3U1DA

The structure of a protein with a gntr superfamily winged-helix-turn-helix domain from halomicrobium mukohataei.
Total Genus 51
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
51
sequence length
148
structure length
148
Chain Sequence
MATQDRGERPNGFGDELERRRFVLHETRLDVLHQILAQPDGVLSVEELLYRNPDETEANLRYHVDELVDRGIVEKIPVPRAKSVDDPPTTFYAVTGEGIALLRAVSMYEEAAVWRSVYEQMERTDRIEAIENLETRPDVDYESRGATA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The structure of a protein with a GntR superfamily winged-helix-turn-helix domain from Halomicrobium mukohataei.
rcsb
source organism Halomicrobium mukohataei
molecule tags Structural genomics, unknown function
molecule keywords uncharacterized protein
total genus 51
structure length 148
sequence length 148
chains with identical sequence B
ec nomenclature
pdb deposition date 2011-09-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF12840 HTH_20 Helix-turn-helix domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 3u1dA00
4RB0A 4GCVA 3FMRA 2K27A 1S8NA 5DCMB 1O57A 2FBHA 4ESBA 2V79A 5CYVA 2EA2A 1AOYA 3BWGA 1TNTA 2EFNA 3FXUA 1ZAOA 4YIFA 4L9TA 3N4MA 2YR2A 4OIRF 5E18F 4HV6A 4ENJA 3CUQA 1P2FA 1VTNC 1G6NA 3CUQB 2P4WA 4G9YA 4RGUA 3L2CA 5LBQA 4UNOA 1YW7A 1T38A 3U9GA 4G7HF 4I2OA 3I53A 2ZXJA 3HRUA 4E70A 3R61A 3LSTA 2HTSA 1LQ1A 2RC4A 4AWXB 1R1VA 3GZ5A 3WGIA 4UHTA 4JBAA 1K6OA 3FMSA 2E7WA 1S6LA 5CVRA 4QLCU 4BYYA 4Q5SF 4CYDA 4OINF 1DPUA 2MLKA 5CVJA 3GFMA 3KZZA 3WTXC 2YPRA 1R00A 2DW4A 1XGNA 3NRVA 1WRJA 2P7CB 4BHPA 4IHSA 2IA0A 2CO5A 3E97A 4XRFA 3ISPA 4WK8F 1IXSB 4A6EA 3WTSC 2G9WA 1FLIA 4A6DA 3D5LA 2IA2A 3WE3A 3BY6A 1KU2A 5ICEA 2FF4A 1K79A 1LNWA 2XRNA 2W57A 4M6XA 1U5TB 1G3SA 4A0XA 4M72A 1XGOA 1HBXG 4BH9A 2HKOA 1F1ZA 2D1VA 4IVNA 4MHGA 3ZN0A 5FLXZ 4NHJA 3RI4A 2A61A 1LVAA 4MTDA 2KKOA 4ESJA 2HFHA 3M8EA 5D5UB 4IPAA 3RDIA 3F6OA 5LHIA 2L01A 2EFOA 1ZN2A 5ILUA 1O3TA 1WSUA 1W7PD 2P7VB 2BEOA 2NYXA 4L18B 2L54A 1LEAA 3VOEA 3REOA 2NRAC 3F6VA 1YG2A 2NNNA 3CTAA 2CGPA 1S3JA 2H94A 4RB3C 2UXXA 3K1NA 4EJVA 4CGZA 3SHFA 4A0ZA 2XUBA 4R8HA 2DLLA 3GYHX 4FHTA 2ZKZA 1D5VA 2ZNYA 1BBYA 3BJOA 3I4PA 4YIIA 2D2WA 1SFXA 3N97A 3ML6A 1YFHA 3F72A 5D4RA 4HQMA 2UWMA 3H92A 2DU9A 5AONA 2HEOA 3E5XA 4OIQF 3HYIA 5E8IA 3DXJF 3LFKA 2DFIA 3IC7A 3HUGA 1Z6TA 1R1UA 4R1HA 2DI3A 1YW8A 3T5XA 2Q8KA 2RQPA 4G8XA 5DDGA 4KFCA 3SFZA 3MCZA 2L02A 3KLNA 3HOSA 2O03A 3FHZA 1SFUA 1DP7P 4UVCA 5K5QA 1IN8A 4KN7X 3WTZA 1BI2A 3ZN1A 5L3FA 2VT2A 3RIRA 3I5UA 4RAZA 5HLGA 5EEGA 3NEUA 1E17A 4L5IA 2VODA 1IF1A 3BJAA 5FFZA 3GVAA 2L4AA 3WODF 2HDCA 2W25A 4HX8A 2XV4S 2FNAA 2FSWA 3PQJA 1EH7A 2EV6A 4N9IA 4PDKA 5CLSA 3EYYA 4CDGA 1O3RA 2XROA 2HR3A 4FX0A 3DKWA 4OU0A 4Q4ZF 3EYIA 1B6AA 3EUHA 5CVVA 2KJCA 3CUOA 5HDNA 1ZHFA 1EH8A 2FBKA 5L3CA 1DUXC 3V7RA 2QBYB 3F23A 4U0YA 4UUVA 2VXZA 1U3EM 2XKOA 2QVOA 4ENMA 1RNLA 4OMZA 2ZFWA 3BZ6A 3CDHA 2EA4A 2LNBA 5H6QA 1FY7A 1TBXA 4M9ZA 1IXRC 5BS6A 3TO6A 1JXSA 4EGZA 4MGRA 1UB9A 2FA5A 2P6SA 1R58A 4A5NA 1BIBA 4CO8A 3I59B 5BPIA 4OOIA 4ASNA 1I27A 4ZYHA 2XASA 4P96A 4O5VA 4XBFA 2PJPA 1S7OA 6PAXA 1FOKA 2IA1A 5A2QK 1FYMA 2OQGA 1FNNA 3ULQB 4YFKF 1MJAA 1W7PA 2M87A 4EQQA 1D3YA 2PBIA 5ERIA 3MWMA 5K5RA 4H0EA 1KA8A 3J80Z 2Y75A 3HTUA 1J2XA 4EJWA 5HLHA 4RS8A 2DQLA 4QWQA 2F5DA 1SFEA 1U78A 5HS8A 1LDDA 3KP3A 1DPRA 3E5QA 4ZYGA 4CHUA 1T98A 3QRFF 1XMAA 1BIAA 4HBLA 5L3BA 4D0PA 3KP2A 1YS6A 3CO6C 1BJAA 2CW0F 3G3ZA 4WCGA 2JZYA 2GXGA 4OIOF 2M8EA 2LKPA 2RV8A 5LGTA 1YYVA 1FBUA 2NAZA 3P9CA 1B9NA 4KYWA 4I01A 1T6SA 3TOBA 3EQLF 2VT3A 2M30A 2PN6A 3FWEA 1HW2A 2XHKA 1P4WA 1I6XA 2DK8A 2Y48A 4L0YB 1HKTA 2E1NA 5E1WA 1O7LA 3J81K 1BN5A 1AWCA 3QOPA 4AIKA 3T8RA 3JAMZ 2JT1A 4M9XA 2M1BA 1BI3A 1KU3A 2IJLA 3W6KB 2A6EF 3MZYA 2XAHA 4LFUA 5DYMA 4HF2A 2XKPA 2ETHA 1P4AA 2MH9A 2GAUA 4OIPF 2XAJA 5DCFA 2COMA 1B4AA 3L00A 1ZG5A 1QBJA 2FE3A 2H09A 5D5VB 2HQRA 3TOAA 3MZHA 3CUQC 2VOPA 3LQQA 3HRTA 1FC3A 5K1YA 1OR7A 2K4JA 2IVMA 4GXOA 4EMSA 4HOBA 1RIOH 2IP2A 2ADUA 4EJOA 1IN7A 1YW9A 3P9KA 1TQIA 1XDUA 3GLXA 2BV6A 3P7NA 1KQ0A 1FP1D 3LWFA 2WTEA 2DQRA 4O3MA 2A3SA 2Z3YA 3IKVA 3WU0A 4AD9A 3NQOA 1OPCA 5D5XB 1MKMA 1BC8C 4I09A 2UZKA 1EV7A 5CVUA 1G4DA 4IRIA 2F5FA 1Z6RA 2ZNZA 4KIBA 4PZJA 3U1DA 2J5OA 3R6SA 3HSEA 4KICA 1MZBA 1V4RA 2M5WA 4G7ZF 3JSPA 1SD4A 4A2UA 5JHUA 3J7AO 1K7AA 3V7SA 1HKQA 5F64A 3I58A 1F5TA 1IRFA 5K5OA 1XSDA 3M9AA 5EEHA 3WTWC 5LLQA 3M7GA 3I54A 3VB2A 1H0MA 3V7CA 2VOOA 2R7DA 4CXFA 3BPVA 1YQAA 4LMYA 3K9TA 2CG4A 3D0SA 5CVIA 3GW2A 1JGSA 1RZ4A 4JQFA 4XSXF 4TV7A 5HOOA 3LQRA 4L5JA 2QWWA 1KU9A 2VE8A 3FM3A 1XMKA 4MEXF 2HGCA 2QQBA 2VE9A 3DV8A 1T0FA 2FNPA 1QO0D 2FU4A 2HKXA 1BM9A 3ZMVA 3RTRA 3TQNA 4CZZA 1P92A 2EFWA 4ESFA 4I98B 1RUOA 1ON1A 4HAMA 2JSCA 2AS5F 3FF5A 2V1UA 3ZMDA 4P9UA 3E5UA 3F8CA 3V8KA 4LLNA 3G73A 1BI0A 4LLLA 3GFIA 5IT9K 5D5WB 2HYGD 4M73A 5E1XA 3Q5FA 1J5YA 1W5TA 1KYZA 4KMUX 3HSRA 2EV0A 4B8XA 4LB6B 4BNCA 2XAFA 3QP5A 1O3SA 1IAWA 3BOQA 3ZMTA 3ZMSA 3LAJA 4OMYA 3WE2A 1I1SA 3QAHA 4HQEA 3I71A 2EWNA 2STTA 4K2EA 1MD0A 2JPBA 2M45A 3BDDA 1UFMA 1ULYA 2O8XA 3O2PE 5J8FA 4LLGF 1IZ1A 1S29A 1RI7A 3C18A 4EGYA 2K4BA 2F5EA 5KVRA 2V6CA 5FFXA 2Z99A 3GXOA 2IRFG 2XVCA 3ABTA 4G94A 2XAQA 2FRHA 3SZPA 3ELKA 2RVCA 2FMYA 4F7ZA 2QM3A 2G7UA 3F8NA 3Q9SA 2LDUA 1G3YA 2MLGA 4L9NA 1MJBA 1ZRDA 2MH2A 3DEUA 1YIOA 1X3UA 3FXRA 3BROA 1XD7A 2UXNA 5HS9A 2PMHA 5DV5A 1R23A 4DQ2A 3ECHA 4AIHA 5LGNA 1HXDA 1MJ9A 4M6YA 3S2WA 3B73A 4EM2A 5BOXA 3L09A 3DF8A 1LDKB 3KEQA 1ONVA 2HOEA 3IRQA 2ISZA 1T39A 4G6QA 1R5HA 2DT5A 3K1MA 3MEXA 1I1GA 2QLZA 3EDPA 5HDGA 3Q9VA 1EH6A 1HQCA 3SXYA 3F21A 4PGHA 4N9HA 4BAYA 1Z91A 2WC2A 2A68F 2TDXA 1P4XA 1T2KA 2PEXA 4HZFA 1KQ9A 4Y17A 2RDPA 3ABUA 2DBBA 2XAGA 3W6JB 3F22A 3IWFA 1USTA 4HF1A 3V8LA 5FD6A 3COAC 4LJZF 3H3UA 1R1TA 2BYVE 4WXHA 1USSA 1JHHA 2WWYA 4U7BA 4A12A 4EM1A 3ROUA 1H9TA 2ESNA 3K1PA 2HYFA 3RKXA 4UV9A 4N0BA 4I7HA 4ZZDA 1ZREA 3KZYA 2VC0A 2V1XA 1XDSA 1IW7F 1ODDA 3ZQ7A 4G6DA 1FT9A 2KIMA 3GF2A 4KUMA 3QU6A 3WU1B 2MC3A 3IRRA 1ZG1A 2F2EA 5D8KB 3KP7A 4HX7A 1Y0UA 3KEOA 5F6FA 3FZVA 3GWZA 2G7HA 1SD6A 4G7OF 3O3KA 4WXDA 3HRMA 1LB2A 4BQAA 1YO5C 3QU3A 2P5VA 1H9GA 4ENKA 2MA3A 5FGMA 1K78B 4PCQA 1KGSA 5HLIA 4UVBA 1R7JA 3RKYA 1HKSA 4L0ZB 1J9IA 3HIFA 3JAMK 1S7AA 5FLXK 4GYIA 4KN4X 3J81Z 1L3LA 4RGRA 3SZTA 2HQNA 3RPQA 3GO5A 1DDNA 4P9FA 4BHCA 4YG2F 4HDVA 2GZWA 5BPDA 1OYYA 1LJ9A 2KIFA 4A0YA 2EK5A 3SQNA 2H6BA 2PQ8A 3F8MA 1ZRFA 3L7WA 5E8GA 5H6RA 2DO7A 4FX4A 2ZCWA 4LK0F 4AVPA 4YFNF 2R3SA 5FB2A 3O6BB 2IPQX 1E2XA 5E17F 2JPCA 2MBFA 3K69A 1UHWA 2PMUA 2W24A 3CJNA 3IWZA 3BPXA 3TGNA 3WTUC 4GGGA 5FD5A 5ICFA 4O6JA 3KLOA 1PUEE 2Z5UA 3IHUA 2B0LA 5D8LB 3DP7A 3VEPA 1W7PB 3E6MA 4ON0A 2QYOA 4ZYEA 2W85A 2LF8A 4HYEA 1HW5A 5LEJA 2GA2A 1WQ2A 1GXQA 1QNTA 2OBPA 2Z33A 5E1ZB 5JR3A 2VBYA 4EJUA 2H6CA 1YTYA 1WI9A 3DQVC 3TO7A 5DUKA 3KP5A 4HW0A 1TNSA 3B02A 1XGMA 2K86A 1GXPA 5E20A 4LGWA 1A04A 4U7DA 1PDNC 4M74A 4ETSA 4P55A 1K78A 1SD7A 1REPC 1U8RA 1Z7UA 3E3VA 2Z9OA 4Z2YA 4KNYA 2JRTA 3WGGA 3P9IA 2A69F 3KCCA 2DK5A 2RKHA 3HOTA 2FXAA 3LA2A 3ZMZA 3T1BA 1FP2A 4GYGA 1Z9CA 1B59A 3KFWX 1XN7A 2RNJA 1U6GA 1F4KA 5LRRA 4RAYA 4WF2A 1BI1A 3I59A 2A6HF 2WV0A 4GO1A 3ZP5A 2HS5A 2ZMEA 1TQMA 4LG0B 2Q0OA 1U5TA 1SD5A 1MGTA 2ISYA 2DPUA 2STWA 1SMTA 5IT3A 1XSXA 4I0BA 2P8TA 2V9VA 1F9NA 2FQ3A 5HS7A 1IUYA 4MQ9F 3IL2A 3WGHA 4YFXF 3WTYC 1XCBA 4Y15A 3JSOA 3ZMUA 3BJ6A 1ZYRF 1TQPA 1UHMA 2A5YB 2X0LA 2D1HA 3E6DA 3MFKA 1G3TA 4HA8A 3C3WA 1XB4A 3R4KA 3AAFA 5LEKA 2W84A 1IXCA 2QZ8A 4MQVA 4I0AA 4UXNA 3BP8A 2EFQA 2VN2A 5ICCA 3HHGA 4Y13A 4BXUA 2BGCA 4KIFA 2DPDA 4IRGA 5DD8A 4XSZF 1FYKA 1R22A 3F8BA 3R60A 3CLOA 3PFIA 2YX7A 4EV0A 5A2QZ 2L3DA 3V8JA 4HLXA 2VC1A 2KJBA 3LAPA 4LB5A 1WWXA 4RB1A 2CFXA 5D4SA 3U2RA 5DD4A 1V3FA 2V1DA 5LHHA 4EM0B 1QZYA 1ZLKA 1W5SA 4EJTA 3C7JA 1TTYA 2C6YA 1U5TC 1G3WA 1TLHB 3GFJA 2NNYA 4ZZLA 2ZMEB 3VODA 2HTJA 4Q48A 5DEQA 3TDUC 2QQ9A 5LHGA 5D6EA 1STZA 3RJPA 1HSJA 2CWEA 3JTHA 5IT9Z 1ZGJA 1FSHA 2GXBA 3OOPA 2OAZA 4M9SA 4KIGA 3WTVC 2QQAA 2EFPA 3KP6A 3FM5A 1FPQA 3TDZC 4IJAA 3GX4X 3QP6A 4RGSA 3DPTA 2OA4A 3KETA 1J7KA 3L9FA 3GFLA 4B09A 1R5GA 3GUDA 1I5ZA 4R79A 5L3GA 3J80K 5KK1A 2VBWA 3HSFA 2FEZA 1W4MA 2E7XA 2GA1A 5TJJA 2P5LC 3EETA 2BBYA 2CSOA 1L0OC 1Z05A 2EV5A 1IN6A 1JE8A 2VBZA 3ZPLA 5H20A 2PLYA 4ZH4F 4UVAA 1FBQA 2QBYA 4IRHA 4U88A 2VONA 3GZ6A 5AIPA 1UCRA 4KDPA 3CO7C 2VBXA 5ILVA 4WXCA 3JTGA 2ESHA 4DNCA 2NS0A 3LA3A 2H27A 2ZBKA 4HX4A 2PG4A 2L4MA 1SAXA 5ED4A 5ICGA 4EVIA 2GIVA 5JI6A 5DUIA 1XSVA 3JW4A 1U2WA 1TW2A 1GHCA 3WG9A 3I0TA 4S05A 1HSTA 2DAOA 4HV5A 2OZUA 2O6GE 3IKTA 2D45A 2LSOA 1CF7B 5LRSA 3M1EA 2IW5A 2AXLA 1GVJA 4FT8A 3RKWA 2HZTA 2PI0A 4KMFA 2F5CA 2R7FA 3WTTC 3HTSB 4CICA 3DPLC 4UV8A 2X4HA 2JTVA 2FOKA 4IF4A 3MAJA 3R0JA 5HDKA 1ZG3A 2O3FA 2BE5F 2O0YA 4JK1X 2HWVA 5DCMA 1J59A 1J75A 5LGUA 3FX3A 2ELHA 3T8TA 3R0AA 2XIGA 4RGXA 1ZRCA 2IT0A 2P6TA 4MEYF 1OMIA 3V4GA 2J5PA 2OQRA 2FMLA 3KP4A 5FO5A 1FX7A 2FBIA 2E1CA 2YX4A 2RGVA 4XLPF 2YU3A 3LA7A 4MTEA 2K02A 3K0LA 4IXAA 3GEZA 3FMQA 1QPMA 1C0WA 2K7LA 1KQ8A 4AIJA 4PGGA 2EJRA 5D6FA 3H3ZA 3K2ZA 2GQQA 1B9MA 1QZZA 1FYLA 1OYIA 3ERED 2OD5A 1J0RA 4KT5C 1BOAA 2OZ6A 2PFBA 5CJ9A 1Q1HA 4P5OA 5ILSA 3E6CC 3I64A 1ZARA 4U0WA 4L9VA 1Z1DA 1LDJA 2ACJA 2CYYA 4HDUA 4LG0A 3VFZA 2KIUA 1CGPA 4HLYA 2QUFA 1CF7A 2OU2A 1MDMB 1P6RA 2QENA 2EB7A 2CQKA 1ZGAA 4M71A 1FZPB 4U0VA 4HF0A 2XGXA 5L3EA 1SMYF 1IN5A 3ECOA 1JHFA 3M8FA 5J6XA 1XGSA 2ZJ2A 3T0YA 4IHTA 4ENNA 1D8JA 1NHAA 2LF7A 1O3QA 4LD5A 3HHHA 2ZO4A 4NQWA 2DTRA 1WKMA 3TKYA 4A5MA 3OV8A 5JVTA 1R36A 5TRDA 4NB5A 4I02A 4WX9A 3QPHA 3E6BA 2P5KA 5JFRA 1RUNA 2Y0MA 2A07F 1OKRA 1D8KA 4XLNF 2MD5A 4KA4A 3MQ0A 4MNUA 1IRGA 4L9JA 3FXQA 2KRFA 1YLFA 2GWRA 1TW3A 4BHBA 1HW1A 1XCVA 4RB2C 3C1DA 5L3DA 4WWCA 3F3XA 3KE2A 4Q47A 1YS7A 3HRSA 1B1BA 2O61A 3PQKA 3F8FA 1BC7C 1O7FA 1QGPA 5F1RA 1PP7U 2YSRA 1IN4A 4ZYDA 4S04A 1LEBA 1KYWA 5AIQA 3RPUA 1QQIA 2Q2EA 1FBSA 5BMZA 1ON2A 3TO9A 5J8CA 4LK1F 1ZLJA 3DFGA 2RN7A 5BQTA 1FSEA 1PP8F 5HVQC 1FWZA 3QPTA 3RYPA 3RYRA 1ZH5A 1MDMA 1OYWA 1KU7A
chains in the Genus database with same CATH superfamily
2BY1A 4RB0A 4GCVA 1KONA 3FMRA 2K27A 3K7AJ 1S8NA 4DW6A 5DCMB 3JRCA 2DMNA 1O57A 2FBHA 4ESBA 2V79A 2LH9A 5CYVA 2EA2A 1AOYA 3H36A 1QRYA 3BWGA 1TNTA 5F04A 2EFNA 3SEZA 3FXUA 1ZAOA 4YIFA 4L9TA 3Q3SA 4AYBA 3BR0A 3N4MA 2YR2A 2E71A 4OIRF 5E18F 4HV6A 1VZ0A 4ZDLA 5CPRB 4ENJA 2DT7B 3DBHB 1PVEA 4XLHA 3H3VK 4G6TB 1R6RA 3FDYA 3CUQA 1P2FA 3TW6A 4XQFA 3PIOF 1VTNC 2PJRB 1G6NA 1V55H 3CUQB 2LD5A 2XGCA 1FMWA 2H1KA 2P4WA 1R4NB 3JRGA 2MSYA 4G9YA 4RGUA 1YRNB 2R7UA 3L2CA 3PUFA 5LBQA 1IO2A 4UNOA 3IAS2 1YRNA 1X2NA 1LUJB 1YW7A 1T38A 1BR4A 3U9GA 4G7HF 3C2GA 2ZSHB 4I2OA 3ZQCA 1QA6A 3I53A 4AYBN 1DU0A 3PL8A 2K9QA 2VI6A 2EZKA 1MBJA 2ZXJA 3G71I 3HRUA 3JRIA 3HJEA 4E70A 5J4YA 1YE9A 2HXIA 2VQGA 3FIWA 3C2BA 1WJBA 3LSTA 3R61A 3ONQA 2HTSA 1LQ1A 2RC4A 4ZC3A 1UHSA 4E7ZA 4Y3OA 4IEJA 3GLLA 4AWXB 4E7IA 1D1BA 3OR2C 1R1VA 3GZ5A 2KL4A 5FKNA 3WGIA 4UHTA 4JBAA 1K6OA 3FMSA 3QOEA 3AG3H 1ZR4A 2E7WA 2JUCA 5KAFC 2V9PA 4ZYAA 2F48A 2FX0A 1I3AA 1S6LA 4OAYA 5CVRA 4QLCU 1K83J 2BW3A 4BYYA 4Q5SF 2VKDA 4PJJA 4CYDA 4OINF 1DPUA 2F4OB 4BDZA 2MLKA 2F4MB 5CVJA 3GFMA 3KZZA 3WTXC 2YPRA 4DJAA 3GTPJ 2DOAA 1R00A 2DW4A 2RNGA 1XGNA 3NRVA 1WRJA 3OYMA 2P7CB 4BHPA 4IHSA 2LKXA 5J1RA 3OYBA 2IA0A 2CO5A 1BOBA 3E97A 4XRFA 4BGDA 3ISPA 4BQNA 3OL3A 4WK8F 1IXSB 4A6EA 3WTSC 2G9WA 2GBYA 1FLIA 4A6DA 3HGYA 2F4IA 3D5LA 5M3FJ 2IA2A 3WE3A 3BY6A 4XL9A 2UUZA 1KU2A 5ICEA 5B5EC 2ZMEC 2FF4A 3BQZA 1K79A 1LNWA 2X6OA 2XRNA 4B43A 2W57A 3S8PA 5FROA 4M6XA 5J47A 1U5TB 2MD0A 1G3SA 3OL4A 4A0XA 5DM7F 4M72A 1JJ8C 1XGOA 1HBXG 4BH9A 2HKOA 1ZGWA 1T0FC 1A31A 2ZXHA 2LTPA 2Y30A 2ZFUA 2EZHA 2XGDA 1F1ZA 2D1VA 4IVNA 4MHGA 3ZN0A 5FLXZ 4XORA 3ZGKA 4NHJA 5E3MA 3G2BA 3RI4A 3SDGA 2A61A 2BXYA 1LVAA 4MTDA 2KKOA 4ESJA 1BR1A 2HFHA 3M8EA 5D5UB 2JA7J 4IPAA 3RDIA 2BHZA 1BJZA 3F6OA 2BVLA 1Z21A 5LHIA 3CMMA 4V2FA 4H4KC 1X19A 2L01A 4ZDPA 1Y1WJ 4PFPA 1VNDA 2EFOA 1V5EA 4EEFG 1ZN2A 5ILUA 1O3TA 4XIDA 1IGNA 1WSUA 1W7PD 2P7VB 4A3CJ 2BEOA 1VQPI 3QYEA 2NYXA 1QU3A 5J40A 3LSRA 4L18B 2L54A 3MKLA 1OCOH 1TL8A 1E3PA 1LEAA 3VOEA 2RREA 3REOA 2NRAC 1Y8RB 4B47A 3F6VA 1YG2A 2EZIA 2EBIA 5GADJ 2DFFA 2NNNA 5FKOA 3CTAA 2IEKA 3L2VA 2CGPA 1S3JA 2H94A 4RB3C 3I55I 2UXXA 3K1NA 2HI3A 4EJVA 4CGZA 4F93B 3SHFA 4A0ZA 1D5YA 2XUBA 3S1QJ 4R8HA 2DLLA 1H8AC 3GYHX 4FHTA 4NC8A 2XPVA 2ZKZA 4BUPA 4RBOA 1MBKA 3HOXJ 4J00A 1D5VA 2ZNYA 1BBYA 2UV1A 3BJOA 3I4PA 4YIIA 4N4NB 4BJ6C 3JRAA 3AG4H 2D2WA 1IUFA 1SFXA 3N97A 2MFZA 3ML6A 2M4KA 1YFHA 1OJLA 3F72A 5D4RA 2DYSH 1RPWA 4HQMA 2PMZA 3H92A 2UWMA 1NK2P 1MSFC 1TT0A 1WH5A 3CCVI 2DU9A 5AONA 2HEOA 4LG3A 3E5XA 4OIQF 3HYIA 4II3A 4CCJA 5FKLA 1QHGA 1NG6A 2Y0SN 3DKYA 5E8IA 3DXJF 3LFKA 2DFIA 3HXLA 2M4GA 3IC7A 2K9MA 3HUGA 2BHYA 1Z6TA 4PJ0C 1R1UA 4R1HA 2DI3A 1ZKGA 3S3MA 1YW8A 4XKVA 4XM3A 1I3QJ 1TP4A 3T5XA 2Q8KA 2RQPA 4G8XA 5DDGA 2IBDA 4KFCA 5FKMA 1O4XA 1OCPA 1WZ2A 3SFZA 1MBEA 3MCZA 2EIKH 2L02A 3KLNA 3HOSA 2O03A 3FHZA 1SFUA 1DP7P 4UVCA 1WFXA 2X1CA 4RAGA 2LBFB 5K5QA 3ZR8X 5GAGJ 1IN8A 1YX5A 1NG7A 2ID6A 3LFUA 5EEAA 4KN7X 3WTZA 1BI2A 3D1NI 1JKQC 2VKVA 1A35A 1TWHJ 4FE7A 1N25A 2H8WA 3ZN1A 2QGUA 5L3FA 1GV5A 2VT2A 3BR2A 3RIRA 5F0HA 2NVXJ 2RAEA 3I5UA 4RAZA 5HLGA 5J4VA 4A3IJ 5EEGA 2R92J 3NEUA 2HDWA 4L5IA 1E17A 3NWTA 2VKEA 2VODA 2NS7A 5H2FC 3L2UA 4HSRA 1IF1A 3BJAA 3BCBA 2A6TA 5FFZA 5IYDJ 4FTHA 3GVAA 2L4AA 3WODF 2W00A 3PNYA 4YEJA 2HDCA 2W25A 1ORKA 4HRIA 4HX8A 2M7AA 2XV4S 2FNAA 2FSWA 1SC7A 4BJTA 3PQJA 1EH7A 2EV6A 2KRCA 4N9IA 4PDKA 3V42A 5CLSA 2O8KA 3EYYA 1TWCJ 4CDGA 1O3RA 2XROA 2XDVA 2HR3A 4FX0A 3DU6A 1ETOA 3DKWA 1FOYA 2LRDA 4DZJA 4OU0A 4Q4ZF 3EYIA 4DBRA 1B6AA 3EUHA 5CVVA 2AXTC 2ZSIB 2K3FA 1KZHA 2KJCA 2JMWA 1ACIA 1TWFJ 3CUOA 5HDNA 3HG9A 4B3AA 3DCFA 2WY7Q 1ZHFA 3MKZA 1EH8A 3BQYA 2FBKA 5L3CA 4B48A 1NK3P 1DUXC 3V7RA 4XNFA 1GVDA 2QBYB 3M1CA 3F23A 1TZLA 1MSEC 4U0YA 4UUVA 2CQ7A 2VXZA 1GUUA 1U3EM 2XKOA 1I6HJ 4DZPA 3H9QA 1APLC 1NH3A 3DLAA 1Z3YA 2QVOA 5GAHJ 2R7WA 3SJMA 1EF4A 4ENMA 3LNQA 5B3SH 1XG1A 1RNLA 2X1EA 2ZFWA 3GBGA 4OMZA 2HPMA 3BG5A 3BZ6A 2K85A 3CDHA 2EA4A 2LNBA 5H6QA 1FY7A 3SEQA 1Y1VJ 1TBXA 4M9ZA 1IXRC 2WB1N 2ZJQF 3PM1A 1SVOA 5BS6A 3CCYA 3TO6A 3OYEA 1JXSA 3I9V2 4EGZA 3DWLE 4MGRA 1UB9A 2FA5A 2LG4A 2P6SA 2VXDA 2DXIA 4IZZA 1R58A 4A5NA 1BIBA 1A5JA 4CO8A 4XRSG 4XONA 5EF6A 3I59B 5BPIA 4OOIA 4ASNA 5K7ZA 1I27A 4ZYHA 3LOCA 1FIAA 2QCOA 2XASA 2R7SA 4P96A 1MH3A 3OY9A 4O5VA 3K70C 3BLYA 4NDLA 4U87A 2CQNA 4XBFA 3FHNA 2PJPA 2WAEA 4ABZA 1UZCA 2VASA 4HNTA 3ZQIA 1S7OA 2R7OA 6PAXA 2HYJA 2IS4A 3OYFA 3D5RC 1FOKA 2IA1A 5A2QK 1FYMA 2OQGA 4Z6YA 1FNNA 2WAFA 3PSIA 3ULQB 4YFKF 1AKHB 2R93J 4Y4RA 3VYTB 3ZCOA 1MJAA 1W7PA 2M87A 5J3LA 4EQQA 1D3YA 2PBIA 5ERIA 3MWMA 5K5RA 5IYCJ 4H0EA 1KA8A 3J80Z 1TWGJ 2Y75A 2Z16A 1ETQA 3HTUA 1J2XA 1RC9A 4EJWA 2ZJRF 5HLHA 4RS8A 4DBQA 4A3KJ 5IP6A 2OJED 2HVQA 2XB0X 2DQLA 4QWQA 2F5DA 1ZELA 1TC3C 2VPLA 1SFEA 1S7EA 1U78A 2CUEA 4X1EA 3HOYJ 3HB9A 1EJ9A 5HS8A 1HCRA 3BTCA 3I56I 1LDDA 2EZLA 4KT6A 4BE1A 3KP3A 1DPRA 1HDDC 1ETYA 3E5QA 3BG7A 1U9NA 3HKZN 4ZYGA 4CHUA 1LFBA 1T98A 1RKWA 1VQ4I 3QRFF 2QF7A 2DODA 2M0CA 1A6QA 3PJRA 3QWLA 1HC8A 1XMAA 2XGEA 1JT0A 1BIAA 4HBLA 5L3BA 4D0PA 1ENHA 3KP2A 4V19K 3CCJI 1YS6A 2L9SA 2X6XA 3CO6C 2M9HA 4UUTA 1YJ9I 1BJAA 4PFOA 4RLQA 2CW0F 1QZEA 2L2OA 3G3ZA 4YELA 4WCGA 2JZYA 2GXGA 1RETA 4OIOF 2M8EA 1D0YA 2LKPA 3QYBA 2RV8A 5LGTA 3GCMA 2XF6A 4UB8C 2E60A 5TGTA 1YYVA 1TT5B 4GDFA 1FBUA 2NAZA 2LKSA 3P9CA 4LITA 1B9NA 2WV1A 3DTIA 1K4SA 4KYWA 1E3HA 4I01A 1T6SA 3TOBA 3CP8A 2G0EA 1XS9A 3EQLF 2E35A 2VT3A 2AQEA 2DJIA 2M30A 2V26A 2PN6A 3FWEA 5F0CA 3K4JA 3ABLH 1HW2A 2XHKA 1P4WA 1HF0A 1I6XA 1XMXA 2DK8A 3CDLA 5DS9A 1Z3XA 4C2TA 2Q2EB 2Y48A 1LPQA 4L0YB 2KZGA 1V5GA 4E7LA 2M3AA 1OR7C 1X3ZB 2CV1A 4RLFA 1HKTA 2E1NA 2ZB9A 5E1WA 4FISA 1O7LA 4QPOA 3J81K 2IGOA 2CS3A 1W1WE 4E7JA 1BN5A 1AWCA 3QOPA 3OOUA 2FJ1A 4AIKA 3K4NA 1PJRA 3T8RA 3JAMZ 5C4JJ 2JT1A 4M9XA 2CW8A 3KYDB 2BY2A 2M1BA 3K6GA 2DMTA 3FKIJ 1BI3A 1VQ5I 1S9HA 2XPWA 1BW6A 2W82A 3BCAA 4PUSA 1KU3A 2IJLA 3W6KB 2O7OA 2A6EF 5E3LA 3MZYA 2XAHA 4LFUA 5DYMA 4HF2A 4KJZA 3AG1H 2XKPA 4RM3A 2ETHA 1P4AA 2MH9A 1WJEA 2GAUA 4OIPF 2XAJA 5DCFA 3TMOA 3CF2A 3CD6I 2COMA 1B4AA 3L00A 4RM2A 1ZG5A 2OCCH 3NARA 3DBLB 2L9NA 1QBJA 2FE3A 1I39A 3OMYA 5C44J 2H09A 4NQWB 3MKYB 5D5VB 2HQRA 3TOAA 3MZHA 1X1DA 2NOGA 3CUQC 2VOPA 3LQQA 3HRTA 1FC3A 4Y7NJ 5K1YA 1OR7A 2K4JA 4AIDA 2IVMA 4GXOA 1HDPA 4M3FA 3JRFA 4HSTA 4EMSA 4HOBA 1RIOH 2IP2A 3O8GA 2ADUA 4EJOA 4A3FJ 2DMQA 1IN7A 2ECBA 1YW9A 3P9KA 1QVUA 1X1CA 2QSFX 1TQIA 1VI0A 2L7MP 1XDUA 3GLXA 1E0EA 2BV6A 3P7NA 1KQ0A 1FP1D 4D7NA 4BJ5C 4CYCB 3LWFA 2WTEA 4MLOA 4B4CA 2DQRA 3GTMJ 4O3MA 3TP0A 2A3SA 2CQQA 2L0KA 3HM5A 2DA6A 2Z3YA 3IKVA 3WU0A 4AD9A 3NQOA 1OPCA 1Q1VA 5D5XB 1LFPA 1MKMA 1BC8C 4I09A 2UZKA 2I10A 1EV7A 5CVUA 1G4DA 3OYDA 4IRIA 3PUBA 3A0BC 3ZRGA 2F5FA 1Z6RA 2ZNZA 4JX6A 2L9RA 2KMUA 4KIBA 4PZJA 3U1DA 2J5OA 4XRMA 1IG7A 3R6SA 3L2RA 4A93J 1AHDP 2KFDA 2DFHA 3HSEA 3JRBA 4KICA 1MZBA 3EPZA 2Y9YA 4NUBA 1V4RA 2M5WA 4G7ZF 3H9JA 3JSPA 1SD4A 2QSGX 5J1YA 4A2UA 3A02A 1P9QC 5JHUA 2QQ8A 4XN0A 3OIOA 3J7AO 1K7AA 3V7SA 1G59A 1HKQA 5F64A 3I58A 1F5TA 1IRFA 5K5OA 1PUFB 3QODA 3MMYB 4IL6C 1XSDA 2WAQA 1UELB 3M9AA 5EEHA 2BZTA 3WTWC 3IH3A 1W0TA 3LSHA 4RB1A 3BR3A 3M7GA 5LLQA 4A3GJ 3I54A 3P5JA 3VB2A 1H0MA 3V7CA 2VOOA 3B6AA 3BG9A 4DYQA 2K9NA 2KZVA 4LOCA 2CFOA 1JTYA 2K3PA 2WB1A 1IDYA 2R7DA 3W3CA 4CXFA 3BPVA 1YQAA 4IOAF 4LMYA 3ASNH 3K9TA 4RA2A 2CG4A 2VJJA 1DU6A 3D0SA 5CVIA 3K4CA 1ZQ3P 3GW2A 2FQ4A 1OFCX 2KHMA 1JGSA 1RZ4A 4JQFA 4XSXF 5IP7J 2HVRA 4TV7A 5CQEA 2XSDC 1RR7A 3LSKA 2ZXIA 5HOOA 3LQRA 4L5JA 4XKBA 4CUGA 3IAM2 3Q0UA 2R7ZJ 2BVMA 5C3EJ 1W0UA 2QWWA 3K4KA 3IV5A 1KU9A 1RESA 4FE4A 5IY5H 4JYKA 2CUZA 4M3EA 2VE8A 3DLLF 3RSNA 2NVUB 3H5AA 3CP2A 5JLWA 3FM3A 2QSHX 1XMKA 4MEXF 2HGCA 4C9YA 4NC7A 4RAFA 1OCCH 5B1BH 3W2VA 2QQBA 2VE9A 1E3OC 2HZDA 3H5RA 1FMVA 3S3OA 3DBRB 3VSKA 1R5ID 1OCRH 4BQOA 3ABMH 3DV8A 2JSPA 1T0FA 3WHBA 2FNPA 4N4OB 4HNVA 2W48A 1QO0D 3H9GA 2FU4A 2JK3A 2HKXA 1BM9A 1GV2A 3ZMVA 3RTRA 3TQNA 3CC4I 4CZZA 5K7FA 2HU9A 4F91B 1B8IA 1P92A 2EFWA 4ESFA 1LKXA 4I98B 4CYCA 1IV6A 1RUOA 1ON1A 4HAMA 2KRHA 5F0FA 2JSCA 2AS5F 3FF5A 2V1UA 5EGOA 3ZMDA 3GZNB 2E1MC 3A2KA 2FUG2 4P9UA 1OQYA 1D0XA 3ZOBA 1H89C 1U9OA 1VQ8I 3E5UA 3F8CA 1G8XA 3KPHA 3V8KA 3JRDA 4LLNA 5IOZA 3G73A 1BI0A 4LLLA 3GFIA 3G1MA 3E7LA 1D1AA 2CUJA 5IT9K 4M73A 2HYGD 5E1XA 5D5WB 1MBGA 3Q5FA 1J5YA 1H88C 1XTAA 2LYCA 1W5TA 2I8DA 1KYZA 4KMUX 1MIJA 5FJ8J 3HSRA 2VJIA 2EV0A 2K9SA 4B8XA 4LB6B 5TISC 4BNCA 2XAFA 3QP5A 3OYIA 1O3SA 5HLTA 1IAWA 5DM6F 1MMDA 3BOQA 3CMAI 3ZMTA 5K7HA 3S2DJ 3ZMSA 3LAJA 3CCUI 2E2HJ 4OMYA 3OS0A 1V5FA 2R5ZB 1W36C 3WE2A 3BR5A 4BE0A 1I1SA 2EIJH 3QAHA 1QVTA 3K2AA 4HQEA 3I71A 2EWNA 2X1DA 1IC8A 2STTA 4K2EA 1MD0A 2JPBA 4BXXJ 2M45A 2VB6A 3BT9A 4AVZA 4F3QA 3LSMA 2R7VA 1XC5A 3BDDA 1UFMA 1ULYA 2O8XA 3BZKA 3O2PE 4HG2A 5J8FA 4LLGF 1IZ1A 5KAIC 3KIOA 2K9LA 2V4JC 2LVSA 1S29A 1JGGA 1OCZH 2ZXWH 1RI7A 2HVSA 2A05A 3C18A 1UG0A 1LFUP 4EGYA 2K4BA 2F5EA 2HQ5A 5KVRA 2V6CA 5FFXA 5M5XJ 2Z99A 3GXOA 1FOWA 1WH7A 2CU7A 2IRFG 3BG3A 2LC2A 2XVCA 2LFBA 2KISA 3ABTA 4BY1J 4G94A 2XAQA 2FRHA 1DP3A 3SZPA 3ELKA 4YRVA 3PFYA 3ZQLA 2LP0A 2RVCA 2LK2A 2WADA 2FMYA 4UB6C 3VYUB 4A3MJ 2OUMA 5M5YJ 2KIQA 4F7ZA 1W36D 2QM3A 2G7UA 3F8NA 3Q9SA 2LDUA 1G3YA 2M0MA 2MLGA 4NBQA 3IH2A 4L9NA 1MJBA 1ZRDA 2MH2A 5GPCA 3DEUA 3AFHA 3TP3A 1YIOA 3HKZA 5C4XJ 1X3UA 3FXRA 3BROA 1XD7A 2MC4A 2UXNA 5HS9A 2PMHA 5DV5A 1R23A 3A4CA 4CCKA 4DQ2A 3ECHA 2Y9ZA 4AIHA 5LGNA 1RKTA 1R49A 3VYSB 1HXDA 1MJ9A 1X1BA 5E3OA 3ZQGA 4AC0A 3G6EI 1T08B 1RR8C 1S5LC 4M6YA 3S2WA 3B73A 4EM2A 2JA5J 4DIQA 5BOXA 3DKXA 3MZ8A 3L09A 3DF8A 1LDKB 4IKFA 4Y52J 2DT6A 2E2IJ 1U8BA 4BY7J 3CF5F 1K4TA 2DA3A 3KEQA 1ONVA 3CCEI 2HOEA 3IRQA 2ISZA 1T39A 1JUSA 4G6QA 1R5HA 3CJRB 3GTJJ 2DT5A 3K1MA 3MEXA 4M3GA 1A6IA 1I1GA 2FOWA 2DFEA 2QLZA 3EDPA 5HDGA 2HNHA 2ZC2A 2PX9A 3SZGA 3Q9VA 3K70D 9ANTA 2LLKA 1EH6A 1HQCA 1Y8QB 1X58A 3BTIA 3SXYA 4FASD 3F21A 4PGHA 1Y6IA 3CCSI 2DA4A 5B66C 1IDZA 4CCOA 4N9HA 3UNGC 4BAYA 1Z91A 3OR1C 3BTJA 3FXOA 5FLVA 4B3XA 1N78A 3OYNA 1MH4A 1WPKA 2DA1A 2WC2A 1IRZA 4MFEA 1X1AA 2A68F 2GXAA 4C2UA 2TDXA 1P4XA 1T2KA 3S93A 2PEXA 4GRIA 4HZFA 1KQ9A 1HOMA 3EUAA 2P0WA 4Y17A 4ZJZA 2RDPA 3ABUA 2DBBA 2XAGA 3W6JB 3F22A 3IWFA 4M6VA 1USTA 3RPUD 2X85A 2IXSA 1BL0A 2HOAA 1EA3A 2NVQJ 2YUSA 4HF1A 3V8LA 1JUMA 3EUHC 5FD6A 3COAC 4LJZF 2GM4A 3ESWB 3H3UA 1R1TA 2JJ7A 2MYSA 2BYVE 1Y0NA 4WXHA 4IHXA 1VQOI 3FKJA 1USSA 1JHHA 2KPMA 1DQUA 3C2HA 2WWYA 3AL0C 1FEXA 4U7BA 4A12A 4EATA 2ZJPF 1S72I 4GFBA 4EM1A 2V7FA 3ROUA 2BOLA 2MG4A 3S1NJ 2XB5A 1H9TA 2ESNA 3K1PA 2HYFA 4PSXA 1Z77A 1YI2I 2NS8A 3RKXA 3OYCA 4UV9A 4N0BA 4I7HA 4ZZDA 1J09A 4XLEA 4CCNA 1ZREA 4M3DA 3KZYA 2VC0A 1B72A 2V1XA 2X48A 1XDSA 1IW7F 1ODDA 1HLVA 2F6CA 3CMYA 3ZQ7A 1LE8A 4G6DA 1FT9A 2KIMA 2IAIA 3GF2A 4KUMA 5BNGA 1VQMI 3DTKA 3QU6A 2E5NA 1M1EB 2OTJI 4V2GA 3TEDA 3K10A 2HQAA 4BBSJ 3WU1B 2MC3A 3IRRA 3CCQI 1ZG1A 4D5CA 2F2EA 2V9KA 2X6WA 5D8KB 3KP7A 4J01A 4HX7A 4A3JJ 1Y0UA 3S16J 3KEOA 1WJAA 5F6FA 3FZVA 1AA7A 2V6EA 3GWZA 2G7HA 1SD6A 3GMEA 2H8RA 1SANA 3S1RJ 4G7OF 3O3KA 1IV8A 1G2HA 5CQGA 1SEUA 1VQ7I 4A3DJ 4WXDA 3CJTB 3HRMA 1LB2A 1WGXA 3CMEI 4BQAA 1YO5C 3QU3A 4ANJA 2P5VA 4XLAA 5CKTA 2KQRA 2B7EA 2LREA 1H9GA 4D1QA 3HPHA 4ENKA 2MA3A 5FGMA 1K78B 4PCQA 1KGSA 4XOTA 5HLIA 4AUXA 3EUKL 4UVBA 1R7JA 3RKYA 1HKSA 4CCMA 1XX5A 4L0ZB 2H1LA 3W6VA 1J9IA 2MW8A 4IQ4A 3HIFA 1WI3A 3JAMK 2IS1A 1R71A 1S7AA 5FLXK 2M8GX 4GYIA 4KN4X 3BTLA 3HOZJ 4F92B 3J81Z 2E34A 2R4GA 1L3LA 4RGRA 1VF9A 3SZTA 1ITYA 1UMQA 2AHQA 2HQNA 1ZTRA 3RPQA 3GO5A 1DDNA 3FK7A 4P9FA 4BHCA 3HGGA 2VKHA 1EKEA 4PSWA 2Z1DA 1HA8A 4YG2F 4HDVA 3RKQA 2QKMB 2GZWA 1ETWA 2K40A 2CV2A 2XSJC 4A69C 5BPDA 1OYYA 1BR2A 1LJ9A 2KIFA 5KNLA 5IOYA 5EG0B 2BW3B 2DN0A 4A0YA 2EK5A 5FLMJ 3SQNA 3OS2A 1DGRM 2H6BA 3F8MA 2PQ8A 1ZRFA 2OTLI 4C3HJ 3L7WA 2R7RA 1TWAJ 5E8GA 3GTLJ 1UAAA 5H6RA 3J7YJ 1JTXA 2CRGA 2DO7A 3A0HC 4FX4A 2ZCWA 4LK0F 3RQIA 4PJMA 3BC8A 1P7IA 4AVPA 3VWBA 4YFNF 2I5UA 2R3SA 5FB2A 3O6BB 2IPQX 2NVTJ 1JJ6C 1POGA 1YITI 3HOUJ 1E2XA 5E17F 1MW7A 2JPCA 4W97A 2MBFA 2B63J 1GLNA 1U0JA 1UHWA 3K69A 2PMUA 2W24A 3CJNA 4DYCA 3IWZA 3BPXA 5HODA 4D7MA 4E7KA 3TGNA 5EDNA 3WTUC 3QPSA 4GGGA 5FD5A 5ICFA 4O6JA 3KLOA 1PUEE 2Z5UA 3IHUA 2B0LA 5D8LB 2JN6A 3DP7A 2DDAA 3VEPA 1W7PB 3E6MA 3QQAA 4ON0A 2QA4I 1X1PA 4F52A 2QYOA 4ZYEA 2W85A 2OPTA 2M7BA 2PJRA 3S1MJ 4C30A 5IPAA 3HOVJ 2RQQA 3JREA 3CESA 2LF8A 4HYEA 1HW5A 1YJNI 2IGKA 5LEJA 1QPIA 3HPGA 4A3EJ 1BA5A 3K4LA 2GA2A 1FTZA 1WQ2A 1GXQA 2KDOA 2EILH 1JI8A 2OBPA 1QNTA 2GOMA 2GIZA 5E1ZB 5KCMA 2Z33A 5DTDA 5JR3A 3OYAA 4BEHA 2VBYA 4EJUA 2H6CA 1YTYA 1WI9A 2DYRH 3DQVC 3TO7A 2R5YB 5DUKA 5EGOB 3KP5A 2DTZA 4HW0A 1TNSA 3B02A 5EZHA 1XGMA 2R5YA 2K86A 1GXPA 5E20A 4LGWA 3CJQB 1A04A 5F27A 4U7DA 3OWTA 4BQQA 1PDNC 4M74A 3VPRA 4ETSA 3CLQA 5LD2C 4P55A 3JRHA 3I3LA 2DOEA 3BZCA 1K78A 1SD7A 1REPC 1U8RA 4CA0A 4W1UA 1R9TJ 1Z7UA 3BG6A 3E3VA 2Z9OA 3WHCA 4Z2YA 1SVLA 1ERDA 2ICWG 4KNYA 2JRTA 3WGGA 1IJWC 3P9IA 4A3BJ 2A69F 3H0DA 2M2EA 3KCCA 3HDDA 2DK5A 3MVPA 3AKZA 3PNTA 2RKHA 3HOTA 2FXAA 3J7AY 3LA2A 2W4SA 1MNEA 4XRSA 4X0GA 3ZMZA 3T1BA 3LSIA 2YS9A 1FP2A 5M5WJ 4G12A 2B9SA 3A03A 4GYGA 1Z9CA 1B59A 3KFWX 1JT6A 4KITB 5M3MJ 1XN7A 3S17J 1FOXA 1ZK8A 2RNJA 4E4HA 5E79C 1U6GA 2EIMH 1F4KA 5LRRA 5J1UA 4RAYA 4QTRA 4IQJA 4WF2A 3JR9A 4AM3A 1BI1A 1UG2A 3I59A 2A6HF 2WV0A 4GO1A 1Z0XA 2HOTA 3J7ZI 3OYLA 2HS5A 2TRTA 2ZMEA 4C3IJ 3ZP5A 1TQMA 3HEFA 2XC7A 2Q0OA 4LG0B 4X6AJ 2ME0A 4IHYA 1U5TA 2ELJA 4I6ZA 1SD5A 1NTCA 1FTTA 1MGTA 5JLXA 2ISYA 3GTKJ 2DPUA 2STWA 3CC7I 1F43A 1SMTA 5IT3A 1XSXA 2NVYJ 4D5FA 4I0BA 4XR6A 2P8TA 2V9VA 2BXZA 3W2WA 3DTEA 1F9NA 2FQ3A 2O9LA 3LSGA 5HS7A 1IUYA 2VQLA 4MQ9F 3IL2A 3WGHA 4YFXF 3WTYC 1XCBA 1LE8B 4Y15A 3VYRB 3JSOA 4D9JA 4XKCA 2R7TA 4BS9A 3ZMUA 4PJNA 3BJ6A 5LFAA 3IUOA 3W2AA 1ZYRF 1YHQI 4E7HA 5FKKA 1K6YA 1TQPA 1UHMA 4XICA 3MD2A 2A5YB 1WJDA 3LSJA 2X0LA 2D1HA 3E6DA 4UUSB 1G3TA 3MFKA 4HA8A 3C3WA 1XB4A 3R4KA 4AU7A 2EQRA 3QYFA 3DU5A 2IGMA 5GP9A 3AAFA 2M34A 1JUPA 5LEKA 2VJ4A 2W84A 3OYKA 2LY2A 2NXNB 3TL4X 1IXCA 3H35A 3S2HJ 2QZ8A 4L5EA 4MQVA 4I0AA 1B8IB 4UXNA 5F1JA 3N05A 3BP8A 3S14J 4IO9F 1D0ZA 2EFQA 2VN2A 1IRXA 5ICCA 3HHGA 3LL7A 1ETXA 4Y13A 2Y0SA 2BGCA 4MIMA 4BXUA 4KIFA 4XMYA 2TCTA 3IP4B 4IRGA 2DPDA 2X9DA 3I4NJ 1PYVA 5DD8A 4IX7A 4I99C 4XSZF 1FYKA 1SFKA 1R22A 2KLOA 3CQZJ 3F8BA 3R60A 3CLOA 2R7QA 3PFIA 4IHVA 4BXFA 2YX7A 4EV0A 5A2QZ 1YJWI 2L3DA 3V8JA 1VQLI 4HLXA 2VC1A 2KJBA 2L9VA 3LAPA 3L2QA 2R0QC 2HOSA 4LB5A 5EJCA 1WWXA 5KHDA 4CSWA 2CFXA 2VIXA 5D4SA 3H0GJ 3U2RA 2CH0A 1OISA 5DD4A 2CJJA 5B1AH 1V3FA 2V1DA 5LHHA 4EM0B 4ZTFA 1D1CA 1QZYA 1ZLKA 2LY9A 2HPIA 3UKGA 1W5SA 5E3NA 4EJTA 3C7JA 1TTYA 3HBLA 2C6YA 2OF7A 1U5TC 3PNVA 1G3WA 2JQ7A 1TLHB 3GFJA 2NNYA 3S15J 4ZZLA 1JKPC 2ZMEB 3VODA 1PUFA 3S3NA 1VFCA 2HTJA 4Q48A 5DEQA 1LVKA 3TDUC 3HUGB 2QQ9A 2GLOA 4DGWB 4FCYA 5LHGA 3QPLA 4LIVA 5D6EA 1STZA 1X2MA 2F5VA 4JX4A 4BBRJ 3RJPA 2XAUA 3MKWB 1HSJA 2CWEA 1MBFA 4BU2A 3JTHA 2COBA 5IT9Z 1ZGJA 1FSHA 2GXBA 2DOFA 3OOPA 5GAEJ 2OAZA 4B44A 2VUMJ 3ASOH 4M9SA 1GT0C 4KIGA 3WTVC 2QQAA 4ITVA 2EFPA 4QSHA 2XPUA 1ETVA 3KP6A 3FM5A 1FPQA 2XRLA 3G1OA 3TDZC 3ZXSA 3KYLA 5GTHC 4PK4A 1AKHA 4XK4A 4IHWA 4II2A 4IJAA 2LBFA 2WAQN 3L2WA 3GX4X 3A01B 3QP6A 2VPRA 3M8JA 4RGSA 3DPTA 2OA4A 1T8IA 3KETA 2DCEA 1J7KA 1V54H 3L9FA 3GFLA 4B09A 5EYRA 3OYGA 1R5GA 3ERMA 2FD5A 1T56A 3GUDA 4MO7A 1I5ZA 4R79A 5L3GA 1T33A 4BACA 3J80K 5KK1A 2VBWA 1MBHA 4BEHB 1WJ5A 3AG2H 3HSFA 2FEZA 1W4MA 2E7XA 2GA1A 5TJJA 2P5LC 4NC6A 1SFOJ 3EETA 4KISA 2BBYA 2CSOA 1L0OC 1Z05A 2EV5A 1IN6A 1JE8A 2EINH 3HOWJ 2A5WA 2JA6J 4QPQA 2VBZA 4DYRA 3ZPLA 1MNMC 3PO3J 3HL2A 3FXKA 3KZIC 5H20A 2PLYA 2OV7A 3CC2I 3IH4A 4ZH4F 4XOPA 2EPFA 2CMPA 4UVAA 3S32A 1FBQA 2QBYA 3SDBA 2X6YA 4IRHA 4U88A 2VONA 3GZ6A 5AIPA 1UCRA 3FXLA 2ID3A 4KDPA 1R4MB 3CO7C 2VBXA 2QEXI 2Z2SB 3KX2A 4CH7A 2JA8J 5ILVA 5HNFA 5JVGF 2R5ZA 4WXCA 3JTGA 4I76A 2ESHA 3MN2A 4DNCA 2KDZA 2NS0A 1WJCA 3LA3A 2H27A 2ZBKA 4HX4A 2PG4A 5IP9J 4F55A 2L4MA 1X3WB 2VLAA 1VQ9I 4LIUA 1SAXA 3WU2C 2AO9A 5ED4A 2XF5A 5ICGA 5EG0A 4EVIA 1WHUA 2GIVA 2HXOA 1Y39A 5JI6A 1WVRA 1F36A 5DUIA 1MMSA 1XSVA 3JW4A 1U2WA 4E6KG 1TW2A 2XF7A 2CV0A 1GHCA 2WA0A 3WG9A 1YX3A 2JRMA 2E5ZA 3BR1A 4BDYA 3I0TA 4S05A 1HSTA 1T95A 2DAOA 5F08A 4HV5A 4QIWN 3I4MJ 2OZUA 3O8HA 2O6GE 3IKTA 2E19A 3FBNB 2D45A 2LSOA 4HNUA 1CF7B 2JWTA 5LRSA 3M1EA 2LR8A 1UJ8A 3DPUA 1X4OA 2E1MB 2IW5A 3H5NA 2AXLA 1GVJA 4FT8A 3WG7H 1JKOC 3RKWA 2HZTA 2V1NA 2PI0A 4KMFA 1MMGA 2F5CA 3CZ6A 4JOMA 2R7FA 3WTTC 3HTSB 3NAUA 1B72B 4CICA 3DPLC 4UV8A 2X4HA 2JTVA 2FOKA 4IF4A 3MAJA 3R0JA 5HDKA 1ZG3A 2Y69H 2O3FA 2BE5F 2O0YA 3M3YJ 4JK1X 2HWVA 5DCMA 1X4PA 1J59A 1J75A 5LGUA 4Y33A 4A3LJ 4XKWA 4P1WA 3FX3A 4RDUA 3HZJA 5JHFA 3A01A 1P7JA 3PO2J 2KP6A 2L5QA 2ELHA 2LY1A 3T8TA 2CQXA 3R0AA 2DMPA 5HNHA 2XIGA 4CCLA 4RGXA 3UR3C 2P6TA 4MEYF 1ZRCA 1OMIA 3V4GA 2IT0A 2J5PA 3NWSA 2OQRA 2BY0A 3DEWA 2FMLA 4S0HB 3KP4A 5FO5A 3GTOJ 4MFDA 1FX7A 3TW7A 2FBIA 1I50J 5GTIC 1VQNI 2W7NA 2E1CA 1FIPA 2YX4A 4HEA2 4YIRX 2KT0A 2RGVA 1K61A 4XLPF 2YU3A 3CCLI 3LA7A 2Y2ZA 2E36A 2L7KA 2YU9J 4MTEA 2K02A 3CDIA 3E0JB 2WY8Q 1DGWY 3K0LA 2JUGA 4JX5A 4IXAA 2P81A 3CCMI 3OYJA 3GEZA 1BW5A 3FMQA 3F0CA 2VQHA 3RQ4A 1QPMA 4M3BA 4CZCA 3E1SA 1C0WA 2K7LA 1KQ8A 2DDBA 4AIJA 4PGGA 3KYCB 5FRMA 2EJRA 1JKRC 1RRJA 5D6FA 2VQCA 3FK6A 3H3ZA 3K2ZA 4XN3A 3CCRI 2ECCA 2LOOA 1A36A 2GQQA 4E7SA 1B9MA 4C3JJ 1QZZA 1FYLA 2K5CA 1OYIA 3OSGA 3U21A 3ERED 2OD5A 1J0RA 4C2MJ 1Z7LA 2N8GA 4KT5C 3ZQQA 1BOAA 1OCTC 3RZOJ 2OZ6A 2PFBA 5CJ9A 3VSLA 1Q1HA 4P5OA 5ILSA 3SYTA 3G4SI 3FISA 3E6CC 3I64A 4HPQA 2DA2A 1ZARA 4J19A 3VDXA 2IS2A 1MMAA 4U0WA 4L9VA 3RZDJ 2R7XA 1Z1DA 1SVMA 4FETA 1LDJA 3D5SC 2ACJA 2DA7A 5IYBJ 3U1KA 2CYYA 4HDUA 4LG0A 1OLTA 3H1CA 3VFZA 2BY3A 2KIUA 1CGPA 4HLYA 3B6CA 2W1OA 1YIJI 2QUFA 1CF7A 3TBIA 4IOCF 2OU2A 1MDMB 1P6RA 4ZTJA 2HDDA 2QENA 2EB7A 2CW7A 2CQKA 1ZGAA 4M71A 3SFIA 1FZPB 4U0VA 4HF0A 3GTQJ 3K4BA 4BE2A 1MNDA 2XGXA 5L3EA 1SMYF 3KEYA 3AL0B 2NOJB 1IN5A 3OYHA 1N77A 4OWRB 3ECOA 1VQKI 4OAZA 1JHFA 3M8FA 5J6XA 1XGSA 2ZJ2A 1Y56A 3T0YA 4IHTA 4ENNA 1D8JA 1NHAA 2X51A 4PJLA 4JP0A 2LF7A 3ZQHA 3ZQFA 1O3QA 2WBMA 4LD5A 3HHHA 2ZO4A 2DMUA 3L1PA 4BL0B 2ELKA 3OSFA 3LMMA 4NQWA 2DTRA 1WKMA 3TKYA 4DOZA 3G1LA 2MABA 3OV8A 4A5MA 5JVTA 3Q0VA 1R36A 2Q1ZB 5TRDA 4NB5A 2LMDA 4I02A 4WX9A 3QPHA 3E6BA 2P5KA 5JFRA 1RUNA 1MMNA 2Y0MA 2A07F 5GPAA 2EH3A 3K4MA 1OKRA 1D8KA 4XLNF 4UUSA 2MD5A 3Q0WA 1CQTA 4KA4A 2L7FP 3MQ0A 2VL8A 2D5VA 1W5CC 4MNUA 1IRGA 4L9JA 3JCUC 2OCEA 3FXQA 5EZGA 3PSFA 2KRFA 4NNJA 1YLFA 3OS1A 2GWRA 1TW3A 4BHBA 1YOVB 4XLFA 3OIPA 1ETKA 1HW1A 1GDTA 2ME6A 1XCVA 2JVHA 4RMNA 4RB2C 3C1DA 5L3DA 4WWCA 2QKLB 1ZR2A 2Y31A 3F3XA 3M07A 4B1RA 1WCMJ 3KE2A 4ZDOA 2CUFA 4BKXA 4Q47A 1YS7A 3HRSA 1WJFA 1Z67A 2IGNA 2L7ZA 1AU7A 3DEEA 2AQFA 1B1BA 3HC7A 2OC6A 2O61A 3PQKA 3FBIB 2E2JJ 3F8FA 1BC7C 1O7FA 1QGPA 5F1RA 3OIQA 1PP7U 2O5RA 2YSRA 2GOXB 1FJLA 3F9KA 1IN4A 4ZYDA 3A1YA 4S04A 2PMZN 3GTGJ 1LEBA 1KYWA 4FQGA 5AIQA 3RPUA 1QQIA 2Q2EA 3FXMA 3RCOA 1FBSA 3FXJA 1ON2A 5BMZA 4XLCA 2E1OA 5FRNA 2JVGA 3TO9A 5J8CA 4LK1F 1ZLJA 3DFGA 1SAUA 2RN7A 5BQTA 3M4OJ 3X2QH 1QHHD 1FSEA 3PIPF 1PP8F 5HVQC 1FWZA 2VJ5A 2IS6A 3QPTA 4UY8I 2JA2A 3RYPA 3RYRA 2MGQA 1ZH5A 3LSPA 1OYWA 1MDMA 2DA5A 1XPXA 1KU7A 3BR6A 1VQ6I 1N75A 3ABKH 2DJNA
chains in the Genus database with same CATH topology
4RB0A 4GCVA 3FMRA 2K27A 1S8NA 5DCMB 1O57A 2FBHA 4ESBA 2V79A 5CYVA 2EA2A 1AOYA 3BWGA 1TNTA 2EFNA 3FXUA 1ZAOA 4YIFA 4L9TA 3N4MA 2YR2A 4OIRF 5E18F 4HV6A 4ENJA 3CUQA 1P2FA 1VTNC 1G6NA 3CUQB 2P4WA 4G9YA 4RGUA 3L2CA 5LBQA 4UNOA 1YW7A 1T38A 3U9GA 4G7HF 4I2OA 3I53A 2ZXJA 3HRUA 4E70A 3R61A 3LSTA 2HTSA 1LQ1A 2RC4A 4AWXB 1R1VA 3GZ5A 3WGIA 4UHTA 4JBAA 1K6OA 3FMSA 2E7WA 1S6LA 5CVRA 4QLCU 4BYYA 4Q5SF 4CYDA 4OINF 1DPUA 2MLKA 5CVJA 3GFMA 3KZZA 3WTXC 2YPRA 1R00A 2DW4A 1XGNA 3NRVA 1WRJA 2P7CB 4BHPA 4IHSA 2IA0A 2CO5A 3E97A 4XRFA 3ISPA 4WK8F 1IXSB 4A6EA 3WTSC 2G9WA 1FLIA 4A6DA 3D5LA 2IA2A 3WE3A 3BY6A 1KU2A 5ICEA 2FF4A 1K79A 1LNWA 2XRNA 2W57A 4M6XA 1U5TB 1G3SA 4A0XA 4M72A 1XGOA 1HBXG 4BH9A 2HKOA 1F1ZA 2D1VA 4IVNA 4MHGA 3ZN0A 5FLXZ 4NHJA 3RI4A 2A61A 1LVAA 4MTDA 2KKOA 4ESJA 2HFHA 3M8EA 5D5UB 4IPAA 3RDIA 3F6OA 5LHIA 2L01A 2EFOA 1ZN2A 5ILUA 1O3TA 1WSUA 1W7PD 2P7VB 2BEOA 2NYXA 4L18B 2L54A 1LEAA 3VOEA 3REOA 2NRAC 3F6VA 1YG2A 2NNNA 3CTAA 2CGPA 1S3JA 2H94A 4RB3C 2UXXA 3K1NA 4EJVA 4CGZA 3SHFA 4A0ZA 2XUBA 4R8HA 2DLLA 3GYHX 4FHTA 2ZKZA 1D5VA 2ZNYA 1BBYA 3BJOA 3I4PA 4YIIA 2D2WA 1SFXA 3N97A 3ML6A 1YFHA 3F72A 5D4RA 4HQMA 2UWMA 3H92A 2DU9A 5AONA 2HEOA 3E5XA 4OIQF 3HYIA 5E8IA 3DXJF 3LFKA 2DFIA 3IC7A 3HUGA 1Z6TA 1R1UA 4R1HA 2DI3A 1YW8A 3T5XA 2Q8KA 2RQPA 4G8XA 5DDGA 4KFCA 3SFZA 3MCZA 2L02A 3KLNA 3HOSA 2O03A 3FHZA 1SFUA 1DP7P 4UVCA 5K5QA 1IN8A 4KN7X 3WTZA 1BI2A 3ZN1A 5L3FA 2VT2A 3RIRA 3I5UA 4RAZA 5HLGA 5EEGA 3NEUA 1E17A 4L5IA 2VODA 1IF1A 3BJAA 5FFZA 3GVAA 2L4AA 3WODF 2HDCA 2W25A 4HX8A 2XV4S 2FNAA 2FSWA 3PQJA 1EH7A 2EV6A 4N9IA 4PDKA 5CLSA 3EYYA 4CDGA 1O3RA 2XROA 2HR3A 4FX0A 3DKWA 4OU0A 4Q4ZF 3EYIA 1B6AA 3EUHA 5CVVA 2KJCA 3CUOA 5HDNA 1ZHFA 1EH8A 2FBKA 5L3CA 1DUXC 3V7RA 2QBYB 3F23A 4U0YA 4UUVA 2VXZA 1U3EM 2XKOA 2QVOA 4ENMA 1RNLA 4OMZA 2ZFWA 3BZ6A 3CDHA 2EA4A 2LNBA 5H6QA 1FY7A 1TBXA 4M9ZA 1IXRC 5BS6A 3TO6A 1JXSA 4EGZA 4MGRA 1UB9A 2FA5A 2P6SA 1R58A 4A5NA 1BIBA 4CO8A 3I59B 5BPIA 4OOIA 4ASNA 1I27A 4ZYHA 2XASA 4P96A 4O5VA 4XBFA 2PJPA 1S7OA 6PAXA 1FOKA 2IA1A 5A2QK 1FYMA 2OQGA 1FNNA 3ULQB 4YFKF 1MJAA 1W7PA 2M87A 4EQQA 1D3YA 2PBIA 5ERIA 3MWMA 5K5RA 4H0EA 1KA8A 3J80Z 2Y75A 3HTUA 1J2XA 4EJWA 5HLHA 4RS8A 2DQLA 4QWQA 2F5DA 1SFEA 1U78A 5HS8A 1LDDA 3KP3A 1DPRA 3E5QA 4ZYGA 4CHUA 1T98A 3QRFF 1XMAA 1BIAA 4HBLA 5L3BA 4D0PA 3KP2A 1YS6A 3CO6C 1BJAA 2CW0F 3G3ZA 4WCGA 2JZYA 2GXGA 4OIOF 2M8EA 2LKPA 2RV8A 5LGTA 1YYVA 1FBUA 2NAZA 3P9CA 1B9NA 4KYWA 4I01A 1T6SA 3TOBA 3EQLF 2VT3A 2M30A 2PN6A 3FWEA 1HW2A 2XHKA 1P4WA 1I6XA 2DK8A 2Y48A 4L0YB 1HKTA 2E1NA 5E1WA 1O7LA 3J81K 1BN5A 1AWCA 3QOPA 4AIKA 3T8RA 3JAMZ 2JT1A 4M9XA 2M1BA 1BI3A 1KU3A 2IJLA 3W6KB 2A6EF 3MZYA 2XAHA 4LFUA 5DYMA 4HF2A 2XKPA 2ETHA 1P4AA 2MH9A 2GAUA 4OIPF 2XAJA 5DCFA 2COMA 1B4AA 3L00A 1ZG5A 1QBJA 2FE3A 2H09A 5D5VB 2HQRA 3TOAA 3MZHA 3CUQC 2VOPA 3LQQA 3HRTA 1FC3A 5K1YA 1OR7A 2K4JA 2IVMA 4GXOA 4EMSA 4HOBA 1RIOH 2IP2A 2ADUA 4EJOA 1IN7A 1YW9A 3P9KA 1TQIA 1XDUA 3GLXA 2BV6A 3P7NA 1KQ0A 1FP1D 3LWFA 2WTEA 2DQRA 4O3MA 2A3SA 2Z3YA 3IKVA 3WU0A 4AD9A 3NQOA 1OPCA 5D5XB 1MKMA 1BC8C 4I09A 2UZKA 1EV7A 5CVUA 1G4DA 4IRIA 2F5FA 1Z6RA 2ZNZA 4KIBA 4PZJA 3U1DA 2J5OA 3R6SA 3HSEA 4KICA 1MZBA 1V4RA 2M5WA 4G7ZF 3JSPA 1SD4A 4A2UA 5JHUA 3J7AO 1K7AA 3V7SA 1HKQA 5F64A 3I58A 1F5TA 1IRFA 5K5OA 1XSDA 3M9AA 5EEHA 3WTWC 5LLQA 3M7GA 3I54A 3VB2A 1H0MA 3V7CA 2VOOA 2R7DA 4CXFA 3BPVA 1YQAA 4LMYA 3K9TA 2CG4A 3D0SA 5CVIA 3GW2A 1JGSA 1RZ4A 4JQFA 4XSXF 4TV7A 5HOOA 3LQRA 4L5JA 2QWWA 1KU9A 2VE8A 3FM3A 1XMKA 4MEXF 2HGCA 2QQBA 2VE9A 3DV8A 1T0FA 2FNPA 1QO0D 2FU4A 2HKXA 1BM9A 3ZMVA 3RTRA 3TQNA 4CZZA 1P92A 2EFWA 4ESFA 4I98B 1RUOA 1ON1A 4HAMA 2JSCA 2AS5F 3FF5A 2V1UA 3ZMDA 4P9UA 3E5UA 3F8CA 3V8KA 4LLNA 3G73A 1BI0A 4LLLA 3GFIA 5IT9K 5D5WB 2HYGD 4M73A 5E1XA 3Q5FA 1J5YA 1W5TA 1KYZA 4KMUX 3HSRA 2EV0A 4B8XA 4LB6B 4BNCA 2XAFA 3QP5A 1O3SA 1IAWA 3BOQA 3ZMTA 3ZMSA 3LAJA 4OMYA 3WE2A 1I1SA 3QAHA 4HQEA 3I71A 2EWNA 2STTA 4K2EA 1MD0A 2JPBA 2M45A 3BDDA 1UFMA 1ULYA 2O8XA 3O2PE 5J8FA 4LLGF 1IZ1A 1S29A 1RI7A 3C18A 4EGYA 2K4BA 2F5EA 5KVRA 2V6CA 5FFXA 2Z99A 3GXOA 2IRFG 2XVCA 3ABTA 4G94A 2XAQA 2FRHA 3SZPA 3ELKA 2RVCA 2FMYA 4F7ZA 2QM3A 2G7UA 3F8NA 3Q9SA 2LDUA 1G3YA 2MLGA 4L9NA 1MJBA 1ZRDA 2MH2A 3DEUA 1YIOA 1X3UA 3FXRA 3BROA 1XD7A 2UXNA 5HS9A 2PMHA 5DV5A 1R23A 4DQ2A 3ECHA 4AIHA 5LGNA 1HXDA 1MJ9A 4M6YA 3S2WA 3B73A 4EM2A 5BOXA 3L09A 3DF8A 1LDKB 3KEQA 1ONVA 2HOEA 3IRQA 2ISZA 1T39A 4G6QA 1R5HA 2DT5A 3K1MA 3MEXA 1I1GA 2QLZA 3EDPA 5HDGA 3Q9VA 1EH6A 1HQCA 3SXYA 3F21A 4PGHA 4N9HA 4BAYA 1Z91A 2WC2A 2A68F 2TDXA 1P4XA 1T2KA 2PEXA 4HZFA 1KQ9A 4Y17A 2RDPA 3ABUA 2DBBA 2XAGA 3W6JB 3F22A 3IWFA 1USTA 4HF1A 3V8LA 5FD6A 3COAC 4LJZF 3H3UA 1R1TA 2BYVE 4WXHA 1USSA 1JHHA 2WWYA 4U7BA 4A12A 4EM1A 3ROUA 1H9TA 2ESNA 3K1PA 2HYFA 3RKXA 4UV9A 4N0BA 4I7HA 4ZZDA 1ZREA 3KZYA 2VC0A 2V1XA 1XDSA 1IW7F 1ODDA 3ZQ7A 4G6DA 1FT9A 2KIMA 3GF2A 4KUMA 3QU6A 3WU1B 2MC3A 3IRRA 1ZG1A 2F2EA 5D8KB 3KP7A 4HX7A 1Y0UA 3KEOA 5F6FA 3FZVA 3GWZA 2G7HA 1SD6A 4G7OF 3O3KA 4WXDA 3HRMA 1LB2A 4BQAA 1YO5C 3QU3A 2P5VA 1H9GA 4ENKA 2MA3A 5FGMA 1K78B 4PCQA 1KGSA 5HLIA 4UVBA 1R7JA 3RKYA 1HKSA 4L0ZB 1J9IA 3HIFA 3JAMK 1S7AA 5FLXK 4GYIA 4KN4X 3J81Z 1L3LA 4RGRA 3SZTA 2HQNA 3RPQA 3GO5A 1DDNA 4P9FA 4BHCA 4YG2F 4HDVA 2GZWA 5BPDA 1OYYA 1LJ9A 2KIFA 4A0YA 2EK5A 3SQNA 2H6BA 2PQ8A 3F8MA 1ZRFA 3L7WA 5E8GA 5H6RA 2DO7A 4FX4A 2ZCWA 4LK0F 4AVPA 4YFNF 2R3SA 5FB2A 3O6BB 2IPQX 1E2XA 5E17F 2JPCA 2MBFA 3K69A 1UHWA 2PMUA 2W24A 3CJNA 3IWZA 3BPXA 3TGNA 3WTUC 4GGGA 5FD5A 5ICFA 4O6JA 3KLOA 1PUEE 2Z5UA 3IHUA 2B0LA 5D8LB 3DP7A 3VEPA 1W7PB 3E6MA 4ON0A 2QYOA 4ZYEA 2W85A 2LF8A 4HYEA 1HW5A 5LEJA 2GA2A 1WQ2A 1GXQA 1QNTA 2OBPA 2Z33A 5E1ZB 5JR3A 2VBYA 4EJUA 2H6CA 1YTYA 1WI9A 3DQVC 3TO7A 5DUKA 3KP5A 4HW0A 1TNSA 3B02A 1XGMA 2K86A 1GXPA 5E20A 4LGWA 1A04A 4U7DA 1PDNC 4M74A 4ETSA 4P55A 1K78A 1SD7A 1REPC 1U8RA 1Z7UA 3E3VA 2Z9OA 4Z2YA 4KNYA 2JRTA 3WGGA 3P9IA 2A69F 3KCCA 2DK5A 2RKHA 3HOTA 2FXAA 3LA2A 3ZMZA 3T1BA 1FP2A 4GYGA 1Z9CA 1B59A 3KFWX 1XN7A 2RNJA 1U6GA 1F4KA 5LRRA 4RAYA 4WF2A 1BI1A 3I59A 2A6HF 2WV0A 4GO1A 3ZP5A 2HS5A 2ZMEA 1TQMA 4LG0B 2Q0OA 1U5TA 1SD5A 1MGTA 2ISYA 2DPUA 2STWA 1SMTA 5IT3A 1XSXA 4I0BA 2P8TA 2V9VA 1F9NA 2FQ3A 5HS7A 1IUYA 4MQ9F 3IL2A 3WGHA 4YFXF 3WTYC 1XCBA 4Y15A 3JSOA 3ZMUA 3BJ6A 1ZYRF 1TQPA 1UHMA 2A5YB 2X0LA 2D1HA 3E6DA 3MFKA 1G3TA 4HA8A 3C3WA 1XB4A 3R4KA 3AAFA 5LEKA 2W84A 1IXCA 2QZ8A 4MQVA 4I0AA 4UXNA 3BP8A 2EFQA 2VN2A 5ICCA 3HHGA 4Y13A 4BXUA 2BGCA 4KIFA 2DPDA 4IRGA 5DD8A 4XSZF 1FYKA 1R22A 3F8BA 3R60A 3CLOA 3PFIA 2YX7A 4EV0A 5A2QZ 2L3DA 3V8JA 4HLXA 2VC1A 2KJBA 3LAPA 4LB5A 1WWXA 4RB1A 2CFXA 5D4SA 3U2RA 5DD4A 1V3FA 2V1DA 5LHHA 4EM0B 1QZYA 1ZLKA 1W5SA 4EJTA 3C7JA 1TTYA 2C6YA 1U5TC 1G3WA 1TLHB 3GFJA 2NNYA 4ZZLA 2ZMEB 3VODA 2HTJA 4Q48A 5DEQA 3TDUC 2QQ9A 5LHGA 5D6EA 1STZA 3RJPA 1HSJA 2CWEA 3JTHA 5IT9Z 1ZGJA 1FSHA 2GXBA 3OOPA 2OAZA 4M9SA 4KIGA 3WTVC 2QQAA 2EFPA 3KP6A 3FM5A 1FPQA 3TDZC 4IJAA 3GX4X 3QP6A 4RGSA 3DPTA 2OA4A 3KETA 1J7KA 3L9FA 3GFLA 4B09A 1R5GA 3GUDA 1I5ZA 4R79A 5L3GA 3J80K 5KK1A 2VBWA 3HSFA 2FEZA 1W4MA 2E7XA 2GA1A 5TJJA 2P5LC 3EETA 2BBYA 2CSOA 1L0OC 1Z05A 2EV5A 1IN6A 1JE8A 2VBZA 3ZPLA 5H20A 2PLYA 4ZH4F 4UVAA 1FBQA 2QBYA 4IRHA 4U88A 2VONA 3GZ6A 5AIPA 1UCRA 4KDPA 3CO7C 2VBXA 5ILVA 4WXCA 3JTGA 2ESHA 4DNCA 2NS0A 3LA3A 2H27A 2ZBKA 4HX4A 2PG4A 2L4MA 1SAXA 5ED4A 5ICGA 4EVIA 2GIVA 5JI6A 5DUIA 1XSVA 3JW4A 1U2WA 1TW2A 1GHCA 3WG9A 3I0TA 4S05A 1HSTA 2DAOA 4HV5A 2OZUA 2O6GE 3IKTA 2D45A 2LSOA 1CF7B 5LRSA 3M1EA 2IW5A 2AXLA 1GVJA 4FT8A 3RKWA 2HZTA 2PI0A 4KMFA 2F5CA 2R7FA 3WTTC 3HTSB 4CICA 3DPLC 4UV8A 2X4HA 2JTVA 2FOKA 4IF4A 3MAJA 3R0JA 5HDKA 1ZG3A 2O3FA 2BE5F 2O0YA 4JK1X 2HWVA 5DCMA 1J59A 1J75A 5LGUA 3FX3A 2ELHA 3T8TA 3R0AA 2XIGA 4RGXA 1ZRCA 2IT0A 2P6TA 4MEYF 1OMIA 3V4GA 2J5PA 2OQRA 2FMLA 3KP4A 5FO5A 1FX7A 2FBIA 2E1CA 2YX4A 2RGVA 4XLPF 2YU3A 3LA7A 4MTEA 2K02A 3K0LA 4IXAA 3GEZA 3FMQA 1QPMA 1C0WA 2K7LA 1KQ8A 4AIJA 4PGGA 2EJRA 5D6FA 3H3ZA 3K2ZA 2GQQA 1B9MA 1QZZA 1FYLA 1OYIA 3ERED 2OD5A 1J0RA 4KT5C 1BOAA 2OZ6A 2PFBA 5CJ9A 1Q1HA 4P5OA 5ILSA 3E6CC 3I64A 1ZARA 4U0WA 4L9VA 1Z1DA 1LDJA 2ACJA 2CYYA 4HDUA 4LG0A 3VFZA 2KIUA 1CGPA 4HLYA 2QUFA 1CF7A 2OU2A 1MDMB 1P6RA 2QENA 2EB7A 2CQKA 1ZGAA 4M71A 1FZPB 4U0VA 4HF0A 2XGXA 5L3EA 1SMYF 1IN5A 3ECOA 1JHFA 3M8FA 5J6XA 1XGSA 2ZJ2A 3T0YA 4IHTA 4ENNA 1D8JA 1NHAA 2LF7A 1O3QA 4LD5A 3HHHA 2ZO4A 4NQWA 2DTRA 1WKMA 3TKYA 4A5MA 3OV8A 5JVTA 1R36A 5TRDA 4NB5A 4I02A 4WX9A 3QPHA 3E6BA 2P5KA 5JFRA 1RUNA 2Y0MA 2A07F 1OKRA 1D8KA 4XLNF 2MD5A 4KA4A 3MQ0A 4MNUA 1IRGA 4L9JA 3FXQA 2KRFA 1YLFA 2GWRA 1TW3A 4BHBA 1HW1A 1XCVA 4RB2C 3C1DA 5L3DA 4WWCA 3F3XA 3KE2A 4Q47A 1YS7A 3HRSA 1B1BA 2O61A 3PQKA 3F8FA 1BC7C 1O7FA 1QGPA 5F1RA 1PP7U 2YSRA 1IN4A 4ZYDA 4S04A 1LEBA 1KYWA 5AIQA 3RPUA 1QQIA 2Q2EA 1FBSA 5BMZA 1ON2A 3TO9A 5J8CA 4LK1F 1ZLJA 3DFGA 2RN7A 5BQTA 1FSEA 1PP8F 5HVQC 1FWZA 3QPTA 3RYPA 3RYRA 1ZH5A 1MDMA 1OYWA 1KU7A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4RB0 A;  4GCV A;  3FMR A;  2K27 A;  1S8N A;  5DCM B;  1O57 A;  2FBH A;  4ESB A;  2V79 A;  5CYV A;  2EA2 A;  1AOY A;  3BWG A;  1TNT A;  2EFN A;  3FXU A;  1ZAO A;  4YIF A;  4L9T A;  3N4M A;  2YR2 A;  4OIR F;  5E18 F;  4HV6 A;  4ENJ A;  3CUQ A;  1P2F A;  1VTN C;  1G6N A;  3CUQ B;  2P4W A;  4G9Y A;  4RGU A;  3L2C A;  5LBQ A;  4UNO A;  1YW7 A;  1T38 A;  3U9G A;  4G7H F;  4I2O A;  3I53 A;  2ZXJ A;  3HRU A;  4E70 A;  3R61 A;  3LST A;  2HTS A;  1LQ1 A;  2RC4 A;  4AWX B;  1R1V A;  3GZ5 A;  3WGI A;  4UHT A;  4JBA A;  1K6O A;  3FMS A;  2E7W A;  1S6L A;  5CVR A;  4QLC U;  4BYY A;  4Q5S F;  4CYD A;  4OIN F;  1DPU A;  2MLK A;  5CVJ A;  3GFM A;  3KZZ A;  3WTX C;  2YPR A;  1R00 A;  2DW4 A;  1XGN A;  3NRV A;  1WRJ A;  2P7C B;  4BHP A;  4IHS A;  2IA0 A;  2CO5 A;  3E97 A;  4XRF A;  3ISP A;  4WK8 F;  1IXS B;  4A6E A;  3WTS C;  2G9W A;  1FLI A;  4A6D A;  3D5L A;  2IA2 A;  3WE3 A;  3BY6 A;  1KU2 A;  5ICE A;  2FF4 A;  1K79 A;  1LNW A;  2XRN A;  2W57 A;  4M6X A;  1U5T B;  1G3S A;  4A0X A;  4M72 A;  1XGO A;  1HBX G;  4BH9 A;  2HKO A;  1F1Z A;  2D1V A;  4IVN A;  4MHG A;  3ZN0 A;  5FLX Z;  4NHJ A;  3RI4 A;  2A61 A;  1LVA A;  4MTD A;  2KKO A;  4ESJ A;  2HFH A;  3M8E A;  5D5U B;  4IPA A;  3RDI A;  3F6O A;  5LHI A;  2L01 A;  2EFO A;  1ZN2 A;  5ILU A;  1O3T A;  1WSU A;  1W7P D;  2P7V B;  2BEO A;  2NYX A;  4L18 B;  2L54 A;  1LEA A;  3VOE A;  3REO A;  2NRA C;  3F6V A;  1YG2 A;  2NNN A;  3CTA A;  2CGP A;  1S3J A;  2H94 A;  4RB3 C;  2UXX A;  3K1N A;  4EJV A;  4CGZ A;  3SHF A;  4A0Z A;  2XUB A;  4R8H A;  2DLL A;  3GYH X;  4FHT A;  2ZKZ A;  1D5V A;  2ZNY A;  1BBY A;  3BJO A;  3I4P A;  4YII A;  2D2W A;  1SFX A;  3N97 A;  3ML6 A;  1YFH A;  3F72 A;  5D4R A;  4HQM A;  2UWM A;  3H92 A;  2DU9 A;  5AON A;  2HEO A;  3E5X A;  4OIQ F;  3HYI A;  5E8I A;  3DXJ F;  3LFK A;  2DFI A;  3IC7 A;  3HUG A;  1Z6T A;  1R1U A;  4R1H A;  2DI3 A;  1YW8 A;  3T5X A;  2Q8K A;  2RQP A;  4G8X A;  5DDG A;  4KFC A;  3SFZ A;  3MCZ A;  2L02 A;  3KLN A;  3HOS A;  2O03 A;  3FHZ A;  1SFU A;  1DP7 P;  4UVC A;  5K5Q A;  1IN8 A;  4KN7 X;  3WTZ A;  1BI2 A;  3ZN1 A;  5L3F A;  2VT2 A;  3RIR A;  3I5U A;  4RAZ A;  5HLG A;  5EEG A;  3NEU A;  1E17 A;  4L5I A;  2VOD A;  1IF1 A;  3BJA A;  5FFZ A;  3GVA A;  2L4A A;  3WOD F;  2HDC A;  2W25 A;  4HX8 A;  2XV4 S;  2FNA A;  2FSW A;  3PQJ A;  1EH7 A;  2EV6 A;  4N9I A;  4PDK A;  5CLS A;  3EYY A;  4CDG A;  1O3R A;  2XRO A;  2HR3 A;  4FX0 A;  3DKW A;  4OU0 A;  4Q4Z F;  3EYI A;  1B6A A;  3EUH A;  5CVV A;  2KJC A;  3CUO A;  5HDN A;  1ZHF A;  1EH8 A;  2FBK A;  5L3C A;  1DUX C;  3V7R A;  2QBY B;  3F23 A;  4U0Y A;  4UUV A;  2VXZ A;  1U3E M;  2XKO A;  2QVO A;  4ENM A;  1RNL A;  4OMZ A;  2ZFW A;  3BZ6 A;  3CDH A;  2EA4 A;  2LNB A;  5H6Q A;  1FY7 A;  1TBX A;  4M9Z A;  1IXR C;  5BS6 A;  3TO6 A;  1JXS A;  4EGZ A;  4MGR A;  1UB9 A;  2FA5 A;  2P6S A;  1R58 A;  4A5N A;  1BIB A;  4CO8 A;  3I59 B;  5BPI A;  4OOI A;  4ASN A;  1I27 A;  4ZYH A;  2XAS A;  4P96 A;  4O5V A;  4XBF A;  2PJP A;  1S7O A;  6PAX A;  1FOK A;  2IA1 A;  5A2Q K;  1FYM A;  2OQG A;  1FNN A;  3ULQ B;  4YFK F;  1MJA A;  1W7P A;  2M87 A;  4EQQ A;  1D3Y A;  2PBI A;  5ERI A;  3MWM A;  5K5R A;  4H0E A;  1KA8 A;  3J80 Z;  2Y75 A;  3HTU A;  1J2X A;  4EJW A;  5HLH A;  4RS8 A;  2DQL A;  4QWQ A;  2F5D A;  1SFE A;  1U78 A;  5HS8 A;  1LDD A;  3KP3 A;  1DPR A;  3E5Q A;  4ZYG A;  4CHU A;  1T98 A;  3QRF F;  1XMA A;  1BIA A;  4HBL A;  5L3B A;  4D0P A;  3KP2 A;  1YS6 A;  3CO6 C;  1BJA A;  2CW0 F;  3G3Z A;  4WCG A;  2JZY A;  2GXG A;  4OIO F;  2M8E A;  2LKP A;  2RV8 A;  5LGT A;  1YYV A;  1FBU A;  2NAZ A;  3P9C A;  1B9N A;  4KYW A;  4I01 A;  1T6S A;  3TOB A;  3EQL F;  2VT3 A;  2M30 A;  2PN6 A;  3FWE A;  1HW2 A;  2XHK A;  1P4W A;  1I6X A;  2DK8 A;  2Y48 A;  4L0Y B;  1HKT A;  2E1N A;  5E1W A;  1O7L A;  3J81 K;  1BN5 A;  1AWC A;  3QOP A;  4AIK A;  3T8R A;  3JAM Z;  2JT1 A;  4M9X A;  2M1B A;  1BI3 A;  1KU3 A;  2IJL A;  3W6K B;  2A6E F;  3MZY A;  2XAH A;  4LFU A;  5DYM A;  4HF2 A;  2XKP A;  2ETH A;  1P4A A;  2MH9 A;  2GAU A;  4OIP F;  2XAJ A;  5DCF A;  2COM A;  1B4A A;  3L00 A;  1ZG5 A;  1QBJ A;  2FE3 A;  2H09 A;  5D5V B;  2HQR A;  3TOA A;  3MZH A;  3CUQ C;  2VOP A;  3LQQ A;  3HRT A;  1FC3 A;  5K1Y A;  1OR7 A;  2K4J A;  2IVM A;  4GXO A;  4EMS A;  4HOB A;  1RIO H;  2IP2 A;  2ADU A;  4EJO A;  1IN7 A;  1YW9 A;  3P9K A;  1TQI A;  1XDU A;  3GLX A;  2BV6 A;  3P7N A;  1KQ0 A;  1FP1 D;  3LWF A;  2WTE A;  2DQR A;  4O3M A;  2A3S A;  2Z3Y A;  3IKV A;  3WU0 A;  4AD9 A;  3NQO A;  1OPC A;  5D5X B;  1MKM A;  1BC8 C;  4I09 A;  2UZK A;  1EV7 A;  5CVU A;  1G4D A;  4IRI A;  2F5F A;  1Z6R A;  2ZNZ A;  4KIB A;  4PZJ A;  3U1D A;  2J5O A;  3R6S A;  3HSE A;  4KIC A;  1MZB A;  1V4R A;  2M5W A;  4G7Z F;  3JSP A;  1SD4 A;  4A2U A;  5JHU A;  3J7A O;  1K7A A;  3V7S A;  1HKQ A;  5F64 A;  3I58 A;  1F5T A;  1IRF A;  5K5O A;  1XSD A;  3M9A A;  5EEH A;  3WTW C;  5LLQ A;  3M7G A;  3I54 A;  3VB2 A;  1H0M A;  3V7C A;  2VOO A;  2R7D A;  4CXF A;  3BPV A;  1YQA A;  4LMY A;  3K9T A;  2CG4 A;  3D0S A;  5CVI A;  3GW2 A;  1JGS A;  1RZ4 A;  4JQF A;  4XSX F;  4TV7 A;  5HOO A;  3LQR A;  4L5J A;  2QWW A;  1KU9 A;  2VE8 A;  3FM3 A;  1XMK A;  4MEX F;  2HGC A;  2QQB A;  2VE9 A;  3DV8 A;  1T0F A;  2FNP A;  1QO0 D;  2FU4 A;  2HKX A;  1BM9 A;  3ZMV A;  3RTR A;  3TQN A;  4CZZ A;  1P92 A;  2EFW A;  4ESF A;  4I98 B;  1RUO A;  1ON1 A;  4HAM A;  2JSC A;  2AS5 F;  3FF5 A;  2V1U A;  3ZMD A;  4P9U A;  3E5U A;  3F8C A;  3V8K A;  4LLN A;  3G73 A;  1BI0 A;  4LLL A;  3GFI A;  5IT9 K;  5D5W B;  2HYG D;  4M73 A;  5E1X A;  3Q5F A;  1J5Y A;  1W5T A;  1KYZ A;  4KMU X;  3HSR A;  2EV0 A;  4B8X A;  4LB6 B;  4BNC A;  2XAF A;  3QP5 A;  1O3S A;  1IAW A;  3BOQ A;  3ZMT A;  3ZMS A;  3LAJ A;  4OMY A;  3WE2 A;  1I1S A;  3QAH A;  4HQE A;  3I71 A;  2EWN A;  2STT A;  4K2E A;  1MD0 A;  2JPB A;  2M45 A;  3BDD A;  1UFM A;  1ULY A;  2O8X A;  3O2P E;  5J8F A;  4LLG F;  1IZ1 A;  1S29 A;  1RI7 A;  3C18 A;  4EGY A;  2K4B A;  2F5E A;  5KVR A;  2V6C A;  5FFX A;  2Z99 A;  3GXO A;  2IRF G;  2XVC A;  3ABT A;  4G94 A;  2XAQ A;  2FRH A;  3SZP A;  3ELK A;  2RVC A;  2FMY A;  4F7Z A;  2QM3 A;  2G7U A;  3F8N A;  3Q9S A;  2LDU A;  1G3Y A;  2MLG A;  4L9N A;  1MJB A;  1ZRD A;  2MH2 A;  3DEU A;  1YIO A;  1X3U A;  3FXR A;  3BRO A;  1XD7 A;  2UXN A;  5HS9 A;  2PMH A;  5DV5 A;  1R23 A;  4DQ2 A;  3ECH A;  4AIH A;  5LGN A;  1HXD A;  1MJ9 A;  4M6Y A;  3S2W A;  3B73 A;  4EM2 A;  5BOX A;  3L09 A;  3DF8 A;  1LDK B;  3KEQ A;  1ONV A;  2HOE A;  3IRQ A;  2ISZ A;  1T39 A;  4G6Q A;  1R5H A;  2DT5 A;  3K1M A;  3MEX A;  1I1G A;  2QLZ A;  3EDP A;  5HDG A;  3Q9V A;  1EH6 A;  1HQC A;  3SXY A;  3F21 A;  4PGH A;  4N9H A;  4BAY A;  1Z91 A;  2WC2 A;  2A68 F;  2TDX A;  1P4X A;  1T2K A;  2PEX A;  4HZF A;  1KQ9 A;  4Y17 A;  2RDP A;  3ABU A;  2DBB A;  2XAG A;  3W6J B;  3F22 A;  3IWF A;  1UST A;  4HF1 A;  3V8L A;  5FD6 A;  3COA C;  4LJZ F;  3H3U A;  1R1T A;  2BYV E;  4WXH A;  1USS A;  1JHH A;  2WWY A;  4U7B A;  4A12 A;  4EM1 A;  3ROU A;  1H9T A;  2ESN A;  3K1P A;  2HYF A;  3RKX A;  4UV9 A;  4N0B A;  4I7H A;  4ZZD A;  1ZRE A;  3KZY A;  2VC0 A;  2V1X A;  1XDS A;  1IW7 F;  1ODD A;  3ZQ7 A;  4G6D A;  1FT9 A;  2KIM A;  3GF2 A;  4KUM A;  3QU6 A;  3WU1 B;  2MC3 A;  3IRR A;  1ZG1 A;  2F2E A;  5D8K B;  3KP7 A;  4HX7 A;  1Y0U A;  3KEO A;  5F6F A;  3FZV A;  3GWZ A;  2G7H A;  1SD6 A;  4G7O F;  3O3K A;  4WXD A;  3HRM A;  1LB2 A;  4BQA A;  1YO5 C;  3QU3 A;  2P5V A;  1H9G A;  4ENK A;  2MA3 A;  5FGM A;  1K78 B;  4PCQ A;  1KGS A;  5HLI A;  4UVB A;  1R7J A;  3RKY A;  1HKS A;  4L0Z B;  1J9I A;  3HIF A;  3JAM K;  1S7A A;  5FLX K;  4GYI A;  4KN4 X;  3J81 Z;  1L3L A;  4RGR A;  3SZT A;  2HQN A;  3RPQ A;  3GO5 A;  1DDN A;  4P9F A;  4BHC A;  4YG2 F;  4HDV A;  2GZW A;  5BPD A;  1OYY A;  1LJ9 A;  2KIF A;  4A0Y A;  2EK5 A;  3SQN A;  2H6B A;  2PQ8 A;  3F8M A;  1ZRF A;  3L7W A;  5E8G A;  5H6R A;  2DO7 A;  4FX4 A;  2ZCW A;  4LK0 F;  4AVP A;  4YFN F;  2R3S A;  5FB2 A;  3O6B B;  2IPQ X;  1E2X A;  5E17 F;  2JPC A;  2MBF A;  3K69 A;  1UHW A;  2PMU A;  2W24 A;  3CJN A;  3IWZ A;  3BPX A;  3TGN A;  3WTU C;  4GGG A;  5FD5 A;  5ICF A;  4O6J A;  3KLO A;  1PUE E;  2Z5U A;  3IHU A;  2B0L A;  5D8L B;  3DP7 A;  3VEP A;  1W7P B;  3E6M A;  4ON0 A;  2QYO A;  4ZYE A;  2W85 A;  2LF8 A;  4HYE A;  1HW5 A;  5LEJ A;  2GA2 A;  1WQ2 A;  1GXQ A;  1QNT A;  2OBP A;  2Z33 A;  5E1Z B;  5JR3 A;  2VBY A;  4EJU A;  2H6C A;  1YTY A;  1WI9 A;  3DQV C;  3TO7 A;  5DUK A;  3KP5 A;  4HW0 A;  1TNS A;  3B02 A;  1XGM A;  2K86 A;  1GXP A;  5E20 A;  4LGW A;  1A04 A;  4U7D A;  1PDN C;  4M74 A;  4ETS A;  4P55 A;  1K78 A;  1SD7 A;  1REP C;  1U8R A;  1Z7U A;  3E3V A;  2Z9O A;  4Z2Y A;  4KNY A;  2JRT A;  3WGG A;  3P9I A;  2A69 F;  3KCC A;  2DK5 A;  2RKH A;  3HOT A;  2FXA A;  3LA2 A;  3ZMZ A;  3T1B A;  1FP2 A;  4GYG A;  1Z9C A;  1B59 A;  3KFW X;  1XN7 A;  2RNJ A;  1U6G A;  1F4K A;  5LRR A;  4RAY A;  4WF2 A;  1BI1 A;  3I59 A;  2A6H F;  2WV0 A;  4GO1 A;  3ZP5 A;  2HS5 A;  2ZME A;  1TQM A;  4LG0 B;  2Q0O A;  1U5T A;  1SD5 A;  1MGT A;  2ISY A;  2DPU A;  2STW A;  1SMT A;  5IT3 A;  1XSX A;  4I0B A;  2P8T A;  2V9V A;  1F9N A;  2FQ3 A;  5HS7 A;  1IUY A;  4MQ9 F;  3IL2 A;  3WGH A;  4YFX F;  3WTY C;  1XCB A;  4Y15 A;  3JSO A;  3ZMU A;  3BJ6 A;  1ZYR F;  1TQP A;  1UHM A;  2A5Y B;  2X0L A;  2D1H A;  3E6D A;  3MFK A;  1G3T A;  4HA8 A;  3C3W A;  1XB4 A;  3R4K A;  3AAF A;  5LEK A;  2W84 A;  1IXC A;  2QZ8 A;  4MQV A;  4I0A A;  4UXN A;  3BP8 A;  2EFQ A;  2VN2 A;  5ICC A;  3HHG A;  4Y13 A;  4BXU A;  2BGC A;  4KIF A;  2DPD A;  4IRG A;  5DD8 A;  4XSZ F;  1FYK A;  1R22 A;  3F8B A;  3R60 A;  3CLO A;  3PFI A;  2YX7 A;  4EV0 A;  5A2Q Z;  2L3D A;  3V8J A;  4HLX A;  2VC1 A;  2KJB A;  3LAP A;  4LB5 A;  1WWX A;  4RB1 A;  2CFX A;  5D4S A;  3U2R A;  5DD4 A;  1V3F A;  2V1D A;  5LHH A;  4EM0 B;  1QZY A;  1ZLK A;  1W5S A;  4EJT A;  3C7J A;  1TTY A;  2C6Y A;  1U5T C;  1G3W A;  1TLH B;  3GFJ A;  2NNY A;  4ZZL A;  2ZME B;  3VOD A;  2HTJ A;  4Q48 A;  5DEQ A;  3TDU C;  2QQ9 A;  5LHG A;  5D6E A;  1STZ A;  3RJP A;  1HSJ A;  2CWE A;  3JTH A;  5IT9 Z;  1ZGJ A;  1FSH A;  2GXB A;  3OOP A;  2OAZ A;  4M9S A;  4KIG A;  3WTV C;  2QQA A;  2EFP A;  3KP6 A;  3FM5 A;  1FPQ A;  3TDZ C;  4IJA A;  3GX4 X;  3QP6 A;  4RGS A;  3DPT A;  2OA4 A;  3KET A;  1J7K A;  3L9F A;  3GFL A;  4B09 A;  1R5G A;  3GUD A;  1I5Z A;  4R79 A;  5L3G A;  3J80 K;  5KK1 A;  2VBW A;  3HSF A;  2FEZ A;  1W4M A;  2E7X A;  2GA1 A;  5TJJ A;  2P5L C;  3EET A;  2BBY A;  2CSO A;  1L0O C;  1Z05 A;  2EV5 A;  1IN6 A;  1JE8 A;  2VBZ A;  3ZPL A;  5H20 A;  2PLY A;  4ZH4 F;  4UVA A;  1FBQ A;  2QBY A;  4IRH A;  4U88 A;  2VON A;  3GZ6 A;  5AIP A;  1UCR A;  4KDP A;  3CO7 C;  2VBX A;  5ILV A;  4WXC A;  3JTG A;  2ESH A;  4DNC A;  2NS0 A;  3LA3 A;  2H27 A;  2ZBK A;  4HX4 A;  2PG4 A;  2L4M A;  1SAX A;  5ED4 A;  5ICG A;  4EVI A;  2GIV A;  5JI6 A;  5DUI A;  1XSV A;  3JW4 A;  1U2W A;  1TW2 A;  1GHC A;  3WG9 A;  3I0T A;  4S05 A;  1HST A;  2DAO A;  4HV5 A;  2OZU A;  2O6G E;  3IKT A;  2D45 A;  2LSO A;  1CF7 B;  5LRS A;  3M1E A;  2IW5 A;  2AXL A;  1GVJ A;  4FT8 A;  3RKW A;  2HZT A;  2PI0 A;  4KMF A;  2F5C A;  2R7F A;  3WTT C;  3HTS B;  4CIC A;  3DPL C;  4UV8 A;  2X4H A;  2JTV A;  2FOK A;  4IF4 A;  3MAJ A;  3R0J A;  5HDK A;  1ZG3 A;  2O3F A;  2BE5 F;  2O0Y A;  4JK1 X;  2HWV A;  5DCM A;  1J59 A;  1J75 A;  5LGU A;  3FX3 A;  2ELH A;  3T8T A;  3R0A A;  2XIG A;  4RGX A;  1ZRC A;  2IT0 A;  2P6T A;  4MEY F;  1OMI A;  3V4G A;  2J5P A;  2OQR A;  2FML A;  3KP4 A;  5FO5 A;  1FX7 A;  2FBI A;  2E1C A;  2YX4 A;  2RGV A;  4XLP F;  2YU3 A;  3LA7 A;  4MTE A;  2K02 A;  3K0L A;  4IXA A;  3GEZ A;  3FMQ A;  1QPM A;  1C0W A;  2K7L A;  1KQ8 A;  4AIJ A;  4PGG A;  2EJR A;  5D6F A;  3H3Z A;  3K2Z A;  2GQQ A;  1B9M A;  1QZZ A;  1FYL A;  1OYI A;  3ERE D;  2OD5 A;  1J0R A;  4KT5 C;  1BOA A;  2OZ6 A;  2PFB A;  5CJ9 A;  1Q1H A;  4P5O A;  5ILS A;  3E6C C;  3I64 A;  1ZAR A;  4U0W A;  4L9V A;  1Z1D A;  1LDJ A;  2ACJ A;  2CYY A;  4HDU A;  4LG0 A;  3VFZ A;  2KIU A;  1CGP A;  4HLY A;  2QUF A;  1CF7 A;  2OU2 A;  1MDM B;  1P6R A;  2QEN A;  2EB7 A;  2CQK A;  1ZGA A;  4M71 A;  1FZP B;  4U0V A;  4HF0 A;  2XGX A;  5L3E A;  1SMY F;  1IN5 A;  3ECO A;  1JHF A;  3M8F A;  5J6X A;  1XGS A;  2ZJ2 A;  3T0Y A;  4IHT A;  4ENN A;  1D8J A;  1NHA A;  2LF7 A;  1O3Q A;  4LD5 A;  3HHH A;  2ZO4 A;  4NQW A;  2DTR A;  1WKM A;  3TKY A;  4A5M A;  3OV8 A;  5JVT A;  1R36 A;  5TRD A;  4NB5 A;  4I02 A;  4WX9 A;  3QPH A;  3E6B A;  2P5K A;  5JFR A;  1RUN A;  2Y0M A;  2A07 F;  1OKR A;  1D8K A;  4XLN F;  2MD5 A;  4KA4 A;  3MQ0 A;  4MNU A;  1IRG A;  4L9J A;  3FXQ A;  2KRF A;  1YLF A;  2GWR A;  1TW3 A;  4BHB A;  1HW1 A;  1XCV A;  4RB2 C;  3C1D A;  5L3D A;  4WWC A;  3F3X A;  3KE2 A;  4Q47 A;  1YS7 A;  3HRS A;  1B1B A;  2O61 A;  3PQK A;  3F8F A;  1BC7 C;  1O7F A;  1QGP A;  5F1R A;  1PP7 U;  2YSR A;  1IN4 A;  4ZYD A;  4S04 A;  1LEB A;  1KYW A;  5AIQ A;  3RPU A;  1QQI A;  2Q2E A;  1FBS A;  5BMZ A;  1ON2 A;  3TO9 A;  5J8C A;  4LK1 F;  1ZLJ A;  3DFG A;  2RN7 A;  5BQT A;  1FSE A;  1PP8 F;  5HVQ C;  1FWZ A;  3QPT A;  3RYP A;  3RYR A;  1ZH5 A;  1MDM A;  1OYW A;  1KU7 A; 
#chains in the Genus database with same CATH topology
 2BY1 A;  4RB0 A;  4GCV A;  1KON A;  3FMR A;  2K27 A;  3K7A J;  1S8N A;  4DW6 A;  5DCM B;  3JRC A;  2DMN A;  1O57 A;  2FBH A;  4ESB A;  2V79 A;  2LH9 A;  5CYV A;  2EA2 A;  1AOY A;  3H36 A;  1QRY A;  3BWG A;  1TNT A;  5F04 A;  2EFN A;  3SEZ A;  3FXU A;  1ZAO A;  4YIF A;  4L9T A;  3Q3S A;  4AYB A;  3BR0 A;  3N4M A;  2YR2 A;  2E71 A;  4OIR F;  5E18 F;  4HV6 A;  1VZ0 A;  4ZDL A;  5CPR B;  4ENJ A;  2DT7 B;  3DBH B;  1PVE A;  4XLH A;  3H3V K;  4G6T B;  1R6R A;  3FDY A;  3CUQ A;  1P2F A;  3TW6 A;  4XQF A;  3PIO F;  1VTN C;  2PJR B;  1G6N A;  1V55 H;  3CUQ B;  2LD5 A;  2XGC A;  1FMW A;  2H1K A;  2P4W A;  1R4N B;  3JRG A;  2MSY A;  4G9Y A;  4RGU A;  1YRN B;  2R7U A;  3L2C A;  3PUF A;  5LBQ A;  1IO2 A;  4UNO A;  3IAS 2;  1YRN A;  1X2N A;  1LUJ B;  1YW7 A;  1T38 A;  1BR4 A;  3U9G A;  4G7H F;  3C2G A;  2ZSH B;  4I2O A;  3ZQC A;  1QA6 A;  3I53 A;  4AYB N;  1DU0 A;  3PL8 A;  2K9Q A;  2VI6 A;  2EZK A;  1MBJ A;  2ZXJ A;  3G71 I;  3HRU A;  3JRI A;  3HJE A;  4E70 A;  5J4Y A;  1YE9 A;  2HXI A;  2VQG A;  3FIW A;  3C2B A;  1WJB A;  3LST A;  3R61 A;  3ONQ A;  2HTS A;  1LQ1 A;  2RC4 A;  4ZC3 A;  1UHS A;  4E7Z A;  4Y3O A;  4IEJ A;  3GLL A;  4AWX B;  4E7I A;  1D1B A;  3OR2 C;  1R1V A;  3GZ5 A;  2KL4 A;  5FKN A;  3WGI A;  4UHT A;  4JBA A;  1K6O A;  3FMS A;  3QOE A;  3AG3 H;  1ZR4 A;  2E7W A;  2JUC A;  5KAF C;  2V9P A;  4ZYA A;  2F48 A;  2FX0 A;  1I3A A;  1S6L A;  4OAY A;  5CVR A;  4QLC U;  1K83 J;  2BW3 A;  4BYY A;  4Q5S F;  2VKD A;  4PJJ A;  4CYD A;  4OIN F;  1DPU A;  2F4O B;  4BDZ A;  2MLK A;  2F4M B;  5CVJ A;  3GFM A;  3KZZ A;  3WTX C;  2YPR A;  4DJA A;  3GTP J;  2DOA A;  1R00 A;  2DW4 A;  2RNG A;  1XGN A;  3NRV A;  1WRJ A;  3OYM A;  2P7C B;  4BHP A;  4IHS A;  2LKX A;  5J1R A;  3OYB A;  2IA0 A;  2CO5 A;  1BOB A;  3E97 A;  4XRF A;  4BGD A;  3ISP A;  4BQN A;  3OL3 A;  4WK8 F;  1IXS B;  4A6E A;  3WTS C;  2G9W A;  2GBY A;  1FLI A;  4A6D A;  3HGY A;  2F4I A;  3D5L A;  5M3F J;  2IA2 A;  3WE3 A;  3BY6 A;  4XL9 A;  2UUZ A;  1KU2 A;  5ICE A;  5B5E C;  2ZME C;  2FF4 A;  3BQZ A;  1K79 A;  1LNW A;  2X6O A;  2XRN A;  4B43 A;  2W57 A;  3S8P A;  5FRO A;  4M6X A;  5J47 A;  1U5T B;  2MD0 A;  1G3S A;  3OL4 A;  4A0X A;  5DM7 F;  4M72 A;  1JJ8 C;  1XGO A;  1HBX G;  4BH9 A;  2HKO A;  1ZGW A;  1T0F C;  1A31 A;  2ZXH A;  2LTP A;  2Y30 A;  2ZFU A;  2EZH A;  2XGD A;  1F1Z A;  2D1V A;  4IVN A;  4MHG A;  3ZN0 A;  5FLX Z;  4XOR A;  3ZGK A;  4NHJ A;  5E3M A;  3G2B A;  3RI4 A;  3SDG A;  2A61 A;  2BXY A;  1LVA A;  4MTD A;  2KKO A;  4ESJ A;  1BR1 A;  2HFH A;  3M8E A;  5D5U B;  2JA7 J;  4IPA A;  3RDI A;  2BHZ A;  1BJZ A;  3F6O A;  2BVL A;  1Z21 A;  5LHI A;  3CMM A;  4V2F A;  4H4K C;  1X19 A;  2L01 A;  4ZDP A;  1Y1W J;  4PFP A;  1VND A;  2EFO A;  1V5E A;  4EEF G;  1ZN2 A;  5ILU A;  1O3T A;  4XID A;  1IGN A;  1WSU A;  1W7P D;  2P7V B;  4A3C J;  2BEO A;  1VQP I;  3QYE A;  2NYX A;  1QU3 A;  5J40 A;  3LSR A;  4L18 B;  2L54 A;  3MKL A;  1OCO H;  1TL8 A;  1E3P A;  1LEA A;  3VOE A;  2RRE A;  3REO A;  2NRA C;  1Y8R B;  4B47 A;  3F6V A;  1YG2 A;  2EZI A;  2EBI A;  5GAD J;  2DFF A;  2NNN A;  5FKO A;  3CTA A;  2IEK A;  3L2V A;  2CGP A;  1S3J A;  2H94 A;  4RB3 C;  3I55 I;  2UXX A;  3K1N A;  2HI3 A;  4EJV A;  4CGZ A;  4F93 B;  3SHF A;  4A0Z A;  1D5Y A;  2XUB A;  3S1Q J;  4R8H A;  2DLL A;  1H8A C;  3GYH X;  4FHT A;  4NC8 A;  2XPV A;  2ZKZ A;  4BUP A;  4RBO A;  1MBK A;  3HOX J;  4J00 A;  1D5V A;  2ZNY A;  1BBY A;  2UV1 A;  3BJO A;  3I4P A;  4YII A;  4N4N B;  4BJ6 C;  3JRA A;  3AG4 H;  2D2W A;  1IUF A;  1SFX A;  3N97 A;  2MFZ A;  3ML6 A;  2M4K A;  1YFH A;  1OJL A;  3F72 A;  5D4R A;  2DYS H;  1RPW A;  4HQM A;  2PMZ A;  3H92 A;  2UWM A;  1NK2 P;  1MSF C;  1TT0 A;  1WH5 A;  3CCV I;  2DU9 A;  5AON A;  2HEO A;  4LG3 A;  3E5X A;  4OIQ F;  3HYI A;  4II3 A;  4CCJ A;  5FKL A;  1QHG A;  1NG6 A;  2Y0S N;  3DKY A;  5E8I A;  3DXJ F;  3LFK A;  2DFI A;  3HXL A;  2M4G A;  3IC7 A;  2K9M A;  3HUG A;  2BHY A;  1Z6T A;  4PJ0 C;  1R1U A;  4R1H A;  2DI3 A;  1ZKG A;  3S3M A;  1YW8 A;  4XKV A;  4XM3 A;  1I3Q J;  1TP4 A;  3T5X A;  2Q8K A;  2RQP A;  4G8X A;  5DDG A;  2IBD A;  4KFC A;  5FKM A;  1O4X A;  1OCP A;  1WZ2 A;  3SFZ A;  1MBE A;  3MCZ A;  2EIK H;  2L02 A;  3KLN A;  3HOS A;  2O03 A;  3FHZ A;  1SFU A;  1DP7 P;  4UVC A;  1WFX A;  2X1C A;  4RAG A;  2LBF B;  5K5Q A;  3ZR8 X;  5GAG J;  1IN8 A;  1YX5 A;  1NG7 A;  2ID6 A;  3LFU A;  5EEA A;  4KN7 X;  3WTZ A;  1BI2 A;  3D1N I;  1JKQ C;  2VKV A;  1A35 A;  1TWH J;  4FE7 A;  1N25 A;  2H8W A;  3ZN1 A;  2QGU A;  5L3F A;  1GV5 A;  2VT2 A;  3BR2 A;  3RIR A;  5F0H A;  2NVX J;  2RAE A;  3I5U A;  4RAZ A;  5HLG A;  5J4V A;  4A3I J;  5EEG A;  2R92 J;  3NEU A;  2HDW A;  4L5I A;  1E17 A;  3NWT A;  2VKE A;  2VOD A;  2NS7 A;  5H2F C;  3L2U A;  4HSR A;  1IF1 A;  3BJA A;  3BCB A;  2A6T A;  5FFZ A;  5IYD J;  4FTH A;  3GVA A;  2L4A A;  3WOD F;  2W00 A;  3PNY A;  4YEJ A;  2HDC A;  2W25 A;  1ORK A;  4HRI A;  4HX8 A;  2M7A A;  2XV4 S;  2FNA A;  2FSW A;  1SC7 A;  4BJT A;  3PQJ A;  1EH7 A;  2EV6 A;  2KRC A;  4N9I A;  4PDK A;  3V42 A;  5CLS A;  2O8K A;  3EYY A;  1TWC J;  4CDG A;  1O3R A;  2XRO A;  2XDV A;  2HR3 A;  4FX0 A;  3DU6 A;  1ETO A;  3DKW A;  1FOY A;  2LRD A;  4DZJ A;  4OU0 A;  4Q4Z F;  3EYI A;  4DBR A;  1B6A A;  3EUH A;  5CVV A;  2AXT C;  2ZSI B;  2K3F A;  1KZH A;  2KJC A;  2JMW A;  1ACI A;  1TWF J;  3CUO A;  5HDN A;  3HG9 A;  4B3A A;  3DCF A;  2WY7 Q;  1ZHF A;  3MKZ A;  1EH8 A;  3BQY A;  2FBK A;  5L3C A;  4B48 A;  1NK3 P;  1DUX C;  3V7R A;  4XNF A;  1GVD A;  2QBY B;  3M1C A;  3F23 A;  1TZL A;  1MSE C;  4U0Y A;  4UUV A;  2CQ7 A;  2VXZ A;  1GUU A;  1U3E M;  2XKO A;  1I6H J;  4DZP A;  3H9Q A;  1APL C;  1NH3 A;  3DLA A;  1Z3Y A;  2QVO A;  5GAH J;  2R7W A;  3SJM A;  1EF4 A;  4ENM A;  3LNQ A;  5B3S H;  1XG1 A;  1RNL A;  2X1E A;  2ZFW A;  3GBG A;  4OMZ A;  2HPM A;  3BG5 A;  3BZ6 A;  2K85 A;  3CDH A;  2EA4 A;  2LNB A;  5H6Q A;  1FY7 A;  3SEQ A;  1Y1V J;  1TBX A;  4M9Z A;  1IXR C;  2WB1 N;  2ZJQ F;  3PM1 A;  1SVO A;  5BS6 A;  3CCY A;  3TO6 A;  3OYE A;  1JXS A;  3I9V 2;  4EGZ A;  3DWL E;  4MGR A;  1UB9 A;  2FA5 A;  2LG4 A;  2P6S A;  2VXD A;  2DXI A;  4IZZ A;  1R58 A;  4A5N A;  1BIB A;  1A5J A;  4CO8 A;  4XRS G;  4XON A;  5EF6 A;  3I59 B;  5BPI A;  4OOI A;  4ASN A;  5K7Z A;  1I27 A;  4ZYH A;  3LOC A;  1FIA A;  2QCO A;  2XAS A;  2R7S A;  4P96 A;  1MH3 A;  3OY9 A;  4O5V A;  3K70 C;  3BLY A;  4NDL A;  4U87 A;  2CQN A;  4XBF A;  3FHN A;  2PJP A;  2WAE A;  4ABZ A;  1UZC A;  2VAS A;  4HNT A;  3ZQI A;  1S7O A;  2R7O A;  6PAX A;  2HYJ A;  2IS4 A;  3OYF A;  3D5R C;  1FOK A;  2IA1 A;  5A2Q K;  1FYM A;  2OQG A;  4Z6Y A;  1FNN A;  2WAF A;  3PSI A;  3ULQ B;  4YFK F;  1AKH B;  2R93 J;  4Y4R A;  3VYT B;  3ZCO A;  1MJA A;  1W7P A;  2M87 A;  5J3L A;  4EQQ A;  1D3Y A;  2PBI A;  5ERI A;  3MWM A;  5K5R A;  5IYC J;  4H0E A;  1KA8 A;  3J80 Z;  1TWG J;  2Y75 A;  2Z16 A;  1ETQ A;  3HTU A;  1J2X A;  1RC9 A;  4EJW A;  2ZJR F;  5HLH A;  4RS8 A;  4DBQ A;  4A3K J;  5IP6 A;  2OJE D;  2HVQ A;  2XB0 X;  2DQL A;  4QWQ A;  2F5D A;  1ZEL A;  1TC3 C;  2VPL A;  1SFE A;  1S7E A;  1U78 A;  2CUE A;  4X1E A;  3HOY J;  3HB9 A;  1EJ9 A;  5HS8 A;  1HCR A;  3BTC A;  3I56 I;  1LDD A;  2EZL A;  4KT6 A;  4BE1 A;  3KP3 A;  1DPR A;  1HDD C;  1ETY A;  3E5Q A;  3BG7 A;  1U9N A;  3HKZ N;  4ZYG A;  4CHU A;  1LFB A;  1T98 A;  1RKW A;  1VQ4 I;  3QRF F;  2QF7 A;  2DOD A;  2M0C A;  1A6Q A;  3PJR A;  3QWL A;  1HC8 A;  1XMA A;  2XGE A;  1JT0 A;  1BIA A;  4HBL A;  5L3B A;  4D0P A;  1ENH A;  3KP2 A;  4V19 K;  3CCJ I;  1YS6 A;  2L9S A;  2X6X A;  3CO6 C;  2M9H A;  4UUT A;  1YJ9 I;  1BJA A;  4PFO A;  4RLQ A;  2CW0 F;  1QZE A;  2L2O A;  3G3Z A;  4YEL A;  4WCG A;  2JZY A;  2GXG A;  1RET A;  4OIO F;  2M8E A;  1D0Y A;  2LKP A;  3QYB A;  2RV8 A;  5LGT A;  3GCM A;  2XF6 A;  4UB8 C;  2E60 A;  5TGT A;  1YYV A;  1TT5 B;  4GDF A;  1FBU A;  2NAZ A;  2LKS A;  3P9C A;  4LIT A;  1B9N A;  2WV1 A;  3DTI A;  1K4S A;  4KYW A;  1E3H A;  4I01 A;  1T6S A;  3TOB A;  3CP8 A;  2G0E A;  1XS9 A;  3EQL F;  2E35 A;  2VT3 A;  2AQE A;  2DJI A;  2M30 A;  2V26 A;  2PN6 A;  3FWE A;  5F0C A;  3K4J A;  3ABL H;  1HW2 A;  2XHK A;  1P4W A;  1HF0 A;  1I6X A;  1XMX A;  2DK8 A;  3CDL A;  5DS9 A;  1Z3X A;  4C2T A;  2Q2E B;  2Y48 A;  1LPQ A;  4L0Y B;  2KZG A;  1V5G A;  4E7L A;  2M3A A;  1OR7 C;  1X3Z B;  2CV1 A;  4RLF A;  1HKT A;  2E1N A;  2ZB9 A;  5E1W A;  4FIS A;  1O7L A;  4QPO A;  3J81 K;  2IGO A;  2CS3 A;  1W1W E;  4E7J A;  1BN5 A;  1AWC A;  3QOP A;  3OOU A;  2FJ1 A;  4AIK A;  3K4N A;  1PJR A;  3T8R A;  3JAM Z;  5C4J J;  2JT1 A;  4M9X A;  2CW8 A;  3KYD B;  2BY2 A;  2M1B A;  3K6G A;  2DMT A;  3FKI J;  1BI3 A;  1VQ5 I;  1S9H A;  2XPW A;  1BW6 A;  2W82 A;  3BCA A;  4PUS A;  1KU3 A;  2IJL A;  3W6K B;  2O7O A;  2A6E F;  5E3L A;  3MZY A;  2XAH A;  4LFU A;  5DYM A;  4HF2 A;  4KJZ A;  3AG1 H;  2XKP A;  4RM3 A;  2ETH A;  1P4A A;  2MH9 A;  1WJE A;  2GAU A;  4OIP F;  2XAJ A;  5DCF A;  3TMO A;  3CF2 A;  3CD6 I;  2COM A;  1B4A A;  3L00 A;  4RM2 A;  1ZG5 A;  2OCC H;  3NAR A;  3DBL B;  2L9N A;  1QBJ A;  2FE3 A;  1I39 A;  3OMY A;  5C44 J;  2H09 A;  4NQW B;  3MKY B;  5D5V B;  2HQR A;  3TOA A;  3MZH A;  1X1D A;  2NOG A;  3CUQ C;  2VOP A;  3LQQ A;  3HRT A;  1FC3 A;  4Y7N J;  5K1Y A;  1OR7 A;  2K4J A;  4AID A;  2IVM A;  4GXO A;  1HDP A;  4M3F A;  3JRF A;  4HST A;  4EMS A;  4HOB A;  1RIO H;  2IP2 A;  3O8G A;  2ADU A;  4EJO A;  4A3F J;  2DMQ A;  1IN7 A;  2ECB A;  1YW9 A;  3P9K A;  1QVU A;  1X1C A;  2QSF X;  1TQI A;  1VI0 A;  2L7M P;  1XDU A;  3GLX A;  1E0E A;  2BV6 A;  3P7N A;  1KQ0 A;  1FP1 D;  4D7N A;  4BJ5 C;  4CYC B;  3LWF A;  2WTE A;  4MLO A;  4B4C A;  2DQR A;  3GTM J;  4O3M A;  3TP0 A;  2A3S A;  2CQQ A;  2L0K A;  3HM5 A;  2DA6 A;  2Z3Y A;  3IKV A;  3WU0 A;  4AD9 A;  3NQO A;  1OPC A;  1Q1V A;  5D5X B;  1LFP A;  1MKM A;  1BC8 C;  4I09 A;  2UZK A;  2I10 A;  1EV7 A;  5CVU A;  1G4D A;  3OYD A;  4IRI A;  3PUB A;  3A0B C;  3ZRG A;  2F5F A;  1Z6R A;  2ZNZ A;  4JX6 A;  2L9R A;  2KMU A;  4KIB A;  4PZJ A;  3U1D A;  2J5O A;  4XRM A;  1IG7 A;  3R6S A;  3L2R A;  4A93 J;  1AHD P;  2KFD A;  2DFH A;  3HSE A;  3JRB A;  4KIC A;  1MZB A;  3EPZ A;  2Y9Y A;  4NUB A;  1V4R A;  2M5W A;  4G7Z F;  3H9J A;  3JSP A;  1SD4 A;  2QSG X;  5J1Y A;  4A2U A;  3A02 A;  1P9Q C;  5JHU A;  2QQ8 A;  4XN0 A;  3OIO A;  3J7A O;  1K7A A;  3V7S A;  1G59 A;  1HKQ A;  5F64 A;  3I58 A;  1F5T A;  1IRF A;  5K5O A;  1PUF B;  3QOD A;  3MMY B;  4IL6 C;  1XSD A;  2WAQ A;  1UEL B;  3M9A A;  5EEH A;  2BZT A;  3WTW C;  3IH3 A;  1W0T A;  3LSH A;  4RB1 A;  3BR3 A;  3M7G A;  5LLQ A;  4A3G J;  3I54 A;  3P5J A;  3VB2 A;  1H0M A;  3V7C A;  2VOO A;  3B6A A;  3BG9 A;  4DYQ A;  2K9N A;  2KZV A;  4LOC A;  2CFO A;  1JTY A;  2K3P A;  2WB1 A;  1IDY A;  2R7D A;  3W3C A;  4CXF A;  3BPV A;  1YQA A;  4IOA F;  4LMY A;  3ASN H;  3K9T A;  4RA2 A;  2CG4 A;  2VJJ A;  1DU6 A;  3D0S A;  5CVI A;  3K4C A;  1ZQ3 P;  3GW2 A;  2FQ4 A;  1OFC X;  2KHM A;  1JGS A;  1RZ4 A;  4JQF A;  4XSX F;  5IP7 J;  2HVR A;  4TV7 A;  5CQE A;  2XSD C;  1RR7 A;  3LSK A;  2ZXI A;  5HOO A;  3LQR A;  4L5J A;  4XKB A;  4CUG A;  3IAM 2;  3Q0U A;  2R7Z J;  2BVM A;  5C3E J;  1W0U A;  2QWW A;  3K4K A;  3IV5 A;  1KU9 A;  1RES A;  4FE4 A;  5IY5 H;  4JYK A;  2CUZ A;  4M3E A;  2VE8 A;  3DLL F;  3RSN A;  2NVU B;  3H5A A;  3CP2 A;  5JLW A;  3FM3 A;  2QSH X;  1XMK A;  4MEX F;  2HGC A;  4C9Y A;  4NC7 A;  4RAF A;  1OCC H;  5B1B H;  3W2V A;  2QQB A;  2VE9 A;  1E3O C;  2HZD A;  3H5R A;  1FMV A;  3S3O A;  3DBR B;  3VSK A;  1R5I D;  1OCR H;  4BQO A;  3ABM H;  3DV8 A;  2JSP A;  1T0F A;  3WHB A;  2FNP A;  4N4O B;  4HNV A;  2W48 A;  1QO0 D;  3H9G A;  2FU4 A;  2JK3 A;  2HKX A;  1BM9 A;  1GV2 A;  3ZMV A;  3RTR A;  3TQN A;  3CC4 I;  4CZZ A;  5K7F A;  2HU9 A;  4F91 B;  1B8I A;  1P92 A;  2EFW A;  4ESF A;  1LKX A;  4I98 B;  4CYC A;  1IV6 A;  1RUO A;  1ON1 A;  4HAM A;  2KRH A;  5F0F A;  2JSC A;  2AS5 F;  3FF5 A;  2V1U A;  5EGO A;  3ZMD A;  3GZN B;  2E1M C;  3A2K A;  2FUG 2;  4P9U A;  1OQY A;  1D0X A;  3ZOB A;  1H89 C;  1U9O A;  1VQ8 I;  3E5U A;  3F8C A;  1G8X A;  3KPH A;  3V8K A;  3JRD A;  4LLN A;  5IOZ A;  3G73 A;  1BI0 A;  4LLL A;  3GFI A;  3G1M A;  3E7L A;  1D1A A;  2CUJ A;  5IT9 K;  4M73 A;  2HYG D;  5E1X A;  5D5W B;  1MBG A;  3Q5F A;  1J5Y A;  1H88 C;  1XTA A;  2LYC A;  1W5T A;  2I8D A;  1KYZ A;  4KMU X;  1MIJ A;  5FJ8 J;  3HSR A;  2VJI A;  2EV0 A;  2K9S A;  4B8X A;  4LB6 B;  5TIS C;  4BNC A;  2XAF A;  3QP5 A;  3OYI A;  1O3S A;  5HLT A;  1IAW A;  5DM6 F;  1MMD A;  3BOQ A;  3CMA I;  3ZMT A;  5K7H A;  3S2D J;  3ZMS A;  3LAJ A;  3CCU I;  2E2H J;  4OMY A;  3OS0 A;  1V5F A;  2R5Z B;  1W36 C;  3WE2 A;  3BR5 A;  4BE0 A;  1I1S A;  2EIJ H;  3QAH A;  1QVT A;  3K2A A;  4HQE A;  3I71 A;  2EWN A;  2X1D A;  1IC8 A;  2STT A;  4K2E A;  1MD0 A;  2JPB A;  4BXX J;  2M45 A;  2VB6 A;  3BT9 A;  4AVZ A;  4F3Q A;  3LSM A;  2R7V A;  1XC5 A;  3BDD A;  1UFM A;  1ULY A;  2O8X A;  3BZK A;  3O2P E;  4HG2 A;  5J8F A;  4LLG F;  1IZ1 A;  5KAI C;  3KIO A;  2K9L A;  2V4J C;  2LVS A;  1S29 A;  1JGG A;  1OCZ H;  2ZXW H;  1RI7 A;  2HVS A;  2A05 A;  3C18 A;  1UG0 A;  1LFU P;  4EGY A;  2K4B A;  2F5E A;  2HQ5 A;  5KVR A;  2V6C A;  5FFX A;  5M5X J;  2Z99 A;  3GXO A;  1FOW A;  1WH7 A;  2CU7 A;  2IRF G;  3BG3 A;  2LC2 A;  2XVC A;  2LFB A;  2KIS A;  3ABT A;  4BY1 J;  4G94 A;  2XAQ A;  2FRH A;  1DP3 A;  3SZP A;  3ELK A;  4YRV A;  3PFY A;  3ZQL A;  2LP0 A;  2RVC A;  2LK2 A;  2WAD A;  2FMY A;  4UB6 C;  3VYU B;  4A3M J;  2OUM A;  5M5Y J;  2KIQ A;  4F7Z A;  1W36 D;  2QM3 A;  2G7U A;  3F8N A;  3Q9S A;  2LDU A;  1G3Y A;  2M0M A;  2MLG A;  4NBQ A;  3IH2 A;  4L9N A;  1MJB A;  1ZRD A;  2MH2 A;  5GPC A;  3DEU A;  3AFH A;  3TP3 A;  1YIO A;  3HKZ A;  5C4X J;  1X3U A;  3FXR A;  3BRO A;  1XD7 A;  2MC4 A;  2UXN A;  5HS9 A;  2PMH A;  5DV5 A;  1R23 A;  3A4C A;  4CCK A;  4DQ2 A;  3ECH A;  2Y9Z A;  4AIH A;  5LGN A;  1RKT A;  1R49 A;  3VYS B;  1HXD A;  1MJ9 A;  1X1B A;  5E3O A;  3ZQG A;  4AC0 A;  3G6E I;  1T08 B;  1RR8 C;  1S5L C;  4M6Y A;  3S2W A;  3B73 A;  4EM2 A;  2JA5 J;  4DIQ A;  5BOX A;  3DKX A;  3MZ8 A;  3L09 A;  3DF8 A;  1LDK B;  4IKF A;  4Y52 J;  2DT6 A;  2E2I J;  1U8B A;  4BY7 J;  3CF5 F;  1K4T A;  2DA3 A;  3KEQ A;  1ONV A;  3CCE I;  2HOE A;  3IRQ A;  2ISZ A;  1T39 A;  1JUS A;  4G6Q A;  1R5H A;  3CJR B;  3GTJ J;  2DT5 A;  3K1M A;  3MEX A;  4M3G A;  1A6I A;  1I1G A;  2FOW A;  2DFE A;  2QLZ A;  3EDP A;  5HDG A;  2HNH A;  2ZC2 A;  2PX9 A;  3SZG A;  3Q9V A;  3K70 D;  9ANT A;  2LLK A;  1EH6 A;  1HQC A;  1Y8Q B;  1X58 A;  3BTI A;  3SXY A;  4FAS D;  3F21 A;  4PGH A;  1Y6I A;  3CCS I;  2DA4 A;  5B66 C;  1IDZ A;  4CCO A;  4N9H A;  3UNG C;  4BAY A;  1Z91 A;  3OR1 C;  3BTJ A;  3FXO A;  5FLV A;  4B3X A;  1N78 A;  3OYN A;  1MH4 A;  1WPK A;  2DA1 A;  2WC2 A;  1IRZ A;  4MFE A;  1X1A A;  2A68 F;  2GXA A;  4C2U A;  2TDX A;  1P4X A;  1T2K A;  3S93 A;  2PEX A;  4GRI A;  4HZF A;  1KQ9 A;  1HOM A;  3EUA A;  2P0W A;  4Y17 A;  4ZJZ A;  2RDP A;  3ABU A;  2DBB A;  2XAG A;  3W6J B;  3F22 A;  3IWF A;  4M6V A;  1UST A;  3RPU D;  2X85 A;  2IXS A;  1BL0 A;  2HOA A;  1EA3 A;  2NVQ J;  2YUS A;  4HF1 A;  3V8L A;  1JUM A;  3EUH C;  5FD6 A;  3COA C;  4LJZ F;  2GM4 A;  3ESW B;  3H3U A;  1R1T A;  2JJ7 A;  2MYS A;  2BYV E;  1Y0N A;  4WXH A;  4IHX A;  1VQO I;  3FKJ A;  1USS A;  1JHH A;  2KPM A;  1DQU A;  3C2H A;  2WWY A;  3AL0 C;  1FEX A;  4U7B A;  4A12 A;  4EAT A;  2ZJP F;  1S72 I;  4GFB A;  4EM1 A;  2V7F A;  3ROU A;  2BOL A;  2MG4 A;  3S1N J;  2XB5 A;  1H9T A;  2ESN A;  3K1P A;  2HYF A;  4PSX A;  1Z77 A;  1YI2 I;  2NS8 A;  3RKX A;  3OYC A;  4UV9 A;  4N0B A;  4I7H A;  4ZZD A;  1J09 A;  4XLE A;  4CCN A;  1ZRE A;  4M3D A;  3KZY A;  2VC0 A;  1B72 A;  2V1X A;  2X48 A;  1XDS A;  1IW7 F;  1ODD A;  1HLV A;  2F6C A;  3CMY A;  3ZQ7 A;  1LE8 A;  4G6D A;  1FT9 A;  2KIM A;  2IAI A;  3GF2 A;  4KUM A;  5BNG A;  1VQM I;  3DTK A;  3QU6 A;  2E5N A;  1M1E B;  2OTJ I;  4V2G A;  3TED A;  3K10 A;  2HQA A;  4BBS J;  3WU1 B;  2MC3 A;  3IRR A;  3CCQ I;  1ZG1 A;  4D5C A;  2F2E A;  2V9K A;  2X6W A;  5D8K B;  3KP7 A;  4J01 A;  4HX7 A;  4A3J J;  1Y0U A;  3S16 J;  3KEO A;  1WJA A;  5F6F A;  3FZV A;  1AA7 A;  2V6E A;  3GWZ A;  2G7H A;  1SD6 A;  3GME A;  2H8R A;  1SAN A;  3S1R J;  4G7O F;  3O3K A;  1IV8 A;  1G2H A;  5CQG A;  1SEU A;  1VQ7 I;  4A3D J;  4WXD A;  3CJT B;  3HRM A;  1LB2 A;  1WGX A;  3CME I;  4BQA A;  1YO5 C;  3QU3 A;  4ANJ A;  2P5V A;  4XLA A;  5CKT A;  2KQR A;  2B7E A;  2LRE A;  1H9G A;  4D1Q A;  3HPH A;  4ENK A;  2MA3 A;  5FGM A;  1K78 B;  4PCQ A;  1KGS A;  4XOT A;  5HLI A;  4AUX A;  3EUK L;  4UVB A;  1R7J A;  3RKY A;  1HKS A;  4CCM A;  1XX5 A;  4L0Z B;  2H1L A;  3W6V A;  1J9I A;  2MW8 A;  4IQ4 A;  3HIF A;  1WI3 A;  3JAM K;  2IS1 A;  1R71 A;  1S7A A;  5FLX K;  2M8G X;  4GYI A;  4KN4 X;  3BTL A;  3HOZ J;  4F92 B;  3J81 Z;  2E34 A;  2R4G A;  1L3L A;  4RGR A;  1VF9 A;  3SZT A;  1ITY A;  1UMQ A;  2AHQ A;  2HQN A;  1ZTR A;  3RPQ A;  3GO5 A;  1DDN A;  3FK7 A;  4P9F A;  4BHC A;  3HGG A;  2VKH A;  1EKE A;  4PSW A;  2Z1D A;  1HA8 A;  4YG2 F;  4HDV A;  3RKQ A;  2QKM B;  2GZW A;  1ETW A;  2K40 A;  2CV2 A;  2XSJ C;  4A69 C;  5BPD A;  1OYY A;  1BR2 A;  1LJ9 A;  2KIF A;  5KNL A;  5IOY A;  5EG0 B;  2BW3 B;  2DN0 A;  4A0Y A;  2EK5 A;  5FLM J;  3SQN A;  3OS2 A;  1DGR M;  2H6B A;  3F8M A;  2PQ8 A;  1ZRF A;  2OTL I;  4C3H J;  3L7W A;  2R7R A;  1TWA J;  5E8G A;  3GTL J;  1UAA A;  5H6R A;  3J7Y J;  1JTX A;  2CRG A;  2DO7 A;  3A0H C;  4FX4 A;  2ZCW A;  4LK0 F;  3RQI A;  4PJM A;  3BC8 A;  1P7I A;  4AVP A;  3VWB A;  4YFN F;  2I5U A;  2R3S A;  5FB2 A;  3O6B B;  2IPQ X;  2NVT J;  1JJ6 C;  1POG A;  1YIT I;  3HOU J;  1E2X A;  5E17 F;  1MW7 A;  2JPC A;  4W97 A;  2MBF A;  2B63 J;  1GLN A;  1U0J A;  1UHW A;  3K69 A;  2PMU A;  2W24 A;  3CJN A;  4DYC A;  3IWZ A;  3BPX A;  5HOD A;  4D7M A;  4E7K A;  3TGN A;  5EDN A;  3WTU C;  3QPS A;  4GGG A;  5FD5 A;  5ICF A;  4O6J A;  3KLO A;  1PUE E;  2Z5U A;  3IHU A;  2B0L A;  5D8L B;  2JN6 A;  3DP7 A;  2DDA A;  3VEP A;  1W7P B;  3E6M A;  3QQA A;  4ON0 A;  2QA4 I;  1X1P A;  4F52 A;  2QYO A;  4ZYE A;  2W85 A;  2OPT A;  2M7B A;  2PJR A;  3S1M J;  4C30 A;  5IPA A;  3HOV J;  2RQQ A;  3JRE A;  3CES A;  2LF8 A;  4HYE A;  1HW5 A;  1YJN I;  2IGK A;  5LEJ A;  1QPI A;  3HPG A;  4A3E J;  1BA5 A;  3K4L A;  2GA2 A;  1FTZ A;  1WQ2 A;  1GXQ A;  2KDO A;  2EIL H;  1JI8 A;  2OBP A;  1QNT A;  2GOM A;  2GIZ A;  5E1Z B;  5KCM A;  2Z33 A;  5DTD A;  5JR3 A;  3OYA A;  4BEH A;  2VBY A;  4EJU A;  2H6C A;  1YTY A;  1WI9 A;  2DYR H;  3DQV C;  3TO7 A;  2R5Y B;  5DUK A;  5EGO B;  3KP5 A;  2DTZ A;  4HW0 A;  1TNS A;  3B02 A;  5EZH A;  1XGM A;  2R5Y A;  2K86 A;  1GXP A;  5E20 A;  4LGW A;  3CJQ B;  1A04 A;  5F27 A;  4U7D A;  3OWT A;  4BQQ A;  1PDN C;  4M74 A;  3VPR A;  4ETS A;  3CLQ A;  5LD2 C;  4P55 A;  3JRH A;  3I3L A;  2DOE A;  3BZC A;  1K78 A;  1SD7 A;  1REP C;  1U8R A;  4CA0 A;  4W1U A;  1R9T J;  1Z7U A;  3BG6 A;  3E3V A;  2Z9O A;  3WHC A;  4Z2Y A;  1SVL A;  1ERD A;  2ICW G;  4KNY A;  2JRT A;  3WGG A;  1IJW C;  3P9I A;  4A3B J;  2A69 F;  3H0D A;  2M2E A;  3KCC A;  3HDD A;  2DK5 A;  3MVP A;  3AKZ A;  3PNT A;  2RKH A;  3HOT A;  2FXA A;  3J7A Y;  3LA2 A;  2W4S A;  1MNE A;  4XRS A;  4X0G A;  3ZMZ A;  3T1B A;  3LSI A;  2YS9 A;  1FP2 A;  5M5W J;  4G12 A;  2B9S A;  3A03 A;  4GYG A;  1Z9C A;  1B59 A;  3KFW X;  1JT6 A;  4KIT B;  5M3M J;  1XN7 A;  3S17 J;  1FOX A;  1ZK8 A;  2RNJ A;  4E4H A;  5E79 C;  1U6G A;  2EIM H;  1F4K A;  5LRR A;  5J1U A;  4RAY A;  4QTR A;  4IQJ A;  4WF2 A;  3JR9 A;  4AM3 A;  1BI1 A;  1UG2 A;  3I59 A;  2A6H F;  2WV0 A;  4GO1 A;  1Z0X A;  2HOT A;  3J7Z I;  3OYL A;  2HS5 A;  2TRT A;  2ZME A;  4C3I J;  3ZP5 A;  1TQM A;  3HEF A;  2XC7 A;  2Q0O A;  4LG0 B;  4X6A J;  2ME0 A;  4IHY A;  1U5T A;  2ELJ A;  4I6Z A;  1SD5 A;  1NTC A;  1FTT A;  1MGT A;  5JLX A;  2ISY A;  3GTK J;  2DPU A;  2STW A;  3CC7 I;  1F43 A;  1SMT A;  5IT3 A;  1XSX A;  2NVY J;  4D5F A;  4I0B A;  4XR6 A;  2P8T A;  2V9V A;  2BXZ A;  3W2W A;  3DTE A;  1F9N A;  2FQ3 A;  2O9L A;  3LSG A;  5HS7 A;  1IUY A;  2VQL A;  4MQ9 F;  3IL2 A;  3WGH A;  4YFX F;  3WTY C;  1XCB A;  1LE8 B;  4Y15 A;  3VYR B;  3JSO A;  4D9J A;  4XKC A;  2R7T A;  4BS9 A;  3ZMU A;  4PJN A;  3BJ6 A;  5LFA A;  3IUO A;  3W2A A;  1ZYR F;  1YHQ I;  4E7H A;  5FKK A;  1K6Y A;  1TQP A;  1UHM A;  4XIC A;  3MD2 A;  2A5Y B;  1WJD A;  3LSJ A;  2X0L A;  2D1H A;  3E6D A;  4UUS B;  1G3T A;  3MFK A;  4HA8 A;  3C3W A;  1XB4 A;  3R4K A;  4AU7 A;  2EQR A;  3QYF A;  3DU5 A;  2IGM A;  5GP9 A;  3AAF A;  2M34 A;  1JUP A;  5LEK A;  2VJ4 A;  2W84 A;  3OYK A;  2LY2 A;  2NXN B;  3TL4 X;  1IXC A;  3H35 A;  3S2H J;  2QZ8 A;  4L5E A;  4MQV A;  4I0A A;  1B8I B;  4UXN A;  5F1J A;  3N05 A;  3BP8 A;  3S14 J;  4IO9 F;  1D0Z A;  2EFQ A;  2VN2 A;  1IRX A;  5ICC A;  3HHG A;  3LL7 A;  1ETX A;  4Y13 A;  2Y0S A;  2BGC A;  4MIM A;  4BXU A;  4KIF A;  4XMY A;  2TCT A;  3IP4 B;  4IRG A;  2DPD A;  2X9D A;  3I4N J;  1PYV A;  5DD8 A;  4IX7 A;  4I99 C;  4XSZ F;  1FYK A;  1SFK A;  1R22 A;  2KLO A;  3CQZ J;  3F8B A;  3R60 A;  3CLO A;  2R7Q A;  3PFI A;  4IHV A;  4BXF A;  2YX7 A;  4EV0 A;  5A2Q Z;  1YJW I;  2L3D A;  3V8J A;  1VQL I;  4HLX A;  2VC1 A;  2KJB A;  2L9V A;  3LAP A;  3L2Q A;  2R0Q C;  2HOS A;  4LB5 A;  5EJC A;  1WWX A;  5KHD A;  4CSW A;  2CFX A;  2VIX A;  5D4S A;  3H0G J;  3U2R A;  2CH0 A;  1OIS A;  5DD4 A;  2CJJ A;  5B1A H;  1V3F A;  2V1D A;  5LHH A;  4EM0 B;  4ZTF A;  1D1C A;  1QZY A;  1ZLK A;  2LY9 A;  2HPI A;  3UKG A;  1W5S A;  5E3N A;  4EJT A;  3C7J A;  1TTY A;  3HBL A;  2C6Y A;  2OF7 A;  1U5T C;  3PNV A;  1G3W A;  2JQ7 A;  1TLH B;  3GFJ A;  2NNY A;  3S15 J;  4ZZL A;  1JKP C;  2ZME B;  3VOD A;  1PUF A;  3S3N A;  1VFC A;  2HTJ A;  4Q48 A;  5DEQ A;  1LVK A;  3TDU C;  3HUG B;  2QQ9 A;  2GLO A;  4DGW B;  4FCY A;  5LHG A;  3QPL A;  4LIV A;  5D6E A;  1STZ A;  1X2M A;  2F5V A;  4JX4 A;  4BBR J;  3RJP A;  2XAU A;  3MKW B;  1HSJ A;  2CWE A;  1MBF A;  4BU2 A;  3JTH A;  2COB A;  5IT9 Z;  1ZGJ A;  1FSH A;  2GXB A;  2DOF A;  3OOP A;  5GAE J;  2OAZ A;  4B44 A;  2VUM J;  3ASO H;  4M9S A;  1GT0 C;  4KIG A;  3WTV C;  2QQA A;  4ITV A;  2EFP A;  4QSH A;  2XPU A;  1ETV A;  3KP6 A;  3FM5 A;  1FPQ A;  2XRL A;  3G1O A;  3TDZ C;  3ZXS A;  3KYL A;  5GTH C;  4PK4 A;  1AKH A;  4XK4 A;  4IHW A;  4II2 A;  4IJA A;  2LBF A;  2WAQ N;  3L2W A;  3GX4 X;  3A01 B;  3QP6 A;  2VPR A;  3M8J A;  4RGS A;  3DPT A;  2OA4 A;  1T8I A;  3KET A;  2DCE A;  1J7K A;  1V54 H;  3L9F A;  3GFL A;  4B09 A;  5EYR A;  3OYG A;  1R5G A;  3ERM A;  2FD5 A;  1T56 A;  3GUD A;  4MO7 A;  1I5Z A;  4R79 A;  5L3G A;  1T33 A;  4BAC A;  3J80 K;  5KK1 A;  2VBW A;  1MBH A;  4BEH B;  1WJ5 A;  3AG2 H;  3HSF A;  2FEZ A;  1W4M A;  2E7X A;  2GA1 A;  5TJJ A;  2P5L C;  4NC6 A;  1SFO J;  3EET A;  4KIS A;  2BBY A;  2CSO A;  1L0O C;  1Z05 A;  2EV5 A;  1IN6 A;  1JE8 A;  2EIN H;  3HOW J;  2A5W A;  2JA6 J;  4QPQ A;  2VBZ A;  4DYR A;  3ZPL A;  1MNM C;  3PO3 J;  3HL2 A;  3FXK A;  3KZI C;  5H20 A;  2PLY A;  2OV7 A;  3CC2 I;  3IH4 A;  4ZH4 F;  4XOP A;  2EPF A;  2CMP A;  4UVA A;  3S32 A;  1FBQ A;  2QBY A;  3SDB A;  2X6Y A;  4IRH A;  4U88 A;  2VON A;  3GZ6 A;  5AIP A;  1UCR A;  3FXL A;  2ID3 A;  4KDP A;  1R4M B;  3CO7 C;  2VBX A;  2QEX I;  2Z2S B;  3KX2 A;  4CH7 A;  2JA8 J;  5ILV A;  5HNF A;  5JVG F;  2R5Z A;  4WXC A;  3JTG A;  4I76 A;  2ESH A;  3MN2 A;  4DNC A;  2KDZ A;  2NS0 A;  1WJC A;  3LA3 A;  2H27 A;  2ZBK A;  4HX4 A;  2PG4 A;  5IP9 J;  4F55 A;  2L4M A;  1X3W B;  2VLA A;  1VQ9 I;  4LIU A;  1SAX A;  3WU2 C;  2AO9 A;  5ED4 A;  2XF5 A;  5ICG A;  5EG0 A;  4EVI A;  1WHU A;  2GIV A;  2HXO A;  1Y39 A;  5JI6 A;  1WVR A;  1F36 A;  5DUI A;  1MMS A;  1XSV A;  3JW4 A;  1U2W A;  4E6K G;  1TW2 A;  2XF7 A;  2CV0 A;  1GHC A;  2WA0 A;  3WG9 A;  1YX3 A;  2JRM A;  2E5Z A;  3BR1 A;  4BDY A;  3I0T A;  4S05 A;  1HST A;  1T95 A;  2DAO A;  5F08 A;  4HV5 A;  4QIW N;  3I4M J;  2OZU A;  3O8H A;  2O6G E;  3IKT A;  2E19 A;  3FBN B;  2D45 A;  2LSO A;  4HNU A;  1CF7 B;  2JWT A;  5LRS A;  3M1E A;  2LR8 A;  1UJ8 A;  3DPU A;  1X4O A;  2E1M B;  2IW5 A;  3H5N A;  2AXL A;  1GVJ A;  4FT8 A;  3WG7 H;  1JKO C;  3RKW A;  2HZT A;  2V1N A;  2PI0 A;  4KMF A;  1MMG A;  2F5C A;  3CZ6 A;  4JOM A;  2R7F A;  3WTT C;  3HTS B;  3NAU A;  1B72 B;  4CIC A;  3DPL C;  4UV8 A;  2X4H A;  2JTV A;  2FOK A;  4IF4 A;  3MAJ A;  3R0J A;  5HDK A;  1ZG3 A;  2Y69 H;  2O3F A;  2BE5 F;  2O0Y A;  3M3Y J;  4JK1 X;  2HWV A;  5DCM A;  1X4P A;  1J59 A;  1J75 A;  5LGU A;  4Y33 A;  4A3L J;  4XKW A;  4P1W A;  3FX3 A;  4RDU A;  3HZJ A;  5JHF A;  3A01 A;  1P7J A;  3PO2 J;  2KP6 A;  2L5Q A;  2ELH A;  2LY1 A;  3T8T A;  2CQX A;  3R0A A;  2DMP A;  5HNH A;  2XIG A;  4CCL A;  4RGX A;  3UR3 C;  2P6T A;  4MEY F;  1ZRC A;  1OMI A;  3V4G A;  2IT0 A;  2J5P A;  3NWS A;  2OQR A;  2BY0 A;  3DEW A;  2FML A;  4S0H B;  3KP4 A;  5FO5 A;  3GTO J;  4MFD A;  1FX7 A;  3TW7 A;  2FBI A;  1I50 J;  5GTI C;  1VQN I;  2W7N A;  2E1C A;  1FIP A;  2YX4 A;  4HEA 2;  4YIR X;  2KT0 A;  2RGV A;  1K61 A;  4XLP F;  2YU3 A;  3CCL I;  3LA7 A;  2Y2Z A;  2E36 A;  2L7K A;  2YU9 J;  4MTE A;  2K02 A;  3CDI A;  3E0J B;  2WY8 Q;  1DGW Y;  3K0L A;  2JUG A;  4JX5 A;  4IXA A;  2P81 A;  3CCM I;  3OYJ A;  3GEZ A;  1BW5 A;  3FMQ A;  3F0C A;  2VQH A;  3RQ4 A;  1QPM A;  4M3B A;  4CZC A;  3E1S A;  1C0W A;  2K7L A;  1KQ8 A;  2DDB A;  4AIJ A;  4PGG A;  3KYC B;  5FRM A;  2EJR A;  1JKR C;  1RRJ A;  5D6F A;  2VQC A;  3FK6 A;  3H3Z A;  3K2Z A;  4XN3 A;  3CCR I;  2ECC A;  2LOO A;  1A36 A;  2GQQ A;  4E7S A;  1B9M A;  4C3J J;  1QZZ A;  1FYL A;  2K5C A;  1OYI A;  3OSG A;  3U21 A;  3ERE D;  2OD5 A;  1J0R A;  4C2M J;  1Z7L A;  2N8G A;  4KT5 C;  3ZQQ A;  1BOA A;  1OCT C;  3RZO J;  2OZ6 A;  2PFB A;  5CJ9 A;  3VSL A;  1Q1H A;  4P5O A;  5ILS A;  3SYT A;  3G4S I;  3FIS A;  3E6C C;  3I64 A;  4HPQ A;  2DA2 A;  1ZAR A;  4J19 A;  3VDX A;  2IS2 A;  1MMA A;  4U0W A;  4L9V A;  3RZD J;  2R7X A;  1Z1D A;  1SVM A;  4FET A;  1LDJ A;  3D5S C;  2ACJ A;  2DA7 A;  5IYB J;  3U1K A;  2CYY A;  4HDU A;  4LG0 A;  1OLT A;  3H1C A;  3VFZ A;  2BY3 A;  2KIU A;  1CGP A;  4HLY A;  3B6C A;  2W1O A;  1YIJ I;  2QUF A;  1CF7 A;  3TBI A;  4IOC F;  2OU2 A;  1MDM B;  1P6R A;  4ZTJ A;  2HDD A;  2QEN A;  2EB7 A;  2CW7 A;  2CQK A;  1ZGA A;  4M71 A;  3SFI A;  1FZP B;  4U0V A;  4HF0 A;  3GTQ J;  3K4B A;  4BE2 A;  1MND A;  2XGX A;  5L3E A;  1SMY F;  3KEY A;  3AL0 B;  2NOJ B;  1IN5 A;  3OYH A;  1N77 A;  4OWR B;  3ECO A;  1VQK I;  4OAZ A;  1JHF A;  3M8F A;  5J6X A;  1XGS A;  2ZJ2 A;  1Y56 A;  3T0Y A;  4IHT A;  4ENN A;  1D8J A;  1NHA A;  2X51 A;  4PJL A;  4JP0 A;  2LF7 A;  3ZQH A;  3ZQF A;  1O3Q A;  2WBM A;  4LD5 A;  3HHH A;  2ZO4 A;  2DMU A;  3L1P A;  4BL0 B;  2ELK A;  3OSF A;  3LMM A;  4NQW A;  2DTR A;  1WKM A;  3TKY A;  4DOZ A;  3G1L A;  2MAB A;  3OV8 A;  4A5M A;  5JVT A;  3Q0V A;  1R36 A;  2Q1Z B;  5TRD A;  4NB5 A;  2LMD A;  4I02 A;  4WX9 A;  3QPH A;  3E6B A;  2P5K A;  5JFR A;  1RUN A;  1MMN A;  2Y0M A;  2A07 F;  5GPA A;  2EH3 A;  3K4M A;  1OKR A;  1D8K A;  4XLN F;  4UUS A;  2MD5 A;  3Q0W A;  1CQT A;  4KA4 A;  2L7F P;  3MQ0 A;  2VL8 A;  2D5V A;  1W5C C;  4MNU A;  1IRG A;  4L9J A;  3JCU C;  2OCE A;  3FXQ A;  5EZG A;  3PSF A;  2KRF A;  4NNJ A;  1YLF A;  3OS1 A;  2GWR A;  1TW3 A;  4BHB A;  1YOV B;  4XLF A;  3OIP A;  1ETK A;  1HW1 A;  1GDT A;  2ME6 A;  1XCV A;  2JVH A;  4RMN A;  4RB2 C;  3C1D A;  5L3D A;  4WWC A;  2QKL B;  1ZR2 A;  2Y31 A;  3F3X A;  3M07 A;  4B1R A;  1WCM J;  3KE2 A;  4ZDO A;  2CUF A;  4BKX A;  4Q47 A;  1YS7 A;  3HRS A;  1WJF A;  1Z67 A;  2IGN A;  2L7Z A;  1AU7 A;  3DEE A;  2AQF A;  1B1B A;  3HC7 A;  2OC6 A;  2O61 A;  3PQK A;  3FBI B;  2E2J J;  3F8F A;  1BC7 C;  1O7F A;  1QGP A;  5F1R A;  3OIQ A;  1PP7 U;  2O5R A;  2YSR A;  2GOX B;  1FJL A;  3F9K A;  1IN4 A;  4ZYD A;  3A1Y A;  4S04 A;  2PMZ N;  3GTG J;  1LEB A;  1KYW A;  4FQG A;  5AIQ A;  3RPU A;  1QQI A;  2Q2E A;  3FXM A;  3RCO A;  1FBS A;  3FXJ A;  1ON2 A;  5BMZ A;  4XLC A;  2E1O A;  5FRN A;  2JVG A;  3TO9 A;  5J8C A;  4LK1 F;  1ZLJ A;  3DFG A;  1SAU A;  2RN7 A;  5BQT A;  3M4O J;  3X2Q H;  1QHH D;  1FSE A;  3PIP F;  1PP8 F;  5HVQ C;  1FWZ A;  2VJ5 A;  2IS6 A;  3QPT A;  4UY8 I;  2JA2 A;  3RYP A;  3RYR A;  2MGQ A;  1ZH5 A;  3LSP A;  1OYW A;  1MDM A;  2DA5 A;  1XPX A;  1KU7 A;  3BR6 A;  1VQ6 I;  1N75 A;  3ABK H;  2DJN A; 
#chains in the Genus database with same CATH homology
 4RB0 A;  4GCV A;  3FMR A;  2K27 A;  1S8N A;  5DCM B;  1O57 A;  2FBH A;  4ESB A;  2V79 A;  5CYV A;  2EA2 A;  1AOY A;  3BWG A;  1TNT A;  2EFN A;  3FXU A;  1ZAO A;  4YIF A;  4L9T A;  3N4M A;  2YR2 A;  4OIR F;  5E18 F;  4HV6 A;  4ENJ A;  3CUQ A;  1P2F A;  1VTN C;  1G6N A;  3CUQ B;  2P4W A;  4G9Y A;  4RGU A;  3L2C A;  5LBQ A;  4UNO A;  1YW7 A;  1T38 A;  3U9G A;  4G7H F;  4I2O A;  3I53 A;  2ZXJ A;  3HRU A;  4E70 A;  3R61 A;  3LST A;  2HTS A;  1LQ1 A;  2RC4 A;  4AWX B;  1R1V A;  3GZ5 A;  3WGI A;  4UHT A;  4JBA A;  1K6O A;  3FMS A;  2E7W A;  1S6L A;  5CVR A;  4QLC U;  4BYY A;  4Q5S F;  4CYD A;  4OIN F;  1DPU A;  2MLK A;  5CVJ A;  3GFM A;  3KZZ A;  3WTX C;  2YPR A;  1R00 A;  2DW4 A;  1XGN A;  3NRV A;  1WRJ A;  2P7C B;  4BHP A;  4IHS A;  2IA0 A;  2CO5 A;  3E97 A;  4XRF A;  3ISP A;  4WK8 F;  1IXS B;  4A6E A;  3WTS C;  2G9W A;  1FLI A;  4A6D A;  3D5L A;  2IA2 A;  3WE3 A;  3BY6 A;  1KU2 A;  5ICE A;  2FF4 A;  1K79 A;  1LNW A;  2XRN A;  2W57 A;  4M6X A;  1U5T B;  1G3S A;  4A0X A;  4M72 A;  1XGO A;  1HBX G;  4BH9 A;  2HKO A;  1F1Z A;  2D1V A;  4IVN A;  4MHG A;  3ZN0 A;  5FLX Z;  4NHJ A;  3RI4 A;  2A61 A;  1LVA A;  4MTD A;  2KKO A;  4ESJ A;  2HFH A;  3M8E A;  5D5U B;  4IPA A;  3RDI A;  3F6O A;  5LHI A;  2L01 A;  2EFO A;  1ZN2 A;  5ILU A;  1O3T A;  1WSU A;  1W7P D;  2P7V B;  2BEO A;  2NYX A;  4L18 B;  2L54 A;  1LEA A;  3VOE A;  3REO A;  2NRA C;  3F6V A;  1YG2 A;  2NNN A;  3CTA A;  2CGP A;  1S3J A;  2H94 A;  4RB3 C;  2UXX A;  3K1N A;  4EJV A;  4CGZ A;  3SHF A;  4A0Z A;  2XUB A;  4R8H A;  2DLL A;  3GYH X;  4FHT A;  2ZKZ A;  1D5V A;  2ZNY A;  1BBY A;  3BJO A;  3I4P A;  4YII A;  2D2W A;  1SFX A;  3N97 A;  3ML6 A;  1YFH A;  3F72 A;  5D4R A;  4HQM A;  2UWM A;  3H92 A;  2DU9 A;  5AON A;  2HEO A;  3E5X A;  4OIQ F;  3HYI A;  5E8I A;  3DXJ F;  3LFK A;  2DFI A;  3IC7 A;  3HUG A;  1Z6T A;  1R1U A;  4R1H A;  2DI3 A;  1YW8 A;  3T5X A;  2Q8K A;  2RQP A;  4G8X A;  5DDG A;  4KFC A;  3SFZ A;  3MCZ A;  2L02 A;  3KLN A;  3HOS A;  2O03 A;  3FHZ A;  1SFU A;  1DP7 P;  4UVC A;  5K5Q A;  1IN8 A;  4KN7 X;  3WTZ A;  1BI2 A;  3ZN1 A;  5L3F A;  2VT2 A;  3RIR A;  3I5U A;  4RAZ A;  5HLG A;  5EEG A;  3NEU A;  1E17 A;  4L5I A;  2VOD A;  1IF1 A;  3BJA A;  5FFZ A;  3GVA A;  2L4A A;  3WOD F;  2HDC A;  2W25 A;  4HX8 A;  2XV4 S;  2FNA A;  2FSW A;  3PQJ A;  1EH7 A;  2EV6 A;  4N9I A;  4PDK A;  5CLS A;  3EYY A;  4CDG A;  1O3R A;  2XRO A;  2HR3 A;  4FX0 A;  3DKW A;  4OU0 A;  4Q4Z F;  3EYI A;  1B6A A;  3EUH A;  5CVV A;  2KJC A;  3CUO A;  5HDN A;  1ZHF A;  1EH8 A;  2FBK A;  5L3C A;  1DUX C;  3V7R A;  2QBY B;  3F23 A;  4U0Y A;  4UUV A;  2VXZ A;  1U3E M;  2XKO A;  2QVO A;  4ENM A;  1RNL A;  4OMZ A;  2ZFW A;  3BZ6 A;  3CDH A;  2EA4 A;  2LNB A;  5H6Q A;  1FY7 A;  1TBX A;  4M9Z A;  1IXR C;  5BS6 A;  3TO6 A;  1JXS A;  4EGZ A;  4MGR A;  1UB9 A;  2FA5 A;  2P6S A;  1R58 A;  4A5N A;  1BIB A;  4CO8 A;  3I59 B;  5BPI A;  4OOI A;  4ASN A;  1I27 A;  4ZYH A;  2XAS A;  4P96 A;  4O5V A;  4XBF A;  2PJP A;  1S7O A;  6PAX A;  1FOK A;  2IA1 A;  5A2Q K;  1FYM A;  2OQG A;  1FNN A;  3ULQ B;  4YFK F;  1MJA A;  1W7P A;  2M87 A;  4EQQ A;  1D3Y A;  2PBI A;  5ERI A;  3MWM A;  5K5R A;  4H0E A;  1KA8 A;  3J80 Z;  2Y75 A;  3HTU A;  1J2X A;  4EJW A;  5HLH A;  4RS8 A;  2DQL A;  4QWQ A;  2F5D A;  1SFE A;  1U78 A;  5HS8 A;  1LDD A;  3KP3 A;  1DPR A;  3E5Q A;  4ZYG A;  4CHU A;  1T98 A;  3QRF F;  1XMA A;  1BIA A;  4HBL A;  5L3B A;  4D0P A;  3KP2 A;  1YS6 A;  3CO6 C;  1BJA A;  2CW0 F;  3G3Z A;  4WCG A;  2JZY A;  2GXG A;  4OIO F;  2M8E A;  2LKP A;  2RV8 A;  5LGT A;  1YYV A;  1FBU A;  2NAZ A;  3P9C A;  1B9N A;  4KYW A;  4I01 A;  1T6S A;  3TOB A;  3EQL F;  2VT3 A;  2M30 A;  2PN6 A;  3FWE A;  1HW2 A;  2XHK A;  1P4W A;  1I6X A;  2DK8 A;  2Y48 A;  4L0Y B;  1HKT A;  2E1N A;  5E1W A;  1O7L A;  3J81 K;  1BN5 A;  1AWC A;  3QOP A;  4AIK A;  3T8R A;  3JAM Z;  2JT1 A;  4M9X A;  2M1B A;  1BI3 A;  1KU3 A;  2IJL A;  3W6K B;  2A6E F;  3MZY A;  2XAH A;  4LFU A;  5DYM A;  4HF2 A;  2XKP A;  2ETH A;  1P4A A;  2MH9 A;  2GAU A;  4OIP F;  2XAJ A;  5DCF A;  2COM A;  1B4A A;  3L00 A;  1ZG5 A;  1QBJ A;  2FE3 A;  2H09 A;  5D5V B;  2HQR A;  3TOA A;  3MZH A;  3CUQ C;  2VOP A;  3LQQ A;  3HRT A;  1FC3 A;  5K1Y A;  1OR7 A;  2K4J A;  2IVM A;  4GXO A;  4EMS A;  4HOB A;  1RIO H;  2IP2 A;  2ADU A;  4EJO A;  1IN7 A;  1YW9 A;  3P9K A;  1TQI A;  1XDU A;  3GLX A;  2BV6 A;  3P7N A;  1KQ0 A;  1FP1 D;  3LWF A;  2WTE A;  2DQR A;  4O3M A;  2A3S A;  2Z3Y A;  3IKV A;  3WU0 A;  4AD9 A;  3NQO A;  1OPC A;  5D5X B;  1MKM A;  1BC8 C;  4I09 A;  2UZK A;  1EV7 A;  5CVU A;  1G4D A;  4IRI A;  2F5F A;  1Z6R A;  2ZNZ A;  4KIB A;  4PZJ A;  3U1D A;  2J5O A;  3R6S A;  3HSE A;  4KIC A;  1MZB A;  1V4R A;  2M5W A;  4G7Z F;  3JSP A;  1SD4 A;  4A2U A;  5JHU A;  3J7A O;  1K7A A;  3V7S A;  1HKQ A;  5F64 A;  3I58 A;  1F5T A;  1IRF A;  5K5O A;  1XSD A;  3M9A A;  5EEH A;  3WTW C;  5LLQ A;  3M7G A;  3I54 A;  3VB2 A;  1H0M A;  3V7C A;  2VOO A;  2R7D A;  4CXF A;  3BPV A;  1YQA A;  4LMY A;  3K9T A;  2CG4 A;  3D0S A;  5CVI A;  3GW2 A;  1JGS A;  1RZ4 A;  4JQF A;  4XSX F;  4TV7 A;  5HOO A;  3LQR A;  4L5J A;  2QWW A;  1KU9 A;  2VE8 A;  3FM3 A;  1XMK A;  4MEX F;  2HGC A;  2QQB A;  2VE9 A;  3DV8 A;  1T0F A;  2FNP A;  1QO0 D;  2FU4 A;  2HKX A;  1BM9 A;  3ZMV A;  3RTR A;  3TQN A;  4CZZ A;  1P92 A;  2EFW A;  4ESF A;  4I98 B;  1RUO A;  1ON1 A;  4HAM A;  2JSC A;  2AS5 F;  3FF5 A;  2V1U A;  3ZMD A;  4P9U A;  3E5U A;  3F8C A;  3V8K A;  4LLN A;  3G73 A;  1BI0 A;  4LLL A;  3GFI A;  5IT9 K;  5D5W B;  2HYG D;  4M73 A;  5E1X A;  3Q5F A;  1J5Y A;  1W5T A;  1KYZ A;  4KMU X;  3HSR A;  2EV0 A;  4B8X A;  4LB6 B;  4BNC A;  2XAF A;  3QP5 A;  1O3S A;  1IAW A;  3BOQ A;  3ZMT A;  3ZMS A;  3LAJ A;  4OMY A;  3WE2 A;  1I1S A;  3QAH A;  4HQE A;  3I71 A;  2EWN A;  2STT A;  4K2E A;  1MD0 A;  2JPB A;  2M45 A;  3BDD A;  1UFM A;  1ULY A;  2O8X A;  3O2P E;  5J8F A;  4LLG F;  1IZ1 A;  1S29 A;  1RI7 A;  3C18 A;  4EGY A;  2K4B A;  2F5E A;  5KVR A;  2V6C A;  5FFX A;  2Z99 A;  3GXO A;  2IRF G;  2XVC A;  3ABT A;  4G94 A;  2XAQ A;  2FRH A;  3SZP A;  3ELK A;  2RVC A;  2FMY A;  4F7Z A;  2QM3 A;  2G7U A;  3F8N A;  3Q9S A;  2LDU A;  1G3Y A;  2MLG A;  4L9N A;  1MJB A;  1ZRD A;  2MH2 A;  3DEU A;  1YIO A;  1X3U A;  3FXR A;  3BRO A;  1XD7 A;  2UXN A;  5HS9 A;  2PMH A;  5DV5 A;  1R23 A;  4DQ2 A;  3ECH A;  4AIH A;  5LGN A;  1HXD A;  1MJ9 A;  4M6Y A;  3S2W A;  3B73 A;  4EM2 A;  5BOX A;  3L09 A;  3DF8 A;  1LDK B;  3KEQ A;  1ONV A;  2HOE A;  3IRQ A;  2ISZ A;  1T39 A;  4G6Q A;  1R5H A;  2DT5 A;  3K1M A;  3MEX A;  1I1G A;  2QLZ A;  3EDP A;  5HDG A;  3Q9V A;  1EH6 A;  1HQC A;  3SXY A;  3F21 A;  4PGH A;  4N9H A;  4BAY A;  1Z91 A;  2WC2 A;  2A68 F;  2TDX A;  1P4X A;  1T2K A;  2PEX A;  4HZF A;  1KQ9 A;  4Y17 A;  2RDP A;  3ABU A;  2DBB A;  2XAG A;  3W6J B;  3F22 A;  3IWF A;  1UST A;  4HF1 A;  3V8L A;  5FD6 A;  3COA C;  4LJZ F;  3H3U A;  1R1T A;  2BYV E;  4WXH A;  1USS A;  1JHH A;  2WWY A;  4U7B A;  4A12 A;  4EM1 A;  3ROU A;  1H9T A;  2ESN A;  3K1P A;  2HYF A;  3RKX A;  4UV9 A;  4N0B A;  4I7H A;  4ZZD A;  1ZRE A;  3KZY A;  2VC0 A;  2V1X A;  1XDS A;  1IW7 F;  1ODD A;  3ZQ7 A;  4G6D A;  1FT9 A;  2KIM A;  3GF2 A;  4KUM A;  3QU6 A;  3WU1 B;  2MC3 A;  3IRR A;  1ZG1 A;  2F2E A;  5D8K B;  3KP7 A;  4HX7 A;  1Y0U A;  3KEO A;  5F6F A;  3FZV A;  3GWZ A;  2G7H A;  1SD6 A;  4G7O F;  3O3K A;  4WXD A;  3HRM A;  1LB2 A;  4BQA A;  1YO5 C;  3QU3 A;  2P5V A;  1H9G A;  4ENK A;  2MA3 A;  5FGM A;  1K78 B;  4PCQ A;  1KGS A;  5HLI A;  4UVB A;  1R7J A;  3RKY A;  1HKS A;  4L0Z B;  1J9I A;  3HIF A;  3JAM K;  1S7A A;  5FLX K;  4GYI A;  4KN4 X;  3J81 Z;  1L3L A;  4RGR A;  3SZT A;  2HQN A;  3RPQ A;  3GO5 A;  1DDN A;  4P9F A;  4BHC A;  4YG2 F;  4HDV A;  2GZW A;  5BPD A;  1OYY A;  1LJ9 A;  2KIF A;  4A0Y A;  2EK5 A;  3SQN A;  2H6B A;  2PQ8 A;  3F8M A;  1ZRF A;  3L7W A;  5E8G A;  5H6R A;  2DO7 A;  4FX4 A;  2ZCW A;  4LK0 F;  4AVP A;  4YFN F;  2R3S A;  5FB2 A;  3O6B B;  2IPQ X;  1E2X A;  5E17 F;  2JPC A;  2MBF A;  3K69 A;  1UHW A;  2PMU A;  2W24 A;  3CJN A;  3IWZ A;  3BPX A;  3TGN A;  3WTU C;  4GGG A;  5FD5 A;  5ICF A;  4O6J A;  3KLO A;  1PUE E;  2Z5U A;  3IHU A;  2B0L A;  5D8L B;  3DP7 A;  3VEP A;  1W7P B;  3E6M A;  4ON0 A;  2QYO A;  4ZYE A;  2W85 A;  2LF8 A;  4HYE A;  1HW5 A;  5LEJ A;  2GA2 A;  1WQ2 A;  1GXQ A;  1QNT A;  2OBP A;  2Z33 A;  5E1Z B;  5JR3 A;  2VBY A;  4EJU A;  2H6C A;  1YTY A;  1WI9 A;  3DQV C;  3TO7 A;  5DUK A;  3KP5 A;  4HW0 A;  1TNS A;  3B02 A;  1XGM A;  2K86 A;  1GXP A;  5E20 A;  4LGW A;  1A04 A;  4U7D A;  1PDN C;  4M74 A;  4ETS A;  4P55 A;  1K78 A;  1SD7 A;  1REP C;  1U8R A;  1Z7U A;  3E3V A;  2Z9O A;  4Z2Y A;  4KNY A;  2JRT A;  3WGG A;  3P9I A;  2A69 F;  3KCC A;  2DK5 A;  2RKH A;  3HOT A;  2FXA A;  3LA2 A;  3ZMZ A;  3T1B A;  1FP2 A;  4GYG A;  1Z9C A;  1B59 A;  3KFW X;  1XN7 A;  2RNJ A;  1U6G A;  1F4K A;  5LRR A;  4RAY A;  4WF2 A;  1BI1 A;  3I59 A;  2A6H F;  2WV0 A;  4GO1 A;  3ZP5 A;  2HS5 A;  2ZME A;  1TQM A;  4LG0 B;  2Q0O A;  1U5T A;  1SD5 A;  1MGT A;  2ISY A;  2DPU A;  2STW A;  1SMT A;  5IT3 A;  1XSX A;  4I0B A;  2P8T A;  2V9V A;  1F9N A;  2FQ3 A;  5HS7 A;  1IUY A;  4MQ9 F;  3IL2 A;  3WGH A;  4YFX F;  3WTY C;  1XCB A;  4Y15 A;  3JSO A;  3ZMU A;  3BJ6 A;  1ZYR F;  1TQP A;  1UHM A;  2A5Y B;  2X0L A;  2D1H A;  3E6D A;  3MFK A;  1G3T A;  4HA8 A;  3C3W A;  1XB4 A;  3R4K A;  3AAF A;  5LEK A;  2W84 A;  1IXC A;  2QZ8 A;  4MQV A;  4I0A A;  4UXN A;  3BP8 A;  2EFQ A;  2VN2 A;  5ICC A;  3HHG A;  4Y13 A;  4BXU A;  2BGC A;  4KIF A;  2DPD A;  4IRG A;  5DD8 A;  4XSZ F;  1FYK A;  1R22 A;  3F8B A;  3R60 A;  3CLO A;  3PFI A;  2YX7 A;  4EV0 A;  5A2Q Z;  2L3D A;  3V8J A;  4HLX A;  2VC1 A;  2KJB A;  3LAP A;  4LB5 A;  1WWX A;  4RB1 A;  2CFX A;  5D4S A;  3U2R A;  5DD4 A;  1V3F A;  2V1D A;  5LHH A;  4EM0 B;  1QZY A;  1ZLK A;  1W5S A;  4EJT A;  3C7J A;  1TTY A;  2C6Y A;  1U5T C;  1G3W A;  1TLH B;  3GFJ A;  2NNY A;  4ZZL A;  2ZME B;  3VOD A;  2HTJ A;  4Q48 A;  5DEQ A;  3TDU C;  2QQ9 A;  5LHG A;  5D6E A;  1STZ A;  3RJP A;  1HSJ A;  2CWE A;  3JTH A;  5IT9 Z;  1ZGJ A;  1FSH A;  2GXB A;  3OOP A;  2OAZ A;  4M9S A;  4KIG A;  3WTV C;  2QQA A;  2EFP A;  3KP6 A;  3FM5 A;  1FPQ A;  3TDZ C;  4IJA A;  3GX4 X;  3QP6 A;  4RGS A;  3DPT A;  2OA4 A;  3KET A;  1J7K A;  3L9F A;  3GFL A;  4B09 A;  1R5G A;  3GUD A;  1I5Z A;  4R79 A;  5L3G A;  3J80 K;  5KK1 A;  2VBW A;  3HSF A;  2FEZ A;  1W4M A;  2E7X A;  2GA1 A;  5TJJ A;  2P5L C;  3EET A;  2BBY A;  2CSO A;  1L0O C;  1Z05 A;  2EV5 A;  1IN6 A;  1JE8 A;  2VBZ A;  3ZPL A;  5H20 A;  2PLY A;  4ZH4 F;  4UVA A;  1FBQ A;  2QBY A;  4IRH A;  4U88 A;  2VON A;  3GZ6 A;  5AIP A;  1UCR A;  4KDP A;  3CO7 C;  2VBX A;  5ILV A;  4WXC A;  3JTG A;  2ESH A;  4DNC A;  2NS0 A;  3LA3 A;  2H27 A;  2ZBK A;  4HX4 A;  2PG4 A;  2L4M A;  1SAX A;  5ED4 A;  5ICG A;  4EVI A;  2GIV A;  5JI6 A;  5DUI A;  1XSV A;  3JW4 A;  1U2W A;  1TW2 A;  1GHC A;  3WG9 A;  3I0T A;  4S05 A;  1HST A;  2DAO A;  4HV5 A;  2OZU A;  2O6G E;  3IKT A;  2D45 A;  2LSO A;  1CF7 B;  5LRS A;  3M1E A;  2IW5 A;  2AXL A;  1GVJ A;  4FT8 A;  3RKW A;  2HZT A;  2PI0 A;  4KMF A;  2F5C A;  2R7F A;  3WTT C;  3HTS B;  4CIC A;  3DPL C;  4UV8 A;  2X4H A;  2JTV A;  2FOK A;  4IF4 A;  3MAJ A;  3R0J A;  5HDK A;  1ZG3 A;  2O3F A;  2BE5 F;  2O0Y A;  4JK1 X;  2HWV A;  5DCM A;  1J59 A;  1J75 A;  5LGU A;  3FX3 A;  2ELH A;  3T8T A;  3R0A A;  2XIG A;  4RGX A;  1ZRC A;  2IT0 A;  2P6T A;  4MEY F;  1OMI A;  3V4G A;  2J5P A;  2OQR A;  2FML A;  3KP4 A;  5FO5 A;  1FX7 A;  2FBI A;  2E1C A;  2YX4 A;  2RGV A;  4XLP F;  2YU3 A;  3LA7 A;  4MTE A;  2K02 A;  3K0L A;  4IXA A;  3GEZ A;  3FMQ A;  1QPM A;  1C0W A;  2K7L A;  1KQ8 A;  4AIJ A;  4PGG A;  2EJR A;  5D6F A;  3H3Z A;  3K2Z A;  2GQQ A;  1B9M A;  1QZZ A;  1FYL A;  1OYI A;  3ERE D;  2OD5 A;  1J0R A;  4KT5 C;  1BOA A;  2OZ6 A;  2PFB A;  5CJ9 A;  1Q1H A;  4P5O A;  5ILS A;  3E6C C;  3I64 A;  1ZAR A;  4U0W A;  4L9V A;  1Z1D A;  1LDJ A;  2ACJ A;  2CYY A;  4HDU A;  4LG0 A;  3VFZ A;  2KIU A;  1CGP A;  4HLY A;  2QUF A;  1CF7 A;  2OU2 A;  1MDM B;  1P6R A;  2QEN A;  2EB7 A;  2CQK A;  1ZGA A;  4M71 A;  1FZP B;  4U0V A;  4HF0 A;  2XGX A;  5L3E A;  1SMY F;  1IN5 A;  3ECO A;  1JHF A;  3M8F A;  5J6X A;  1XGS A;  2ZJ2 A;  3T0Y A;  4IHT A;  4ENN A;  1D8J A;  1NHA A;  2LF7 A;  1O3Q A;  4LD5 A;  3HHH A;  2ZO4 A;  4NQW A;  2DTR A;  1WKM A;  3TKY A;  4A5M A;  3OV8 A;  5JVT A;  1R36 A;  5TRD A;  4NB5 A;  4I02 A;  4WX9 A;  3QPH A;  3E6B A;  2P5K A;  5JFR A;  1RUN A;  2Y0M A;  2A07 F;  1OKR A;  1D8K A;  4XLN F;  2MD5 A;  4KA4 A;  3MQ0 A;  4MNU A;  1IRG A;  4L9J A;  3FXQ A;  2KRF A;  1YLF A;  2GWR A;  1TW3 A;  4BHB A;  1HW1 A;  1XCV A;  4RB2 C;  3C1D A;  5L3D A;  4WWC A;  3F3X A;  3KE2 A;  4Q47 A;  1YS7 A;  3HRS A;  1B1B A;  2O61 A;  3PQK A;  3F8F A;  1BC7 C;  1O7F A;  1QGP A;  5F1R A;  1PP7 U;  2YSR A;  1IN4 A;  4ZYD A;  4S04 A;  1LEB A;  1KYW A;  5AIQ A;  3RPU A;  1QQI A;  2Q2E A;  1FBS A;  5BMZ A;  1ON2 A;  3TO9 A;  5J8C A;  4LK1 F;  1ZLJ A;  3DFG A;  2RN7 A;  5BQT A;  1FSE A;  1PP8 F;  5HVQ C;  1FWZ A;  3QPT A;  3RYP A;  3RYR A;  1ZH5 A;  1MDM A;  1OYW A;  1KU7 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...