA 3PNVA 4E7IA 2ZC2A 2R7XA 2UZKA 1PVEA 2QEXI 1FBSA 1YW9A 1VF9A 4ZTFA 1DGRM 3I4PA 1MBFA 5EJCA 3TW6A 1D1BA 1S29A 3PQKA 4RGXA 2HOSA 5FGMA 4ETSA 3DXJF 1WI9A 2TDXA 2Q1ZB 2XASA 2M34A 4OAZA 4PFPA 2OC6A 2ETHA 1KYWA 2E1CA 2Y30A 1U3EM 4CYCB 3HL2A 1SC7A 2KQRA 4BE1A 2M4GA 4P9UA 5EZGA 2D45A 1JGGA 1OMIA 4NC7A 2IS4A 1WH7A 5K7ZA 4BE0A 1D0ZA 2QQ8A 2Z99A 4N4OB 2Z5UA 2MH2A 4XONA 3K69A 5GTIC 2DMNA 2PJRA 2TRTA 1WKMA 2QKLB 2VKVA 3OV8A 1TWGJ 2Q2EB 5F27A 2P5VA 1X3ZB 3TMOA 4KFCA 1Z0XA 3BC8A 1TQPA 3P9IA 3OL3A 3L9FA 4IJAA 2RAEA 3GZ6A 2RREA 3DKXA 3HSFA 3LSHA 1D5YA 2FE3A 3K1MA 2H27A 3OYMA 4OU0A 4BBSJ 3TO9A 3ECOA 3MAJA 4ZDOA 1WJFA 4LLNA 1VQ4I 3G2BA 3PFYA 3KFWX 3QPLA 3LSTA 1YQAA 2JSPA 1SEUA 1SFUA 2EFOA 2PEXA 2QENA 5F1JA 5HDKA 3ELKA 5FJ8J 2PMZN 4W97A 5E3NA 1PP8F 1IRGA 3VFZA 1IXSB 4U7DA 3WTZA 2OJED 1TZLA 1WH5A 3DEUA 2HKOA 5CJ9A 3ULQB 3ZQCA 1WJEA 2L7KA 2QGUA 4DOZA 1VQPI 1FYKA 4DZJA 3E5XA 3KCCA 3HKZN 1QA6A 2GXAA 2XV4S 4XQFA 1Y0UA 2JA5J 3PNTA 4GGGA 4PSWA 1W5TA 1Z3XA 1SANA 3T8TA 2EB7A 3DKWA 2BVMA 2BHZA 3K4BA 1BL0A 2QWWA 2IBDA 3HM5A 5LEKA 1U78A 1IXRC 4BE2A 2A5WA 2FRHA 2UXXA 3CDIA 2VKHA 2ELJA 3AL0C 5GPCA 2ZO4A 5FROA 5DD8A 2LNBA 1YS6A 1Y56A 3K70C 1OR7A 3BQZA 1VQNI 2IA2A 1QHGA 1YE9A 1GXQA 1KZHA 1LB2A 3BT9A 2XB0X 3CO6C 2KIQA 3WTYC 2OPTA 2OCEA 4QIWN 3CMAI 5BPIA 3WG9A 1REPC 3SYTA 1J59A 3DBHB 1IC8A 1MSEC 1MDMB 4M3DA 1TTYA 2H6BA 3H0DA 5D5WB 1HC8A 4KMUX 3T1BA 4IKFA 5E8GA 1HQCA 3JSPA 1DP7P 2W24A 4JX6A 3HEFA 3BCBA 3ZCOA 4KIGA 2CU7A 3MFKA 3A01A 2R0QC 3RTRA 2W57A 2CFOA 3JRIA 3WG7H 3S16J 1FMVA 2QUFA 5KK1A 4XLNF 2DMQA 3BG3A 1ZG5A 4DZPA 4FISA 3VB2A 5FLMJ 3ZP5A 2F5EA 1BN5A 2HNHA 1W7PD 4UV8A 2M7AA 1O4XA 3FBNB 2JPCA 2STTA 2K7LA 2OZUA 4UVBA 5J8CA 4FE4A 3QU6A 1FMWA 2LF8A 3ZRGA 3WODF 3DTIA 2EV5A 2IP2A 4F92B 3JRHA 4S0HB 1XSVA 4KISA 1ITYA 1DPRA 5FB2A 3M4OJ 2ECBA 1J2XA 4HNTA 3S3MA 2HGCA 3GO5A 1Y39A 3M8JA 3QU3A 2QCOA 5HDGA 4NC6A 3OMYA 3S14J 1IXCA 2GZWA 3FM5A 2QF7A 3TL4X 5J40A 1XSXA 4IO9F 1LVKA 1IRZA 4A0ZA 1ETKA 3W2WA 3ECHA 2VBZA 1K6OA 2YU3A 1QZYA 5K5RA 4ZYAA 1P7IA 1IDZA 3Q0WA 3G1MA 3KZIC 1HKQA 3BROA 1HW2A 3HTSB 4BH9A 2H1KA 1MBEA 2V4JC 2W1OA 3J7YJ 3I55I 4I99C 3QOPA 5IP9J 4G94A 3HTUA 4HNVA 2IGKA 5HODA 5CVRA 1DU0A 2L9VA 5ILUA 2HXIA 3RI4A 3CP8A 1WRJA 2E1NA 4QSHA 2M7BA 4ESJA 5C44J 2YPRA 5FLXZ 5D5UB 3MKYB 2P5LC 5E20A 2HZDA 3PQJA 1FBQA 4ZH4F 3D5SC 3RYRA 5DCMB 2CWEA 2LY1A 2X6OA 1S72I 1QGPA 2FOKA 3LSMA 1WWXA 4LGWA 3D0SA 4DQ2A 1J9IA 2CG4A 3ABLH 4B48A 4L5EA 2LBFB 2JSCA 2FMLA 1FT9A 2VE9A 1FP2A 4IHVA 1UCRA 3GXOA 2A69F 2HQRA 3AKZA 3TP3A 4CZZA 2F4OB 1ZK8A 2DFHA 3GTJJ 2XRNA 3OOPA 1ZGWA 2E34A 3E5QA 2NYXA 2VOPA 1B59A 2VOOA 4IEJA 1SFXA 2CUJA 3HXLA 5CPRB 1NH3A 2AXTC 5IP7J 3WTXC 4II2A 1T0FA 2M87A 2L0KA 2VQLA 1OFCX 4V2FA 2VQCA 3R0AA 2O3FA 1OYYA 1MBKA 3LSPA 2KP6A 2R7OA 3ZQIA 2E1MB 1VQ6I 3KP4A 1P4AA 4UUVA 2IVMA 5EGOB 4EGYA 2LY2A 1S9HA 1HLVA 1YIOA 3CCUI 3FF5A 3AFHA 1IZ1A 2FBKA 3S93A 4QPOA 4IHWA 1KQ8A 5LHIA 3F23A 3F8BA 3HZJA 1BIAA 1RPWA 5E1WA 3OOUA 1IAWA 3GLXA 3VOEA 3GTGJ 2ISYA 4S05A 3CJTB 3I58A 4XKCA 2NOJB 1IF1A 1P2FA 2UUZA 1B72B 3LA3A 3VSKA 2LKPA 2P7VB 1Z7LA 3GFIA 4M3BA 1JGSA 3X2QH 2E5ZA 1H8AC 5IPAA 1UB9A 3OYAA 3BY6A 2B7EA 1ZAOA 1MMNA 4BHPA 3TO6A 3A4CA 3WE3A 2H8RA 3ZXSA 4KYWA 1NG6A 3HPGA 1T2KA 2YR2A 1X4PA 1W7PA 4DBQA 5KHDA 4LB6B 4WF2A 1ZG1A 3REOA 3N05A 1TC3C 3HUGA 2HQAA 3JRFA 4U88A 4PJMA 3N97A 2VBXA 4EQQA 4A0YA 2D1VA 2RVCA 1ZTRA 2VLAA 2WAEA 4B3AA 1MH4A 1IJWC 3WE2A 1ZHFA 4YEJA 5K7HA 4IHSA 1AOYA 4HV5A 1DP3A 3HGGA 2BVLA 1UMQA 1XN7A 1SD4A 3KETA 2BHYA 5J47A 3W2AA 3JAMK 1G2HA 2JTVA 2BYVE 3HJEA 2XHKA 3HOUJ 3MVPA 4ZC3A 1G4DA 4C3JJ 3LQQA 3OYNA 3KIOA 2NAZA 3WTUC 2LKSA 4R79A 3KYLA 4BXFA 2ZFWA 1R1TA 3K4JA 4UNOA 2VONA 3LFKA 4ZYHA 1XD7A 3PNYA 3L2RA 2VB6A 1LQ1A 1ETQA 5CVJA 2R5YA 1Z05A 3CCSI 1S6LA 2M2EA 2FD5A 2R92J 2F5DA 1X1AA 3G1LA 2DA4A 3HOTA 4J19A 1WSUA 4GFBA 1WJDA 4NUBA 3VYUB 3IP4B 4XOTA 5BNGA 3CF2A 3TOBA 4A3LJ 3RQ4A 2LYCA 1R22A 2BY3A 2DMUA 2O0YA 4UXNA 2ICWG 2O9LA 3VDXA 3TW7A 3SJMA 4XLCA 5K5OA 3TP0A 2FX0A 4XORA 4QTRA 1VQ8I 3A02A 1AWCA 1ZQ3P 4PUSA 3F6VA 2BXZA 3F8CA 2LBFA 4ENJA 3L1PA 1GUUA 2R7TA 1QZZA 3HPHA 4XLPF 2V7FA 1MMDA 3BOQA 2ESHA 2EA2A 4ZDLA 2R7WA 1SMTA 4I76A 2ZFUA 4PGGA 3I54A 2R5ZA 4IQ4A 1U8BA 3H9GA 2EZLA 4HX4A 2UXNA 2VE8A 2OTJI 4DGWB 1Y8QB 3IV5A 2CW7A 4EM2A 3B73A 3O2PE 4UVAA 4B44A 1VQLI 3QYBA 4NNJA 4JK1X 2RQPA 4G9YA 3SDGA 2IS1A 1Z21A 2FEZA 3AG1H 3GVAA 4BHBA 1RUOA 4LD5A 2W25A 1XMXA 3JRDA 5AONA 1OKRA 1ON2A 1D3YA 5AIPA 2HQ5A 4L9TA 2YSRA 1NHAA 3RKWA 2BY1A 2H1LA 1HW1A 1XCVA 2ZXIA 3J81Z 3G71I 2IA1A 3P5JA 5ILSA 4GXOA 1HCRA 3KE2A 4HW0A 1JTXA 3KYDB 5JLXA 1FP1D 2Y69H 2GLOA 4A5MA 1XDUA 2KIUA 1QZEA 3S15J 5CQEA 5F0FA 5M5WJ 1VQ5I 2DFFA 4XM3A 5JHFA 4XRSG 2UWMA 4RB3C 4XLEA 2B0LA 2W48A 4RAFA 2KPMA 2JWTA 2MLGA 1Z6TA 3JRBA 4E7KA 2MW8A 3QQAA 4PJNA 3F8FA 3K4KA 1FOYA 1IRXA 1WJAA 4X0GA 1ZRCA 5HNHA 1W4MA 3KX2A 1UG0A 1FIPA 2DT5A 2FQ4A 4LJZF 2DMTA 3CUOA 3KLNA 5C3EJ 3ESWB 3PIPF 1BW5A 3S2WA 4JBAA 2K9MA 4XKVA 5HS9A 4I0BA 2OUMA 2XPUA 4MEYF 4N0BA 2WADA 4KICA 5KCMA 5IOYA 4YIRX 1ZLKA 1VTNC 5GPAA 1Z9CA 1UAAA 3IL2A 3E6MA 2BE5F 5E18F 1USSA 2COBA 3EETA 2CSOA 1O3RA 3ZQFA 3M7GA 1Y8RB 2LKXA 3HOZJ 5CVUA 3T5XA 2ZMEA 3CCMI 4O3MA 2ZXHA 4CCJA 2K02A 3KZZA 1ENHA 3T0YA 3QYFA 2A6TA 2E5NA 1CQTA 4CA0A 1JHHA 4A3GJ 5ERIA 3BG9A 3D5LA 1OJLA 4I6ZA 1LDJA 3G73A 3DEEA 5DV5A 3SFIA 1T8IA 1X3WB 1UHWA 1WZ2A 2UV1A 3DU5A 4CHUA 4A3EJ 1MMSA 1V5GA 2HWVA 2ZJPF 3HHGA 2JK3A 4V2GA 2A07F 3W6JB 3I59B 4AD9A 2DO7A 3WU2C 4ENMA 4Y13A 1MMAA 3ZQQA 1UHMA 1SVLA 4M9ZA 4A3JJ 2EIJH 4MEXF 2HVRA 5J1RA 1H89C 2JMWA 2PMUA 1I1SA 1LPQA 2MABA 3FISA 5GTHC 4HDUA 3WTVC 5J4VA 4A6EA 3BCAA 2VJIA 1T56A 4KJZA 4N9IA 3WGIA 2GXBA 1FPQA 3C2BA 4CH7A 2A6EF 3I71A 4E7HA 3OYFA 6PAXA 4HLYA 1W1WE 2K85A 4JOMA 2ID3A 4Z6YA 1XMAA 4NQWB 4RA2A 4ZDPA 3RPUA 4M3GA 2A61A 2FSWA 3K4NA 1Y1VJ 3H3ZA 1R58A 3F8NA 2GBYA 5IYCJ 1VNDA 2LVSA 3G3ZA 1GVDA 1W36D 3GX4X 4EM1A 3B6AA 1UELB 3PUBA 3H35A 3OSFA 1BI2A 2B63J 1R00A 3JRCA 4PZJA 2W84A 2EFQA 2DTRA 2FJ1A 4DIQA 1O3QA 2E2HJ 2XDVA 2NVXJ 1Y6IA 2E71A 1RUNA 5M3FJ 2ESNA 3SDBA 4BGDA 2GXGA 2XRLA 3D1NI 1LVAA 2DAOA 3I5UA 4X6AJ 3BTIA 3GBGA 3VODA 4RB2C 2JZYA 3TEDA 1SFEA 2CV2A 3TQNA 2LDUA 2EFPA 5DUIA 3HDDA 3J80K 2QBYA 2HOTA 5K5QA 2XVCA 2BY2A 4JX4A 2PI0A 2LC2A 1O7LA 1FNNA 1OR7C 3H5NA 3ZQGA 3VWBA 1BR1A 5EYRA 2R93J 1ZN2A 3FM3A 3QOEA 2Q2EA 3BG6A 4UUTA 4LITA 1D5VA 4CICA 1YRNB 3DTKA 4EJOA 1A31A 2PLYA 5FLXK 1KGSA 3NQOA 3R60A 4F7ZA 2R7RA 3L2QA 1ZR2A 2IGNA 3CLQA 2Y9YA 3GTLJ 1Z7UA 2MSYA 1VQ7I 3U1KA 1LE8A 1D1AA 1HXDA 3FXUA 3QPSA 3WTSC 2OCCH 4U0YA 3BJAA 2KKOA 1EH7A 3K2ZA 4E7LA 4BYYA 3ZQLA 2XC7A 1DDNA 4RGUA 1KU7A 5BQTA 4ASNA 2WWYA 3LOCA 3DBLB 1IUYA 4P96A 2VBYA 4M74A 1U6GA 3VYTB 4ANJA 3OYLA 1BOAA 2DA5A 3CCEI 4BY1J 3FZVA 4EEFG 2JRTA 1BOBA 1EA3A 2FBHA 2JT1A 5D4RA 3M3YJ 5GAEJ 4CYDA 1A04A 2IW5A 1TT0A 2FQ3A 2X6YA 5C4XJ 3DTEA 1R5ID 1HBXG 4I2OA 1X2MA 2EZKA 3DPTA 4CDGA 2K3PA 3SZTA 1LFBA 2OQRA 5A2QZ 2G0EA 2WV1A 1WCMJ 3PSFA 4Y15A 3JW4A 1GXPA 1PJRA 2VC1A 1TQMA 2GIVA 3F9KA 4LG0A 3IAS2 1Y0NA 5M3MJ 1UJ8A 3TKYA 1IN4A 1YFHA 1EKEA 2F5CA 3UKGA 3MKWB 2O7OA 4F93B 2Y2ZA 2JA8J 3OWTA 4A69C 5HLHA 1R6RA 4EGZA 3HB9A 3I4MJ 5FFXA 2E2IJ 4BJ5C 2F5VA 3Q5FA 3CMEI 1LDDA 1YJ9I 2TCTA 1XMKA 2LFBA 4UY8I 1PDNC 2ZJ2A 1WFXA 2V1NA 1ETYA 1I50J 3BG5A 4A6DA 5HS8A 2DPDA 4ON0A 3TO7A 2PN6A 3H3UA 3CCRI 5FKMA 1V4RA 1IV8A 3S1MJ 3R0JA 3GMEA 1N75A 4RDUA 3OYKA 4BQAA 2DCEA 2K4JA 2KJCA 2VJJA 4IRGA 3S2DJ 2XPWA 1QQIA 3GTKJ 4R1HA 2K4BA 1FYLA 4KN4X 4UHTA 3RPQA 1WHUA 2CJJA 4EMSA 1H9GA 4XMYA 3B02A 4XOPA 5C4JJ 3HRSA 2F4IA 1JKQC 2MBFA 2GQQA 4I01A 3HOXJ 4ZJZA 2P0WA 2CW0F 1I3AA 2X6WA 4AYBN 4A12A 3BZCA 1W36C 4M73A 4HBLA 4HRIA 2R7VA 3OYGA 2VUMJ 5GAGJ 1W0TA 2CUEA 2BOLA 2DQLA 2MLKA 5E1ZB 2KL4A 1IV6A 2KLOA 1RIOH 3WTTC 3OL4A 3L2CA 4U87A 1ONVA 3V42A 2I10A 1YX3A 3FBIB 4IPAA 3RPUD 3LSGA 2IGOA 2XKPA 1V54H 2LOOA 3PSIA 2KRCA 4UUSA 2CW8A 2VPRA 1ZRDA 2ZSHB 3J7AY 2VKEA 1QVUA 5J1UA 3IHUA 1DU6A 1G3YA 2E2JJ 2PG4A 3K4LA 4LIVA 2K9QA 1W0UA 4HDVA 4OIOF 2BZTA 1AU7A 5FD5A 2NOGA 1NTCA 1I27A 3O3KA 1K79A 2VC0A 3BR2A 2CV0A 4I0AA 4HLXA 2HQNA 4AC0A 1X4OA 4BQOA 2OD5A 2AQFA 2LLKA 1RZ4A 3OYJA 1YJWI 1AKHB 1J09A 2E60A 2PFBA 1S3JA 2W4SA 2CV1A 3RSNA 3VEPA 2MC4A 4RBOA 3S3OA 2L2OA 4NB5A 4OIQF 2XAJA 4M72A 4RGSA 2DOAA 5IP6A 4G6TB 4LLGF 5EG0B 2NS8A 3AG2H 4C9YA 4B09A 3BLYA 5LLQA 2NS7A 1WI3A 1F4KA 3E3VA 2M45A 5HNFA 1MW7A 1RESA 4FE7A 1S7EA 3AG4H 1B8IA 3S1RJ 2HTSA 2DJIA 5HLIA 1YW7A 3EDPA 3ZQHA 1U8RA 2FU4A 2M8GX 2IJLA 5ICGA 2WB1A 3IRRA 2PQ8A 4KIBA 4QWQA 2MH9A 3DLLF 2DYRH 3BR6A 3L7WA 4M9XA 2EJRA 2IAIA 2NXNB 2X0LA 3CUQC 4HV6A 2P6SA 4IF4A 2V9PA 2ZB9A 4XN0A 3I56I 4OWRB 1OCCH 3Q9SA 2V1UA 3CCQI 3H1CA 2DA2A 3GWZA 1YI2I 2HFHA 2DXIA 4NHJA 4DYCA 2LR8A 3DPUA 3LA7A 2EV0A 3L09A 3NWTA 1A5JA 2ECCA 5EG0A 4CGZA 4OIPF 1TNSA 3IKVA 2F6CA 4I02A 2R7SA 1FSEA 1ERDA 3FXJA 3R6SA 1M1EB 2G7UA 4IXAA 1JT0A 4PDKA 3O8GA 3VYSB 3NWSA 3ZMUA 1R1VA 1RC9A 4JYKA 3FMQA 3BPVA 4FTHA 4CO8A 1GLNA 3K0LA 4Q4ZF 1TW3A 2ELKA 1ZELA 3PJRA 2VIXA 3L00A 2CYYA 4EJVA 3J7AO 1JKPC 4AIJA 2VN2A 1R71A 1P7JA 2R3SA 2DBBA 3F0CA 2XSDC 3PO2J 2DA1A 4CXFA 3J81K 2VT2A 1R49A 4HA8A 3M8EA 3ABTA 4DJAA 4LMYA 5CVVA 1D8JA 3PIOF 2ID6A 2RGVA 2M8EA 3QYEA 1YOVB 5DUKA 5J8FA 1LEAA 2M0MA 1XPXA 2B9SA 4Y52J 3CCVI 3DKYA 2ACJA 1K78A 3HUGB 1P4WA 2XGCA 5KAFC 2CMPA 4KT5C 3RKXA 1HDPA 1XX5A 3EQLF 4PCQA 4XKBA 1W5CC 1MZBA 5GAHJ 1LNWA 2K9NA 2DJNA 2IRFG 1LFPA 4ZZLA 4RB0A 2QKMB 2E19A 1NG7A 4XLAA 1F9NA 3PL8A 1PUFA 1ZARA 1ZGAA 5JVTA 4Z2YA 5JLWA 2RNJA 3HC7A 2Y0MA 2EZHA 3BTCA 3NRVA 2XGXA 3RCOA 1K83J 2DOEA 3CJRB 2WBMA 4A3KJ 1YJNI 3CC4I 3TOAA 5E17F 2MG4A 1U5TB 3ABKH 4HYEA 5IYDJ 2IT0A 4L0ZB 4Y17A 5A2QK 2V26A 3V8KA 2QVOA 1STZA 2QQAA 2P5KA 3V7CA 4MQVA 3MKLA 3JREA 4Q47A 2X6XA 2DT7B 4HQEA 3NAUA 2E1MC 4IRHA 3HG9A 3K1PA 3FX3A 1R9TJ 2P4WA 1Z1DA 1B8IB 2BGCA 2HU9A 3LAJA 2JJ7A 1XGMA 4II3A 2HOAA 4GYGA 4MLOA 3RKYA 3K70D 2OTLI 3WTWC 3OR2C 4RLFA 3WU1B 5LHGA 1E2XA 1FOKA 4V19K 3OYIA 2H6CA 4HNUA 2Y9ZA 2X4HA 4X1EA 2F5FA 2LTPA 3S17J 2Z33A 2R4GA 2FMYA 3K4MA 5LD2C 4AVZA 2DT6A 1DUXC 2GA2A 4PJJA 3A0HC 2E1OA 2KIMA 2O8XA 2P81A 2NVTJ 1RETA 4H4KC 1HA8A 1NK3P 3GFMA 1TP4A 1WGXA 3H36A 3BZKA 4XSXF 1Q1HA 3IH4A 5CLSA 5DCFA 5EEAA 1KQ0A 2WAQN 2CGPA 1JTYA 4E7SA 4N4NB 2AS5F 2RKHA 3CLOA 2PX9A 2KDOA 2NNYA 2K5CA 2NVUB 1BR4A 4PGHA 2VPLA 4GYIA 3M1CA 5B3SH 2DN0A 3FXMA 1O3TA 2EINH 4C3HJ 5IT3A 5FFZA 2HVSA 5F04A 3K4CA 1OLTA 5J1YA 5F08A 1HF0A 2XGEA 3OYHA 2L4MA 3PUFA 1VFCA 2K40A 2HDWA 2XAFA 2KJBA 3EPZA 1ODDA 1WJBA 2A6HF 1T95A 2XF6A 3ISPA 3QP6A 1ZLJA 1JUPA 2CQXA 1T6SA 2HS5A 1HOMA 2EPFA 3MCZA 2CQQA 4D5FA 4RLQA 3FXOA 1YHQI 3CJNA 3GFLA 3KP2A 3O6BB 1V5FA 2V9VA 4AYBA 3K7AJ 1TT5B 2NS0A 4UB8C 2O61A 5F6FA 3M1EA 1OISA 3OYDA 4MQ9F 2EH3A 2HDCA 1U0JA 3MD2A 2I5UA 1DPUA 4AVPA 1CF7A 5HS7A 1MD0A 1X1PA 2COMA 1NK2P 1OCRH 1BIBA 5HLTA 3BTJA 2OQGA 5EZHA 3L2UA 5FKNA 1W5SA 3ERMA 2O5RA 3R4KA 1LJ9A 4A3CJ 1A35A 2DLLA 3K2AA 5LGNA 1FY7A 3SHFA 4JX5A 2Z2SB 5DEQA 1YX5A 2M9HA 3BDDA 4XN3A 2RDPA 5JI6A 3N4MA 4AIHA 5ICCA 1D0YA 1KU2A 3DWLE 1QNTA 1YIJI 4D5CA 1FWZA 2EIMH 2IA0A 4TV7A 2RN7A 3RQIA 4CUGA 1EH6A 4RAYA 3JAMZ 3D5RC 4RB1A 1P9QC 2M1BA 1KU3A 4YIFA 3CDHA 1I1GA 1A6IA 1EV7A 5F1RA 1TNTA 3A03A 1UFMA 1R7JA 3V8LA 4BJTA 4L9VA 1MIJA 4YFKF 1J7KA 2G7HA 4WX9A 2EIKH 1L0OC 2ZXWH 3O8HA 2VKDA 3GTMJ 3E5UA 3CUQA 5FKOA 1RKWA 3L2WA 1KONA 3JTGA 4MGRA 5LRSA 2M5WA 1XGOA 4R8HA 2BW3B 2CH0A 1P6RA 5CVIA 1QU3A 2A68F 2LG4A 2OU2A 4L0YB 2K27A 3GEZA 1H9TA 1EF4A 2M4KA 2PMZA 5EF6A 3I4NJ 5L3FA 2W7NA 3TDZC 2D2WA 5DM7F 1LEBA 3HRMA 1Z3YA 4XRMA 3AAFA 1X1BA 1Y1WJ 4B43A 4KIFA 1ETVA 2XROA 4WXDA 1YTYA 2V9KA 3S2HJ 4D0PA 3OS1A 1D1CA 2GOXB 2KIFA 3TDUC 2LH9A 1YYVA 3E0JB 2AXLA 3LFUA 2GAUA 3FKIJ 1YITI 4WCGA 3OYCA 2JRMA 5KVRA 1JJ6C 2JVHA 5ICFA 1MSFC 3M07A 2R7UA 4L5IA 3IRQA 4F55A 1YLFA 2L4AA 1TWAJ 3OY9A 3ERED 3CCJI 2DDBA 4M9SA 4D7MA 4C30A 3ZPLA 3C2GA 2L9NA 1I6HJ 3LSIA 3SZGA 4FHTA 1RR7A 5FKKA 4A2UA 4L9JA 5FLVA 5BPDA 1LFUP 3LSKA 1EH8A 3CDLA 3FKJA 4PK4A 4S04A 2JUCA 5D6FA 3MN2A 1KA8A 1T0FC 3F3XA 1BR2A 4KITB 2DPUA 1ZR4A 4GCVA 1XCBA 2JA7J 3EUHA 2OV7A 4RMNA 2VL8A 2QQBA 1BM9A 4C3IJ 2X85A 1FX7A 2YU9J 5FO5A 4HF0A 1IW7F 3OS0A 2DDAA 5J3LA 2WAQA 4IX7A 4O6JA 2NNNA 2YX7A 1AHDP 1V55H 4CCMA 2E7WA 1WPKA 3LSJA 4LK0F 1AKHA 3PM1A 5IY5H 3CC2I 1U5TC 3EUKL 1S8NA 2Z9OA 1XGSA 1HKSA 1U9OA 4BL0B 4LG3A 2WA0A 3UR3C 3E6BA 5D5XB 1CF7B 1QHHD 1BBYA 2L7MP 1MBGA 3B6CA 4UV9A 1SVMA 3EYIA 2XGDA 3EYYA 1YO5C 4UVCA 2Y0SA 3CCYA 3HOVJ 1B72A 1KQ9A 3ZMVA 3GTOJ 4GDFA 2IGMA 2MFZA 4BDZA 2W85A 3QPHA 2GWRA 3IWFA 2OZ6A 4MO7A 4HSTA 2HTJA 4M6YA 3GYHX 3BJOA 5L3CA 4KMFA 2K3FA 3Q9VA 3GTPJ 4ZTJA 4B47A 5M5YJ 1MJ9A 3BP8A 2O8KA 3KP5A 4RM3A 1MNEA 2DOFA 1QPMA 2FXAA 4XICA 2XAGA 2ZNYA 1D0XA 5L3BA 1XSDA 2MGQA 5FKLA 5JVGF 3C1DA 1R5HA 3NARA 3U9GA 1N77A 4D1QA 2Y31A 4I98B 4D9JA 2VI6A 1TBXA 1MNDA 3DQVC 2D1HA 3U2RA 3FK7A 1E0EA 2R5ZB 4DW6A 2VXZA 2HYGD 2XUBA 4IOCF 4OMYA 2JVGA 4C2UA 3J80Z 1WQ2A 1WJ5A 4BQNA 1FIAA 2VASA 4BDYA 2EV6A 3V7RA 2BY0A 4RAGA 4FT8A 3FXKA 1Z77A 4ZZDA 1IN8A 1TW2A 2EQRA 3HKZA 3DFGA 1O57A 3ASOH 3KEOA 3ZOBA 2DMPA 1BC7C 1OYIA 4LG0B 4ABZA 4W1UA 1GVJA 3FXRA 3OYEA 3RZDJ 2LF7A 3DLAA 1FJLA 3ML6A 2H09A 1ZGJA 1X19A 1P4XA 2HZTA 3SXYA 1IUFA 3ZMTA 4ENKA 3KP7A 5DCMA 1DGWY 1U5TA 4IHXA 1ULYA 3C2HA 4G7ZF 1XC5A 4NDLA 4A3IJ 4WWCA 2JQ7A 3F21A 1PP7U 1B1BA 4D7NA 1F5TA 3H5AA 4CCLA 5H2FC 1XG1A 2Z1DA 4RAZA 5IYBJ 2LREA 2WY8Q 4BY7J 2IXSA 4Q48A 3OYBA 1BA5A 2XPVA 3Q0UA 1A36A 3G1OA 4BNCA 1WVRA 4A3BJ 5BMZA 2DTZA 1RKTA 3BTLA 2ZKZA 5D6EA 5DD4A 5GP9A 2F48A 2EFNA 1VQKI 5GADJ 2CUFA 4YELA 4MFDA 2MD0A 2Q0OA 2KDZA 5BOXA 3HSRA 5H6RA 3ABUA 1V5EA 3ASNH 2ZCWA 3MKZA 2BW3A 3FMSA 3GZNB 5JR3A 4Y7NJ 1SD6A 1S7OA 3FK6A 5D8LB 3CUQB 3QWLA 3W6VA 2A05A 1MH3A 2RNGA 1FLIA 3C7JA 2V6EA 3ZQ7A 3CC7I 4C2TA 2VXDA 5FD6A 2NRAC 1G3TA 1T33A 1LUJB 2FF4A 4BEHA 4KUMA 1FBUA 4OINF 4M6VA 1LDKB 2IS6A 5K1YA 2QBYB 5E1XA 3HIFA 4HOBA 3GTQJ 3HGYA 5LEJA 3CP2A 3S3NA 2R7ZJ 5DDGA 3SFZA 4G7HF 2GM4A 4Y3OA 4NQWA 4CZCA 3LNQA 2MA3A 3V8JA 2DI3A 1JUSA 1ON1A 2DFEA 4YFXF 1JI8A 4YIIA 1YS7A 4YFNF 2KFDA 1ZH5A 4BXUA 3CF5F 5J6XA 2AHQA 3WGHA 4JQFA 4XLFA 1MMGA 2V79A 3ZN0A 1E17A 2PJRB 1N25A 1I3QJ 1WJCA 1POGA 3BQYA 2ZSIB 4L9NA 1JKRC 1B6AA 4HX7A 2M30A 4DYQA 4AWXB 5EGOA 5TJJA 4LB5A 5IOZA 4HX8A 2Z16A 2VJ4A 3CO7C 2PMHA 2QA4I 2CQKA 5EDNA 1EJ9A 2IS2A 1B9NA 2CQ7A 1JJ8C 3HYIA 1U9NA 1QVTA 1E3OC 1RI7A 2K86A 4LFUA 4AIDA 1OCPA 4G6QA 5B1BH 1N78A 4BKXA 1ZG3A 2JUGA 3E7LA 1X3UA 3V4GA 1KU9A 3F72A 1I6XA 4HQMA 4BXXJ 4B8XA 2DODA 4CCOA 1RR8C 2L7ZA 2L9RA 1I39A 1VZ0A 2E7XA 1VI0A 5L3DA 4BU2A 2KRHA 1TWHJ 4FX0A 2WB1N 2XB5A 2N8GA 2L5QA 2XAHA 4B4CA 3FHZA 4E70A 5L3EA 1OPCA 3MWMA 4CSWA 3CMYA 5FRNA 1HKTA 3R61A 3QAHA 4O5VA 1FEXA 1A6QA 4NBQA 3HSEA 1FOWA 4A3MJ 2XAQA 2DK5A 2E36A 4Y4RA 3RJPA 4BQQA 3DF8A 2GOMA 1HSTA 1GHCA 3IUOA 4Q5SF 4FQGA 4BS9A 3FDYA 2VBWA 1XTAA 4E6KG 4UUSB 3F22A 2ME0A 1X1CA 4Y33A 2V1DA 2HR3A 1HSJA 5CKTA 1P92A 2M0CA 3MEXA 2W00A 1R1UA 3FXQA 2L01A 1ACIA 4I09A 5HLGA 1W7PB 2CS3A 3W3CA 2HDDA 1MKMA 4F3QA 3H3VK 4KNYA 2Y75A 4HZFA 4L5JA 3LAPA 5CQGA 5LBQA 1G59A 1ETOA 1MNMC 5DTDA 2W82A 3LA2A 3QODA 4EJTA 3K9TA 4XKWA 4PJLA 4GO1A 2FUG2 5ED4A 3AL0B 2RQQA 4P9FA 3S32A 4MNUA 3SEQA 3EUHC 1BC8C 5DS9A 2XIGA 3KPHA 4EJWA 3AG3H 1D8KA 2Y48A 2QZ8A 5F64A 2AQEA 3SQNA 2Y0SN 4B3XA 5B1AH 4LK1F 1YW8A 4IHTA 1FTZA 3SEZA 3WHBA 1R4NB 3U21A 5D5VB 3I64A 3KLOA 4MTEA 1HDDC 1VQMI 2PJPA 3FHNA 2BXYA 4M3EA 4CCNA 2I8DA 1R5GA 3VSLA 4HG2A 5E79C 4B1RA 4HF2A 5TGTA 4BACA 1JHFA 2KRFA 4EATA 1K7AA 1UG2A 4M3FA 5F0CA 4MTDA 4P1WA 4DBRA 1TQIA 1FTTA 3EUAA 3WU0A 2A3SA 3BPXA 1IG7A 3A2KA 2DFIA 1JT6A 2K9LA 1MJBA 2QSFX 3LMMA 4MFEA 5TRDA 2P8TA 3BR0A 3CZ6A 4C2MJ 1K4SA 4LOCA 4AU7A 3P9CA 1X1DA 3KP3A 5TISC 1IN6A 1MBHA 5HOOA 2RV8A 3QP5A 2YUSA 3I0TA 2R7DA 2LRDA 4E4HA 1OCTC 3I3LA 4N9HA 4IRIA 2ZXJA 2LP0A 2MD5A 1MDMA 2LY9A 5LFAA 2EFWA 4RGRA 3BR5A 4E7JA 2HPMA 1TLHB 5L3GA 4XRSA 3MZHA 2Z3YA 1J0RA 3VPRA 4WXCA 4U7BA 1UHSA 2L02A 1ORKA 3ZMSA 4BJ6C 4P55A 3JRGA 1FSHA 2VQGA 4XNFA 4I7HA 4H0EA 3WHCA 5JHUA 9ANTA 4G6DA 3PO3J 4CCKA 1FC3A 2ZMEB 5LHHA 1SFOJ 2HVQA 5H20A 4KDPA 4QPQA 3IWZA 3S8PA 1JKOC 2HXOA 4U0WA 3RYPA 1ZRFA 5ILVA 1USTA 2CO5A 3V7SA 1BW6A 1FZPB 2OA4A 4IQJA 1ZREA 2ISZA 5F0HA 2LSOA 3IH2A 5H6QA 3CD6I 4XIDA 4ZYEA 3S1NJ 5DM6F 4J01A 1TL8A 3K10A 2E35A 1FOXA 4XRFA 2JA6J 3HBLA 3MZ8A 1IN7A 2V6CA 3ROUA 2J5PA 3HHHA 1PUFB 3CTAA 4EM0B 2IEKA 4IL6C 2D5VA 1J5YA 1R23A 3MZYA 5FRMA 2KISA 3K6GA 1JE8A 3GF2A 3FIWA 3HOSA 3TBIA 2FA5A 1XGNA 1S5LC 3CJQB 2X1DA 4P5OA 2LMDA 4K2EA 1HW5A 5D4SA 2HI3A 1X58A 3TGNA 3H0GJ 4ITVA 3DCFA 5EEHA 4UB6C 3FWEA 3ZR8X 3JRAA 1BJZA 1GV5A 1QRYA 2GIZA 3KEQA 4MHGA 1OQYA 4HAMA 3RDIA 3GCMA 1SD5A 2CQNA 3WGGA 2KZGA 4WK8F 2QM3A 2ZNZA 4DNCA 1H88C 2YX4A 2FBIA 4BBRJ 1T08B 2DYSH 4JP0A 4BUPA 5K7FA 1BI1A 2P7CB 2O6GE 2EZIA 2HPIA 4A93J 2OF7A 3BR3A 4MIMA 2OBPA 5J4YA 1PYVA 4FASD 1GDTA 2OAZA 1SMYF 4ZYDA 2KT0A 3ZN1A 1KYZA 5LGUA 2BBYA 3L2VA 2ME6A 4G12A 3OS2A 2HKXA 3A0BC 4EV0A 5LRRA 1BJAA 1IDYA 3OIQA 1F43A 2ZMEC 4ESFA 2NVYJ 1Z67A 2DA7A 3E97A 3P9KA 1Z6RA 1LKXA 1E3PA 4RM2A 3H9QA 1G8XA 4A3FJ 3Q0VA 4HF1A 4WXHA 4XR6A 2GA1A 1G6NA 3OIPA 4G7OF 1SAUA 3DPLC 2H94A 3A1YA 4L18B 4LIUA 1PUEE 2BV6A 1QPIA 2XKOA 2LK2A 3KZYA 2O03A 5DYMA 1OCOH 5ICEA 2VQHA 3BR1A 3GW2A 3DV8A 2ZJQF 1GT0C 1APLC 2DU9A 3E6DA 2KMUA 1YG2A 2G9WA 3LSRA 4OIRF 3HOWJ 1ETWA 1I5ZA 3NEUA 4NC8A 4BAYA 2C6YA 1Q1VA 3CESA 1O3SA 2MC3A 4KA4A 3F8MA 3I59A 2VJ5A 3FXLA 3HRTA 4OOIA 2ELHA 2WAFA 2X51A 3J7ZI 3ZGKA 1IN5A 4ENNA 2DA3A 3KYCB 2QSHX 4E7ZA 2XF5A 1JXSA 3HRUA 1B9MA 3LWFA 5HDNA 1XS9A 1F36A 5HVQC 3I9V2 1G3SA 3M8FA 3QRFF 1QO0D 4DYRA 4RS8A 4M71A 4ZYGA 4M6XA 1ZKGA 1Z91A 3A01B 3F6OA 2A5YB 3H5RA 3E1SA 5E8IA 1RNLA 2LD5A 2P6TA 2MYSA 2NVQJ 2FOWA 2X9DA 5B66C 2WTEA 3GLLA 3OR1C 3MMYB 4IHYA 4PJ0C 3T8RA 4XL9A 4YRVA 2K9SA 2RC4A 2FNPA 5JFRA 2DQRA 3DBRB 3GFJA 2WV0A 2J5OA 4XLHA 4EJUA 2EBIA 2Q8KA 1F1ZA 3ONQA 4HEA2 2X1CA 2EILH 4BEHB 4IOAF 1IRFA 2L7FP 3VYRB 3ZMZA 2F2EA 2DK8A 1C0WA 1XDSA 1IO2A 2M3AA 1DQUA 3IC7A 3IAM2 1ETXA 2JA2A 1SAXA 3S1QJ 2CRGA 4IVNA 1H0MA 3UNGC 4QLCU 2X48A 1SFKA 3FMRA 2EA4A 5AIQA 1J75A 4GRIA 3SZPA 2EWNA 5D8KB 2F4MB 2KHMA 2QYOA 4G8XA 3ABMH 2JN6A 2XAUA 2DA6A 3U1DA 3CQZJ 4AM3A 4PFOA 1UZCA 4A3DJ 3JSOA 1JUMA
chains in the Genus database with same CATH topology
1S7AA 5CYVA 1CGPA 4LLLA 5IT9K 2QQ9A 3QPTA 4XBFA 3RIRA 2PBIA 2L3DA 4U0VA 3ZMDA 2HOEA 3MQ0A 3COAC 1V3FA 3E6CC 4YG2F 2DW4A 3H92A 3KP6A 1XB4A 1L3LA 2FNAA 3K1NA 2ADUA 4A0XA 2ZBKA 1T39A 4EVIA 1FYMA 2QLZA 4OMZA 4FX4A 3C3WA 3JTHA 1B4AA 1U2WA 2R7FA 3BWGA 1K78B 3LQRA 1R36A 3P7NA 2IPQX 3M9AA 3W6KB 1OYWA 5LGTA 3IKTA 3DP7A 2L54A 1QBJA 2VODA 3C18A 1BI0A 3BJ6A 1MGTA 1BI3A 1SD7A 2WC2A 2EK5A 3GUDA 3BZ6A 5IT9Z 4KN7X 4ESBA 2JPBA 5BS6A 4BHCA 1T38A 2BEOA 1ZYRF 2CFXA 3GZ5A 5EEGA 4A5NA 3PFIA 3I53A 2V1XA 1MJAA 1T98A 4AIKA 1G3WA 2VT3A 2HEOA 2HYFA 4XSZF 1O7FA 2STWA 2UZKA 1FBSA 1YW9A 3I4PA 1S29A 3PQKA 4RGXA 5FGMA 4ETSA 3DXJF 1WI9A 2TDXA 2XASA 2ETHA 2E1CA 1KYWA 1U3EM 4P9UA 2D45A 1OMIA 2Z99A 2Z5UA 2MH2A 3K69A 1WKMA 3OV8A 2P5VA 4KFCA 1TQPA 3P9IA 3L9FA 4IJAA 3GZ6A 3HSFA 2FE3A 3K1MA 2H27A 4OU0A 3TO9A 3ECOA 3MAJA 4LLNA 3KFWX 3LSTA 1YQAA 1SFUA 2EFOA 2PEXA 2QENA 5HDKA 3ELKA 1PP8F 1IRGA 3VFZA 1IXSB 4U7DA 3WTZA 3DEUA 2HKOA 5CJ9A 3ULQB 1FYKA 3E5XA 3KCCA 2XV4S 1Y0UA 4GGGA 1W5TA 3T8TA 2EB7A 3DKWA 2QWWA 5LEKA 1U78A 1IXRC 2FRHA 2UXXA 2ZO4A 5DD8A 2LNBA 1YS6A 1OR7A 2IA2A 1GXQA 1LB2A 3CO6C 3WTYC 5BPIA 3WG9A 1REPC 1J59A 1MDMB 1TTYA 2H6BA 5D5WB 4KMUX 3T1BA 5E8GA 1HQCA 3JSPA 1DP7P 2W24A 4KIGA 3MFKA 3RTRA 2W57A 2QUFA 5KK1A 4XLNF 1ZG5A 3VB2A 3ZP5A 2F5EA 1BN5A 1W7PD 4UV8A 2STTA 2JPCA 2K7LA 2OZUA 4UVBA 5J8CA 3QU6A 2LF8A 3WODF 2EV5A 2IP2A 1XSVA 1DPRA 5FB2A 1J2XA 2HGCA 3GO5A 3QU3A 5HDGA 1IXCA 2GZWA 3FM5A 1XSXA 4A0ZA 3ECHA 2VBZA 2YU3A 1QZYA 5K5RA 1HKQA 3BROA 1HW2A 3HTSB 4BH9A 3QOPA 4G94A 3HTUA 5CVRA 5ILUA 3RI4A 1WRJA 2E1NA 4ESJA 2YPRA 5FLXZ 5D5UB 2P5LC 5E20A 3PQJA 1FBQA 4ZH4F 3RYRA 5DCMB 2CWEA 1QGPA 2FOKA 1WWXA 4LGWA 3D0SA 4DQ2A 1J9IA 2CG4A 2VE9A 2JSCA 2FMLA 1FT9A 1FP2A 1UCRA 3GXOA 2A69F 2HQRA 4CZZA 2XRNA 3OOPA 3E5QA 2NYXA 2VOPA 1B59A 2VOOA 1SFXA 3WTXC 1T0FA 2M87A 3R0AA 2O3FA 1OYYA 3KP4A 1P4AA 4UUVA 2IVMA 4EGYA 1YIOA 3FF5A 1IZ1A 2FBKA 1KQ8A 5LHIA 3F23A 3F8BA 1BIAA 5E1WA 1IAWA 3GLXA 3VOEA 2ISYA 4S05A 3I58A 1IF1A 1P2FA 3LA3A 2LKPA 2P7VB 3GFIA 1JGSA 1UB9A 3BY6A 1ZAOA 4BHPA 3TO6A 3WE3A 4KYWA 1T2KA 2YR2A 1W7PA 4LB6B 4WF2A 1ZG1A 3REOA 3HUGA 4U88A 3N97A 2VBXA 4EQQA 4A0YA 2D1VA 2RVCA 3WE2A 1ZHFA 4IHSA 1AOYA 4HV5A 1XN7A 1SD4A 3KETA 3JAMK 2JTVA 2BYVE 2XHKA 1G4DA 3LQQA 2NAZA 3WTUC 4R79A 2ZFWA 1R1TA 4UNOA 2VONA 3LFKA 4ZYHA 1XD7A 1LQ1A 5CVJA 1Z05A 1S6LA 2F5DA 3HOTA 1WSUA 3TOBA 1R22A 2O0YA 4UXNA 5K5OA 1AWCA 3F6VA 3F8CA 4ENJA 1QZZA 4XLPF 3BOQA 2ESHA 2EA2A 1SMTA 4PGGA 3I54A 4HX4A 2UXNA 2VE8A 4EM2A 3B73A 3O2PE 4UVAA 4JK1X 2RQPA 4G9YA 2FEZA 3GVAA 4BHBA 1RUOA 4LD5A 2W25A 5AONA 1OKRA 1ON2A 1D3YA 5AIPA 4L9TA 2YSRA 1NHAA 3RKWA 1HW1A 1XCVA 3J81Z 2IA1A 5ILSA 4GXOA 3KE2A 4HW0A 1FP1D 4A5MA 1XDUA 2KIUA 2UWMA 4RB3C 2B0LA 2MLGA 1Z6TA 3F8FA 1ZRCA 1W4MA 2DT5A 4LJZF 3CUOA 3KLNA 3S2WA 4JBAA 5HS9A 4I0BA 4N0BA 4MEYF 4KICA 1ZLKA 1VTNC 1Z9CA 3IL2A 3E6MA 2BE5F 5E18F 1USSA 3EETA 2CSOA 1O3RA 3M7GA 5CVUA 3T5XA 2ZMEA 4O3MA 2K02A 3KZZA 3T0YA 1JHHA 5ERIA 3D5LA 1LDJA 3G73A 5DV5A 1UHWA 4CHUA 2HWVA 2A07F 3HHGA 3W6JB 3I59B 4AD9A 2DO7A 4ENMA 4Y13A 1UHMA 4M9ZA 4MEXF 2PMUA 1I1SA 4HDUA 3WTVC 4A6EA 4N9IA 3WGIA 2GXBA 1FPQA 2A6EF 3I71A 6PAXA 4HLYA 1XMAA 3RPUA 2A61A 2FSWA 3H3ZA 1R58A 3F8NA 3G3ZA 3GX4X 4EM1A 1BI2A 1R00A 4PZJA 2W84A 2EFQA 2DTRA 1O3QA 1RUNA 2ESNA 2GXGA 1LVAA 2DAOA 3I5UA 4RB2C 3VODA 2JZYA 1SFEA 3TQNA 2LDUA 2EFPA 5DUIA 3J80K 2QBYA 5K5QA 2XVCA 2PI0A 1O7LA 1FNNA 1ZN2A 3FM3A 2Q2EA 1D5VA 4CICA 4EJOA 2PLYA 5FLXK 1KGSA 3NQOA 3R60A 4F7ZA 1Z7UA 1HXDA 3FXUA 3WTSC 4U0YA 3BJAA 2KKOA 1EH7A 3K2ZA 4BYYA 1DDNA 4RGUA 1KU7A 5BQTA 4ASNA 2WWYA 1IUYA 4P96A 2VBYA 4M74A 1U6GA 1BOAA 3FZVA 2JRTA 2JT1A 2FBHA 5D4RA 4CYDA 1A04A 2IW5A 2FQ3A 1HBXG 4I2OA 3DPTA 4CDGA 3SZTA 2OQRA 5A2QZ 4Y15A 3JW4A 1GXPA 2VC1A 1TQMA 2GIVA 4LG0A 3TKYA 1IN4A 1YFHA 2F5CA 5HLHA 4EGZA 5FFXA 3Q5FA 1LDDA 1XMKA 1PDNC 2ZJ2A 5HS8A 4A6DA 2DPDA 3TO7A 4ON0A 2PN6A 3H3UA 1V4RA 3R0JA 4BQAA 2K4JA 2KJCA 4IRGA 1QQIA 4R1HA 1FYLA 2K4BA 4KN4X 4UHTA 3RPQA 4EMSA 1H9GA 3B02A 3HRSA 2MBFA 2GQQA 4I01A 2CW0F 4A12A 4M73A 4HBLA 2DQLA 2MLKA 5E1ZB 1RIOH 3WTTC 3L2CA 1ONVA 4IPAA 2XKPA 1ZRDA 3IHUA 1G3YA 2PG4A 4HDVA 4OIOF 5FD5A 3O3KA 1I27A 1K79A 2VC0A 4I0AA 4HLXA 2HQNA 2OD5A 1RZ4A 2PFBA 1S3JA 3VEPA 4NB5A 4OIQF 2XAJA 4M72A 4RGSA 4LLGF 5LLQA 4B09A 1F4KA 3E3VA 2M45A 2HTSA 5HLIA 1YW7A 3EDPA 1U8RA 2FU4A 2IJLA 5ICGA 3IRRA 2PQ8A 4KIBA 4QWQA 2MH9A 3L7WA 4M9XA 2EJRA 2X0LA 3CUQC 4IF4A 4HV6A 2P6SA 3Q9SA 2V1UA 3GWZA 2HFHA 4NHJA 3LA7A 2EV0A 3L09A 4CGZA 4OIPF 1TNSA 3IKVA 4I02A 1FSEA 3R6SA 2G7UA 4IXAA 4PDKA 3ZMUA 1R1VA 3FMQA 3BPVA 4CO8A 3K0LA 4Q4ZF 1TW3A 3L00A 2CYYA 4EJVA 3J7AO 4AIJA 2VN2A 2R3SA 2DBBA 4CXFA 3J81K 2VT2A 4HA8A 3M8EA 3ABTA 4LMYA 5CVVA 1D8JA 2RGVA 2M8EA 5DUKA 5J8FA 1LEAA 2ACJA 1K78A 1P4WA 4KT5C 3RKXA 3EQLF 4PCQA 1MZBA 1LNWA 2IRFG 4ZZLA 4RB0A 1F9NA 1ZARA 1ZGAA 5JVTA 4Z2YA 2RNJA 2Y0MA 3NRVA 2XGXA 5E17F 3TOAA 1U5TB 4HYEA 2IT0A 4L0ZB 4Y17A 5A2QK 3V8KA 2QVOA 1STZA 2QQAA 2P5KA 3V7CA 4MQVA 4Q47A 4HQEA 4IRHA 3K1PA 3FX3A 2P4WA 1Z1DA 2BGCA 3LAJA 1XGMA 4GYGA 3RKYA 3WTWC 3WU1B 5LHGA 1E2XA 1FOKA 2H6CA 2X4HA 2F5FA 2Z33A 2FMYA 1DUXC 2GA2A 2KIMA 2O8XA 3GFMA 4XSXF 1Q1HA 5CLSA 5DCFA 1KQ0A 2CGPA 2AS5F 2RKHA 3CLOA 2NNYA 4PGHA 4GYIA 1O3TA 5IT3A 5FFZA 2L4MA 2XAFA 2KJBA 1ODDA 2A6HF 3ISPA 3QP6A 1ZLJA 1T6SA 2HS5A 3MCZA 3CJNA 3GFLA 3KP2A 3O6BB 2V9VA 2NS0A 2O61A 5F6FA 3M1EA 4MQ9F 2HDCA 1DPUA 4AVPA 1CF7A 5HS7A 1MD0A 2COMA 1BIBA 2OQGA 1W5SA 3R4KA 1LJ9A 2DLLA 5LGNA 1FY7A 3SHFA 5DEQA 3BDDA 5JI6A 2RDPA 3N4MA 4AIHA 5ICCA 1KU2A 1QNTA 1FWZA 2IA0A 4TV7A 2RN7A 1EH6A 4RAYA 3JAMZ 4RB1A 2M1BA 1KU3A 4YIFA 3CDHA 1I1GA 1EV7A 5F1RA 1TNTA 1UFMA 1R7JA 3V8LA 4L9VA 4YFKF 1J7KA 2G7HA 4WX9A 1L0OC 3E5UA 3CUQA 3JTGA 4MGRA 5LRSA 2M5WA 1XGOA 4R8HA 1P6RA 5CVIA 2A68F 2OU2A 4L0YB 2K27A 3GEZA 1H9TA 5L3FA 3TDZC 2D2WA 1LEBA 3HRMA 3AAFA 4KIFA 2XROA 1YTYA 4WXDA 4D0PA 2KIFA 3TDUC 1YYVA 2AXLA 2GAUA 4WCGA 5KVRA 5ICFA 4L5IA 3IRQA 1YLFA 2L4AA 3ERED 4M9SA 3ZPLA 4FHTA 4A2UA 4L9JA 5BPDA 1EH8A 4S04A 5D6FA 1KA8A 3F3XA 2DPUA 4GCVA 1XCBA 3EUHA 2QQBA 1BM9A 1FX7A 5FO5A 4HF0A 1IW7F 4O6JA 2NNNA 2YX7A 2E7WA 4LK0F 1U5TC 2Z9OA 1S8NA 1XGSA 1HKSA 3E6BA 5D5XB 1CF7B 1BBYA 4UV9A 3EYIA 3EYYA 1YO5C 4UVCA 1KQ9A 3ZMVA 2W85A 3QPHA 2GWRA 3IWFA 2OZ6A 2HTJA 4M6YA 3GYHX 3BJOA 5L3CA 4KMFA 3Q9VA 1MJ9A 3BP8A 3KP5A 1QPMA 2FXAA 2XAGA 2ZNYA 5L3BA 1XSDA 3C1DA 1R5HA 3U9GA 4I98B 1TBXA 3DQVC 2D1HA 3U2RA 2VXZA 2HYGD 2XUBA 4OMYA 3J80Z 1WQ2A 2EV6A 3V7RA 4FT8A 4ZZDA 1IN8A 1TW2A 3DFGA 1O57A 3KEOA 4LG0B 1BC7C 1OYIA 1GVJA 3FXRA 2LF7A 3ML6A 2H09A 1ZGJA 1P4XA 2HZTA 3SXYA 3ZMTA 4ENKA 3KP7A 5DCMA 1U5TA 1ULYA 4G7ZF 4WWCA 3F21A 1PP7U 1B1BA 1F5TA 4RAZA 4Q48A 4BNCA 5BMZA 2ZKZA 5D6EA 5DD4A 2EFNA 2Q0OA 5BOXA 3HSRA 5H6RA 3ABUA 2ZCWA 3FMSA 5JR3A 1SD6A 1S7OA 5D8LB 3CUQB 1FLIA 3C7JA 3ZQ7A 5FD6A 2NRAC 1G3TA 2FF4A 4KUMA 1FBUA 4OINF 1LDKB 5K1YA 2QBYB 5E1XA 3HIFA 4HOBA 5LEJA 5DDGA 3SFZA 4G7HF 4NQWA 2MA3A 3V8JA 2DI3A 1ON1A 4YFXF 4YIIA 1YS7A 4YFNF 1ZH5A 4BXUA 5J6XA 3WGHA 4JQFA 2V79A 3ZN0A 1E17A 1K6OA 4L9NA 1B6AA 4HX7A 2M30A 4AWXB 4LB5A 5TJJA 4HX8A 3CO7C 2PMHA 2CQKA 1B9NA 3HYIA 1RI7A 2K86A 4LFUA 4G6QA 1ZG3A 1X3UA 3V4GA 1KU9A 3F72A 1I6XA 4HQMA 4B8XA 2E7XA 5L3DA 4FX0A 2XAHA 3FHZA 4E70A 5L3EA 1OPCA 3MWMA 1HKTA 3R61A 3QAHA 4O5VA 3HSEA 2XAQA 2DK5A 3RJPA 3DF8A 1HSTA 1GHCA 4Q5SF 2VBWA 3F22A 2V1DA 2HR3A 1HSJA 1P92A 3MEXA 1R1UA 3FXQA 2L01A 4I09A 5HLGA 1W7PB 1MKMA 4KNYA 2Y75A 4HZFA 4L5JA 3LAPA 5LBQA 3LA2A 4EJTA 3K9TA 4GO1A 5ED4A 4P9FA 4MNUA 1BC8C 2XIGA 4EJWA 1D8KA 2Y48A 2QZ8A 5F64A 3SQNA 4LK1F 1YW8A 4IHTA 5D5VB 3I64A 3KLOA 4MTEA 2PJPA 1R5GA 4HF2A 1JHFA 2KRFA 1K7AA 4MTDA 1TQIA 3WU0A 2A3SA 3BPXA 2DFIA 1MJBA 5TRDA 2P8TA 3P9CA 3KP3A 1IN6A 5HOOA 2RV8A 3QP5A 3I0TA 2R7DA 4N9HA 4IRIA 2ZXJA 2MD5A 1MDMA 2EFWA 4RGRA 1TLHB 5L3GA 3MZHA 2Z3YA 1J0RA 4WXCA 4U7BA 2L02A 3ZMSA 4P55A 1FSHA 4I7HA 4H0EA 5JHUA 4G6DA 1FC3A 2ZMEB 5LHHA 5H20A 4KDPA 3IWZA 4U0WA 3RYPA 1ZRFA 5ILVA 1USTA 2CO5A 3V7SA 1FZPB 2OA4A 1ZREA 2ISZA 2LSOA 5H6QA 4ZYEA 4XRFA 1IN7A 2V6CA 3ROUA 2J5PA 3HHHA 3CTAA 4EM0B 1J5YA 1R23A 3MZYA 1JE8A 3GF2A 3HOSA 2FA5A 1XGNA 4P5OA 5D4SA 1HW5A 4K2EA 3TGNA 5EEHA 3FWEA 3KEQA 4MHGA 4HAMA 3RDIA 1SD5A 3WGGA 4WK8F 2QM3A 2ZNZA 4DNCA 2YX4A 2FBIA 1BI1A 2P7CB 2O6GE 2OBPA 2OAZA 1SMYF 4ZYDA 3ZN1A 1KYZA 5LGUA 2BBYA 2HKXA 4EV0A 5LRRA 1BJAA 4ESFA 3E97A 3P9KA 1Z6RA 4HF1A 4WXHA 2GA1A 1G6NA 4G7OF 3DPLC 2H94A 4L18B 1PUEE 2BV6A 2XKOA 3KZYA 2O03A 5DYMA 5ICEA 3GW2A 3DV8A 2DU9A 3E6DA 1YG2A 2G9WA 4OIRF 1I5ZA 3NEUA 4BAYA 2C6YA 1O3SA 2MC3A 4KA4A 3F8MA 3I59A 3HRTA 4OOIA 2ELHA 1IN5A 4ENNA 1JXSA 3HRUA 1B9MA 3LWFA 5HDNA 5HVQC 1G3SA 3M8FA 3QRFF 1QO0D 4RS8A 4M71A 4ZYGA 4M6XA 1Z91A 3F6OA 2A5YB 5E8IA 1RNLA 2P6TA 2WTEA 3T8RA 2RC4A 2FNPA 5JFRA 2DQRA 3GFJA 2WV0A 2J5OA 4EJUA 2Q8KA 1F1ZA 1IRFA 3ZMZA 2F2EA 2DK8A 1C0WA 1XDSA 3IC7A 1SAXA 4IVNA 1H0MA 4QLCU 3FMRA 2EA4A 5AIQA 1J75A 3SZPA 2EWNA 5D8KB 2QYOA 4G8XA 3U1DA 3JSOA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1S7A A;  5CYV A;  1CGP A;  4LLL A;  5IT9 K;  2QQ9 A;  3QPT A;  4XBF A;  3RIR A;  2PBI A;  2L3D A;  4U0V A;  3ZMD A;  2HOE A;  3MQ0 A;  3COA C;  1V3F A;  3E6C C;  4YG2 F;  2DW4 A;  3H92 A;  3KP6 A;  1XB4 A;  1L3L A;  2FNA A;  3K1N A;  2ADU A;  4A0X A;  2ZBK A;  1T39 A;  4EVI A;  1FYM A;  2QLZ A;  4OMZ A;  4FX4 A;  3C3W A;  3JTH A;  1B4A A;  1U2W A;  2R7F A;  3BWG A;  1K78 B;  3LQR A;  1R36 A;  3P7N A;  2IPQ X;  3M9A A;  3W6K B;  1OYW A;  5LGT A;  3IKT A;  3DP7 A;  2L54 A;  1QBJ A;  2VOD A;  3C18 A;  1BI0 A;  3BJ6 A;  1MGT A;  1BI3 A;  1SD7 A;  2WC2 A;  2EK5 A;  3GUD A;  3BZ6 A;  5IT9 Z;  4KN7 X;  4ESB A;  2JPB A;  5BS6 A;  4BHC A;  1T38 A;  2BEO A;  1ZYR F;  2CFX A;  3GZ5 A;  5EEG A;  4A5N A;  3PFI A;  3I53 A;  2V1X A;  1MJA A;  1T98 A;  4AIK A;  1G3W A;  2VT3 A;  2HEO A;  2HYF A;  4XSZ F;  1O7F A;  2STW A;  2UZK A;  1FBS A;  1YW9 A;  3I4P A;  1S29 A;  3PQK A;  4RGX A;  5FGM A;  4ETS A;  3DXJ F;  1WI9 A;  2TDX A;  2XAS A;  2ETH A;  2E1C A;  1KYW A;  1U3E M;  4P9U A;  2D45 A;  1OMI A;  2Z99 A;  2Z5U A;  2MH2 A;  3K69 A;  1WKM A;  3OV8 A;  2P5V A;  4KFC A;  1TQP A;  3P9I A;  3L9F A;  4IJA A;  3GZ6 A;  3HSF A;  2FE3 A;  3K1M A;  2H27 A;  4OU0 A;  3TO9 A;  3ECO A;  3MAJ A;  4LLN A;  3KFW X;  3LST A;  1YQA A;  1SFU A;  2EFO A;  2PEX A;  2QEN A;  5HDK A;  3ELK A;  1PP8 F;  1IRG A;  3VFZ A;  1IXS B;  4U7D A;  3WTZ A;  3DEU A;  2HKO A;  5CJ9 A;  3ULQ B;  1FYK A;  3E5X A;  3KCC A;  2XV4 S;  1Y0U A;  4GGG A;  1W5T A;  3T8T A;  2EB7 A;  3DKW A;  2QWW A;  5LEK A;  1U78 A;  1IXR C;  2FRH A;  2UXX A;  2ZO4 A;  5DD8 A;  2LNB A;  1YS6 A;  1OR7 A;  2IA2 A;  1GXQ A;  1LB2 A;  3CO6 C;  3WTY C;  5BPI A;  3WG9 A;  1REP C;  1J59 A;  1MDM B;  1TTY A;  2H6B A;  5D5W B;  4KMU X;  3T1B A;  5E8G A;  1HQC A;  3JSP A;  1DP7 P;  2W24 A;  4KIG A;  3MFK A;  3RTR A;  2W57 A;  2QUF A;  5KK1 A;  4XLN F;  1ZG5 A;  3VB2 A;  3ZP5 A;  2F5E A;  1BN5 A;  1W7P D;  4UV8 A;  2STT A;  2JPC A;  2K7L A;  2OZU A;  4UVB A;  5J8C A;  3QU6 A;  2LF8 A;  3WOD F;  2EV5 A;  2IP2 A;  1XSV A;  1DPR A;  5FB2 A;  1J2X A;  2HGC A;  3GO5 A;  3QU3 A;  5HDG A;  1IXC A;  2GZW A;  3FM5 A;  1XSX A;  4A0Z A;  3ECH A;  2VBZ A;  2YU3 A;  1QZY A;  5K5R A;  1HKQ A;  3BRO A;  1HW2 A;  3HTS B;  4BH9 A;  3QOP A;  4G94 A;  3HTU A;  5CVR A;  5ILU A;  3RI4 A;  1WRJ A;  2E1N A;  4ESJ A;  2YPR A;  5FLX Z;  5D5U B;  2P5L C;  5E20 A;  3PQJ A;  1FBQ A;  4ZH4 F;  3RYR A;  5DCM B;  2CWE A;  1QGP A;  2FOK A;  1WWX A;  4LGW A;  3D0S A;  4DQ2 A;  1J9I A;  2CG4 A;  2VE9 A;  2JSC A;  2FML A;  1FT9 A;  1FP2 A;  1UCR A;  3GXO A;  2A69 F;  2HQR A;  4CZZ A;  2XRN A;  3OOP A;  3E5Q A;  2NYX A;  2VOP A;  1B59 A;  2VOO A;  1SFX A;  3WTX C;  1T0F A;  2M87 A;  3R0A A;  2O3F A;  1OYY A;  3KP4 A;  1P4A A;  4UUV A;  2IVM A;  4EGY A;  1YIO A;  3FF5 A;  1IZ1 A;  2FBK A;  1KQ8 A;  5LHI A;  3F23 A;  3F8B A;  1BIA A;  5E1W A;  1IAW A;  3GLX A;  3VOE A;  2ISY A;  4S05 A;  3I58 A;  1IF1 A;  1P2F A;  3LA3 A;  2LKP A;  2P7V B;  3GFI A;  1JGS A;  1UB9 A;  3BY6 A;  1ZAO A;  4BHP A;  3TO6 A;  3WE3 A;  4KYW A;  1T2K A;  2YR2 A;  1W7P A;  4LB6 B;  4WF2 A;  1ZG1 A;  3REO A;  3HUG A;  4U88 A;  3N97 A;  2VBX A;  4EQQ A;  4A0Y A;  2D1V A;  2RVC A;  3WE2 A;  1ZHF A;  4IHS A;  1AOY A;  4HV5 A;  1XN7 A;  1SD4 A;  3KET A;  3JAM K;  2JTV A;  2BYV E;  2XHK A;  1G4D A;  3LQQ A;  2NAZ A;  3WTU C;  4R79 A;  2ZFW A;  1R1T A;  4UNO A;  2VON A;  3LFK A;  4ZYH A;  1XD7 A;  1LQ1 A;  5CVJ A;  1Z05 A;  1S6L A;  2F5D A;  3HOT A;  1WSU A;  3TOB A;  1R22 A;  2O0Y A;  4UXN A;  5K5O A;  1AWC A;  3F6V A;  3F8C A;  4ENJ A;  1QZZ A;  4XLP F;  3BOQ A;  2ESH A;  2EA2 A;  1SMT A;  4PGG A;  3I54 A;  4HX4 A;  2UXN A;  2VE8 A;  4EM2 A;  3B73 A;  3O2P E;  4UVA A;  4JK1 X;  2RQP A;  4G9Y A;  2FEZ A;  3GVA A;  4BHB A;  1RUO A;  4LD5 A;  2W25 A;  5AON A;  1OKR A;  1ON2 A;  1D3Y A;  5AIP A;  4L9T A;  2YSR A;  1NHA A;  3RKW A;  1HW1 A;  1XCV A;  3J81 Z;  2IA1 A;  5ILS A;  4GXO A;  3KE2 A;  4HW0 A;  1FP1 D;  4A5M A;  1XDU A;  2KIU A;  2UWM A;  4RB3 C;  2B0L A;  2MLG A;  1Z6T A;  3F8F A;  1ZRC A;  1W4M A;  2DT5 A;  4LJZ F;  3CUO A;  3KLN A;  3S2W A;  4JBA A;  5HS9 A;  4I0B A;  4N0B A;  4MEY F;  4KIC A;  1ZLK A;  1VTN C;  1Z9C A;  3IL2 A;  3E6M A;  2BE5 F;  5E18 F;  1USS A;  3EET A;  2CSO A;  1O3R A;  3M7G A;  5CVU A;  3T5X A;  2ZME A;  4O3M A;  2K02 A;  3KZZ A;  3T0Y A;  1JHH A;  5ERI A;  3D5L A;  1LDJ A;  3G73 A;  5DV5 A;  1UHW A;  4CHU A;  2HWV A;  2A07 F;  3HHG A;  3W6J B;  3I59 B;  4AD9 A;  2DO7 A;  4ENM A;  4Y13 A;  1UHM A;  4M9Z A;  4MEX F;  2PMU A;  1I1S A;  4HDU A;  3WTV C;  4A6E A;  4N9I A;  3WGI A;  2GXB A;  1FPQ A;  2A6E F;  3I71 A;  6PAX A;  4HLY A;  1XMA A;  3RPU A;  2A61 A;  2FSW A;  3H3Z A;  1R58 A;  3F8N A;  3G3Z A;  3GX4 X;  4EM1 A;  1BI2 A;  1R00 A;  4PZJ A;  2W84 A;  2EFQ A;  2DTR A;  1O3Q A;  1RUN A;  2ESN A;  2GXG A;  1LVA A;  2DAO A;  3I5U A;  4RB2 C;  3VOD A;  2JZY A;  1SFE A;  3TQN A;  2LDU A;  2EFP A;  5DUI A;  3J80 K;  2QBY A;  5K5Q A;  2XVC A;  2PI0 A;  1O7L A;  1FNN A;  1ZN2 A;  3FM3 A;  2Q2E A;  1D5V A;  4CIC A;  4EJO A;  2PLY A;  5FLX K;  1KGS A;  3NQO A;  3R60 A;  4F7Z A;  1Z7U A;  1HXD A;  3FXU A;  3WTS C;  4U0Y A;  3BJA A;  2KKO A;  1EH7 A;  3K2Z A;  4BYY A;  1DDN A;  4RGU A;  1KU7 A;  5BQT A;  4ASN A;  2WWY A;  1IUY A;  4P96 A;  2VBY A;  4M74 A;  1U6G A;  1BOA A;  3FZV A;  2JRT A;  2JT1 A;  2FBH A;  5D4R A;  4CYD A;  1A04 A;  2IW5 A;  2FQ3 A;  1HBX G;  4I2O A;  3DPT A;  4CDG A;  3SZT A;  2OQR A;  5A2Q Z;  4Y15 A;  3JW4 A;  1GXP A;  2VC1 A;  1TQM A;  2GIV A;  4LG0 A;  3TKY A;  1IN4 A;  1YFH A;  2F5C A;  5HLH A;  4EGZ A;  5FFX A;  3Q5F A;  1LDD A;  1XMK A;  1PDN C;  2ZJ2 A;  5HS8 A;  4A6D A;  2DPD A;  3TO7 A;  4ON0 A;  2PN6 A;  3H3U A;  1V4R A;  3R0J A;  4BQA A;  2K4J A;  2KJC A;  4IRG A;  1QQI A;  4R1H A;  1FYL A;  2K4B A;  4KN4 X;  4UHT A;  3RPQ A;  4EMS A;  1H9G A;  3B02 A;  3HRS A;  2MBF A;  2GQQ A;  4I01 A;  2CW0 F;  4A12 A;  4M73 A;  4HBL A;  2DQL A;  2MLK A;  5E1Z B;  1RIO H;  3WTT C;  3L2C A;  1ONV A;  4IPA A;  2XKP A;  1ZRD A;  3IHU A;  1G3Y A;  2PG4 A;  4HDV A;  4OIO F;  5FD5 A;  3O3K A;  1I27 A;  1K79 A;  2VC0 A;  4I0A A;  4HLX A;  2HQN A;  2OD5 A;  1RZ4 A;  2PFB A;  1S3J A;  3VEP A;  4NB5 A;  4OIQ F;  2XAJ A;  4M72 A;  4RGS A;  4LLG F;  5LLQ A;  4B09 A;  1F4K A;  3E3V A;  2M45 A;  2HTS A;  5HLI A;  1YW7 A;  3EDP A;  1U8R A;  2FU4 A;  2IJL A;  5ICG A;  3IRR A;  2PQ8 A;  4KIB A;  4QWQ A;  2MH9 A;  3L7W A;  4M9X A;  2EJR A;  2X0L A;  3CUQ C;  4IF4 A;  4HV6 A;  2P6S A;  3Q9S A;  2V1U A;  3GWZ A;  2HFH A;  4NHJ A;  3LA7 A;  2EV0 A;  3L09 A;  4CGZ A;  4OIP F;  1TNS A;  3IKV A;  4I02 A;  1FSE A;  3R6S A;  2G7U A;  4IXA A;  4PDK A;  3ZMU A;  1R1V A;  3FMQ A;  3BPV A;  4CO8 A;  3K0L A;  4Q4Z F;  1TW3 A;  3L00 A;  2CYY A;  4EJV A;  3J7A O;  4AIJ A;  2VN2 A;  2R3S A;  2DBB A;  4CXF A;  3J81 K;  2VT2 A;  4HA8 A;  3M8E A;  3ABT A;  4LMY A;  5CVV A;  1D8J A;  2RGV A;  2M8E A;  5DUK A;  5J8F A;  1LEA A;  2ACJ A;  1K78 A;  1P4W A;  4KT5 C;  3RKX A;  3EQL F;  4PCQ A;  1MZB A;  1LNW A;  2IRF G;  4ZZL A;  4RB0 A;  1F9N A;  1ZAR A;  1ZGA A;  5JVT A;  4Z2Y A;  2RNJ A;  2Y0M A;  3NRV A;  2XGX A;  5E17 F;  3TOA A;  1U5T B;  4HYE A;  2IT0 A;  4L0Z B;  4Y17 A;  5A2Q K;  3V8K A;  2QVO A;  1STZ A;  2QQA A;  2P5K A;  3V7C A;  4MQV A;  4Q47 A;  4HQE A;  4IRH A;  3K1P A;  3FX3 A;  2P4W A;  1Z1D A;  2BGC A;  3LAJ A;  1XGM A;  4GYG A;  3RKY A;  3WTW C;  3WU1 B;  5LHG A;  1E2X A;  1FOK A;  2H6C A;  2X4H A;  2F5F A;  2Z33 A;  2FMY A;  1DUX C;  2GA2 A;  2KIM A;  2O8X A;  3GFM A;  4XSX F;  1Q1H A;  5CLS A;  5DCF A;  1KQ0 A;  2CGP A;  2AS5 F;  2RKH A;  3CLO A;  2NNY A;  4PGH A;  4GYI A;  1O3T A;  5IT3 A;  5FFZ A;  2L4M A;  2XAF A;  2KJB A;  1ODD A;  2A6H F;  3ISP A;  3QP6 A;  1ZLJ A;  1T6S A;  2HS5 A;  3MCZ A;  3CJN A;  3GFL A;  3KP2 A;  3O6B B;  2V9V A;  2NS0 A;  2O61 A;  5F6F A;  3M1E A;  4MQ9 F;  2HDC A;  1DPU A;  4AVP A;  1CF7 A;  5HS7 A;  1MD0 A;  2COM A;  1BIB A;  2OQG A;  1W5S A;  3R4K A;  1LJ9 A;  2DLL A;  5LGN A;  1FY7 A;  3SHF A;  5DEQ A;  3BDD A;  5JI6 A;  2RDP A;  3N4M A;  4AIH A;  5ICC A;  1KU2 A;  1QNT A;  1FWZ A;  2IA0 A;  4TV7 A;  2RN7 A;  1EH6 A;  4RAY A;  3JAM Z;  4RB1 A;  2M1B A;  1KU3 A;  4YIF A;  3CDH A;  1I1G A;  1EV7 A;  5F1R A;  1TNT A;  1UFM A;  1R7J A;  3V8L A;  4L9V A;  4YFK F;  1J7K A;  2G7H A;  4WX9 A;  1L0O C;  3E5U A;  3CUQ A;  3JTG A;  4MGR A;  5LRS A;  2M5W A;  1XGO A;  4R8H A;  1P6R A;  5CVI A;  2A68 F;  2OU2 A;  4L0Y B;  2K27 A;  3GEZ A;  1H9T A;  5L3F A;  3TDZ C;  2D2W A;  1LEB A;  3HRM A;  3AAF A;  4KIF A;  2XRO A;  1YTY A;  4WXD A;  4D0P A;  2KIF A;  3TDU C;  1YYV A;  2AXL A;  2GAU A;  4WCG A;  5KVR A;  5ICF A;  4L5I A;  3IRQ A;  1YLF A;  2L4A A;  3ERE D;  4M9S A;  3ZPL A;  4FHT A;  4A2U A;  4L9J A;  5BPD A;  1EH8 A;  4S04 A;  5D6F A;  1KA8 A;  3F3X A;  2DPU A;  4GCV A;  1XCB A;  3EUH A;  2QQB A;  1BM9 A;  1FX7 A;  5FO5 A;  4HF0 A;  1IW7 F;  4O6J A;  2NNN A;  2YX7 A;  2E7W A;  4LK0 F;  1U5T C;  2Z9O A;  1S8N A;  1XGS A;  1HKS A;  3E6B A;  5D5X B;  1CF7 B;  1BBY A;  4UV9 A;  3EYI A;  3EYY A;  1YO5 C;  4UVC A;  1KQ9 A;  3ZMV A;  2W85 A;  3QPH A;  2GWR A;  3IWF A;  2OZ6 A;  2HTJ A;  4M6Y A;  3GYH X;  3BJO A;  5L3C A;  4KMF A;  3Q9V A;  1MJ9 A;  3BP8 A;  3KP5 A;  1QPM A;  2FXA A;  2XAG A;  2ZNY A;  5L3B A;  1XSD A;  3C1D A;  1R5H A;  3U9G A;  4I98 B;  1TBX A;  3DQV C;  2D1H A;  3U2R A;  2VXZ A;  2HYG D;  2XUB A;  4OMY A;  3J80 Z;  1WQ2 A;  2EV6 A;  3V7R A;  4FT8 A;  4ZZD A;  1IN8 A;  1TW2 A;  3DFG A;  1O57 A;  3KEO A;  4LG0 B;  1BC7 C;  1OYI A;  1GVJ A;  3FXR A;  2LF7 A;  3ML6 A;  2H09 A;  1ZGJ A;  1P4X A;  2HZT A;  3SXY A;  3ZMT A;  4ENK A;  3KP7 A;  5DCM A;  1U5T A;  1ULY A;  4G7Z F;  4WWC A;  3F21 A;  1PP7 U;  1B1B A;  1F5T A;  4RAZ A;  4Q48 A;  4BNC A;  5BMZ A;  2ZKZ A;  5D6E A;  5DD4 A;  2EFN A;  2Q0O A;  5BOX A;  3HSR A;  5H6R A;  3ABU A;  2ZCW A;  3FMS A;  5JR3 A;  1SD6 A;  1S7O A;  5D8L B;  3CUQ B;  1FLI A;  3C7J A;  3ZQ7 A;  5FD6 A;  2NRA C;  1G3T A;  2FF4 A;  4KUM A;  1FBU A;  4OIN F;  1LDK B;  5K1Y A;  2QBY B;  5E1X A;  3HIF A;  4HOB A;  5LEJ A;  5DDG A;  3SFZ A;  4G7H F;  4NQW A;  2MA3 A;  3V8J A;  2DI3 A;  1ON1 A;  4YFX F;  4YII A;  1YS7 A;  4YFN F;  1ZH5 A;  4BXU A;  5J6X A;  3WGH A;  4JQF A;  2V79 A;  3ZN0 A;  1E17 A;  1K6O A;  4L9N A;  1B6A A;  4HX7 A;  2M30 A;  4AWX B;  4LB5 A;  5TJJ A;  4HX8 A;  3CO7 C;  2PMH A;  2CQK A;  1B9N A;  3HYI A;  1RI7 A;  2K86 A;  4LFU A;  4G6Q A;  1ZG3 A;  1X3U A;  3V4G A;  1KU9 A;  3F72 A;  1I6X A;  4HQM A;  4B8X A;  2E7X A;  5L3D A;  4FX0 A;  2XAH A;  3FHZ A;  4E70 A;  5L3E A;  1OPC A;  3MWM A;  1HKT A;  3R61 A;  3QAH A;  4O5V A;  3HSE A;  2XAQ A;  2DK5 A;  3RJP A;  3DF8 A;  1HST A;  1GHC A;  4Q5S F;  2VBW A;  3F22 A;  2V1D A;  2HR3 A;  1HSJ A;  1P92 A;  3MEX A;  1R1U A;  3FXQ A;  2L01 A;  4I09 A;  5HLG A;  1W7P B;  1MKM A;  4KNY A;  2Y75 A;  4HZF A;  4L5J A;  3LAP A;  5LBQ A;  3LA2 A;  4EJT A;  3K9T A;  4GO1 A;  5ED4 A;  4P9F A;  4MNU A;  1BC8 C;  2XIG A;  4EJW A;  1D8K A;  2Y48 A;  2QZ8 A;  5F64 A;  3SQN A;  4LK1 F;  1YW8 A;  4IHT A;  5D5V B;  3I64 A;  3KLO A;  4MTE A;  2PJP A;  1R5G A;  4HF2 A;  1JHF A;  2KRF A;  1K7A A;  4MTD A;  1TQI A;  3WU0 A;  2A3S A;  3BPX A;  2DFI A;  1MJB A;  5TRD A;  2P8T A;  3P9C A;  3KP3 A;  1IN6 A;  5HOO A;  2RV8 A;  3QP5 A;  3I0T A;  2R7D A;  4N9H A;  4IRI A;  2ZXJ A;  2MD5 A;  1MDM A;  2EFW A;  4RGR A;  1TLH B;  5L3G A;  3MZH A;  2Z3Y A;  1J0R A;  4WXC A;  4U7B A;  2L02 A;  3ZMS A;  4P55 A;  1FSH A;  4I7H A;  4H0E A;  5JHU A;  4G6D A;  1FC3 A;  2ZME B;  5LHH A;  5H20 A;  4KDP A;  3IWZ A;  4U0W A;  3RYP A;  1ZRF A;  5ILV A;  1UST A;  2CO5 A;  3V7S A;  1FZP B;  2OA4 A;  1ZRE A;  2ISZ A;  2LSO A;  5H6Q A;  4ZYE A;  4XRF A;  1IN7 A;  2V6C A;  3ROU A;  2J5P A;  3HHH A;  3CTA A;  4EM0 B;  1J5Y A;  1R23 A;  3MZY A;  1JE8 A;  3GF2 A;  3HOS A;  2FA5 A;  1XGN A;  4P5O A;  5D4S A;  1HW5 A;  4K2E A;  3TGN A;  5EEH A;  3FWE A;  3KEQ A;  4MHG A;  4HAM A;  3RDI A;  1SD5 A;  3WGG A;  4WK8 F;  2QM3 A;  2ZNZ A;  4DNC A;  2YX4 A;  2FBI A;  1BI1 A;  2P7C B;  2O6G E;  2OBP A;  2OAZ A;  1SMY F;  4ZYD A;  3ZN1 A;  1KYZ A;  5LGU A;  2BBY A;  2HKX A;  4EV0 A;  5LRR A;  1BJA A;  4ESF A;  3E97 A;  3P9K A;  1Z6R A;  4HF1 A;  4WXH A;  2GA1 A;  1G6N A;  4G7O F;  3DPL C;  2H94 A;  4L18 B;  1PUE E;  2BV6 A;  2XKO A;  3KZY A;  2O03 A;  5DYM A;  5ICE A;  3GW2 A;  3DV8 A;  2DU9 A;  3E6D A;  1YG2 A;  2G9W A;  4OIR F;  1I5Z A;  3NEU A;  4BAY A;  2C6Y A;  1O3S A;  2MC3 A;  4KA4 A;  3F8M A;  3I59 A;  3HRT A;  4OOI A;  2ELH A;  1IN5 A;  4ENN A;  1JXS A;  3HRU A;  1B9M A;  3LWF A;  5HDN A;  5HVQ C;  1G3S A;  3M8F A;  3QRF F;  1QO0 D;  4RS8 A;  4M71 A;  4ZYG A;  4M6X A;  1Z91 A;  3F6O A;  2A5Y B;  5E8I A;  1RNL A;  2P6T A;  2WTE A;  3T8R A;  2RC4 A;  2FNP A;  5JFR A;  2DQR A;  3GFJ A;  2WV0 A;  2J5O A;  4EJU A;  2Q8K A;  1F1Z A;  1IRF A;  3ZMZ A;  2F2E A;  2DK8 A;  1C0W A;  1XDS A;  3IC7 A;  1SAX A;  4IVN A;  1H0M A;  4QLC U;  3FMR A;  2EA4 A;  5AIQ A;  1J75 A;  3SZP A;  2EWN A;  5D8K B;  2QYO A;  4G8X A;  3U1D A;  3JSO A; 
#chains in the Genus database with same CATH topology
 1K6Y A;  1S7A A;  5CYV A;  5E3M A;  1CGP A;  4XK4 A;  4LLL A;  1R4M B;  5M5X J;  3DU6 A;  5IT9 K;  3KEY A;  2QQ9 A;  3QPT A;  4XBF A;  4F91 B;  1OCZ H;  2R5Y B;  1YRN A;  3RIR A;  3RKQ A;  2PBI A;  2L3D A;  4KT6 A;  4U0V A;  3ZMD A;  2HOE A;  4FCY A;  3MQ0 A;  3COA C;  1V3F A;  3E6C C;  4F52 A;  3DEW A;  4YG2 F;  2DW4 A;  3H92 A;  3KP6 A;  3G4S I;  1XB4 A;  1TWF J;  1L3L A;  2FNA A;  2XF7 A;  3LL7 A;  4AUX A;  3OSG A;  2HYJ A;  3K1N A;  2ADU A;  1TWC J;  4A0X A;  2ZJR F;  2ZBK A;  2L9S A;  1T39 A;  1LE8 B;  1RRJ A;  2QSG X;  4EVI A;  1FYM A;  2R7Q A;  2QLZ A;  4HPQ A;  4OMZ A;  1VQO I;  2AO9 A;  3JR9 A;  3Q3S A;  4FX4 A;  1VQ9 I;  5E3L A;  3C3W A;  3JTH A;  1B4A A;  1U2W A;  3RZO J;  2R7F A;  3BWG A;  1AA7 A;  5KNL A;  1K78 B;  3LQR A;  5B5E C;  1R36 A;  3W2V A;  2WY7 Q;  3P7N A;  2IPQ X;  3M9A A;  3W6K B;  1OYW A;  1E3H A;  1GV2 A;  1X2N A;  5LGT A;  3H9J A;  3IKT A;  4IZZ A;  1K61 A;  3DP7 A;  2KZV A;  2L54 A;  4CYC A;  1QBJ A;  3HOY J;  2H8W A;  2VOD A;  4HSR A;  3C18 A;  3OIO A;  1BI0 A;  1MBJ A;  3BJ6 A;  1MGT A;  2XSJ C;  1BI3 A;  3G6E I;  1SD7 A;  2WC2 A;  5E3O A;  2EK5 A;  3GUD A;  3BZ6 A;  3CCL I;  4KN7 X;  5IT9 Z;  3IH3 A;  4ESB A;  2JPB A;  5BS6 A;  4BHC A;  4PSX A;  1T38 A;  1K4T A;  2BEO A;  1ZYR F;  2CFX A;  4FET A;  1IGN A;  3GZ5 A;  5EEG A;  2YS9 A;  4A5N A;  5KAI C;  3PFI A;  3I53 A;  2V1X A;  2X1E A;  1MJA A;  1T98 A;  4OAY A;  4AIK A;  2CUZ A;  1G3W A;  3BG7 A;  1SVO A;  2VT3 A;  2HEO A;  3JCU C;  2HYF A;  4XSZ F;  4J00 A;  1O7F A;  3CMM A;  2STW A;  3PNV A;  4E7I A;  2ZC2 A;  2R7X A;  2UZK A;  1PVE A;  2QEX I;  1FBS A;  1YW9 A;  1VF9 A;  4ZTF A;  1DGR M;  3I4P A;  1MBF A;  5EJC A;  3TW6 A;  1D1B A;  1S29 A;  3PQK A;  4RGX A;  2HOS A;  5FGM A;  4ETS A;  3DXJ F;  1WI9 A;  2TDX A;  2Q1Z B;  2XAS A;  2M34 A;  4OAZ A;  4PFP A;  2OC6 A;  2ETH A;  1KYW A;  2E1C A;  2Y30 A;  1U3E M;  4CYC B;  3HL2 A;  1SC7 A;  2KQR A;  4BE1 A;  2M4G A;  4P9U A;  5EZG A;  2D45 A;  1JGG A;  1OMI A;  4NC7 A;  2IS4 A;  1WH7 A;  5K7Z A;  4BE0 A;  1D0Z A;  2QQ8 A;  2Z99 A;  4N4O B;  2Z5U A;  2MH2 A;  4XON A;  3K69 A;  5GTI C;  2DMN A;  2PJR A;  2TRT A;  1WKM A;  2QKL B;  2VKV A;  3OV8 A;  1TWG J;  2Q2E B;  5F27 A;  2P5V A;  1X3Z B;  3TMO A;  4KFC A;  1Z0X A;  3BC8 A;  1TQP A;  3P9I A;  3OL3 A;  3L9F A;  4IJA A;  2RAE A;  3GZ6 A;  2RRE A;  3DKX A;  3HSF A;  3LSH A;  1D5Y A;  2FE3 A;  3K1M A;  2H27 A;  3OYM A;  4OU0 A;  4BBS J;  3TO9 A;  3ECO A;  3MAJ A;  4ZDO A;  1WJF A;  4LLN A;  1VQ4 I;  3G2B A;  3PFY A;  3KFW X;  3QPL A;  3LST A;  1YQA A;  2JSP A;  1SEU A;  1SFU A;  2EFO A;  2PEX A;  2QEN A;  5F1J A;  5HDK A;  3ELK A;  5FJ8 J;  2PMZ N;  4W97 A;  5E3N A;  1PP8 F;  1IRG A;  3VFZ A;  1IXS B;  4U7D A;  3WTZ A;  2OJE D;  1TZL A;  1WH5 A;  3DEU A;  2HKO A;  5CJ9 A;  3ULQ B;  3ZQC A;  1WJE A;  2L7K A;  2QGU A;  4DOZ A;  1VQP I;  1FYK A;  4DZJ A;  3E5X A;  3KCC A;  3HKZ N;  1QA6 A;  2GXA A;  2XV4 S;  4XQF A;  1Y0U A;  2JA5 J;  3PNT A;  4GGG A;  4PSW A;  1W5T A;  1Z3X A;  1SAN A;  3T8T A;  2EB7 A;  3DKW A;  2BVM A;  2BHZ A;  3K4B A;  1BL0 A;  2QWW A;  2IBD A;  3HM5 A;  5LEK A;  1U78 A;  1IXR C;  4BE2 A;  2A5W A;  2FRH A;  2UXX A;  3CDI A;  2VKH A;  2ELJ A;  3AL0 C;  5GPC A;  2ZO4 A;  5FRO A;  5DD8 A;  2LNB A;  1YS6 A;  1Y56 A;  3K70 C;  1OR7 A;  3BQZ A;  1VQN I;  2IA2 A;  1QHG A;  1YE9 A;  1GXQ A;  1KZH A;  1LB2 A;  3BT9 A;  2XB0 X;  3CO6 C;  2KIQ A;  3WTY C;  2OPT A;  2OCE A;  4QIW N;  3CMA I;  5BPI A;  3WG9 A;  1REP C;  3SYT A;  1J59 A;  3DBH B;  1IC8 A;  1MSE C;  1MDM B;  4M3D A;  1TTY A;  2H6B A;  3H0D A;  5D5W B;  1HC8 A;  4KMU X;  3T1B A;  4IKF A;  5E8G A;  1HQC A;  3JSP A;  1DP7 P;  2W24 A;  4JX6 A;  3HEF A;  3BCB A;  3ZCO A;  4KIG A;  2CU7 A;  3MFK A;  3A01 A;  2R0Q C;  3RTR A;  2W57 A;  2CFO A;  3JRI A;  3WG7 H;  3S16 J;  1FMV A;  2QUF A;  5KK1 A;  4XLN F;  2DMQ A;  3BG3 A;  1ZG5 A;  4DZP A;  4FIS A;  3VB2 A;  5FLM J;  3ZP5 A;  2F5E A;  1BN5 A;  2HNH A;  1W7P D;  4UV8 A;  2M7A A;  1O4X A;  3FBN B;  2JPC A;  2STT A;  2K7L A;  2OZU A;  4UVB A;  5J8C A;  4FE4 A;  3QU6 A;  1FMW A;  2LF8 A;  3ZRG A;  3WOD F;  3DTI A;  2EV5 A;  2IP2 A;  4F92 B;  3JRH A;  4S0H B;  1XSV A;  4KIS A;  1ITY A;  1DPR A;  5FB2 A;  3M4O J;  2ECB A;  1J2X A;  4HNT A;  3S3M A;  2HGC A;  3GO5 A;  1Y39 A;  3M8J A;  3QU3 A;  2QCO A;  5HDG A;  4NC6 A;  3OMY A;  3S14 J;  1IXC A;  2GZW A;  3FM5 A;  2QF7 A;  3TL4 X;  5J40 A;  1XSX A;  4IO9 F;  1LVK A;  1IRZ A;  4A0Z A;  1ETK A;  3W2W A;  3ECH A;  2VBZ A;  1K6O A;  2YU3 A;  1QZY A;  5K5R A;  4ZYA A;  1P7I A;  1IDZ A;  3Q0W A;  3G1M A;  3KZI C;  1HKQ A;  3BRO A;  1HW2 A;  3HTS B;  4BH9 A;  2H1K A;  1MBE A;  2V4J C;  2W1O A;  3J7Y J;  3I55 I;  4I99 C;  3QOP A;  5IP9 J;  4G94 A;  3HTU A;  4HNV A;  2IGK A;  5HOD A;  5CVR A;  1DU0 A;  2L9V A;  5ILU A;  2HXI A;  3RI4 A;  3CP8 A;  1WRJ A;  2E1N A;  4QSH A;  2M7B A;  4ESJ A;  5C44 J;  2YPR A;  5FLX Z;  5D5U B;  3MKY B;  2P5L C;  5E20 A;  2HZD A;  3PQJ A;  1FBQ A;  4ZH4 F;  3D5S C;  3RYR A;  5DCM B;  2CWE A;  2LY1 A;  2X6O A;  1S72 I;  1QGP A;  2FOK A;  3LSM A;  1WWX A;  4LGW A;  3D0S A;  4DQ2 A;  1J9I A;  2CG4 A;  3ABL H;  4B48 A;  4L5E A;  2LBF B;  2JSC A;  2FML A;  1FT9 A;  2VE9 A;  1FP2 A;  4IHV A;  1UCR A;  3GXO A;  2A69 F;  2HQR A;  3AKZ A;  3TP3 A;  4CZZ A;  2F4O B;  1ZK8 A;  2DFH A;  3GTJ J;  2XRN A;  3OOP A;  1ZGW A;  2E34 A;  3E5Q A;  2NYX A;  2VOP A;  1B59 A;  2VOO A;  4IEJ A;  1SFX A;  2CUJ A;  3HXL A;  5CPR B;  1NH3 A;  2AXT C;  5IP7 J;  3WTX C;  4II2 A;  1T0F A;  2M87 A;  2L0K A;  2VQL A;  1OFC X;  4V2F A;  2VQC A;  3R0A A;  2O3F A;  1OYY A;  1MBK A;  3LSP A;  2KP6 A;  2R7O A;  3ZQI A;  2E1M B;  1VQ6 I;  3KP4 A;  1P4A A;  4UUV A;  2IVM A;  5EGO B;  4EGY A;  2LY2 A;  1S9H A;  1HLV A;  1YIO A;  3CCU I;  3FF5 A;  3AFH A;  1IZ1 A;  2FBK A;  3S93 A;  4QPO A;  4IHW A;  1KQ8 A;  5LHI A;  3F23 A;  3F8B A;  3HZJ A;  1BIA A;  1RPW A;  5E1W A;  3OOU A;  1IAW A;  3GLX A;  3VOE A;  3GTG J;  2ISY A;  4S05 A;  3CJT B;  3I58 A;  4XKC A;  2NOJ B;  1IF1 A;  1P2F A;  2UUZ A;  1B72 B;  3LA3 A;  3VSK A;  2LKP A;  2P7V B;  1Z7L A;  3GFI A;  4M3B A;  1JGS A;  3X2Q H;  2E5Z A;  1H8A C;  5IPA A;  1UB9 A;  3OYA A;  3BY6 A;  2B7E A;  1ZAO A;  1MMN A;  4BHP A;  3TO6 A;  3A4C A;  3WE3 A;  2H8R A;  3ZXS A;  4KYW A;  1NG6 A;  3HPG A;  1T2K A;  2YR2 A;  1X4P A;  1W7P A;  4DBQ A;  5KHD A;  4LB6 B;  4WF2 A;  1ZG1 A;  3REO A;  3N05 A;  1TC3 C;  3HUG A;  2HQA A;  3JRF A;  4U88 A;  4PJM A;  3N97 A;  2VBX A;  4EQQ A;  4A0Y A;  2D1V A;  2RVC A;  1ZTR A;  2VLA A;  2WAE A;  4B3A A;  1MH4 A;  1IJW C;  3WE2 A;  1ZHF A;  4YEJ A;  5K7H A;  4IHS A;  1AOY A;  4HV5 A;  1DP3 A;  3HGG A;  2BVL A;  1UMQ A;  1XN7 A;  1SD4 A;  3KET A;  2BHY A;  5J47 A;  3W2A A;  3JAM K;  1G2H A;  2JTV A;  2BYV E;  3HJE A;  2XHK A;  3HOU J;  3MVP A;  4ZC3 A;  1G4D A;  4C3J J;  3LQQ A;  3OYN A;  3KIO A;  2NAZ A;  3WTU C;  2LKS A;  4R79 A;  3KYL A;  4BXF A;  2ZFW A;  1R1T A;  3K4J A;  4UNO A;  2VON A;  3LFK A;  4ZYH A;  1XD7 A;  3PNY A;  3L2R A;  2VB6 A;  1LQ1 A;  1ETQ A;  5CVJ A;  2R5Y A;  1Z05 A;  3CCS I;  1S6L A;  2M2E A;  2FD5 A;  2R92 J;  2F5D A;  1X1A A;  3G1L A;  2DA4 A;  3HOT A;  4J19 A;  1WSU A;  4GFB A;  1WJD A;  4NUB A;  3VYU B;  3IP4 B;  4XOT A;  5BNG A;  3CF2 A;  3TOB A;  4A3L J;  3RQ4 A;  2LYC A;  1R22 A;  2BY3 A;  2DMU A;  2O0Y A;  4UXN A;  2ICW G;  2O9L A;  3VDX A;  3TW7 A;  3SJM A;  4XLC A;  5K5O A;  3TP0 A;  2FX0 A;  4XOR A;  4QTR A;  1VQ8 I;  3A02 A;  1AWC A;  1ZQ3 P;  4PUS A;  3F6V A;  2BXZ A;  3F8C A;  2LBF A;  4ENJ A;  3L1P A;  1GUU A;  2R7T A;  1QZZ A;  3HPH A;  4XLP F;  2V7F A;  1MMD A;  3BOQ A;  2ESH A;  2EA2 A;  4ZDL A;  2R7W A;  1SMT A;  4I76 A;  2ZFU A;  4PGG A;  3I54 A;  2R5Z A;  4IQ4 A;  1U8B A;  3H9G A;  2EZL A;  4HX4 A;  2UXN A;  2VE8 A;  2OTJ I;  4DGW B;  1Y8Q B;  3IV5 A;  2CW7 A;  4EM2 A;  3B73 A;  3O2P E;  4UVA A;  4B44 A;  1VQL I;  3QYB A;  4NNJ A;  4JK1 X;  2RQP A;  4G9Y A;  3SDG A;  2IS1 A;  1Z21 A;  2FEZ A;  3AG1 H;  3GVA A;  4BHB A;  1RUO A;  4LD5 A;  2W25 A;  1XMX A;  3JRD A;  5AON A;  1OKR A;  1ON2 A;  1D3Y A;  5AIP A;  2HQ5 A;  4L9T A;  2YSR A;  1NHA A;  3RKW A;  2BY1 A;  2H1L A;  1HW1 A;  1XCV A;  2ZXI A;  3J81 Z;  3G71 I;  2IA1 A;  3P5J A;  5ILS A;  4GXO A;  1HCR A;  3KE2 A;  4HW0 A;  1JTX A;  3KYD B;  5JLX A;  1FP1 D;  2Y69 H;  2GLO A;  4A5M A;  1XDU A;  2KIU A;  1QZE A;  3S15 J;  5CQE A;  5F0F A;  5M5W J;  1VQ5 I;  2DFF A;  4XM3 A;  5JHF A;  4XRS G;  2UWM A;  4RB3 C;  4XLE A;  2B0L A;  2W48 A;  4RAF A;  2KPM A;  2JWT A;  2MLG A;  1Z6T A;  3JRB A;  4E7K A;  2MW8 A;  3QQA A;  4PJN A;  3F8F A;  3K4K A;  1FOY A;  1IRX A;  1WJA A;  4X0G A;  1ZRC A;  5HNH A;  1W4M A;  3KX2 A;  1UG0 A;  1FIP A;  2DT5 A;  2FQ4 A;  4LJZ F;  2DMT A;  3CUO A;  3KLN A;  5C3E J;  3ESW B;  3PIP F;  1BW5 A;  3S2W A;  4JBA A;  2K9M A;  4XKV A;  5HS9 A;  4I0B A;  2OUM A;  2XPU A;  4MEY F;  4N0B A;  2WAD A;  4KIC A;  5KCM A;  5IOY A;  4YIR X;  1ZLK A;  1VTN C;  5GPA A;  1Z9C A;  1UAA A;  3IL2 A;  3E6M A;  2BE5 F;  5E18 F;  1USS A;  2COB A;  3EET A;  2CSO A;  1O3R A;  3ZQF A;  3M7G A;  1Y8R B;  2LKX A;  3HOZ J;  5CVU A;  3T5X A;  2ZME A;  3CCM I;  4O3M A;  2ZXH A;  4CCJ A;  2K02 A;  3KZZ A;  1ENH A;  3T0Y A;  3QYF A;  2A6T A;  2E5N A;  1CQT A;  4CA0 A;  1JHH A;  4A3G J;  5ERI A;  3BG9 A;  3D5L A;  1OJL A;  4I6Z A;  1LDJ A;  3G73 A;  3DEE A;  5DV5 A;  3SFI A;  1T8I A;  1X3W B;  1UHW A;  1WZ2 A;  2UV1 A;  3DU5 A;  4CHU A;  4A3E J;  1MMS A;  1V5G A;  2HWV A;  2ZJP F;  3HHG A;  2JK3 A;  4V2G A;  2A07 F;  3W6J B;  3I59 B;  4AD9 A;  2DO7 A;  3WU2 C;  4ENM A;  4Y13 A;  1MMA A;  3ZQQ A;  1UHM A;  1SVL A;  4M9Z A;  4A3J J;  2EIJ H;  4MEX F;  2HVR A;  5J1R A;  1H89 C;  2JMW A;  2PMU A;  1I1S A;  1LPQ A;  2MAB A;  3FIS A;  5GTH C;  4HDU A;  3WTV C;  5J4V A;  4A6E A;  3BCA A;  2VJI A;  1T56 A;  4KJZ A;  4N9I A;  3WGI A;  2GXB A;  1FPQ A;  3C2B A;  4CH7 A;  2A6E F;  3I71 A;  4E7H A;  3OYF A;  6PAX A;  4HLY A;  1W1W E;  2K85 A;  4JOM A;  2ID3 A;  4Z6Y A;  1XMA A;  4NQW B;  4RA2 A;  4ZDP A;  3RPU A;  4M3G A;  2A61 A;  2FSW A;  3K4N A;  1Y1V J;  3H3Z A;  1R58 A;  3F8N A;  2GBY A;  5IYC J;  1VND A;  2LVS A;  3G3Z A;  1GVD A;  1W36 D;  3GX4 X;  4EM1 A;  3B6A A;  1UEL B;  3PUB A;  3H35 A;  3OSF A;  1BI2 A;  2B63 J;  1R00 A;  3JRC A;  4PZJ A;  2W84 A;  2EFQ A;  2DTR A;  2FJ1 A;  4DIQ A;  1O3Q A;  2E2H J;  2XDV A;  2NVX J;  1Y6I A;  2E71 A;  1RUN A;  5M3F J;  2ESN A;  3SDB A;  4BGD A;  2GXG A;  2XRL A;  3D1N I;  1LVA A;  2DAO A;  3I5U A;  4X6A J;  3BTI A;  3GBG A;  3VOD A;  4RB2 C;  2JZY A;  3TED A;  1SFE A;  2CV2 A;  3TQN A;  2LDU A;  2EFP A;  5DUI A;  3HDD A;  3J80 K;  2QBY A;  2HOT A;  5K5Q A;  2XVC A;  2BY2 A;  4JX4 A;  2PI0 A;  2LC2 A;  1O7L A;  1FNN A;  1OR7 C;  3H5N A;  3ZQG A;  3VWB A;  1BR1 A;  5EYR A;  2R93 J;  1ZN2 A;  3FM3 A;  3QOE A;  2Q2E A;  3BG6 A;  4UUT A;  4LIT A;  1D5V A;  4CIC A;  1YRN B;  3DTK A;  4EJO A;  1A31 A;  2PLY A;  5FLX K;  1KGS A;  3NQO A;  3R60 A;  4F7Z A;  2R7R A;  3L2Q A;  1ZR2 A;  2IGN A;  3CLQ A;  2Y9Y A;  3GTL J;  1Z7U A;  2MSY A;  1VQ7 I;  3U1K A;  1LE8 A;  1D1A A;  1HXD A;  3FXU A;  3QPS A;  3WTS C;  2OCC H;  4U0Y A;  3BJA A;  2KKO A;  1EH7 A;  3K2Z A;  4E7L A;  4BYY A;  3ZQL A;  2XC7 A;  1DDN A;  4RGU A;  1KU7 A;  5BQT A;  4ASN A;  2WWY A;  3LOC A;  3DBL B;  1IUY A;  4P96 A;  2VBY A;  4M74 A;  1U6G A;  3VYT B;  4ANJ A;  3OYL A;  1BOA A;  2DA5 A;  3CCE I;  4BY1 J;  3FZV A;  4EEF G;  2JRT A;  1BOB A;  1EA3 A;  2FBH A;  2JT1 A;  5D4R A;  3M3Y J;  5GAE J;  4CYD A;  1A04 A;  2IW5 A;  1TT0 A;  2FQ3 A;  2X6Y A;  5C4X J;  3DTE A;  1R5I D;  1HBX G;  4I2O A;  1X2M A;  2EZK A;  3DPT A;  4CDG A;  2K3P A;  3SZT A;  1LFB A;  2OQR A;  5A2Q Z;  2G0E A;  2WV1 A;  1WCM J;  3PSF A;  4Y15 A;  3JW4 A;  1GXP A;  1PJR A;  2VC1 A;  1TQM A;  2GIV A;  3F9K A;  4LG0 A;  3IAS 2;  1Y0N A;  5M3M J;  1UJ8 A;  3TKY A;  1IN4 A;  1YFH A;  1EKE A;  2F5C A;  3UKG A;  3MKW B;  2O7O A;  4F93 B;  2Y2Z A;  2JA8 J;  3OWT A;  4A69 C;  5HLH A;  1R6R A;  4EGZ A;  3HB9 A;  3I4M J;  5FFX A;  2E2I J;  4BJ5 C;  2F5V A;  3Q5F A;  3CME I;  1LDD A;  1YJ9 I;  2TCT A;  1XMK A;  2LFB A;  4UY8 I;  1PDN C;  2ZJ2 A;  1WFX A;  2V1N A;  1ETY A;  1I50 J;  3BG5 A;  4A6D A;  5HS8 A;  2DPD A;  4ON0 A;  3TO7 A;  2PN6 A;  3H3U A;  3CCR I;  5FKM A;  1V4R A;  1IV8 A;  3S1M J;  3R0J A;  3GME A;  1N75 A;  4RDU A;  3OYK A;  4BQA A;  2DCE A;  2K4J A;  2KJC A;  2VJJ A;  4IRG A;  3S2D J;  2XPW A;  1QQI A;  3GTK J;  4R1H A;  2K4B A;  1FYL A;  4KN4 X;  4UHT A;  3RPQ A;  1WHU A;  2CJJ A;  4EMS A;  1H9G A;  4XMY A;  3B02 A;  4XOP A;  5C4J J;  3HRS A;  2F4I A;  1JKQ C;  2MBF A;  2GQQ A;  4I01 A;  3HOX J;  4ZJZ A;  2P0W A;  2CW0 F;  1I3A A;  2X6W A;  4AYB N;  4A12 A;  3BZC A;  1W36 C;  4M73 A;  4HBL A;  4HRI A;  2R7V A;  3OYG A;  2VUM J;  5GAG J;  1W0T A;  2CUE A;  2BOL A;  2DQL A;  2MLK A;  5E1Z B;  2KL4 A;  1IV6 A;  2KLO A;  1RIO H;  3WTT C;  3OL4 A;  3L2C A;  4U87 A;  1ONV A;  3V42 A;  2I10 A;  1YX3 A;  3FBI B;  4IPA A;  3RPU D;  3LSG A;  2IGO A;  2XKP A;  1V54 H;  2LOO A;  3PSI A;  2KRC A;  4UUS A;  2CW8 A;  2VPR A;  1ZRD A;  2ZSH B;  3J7A Y;  2VKE A;  1QVU A;  5J1U A;  3IHU A;  1DU6 A;  1G3Y A;  2E2J J;  2PG4 A;  3K4L A;  4LIV A;  2K9Q A;  1W0U A;  4HDV A;  4OIO F;  2BZT A;  1AU7 A;  5FD5 A;  2NOG A;  1NTC A;  1I27 A;  3O3K A;  1K79 A;  2VC0 A;  3BR2 A;  2CV0 A;  4I0A A;  4HLX A;  2HQN A;  4AC0 A;  1X4O A;  4BQO A;  2OD5 A;  2AQF A;  2LLK A;  1RZ4 A;  3OYJ A;  1YJW I;  1AKH B;  1J09 A;  2E60 A;  2PFB A;  1S3J A;  2W4S A;  2CV1 A;  3RSN A;  3VEP A;  2MC4 A;  4RBO A;  3S3O A;  2L2O A;  4NB5 A;  4OIQ F;  2XAJ A;  4M72 A;  4RGS A;  2DOA A;  5IP6 A;  4G6T B;  4LLG F;  5EG0 B;  2NS8 A;  3AG2 H;  4C9Y A;  4B09 A;  3BLY A;  5LLQ A;  2NS7 A;  1WI3 A;  1F4K A;  3E3V A;  2M45 A;  5HNF A;  1MW7 A;  1RES A;  4FE7 A;  1S7E A;  3AG4 H;  1B8I A;  3S1R J;  2HTS A;  2DJI A;  5HLI A;  1YW7 A;  3EDP A;  3ZQH A;  1U8R A;  2FU4 A;  2M8G X;  2IJL A;  5ICG A;  2WB1 A;  3IRR A;  2PQ8 A;  4KIB A;  4QWQ A;  2MH9 A;  3DLL F;  2DYR H;  3BR6 A;  3L7W A;  4M9X A;  2EJR A;  2IAI A;  2NXN B;  2X0L A;  3CUQ C;  4HV6 A;  2P6S A;  4IF4 A;  2V9P A;  2ZB9 A;  4XN0 A;  3I56 I;  4OWR B;  1OCC H;  3Q9S A;  2V1U A;  3CCQ I;  3H1C A;  2DA2 A;  3GWZ A;  1YI2 I;  2HFH A;  2DXI A;  4NHJ A;  4DYC A;  2LR8 A;  3DPU A;  3LA7 A;  2EV0 A;  3L09 A;  3NWT A;  1A5J A;  2ECC A;  5EG0 A;  4CGZ A;  4OIP F;  1TNS A;  3IKV A;  2F6C A;  4I02 A;  2R7S A;  1FSE A;  1ERD A;  3FXJ A;  3R6S A;  1M1E B;  2G7U A;  4IXA A;  1JT0 A;  4PDK A;  3O8G A;  3VYS B;  3NWS A;  3ZMU A;  1R1V A;  1RC9 A;  4JYK A;  3FMQ A;  3BPV A;  4FTH A;  4CO8 A;  1GLN A;  3K0L A;  4Q4Z F;  1TW3 A;  2ELK A;  1ZEL A;  3PJR A;  2VIX A;  3L00 A;  2CYY A;  4EJV A;  3J7A O;  1JKP C;  4AIJ A;  2VN2 A;  1R71 A;  1P7J A;  2R3S A;  2DBB A;  3F0C A;  2XSD C;  3PO2 J;  2DA1 A;  4CXF A;  3J81 K;  2VT2 A;  1R49 A;  4HA8 A;  3M8E A;  3ABT A;  4DJA A;  4LMY A;  5CVV A;  1D8J A;  3PIO F;  2ID6 A;  2RGV A;  2M8E A;  3QYE A;  1YOV B;  5DUK A;  5J8F A;  1LEA A;  2M0M A;  1XPX A;  2B9S A;  4Y52 J;  3CCV I;  3DKY A;  2ACJ A;  1K78 A;  3HUG B;  1P4W A;  2XGC A;  5KAF C;  2CMP A;  4KT5 C;  3RKX A;  1HDP A;  1XX5 A;  3EQL F;  4PCQ A;  4XKB A;  1W5C C;  1MZB A;  5GAH J;  1LNW A;  2K9N A;  2DJN A;  2IRF G;  1LFP A;  4ZZL A;  4RB0 A;  2QKM B;  2E19 A;  1NG7 A;  4XLA A;  1F9N A;  3PL8 A;  1PUF A;  1ZAR A;  1ZGA A;  5JVT A;  4Z2Y A;  5JLW A;  2RNJ A;  3HC7 A;  2Y0M A;  2EZH A;  3BTC A;  3NRV A;  2XGX A;  3RCO A;  1K83 J;  2DOE A;  3CJR B;  2WBM A;  4A3K J;  1YJN I;  3CC4 I;  3TOA A;  5E17 F;  2MG4 A;  1U5T B;  3ABK H;  4HYE A;  5IYD J;  2IT0 A;  4L0Z B;  4Y17 A;  5A2Q K;  2V26 A;  3V8K A;  2QVO A;  1STZ A;  2QQA A;  2P5K A;  3V7C A;  4MQV A;  3MKL A;  3JRE A;  4Q47 A;  2X6X A;  2DT7 B;  4HQE A;  3NAU A;  2E1M C;  4IRH A;  3HG9 A;  3K1P A;  3FX3 A;  1R9T J;  2P4W A;  1Z1D A;  1B8I B;  2BGC A;  2HU9 A;  3LAJ A;  2JJ7 A;  1XGM A;  4II3 A;  2HOA A;  4GYG A;  4MLO A;  3RKY A;  3K70 D;  2OTL I;  3WTW C;  3OR2 C;  4RLF A;  3WU1 B;  5LHG A;  1E2X A;  1FOK A;  4V19 K;  3OYI A;  2H6C A;  4HNU A;  2Y9Z A;  2X4H A;  4X1E A;  2F5F A;  2LTP A;  3S17 J;  2Z33 A;  2R4G A;  2FMY A;  3K4M A;  5LD2 C;  4AVZ A;  2DT6 A;  1DUX C;  2GA2 A;  4PJJ A;  3A0H C;  2E1O A;  2KIM A;  2O8X A;  2P81 A;  2NVT J;  1RET A;  4H4K C;  1HA8 A;  1NK3 P;  3GFM A;  1TP4 A;  1WGX A;  3H36 A;  3BZK A;  4XSX F;  1Q1H A;  3IH4 A;  5CLS A;  5DCF A;  5EEA A;  1KQ0 A;  2WAQ N;  2CGP A;  1JTY A;  4E7S A;  4N4N B;  2AS5 F;  2RKH A;  3CLO A;  2PX9 A;  2KDO A;  2NNY A;  2K5C A;  2NVU B;  1BR4 A;  4PGH A;  2VPL A;  4GYI A;  3M1C A;  5B3S H;  2DN0 A;  3FXM A;  1O3T A;  2EIN H;  4C3H J;  5IT3 A;  5FFZ A;  2HVS A;  5F04 A;  3K4C A;  1OLT A;  5J1Y A;  5F08 A;  1HF0 A;  2XGE A;  3OYH A;  2L4M A;  3PUF A;  1VFC A;  2K40 A;  2HDW A;  2XAF A;  2KJB A;  3EPZ A;  1ODD A;  1WJB A;  2A6H F;  1T95 A;  2XF6 A;  3ISP A;  3QP6 A;  1ZLJ A;  1JUP A;  2CQX A;  1T6S A;  2HS5 A;  1HOM A;  2EPF A;  3MCZ A;  2CQQ A;  4D5F A;  4RLQ A;  3FXO A;  1YHQ I;  3CJN A;  3GFL A;  3KP2 A;  3O6B B;  1V5F A;  2V9V A;  4AYB A;  3K7A J;  1TT5 B;  2NS0 A;  4UB8 C;  2O61 A;  5F6F A;  3M1E A;  1OIS A;  3OYD A;  4MQ9 F;  2EH3 A;  2HDC A;  1U0J A;  3MD2 A;  2I5U A;  1DPU A;  4AVP A;  1CF7 A;  5HS7 A;  1MD0 A;  1X1P A;  2COM A;  1NK2 P;  1OCR H;  1BIB A;  5HLT A;  3BTJ A;  2OQG A;  5EZH A;  3L2U A;  5FKN A;  1W5S A;  3ERM A;  2O5R A;  3R4K A;  1LJ9 A;  4A3C J;  1A35 A;  2DLL A;  3K2A A;  5LGN A;  1FY7 A;  3SHF A;  4JX5 A;  2Z2S B;  5DEQ A;  1YX5 A;  2M9H A;  3BDD A;  4XN3 A;  2RDP A;  5JI6 A;  3N4M A;  4AIH A;  5ICC A;  1D0Y A;  1KU2 A;  3DWL E;  1QNT A;  1YIJ I;  4D5C A;  1FWZ A;  2EIM H;  2IA0 A;  4TV7 A;  2RN7 A;  3RQI A;  4CUG A;  1EH6 A;  4RAY A;  3JAM Z;  3D5R C;  4RB1 A;  1P9Q C;  2M1B A;  1KU3 A;  4YIF A;  3CDH A;  1I1G A;  1A6I A;  1EV7 A;  5F1R A;  1TNT A;  3A03 A;  1UFM A;  1R7J A;  3V8L A;  4BJT A;  4L9V A;  1MIJ A;  4YFK F;  1J7K A;  2G7H A;  4WX9 A;  2EIK H;  1L0O C;  2ZXW H;  3O8H A;  2VKD A;  3GTM J;  3E5U A;  3CUQ A;  5FKO A;  1RKW A;  3L2W A;  1KON A;  3JTG A;  4MGR A;  5LRS A;  2M5W A;  1XGO A;  4R8H A;  2BW3 B;  2CH0 A;  1P6R A;  5CVI A;  1QU3 A;  2A68 F;  2LG4 A;  2OU2 A;  4L0Y B;  2K27 A;  3GEZ A;  1H9T A;  1EF4 A;  2M4K A;  2PMZ A;  5EF6 A;  3I4N J;  5L3F A;  2W7N A;  3TDZ C;  2D2W A;  5DM7 F;  1LEB A;  3HRM A;  1Z3Y A;  4XRM A;  3AAF A;  1X1B A;  1Y1W J;  4B43 A;  4KIF A;  1ETV A;  2XRO A;  4WXD A;  1YTY A;  2V9K A;  3S2H J;  4D0P A;  3OS1 A;  1D1C A;  2GOX B;  2KIF A;  3TDU C;  2LH9 A;  1YYV A;  3E0J B;  2AXL A;  3LFU A;  2GAU A;  3FKI J;  1YIT I;  4WCG A;  3OYC A;  2JRM A;  5KVR A;  1JJ6 C;  2JVH A;  5ICF A;  1MSF C;  3M07 A;  2R7U A;  4L5I A;  3IRQ A;  4F55 A;  1YLF A;  2L4A A;  1TWA J;  3OY9 A;  3ERE D;  3CCJ I;  2DDB A;  4M9S A;  4D7M A;  4C30 A;  3ZPL A;  3C2G A;  2L9N A;  1I6H J;  3LSI A;  3SZG A;  4FHT A;  1RR7 A;  5FKK A;  4A2U A;  4L9J A;  5FLV A;  5BPD A;  1LFU P;  3LSK A;  1EH8 A;  3CDL A;  3FKJ A;  4PK4 A;  4S04 A;  2JUC A;  5D6F A;  3MN2 A;  1KA8 A;  1T0F C;  3F3X A;  1BR2 A;  4KIT B;  2DPU A;  1ZR4 A;  4GCV A;  1XCB A;  2JA7 J;  3EUH A;  2OV7 A;  4RMN A;  2VL8 A;  2QQB A;  1BM9 A;  4C3I J;  2X85 A;  1FX7 A;  2YU9 J;  5FO5 A;  4HF0 A;  1IW7 F;  3OS0 A;  2DDA A;  5J3L A;  2WAQ A;  4IX7 A;  4O6J A;  2NNN A;  2YX7 A;  1AHD P;  1V55 H;  4CCM A;  2E7W A;  1WPK A;  3LSJ A;  4LK0 F;  1AKH A;  3PM1 A;  5IY5 H;  3CC2 I;  1U5T C;  3EUK L;  1S8N A;  2Z9O A;  1XGS A;  1HKS A;  1U9O A;  4BL0 B;  4LG3 A;  2WA0 A;  3UR3 C;  3E6B A;  5D5X B;  1CF7 B;  1QHH D;  1BBY A;  2L7M P;  1MBG A;  3B6C A;  4UV9 A;  1SVM A;  3EYI A;  2XGD A;  3EYY A;  1YO5 C;  4UVC A;  2Y0S A;  3CCY A;  3HOV J;  1B72 A;  1KQ9 A;  3ZMV A;  3GTO J;  4GDF A;  2IGM A;  2MFZ A;  4BDZ A;  2W85 A;  3QPH A;  2GWR A;  3IWF A;  2OZ6 A;  4MO7 A;  4HST A;  2HTJ A;  4M6Y A;  3GYH X;  3BJO A;  5L3C A;  4KMF A;  2K3F A;  3Q9V A;  3GTP J;  4ZTJ A;  4B47 A;  5M5Y J;  1MJ9 A;  3BP8 A;  2O8K A;  3KP5 A;  4RM3 A;  1MNE A;  2DOF A;  1QPM A;  2FXA A;  4XIC A;  2XAG A;  2ZNY A;  1D0X A;  5L3B A;  1XSD A;  2MGQ A;  5FKL A;  5JVG F;  3C1D A;  1R5H A;  3NAR A;  3U9G A;  1N77 A;  4D1Q A;  2Y31 A;  4I98 B;  4D9J A;  2VI6 A;  1TBX A;  1MND A;  3DQV C;  2D1H A;  3U2R A;  3FK7 A;  1E0E A;  2R5Z B;  4DW6 A;  2VXZ A;  2HYG D;  2XUB A;  4IOC F;  4OMY A;  2JVG A;  4C2U A;  3J80 Z;  1WQ2 A;  1WJ5 A;  4BQN A;  1FIA A;  2VAS A;  4BDY A;  2EV6 A;  3V7R A;  2BY0 A;  4RAG A;  4FT8 A;  3FXK A;  1Z77 A;  4ZZD A;  1IN8 A;  1TW2 A;  2EQR A;  3HKZ A;  3DFG A;  1O57 A;  3ASO H;  3KEO A;  3ZOB A;  2DMP A;  1BC7 C;  1OYI A;  4LG0 B;  4ABZ A;  4W1U A;  1GVJ A;  3FXR A;  3OYE A;  3RZD J;  2LF7 A;  3DLA A;  1FJL A;  3ML6 A;  2H09 A;  1ZGJ A;  1X19 A;  1P4X A;  2HZT A;  3SXY A;  1IUF A;  3ZMT A;  4ENK A;  3KP7 A;  5DCM A;  1DGW Y;  1U5T A;  4IHX A;  1ULY A;  3C2H A;  4G7Z F;  1XC5 A;  4NDL A;  4A3I J;  4WWC A;  2JQ7 A;  3F21 A;  1PP7 U;  1B1B A;  4D7N A;  1F5T A;  3H5A A;  4CCL A;  5H2F C;  1XG1 A;  2Z1D A;  4RAZ A;  5IYB J;  2LRE A;  2WY8 Q;  4BY7 J;  2IXS A;  4Q48 A;  3OYB A;  1BA5 A;  2XPV A;  3Q0U A;  1A36 A;  3G1O A;  4BNC A;  1WVR A;  4A3B J;  5BMZ A;  2DTZ A;  1RKT A;  3BTL A;  2ZKZ A;  5D6E A;  5DD4 A;  5GP9 A;  2F48 A;  2EFN A;  1VQK I;  5GAD J;  2CUF A;  4YEL A;  4MFD A;  2MD0 A;  2Q0O A;  2KDZ A;  5BOX A;  3HSR A;  5H6R A;  3ABU A;  1V5E A;  3ASN H;  2ZCW A;  3MKZ A;  2BW3 A;  3FMS A;  3GZN B;  5JR3 A;  4Y7N J;  1SD6 A;  1S7O A;  3FK6 A;  5D8L B;  3CUQ B;  3QWL A;  3W6V A;  2A05 A;  1MH3 A;  2RNG A;  1FLI A;  3C7J A;  2V6E A;  3ZQ7 A;  3CC7 I;  4C2T A;  2VXD A;  5FD6 A;  2NRA C;  1G3T A;  1T33 A;  1LUJ B;  2FF4 A;  4BEH A;  4KUM A;  1FBU A;  4OIN F;  4M6V A;  1LDK B;  2IS6 A;  5K1Y A;  2QBY B;  5E1X A;  3HIF A;  4HOB A;  3GTQ J;  3HGY A;  5LEJ A;  3CP2 A;  3S3N A;  2R7Z J;  5DDG A;  3SFZ A;  4G7H F;  2GM4 A;  4Y3O A;  4NQW A;  4CZC A;  3LNQ A;  2MA3 A;  3V8J A;  2DI3 A;  1JUS A;  1ON1 A;  2DFE A;  4YFX F;  1JI8 A;  4YII A;  1YS7 A;  4YFN F;  2KFD A;  1ZH5 A;  4BXU A;  3CF5 F;  5J6X A;  2AHQ A;  3WGH A;  4JQF A;  4XLF A;  1MMG A;  2V79 A;  3ZN0 A;  1E17 A;  2PJR B;  1N25 A;  1I3Q J;  1WJC A;  1POG A;  3BQY A;  2ZSI B;  4L9N A;  1JKR C;  1B6A A;  4HX7 A;  2M30 A;  4DYQ A;  4AWX B;  5EGO A;  5TJJ A;  4LB5 A;  5IOZ A;  4HX8 A;  2Z16 A;  2VJ4 A;  3CO7 C;  2PMH A;  2QA4 I;  2CQK A;  5EDN A;  1EJ9 A;  2IS2 A;  1B9N A;  2CQ7 A;  1JJ8 C;  3HYI A;  1U9N A;  1QVT A;  1E3O C;  1RI7 A;  2K86 A;  4LFU A;  4AID A;  1OCP A;  4G6Q A;  5B1B H;  1N78 A;  4BKX A;  1ZG3 A;  2JUG A;  3E7L A;  1X3U A;  3V4G A;  1KU9 A;  3F72 A;  1I6X A;  4HQM A;  4BXX J;  4B8X A;  2DOD A;  4CCO A;  1RR8 C;  2L7Z A;  2L9R A;  1I39 A;  1VZ0 A;  2E7X A;  1VI0 A;  5L3D A;  4BU2 A;  2KRH A;  1TWH J;  4FX0 A;  2WB1 N;  2XB5 A;  2N8G A;  2L5Q A;  2XAH A;  4B4C A;  3FHZ A;  4E70 A;  5L3E A;  1OPC A;  3MWM A;  4CSW A;  3CMY A;  5FRN A;  1HKT A;  3R61 A;  3QAH A;  4O5V A;  1FEX A;  1A6Q A;  4NBQ A;  3HSE A;  1FOW A;  4A3M J;  2XAQ A;  2DK5 A;  2E36 A;  4Y4R A;  3RJP A;  4BQQ A;  3DF8 A;  2GOM A;  1HST A;  1GHC A;  3IUO A;  4Q5S F;  4FQG A;  4BS9 A;  3FDY A;  2VBW A;  1XTA A;  4E6K G;  4UUS B;  3F22 A;  2ME0 A;  1X1C A;  4Y33 A;  2V1D A;  2HR3 A;  1HSJ A;  5CKT A;  1P92 A;  2M0C A;  3MEX A;  2W00 A;  1R1U A;  3FXQ A;  2L01 A;  1ACI A;  4I09 A;  5HLG A;  1W7P B;  2CS3 A;  3W3C A;  2HDD A;  1MKM A;  4F3Q A;  3H3V K;  4KNY A;  2Y75 A;  4HZF A;  4L5J A;  3LAP A;  5CQG A;  5LBQ A;  1G59 A;  1ETO A;  1MNM C;  5DTD A;  2W82 A;  3LA2 A;  3QOD A;  4EJT A;  3K9T A;  4XKW A;  4PJL A;  4GO1 A;  2FUG 2;  5ED4 A;  3AL0 B;  2RQQ A;  4P9F A;  3S32 A;  4MNU A;  3SEQ A;  3EUH C;  1BC8 C;  5DS9 A;  2XIG A;  3KPH A;  4EJW A;  3AG3 H;  1D8K A;  2Y48 A;  2QZ8 A;  5F64 A;  2AQE A;  3SQN A;  2Y0S N;  4B3X A;  5B1A H;  4LK1 F;  1YW8 A;  4IHT A;  1FTZ A;  3SEZ A;  3WHB A;  1R4N B;  3U21 A;  5D5V B;  3I64 A;  3KLO A;  4MTE A;  1HDD C;  1VQM I;  2PJP A;  3FHN A;  2BXY A;  4M3E A;  4CCN A;  2I8D A;  1R5G A;  3VSL A;  4HG2 A;  5E79 C;  4B1R A;  4HF2 A;  5TGT A;  4BAC A;  1JHF A;  2KRF A;  4EAT A;  1K7A A;  1UG2 A;  4M3F A;  5F0C A;  4MTD A;  4P1W A;  4DBR A;  1TQI A;  1FTT A;  3EUA A;  3WU0 A;  2A3S A;  3BPX A;  1IG7 A;  3A2K A;  2DFI A;  1JT6 A;  2K9L A;  1MJB A;  2QSF X;  3LMM A;  4MFE A;  5TRD A;  2P8T A;  3BR0 A;  3CZ6 A;  4C2M J;  1K4S A;  4LOC A;  4AU7 A;  3P9C A;  1X1D A;  3KP3 A;  5TIS C;  1IN6 A;  1MBH A;  5HOO A;  2RV8 A;  3QP5 A;  2YUS A;  3I0T A;  2R7D A;  2LRD A;  4E4H A;  1OCT C;  3I3L A;  4N9H A;  4IRI A;  2ZXJ A;  2LP0 A;  2MD5 A;  1MDM A;  2LY9 A;  5LFA A;  2EFW A;  4RGR A;  3BR5 A;  4E7J A;  2HPM A;  1TLH B;  5L3G A;  4XRS A;  3MZH A;  2Z3Y A;  1J0R A;  3VPR A;  4WXC A;  4U7B A;  1UHS A;  2L02 A;  1ORK A;  3ZMS A;  4BJ6 C;  4P55 A;  3JRG A;  1FSH A;  2VQG A;  4XNF A;  4I7H A;  4H0E A;  3WHC A;  5JHU A;  9ANT A;  4G6D A;  3PO3 J;  4CCK A;  1FC3 A;  2ZME B;  5LHH A;  1SFO J;  2HVQ A;  5H20 A;  4KDP A;  4QPQ A;  3IWZ A;  3S8P A;  1JKO C;  2HXO A;  4U0W A;  3RYP A;  1ZRF A;  5ILV A;  1UST A;  2CO5 A;  3V7S A;  1BW6 A;  1FZP B;  2OA4 A;  4IQJ A;  1ZRE A;  2ISZ A;  5F0H A;  2LSO A;  3IH2 A;  5H6Q A;  3CD6 I;  4XID A;  4ZYE A;  3S1N J;  5DM6 F;  4J01 A;  1TL8 A;  3K10 A;  2E35 A;  1FOX A;  4XRF A;  2JA6 J;  3HBL A;  3MZ8 A;  1IN7 A;  2V6C A;  3ROU A;  2J5P A;  3HHH A;  1PUF B;  3CTA A;  4EM0 B;  2IEK A;  4IL6 C;  2D5V A;  1J5Y A;  1R23 A;  3MZY A;  5FRM A;  2KIS A;  3K6G A;  1JE8 A;  3GF2 A;  3FIW A;  3HOS A;  3TBI A;  2FA5 A;  1XGN A;  1S5L C;  3CJQ B;  2X1D A;  4P5O A;  2LMD A;  4K2E A;  1HW5 A;  5D4S A;  2HI3 A;  1X58 A;  3TGN A;  3H0G J;  4ITV A;  3DCF A;  5EEH A;  4UB6 C;  3FWE A;  3ZR8 X;  3JRA A;  1BJZ A;  1GV5 A;  1QRY A;  2GIZ A;  3KEQ A;  4MHG A;  1OQY A;  4HAM A;  3RDI A;  3GCM A;  1SD5 A;  2CQN A;  3WGG A;  2KZG A;  4WK8 F;  2QM3 A;  2ZNZ A;  4DNC A;  1H88 C;  2YX4 A;  2FBI A;  4BBR J;  1T08 B;  2DYS H;  4JP0 A;  4BUP A;  5K7F A;  1BI1 A;  2P7C B;  2O6G E;  2EZI A;  2HPI A;  4A93 J;  2OF7 A;  3BR3 A;  4MIM A;  2OBP A;  5J4Y A;  1PYV A;  4FAS D;  1GDT A;  2OAZ A;  1SMY F;  4ZYD A;  2KT0 A;  3ZN1 A;  1KYZ A;  5LGU A;  2BBY A;  3L2V A;  2ME6 A;  4G12 A;  3OS2 A;  2HKX A;  3A0B C;  4EV0 A;  5LRR A;  1BJA A;  1IDY A;  3OIQ A;  1F43 A;  2ZME C;  4ESF A;  2NVY J;  1Z67 A;  2DA7 A;  3E97 A;  3P9K A;  1Z6R A;  1LKX A;  1E3P A;  4RM2 A;  3H9Q A;  1G8X A;  4A3F J;  3Q0V A;  4HF1 A;  4WXH A;  4XR6 A;  2GA1 A;  1G6N A;  3OIP A;  4G7O F;  1SAU A;  3DPL C;  2H94 A;  3A1Y A;  4L18 B;  4LIU A;  1PUE E;  2BV6 A;  1QPI A;  2XKO A;  2LK2 A;  3KZY A;  2O03 A;  5DYM A;  1OCO H;  5ICE A;  2VQH A;  3BR1 A;  3GW2 A;  3DV8 A;  2ZJQ F;  1GT0 C;  1APL C;  2DU9 A;  3E6D A;  2KMU A;  1YG2 A;  2G9W A;  3LSR A;  4OIR F;  3HOW J;  1ETW A;  1I5Z A;  3NEU A;  4NC8 A;  4BAY A;  2C6Y A;  1Q1V A;  3CES A;  1O3S A;  2MC3 A;  4KA4 A;  3F8M A;  3I59 A;  2VJ5 A;  3FXL A;  3HRT A;  4OOI A;  2ELH A;  2WAF A;  2X51 A;  3J7Z I;  3ZGK A;  1IN5 A;  4ENN A;  2DA3 A;  3KYC B;  2QSH X;  4E7Z A;  2XF5 A;  1JXS A;  3HRU A;  1B9M A;  3LWF A;  5HDN A;  1XS9 A;  1F36 A;  5HVQ C;  3I9V 2;  1G3S A;  3M8F A;  3QRF F;  1QO0 D;  4DYR A;  4RS8 A;  4M71 A;  4ZYG A;  4M6X A;  1ZKG A;  1Z91 A;  3A01 B;  3F6O A;  2A5Y B;  3H5R A;  3E1S A;  5E8I A;  1RNL A;  2LD5 A;  2P6T A;  2MYS A;  2NVQ J;  2FOW A;  2X9D A;  5B66 C;  2WTE A;  3GLL A;  3OR1 C;  3MMY B;  4IHY A;  4PJ0 C;  3T8R A;  4XL9 A;  4YRV A;  2K9S A;  2RC4 A;  2FNP A;  5JFR A;  2DQR A;  3DBR B;  3GFJ A;  2WV0 A;  2J5O A;  4XLH A;  4EJU A;  2EBI A;  2Q8K A;  1F1Z A;  3ONQ A;  4HEA 2;  2X1C A;  2EIL H;  4BEH B;  4IOA F;  1IRF A;  2L7F P;  3VYR B;  3ZMZ A;  2F2E A;  2DK8 A;  1C0W A;  1XDS A;  1IO2 A;  2M3A A;  1DQU A;  3IC7 A;  3IAM 2;  1ETX A;  2JA2 A;  1SAX A;  3S1Q J;  2CRG A;  4IVN A;  1H0M A;  3UNG C;  4QLC U;  2X48 A;  1SFK A;  3FMR A;  2EA4 A;  5AIQ A;  1J75 A;  4GRI A;  3SZP A;  2EWN A;  5D8K B;  2F4M B;  2KHM A;  2QYO A;  4G8X A;  3ABM H;  2JN6 A;  2XAU A;  2DA6 A;  3U1D A;  3CQZ J;  4AM3 A;  4PFO A;  1UZC A;  4A3D J;  3JSO A;  1JUM A; 
#chains in the Genus database with same CATH homology
 1S7A A;  5CYV A;  1CGP A;  4LLL A;  5IT9 K;  2QQ9 A;  3QPT A;  4XBF A;  3RIR A;  2PBI A;  2L3D A;  4U0V A;  3ZMD A;  2HOE A;  3MQ0 A;  3COA C;  1V3F A;  3E6C C;  4YG2 F;  2DW4 A;  3H92 A;  3KP6 A;  1XB4 A;  1L3L A;  2FNA A;  3K1N A;  2ADU A;  4A0X A;  2ZBK A;  1T39 A;  4EVI A;  1FYM A;  2QLZ A;  4OMZ A;  4FX4 A;  3C3W A;  3JTH A;  1B4A A;  1U2W A;  2R7F A;  3BWG A;  1K78 B;  3LQR A;  1R36 A;  3P7N A;  2IPQ X;  3M9A A;  3W6K B;  1OYW A;  5LGT A;  3IKT A;  3DP7 A;  2L54 A;  1QBJ A;  2VOD A;  3C18 A;  1BI0 A;  3BJ6 A;  1MGT A;  1BI3 A;  1SD7 A;  2WC2 A;  2EK5 A;  3GUD A;  3BZ6 A;  5IT9 Z;  4KN7 X;  4ESB A;  2JPB A;  5BS6 A;  4BHC A;  1T38 A;  2BEO A;  1ZYR F;  2CFX A;  3GZ5 A;  5EEG A;  4A5N A;  3PFI A;  3I53 A;  2V1X A;  1MJA A;  1T98 A;  4AIK A;  1G3W A;  2VT3 A;  2HEO A;  2HYF A;  4XSZ F;  1O7F A;  2STW A;  2UZK A;  1FBS A;  1YW9 A;  3I4P A;  1S29 A;  3PQK A;  4RGX A;  5FGM A;  4ETS A;  3DXJ F;  1WI9 A;  2TDX A;  2XAS A;  2ETH A;  2E1C A;  1KYW A;  1U3E M;  4P9U A;  2D45 A;  1OMI A;  2Z99 A;  2Z5U A;  2MH2 A;  3K69 A;  1WKM A;  3OV8 A;  2P5V A;  4KFC A;  1TQP A;  3P9I A;  3L9F A;  4IJA A;  3GZ6 A;  3HSF A;  2FE3 A;  3K1M A;  2H27 A;  4OU0 A;  3TO9 A;  3ECO A;  3MAJ A;  4LLN A;  3KFW X;  3LST A;  1YQA A;  1SFU A;  2EFO A;  2PEX A;  2QEN A;  5HDK A;  3ELK A;  1PP8 F;  1IRG A;  3VFZ A;  1IXS B;  4U7D A;  3WTZ A;  3DEU A;  2HKO A;  5CJ9 A;  3ULQ B;  1FYK A;  3E5X A;  3KCC A;  2XV4 S;  1Y0U A;  4GGG A;  1W5T A;  3T8T A;  2EB7 A;  3DKW A;  2QWW A;  5LEK A;  1U78 A;  1IXR C;  2FRH A;  2UXX A;  2ZO4 A;  5DD8 A;  2LNB A;  1YS6 A;  1OR7 A;  2IA2 A;  1GXQ A;  1LB2 A;  3CO6 C;  3WTY C;  5BPI A;  3WG9 A;  1REP C;  1J59 A;  1MDM B;  1TTY A;  2H6B A;  5D5W B;  4KMU X;  3T1B A;  5E8G A;  1HQC A;  3JSP A;  1DP7 P;  2W24 A;  4KIG A;  3MFK A;  3RTR A;  2W57 A;  2QUF A;  5KK1 A;  4XLN F;  1ZG5 A;  3VB2 A;  3ZP5 A;  2F5E A;  1BN5 A;  1W7P D;  4UV8 A;  2STT A;  2JPC A;  2K7L A;  2OZU A;  4UVB A;  5J8C A;  3QU6 A;  2LF8 A;  3WOD F;  2EV5 A;  2IP2 A;  1XSV A;  1DPR A;  5FB2 A;  1J2X A;  2HGC A;  3GO5 A;  3QU3 A;  5HDG A;  1IXC A;  2GZW A;  3FM5 A;  1XSX A;  4A0Z A;  3ECH A;  2VBZ A;  2YU3 A;  1QZY A;  5K5R A;  1HKQ A;  3BRO A;  1HW2 A;  3HTS B;  4BH9 A;  3QOP A;  4G94 A;  3HTU A;  5CVR A;  5ILU A;  3RI4 A;  1WRJ A;  2E1N A;  4ESJ A;  2YPR A;  5FLX Z;  5D5U B;  2P5L C;  5E20 A;  3PQJ A;  1FBQ A;  4ZH4 F;  3RYR A;  5DCM B;  2CWE A;  1QGP A;  2FOK A;  1WWX A;  4LGW A;  3D0S A;  4DQ2 A;  1J9I A;  2CG4 A;  2VE9 A;  2JSC A;  2FML A;  1FT9 A;  1FP2 A;  1UCR A;  3GXO A;  2A69 F;  2HQR A;  4CZZ A;  2XRN A;  3OOP A;  3E5Q A;  2NYX A;  2VOP A;  1B59 A;  2VOO A;  1SFX A;  3WTX C;  1T0F A;  2M87 A;  3R0A A;  2O3F A;  1OYY A;  3KP4 A;  1P4A A;  4UUV A;  2IVM A;  4EGY A;  1YIO A;  3FF5 A;  1IZ1 A;  2FBK A;  1KQ8 A;  5LHI A;  3F23 A;  3F8B A;  1BIA A;  5E1W A;  1IAW A;  3GLX A;  3VOE A;  2ISY A;  4S05 A;  3I58 A;  1IF1 A;  1P2F A;  3LA3 A;  2LKP A;  2P7V B;  3GFI A;  1JGS A;  1UB9 A;  3BY6 A;  1ZAO A;  4BHP A;  3TO6 A;  3WE3 A;  4KYW A;  1T2K A;  2YR2 A;  1W7P A;  4LB6 B;  4WF2 A;  1ZG1 A;  3REO A;  3HUG A;  4U88 A;  3N97 A;  2VBX A;  4EQQ A;  4A0Y A;  2D1V A;  2RVC A;  3WE2 A;  1ZHF A;  4IHS A;  1AOY A;  4HV5 A;  1XN7 A;  1SD4 A;  3KET A;  3JAM K;  2JTV A;  2BYV E;  2XHK A;  1G4D A;  3LQQ A;  2NAZ A;  3WTU C;  4R79 A;  2ZFW A;  1R1T A;  4UNO A;  2VON A;  3LFK A;  4ZYH A;  1XD7 A;  1LQ1 A;  5CVJ A;  1Z05 A;  1S6L A;  2F5D A;  3HOT A;  1WSU A;  3TOB A;  1R22 A;  2O0Y A;  4UXN A;  5K5O A;  1AWC A;  3F6V A;  3F8C A;  4ENJ A;  1QZZ A;  4XLP F;  3BOQ A;  2ESH A;  2EA2 A;  1SMT A;  4PGG A;  3I54 A;  4HX4 A;  2UXN A;  2VE8 A;  4EM2 A;  3B73 A;  3O2P E;  4UVA A;  4JK1 X;  2RQP A;  4G9Y A;  2FEZ A;  3GVA A;  4BHB A;  1RUO A;  4LD5 A;  2W25 A;  5AON A;  1OKR A;  1ON2 A;  1D3Y A;  5AIP A;  4L9T A;  2YSR A;  1NHA A;  3RKW A;  1HW1 A;  1XCV A;  3J81 Z;  2IA1 A;  5ILS A;  4GXO A;  3KE2 A;  4HW0 A;  1FP1 D;  4A5M A;  1XDU A;  2KIU A;  2UWM A;  4RB3 C;  2B0L A;  2MLG A;  1Z6T A;  3F8F A;  1ZRC A;  1W4M A;  2DT5 A;  4LJZ F;  3CUO A;  3KLN A;  3S2W A;  4JBA A;  5HS9 A;  4I0B A;  4N0B A;  4MEY F;  4KIC A;  1ZLK A;  1VTN C;  1Z9C A;  3IL2 A;  3E6M A;  2BE5 F;  5E18 F;  1USS A;  3EET A;  2CSO A;  1O3R A;  3M7G A;  5CVU A;  3T5X A;  2ZME A;  4O3M A;  2K02 A;  3KZZ A;  3T0Y A;  1JHH A;  5ERI A;  3D5L A;  1LDJ A;  3G73 A;  5DV5 A;  1UHW A;  4CHU A;  2HWV A;  2A07 F;  3HHG A;  3W6J B;  3I59 B;  4AD9 A;  2DO7 A;  4ENM A;  4Y13 A;  1UHM A;  4M9Z A;  4MEX F;  2PMU A;  1I1S A;  4HDU A;  3WTV C;  4A6E A;  4N9I A;  3WGI A;  2GXB A;  1FPQ A;  2A6E F;  3I71 A;  6PAX A;  4HLY A;  1XMA A;  3RPU A;  2A61 A;  2FSW A;  3H3Z A;  1R58 A;  3F8N A;  3G3Z A;  3GX4 X;  4EM1 A;  1BI2 A;  1R00 A;  4PZJ A;  2W84 A;  2EFQ A;  2DTR A;  1O3Q A;  1RUN A;  2ESN A;  2GXG A;  1LVA A;  2DAO A;  3I5U A;  4RB2 C;  3VOD A;  2JZY A;  1SFE A;  3TQN A;  2LDU A;  2EFP A;  5DUI A;  3J80 K;  2QBY A;  5K5Q A;  2XVC A;  2PI0 A;  1O7L A;  1FNN A;  1ZN2 A;  3FM3 A;  2Q2E A;  1D5V A;  4CIC A;  4EJO A;  2PLY A;  5FLX K;  1KGS A;  3NQO A;  3R60 A;  4F7Z A;  1Z7U A;  1HXD A;  3FXU A;  3WTS C;  4U0Y A;  3BJA A;  2KKO A;  1EH7 A;  3K2Z A;  4BYY A;  1DDN A;  4RGU A;  1KU7 A;  5BQT A;  4ASN A;  2WWY A;  1IUY A;  4P96 A;  2VBY A;  4M74 A;  1U6G A;  1BOA A;  3FZV A;  2JRT A;  2JT1 A;  2FBH A;  5D4R A;  4CYD A;  1A04 A;  2IW5 A;  2FQ3 A;  1HBX G;  4I2O A;  3DPT A;  4CDG A;  3SZT A;  2OQR A;  5A2Q Z;  4Y15 A;  3JW4 A;  1GXP A;  2VC1 A;  1TQM A;  2GIV A;  4LG0 A;  3TKY A;  1IN4 A;  1YFH A;  2F5C A;  5HLH A;  4EGZ A;  5FFX A;  3Q5F A;  1LDD A;  1XMK A;  1PDN C;  2ZJ2 A;  5HS8 A;  4A6D A;  2DPD A;  3TO7 A;  4ON0 A;  2PN6 A;  3H3U A;  1V4R A;  3R0J A;  4BQA A;  2K4J A;  2KJC A;  4IRG A;  1QQI A;  4R1H A;  1FYL A;  2K4B A;  4KN4 X;  4UHT A;  3RPQ A;  4EMS A;  1H9G A;  3B02 A;  3HRS A;  2MBF A;  2GQQ A;  4I01 A;  2CW0 F;  4A12 A;  4M73 A;  4HBL A;  2DQL A;  2MLK A;  5E1Z B;  1RIO H;  3WTT C;  3L2C A;  1ONV A;  4IPA A;  2XKP A;  1ZRD A;  3IHU A;  1G3Y A;  2PG4 A;  4HDV A;  4OIO F;  5FD5 A;  3O3K A;  1I27 A;  1K79 A;  2VC0 A;  4I0A A;  4HLX A;  2HQN A;  2OD5 A;  1RZ4 A;  2PFB A;  1S3J A;  3VEP A;  4NB5 A;  4OIQ F;  2XAJ A;  4M72 A;  4RGS A;  4LLG F;  5LLQ A;  4B09 A;  1F4K A;  3E3V A;  2M45 A;  2HTS A;  5HLI A;  1YW7 A;  3EDP A;  1U8R A;  2FU4 A;  2IJL A;  5ICG A;  3IRR A;  2PQ8 A;  4KIB A;  4QWQ A;  2MH9 A;  3L7W A;  4M9X A;  2EJR A;  2X0L A;  3CUQ C;  4IF4 A;  4HV6 A;  2P6S A;  3Q9S A;  2V1U A;  3GWZ A;  2HFH A;  4NHJ A;  3LA7 A;  2EV0 A;  3L09 A;  4CGZ A;  4OIP F;  1TNS A;  3IKV A;  4I02 A;  1FSE A;  3R6S A;  2G7U A;  4IXA A;  4PDK A;  3ZMU A;  1R1V A;  3FMQ A;  3BPV A;  4CO8 A;  3K0L A;  4Q4Z F;  1TW3 A;  3L00 A;  2CYY A;  4EJV A;  3J7A O;  4AIJ A;  2VN2 A;  2R3S A;  2DBB A;  4CXF A;  3J81 K;  2VT2 A;  4HA8 A;  3M8E A;  3ABT A;  4LMY A;  5CVV A;  1D8J A;  2RGV A;  2M8E A;  5DUK A;  5J8F A;  1LEA A;  2ACJ A;  1K78 A;  1P4W A;  4KT5 C;  3RKX A;  3EQL F;  4PCQ A;  1MZB A;  1LNW A;  2IRF G;  4ZZL A;  4RB0 A;  1F9N A;  1ZAR A;  1ZGA A;  5JVT A;  4Z2Y A;  2RNJ A;  2Y0M A;  3NRV A;  2XGX A;  5E17 F;  3TOA A;  1U5T B;  4HYE A;  2IT0 A;  4L0Z B;  4Y17 A;  5A2Q K;  3V8K A;  2QVO A;  1STZ A;  2QQA A;  2P5K A;  3V7C A;  4MQV A;  4Q47 A;  4HQE A;  4IRH A;  3K1P A;  3FX3 A;  2P4W A;  1Z1D A;  2BGC A;  3LAJ A;  1XGM A;  4GYG A;  3RKY A;  3WTW C;  3WU1 B;  5LHG A;  1E2X A;  1FOK A;  2H6C A;  2X4H A;  2F5F A;  2Z33 A;  2FMY A;  1DUX C;  2GA2 A;  2KIM A;  2O8X A;  3GFM A;  4XSX F;  1Q1H A;  5CLS A;  5DCF A;  1KQ0 A;  2CGP A;  2AS5 F;  2RKH A;  3CLO A;  2NNY A;  4PGH A;  4GYI A;  1O3T A;  5IT3 A;  5FFZ A;  2L4M A;  2XAF A;  2KJB A;  1ODD A;  2A6H F;  3ISP A;  3QP6 A;  1ZLJ A;  1T6S A;  2HS5 A;  3MCZ A;  3CJN A;  3GFL A;  3KP2 A;  3O6B B;  2V9V A;  2NS0 A;  2O61 A;  5F6F A;  3M1E A;  4MQ9 F;  2HDC A;  1DPU A;  4AVP A;  1CF7 A;  5HS7 A;  1MD0 A;  2COM A;  1BIB A;  2OQG A;  1W5S A;  3R4K A;  1LJ9 A;  2DLL A;  5LGN A;  1FY7 A;  3SHF A;  5DEQ A;  3BDD A;  5JI6 A;  2RDP A;  3N4M A;  4AIH A;  5ICC A;  1KU2 A;  1QNT A;  1FWZ A;  2IA0 A;  4TV7 A;  2RN7 A;  1EH6 A;  4RAY A;  3JAM Z;  4RB1 A;  2M1B A;  1KU3 A;  4YIF A;  3CDH A;  1I1G A;  1EV7 A;  5F1R A;  1TNT A;  1UFM A;  1R7J A;  3V8L A;  4L9V A;  4YFK F;  1J7K A;  2G7H A;  4WX9 A;  1L0O C;  3E5U A;  3CUQ A;  3JTG A;  4MGR A;  5LRS A;  2M5W A;  1XGO A;  4R8H A;  1P6R A;  5CVI A;  2A68 F;  2OU2 A;  4L0Y B;  2K27 A;  3GEZ A;  1H9T A;  5L3F A;  3TDZ C;  2D2W A;  1LEB A;  3HRM A;  3AAF A;  4KIF A;  2XRO A;  1YTY A;  4WXD A;  4D0P A;  2KIF A;  3TDU C;  1YYV A;  2AXL A;  2GAU A;  4WCG A;  5KVR A;  5ICF A;  4L5I A;  3IRQ A;  1YLF A;  2L4A A;  3ERE D;  4M9S A;  3ZPL A;  4FHT A;  4A2U A;  4L9J A;  5BPD A;  1EH8 A;  4S04 A;  5D6F A;  1KA8 A;  3F3X A;  2DPU A;  4GCV A;  1XCB A;  3EUH A;  2QQB A;  1BM9 A;  1FX7 A;  5FO5 A;  4HF0 A;  1IW7 F;  4O6J A;  2NNN A;  2YX7 A;  2E7W A;  4LK0 F;  1U5T C;  2Z9O A;  1S8N A;  1XGS A;  1HKS A;  3E6B A;  5D5X B;  1CF7 B;  1BBY A;  4UV9 A;  3EYI A;  3EYY A;  1YO5 C;  4UVC A;  1KQ9 A;  3ZMV A;  2W85 A;  3QPH A;  2GWR A;  3IWF A;  2OZ6 A;  2HTJ A;  4M6Y A;  3GYH X;  3BJO A;  5L3C A;  4KMF A;  3Q9V A;  1MJ9 A;  3BP8 A;  3KP5 A;  1QPM A;  2FXA A;  2XAG A;  2ZNY A;  5L3B A;  1XSD A;  3C1D A;  1R5H A;  3U9G A;  4I98 B;  1TBX A;  3DQV C;  2D1H A;  3U2R A;  2VXZ A;  2HYG D;  2XUB A;  4OMY A;  3J80 Z;  1WQ2 A;  2EV6 A;  3V7R A;  4FT8 A;  4ZZD A;  1IN8 A;  1TW2 A;  3DFG A;  1O57 A;  3KEO A;  4LG0 B;  1BC7 C;  1OYI A;  1GVJ A;  3FXR A;  2LF7 A;  3ML6 A;  2H09 A;  1ZGJ A;  1P4X A;  2HZT A;  3SXY A;  3ZMT A;  4ENK A;  3KP7 A;  5DCM A;  1U5T A;  1ULY A;  4G7Z F;  4WWC A;  3F21 A;  1PP7 U;  1B1B A;  1F5T A;  4RAZ A;  4Q48 A;  4BNC A;  5BMZ A;  2ZKZ A;  5D6E A;  5DD4 A;  2EFN A;  2Q0O A;  5BOX A;  3HSR A;  5H6R A;  3ABU A;  2ZCW A;  3FMS A;  5JR3 A;  1SD6 A;  1S7O A;  5D8L B;  3CUQ B;  1FLI A;  3C7J A;  3ZQ7 A;  5FD6 A;  2NRA C;  1G3T A;  2FF4 A;  4KUM A;  1FBU A;  4OIN F;  1LDK B;  5K1Y A;  2QBY B;  5E1X A;  3HIF A;  4HOB A;  5LEJ A;  5DDG A;  3SFZ A;  4G7H F;  4NQW A;  2MA3 A;  3V8J A;  2DI3 A;  1ON1 A;  4YFX F;  4YII A;  1YS7 A;  4YFN F;  1ZH5 A;  4BXU A;  5J6X A;  3WGH A;  4JQF A;  2V79 A;  3ZN0 A;  1E17 A;  1K6O A;  4L9N A;  1B6A A;  4HX7 A;  2M30 A;  4AWX B;  4LB5 A;  5TJJ A;  4HX8 A;  3CO7 C;  2PMH A;  2CQK A;  1B9N A;  3HYI A;  1RI7 A;  2K86 A;  4LFU A;  4G6Q A;  1ZG3 A;  1X3U A;  3V4G A;  1KU9 A;  3F72 A;  1I6X A;  4HQM A;  4B8X A;  2E7X A;  5L3D A;  4FX0 A;  2XAH A;  3FHZ A;  4E70 A;  5L3E A;  1OPC A;  3MWM A;  1HKT A;  3R61 A;  3QAH A;  4O5V A;  3HSE A;  2XAQ A;  2DK5 A;  3RJP A;  3DF8 A;  1HST A;  1GHC A;  4Q5S F;  2VBW A;  3F22 A;  2V1D A;  2HR3 A;  1HSJ A;  1P92 A;  3MEX A;  1R1U A;  3FXQ A;  2L01 A;  4I09 A;  5HLG A;  1W7P B;  1MKM A;  4KNY A;  2Y75 A;  4HZF A;  4L5J A;  3LAP A;  5LBQ A;  3LA2 A;  4EJT A;  3K9T A;  4GO1 A;  5ED4 A;  4P9F A;  4MNU A;  1BC8 C;  2XIG A;  4EJW A;  1D8K A;  2Y48 A;  2QZ8 A;  5F64 A;  3SQN A;  4LK1 F;  1YW8 A;  4IHT A;  5D5V B;  3I64 A;  3KLO A;  4MTE A;  2PJP A;  1R5G A;  4HF2 A;  1JHF A;  2KRF A;  1K7A A;  4MTD A;  1TQI A;  3WU0 A;  2A3S A;  3BPX A;  2DFI A;  1MJB A;  5TRD A;  2P8T A;  3P9C A;  3KP3 A;  1IN6 A;  5HOO A;  2RV8 A;  3QP5 A;  3I0T A;  2R7D A;  4N9H A;  4IRI A;  2ZXJ A;  2MD5 A;  1MDM A;  2EFW A;  4RGR A;  1TLH B;  5L3G A;  3MZH A;  2Z3Y A;  1J0R A;  4WXC A;  4U7B A;  2L02 A;  3ZMS A;  4P55 A;  1FSH A;  4I7H A;  4H0E A;  5JHU A;  4G6D A;  1FC3 A;  2ZME B;  5LHH A;  5H20 A;  4KDP A;  3IWZ A;  4U0W A;  3RYP A;  1ZRF A;  5ILV A;  1UST A;  2CO5 A;  3V7S A;  1FZP B;  2OA4 A;  1ZRE A;  2ISZ A;  2LSO A;  5H6Q A;  4ZYE A;  4XRF A;  1IN7 A;  2V6C A;  3ROU A;  2J5P A;  3HHH A;  3CTA A;  4EM0 B;  1J5Y A;  1R23 A;  3MZY A;  1JE8 A;  3GF2 A;  3HOS A;  2FA5 A;  1XGN A;  4P5O A;  5D4S A;  1HW5 A;  4K2E A;  3TGN A;  5EEH A;  3FWE A;  3KEQ A;  4MHG A;  4HAM A;  3RDI A;  1SD5 A;  3WGG A;  4WK8 F;  2QM3 A;  2ZNZ A;  4DNC A;  2YX4 A;  2FBI A;  1BI1 A;  2P7C B;  2O6G E;  2OBP A;  2OAZ A;  1SMY F;  4ZYD A;  3ZN1 A;  1KYZ A;  5LGU A;  2BBY A;  2HKX A;  4EV0 A;  5LRR A;  1BJA A;  4ESF A;  3E97 A;  3P9K A;  1Z6R A;  4HF1 A;  4WXH A;  2GA1 A;  1G6N A;  4G7O F;  3DPL C;  2H94 A;  4L18 B;  1PUE E;  2BV6 A;  2XKO A;  3KZY A;  2O03 A;  5DYM A;  5ICE A;  3GW2 A;  3DV8 A;  2DU9 A;  3E6D A;  1YG2 A;  2G9W A;  4OIR F;  1I5Z A;  3NEU A;  4BAY A;  2C6Y A;  1O3S A;  2MC3 A;  4KA4 A;  3F8M A;  3I59 A;  3HRT A;  4OOI A;  2ELH A;  1IN5 A;  4ENN A;  1JXS A;  3HRU A;  1B9M A;  3LWF A;  5HDN A;  5HVQ C;  1G3S A;  3M8F A;  3QRF F;  1QO0 D;  4RS8 A;  4M71 A;  4ZYG A;  4M6X A;  1Z91 A;  3F6O A;  2A5Y B;  5E8I A;  1RNL A;  2P6T A;  2WTE A;  3T8R A;  2RC4 A;  2FNP A;  5JFR A;  2DQR A;  3GFJ A;  2WV0 A;  2J5O A;  4EJU A;  2Q8K A;  1F1Z A;  1IRF A;  3ZMZ A;  2F2E A;  2DK8 A;  1C0W A;  1XDS A;  3IC7 A;  1SAX A;  4IVN A;  1H0M A;  4QLC U;  3FMR A;  2EA4 A;  5AIQ A;  1J75 A;  3SZP A;  2EWN A;  5D8K B;  2QYO A;  4G8X A;  3U1D A;  3JSO A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...