4AIKA

Crystal structure of rova from yersinia in complex with an invasin promoter fragment
Total Genus 52
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
52
sequence length
139
structure length
139
Chain Sequence
STLGSDLARLVRVWRALIDHRLKPLELTQTHWVTLYNINRLPPEQSQIQLAKAIGIEQPSLVRTLDQLEEKGLITRHTSANDRRAKRIKLTEQSSPIIEQVDGVISSTRKEILGGISSDEIAVLSGLIDKLEKNIIQLQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural Basis for Intrinsic Thermosensing by the Master Virulence Regulator Rova of Yersinia.
pubmed doi rcsb
source organism Yersinia pseudotuberculosis
molecule tags Transcription
molecule keywords TRANSCRIPTIONAL REGULATOR SLYA
total genus 52
structure length 139
sequence length 139
chains with identical sequence B
ec nomenclature
pdb deposition date 2012-02-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01047 MarR MarR family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 4aikA00
4LGWA 2O0YA 3D5LA 4ZYDA 5E8IA 3Q5FA 3HYIA 4A0ZA 3KE2A 2MBFA 5HDKA 2HQNA 3HIFA 5HVQC 2PQ8A 4HOBA 1O7FA 3KP7A 5FLXZ 2KJCA 3F72A 4N9HA 2M30A 1Z1DA 1YYVA 1QQIA 3T1BA 2IA1A 5HS7A 1OPCA 2XGXA 3U1DA 1BOAA 4FT8A 2ESHA 1DDNA 4UXNA 1HW1A 4ENJA 3IKVA 2V79A 3JSPA 3WTZA 1K78B 4QWQA 2UXNA 3I4PA 3MQ0A 4LD5A 5J6XA 4IRHA 4EM2A 3DP7A 2BE5F 2STWA 2HEOA 2O6GE 1RNLA 4OIOF 4WX9A 3DEUA 1BBYA 5CVJA 5FD5A 1FWZA 1SMYF 3U2RA 3F8FA 1ZYRF 4Q47A 4E70A 4BHPA 4P96A 5LGNA 1K7AA 3GEZA 1JGSA 3GVAA 2YSRA 2E7XA 2DK5A 2Y75A 5FO5A 1HW2A 4O5VA 1MJ9A 2IA2A 1YW9A 2Y0MA 4KICA 2VBZA 2HR3A 1IN8A 2W85A 1TTYA 4WCGA 1G4DA 2A07F 4KUMA 2M45A 1BN5A 2OQRA 4EV0A 2UWMA 3I58A 4UVAA 3GLXA 2MLKA 2HKOA 3WGGA 2ZO4A 2H94A 2HWVA 4IF4A 5D6EA 4I01A 4IJAA 5LEJA 4LK1F 4MGRA 4GYGA 2DAOA 2QBYA 4GYIA 5FLXK 1D8KA 5D5XB 1TW3A 3PQKA 4UVBA 3CJNA 2K02A 4O3MA 5E1ZB 3CO7C 1YTYA 2JSCA 1D8JA 4F7ZA 3FMQA 4HQEA 5FGMA 3F8NA 3FXUA 3IC7A 3HOTA 5DCFA 4YIIA 3R6SA 4L9JA 4HZFA 3FM5A 3VB2A 5LGUA 3GZ6A 2QVOA 1QPMA 1CGPA 1XGNA 1SD4A 1R00A 4G6QA 1R7JA 3K1MA 4HV6A 1YFHA 1T2KA 4RB2C 2K4BA 4HW0A 3IRRA 4QLCU 3M8EA 4RGUA 1FYKA 2QENA 3QP6A 5EEHA 3I59B 2J5PA 2QQ9A 3T8RA 3TGNA 4U88A 4LK0F 2DQLA 2RQPA 1B4AA 3ELKA 3V7RA 3TOBA 1F5TA 1LVAA 3KEOA 3MWMA 5HOOA 3CO6C 5F6FA 4L9VA 3H3ZA 4HLYA 1XDSA 4S05A 3BY6A 1Z7UA 3EDPA 4BXUA 2CYYA 3P7NA 1DPUA 4HYEA 2A6HF 2YX7A 3G3ZA 4U0WA 2L02A 2GAUA 3HTSB 1HXDA 1O57A 3NRVA 4M73A 3L9FA 2FU4A 1XMKA 1ZLJA 1XMAA 2VE9A 3RKXA 1FX7A 2G9WA 3VODA 1KQ9A 1HKSA 4IPAA 2WWYA 4RAZA 1MZBA 4ON0A 1U5TA 2XAHA 3GYHX 2XASA 1L3LA 1TBXA 1FZPB 5FD6A 3V8KA 1SAXA 5JHUA 3E6CC 3BDDA 3Q9VA 4OMYA 1KYWA 3E5UA 2ADUA 2XAJA 1NHAA 4DNCA 4RGSA 4N0BA 5L3FA 4KMUX 1JHFA 1OR7A 1FPQA 1YIOA 1IXCA 2VOOA 5FFXA 4UHTA 2PBIA 2FNPA 1UFMA 3SHFA 5JFRA 2FNAA 1K6OA 3MFKA 3N97A 1PUEE 5D5WB 2O03A 1R22A 3K1NA 2DPDA 1PP8F 1YLFA 2XKOA 3FMRA 5ICFA 1IN7A 3PQJA 4CYDA 5K1YA 4OINF 2Z33A 4EMSA 5ILVA 4XRFA 1DP7P 1FC3A 3WTUC 4R8HA 5ED4A 3F8CA 1ZRDA 2PMHA 5EEGA 3I0TA 3TDUC 3RYRA 2EV0A 4B09A 4CICA 2MC3A 4P9FA 2K27A 4WXCA 3ZN0A 3BJAA 3H3UA 2BEOA 4BH9A 2ZNZA 4ESFA 1T39A 5DCMA 4HX7A 3HRMA 2KKOA 1IN4A 5E18F 4PCQA 1MJBA 3LQRA 1FY7A 2YX4A 5DEQA 1OYYA 3BWGA 3N4MA 4M72A 3RTRA 2RC4A 1HKQA 1HSTA 1S7AA 3M8FA 1H9GA 1ZAOA 4JQFA 4I7HA 3QU3A 3IRQA 3KP6A 1ZGAA 3CTAA 2CG4A 3T8TA 3F3XA 1UCRA 2IPQX 2K7LA 2EA2A 1H0MA 2P8TA 2V1XA 3GW2A 3KP4A 1V3FA 1I1SA 1XGSA 1YG2A 1K78A 2FEZA 4ENMA 3E6DA 4G7ZF 2Q8KA 1FSHA 3REOA 4KN7X 1F1ZA 5D8KB 3LWFA 4NQWA 3F8MA 2YU3A 1FOKA 3JAMZ 1REPC 4IVNA 3CUOA 4MEYF 1IRFA 1B59A 1L0OC 1BI0A 2BYVE 3CUQB 2XAQA 2JPBA 4HF2A 1S29A 3IL2A 1XGMA 2XAFA 4KMFA 1O3QA 3ZPLA 4EQQA 4L9NA 4M9SA 4KA4A 3MZHA 1HW5A 2CGPA 1QZZA 5D5VB 3TQNA 3KP5A 2C6YA 1TQMA 1FBUA 1P2FA 2GIVA 1J0RA 4XSXF 3MAJA 3GFJA 4ENNA 5FB2A 2YPRA 5H6QA 3QAHA 2W57A 3P9KA 4G8XA 1XD7A 3EYIA 2EK5A 4EJTA 5KVRA 3C3WA 1ODDA 2O8XA 1MKMA 2PFBA 1ZHFA 4HX8A 5DD4A 3RI4A 2LNBA 4GGGA 2V9VA 4RB3C 2P7VB 1QO0D 5TJJA 4A2UA 3ABTA 5AIPA 4CXFA 1ZG5A 5IT9K 2OZ6A 3L7WA 2UXXA 4L0YB 2OA4A 2NYXA 3HOSA 1XSXA 1YQAA 3F6VA 2CSOA 2FA5A 3P9IA 4PDKA 4HX4A 5LBQA 1ZRFA 1LB2A 4K2EA 4Z2YA 1W7PB 1EV7A 3VFZA 2XRNA 5AIQA 2HYGD 1ZLKA 1TLHB 3ROUA 1KU2A 1B9NA 5HLIA 3LAJA 5BPDA 1TW2A 3HRTA 3ECOA 1WRJA 1V4RA 3QU6A 1FT9A 3SZPA 1K79A 3WGHA 4MHGA 2M1BA 3WTVC 3IKTA 1ZH5A 1XCVA 1U2WA 1U6GA 3WE2A 3E97A 5HS8A 3E3VA 4IHTA 2EFPA 5F1RA 5D4RA 2EV6A 1WI9A 3RPUA 2ESNA 3V8LA 5DD8A 1PP7U 2QUFA 3ECHA 1G3WA 2DU9A 4R1HA 4WK8F 4I0BA 2QBYB 1HSJA 5D6FA 1HQCA 1P6RA 1T38A 2F5CA 3C18A 2L4MA 3KP3A 2QZ8A 1U8RA 3S2WA 3ZMVA 3QRFF 1MDMA 4KFCA 3IWFA 2VT2A 3LA2A 1AOYA 3HSEA 4ZZLA 1U3EM 2VT3A 1R5GA 2HS5A 4Y13A 1JXSA 2IW5A 1BI3A 3W6KB 5E8GA 2YR2A 2PJPA 4BHBA 2XIGA 1U78A 2F5EA 3I59A 3BJ6A 1T6SA 1USTA 1HBXG 2PEXA 1OYIA 4A6DA 1LEAA 3J81Z 4LFUA 5A2QK 4BQAA 2EV5A 4I09A 1XCBA 2EWNA 2PMUA 1W5TA 3WG9A 1H9TA 3ULQB 2LF8A 5BOXA 4UUVA 3RJPA 3V7SA 2ZMEB 3CDHA 2K4JA 3GFMA 2VC0A 3DPTA 4LMYA 4I02A 3K2ZA 2EFQA 2J5OA 4XLPF 1KU9A 2VXZA 4BNCA 2D1HA 1FBSA 2ZNYA 3RKYA 4MNUA 4ZYGA 1QZYA 2BV6A 2L4AA 3LFKA 2XAGA 2CQKA 3B02A 3BZ6A 5BMZA 4CO8A 1W7PD 2XUBA 2HOEA 1S8NA 1FYMA 3FXRA 1TQIA 4EJUA 2BGCA 3WTXC 2V6CA 2HFHA 1U5TC 4LLGF 5CVVA 3KFWX 3ZP5A 2B0LA 4L18B 1R1VA 3SQNA 4CDGA 5CVRA 1WSUA 1BI2A 1MGTA 4A6EA 2A3SA 1E17A 2XV4S 3MEXA 1ULYA 2FMLA 4WF2A 4D0PA 1W5SA 3CLOA 3G73A 3DPLC 1P92A 4LLLA 3K69A 5D5UB 2E1NA 2JRTA 3U9GA 1O3TA 3KCCA 1IF1A 5CJ9A 2E1CA 1IUYA 4MTDA 3COAC 1WKMA 2CWEA 1Z9CA 1W7PA 2QYOA 4DQ2A 4LB5A 2JZYA 2F5DA 4AD9A 4IRGA 1O3SA 1XSDA 1T98A 4KIBA 2HDCA 3V8JA 3RPQA 4MEXF 4ZYEA 3FX3A 4I98B 4OIQF 3I71A 2XKPA 1B1BA 1VTNC 2ISZA 2L54A 3E5XA 3F22A 4CGZA 1RZ4A 4OU0A 2HTSA 2WV0A 3SZTA 3EETA 3KP2A 5E1WA 2A69F 1OYWA 4HBLA 3QPTA 2VOPA 3QP5A 5LHHA 2GA1A 1YS7A 5HDGA 3DF8A 2FBKA 2P5KA 2PI0A 3KLOA 1G3YA 3GXOA 4KIFA 1YW7A 3JTGA 2ZBKA 3ABUA 1IW7F 2UZKA 2BBYA 3W6JB 2D45A 2VE8A 1G3SA 3RDIA 3T5XA 3GFIA 1F4KA 4LJZF 2GXGA 4BHCA 4HA8A 2EA4A 2FMYA 2ZMEA 1I27A 1ZG3A 5J8FA 1GVJA 2KRFA 1IZ1A 3KZZA 3GFLA 1RUNA 2MLGA 2DK8A 4A12A 1O7LA 2NRAC 1KYZA 3SXYA 3PFIA 4AIHA 2MD5A 1EH7A 4YIFA 3R60A 2MH9A 4Q5SF 5DUIA 3M1EA 5K5QA 3HTUA 1OKRA 1CF7A 3ZMSA 2XROA 3BROA 5H6RA 2M8EA 3HRUA 5IT3A 3WTWC 5BPIA 2QWWA 4HLXA 4UV9A 2AS5F 5JVTA 1AWCA 2P7CB 5BQTA 1Y0UA 2V1DA 4LB6B 4RB1A 1R1UA 2Z3YA 2FBHA 1Z6RA 3GZ5A 4LLNA 4EM0B 3GWZA 5LGTA 2RVCA 4RGXA 3IWZA 4EM1A 3IHUA 2PN6A 4GXOA 4LG0B 3L2CA 1ZGJA 2VBYA 1TNTA 2XHKA 4AWXB 5ERIA 4CZZA 1XB4A 1MD0A 2PG4A 4G6DA 2W84A 1B9MA 5DUKA 2VBWA 2VBXA 2Q0OA 3MCZA 2OQGA 5LEKA 2H6CA 4XSZF 3KETA 4LG0A 2XVCA 5CVIA 2WTEA 2DT5A 5K5OA 5L3DA 2IJLA 3CUQC 1BM9A 3OOPA 3HHHA 2ZKZA 4P9UA 4A5MA 1PDNC 4G94A 1JHHA 1OMIA 4ZH4F 2GA2A 2DI3A 3I54A 2FSWA 2FBIA 2RDPA 4B8XA 4RB0A 2Y48A 5F64A 1YW8A 1J59A 2STTA 3ZMZA 2H09A 2NNYA 4O6JA 2MH2A 2NNNA 2KIUA 4RAYA 3I64A 4OMZA 4PGGA 4Y15A 5A2QZ 3FZVA 5LLQA 4WXHA 2O61A 2TDXA 2V1UA 3V7CA 1SMTA 3QPHA 1GXQA 3L00A 1KGSA 3R0JA 3JW4A 4M74A 2DW4A 3E5QA 1T0FA 2H27A 1R58A 1FBQA 5FFZA 2Z5UA 1XGOA 2LSOA 3R0AA 2HKXA 5HS9A 3ML6A 5L3BA 4S04A 4FHTA 3FF5A 2NS0A 5LRRA 4Q4ZF 1P4XA 2GWRA 4YG2F 2EFOA 4GCVA 2G7UA 1IN5A 2RGVA 3C7JA 2Q2EA 3O3KA 1BJAA 1EH6A 4EGYA 5JI6A 3ZMUA 1RI7A 2IA0A 2QQBA 2R7DA 1ON1A 1YO5C 1FNNA 3BPVA 2RV8A 4UNOA 2HTJA 3LAPA 5CYVA 2AXLA 4L5IA 4NHJA 1SFXA 3JAMK 2R3SA 4KT5C 3VOEA 4WWCA 4AIJA 3I53A 3B73A 4Q48A 2X4HA 4YFXF 2DO7A 4CHUA 4ETSA 2P5LC 1GXPA 1TQPA 2RKHA 5BS6A 4L9TA 2KIFA 3E6MA 4EJVA 1MJAA 3WGIA 2A68F 3I5UA 4ESJA 5DYMA 2OD5A 2EFWA 4NB5A 5HLHA 4H0EA 2A6EF 2A5YB 4AVPA 1W4MA 1Q1HA 4KIGA 4BAYA 4M71A 1QGPA 1I6XA 3MZYA 3HSFA 5DDGA 4ZYHA 4IRIA 1ZG1A 4HV5A 1DUXC 2LKPA 2HYFA 4AIKA 4P55A 3AAFA 2ISYA 3ERED 2GXBA 1ZN2A 4YFNF 5DCMB 1D5VA 4HF1A 1BC7C 3KEQA 2HZTA 2EJRA 2IP2A 4U7BA 2ETHA 1FP1D 3TOAA 4MQ9F 4OOIA 2FRHA 5CVUA 5J8CA 1LDKB 4I2OA 2ZFWA 1F9NA 1LEBA 4N9IA 3ZMDA 1EH8A 1KQ8A 2FOKA 4EGZA 3HUGA 4JBAA 4YFKF 4HDUA 3DQVC 4L5JA 2ZJ2A 4MTEA 2EFNA 4WXDA 1FLIA 1WWXA 3CUQA 1Z05A 3TO7A 2E7WA 1LDDA 2G7HA 3TDZC 1Z91A 2F2EA 1LJ9A 4HAMA 1UHMA 2CW0F 1RIOH 3HSRA 4KDPA 1BC8C 3DKWA 4EJWA 1SFUA 1I1GA 2P4WA 2L01A 2DPUA 3SFZA 2W24A 3WU1B 3WE3A 5D4SA 4ZZDA 2ELHA 2CFXA 3WTSC 3J81K 4U0YA 1S3JA 1IRGA 3ZN1A 2DLLA 4UVCA 1XDUA 3H92A 1DPRA 3GX4X 3OV8A 4G7HF 5IT9Z 3K1PA 1JE8A 2JTVA 2CO5A 2RNJA 5ICGA 2D2WA 2ACJA 3EYYA 1XSVA 1GHCA 1MDMB 3KZYA 2DQRA 3O2PE 3HRSA 3JTHA 2D1VA 2OBPA 4MQVA 4GO1A 3DV8A 3V4GA 5TRDA 1BI1A 1UB9A 1QBJA 1E2XA 4EJOA 3GO5A 2H6BA 1X3UA 3ZMTA 1IN6A 2HGCA 2F5FA 2WC2A 2VONA 1IXSB 1TNSA 2A61A 5E1XA 5H20A 3FHZA 4XLNF 4IHSA 5DV5A 1SFEA 3NQOA 3BOQA 1RUOA 2R7FA 4XBFA 1QNTA 1LQ1A 4IXAA 1USSA 1R5HA 3R61A 4M9XA 5L3CA 4HQMA 2GZWA 4U7DA 1SD7A 2OZUA 4Y17A 1R1TA 3TO9A 3BP8A 3LA3A 1P4AA 1ZARA 2KIMA 3D0SA 2Z99A 3NEUA 5E20A 2LF7A 3WTTC 4ENKA 3K9TA 2QQAA 1P4WA 3LQQA 5LHIA 1J7KA 2DBBA 5ICEA 3KLNA 1HKTA 3DXJF 3EQLF 2LDUA 2FXAA 4A0YA 1S7OA 3C1DA 4FX0A 4KNYA 3F23A 4OIPF 4PZJA 3RIRA 3M7GA 1SD5A 2PLYA 2O3FA 4R79A 2K86A 3M9AA 1WQ2A 4PGHA 5D8LB 3L09A 5HDNA 2VODA 5CLSA 1KA8A 3WTYC 3VEPA 1STZA 3J80K 2GQQA 2OU2A 4I0AA 4A0XA 1ZREA 1SD6A 1J5YA 1IXRC 2FE3A 2M87A 3BPXA 2FF4A 2COMA 1R23A 1A04A 2IVMA 4U0VA 5KK1A 4L0ZB 4HDVA 2W25A 3R4KA 4KYWA 1U5TB 5K5RA 1LDJA 4BYYA 2KJBA 1LNWA 1B6AA 3WU0A 5ICCA 3QOPA 3ZQ7A 2M5WA 3RKWA 4M9ZA 5L3EA 3GUDA 2X0LA 1J2XA 1KQ0A 5HLGA 4P5OA 1IAWA 1O3RA 4EVIA 4KN4X 2DTRA 3J80Z 1J9IA 1ZRCA 1BIBA 3Q9SA 4JK1X 4OIRF 4RS8A 1KU3A 1XN7A 2P6TA 3FWEA 4RGRA 2RN7A 2Z9OA 3F6OA 2IT0A 1G3TA 1J75A 3DFGA 5L3GA 4M6XA 2HQRA 5LHGA 1CF7B 3F21A 3K0LA 3O6BB 2OAZA 1UHWA 3T0YA 3F8BA 3FXQA 1G6NA 2P5VA 3LSTA 4ESBA 1C0WA 1ONVA 5ILSA 4A5NA 1BIAA 3HHGA 1D3YA 3RYPA 2ZCWA 3BJOA 2ZXJA 2JT1A 2L3DA 6PAXA 3FM3A 2MA3A 3TKYA 3ISPA 3LA7A 4TV7A 1Z6TA 3JSOA 1FSEA 1I5ZA 3GF2A 1FYLA 1ON2A 5LRSA 4G9YA 3J7AO 4M6YA 2IRFG 3EUHA 2VN2A 4HF0A 1S6LA 5AONA 4G7OF 1KU7A 2QLZA 1YS6A 2P6SA 2DFIA 1R36A 2EB7A 3E6BA 3FMSA 5JR3A 2VC1A 1FP2A 4ASNA 5E17F 2JPCA 2QM3A 2NAZA 3WODF 5ILUA 4UV8A 3P9CA 4FX4A 3TO6A 2FQ3A
chains in the Genus database with same CATH superfamily
4LGWA 3K70D 2MG4A 2IXSA 1AKHA 2OTJI 2O0YA 3JRGA 2BW3B 3D5LA 5E8IA 4ZYDA 2FQ4A 5M3MJ 3Q5FA 4RMNA 3DLAA 3HYIA 2K9MA 2Y2ZA 4A0ZA 3KE2A 2JUGA 2MBFA 1GT0C 4PFPA 1GVDA 5HDKA 4HSRA 4A3MJ 4LIVA 4E7LA 2HQNA 3HIFA 1LPQA 5HVQC 2PQ8A 4HOBA 1O7FA 2VI6A 3KP7A 5FLXZ 2P0WA 3EUHC 2KJCA 3F72A 1Z3XA 4N9HA 1VQ6I 2M30A 4PJMA 1Z1DA 1YYVA 1QQIA 4NQWB 2IA1A 5HS7A 3T1BA 2JA5J 3H35A 1PVEA 1X1PA 1OPCA 1G8XA 2XGXA 1I50J 2W7NA 4ZTJA 3WHCA 2OPTA 3W6VA 4IEJA 3LL7A 3U1DA 3IV5A 3A01B 1BOAA 4FT8A 2DFEA 3OYNA 2ESHA 1DDNA 4UXNA 1HW1A 2O5RA 2KDZA 4ENJA 3IKVA 4XKVA 2V79A 5K7HA 3MKYB 3JSPA 3WTZA 3X2QH 1K78B 2IGNA 2Y69H 4QWQA 2LBFB 2X6YA 2UXNA 3I4PA 5GPAA 3MQ0A 4LD5A 3OYCA 2HQAA 4XNFA 5J6XA 2XB0X 4IRHA 2A6TA 4EM2A 3DP7A 3L2VA 3FBNB 2BE5F 2STWA 2HEOA 1IRXA 3HKZA 5KNLA 2O6GE 1RNLA 4OIOF 5KAIC 2M3AA 3JRHA 2L9SA 4WX9A 1TWCJ 3FK6A 3DEUA 1BBYA 3K4LA 5CVJA 3ZQLA 5FD5A 1FWZA 1SMYF 3U2RA 3F8FA 4A3GJ 1ZYRF 4BS9A 4Q47A 2WB1A 3D1NI 1W36C 4E70A 2KPMA 4ZDPA 2RNGA 4P96A 4BHPA 5LGNA 1K7AA 3GEZA 3H9JA 4HEA2 2CUZA 1JGSA 3GVAA 2YSRA 2E7XA 2HXIA 1W0UA 2DK5A 4AUXA 2Y75A 2X1DA 5FO5A 5E3OA 2ZXWH 4O5VA 1HW2A 1MJ9A 2IA2A 3BCAA 1YW9A 3BLYA 3M1CA 3S1NJ 2Y0MA 2PMZN 2QSHX 4KICA 1BJZA 2VBZA 2HR3A 1IN8A 2W85A 2EQRA 3LNQA 3OIOA 1TTYA 4WCGA 1G4DA 2A07F 4KUMA 2M45A 4XLCA 3OWTA 1BN5A 4E7HA 2OQRA 3GLLA 4EV0A 3I58A 3GTKJ 2UWMA 4M6VA 3ZR8X 1OLTA 4IOAF 1AA7A 4UVAA 4PSXA 1WI3A 1X2NA 1NTCA 2MLKA 2HKOA 2UV1A 3GLXA 3DLLF 3WGGA 2ZO4A 2H94A 2HWVA 4RLFA 1FTZA 1UELB 4EATA 4UB8C 4IF4A 2K40A 1JTXA 1LE8B 3FXOA 3JRIA 5D6EA 4I01A 4IJAA 3WHBA 5LEJA 2OUMA 1SFOJ 5EG0A 4LK1F 4MGRA 4GYGA 2VKHA 2DAOA 2XB5A 4GYIA 2QBYA 3OY9A 5FLXK 1D8KA 5D5XB 1TW3A 4IZZA 5CQEA 2M0MA 3PQKA 5J1UA 2VQGA 2R5YA 1UAAA 4UVBA 2IGKA 1IDYA 3HEFA 2V9KA 3CJNA 2K02A 4O3MA 5E1ZB 3CO7C 1YTYA 2JSCA 1D8JA 4F7ZA 3FMQA 3RZDJ 4HQEA 2LRDA 5FGMA 1YRNA 3F8NA 3FXUA 3IC7A 3HOTA 5DCFA 4YIIA 3R6SA 1IV8A 3S17J 5B66C 4D9JA 5FKMA 2XAUA 4CA0A 4L9JA 4HZFA 2JA8J 2QCOA 2NOJB 2Y31A 3KX2A 3FM5A 1GV2A 2KDOA 3VB2A 5LGUA 4DGWB 3GZ6A 3HUGB 3H0DA 2QVOA 2K85A 4XR6A 1QPMA 2R7SA 2WA0A 5GADJ 4XKBA 1CGPA 1XGNA 1D5YA 1SD4A 1R00A 2D5VA 5HODA 3OL3A 1DP3A 4JX5A 2ELKA 3OS2A 3PM1A 2CFOA 4G6QA 3TP3A 3OYKA 3PUBA 2W1OA 4J19A 1R7JA 3BR2A 4IQJA 4GRIA 2CW7A 2R7TA 1IJWC 3K1MA 5DM6F 4HV6A 1YFHA 1T2KA 1YJWI 4RB2C 3K4BA 2K4BA 4HW0A 5JVGF 3IRRA 3RSNA 3S3NA 3M3YJ 2HVQA 4QLCU 3A03A 3M07A 4C2UA 3M8EA 4BACA 4RGUA 1FYKA 1WHUA 2QENA 3CCSI 3QP6A 2MGQA 3I59B 2J5PA 5EEHA 4BJ6C 3FDYA 2E36A 4RAFA 3HOWJ 2HXOA 2QGUA 2QQ9A 1J09A 2YU9J 2DT6A 3T8RA 3TGNA 4U88A 4LK0F 2DQLA 2RQPA 1B4AA 4AC0A 3ELKA 3V7RA 3IH2A 5E3LA 5IOYA 2R7QA 3TOBA 1F5TA 1LVAA 3KEOA 3MWMA 2R93J 5HOOA 1X2MA 3BZKA 3W2VA 3CO6C 4M3FA 5F6FA 2HNHA 1UJ8A 4L9VA 3H3ZA 4HLYA 1XDSA 4S05A 3BY6A 1Z7UA 2KFDA 1MSFC 3K4CA 1XX5A 3EDPA 4BXUA 3NWSA 2DFHA 2CYYA 3S16J 3UR3C 3P7NA 3RKQA 3S15J 3HOZJ 1DPUA 4HYEA 2A6HF 2YX7A 3G3ZA 4U0WA 1POGA 2L02A 3S8PA 3HM5A 4HNUA 2GAUA 3HTSB 4B4CA 2BHZA 1HXDA 1O57A 3NRVA 4PJJA 4CCOA 3OR1C 4M73A 2DMPA 3L9FA 2DMUA 2FU4A 4A3FJ 1D0ZA 1MW7A 2K3PA 2VPLA 1VFCA 1XMKA 2YS9A 3AG2H 1ZLJA 1XMAA 2FJ1A 5M5WJ 2X51A 4BGDA 3DTKA 4HNVA 1V5EA 4QPOA 2VE9A 4UB6C 5EEAA 3C2BA 4UUTA 3RKXA 3QWLA 1FX7A 2G9WA 3IH4A 3VODA 1KQ9A 1HKSA 4IPAA 1S7EA 2WWYA 5EZHA 4RAZA 3L2RA 1VQ5I 4BEHB 1MZBA 1Y8RB 4ON0A 2DFFA 5FROA 1U5TA 2XAHA 1F36A 2XASA 4XN3A 2YUSA 3GYHX 4RLQA 1L3LA 5FLVA 1DGWY 4A3BJ 1TBXA 5FKKA 2FX0A 4JX6A 1FZPB 3BTLA 2E5NA 5FD6A 1V5GA 3V8KA 2EZIA 3DU5A 4PUSA 1SAXA 5JHUA 3PSFA 3E6CC 2NVYJ 4W97A 1SC7A 3CMYA 3BDDA 2BY0A 3Q9VA 3OYHA 4OMYA 1KYWA 4FETA 2W00A 3H1CA 3E5UA 2ADUA 2XAJA 1NHAA 4DNCA 4RGSA 4N0BA 5L3FA 4KMUX 1JHFA 1OR7A 1MMSA 1FPQA 1YIOA 3S2HJ 2ME6A 3AG1H 1IXCA 2VOOA 5FFXA 3CJQB 4BE1A 4UHTA 2PBIA 5DTDA 2FNPA 1UFMA 3LSIA 2MYSA 3SHFA 1ZTRA 1MMAA 2FNAA 5JFRA 1FMVA 3CMMA 1K6OA 1KONA 3MFKA 1EJ9A 2CUEA 2OV7A 3N97A 4HSTA 1PUEE 2ICWG 1VQMI 2IGOA 1WH5A 5D5WB 4DZJA 4ITVA 2O03A 1OCCH 4RM3A 2JUCA 1R22A 5E3MA 2NS7A 3K1NA 2VKVA 4FQGA 2X85A 2DPDA 1PP8F 1YLFA 2EINH 3FMRA 2G0EA 2XKOA 3BTCA 4PJNA 2WV1A 4PFOA 5ICFA 1XS9A 1IN7A 2HYJA 3PQJA 1O4XA 4CYDA 1JUPA 5K1YA 4OINF 2Z33A 5E79C 4EMSA 5ILVA 1T56A 4XRFA 5C4XJ 3N05A 3KYCB 3LSMA 1DP7P 1FC3A 2X48A 3PNTA 3HKZN 2R7UA 3WTUC 2R7ZJ 4R8HA 1DU0A 5ED4A 2OC6A 2DT7B 1MBHA 3F8CA 3LOCA 4JYKA 5K7FA 1ZRDA 2PMHA 1HC8A 5EEGA 3I0TA 3TDUC 3FHNA 2DA5A 3RYRA 2EV0A 4B09A 4CICA 2MC3A 2DA3A 3BC8A 2K27A 4P9FA 4WXCA 2ZSHB 3ZN0A 2JA6J 1FEXA 4RAGA 3BJAA 5JLWA 3H3UA 1WJEA 4Y4RA 1K4TA 1R9TJ 4DOZA 1E3OC 5GTIC 2PX9A 2BEOA 2GXAA 5GP9A 3I4NJ 4BH9A 3SFIA 1NH3A 4XQFA 2ZNZA 4OAZA 3DWLE 4ESFA 1PUFA 1YE9A 3QODA 1T39A 2K5CA 2EIKH 5DCMA 1XPXA 4HX7A 3HRMA 4GFBA 2KKOA 1TWFJ 3EPZA 1IN4A 2VJ5A 5E18F 4PCQA 1MJBA 3LQRA 2DJNA 3ZQIA 3HZJA 1IV6A 1FY7A 1PJRA 2YX4A 4BQNA 4BE0A 2CQ7A 3DTIA 5DEQA 1U9OA 3C2GA 3MVPA 1JT6A 1OYYA 2K9NA 3BWGA 2XSDC 1WJDA 3N4MA 1X19A 4M72A 3OR2C 3RTRA 2R5ZB 4BL0B 2AXTC 2RC4A 4FCYA 1HKQA 1HSTA 1S7AA 3M8FA 1H9GA 2B7EA 2JMWA 1JTYA 1ZAOA 3QOEA 4JQFA 3CMAI 4I7HA 1UHSA 3LFUA 4BY7J 4I6ZA 3QU3A 3IRQA 2CQNA 4PJ0C 3KP6A 3WG7H 1Q1VA 4N4NB 5CQGA 3K4JA 1ZGAA 3CTAA 4A3IJ 2CG4A 3T8TA 3F3XA 1UCRA 2ECBA 2IPQX 3ZRGA 2K7LA 2EA2A 1OCZH 3LSPA 2P8TA 2HU9A 2V1XA 3GW2A 3KP4A 4L5EA 1V3FA 1H0MA 1JKRC 1I1SA 1FOXA 2V7FA 1XGSA 3S2DJ 1WH7A 1YG2A 3OYIA 3ABMH 1MNDA 3BG7A 1K78A 2V6EA 2XF5A 2FEZA 4ENMA 3GMEA 2R92J 1VQKI 3SDBA 3E6DA 1JJ6C 4G7ZF 2Q8KA 1FSHA 1OCRH 3REOA 4FE7A 4PJLA 4KN7X 1F1ZA 5D8KB 4D7MA 3LWFA 4NQWA 3F8MA 3M4OJ 2YU3A 1FOKA 3JAMZ 1REPC 1G59A 4IVNA 3W2AA 1E3PA 3CUOA 1IRFA 4MEYF 2R5YB 5C44J 2CV0A 2ZMEC 1B59A 2R7RA 2O7OA 1L0OC 1BI0A 2BYVE 1FTTA 2H1LA 3VDXA 3CUQB 4B1RA 2XAQA 2JPBA 1VQ9I 2ZXHA 1A6QA 4HF2A 1S29A 1V55H 3IL2A 1XGMA 2XAFA 4KMFA 4C3HJ 5HNFA 3EUAA 1O3QA 3ZPLA 4EQQA 4L9NA 4M9SA 4KA4A 3MZHA 2EBIA 1HW5A 2CGPA 1QZZA 2VUMJ 3ZXSA 1Y0NA 1BA5A 5D5VB 3TQNA 3KP5A 2C6YA 1TQMA 1FBUA 1P2FA 1SVLA 3KYDB 2GIVA 2QKMB 1J0RA 4G6TB 3K7AJ 4XSXF 3MAJA 3GFJA 1Z7LA 4ENNA 3QYBA 5FB2A 2YPRA 5H6QA 3JRBA 3QAHA 1ZGWA 3CF2A 2W57A 3P9KA 4G8XA 1XD7A 3EYIA 2EK5A 1ZQ3P 1YITI 4MLOA 4EJTA 1TWHJ 5KVRA 3C3WA 5KCMA 1T33A 2X6WA 3MKWB 1ODDA 2WAEA 2O8XA 4A3DJ 1MKMA 2PFBA 1IRZA 1ZHFA 2DYSH 2L9RA 3B6AA 4HX8A 4CYCA 4XN0A 3UNGC 4E7ZA 5DD4A 3RI4A 2LNBA 4GGGA 3JCUC 1I3QJ 2V9VA 3CJTB 4RB3C 2P7VB 1B8IB 1VQ8I 3ZCOA 1QO0D 5TJJA 3L1PA 3FIWA 4A2UA 3ABTA 5AIPA 4CXFA 2XC7A 1ZG5A 3AG3H 2IS4A 5IT9K 1OCOH 2OZ6A 3E0JB 3OYMA 1YI2I 2CS3A 1UZCA 3L7WA 2KL4A 2UXXA 4L0YB 4UUSA 2OA4A 4RBOA 2WBMA 3CC7I 4HG2A 2NYXA 3HOSA 1F43A 1XSXA 4V2GA 1YQAA 3F6VA 4B3AA 2CSOA 2FA5A 3P9IA 1T95A 4PDKA 2NXNB 4HX4A 5LBQA 4M3EA 1E3HA 1ZRFA 3K10A 1SFKA 2DODA 1LB2A 4K2EA 4YELA 2BY1A 2HOSA 2OJED 4Z2YA 1OCPA 1W7PB 4DYRA 2RREA 1EV7A 3BCBA 3VFZA 3BR0A 2JA2A 2XRNA 4CCJA 3PIPF 3I3LA 5AIQA 2HYGD 1ZLKA 1TLHB 3ROUA 1B72A 1KU2A 1B9NA 5HLIA 1CQTA 2DCEA 3LAJA 5BPDA 2JVGA 4XLHA 1TW2A 3HRTA 3ECOA 1WRJA 1V4RA 4BY1J 1BR1A 3QU6A 4IHVA 1Z77A 1FT9A 3SZPA 3WGHA 1K79A 4MHGA 2M1BA 2ZSIB 3WTVC 3IKTA 3FISA 1ZH5A 5K7ZA 1XCVA 1VQ7I 3JRAA 1U2WA 1LFPA 1U6GA 3E97A 3WE2A 5HS8A 4IKFA 2A05A 3E3VA 2WADA 4IHTA 4E7KA 4XOTA 2DOEA 2M0CA 4AYBA 3FXJA 2EFPA 1V5FA 5F1RA 5D4RA 1WJCA 2EV6A 2KMUA 3L2WA 1WI9A 2BOLA 3RPUA 2ESNA 2H1KA 1FOYA 2VIXA 4XLEA 4PSWA 5F0HA 3V8LA 5DD8A 1PP7U 3S1MJ 2QUFA 2VKDA 3ECHA 1Y6IA 3OIPA 1G3WA 2DU9A 2VASA 4R1HA 4X1EA 4WK8F 4I0BA 2QBYB 1VQLI 1HSJA 4ZDOA 5D6FA 2LD5A 1HQCA 3BG9A 1P6RA 1T38A 4XORA 4ZTFA 2F5CA 2M7AA 3C18A 4HNTA 2KP6A 2QKLB 2L4MA 2MABA 3BG6A 3KP3A 4DBRA 1NK3P 2QZ8A 4MO7A 1U8RA 3S2WA 3ZMVA 3QRFF 1OQYA 1MDMA 4KFCA 2GOMA 3BR1A 2UUZA 5GTHC 3IWFA 2VT2A 1ETYA 3LA2A 1AOYA 3JR9A 3HSEA 4ZZLA 4ZJZA 1U3EM 2VT3A 2DMTA 1R5GA 2HS5A 5F1JA 4Y13A 1JXSA 2IW5A 2L7ZA 4E6KG 1R4NB 1A31A 1I39A 3NWTA 1BI3A 1MIJA 4RM2A 3W6KB 5E8GA 5B1AH 5M5YJ 2YR2A 2PJPA 3BG5A 4BHBA 1ETXA 2QQ8A 2XIGA 1U78A 1WJAA 2LKSA 1LE8A 2Y9ZA 2F5EA 3I59A 1U0JA 1T6SA 1USTA 3BJ6A 4JP0A 3H5AA 1FOWA 3O8GA 5EZGA 1HBXG 1TL8A 4XIDA 2K3FA 2KRHA 3FXKA 4AU7A 2CRGA 2PEXA 3A02A 1U9NA 1OYIA 3K4NA 4A6DA 1NK2P 1D0XA 1JUMA 2E35A 1LEAA 1MNMC 3J81Z 4LFUA 2CUFA 3HGGA 5A2QK 4BQAA 2X6OA 4XLFA 5IYCJ 2EV5A 4I09A 2Z2SB 4XMYA 5EF6A 1XCBA 3RZOJ 1HOMA 2EWNA 2PMUA 4HRIA 1W5TA 2ZJRF 1X4PA 2DDBA 3WG9A 2RAEA 1H9TA 1LUJB 5F27A 2CJJA 5IP9J 4CUGA 3ULQB 2LF8A 4XM3A 5BOXA 4UUVA 3DEWA 3RJPA 4V2FA 5FKOA 2ZMEB 2JRMA 3V7SA 1Y1VJ 1VQPI 2I5UA 3CDHA 1RETA 1PYVA 2K4JA 3ESWB 3GFMA 2VC0A 3DPTA 1R4MB 3SEQA 4QIWN 4LMYA 1AKHB 4I02A 3K2ZA 2OCEA 2EFQA 2J5OA 3BR5A 4XLPF 1KU9A 2Y0SA 5F08A 2KZGA 2VXZA 4BNCA 2D1HA 1FBSA 2L5QA 2ZNYA 4KITB 2HVRA 4A3EJ 5M5XJ 3RKYA 3CCUI 4E7IA 4MNUA 1B8IA 3IUOA 4NDLA 1WPKA 2NVQJ 4A93J 4ZYGA 5FRMA 2L2OA 1IC8A 3D5SC 4BXFA 1QZYA 2BV6A 1QA6A 2OTLI 2L4AA 3QPSA 2BZTA 3SZGA 3LFKA 2XAGA 2CQKA 3B02A 3BZ6A 5BMZA 4CCMA 4CO8A 1W7PD 2XUBA 2ZB9A 2HOEA 1S8NA 1FYMA 1TWGJ 2ID6A 3Q0VA 3JRFA 4IHYA 3FXRA 4DIQA 1TQIA 4EJUA 2L7MP 2GM4A 2BGCA 3WTXC 2V6CA 4D1QA 3HXLA 2HFHA 2NVTJ 3VSLA 3ZOBA 1X1AA 1T8IA 3SEZA 2CW8A 1U5TC 3CC2I 4LLGF 3F9KA 5CVVA 3CCRI 1APLC 2KZVA 1YX3A 3SYTA 1R49A 3OL4A 3P5JA 3FKJA 3KFWX 2K9QA 2B0LA 5TGTA 3ZP5A 1R1VA 2VL8A 3SQNA 4L18B 3AKZA 4CDGA 5IPAA 2F6CA 3ABKH 5CVRA 2AQFA 4Y52J 1H89C 1BI2A 1WSUA 1MGTA 4A6EA 2A3SA 1LVKA 2Z16A 2R7VA 2XV4S 1E17A 3MEXA 1EA3A 2GIZA 3W2WA 2LYCA 2E2HJ 1ULYA 2XPWA 4J01A 2FMLA 3GTOJ 4WF2A 1OR7C 4D0PA 1YIJI 1W5SA 3TMOA 3I55I 3CLOA 3G73A 3ZQGA 3DPLC 1P92A 4BQQA 3JREA 3PO3J 4LLLA 2CV1A 4PK4A 3DKYA 2HQ5A 3K69A 1RRJA 1SVOA 3HC7A 5FKNA 1GUUA 5D5UB 3OIQA 4BXXJ 1QRYA 1KZHA 2E1NA 1K61A 1ZR4A 2LMDA 2JRTA 4IL6C 3CP8A 2LREA 2DN0A 3OYJA 3LMMA 3U9GA 1O3TA 1HDPA 1TC3C 2H8RA 3E1SA 3HPHA 3KCCA 2R4GA 1IF1A 2EPFA 1SVMA 1GV5A 2N8GA 4A3CJ 5CJ9A 2E1CA 4A69C 4C3IJ 3OYDA 1JT0A 1IUYA 1JKOC 5C3EJ 4MTDA 4F55A 3COAC 1WKMA 2CWEA 1Z9CA 1TWAJ 1W7PA 2QYOA 2LOOA 1HDDC 4DQ2A 4LB5A 2JZYA 4UY8I 2VXDA 2LH9A 2F5DA 2L7KA 5LFAA 3G1OA 5B5EC 4AD9A 4IRGA 1YHQI 4XLAA 1O3SA 1XSDA 1T98A 4KIBA 4YRVA 2HDCA 3V8JA 3RPQA 4MEXF 3MN2A 4ZYEA 4F92B 3FX3A 4I98B 5J3LA 3Q0WA 3CDIA 4OIQF 3IAM2 3I71A 2XKPA 1B1BA 3PL8A 1VTNC 2ISZA 2L54A 3E5XA 1JI8A 3F22A 4CGZA 3BR3A 1RZ4A 4OU0A 2HTSA 2WV0A 1Y56A 3SZTA 3EETA 3ZQCA 3KP2A 5E1WA 3SDGA 3BTJA 2A69F 2FOWA 1OYWA 1A6IA 4HBLA 3QPTA 3GZNB 2VOPA 2KIQA 2B9SA 3QP5A 4I99C 5LHHA 2GA1A 1YS7A 1DU6A 5HDGA 1IGNA 2P81A 2ZFUA 3GTGJ 3DF8A 2FBKA 2DA1A 2P5KA 2F4OB 2VQHA 2PI0A 1N75A 3KLOA 4C2MJ 1QHHD 2DMNA 1G3YA 3GXOA 3CCJI 2JJ7A 4KIFA 1S9HA 1YW7A 4CZCA 3JTGA 2ZBKA 3ABUA 1IW7F 3FKIJ 2UZKA 4KISA 1G2HA 2AQEA 2BBYA 3OOUA 1N78A 3W6JB 2D45A 2VE8A 1G3SA 3RDIA 3T5XA 3GFIA 1F4KA 3NARA 2JA7J 5CKTA 2BVMA 1LFUP 4LJZF 1V54H 2GXGA 1XTAA 4BHCA 1ACIA 4Y7NJ 2DDAA 4HA8A 1MMGA 5IYBJ 2B63J 2EA4A 1ETWA 2FMYA 2ZMEA 2F4MB 1I27A 1ZG3A 5J8FA 3BTIA 3CD6I 1RKWA 1GVJA 3IP4B 5LD2C 2DYRH 5M3FJ 2IBDA 1BW6A 1IZ1A 2DTZA 2KRFA 3OYAA 4DW6A 2ELJA 3OYFA 5BNGA 3KZZA 1B72B 1K6YA 3GFLA 3VYSB 1RUNA 1ERDA 2MLGA 2DK8A 1R6RA 4A12A 3LSRA 1O7LA 1N25A 2NRAC 4BU2A 1KYZA 3SXYA 3ZQFA 3PFIA 1R5ID 1XG1A 2EH3A 4X0GA 4G12A 4I76A 4AIHA 2Q1ZB 3CCMI 2MD5A 3HDDA 1EH7A 2R5ZA 3OMYA 4YIFA 3R60A 3BQYA 5EGOA 2MH9A 4Q5SF 3HB9A 4EEFG 5DUIA 3M1EA 5J4YA 5K5QA 3HTUA 1OKRA 3A4CA 1CF7A 3ZMSA 2XROA 3ONQA 3BROA 3K4KA 5H6RA 3ASOH 4E7SA 2M8EA 3LSJA 1OCTC 1ETQA 3HRUA 2PJRB 5IT3A 3WTWC 5BPIA 1RR8C 2QWWA 4HLXA 4UV9A 2AS5F 2E34A 5JVTA 1OISA 1AWCA 2P7CB 5BQTA 1Y0UA 2V1DA 4LB6B 3DPUA 4RB1A 1R1UA 2Z3YA 2FBHA 1Z6RA 4B43A 3CESA 3BG3A 3GZ5A 4LLNA 4S0HB 2X9DA 4EM0B 3GWZA 3TW7A 2RVCA 5LGTA 2I10A 2W48A 2E2JJ 2WAQA 3ASNH 1DQUA 4RGXA 3QPLA 3IWZA 4EM1A 4A3KJ 3NAUA 2M9HA 3IHUA 1YRNB 2R7OA 2XF6A 2PN6A 4GXOA 4LG0B 1ZGJA 2M2EA 3L2CA 2VBYA 1TNTA 2XHKA 3IAS2 4AWXB 3CCEI 2AO9A 4II3A 5ERIA 4CZZA 2HVSA 1XB4A 3RPUD 1MD0A 2PG4A 3CCQI 4G6DA 2W84A 2XPVA 5B1BH 1B9MA 3LSGA 2VLAA 5DUKA 2ME0A 2VBWA 2VBXA 3EUKL 1RPWA 1MMDA 1UG2A 2Q0OA 3MCZA 2OQGA 5LEKA 3FXLA 4CCNA 2H6CA 4XSZF 4IQ4A 5JHFA 3KETA 4LG0A 2XVCA 2EIJH 3C2HA 5CVIA 1BL0A 2R0QC 3RQIA 1JUSA 1ZKGA 4BDZA 2VJJA 2WTEA 2DT5A 3IH3A 3CJRB 5K5OA 5L3DA 2IJLA 1IDZA 3CUQC 1BM9A 5EYRA 3OOPA 2XF7A 3HHHA 2Y0SN 2ZKZA 2HOTA 4P9UA 4A5MA 4IHXA 1PDNC 4G94A 4RA2A 5IP7J 3F0CA 1JKQC 1QVUA 1JHHA 3TP0A 1OMIA 4ZH4F 2GA2A 1IG7A 2DI3A 4E7JA 3I54A 2FSWA 3Q3SA 2FBIA 2RDPA 4Y3OA 4B44A 3K6GA 1ZK8A 4B8XA 2DOAA 4KJZA 1HCRA 3H5RA 4RB0A 2Y48A 5FJ8J 5F64A 5E3NA 2LFBA 1MBEA 1YW8A 1J59A 2STTA 5J1YA 3ZMZA 2H09A 4ZDLA 2XGEA 5HLTA 4IX7A 1LFBA 2NNYA 1RESA 2V1NA 4O6JA 2MH2A 2NNNA 2KIUA 4RAYA 4D5CA 3O8HA 3I64A 4OMZA 4PGGA 3VYRB 4Y15A 2HPIA 5A2QZ 1RKTA 3FZVA 5LLQA 4WXHA 2FD5A 4NC6A 2O61A 2TDXA 3LSHA 2V1UA 3V7CA 1SMTA 3OS1A 3QPHA 2IS1A 1GXQA 3FXMA 5J1RA 2KT0A 3L00A 1KGSA 1Z3YA 3R0JA 3VWBA 3JW4A 1JKPC 4M74A 2BXZA 3VSKA 2XGCA 3PIOF 2QSFX 2DW4A 3E5QA 2A5WA 3DTEA 1T0FA 2H27A 1R58A 2VJ4A 1FBQA 2XPUA 5FFZA 2Z5UA 2WY7Q 4II2A 1XGOA 3CCLI 3A01A 3D5RC 2LSOA 3PJRA 3R0AA 1JJ8C 2HKXA 4C2TA 2LP0A 3CCYA 5HS9A 3ML6A 5L3BA 2BHYA 3DBHB 2X6XA 4S04A 1X58A 4FHTA 5CPRB 1SAUA 2GBYA 3FF5A 2NS0A 2HOAA 5LRRA 4Q4ZF 1P4XA 2GWRA 4YG2F 3J7AY 2EFOA 4GCVA 3HL2A 2G7UA 1IN5A 4LIUA 1QVTA 4F3QA 2RGVA 4LITA 5IOZA 3A0HC 3C7JA 2TCTA 1P7JA 2Q2EA 3MZ8A 5KAFC 3GTMJ 2K9SA 3O3KA 1BJAA 1EH6A 4EGYA 5JI6A 3ZMUA 4X6AJ 1RI7A 1M1EB 4MFEA 2IA0A 1VQ4I 4N4OB 2DMQA 1A36A 1GLNA 1WZ2A 2QQBA 3QYEA 2R7DA 1ON1A 2HZDA 1YO5C 1FNNA 3BPVA 2RV8A 3A1YA 3OYLA 4UNOA 2HTJA 3LAPA 5CYVA 2AXLA 4L5IA 5EG0B 4NHJA 3PNYA 2JSPA 3L2UA 1SFXA 3JAMK 2R3SA 1I3AA 2H8WA 4KT5C 4W1UA 1X1DA 3VOEA 1AU7A 2HDDA 1QU3A 4CSWA 2DXIA 3GBGA 3DBLB 2BY3A 4WWCA 4AIJA 1ITYA 3I53A 3B73A 3TBIA 4Q48A 1JGGA 2X4HA 4YFXF 1HLVA 5F0CA 2XGDA 2DO7A 4CHUA 3H0GJ 4ETSA 2P5LC 3JRDA 4F52A 1GXPA 4M3BA 1TQPA 2RKHA 3DKXA 5BS6A 4L9TA 2KIFA 3OYGA 3S93A 3E6MA 4EJVA 2ZC2A 1MJAA 2M4GA 2OCCH 4CCKA 3KYLA 3S1RJ 4ABZA 1ORKA 4H4KC 3WGIA 2CQQA 4BBSJ 1I6HJ 2A68F 3W3CA 4RDUA 1TT5B 1WJFA 3I5UA 4ESJA 5DYMA 2OD5A 3MKZA 1X3WB 4NB5A 2EFWA 3I56I 3KIOA 5HLHA 4H0EA 2A6EF 2A5YB 1VZ0A 2PJRA 4NBQA 4AVPA 4QPQA 2Y30A 1W4MA 1Q1HA 2BY2A 4KIGA 2V26A 4BAYA 2XRLA 4M71A 1QGPA 1I6XA 3MZYA 1IO2A 3HSFA 1WFXA 1H8AC 3S14J 5DDGA 4ZYHA 2EZLA 5GAGJ 4IRIA 1ZG1A 3OYEA 4HV5A 1DUXC 2LKPA 2HYFA 2LLKA 4AIKA 2LY2A 4P55A 2E1MB 2DJIA 3AAFA 2KRCA 2DA2A 2ISYA 3OSGA 5TISC 3ERED 2GXBA 3H36A 4Z6YA 1ZN2A 1ETKA 4YFNF 4DYQA 5DCMB 3OSFA 4C9YA 3QYFA 1D5VA 4HF1A 2QEXI 3DEEA 2E71A 2V9PA 1BC7C 2VQLA 3KEQA 2HZTA 1ZR2A 2EJRA 2X1CA 4NUBA 2IP2A 4U7BA 1X4OA 2ETHA 1FP1D 2E1MC 4MQ9F 4OOIA 2FRHA 3PFYA 3TOAA 1OFCX 3J7YJ 5C4JJ 2Q2EB 2HPMA 5CVUA 3H3VK 4AIDA 5J8CA 1LDKB 3PO2J 4BBRJ 3U21A 4I2OA 1Z21A 2ZFWA 1F9NA 1LEBA 1D1CA 4N9IA 1DGRM 3ZMDA 1EH8A 2JN6A 2O8KA 2MD0A 2HI3A 1KQ8A 2JVHA 4XICA 2FOKA 2NS8A 2Z1DA 3BQZA 3L2QA 2EIMH 1MBGA 4EGZA 1HA8A 3HUGA 4F93B 1RC9A 3CQZJ 4IHWA 3RCOA 2MSYA 2MFZA 4JBAA 2Y9YA 2LTPA 2PMZA 4YFKF 4GDFA 2VB6A 5J40A 2CH0A 2GLOA 2XDVA 4HDUA 3DQVC 4L5JA 2ZJ2A 4CYCB 1W5CC 1TZLA 4MTEA 2EFNA 4WXDA 1FLIA 3SJMA 1WWXA 3CUQA 4CCLA 4U87A 1Z05A 2IGMA 3TO7A 2E7WA 1NG6A 1LDDA 2G7HA 5GAEJ 3KEYA 3TDZC 1Z91A 5EGOB 3H9GA 2F2EA 3B6CA 1LJ9A 1MBJA 4HAMA 1UHMA 2CW0F 1RIOH 3QQAA 2LKXA 3HSRA 2KHMA 1XC5A 1VQNI 1X3ZB 4KDPA 1BC8C 3DKWA 2QA4I 1A35A 4EJWA 1SFUA 2E2IJ 1I1GA 3FBIB 2XSJC 4DZPA 2ID3A 2P4WA 2L01A 2DPUA 3SFZA 2W24A 3WU1B 3FK7A 3WE3A 5D4SA 4ZZDA 2ELHA 4A3JJ 2CFXA 1GDTA 2CV2A 3WTSC 3VYUB 3J81K 3E7LA 4U0YA 1S3JA 1IRGA 3ZN1A 2F48A 3HG9A 3HPGA 2JK3A 4A3LJ 2DLLA 4UVCA 3AL0C 2E5ZA 4XOPA 1XDUA 3H92A 2E19A 1DPRA 3GX4X 3OV8A 2WAFA 3GTJJ 4ZYAA 3CLQA 2CU7A 4P1WA 1MNEA 4DBQA 1MSEC 2QF7A 4G7HF 4YEJA 2F5VA 4LOCA 4XK4A 2QSGX 1QHGA 5IT9Z 2AHQA 2HDWA 3V42A 4FE4A 3K1PA 1JE8A 4M3DA 2JTVA 2CO5A 2RNJA 4BE2A 5ICGA 2ECCA 2TRTA 2D2WA 5IP6A 3EYYA 2ACJA 3OYBA 1XSVA 5GPCA 1GHCA 1MDMB 3KZYA 1EKEA 2DQRA 4BJTA 3O2PE 2K9LA 3HRSA 3JTHA 2D1VA 1HF0A 2OBPA 1A5JA 4MQVA 3HJEA 1H88C 4GO1A 3DV8A 4UUSB 2O9LA 3ZQHA 3V4GA 5TRDA 2DA7A 1T0FC 1BI1A 2LR8A 1UB9A 1QBJA 1E2XA 4BUPA 4EJOA 1VF9A 3GO5A 2H6BA 3UKGA 1X3UA 3ZMTA 1N77A 1IN6A 2HGCA 2F5FA 2WC2A 1W36D 2VONA 1D1BA 1IXSB 1TNSA 1IUFA 2A61A 1E0EA 5E1XA 5H20A 5HNHA 3FHZA 4XLNF 4IHSA 5DV5A 1SFEA 2ZJQF 3NQOA 3BOQA 1SANA 2F4IA 3G1LA 2CQXA 2E60A 1RUOA 4IOCF 2R7FA 3H9QA 4XBFA 4J00A 1QNTA 2ZJPF 1LQ1A 1AHDP 3A0BC 1YJ9I 4V19K 1Z67A 3DCFA 2VPRA 4IXAA 1SEUA 1RR7A 1USSA 1R5HA 3R61A 4M9XA 5L3CA 2LC2A 3MKLA 4HQMA 1BW5A 1Z0XA 2GZWA 4U7DA 1SD7A 3KZIC 3I4MJ 3KPHA 4B47A 2EILH 3CZ6A 2OZUA 4Y17A 1R1TA 4C30A 4IO9F 4ZC3A 3TO9A 3Q0UA 3BP8A 3MMYB 3LSKA 3LA3A 3PNVA 5J47A 1XMXA 3PSIA 4NC8A 1P4AA 1X1BA 1ZARA 2KIMA 2W82A 5IYDJ 3D0SA 2Z99A 3NEUA 1NG7A 5E20A 1QZEA 2LF7A 3CF5F 3WTTC 4E4HA 2DA6A 4ENKA 4DJAA 3K9TA 2NVUB 2QQAA 5B3SH 3S3OA 5EJCA 5FRNA 1P4WA 4C3JJ 3LQQA 5F0FA 5LHIA 1J7KA 4NNJA 2DBBA 5ICEA 2FUG2 3HOYJ 1ZELA 4JX4A 2ZXIA 3M8JA 3MD2A 4B48A 2IAIA 3KLNA 1ENHA 1HKTA 2EZHA 3CCVI 3DXJF 2WAQN 3CDLA 3BR6A 3EQLF 2LDUA 2FXAA 4A0YA 2EZKA 2RQQA 2WY8Q 1S7OA 4B3XA 1WCMJ 1S5LC 3C1DA 4FX0A 4KNYA 1P9QC 3RQ4A 3F23A 4OIPF 4PZJA 3TW6A 3K4MA 3M7GA 3RIRA 1D0YA 2L9NA 3HOUJ 1SD5A 1TT0A 1VQOI 2MW8A 2PLYA 2O3FA 5IY5H 1WVRA 4R79A 4QSHA 3K70C 2K86A 3M9AA 1WQ2A 4PGHA 5D8LB 3L09A 5HDNA 2VODA 4QTRA 5CLSA 1BR4A 1YOVB 1Y8QB 1KA8A 3DU6A 3WU2C 2JQ7A 3GTLJ 2OF7A 3G2BA 3WTYC 5GAHJ 3VEPA 1STZA 3J80K 5F04A 2GQQA 1TP4A 2OU2A 2IS2A 4I0AA 4A0XA 1ZREA 1SD6A 1MH4A 1J5YA 1IXRC 3U1KA 2FE3A 4XRSA 2M87A 1BR2A 3BPXA 2FF4A 2R7WA 1S72I 2COMA 1R23A 5FLMJ 1A04A 2IVMA 4U0VA 2E1OA 4OWRB 5KK1A 4L0ZB 4HDVA 3ABLH 2W25A 3R4KA 3CMEI 1Y39A 4KYWA 1U5TB 3HOVJ 5K5RA 4MFDA 3TL4X 4XONA 1WJBA 4D5FA 5DM7F 1YX5A 1VNDA 1OJLA 1LDJA 4BYYA 2NVXJ 2M7BA 1MH3A 4XRSG 4YIRX 3HGYA 2VQCA 2KJBA 1LNWA 4XL9A 3HBLA 4Y33A 2LY1A 1B6AA 3WU0A 4D7NA 5ICCA 3QOPA 3ZQ7A 4FASD 2M5WA 5KHDA 3DBRB 2BVLA 3RKWA 4M9ZA 3A2KA 4BQOA 4F91B 5L3EA 3GUDA 3G6EI 4KT6A 4AVZA 2X0LA 1J2XA 1KQ0A 5HLGA 2DOFA 4P5OA 4BJ5C 2VJIA 1IAWA 3OS0A 1K83J 1UG0A 1WJ5A 3AG4H 4FISA 4JOMA 1O3RA 4EVIA 2L7FP 4KN4X 2M34A 2LK2A 3AL0B 2DTRA 3JRCA 4XKWA 3J80Z 1BOBA 1J9IA 5DS9A 1ZRCA 4NC7A 1BIBA 1U8BA 3Q9SA 4JK1X 4OIRF 4RS8A 1KU3A 1XN7A 2P6TA 3FWEA 2IS6A 1X1CA 4RGRA 1PUFB 2RN7A 3CC4I 2Z9OA 3F6OA 3G71I 2IT0A 4MIMA 1G3TA 3HOXJ 5H2FC 1T08B 2LG4A 3J7ZI 3G4SI 1J75A 1FJLA 2BXYA 1R71A 3DFGA 1Y1WJ 5L3GA 4M6XA 3H5NA 4ANJA 2HQRA 2L0KA 3BZCA 4BEHA 5LHGA 2KQRA 1CF7B 9ANTA 1ETVA 2WB1N 4AYBN 3K0LA 3F21A 3O6BB 2L9VA 2M4KA 2OAZA 1QPIA 4FTHA 1UHWA 3T0YA 3F8BA 3FXQA 2GOXB 5EDNA 1G6NA 2BW3A 5FKLA 3TEDA 2P5VA 3LSTA 2LVSA 3K2AA 4ESBA 1W1WE 1C0WA 1MBFA 1ONVA 2CUJA 3G1MA 5ILSA 4A5NA 4XKCA 1P7IA 2JWTA 2COBA 2LBFA 1BIAA 2MC4A 3PUFA 3HHGA 2KISA 1D3YA 1WGXA 3RYPA 2ZCWA 3BJOA 2ZXJA 3AFHA 1K4SA 4OAYA 2JT1A 2L3DA 3S3MA 6PAXA 3FM3A 2MA3A 3GTPJ 2KLOA 4HPQA 3TKYA 4XRMA 1VI0A 3CP2A 2R7XA 3GTQJ 3ERMA 4AM3A 3S32A 2IEKA 2M8GX 1MMNA 1Z6TA 3ISPA 3LA7A 1FSEA 4TV7A 3JSOA 1I5ZA 1FIAA 1W0TA 3GF2A 1FYLA 1ON2A 3GCMA 4BKXA 5LRSA 4LG3A 1FIPA 4G9YA 3ZGKA 2CMPA 3J7AO 4M6YA 3VPRA 1FMWA 2IRFG 2V4JC 3ZQQA 3EUHA 2VN2A 4HF0A 1S6LA 5AONA 4G7OF 4BDYA 4DYCA 1KU7A 2W4SA 2QLZA 1YS6A 3BT9A 2P6SA 2DFIA 3S1QJ 2I8DA 1R36A 2X1EA 2EB7A 3E6BA 1ETOA 3FMSA 5JR3A 2VC1A 1YJNI 1FP2A 1LKXA 4ASNA 3VYTB 5E17F 4CH7A 2JPCA 2QM3A 2NAZA 2DA4A 3I9V2 2VKEA 3WODF 5ILUA 2LY9A 1MBKA 4UV8A 5J4VA 3P9CA 4M3GA 1D1AA 1UMQA 4FX4A 3TO6A 2NOGA 1EF4A 2FQ3A 5JLXA
chains in the Genus database with same CATH topology
4LGWA 2O0YA 3D5LA 4ZYDA 5E8IA 3Q5FA 3HYIA 4A0ZA 3KE2A 2MBFA 5HDKA 2HQNA 3HIFA 5HVQC 2PQ8A 4HOBA 1O7FA 3KP7A 5FLXZ 2KJCA 3F72A 4N9HA 2M30A 1Z1DA 1YYVA 1QQIA 3T1BA 2IA1A 5HS7A 1OPCA 2XGXA 3U1DA 1BOAA 4FT8A 2ESHA 1DDNA 4UXNA 1HW1A 4ENJA 3IKVA 2V79A 3JSPA 3WTZA 1K78B 4QWQA 2UXNA 3I4PA 3MQ0A 4LD5A 5J6XA 4IRHA 4EM2A 3DP7A 2BE5F 2STWA 2HEOA 2O6GE 1RNLA 4OIOF 4WX9A 3DEUA 1BBYA 5CVJA 5FD5A 1FWZA 1SMYF 3U2RA 3F8FA 1ZYRF 4Q47A 4E70A 4BHPA 4P96A 5LGNA 1K7AA 3GEZA 1JGSA 3GVAA 2YSRA 2E7XA 2DK5A 2Y75A 5FO5A 1HW2A 4O5VA 1MJ9A 2IA2A 1YW9A 2Y0MA 4KICA 2VBZA 2HR3A 1IN8A 2W85A 1TTYA 4WCGA 1G4DA 2A07F 4KUMA 2M45A 1BN5A 2OQRA 4EV0A 2UWMA 3I58A 4UVAA 3GLXA 2MLKA 2HKOA 3WGGA 2ZO4A 2H94A 2HWVA 4IF4A 5D6EA 4I01A 4IJAA 5LEJA 4LK1F 4MGRA 4GYGA 2DAOA 2QBYA 4GYIA 5FLXK 1D8KA 5D5XB 1TW3A 3PQKA 4UVBA 3CJNA 2K02A 4O3MA 5E1ZB 3CO7C 1YTYA 2JSCA 1D8JA 4F7ZA 3FMQA 4HQEA 5FGMA 3F8NA 3FXUA 3IC7A 3HOTA 5DCFA 4YIIA 3R6SA 4L9JA 4HZFA 3FM5A 3VB2A 5LGUA 3GZ6A 2QVOA 1QPMA 1CGPA 1XGNA 1SD4A 1R00A 4G6QA 1R7JA 3K1MA 4HV6A 1YFHA 1T2KA 4RB2C 2K4BA 4HW0A 3IRRA 4QLCU 3M8EA 4RGUA 1FYKA 2QENA 3QP6A 5EEHA 3I59B 2J5PA 2QQ9A 3T8RA 3TGNA 4U88A 4LK0F 2DQLA 2RQPA 1B4AA 3ELKA 3V7RA 3TOBA 1F5TA 1LVAA 3KEOA 3MWMA 5HOOA 3CO6C 5F6FA 4L9VA 3H3ZA 4HLYA 1XDSA 4S05A 3BY6A 1Z7UA 3EDPA 4BXUA 2CYYA 3P7NA 1DPUA 4HYEA 2A6HF 2YX7A 3G3ZA 4U0WA 2L02A 2GAUA 3HTSB 1HXDA 1O57A 3NRVA 4M73A 3L9FA 2FU4A 1XMKA 1ZLJA 1XMAA 2VE9A 3RKXA 1FX7A 2G9WA 3VODA 1KQ9A 1HKSA 4IPAA 2WWYA 4RAZA 1MZBA 4ON0A 1U5TA 2XAHA 3GYHX 2XASA 1L3LA 1TBXA 1FZPB 5FD6A 3V8KA 1SAXA 5JHUA 3E6CC 3BDDA 3Q9VA 4OMYA 1KYWA 3E5UA 2ADUA 2XAJA 1NHAA 4DNCA 4RGSA 4N0BA 5L3FA 4KMUX 1JHFA 1OR7A 1FPQA 1YIOA 1IXCA 2VOOA 5FFXA 4UHTA 2PBIA 2FNPA 1UFMA 3SHFA 5JFRA 2FNAA 1K6OA 3MFKA 3N97A 1PUEE 5D5WB 2O03A 1R22A 3K1NA 2DPDA 1PP8F 1YLFA 2XKOA 3FMRA 5ICFA 1IN7A 3PQJA 4CYDA 5K1YA 4OINF 2Z33A 4EMSA 5ILVA 4XRFA 1DP7P 1FC3A 3WTUC 4R8HA 5ED4A 3F8CA 1ZRDA 2PMHA 5EEGA 3I0TA 3TDUC 3RYRA 2EV0A 4B09A 4CICA 2MC3A 4P9FA 2K27A 4WXCA 3ZN0A 3BJAA 3H3UA 2BEOA 4BH9A 2ZNZA 4ESFA 1T39A 5DCMA 4HX7A 3HRMA 2KKOA 1IN4A 5E18F 4PCQA 1MJBA 3LQRA 1FY7A 2YX4A 5DEQA 1OYYA 3BWGA 3N4MA 4M72A 3RTRA 2RC4A 1HKQA 1HSTA 1S7AA 3M8FA 1H9GA 1ZAOA 4JQFA 4I7HA 3QU3A 3IRQA 3KP6A 1ZGAA 3CTAA 2CG4A 3T8TA 3F3XA 1UCRA 2IPQX 2K7LA 2EA2A 1H0MA 2P8TA 2V1XA 3GW2A 3KP4A 1V3FA 1I1SA 1XGSA 1YG2A 1K78A 2FEZA 4ENMA 3E6DA 4G7ZF 2Q8KA 1FSHA 3REOA 4KN7X 1F1ZA 5D8KB 3LWFA 4NQWA 3F8MA 2YU3A 1FOKA 3JAMZ 1REPC 4IVNA 3CUOA 4MEYF 1IRFA 1B59A 1L0OC 1BI0A 2BYVE 3CUQB 2XAQA 2JPBA 4HF2A 1S29A 3IL2A 1XGMA 2XAFA 4KMFA 1O3QA 3ZPLA 4EQQA 4L9NA 4M9SA 4KA4A 3MZHA 1HW5A 2CGPA 1QZZA 5D5VB 3TQNA 3KP5A 2C6YA 1TQMA 1FBUA 1P2FA 2GIVA 1J0RA 4XSXF 3MAJA 3GFJA 4ENNA 5FB2A 2YPRA 5H6QA 3QAHA 2W57A 3P9KA 4G8XA 1XD7A 3EYIA 2EK5A 4EJTA 5KVRA 3C3WA 1ODDA 2O8XA 1MKMA 2PFBA 1ZHFA 4HX8A 5DD4A 3RI4A 2LNBA 4GGGA 2V9VA 4RB3C 2P7VB 1QO0D 5TJJA 4A2UA 3ABTA 5AIPA 4CXFA 1ZG5A 5IT9K 2OZ6A 3L7WA 2UXXA 4L0YB 2OA4A 2NYXA 3HOSA 1XSXA 1YQAA 3F6VA 2CSOA 2FA5A 3P9IA 4PDKA 4HX4A 5LBQA 1ZRFA 1LB2A 4K2EA 4Z2YA 1W7PB 1EV7A 3VFZA 2XRNA 5AIQA 2HYGD 1ZLKA 1TLHB 3ROUA 1KU2A 1B9NA 5HLIA 3LAJA 5BPDA 1TW2A 3HRTA 3ECOA 1WRJA 1V4RA 3QU6A 1FT9A 3SZPA 1K79A 3WGHA 4MHGA 2M1BA 3WTVC 3IKTA 1ZH5A 1XCVA 1U2WA 1U6GA 3WE2A 3E97A 5HS8A 3E3VA 4IHTA 2EFPA 5F1RA 5D4RA 2EV6A 1WI9A 3RPUA 2ESNA 3V8LA 5DD8A 1PP7U 2QUFA 3ECHA 1G3WA 2DU9A 4R1HA 4WK8F 4I0BA 2QBYB 1HSJA 5D6FA 1HQCA 1P6RA 1T38A 2F5CA 3C18A 2L4MA 3KP3A 2QZ8A 1U8RA 3S2WA 3ZMVA 3QRFF 1MDMA 4KFCA 3IWFA 2VT2A 3LA2A 1AOYA 3HSEA 4ZZLA 1U3EM 2VT3A 1R5GA 2HS5A 4Y13A 1JXSA 2IW5A 1BI3A 3W6KB 5E8GA 2YR2A 2PJPA 4BHBA 2XIGA 1U78A 2F5EA 3I59A 3BJ6A 1T6SA 1USTA 1HBXG 2PEXA 1OYIA 4A6DA 1LEAA 3J81Z 4LFUA 5A2QK 4BQAA 2EV5A 4I09A 1XCBA 2EWNA 2PMUA 1W5TA 3WG9A 1H9TA 3ULQB 2LF8A 5BOXA 4UUVA 3RJPA 3V7SA 2ZMEB 3CDHA 2K4JA 3GFMA 2VC0A 3DPTA 4LMYA 4I02A 3K2ZA 2EFQA 2J5OA 4XLPF 1KU9A 2VXZA 4BNCA 2D1HA 1FBSA 2ZNYA 3RKYA 4MNUA 4ZYGA 1QZYA 2BV6A 2L4AA 3LFKA 2XAGA 2CQKA 3B02A 3BZ6A 5BMZA 4CO8A 1W7PD 2XUBA 2HOEA 1S8NA 1FYMA 3FXRA 1TQIA 4EJUA 2BGCA 3WTXC 2V6CA 2HFHA 1U5TC 4LLGF 5CVVA 3KFWX 3ZP5A 2B0LA 4L18B 1R1VA 3SQNA 4CDGA 5CVRA 1WSUA 1BI2A 1MGTA 4A6EA 2A3SA 1E17A 2XV4S 3MEXA 1ULYA 2FMLA 4WF2A 4D0PA 1W5SA 3CLOA 3G73A 3DPLC 1P92A 4LLLA 3K69A 5D5UB 2E1NA 2JRTA 3U9GA 1O3TA 3KCCA 1IF1A 5CJ9A 2E1CA 1IUYA 4MTDA 3COAC 1WKMA 2CWEA 1Z9CA 1W7PA 2QYOA 4DQ2A 4LB5A 2JZYA 2F5DA 4AD9A 4IRGA 1O3SA 1XSDA 1T98A 4KIBA 2HDCA 3V8JA 3RPQA 4MEXF 4ZYEA 3FX3A 4I98B 4OIQF 3I71A 2XKPA 1B1BA 1VTNC 2ISZA 2L54A 3E5XA 3F22A 4CGZA 1RZ4A 4OU0A 2HTSA 2WV0A 3SZTA 3EETA 3KP2A 5E1WA 2A69F 1OYWA 4HBLA 3QPTA 2VOPA 3QP5A 5LHHA 2GA1A 1YS7A 5HDGA 3DF8A 2FBKA 2P5KA 2PI0A 3KLOA 1G3YA 3GXOA 4KIFA 1YW7A 3JTGA 2ZBKA 3ABUA 1IW7F 2UZKA 2BBYA 3W6JB 2D45A 2VE8A 1G3SA 3RDIA 3T5XA 3GFIA 1F4KA 4LJZF 2GXGA 4BHCA 4HA8A 2EA4A 2FMYA 2ZMEA 1I27A 1ZG3A 5J8FA 1GVJA 2KRFA 1IZ1A 3KZZA 3GFLA 1RUNA 2MLGA 2DK8A 4A12A 1O7LA 2NRAC 1KYZA 3SXYA 3PFIA 4AIHA 2MD5A 1EH7A 4YIFA 3R60A 2MH9A 4Q5SF 5DUIA 3M1EA 5K5QA 3HTUA 1OKRA 1CF7A 3ZMSA 2XROA 3BROA 5H6RA 2M8EA 3HRUA 5IT3A 3WTWC 5BPIA 2QWWA 4HLXA 4UV9A 2AS5F 5JVTA 1AWCA 2P7CB 5BQTA 1Y0UA 2V1DA 4LB6B 4RB1A 1R1UA 2Z3YA 2FBHA 1Z6RA 3GZ5A 4LLNA 4EM0B 3GWZA 5LGTA 2RVCA 4RGXA 3IWZA 4EM1A 3IHUA 2PN6A 4GXOA 4LG0B 3L2CA 1ZGJA 2VBYA 1TNTA 2XHKA 4AWXB 5ERIA 4CZZA 1XB4A 1MD0A 2PG4A 4G6DA 2W84A 1B9MA 5DUKA 2VBWA 2VBXA 2Q0OA 3MCZA 2OQGA 5LEKA 2H6CA 4XSZF 3KETA 4LG0A 2XVCA 5CVIA 2WTEA 2DT5A 5K5OA 5L3DA 2IJLA 3CUQC 1BM9A 3OOPA 3HHHA 2ZKZA 4P9UA 4A5MA 1PDNC 4G94A 1JHHA 1OMIA 4ZH4F 2GA2A 2DI3A 3I54A 2FSWA 2FBIA 2RDPA 4B8XA 4RB0A 2Y48A 5F64A 1YW8A 1J59A 2STTA 3ZMZA 2H09A 2NNYA 4O6JA 2MH2A 2NNNA 2KIUA 4RAYA 3I64A 4OMZA 4PGGA 4Y15A 5A2QZ 3FZVA 5LLQA 4WXHA 2O61A 2TDXA 2V1UA 3V7CA 1SMTA 3QPHA 1GXQA 3L00A 1KGSA 3R0JA 3JW4A 4M74A 2DW4A 3E5QA 1T0FA 2H27A 1R58A 1FBQA 5FFZA 2Z5UA 1XGOA 2LSOA 3R0AA 2HKXA 5HS9A 3ML6A 5L3BA 4S04A 4FHTA 3FF5A 2NS0A 5LRRA 4Q4ZF 1P4XA 2GWRA 4YG2F 2EFOA 4GCVA 2G7UA 1IN5A 2RGVA 3C7JA 2Q2EA 3O3KA 1BJAA 1EH6A 4EGYA 5JI6A 3ZMUA 1RI7A 2IA0A 2QQBA 2R7DA 1ON1A 1YO5C 1FNNA 3BPVA 2RV8A 4UNOA 2HTJA 3LAPA 5CYVA 2AXLA 4L5IA 4NHJA 1SFXA 3JAMK 2R3SA 4KT5C 3VOEA 4WWCA 4AIJA 3I53A 3B73A 4Q48A 2X4HA 4YFXF 2DO7A 4CHUA 4ETSA 2P5LC 1GXPA 1TQPA 2RKHA 5BS6A 4L9TA 2KIFA 3E6MA 4EJVA 1MJAA 3WGIA 2A68F 3I5UA 4ESJA 5DYMA 2OD5A 2EFWA 4NB5A 5HLHA 4H0EA 2A6EF 2A5YB 4AVPA 1W4MA 1Q1HA 4KIGA 4BAYA 4M71A 1QGPA 1I6XA 3MZYA 3HSFA 5DDGA 4ZYHA 4IRIA 1ZG1A 4HV5A 1DUXC 2LKPA 2HYFA 4AIKA 4P55A 3AAFA 2ISYA 3ERED 2GXBA 1ZN2A 4YFNF 5DCMB 1D5VA 4HF1A 1BC7C 3KEQA 2HZTA 2EJRA 2IP2A 4U7BA 2ETHA 1FP1D 3TOAA 4MQ9F 4OOIA 2FRHA 5CVUA 5J8CA 1LDKB 4I2OA 2ZFWA 1F9NA 1LEBA 4N9IA 3ZMDA 1EH8A 1KQ8A 2FOKA 4EGZA 3HUGA 4JBAA 4YFKF 4HDUA 3DQVC 4L5JA 2ZJ2A 4MTEA 2EFNA 4WXDA 1FLIA 1WWXA 3CUQA 1Z05A 3TO7A 2E7WA 1LDDA 2G7HA 3TDZC 1Z91A 2F2EA 1LJ9A 4HAMA 1UHMA 2CW0F 1RIOH 3HSRA 4KDPA 1BC8C 3DKWA 4EJWA 1SFUA 1I1GA 2P4WA 2L01A 2DPUA 3SFZA 2W24A 3WU1B 3WE3A 5D4SA 4ZZDA 2ELHA 2CFXA 3WTSC 3J81K 4U0YA 1S3JA 1IRGA 3ZN1A 2DLLA 4UVCA 1XDUA 3H92A 1DPRA 3GX4X 3OV8A 4G7HF 5IT9Z 3K1PA 1JE8A 2JTVA 2CO5A 2RNJA 5ICGA 2D2WA 2ACJA 3EYYA 1XSVA 1GHCA 1MDMB 3KZYA 2DQRA 3O2PE 3HRSA 3JTHA 2D1VA 2OBPA 4MQVA 4GO1A 3DV8A 3V4GA 5TRDA 1BI1A 1UB9A 1QBJA 1E2XA 4EJOA 3GO5A 2H6BA 1X3UA 3ZMTA 1IN6A 2HGCA 2F5FA 2WC2A 2VONA 1IXSB 1TNSA 2A61A 5E1XA 5H20A 3FHZA 4XLNF 4IHSA 5DV5A 1SFEA 3NQOA 3BOQA 1RUOA 2R7FA 4XBFA 1QNTA 1LQ1A 4IXAA 1USSA 1R5HA 3R61A 4M9XA 5L3CA 4HQMA 2GZWA 4U7DA 1SD7A 2OZUA 4Y17A 1R1TA 3TO9A 3BP8A 3LA3A 1P4AA 1ZARA 2KIMA 3D0SA 2Z99A 3NEUA 5E20A 2LF7A 3WTTC 4ENKA 3K9TA 2QQAA 1P4WA 3LQQA 5LHIA 1J7KA 2DBBA 5ICEA 3KLNA 1HKTA 3DXJF 3EQLF 2LDUA 2FXAA 4A0YA 1S7OA 3C1DA 4FX0A 4KNYA 3F23A 4OIPF 4PZJA 3RIRA 3M7GA 1SD5A 2PLYA 2O3FA 4R79A 2K86A 3M9AA 1WQ2A 4PGHA 5D8LB 3L09A 5HDNA 2VODA 5CLSA 1KA8A 3WTYC 3VEPA 1STZA 3J80K 2GQQA 2OU2A 4I0AA 4A0XA 1ZREA 1SD6A 1J5YA 1IXRC 2FE3A 2M87A 3BPXA 2FF4A 2COMA 1R23A 1A04A 2IVMA 4U0VA 5KK1A 4L0ZB 4HDVA 2W25A 3R4KA 4KYWA 1U5TB 5K5RA 1LDJA 4BYYA 2KJBA 1LNWA 1B6AA 3WU0A 5ICCA 3QOPA 3ZQ7A 2M5WA 3RKWA 4M9ZA 5L3EA 3GUDA 2X0LA 1J2XA 1KQ0A 5HLGA 4P5OA 1IAWA 1O3RA 4EVIA 4KN4X 2DTRA 3J80Z 1J9IA 1ZRCA 1BIBA 3Q9SA 4JK1X 4OIRF 4RS8A 1KU3A 1XN7A 2P6TA 3FWEA 4RGRA 2RN7A 2Z9OA 3F6OA 2IT0A 1G3TA 1J75A 3DFGA 5L3GA 4M6XA 2HQRA 5LHGA 1CF7B 3F21A 3K0LA 3O6BB 2OAZA 1UHWA 3T0YA 3F8BA 3FXQA 1G6NA 2P5VA 3LSTA 4ESBA 1C0WA 1ONVA 5ILSA 4A5NA 1BIAA 3HHGA 1D3YA 3RYPA 2ZCWA 3BJOA 2ZXJA 2JT1A 2L3DA 6PAXA 3FM3A 2MA3A 3TKYA 3ISPA 3LA7A 4TV7A 1Z6TA 3JSOA 1FSEA 1I5ZA 3GF2A 1FYLA 1ON2A 5LRSA 4G9YA 3J7AO 4M6YA 2IRFG 3EUHA 2VN2A 4HF0A 1S6LA 5AONA 4G7OF 1KU7A 2QLZA 1YS6A 2P6SA 2DFIA 1R36A 2EB7A 3E6BA 3FMSA 5JR3A 2VC1A 1FP2A 4ASNA 5E17F 2JPCA 2QM3A 2NAZA 3WODF 5ILUA 4UV8A 3P9CA 4FX4A 3TO6A 2FQ3A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4LGW A;  2O0Y A;  3D5L A;  4ZYD A;  5E8I A;  3Q5F A;  3HYI A;  4A0Z A;  3KE2 A;  2MBF A;  5HDK A;  2HQN A;  3HIF A;  5HVQ C;  2PQ8 A;  4HOB A;  1O7F A;  3KP7 A;  5FLX Z;  2KJC A;  3F72 A;  4N9H A;  2M30 A;  1Z1D A;  1YYV A;  1QQI A;  3T1B A;  2IA1 A;  5HS7 A;  1OPC A;  2XGX A;  3U1D A;  1BOA A;  4FT8 A;  2ESH A;  1DDN A;  4UXN A;  1HW1 A;  4ENJ A;  3IKV A;  2V79 A;  3JSP A;  3WTZ A;  1K78 B;  4QWQ A;  2UXN A;  3I4P A;  3MQ0 A;  4LD5 A;  5J6X A;  4IRH A;  4EM2 A;  3DP7 A;  2BE5 F;  2STW A;  2HEO A;  2O6G E;  1RNL A;  4OIO F;  4WX9 A;  3DEU A;  1BBY A;  5CVJ A;  5FD5 A;  1FWZ A;  1SMY F;  3U2R A;  3F8F A;  1ZYR F;  4Q47 A;  4E70 A;  4BHP A;  4P96 A;  5LGN A;  1K7A A;  3GEZ A;  1JGS A;  3GVA A;  2YSR A;  2E7X A;  2DK5 A;  2Y75 A;  5FO5 A;  1HW2 A;  4O5V A;  1MJ9 A;  2IA2 A;  1YW9 A;  2Y0M A;  4KIC A;  2VBZ A;  2HR3 A;  1IN8 A;  2W85 A;  1TTY A;  4WCG A;  1G4D A;  2A07 F;  4KUM A;  2M45 A;  1BN5 A;  2OQR A;  4EV0 A;  2UWM A;  3I58 A;  4UVA A;  3GLX A;  2MLK A;  2HKO A;  3WGG A;  2ZO4 A;  2H94 A;  2HWV A;  4IF4 A;  5D6E A;  4I01 A;  4IJA A;  5LEJ A;  4LK1 F;  4MGR A;  4GYG A;  2DAO A;  2QBY A;  4GYI A;  5FLX K;  1D8K A;  5D5X B;  1TW3 A;  3PQK A;  4UVB A;  3CJN A;  2K02 A;  4O3M A;  5E1Z B;  3CO7 C;  1YTY A;  2JSC A;  1D8J A;  4F7Z A;  3FMQ A;  4HQE A;  5FGM A;  3F8N A;  3FXU A;  3IC7 A;  3HOT A;  5DCF A;  4YII A;  3R6S A;  4L9J A;  4HZF A;  3FM5 A;  3VB2 A;  5LGU A;  3GZ6 A;  2QVO A;  1QPM A;  1CGP A;  1XGN A;  1SD4 A;  1R00 A;  4G6Q A;  1R7J A;  3K1M A;  4HV6 A;  1YFH A;  1T2K A;  4RB2 C;  2K4B A;  4HW0 A;  3IRR A;  4QLC U;  3M8E A;  4RGU A;  1FYK A;  2QEN A;  3QP6 A;  5EEH A;  3I59 B;  2J5P A;  2QQ9 A;  3T8R A;  3TGN A;  4U88 A;  4LK0 F;  2DQL A;  2RQP A;  1B4A A;  3ELK A;  3V7R A;  3TOB A;  1F5T A;  1LVA A;  3KEO A;  3MWM A;  5HOO A;  3CO6 C;  5F6F A;  4L9V A;  3H3Z A;  4HLY A;  1XDS A;  4S05 A;  3BY6 A;  1Z7U A;  3EDP A;  4BXU A;  2CYY A;  3P7N A;  1DPU A;  4HYE A;  2A6H F;  2YX7 A;  3G3Z A;  4U0W A;  2L02 A;  2GAU A;  3HTS B;  1HXD A;  1O57 A;  3NRV A;  4M73 A;  3L9F A;  2FU4 A;  1XMK A;  1ZLJ A;  1XMA A;  2VE9 A;  3RKX A;  1FX7 A;  2G9W A;  3VOD A;  1KQ9 A;  1HKS A;  4IPA A;  2WWY A;  4RAZ A;  1MZB A;  4ON0 A;  1U5T A;  2XAH A;  3GYH X;  2XAS A;  1L3L A;  1TBX A;  1FZP B;  5FD6 A;  3V8K A;  1SAX A;  5JHU A;  3E6C C;  3BDD A;  3Q9V A;  4OMY A;  1KYW A;  3E5U A;  2ADU A;  2XAJ A;  1NHA A;  4DNC A;  4RGS A;  4N0B A;  5L3F A;  4KMU X;  1JHF A;  1OR7 A;  1FPQ A;  1YIO A;  1IXC A;  2VOO A;  5FFX A;  4UHT A;  2PBI A;  2FNP A;  1UFM A;  3SHF A;  5JFR A;  2FNA A;  1K6O A;  3MFK A;  3N97 A;  1PUE E;  5D5W B;  2O03 A;  1R22 A;  3K1N A;  2DPD A;  1PP8 F;  1YLF A;  2XKO A;  3FMR A;  5ICF A;  1IN7 A;  3PQJ A;  4CYD A;  5K1Y A;  4OIN F;  2Z33 A;  4EMS A;  5ILV A;  4XRF A;  1DP7 P;  1FC3 A;  3WTU C;  4R8H A;  5ED4 A;  3F8C A;  1ZRD A;  2PMH A;  5EEG A;  3I0T A;  3TDU C;  3RYR A;  2EV0 A;  4B09 A;  4CIC A;  2MC3 A;  4P9F A;  2K27 A;  4WXC A;  3ZN0 A;  3BJA A;  3H3U A;  2BEO A;  4BH9 A;  2ZNZ A;  4ESF A;  1T39 A;  5DCM A;  4HX7 A;  3HRM A;  2KKO A;  1IN4 A;  5E18 F;  4PCQ A;  1MJB A;  3LQR A;  1FY7 A;  2YX4 A;  5DEQ A;  1OYY A;  3BWG A;  3N4M A;  4M72 A;  3RTR A;  2RC4 A;  1HKQ A;  1HST A;  1S7A A;  3M8F A;  1H9G A;  1ZAO A;  4JQF A;  4I7H A;  3QU3 A;  3IRQ A;  3KP6 A;  1ZGA A;  3CTA A;  2CG4 A;  3T8T A;  3F3X A;  1UCR A;  2IPQ X;  2K7L A;  2EA2 A;  1H0M A;  2P8T A;  2V1X A;  3GW2 A;  3KP4 A;  1V3F A;  1I1S A;  1XGS A;  1YG2 A;  1K78 A;  2FEZ A;  4ENM A;  3E6D A;  4G7Z F;  2Q8K A;  1FSH A;  3REO A;  4KN7 X;  1F1Z A;  5D8K B;  3LWF A;  4NQW A;  3F8M A;  2YU3 A;  1FOK A;  3JAM Z;  1REP C;  4IVN A;  3CUO A;  4MEY F;  1IRF A;  1B59 A;  1L0O C;  1BI0 A;  2BYV E;  3CUQ B;  2XAQ A;  2JPB A;  4HF2 A;  1S29 A;  3IL2 A;  1XGM A;  2XAF A;  4KMF A;  1O3Q A;  3ZPL A;  4EQQ A;  4L9N A;  4M9S A;  4KA4 A;  3MZH A;  1HW5 A;  2CGP A;  1QZZ A;  5D5V B;  3TQN A;  3KP5 A;  2C6Y A;  1TQM A;  1FBU A;  1P2F A;  2GIV A;  1J0R A;  4XSX F;  3MAJ A;  3GFJ A;  4ENN A;  5FB2 A;  2YPR A;  5H6Q A;  3QAH A;  2W57 A;  3P9K A;  4G8X A;  1XD7 A;  3EYI A;  2EK5 A;  4EJT A;  5KVR A;  3C3W A;  1ODD A;  2O8X A;  1MKM A;  2PFB A;  1ZHF A;  4HX8 A;  5DD4 A;  3RI4 A;  2LNB A;  4GGG A;  2V9V A;  4RB3 C;  2P7V B;  1QO0 D;  5TJJ A;  4A2U A;  3ABT A;  5AIP A;  4CXF A;  1ZG5 A;  5IT9 K;  2OZ6 A;  3L7W A;  2UXX A;  4L0Y B;  2OA4 A;  2NYX A;  3HOS A;  1XSX A;  1YQA A;  3F6V A;  2CSO A;  2FA5 A;  3P9I A;  4PDK A;  4HX4 A;  5LBQ A;  1ZRF A;  1LB2 A;  4K2E A;  4Z2Y A;  1W7P B;  1EV7 A;  3VFZ A;  2XRN A;  5AIQ A;  2HYG D;  1ZLK A;  1TLH B;  3ROU A;  1KU2 A;  1B9N A;  5HLI A;  3LAJ A;  5BPD A;  1TW2 A;  3HRT A;  3ECO A;  1WRJ A;  1V4R A;  3QU6 A;  1FT9 A;  3SZP A;  1K79 A;  3WGH A;  4MHG A;  2M1B A;  3WTV C;  3IKT A;  1ZH5 A;  1XCV A;  1U2W A;  1U6G A;  3WE2 A;  3E97 A;  5HS8 A;  3E3V A;  4IHT A;  2EFP A;  5F1R A;  5D4R A;  2EV6 A;  1WI9 A;  3RPU A;  2ESN A;  3V8L A;  5DD8 A;  1PP7 U;  2QUF A;  3ECH A;  1G3W A;  2DU9 A;  4R1H A;  4WK8 F;  4I0B A;  2QBY B;  1HSJ A;  5D6F A;  1HQC A;  1P6R A;  1T38 A;  2F5C A;  3C18 A;  2L4M A;  3KP3 A;  2QZ8 A;  1U8R A;  3S2W A;  3ZMV A;  3QRF F;  1MDM A;  4KFC A;  3IWF A;  2VT2 A;  3LA2 A;  1AOY A;  3HSE A;  4ZZL A;  1U3E M;  2VT3 A;  1R5G A;  2HS5 A;  4Y13 A;  1JXS A;  2IW5 A;  1BI3 A;  3W6K B;  5E8G A;  2YR2 A;  2PJP A;  4BHB A;  2XIG A;  1U78 A;  2F5E A;  3I59 A;  3BJ6 A;  1T6S A;  1UST A;  1HBX G;  2PEX A;  1OYI A;  4A6D A;  1LEA A;  3J81 Z;  4LFU A;  5A2Q K;  4BQA A;  2EV5 A;  4I09 A;  1XCB A;  2EWN A;  2PMU A;  1W5T A;  3WG9 A;  1H9T A;  3ULQ B;  2LF8 A;  5BOX A;  4UUV A;  3RJP A;  3V7S A;  2ZME B;  3CDH A;  2K4J A;  3GFM A;  2VC0 A;  3DPT A;  4LMY A;  4I02 A;  3K2Z A;  2EFQ A;  2J5O A;  4XLP F;  1KU9 A;  2VXZ A;  4BNC A;  2D1H A;  1FBS A;  2ZNY A;  3RKY A;  4MNU A;  4ZYG A;  1QZY A;  2BV6 A;  2L4A A;  3LFK A;  2XAG A;  2CQK A;  3B02 A;  3BZ6 A;  5BMZ A;  4CO8 A;  1W7P D;  2XUB A;  2HOE A;  1S8N A;  1FYM A;  3FXR A;  1TQI A;  4EJU A;  2BGC A;  3WTX C;  2V6C A;  2HFH A;  1U5T C;  4LLG F;  5CVV A;  3KFW X;  3ZP5 A;  2B0L A;  4L18 B;  1R1V A;  3SQN A;  4CDG A;  5CVR A;  1WSU A;  1BI2 A;  1MGT A;  4A6E A;  2A3S A;  1E17 A;  2XV4 S;  3MEX A;  1ULY A;  2FML A;  4WF2 A;  4D0P A;  1W5S A;  3CLO A;  3G73 A;  3DPL C;  1P92 A;  4LLL A;  3K69 A;  5D5U B;  2E1N A;  2JRT A;  3U9G A;  1O3T A;  3KCC A;  1IF1 A;  5CJ9 A;  2E1C A;  1IUY A;  4MTD A;  3COA C;  1WKM A;  2CWE A;  1Z9C A;  1W7P A;  2QYO A;  4DQ2 A;  4LB5 A;  2JZY A;  2F5D A;  4AD9 A;  4IRG A;  1O3S A;  1XSD A;  1T98 A;  4KIB A;  2HDC A;  3V8J A;  3RPQ A;  4MEX F;  4ZYE A;  3FX3 A;  4I98 B;  4OIQ F;  3I71 A;  2XKP A;  1B1B A;  1VTN C;  2ISZ A;  2L54 A;  3E5X A;  3F22 A;  4CGZ A;  1RZ4 A;  4OU0 A;  2HTS A;  2WV0 A;  3SZT A;  3EET A;  3KP2 A;  5E1W A;  2A69 F;  1OYW A;  4HBL A;  3QPT A;  2VOP A;  3QP5 A;  5LHH A;  2GA1 A;  1YS7 A;  5HDG A;  3DF8 A;  2FBK A;  2P5K A;  2PI0 A;  3KLO A;  1G3Y A;  3GXO A;  4KIF A;  1YW7 A;  3JTG A;  2ZBK A;  3ABU A;  1IW7 F;  2UZK A;  2BBY A;  3W6J B;  2D45 A;  2VE8 A;  1G3S A;  3RDI A;  3T5X A;  3GFI A;  1F4K A;  4LJZ F;  2GXG A;  4BHC A;  4HA8 A;  2EA4 A;  2FMY A;  2ZME A;  1I27 A;  1ZG3 A;  5J8F A;  1GVJ A;  2KRF A;  1IZ1 A;  3KZZ A;  3GFL A;  1RUN A;  2MLG A;  2DK8 A;  4A12 A;  1O7L A;  2NRA C;  1KYZ A;  3SXY A;  3PFI A;  4AIH A;  2MD5 A;  1EH7 A;  4YIF A;  3R60 A;  2MH9 A;  4Q5S F;  5DUI A;  3M1E A;  5K5Q A;  3HTU A;  1OKR A;  1CF7 A;  3ZMS A;  2XRO A;  3BRO A;  5H6R A;  2M8E A;  3HRU A;  5IT3 A;  3WTW C;  5BPI A;  2QWW A;  4HLX A;  4UV9 A;  2AS5 F;  5JVT A;  1AWC A;  2P7C B;  5BQT A;  1Y0U A;  2V1D A;  4LB6 B;  4RB1 A;  1R1U A;  2Z3Y A;  2FBH A;  1Z6R A;  3GZ5 A;  4LLN A;  4EM0 B;  3GWZ A;  5LGT A;  2RVC A;  4RGX A;  3IWZ A;  4EM1 A;  3IHU A;  2PN6 A;  4GXO A;  4LG0 B;  3L2C A;  1ZGJ A;  2VBY A;  1TNT A;  2XHK A;  4AWX B;  5ERI A;  4CZZ A;  1XB4 A;  1MD0 A;  2PG4 A;  4G6D A;  2W84 A;  1B9M A;  5DUK A;  2VBW A;  2VBX A;  2Q0O A;  3MCZ A;  2OQG A;  5LEK A;  2H6C A;  4XSZ F;  3KET A;  4LG0 A;  2XVC A;  5CVI A;  2WTE A;  2DT5 A;  5K5O A;  5L3D A;  2IJL A;  3CUQ C;  1BM9 A;  3OOP A;  3HHH A;  2ZKZ A;  4P9U A;  4A5M A;  1PDN C;  4G94 A;  1JHH A;  1OMI A;  4ZH4 F;  2GA2 A;  2DI3 A;  3I54 A;  2FSW A;  2FBI A;  2RDP A;  4B8X A;  4RB0 A;  2Y48 A;  5F64 A;  1YW8 A;  1J59 A;  2STT A;  3ZMZ A;  2H09 A;  2NNY A;  4O6J A;  2MH2 A;  2NNN A;  2KIU A;  4RAY A;  3I64 A;  4OMZ A;  4PGG A;  4Y15 A;  5A2Q Z;  3FZV A;  5LLQ A;  4WXH A;  2O61 A;  2TDX A;  2V1U A;  3V7C A;  1SMT A;  3QPH A;  1GXQ A;  3L00 A;  1KGS A;  3R0J A;  3JW4 A;  4M74 A;  2DW4 A;  3E5Q A;  1T0F A;  2H27 A;  1R58 A;  1FBQ A;  5FFZ A;  2Z5U A;  1XGO A;  2LSO A;  3R0A A;  2HKX A;  5HS9 A;  3ML6 A;  5L3B A;  4S04 A;  4FHT A;  3FF5 A;  2NS0 A;  5LRR A;  4Q4Z F;  1P4X A;  2GWR A;  4YG2 F;  2EFO A;  4GCV A;  2G7U A;  1IN5 A;  2RGV A;  3C7J A;  2Q2E A;  3O3K A;  1BJA A;  1EH6 A;  4EGY A;  5JI6 A;  3ZMU A;  1RI7 A;  2IA0 A;  2QQB A;  2R7D A;  1ON1 A;  1YO5 C;  1FNN A;  3BPV A;  2RV8 A;  4UNO A;  2HTJ A;  3LAP A;  5CYV A;  2AXL A;  4L5I A;  4NHJ A;  1SFX A;  3JAM K;  2R3S A;  4KT5 C;  3VOE A;  4WWC A;  4AIJ A;  3I53 A;  3B73 A;  4Q48 A;  2X4H A;  4YFX F;  2DO7 A;  4CHU A;  4ETS A;  2P5L C;  1GXP A;  1TQP A;  2RKH A;  5BS6 A;  4L9T A;  2KIF A;  3E6M A;  4EJV A;  1MJA A;  3WGI A;  2A68 F;  3I5U A;  4ESJ A;  5DYM A;  2OD5 A;  2EFW A;  4NB5 A;  5HLH A;  4H0E A;  2A6E F;  2A5Y B;  4AVP A;  1W4M A;  1Q1H A;  4KIG A;  4BAY A;  4M71 A;  1QGP A;  1I6X A;  3MZY A;  3HSF A;  5DDG A;  4ZYH A;  4IRI A;  1ZG1 A;  4HV5 A;  1DUX C;  2LKP A;  2HYF A;  4AIK A;  4P55 A;  3AAF A;  2ISY A;  3ERE D;  2GXB A;  1ZN2 A;  4YFN F;  5DCM B;  1D5V A;  4HF1 A;  1BC7 C;  3KEQ A;  2HZT A;  2EJR A;  2IP2 A;  4U7B A;  2ETH A;  1FP1 D;  3TOA A;  4MQ9 F;  4OOI A;  2FRH A;  5CVU A;  5J8C A;  1LDK B;  4I2O A;  2ZFW A;  1F9N A;  1LEB A;  4N9I A;  3ZMD A;  1EH8 A;  1KQ8 A;  2FOK A;  4EGZ A;  3HUG A;  4JBA A;  4YFK F;  4HDU A;  3DQV C;  4L5J A;  2ZJ2 A;  4MTE A;  2EFN A;  4WXD A;  1FLI A;  1WWX A;  3CUQ A;  1Z05 A;  3TO7 A;  2E7W A;  1LDD A;  2G7H A;  3TDZ C;  1Z91 A;  2F2E A;  1LJ9 A;  4HAM A;  1UHM A;  2CW0 F;  1RIO H;  3HSR A;  4KDP A;  1BC8 C;  3DKW A;  4EJW A;  1SFU A;  1I1G A;  2P4W A;  2L01 A;  2DPU A;  3SFZ A;  2W24 A;  3WU1 B;  3WE3 A;  5D4S A;  4ZZD A;  2ELH A;  2CFX A;  3WTS C;  3J81 K;  4U0Y A;  1S3J A;  1IRG A;  3ZN1 A;  2DLL A;  4UVC A;  1XDU A;  3H92 A;  1DPR A;  3GX4 X;  3OV8 A;  4G7H F;  5IT9 Z;  3K1P A;  1JE8 A;  2JTV A;  2CO5 A;  2RNJ A;  5ICG A;  2D2W A;  2ACJ A;  3EYY A;  1XSV A;  1GHC A;  1MDM B;  3KZY A;  2DQR A;  3O2P E;  3HRS A;  3JTH A;  2D1V A;  2OBP A;  4MQV A;  4GO1 A;  3DV8 A;  3V4G A;  5TRD A;  1BI1 A;  1UB9 A;  1QBJ A;  1E2X A;  4EJO A;  3GO5 A;  2H6B A;  1X3U A;  3ZMT A;  1IN6 A;  2HGC A;  2F5F A;  2WC2 A;  2VON A;  1IXS B;  1TNS A;  2A61 A;  5E1X A;  5H20 A;  3FHZ A;  4XLN F;  4IHS A;  5DV5 A;  1SFE A;  3NQO A;  3BOQ A;  1RUO A;  2R7F A;  4XBF A;  1QNT A;  1LQ1 A;  4IXA A;  1USS A;  1R5H A;  3R61 A;  4M9X A;  5L3C A;  4HQM A;  2GZW A;  4U7D A;  1SD7 A;  2OZU A;  4Y17 A;  1R1T A;  3TO9 A;  3BP8 A;  3LA3 A;  1P4A A;  1ZAR A;  2KIM A;  3D0S A;  2Z99 A;  3NEU A;  5E20 A;  2LF7 A;  3WTT C;  4ENK A;  3K9T A;  2QQA A;  1P4W A;  3LQQ A;  5LHI A;  1J7K A;  2DBB A;  5ICE A;  3KLN A;  1HKT A;  3DXJ F;  3EQL F;  2LDU A;  2FXA A;  4A0Y A;  1S7O A;  3C1D A;  4FX0 A;  4KNY A;  3F23 A;  4OIP F;  4PZJ A;  3RIR A;  3M7G A;  1SD5 A;  2PLY A;  2O3F A;  4R79 A;  2K86 A;  3M9A A;  1WQ2 A;  4PGH A;  5D8L B;  3L09 A;  5HDN A;  2VOD A;  5CLS A;  1KA8 A;  3WTY C;  3VEP A;  1STZ A;  3J80 K;  2GQQ A;  2OU2 A;  4I0A A;  4A0X A;  1ZRE A;  1SD6 A;  1J5Y A;  1IXR C;  2FE3 A;  2M87 A;  3BPX A;  2FF4 A;  2COM A;  1R23 A;  1A04 A;  2IVM A;  4U0V A;  5KK1 A;  4L0Z B;  4HDV A;  2W25 A;  3R4K A;  4KYW A;  1U5T B;  5K5R A;  1LDJ A;  4BYY A;  2KJB A;  1LNW A;  1B6A A;  3WU0 A;  5ICC A;  3QOP A;  3ZQ7 A;  2M5W A;  3RKW A;  4M9Z A;  5L3E A;  3GUD A;  2X0L A;  1J2X A;  1KQ0 A;  5HLG A;  4P5O A;  1IAW A;  1O3R A;  4EVI A;  4KN4 X;  2DTR A;  3J80 Z;  1J9I A;  1ZRC A;  1BIB A;  3Q9S A;  4JK1 X;  4OIR F;  4RS8 A;  1KU3 A;  1XN7 A;  2P6T A;  3FWE A;  4RGR A;  2RN7 A;  2Z9O A;  3F6O A;  2IT0 A;  1G3T A;  1J75 A;  3DFG A;  5L3G A;  4M6X A;  2HQR A;  5LHG A;  1CF7 B;  3F21 A;  3K0L A;  3O6B B;  2OAZ A;  1UHW A;  3T0Y A;  3F8B A;  3FXQ A;  1G6N A;  2P5V A;  3LST A;  4ESB A;  1C0W A;  1ONV A;  5ILS A;  4A5N A;  1BIA A;  3HHG A;  1D3Y A;  3RYP A;  2ZCW A;  3BJO A;  2ZXJ A;  2JT1 A;  2L3D A;  6PAX A;  3FM3 A;  2MA3 A;  3TKY A;  3ISP A;  3LA7 A;  4TV7 A;  1Z6T A;  3JSO A;  1FSE A;  1I5Z A;  3GF2 A;  1FYL A;  1ON2 A;  5LRS A;  4G9Y A;  3J7A O;  4M6Y A;  2IRF G;  3EUH A;  2VN2 A;  4HF0 A;  1S6L A;  5AON A;  4G7O F;  1KU7 A;  2QLZ A;  1YS6 A;  2P6S A;  2DFI A;  1R36 A;  2EB7 A;  3E6B A;  3FMS A;  5JR3 A;  2VC1 A;  1FP2 A;  4ASN A;  5E17 F;  2JPC A;  2QM3 A;  2NAZ A;  3WOD F;  5ILU A;  4UV8 A;  3P9C A;  4FX4 A;  3TO6 A;  2FQ3 A; 
#chains in the Genus database with same CATH topology
 4LGW A;  3K70 D;  2MG4 A;  2IXS A;  1AKH A;  2OTJ I;  2O0Y A;  3JRG A;  2BW3 B;  3D5L A;  5E8I A;  4ZYD A;  2FQ4 A;  5M3M J;  3Q5F A;  4RMN A;  3DLA A;  3HYI A;  2K9M A;  2Y2Z A;  4A0Z A;  3KE2 A;  2JUG A;  2MBF A;  1GT0 C;  4PFP A;  1GVD A;  5HDK A;  4HSR A;  4A3M J;  4LIV A;  4E7L A;  2HQN A;  3HIF A;  1LPQ A;  5HVQ C;  2PQ8 A;  4HOB A;  1O7F A;  2VI6 A;  3KP7 A;  5FLX Z;  2P0W A;  3EUH C;  2KJC A;  3F72 A;  1Z3X A;  4N9H A;  1VQ6 I;  2M30 A;  4PJM A;  1Z1D A;  1YYV A;  1QQI A;  4NQW B;  2IA1 A;  5HS7 A;  3T1B A;  2JA5 J;  3H35 A;  1PVE A;  1X1P A;  1OPC A;  1G8X A;  2XGX A;  1I50 J;  2W7N A;  4ZTJ A;  3WHC A;  2OPT A;  3W6V A;  4IEJ A;  3LL7 A;  3U1D A;  3IV5 A;  3A01 B;  1BOA A;  4FT8 A;  2DFE A;  3OYN A;  2ESH A;  1DDN A;  4UXN A;  1HW1 A;  2O5R A;  2KDZ A;  4ENJ A;  3IKV A;  4XKV A;  2V79 A;  5K7H A;  3MKY B;  3JSP A;  3WTZ A;  3X2Q H;  1K78 B;  2IGN A;  2Y69 H;  4QWQ A;  2LBF B;  2X6Y A;  2UXN A;  3I4P A;  5GPA A;  3MQ0 A;  4LD5 A;  3OYC A;  2HQA A;  4XNF A;  5J6X A;  2XB0 X;  4IRH A;  2A6T A;  4EM2 A;  3DP7 A;  3L2V A;  3FBN B;  2BE5 F;  2STW A;  2HEO A;  1IRX A;  3HKZ A;  5KNL A;  2O6G E;  1RNL A;  4OIO F;  5KAI C;  2M3A A;  3JRH A;  2L9S A;  4WX9 A;  1TWC J;  3FK6 A;  3DEU A;  1BBY A;  3K4L A;  5CVJ A;  3ZQL A;  5FD5 A;  1FWZ A;  1SMY F;  3U2R A;  3F8F A;  4A3G J;  1ZYR F;  4BS9 A;  4Q47 A;  2WB1 A;  3D1N I;  1W36 C;  4E70 A;  2KPM A;  4ZDP A;  2RNG A;  4P96 A;  4BHP A;  5LGN A;  1K7A A;  3GEZ A;  3H9J A;  4HEA 2;  2CUZ A;  1JGS A;  3GVA A;  2YSR A;  2E7X A;  2HXI A;  1W0U A;  2DK5 A;  4AUX A;  2Y75 A;  2X1D A;  5FO5 A;  5E3O A;  2ZXW H;  4O5V A;  1HW2 A;  1MJ9 A;  2IA2 A;  3BCA A;  1YW9 A;  3BLY A;  3M1C A;  3S1N J;  2Y0M A;  2PMZ N;  2QSH X;  4KIC A;  1BJZ A;  2VBZ A;  2HR3 A;  1IN8 A;  2W85 A;  2EQR A;  3LNQ A;  3OIO A;  1TTY A;  4WCG A;  1G4D A;  2A07 F;  4KUM A;  2M45 A;  4XLC A;  3OWT A;  1BN5 A;  4E7H A;  2OQR A;  3GLL A;  4EV0 A;  3I58 A;  3GTK J;  2UWM A;  4M6V A;  3ZR8 X;  1OLT A;  4IOA F;  1AA7 A;  4UVA A;  4PSX A;  1WI3 A;  1X2N A;  1NTC A;  2MLK A;  2HKO A;  2UV1 A;  3GLX A;  3DLL F;  3WGG A;  2ZO4 A;  2H94 A;  2HWV A;  4RLF A;  1FTZ A;  1UEL B;  4EAT A;  4UB8 C;  4IF4 A;  2K40 A;  1JTX A;  1LE8 B;  3FXO A;  3JRI A;  5D6E A;  4I01 A;  4IJA A;  3WHB A;  5LEJ A;  2OUM A;  1SFO J;  5EG0 A;  4LK1 F;  4MGR A;  4GYG A;  2VKH A;  2DAO A;  2XB5 A;  4GYI A;  2QBY A;  3OY9 A;  5FLX K;  1D8K A;  5D5X B;  1TW3 A;  4IZZ A;  5CQE A;  2M0M A;  3PQK A;  5J1U A;  2VQG A;  2R5Y A;  1UAA A;  4UVB A;  2IGK A;  1IDY A;  3HEF A;  2V9K A;  3CJN A;  2K02 A;  4O3M A;  5E1Z B;  3CO7 C;  1YTY A;  2JSC A;  1D8J A;  4F7Z A;  3FMQ A;  3RZD J;  4HQE A;  2LRD A;  5FGM A;  1YRN A;  3F8N A;  3FXU A;  3IC7 A;  3HOT A;  5DCF A;  4YII A;  3R6S A;  1IV8 A;  3S17 J;  5B66 C;  4D9J A;  5FKM A;  2XAU A;  4CA0 A;  4L9J A;  4HZF A;  2JA8 J;  2QCO A;  2NOJ B;  2Y31 A;  3KX2 A;  3FM5 A;  1GV2 A;  2KDO A;  3VB2 A;  5LGU A;  4DGW B;  3GZ6 A;  3HUG B;  3H0D A;  2QVO A;  2K85 A;  4XR6 A;  1QPM A;  2R7S A;  2WA0 A;  5GAD J;  4XKB A;  1CGP A;  1XGN A;  1D5Y A;  1SD4 A;  1R00 A;  2D5V A;  5HOD A;  3OL3 A;  1DP3 A;  4JX5 A;  2ELK A;  3OS2 A;  3PM1 A;  2CFO A;  4G6Q A;  3TP3 A;  3OYK A;  3PUB A;  2W1O A;  4J19 A;  1R7J A;  3BR2 A;  4IQJ A;  4GRI A;  2CW7 A;  2R7T A;  1IJW C;  3K1M A;  5DM6 F;  4HV6 A;  1YFH A;  1T2K A;  1YJW I;  4RB2 C;  3K4B A;  2K4B A;  4HW0 A;  5JVG F;  3IRR A;  3RSN A;  3S3N A;  3M3Y J;  2HVQ A;  4QLC U;  3A03 A;  3M07 A;  4C2U A;  3M8E A;  4BAC A;  4RGU A;  1FYK A;  1WHU A;  2QEN A;  3CCS I;  3QP6 A;  2MGQ A;  3I59 B;  2J5P A;  5EEH A;  4BJ6 C;  3FDY A;  2E36 A;  4RAF A;  3HOW J;  2HXO A;  2QGU A;  2QQ9 A;  1J09 A;  2YU9 J;  2DT6 A;  3T8R A;  3TGN A;  4U88 A;  4LK0 F;  2DQL A;  2RQP A;  1B4A A;  4AC0 A;  3ELK A;  3V7R A;  3IH2 A;  5E3L A;  5IOY A;  2R7Q A;  3TOB A;  1F5T A;  1LVA A;  3KEO A;  3MWM A;  2R93 J;  5HOO A;  1X2M A;  3BZK A;  3W2V A;  3CO6 C;  4M3F A;  5F6F A;  2HNH A;  1UJ8 A;  4L9V A;  3H3Z A;  4HLY A;  1XDS A;  4S05 A;  3BY6 A;  1Z7U A;  2KFD A;  1MSF C;  3K4C A;  1XX5 A;  3EDP A;  4BXU A;  3NWS A;  2DFH A;  2CYY A;  3S16 J;  3UR3 C;  3P7N A;  3RKQ A;  3S15 J;  3HOZ J;  1DPU A;  4HYE A;  2A6H F;  2YX7 A;  3G3Z A;  4U0W A;  1POG A;  2L02 A;  3S8P A;  3HM5 A;  4HNU A;  2GAU A;  3HTS B;  4B4C A;  2BHZ A;  1HXD A;  1O57 A;  3NRV A;  4PJJ A;  4CCO A;  3OR1 C;  4M73 A;  2DMP A;  3L9F A;  2DMU A;  2FU4 A;  4A3F J;  1D0Z A;  1MW7 A;  2K3P A;  2VPL A;  1VFC A;  1XMK A;  2YS9 A;  3AG2 H;  1ZLJ A;  1XMA A;  2FJ1 A;  5M5W J;  2X51 A;  4BGD A;  3DTK A;  4HNV A;  1V5E A;  4QPO A;  2VE9 A;  4UB6 C;  5EEA A;  3C2B A;  4UUT A;  3RKX A;  3QWL A;  1FX7 A;  2G9W A;  3IH4 A;  3VOD A;  1KQ9 A;  1HKS A;  4IPA A;  1S7E A;  2WWY A;  5EZH A;  4RAZ A;  3L2R A;  1VQ5 I;  4BEH B;  1MZB A;  1Y8R B;  4ON0 A;  2DFF A;  5FRO A;  1U5T A;  2XAH A;  1F36 A;  2XAS A;  4XN3 A;  2YUS A;  3GYH X;  4RLQ A;  1L3L A;  5FLV A;  1DGW Y;  4A3B J;  1TBX A;  5FKK A;  2FX0 A;  4JX6 A;  1FZP B;  3BTL A;  2E5N A;  5FD6 A;  1V5G A;  3V8K A;  2EZI A;  3DU5 A;  4PUS A;  1SAX A;  5JHU A;  3PSF A;  3E6C C;  2NVY J;  4W97 A;  1SC7 A;  3CMY A;  3BDD A;  2BY0 A;  3Q9V A;  3OYH A;  4OMY A;  1KYW A;  4FET A;  2W00 A;  3H1C A;  3E5U A;  2ADU A;  2XAJ A;  1NHA A;  4DNC A;  4RGS A;  4N0B A;  5L3F A;  4KMU X;  1JHF A;  1OR7 A;  1MMS A;  1FPQ A;  1YIO A;  3S2H J;  2ME6 A;  3AG1 H;  1IXC A;  2VOO A;  5FFX A;  3CJQ B;  4BE1 A;  4UHT A;  2PBI A;  5DTD A;  2FNP A;  1UFM A;  3LSI A;  2MYS A;  3SHF A;  1ZTR A;  1MMA A;  2FNA A;  5JFR A;  1FMV A;  3CMM A;  1K6O A;  1KON A;  3MFK A;  1EJ9 A;  2CUE A;  2OV7 A;  3N97 A;  4HST A;  1PUE E;  2ICW G;  1VQM I;  2IGO A;  1WH5 A;  5D5W B;  4DZJ A;  4ITV A;  2O03 A;  1OCC H;  4RM3 A;  2JUC A;  1R22 A;  5E3M A;  2NS7 A;  3K1N A;  2VKV A;  4FQG A;  2X85 A;  2DPD A;  1PP8 F;  1YLF A;  2EIN H;  3FMR A;  2G0E A;  2XKO A;  3BTC A;  4PJN A;  2WV1 A;  4PFO A;  5ICF A;  1XS9 A;  1IN7 A;  2HYJ A;  3PQJ A;  1O4X A;  4CYD A;  1JUP A;  5K1Y A;  4OIN F;  2Z33 A;  5E79 C;  4EMS A;  5ILV A;  1T56 A;  4XRF A;  5C4X J;  3N05 A;  3KYC B;  3LSM A;  1DP7 P;  1FC3 A;  2X48 A;  3PNT A;  3HKZ N;  2R7U A;  3WTU C;  2R7Z J;  4R8H A;  1DU0 A;  5ED4 A;  2OC6 A;  2DT7 B;  1MBH A;  3F8C A;  3LOC A;  4JYK A;  5K7F A;  1ZRD A;  2PMH A;  1HC8 A;  5EEG A;  3I0T A;  3TDU C;  3FHN A;  2DA5 A;  3RYR A;  2EV0 A;  4B09 A;  4CIC A;  2MC3 A;  2DA3 A;  3BC8 A;  2K27 A;  4P9F A;  4WXC A;  2ZSH B;  3ZN0 A;  2JA6 J;  1FEX A;  4RAG A;  3BJA A;  5JLW A;  3H3U A;  1WJE A;  4Y4R A;  1K4T A;  1R9T J;  4DOZ A;  1E3O C;  5GTI C;  2PX9 A;  2BEO A;  2GXA A;  5GP9 A;  3I4N J;  4BH9 A;  3SFI A;  1NH3 A;  4XQF A;  2ZNZ A;  4OAZ A;  3DWL E;  4ESF A;  1PUF A;  1YE9 A;  3QOD A;  1T39 A;  2K5C A;  2EIK H;  5DCM A;  1XPX A;  4HX7 A;  3HRM A;  4GFB A;  2KKO A;  1TWF J;  3EPZ A;  1IN4 A;  2VJ5 A;  5E18 F;  4PCQ A;  1MJB A;  3LQR A;  2DJN A;  3ZQI A;  3HZJ A;  1IV6 A;  1FY7 A;  1PJR A;  2YX4 A;  4BQN A;  4BE0 A;  2CQ7 A;  3DTI A;  5DEQ A;  1U9O A;  3C2G A;  3MVP A;  1JT6 A;  1OYY A;  2K9N A;  3BWG A;  2XSD C;  1WJD A;  3N4M A;  1X19 A;  4M72 A;  3OR2 C;  3RTR A;  2R5Z B;  4BL0 B;  2AXT C;  2RC4 A;  4FCY A;  1HKQ A;  1HST A;  1S7A A;  3M8F A;  1H9G A;  2B7E A;  2JMW A;  1JTY A;  1ZAO A;  3QOE A;  4JQF A;  3CMA I;  4I7H A;  1UHS A;  3LFU A;  4BY7 J;  4I6Z A;  3QU3 A;  3IRQ A;  2CQN A;  4PJ0 C;  3KP6 A;  3WG7 H;  1Q1V A;  4N4N B;  5CQG A;  3K4J A;  1ZGA A;  3CTA A;  4A3I J;  2CG4 A;  3T8T A;  3F3X A;  1UCR A;  2ECB A;  2IPQ X;  3ZRG A;  2K7L A;  2EA2 A;  1OCZ H;  3LSP A;  2P8T A;  2HU9 A;  2V1X A;  3GW2 A;  3KP4 A;  4L5E A;  1V3F A;  1H0M A;  1JKR C;  1I1S A;  1FOX A;  2V7F A;  1XGS A;  3S2D J;  1WH7 A;  1YG2 A;  3OYI A;  3ABM H;  1MND A;  3BG7 A;  1K78 A;  2V6E A;  2XF5 A;  2FEZ A;  4ENM A;  3GME A;  2R92 J;  1VQK I;  3SDB A;  3E6D A;  1JJ6 C;  4G7Z F;  2Q8K A;  1FSH A;  1OCR H;  3REO A;  4FE7 A;  4PJL A;  4KN7 X;  1F1Z A;  5D8K B;  4D7M A;  3LWF A;  4NQW A;  3F8M A;  3M4O J;  2YU3 A;  1FOK A;  3JAM Z;  1REP C;  1G59 A;  4IVN A;  3W2A A;  1E3P A;  3CUO A;  1IRF A;  4MEY F;  2R5Y B;  5C44 J;  2CV0 A;  2ZME C;  1B59 A;  2R7R A;  2O7O A;  1L0O C;  1BI0 A;  2BYV E;  1FTT A;  2H1L A;  3VDX A;  3CUQ B;  4B1R A;  2XAQ A;  2JPB A;  1VQ9 I;  2ZXH A;  1A6Q A;  4HF2 A;  1S29 A;  1V55 H;  3IL2 A;  1XGM A;  2XAF A;  4KMF A;  4C3H J;  5HNF A;  3EUA A;  1O3Q A;  3ZPL A;  4EQQ A;  4L9N A;  4M9S A;  4KA4 A;  3MZH A;  2EBI A;  1HW5 A;  2CGP A;  1QZZ A;  2VUM J;  3ZXS A;  1Y0N A;  1BA5 A;  5D5V B;  3TQN A;  3KP5 A;  2C6Y A;  1TQM A;  1FBU A;  1P2F A;  1SVL A;  3KYD B;  2GIV A;  2QKM B;  1J0R A;  4G6T B;  3K7A J;  4XSX F;  3MAJ A;  3GFJ A;  1Z7L A;  4ENN A;  3QYB A;  5FB2 A;  2YPR A;  5H6Q A;  3JRB A;  3QAH A;  1ZGW A;  3CF2 A;  2W57 A;  3P9K A;  4G8X A;  1XD7 A;  3EYI A;  2EK5 A;  1ZQ3 P;  1YIT I;  4MLO A;  4EJT A;  1TWH J;  5KVR A;  3C3W A;  5KCM A;  1T33 A;  2X6W A;  3MKW B;  1ODD A;  2WAE A;  2O8X A;  4A3D J;  1MKM A;  2PFB A;  1IRZ A;  1ZHF A;  2DYS H;  2L9R A;  3B6A A;  4HX8 A;  4CYC A;  4XN0 A;  3UNG C;  4E7Z A;  5DD4 A;  3RI4 A;  2LNB A;  4GGG A;  3JCU C;  1I3Q J;  2V9V A;  3CJT B;  4RB3 C;  2P7V B;  1B8I B;  1VQ8 I;  3ZCO A;  1QO0 D;  5TJJ A;  3L1P A;  3FIW A;  4A2U A;  3ABT A;  5AIP A;  4CXF A;  2XC7 A;  1ZG5 A;  3AG3 H;  2IS4 A;  5IT9 K;  1OCO H;  2OZ6 A;  3E0J B;  3OYM A;  1YI2 I;  2CS3 A;  1UZC A;  3L7W A;  2KL4 A;  2UXX A;  4L0Y B;  4UUS A;  2OA4 A;  4RBO A;  2WBM A;  3CC7 I;  4HG2 A;  2NYX A;  3HOS A;  1F43 A;  1XSX A;  4V2G A;  1YQA A;  3F6V A;  4B3A A;  2CSO A;  2FA5 A;  3P9I A;  1T95 A;  4PDK A;  2NXN B;  4HX4 A;  5LBQ A;  4M3E A;  1E3H A;  1ZRF A;  3K10 A;  1SFK A;  2DOD A;  1LB2 A;  4K2E A;  4YEL A;  2BY1 A;  2HOS A;  2OJE D;  4Z2Y A;  1OCP A;  1W7P B;  4DYR A;  2RRE A;  1EV7 A;  3BCB A;  3VFZ A;  3BR0 A;  2JA2 A;  2XRN A;  4CCJ A;  3PIP F;  3I3L A;  5AIQ A;  2HYG D;  1ZLK A;  1TLH B;  3ROU A;  1B72 A;  1KU2 A;  1B9N A;  5HLI A;  1CQT A;  2DCE A;  3LAJ A;  5BPD A;  2JVG A;  4XLH A;  1TW2 A;  3HRT A;  3ECO A;  1WRJ A;  1V4R A;  4BY1 J;  1BR1 A;  3QU6 A;  4IHV A;  1Z77 A;  1FT9 A;  3SZP A;  3WGH A;  1K79 A;  4MHG A;  2M1B A;  2ZSI B;  3WTV C;  3IKT A;  3FIS A;  1ZH5 A;  5K7Z A;  1XCV A;  1VQ7 I;  3JRA A;  1U2W A;  1LFP A;  1U6G A;  3E97 A;  3WE2 A;  5HS8 A;  4IKF A;  2A05 A;  3E3V A;  2WAD A;  4IHT A;  4E7K A;  4XOT A;  2DOE A;  2M0C A;  4AYB A;  3FXJ A;  2EFP A;  1V5F A;  5F1R A;  5D4R A;  1WJC A;  2EV6 A;  2KMU A;  3L2W A;  1WI9 A;  2BOL A;  3RPU A;  2ESN A;  2H1K A;  1FOY A;  2VIX A;  4XLE A;  4PSW A;  5F0H A;  3V8L A;  5DD8 A;  1PP7 U;  3S1M J;  2QUF A;  2VKD A;  3ECH A;  1Y6I A;  3OIP A;  1G3W A;  2DU9 A;  2VAS A;  4R1H A;  4X1E A;  4WK8 F;  4I0B A;  2QBY B;  1VQL I;  1HSJ A;  4ZDO A;  5D6F A;  2LD5 A;  1HQC A;  3BG9 A;  1P6R A;  1T38 A;  4XOR A;  4ZTF A;  2F5C A;  2M7A A;  3C18 A;  4HNT A;  2KP6 A;  2QKL B;  2L4M A;  2MAB A;  3BG6 A;  3KP3 A;  4DBR A;  1NK3 P;  2QZ8 A;  4MO7 A;  1U8R A;  3S2W A;  3ZMV A;  3QRF F;  1OQY A;  1MDM A;  4KFC A;  2GOM A;  3BR1 A;  2UUZ A;  5GTH C;  3IWF A;  2VT2 A;  1ETY A;  3LA2 A;  1AOY A;  3JR9 A;  3HSE A;  4ZZL A;  4ZJZ A;  1U3E M;  2VT3 A;  2DMT A;  1R5G A;  2HS5 A;  5F1J A;  4Y13 A;  1JXS A;  2IW5 A;  2L7Z A;  4E6K G;  1R4N B;  1A31 A;  1I39 A;  3NWT A;  1BI3 A;  1MIJ A;  4RM2 A;  3W6K B;  5E8G A;  5B1A H;  5M5Y J;  2YR2 A;  2PJP A;  3BG5 A;  4BHB A;  1ETX A;  2QQ8 A;  2XIG A;  1U78 A;  1WJA A;  2LKS A;  1LE8 A;  2Y9Z A;  2F5E A;  3I59 A;  1U0J A;  1T6S A;  1UST A;  3BJ6 A;  4JP0 A;  3H5A A;  1FOW A;  3O8G A;  5EZG A;  1HBX G;  1TL8 A;  4XID A;  2K3F A;  2KRH A;  3FXK A;  4AU7 A;  2CRG A;  2PEX A;  3A02 A;  1U9N A;  1OYI A;  3K4N A;  4A6D A;  1NK2 P;  1D0X A;  1JUM A;  2E35 A;  1LEA A;  1MNM C;  3J81 Z;  4LFU A;  2CUF A;  3HGG A;  5A2Q K;  4BQA A;  2X6O A;  4XLF A;  5IYC J;  2EV5 A;  4I09 A;  2Z2S B;  4XMY A;  5EF6 A;  1XCB A;  3RZO J;  1HOM A;  2EWN A;  2PMU A;  4HRI A;  1W5T A;  2ZJR F;  1X4P A;  2DDB A;  3WG9 A;  2RAE A;  1H9T A;  1LUJ B;  5F27 A;  2CJJ A;  5IP9 J;  4CUG A;  3ULQ B;  2LF8 A;  4XM3 A;  5BOX A;  4UUV A;  3DEW A;  3RJP A;  4V2F A;  5FKO A;  2ZME B;  2JRM A;  3V7S A;  1Y1V J;  1VQP I;  2I5U A;  3CDH A;  1RET A;  1PYV A;  2K4J A;  3ESW B;  3GFM A;  2VC0 A;  3DPT A;  1R4M B;  3SEQ A;  4QIW N;  4LMY A;  1AKH B;  4I02 A;  3K2Z A;  2OCE A;  2EFQ A;  2J5O A;  3BR5 A;  4XLP F;  1KU9 A;  2Y0S A;  5F08 A;  2KZG A;  2VXZ A;  4BNC A;  2D1H A;  1FBS A;  2L5Q A;  2ZNY A;  4KIT B;  2HVR A;  4A3E J;  5M5X J;  3RKY A;  3CCU I;  4E7I A;  4MNU A;  1B8I A;  3IUO A;  4NDL A;  1WPK A;  2NVQ J;  4A93 J;  4ZYG A;  5FRM A;  2L2O A;  1IC8 A;  3D5S C;  4BXF A;  1QZY A;  2BV6 A;  1QA6 A;  2OTL I;  2L4A A;  3QPS A;  2BZT A;  3SZG A;  3LFK A;  2XAG A;  2CQK A;  3B02 A;  3BZ6 A;  5BMZ A;  4CCM A;  4CO8 A;  1W7P D;  2XUB A;  2ZB9 A;  2HOE A;  1S8N A;  1FYM A;  1TWG J;  2ID6 A;  3Q0V A;  3JRF A;  4IHY A;  3FXR A;  4DIQ A;  1TQI A;  4EJU A;  2L7M P;  2GM4 A;  2BGC A;  3WTX C;  2V6C A;  4D1Q A;  3HXL A;  2HFH A;  2NVT J;  3VSL A;  3ZOB A;  1X1A A;  1T8I A;  3SEZ A;  2CW8 A;  1U5T C;  3CC2 I;  4LLG F;  3F9K A;  5CVV A;  3CCR I;  1APL C;  2KZV A;  1YX3 A;  3SYT A;  1R49 A;  3OL4 A;  3P5J A;  3FKJ A;  3KFW X;  2K9Q A;  2B0L A;  5TGT A;  3ZP5 A;  1R1V A;  2VL8 A;  3SQN A;  4L18 B;  3AKZ A;  4CDG A;  5IPA A;  2F6C A;  3ABK H;  5CVR A;  2AQF A;  4Y52 J;  1H89 C;  1BI2 A;  1WSU A;  1MGT A;  4A6E A;  2A3S A;  1LVK A;  2Z16 A;  2R7V A;  2XV4 S;  1E17 A;  3MEX A;  1EA3 A;  2GIZ A;  3W2W A;  2LYC A;  2E2H J;  1ULY A;  2XPW A;  4J01 A;  2FML A;  3GTO J;  4WF2 A;  1OR7 C;  4D0P A;  1YIJ I;  1W5S A;  3TMO A;  3I55 I;  3CLO A;  3G73 A;  3ZQG A;  3DPL C;  1P92 A;  4BQQ A;  3JRE A;  3PO3 J;  4LLL A;  2CV1 A;  4PK4 A;  3DKY A;  2HQ5 A;  3K69 A;  1RRJ A;  1SVO A;  3HC7 A;  5FKN A;  1GUU A;  5D5U B;  3OIQ A;  4BXX J;  1QRY A;  1KZH A;  2E1N A;  1K61 A;  1ZR4 A;  2LMD A;  2JRT A;  4IL6 C;  3CP8 A;  2LRE A;  2DN0 A;  3OYJ A;  3LMM A;  3U9G A;  1O3T A;  1HDP A;  1TC3 C;  2H8R A;  3E1S A;  3HPH A;  3KCC A;  2R4G A;  1IF1 A;  2EPF A;  1SVM A;  1GV5 A;  2N8G A;  4A3C J;  5CJ9 A;  2E1C A;  4A69 C;  4C3I J;  3OYD A;  1JT0 A;  1IUY A;  1JKO C;  5C3E J;  4MTD A;  4F55 A;  3COA C;  1WKM A;  2CWE A;  1Z9C A;  1TWA J;  1W7P A;  2QYO A;  2LOO A;  1HDD C;  4DQ2 A;  4LB5 A;  2JZY A;  4UY8 I;  2VXD A;  2LH9 A;  2F5D A;  2L7K A;  5LFA A;  3G1O A;  5B5E C;  4AD9 A;  4IRG A;  1YHQ I;  4XLA A;  1O3S A;  1XSD A;  1T98 A;  4KIB A;  4YRV A;  2HDC A;  3V8J A;  3RPQ A;  4MEX F;  3MN2 A;  4ZYE A;  4F92 B;  3FX3 A;  4I98 B;  5J3L A;  3Q0W A;  3CDI A;  4OIQ F;  3IAM 2;  3I71 A;  2XKP A;  1B1B A;  3PL8 A;  1VTN C;  2ISZ A;  2L54 A;  3E5X A;  1JI8 A;  3F22 A;  4CGZ A;  3BR3 A;  1RZ4 A;  4OU0 A;  2HTS A;  2WV0 A;  1Y56 A;  3SZT A;  3EET A;  3ZQC A;  3KP2 A;  5E1W A;  3SDG A;  3BTJ A;  2A69 F;  2FOW A;  1OYW A;  1A6I A;  4HBL A;  3QPT A;  3GZN B;  2VOP A;  2KIQ A;  2B9S A;  3QP5 A;  4I99 C;  5LHH A;  2GA1 A;  1YS7 A;  1DU6 A;  5HDG A;  1IGN A;  2P81 A;  2ZFU A;  3GTG J;  3DF8 A;  2FBK A;  2DA1 A;  2P5K A;  2F4O B;  2VQH A;  2PI0 A;  1N75 A;  3KLO A;  4C2M J;  1QHH D;  2DMN A;  1G3Y A;  3GXO A;  3CCJ I;  2JJ7 A;  4KIF A;  1S9H A;  1YW7 A;  4CZC A;  3JTG A;  2ZBK A;  3ABU A;  1IW7 F;  3FKI J;  2UZK A;  4KIS A;  1G2H A;  2AQE A;  2BBY A;  3OOU A;  1N78 A;  3W6J B;  2D45 A;  2VE8 A;  1G3S A;  3RDI A;  3T5X A;  3GFI A;  1F4K A;  3NAR A;  2JA7 J;  5CKT A;  2BVM A;  1LFU P;  4LJZ F;  1V54 H;  2GXG A;  1XTA A;  4BHC A;  1ACI A;  4Y7N J;  2DDA A;  4HA8 A;  1MMG A;  5IYB J;  2B63 J;  2EA4 A;  1ETW A;  2FMY A;  2ZME A;  2F4M B;  1I27 A;  1ZG3 A;  5J8F A;  3BTI A;  3CD6 I;  1RKW A;  1GVJ A;  3IP4 B;  5LD2 C;  2DYR H;  5M3F J;  2IBD A;  1BW6 A;  1IZ1 A;  2DTZ A;  2KRF A;  3OYA A;  4DW6 A;  2ELJ A;  3OYF A;  5BNG A;  3KZZ A;  1B72 B;  1K6Y A;  3GFL A;  3VYS B;  1RUN A;  1ERD A;  2MLG A;  2DK8 A;  1R6R A;  4A12 A;  3LSR A;  1O7L A;  1N25 A;  2NRA C;  4BU2 A;  1KYZ A;  3SXY A;  3ZQF A;  3PFI A;  1R5I D;  1XG1 A;  2EH3 A;  4X0G A;  4G12 A;  4I76 A;  4AIH A;  2Q1Z B;  3CCM I;  2MD5 A;  3HDD A;  1EH7 A;  2R5Z A;  3OMY A;  4YIF A;  3R60 A;  3BQY A;  5EGO A;  2MH9 A;  4Q5S F;  3HB9 A;  4EEF G;  5DUI A;  3M1E A;  5J4Y A;  5K5Q A;  3HTU A;  1OKR A;  3A4C A;  1CF7 A;  3ZMS A;  2XRO A;  3ONQ A;  3BRO A;  3K4K A;  5H6R A;  3ASO H;  4E7S A;  2M8E A;  3LSJ A;  1OCT C;  1ETQ A;  3HRU A;  2PJR B;  5IT3 A;  3WTW C;  5BPI A;  1RR8 C;  2QWW A;  4HLX A;  4UV9 A;  2AS5 F;  2E34 A;  5JVT A;  1OIS A;  1AWC A;  2P7C B;  5BQT A;  1Y0U A;  2V1D A;  4LB6 B;  3DPU A;  4RB1 A;  1R1U A;  2Z3Y A;  2FBH A;  1Z6R A;  4B43 A;  3CES A;  3BG3 A;  3GZ5 A;  4LLN A;  4S0H B;  2X9D A;  4EM0 B;  3GWZ A;  3TW7 A;  2RVC A;  5LGT A;  2I10 A;  2W48 A;  2E2J J;  2WAQ A;  3ASN H;  1DQU A;  4RGX A;  3QPL A;  3IWZ A;  4EM1 A;  4A3K J;  3NAU A;  2M9H A;  3IHU A;  1YRN B;  2R7O A;  2XF6 A;  2PN6 A;  4GXO A;  4LG0 B;  1ZGJ A;  2M2E A;  3L2C A;  2VBY A;  1TNT A;  2XHK A;  3IAS 2;  4AWX B;  3CCE I;  2AO9 A;  4II3 A;  5ERI A;  4CZZ A;  2HVS A;  1XB4 A;  3RPU D;  1MD0 A;  2PG4 A;  3CCQ I;  4G6D A;  2W84 A;  2XPV A;  5B1B H;  1B9M A;  3LSG A;  2VLA A;  5DUK A;  2ME0 A;  2VBW A;  2VBX A;  3EUK L;  1RPW A;  1MMD A;  1UG2 A;  2Q0O A;  3MCZ A;  2OQG A;  5LEK A;  3FXL A;  4CCN A;  2H6C A;  4XSZ F;  4IQ4 A;  5JHF A;  3KET A;  4LG0 A;  2XVC A;  2EIJ H;  3C2H A;  5CVI A;  1BL0 A;  2R0Q C;  3RQI A;  1JUS A;  1ZKG A;  4BDZ A;  2VJJ A;  2WTE A;  2DT5 A;  3IH3 A;  3CJR B;  5K5O A;  5L3D A;  2IJL A;  1IDZ A;  3CUQ C;  1BM9 A;  5EYR A;  3OOP A;  2XF7 A;  3HHH A;  2Y0S N;  2ZKZ A;  2HOT A;  4P9U A;  4A5M A;  4IHX A;  1PDN C;  4G94 A;  4RA2 A;  5IP7 J;  3F0C A;  1JKQ C;  1QVU A;  1JHH A;  3TP0 A;  1OMI A;  4ZH4 F;  2GA2 A;  1IG7 A;  2DI3 A;  4E7J A;  3I54 A;  2FSW A;  3Q3S A;  2FBI A;  2RDP A;  4Y3O A;  4B44 A;  3K6G A;  1ZK8 A;  4B8X A;  2DOA A;  4KJZ A;  1HCR A;  3H5R A;  4RB0 A;  2Y48 A;  5FJ8 J;  5F64 A;  5E3N A;  2LFB A;  1MBE A;  1YW8 A;  1J59 A;  2STT A;  5J1Y A;  3ZMZ A;  2H09 A;  4ZDL A;  2XGE A;  5HLT A;  4IX7 A;  1LFB A;  2NNY A;  1RES A;  2V1N A;  4O6J A;  2MH2 A;  2NNN A;  2KIU A;  4RAY A;  4D5C A;  3O8H A;  3I64 A;  4OMZ A;  4PGG A;  3VYR B;  4Y15 A;  2HPI A;  5A2Q Z;  1RKT A;  3FZV A;  5LLQ A;  4WXH A;  2FD5 A;  4NC6 A;  2O61 A;  2TDX A;  3LSH A;  2V1U A;  3V7C A;  1SMT A;  3OS1 A;  3QPH A;  2IS1 A;  1GXQ A;  3FXM A;  5J1R A;  2KT0 A;  3L00 A;  1KGS A;  1Z3Y A;  3R0J A;  3VWB A;  3JW4 A;  1JKP C;  4M74 A;  2BXZ A;  3VSK A;  2XGC A;  3PIO F;  2QSF X;  2DW4 A;  3E5Q A;  2A5W A;  3DTE A;  1T0F A;  2H27 A;  1R58 A;  2VJ4 A;  1FBQ A;  2XPU A;  5FFZ A;  2Z5U A;  2WY7 Q;  4II2 A;  1XGO A;  3CCL I;  3A01 A;  3D5R C;  2LSO A;  3PJR A;  3R0A A;  1JJ8 C;  2HKX A;  4C2T A;  2LP0 A;  3CCY A;  5HS9 A;  3ML6 A;  5L3B A;  2BHY A;  3DBH B;  2X6X A;  4S04 A;  1X58 A;  4FHT A;  5CPR B;  1SAU A;  2GBY A;  3FF5 A;  2NS0 A;  2HOA A;  5LRR A;  4Q4Z F;  1P4X A;  2GWR A;  4YG2 F;  3J7A Y;  2EFO A;  4GCV A;  3HL2 A;  2G7U A;  1IN5 A;  4LIU A;  1QVT A;  4F3Q A;  2RGV A;  4LIT A;  5IOZ A;  3A0H C;  3C7J A;  2TCT A;  1P7J A;  2Q2E A;  3MZ8 A;  5KAF C;  3GTM J;  2K9S A;  3O3K A;  1BJA A;  1EH6 A;  4EGY A;  5JI6 A;  3ZMU A;  4X6A J;  1RI7 A;  1M1E B;  4MFE A;  2IA0 A;  1VQ4 I;  4N4O B;  2DMQ A;  1A36 A;  1GLN A;  1WZ2 A;  2QQB A;  3QYE A;  2R7D A;  1ON1 A;  2HZD A;  1YO5 C;  1FNN A;  3BPV A;  2RV8 A;  3A1Y A;  3OYL A;  4UNO A;  2HTJ A;  3LAP A;  5CYV A;  2AXL A;  4L5I A;  5EG0 B;  4NHJ A;  3PNY A;  2JSP A;  3L2U A;  1SFX A;  3JAM K;  2R3S A;  1I3A A;  2H8W A;  4KT5 C;  4W1U A;  1X1D A;  3VOE A;  1AU7 A;  2HDD A;  1QU3 A;  4CSW A;  2DXI A;  3GBG A;  3DBL B;  2BY3 A;  4WWC A;  4AIJ A;  1ITY A;  3I53 A;  3B73 A;  3TBI A;  4Q48 A;  1JGG A;  2X4H A;  4YFX F;  1HLV A;  5F0C A;  2XGD A;  2DO7 A;  4CHU A;  3H0G J;  4ETS A;  2P5L C;  3JRD A;  4F52 A;  1GXP A;  4M3B A;  1TQP A;  2RKH A;  3DKX A;  5BS6 A;  4L9T A;  2KIF A;  3OYG A;  3S93 A;  3E6M A;  4EJV A;  2ZC2 A;  1MJA A;  2M4G A;  2OCC H;  4CCK A;  3KYL A;  3S1R J;  4ABZ A;  1ORK A;  4H4K C;  3WGI A;  2CQQ A;  4BBS J;  1I6H J;  2A68 F;  3W3C A;  4RDU A;  1TT5 B;  1WJF A;  3I5U A;  4ESJ A;  5DYM A;  2OD5 A;  3MKZ A;  1X3W B;  4NB5 A;  2EFW A;  3I56 I;  3KIO A;  5HLH A;  4H0E A;  2A6E F;  2A5Y B;  1VZ0 A;  2PJR A;  4NBQ A;  4AVP A;  4QPQ A;  2Y30 A;  1W4M A;  1Q1H A;  2BY2 A;  4KIG A;  2V26 A;  4BAY A;  2XRL A;  4M71 A;  1QGP A;  1I6X A;  3MZY A;  1IO2 A;  3HSF A;  1WFX A;  1H8A C;  3S14 J;  5DDG A;  4ZYH A;  2EZL A;  5GAG J;  4IRI A;  1ZG1 A;  3OYE A;  4HV5 A;  1DUX C;  2LKP A;  2HYF A;  2LLK A;  4AIK A;  2LY2 A;  4P55 A;  2E1M B;  2DJI A;  3AAF A;  2KRC A;  2DA2 A;  2ISY A;  3OSG A;  5TIS C;  3ERE D;  2GXB A;  3H36 A;  4Z6Y A;  1ZN2 A;  1ETK A;  4YFN F;  4DYQ A;  5DCM B;  3OSF A;  4C9Y A;  3QYF A;  1D5V A;  4HF1 A;  2QEX I;  3DEE A;  2E71 A;  2V9P A;  1BC7 C;  2VQL A;  3KEQ A;  2HZT A;  1ZR2 A;  2EJR A;  2X1C A;  4NUB A;  2IP2 A;  4U7B A;  1X4O A;  2ETH A;  1FP1 D;  2E1M C;  4MQ9 F;  4OOI A;  2FRH A;  3PFY A;  3TOA A;  1OFC X;  3J7Y J;  5C4J J;  2Q2E B;  2HPM A;  5CVU A;  3H3V K;  4AID A;  5J8C A;  1LDK B;  3PO2 J;  4BBR J;  3U21 A;  4I2O A;  1Z21 A;  2ZFW A;  1F9N A;  1LEB A;  1D1C A;  4N9I A;  1DGR M;  3ZMD A;  1EH8 A;  2JN6 A;  2O8K A;  2MD0 A;  2HI3 A;  1KQ8 A;  2JVH A;  4XIC A;  2FOK A;  2NS8 A;  2Z1D A;  3BQZ A;  3L2Q A;  2EIM H;  1MBG A;  4EGZ A;  1HA8 A;  3HUG A;  4F93 B;  1RC9 A;  3CQZ J;  4IHW A;  3RCO A;  2MSY A;  2MFZ A;  4JBA A;  2Y9Y A;  2LTP A;  2PMZ A;  4YFK F;  4GDF A;  2VB6 A;  5J40 A;  2CH0 A;  2GLO A;  2XDV A;  4HDU A;  3DQV C;  4L5J A;  2ZJ2 A;  4CYC B;  1W5C C;  1TZL A;  4MTE A;  2EFN A;  4WXD A;  1FLI A;  3SJM A;  1WWX A;  3CUQ A;  4CCL A;  4U87 A;  1Z05 A;  2IGM A;  3TO7 A;  2E7W A;  1NG6 A;  1LDD A;  2G7H A;  5GAE J;  3KEY A;  3TDZ C;  1Z91 A;  5EGO B;  3H9G A;  2F2E A;  3B6C A;  1LJ9 A;  1MBJ A;  4HAM A;  1UHM A;  2CW0 F;  1RIO H;  3QQA A;  2LKX A;  3HSR A;  2KHM A;  1XC5 A;  1VQN I;  1X3Z B;  4KDP A;  1BC8 C;  3DKW A;  2QA4 I;  1A35 A;  4EJW A;  1SFU A;  2E2I J;  1I1G A;  3FBI B;  2XSJ C;  4DZP A;  2ID3 A;  2P4W A;  2L01 A;  2DPU A;  3SFZ A;  2W24 A;  3WU1 B;  3FK7 A;  3WE3 A;  5D4S A;  4ZZD A;  2ELH A;  4A3J J;  2CFX A;  1GDT A;  2CV2 A;  3WTS C;  3VYU B;  3J81 K;  3E7L A;  4U0Y A;  1S3J A;  1IRG A;  3ZN1 A;  2F48 A;  3HG9 A;  3HPG A;  2JK3 A;  4A3L J;  2DLL A;  4UVC A;  3AL0 C;  2E5Z A;  4XOP A;  1XDU A;  3H92 A;  2E19 A;  1DPR A;  3GX4 X;  3OV8 A;  2WAF A;  3GTJ J;  4ZYA A;  3CLQ A;  2CU7 A;  4P1W A;  1MNE A;  4DBQ A;  1MSE C;  2QF7 A;  4G7H F;  4YEJ A;  2F5V A;  4LOC A;  4XK4 A;  2QSG X;  1QHG A;  5IT9 Z;  2AHQ A;  2HDW A;  3V42 A;  4FE4 A;  3K1P A;  1JE8 A;  4M3D A;  2JTV A;  2CO5 A;  2RNJ A;  4BE2 A;  5ICG A;  2ECC A;  2TRT A;  2D2W A;  5IP6 A;  3EYY A;  2ACJ A;  3OYB A;  1XSV A;  5GPC A;  1GHC A;  1MDM B;  3KZY A;  1EKE A;  2DQR A;  4BJT A;  3O2P E;  2K9L A;  3HRS A;  3JTH A;  2D1V A;  1HF0 A;  2OBP A;  1A5J A;  4MQV A;  3HJE A;  1H88 C;  4GO1 A;  3DV8 A;  4UUS B;  2O9L A;  3ZQH A;  3V4G A;  5TRD A;  2DA7 A;  1T0F C;  1BI1 A;  2LR8 A;  1UB9 A;  1QBJ A;  1E2X A;  4BUP A;  4EJO A;  1VF9 A;  3GO5 A;  2H6B A;  3UKG A;  1X3U A;  3ZMT A;  1N77 A;  1IN6 A;  2HGC A;  2F5F A;  2WC2 A;  1W36 D;  2VON A;  1D1B A;  1IXS B;  1TNS A;  1IUF A;  2A61 A;  1E0E A;  5E1X A;  5H20 A;  5HNH A;  3FHZ A;  4XLN F;  4IHS A;  5DV5 A;  1SFE A;  2ZJQ F;  3NQO A;  3BOQ A;  1SAN A;  2F4I A;  3G1L A;  2CQX A;  2E60 A;  1RUO A;  4IOC F;  2R7F A;  3H9Q A;  4XBF A;  4J00 A;  1QNT A;  2ZJP F;  1LQ1 A;  1AHD P;  3A0B C;  1YJ9 I;  4V19 K;  1Z67 A;  3DCF A;  2VPR A;  4IXA A;  1SEU A;  1RR7 A;  1USS A;  1R5H A;  3R61 A;  4M9X A;  5L3C A;  2LC2 A;  3MKL A;  4HQM A;  1BW5 A;  1Z0X A;  2GZW A;  4U7D A;  1SD7 A;  3KZI C;  3I4M J;  3KPH A;  4B47 A;  2EIL H;  3CZ6 A;  2OZU A;  4Y17 A;  1R1T A;  4C30 A;  4IO9 F;  4ZC3 A;  3TO9 A;  3Q0U A;  3BP8 A;  3MMY B;  3LSK A;  3LA3 A;  3PNV A;  5J47 A;  1XMX A;  3PSI A;  4NC8 A;  1P4A A;  1X1B A;  1ZAR A;  2KIM A;  2W82 A;  5IYD J;  3D0S A;  2Z99 A;  3NEU A;  1NG7 A;  5E20 A;  1QZE A;  2LF7 A;  3CF5 F;  3WTT C;  4E4H A;  2DA6 A;  4ENK A;  4DJA A;  3K9T A;  2NVU B;  2QQA A;  5B3S H;  3S3O A;  5EJC A;  5FRN A;  1P4W A;  4C3J J;  3LQQ A;  5F0F A;  5LHI A;  1J7K A;  4NNJ A;  2DBB A;  5ICE A;  2FUG 2;  3HOY J;  1ZEL A;  4JX4 A;  2ZXI A;  3M8J A;  3MD2 A;  4B48 A;  2IAI A;  3KLN A;  1ENH A;  1HKT A;  2EZH A;  3CCV I;  3DXJ F;  2WAQ N;  3CDL A;  3BR6 A;  3EQL F;  2LDU A;  2FXA A;  4A0Y A;  2EZK A;  2RQQ A;  2WY8 Q;  1S7O A;  4B3X A;  1WCM J;  1S5L C;  3C1D A;  4FX0 A;  4KNY A;  1P9Q C;  3RQ4 A;  3F23 A;  4OIP F;  4PZJ A;  3TW6 A;  3K4M A;  3M7G A;  3RIR A;  1D0Y A;  2L9N A;  3HOU J;  1SD5 A;  1TT0 A;  1VQO I;  2MW8 A;  2PLY A;  2O3F A;  5IY5 H;  1WVR A;  4R79 A;  4QSH A;  3K70 C;  2K86 A;  3M9A A;  1WQ2 A;  4PGH A;  5D8L B;  3L09 A;  5HDN A;  2VOD A;  4QTR A;  5CLS A;  1BR4 A;  1YOV B;  1Y8Q B;  1KA8 A;  3DU6 A;  3WU2 C;  2JQ7 A;  3GTL J;  2OF7 A;  3G2B A;  3WTY C;  5GAH J;  3VEP A;  1STZ A;  3J80 K;  5F04 A;  2GQQ A;  1TP4 A;  2OU2 A;  2IS2 A;  4I0A A;  4A0X A;  1ZRE A;  1SD6 A;  1MH4 A;  1J5Y A;  1IXR C;  3U1K A;  2FE3 A;  4XRS A;  2M87 A;  1BR2 A;  3BPX A;  2FF4 A;  2R7W A;  1S72 I;  2COM A;  1R23 A;  5FLM J;  1A04 A;  2IVM A;  4U0V A;  2E1O A;  4OWR B;  5KK1 A;  4L0Z B;  4HDV A;  3ABL H;  2W25 A;  3R4K A;  3CME I;  1Y39 A;  4KYW A;  1U5T B;  3HOV J;  5K5R A;  4MFD A;  3TL4 X;  4XON A;  1WJB A;  4D5F A;  5DM7 F;  1YX5 A;  1VND A;  1OJL A;  1LDJ A;  4BYY A;  2NVX J;  2M7B A;  1MH3 A;  4XRS G;  4YIR X;  3HGY A;  2VQC A;  2KJB A;  1LNW A;  4XL9 A;  3HBL A;  4Y33 A;  2LY1 A;  1B6A A;  3WU0 A;  4D7N A;  5ICC A;  3QOP A;  3ZQ7 A;  4FAS D;  2M5W A;  5KHD A;  3DBR B;  2BVL A;  3RKW A;  4M9Z A;  3A2K A;  4BQO A;  4F91 B;  5L3E A;  3GUD A;  3G6E I;  4KT6 A;  4AVZ A;  2X0L A;  1J2X A;  1KQ0 A;  5HLG A;  2DOF A;  4P5O A;  4BJ5 C;  2VJI A;  1IAW A;  3OS0 A;  1K83 J;  1UG0 A;  1WJ5 A;  3AG4 H;  4FIS A;  4JOM A;  1O3R A;  4EVI A;  2L7F P;  4KN4 X;  2M34 A;  2LK2 A;  3AL0 B;  2DTR A;  3JRC A;  4XKW A;  3J80 Z;  1BOB A;  1J9I A;  5DS9 A;  1ZRC A;  4NC7 A;  1BIB A;  1U8B A;  3Q9S A;  4JK1 X;  4OIR F;  4RS8 A;  1KU3 A;  1XN7 A;  2P6T A;  3FWE A;  2IS6 A;  1X1C A;  4RGR A;  1PUF B;  2RN7 A;  3CC4 I;  2Z9O A;  3F6O A;  3G71 I;  2IT0 A;  4MIM A;  1G3T A;  3HOX J;  5H2F C;  1T08 B;  2LG4 A;  3J7Z I;  3G4S I;  1J75 A;  1FJL A;  2BXY A;  1R71 A;  3DFG A;  1Y1W J;  5L3G A;  4M6X A;  3H5N A;  4ANJ A;  2HQR A;  2L0K A;  3BZC A;  4BEH A;  5LHG A;  2KQR A;  1CF7 B;  9ANT A;  1ETV A;  2WB1 N;  4AYB N;  3K0L A;  3F21 A;  3O6B B;  2L9V A;  2M4K A;  2OAZ A;  1QPI A;  4FTH A;  1UHW A;  3T0Y A;  3F8B A;  3FXQ A;  2GOX B;  5EDN A;  1G6N A;  2BW3 A;  5FKL A;  3TED A;  2P5V A;  3LST A;  2LVS A;  3K2A A;  4ESB A;  1W1W E;  1C0W A;  1MBF A;  1ONV A;  2CUJ A;  3G1M A;  5ILS A;  4A5N A;  4XKC A;  1P7I A;  2JWT A;  2COB A;  2LBF A;  1BIA A;  2MC4 A;  3PUF A;  3HHG A;  2KIS A;  1D3Y A;  1WGX A;  3RYP A;  2ZCW A;  3BJO A;  2ZXJ A;  3AFH A;  1K4S A;  4OAY A;  2JT1 A;  2L3D A;  3S3M A;  6PAX A;  3FM3 A;  2MA3 A;  3GTP J;  2KLO A;  4HPQ A;  3TKY A;  4XRM A;  1VI0 A;  3CP2 A;  2R7X A;  3GTQ J;  3ERM A;  4AM3 A;  3S32 A;  2IEK A;  2M8G X;  1MMN A;  1Z6T A;  3ISP A;  3LA7 A;  1FSE A;  4TV7 A;  3JSO A;  1I5Z A;  1FIA A;  1W0T A;  3GF2 A;  1FYL A;  1ON2 A;  3GCM A;  4BKX A;  5LRS A;  4LG3 A;  1FIP A;  4G9Y A;  3ZGK A;  2CMP A;  3J7A O;  4M6Y A;  3VPR A;  1FMW A;  2IRF G;  2V4J C;  3ZQQ A;  3EUH A;  2VN2 A;  4HF0 A;  1S6L A;  5AON A;  4G7O F;  4BDY A;  4DYC A;  1KU7 A;  2W4S A;  2QLZ A;  1YS6 A;  3BT9 A;  2P6S A;  2DFI A;  3S1Q J;  2I8D A;  1R36 A;  2X1E A;  2EB7 A;  3E6B A;  1ETO A;  3FMS A;  5JR3 A;  2VC1 A;  1YJN I;  1FP2 A;  1LKX A;  4ASN A;  3VYT B;  5E17 F;  4CH7 A;  2JPC A;  2QM3 A;  2NAZ A;  2DA4 A;  3I9V 2;  2VKE A;  3WOD F;  5ILU A;  2LY9 A;  1MBK A;  4UV8 A;  5J4V A;  3P9C A;  4M3G A;  1D1A A;  1UMQ A;  4FX4 A;  3TO6 A;  2NOG A;  1EF4 A;  2FQ3 A;  5JLX A; 
#chains in the Genus database with same CATH homology
 4LGW A;  2O0Y A;  3D5L A;  4ZYD A;  5E8I A;  3Q5F A;  3HYI A;  4A0Z A;  3KE2 A;  2MBF A;  5HDK A;  2HQN A;  3HIF A;  5HVQ C;  2PQ8 A;  4HOB A;  1O7F A;  3KP7 A;  5FLX Z;  2KJC A;  3F72 A;  4N9H A;  2M30 A;  1Z1D A;  1YYV A;  1QQI A;  3T1B A;  2IA1 A;  5HS7 A;  1OPC A;  2XGX A;  3U1D A;  1BOA A;  4FT8 A;  2ESH A;  1DDN A;  4UXN A;  1HW1 A;  4ENJ A;  3IKV A;  2V79 A;  3JSP A;  3WTZ A;  1K78 B;  4QWQ A;  2UXN A;  3I4P A;  3MQ0 A;  4LD5 A;  5J6X A;  4IRH A;  4EM2 A;  3DP7 A;  2BE5 F;  2STW A;  2HEO A;  2O6G E;  1RNL A;  4OIO F;  4WX9 A;  3DEU A;  1BBY A;  5CVJ A;  5FD5 A;  1FWZ A;  1SMY F;  3U2R A;  3F8F A;  1ZYR F;  4Q47 A;  4E70 A;  4BHP A;  4P96 A;  5LGN A;  1K7A A;  3GEZ A;  1JGS A;  3GVA A;  2YSR A;  2E7X A;  2DK5 A;  2Y75 A;  5FO5 A;  1HW2 A;  4O5V A;  1MJ9 A;  2IA2 A;  1YW9 A;  2Y0M A;  4KIC A;  2VBZ A;  2HR3 A;  1IN8 A;  2W85 A;  1TTY A;  4WCG A;  1G4D A;  2A07 F;  4KUM A;  2M45 A;  1BN5 A;  2OQR A;  4EV0 A;  2UWM A;  3I58 A;  4UVA A;  3GLX A;  2MLK A;  2HKO A;  3WGG A;  2ZO4 A;  2H94 A;  2HWV A;  4IF4 A;  5D6E A;  4I01 A;  4IJA A;  5LEJ A;  4LK1 F;  4MGR A;  4GYG A;  2DAO A;  2QBY A;  4GYI A;  5FLX K;  1D8K A;  5D5X B;  1TW3 A;  3PQK A;  4UVB A;  3CJN A;  2K02 A;  4O3M A;  5E1Z B;  3CO7 C;  1YTY A;  2JSC A;  1D8J A;  4F7Z A;  3FMQ A;  4HQE A;  5FGM A;  3F8N A;  3FXU A;  3IC7 A;  3HOT A;  5DCF A;  4YII A;  3R6S A;  4L9J A;  4HZF A;  3FM5 A;  3VB2 A;  5LGU A;  3GZ6 A;  2QVO A;  1QPM A;  1CGP A;  1XGN A;  1SD4 A;  1R00 A;  4G6Q A;  1R7J A;  3K1M A;  4HV6 A;  1YFH A;  1T2K A;  4RB2 C;  2K4B A;  4HW0 A;  3IRR A;  4QLC U;  3M8E A;  4RGU A;  1FYK A;  2QEN A;  3QP6 A;  5EEH A;  3I59 B;  2J5P A;  2QQ9 A;  3T8R A;  3TGN A;  4U88 A;  4LK0 F;  2DQL A;  2RQP A;  1B4A A;  3ELK A;  3V7R A;  3TOB A;  1F5T A;  1LVA A;  3KEO A;  3MWM A;  5HOO A;  3CO6 C;  5F6F A;  4L9V A;  3H3Z A;  4HLY A;  1XDS A;  4S05 A;  3BY6 A;  1Z7U A;  3EDP A;  4BXU A;  2CYY A;  3P7N A;  1DPU A;  4HYE A;  2A6H F;  2YX7 A;  3G3Z A;  4U0W A;  2L02 A;  2GAU A;  3HTS B;  1HXD A;  1O57 A;  3NRV A;  4M73 A;  3L9F A;  2FU4 A;  1XMK A;  1ZLJ A;  1XMA A;  2VE9 A;  3RKX A;  1FX7 A;  2G9W A;  3VOD A;  1KQ9 A;  1HKS A;  4IPA A;  2WWY A;  4RAZ A;  1MZB A;  4ON0 A;  1U5T A;  2XAH A;  3GYH X;  2XAS A;  1L3L A;  1TBX A;  1FZP B;  5FD6 A;  3V8K A;  1SAX A;  5JHU A;  3E6C C;  3BDD A;  3Q9V A;  4OMY A;  1KYW A;  3E5U A;  2ADU A;  2XAJ A;  1NHA A;  4DNC A;  4RGS A;  4N0B A;  5L3F A;  4KMU X;  1JHF A;  1OR7 A;  1FPQ A;  1YIO A;  1IXC A;  2VOO A;  5FFX A;  4UHT A;  2PBI A;  2FNP A;  1UFM A;  3SHF A;  5JFR A;  2FNA A;  1K6O A;  3MFK A;  3N97 A;  1PUE E;  5D5W B;  2O03 A;  1R22 A;  3K1N A;  2DPD A;  1PP8 F;  1YLF A;  2XKO A;  3FMR A;  5ICF A;  1IN7 A;  3PQJ A;  4CYD A;  5K1Y A;  4OIN F;  2Z33 A;  4EMS A;  5ILV A;  4XRF A;  1DP7 P;  1FC3 A;  3WTU C;  4R8H A;  5ED4 A;  3F8C A;  1ZRD A;  2PMH A;  5EEG A;  3I0T A;  3TDU C;  3RYR A;  2EV0 A;  4B09 A;  4CIC A;  2MC3 A;  4P9F A;  2K27 A;  4WXC A;  3ZN0 A;  3BJA A;  3H3U A;  2BEO A;  4BH9 A;  2ZNZ A;  4ESF A;  1T39 A;  5DCM A;  4HX7 A;  3HRM A;  2KKO A;  1IN4 A;  5E18 F;  4PCQ A;  1MJB A;  3LQR A;  1FY7 A;  2YX4 A;  5DEQ A;  1OYY A;  3BWG A;  3N4M A;  4M72 A;  3RTR A;  2RC4 A;  1HKQ A;  1HST A;  1S7A A;  3M8F A;  1H9G A;  1ZAO A;  4JQF A;  4I7H A;  3QU3 A;  3IRQ A;  3KP6 A;  1ZGA A;  3CTA A;  2CG4 A;  3T8T A;  3F3X A;  1UCR A;  2IPQ X;  2K7L A;  2EA2 A;  1H0M A;  2P8T A;  2V1X A;  3GW2 A;  3KP4 A;  1V3F A;  1I1S A;  1XGS A;  1YG2 A;  1K78 A;  2FEZ A;  4ENM A;  3E6D A;  4G7Z F;  2Q8K A;  1FSH A;  3REO A;  4KN7 X;  1F1Z A;  5D8K B;  3LWF A;  4NQW A;  3F8M A;  2YU3 A;  1FOK A;  3JAM Z;  1REP C;  4IVN A;  3CUO A;  4MEY F;  1IRF A;  1B59 A;  1L0O C;  1BI0 A;  2BYV E;  3CUQ B;  2XAQ A;  2JPB A;  4HF2 A;  1S29 A;  3IL2 A;  1XGM A;  2XAF A;  4KMF A;  1O3Q A;  3ZPL A;  4EQQ A;  4L9N A;  4M9S A;  4KA4 A;  3MZH A;  1HW5 A;  2CGP A;  1QZZ A;  5D5V B;  3TQN A;  3KP5 A;  2C6Y A;  1TQM A;  1FBU A;  1P2F A;  2GIV A;  1J0R A;  4XSX F;  3MAJ A;  3GFJ A;  4ENN A;  5FB2 A;  2YPR A;  5H6Q A;  3QAH A;  2W57 A;  3P9K A;  4G8X A;  1XD7 A;  3EYI A;  2EK5 A;  4EJT A;  5KVR A;  3C3W A;  1ODD A;  2O8X A;  1MKM A;  2PFB A;  1ZHF A;  4HX8 A;  5DD4 A;  3RI4 A;  2LNB A;  4GGG A;  2V9V A;  4RB3 C;  2P7V B;  1QO0 D;  5TJJ A;  4A2U A;  3ABT A;  5AIP A;  4CXF A;  1ZG5 A;  5IT9 K;  2OZ6 A;  3L7W A;  2UXX A;  4L0Y B;  2OA4 A;  2NYX A;  3HOS A;  1XSX A;  1YQA A;  3F6V A;  2CSO A;  2FA5 A;  3P9I A;  4PDK A;  4HX4 A;  5LBQ A;  1ZRF A;  1LB2 A;  4K2E A;  4Z2Y A;  1W7P B;  1EV7 A;  3VFZ A;  2XRN A;  5AIQ A;  2HYG D;  1ZLK A;  1TLH B;  3ROU A;  1KU2 A;  1B9N A;  5HLI A;  3LAJ A;  5BPD A;  1TW2 A;  3HRT A;  3ECO A;  1WRJ A;  1V4R A;  3QU6 A;  1FT9 A;  3SZP A;  1K79 A;  3WGH A;  4MHG A;  2M1B A;  3WTV C;  3IKT A;  1ZH5 A;  1XCV A;  1U2W A;  1U6G A;  3WE2 A;  3E97 A;  5HS8 A;  3E3V A;  4IHT A;  2EFP A;  5F1R A;  5D4R A;  2EV6 A;  1WI9 A;  3RPU A;  2ESN A;  3V8L A;  5DD8 A;  1PP7 U;  2QUF A;  3ECH A;  1G3W A;  2DU9 A;  4R1H A;  4WK8 F;  4I0B A;  2QBY B;  1HSJ A;  5D6F A;  1HQC A;  1P6R A;  1T38 A;  2F5C A;  3C18 A;  2L4M A;  3KP3 A;  2QZ8 A;  1U8R A;  3S2W A;  3ZMV A;  3QRF F;  1MDM A;  4KFC A;  3IWF A;  2VT2 A;  3LA2 A;  1AOY A;  3HSE A;  4ZZL A;  1U3E M;  2VT3 A;  1R5G A;  2HS5 A;  4Y13 A;  1JXS A;  2IW5 A;  1BI3 A;  3W6K B;  5E8G A;  2YR2 A;  2PJP A;  4BHB A;  2XIG A;  1U78 A;  2F5E A;  3I59 A;  3BJ6 A;  1T6S A;  1UST A;  1HBX G;  2PEX A;  1OYI A;  4A6D A;  1LEA A;  3J81 Z;  4LFU A;  5A2Q K;  4BQA A;  2EV5 A;  4I09 A;  1XCB A;  2EWN A;  2PMU A;  1W5T A;  3WG9 A;  1H9T A;  3ULQ B;  2LF8 A;  5BOX A;  4UUV A;  3RJP A;  3V7S A;  2ZME B;  3CDH A;  2K4J A;  3GFM A;  2VC0 A;  3DPT A;  4LMY A;  4I02 A;  3K2Z A;  2EFQ A;  2J5O A;  4XLP F;  1KU9 A;  2VXZ A;  4BNC A;  2D1H A;  1FBS A;  2ZNY A;  3RKY A;  4MNU A;  4ZYG A;  1QZY A;  2BV6 A;  2L4A A;  3LFK A;  2XAG A;  2CQK A;  3B02 A;  3BZ6 A;  5BMZ A;  4CO8 A;  1W7P D;  2XUB A;  2HOE A;  1S8N A;  1FYM A;  3FXR A;  1TQI A;  4EJU A;  2BGC A;  3WTX C;  2V6C A;  2HFH A;  1U5T C;  4LLG F;  5CVV A;  3KFW X;  3ZP5 A;  2B0L A;  4L18 B;  1R1V A;  3SQN A;  4CDG A;  5CVR A;  1WSU A;  1BI2 A;  1MGT A;  4A6E A;  2A3S A;  1E17 A;  2XV4 S;  3MEX A;  1ULY A;  2FML A;  4WF2 A;  4D0P A;  1W5S A;  3CLO A;  3G73 A;  3DPL C;  1P92 A;  4LLL A;  3K69 A;  5D5U B;  2E1N A;  2JRT A;  3U9G A;  1O3T A;  3KCC A;  1IF1 A;  5CJ9 A;  2E1C A;  1IUY A;  4MTD A;  3COA C;  1WKM A;  2CWE A;  1Z9C A;  1W7P A;  2QYO A;  4DQ2 A;  4LB5 A;  2JZY A;  2F5D A;  4AD9 A;  4IRG A;  1O3S A;  1XSD A;  1T98 A;  4KIB A;  2HDC A;  3V8J A;  3RPQ A;  4MEX F;  4ZYE A;  3FX3 A;  4I98 B;  4OIQ F;  3I71 A;  2XKP A;  1B1B A;  1VTN C;  2ISZ A;  2L54 A;  3E5X A;  3F22 A;  4CGZ A;  1RZ4 A;  4OU0 A;  2HTS A;  2WV0 A;  3SZT A;  3EET A;  3KP2 A;  5E1W A;  2A69 F;  1OYW A;  4HBL A;  3QPT A;  2VOP A;  3QP5 A;  5LHH A;  2GA1 A;  1YS7 A;  5HDG A;  3DF8 A;  2FBK A;  2P5K A;  2PI0 A;  3KLO A;  1G3Y A;  3GXO A;  4KIF A;  1YW7 A;  3JTG A;  2ZBK A;  3ABU A;  1IW7 F;  2UZK A;  2BBY A;  3W6J B;  2D45 A;  2VE8 A;  1G3S A;  3RDI A;  3T5X A;  3GFI A;  1F4K A;  4LJZ F;  2GXG A;  4BHC A;  4HA8 A;  2EA4 A;  2FMY A;  2ZME A;  1I27 A;  1ZG3 A;  5J8F A;  1GVJ A;  2KRF A;  1IZ1 A;  3KZZ A;  3GFL A;  1RUN A;  2MLG A;  2DK8 A;  4A12 A;  1O7L A;  2NRA C;  1KYZ A;  3SXY A;  3PFI A;  4AIH A;  2MD5 A;  1EH7 A;  4YIF A;  3R60 A;  2MH9 A;  4Q5S F;  5DUI A;  3M1E A;  5K5Q A;  3HTU A;  1OKR A;  1CF7 A;  3ZMS A;  2XRO A;  3BRO A;  5H6R A;  2M8E A;  3HRU A;  5IT3 A;  3WTW C;  5BPI A;  2QWW A;  4HLX A;  4UV9 A;  2AS5 F;  5JVT A;  1AWC A;  2P7C B;  5BQT A;  1Y0U A;  2V1D A;  4LB6 B;  4RB1 A;  1R1U A;  2Z3Y A;  2FBH A;  1Z6R A;  3GZ5 A;  4LLN A;  4EM0 B;  3GWZ A;  5LGT A;  2RVC A;  4RGX A;  3IWZ A;  4EM1 A;  3IHU A;  2PN6 A;  4GXO A;  4LG0 B;  3L2C A;  1ZGJ A;  2VBY A;  1TNT A;  2XHK A;  4AWX B;  5ERI A;  4CZZ A;  1XB4 A;  1MD0 A;  2PG4 A;  4G6D A;  2W84 A;  1B9M A;  5DUK A;  2VBW A;  2VBX A;  2Q0O A;  3MCZ A;  2OQG A;  5LEK A;  2H6C A;  4XSZ F;  3KET A;  4LG0 A;  2XVC A;  5CVI A;  2WTE A;  2DT5 A;  5K5O A;  5L3D A;  2IJL A;  3CUQ C;  1BM9 A;  3OOP A;  3HHH A;  2ZKZ A;  4P9U A;  4A5M A;  1PDN C;  4G94 A;  1JHH A;  1OMI A;  4ZH4 F;  2GA2 A;  2DI3 A;  3I54 A;  2FSW A;  2FBI A;  2RDP A;  4B8X A;  4RB0 A;  2Y48 A;  5F64 A;  1YW8 A;  1J59 A;  2STT A;  3ZMZ A;  2H09 A;  2NNY A;  4O6J A;  2MH2 A;  2NNN A;  2KIU A;  4RAY A;  3I64 A;  4OMZ A;  4PGG A;  4Y15 A;  5A2Q Z;  3FZV A;  5LLQ A;  4WXH A;  2O61 A;  2TDX A;  2V1U A;  3V7C A;  1SMT A;  3QPH A;  1GXQ A;  3L00 A;  1KGS A;  3R0J A;  3JW4 A;  4M74 A;  2DW4 A;  3E5Q A;  1T0F A;  2H27 A;  1R58 A;  1FBQ A;  5FFZ A;  2Z5U A;  1XGO A;  2LSO A;  3R0A A;  2HKX A;  5HS9 A;  3ML6 A;  5L3B A;  4S04 A;  4FHT A;  3FF5 A;  2NS0 A;  5LRR A;  4Q4Z F;  1P4X A;  2GWR A;  4YG2 F;  2EFO A;  4GCV A;  2G7U A;  1IN5 A;  2RGV A;  3C7J A;  2Q2E A;  3O3K A;  1BJA A;  1EH6 A;  4EGY A;  5JI6 A;  3ZMU A;  1RI7 A;  2IA0 A;  2QQB A;  2R7D A;  1ON1 A;  1YO5 C;  1FNN A;  3BPV A;  2RV8 A;  4UNO A;  2HTJ A;  3LAP A;  5CYV A;  2AXL A;  4L5I A;  4NHJ A;  1SFX A;  3JAM K;  2R3S A;  4KT5 C;  3VOE A;  4WWC A;  4AIJ A;  3I53 A;  3B73 A;  4Q48 A;  2X4H A;  4YFX F;  2DO7 A;  4CHU A;  4ETS A;  2P5L C;  1GXP A;  1TQP A;  2RKH A;  5BS6 A;  4L9T A;  2KIF A;  3E6M A;  4EJV A;  1MJA A;  3WGI A;  2A68 F;  3I5U A;  4ESJ A;  5DYM A;  2OD5 A;  2EFW A;  4NB5 A;  5HLH A;  4H0E A;  2A6E F;  2A5Y B;  4AVP A;  1W4M A;  1Q1H A;  4KIG A;  4BAY A;  4M71 A;  1QGP A;  1I6X A;  3MZY A;  3HSF A;  5DDG A;  4ZYH A;  4IRI A;  1ZG1 A;  4HV5 A;  1DUX C;  2LKP A;  2HYF A;  4AIK A;  4P55 A;  3AAF A;  2ISY A;  3ERE D;  2GXB A;  1ZN2 A;  4YFN F;  5DCM B;  1D5V A;  4HF1 A;  1BC7 C;  3KEQ A;  2HZT A;  2EJR A;  2IP2 A;  4U7B A;  2ETH A;  1FP1 D;  3TOA A;  4MQ9 F;  4OOI A;  2FRH A;  5CVU A;  5J8C A;  1LDK B;  4I2O A;  2ZFW A;  1F9N A;  1LEB A;  4N9I A;  3ZMD A;  1EH8 A;  1KQ8 A;  2FOK A;  4EGZ A;  3HUG A;  4JBA A;  4YFK F;  4HDU A;  3DQV C;  4L5J A;  2ZJ2 A;  4MTE A;  2EFN A;  4WXD A;  1FLI A;  1WWX A;  3CUQ A;  1Z05 A;  3TO7 A;  2E7W A;  1LDD A;  2G7H A;  3TDZ C;  1Z91 A;  2F2E A;  1LJ9 A;  4HAM A;  1UHM A;  2CW0 F;  1RIO H;  3HSR A;  4KDP A;  1BC8 C;  3DKW A;  4EJW A;  1SFU A;  1I1G A;  2P4W A;  2L01 A;  2DPU A;  3SFZ A;  2W24 A;  3WU1 B;  3WE3 A;  5D4S A;  4ZZD A;  2ELH A;  2CFX A;  3WTS C;  3J81 K;  4U0Y A;  1S3J A;  1IRG A;  3ZN1 A;  2DLL A;  4UVC A;  1XDU A;  3H92 A;  1DPR A;  3GX4 X;  3OV8 A;  4G7H F;  5IT9 Z;  3K1P A;  1JE8 A;  2JTV A;  2CO5 A;  2RNJ A;  5ICG A;  2D2W A;  2ACJ A;  3EYY A;  1XSV A;  1GHC A;  1MDM B;  3KZY A;  2DQR A;  3O2P E;  3HRS A;  3JTH A;  2D1V A;  2OBP A;  4MQV A;  4GO1 A;  3DV8 A;  3V4G A;  5TRD A;  1BI1 A;  1UB9 A;  1QBJ A;  1E2X A;  4EJO A;  3GO5 A;  2H6B A;  1X3U A;  3ZMT A;  1IN6 A;  2HGC A;  2F5F A;  2WC2 A;  2VON A;  1IXS B;  1TNS A;  2A61 A;  5E1X A;  5H20 A;  3FHZ A;  4XLN F;  4IHS A;  5DV5 A;  1SFE A;  3NQO A;  3BOQ A;  1RUO A;  2R7F A;  4XBF A;  1QNT A;  1LQ1 A;  4IXA A;  1USS A;  1R5H A;  3R61 A;  4M9X A;  5L3C A;  4HQM A;  2GZW A;  4U7D A;  1SD7 A;  2OZU A;  4Y17 A;  1R1T A;  3TO9 A;  3BP8 A;  3LA3 A;  1P4A A;  1ZAR A;  2KIM A;  3D0S A;  2Z99 A;  3NEU A;  5E20 A;  2LF7 A;  3WTT C;  4ENK A;  3K9T A;  2QQA A;  1P4W A;  3LQQ A;  5LHI A;  1J7K A;  2DBB A;  5ICE A;  3KLN A;  1HKT A;  3DXJ F;  3EQL F;  2LDU A;  2FXA A;  4A0Y A;  1S7O A;  3C1D A;  4FX0 A;  4KNY A;  3F23 A;  4OIP F;  4PZJ A;  3RIR A;  3M7G A;  1SD5 A;  2PLY A;  2O3F A;  4R79 A;  2K86 A;  3M9A A;  1WQ2 A;  4PGH A;  5D8L B;  3L09 A;  5HDN A;  2VOD A;  5CLS A;  1KA8 A;  3WTY C;  3VEP A;  1STZ A;  3J80 K;  2GQQ A;  2OU2 A;  4I0A A;  4A0X A;  1ZRE A;  1SD6 A;  1J5Y A;  1IXR C;  2FE3 A;  2M87 A;  3BPX A;  2FF4 A;  2COM A;  1R23 A;  1A04 A;  2IVM A;  4U0V A;  5KK1 A;  4L0Z B;  4HDV A;  2W25 A;  3R4K A;  4KYW A;  1U5T B;  5K5R A;  1LDJ A;  4BYY A;  2KJB A;  1LNW A;  1B6A A;  3WU0 A;  5ICC A;  3QOP A;  3ZQ7 A;  2M5W A;  3RKW A;  4M9Z A;  5L3E A;  3GUD A;  2X0L A;  1J2X A;  1KQ0 A;  5HLG A;  4P5O A;  1IAW A;  1O3R A;  4EVI A;  4KN4 X;  2DTR A;  3J80 Z;  1J9I A;  1ZRC A;  1BIB A;  3Q9S A;  4JK1 X;  4OIR F;  4RS8 A;  1KU3 A;  1XN7 A;  2P6T A;  3FWE A;  4RGR A;  2RN7 A;  2Z9O A;  3F6O A;  2IT0 A;  1G3T A;  1J75 A;  3DFG A;  5L3G A;  4M6X A;  2HQR A;  5LHG A;  1CF7 B;  3F21 A;  3K0L A;  3O6B B;  2OAZ A;  1UHW A;  3T0Y A;  3F8B A;  3FXQ A;  1G6N A;  2P5V A;  3LST A;  4ESB A;  1C0W A;  1ONV A;  5ILS A;  4A5N A;  1BIA A;  3HHG A;  1D3Y A;  3RYP A;  2ZCW A;  3BJO A;  2ZXJ A;  2JT1 A;  2L3D A;  6PAX A;  3FM3 A;  2MA3 A;  3TKY A;  3ISP A;  3LA7 A;  4TV7 A;  1Z6T A;  3JSO A;  1FSE A;  1I5Z A;  3GF2 A;  1FYL A;  1ON2 A;  5LRS A;  4G9Y A;  3J7A O;  4M6Y A;  2IRF G;  3EUH A;  2VN2 A;  4HF0 A;  1S6L A;  5AON A;  4G7O F;  1KU7 A;  2QLZ A;  1YS6 A;  2P6S A;  2DFI A;  1R36 A;  2EB7 A;  3E6B A;  3FMS A;  5JR3 A;  2VC1 A;  1FP2 A;  4ASN A;  5E17 F;  2JPC A;  2QM3 A;  2NAZ A;  3WOD F;  5ILU A;  4UV8 A;  3P9C A;  4FX4 A;  3TO6 A;  2FQ3 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...