3U1DA

The structure of a protein with a gntr superfamily winged-helix-turn-helix domain from halomicrobium mukohataei.
Total Genus 51
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
51
sequence length
148
structure length
148
Chain Sequence
MATQDRGERPNGFGDELERRRFVLHETRLDVLHQILAQPDGVLSVEELLYRNPDETEANLRYHVDELVDRGIVEKIPVPRAKSVDDPPTTFYAVTGEGIALLRAVSMYEEAAVWRSVYEQMERTDRIEAIENLETRPDVDYESRGATA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The structure of a protein with a GntR superfamily winged-helix-turn-helix domain from Halomicrobium mukohataei.
rcsb
source organism Halomicrobium mukohataei
molecule tags Structural genomics, unknown function
molecule keywords uncharacterized protein
total genus 51
structure length 148
sequence length 148
chains with identical sequence B
ec nomenclature
pdb deposition date 2011-09-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF12840 HTH_20 Helix-turn-helix domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 3u1dA00
1E17A 2J5OA 3B02A 2DO7A 1B9MA 1S3JA 1R1TA 4L9TA 4RB1A 3TOAA 1XGNA 3WGIA 2JRTA 1BI0A 1SAXA 3ZMVA 3D5LA 3ZMDA 3LWFA 1FLIA 2ZMEB 2PLYA 4L0YB 1QZYA 2ESHA 2V1XA 1LDJA 4KN7X 1S7AA 4LB6B 1EV7A 3LSTA 5HS7A 5EEGA 5LGUA 5K5QA 2IPQX 2VE8A 5LRRA 3ZMSA 2NRAC 2V9VA 5LBQA 2RKHA 3H92A 3GUDA 5ICGA 3TDUC 1MD0A 3O6BB 1TW2A 3PQJA 3FX3A 1QNTA 2EK5A 1F9NA 2M30A 3HHGA 2FOKA 1ZN2A 1IN8A 1R1UA 2EFQA 4HX8A 2KIMA 1MZBA 4I01A 1HQCA 5TJJA 5CVRA 5LRSA 1FBSA 1OYYA 1CGPA 3F6OA 3QPTA 5LHIA 3FM3A 1W7PB 1O3QA 1Z7UA 2DFIA 5F1RA 3HOTA 5BOXA 3V7SA 5HDGA 3T0YA 5JI6A 4IHTA 3G73A 1LDDA 3LAJA 2FU4A 2MLGA 5FFXA 1Q1HA 5IT9Z 2VBXA 1ZG5A 1ZHFA 2NNNA 2DU9A 5JHUA 2MH9A 3KEOA 1IXSB 2VODA 2YSRA 4UUVA 3EYIA 2M8EA 2HKXA 5K5OA 5DD4A 4PGGA 4RAYA 1RUNA 4G94A 5AONA 2PJPA 1CF7A 2HOEA 5LGTA 4ESJA 2FBIA 2KIFA 4I2OA 1JE8A 5F6FA 1B1BA 2K02A 5CVUA 4OMZA 1USSA 3G3ZA 5KVRA 1Z6RA 5K5RA 2GXGA 3IKVA 3Q9SA 2VONA 2EFPA 2UXNA 2IW5A 2FBHA 2W25A 5D5WB 4I7HA 5D5UB 5L3FA 1HW5A 2O03A 1XGMA 2VOPA 3FXRA 1MDMA 3CUQC 3V4GA 3ZN1A 4LFUA 2Z3YA 2QWWA 3M8FA 4U7DA 1K78B 1KQ0A 1IXCA 3NRVA 3HOSA 2OD5A 3NQOA 1I27A 3CUQA 4IRHA 3CUQB 4LLLA 2XAHA 1GHCA 3F8MA 3U2RA 1BI1A 1UFMA 4KIGA 4RGRA 1Z1DA 5BPIA 4U0YA 2DLLA 1SMYF 2G9WA 4PZJA 1KYZA 2VT3A 2P7CB 2XVCA 3F8FA 4EGYA 4HLYA 2E7XA 4EV0A 1J5YA 2FNPA 2ADUA 3WGHA 2E1NA 1E2XA 1SFXA 3MWMA 2L54A 3HRUA 4WX9A 5CLSA 3DPLC 4CZZA 4MEYF 2LF7A 1HKSA 1FWZA 4HA8A 1L3LA 5L3BA 2JPBA 2LDUA 2RN7A 5JFRA 3I58A 2MLKA 4A0XA 1DP7P 2ZXJA 3I71A 3TKYA 1BOAA 2P7VB 3RYPA 4CICA 3L09A 1OYWA 3BDDA 4OIOF 3K9TA 3I59B 2AXLA 1HBXG 4PDKA 2MBFA 2HDCA 3TO7A 3QU6A 3TQNA 4HDUA 3W6KB 4RGXA 2A3SA 5J6XA 4G8XA 4KT5C 4MNUA 1XSVA 4BHPA 2STWA 5HVQC 3QP5A 4L5JA 4IJAA 4ENMA 2R7DA 1ZRFA 1W5TA 4IPAA 2DK5A 5E20A 1TLHB 1QPMA 5BPDA 3Q5FA 5CVIA 2BEOA 2EFOA 2GIVA 4MEXF 2WV0A 4YFKF 2DW4A 3FZVA 4HAMA 4EJWA 2K7LA 3F72A 4GYGA 2CW0F 4CXFA 4M71A 2P5KA 2UXXA 3WE3A 2E1CA 4HF0A 3FHZA 3N4MA 4A5NA 3CTAA 2W84A 4N0BA 3BROA 3QAHA 4A5MA 1ODDA 1ZAOA 3RIRA 2QBYA 2IJLA 4Q48A 4B09A 1U2WA 4AIHA 4PCQA 2GXBA 1XCBA 5IT9K 1YYVA 3ZMZA 2F5CA 3HSEA 4EJUA 2FE3A 3COAC 1WKMA 3HRMA 2EV6A 5HDNA 1K79A 4I02A 3J80Z 1IAWA 2V79A 4Y13A 4ZZLA 1J59A 3MAJA 2HZTA 3JSPA 2GA1A 1U6GA 3DKWA 1LB2A 3IL2A 2RGVA 3GFJA 2F5EA 5DV5A 5D8LB 2HTJA 4IXAA 3C7JA 1U5TA 3WU1B 2XV4S 4P96A 2C6YA 1R22A 2P5LC 4OIPF 1ZGAA 1YIOA 5ERIA 1IN7A 1H9GA 2KKOA 4BQAA 3JSOA 5DCFA 3E97A 3GZ5A 2DQRA 5E8IA 4MHGA 2JTVA 3WODF 3Q9VA 1K6OA 4QLCU 4JK1X 1RI7A 1KQ8A 3KETA 3E6DA 2RNJA 2G7HA 3KE2A 3WTXC 4BXUA 2L3DA 3O2PE 3BJAA 3ECHA 3VOEA 3HRTA 1MJAA 3E6MA 1U3EM 1I1SA 4IHSA 6PAXA 3GW2A 1IN5A 1ULYA 3FMSA 5BMZA 4P55A 2DPUA 2ACJA 4RS8A 1TQMA 1H0MA 4HX7A 2L4AA 5JVTA 2IP2A 3VB2A 1Y0UA 3HSRA 3WU0A 2FEZA 1ZG1A 1REPC 2A07F 2FF4A 4RB0A 1D3YA 2QQAA 1R5GA 4G6QA 4OIRF 1Z05A 4WXDA 3PFIA 1C0WA 2L4MA 4K2EA 1OMIA 3IRRA 1B59A 2D45A 1ZG3A 3K69A 2FA5A 1R1VA 4LB5A 3S2WA 2CQKA 3E5UA 3TGNA 1DPRA 1B6AA 4A6DA 3ULQB 4HBLA 2O6GE 4DNCA 3ELKA 3LFKA 2FBKA 2G7UA 1YO5C 4P9UA 3F22A 3HSFA 1FY7A 1QZZA 5TRDA 2RQPA 2YX4A 4LG0A 3F23A 3GWZA 3DEUA 2H6BA 2XAJA 1YW9A 5CVJA 2Z33A 2R7FA 2YX7A 1QO0D 4HLXA 1XGSA 1ZH5A 2OA4A 4EMSA 1MDMB 3GZ6A 3WG9A 4G9YA 4BH9A 5FD5A 2FMYA 1RZ4A 1J75A 1GVJA 4ESFA 3DQVC 2QBYB 4KDPA 3C1DA 4R79A 3J81K 4ESBA 1FYKA 2QM3A 2CSOA 5DD8A 2Q0OA 4G7HF 3GX4X 4M9ZA 3KP6A 3KP3A 4XRFA 2XGXA 4ASNA 1ZREA 2OQGA 4ZH4F 4UVCA 4L18B 2P4WA 3ROUA 3I0TA 5JR3A 3QPHA 1ZRDA 3VFZA 1UHMA 3I53A 4LJZF 3BP8A 2ZNZA 2V1UA 2LF8A 4EJTA 1XMAA 5DCMA 2O3FA 4WWCA 4BNCA 3DP7A 5DDGA 3HIFA 1J2XA 3KFWX 1FX7A 5LEJA 1FBUA 4YG2F 1TQPA 4XLNF 3WTVC 1BBYA 3T8TA 4RGUA 4HV5A 1Z9CA 4M72A 2A5YB 4Y15A 4L9JA 3GFMA 3JAMZ 2NAZA 1TNTA 1R00A 2QLZA 2OQRA 2F2EA 3I4PA 1FNNA 5HOOA 1IW7F 1S8NA 4GO1A 2ISYA 1O3SA 4EM2A 4RB3C 4R1HA 1D8KA 1QBJA 2HGCA 1PP7U 4UVAA 3LAPA 4Q5SF 1F1ZA 4ON0A 1PUEE 3P7NA 4OINF 2UWMA 1QGPA 2QQBA 2HFHA 2Y0MA 2HR3A 5DUIA 2DPDA 2X0LA 4EM0B 3EQLF 3WTTC 5FLXK 4L5IA 3BOQA 3GEZA 4A2UA 3R4KA 3I54A 3WGGA 3V7CA 1FOKA 1SFUA 1I1GA 3DFGA 1ONVA 3R6SA 1OR7A 1XMKA 3BJOA 2XHKA 4KA4A 1XD7A 5BS6A 5FB2A 1L0OC 4A6EA 1HSJA 2ZNYA 3BPVA 4KMUX 4UV9A 3WTWC 2FNAA 2X4HA 3CO6C 5D5VB 4A12A 2K4JA 2F5FA 1J9IA 5EEHA 2EA4A 2KIUA 3C18A 2BGCA 3FM5A 2M1BA 2NS0A 2HKOA 3E6CC 2Y75A 2BYVE 2KJCA 3L00A 5K1YA 3SZTA 3IRQA 1W5SA 3SQNA 4ETSA 4L0ZB 3NEUA 1G4DA 2CGPA 4KMFA 3F8BA 4FX0A 3OOPA 1ON1A 3TOBA 4N9HA 3EETA 3JW4A 1WSUA 3KZYA 5ICCA 2IT0A 2BE5F 4KIBA 4ENKA 2XAQA 1IUYA 1VTNC 1KU2A 4AD9A 1IN6A 3KLNA 1GXPA 2FMLA 1DPUA 2VC1A 2IA1A 1BC8C 1D5VA 3H3UA 2QUFA 1P4XA 2RVCA 3KEQA 3SZPA 3ZQ7A 5D4SA 1O7LA 4MTDA 2Q2EA 4HZFA 3K0LA 1CF7B 3E6BA 3L9FA 3MFKA 3LQQA 5HS9A 2A6HF 4NQWA 4WXCA 5L3DA 1S7OA 3R61A 2XASA 3F6VA 5LLQA 3PQKA 2GZWA 3GO5A 3RI4A 2OU2A 4IF4A 1BN5A 4LGWA 3ISPA 1STZA 1UHWA 2EWNA 5HLHA 5H6RA 3RKWA 4EJVA 2IA2A 2IA0A 5FLXZ 4A0ZA 1SD4A 4FT8A 1IRGA 2VT2A 1IRFA 5ILSA 4QWQA 3MEXA 1R23A 2VBWA 1K7AA 3F8CA 1QQIA 1WRJA 2O61A 2HEOA 2MH2A 4O6JA 3FXQA 3ABUA 1MJBA 2XKPA 1J0RA 3ZN0A 2O0YA 1T98A 3TO6A 2WTEA 1FPQA 1WQ2A 4U0VA 4BHCA 3BJ6A 1FP2A 1T2KA 2LSOA 1R5HA 4HDVA 2GQQA 5DUKA 4GCVA 2XROA 4WK8F 4L9NA 5E17F 3T8RA 5ILVA 1XB4A 3AAFA 3GFIA 4S05A 2PN6A 1BIAA 1LEBA 3L2CA 1BI2A 5J8FA 3CDHA 3JTHA 3BY6A 4XLPF 4AVPA 2AS5F 1ZARA 3VEPA 3M1EA 4IVNA 3RKYA 4HF2A 1H9TA 3ZMTA 2HS5A 2P5VA 3N97A 4OOIA 1KU9A 5D8KB 2XAGA 5E1WA 5CJ9A 3KP2A 4LD5A 3I64A 1WI9A 4KYWA 1O3RA 5F64A 1W4MA 1TW3A 2CFXA 1YS7A 2XKOA 3REOA 1TBXA 2Z99A 4B8XA 2PI0A 5E1ZB 1ON2A 4M6XA 4KN4X 2VE9A 5AIPA 4BYYA 2W24A 2D1VA 3MZHA 2VBYA 2K86A 1I6XA 4RAZA 3O3KA 5L3EA 1BC7C 4I09A 5J8CA 1I5ZA 3ABTA 3OV8A 2J5PA 2LKPA 1DUXC 1GXQA 3RJPA 3BWGA 2CG4A 2HQRA 1B9NA 1USTA 1FYLA 3U9GA 1BM9A 5DCMB 1JHFA 1X3UA 1TQIA 1IXRC 3I5UA 4MTEA 3D0SA 1EH7A 2GWRA 2EB7A 1XN7A 1ZLJA 2UZKA 1KQ9A 4YIIA 1U8RA 1LNWA 2PEXA 1O3TA 2FSWA 3HTUA 3W6JB 1FSEA 3RDIA 2FRHA 1MJ9A 4EM1A 3KLOA 3P9IA 1LJ9A 1WWXA 2K27A 4Y17A 3T5XA 4RB2C 1U78A 4PGHA 1IF1A 3HRSA 1AWCA 4G7OF 4HQEA 3E3VA 4YFNF 3RKXA 2M5WA 3F3XA 3RYRA 1G3WA 3WTSC 2F5DA 4WF2A 5ILUA 4D0PA 2FQ3A 2QENA 2STTA 3GFLA 3CLOA 2FXAA 2QZ8A 2V1DA 2MC3A 4GYIA 4HOBA 2B0LA 2ZMEA 2HYGD 3H3ZA 3HYIA 2LNBA 4ZYHA 2ESNA 2EV0A 1FSHA 4G7ZF 2V6CA 2HQNA 1T0FA 4UHTA 3IKTA 4KIFA 1FBQA 3CUOA 4LMYA 1P6RA 5D6EA 2XRNA 4S04A 3FMQA 3LA2A 4UNOA 2DTRA 1BJAA 4AIJA 2PG4A 5FO5A 4M9SA 2RC4A 3QU3A 1SFEA 4AWXB 4JBAA 5DYMA 1PDNC 5L3GA 1YS6A 2YR2A 4M73A 2OZUA 1Z91A 1SD5A 3WTUC 1HW1A 1W7PD 2D1HA 3FXUA 4EJOA 1OPCA 3CJNA 3MQ0A 3R60A 2DQLA 2P6SA 3V8JA 3IC7A 3IHUA 5D4RA 3K1PA 4G6DA 1XSXA 2OZ6A 4UXNA 5HLIA 2ETHA 4HF1A 2VOOA 3ECOA 5H20A 2CO5A 3KP4A 1OYIA 1YQAA 4NB5A 1G3YA 2PBIA 1T38A 5FGMA 1JGSA 4Q47A 2JT1A 2YU3A 3R0JA 1YLFA 2PFBA 3GXOA 3IWZA 3LA7A 4CHUA 5IT3A 3EYYA 2A6EF 4R8HA 4U0WA 3E5XA 3ZPLA 3ZMUA 1XDUA 1TTYA 4H0EA 1ZGJA 1AOYA 1LQ1A 1YG2A 2PMUA 1R7JA 3WTYC 3GF2A 3P9CA 4UVBA 4Z2YA 3RTRA 5FFZA 2IRFG 3E5QA 2WWYA 2XAFA 3V7RA 2A68F 4XBFA 1LVAA 2Z9OA 4WCGA 3HUGA 1P4AA 4OMYA 2R3SA 4JQFA 2ZBKA 2HTSA 3JAMK 1JHHA 2DT5A 4I0AA 4HQMA 3QP6A 2JSCA 2MA3A 4ZYDA 1D8JA 2M45A 4DQ2A 1FP1D 3FF5A 4EGZA 2O8XA 2RDPA 2H27A 4BHBA 1HXDA 3HHHA 5LGNA 3J7AO 3ERED 2MD5A 2Y48A 4O3MA 1V3FA 2EJRA 1F4KA 5KK1A 4CYDA 2BV6A 2BBYA 3K2ZA 4WXHA 4L9VA 2VC0A 4RGSA 4XSZF 2ISZA 3IWFA 5LHGA 2E7WA 2L01A 3M8EA 2VBZA 2XUBA 3M7GA 5D6FA 2D2WA 3SXYA 4P9FA 4TV7A 5DEQA 1Z6TA 1HW2A 2Q8KA 1KGSA 1SD6A 1LDKB 2QYOA 3ML6A 1JXSA 4E70A 5ICEA 3QOPA 1MGTA 2DAOA 3ZP5A 1K78A 2ZKZA 3GLXA 4XSXF 4F7ZA 1G3SA 2A69F 3DF8A 4FX4A 2H6CA 1HKQA 1U5TC 3KP7A 4HX4A 4EVIA 2PQ8A 3RPQA 1OKRA 1ZLKA 4HW0A 1XGOA 1U5TB 2PMHA 5HLGA 2K4BA 1SD7A 2ZO4A 2HWVA 2ELHA 1PP8F 2XIGA 3DPTA 3BPXA 1DDNA 3I59A 2DBBA 3MCZA 4LLNA 2NNYA 3GYHX 2ZJ2A 1HSTA 1RIOH 5H6QA 1FYMA 5CVVA 4YFXF 1B4AA 3J80K 3JTGA 3L7WA 3KP5A 5BQTA 3CO7C 3K1MA 1KU3A 2L02A 4KFCA 4LG0B 1XCVA 1G6NA 3F21A 2IVMA 5AIQA 3B73A 2WC2A 4BAYA 4O5VA 4OU0A 3QRFF 2GAUA 4OIQF 1RUOA 4U88A 3T1BA 4NHJA 3V8KA 4KICA 5FD6A 1ZRCA 4IRGA 2JZYA 1S6LA 1KYWA 1XDSA 1W7PA 4LK1F 2DK8A 5A2QZ 3F8NA 3R0AA 1FT9A 3C3WA 4HV6A 4A0YA 4ZYGA 1KU7A 1YW7A 3WTZA 5D5XB 5LHHA 1T6SA 5ICFA 1NHAA 1V4RA 4CGZA 1YW8A 2DI3A 2EA2A 3RPUA 3U1DA 4ZZDA 2RV8A 5ED4A 5E18F 2EFNA 1A04A 1R58A 1HKTA 3KZZA 4MQ9F 2H09A 1YTYA 2OBPA 3VODA 4ENJA 1S29A 2TDXA 1XSDA 3DV8A 3V8LA 1ZYRF 1EH8A 3EUHA 2KJBA 3DXJF 4CDGA 2GA2A 5L3CA 4HYEA 2P8TA 2ZCWA 4N9IA 4ZYEA 3P9KA 3J81Z 1BIBA 4U7BA 4GXOA 1P92A 3KCCA 4LLGF 5CYVA 2COMA 4KNYA 4M74A 4I98B 2HYFA 4FHTA 1EH6A 4M6YA 3TDZC 3SFZA 2ZFWA 1FZPB 3LQRA 2JPCA 1UCRA 2EFWA 5E8GA 3GVAA 1F5TA 2OAZA 3TO9A 1IN4A 1TNSA 4MQVA 3EDPA 3LA3A 5LEKA 1O7FA 3WE2A 1MKMA 3FWEA 1O57A 2CWEA 1KA8A 1SMTA 4AIKA 1YFHA 1LEAA 4YIFA 1P2FA 5HS8A 3BZ6A 2VXZA 4I0BA 1J7KA 4Q4ZF 3FMRA 3HTSB 2QVOA 5HDKA 3SHFA 5E1XA 1UB9A 3MZYA 4GGGA 1R36A 4KUMA 2W57A 1BI3A 2CYYA 2KRFA 4MGRA 5A2QK 1IZ1A 4UV8A 2Z5UA 1FC3A 4M9XA 4IRIA 2NYXA 2A61A 3K1NA 2VN2A 4CO8A 1T39A 2M87A 2H94A 2EV5A 3M9AA 4ENNA 1P4WA 2P6TA 4EQQA 4P5OA 2YPRA 1RNLA 2W85A 1G3TA 4LK0F 2QQ9A
chains in the Genus database with same CATH superfamily
4NC8A 3I55I 1E17A 2XSDC 2VQLA 4UUTA 4GFBA 2J5OA 3B02A 2DO7A 1B9MA 1S3JA 4CA0A 1R1TA 4L9TA 1QHHD 2XGDA 2V26A 1XMXA 3HPGA 5KHDA 3K70D 1O4XA 4RB1A 4XKBA 3EUHC 2LLKA 3TOAA 4NNJA 4BBSJ 1XGNA 4CCNA 4HPQA 3WGIA 1JT0A 4AM3A 3G2BA 2JRTA 4RBOA 3S93A 1IJWC 4ZDOA 1BI0A 1SAXA 2R4GA 3ZMVA 3D5LA 2DA7A 3ZMDA 3LWFA 4M3GA 2QGUA 4JX5A 2YUSA 4P1WA 1FLIA 1ETXA 2ZMEB 2PLYA 1RKWA 4L0YB 4IX7A 4N4OB 4W97A 1QZYA 4FETA 2JUGA 1X1AA 2HNHA 2ESHA 2V1XA 1LDJA 4KN7X 4D7MA 1S7AA 4LIUA 4LB6B 1EV7A 2QSHX 3BCAA 3LSTA 5HS7A 5EEGA 4FASD 5LGUA 5K5QA 1VQ6I 2E2HJ 4IOCF 2XB5A 1WPKA 2IPQX 2VE8A 5LRRA 3ZMSA 4G12A 2V9VA 1OCZH 4XL9A 5LBQA 2NRAC 2RKHA 2ELKA 3H92A 3GUDA 5ICGA 3TDUC 2KZVA 1XPXA 3GTLJ 1MD0A 2VKDA 3O6BB 3LSGA 2DN0A 3OYNA 2PJRA 2JA8J 3GTJJ 1W0UA 1TW2A 3PQJA 2ZJPF 3FX3A 3IUOA 1QNTA 2EK5A 1Y56A 4HNTA 2XC7A 2EPFA 1F9NA 2M30A 3HHGA 3K70C 3P5JA 1MBKA 4A3IJ 2FOKA 1ZN2A 1IN8A 2O9LA 1R1UA 1MNDA 2L7FP 3G4SI 3KYCB 2WB1A 1WH7A 2EFQA 1A6IA 4F92B 4HX8A 2CUEA 2KIMA 3HG9A 4Y3OA 1MZBA 2DYRH 4I01A 2KP6A 1HQCA 5TJJA 5CVRA 3G1OA 5LRSA 2B9SA 1FBSA 1OYYA 1NK2P 1CGPA 3F6OA 3QPTA 5LHIA 3FM3A 1W7PB 2L7ZA 3KIOA 2HVSA 1O3QA 1Z7UA 3WG7H 2DFIA 5F1RA 3HOTA 5BOXA 4A3DJ 3V7SA 3CCYA 5HDGA 3T0YA 5JI6A 4IHTA 1LFPA 3G73A 4X1EA 4XLCA 1LDDA 3LAJA 2FU4A 2MLGA 5FFXA 1Q1HA 5IT9Z 2VBXA 1ZG5A 2WAQN 2L0KA 1ZHFA 2NNNA 2X51A 2DU9A 3O8GA 5JHUA 2MH9A 3KEOA 1IXSB 2HPMA 3PSFA 2VODA 2YSRA 4UUVA 3LSMA 2R7QA 1R5ID 4BJTA 3EYIA 2M8EA 4E7KA 2HKXA 5K5OA 5DD4A 4PGGA 3I3LA 4RAYA 1ETWA 3BG7A 1RUNA 1A36A 4G94A 5AONA 2PJPA 1CF7A 2M4GA 3H9QA 2HOEA 2X1DA 4XLHA 5EF6A 5LGTA 4CCJA 2LREA 4ESJA 3K4LA 2FBIA 2KIFA 2IEKA 1YJWI 4I2OA 3K2AA 1JE8A 5F6FA 2DDAA 2HXIA 1B1BA 2K02A 5CVUA 2HVRA 4OMZA 2IGOA 4GRIA 1USSA 3OIOA 1YI2I 3G3ZA 5KVRA 5M5WJ 4DZPA 1Z6RA 2R7SA 5K5RA 2GXGA 4X0GA 1LE8A 1GVDA 3IKVA 3Q9SA 4FISA 2HOAA 2EFPA 2VL8A 2UXNA 5HNHA 2VONA 2EZKA 4XRSA 2R7RA 2H1LA 2HU9A 1VI0A 2IW5A 2A5WA 3IP4B 2FBHA 2W25A 1WH5A 3JRIA 2DT7B 5D5WB 3H0GJ 4I7HA 5D5UB 5L3FA 1DGRM 1UHSA 4H4KC 1HW5A 2O03A 1XGMA 2ZXWH 2VOPA 3FXRA 4YRVA 1MDMA 3CUQC 3V4GA 3VWBA 3ZN1A 4LFUA 3H5RA 2Z3YA 4A93J 2QWWA 3OYAA 2JWTA 2PMZA 1EA3A 3M8FA 4U7DA 1WJEA 3DTEA 1LFBA 1K78B 1KQ0A 1IXCA 3NRVA 4J19A 4E7JA 3OYIA 3HOSA 2OD5A 3NQOA 3TP3A 4DBRA 4XMYA 4CYCB 4HNUA 1I27A 5GTIC 2MG4A 3CUQA 4IRHA 2QF7A 4OWRB 4BXXJ 4F93B 2KIQA 3S2HJ 3CUQB 4LLLA 2XAHA 3UR3C 1YITI 3WHCA 5EJCA 3K4BA 2DFHA 1OCPA 1GHCA 3F8MA 3IAM2 3U2RA 4IHYA 1BI1A 5IYBJ 2K3PA 1UFMA 2DJNA 4KIGA 3CCEI 4BY1J 4ZDPA 4RGRA 4ZTJA 3RQ4A 2Y69H 2BHYA 1Z1DA 5FKLA 5BPIA 3J7ZI 2LY9A 1SEUA 1HC8A 5IP6A 2HVQA 4U0YA 2XGEA 1S5LC 4DGWB 2DLLA 1SMYF 2G9WA 4PZJA 1KYZA 3H3VK 3I4NJ 2VT3A 2X6OA 1MMSA 2P7CB 2I8DA 2PJRB 2XVCA 1MSFC 3F8FA 3BZKA 2DA6A 4ABZA 1YRNB 4AC0A 2BVMA 5HNFA 1OCOH 4EGYA 4HLYA 2E7XA 4EV0A 1J5YA 3UNGC 3OYDA 3FXJA 3CCLI 3D5RC 2FNPA 2ADUA 2Q1ZB 4B47A 4BUPA 5F0FA 3WGHA 2E1NA 1E2XA 1SFXA 3MWMA 2L54A 3QYEA 3HRUA 4WX9A 1TWFJ 1VQOI 1RR8C 1VQKI 5IOZA 2DXIA 5CLSA 3DPLC 1ETOA 4CZZA 3ABMH 4MEYF 2LF7A 1HKSA 3DTKA 1FWZA 4HA8A 1L3LA 5L3BA 2IS1A 2JPBA 2LDUA 2ZJQF 3K7AJ 2IGMA 1WJBA 1BR1A 2RN7A 5JFRA 3W2WA 3I58A 1YHQI 2MLKA 4A0XA 5EG0A 3DU5A 1WI3A 2DMNA 4PFPA 1DP7P 2M0CA 3MKYB 4BS9A 1ENHA 2ZXJA 2HQ5A 3I71A 2XPVA 2AHQA 2R92J 3X2QH 3TKYA 1BOAA 2P7VB 3RYPA 4CICA 3L09A 1OYWA 3BDDA 3FK6A 3ONQA 3K9TA 5TGTA 4OIOF 3I59B 2AXLA 1HBXG 4PDKA 3OL4A 2MBFA 3SYTA 3LSIA 2L9VA 2VB6A 2HDCA 4C2MJ 1JI8A 5FKKA 5K7FA 3TO7A 3QU6A 4DYRA 5IYCJ 4CYCA 3TQNA 3A01A 4Y52J 4HDUA 1JGGA 5FKNA 3W6KB 5JHFA 4RGXA 2A3SA 2R0QC 1OISA 4IZZA 1R6RA 5J6XA 3A01B 4Z6YA 4G8XA 4KT5C 4MNUA 4NC6A 1ZR2A 1XSVA 4BHPA 2STWA 1JTYA 3CMMA 3CJQB 5HVQC 2LFBA 3QP5A 1UMQA 4L5JA 4IJAA 2DT6A 4ENMA 2R7DA 4ITVA 1ZRFA 5EEAA 2K85A 3OYBA 1W5TA 4XRMA 2ZC2A 3CJRB 3A03A 3HXLA 4C9YA 4IPAA 4C30A 2DK5A 3CF5F 1JUMA 5E20A 2K9QA 1IRZA 3HKZA 1TC3C 3VDXA 1RESA 1TLHB 1QPMA 1ZELA 2OPTA 1LKXA 1FJLA 5BPDA 3W2AA 1GT0C 3W2VA 3FXLA 3A2KA 2V4JC 3OOUA 3Q5FA 5CVIA 3G6EI 2BEOA 2EFOA 2GIVA 4MEXF 2X1CA 4IOAF 4BKXA 4PJJA 2WV0A 4YFKF 2DW4A 3FZVA 3IH3A 4HAMA 4RAFA 4EJWA 4QPQA 2K7LA 2M4KA 3F72A 4YIRX 4GYGA 2CW0F 1VQ7I 2WBMA 1MBGA 3FBNB 1E0EA 1TWCJ 4CXFA 4M71A 3CP8A 4MFDA 1U9NA 3OR2C 2E36A 2P5KA 2LY2A 2UXXA 5F0HA 3WE3A 2E1CA 2A6TA 4HF0A 5M3MJ 2F4OB 3FHZA 5E3MA 2CV2A 3N4MA 4A5NA 3CTAA 2W84A 1M1EB 2NVUB 4N0BA 2LC2A 2DFEA 3CC2I 4LITA 3ABLH 3BROA 2CV0A 3QAHA 2KFDA 2QKMB 4A5MA 1ODDA 3GLLA 5CQGA 1ZAOA 3E0JB 3RIRA 2QBYA 2IJLA 4Q48A 2JMWA 4B09A 1U2WA 1R4MB 2JJ7A 3OYEA 4AIHA 4PCQA 2GXBA 1XCBA 5IT9K 1YYVA 3TL4X 3HUGB 3ZMZA 3S32A 2E34A 2F5CA 1UELB 2DJIA 3HSEA 1MNEA 5J40A 2LH9A 4EATA 3SJMA 1ZQ3P 3QWLA 4EJUA 1NTCA 1TWAJ 2FE3A 2VQCA 5EZGA 3COAC 2MC4A 4FE7A 4A3KJ 4IKFA 1WKMA 4A3CJ 3HRMA 2EV6A 5HDNA 3CP2A 1K79A 4I02A 3J80Z 1IAWA 2V79A 3IH2A 2M7AA 4XLAA 4QIWN 4Y13A 1SVMA 4ZZLA 2OTLI 1J59A 1W1WE 2HZTA 3MAJA 3JSPA 3F9KA 2CQQA 3L2VA 2XPWA 5B1AH 5DTDA 5GADJ 2GA1A 1U6GA 4XOPA 4AUXA 2DCEA 3DKWA 4PJNA 2PMZN 3B6AA 4JP0A 1LB2A 4L5EA 1MIJA 2RGVA 3GFJA 3IL2A 2F5EA 1X19A 2LRDA 2A05A 2E5ZA 5DV5A 4XM3A 5D8LB 2HTJA 5DM6F 4V19K 3HOUJ 4IXAA 1ACIA 3C7JA 1U5TA 4G6TB 3WU1B 1EJ9A 3CC7I 2DMUA 2XV4S 2BY2A 2OUMA 4P96A 2C6YA 1R22A 2P5LC 4OIPF 5GPAA 1YIOA 1ZGAA 5ERIA 4BQQA 1IN7A 1H9GA 2KKOA 3JSOA 4BQAA 3GTMJ 5DCFA 3DBHB 3S1RJ 3E97A 3GZ5A 3L1PA 2O8KA 3S1NJ 1E3HA 2DQRA 5E8IA 4MHGA 1EF4A 1LUJB 2JTVA 2K9SA 2ZMEC 1Q1VA 3Q9VA 3WODF 1K6OA 1GDTA 4ZDLA 2GLOA 4QLCU 4JK1X 1RI7A 1KQ8A 3KETA 1GLNA 5IP9J 3E6DA 1ZR4A 2RNJA 2G7HA 3BR0A 3KE2A 3PNTA 2AQFA 4YEJA 4II2A 3WTXC 5TISC 2VJ4A 4BXUA 2L3DA 1SFOJ 2R7VA 3O2PE 3BJAA 2IXSA 3ECHA 2HXOA 3EPZA 2NOJB 5EZHA 1VFCA 4AYBA 3MD2A 1YX3A 3VOEA 3JCUC 4C2TA 2IS2A 4PJ0C 3HRTA 1MJAA 5HLTA 2MD0A 1JUSA 1TWHJ 3E6MA 4QSHA 1U3EM 2W1OA 2ZXIA 5B3SH 1I1SA 4IHSA 6PAXA 3GW2A 1IN5A 1ULYA 3DU6A 4BBRJ 3FMSA 4C3HJ 4C2UA 5BMZA 4P55A 2DPUA 2ACJA 4XKVA 5E79C 1E3PA 4RS8A 1TQMA 1H0MA 4HX7A 1I50J 1Z67A 3SDBA 2L4AA 5JVTA 4D5FA 2IP2A 3VB2A 3E1SA 1Y0UA 3HSRA 3WU0A 1RRJA 4A69C 3C2HA 1V5GA 2FEZA 1SAUA 2PX9A 1SC7A 1ZG1A 2H8RA 1REPC 1S7EA 2WAQA 2A07F 2OTJI 2FF4A 4RB0A 1D3YA 3H0DA 1NG6A 2QQAA 3OIQA 4E7HA 2B63J 1R5GA 4G6QA 4OIRF 1QVUA 1A35A 1FOYA 1X3ZB 4UB6C 1Z05A 3LL7A 4WXDA 1X1PA 3PFIA 1RKTA 1Y8QB 1C0WA 2L4MA 4MFEA 5K7ZA 4K2EA 1OMIA 3IRRA 2X85A 3FXOA 1B59A 3LFUA 2MGQA 2D45A 1ZG3A 3K4KA 1KONA 4Y4RA 4MO7A 4CCKA 3K69A 2FA5A 1R1VA 4LB5A 2OC6A 3S2WA 2CQKA 4IEJA 3E5UA 3TGNA 3ZQLA 1DPRA 1OR7C 3GTPJ 3ZR8X 2WY7Q 3HOXJ 1B6AA 2KT0A 2NOGA 3BQZA 4A6DA 3ULQB 4HBLA 3TP0A 2O6GE 3CF2A 2I5UA 4A3GJ 4DNCA 3WHBA 3ELKA 3LFKA 2QEXI 1FMVA 2LKSA 4A3JJ 2FBKA 1WJDA 4B1RA 1NH3A 2G7UA 1YO5C 2FX0A 4P9UA 3DKYA 3F22A 2DMPA 3HGYA 3HSFA 1FY7A 1QZZA 5TRDA 2RQPA 2YX4A 3OY9A 3M4OJ 2L7KA 3W3CA 4LG0A 3F23A 2Y2ZA 3GWZA 1MBFA 3DEUA 2H6BA 2XAJA 1YW9A 5CVJA 4CUGA 3CMYA 4BJ6C 2Z33A 4PSXA 2LK2A 2R7FA 3AG1H 1MSEC 4M3BA 2YX7A 1QO0D 5J3LA 2R5YA 4HLXA 2IAIA 1XGSA 2JK3A 3OS0A 1ZH5A 2JSPA 5B1BH 2OA4A 4EMSA 4N4NB 3GZ6A 2Y0SN 1MDMB 4AVZA 3WG9A 2WA0A 2AO9A 4G9YA 3ABKH 4BH9A 2VKHA 1ZTRA 5F0CA 4ZYAA 2K3FA 1IRXA 5FD5A 4Y33A 2FMYA 1RZ4A 1OQYA 1J75A 1GVJA 2V6EA 1G2HA 1GUUA 4ESFA 2W4SA 1BOBA 2QKLB 3DQVC 2QBYB 4LIVA 3VPRA 4KDPA 3C1DA 4R79A 2LP0A 3J81K 1TZLA 3KYDB 2P81A 3LSRA 2L9NA 4ESBA 1FYKA 2E2IJ 1MBJA 3HC7A 3HOVJ 2QM3A 1OFCX 2ELJA 3CLQA 2CSOA 2W82A 2O7OA 3FHNA 2R7UA 3BG9A 2E60A 3MKLA 5DD8A 2Q0OA 4G7HF 1ZKGA 2JA5J 3GX4X 4M9ZA 3KP6A 3KP3A 2GM4A 4XRFA 2XGXA 4MIMA 4RM2A 4ASNA 1ZREA 1HDPA 2CUFA 5F27A 1FEXA 2BOLA 2WADA 4KISA 2OQGA 3PNVA 4UVCA 4ZH4F 2M9HA 2MW8A 2NXNB 5DS9A 4L18B 3M07A 2P4WA 2ZB9A 5M3FJ 2KQRA 3ROUA 3GZNB 3TEDA 1D0YA 3RCOA 3I0TA 2K9LA 5JR3A 3QPHA 1D0XA 3HKZN 5J4YA 1ZRDA 2Y9ZA 2CQNA 3VFZA 1UG2A 1D1CA 3ZQQA 1Y1WJ 1UHMA 3U1KA 2WAFA 3I53A 4LJZF 3BP8A 2Q2EB 1QVTA 2ZNZA 2VPLA 2V1UA 1RETA 2LF8A 3JR9A 4EJTA 2M2EA 1XMAA 5DCMA 2O3FA 4WWCA 4BNCA 3DP7A 5DDGA 3S16J 3HIFA 3KX2A 2FUG2 1J2XA 2L5QA 3KFWX 5GPCA 1IDZA 1FX7A 3M8JA 5LEJA 2DOEA 1D0ZA 1FBUA 4YG2F 2QCOA 1TQPA 1YOVB 4XLNF 2BVLA 3WTVC 3S3MA 2E1OA 1BBYA 4CCLA 3T8TA 4W1UA 4RGUA 4HV5A 1Z9CA 1WCMJ 2CQ7A 4M72A 1WGXA 3N05A 2A5YB 5CKTA 4IL6C 4Y15A 2HI3A 3SFIA 4L9JA 2QQ8A 3GFMA 3JAMZ 5IYDJ 4MLOA 2NAZA 4ZC3A 1TNTA 1R00A 1W0TA 2QLZA 3CC4I 2OQRA 2F2EA 2DA2A 1UG0A 3BTLA 3I4PA 1FNNA 1X4PA 5HOOA 1IW7F 1S8NA 4GO1A 2ISYA 3DPUA 1O3SA 2EIJH 1HA8A 2EILH 4EM2A 4RB3C 4R1HA 2KDOA 4E7ZA 1D8KA 1QBJA 5C4XJ 2HGCA 4EEFG 1PP7U 3CESA 3JREA 1K83J 4UVAA 5GP9A 3LAPA 4Q5SF 1F1ZA 3A0HC 4XLFA 4ON0A 1VQ4I 1JKOC 2I10A 2MFZA 1PUEE 3P7NA 2F4IA 1EKEA 1RC9A 4OINF 3L2UA 2LY1A 2UWMA 3BCBA 1QGPA 1XG1A 2QQBA 3PFYA 2HFHA 3ZXSA 2Y0MA 3PO2J 2FD5A 3U21A 3D5SC 3DEEA 5J47A 5FROA 4BE2A 2V1NA 2HR3A 4XK4A 4XLEA 2EIKH 5DUIA 2DPDA 2F6CA 2X0LA 4EM0B 3PNYA 1IDYA 1P7IA 3WU2C 1R4NB 1YIJI 1R9TJ 1ITYA 2QA4I 3Q3SA 4JX4A 3H5NA 1VQLI 2XF5A 3EQLF 2X1EA 4E7IA 3WTTC 1DU0A 2CUZA 5FLXK 4L5IA 2EBIA 3A1YA 3BOQA 3CCMI 3GEZA 4A2UA 3R4KA 3I54A 4F91B 3JRGA 3KEYA 3WGGA 3AG4H 3ZCOA 3V7CA 2B7EA 3A02A 3AG3H 3AKZA 1FOKA 1J09A 3PO3J 2HQAA 3GTKJ 1SFUA 2Y30A 1Z21A 1VQ9I 1I1GA 3DFGA 1HDDC 1ONVA 1R71A 1P9QC 3R6SA 4I6ZA 3AL0C 3TBIA 1OR7A 1XMKA 3GTOJ 3BJOA 2IGNA 2XHKA 4KA4A 2NVYJ 1XD7A 2WAEA 3FIWA 5BS6A 5FB2A 4NC7A 1T08B 1L0OC 4A6EA 1D5YA 1HSJA 2ZNYA 3KZIC 1XS9A 3BPVA 4KMUX 4UV9A 1H89C 3OIPA 5KCMA 3WTWC 1UJ8A 2FNAA 2X4HA 3CO6C 2DMQA 1WZ2A 3KPHA 5D5VB 3PIOF 2G0EA 4A12A 2CUJA 1I6HJ 2HPIA 2K4JA 2F5FA 1J9IA 2F4MB 1MBHA 5EEHA 2EA4A 2KIUA 3C18A 2BGCA 3FDYA 3FM5A 3FXMA 2M1BA 2NS0A 2HKOA 3E6CC 2Y75A 3MMYB 2BYVE 2GOMA 4DBQA 3JRBA 2CV1A 4KT6A 2KJCA 4A3FJ 3L00A 5E3LA 3SZTA 5K1YA 3IRQA 1W5SA 4HSTA 2JN6A 1BW5A 1HF0A 3SQNA 4ETSA 4L0ZB 3NEUA 1G4DA 3C2GA 2CGPA 3LSPA 2F5VA 4KMFA 2BY3A 3F8BA 4FX0A 3OOPA 1ON1A 3TOBA 1W36D 3BG6A 4N9HA 2IS6A 2Z16A 4HG2A 3EETA 3JW4A 1HLVA 1WSUA 5F04A 3KZYA 4XN0A 3OYJA 5ICCA 1G59A 2IT0A 2BE5F 4KIBA 4ENKA 1X3WB 3GTGJ 4XOTA 2XAQA 5KAIC 1IUYA 1VTNC 1YJ9I 1PYVA 1KU2A 1XC5A 4V2GA 3BTIA 3HBLA 4BACA 4AD9A 1IN6A 2EIMH 2K40A 3K10A 1HCRA 1T0FC 3KLNA 4XRSG 4RDUA 3J7YJ 4C3IJ 1JTXA 2XRLA 2UUZA 1GXPA 3S17J 2FMLA 3ZQGA 2X48A 1DPUA 2VC1A 2IA1A 5JVGF 1BC8C 1D5VA 3H3UA 2DFFA 5IPAA 2QUFA 3O8HA 3BQYA 1P4XA 2EQRA 2JVHA 2RREA 2RVCA 3KEQA 3SZPA 2ME0A 3ZQ7A 3K6GA 5D4SA 1RPWA 1S9HA 1O7LA 4PUSA 4MTDA 2Q2EA 4HZFA 3BTCA 1SFKA 3K0LA 5FKMA 3OYHA 1CF7B 3E6BA 3FXKA 5BNGA 3L9FA 3MFKA 3LQQA 5HS9A 1W36C 2A6HF 3A0BC 4NQWA 4NUBA 3LSHA 4WXCA 5C4JJ 3NWSA 2VIXA 5L3DA 3ZOBA 4V2FA 1S7OA 3R61A 2XASA 3F6VA 1RR7A 2LMDA 5LLQA 3PQKA 2GZWA 3GO5A 3RI4A 2OU2A 4XKWA 2X9DA 4IF4A 1BN5A 4LGWA 3SEQA 5C3EJ 2FQ4A 3ISPA 1STZA 1UHWA 1A31A 2EWNA 2O5RA 5HLHA 5H6RA 3DEWA 4AIDA 1IUFA 3RKWA 4EJVA 4D1QA 4CZCA 2IA2A 2IA0A 1G8XA 4F52A 3MN2A 5FLXZ 4A0ZA 1SD4A 2RQQA 4FT8A 2VT2A 1IRFA 4CSWA 4A3BJ 1IRGA 2OCEA 5ILSA 1FMWA 4QWQA 3MEXA 3AL0B 1R23A 1U9OA 2VBWA 1K7AA 4BE0A 3TW7A 3F8CA 1QQIA 1WRJA 2O61A 1I39A 4DYCA 1V5EA 2HEOA 3Q0VA 3HOZJ 2MH2A 4O6JA 3FXQA 1TP4A 3ABUA 3PM1A 1MJBA 2XKPA 1J0RA 2FJ1A 2K9NA 3ZN0A 2HOTA 1VNDA 3HL2A 2KLOA 5F08A 2O0YA 1T98A 1F36A 3TO6A 3AG2H 2WTEA 4B43A 3CCQI 2XSJC 1FOWA 1FPQA 1MBEA 3RPUD 1WQ2A 2BZTA 3G1LA 2E1MB 2JA2A 3ZRGA 3ESWB 4U0VA 4RA2A 4BHCA 3BJ6A 1FP2A 3JRFA 1LVKA 1T2KA 2LSOA 1Z0XA 1T95A 1A6QA 4QTRA 4F55A 1R5HA 3OYKA 4HDVA 2GQQA 4IO9F 2Z1DA 5DUKA 1WJCA 2M7BA 4GCVA 2LVSA 4RM3A 2DA3A 2XROA 2M34A 3HJEA 2ICWG 3TW6A 4WK8F 5LFAA 4XIDA 3QYFA 4L9NA 5M5YJ 5E17F 3T8RA 1S72I 2Y0SA 1X1BA 2LTPA 1XB4A 5ILVA 3D1NI 3AAFA 1BA5A 3BZCA 3GFIA 4S05A 2PN6A 4OAYA 2ZJRF 1BIAA 2E1MC 4DOZA 1LEBA 1IGNA 4BL0B 4C3JJ 3L2CA 1BI2A 2EH3A 5J8FA 2BXZA 3CDHA 3JTHA 3LSKA 3RZDJ 1X58A 2DDBA 3QODA 3OWTA 1WFXA 5FLVA 3BY6A 3F0CA 4XLPF 4AVPA 2AS5F 1ZARA 3VEPA 3M1EA 1OCCH 4IVNA 3RKYA 1AU7A 4HF2A 1AKHA 1H9TA 3ZMTA 2HS5A 2P5VA 2R7XA 4RLFA 3N97A 4B4CA 4OOIA 5C44J 3I4MJ 1KU9A 5D8KB 3S3NA 2XAGA 5E1WA 5CJ9A 3KP2A 3K4NA 4LD5A 3DBRB 3I64A 1WI9A 4E6KG 1O3RA 4KYWA 1AA7A 3M1CA 3VSKA 5F64A 1W4MA 1PVEA 4AU7A 1TW3A 2CFXA 2W00A 1YS7A 2XKOA 3REOA 1TBXA 1D1BA 3C2BA 4B3XA 3ZQCA 1VQ5I 2N8GA 5FJ8J 2IBDA 2Z99A 4B8XA 2PI0A 5E1ZB 4A3LJ 1ON2A 1SVLA 1WJAA 3OS1A 2LG4A 3OYLA 4M6XA 1V5FA 2BW3B 3CCRI 4KN4X 4JX6A 3H9GA 2VE9A 5J1RA 2ECCA 5AIPA 4BYYA 2DA1A 3AFHA 2W24A 2D1VA 1VQMI 1SANA 2VKVA 4RAGA 3MZHA 3CCVI 2VBYA 2OV7A 1OCTC 2K86A 1MH4A 3PSIA 1I6XA 4HSRA 4RAZA 5JLXA 1AHDP 1FTZA 3O3KA 5L3EA 2IS4A 3QQAA 1BC7C 3H36A 4I09A 2Y31A 5J8CA 1I5ZA 3ABTA 3OV8A 5H2FC 1IV6A 2J5PA 4I76A 2LKPA 2ID3A 5HODA 1DUXC 1FOXA 2M8GX 2L7MP 1GXQA 1Z77A 3RSNA 2V9KA 2BY1A 4PJMA 3RJPA 3BWGA 2CW8A 2CG4A 2HQRA 3BR2A 1B9NA 3H1CA 3K4CA 3VYSB 1USTA 3DCFA 2CJJA 3HB9A 3JRAA 1FYLA 4AYBN 3U9GA 1BM9A 2VASA 2RAEA 1WHUA 3EUKL 2H1KA 5DCMB 1JHFA 4LG3A 1X3UA 1Z7LA 4BE1A 2XGCA 4KJZA 1TQIA 1IXRC 3I5UA 4MTEA 3S15J 2JA7J 3PJRA 3D0SA 1EH7A 2GWRA 2EB7A 1XN7A 1ZLJA 2UZKA 1KQ9A 3DTIA 4YIIA 1W5CC 2E5NA 2GOXB 1U8RA 1IC8A 3CDIA 1LNWA 2PEXA 3GBGA 2Y9YA 3GCMA 4HNVA 1O3TA 2FSWA 3HTUA 1FSEA 3RDIA 3RQIA 3W6JB 2FRHA 1K4TA 3HDDA 1N25A 3LMMA 1MJ9A 4EM1A 2DA5A 2OJED 4CH7A 4BDZA 2VJIA 4BU2A 2E71A 3KLOA 3OYCA 4XN3A 2VI6A 3P9IA 2R5YB 1LJ9A 1WWXA 2K27A 1XTAA 4Y17A 3T5XA 4RB2C 2EINH 1U78A 1CQTA 4XORA 4PGHA 1PUFB 4S0HB 2HOSA 1IF1A 2MYSA 2JUCA 3HRSA 4E4HA 1AWCA 3HPHA 1B8IB 1UZCA 4HQEA 4G7OF 3E3VA 2LKXA 2VPRA 4YFNF 3RKXA 2M5WA 3F3XA 3RYRA 1G3WA 3WTSC 2JA6J 2F5DA 4WF2A 5ILUA 1DP3A 4D0PA 2FQ3A 2QENA 2STTA 3GFLA 4IQ4A 3L2WA 3CLOA 2FXAA 1N77A 3BC8A 5IOYA 2QZ8A 2V1DA 2MC3A 2HZDA 4GYIA 3BLYA 4HOBA 5GAGJ 5LD2C 2B0LA 3ASOH 1YRNA 3VSLA 2DTZA 3IH4A 3QOEA 2ZMEA 2HYGD 3H3ZA 3HYIA 5F1JA 4DW6A 2VKEA 2LNBA 4ZYHA 2ESNA 4UUSB 2EV0A 5JLWA 1FSHA 2W7NA 4G7ZF 2V6CA 2HQNA 1T0FA 4UHTA 3IKTA 4KIFA 1FBQA 4PFOA 3CUOA 4LMYA 4PK4A 5EG0B 1P6RA 3OMYA 3M3YJ 1ZGWA 5D6EA 3HEFA 2XRNA 4S04A 1WJFA 3FMQA 3LA2A 3CDLA 1F43A 1X4OA 3ZQIA 4CCMA 3J7AY 4XONA 5GAHJ 4UNOA 2DTRA 2R5ZA 1BJAA 3OSGA 5FKOA 3VYTB 5FRNA 2DMTA 1B8IA 2KMUA 4AIJA 2PG4A 5FO5A 3NAUA 4XR6A 3S14J 4M9SA 2RC4A 5IY5H 1JJ8C 3QU3A 4II3A 1SFEA 2KL4A 4AWXB 4JBAA 5DYMA 1PDNC 3HOWJ 5L3GA 1YS6A 4NQWB 2YR2A 4M3EA 5DM7F 2VLAA 4M73A 2E2JJ 2OZUA 5E3NA 2ZXHA 1Z91A 3QPSA 2BHZA 3LOCA 2CW7A 1SD5A 3WTUC 1N75A 1HW1A 1W7PD 2D1HA 3JRCA 3PL8A 2V7FA 1JKPC 3FXUA 4EJOA 1OPCA 3CJNA 3MQ0A 4HRIA 3R60A 2DQLA 2P6SA 3V8JA 1K61A 3IC7A 3IHUA 5D4RA 3K1PA 2F48A 4XNFA 4G6DA 1V54H 3CQZJ 1XSXA 2OZ6A 4UXNA 3V42A 5HLIA 2AXTC 1BR2A 3OS2A 1MMAA 2ETHA 4HF1A 2VOOA 3ECOA 5H20A 2VQHA 2CO5A 1E3OC 3KP4A 2GIZA 1OYIA 3G71I 1TWGJ 2MSYA 1B72B 1YQAA 4NB5A 3K4JA 4A3MJ 3DLLF 1G3YA 2PBIA 2OCCH 3Q0WA 1T38A 5FGMA 2EZIA 1JGSA 4Q47A 1MMNA 2JT1A 2P0WA 2YU3A 2WB1N 2ID6A 3VYRB 3CZ6A 3R0JA 1YLFA 2PFBA 3GXOA 2ECBA 3IWZA 3LA7A 4CHUA 5IT3A 3H5AA 3FKJA 3EYYA 2A6EF 2LR8A 3HGGA 2DOAA 4R8HA 1JJ6C 2ZSIB 3BR3A 1K4SA 1TT5B 4U0WA 4U87A 3E5XA 3ZPLA 5EGOB 1U0JA 3ZMUA 1XDUA 1TTYA 4H0EA 1T33A 1ZGJA 4D9JA 1AOYA 4UB8C 2IGKA 2LBFA 3OYFA 1MMGA 1LQ1A 1YG2A 2PMUA 2VUMJ 1R7JA 3WTYC 3GF2A 1Z3YA 3P9CA 2Z2SB 4UVBA 1LPQA 4Z2YA 2R5ZB 3RTRA 4FQGA 5FFZA 1VQ8I 2IRFG 3E5QA 2XAUA 2XAFA 2WWYA 3V7RA 2EZHA 1B72A 2A68F 3FISA 4XBFA 1LVAA 2DYSH 1U8BA 1ETQA 2AQEA 2L9SA 3HUGA 1P4AA 4WCGA 2R3SA 2Z9OA 4OMYA 4JQFA 2BY0A 2KRHA 3A4CA 2DODA 2ZBKA 2HTSA 2R7ZJ 3JAMK 1JHHA 2DT5A 2HDWA 4I0AA 5B5EC 1AKHB 2QSGX 2TRTA 4HQMA 4OAZA 4CCOA 3QP6A 2JSCA 4BQOA 2MA3A 1NK3P 4ZYDA 1D8JA 2M45A 4DQ2A 4X6AJ 2V9PA 1FP1D 2RNGA 5J4VA 3FF5A 4EGZA 2O8XA 1LE8B 1OCRH 2RDPA 1Y0NA 4BHBA 2H27A 1HXDA 3HHHA 5LGNA 3J7AO 1MH3A 3MVPA 4DZJA 2MD5A 3ERED 2Y48A 9ANTA 4O3MA 4ANJA 1V3FA 4JOMA 2EJRA 4XKCA 1F4KA 2X6XA 5KK1A 4CYDA 2BV6A 3IAS2 3DKXA 2BBYA 3K2ZA 4WXHA 4L9VA 2VC0A 3MKZA 4BY7J 2E35A 4BQNA 4RGSA 4XSZF 2ISZA 3IWFA 5LHGA 4IQJA 2E7WA 2L01A 1DGWY 3M8EA 2VBZA 3I9V2 2XUBA 3M7GA 2X6YA 1TL8A 5CQEA 2LYCA 3BT9A 3S3OA 4IHWA 5D6FA 2D2WA 3SXYA 4P9FA 1NG7A 4BEHB 4YELA 4XQFA 4Y7NJ 4NBQA 4TV7A 5DEQA 1Z6TA 1HW2A 4UY8I 2Q8KA 1KGSA 1BJZA 1LDKB 1SD6A 2HYJA 2VJ5A 2QYOA 1QRYA 3EUAA 5J1YA 1MNMC 2QSFX 3ML6A 3OR1C 1JXSA 3ERMA 4E70A 5ICEA 3QOPA 1UAAA 2ZFUA 1MGTA 1P7JA 2DAOA 3E7LA 5EYRA 2YU9J 3ZP5A 1K78A 2CRGA 2ZKZA 4RLQA 3GLXA 5K7HA 1WJ5A 4XSXF 4F7ZA 1G3SA 2A69F 4J00A 3S2DJ 2VJJA 3DF8A 5J1UA 4FX4A 2H6CA 3BTJA 2WV1A 1HKQA 4M3DA 4DJAA 1U5TC 3KP7A 3I56I 4HX4A 3TMOA 1V55H 4EVIA 3JRHA 2CS3A 3B6CA 2PQ8A 3RPQA 1OKRA 1ZLKA 2NS8A 4HW0A 1XGOA 1U5TB 2PMHA 5HLGA 2LBFB 4M3FA 2K4BA 3LSJA 4BJ5C 1SD7A 2ZO4A 1OLTA 2HWVA 2ELHA 1PP8F 2XIGA 3DPTA 3JRDA 2KISA 4ZJZA 3ASNH 2CMPA 1IG7A 3BPXA 1DDNA 1T56A 2VQGA 3OSFA 3I59A 1PUFA 2DBBA 3MCZA 4BEHA 4LLNA 5M5XJ 3KYLA 2NNYA 1X1DA 1WVRA 2M3AA 3GYHX 2NVXJ 2NS7A 4E7SA 2ZJ2A 1HSTA 1RIOH 5H6QA 2KDZA 1X1CA 1FYMA 4F3QA 5CVVA 4YFXF 3L2QA 1B4AA 2COBA 3J80K 3BR1A 1MW7A 1SVOA 3JTGA 2ZSHB 3L7WA 1TT0A 2XB0X 3KP5A 1N78A 1GV2A 4GDFA 3W6VA 5BQTA 3CO7C 3S1MJ 3K1MA 3CMEI 1KU3A 2L02A 5GAEJ 1BL0A 4KFCA 4XICA 3GTQJ 4LG0B 1XCVA 1G6NA 3OYMA 1Z3XA 3F21A 3IV5A 1ERDA 2IVMA 1BR4A 1QPIA 5AIQA 1FTTA 3B73A 2WC2A 4BAYA 2R7WA 2LOOA 4O5VA 4OU0A 3QRFF 2GAUA 4OIQF 1RUOA 4U88A 3T1BA 4NHJA 5FRMA 3V8KA 2R7OA 3S8PA 1LFUP 2H8WA 3BG3A 4KICA 5FD6A 1ZRCA 3Q0UA 1QU3A 2ME6A 1FIAA 2JZYA 4IRGA 4D5CA 2CQXA 4FCYA 1S6LA 2NVTJ 1KYWA 1XDSA 3FBIB 1W7PA 4LK1F 1IV8A 2DK8A 5A2QZ 3QYBA 3F8NA 3R0AA 1H88C 5IP7J 2KHMA 3OL3A 1I3AA 1FT9A 2XDVA 2R7TA 2HDDA 4RMNA 3C3WA 1ETKA 4HV6A 4A0YA 4ZYGA 1KU7A 4D7NA 2XF6A 2JVGA 2TCTA 1A5JA 1JKRC 2L2OA 2VXDA 1YW7A 3BG5A 3WTZA 5D5XB 5LHHA 1T6SA 5ICFA 1NHAA 1YJNI 2CU7A 2FOWA 4FE4A 1V4RA 4CGZA 2DA4A 5EGOA 1YW8A 3PIPF 1ETYA 2DI3A 4KITB 2EA2A 4B3AA 3RPUA 4DYQA 3FK7A 1GV5A 1X2NA 1BW6A 3U1DA 2KRCA 4QPOA 3ZGKA 1T8IA 4ZZDA 2DOFA 5KNLA 2RV8A 5ED4A 5E18F 3BR5A 3PUBA 2EFNA 2M0MA 1DQUA 4A3EJ 2W48A 1DU6A 1A04A 1KZHA 3CCJI 1R58A 2XF7A 1HKTA 3KZZA 1QZEA 4MQ9F 2H09A 1YTYA 2OBPA 1XX5A 3VODA 4ENJA 1FIPA 1S29A 2TDXA 1XSDA 3DV8A 2LD5A 3DBLB 1R49A 3V8LA 1ZYRF 1JT6A 1EH8A 3EUHA 2KJBA 3DXJF 4CDGA 2GA2A 4PSWA 1VZ0A 5L3CA 4IHVA 3NARA 4HYEA 2P8TA 4BGDA 2ZCWA 3HZJA 5B66C 1YE9A 2L9RA 4N9IA 3S1QJ 4ZYEA 1YX5A 3ZQHA 3UKGA 3P9KA 3VYUB 3J81Z 1BIBA 4M6VA 4U7BA 3H9JA 4GXOA 1P92A 3KCCA 1QA6A 4LLGF 3CD6I 2X6WA 5CYVA 2COMA 4KNYA 2OF7A 4M74A 5CPRB 4I98B 2HYFA 4FHTA 2MABA 5EDNA 1EH6A 3SEZA 4M6YA 3TDZC 3SFZA 2ZFWA 4J01A 1FZPB 3BR6A 3LQRA 3CJTB 3HOYJ 1HOMA 2JPCA 1UCRA 2CH0A 2YS9A 4I99C 4LOCA 1VQNI 2EFWA 2CFOA 5E8GA 3GVAA 1F5TA 2OAZA 3TO9A 1IN4A 1IO2A 1Y39A 1TNSA 2WY8Q 4MQVA 3EDPA 3LA3A 3QPLA 1PJRA 1MMDA 4ZTFA 5LEKA 1O7FA 4PJLA 3WE2A 4B48A 3RZOJ 1JKQC 3L2RA 1MKMA 3FWEA 1O57A 1VF9A 2BXYA 4NDLA 2GBYA 2CWEA 1KA8A 1SMTA 2XPUA 4AIKA 1YFHA 1LEAA 5E3OA 2K5CA 1H8AC 4BDYA 2K9MA 3HM5A 3SZGA 4YIFA 2EZLA 1P2FA 5HS8A 3BZ6A 1ORKA 3CMAI 2VXZA 4I0BA 1J7KA 4Q4ZF 2JQ7A 3FMRA 1POGA 2D5VA 2KPMA 3DWLE 3HTSB 2GXAA 2QVOA 1Y1VJ 5HDKA 2E19A 3SHFA 5E1XA 1X2MA 4JYKA 4UUSA 1APLC 1UB9A 1I3QJ 2KZGA 3MZYA 1ETVA 3H35A 3PUFA 1Y6IA 3NWTA 2UV1A 1R36A 4GGGA 4KUMA 3MKWB 3MZ8A 2W57A 1D1AA 3ZQFA 1BI3A 2CYYA 1K6YA 2KRFA 1OJLA 3G1MA 4MGRA 5FLMJ 4IHXA 5A2QK 3CCSI 1VQPI 1IZ1A 4UV8A 1QHGA 2BW3A 2Z5UA 3FKIJ 1FC3A 1Y8RB 2JRMA 4BXFA 3LNQA 4M9XA 4IRIA 2NYXA 2A61A 3K1NA 2VN2A 4HEA2 3GMEA 4CO8A 2M87A 3M9AA 2H94A 2EV5A 3RKQA 1T39A 3OYGA 4ENNA 4B44A 1P4WA 2NVQJ 5KAFC 2P6TA 3CCUI 4EQQA 5GTHC 4P5OA 2YPRA 3DLAA 3SDGA 2R93J 4DIQA 3K4MA 4FTHA 1RNLA 2W85A 4E7LA 1G3TA 1ZK8A 4LK0F 2QQ9A 1JUPA
chains in the Genus database with same CATH topology
1E17A 2J5OA 3B02A 2DO7A 1B9MA 1S3JA 1R1TA 4L9TA 4RB1A 3TOAA 1XGNA 3WGIA 2JRTA 1BI0A 1SAXA 3ZMVA 3D5LA 3ZMDA 3LWFA 1FLIA 2ZMEB 2PLYA 4L0YB 1QZYA 2ESHA 2V1XA 1LDJA 4KN7X 1S7AA 4LB6B 1EV7A 3LSTA 5HS7A 5EEGA 5LGUA 5K5QA 2IPQX 2VE8A 5LRRA 3ZMSA 2NRAC 2V9VA 5LBQA 2RKHA 3H92A 3GUDA 5ICGA 3TDUC 1MD0A 3O6BB 1TW2A 3PQJA 3FX3A 1QNTA 2EK5A 1F9NA 2M30A 3HHGA 2FOKA 1ZN2A 1IN8A 1R1UA 2EFQA 4HX8A 2KIMA 1MZBA 4I01A 1HQCA 5TJJA 5CVRA 5LRSA 1FBSA 1OYYA 1CGPA 3F6OA 3QPTA 5LHIA 3FM3A 1W7PB 1O3QA 1Z7UA 2DFIA 5F1RA 3HOTA 5BOXA 3V7SA 5HDGA 3T0YA 5JI6A 4IHTA 3G73A 1LDDA 3LAJA 2FU4A 2MLGA 5FFXA 1Q1HA 5IT9Z 2VBXA 1ZG5A 1ZHFA 2NNNA 2DU9A 5JHUA 2MH9A 3KEOA 1IXSB 2VODA 2YSRA 4UUVA 3EYIA 2M8EA 2HKXA 5K5OA 5DD4A 4PGGA 4RAYA 1RUNA 4G94A 5AONA 2PJPA 1CF7A 2HOEA 5LGTA 4ESJA 2FBIA 2KIFA 4I2OA 1JE8A 5F6FA 1B1BA 2K02A 5CVUA 4OMZA 1USSA 3G3ZA 5KVRA 1Z6RA 5K5RA 2GXGA 3IKVA 3Q9SA 2VONA 2EFPA 2UXNA 2IW5A 2FBHA 2W25A 5D5WB 4I7HA 5D5UB 5L3FA 1HW5A 2O03A 1XGMA 2VOPA 3FXRA 1MDMA 3CUQC 3V4GA 3ZN1A 4LFUA 2Z3YA 2QWWA 3M8FA 4U7DA 1K78B 1KQ0A 1IXCA 3NRVA 3HOSA 2OD5A 3NQOA 1I27A 3CUQA 4IRHA 3CUQB 4LLLA 2XAHA 1GHCA 3F8MA 3U2RA 1BI1A 1UFMA 4KIGA 4RGRA 1Z1DA 5BPIA 4U0YA 2DLLA 1SMYF 2G9WA 4PZJA 1KYZA 2VT3A 2P7CB 2XVCA 3F8FA 4EGYA 4HLYA 2E7XA 4EV0A 1J5YA 2FNPA 2ADUA 3WGHA 2E1NA 1E2XA 1SFXA 3MWMA 2L54A 3HRUA 4WX9A 5CLSA 3DPLC 4CZZA 4MEYF 2LF7A 1HKSA 1FWZA 4HA8A 1L3LA 5L3BA 2JPBA 2LDUA 2RN7A 5JFRA 3I58A 2MLKA 4A0XA 1DP7P 2ZXJA 3I71A 3TKYA 1BOAA 2P7VB 3RYPA 4CICA 3L09A 1OYWA 3BDDA 4OIOF 3K9TA 3I59B 2AXLA 1HBXG 4PDKA 2MBFA 2HDCA 3TO7A 3QU6A 3TQNA 4HDUA 3W6KB 4RGXA 2A3SA 5J6XA 4G8XA 4KT5C 4MNUA 1XSVA 4BHPA 2STWA 5HVQC 3QP5A 4L5JA 4IJAA 4ENMA 2R7DA 1ZRFA 1W5TA 4IPAA 2DK5A 5E20A 1TLHB 1QPMA 5BPDA 3Q5FA 5CVIA 2BEOA 2EFOA 2GIVA 4MEXF 2WV0A 4YFKF 2DW4A 3FZVA 4HAMA 4EJWA 2K7LA 3F72A 4GYGA 2CW0F 4CXFA 4M71A 2P5KA 2UXXA 3WE3A 2E1CA 4HF0A 3FHZA 3N4MA 4A5NA 3CTAA 2W84A 4N0BA 3BROA 3QAHA 4A5MA 1ODDA 1ZAOA 3RIRA 2QBYA 2IJLA 4Q48A 4B09A 1U2WA 4AIHA 4PCQA 2GXBA 1XCBA 5IT9K 1YYVA 3ZMZA 2F5CA 3HSEA 4EJUA 2FE3A 3COAC 1WKMA 3HRMA 2EV6A 5HDNA 1K79A 4I02A 3J80Z 1IAWA 2V79A 4Y13A 4ZZLA 1J59A 3MAJA 2HZTA 3JSPA 2GA1A 1U6GA 3DKWA 1LB2A 3IL2A 2RGVA 3GFJA 2F5EA 5DV5A 5D8LB 2HTJA 4IXAA 3C7JA 1U5TA 3WU1B 2XV4S 4P96A 2C6YA 1R22A 2P5LC 4OIPF 1ZGAA 1YIOA 5ERIA 1IN7A 1H9GA 2KKOA 4BQAA 3JSOA 5DCFA 3E97A 3GZ5A 2DQRA 5E8IA 4MHGA 2JTVA 3WODF 3Q9VA 1K6OA 4QLCU 4JK1X 1RI7A 1KQ8A 3KETA 3E6DA 2RNJA 2G7HA 3KE2A 3WTXC 4BXUA 2L3DA 3O2PE 3BJAA 3ECHA 3VOEA 3HRTA 1MJAA 3E6MA 1U3EM 1I1SA 4IHSA 6PAXA 3GW2A 1IN5A 1ULYA 3FMSA 5BMZA 4P55A 2DPUA 2ACJA 4RS8A 1TQMA 1H0MA 4HX7A 2L4AA 5JVTA 2IP2A 3VB2A 1Y0UA 3HSRA 3WU0A 2FEZA 1ZG1A 1REPC 2A07F 2FF4A 4RB0A 1D3YA 2QQAA 1R5GA 4G6QA 4OIRF 1Z05A 4WXDA 3PFIA 1C0WA 2L4MA 4K2EA 1OMIA 3IRRA 1B59A 2D45A 1ZG3A 3K69A 2FA5A 1R1VA 4LB5A 3S2WA 2CQKA 3E5UA 3TGNA 1DPRA 1B6AA 4A6DA 3ULQB 4HBLA 2O6GE 4DNCA 3ELKA 3LFKA 2FBKA 2G7UA 1YO5C 4P9UA 3F22A 3HSFA 1FY7A 1QZZA 5TRDA 2RQPA 2YX4A 4LG0A 3F23A 3GWZA 3DEUA 2H6BA 2XAJA 1YW9A 5CVJA 2Z33A 2R7FA 2YX7A 1QO0D 4HLXA 1XGSA 1ZH5A 2OA4A 4EMSA 1MDMB 3GZ6A 3WG9A 4G9YA 4BH9A 5FD5A 2FMYA 1RZ4A 1J75A 1GVJA 4ESFA 3DQVC 2QBYB 4KDPA 3C1DA 4R79A 3J81K 4ESBA 1FYKA 2QM3A 2CSOA 5DD8A 2Q0OA 4G7HF 3GX4X 4M9ZA 3KP6A 3KP3A 4XRFA 2XGXA 4ASNA 1ZREA 2OQGA 4ZH4F 4UVCA 4L18B 2P4WA 3ROUA 3I0TA 5JR3A 3QPHA 1ZRDA 3VFZA 1UHMA 3I53A 4LJZF 3BP8A 2ZNZA 2V1UA 2LF8A 4EJTA 1XMAA 5DCMA 2O3FA 4WWCA 4BNCA 3DP7A 5DDGA 3HIFA 1J2XA 3KFWX 1FX7A 5LEJA 1FBUA 4YG2F 1TQPA 4XLNF 3WTVC 1BBYA 3T8TA 4RGUA 4HV5A 1Z9CA 4M72A 2A5YB 4Y15A 4L9JA 3GFMA 3JAMZ 2NAZA 1TNTA 1R00A 2QLZA 2OQRA 2F2EA 3I4PA 1FNNA 5HOOA 1IW7F 1S8NA 4GO1A 2ISYA 1O3SA 4EM2A 4RB3C 4R1HA 1D8KA 1QBJA 2HGCA 1PP7U 4UVAA 3LAPA 4Q5SF 1F1ZA 4ON0A 1PUEE 3P7NA 4OINF 2UWMA 1QGPA 2QQBA 2HFHA 2Y0MA 2HR3A 5DUIA 2DPDA 2X0LA 4EM0B 3EQLF 3WTTC 5FLXK 4L5IA 3BOQA 3GEZA 4A2UA 3R4KA 3I54A 3WGGA 3V7CA 1FOKA 1SFUA 1I1GA 3DFGA 1ONVA 3R6SA 1OR7A 1XMKA 3BJOA 2XHKA 4KA4A 1XD7A 5BS6A 5FB2A 1L0OC 4A6EA 1HSJA 2ZNYA 3BPVA 4KMUX 4UV9A 3WTWC 2FNAA 2X4HA 3CO6C 5D5VB 4A12A 2K4JA 2F5FA 1J9IA 5EEHA 2EA4A 2KIUA 3C18A 2BGCA 3FM5A 2M1BA 2NS0A 2HKOA 3E6CC 2Y75A 2BYVE 2KJCA 3L00A 5K1YA 3SZTA 3IRQA 1W5SA 3SQNA 4ETSA 4L0ZB 3NEUA 1G4DA 2CGPA 4KMFA 3F8BA 4FX0A 3OOPA 1ON1A 3TOBA 4N9HA 3EETA 3JW4A 1WSUA 3KZYA 5ICCA 2IT0A 2BE5F 4KIBA 4ENKA 2XAQA 1IUYA 1VTNC 1KU2A 4AD9A 1IN6A 3KLNA 1GXPA 2FMLA 1DPUA 2VC1A 2IA1A 1BC8C 1D5VA 3H3UA 2QUFA 1P4XA 2RVCA 3KEQA 3SZPA 3ZQ7A 5D4SA 1O7LA 4MTDA 2Q2EA 4HZFA 3K0LA 1CF7B 3E6BA 3L9FA 3MFKA 3LQQA 5HS9A 2A6HF 4NQWA 4WXCA 5L3DA 1S7OA 3R61A 2XASA 3F6VA 5LLQA 3PQKA 2GZWA 3GO5A 3RI4A 2OU2A 4IF4A 1BN5A 4LGWA 3ISPA 1STZA 1UHWA 2EWNA 5HLHA 5H6RA 3RKWA 4EJVA 2IA2A 2IA0A 5FLXZ 4A0ZA 1SD4A 4FT8A 1IRGA 2VT2A 1IRFA 5ILSA 4QWQA 3MEXA 1R23A 2VBWA 1K7AA 3F8CA 1QQIA 1WRJA 2O61A 2HEOA 2MH2A 4O6JA 3FXQA 3ABUA 1MJBA 2XKPA 1J0RA 3ZN0A 2O0YA 1T98A 3TO6A 2WTEA 1FPQA 1WQ2A 4U0VA 4BHCA 3BJ6A 1FP2A 1T2KA 2LSOA 1R5HA 4HDVA 2GQQA 5DUKA 4GCVA 2XROA 4WK8F 4L9NA 5E17F 3T8RA 5ILVA 1XB4A 3AAFA 3GFIA 4S05A 2PN6A 1BIAA 1LEBA 3L2CA 1BI2A 5J8FA 3CDHA 3JTHA 3BY6A 4XLPF 4AVPA 2AS5F 1ZARA 3VEPA 3M1EA 4IVNA 3RKYA 4HF2A 1H9TA 3ZMTA 2HS5A 2P5VA 3N97A 4OOIA 1KU9A 5D8KB 2XAGA 5E1WA 5CJ9A 3KP2A 4LD5A 3I64A 1WI9A 4KYWA 1O3RA 5F64A 1W4MA 1TW3A 2CFXA 1YS7A 2XKOA 3REOA 1TBXA 2Z99A 4B8XA 2PI0A 5E1ZB 1ON2A 4M6XA 4KN4X 2VE9A 5AIPA 4BYYA 2W24A 2D1VA 3MZHA 2VBYA 2K86A 1I6XA 4RAZA 3O3KA 5L3EA 1BC7C 4I09A 5J8CA 1I5ZA 3ABTA 3OV8A 2J5PA 2LKPA 1DUXC 1GXQA 3RJPA 3BWGA 2CG4A 2HQRA 1B9NA 1USTA 1FYLA 3U9GA 1BM9A 5DCMB 1JHFA 1X3UA 1TQIA 1IXRC 3I5UA 4MTEA 3D0SA 1EH7A 2GWRA 2EB7A 1XN7A 1ZLJA 2UZKA 1KQ9A 4YIIA 1U8RA 1LNWA 2PEXA 1O3TA 2FSWA 3HTUA 3W6JB 1FSEA 3RDIA 2FRHA 1MJ9A 4EM1A 3KLOA 3P9IA 1LJ9A 1WWXA 2K27A 4Y17A 3T5XA 4RB2C 1U78A 4PGHA 1IF1A 3HRSA 1AWCA 4G7OF 4HQEA 3E3VA 4YFNF 3RKXA 2M5WA 3F3XA 3RYRA 1G3WA 3WTSC 2F5DA 4WF2A 5ILUA 4D0PA 2FQ3A 2QENA 2STTA 3GFLA 3CLOA 2FXAA 2QZ8A 2V1DA 2MC3A 4GYIA 4HOBA 2B0LA 2ZMEA 2HYGD 3H3ZA 3HYIA 2LNBA 4ZYHA 2ESNA 2EV0A 1FSHA 4G7ZF 2V6CA 2HQNA 1T0FA 4UHTA 3IKTA 4KIFA 1FBQA 3CUOA 4LMYA 1P6RA 5D6EA 2XRNA 4S04A 3FMQA 3LA2A 4UNOA 2DTRA 1BJAA 4AIJA 2PG4A 5FO5A 4M9SA 2RC4A 3QU3A 1SFEA 4AWXB 4JBAA 5DYMA 1PDNC 5L3GA 1YS6A 2YR2A 4M73A 2OZUA 1Z91A 1SD5A 3WTUC 1HW1A 1W7PD 2D1HA 3FXUA 4EJOA 1OPCA 3CJNA 3MQ0A 3R60A 2DQLA 2P6SA 3V8JA 3IC7A 3IHUA 5D4RA 3K1PA 4G6DA 1XSXA 2OZ6A 4UXNA 5HLIA 2ETHA 4HF1A 2VOOA 3ECOA 5H20A 2CO5A 3KP4A 1OYIA 1YQAA 4NB5A 1G3YA 2PBIA 1T38A 5FGMA 1JGSA 4Q47A 2JT1A 2YU3A 3R0JA 1YLFA 2PFBA 3GXOA 3IWZA 3LA7A 4CHUA 5IT3A 3EYYA 2A6EF 4R8HA 4U0WA 3E5XA 3ZPLA 3ZMUA 1XDUA 1TTYA 4H0EA 1ZGJA 1AOYA 1LQ1A 1YG2A 2PMUA 1R7JA 3WTYC 3GF2A 3P9CA 4UVBA 4Z2YA 3RTRA 5FFZA 2IRFG 3E5QA 2WWYA 2XAFA 3V7RA 2A68F 4XBFA 1LVAA 2Z9OA 4WCGA 3HUGA 1P4AA 4OMYA 2R3SA 4JQFA 2ZBKA 2HTSA 3JAMK 1JHHA 2DT5A 4I0AA 4HQMA 3QP6A 2JSCA 2MA3A 4ZYDA 1D8JA 2M45A 4DQ2A 1FP1D 3FF5A 4EGZA 2O8XA 2RDPA 2H27A 4BHBA 1HXDA 3HHHA 5LGNA 3J7AO 3ERED 2MD5A 2Y48A 4O3MA 1V3FA 2EJRA 1F4KA 5KK1A 4CYDA 2BV6A 2BBYA 3K2ZA 4WXHA 4L9VA 2VC0A 4RGSA 4XSZF 2ISZA 3IWFA 5LHGA 2E7WA 2L01A 3M8EA 2VBZA 2XUBA 3M7GA 5D6FA 2D2WA 3SXYA 4P9FA 4TV7A 5DEQA 1Z6TA 1HW2A 2Q8KA 1KGSA 1SD6A 1LDKB 2QYOA 3ML6A 1JXSA 4E70A 5ICEA 3QOPA 1MGTA 2DAOA 3ZP5A 1K78A 2ZKZA 3GLXA 4XSXF 4F7ZA 1G3SA 2A69F 3DF8A 4FX4A 2H6CA 1HKQA 1U5TC 3KP7A 4HX4A 4EVIA 2PQ8A 3RPQA 1OKRA 1ZLKA 4HW0A 1XGOA 1U5TB 2PMHA 5HLGA 2K4BA 1SD7A 2ZO4A 2HWVA 2ELHA 1PP8F 2XIGA 3DPTA 3BPXA 1DDNA 3I59A 2DBBA 3MCZA 4LLNA 2NNYA 3GYHX 2ZJ2A 1HSTA 1RIOH 5H6QA 1FYMA 5CVVA 4YFXF 1B4AA 3J80K 3JTGA 3L7WA 3KP5A 5BQTA 3CO7C 3K1MA 1KU3A 2L02A 4KFCA 4LG0B 1XCVA 1G6NA 3F21A 2IVMA 5AIQA 3B73A 2WC2A 4BAYA 4O5VA 4OU0A 3QRFF 2GAUA 4OIQF 1RUOA 4U88A 3T1BA 4NHJA 3V8KA 4KICA 5FD6A 1ZRCA 4IRGA 2JZYA 1S6LA 1KYWA 1XDSA 1W7PA 4LK1F 2DK8A 5A2QZ 3F8NA 3R0AA 1FT9A 3C3WA 4HV6A 4A0YA 4ZYGA 1KU7A 1YW7A 3WTZA 5D5XB 5LHHA 1T6SA 5ICFA 1NHAA 1V4RA 4CGZA 1YW8A 2DI3A 2EA2A 3RPUA 3U1DA 4ZZDA 2RV8A 5ED4A 5E18F 2EFNA 1A04A 1R58A 1HKTA 3KZZA 4MQ9F 2H09A 1YTYA 2OBPA 3VODA 4ENJA 1S29A 2TDXA 1XSDA 3DV8A 3V8LA 1ZYRF 1EH8A 3EUHA 2KJBA 3DXJF 4CDGA 2GA2A 5L3CA 4HYEA 2P8TA 2ZCWA 4N9IA 4ZYEA 3P9KA 3J81Z 1BIBA 4U7BA 4GXOA 1P92A 3KCCA 4LLGF 5CYVA 2COMA 4KNYA 4M74A 4I98B 2HYFA 4FHTA 1EH6A 4M6YA 3TDZC 3SFZA 2ZFWA 1FZPB 3LQRA 2JPCA 1UCRA 2EFWA 5E8GA 3GVAA 1F5TA 2OAZA 3TO9A 1IN4A 1TNSA 4MQVA 3EDPA 3LA3A 5LEKA 1O7FA 3WE2A 1MKMA 3FWEA 1O57A 2CWEA 1KA8A 1SMTA 4AIKA 1YFHA 1LEAA 4YIFA 1P2FA 5HS8A 3BZ6A 2VXZA 4I0BA 1J7KA 4Q4ZF 3FMRA 3HTSB 2QVOA 5HDKA 3SHFA 5E1XA 1UB9A 3MZYA 4GGGA 1R36A 4KUMA 2W57A 1BI3A 2CYYA 2KRFA 4MGRA 5A2QK 1IZ1A 4UV8A 2Z5UA 1FC3A 4M9XA 4IRIA 2NYXA 2A61A 3K1NA 2VN2A 4CO8A 1T39A 2M87A 2H94A 2EV5A 3M9AA 4ENNA 1P4WA 2P6TA 4EQQA 4P5OA 2YPRA 1RNLA 2W85A 1G3TA 4LK0F 2QQ9A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1E17 A;  2J5O A;  3B02 A;  2DO7 A;  1B9M A;  1S3J A;  1R1T A;  4L9T A;  4RB1 A;  3TOA A;  1XGN A;  3WGI A;  2JRT A;  1BI0 A;  1SAX A;  3ZMV A;  3D5L A;  3ZMD A;  3LWF A;  1FLI A;  2ZME B;  2PLY A;  4L0Y B;  1QZY A;  2ESH A;  2V1X A;  1LDJ A;  4KN7 X;  1S7A A;  4LB6 B;  1EV7 A;  3LST A;  5HS7 A;  5EEG A;  5LGU A;  5K5Q A;  2IPQ X;  2VE8 A;  5LRR A;  3ZMS A;  2NRA C;  2V9V A;  5LBQ A;  2RKH A;  3H92 A;  3GUD A;  5ICG A;  3TDU C;  1MD0 A;  3O6B B;  1TW2 A;  3PQJ A;  3FX3 A;  1QNT A;  2EK5 A;  1F9N A;  2M30 A;  3HHG A;  2FOK A;  1ZN2 A;  1IN8 A;  1R1U A;  2EFQ A;  4HX8 A;  2KIM A;  1MZB A;  4I01 A;  1HQC A;  5TJJ A;  5CVR A;  5LRS A;  1FBS A;  1OYY A;  1CGP A;  3F6O A;  3QPT A;  5LHI A;  3FM3 A;  1W7P B;  1O3Q A;  1Z7U A;  2DFI A;  5F1R A;  3HOT A;  5BOX A;  3V7S A;  5HDG A;  3T0Y A;  5JI6 A;  4IHT A;  3G73 A;  1LDD A;  3LAJ A;  2FU4 A;  2MLG A;  5FFX A;  1Q1H A;  5IT9 Z;  2VBX A;  1ZG5 A;  1ZHF A;  2NNN A;  2DU9 A;  5JHU A;  2MH9 A;  3KEO A;  1IXS B;  2VOD A;  2YSR A;  4UUV A;  3EYI A;  2M8E A;  2HKX A;  5K5O A;  5DD4 A;  4PGG A;  4RAY A;  1RUN A;  4G94 A;  5AON A;  2PJP A;  1CF7 A;  2HOE A;  5LGT A;  4ESJ A;  2FBI A;  2KIF A;  4I2O A;  1JE8 A;  5F6F A;  1B1B A;  2K02 A;  5CVU A;  4OMZ A;  1USS A;  3G3Z A;  5KVR A;  1Z6R A;  5K5R A;  2GXG A;  3IKV A;  3Q9S A;  2VON A;  2EFP A;  2UXN A;  2IW5 A;  2FBH A;  2W25 A;  5D5W B;  4I7H A;  5D5U B;  5L3F A;  1HW5 A;  2O03 A;  1XGM A;  2VOP A;  3FXR A;  1MDM A;  3CUQ C;  3V4G A;  3ZN1 A;  4LFU A;  2Z3Y A;  2QWW A;  3M8F A;  4U7D A;  1K78 B;  1KQ0 A;  1IXC A;  3NRV A;  3HOS A;  2OD5 A;  3NQO A;  1I27 A;  3CUQ A;  4IRH A;  3CUQ B;  4LLL A;  2XAH A;  1GHC A;  3F8M A;  3U2R A;  1BI1 A;  1UFM A;  4KIG A;  4RGR A;  1Z1D A;  5BPI A;  4U0Y A;  2DLL A;  1SMY F;  2G9W A;  4PZJ A;  1KYZ A;  2VT3 A;  2P7C B;  2XVC A;  3F8F A;  4EGY A;  4HLY A;  2E7X A;  4EV0 A;  1J5Y A;  2FNP A;  2ADU A;  3WGH A;  2E1N A;  1E2X A;  1SFX A;  3MWM A;  2L54 A;  3HRU A;  4WX9 A;  5CLS A;  3DPL C;  4CZZ A;  4MEY F;  2LF7 A;  1HKS A;  1FWZ A;  4HA8 A;  1L3L A;  5L3B A;  2JPB A;  2LDU A;  2RN7 A;  5JFR A;  3I58 A;  2MLK A;  4A0X A;  1DP7 P;  2ZXJ A;  3I71 A;  3TKY A;  1BOA A;  2P7V B;  3RYP A;  4CIC A;  3L09 A;  1OYW A;  3BDD A;  4OIO F;  3K9T A;  3I59 B;  2AXL A;  1HBX G;  4PDK A;  2MBF A;  2HDC A;  3TO7 A;  3QU6 A;  3TQN A;  4HDU A;  3W6K B;  4RGX A;  2A3S A;  5J6X A;  4G8X A;  4KT5 C;  4MNU A;  1XSV A;  4BHP A;  2STW A;  5HVQ C;  3QP5 A;  4L5J A;  4IJA A;  4ENM A;  2R7D A;  1ZRF A;  1W5T A;  4IPA A;  2DK5 A;  5E20 A;  1TLH B;  1QPM A;  5BPD A;  3Q5F A;  5CVI A;  2BEO A;  2EFO A;  2GIV A;  4MEX F;  2WV0 A;  4YFK F;  2DW4 A;  3FZV A;  4HAM A;  4EJW A;  2K7L A;  3F72 A;  4GYG A;  2CW0 F;  4CXF A;  4M71 A;  2P5K A;  2UXX A;  3WE3 A;  2E1C A;  4HF0 A;  3FHZ A;  3N4M A;  4A5N A;  3CTA A;  2W84 A;  4N0B A;  3BRO A;  3QAH A;  4A5M A;  1ODD A;  1ZAO A;  3RIR A;  2QBY A;  2IJL A;  4Q48 A;  4B09 A;  1U2W A;  4AIH A;  4PCQ A;  2GXB A;  1XCB A;  5IT9 K;  1YYV A;  3ZMZ A;  2F5C A;  3HSE A;  4EJU A;  2FE3 A;  3COA C;  1WKM A;  3HRM A;  2EV6 A;  5HDN A;  1K79 A;  4I02 A;  3J80 Z;  1IAW A;  2V79 A;  4Y13 A;  4ZZL A;  1J59 A;  3MAJ A;  2HZT A;  3JSP A;  2GA1 A;  1U6G A;  3DKW A;  1LB2 A;  3IL2 A;  2RGV A;  3GFJ A;  2F5E A;  5DV5 A;  5D8L B;  2HTJ A;  4IXA A;  3C7J A;  1U5T A;  3WU1 B;  2XV4 S;  4P96 A;  2C6Y A;  1R22 A;  2P5L C;  4OIP F;  1ZGA A;  1YIO A;  5ERI A;  1IN7 A;  1H9G A;  2KKO A;  4BQA A;  3JSO A;  5DCF A;  3E97 A;  3GZ5 A;  2DQR A;  5E8I A;  4MHG A;  2JTV A;  3WOD F;  3Q9V A;  1K6O A;  4QLC U;  4JK1 X;  1RI7 A;  1KQ8 A;  3KET A;  3E6D A;  2RNJ A;  2G7H A;  3KE2 A;  3WTX C;  4BXU A;  2L3D A;  3O2P E;  3BJA A;  3ECH A;  3VOE A;  3HRT A;  1MJA A;  3E6M A;  1U3E M;  1I1S A;  4IHS A;  6PAX A;  3GW2 A;  1IN5 A;  1ULY A;  3FMS A;  5BMZ A;  4P55 A;  2DPU A;  2ACJ A;  4RS8 A;  1TQM A;  1H0M A;  4HX7 A;  2L4A A;  5JVT A;  2IP2 A;  3VB2 A;  1Y0U A;  3HSR A;  3WU0 A;  2FEZ A;  1ZG1 A;  1REP C;  2A07 F;  2FF4 A;  4RB0 A;  1D3Y A;  2QQA A;  1R5G A;  4G6Q A;  4OIR F;  1Z05 A;  4WXD A;  3PFI A;  1C0W A;  2L4M A;  4K2E A;  1OMI A;  3IRR A;  1B59 A;  2D45 A;  1ZG3 A;  3K69 A;  2FA5 A;  1R1V A;  4LB5 A;  3S2W A;  2CQK A;  3E5U A;  3TGN A;  1DPR A;  1B6A A;  4A6D A;  3ULQ B;  4HBL A;  2O6G E;  4DNC A;  3ELK A;  3LFK A;  2FBK A;  2G7U A;  1YO5 C;  4P9U A;  3F22 A;  3HSF A;  1FY7 A;  1QZZ A;  5TRD A;  2RQP A;  2YX4 A;  4LG0 A;  3F23 A;  3GWZ A;  3DEU A;  2H6B A;  2XAJ A;  1YW9 A;  5CVJ A;  2Z33 A;  2R7F A;  2YX7 A;  1QO0 D;  4HLX A;  1XGS A;  1ZH5 A;  2OA4 A;  4EMS A;  1MDM B;  3GZ6 A;  3WG9 A;  4G9Y A;  4BH9 A;  5FD5 A;  2FMY A;  1RZ4 A;  1J75 A;  1GVJ A;  4ESF A;  3DQV C;  2QBY B;  4KDP A;  3C1D A;  4R79 A;  3J81 K;  4ESB A;  1FYK A;  2QM3 A;  2CSO A;  5DD8 A;  2Q0O A;  4G7H F;  3GX4 X;  4M9Z A;  3KP6 A;  3KP3 A;  4XRF A;  2XGX A;  4ASN A;  1ZRE A;  2OQG A;  4ZH4 F;  4UVC A;  4L18 B;  2P4W A;  3ROU A;  3I0T A;  5JR3 A;  3QPH A;  1ZRD A;  3VFZ A;  1UHM A;  3I53 A;  4LJZ F;  3BP8 A;  2ZNZ A;  2V1U A;  2LF8 A;  4EJT A;  1XMA A;  5DCM A;  2O3F A;  4WWC A;  4BNC A;  3DP7 A;  5DDG A;  3HIF A;  1J2X A;  3KFW X;  1FX7 A;  5LEJ A;  1FBU A;  4YG2 F;  1TQP A;  4XLN F;  3WTV C;  1BBY A;  3T8T A;  4RGU A;  4HV5 A;  1Z9C A;  4M72 A;  2A5Y B;  4Y15 A;  4L9J A;  3GFM A;  3JAM Z;  2NAZ A;  1TNT A;  1R00 A;  2QLZ A;  2OQR A;  2F2E A;  3I4P A;  1FNN A;  5HOO A;  1IW7 F;  1S8N A;  4GO1 A;  2ISY A;  1O3S A;  4EM2 A;  4RB3 C;  4R1H A;  1D8K A;  1QBJ A;  2HGC A;  1PP7 U;  4UVA A;  3LAP A;  4Q5S F;  1F1Z A;  4ON0 A;  1PUE E;  3P7N A;  4OIN F;  2UWM A;  1QGP A;  2QQB A;  2HFH A;  2Y0M A;  2HR3 A;  5DUI A;  2DPD A;  2X0L A;  4EM0 B;  3EQL F;  3WTT C;  5FLX K;  4L5I A;  3BOQ A;  3GEZ A;  4A2U A;  3R4K A;  3I54 A;  3WGG A;  3V7C A;  1FOK A;  1SFU A;  1I1G A;  3DFG A;  1ONV A;  3R6S A;  1OR7 A;  1XMK A;  3BJO A;  2XHK A;  4KA4 A;  1XD7 A;  5BS6 A;  5FB2 A;  1L0O C;  4A6E A;  1HSJ A;  2ZNY A;  3BPV A;  4KMU X;  4UV9 A;  3WTW C;  2FNA A;  2X4H A;  3CO6 C;  5D5V B;  4A12 A;  2K4J A;  2F5F A;  1J9I A;  5EEH A;  2EA4 A;  2KIU A;  3C18 A;  2BGC A;  3FM5 A;  2M1B A;  2NS0 A;  2HKO A;  3E6C C;  2Y75 A;  2BYV E;  2KJC A;  3L00 A;  5K1Y A;  3SZT A;  3IRQ A;  1W5S A;  3SQN A;  4ETS A;  4L0Z B;  3NEU A;  1G4D A;  2CGP A;  4KMF A;  3F8B A;  4FX0 A;  3OOP A;  1ON1 A;  3TOB A;  4N9H A;  3EET A;  3JW4 A;  1WSU A;  3KZY A;  5ICC A;  2IT0 A;  2BE5 F;  4KIB A;  4ENK A;  2XAQ A;  1IUY A;  1VTN C;  1KU2 A;  4AD9 A;  1IN6 A;  3KLN A;  1GXP A;  2FML A;  1DPU A;  2VC1 A;  2IA1 A;  1BC8 C;  1D5V A;  3H3U A;  2QUF A;  1P4X A;  2RVC A;  3KEQ A;  3SZP A;  3ZQ7 A;  5D4S A;  1O7L A;  4MTD A;  2Q2E A;  4HZF A;  3K0L A;  1CF7 B;  3E6B A;  3L9F A;  3MFK A;  3LQQ A;  5HS9 A;  2A6H F;  4NQW A;  4WXC A;  5L3D A;  1S7O A;  3R61 A;  2XAS A;  3F6V A;  5LLQ A;  3PQK A;  2GZW A;  3GO5 A;  3RI4 A;  2OU2 A;  4IF4 A;  1BN5 A;  4LGW A;  3ISP A;  1STZ A;  1UHW A;  2EWN A;  5HLH A;  5H6R A;  3RKW A;  4EJV A;  2IA2 A;  2IA0 A;  5FLX Z;  4A0Z A;  1SD4 A;  4FT8 A;  1IRG A;  2VT2 A;  1IRF A;  5ILS A;  4QWQ A;  3MEX A;  1R23 A;  2VBW A;  1K7A A;  3F8C A;  1QQI A;  1WRJ A;  2O61 A;  2HEO A;  2MH2 A;  4O6J A;  3FXQ A;  3ABU A;  1MJB A;  2XKP A;  1J0R A;  3ZN0 A;  2O0Y A;  1T98 A;  3TO6 A;  2WTE A;  1FPQ A;  1WQ2 A;  4U0V A;  4BHC A;  3BJ6 A;  1FP2 A;  1T2K A;  2LSO A;  1R5H A;  4HDV A;  2GQQ A;  5DUK A;  4GCV A;  2XRO A;  4WK8 F;  4L9N A;  5E17 F;  3T8R A;  5ILV A;  1XB4 A;  3AAF A;  3GFI A;  4S05 A;  2PN6 A;  1BIA A;  1LEB A;  3L2C A;  1BI2 A;  5J8F A;  3CDH A;  3JTH A;  3BY6 A;  4XLP F;  4AVP A;  2AS5 F;  1ZAR A;  3VEP A;  3M1E A;  4IVN A;  3RKY A;  4HF2 A;  1H9T A;  3ZMT A;  2HS5 A;  2P5V A;  3N97 A;  4OOI A;  1KU9 A;  5D8K B;  2XAG A;  5E1W A;  5CJ9 A;  3KP2 A;  4LD5 A;  3I64 A;  1WI9 A;  4KYW A;  1O3R A;  5F64 A;  1W4M A;  1TW3 A;  2CFX A;  1YS7 A;  2XKO A;  3REO A;  1TBX A;  2Z99 A;  4B8X A;  2PI0 A;  5E1Z B;  1ON2 A;  4M6X A;  4KN4 X;  2VE9 A;  5AIP A;  4BYY A;  2W24 A;  2D1V A;  3MZH A;  2VBY A;  2K86 A;  1I6X A;  4RAZ A;  3O3K A;  5L3E A;  1BC7 C;  4I09 A;  5J8C A;  1I5Z A;  3ABT A;  3OV8 A;  2J5P A;  2LKP A;  1DUX C;  1GXQ A;  3RJP A;  3BWG A;  2CG4 A;  2HQR A;  1B9N A;  1UST A;  1FYL A;  3U9G A;  1BM9 A;  5DCM B;  1JHF A;  1X3U A;  1TQI A;  1IXR C;  3I5U A;  4MTE A;  3D0S A;  1EH7 A;  2GWR A;  2EB7 A;  1XN7 A;  1ZLJ A;  2UZK A;  1KQ9 A;  4YII A;  1U8R A;  1LNW A;  2PEX A;  1O3T A;  2FSW A;  3HTU A;  3W6J B;  1FSE A;  3RDI A;  2FRH A;  1MJ9 A;  4EM1 A;  3KLO A;  3P9I A;  1LJ9 A;  1WWX A;  2K27 A;  4Y17 A;  3T5X A;  4RB2 C;  1U78 A;  4PGH A;  1IF1 A;  3HRS A;  1AWC A;  4G7O F;  4HQE A;  3E3V A;  4YFN F;  3RKX A;  2M5W A;  3F3X A;  3RYR A;  1G3W A;  3WTS C;  2F5D A;  4WF2 A;  5ILU A;  4D0P A;  2FQ3 A;  2QEN A;  2STT A;  3GFL A;  3CLO A;  2FXA A;  2QZ8 A;  2V1D A;  2MC3 A;  4GYI A;  4HOB A;  2B0L A;  2ZME A;  2HYG D;  3H3Z A;  3HYI A;  2LNB A;  4ZYH A;  2ESN A;  2EV0 A;  1FSH A;  4G7Z F;  2V6C A;  2HQN A;  1T0F A;  4UHT A;  3IKT A;  4KIF A;  1FBQ A;  3CUO A;  4LMY A;  1P6R A;  5D6E A;  2XRN A;  4S04 A;  3FMQ A;  3LA2 A;  4UNO A;  2DTR A;  1BJA A;  4AIJ A;  2PG4 A;  5FO5 A;  4M9S A;  2RC4 A;  3QU3 A;  1SFE A;  4AWX B;  4JBA A;  5DYM A;  1PDN C;  5L3G A;  1YS6 A;  2YR2 A;  4M73 A;  2OZU A;  1Z91 A;  1SD5 A;  3WTU C;  1HW1 A;  1W7P D;  2D1H A;  3FXU A;  4EJO A;  1OPC A;  3CJN A;  3MQ0 A;  3R60 A;  2DQL A;  2P6S A;  3V8J A;  3IC7 A;  3IHU A;  5D4R A;  3K1P A;  4G6D A;  1XSX A;  2OZ6 A;  4UXN A;  5HLI A;  2ETH A;  4HF1 A;  2VOO A;  3ECO A;  5H20 A;  2CO5 A;  3KP4 A;  1OYI A;  1YQA A;  4NB5 A;  1G3Y A;  2PBI A;  1T38 A;  5FGM A;  1JGS A;  4Q47 A;  2JT1 A;  2YU3 A;  3R0J A;  1YLF A;  2PFB A;  3GXO A;  3IWZ A;  3LA7 A;  4CHU A;  5IT3 A;  3EYY A;  2A6E F;  4R8H A;  4U0W A;  3E5X A;  3ZPL A;  3ZMU A;  1XDU A;  1TTY A;  4H0E A;  1ZGJ A;  1AOY A;  1LQ1 A;  1YG2 A;  2PMU A;  1R7J A;  3WTY C;  3GF2 A;  3P9C A;  4UVB A;  4Z2Y A;  3RTR A;  5FFZ A;  2IRF G;  3E5Q A;  2WWY A;  2XAF A;  3V7R A;  2A68 F;  4XBF A;  1LVA A;  2Z9O A;  4WCG A;  3HUG A;  1P4A A;  4OMY A;  2R3S A;  4JQF A;  2ZBK A;  2HTS A;  3JAM K;  1JHH A;  2DT5 A;  4I0A A;  4HQM A;  3QP6 A;  2JSC A;  2MA3 A;  4ZYD A;  1D8J A;  2M45 A;  4DQ2 A;  1FP1 D;  3FF5 A;  4EGZ A;  2O8X A;  2RDP A;  2H27 A;  4BHB A;  1HXD A;  3HHH A;  5LGN A;  3J7A O;  3ERE D;  2MD5 A;  2Y48 A;  4O3M A;  1V3F A;  2EJR A;  1F4K A;  5KK1 A;  4CYD A;  2BV6 A;  2BBY A;  3K2Z A;  4WXH A;  4L9V A;  2VC0 A;  4RGS A;  4XSZ F;  2ISZ A;  3IWF A;  5LHG A;  2E7W A;  2L01 A;  3M8E A;  2VBZ A;  2XUB A;  3M7G A;  5D6F A;  2D2W A;  3SXY A;  4P9F A;  4TV7 A;  5DEQ A;  1Z6T A;  1HW2 A;  2Q8K A;  1KGS A;  1SD6 A;  1LDK B;  2QYO A;  3ML6 A;  1JXS A;  4E70 A;  5ICE A;  3QOP A;  1MGT A;  2DAO A;  3ZP5 A;  1K78 A;  2ZKZ A;  3GLX A;  4XSX F;  4F7Z A;  1G3S A;  2A69 F;  3DF8 A;  4FX4 A;  2H6C A;  1HKQ A;  1U5T C;  3KP7 A;  4HX4 A;  4EVI A;  2PQ8 A;  3RPQ A;  1OKR A;  1ZLK A;  4HW0 A;  1XGO A;  1U5T B;  2PMH A;  5HLG A;  2K4B A;  1SD7 A;  2ZO4 A;  2HWV A;  2ELH A;  1PP8 F;  2XIG A;  3DPT A;  3BPX A;  1DDN A;  3I59 A;  2DBB A;  3MCZ A;  4LLN A;  2NNY A;  3GYH X;  2ZJ2 A;  1HST A;  1RIO H;  5H6Q A;  1FYM A;  5CVV A;  4YFX F;  1B4A A;  3J80 K;  3JTG A;  3L7W A;  3KP5 A;  5BQT A;  3CO7 C;  3K1M A;  1KU3 A;  2L02 A;  4KFC A;  4LG0 B;  1XCV A;  1G6N A;  3F21 A;  2IVM A;  5AIQ A;  3B73 A;  2WC2 A;  4BAY A;  4O5V A;  4OU0 A;  3QRF F;  2GAU A;  4OIQ F;  1RUO A;  4U88 A;  3T1B A;  4NHJ A;  3V8K A;  4KIC A;  5FD6 A;  1ZRC A;  4IRG A;  2JZY A;  1S6L A;  1KYW A;  1XDS A;  1W7P A;  4LK1 F;  2DK8 A;  5A2Q Z;  3F8N A;  3R0A A;  1FT9 A;  3C3W A;  4HV6 A;  4A0Y A;  4ZYG A;  1KU7 A;  1YW7 A;  3WTZ A;  5D5X B;  5LHH A;  1T6S A;  5ICF A;  1NHA A;  1V4R A;  4CGZ A;  1YW8 A;  2DI3 A;  2EA2 A;  3RPU A;  3U1D A;  4ZZD A;  2RV8 A;  5ED4 A;  5E18 F;  2EFN A;  1A04 A;  1R58 A;  1HKT A;  3KZZ A;  4MQ9 F;  2H09 A;  1YTY A;  2OBP A;  3VOD A;  4ENJ A;  1S29 A;  2TDX A;  1XSD A;  3DV8 A;  3V8L A;  1ZYR F;  1EH8 A;  3EUH A;  2KJB A;  3DXJ F;  4CDG A;  2GA2 A;  5L3C A;  4HYE A;  2P8T A;  2ZCW A;  4N9I A;  4ZYE A;  3P9K A;  3J81 Z;  1BIB A;  4U7B A;  4GXO A;  1P92 A;  3KCC A;  4LLG F;  5CYV A;  2COM A;  4KNY A;  4M74 A;  4I98 B;  2HYF A;  4FHT A;  1EH6 A;  4M6Y A;  3TDZ C;  3SFZ A;  2ZFW A;  1FZP B;  3LQR A;  2JPC A;  1UCR A;  2EFW A;  5E8G A;  3GVA A;  1F5T A;  2OAZ A;  3TO9 A;  1IN4 A;  1TNS A;  4MQV A;  3EDP A;  3LA3 A;  5LEK A;  1O7F A;  3WE2 A;  1MKM A;  3FWE A;  1O57 A;  2CWE A;  1KA8 A;  1SMT A;  4AIK A;  1YFH A;  1LEA A;  4YIF A;  1P2F A;  5HS8 A;  3BZ6 A;  2VXZ A;  4I0B A;  1J7K A;  4Q4Z F;  3FMR A;  3HTS B;  2QVO A;  5HDK A;  3SHF A;  5E1X A;  1UB9 A;  3MZY A;  4GGG A;  1R36 A;  4KUM A;  2W57 A;  1BI3 A;  2CYY A;  2KRF A;  4MGR A;  5A2Q K;  1IZ1 A;  4UV8 A;  2Z5U A;  1FC3 A;  4M9X A;  4IRI A;  2NYX A;  2A61 A;  3K1N A;  2VN2 A;  4CO8 A;  1T39 A;  2M87 A;  2H94 A;  2EV5 A;  3M9A A;  4ENN A;  1P4W A;  2P6T A;  4EQQ A;  4P5O A;  2YPR A;  1RNL A;  2W85 A;  1G3T A;  4LK0 F;  2QQ9 A; 
#chains in the Genus database with same CATH topology
 4NC8 A;  3I55 I;  1E17 A;  2XSD C;  2VQL A;  4UUT A;  4GFB A;  2J5O A;  3B02 A;  2DO7 A;  1B9M A;  1S3J A;  4CA0 A;  1R1T A;  4L9T A;  1QHH D;  2XGD A;  2V26 A;  1XMX A;  3HPG A;  5KHD A;  3K70 D;  1O4X A;  4RB1 A;  4XKB A;  3EUH C;  2LLK A;  3TOA A;  4NNJ A;  4BBS J;  1XGN A;  4CCN A;  4HPQ A;  3WGI A;  1JT0 A;  4AM3 A;  3G2B A;  2JRT A;  4RBO A;  3S93 A;  1IJW C;  4ZDO A;  1BI0 A;  1SAX A;  2R4G A;  3ZMV A;  3D5L A;  2DA7 A;  3ZMD A;  3LWF A;  4M3G A;  2QGU A;  4JX5 A;  2YUS A;  4P1W A;  1FLI A;  1ETX A;  2ZME B;  2PLY A;  1RKW A;  4L0Y B;  4IX7 A;  4N4O B;  4W97 A;  1QZY A;  4FET A;  2JUG A;  1X1A A;  2HNH A;  2ESH A;  2V1X A;  1LDJ A;  4KN7 X;  4D7M A;  1S7A A;  4LIU A;  4LB6 B;  1EV7 A;  2QSH X;  3BCA A;  3LST A;  5HS7 A;  5EEG A;  4FAS D;  5LGU A;  5K5Q A;  1VQ6 I;  2E2H J;  4IOC F;  2XB5 A;  1WPK A;  2IPQ X;  2VE8 A;  5LRR A;  3ZMS A;  4G12 A;  2V9V A;  1OCZ H;  4XL9 A;  5LBQ A;  2NRA C;  2RKH A;  2ELK A;  3H92 A;  3GUD A;  5ICG A;  3TDU C;  2KZV A;  1XPX A;  3GTL J;  1MD0 A;  2VKD A;  3O6B B;  3LSG A;  2DN0 A;  3OYN A;  2PJR A;  2JA8 J;  3GTJ J;  1W0U A;  1TW2 A;  3PQJ A;  2ZJP F;  3FX3 A;  3IUO A;  1QNT A;  2EK5 A;  1Y56 A;  4HNT A;  2XC7 A;  2EPF A;  1F9N A;  2M30 A;  3HHG A;  3K70 C;  3P5J A;  1MBK A;  4A3I J;  2FOK A;  1ZN2 A;  1IN8 A;  2O9L A;  1R1U A;  1MND A;  2L7F P;  3G4S I;  3KYC B;  2WB1 A;  1WH7 A;  2EFQ A;  1A6I A;  4F92 B;  4HX8 A;  2CUE A;  2KIM A;  3HG9 A;  4Y3O A;  1MZB A;  2DYR H;  4I01 A;  2KP6 A;  1HQC A;  5TJJ A;  5CVR A;  3G1O A;  5LRS A;  2B9S A;  1FBS A;  1OYY A;  1NK2 P;  1CGP A;  3F6O A;  3QPT A;  5LHI A;  3FM3 A;  1W7P B;  2L7Z A;  3KIO A;  2HVS A;  1O3Q A;  1Z7U A;  3WG7 H;  2DFI A;  5F1R A;  3HOT A;  5BOX A;  4A3D J;  3V7S A;  3CCY A;  5HDG A;  3T0Y A;  5JI6 A;  4IHT A;  1LFP A;  3G73 A;  4X1E A;  4XLC A;  1LDD A;  3LAJ A;  2FU4 A;  2MLG A;  5FFX A;  1Q1H A;  5IT9 Z;  2VBX A;  1ZG5 A;  2WAQ N;  2L0K A;  1ZHF A;  2NNN A;  2X51 A;  2DU9 A;  3O8G A;  5JHU A;  2MH9 A;  3KEO A;  1IXS B;  2HPM A;  3PSF A;  2VOD A;  2YSR A;  4UUV A;  3LSM A;  2R7Q A;  1R5I D;  4BJT A;  3EYI A;  2M8E A;  4E7K A;  2HKX A;  5K5O A;  5DD4 A;  4PGG A;  3I3L A;  4RAY A;  1ETW A;  3BG7 A;  1RUN A;  1A36 A;  4G94 A;  5AON A;  2PJP A;  1CF7 A;  2M4G A;  3H9Q A;  2HOE A;  2X1D A;  4XLH A;  5EF6 A;  5LGT A;  4CCJ A;  2LRE A;  4ESJ A;  3K4L A;  2FBI A;  2KIF A;  2IEK A;  1YJW I;  4I2O A;  3K2A A;  1JE8 A;  5F6F A;  2DDA A;  2HXI A;  1B1B A;  2K02 A;  5CVU A;  2HVR A;  4OMZ A;  2IGO A;  4GRI A;  1USS A;  3OIO A;  1YI2 I;  3G3Z A;  5KVR A;  5M5W J;  4DZP A;  1Z6R A;  2R7S A;  5K5R A;  2GXG A;  4X0G A;  1LE8 A;  1GVD A;  3IKV A;  3Q9S A;  4FIS A;  2HOA A;  2EFP A;  2VL8 A;  2UXN A;  5HNH A;  2VON A;  2EZK A;  4XRS A;  2R7R A;  2H1L A;  2HU9 A;  1VI0 A;  2IW5 A;  2A5W A;  3IP4 B;  2FBH A;  2W25 A;  1WH5 A;  3JRI A;  2DT7 B;  5D5W B;  3H0G J;  4I7H A;  5D5U B;  5L3F A;  1DGR M;  1UHS A;  4H4K C;  1HW5 A;  2O03 A;  1XGM A;  2ZXW H;  2VOP A;  3FXR A;  4YRV A;  1MDM A;  3CUQ C;  3V4G A;  3VWB A;  3ZN1 A;  4LFU A;  3H5R A;  2Z3Y A;  4A93 J;  2QWW A;  3OYA A;  2JWT A;  2PMZ A;  1EA3 A;  3M8F A;  4U7D A;  1WJE A;  3DTE A;  1LFB A;  1K78 B;  1KQ0 A;  1IXC A;  3NRV A;  4J19 A;  4E7J A;  3OYI A;  3HOS A;  2OD5 A;  3NQO A;  3TP3 A;  4DBR A;  4XMY A;  4CYC B;  4HNU A;  1I27 A;  5GTI C;  2MG4 A;  3CUQ A;  4IRH A;  2QF7 A;  4OWR B;  4BXX J;  4F93 B;  2KIQ A;  3S2H J;  3CUQ B;  4LLL A;  2XAH A;  3UR3 C;  1YIT I;  3WHC A;  5EJC A;  3K4B A;  2DFH A;  1OCP A;  1GHC A;  3F8M A;  3IAM 2;  3U2R A;  4IHY A;  1BI1 A;  5IYB J;  2K3P A;  1UFM A;  2DJN A;  4KIG A;  3CCE I;  4BY1 J;  4ZDP A;  4RGR A;  4ZTJ A;  3RQ4 A;  2Y69 H;  2BHY A;  1Z1D A;  5FKL A;  5BPI A;  3J7Z I;  2LY9 A;  1SEU A;  1HC8 A;  5IP6 A;  2HVQ A;  4U0Y A;  2XGE A;  1S5L C;  4DGW B;  2DLL A;  1SMY F;  2G9W A;  4PZJ A;  1KYZ A;  3H3V K;  3I4N J;  2VT3 A;  2X6O A;  1MMS A;  2P7C B;  2I8D A;  2PJR B;  2XVC A;  1MSF C;  3F8F A;  3BZK A;  2DA6 A;  4ABZ A;  1YRN B;  4AC0 A;  2BVM A;  5HNF A;  1OCO H;  4EGY A;  4HLY A;  2E7X A;  4EV0 A;  1J5Y A;  3UNG C;  3OYD A;  3FXJ A;  3CCL I;  3D5R C;  2FNP A;  2ADU A;  2Q1Z B;  4B47 A;  4BUP A;  5F0F A;  3WGH A;  2E1N A;  1E2X A;  1SFX A;  3MWM A;  2L54 A;  3QYE A;  3HRU A;  4WX9 A;  1TWF J;  1VQO I;  1RR8 C;  1VQK I;  5IOZ A;  2DXI A;  5CLS A;  3DPL C;  1ETO A;  4CZZ A;  3ABM H;  4MEY F;  2LF7 A;  1HKS A;  3DTK A;  1FWZ A;  4HA8 A;  1L3L A;  5L3B A;  2IS1 A;  2JPB A;  2LDU A;  2ZJQ F;  3K7A J;  2IGM A;  1WJB A;  1BR1 A;  2RN7 A;  5JFR A;  3W2W A;  3I58 A;  1YHQ I;  2MLK A;  4A0X A;  5EG0 A;  3DU5 A;  1WI3 A;  2DMN A;  4PFP A;  1DP7 P;  2M0C A;  3MKY B;  4BS9 A;  1ENH A;  2ZXJ A;  2HQ5 A;  3I71 A;  2XPV A;  2AHQ A;  2R92 J;  3X2Q H;  3TKY A;  1BOA A;  2P7V B;  3RYP A;  4CIC A;  3L09 A;  1OYW A;  3BDD A;  3FK6 A;  3ONQ A;  3K9T A;  5TGT A;  4OIO F;  3I59 B;  2AXL A;  1HBX G;  4PDK A;  3OL4 A;  2MBF A;  3SYT A;  3LSI A;  2L9V A;  2VB6 A;  2HDC A;  4C2M J;  1JI8 A;  5FKK A;  5K7F A;  3TO7 A;  3QU6 A;  4DYR A;  5IYC J;  4CYC A;  3TQN A;  3A01 A;  4Y52 J;  4HDU A;  1JGG A;  5FKN A;  3W6K B;  5JHF A;  4RGX A;  2A3S A;  2R0Q C;  1OIS A;  4IZZ A;  1R6R A;  5J6X A;  3A01 B;  4Z6Y A;  4G8X A;  4KT5 C;  4MNU A;  4NC6 A;  1ZR2 A;  1XSV A;  4BHP A;  2STW A;  1JTY A;  3CMM A;  3CJQ B;  5HVQ C;  2LFB A;  3QP5 A;  1UMQ A;  4L5J A;  4IJA A;  2DT6 A;  4ENM A;  2R7D A;  4ITV A;  1ZRF A;  5EEA A;  2K85 A;  3OYB A;  1W5T A;  4XRM A;  2ZC2 A;  3CJR B;  3A03 A;  3HXL A;  4C9Y A;  4IPA A;  4C30 A;  2DK5 A;  3CF5 F;  1JUM A;  5E20 A;  2K9Q A;  1IRZ A;  3HKZ A;  1TC3 C;  3VDX A;  1RES A;  1TLH B;  1QPM A;  1ZEL A;  2OPT A;  1LKX A;  1FJL A;  5BPD A;  3W2A A;  1GT0 C;  3W2V A;  3FXL A;  3A2K A;  2V4J C;  3OOU A;  3Q5F A;  5CVI A;  3G6E I;  2BEO A;  2EFO A;  2GIV A;  4MEX F;  2X1C A;  4IOA F;  4BKX A;  4PJJ A;  2WV0 A;  4YFK F;  2DW4 A;  3FZV A;  3IH3 A;  4HAM A;  4RAF A;  4EJW A;  4QPQ A;  2K7L A;  2M4K A;  3F72 A;  4YIR X;  4GYG A;  2CW0 F;  1VQ7 I;  2WBM A;  1MBG A;  3FBN B;  1E0E A;  1TWC J;  4CXF A;  4M71 A;  3CP8 A;  4MFD A;  1U9N A;  3OR2 C;  2E36 A;  2P5K A;  2LY2 A;  2UXX A;  5F0H A;  3WE3 A;  2E1C A;  2A6T A;  4HF0 A;  5M3M J;  2F4O B;  3FHZ A;  5E3M A;  2CV2 A;  3N4M A;  4A5N A;  3CTA A;  2W84 A;  1M1E B;  2NVU B;  4N0B A;  2LC2 A;  2DFE A;  3CC2 I;  4LIT A;  3ABL H;  3BRO A;  2CV0 A;  3QAH A;  2KFD A;  2QKM B;  4A5M A;  1ODD A;  3GLL A;  5CQG A;  1ZAO A;  3E0J B;  3RIR A;  2QBY A;  2IJL A;  4Q48 A;  2JMW A;  4B09 A;  1U2W A;  1R4M B;  2JJ7 A;  3OYE A;  4AIH A;  4PCQ A;  2GXB A;  1XCB A;  5IT9 K;  1YYV A;  3TL4 X;  3HUG B;  3ZMZ A;  3S32 A;  2E34 A;  2F5C A;  1UEL B;  2DJI A;  3HSE A;  1MNE A;  5J40 A;  2LH9 A;  4EAT A;  3SJM A;  1ZQ3 P;  3QWL A;  4EJU A;  1NTC A;  1TWA J;  2FE3 A;  2VQC A;  5EZG A;  3COA C;  2MC4 A;  4FE7 A;  4A3K J;  4IKF A;  1WKM A;  4A3C J;  3HRM A;  2EV6 A;  5HDN A;  3CP2 A;  1K79 A;  4I02 A;  3J80 Z;  1IAW A;  2V79 A;  3IH2 A;  2M7A A;  4XLA A;  4QIW N;  4Y13 A;  1SVM A;  4ZZL A;  2OTL I;  1J59 A;  1W1W E;  2HZT A;  3MAJ A;  3JSP A;  3F9K A;  2CQQ A;  3L2V A;  2XPW A;  5B1A H;  5DTD A;  5GAD J;  2GA1 A;  1U6G A;  4XOP A;  4AUX A;  2DCE A;  3DKW A;  4PJN A;  2PMZ N;  3B6A A;  4JP0 A;  1LB2 A;  4L5E A;  1MIJ A;  2RGV A;  3GFJ A;  3IL2 A;  2F5E A;  1X19 A;  2LRD A;  2A05 A;  2E5Z A;  5DV5 A;  4XM3 A;  5D8L B;  2HTJ A;  5DM6 F;  4V19 K;  3HOU J;  4IXA A;  1ACI A;  3C7J A;  1U5T A;  4G6T B;  3WU1 B;  1EJ9 A;  3CC7 I;  2DMU A;  2XV4 S;  2BY2 A;  2OUM A;  4P96 A;  2C6Y A;  1R22 A;  2P5L C;  4OIP F;  5GPA A;  1YIO A;  1ZGA A;  5ERI A;  4BQQ A;  1IN7 A;  1H9G A;  2KKO A;  3JSO A;  4BQA A;  3GTM J;  5DCF A;  3DBH B;  3S1R J;  3E97 A;  3GZ5 A;  3L1P A;  2O8K A;  3S1N J;  1E3H A;  2DQR A;  5E8I A;  4MHG A;  1EF4 A;  1LUJ B;  2JTV A;  2K9S A;  2ZME C;  1Q1V A;  3Q9V A;  3WOD F;  1K6O A;  1GDT A;  4ZDL A;  2GLO A;  4QLC U;  4JK1 X;  1RI7 A;  1KQ8 A;  3KET A;  1GLN A;  5IP9 J;  3E6D A;  1ZR4 A;  2RNJ A;  2G7H A;  3BR0 A;  3KE2 A;  3PNT A;  2AQF A;  4YEJ A;  4II2 A;  3WTX C;  5TIS C;  2VJ4 A;  4BXU A;  2L3D A;  1SFO J;  2R7V A;  3O2P E;  3BJA A;  2IXS A;  3ECH A;  2HXO A;  3EPZ A;  2NOJ B;  5EZH A;  1VFC A;  4AYB A;  3MD2 A;  1YX3 A;  3VOE A;  3JCU C;  4C2T A;  2IS2 A;  4PJ0 C;  3HRT A;  1MJA A;  5HLT A;  2MD0 A;  1JUS A;  1TWH J;  3E6M A;  4QSH A;  1U3E M;  2W1O A;  2ZXI A;  5B3S H;  1I1S A;  4IHS A;  6PAX A;  3GW2 A;  1IN5 A;  1ULY A;  3DU6 A;  4BBR J;  3FMS A;  4C3H J;  4C2U A;  5BMZ A;  4P55 A;  2DPU A;  2ACJ A;  4XKV A;  5E79 C;  1E3P A;  4RS8 A;  1TQM A;  1H0M A;  4HX7 A;  1I50 J;  1Z67 A;  3SDB A;  2L4A A;  5JVT A;  4D5F A;  2IP2 A;  3VB2 A;  3E1S A;  1Y0U A;  3HSR A;  3WU0 A;  1RRJ A;  4A69 C;  3C2H A;  1V5G A;  2FEZ A;  1SAU A;  2PX9 A;  1SC7 A;  1ZG1 A;  2H8R A;  1REP C;  1S7E A;  2WAQ A;  2A07 F;  2OTJ I;  2FF4 A;  4RB0 A;  1D3Y A;  3H0D A;  1NG6 A;  2QQA A;  3OIQ A;  4E7H A;  2B63 J;  1R5G A;  4G6Q A;  4OIR F;  1QVU A;  1A35 A;  1FOY A;  1X3Z B;  4UB6 C;  1Z05 A;  3LL7 A;  4WXD A;  1X1P A;  3PFI A;  1RKT A;  1Y8Q B;  1C0W A;  2L4M A;  4MFE A;  5K7Z A;  4K2E A;  1OMI A;  3IRR A;  2X85 A;  3FXO A;  1B59 A;  3LFU A;  2MGQ A;  2D45 A;  1ZG3 A;  3K4K A;  1KON A;  4Y4R A;  4MO7 A;  4CCK A;  3K69 A;  2FA5 A;  1R1V A;  4LB5 A;  2OC6 A;  3S2W A;  2CQK A;  4IEJ A;  3E5U A;  3TGN A;  3ZQL A;  1DPR A;  1OR7 C;  3GTP J;  3ZR8 X;  2WY7 Q;  3HOX J;  1B6A A;  2KT0 A;  2NOG A;  3BQZ A;  4A6D A;  3ULQ B;  4HBL A;  3TP0 A;  2O6G E;  3CF2 A;  2I5U A;  4A3G J;  4DNC A;  3WHB A;  3ELK A;  3LFK A;  2QEX I;  1FMV A;  2LKS A;  4A3J J;  2FBK A;  1WJD A;  4B1R A;  1NH3 A;  2G7U A;  1YO5 C;  2FX0 A;  4P9U A;  3DKY A;  3F22 A;  2DMP A;  3HGY A;  3HSF A;  1FY7 A;  1QZZ A;  5TRD A;  2RQP A;  2YX4 A;  3OY9 A;  3M4O J;  2L7K A;  3W3C A;  4LG0 A;  3F23 A;  2Y2Z A;  3GWZ A;  1MBF A;  3DEU A;  2H6B A;  2XAJ A;  1YW9 A;  5CVJ A;  4CUG A;  3CMY A;  4BJ6 C;  2Z33 A;  4PSX A;  2LK2 A;  2R7F A;  3AG1 H;  1MSE C;  4M3B A;  2YX7 A;  1QO0 D;  5J3L A;  2R5Y A;  4HLX A;  2IAI A;  1XGS A;  2JK3 A;  3OS0 A;  1ZH5 A;  2JSP A;  5B1B H;  2OA4 A;  4EMS A;  4N4N B;  3GZ6 A;  2Y0S N;  1MDM B;  4AVZ A;  3WG9 A;  2WA0 A;  2AO9 A;  4G9Y A;  3ABK H;  4BH9 A;  2VKH A;  1ZTR A;  5F0C A;  4ZYA A;  2K3F A;  1IRX A;  5FD5 A;  4Y33 A;  2FMY A;  1RZ4 A;  1OQY A;  1J75 A;  1GVJ A;  2V6E A;  1G2H A;  1GUU A;  4ESF A;  2W4S A;  1BOB A;  2QKL B;  3DQV C;  2QBY B;  4LIV A;  3VPR A;  4KDP A;  3C1D A;  4R79 A;  2LP0 A;  3J81 K;  1TZL A;  3KYD B;  2P81 A;  3LSR A;  2L9N A;  4ESB A;  1FYK A;  2E2I J;  1MBJ A;  3HC7 A;  3HOV J;  2QM3 A;  1OFC X;  2ELJ A;  3CLQ A;  2CSO A;  2W82 A;  2O7O A;  3FHN A;  2R7U A;  3BG9 A;  2E60 A;  3MKL A;  5DD8 A;  2Q0O A;  4G7H F;  1ZKG A;  2JA5 J;  3GX4 X;  4M9Z A;  3KP6 A;  3KP3 A;  2GM4 A;  4XRF A;  2XGX A;  4MIM A;  4RM2 A;  4ASN A;  1ZRE A;  1HDP A;  2CUF A;  5F27 A;  1FEX A;  2BOL A;  2WAD A;  4KIS A;  2OQG A;  3PNV A;  4UVC A;  4ZH4 F;  2M9H A;  2MW8 A;  2NXN B;  5DS9 A;  4L18 B;  3M07 A;  2P4W A;  2ZB9 A;  5M3F J;  2KQR A;  3ROU A;  3GZN B;  3TED A;  1D0Y A;  3RCO A;  3I0T A;  2K9L A;  5JR3 A;  3QPH A;  1D0X A;  3HKZ N;  5J4Y A;  1ZRD A;  2Y9Z A;  2CQN A;  3VFZ A;  1UG2 A;  1D1C A;  3ZQQ A;  1Y1W J;  1UHM A;  3U1K A;  2WAF A;  3I53 A;  4LJZ F;  3BP8 A;  2Q2E B;  1QVT A;  2ZNZ A;  2VPL A;  2V1U A;  1RET A;  2LF8 A;  3JR9 A;  4EJT A;  2M2E A;  1XMA A;  5DCM A;  2O3F A;  4WWC A;  4BNC A;  3DP7 A;  5DDG A;  3S16 J;  3HIF A;  3KX2 A;  2FUG 2;  1J2X A;  2L5Q A;  3KFW X;  5GPC A;  1IDZ A;  1FX7 A;  3M8J A;  5LEJ A;  2DOE A;  1D0Z A;  1FBU A;  4YG2 F;  2QCO A;  1TQP A;  1YOV B;  4XLN F;  2BVL A;  3WTV C;  3S3M A;  2E1O A;  1BBY A;  4CCL A;  3T8T A;  4W1U A;  4RGU A;  4HV5 A;  1Z9C A;  1WCM J;  2CQ7 A;  4M72 A;  1WGX A;  3N05 A;  2A5Y B;  5CKT A;  4IL6 C;  4Y15 A;  2HI3 A;  3SFI A;  4L9J A;  2QQ8 A;  3GFM A;  3JAM Z;  5IYD J;  4MLO A;  2NAZ A;  4ZC3 A;  1TNT A;  1R00 A;  1W0T A;  2QLZ A;  3CC4 I;  2OQR A;  2F2E A;  2DA2 A;  1UG0 A;  3BTL A;  3I4P A;  1FNN A;  1X4P A;  5HOO A;  1IW7 F;  1S8N A;  4GO1 A;  2ISY A;  3DPU A;  1O3S A;  2EIJ H;  1HA8 A;  2EIL H;  4EM2 A;  4RB3 C;  4R1H A;  2KDO A;  4E7Z A;  1D8K A;  1QBJ A;  5C4X J;  2HGC A;  4EEF G;  1PP7 U;  3CES A;  3JRE A;  1K83 J;  4UVA A;  5GP9 A;  3LAP A;  4Q5S F;  1F1Z A;  3A0H C;  4XLF A;  4ON0 A;  1VQ4 I;  1JKO C;  2I10 A;  2MFZ A;  1PUE E;  3P7N A;  2F4I A;  1EKE A;  1RC9 A;  4OIN F;  3L2U A;  2LY1 A;  2UWM A;  3BCB A;  1QGP A;  1XG1 A;  2QQB A;  3PFY A;  2HFH A;  3ZXS A;  2Y0M A;  3PO2 J;  2FD5 A;  3U21 A;  3D5S C;  3DEE A;  5J47 A;  5FRO A;  4BE2 A;  2V1N A;  2HR3 A;  4XK4 A;  4XLE A;  2EIK H;  5DUI A;  2DPD A;  2F6C A;  2X0L A;  4EM0 B;  3PNY A;  1IDY A;  1P7I A;  3WU2 C;  1R4N B;  1YIJ I;  1R9T J;  1ITY A;  2QA4 I;  3Q3S A;  4JX4 A;  3H5N A;  1VQL I;  2XF5 A;  3EQL F;  2X1E A;  4E7I A;  3WTT C;  1DU0 A;  2CUZ A;  5FLX K;  4L5I A;  2EBI A;  3A1Y A;  3BOQ A;  3CCM I;  3GEZ A;  4A2U A;  3R4K A;  3I54 A;  4F91 B;  3JRG A;  3KEY A;  3WGG A;  3AG4 H;  3ZCO A;  3V7C A;  2B7E A;  3A02 A;  3AG3 H;  3AKZ A;  1FOK A;  1J09 A;  3PO3 J;  2HQA A;  3GTK J;  1SFU A;  2Y30 A;  1Z21 A;  1VQ9 I;  1I1G A;  3DFG A;  1HDD C;  1ONV A;  1R71 A;  1P9Q C;  3R6S A;  4I6Z A;  3AL0 C;  3TBI A;  1OR7 A;  1XMK A;  3GTO J;  3BJO A;  2IGN A;  2XHK A;  4KA4 A;  2NVY J;  1XD7 A;  2WAE A;  3FIW A;  5BS6 A;  5FB2 A;  4NC7 A;  1T08 B;  1L0O C;  4A6E A;  1D5Y A;  1HSJ A;  2ZNY A;  3KZI C;  1XS9 A;  3BPV A;  4KMU X;  4UV9 A;  1H89 C;  3OIP A;  5KCM A;  3WTW C;  1UJ8 A;  2FNA A;  2X4H A;  3CO6 C;  2DMQ A;  1WZ2 A;  3KPH A;  5D5V B;  3PIO F;  2G0E A;  4A12 A;  2CUJ A;  1I6H J;  2HPI A;  2K4J A;  2F5F A;  1J9I A;  2F4M B;  1MBH A;  5EEH A;  2EA4 A;  2KIU A;  3C18 A;  2BGC A;  3FDY A;  3FM5 A;  3FXM A;  2M1B A;  2NS0 A;  2HKO A;  3E6C C;  2Y75 A;  3MMY B;  2BYV E;  2GOM A;  4DBQ A;  3JRB A;  2CV1 A;  4KT6 A;  2KJC A;  4A3F J;  3L00 A;  5E3L A;  3SZT A;  5K1Y A;  3IRQ A;  1W5S A;  4HST A;  2JN6 A;  1BW5 A;  1HF0 A;  3SQN A;  4ETS A;  4L0Z B;  3NEU A;  1G4D A;  3C2G A;  2CGP A;  3LSP A;  2F5V A;  4KMF A;  2BY3 A;  3F8B A;  4FX0 A;  3OOP A;  1ON1 A;  3TOB A;  1W36 D;  3BG6 A;  4N9H A;  2IS6 A;  2Z16 A;  4HG2 A;  3EET A;  3JW4 A;  1HLV A;  1WSU A;  5F04 A;  3KZY A;  4XN0 A;  3OYJ A;  5ICC A;  1G59 A;  2IT0 A;  2BE5 F;  4KIB A;  4ENK A;  1X3W B;  3GTG J;  4XOT A;  2XAQ A;  5KAI C;  1IUY A;  1VTN C;  1YJ9 I;  1PYV A;  1KU2 A;  1XC5 A;  4V2G A;  3BTI A;  3HBL A;  4BAC A;  4AD9 A;  1IN6 A;  2EIM H;  2K40 A;  3K10 A;  1HCR A;  1T0F C;  3KLN A;  4XRS G;  4RDU A;  3J7Y J;  4C3I J;  1JTX A;  2XRL A;  2UUZ A;  1GXP A;  3S17 J;  2FML A;  3ZQG A;  2X48 A;  1DPU A;  2VC1 A;  2IA1 A;  5JVG F;  1BC8 C;  1D5V A;  3H3U A;  2DFF A;  5IPA A;  2QUF A;  3O8H A;  3BQY A;  1P4X A;  2EQR A;  2JVH A;  2RRE A;  2RVC A;  3KEQ A;  3SZP A;  2ME0 A;  3ZQ7 A;  3K6G A;  5D4S A;  1RPW A;  1S9H A;  1O7L A;  4PUS A;  4MTD A;  2Q2E A;  4HZF A;  3BTC A;  1SFK A;  3K0L A;  5FKM A;  3OYH A;  1CF7 B;  3E6B A;  3FXK A;  5BNG A;  3L9F A;  3MFK A;  3LQQ A;  5HS9 A;  1W36 C;  2A6H F;  3A0B C;  4NQW A;  4NUB A;  3LSH A;  4WXC A;  5C4J J;  3NWS A;  2VIX A;  5L3D A;  3ZOB A;  4V2F A;  1S7O A;  3R61 A;  2XAS A;  3F6V A;  1RR7 A;  2LMD A;  5LLQ A;  3PQK A;  2GZW A;  3GO5 A;  3RI4 A;  2OU2 A;  4XKW A;  2X9D A;  4IF4 A;  1BN5 A;  4LGW A;  3SEQ A;  5C3E J;  2FQ4 A;  3ISP A;  1STZ A;  1UHW A;  1A31 A;  2EWN A;  2O5R A;  5HLH A;  5H6R A;  3DEW A;  4AID A;  1IUF A;  3RKW A;  4EJV A;  4D1Q A;  4CZC A;  2IA2 A;  2IA0 A;  1G8X A;  4F52 A;  3MN2 A;  5FLX Z;  4A0Z A;  1SD4 A;  2RQQ A;  4FT8 A;  2VT2 A;  1IRF A;  4CSW A;  4A3B J;  1IRG A;  2OCE A;  5ILS A;  1FMW A;  4QWQ A;  3MEX A;  3AL0 B;  1R23 A;  1U9O A;  2VBW A;  1K7A A;  4BE0 A;  3TW7 A;  3F8C A;  1QQI A;  1WRJ A;  2O61 A;  1I39 A;  4DYC A;  1V5E A;  2HEO A;  3Q0V A;  3HOZ J;  2MH2 A;  4O6J A;  3FXQ A;  1TP4 A;  3ABU A;  3PM1 A;  1MJB A;  2XKP A;  1J0R A;  2FJ1 A;  2K9N A;  3ZN0 A;  2HOT A;  1VND A;  3HL2 A;  2KLO A;  5F08 A;  2O0Y A;  1T98 A;  1F36 A;  3TO6 A;  3AG2 H;  2WTE A;  4B43 A;  3CCQ I;  2XSJ C;  1FOW A;  1FPQ A;  1MBE A;  3RPU D;  1WQ2 A;  2BZT A;  3G1L A;  2E1M B;  2JA2 A;  3ZRG A;  3ESW B;  4U0V A;  4RA2 A;  4BHC A;  3BJ6 A;  1FP2 A;  3JRF A;  1LVK A;  1T2K A;  2LSO A;  1Z0X A;  1T95 A;  1A6Q A;  4QTR A;  4F55 A;  1R5H A;  3OYK A;  4HDV A;  2GQQ A;  4IO9 F;  2Z1D A;  5DUK A;  1WJC A;  2M7B A;  4GCV A;  2LVS A;  4RM3 A;  2DA3 A;  2XRO A;  2M34 A;  3HJE A;  2ICW G;  3TW6 A;  4WK8 F;  5LFA A;  4XID A;  3QYF A;  4L9N A;  5M5Y J;  5E17 F;  3T8R A;  1S72 I;  2Y0S A;  1X1B A;  2LTP A;  1XB4 A;  5ILV A;  3D1N I;  3AAF A;  1BA5 A;  3BZC A;  3GFI A;  4S05 A;  2PN6 A;  4OAY A;  2ZJR F;  1BIA A;  2E1M C;  4DOZ A;  1LEB A;  1IGN A;  4BL0 B;  4C3J J;  3L2C A;  1BI2 A;  2EH3 A;  5J8F A;  2BXZ A;  3CDH A;  3JTH A;  3LSK A;  3RZD J;  1X58 A;  2DDB A;  3QOD A;  3OWT A;  1WFX A;  5FLV A;  3BY6 A;  3F0C A;  4XLP F;  4AVP A;  2AS5 F;  1ZAR A;  3VEP A;  3M1E A;  1OCC H;  4IVN A;  3RKY A;  1AU7 A;  4HF2 A;  1AKH A;  1H9T A;  3ZMT A;  2HS5 A;  2P5V A;  2R7X A;  4RLF A;  3N97 A;  4B4C A;  4OOI A;  5C44 J;  3I4M J;  1KU9 A;  5D8K B;  3S3N A;  2XAG A;  5E1W A;  5CJ9 A;  3KP2 A;  3K4N A;  4LD5 A;  3DBR B;  3I64 A;  1WI9 A;  4E6K G;  1O3R A;  4KYW A;  1AA7 A;  3M1C A;  3VSK A;  5F64 A;  1W4M A;  1PVE A;  4AU7 A;  1TW3 A;  2CFX A;  2W00 A;  1YS7 A;  2XKO A;  3REO A;  1TBX A;  1D1B A;  3C2B A;  4B3X A;  3ZQC A;  1VQ5 I;  2N8G A;  5FJ8 J;  2IBD A;  2Z99 A;  4B8X A;  2PI0 A;  5E1Z B;  4A3L J;  1ON2 A;  1SVL A;  1WJA A;  3OS1 A;  2LG4 A;  3OYL A;  4M6X A;  1V5F A;  2BW3 B;  3CCR I;  4KN4 X;  4JX6 A;  3H9G A;  2VE9 A;  5J1R A;  2ECC A;  5AIP A;  4BYY A;  2DA1 A;  3AFH A;  2W24 A;  2D1V A;  1VQM I;  1SAN A;  2VKV A;  4RAG A;  3MZH A;  3CCV I;  2VBY A;  2OV7 A;  1OCT C;  2K86 A;  1MH4 A;  3PSI A;  1I6X A;  4HSR A;  4RAZ A;  5JLX A;  1AHD P;  1FTZ A;  3O3K A;  5L3E A;  2IS4 A;  3QQA A;  1BC7 C;  3H36 A;  4I09 A;  2Y31 A;  5J8C A;  1I5Z A;  3ABT A;  3OV8 A;  5H2F C;  1IV6 A;  2J5P A;  4I76 A;  2LKP A;  2ID3 A;  5HOD A;  1DUX C;  1FOX A;  2M8G X;  2L7M P;  1GXQ A;  1Z77 A;  3RSN A;  2V9K A;  2BY1 A;  4PJM A;  3RJP A;  3BWG A;  2CW8 A;  2CG4 A;  2HQR A;  3BR2 A;  1B9N A;  3H1C A;  3K4C A;  3VYS B;  1UST A;  3DCF A;  2CJJ A;  3HB9 A;  3JRA A;  1FYL A;  4AYB N;  3U9G A;  1BM9 A;  2VAS A;  2RAE A;  1WHU A;  3EUK L;  2H1K A;  5DCM B;  1JHF A;  4LG3 A;  1X3U A;  1Z7L A;  4BE1 A;  2XGC A;  4KJZ A;  1TQI A;  1IXR C;  3I5U A;  4MTE A;  3S15 J;  2JA7 J;  3PJR A;  3D0S A;  1EH7 A;  2GWR A;  2EB7 A;  1XN7 A;  1ZLJ A;  2UZK A;  1KQ9 A;  3DTI A;  4YII A;  1W5C C;  2E5N A;  2GOX B;  1U8R A;  1IC8 A;  3CDI A;  1LNW A;  2PEX A;  3GBG A;  2Y9Y A;  3GCM A;  4HNV A;  1O3T A;  2FSW A;  3HTU A;  1FSE A;  3RDI A;  3RQI A;  3W6J B;  2FRH A;  1K4T A;  3HDD A;  1N25 A;  3LMM A;  1MJ9 A;  4EM1 A;  2DA5 A;  2OJE D;  4CH7 A;  4BDZ A;  2VJI A;  4BU2 A;  2E71 A;  3KLO A;  3OYC A;  4XN3 A;  2VI6 A;  3P9I A;  2R5Y B;  1LJ9 A;  1WWX A;  2K27 A;  1XTA A;  4Y17 A;  3T5X A;  4RB2 C;  2EIN H;  1U78 A;  1CQT A;  4XOR A;  4PGH A;  1PUF B;  4S0H B;  2HOS A;  1IF1 A;  2MYS A;  2JUC A;  3HRS A;  4E4H A;  1AWC A;  3HPH A;  1B8I B;  1UZC A;  4HQE A;  4G7O F;  3E3V A;  2LKX A;  2VPR A;  4YFN F;  3RKX A;  2M5W A;  3F3X A;  3RYR A;  1G3W A;  3WTS C;  2JA6 J;  2F5D A;  4WF2 A;  5ILU A;  1DP3 A;  4D0P A;  2FQ3 A;  2QEN A;  2STT A;  3GFL A;  4IQ4 A;  3L2W A;  3CLO A;  2FXA A;  1N77 A;  3BC8 A;  5IOY A;  2QZ8 A;  2V1D A;  2MC3 A;  2HZD A;  4GYI A;  3BLY A;  4HOB A;  5GAG J;  5LD2 C;  2B0L A;  3ASO H;  1YRN A;  3VSL A;  2DTZ A;  3IH4 A;  3QOE A;  2ZME A;  2HYG D;  3H3Z A;  3HYI A;  5F1J A;  4DW6 A;  2VKE A;  2LNB A;  4ZYH A;  2ESN A;  4UUS B;  2EV0 A;  5JLW A;  1FSH A;  2W7N A;  4G7Z F;  2V6C A;  2HQN A;  1T0F A;  4UHT A;  3IKT A;  4KIF A;  1FBQ A;  4PFO A;  3CUO A;  4LMY A;  4PK4 A;  5EG0 B;  1P6R A;  3OMY A;  3M3Y J;  1ZGW A;  5D6E A;  3HEF A;  2XRN A;  4S04 A;  1WJF A;  3FMQ A;  3LA2 A;  3CDL A;  1F43 A;  1X4O A;  3ZQI A;  4CCM A;  3J7A Y;  4XON A;  5GAH J;  4UNO A;  2DTR A;  2R5Z A;  1BJA A;  3OSG A;  5FKO A;  3VYT B;  5FRN A;  2DMT A;  1B8I A;  2KMU A;  4AIJ A;  2PG4 A;  5FO5 A;  3NAU A;  4XR6 A;  3S14 J;  4M9S A;  2RC4 A;  5IY5 H;  1JJ8 C;  3QU3 A;  4II3 A;  1SFE A;  2KL4 A;  4AWX B;  4JBA A;  5DYM A;  1PDN C;  3HOW J;  5L3G A;  1YS6 A;  4NQW B;  2YR2 A;  4M3E A;  5DM7 F;  2VLA A;  4M73 A;  2E2J J;  2OZU A;  5E3N A;  2ZXH A;  1Z91 A;  3QPS A;  2BHZ A;  3LOC A;  2CW7 A;  1SD5 A;  3WTU C;  1N75 A;  1HW1 A;  1W7P D;  2D1H A;  3JRC A;  3PL8 A;  2V7F A;  1JKP C;  3FXU A;  4EJO A;  1OPC A;  3CJN A;  3MQ0 A;  4HRI A;  3R60 A;  2DQL A;  2P6S A;  3V8J A;  1K61 A;  3IC7 A;  3IHU A;  5D4R A;  3K1P A;  2F48 A;  4XNF A;  4G6D A;  1V54 H;  3CQZ J;  1XSX A;  2OZ6 A;  4UXN A;  3V42 A;  5HLI A;  2AXT C;  1BR2 A;  3OS2 A;  1MMA A;  2ETH A;  4HF1 A;  2VOO A;  3ECO A;  5H20 A;  2VQH A;  2CO5 A;  1E3O C;  3KP4 A;  2GIZ A;  1OYI A;  3G71 I;  1TWG J;  2MSY A;  1B72 B;  1YQA A;  4NB5 A;  3K4J A;  4A3M J;  3DLL F;  1G3Y A;  2PBI A;  2OCC H;  3Q0W A;  1T38 A;  5FGM A;  2EZI A;  1JGS A;  4Q47 A;  1MMN A;  2JT1 A;  2P0W A;  2YU3 A;  2WB1 N;  2ID6 A;  3VYR B;  3CZ6 A;  3R0J A;  1YLF A;  2PFB A;  3GXO A;  2ECB A;  3IWZ A;  3LA7 A;  4CHU A;  5IT3 A;  3H5A A;  3FKJ A;  3EYY A;  2A6E F;  2LR8 A;  3HGG A;  2DOA A;  4R8H A;  1JJ6 C;  2ZSI B;  3BR3 A;  1K4S A;  1TT5 B;  4U0W A;  4U87 A;  3E5X A;  3ZPL A;  5EGO B;  1U0J A;  3ZMU A;  1XDU A;  1TTY A;  4H0E A;  1T33 A;  1ZGJ A;  4D9J A;  1AOY A;  4UB8 C;  2IGK A;  2LBF A;  3OYF A;  1MMG A;  1LQ1 A;  1YG2 A;  2PMU A;  2VUM J;  1R7J A;  3WTY C;  3GF2 A;  1Z3Y A;  3P9C A;  2Z2S B;  4UVB A;  1LPQ A;  4Z2Y A;  2R5Z B;  3RTR A;  4FQG A;  5FFZ A;  1VQ8 I;  2IRF G;  3E5Q A;  2XAU A;  2XAF A;  2WWY A;  3V7R A;  2EZH A;  1B72 A;  2A68 F;  3FIS A;  4XBF A;  1LVA A;  2DYS H;  1U8B A;  1ETQ A;  2AQE A;  2L9S A;  3HUG A;  1P4A A;  4WCG A;  2R3S A;  2Z9O A;  4OMY A;  4JQF A;  2BY0 A;  2KRH A;  3A4C A;  2DOD A;  2ZBK A;  2HTS A;  2R7Z J;  3JAM K;  1JHH A;  2DT5 A;  2HDW A;  4I0A A;  5B5E C;  1AKH B;  2QSG X;  2TRT A;  4HQM A;  4OAZ A;  4CCO A;  3QP6 A;  2JSC A;  4BQO A;  2MA3 A;  1NK3 P;  4ZYD A;  1D8J A;  2M45 A;  4DQ2 A;  4X6A J;  2V9P A;  1FP1 D;  2RNG A;  5J4V A;  3FF5 A;  4EGZ A;  2O8X A;  1LE8 B;  1OCR H;  2RDP A;  1Y0N A;  4BHB A;  2H27 A;  1HXD A;  3HHH A;  5LGN A;  3J7A O;  1MH3 A;  3MVP A;  4DZJ A;  2MD5 A;  3ERE D;  2Y48 A;  9ANT A;  4O3M A;  4ANJ A;  1V3F A;  4JOM A;  2EJR A;  4XKC A;  1F4K A;  2X6X A;  5KK1 A;  4CYD A;  2BV6 A;  3IAS 2;  3DKX A;  2BBY A;  3K2Z A;  4WXH A;  4L9V A;  2VC0 A;  3MKZ A;  4BY7 J;  2E35 A;  4BQN A;  4RGS A;  4XSZ F;  2ISZ A;  3IWF A;  5LHG A;  4IQJ A;  2E7W A;  2L01 A;  1DGW Y;  3M8E A;  2VBZ A;  3I9V 2;  2XUB A;  3M7G A;  2X6Y A;  1TL8 A;  5CQE A;  2LYC A;  3BT9 A;  3S3O A;  4IHW A;  5D6F A;  2D2W A;  3SXY A;  4P9F A;  1NG7 A;  4BEH B;  4YEL A;  4XQF A;  4Y7N J;  4NBQ A;  4TV7 A;  5DEQ A;  1Z6T A;  1HW2 A;  4UY8 I;  2Q8K A;  1KGS A;  1BJZ A;  1LDK B;  1SD6 A;  2HYJ A;  2VJ5 A;  2QYO A;  1QRY A;  3EUA A;  5J1Y A;  1MNM C;  2QSF X;  3ML6 A;  3OR1 C;  1JXS A;  3ERM A;  4E70 A;  5ICE A;  3QOP A;  1UAA A;  2ZFU A;  1MGT A;  1P7J A;  2DAO A;  3E7L A;  5EYR A;  2YU9 J;  3ZP5 A;  1K78 A;  2CRG A;  2ZKZ A;  4RLQ A;  3GLX A;  5K7H A;  1WJ5 A;  4XSX F;  4F7Z A;  1G3S A;  2A69 F;  4J00 A;  3S2D J;  2VJJ A;  3DF8 A;  5J1U A;  4FX4 A;  2H6C A;  3BTJ A;  2WV1 A;  1HKQ A;  4M3D A;  4DJA A;  1U5T C;  3KP7 A;  3I56 I;  4HX4 A;  3TMO A;  1V55 H;  4EVI A;  3JRH A;  2CS3 A;  3B6C A;  2PQ8 A;  3RPQ A;  1OKR A;  1ZLK A;  2NS8 A;  4HW0 A;  1XGO A;  1U5T B;  2PMH A;  5HLG A;  2LBF B;  4M3F A;  2K4B A;  3LSJ A;  4BJ5 C;  1SD7 A;  2ZO4 A;  1OLT A;  2HWV A;  2ELH A;  1PP8 F;  2XIG A;  3DPT A;  3JRD A;  2KIS A;  4ZJZ A;  3ASN H;  2CMP A;  1IG7 A;  3BPX A;  1DDN A;  1T56 A;  2VQG A;  3OSF A;  3I59 A;  1PUF A;  2DBB A;  3MCZ A;  4BEH A;  4LLN A;  5M5X J;  3KYL A;  2NNY A;  1X1D A;  1WVR A;  2M3A A;  3GYH X;  2NVX J;  2NS7 A;  4E7S A;  2ZJ2 A;  1HST A;  1RIO H;  5H6Q A;  2KDZ A;  1X1C A;  1FYM A;  4F3Q A;  5CVV A;  4YFX F;  3L2Q A;  1B4A A;  2COB A;  3J80 K;  3BR1 A;  1MW7 A;  1SVO A;  3JTG A;  2ZSH B;  3L7W A;  1TT0 A;  2XB0 X;  3KP5 A;  1N78 A;  1GV2 A;  4GDF A;  3W6V A;  5BQT A;  3CO7 C;  3S1M J;  3K1M A;  3CME I;  1KU3 A;  2L02 A;  5GAE J;  1BL0 A;  4KFC A;  4XIC A;  3GTQ J;  4LG0 B;  1XCV A;  1G6N A;  3OYM A;  1Z3X A;  3F21 A;  3IV5 A;  1ERD A;  2IVM A;  1BR4 A;  1QPI A;  5AIQ A;  1FTT A;  3B73 A;  2WC2 A;  4BAY A;  2R7W A;  2LOO A;  4O5V A;  4OU0 A;  3QRF F;  2GAU A;  4OIQ F;  1RUO A;  4U88 A;  3T1B A;  4NHJ A;  5FRM A;  3V8K A;  2R7O A;  3S8P A;  1LFU P;  2H8W A;  3BG3 A;  4KIC A;  5FD6 A;  1ZRC A;  3Q0U A;  1QU3 A;  2ME6 A;  1FIA A;  2JZY A;  4IRG A;  4D5C A;  2CQX A;  4FCY A;  1S6L A;  2NVT J;  1KYW A;  1XDS A;  3FBI B;  1W7P A;  4LK1 F;  1IV8 A;  2DK8 A;  5A2Q Z;  3QYB A;  3F8N A;  3R0A A;  1H88 C;  5IP7 J;  2KHM A;  3OL3 A;  1I3A A;  1FT9 A;  2XDV A;  2R7T A;  2HDD A;  4RMN A;  3C3W A;  1ETK A;  4HV6 A;  4A0Y A;  4ZYG A;  1KU7 A;  4D7N A;  2XF6 A;  2JVG A;  2TCT A;  1A5J A;  1JKR C;  2L2O A;  2VXD A;  1YW7 A;  3BG5 A;  3WTZ A;  5D5X B;  5LHH A;  1T6S A;  5ICF A;  1NHA A;  1YJN I;  2CU7 A;  2FOW A;  4FE4 A;  1V4R A;  4CGZ A;  2DA4 A;  5EGO A;  1YW8 A;  3PIP F;  1ETY A;  2DI3 A;  4KIT B;  2EA2 A;  4B3A A;  3RPU A;  4DYQ A;  3FK7 A;  1GV5 A;  1X2N A;  1BW6 A;  3U1D A;  2KRC A;  4QPO A;  3ZGK A;  1T8I A;  4ZZD A;  2DOF A;  5KNL A;  2RV8 A;  5ED4 A;  5E18 F;  3BR5 A;  3PUB A;  2EFN A;  2M0M A;  1DQU A;  4A3E J;  2W48 A;  1DU6 A;  1A04 A;  1KZH A;  3CCJ I;  1R58 A;  2XF7 A;  1HKT A;  3KZZ A;  1QZE A;  4MQ9 F;  2H09 A;  1YTY A;  2OBP A;  1XX5 A;  3VOD A;  4ENJ A;  1FIP A;  1S29 A;  2TDX A;  1XSD A;  3DV8 A;  2LD5 A;  3DBL B;  1R49 A;  3V8L A;  1ZYR F;  1JT6 A;  1EH8 A;  3EUH A;  2KJB A;  3DXJ F;  4CDG A;  2GA2 A;  4PSW A;  1VZ0 A;  5L3C A;  4IHV A;  3NAR A;  4HYE A;  2P8T A;  4BGD A;  2ZCW A;  3HZJ A;  5B66 C;  1YE9 A;  2L9R A;  4N9I A;  3S1Q J;  4ZYE A;  1YX5 A;  3ZQH A;  3UKG A;  3P9K A;  3VYU B;  3J81 Z;  1BIB A;  4M6V A;  4U7B A;  3H9J A;  4GXO A;  1P92 A;  3KCC A;  1QA6 A;  4LLG F;  3CD6 I;  2X6W A;  5CYV A;  2COM A;  4KNY A;  2OF7 A;  4M74 A;  5CPR B;  4I98 B;  2HYF A;  4FHT A;  2MAB A;  5EDN A;  1EH6 A;  3SEZ A;  4M6Y A;  3TDZ C;  3SFZ A;  2ZFW A;  4J01 A;  1FZP B;  3BR6 A;  3LQR A;  3CJT B;  3HOY J;  1HOM A;  2JPC A;  1UCR A;  2CH0 A;  2YS9 A;  4I99 C;  4LOC A;  1VQN I;  2EFW A;  2CFO A;  5E8G A;  3GVA A;  1F5T A;  2OAZ A;  3TO9 A;  1IN4 A;  1IO2 A;  1Y39 A;  1TNS A;  2WY8 Q;  4MQV A;  3EDP A;  3LA3 A;  3QPL A;  1PJR A;  1MMD A;  4ZTF A;  5LEK A;  1O7F A;  4PJL A;  3WE2 A;  4B48 A;  3RZO J;  1JKQ C;  3L2R A;  1MKM A;  3FWE A;  1O57 A;  1VF9 A;  2BXY A;  4NDL A;  2GBY A;  2CWE A;  1KA8 A;  1SMT A;  2XPU A;  4AIK A;  1YFH A;  1LEA A;  5E3O A;  2K5C A;  1H8A C;  4BDY A;  2K9M A;  3HM5 A;  3SZG A;  4YIF A;  2EZL A;  1P2F A;  5HS8 A;  3BZ6 A;  1ORK A;  3CMA I;  2VXZ A;  4I0B A;  1J7K A;  4Q4Z F;  2JQ7 A;  3FMR A;  1POG A;  2D5V A;  2KPM A;  3DWL E;  3HTS B;  2GXA A;  2QVO A;  1Y1V J;  5HDK A;  2E19 A;  3SHF A;  5E1X A;  1X2M A;  4JYK A;  4UUS A;  1APL C;  1UB9 A;  1I3Q J;  2KZG A;  3MZY A;  1ETV A;  3H35 A;  3PUF A;  1Y6I A;  3NWT A;  2UV1 A;  1R36 A;  4GGG A;  4KUM A;  3MKW B;  3MZ8 A;  2W57 A;  1D1A A;  3ZQF A;  1BI3 A;  2CYY A;  1K6Y A;  2KRF A;  1OJL A;  3G1M A;  4MGR A;  5FLM J;  4IHX A;  5A2Q K;  3CCS I;  1VQP I;  1IZ1 A;  4UV8 A;  1QHG A;  2BW3 A;  2Z5U A;  3FKI J;  1FC3 A;  1Y8R B;  2JRM A;  4BXF A;  3LNQ A;  4M9X A;  4IRI A;  2NYX A;  2A61 A;  3K1N A;  2VN2 A;  4HEA 2;  3GME A;  4CO8 A;  2M87 A;  3M9A A;  2H94 A;  2EV5 A;  3RKQ A;  1T39 A;  3OYG A;  4ENN A;  4B44 A;  1P4W A;  2NVQ J;  5KAF C;  2P6T A;  3CCU I;  4EQQ A;  5GTH C;  4P5O A;  2YPR A;  3DLA A;  3SDG A;  2R93 J;  4DIQ A;  3K4M A;  4FTH A;  1RNL A;  2W85 A;  4E7L A;  1G3T A;  1ZK8 A;  4LK0 F;  2QQ9 A;  1JUP A; 
#chains in the Genus database with same CATH homology
 1E17 A;  2J5O A;  3B02 A;  2DO7 A;  1B9M A;  1S3J A;  1R1T A;  4L9T A;  4RB1 A;  3TOA A;  1XGN A;  3WGI A;  2JRT A;  1BI0 A;  1SAX A;  3ZMV A;  3D5L A;  3ZMD A;  3LWF A;  1FLI A;  2ZME B;  2PLY A;  4L0Y B;  1QZY A;  2ESH A;  2V1X A;  1LDJ A;  4KN7 X;  1S7A A;  4LB6 B;  1EV7 A;  3LST A;  5HS7 A;  5EEG A;  5LGU A;  5K5Q A;  2IPQ X;  2VE8 A;  5LRR A;  3ZMS A;  2NRA C;  2V9V A;  5LBQ A;  2RKH A;  3H92 A;  3GUD A;  5ICG A;  3TDU C;  1MD0 A;  3O6B B;  1TW2 A;  3PQJ A;  3FX3 A;  1QNT A;  2EK5 A;  1F9N A;  2M30 A;  3HHG A;  2FOK A;  1ZN2 A;  1IN8 A;  1R1U A;  2EFQ A;  4HX8 A;  2KIM A;  1MZB A;  4I01 A;  1HQC A;  5TJJ A;  5CVR A;  5LRS A;  1FBS A;  1OYY A;  1CGP A;  3F6O A;  3QPT A;  5LHI A;  3FM3 A;  1W7P B;  1O3Q A;  1Z7U A;  2DFI A;  5F1R A;  3HOT A;  5BOX A;  3V7S A;  5HDG A;  3T0Y A;  5JI6 A;  4IHT A;  3G73 A;  1LDD A;  3LAJ A;  2FU4 A;  2MLG A;  5FFX A;  1Q1H A;  5IT9 Z;  2VBX A;  1ZG5 A;  1ZHF A;  2NNN A;  2DU9 A;  5JHU A;  2MH9 A;  3KEO A;  1IXS B;  2VOD A;  2YSR A;  4UUV A;  3EYI A;  2M8E A;  2HKX A;  5K5O A;  5DD4 A;  4PGG A;  4RAY A;  1RUN A;  4G94 A;  5AON A;  2PJP A;  1CF7 A;  2HOE A;  5LGT A;  4ESJ A;  2FBI A;  2KIF A;  4I2O A;  1JE8 A;  5F6F A;  1B1B A;  2K02 A;  5CVU A;  4OMZ A;  1USS A;  3G3Z A;  5KVR A;  1Z6R A;  5K5R A;  2GXG A;  3IKV A;  3Q9S A;  2VON A;  2EFP A;  2UXN A;  2IW5 A;  2FBH A;  2W25 A;  5D5W B;  4I7H A;  5D5U B;  5L3F A;  1HW5 A;  2O03 A;  1XGM A;  2VOP A;  3FXR A;  1MDM A;  3CUQ C;  3V4G A;  3ZN1 A;  4LFU A;  2Z3Y A;  2QWW A;  3M8F A;  4U7D A;  1K78 B;  1KQ0 A;  1IXC A;  3NRV A;  3HOS A;  2OD5 A;  3NQO A;  1I27 A;  3CUQ A;  4IRH A;  3CUQ B;  4LLL A;  2XAH A;  1GHC A;  3F8M A;  3U2R A;  1BI1 A;  1UFM A;  4KIG A;  4RGR A;  1Z1D A;  5BPI A;  4U0Y A;  2DLL A;  1SMY F;  2G9W A;  4PZJ A;  1KYZ A;  2VT3 A;  2P7C B;  2XVC A;  3F8F A;  4EGY A;  4HLY A;  2E7X A;  4EV0 A;  1J5Y A;  2FNP A;  2ADU A;  3WGH A;  2E1N A;  1E2X A;  1SFX A;  3MWM A;  2L54 A;  3HRU A;  4WX9 A;  5CLS A;  3DPL C;  4CZZ A;  4MEY F;  2LF7 A;  1HKS A;  1FWZ A;  4HA8 A;  1L3L A;  5L3B A;  2JPB A;  2LDU A;  2RN7 A;  5JFR A;  3I58 A;  2MLK A;  4A0X A;  1DP7 P;  2ZXJ A;  3I71 A;  3TKY A;  1BOA A;  2P7V B;  3RYP A;  4CIC A;  3L09 A;  1OYW A;  3BDD A;  4OIO F;  3K9T A;  3I59 B;  2AXL A;  1HBX G;  4PDK A;  2MBF A;  2HDC A;  3TO7 A;  3QU6 A;  3TQN A;  4HDU A;  3W6K B;  4RGX A;  2A3S A;  5J6X A;  4G8X A;  4KT5 C;  4MNU A;  1XSV A;  4BHP A;  2STW A;  5HVQ C;  3QP5 A;  4L5J A;  4IJA A;  4ENM A;  2R7D A;  1ZRF A;  1W5T A;  4IPA A;  2DK5 A;  5E20 A;  1TLH B;  1QPM A;  5BPD A;  3Q5F A;  5CVI A;  2BEO A;  2EFO A;  2GIV A;  4MEX F;  2WV0 A;  4YFK F;  2DW4 A;  3FZV A;  4HAM A;  4EJW A;  2K7L A;  3F72 A;  4GYG A;  2CW0 F;  4CXF A;  4M71 A;  2P5K A;  2UXX A;  3WE3 A;  2E1C A;  4HF0 A;  3FHZ A;  3N4M A;  4A5N A;  3CTA A;  2W84 A;  4N0B A;  3BRO A;  3QAH A;  4A5M A;  1ODD A;  1ZAO A;  3RIR A;  2QBY A;  2IJL A;  4Q48 A;  4B09 A;  1U2W A;  4AIH A;  4PCQ A;  2GXB A;  1XCB A;  5IT9 K;  1YYV A;  3ZMZ A;  2F5C A;  3HSE A;  4EJU A;  2FE3 A;  3COA C;  1WKM A;  3HRM A;  2EV6 A;  5HDN A;  1K79 A;  4I02 A;  3J80 Z;  1IAW A;  2V79 A;  4Y13 A;  4ZZL A;  1J59 A;  3MAJ A;  2HZT A;  3JSP A;  2GA1 A;  1U6G A;  3DKW A;  1LB2 A;  3IL2 A;  2RGV A;  3GFJ A;  2F5E A;  5DV5 A;  5D8L B;  2HTJ A;  4IXA A;  3C7J A;  1U5T A;  3WU1 B;  2XV4 S;  4P96 A;  2C6Y A;  1R22 A;  2P5L C;  4OIP F;  1ZGA A;  1YIO A;  5ERI A;  1IN7 A;  1H9G A;  2KKO A;  4BQA A;  3JSO A;  5DCF A;  3E97 A;  3GZ5 A;  2DQR A;  5E8I A;  4MHG A;  2JTV A;  3WOD F;  3Q9V A;  1K6O A;  4QLC U;  4JK1 X;  1RI7 A;  1KQ8 A;  3KET A;  3E6D A;  2RNJ A;  2G7H A;  3KE2 A;  3WTX C;  4BXU A;  2L3D A;  3O2P E;  3BJA A;  3ECH A;  3VOE A;  3HRT A;  1MJA A;  3E6M A;  1U3E M;  1I1S A;  4IHS A;  6PAX A;  3GW2 A;  1IN5 A;  1ULY A;  3FMS A;  5BMZ A;  4P55 A;  2DPU A;  2ACJ A;  4RS8 A;  1TQM A;  1H0M A;  4HX7 A;  2L4A A;  5JVT A;  2IP2 A;  3VB2 A;  1Y0U A;  3HSR A;  3WU0 A;  2FEZ A;  1ZG1 A;  1REP C;  2A07 F;  2FF4 A;  4RB0 A;  1D3Y A;  2QQA A;  1R5G A;  4G6Q A;  4OIR F;  1Z05 A;  4WXD A;  3PFI A;  1C0W A;  2L4M A;  4K2E A;  1OMI A;  3IRR A;  1B59 A;  2D45 A;  1ZG3 A;  3K69 A;  2FA5 A;  1R1V A;  4LB5 A;  3S2W A;  2CQK A;  3E5U A;  3TGN A;  1DPR A;  1B6A A;  4A6D A;  3ULQ B;  4HBL A;  2O6G E;  4DNC A;  3ELK A;  3LFK A;  2FBK A;  2G7U A;  1YO5 C;  4P9U A;  3F22 A;  3HSF A;  1FY7 A;  1QZZ A;  5TRD A;  2RQP A;  2YX4 A;  4LG0 A;  3F23 A;  3GWZ A;  3DEU A;  2H6B A;  2XAJ A;  1YW9 A;  5CVJ A;  2Z33 A;  2R7F A;  2YX7 A;  1QO0 D;  4HLX A;  1XGS A;  1ZH5 A;  2OA4 A;  4EMS A;  1MDM B;  3GZ6 A;  3WG9 A;  4G9Y A;  4BH9 A;  5FD5 A;  2FMY A;  1RZ4 A;  1J75 A;  1GVJ A;  4ESF A;  3DQV C;  2QBY B;  4KDP A;  3C1D A;  4R79 A;  3J81 K;  4ESB A;  1FYK A;  2QM3 A;  2CSO A;  5DD8 A;  2Q0O A;  4G7H F;  3GX4 X;  4M9Z A;  3KP6 A;  3KP3 A;  4XRF A;  2XGX A;  4ASN A;  1ZRE A;  2OQG A;  4ZH4 F;  4UVC A;  4L18 B;  2P4W A;  3ROU A;  3I0T A;  5JR3 A;  3QPH A;  1ZRD A;  3VFZ A;  1UHM A;  3I53 A;  4LJZ F;  3BP8 A;  2ZNZ A;  2V1U A;  2LF8 A;  4EJT A;  1XMA A;  5DCM A;  2O3F A;  4WWC A;  4BNC A;  3DP7 A;  5DDG A;  3HIF A;  1J2X A;  3KFW X;  1FX7 A;  5LEJ A;  1FBU A;  4YG2 F;  1TQP A;  4XLN F;  3WTV C;  1BBY A;  3T8T A;  4RGU A;  4HV5 A;  1Z9C A;  4M72 A;  2A5Y B;  4Y15 A;  4L9J A;  3GFM A;  3JAM Z;  2NAZ A;  1TNT A;  1R00 A;  2QLZ A;  2OQR A;  2F2E A;  3I4P A;  1FNN A;  5HOO A;  1IW7 F;  1S8N A;  4GO1 A;  2ISY A;  1O3S A;  4EM2 A;  4RB3 C;  4R1H A;  1D8K A;  1QBJ A;  2HGC A;  1PP7 U;  4UVA A;  3LAP A;  4Q5S F;  1F1Z A;  4ON0 A;  1PUE E;  3P7N A;  4OIN F;  2UWM A;  1QGP A;  2QQB A;  2HFH A;  2Y0M A;  2HR3 A;  5DUI A;  2DPD A;  2X0L A;  4EM0 B;  3EQL F;  3WTT C;  5FLX K;  4L5I A;  3BOQ A;  3GEZ A;  4A2U A;  3R4K A;  3I54 A;  3WGG A;  3V7C A;  1FOK A;  1SFU A;  1I1G A;  3DFG A;  1ONV A;  3R6S A;  1OR7 A;  1XMK A;  3BJO A;  2XHK A;  4KA4 A;  1XD7 A;  5BS6 A;  5FB2 A;  1L0O C;  4A6E A;  1HSJ A;  2ZNY A;  3BPV A;  4KMU X;  4UV9 A;  3WTW C;  2FNA A;  2X4H A;  3CO6 C;  5D5V B;  4A12 A;  2K4J A;  2F5F A;  1J9I A;  5EEH A;  2EA4 A;  2KIU A;  3C18 A;  2BGC A;  3FM5 A;  2M1B A;  2NS0 A;  2HKO A;  3E6C C;  2Y75 A;  2BYV E;  2KJC A;  3L00 A;  5K1Y A;  3SZT A;  3IRQ A;  1W5S A;  3SQN A;  4ETS A;  4L0Z B;  3NEU A;  1G4D A;  2CGP A;  4KMF A;  3F8B A;  4FX0 A;  3OOP A;  1ON1 A;  3TOB A;  4N9H A;  3EET A;  3JW4 A;  1WSU A;  3KZY A;  5ICC A;  2IT0 A;  2BE5 F;  4KIB A;  4ENK A;  2XAQ A;  1IUY A;  1VTN C;  1KU2 A;  4AD9 A;  1IN6 A;  3KLN A;  1GXP A;  2FML A;  1DPU A;  2VC1 A;  2IA1 A;  1BC8 C;  1D5V A;  3H3U A;  2QUF A;  1P4X A;  2RVC A;  3KEQ A;  3SZP A;  3ZQ7 A;  5D4S A;  1O7L A;  4MTD A;  2Q2E A;  4HZF A;  3K0L A;  1CF7 B;  3E6B A;  3L9F A;  3MFK A;  3LQQ A;  5HS9 A;  2A6H F;  4NQW A;  4WXC A;  5L3D A;  1S7O A;  3R61 A;  2XAS A;  3F6V A;  5LLQ A;  3PQK A;  2GZW A;  3GO5 A;  3RI4 A;  2OU2 A;  4IF4 A;  1BN5 A;  4LGW A;  3ISP A;  1STZ A;  1UHW A;  2EWN A;  5HLH A;  5H6R A;  3RKW A;  4EJV A;  2IA2 A;  2IA0 A;  5FLX Z;  4A0Z A;  1SD4 A;  4FT8 A;  1IRG A;  2VT2 A;  1IRF A;  5ILS A;  4QWQ A;  3MEX A;  1R23 A;  2VBW A;  1K7A A;  3F8C A;  1QQI A;  1WRJ A;  2O61 A;  2HEO A;  2MH2 A;  4O6J A;  3FXQ A;  3ABU A;  1MJB A;  2XKP A;  1J0R A;  3ZN0 A;  2O0Y A;  1T98 A;  3TO6 A;  2WTE A;  1FPQ A;  1WQ2 A;  4U0V A;  4BHC A;  3BJ6 A;  1FP2 A;  1T2K A;  2LSO A;  1R5H A;  4HDV A;  2GQQ A;  5DUK A;  4GCV A;  2XRO A;  4WK8 F;  4L9N A;  5E17 F;  3T8R A;  5ILV A;  1XB4 A;  3AAF A;  3GFI A;  4S05 A;  2PN6 A;  1BIA A;  1LEB A;  3L2C A;  1BI2 A;  5J8F A;  3CDH A;  3JTH A;  3BY6 A;  4XLP F;  4AVP A;  2AS5 F;  1ZAR A;  3VEP A;  3M1E A;  4IVN A;  3RKY A;  4HF2 A;  1H9T A;  3ZMT A;  2HS5 A;  2P5V A;  3N97 A;  4OOI A;  1KU9 A;  5D8K B;  2XAG A;  5E1W A;  5CJ9 A;  3KP2 A;  4LD5 A;  3I64 A;  1WI9 A;  4KYW A;  1O3R A;  5F64 A;  1W4M A;  1TW3 A;  2CFX A;  1YS7 A;  2XKO A;  3REO A;  1TBX A;  2Z99 A;  4B8X A;  2PI0 A;  5E1Z B;  1ON2 A;  4M6X A;  4KN4 X;  2VE9 A;  5AIP A;  4BYY A;  2W24 A;  2D1V A;  3MZH A;  2VBY A;  2K86 A;  1I6X A;  4RAZ A;  3O3K A;  5L3E A;  1BC7 C;  4I09 A;  5J8C A;  1I5Z A;  3ABT A;  3OV8 A;  2J5P A;  2LKP A;  1DUX C;  1GXQ A;  3RJP A;  3BWG A;  2CG4 A;  2HQR A;  1B9N A;  1UST A;  1FYL A;  3U9G A;  1BM9 A;  5DCM B;  1JHF A;  1X3U A;  1TQI A;  1IXR C;  3I5U A;  4MTE A;  3D0S A;  1EH7 A;  2GWR A;  2EB7 A;  1XN7 A;  1ZLJ A;  2UZK A;  1KQ9 A;  4YII A;  1U8R A;  1LNW A;  2PEX A;  1O3T A;  2FSW A;  3HTU A;  3W6J B;  1FSE A;  3RDI A;  2FRH A;  1MJ9 A;  4EM1 A;  3KLO A;  3P9I A;  1LJ9 A;  1WWX A;  2K27 A;  4Y17 A;  3T5X A;  4RB2 C;  1U78 A;  4PGH A;  1IF1 A;  3HRS A;  1AWC A;  4G7O F;  4HQE A;  3E3V A;  4YFN F;  3RKX A;  2M5W A;  3F3X A;  3RYR A;  1G3W A;  3WTS C;  2F5D A;  4WF2 A;  5ILU A;  4D0P A;  2FQ3 A;  2QEN A;  2STT A;  3GFL A;  3CLO A;  2FXA A;  2QZ8 A;  2V1D A;  2MC3 A;  4GYI A;  4HOB A;  2B0L A;  2ZME A;  2HYG D;  3H3Z A;  3HYI A;  2LNB A;  4ZYH A;  2ESN A;  2EV0 A;  1FSH A;  4G7Z F;  2V6C A;  2HQN A;  1T0F A;  4UHT A;  3IKT A;  4KIF A;  1FBQ A;  3CUO A;  4LMY A;  1P6R A;  5D6E A;  2XRN A;  4S04 A;  3FMQ A;  3LA2 A;  4UNO A;  2DTR A;  1BJA A;  4AIJ A;  2PG4 A;  5FO5 A;  4M9S A;  2RC4 A;  3QU3 A;  1SFE A;  4AWX B;  4JBA A;  5DYM A;  1PDN C;  5L3G A;  1YS6 A;  2YR2 A;  4M73 A;  2OZU A;  1Z91 A;  1SD5 A;  3WTU C;  1HW1 A;  1W7P D;  2D1H A;  3FXU A;  4EJO A;  1OPC A;  3CJN A;  3MQ0 A;  3R60 A;  2DQL A;  2P6S A;  3V8J A;  3IC7 A;  3IHU A;  5D4R A;  3K1P A;  4G6D A;  1XSX A;  2OZ6 A;  4UXN A;  5HLI A;  2ETH A;  4HF1 A;  2VOO A;  3ECO A;  5H20 A;  2CO5 A;  3KP4 A;  1OYI A;  1YQA A;  4NB5 A;  1G3Y A;  2PBI A;  1T38 A;  5FGM A;  1JGS A;  4Q47 A;  2JT1 A;  2YU3 A;  3R0J A;  1YLF A;  2PFB A;  3GXO A;  3IWZ A;  3LA7 A;  4CHU A;  5IT3 A;  3EYY A;  2A6E F;  4R8H A;  4U0W A;  3E5X A;  3ZPL A;  3ZMU A;  1XDU A;  1TTY A;  4H0E A;  1ZGJ A;  1AOY A;  1LQ1 A;  1YG2 A;  2PMU A;  1R7J A;  3WTY C;  3GF2 A;  3P9C A;  4UVB A;  4Z2Y A;  3RTR A;  5FFZ A;  2IRF G;  3E5Q A;  2WWY A;  2XAF A;  3V7R A;  2A68 F;  4XBF A;  1LVA A;  2Z9O A;  4WCG A;  3HUG A;  1P4A A;  4OMY A;  2R3S A;  4JQF A;  2ZBK A;  2HTS A;  3JAM K;  1JHH A;  2DT5 A;  4I0A A;  4HQM A;  3QP6 A;  2JSC A;  2MA3 A;  4ZYD A;  1D8J A;  2M45 A;  4DQ2 A;  1FP1 D;  3FF5 A;  4EGZ A;  2O8X A;  2RDP A;  2H27 A;  4BHB A;  1HXD A;  3HHH A;  5LGN A;  3J7A O;  3ERE D;  2MD5 A;  2Y48 A;  4O3M A;  1V3F A;  2EJR A;  1F4K A;  5KK1 A;  4CYD A;  2BV6 A;  2BBY A;  3K2Z A;  4WXH A;  4L9V A;  2VC0 A;  4RGS A;  4XSZ F;  2ISZ A;  3IWF A;  5LHG A;  2E7W A;  2L01 A;  3M8E A;  2VBZ A;  2XUB A;  3M7G A;  5D6F A;  2D2W A;  3SXY A;  4P9F A;  4TV7 A;  5DEQ A;  1Z6T A;  1HW2 A;  2Q8K A;  1KGS A;  1SD6 A;  1LDK B;  2QYO A;  3ML6 A;  1JXS A;  4E70 A;  5ICE A;  3QOP A;  1MGT A;  2DAO A;  3ZP5 A;  1K78 A;  2ZKZ A;  3GLX A;  4XSX F;  4F7Z A;  1G3S A;  2A69 F;  3DF8 A;  4FX4 A;  2H6C A;  1HKQ A;  1U5T C;  3KP7 A;  4HX4 A;  4EVI A;  2PQ8 A;  3RPQ A;  1OKR A;  1ZLK A;  4HW0 A;  1XGO A;  1U5T B;  2PMH A;  5HLG A;  2K4B A;  1SD7 A;  2ZO4 A;  2HWV A;  2ELH A;  1PP8 F;  2XIG A;  3DPT A;  3BPX A;  1DDN A;  3I59 A;  2DBB A;  3MCZ A;  4LLN A;  2NNY A;  3GYH X;  2ZJ2 A;  1HST A;  1RIO H;  5H6Q A;  1FYM A;  5CVV A;  4YFX F;  1B4A A;  3J80 K;  3JTG A;  3L7W A;  3KP5 A;  5BQT A;  3CO7 C;  3K1M A;  1KU3 A;  2L02 A;  4KFC A;  4LG0 B;  1XCV A;  1G6N A;  3F21 A;  2IVM A;  5AIQ A;  3B73 A;  2WC2 A;  4BAY A;  4O5V A;  4OU0 A;  3QRF F;  2GAU A;  4OIQ F;  1RUO A;  4U88 A;  3T1B A;  4NHJ A;  3V8K A;  4KIC A;  5FD6 A;  1ZRC A;  4IRG A;  2JZY A;  1S6L A;  1KYW A;  1XDS A;  1W7P A;  4LK1 F;  2DK8 A;  5A2Q Z;  3F8N A;  3R0A A;  1FT9 A;  3C3W A;  4HV6 A;  4A0Y A;  4ZYG A;  1KU7 A;  1YW7 A;  3WTZ A;  5D5X B;  5LHH A;  1T6S A;  5ICF A;  1NHA A;  1V4R A;  4CGZ A;  1YW8 A;  2DI3 A;  2EA2 A;  3RPU A;  3U1D A;  4ZZD A;  2RV8 A;  5ED4 A;  5E18 F;  2EFN A;  1A04 A;  1R58 A;  1HKT A;  3KZZ A;  4MQ9 F;  2H09 A;  1YTY A;  2OBP A;  3VOD A;  4ENJ A;  1S29 A;  2TDX A;  1XSD A;  3DV8 A;  3V8L A;  1ZYR F;  1EH8 A;  3EUH A;  2KJB A;  3DXJ F;  4CDG A;  2GA2 A;  5L3C A;  4HYE A;  2P8T A;  2ZCW A;  4N9I A;  4ZYE A;  3P9K A;  3J81 Z;  1BIB A;  4U7B A;  4GXO A;  1P92 A;  3KCC A;  4LLG F;  5CYV A;  2COM A;  4KNY A;  4M74 A;  4I98 B;  2HYF A;  4FHT A;  1EH6 A;  4M6Y A;  3TDZ C;  3SFZ A;  2ZFW A;  1FZP B;  3LQR A;  2JPC A;  1UCR A;  2EFW A;  5E8G A;  3GVA A;  1F5T A;  2OAZ A;  3TO9 A;  1IN4 A;  1TNS A;  4MQV A;  3EDP A;  3LA3 A;  5LEK A;  1O7F A;  3WE2 A;  1MKM A;  3FWE A;  1O57 A;  2CWE A;  1KA8 A;  1SMT A;  4AIK A;  1YFH A;  1LEA A;  4YIF A;  1P2F A;  5HS8 A;  3BZ6 A;  2VXZ A;  4I0B A;  1J7K A;  4Q4Z F;  3FMR A;  3HTS B;  2QVO A;  5HDK A;  3SHF A;  5E1X A;  1UB9 A;  3MZY A;  4GGG A;  1R36 A;  4KUM A;  2W57 A;  1BI3 A;  2CYY A;  2KRF A;  4MGR A;  5A2Q K;  1IZ1 A;  4UV8 A;  2Z5U A;  1FC3 A;  4M9X A;  4IRI A;  2NYX A;  2A61 A;  3K1N A;  2VN2 A;  4CO8 A;  1T39 A;  2M87 A;  2H94 A;  2EV5 A;  3M9A A;  4ENN A;  1P4W A;  2P6T A;  4EQQ A;  4P5O A;  2YPR A;  1RNL A;  2W85 A;  1G3T A;  4LK0 F;  2QQ9 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...