4AIKA

Crystal structure of rova from yersinia in complex with an invasin promoter fragment
Total Genus 52
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
52
sequence length
139
structure length
139
Chain Sequence
STLGSDLARLVRVWRALIDHRLKPLELTQTHWVTLYNINRLPPEQSQIQLAKAIGIEQPSLVRTLDQLEEKGLITRHTSANDRRAKRIKLTEQSSPIIEQVDGVISSTRKEILGGISSDEIAVLSGLIDKLEKNIIQLQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords TRANSCRIPTIONAL REGULATOR SLYA
publication title Structural Basis for Intrinsic Thermosensing by the Master Virulence Regulator Rova of Yersinia.
pubmed doi rcsb
source organism Yersinia pseudotuberculosis
molecule tags Transcription
total genus 52
structure length 139
sequence length 139
chains with identical sequence B
ec nomenclature
pdb deposition date 2012-02-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01047 MarR MarR family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 4aikA00
3P9IA 2XAJA 3J80Z 3GF2A 5K5OA 1R5HA 2FEZA 2XROA 2AS5F 1I1GA 2GIVA 1IF1A 3QAHA 2XKOA 1LEBA 3WTXC 1U78A 3KE2A 3E3VA 1TW3A 4MEYF 4Y15A 2MLKA 3C1DA 2ISZA 5J8CA 2PEXA 1J0RA 1B9MA 3MZYA 3R0AA 1ZLKA 3FMRA 2YPRA 3R61A 3WTSC 1XGNA 1SMTA 3P9CA 2O0YA 3WTVC 5L3DA 1O3RA 3F8NA 4DQ2A 1TNTA 3TQNA 2KIUA 3HSEA 2MH2A 5FB2A 4L0ZB 1TBXA 1QGPA 4LLNA 3BPVA 5K1YA 2M30A 1LVAA 2ZBKA 1QQIA 3P9KA 1FP1D 1AOYA 4Y13A 1BBYA 3M8FA 1R1TA 2EJRA 3V7SA 1WQ2A 2IA1A 1A04A 3CUQC 4CGZA 2BE5F 5FLXK 5KVRA 1YLFA 5D5UB 1KQ8A 2RV8A 4NB5A 3J81K 3HRSA 2Z3YA 2VONA 3ZMVA 3H92A 2E1CA 2HYGD 1K7AA 3O2PE 2FMLA 4L0YB 1I6XA 3GO5A 2RNJA 3B73A 1E17A 4PDKA 3J80K 1MJBA 2DW4A 1R22A 2PMUA 4H0EA 4O3MA 4KIFA 3IKTA 3F72A 1W5TA 1FBUA 3Q5FA 1FPQA 4OU0A 5LHHA 2VOPA 4B8XA 3FXUA 2P5VA 4IJAA 3U9GA 3HIFA 2PG4A 2QLZA 4GYGA 1KU2A 2R7DA 3K1MA 1S6LA 3WTUC 1PUEE 5DCFA 4EGZA 4A0YA 4OMZA 4PGGA 2FA5A 4CYDA 1ZAOA 4EM2A 3CO6C 3T8RA 5AIQA 2E7WA 2WTEA 2MC3A 2FQ3A 3HHHA 3QU3A 3ZMDA 2DBBA 4HX7A 4IRIA 4HQMA 1MDMB 5HOOA 2FF4A 1TNSA 3WGIA 1P4AA 3RDIA 1Z9CA 2VXZA 3WTTC 2W25A 2CFXA 2XUBA 4GYIA 5JR3A 1D3YA 2P7VB 4KA4A 2PMHA 4IHSA 2QBYA 1SD4A 3HUGA 5AIPA 2VN2A 2L4MA 4YFNF 1FSHA 1QZZA 2NS0A 4RGRA 4G94A 1G4DA 2G9WA 3V7CA 5K5RA 3LQRA 4ENKA 3ZP5A 4ZYDA 2RQPA 3E5QA 4UHTA 3EQLF 4LD5A 4N9HA 1ON2A 5ILUA 2UZKA 1KA8A 2XIGA 1GXPA 3DPTA 2DFIA 2X0LA 4UNOA 3R0JA 4KIGA 5BMZA 3FMQA 3FF5A 4LMYA 2LKPA 5CJ9A 1HKTA 2FNAA 4L9NA 3GXOA 3F8FA 3I58A 5L3GA 1XMKA 3E97A 3BJ6A 1I1SA 4AD9A 1R1UA 1VTNC 3F6OA 2H6BA 1WKMA 5HDNA 2FBIA 1IUYA 2K02A 5ICEA 3HOTA 2DO7A 2PI0A 2VODA 1R58A 4F7ZA 4ESJA 3S2WA 1K78A 1ZYRF 2JTVA 4YG2F 3F6VA 4U7BA 1MDMA 2ZNYA 2XAGA 4WX9A 5CVRA 3LA7A 3U1DA 5LEJA 4M9ZA 3J7AO 3TDZC 4RB1A 3FWEA 3T0YA 5HLGA 3EYIA 2BYVE 2PLYA 2B0LA 3F8BA 1GXQA 1LEAA 4I7HA 4ZYGA 2YU3A 3MQ0A 5KK1A 4XLPF 1R00A 3HOSA 2BEOA 2CGPA 6PAXA 2RC4A 4XBFA 4BHPA 3BWGA 2KIFA 2D2WA 2GXBA 2HOEA 4MGRA 1IXCA 3CUOA 4ENMA 2V9VA 1YS6A 1HKSA 1Z05A 3F8CA 1BJAA 2KKOA 3TO6A 4FX0A 5A2QZ 1DP7P 2KJCA 5D5VB 4YIIA 1SMYF 5L3EA 3TO7A 3V8KA 1IZ1A 1ZRFA 1RI7A 1ZLJA 3ELKA 2NNNA 3Q9SA 1Q1HA 3TKYA 1R36A 2DQRA 3EYYA 2JZYA 3VFZA 4ENNA 4KNYA 1LJ9A 5DCMB 2NYXA 4BXUA 3H3UA 2QWWA 5EEGA 1D8JA 5JI6A 1D5VA 3BZ6A 1JXSA 3BOQA 4I2OA 2FOKA 2GQQA 4BAYA 3I59B 5FFZA 2CQKA 2CSOA 3VOEA 1S8NA 1R23A 4AVPA 1LQ1A 3MAJA 3FX3A 1IW7F 1WRJA 1FZPB 1LDKB 5DYMA 4WWCA 2M45A 3QOPA 1YQAA 3TGNA 1O3SA 1ONVA 2OQRA 4U0YA 3VODA 3LFKA 2G7HA 2A3SA 5D8LB 2V79A 3CUQB 4Q5SF 1V3FA 1MJAA 2GAUA 3ABTA 2DAOA 4XSZF 4XLNF 1ZG5A 5JHUA 1IN6A 2EFOA 2OBPA 1B4AA 1BIAA 2O8XA 2IJLA 5HLHA 5JFRA 3KEQA 1LNWA 5E1WA 4HV6A 5A2QK 4G7ZF 5LGUA 3OOPA 5LHGA 4RGSA 5FLXZ 1HW5A 4XRFA 5FD6A 4BHBA 5DDGA 3C7JA 3WGGA 4GGGA 5CLSA 5HS7A 1C0WA 4M9SA 3I0TA 3R60A 4CZZA 4CHUA 4LFUA 1HXDA 1BIBA 4HZFA 1UB9A 4KYWA 5J8FA 1O7FA 2PFBA 4P9UA 4QWQA 2L02A 4WF2A 4B09A 3K9TA 3QPTA 3RKWA 1FY7A 2RVCA 1P4XA 4G6QA 3IKVA 5LLQA 3K1PA 2DI3A 4U88A 1SD6A 4MTEA 3QP5A 2STWA 3FZVA 4GO1A 5CYVA 1P92A 4AIKA 1EH7A 4HLXA 3I59A 2EV5A 4ON0A 2V1DA 5LEKA 1G3TA 5TJJA 4KIBA 4EMSA 2JRTA 1XDUA 2HKOA 2F5CA 4L9JA 4WCGA 1H9TA 1H0MA 2KRFA 3NQOA 2A5YB 1SD5A 3F22A 4M6YA 1U5TC 4MTDA 2JSCA 4RS8A 1FC3A 4OMYA 3IL2A 3I5UA 1HQCA 2DTRA 3F21A 1TTYA 4RB2C 4BQAA 4JBAA 1T39A 1W7PA 4R79A 5ILVA 1OYWA 3E6CC 2IRFG 2DU9A 1PP8F 2Q8KA 4UXNA 4Q47A 3OV8A 1XGOA 3KP5A 4BNCA 1BI3A 3WTZA 4UVBA 5FFXA 3E6BA 2CYYA 4MNUA 2OQGA 1IRGA 2EFWA 1JGSA 1ZRCA 1QZYA 3WODF 3KZYA 4YIFA 1FYLA 4U0WA 4KN4X 1QPMA 1YIOA 1OR7A 3FHZA 3KP7A 4M6XA 1Z1DA 3AAFA 3H3ZA 2ZCWA 5HVQC 3BPXA 5TRDA 3FM3A 1J7KA 1O57A 1KU7A 3C3WA 4I0BA 5CVJA 5FGMA 1ULYA 4HF2A 2NNYA 1OYIA 4KT5C 2M5WA 2PJPA 5ICGA 4AIHA 2XASA 3GFJA 2K86A 3GFIA 2VC0A 2A69F 2VBWA 1Z6RA 1YW7A 2OAZA 3BJAA 3EETA 2EV6A 3ULQB 2OZ6A 3E6MA 2NAZA 3HTUA 3K1NA 2EFNA 3CDHA 3JW4A 4CXFA 2DQLA 4OOIA 2IT0A 1IAWA 2HTJA 1FP2A 2PN6A 1I5ZA 3JSPA 1ODDA 3DKWA 1DPUA 1KU9A 5E20A 3V7RA 3U2RA 1MGTA 2EFPA 4ENJA 4GCVA 1ZG3A 3E6DA 5DUKA 3FXRA 1YO5C 1WWXA 1K6OA 2FNPA 3TDUC 4HYEA 2QENA 2IVMA 1GVJA 3F3XA 4IRGA 5L3FA 1CGPA 4HBLA 1FLIA 4L9VA 1B59A 3WU1B 4IVNA 2X4HA 1F1ZA 2ZXJA 1BM9A 2XAQA 1JE8A 2CG4A 2IPQX 4FHTA 2H09A 4U0VA 1V4RA 4LG0B 3C18A 1F4KA 2IA2A 4EVIA 3VB2A 2W85A 4NQWA 2F2EA 4FT8A 2ESNA 3ZMSA 3CO7C 1XB4A 5H6QA 1G3WA 2H94A 3DPLC 5HDKA 4CO8A 4BH9A 4EM0B 3SZTA 4AWXB 1XSVA 4UUVA 4PGHA 5DUIA 1OMIA 1FX7A 3I54A 3HTSB 2ZMEB 1S7OA 1MJ9A 2O61A 4LK1F 3HSRA 3MFKA 1P6RA 2P4WA 4L9TA 5H6RA 5FO5A 1IN7A 3GFLA 3HHGA 2JPBA 3KLOA 1U2WA 2W24A 3REOA 2QUFA 5BPDA 2FE3A 3FXQA 2XAFA 3LWFA 1O7LA 1WI9A 5E18F 2O3FA 4P55A 3V8LA 2MD5A 2D1HA 1YYVA 2EFQA 4L5JA 2FRHA 3KP2A 2CW0F 4UV8A 3QRFF 3NRVA 4P5OA 4MHGA 3FMSA 3MWMA 5DD8A 4ZH4F 5F1RA 1ZRDA 4HV5A 2M8EA 3G3ZA 4O6JA 3GFMA 2BV6A 3DV8A 4RAYA 2F5DA 3DXJF 4IPAA 1MZBA 3M9AA 2DK8A 1YW8A 2GA1A 1RUNA 2BGCA 5H20A 2OU2A 3IC7A 1J2XA 1FSEA 4KMFA 3KLNA 4ZYHA 3TOBA 1UCRA 1STZA 4R8HA 4OIPF 1USTA 2VBZA 2A07F 2HFHA 3E5XA 4O5VA 2WC2A 3I4PA 3PQJA 4LLLA 3ZQ7A 2FXAA 3MZHA 2JPCA 3I71A 4ZZDA 2ISYA 4LGWA 1T6SA 4YFXF 1F5TA 2HQNA 1B1BA 4EQQA 5ED4A 1HW2A 4JK1X 1XSDA 5CVVA 3ERED 1EV7A 4NHJA 1BN5A 3K69A 1QO0D 4KN7X 2TDXA 3GW2A 4A0ZA 4M72A 1TQIA 2L01A 4HW0A 5AONA 5FD5A 3GZ5A 1QBJA 2LDUA 1EH6A 1DDNA 4HDVA 3DEUA 1U5TB 2ZNZA 1RIOH 2HWVA 4HAMA 5D5XB 1DUXC 2ZMEA 2F5FA 1DPRA 2XVCA 1IXRC 1TW2A 5BQTA 2QYOA 3I53A 2R7FA 3ROUA 5ICFA 3WE3A 2YX4A 3ECHA 1ZG1A 1W5SA 4KUMA 1QNTA 2FBHA 1W4MA 3ABUA 5E8GA 4IF4A 1D8KA 3GUDA 3DQVC 4LK0F 2GXGA 1U8RA 4CICA 2EV0A 3N97A 4IXAA 2V6CA 4ESBA 4XSXF 3JAMZ 3EDPA 2H27A 4WXDA 3RKYA 3RYRA 2L3DA 3T8TA 3GVAA 4JQFA 1TQPA 4ASNA 5ICCA 5K5QA 1OKRA 2JT1A 2EB7A 2HDCA 4KDPA 1K79A 2O03A 2A6EF 5E1ZB 3ZN0A 2ZJ2A 2DLLA 3D0SA 3MEXA 3T1BA 3L2CA 4Z2YA 4HDUA 4MEXF 1BI2A 2FBKA 1S29A 2R3SA 1HKQA 1XCVA 3JTHA 3IWZA 2ZFWA 3KP4A 4G9YA 1L3LA 3SFZA 2ADUA 1FBSA 1BI0A 4ZZLA 3LAPA 1WSUA 3RYPA 3ISPA 1IXSB 3HYIA 2QQ9A 3WU0A 2GA2A 4PCQA 1GHCA 5ILSA 4QLCU 2VT3A 5DCMA 3P7NA 5D6EA 3HRUA 2GWRA 4BYYA 2DT5A 2O6GE 1HBXG 3WGHA 5CVIA 4IHTA 3GYHX 1ZH5A 3IHUA 1IN5A 5D8KB 4ETSA 2XRNA 1HSJA 1ZGAA 2W84A 2XAHA 2HGCA 2WWYA 3L00A 3RTRA 1T2KA 2IA0A 4G8XA 4EJWA 1U5TA 3VEPA 4A6DA 1KQ9A 2ESHA 2GZWA 3LSTA 4Q4ZF 5LGTA 2LNBA 2STTA 3CUQA 3JAMK 1CF7B 2XGXA 2EA2A 5D4RA 5IT9Z 1Y0UA 2ZKZA 2HQRA 1SD7A 2QBYB 2QZ8A 2A61A 1U3EM 1ZN2A 1S3JA 2E7XA 3ZMTA 2RN7A 5HS9A 2RKHA 2WV0A 1J5YA 1ZREA 1KYZA 3V8JA 3W6JB 2J5PA 4LB5A 2IW5A 3EUHA 2QM3A 3PQKA 2P5LC 1XD7A 3HSFA 3QU6A 3BY6A 3SXYA 3F23A 3DF8A 1PP7U 2QQAA 2KJBA 4OIQF 3E5UA 3IWFA 1B6AA 3IRQA 4R1HA 1YS7A 2Q2EA 1OPCA 2EWNA 5ERIA 2Z33A 1BC7C 1USSA 1F9NA 3RIRA 3KP3A 4OIOF 3M7GA 1R5GA 1JHHA 5DEQA 2M87A 2D45A 2IP2A 4I0AA 1W7PD 5BS6A 2E1NA 2HEOA 1IN4A 2FU4A 1KYWA 5LBQA 4G7HF 3DP7A 1RUOA 4L18B 2COMA 2ETHA 1L0OC 2UXXA 2VE9A 2MLGA 3O3KA 2C6YA 2MA3A 2K7LA 4Q48A 2PBIA 2VC1A 3R6SA 4EJOA 3KFWX 1PDNC 1MKMA 2OD5A 4UV9A 2EA4A 3GZ6A 1G3YA 2YSRA 1FYKA 4HX8A 5LGNA 2EK5A 5IT9K 1H9GA 4N9IA 3K0LA 1J75A 2BBYA 1K78B 2MH9A 1P4WA 5BPIA 1SFUA 2P7CB 5LRSA 3L09A 4I09A 4UVCA 4I98B 4ESFA 2ZO4A 3COAC 1UFMA 1RNLA 5E8IA 4RB0A 5LHIA 2VE8A 1XCBA 4LJZF 1CF7A 4YFKF 2P6TA 3TOAA 1XGSA 2HS5A 3KCCA 1J9IA 2Z99A 4MQVA 1BOAA 3TO9A 4WXHA 4D0PA 3WTYC 3K2ZA 5E17F 4UVAA 4ZYEA 1BI1A 3M1EA 4EM1A 2Y48A 2CWEA 3BP8A 5HDGA 3JTGA 2HR3A 4K2EA 3KP6A 4RAZA 3WG9A 1Z7UA 3CTAA 1IN8A 3O6BB 1XSXA 1TQMA 3HRTA 4G6DA 4RGXA 3B02A 1B9NA 4A0XA 2V1UA 3WE2A 3FM5A 3NEUA 4RB3C 5DD4A 3PFIA 4G7OF 3QPHA 1O3QA 1HSTA 1FNNA 2V1XA 4M71A 1R7JA 4S05A 3RJPA 2NRAC 4M73A 5IT3A 1SAXA 2UXNA 2K4BA 4KICA 1T0FA 1RZ4A 1YG2A 4HQEA 4WXCA 3V4GA 2YX7A 3SZPA 3CJNA 4HOBA 3GEZA 3KETA 1I27A 3WTWC 4P96A 2HYFA 1KQ0A 3ZPLA 3BDDA 1YFHA 1FOKA 1KGSA 1Z6TA 4KFCA 1AWCA 3F8MA 2Z5UA 1YTYA 2VBXA 4OIRF 5D6FA 1R1VA 4P9FA 4A5NA 5D5WB 2Q0OA 5D4SA 1LDJA 1FBQA 3IRRA 4HA8A 2UWMA 2AXLA 4RGUA 3R4KA 1JHFA 2L54A 2Y75A 1Z91A 4M9XA 4CDGA 3KEOA 2FSWA 4LLGF 4AIJA 2OA4A 3BJOA 2A6HF 2PQ8A 3BROA 4E70A 2A68F 2HTSA 2QQBA 2J5OA 1LDDA 1T98A 2LSOA 3MCZA 2CO5A 4WK8F 2W57A 1ON1A 2D1VA 1HW1A 1ZHFA 1UHWA 1O3TA 2Z9OA 2G7UA 1KU3A 2HKXA 2FMYA 1YW9A 3GX4X 5HS8A 4A12A 2LF7A 4GXOA 1SFEA 3RKXA 1FWZA 4M74A 3HRMA 4LB6B 2VOOA 1IRFA 4I01A 2XV4S 2DPDA 1P2FA 3ZMUA 3W6KB 4HF1A 2ELHA 1E2XA 3LQQA 2H6CA 4EJTA 1BC8C 4EJVA 3Q9VA 1UHMA 2YR2A 3L9FA 4LG0A 4FX4A 2HZTA 4IRHA 3LA2A 4Y17A 3GLXA 3DFGA 5EEHA 1ZARA 1XGMA 3LA3A 5J6XA 3ECOA 2QVOA 4N0BA 2Y0MA 2L4AA 2LF8A 5HLIA 2P6SA 5DV5A 3KZZA 3QP6A 1G3SA 2MBFA 2XHKA 4EV0A 3L7WA 5BOXA 1U6GA 3RI4A 1EH8A 2K27A 3M8EA 1ZGJA 3RPUA 4HLYA 3D5LA 3G73A 1MD0A 3ZN1A 4DNCA 4PZJA 2RGVA 1XN7A 1REPC 1S7AA 1NHAA 5JVTA 4EGYA 4I02A 4A5MA 3ML6A 5F64A 1FYMA 1J59A 3LAJA 2M1BA 4A2UA 3JSOA 3N4MA 3RPQA 5E1XA 1W7PB 2KIMA 1OYYA 4OINF 2RDPA 3SQNA 4HX4A 2XKPA 4U7DA 3GWZA 1SFXA 4BHCA 3CLOA 4HF0A 4S04A 2DK5A 2VT2A 3J81Z 1T38A 1LB2A 2VBYA 4L5IA 1X3UA 1XDSA 2F5EA 4EJUA 5LRRA 5CVUA 4KMUX 4A6EA 2P5KA 5L3CA 5F6FA 3SHFA 1FT9A 1TLHB 3I64A 2DPUA 3T5XA 3ZMZA 2OZUA 1XMAA 4TV7A 5L3BA 1G6NA 2P8TA 4MQ9F 2ACJA 2K4JA
chains in the Genus database with same CATH superfamily
3P9IA 2ZJQF 3BR3A 4IO9F 2XAJA 3J80Z 3BZCA 3GF2A 2V1NA 1TWCJ 5K5OA 4BEHB 1YRNB 1R5HA 2FEZA 2IS4A 2DOEA 1YI2I 2O5RA 5JLWA 5HNHA 2XROA 2AS5F 1I1GA 2GIVA 4NC7A 1IF1A 3QAHA 2XKOA 1LEBA 2IS1A 3WTXC 2OV7A 4HRIA 3H36A 1U78A 3H0GJ 4XN0A 1QHHD 3ZQCA 3KE2A 1DU6A 1LKXA 1VNDA 2R7XA 3E3VA 1TW3A 4MEYF 4IL6C 4Y15A 1R71A 3QWLA 5M5WJ 2MLKA 2QCOA 2FD5A 3C1DA 2ISZA 5FROA 5J8CA 1T33A 2PEXA 1J0RA 1B9MA 3MZYA 3R0AA 3RZDJ 1ZLKA 2OC6A 1VQ4I 1UJ8A 3FMRA 2YPRA 3R61A 3MKWB 3WTSC 4B3AA 1IUFA 2XC7A 1XGNA 1SMTA 3S1QJ 1GUUA 1K83J 3P9CA 2O0YA 3N05A 3WTVC 2BW3B 1VQ7I 3VYTB 2BZTA 5L3DA 1ZELA 2WY7Q 1SFOJ 5K7FA 3OMYA 1O3RA 3F8NA 4DQ2A 1TP4A 1TNTA 4B47A 3TQNA 5J1RA 2KIUA 3S16J 2EZIA 2VASA 3HSEA 2MH2A 5FB2A 4L0ZB 1TBXA 5GAHJ 1QGPA 2E35A 5EGOB 1H89C 4LLNA 3BPVA 4JX5A 3Q0WA 4Y3OA 5K1YA 5E79C 2M30A 2A05A 1LVAA 2RAEA 2ZBKA 3HUGB 1QQIA 3P9KA 4AYBA 3HL2A 1FP1D 2LR8A 1AOYA 4Y13A 1VQPI 1HDDC 1BBYA 1ETQA 3M8FA 1R1TA 2EJRA 3Q3SA 3V7SA 1WQ2A 2IA1A 1A04A 5C44J 3JRFA 3CUQC 4CGZA 2BE5F 5FLXK 5KVRA 1YLFA 5D5UB 1KQ8A 2RV8A 4NB5A 2R7RA 3J81K 2VI6A 3HRSA 2Z3YA 2QF7A 2HXIA 2VONA 3ZMVA 3X2QH 4XK4A 3E1SA 2AQFA 3H92A 2E1CA 2HYGD 3A01B 1QRYA 1K7AA 3O2PE 2FMLA 1S5LC 4L0YB 2DT6A 1I6XA 3G1OA 1R4NB 3GO5A 2RNJA 1MMSA 2IEKA 4EEFG 3RZOJ 3B73A 2XAUA 1E17A 4PDKA 3GTGJ 4G6TB 3J80K 4A3JJ 3KIOA 4D1QA 2LFBA 2XDVA 1MJBA 2DW4A 1PJRA 1R22A 3HJEA 2PMUA 2V9KA 3DKXA 3LSGA 1KZHA 4BJTA 4H0EA 4CSWA 2PJRB 4O3MA 3BQYA 4KIFA 1M1EB 3IKTA 3F72A 1W5TA 1FBUA 3Q5FA 1FPQA 1FMWA 3OSFA 4OU0A 5LHHA 1W0TA 2VOPA 2Y2ZA 3DWLE 3FXUA 4B8XA 2ME6A 4QSHA 3DTIA 2AXTC 2P5VA 4IJAA 2Q1ZB 3U9GA 3HIFA 1GV5A 4CUGA 2E36A 2PG4A 3CJTB 5EJCA 5E3NA 4F91B 5K7ZA 3DTEA 2ZJPF 2QLZA 3ZGKA 1TWAJ 4GYGA 1KU2A 2R7DA 3K1MA 1S6LA 3WTUC 4BEHA 1PUEE 1YRNA 5DCFA 2R92J 2CMPA 1NK3P 4EGZA 5DM6F 3J7YJ 5GPAA 1OR7C 4A0YA 5HLTA 2JWTA 3GMEA 4OMZA 4PGGA 2FA5A 1YIJI 2R7VA 1SVMA 4HSTA 4CYDA 1ZAOA 4XOTA 4EM2A 3CO6C 2R4GA 2VJ5A 3T8RA 5AIQA 4XLCA 2E7WA 4D7MA 2WTEA 3C2HA 3S93A 2EZLA 3CQZJ 4AC0A 2MC3A 1B72B 3CZ6A 4CCKA 2E5NA 5GTIC 2FQ3A 3HHHA 3K4LA 3QU3A 4ITVA 4UB8C 3SEQA 3ZMDA 2DBBA 2L9RA 1JUPA 4XMYA 2WA0A 2CW7A 4HX7A 2NVYJ 4IRIA 4F55A 4HQMA 9ANTA 3C2BA 5F04A 1MDMB 5HOOA 2EQRA 2W4SA 3UNGC 5E3LA 1P7IA 3Q0VA 3S3OA 2FF4A 1TNSA 1VQMI 3WGIA 1X3WB 1P4AA 4RAGA 3RDIA 1Z9CA 5F1JA 3S14J 2BW3A 2VXZA 1EA3A 4Y4RA 1ETKA 5CKTA 2LKXA 3WTTC 3L2VA 2A5WA 3JRIA 2H8WA 2W25A 2CFXA 2XUBA 3RKQA 4GYIA 4FE4A 2WY8Q 3BTIA 5EGOA 4B43A 1D3YA 5JR3A 2P7VB 4KA4A 2PMHA 4IHSA 2GBYA 3S1RJ 1SD4A 3IUOA 2QBYA 1OJLA 3HUGA 3CCJI 3W2AA 3G2BA 5AIPA 1R49A 2WAFA 2VN2A 4DGWB 4IHXA 2BHZA 3SDBA 1MW7A 4PFOA 1ZR2A 2L4MA 4YFNF 1FSHA 1QZZA 2NS0A 4RGRA 4G94A 1G4DA 1I3AA 5FKNA 2G9WA 5EF6A 2MABA 3V7CA 5K5RA 3LQRA 4ENKA 3ZP5A 4ZYDA 2RQPA 3E5QA 1WJBA 3OIOA 2JA8J 3TP3A 1ZTRA 4UHTA 3AL0B 4HPQA 2M34A 2E1MC 3EQLF 2RQQA 3K7AJ 2K9NA 3MMYB 4LD5A 1U9NA 4N9HA 4E7JA 1ON2A 1OQYA 2M0MA 5ILUA 2UZKA 1TT5B 1KA8A 2XIGA 1FIAA 1GXPA 1MMGA 3BLYA 2E1OA 2V7FA 3DPTA 1OLTA 3HBLA 3AG1H 3OYGA 1TZLA 2HVQA 1WHUA 2DFIA 2JK3A 5CPRB 2X0LA 4UNOA 4UUSB 1T95A 4E7SA 2BHYA 2ECBA 3R0JA 4BE0A 1TT0A 4KIGA 2YU9J 2CQ7A 5BMZA 3FMQA 3FF5A 4LMYA 2LKPA 5CJ9A 1HKTA 2EPFA 1Y8QB 2FNAA 4L9NA 3BG3A 5C4JJ 2NVQJ 2WBMA 4CH7A 3GXOA 1FIPA 3F8FA 3I58A 5L3GA 1XMKA 3E97A 3BJ6A 3SFIA 1I1SA 1H8AC 3BG7A 4LG3A 3CF5F 4AD9A 1BR1A 4OWRB 1EF4A 4X1EA 5F0FA 3FKJA 1QA6A 1QZEA 3OYEA 1VZ0A 2E5ZA 2DJIA 4IHWA 5GAEJ 3IH4A 5HNFA 3H9QA 1R1UA 3OYAA 1VTNC 3AKZA 3H0DA 3F6OA 2CV1A 3Q0UA 4L5EA 2H6BA 1FMVA 3JRAA 3JRHA 1WKMA 3G6EI 5HDNA 2FBIA 2R7SA 1IUYA 2K02A 2DOFA 2I10A 2JA2A 5ICEA 2DO7A 3HOTA 1DGWY 2DA1A 4FISA 2W48A 4QPQA 2PI0A 2VODA 2IGKA 1YJWI 1R58A 4A3LJ 4F7ZA 3PIOF 1B72A 4ESJA 2JQ7A 2B63J 3ZCOA 3S2WA 1K78A 3S15J 1ZYRF 3LSHA 2JTVA 3S3NA 4HG2A 1R9TJ 4YG2F 3F6VA 4U7BA 1MDMA 2KHMA 1PUFB 2ZNYA 1BOBA 2XAGA 4WX9A 4CCOA 5CVRA 3PO3J 3LA7A 1IRXA 1BW6A 1N78A 2Y31A 3U1DA 5LEJA 4E7KA 2R93J 2WV1A 4M9ZA 3J7AO 1RETA 3H9JA 3TDZC 4RB1A 3FWEA 1RKWA 3T0YA 5HLGA 1S9HA 3EUKL 1OCCH 2BYVE 2PLYA 2B0LA 3EYIA 3F8BA 1GXQA 2W82A 1LEAA 1W5CC 4I7HA 4DYQA 3CCEI 2HI3A 4A3CJ 4A3MJ 4ZYGA 1YOVB 2YU3A 3M1CA 3MQ0A 5KK1A 2OTLI 3GBGA 3TMOA 4XLPF 2JJ7A 1R00A 3HOSA 2DXIA 2BEOA 3HXLA 2CGPA 6PAXA 2RC4A 4XBFA 5KNLA 2XPWA 4BHPA 1POGA 3BWGA 3V42A 2KIFA 4BY7J 2D2WA 2ZB9A 2GXBA 2HOEA 4MGRA 1X1PA 1IXCA 3CUOA 3OYNA 4ENMA 3A0HC 2V9VA 1YS6A 1HKSA 1Z05A 2KRHA 3F8CA 1H88C 1B8IB 1BJAA 1E3PA 5FJ8J 4J00A 1UELB 2RREA 2KKOA 2MSYA 3TO6A 4FX0A 5A2QZ 3ZQLA 4PUSA 1WVRA 1DP7P 3OYJA 2KJCA 5D5VB 4YIIA 1SMYF 1X1CA 3TO7A 3V8KA 1IZ1A 5L3EA 1ZRFA 1RI7A 4J01A 3S8PA 3FXLA 1ZLJA 3SJMA 5IY5H 3ELKA 1GDTA 2NNNA 3Q9SA 1Q1HA 3TKYA 1QVTA 3CDIA 3CCVI 1FJLA 1R36A 2DQRA 2ZXHA 3EYYA 2JZYA 3BTJA 1MMAA 3VFZA 4IHYA 4ENNA 4KNYA 3G1LA 1LJ9A 2R7TA 2HDWA 5DCMB 2NYXA 5EDNA 4BXUA 1JJ6C 4UUSA 3H3UA 4X0GA 4JX6A 2QWWA 3S2DJ 5EEGA 1JGGA 2XB0X 3KYDB 1D8JA 5JI6A 1D5VA 3DKYA 4DIQA 1QU3A 4Y52J 3CCUI 1MBKA 3BZ6A 1JXSA 3BOQA 1NG7A 4I2OA 1MH3A 2DDBA 2FOKA 2CQQA 2GQQA 4PSWA 4IOCF 2CFOA 3BQZA 4PJLA 2VJ4A 4BAYA 1MSEC 3I59B 5FFZA 3OYDA 2CQKA 2CSOA 3HKZA 2L7KA 3VOEA 1S8NA 4XR6A 1R23A 4AVPA 1LQ1A 3MAJA 3FX3A 1IW7F 1WRJA 1FZPB 1LDKB 5DYMA 4WWCA 2NS8A 3TEDA 2M45A 3QOPA 2VXDA 4BDYA 1WH5A 1YQAA 3TGNA 1O3SA 4C2MJ 1ONVA 2WB1A 3WHCA 2OQRA 4U0YA 1IG7A 4KISA 2KLOA 3VODA 3CDLA 3LFKA 4AUXA 2MW8A 1WFXA 1WZ2A 2G7HA 2A3SA 5D8LB 2V79A 2X9DA 3CUQB 4Q5SF 2H1LA 2BXYA 1V3FA 1MJAA 2GAUA 3ABTA 2DAOA 2HYJA 2KZVA 2JA5J 4XSZF 2ZMEC 3HKZN 3BR6A 5C4XJ 4XLNF 1ZG5A 5JHUA 2H1KA 1IN6A 3TBIA 2EFOA 5KAFC 1ZR4A 4XLEA 2OBPA 4UB6C 1A5JA 4HSRA 1IV8A 2TRTA 1B4AA 4PFPA 3LSRA 1LPQA 2LY9A 4PSXA 2DJNA 5IP9J 1BIAA 2O8XA 2IJLA 2QEXI 2WB1N 2DMNA 3FXOA 2E2JJ 5HLHA 5J1UA 2R0QC 3SZGA 3JRCA 1DP3A 5JFRA 3KEQA 1LNWA 5E1WA 4HV6A 1U9OA 1YITI 3CCLI 4NDLA 5A2QK 2KIQA 3DLLF 4G7ZF 5LGUA 3FBIB 3ABLH 3OOPA 5LHGA 2HXOA 1MH4A 2ID6A 4RGSA 5FLXZ 1HW5A 2W1OA 4XRFA 5FD6A 4BHBA 3J7AY 1AU7A 5DDGA 1Y1WJ 1EKEA 3S2HJ 1HC8A 1JI8A 3C7JA 3BTCA 1R6RA 3WGGA 4GGGA 5IPAA 1PVEA 4Y7NJ 3LMMA 2HOAA 4A3DJ 5CLSA 3PNTA 5HS7A 1C0WA 2DMUA 3I0TA 3OR1C 3R60A 4M9SA 4XONA 4CZZA 1VFCA 4LFUA 4CHUA 2VL8A 1YE9A 1HXDA 1BIBA 4HZFA 1AHDP 1HDPA 1B8IA 1UB9A 2ICWG 4BBSJ 1WI3A 2MD0A 4KYWA 5J8FA 1O7FA 2LYCA 2PFBA 3HOZJ 4P9UA 3RQIA 3FDYA 1D0XA 4QWQA 4A3IJ 1YHQI 3KEYA 1J09A 2L02A 2QGUA 4WF2A 4B09A 3SYTA 4ZDPA 3K9TA 3QPTA 3RKWA 1FY7A 4BS9A 2F48A 4MLOA 4KJZA 2RVCA 2V4JC 1X3ZB 1QHGA 1P4XA 4G6QA 3IKVA 5LLQA 3GTOJ 2CRGA 1MBHA 3K1PA 3BC8A 3HPHA 3PNVA 2DI3A 4U88A 1VQ6I 1KONA 1SD6A 4MTEA 1VQ9I 2EIJH 5B5EC 2W7NA 1LUJB 3QP5A 2L7FP 4ZC3A 2STWA 3FZVA 4GO1A 5CYVA 3CMMA 1P92A 3PUBA 1OISA 2M7BA 3QPLA 4AIKA 1EH7A 2LOOA 1LFBA 1RR7A 4HLXA 2QKMB 1JUSA 3I59A 3S32A 2WAEA 2NXNB 2EV5A 4ON0A 2V1DA 5LEKA 1G3TA 4HNTA 1NK2P 5TJJA 4KIBA 4B4CA 2D5VA 4EMSA 2VPRA 2JRTA 1XDUA 2HKOA 2EZHA 1AKHB 1SEUA 2VUMJ 2HZDA 2LBFA 5EG0A 2F5CA 3S17J 4L9JA 4WCGA 4XORA 2ZJRF 5B1AH 1K61A 3CP8A 1H0MA 1H9TA 2V6EA 5FKLA 1BR4A 2KRFA 3NQOA 2A5YB 1SD5A 3W3CA 3F22A 4M6YA 3LSJA 1U5TC 4MTDA 2F5VA 1K6YA 2JSCA 3CC7I 4RS8A 1FC3A 4OMYA 1D1AA 3IL2A 4RBOA 3I5UA 1HQCA 2DTRA 2M9HA 4NBQA 3F21A 2JA6J 3MKLA 4E6KG 1S7EA 3K4BA 2KT0A 2VQLA 2EIMH 1TTYA 2OCCH 5J40A 4RB2C 3CMYA 2E1MB 2LD5A 4BQAA 4JBAA 1T39A 1Z7LA 3OYCA 1W7PA 4R79A 5ILVA 1WJEA 1OYWA 3E6CC 2IRFG 2DU9A 1PP8F 1MSFC 3MKYB 3L2RA 2L9VA 2LLKA 1RRJA 2Q8KA 4UXNA 5M5YJ 4Q47A 2Y0SN 4CYCB 5IP6A 3OV8A 1XGOA 2MC4A 2ZSIB 3MZ8A 3KP5A 1VQLI 4BNCA 1D1CA 2KMUA 1BI3A 3WTZA 2WAQA 2GOMA 4BUPA 2BY2A 4UVBA 1XC5A 5FFXA 3E6BA 4BJ5C 1HLVA 1VQ8I 1YJ9I 2CYYA 4C2TA 3EUHC 1ZGWA 2CQXA 1X2MA 4MNUA 2OQGA 1IRGA 1LFPA 4MO7A 2EFWA 3HOWJ 1JGSA 1ZRCA 1QZYA 3WODF 3KZYA 2PMZN 4XRMA 2X1EA 3LSMA 4YIFA 2LTPA 1FYLA 4NQWB 4U0WA 2JRMA 4KN4X 1QPMA 2WADA 1YIOA 3G71I 1UHSA 3LSIA 1OR7A 3ZRGA 2WAQN 3OYIA 3FHZA 3KP7A 3W2VA 4M6XA 3VYSB 1Z1DA 3AAFA 3H3ZA 1EJ9A 3HOVJ 2LKSA 1IV6A 2PX9A 2O7OA 2I8DA 2GIZA 4Z6YA 2ZCWA 3TW7A 3BPXA 5HVQC 3OY9A 4BACA 5GP9A 5TRDA 1VQ5I 4X6AJ 4I6ZA 3FM3A 1J7KA 3D5RC 2CV0A 1O57A 1KU7A 2CUZA 3C3WA 1W0UA 1DGRM 2VQGA 4I0BA 5CVJA 4F93B 1HOMA 5FGMA 1ULYA 4AU7A 4HF2A 3CCMI 2NNYA 3HZJA 1OYIA 3OR2C 3JRBA 2KISA 2X85A 2BOLA 3IAM2 4KT5C 4PJ0C 2M5WA 2PJPA 1G2HA 5ICGA 4AIHA 2XASA 3GFJA 4CCLA 2K86A 4W1UA 2JVGA 3GFIA 2VC0A 1JKPC 1X4OA 3OIQA 2H8RA 2A69F 1IRZA 3PJRA 2VBWA 2O9LA 1Z6RA 1YW7A 4IOAF 2OAZA 3BJAA 1X4PA 2FOWA 1MMNA 3EETA 1XX5A 4N4NB 2EV6A 5KHDA 3ULQB 1U0JA 1MMDA 4MIMA 2OZ6A 3E6MA 2XGEA 2NAZA 3HTUA 3K1NA 1P9QC 1JJ8C 2EFNA 2DT7B 3CDHA 3JW4A 4CXFA 1X1AA 4QIWN 3FXKA 1UZCA 2DQLA 4I76A 3U21A 4OOIA 5F27A 3WU2C 2VJIA 2M8GX 2IT0A 1IAWA 2P81A 2HTJA 1FP2A 2K3FA 2PN6A 3L2QA 2L9SA 2B7EA 1I5ZA 2L0KA 3JSPA 1Y8RB 4CCMA 1HF0A 4ZYAA 1ODDA 3DKWA 3VYRB 3ONQA 1DPUA 1KU9A 5E20A 1MBJA 4J19A 1MNDA 2V26A 3V7RA 3U2RA 1MGTA 4CA0A 3BG6A 2EFPA 3L2UA 4GCVA 4W97A 4ENJA 1ZG3A 2FQ4A 3E6DA 3FHNA 2LREA 5DUKA 2QSFX 3FXRA 1Y39A 3VDXA 1YO5C 4KT6A 2M3AA 3CMAI 3FK6A 1WWXA 1K6OA 2FNPA 3TDUC 2GXAA 1GVDA 1NG6A 3IH3A 3KZIC 3A01A 3IP4B 4HYEA 3MN2A 3HDDA 2QENA 2IVMA 1GVJA 2IBDA 4DBRA 3F3XA 4IRGA 3LL7A 5L3FA 5J4YA 1CQTA 2DFHA 1CGPA 1R4MB 4HBLA 3RSNA 1FLIA 4L9VA 2X6YA 2M0CA 1MBFA 3DCFA 5CQGA 5J3LA 1Z3XA 1W1WE 2BVLA 2KQRA 4GFBA 3EPZA 4E4HA 2EBIA 3FKIJ 2PJRA 1B59A 3WU1B 2GOXB 4IVNA 2YUSA 2NOGA 2X4HA 2IGMA 1F1ZA 2ZXJA 1BM9A 3OS2A 5FKMA 5E3OA 2XAQA 3I56I 1X58A 1JE8A 2CG4A 2IPQX 4FHTA 2H09A 2Y9ZA 4U0VA 4DOZA 2NOJB 1V4RA 4LG0B 2HNHA 3C18A 3TL4X 1F4KA 2IA2A 4YIRX 2COBA 4EVIA 3VB2A 2W85A 4NQWA 2XPUA 2KP6A 2N8GA 3ZOBA 3OYMA 2F2EA 4FT8A 2ESNA 2HU9A 3OYBA 4S0HB 3ZMSA 4FQGA 2EZKA 1XB4A 3CO7C 1BJZA 5H6QA 2BVMA 1G3WA 2H94A 3DPLC 5HDKA 4CO8A 4BH9A 4EM0B 4KITB 5HODA 1JKQC 2DA7A 3AG4H 3C2GA 3K70C 3OS1A 5IOZA 3SZTA 4PJNA 1T0FC 1XSVA 4AWXB 3ZQHA 4ZJZA 2NS7A 4UUVA 4G12A 4PGHA 5DUIA 3QYBA 1OMIA 1MNEA 1FX7A 3I54A 3HTSB 2ZMEB 1S7OA 2X6WA 1MJ9A 4A3FJ 2E2IJ 2XSDC 2Z16A 2O61A 1JKRC 3K10A 4LK1F 3HSRA 3MFKA 1P6RA 2P4WA 4L9TA 5E3MA 1A36A 5H6RA 4BQNA 3H1CA 5FO5A 3I4NJ 4CZCA 2KFDA 3CJRB 1UG0A 1IN7A 5DTDA 3GFLA 1SVLA 3HHGA 2R7QA 5B66C 2JPBA 4QTRA 3KLOA 4XKCA 1U2WA 2W24A 3REOA 1I6HJ 2F4IA 2QUFA 1JT0A 5BPDA 2FE3A 2K9SA 1MBGA 3FXQA 3K70D 2XAFA 4C9YA 1BW5A 3LWFA 1O7LA 1WI9A 3FXJA 5E18F 2O3FA 4P55A 3V8LA 3GTMJ 2KRCA 2MD5A 1D0YA 2D1HA 4M6VA 4D5CA 1ZQ3P 1YYVA 3DBRB 1V5GA 4XRSA 3A02A 2EFQA 2B9SA 4L5JA 2FRHA 4LIUA 3KP2A 2CW0F 2E2HJ 4UV8A 3QRFF 3JRDA 3NRVA 4P5OA 4MHGA 3HB9A 4IQJA 3FMSA 1RC9A 3MWMA 5DD8A 2JA7J 2LMDA 4ZH4F 3LSPA 5F1RA 1ZRDA 4HV5A 2M8EA 4RM3A 3G3ZA 1XTAA 3BR0A 3BR5A 1X1DA 2VQCA 4O6JA 3GFMA 2BV6A 3DV8A 4RAYA 3O8HA 2XF6A 3H9GA 2DYSH 3AFHA 2F5DA 2X1CA 3DXJF 2DODA 3LFUA 4IPAA 4BU2A 2DA4A 1MZBA 4XKVA 3M9AA 5EZGA 3OIPA 2DK8A 1JUMA 1YW8A 2GA1A 1RUNA 5GADJ 2BGCA 2OU2A 3IC7A 5H20A 1IO2A 1J2XA 1FSEA 3AG2H 5M3MJ 3KLNA 4KMFA 4DBQA 4ZYHA 5M5XJ 4C3IJ 2DN0A 2DMTA 3TOBA 1UCRA 1STZA 4R8HA 4OIPF 2AQEA 1FOYA 4B3XA 1USTA 1R5ID 2VBZA 4Y33A 2A07F 2GLOA 2HFHA 1Z0XA 1HCRA 3E5XA 3HM5A 3I3LA 4O5VA 4A93J 2WC2A 3I4PA 1WCMJ 4XM3A 2L7ZA 3B6AA 3PQJA 2HVSA 4LLLA 3ZQ7A 2FXAA 3MZHA 3OYFA 2JPCA 2LG4A 3K4NA 3I71A 4ZZDA 1A31A 3G1MA 2ISYA 4LGWA 4DYRA 1T6SA 4YFXF 3OWTA 4F3QA 1F5TA 2HQNA 2ZXWH 1B1BA 1WJ5A 4RMNA 4EQQA 5ED4A 1NTCA 1HW2A 1YJNI 2ZSHB 4JK1X 1XSDA 2HOTA 5CVVA 2CQNA 3ERED 1EV7A 4NHJA 2ID3A 4B48A 4II3A 3ZQQA 1BN5A 2LK2A 3K69A 1QO0D 2G0EA 2L9NA 4KN7X 1LE8B 2TDXA 3DU6A 2FUG2 5KCMA 2FJ1A 2DOAA 3GW2A 4A0ZA 4M72A 2QSHX 2OCEA 2M4GA 4DYCA 3NWSA 1TQIA 2L01A 4XLHA 4HW0A 5AONA 5FD5A 3J7ZI 1FOXA 3GZ5A 5J47A 2ELKA 1QBJA 4C30A 2LDUA 1EH6A 3DU5A 4XLFA 2CUFA 3H5NA 3QYEA 4HDVA 1DDNA 3RCOA 2CH0A 4I99C 5J1YA 3DEUA 1U5TB 2ZNZA 3MKZA 3IH2A 1P7JA 1RIOH 2HWVA 1ETOA 3CESA 4XKWA 2CUJA 4HAMA 5D5XB 4XL9A 1DUXC 3PIPF 2ZMEA 2F5FA 4ZTJA 1DPRA 2XVCA 1IXRC 3EUAA 3K4CA 1TW2A 2R7WA 3OYLA 3M8JA 5BQTA 2XB5A 4IX7A 2MYSA 3FBNB 1V55H 2QYOA 3I53A 4YEJA 1N77A 3ASOH 1V54H 2R7FA 5TISC 4RAFA 3ROUA 5ICFA 3ZQIA 2R7ZJ 3WE3A 2YX4A 3ECHA 2ZXIA 3DLAA 1ZG1A 2EIKH 3QODA 1W5SA 2ZFUA 4KUMA 1QNTA 3RQ4A 2FBHA 2VKHA 1ERDA 1PUFA 1W4MA 2FX0A 3ABUA 5E8GA 1BA5A 4IF4A 3GTQJ 1S72I 3ERMA 1D8KA 3GUDA 3DQVC 1GT0C 1ETYA 4LK0F 2GXGA 1X2NA 1U8RA 3I9V2 3P5JA 2OJED 4CICA 2EV0A 3HC7A 1TL8A 3N97A 4IXAA 2V6CA 4ESBA 4XSXF 3JAMZ 1ETWA 3EDPA 3PL8A 2H27A 4WXDA 3RKYA 2OPTA 3W6VA 3RYRA 1IJWC 5F0HA 2M2EA 3VYUB 2L3DA 3A4CA 3T8TA 3GVAA 1OCZH 4JQFA 1TQPA 4C3HJ 4ASNA 3RPUD 2X6OA 5ICCA 2BXZA 5K5QA 1OKRA 2VQHA 1RESA 2JT1A 2DA6A 3CCYA 2EB7A 3KYCB 2HDCA 4KDPA 1WH7A 3G4SI 4PJJA 1K79A 2O03A 4CCJA 2A6EF 5E1ZB 3ZN0A 2ZJ2A 2DLLA 3D0SA 3MEXA 2LVSA 1HA8A 4BE1A 3T1BA 3L2CA 4A3EJ 4Z2YA 2KL4A 2EINH 4HNVA 2Q2EB 3CMEI 3H35A 2R5YB 4HDUA 2RNGA 3PFYA 4MEXF 1BI2A 3CC4I 2JMWA 1RKTA 1S29A 2FBKA 1VF9A 2R7OA 2R3SA 3GCMA 1HKQA 1XCVA 3JTHA 3IWZA 2L2OA 2Y30A 2ZFWA 3KP4A 4G9YA 1L3LA 3SFZA 1RR8C 1OCRH 1APLC 4AM3A 2ADUA 1FBSA 2IGNA 1MBEA 4A69C 5B3SH 1BI0A 4ZZLA 3LAPA 4BXXJ 3QOEA 1WSUA 2XPVA 3RYPA 3ISPA 1IXSB 1G8XA 3HYIA 2QQ9A 3JRGA 3ASNH 3L2WA 1FTZA 2E19A 3WU0A 2GA2A 4PCQA 1GHCA 3GTPJ 5ILSA 4QLCU 1Q1VA 1ETXA 2VT3A 4OAZA 5DCMA 3P7NA 5D6EA 3S1MJ 3HRUA 1A35A 2GWRA 2V9PA 4BYYA 1NH3A 2DT5A 2O6GE 2JVHA 2LH9A 1HBXG 1D5YA 1SVOA 3WGHA 5CVIA 4IHTA 3GYHX 2ME0A 4P1WA 1IC8A 4BL0B 2BY3A 4PK4A 3I55I 4B44A 1ZH5A 3BCAA 2DTZA 3IHUA 1IN5A 5D8KB 4ETSA 2CS3A 2XRNA 2CW8A 1LE8A 1HSJA 2X6XA 1ZGAA 2W84A 2XAHA 1WJDA 4EATA 2HGCA 2WWYA 3L00A 3RTRA 2KDZA 3DTKA 4FCYA 4M3GA 5BNGA 2KPMA 1T2KA 2IA0A 4G8XA 3TP0A 1VQOI 1SANA 2DCEA 2VKDA 2QQ8A 3FXMA 4EJWA 3PNYA 1XS9A 4F52A 1U5TA 3VEPA 2LY2A 1KQ9A 2ESHA 3A03A 3VPRA 4A6DA 2GZWA 3KYLA 4XICA 3LSTA 4Q4ZF 1T08B 4XNFA 4DZPA 5LGTA 3JR9A 1V5FA 2LNBA 2STTA 3CUQA 2Y0SA 5FKOA 2KDOA 3W2WA 1JKOC 3OYHA 3JAMK 1CF7B 1UG2A 2XGXA 4BXFA 2EA2A 3SEZA 5D4RA 5IT9Z 1Y6IA 1Y0UA 2ZKZA 5EZHA 3HOUJ 2E71A 2HQRA 3BG9A 1SD7A 5H2FC 3NAUA 3BG5A 2QBYB 2QZ8A 3OL4A 3GLLA 4ABZA 1XMXA 3QPSA 2A61A 3K2AA 1WJFA 3GTKJ 3DEWA 3CD6I 1U3EM 5C3EJ 1ZN2A 4RDUA 1S3JA 2E7XA 3ZMTA 2RN7A 2PMZA 5HS9A 4B1RA 3K4MA 1T56A 1IDZA 2RKHA 1FEXA 3A0BC 2WV0A 2CUEA 1OCTC 1J5YA 1Y0NA 1VQKI 3DPUA 3LOCA 1ZREA 1KYZA 3HGYA 3V8JA 3W6JB 2J5PA 4LB5A 3E7LA 2NVTJ 1V5EA 1XG1A 2CJJA 2IW5A 3EUHA 2DYRH 2QM3A 3PQKA 3VSLA 3HOYJ 2P5LC 1XD7A 3HSFA 3QU6A 3BY6A 2DMQA 1N25A 3SXYA 5IYCJ 1W36C 3F23A 3HOXJ 2F6CA 2K5CA 5IP7J 1WGXA 3ABKH 3DF8A 4AYBN 2QQAA 4BGDA 5DS9A 1PP7U 2KJBA 4OIQF 3E5UA 3IWFA 1B6AA 5GTHC 3IRQA 4R1HA 1QPIA 1YS7A 1XPXA 2Q2EA 1OPCA 2EWNA 5ERIA 2R5YA 4C2UA 2Z33A 1BC7C 5FKKA 2DFFA 1USSA 1JTXA 1F43A 1WPKA 1F9NA 3RIRA 2F4OB 3KP3A 4OIOF 1E3HA 3M7GA 3BTLA 5JLXA 1R5GA 3BT9A 1JHHA 5DEQA 2M87A 1G59A 2D45A 2IP2A 3KX2A 3ZR8X 1PYVA 4I0AA 1W7PD 1TC3C 1A6QA 1IDYA 1W36D 5BS6A 1X1BA 3BZKA 3LNQA 5TGTA 1FTTA 2E1NA 2HEOA 1IN4A 2FU4A 1KYWA 5LBQA 4G7HF 4JYKA 3U1KA 2BY0A 3DP7A 4ANJA 2X1DA 2R5ZB 2DA3A 1RUOA 4L18B 2COMA 2ETHA 1L0OC 1N75A 1TWFJ 2UXXA 2VE9A 4OAYA 4A3GJ 5GPCA 4DZJA 2MLGA 1K4TA 3O3KA 5FLVA 1Z3YA 2C6YA 2MA3A 3PO2J 2K7LA 2Z1DA 5EYRA 4DW6A 4Q48A 2PBIA 2M7AA 2VC1A 3R6SA 5F08A 4EJOA 3KFWX 1ENHA 1PDNC 1MKMA 2OD5A 4UV9A 2EA4A 3GZ6A 2HDDA 1X19A 1G3YA 2AO9A 2YSRA 4XOPA 1FYKA 4HX8A 5LGNA 2K9MA 2EK5A 2MFZA 5IT9K 1H9GA 4N9IA 3K0LA 2O8KA 1J75A 2BBYA 1K78B 2OTJI 2MH9A 1P4WA 1RPWA 1OFCX 5BPIA 3B6CA 3ZQGA 4V19K 3HG9A 1SFUA 1BR2A 2VIXA 1AKHA 1D1BA 2P7CB 3PSFA 2E34A 5LRSA 3L09A 1SFKA 2TCTA 1O4XA 4V2FA 4I09A 2K85A 4UVCA 4I98B 4ESFA 1Z67A 2ZO4A 3COAC 1UFMA 1RNLA 5E8IA 1I39A 4RB0A 5LHIA 3K6GA 2VE8A 3K4JA 1XCBA 3BR2A 4LJZF 1CF7A 3JREA 4ZDOA 2KZGA 4YFKF 2P6TA 4JX4A 3TOAA 1TWGJ 1XGSA 2HS5A 4FASD 3IV5A 3KCCA 3CCQI 1GLNA 5CQEA 2X51A 1WJAA 4RLQA 1J9IA 5IOYA 2Z99A 2ELJA 4MQVA 1BOAA 2DMPA 5FLMJ 2IS6A 3TO9A 4WXHA 4D0PA 4ZDLA 4XIDA 5LFAA 3WTYC 3K2ZA 5E17F 3ABMH 1YX5A 4UVAA 3H5RA 2R7UA 4JP0A 4NC6A 2NVUB 1ACIA 4XRSG 3QQAA 1BI1A 4ZYEA 1VQNI 3M1EA 4EM1A 2A6TA 4CYCA 1WJCA 3M4OJ 2Y48A 2CWEA 3IAS2 3BP8A 5HDGA 5KAIC 2VB6A 5K7HA 3JTGA 2HR3A 4K2EA 3KP6A 3D1NI 4RAZA 3WG9A 3CJQB 4AVZA 1Z7UA 3CTAA 1IN8A 4QPOA 3ZXSA 3S3MA 2IXSA 3D5SC 3O8GA 4IHVA 3O6BB 2IS2A 3HPGA 3AG3H 1XSXA 1TQMA 1Z21A 3HRTA 2LRDA 4G6DA 4RGXA 3H3VK 3B02A 1IGNA 5JHFA 2VJJA 1B9NA 4A0XA 3OSGA 2V1UA 3WE2A 2L5QA 3FM5A 3NEUA 4RB3C 5DD4A 4IZZA 2OF7A 3PFIA 1VI0A 4XN3A 3QPHA 4G7OF 1GV2A 1O3QA 1HSTA 4M3FA 1FNNA 2V1XA 4M71A 4II2A 1R7JA 4JOMA 1SC7A 4S05A 3RJPA 2NRAC 4M73A 5IT3A 1SAXA 2QSGX 4MFEA 2K3PA 3BR1A 2UXNA 2K4BA 4M3DA 1JT6A 1T0FA 4KICA 4NUBA 2I5UA 4CCNA 1RZ4A 2LY1A 1YG2A 1U8BA 3PSIA 4WXCA 3V4GA 2YX7A 4BJ6C 4HQEA 4NNJA 3SZPA 3ESWB 3CLQA 3HEFA 2M4KA 3PUFA 1OCOH 3CJNA 3I4MJ 4HOBA 3GEZA 2LC2A 3UR3C 1K4SA 4M3BA 3KETA 1I27A 4D9JA 3WTWC 1ETVA 2R5ZA 2XF7A 4RA2A 4P96A 2ECCA 3CCRI 2HYFA 1KQ0A 3ZPLA 3BDDA 4AIDA 1YFHA 2EILH 1FOKA 3E0JB 1KGSA 1Z6TA 1ITYA 4FETA 3CC2I 4C3JJ 4KFCA 3WHBA 1AWCA 3F8MA 1A6IA 2VLAA 2Z5UA 1YTYA 4NC8A 2VBXA 2Y69H 3MVPA 1SAUA 4OIRF 5D6FA 4E7HA 1ORKA 1R1VA 4P9FA 3HGGA 4A5NA 5D5WB 2Q0OA 4V2GA 5D4SA 1I3QJ 1LDJA 1FBQA 3IRRA 4HA8A 2UWMA 3VWBA 2AXLA 4RGUA 3R4KA 3M07A 1JHFA 2L54A 2Y75A 3OS0A 2VKEA 1Z91A 4GDFA 2HQ5A 4M9XA 1Y56A 3SDGA 2CU7A 4CDGA 3FIWA 3KEOA 2FSWA 4LLGF 3UKGA 3GTLJ 3WG7H 3KPHA 3F9KA 3FISA 4GRIA 4RLFA 4AIJA 2OA4A 2NVXJ 1ZK8A 1ZKGA 3BJOA 2A6HF 4U87A 4BQOA 2PQ8A 3BROA 4XKBA 4E70A 2DFEA 3CP2A 2A68F 1QVUA 2HTSA 2QQBA 2J5OA 2XGDA 1LDDA 1T98A 2LSOA 3MCZA 4M3EA 2W00A 1D0ZA 2CO5A 4WK8F 2W57A 3DEEA 1ON1A 2D1VA 3CCSI 1HW1A 1ZHFA 1UHWA 1MIJA 4FE7A 2XSJC 1O3TA 2Z9OA 2GM4A 2G7UA 1LFUP 2MG4A 3OYKA 1KU3A 2HKXA 2ZC2A 2FMYA 3F0CA 2OUMA 1YW9A 3GX4X 5J4VA 5HS8A 2DDAA 4A12A 1AA7A 2JSPA 2LF7A 2JUCA 4GXOA 1SFEA 4E7LA 3RKXA 1FWZA 3H5AA 4M74A 2K9QA 4D7NA 3MD2A 4YRVA 4MFDA 3HRMA 4LB6B 2VOOA 1IRFA 4I01A 1E0EA 2XV4S 1Y1VJ 2DPDA 2HVRA 4IKFA 5FRNA 1P2FA 1I50J 3ZMUA 3W6KB 4HF1A 3AL0C 2P0WA 2ELHA 4IQ4A 4LITA 5JVGF 1E2XA 3LQQA 2H6CA 2MGQA 3DBHB 4A3BJ 4HEA2 4EJTA 1BC8C 4EJVA 3Q9VA 1UHMA 2YR2A 3L9FA 1YX3A 1BL0A 4LG0A 2K9LA 4FX4A 2HZTA 4IRHA 2XRLA 3LA2A 3BCBA 4Y17A 3GLXA 3DFGA 3LSKA 5EEHA 1ZARA 4A3KJ 1MNMC 5M3FJ 4LOCA 1XGMA 3LA3A 4XQFA 5J6XA 1DQUA 1DU0A 2JN6A 3JCUC 4BY1J 5B1BH 4BE2A 3ECOA 2VKVA 2QVOA 4IEJA 2E60A 4N0BA 2Y0MA 5LD2C 2L4AA 2LF8A 3NARA 4PJMA 4BKXA 4DJAA 3CF2A 5HLIA 1UAAA 2P6SA 4HNUA 4UUTA 5DV5A 3KZZA 3QP6A 1G3SA 2MBFA 2XHKA 4EV0A 3L7WA 1FOWA 1U6GA 2HPIA 2LBFB 3RI4A 5BOXA 1T8IA 1EH8A 2K27A 3M8EA 5EG0B 1ZGJA 3RPUA 1OCPA 2XF5A 4HLYA 3D5LA 3G73A 1MD0A 3ZN1A 4DNCA 3ZQFA 4PZJA 2RGVA 3VSKA 2L7MP 4XLAA 2UV1A 1XN7A 1REPC 3K4KA 2XGCA 1S7AA 1NHAA 5JVTA 4BQQA 4EGYA 3S1NJ 4I02A 4A5MA 4BBRJ 3ML6A 2DA2A 5EEAA 3L1PA 5F64A 3A1YA 2K40A 2QA4I 1FYMA 5IYBJ 2JUGA 3QYFA 1J59A 3LAJA 2M1BA 4A2UA 3JSOA 3N4MA 3PM1A 3RPQA 2LP0A 5GAGJ 2Z2SB 1UMQA 2CV2A 4H4KC 1Z77A 2IGOA 3OL3A 3FK7A 2UUZA 3TW6A 5E1XA 1W7PB 2KIMA 1LVKA 1OYYA 4OINF 2RDPA 3SQNA 4HX4A 2XKPA 2DA5A 4ZTFA 4U7DA 2F4MB 3GWZA 1F36A 5DM7F 1SFXA 2HQAA 5IYDJ 4BHCA 2HOSA 3CLOA 4BDZA 4HF0A 2BY1A 3NWTA 4S04A 2DK5A 2VT2A 3J81Z 3M3YJ 1T38A 1LB2A 2VBYA 2HPMA 3DBLB 4L5IA 2EH3A 1X3UA 5FRMA 1XDSA 2F5EA 5F0CA 4F92B 4EJUA 5LRRA 1TWHJ 5CVUA 4KMUX 4D5FA 3GTJJ 3OOUA 4UY8I 4A6EA 2P5KA 4RM2A 5L3CA 5F6FA 1JTYA 3SHFA 1FT9A 1TLHB 2Y9YA 3I64A 4LIVA 2DPUA 3T5XA 3ZMZA 3GZNB 3A2KA 4E7ZA 1E3OC 2OZUA 4YELA 1XMAA 4TV7A 5L3BA 1G6NA 2X48A 2IAIA 2P8TA 4E7IA 2AHQA 4MQ9F 2VPLA 2QKLB 4FTHA 2YS9A 4N4OB 2ACJA 2K4JA
chains in the Genus database with same CATH topology
3P9IA 2XAJA 3J80Z 3GF2A 5K5OA 1R5HA 2FEZA 2XROA 2AS5F 1I1GA 2GIVA 1IF1A 3QAHA 2XKOA 1LEBA 3WTXC 1U78A 3KE2A 3E3VA 1TW3A 4MEYF 4Y15A 2MLKA 3C1DA 2ISZA 5J8CA 2PEXA 1J0RA 1B9MA 3MZYA 3R0AA 1ZLKA 3FMRA 2YPRA 3R61A 3WTSC 1XGNA 1SMTA 3P9CA 2O0YA 3WTVC 5L3DA 1O3RA 3F8NA 4DQ2A 1TNTA 3TQNA 2KIUA 3HSEA 2MH2A 5FB2A 4L0ZB 1TBXA 1QGPA 4LLNA 3BPVA 5K1YA 2M30A 1LVAA 2ZBKA 1QQIA 3P9KA 1FP1D 1AOYA 4Y13A 1BBYA 3M8FA 1R1TA 2EJRA 3V7SA 1WQ2A 2IA1A 1A04A 3CUQC 4CGZA 2BE5F 5FLXK 5KVRA 1YLFA 5D5UB 1KQ8A 2RV8A 4NB5A 3J81K 3HRSA 2Z3YA 2VONA 3ZMVA 3H92A 2E1CA 2HYGD 1K7AA 3O2PE 2FMLA 4L0YB 1I6XA 3GO5A 2RNJA 3B73A 1E17A 4PDKA 3J80K 1MJBA 2DW4A 1R22A 2PMUA 4H0EA 4O3MA 4KIFA 3IKTA 3F72A 1W5TA 1FBUA 3Q5FA 1FPQA 4OU0A 5LHHA 2VOPA 4B8XA 3FXUA 2P5VA 4IJAA 3U9GA 3HIFA 2PG4A 2QLZA 4GYGA 1KU2A 2R7DA 3K1MA 1S6LA 3WTUC 1PUEE 5DCFA 4EGZA 4A0YA 4OMZA 4PGGA 2FA5A 4CYDA 1ZAOA 4EM2A 3CO6C 3T8RA 5AIQA 2E7WA 2WTEA 2MC3A 2FQ3A 3HHHA 3QU3A 3ZMDA 2DBBA 4HX7A 4IRIA 4HQMA 1MDMB 5HOOA 2FF4A 1TNSA 3WGIA 1P4AA 3RDIA 1Z9CA 2VXZA 3WTTC 2W25A 2CFXA 2XUBA 4GYIA 5JR3A 1D3YA 2P7VB 4KA4A 2PMHA 4IHSA 2QBYA 1SD4A 3HUGA 5AIPA 2VN2A 2L4MA 4YFNF 1FSHA 1QZZA 2NS0A 4RGRA 4G94A 1G4DA 2G9WA 3V7CA 5K5RA 3LQRA 4ENKA 3ZP5A 4ZYDA 2RQPA 3E5QA 4UHTA 3EQLF 4LD5A 4N9HA 1ON2A 5ILUA 2UZKA 1KA8A 2XIGA 1GXPA 3DPTA 2DFIA 2X0LA 4UNOA 3R0JA 4KIGA 5BMZA 3FMQA 3FF5A 4LMYA 2LKPA 5CJ9A 1HKTA 2FNAA 4L9NA 3GXOA 3F8FA 3I58A 5L3GA 1XMKA 3E97A 3BJ6A 1I1SA 4AD9A 1R1UA 1VTNC 3F6OA 2H6BA 1WKMA 5HDNA 2FBIA 1IUYA 2K02A 5ICEA 3HOTA 2DO7A 2PI0A 2VODA 1R58A 4F7ZA 4ESJA 3S2WA 1K78A 1ZYRF 2JTVA 4YG2F 3F6VA 4U7BA 1MDMA 2ZNYA 2XAGA 4WX9A 5CVRA 3LA7A 3U1DA 5LEJA 4M9ZA 3J7AO 3TDZC 4RB1A 3FWEA 3T0YA 5HLGA 3EYIA 2BYVE 2PLYA 2B0LA 3F8BA 1GXQA 1LEAA 4I7HA 4ZYGA 2YU3A 3MQ0A 5KK1A 4XLPF 1R00A 3HOSA 2BEOA 2CGPA 6PAXA 2RC4A 4XBFA 4BHPA 3BWGA 2KIFA 2D2WA 2GXBA 2HOEA 4MGRA 1IXCA 3CUOA 4ENMA 2V9VA 1YS6A 1HKSA 1Z05A 3F8CA 1BJAA 2KKOA 3TO6A 4FX0A 5A2QZ 1DP7P 2KJCA 5D5VB 4YIIA 1SMYF 5L3EA 3TO7A 3V8KA 1IZ1A 1ZRFA 1RI7A 1ZLJA 3ELKA 2NNNA 3Q9SA 1Q1HA 3TKYA 1R36A 2DQRA 3EYYA 2JZYA 3VFZA 4ENNA 4KNYA 1LJ9A 5DCMB 2NYXA 4BXUA 3H3UA 2QWWA 5EEGA 1D8JA 5JI6A 1D5VA 3BZ6A 1JXSA 3BOQA 4I2OA 2FOKA 2GQQA 4BAYA 3I59B 5FFZA 2CQKA 2CSOA 3VOEA 1S8NA 1R23A 4AVPA 1LQ1A 3MAJA 3FX3A 1IW7F 1WRJA 1FZPB 1LDKB 5DYMA 4WWCA 2M45A 3QOPA 1YQAA 3TGNA 1O3SA 1ONVA 2OQRA 4U0YA 3VODA 3LFKA 2G7HA 2A3SA 5D8LB 2V79A 3CUQB 4Q5SF 1V3FA 1MJAA 2GAUA 3ABTA 2DAOA 4XSZF 4XLNF 1ZG5A 5JHUA 1IN6A 2EFOA 2OBPA 1B4AA 1BIAA 2O8XA 2IJLA 5HLHA 5JFRA 3KEQA 1LNWA 5E1WA 4HV6A 5A2QK 4G7ZF 5LGUA 3OOPA 5LHGA 4RGSA 5FLXZ 1HW5A 4XRFA 5FD6A 4BHBA 5DDGA 3C7JA 3WGGA 4GGGA 5CLSA 5HS7A 1C0WA 4M9SA 3I0TA 3R60A 4CZZA 4CHUA 4LFUA 1HXDA 1BIBA 4HZFA 1UB9A 4KYWA 5J8FA 1O7FA 2PFBA 4P9UA 4QWQA 2L02A 4WF2A 4B09A 3K9TA 3QPTA 3RKWA 1FY7A 2RVCA 1P4XA 4G6QA 3IKVA 5LLQA 3K1PA 2DI3A 4U88A 1SD6A 4MTEA 3QP5A 2STWA 3FZVA 4GO1A 5CYVA 1P92A 4AIKA 1EH7A 4HLXA 3I59A 2EV5A 4ON0A 2V1DA 5LEKA 1G3TA 5TJJA 4KIBA 4EMSA 2JRTA 1XDUA 2HKOA 2F5CA 4L9JA 4WCGA 1H9TA 1H0MA 2KRFA 3NQOA 2A5YB 1SD5A 3F22A 4M6YA 1U5TC 4MTDA 2JSCA 4RS8A 1FC3A 4OMYA 3IL2A 3I5UA 1HQCA 2DTRA 3F21A 1TTYA 4RB2C 4BQAA 4JBAA 1T39A 1W7PA 4R79A 5ILVA 1OYWA 3E6CC 2IRFG 2DU9A 1PP8F 2Q8KA 4UXNA 4Q47A 3OV8A 1XGOA 3KP5A 4BNCA 1BI3A 3WTZA 4UVBA 5FFXA 3E6BA 2CYYA 4MNUA 2OQGA 1IRGA 2EFWA 1JGSA 1ZRCA 1QZYA 3WODF 3KZYA 4YIFA 1FYLA 4U0WA 4KN4X 1QPMA 1YIOA 1OR7A 3FHZA 3KP7A 4M6XA 1Z1DA 3AAFA 3H3ZA 2ZCWA 5HVQC 3BPXA 5TRDA 3FM3A 1J7KA 1O57A 1KU7A 3C3WA 4I0BA 5CVJA 5FGMA 1ULYA 4HF2A 2NNYA 1OYIA 4KT5C 2M5WA 2PJPA 5ICGA 4AIHA 2XASA 3GFJA 2K86A 3GFIA 2VC0A 2A69F 2VBWA 1Z6RA 1YW7A 2OAZA 3BJAA 3EETA 2EV6A 3ULQB 2OZ6A 3E6MA 2NAZA 3HTUA 3K1NA 2EFNA 3CDHA 3JW4A 4CXFA 2DQLA 4OOIA 2IT0A 1IAWA 2HTJA 1FP2A 2PN6A 1I5ZA 3JSPA 1ODDA 3DKWA 1DPUA 1KU9A 5E20A 3V7RA 3U2RA 1MGTA 2EFPA 4ENJA 4GCVA 1ZG3A 3E6DA 5DUKA 3FXRA 1YO5C 1WWXA 1K6OA 2FNPA 3TDUC 4HYEA 2QENA 2IVMA 1GVJA 3F3XA 4IRGA 5L3FA 1CGPA 4HBLA 1FLIA 4L9VA 1B59A 3WU1B 4IVNA 2X4HA 1F1ZA 2ZXJA 1BM9A 2XAQA 1JE8A 2CG4A 2IPQX 4FHTA 2H09A 4U0VA 1V4RA 4LG0B 3C18A 1F4KA 2IA2A 4EVIA 3VB2A 2W85A 4NQWA 2F2EA 4FT8A 2ESNA 3ZMSA 3CO7C 1XB4A 5H6QA 1G3WA 2H94A 3DPLC 5HDKA 4CO8A 4BH9A 4EM0B 3SZTA 4AWXB 1XSVA 4UUVA 4PGHA 5DUIA 1OMIA 1FX7A 3I54A 3HTSB 2ZMEB 1S7OA 1MJ9A 2O61A 4LK1F 3HSRA 3MFKA 1P6RA 2P4WA 4L9TA 5H6RA 5FO5A 1IN7A 3GFLA 3HHGA 2JPBA 3KLOA 1U2WA 2W24A 3REOA 2QUFA 5BPDA 2FE3A 3FXQA 2XAFA 3LWFA 1O7LA 1WI9A 5E18F 2O3FA 4P55A 3V8LA 2MD5A 2D1HA 1YYVA 2EFQA 4L5JA 2FRHA 3KP2A 2CW0F 4UV8A 3QRFF 3NRVA 4P5OA 4MHGA 3FMSA 3MWMA 5DD8A 4ZH4F 5F1RA 1ZRDA 4HV5A 2M8EA 3G3ZA 4O6JA 3GFMA 2BV6A 3DV8A 4RAYA 2F5DA 3DXJF 4IPAA 1MZBA 3M9AA 2DK8A 1YW8A 2GA1A 1RUNA 2BGCA 5H20A 2OU2A 3IC7A 1J2XA 1FSEA 4KMFA 3KLNA 4ZYHA 3TOBA 1UCRA 1STZA 4R8HA 4OIPF 1USTA 2VBZA 2A07F 2HFHA 3E5XA 4O5VA 2WC2A 3I4PA 3PQJA 4LLLA 3ZQ7A 2FXAA 3MZHA 2JPCA 3I71A 4ZZDA 2ISYA 4LGWA 1T6SA 4YFXF 1F5TA 2HQNA 1B1BA 4EQQA 5ED4A 1HW2A 4JK1X 1XSDA 5CVVA 3ERED 1EV7A 4NHJA 1BN5A 3K69A 1QO0D 4KN7X 2TDXA 3GW2A 4A0ZA 4M72A 1TQIA 2L01A 4HW0A 5AONA 5FD5A 3GZ5A 1QBJA 2LDUA 1EH6A 1DDNA 4HDVA 3DEUA 1U5TB 2ZNZA 1RIOH 2HWVA 4HAMA 5D5XB 1DUXC 2ZMEA 2F5FA 1DPRA 2XVCA 1IXRC 1TW2A 5BQTA 2QYOA 3I53A 2R7FA 3ROUA 5ICFA 3WE3A 2YX4A 3ECHA 1ZG1A 1W5SA 4KUMA 1QNTA 2FBHA 1W4MA 3ABUA 5E8GA 4IF4A 1D8KA 3GUDA 3DQVC 4LK0F 2GXGA 1U8RA 4CICA 2EV0A 3N97A 4IXAA 2V6CA 4ESBA 4XSXF 3JAMZ 3EDPA 2H27A 4WXDA 3RKYA 3RYRA 2L3DA 3T8TA 3GVAA 4JQFA 1TQPA 4ASNA 5ICCA 5K5QA 1OKRA 2JT1A 2EB7A 2HDCA 4KDPA 1K79A 2O03A 2A6EF 5E1ZB 3ZN0A 2ZJ2A 2DLLA 3D0SA 3MEXA 3T1BA 3L2CA 4Z2YA 4HDUA 4MEXF 1BI2A 2FBKA 1S29A 2R3SA 1HKQA 1XCVA 3JTHA 3IWZA 2ZFWA 3KP4A 4G9YA 1L3LA 3SFZA 2ADUA 1FBSA 1BI0A 4ZZLA 3LAPA 1WSUA 3RYPA 3ISPA 1IXSB 3HYIA 2QQ9A 3WU0A 2GA2A 4PCQA 1GHCA 5ILSA 4QLCU 2VT3A 5DCMA 3P7NA 5D6EA 3HRUA 2GWRA 4BYYA 2DT5A 2O6GE 1HBXG 3WGHA 5CVIA 4IHTA 3GYHX 1ZH5A 3IHUA 1IN5A 5D8KB 4ETSA 2XRNA 1HSJA 1ZGAA 2W84A 2XAHA 2HGCA 2WWYA 3L00A 3RTRA 1T2KA 2IA0A 4G8XA 4EJWA 1U5TA 3VEPA 4A6DA 1KQ9A 2ESHA 2GZWA 3LSTA 4Q4ZF 5LGTA 2LNBA 2STTA 3CUQA 3JAMK 1CF7B 2XGXA 2EA2A 5D4RA 5IT9Z 1Y0UA 2ZKZA 2HQRA 1SD7A 2QBYB 2QZ8A 2A61A 1U3EM 1ZN2A 1S3JA 2E7XA 3ZMTA 2RN7A 5HS9A 2RKHA 2WV0A 1J5YA 1ZREA 1KYZA 3V8JA 3W6JB 2J5PA 4LB5A 2IW5A 3EUHA 2QM3A 3PQKA 2P5LC 1XD7A 3HSFA 3QU6A 3BY6A 3SXYA 3F23A 3DF8A 1PP7U 2QQAA 2KJBA 4OIQF 3E5UA 3IWFA 1B6AA 3IRQA 4R1HA 1YS7A 2Q2EA 1OPCA 2EWNA 5ERIA 2Z33A 1BC7C 1USSA 1F9NA 3RIRA 3KP3A 4OIOF 3M7GA 1R5GA 1JHHA 5DEQA 2M87A 2D45A 2IP2A 4I0AA 1W7PD 5BS6A 2E1NA 2HEOA 1IN4A 2FU4A 1KYWA 5LBQA 4G7HF 3DP7A 1RUOA 4L18B 2COMA 2ETHA 1L0OC 2UXXA 2VE9A 2MLGA 3O3KA 2C6YA 2MA3A 2K7LA 4Q48A 2PBIA 2VC1A 3R6SA 4EJOA 3KFWX 1PDNC 1MKMA 2OD5A 4UV9A 2EA4A 3GZ6A 1G3YA 2YSRA 1FYKA 4HX8A 5LGNA 2EK5A 5IT9K 1H9GA 4N9IA 3K0LA 1J75A 2BBYA 1K78B 2MH9A 1P4WA 5BPIA 1SFUA 2P7CB 5LRSA 3L09A 4I09A 4UVCA 4I98B 4ESFA 2ZO4A 3COAC 1UFMA 1RNLA 5E8IA 4RB0A 5LHIA 2VE8A 1XCBA 4LJZF 1CF7A 4YFKF 2P6TA 3TOAA 1XGSA 2HS5A 3KCCA 1J9IA 2Z99A 4MQVA 1BOAA 3TO9A 4WXHA 4D0PA 3WTYC 3K2ZA 5E17F 4UVAA 4ZYEA 1BI1A 3M1EA 4EM1A 2Y48A 2CWEA 3BP8A 5HDGA 3JTGA 2HR3A 4K2EA 3KP6A 4RAZA 3WG9A 1Z7UA 3CTAA 1IN8A 3O6BB 1XSXA 1TQMA 3HRTA 4G6DA 4RGXA 3B02A 1B9NA 4A0XA 2V1UA 3WE2A 3FM5A 3NEUA 4RB3C 5DD4A 3PFIA 4G7OF 3QPHA 1O3QA 1HSTA 1FNNA 2V1XA 4M71A 1R7JA 4S05A 3RJPA 2NRAC 4M73A 5IT3A 1SAXA 2UXNA 2K4BA 4KICA 1T0FA 1RZ4A 1YG2A 4HQEA 4WXCA 3V4GA 2YX7A 3SZPA 3CJNA 4HOBA 3GEZA 3KETA 1I27A 3WTWC 4P96A 2HYFA 1KQ0A 3ZPLA 3BDDA 1YFHA 1FOKA 1KGSA 1Z6TA 4KFCA 1AWCA 3F8MA 2Z5UA 1YTYA 2VBXA 4OIRF 5D6FA 1R1VA 4P9FA 4A5NA 5D5WB 2Q0OA 5D4SA 1LDJA 1FBQA 3IRRA 4HA8A 2UWMA 2AXLA 4RGUA 3R4KA 1JHFA 2L54A 2Y75A 1Z91A 4M9XA 4CDGA 3KEOA 2FSWA 4LLGF 4AIJA 2OA4A 3BJOA 2A6HF 2PQ8A 3BROA 4E70A 2A68F 2HTSA 2QQBA 2J5OA 1LDDA 1T98A 2LSOA 3MCZA 2CO5A 4WK8F 2W57A 1ON1A 2D1VA 1HW1A 1ZHFA 1UHWA 1O3TA 2Z9OA 2G7UA 1KU3A 2HKXA 2FMYA 1YW9A 3GX4X 5HS8A 4A12A 2LF7A 4GXOA 1SFEA 3RKXA 1FWZA 4M74A 3HRMA 4LB6B 2VOOA 1IRFA 4I01A 2XV4S 2DPDA 1P2FA 3ZMUA 3W6KB 4HF1A 2ELHA 1E2XA 3LQQA 2H6CA 4EJTA 1BC8C 4EJVA 3Q9VA 1UHMA 2YR2A 3L9FA 4LG0A 4FX4A 2HZTA 4IRHA 3LA2A 4Y17A 3GLXA 3DFGA 5EEHA 1ZARA 1XGMA 3LA3A 5J6XA 3ECOA 2QVOA 4N0BA 2Y0MA 2L4AA 2LF8A 5HLIA 2P6SA 5DV5A 3KZZA 3QP6A 1G3SA 2MBFA 2XHKA 4EV0A 3L7WA 5BOXA 1U6GA 3RI4A 1EH8A 2K27A 3M8EA 1ZGJA 3RPUA 4HLYA 3D5LA 3G73A 1MD0A 3ZN1A 4DNCA 4PZJA 2RGVA 1XN7A 1REPC 1S7AA 1NHAA 5JVTA 4EGYA 4I02A 4A5MA 3ML6A 5F64A 1FYMA 1J59A 3LAJA 2M1BA 4A2UA 3JSOA 3N4MA 3RPQA 5E1XA 1W7PB 2KIMA 1OYYA 4OINF 2RDPA 3SQNA 4HX4A 2XKPA 4U7DA 3GWZA 1SFXA 4BHCA 3CLOA 4HF0A 4S04A 2DK5A 2VT2A 3J81Z 1T38A 1LB2A 2VBYA 4L5IA 1X3UA 1XDSA 2F5EA 4EJUA 5LRRA 5CVUA 4KMUX 4A6EA 2P5KA 5L3CA 5F6FA 3SHFA 1FT9A 1TLHB 3I64A 2DPUA 3T5XA 3ZMZA 2OZUA 1XMAA 4TV7A 5L3BA 1G6NA 2P8TA 4MQ9F 2ACJA 2K4JA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3P9I A;  2XAJ A;  3J80 Z;  3GF2 A;  5K5O A;  1R5H A;  2FEZ A;  2XRO A;  2AS5 F;  1I1G A;  2GIV A;  1IF1 A;  3QAH A;  2XKO A;  1LEB A;  3WTX C;  1U78 A;  3KE2 A;  3E3V A;  1TW3 A;  4MEY F;  4Y15 A;  2MLK A;  3C1D A;  2ISZ A;  5J8C A;  2PEX A;  1J0R A;  1B9M A;  3MZY A;  3R0A A;  1ZLK A;  3FMR A;  2YPR A;  3R61 A;  3WTS C;  1XGN A;  1SMT A;  3P9C A;  2O0Y A;  3WTV C;  5L3D A;  1O3R A;  3F8N A;  4DQ2 A;  1TNT A;  3TQN A;  2KIU A;  3HSE A;  2MH2 A;  5FB2 A;  4L0Z B;  1TBX A;  1QGP A;  4LLN A;  3BPV A;  5K1Y A;  2M30 A;  1LVA A;  2ZBK A;  1QQI A;  3P9K A;  1FP1 D;  1AOY A;  4Y13 A;  1BBY A;  3M8F A;  1R1T A;  2EJR A;  3V7S A;  1WQ2 A;  2IA1 A;  1A04 A;  3CUQ C;  4CGZ A;  2BE5 F;  5FLX K;  5KVR A;  1YLF A;  5D5U B;  1KQ8 A;  2RV8 A;  4NB5 A;  3J81 K;  3HRS A;  2Z3Y A;  2VON A;  3ZMV A;  3H92 A;  2E1C A;  2HYG D;  1K7A A;  3O2P E;  2FML A;  4L0Y B;  1I6X A;  3GO5 A;  2RNJ A;  3B73 A;  1E17 A;  4PDK A;  3J80 K;  1MJB A;  2DW4 A;  1R22 A;  2PMU A;  4H0E A;  4O3M A;  4KIF A;  3IKT A;  3F72 A;  1W5T A;  1FBU A;  3Q5F A;  1FPQ A;  4OU0 A;  5LHH A;  2VOP A;  4B8X A;  3FXU A;  2P5V A;  4IJA A;  3U9G A;  3HIF A;  2PG4 A;  2QLZ A;  4GYG A;  1KU2 A;  2R7D A;  3K1M A;  1S6L A;  3WTU C;  1PUE E;  5DCF A;  4EGZ A;  4A0Y A;  4OMZ A;  4PGG A;  2FA5 A;  4CYD A;  1ZAO A;  4EM2 A;  3CO6 C;  3T8R A;  5AIQ A;  2E7W A;  2WTE A;  2MC3 A;  2FQ3 A;  3HHH A;  3QU3 A;  3ZMD A;  2DBB A;  4HX7 A;  4IRI A;  4HQM A;  1MDM B;  5HOO A;  2FF4 A;  1TNS A;  3WGI A;  1P4A A;  3RDI A;  1Z9C A;  2VXZ A;  3WTT C;  2W25 A;  2CFX A;  2XUB A;  4GYI A;  5JR3 A;  1D3Y A;  2P7V B;  4KA4 A;  2PMH A;  4IHS A;  2QBY A;  1SD4 A;  3HUG A;  5AIP A;  2VN2 A;  2L4M A;  4YFN F;  1FSH A;  1QZZ A;  2NS0 A;  4RGR A;  4G94 A;  1G4D A;  2G9W A;  3V7C A;  5K5R A;  3LQR A;  4ENK A;  3ZP5 A;  4ZYD A;  2RQP A;  3E5Q A;  4UHT A;  3EQL F;  4LD5 A;  4N9H A;  1ON2 A;  5ILU A;  2UZK A;  1KA8 A;  2XIG A;  1GXP A;  3DPT A;  2DFI A;  2X0L A;  4UNO A;  3R0J A;  4KIG A;  5BMZ A;  3FMQ A;  3FF5 A;  4LMY A;  2LKP A;  5CJ9 A;  1HKT A;  2FNA A;  4L9N A;  3GXO A;  3F8F A;  3I58 A;  5L3G A;  1XMK A;  3E97 A;  3BJ6 A;  1I1S A;  4AD9 A;  1R1U A;  1VTN C;  3F6O A;  2H6B A;  1WKM A;  5HDN A;  2FBI A;  1IUY A;  2K02 A;  5ICE A;  3HOT A;  2DO7 A;  2PI0 A;  2VOD A;  1R58 A;  4F7Z A;  4ESJ A;  3S2W A;  1K78 A;  1ZYR F;  2JTV A;  4YG2 F;  3F6V A;  4U7B A;  1MDM A;  2ZNY A;  2XAG A;  4WX9 A;  5CVR A;  3LA7 A;  3U1D A;  5LEJ A;  4M9Z A;  3J7A O;  3TDZ C;  4RB1 A;  3FWE A;  3T0Y A;  5HLG A;  3EYI A;  2BYV E;  2PLY A;  2B0L A;  3F8B A;  1GXQ A;  1LEA A;  4I7H A;  4ZYG A;  2YU3 A;  3MQ0 A;  5KK1 A;  4XLP F;  1R00 A;  3HOS A;  2BEO A;  2CGP A;  6PAX A;  2RC4 A;  4XBF A;  4BHP A;  3BWG A;  2KIF A;  2D2W A;  2GXB A;  2HOE A;  4MGR A;  1IXC A;  3CUO A;  4ENM A;  2V9V A;  1YS6 A;  1HKS A;  1Z05 A;  3F8C A;  1BJA A;  2KKO A;  3TO6 A;  4FX0 A;  5A2Q Z;  1DP7 P;  2KJC A;  5D5V B;  4YII A;  1SMY F;  5L3E A;  3TO7 A;  3V8K A;  1IZ1 A;  1ZRF A;  1RI7 A;  1ZLJ A;  3ELK A;  2NNN A;  3Q9S A;  1Q1H A;  3TKY A;  1R36 A;  2DQR A;  3EYY A;  2JZY A;  3VFZ A;  4ENN A;  4KNY A;  1LJ9 A;  5DCM B;  2NYX A;  4BXU A;  3H3U A;  2QWW A;  5EEG A;  1D8J A;  5JI6 A;  1D5V A;  3BZ6 A;  1JXS A;  3BOQ A;  4I2O A;  2FOK A;  2GQQ A;  4BAY A;  3I59 B;  5FFZ A;  2CQK A;  2CSO A;  3VOE A;  1S8N A;  1R23 A;  4AVP A;  1LQ1 A;  3MAJ A;  3FX3 A;  1IW7 F;  1WRJ A;  1FZP B;  1LDK B;  5DYM A;  4WWC A;  2M45 A;  3QOP A;  1YQA A;  3TGN A;  1O3S A;  1ONV A;  2OQR A;  4U0Y A;  3VOD A;  3LFK A;  2G7H A;  2A3S A;  5D8L B;  2V79 A;  3CUQ B;  4Q5S F;  1V3F A;  1MJA A;  2GAU A;  3ABT A;  2DAO A;  4XSZ F;  4XLN F;  1ZG5 A;  5JHU A;  1IN6 A;  2EFO A;  2OBP A;  1B4A A;  1BIA A;  2O8X A;  2IJL A;  5HLH A;  5JFR A;  3KEQ A;  1LNW A;  5E1W A;  4HV6 A;  5A2Q K;  4G7Z F;  5LGU A;  3OOP A;  5LHG A;  4RGS A;  5FLX Z;  1HW5 A;  4XRF A;  5FD6 A;  4BHB A;  5DDG A;  3C7J A;  3WGG A;  4GGG A;  5CLS A;  5HS7 A;  1C0W A;  4M9S A;  3I0T A;  3R60 A;  4CZZ A;  4CHU A;  4LFU A;  1HXD A;  1BIB A;  4HZF A;  1UB9 A;  4KYW A;  5J8F A;  1O7F A;  2PFB A;  4P9U A;  4QWQ A;  2L02 A;  4WF2 A;  4B09 A;  3K9T A;  3QPT A;  3RKW A;  1FY7 A;  2RVC A;  1P4X A;  4G6Q A;  3IKV A;  5LLQ A;  3K1P A;  2DI3 A;  4U88 A;  1SD6 A;  4MTE A;  3QP5 A;  2STW A;  3FZV A;  4GO1 A;  5CYV A;  1P92 A;  4AIK A;  1EH7 A;  4HLX A;  3I59 A;  2EV5 A;  4ON0 A;  2V1D A;  5LEK A;  1G3T A;  5TJJ A;  4KIB A;  4EMS A;  2JRT A;  1XDU A;  2HKO A;  2F5C A;  4L9J A;  4WCG A;  1H9T A;  1H0M A;  2KRF A;  3NQO A;  2A5Y B;  1SD5 A;  3F22 A;  4M6Y A;  1U5T C;  4MTD A;  2JSC A;  4RS8 A;  1FC3 A;  4OMY A;  3IL2 A;  3I5U A;  1HQC A;  2DTR A;  3F21 A;  1TTY A;  4RB2 C;  4BQA A;  4JBA A;  1T39 A;  1W7P A;  4R79 A;  5ILV A;  1OYW A;  3E6C C;  2IRF G;  2DU9 A;  1PP8 F;  2Q8K A;  4UXN A;  4Q47 A;  3OV8 A;  1XGO A;  3KP5 A;  4BNC A;  1BI3 A;  3WTZ A;  4UVB A;  5FFX A;  3E6B A;  2CYY A;  4MNU A;  2OQG A;  1IRG A;  2EFW A;  1JGS A;  1ZRC A;  1QZY A;  3WOD F;  3KZY A;  4YIF A;  1FYL A;  4U0W A;  4KN4 X;  1QPM A;  1YIO A;  1OR7 A;  3FHZ A;  3KP7 A;  4M6X A;  1Z1D A;  3AAF A;  3H3Z A;  2ZCW A;  5HVQ C;  3BPX A;  5TRD A;  3FM3 A;  1J7K A;  1O57 A;  1KU7 A;  3C3W A;  4I0B A;  5CVJ A;  5FGM A;  1ULY A;  4HF2 A;  2NNY A;  1OYI A;  4KT5 C;  2M5W A;  2PJP A;  5ICG A;  4AIH A;  2XAS A;  3GFJ A;  2K86 A;  3GFI A;  2VC0 A;  2A69 F;  2VBW A;  1Z6R A;  1YW7 A;  2OAZ A;  3BJA A;  3EET A;  2EV6 A;  3ULQ B;  2OZ6 A;  3E6M A;  2NAZ A;  3HTU A;  3K1N A;  2EFN A;  3CDH A;  3JW4 A;  4CXF A;  2DQL A;  4OOI A;  2IT0 A;  1IAW A;  2HTJ A;  1FP2 A;  2PN6 A;  1I5Z A;  3JSP A;  1ODD A;  3DKW A;  1DPU A;  1KU9 A;  5E20 A;  3V7R A;  3U2R A;  1MGT A;  2EFP A;  4ENJ A;  4GCV A;  1ZG3 A;  3E6D A;  5DUK A;  3FXR A;  1YO5 C;  1WWX A;  1K6O A;  2FNP A;  3TDU C;  4HYE A;  2QEN A;  2IVM A;  1GVJ A;  3F3X A;  4IRG A;  5L3F A;  1CGP A;  4HBL A;  1FLI A;  4L9V A;  1B59 A;  3WU1 B;  4IVN A;  2X4H A;  1F1Z A;  2ZXJ A;  1BM9 A;  2XAQ A;  1JE8 A;  2CG4 A;  2IPQ X;  4FHT A;  2H09 A;  4U0V A;  1V4R A;  4LG0 B;  3C18 A;  1F4K A;  2IA2 A;  4EVI A;  3VB2 A;  2W85 A;  4NQW A;  2F2E A;  4FT8 A;  2ESN A;  3ZMS A;  3CO7 C;  1XB4 A;  5H6Q A;  1G3W A;  2H94 A;  3DPL C;  5HDK A;  4CO8 A;  4BH9 A;  4EM0 B;  3SZT A;  4AWX B;  1XSV A;  4UUV A;  4PGH A;  5DUI A;  1OMI A;  1FX7 A;  3I54 A;  3HTS B;  2ZME B;  1S7O A;  1MJ9 A;  2O61 A;  4LK1 F;  3HSR A;  3MFK A;  1P6R A;  2P4W A;  4L9T A;  5H6R A;  5FO5 A;  1IN7 A;  3GFL A;  3HHG A;  2JPB A;  3KLO A;  1U2W A;  2W24 A;  3REO A;  2QUF A;  5BPD A;  2FE3 A;  3FXQ A;  2XAF A;  3LWF A;  1O7L A;  1WI9 A;  5E18 F;  2O3F A;  4P55 A;  3V8L A;  2MD5 A;  2D1H A;  1YYV A;  2EFQ A;  4L5J A;  2FRH A;  3KP2 A;  2CW0 F;  4UV8 A;  3QRF F;  3NRV A;  4P5O A;  4MHG A;  3FMS A;  3MWM A;  5DD8 A;  4ZH4 F;  5F1R A;  1ZRD A;  4HV5 A;  2M8E A;  3G3Z A;  4O6J A;  3GFM A;  2BV6 A;  3DV8 A;  4RAY A;  2F5D A;  3DXJ F;  4IPA A;  1MZB A;  3M9A A;  2DK8 A;  1YW8 A;  2GA1 A;  1RUN A;  2BGC A;  5H20 A;  2OU2 A;  3IC7 A;  1J2X A;  1FSE A;  4KMF A;  3KLN A;  4ZYH A;  3TOB A;  1UCR A;  1STZ A;  4R8H A;  4OIP F;  1UST A;  2VBZ A;  2A07 F;  2HFH A;  3E5X A;  4O5V A;  2WC2 A;  3I4P A;  3PQJ A;  4LLL A;  3ZQ7 A;  2FXA A;  3MZH A;  2JPC A;  3I71 A;  4ZZD A;  2ISY A;  4LGW A;  1T6S A;  4YFX F;  1F5T A;  2HQN A;  1B1B A;  4EQQ A;  5ED4 A;  1HW2 A;  4JK1 X;  1XSD A;  5CVV A;  3ERE D;  1EV7 A;  4NHJ A;  1BN5 A;  3K69 A;  1QO0 D;  4KN7 X;  2TDX A;  3GW2 A;  4A0Z A;  4M72 A;  1TQI A;  2L01 A;  4HW0 A;  5AON A;  5FD5 A;  3GZ5 A;  1QBJ A;  2LDU A;  1EH6 A;  1DDN A;  4HDV A;  3DEU A;  1U5T B;  2ZNZ A;  1RIO H;  2HWV A;  4HAM A;  5D5X B;  1DUX C;  2ZME A;  2F5F A;  1DPR A;  2XVC A;  1IXR C;  1TW2 A;  5BQT A;  2QYO A;  3I53 A;  2R7F A;  3ROU A;  5ICF A;  3WE3 A;  2YX4 A;  3ECH A;  1ZG1 A;  1W5S A;  4KUM A;  1QNT A;  2FBH A;  1W4M A;  3ABU A;  5E8G A;  4IF4 A;  1D8K A;  3GUD A;  3DQV C;  4LK0 F;  2GXG A;  1U8R A;  4CIC A;  2EV0 A;  3N97 A;  4IXA A;  2V6C A;  4ESB A;  4XSX F;  3JAM Z;  3EDP A;  2H27 A;  4WXD A;  3RKY A;  3RYR A;  2L3D A;  3T8T A;  3GVA A;  4JQF A;  1TQP A;  4ASN A;  5ICC A;  5K5Q A;  1OKR A;  2JT1 A;  2EB7 A;  2HDC A;  4KDP A;  1K79 A;  2O03 A;  2A6E F;  5E1Z B;  3ZN0 A;  2ZJ2 A;  2DLL A;  3D0S A;  3MEX A;  3T1B A;  3L2C A;  4Z2Y A;  4HDU A;  4MEX F;  1BI2 A;  2FBK A;  1S29 A;  2R3S A;  1HKQ A;  1XCV A;  3JTH A;  3IWZ A;  2ZFW A;  3KP4 A;  4G9Y A;  1L3L A;  3SFZ A;  2ADU A;  1FBS A;  1BI0 A;  4ZZL A;  3LAP A;  1WSU A;  3RYP A;  3ISP A;  1IXS B;  3HYI A;  2QQ9 A;  3WU0 A;  2GA2 A;  4PCQ A;  1GHC A;  5ILS A;  4QLC U;  2VT3 A;  5DCM A;  3P7N A;  5D6E A;  3HRU A;  2GWR A;  4BYY A;  2DT5 A;  2O6G E;  1HBX G;  3WGH A;  5CVI A;  4IHT A;  3GYH X;  1ZH5 A;  3IHU A;  1IN5 A;  5D8K B;  4ETS A;  2XRN A;  1HSJ A;  1ZGA A;  2W84 A;  2XAH A;  2HGC A;  2WWY A;  3L00 A;  3RTR A;  1T2K A;  2IA0 A;  4G8X A;  4EJW A;  1U5T A;  3VEP A;  4A6D A;  1KQ9 A;  2ESH A;  2GZW A;  3LST A;  4Q4Z F;  5LGT A;  2LNB A;  2STT A;  3CUQ A;  3JAM K;  1CF7 B;  2XGX A;  2EA2 A;  5D4R A;  5IT9 Z;  1Y0U A;  2ZKZ A;  2HQR A;  1SD7 A;  2QBY B;  2QZ8 A;  2A61 A;  1U3E M;  1ZN2 A;  1S3J A;  2E7X A;  3ZMT A;  2RN7 A;  5HS9 A;  2RKH A;  2WV0 A;  1J5Y A;  1ZRE A;  1KYZ A;  3V8J A;  3W6J B;  2J5P A;  4LB5 A;  2IW5 A;  3EUH A;  2QM3 A;  3PQK A;  2P5L C;  1XD7 A;  3HSF A;  3QU6 A;  3BY6 A;  3SXY A;  3F23 A;  3DF8 A;  1PP7 U;  2QQA A;  2KJB A;  4OIQ F;  3E5U A;  3IWF A;  1B6A A;  3IRQ A;  4R1H A;  1YS7 A;  2Q2E A;  1OPC A;  2EWN A;  5ERI A;  2Z33 A;  1BC7 C;  1USS A;  1F9N A;  3RIR A;  3KP3 A;  4OIO F;  3M7G A;  1R5G A;  1JHH A;  5DEQ A;  2M87 A;  2D45 A;  2IP2 A;  4I0A A;  1W7P D;  5BS6 A;  2E1N A;  2HEO A;  1IN4 A;  2FU4 A;  1KYW A;  5LBQ A;  4G7H F;  3DP7 A;  1RUO A;  4L18 B;  2COM A;  2ETH A;  1L0O C;  2UXX A;  2VE9 A;  2MLG A;  3O3K A;  2C6Y A;  2MA3 A;  2K7L A;  4Q48 A;  2PBI A;  2VC1 A;  3R6S A;  4EJO A;  3KFW X;  1PDN C;  1MKM A;  2OD5 A;  4UV9 A;  2EA4 A;  3GZ6 A;  1G3Y A;  2YSR A;  1FYK A;  4HX8 A;  5LGN A;  2EK5 A;  5IT9 K;  1H9G A;  4N9I A;  3K0L A;  1J75 A;  2BBY A;  1K78 B;  2MH9 A;  1P4W A;  5BPI A;  1SFU A;  2P7C B;  5LRS A;  3L09 A;  4I09 A;  4UVC A;  4I98 B;  4ESF A;  2ZO4 A;  3COA C;  1UFM A;  1RNL A;  5E8I A;  4RB0 A;  5LHI A;  2VE8 A;  1XCB A;  4LJZ F;  1CF7 A;  4YFK F;  2P6T A;  3TOA A;  1XGS A;  2HS5 A;  3KCC A;  1J9I A;  2Z99 A;  4MQV A;  1BOA A;  3TO9 A;  4WXH A;  4D0P A;  3WTY C;  3K2Z A;  5E17 F;  4UVA A;  4ZYE A;  1BI1 A;  3M1E A;  4EM1 A;  2Y48 A;  2CWE A;  3BP8 A;  5HDG A;  3JTG A;  2HR3 A;  4K2E A;  3KP6 A;  4RAZ A;  3WG9 A;  1Z7U A;  3CTA A;  1IN8 A;  3O6B B;  1XSX A;  1TQM A;  3HRT A;  4G6D A;  4RGX A;  3B02 A;  1B9N A;  4A0X A;  2V1U A;  3WE2 A;  3FM5 A;  3NEU A;  4RB3 C;  5DD4 A;  3PFI A;  4G7O F;  3QPH A;  1O3Q A;  1HST A;  1FNN A;  2V1X A;  4M71 A;  1R7J A;  4S05 A;  3RJP A;  2NRA C;  4M73 A;  5IT3 A;  1SAX A;  2UXN A;  2K4B A;  4KIC A;  1T0F A;  1RZ4 A;  1YG2 A;  4HQE A;  4WXC A;  3V4G A;  2YX7 A;  3SZP A;  3CJN A;  4HOB A;  3GEZ A;  3KET A;  1I27 A;  3WTW C;  4P96 A;  2HYF A;  1KQ0 A;  3ZPL A;  3BDD A;  1YFH A;  1FOK A;  1KGS A;  1Z6T A;  4KFC A;  1AWC A;  3F8M A;  2Z5U A;  1YTY A;  2VBX A;  4OIR F;  5D6F A;  1R1V A;  4P9F A;  4A5N A;  5D5W B;  2Q0O A;  5D4S A;  1LDJ A;  1FBQ A;  3IRR A;  4HA8 A;  2UWM A;  2AXL A;  4RGU A;  3R4K A;  1JHF A;  2L54 A;  2Y75 A;  1Z91 A;  4M9X A;  4CDG A;  3KEO A;  2FSW A;  4LLG F;  4AIJ A;  2OA4 A;  3BJO A;  2A6H F;  2PQ8 A;  3BRO A;  4E70 A;  2A68 F;  2HTS A;  2QQB A;  2J5O A;  1LDD A;  1T98 A;  2LSO A;  3MCZ A;  2CO5 A;  4WK8 F;  2W57 A;  1ON1 A;  2D1V A;  1HW1 A;  1ZHF A;  1UHW A;  1O3T A;  2Z9O A;  2G7U A;  1KU3 A;  2HKX A;  2FMY A;  1YW9 A;  3GX4 X;  5HS8 A;  4A12 A;  2LF7 A;  4GXO A;  1SFE A;  3RKX A;  1FWZ A;  4M74 A;  3HRM A;  4LB6 B;  2VOO A;  1IRF A;  4I01 A;  2XV4 S;  2DPD A;  1P2F A;  3ZMU A;  3W6K B;  4HF1 A;  2ELH A;  1E2X A;  3LQQ A;  2H6C A;  4EJT A;  1BC8 C;  4EJV A;  3Q9V A;  1UHM A;  2YR2 A;  3L9F A;  4LG0 A;  4FX4 A;  2HZT A;  4IRH A;  3LA2 A;  4Y17 A;  3GLX A;  3DFG A;  5EEH A;  1ZAR A;  1XGM A;  3LA3 A;  5J6X A;  3ECO A;  2QVO A;  4N0B A;  2Y0M A;  2L4A A;  2LF8 A;  5HLI A;  2P6S A;  5DV5 A;  3KZZ A;  3QP6 A;  1G3S A;  2MBF A;  2XHK A;  4EV0 A;  3L7W A;  5BOX A;  1U6G A;  3RI4 A;  1EH8 A;  2K27 A;  3M8E A;  1ZGJ A;  3RPU A;  4HLY A;  3D5L A;  3G73 A;  1MD0 A;  3ZN1 A;  4DNC A;  4PZJ A;  2RGV A;  1XN7 A;  1REP C;  1S7A A;  1NHA A;  5JVT A;  4EGY A;  4I02 A;  4A5M A;  3ML6 A;  5F64 A;  1FYM A;  1J59 A;  3LAJ A;  2M1B A;  4A2U A;  3JSO A;  3N4M A;  3RPQ A;  5E1X A;  1W7P B;  2KIM A;  1OYY A;  4OIN F;  2RDP A;  3SQN A;  4HX4 A;  2XKP A;  4U7D A;  3GWZ A;  1SFX A;  4BHC A;  3CLO A;  4HF0 A;  4S04 A;  2DK5 A;  2VT2 A;  3J81 Z;  1T38 A;  1LB2 A;  2VBY A;  4L5I A;  1X3U A;  1XDS A;  2F5E A;  4EJU A;  5LRR A;  5CVU A;  4KMU X;  4A6E A;  2P5K A;  5L3C A;  5F6F A;  3SHF A;  1FT9 A;  1TLH B;  3I64 A;  2DPU A;  3T5X A;  3ZMZ A;  2OZU A;  1XMA A;  4TV7 A;  5L3B A;  1G6N A;  2P8T A;  4MQ9 F;  2ACJ A;  2K4J A; 
#chains in the Genus database with same CATH topology
 3P9I A;  2ZJQ F;  3BR3 A;  4IO9 F;  2XAJ A;  3J80 Z;  3BZC A;  3GF2 A;  2V1N A;  1TWC J;  5K5O A;  4BEH B;  1YRN B;  1R5H A;  2FEZ A;  2IS4 A;  2DOE A;  1YI2 I;  2O5R A;  5JLW A;  5HNH A;  2XRO A;  2AS5 F;  1I1G A;  2GIV A;  4NC7 A;  1IF1 A;  3QAH A;  2XKO A;  1LEB A;  2IS1 A;  3WTX C;  2OV7 A;  4HRI A;  3H36 A;  1U78 A;  3H0G J;  4XN0 A;  1QHH D;  3ZQC A;  3KE2 A;  1DU6 A;  1LKX A;  1VND A;  2R7X A;  3E3V A;  1TW3 A;  4MEY F;  4IL6 C;  4Y15 A;  1R71 A;  3QWL A;  5M5W J;  2MLK A;  2QCO A;  2FD5 A;  3C1D A;  2ISZ A;  5FRO A;  5J8C A;  1T33 A;  2PEX A;  1J0R A;  1B9M A;  3MZY A;  3R0A A;  3RZD J;  1ZLK A;  2OC6 A;  1VQ4 I;  1UJ8 A;  3FMR A;  2YPR A;  3R61 A;  3MKW B;  3WTS C;  4B3A A;  1IUF A;  2XC7 A;  1XGN A;  1SMT A;  3S1Q J;  1GUU A;  1K83 J;  3P9C A;  2O0Y A;  3N05 A;  3WTV C;  2BW3 B;  1VQ7 I;  3VYT B;  2BZT A;  5L3D A;  1ZEL A;  2WY7 Q;  1SFO J;  5K7F A;  3OMY A;  1O3R A;  3F8N A;  4DQ2 A;  1TP4 A;  1TNT A;  4B47 A;  3TQN A;  5J1R A;  2KIU A;  3S16 J;  2EZI A;  2VAS A;  3HSE A;  2MH2 A;  5FB2 A;  4L0Z B;  1TBX A;  5GAH J;  1QGP A;  2E35 A;  5EGO B;  1H89 C;  4LLN A;  3BPV A;  4JX5 A;  3Q0W A;  4Y3O A;  5K1Y A;  5E79 C;  2M30 A;  2A05 A;  1LVA A;  2RAE A;  2ZBK A;  3HUG B;  1QQI A;  3P9K A;  4AYB A;  3HL2 A;  1FP1 D;  2LR8 A;  1AOY A;  4Y13 A;  1VQP I;  1HDD C;  1BBY A;  1ETQ A;  3M8F A;  1R1T A;  2EJR A;  3Q3S A;  3V7S A;  1WQ2 A;  2IA1 A;  1A04 A;  5C44 J;  3JRF A;  3CUQ C;  4CGZ A;  2BE5 F;  5FLX K;  5KVR A;  1YLF A;  5D5U B;  1KQ8 A;  2RV8 A;  4NB5 A;  2R7R A;  3J81 K;  2VI6 A;  3HRS A;  2Z3Y A;  2QF7 A;  2HXI A;  2VON A;  3ZMV A;  3X2Q H;  4XK4 A;  3E1S A;  2AQF A;  3H92 A;  2E1C A;  2HYG D;  3A01 B;  1QRY A;  1K7A A;  3O2P E;  2FML A;  1S5L C;  4L0Y B;  2DT6 A;  1I6X A;  3G1O A;  1R4N B;  3GO5 A;  2RNJ A;  1MMS A;  2IEK A;  4EEF G;  3RZO J;  3B73 A;  2XAU A;  1E17 A;  4PDK A;  3GTG J;  4G6T B;  3J80 K;  4A3J J;  3KIO A;  4D1Q A;  2LFB A;  2XDV A;  1MJB A;  2DW4 A;  1PJR A;  1R22 A;  3HJE A;  2PMU A;  2V9K A;  3DKX A;  3LSG A;  1KZH A;  4BJT A;  4H0E A;  4CSW A;  2PJR B;  4O3M A;  3BQY A;  4KIF A;  1M1E B;  3IKT A;  3F72 A;  1W5T A;  1FBU A;  3Q5F A;  1FPQ A;  1FMW A;  3OSF A;  4OU0 A;  5LHH A;  1W0T A;  2VOP A;  2Y2Z A;  3DWL E;  3FXU A;  4B8X A;  2ME6 A;  4QSH A;  3DTI A;  2AXT C;  2P5V A;  4IJA A;  2Q1Z B;  3U9G A;  3HIF A;  1GV5 A;  4CUG A;  2E36 A;  2PG4 A;  3CJT B;  5EJC A;  5E3N A;  4F91 B;  5K7Z A;  3DTE A;  2ZJP F;  2QLZ A;  3ZGK A;  1TWA J;  4GYG A;  1KU2 A;  2R7D A;  3K1M A;  1S6L A;  3WTU C;  4BEH A;  1PUE E;  1YRN A;  5DCF A;  2R92 J;  2CMP A;  1NK3 P;  4EGZ A;  5DM6 F;  3J7Y J;  5GPA A;  1OR7 C;  4A0Y A;  5HLT A;  2JWT A;  3GME A;  4OMZ A;  4PGG A;  2FA5 A;  1YIJ I;  2R7V A;  1SVM A;  4HST A;  4CYD A;  1ZAO A;  4XOT A;  4EM2 A;  3CO6 C;  2R4G A;  2VJ5 A;  3T8R A;  5AIQ A;  4XLC A;  2E7W A;  4D7M A;  2WTE A;  3C2H A;  3S93 A;  2EZL A;  3CQZ J;  4AC0 A;  2MC3 A;  1B72 B;  3CZ6 A;  4CCK A;  2E5N A;  5GTI C;  2FQ3 A;  3HHH A;  3K4L A;  3QU3 A;  4ITV A;  4UB8 C;  3SEQ A;  3ZMD A;  2DBB A;  2L9R A;  1JUP A;  4XMY A;  2WA0 A;  2CW7 A;  4HX7 A;  2NVY J;  4IRI A;  4F55 A;  4HQM A;  9ANT A;  3C2B A;  5F04 A;  1MDM B;  5HOO A;  2EQR A;  2W4S A;  3UNG C;  5E3L A;  1P7I A;  3Q0V A;  3S3O A;  2FF4 A;  1TNS A;  1VQM I;  3WGI A;  1X3W B;  1P4A A;  4RAG A;  3RDI A;  1Z9C A;  5F1J A;  3S14 J;  2BW3 A;  2VXZ A;  1EA3 A;  4Y4R A;  1ETK A;  5CKT A;  2LKX A;  3WTT C;  3L2V A;  2A5W A;  3JRI A;  2H8W A;  2W25 A;  2CFX A;  2XUB A;  3RKQ A;  4GYI A;  4FE4 A;  2WY8 Q;  3BTI A;  5EGO A;  4B43 A;  1D3Y A;  5JR3 A;  2P7V B;  4KA4 A;  2PMH A;  4IHS A;  2GBY A;  3S1R J;  1SD4 A;  3IUO A;  2QBY A;  1OJL A;  3HUG A;  3CCJ I;  3W2A A;  3G2B A;  5AIP A;  1R49 A;  2WAF A;  2VN2 A;  4DGW B;  4IHX A;  2BHZ A;  3SDB A;  1MW7 A;  4PFO A;  1ZR2 A;  2L4M A;  4YFN F;  1FSH A;  1QZZ A;  2NS0 A;  4RGR A;  4G94 A;  1G4D A;  1I3A A;  5FKN A;  2G9W A;  5EF6 A;  2MAB A;  3V7C A;  5K5R A;  3LQR A;  4ENK A;  3ZP5 A;  4ZYD A;  2RQP A;  3E5Q A;  1WJB A;  3OIO A;  2JA8 J;  3TP3 A;  1ZTR A;  4UHT A;  3AL0 B;  4HPQ A;  2M34 A;  2E1M C;  3EQL F;  2RQQ A;  3K7A J;  2K9N A;  3MMY B;  4LD5 A;  1U9N A;  4N9H A;  4E7J A;  1ON2 A;  1OQY A;  2M0M A;  5ILU A;  2UZK A;  1TT5 B;  1KA8 A;  2XIG A;  1FIA A;  1GXP A;  1MMG A;  3BLY A;  2E1O A;  2V7F A;  3DPT A;  1OLT A;  3HBL A;  3AG1 H;  3OYG A;  1TZL A;  2HVQ A;  1WHU A;  2DFI A;  2JK3 A;  5CPR B;  2X0L A;  4UNO A;  4UUS B;  1T95 A;  4E7S A;  2BHY A;  2ECB A;  3R0J A;  4BE0 A;  1TT0 A;  4KIG A;  2YU9 J;  2CQ7 A;  5BMZ A;  3FMQ A;  3FF5 A;  4LMY A;  2LKP A;  5CJ9 A;  1HKT A;  2EPF A;  1Y8Q B;  2FNA A;  4L9N A;  3BG3 A;  5C4J J;  2NVQ J;  2WBM A;  4CH7 A;  3GXO A;  1FIP A;  3F8F A;  3I58 A;  5L3G A;  1XMK A;  3E97 A;  3BJ6 A;  3SFI A;  1I1S A;  1H8A C;  3BG7 A;  4LG3 A;  3CF5 F;  4AD9 A;  1BR1 A;  4OWR B;  1EF4 A;  4X1E A;  5F0F A;  3FKJ A;  1QA6 A;  1QZE A;  3OYE A;  1VZ0 A;  2E5Z A;  2DJI A;  4IHW A;  5GAE J;  3IH4 A;  5HNF A;  3H9Q A;  1R1U A;  3OYA A;  1VTN C;  3AKZ A;  3H0D A;  3F6O A;  2CV1 A;  3Q0U A;  4L5E A;  2H6B A;  1FMV A;  3JRA A;  3JRH A;  1WKM A;  3G6E I;  5HDN A;  2FBI A;  2R7S A;  1IUY A;  2K02 A;  2DOF A;  2I10 A;  2JA2 A;  5ICE A;  2DO7 A;  3HOT A;  1DGW Y;  2DA1 A;  4FIS A;  2W48 A;  4QPQ A;  2PI0 A;  2VOD A;  2IGK A;  1YJW I;  1R58 A;  4A3L J;  4F7Z A;  3PIO F;  1B72 A;  4ESJ A;  2JQ7 A;  2B63 J;  3ZCO A;  3S2W A;  1K78 A;  3S15 J;  1ZYR F;  3LSH A;  2JTV A;  3S3N A;  4HG2 A;  1R9T J;  4YG2 F;  3F6V A;  4U7B A;  1MDM A;  2KHM A;  1PUF B;  2ZNY A;  1BOB A;  2XAG A;  4WX9 A;  4CCO A;  5CVR A;  3PO3 J;  3LA7 A;  1IRX A;  1BW6 A;  1N78 A;  2Y31 A;  3U1D A;  5LEJ A;  4E7K A;  2R93 J;  2WV1 A;  4M9Z A;  3J7A O;  1RET A;  3H9J A;  3TDZ C;  4RB1 A;  3FWE A;  1RKW A;  3T0Y A;  5HLG A;  1S9H A;  3EUK L;  1OCC H;  2BYV E;  2PLY A;  2B0L A;  3EYI A;  3F8B A;  1GXQ A;  2W82 A;  1LEA A;  1W5C C;  4I7H A;  4DYQ A;  3CCE I;  2HI3 A;  4A3C J;  4A3M J;  4ZYG A;  1YOV B;  2YU3 A;  3M1C A;  3MQ0 A;  5KK1 A;  2OTL I;  3GBG A;  3TMO A;  4XLP F;  2JJ7 A;  1R00 A;  3HOS A;  2DXI A;  2BEO A;  3HXL A;  2CGP A;  6PAX A;  2RC4 A;  4XBF A;  5KNL A;  2XPW A;  4BHP A;  1POG A;  3BWG A;  3V42 A;  2KIF A;  4BY7 J;  2D2W A;  2ZB9 A;  2GXB A;  2HOE A;  4MGR A;  1X1P A;  1IXC A;  3CUO A;  3OYN A;  4ENM A;  3A0H C;  2V9V A;  1YS6 A;  1HKS A;  1Z05 A;  2KRH A;  3F8C A;  1H88 C;  1B8I B;  1BJA A;  1E3P A;  5FJ8 J;  4J00 A;  1UEL B;  2RRE A;  2KKO A;  2MSY A;  3TO6 A;  4FX0 A;  5A2Q Z;  3ZQL A;  4PUS A;  1WVR A;  1DP7 P;  3OYJ A;  2KJC A;  5D5V B;  4YII A;  1SMY F;  1X1C A;  3TO7 A;  3V8K A;  1IZ1 A;  5L3E A;  1ZRF A;  1RI7 A;  4J01 A;  3S8P A;  3FXL A;  1ZLJ A;  3SJM A;  5IY5 H;  3ELK A;  1GDT A;  2NNN A;  3Q9S A;  1Q1H A;  3TKY A;  1QVT A;  3CDI A;  3CCV I;  1FJL A;  1R36 A;  2DQR A;  2ZXH A;  3EYY A;  2JZY A;  3BTJ A;  1MMA A;  3VFZ A;  4IHY A;  4ENN A;  4KNY A;  3G1L A;  1LJ9 A;  2R7T A;  2HDW A;  5DCM B;  2NYX A;  5EDN A;  4BXU A;  1JJ6 C;  4UUS A;  3H3U A;  4X0G A;  4JX6 A;  2QWW A;  3S2D J;  5EEG A;  1JGG A;  2XB0 X;  3KYD B;  1D8J A;  5JI6 A;  1D5V A;  3DKY A;  4DIQ A;  1QU3 A;  4Y52 J;  3CCU I;  1MBK A;  3BZ6 A;  1JXS A;  3BOQ A;  1NG7 A;  4I2O A;  1MH3 A;  2DDB A;  2FOK A;  2CQQ A;  2GQQ A;  4PSW A;  4IOC F;  2CFO A;  3BQZ A;  4PJL A;  2VJ4 A;  4BAY A;  1MSE C;  3I59 B;  5FFZ A;  3OYD A;  2CQK A;  2CSO A;  3HKZ A;  2L7K A;  3VOE A;  1S8N A;  4XR6 A;  1R23 A;  4AVP A;  1LQ1 A;  3MAJ A;  3FX3 A;  1IW7 F;  1WRJ A;  1FZP B;  1LDK B;  5DYM A;  4WWC A;  2NS8 A;  3TED A;  2M45 A;  3QOP A;  2VXD A;  4BDY A;  1WH5 A;  1YQA A;  3TGN A;  1O3S A;  4C2M J;  1ONV A;  2WB1 A;  3WHC A;  2OQR A;  4U0Y A;  1IG7 A;  4KIS A;  2KLO A;  3VOD A;  3CDL A;  3LFK A;  4AUX A;  2MW8 A;  1WFX A;  1WZ2 A;  2G7H A;  2A3S A;  5D8L B;  2V79 A;  2X9D A;  3CUQ B;  4Q5S F;  2H1L A;  2BXY A;  1V3F A;  1MJA A;  2GAU A;  3ABT A;  2DAO A;  2HYJ A;  2KZV A;  2JA5 J;  4XSZ F;  2ZME C;  3HKZ N;  3BR6 A;  5C4X J;  4XLN F;  1ZG5 A;  5JHU A;  2H1K A;  1IN6 A;  3TBI A;  2EFO A;  5KAF C;  1ZR4 A;  4XLE A;  2OBP A;  4UB6 C;  1A5J A;  4HSR A;  1IV8 A;  2TRT A;  1B4A A;  4PFP A;  3LSR A;  1LPQ A;  2LY9 A;  4PSX A;  2DJN A;  5IP9 J;  1BIA A;  2O8X A;  2IJL A;  2QEX I;  2WB1 N;  2DMN A;  3FXO A;  2E2J J;  5HLH A;  5J1U A;  2R0Q C;  3SZG A;  3JRC A;  1DP3 A;  5JFR A;  3KEQ A;  1LNW A;  5E1W A;  4HV6 A;  1U9O A;  1YIT I;  3CCL I;  4NDL A;  5A2Q K;  2KIQ A;  3DLL F;  4G7Z F;  5LGU A;  3FBI B;  3ABL H;  3OOP A;  5LHG A;  2HXO A;  1MH4 A;  2ID6 A;  4RGS A;  5FLX Z;  1HW5 A;  2W1O A;  4XRF A;  5FD6 A;  4BHB A;  3J7A Y;  1AU7 A;  5DDG A;  1Y1W J;  1EKE A;  3S2H J;  1HC8 A;  1JI8 A;  3C7J A;  3BTC A;  1R6R A;  3WGG A;  4GGG A;  5IPA A;  1PVE A;  4Y7N J;  3LMM A;  2HOA A;  4A3D J;  5CLS A;  3PNT A;  5HS7 A;  1C0W A;  2DMU A;  3I0T A;  3OR1 C;  3R60 A;  4M9S A;  4XON A;  4CZZ A;  1VFC A;  4LFU A;  4CHU A;  2VL8 A;  1YE9 A;  1HXD A;  1BIB A;  4HZF A;  1AHD P;  1HDP A;  1B8I A;  1UB9 A;  2ICW G;  4BBS J;  1WI3 A;  2MD0 A;  4KYW A;  5J8F A;  1O7F A;  2LYC A;  2PFB A;  3HOZ J;  4P9U A;  3RQI A;  3FDY A;  1D0X A;  4QWQ A;  4A3I J;  1YHQ I;  3KEY A;  1J09 A;  2L02 A;  2QGU A;  4WF2 A;  4B09 A;  3SYT A;  4ZDP A;  3K9T A;  3QPT A;  3RKW A;  1FY7 A;  4BS9 A;  2F48 A;  4MLO A;  4KJZ A;  2RVC A;  2V4J C;  1X3Z B;  1QHG A;  1P4X A;  4G6Q A;  3IKV A;  5LLQ A;  3GTO J;  2CRG A;  1MBH A;  3K1P A;  3BC8 A;  3HPH A;  3PNV A;  2DI3 A;  4U88 A;  1VQ6 I;  1KON A;  1SD6 A;  4MTE A;  1VQ9 I;  2EIJ H;  5B5E C;  2W7N A;  1LUJ B;  3QP5 A;  2L7F P;  4ZC3 A;  2STW A;  3FZV A;  4GO1 A;  5CYV A;  3CMM A;  1P92 A;  3PUB A;  1OIS A;  2M7B A;  3QPL A;  4AIK A;  1EH7 A;  2LOO A;  1LFB A;  1RR7 A;  4HLX A;  2QKM B;  1JUS A;  3I59 A;  3S32 A;  2WAE A;  2NXN B;  2EV5 A;  4ON0 A;  2V1D A;  5LEK A;  1G3T A;  4HNT A;  1NK2 P;  5TJJ A;  4KIB A;  4B4C A;  2D5V A;  4EMS A;  2VPR A;  2JRT A;  1XDU A;  2HKO A;  2EZH A;  1AKH B;  1SEU A;  2VUM J;  2HZD A;  2LBF A;  5EG0 A;  2F5C A;  3S17 J;  4L9J A;  4WCG A;  4XOR A;  2ZJR F;  5B1A H;  1K61 A;  3CP8 A;  1H0M A;  1H9T A;  2V6E A;  5FKL A;  1BR4 A;  2KRF A;  3NQO A;  2A5Y B;  1SD5 A;  3W3C A;  3F22 A;  4M6Y A;  3LSJ A;  1U5T C;  4MTD A;  2F5V A;  1K6Y A;  2JSC A;  3CC7 I;  4RS8 A;  1FC3 A;  4OMY A;  1D1A A;  3IL2 A;  4RBO A;  3I5U A;  1HQC A;  2DTR A;  2M9H A;  4NBQ A;  3F21 A;  2JA6 J;  3MKL A;  4E6K G;  1S7E A;  3K4B A;  2KT0 A;  2VQL A;  2EIM H;  1TTY A;  2OCC H;  5J40 A;  4RB2 C;  3CMY A;  2E1M B;  2LD5 A;  4BQA A;  4JBA A;  1T39 A;  1Z7L A;  3OYC A;  1W7P A;  4R79 A;  5ILV A;  1WJE A;  1OYW A;  3E6C C;  2IRF G;  2DU9 A;  1PP8 F;  1MSF C;  3MKY B;  3L2R A;  2L9V A;  2LLK A;  1RRJ A;  2Q8K A;  4UXN A;  5M5Y J;  4Q47 A;  2Y0S N;  4CYC B;  5IP6 A;  3OV8 A;  1XGO A;  2MC4 A;  2ZSI B;  3MZ8 A;  3KP5 A;  1VQL I;  4BNC A;  1D1C A;  2KMU A;  1BI3 A;  3WTZ A;  2WAQ A;  2GOM A;  4BUP A;  2BY2 A;  4UVB A;  1XC5 A;  5FFX A;  3E6B A;  4BJ5 C;  1HLV A;  1VQ8 I;  1YJ9 I;  2CYY A;  4C2T A;  3EUH C;  1ZGW A;  2CQX A;  1X2M A;  4MNU A;  2OQG A;  1IRG A;  1LFP A;  4MO7 A;  2EFW A;  3HOW J;  1JGS A;  1ZRC A;  1QZY A;  3WOD F;  3KZY A;  2PMZ N;  4XRM A;  2X1E A;  3LSM A;  4YIF A;  2LTP A;  1FYL A;  4NQW B;  4U0W A;  2JRM A;  4KN4 X;  1QPM A;  2WAD A;  1YIO A;  3G71 I;  1UHS A;  3LSI A;  1OR7 A;  3ZRG A;  2WAQ N;  3OYI A;  3FHZ A;  3KP7 A;  3W2V A;  4M6X A;  3VYS B;  1Z1D A;  3AAF A;  3H3Z A;  1EJ9 A;  3HOV J;  2LKS A;  1IV6 A;  2PX9 A;  2O7O A;  2I8D A;  2GIZ A;  4Z6Y A;  2ZCW A;  3TW7 A;  3BPX A;  5HVQ C;  3OY9 A;  4BAC A;  5GP9 A;  5TRD A;  1VQ5 I;  4X6A J;  4I6Z A;  3FM3 A;  1J7K A;  3D5R C;  2CV0 A;  1O57 A;  1KU7 A;  2CUZ A;  3C3W A;  1W0U A;  1DGR M;  2VQG A;  4I0B A;  5CVJ A;  4F93 B;  1HOM A;  5FGM A;  1ULY A;  4AU7 A;  4HF2 A;  3CCM I;  2NNY A;  3HZJ A;  1OYI A;  3OR2 C;  3JRB A;  2KIS A;  2X85 A;  2BOL A;  3IAM 2;  4KT5 C;  4PJ0 C;  2M5W A;  2PJP A;  1G2H A;  5ICG A;  4AIH A;  2XAS A;  3GFJ A;  4CCL A;  2K86 A;  4W1U A;  2JVG A;  3GFI A;  2VC0 A;  1JKP C;  1X4O A;  3OIQ A;  2H8R A;  2A69 F;  1IRZ A;  3PJR A;  2VBW A;  2O9L A;  1Z6R A;  1YW7 A;  4IOA F;  2OAZ A;  3BJA A;  1X4P A;  2FOW A;  1MMN A;  3EET A;  1XX5 A;  4N4N B;  2EV6 A;  5KHD A;  3ULQ B;  1U0J A;  1MMD A;  4MIM A;  2OZ6 A;  3E6M A;  2XGE A;  2NAZ A;  3HTU A;  3K1N A;  1P9Q C;  1JJ8 C;  2EFN A;  2DT7 B;  3CDH A;  3JW4 A;  4CXF A;  1X1A A;  4QIW N;  3FXK A;  1UZC A;  2DQL A;  4I76 A;  3U21 A;  4OOI A;  5F27 A;  3WU2 C;  2VJI A;  2M8G X;  2IT0 A;  1IAW A;  2P81 A;  2HTJ A;  1FP2 A;  2K3F A;  2PN6 A;  3L2Q A;  2L9S A;  2B7E A;  1I5Z A;  2L0K A;  3JSP A;  1Y8R B;  4CCM A;  1HF0 A;  4ZYA A;  1ODD A;  3DKW A;  3VYR B;  3ONQ A;  1DPU A;  1KU9 A;  5E20 A;  1MBJ A;  4J19 A;  1MND A;  2V26 A;  3V7R A;  3U2R A;  1MGT A;  4CA0 A;  3BG6 A;  2EFP A;  3L2U A;  4GCV A;  4W97 A;  4ENJ A;  1ZG3 A;  2FQ4 A;  3E6D A;  3FHN A;  2LRE A;  5DUK A;  2QSF X;  3FXR A;  1Y39 A;  3VDX A;  1YO5 C;  4KT6 A;  2M3A A;  3CMA I;  3FK6 A;  1WWX A;  1K6O A;  2FNP A;  3TDU C;  2GXA A;  1GVD A;  1NG6 A;  3IH3 A;  3KZI C;  3A01 A;  3IP4 B;  4HYE A;  3MN2 A;  3HDD A;  2QEN A;  2IVM A;  1GVJ A;  2IBD A;  4DBR A;  3F3X A;  4IRG A;  3LL7 A;  5L3F A;  5J4Y A;  1CQT A;  2DFH A;  1CGP A;  1R4M B;  4HBL A;  3RSN A;  1FLI A;  4L9V A;  2X6Y A;  2M0C A;  1MBF A;  3DCF A;  5CQG A;  5J3L A;  1Z3X A;  1W1W E;  2BVL A;  2KQR A;  4GFB A;  3EPZ A;  4E4H A;  2EBI A;  3FKI J;  2PJR A;  1B59 A;  3WU1 B;  2GOX B;  4IVN A;  2YUS A;  2NOG A;  2X4H A;  2IGM A;  1F1Z A;  2ZXJ A;  1BM9 A;  3OS2 A;  5FKM A;  5E3O A;  2XAQ A;  3I56 I;  1X58 A;  1JE8 A;  2CG4 A;  2IPQ X;  4FHT A;  2H09 A;  2Y9Z A;  4U0V A;  4DOZ A;  2NOJ B;  1V4R A;  4LG0 B;  2HNH A;  3C18 A;  3TL4 X;  1F4K A;  2IA2 A;  4YIR X;  2COB A;  4EVI A;  3VB2 A;  2W85 A;  4NQW A;  2XPU A;  2KP6 A;  2N8G A;  3ZOB A;  3OYM A;  2F2E A;  4FT8 A;  2ESN A;  2HU9 A;  3OYB A;  4S0H B;  3ZMS A;  4FQG A;  2EZK A;  1XB4 A;  3CO7 C;  1BJZ A;  5H6Q A;  2BVM A;  1G3W A;  2H94 A;  3DPL C;  5HDK A;  4CO8 A;  4BH9 A;  4EM0 B;  4KIT B;  5HOD A;  1JKQ C;  2DA7 A;  3AG4 H;  3C2G A;  3K70 C;  3OS1 A;  5IOZ A;  3SZT A;  4PJN A;  1T0F C;  1XSV A;  4AWX B;  3ZQH A;  4ZJZ A;  2NS7 A;  4UUV A;  4G12 A;  4PGH A;  5DUI A;  3QYB A;  1OMI A;  1MNE A;  1FX7 A;  3I54 A;  3HTS B;  2ZME B;  1S7O A;  2X6W A;  1MJ9 A;  4A3F J;  2E2I J;  2XSD C;  2Z16 A;  2O61 A;  1JKR C;  3K10 A;  4LK1 F;  3HSR A;  3MFK A;  1P6R A;  2P4W A;  4L9T A;  5E3M A;  1A36 A;  5H6R A;  4BQN A;  3H1C A;  5FO5 A;  3I4N J;  4CZC A;  2KFD A;  3CJR B;  1UG0 A;  1IN7 A;  5DTD A;  3GFL A;  1SVL A;  3HHG A;  2R7Q A;  5B66 C;  2JPB A;  4QTR A;  3KLO A;  4XKC A;  1U2W A;  2W24 A;  3REO A;  1I6H J;  2F4I A;  2QUF A;  1JT0 A;  5BPD A;  2FE3 A;  2K9S A;  1MBG A;  3FXQ A;  3K70 D;  2XAF A;  4C9Y A;  1BW5 A;  3LWF A;  1O7L A;  1WI9 A;  3FXJ A;  5E18 F;  2O3F A;  4P55 A;  3V8L A;  3GTM J;  2KRC A;  2MD5 A;  1D0Y A;  2D1H A;  4M6V A;  4D5C A;  1ZQ3 P;  1YYV A;  3DBR B;  1V5G A;  4XRS A;  3A02 A;  2EFQ A;  2B9S A;  4L5J A;  2FRH A;  4LIU A;  3KP2 A;  2CW0 F;  2E2H J;  4UV8 A;  3QRF F;  3JRD A;  3NRV A;  4P5O A;  4MHG A;  3HB9 A;  4IQJ A;  3FMS A;  1RC9 A;  3MWM A;  5DD8 A;  2JA7 J;  2LMD A;  4ZH4 F;  3LSP A;  5F1R A;  1ZRD A;  4HV5 A;  2M8E A;  4RM3 A;  3G3Z A;  1XTA A;  3BR0 A;  3BR5 A;  1X1D A;  2VQC A;  4O6J A;  3GFM A;  2BV6 A;  3DV8 A;  4RAY A;  3O8H A;  2XF6 A;  3H9G A;  2DYS H;  3AFH A;  2F5D A;  2X1C A;  3DXJ F;  2DOD A;  3LFU A;  4IPA A;  4BU2 A;  2DA4 A;  1MZB A;  4XKV A;  3M9A A;  5EZG A;  3OIP A;  2DK8 A;  1JUM A;  1YW8 A;  2GA1 A;  1RUN A;  5GAD J;  2BGC A;  2OU2 A;  3IC7 A;  5H20 A;  1IO2 A;  1J2X A;  1FSE A;  3AG2 H;  5M3M J;  3KLN A;  4KMF A;  4DBQ A;  4ZYH A;  5M5X J;  4C3I J;  2DN0 A;  2DMT A;  3TOB A;  1UCR A;  1STZ A;  4R8H A;  4OIP F;  2AQE A;  1FOY A;  4B3X A;  1UST A;  1R5I D;  2VBZ A;  4Y33 A;  2A07 F;  2GLO A;  2HFH A;  1Z0X A;  1HCR A;  3E5X A;  3HM5 A;  3I3L A;  4O5V A;  4A93 J;  2WC2 A;  3I4P A;  1WCM J;  4XM3 A;  2L7Z A;  3B6A A;  3PQJ A;  2HVS A;  4LLL A;  3ZQ7 A;  2FXA A;  3MZH A;  3OYF A;  2JPC A;  2LG4 A;  3K4N A;  3I71 A;  4ZZD A;  1A31 A;  3G1M A;  2ISY A;  4LGW A;  4DYR A;  1T6S A;  4YFX F;  3OWT A;  4F3Q A;  1F5T A;  2HQN A;  2ZXW H;  1B1B A;  1WJ5 A;  4RMN A;  4EQQ A;  5ED4 A;  1NTC A;  1HW2 A;  1YJN I;  2ZSH B;  4JK1 X;  1XSD A;  2HOT A;  5CVV A;  2CQN A;  3ERE D;  1EV7 A;  4NHJ A;  2ID3 A;  4B48 A;  4II3 A;  3ZQQ A;  1BN5 A;  2LK2 A;  3K69 A;  1QO0 D;  2G0E A;  2L9N A;  4KN7 X;  1LE8 B;  2TDX A;  3DU6 A;  2FUG 2;  5KCM A;  2FJ1 A;  2DOA A;  3GW2 A;  4A0Z A;  4M72 A;  2QSH X;  2OCE A;  2M4G A;  4DYC A;  3NWS A;  1TQI A;  2L01 A;  4XLH A;  4HW0 A;  5AON A;  5FD5 A;  3J7Z I;  1FOX A;  3GZ5 A;  5J47 A;  2ELK A;  1QBJ A;  4C30 A;  2LDU A;  1EH6 A;  3DU5 A;  4XLF A;  2CUF A;  3H5N A;  3QYE A;  4HDV A;  1DDN A;  3RCO A;  2CH0 A;  4I99 C;  5J1Y A;  3DEU A;  1U5T B;  2ZNZ A;  3MKZ A;  3IH2 A;  1P7J A;  1RIO H;  2HWV A;  1ETO A;  3CES A;  4XKW A;  2CUJ A;  4HAM A;  5D5X B;  4XL9 A;  1DUX C;  3PIP F;  2ZME A;  2F5F A;  4ZTJ A;  1DPR A;  2XVC A;  1IXR C;  3EUA A;  3K4C A;  1TW2 A;  2R7W A;  3OYL A;  3M8J A;  5BQT A;  2XB5 A;  4IX7 A;  2MYS A;  3FBN B;  1V55 H;  2QYO A;  3I53 A;  4YEJ A;  1N77 A;  3ASO H;  1V54 H;  2R7F A;  5TIS C;  4RAF A;  3ROU A;  5ICF A;  3ZQI A;  2R7Z J;  3WE3 A;  2YX4 A;  3ECH A;  2ZXI A;  3DLA A;  1ZG1 A;  2EIK H;  3QOD A;  1W5S A;  2ZFU A;  4KUM A;  1QNT A;  3RQ4 A;  2FBH A;  2VKH A;  1ERD A;  1PUF A;  1W4M A;  2FX0 A;  3ABU A;  5E8G A;  1BA5 A;  4IF4 A;  3GTQ J;  1S72 I;  3ERM A;  1D8K A;  3GUD A;  3DQV C;  1GT0 C;  1ETY A;  4LK0 F;  2GXG A;  1X2N A;  1U8R A;  3I9V 2;  3P5J A;  2OJE D;  4CIC A;  2EV0 A;  3HC7 A;  1TL8 A;  3N97 A;  4IXA A;  2V6C A;  4ESB A;  4XSX F;  3JAM Z;  1ETW A;  3EDP A;  3PL8 A;  2H27 A;  4WXD A;  3RKY A;  2OPT A;  3W6V A;  3RYR A;  1IJW C;  5F0H A;  2M2E A;  3VYU B;  2L3D A;  3A4C A;  3T8T A;  3GVA A;  1OCZ H;  4JQF A;  1TQP A;  4C3H J;  4ASN A;  3RPU D;  2X6O A;  5ICC A;  2BXZ A;  5K5Q A;  1OKR A;  2VQH A;  1RES A;  2JT1 A;  2DA6 A;  3CCY A;  2EB7 A;  3KYC B;  2HDC A;  4KDP A;  1WH7 A;  3G4S I;  4PJJ A;  1K79 A;  2O03 A;  4CCJ A;  2A6E F;  5E1Z B;  3ZN0 A;  2ZJ2 A;  2DLL A;  3D0S A;  3MEX A;  2LVS A;  1HA8 A;  4BE1 A;  3T1B A;  3L2C A;  4A3E J;  4Z2Y A;  2KL4 A;  2EIN H;  4HNV A;  2Q2E B;  3CME I;  3H35 A;  2R5Y B;  4HDU A;  2RNG A;  3PFY A;  4MEX F;  1BI2 A;  3CC4 I;  2JMW A;  1RKT A;  1S29 A;  2FBK A;  1VF9 A;  2R7O A;  2R3S A;  3GCM A;  1HKQ A;  1XCV A;  3JTH A;  3IWZ A;  2L2O A;  2Y30 A;  2ZFW A;  3KP4 A;  4G9Y A;  1L3L A;  3SFZ A;  1RR8 C;  1OCR H;  1APL C;  4AM3 A;  2ADU A;  1FBS A;  2IGN A;  1MBE A;  4A69 C;  5B3S H;  1BI0 A;  4ZZL A;  3LAP A;  4BXX J;  3QOE A;  1WSU A;  2XPV A;  3RYP A;  3ISP A;  1IXS B;  1G8X A;  3HYI A;  2QQ9 A;  3JRG A;  3ASN H;  3L2W A;  1FTZ A;  2E19 A;  3WU0 A;  2GA2 A;  4PCQ A;  1GHC A;  3GTP J;  5ILS A;  4QLC U;  1Q1V A;  1ETX A;  2VT3 A;  4OAZ A;  5DCM A;  3P7N A;  5D6E A;  3S1M J;  3HRU A;  1A35 A;  2GWR A;  2V9P A;  4BYY A;  1NH3 A;  2DT5 A;  2O6G E;  2JVH A;  2LH9 A;  1HBX G;  1D5Y A;  1SVO A;  3WGH A;  5CVI A;  4IHT A;  3GYH X;  2ME0 A;  4P1W A;  1IC8 A;  4BL0 B;  2BY3 A;  4PK4 A;  3I55 I;  4B44 A;  1ZH5 A;  3BCA A;  2DTZ A;  3IHU A;  1IN5 A;  5D8K B;  4ETS A;  2CS3 A;  2XRN A;  2CW8 A;  1LE8 A;  1HSJ A;  2X6X A;  1ZGA A;  2W84 A;  2XAH A;  1WJD A;  4EAT A;  2HGC A;  2WWY A;  3L00 A;  3RTR A;  2KDZ A;  3DTK A;  4FCY A;  4M3G A;  5BNG A;  2KPM A;  1T2K A;  2IA0 A;  4G8X A;  3TP0 A;  1VQO I;  1SAN A;  2DCE A;  2VKD A;  2QQ8 A;  3FXM A;  4EJW A;  3PNY A;  1XS9 A;  4F52 A;  1U5T A;  3VEP A;  2LY2 A;  1KQ9 A;  2ESH A;  3A03 A;  3VPR A;  4A6D A;  2GZW A;  3KYL A;  4XIC A;  3LST A;  4Q4Z F;  1T08 B;  4XNF A;  4DZP A;  5LGT A;  3JR9 A;  1V5F A;  2LNB A;  2STT A;  3CUQ A;  2Y0S A;  5FKO A;  2KDO A;  3W2W A;  1JKO C;  3OYH A;  3JAM K;  1CF7 B;  1UG2 A;  2XGX A;  4BXF A;  2EA2 A;  3SEZ A;  5D4R A;  5IT9 Z;  1Y6I A;  1Y0U A;  2ZKZ A;  5EZH A;  3HOU J;  2E71 A;  2HQR A;  3BG9 A;  1SD7 A;  5H2F C;  3NAU A;  3BG5 A;  2QBY B;  2QZ8 A;  3OL4 A;  3GLL A;  4ABZ A;  1XMX A;  3QPS A;  2A61 A;  3K2A A;  1WJF A;  3GTK J;  3DEW A;  3CD6 I;  1U3E M;  5C3E J;  1ZN2 A;  4RDU A;  1S3J A;  2E7X A;  3ZMT A;  2RN7 A;  2PMZ A;  5HS9 A;  4B1R A;  3K4M A;  1T56 A;  1IDZ A;  2RKH A;  1FEX A;  3A0B C;  2WV0 A;  2CUE A;  1OCT C;  1J5Y A;  1Y0N A;  1VQK I;  3DPU A;  3LOC A;  1ZRE A;  1KYZ A;  3HGY A;  3V8J A;  3W6J B;  2J5P A;  4LB5 A;  3E7L A;  2NVT J;  1V5E A;  1XG1 A;  2CJJ A;  2IW5 A;  3EUH A;  2DYR H;  2QM3 A;  3PQK A;  3VSL A;  3HOY J;  2P5L C;  1XD7 A;  3HSF A;  3QU6 A;  3BY6 A;  2DMQ A;  1N25 A;  3SXY A;  5IYC J;  1W36 C;  3F23 A;  3HOX J;  2F6C A;  2K5C A;  5IP7 J;  1WGX A;  3ABK H;  3DF8 A;  4AYB N;  2QQA A;  4BGD A;  5DS9 A;  1PP7 U;  2KJB A;  4OIQ F;  3E5U A;  3IWF A;  1B6A A;  5GTH C;  3IRQ A;  4R1H A;  1QPI A;  1YS7 A;  1XPX A;  2Q2E A;  1OPC A;  2EWN A;  5ERI A;  2R5Y A;  4C2U A;  2Z33 A;  1BC7 C;  5FKK A;  2DFF A;  1USS A;  1JTX A;  1F43 A;  1WPK A;  1F9N A;  3RIR A;  2F4O B;  3KP3 A;  4OIO F;  1E3H A;  3M7G A;  3BTL A;  5JLX A;  1R5G A;  3BT9 A;  1JHH A;  5DEQ A;  2M87 A;  1G59 A;  2D45 A;  2IP2 A;  3KX2 A;  3ZR8 X;  1PYV A;  4I0A A;  1W7P D;  1TC3 C;  1A6Q A;  1IDY A;  1W36 D;  5BS6 A;  1X1B A;  3BZK A;  3LNQ A;  5TGT A;  1FTT A;  2E1N A;  2HEO A;  1IN4 A;  2FU4 A;  1KYW A;  5LBQ A;  4G7H F;  4JYK A;  3U1K A;  2BY0 A;  3DP7 A;  4ANJ A;  2X1D A;  2R5Z B;  2DA3 A;  1RUO A;  4L18 B;  2COM A;  2ETH A;  1L0O C;  1N75 A;  1TWF J;  2UXX A;  2VE9 A;  4OAY A;  4A3G J;  5GPC A;  4DZJ A;  2MLG A;  1K4T A;  3O3K A;  5FLV A;  1Z3Y A;  2C6Y A;  2MA3 A;  3PO2 J;  2K7L A;  2Z1D A;  5EYR A;  4DW6 A;  4Q48 A;  2PBI A;  2M7A A;  2VC1 A;  3R6S A;  5F08 A;  4EJO A;  3KFW X;  1ENH A;  1PDN C;  1MKM A;  2OD5 A;  4UV9 A;  2EA4 A;  3GZ6 A;  2HDD A;  1X19 A;  1G3Y A;  2AO9 A;  2YSR A;  4XOP A;  1FYK A;  4HX8 A;  5LGN A;  2K9M A;  2EK5 A;  2MFZ A;  5IT9 K;  1H9G A;  4N9I A;  3K0L A;  2O8K A;  1J75 A;  2BBY A;  1K78 B;  2OTJ I;  2MH9 A;  1P4W A;  1RPW A;  1OFC X;  5BPI A;  3B6C A;  3ZQG A;  4V19 K;  3HG9 A;  1SFU A;  1BR2 A;  2VIX A;  1AKH A;  1D1B A;  2P7C B;  3PSF A;  2E34 A;  5LRS A;  3L09 A;  1SFK A;  2TCT A;  1O4X A;  4V2F A;  4I09 A;  2K85 A;  4UVC A;  4I98 B;  4ESF A;  1Z67 A;  2ZO4 A;  3COA C;  1UFM A;  1RNL A;  5E8I A;  1I39 A;  4RB0 A;  5LHI A;  3K6G A;  2VE8 A;  3K4J A;  1XCB A;  3BR2 A;  4LJZ F;  1CF7 A;  3JRE A;  4ZDO A;  2KZG A;  4YFK F;  2P6T A;  4JX4 A;  3TOA A;  1TWG J;  1XGS A;  2HS5 A;  4FAS D;  3IV5 A;  3KCC A;  3CCQ I;  1GLN A;  5CQE A;  2X51 A;  1WJA A;  4RLQ A;  1J9I A;  5IOY A;  2Z99 A;  2ELJ A;  4MQV A;  1BOA A;  2DMP A;  5FLM J;  2IS6 A;  3TO9 A;  4WXH A;  4D0P A;  4ZDL A;  4XID A;  5LFA A;  3WTY C;  3K2Z A;  5E17 F;  3ABM H;  1YX5 A;  4UVA A;  3H5R A;  2R7U A;  4JP0 A;  4NC6 A;  2NVU B;  1ACI A;  4XRS G;  3QQA A;  1BI1 A;  4ZYE A;  1VQN I;  3M1E A;  4EM1 A;  2A6T A;  4CYC A;  1WJC A;  3M4O J;  2Y48 A;  2CWE A;  3IAS 2;  3BP8 A;  5HDG A;  5KAI C;  2VB6 A;  5K7H A;  3JTG A;  2HR3 A;  4K2E A;  3KP6 A;  3D1N I;  4RAZ A;  3WG9 A;  3CJQ B;  4AVZ A;  1Z7U A;  3CTA A;  1IN8 A;  4QPO A;  3ZXS A;  3S3M A;  2IXS A;  3D5S C;  3O8G A;  4IHV A;  3O6B B;  2IS2 A;  3HPG A;  3AG3 H;  1XSX A;  1TQM A;  1Z21 A;  3HRT A;  2LRD A;  4G6D A;  4RGX A;  3H3V K;  3B02 A;  1IGN A;  5JHF A;  2VJJ A;  1B9N A;  4A0X A;  3OSG A;  2V1U A;  3WE2 A;  2L5Q A;  3FM5 A;  3NEU A;  4RB3 C;  5DD4 A;  4IZZ A;  2OF7 A;  3PFI A;  1VI0 A;  4XN3 A;  3QPH A;  4G7O F;  1GV2 A;  1O3Q A;  1HST A;  4M3F A;  1FNN A;  2V1X A;  4M71 A;  4II2 A;  1R7J A;  4JOM A;  1SC7 A;  4S05 A;  3RJP A;  2NRA C;  4M73 A;  5IT3 A;  1SAX A;  2QSG X;  4MFE A;  2K3P A;  3BR1 A;  2UXN A;  2K4B A;  4M3D A;  1JT6 A;  1T0F A;  4KIC A;  4NUB A;  2I5U A;  4CCN A;  1RZ4 A;  2LY1 A;  1YG2 A;  1U8B A;  3PSI A;  4WXC A;  3V4G A;  2YX7 A;  4BJ6 C;  4HQE A;  4NNJ A;  3SZP A;  3ESW B;  3CLQ A;  3HEF A;  2M4K A;  3PUF A;  1OCO H;  3CJN A;  3I4M J;  4HOB A;  3GEZ A;  2LC2 A;  3UR3 C;  1K4S A;  4M3B A;  3KET A;  1I27 A;  4D9J A;  3WTW C;  1ETV A;  2R5Z A;  2XF7 A;  4RA2 A;  4P96 A;  2ECC A;  3CCR I;  2HYF A;  1KQ0 A;  3ZPL A;  3BDD A;  4AID A;  1YFH A;  2EIL H;  1FOK A;  3E0J B;  1KGS A;  1Z6T A;  1ITY A;  4FET A;  3CC2 I;  4C3J J;  4KFC A;  3WHB A;  1AWC A;  3F8M A;  1A6I A;  2VLA A;  2Z5U A;  1YTY A;  4NC8 A;  2VBX A;  2Y69 H;  3MVP A;  1SAU A;  4OIR F;  5D6F A;  4E7H A;  1ORK A;  1R1V A;  4P9F A;  3HGG A;  4A5N A;  5D5W B;  2Q0O A;  4V2G A;  5D4S A;  1I3Q J;  1LDJ A;  1FBQ A;  3IRR A;  4HA8 A;  2UWM A;  3VWB A;  2AXL A;  4RGU A;  3R4K A;  3M07 A;  1JHF A;  2L54 A;  2Y75 A;  3OS0 A;  2VKE A;  1Z91 A;  4GDF A;  2HQ5 A;  4M9X A;  1Y56 A;  3SDG A;  2CU7 A;  4CDG A;  3FIW A;  3KEO A;  2FSW A;  4LLG F;  3UKG A;  3GTL J;  3WG7 H;  3KPH A;  3F9K A;  3FIS A;  4GRI A;  4RLF A;  4AIJ A;  2OA4 A;  2NVX J;  1ZK8 A;  1ZKG A;  3BJO A;  2A6H F;  4U87 A;  4BQO A;  2PQ8 A;  3BRO A;  4XKB A;  4E70 A;  2DFE A;  3CP2 A;  2A68 F;  1QVU A;  2HTS A;  2QQB A;  2J5O A;  2XGD A;  1LDD A;  1T98 A;  2LSO A;  3MCZ A;  4M3E A;  2W00 A;  1D0Z A;  2CO5 A;  4WK8 F;  2W57 A;  3DEE A;  1ON1 A;  2D1V A;  3CCS I;  1HW1 A;  1ZHF A;  1UHW A;  1MIJ A;  4FE7 A;  2XSJ C;  1O3T A;  2Z9O A;  2GM4 A;  2G7U A;  1LFU P;  2MG4 A;  3OYK A;  1KU3 A;  2HKX A;  2ZC2 A;  2FMY A;  3F0C A;  2OUM A;  1YW9 A;  3GX4 X;  5J4V A;  5HS8 A;  2DDA A;  4A12 A;  1AA7 A;  2JSP A;  2LF7 A;  2JUC A;  4GXO A;  1SFE A;  4E7L A;  3RKX A;  1FWZ A;  3H5A A;  4M74 A;  2K9Q A;  4D7N A;  3MD2 A;  4YRV A;  4MFD A;  3HRM A;  4LB6 B;  2VOO A;  1IRF A;  4I01 A;  1E0E A;  2XV4 S;  1Y1V J;  2DPD A;  2HVR A;  4IKF A;  5FRN A;  1P2F A;  1I50 J;  3ZMU A;  3W6K B;  4HF1 A;  3AL0 C;  2P0W A;  2ELH A;  4IQ4 A;  4LIT A;  5JVG F;  1E2X A;  3LQQ A;  2H6C A;  2MGQ A;  3DBH B;  4A3B J;  4HEA 2;  4EJT A;  1BC8 C;  4EJV A;  3Q9V A;  1UHM A;  2YR2 A;  3L9F A;  1YX3 A;  1BL0 A;  4LG0 A;  2K9L A;  4FX4 A;  2HZT A;  4IRH A;  2XRL A;  3LA2 A;  3BCB A;  4Y17 A;  3GLX A;  3DFG A;  3LSK A;  5EEH A;  1ZAR A;  4A3K J;  1MNM C;  5M3F J;  4LOC A;  1XGM A;  3LA3 A;  4XQF A;  5J6X A;  1DQU A;  1DU0 A;  2JN6 A;  3JCU C;  4BY1 J;  5B1B H;  4BE2 A;  3ECO A;  2VKV A;  2QVO A;  4IEJ A;  2E60 A;  4N0B A;  2Y0M A;  5LD2 C;  2L4A A;  2LF8 A;  3NAR A;  4PJM A;  4BKX A;  4DJA A;  3CF2 A;  5HLI A;  1UAA A;  2P6S A;  4HNU A;  4UUT A;  5DV5 A;  3KZZ A;  3QP6 A;  1G3S A;  2MBF A;  2XHK A;  4EV0 A;  3L7W A;  1FOW A;  1U6G A;  2HPI A;  2LBF B;  3RI4 A;  5BOX A;  1T8I A;  1EH8 A;  2K27 A;  3M8E A;  5EG0 B;  1ZGJ A;  3RPU A;  1OCP A;  2XF5 A;  4HLY A;  3D5L A;  3G73 A;  1MD0 A;  3ZN1 A;  4DNC A;  3ZQF A;  4PZJ A;  2RGV A;  3VSK A;  2L7M P;  4XLA A;  2UV1 A;  1XN7 A;  1REP C;  3K4K A;  2XGC A;  1S7A A;  1NHA A;  5JVT A;  4BQQ A;  4EGY A;  3S1N J;  4I02 A;  4A5M A;  4BBR J;  3ML6 A;  2DA2 A;  5EEA A;  3L1P A;  5F64 A;  3A1Y A;  2K40 A;  2QA4 I;  1FYM A;  5IYB J;  2JUG A;  3QYF A;  1J59 A;  3LAJ A;  2M1B A;  4A2U A;  3JSO A;  3N4M A;  3PM1 A;  3RPQ A;  2LP0 A;  5GAG J;  2Z2S B;  1UMQ A;  2CV2 A;  4H4K C;  1Z77 A;  2IGO A;  3OL3 A;  3FK7 A;  2UUZ A;  3TW6 A;  5E1X A;  1W7P B;  2KIM A;  1LVK A;  1OYY A;  4OIN F;  2RDP A;  3SQN A;  4HX4 A;  2XKP A;  2DA5 A;  4ZTF A;  4U7D A;  2F4M B;  3GWZ A;  1F36 A;  5DM7 F;  1SFX A;  2HQA A;  5IYD J;  4BHC A;  2HOS A;  3CLO A;  4BDZ A;  4HF0 A;  2BY1 A;  3NWT A;  4S04 A;  2DK5 A;  2VT2 A;  3J81 Z;  3M3Y J;  1T38 A;  1LB2 A;  2VBY A;  2HPM A;  3DBL B;  4L5I A;  2EH3 A;  1X3U A;  5FRM A;  1XDS A;  2F5E A;  5F0C A;  4F92 B;  4EJU A;  5LRR A;  1TWH J;  5CVU A;  4KMU X;  4D5F A;  3GTJ J;  3OOU A;  4UY8 I;  4A6E A;  2P5K A;  4RM2 A;  5L3C A;  5F6F A;  1JTY A;  3SHF A;  1FT9 A;  1TLH B;  2Y9Y A;  3I64 A;  4LIV A;  2DPU A;  3T5X A;  3ZMZ A;  3GZN B;  3A2K A;  4E7Z A;  1E3O C;  2OZU A;  4YEL A;  1XMA A;  4TV7 A;  5L3B A;  1G6N A;  2X48 A;  2IAI A;  2P8T A;  4E7I A;  2AHQ A;  4MQ9 F;  2VPL A;  2QKL B;  4FTH A;  2YS9 A;  4N4O B;  2ACJ A;  2K4J A; 
#chains in the Genus database with same CATH homology
 3P9I A;  2XAJ A;  3J80 Z;  3GF2 A;  5K5O A;  1R5H A;  2FEZ A;  2XRO A;  2AS5 F;  1I1G A;  2GIV A;  1IF1 A;  3QAH A;  2XKO A;  1LEB A;  3WTX C;  1U78 A;  3KE2 A;  3E3V A;  1TW3 A;  4MEY F;  4Y15 A;  2MLK A;  3C1D A;  2ISZ A;  5J8C A;  2PEX A;  1J0R A;  1B9M A;  3MZY A;  3R0A A;  1ZLK A;  3FMR A;  2YPR A;  3R61 A;  3WTS C;  1XGN A;  1SMT A;  3P9C A;  2O0Y A;  3WTV C;  5L3D A;  1O3R A;  3F8N A;  4DQ2 A;  1TNT A;  3TQN A;  2KIU A;  3HSE A;  2MH2 A;  5FB2 A;  4L0Z B;  1TBX A;  1QGP A;  4LLN A;  3BPV A;  5K1Y A;  2M30 A;  1LVA A;  2ZBK A;  1QQI A;  3P9K A;  1FP1 D;  1AOY A;  4Y13 A;  1BBY A;  3M8F A;  1R1T A;  2EJR A;  3V7S A;  1WQ2 A;  2IA1 A;  1A04 A;  3CUQ C;  4CGZ A;  2BE5 F;  5FLX K;  5KVR A;  1YLF A;  5D5U B;  1KQ8 A;  2RV8 A;  4NB5 A;  3J81 K;  3HRS A;  2Z3Y A;  2VON A;  3ZMV A;  3H92 A;  2E1C A;  2HYG D;  1K7A A;  3O2P E;  2FML A;  4L0Y B;  1I6X A;  3GO5 A;  2RNJ A;  3B73 A;  1E17 A;  4PDK A;  3J80 K;  1MJB A;  2DW4 A;  1R22 A;  2PMU A;  4H0E A;  4O3M A;  4KIF A;  3IKT A;  3F72 A;  1W5T A;  1FBU A;  3Q5F A;  1FPQ A;  4OU0 A;  5LHH A;  2VOP A;  4B8X A;  3FXU A;  2P5V A;  4IJA A;  3U9G A;  3HIF A;  2PG4 A;  2QLZ A;  4GYG A;  1KU2 A;  2R7D A;  3K1M A;  1S6L A;  3WTU C;  1PUE E;  5DCF A;  4EGZ A;  4A0Y A;  4OMZ A;  4PGG A;  2FA5 A;  4CYD A;  1ZAO A;  4EM2 A;  3CO6 C;  3T8R A;  5AIQ A;  2E7W A;  2WTE A;  2MC3 A;  2FQ3 A;  3HHH A;  3QU3 A;  3ZMD A;  2DBB A;  4HX7 A;  4IRI A;  4HQM A;  1MDM B;  5HOO A;  2FF4 A;  1TNS A;  3WGI A;  1P4A A;  3RDI A;  1Z9C A;  2VXZ A;  3WTT C;  2W25 A;  2CFX A;  2XUB A;  4GYI A;  5JR3 A;  1D3Y A;  2P7V B;  4KA4 A;  2PMH A;  4IHS A;  2QBY A;  1SD4 A;  3HUG A;  5AIP A;  2VN2 A;  2L4M A;  4YFN F;  1FSH A;  1QZZ A;  2NS0 A;  4RGR A;  4G94 A;  1G4D A;  2G9W A;  3V7C A;  5K5R A;  3LQR A;  4ENK A;  3ZP5 A;  4ZYD A;  2RQP A;  3E5Q A;  4UHT A;  3EQL F;  4LD5 A;  4N9H A;  1ON2 A;  5ILU A;  2UZK A;  1KA8 A;  2XIG A;  1GXP A;  3DPT A;  2DFI A;  2X0L A;  4UNO A;  3R0J A;  4KIG A;  5BMZ A;  3FMQ A;  3FF5 A;  4LMY A;  2LKP A;  5CJ9 A;  1HKT A;  2FNA A;  4L9N A;  3GXO A;  3F8F A;  3I58 A;  5L3G A;  1XMK A;  3E97 A;  3BJ6 A;  1I1S A;  4AD9 A;  1R1U A;  1VTN C;  3F6O A;  2H6B A;  1WKM A;  5HDN A;  2FBI A;  1IUY A;  2K02 A;  5ICE A;  3HOT A;  2DO7 A;  2PI0 A;  2VOD A;  1R58 A;  4F7Z A;  4ESJ A;  3S2W A;  1K78 A;  1ZYR F;  2JTV A;  4YG2 F;  3F6V A;  4U7B A;  1MDM A;  2ZNY A;  2XAG A;  4WX9 A;  5CVR A;  3LA7 A;  3U1D A;  5LEJ A;  4M9Z A;  3J7A O;  3TDZ C;  4RB1 A;  3FWE A;  3T0Y A;  5HLG A;  3EYI A;  2BYV E;  2PLY A;  2B0L A;  3F8B A;  1GXQ A;  1LEA A;  4I7H A;  4ZYG A;  2YU3 A;  3MQ0 A;  5KK1 A;  4XLP F;  1R00 A;  3HOS A;  2BEO A;  2CGP A;  6PAX A;  2RC4 A;  4XBF A;  4BHP A;  3BWG A;  2KIF A;  2D2W A;  2GXB A;  2HOE A;  4MGR A;  1IXC A;  3CUO A;  4ENM A;  2V9V A;  1YS6 A;  1HKS A;  1Z05 A;  3F8C A;  1BJA A;  2KKO A;  3TO6 A;  4FX0 A;  5A2Q Z;  1DP7 P;  2KJC A;  5D5V B;  4YII A;  1SMY F;  5L3E A;  3TO7 A;  3V8K A;  1IZ1 A;  1ZRF A;  1RI7 A;  1ZLJ A;  3ELK A;  2NNN A;  3Q9S A;  1Q1H A;  3TKY A;  1R36 A;  2DQR A;  3EYY A;  2JZY A;  3VFZ A;  4ENN A;  4KNY A;  1LJ9 A;  5DCM B;  2NYX A;  4BXU A;  3H3U A;  2QWW A;  5EEG A;  1D8J A;  5JI6 A;  1D5V A;  3BZ6 A;  1JXS A;  3BOQ A;  4I2O A;  2FOK A;  2GQQ A;  4BAY A;  3I59 B;  5FFZ A;  2CQK A;  2CSO A;  3VOE A;  1S8N A;  1R23 A;  4AVP A;  1LQ1 A;  3MAJ A;  3FX3 A;  1IW7 F;  1WRJ A;  1FZP B;  1LDK B;  5DYM A;  4WWC A;  2M45 A;  3QOP A;  1YQA A;  3TGN A;  1O3S A;  1ONV A;  2OQR A;  4U0Y A;  3VOD A;  3LFK A;  2G7H A;  2A3S A;  5D8L B;  2V79 A;  3CUQ B;  4Q5S F;  1V3F A;  1MJA A;  2GAU A;  3ABT A;  2DAO A;  4XSZ F;  4XLN F;  1ZG5 A;  5JHU A;  1IN6 A;  2EFO A;  2OBP A;  1B4A A;  1BIA A;  2O8X A;  2IJL A;  5HLH A;  5JFR A;  3KEQ A;  1LNW A;  5E1W A;  4HV6 A;  5A2Q K;  4G7Z F;  5LGU A;  3OOP A;  5LHG A;  4RGS A;  5FLX Z;  1HW5 A;  4XRF A;  5FD6 A;  4BHB A;  5DDG A;  3C7J A;  3WGG A;  4GGG A;  5CLS A;  5HS7 A;  1C0W A;  4M9S A;  3I0T A;  3R60 A;  4CZZ A;  4CHU A;  4LFU A;  1HXD A;  1BIB A;  4HZF A;  1UB9 A;  4KYW A;  5J8F A;  1O7F A;  2PFB A;  4P9U A;  4QWQ A;  2L02 A;  4WF2 A;  4B09 A;  3K9T A;  3QPT A;  3RKW A;  1FY7 A;  2RVC A;  1P4X A;  4G6Q A;  3IKV A;  5LLQ A;  3K1P A;  2DI3 A;  4U88 A;  1SD6 A;  4MTE A;  3QP5 A;  2STW A;  3FZV A;  4GO1 A;  5CYV A;  1P92 A;  4AIK A;  1EH7 A;  4HLX A;  3I59 A;  2EV5 A;  4ON0 A;  2V1D A;  5LEK A;  1G3T A;  5TJJ A;  4KIB A;  4EMS A;  2JRT A;  1XDU A;  2HKO A;  2F5C A;  4L9J A;  4WCG A;  1H9T A;  1H0M A;  2KRF A;  3NQO A;  2A5Y B;  1SD5 A;  3F22 A;  4M6Y A;  1U5T C;  4MTD A;  2JSC A;  4RS8 A;  1FC3 A;  4OMY A;  3IL2 A;  3I5U A;  1HQC A;  2DTR A;  3F21 A;  1TTY A;  4RB2 C;  4BQA A;  4JBA A;  1T39 A;  1W7P A;  4R79 A;  5ILV A;  1OYW A;  3E6C C;  2IRF G;  2DU9 A;  1PP8 F;  2Q8K A;  4UXN A;  4Q47 A;  3OV8 A;  1XGO A;  3KP5 A;  4BNC A;  1BI3 A;  3WTZ A;  4UVB A;  5FFX A;  3E6B A;  2CYY A;  4MNU A;  2OQG A;  1IRG A;  2EFW A;  1JGS A;  1ZRC A;  1QZY A;  3WOD F;  3KZY A;  4YIF A;  1FYL A;  4U0W A;  4KN4 X;  1QPM A;  1YIO A;  1OR7 A;  3FHZ A;  3KP7 A;  4M6X A;  1Z1D A;  3AAF A;  3H3Z A;  2ZCW A;  5HVQ C;  3BPX A;  5TRD A;  3FM3 A;  1J7K A;  1O57 A;  1KU7 A;  3C3W A;  4I0B A;  5CVJ A;  5FGM A;  1ULY A;  4HF2 A;  2NNY A;  1OYI A;  4KT5 C;  2M5W A;  2PJP A;  5ICG A;  4AIH A;  2XAS A;  3GFJ A;  2K86 A;  3GFI A;  2VC0 A;  2A69 F;  2VBW A;  1Z6R A;  1YW7 A;  2OAZ A;  3BJA A;  3EET A;  2EV6 A;  3ULQ B;  2OZ6 A;  3E6M A;  2NAZ A;  3HTU A;  3K1N A;  2EFN A;  3CDH A;  3JW4 A;  4CXF A;  2DQL A;  4OOI A;  2IT0 A;  1IAW A;  2HTJ A;  1FP2 A;  2PN6 A;  1I5Z A;  3JSP A;  1ODD A;  3DKW A;  1DPU A;  1KU9 A;  5E20 A;  3V7R A;  3U2R A;  1MGT A;  2EFP A;  4ENJ A;  4GCV A;  1ZG3 A;  3E6D A;  5DUK A;  3FXR A;  1YO5 C;  1WWX A;  1K6O A;  2FNP A;  3TDU C;  4HYE A;  2QEN A;  2IVM A;  1GVJ A;  3F3X A;  4IRG A;  5L3F A;  1CGP A;  4HBL A;  1FLI A;  4L9V A;  1B59 A;  3WU1 B;  4IVN A;  2X4H A;  1F1Z A;  2ZXJ A;  1BM9 A;  2XAQ A;  1JE8 A;  2CG4 A;  2IPQ X;  4FHT A;  2H09 A;  4U0V A;  1V4R A;  4LG0 B;  3C18 A;  1F4K A;  2IA2 A;  4EVI A;  3VB2 A;  2W85 A;  4NQW A;  2F2E A;  4FT8 A;  2ESN A;  3ZMS A;  3CO7 C;  1XB4 A;  5H6Q A;  1G3W A;  2H94 A;  3DPL C;  5HDK A;  4CO8 A;  4BH9 A;  4EM0 B;  3SZT A;  4AWX B;  1XSV A;  4UUV A;  4PGH A;  5DUI A;  1OMI A;  1FX7 A;  3I54 A;  3HTS B;  2ZME B;  1S7O A;  1MJ9 A;  2O61 A;  4LK1 F;  3HSR A;  3MFK A;  1P6R A;  2P4W A;  4L9T A;  5H6R A;  5FO5 A;  1IN7 A;  3GFL A;  3HHG A;  2JPB A;  3KLO A;  1U2W A;  2W24 A;  3REO A;  2QUF A;  5BPD A;  2FE3 A;  3FXQ A;  2XAF A;  3LWF A;  1O7L A;  1WI9 A;  5E18 F;  2O3F A;  4P55 A;  3V8L A;  2MD5 A;  2D1H A;  1YYV A;  2EFQ A;  4L5J A;  2FRH A;  3KP2 A;  2CW0 F;  4UV8 A;  3QRF F;  3NRV A;  4P5O A;  4MHG A;  3FMS A;  3MWM A;  5DD8 A;  4ZH4 F;  5F1R A;  1ZRD A;  4HV5 A;  2M8E A;  3G3Z A;  4O6J A;  3GFM A;  2BV6 A;  3DV8 A;  4RAY A;  2F5D A;  3DXJ F;  4IPA A;  1MZB A;  3M9A A;  2DK8 A;  1YW8 A;  2GA1 A;  1RUN A;  2BGC A;  5H20 A;  2OU2 A;  3IC7 A;  1J2X A;  1FSE A;  4KMF A;  3KLN A;  4ZYH A;  3TOB A;  1UCR A;  1STZ A;  4R8H A;  4OIP F;  1UST A;  2VBZ A;  2A07 F;  2HFH A;  3E5X A;  4O5V A;  2WC2 A;  3I4P A;  3PQJ A;  4LLL A;  3ZQ7 A;  2FXA A;  3MZH A;  2JPC A;  3I71 A;  4ZZD A;  2ISY A;  4LGW A;  1T6S A;  4YFX F;  1F5T A;  2HQN A;  1B1B A;  4EQQ A;  5ED4 A;  1HW2 A;  4JK1 X;  1XSD A;  5CVV A;  3ERE D;  1EV7 A;  4NHJ A;  1BN5 A;  3K69 A;  1QO0 D;  4KN7 X;  2TDX A;  3GW2 A;  4A0Z A;  4M72 A;  1TQI A;  2L01 A;  4HW0 A;  5AON A;  5FD5 A;  3GZ5 A;  1QBJ A;  2LDU A;  1EH6 A;  1DDN A;  4HDV A;  3DEU A;  1U5T B;  2ZNZ A;  1RIO H;  2HWV A;  4HAM A;  5D5X B;  1DUX C;  2ZME A;  2F5F A;  1DPR A;  2XVC A;  1IXR C;  1TW2 A;  5BQT A;  2QYO A;  3I53 A;  2R7F A;  3ROU A;  5ICF A;  3WE3 A;  2YX4 A;  3ECH A;  1ZG1 A;  1W5S A;  4KUM A;  1QNT A;  2FBH A;  1W4M A;  3ABU A;  5E8G A;  4IF4 A;  1D8K A;  3GUD A;  3DQV C;  4LK0 F;  2GXG A;  1U8R A;  4CIC A;  2EV0 A;  3N97 A;  4IXA A;  2V6C A;  4ESB A;  4XSX F;  3JAM Z;  3EDP A;  2H27 A;  4WXD A;  3RKY A;  3RYR A;  2L3D A;  3T8T A;  3GVA A;  4JQF A;  1TQP A;  4ASN A;  5ICC A;  5K5Q A;  1OKR A;  2JT1 A;  2EB7 A;  2HDC A;  4KDP A;  1K79 A;  2O03 A;  2A6E F;  5E1Z B;  3ZN0 A;  2ZJ2 A;  2DLL A;  3D0S A;  3MEX A;  3T1B A;  3L2C A;  4Z2Y A;  4HDU A;  4MEX F;  1BI2 A;  2FBK A;  1S29 A;  2R3S A;  1HKQ A;  1XCV A;  3JTH A;  3IWZ A;  2ZFW A;  3KP4 A;  4G9Y A;  1L3L A;  3SFZ A;  2ADU A;  1FBS A;  1BI0 A;  4ZZL A;  3LAP A;  1WSU A;  3RYP A;  3ISP A;  1IXS B;  3HYI A;  2QQ9 A;  3WU0 A;  2GA2 A;  4PCQ A;  1GHC A;  5ILS A;  4QLC U;  2VT3 A;  5DCM A;  3P7N A;  5D6E A;  3HRU A;  2GWR A;  4BYY A;  2DT5 A;  2O6G E;  1HBX G;  3WGH A;  5CVI A;  4IHT A;  3GYH X;  1ZH5 A;  3IHU A;  1IN5 A;  5D8K B;  4ETS A;  2XRN A;  1HSJ A;  1ZGA A;  2W84 A;  2XAH A;  2HGC A;  2WWY A;  3L00 A;  3RTR A;  1T2K A;  2IA0 A;  4G8X A;  4EJW A;  1U5T A;  3VEP A;  4A6D A;  1KQ9 A;  2ESH A;  2GZW A;  3LST A;  4Q4Z F;  5LGT A;  2LNB A;  2STT A;  3CUQ A;  3JAM K;  1CF7 B;  2XGX A;  2EA2 A;  5D4R A;  5IT9 Z;  1Y0U A;  2ZKZ A;  2HQR A;  1SD7 A;  2QBY B;  2QZ8 A;  2A61 A;  1U3E M;  1ZN2 A;  1S3J A;  2E7X A;  3ZMT A;  2RN7 A;  5HS9 A;  2RKH A;  2WV0 A;  1J5Y A;  1ZRE A;  1KYZ A;  3V8J A;  3W6J B;  2J5P A;  4LB5 A;  2IW5 A;  3EUH A;  2QM3 A;  3PQK A;  2P5L C;  1XD7 A;  3HSF A;  3QU6 A;  3BY6 A;  3SXY A;  3F23 A;  3DF8 A;  1PP7 U;  2QQA A;  2KJB A;  4OIQ F;  3E5U A;  3IWF A;  1B6A A;  3IRQ A;  4R1H A;  1YS7 A;  2Q2E A;  1OPC A;  2EWN A;  5ERI A;  2Z33 A;  1BC7 C;  1USS A;  1F9N A;  3RIR A;  3KP3 A;  4OIO F;  3M7G A;  1R5G A;  1JHH A;  5DEQ A;  2M87 A;  2D45 A;  2IP2 A;  4I0A A;  1W7P D;  5BS6 A;  2E1N A;  2HEO A;  1IN4 A;  2FU4 A;  1KYW A;  5LBQ A;  4G7H F;  3DP7 A;  1RUO A;  4L18 B;  2COM A;  2ETH A;  1L0O C;  2UXX A;  2VE9 A;  2MLG A;  3O3K A;  2C6Y A;  2MA3 A;  2K7L A;  4Q48 A;  2PBI A;  2VC1 A;  3R6S A;  4EJO A;  3KFW X;  1PDN C;  1MKM A;  2OD5 A;  4UV9 A;  2EA4 A;  3GZ6 A;  1G3Y A;  2YSR A;  1FYK A;  4HX8 A;  5LGN A;  2EK5 A;  5IT9 K;  1H9G A;  4N9I A;  3K0L A;  1J75 A;  2BBY A;  1K78 B;  2MH9 A;  1P4W A;  5BPI A;  1SFU A;  2P7C B;  5LRS A;  3L09 A;  4I09 A;  4UVC A;  4I98 B;  4ESF A;  2ZO4 A;  3COA C;  1UFM A;  1RNL A;  5E8I A;  4RB0 A;  5LHI A;  2VE8 A;  1XCB A;  4LJZ F;  1CF7 A;  4YFK F;  2P6T A;  3TOA A;  1XGS A;  2HS5 A;  3KCC A;  1J9I A;  2Z99 A;  4MQV A;  1BOA A;  3TO9 A;  4WXH A;  4D0P A;  3WTY C;  3K2Z A;  5E17 F;  4UVA A;  4ZYE A;  1BI1 A;  3M1E A;  4EM1 A;  2Y48 A;  2CWE A;  3BP8 A;  5HDG A;  3JTG A;  2HR3 A;  4K2E A;  3KP6 A;  4RAZ A;  3WG9 A;  1Z7U A;  3CTA A;  1IN8 A;  3O6B B;  1XSX A;  1TQM A;  3HRT A;  4G6D A;  4RGX A;  3B02 A;  1B9N A;  4A0X A;  2V1U A;  3WE2 A;  3FM5 A;  3NEU A;  4RB3 C;  5DD4 A;  3PFI A;  4G7O F;  3QPH A;  1O3Q A;  1HST A;  1FNN A;  2V1X A;  4M71 A;  1R7J A;  4S05 A;  3RJP A;  2NRA C;  4M73 A;  5IT3 A;  1SAX A;  2UXN A;  2K4B A;  4KIC A;  1T0F A;  1RZ4 A;  1YG2 A;  4HQE A;  4WXC A;  3V4G A;  2YX7 A;  3SZP A;  3CJN A;  4HOB A;  3GEZ A;  3KET A;  1I27 A;  3WTW C;  4P96 A;  2HYF A;  1KQ0 A;  3ZPL A;  3BDD A;  1YFH A;  1FOK A;  1KGS A;  1Z6T A;  4KFC A;  1AWC A;  3F8M A;  2Z5U A;  1YTY A;  2VBX A;  4OIR F;  5D6F A;  1R1V A;  4P9F A;  4A5N A;  5D5W B;  2Q0O A;  5D4S A;  1LDJ A;  1FBQ A;  3IRR A;  4HA8 A;  2UWM A;  2AXL A;  4RGU A;  3R4K A;  1JHF A;  2L54 A;  2Y75 A;  1Z91 A;  4M9X A;  4CDG A;  3KEO A;  2FSW A;  4LLG F;  4AIJ A;  2OA4 A;  3BJO A;  2A6H F;  2PQ8 A;  3BRO A;  4E70 A;  2A68 F;  2HTS A;  2QQB A;  2J5O A;  1LDD A;  1T98 A;  2LSO A;  3MCZ A;  2CO5 A;  4WK8 F;  2W57 A;  1ON1 A;  2D1V A;  1HW1 A;  1ZHF A;  1UHW A;  1O3T A;  2Z9O A;  2G7U A;  1KU3 A;  2HKX A;  2FMY A;  1YW9 A;  3GX4 X;  5HS8 A;  4A12 A;  2LF7 A;  4GXO A;  1SFE A;  3RKX A;  1FWZ A;  4M74 A;  3HRM A;  4LB6 B;  2VOO A;  1IRF A;  4I01 A;  2XV4 S;  2DPD A;  1P2F A;  3ZMU A;  3W6K B;  4HF1 A;  2ELH A;  1E2X A;  3LQQ A;  2H6C A;  4EJT A;  1BC8 C;  4EJV A;  3Q9V A;  1UHM A;  2YR2 A;  3L9F A;  4LG0 A;  4FX4 A;  2HZT A;  4IRH A;  3LA2 A;  4Y17 A;  3GLX A;  3DFG A;  5EEH A;  1ZAR A;  1XGM A;  3LA3 A;  5J6X A;  3ECO A;  2QVO A;  4N0B A;  2Y0M A;  2L4A A;  2LF8 A;  5HLI A;  2P6S A;  5DV5 A;  3KZZ A;  3QP6 A;  1G3S A;  2MBF A;  2XHK A;  4EV0 A;  3L7W A;  5BOX A;  1U6G A;  3RI4 A;  1EH8 A;  2K27 A;  3M8E A;  1ZGJ A;  3RPU A;  4HLY A;  3D5L A;  3G73 A;  1MD0 A;  3ZN1 A;  4DNC A;  4PZJ A;  2RGV A;  1XN7 A;  1REP C;  1S7A A;  1NHA A;  5JVT A;  4EGY A;  4I02 A;  4A5M A;  3ML6 A;  5F64 A;  1FYM A;  1J59 A;  3LAJ A;  2M1B A;  4A2U A;  3JSO A;  3N4M A;  3RPQ A;  5E1X A;  1W7P B;  2KIM A;  1OYY A;  4OIN F;  2RDP A;  3SQN A;  4HX4 A;  2XKP A;  4U7D A;  3GWZ A;  1SFX A;  4BHC A;  3CLO A;  4HF0 A;  4S04 A;  2DK5 A;  2VT2 A;  3J81 Z;  1T38 A;  1LB2 A;  2VBY A;  4L5I A;  1X3U A;  1XDS A;  2F5E A;  4EJU A;  5LRR A;  5CVU A;  4KMU X;  4A6E A;  2P5K A;  5L3C A;  5F6F A;  3SHF A;  1FT9 A;  1TLH B;  3I64 A;  2DPU A;  3T5X A;  3ZMZ A;  2OZU A;  1XMA A;  4TV7 A;  5L3B A;  1G6N A;  2P8T A;  4MQ9 F;  2ACJ A;  2K4J A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...