4AIKA

Crystal structure of rova from yersinia in complex with an invasin promoter fragment
Total Genus 52
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
52
sequence length
139
structure length
139
Chain Sequence
b'STLGSDLARLVRVWRALIDHRLKPLELTQTHWVTLYNINRLPPEQSQIQLAKAIGIEQPSLVRTLDQLEEKGLITRHTSANDRRAKRIKLTEQSSPIIEQVDGVISSTRKEILGGISSDEIAVLSGLIDKLEKNIIQLQ'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords TRANSCRIPTIONAL REGULATOR SLYA
publication title Structural Basis for Intrinsic Thermosensing by the Master Virulence Regulator Rova of Yersinia.
pubmed doi rcsb
source organism Yersinia pseudotuberculosis
molecule tags Transcription
total genus 52
structure length 139
sequence length 139
chains with identical sequence B
ec nomenclature
pdb deposition date 2012-02-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01047 MarR MarR family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 4aikA00
1HSTA 2HTJA 3JSOA 2J5PA 4O3MA 4Z2YA 2DPUA 4ZH4F 1O3RA 3TQNA 4NB5A 1XMAA 2HZTA 2QYOA 3CDHA 3WU0A 2E7XA 5HDKA 2COMA 4OIQF 2EV6A 2DU9A 3ZMZA 5J8FA 3ZP5A 1XMKA 3LAJA 4N0BA 4EM0B 1G3SA 1S7AA 3FXQA 2VC1A 3CUQC 4M71A 3K2ZA 3LA7A 1SFXA 2QQBA 4WX9A 5DD4A 3K1PA 4ON0A 2DT5A 2ZJ2A 5LLQA 1FOKA 1XSVA 1O57A 1SD7A 1P2FA 2PFBA 2CW0F 1W7PA 2LF8A 5K5QA 4HX4A 2XV4S 4LG0A 2Q0OA 4L9VA 2PN6A 1KA8A 2A68F 5HLGA 1BOAA 4NQWA 4LG0B 4IXAA 1EH8A 2C6YA 3TO6A 1TLHB 2BBYA 3L09A 4BQAA 1LQ1A 1SAXA 4IJAA 5IT9K 2K4JA 2OQRA 4QWQA 2XAJA 3NEUA 3D5LA 1KQ8A 1SD5A 2JT1A 5L3EA 1HW2A 4MGRA 3J80K 4Q4ZF 2F5EA 4I2OA 2K27A 1XN7A 1R36A 2FSWA 3JTGA 4R79A 4BHCA 2RNJA 1I6XA 1R1VA 2MLGA 2O61A 2HTSA 4HF0A 4KICA 3P9CA 1EV7A 2RKHA 3GYHX 2P7VB 1XGMA 3CJNA 1ZARA 3F6OA 4S05A 4S04A 4B8XA 2OAZA 3BY6A 3GO5A 5IT3A 2PQ8A 3GFLA 5HLIA 4N9HA 4M9SA 3VODA 1E2XA 2BV6A 5DD8A 3ZMTA 4PCQA 2FU4A 4IHSA 4CICA 3C7JA 1G6NA 4A6EA 3LA3A 3ZN1A 2QQAA 1YQAA 2FMLA 3TDUC 2Z99A 2HEOA 1ZLJA 5L3GA 1Z6RA 2A6HF 2KIFA 2P4WA 4G7HF 3V7CA 3K1NA 2L02A 2XKOA 5JFRA 3E5UA 2L01A 1MGTA 5D8KB 1WKMA 4OIRF 3F6VA 1KQ0A 1V4RA 3N4MA 4GO1A 1S3JA 4ESBA 2GAUA 3WGIA 2WC2A 2QQ9A 4KN7X 2Y0MA 3DXJF 3H3UA 3HRSA 4YIIA 4YFNF 4HW0A 2P8TA 1P4WA 4IVNA 2PBIA 2PEXA 5HDGA 1R58A 1Z05A 1HXDA 3I64A 2K4BA 4EGYA 1FY7A 5D6EA 1O3QA 3V8LA 1EH6A 3VFZA 4KYWA 4O5VA 4A0ZA 2XHKA 4LLNA 4GCVA 2D2WA 3QAHA 2HKXA 1STZA 1RIOH 1U5TC 3JSPA 2V9VA 2Z3YA 1OPCA 1FSHA 3Q9VA 4BHPA 1Z7UA 4G6DA 2VBYA 2UXXA 1ZLKA 1KU9A 1S7OA 3FM3A 1OKRA 2OZUA 2DTRA 1WI9A 1L3LA 1B4AA 4G7ZF 3E5XA 4M72A 3I59A 2E1CA 4BAYA 1ZGJA 4RB2C 1J5YA 1ZN2A 2PMHA 3DV8A 1HSJA 4ESFA 2FBIA 3PFIA 3GXOA 1DPUA 4XSXF 4HQMA 4KT5C 2GIVA 5FFZA 5CJ9A 1DPRA 1QZYA 1FC3A 3FXUA 3U9GA 2QBYB 1ONVA 3WTXC 3HHGA 2DAOA 3KE2A 1KU2A 1CF7A 1Z9CA 3EDPA 4M6YA 1BJAA 3R61A 3BOQA 1LDKB 3V4GA 5FGMA 1UHMA 1U6GA 2YR2A 4LFUA 3B73A 1I1SA 2OA4A 4AVPA 1MJAA 3HTSB 1RNLA 4PGGA 1FYLA 1I5ZA 1J59A 4KIFA 4A0YA 4UUVA 3CTAA 5FLXZ 2G7UA 5L3DA 1HKQA 3FHZA 4A12A 2FXAA 2A6EF 2F2EA 2ISZA 4U7DA 1R22A 2O3FA 2ESNA 5A2QK 1IF1A 2VT3A 2NS0A 3WGHA 1R5GA 2H6BA 1AOYA 3MFKA 3Q9SA 1HKTA 1FBSA 3MWMA 1F4KA 1USSA 4HF1A 4KA4A 2O03A 2M5WA 2QZ8A 2ZNYA 3L00A 2V6CA 1ULYA 3ZMUA 4RGUA 3K1MA 2R3SA 4LD5A 1LNWA 3KP3A 3L9FA 3I58A 1I27A 1OYWA 3RKXA 3MAJA 5ICGA 4UV8A 1CGPA 2O6GE 5HS8A 1T6SA 3FM5A 2A07F 2D1VA 1R00A 5LHGA 5DDGA 2OU2A 4JK1X 5FD5A 1TNTA 3LAPA 3HRUA 3KZZA 2CQKA 4MQVA 2L4AA 1ZH5A 1GVJA 3C1DA 1LEBA 3BZ6A 4HBLA 1W4MA 3T1BA 4HLXA 4A5MA 2A3SA 1FBQA 4UNOA 3WODF 1TTYA 4I01A 4MEYF 2MH9A 3F8BA 2V1DA 4G8XA 2GXGA 2XROA 1Z6TA 4XRFA 1GXPA 3P9KA 2O0YA 1BBYA 1B6AA 2H27A 2VBXA 1QPMA 4XLNF 2ZFWA 2Z5UA 4P9FA 1D8KA 4WXCA 4HF2A 3G3ZA 3F8MA 2XKPA 2XASA 4RAYA 3SZTA 1TQPA 2QUFA 3ABTA 3KETA 3ECOA 3M7GA 1TQIA 2VT2A 1YO5C 5ED4A 3KLOA 5CVVA 3WTYC 3M8EA 3HTUA 3FMQA 2FMYA 2VE8A 1IN8A 4OIOF 2STWA 4ENNA 1T39A 2Z9OA 4HQEA 1S29A 5H6QA 5LEJA 3I71A 4ASNA 4G9YA 5HS7A 1IAWA 3DF8A 1W5SA 4L9TA 2TDXA 2CFXA 4L9NA 4PZJA 4UXNA 4YFXF 3MZYA 5A2QZ 3BJAA 3ECHA 1SMYF 1U78A 2EK5A 1RI7A 2EV0A 5J6XA 2IP2A 1D3YA 3T8TA 1BI3A 2CYYA 3J81Z 1G4DA 4WXDA 3LWFA 1MZBA 1PP7U 1YFHA 3QP6A 3QPHA 4G7OF 1FWZA 1IXRC 4I02A 2ELHA 2VOPA 1TQMA 3CLOA 2GWRA 3F3XA 5E8IA 5LBQA 2HQNA 1IZ1A 3MCZA 2W24A 4UHTA 1O3SA 1SMTA 4F7ZA 4TV7A 2KJCA 3KP6A 4HA8A 1BC7C 3ROUA 3GUDA 4G94A 1FLIA 1IN6A 4HV5A 2VN2A 3HUGA 4UVCA 3HSEA 3I54A 1XDUA 4CYDA 1O7LA 3C3WA 1ZRDA 4P9UA 1JE8A 4OMZA 3RKYA 2G7HA 3SZPA 4BH9A 2IPQX 3EYIA 4ZZDA 2YX7A 1OMIA 3DKWA 4KIGA 4U0WA 1BIBA 3DP7A 3TO7A 4GYIA 1FZPB 3DEUA 2GQQA 3Q5FA 1U8RA 5ILVA 1B59A 1ZG5A 2RN7A 4CDGA 4YFKF 2PLYA 1XDSA 3NRVA 4MHGA 2JTVA 4AD9A 4E70A 1S8NA 2ZBKA 1JGSA 2YSRA 5DYMA 4ENJA 4HAMA 5D5UB 2OZ6A 5EEHA 4A0XA 2A61A 1D5VA 1P6RA 5BS6A 3IL2A 3DQVC 2V1XA 3FMRA 1PUEE 2ZMEB 5D5VB 2ISYA 5F1RA 2CG4A 4GYGA 4D0PA 3RI4A 4L5JA 5CLSA 4A6DA 4EJVA 4IRGA 4BHBA 5E1ZB 1A04A 5E20A 4H0EA 3TO9A 3RYRA 4ESJA 1HBXG 1MJBA 4A2UA 3BJOA 3TKYA 3WG9A 2DFIA 4MTEA 5FB2A 5DV5A 2H94A 2DQRA 3GFMA 4PGHA 4MTDA 2AXLA 5DUKA 4Q47A 3ELKA 2ZXJA 5DUIA 2BEOA 4P55A 1D8JA 3TOAA 4I0AA 1JHFA 4FT8A 3V8KA 3H92A 3ZMDA 4UV9A 3HRMA 4IRIA 2GZWA 2M1BA 2K02A 5ICFA 4M9XA 1ON1A 3IWZA 3IKVA 2UXNA 4LB5A 5BMZA 4RGXA 1RUOA 1P4XA 3MEXA 2IRFG 1FP2A 4UVBA 5FD6A 3JW4A 2EFPA 1J2XA 3BROA 5L3FA 1IRGA 5DCMB 1BN5A 1LB2A 3RTRA 3F8FA 5D4RA 1B1BA 3HRTA 3OOPA 2FOKA 3KFWX 4I7HA 5IT9Z 1FYMA 2X4HA 4A5NA 1G3TA 1H9TA 3KP7A 1T38A 1F1ZA 4LJZF 4U88A 1YIOA 2J5OA 1H0MA 2MBFA 1IN5A 3LA2A 4JBAA 3CUQA 5KK1A 2MLKA 2QBYA 5K5RA 1B9MA 3J80Z 1IUYA 4M6XA 4EJTA 3PQJA 3CUQB 1O7FA 2GXBA 2YU3A 3WTUC 3IRQA 1XB4A 3JTHA 5TRDA 2P5LC 2CGPA 1DP7P 1XSDA 2L3DA 2VC0A 4WXHA 2IJLA 4AIKA 2DI3A 1FSEA 5ICCA 4Q5SF 2FRHA 1XGOA 4LGWA 1J7KA 2EFOA 3R0AA 4HOBA 1RZ4A 5L3BA 3W6KB 3I5UA 1ZREA 3O2PE 4BNCA 3QPTA 1R5HA 1ZAOA 4Y15A 1P92A 4OIPF 2MC3A 1HKSA 5ILSA 1MDMB 1OYIA 2WTEA 5CVRA 3GFIA 3WTTC 3JAMK 5AIPA 5BQTA 3R60A 2D1HA 4IF4A 3QU6A 4LLGF 1USTA 4RB3C 4OINF 4DNCA 2AS5F 4KFCA 3N97A 2M8EA 1TNSA 2Q8KA 4AWXB 2QWWA 4BXUA 1FYKA 5JHUA 5J8CA 2EWNA 3K0LA 4MNUA 1HQCA 3GFJA 4HDUA 2PJPA 2FNAA 1BI1A 1I1GA 2BE5F 2HQRA 3GEZA 3ML6A 3RDIA 2STTA 1R1UA 1Z91A 2W85A 1R7JA 3B02A 5ERIA 2ZNZA 1BIAA 3KEOA 3E6BA 4L5IA 1ODDA 2BGCA 5D5WB 2ACJA 1U3EM 1ZRFA 2E1NA 4EM2A 1LDDA 4R8HA 2W57A 4I09A 4PDKA 5CYVA 2XAGA 1SFUA 3HIFA 3GZ6A 2M87A 2QM3A 2W84A 3GLXA 1DUXC 2FE3A 4CHUA 3GF2A 3ERED 2WV0A 3LQQA 4RB0A 4CGZA 3FXRA 2H6CA 1PDNC 2HR3A 2KRFA 5LRSA 4LMYA 1TW3A 3OV8A 2XGXA 4JQFA 2PI0A 2K86A 1KQ9A 3CO6C 3VEPA 3V7RA 2L4MA 4RGRA 1MJ9A 2GA2A 1W5TA 3GZ5A 3ABUA 3FF5A 3AAFA 4XLPF 3BJ6A 4EJUA 2NRAC 3M1EA 5AIQA 1UCRA 3ZMSA 4U0YA 1Q1HA 5E1XA 3BWGA 1U5TB 3RYPA 2F5FA 1T0FA 5K5OA 2XAQA 2XIGA 3BDDA 4LK1F 2QVOA 5ICEA 1AWCA 1TBXA 2DW4A 2DPDA 4L18B 2V79A 3TOBA 3IKTA 4OMYA 2NYXA 4K2EA 3HOTA 1G3YA 1SFEA 1FNNA 1R1TA 1YLFA 1QNTA 2FBHA 1XCBA 2ZKZA 5F6FA 2PMUA 2ETHA 4UVAA 1UHWA 2LSOA 5TJJA 3U1DA 3CUOA 2XAHA 2W25A 5LHIA 4M9ZA 2A69F 2IA1A 3M9AA 3WGGA 1K7AA 3KP2A 3IRRA 1ZHFA 1YS7A 1TW2A 5E17F 2Y48A 2VE9A 3SQNA 4HDVA 3D0SA 4EMSA 4WWCA 3IWFA 4U0VA 6PAXA 3SFZA 4ETSA 5CVUA 1Y0UA 1KYZA 2M45A 4EM1A 1H9GA 2HWVA 2KIUA 1IW7F 5BOXA 2FF4A 4FX0A 2Y75A 1GHCA 4NHJA 5E18F 2ADUA 3E3VA 4WCGA 4RGSA 2EV5A 5D8LB 4QLCU 3KLNA 3ZPLA 2UWMA 3ULQB 3R0JA 4MEXF 4R1HA 1ZYRF 4GXOA 2NNYA 2IA2A 1ON2A 3K9TA 2CWEA 2IT0A 1QZZA 3O6BB 1IXSB 1WRJA 5EEGA 2ESHA 2EFNA 2HGCA 2DLLA 3I53A 3DPLC 2VBZA 2O8XA 3RKWA 3RPUA 2EFWA 3PQKA 5HLHA 3EQLF 1W7PB 3RIRA 3T5XA 4LLLA 3BPXA 5HVQC 4EJWA 2HYFA 3WE3A 4N9IA 2DO7A 4OU0A 1J9IA 2R7DA 2IVMA 2IA0A 5FO5A 3TDZC 2YPRA 5JI6A 5CVJA 3LFKA 2DK5A 4M73A 1BM9A 4IRHA 2LDUA 4KN4X 1Z1DA 3SHFA 1BI0A 1XSXA 1JHHA 2BYVE 3QU3A 2HS5A 1MKMA 1YS6A 3T8RA 1T2KA 4AIJA 4I98B 2P5KA 2RV8A 2ZMEA 1J0RA 1LDJA 3RJPA 2LNBA 4EJOA 1DDNA 1SD4A 4IPAA 3KCCA 2XVCA 1IN7A 2VOOA 1O3TA 1FX7A 1QO0D 2K7LA 4CZZA 2FQ3A 4RB1A 3KEQA 3LQRA 3ZMVA 2HKOA 1VTNC 5E1WA 1FBUA 5LGTA 2EA2A 1U2WA 2JPBA 4M74A 3QRFF 2MD5A 1XGNA 3FX3A 1XGSA 3I0TA 3WTZA 3L7WA 3KP5A 5LRRA 2FBKA 5H20A 2JZYA 2B0LA 5FLXK 1R23A 4RAZA 2RC4A 3GWZA 1GXQA 1T98A 2ZCWA 4FX4A 4CO8A 5BPIA 1YTYA 1ZG3A 2G9WA 4HYEA 1ZGAA 3U2RA 2HDCA 2DK8A 3WTSC 2OQGA 2OBPA 3VB2A 1BC8C 3F23A 2XRNA 3MQ0A 1EH7A 4WF2A 2FEZA 1FP1D 5AONA 2EFQA 2EJRA 3V7SA 3F21A 5H6RA 3IC7A 1E17A 3WTVC 5LHHA 2F5CA 5DCMA 4OOIA 1PP8F 4L9JA 3E6CC 4BYYA 4WK8F 3H3ZA 3EYYA 3KP4A 4DQ2A 3E6MA 1V3FA 2V1UA 4ZZLA 3F8CA 1WWXA 4EVIA 1WSUA 2A5YB 3COAC 3P7NA 4HZFA 4LK0F 2VODA 5DCFA 1RUNA 3BP8A 2YX4A 5KVRA 3REOA 4ENKA 1F5TA 4G6QA 3C18A 4HX7A 2CSOA 5E8GA 3EETA 1UFMA 3QP5A 2KJBA 1UB9A 2P7CB 4B09A 3I59B 2M30A 3TGNA 2KIMA 5HOOA 3I4PA 5K1YA 3R6SA 1IN4A 1W7PD 3WU1B 4EV0A 4Y17A 1KYWA 3F72A 1K78A 2P6SA 3E5QA 1FPQA 5CVIA 2VONA 5DEQA 2HFHA 2VBWA 5ILUA 2RQPA 1K78B 3HSRA 4P5OA 4MQ9F 5LGUA 2EA4A 1OR7A 1CF7B 2H09A 2LF7A 1MDMA 3L2CA 3IHUA 3HSFA 1OYYA 2P5VA 1NHAA 3G73A 3VOEA 2HOEA 1B9NA 4KDPA 4FHTA 1YG2A 4L0YB 1KU7A 1QQIA 1QGPA 2XAFA 2VXZA 3SXYA 4AIHA 1K6OA 2D45A 1ZG1A 1KU3A 3K69A 3FMSA 2QLZA 4KIBA 1BI2A 1HW1A 3HOSA 1X3UA 3W6JB 2WWYA 1S6LA 1YW8A 1WQ2A 3FWEA 3LSTA 2IW5A 4ZYGA 4YG2F 3WE2A 1ZRCA 4ZYDA 2QENA 3J81K 5D5XB 1K79A 3E97A 5JVTA 3V8JA 4Q48A 1SD6A 2JPCA 5L3CA 3ZN0A 3O3KA 4EGZA 1LEAA 2Q2EA 1IXCA 2NAZA 3WTWC 3MZHA 4KMUX 2FA5A 4L0ZB 2JRTA 2UZKA 2GA1A 5HDNA 2MA3A 2RDPA 3DPTA 4IHTA 2RGVA 4YIFA 3NQOA 3GVAA 4XBFA 2X0LA 3RPQA 1IRFA 4XSZF 4Y13A 1XCVA 2E7WA 1C0WA 4GGGA 5D4SA 3F8NA 1JXSA 2KKOA 1HW5A 1LVAA 2LKPA 3FZVA 3BPVA 2NNNA 3ISPA 3F22A 1YW7A 2XUBA 2MH2A 3HHHA 5LGNA 3J7AO 5HS9A 3ZQ7A 4ENMA 1U5TA 1QBJA 1YW9A 2EB7A 2DQLA 2HYGD 1F9NA 2DBBA 4KMFA 2Z33A 2L54A 3CO7C 4ZYEA 1LJ9A 3S2WA 5JR3A 2PG4A 2ZO4A 3GX4X 2RVCA 5FFXA 1KGSA 3M8FA 1MD0A 4I0BA 1FT9A 3KZYA 5LEKA 4P96A 5F64A 4EQQA 4HX8A 1L0OC 1YYVA 2JSCA 3E6DA 1J75A 4HV6A 4O6JA 1REPC 2P6TA 1XD7A 4RS8A 3QOPA 5D6FA 2F5DA 4KUMA 4LB6B 2R7FA 5BPDA 3GW2A 2FNPA 3EUHA 3R4KA 3JAMZ 1G3WA 3T0YA 4ZYHA 1P4AA 4HLYA 4U7BA 2OD5A 3DFGA 3P9IA 4CXFA 4KNYA 2CO5A 3HYIA
chains in the Genus database with same CATH superfamily
1HSTA 2LLKA 2HTJA 3JSOA 2J5PA 3FHNA 4O3MA 4Z2YA 1ENHA 2EBIA 2DPUA 2NVQJ 4LITA 4ZH4F 1O3RA 1NTCA 3TQNA 4BGDA 4NB5A 1EKEA 1XMAA 1T95A 1H89C 2HZTA 3F0CA 2QYOA 2R7ZJ 5FKNA 2LP0A 3CDHA 3WU0A 2CV1A 2PJRA 2E7XA 5HDKA 3PNYA 2X6XA 1DQUA 2MD0A 5F0HA 2COMA 4C2UA 4OIQF 2EV6A 2DU9A 3ZMZA 1U0JA 3HOXJ 5J8FA 5B1BH 2DT6A 3ZP5A 1XMKA 3LAJA 4N0BA 5HNHA 2LOOA 4EM0B 1XC5A 1G3SA 1S7AA 3FXQA 3LSJA 2ME6A 2VC1A 3CUQC 4M71A 1QPIA 3M07A 3K2ZA 3LA7A 4Y33A 1SFXA 2QQBA 4WX9A 3K4NA 5DD4A 3K1PA 2DODA 3BR1A 3OL4A 1BOBA 1JTXA 1XTAA 2WV1A 3ASNH 4ON0A 1RC9A 2DT5A 3QQAA 2GLOA 2ZJ2A 1BR1A 2VIXA 3TP3A 2E1OA 5LLQA 1FOKA 1XSVA 2ZC2A 2VXDA 1O57A 1SD7A 1P2FA 4FETA 2BZTA 2PFBA 2CW0F 4BL0B 1W7PA 2LF8A 2DMPA 3BG7A 1SANA 5K5QA 4HX4A 2HVSA 5GAGJ 1ZQ3P 2XV4S 2KZGA 4LG0A 2Q0OA 2AQEA 4BS9A 3JRFA 3HGGA 4L9VA 2PN6A 1Y56A 1KA8A 2K9SA 2O9LA 2OCCH 4C9YA 4CYCA 2KDZA 2A68F 5HLGA 4DGWB 3JRAA 1BOAA 4NQWA 3HL2A 4LG0B 2ELKA 2LMDA 3IH3A 4IXAA 2CV2A 2CUJA 1IDYA 4QTRA 2WAQN 5HLTA 1EH8A 3FXKA 2C6YA 3TO6A 1TLHB 4CYCB 2JJ7A 3RZDJ 2BBYA 3L09A 4AC0A 4BQAA 4C30A 1LQ1A 4FQGA 1SAXA 4IJAA 5IT9K 4BE0A 2K4JA 2OQRA 4QWQA 2XAJA 2DA4A 1NK2P 3NEUA 2EZIA 1OCRH 1SC7A 3OS2A 3D5LA 3WG7H 1KQ8A 3Q0UA 1SD5A 2JT1A 4CH7A 4D7NA 3G1LA 3JRBA 5GTIC 5L3EA 4XM3A 1HW2A 4MGRA 3J80K 2Z16A 3P5JA 4Q4ZF 2F5EA 3I4MJ 3OYFA 4I2OA 3ZQHA 2K27A 2W4SA 1XN7A 1R36A 2FSWA 3JTGA 4R79A 4BHCA 2RNJA 1I6XA 1R1VA 2MLGA 2QSHX 2O61A 4XL9A 4KITB 1UZCA 2HTSA 4HF0A 4XNFA 3VYUB 1XPXA 5KNLA 2KFDA 4KICA 3A0HC 3P9CA 1EV7A 2QKMB 1X1DA 1NK3P 2R7SA 2RKHA 4B44A 3GYHX 4XKWA 4XN0A 2P7VB 1XGMA 2IGNA 3CJNA 5JLWA 1I3QJ 3H5RA 4BE2A 4AM3A 3CMEI 1ZARA 3F6OA 3G71I 2X1EA 3AKZA 4S05A 2RREA 2ZSHB 1VZ0A 4S04A 2FUG2 3BG5A 4B8XA 1X3WB 3UKGA 1VQ8I 2OAZA 1WCMJ 3BY6A 2I8DA 1IGNA 3GO5A 5IT3A 2PQ8A 2F4OB 3GFLA 5HLIA 1SEUA 4N9HA 3LL7A 4M9SA 1E2XA 5J3LA 3VODA 2BV6A 2WY8Q 5E3NA 2Y9YA 5DD8A 3ZMTA 1XMXA 4BQQA 4PCQA 3MKYB 2FU4A 4IHSA 4CICA 1IRZA 4JYKA 5EYRA 3C7JA 1G6NA 4HEA2 5C4JJ 2O5RA 4A6EA 3LA3A 3ZN1A 3S16J 2CQQA 3HXLA 3DEWA 2QQAA 1A6QA 4YEJA 1YQAA 2FMLA 2ZXHA 3TDUC 2QF7A 1MSEC 3S1QJ 1V5GA 1I6HJ 2Z99A 2HEOA 1ZLJA 2CJJA 1Z6RA 2A6HF 2LH9A 4N4NB 2KIFA 5L3GA 1EF4A 2P4WA 4G7HF 3V7CA 3K1NA 2L02A 2NOJB 2X1DA 2XKOA 5E3MA 3S3OA 5JFRA 1K4TA 3E5UA 2K5CA 2XRLA 1X2NA 2LR8A 3HC7A 2Y30A 2VKEA 1WFXA 2L01A 2JA5J 1MGTA 1XG1A 2K9QA 1G8XA 1WKMA 5D8KB 4OIRF 1Y8RB 3F6VA 1KQ0A 2VQHA 1V4RA 3N4MA 4GO1A 1S3JA 3G1OA 4C3JJ 4ESBA 2GAUA 3BR2A 1ETOA 3WGIA 2WC2A 2QQ9A 4YRVA 2CV0A 4KN7X 1H8AC 4XICA 2W7NA 2Y0MA 4Y3OA 1TWFJ 3DXJF 4PUSA 3H3UA 3CDLA 3HRSA 4YIIA 4YFNF 2DMQA 4XIDA 4HW0A 2CUEA 2P8TA 4F91B 1P4WA 3CJQB 4IVNA 2PBIA 3DLAA 2PEXA 2QEXI 1JGGA 4XQFA 4ANJA 2DJNA 2F5VA 5HDGA 1R58A 1Z05A 3L2UA 1HXDA 3I64A 2K4BA 4EGYA 4DIQA 1VQNI 1FY7A 5D6EA 1O3QA 4BEHA 1ZR4A 3V8LA 1EH6A 3VFZA 4KYWA 2VB6A 4O5VA 4A0ZA 3HOVJ 2XHKA 4LLNA 4GCVA 2D2WA 3QAHA 3IP4B 2HKXA 1STZA 1RIOH 2E2IJ 1U5TC 2E19A 3JSPA 2V9VA 2Z3YA 2OF7A 1V5FA 2V4JC 4DW6A 2VKHA 3FXMA 4BEHB 5J4VA 4E7IA 1OPCA 5EDNA 1Z0XA 1UJ8A 1DU6A 1FSHA 4BBRJ 2W00A 2E60A 3Q9VA 2LVSA 4BHPA 1Z7UA 2KISA 1T0FC 3FXOA 4G6DA 2VBYA 2L7ZA 2UXXA 3HGYA 1VF9A 1ZLKA 1ETVA 1KU9A 1TL8A 3JCUC 3I9V2 2JA7J 1S7OA 3FM3A 4RMNA 4BJTA 4HPQA 3TW7A 1OKRA 2E2HJ 2OZUA 3Q3SA 2DTRA 1WH7A 1WI9A 1L3LA 1B4AA 2DN0A 3DKXA 4CSWA 1X1AA 1P7IA 2H8WA 4G7ZF 3E5XA 3S1MJ 4M72A 3I59A 3PFYA 2E1CA 3DKYA 2ME0A 4BAYA 5B1AH 1R5ID 5B5EC 3M8JA 1ZGJA 3FK7A 4RB2C 4Z6YA 3JRDA 1J5YA 4OAZA 2DA2A 1ZN2A 3BZKA 4LIVA 2PMHA 3DV8A 1HSJA 4ESFA 1JJ8C 3I4NJ 2FBIA 3PFIA 3GXOA 1DPUA 1WJAA 4J01A 2F4MB 4XSXF 1RESA 4HQMA 4KT5C 4JX5A 1YRNA 2GIVA 5FFZA 5CJ9A 1DPRA 1QZYA 1FC3A 3ESWB 1POGA 3AG1H 3FXUA 3EUHC 1AA7A 3U9GA 4QPOA 4YIRX 3S1RJ 2QBYB 4CCOA 3NWSA 3PIPF 1OCCH 1ONVA 3WTXC 3HHGA 1I50J 2DAOA 3KE2A 1KU2A 5F0FA 2CUZA 3VPRA 2LKXA 1D5YA 1CF7A 3N05A 1Z9CA 3EDPA 4M6YA 1BJAA 1ZELA 3F9KA 4A3IJ 1GLNA 3AG4H 3R61A 3BOQA 3G6EI 3J7AY 1LDKB 3BTCA 5FKOA 3V4GA 5FGMA 4QPQA 1UHMA 1U6GA 4BY1J 3KX2A 2MC4A 2YR2A 3QPSA 3CCJI 2DMNA 2NS7A 2VJ5A 4LFUA 3B73A 4C2MJ 2KRCA 1I1SA 4E7KA 2OA4A 1JKQC 2M3AA 4F55A 4AVPA 1MJAA 3HTSB 4PFPA 1YX5A 1RNLA 3H5NA 4F92B 4PGGA 2OPTA 3RQ4A 1FOYA 1FYLA 3S32A 1I5ZA 3OYAA 4KIFA 1J59A 4A0YA 4UUVA 3JR9A 3CTAA 5FLXZ 5GP9A 2G7UA 5L3DA 1HKQA 3FHZA 4A12A 2IS4A 3JREA 3B6CA 2FXAA 1LPQA 2A6EF 2F2EA 2ISZA 3S2DJ 2ZFUA 2RQQA 2H8RA 1D0XA 4HNTA 2R5YA 4U7DA 1AHDP 1R22A 2O3FA 2ESNA 1IDZA 3BT9A 5A2QK 2VPLA 4ZDOA 1IF1A 2VT3A 2NS0A 2DOEA 3WGHA 2LY9A 1R5GA 1AKHA 4E7HA 2HVQA 2H6BA 2BVMA 5TGTA 1AOYA 2L7KA 3CESA 3MFKA 3Q9SA 1HKTA 1FBSA 1Y1WJ 3MWMA 1VFCA 4IEJA 1AKHB 2CUFA 1F4KA 3L2WA 4BUPA 1S72I 1USSA 2Z1DA 4HF1A 4KA4A 3PL8A 2O03A 1OCPA 2M5WA 3OYIA 1YE9A 1G59A 2VJIA 2QZ8A 3SFIA 2ZNYA 3L00A 2V6CA 1ULYA 3ZMUA 4RGUA 3SEZA 3K1MA 1LFUP 3LSIA 2R3SA 3KPHA 1X1PA 1LNWA 4LD5A 3KP3A 3L9FA 3I58A 1I27A 1OYWA 3RKXA 2XF5A 3PJRA 3MAJA 5ICGA 3H35A 4GRIA 4F93B 3S93A 1NH3A 4UV8A 2L9RA 1CGPA 1GDTA 5HS8A 2O6GE 3FISA 1MBHA 1T6SA 3FM5A 2A07F 2D1VA 1R00A 2FX0A 4CCMA 5LHGA 5DDGA 2OU2A 2LFBA 1WVRA 2CQNA 4JK1X 1TP4A 5FD5A 5E3OA 3L2VA 1TNTA 2DA6A 3LAPA 4D7MA 2R93J 3HRUA 3KZZA 2CQKA 3HOWJ 1I3AA 1A31A 4MQVA 1BJZA 2I10A 3UR3C 1X4PA 4A93J 2PMZA 2L4AA 2HU9A 2E5ZA 1ZH5A 1GVJA 3C1DA 1LEBA 3BZ6A 4HBLA 5E79C 1W4MA 1TWGJ 2DYRH 3T1BA 1CQTA 4HLXA 4A5MA 2A3SA 1FBQA 3AFHA 1RPWA 3BG6A 4XLHA 5FROA 3OS1A 4UNOA 1W5CC 1TTYA 3DTIA 3WODF 3NARA 1N77A 4I01A 1MMDA 4MEYF 2MH9A 4AIDA 3F8BA 2V1DA 4G8XA 3OYDA 4KISA 2GXGA 2XROA 1VI0A 1Z6TA 4XRFA 1GXPA 2ZXIA 5IOZA 3BLYA 2XSJC 5KCMA 3P9KA 2O0YA 1BBYA 1B6AA 4ZTFA 4E7LA 3ONQA 2H27A 2VBXA 1QPMA 4XLNF 2ZFWA 2Z5UA 4P9FA 4IZZA 3K4KA 1D8KA 2WAEA 4WXCA 4HF2A 3DCFA 4B48A 4UY8I 3G3ZA 2E1MC 2E2JJ 3F8MA 2QCOA 1MH4A 4RDUA 2XF7A 2XKPA 1VQ5I 4BDZA 1HOMA 2XASA 2L0KA 4RAYA 3SZTA 1TQPA 2QUFA 1OQYA 2Y69H 3ABTA 3KETA 3A01A 3ECOA 1OLTA 1VQ7I 3M7GA 1TQIA 2M7AA 3OIQA 4KT6A 4ZDPA 2VT2A 4XRMA 2YUSA 4EATA 1O4XA 5EZGA 2EZLA 1YO5C 5ED4A 3KLOA 5CVVA 3DTKA 1SAUA 3WTYC 1QZEA 4OWRB 3M8EA 3HTUA 3OWTA 3FMQA 2K85A 1W1WE 2QKLB 2FMYA 1MMSA 2VE8A 2LTPA 4EEFG 1GUUA 1IN8A 3DU6A 4OIOF 2STWA 4ENNA 1T39A 2P0WA 2Z9OA 4HQEA 1ETYA 3PSIA 3PSFA 3HDDA 1S29A 5H6QA 3K4BA 3K4MA 4IL6C 5LEJA 2LBFA 3PNVA 3IV5A 3I56I 4IO9F 2V26A 3I71A 2XSDC 1YJWI 1WJEA 4ASNA 2JK3A 3LSPA 4G9YA 1T56A 2X6OA 3HJEA 5HS7A 1W0TA 2IBDA 1IAWA 2KZVA 3DF8A 2A5WA 2F6CA 4CUGA 1E3OC 1DU0A 2M4KA 4NC6A 2HOSA 1MNMC 1W5SA 4L9TA 2TDXA 2CFXA 2P81A 1JUPA 4L9NA 4PZJA 4XOTA 4UB6C 4UXNA 2EH3A 4YFXF 3MZYA 2X1CA 5M5YJ 5A2QZ 4XKCA 2DYSH 3BJAA 3PO2J 3ECHA 1SMYF 3GTKJ 1XX5A 3DBRB 2E34A 1U78A 2EK5A 3GTMJ 1RI7A 2EV0A 2ZJQF 2HDDA 5J6XA 2IP2A 1D3YA 3T8TA 2WB1N 2X48A 1BI3A 2HPMA 2CYYA 1K83J 1ZKGA 3J81Z 1G4DA 5HODA 4WXDA 2KQRA 3LWFA 1MZBA 2LY1A 3OS0A 3J7YJ 1YFHA 1PP7U 3QP6A 3BG9A 3QPHA 3LSRA 4DJAA 4IHYA 1OJLA 2DA3A 2KHMA 4G7OF 1FWZA 1IXRC 4I02A 1VQOI 2ELHA 2QGUA 2VOPA 1TQMA 3CLOA 2GWRA 4XRSA 3L1PA 1JJ6C 3F3XA 3FDYA 5E8IA 4V2FA 5LBQA 2R4GA 2HQNA 1IZ1A 3MCZA 4AUXA 3AL0B 3Q0VA 4W97A 2W24A 5E3LA 4UHTA 1O3SA 1SMTA 3SDGA 4F7ZA 4TV7A 3OYEA 1E0EA 4M3DA 2KJCA 2OJED 2PMZN 1LVKA 3CLQA 3KP6A 4HA8A 1BC7C 3ROUA 1MMGA 2UUZA 3GUDA 4G94A 2BXYA 1FLIA 3CF2A 1IN6A 2M0CA 4HV5A 2VN2A 4IHVA 3HUGA 4UVCA 3WHCA 3HSEA 3I54A 1ZTRA 1QVUA 1XDUA 4CYDA 1ZGWA 2HQAA 2DCEA 3CD6I 4N4OB 1O7LA 1BR4A 3C3WA 3HUGB 1ZRDA 3OYHA 2D5VA 4P9UA 4PSWA 2IXSA 2KMUA 4OMZA 3RKYA 1JE8A 2G7HA 3SZPA 4PJNA 1D1AA 2L9VA 1OR7C 4BH9A 3H3VK 2IPQX 4OAYA 3SYTA 4E4HA 3EYIA 2MFZA 4ZDLA 4ZZDA 3GLLA 4II2A 2EIJH 1D0ZA 3HPGA 4G6TB 2YX7A 1GV5A 1OMIA 3DKWA 2MABA 2VI6A 4KIGA 1Z7LA 4U0WA 1BIBA 3QODA 3DP7A 4RAGA 1S7EA 3U21A 1X58A 3TO7A 3ZGKA 4GYIA 4BJ6C 1FZPB 2X9DA 3DEUA 2GQQA 3Q5FA 1U8RA 5ILVA 2DFHA 1B59A 4HSRA 1ZG5A 2RN7A 4CDGA 4YFKF 3TEDA 2OUMA 2PLYA 1XDSA 3NRVA 4MHGA 2JTVA 4AD9A 4E70A 4YELA 1S8NA 2ZBKA 5HNFA 1JGSA 2YSRA 5DYMA 4ENJA 4HAMA 5D5UB 3CCMI 2VPRA 2OZ6A 5EEHA 4A0XA 3ASOH 2A61A 1D5VA 1P6RA 1X1BA 5BS6A 3BTLA 3KEYA 5DTDA 3KYCB 3BTJA 3IL2A 2Y2ZA 1SFOJ 1GV2A 1ORKA 2BY2A 3DQVC 2V1XA 2GOMA 2CRGA 2TRTA 2X6WA 3FMRA 4M3BA 1PUEE 2ZMEB 5D5VB 2ISYA 3PUBA 2EZKA 5F1RA 2CG4A 2E36A 4GYGA 4D0PA 3RI4A 2BY0A 4L5JA 1X2MA 5CLSA 4A6DA 4EJVA 4QIWN 3DLLF 2M34A 3IH2A 4IRGA 3ZQLA 1MH3A 4RLQA 4BHBA 1EJ9A 1R4NB 5E1ZB 1A04A 5E20A 4H0EA 3TO9A 3RYRA 1W36D 4IHWA 4D9JA 4ESJA 1HBXG 4BXFA 2ZJRF 3CCUI 4HSTA 4XOPA 4MFDA 1TZLA 1MJBA 2BVLA 3C2GA 3SEQA 4A2UA 4KJZA 4UUTA 4A3EJ 3BJOA 3TKYA 1TT5B 3WG9A 1DGRM 2DFIA 4MTEA 2VKVA 5M3MJ 5FB2A 1WJCA 5DV5A 2H94A 2DQRA 3GFMA 4PGHA 1VQPI 4IX7A 1D1BA 3HKZA 4PJLA 4MTDA 2AXLA 1J09A 3BTIA 1NG7A 3WU2C 5DUKA 1GT0C 2OCEA 1V5EA 4Q47A 3ELKA 4DZJA 2ZXJA 5DUIA 5F0CA 2BEOA 4P55A 1TC3C 1D8JA 4RM2A 5B66C 1WJDA 3TOAA 4I0AA 1JHFA 4FT8A 3V8KA 3H92A 3ZMDA 1MBFA 4UV9A 2ZJPF 4BBSJ 5F1JA 3HRMA 1B8IB 3CCQI 2GZWA 4IRIA 1HDDC 2M1BA 5FLVA 5J1UA 1FOWA 2K02A 5F08A 2BW3B 5ICFA 4GFBA 4M9XA 1ON1A 3IWZA 3FIWA 4F3QA 3BR0A 3IKVA 1VNDA 2UXNA 4LB5A 1APLC 5BMZA 1Z67A 3M1CA 4RGXA 2DDAA 3E7LA 2GM4A 2EPFA 2CW8A 1P4XA 1RUOA 3MEXA 1FOXA 3H0GJ 2IRFG 1FP2A 4B3XA 2JQ7A 2M9HA 4UVBA 1UELB 5FKKA 5FD6A 3IAS2 3JW4A 2EFPA 1J2XA 3GTQJ 3BROA 4RAFA 5FKMA 5L3FA 3ERMA 1IRGA 3D5RC 1W36C 2HNHA 2VQCA 4Y7NJ 5DCMB 2IAIA 3CQZJ 3OMYA 1BN5A 1LB2A 3RTRA 3F8FA 1QHGA 5D4RA 1B1BA 2OTLI 3HRTA 3I55I 3LSKA 3HOUJ 3OOPA 3MD2A 2FOKA 3UNGC 3RKQA 4BXXJ 3KFWX 2QA4I 4I7HA 2XB0X 3E1SA 5IT9Z 1FYMA 2X4HA 4XORA 3CC2I 4A5NA 1G3TA 5F27A 2CFOA 3GZNB 1H9TA 3KP7A 4DZPA 1IRXA 1Z77A 4I6ZA 1EA3A 1T38A 1F1ZA 4LJZF 4U88A 1YIOA 2J5OA 1H0MA 1BA5A 2F4IA 2RNGA 2MBFA 2VASA 2W82A 1IN5A 5C3EJ 1MBKA 5EZHA 3LA2A 4JBAA 3CUQA 4ABZA 4D5FA 5KK1A 2MLKA 5DM7F 5K5RA 1B9MA 2QBYA 4C2TA 2GOXB 4I76A 1D1CA 3J80Z 2FD5A 2NVUB 1IUYA 4L5EA 2K3PA 4M6XA 4XR6A 2DOFA 3PQJA 5DS9A 4CCKA 2PX9A 4EJTA 2MSYA 3H5AA 4B4CA 3CUQB 1LUJB 3CP8A 3CMYA 1O7FA 2GXBA 4XK4A 3PM1A 2YU3A 1R49A 4XMYA 4AU7A 3WTUC 3ZRGA 3IRQA 1R9TJ 1XB4A 2R0QC 3JTHA 4PFOA 5TRDA 2P5LC 2CGPA 3JRIA 2NVTJ 4BU2A 1DP7P 1XSDA 3FXLA 4DYQA 2L3DA 1B72A 2VC0A 3CCSI 2KL4A 2UV1A 2IJLA 4WXHA 4AIKA 2M2EA 2Y0SA 2DI3A 1FSEA 5ICCA 4Q5SF 2ECBA 2FRHA 1XGOA 1B72B 3BR3A 4LGWA 1J7KA 1JT0A 2EFOA 3ZOBA 1IJWC 2Z2SB 3R0AA 4HOBA 1ERDA 5KHDA 1QVTA 1RZ4A 1KONA 5L3BA 2LRDA 3W6KB 4JX6A 3I5UA 1ZREA 5K7ZA 3O2PE 1UG2A 4BNCA 3QPTA 1R5HA 2L9SA 4MFEA 5FRNA 1ZAOA 1S9HA 3GTPJ 4Y15A 1P92A 4OIPF 3ZQQA 2VL8A 1Z21A 2MC3A 1IC8A 3HKZN 1OCZH 5B3SH 1HKSA 5ILSA 1MDMB 5EG0B 1JKRC 1OYIA 3TMOA 1MNEA 4BKXA 2WTEA 2IS6A 4JP0A 4G12A 5CVRA 3GFIA 1VQKI 3WTTC 3GTJJ 3LSHA 3JAMK 5AIPA 5BQTA 3R60A 2D1HA 2R7TA 4V2GA 4IF4A 1ZR2A 3EUAA 3QU6A 2AQFA 1MBJA 4LLGF 1USTA 3HG9A 3SDBA 4RB3C 4OINF 2LKSA 4DNCA 4MO7A 3CJRB 2R7WA 2AS5F 4KFCA 3H9GA 4RBOA 3N97A 2M8EA 4IOCF 1V55H 1TNSA 2JVHA 1QU3A 2Q8KA 4AWXB 2QWWA 5DM6F 4BXUA 3K70D 2HYJA 1FYKA 1K6YA 3DBHB 3A02A 5JHUA 2VJJA 3DU5A 4CCJA 2H1KA 5J8CA 2HZDA 4ZJZA 2EWNA 3K0LA 4MNUA 1F36A 4A3DJ 1HQCA 3GFJA 2XC7A 2B9SA 5IY5H 4DBRA 4HDUA 2PJPA 4BJ5C 2FNAA 3BCBA 1BI1A 3LFUA 1I1GA 2BE5F 2HQRA 4A69C 2AHQA 5FJ8J 1JT6A 3OYGA 3D1NI 2A05A 2DFEA 3GEZA 3K4JA 4A3MJ 3ML6A 5J1YA 3IUOA 3RDIA 2STTA 1R1UA 1Z91A 2W85A 1JKOC 1R7JA 1WI3A 3B02A 5ERIA 2ZNZA 1BIAA 3GTGJ 3KEOA 3GTLJ 3E6BA 2HQ5A 1YI2I 1UMQA 4L5IA 1MIJA 1N75A 1RR7A 1VQLI 1ODDA 3KYDB 2BGCA 4PJMA 5D5WB 3BQYA 2CQXA 2ELJA 2ACJA 2R7VA 4IQ4A 1U3EM 3O8GA 3HZJA 1VQMI 1ZRFA 2R5ZB 2Q1ZB 2E1NA 4EM2A 2WA0A 1LDDA 4R8HA 2W57A 4I09A 4PDKA 5CYVA 2XAGA 1SFUA 3HIFA 3GZ6A 2M87A 2QM3A 4DBQA 2W84A 2L5QA 3GLXA 1IV8A 4NUBA 3TBIA 1DUXC 1OCOH 3K6GA 1HLVA 2FE3A 2MG4A 4CHUA 3GF2A 2XAUA 5LD2C 1LFPA 3ERED 2E5NA 2WV0A 1D0YA 3LQQA 4RB0A 3U1KA 4BACA 2N8GA 4CGZA 3FXRA 2H6CA 1PDNC 1E3PA 2KPMA 3S1NJ 3D5SC 2HR3A 2KRFA 5LRSA 4LMYA 1TW3A 3OV8A 5GADJ 2XGXA 4JQFA 4CCLA 1ETXA 3OL3A 1UHSA 5IP6A 2PI0A 2K86A 3BR5A 4B43A 1KQ9A 3CO6C 2JUGA 2JN6A 3VEPA 3QYBA 1T33A 3V7RA 2L4MA 4RGRA 2QQ8A 1MJ9A 2GA2A 1FTTA 1W5TA 3GZ5A 3ABUA 2I5UA 3FF5A 3AAFA 2WAQA 4XLPF 3BJ6A 4EJUA 3KYLA 2NRAC 1JUSA 3M1EA 3JRHA 5AIQA 4NDLA 2GXAA 1UCRA 3ZMSA 4U0YA 4FISA 1Q1HA 5E1XA 2Y9ZA 3BWGA 1U5TB 3RYPA 1ZK8A 1T0FA 2F5FA 5K5OA 2XAQA 2XIGA 3BDDA 1Z3XA 4LK1F 2FQ4A 4E6KG 2Y31A 2QVOA 5BNGA 5ICEA 2GBYA 2JRMA 3LSGA 3SZGA 1AWCA 2NXNB 2KT0A 1TBXA 2HPIA 2HDWA 2DW4A 2DPDA 3CMMA 4L18B 2V79A 3TOBA 4BQNA 3IKTA 1IO2A 2COBA 2NYXA 4OMYA 4K2EA 3HOTA 4DYRA 1G3YA 1SFEA 2FJ1A 1FNNA 1R1TA 1YLFA 1QNTA 2FBHA 4U87A 1WJ5A 2E71A 1WHUA 1XCBA 2ZKZA 5F6FA 2XB5A 2PMUA 1FIPA 2ETHA 4UVAA 1YITI 2EZHA 1UHWA 3OYKA 3LNQA 2LSOA 5TJJA 3U1DA 3CUOA 2TCTA 5IYCJ 1TWHJ 2M0MA 2XAHA 2W25A 4HRIA 5LHIA 4M9ZA 3OYLA 5M3FJ 2A69F 2BHYA 2IA1A 4E7SA 3M9AA 3PUFA 4XN3A 3WGGA 3M3YJ 3DBLB 3ZCOA 1K7AA 3KP2A 3MVPA 3IRRA 3W2VA 3S2HJ 3RZOJ 4FASD 1ZHFA 2OV7A 1V54H 1YS7A 4C3IJ 4LOCA 1TW2A 1LE8B 3QOEA 1WPKA 2L9NA 4X1EA 5E17F 2Y48A 5EEAA 4E7JA 2VE9A 3SQNA 4FE4A 4PK4A 2DMUA 4HDVA 3D0SA 3K10A 4EMSA 4JOMA 2XPWA 1ETWA 5H2FC 4WWCA 3IWFA 4U0VA 6PAXA 3SFZA 4XLEA 1PYVA 4ETSA 5CVUA 3HOZJ 1Y0UA 1KYZA 4H4KC 4B3AA 2M45A 4AYBA 4EM1A 1H9GA 2HWVA 1NG6A 2L7FP 2KIUA 3ZQFA 4MLOA 1IW7F 5BOXA 3GBGA 3H9QA 2FF4A 4FX0A 4XLCA 1QRYA 2Y75A 5TISC 3DTEA 1GHCA 1ETKA 3W2WA 4NHJA 3BR6A 5E18F 2XGDA 2JA6J 2ADUA 3E3VA 4WCGA 4M3EA 5J47A 1BW5A 1P9QC 1LFBA 5K7HA 1HCRA 2PJRB 4RGSA 2EV5A 3QPLA 3OY9A 5D8LB 4QLCU 3KLNA 5EF6A 2IS1A 3ZPLA 1YJ9I 4DYCA 1Y39A 3DPUA 1RR8C 2UWMA 3ULQB 3R0JA 4MEXF 4R1HA 2WAFA 2ZXWH 4A3LJ 1ZYRF 4GXOA 2NNYA 2IA2A 4A3FJ 2V1NA 1ON2A 1LKXA 3K9TA 2CWEA 2IT0A 3S3NA 1QZZA 3O6BB 1IXSB 2HI3A 4I99C 2RAEA 1WRJA 1FMVA 3Q0WA 3BQZA 4M3FA 4ZC3A 4PJ0C 5EEGA 3ABLH 2ESHA 2EFNA 2HGCA 1GVDA 2DLLA 4Y52J 3I53A 2R7RA 3DPLC 2VBZA 2O8XA 3KZIC 2DMTA 3QWLA 3RKWA 1WZ2A 1ITYA 3RPUA 2IGMA 1MSFC 2EFWA 3PQKA 4ZTJA 3LOCA 5HLHA 3A03A 2ID6A 1W7PB 3EQLF 2NVYJ 3RIRA 3T5XA 4HNVA 4LLLA 3HBLA 5CKTA 3A4CA 2O7OA 4BQOA 4UB8C 3BPXA 1IUFA 1N25A 5HVQC 4EJWA 1FTZA 2WBMA 2V9PA 3KIOA 2HYFA 3WE3A 5CPRB 4N9IA 2DO7A 3CP2A 4OU0A 2M7BA 4NQWB 3OYJA 1H88C 1J9IA 2CW7A 2R7DA 3O8HA 2V9KA 4BE1A 4A3BJ 2IVMA 3OYBA 2IA0A 5FO5A 4E7ZA 3GMEA 2MYSA 3TDZC 1FJLA 3M4OJ 2R7QA 1RKTA 4DOZA 2YPRA 5JI6A 5CVJA 3GCMA 3LFKA 2DK5A 4M73A 1BM9A 3CC4I 4IRHA 2LDUA 4KN4X 3S8PA 1Z1DA 1PJRA 3H36A 3FBNB 3VSLA 3SHFA 1BI0A 1RRJA 1XSXA 1JHHA 3DEEA 2BYVE 3QU3A 4S0HB 2HS5A 3MN2A 2MGQA 1MKMA 1YS6A 3T8RA 3VYSB 5GAEJ 5M5WJ 1U8BA 3CF5F 2R7OA 1SVMA 4AIJA 1T2KA 4I98B 5LFAA 2P5KA 2RV8A 3VYRB 2JA2A 2ZMEA 1J0RA 4FCYA 1LDJA 3RJPA 5EJCA 3K4LA 1HA8A 1PVEA 2ECCA 2LNBA 4EJOA 1DDNA 1SD4A 4IPAA 3KCCA 2XVCA 1IN7A 5IOYA 2DT7B 2BY3A 3IAM2 4QSHA 2VOOA 1O3TA 2L7MP 1FX7A 1QO0D 2K7LA 3PIOF 2JWTA 1FMWA 4CZZA 4GDFA 3MKWB 2FQ3A 4RB1A 3KEQA 4XRSG 1N78A 3LQRA 3ZMVA 4MIMA 2HKOA 2V7FA 1VTNC 1W0UA 3DWLE 3CZ6A 2B63J 5E1WA 1FBUA 3CC7I 2OTJI 5LGTA 5JVGF 5K7FA 1M1EB 1TWAJ 2JUCA 2EA2A 1Q1VA 3BCAA 4X6AJ 1U2WA 2JPBA 4PSXA 1JI8A 3GTOJ 2X6YA 2XGCA 4M74A 2R7UA 1R6RA 3VDXA 5C44J 4AYBN 2ICWG 2K9LA 3IH4A 3QRFF 2MD5A 4PJJA 1XGNA 3FX3A 1XGSA 3I0TA 3WTZA 3OYMA 3L7WA 1IV6A 3TP0A 3KP5A 5LRRA 2FBKA 3E0JB 4AVZA 2JZYA 5H20A 2KDOA 2B0LA 5FLXK 1R23A 4RAZA 4IOAF 2RC4A 3GWZA 1GXQA 3A0BC 3L2RA 2E1MB 5IYDJ 1DGWY 1T98A 2ZCWA 3CCYA 4FX4A 4CO8A 5BPIA 1YTYA 3FBIB 1ZG3A 2G9WA 1AU7A 4HYEA 1B8IA 3PO3J 1ZGAA 5J1RA 3U2RA 2HDCA 3HOYJ 2DK8A 2ZSIB 3L2QA 1X1CA 2BW3A 3BZCA 3WTSC 2OQGA 1P7JA 1T8IA 2OBPA 4M6VA 3VB2A 4XONA 3ZXSA 4RLFA 3MZ8A 2XDVA 4XKBA 1BC8C 2LY2A 3F23A 2XRNA 1Y6IA 3MQ0A 3CCVI 1EH7A 3HB9A 4WF2A 2FEZA 4C3HJ 2IGOA 4FTHA 1R71A 1FP1D 5AONA 3FKJA 2CS3A 4BDYA 1SFKA 3NWTA 4HNUA 3ABKH 2EFQA 2EJRA 1A6IA 3V7SA 3F21A 3RSNA 5H6RA 4NBQA 2LC2A 3IC7A 4B47A 1WJBA 1E17A 2V6EA 3JRCA 3WTVC 1HDPA 3FK6A 3ZQIA 4CCNA 5LHHA 2F5CA 5DCMA 2G0EA 4IQJA 4OOIA 1JUMA 2K9MA 3CDIA 3S14J 3TL4X 1PP8F 4W1UA 2QSGX 1TT0A 4L9JA 3JRGA 3MMYB 3ABMH 3E6CC 4D1QA 4BYYA 4CA0A 4WK8F 1QA6A 3H3ZA 3EYYA 3KP4A 2IGKA 4DQ2A 1U9OA 3E6MA 2JMWA 3VSKA 2LG4A 1V3FA 1QHHD 4ZZLA 2V1UA 3F8CA 1WWXA 2VQLA 3AG3H 3LMMA 4EVIA 1YJNI 1WSUA 2A5YB 4M3GA 3P7NA 4HZFA 2EIMH 4LK0F 3COAC 2VODA 1WH5A 4NNJA 1HF0A 3AG2H 2JVGA 5IP9J 1YHQI 5DCFA 2DA1A 1RUNA 3WHBA 3BP8A 1K4SA 3CCLI 2YX4A 5KVRA 3REOA 4ENKA 1MMAA 1VQ6I 3OR1C 1F5TA 3K2AA 3C18A 2K9NA 4G6QA 4HX7A 2DDBA 2CSOA 5E8GA 3EETA 1UFMA 1MNDA 2K3FA 3OSGA 2HVRA 3QP5A 2WY7Q 3H0DA 3S17J 3ZR8X 2DXIA 1X19A 3QYFA 4Y4RA 2HOTA 3HEFA 2KJBA 1JKPC 1UB9A 2P7CB 3RCOA 4B09A 2BOLA 2M30A 3I59B 3TGNA 4RA2A 5FLMJ 2EILH 2KIMA 5JLXA 5HOOA 3I4PA 5K1YA 2M4GA 3R6SA 1IN4A 1W7PD 1OISA 2ID3A 3PNTA 1Y8QB 3OIPA 3WU1B 4EV0A 3RPUD 1Z3YA 5GPCA 4Y17A 4II3A 1KYWA 2VUMJ 2LYCA 3TW6A 3F72A 1K78A 2CQ7A 2KLOA 1YRNB 3S15J 2P6SA 3E5QA 2LREA 1FPQA 5CVIA 2VONA 5DEQA 2HFHA 2VBWA 5ILUA 2RQPA 1K78B 3HSRA 3LSMA 4P5OA 4MQ9F 5LGUA 2XGEA 3K4CA 2EA4A 1MBGA 1OR7A 4CZCA 3OR2C 3G2BA 1CF7B 3VYTB 2H09A 3W3CA 2LF7A 2VKDA 4A3JJ 2YS9A 5CQEA 1SVLA 1MDMA 2GIZA 4FE7A 5EG0A 4X0GA 2F48A 3L2CA 3IHUA 5F04A 3HSFA 3QYEA 1ACIA 2WADA 1OYYA 3EPZA 4IHXA 2P5VA 5J4YA 1NHAA 1Y0NA 3G73A 4RM3A 3VOEA 1RETA 1YX3A 2HOEA 5FRMA 3AL0C 1B9NA 4JX4A 4XLFA 3VWBA 4KDPA 4FHTA 2VQGA 1YG2A 4L0YB 2X85A 2DFFA 2IS2A 1VQ9I 1S5LC 2BY1A 1KU7A 1QQIA 2NOGA 1QGPA 2XAFA 3HPHA 2VXZA 3SXYA 1E3HA 4AIHA 1K6OA 2D45A 2HXOA 1ZG1A 1UG0A 4UUSA 4A3GJ 1KU3A 3K69A 1A36A 3FMSA 2AO9A 2QLZA 4KIBA 3G4SI 1XS9A 5GTHC 3MKLA 2M8GX 3RQIA 1BI2A 1HW1A 2AXTC 4NC8A 3W6VA 4UUSB 3HM5A 2H1LA 3HOSA 1X3UA 3W6JB 2WWYA 1S6LA 1YW8A 2LK2A 5M5XJ 1WGXA 1WQ2A 3FWEA 3I3LA 3BC8A 3LSTA 1KZHA 5EGOA 2IW5A 2R92J 3K7AJ 4ZYGA 2R5YB 4YG2F 3V42A 2DJIA 3WE2A 1ZRCA 2OC6A 1MBEA 4ZYDA 3G1MA 2QENA 5EGOB 3J81K 3B6AA 5FKLA 4XLAA 5D5XB 1K79A 3E97A 1G2HA 5JVTA 1A35A 3V8JA 1R4MB 4Q48A 1SD6A 2JPCA 5L3CA 3ZN0A 2LD5A 1X3ZB 4BY7J 4HG2A 3O3KA 4EGZA 1LEAA 2Q2EA 1IXCA 2NAZA 3WTWC 3MZHA 2E35A 2FA5A 4KMUX 2R5ZA 2WB1A 5IYBJ 4IKFA 4L0ZB 3CCRI 2JRTA 2R7XA 2UZKA 2Q2EB 5JHFA 2GA1A 3OYNA 2W1OA 2HOAA 2KIQA 5HDNA 2MA3A 2RDPA 3DPTA 3SJMA 1IG7A 4IHTA 4A3CJ 2RGVA 5J40A 4XKVA 2NVXJ 4YIFA 3FXJA 3NQOA 2NS8A 3GVAA 4XBFA 2X0LA 1RKWA 3RPQA 1UAAA 2DA5A 2X51A 1IRFA 4XSZF 4Y13A 3H1CA 1XCVA 2CU7A 2JSPA 2E7WA 3C2BA 3NAUA 2ZMEC 1BW6A 1C0WA 4GGGA 4NC7A 5D4SA 3F8NA 4J19A 1DP3A 1JXSA 2XF6A 2KKOA 1HW5A 1TWCJ 1LVAA 2LKPA 3FZVA 3BPVA 3C2HA 3K70C 2NNNA 2KP6A 5IP7J 5CQGA 3ISPA 2BXZA 3F22A 1YW7A 3MKZA 1JTYA 2XUBA 2MH2A 3HHHA 5LGNA 1MW7A 2VJ4A 4D5CA 1ETQA 9ANTA 5C4XJ 3A2KA 3J7AO 4ITVA 5GAHJ 2K40A 5HS9A 2CH0A 3X2QH 1I39A 3ZQ7A 2Y0SN 2EQRA 1MMNA 4ENMA 3H9JA 1T08B 2KRHA 1OFCX 1U5TA 1WJFA 1OCTC 1QBJA 1YW9A 2EB7A 2DQLA 2CMPA 2HYGD 1A5JA 2B7EA 1F9NA 2DBBA 4KMFA 2IEKA 2Z33A 1F43A 2EIKH 2L54A 1BL0A 4A3KJ 3CO7C 4ZYEA 1LJ9A 3OIOA 4LIUA 2O8KA 3S2WA 4B1RA 5JR3A 1VQ4I 2W48A 4V19K 3EUKL 2L2OA 1SVOA 2MW8A 2PG4A 2ZO4A 1YIJI 3GX4X 2DA7A 2VLAA 3BG3A 2RVCA 4ZYAA 3OYCA 2XPVA 5FFXA 1KGSA 3M8FA 1MD0A 4I0BA 5IPAA 1FEXA 1FT9A 3KZYA 5LEKA 3W2AA 2A6TA 4J00A 1K61A 5GPAA 3A01B 2FOWA 4P96A 5F64A 4HX8A 3CJTB 1L0OC 4EQQA 1PUFA 1HC8A 1FIAA 1YYVA 1X4OA 2JSCA 1YOVB 2BHZA 3E6DA 4HV6A 4O6JA 1J75A 1REPC 2XPUA 2P6TA 1XD7A 4RS8A 3QOPA 5KAIC 2JA8J 5D6FA 2F5DA 1PUFB 1LE8A 4KUMA 3J7ZI 3A1YA 4LG3A 4LB6B 2HXIA 2R7FA 5BPDA 4P1WA 2ZB9A 3OOUA 3GW2A 3ZQGA 2FNPA 3ZQCA 2YU9J 5KAFC 3EUHA 2DTZA 2QSFX 3R4KA 3FKIJ 3JAMZ 1G3WA 1Y1VJ 1BR2A 3S3MA 3T0YA 3OSFA 4ZYHA 1U9NA 2DOAA 1P4AA 4F52A 3CMAI 4HLYA 4U7BA 2OD5A 3DFGA 3P9IA 4CXFA 4KNYA 2CO5A 2EINH 3HYIA 3CCEI 2LBFB
chains in the Genus database with same CATH topology
1HSTA 2HTJA 3JSOA 2J5PA 4O3MA 4Z2YA 2DPUA 4ZH4F 1O3RA 3TQNA 4NB5A 1XMAA 2HZTA 2QYOA 3CDHA 3WU0A 2E7XA 5HDKA 2COMA 4OIQF 2EV6A 2DU9A 3ZMZA 5J8FA 3ZP5A 1XMKA 3LAJA 4N0BA 4EM0B 1G3SA 1S7AA 3FXQA 2VC1A 3CUQC 4M71A 3K2ZA 3LA7A 1SFXA 2QQBA 4WX9A 5DD4A 3K1PA 4ON0A 2DT5A 2ZJ2A 5LLQA 1FOKA 1XSVA 1O57A 1SD7A 1P2FA 2PFBA 2CW0F 1W7PA 2LF8A 5K5QA 4HX4A 2XV4S 4LG0A 2Q0OA 4L9VA 2PN6A 1KA8A 2A68F 5HLGA 1BOAA 4NQWA 4LG0B 4IXAA 1EH8A 2C6YA 3TO6A 1TLHB 2BBYA 3L09A 4BQAA 1LQ1A 1SAXA 4IJAA 5IT9K 2K4JA 2OQRA 4QWQA 2XAJA 3NEUA 3D5LA 1KQ8A 1SD5A 2JT1A 5L3EA 1HW2A 4MGRA 3J80K 4Q4ZF 2F5EA 4I2OA 2K27A 1XN7A 1R36A 2FSWA 3JTGA 4R79A 4BHCA 2RNJA 1I6XA 1R1VA 2MLGA 2O61A 2HTSA 4HF0A 4KICA 3P9CA 1EV7A 2RKHA 3GYHX 2P7VB 1XGMA 3CJNA 1ZARA 3F6OA 4S05A 4S04A 4B8XA 2OAZA 3BY6A 3GO5A 5IT3A 2PQ8A 3GFLA 5HLIA 4N9HA 4M9SA 3VODA 1E2XA 2BV6A 5DD8A 3ZMTA 4PCQA 2FU4A 4IHSA 4CICA 3C7JA 1G6NA 4A6EA 3LA3A 3ZN1A 2QQAA 1YQAA 2FMLA 3TDUC 2Z99A 2HEOA 1ZLJA 5L3GA 1Z6RA 2A6HF 2KIFA 2P4WA 4G7HF 3V7CA 3K1NA 2L02A 2XKOA 5JFRA 3E5UA 2L01A 1MGTA 5D8KB 1WKMA 4OIRF 3F6VA 1KQ0A 1V4RA 3N4MA 4GO1A 1S3JA 4ESBA 2GAUA 3WGIA 2WC2A 2QQ9A 4KN7X 2Y0MA 3DXJF 3H3UA 3HRSA 4YIIA 4YFNF 4HW0A 2P8TA 1P4WA 4IVNA 2PBIA 2PEXA 5HDGA 1R58A 1Z05A 1HXDA 3I64A 2K4BA 4EGYA 1FY7A 5D6EA 1O3QA 3V8LA 1EH6A 3VFZA 4KYWA 4O5VA 4A0ZA 2XHKA 4LLNA 4GCVA 2D2WA 3QAHA 2HKXA 1STZA 1RIOH 1U5TC 3JSPA 2V9VA 2Z3YA 1OPCA 1FSHA 3Q9VA 4BHPA 1Z7UA 4G6DA 2VBYA 2UXXA 1ZLKA 1KU9A 1S7OA 3FM3A 1OKRA 2OZUA 2DTRA 1WI9A 1L3LA 1B4AA 4G7ZF 3E5XA 4M72A 3I59A 2E1CA 4BAYA 1ZGJA 4RB2C 1J5YA 1ZN2A 2PMHA 3DV8A 1HSJA 4ESFA 2FBIA 3PFIA 3GXOA 1DPUA 4XSXF 4HQMA 4KT5C 2GIVA 5FFZA 5CJ9A 1DPRA 1QZYA 1FC3A 3FXUA 3U9GA 2QBYB 1ONVA 3WTXC 3HHGA 2DAOA 3KE2A 1KU2A 1CF7A 1Z9CA 3EDPA 4M6YA 1BJAA 3R61A 3BOQA 1LDKB 3V4GA 5FGMA 1UHMA 1U6GA 2YR2A 4LFUA 3B73A 1I1SA 2OA4A 4AVPA 1MJAA 3HTSB 1RNLA 4PGGA 1FYLA 1I5ZA 1J59A 4KIFA 4A0YA 4UUVA 3CTAA 5FLXZ 2G7UA 5L3DA 1HKQA 3FHZA 4A12A 2FXAA 2A6EF 2F2EA 2ISZA 4U7DA 1R22A 2O3FA 2ESNA 5A2QK 1IF1A 2VT3A 2NS0A 3WGHA 1R5GA 2H6BA 1AOYA 3MFKA 3Q9SA 1HKTA 1FBSA 3MWMA 1F4KA 1USSA 4HF1A 4KA4A 2O03A 2M5WA 2QZ8A 2ZNYA 3L00A 2V6CA 1ULYA 3ZMUA 4RGUA 3K1MA 2R3SA 4LD5A 1LNWA 3KP3A 3L9FA 3I58A 1I27A 1OYWA 3RKXA 3MAJA 5ICGA 4UV8A 1CGPA 2O6GE 5HS8A 1T6SA 3FM5A 2A07F 2D1VA 1R00A 5LHGA 5DDGA 2OU2A 4JK1X 5FD5A 1TNTA 3LAPA 3HRUA 3KZZA 2CQKA 4MQVA 2L4AA 1ZH5A 1GVJA 3C1DA 1LEBA 3BZ6A 4HBLA 1W4MA 3T1BA 4HLXA 4A5MA 2A3SA 1FBQA 4UNOA 3WODF 1TTYA 4I01A 4MEYF 2MH9A 3F8BA 2V1DA 4G8XA 2GXGA 2XROA 1Z6TA 4XRFA 1GXPA 3P9KA 2O0YA 1BBYA 1B6AA 2H27A 2VBXA 1QPMA 4XLNF 2ZFWA 2Z5UA 4P9FA 1D8KA 4WXCA 4HF2A 3G3ZA 3F8MA 2XKPA 2XASA 4RAYA 3SZTA 1TQPA 2QUFA 3ABTA 3KETA 3ECOA 3M7GA 1TQIA 2VT2A 1YO5C 5ED4A 3KLOA 5CVVA 3WTYC 3M8EA 3HTUA 3FMQA 2FMYA 2VE8A 1IN8A 4OIOF 2STWA 4ENNA 1T39A 2Z9OA 4HQEA 1S29A 5H6QA 5LEJA 3I71A 4ASNA 4G9YA 5HS7A 1IAWA 3DF8A 1W5SA 4L9TA 2TDXA 2CFXA 4L9NA 4PZJA 4UXNA 4YFXF 3MZYA 5A2QZ 3BJAA 3ECHA 1SMYF 1U78A 2EK5A 1RI7A 2EV0A 5J6XA 2IP2A 1D3YA 3T8TA 1BI3A 2CYYA 3J81Z 1G4DA 4WXDA 3LWFA 1MZBA 1PP7U 1YFHA 3QP6A 3QPHA 4G7OF 1FWZA 1IXRC 4I02A 2ELHA 2VOPA 1TQMA 3CLOA 2GWRA 3F3XA 5E8IA 5LBQA 2HQNA 1IZ1A 3MCZA 2W24A 4UHTA 1O3SA 1SMTA 4F7ZA 4TV7A 2KJCA 3KP6A 4HA8A 1BC7C 3ROUA 3GUDA 4G94A 1FLIA 1IN6A 4HV5A 2VN2A 3HUGA 4UVCA 3HSEA 3I54A 1XDUA 4CYDA 1O7LA 3C3WA 1ZRDA 4P9UA 1JE8A 4OMZA 3RKYA 2G7HA 3SZPA 4BH9A 2IPQX 3EYIA 4ZZDA 2YX7A 1OMIA 3DKWA 4KIGA 4U0WA 1BIBA 3DP7A 3TO7A 4GYIA 1FZPB 3DEUA 2GQQA 3Q5FA 1U8RA 5ILVA 1B59A 1ZG5A 2RN7A 4CDGA 4YFKF 2PLYA 1XDSA 3NRVA 4MHGA 2JTVA 4AD9A 4E70A 1S8NA 2ZBKA 1JGSA 2YSRA 5DYMA 4ENJA 4HAMA 5D5UB 2OZ6A 5EEHA 4A0XA 2A61A 1D5VA 1P6RA 5BS6A 3IL2A 3DQVC 2V1XA 3FMRA 1PUEE 2ZMEB 5D5VB 2ISYA 5F1RA 2CG4A 4GYGA 4D0PA 3RI4A 4L5JA 5CLSA 4A6DA 4EJVA 4IRGA 4BHBA 5E1ZB 1A04A 5E20A 4H0EA 3TO9A 3RYRA 4ESJA 1HBXG 1MJBA 4A2UA 3BJOA 3TKYA 3WG9A 2DFIA 4MTEA 5FB2A 5DV5A 2H94A 2DQRA 3GFMA 4PGHA 4MTDA 2AXLA 5DUKA 4Q47A 3ELKA 2ZXJA 5DUIA 2BEOA 4P55A 1D8JA 3TOAA 4I0AA 1JHFA 4FT8A 3V8KA 3H92A 3ZMDA 4UV9A 3HRMA 4IRIA 2GZWA 2M1BA 2K02A 5ICFA 4M9XA 1ON1A 3IWZA 3IKVA 2UXNA 4LB5A 5BMZA 4RGXA 1RUOA 1P4XA 3MEXA 2IRFG 1FP2A 4UVBA 5FD6A 3JW4A 2EFPA 1J2XA 3BROA 5L3FA 1IRGA 5DCMB 1BN5A 1LB2A 3RTRA 3F8FA 5D4RA 1B1BA 3HRTA 3OOPA 2FOKA 3KFWX 4I7HA 5IT9Z 1FYMA 2X4HA 4A5NA 1G3TA 1H9TA 3KP7A 1T38A 1F1ZA 4LJZF 4U88A 1YIOA 2J5OA 1H0MA 2MBFA 1IN5A 3LA2A 4JBAA 3CUQA 5KK1A 2MLKA 2QBYA 5K5RA 1B9MA 3J80Z 1IUYA 4M6XA 4EJTA 3PQJA 3CUQB 1O7FA 2GXBA 2YU3A 3WTUC 3IRQA 1XB4A 3JTHA 5TRDA 2P5LC 2CGPA 1DP7P 1XSDA 2L3DA 2VC0A 4WXHA 2IJLA 4AIKA 2DI3A 1FSEA 5ICCA 4Q5SF 2FRHA 1XGOA 4LGWA 1J7KA 2EFOA 3R0AA 4HOBA 1RZ4A 5L3BA 3W6KB 3I5UA 1ZREA 3O2PE 4BNCA 3QPTA 1R5HA 1ZAOA 4Y15A 1P92A 4OIPF 2MC3A 1HKSA 5ILSA 1MDMB 1OYIA 2WTEA 5CVRA 3GFIA 3WTTC 3JAMK 5AIPA 5BQTA 3R60A 2D1HA 4IF4A 3QU6A 4LLGF 1USTA 4RB3C 4OINF 4DNCA 2AS5F 4KFCA 3N97A 2M8EA 1TNSA 2Q8KA 4AWXB 2QWWA 4BXUA 1FYKA 5JHUA 5J8CA 2EWNA 3K0LA 4MNUA 1HQCA 3GFJA 4HDUA 2PJPA 2FNAA 1BI1A 1I1GA 2BE5F 2HQRA 3GEZA 3ML6A 3RDIA 2STTA 1R1UA 1Z91A 2W85A 1R7JA 3B02A 5ERIA 2ZNZA 1BIAA 3KEOA 3E6BA 4L5IA 1ODDA 2BGCA 5D5WB 2ACJA 1U3EM 1ZRFA 2E1NA 4EM2A 1LDDA 4R8HA 2W57A 4I09A 4PDKA 5CYVA 2XAGA 1SFUA 3HIFA 3GZ6A 2M87A 2QM3A 2W84A 3GLXA 1DUXC 2FE3A 4CHUA 3GF2A 3ERED 2WV0A 3LQQA 4RB0A 4CGZA 3FXRA 2H6CA 1PDNC 2HR3A 2KRFA 5LRSA 4LMYA 1TW3A 3OV8A 2XGXA 4JQFA 2PI0A 2K86A 1KQ9A 3CO6C 3VEPA 3V7RA 2L4MA 4RGRA 1MJ9A 2GA2A 1W5TA 3GZ5A 3ABUA 3FF5A 3AAFA 4XLPF 3BJ6A 4EJUA 2NRAC 3M1EA 5AIQA 1UCRA 3ZMSA 4U0YA 1Q1HA 5E1XA 3BWGA 1U5TB 3RYPA 2F5FA 1T0FA 5K5OA 2XAQA 2XIGA 3BDDA 4LK1F 2QVOA 5ICEA 1AWCA 1TBXA 2DW4A 2DPDA 4L18B 2V79A 3TOBA 3IKTA 4OMYA 2NYXA 4K2EA 3HOTA 1G3YA 1SFEA 1FNNA 1R1TA 1YLFA 1QNTA 2FBHA 1XCBA 2ZKZA 5F6FA 2PMUA 2ETHA 4UVAA 1UHWA 2LSOA 5TJJA 3U1DA 3CUOA 2XAHA 2W25A 5LHIA 4M9ZA 2A69F 2IA1A 3M9AA 3WGGA 1K7AA 3KP2A 3IRRA 1ZHFA 1YS7A 1TW2A 5E17F 2Y48A 2VE9A 3SQNA 4HDVA 3D0SA 4EMSA 4WWCA 3IWFA 4U0VA 6PAXA 3SFZA 4ETSA 5CVUA 1Y0UA 1KYZA 2M45A 4EM1A 1H9GA 2HWVA 2KIUA 1IW7F 5BOXA 2FF4A 4FX0A 2Y75A 1GHCA 4NHJA 5E18F 2ADUA 3E3VA 4WCGA 4RGSA 2EV5A 5D8LB 4QLCU 3KLNA 3ZPLA 2UWMA 3ULQB 3R0JA 4MEXF 4R1HA 1ZYRF 4GXOA 2NNYA 2IA2A 1ON2A 3K9TA 2CWEA 2IT0A 1QZZA 3O6BB 1IXSB 1WRJA 5EEGA 2ESHA 2EFNA 2HGCA 2DLLA 3I53A 3DPLC 2VBZA 2O8XA 3RKWA 3RPUA 2EFWA 3PQKA 5HLHA 3EQLF 1W7PB 3RIRA 3T5XA 4LLLA 3BPXA 5HVQC 4EJWA 2HYFA 3WE3A 4N9IA 2DO7A 4OU0A 1J9IA 2R7DA 2IVMA 2IA0A 5FO5A 3TDZC 2YPRA 5JI6A 5CVJA 3LFKA 2DK5A 4M73A 1BM9A 4IRHA 2LDUA 4KN4X 1Z1DA 3SHFA 1BI0A 1XSXA 1JHHA 2BYVE 3QU3A 2HS5A 1MKMA 1YS6A 3T8RA 1T2KA 4AIJA 4I98B 2P5KA 2RV8A 2ZMEA 1J0RA 1LDJA 3RJPA 2LNBA 4EJOA 1DDNA 1SD4A 4IPAA 3KCCA 2XVCA 1IN7A 2VOOA 1O3TA 1FX7A 1QO0D 2K7LA 4CZZA 2FQ3A 4RB1A 3KEQA 3LQRA 3ZMVA 2HKOA 1VTNC 5E1WA 1FBUA 5LGTA 2EA2A 1U2WA 2JPBA 4M74A 3QRFF 2MD5A 1XGNA 3FX3A 1XGSA 3I0TA 3WTZA 3L7WA 3KP5A 5LRRA 2FBKA 5H20A 2JZYA 2B0LA 5FLXK 1R23A 4RAZA 2RC4A 3GWZA 1GXQA 1T98A 2ZCWA 4FX4A 4CO8A 5BPIA 1YTYA 1ZG3A 2G9WA 4HYEA 1ZGAA 3U2RA 2HDCA 2DK8A 3WTSC 2OQGA 2OBPA 3VB2A 1BC8C 3F23A 2XRNA 3MQ0A 1EH7A 4WF2A 2FEZA 1FP1D 5AONA 2EFQA 2EJRA 3V7SA 3F21A 5H6RA 3IC7A 1E17A 3WTVC 5LHHA 2F5CA 5DCMA 4OOIA 1PP8F 4L9JA 3E6CC 4BYYA 4WK8F 3H3ZA 3EYYA 3KP4A 4DQ2A 3E6MA 1V3FA 2V1UA 4ZZLA 3F8CA 1WWXA 4EVIA 1WSUA 2A5YB 3COAC 3P7NA 4HZFA 4LK0F 2VODA 5DCFA 1RUNA 3BP8A 2YX4A 5KVRA 3REOA 4ENKA 1F5TA 4G6QA 3C18A 4HX7A 2CSOA 5E8GA 3EETA 1UFMA 3QP5A 2KJBA 1UB9A 2P7CB 4B09A 3I59B 2M30A 3TGNA 2KIMA 5HOOA 3I4PA 5K1YA 3R6SA 1IN4A 1W7PD 3WU1B 4EV0A 4Y17A 1KYWA 3F72A 1K78A 2P6SA 3E5QA 1FPQA 5CVIA 2VONA 5DEQA 2HFHA 2VBWA 5ILUA 2RQPA 1K78B 3HSRA 4P5OA 4MQ9F 5LGUA 2EA4A 1OR7A 1CF7B 2H09A 2LF7A 1MDMA 3L2CA 3IHUA 3HSFA 1OYYA 2P5VA 1NHAA 3G73A 3VOEA 2HOEA 1B9NA 4KDPA 4FHTA 1YG2A 4L0YB 1KU7A 1QQIA 1QGPA 2XAFA 2VXZA 3SXYA 4AIHA 1K6OA 2D45A 1ZG1A 1KU3A 3K69A 3FMSA 2QLZA 4KIBA 1BI2A 1HW1A 3HOSA 1X3UA 3W6JB 2WWYA 1S6LA 1YW8A 1WQ2A 3FWEA 3LSTA 2IW5A 4ZYGA 4YG2F 3WE2A 1ZRCA 4ZYDA 2QENA 3J81K 5D5XB 1K79A 3E97A 5JVTA 3V8JA 4Q48A 1SD6A 2JPCA 5L3CA 3ZN0A 3O3KA 4EGZA 1LEAA 2Q2EA 1IXCA 2NAZA 3WTWC 3MZHA 4KMUX 2FA5A 4L0ZB 2JRTA 2UZKA 2GA1A 5HDNA 2MA3A 2RDPA 3DPTA 4IHTA 2RGVA 4YIFA 3NQOA 3GVAA 4XBFA 2X0LA 3RPQA 1IRFA 4XSZF 4Y13A 1XCVA 2E7WA 1C0WA 4GGGA 5D4SA 3F8NA 1JXSA 2KKOA 1HW5A 1LVAA 2LKPA 3FZVA 3BPVA 2NNNA 3ISPA 3F22A 1YW7A 2XUBA 2MH2A 3HHHA 5LGNA 3J7AO 5HS9A 3ZQ7A 4ENMA 1U5TA 1QBJA 1YW9A 2EB7A 2DQLA 2HYGD 1F9NA 2DBBA 4KMFA 2Z33A 2L54A 3CO7C 4ZYEA 1LJ9A 3S2WA 5JR3A 2PG4A 2ZO4A 3GX4X 2RVCA 5FFXA 1KGSA 3M8FA 1MD0A 4I0BA 1FT9A 3KZYA 5LEKA 4P96A 5F64A 4EQQA 4HX8A 1L0OC 1YYVA 2JSCA 3E6DA 1J75A 4HV6A 4O6JA 1REPC 2P6TA 1XD7A 4RS8A 3QOPA 5D6FA 2F5DA 4KUMA 4LB6B 2R7FA 5BPDA 3GW2A 2FNPA 3EUHA 3R4KA 3JAMZ 1G3WA 3T0YA 4ZYHA 1P4AA 4HLYA 4U7BA 2OD5A 3DFGA 3P9IA 4CXFA 4KNYA 2CO5A 3HYIA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1HST A;  2HTJ A;  3JSO A;  2J5P A;  4O3M A;  4Z2Y A;  2DPU A;  4ZH4 F;  1O3R A;  3TQN A;  4NB5 A;  1XMA A;  2HZT A;  2QYO A;  3CDH A;  3WU0 A;  2E7X A;  5HDK A;  2COM A;  4OIQ F;  2EV6 A;  2DU9 A;  3ZMZ A;  5J8F A;  3ZP5 A;  1XMK A;  3LAJ A;  4N0B A;  4EM0 B;  1G3S A;  1S7A A;  3FXQ A;  2VC1 A;  3CUQ C;  4M71 A;  3K2Z A;  3LA7 A;  1SFX A;  2QQB A;  4WX9 A;  5DD4 A;  3K1P A;  4ON0 A;  2DT5 A;  2ZJ2 A;  5LLQ A;  1FOK A;  1XSV A;  1O57 A;  1SD7 A;  1P2F A;  2PFB A;  2CW0 F;  1W7P A;  2LF8 A;  5K5Q A;  4HX4 A;  2XV4 S;  4LG0 A;  2Q0O A;  4L9V A;  2PN6 A;  1KA8 A;  2A68 F;  5HLG A;  1BOA A;  4NQW A;  4LG0 B;  4IXA A;  1EH8 A;  2C6Y A;  3TO6 A;  1TLH B;  2BBY A;  3L09 A;  4BQA A;  1LQ1 A;  1SAX A;  4IJA A;  5IT9 K;  2K4J A;  2OQR A;  4QWQ A;  2XAJ A;  3NEU A;  3D5L A;  1KQ8 A;  1SD5 A;  2JT1 A;  5L3E A;  1HW2 A;  4MGR A;  3J80 K;  4Q4Z F;  2F5E A;  4I2O A;  2K27 A;  1XN7 A;  1R36 A;  2FSW A;  3JTG A;  4R79 A;  4BHC A;  2RNJ A;  1I6X A;  1R1V A;  2MLG A;  2O61 A;  2HTS A;  4HF0 A;  4KIC A;  3P9C A;  1EV7 A;  2RKH A;  3GYH X;  2P7V B;  1XGM A;  3CJN A;  1ZAR A;  3F6O A;  4S05 A;  4S04 A;  4B8X A;  2OAZ A;  3BY6 A;  3GO5 A;  5IT3 A;  2PQ8 A;  3GFL A;  5HLI A;  4N9H A;  4M9S A;  3VOD A;  1E2X A;  2BV6 A;  5DD8 A;  3ZMT A;  4PCQ A;  2FU4 A;  4IHS A;  4CIC A;  3C7J A;  1G6N A;  4A6E A;  3LA3 A;  3ZN1 A;  2QQA A;  1YQA A;  2FML A;  3TDU C;  2Z99 A;  2HEO A;  1ZLJ A;  5L3G A;  1Z6R A;  2A6H F;  2KIF A;  2P4W A;  4G7H F;  3V7C A;  3K1N A;  2L02 A;  2XKO A;  5JFR A;  3E5U A;  2L01 A;  1MGT A;  5D8K B;  1WKM A;  4OIR F;  3F6V A;  1KQ0 A;  1V4R A;  3N4M A;  4GO1 A;  1S3J A;  4ESB A;  2GAU A;  3WGI A;  2WC2 A;  2QQ9 A;  4KN7 X;  2Y0M A;  3DXJ F;  3H3U A;  3HRS A;  4YII A;  4YFN F;  4HW0 A;  2P8T A;  1P4W A;  4IVN A;  2PBI A;  2PEX A;  5HDG A;  1R58 A;  1Z05 A;  1HXD A;  3I64 A;  2K4B A;  4EGY A;  1FY7 A;  5D6E A;  1O3Q A;  3V8L A;  1EH6 A;  3VFZ A;  4KYW A;  4O5V A;  4A0Z A;  2XHK A;  4LLN A;  4GCV A;  2D2W A;  3QAH A;  2HKX A;  1STZ A;  1RIO H;  1U5T C;  3JSP A;  2V9V A;  2Z3Y A;  1OPC A;  1FSH A;  3Q9V A;  4BHP A;  1Z7U A;  4G6D A;  2VBY A;  2UXX A;  1ZLK A;  1KU9 A;  1S7O A;  3FM3 A;  1OKR A;  2OZU A;  2DTR A;  1WI9 A;  1L3L A;  1B4A A;  4G7Z F;  3E5X A;  4M72 A;  3I59 A;  2E1C A;  4BAY A;  1ZGJ A;  4RB2 C;  1J5Y A;  1ZN2 A;  2PMH A;  3DV8 A;  1HSJ A;  4ESF A;  2FBI A;  3PFI A;  3GXO A;  1DPU A;  4XSX F;  4HQM A;  4KT5 C;  2GIV A;  5FFZ A;  5CJ9 A;  1DPR A;  1QZY A;  1FC3 A;  3FXU A;  3U9G A;  2QBY B;  1ONV A;  3WTX C;  3HHG A;  2DAO A;  3KE2 A;  1KU2 A;  1CF7 A;  1Z9C A;  3EDP A;  4M6Y A;  1BJA A;  3R61 A;  3BOQ A;  1LDK B;  3V4G A;  5FGM A;  1UHM A;  1U6G A;  2YR2 A;  4LFU A;  3B73 A;  1I1S A;  2OA4 A;  4AVP A;  1MJA A;  3HTS B;  1RNL A;  4PGG A;  1FYL A;  1I5Z A;  1J59 A;  4KIF A;  4A0Y A;  4UUV A;  3CTA A;  5FLX Z;  2G7U A;  5L3D A;  1HKQ A;  3FHZ A;  4A12 A;  2FXA A;  2A6E F;  2F2E A;  2ISZ A;  4U7D A;  1R22 A;  2O3F A;  2ESN A;  5A2Q K;  1IF1 A;  2VT3 A;  2NS0 A;  3WGH A;  1R5G A;  2H6B A;  1AOY A;  3MFK A;  3Q9S A;  1HKT A;  1FBS A;  3MWM A;  1F4K A;  1USS A;  4HF1 A;  4KA4 A;  2O03 A;  2M5W A;  2QZ8 A;  2ZNY A;  3L00 A;  2V6C A;  1ULY A;  3ZMU A;  4RGU A;  3K1M A;  2R3S A;  4LD5 A;  1LNW A;  3KP3 A;  3L9F A;  3I58 A;  1I27 A;  1OYW A;  3RKX A;  3MAJ A;  5ICG A;  4UV8 A;  1CGP A;  2O6G E;  5HS8 A;  1T6S A;  3FM5 A;  2A07 F;  2D1V A;  1R00 A;  5LHG A;  5DDG A;  2OU2 A;  4JK1 X;  5FD5 A;  1TNT A;  3LAP A;  3HRU A;  3KZZ A;  2CQK A;  4MQV A;  2L4A A;  1ZH5 A;  1GVJ A;  3C1D A;  1LEB A;  3BZ6 A;  4HBL A;  1W4M A;  3T1B A;  4HLX A;  4A5M A;  2A3S A;  1FBQ A;  4UNO A;  3WOD F;  1TTY A;  4I01 A;  4MEY F;  2MH9 A;  3F8B A;  2V1D A;  4G8X A;  2GXG A;  2XRO A;  1Z6T A;  4XRF A;  1GXP A;  3P9K A;  2O0Y A;  1BBY A;  1B6A A;  2H27 A;  2VBX A;  1QPM A;  4XLN F;  2ZFW A;  2Z5U A;  4P9F A;  1D8K A;  4WXC A;  4HF2 A;  3G3Z A;  3F8M A;  2XKP A;  2XAS A;  4RAY A;  3SZT A;  1TQP A;  2QUF A;  3ABT A;  3KET A;  3ECO A;  3M7G A;  1TQI A;  2VT2 A;  1YO5 C;  5ED4 A;  3KLO A;  5CVV A;  3WTY C;  3M8E A;  3HTU A;  3FMQ A;  2FMY A;  2VE8 A;  1IN8 A;  4OIO F;  2STW A;  4ENN A;  1T39 A;  2Z9O A;  4HQE A;  1S29 A;  5H6Q A;  5LEJ A;  3I71 A;  4ASN A;  4G9Y A;  5HS7 A;  1IAW A;  3DF8 A;  1W5S A;  4L9T A;  2TDX A;  2CFX A;  4L9N A;  4PZJ A;  4UXN A;  4YFX F;  3MZY A;  5A2Q Z;  3BJA A;  3ECH A;  1SMY F;  1U78 A;  2EK5 A;  1RI7 A;  2EV0 A;  5J6X A;  2IP2 A;  1D3Y A;  3T8T A;  1BI3 A;  2CYY A;  3J81 Z;  1G4D A;  4WXD A;  3LWF A;  1MZB A;  1PP7 U;  1YFH A;  3QP6 A;  3QPH A;  4G7O F;  1FWZ A;  1IXR C;  4I02 A;  2ELH A;  2VOP A;  1TQM A;  3CLO A;  2GWR A;  3F3X A;  5E8I A;  5LBQ A;  2HQN A;  1IZ1 A;  3MCZ A;  2W24 A;  4UHT A;  1O3S A;  1SMT A;  4F7Z A;  4TV7 A;  2KJC A;  3KP6 A;  4HA8 A;  1BC7 C;  3ROU A;  3GUD A;  4G94 A;  1FLI A;  1IN6 A;  4HV5 A;  2VN2 A;  3HUG A;  4UVC A;  3HSE A;  3I54 A;  1XDU A;  4CYD A;  1O7L A;  3C3W A;  1ZRD A;  4P9U A;  1JE8 A;  4OMZ A;  3RKY A;  2G7H A;  3SZP A;  4BH9 A;  2IPQ X;  3EYI A;  4ZZD A;  2YX7 A;  1OMI A;  3DKW A;  4KIG A;  4U0W A;  1BIB A;  3DP7 A;  3TO7 A;  4GYI A;  1FZP B;  3DEU A;  2GQQ A;  3Q5F A;  1U8R A;  5ILV A;  1B59 A;  1ZG5 A;  2RN7 A;  4CDG A;  4YFK F;  2PLY A;  1XDS A;  3NRV A;  4MHG A;  2JTV A;  4AD9 A;  4E70 A;  1S8N A;  2ZBK A;  1JGS A;  2YSR A;  5DYM A;  4ENJ A;  4HAM A;  5D5U B;  2OZ6 A;  5EEH A;  4A0X A;  2A61 A;  1D5V A;  1P6R A;  5BS6 A;  3IL2 A;  3DQV C;  2V1X A;  3FMR A;  1PUE E;  2ZME B;  5D5V B;  2ISY A;  5F1R A;  2CG4 A;  4GYG A;  4D0P A;  3RI4 A;  4L5J A;  5CLS A;  4A6D A;  4EJV A;  4IRG A;  4BHB A;  5E1Z B;  1A04 A;  5E20 A;  4H0E A;  3TO9 A;  3RYR A;  4ESJ A;  1HBX G;  1MJB A;  4A2U A;  3BJO A;  3TKY A;  3WG9 A;  2DFI A;  4MTE A;  5FB2 A;  5DV5 A;  2H94 A;  2DQR A;  3GFM A;  4PGH A;  4MTD A;  2AXL A;  5DUK A;  4Q47 A;  3ELK A;  2ZXJ A;  5DUI A;  2BEO A;  4P55 A;  1D8J A;  3TOA A;  4I0A A;  1JHF A;  4FT8 A;  3V8K A;  3H92 A;  3ZMD A;  4UV9 A;  3HRM A;  4IRI A;  2GZW A;  2M1B A;  2K02 A;  5ICF A;  4M9X A;  1ON1 A;  3IWZ A;  3IKV A;  2UXN A;  4LB5 A;  5BMZ A;  4RGX A;  1RUO A;  1P4X A;  3MEX A;  2IRF G;  1FP2 A;  4UVB A;  5FD6 A;  3JW4 A;  2EFP A;  1J2X A;  3BRO A;  5L3F A;  1IRG A;  5DCM B;  1BN5 A;  1LB2 A;  3RTR A;  3F8F A;  5D4R A;  1B1B A;  3HRT A;  3OOP A;  2FOK A;  3KFW X;  4I7H A;  5IT9 Z;  1FYM A;  2X4H A;  4A5N A;  1G3T A;  1H9T A;  3KP7 A;  1T38 A;  1F1Z A;  4LJZ F;  4U88 A;  1YIO A;  2J5O A;  1H0M A;  2MBF A;  1IN5 A;  3LA2 A;  4JBA A;  3CUQ A;  5KK1 A;  2MLK A;  2QBY A;  5K5R A;  1B9M A;  3J80 Z;  1IUY A;  4M6X A;  4EJT A;  3PQJ A;  3CUQ B;  1O7F A;  2GXB A;  2YU3 A;  3WTU C;  3IRQ A;  1XB4 A;  3JTH A;  5TRD A;  2P5L C;  2CGP A;  1DP7 P;  1XSD A;  2L3D A;  2VC0 A;  4WXH A;  2IJL A;  4AIK A;  2DI3 A;  1FSE A;  5ICC A;  4Q5S F;  2FRH A;  1XGO A;  4LGW A;  1J7K A;  2EFO A;  3R0A A;  4HOB A;  1RZ4 A;  5L3B A;  3W6K B;  3I5U A;  1ZRE A;  3O2P E;  4BNC A;  3QPT A;  1R5H A;  1ZAO A;  4Y15 A;  1P92 A;  4OIP F;  2MC3 A;  1HKS A;  5ILS A;  1MDM B;  1OYI A;  2WTE A;  5CVR A;  3GFI A;  3WTT C;  3JAM K;  5AIP A;  5BQT A;  3R60 A;  2D1H A;  4IF4 A;  3QU6 A;  4LLG F;  1UST A;  4RB3 C;  4OIN F;  4DNC A;  2AS5 F;  4KFC A;  3N97 A;  2M8E A;  1TNS A;  2Q8K A;  4AWX B;  2QWW A;  4BXU A;  1FYK A;  5JHU A;  5J8C A;  2EWN A;  3K0L A;  4MNU A;  1HQC A;  3GFJ A;  4HDU A;  2PJP A;  2FNA A;  1BI1 A;  1I1G A;  2BE5 F;  2HQR A;  3GEZ A;  3ML6 A;  3RDI A;  2STT A;  1R1U A;  1Z91 A;  2W85 A;  1R7J A;  3B02 A;  5ERI A;  2ZNZ A;  1BIA A;  3KEO A;  3E6B A;  4L5I A;  1ODD A;  2BGC A;  5D5W B;  2ACJ A;  1U3E M;  1ZRF A;  2E1N A;  4EM2 A;  1LDD A;  4R8H A;  2W57 A;  4I09 A;  4PDK A;  5CYV A;  2XAG A;  1SFU A;  3HIF A;  3GZ6 A;  2M87 A;  2QM3 A;  2W84 A;  3GLX A;  1DUX C;  2FE3 A;  4CHU A;  3GF2 A;  3ERE D;  2WV0 A;  3LQQ A;  4RB0 A;  4CGZ A;  3FXR A;  2H6C A;  1PDN C;  2HR3 A;  2KRF A;  5LRS A;  4LMY A;  1TW3 A;  3OV8 A;  2XGX A;  4JQF A;  2PI0 A;  2K86 A;  1KQ9 A;  3CO6 C;  3VEP A;  3V7R A;  2L4M A;  4RGR A;  1MJ9 A;  2GA2 A;  1W5T A;  3GZ5 A;  3ABU A;  3FF5 A;  3AAF A;  4XLP F;  3BJ6 A;  4EJU A;  2NRA C;  3M1E A;  5AIQ A;  1UCR A;  3ZMS A;  4U0Y A;  1Q1H A;  5E1X A;  3BWG A;  1U5T B;  3RYP A;  2F5F A;  1T0F A;  5K5O A;  2XAQ A;  2XIG A;  3BDD A;  4LK1 F;  2QVO A;  5ICE A;  1AWC A;  1TBX A;  2DW4 A;  2DPD A;  4L18 B;  2V79 A;  3TOB A;  3IKT A;  4OMY A;  2NYX A;  4K2E A;  3HOT A;  1G3Y A;  1SFE A;  1FNN A;  1R1T A;  1YLF A;  1QNT A;  2FBH A;  1XCB A;  2ZKZ A;  5F6F A;  2PMU A;  2ETH A;  4UVA A;  1UHW A;  2LSO A;  5TJJ A;  3U1D A;  3CUO A;  2XAH A;  2W25 A;  5LHI A;  4M9Z A;  2A69 F;  2IA1 A;  3M9A A;  3WGG A;  1K7A A;  3KP2 A;  3IRR A;  1ZHF A;  1YS7 A;  1TW2 A;  5E17 F;  2Y48 A;  2VE9 A;  3SQN A;  4HDV A;  3D0S A;  4EMS A;  4WWC A;  3IWF A;  4U0V A;  6PAX A;  3SFZ A;  4ETS A;  5CVU A;  1Y0U A;  1KYZ A;  2M45 A;  4EM1 A;  1H9G A;  2HWV A;  2KIU A;  1IW7 F;  5BOX A;  2FF4 A;  4FX0 A;  2Y75 A;  1GHC A;  4NHJ A;  5E18 F;  2ADU A;  3E3V A;  4WCG A;  4RGS A;  2EV5 A;  5D8L B;  4QLC U;  3KLN A;  3ZPL A;  2UWM A;  3ULQ B;  3R0J A;  4MEX F;  4R1H A;  1ZYR F;  4GXO A;  2NNY A;  2IA2 A;  1ON2 A;  3K9T A;  2CWE A;  2IT0 A;  1QZZ A;  3O6B B;  1IXS B;  1WRJ A;  5EEG A;  2ESH A;  2EFN A;  2HGC A;  2DLL A;  3I53 A;  3DPL C;  2VBZ A;  2O8X A;  3RKW A;  3RPU A;  2EFW A;  3PQK A;  5HLH A;  3EQL F;  1W7P B;  3RIR A;  3T5X A;  4LLL A;  3BPX A;  5HVQ C;  4EJW A;  2HYF A;  3WE3 A;  4N9I A;  2DO7 A;  4OU0 A;  1J9I A;  2R7D A;  2IVM A;  2IA0 A;  5FO5 A;  3TDZ C;  2YPR A;  5JI6 A;  5CVJ A;  3LFK A;  2DK5 A;  4M73 A;  1BM9 A;  4IRH A;  2LDU A;  4KN4 X;  1Z1D A;  3SHF A;  1BI0 A;  1XSX A;  1JHH A;  2BYV E;  3QU3 A;  2HS5 A;  1MKM A;  1YS6 A;  3T8R A;  1T2K A;  4AIJ A;  4I98 B;  2P5K A;  2RV8 A;  2ZME A;  1J0R A;  1LDJ A;  3RJP A;  2LNB A;  4EJO A;  1DDN A;  1SD4 A;  4IPA A;  3KCC A;  2XVC A;  1IN7 A;  2VOO A;  1O3T A;  1FX7 A;  1QO0 D;  2K7L A;  4CZZ A;  2FQ3 A;  4RB1 A;  3KEQ A;  3LQR A;  3ZMV A;  2HKO A;  1VTN C;  5E1W A;  1FBU A;  5LGT A;  2EA2 A;  1U2W A;  2JPB A;  4M74 A;  3QRF F;  2MD5 A;  1XGN A;  3FX3 A;  1XGS A;  3I0T A;  3WTZ A;  3L7W A;  3KP5 A;  5LRR A;  2FBK A;  5H20 A;  2JZY A;  2B0L A;  5FLX K;  1R23 A;  4RAZ A;  2RC4 A;  3GWZ A;  1GXQ A;  1T98 A;  2ZCW A;  4FX4 A;  4CO8 A;  5BPI A;  1YTY A;  1ZG3 A;  2G9W A;  4HYE A;  1ZGA A;  3U2R A;  2HDC A;  2DK8 A;  3WTS C;  2OQG A;  2OBP A;  3VB2 A;  1BC8 C;  3F23 A;  2XRN A;  3MQ0 A;  1EH7 A;  4WF2 A;  2FEZ A;  1FP1 D;  5AON A;  2EFQ A;  2EJR A;  3V7S A;  3F21 A;  5H6R A;  3IC7 A;  1E17 A;  3WTV C;  5LHH A;  2F5C A;  5DCM A;  4OOI A;  1PP8 F;  4L9J A;  3E6C C;  4BYY A;  4WK8 F;  3H3Z A;  3EYY A;  3KP4 A;  4DQ2 A;  3E6M A;  1V3F A;  2V1U A;  4ZZL A;  3F8C A;  1WWX A;  4EVI A;  1WSU A;  2A5Y B;  3COA C;  3P7N A;  4HZF A;  4LK0 F;  2VOD A;  5DCF A;  1RUN A;  3BP8 A;  2YX4 A;  5KVR A;  3REO A;  4ENK A;  1F5T A;  4G6Q A;  3C18 A;  4HX7 A;  2CSO A;  5E8G A;  3EET A;  1UFM A;  3QP5 A;  2KJB A;  1UB9 A;  2P7C B;  4B09 A;  3I59 B;  2M30 A;  3TGN A;  2KIM A;  5HOO A;  3I4P A;  5K1Y A;  3R6S A;  1IN4 A;  1W7P D;  3WU1 B;  4EV0 A;  4Y17 A;  1KYW A;  3F72 A;  1K78 A;  2P6S A;  3E5Q A;  1FPQ A;  5CVI A;  2VON A;  5DEQ A;  2HFH A;  2VBW A;  5ILU A;  2RQP A;  1K78 B;  3HSR A;  4P5O A;  4MQ9 F;  5LGU A;  2EA4 A;  1OR7 A;  1CF7 B;  2H09 A;  2LF7 A;  1MDM A;  3L2C A;  3IHU A;  3HSF A;  1OYY A;  2P5V A;  1NHA A;  3G73 A;  3VOE A;  2HOE A;  1B9N A;  4KDP A;  4FHT A;  1YG2 A;  4L0Y B;  1KU7 A;  1QQI A;  1QGP A;  2XAF A;  2VXZ A;  3SXY A;  4AIH A;  1K6O A;  2D45 A;  1ZG1 A;  1KU3 A;  3K69 A;  3FMS A;  2QLZ A;  4KIB A;  1BI2 A;  1HW1 A;  3HOS A;  1X3U A;  3W6J B;  2WWY A;  1S6L A;  1YW8 A;  1WQ2 A;  3FWE A;  3LST A;  2IW5 A;  4ZYG A;  4YG2 F;  3WE2 A;  1ZRC A;  4ZYD A;  2QEN A;  3J81 K;  5D5X B;  1K79 A;  3E97 A;  5JVT A;  3V8J A;  4Q48 A;  1SD6 A;  2JPC A;  5L3C A;  3ZN0 A;  3O3K A;  4EGZ A;  1LEA A;  2Q2E A;  1IXC A;  2NAZ A;  3WTW C;  3MZH A;  4KMU X;  2FA5 A;  4L0Z B;  2JRT A;  2UZK A;  2GA1 A;  5HDN A;  2MA3 A;  2RDP A;  3DPT A;  4IHT A;  2RGV A;  4YIF A;  3NQO A;  3GVA A;  4XBF A;  2X0L A;  3RPQ A;  1IRF A;  4XSZ F;  4Y13 A;  1XCV A;  2E7W A;  1C0W A;  4GGG A;  5D4S A;  3F8N A;  1JXS A;  2KKO A;  1HW5 A;  1LVA A;  2LKP A;  3FZV A;  3BPV A;  2NNN A;  3ISP A;  3F22 A;  1YW7 A;  2XUB A;  2MH2 A;  3HHH A;  5LGN A;  3J7A O;  5HS9 A;  3ZQ7 A;  4ENM A;  1U5T A;  1QBJ A;  1YW9 A;  2EB7 A;  2DQL A;  2HYG D;  1F9N A;  2DBB A;  4KMF A;  2Z33 A;  2L54 A;  3CO7 C;  4ZYE A;  1LJ9 A;  3S2W A;  5JR3 A;  2PG4 A;  2ZO4 A;  3GX4 X;  2RVC A;  5FFX A;  1KGS A;  3M8F A;  1MD0 A;  4I0B A;  1FT9 A;  3KZY A;  5LEK A;  4P96 A;  5F64 A;  4EQQ A;  4HX8 A;  1L0O C;  1YYV A;  2JSC A;  3E6D A;  1J75 A;  4HV6 A;  4O6J A;  1REP C;  2P6T A;  1XD7 A;  4RS8 A;  3QOP A;  5D6F A;  2F5D A;  4KUM A;  4LB6 B;  2R7F A;  5BPD A;  3GW2 A;  2FNP A;  3EUH A;  3R4K A;  3JAM Z;  1G3W A;  3T0Y A;  4ZYH A;  1P4A A;  4HLY A;  4U7B A;  2OD5 A;  3DFG A;  3P9I A;  4CXF A;  4KNY A;  2CO5 A;  3HYI A; 
#chains in the Genus database with same CATH topology
 1HST A;  2LLK A;  2HTJ A;  3JSO A;  2J5P A;  3FHN A;  4O3M A;  4Z2Y A;  1ENH A;  2EBI A;  2DPU A;  2NVQ J;  4LIT A;  4ZH4 F;  1O3R A;  1NTC A;  3TQN A;  4BGD A;  4NB5 A;  1EKE A;  1XMA A;  1T95 A;  1H89 C;  2HZT A;  3F0C A;  2QYO A;  2R7Z J;  5FKN A;  2LP0 A;  3CDH A;  3WU0 A;  2CV1 A;  2PJR A;  2E7X A;  5HDK A;  3PNY A;  2X6X A;  1DQU A;  2MD0 A;  5F0H A;  2COM A;  4C2U A;  4OIQ F;  2EV6 A;  2DU9 A;  3ZMZ A;  1U0J A;  3HOX J;  5J8F A;  5B1B H;  2DT6 A;  3ZP5 A;  1XMK A;  3LAJ A;  4N0B A;  5HNH A;  2LOO A;  4EM0 B;  1XC5 A;  1G3S A;  1S7A A;  3FXQ A;  3LSJ A;  2ME6 A;  2VC1 A;  3CUQ C;  4M71 A;  1QPI A;  3M07 A;  3K2Z A;  3LA7 A;  4Y33 A;  1SFX A;  2QQB A;  4WX9 A;  3K4N A;  5DD4 A;  3K1P A;  2DOD A;  3BR1 A;  3OL4 A;  1BOB A;  1JTX A;  1XTA A;  2WV1 A;  3ASN H;  4ON0 A;  1RC9 A;  2DT5 A;  3QQA A;  2GLO A;  2ZJ2 A;  1BR1 A;  2VIX A;  3TP3 A;  2E1O A;  5LLQ A;  1FOK A;  1XSV A;  2ZC2 A;  2VXD A;  1O57 A;  1SD7 A;  1P2F A;  4FET A;  2BZT A;  2PFB A;  2CW0 F;  4BL0 B;  1W7P A;  2LF8 A;  2DMP A;  3BG7 A;  1SAN A;  5K5Q A;  4HX4 A;  2HVS A;  5GAG J;  1ZQ3 P;  2XV4 S;  2KZG A;  4LG0 A;  2Q0O A;  2AQE A;  4BS9 A;  3JRF A;  3HGG A;  4L9V A;  2PN6 A;  1Y56 A;  1KA8 A;  2K9S A;  2O9L A;  2OCC H;  4C9Y A;  4CYC A;  2KDZ A;  2A68 F;  5HLG A;  4DGW B;  3JRA A;  1BOA A;  4NQW A;  3HL2 A;  4LG0 B;  2ELK A;  2LMD A;  3IH3 A;  4IXA A;  2CV2 A;  2CUJ A;  1IDY A;  4QTR A;  2WAQ N;  5HLT A;  1EH8 A;  3FXK A;  2C6Y A;  3TO6 A;  1TLH B;  4CYC B;  2JJ7 A;  3RZD J;  2BBY A;  3L09 A;  4AC0 A;  4BQA A;  4C30 A;  1LQ1 A;  4FQG A;  1SAX A;  4IJA A;  5IT9 K;  4BE0 A;  2K4J A;  2OQR A;  4QWQ A;  2XAJ A;  2DA4 A;  1NK2 P;  3NEU A;  2EZI A;  1OCR H;  1SC7 A;  3OS2 A;  3D5L A;  3WG7 H;  1KQ8 A;  3Q0U A;  1SD5 A;  2JT1 A;  4CH7 A;  4D7N A;  3G1L A;  3JRB A;  5GTI C;  5L3E A;  4XM3 A;  1HW2 A;  4MGR A;  3J80 K;  2Z16 A;  3P5J A;  4Q4Z F;  2F5E A;  3I4M J;  3OYF A;  4I2O A;  3ZQH A;  2K27 A;  2W4S A;  1XN7 A;  1R36 A;  2FSW A;  3JTG A;  4R79 A;  4BHC A;  2RNJ A;  1I6X A;  1R1V A;  2MLG A;  2QSH X;  2O61 A;  4XL9 A;  4KIT B;  1UZC A;  2HTS A;  4HF0 A;  4XNF A;  3VYU B;  1XPX A;  5KNL A;  2KFD A;  4KIC A;  3A0H C;  3P9C A;  1EV7 A;  2QKM B;  1X1D A;  1NK3 P;  2R7S A;  2RKH A;  4B44 A;  3GYH X;  4XKW A;  4XN0 A;  2P7V B;  1XGM A;  2IGN A;  3CJN A;  5JLW A;  1I3Q J;  3H5R A;  4BE2 A;  4AM3 A;  3CME I;  1ZAR A;  3F6O A;  3G71 I;  2X1E A;  3AKZ A;  4S05 A;  2RRE A;  2ZSH B;  1VZ0 A;  4S04 A;  2FUG 2;  3BG5 A;  4B8X A;  1X3W B;  3UKG A;  1VQ8 I;  2OAZ A;  1WCM J;  3BY6 A;  2I8D A;  1IGN A;  3GO5 A;  5IT3 A;  2PQ8 A;  2F4O B;  3GFL A;  5HLI A;  1SEU A;  4N9H A;  3LL7 A;  4M9S A;  1E2X A;  5J3L A;  3VOD A;  2BV6 A;  2WY8 Q;  5E3N A;  2Y9Y A;  5DD8 A;  3ZMT A;  1XMX A;  4BQQ A;  4PCQ A;  3MKY B;  2FU4 A;  4IHS A;  4CIC A;  1IRZ A;  4JYK A;  5EYR A;  3C7J A;  1G6N A;  4HEA 2;  5C4J J;  2O5R A;  4A6E A;  3LA3 A;  3ZN1 A;  3S16 J;  2CQQ A;  3HXL A;  3DEW A;  2QQA A;  1A6Q A;  4YEJ A;  1YQA A;  2FML A;  2ZXH A;  3TDU C;  2QF7 A;  1MSE C;  3S1Q J;  1V5G A;  1I6H J;  2Z99 A;  2HEO A;  1ZLJ A;  2CJJ A;  1Z6R A;  2A6H F;  2LH9 A;  4N4N B;  2KIF A;  5L3G A;  1EF4 A;  2P4W A;  4G7H F;  3V7C A;  3K1N A;  2L02 A;  2NOJ B;  2X1D A;  2XKO A;  5E3M A;  3S3O A;  5JFR A;  1K4T A;  3E5U A;  2K5C A;  2XRL A;  1X2N A;  2LR8 A;  3HC7 A;  2Y30 A;  2VKE A;  1WFX A;  2L01 A;  2JA5 J;  1MGT A;  1XG1 A;  2K9Q A;  1G8X A;  1WKM A;  5D8K B;  4OIR F;  1Y8R B;  3F6V A;  1KQ0 A;  2VQH A;  1V4R A;  3N4M A;  4GO1 A;  1S3J A;  3G1O A;  4C3J J;  4ESB A;  2GAU A;  3BR2 A;  1ETO A;  3WGI A;  2WC2 A;  2QQ9 A;  4YRV A;  2CV0 A;  4KN7 X;  1H8A C;  4XIC A;  2W7N A;  2Y0M A;  4Y3O A;  1TWF J;  3DXJ F;  4PUS A;  3H3U A;  3CDL A;  3HRS A;  4YII A;  4YFN F;  2DMQ A;  4XID A;  4HW0 A;  2CUE A;  2P8T A;  4F91 B;  1P4W A;  3CJQ B;  4IVN A;  2PBI A;  3DLA A;  2PEX A;  2QEX I;  1JGG A;  4XQF A;  4ANJ A;  2DJN A;  2F5V A;  5HDG A;  1R58 A;  1Z05 A;  3L2U A;  1HXD A;  3I64 A;  2K4B A;  4EGY A;  4DIQ A;  1VQN I;  1FY7 A;  5D6E A;  1O3Q A;  4BEH A;  1ZR4 A;  3V8L A;  1EH6 A;  3VFZ A;  4KYW A;  2VB6 A;  4O5V A;  4A0Z A;  3HOV J;  2XHK A;  4LLN A;  4GCV A;  2D2W A;  3QAH A;  3IP4 B;  2HKX A;  1STZ A;  1RIO H;  2E2I J;  1U5T C;  2E19 A;  3JSP A;  2V9V A;  2Z3Y A;  2OF7 A;  1V5F A;  2V4J C;  4DW6 A;  2VKH A;  3FXM A;  4BEH B;  5J4V A;  4E7I A;  1OPC A;  5EDN A;  1Z0X A;  1UJ8 A;  1DU6 A;  1FSH A;  4BBR J;  2W00 A;  2E60 A;  3Q9V A;  2LVS A;  4BHP A;  1Z7U A;  2KIS A;  1T0F C;  3FXO A;  4G6D A;  2VBY A;  2L7Z A;  2UXX A;  3HGY A;  1VF9 A;  1ZLK A;  1ETV A;  1KU9 A;  1TL8 A;  3JCU C;  3I9V 2;  2JA7 J;  1S7O A;  3FM3 A;  4RMN A;  4BJT A;  4HPQ A;  3TW7 A;  1OKR A;  2E2H J;  2OZU A;  3Q3S A;  2DTR A;  1WH7 A;  1WI9 A;  1L3L A;  1B4A A;  2DN0 A;  3DKX A;  4CSW A;  1X1A A;  1P7I A;  2H8W A;  4G7Z F;  3E5X A;  3S1M J;  4M72 A;  3I59 A;  3PFY A;  2E1C A;  3DKY A;  2ME0 A;  4BAY A;  5B1A H;  1R5I D;  5B5E C;  3M8J A;  1ZGJ A;  3FK7 A;  4RB2 C;  4Z6Y A;  3JRD A;  1J5Y A;  4OAZ A;  2DA2 A;  1ZN2 A;  3BZK A;  4LIV A;  2PMH A;  3DV8 A;  1HSJ A;  4ESF A;  1JJ8 C;  3I4N J;  2FBI A;  3PFI A;  3GXO A;  1DPU A;  1WJA A;  4J01 A;  2F4M B;  4XSX F;  1RES A;  4HQM A;  4KT5 C;  4JX5 A;  1YRN A;  2GIV A;  5FFZ A;  5CJ9 A;  1DPR A;  1QZY A;  1FC3 A;  3ESW B;  1POG A;  3AG1 H;  3FXU A;  3EUH C;  1AA7 A;  3U9G A;  4QPO A;  4YIR X;  3S1R J;  2QBY B;  4CCO A;  3NWS A;  3PIP F;  1OCC H;  1ONV A;  3WTX C;  3HHG A;  1I50 J;  2DAO A;  3KE2 A;  1KU2 A;  5F0F A;  2CUZ A;  3VPR A;  2LKX A;  1D5Y A;  1CF7 A;  3N05 A;  1Z9C A;  3EDP A;  4M6Y A;  1BJA A;  1ZEL A;  3F9K A;  4A3I J;  1GLN A;  3AG4 H;  3R61 A;  3BOQ A;  3G6E I;  3J7A Y;  1LDK B;  3BTC A;  5FKO A;  3V4G A;  5FGM A;  4QPQ A;  1UHM A;  1U6G A;  4BY1 J;  3KX2 A;  2MC4 A;  2YR2 A;  3QPS A;  3CCJ I;  2DMN A;  2NS7 A;  2VJ5 A;  4LFU A;  3B73 A;  4C2M J;  2KRC A;  1I1S A;  4E7K A;  2OA4 A;  1JKQ C;  2M3A A;  4F55 A;  4AVP A;  1MJA A;  3HTS B;  4PFP A;  1YX5 A;  1RNL A;  3H5N A;  4F92 B;  4PGG A;  2OPT A;  3RQ4 A;  1FOY A;  1FYL A;  3S32 A;  1I5Z A;  3OYA A;  4KIF A;  1J59 A;  4A0Y A;  4UUV A;  3JR9 A;  3CTA A;  5FLX Z;  5GP9 A;  2G7U A;  5L3D A;  1HKQ A;  3FHZ A;  4A12 A;  2IS4 A;  3JRE A;  3B6C A;  2FXA A;  1LPQ A;  2A6E F;  2F2E A;  2ISZ A;  3S2D J;  2ZFU A;  2RQQ A;  2H8R A;  1D0X A;  4HNT A;  2R5Y A;  4U7D A;  1AHD P;  1R22 A;  2O3F A;  2ESN A;  1IDZ A;  3BT9 A;  5A2Q K;  2VPL A;  4ZDO A;  1IF1 A;  2VT3 A;  2NS0 A;  2DOE A;  3WGH A;  2LY9 A;  1R5G A;  1AKH A;  4E7H A;  2HVQ A;  2H6B A;  2BVM A;  5TGT A;  1AOY A;  2L7K A;  3CES A;  3MFK A;  3Q9S A;  1HKT A;  1FBS A;  1Y1W J;  3MWM A;  1VFC A;  4IEJ A;  1AKH B;  2CUF A;  1F4K A;  3L2W A;  4BUP A;  1S72 I;  1USS A;  2Z1D A;  4HF1 A;  4KA4 A;  3PL8 A;  2O03 A;  1OCP A;  2M5W A;  3OYI A;  1YE9 A;  1G59 A;  2VJI A;  2QZ8 A;  3SFI A;  2ZNY A;  3L00 A;  2V6C A;  1ULY A;  3ZMU A;  4RGU A;  3SEZ A;  3K1M A;  1LFU P;  3LSI A;  2R3S A;  3KPH A;  1X1P A;  1LNW A;  4LD5 A;  3KP3 A;  3L9F A;  3I58 A;  1I27 A;  1OYW A;  3RKX A;  2XF5 A;  3PJR A;  3MAJ A;  5ICG A;  3H35 A;  4GRI A;  4F93 B;  3S93 A;  1NH3 A;  4UV8 A;  2L9R A;  1CGP A;  1GDT A;  5HS8 A;  2O6G E;  3FIS A;  1MBH A;  1T6S A;  3FM5 A;  2A07 F;  2D1V A;  1R00 A;  2FX0 A;  4CCM A;  5LHG A;  5DDG A;  2OU2 A;  2LFB A;  1WVR A;  2CQN A;  4JK1 X;  1TP4 A;  5FD5 A;  5E3O A;  3L2V A;  1TNT A;  2DA6 A;  3LAP A;  4D7M A;  2R93 J;  3HRU A;  3KZZ A;  2CQK A;  3HOW J;  1I3A A;  1A31 A;  4MQV A;  1BJZ A;  2I10 A;  3UR3 C;  1X4P A;  4A93 J;  2PMZ A;  2L4A A;  2HU9 A;  2E5Z A;  1ZH5 A;  1GVJ A;  3C1D A;  1LEB A;  3BZ6 A;  4HBL A;  5E79 C;  1W4M A;  1TWG J;  2DYR H;  3T1B A;  1CQT A;  4HLX A;  4A5M A;  2A3S A;  1FBQ A;  3AFH A;  1RPW A;  3BG6 A;  4XLH A;  5FRO A;  3OS1 A;  4UNO A;  1W5C C;  1TTY A;  3DTI A;  3WOD F;  3NAR A;  1N77 A;  4I01 A;  1MMD A;  4MEY F;  2MH9 A;  4AID A;  3F8B A;  2V1D A;  4G8X A;  3OYD A;  4KIS A;  2GXG A;  2XRO A;  1VI0 A;  1Z6T A;  4XRF A;  1GXP A;  2ZXI A;  5IOZ A;  3BLY A;  2XSJ C;  5KCM A;  3P9K A;  2O0Y A;  1BBY A;  1B6A A;  4ZTF A;  4E7L A;  3ONQ A;  2H27 A;  2VBX A;  1QPM A;  4XLN F;  2ZFW A;  2Z5U A;  4P9F A;  4IZZ A;  3K4K A;  1D8K A;  2WAE A;  4WXC A;  4HF2 A;  3DCF A;  4B48 A;  4UY8 I;  3G3Z A;  2E1M C;  2E2J J;  3F8M A;  2QCO A;  1MH4 A;  4RDU A;  2XF7 A;  2XKP A;  1VQ5 I;  4BDZ A;  1HOM A;  2XAS A;  2L0K A;  4RAY A;  3SZT A;  1TQP A;  2QUF A;  1OQY A;  2Y69 H;  3ABT A;  3KET A;  3A01 A;  3ECO A;  1OLT A;  1VQ7 I;  3M7G A;  1TQI A;  2M7A A;  3OIQ A;  4KT6 A;  4ZDP A;  2VT2 A;  4XRM A;  2YUS A;  4EAT A;  1O4X A;  5EZG A;  2EZL A;  1YO5 C;  5ED4 A;  3KLO A;  5CVV A;  3DTK A;  1SAU A;  3WTY C;  1QZE A;  4OWR B;  3M8E A;  3HTU A;  3OWT A;  3FMQ A;  2K85 A;  1W1W E;  2QKL B;  2FMY A;  1MMS A;  2VE8 A;  2LTP A;  4EEF G;  1GUU A;  1IN8 A;  3DU6 A;  4OIO F;  2STW A;  4ENN A;  1T39 A;  2P0W A;  2Z9O A;  4HQE A;  1ETY A;  3PSI A;  3PSF A;  3HDD A;  1S29 A;  5H6Q A;  3K4B A;  3K4M A;  4IL6 C;  5LEJ A;  2LBF A;  3PNV A;  3IV5 A;  3I56 I;  4IO9 F;  2V26 A;  3I71 A;  2XSD C;  1YJW I;  1WJE A;  4ASN A;  2JK3 A;  3LSP A;  4G9Y A;  1T56 A;  2X6O A;  3HJE A;  5HS7 A;  1W0T A;  2IBD A;  1IAW A;  2KZV A;  3DF8 A;  2A5W A;  2F6C A;  4CUG A;  1E3O C;  1DU0 A;  2M4K A;  4NC6 A;  2HOS A;  1MNM C;  1W5S A;  4L9T A;  2TDX A;  2CFX A;  2P81 A;  1JUP A;  4L9N A;  4PZJ A;  4XOT A;  4UB6 C;  4UXN A;  2EH3 A;  4YFX F;  3MZY A;  2X1C A;  5M5Y J;  5A2Q Z;  4XKC A;  2DYS H;  3BJA A;  3PO2 J;  3ECH A;  1SMY F;  3GTK J;  1XX5 A;  3DBR B;  2E34 A;  1U78 A;  2EK5 A;  3GTM J;  1RI7 A;  2EV0 A;  2ZJQ F;  2HDD A;  5J6X A;  2IP2 A;  1D3Y A;  3T8T A;  2WB1 N;  2X48 A;  1BI3 A;  2HPM A;  2CYY A;  1K83 J;  1ZKG A;  3J81 Z;  1G4D A;  5HOD A;  4WXD A;  2KQR A;  3LWF A;  1MZB A;  2LY1 A;  3OS0 A;  3J7Y J;  1YFH A;  1PP7 U;  3QP6 A;  3BG9 A;  3QPH A;  3LSR A;  4DJA A;  4IHY A;  1OJL A;  2DA3 A;  2KHM A;  4G7O F;  1FWZ A;  1IXR C;  4I02 A;  1VQO I;  2ELH A;  2QGU A;  2VOP A;  1TQM A;  3CLO A;  2GWR A;  4XRS A;  3L1P A;  1JJ6 C;  3F3X A;  3FDY A;  5E8I A;  4V2F A;  5LBQ A;  2R4G A;  2HQN A;  1IZ1 A;  3MCZ A;  4AUX A;  3AL0 B;  3Q0V A;  4W97 A;  2W24 A;  5E3L A;  4UHT A;  1O3S A;  1SMT A;  3SDG A;  4F7Z A;  4TV7 A;  3OYE A;  1E0E A;  4M3D A;  2KJC A;  2OJE D;  2PMZ N;  1LVK A;  3CLQ A;  3KP6 A;  4HA8 A;  1BC7 C;  3ROU A;  1MMG A;  2UUZ A;  3GUD A;  4G94 A;  2BXY A;  1FLI A;  3CF2 A;  1IN6 A;  2M0C A;  4HV5 A;  2VN2 A;  4IHV A;  3HUG A;  4UVC A;  3WHC A;  3HSE A;  3I54 A;  1ZTR A;  1QVU A;  1XDU A;  4CYD A;  1ZGW A;  2HQA A;  2DCE A;  3CD6 I;  4N4O B;  1O7L A;  1BR4 A;  3C3W A;  3HUG B;  1ZRD A;  3OYH A;  2D5V A;  4P9U A;  4PSW A;  2IXS A;  2KMU A;  4OMZ A;  3RKY A;  1JE8 A;  2G7H A;  3SZP A;  4PJN A;  1D1A A;  2L9V A;  1OR7 C;  4BH9 A;  3H3V K;  2IPQ X;  4OAY A;  3SYT A;  4E4H A;  3EYI A;  2MFZ A;  4ZDL A;  4ZZD A;  3GLL A;  4II2 A;  2EIJ H;  1D0Z A;  3HPG A;  4G6T B;  2YX7 A;  1GV5 A;  1OMI A;  3DKW A;  2MAB A;  2VI6 A;  4KIG A;  1Z7L A;  4U0W A;  1BIB A;  3QOD A;  3DP7 A;  4RAG A;  1S7E A;  3U21 A;  1X58 A;  3TO7 A;  3ZGK A;  4GYI A;  4BJ6 C;  1FZP B;  2X9D A;  3DEU A;  2GQQ A;  3Q5F A;  1U8R A;  5ILV A;  2DFH A;  1B59 A;  4HSR A;  1ZG5 A;  2RN7 A;  4CDG A;  4YFK F;  3TED A;  2OUM A;  2PLY A;  1XDS A;  3NRV A;  4MHG A;  2JTV A;  4AD9 A;  4E70 A;  4YEL A;  1S8N A;  2ZBK A;  5HNF A;  1JGS A;  2YSR A;  5DYM A;  4ENJ A;  4HAM A;  5D5U B;  3CCM I;  2VPR A;  2OZ6 A;  5EEH A;  4A0X A;  3ASO H;  2A61 A;  1D5V A;  1P6R A;  1X1B A;  5BS6 A;  3BTL A;  3KEY A;  5DTD A;  3KYC B;  3BTJ A;  3IL2 A;  2Y2Z A;  1SFO J;  1GV2 A;  1ORK A;  2BY2 A;  3DQV C;  2V1X A;  2GOM A;  2CRG A;  2TRT A;  2X6W A;  3FMR A;  4M3B A;  1PUE E;  2ZME B;  5D5V B;  2ISY A;  3PUB A;  2EZK A;  5F1R A;  2CG4 A;  2E36 A;  4GYG A;  4D0P A;  3RI4 A;  2BY0 A;  4L5J A;  1X2M A;  5CLS A;  4A6D A;  4EJV A;  4QIW N;  3DLL F;  2M34 A;  3IH2 A;  4IRG A;  3ZQL A;  1MH3 A;  4RLQ A;  4BHB A;  1EJ9 A;  1R4N B;  5E1Z B;  1A04 A;  5E20 A;  4H0E A;  3TO9 A;  3RYR A;  1W36 D;  4IHW A;  4D9J A;  4ESJ A;  1HBX G;  4BXF A;  2ZJR F;  3CCU I;  4HST A;  4XOP A;  4MFD A;  1TZL A;  1MJB A;  2BVL A;  3C2G A;  3SEQ A;  4A2U A;  4KJZ A;  4UUT A;  4A3E J;  3BJO A;  3TKY A;  1TT5 B;  3WG9 A;  1DGR M;  2DFI A;  4MTE A;  2VKV A;  5M3M J;  5FB2 A;  1WJC A;  5DV5 A;  2H94 A;  2DQR A;  3GFM A;  4PGH A;  1VQP I;  4IX7 A;  1D1B A;  3HKZ A;  4PJL A;  4MTD A;  2AXL A;  1J09 A;  3BTI A;  1NG7 A;  3WU2 C;  5DUK A;  1GT0 C;  2OCE A;  1V5E A;  4Q47 A;  3ELK A;  4DZJ A;  2ZXJ A;  5DUI A;  5F0C A;  2BEO A;  4P55 A;  1TC3 C;  1D8J A;  4RM2 A;  5B66 C;  1WJD A;  3TOA A;  4I0A A;  1JHF A;  4FT8 A;  3V8K A;  3H92 A;  3ZMD A;  1MBF A;  4UV9 A;  2ZJP F;  4BBS J;  5F1J A;  3HRM A;  1B8I B;  3CCQ I;  2GZW A;  4IRI A;  1HDD C;  2M1B A;  5FLV A;  5J1U A;  1FOW A;  2K02 A;  5F08 A;  2BW3 B;  5ICF A;  4GFB A;  4M9X A;  1ON1 A;  3IWZ A;  3FIW A;  4F3Q A;  3BR0 A;  3IKV A;  1VND A;  2UXN A;  4LB5 A;  1APL C;  5BMZ A;  1Z67 A;  3M1C A;  4RGX A;  2DDA A;  3E7L A;  2GM4 A;  2EPF A;  2CW8 A;  1P4X A;  1RUO A;  3MEX A;  1FOX A;  3H0G J;  2IRF G;  1FP2 A;  4B3X A;  2JQ7 A;  2M9H A;  4UVB A;  1UEL B;  5FKK A;  5FD6 A;  3IAS 2;  3JW4 A;  2EFP A;  1J2X A;  3GTQ J;  3BRO A;  4RAF A;  5FKM A;  5L3F A;  3ERM A;  1IRG A;  3D5R C;  1W36 C;  2HNH A;  2VQC A;  4Y7N J;  5DCM B;  2IAI A;  3CQZ J;  3OMY A;  1BN5 A;  1LB2 A;  3RTR A;  3F8F A;  1QHG A;  5D4R A;  1B1B A;  2OTL I;  3HRT A;  3I55 I;  3LSK A;  3HOU J;  3OOP A;  3MD2 A;  2FOK A;  3UNG C;  3RKQ A;  4BXX J;  3KFW X;  2QA4 I;  4I7H A;  2XB0 X;  3E1S A;  5IT9 Z;  1FYM A;  2X4H A;  4XOR A;  3CC2 I;  4A5N A;  1G3T A;  5F27 A;  2CFO A;  3GZN B;  1H9T A;  3KP7 A;  4DZP A;  1IRX A;  1Z77 A;  4I6Z A;  1EA3 A;  1T38 A;  1F1Z A;  4LJZ F;  4U88 A;  1YIO A;  2J5O A;  1H0M A;  1BA5 A;  2F4I A;  2RNG A;  2MBF A;  2VAS A;  2W82 A;  1IN5 A;  5C3E J;  1MBK A;  5EZH A;  3LA2 A;  4JBA A;  3CUQ A;  4ABZ A;  4D5F A;  5KK1 A;  2MLK A;  5DM7 F;  5K5R A;  1B9M A;  2QBY A;  4C2T A;  2GOX B;  4I76 A;  1D1C A;  3J80 Z;  2FD5 A;  2NVU B;  1IUY A;  4L5E A;  2K3P A;  4M6X A;  4XR6 A;  2DOF A;  3PQJ A;  5DS9 A;  4CCK A;  2PX9 A;  4EJT A;  2MSY A;  3H5A A;  4B4C A;  3CUQ B;  1LUJ B;  3CP8 A;  3CMY A;  1O7F A;  2GXB A;  4XK4 A;  3PM1 A;  2YU3 A;  1R49 A;  4XMY A;  4AU7 A;  3WTU C;  3ZRG A;  3IRQ A;  1R9T J;  1XB4 A;  2R0Q C;  3JTH A;  4PFO A;  5TRD A;  2P5L C;  2CGP A;  3JRI A;  2NVT J;  4BU2 A;  1DP7 P;  1XSD A;  3FXL A;  4DYQ A;  2L3D A;  1B72 A;  2VC0 A;  3CCS I;  2KL4 A;  2UV1 A;  2IJL A;  4WXH A;  4AIK A;  2M2E A;  2Y0S A;  2DI3 A;  1FSE A;  5ICC A;  4Q5S F;  2ECB A;  2FRH A;  1XGO A;  1B72 B;  3BR3 A;  4LGW A;  1J7K A;  1JT0 A;  2EFO A;  3ZOB A;  1IJW C;  2Z2S B;  3R0A A;  4HOB A;  1ERD A;  5KHD A;  1QVT A;  1RZ4 A;  1KON A;  5L3B A;  2LRD A;  3W6K B;  4JX6 A;  3I5U A;  1ZRE A;  5K7Z A;  3O2P E;  1UG2 A;  4BNC A;  3QPT A;  1R5H A;  2L9S A;  4MFE A;  5FRN A;  1ZAO A;  1S9H A;  3GTP J;  4Y15 A;  1P92 A;  4OIP F;  3ZQQ A;  2VL8 A;  1Z21 A;  2MC3 A;  1IC8 A;  3HKZ N;  1OCZ H;  5B3S H;  1HKS A;  5ILS A;  1MDM B;  5EG0 B;  1JKR C;  1OYI A;  3TMO A;  1MNE A;  4BKX A;  2WTE A;  2IS6 A;  4JP0 A;  4G12 A;  5CVR A;  3GFI A;  1VQK I;  3WTT C;  3GTJ J;  3LSH A;  3JAM K;  5AIP A;  5BQT A;  3R60 A;  2D1H A;  2R7T A;  4V2G A;  4IF4 A;  1ZR2 A;  3EUA A;  3QU6 A;  2AQF A;  1MBJ A;  4LLG F;  1UST A;  3HG9 A;  3SDB A;  4RB3 C;  4OIN F;  2LKS A;  4DNC A;  4MO7 A;  3CJR B;  2R7W A;  2AS5 F;  4KFC A;  3H9G A;  4RBO A;  3N97 A;  2M8E A;  4IOC F;  1V55 H;  1TNS A;  2JVH A;  1QU3 A;  2Q8K A;  4AWX B;  2QWW A;  5DM6 F;  4BXU A;  3K70 D;  2HYJ A;  1FYK A;  1K6Y A;  3DBH B;  3A02 A;  5JHU A;  2VJJ A;  3DU5 A;  4CCJ A;  2H1K A;  5J8C A;  2HZD A;  4ZJZ A;  2EWN A;  3K0L A;  4MNU A;  1F36 A;  4A3D J;  1HQC A;  3GFJ A;  2XC7 A;  2B9S A;  5IY5 H;  4DBR A;  4HDU A;  2PJP A;  4BJ5 C;  2FNA A;  3BCB A;  1BI1 A;  3LFU A;  1I1G A;  2BE5 F;  2HQR A;  4A69 C;  2AHQ A;  5FJ8 J;  1JT6 A;  3OYG A;  3D1N I;  2A05 A;  2DFE A;  3GEZ A;  3K4J A;  4A3M J;  3ML6 A;  5J1Y A;  3IUO A;  3RDI A;  2STT A;  1R1U A;  1Z91 A;  2W85 A;  1JKO C;  1R7J A;  1WI3 A;  3B02 A;  5ERI A;  2ZNZ A;  1BIA A;  3GTG J;  3KEO A;  3GTL J;  3E6B A;  2HQ5 A;  1YI2 I;  1UMQ A;  4L5I A;  1MIJ A;  1N75 A;  1RR7 A;  1VQL I;  1ODD A;  3KYD B;  2BGC A;  4PJM A;  5D5W B;  3BQY A;  2CQX A;  2ELJ A;  2ACJ A;  2R7V A;  4IQ4 A;  1U3E M;  3O8G A;  3HZJ A;  1VQM I;  1ZRF A;  2R5Z B;  2Q1Z B;  2E1N A;  4EM2 A;  2WA0 A;  1LDD A;  4R8H A;  2W57 A;  4I09 A;  4PDK A;  5CYV A;  2XAG A;  1SFU A;  3HIF A;  3GZ6 A;  2M87 A;  2QM3 A;  4DBQ A;  2W84 A;  2L5Q A;  3GLX A;  1IV8 A;  4NUB A;  3TBI A;  1DUX C;  1OCO H;  3K6G A;  1HLV A;  2FE3 A;  2MG4 A;  4CHU A;  3GF2 A;  2XAU A;  5LD2 C;  1LFP A;  3ERE D;  2E5N A;  2WV0 A;  1D0Y A;  3LQQ A;  4RB0 A;  3U1K A;  4BAC A;  2N8G A;  4CGZ A;  3FXR A;  2H6C A;  1PDN C;  1E3P A;  2KPM A;  3S1N J;  3D5S C;  2HR3 A;  2KRF A;  5LRS A;  4LMY A;  1TW3 A;  3OV8 A;  5GAD J;  2XGX A;  4JQF A;  4CCL A;  1ETX A;  3OL3 A;  1UHS A;  5IP6 A;  2PI0 A;  2K86 A;  3BR5 A;  4B43 A;  1KQ9 A;  3CO6 C;  2JUG A;  2JN6 A;  3VEP A;  3QYB A;  1T33 A;  3V7R A;  2L4M A;  4RGR A;  2QQ8 A;  1MJ9 A;  2GA2 A;  1FTT A;  1W5T A;  3GZ5 A;  3ABU A;  2I5U A;  3FF5 A;  3AAF A;  2WAQ A;  4XLP F;  3BJ6 A;  4EJU A;  3KYL A;  2NRA C;  1JUS A;  3M1E A;  3JRH A;  5AIQ A;  4NDL A;  2GXA A;  1UCR A;  3ZMS A;  4U0Y A;  4FIS A;  1Q1H A;  5E1X A;  2Y9Z A;  3BWG A;  1U5T B;  3RYP A;  1ZK8 A;  1T0F A;  2F5F A;  5K5O A;  2XAQ A;  2XIG A;  3BDD A;  1Z3X A;  4LK1 F;  2FQ4 A;  4E6K G;  2Y31 A;  2QVO A;  5BNG A;  5ICE A;  2GBY A;  2JRM A;  3LSG A;  3SZG A;  1AWC A;  2NXN B;  2KT0 A;  1TBX A;  2HPI A;  2HDW A;  2DW4 A;  2DPD A;  3CMM A;  4L18 B;  2V79 A;  3TOB A;  4BQN A;  3IKT A;  1IO2 A;  2COB A;  2NYX A;  4OMY A;  4K2E A;  3HOT A;  4DYR A;  1G3Y A;  1SFE A;  2FJ1 A;  1FNN A;  1R1T A;  1YLF A;  1QNT A;  2FBH A;  4U87 A;  1WJ5 A;  2E71 A;  1WHU A;  1XCB A;  2ZKZ A;  5F6F A;  2XB5 A;  2PMU A;  1FIP A;  2ETH A;  4UVA A;  1YIT I;  2EZH A;  1UHW A;  3OYK A;  3LNQ A;  2LSO A;  5TJJ A;  3U1D A;  3CUO A;  2TCT A;  5IYC J;  1TWH J;  2M0M A;  2XAH A;  2W25 A;  4HRI A;  5LHI A;  4M9Z A;  3OYL A;  5M3F J;  2A69 F;  2BHY A;  2IA1 A;  4E7S A;  3M9A A;  3PUF A;  4XN3 A;  3WGG A;  3M3Y J;  3DBL B;  3ZCO A;  1K7A A;  3KP2 A;  3MVP A;  3IRR A;  3W2V A;  3S2H J;  3RZO J;  4FAS D;  1ZHF A;  2OV7 A;  1V54 H;  1YS7 A;  4C3I J;  4LOC A;  1TW2 A;  1LE8 B;  3QOE A;  1WPK A;  2L9N A;  4X1E A;  5E17 F;  2Y48 A;  5EEA A;  4E7J A;  2VE9 A;  3SQN A;  4FE4 A;  4PK4 A;  2DMU A;  4HDV A;  3D0S A;  3K10 A;  4EMS A;  4JOM A;  2XPW A;  1ETW A;  5H2F C;  4WWC A;  3IWF A;  4U0V A;  6PAX A;  3SFZ A;  4XLE A;  1PYV A;  4ETS A;  5CVU A;  3HOZ J;  1Y0U A;  1KYZ A;  4H4K C;  4B3A A;  2M45 A;  4AYB A;  4EM1 A;  1H9G A;  2HWV A;  1NG6 A;  2L7F P;  2KIU A;  3ZQF A;  4MLO A;  1IW7 F;  5BOX A;  3GBG A;  3H9Q A;  2FF4 A;  4FX0 A;  4XLC A;  1QRY A;  2Y75 A;  5TIS C;  3DTE A;  1GHC A;  1ETK A;  3W2W A;  4NHJ A;  3BR6 A;  5E18 F;  2XGD A;  2JA6 J;  2ADU A;  3E3V A;  4WCG A;  4M3E A;  5J47 A;  1BW5 A;  1P9Q C;  1LFB A;  5K7H A;  1HCR A;  2PJR B;  4RGS A;  2EV5 A;  3QPL A;  3OY9 A;  5D8L B;  4QLC U;  3KLN A;  5EF6 A;  2IS1 A;  3ZPL A;  1YJ9 I;  4DYC A;  1Y39 A;  3DPU A;  1RR8 C;  2UWM A;  3ULQ B;  3R0J A;  4MEX F;  4R1H A;  2WAF A;  2ZXW H;  4A3L J;  1ZYR F;  4GXO A;  2NNY A;  2IA2 A;  4A3F J;  2V1N A;  1ON2 A;  1LKX A;  3K9T A;  2CWE A;  2IT0 A;  3S3N A;  1QZZ A;  3O6B B;  1IXS B;  2HI3 A;  4I99 C;  2RAE A;  1WRJ A;  1FMV A;  3Q0W A;  3BQZ A;  4M3F A;  4ZC3 A;  4PJ0 C;  5EEG A;  3ABL H;  2ESH A;  2EFN A;  2HGC A;  1GVD A;  2DLL A;  4Y52 J;  3I53 A;  2R7R A;  3DPL C;  2VBZ A;  2O8X A;  3KZI C;  2DMT A;  3QWL A;  3RKW A;  1WZ2 A;  1ITY A;  3RPU A;  2IGM A;  1MSF C;  2EFW A;  3PQK A;  4ZTJ A;  3LOC A;  5HLH A;  3A03 A;  2ID6 A;  1W7P B;  3EQL F;  2NVY J;  3RIR A;  3T5X A;  4HNV A;  4LLL A;  3HBL A;  5CKT A;  3A4C A;  2O7O A;  4BQO A;  4UB8 C;  3BPX A;  1IUF A;  1N25 A;  5HVQ C;  4EJW A;  1FTZ A;  2WBM A;  2V9P A;  3KIO A;  2HYF A;  3WE3 A;  5CPR B;  4N9I A;  2DO7 A;  3CP2 A;  4OU0 A;  2M7B A;  4NQW B;  3OYJ A;  1H88 C;  1J9I A;  2CW7 A;  2R7D A;  3O8H A;  2V9K A;  4BE1 A;  4A3B J;  2IVM A;  3OYB A;  2IA0 A;  5FO5 A;  4E7Z A;  3GME A;  2MYS A;  3TDZ C;  1FJL A;  3M4O J;  2R7Q A;  1RKT A;  4DOZ A;  2YPR A;  5JI6 A;  5CVJ A;  3GCM A;  3LFK A;  2DK5 A;  4M73 A;  1BM9 A;  3CC4 I;  4IRH A;  2LDU A;  4KN4 X;  3S8P A;  1Z1D A;  1PJR A;  3H36 A;  3FBN B;  3VSL A;  3SHF A;  1BI0 A;  1RRJ A;  1XSX A;  1JHH A;  3DEE A;  2BYV E;  3QU3 A;  4S0H B;  2HS5 A;  3MN2 A;  2MGQ A;  1MKM A;  1YS6 A;  3T8R A;  3VYS B;  5GAE J;  5M5W J;  1U8B A;  3CF5 F;  2R7O A;  1SVM A;  4AIJ A;  1T2K A;  4I98 B;  5LFA A;  2P5K A;  2RV8 A;  3VYR B;  2JA2 A;  2ZME A;  1J0R A;  4FCY A;  1LDJ A;  3RJP A;  5EJC A;  3K4L A;  1HA8 A;  1PVE A;  2ECC A;  2LNB A;  4EJO A;  1DDN A;  1SD4 A;  4IPA A;  3KCC A;  2XVC A;  1IN7 A;  5IOY A;  2DT7 B;  2BY3 A;  3IAM 2;  4QSH A;  2VOO A;  1O3T A;  2L7M P;  1FX7 A;  1QO0 D;  2K7L A;  3PIO F;  2JWT A;  1FMW A;  4CZZ A;  4GDF A;  3MKW B;  2FQ3 A;  4RB1 A;  3KEQ A;  4XRS G;  1N78 A;  3LQR A;  3ZMV A;  4MIM A;  2HKO A;  2V7F A;  1VTN C;  1W0U A;  3DWL E;  3CZ6 A;  2B63 J;  5E1W A;  1FBU A;  3CC7 I;  2OTJ I;  5LGT A;  5JVG F;  5K7F A;  1M1E B;  1TWA J;  2JUC A;  2EA2 A;  1Q1V A;  3BCA A;  4X6A J;  1U2W A;  2JPB A;  4PSX A;  1JI8 A;  3GTO J;  2X6Y A;  2XGC A;  4M74 A;  2R7U A;  1R6R A;  3VDX A;  5C44 J;  4AYB N;  2ICW G;  2K9L A;  3IH4 A;  3QRF F;  2MD5 A;  4PJJ A;  1XGN A;  3FX3 A;  1XGS A;  3I0T A;  3WTZ A;  3OYM A;  3L7W A;  1IV6 A;  3TP0 A;  3KP5 A;  5LRR A;  2FBK A;  3E0J B;  4AVZ A;  2JZY A;  5H20 A;  2KDO A;  2B0L A;  5FLX K;  1R23 A;  4RAZ A;  4IOA F;  2RC4 A;  3GWZ A;  1GXQ A;  3A0B C;  3L2R A;  2E1M B;  5IYD J;  1DGW Y;  1T98 A;  2ZCW A;  3CCY A;  4FX4 A;  4CO8 A;  5BPI A;  1YTY A;  3FBI B;  1ZG3 A;  2G9W A;  1AU7 A;  4HYE A;  1B8I A;  3PO3 J;  1ZGA A;  5J1R A;  3U2R A;  2HDC A;  3HOY J;  2DK8 A;  2ZSI B;  3L2Q A;  1X1C A;  2BW3 A;  3BZC A;  3WTS C;  2OQG A;  1P7J A;  1T8I A;  2OBP A;  4M6V A;  3VB2 A;  4XON A;  3ZXS A;  4RLF A;  3MZ8 A;  2XDV A;  4XKB A;  1BC8 C;  2LY2 A;  3F23 A;  2XRN A;  1Y6I A;  3MQ0 A;  3CCV I;  1EH7 A;  3HB9 A;  4WF2 A;  2FEZ A;  4C3H J;  2IGO A;  4FTH A;  1R71 A;  1FP1 D;  5AON A;  3FKJ A;  2CS3 A;  4BDY A;  1SFK A;  3NWT A;  4HNU A;  3ABK H;  2EFQ A;  2EJR A;  1A6I A;  3V7S A;  3F21 A;  3RSN A;  5H6R A;  4NBQ A;  2LC2 A;  3IC7 A;  4B47 A;  1WJB A;  1E17 A;  2V6E A;  3JRC A;  3WTV C;  1HDP A;  3FK6 A;  3ZQI A;  4CCN A;  5LHH A;  2F5C A;  5DCM A;  2G0E A;  4IQJ A;  4OOI A;  1JUM A;  2K9M A;  3CDI A;  3S14 J;  3TL4 X;  1PP8 F;  4W1U A;  2QSG X;  1TT0 A;  4L9J A;  3JRG A;  3MMY B;  3ABM H;  3E6C C;  4D1Q A;  4BYY A;  4CA0 A;  4WK8 F;  1QA6 A;  3H3Z A;  3EYY A;  3KP4 A;  2IGK A;  4DQ2 A;  1U9O A;  3E6M A;  2JMW A;  3VSK A;  2LG4 A;  1V3F A;  1QHH D;  4ZZL A;  2V1U A;  3F8C A;  1WWX A;  2VQL A;  3AG3 H;  3LMM A;  4EVI A;  1YJN I;  1WSU A;  2A5Y B;  4M3G A;  3P7N A;  4HZF A;  2EIM H;  4LK0 F;  3COA C;  2VOD A;  1WH5 A;  4NNJ A;  1HF0 A;  3AG2 H;  2JVG A;  5IP9 J;  1YHQ I;  5DCF A;  2DA1 A;  1RUN A;  3WHB A;  3BP8 A;  1K4S A;  3CCL I;  2YX4 A;  5KVR A;  3REO A;  4ENK A;  1MMA A;  1VQ6 I;  3OR1 C;  1F5T A;  3K2A A;  3C18 A;  2K9N A;  4G6Q A;  4HX7 A;  2DDB A;  2CSO A;  5E8G A;  3EET A;  1UFM A;  1MND A;  2K3F A;  3OSG A;  2HVR A;  3QP5 A;  2WY7 Q;  3H0D A;  3S17 J;  3ZR8 X;  2DXI A;  1X19 A;  3QYF A;  4Y4R A;  2HOT A;  3HEF A;  2KJB A;  1JKP C;  1UB9 A;  2P7C B;  3RCO A;  4B09 A;  2BOL A;  2M30 A;  3I59 B;  3TGN A;  4RA2 A;  5FLM J;  2EIL H;  2KIM A;  5JLX A;  5HOO A;  3I4P A;  5K1Y A;  2M4G A;  3R6S A;  1IN4 A;  1W7P D;  1OIS A;  2ID3 A;  3PNT A;  1Y8Q B;  3OIP A;  3WU1 B;  4EV0 A;  3RPU D;  1Z3Y A;  5GPC A;  4Y17 A;  4II3 A;  1KYW A;  2VUM J;  2LYC A;  3TW6 A;  3F72 A;  1K78 A;  2CQ7 A;  2KLO A;  1YRN B;  3S15 J;  2P6S A;  3E5Q A;  2LRE A;  1FPQ A;  5CVI A;  2VON A;  5DEQ A;  2HFH A;  2VBW A;  5ILU A;  2RQP A;  1K78 B;  3HSR A;  3LSM A;  4P5O A;  4MQ9 F;  5LGU A;  2XGE A;  3K4C A;  2EA4 A;  1MBG A;  1OR7 A;  4CZC A;  3OR2 C;  3G2B A;  1CF7 B;  3VYT B;  2H09 A;  3W3C A;  2LF7 A;  2VKD A;  4A3J J;  2YS9 A;  5CQE A;  1SVL A;  1MDM A;  2GIZ A;  4FE7 A;  5EG0 A;  4X0G A;  2F48 A;  3L2C A;  3IHU A;  5F04 A;  3HSF A;  3QYE A;  1ACI A;  2WAD A;  1OYY A;  3EPZ A;  4IHX A;  2P5V A;  5J4Y A;  1NHA A;  1Y0N A;  3G73 A;  4RM3 A;  3VOE A;  1RET A;  1YX3 A;  2HOE A;  5FRM A;  3AL0 C;  1B9N A;  4JX4 A;  4XLF A;  3VWB A;  4KDP A;  4FHT A;  2VQG A;  1YG2 A;  4L0Y B;  2X85 A;  2DFF A;  2IS2 A;  1VQ9 I;  1S5L C;  2BY1 A;  1KU7 A;  1QQI A;  2NOG A;  1QGP A;  2XAF A;  3HPH A;  2VXZ A;  3SXY A;  1E3H A;  4AIH A;  1K6O A;  2D45 A;  2HXO A;  1ZG1 A;  1UG0 A;  4UUS A;  4A3G J;  1KU3 A;  3K69 A;  1A36 A;  3FMS A;  2AO9 A;  2QLZ A;  4KIB A;  3G4S I;  1XS9 A;  5GTH C;  3MKL A;  2M8G X;  3RQI A;  1BI2 A;  1HW1 A;  2AXT C;  4NC8 A;  3W6V A;  4UUS B;  3HM5 A;  2H1L A;  3HOS A;  1X3U A;  3W6J B;  2WWY A;  1S6L A;  1YW8 A;  2LK2 A;  5M5X J;  1WGX A;  1WQ2 A;  3FWE A;  3I3L A;  3BC8 A;  3LST A;  1KZH A;  5EGO A;  2IW5 A;  2R92 J;  3K7A J;  4ZYG A;  2R5Y B;  4YG2 F;  3V42 A;  2DJI A;  3WE2 A;  1ZRC A;  2OC6 A;  1MBE A;  4ZYD A;  3G1M A;  2QEN A;  5EGO B;  3J81 K;  3B6A A;  5FKL A;  4XLA A;  5D5X B;  1K79 A;  3E97 A;  1G2H A;  5JVT A;  1A35 A;  3V8J A;  1R4M B;  4Q48 A;  1SD6 A;  2JPC A;  5L3C A;  3ZN0 A;  2LD5 A;  1X3Z B;  4BY7 J;  4HG2 A;  3O3K A;  4EGZ A;  1LEA A;  2Q2E A;  1IXC A;  2NAZ A;  3WTW C;  3MZH A;  2E35 A;  2FA5 A;  4KMU X;  2R5Z A;  2WB1 A;  5IYB J;  4IKF A;  4L0Z B;  3CCR I;  2JRT A;  2R7X A;  2UZK A;  2Q2E B;  5JHF A;  2GA1 A;  3OYN A;  2W1O A;  2HOA A;  2KIQ A;  5HDN A;  2MA3 A;  2RDP A;  3DPT A;  3SJM A;  1IG7 A;  4IHT A;  4A3C J;  2RGV A;  5J40 A;  4XKV A;  2NVX J;  4YIF A;  3FXJ A;  3NQO A;  2NS8 A;  3GVA A;  4XBF A;  2X0L A;  1RKW A;  3RPQ A;  1UAA A;  2DA5 A;  2X51 A;  1IRF A;  4XSZ F;  4Y13 A;  3H1C A;  1XCV A;  2CU7 A;  2JSP A;  2E7W A;  3C2B A;  3NAU A;  2ZME C;  1BW6 A;  1C0W A;  4GGG A;  4NC7 A;  5D4S A;  3F8N A;  4J19 A;  1DP3 A;  1JXS A;  2XF6 A;  2KKO A;  1HW5 A;  1TWC J;  1LVA A;  2LKP A;  3FZV A;  3BPV A;  3C2H A;  3K70 C;  2NNN A;  2KP6 A;  5IP7 J;  5CQG A;  3ISP A;  2BXZ A;  3F22 A;  1YW7 A;  3MKZ A;  1JTY A;  2XUB A;  2MH2 A;  3HHH A;  5LGN A;  1MW7 A;  2VJ4 A;  4D5C A;  1ETQ A;  9ANT A;  5C4X J;  3A2K A;  3J7A O;  4ITV A;  5GAH J;  2K40 A;  5HS9 A;  2CH0 A;  3X2Q H;  1I39 A;  3ZQ7 A;  2Y0S N;  2EQR A;  1MMN A;  4ENM A;  3H9J A;  1T08 B;  2KRH A;  1OFC X;  1U5T A;  1WJF A;  1OCT C;  1QBJ A;  1YW9 A;  2EB7 A;  2DQL A;  2CMP A;  2HYG D;  1A5J A;  2B7E A;  1F9N A;  2DBB A;  4KMF A;  2IEK A;  2Z33 A;  1F43 A;  2EIK H;  2L54 A;  1BL0 A;  4A3K J;  3CO7 C;  4ZYE A;  1LJ9 A;  3OIO A;  4LIU A;  2O8K A;  3S2W A;  4B1R A;  5JR3 A;  1VQ4 I;  2W48 A;  4V19 K;  3EUK L;  2L2O A;  1SVO A;  2MW8 A;  2PG4 A;  2ZO4 A;  1YIJ I;  3GX4 X;  2DA7 A;  2VLA A;  3BG3 A;  2RVC A;  4ZYA A;  3OYC A;  2XPV A;  5FFX A;  1KGS A;  3M8F A;  1MD0 A;  4I0B A;  5IPA A;  1FEX A;  1FT9 A;  3KZY A;  5LEK A;  3W2A A;  2A6T A;  4J00 A;  1K61 A;  5GPA A;  3A01 B;  2FOW A;  4P96 A;  5F64 A;  4HX8 A;  3CJT B;  1L0O C;  4EQQ A;  1PUF A;  1HC8 A;  1FIA A;  1YYV A;  1X4O A;  2JSC A;  1YOV B;  2BHZ A;  3E6D A;  4HV6 A;  4O6J A;  1J75 A;  1REP C;  2XPU A;  2P6T A;  1XD7 A;  4RS8 A;  3QOP A;  5KAI C;  2JA8 J;  5D6F A;  2F5D A;  1PUF B;  1LE8 A;  4KUM A;  3J7Z I;  3A1Y A;  4LG3 A;  4LB6 B;  2HXI A;  2R7F A;  5BPD A;  4P1W A;  2ZB9 A;  3OOU A;  3GW2 A;  3ZQG A;  2FNP A;  3ZQC A;  2YU9 J;  5KAF C;  3EUH A;  2DTZ A;  2QSF X;  3R4K A;  3FKI J;  3JAM Z;  1G3W A;  1Y1V J;  1BR2 A;  3S3M A;  3T0Y A;  3OSF A;  4ZYH A;  1U9N A;  2DOA A;  1P4A A;  4F52 A;  3CMA I;  4HLY A;  4U7B A;  2OD5 A;  3DFG A;  3P9I A;  4CXF A;  4KNY A;  2CO5 A;  2EIN H;  3HYI A;  3CCE I;  2LBF B; 
#chains in the Genus database with same CATH homology
 1HST A;  2HTJ A;  3JSO A;  2J5P A;  4O3M A;  4Z2Y A;  2DPU A;  4ZH4 F;  1O3R A;  3TQN A;  4NB5 A;  1XMA A;  2HZT A;  2QYO A;  3CDH A;  3WU0 A;  2E7X A;  5HDK A;  2COM A;  4OIQ F;  2EV6 A;  2DU9 A;  3ZMZ A;  5J8F A;  3ZP5 A;  1XMK A;  3LAJ A;  4N0B A;  4EM0 B;  1G3S A;  1S7A A;  3FXQ A;  2VC1 A;  3CUQ C;  4M71 A;  3K2Z A;  3LA7 A;  1SFX A;  2QQB A;  4WX9 A;  5DD4 A;  3K1P A;  4ON0 A;  2DT5 A;  2ZJ2 A;  5LLQ A;  1FOK A;  1XSV A;  1O57 A;  1SD7 A;  1P2F A;  2PFB A;  2CW0 F;  1W7P A;  2LF8 A;  5K5Q A;  4HX4 A;  2XV4 S;  4LG0 A;  2Q0O A;  4L9V A;  2PN6 A;  1KA8 A;  2A68 F;  5HLG A;  1BOA A;  4NQW A;  4LG0 B;  4IXA A;  1EH8 A;  2C6Y A;  3TO6 A;  1TLH B;  2BBY A;  3L09 A;  4BQA A;  1LQ1 A;  1SAX A;  4IJA A;  5IT9 K;  2K4J A;  2OQR A;  4QWQ A;  2XAJ A;  3NEU A;  3D5L A;  1KQ8 A;  1SD5 A;  2JT1 A;  5L3E A;  1HW2 A;  4MGR A;  3J80 K;  4Q4Z F;  2F5E A;  4I2O A;  2K27 A;  1XN7 A;  1R36 A;  2FSW A;  3JTG A;  4R79 A;  4BHC A;  2RNJ A;  1I6X A;  1R1V A;  2MLG A;  2O61 A;  2HTS A;  4HF0 A;  4KIC A;  3P9C A;  1EV7 A;  2RKH A;  3GYH X;  2P7V B;  1XGM A;  3CJN A;  1ZAR A;  3F6O A;  4S05 A;  4S04 A;  4B8X A;  2OAZ A;  3BY6 A;  3GO5 A;  5IT3 A;  2PQ8 A;  3GFL A;  5HLI A;  4N9H A;  4M9S A;  3VOD A;  1E2X A;  2BV6 A;  5DD8 A;  3ZMT A;  4PCQ A;  2FU4 A;  4IHS A;  4CIC A;  3C7J A;  1G6N A;  4A6E A;  3LA3 A;  3ZN1 A;  2QQA A;  1YQA A;  2FML A;  3TDU C;  2Z99 A;  2HEO A;  1ZLJ A;  5L3G A;  1Z6R A;  2A6H F;  2KIF A;  2P4W A;  4G7H F;  3V7C A;  3K1N A;  2L02 A;  2XKO A;  5JFR A;  3E5U A;  2L01 A;  1MGT A;  5D8K B;  1WKM A;  4OIR F;  3F6V A;  1KQ0 A;  1V4R A;  3N4M A;  4GO1 A;  1S3J A;  4ESB A;  2GAU A;  3WGI A;  2WC2 A;  2QQ9 A;  4KN7 X;  2Y0M A;  3DXJ F;  3H3U A;  3HRS A;  4YII A;  4YFN F;  4HW0 A;  2P8T A;  1P4W A;  4IVN A;  2PBI A;  2PEX A;  5HDG A;  1R58 A;  1Z05 A;  1HXD A;  3I64 A;  2K4B A;  4EGY A;  1FY7 A;  5D6E A;  1O3Q A;  3V8L A;  1EH6 A;  3VFZ A;  4KYW A;  4O5V A;  4A0Z A;  2XHK A;  4LLN A;  4GCV A;  2D2W A;  3QAH A;  2HKX A;  1STZ A;  1RIO H;  1U5T C;  3JSP A;  2V9V A;  2Z3Y A;  1OPC A;  1FSH A;  3Q9V A;  4BHP A;  1Z7U A;  4G6D A;  2VBY A;  2UXX A;  1ZLK A;  1KU9 A;  1S7O A;  3FM3 A;  1OKR A;  2OZU A;  2DTR A;  1WI9 A;  1L3L A;  1B4A A;  4G7Z F;  3E5X A;  4M72 A;  3I59 A;  2E1C A;  4BAY A;  1ZGJ A;  4RB2 C;  1J5Y A;  1ZN2 A;  2PMH A;  3DV8 A;  1HSJ A;  4ESF A;  2FBI A;  3PFI A;  3GXO A;  1DPU A;  4XSX F;  4HQM A;  4KT5 C;  2GIV A;  5FFZ A;  5CJ9 A;  1DPR A;  1QZY A;  1FC3 A;  3FXU A;  3U9G A;  2QBY B;  1ONV A;  3WTX C;  3HHG A;  2DAO A;  3KE2 A;  1KU2 A;  1CF7 A;  1Z9C A;  3EDP A;  4M6Y A;  1BJA A;  3R61 A;  3BOQ A;  1LDK B;  3V4G A;  5FGM A;  1UHM A;  1U6G A;  2YR2 A;  4LFU A;  3B73 A;  1I1S A;  2OA4 A;  4AVP A;  1MJA A;  3HTS B;  1RNL A;  4PGG A;  1FYL A;  1I5Z A;  1J59 A;  4KIF A;  4A0Y A;  4UUV A;  3CTA A;  5FLX Z;  2G7U A;  5L3D A;  1HKQ A;  3FHZ A;  4A12 A;  2FXA A;  2A6E F;  2F2E A;  2ISZ A;  4U7D A;  1R22 A;  2O3F A;  2ESN A;  5A2Q K;  1IF1 A;  2VT3 A;  2NS0 A;  3WGH A;  1R5G A;  2H6B A;  1AOY A;  3MFK A;  3Q9S A;  1HKT A;  1FBS A;  3MWM A;  1F4K A;  1USS A;  4HF1 A;  4KA4 A;  2O03 A;  2M5W A;  2QZ8 A;  2ZNY A;  3L00 A;  2V6C A;  1ULY A;  3ZMU A;  4RGU A;  3K1M A;  2R3S A;  4LD5 A;  1LNW A;  3KP3 A;  3L9F A;  3I58 A;  1I27 A;  1OYW A;  3RKX A;  3MAJ A;  5ICG A;  4UV8 A;  1CGP A;  2O6G E;  5HS8 A;  1T6S A;  3FM5 A;  2A07 F;  2D1V A;  1R00 A;  5LHG A;  5DDG A;  2OU2 A;  4JK1 X;  5FD5 A;  1TNT A;  3LAP A;  3HRU A;  3KZZ A;  2CQK A;  4MQV A;  2L4A A;  1ZH5 A;  1GVJ A;  3C1D A;  1LEB A;  3BZ6 A;  4HBL A;  1W4M A;  3T1B A;  4HLX A;  4A5M A;  2A3S A;  1FBQ A;  4UNO A;  3WOD F;  1TTY A;  4I01 A;  4MEY F;  2MH9 A;  3F8B A;  2V1D A;  4G8X A;  2GXG A;  2XRO A;  1Z6T A;  4XRF A;  1GXP A;  3P9K A;  2O0Y A;  1BBY A;  1B6A A;  2H27 A;  2VBX A;  1QPM A;  4XLN F;  2ZFW A;  2Z5U A;  4P9F A;  1D8K A;  4WXC A;  4HF2 A;  3G3Z A;  3F8M A;  2XKP A;  2XAS A;  4RAY A;  3SZT A;  1TQP A;  2QUF A;  3ABT A;  3KET A;  3ECO A;  3M7G A;  1TQI A;  2VT2 A;  1YO5 C;  5ED4 A;  3KLO A;  5CVV A;  3WTY C;  3M8E A;  3HTU A;  3FMQ A;  2FMY A;  2VE8 A;  1IN8 A;  4OIO F;  2STW A;  4ENN A;  1T39 A;  2Z9O A;  4HQE A;  1S29 A;  5H6Q A;  5LEJ A;  3I71 A;  4ASN A;  4G9Y A;  5HS7 A;  1IAW A;  3DF8 A;  1W5S A;  4L9T A;  2TDX A;  2CFX A;  4L9N A;  4PZJ A;  4UXN A;  4YFX F;  3MZY A;  5A2Q Z;  3BJA A;  3ECH A;  1SMY F;  1U78 A;  2EK5 A;  1RI7 A;  2EV0 A;  5J6X A;  2IP2 A;  1D3Y A;  3T8T A;  1BI3 A;  2CYY A;  3J81 Z;  1G4D A;  4WXD A;  3LWF A;  1MZB A;  1PP7 U;  1YFH A;  3QP6 A;  3QPH A;  4G7O F;  1FWZ A;  1IXR C;  4I02 A;  2ELH A;  2VOP A;  1TQM A;  3CLO A;  2GWR A;  3F3X A;  5E8I A;  5LBQ A;  2HQN A;  1IZ1 A;  3MCZ A;  2W24 A;  4UHT A;  1O3S A;  1SMT A;  4F7Z A;  4TV7 A;  2KJC A;  3KP6 A;  4HA8 A;  1BC7 C;  3ROU A;  3GUD A;  4G94 A;  1FLI A;  1IN6 A;  4HV5 A;  2VN2 A;  3HUG A;  4UVC A;  3HSE A;  3I54 A;  1XDU A;  4CYD A;  1O7L A;  3C3W A;  1ZRD A;  4P9U A;  1JE8 A;  4OMZ A;  3RKY A;  2G7H A;  3SZP A;  4BH9 A;  2IPQ X;  3EYI A;  4ZZD A;  2YX7 A;  1OMI A;  3DKW A;  4KIG A;  4U0W A;  1BIB A;  3DP7 A;  3TO7 A;  4GYI A;  1FZP B;  3DEU A;  2GQQ A;  3Q5F A;  1U8R A;  5ILV A;  1B59 A;  1ZG5 A;  2RN7 A;  4CDG A;  4YFK F;  2PLY A;  1XDS A;  3NRV A;  4MHG A;  2JTV A;  4AD9 A;  4E70 A;  1S8N A;  2ZBK A;  1JGS A;  2YSR A;  5DYM A;  4ENJ A;  4HAM A;  5D5U B;  2OZ6 A;  5EEH A;  4A0X A;  2A61 A;  1D5V A;  1P6R A;  5BS6 A;  3IL2 A;  3DQV C;  2V1X A;  3FMR A;  1PUE E;  2ZME B;  5D5V B;  2ISY A;  5F1R A;  2CG4 A;  4GYG A;  4D0P A;  3RI4 A;  4L5J A;  5CLS A;  4A6D A;  4EJV A;  4IRG A;  4BHB A;  5E1Z B;  1A04 A;  5E20 A;  4H0E A;  3TO9 A;  3RYR A;  4ESJ A;  1HBX G;  1MJB A;  4A2U A;  3BJO A;  3TKY A;  3WG9 A;  2DFI A;  4MTE A;  5FB2 A;  5DV5 A;  2H94 A;  2DQR A;  3GFM A;  4PGH A;  4MTD A;  2AXL A;  5DUK A;  4Q47 A;  3ELK A;  2ZXJ A;  5DUI A;  2BEO A;  4P55 A;  1D8J A;  3TOA A;  4I0A A;  1JHF A;  4FT8 A;  3V8K A;  3H92 A;  3ZMD A;  4UV9 A;  3HRM A;  4IRI A;  2GZW A;  2M1B A;  2K02 A;  5ICF A;  4M9X A;  1ON1 A;  3IWZ A;  3IKV A;  2UXN A;  4LB5 A;  5BMZ A;  4RGX A;  1RUO A;  1P4X A;  3MEX A;  2IRF G;  1FP2 A;  4UVB A;  5FD6 A;  3JW4 A;  2EFP A;  1J2X A;  3BRO A;  5L3F A;  1IRG A;  5DCM B;  1BN5 A;  1LB2 A;  3RTR A;  3F8F A;  5D4R A;  1B1B A;  3HRT A;  3OOP A;  2FOK A;  3KFW X;  4I7H A;  5IT9 Z;  1FYM A;  2X4H A;  4A5N A;  1G3T A;  1H9T A;  3KP7 A;  1T38 A;  1F1Z A;  4LJZ F;  4U88 A;  1YIO A;  2J5O A;  1H0M A;  2MBF A;  1IN5 A;  3LA2 A;  4JBA A;  3CUQ A;  5KK1 A;  2MLK A;  2QBY A;  5K5R A;  1B9M A;  3J80 Z;  1IUY A;  4M6X A;  4EJT A;  3PQJ A;  3CUQ B;  1O7F A;  2GXB A;  2YU3 A;  3WTU C;  3IRQ A;  1XB4 A;  3JTH A;  5TRD A;  2P5L C;  2CGP A;  1DP7 P;  1XSD A;  2L3D A;  2VC0 A;  4WXH A;  2IJL A;  4AIK A;  2DI3 A;  1FSE A;  5ICC A;  4Q5S F;  2FRH A;  1XGO A;  4LGW A;  1J7K A;  2EFO A;  3R0A A;  4HOB A;  1RZ4 A;  5L3B A;  3W6K B;  3I5U A;  1ZRE A;  3O2P E;  4BNC A;  3QPT A;  1R5H A;  1ZAO A;  4Y15 A;  1P92 A;  4OIP F;  2MC3 A;  1HKS A;  5ILS A;  1MDM B;  1OYI A;  2WTE A;  5CVR A;  3GFI A;  3WTT C;  3JAM K;  5AIP A;  5BQT A;  3R60 A;  2D1H A;  4IF4 A;  3QU6 A;  4LLG F;  1UST A;  4RB3 C;  4OIN F;  4DNC A;  2AS5 F;  4KFC A;  3N97 A;  2M8E A;  1TNS A;  2Q8K A;  4AWX B;  2QWW A;  4BXU A;  1FYK A;  5JHU A;  5J8C A;  2EWN A;  3K0L A;  4MNU A;  1HQC A;  3GFJ A;  4HDU A;  2PJP A;  2FNA A;  1BI1 A;  1I1G A;  2BE5 F;  2HQR A;  3GEZ A;  3ML6 A;  3RDI A;  2STT A;  1R1U A;  1Z91 A;  2W85 A;  1R7J A;  3B02 A;  5ERI A;  2ZNZ A;  1BIA A;  3KEO A;  3E6B A;  4L5I A;  1ODD A;  2BGC A;  5D5W B;  2ACJ A;  1U3E M;  1ZRF A;  2E1N A;  4EM2 A;  1LDD A;  4R8H A;  2W57 A;  4I09 A;  4PDK A;  5CYV A;  2XAG A;  1SFU A;  3HIF A;  3GZ6 A;  2M87 A;  2QM3 A;  2W84 A;  3GLX A;  1DUX C;  2FE3 A;  4CHU A;  3GF2 A;  3ERE D;  2WV0 A;  3LQQ A;  4RB0 A;  4CGZ A;  3FXR A;  2H6C A;  1PDN C;  2HR3 A;  2KRF A;  5LRS A;  4LMY A;  1TW3 A;  3OV8 A;  2XGX A;  4JQF A;  2PI0 A;  2K86 A;  1KQ9 A;  3CO6 C;  3VEP A;  3V7R A;  2L4M A;  4RGR A;  1MJ9 A;  2GA2 A;  1W5T A;  3GZ5 A;  3ABU A;  3FF5 A;  3AAF A;  4XLP F;  3BJ6 A;  4EJU A;  2NRA C;  3M1E A;  5AIQ A;  1UCR A;  3ZMS A;  4U0Y A;  1Q1H A;  5E1X A;  3BWG A;  1U5T B;  3RYP A;  2F5F A;  1T0F A;  5K5O A;  2XAQ A;  2XIG A;  3BDD A;  4LK1 F;  2QVO A;  5ICE A;  1AWC A;  1TBX A;  2DW4 A;  2DPD A;  4L18 B;  2V79 A;  3TOB A;  3IKT A;  4OMY A;  2NYX A;  4K2E A;  3HOT A;  1G3Y A;  1SFE A;  1FNN A;  1R1T A;  1YLF A;  1QNT A;  2FBH A;  1XCB A;  2ZKZ A;  5F6F A;  2PMU A;  2ETH A;  4UVA A;  1UHW A;  2LSO A;  5TJJ A;  3U1D A;  3CUO A;  2XAH A;  2W25 A;  5LHI A;  4M9Z A;  2A69 F;  2IA1 A;  3M9A A;  3WGG A;  1K7A A;  3KP2 A;  3IRR A;  1ZHF A;  1YS7 A;  1TW2 A;  5E17 F;  2Y48 A;  2VE9 A;  3SQN A;  4HDV A;  3D0S A;  4EMS A;  4WWC A;  3IWF A;  4U0V A;  6PAX A;  3SFZ A;  4ETS A;  5CVU A;  1Y0U A;  1KYZ A;  2M45 A;  4EM1 A;  1H9G A;  2HWV A;  2KIU A;  1IW7 F;  5BOX A;  2FF4 A;  4FX0 A;  2Y75 A;  1GHC A;  4NHJ A;  5E18 F;  2ADU A;  3E3V A;  4WCG A;  4RGS A;  2EV5 A;  5D8L B;  4QLC U;  3KLN A;  3ZPL A;  2UWM A;  3ULQ B;  3R0J A;  4MEX F;  4R1H A;  1ZYR F;  4GXO A;  2NNY A;  2IA2 A;  1ON2 A;  3K9T A;  2CWE A;  2IT0 A;  1QZZ A;  3O6B B;  1IXS B;  1WRJ A;  5EEG A;  2ESH A;  2EFN A;  2HGC A;  2DLL A;  3I53 A;  3DPL C;  2VBZ A;  2O8X A;  3RKW A;  3RPU A;  2EFW A;  3PQK A;  5HLH A;  3EQL F;  1W7P B;  3RIR A;  3T5X A;  4LLL A;  3BPX A;  5HVQ C;  4EJW A;  2HYF A;  3WE3 A;  4N9I A;  2DO7 A;  4OU0 A;  1J9I A;  2R7D A;  2IVM A;  2IA0 A;  5FO5 A;  3TDZ C;  2YPR A;  5JI6 A;  5CVJ A;  3LFK A;  2DK5 A;  4M73 A;  1BM9 A;  4IRH A;  2LDU A;  4KN4 X;  1Z1D A;  3SHF A;  1BI0 A;  1XSX A;  1JHH A;  2BYV E;  3QU3 A;  2HS5 A;  1MKM A;  1YS6 A;  3T8R A;  1T2K A;  4AIJ A;  4I98 B;  2P5K A;  2RV8 A;  2ZME A;  1J0R A;  1LDJ A;  3RJP A;  2LNB A;  4EJO A;  1DDN A;  1SD4 A;  4IPA A;  3KCC A;  2XVC A;  1IN7 A;  2VOO A;  1O3T A;  1FX7 A;  1QO0 D;  2K7L A;  4CZZ A;  2FQ3 A;  4RB1 A;  3KEQ A;  3LQR A;  3ZMV A;  2HKO A;  1VTN C;  5E1W A;  1FBU A;  5LGT A;  2EA2 A;  1U2W A;  2JPB A;  4M74 A;  3QRF F;  2MD5 A;  1XGN A;  3FX3 A;  1XGS A;  3I0T A;  3WTZ A;  3L7W A;  3KP5 A;  5LRR A;  2FBK A;  5H20 A;  2JZY A;  2B0L A;  5FLX K;  1R23 A;  4RAZ A;  2RC4 A;  3GWZ A;  1GXQ A;  1T98 A;  2ZCW A;  4FX4 A;  4CO8 A;  5BPI A;  1YTY A;  1ZG3 A;  2G9W A;  4HYE A;  1ZGA A;  3U2R A;  2HDC A;  2DK8 A;  3WTS C;  2OQG A;  2OBP A;  3VB2 A;  1BC8 C;  3F23 A;  2XRN A;  3MQ0 A;  1EH7 A;  4WF2 A;  2FEZ A;  1FP1 D;  5AON A;  2EFQ A;  2EJR A;  3V7S A;  3F21 A;  5H6R A;  3IC7 A;  1E17 A;  3WTV C;  5LHH A;  2F5C A;  5DCM A;  4OOI A;  1PP8 F;  4L9J A;  3E6C C;  4BYY A;  4WK8 F;  3H3Z A;  3EYY A;  3KP4 A;  4DQ2 A;  3E6M A;  1V3F A;  2V1U A;  4ZZL A;  3F8C A;  1WWX A;  4EVI A;  1WSU A;  2A5Y B;  3COA C;  3P7N A;  4HZF A;  4LK0 F;  2VOD A;  5DCF A;  1RUN A;  3BP8 A;  2YX4 A;  5KVR A;  3REO A;  4ENK A;  1F5T A;  4G6Q A;  3C18 A;  4HX7 A;  2CSO A;  5E8G A;  3EET A;  1UFM A;  3QP5 A;  2KJB A;  1UB9 A;  2P7C B;  4B09 A;  3I59 B;  2M30 A;  3TGN A;  2KIM A;  5HOO A;  3I4P A;  5K1Y A;  3R6S A;  1IN4 A;  1W7P D;  3WU1 B;  4EV0 A;  4Y17 A;  1KYW A;  3F72 A;  1K78 A;  2P6S A;  3E5Q A;  1FPQ A;  5CVI A;  2VON A;  5DEQ A;  2HFH A;  2VBW A;  5ILU A;  2RQP A;  1K78 B;  3HSR A;  4P5O A;  4MQ9 F;  5LGU A;  2EA4 A;  1OR7 A;  1CF7 B;  2H09 A;  2LF7 A;  1MDM A;  3L2C A;  3IHU A;  3HSF A;  1OYY A;  2P5V A;  1NHA A;  3G73 A;  3VOE A;  2HOE A;  1B9N A;  4KDP A;  4FHT A;  1YG2 A;  4L0Y B;  1KU7 A;  1QQI A;  1QGP A;  2XAF A;  2VXZ A;  3SXY A;  4AIH A;  1K6O A;  2D45 A;  1ZG1 A;  1KU3 A;  3K69 A;  3FMS A;  2QLZ A;  4KIB A;  1BI2 A;  1HW1 A;  3HOS A;  1X3U A;  3W6J B;  2WWY A;  1S6L A;  1YW8 A;  1WQ2 A;  3FWE A;  3LST A;  2IW5 A;  4ZYG A;  4YG2 F;  3WE2 A;  1ZRC A;  4ZYD A;  2QEN A;  3J81 K;  5D5X B;  1K79 A;  3E97 A;  5JVT A;  3V8J A;  4Q48 A;  1SD6 A;  2JPC A;  5L3C A;  3ZN0 A;  3O3K A;  4EGZ A;  1LEA A;  2Q2E A;  1IXC A;  2NAZ A;  3WTW C;  3MZH A;  4KMU X;  2FA5 A;  4L0Z B;  2JRT A;  2UZK A;  2GA1 A;  5HDN A;  2MA3 A;  2RDP A;  3DPT A;  4IHT A;  2RGV A;  4YIF A;  3NQO A;  3GVA A;  4XBF A;  2X0L A;  3RPQ A;  1IRF A;  4XSZ F;  4Y13 A;  1XCV A;  2E7W A;  1C0W A;  4GGG A;  5D4S A;  3F8N A;  1JXS A;  2KKO A;  1HW5 A;  1LVA A;  2LKP A;  3FZV A;  3BPV A;  2NNN A;  3ISP A;  3F22 A;  1YW7 A;  2XUB A;  2MH2 A;  3HHH A;  5LGN A;  3J7A O;  5HS9 A;  3ZQ7 A;  4ENM A;  1U5T A;  1QBJ A;  1YW9 A;  2EB7 A;  2DQL A;  2HYG D;  1F9N A;  2DBB A;  4KMF A;  2Z33 A;  2L54 A;  3CO7 C;  4ZYE A;  1LJ9 A;  3S2W A;  5JR3 A;  2PG4 A;  2ZO4 A;  3GX4 X;  2RVC A;  5FFX A;  1KGS A;  3M8F A;  1MD0 A;  4I0B A;  1FT9 A;  3KZY A;  5LEK A;  4P96 A;  5F64 A;  4EQQ A;  4HX8 A;  1L0O C;  1YYV A;  2JSC A;  3E6D A;  1J75 A;  4HV6 A;  4O6J A;  1REP C;  2P6T A;  1XD7 A;  4RS8 A;  3QOP A;  5D6F A;  2F5D A;  4KUM A;  4LB6 B;  2R7F A;  5BPD A;  3GW2 A;  2FNP A;  3EUH A;  3R4K A;  3JAM Z;  1G3W A;  3T0Y A;  4ZYH A;  1P4A A;  4HLY A;  4U7B A;  2OD5 A;  3DFG A;  3P9I A;  4CXF A;  4KNY A;  2CO5 A;  3HYI A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...