4AIKA

Crystal structure of rova from yersinia in complex with an invasin promoter fragment
Total Genus 52
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
52
sequence length
139
structure length
139
Chain Sequence
STLGSDLARLVRVWRALIDHRLKPLELTQTHWVTLYNINRLPPEQSQIQLAKAIGIEQPSLVRTLDQLEEKGLITRHTSANDRRAKRIKLTEQSSPIIEQVDGVISSTRKEILGGISSDEIAVLSGLIDKLEKNIIQLQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transcription
molecule keywords TRANSCRIPTIONAL REGULATOR SLYA
publication title Structural Basis for Intrinsic Thermosensing by the Master Virulence Regulator Rova of Yersinia.
pubmed doi rcsb
source organism Yersinia pseudotuberculosis
total genus 52
structure length 139
sequence length 139
chains with identical sequence B
ec nomenclature
pdb deposition date 2012-02-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01047 MarR MarR family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 4aikA00
1BI0A 1R23A 1STZA 4ZZLA 4P5OA 5D5WB 2LSOA 1LVAA 3V4GA 1KA8A 3L00A 3HUGA 4M6YA 1R00A 2HDCA 4JK1X 2OBPA 1XGOA 2KRFA 3RKYA 4L5IA 1MDMB 3F21A 4BYYA 4G94A 4UVCA 1B9NA 5DUKA 1PP8F 5E20A 1TQMA 3K1MA 3RYRA 4IXAA 3EDPA 5K5QA 2HTSA 1L0OC 3ZPLA 2F5FA 4CZZA 4XBFA 2PMUA 1HKQA 1DPRA 2M87A 1J59A 4Q47A 4UV9A 2EV0A 1ZRFA 2EFQA 3CDHA 3K69A 3QP6A 3F8NA 2XGXA 3U1DA 1S3JA 3F8FA 3BJOA 4HV6A 2YSRA 4LG0B 3RDIA 4HX8A 1OKRA 5DDGA 1KQ8A 3KLOA 3WTZA 1WQ2A 1IXRC 4WF2A 4I01A 1KGSA 1DP7P 1IN8A 2CYYA 2GA2A 2PJPA 2OD5A 2Z33A 1B4AA 3NEUA 5FFXA 4Z2YA 3W6JB 2C6YA 2MH9A 3EYYA 5BMZA 2ELHA 5D8KB 3T8TA 3COAC 2Q0OA 4RGRA 2UXXA 2QUFA 1QZYA 1I5ZA 1UB9A 2FXAA 2RC4A 1D8JA 5LBQA 4HF2A 1BIAA 3LA3A 3WE2A 4KICA 4LB5A 3BPVA 1YFHA 2PG4A 3E6CC 3GFJA 3CUQB 4UXNA 1MJAA 4RGUA 4CICA 5BOXA 2DT5A 4G6DA 1O7LA 3VEPA 2FA5A 2IJLA 4OMZA 3WG9A 2WV0A 4KN7X 2QQ9A 1O3SA 5D5XB 1K6OA 4KIGA 1F9NA 1FBUA 2L02A 2QENA 2R7DA 4RB3C 4AWXB 1ZAOA 3DP7A 1W7PB 2STWA 3ROUA 1HXDA 1FNNA 2MH2A 2IP2A 5LGUA 1RI7A 2DK5A 3KP5A 4PGHA 5HS9A 3SZTA 3FWEA 4OMYA 4M9XA 1FLIA 3E97A 4KYWA 5DYMA 4HDUA 2FBIA 1WI9A 2O6GE 4ENJA 1BI1A 1J9IA 5LEKA 4GGGA 5DV5A 2P4WA 4IHSA 2TDXA 2NAZA 4BXUA 1B6AA 2VONA 2K86A 2PMHA 2XAQA 2L4MA 3LAPA 3E5UA 4L9VA 1UFMA 3QU3A 2FE3A 5CVUA 5E1WA 3HSFA 1HQCA 1J75A 2UWMA 2JT1A 3BJ6A 1IRGA 3CLOA 3M1EA 2QZ8A 1QZZA 3R6SA 5J6XA 2STTA 5H20A 2MLGA 3HTUA 5LHGA 2IA2A 1SD7A 1TQPA 3SQNA 3M8FA 4P9UA 3ZN1A 2QVOA 5LGTA 1PUEE 3MAJA 1HBXG 2VXZA 4ESJA 5TRDA 2H09A 4MTEA 2A6HF 2MA3A 1BC8C 2P5VA 2XUBA 4AVPA 2CQKA 3GZ6A 1XMAA 4MHGA 2Z5UA 5FGMA 1YQAA 3R4KA 5D5VB 3BP8A 2EB7A 3KEOA 1JGSA 1ZHFA 3ZP5A 5CVVA 2OAZA 3ZMVA 1USTA 4RGXA 2V1UA 2YU3A 3FXUA 2OZ6A 2O0YA 1SD4A 3GLXA 4ZZDA 2FEZA 1G3YA 4U0WA 2XRNA 3K1NA 4BH9A 1O3QA 4CHUA 2HKOA 1VTNC 3WU0A 3F6VA 1W7PD 4QWQA 1J0RA 1OPCA 3DF8A 3ZMUA 2XKOA 2JRTA 1JE8A 1MD0A 5HDNA 5EEGA 1SFUA 1FSHA 1J2XA 2DW4A 3P7NA 4Y17A 2P6SA 4YIIA 3S2WA 3P9KA 2E1CA 1QO0D 3TOBA 2O61A 2XIGA 1XGSA 5J8FA 2K27A 5ED4A 3GZ5A 3T5XA 3BDDA 4A0XA 2KIUA 1XGMA 4U88A 1O3RA 4R79A 1ON1A 1EV7A 3NQOA 4U7DA 5LHIA 2EV5A 2UZKA 3P9CA 1R7JA 3TDZC 3PFIA 1T98A 3G73A 1XN7A 2OQGA 3LSTA 3I58A 5ICCA 2B0LA 1YW7A 3L2CA 3WGGA 1ZG1A 1ODDA 2LKPA 1XSXA 3KP4A 4YFXF 5DCFA 1WKMA 4EV0A 3F72A 2GAUA 4HBLA 4DNCA 3DXJF 4WXDA 3KETA 2D45A 3JSOA 2HFHA 1WWXA 2EFNA 3LQQA 3V7SA 4BAYA 4IJAA 5ICGA 1SD6A 1D8KA 1KYZA 1H9GA 4OIOF 2L4AA 2O8XA 2VT2A 2A07F 2L54A 1HSTA 2FMYA 2DFIA 1TW3A 1WRJA 5E1XA 2IPQX 3F8MA 2A61A 5HLIA 3RIRA 2Y75A 1FYMA 1FBSA 2BGCA 2K4BA 1XDSA 2FBHA 1P4AA 4BHBA 3C7JA 3NRVA 3ZMTA 3L09A 5ICFA 4B09A 1W5TA 4NB5A 3DPTA 1L3LA 5D8LB 4EM2A 1IRFA 2RQPA 1HSJA 2G9WA 3ABUA 3I59A 1MJBA 1T6SA 2CFXA 3RKXA 2BE5F 5L3FA 2DI3A 1FY7A 4YIFA 2KKOA 5LRRA 5CVRA 3ISPA 3BZ6A 3GO5A 4HAMA 1YS7A 4P55A 2W24A 4ASNA 4KUMA 3KCCA 2Z99A 2VOOA 1TQIA 1HKTA 3GX4X 4XSXF 4I09A 5FO5A 1LDDA 3E6MA 2E1NA 1P4XA 1R36A 1XMKA 1YS6A 2JSCA 3QAHA 4MEXF 4I98B 1BC7C 3O3KA 3FM5A 4ESFA 2XROA 4KNYA 1QGPA 1B1BA 3RPQA 2AXLA 3JTGA 2RN7A 4CGZA 4ON0A 3DEUA 2UXNA 3GFLA 1P2FA 5D6EA 4Q5SF 1R1VA 1XSVA 2ZNYA 3KE2A 4Q48A 1OYIA 3EYIA 3HYIA 4L0YB 5CVJA 4A6EA 4HF0A 5L3CA 2Q8KA 2RV8A 3MEXA 2J5PA 5D6FA 1U2WA 5CYVA 2K7LA 2PBIA 4MEYF 4L0ZB 4JBAA 4LMYA 4MQVA 2HKXA 4I7HA 3O6BB 5LRSA 2KIMA 1REPC 4UVBA 3V8JA 1DPUA 4FX0A 4CO8A 1F5TA 4U0YA 3T0YA 3BY6A 2HEOA 2L3DA 1BBYA 2DO7A 2VC0A 2W57A 1U8RA 1TLHB 4NHJA 5FD5A 1Z05A 1BIBA 1FZPB 1LB2A 1O3TA 3F23A 4G7ZF 2YX4A 3IKVA 2LF8A 3L7WA 3SXYA 2YPRA 1G6NA 4RB2C 3QRFF 5CLSA 4ZYGA 4O6JA 1TNTA 2VBXA 1BN5A 2A68F 4OIQF 5HOOA 4LGWA 3VODA 2HOEA 1Q1HA 2HS5A 1PP7U 3KP6A 4LJZF 4M6XA 2EFPA 2GXBA 3N4MA 3IRQA 2COMA 4HOBA 4WK8F 2HQRA 4N9HA 4EJWA 3GUDA 2V1XA 1ZG5A 1GHCA 3B02A 2EA2A 3GXOA 3O2PE 1FOKA 4A5NA 3WTYC 4HYEA 1ZN2A 3I59B 3G3ZA 3LA7A 3Q9VA 1R1TA 3GYHX 2XHKA 2V79A 5TJJA 5F6FA 1TNSA 2X0LA 1T0FA 2KJCA 2XAHA 2VE8A 3GWZA 1EH8A 2DPDA 4BQAA 2ISZA 2H6BA 3V7RA 5ILVA 2VT3A 1ZGJA 2ESNA 4LB6B 5LEJA 2EV6A 3EUHA 4GO1A 2XV4S 1T39A 2M5WA 5HS7A 1RUNA 1D5VA 1OMIA 5CVIA 5ERIA 5DUIA 3GFIA 1I27A 1FYKA 4L9TA 1D3YA 4B8XA 2R7FA 5LHHA 2QM3A 1KYWA 1FBQA 4HX4A 2VBYA 2HYFA 1GXQA 4RB0A 2PLYA 4DQ2A 1RIOH 5JR3A 4LLGF 1CF7A 1SMYF 5F1RA 4KIBA 4S04A 1SD5A 1YW9A 1IUYA 2M45A 3U9GA 3HRTA 1USSA 2FMLA 1FX7A 3LFKA 4EVIA 4ZYEA 1U3EM 2P8TA 3KFWX 3CO6C 2W84A 3WU1B 2ZBKA 1XDUA 3T1BA 1ZG3A 3ZQ7A 1R22A 1FP2A 2XAFA 3SFZA 1FSEA 1Z7UA 3H92A 3HTSB 2G7UA 3RYPA 4A0YA 4HW0A 5H6RA 5L3EA 2P5LC 5F64A 2QWWA 1YG2A 1B9MA 4L5JA 1ZRDA 4GCVA 2P6TA 2JPCA 4AIKA 4WCGA 2OZUA 4AIJA 2ISYA 1Z6RA 1LDKB 2XAJA 3QPHA 4KFCA 2DPUA 2VOPA 3HSRA 3WE3A 3VB2A 4GYIA 4OOIA 5IT9K 1FC3A 3BPXA 1IF1A 2P7CB 4LLLA 2FNPA 2NYXA 2HZTA 5HVQC 4GXOA 4L18B 4I0BA 5JI6A 4FX4A 4EJUA 1ZYRF 2RGVA 4HV5A 3WTVC 3ZMDA 2ACJA 2OU2A 4EM1A 4KDPA 3R60A 4N0BA 5E8IA 4S05A 3E5QA 3TO7A 3F3XA 4M72A 2CGPA 5JFRA 4Q4ZF 4IRGA 3TQNA 3T8RA 2A6EF 5FFZA 1IAWA 3N97A 3Q9SA 4CDGA 4WXCA 2XVCA 1KU7A 5IT3A 1G3WA 4I02A 3BROA 5KVRA 2CO5A 4LK1F 1P92A 3LAJA 1IN6A 1R58A 3M9AA 3MZYA 3FMRA 2E7WA 4M9SA 1J5YA 2EFWA 2LDUA 3JAMK 1W5SA 1AWCA 5IT9Z 2V1DA 1SAXA 1E2XA 4LK0F 1LQ1A 4D0PA 1KU9A 3F6OA 3JSPA 4G7HF 4M74A 5E8GA 5ICEA 4A12A 5JVTA 3D0SA 1QNTA 4PGGA 3R0JA 4N9IA 1IN7A 1CF7B 4EM0B 1KQ0A 1LEBA 3ZMZA 3R0AA 4I0AA 1QPMA 4XRFA 2HQNA 1IN4A 1UCRA 3OOPA 1FP1D 2RNJA 4HQEA 3Q5FA 1ON2A 1T2KA 2CWEA 5A2QZ 1E17A 1LEAA 1A04A 3VFZA 4E70A 5K5RA 3HHHA 4RAZA 2BBYA 1FYLA 4FT8A 2BEOA 1ZREA 2VN2A 1WSUA 2OA4A 5E18F 4JQFA 4EJOA 4Y15A 3ZMSA 4KN4X 2KIFA 1YIOA 1LJ9A 6PAXA 3DV8A 4LG0A 3JAMZ 4RGSA 1I6XA 2FSWA 3PQJA 2IVMA 4ZH4F 4L9JA 3HIFA 4EGYA 2HGCA 3C3WA 2FNAA 1YLFA 2F2EA 2ZXJA 1TTYA 2IRFG 1U6GA 1IZ1A 2CW0F 3JW4A 4HF1A 3TOAA 4LD5A 3WTSC 3GF2A 2IA0A 4HLYA 3FHZA 4EMSA 3GW2A 4CXFA 2JTVA 5E1ZB 1AOYA 4HA8A 3IWFA 3CTAA 1O57A 3HRMA 3SZPA 2V6CA 1T38A 3IKTA 3ZN0A 5LGNA 2OQRA 4EQQA 1K7AA 4YFKF 2GWRA 2QQAA 2FBKA 1B59A 3FXRA 5FB2A 1P4WA 1YYVA 2DAOA 1BI3A 1W4MA 4WX9A 1R5HA 3RI4A 2IT0A 3I4PA 5HS8A 4QLCU 3B73A 3J7AO 2G7HA 2VC1A 3ULQB 4BNCA 3WTWC 1UHWA 3TKYA 2RKHA 5ILUA 1K78A 3WTXC 1U78A 1MZBA 1OYYA 2AS5F 1Z1DA 1ZLJA 4IPAA 3OV8A 4UV8A 3FM3A 1EH7A 4OINF 5D5UB 1MGTA 3KLNA 2Y48A 1ZARA 2XAGA 3BWGA 4F7ZA 5HDGA 3V8KA 1IW7F 2H6CA 4G6QA 4OU0A 4KT5C 1XSDA 2LNBA 1S8NA 2IW5A 3ELKA 2GIVA 3BOQA 1P6RA 1IN5A 2DQRA 1G3TA 4RAYA 2VE9A 3SHFA 2W85A 4WXHA 3QPTA 3J81K 4RS8A 4A0ZA 4IRIA 2ZMEA 2GA1A 3U2RA 4U7BA 3DQVC 3IHUA 1H9TA 1Z6TA 3K1PA 2F5EA 3E3VA 4WWCA 2Q2EA 1NHAA 4L9NA 1KU2A 5L3BA 2JZYA 3CUOA 1IXSB 2NNYA 3AAFA 2K02A 3DPLC 2EWNA 1PDNC 2QBYA 5BPIA 1LNWA 2R3SA 3E5XA 5FLXK 3RPUA 2XKPA 2P7VB 2QYOA 3I0TA 4G9YA 5DD4A 1EH6A 1JHFA 1SMTA 1ONVA 1HW2A 1OYWA 1K79A 2GXGA 5BS6A 1Z91A 3ECOA 2E7XA 3C1DA 5ILSA 3TO9A 2PFBA 2HWVA 3FF5A 1S29A 4R1HA 3CO7C 3V8LA 2X4HA 3P9IA 1DUXC 3M8EA 2Z9OA 4ENNA 2HR3A 3J81Z 1XB4A 3EETA 5BQTA 3F8CA 2QLZA 3BJAA 3W6KB 4NQWA 4PCQA 1QQIA 1HW5A 3HHGA 2RDPA 2CG4A 3M7GA 4A6DA 4OIPF 2A5YB 1FT9A 4ZYDA 4MQ9F 1QBJA 4UUVA 2LF7A 3K9TA 2YR2A 1U5TC 2PQ8A 1RNLA 3ECHA 3I5UA 5LLQA 1K78B 5FLXZ 5L3DA 2NNNA 3KEQA 4OIRF 1Y0UA 2VBZA 3ML6A 2F5CA 3FMQA 4O5VA 4A5MA 1C0WA 2ZCWA 1GXPA 2K4JA 5CJ9A 4IF4A 2L01A 1F1ZA 1S7OA 2EJRA 2PEXA 3E6BA 1I1GA 2D1HA 2ZJ2A 4Y13A 4UNOA 2M8EA 3K2ZA 4M73A 3DFGA 5BPDA 1HW1A 3MQ0A 1J7KA 4TV7A 2J5OA 4I2OA 2IA1A 2ESHA 3LA2A 5K1YA 2P5KA 1SFEA 1U5TA 3MWMA 2FRHA 3I54A 2A69F 1XCVA 5AONA 5E17F 3MCZA 2ZMEB 3LQRA 5J8CA 1R5GA 5HDKA 2O3FA 3QU6A 2Z3YA 4U0VA 2NRAC 4LLNA 4AIHA 2FF4A 3WODF 2QQBA 3TGNA 1BI2A 3K0LA 1MJ9A 3C18A 2QBYB 4FHTA 4PZJA 1Z9CA 4O3MA 3HOTA 2MLKA 2MD5A 2V9VA 1BJAA 3FMSA 3QOPA 4KA4A 1O7FA 3F22A 1SFXA 2CSOA 4K2EA 1UHMA 2NS0A 4LFUA 3I53A 1RUOA 3IC7A 1BM9A 2ZNZA 1XD7A 2EK5A 4P9FA 3HSEA 4P96A 5EEHA 4ZYHA 4R8HA 3WGHA 5A2QK 3KZZA 2VBWA 2GZWA 1R1UA 4HZFA 2D2WA 3GEZA 4MNUA 4ENMA 1FWZA 4BHPA 3RTRA 3MFKA 4M71A 5KK1A 3WTTC 1JHHA 5DCMA 2BV6A 4HDVA 3H3ZA 5D4SA 1V3FA 3R61A 2RVCA 1ZLKA 3ABTA 2O03A 1HKSA 3VOEA 1JXSA 4XLNF 3JTHA 4M9ZA 2M1BA 2A3SA 1KQ9A 5H6QA 2H94A 2ZKZA 4HX7A 4H0EA 2FOKA 1OR7A 3FXQA 1ZH5A 4G8XA 2DQLA 1YO5C 2PI0A 4KMFA 1MDMA 3KP7A 1S6LA 3ERED 4BHCA 4HQMA 4KIFA 3V7CA 4A2UA 2VODA 3CJNA 4EJVA 5K5OA 1H0MA 3GVAA 2WWYA 1RZ4A 2FU4A 5AIPA 1MKMA 2Y0MA 2ZO4A 4ETSA 1U5TB 5JHUA 2WC2A 2GQQA 2EFOA 1DDNA 2DU9A 1XCBA 2M30A 2ETHA 5AIQA 1YW8A 5DEQA 3REOA 2KJBA 2W25A 4ENKA 3L9FA 1TBXA 3WGIA 4IVNA 3RKWA 1ZRCA 2DK8A 4KMUX 1G4DA 3CUQC 3F8BA 3FZVA 2PN6A 3EQLF 2ADUA 1GVJA 4G7OF 4YG2F 3PQKA 3IL2A 4GYGA 3RJPA 3J80K 1S7AA 1CGPA 3KP3A 1I1SA 2MC3A 4HLXA 3E6DA 2HTJA 4RB1A 2DBBA 3HRSA 4MTDA 3I71A 2F5DA 2MBFA 4EGZA 4PDKA 2YX7A 4MGRA 2WTEA 3D5LA 3MZHA 5DD8A 3TO6A 3I64A 1XGNA 1F4KA 3GFMA 4XSZF 2ZFWA 3IWZA 4UVAA 3CUQA 1G3SA 3IRRA 3TDUC 4AD9A 3QP5A 2DTRA 3HRUA 2FQ3A 5HLGA 3H3UA 1ZGAA 4EJTA 2BYVE 3KZYA 5FD6A 1YTYA 1FPQA 4IRHA 1X3UA 3LWFA 4IHTA 5L3GA 3WTUC 4CYDA 4ESBA 2HYGD 2JPBA 2D1VA 1LDJA 1ULYA 2EA4A 5DCMB 4XLPF 5HLHA 1TW2A 1W7PA 4UHTA 1BOAA 5D4RA 3DKWA 3FX3A 3HOSA 4YFNF 2H27A 3KP2A 1IXCA 1V4RA 3J80Z 2DLLA 2XASA 1KU3A
chains in the Genus database with same CATH superfamily
3OYEA 2Y9YA 1BI0A 1R23A 1STZA 4ZZLA 3HOWJ 1RESA 4P5OA 3FK6A 2Z1DA 5D5WB 2LSOA 3GTKJ 2VKVA 1JUMA 1LVAA 1MNEA 2XF7A 3V4GA 9ANTA 1KA8A 2ECBA 2N8GA 1D5YA 3L00A 3HUGA 1KONA 4M6YA 4XIDA 1R00A 1BR2A 2BHYA 3Q0UA 3VSLA 3ONQA 2OC6A 2HDCA 2E1MC 4JK1X 3F9KA 2ECCA 3CZ6A 1WI3A 4PSWA 2OBPA 2R7ZJ 1XGOA 5E79C 2KRFA 3RKYA 4L5IA 1MDMB 1JTYA 3GLLA 3Q3SA 2ZXIA 2M3AA 3VSKA 3F21A 4BYYA 3GTOJ 4G94A 2F4IA 3AG2H 3ABMH 2E34A 4UVCA 1B9NA 5DUKA 1PP8F 1FIPA 5E20A 5M5YJ 1TQMA 3K1MA 3RYRA 3GZNB 4IXAA 2WAFA 3EDPA 5K5QA 2HTSA 1L0OC 3S1MJ 4CYCA 3ZPLA 1Z0XA 4BQQA 4ZDOA 2F5FA 3VWBA 4CZZA 4XBFA 2EIJH 2PMUA 1HKQA 3RQIA 5M5XJ 3QYBA 3I4NJ 4Y7NJ 1DPRA 2QSGX 3BTLA 2M87A 1TWGJ 3I3LA 3ZR8X 1J59A 4Q47A 4UV9A 3E0JB 3BTJA 3AL0C 2EV0A 4HNTA 1HLVA 4H4KC 2XF6A 3HG9A 1VQKI 1ZRFA 2EFQA 1OQYA 3CDHA 3K69A 1ZK8A 3HXLA 1ENHA 3QP6A 2HOAA 3F8NA 2XGXA 2CH0A 3U1DA 1AU7A 3GTMJ 2P81A 5FRMA 2EINH 1W0UA 1S3JA 5IOYA 1D0XA 3F8FA 3BJOA 4CZCA 4HV6A 2FUG2 2HOSA 2YSRA 4LG0B 1JJ8C 2O7OA 4BDYA 2KIQA 3RDIA 4HX8A 2B7EA 5EGOA 1IC8A 4MIMA 1OKRA 1I3AA 1AKHB 3K4MA 4PJLA 5DDGA 1KQ8A 2OCEA 3CCYA 3KLOA 3WTZA 1WQ2A 5K7ZA 1IXRC 3BQZA 2PX9A 2EZHA 2Y0SA 2ZSIB 4WF2A 2IAIA 1TC3C 4I01A 4CCNA 4CCLA 1KGSA 1DP7P 1IN8A 3WG7H 2NS7A 2CYYA 3UNGC 4DZJA 3CCLI 2HVRA 2M0MA 2GA2A 2PJPA 2OD5A 2Z33A 1B4AA 3HGGA 3NEUA 5J40A 5FFXA 4Z2YA 2W1OA 3W2VA 1RETA 4D1QA 3W6JB 2C6YA 2MH9A 2WB1A 3EYYA 3DBLB 3ZGKA 5BMZA 2ELHA 5D8KB 3T8TA 3COAC 2Q0OA 4RGRA 2UXXA 2QUFA 1QZYA 3DTKA 3GTPJ 1I5ZA 1UB9A 2FXAA 2RC4A 1D8JA 5LBQA 4HF2A 1BIAA 3LA3A 1Y1VJ 3WE2A 2R5ZB 2Y30A 3A02A 4KICA 1MMAA 2ELKA 4UB6C 4LB5A 2BZTA 1BR4A 3BPVA 1YFHA 2PG4A 2TRTA 4F52A 3E6CC 2NVQJ 3GFJA 3CUQB 2W00A 4I99C 4UXNA 1MJAA 2KFDA 4RGUA 3H5AA 2FX0A 4X1EA 4CICA 1RKTA 5BOXA 4BJ5C 1EA3A 2DT5A 4G6DA 1O7LA 3MVPA 3VEPA 3D1NI 2FA5A 1BJZA 4XLHA 2IJLA 1UG0A 4OMZA 3WG9A 2WV0A 4KN7X 2QQ9A 1O3SA 3LSPA 4C2UA 2LC2A 5D5XB 1ZR2A 1K6OA 4KIGA 1F9NA 5CQGA 1ZKGA 1FBUA 2L02A 3BTIA 2ICWG 3BLYA 4XMYA 1LUJB 3E1SA 2QENA 1LKXA 2R7DA 4RB3C 2I10A 3IH3A 3MD2A 5M3FJ 4AWXB 5EZGA 1YITI 1ZAOA 3DP7A 1V54H 1W7PB 3ERMA 2CJJA 3OS2A 2STWA 2M8GX 3ROUA 3JRGA 1HXDA 3RSNA 4BY1J 1FNNA 2MH2A 3OL3A 2IP2A 1GUUA 3HPHA 4PSXA 4ZDLA 5LGUA 1RI7A 2M0CA 3OOUA 5CKTA 3TP0A 2DK5A 3L2VA 4UY8I 3KP5A 4DIQA 1YOVB 4PGHA 4PJJA 5HS9A 3SZTA 3FWEA 5JHFA 2X9DA 1JTXA 4OMYA 4M9XA 3FXLA 5FKKA 1FLIA 3SDBA 3L1PA 1WJ5A 3TEDA 3E97A 4YIRX 1GLNA 4KYWA 2KT0A 1MBGA 1D1CA 3HUGB 5DYMA 3BZKA 2M4KA 4HDUA 2OPTA 2FBIA 3BR1A 1WI9A 2O6GE 3BC8A 4B1RA 3K4NA 5C4JJ 1BI1A 4ENJA 3KX2A 1J9IA 5LEKA 4GGGA 3Q0WA 3OL4A 5DV5A 4HNUA 2P4WA 4IHSA 2X6OA 2TDXA 2NAZA 4BXUA 1PJRA 1ETOA 2LKXA 1ITYA 4B44A 5EDNA 4PK4A 1B6AA 4E6KG 2VJIA 2VONA 2K86A 2XAQA 2PMHA 4W97A 4A93J 4IOCF 2E1OA 2L4MA 3SJMA 3LAPA 4CYCB 3E5UA 4L9VA 2EPFA 2F4OB 1UFMA 3QU3A 3PNYA 4X0GA 2FE3A 5CVUA 3OYDA 5E1WA 4F93B 2H1KA 3HSFA 1HQCA 2K9MA 1J75A 2UWMA 2JT1A 3BJ6A 3LL7A 1IRGA 4J00A 2E36A 2EZKA 3G6EI 3CLOA 3M1EA 3P5JA 2QZ8A 4DYCA 1QZZA 1WH7A 2DMTA 3R6SA 4CCJA 5J6XA 3OYBA 2STTA 3OYFA 2AQEA 5H20A 2MLGA 4JYKA 3HTUA 2NS8A 1YX3A 5LHGA 2HPIA 4S0HB 2IA2A 1SD7A 2GIZA 3W2WA 2Y2ZA 1TQPA 2W82A 1R9TJ 2E1MB 3SQNA 5B3SH 3HOZJ 2L7FP 1RKWA 3M8FA 4P9UA 2L7KA 3ZN1A 3Q0VA 3S2HJ 2QVOA 2L9RA 5LGTA 2ZSHB 4NC8A 2XB0X 1PUEE 3MAJA 1HBXG 2VXZA 4ESJA 5EGOB 5TRDA 2H09A 4BDZA 4MTEA 3S15J 2A6HF 2MA3A 1MNMC 2CU7A 2DJNA 4CA0A 1BC8C 2P5VA 2XUBA 1X1AA 5EYRA 4AVPA 2CQKA 4L5EA 5E3OA 2Q1ZB 3GZ6A 2HI3A 1VZ0A 1XMAA 4MHGA 2E2JJ 1LVKA 4MFEA 4V2FA 3J7YJ 2Z5UA 5FGMA 3S17J 1Y1WJ 1YQAA 1H88C 1IRXA 3R4KA 5D5VB 2LY1A 3HBLA 3BP8A 2EB7A 3KEOA 2WB1N 3ZRGA 4BQOA 3AL0B 4NUBA 1JGSA 4E7JA 1ZHFA 3ZP5A 5CVVA 1Y8QB 2OAZA 3ZMVA 1USTA 4RGXA 3VDXA 4ANJA 2V1UA 2YU3A 3FXUA 3WHCA 2OZ6A 2O0YA 3HOUJ 1NG6A 1SD4A 3GLXA 4ZZDA 1N75A 4XN3A 2FEZA 1G3YA 1IDZA 2XPWA 4U0WA 1TT5B 2K9LA 2XRNA 3K1NA 2VJ5A 3GBGA 1ETYA 2LD5A 4BH9A 1O3QA 3HKZA 3PJRA 4CHUA 1E0EA 2HKOA 2ZXHA 1VTNC 1OCZH 3WU0A 5HLTA 3F6VA 4C2TA 1QA6A 1MW7A 2BHZA 3CP8A 3CF5F 1W7PD 2F48A 4QWQA 1J0RA 1OPCA 4NQWB 3DF8A 2LOOA 3ZMUA 2XKOA 2JRTA 2GBYA 3FHNA 2IS1A 3LSMA 4A3JJ 3G2BA 1JE8A 2JUCA 1MD0A 5HDNA 5EEGA 2JQ7A 1SFUA 1FSHA 1P7JA 1J2XA 2DW4A 3P7NA 4Y17A 2P6SA 4YIIA 5F0CA 3S2WA 2B9SA 4BE0A 2IS4A 4BXXJ 3P9KA 1VI0A 4ZTJA 3SFIA 1QO0D 2E1CA 1Y0NA 1HC8A 3K10A 3TOBA 2O61A 1AA7A 2XIGA 2V6EA 1XGSA 2DDBA 5J8FA 1WCMJ 2K27A 3VYUB 1ZR4A 2GXAA 2ME6A 5ED4A 3GZ5A 3T5XA 3KEYA 5EG0B 1OLTA 2LRDA 1WFXA 3BDDA 1YE9A 4A0XA 4ABZA 2KIUA 3FIWA 1XGMA 1A6IA 4UUTA 4U88A 5KAFC 1O3RA 2YUSA 1QRYA 4ZYAA 4R79A 1ON1A 1EV7A 3NQOA 4U7DA 4BQNA 1W1WE 5LHIA 2EV5A 2UZKA 2KZVA 2P0WA 3P9CA 1R7JA 1OJLA 2LTPA 3TDZC 2IBDA 3PFIA 3S3MA 3HOVJ 2HVQA 4BL0B 2OV7A 1T98A 3CJRB 2VKHA 3G73A 2R0QC 1XN7A 4D7MA 2QQ8A 3ZXSA 2LVSA 5F27A 2OQGA 3LSTA 3I58A 3S8PA 2AO9A 5ICCA 2B0LA 4FETA 1YW7A 3KZIC 2JN6A 3BT9A 3CF2A 5EZHA 5B1BH 3CD6I 3L2CA 1X2NA 2KHMA 3M07A 3KYDB 3WGGA 3TL4X 1ZG1A 4ZJZA 5GAEJ 3ZCOA 4C2MJ 1ODDA 2LKPA 1XSXA 3KP4A 4YFXF 5DCFA 2CV1A 1WKMA 4EV0A 3F72A 3LSIA 2GM4A 3GCMA 1R6RA 3PSFA 1W0TA 2GAUA 1TL8A 3LNQA 2QGUA 4HBLA 4DNCA 3DXJF 4WXDA 3KETA 3CC7I 2D45A 2VPLA 1DQUA 3ABLH 3C2BA 3HDDA 3JSOA 4Y4RA 2HFHA 2ID3A 4CH7A 1WHUA 1WWXA 2EFNA 3LQQA 3V7SA 1VQ9I 4BAYA 4IJAA 2QKLB 1G59A 2X85A 5ICGA 4BBSJ 1SD6A 3MZ8A 2BY1A 1Y39A 1D8KA 1KYZA 1H9GA 1IG7A 1HF0A 1A31A 4OIOF 1UG2A 3BG3A 2L4AA 2K9NA 4GRIA 2HPMA 4JOMA 1N25A 1XTAA 2O8XA 4II2A 1N77A 2VT2A 3JRCA 3JRDA 2A07F 2DDAA 2E71A 1HSTA 2L54A 2L7ZA 2FMYA 2DFIA 1TW3A 1WRJA 5E1XA 3OYIA 2IPQX 3F8MA 2X6YA 3A2KA 1EF4A 1E3PA 2A61A 5HLIA 3CJTB 3RIRA 2Y75A 3K70D 1FYMA 2DCEA 3A01A 2LBFA 4M3EA 1FBSA 3IP4B 2BGCA 2K4BA 1XDSA 1DU6A 4MO7A 2FBHA 1P4AA 1FMVA 4BHBA 3C7JA 1R4MB 3NRVA 3ZMTA 4M3FA 1IV6A 2M7AA 3L09A 5ICFA 4B09A 1W5TA 4NB5A 1B72A 3DPTA 2CUFA 5D8LB 1L3LA 3S1QJ 4PJMA 4EM2A 2XDVA 1IRFA 2RQPA 4A3DJ 2M4GA 2I5UA 2MW8A 4BY7J 4A3GJ 1HSJA 3UR3C 2CFOA 5JVGF 1JKRC 3K4JA 3N05A 4AC0A 2KDOA 4JX5A 2G9WA 1WH5A 3FXJA 3H5RA 3ABUA 3I59A 3PNTA 2FD5A 1MJBA 4J19A 1MMNA 1T6SA 2CFXA 3RKXA 2BE5F 5L3FA 4A3MJ 2ME0A 2DI3A 1FY7A 5IOZA 2IGNA 1YRNA 4YIFA 1APLC 3L2RA 4XICA 2KKOA 5LRRA 4BJ6C 2LK2A 5CVRA 2DXIA 2UV1A 2CUZA 3OYMA 4OAZA 2DOFA 3ISPA 3HKZN 3BZ6A 3VYRB 1AHDP 3GO5A 4HAMA 1TWFJ 1YS7A 4P55A 2W24A 4ASNA 4KUMA 1RC9A 2VQHA 3CCJI 3KCCA 2Z99A 2JWTA 1O4XA 2VOOA 1FOWA 1TQIA 1ZGWA 4AUXA 2BY2A 2M9HA 1HKTA 3GX4X 4XSXF 4C30A 4I09A 5FO5A 1LDDA 3E6MA 3LMMA 3MKZA 2E1NA 2QSFX 3BG5A 1P4XA 1R36A 3X2QH 2EQRA 1XMKA 1YS6A 2JSCA 1VQMI 2CQQA 3QAHA 4I98B 4MEXF 1R71A 3O3KA 3FM5A 1BC7C 4ESFA 4IQ4A 2KPMA 3LSRA 2PMZA 2XROA 4KNYA 3TW6A 3PL8A 1QGPA 4XNFA 1B1BA 1GT0C 3RPQA 2AXLA 3JTGA 2RN7A 4CGZA 2YU9J 4ON0A 3W6VA 1G8XA 3DEUA 2JVHA 1JI8A 2UXNA 3GFLA 1P2FA 2O5RA 5D6EA 3OYGA 1JKOC 4Q5SF 1JUPA 3M1CA 1R1VA 1XSVA 3KPHA 2ZNYA 3KE2A 4C3JJ 5GAHJ 2IGMA 4RBOA 4Q48A 5EF6A 2K3PA 1OYIA 1P9QC 3EYIA 3IH2A 1W36D 3HYIA 4L0YB 3BG6A 5CVJA 4A6EA 4HF0A 5L3CA 3FK7A 2Q8KA 3CCUI 2RV8A 3MEXA 3CDIA 1Z3XA 2J5PA 4B48A 5D6FA 5BNGA 1U2WA 3CLQA 5CYVA 3S16J 2K7LA 2PBIA 4MEYF 3QQAA 3NARA 4IL6C 2UUZA 2WBMA 4L0ZB 4JBAA 1XPXA 2K5CA 1FOXA 3OY9A 4FCYA 4LMYA 2COBA 4MQVA 2HKXA 4I7HA 1U9NA 3O6BB 4N4NB 2KIMA 3DPUA 4UVBA 3V8JA 5LRSA 1REPC 2LR8A 1DPUA 2WV1A 4FX0A 1Z7LA 4CO8A 1F5TA 4U0YA 3W3CA 3TP3A 4BU2A 4IO9F 3T0YA 3K70C 3BY6A 2HEOA 2M34A 2L3DA 1DP3A 1BBYA 3DKYA 2DO7A 3BR6A 1NK2P 2VC0A 2W57A 1U8RA 3L2QA 1TLHB 3OYJA 1IDYA 5FD5A 4NHJA 2RQQA 1Z05A 1BIBA 1FZPB 5C3EJ 2HDDA 1LB2A 1BOBA 1O3TA 2KQRA 3F23A 1WGXA 4G7ZF 2H8RA 2YX4A 3AG1H 3IKVA 2LF8A 1XG1A 3L2WA 5F0HA 3L7WA 3SXYA 2YPRA 4D5FA 4FTHA 1G6NA 4RB2C 3H1CA 3QRFF 5CLSA 4ZYGA 1T95A 1FTZA 1WJAA 4O6JA 1T0FC 4PJ0C 5GPAA 1TNTA 2VBXA 1BN5A 2A68F 4OIQF 1DGWY 5HOOA 4LGWA 2IXSA 3VODA 2HOEA 1Q1HA 2HS5A 5JLXA 1VQLI 2GLOA 2LY9A 1Z77A 1LFUP 3CCRI 3EUHC 2E5ZA 1PP7U 3KP6A 4LJZF 4M6XA 1VFCA 2EFPA 2GXBA 2XPVA 3CESA 1V5GA 3N4MA 4UUSA 3IRQA 3OYKA 3A01B 2LBFB 5H2FC 2COMA 3OIQA 4HG2A 4HOBA 3H5NA 2HQRA 4G12A 4WK8F 1MSEC 4N9HA 4EJWA 3GUDA 2V1XA 4XM3A 3RQ4A 3LSKA 3HOYJ 4CCKA 1ZG5A 1GHCA 1U9OA 1JT0A 5GP9A 3S2DJ 2JUGA 1B72B 3B02A 2R7SA 1BL0A 2EA2A 3QYFA 3CCEI 3GXOA 2CUJA 1FEXA 3O2PE 1FOKA 2XB5A 1PYVA 1BR1A 4YRVA 2E35A 3QPSA 4A5NA 3WTYC 4HYEA 1ZN2A 3I59B 3G3ZA 3LA7A 2WY8Q 3Q9VA 1R1TA 3GYHX 1YRNB 5DM6F 3QPLA 2XHKA 2V79A 4CSWA 5TJJA 5F6FA 1TNSA 2X0LA 1T0FA 2KJCA 2XAHA 4BEHA 3TMOA 4YELA 2VE8A 5KHDA 3GWZA 1FJLA 5J4VA 1EH8A 2DPDA 5JLWA 4F3QA 4BQAA 3CMMA 3QODA 2ISZA 2H6BA 3V7RA 5ILVA 2K85A 2VT3A 1ZGJA 2ESNA 4LB6B 4DGWB 5LEJA 3HL2A 2EV6A 3EUHA 4GO1A 2K40A 2L9NA 4FQGA 2XV4S 4DYQA 1T39A 2MABA 2M5WA 3VYTB 5HS7A 1RUNA 1D5VA 3DU5A 1OMIA 1W36C 5CVIA 5ERIA 2XSDC 3BR3A 5DUIA 3OR2C 1FIAA 3DBHB 1UMQA 2V7FA 3K4KA 5J1UA 4XRMA 1TP4A 2M2EA 5HODA 5C44J 3GFIA 4M3DA 1I27A 1FYKA 2XC7A 4L9TA 4QPOA 4IHYA 1D3YA 4HSRA 1SVLA 4B8XA 3BZCA 2R7FA 5LHHA 3CP2A 2QM3A 2PMZN 1KYWA 3LOCA 1FBQA 2R7TA 2MYSA 4HX4A 1X1DA 2VBYA 1WJBA 3OIPA 1SAUA 3S32A 2HYFA 1SVMA 1GXQA 3JRAA 3S1NJ 2DA2A 4C3IJ 4RB0A 2PLYA 4XONA 2KISA 4DQ2A 1RIOH 2GOXB 5JR3A 4HEA2 4LLGF 1CF7A 1SMYF 2OCCH 3FXKA 5F1RA 4KIBA 4S04A 2F4MB 2WADA 1SD5A 1YW9A 4B3AA 1IUYA 2M45A 3U9GA 1QZEA 3HRTA 1USSA 2ZC2A 3A4CA 3PO2J 2BVMA 2R7UA 2FMLA 1FX7A 1VF9A 4I6ZA 3LFKA 4EVIA 4ZYEA 1U3EM 2P8TA 2X1CA 3KFWX 3OS1A 2W84A 3CO6C 2VJ4A 2DJIA 2R4GA 3WU1B 2ZBKA 1XDUA 3B6CA 3T1BA 1ZG3A 3ZQ7A 1R22A 1JKQC 3M8JA 1FP2A 2XAFA 4XKCA 3SFZA 1PUFA 1FSEA 1Z7UA 4LOCA 2ZFUA 1ZTRA 3H92A 3HTSB 2HVSA 2G7UA 2X1DA 4JX4A 4LG3A 4XKBA 3RYPA 1OCCH 1KZHA 2V1NA 2EZIA 4IQJA 2QA4I 1ETQA 2DOAA 4QIWN 4A0YA 4HW0A 5H6RA 4D5CA 2DOEA 5L3EA 2R5YA 4DW6A 2D5VA 2P5LC 2NOGA 1D1AA 5F64A 2QWWA 3DEEA 3HEFA 5J1YA 2DTZA 3VYSB 2L2OA 1IJWC 1MBKA 1YG2A 2VB6A 4F92B 1B9MA 4L5JA 1ZRDA 2IS6A 2CRGA 1E3OC 4HNVA 1Q1VA 4GCVA 1BW5A 2P6TA 2JPCA 4AIKA 1QPIA 2HYJA 4WCGA 2NVXJ 3QYEA 2OZUA 1TWCJ 3BQYA 4AIJA 2ISYA 1Z6RA 1XC5A 4RDUA 1LDKB 3H0GJ 1V55H 2XAJA 3QPHA 3ZQHA 1ZQ3P 4KFCA 5EJCA 2VI6A 2DPUA 1X1CA 2EH3A 2VOPA 1MNDA 4CCOA 1K61A 3HSRA 1OCOH 2E2HJ 2CV0A 2XSJC 1MIJA 3WE3A 3VB2A 4GYIA 3LFUA 4OOIA 2LFBA 5IT9K 1T56A 1FC3A 2V9PA 4KJZA 4RAGA 3BPXA 2DA3A 4MLOA 2F6CA 1IF1A 2P7CB 4LLLA 2FNPA 3BG7A 2NYXA 2HZTA 1ETVA 2E60A 5IYBJ 5HVQC 4GXOA 4L18B 1MBFA 2KLOA 4I0BA 2DMQA 4UUSB 1MMGA 3OWTA 4E7KA 2LMDA 5JI6A 4FX4A 4EJUA 1JKPC 3CCVI 1ZYRF 2RGVA 4HV5A 3PIOF 3WTVC 2DA4A 2RAEA 3DKXA 3ZMDA 2ACJA 3PO3J 3K6GA 3PSIA 1ETKA 2A6TA 2OU2A 3H36A 1OCRH 4EM1A 4KDPA 1Y8RB 3R60A 3CMEI 4N0BA 5E8IA 5J3LA 4S05A 3E5QA 3ZQLA 3TO7A 3F3XA 5E3MA 2VJJA 4M72A 5IP7J 2CGPA 1ACIA 3MKLA 5M3MJ 5JFRA 3K4BA 3D5SC 4EATA 2ZJPF 2WAEA 4Q4ZF 4IRGA 3TQNA 3T8RA 1A35A 2Y9ZA 2A6EF 5FFZA 1IAWA 2BXYA 1MMSA 3N97A 5J47A 2EIMH 3Q9SA 1UHSA 4BEHB 4CDGA 1VQOI 4WXCA 2XVCA 4XOPA 1LFPA 1KU7A 4YEJA 5IT3A 1IUFA 1G3WA 2NVUB 1FTTA 1VQPI 1SFOJ 3DWLE 3O8GA 4I02A 3BROA 4Y52J 1YIJI 5KVRA 2CO5A 4LK1F 1P92A 3LAJA 1IN6A 3EUAA 1R58A 2ZJRF 4BGDA 3M9AA 3JRFA 3MZYA 2ZJQF 3FMRA 4DZPA 2E7WA 4M9SA 1J5YA 3DEWA 3G1OA 2EFWA 2LDUA 4QTRA 4A3EJ 3JAMK 3JRHA 3J7ZI 1W5SA 1AWCA 3H9GA 1A6QA 3RZOJ 5IT9Z 2YS9A 1TT0A 3KYLA 2V1DA 5DTDA 1SAXA 1E2XA 4LK0F 1LQ1A 4D0PA 3S3NA 1KU9A 2XGEA 3HB9A 5DM7F 3F6OA 1CQTA 3FBNB 3JSPA 4G7HF 4M74A 5E8GA 5ICEA 3FXMA 2RREA 4G6TB 4A12A 5JVTA 3D0SA 1QNTA 4PGGA 3R0JA 4N9IA 1IN7A 1CF7B 2B63J 4EM0B 1VNDA 4RMNA 1KQ0A 4PFOA 1LEBA 2E19A 3ZMZA 3R0AA 4C3HJ 4I0AA 4FASD 3JRIA 1QPMA 4XRFA 2HQNA 4XOTA 1IN4A 1UCRA 2FJ1A 4RLFA 3OOPA 1FP1D 2RNJA 1EKEA 3H3VK 2DFEA 2L9SA 4HQEA 3Q5FA 1ETWA 1ON2A 2KRCA 1T2KA 2CWEA 5A2QZ 2MD0A 2X6XA 1SANA 1X1BA 1E17A 2I8DA 1LEAA 2DA5A 1NG7A 1A04A 2OF7A 4XKVA 1PUFB 3VFZA 3CQZJ 4E70A 5K5RA 3HHHA 5HNFA 4RAZA 3H35A 2BBYA 5IYDJ 1FYLA 4FT8A 2BEOA 4PJNA 1GV2A 1ZREA 2VN2A 2V4JC 1WSUA 2OA4A 2R5YB 5E18F 4B3XA 5F04A 4CUGA 4JQFA 3ZQGA 4EJOA 4XRSA 3JRBA 3M3YJ 3NWSA 4Y15A 2VLAA 2H1LA 1YJ9I 1MMDA 3ZMSA 4KN4X 2KIFA 1YIOA 1LJ9A 1UJ8A 3DV8A 4LG0A 6PAXA 3S3OA 3BCBA 2RNGA 3BR0A 3A0HC 3JAMZ 4BXFA 2Y69H 2JVGA 3OMYA 4LIUA 4RGSA 3G1MA 1I6XA 3SDGA 2FSWA 4PUSA 3PQJA 1WZ2A 2IVMA 4ZH4F 4L9JA 3HIFA 3SEZA 2DA7A 4EGYA 1WJDA 1V5EA 2MG4A 2HGCA 3C3WA 2CW8A 3G71I 3OYCA 3S1RJ 2FNAA 1YLFA 2F2EA 2ZXJA 1TTYA 1QU3A 2IRFG 4AIDA 2WAQA 1U6GA 4DBQA 4Y3OA 2Z2SB 2XPUA 1IZ1A 2CW0F 3JW4A 4HF1A 3TOAA 4LD5A 3WTSC 3GF2A 1QVTA 3GTJJ 2QSHX 1I39A 2IA0A 4A3KJ 3CMYA 5KAIC 4HLYA 2CQNA 2HQAA 3PUFA 3FHZA 4EMSA 3GW2A 4CXFA 2FOWA 2JTVA 1T8IA 4IHXA 1YX5A 1WVRA 5E1ZB 1X3WB 1LE8A 3J7AY 4GFBA 5F0FA 1Y56A 4E7LA 1DGRM 1AOYA 3BR2A 4HA8A 2MC4A 2L5QA 3IWFA 3CTAA 1O57A 3HRMA 3SZPA 2V6CA 1T38A 1A5JA 1H8AC 3IKTA 1BA5A 5J1RA 1NTCA 2KP6A 3ZN0A 1YI2I 5LGNA 4Z6YA 2OQRA 4J01A 4EQQA 4C9YA 1K7AA 4YFKF 1ZELA 2GWRA 2QQAA 2FBKA 1B59A 4HSTA 3FXRA 2DFHA 5FB2A 1P4WA 1YYVA 2DAOA 2ZB9A 2JA5J 1BI3A 1X3ZB 1VQ5I 2E2IJ 1W4MA 2L7MP 1GVDA 4BJTA 4WX9A 2BY0A 2R7OA 1R5HA 4BBRJ 3RI4A 3I56I 4IEJA 1A36A 2IT0A 3EPZA 3I4PA 5IPAA 5HS8A 4QLCU 3W2AA 3DU6A 4W1UA 3B73A 3J7AO 3IAM2 2G7HA 2VC1A 1MH3A 3ULQB 4BNCA 3WTWC 1JUSA 1UHWA 2LP0A 3TKYA 4ZTFA 2R93J 3GTGJ 2RKHA 1K4SA 5ILUA 1K78A 3HPGA 4BS9A 3WTXC 1U78A 2VQLA 1MZBA 4X6AJ 1OYYA 2WA0A 4E7ZA 3ZQQA 2AS5F 1ORKA 1Z1DA 2ZMEC 3I9V2 1ZLJA 3HC7A 4IPAA 1ETXA 3OV8A 4UV8A 2K3FA 3ZQIA 3FM3A 4LITA 1EH7A 4OINF 5D5UB 1MGTA 3KLNA 2PJRA 1X4PA 2NOJB 1HDPA 2W4SA 2O8KA 2Y48A 1ZARA 2EBIA 2XAGA 1TZLA 3BWGA 3PM1A 4F7ZA 5HDGA 5IYCJ 3MMYB 3V8KA 1IW7F 2EILH 2H6CA 3KYCB 3OYAA 4MFDA 2TCTA 4G6QA 2IGOA 3ZOBA 5TISC 4OU0A 2R92J 4KT5C 1XSDA 2LNBA 3RZDJ 2DMPA 4NBQA 5GAGJ 2XAUA 1X19A 1S8NA 4OWRB 1T33A 4XQFA 4A3BJ 5B1AH 2IW5A 3ELKA 2KRHA 4XR6A 2GIVA 2WY7Q 3BOQA 1P6RA 1IN5A 2DQRA 4AU7A 1G3TA 4RAYA 2VE9A 3SHFA 3OSGA 4M3BA 3NWTA 3TBIA 2W85A 3MN2A 4WXHA 4E7HA 1EJ9A 4A3LJ 3QPTA 3J81K 2JJ7A 4RS8A 4A0ZA 1T08B 2ZMEA 1S9HA 4IRIA 3PNVA 2GA1A 1RRJA 4GDFA 2DN0A 3U2RA 4U7BA 5FRNA 2IEKA 3DQVC 2HOTA 3IHUA 1H9TA 1IRZA 2R7RA 1Z6TA 2LH9A 2F5EA 3K1PA 3E3VA 4AYBA 1VQ8I 2X51A 4WWCA 2Q2EA 1NHAA 2DODA 4L9NA 3G4SI 1KU2A 2ID6A 3QWLA 5L3BA 4XL9A 2JZYA 3CUOA 1IXSB 2NNYA 3K2AA 3AAFA 2K02A 1X4OA 2EWNA 3DPLC 5F1JA 1PDNC 2QBYA 5BPIA 1HOMA 1LNWA 2OUMA 2R3SA 3A1YA 3E5XA 2CQ7A 3IV5A 5FLXK 1SVOA 3RPUA 3DTIA 2XKPA 3DLAA 2P7VB 2QYOA 3MKYB 3I0TA 3ASOH 4G9YA 5DD4A 1EH6A 1JHFA 1SMTA 1ONVA 1HW2A 1OYWA 3G1LA 2JRMA 1K79A 2GXGA 4P1WA 3GTLJ 5BS6A 4BE1A 2WAQN 3SYTA 1Z91A 3ECOA 1GV5A 2E7XA 2XF5A 3C1DA 1I50J 5ILSA 3TO9A 2PFBA 3ZQFA 4JP0A 5FKLA 4AVZA 2CV2A 2K9QA 4V2GA 2HWVA 5B66C 1M1EB 1TWAJ 3FF5A 3I55I 1S29A 4R1HA 4IHVA 1OCPA 1V5FA 4XLCA 3CO7C 3V8LA 2HNHA 2X4HA 1OISA 1SC7A 3CJQB 2VKDA 3OYLA 4A3IJ 1LE8B 3OYHA 2MGQA 3P9IA 1DUXC 2DMNA 2GOMA 2JA2A 5CPRB 3NAUA 3M8EA 4RLQA 1J09A 1MSFC 2Z9OA 2KDZA 4ENNA 2HR3A 3J81Z 1XB4A 1Y6IA 1WPKA 4U87A 1VQ4I 2XGCA 2DMUA 1RPWA 3EETA 5BQTA 3F8CA 2QLZA 1QVUA 1JGGA 3BJAA 3W6KB 3VPRA 4NQWA 3FDYA 4D7NA 4PCQA 1QQIA 1HW5A 1JJ6C 3FBIB 4NC6A 3HHGA 3TW7A 2RDPA 2NVYJ 4IX7A 2CG4A 3GMEA 2DYSH 4BE2A 1DU0A 3M7GA 4A6DA 1W5CC 4OIPF 2A5YB 4I76A 2DFFA 3OSFA 2X48A 1FT9A 4ZYDA 2VKEA 4MQ9F 1QBJA 4UUVA 5FROA 4KISA 2LF7A 3K9TA 2NVTJ 1FMWA 2YR2A 5FKNA 1U5TC 2W48A 1Z67A 3BCAA 4B4CA 1LPQA 2OTLI 2HZDA 2PQ8A 1RNLA 3ECHA 3I5UA 5F08A 5LLQA 1K78B 5K7HA 3OR1C 4XLEA 5L3DA 2NNNA 5FLXZ 4ZC3A 1WJFA 3KEQA 4OIRF 5GPCA 1Y0UA 2VBZA 3ML6A 2F5CA 4EEFG 3FMQA 4O5VA 2XRLA 4A5MA 1C0WA 1YJNI 1HDDC 2ZCWA 5EG0A 1NH3A 1GXPA 2K4JA 5CJ9A 4IF4A 3FKIJ 2PJRB 2L01A 1F1ZA 4QPQA 2CUEA 2VPRA 1S7OA 2EJRA 2PEXA 3E6BA 1I1GA 2D1HA 3K7AJ 3S14J 2XGDA 2AHQA 2ZJ2A 2QF7A 4Y13A 3C2GA 3ESWB 1TWHJ 1BW6A 4UNOA 2M8EA 2IGKA 1LFBA 3K2ZA 1IO2A 1POGA 4M73A 3DFGA 1WJCA 5BPDA 1SEUA 1HW1A 3MQ0A 5EEAA 1R4NB 4DYRA 4F91B 1J7KA 4TV7A 2J5OA 3CC4I 4I2OA 2IA1A 2DT6A 3ZQCA 1GDTA 2ESHA 2X1EA 3LA2A 1MBJA 5K1YA 2P5KA 1SFEA 2JA8J 3FXOA 3GTQJ 3EUKL 3UKGA 3HGYA 1U5TA 2HXIA 3MWMA 2FRHA 1D0ZA 3I54A 3U1KA 2A69F 2BW3A 1UELB 1XCVA 3IAS2 3RKQA 4M3GA 3WHBA 1B8IA 2JMWA 2ELJA 4XK4A 5AONA 4KITB 5E17F 3MCZA 2ZMEB 5FKOA 5IP9J 2MFZA 3BTCA 3LQRA 5J8CA 2V26A 1WJEA 1R5GA 5HDKA 2EIKH 2O3FA 1S72I 2ZXWH 3A0BC 3QU6A 2Z3YA 4AYBN 5E3NA 3IH4A 3KIOA 4U0VA 2Q2EB 2NRAC 4A3FJ 4LLNA 4AIHA 4RM2A 2FF4A 4M6VA 3WODF 3JREA 2QQBA 2DA6A 3TGNA 2V9KA 3JCUC 1BI2A 3K0LA 1MJ9A 3SEQA 3PFYA 4NNJA 4PFPA 3JR9A 1VQ7I 3C18A 5FLMJ 2QBYB 4V19K 4FHTA 4PZJA 2CW7A 1Z9CA 1S7EA 1K6YA 2VUMJ 4O3MA 3HOTA 2MLKA 1RR7A 2MD5A 2V9VA 4NDLA 1BJAA 4XN0A 1QHGA 2Y0SN 4FISA 3FMSA 3PIPF 2KL4A 1Z21A 2L9VA 3QOPA 3H9QA 4KA4A 1O7FA 3F22A 1SFXA 2CSOA 2O9LA 4K2EA 1UHMA 2X6WA 2NS0A 4XORA 4LFUA 4HRIA 1JT6A 3I53A 2JA7J 1X1PA 4CCMA 1RUOA 2R7XA 3ABKH 3ASNH 1E3HA 3H0DA 1UZCA 4RA2A 3IC7A 4BACA 5J4YA 1BM9A 2ZNZA 1XD7A 2VL8A 2EK5A 4P9FA 3HSEA 3DCFA 2FQ4A 4E7SA 4P96A 5EEHA 4ZYHA 4DBRA 4E7IA 2OJED 4R8HA 4B47A 3WGHA 4IOAF 5A2QK 3KZZA 2JSPA 2VBWA 2GZWA 1R1UA 1OR7C 4HZFA 2D2WA 3GEZA 2HXOA 4MNUA 4RM3A 4ENMA 1VQ6I 1MBHA 1FWZA 4BHPA 2M7BA 2QKMB 3RTRA 5HNHA 4UB8C 4KT6A 3MFKA 1U0JA 4M71A 2HDWA 3DLLF 5LD2C 2NXNB 1YHQI 4F55A 5KK1A 3WTTC 2L0KA 1JHHA 5DCMA 1XS9A 4II3A 1UAAA 3FISA 1D0YA 2BV6A 2AQFA 4HDVA 3FKJA 3M4OJ 3OYNA 3H3ZA 5D4SA 3OIOA 1V3FA 3R61A 2HU9A 4FE4A 1I6HJ 2RVCA 1ZLKA 2K9SA 2EZLA 3ABTA 1QHHD 2F5VA 2O03A 1HKSA 3VOEA 4IHWA 4DJAA 3BG9A 3B6AA 3LSJA 1JXSA 4JX6A 4XLNF 3JTHA 4M9ZA 4D9JA 2CQXA 2M1BA 3HJEA 2A3SA 1KQ9A 5H6QA 5KNLA 3CC2I 4BUPA 2H94A 4BKXA 2VQCA 4E4HA 2ZKZA 4AM3A 4HX7A 3C2HA 3QOEA 4H0EA 1OCTC 2FOKA 1OR7A 3FXQA 2LREA 2HQ5A 1ZH5A 5K7FA 4G8XA 2DQLA 2CS3A 4QSHA 1YO5C 1H89C 2PI0A 1N78A 4KMFA 1SFKA 3LSHA 2R7QA 1MDMA 3V42A 3KP7A 5GTHC 1S6LA 5IY5H 1XX5A 3AG3H 2KMUA 3F0CA 3LSGA 3ERED 4BHCA 4HQMA 4KIFA 3V7CA 1S5LC 4A2UA 2VODA 3CJNA 4EJVA 5K5OA 1XMXA 2DT7B 2A5WA 1H0MA 1IGNA 1R5ID 5TGTA 3GVAA 2BXZA 3MKWB 2G0EA 1RZ4A 2QCOA 2WWYA 4XKWA 2FU4A 2DA1A 5M5WJ 1FOYA 4Y33A 5AIPA 1HA8A 5B5EC 1Z3YA 5DS9A 1MKMA 3AKZA 2H8WA 2Y0MA 2ZO4A 4ETSA 2Y31A 3K4CA 1U5TB 5JHUA 2WC2A 2GQQA 2EFOA 2VIXA 1DDNA 5FKMA 2BW3B 2DU9A 4NC7A 1XCBA 4ZDPA 2M30A 3OS0A 4IZZA 1B8IB 3DTEA 1NK3P 2ETHA 5E3LA 3D5RC 5AIQA 1YW8A 5DEQA 3REOA 2KJBA 2W25A 4ENKA 3L9FA 1TBXA 4RAFA 3WGIA 5KCMA 4IVNA 3RPUD 3S93A 3WU2C 4XLFA 5GTIC 3RKWA 1ZRCA 2DK8A 2VQGA 2JK3A 3HZJA 4KMUX 1G4DA 2DYRH 3CUQC 3L2UA 2LY2A 3F8BA 2LLKA 3FZVA 2PN6A 3EQLF 2ADUA 1GVJA 1AKHA 5CQEA 4G7OF 5IP6A 4YG2F 3PQKA 3IL2A 2JA6J 3H9JA 2R7VA 3HOXJ 4GYGA 3RJPA 3J80K 2LKSA 1S7AA 1CGPA 4IKFA 3KP3A 1G2HA 1I1SA 1F36A 2MC3A 4HLXA 2VXDA 3PUBA 3E6DA 2HTJA 4RB1A 2DBBA 3HRSA 1R49A 4MTDA 3CCSI 3E7LA 3I71A 2A05A 2F5DA 3K4LA 4A3CJ 2MBFA 3CMAI 4FE7A 4EGZA 4PDKA 4OAYA 5FJ8J 2YX7A 1IV8A 1PVEA 1D1BA 4MGRA 2WTEA 2MSYA 3D5LA 3MZHA 1MBEA 3U21A 3AFHA 5DD8A 3TO6A 1YJWI 3I64A 1X2MA 2BVLA 1XGNA 2AXTC 1HCRA 1U8BA 1I3QJ 4LIVA 3DBRB 4XLAA 2KZGA 1VQNI 2IS2A 2R5ZA 1F4KA 3HM5A 4B43A 2OTJI 3IUOA 1P7IA 4A69C 3GFMA 4XSZF 2ZFWA 3IWZA 3AG4H 4UVAA 3CUQA 1G3SA 3IRRA 5GADJ 3TDUC 3RCOA 2E5NA 3A03A 4AD9A 5LFAA 3QP5A 2DTRA 3CCMI 4N4OB 1K83J 3HRUA 2FQ3A 5HLGA 3I4MJ 3H3UA 1ZGAA 4EJTA 3BR5A 1X58A 2BYVE 4XRSG 3KZYA 5FD6A 1YTYA 1FPQA 2QEXI 4IRHA 2W7NA 1X3UA 1RR8C 2Z16A 3LWFA 1K4TA 5FLVA 4IHTA 5L3GA 3WTUC 1MH4A 2CMPA 4HPQA 4CYDA 4ESBA 2HYGD 2JPBA 2LYCA 2D1VA 1LDJA 1ULYA 2EA4A 2BY3A 5DCMB 4XLPF 5HLHA 1TW2A 1W7PA 3CDLA 4UHTA 1BOAA 5C4XJ 1OFCX 3CCQI 1ERDA 2BOLA 4DOZA 5D4RA 2R7WA 2LG4A 3DKWA 3FX3A 3SZGA 3O8HA 3HOSA 2VASA 4ITVA 4YFNF 2H27A 3KP2A 1IXCA 1V4RA 3J80Z 1F43A 2DLLA 2XASA 1KU3A
chains in the Genus database with same CATH topology
1BI0A 1R23A 1STZA 4ZZLA 4P5OA 5D5WB 2LSOA 1LVAA 3V4GA 1KA8A 3L00A 3HUGA 4M6YA 1R00A 2HDCA 4JK1X 2OBPA 1XGOA 2KRFA 3RKYA 4L5IA 1MDMB 3F21A 4BYYA 4G94A 4UVCA 1B9NA 5DUKA 1PP8F 5E20A 1TQMA 3K1MA 3RYRA 4IXAA 3EDPA 5K5QA 2HTSA 1L0OC 3ZPLA 2F5FA 4CZZA 4XBFA 2PMUA 1HKQA 1DPRA 2M87A 1J59A 4Q47A 4UV9A 2EV0A 1ZRFA 2EFQA 3CDHA 3K69A 3QP6A 3F8NA 2XGXA 3U1DA 1S3JA 3F8FA 3BJOA 4HV6A 2YSRA 4LG0B 3RDIA 4HX8A 1OKRA 5DDGA 1KQ8A 3KLOA 3WTZA 1WQ2A 1IXRC 4WF2A 4I01A 1KGSA 1DP7P 1IN8A 2CYYA 2GA2A 2PJPA 2OD5A 2Z33A 1B4AA 3NEUA 5FFXA 4Z2YA 3W6JB 2C6YA 2MH9A 3EYYA 5BMZA 2ELHA 5D8KB 3T8TA 3COAC 2Q0OA 4RGRA 2UXXA 2QUFA 1QZYA 1I5ZA 1UB9A 2FXAA 2RC4A 1D8JA 5LBQA 4HF2A 1BIAA 3LA3A 3WE2A 4KICA 4LB5A 3BPVA 1YFHA 2PG4A 3E6CC 3GFJA 3CUQB 4UXNA 1MJAA 4RGUA 4CICA 5BOXA 2DT5A 4G6DA 1O7LA 3VEPA 2FA5A 2IJLA 4OMZA 3WG9A 2WV0A 4KN7X 2QQ9A 1O3SA 5D5XB 1K6OA 4KIGA 1F9NA 1FBUA 2L02A 2QENA 2R7DA 4RB3C 4AWXB 1ZAOA 3DP7A 1W7PB 2STWA 3ROUA 1HXDA 1FNNA 2MH2A 2IP2A 5LGUA 1RI7A 2DK5A 3KP5A 4PGHA 5HS9A 3SZTA 3FWEA 4OMYA 4M9XA 1FLIA 3E97A 4KYWA 5DYMA 4HDUA 2FBIA 1WI9A 2O6GE 4ENJA 1BI1A 1J9IA 5LEKA 4GGGA 5DV5A 2P4WA 4IHSA 2TDXA 2NAZA 4BXUA 1B6AA 2VONA 2K86A 2PMHA 2XAQA 2L4MA 3LAPA 3E5UA 4L9VA 1UFMA 3QU3A 2FE3A 5CVUA 5E1WA 3HSFA 1HQCA 1J75A 2UWMA 2JT1A 3BJ6A 1IRGA 3CLOA 3M1EA 2QZ8A 1QZZA 3R6SA 5J6XA 2STTA 5H20A 2MLGA 3HTUA 5LHGA 2IA2A 1SD7A 1TQPA 3SQNA 3M8FA 4P9UA 3ZN1A 2QVOA 5LGTA 1PUEE 3MAJA 1HBXG 2VXZA 4ESJA 5TRDA 2H09A 4MTEA 2A6HF 2MA3A 1BC8C 2P5VA 2XUBA 4AVPA 2CQKA 3GZ6A 1XMAA 4MHGA 2Z5UA 5FGMA 1YQAA 3R4KA 5D5VB 3BP8A 2EB7A 3KEOA 1JGSA 1ZHFA 3ZP5A 5CVVA 2OAZA 3ZMVA 1USTA 4RGXA 2V1UA 2YU3A 3FXUA 2OZ6A 2O0YA 1SD4A 3GLXA 4ZZDA 2FEZA 1G3YA 4U0WA 2XRNA 3K1NA 4BH9A 1O3QA 4CHUA 2HKOA 1VTNC 3WU0A 3F6VA 1W7PD 4QWQA 1J0RA 1OPCA 3DF8A 3ZMUA 2XKOA 2JRTA 1JE8A 1MD0A 5HDNA 5EEGA 1SFUA 1FSHA 1J2XA 2DW4A 3P7NA 4Y17A 2P6SA 4YIIA 3S2WA 3P9KA 2E1CA 1QO0D 3TOBA 2O61A 2XIGA 1XGSA 5J8FA 2K27A 5ED4A 3GZ5A 3T5XA 3BDDA 4A0XA 2KIUA 1XGMA 4U88A 1O3RA 4R79A 1ON1A 1EV7A 3NQOA 4U7DA 5LHIA 2EV5A 2UZKA 3P9CA 1R7JA 3TDZC 3PFIA 1T98A 3G73A 1XN7A 2OQGA 3LSTA 3I58A 5ICCA 2B0LA 1YW7A 3L2CA 3WGGA 1ZG1A 1ODDA 2LKPA 1XSXA 3KP4A 4YFXF 5DCFA 1WKMA 4EV0A 3F72A 2GAUA 4HBLA 4DNCA 3DXJF 4WXDA 3KETA 2D45A 3JSOA 2HFHA 1WWXA 2EFNA 3LQQA 3V7SA 4BAYA 4IJAA 5ICGA 1SD6A 1D8KA 1KYZA 1H9GA 4OIOF 2L4AA 2O8XA 2VT2A 2A07F 2L54A 1HSTA 2FMYA 2DFIA 1TW3A 1WRJA 5E1XA 2IPQX 3F8MA 2A61A 5HLIA 3RIRA 2Y75A 1FYMA 1FBSA 2BGCA 2K4BA 1XDSA 2FBHA 1P4AA 4BHBA 3C7JA 3NRVA 3ZMTA 3L09A 5ICFA 4B09A 1W5TA 4NB5A 3DPTA 1L3LA 5D8LB 4EM2A 1IRFA 2RQPA 1HSJA 2G9WA 3ABUA 3I59A 1MJBA 1T6SA 2CFXA 3RKXA 2BE5F 5L3FA 2DI3A 1FY7A 4YIFA 2KKOA 5LRRA 5CVRA 3ISPA 3BZ6A 3GO5A 4HAMA 1YS7A 4P55A 2W24A 4ASNA 4KUMA 3KCCA 2Z99A 2VOOA 1TQIA 1HKTA 3GX4X 4XSXF 4I09A 5FO5A 1LDDA 3E6MA 2E1NA 1P4XA 1R36A 1XMKA 1YS6A 2JSCA 3QAHA 4MEXF 4I98B 1BC7C 3O3KA 3FM5A 4ESFA 2XROA 4KNYA 1QGPA 1B1BA 3RPQA 2AXLA 3JTGA 2RN7A 4CGZA 4ON0A 3DEUA 2UXNA 3GFLA 1P2FA 5D6EA 4Q5SF 1R1VA 1XSVA 2ZNYA 3KE2A 4Q48A 1OYIA 3EYIA 3HYIA 4L0YB 5CVJA 4A6EA 4HF0A 5L3CA 2Q8KA 2RV8A 3MEXA 2J5PA 5D6FA 1U2WA 5CYVA 2K7LA 2PBIA 4MEYF 4L0ZB 4JBAA 4LMYA 4MQVA 2HKXA 4I7HA 3O6BB 5LRSA 2KIMA 1REPC 4UVBA 3V8JA 1DPUA 4FX0A 4CO8A 1F5TA 4U0YA 3T0YA 3BY6A 2HEOA 2L3DA 1BBYA 2DO7A 2VC0A 2W57A 1U8RA 1TLHB 4NHJA 5FD5A 1Z05A 1BIBA 1FZPB 1LB2A 1O3TA 3F23A 4G7ZF 2YX4A 3IKVA 2LF8A 3L7WA 3SXYA 2YPRA 1G6NA 4RB2C 3QRFF 5CLSA 4ZYGA 4O6JA 1TNTA 2VBXA 1BN5A 2A68F 4OIQF 5HOOA 4LGWA 3VODA 2HOEA 1Q1HA 2HS5A 1PP7U 3KP6A 4LJZF 4M6XA 2EFPA 2GXBA 3N4MA 3IRQA 2COMA 4HOBA 4WK8F 2HQRA 4N9HA 4EJWA 3GUDA 2V1XA 1ZG5A 1GHCA 3B02A 2EA2A 3GXOA 3O2PE 1FOKA 4A5NA 3WTYC 4HYEA 1ZN2A 3I59B 3G3ZA 3LA7A 3Q9VA 1R1TA 3GYHX 2XHKA 2V79A 5TJJA 5F6FA 1TNSA 2X0LA 1T0FA 2KJCA 2XAHA 2VE8A 3GWZA 1EH8A 2DPDA 4BQAA 2ISZA 2H6BA 3V7RA 5ILVA 2VT3A 1ZGJA 2ESNA 4LB6B 5LEJA 2EV6A 3EUHA 4GO1A 2XV4S 1T39A 2M5WA 5HS7A 1RUNA 1D5VA 1OMIA 5CVIA 5ERIA 5DUIA 3GFIA 1I27A 1FYKA 4L9TA 1D3YA 4B8XA 2R7FA 5LHHA 2QM3A 1KYWA 1FBQA 4HX4A 2VBYA 2HYFA 1GXQA 4RB0A 2PLYA 4DQ2A 1RIOH 5JR3A 4LLGF 1CF7A 1SMYF 5F1RA 4KIBA 4S04A 1SD5A 1YW9A 1IUYA 2M45A 3U9GA 3HRTA 1USSA 2FMLA 1FX7A 3LFKA 4EVIA 4ZYEA 1U3EM 2P8TA 3KFWX 3CO6C 2W84A 3WU1B 2ZBKA 1XDUA 3T1BA 1ZG3A 3ZQ7A 1R22A 1FP2A 2XAFA 3SFZA 1FSEA 1Z7UA 3H92A 3HTSB 2G7UA 3RYPA 4A0YA 4HW0A 5H6RA 5L3EA 2P5LC 5F64A 2QWWA 1YG2A 1B9MA 4L5JA 1ZRDA 4GCVA 2P6TA 2JPCA 4AIKA 4WCGA 2OZUA 4AIJA 2ISYA 1Z6RA 1LDKB 2XAJA 3QPHA 4KFCA 2DPUA 2VOPA 3HSRA 3WE3A 3VB2A 4GYIA 4OOIA 5IT9K 1FC3A 3BPXA 1IF1A 2P7CB 4LLLA 2FNPA 2NYXA 2HZTA 5HVQC 4GXOA 4L18B 4I0BA 5JI6A 4FX4A 4EJUA 1ZYRF 2RGVA 4HV5A 3WTVC 3ZMDA 2ACJA 2OU2A 4EM1A 4KDPA 3R60A 4N0BA 5E8IA 4S05A 3E5QA 3TO7A 3F3XA 4M72A 2CGPA 5JFRA 4Q4ZF 4IRGA 3TQNA 3T8RA 2A6EF 5FFZA 1IAWA 3N97A 3Q9SA 4CDGA 4WXCA 2XVCA 1KU7A 5IT3A 1G3WA 4I02A 3BROA 5KVRA 2CO5A 4LK1F 1P92A 3LAJA 1IN6A 1R58A 3M9AA 3MZYA 3FMRA 2E7WA 4M9SA 1J5YA 2EFWA 2LDUA 3JAMK 1W5SA 1AWCA 5IT9Z 2V1DA 1SAXA 1E2XA 4LK0F 1LQ1A 4D0PA 1KU9A 3F6OA 3JSPA 4G7HF 4M74A 5E8GA 5ICEA 4A12A 5JVTA 3D0SA 1QNTA 4PGGA 3R0JA 4N9IA 1IN7A 1CF7B 4EM0B 1KQ0A 1LEBA 3ZMZA 3R0AA 4I0AA 1QPMA 4XRFA 2HQNA 1IN4A 1UCRA 3OOPA 1FP1D 2RNJA 4HQEA 3Q5FA 1ON2A 1T2KA 2CWEA 5A2QZ 1E17A 1LEAA 1A04A 3VFZA 4E70A 5K5RA 3HHHA 4RAZA 2BBYA 1FYLA 4FT8A 2BEOA 1ZREA 2VN2A 1WSUA 2OA4A 5E18F 4JQFA 4EJOA 4Y15A 3ZMSA 4KN4X 2KIFA 1YIOA 1LJ9A 6PAXA 3DV8A 4LG0A 3JAMZ 4RGSA 1I6XA 2FSWA 3PQJA 2IVMA 4ZH4F 4L9JA 3HIFA 4EGYA 2HGCA 3C3WA 2FNAA 1YLFA 2F2EA 2ZXJA 1TTYA 2IRFG 1U6GA 1IZ1A 2CW0F 3JW4A 4HF1A 3TOAA 4LD5A 3WTSC 3GF2A 2IA0A 4HLYA 3FHZA 4EMSA 3GW2A 4CXFA 2JTVA 5E1ZB 1AOYA 4HA8A 3IWFA 3CTAA 1O57A 3HRMA 3SZPA 2V6CA 1T38A 3IKTA 3ZN0A 5LGNA 2OQRA 4EQQA 1K7AA 4YFKF 2GWRA 2QQAA 2FBKA 1B59A 3FXRA 5FB2A 1P4WA 1YYVA 2DAOA 1BI3A 1W4MA 4WX9A 1R5HA 3RI4A 2IT0A 3I4PA 5HS8A 4QLCU 3B73A 3J7AO 2G7HA 2VC1A 3ULQB 4BNCA 3WTWC 1UHWA 3TKYA 2RKHA 5ILUA 1K78A 3WTXC 1U78A 1MZBA 1OYYA 2AS5F 1Z1DA 1ZLJA 4IPAA 3OV8A 4UV8A 3FM3A 1EH7A 4OINF 5D5UB 1MGTA 3KLNA 2Y48A 1ZARA 2XAGA 3BWGA 4F7ZA 5HDGA 3V8KA 1IW7F 2H6CA 4G6QA 4OU0A 4KT5C 1XSDA 2LNBA 1S8NA 2IW5A 3ELKA 2GIVA 3BOQA 1P6RA 1IN5A 2DQRA 1G3TA 4RAYA 2VE9A 3SHFA 2W85A 4WXHA 3QPTA 3J81K 4RS8A 4A0ZA 4IRIA 2ZMEA 2GA1A 3U2RA 4U7BA 3DQVC 3IHUA 1H9TA 1Z6TA 3K1PA 2F5EA 3E3VA 4WWCA 2Q2EA 1NHAA 4L9NA 1KU2A 5L3BA 2JZYA 3CUOA 1IXSB 2NNYA 3AAFA 2K02A 3DPLC 2EWNA 1PDNC 2QBYA 5BPIA 1LNWA 2R3SA 3E5XA 5FLXK 3RPUA 2XKPA 2P7VB 2QYOA 3I0TA 4G9YA 5DD4A 1EH6A 1JHFA 1SMTA 1ONVA 1HW2A 1OYWA 1K79A 2GXGA 5BS6A 1Z91A 3ECOA 2E7XA 3C1DA 5ILSA 3TO9A 2PFBA 2HWVA 3FF5A 1S29A 4R1HA 3CO7C 3V8LA 2X4HA 3P9IA 1DUXC 3M8EA 2Z9OA 4ENNA 2HR3A 3J81Z 1XB4A 3EETA 5BQTA 3F8CA 2QLZA 3BJAA 3W6KB 4NQWA 4PCQA 1QQIA 1HW5A 3HHGA 2RDPA 2CG4A 3M7GA 4A6DA 4OIPF 2A5YB 1FT9A 4ZYDA 4MQ9F 1QBJA 4UUVA 2LF7A 3K9TA 2YR2A 1U5TC 2PQ8A 1RNLA 3ECHA 3I5UA 5LLQA 1K78B 5FLXZ 5L3DA 2NNNA 3KEQA 4OIRF 1Y0UA 2VBZA 3ML6A 2F5CA 3FMQA 4O5VA 4A5MA 1C0WA 2ZCWA 1GXPA 2K4JA 5CJ9A 4IF4A 2L01A 1F1ZA 1S7OA 2EJRA 2PEXA 3E6BA 1I1GA 2D1HA 2ZJ2A 4Y13A 4UNOA 2M8EA 3K2ZA 4M73A 3DFGA 5BPDA 1HW1A 3MQ0A 1J7KA 4TV7A 2J5OA 4I2OA 2IA1A 2ESHA 3LA2A 5K1YA 2P5KA 1SFEA 1U5TA 3MWMA 2FRHA 3I54A 2A69F 1XCVA 5AONA 5E17F 3MCZA 2ZMEB 3LQRA 5J8CA 1R5GA 5HDKA 2O3FA 3QU6A 2Z3YA 4U0VA 2NRAC 4LLNA 4AIHA 2FF4A 3WODF 2QQBA 3TGNA 1BI2A 3K0LA 1MJ9A 3C18A 2QBYB 4FHTA 4PZJA 1Z9CA 4O3MA 3HOTA 2MLKA 2MD5A 2V9VA 1BJAA 3FMSA 3QOPA 4KA4A 1O7FA 3F22A 1SFXA 2CSOA 4K2EA 1UHMA 2NS0A 4LFUA 3I53A 1RUOA 3IC7A 1BM9A 2ZNZA 1XD7A 2EK5A 4P9FA 3HSEA 4P96A 5EEHA 4ZYHA 4R8HA 3WGHA 5A2QK 3KZZA 2VBWA 2GZWA 1R1UA 4HZFA 2D2WA 3GEZA 4MNUA 4ENMA 1FWZA 4BHPA 3RTRA 3MFKA 4M71A 5KK1A 3WTTC 1JHHA 5DCMA 2BV6A 4HDVA 3H3ZA 5D4SA 1V3FA 3R61A 2RVCA 1ZLKA 3ABTA 2O03A 1HKSA 3VOEA 1JXSA 4XLNF 3JTHA 4M9ZA 2M1BA 2A3SA 1KQ9A 5H6QA 2H94A 2ZKZA 4HX7A 4H0EA 2FOKA 1OR7A 3FXQA 1ZH5A 4G8XA 2DQLA 1YO5C 2PI0A 4KMFA 1MDMA 3KP7A 1S6LA 3ERED 4BHCA 4HQMA 4KIFA 3V7CA 4A2UA 2VODA 3CJNA 4EJVA 5K5OA 1H0MA 3GVAA 2WWYA 1RZ4A 2FU4A 5AIPA 1MKMA 2Y0MA 2ZO4A 4ETSA 1U5TB 5JHUA 2WC2A 2GQQA 2EFOA 1DDNA 2DU9A 1XCBA 2M30A 2ETHA 5AIQA 1YW8A 5DEQA 3REOA 2KJBA 2W25A 4ENKA 3L9FA 1TBXA 3WGIA 4IVNA 3RKWA 1ZRCA 2DK8A 4KMUX 1G4DA 3CUQC 3F8BA 3FZVA 2PN6A 3EQLF 2ADUA 1GVJA 4G7OF 4YG2F 3PQKA 3IL2A 4GYGA 3RJPA 3J80K 1S7AA 1CGPA 3KP3A 1I1SA 2MC3A 4HLXA 3E6DA 2HTJA 4RB1A 2DBBA 3HRSA 4MTDA 3I71A 2F5DA 2MBFA 4EGZA 4PDKA 2YX7A 4MGRA 2WTEA 3D5LA 3MZHA 5DD8A 3TO6A 3I64A 1XGNA 1F4KA 3GFMA 4XSZF 2ZFWA 3IWZA 4UVAA 3CUQA 1G3SA 3IRRA 3TDUC 4AD9A 3QP5A 2DTRA 3HRUA 2FQ3A 5HLGA 3H3UA 1ZGAA 4EJTA 2BYVE 3KZYA 5FD6A 1YTYA 1FPQA 4IRHA 1X3UA 3LWFA 4IHTA 5L3GA 3WTUC 4CYDA 4ESBA 2HYGD 2JPBA 2D1VA 1LDJA 1ULYA 2EA4A 5DCMB 4XLPF 5HLHA 1TW2A 1W7PA 4UHTA 1BOAA 5D4RA 3DKWA 3FX3A 3HOSA 4YFNF 2H27A 3KP2A 1IXCA 1V4RA 3J80Z 2DLLA 2XASA 1KU3A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1BI0 A;  1R23 A;  1STZ A;  4ZZL A;  4P5O A;  5D5W B;  2LSO A;  1LVA A;  3V4G A;  1KA8 A;  3L00 A;  3HUG A;  4M6Y A;  1R00 A;  2HDC A;  4JK1 X;  2OBP A;  1XGO A;  2KRF A;  3RKY A;  4L5I A;  1MDM B;  3F21 A;  4BYY A;  4G94 A;  4UVC A;  1B9N A;  5DUK A;  1PP8 F;  5E20 A;  1TQM A;  3K1M A;  3RYR A;  4IXA A;  3EDP A;  5K5Q A;  2HTS A;  1L0O C;  3ZPL A;  2F5F A;  4CZZ A;  4XBF A;  2PMU A;  1HKQ A;  1DPR A;  2M87 A;  1J59 A;  4Q47 A;  4UV9 A;  2EV0 A;  1ZRF A;  2EFQ A;  3CDH A;  3K69 A;  3QP6 A;  3F8N A;  2XGX A;  3U1D A;  1S3J A;  3F8F A;  3BJO A;  4HV6 A;  2YSR A;  4LG0 B;  3RDI A;  4HX8 A;  1OKR A;  5DDG A;  1KQ8 A;  3KLO A;  3WTZ A;  1WQ2 A;  1IXR C;  4WF2 A;  4I01 A;  1KGS A;  1DP7 P;  1IN8 A;  2CYY A;  2GA2 A;  2PJP A;  2OD5 A;  2Z33 A;  1B4A A;  3NEU A;  5FFX A;  4Z2Y A;  3W6J B;  2C6Y A;  2MH9 A;  3EYY A;  5BMZ A;  2ELH A;  5D8K B;  3T8T A;  3COA C;  2Q0O A;  4RGR A;  2UXX A;  2QUF A;  1QZY A;  1I5Z A;  1UB9 A;  2FXA A;  2RC4 A;  1D8J A;  5LBQ A;  4HF2 A;  1BIA A;  3LA3 A;  3WE2 A;  4KIC A;  4LB5 A;  3BPV A;  1YFH A;  2PG4 A;  3E6C C;  3GFJ A;  3CUQ B;  4UXN A;  1MJA A;  4RGU A;  4CIC A;  5BOX A;  2DT5 A;  4G6D A;  1O7L A;  3VEP A;  2FA5 A;  2IJL A;  4OMZ A;  3WG9 A;  2WV0 A;  4KN7 X;  2QQ9 A;  1O3S A;  5D5X B;  1K6O A;  4KIG A;  1F9N A;  1FBU A;  2L02 A;  2QEN A;  2R7D A;  4RB3 C;  4AWX B;  1ZAO A;  3DP7 A;  1W7P B;  2STW A;  3ROU A;  1HXD A;  1FNN A;  2MH2 A;  2IP2 A;  5LGU A;  1RI7 A;  2DK5 A;  3KP5 A;  4PGH A;  5HS9 A;  3SZT A;  3FWE A;  4OMY A;  4M9X A;  1FLI A;  3E97 A;  4KYW A;  5DYM A;  4HDU A;  2FBI A;  1WI9 A;  2O6G E;  4ENJ A;  1BI1 A;  1J9I A;  5LEK A;  4GGG A;  5DV5 A;  2P4W A;  4IHS A;  2TDX A;  2NAZ A;  4BXU A;  1B6A A;  2VON A;  2K86 A;  2PMH A;  2XAQ A;  2L4M A;  3LAP A;  3E5U A;  4L9V A;  1UFM A;  3QU3 A;  2FE3 A;  5CVU A;  5E1W A;  3HSF A;  1HQC A;  1J75 A;  2UWM A;  2JT1 A;  3BJ6 A;  1IRG A;  3CLO A;  3M1E A;  2QZ8 A;  1QZZ A;  3R6S A;  5J6X A;  2STT A;  5H20 A;  2MLG A;  3HTU A;  5LHG A;  2IA2 A;  1SD7 A;  1TQP A;  3SQN A;  3M8F A;  4P9U A;  3ZN1 A;  2QVO A;  5LGT A;  1PUE E;  3MAJ A;  1HBX G;  2VXZ A;  4ESJ A;  5TRD A;  2H09 A;  4MTE A;  2A6H F;  2MA3 A;  1BC8 C;  2P5V A;  2XUB A;  4AVP A;  2CQK A;  3GZ6 A;  1XMA A;  4MHG A;  2Z5U A;  5FGM A;  1YQA A;  3R4K A;  5D5V B;  3BP8 A;  2EB7 A;  3KEO A;  1JGS A;  1ZHF A;  3ZP5 A;  5CVV A;  2OAZ A;  3ZMV A;  1UST A;  4RGX A;  2V1U A;  2YU3 A;  3FXU A;  2OZ6 A;  2O0Y A;  1SD4 A;  3GLX A;  4ZZD A;  2FEZ A;  1G3Y A;  4U0W A;  2XRN A;  3K1N A;  4BH9 A;  1O3Q A;  4CHU A;  2HKO A;  1VTN C;  3WU0 A;  3F6V A;  1W7P D;  4QWQ A;  1J0R A;  1OPC A;  3DF8 A;  3ZMU A;  2XKO A;  2JRT A;  1JE8 A;  1MD0 A;  5HDN A;  5EEG A;  1SFU A;  1FSH A;  1J2X A;  2DW4 A;  3P7N A;  4Y17 A;  2P6S A;  4YII A;  3S2W A;  3P9K A;  2E1C A;  1QO0 D;  3TOB A;  2O61 A;  2XIG A;  1XGS A;  5J8F A;  2K27 A;  5ED4 A;  3GZ5 A;  3T5X A;  3BDD A;  4A0X A;  2KIU A;  1XGM A;  4U88 A;  1O3R A;  4R79 A;  1ON1 A;  1EV7 A;  3NQO A;  4U7D A;  5LHI A;  2EV5 A;  2UZK A;  3P9C A;  1R7J A;  3TDZ C;  3PFI A;  1T98 A;  3G73 A;  1XN7 A;  2OQG A;  3LST A;  3I58 A;  5ICC A;  2B0L A;  1YW7 A;  3L2C A;  3WGG A;  1ZG1 A;  1ODD A;  2LKP A;  1XSX A;  3KP4 A;  4YFX F;  5DCF A;  1WKM A;  4EV0 A;  3F72 A;  2GAU A;  4HBL A;  4DNC A;  3DXJ F;  4WXD A;  3KET A;  2D45 A;  3JSO A;  2HFH A;  1WWX A;  2EFN A;  3LQQ A;  3V7S A;  4BAY A;  4IJA A;  5ICG A;  1SD6 A;  1D8K A;  1KYZ A;  1H9G A;  4OIO F;  2L4A A;  2O8X A;  2VT2 A;  2A07 F;  2L54 A;  1HST A;  2FMY A;  2DFI A;  1TW3 A;  1WRJ A;  5E1X A;  2IPQ X;  3F8M A;  2A61 A;  5HLI A;  3RIR A;  2Y75 A;  1FYM A;  1FBS A;  2BGC A;  2K4B A;  1XDS A;  2FBH A;  1P4A A;  4BHB A;  3C7J A;  3NRV A;  3ZMT A;  3L09 A;  5ICF A;  4B09 A;  1W5T A;  4NB5 A;  3DPT A;  1L3L A;  5D8L B;  4EM2 A;  1IRF A;  2RQP A;  1HSJ A;  2G9W A;  3ABU A;  3I59 A;  1MJB A;  1T6S A;  2CFX A;  3RKX A;  2BE5 F;  5L3F A;  2DI3 A;  1FY7 A;  4YIF A;  2KKO A;  5LRR A;  5CVR A;  3ISP A;  3BZ6 A;  3GO5 A;  4HAM A;  1YS7 A;  4P55 A;  2W24 A;  4ASN A;  4KUM A;  3KCC A;  2Z99 A;  2VOO A;  1TQI A;  1HKT A;  3GX4 X;  4XSX F;  4I09 A;  5FO5 A;  1LDD A;  3E6M A;  2E1N A;  1P4X A;  1R36 A;  1XMK A;  1YS6 A;  2JSC A;  3QAH A;  4MEX F;  4I98 B;  1BC7 C;  3O3K A;  3FM5 A;  4ESF A;  2XRO A;  4KNY A;  1QGP A;  1B1B A;  3RPQ A;  2AXL A;  3JTG A;  2RN7 A;  4CGZ A;  4ON0 A;  3DEU A;  2UXN A;  3GFL A;  1P2F A;  5D6E A;  4Q5S F;  1R1V A;  1XSV A;  2ZNY A;  3KE2 A;  4Q48 A;  1OYI A;  3EYI A;  3HYI A;  4L0Y B;  5CVJ A;  4A6E A;  4HF0 A;  5L3C A;  2Q8K A;  2RV8 A;  3MEX A;  2J5P A;  5D6F A;  1U2W A;  5CYV A;  2K7L A;  2PBI A;  4MEY F;  4L0Z B;  4JBA A;  4LMY A;  4MQV A;  2HKX A;  4I7H A;  3O6B B;  5LRS A;  2KIM A;  1REP C;  4UVB A;  3V8J A;  1DPU A;  4FX0 A;  4CO8 A;  1F5T A;  4U0Y A;  3T0Y A;  3BY6 A;  2HEO A;  2L3D A;  1BBY A;  2DO7 A;  2VC0 A;  2W57 A;  1U8R A;  1TLH B;  4NHJ A;  5FD5 A;  1Z05 A;  1BIB A;  1FZP B;  1LB2 A;  1O3T A;  3F23 A;  4G7Z F;  2YX4 A;  3IKV A;  2LF8 A;  3L7W A;  3SXY A;  2YPR A;  1G6N A;  4RB2 C;  3QRF F;  5CLS A;  4ZYG A;  4O6J A;  1TNT A;  2VBX A;  1BN5 A;  2A68 F;  4OIQ F;  5HOO A;  4LGW A;  3VOD A;  2HOE A;  1Q1H A;  2HS5 A;  1PP7 U;  3KP6 A;  4LJZ F;  4M6X A;  2EFP A;  2GXB A;  3N4M A;  3IRQ A;  2COM A;  4HOB A;  4WK8 F;  2HQR A;  4N9H A;  4EJW A;  3GUD A;  2V1X A;  1ZG5 A;  1GHC A;  3B02 A;  2EA2 A;  3GXO A;  3O2P E;  1FOK A;  4A5N A;  3WTY C;  4HYE A;  1ZN2 A;  3I59 B;  3G3Z A;  3LA7 A;  3Q9V A;  1R1T A;  3GYH X;  2XHK A;  2V79 A;  5TJJ A;  5F6F A;  1TNS A;  2X0L A;  1T0F A;  2KJC A;  2XAH A;  2VE8 A;  3GWZ A;  1EH8 A;  2DPD A;  4BQA A;  2ISZ A;  2H6B A;  3V7R A;  5ILV A;  2VT3 A;  1ZGJ A;  2ESN A;  4LB6 B;  5LEJ A;  2EV6 A;  3EUH A;  4GO1 A;  2XV4 S;  1T39 A;  2M5W A;  5HS7 A;  1RUN A;  1D5V A;  1OMI A;  5CVI A;  5ERI A;  5DUI A;  3GFI A;  1I27 A;  1FYK A;  4L9T A;  1D3Y A;  4B8X A;  2R7F A;  5LHH A;  2QM3 A;  1KYW A;  1FBQ A;  4HX4 A;  2VBY A;  2HYF A;  1GXQ A;  4RB0 A;  2PLY A;  4DQ2 A;  1RIO H;  5JR3 A;  4LLG F;  1CF7 A;  1SMY F;  5F1R A;  4KIB A;  4S04 A;  1SD5 A;  1YW9 A;  1IUY A;  2M45 A;  3U9G A;  3HRT A;  1USS A;  2FML A;  1FX7 A;  3LFK A;  4EVI A;  4ZYE A;  1U3E M;  2P8T A;  3KFW X;  3CO6 C;  2W84 A;  3WU1 B;  2ZBK A;  1XDU A;  3T1B A;  1ZG3 A;  3ZQ7 A;  1R22 A;  1FP2 A;  2XAF A;  3SFZ A;  1FSE A;  1Z7U A;  3H92 A;  3HTS B;  2G7U A;  3RYP A;  4A0Y A;  4HW0 A;  5H6R A;  5L3E A;  2P5L C;  5F64 A;  2QWW A;  1YG2 A;  1B9M A;  4L5J A;  1ZRD A;  4GCV A;  2P6T A;  2JPC A;  4AIK A;  4WCG A;  2OZU A;  4AIJ A;  2ISY A;  1Z6R A;  1LDK B;  2XAJ A;  3QPH A;  4KFC A;  2DPU A;  2VOP A;  3HSR A;  3WE3 A;  3VB2 A;  4GYI A;  4OOI A;  5IT9 K;  1FC3 A;  3BPX A;  1IF1 A;  2P7C B;  4LLL A;  2FNP A;  2NYX A;  2HZT A;  5HVQ C;  4GXO A;  4L18 B;  4I0B A;  5JI6 A;  4FX4 A;  4EJU A;  1ZYR F;  2RGV A;  4HV5 A;  3WTV C;  3ZMD A;  2ACJ A;  2OU2 A;  4EM1 A;  4KDP A;  3R60 A;  4N0B A;  5E8I A;  4S05 A;  3E5Q A;  3TO7 A;  3F3X A;  4M72 A;  2CGP A;  5JFR A;  4Q4Z F;  4IRG A;  3TQN A;  3T8R A;  2A6E F;  5FFZ A;  1IAW A;  3N97 A;  3Q9S A;  4CDG A;  4WXC A;  2XVC A;  1KU7 A;  5IT3 A;  1G3W A;  4I02 A;  3BRO A;  5KVR A;  2CO5 A;  4LK1 F;  1P92 A;  3LAJ A;  1IN6 A;  1R58 A;  3M9A A;  3MZY A;  3FMR A;  2E7W A;  4M9S A;  1J5Y A;  2EFW A;  2LDU A;  3JAM K;  1W5S A;  1AWC A;  5IT9 Z;  2V1D A;  1SAX A;  1E2X A;  4LK0 F;  1LQ1 A;  4D0P A;  1KU9 A;  3F6O A;  3JSP A;  4G7H F;  4M74 A;  5E8G A;  5ICE A;  4A12 A;  5JVT A;  3D0S A;  1QNT A;  4PGG A;  3R0J A;  4N9I A;  1IN7 A;  1CF7 B;  4EM0 B;  1KQ0 A;  1LEB A;  3ZMZ A;  3R0A A;  4I0A A;  1QPM A;  4XRF A;  2HQN A;  1IN4 A;  1UCR A;  3OOP A;  1FP1 D;  2RNJ A;  4HQE A;  3Q5F A;  1ON2 A;  1T2K A;  2CWE A;  5A2Q Z;  1E17 A;  1LEA A;  1A04 A;  3VFZ A;  4E70 A;  5K5R A;  3HHH A;  4RAZ A;  2BBY A;  1FYL A;  4FT8 A;  2BEO A;  1ZRE A;  2VN2 A;  1WSU A;  2OA4 A;  5E18 F;  4JQF A;  4EJO A;  4Y15 A;  3ZMS A;  4KN4 X;  2KIF A;  1YIO A;  1LJ9 A;  6PAX A;  3DV8 A;  4LG0 A;  3JAM Z;  4RGS A;  1I6X A;  2FSW A;  3PQJ A;  2IVM A;  4ZH4 F;  4L9J A;  3HIF A;  4EGY A;  2HGC A;  3C3W A;  2FNA A;  1YLF A;  2F2E A;  2ZXJ A;  1TTY A;  2IRF G;  1U6G A;  1IZ1 A;  2CW0 F;  3JW4 A;  4HF1 A;  3TOA A;  4LD5 A;  3WTS C;  3GF2 A;  2IA0 A;  4HLY A;  3FHZ A;  4EMS A;  3GW2 A;  4CXF A;  2JTV A;  5E1Z B;  1AOY A;  4HA8 A;  3IWF A;  3CTA A;  1O57 A;  3HRM A;  3SZP A;  2V6C A;  1T38 A;  3IKT A;  3ZN0 A;  5LGN A;  2OQR A;  4EQQ A;  1K7A A;  4YFK F;  2GWR A;  2QQA A;  2FBK A;  1B59 A;  3FXR A;  5FB2 A;  1P4W A;  1YYV A;  2DAO A;  1BI3 A;  1W4M A;  4WX9 A;  1R5H A;  3RI4 A;  2IT0 A;  3I4P A;  5HS8 A;  4QLC U;  3B73 A;  3J7A O;  2G7H A;  2VC1 A;  3ULQ B;  4BNC A;  3WTW C;  1UHW A;  3TKY A;  2RKH A;  5ILU A;  1K78 A;  3WTX C;  1U78 A;  1MZB A;  1OYY A;  2AS5 F;  1Z1D A;  1ZLJ A;  4IPA A;  3OV8 A;  4UV8 A;  3FM3 A;  1EH7 A;  4OIN F;  5D5U B;  1MGT A;  3KLN A;  2Y48 A;  1ZAR A;  2XAG A;  3BWG A;  4F7Z A;  5HDG A;  3V8K A;  1IW7 F;  2H6C A;  4G6Q A;  4OU0 A;  4KT5 C;  1XSD A;  2LNB A;  1S8N A;  2IW5 A;  3ELK A;  2GIV A;  3BOQ A;  1P6R A;  1IN5 A;  2DQR A;  1G3T A;  4RAY A;  2VE9 A;  3SHF A;  2W85 A;  4WXH A;  3QPT A;  3J81 K;  4RS8 A;  4A0Z A;  4IRI A;  2ZME A;  2GA1 A;  3U2R A;  4U7B A;  3DQV C;  3IHU A;  1H9T A;  1Z6T A;  3K1P A;  2F5E A;  3E3V A;  4WWC A;  2Q2E A;  1NHA A;  4L9N A;  1KU2 A;  5L3B A;  2JZY A;  3CUO A;  1IXS B;  2NNY A;  3AAF A;  2K02 A;  3DPL C;  2EWN A;  1PDN C;  2QBY A;  5BPI A;  1LNW A;  2R3S A;  3E5X A;  5FLX K;  3RPU A;  2XKP A;  2P7V B;  2QYO A;  3I0T A;  4G9Y A;  5DD4 A;  1EH6 A;  1JHF A;  1SMT A;  1ONV A;  1HW2 A;  1OYW A;  1K79 A;  2GXG A;  5BS6 A;  1Z91 A;  3ECO A;  2E7X A;  3C1D A;  5ILS A;  3TO9 A;  2PFB A;  2HWV A;  3FF5 A;  1S29 A;  4R1H A;  3CO7 C;  3V8L A;  2X4H A;  3P9I A;  1DUX C;  3M8E A;  2Z9O A;  4ENN A;  2HR3 A;  3J81 Z;  1XB4 A;  3EET A;  5BQT A;  3F8C A;  2QLZ A;  3BJA A;  3W6K B;  4NQW A;  4PCQ A;  1QQI A;  1HW5 A;  3HHG A;  2RDP A;  2CG4 A;  3M7G A;  4A6D A;  4OIP F;  2A5Y B;  1FT9 A;  4ZYD A;  4MQ9 F;  1QBJ A;  4UUV A;  2LF7 A;  3K9T A;  2YR2 A;  1U5T C;  2PQ8 A;  1RNL A;  3ECH A;  3I5U A;  5LLQ A;  1K78 B;  5FLX Z;  5L3D A;  2NNN A;  3KEQ A;  4OIR F;  1Y0U A;  2VBZ A;  3ML6 A;  2F5C A;  3FMQ A;  4O5V A;  4A5M A;  1C0W A;  2ZCW A;  1GXP A;  2K4J A;  5CJ9 A;  4IF4 A;  2L01 A;  1F1Z A;  1S7O A;  2EJR A;  2PEX A;  3E6B A;  1I1G A;  2D1H A;  2ZJ2 A;  4Y13 A;  4UNO A;  2M8E A;  3K2Z A;  4M73 A;  3DFG A;  5BPD A;  1HW1 A;  3MQ0 A;  1J7K A;  4TV7 A;  2J5O A;  4I2O A;  2IA1 A;  2ESH A;  3LA2 A;  5K1Y A;  2P5K A;  1SFE A;  1U5T A;  3MWM A;  2FRH A;  3I54 A;  2A69 F;  1XCV A;  5AON A;  5E17 F;  3MCZ A;  2ZME B;  3LQR A;  5J8C A;  1R5G A;  5HDK A;  2O3F A;  3QU6 A;  2Z3Y A;  4U0V A;  2NRA C;  4LLN A;  4AIH A;  2FF4 A;  3WOD F;  2QQB A;  3TGN A;  1BI2 A;  3K0L A;  1MJ9 A;  3C18 A;  2QBY B;  4FHT A;  4PZJ A;  1Z9C A;  4O3M A;  3HOT A;  2MLK A;  2MD5 A;  2V9V A;  1BJA A;  3FMS A;  3QOP A;  4KA4 A;  1O7F A;  3F22 A;  1SFX A;  2CSO A;  4K2E A;  1UHM A;  2NS0 A;  4LFU A;  3I53 A;  1RUO A;  3IC7 A;  1BM9 A;  2ZNZ A;  1XD7 A;  2EK5 A;  4P9F A;  3HSE A;  4P96 A;  5EEH A;  4ZYH A;  4R8H A;  3WGH A;  5A2Q K;  3KZZ A;  2VBW A;  2GZW A;  1R1U A;  4HZF A;  2D2W A;  3GEZ A;  4MNU A;  4ENM A;  1FWZ A;  4BHP A;  3RTR A;  3MFK A;  4M71 A;  5KK1 A;  3WTT C;  1JHH A;  5DCM A;  2BV6 A;  4HDV A;  3H3Z A;  5D4S A;  1V3F A;  3R61 A;  2RVC A;  1ZLK A;  3ABT A;  2O03 A;  1HKS A;  3VOE A;  1JXS A;  4XLN F;  3JTH A;  4M9Z A;  2M1B A;  2A3S A;  1KQ9 A;  5H6Q A;  2H94 A;  2ZKZ A;  4HX7 A;  4H0E A;  2FOK A;  1OR7 A;  3FXQ A;  1ZH5 A;  4G8X A;  2DQL A;  1YO5 C;  2PI0 A;  4KMF A;  1MDM A;  3KP7 A;  1S6L A;  3ERE D;  4BHC A;  4HQM A;  4KIF A;  3V7C A;  4A2U A;  2VOD A;  3CJN A;  4EJV A;  5K5O A;  1H0M A;  3GVA A;  2WWY A;  1RZ4 A;  2FU4 A;  5AIP A;  1MKM A;  2Y0M A;  2ZO4 A;  4ETS A;  1U5T B;  5JHU A;  2WC2 A;  2GQQ A;  2EFO A;  1DDN A;  2DU9 A;  1XCB A;  2M30 A;  2ETH A;  5AIQ A;  1YW8 A;  5DEQ A;  3REO A;  2KJB A;  2W25 A;  4ENK A;  3L9F A;  1TBX A;  3WGI A;  4IVN A;  3RKW A;  1ZRC A;  2DK8 A;  4KMU X;  1G4D A;  3CUQ C;  3F8B A;  3FZV A;  2PN6 A;  3EQL F;  2ADU A;  1GVJ A;  4G7O F;  4YG2 F;  3PQK A;  3IL2 A;  4GYG A;  3RJP A;  3J80 K;  1S7A A;  1CGP A;  3KP3 A;  1I1S A;  2MC3 A;  4HLX A;  3E6D A;  2HTJ A;  4RB1 A;  2DBB A;  3HRS A;  4MTD A;  3I71 A;  2F5D A;  2MBF A;  4EGZ A;  4PDK A;  2YX7 A;  4MGR A;  2WTE A;  3D5L A;  3MZH A;  5DD8 A;  3TO6 A;  3I64 A;  1XGN A;  1F4K A;  3GFM A;  4XSZ F;  2ZFW A;  3IWZ A;  4UVA A;  3CUQ A;  1G3S A;  3IRR A;  3TDU C;  4AD9 A;  3QP5 A;  2DTR A;  3HRU A;  2FQ3 A;  5HLG A;  3H3U A;  1ZGA A;  4EJT A;  2BYV E;  3KZY A;  5FD6 A;  1YTY A;  1FPQ A;  4IRH A;  1X3U A;  3LWF A;  4IHT A;  5L3G A;  3WTU C;  4CYD A;  4ESB A;  2HYG D;  2JPB A;  2D1V A;  1LDJ A;  1ULY A;  2EA4 A;  5DCM B;  4XLP F;  5HLH A;  1TW2 A;  1W7P A;  4UHT A;  1BOA A;  5D4R A;  3DKW A;  3FX3 A;  3HOS A;  4YFN F;  2H27 A;  3KP2 A;  1IXC A;  1V4R A;  3J80 Z;  2DLL A;  2XAS A;  1KU3 A; 
#chains in the Genus database with same CATH topology
 3OYE A;  2Y9Y A;  1BI0 A;  1R23 A;  1STZ A;  4ZZL A;  3HOW J;  1RES A;  4P5O A;  3FK6 A;  2Z1D A;  5D5W B;  2LSO A;  3GTK J;  2VKV A;  1JUM A;  1LVA A;  1MNE A;  2XF7 A;  3V4G A;  9ANT A;  1KA8 A;  2ECB A;  2N8G A;  1D5Y A;  3L00 A;  3HUG A;  1KON A;  4M6Y A;  4XID A;  1R00 A;  1BR2 A;  2BHY A;  3Q0U A;  3VSL A;  3ONQ A;  2OC6 A;  2HDC A;  2E1M C;  4JK1 X;  3F9K A;  2ECC A;  3CZ6 A;  1WI3 A;  4PSW A;  2OBP A;  2R7Z J;  1XGO A;  5E79 C;  2KRF A;  3RKY A;  4L5I A;  1MDM B;  1JTY A;  3GLL A;  3Q3S A;  2ZXI A;  2M3A A;  3VSK A;  3F21 A;  4BYY A;  3GTO J;  4G94 A;  2F4I A;  3AG2 H;  3ABM H;  2E34 A;  4UVC A;  1B9N A;  5DUK A;  1PP8 F;  1FIP A;  5E20 A;  5M5Y J;  1TQM A;  3K1M A;  3RYR A;  3GZN B;  4IXA A;  2WAF A;  3EDP A;  5K5Q A;  2HTS A;  1L0O C;  3S1M J;  4CYC A;  3ZPL A;  1Z0X A;  4BQQ A;  4ZDO A;  2F5F A;  3VWB A;  4CZZ A;  4XBF A;  2EIJ H;  2PMU A;  1HKQ A;  3RQI A;  5M5X J;  3QYB A;  3I4N J;  4Y7N J;  1DPR A;  2QSG X;  3BTL A;  2M87 A;  1TWG J;  3I3L A;  3ZR8 X;  1J59 A;  4Q47 A;  4UV9 A;  3E0J B;  3BTJ A;  3AL0 C;  2EV0 A;  4HNT A;  1HLV A;  4H4K C;  2XF6 A;  3HG9 A;  1VQK I;  1ZRF A;  2EFQ A;  1OQY A;  3CDH A;  3K69 A;  1ZK8 A;  3HXL A;  1ENH A;  3QP6 A;  2HOA A;  3F8N A;  2XGX A;  2CH0 A;  3U1D A;  1AU7 A;  3GTM J;  2P81 A;  5FRM A;  2EIN H;  1W0U A;  1S3J A;  5IOY A;  1D0X A;  3F8F A;  3BJO A;  4CZC A;  4HV6 A;  2FUG 2;  2HOS A;  2YSR A;  4LG0 B;  1JJ8 C;  2O7O A;  4BDY A;  2KIQ A;  3RDI A;  4HX8 A;  2B7E A;  5EGO A;  1IC8 A;  4MIM A;  1OKR A;  1I3A A;  1AKH B;  3K4M A;  4PJL A;  5DDG A;  1KQ8 A;  2OCE A;  3CCY A;  3KLO A;  3WTZ A;  1WQ2 A;  5K7Z A;  1IXR C;  3BQZ A;  2PX9 A;  2EZH A;  2Y0S A;  2ZSI B;  4WF2 A;  2IAI A;  1TC3 C;  4I01 A;  4CCN A;  4CCL A;  1KGS A;  1DP7 P;  1IN8 A;  3WG7 H;  2NS7 A;  2CYY A;  3UNG C;  4DZJ A;  3CCL I;  2HVR A;  2M0M A;  2GA2 A;  2PJP A;  2OD5 A;  2Z33 A;  1B4A A;  3HGG A;  3NEU A;  5J40 A;  5FFX A;  4Z2Y A;  2W1O A;  3W2V A;  1RET A;  4D1Q A;  3W6J B;  2C6Y A;  2MH9 A;  2WB1 A;  3EYY A;  3DBL B;  3ZGK A;  5BMZ A;  2ELH A;  5D8K B;  3T8T A;  3COA C;  2Q0O A;  4RGR A;  2UXX A;  2QUF A;  1QZY A;  3DTK A;  3GTP J;  1I5Z A;  1UB9 A;  2FXA A;  2RC4 A;  1D8J A;  5LBQ A;  4HF2 A;  1BIA A;  3LA3 A;  1Y1V J;  3WE2 A;  2R5Z B;  2Y30 A;  3A02 A;  4KIC A;  1MMA A;  2ELK A;  4UB6 C;  4LB5 A;  2BZT A;  1BR4 A;  3BPV A;  1YFH A;  2PG4 A;  2TRT A;  4F52 A;  3E6C C;  2NVQ J;  3GFJ A;  3CUQ B;  2W00 A;  4I99 C;  4UXN A;  1MJA A;  2KFD A;  4RGU A;  3H5A A;  2FX0 A;  4X1E A;  4CIC A;  1RKT A;  5BOX A;  4BJ5 C;  1EA3 A;  2DT5 A;  4G6D A;  1O7L A;  3MVP A;  3VEP A;  3D1N I;  2FA5 A;  1BJZ A;  4XLH A;  2IJL A;  1UG0 A;  4OMZ A;  3WG9 A;  2WV0 A;  4KN7 X;  2QQ9 A;  1O3S A;  3LSP A;  4C2U A;  2LC2 A;  5D5X B;  1ZR2 A;  1K6O A;  4KIG A;  1F9N A;  5CQG A;  1ZKG A;  1FBU A;  2L02 A;  3BTI A;  2ICW G;  3BLY A;  4XMY A;  1LUJ B;  3E1S A;  2QEN A;  1LKX A;  2R7D A;  4RB3 C;  2I10 A;  3IH3 A;  3MD2 A;  5M3F J;  4AWX B;  5EZG A;  1YIT I;  1ZAO A;  3DP7 A;  1V54 H;  1W7P B;  3ERM A;  2CJJ A;  3OS2 A;  2STW A;  2M8G X;  3ROU A;  3JRG A;  1HXD A;  3RSN A;  4BY1 J;  1FNN A;  2MH2 A;  3OL3 A;  2IP2 A;  1GUU A;  3HPH A;  4PSX A;  4ZDL A;  5LGU A;  1RI7 A;  2M0C A;  3OOU A;  5CKT A;  3TP0 A;  2DK5 A;  3L2V A;  4UY8 I;  3KP5 A;  4DIQ A;  1YOV B;  4PGH A;  4PJJ A;  5HS9 A;  3SZT A;  3FWE A;  5JHF A;  2X9D A;  1JTX A;  4OMY A;  4M9X A;  3FXL A;  5FKK A;  1FLI A;  3SDB A;  3L1P A;  1WJ5 A;  3TED A;  3E97 A;  4YIR X;  1GLN A;  4KYW A;  2KT0 A;  1MBG A;  1D1C A;  3HUG B;  5DYM A;  3BZK A;  2M4K A;  4HDU A;  2OPT A;  2FBI A;  3BR1 A;  1WI9 A;  2O6G E;  3BC8 A;  4B1R A;  3K4N A;  5C4J J;  1BI1 A;  4ENJ A;  3KX2 A;  1J9I A;  5LEK A;  4GGG A;  3Q0W A;  3OL4 A;  5DV5 A;  4HNU A;  2P4W A;  4IHS A;  2X6O A;  2TDX A;  2NAZ A;  4BXU A;  1PJR A;  1ETO A;  2LKX A;  1ITY A;  4B44 A;  5EDN A;  4PK4 A;  1B6A A;  4E6K G;  2VJI A;  2VON A;  2K86 A;  2XAQ A;  2PMH A;  4W97 A;  4A93 J;  4IOC F;  2E1O A;  2L4M A;  3SJM A;  3LAP A;  4CYC B;  3E5U A;  4L9V A;  2EPF A;  2F4O B;  1UFM A;  3QU3 A;  3PNY A;  4X0G A;  2FE3 A;  5CVU A;  3OYD A;  5E1W A;  4F93 B;  2H1K A;  3HSF A;  1HQC A;  2K9M A;  1J75 A;  2UWM A;  2JT1 A;  3BJ6 A;  3LL7 A;  1IRG A;  4J00 A;  2E36 A;  2EZK A;  3G6E I;  3CLO A;  3M1E A;  3P5J A;  2QZ8 A;  4DYC A;  1QZZ A;  1WH7 A;  2DMT A;  3R6S A;  4CCJ A;  5J6X A;  3OYB A;  2STT A;  3OYF A;  2AQE A;  5H20 A;  2MLG A;  4JYK A;  3HTU A;  2NS8 A;  1YX3 A;  5LHG A;  2HPI A;  4S0H B;  2IA2 A;  1SD7 A;  2GIZ A;  3W2W A;  2Y2Z A;  1TQP A;  2W82 A;  1R9T J;  2E1M B;  3SQN A;  5B3S H;  3HOZ J;  2L7F P;  1RKW A;  3M8F A;  4P9U A;  2L7K A;  3ZN1 A;  3Q0V A;  3S2H J;  2QVO A;  2L9R A;  5LGT A;  2ZSH B;  4NC8 A;  2XB0 X;  1PUE E;  3MAJ A;  1HBX G;  2VXZ A;  4ESJ A;  5EGO B;  5TRD A;  2H09 A;  4BDZ A;  4MTE A;  3S15 J;  2A6H F;  2MA3 A;  1MNM C;  2CU7 A;  2DJN A;  4CA0 A;  1BC8 C;  2P5V A;  2XUB A;  1X1A A;  5EYR A;  4AVP A;  2CQK A;  4L5E A;  5E3O A;  2Q1Z B;  3GZ6 A;  2HI3 A;  1VZ0 A;  1XMA A;  4MHG A;  2E2J J;  1LVK A;  4MFE A;  4V2F A;  3J7Y J;  2Z5U A;  5FGM A;  3S17 J;  1Y1W J;  1YQA A;  1H88 C;  1IRX A;  3R4K A;  5D5V B;  2LY1 A;  3HBL A;  3BP8 A;  2EB7 A;  3KEO A;  2WB1 N;  3ZRG A;  4BQO A;  3AL0 B;  4NUB A;  1JGS A;  4E7J A;  1ZHF A;  3ZP5 A;  5CVV A;  1Y8Q B;  2OAZ A;  3ZMV A;  1UST A;  4RGX A;  3VDX A;  4ANJ A;  2V1U A;  2YU3 A;  3FXU A;  3WHC A;  2OZ6 A;  2O0Y A;  3HOU J;  1NG6 A;  1SD4 A;  3GLX A;  4ZZD A;  1N75 A;  4XN3 A;  2FEZ A;  1G3Y A;  1IDZ A;  2XPW A;  4U0W A;  1TT5 B;  2K9L A;  2XRN A;  3K1N A;  2VJ5 A;  3GBG A;  1ETY A;  2LD5 A;  4BH9 A;  1O3Q A;  3HKZ A;  3PJR A;  4CHU A;  1E0E A;  2HKO A;  2ZXH A;  1VTN C;  1OCZ H;  3WU0 A;  5HLT A;  3F6V A;  4C2T A;  1QA6 A;  1MW7 A;  2BHZ A;  3CP8 A;  3CF5 F;  1W7P D;  2F48 A;  4QWQ A;  1J0R A;  1OPC A;  4NQW B;  3DF8 A;  2LOO A;  3ZMU A;  2XKO A;  2JRT A;  2GBY A;  3FHN A;  2IS1 A;  3LSM A;  4A3J J;  3G2B A;  1JE8 A;  2JUC A;  1MD0 A;  5HDN A;  5EEG A;  2JQ7 A;  1SFU A;  1FSH A;  1P7J A;  1J2X A;  2DW4 A;  3P7N A;  4Y17 A;  2P6S A;  4YII A;  5F0C A;  3S2W A;  2B9S A;  4BE0 A;  2IS4 A;  4BXX J;  3P9K A;  1VI0 A;  4ZTJ A;  3SFI A;  1QO0 D;  2E1C A;  1Y0N A;  1HC8 A;  3K10 A;  3TOB A;  2O61 A;  1AA7 A;  2XIG A;  2V6E A;  1XGS A;  2DDB A;  5J8F A;  1WCM J;  2K27 A;  3VYU B;  1ZR4 A;  2GXA A;  2ME6 A;  5ED4 A;  3GZ5 A;  3T5X A;  3KEY A;  5EG0 B;  1OLT A;  2LRD A;  1WFX A;  3BDD A;  1YE9 A;  4A0X A;  4ABZ A;  2KIU A;  3FIW A;  1XGM A;  1A6I A;  4UUT A;  4U88 A;  5KAF C;  1O3R A;  2YUS A;  1QRY A;  4ZYA A;  4R79 A;  1ON1 A;  1EV7 A;  3NQO A;  4U7D A;  4BQN A;  1W1W E;  5LHI A;  2EV5 A;  2UZK A;  2KZV A;  2P0W A;  3P9C A;  1R7J A;  1OJL A;  2LTP A;  3TDZ C;  2IBD A;  3PFI A;  3S3M A;  3HOV J;  2HVQ A;  4BL0 B;  2OV7 A;  1T98 A;  3CJR B;  2VKH A;  3G73 A;  2R0Q C;  1XN7 A;  4D7M A;  2QQ8 A;  3ZXS A;  2LVS A;  5F27 A;  2OQG A;  3LST A;  3I58 A;  3S8P A;  2AO9 A;  5ICC A;  2B0L A;  4FET A;  1YW7 A;  3KZI C;  2JN6 A;  3BT9 A;  3CF2 A;  5EZH A;  5B1B H;  3CD6 I;  3L2C A;  1X2N A;  2KHM A;  3M07 A;  3KYD B;  3WGG A;  3TL4 X;  1ZG1 A;  4ZJZ A;  5GAE J;  3ZCO A;  4C2M J;  1ODD A;  2LKP A;  1XSX A;  3KP4 A;  4YFX F;  5DCF A;  2CV1 A;  1WKM A;  4EV0 A;  3F72 A;  3LSI A;  2GM4 A;  3GCM A;  1R6R A;  3PSF A;  1W0T A;  2GAU A;  1TL8 A;  3LNQ A;  2QGU A;  4HBL A;  4DNC A;  3DXJ F;  4WXD A;  3KET A;  3CC7 I;  2D45 A;  2VPL A;  1DQU A;  3ABL H;  3C2B A;  3HDD A;  3JSO A;  4Y4R A;  2HFH A;  2ID3 A;  4CH7 A;  1WHU A;  1WWX A;  2EFN A;  3LQQ A;  3V7S A;  1VQ9 I;  4BAY A;  4IJA A;  2QKL B;  1G59 A;  2X85 A;  5ICG A;  4BBS J;  1SD6 A;  3MZ8 A;  2BY1 A;  1Y39 A;  1D8K A;  1KYZ A;  1H9G A;  1IG7 A;  1HF0 A;  1A31 A;  4OIO F;  1UG2 A;  3BG3 A;  2L4A A;  2K9N A;  4GRI A;  2HPM A;  4JOM A;  1N25 A;  1XTA A;  2O8X A;  4II2 A;  1N77 A;  2VT2 A;  3JRC A;  3JRD A;  2A07 F;  2DDA A;  2E71 A;  1HST A;  2L54 A;  2L7Z A;  2FMY A;  2DFI A;  1TW3 A;  1WRJ A;  5E1X A;  3OYI A;  2IPQ X;  3F8M A;  2X6Y A;  3A2K A;  1EF4 A;  1E3P A;  2A61 A;  5HLI A;  3CJT B;  3RIR A;  2Y75 A;  3K70 D;  1FYM A;  2DCE A;  3A01 A;  2LBF A;  4M3E A;  1FBS A;  3IP4 B;  2BGC A;  2K4B A;  1XDS A;  1DU6 A;  4MO7 A;  2FBH A;  1P4A A;  1FMV A;  4BHB A;  3C7J A;  1R4M B;  3NRV A;  3ZMT A;  4M3F A;  1IV6 A;  2M7A A;  3L09 A;  5ICF A;  4B09 A;  1W5T A;  4NB5 A;  1B72 A;  3DPT A;  2CUF A;  5D8L B;  1L3L A;  3S1Q J;  4PJM A;  4EM2 A;  2XDV A;  1IRF A;  2RQP A;  4A3D J;  2M4G A;  2I5U A;  2MW8 A;  4BY7 J;  4A3G J;  1HSJ A;  3UR3 C;  2CFO A;  5JVG F;  1JKR C;  3K4J A;  3N05 A;  4AC0 A;  2KDO A;  4JX5 A;  2G9W A;  1WH5 A;  3FXJ A;  3H5R A;  3ABU A;  3I59 A;  3PNT A;  2FD5 A;  1MJB A;  4J19 A;  1MMN A;  1T6S A;  2CFX A;  3RKX A;  2BE5 F;  5L3F A;  4A3M J;  2ME0 A;  2DI3 A;  1FY7 A;  5IOZ A;  2IGN A;  1YRN A;  4YIF A;  1APL C;  3L2R A;  4XIC A;  2KKO A;  5LRR A;  4BJ6 C;  2LK2 A;  5CVR A;  2DXI A;  2UV1 A;  2CUZ A;  3OYM A;  4OAZ A;  2DOF A;  3ISP A;  3HKZ N;  3BZ6 A;  3VYR B;  1AHD P;  3GO5 A;  4HAM A;  1TWF J;  1YS7 A;  4P55 A;  2W24 A;  4ASN A;  4KUM A;  1RC9 A;  2VQH A;  3CCJ I;  3KCC A;  2Z99 A;  2JWT A;  1O4X A;  2VOO A;  1FOW A;  1TQI A;  1ZGW A;  4AUX A;  2BY2 A;  2M9H A;  1HKT A;  3GX4 X;  4XSX F;  4C30 A;  4I09 A;  5FO5 A;  1LDD A;  3E6M A;  3LMM A;  3MKZ A;  2E1N A;  2QSF X;  3BG5 A;  1P4X A;  1R36 A;  3X2Q H;  2EQR A;  1XMK A;  1YS6 A;  2JSC A;  1VQM I;  2CQQ A;  3QAH A;  4I98 B;  4MEX F;  1R71 A;  3O3K A;  3FM5 A;  1BC7 C;  4ESF A;  4IQ4 A;  2KPM A;  3LSR A;  2PMZ A;  2XRO A;  4KNY A;  3TW6 A;  3PL8 A;  1QGP A;  4XNF A;  1B1B A;  1GT0 C;  3RPQ A;  2AXL A;  3JTG A;  2RN7 A;  4CGZ A;  2YU9 J;  4ON0 A;  3W6V A;  1G8X A;  3DEU A;  2JVH A;  1JI8 A;  2UXN A;  3GFL A;  1P2F A;  2O5R A;  5D6E A;  3OYG A;  1JKO C;  4Q5S F;  1JUP A;  3M1C A;  1R1V A;  1XSV A;  3KPH A;  2ZNY A;  3KE2 A;  4C3J J;  5GAH J;  2IGM A;  4RBO A;  4Q48 A;  5EF6 A;  2K3P A;  1OYI A;  1P9Q C;  3EYI A;  3IH2 A;  1W36 D;  3HYI A;  4L0Y B;  3BG6 A;  5CVJ A;  4A6E A;  4HF0 A;  5L3C A;  3FK7 A;  2Q8K A;  3CCU I;  2RV8 A;  3MEX A;  3CDI A;  1Z3X A;  2J5P A;  4B48 A;  5D6F A;  5BNG A;  1U2W A;  3CLQ A;  5CYV A;  3S16 J;  2K7L A;  2PBI A;  4MEY F;  3QQA A;  3NAR A;  4IL6 C;  2UUZ A;  2WBM A;  4L0Z B;  4JBA A;  1XPX A;  2K5C A;  1FOX A;  3OY9 A;  4FCY A;  4LMY A;  2COB A;  4MQV A;  2HKX A;  4I7H A;  1U9N A;  3O6B B;  4N4N B;  2KIM A;  3DPU A;  4UVB A;  3V8J A;  5LRS A;  1REP C;  2LR8 A;  1DPU A;  2WV1 A;  4FX0 A;  1Z7L A;  4CO8 A;  1F5T A;  4U0Y A;  3W3C A;  3TP3 A;  4BU2 A;  4IO9 F;  3T0Y A;  3K70 C;  3BY6 A;  2HEO A;  2M34 A;  2L3D A;  1DP3 A;  1BBY A;  3DKY A;  2DO7 A;  3BR6 A;  1NK2 P;  2VC0 A;  2W57 A;  1U8R A;  3L2Q A;  1TLH B;  3OYJ A;  1IDY A;  5FD5 A;  4NHJ A;  2RQQ A;  1Z05 A;  1BIB A;  1FZP B;  5C3E J;  2HDD A;  1LB2 A;  1BOB A;  1O3T A;  2KQR A;  3F23 A;  1WGX A;  4G7Z F;  2H8R A;  2YX4 A;  3AG1 H;  3IKV A;  2LF8 A;  1XG1 A;  3L2W A;  5F0H A;  3L7W A;  3SXY A;  2YPR A;  4D5F A;  4FTH A;  1G6N A;  4RB2 C;  3H1C A;  3QRF F;  5CLS A;  4ZYG A;  1T95 A;  1FTZ A;  1WJA A;  4O6J A;  1T0F C;  4PJ0 C;  5GPA A;  1TNT A;  2VBX A;  1BN5 A;  2A68 F;  4OIQ F;  1DGW Y;  5HOO A;  4LGW A;  2IXS A;  3VOD A;  2HOE A;  1Q1H A;  2HS5 A;  5JLX A;  1VQL I;  2GLO A;  2LY9 A;  1Z77 A;  1LFU P;  3CCR I;  3EUH C;  2E5Z A;  1PP7 U;  3KP6 A;  4LJZ F;  4M6X A;  1VFC A;  2EFP A;  2GXB A;  2XPV A;  3CES A;  1V5G A;  3N4M A;  4UUS A;  3IRQ A;  3OYK A;  3A01 B;  2LBF B;  5H2F C;  2COM A;  3OIQ A;  4HG2 A;  4HOB A;  3H5N A;  2HQR A;  4G12 A;  4WK8 F;  1MSE C;  4N9H A;  4EJW A;  3GUD A;  2V1X A;  4XM3 A;  3RQ4 A;  3LSK A;  3HOY J;  4CCK A;  1ZG5 A;  1GHC A;  1U9O A;  1JT0 A;  5GP9 A;  3S2D J;  2JUG A;  1B72 B;  3B02 A;  2R7S A;  1BL0 A;  2EA2 A;  3QYF A;  3CCE I;  3GXO A;  2CUJ A;  1FEX A;  3O2P E;  1FOK A;  2XB5 A;  1PYV A;  1BR1 A;  4YRV A;  2E35 A;  3QPS A;  4A5N A;  3WTY C;  4HYE A;  1ZN2 A;  3I59 B;  3G3Z A;  3LA7 A;  2WY8 Q;  3Q9V A;  1R1T A;  3GYH X;  1YRN B;  5DM6 F;  3QPL A;  2XHK A;  2V79 A;  4CSW A;  5TJJ A;  5F6F A;  1TNS A;  2X0L A;  1T0F A;  2KJC A;  2XAH A;  4BEH A;  3TMO A;  4YEL A;  2VE8 A;  5KHD A;  3GWZ A;  1FJL A;  5J4V A;  1EH8 A;  2DPD A;  5JLW A;  4F3Q A;  4BQA A;  3CMM A;  3QOD A;  2ISZ A;  2H6B A;  3V7R A;  5ILV A;  2K85 A;  2VT3 A;  1ZGJ A;  2ESN A;  4LB6 B;  4DGW B;  5LEJ A;  3HL2 A;  2EV6 A;  3EUH A;  4GO1 A;  2K40 A;  2L9N A;  4FQG A;  2XV4 S;  4DYQ A;  1T39 A;  2MAB A;  2M5W A;  3VYT B;  5HS7 A;  1RUN A;  1D5V A;  3DU5 A;  1OMI A;  1W36 C;  5CVI A;  5ERI A;  2XSD C;  3BR3 A;  5DUI A;  3OR2 C;  1FIA A;  3DBH B;  1UMQ A;  2V7F A;  3K4K A;  5J1U A;  4XRM A;  1TP4 A;  2M2E A;  5HOD A;  5C44 J;  3GFI A;  4M3D A;  1I27 A;  1FYK A;  2XC7 A;  4L9T A;  4QPO A;  4IHY A;  1D3Y A;  4HSR A;  1SVL A;  4B8X A;  3BZC A;  2R7F A;  5LHH A;  3CP2 A;  2QM3 A;  2PMZ N;  1KYW A;  3LOC A;  1FBQ A;  2R7T A;  2MYS A;  4HX4 A;  1X1D A;  2VBY A;  1WJB A;  3OIP A;  1SAU A;  3S32 A;  2HYF A;  1SVM A;  1GXQ A;  3JRA A;  3S1N J;  2DA2 A;  4C3I J;  4RB0 A;  2PLY A;  4XON A;  2KIS A;  4DQ2 A;  1RIO H;  2GOX B;  5JR3 A;  4HEA 2;  4LLG F;  1CF7 A;  1SMY F;  2OCC H;  3FXK A;  5F1R A;  4KIB A;  4S04 A;  2F4M B;  2WAD A;  1SD5 A;  1YW9 A;  4B3A A;  1IUY A;  2M45 A;  3U9G A;  1QZE A;  3HRT A;  1USS A;  2ZC2 A;  3A4C A;  3PO2 J;  2BVM A;  2R7U A;  2FML A;  1FX7 A;  1VF9 A;  4I6Z A;  3LFK A;  4EVI A;  4ZYE A;  1U3E M;  2P8T A;  2X1C A;  3KFW X;  3OS1 A;  2W84 A;  3CO6 C;  2VJ4 A;  2DJI A;  2R4G A;  3WU1 B;  2ZBK A;  1XDU A;  3B6C A;  3T1B A;  1ZG3 A;  3ZQ7 A;  1R22 A;  1JKQ C;  3M8J A;  1FP2 A;  2XAF A;  4XKC A;  3SFZ A;  1PUF A;  1FSE A;  1Z7U A;  4LOC A;  2ZFU A;  1ZTR A;  3H92 A;  3HTS B;  2HVS A;  2G7U A;  2X1D A;  4JX4 A;  4LG3 A;  4XKB A;  3RYP A;  1OCC H;  1KZH A;  2V1N A;  2EZI A;  4IQJ A;  2QA4 I;  1ETQ A;  2DOA A;  4QIW N;  4A0Y A;  4HW0 A;  5H6R A;  4D5C A;  2DOE A;  5L3E A;  2R5Y A;  4DW6 A;  2D5V A;  2P5L C;  2NOG A;  1D1A A;  5F64 A;  2QWW A;  3DEE A;  3HEF A;  5J1Y A;  2DTZ A;  3VYS B;  2L2O A;  1IJW C;  1MBK A;  1YG2 A;  2VB6 A;  4F92 B;  1B9M A;  4L5J A;  1ZRD A;  2IS6 A;  2CRG A;  1E3O C;  4HNV A;  1Q1V A;  4GCV A;  1BW5 A;  2P6T A;  2JPC A;  4AIK A;  1QPI A;  2HYJ A;  4WCG A;  2NVX J;  3QYE A;  2OZU A;  1TWC J;  3BQY A;  4AIJ A;  2ISY A;  1Z6R A;  1XC5 A;  4RDU A;  1LDK B;  3H0G J;  1V55 H;  2XAJ A;  3QPH A;  3ZQH A;  1ZQ3 P;  4KFC A;  5EJC A;  2VI6 A;  2DPU A;  1X1C A;  2EH3 A;  2VOP A;  1MND A;  4CCO A;  1K61 A;  3HSR A;  1OCO H;  2E2H J;  2CV0 A;  2XSJ C;  1MIJ A;  3WE3 A;  3VB2 A;  4GYI A;  3LFU A;  4OOI A;  2LFB A;  5IT9 K;  1T56 A;  1FC3 A;  2V9P A;  4KJZ A;  4RAG A;  3BPX A;  2DA3 A;  4MLO A;  2F6C A;  1IF1 A;  2P7C B;  4LLL A;  2FNP A;  3BG7 A;  2NYX A;  2HZT A;  1ETV A;  2E60 A;  5IYB J;  5HVQ C;  4GXO A;  4L18 B;  1MBF A;  2KLO A;  4I0B A;  2DMQ A;  4UUS B;  1MMG A;  3OWT A;  4E7K A;  2LMD A;  5JI6 A;  4FX4 A;  4EJU A;  1JKP C;  3CCV I;  1ZYR F;  2RGV A;  4HV5 A;  3PIO F;  3WTV C;  2DA4 A;  2RAE A;  3DKX A;  3ZMD A;  2ACJ A;  3PO3 J;  3K6G A;  3PSI A;  1ETK A;  2A6T A;  2OU2 A;  3H36 A;  1OCR H;  4EM1 A;  4KDP A;  1Y8R B;  3R60 A;  3CME I;  4N0B A;  5E8I A;  5J3L A;  4S05 A;  3E5Q A;  3ZQL A;  3TO7 A;  3F3X A;  5E3M A;  2VJJ A;  4M72 A;  5IP7 J;  2CGP A;  1ACI A;  3MKL A;  5M3M J;  5JFR A;  3K4B A;  3D5S C;  4EAT A;  2ZJP F;  2WAE A;  4Q4Z F;  4IRG A;  3TQN A;  3T8R A;  1A35 A;  2Y9Z A;  2A6E F;  5FFZ A;  1IAW A;  2BXY A;  1MMS A;  3N97 A;  5J47 A;  2EIM H;  3Q9S A;  1UHS A;  4BEH B;  4CDG A;  1VQO I;  4WXC A;  2XVC A;  4XOP A;  1LFP A;  1KU7 A;  4YEJ A;  5IT3 A;  1IUF A;  1G3W A;  2NVU B;  1FTT A;  1VQP I;  1SFO J;  3DWL E;  3O8G A;  4I02 A;  3BRO A;  4Y52 J;  1YIJ I;  5KVR A;  2CO5 A;  4LK1 F;  1P92 A;  3LAJ A;  1IN6 A;  3EUA A;  1R58 A;  2ZJR F;  4BGD A;  3M9A A;  3JRF A;  3MZY A;  2ZJQ F;  3FMR A;  4DZP A;  2E7W A;  4M9S A;  1J5Y A;  3DEW A;  3G1O A;  2EFW A;  2LDU A;  4QTR A;  4A3E J;  3JAM K;  3JRH A;  3J7Z I;  1W5S A;  1AWC A;  3H9G A;  1A6Q A;  3RZO J;  5IT9 Z;  2YS9 A;  1TT0 A;  3KYL A;  2V1D A;  5DTD A;  1SAX A;  1E2X A;  4LK0 F;  1LQ1 A;  4D0P A;  3S3N A;  1KU9 A;  2XGE A;  3HB9 A;  5DM7 F;  3F6O A;  1CQT A;  3FBN B;  3JSP A;  4G7H F;  4M74 A;  5E8G A;  5ICE A;  3FXM A;  2RRE A;  4G6T B;  4A12 A;  5JVT A;  3D0S A;  1QNT A;  4PGG A;  3R0J A;  4N9I A;  1IN7 A;  1CF7 B;  2B63 J;  4EM0 B;  1VND A;  4RMN A;  1KQ0 A;  4PFO A;  1LEB A;  2E19 A;  3ZMZ A;  3R0A A;  4C3H J;  4I0A A;  4FAS D;  3JRI A;  1QPM A;  4XRF A;  2HQN A;  4XOT A;  1IN4 A;  1UCR A;  2FJ1 A;  4RLF A;  3OOP A;  1FP1 D;  2RNJ A;  1EKE A;  3H3V K;  2DFE A;  2L9S A;  4HQE A;  3Q5F A;  1ETW A;  1ON2 A;  2KRC A;  1T2K A;  2CWE A;  5A2Q Z;  2MD0 A;  2X6X A;  1SAN A;  1X1B A;  1E17 A;  2I8D A;  1LEA A;  2DA5 A;  1NG7 A;  1A04 A;  2OF7 A;  4XKV A;  1PUF B;  3VFZ A;  3CQZ J;  4E70 A;  5K5R A;  3HHH A;  5HNF A;  4RAZ A;  3H35 A;  2BBY A;  5IYD J;  1FYL A;  4FT8 A;  2BEO A;  4PJN A;  1GV2 A;  1ZRE A;  2VN2 A;  2V4J C;  1WSU A;  2OA4 A;  2R5Y B;  5E18 F;  4B3X A;  5F04 A;  4CUG A;  4JQF A;  3ZQG A;  4EJO A;  4XRS A;  3JRB A;  3M3Y J;  3NWS A;  4Y15 A;  2VLA A;  2H1L A;  1YJ9 I;  1MMD A;  3ZMS A;  4KN4 X;  2KIF A;  1YIO A;  1LJ9 A;  1UJ8 A;  3DV8 A;  4LG0 A;  6PAX A;  3S3O A;  3BCB A;  2RNG A;  3BR0 A;  3A0H C;  3JAM Z;  4BXF A;  2Y69 H;  2JVG A;  3OMY A;  4LIU A;  4RGS A;  3G1M A;  1I6X A;  3SDG A;  2FSW A;  4PUS A;  3PQJ A;  1WZ2 A;  2IVM A;  4ZH4 F;  4L9J A;  3HIF A;  3SEZ A;  2DA7 A;  4EGY A;  1WJD A;  1V5E A;  2MG4 A;  2HGC A;  3C3W A;  2CW8 A;  3G71 I;  3OYC A;  3S1R J;  2FNA A;  1YLF A;  2F2E A;  2ZXJ A;  1TTY A;  1QU3 A;  2IRF G;  4AID A;  2WAQ A;  1U6G A;  4DBQ A;  4Y3O A;  2Z2S B;  2XPU A;  1IZ1 A;  2CW0 F;  3JW4 A;  4HF1 A;  3TOA A;  4LD5 A;  3WTS C;  3GF2 A;  1QVT A;  3GTJ J;  2QSH X;  1I39 A;  2IA0 A;  4A3K J;  3CMY A;  5KAI C;  4HLY A;  2CQN A;  2HQA A;  3PUF A;  3FHZ A;  4EMS A;  3GW2 A;  4CXF A;  2FOW A;  2JTV A;  1T8I A;  4IHX A;  1YX5 A;  1WVR A;  5E1Z B;  1X3W B;  1LE8 A;  3J7A Y;  4GFB A;  5F0F A;  1Y56 A;  4E7L A;  1DGR M;  1AOY A;  3BR2 A;  4HA8 A;  2MC4 A;  2L5Q A;  3IWF A;  3CTA A;  1O57 A;  3HRM A;  3SZP A;  2V6C A;  1T38 A;  1A5J A;  1H8A C;  3IKT A;  1BA5 A;  5J1R A;  1NTC A;  2KP6 A;  3ZN0 A;  1YI2 I;  5LGN A;  4Z6Y A;  2OQR A;  4J01 A;  4EQQ A;  4C9Y A;  1K7A A;  4YFK F;  1ZEL A;  2GWR A;  2QQA A;  2FBK A;  1B59 A;  4HST A;  3FXR A;  2DFH A;  5FB2 A;  1P4W A;  1YYV A;  2DAO A;  2ZB9 A;  2JA5 J;  1BI3 A;  1X3Z B;  1VQ5 I;  2E2I J;  1W4M A;  2L7M P;  1GVD A;  4BJT A;  4WX9 A;  2BY0 A;  2R7O A;  1R5H A;  4BBR J;  3RI4 A;  3I56 I;  4IEJ A;  1A36 A;  2IT0 A;  3EPZ A;  3I4P A;  5IPA A;  5HS8 A;  4QLC U;  3W2A A;  3DU6 A;  4W1U A;  3B73 A;  3J7A O;  3IAM 2;  2G7H A;  2VC1 A;  1MH3 A;  3ULQ B;  4BNC A;  3WTW C;  1JUS A;  1UHW A;  2LP0 A;  3TKY A;  4ZTF A;  2R93 J;  3GTG J;  2RKH A;  1K4S A;  5ILU A;  1K78 A;  3HPG A;  4BS9 A;  3WTX C;  1U78 A;  2VQL A;  1MZB A;  4X6A J;  1OYY A;  2WA0 A;  4E7Z A;  3ZQQ A;  2AS5 F;  1ORK A;  1Z1D A;  2ZME C;  3I9V 2;  1ZLJ A;  3HC7 A;  4IPA A;  1ETX A;  3OV8 A;  4UV8 A;  2K3F A;  3ZQI A;  3FM3 A;  4LIT A;  1EH7 A;  4OIN F;  5D5U B;  1MGT A;  3KLN A;  2PJR A;  1X4P A;  2NOJ B;  1HDP A;  2W4S A;  2O8K A;  2Y48 A;  1ZAR A;  2EBI A;  2XAG A;  1TZL A;  3BWG A;  3PM1 A;  4F7Z A;  5HDG A;  5IYC J;  3MMY B;  3V8K A;  1IW7 F;  2EIL H;  2H6C A;  3KYC B;  3OYA A;  4MFD A;  2TCT A;  4G6Q A;  2IGO A;  3ZOB A;  5TIS C;  4OU0 A;  2R92 J;  4KT5 C;  1XSD A;  2LNB A;  3RZD J;  2DMP A;  4NBQ A;  5GAG J;  2XAU A;  1X19 A;  1S8N A;  4OWR B;  1T33 A;  4XQF A;  4A3B J;  5B1A H;  2IW5 A;  3ELK A;  2KRH A;  4XR6 A;  2GIV A;  2WY7 Q;  3BOQ A;  1P6R A;  1IN5 A;  2DQR A;  4AU7 A;  1G3T A;  4RAY A;  2VE9 A;  3SHF A;  3OSG A;  4M3B A;  3NWT A;  3TBI A;  2W85 A;  3MN2 A;  4WXH A;  4E7H A;  1EJ9 A;  4A3L J;  3QPT A;  3J81 K;  2JJ7 A;  4RS8 A;  4A0Z A;  1T08 B;  2ZME A;  1S9H A;  4IRI A;  3PNV A;  2GA1 A;  1RRJ A;  4GDF A;  2DN0 A;  3U2R A;  4U7B A;  5FRN A;  2IEK A;  3DQV C;  2HOT A;  3IHU A;  1H9T A;  1IRZ A;  2R7R A;  1Z6T A;  2LH9 A;  2F5E A;  3K1P A;  3E3V A;  4AYB A;  1VQ8 I;  2X51 A;  4WWC A;  2Q2E A;  1NHA A;  2DOD A;  4L9N A;  3G4S I;  1KU2 A;  2ID6 A;  3QWL A;  5L3B A;  4XL9 A;  2JZY A;  3CUO A;  1IXS B;  2NNY A;  3K2A A;  3AAF A;  2K02 A;  1X4O A;  2EWN A;  3DPL C;  5F1J A;  1PDN C;  2QBY A;  5BPI A;  1HOM A;  1LNW A;  2OUM A;  2R3S A;  3A1Y A;  3E5X A;  2CQ7 A;  3IV5 A;  5FLX K;  1SVO A;  3RPU A;  3DTI A;  2XKP A;  3DLA A;  2P7V B;  2QYO A;  3MKY B;  3I0T A;  3ASO H;  4G9Y A;  5DD4 A;  1EH6 A;  1JHF A;  1SMT A;  1ONV A;  1HW2 A;  1OYW A;  3G1L A;  2JRM A;  1K79 A;  2GXG A;  4P1W A;  3GTL J;  5BS6 A;  4BE1 A;  2WAQ N;  3SYT A;  1Z91 A;  3ECO A;  1GV5 A;  2E7X A;  2XF5 A;  3C1D A;  1I50 J;  5ILS A;  3TO9 A;  2PFB A;  3ZQF A;  4JP0 A;  5FKL A;  4AVZ A;  2CV2 A;  2K9Q A;  4V2G A;  2HWV A;  5B66 C;  1M1E B;  1TWA J;  3FF5 A;  3I55 I;  1S29 A;  4R1H A;  4IHV A;  1OCP A;  1V5F A;  4XLC A;  3CO7 C;  3V8L A;  2HNH A;  2X4H A;  1OIS A;  1SC7 A;  3CJQ B;  2VKD A;  3OYL A;  4A3I J;  1LE8 B;  3OYH A;  2MGQ A;  3P9I A;  1DUX C;  2DMN A;  2GOM A;  2JA2 A;  5CPR B;  3NAU A;  3M8E A;  4RLQ A;  1J09 A;  1MSF C;  2Z9O A;  2KDZ A;  4ENN A;  2HR3 A;  3J81 Z;  1XB4 A;  1Y6I A;  1WPK A;  4U87 A;  1VQ4 I;  2XGC A;  2DMU A;  1RPW A;  3EET A;  5BQT A;  3F8C A;  2QLZ A;  1QVU A;  1JGG A;  3BJA A;  3W6K B;  3VPR A;  4NQW A;  3FDY A;  4D7N A;  4PCQ A;  1QQI A;  1HW5 A;  1JJ6 C;  3FBI B;  4NC6 A;  3HHG A;  3TW7 A;  2RDP A;  2NVY J;  4IX7 A;  2CG4 A;  3GME A;  2DYS H;  4BE2 A;  1DU0 A;  3M7G A;  4A6D A;  1W5C C;  4OIP F;  2A5Y B;  4I76 A;  2DFF A;  3OSF A;  2X48 A;  1FT9 A;  4ZYD A;  2VKE A;  4MQ9 F;  1QBJ A;  4UUV A;  5FRO A;  4KIS A;  2LF7 A;  3K9T A;  2NVT J;  1FMW A;  2YR2 A;  5FKN A;  1U5T C;  2W48 A;  1Z67 A;  3BCA A;  4B4C A;  1LPQ A;  2OTL I;  2HZD A;  2PQ8 A;  1RNL A;  3ECH A;  3I5U A;  5F08 A;  5LLQ A;  1K78 B;  5K7H A;  3OR1 C;  4XLE A;  5L3D A;  2NNN A;  5FLX Z;  4ZC3 A;  1WJF A;  3KEQ A;  4OIR F;  5GPC A;  1Y0U A;  2VBZ A;  3ML6 A;  2F5C A;  4EEF G;  3FMQ A;  4O5V A;  2XRL A;  4A5M A;  1C0W A;  1YJN I;  1HDD C;  2ZCW A;  5EG0 A;  1NH3 A;  1GXP A;  2K4J A;  5CJ9 A;  4IF4 A;  3FKI J;  2PJR B;  2L01 A;  1F1Z A;  4QPQ A;  2CUE A;  2VPR A;  1S7O A;  2EJR A;  2PEX A;  3E6B A;  1I1G A;  2D1H A;  3K7A J;  3S14 J;  2XGD A;  2AHQ A;  2ZJ2 A;  2QF7 A;  4Y13 A;  3C2G A;  3ESW B;  1TWH J;  1BW6 A;  4UNO A;  2M8E A;  2IGK A;  1LFB A;  3K2Z A;  1IO2 A;  1POG A;  4M73 A;  3DFG A;  1WJC A;  5BPD A;  1SEU A;  1HW1 A;  3MQ0 A;  5EEA A;  1R4N B;  4DYR A;  4F91 B;  1J7K A;  4TV7 A;  2J5O A;  3CC4 I;  4I2O A;  2IA1 A;  2DT6 A;  3ZQC A;  1GDT A;  2ESH A;  2X1E A;  3LA2 A;  1MBJ A;  5K1Y A;  2P5K A;  1SFE A;  2JA8 J;  3FXO A;  3GTQ J;  3EUK L;  3UKG A;  3HGY A;  1U5T A;  2HXI A;  3MWM A;  2FRH A;  1D0Z A;  3I54 A;  3U1K A;  2A69 F;  2BW3 A;  1UEL B;  1XCV A;  3IAS 2;  3RKQ A;  4M3G A;  3WHB A;  1B8I A;  2JMW A;  2ELJ A;  4XK4 A;  5AON A;  4KIT B;  5E17 F;  3MCZ A;  2ZME B;  5FKO A;  5IP9 J;  2MFZ A;  3BTC A;  3LQR A;  5J8C A;  2V26 A;  1WJE A;  1R5G A;  5HDK A;  2EIK H;  2O3F A;  1S72 I;  2ZXW H;  3A0B C;  3QU6 A;  2Z3Y A;  4AYB N;  5E3N A;  3IH4 A;  3KIO A;  4U0V A;  2Q2E B;  2NRA C;  4A3F J;  4LLN A;  4AIH A;  4RM2 A;  2FF4 A;  4M6V A;  3WOD F;  3JRE A;  2QQB A;  2DA6 A;  3TGN A;  2V9K A;  3JCU C;  1BI2 A;  3K0L A;  1MJ9 A;  3SEQ A;  3PFY A;  4NNJ A;  4PFP A;  3JR9 A;  1VQ7 I;  3C18 A;  5FLM J;  2QBY B;  4V19 K;  4FHT A;  4PZJ A;  2CW7 A;  1Z9C A;  1S7E A;  1K6Y A;  2VUM J;  4O3M A;  3HOT A;  2MLK A;  1RR7 A;  2MD5 A;  2V9V A;  4NDL A;  1BJA A;  4XN0 A;  1QHG A;  2Y0S N;  4FIS A;  3FMS A;  3PIP F;  2KL4 A;  1Z21 A;  2L9V A;  3QOP A;  3H9Q A;  4KA4 A;  1O7F A;  3F22 A;  1SFX A;  2CSO A;  2O9L A;  4K2E A;  1UHM A;  2X6W A;  2NS0 A;  4XOR A;  4LFU A;  4HRI A;  1JT6 A;  3I53 A;  2JA7 J;  1X1P A;  4CCM A;  1RUO A;  2R7X A;  3ABK H;  3ASN H;  1E3H A;  3H0D A;  1UZC A;  4RA2 A;  3IC7 A;  4BAC A;  5J4Y A;  1BM9 A;  2ZNZ A;  1XD7 A;  2VL8 A;  2EK5 A;  4P9F A;  3HSE A;  3DCF A;  2FQ4 A;  4E7S A;  4P96 A;  5EEH A;  4ZYH A;  4DBR A;  4E7I A;  2OJE D;  4R8H A;  4B47 A;  3WGH A;  4IOA F;  5A2Q K;  3KZZ A;  2JSP A;  2VBW A;  2GZW A;  1R1U A;  1OR7 C;  4HZF A;  2D2W A;  3GEZ A;  2HXO A;  4MNU A;  4RM3 A;  4ENM A;  1VQ6 I;  1MBH A;  1FWZ A;  4BHP A;  2M7B A;  2QKM B;  3RTR A;  5HNH A;  4UB8 C;  4KT6 A;  3MFK A;  1U0J A;  4M71 A;  2HDW A;  3DLL F;  5LD2 C;  2NXN B;  1YHQ I;  4F55 A;  5KK1 A;  3WTT C;  2L0K A;  1JHH A;  5DCM A;  1XS9 A;  4II3 A;  1UAA A;  3FIS A;  1D0Y A;  2BV6 A;  2AQF A;  4HDV A;  3FKJ A;  3M4O J;  3OYN A;  3H3Z A;  5D4S A;  3OIO A;  1V3F A;  3R61 A;  2HU9 A;  4FE4 A;  1I6H J;  2RVC A;  1ZLK A;  2K9S A;  2EZL A;  3ABT A;  1QHH D;  2F5V A;  2O03 A;  1HKS A;  3VOE A;  4IHW A;  4DJA A;  3BG9 A;  3B6A A;  3LSJ A;  1JXS A;  4JX6 A;  4XLN F;  3JTH A;  4M9Z A;  4D9J A;  2CQX A;  2M1B A;  3HJE A;  2A3S A;  1KQ9 A;  5H6Q A;  5KNL A;  3CC2 I;  4BUP A;  2H94 A;  4BKX A;  2VQC A;  4E4H A;  2ZKZ A;  4AM3 A;  4HX7 A;  3C2H A;  3QOE A;  4H0E A;  1OCT C;  2FOK A;  1OR7 A;  3FXQ A;  2LRE A;  2HQ5 A;  1ZH5 A;  5K7F A;  4G8X A;  2DQL A;  2CS3 A;  4QSH A;  1YO5 C;  1H89 C;  2PI0 A;  1N78 A;  4KMF A;  1SFK A;  3LSH A;  2R7Q A;  1MDM A;  3V42 A;  3KP7 A;  5GTH C;  1S6L A;  5IY5 H;  1XX5 A;  3AG3 H;  2KMU A;  3F0C A;  3LSG A;  3ERE D;  4BHC A;  4HQM A;  4KIF A;  3V7C A;  1S5L C;  4A2U A;  2VOD A;  3CJN A;  4EJV A;  5K5O A;  1XMX A;  2DT7 B;  2A5W A;  1H0M A;  1IGN A;  1R5I D;  5TGT A;  3GVA A;  2BXZ A;  3MKW B;  2G0E A;  1RZ4 A;  2QCO A;  2WWY A;  4XKW A;  2FU4 A;  2DA1 A;  5M5W J;  1FOY A;  4Y33 A;  5AIP A;  1HA8 A;  5B5E C;  1Z3Y A;  5DS9 A;  1MKM A;  3AKZ A;  2H8W A;  2Y0M A;  2ZO4 A;  4ETS A;  2Y31 A;  3K4C A;  1U5T B;  5JHU A;  2WC2 A;  2GQQ A;  2EFO A;  2VIX A;  1DDN A;  5FKM A;  2BW3 B;  2DU9 A;  4NC7 A;  1XCB A;  4ZDP A;  2M30 A;  3OS0 A;  4IZZ A;  1B8I B;  3DTE A;  1NK3 P;  2ETH A;  5E3L A;  3D5R C;  5AIQ A;  1YW8 A;  5DEQ A;  3REO A;  2KJB A;  2W25 A;  4ENK A;  3L9F A;  1TBX A;  4RAF A;  3WGI A;  5KCM A;  4IVN A;  3RPU D;  3S93 A;  3WU2 C;  4XLF A;  5GTI C;  3RKW A;  1ZRC A;  2DK8 A;  2VQG A;  2JK3 A;  3HZJ A;  4KMU X;  1G4D A;  2DYR H;  3CUQ C;  3L2U A;  2LY2 A;  3F8B A;  2LLK A;  3FZV A;  2PN6 A;  3EQL F;  2ADU A;  1GVJ A;  1AKH A;  5CQE A;  4G7O F;  5IP6 A;  4YG2 F;  3PQK A;  3IL2 A;  2JA6 J;  3H9J A;  2R7V A;  3HOX J;  4GYG A;  3RJP A;  3J80 K;  2LKS A;  1S7A A;  1CGP A;  4IKF A;  3KP3 A;  1G2H A;  1I1S A;  1F36 A;  2MC3 A;  4HLX A;  2VXD A;  3PUB A;  3E6D A;  2HTJ A;  4RB1 A;  2DBB A;  3HRS A;  1R49 A;  4MTD A;  3CCS I;  3E7L A;  3I71 A;  2A05 A;  2F5D A;  3K4L A;  4A3C J;  2MBF A;  3CMA I;  4FE7 A;  4EGZ A;  4PDK A;  4OAY A;  5FJ8 J;  2YX7 A;  1IV8 A;  1PVE A;  1D1B A;  4MGR A;  2WTE A;  2MSY A;  3D5L A;  3MZH A;  1MBE A;  3U21 A;  3AFH A;  5DD8 A;  3TO6 A;  1YJW I;  3I64 A;  1X2M A;  2BVL A;  1XGN A;  2AXT C;  1HCR A;  1U8B A;  1I3Q J;  4LIV A;  3DBR B;  4XLA A;  2KZG A;  1VQN I;  2IS2 A;  2R5Z A;  1F4K A;  3HM5 A;  4B43 A;  2OTJ I;  3IUO A;  1P7I A;  4A69 C;  3GFM A;  4XSZ F;  2ZFW A;  3IWZ A;  3AG4 H;  4UVA A;  3CUQ A;  1G3S A;  3IRR A;  5GAD J;  3TDU C;  3RCO A;  2E5N A;  3A03 A;  4AD9 A;  5LFA A;  3QP5 A;  2DTR A;  3CCM I;  4N4O B;  1K83 J;  3HRU A;  2FQ3 A;  5HLG A;  3I4M J;  3H3U A;  1ZGA A;  4EJT A;  3BR5 A;  1X58 A;  2BYV E;  4XRS G;  3KZY A;  5FD6 A;  1YTY A;  1FPQ A;  2QEX I;  4IRH A;  2W7N A;  1X3U A;  1RR8 C;  2Z16 A;  3LWF A;  1K4T A;  5FLV A;  4IHT A;  5L3G A;  3WTU C;  1MH4 A;  2CMP A;  4HPQ A;  4CYD A;  4ESB A;  2HYG D;  2JPB A;  2LYC A;  2D1V A;  1LDJ A;  1ULY A;  2EA4 A;  2BY3 A;  5DCM B;  4XLP F;  5HLH A;  1TW2 A;  1W7P A;  3CDL A;  4UHT A;  1BOA A;  5C4X J;  1OFC X;  3CCQ I;  1ERD A;  2BOL A;  4DOZ A;  5D4R A;  2R7W A;  2LG4 A;  3DKW A;  3FX3 A;  3SZG A;  3O8H A;  3HOS A;  2VAS A;  4ITV A;  4YFN F;  2H27 A;  3KP2 A;  1IXC A;  1V4R A;  3J80 Z;  1F43 A;  2DLL A;  2XAS A;  1KU3 A; 
#chains in the Genus database with same CATH homology
 1BI0 A;  1R23 A;  1STZ A;  4ZZL A;  4P5O A;  5D5W B;  2LSO A;  1LVA A;  3V4G A;  1KA8 A;  3L00 A;  3HUG A;  4M6Y A;  1R00 A;  2HDC A;  4JK1 X;  2OBP A;  1XGO A;  2KRF A;  3RKY A;  4L5I A;  1MDM B;  3F21 A;  4BYY A;  4G94 A;  4UVC A;  1B9N A;  5DUK A;  1PP8 F;  5E20 A;  1TQM A;  3K1M A;  3RYR A;  4IXA A;  3EDP A;  5K5Q A;  2HTS A;  1L0O C;  3ZPL A;  2F5F A;  4CZZ A;  4XBF A;  2PMU A;  1HKQ A;  1DPR A;  2M87 A;  1J59 A;  4Q47 A;  4UV9 A;  2EV0 A;  1ZRF A;  2EFQ A;  3CDH A;  3K69 A;  3QP6 A;  3F8N A;  2XGX A;  3U1D A;  1S3J A;  3F8F A;  3BJO A;  4HV6 A;  2YSR A;  4LG0 B;  3RDI A;  4HX8 A;  1OKR A;  5DDG A;  1KQ8 A;  3KLO A;  3WTZ A;  1WQ2 A;  1IXR C;  4WF2 A;  4I01 A;  1KGS A;  1DP7 P;  1IN8 A;  2CYY A;  2GA2 A;  2PJP A;  2OD5 A;  2Z33 A;  1B4A A;  3NEU A;  5FFX A;  4Z2Y A;  3W6J B;  2C6Y A;  2MH9 A;  3EYY A;  5BMZ A;  2ELH A;  5D8K B;  3T8T A;  3COA C;  2Q0O A;  4RGR A;  2UXX A;  2QUF A;  1QZY A;  1I5Z A;  1UB9 A;  2FXA A;  2RC4 A;  1D8J A;  5LBQ A;  4HF2 A;  1BIA A;  3LA3 A;  3WE2 A;  4KIC A;  4LB5 A;  3BPV A;  1YFH A;  2PG4 A;  3E6C C;  3GFJ A;  3CUQ B;  4UXN A;  1MJA A;  4RGU A;  4CIC A;  5BOX A;  2DT5 A;  4G6D A;  1O7L A;  3VEP A;  2FA5 A;  2IJL A;  4OMZ A;  3WG9 A;  2WV0 A;  4KN7 X;  2QQ9 A;  1O3S A;  5D5X B;  1K6O A;  4KIG A;  1F9N A;  1FBU A;  2L02 A;  2QEN A;  2R7D A;  4RB3 C;  4AWX B;  1ZAO A;  3DP7 A;  1W7P B;  2STW A;  3ROU A;  1HXD A;  1FNN A;  2MH2 A;  2IP2 A;  5LGU A;  1RI7 A;  2DK5 A;  3KP5 A;  4PGH A;  5HS9 A;  3SZT A;  3FWE A;  4OMY A;  4M9X A;  1FLI A;  3E97 A;  4KYW A;  5DYM A;  4HDU A;  2FBI A;  1WI9 A;  2O6G E;  4ENJ A;  1BI1 A;  1J9I A;  5LEK A;  4GGG A;  5DV5 A;  2P4W A;  4IHS A;  2TDX A;  2NAZ A;  4BXU A;  1B6A A;  2VON A;  2K86 A;  2PMH A;  2XAQ A;  2L4M A;  3LAP A;  3E5U A;  4L9V A;  1UFM A;  3QU3 A;  2FE3 A;  5CVU A;  5E1W A;  3HSF A;  1HQC A;  1J75 A;  2UWM A;  2JT1 A;  3BJ6 A;  1IRG A;  3CLO A;  3M1E A;  2QZ8 A;  1QZZ A;  3R6S A;  5J6X A;  2STT A;  5H20 A;  2MLG A;  3HTU A;  5LHG A;  2IA2 A;  1SD7 A;  1TQP A;  3SQN A;  3M8F A;  4P9U A;  3ZN1 A;  2QVO A;  5LGT A;  1PUE E;  3MAJ A;  1HBX G;  2VXZ A;  4ESJ A;  5TRD A;  2H09 A;  4MTE A;  2A6H F;  2MA3 A;  1BC8 C;  2P5V A;  2XUB A;  4AVP A;  2CQK A;  3GZ6 A;  1XMA A;  4MHG A;  2Z5U A;  5FGM A;  1YQA A;  3R4K A;  5D5V B;  3BP8 A;  2EB7 A;  3KEO A;  1JGS A;  1ZHF A;  3ZP5 A;  5CVV A;  2OAZ A;  3ZMV A;  1UST A;  4RGX A;  2V1U A;  2YU3 A;  3FXU A;  2OZ6 A;  2O0Y A;  1SD4 A;  3GLX A;  4ZZD A;  2FEZ A;  1G3Y A;  4U0W A;  2XRN A;  3K1N A;  4BH9 A;  1O3Q A;  4CHU A;  2HKO A;  1VTN C;  3WU0 A;  3F6V A;  1W7P D;  4QWQ A;  1J0R A;  1OPC A;  3DF8 A;  3ZMU A;  2XKO A;  2JRT A;  1JE8 A;  1MD0 A;  5HDN A;  5EEG A;  1SFU A;  1FSH A;  1J2X A;  2DW4 A;  3P7N A;  4Y17 A;  2P6S A;  4YII A;  3S2W A;  3P9K A;  2E1C A;  1QO0 D;  3TOB A;  2O61 A;  2XIG A;  1XGS A;  5J8F A;  2K27 A;  5ED4 A;  3GZ5 A;  3T5X A;  3BDD A;  4A0X A;  2KIU A;  1XGM A;  4U88 A;  1O3R A;  4R79 A;  1ON1 A;  1EV7 A;  3NQO A;  4U7D A;  5LHI A;  2EV5 A;  2UZK A;  3P9C A;  1R7J A;  3TDZ C;  3PFI A;  1T98 A;  3G73 A;  1XN7 A;  2OQG A;  3LST A;  3I58 A;  5ICC A;  2B0L A;  1YW7 A;  3L2C A;  3WGG A;  1ZG1 A;  1ODD A;  2LKP A;  1XSX A;  3KP4 A;  4YFX F;  5DCF A;  1WKM A;  4EV0 A;  3F72 A;  2GAU A;  4HBL A;  4DNC A;  3DXJ F;  4WXD A;  3KET A;  2D45 A;  3JSO A;  2HFH A;  1WWX A;  2EFN A;  3LQQ A;  3V7S A;  4BAY A;  4IJA A;  5ICG A;  1SD6 A;  1D8K A;  1KYZ A;  1H9G A;  4OIO F;  2L4A A;  2O8X A;  2VT2 A;  2A07 F;  2L54 A;  1HST A;  2FMY A;  2DFI A;  1TW3 A;  1WRJ A;  5E1X A;  2IPQ X;  3F8M A;  2A61 A;  5HLI A;  3RIR A;  2Y75 A;  1FYM A;  1FBS A;  2BGC A;  2K4B A;  1XDS A;  2FBH A;  1P4A A;  4BHB A;  3C7J A;  3NRV A;  3ZMT A;  3L09 A;  5ICF A;  4B09 A;  1W5T A;  4NB5 A;  3DPT A;  1L3L A;  5D8L B;  4EM2 A;  1IRF A;  2RQP A;  1HSJ A;  2G9W A;  3ABU A;  3I59 A;  1MJB A;  1T6S A;  2CFX A;  3RKX A;  2BE5 F;  5L3F A;  2DI3 A;  1FY7 A;  4YIF A;  2KKO A;  5LRR A;  5CVR A;  3ISP A;  3BZ6 A;  3GO5 A;  4HAM A;  1YS7 A;  4P55 A;  2W24 A;  4ASN A;  4KUM A;  3KCC A;  2Z99 A;  2VOO A;  1TQI A;  1HKT A;  3GX4 X;  4XSX F;  4I09 A;  5FO5 A;  1LDD A;  3E6M A;  2E1N A;  1P4X A;  1R36 A;  1XMK A;  1YS6 A;  2JSC A;  3QAH A;  4MEX F;  4I98 B;  1BC7 C;  3O3K A;  3FM5 A;  4ESF A;  2XRO A;  4KNY A;  1QGP A;  1B1B A;  3RPQ A;  2AXL A;  3JTG A;  2RN7 A;  4CGZ A;  4ON0 A;  3DEU A;  2UXN A;  3GFL A;  1P2F A;  5D6E A;  4Q5S F;  1R1V A;  1XSV A;  2ZNY A;  3KE2 A;  4Q48 A;  1OYI A;  3EYI A;  3HYI A;  4L0Y B;  5CVJ A;  4A6E A;  4HF0 A;  5L3C A;  2Q8K A;  2RV8 A;  3MEX A;  2J5P A;  5D6F A;  1U2W A;  5CYV A;  2K7L A;  2PBI A;  4MEY F;  4L0Z B;  4JBA A;  4LMY A;  4MQV A;  2HKX A;  4I7H A;  3O6B B;  5LRS A;  2KIM A;  1REP C;  4UVB A;  3V8J A;  1DPU A;  4FX0 A;  4CO8 A;  1F5T A;  4U0Y A;  3T0Y A;  3BY6 A;  2HEO A;  2L3D A;  1BBY A;  2DO7 A;  2VC0 A;  2W57 A;  1U8R A;  1TLH B;  4NHJ A;  5FD5 A;  1Z05 A;  1BIB A;  1FZP B;  1LB2 A;  1O3T A;  3F23 A;  4G7Z F;  2YX4 A;  3IKV A;  2LF8 A;  3L7W A;  3SXY A;  2YPR A;  1G6N A;  4RB2 C;  3QRF F;  5CLS A;  4ZYG A;  4O6J A;  1TNT A;  2VBX A;  1BN5 A;  2A68 F;  4OIQ F;  5HOO A;  4LGW A;  3VOD A;  2HOE A;  1Q1H A;  2HS5 A;  1PP7 U;  3KP6 A;  4LJZ F;  4M6X A;  2EFP A;  2GXB A;  3N4M A;  3IRQ A;  2COM A;  4HOB A;  4WK8 F;  2HQR A;  4N9H A;  4EJW A;  3GUD A;  2V1X A;  1ZG5 A;  1GHC A;  3B02 A;  2EA2 A;  3GXO A;  3O2P E;  1FOK A;  4A5N A;  3WTY C;  4HYE A;  1ZN2 A;  3I59 B;  3G3Z A;  3LA7 A;  3Q9V A;  1R1T A;  3GYH X;  2XHK A;  2V79 A;  5TJJ A;  5F6F A;  1TNS A;  2X0L A;  1T0F A;  2KJC A;  2XAH A;  2VE8 A;  3GWZ A;  1EH8 A;  2DPD A;  4BQA A;  2ISZ A;  2H6B A;  3V7R A;  5ILV A;  2VT3 A;  1ZGJ A;  2ESN A;  4LB6 B;  5LEJ A;  2EV6 A;  3EUH A;  4GO1 A;  2XV4 S;  1T39 A;  2M5W A;  5HS7 A;  1RUN A;  1D5V A;  1OMI A;  5CVI A;  5ERI A;  5DUI A;  3GFI A;  1I27 A;  1FYK A;  4L9T A;  1D3Y A;  4B8X A;  2R7F A;  5LHH A;  2QM3 A;  1KYW A;  1FBQ A;  4HX4 A;  2VBY A;  2HYF A;  1GXQ A;  4RB0 A;  2PLY A;  4DQ2 A;  1RIO H;  5JR3 A;  4LLG F;  1CF7 A;  1SMY F;  5F1R A;  4KIB A;  4S04 A;  1SD5 A;  1YW9 A;  1IUY A;  2M45 A;  3U9G A;  3HRT A;  1USS A;  2FML A;  1FX7 A;  3LFK A;  4EVI A;  4ZYE A;  1U3E M;  2P8T A;  3KFW X;  3CO6 C;  2W84 A;  3WU1 B;  2ZBK A;  1XDU A;  3T1B A;  1ZG3 A;  3ZQ7 A;  1R22 A;  1FP2 A;  2XAF A;  3SFZ A;  1FSE A;  1Z7U A;  3H92 A;  3HTS B;  2G7U A;  3RYP A;  4A0Y A;  4HW0 A;  5H6R A;  5L3E A;  2P5L C;  5F64 A;  2QWW A;  1YG2 A;  1B9M A;  4L5J A;  1ZRD A;  4GCV A;  2P6T A;  2JPC A;  4AIK A;  4WCG A;  2OZU A;  4AIJ A;  2ISY A;  1Z6R A;  1LDK B;  2XAJ A;  3QPH A;  4KFC A;  2DPU A;  2VOP A;  3HSR A;  3WE3 A;  3VB2 A;  4GYI A;  4OOI A;  5IT9 K;  1FC3 A;  3BPX A;  1IF1 A;  2P7C B;  4LLL A;  2FNP A;  2NYX A;  2HZT A;  5HVQ C;  4GXO A;  4L18 B;  4I0B A;  5JI6 A;  4FX4 A;  4EJU A;  1ZYR F;  2RGV A;  4HV5 A;  3WTV C;  3ZMD A;  2ACJ A;  2OU2 A;  4EM1 A;  4KDP A;  3R60 A;  4N0B A;  5E8I A;  4S05 A;  3E5Q A;  3TO7 A;  3F3X A;  4M72 A;  2CGP A;  5JFR A;  4Q4Z F;  4IRG A;  3TQN A;  3T8R A;  2A6E F;  5FFZ A;  1IAW A;  3N97 A;  3Q9S A;  4CDG A;  4WXC A;  2XVC A;  1KU7 A;  5IT3 A;  1G3W A;  4I02 A;  3BRO A;  5KVR A;  2CO5 A;  4LK1 F;  1P92 A;  3LAJ A;  1IN6 A;  1R58 A;  3M9A A;  3MZY A;  3FMR A;  2E7W A;  4M9S A;  1J5Y A;  2EFW A;  2LDU A;  3JAM K;  1W5S A;  1AWC A;  5IT9 Z;  2V1D A;  1SAX A;  1E2X A;  4LK0 F;  1LQ1 A;  4D0P A;  1KU9 A;  3F6O A;  3JSP A;  4G7H F;  4M74 A;  5E8G A;  5ICE A;  4A12 A;  5JVT A;  3D0S A;  1QNT A;  4PGG A;  3R0J A;  4N9I A;  1IN7 A;  1CF7 B;  4EM0 B;  1KQ0 A;  1LEB A;  3ZMZ A;  3R0A A;  4I0A A;  1QPM A;  4XRF A;  2HQN A;  1IN4 A;  1UCR A;  3OOP A;  1FP1 D;  2RNJ A;  4HQE A;  3Q5F A;  1ON2 A;  1T2K A;  2CWE A;  5A2Q Z;  1E17 A;  1LEA A;  1A04 A;  3VFZ A;  4E70 A;  5K5R A;  3HHH A;  4RAZ A;  2BBY A;  1FYL A;  4FT8 A;  2BEO A;  1ZRE A;  2VN2 A;  1WSU A;  2OA4 A;  5E18 F;  4JQF A;  4EJO A;  4Y15 A;  3ZMS A;  4KN4 X;  2KIF A;  1YIO A;  1LJ9 A;  6PAX A;  3DV8 A;  4LG0 A;  3JAM Z;  4RGS A;  1I6X A;  2FSW A;  3PQJ A;  2IVM A;  4ZH4 F;  4L9J A;  3HIF A;  4EGY A;  2HGC A;  3C3W A;  2FNA A;  1YLF A;  2F2E A;  2ZXJ A;  1TTY A;  2IRF G;  1U6G A;  1IZ1 A;  2CW0 F;  3JW4 A;  4HF1 A;  3TOA A;  4LD5 A;  3WTS C;  3GF2 A;  2IA0 A;  4HLY A;  3FHZ A;  4EMS A;  3GW2 A;  4CXF A;  2JTV A;  5E1Z B;  1AOY A;  4HA8 A;  3IWF A;  3CTA A;  1O57 A;  3HRM A;  3SZP A;  2V6C A;  1T38 A;  3IKT A;  3ZN0 A;  5LGN A;  2OQR A;  4EQQ A;  1K7A A;  4YFK F;  2GWR A;  2QQA A;  2FBK A;  1B59 A;  3FXR A;  5FB2 A;  1P4W A;  1YYV A;  2DAO A;  1BI3 A;  1W4M A;  4WX9 A;  1R5H A;  3RI4 A;  2IT0 A;  3I4P A;  5HS8 A;  4QLC U;  3B73 A;  3J7A O;  2G7H A;  2VC1 A;  3ULQ B;  4BNC A;  3WTW C;  1UHW A;  3TKY A;  2RKH A;  5ILU A;  1K78 A;  3WTX C;  1U78 A;  1MZB A;  1OYY A;  2AS5 F;  1Z1D A;  1ZLJ A;  4IPA A;  3OV8 A;  4UV8 A;  3FM3 A;  1EH7 A;  4OIN F;  5D5U B;  1MGT A;  3KLN A;  2Y48 A;  1ZAR A;  2XAG A;  3BWG A;  4F7Z A;  5HDG A;  3V8K A;  1IW7 F;  2H6C A;  4G6Q A;  4OU0 A;  4KT5 C;  1XSD A;  2LNB A;  1S8N A;  2IW5 A;  3ELK A;  2GIV A;  3BOQ A;  1P6R A;  1IN5 A;  2DQR A;  1G3T A;  4RAY A;  2VE9 A;  3SHF A;  2W85 A;  4WXH A;  3QPT A;  3J81 K;  4RS8 A;  4A0Z A;  4IRI A;  2ZME A;  2GA1 A;  3U2R A;  4U7B A;  3DQV C;  3IHU A;  1H9T A;  1Z6T A;  3K1P A;  2F5E A;  3E3V A;  4WWC A;  2Q2E A;  1NHA A;  4L9N A;  1KU2 A;  5L3B A;  2JZY A;  3CUO A;  1IXS B;  2NNY A;  3AAF A;  2K02 A;  3DPL C;  2EWN A;  1PDN C;  2QBY A;  5BPI A;  1LNW A;  2R3S A;  3E5X A;  5FLX K;  3RPU A;  2XKP A;  2P7V B;  2QYO A;  3I0T A;  4G9Y A;  5DD4 A;  1EH6 A;  1JHF A;  1SMT A;  1ONV A;  1HW2 A;  1OYW A;  1K79 A;  2GXG A;  5BS6 A;  1Z91 A;  3ECO A;  2E7X A;  3C1D A;  5ILS A;  3TO9 A;  2PFB A;  2HWV A;  3FF5 A;  1S29 A;  4R1H A;  3CO7 C;  3V8L A;  2X4H A;  3P9I A;  1DUX C;  3M8E A;  2Z9O A;  4ENN A;  2HR3 A;  3J81 Z;  1XB4 A;  3EET A;  5BQT A;  3F8C A;  2QLZ A;  3BJA A;  3W6K B;  4NQW A;  4PCQ A;  1QQI A;  1HW5 A;  3HHG A;  2RDP A;  2CG4 A;  3M7G A;  4A6D A;  4OIP F;  2A5Y B;  1FT9 A;  4ZYD A;  4MQ9 F;  1QBJ A;  4UUV A;  2LF7 A;  3K9T A;  2YR2 A;  1U5T C;  2PQ8 A;  1RNL A;  3ECH A;  3I5U A;  5LLQ A;  1K78 B;  5FLX Z;  5L3D A;  2NNN A;  3KEQ A;  4OIR F;  1Y0U A;  2VBZ A;  3ML6 A;  2F5C A;  3FMQ A;  4O5V A;  4A5M A;  1C0W A;  2ZCW A;  1GXP A;  2K4J A;  5CJ9 A;  4IF4 A;  2L01 A;  1F1Z A;  1S7O A;  2EJR A;  2PEX A;  3E6B A;  1I1G A;  2D1H A;  2ZJ2 A;  4Y13 A;  4UNO A;  2M8E A;  3K2Z A;  4M73 A;  3DFG A;  5BPD A;  1HW1 A;  3MQ0 A;  1J7K A;  4TV7 A;  2J5O A;  4I2O A;  2IA1 A;  2ESH A;  3LA2 A;  5K1Y A;  2P5K A;  1SFE A;  1U5T A;  3MWM A;  2FRH A;  3I54 A;  2A69 F;  1XCV A;  5AON A;  5E17 F;  3MCZ A;  2ZME B;  3LQR A;  5J8C A;  1R5G A;  5HDK A;  2O3F A;  3QU6 A;  2Z3Y A;  4U0V A;  2NRA C;  4LLN A;  4AIH A;  2FF4 A;  3WOD F;  2QQB A;  3TGN A;  1BI2 A;  3K0L A;  1MJ9 A;  3C18 A;  2QBY B;  4FHT A;  4PZJ A;  1Z9C A;  4O3M A;  3HOT A;  2MLK A;  2MD5 A;  2V9V A;  1BJA A;  3FMS A;  3QOP A;  4KA4 A;  1O7F A;  3F22 A;  1SFX A;  2CSO A;  4K2E A;  1UHM A;  2NS0 A;  4LFU A;  3I53 A;  1RUO A;  3IC7 A;  1BM9 A;  2ZNZ A;  1XD7 A;  2EK5 A;  4P9F A;  3HSE A;  4P96 A;  5EEH A;  4ZYH A;  4R8H A;  3WGH A;  5A2Q K;  3KZZ A;  2VBW A;  2GZW A;  1R1U A;  4HZF A;  2D2W A;  3GEZ A;  4MNU A;  4ENM A;  1FWZ A;  4BHP A;  3RTR A;  3MFK A;  4M71 A;  5KK1 A;  3WTT C;  1JHH A;  5DCM A;  2BV6 A;  4HDV A;  3H3Z A;  5D4S A;  1V3F A;  3R61 A;  2RVC A;  1ZLK A;  3ABT A;  2O03 A;  1HKS A;  3VOE A;  1JXS A;  4XLN F;  3JTH A;  4M9Z A;  2M1B A;  2A3S A;  1KQ9 A;  5H6Q A;  2H94 A;  2ZKZ A;  4HX7 A;  4H0E A;  2FOK A;  1OR7 A;  3FXQ A;  1ZH5 A;  4G8X A;  2DQL A;  1YO5 C;  2PI0 A;  4KMF A;  1MDM A;  3KP7 A;  1S6L A;  3ERE D;  4BHC A;  4HQM A;  4KIF A;  3V7C A;  4A2U A;  2VOD A;  3CJN A;  4EJV A;  5K5O A;  1H0M A;  3GVA A;  2WWY A;  1RZ4 A;  2FU4 A;  5AIP A;  1MKM A;  2Y0M A;  2ZO4 A;  4ETS A;  1U5T B;  5JHU A;  2WC2 A;  2GQQ A;  2EFO A;  1DDN A;  2DU9 A;  1XCB A;  2M30 A;  2ETH A;  5AIQ A;  1YW8 A;  5DEQ A;  3REO A;  2KJB A;  2W25 A;  4ENK A;  3L9F A;  1TBX A;  3WGI A;  4IVN A;  3RKW A;  1ZRC A;  2DK8 A;  4KMU X;  1G4D A;  3CUQ C;  3F8B A;  3FZV A;  2PN6 A;  3EQL F;  2ADU A;  1GVJ A;  4G7O F;  4YG2 F;  3PQK A;  3IL2 A;  4GYG A;  3RJP A;  3J80 K;  1S7A A;  1CGP A;  3KP3 A;  1I1S A;  2MC3 A;  4HLX A;  3E6D A;  2HTJ A;  4RB1 A;  2DBB A;  3HRS A;  4MTD A;  3I71 A;  2F5D A;  2MBF A;  4EGZ A;  4PDK A;  2YX7 A;  4MGR A;  2WTE A;  3D5L A;  3MZH A;  5DD8 A;  3TO6 A;  3I64 A;  1XGN A;  1F4K A;  3GFM A;  4XSZ F;  2ZFW A;  3IWZ A;  4UVA A;  3CUQ A;  1G3S A;  3IRR A;  3TDU C;  4AD9 A;  3QP5 A;  2DTR A;  3HRU A;  2FQ3 A;  5HLG A;  3H3U A;  1ZGA A;  4EJT A;  2BYV E;  3KZY A;  5FD6 A;  1YTY A;  1FPQ A;  4IRH A;  1X3U A;  3LWF A;  4IHT A;  5L3G A;  3WTU C;  4CYD A;  4ESB A;  2HYG D;  2JPB A;  2D1V A;  1LDJ A;  1ULY A;  2EA4 A;  5DCM B;  4XLP F;  5HLH A;  1TW2 A;  1W7P A;  4UHT A;  1BOA A;  5D4R A;  3DKW A;  3FX3 A;  3HOS A;  4YFN F;  2H27 A;  3KP2 A;  1IXC A;  1V4R A;  3J80 Z;  2DLL A;  2XAS A;  1KU3 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...