4AIKA

Crystal structure of rova from yersinia in complex with an invasin promoter fragment
Total Genus 52
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
52
sequence length
139
structure length
139
Chain Sequence
b'STLGSDLARLVRVWRALIDHRLKPLELTQTHWVTLYNINRLPPEQSQIQLAKAIGIEQPSLVRTLDQLEEKGLITRHTSANDRRAKRIKLTEQSSPIIEQVDGVISSTRKEILGGISSDEIAVLSGLIDKLEKNIIQLQ'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords TRANSCRIPTIONAL REGULATOR SLYA
molecule tags Transcription
source organism Yersinia pseudotuberculosis
publication title Structural Basis for Intrinsic Thermosensing by the Master Virulence Regulator Rova of Yersinia.
pubmed doi rcsb
total genus 52
structure length 139
sequence length 139
chains with identical sequence B
ec nomenclature
pdb deposition date 2012-02-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01047 MarR MarR family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 4aikA00
5ED4A 4OIQF 1YW8A 4BXUA 2O0YA 2Z33A 1A04A 1B9NA 2LNBA 3M9AA 3FXQA 4OU0A 5DYMA 1Z05A 4A6DA 3ZMSA 4R79A 2R7FA 3P9KA 2O8XA 5FLXK 1P2FA 3LA3A 5E17F 3F6OA 3F8BA 1IXSB 5LHIA 1QNTA 2DPDA 3LQQA 4KMUX 4R8HA 2GZWA 1S29A 4ENKA 2YR2A 1IN4A 5K5OA 3P9IA 3HHGA 2W84A 5HS9A 1XGSA 3IRQA 1TBXA 2HQRA 4HX7A 4CHUA 1GVJA 3KEOA 3U2RA 1JHHA 1FYMA 1RI7A 2FMLA 4GGGA 3RYPA 1TLHB 5LEJA 3U1DA 1KU3A 2PMHA 4U0VA 1SAXA 2IVMA 1HKQA 3HTSB 5FD5A 3L9FA 5LGUA 1L3LA 2HDCA 1QZZA 3ELKA 3LWFA 2L4AA 4KN4X 3E5UA 2DW4A 2P4WA 3LFKA 4ESBA 5JFRA 1R23A 2H27A 1BC8C 3VB2A 2QVOA 4UUVA 1OYYA 1F1ZA 4Y17A 1XSDA 3ZMDA 1BOAA 1V3FA 2G9WA 2E7XA 4ZZDA 2XGXA 4I7HA 1ZG3A 4R1HA 4WXHA 4O3MA 1IN8A 2ZCWA 1B6AA 5FD6A 1YO5C 6PAXA 1IRFA 2K86A 4U7DA 3F8FA 2HS5A 4BHBA 3E5XA 4UV8A 3WTTC 1FT9A 1ZG5A 4EVIA 4ENNA 1XGOA 2L54A 4HYEA 5ERIA 2NS0A 4RGXA 2Q2EA 3BJOA 1I5ZA 5DD8A 1LDDA 3R61A 2KIMA 3SZTA 3N4MA 2MH9A 1EH7A 3T8TA 3V7CA 4EGYA 2FBIA 2H09A 2HKXA 4HBLA 4EJWA 1QBJA 1UHWA 3GYHX 2R7DA 2VE9A 2QQAA 3CO7C 3WTZA 1C0WA 2V79A 2MH2A 4L18B 4L9VA 5E1WA 1ZLJA 2OAZA 2M1BA 1T0FA 2JSCA 1BI0A 1R00A 3T5XA 3QAHA 4LFUA 4Q4ZF 1H9GA 2PN6A 5AIPA 4JBAA 5CLSA 5D8KB 3WGHA 1H0MA 3BDDA 2IT0A 2ZNZA 2GA1A 2A5YB 3WTXC 4BAYA 4UHTA 1O3SA 5E20A 1KU2A 3GFMA 2P7VB 1FWZA 2QUFA 1XB4A 3L00A 5E1XA 2K4BA 1ZH5A 5BOXA 1OYWA 1BIAA 1BI3A 3I59B 2OA4A 2D1VA 1K78A 1Z9CA 3BJ6A 3E6DA 2A3SA 3KETA 3GWZA 2MC3A 1QGPA 4S05A 3EQLF 1SD5A 2Y75A 4ON0A 4I0BA 3HUGA 2NRAC 1XD7A 1RUNA 2PEXA 4OMYA 5HDKA 4CICA 2DBBA 1RUOA 2ETHA 1P4XA 3LQRA 5L3EA 2VE8A 2RQPA 4EJTA 5J8CA 4EM1A 3WE3A 3LA2A 1S8NA 4A0YA 2FNPA 4IF4A 2VONA 1DUXC 2QZ8A 1JHFA 1PP8F 3HHHA 3ERED 4GO1A 4GXOA 3F8CA 1G3SA 4ETSA 1IF1A 1OKRA 3LAJA 1FP1D 4G8XA 4L5IA 4AD9A 4M73A 1ULYA 1TTYA 4B09A 5DEQA 4Q48A 2FSWA 4G94A 3K9TA 1USSA 1VTNC 4ENJA 5ILSA 5IT9K 4KICA 4WXCA 4XBFA 1BI2A 4AWXB 3L09A 1HKSA 1IN7A 1CF7B 3HTUA 2A07F 2LKPA 4O5VA 3CUQB 5L3BA 1Y0UA 4GCVA 1U6GA 2CG4A 2EFNA 2PLYA 4RB3C 3RKWA 3I5UA 5DCMA 3ZPLA 3JW4A 1XCBA 1SD7A 3MFKA 5BPIA 1G3TA 1PDNC 4JQFA 3C7JA 3HRUA 3FX3A 2EFOA 2STWA 5LGTA 1D5VA 4IRHA 4Y15A 3EETA 1TW3A 2STTA 2VBYA 2CSOA 3TKYA 2JZYA 2XRNA 1R36A 2DT5A 4YIFA 2M8EA 2CO5A 3WE2A 2CQKA 2VC1A 4P55A 3CO6C 3F3XA 4BH9A 4BYYA 1KQ8A 4ENMA 2XROA 2B0LA 2EV5A 3COAC 1W5SA 2Y0MA 2Y48A 3GFLA 5CYVA 1F9NA 3IRRA 3FXRA 3SFZA 2H94A 1LEAA 2HWVA 4IHTA 5K1YA 3J7AO 1LVAA 3MZHA 4LK1F 2FQ3A 4KT5C 4CZZA 2PBIA 1FNNA 4NHJA 5ICCA 3LA7A 1MDMA 2QM3A 3LSTA 4HX8A 3GUDA 2HTSA 2X4HA 4WWCA 3I0TA 5H6QA 3KEQA 5H6RA 1RZ4A 4EMSA 1D8JA 4ZYEA 4IPAA 3IWFA 1K6OA 3KCCA 4KNYA 4RB2C 5DCMB 3EYYA 3EUHA 2DLLA 3I71A 2EJRA 4YIIA 3HIFA 1SFXA 4L9TA 1V4RA 4YFXF 3HRSA 5ICEA 3F23A 1YTYA 2OZ6A 2ZBKA 3WTYC 5LRSA 4LLLA 4MQ9F 2ZMEA 1IN6A 3FMRA 1HSJA 5AIQA 3TOBA 2FF4A 3MZYA 4FT8A 4ESJA 2OU2A 2XAFA 3CLOA 2PG4A 4G6DA 2W85A 1T98A 2EWNA 2IPQX 1MGTA 1ZN2A 1E2XA 2CW0F 4U88A 2DTRA 5D4RA 4M6XA 2RVCA 1WQ2A 4KIGA 4NQWA 2NNNA 4LMYA 2GQQA 1U78A 4M6YA 1DPUA 3ZN0A 4I09A 3VFZA 3KFWX 2ZJ2A 3V8LA 2GWRA 2OD5A 1XGMA 5CVIA 1CF7A 1FX7A 3IHUA 4UVCA 3JSOA 2FOKA 3H3UA 1RNLA 1JXSA 3OOPA 4ZYGA 1W5TA 3ZQ7A 4PCQA 3VODA 3GW2A 2DU9A 5K5QA 2FBHA 2A6EF 4AIKA 3JSPA 2OQGA 4KIFA 2XUBA 2OBPA 4IJAA 2M5WA 3FMQA 2FU4A 2NNYA 1IW7F 1OR7A 2IJLA 3IC7A 3GX4X 4EM0B 5EEHA 4HZFA 5FGMA 5LGNA 4DNCA 3NRVA 2QQBA 1K7AA 1CGPA 4EV0A 1BBYA 2VT3A 1J2XA 3WGGA 4HLXA 1FYKA 1P92A 3PQJA 3FZVA 2RN7A 2QQ9A 4IRGA 3BPXA 4BQAA 2PJPA 2DI3A 2BE5F 2PFBA 1ZGAA 2BBYA 5D8LB 5JR3A 2XIGA 1R5GA 3W6KB 3G3ZA 3KZZA 4A0ZA 1STZA 3O2PE 1E17A 3QPTA 3V7RA 3Q5FA 1Z7UA 3E6MA 1I1GA 1L0OC 2VC0A 1SMYF 3VOEA 1YFHA 2HYGD 4HOBA 2Q0OA 2D1HA 2ZNYA 4LB5A 1S7OA 4YFNF 3TOAA 3HRMA 5BPDA 2XAQA 3F8NA 3K69A 3P9CA 2EFQA 2QBYA 4HA8A 2RKHA 1S3JA 4P5OA 3I64A 2JTVA 3K2ZA 5HOOA 3JAMK 1LEBA 3TQNA 2XAJA 1FC3A 1J5YA 2EFPA 1ZARA 1TQMA 4L0YB 3DEUA 2P8TA 3N97A 2Z3YA 1ZAOA 3DP7A 1G3YA 4ESFA 2J5OA 2LDUA 1I6XA 3I54A 1Q1HA 2A68F 5CVJA 4Q47A 4L9JA 1RIOH 3MEXA 3E5QA 3TO7A 3G73A 4P96A 3VEPA 1Z6TA 4M71A 4I01A 2E1CA 3SQNA 3REOA 5JI6A 2EA4A 2HZTA 4LD5A 1LJ9A 1ODDA 1ZREA 4FHTA 4PGGA 5A2QZ 2MLKA 3GLXA 1HKTA 1HW5A 1XDUA 3BWGA 2BEOA 2GA2A 2L4MA 1T39A 2ZXJA 1T2KA 3WGIA 3R4KA 5FO5A 2P5KA 2RGVA 5DV5A 2AS5F 3WTWC 1R22A 3CDHA 1F4KA 1SMTA 2AXLA 3FHZA 3DQVC 4CDGA 2COMA 2NYXA 4RB0A 2OZUA 4M72A 3GFIA 5DD4A 5JHUA 3GO5A 3RPUA 4S04A 1FY7A 3WTSC 3WU1B 3H3ZA 4AIHA 5E18F 3KLOA 3BOQA 4U0WA 1LDJA 5HLIA 2L02A 3DXJF 4QLCU 3KLNA 2VOOA 4F7ZA 1P4AA 5TRDA 1AWCA 3R60A 1KGSA 2BV6A 4N9IA 3ZMTA 3F22A 1PUEE 5J6XA 4Q5SF 2JPBA 4AIJA 3RPQA 1G4DA 4EM2A 3CUOA 2RV8A 4A12A 3HOSA 1P6RA 2K4JA 2WV0A 3ECHA 4UV9A 2MD5A 4PZJA 2K7LA 3CUQC 2A6HF 1MDMB 3GXOA 4GYGA 3FWEA 3WTVC 1BN5A 3NQOA 5D6EA 3MWMA 3ROUA 3WG9A 1LQ1A 2R3SA 5BMZA 3JTGA 4EGZA 1DPRA 4WX9A 2XKOA 3BROA 5A2QK 1YIOA 3KP6A 5IT3A 2RDPA 3RI4A 3M8EA 4MHGA 1G6NA 1FSEA 3CJNA 2WWYA 3DKWA 3HOTA 3E3VA 1U5TB 1UCRA 1HBXG 3M8FA 1P4WA 1BM9A 4P9FA 5F1RA 4L0ZB 3HYIA 4RAYA 4M9ZA 2KIUA 2YX7A 4IRIA 4RAZA 4XLNF 1KQ9A 1KQ0A 1MKMA 3IWZA 3PFIA 4YFKF 2NAZA 3KE2A 4HF2A 3B02A 2F5FA 1DDNA 2QYOA 2Z5UA 5LHHA 3ZMZA 5J8FA 4OIRF 2L3DA 2P6TA 5CVVA 4Y13A 4OMZA 5DUIA 3QU3A 4JK1X 3HRTA 2IP2A 4UXNA 3KZYA 1HW2A 5LRRA 2HOEA 1WKMA 1IUYA 1B59A 2DAOA 2BYVE 4MTDA 3ABUA 1YYVA 2ADUA 3K1PA 4A6EA 2O6GE 3DPTA 1UHMA 2ESNA 4TV7A 5D5XB 2DQRA 1XN7A 2P5VA 4ASNA 2EA2A 4PGHA 3WU0A 2VODA 2FA5A 2F5DA 3MCZA 4Z2YA 1EH8A 2YU3A 1QQIA 4HQEA 2M45A 4MNUA 3IKTA 1BI1A 4IXAA 2H6CA 2XHKA 2KJBA 2PI0A 1LDKB 2DQLA 4LJZF 1J9IA 4LK0F 3HSEA 4IHSA 4U7BA 3U9GA 1USTA 4HV5A 3E6BA 3RDIA 4MEXF 4G7HF 5D5VB 2HYFA 3FM3A 5F6FA 2M30A 3M7GA 4FX4A 3GZ5A 4N9HA 3CUQA 3F72A 3L2CA 4XSZF 5H20A 3KP3A 3Q9SA 1TQIA 2UXXA 2RNJA 2WTEA 2PMUA 2KKOA 2HQNA 5FFXA 4OIOF 5HVQC 3F6VA 3ISPA 3E6CC 4WF2A 2V1DA 4RGUA 4G9YA 1J59A 2J5PA 2KIFA 3BPVA 2FBKA 2VN2A 2ZKZA 2F5EA 4I98B 3QP6A 5TJJA 4RS8A 2V1XA 4UVBA 1XGNA 1KU9A 2L01A 1WWXA 2UZKA 5CJ9A 1IN5A 3SXYA 1D8KA 2E7WA 1FYLA 4UNOA 5HDNA 3J80K 3E97A 1B4AA 4I2OA 1KU7A 4MQVA 4EJUA 3GF2A 3T8RA 4YG2F 1YLFA 1KYZA 1YS7A 4O6JA 5E1ZB 2VBZA 3RJPA 3GZ6A 1JGSA 2XVCA 3J81Z 3D0SA 4RGRA 4WCGA 4KN7X 4WK8F 4A5MA 3SHFA 4HDVA 1YG2A 1K78B 3D5LA 3V7SA 4ZYHA 1ZHFA 4A5NA 1FZPB 2GXGA 2ZFWA 1U8RA 1S6LA 3DFGA 5BS6A 1GHCA 4A0XA 2D45A 1WSUA 4GYIA 1R1VA 5D6FA 2ISZA 3QPHA 4BHPA 3IL2A 4EJVA 2FEZA 1IXCA 4HX4A 1Z6RA 4OOIA 3DPLC 2KRFA 1GXQA 3GEZA 3I58A 4ZZLA 2QENA 3EDPA 1SD4A 2P7CB 5ILVA 2VOPA 4LGWA 1YQAA 3K1NA 5DCFA 2HTJA 1R7JA 2IA0A 3GVAA 1B1BA 2IA1A 2A69F 2W57A 3C3WA 4B8XA 3FM5A 2K27A 3BZ6A 3KP7A 3O3KA 1B9MA 3B73A 4L9NA 3V8KA 4HV6A 2QWWA 2W24A 3W6JB 1O3RA 2UWMA 2JPCA 1G3WA 4OINF 1W4MA 2TDXA 3ZN1A 4M9SA 1R1TA 1GXPA 3S2WA 1UB9A 1I1SA 1SD6A 3ML6A 3JTHA 3R0JA 3HSRA 3RTRA 5ICGA 4HLYA 4U0YA 2G7HA 1O7LA 1IXRC 3V8JA 2CFXA 4HF0A 3AAFA 2YPRA 2FE3A 2Q8KA 1I27A 4CGZA 1ZRCA 1WI9A 2DK5A 4HQMA 4KUMA 4HAMA 4BNCA 3ZP5A 3R0AA 2M87A 5HLHA 1MD0A 1ON2A 2KJCA 1PP7U 3KP4A 2EFWA 1F5TA 2XAGA 1UFMA 4RB1A 4XLPF 2YX4A 1YW9A 3QRFF 5D4SA 4PDKA 2D2WA 2XKPA 3O6BB 1ON1A 5K5RA 2P5LC 2WC2A 2IRFG 1MJ9A 2H6BA 3MAJA 3H92A 4I02A 4OIPF 3TO9A 2HR3A 1J0RA 5L3FA 2Z99A 2XASA 5HDGA 3QOPA 2FNAA 3TDZC 5DUKA 1U5TA 1SFEA 5ICFA 1BJAA 4CYDA 3GFJA 3F8MA 4BHCA 2HFHA 5LHGA 4MTEA 3RKYA 4KA4A 4UVAA 1ZLKA 2GAUA 1FP2A 3L7WA 4M9XA 1LB2A 4ZH4F 1XSXA 1H9TA 1W7PD 3M1EA 1IRGA 4LLGF 1FSHA 5E8IA 4RGSA 5HLGA 3EYIA 2GXBA 2O03A 3P7NA 4EQQA 2X0LA 5FB2A 5KK1A 3F21A 1EV7A 2DO7A 1SFUA 1NHAA 1FLIA 5E8GA 4G7ZF 2DK8A 3WODF 1T38A 2A61A 5HS8A 5LEKA 2O61A 5AONA 2F5CA 2CWEA 1KYWA 4LLNA 5LLQA 4G6QA 1DP7P 1X3UA 2LF8A 3ULQB 2DPUA 4IVNA 2YSRA 1XSVA 4HW0A 3TDUC 3I4PA 5D5WB 1HQCA 2RC4A 3PQKA 3I53A 1QO0D 4HF1A 3T1BA 4ZYDA 1W7PB 4LG0B 2ISYA 1FPQA 1TQPA 4KYWA 4MGRA 5FFZA 3IKVA 3I59A 5L3DA 3ABTA 1O7FA 3BJAA 1XMAA 3ZMVA 2VT2A 1ZGJA 4XSXF 3FMSA 1HXDA 1WRJA 1K79A 1ZG1A 2VBWA 1O57A 1JE8A 3CTAA 2P6SA 1ONVA 5EEGA 1OPCA 2QBYB 2EK5A 4AVPA 3KP2A 4K2EA 1U5TC 1HW1A 4KIBA 2LSOA 3FXUA 3TO6A 3C1DA 2MBFA 2V1UA 2XAHA 1YS6A 1R5HA 5CVRA 4L5JA 1U3EM 2HEOA 1U2WA 3BP8A 3RIRA 1REPC 4FX0A 5BQTA 2FXAA 2ACJA 1QZYA 1Z1DA 1XDSA 1AOYA 5JVTA 3MQ0A 4QWQA 2HGCA 2EV0A 4P9UA 1D3YA 1J75A 2W25A 1FBUA 2JT1A 2HKOA 3LAPA 4G7OF 2CYYA 2FRHA 5IT9Z 1O3TA 1ZRDA 4CXFA 4WXDA 1QPMA 3C18A 1BIBA 3FF5A 2LF7A 1BC7C 3J80Z 1TW2A 5ILUA 2JRTA 1EH6A 1OYIA 2PQ8A 5CVUA 1T6SA 4KFCA 1FBQA 5LBQA 2C6YA 4E70A 2EV6A 2IW5A 2V9VA 3Q9VA 1IZ1A 2ESHA 4EJOA 2ELHA 1ZYRF 3TGNA 4MEYF 4NB5A 3OV8A 1MZBA 2CGPA 1XMKA 1W7PA 2FMYA 3BY6A 1R58A 3T0YA 1TNSA 2MLGA 5HS7A 5KVRA 1J7KA 3HSFA 3QP5A 1OMIA 4DQ2A 5F64A 1FOKA 2Z9OA 2VXZA 3JAMZ 4I0AA 3DV8A 2VBXA 5L3CA 5FLXZ 2O3FA 1XCVA 2GIVA 3K0LA 1TNTA 2V6CA 2E1NA 3NEUA 5L3GA 4KMFA 1MJBA 1R1UA 3K1MA 1S7AA 2EB7A 4CO8A 1LNWA 1Z91A 3WTUC 3DF8A 2MA3A 4HDUA 4XRFA 2F2EA 2XV4S 3ZMUA 4LB6B 2K02A 5DDGA 4KDPA 3R6SA 3QU6A 1FBSA 4D0PA 2QLZA 4N0BA 2ZO4A 5D5UB 2ZMEB 4LG0A 3RYRA 2UXNA 3RKXA 3J81K 2DFIA 1MJAA 1YW7A 3ECOA 2G7UA 2BGCA 1KA8A 1ZRFA 2OQRA 2IA2A 3KP5A 4M74A 1O3QA 4A2UA 3V4GA 1HSTA 3SZPA 1IAWA 4H0EA
chains in the Genus database with same CATH superfamily
5ED4A 4OIQF 1MH3A 2LY1A 1YW8A 3NARA 4BXUA 4M6VA 2O0YA 1ETOA 3BT9A 1TWHJ 1VQ7I 5M5XJ 3K2AA 1A04A 2Z33A 1B9NA 1POGA 1MW7A 4DBQA 4F93B 4IO9F 4DZJA 2LNBA 3AG2H 3M9AA 4E7SA 3FXQA 4OU0A 5DYMA 1Z05A 2KISA 4A6DA 3ZMSA 2WV1A 4R79A 1X1CA 2Z16A 5HODA 2R7FA 2XF6A 2O8XA 3P9KA 3O8GA 2MYSA 3DTIA 5FLXK 1P2FA 3LA3A 2JSPA 1A35A 5E17F 4AC0A 5J1RA 3F6OA 3F8BA 1IXSB 5LHIA 3OYIA 4QPQA 3OSGA 1QNTA 2DPDA 4KITB 5B1BH 1IGNA 1T33A 3LQQA 4KMUX 4R8HA 4NUBA 3OIQA 2GZWA 1S29A 4ENKA 2YR2A 1IN4A 2XPUA 5K5OA 3P9IA 3OYNA 3HHGA 2CV2A 4W97A 3CC7I 1JGGA 5JLWA 2W84A 3GBGA 5HS9A 1XGSA 1D0YA 1TBXA 3IRQA 3NWTA 2HQRA 4HX7A 4CHUA 4J00A 1GVJA 3KEOA 3U2RA 1JHHA 1FYMA 1P7IA 1RI7A 3BQZA 3PIPF 2FMLA 3LSKA 2NVXJ 4GGGA 2FD5A 4ITVA 3RYPA 1TLHB 4RAGA 5LEJA 3U1DA 2V26A 4A3JJ 4F3QA 1KU3A 2PMHA 4U0VA 1VQMI 1SAXA 2IVMA 2PJRA 1RC9A 1HKQA 2F48A 3HTSB 4PSXA 3L1PA 2HOTA 5FD5A 3L9FA 3S1MJ 5LGUA 5BNGA 4J01A 1L3LA 2HDCA 3LMMA 1QZZA 3ELKA 3B6CA 3RQ4A 3LWFA 3OYAA 2DT6A 2L4AA 1JUSA 4KN4X 5HNFA 3E5UA 4KJZA 2DW4A 2P4WA 3LFKA 4ESBA 5JFRA 2YU9J 1R23A 2H27A 1A31A 1BC8C 3VB2A 2QVOA 4UUVA 4QPOA 3GTLJ 1OYYA 1F1ZA 3HC7A 2MW8A 4XLHA 4Y17A 1XSDA 2V9KA 2VKDA 3ZMDA 1BOAA 3KZIC 4E4HA 1U8BA 4NDLA 1TL8A 1V3FA 3FXLA 4BJ6C 5EDNA 2B63J 2BY1A 3H5NA 1VQPI 3ZRGA 1Y0NA 2QGUA 3O8HA 2BY3A 4E7JA 2G9WA 4B47A 3GTJJ 4BBSJ 3C2GA 2E7XA 4ZZDA 4JX4A 1HOMA 3DLAA 3G4SI 2XGXA 4I7HA 1X19A 1ZG3A 4R1HA 4WXHA 1MH4A 4O3MA 1IN8A 3OYJA 2ZCWA 1B6AA 1G59A 5FD6A 1YO5C 6PAXA 1IRFA 2H1LA 4IHVA 2K86A 4U7DA 2DMNA 1VNDA 3ZR8X 3BTCA 3F8FA 2HS5A 4BHBA 2AO9A 1YJNI 1JUMA 1X2MA 1LKXA 3V42A 3E5XA 2XC7A 4UV8A 1Y39A 3WTTC 1FT9A 2DMUA 1ZG5A 4HSRA 4EVIA 3OYEA 3QWLA 4XM3A 3ASNH 5K7FA 4X6AJ 4ENNA 1XGOA 3CDIA 2L54A 3OL3A 4HYEA 3I55I 4XICA 2M3AA 4PJMA 5LFAA 1RKTA 3EUKL 1MMNA 2NS0A 5ERIA 5IY5H 4RGXA 2Q2EA 3H1CA 3S14J 3BJOA 1I5ZA 5DD8A 1O4XA 1ZR2A 1LDDA 3R61A 5LD2C 2KIMA 3K4LA 4KT6A 1EF4A 3SZTA 3N4MA 5GPAA 2MH9A 3S3OA 1EH7A 2VIXA 3ESWB 3T8TA 2WA0A 4A3MJ 3V7CA 4EGYA 2Z2SB 1VF9A 2FBIA 2H09A 1LVKA 2HKXA 3HOWJ 3VSLA 4HBLA 4EJWA 4II3A 1QBJA 4XL9A 1WCMJ 1UHWA 2X9DA 3N05A 3GYHX 2R7DA 3RPUD 2VE9A 2QQAA 3CO7C 3WTZA 1C0WA 2LYCA 2ZXHA 1ZKGA 2V79A 2MH2A 3VYUB 1WFXA 2L7FP 4L18B 3LSGA 4L9VA 5E1WA 1ZLJA 2CQXA 2OAZA 4E7KA 2M1BA 2I8DA 1T0FA 2TCTA 4BQNA 2JSCA 1BI0A 2DTZA 1R00A 4D5CA 3T5XA 3S2HJ 1TT5B 2DMTA 3QAHA 1U9NA 3DBLB 4C3HJ 2JA7J 3H9JA 2LD5A 1Z3XA 4C2MJ 4LFUA 4C3IJ 4XRMA 3BR2A 4Q4ZF 3H3VK 3ZQIA 2HI3A 1H9GA 5B5EC 2PN6A 3OYLA 5AIPA 3TW7A 4JBAA 3EPZA 1ZGWA 1V54H 2VQCA 5C44J 5CQEA 4BUPA 5CLSA 5D8KB 3WGHA 1H0MA 3OOUA 3S1RJ 3BDDA 3A02A 2IT0A 1WJCA 1ETVA 3ABMH 4RDUA 2ZNZA 1WJDA 2GA1A 2A5YB 2ID3A 3WTXC 3DEWA 3Q0UA 4BAYA 4UHTA 5EZGA 1O3SA 5E20A 1KU2A 3QYEA 3GFMA 2P7VB 1FWZA 4S0HB 3U1KA 2QUFA 1XB4A 1G8XA 3L00A 1SAUA 4GDFA 2A6TA 5E1XA 2K4BA 1K83J 4B43A 1ZH5A 5BOXA 1OYWA 1BI3A 1BIAA 3OYMA 5TGTA 3H35A 3S3MA 3BCBA 4D7NA 5IP9J 3I59B 4BQOA 1EA3A 2OA4A 2D1VA 2RREA 2OUMA 1Z9CA 1K78A 3BJ6A 5DTDA 1AKHB 3E6DA 3K10A 2A3SA 4PJJA 3KETA 3GWZA 2JA8J 3M8JA 2EZHA 5GAHJ 3FISA 2MC3A 1QGPA 4S05A 2F6CA 1XPXA 1U0JA 3EQLF 2H8WA 1SD5A 2Y75A 2M34A 4ON0A 2WY8Q 2DOFA 3PNTA 4I0BA 1TP4A 1RRJA 1Y1WJ 3HUGA 2NRAC 2HQ5A 1YRNA 3H5AA 1XD7A 1RUNA 4CCNA 2PEXA 4OMYA 5HDKA 1FTTA 1OQYA 4CICA 2DBBA 3LOCA 1SC7A 1RUOA 2ETHA 1P4XA 2QKLB 5HNHA 2KMUA 3LQRA 5L3EA 2CFOA 2VE8A 2E60A 1JTXA 2RQPA 4EJTA 5J8CA 4EM1A 3WE3A 2Y9ZA 1T56A 1S8NA 3LA2A 4A0YA 3DPUA 3RZOJ 2FNPA 2DT7B 4IF4A 4CH7A 2VONA 1DUXC 1NK2P 5GAGJ 2QZ8A 1JHFA 3ZGKA 2XAUA 1PP8F 3HHHA 3CP8A 3ERED 4XKVA 2KRCA 4BS9A 3BG7A 4GO1A 4GXOA 3F8CA 4Y52J 1G3SA 4ETSA 1IF1A 1OKRA 2OJED 1I3QJ 3LAJA 1EKEA 1FP1D 4G8XA 4L5IA 4AD9A 3HGGA 4M73A 1VQ8I 4CA0A 2QA4I 1TTYA 1ULYA 4B09A 1PYVA 5DEQA 3K6GA 4Q48A 2FSWA 1OCOH 4G94A 3K9TA 1K4TA 1USSA 3CD6I 3TEDA 1QPIA 3RCOA 1VTNC 1ETYA 4E7HA 4ENJA 5ILSA 2VQGA 4KICA 5IT9K 5K7HA 1BW5A 2X1DA 2R4GA 3I56I 4WXCA 2CU7A 4XBFA 1BI2A 4AWXB 3OS1A 4B3XA 3L09A 1HKSA 2Q2EB 3CCMI 2EH3A 3GCMA 4XQFA 1WH7A 1TWCJ 1IN7A 2BVMA 4ZDLA 3NAUA 1CF7B 1GV2A 2NS7A 3HTUA 1GLNA 1RESA 2R7VA 2LBFA 4ANJA 1N25A 1YE9A 2KT0A 2A07F 2KZGA 3A1YA 2LKPA 3CUQB 4O5VA 1IUFA 5L3BA 1Y0UA 4BJTA 4GCVA 3SEQA 1JT0A 1U6GA 2CG4A 2EFNA 5EYRA 2PLYA 3VYTB 4RB3C 3RKWA 4P1WA 1JTYA 3Q3SA 3I5UA 5DCMA 3ZPLA 2W1OA 4EEFG 3JW4A 1XCBA 3CCSI 1SD7A 3MFKA 2NXNB 5BPIA 1G3TA 1PDNC 4JQFA 3L2RA 2R7RA 4CYCA 1P7JA 4AYBA 2AQFA 3HRUA 3C7JA 3FXOA 1OJLA 3FX3A 1TWGJ 5KAIC 3HKZA 2EFOA 5JVGF 2STWA 5LGTA 2V6EA 2OCEA 3BTLA 2ZJPF 4N4NB 1D5VA 4IRHA 1ACIA 4Y15A 3EETA 3K7AJ 1TW3A 2EZKA 4AVZA 2STTA 2CQQA 2VBYA 2CSOA 2X48A 4DOZA 3KYCB 3TKYA 2WAFA 3Q0VA 2VASA 2JZYA 2XRNA 3LSPA 2L2OA 3CCQI 2CW7A 1MMDA 1R36A 1SANA 3SYTA 2DT5A 4YIFA 2M8EA 1Y8QB 2CO5A 2Y0SA 1XC5A 2MSYA 5FKOA 3WE2A 2CQKA 4C3JJ 2VC1A 4P55A 2DOAA 3CO6C 3F3XA 3G1LA 3ONQA 4BH9A 4BYYA 5F08A 1KQ8A 4ENMA 4JOMA 1MNMC 1WVRA 2XROA 2B0LA 2EV5A 4LOCA 1W5SA 4XLFA 3COAC 2JQ7A 2Y0MA 3HZJA 1UELB 2Y48A 3GFLA 1MSEC 5CYVA 1F9NA 3K4CA 1WGXA 2L0KA 2M4KA 3IRRA 2ZB9A 3FXRA 3SFZA 2H94A 3IUOA 4DBRA 4A3FJ 1LEAA 2VKEA 1FOWA 2Y9YA 2HWVA 1IO2A 2MFZA 5K1YA 4IHTA 1X4PA 2LTPA 3J7AO 1LVAA 2X6YA 4BEHB 4RMNA 4LK1F 1D1AA 2E1MC 3MZHA 1D1CA 4XKWA 3A01B 2FQ3A 4KT5C 2X6XA 4RAFA 4CZZA 1HC8A 2DMQA 1JKOC 2PBIA 2EILH 1FNNA 1YOVB 4NHJA 5ICCA 1UZCA 2L7ZA 3LA7A 3Q0WA 1MDMA 3HGYA 3LSJA 5F0FA 1OCZH 2QM3A 3LSTA 2MD0A 4HX8A 1R5ID 3ZCOA 3GUDA 2HTSA 2X4HA 2VJ5A 4WWCA 3W3CA 3I0TA 3BR5A 5H6QA 2VJJA 2ECCA 2F4MB 3KEQA 4V19K 5H6RA 1RZ4A 5GADJ 2Y0SN 4EMSA 1RR8C 3L2QA 1D8JA 4ZYEA 4IPAA 3PSFA 3IAS2 2W4SA 3A01A 2MABA 2JRMA 3IWFA 1K6OA 3CCLI 3KCCA 4DYCA 4KNYA 2XF5A 2ZSIB 2LOOA 4RB2C 2DFFA 5DCMB 3EYYA 1VQ6I 3KYDB 1XS9A 3EUHA 2DLLA 4F52A 5IP6A 1IDYA 1FMWA 3I71A 3AKZA 2EJRA 4YIIA 2KDZA 3HIFA 1SFXA 4L9TA 2LBFB 2F4IA 1V4RA 4BE2A 1FTZA 3M07A 3TBIA 1WPKA 4YFXF 3HRSA 2UUZA 5ICEA 3F23A 1W5CC 1YTYA 2OZ6A 2ZBKA 4MIMA 3WTYC 2R0QC 5LRSA 2DA2A 1ZQ3P 4DYQA 2IGKA 4LLLA 4MQ9F 2YUSA 2ZMEA 1IN6A 3JREA 3FMRA 1HSJA 5AIQA 3TOBA 4BY1J 2FF4A 2MGQA 3MZYA 2CH0A 4FT8A 2L9RA 4ESJA 2OU2A 2XAFA 4XLAA 1VZ0A 2VB6A 3CLOA 2LRDA 2PG4A 5B66C 4G6DA 2W85A 1T98A 3L2UA 1JJ6C 2EWNA 2IPQX 2VXDA 4XRSA 3GTPJ 3A2KA 1OCPA 3ABLH 1MGTA 3LSRA 2CUFA 1ZN2A 1E2XA 2XSDC 2CW0F 4U88A 4DIQA 2DTRA 2DODA 2RQQA 5D4RA 4M6XA 2L5QA 2RVCA 1WQ2A 4KIGA 3WHCA 3ASOH 4NQWA 2NNNA 3QPSA 4LMYA 2YS9A 2GQQA 3LSIA 1U78A 4M6YA 3HL2A 4JYKA 1DPUA 5EG0A 3ZN0A 4GFBA 4I09A 3VFZA 3HB9A 4B4CA 3KFWX 5C4XJ 2ZJ2A 3MZ8A 3V8LA 2GWRA 2OTJI 2OD5A 1ERDA 1XGMA 5CVIA 1X1PA 4E7ZA 1JKPC 2FX0A 2XB5A 4X0GA 1CF7A 1FX7A 3A0BC 2ICWG 2GOMA 3IHUA 4UVCA 4FQGA 3JSOA 4I6ZA 3GTOJ 2FOKA 3H3UA 5F04A 1SVMA 2WAQN 1RNLA 1JXSA 5GAEJ 3I4MJ 3OMYA 1UMQA 3OOPA 4M3EA 1DGRM 2JA5J 4ZYGA 4HNVA 1B8IA 1ZK8A 1W5TA 1QVTA 2L7MP 2NOGA 3ZQ7A 4PCQA 4BQQA 4RM2A 2LLKA 3VODA 5J47A 5E3NA 1JI8A 4YELA 3GW2A 1M1EB 2Y31A 2DU9A 2FBHA 1MBKA 5K5QA 2A6EF 3AL0C 4AIKA 2X6WA 3JSPA 2OQGA 3KX2A 4KIFA 1SVLA 2I5UA 2XUBA 2OBPA 1HF0A 4HRIA 4IJAA 1N77A 2IBDA 2M5WA 4M3BA 1MBJA 3FMQA 1MBHA 2CJJA 2FU4A 2M7BA 2NNYA 5FRMA 3FK6A 3SDBA 3PFYA 1IW7F 1WJ5A 3DKXA 5M3MJ 1OR7A 2IJLA 3K70C 3OS2A 3IC7A 3GX4X 4XOPA 4XN0A 1I6HJ 4EM0B 5EEHA 1DP3A 3A4CA 3DLLF 4HZFA 5FGMA 4FASD 1APLC 5LGNA 4DNCA 1WZ2A 3NRVA 4Z6YA 2QQBA 1I39A 1K7AA 1CGPA 1VQNI 4EV0A 1BBYA 2VT3A 1J2XA 4DW6A 1KONA 1QZEA 4AUXA 2JUGA 3WGGA 2DA6A 5KAFC 4HLXA 1FYKA 2EIMH 1P92A 2Y30A 3PQJA 3FZVA 2RN7A 3FBNB 5GPCA 1VQ4I 3H9QA 3OR2C 1QVUA 1D5YA 2QQ9A 4IZZA 3CLQA 3VYRB 4IRGA 3JRCA 1YHQI 1OCRH 4RM3A 4BACA 3BPXA 2XPWA 4BQAA 2PJPA 3HOZJ 2DI3A 3WHBA 3S15J 2BE5F 4X1EA 5KNLA 2PFBA 4UB6C 1ZGAA 2BBYA 2XDVA 5D8LB 3GTKJ 3CJTB 5JR3A 2XIGA 4XONA 1R5GA 4UY8I 3W6KB 3G3ZA 2HDDA 3KZZA 5GTIC 3S3NA 4A0ZA 1STZA 3O2PE 3OS0A 1E17A 3BCAA 3QPTA 2X1EA 2VL8A 2V9PA 3VYSB 3V7RA 2WB1N 1A6QA 3Q5FA 2HPIA 1Z7UA 3E6MA 1NG7A 1I1GA 1L0OC 2B9SA 1ITYA 2ZJQF 3MKZA 2VC0A 1SMYF 3H5RA 3D5SC 3VOEA 4B48A 2QEXI 1YFHA 2HYGD 4HOBA 2Q0OA 2D1HA 2ZNYA 4LB5A 1I50J 3G1OA 1TC3C 1S7OA 4IL6C 4YFNF 3BTIA 3TOAA 3HRMA 4XNFA 5BPDA 3ZXSA 3BR3A 2XAQA 4PUSA 3F8NA 2OPTA 3K69A 3P9CA 2EFQA 2QBYA 4HA8A 2RKHA 1S3JA 4P5OA 3SEZA 3I64A 3PNVA 4LIVA 2JK3A 5M5YJ 2JTVA 3K2ZA 5HOOA 3JAMK 1HDDC 1LEBA 3TQNA 1WH5A 1QA6A 2XAJA 2CUZA 1FC3A 1J5YA 2EFPA 2X85A 2WADA 1ZARA 5E3OA 2OTLI 1QU3A 1TQMA 2ECBA 3K4JA 3W2AA 4L0YB 3PJRA 2IS6A 3FKJA 4BBRJ 4DJAA 3DEUA 2P8TA 3H0GJ 1FIPA 1MBFA 3N97A 2GM4A 2NVQJ 2Z3YA 1ZAOA 3DP7A 1G3YA 4BU2A 4BGDA 4ESFA 2J5OA 2LDUA 1K61A 1I6XA 3FXMA 3PSIA 2R7OA 3I54A 1Q1HA 4C30A 2A68F 5F0CA 4XLEA 5CVJA 1DU6A 1GV5A 3EUHC 4Q47A 4L9JA 4A3LJ 3S1QJ 1MMGA 1RIOH 3MEXA 3E5QA 4XMYA 2DN0A 3SJMA 1Q1VA 3TO7A 2JUCA 2KHMA 2KPMA 3CZ6A 3G73A 4P96A 3VEPA 1Z6TA 4M71A 4I01A 2W48A 2E1CA 3SQNA 3REOA 4XIDA 4J19A 2ZXIA 2HU9A 4XLCA 5JI6A 2LH9A 1X1DA 2K9MA 1T0FC 2EA4A 2HZTA 4LD5A 2NVTJ 1LJ9A 1ODDA 1ZREA 2GOXB 4FHTA 4PGGA 2LG4A 2MLKA 5A2QZ 3FXKA 3GLXA 1HKTA 1HW5A 1XDUA 3SDGA 3BWGA 2BEOA 2GA2A 2KRHA 2L4MA 1T39A 1H88C 3BZCA 2ZXJA 1NH3A 2EPFA 1T2KA 4HEA2 2PJRB 2K5CA 3WGIA 3KYLA 3R4KA 5FO5A 4M3DA 3CCVI 1HLVA 1Z0XA 2P5KA 2ME6A 2RGVA 5DV5A 2AS5F 3WTWC 1JJ8C 1R22A 3CDHA 3AG3H 1F4KA 1CQTA 1SMTA 3OYBA 2AXLA 3FHZA 3DQVC 4CDGA 2HPMA 4V2GA 2JVGA 2VLAA 2COMA 2NYXA 4RB0A 3CJRB 3WG7H 2EZLA 2NVUB 2O5RA 4BL0B 2MG4A 2OZUA 4NC6A 3CC2I 1E3HA 4FE7A 4H4KC 4LG3A 4M72A 2KP6A 3GFIA 3AG4H 5DD4A 1PJRA 2K9NA 2ZJRF 5JHUA 2H8RA 2EIJH 2IAIA 3GO5A 3RPUA 4S04A 1ORKA 1FY7A 1R9TJ 1LE8B 2EINH 1IRZA 3WTSC 3WU1B 3H3ZA 3BG3A 4AIHA 2QF7A 3QYBA 5J4YA 5E18F 1S5LC 2WBMA 4I99C 2E5NA 3KLOA 3KIOA 2Y69H 3BOQA 4U0WA 2ME0A 1LDJA 3HPHA 5HLIA 5M3FJ 4IOCF 2L02A 2HXIA 3CMAI 3DXJF 4QLCU 3KLNA 2VOOA 4Y3OA 2F4OB 4F7ZA 1P4AA 2DXIA 5TRDA 1A36A 1AWCA 3VDXA 3R60A 2RNGA 4G6TB 1HDPA 1KGSA 2BV6A 4N9IA 1W36D 2LC2A 3ZMTA 3F22A 1PUEE 4IQJA 5J6XA 2L9NA 2W7NA 2TRTA 4Q5SF 3BG6A 2JPBA 4AIJA 3RPQA 1G4DA 4E7IA 4EM2A 2V1NA 5H2FC 4RBOA 3CUOA 2RV8A 4A12A 3HOSA 1B72B 1P6RA 1R4NB 3SZGA 2K4JA 1FOXA 1QHGA 2LREA 4F92B 1ETKA 3MN2A 2WV0A 2R7ZJ 3ECHA 2ZC2A 2MD5A 4RLFA 4PZJA 2K7LA 4UV9A 2HVRA 3CUQC 2A6HF 2XPVA 1MDMB 3GXOA 1LE8A 4D5FA 2A5WA 5IPAA 4GYGA 2E2IJ 3FWEA 3WTVC 1BN5A 4LIUA 3NQOA 3H9GA 2XSJC 3MWMA 5D6EA 3ROUA 3WG9A 1LQ1A 2R3SA 2ZSHB 5BMZA 3JTGA 2IXSA 2BHZA 2DFHA 4EGZA 1DPRA 4WX9A 2XKOA 5EJCA 2Z1DA 5FLMJ 4YEJA 3BROA 3F9KA 2XF7A 5A2QK 1YIOA 3KP6A 1X1AA 5IT3A 2KIQA 2RDPA 3KEYA 3X2QH 2K9LA 4F55A 3RI4A 3M8EA 1P9QC 4XN3A 1B72A 3OIPA 4MHGA 1G6NA 1FSEA 4CCMA 3CJNA 2WWYA 3LFUA 2DYSH 5J1UA 5GTHC 1UG0A 3HXLA 3DKWA 1AU7A 3HOTA 3E3VA 2K3FA 4UB8C 1U5TB 1UCRA 1HA8A 1HBXG 3CP2A 2P81A 3D5RC 3M8FA 1PUFA 1P4WA 1BM9A 2OC6A 4P9FA 5F1RA 1Y8RB 4ZJZA 2NVYJ 1OISA 5IYBJ 3OYKA 4L0ZB 5FROA 3HYIA 4YRVA 1F43A 4RAYA 2HDWA 4RA2A 4PK4A 4M9ZA 2KIUA 2YX7A 4IRIA 4RAZA 3AFHA 3OWTA 2JVHA 4XKBA 3ZQLA 3W6VA 1G2HA 4XLNF 1KQ9A 1KQ0A 2VPRA 3ZQQA 4BKXA 3OYHA 1MKMA 3IWZA 3PFIA 3JRBA 1BR4A 4YFKF 2NAZA 1TWFJ 2QSGX 1ETWA 3KE2A 4HF2A 3B02A 2FOWA 3I9V2 2Q1ZB 4V2FA 2VI6A 1Z21A 3CF2A 2F5FA 1DDNA 2CV0A 2QYOA 2Z5UA 5LHHA 3ZMZA 5J8FA 2VUMJ 1GVDA 4OIRF 1XTAA 4BEHA 3OIOA 2VKVA 1X58A 3CDLA 2LY9A 1FMVA 2L3DA 2P6TA 5CVVA 4Y13A 3JRAA 2DA4A 4OMZA 5DUIA 3QU3A 4JK1X 3HRTA 2IP2A 4UXNA 2IGNA 2M0CA 5DM7F 3M3YJ 5E3MA 4ZDOA 3KZYA 4L5EA 5LRRA 1HW2A 2HOEA 1IRXA 3OL4A 2E71A 2FQ4A 1WKMA 3RZDJ 2E36A 2XB0X 1IUYA 1F36A 1YIJI 3K70D 2IS2A 1B59A 2DAOA 2BYVE 4MTDA 3ABUA 4IQ4A 3RKQA 3M1CA 1XG1A 1YYVA 2NOJB 2ADUA 3K1PA 4A6EA 2O6GE 3S8PA 3DPTA 2A05A 1JKRC 1R6RA 4KISA 1UHMA 2ESNA 2AXTC 2QCOA 4TV7A 5D5XB 2DQRA 1XN7A 2P5VA 4ASNA 2VQLA 2EA2A 4PGHA 3WU0A 3E0JB 2VODA 4A93J 4AM3A 2FA5A 2F5DA 3MCZA 4Z2YA 2VJIA 5EZHA 1D0XA 1EH8A 2YU3A 1E0EA 1QQIA 4HQEA 2M45A 4MNUA 2FUG2 3IKTA 4B3AA 1BI1A 3DTEA 1FJLA 4IXAA 2H6CA 2XHKA 5E79C 2LP0A 2KJBA 3J7ZI 2PI0A 1LDKB 1GT0C 3BG5A 3CJQB 1VQLI 5J3LA 4ZTJA 2R7SA 5K7ZA 1OFCX 1QHHD 2DQLA 4LJZF 3SFIA 1V5GA 4LK0F 4ZDPA 1T8IA 3IH3A 2JN6A 1J9IA 3HSEA 3OYDA 4IHSA 4U7BA 3U9GA 2Y2ZA 3OYFA 1USTA 3CCEI 1BL0A 1VFCA 4HV5A 2W82A 3E6BA 2E1MB 3RDIA 4MEXF 4G7HF 2DA7A 4IEJA 4XK4A 1MNEA 3DTKA 5D5VB 1JT6A 2HYFA 3FM3A 5IOZA 5F6FA 2M30A 4XRSG 3M7GA 1WJAA 4FX4A 1ENHA 2F5VA 1MMSA 3GZ5A 3LSHA 4N9HA 3VWBA 4AU7A 2X6OA 3CUQA 3AG1H 1LFPA 3F72A 3S1NJ 1X3WB 3L2CA 4XSZF 3C2BA 2R5YB 4CZCA 2BHYA 1SFOJ 5H20A 2O7OA 3BLYA 3KP3A 4Y33A 3Q9SA 4IHXA 1TQIA 3HEFA 2UXXA 2RNJA 2WTEA 1J09A 2PMUA 5B3SH 2K85A 5C4JJ 1FOYA 2KKOA 2HQNA 5FFXA 2R92J 4MFEA 5HVQC 4OIOF 3F6VA 5J4VA 3ISPA 3E6CC 5E3LA 2KLOA 4WF2A 4CUGA 4BE1A 2JA2A 3DCFA 4EATA 2K40A 2V1DA 4RGUA 4C2UA 4G9YA 1J59A 2J5PA 3F0CA 2KIFA 2DA5A 3IH2A 2HVSA 3BPVA 4D7MA 3HDDA 2FBKA 2VN2A 2ZKZA 3H36A 2F5EA 4I98B 3QP6A 3PL8A 1AHDP 1IG7A 1WJFA 5IYCJ 4Y7NJ 3OSFA 4HG2A 5TJJA 4RS8A 3HG9A 2V1XA 2R5ZA 3HM5A 4UVBA 4A3EJ 1XGNA 1KU9A 2M2EA 2L01A 1WWXA 3UR3C 2UZKA 5CJ9A 1IN5A 3SXYA 2BW3B 2GXAA 1D8KA 1SEUA 2E7WA 1FYLA 4B1RA 4UNOA 5HDNA 3J80K 4BY7J 4LITA 3E97A 3MD2A 5DM6F 1B4AA 1JUPA 4A3CJ 3OR1C 4I2OA 1KU7A 3JRIA 2IEKA 4MQVA 3OYCA 4EJUA 3K4MA 4D1QA 3MKYB 3GF2A 3T8RA 4YG2F 1YLFA 2M9HA 1KYZA 1YS7A 2KZVA 4O6JA 5E1ZB 2VBZA 1UG2A 3RJPA 2X1CA 4MO7A 3GZ6A 1OCCH 1JGSA 2JMWA 1WHUA 2XVCA 4QIWN 2CQNA 4U87A 5J1YA 3J81Z 2GLOA 3D0SA 4RGRA 4WCGA 4HNUA 3HBLA 4OAZA 4KN7X 4WK8F 1MSFC 3U21A 4A5MA 3UNGC 1W1WE 3GTGJ 1Z67A 3SHFA 4HDVA 1AKHA 3VPRA 1YG2A 1K78B 3D5LA 3EUAA 3V7SA 3BQYA 4BE0A 4ZYHA 1ZHFA 2VQHA 4CSWA 1NK3P 4A5NA 3C2HA 1JKQC 1FZPB 2GXGA 2ZFWA 2FJ1A 1BOBA 1YX5A 2LKSA 2LK2A 2L9VA 4OWRB 1U8RA 1ETXA 1S6LA 5J40A 3DFGA 2R7TA 5BS6A 4XR6A 3G6EI 1GHCA 4A0XA 2D45A 1WSUA 3D1NI 1IDZA 4GYIA 1R1VA 5D6FA 1FEXA 2ISZA 2X51A 3QPHA 2AQEA 4BHPA 2ZXWH 3IL2A 1ZTRA 4EJVA 1ETQA 4HPQA 2R5YA 2FEZA 3CCJI 1IXCA 4HX4A 1Z6RA 3CMMA 2HXOA 4OOIA 4JP0A 3DPLC 2KRFA 1GXQA 3GEZA 3I58A 3L2VA 4ZZLA 3W2VA 2QENA 1HCRA 3CF5F 3EDPA 1SD4A 1OR7C 2CUEA 3JRHA 3HOXJ 3LL7A 4DGWB 1BA5A 2P7CB 5ILVA 3UKGA 2VOPA 3RQIA 5EG0B 4LGWA 4M3GA 4GRIA 4QTRA 1YQAA 3PM1A 1DQUA 3FKIJ 2L7KA 1S7EA 3K1NA 3BZKA 2CQ7A 5DCFA 2HTJA 4IHWA 1R7JA 2IA0A 1YITI 1K4SA 3GVAA 1B1BA 2IA1A 4E6KG 3HOVJ 1TWAJ 3DBRB 2A69F 1LPQA 2W57A 3C3WA 1RETA 4B8XA 3FM5A 2K27A 3BZ6A 4CCLA 3QPLA 3KP7A 3PO3J 3O3KA 1KZHA 2IS1A 1B9MA 3B73A 3IAM2 4L9NA 2DMPA 3CCRI 3V8KA 4HV6A 2QWWA 2W24A 1AA7A 3DEEA 3W6JB 1O3RA 4PJ0C 1TT0A 2UWMA 3L2WA 2JPCA 1G3WA 4OINF 2M0MA 1Y1VJ 1W4MA 2TDXA 4ZYAA 3CMEI 3ZN1A 4M9SA 1R1TA 3TMOA 1GXPA 3S2WA 1UB9A 3BTJA 1SD6A 2E2HJ 1I1SA 1RR7A 2ZFUA 3ML6A 3JTHA 3E1SA 3R0JA 3HSRA 4OAYA 3RTRA 1PUFB 5ICGA 5CKTA 2XRLA 4HLYA 4U0YA 4G12A 1XMXA 3CC4I 2G7HA 1O7LA 2DFEA 2DOEA 2MC4A 1IXRC 1V55H 3GLLA 3V8JA 4PJLA 1RPWA 2CFXA 4A3DJ 4HF0A 2KQRA 3AAFA 1QRYA 2FE3A 2YPRA 1V5FA 2JWTA 2Q8KA 1ZELA 1I27A 4CGZA 4C2TA 4FETA 1ZRCA 1BJZA 3PNYA 4B44A 1WI9A 2DK5A 4HQMA 4KUMA 4HAMA 3FDYA 4BNCA 2PX9A 3ZP5A 1WI3A 3IV5A 3R0AA 4CCJA 2M87A 5HLHA 1MD0A 1ON2A 2KJCA 1PP7U 3KP4A 1A6IA 2EFWA 4A3IJ 1X2NA 3KPHA 2VPLA 4ZC3A 1F5TA 3JRFA 3FBIB 2M7AA 2XAGA 1UFMA 1LFUP 2QSFX 4RB1A 3I4NJ 4XLPF 1BR1A 4FE4A 2HYJA 4IX7A 2YX4A 4PFPA 3PIOF 1YW9A 2R93J 1D0ZA 5IYDJ 2RAEA 3QRFF 2QSHX 3TW6A 5D4SA 3JCUC 4PDKA 2D2WA 5EF6A 1TZLA 3JRDA 4C9YA 2XKPA 1VI0A 3HPGA 3O6BB 1R4MB 1ON1A 5K5RA 3K4BA 3MVPA 2P5LC 2WC2A 4M3FA 2HOSA 2IRFG 1MJ9A 2CW8A 2H6BA 2VJ4A 3H92A 3MAJA 2HZDA 5KHDA 1YJ9I 4I02A 4OIPF 4CCKA 3TO9A 5F1JA 3A0HC 2HR3A 5CPRB 1J0RA 5L3FA 2Z99A 1S72I 2XASA 5HDGA 3QOPA 1NTCA 1OLTA 1DGWY 2FNAA 3TDZC 3J7AY 5DUKA 2WY7Q 1U9OA 1U5TA 1SFEA 1BR2A 5ICFA 4HNTA 2HOAA 3CCYA 1BJAA 4CYDA 1SVOA 2E19A 3QODA 3GFJA 3VSKA 4FCYA 3F8MA 3RSNA 3E7LA 1R71A 2WB1A 4BHCA 2HFHA 1EJ9A 2ZMEC 5LHGA 3JR9A 3BR1A 4MTEA 3RKYA 4KA4A 2KDOA 4BDYA 4UVAA 1ZLKA 2DCEA 1BW6A 2GAUA 1FP2A 4AIDA 3DU6A 3L7WA 4M9XA 3H0DA 1LB2A 1E3PA 2CUJA 4ZH4F 4FISA 1XSXA 1H9TA 1W7PD 2R7WA 2V7FA 3CQZJ 3PUBA 2BY2A 3M1EA 1IRGA 4LLGF 2K3PA 2DA1A 3A03A 5FKNA 1FSHA 4BXFA 4ABZA 1T08B 5E8IA 3J7YJ 2JJ7A 4RGSA 2E34A 5HLGA 1MBGA 5F0HA 3EYIA 1ZR4A 3DWLE 2PMZN 3G71I 2O03A 1RKWA 2GXBA 1MIJA 2VKHA 3P7NA 4UUTA 2X0LA 4EQQA 5FB2A 5KK1A 3F21A 1EV7A 1W36C 2DO7A 1WJBA 1NHAA 1SFUA 5E8GA 1FLIA 4CYCB 4G7ZF 4W1UA 1X1BA 2DK8A 1DU0A 1GDTA 3WODF 4IKFA 4MLOA 5B1AH 1T38A 2A61A 5HS8A 5LEKA 2O61A 5AONA 2F5CA 2CWEA 3JRGA 1KYWA 4LLNA 3PO2J 5LLQA 4G6QA 1DP7P 1X3UA 3CESA 2LF8A 1OCTC 3ULQB 2DPUA 3GZNB 4IVNA 4XOTA 4HSTA 2YSRA 1XSVA 4HW0A 3HUGB 3TDUC 3ZQHA 3I4PA 2JA6J 3FHNA 2BW3A 5D5WB 1HQCA 3I3LA 1SFKA 1LUJB 2RC4A 3PQKA 1H8AC 3I53A 1QO0D 3HOUJ 2O9LA 4HF1A 3FXJA 3LSMA 3T1BA 4ZYDA 2ELKA 2BOLA 1W7PB 4LG0B 2ISYA 1NG6A 3BR0A 1FPQA 2UV1A 2K9QA 1W0TA 1TQPA 4KYWA 5M5WJ 4MGRA 5FFZA 3IKVA 2OV7A 3I59A 4XKCA 2P0WA 5L3DA 3ABTA 2PMZA 1YI2I 2E1OA 5EGOA 3S2DJ 3HJEA 3OY9A 2WAQA 1O7FA 1FIAA 2IS4A 4Y4RA 3BJAA 4PFOA 1XMAA 3ZMVA 3MKLA 2LKXA 1N78A 1S9HA 2VT2A 1ZGJA 4XSXF 3FMSA 1HXDA 2K9SA 3DU5A 3S32A 4DZPA 1WRJA 1K79A 2V4JC 1ZG1A 2VBWA 1O57A 5C3EJ 1JE8A 3CTAA 1N75A 2P6SA 1ONVA 5EEGA 2KFDA 2OCCH 2DA3A 1OPCA 2QBYB 3DBHB 2EK5A 1Z7LA 4AVPA 5HLTA 3S16J 1A5JA 3KP2A 4K2EA 1U5TC 1HW1A 4KIBA 2LSOA 3FXUA 3TO6A 2E2JJ 2N8GA 3C1DA 2HQAA 4UUSA 2MBFA 2V1UA 9ANTA 1E3OC 2XAHA 2HNHA 2D5VA 1YS6A 2M8GX 1R5HA 5CVRA 4L5JA 1U3EM 2HEOA 1U2WA 2GIZA 4A3GJ 3HKZN 1YRNB 2CMPA 3BP8A 4XORA 3RIRA 3W2WA 1REPC 4FX0A 5BQTA 1MNDA 2FXAA 3ZQCA 2ACJA 3BG9A 2E35A 4PJNA 3NWSA 1QZYA 1Z1DA 3CCUI 1XDSA 2R5ZB 2CV1A 1AOYA 2R7UA 2BVLA 3B6AA 3WU2C 5JVTA 2ID6A 1H89C 3MQ0A 4RLQA 1PVEA 4QWQA 2HGCA 2EV0A 2LR8A 4IOAF 4P9UA 1D3YA 4JX5A 5IP7J 1J75A 2W25A 4NBQA 2DJIA 3DKYA 1FBUA 3M4OJ 2EIKH 1VQ5I 2JT1A 2XGCA 1GUUA 2HKOA 4N4OB 3LAPA 3CMYA 2W00A 2DYRH 4UUSB 2DDAA 3FK7A 1X4OA 4G7OF 2CYYA 1Y6IA 2FRHA 3LNQA 5IT9Z 1O3TA 1YX3A 1ZRDA 2H1KA 4CXFA 4WXDA 2BXYA 2I10A 5CQGA 5FJ8J 1QPMA 2HVQA 3C18A 5FKLA 1BIBA 2E5ZA 3TL4X 3FF5A 4YIRX 2BY0A 2L9SA 2LF7A 1BC7C 2R7QA 3J80Z 1TW2A 1VQ9I 2O8KA 5ILUA 2JRTA 1EH6A 1OYIA 4BJ5C 2PQ8A 4NC8A 3P5JA 1W0UA 5CVUA 3AL0B 3ERMA 2QQ8A 1T6SA 2KL4A 2OF7A 1FBQA 5LBQA 4KFCA 2LMDA 1I3AA 2C6YA 4E70A 2EV6A 3GTMJ 2IW5A 3BR6A 3K4NA 2B7EA 2V9VA 3Q9VA 5FLVA 2M4GA 1IZ1A 2BXZA 3ABKH 4DYRA 4BXXJ 2ESHA 4FTHA 2CRGA 5GP9A 5EGOB 4EJOA 2ELHA 5KCMA 1ZYRF 3TGNA 1X3ZB 4MEYF 4NB5A 3OV8A 5IOYA 1MZBA 1B8IB 2CGPA 1XMKA 1W7PA 2FMYA 3BY6A 1R58A 3T0YA 4QSHA 3FIWA 1YJWI 4F91B 1TNSA 2LY2A 2CS3A 4I76A 2LVSA 3ZQGA 2ELJA 2MLGA 2AHQA 5HS7A 5KVRA 1V5EA 3PUFA 3ZQFA 1UJ8A 5FRNA 1MBEA 1J7KA 3IH4A 4II2A 3HSFA 3QP5A 1OMIA 4JX6A 1VQOI 4DQ2A 1Z3YA 2LFBA 1IJWC 3GMEA 5F64A 5JLXA 1FOKA 2Z9OA 4CCOA 2VXZA 3TP3A 2NS8A 3S17J 2COBA 3S93A 3ZOBA 1K6YA 1Z77A 3JAMZ 4I0AA 3DV8A 2GBYA 2VBXA 2XGDA 1WJEA 4IHYA 5L3CA 1D1BA 5FLXZ 4E7LA 5FKKA 3QQAA 2EQRA 2O3FA 4NQWB 1XCVA 2GIVA 3K0LA 1TNTA 4A3KJ 2V6CA 4A3BJ 2E1NA 3NEUA 5L3GA 1VQKI 4KMFA 1MJBA 1R1UA 3TP0A 5F27A 3K1MA 1S7AA 2EB7A 3G2BA 3IP4B 1R49A 3K4KA 4CO8A 1UAAA 1LNWA 1Z91A 3WTUC 3DF8A 1LFBA 2MA3A 4HDUA 4XRFA 4ZTFA 2F2EA 5DS9A 5EEAA 3QOEA 2XV4S 3ZMUA 4LB6B 4A69C 2EZIA 2K02A 5DDGA 4PSWA 2G0EA 2IGMA 4KDPA 3MKWB 3R6SA 3OYGA 4NC7A 3QU6A 1MMAA 2XGEA 2EBIA 1FBSA 4D0PA 2QLZA 4N0BA 2ZO4A 5FKMA 1IV6A 3BC8A 5D5UB 3HOYJ 3QYFA 2ZMEB 3GTQJ 4LG0A 3RYRA 2UXNA 3MMYB 3RKXA 5TISC 2BZTA 3J81K 2DFIA 1MJAA 2IGOA 1T95A 1YW7A 4D9JA 3ECOA 1XX5A 2G7UA 2R7XA 2BGCA 1Y56A 2WAEA 1KA8A 2DDBA 5JHFA 1ZRFA 4BDZA 2OQRA 2IA2A 3KP5A 4M74A 4NNJA 1O3QA 1IC8A 4A2UA 3G1MA 3V4GA 4AYBN 2DJNA 1HSTA 3SZPA 4MFDA 1IV8A 1UHSA 2QKMB 1IAWA 4H0EA
chains in the Genus database with same CATH topology
5ED4A 4OIQF 1YW8A 4BXUA 2O0YA 2Z33A 1A04A 1B9NA 2LNBA 3M9AA 3FXQA 4OU0A 5DYMA 1Z05A 4A6DA 3ZMSA 4R79A 2R7FA 3P9KA 2O8XA 5FLXK 1P2FA 3LA3A 5E17F 3F6OA 3F8BA 1IXSB 5LHIA 1QNTA 2DPDA 3LQQA 4KMUX 4R8HA 2GZWA 1S29A 4ENKA 2YR2A 1IN4A 5K5OA 3P9IA 3HHGA 2W84A 5HS9A 1XGSA 3IRQA 1TBXA 2HQRA 4HX7A 4CHUA 1GVJA 3KEOA 3U2RA 1JHHA 1FYMA 1RI7A 2FMLA 4GGGA 3RYPA 1TLHB 5LEJA 3U1DA 1KU3A 2PMHA 4U0VA 1SAXA 2IVMA 1HKQA 3HTSB 5FD5A 3L9FA 5LGUA 1L3LA 2HDCA 1QZZA 3ELKA 3LWFA 2L4AA 4KN4X 3E5UA 2DW4A 2P4WA 3LFKA 4ESBA 5JFRA 1R23A 2H27A 1BC8C 3VB2A 2QVOA 4UUVA 1OYYA 1F1ZA 4Y17A 1XSDA 3ZMDA 1BOAA 1V3FA 2G9WA 2E7XA 4ZZDA 2XGXA 4I7HA 1ZG3A 4R1HA 4WXHA 4O3MA 1IN8A 2ZCWA 1B6AA 5FD6A 1YO5C 6PAXA 1IRFA 2K86A 4U7DA 3F8FA 2HS5A 4BHBA 3E5XA 4UV8A 3WTTC 1FT9A 1ZG5A 4EVIA 4ENNA 1XGOA 2L54A 4HYEA 5ERIA 2NS0A 4RGXA 2Q2EA 3BJOA 1I5ZA 5DD8A 1LDDA 3R61A 2KIMA 3SZTA 3N4MA 2MH9A 1EH7A 3T8TA 3V7CA 4EGYA 2FBIA 2H09A 2HKXA 4HBLA 4EJWA 1QBJA 1UHWA 3GYHX 2R7DA 2VE9A 2QQAA 3CO7C 3WTZA 1C0WA 2V79A 2MH2A 4L18B 4L9VA 5E1WA 1ZLJA 2OAZA 2M1BA 1T0FA 2JSCA 1BI0A 1R00A 3T5XA 3QAHA 4LFUA 4Q4ZF 1H9GA 2PN6A 5AIPA 4JBAA 5CLSA 5D8KB 3WGHA 1H0MA 3BDDA 2IT0A 2ZNZA 2GA1A 2A5YB 3WTXC 4BAYA 4UHTA 1O3SA 5E20A 1KU2A 3GFMA 2P7VB 1FWZA 2QUFA 1XB4A 3L00A 5E1XA 2K4BA 1ZH5A 5BOXA 1OYWA 1BIAA 1BI3A 3I59B 2OA4A 2D1VA 1K78A 1Z9CA 3BJ6A 3E6DA 2A3SA 3KETA 3GWZA 2MC3A 1QGPA 4S05A 3EQLF 1SD5A 2Y75A 4ON0A 4I0BA 3HUGA 2NRAC 1XD7A 1RUNA 2PEXA 4OMYA 5HDKA 4CICA 2DBBA 1RUOA 2ETHA 1P4XA 3LQRA 5L3EA 2VE8A 2RQPA 4EJTA 5J8CA 4EM1A 3WE3A 3LA2A 1S8NA 4A0YA 2FNPA 4IF4A 2VONA 1DUXC 2QZ8A 1JHFA 1PP8F 3HHHA 3ERED 4GO1A 4GXOA 3F8CA 1G3SA 4ETSA 1IF1A 1OKRA 3LAJA 1FP1D 4G8XA 4L5IA 4AD9A 4M73A 1ULYA 1TTYA 4B09A 5DEQA 4Q48A 2FSWA 4G94A 3K9TA 1USSA 1VTNC 4ENJA 5ILSA 5IT9K 4KICA 4WXCA 4XBFA 1BI2A 4AWXB 3L09A 1HKSA 1IN7A 1CF7B 3HTUA 2A07F 2LKPA 4O5VA 3CUQB 5L3BA 1Y0UA 4GCVA 1U6GA 2CG4A 2EFNA 2PLYA 4RB3C 3RKWA 3I5UA 5DCMA 3ZPLA 3JW4A 1XCBA 1SD7A 3MFKA 5BPIA 1G3TA 1PDNC 4JQFA 3C7JA 3HRUA 3FX3A 2EFOA 2STWA 5LGTA 1D5VA 4IRHA 4Y15A 3EETA 1TW3A 2STTA 2VBYA 2CSOA 3TKYA 2JZYA 2XRNA 1R36A 2DT5A 4YIFA 2M8EA 2CO5A 3WE2A 2CQKA 2VC1A 4P55A 3CO6C 3F3XA 4BH9A 4BYYA 1KQ8A 4ENMA 2XROA 2B0LA 2EV5A 3COAC 1W5SA 2Y0MA 2Y48A 3GFLA 5CYVA 1F9NA 3IRRA 3FXRA 3SFZA 2H94A 1LEAA 2HWVA 4IHTA 5K1YA 3J7AO 1LVAA 3MZHA 4LK1F 2FQ3A 4KT5C 4CZZA 2PBIA 1FNNA 4NHJA 5ICCA 3LA7A 1MDMA 2QM3A 3LSTA 4HX8A 3GUDA 2HTSA 2X4HA 4WWCA 3I0TA 5H6QA 3KEQA 5H6RA 1RZ4A 4EMSA 1D8JA 4ZYEA 4IPAA 3IWFA 1K6OA 3KCCA 4KNYA 4RB2C 5DCMB 3EYYA 3EUHA 2DLLA 3I71A 2EJRA 4YIIA 3HIFA 1SFXA 4L9TA 1V4RA 4YFXF 3HRSA 5ICEA 3F23A 1YTYA 2OZ6A 2ZBKA 3WTYC 5LRSA 4LLLA 4MQ9F 2ZMEA 1IN6A 3FMRA 1HSJA 5AIQA 3TOBA 2FF4A 3MZYA 4FT8A 4ESJA 2OU2A 2XAFA 3CLOA 2PG4A 4G6DA 2W85A 1T98A 2EWNA 2IPQX 1MGTA 1ZN2A 1E2XA 2CW0F 4U88A 2DTRA 5D4RA 4M6XA 2RVCA 1WQ2A 4KIGA 4NQWA 2NNNA 4LMYA 2GQQA 1U78A 4M6YA 1DPUA 3ZN0A 4I09A 3VFZA 3KFWX 2ZJ2A 3V8LA 2GWRA 2OD5A 1XGMA 5CVIA 1CF7A 1FX7A 3IHUA 4UVCA 3JSOA 2FOKA 3H3UA 1RNLA 1JXSA 3OOPA 4ZYGA 1W5TA 3ZQ7A 4PCQA 3VODA 3GW2A 2DU9A 5K5QA 2FBHA 2A6EF 4AIKA 3JSPA 2OQGA 4KIFA 2XUBA 2OBPA 4IJAA 2M5WA 3FMQA 2FU4A 2NNYA 1IW7F 1OR7A 2IJLA 3IC7A 3GX4X 4EM0B 5EEHA 4HZFA 5FGMA 5LGNA 4DNCA 3NRVA 2QQBA 1K7AA 1CGPA 4EV0A 1BBYA 2VT3A 1J2XA 3WGGA 4HLXA 1FYKA 1P92A 3PQJA 3FZVA 2RN7A 2QQ9A 4IRGA 3BPXA 4BQAA 2PJPA 2DI3A 2BE5F 2PFBA 1ZGAA 2BBYA 5D8LB 5JR3A 2XIGA 1R5GA 3W6KB 3G3ZA 3KZZA 4A0ZA 1STZA 3O2PE 1E17A 3QPTA 3V7RA 3Q5FA 1Z7UA 3E6MA 1I1GA 1L0OC 2VC0A 1SMYF 3VOEA 1YFHA 2HYGD 4HOBA 2Q0OA 2D1HA 2ZNYA 4LB5A 1S7OA 4YFNF 3TOAA 3HRMA 5BPDA 2XAQA 3F8NA 3K69A 3P9CA 2EFQA 2QBYA 4HA8A 2RKHA 1S3JA 4P5OA 3I64A 2JTVA 3K2ZA 5HOOA 3JAMK 1LEBA 3TQNA 2XAJA 1FC3A 1J5YA 2EFPA 1ZARA 1TQMA 4L0YB 3DEUA 2P8TA 3N97A 2Z3YA 1ZAOA 3DP7A 1G3YA 4ESFA 2J5OA 2LDUA 1I6XA 3I54A 1Q1HA 2A68F 5CVJA 4Q47A 4L9JA 1RIOH 3MEXA 3E5QA 3TO7A 3G73A 4P96A 3VEPA 1Z6TA 4M71A 4I01A 2E1CA 3SQNA 3REOA 5JI6A 2EA4A 2HZTA 4LD5A 1LJ9A 1ODDA 1ZREA 4FHTA 4PGGA 5A2QZ 2MLKA 3GLXA 1HKTA 1HW5A 1XDUA 3BWGA 2BEOA 2GA2A 2L4MA 1T39A 2ZXJA 1T2KA 3WGIA 3R4KA 5FO5A 2P5KA 2RGVA 5DV5A 2AS5F 3WTWC 1R22A 3CDHA 1F4KA 1SMTA 2AXLA 3FHZA 3DQVC 4CDGA 2COMA 2NYXA 4RB0A 2OZUA 4M72A 3GFIA 5DD4A 5JHUA 3GO5A 3RPUA 4S04A 1FY7A 3WTSC 3WU1B 3H3ZA 4AIHA 5E18F 3KLOA 3BOQA 4U0WA 1LDJA 5HLIA 2L02A 3DXJF 4QLCU 3KLNA 2VOOA 4F7ZA 1P4AA 5TRDA 1AWCA 3R60A 1KGSA 2BV6A 4N9IA 3ZMTA 3F22A 1PUEE 5J6XA 4Q5SF 2JPBA 4AIJA 3RPQA 1G4DA 4EM2A 3CUOA 2RV8A 4A12A 3HOSA 1P6RA 2K4JA 2WV0A 3ECHA 4UV9A 2MD5A 4PZJA 2K7LA 3CUQC 2A6HF 1MDMB 3GXOA 4GYGA 3FWEA 3WTVC 1BN5A 3NQOA 5D6EA 3MWMA 3ROUA 3WG9A 1LQ1A 2R3SA 5BMZA 3JTGA 4EGZA 1DPRA 4WX9A 2XKOA 3BROA 5A2QK 1YIOA 3KP6A 5IT3A 2RDPA 3RI4A 3M8EA 4MHGA 1G6NA 1FSEA 3CJNA 2WWYA 3DKWA 3HOTA 3E3VA 1U5TB 1UCRA 1HBXG 3M8FA 1P4WA 1BM9A 4P9FA 5F1RA 4L0ZB 3HYIA 4RAYA 4M9ZA 2KIUA 2YX7A 4IRIA 4RAZA 4XLNF 1KQ9A 1KQ0A 1MKMA 3IWZA 3PFIA 4YFKF 2NAZA 3KE2A 4HF2A 3B02A 2F5FA 1DDNA 2QYOA 2Z5UA 5LHHA 3ZMZA 5J8FA 4OIRF 2L3DA 2P6TA 5CVVA 4Y13A 4OMZA 5DUIA 3QU3A 4JK1X 3HRTA 2IP2A 4UXNA 3KZYA 1HW2A 5LRRA 2HOEA 1WKMA 1IUYA 1B59A 2DAOA 2BYVE 4MTDA 3ABUA 1YYVA 2ADUA 3K1PA 4A6EA 2O6GE 3DPTA 1UHMA 2ESNA 4TV7A 5D5XB 2DQRA 1XN7A 2P5VA 4ASNA 2EA2A 4PGHA 3WU0A 2VODA 2FA5A 2F5DA 3MCZA 4Z2YA 1EH8A 2YU3A 1QQIA 4HQEA 2M45A 4MNUA 3IKTA 1BI1A 4IXAA 2H6CA 2XHKA 2KJBA 2PI0A 1LDKB 2DQLA 4LJZF 1J9IA 4LK0F 3HSEA 4IHSA 4U7BA 3U9GA 1USTA 4HV5A 3E6BA 3RDIA 4MEXF 4G7HF 5D5VB 2HYFA 3FM3A 5F6FA 2M30A 3M7GA 4FX4A 3GZ5A 4N9HA 3CUQA 3F72A 3L2CA 4XSZF 5H20A 3KP3A 3Q9SA 1TQIA 2UXXA 2RNJA 2WTEA 2PMUA 2KKOA 2HQNA 5FFXA 4OIOF 5HVQC 3F6VA 3ISPA 3E6CC 4WF2A 2V1DA 4RGUA 4G9YA 1J59A 2J5PA 2KIFA 3BPVA 2FBKA 2VN2A 2ZKZA 2F5EA 4I98B 3QP6A 5TJJA 4RS8A 2V1XA 4UVBA 1XGNA 1KU9A 2L01A 1WWXA 2UZKA 5CJ9A 1IN5A 3SXYA 1D8KA 2E7WA 1FYLA 4UNOA 5HDNA 3J80K 3E97A 1B4AA 4I2OA 1KU7A 4MQVA 4EJUA 3GF2A 3T8RA 4YG2F 1YLFA 1KYZA 1YS7A 4O6JA 5E1ZB 2VBZA 3RJPA 3GZ6A 1JGSA 2XVCA 3J81Z 3D0SA 4RGRA 4WCGA 4KN7X 4WK8F 4A5MA 3SHFA 4HDVA 1YG2A 1K78B 3D5LA 3V7SA 4ZYHA 1ZHFA 4A5NA 1FZPB 2GXGA 2ZFWA 1U8RA 1S6LA 3DFGA 5BS6A 1GHCA 4A0XA 2D45A 1WSUA 4GYIA 1R1VA 5D6FA 2ISZA 3QPHA 4BHPA 3IL2A 4EJVA 2FEZA 1IXCA 4HX4A 1Z6RA 4OOIA 3DPLC 2KRFA 1GXQA 3GEZA 3I58A 4ZZLA 2QENA 3EDPA 1SD4A 2P7CB 5ILVA 2VOPA 4LGWA 1YQAA 3K1NA 5DCFA 2HTJA 1R7JA 2IA0A 3GVAA 1B1BA 2IA1A 2A69F 2W57A 3C3WA 4B8XA 3FM5A 2K27A 3BZ6A 3KP7A 3O3KA 1B9MA 3B73A 4L9NA 3V8KA 4HV6A 2QWWA 2W24A 3W6JB 1O3RA 2UWMA 2JPCA 1G3WA 4OINF 1W4MA 2TDXA 3ZN1A 4M9SA 1R1TA 1GXPA 3S2WA 1UB9A 1I1SA 1SD6A 3ML6A 3JTHA 3R0JA 3HSRA 3RTRA 5ICGA 4HLYA 4U0YA 2G7HA 1O7LA 1IXRC 3V8JA 2CFXA 4HF0A 3AAFA 2YPRA 2FE3A 2Q8KA 1I27A 4CGZA 1ZRCA 1WI9A 2DK5A 4HQMA 4KUMA 4HAMA 4BNCA 3ZP5A 3R0AA 2M87A 5HLHA 1MD0A 1ON2A 2KJCA 1PP7U 3KP4A 2EFWA 1F5TA 2XAGA 1UFMA 4RB1A 4XLPF 2YX4A 1YW9A 3QRFF 5D4SA 4PDKA 2D2WA 2XKPA 3O6BB 1ON1A 5K5RA 2P5LC 2WC2A 2IRFG 1MJ9A 2H6BA 3MAJA 3H92A 4I02A 4OIPF 3TO9A 2HR3A 1J0RA 5L3FA 2Z99A 2XASA 5HDGA 3QOPA 2FNAA 3TDZC 5DUKA 1U5TA 1SFEA 5ICFA 1BJAA 4CYDA 3GFJA 3F8MA 4BHCA 2HFHA 5LHGA 4MTEA 3RKYA 4KA4A 4UVAA 1ZLKA 2GAUA 1FP2A 3L7WA 4M9XA 1LB2A 4ZH4F 1XSXA 1H9TA 1W7PD 3M1EA 1IRGA 4LLGF 1FSHA 5E8IA 4RGSA 5HLGA 3EYIA 2GXBA 2O03A 3P7NA 4EQQA 2X0LA 5FB2A 5KK1A 3F21A 1EV7A 2DO7A 1SFUA 1NHAA 1FLIA 5E8GA 4G7ZF 2DK8A 3WODF 1T38A 2A61A 5HS8A 5LEKA 2O61A 5AONA 2F5CA 2CWEA 1KYWA 4LLNA 5LLQA 4G6QA 1DP7P 1X3UA 2LF8A 3ULQB 2DPUA 4IVNA 2YSRA 1XSVA 4HW0A 3TDUC 3I4PA 5D5WB 1HQCA 2RC4A 3PQKA 3I53A 1QO0D 4HF1A 3T1BA 4ZYDA 1W7PB 4LG0B 2ISYA 1FPQA 1TQPA 4KYWA 4MGRA 5FFZA 3IKVA 3I59A 5L3DA 3ABTA 1O7FA 3BJAA 1XMAA 3ZMVA 2VT2A 1ZGJA 4XSXF 3FMSA 1HXDA 1WRJA 1K79A 1ZG1A 2VBWA 1O57A 1JE8A 3CTAA 2P6SA 1ONVA 5EEGA 1OPCA 2QBYB 2EK5A 4AVPA 3KP2A 4K2EA 1U5TC 1HW1A 4KIBA 2LSOA 3FXUA 3TO6A 3C1DA 2MBFA 2V1UA 2XAHA 1YS6A 1R5HA 5CVRA 4L5JA 1U3EM 2HEOA 1U2WA 3BP8A 3RIRA 1REPC 4FX0A 5BQTA 2FXAA 2ACJA 1QZYA 1Z1DA 1XDSA 1AOYA 5JVTA 3MQ0A 4QWQA 2HGCA 2EV0A 4P9UA 1D3YA 1J75A 2W25A 1FBUA 2JT1A 2HKOA 3LAPA 4G7OF 2CYYA 2FRHA 5IT9Z 1O3TA 1ZRDA 4CXFA 4WXDA 1QPMA 3C18A 1BIBA 3FF5A 2LF7A 1BC7C 3J80Z 1TW2A 5ILUA 2JRTA 1EH6A 1OYIA 2PQ8A 5CVUA 1T6SA 4KFCA 1FBQA 5LBQA 2C6YA 4E70A 2EV6A 2IW5A 2V9VA 3Q9VA 1IZ1A 2ESHA 4EJOA 2ELHA 1ZYRF 3TGNA 4MEYF 4NB5A 3OV8A 1MZBA 2CGPA 1XMKA 1W7PA 2FMYA 3BY6A 1R58A 3T0YA 1TNSA 2MLGA 5HS7A 5KVRA 1J7KA 3HSFA 3QP5A 1OMIA 4DQ2A 5F64A 1FOKA 2Z9OA 2VXZA 3JAMZ 4I0AA 3DV8A 2VBXA 5L3CA 5FLXZ 2O3FA 1XCVA 2GIVA 3K0LA 1TNTA 2V6CA 2E1NA 3NEUA 5L3GA 4KMFA 1MJBA 1R1UA 3K1MA 1S7AA 2EB7A 4CO8A 1LNWA 1Z91A 3WTUC 3DF8A 2MA3A 4HDUA 4XRFA 2F2EA 2XV4S 3ZMUA 4LB6B 2K02A 5DDGA 4KDPA 3R6SA 3QU6A 1FBSA 4D0PA 2QLZA 4N0BA 2ZO4A 5D5UB 2ZMEB 4LG0A 3RYRA 2UXNA 3RKXA 3J81K 2DFIA 1MJAA 1YW7A 3ECOA 2G7UA 2BGCA 1KA8A 1ZRFA 2OQRA 2IA2A 3KP5A 4M74A 1O3QA 4A2UA 3V4GA 1HSTA 3SZPA 1IAWA 4H0EA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5ED4 A;  4OIQ F;  1YW8 A;  4BXU A;  2O0Y A;  2Z33 A;  1A04 A;  1B9N A;  2LNB A;  3M9A A;  3FXQ A;  4OU0 A;  5DYM A;  1Z05 A;  4A6D A;  3ZMS A;  4R79 A;  2R7F A;  3P9K A;  2O8X A;  5FLX K;  1P2F A;  3LA3 A;  5E17 F;  3F6O A;  3F8B A;  1IXS B;  5LHI A;  1QNT A;  2DPD A;  3LQQ A;  4KMU X;  4R8H A;  2GZW A;  1S29 A;  4ENK A;  2YR2 A;  1IN4 A;  5K5O A;  3P9I A;  3HHG A;  2W84 A;  5HS9 A;  1XGS A;  3IRQ A;  1TBX A;  2HQR A;  4HX7 A;  4CHU A;  1GVJ A;  3KEO A;  3U2R A;  1JHH A;  1FYM A;  1RI7 A;  2FML A;  4GGG A;  3RYP A;  1TLH B;  5LEJ A;  3U1D A;  1KU3 A;  2PMH A;  4U0V A;  1SAX A;  2IVM A;  1HKQ A;  3HTS B;  5FD5 A;  3L9F A;  5LGU A;  1L3L A;  2HDC A;  1QZZ A;  3ELK A;  3LWF A;  2L4A A;  4KN4 X;  3E5U A;  2DW4 A;  2P4W A;  3LFK A;  4ESB A;  5JFR A;  1R23 A;  2H27 A;  1BC8 C;  3VB2 A;  2QVO A;  4UUV A;  1OYY A;  1F1Z A;  4Y17 A;  1XSD A;  3ZMD A;  1BOA A;  1V3F A;  2G9W A;  2E7X A;  4ZZD A;  2XGX A;  4I7H A;  1ZG3 A;  4R1H A;  4WXH A;  4O3M A;  1IN8 A;  2ZCW A;  1B6A A;  5FD6 A;  1YO5 C;  6PAX A;  1IRF A;  2K86 A;  4U7D A;  3F8F A;  2HS5 A;  4BHB A;  3E5X A;  4UV8 A;  3WTT C;  1FT9 A;  1ZG5 A;  4EVI A;  4ENN A;  1XGO A;  2L54 A;  4HYE A;  5ERI A;  2NS0 A;  4RGX A;  2Q2E A;  3BJO A;  1I5Z A;  5DD8 A;  1LDD A;  3R61 A;  2KIM A;  3SZT A;  3N4M A;  2MH9 A;  1EH7 A;  3T8T A;  3V7C A;  4EGY A;  2FBI A;  2H09 A;  2HKX A;  4HBL A;  4EJW A;  1QBJ A;  1UHW A;  3GYH X;  2R7D A;  2VE9 A;  2QQA A;  3CO7 C;  3WTZ A;  1C0W A;  2V79 A;  2MH2 A;  4L18 B;  4L9V A;  5E1W A;  1ZLJ A;  2OAZ A;  2M1B A;  1T0F A;  2JSC A;  1BI0 A;  1R00 A;  3T5X A;  3QAH A;  4LFU A;  4Q4Z F;  1H9G A;  2PN6 A;  5AIP A;  4JBA A;  5CLS A;  5D8K B;  3WGH A;  1H0M A;  3BDD A;  2IT0 A;  2ZNZ A;  2GA1 A;  2A5Y B;  3WTX C;  4BAY A;  4UHT A;  1O3S A;  5E20 A;  1KU2 A;  3GFM A;  2P7V B;  1FWZ A;  2QUF A;  1XB4 A;  3L00 A;  5E1X A;  2K4B A;  1ZH5 A;  5BOX A;  1OYW A;  1BIA A;  1BI3 A;  3I59 B;  2OA4 A;  2D1V A;  1K78 A;  1Z9C A;  3BJ6 A;  3E6D A;  2A3S A;  3KET A;  3GWZ A;  2MC3 A;  1QGP A;  4S05 A;  3EQL F;  1SD5 A;  2Y75 A;  4ON0 A;  4I0B A;  3HUG A;  2NRA C;  1XD7 A;  1RUN A;  2PEX A;  4OMY A;  5HDK A;  4CIC A;  2DBB A;  1RUO A;  2ETH A;  1P4X A;  3LQR A;  5L3E A;  2VE8 A;  2RQP A;  4EJT A;  5J8C A;  4EM1 A;  3WE3 A;  3LA2 A;  1S8N A;  4A0Y A;  2FNP A;  4IF4 A;  2VON A;  1DUX C;  2QZ8 A;  1JHF A;  1PP8 F;  3HHH A;  3ERE D;  4GO1 A;  4GXO A;  3F8C A;  1G3S A;  4ETS A;  1IF1 A;  1OKR A;  3LAJ A;  1FP1 D;  4G8X A;  4L5I A;  4AD9 A;  4M73 A;  1ULY A;  1TTY A;  4B09 A;  5DEQ A;  4Q48 A;  2FSW A;  4G94 A;  3K9T A;  1USS A;  1VTN C;  4ENJ A;  5ILS A;  5IT9 K;  4KIC A;  4WXC A;  4XBF A;  1BI2 A;  4AWX B;  3L09 A;  1HKS A;  1IN7 A;  1CF7 B;  3HTU A;  2A07 F;  2LKP A;  4O5V A;  3CUQ B;  5L3B A;  1Y0U A;  4GCV A;  1U6G A;  2CG4 A;  2EFN A;  2PLY A;  4RB3 C;  3RKW A;  3I5U A;  5DCM A;  3ZPL A;  3JW4 A;  1XCB A;  1SD7 A;  3MFK A;  5BPI A;  1G3T A;  1PDN C;  4JQF A;  3C7J A;  3HRU A;  3FX3 A;  2EFO A;  2STW A;  5LGT A;  1D5V A;  4IRH A;  4Y15 A;  3EET A;  1TW3 A;  2STT A;  2VBY A;  2CSO A;  3TKY A;  2JZY A;  2XRN A;  1R36 A;  2DT5 A;  4YIF A;  2M8E A;  2CO5 A;  3WE2 A;  2CQK A;  2VC1 A;  4P55 A;  3CO6 C;  3F3X A;  4BH9 A;  4BYY A;  1KQ8 A;  4ENM A;  2XRO A;  2B0L A;  2EV5 A;  3COA C;  1W5S A;  2Y0M A;  2Y48 A;  3GFL A;  5CYV A;  1F9N A;  3IRR A;  3FXR A;  3SFZ A;  2H94 A;  1LEA A;  2HWV A;  4IHT A;  5K1Y A;  3J7A O;  1LVA A;  3MZH A;  4LK1 F;  2FQ3 A;  4KT5 C;  4CZZ A;  2PBI A;  1FNN A;  4NHJ A;  5ICC A;  3LA7 A;  1MDM A;  2QM3 A;  3LST A;  4HX8 A;  3GUD A;  2HTS A;  2X4H A;  4WWC A;  3I0T A;  5H6Q A;  3KEQ A;  5H6R A;  1RZ4 A;  4EMS A;  1D8J A;  4ZYE A;  4IPA A;  3IWF A;  1K6O A;  3KCC A;  4KNY A;  4RB2 C;  5DCM B;  3EYY A;  3EUH A;  2DLL A;  3I71 A;  2EJR A;  4YII A;  3HIF A;  1SFX A;  4L9T A;  1V4R A;  4YFX F;  3HRS A;  5ICE A;  3F23 A;  1YTY A;  2OZ6 A;  2ZBK A;  3WTY C;  5LRS A;  4LLL A;  4MQ9 F;  2ZME A;  1IN6 A;  3FMR A;  1HSJ A;  5AIQ A;  3TOB A;  2FF4 A;  3MZY A;  4FT8 A;  4ESJ A;  2OU2 A;  2XAF A;  3CLO A;  2PG4 A;  4G6D A;  2W85 A;  1T98 A;  2EWN A;  2IPQ X;  1MGT A;  1ZN2 A;  1E2X A;  2CW0 F;  4U88 A;  2DTR A;  5D4R A;  4M6X A;  2RVC A;  1WQ2 A;  4KIG A;  4NQW A;  2NNN A;  4LMY A;  2GQQ A;  1U78 A;  4M6Y A;  1DPU A;  3ZN0 A;  4I09 A;  3VFZ A;  3KFW X;  2ZJ2 A;  3V8L A;  2GWR A;  2OD5 A;  1XGM A;  5CVI A;  1CF7 A;  1FX7 A;  3IHU A;  4UVC A;  3JSO A;  2FOK A;  3H3U A;  1RNL A;  1JXS A;  3OOP A;  4ZYG A;  1W5T A;  3ZQ7 A;  4PCQ A;  3VOD A;  3GW2 A;  2DU9 A;  5K5Q A;  2FBH A;  2A6E F;  4AIK A;  3JSP A;  2OQG A;  4KIF A;  2XUB A;  2OBP A;  4IJA A;  2M5W A;  3FMQ A;  2FU4 A;  2NNY A;  1IW7 F;  1OR7 A;  2IJL A;  3IC7 A;  3GX4 X;  4EM0 B;  5EEH A;  4HZF A;  5FGM A;  5LGN A;  4DNC A;  3NRV A;  2QQB A;  1K7A A;  1CGP A;  4EV0 A;  1BBY A;  2VT3 A;  1J2X A;  3WGG A;  4HLX A;  1FYK A;  1P92 A;  3PQJ A;  3FZV A;  2RN7 A;  2QQ9 A;  4IRG A;  3BPX A;  4BQA A;  2PJP A;  2DI3 A;  2BE5 F;  2PFB A;  1ZGA A;  2BBY A;  5D8L B;  5JR3 A;  2XIG A;  1R5G A;  3W6K B;  3G3Z A;  3KZZ A;  4A0Z A;  1STZ A;  3O2P E;  1E17 A;  3QPT A;  3V7R A;  3Q5F A;  1Z7U A;  3E6M A;  1I1G A;  1L0O C;  2VC0 A;  1SMY F;  3VOE A;  1YFH A;  2HYG D;  4HOB A;  2Q0O A;  2D1H A;  2ZNY A;  4LB5 A;  1S7O A;  4YFN F;  3TOA A;  3HRM A;  5BPD A;  2XAQ A;  3F8N A;  3K69 A;  3P9C A;  2EFQ A;  2QBY A;  4HA8 A;  2RKH A;  1S3J A;  4P5O A;  3I64 A;  2JTV A;  3K2Z A;  5HOO A;  3JAM K;  1LEB A;  3TQN A;  2XAJ A;  1FC3 A;  1J5Y A;  2EFP A;  1ZAR A;  1TQM A;  4L0Y B;  3DEU A;  2P8T A;  3N97 A;  2Z3Y A;  1ZAO A;  3DP7 A;  1G3Y A;  4ESF A;  2J5O A;  2LDU A;  1I6X A;  3I54 A;  1Q1H A;  2A68 F;  5CVJ A;  4Q47 A;  4L9J A;  1RIO H;  3MEX A;  3E5Q A;  3TO7 A;  3G73 A;  4P96 A;  3VEP A;  1Z6T A;  4M71 A;  4I01 A;  2E1C A;  3SQN A;  3REO A;  5JI6 A;  2EA4 A;  2HZT A;  4LD5 A;  1LJ9 A;  1ODD A;  1ZRE A;  4FHT A;  4PGG A;  5A2Q Z;  2MLK A;  3GLX A;  1HKT A;  1HW5 A;  1XDU A;  3BWG A;  2BEO A;  2GA2 A;  2L4M A;  1T39 A;  2ZXJ A;  1T2K A;  3WGI A;  3R4K A;  5FO5 A;  2P5K A;  2RGV A;  5DV5 A;  2AS5 F;  3WTW C;  1R22 A;  3CDH A;  1F4K A;  1SMT A;  2AXL A;  3FHZ A;  3DQV C;  4CDG A;  2COM A;  2NYX A;  4RB0 A;  2OZU A;  4M72 A;  3GFI A;  5DD4 A;  5JHU A;  3GO5 A;  3RPU A;  4S04 A;  1FY7 A;  3WTS C;  3WU1 B;  3H3Z A;  4AIH A;  5E18 F;  3KLO A;  3BOQ A;  4U0W A;  1LDJ A;  5HLI A;  2L02 A;  3DXJ F;  4QLC U;  3KLN A;  2VOO A;  4F7Z A;  1P4A A;  5TRD A;  1AWC A;  3R60 A;  1KGS A;  2BV6 A;  4N9I A;  3ZMT A;  3F22 A;  1PUE E;  5J6X A;  4Q5S F;  2JPB A;  4AIJ A;  3RPQ A;  1G4D A;  4EM2 A;  3CUO A;  2RV8 A;  4A12 A;  3HOS A;  1P6R A;  2K4J A;  2WV0 A;  3ECH A;  4UV9 A;  2MD5 A;  4PZJ A;  2K7L A;  3CUQ C;  2A6H F;  1MDM B;  3GXO A;  4GYG A;  3FWE A;  3WTV C;  1BN5 A;  3NQO A;  5D6E A;  3MWM A;  3ROU A;  3WG9 A;  1LQ1 A;  2R3S A;  5BMZ A;  3JTG A;  4EGZ A;  1DPR A;  4WX9 A;  2XKO A;  3BRO A;  5A2Q K;  1YIO A;  3KP6 A;  5IT3 A;  2RDP A;  3RI4 A;  3M8E A;  4MHG A;  1G6N A;  1FSE A;  3CJN A;  2WWY A;  3DKW A;  3HOT A;  3E3V A;  1U5T B;  1UCR A;  1HBX G;  3M8F A;  1P4W A;  1BM9 A;  4P9F A;  5F1R A;  4L0Z B;  3HYI A;  4RAY A;  4M9Z A;  2KIU A;  2YX7 A;  4IRI A;  4RAZ A;  4XLN F;  1KQ9 A;  1KQ0 A;  1MKM A;  3IWZ A;  3PFI A;  4YFK F;  2NAZ A;  3KE2 A;  4HF2 A;  3B02 A;  2F5F A;  1DDN A;  2QYO A;  2Z5U A;  5LHH A;  3ZMZ A;  5J8F A;  4OIR F;  2L3D A;  2P6T A;  5CVV A;  4Y13 A;  4OMZ A;  5DUI A;  3QU3 A;  4JK1 X;  3HRT A;  2IP2 A;  4UXN A;  3KZY A;  1HW2 A;  5LRR A;  2HOE A;  1WKM A;  1IUY A;  1B59 A;  2DAO A;  2BYV E;  4MTD A;  3ABU A;  1YYV A;  2ADU A;  3K1P A;  4A6E A;  2O6G E;  3DPT A;  1UHM A;  2ESN A;  4TV7 A;  5D5X B;  2DQR A;  1XN7 A;  2P5V A;  4ASN A;  2EA2 A;  4PGH A;  3WU0 A;  2VOD A;  2FA5 A;  2F5D A;  3MCZ A;  4Z2Y A;  1EH8 A;  2YU3 A;  1QQI A;  4HQE A;  2M45 A;  4MNU A;  3IKT A;  1BI1 A;  4IXA A;  2H6C A;  2XHK A;  2KJB A;  2PI0 A;  1LDK B;  2DQL A;  4LJZ F;  1J9I A;  4LK0 F;  3HSE A;  4IHS A;  4U7B A;  3U9G A;  1UST A;  4HV5 A;  3E6B A;  3RDI A;  4MEX F;  4G7H F;  5D5V B;  2HYF A;  3FM3 A;  5F6F A;  2M30 A;  3M7G A;  4FX4 A;  3GZ5 A;  4N9H A;  3CUQ A;  3F72 A;  3L2C A;  4XSZ F;  5H20 A;  3KP3 A;  3Q9S A;  1TQI A;  2UXX A;  2RNJ A;  2WTE A;  2PMU A;  2KKO A;  2HQN A;  5FFX A;  4OIO F;  5HVQ C;  3F6V A;  3ISP A;  3E6C C;  4WF2 A;  2V1D A;  4RGU A;  4G9Y A;  1J59 A;  2J5P A;  2KIF A;  3BPV A;  2FBK A;  2VN2 A;  2ZKZ A;  2F5E A;  4I98 B;  3QP6 A;  5TJJ A;  4RS8 A;  2V1X A;  4UVB A;  1XGN A;  1KU9 A;  2L01 A;  1WWX A;  2UZK A;  5CJ9 A;  1IN5 A;  3SXY A;  1D8K A;  2E7W A;  1FYL A;  4UNO A;  5HDN A;  3J80 K;  3E97 A;  1B4A A;  4I2O A;  1KU7 A;  4MQV A;  4EJU A;  3GF2 A;  3T8R A;  4YG2 F;  1YLF A;  1KYZ A;  1YS7 A;  4O6J A;  5E1Z B;  2VBZ A;  3RJP A;  3GZ6 A;  1JGS A;  2XVC A;  3J81 Z;  3D0S A;  4RGR A;  4WCG A;  4KN7 X;  4WK8 F;  4A5M A;  3SHF A;  4HDV A;  1YG2 A;  1K78 B;  3D5L A;  3V7S A;  4ZYH A;  1ZHF A;  4A5N A;  1FZP B;  2GXG A;  2ZFW A;  1U8R A;  1S6L A;  3DFG A;  5BS6 A;  1GHC A;  4A0X A;  2D45 A;  1WSU A;  4GYI A;  1R1V A;  5D6F A;  2ISZ A;  3QPH A;  4BHP A;  3IL2 A;  4EJV A;  2FEZ A;  1IXC A;  4HX4 A;  1Z6R A;  4OOI A;  3DPL C;  2KRF A;  1GXQ A;  3GEZ A;  3I58 A;  4ZZL A;  2QEN A;  3EDP A;  1SD4 A;  2P7C B;  5ILV A;  2VOP A;  4LGW A;  1YQA A;  3K1N A;  5DCF A;  2HTJ A;  1R7J A;  2IA0 A;  3GVA A;  1B1B A;  2IA1 A;  2A69 F;  2W57 A;  3C3W A;  4B8X A;  3FM5 A;  2K27 A;  3BZ6 A;  3KP7 A;  3O3K A;  1B9M A;  3B73 A;  4L9N A;  3V8K A;  4HV6 A;  2QWW A;  2W24 A;  3W6J B;  1O3R A;  2UWM A;  2JPC A;  1G3W A;  4OIN F;  1W4M A;  2TDX A;  3ZN1 A;  4M9S A;  1R1T A;  1GXP A;  3S2W A;  1UB9 A;  1I1S A;  1SD6 A;  3ML6 A;  3JTH A;  3R0J A;  3HSR A;  3RTR A;  5ICG A;  4HLY A;  4U0Y A;  2G7H A;  1O7L A;  1IXR C;  3V8J A;  2CFX A;  4HF0 A;  3AAF A;  2YPR A;  2FE3 A;  2Q8K A;  1I27 A;  4CGZ A;  1ZRC A;  1WI9 A;  2DK5 A;  4HQM A;  4KUM A;  4HAM A;  4BNC A;  3ZP5 A;  3R0A A;  2M87 A;  5HLH A;  1MD0 A;  1ON2 A;  2KJC A;  1PP7 U;  3KP4 A;  2EFW A;  1F5T A;  2XAG A;  1UFM A;  4RB1 A;  4XLP F;  2YX4 A;  1YW9 A;  3QRF F;  5D4S A;  4PDK A;  2D2W A;  2XKP A;  3O6B B;  1ON1 A;  5K5R A;  2P5L C;  2WC2 A;  2IRF G;  1MJ9 A;  2H6B A;  3MAJ A;  3H92 A;  4I02 A;  4OIP F;  3TO9 A;  2HR3 A;  1J0R A;  5L3F A;  2Z99 A;  2XAS A;  5HDG A;  3QOP A;  2FNA A;  3TDZ C;  5DUK A;  1U5T A;  1SFE A;  5ICF A;  1BJA A;  4CYD A;  3GFJ A;  3F8M A;  4BHC A;  2HFH A;  5LHG A;  4MTE A;  3RKY A;  4KA4 A;  4UVA A;  1ZLK A;  2GAU A;  1FP2 A;  3L7W A;  4M9X A;  1LB2 A;  4ZH4 F;  1XSX A;  1H9T A;  1W7P D;  3M1E A;  1IRG A;  4LLG F;  1FSH A;  5E8I A;  4RGS A;  5HLG A;  3EYI A;  2GXB A;  2O03 A;  3P7N A;  4EQQ A;  2X0L A;  5FB2 A;  5KK1 A;  3F21 A;  1EV7 A;  2DO7 A;  1SFU A;  1NHA A;  1FLI A;  5E8G A;  4G7Z F;  2DK8 A;  3WOD F;  1T38 A;  2A61 A;  5HS8 A;  5LEK A;  2O61 A;  5AON A;  2F5C A;  2CWE A;  1KYW A;  4LLN A;  5LLQ A;  4G6Q A;  1DP7 P;  1X3U A;  2LF8 A;  3ULQ B;  2DPU A;  4IVN A;  2YSR A;  1XSV A;  4HW0 A;  3TDU C;  3I4P A;  5D5W B;  1HQC A;  2RC4 A;  3PQK A;  3I53 A;  1QO0 D;  4HF1 A;  3T1B A;  4ZYD A;  1W7P B;  4LG0 B;  2ISY A;  1FPQ A;  1TQP A;  4KYW A;  4MGR A;  5FFZ A;  3IKV A;  3I59 A;  5L3D A;  3ABT A;  1O7F A;  3BJA A;  1XMA A;  3ZMV A;  2VT2 A;  1ZGJ A;  4XSX F;  3FMS A;  1HXD A;  1WRJ A;  1K79 A;  1ZG1 A;  2VBW A;  1O57 A;  1JE8 A;  3CTA A;  2P6S A;  1ONV A;  5EEG A;  1OPC A;  2QBY B;  2EK5 A;  4AVP A;  3KP2 A;  4K2E A;  1U5T C;  1HW1 A;  4KIB A;  2LSO A;  3FXU A;  3TO6 A;  3C1D A;  2MBF A;  2V1U A;  2XAH A;  1YS6 A;  1R5H A;  5CVR A;  4L5J A;  1U3E M;  2HEO A;  1U2W A;  3BP8 A;  3RIR A;  1REP C;  4FX0 A;  5BQT A;  2FXA A;  2ACJ A;  1QZY A;  1Z1D A;  1XDS A;  1AOY A;  5JVT A;  3MQ0 A;  4QWQ A;  2HGC A;  2EV0 A;  4P9U A;  1D3Y A;  1J75 A;  2W25 A;  1FBU A;  2JT1 A;  2HKO A;  3LAP A;  4G7O F;  2CYY A;  2FRH A;  5IT9 Z;  1O3T A;  1ZRD A;  4CXF A;  4WXD A;  1QPM A;  3C18 A;  1BIB A;  3FF5 A;  2LF7 A;  1BC7 C;  3J80 Z;  1TW2 A;  5ILU A;  2JRT A;  1EH6 A;  1OYI A;  2PQ8 A;  5CVU A;  1T6S A;  4KFC A;  1FBQ A;  5LBQ A;  2C6Y A;  4E70 A;  2EV6 A;  2IW5 A;  2V9V A;  3Q9V A;  1IZ1 A;  2ESH A;  4EJO A;  2ELH A;  1ZYR F;  3TGN A;  4MEY F;  4NB5 A;  3OV8 A;  1MZB A;  2CGP A;  1XMK A;  1W7P A;  2FMY A;  3BY6 A;  1R58 A;  3T0Y A;  1TNS A;  2MLG A;  5HS7 A;  5KVR A;  1J7K A;  3HSF A;  3QP5 A;  1OMI A;  4DQ2 A;  5F64 A;  1FOK A;  2Z9O A;  2VXZ A;  3JAM Z;  4I0A A;  3DV8 A;  2VBX A;  5L3C A;  5FLX Z;  2O3F A;  1XCV A;  2GIV A;  3K0L A;  1TNT A;  2V6C A;  2E1N A;  3NEU A;  5L3G A;  4KMF A;  1MJB A;  1R1U A;  3K1M A;  1S7A A;  2EB7 A;  4CO8 A;  1LNW A;  1Z91 A;  3WTU C;  3DF8 A;  2MA3 A;  4HDU A;  4XRF A;  2F2E A;  2XV4 S;  3ZMU A;  4LB6 B;  2K02 A;  5DDG A;  4KDP A;  3R6S A;  3QU6 A;  1FBS A;  4D0P A;  2QLZ A;  4N0B A;  2ZO4 A;  5D5U B;  2ZME B;  4LG0 A;  3RYR A;  2UXN A;  3RKX A;  3J81 K;  2DFI A;  1MJA A;  1YW7 A;  3ECO A;  2G7U A;  2BGC A;  1KA8 A;  1ZRF A;  2OQR A;  2IA2 A;  3KP5 A;  4M74 A;  1O3Q A;  4A2U A;  3V4G A;  1HST A;  3SZP A;  1IAW A;  4H0E A; 
#chains in the Genus database with same CATH topology
 5ED4 A;  4OIQ F;  1MH3 A;  2LY1 A;  1YW8 A;  3NAR A;  4BXU A;  4M6V A;  2O0Y A;  1ETO A;  3BT9 A;  1TWH J;  1VQ7 I;  5M5X J;  3K2A A;  1A04 A;  2Z33 A;  1B9N A;  1POG A;  1MW7 A;  4DBQ A;  4F93 B;  4IO9 F;  4DZJ A;  2LNB A;  3AG2 H;  3M9A A;  4E7S A;  3FXQ A;  4OU0 A;  5DYM A;  1Z05 A;  2KIS A;  4A6D A;  3ZMS A;  2WV1 A;  4R79 A;  1X1C A;  2Z16 A;  5HOD A;  2R7F A;  2XF6 A;  2O8X A;  3P9K A;  3O8G A;  2MYS A;  3DTI A;  5FLX K;  1P2F A;  3LA3 A;  2JSP A;  1A35 A;  5E17 F;  4AC0 A;  5J1R A;  3F6O A;  3F8B A;  1IXS B;  5LHI A;  3OYI A;  4QPQ A;  3OSG A;  1QNT A;  2DPD A;  4KIT B;  5B1B H;  1IGN A;  1T33 A;  3LQQ A;  4KMU X;  4R8H A;  4NUB A;  3OIQ A;  2GZW A;  1S29 A;  4ENK A;  2YR2 A;  1IN4 A;  2XPU A;  5K5O A;  3P9I A;  3OYN A;  3HHG A;  2CV2 A;  4W97 A;  3CC7 I;  1JGG A;  5JLW A;  2W84 A;  3GBG A;  5HS9 A;  1XGS A;  1D0Y A;  1TBX A;  3IRQ A;  3NWT A;  2HQR A;  4HX7 A;  4CHU A;  4J00 A;  1GVJ A;  3KEO A;  3U2R A;  1JHH A;  1FYM A;  1P7I A;  1RI7 A;  3BQZ A;  3PIP F;  2FML A;  3LSK A;  2NVX J;  4GGG A;  2FD5 A;  4ITV A;  3RYP A;  1TLH B;  4RAG A;  5LEJ A;  3U1D A;  2V26 A;  4A3J J;  4F3Q A;  1KU3 A;  2PMH A;  4U0V A;  1VQM I;  1SAX A;  2IVM A;  2PJR A;  1RC9 A;  1HKQ A;  2F48 A;  3HTS B;  4PSX A;  3L1P A;  2HOT A;  5FD5 A;  3L9F A;  3S1M J;  5LGU A;  5BNG A;  4J01 A;  1L3L A;  2HDC A;  3LMM A;  1QZZ A;  3ELK A;  3B6C A;  3RQ4 A;  3LWF A;  3OYA A;  2DT6 A;  2L4A A;  1JUS A;  4KN4 X;  5HNF A;  3E5U A;  4KJZ A;  2DW4 A;  2P4W A;  3LFK A;  4ESB A;  5JFR A;  2YU9 J;  1R23 A;  2H27 A;  1A31 A;  1BC8 C;  3VB2 A;  2QVO A;  4UUV A;  4QPO A;  3GTL J;  1OYY A;  1F1Z A;  3HC7 A;  2MW8 A;  4XLH A;  4Y17 A;  1XSD A;  2V9K A;  2VKD A;  3ZMD A;  1BOA A;  3KZI C;  4E4H A;  1U8B A;  4NDL A;  1TL8 A;  1V3F A;  3FXL A;  4BJ6 C;  5EDN A;  2B63 J;  2BY1 A;  3H5N A;  1VQP I;  3ZRG A;  1Y0N A;  2QGU A;  3O8H A;  2BY3 A;  4E7J A;  2G9W A;  4B47 A;  3GTJ J;  4BBS J;  3C2G A;  2E7X A;  4ZZD A;  4JX4 A;  1HOM A;  3DLA A;  3G4S I;  2XGX A;  4I7H A;  1X19 A;  1ZG3 A;  4R1H A;  4WXH A;  1MH4 A;  4O3M A;  1IN8 A;  3OYJ A;  2ZCW A;  1B6A A;  1G59 A;  5FD6 A;  1YO5 C;  6PAX A;  1IRF A;  2H1L A;  4IHV A;  2K86 A;  4U7D A;  2DMN A;  1VND A;  3ZR8 X;  3BTC A;  3F8F A;  2HS5 A;  4BHB A;  2AO9 A;  1YJN I;  1JUM A;  1X2M A;  1LKX A;  3V42 A;  3E5X A;  2XC7 A;  4UV8 A;  1Y39 A;  3WTT C;  1FT9 A;  2DMU A;  1ZG5 A;  4HSR A;  4EVI A;  3OYE A;  3QWL A;  4XM3 A;  3ASN H;  5K7F A;  4X6A J;  4ENN A;  1XGO A;  3CDI A;  2L54 A;  3OL3 A;  4HYE A;  3I55 I;  4XIC A;  2M3A A;  4PJM A;  5LFA A;  1RKT A;  3EUK L;  1MMN A;  2NS0 A;  5ERI A;  5IY5 H;  4RGX A;  2Q2E A;  3H1C A;  3S14 J;  3BJO A;  1I5Z A;  5DD8 A;  1O4X A;  1ZR2 A;  1LDD A;  3R61 A;  5LD2 C;  2KIM A;  3K4L A;  4KT6 A;  1EF4 A;  3SZT A;  3N4M A;  5GPA A;  2MH9 A;  3S3O A;  1EH7 A;  2VIX A;  3ESW B;  3T8T A;  2WA0 A;  4A3M J;  3V7C A;  4EGY A;  2Z2S B;  1VF9 A;  2FBI A;  2H09 A;  1LVK A;  2HKX A;  3HOW J;  3VSL A;  4HBL A;  4EJW A;  4II3 A;  1QBJ A;  4XL9 A;  1WCM J;  1UHW A;  2X9D A;  3N05 A;  3GYH X;  2R7D A;  3RPU D;  2VE9 A;  2QQA A;  3CO7 C;  3WTZ A;  1C0W A;  2LYC A;  2ZXH A;  1ZKG A;  2V79 A;  2MH2 A;  3VYU B;  1WFX A;  2L7F P;  4L18 B;  3LSG A;  4L9V A;  5E1W A;  1ZLJ A;  2CQX A;  2OAZ A;  4E7K A;  2M1B A;  2I8D A;  1T0F A;  2TCT A;  4BQN A;  2JSC A;  1BI0 A;  2DTZ A;  1R00 A;  4D5C A;  3T5X A;  3S2H J;  1TT5 B;  2DMT A;  3QAH A;  1U9N A;  3DBL B;  4C3H J;  2JA7 J;  3H9J A;  2LD5 A;  1Z3X A;  4C2M J;  4LFU A;  4C3I J;  4XRM A;  3BR2 A;  4Q4Z F;  3H3V K;  3ZQI A;  2HI3 A;  1H9G A;  5B5E C;  2PN6 A;  3OYL A;  5AIP A;  3TW7 A;  4JBA A;  3EPZ A;  1ZGW A;  1V54 H;  2VQC A;  5C44 J;  5CQE A;  4BUP A;  5CLS A;  5D8K B;  3WGH A;  1H0M A;  3OOU A;  3S1R J;  3BDD A;  3A02 A;  2IT0 A;  1WJC A;  1ETV A;  3ABM H;  4RDU A;  2ZNZ A;  1WJD A;  2GA1 A;  2A5Y B;  2ID3 A;  3WTX C;  3DEW A;  3Q0U A;  4BAY A;  4UHT A;  5EZG A;  1O3S A;  5E20 A;  1KU2 A;  3QYE A;  3GFM A;  2P7V B;  1FWZ A;  4S0H B;  3U1K A;  2QUF A;  1XB4 A;  1G8X A;  3L00 A;  1SAU A;  4GDF A;  2A6T A;  5E1X A;  2K4B A;  1K83 J;  4B43 A;  1ZH5 A;  5BOX A;  1OYW A;  1BI3 A;  1BIA A;  3OYM A;  5TGT A;  3H35 A;  3S3M A;  3BCB A;  4D7N A;  5IP9 J;  3I59 B;  4BQO A;  1EA3 A;  2OA4 A;  2D1V A;  2RRE A;  2OUM A;  1Z9C A;  1K78 A;  3BJ6 A;  5DTD A;  1AKH B;  3E6D A;  3K10 A;  2A3S A;  4PJJ A;  3KET A;  3GWZ A;  2JA8 J;  3M8J A;  2EZH A;  5GAH J;  3FIS A;  2MC3 A;  1QGP A;  4S05 A;  2F6C A;  1XPX A;  1U0J A;  3EQL F;  2H8W A;  1SD5 A;  2Y75 A;  2M34 A;  4ON0 A;  2WY8 Q;  2DOF A;  3PNT A;  4I0B A;  1TP4 A;  1RRJ A;  1Y1W J;  3HUG A;  2NRA C;  2HQ5 A;  1YRN A;  3H5A A;  1XD7 A;  1RUN A;  4CCN A;  2PEX A;  4OMY A;  5HDK A;  1FTT A;  1OQY A;  4CIC A;  2DBB A;  3LOC A;  1SC7 A;  1RUO A;  2ETH A;  1P4X A;  2QKL B;  5HNH A;  2KMU A;  3LQR A;  5L3E A;  2CFO A;  2VE8 A;  2E60 A;  1JTX A;  2RQP A;  4EJT A;  5J8C A;  4EM1 A;  3WE3 A;  2Y9Z A;  1T56 A;  1S8N A;  3LA2 A;  4A0Y A;  3DPU A;  3RZO J;  2FNP A;  2DT7 B;  4IF4 A;  4CH7 A;  2VON A;  1DUX C;  1NK2 P;  5GAG J;  2QZ8 A;  1JHF A;  3ZGK A;  2XAU A;  1PP8 F;  3HHH A;  3CP8 A;  3ERE D;  4XKV A;  2KRC A;  4BS9 A;  3BG7 A;  4GO1 A;  4GXO A;  3F8C A;  4Y52 J;  1G3S A;  4ETS A;  1IF1 A;  1OKR A;  2OJE D;  1I3Q J;  3LAJ A;  1EKE A;  1FP1 D;  4G8X A;  4L5I A;  4AD9 A;  3HGG A;  4M73 A;  1VQ8 I;  4CA0 A;  2QA4 I;  1TTY A;  1ULY A;  4B09 A;  1PYV A;  5DEQ A;  3K6G A;  4Q48 A;  2FSW A;  1OCO H;  4G94 A;  3K9T A;  1K4T A;  1USS A;  3CD6 I;  3TED A;  1QPI A;  3RCO A;  1VTN C;  1ETY A;  4E7H A;  4ENJ A;  5ILS A;  2VQG A;  4KIC A;  5IT9 K;  5K7H A;  1BW5 A;  2X1D A;  2R4G A;  3I56 I;  4WXC A;  2CU7 A;  4XBF A;  1BI2 A;  4AWX B;  3OS1 A;  4B3X A;  3L09 A;  1HKS A;  2Q2E B;  3CCM I;  2EH3 A;  3GCM A;  4XQF A;  1WH7 A;  1TWC J;  1IN7 A;  2BVM A;  4ZDL A;  3NAU A;  1CF7 B;  1GV2 A;  2NS7 A;  3HTU A;  1GLN A;  1RES A;  2R7V A;  2LBF A;  4ANJ A;  1N25 A;  1YE9 A;  2KT0 A;  2A07 F;  2KZG A;  3A1Y A;  2LKP A;  3CUQ B;  4O5V A;  1IUF A;  5L3B A;  1Y0U A;  4BJT A;  4GCV A;  3SEQ A;  1JT0 A;  1U6G A;  2CG4 A;  2EFN A;  5EYR A;  2PLY A;  3VYT B;  4RB3 C;  3RKW A;  4P1W A;  1JTY A;  3Q3S A;  3I5U A;  5DCM A;  3ZPL A;  2W1O A;  4EEF G;  3JW4 A;  1XCB A;  3CCS I;  1SD7 A;  3MFK A;  2NXN B;  5BPI A;  1G3T A;  1PDN C;  4JQF A;  3L2R A;  2R7R A;  4CYC A;  1P7J A;  4AYB A;  2AQF A;  3HRU A;  3C7J A;  3FXO A;  1OJL A;  3FX3 A;  1TWG J;  5KAI C;  3HKZ A;  2EFO A;  5JVG F;  2STW A;  5LGT A;  2V6E A;  2OCE A;  3BTL A;  2ZJP F;  4N4N B;  1D5V A;  4IRH A;  1ACI A;  4Y15 A;  3EET A;  3K7A J;  1TW3 A;  2EZK A;  4AVZ A;  2STT A;  2CQQ A;  2VBY A;  2CSO A;  2X48 A;  4DOZ A;  3KYC B;  3TKY A;  2WAF A;  3Q0V A;  2VAS A;  2JZY A;  2XRN A;  3LSP A;  2L2O A;  3CCQ I;  2CW7 A;  1MMD A;  1R36 A;  1SAN A;  3SYT A;  2DT5 A;  4YIF A;  2M8E A;  1Y8Q B;  2CO5 A;  2Y0S A;  1XC5 A;  2MSY A;  5FKO A;  3WE2 A;  2CQK A;  4C3J J;  2VC1 A;  4P55 A;  2DOA A;  3CO6 C;  3F3X A;  3G1L A;  3ONQ A;  4BH9 A;  4BYY A;  5F08 A;  1KQ8 A;  4ENM A;  4JOM A;  1MNM C;  1WVR A;  2XRO A;  2B0L A;  2EV5 A;  4LOC A;  1W5S A;  4XLF A;  3COA C;  2JQ7 A;  2Y0M A;  3HZJ A;  1UEL B;  2Y48 A;  3GFL A;  1MSE C;  5CYV A;  1F9N A;  3K4C A;  1WGX A;  2L0K A;  2M4K A;  3IRR A;  2ZB9 A;  3FXR A;  3SFZ A;  2H94 A;  3IUO A;  4DBR A;  4A3F J;  1LEA A;  2VKE A;  1FOW A;  2Y9Y A;  2HWV A;  1IO2 A;  2MFZ A;  5K1Y A;  4IHT A;  1X4P A;  2LTP A;  3J7A O;  1LVA A;  2X6Y A;  4BEH B;  4RMN A;  4LK1 F;  1D1A A;  2E1M C;  3MZH A;  1D1C A;  4XKW A;  3A01 B;  2FQ3 A;  4KT5 C;  2X6X A;  4RAF A;  4CZZ A;  1HC8 A;  2DMQ A;  1JKO C;  2PBI A;  2EIL H;  1FNN A;  1YOV B;  4NHJ A;  5ICC A;  1UZC A;  2L7Z A;  3LA7 A;  3Q0W A;  1MDM A;  3HGY A;  3LSJ A;  5F0F A;  1OCZ H;  2QM3 A;  3LST A;  2MD0 A;  4HX8 A;  1R5I D;  3ZCO A;  3GUD A;  2HTS A;  2X4H A;  2VJ5 A;  4WWC A;  3W3C A;  3I0T A;  3BR5 A;  5H6Q A;  2VJJ A;  2ECC A;  2F4M B;  3KEQ A;  4V19 K;  5H6R A;  1RZ4 A;  5GAD J;  2Y0S N;  4EMS A;  1RR8 C;  3L2Q A;  1D8J A;  4ZYE A;  4IPA A;  3PSF A;  3IAS 2;  2W4S A;  3A01 A;  2MAB A;  2JRM A;  3IWF A;  1K6O A;  3CCL I;  3KCC A;  4DYC A;  4KNY A;  2XF5 A;  2ZSI B;  2LOO A;  4RB2 C;  2DFF A;  5DCM B;  3EYY A;  1VQ6 I;  3KYD B;  1XS9 A;  3EUH A;  2DLL A;  4F52 A;  5IP6 A;  1IDY A;  1FMW A;  3I71 A;  3AKZ A;  2EJR A;  4YII A;  2KDZ A;  3HIF A;  1SFX A;  4L9T A;  2LBF B;  2F4I A;  1V4R A;  4BE2 A;  1FTZ A;  3M07 A;  3TBI A;  1WPK A;  4YFX F;  3HRS A;  2UUZ A;  5ICE A;  3F23 A;  1W5C C;  1YTY A;  2OZ6 A;  2ZBK A;  4MIM A;  3WTY C;  2R0Q C;  5LRS A;  2DA2 A;  1ZQ3 P;  4DYQ A;  2IGK A;  4LLL A;  4MQ9 F;  2YUS A;  2ZME A;  1IN6 A;  3JRE A;  3FMR A;  1HSJ A;  5AIQ A;  3TOB A;  4BY1 J;  2FF4 A;  2MGQ A;  3MZY A;  2CH0 A;  4FT8 A;  2L9R A;  4ESJ A;  2OU2 A;  2XAF A;  4XLA A;  1VZ0 A;  2VB6 A;  3CLO A;  2LRD A;  2PG4 A;  5B66 C;  4G6D A;  2W85 A;  1T98 A;  3L2U A;  1JJ6 C;  2EWN A;  2IPQ X;  2VXD A;  4XRS A;  3GTP J;  3A2K A;  1OCP A;  3ABL H;  1MGT A;  3LSR A;  2CUF A;  1ZN2 A;  1E2X A;  2XSD C;  2CW0 F;  4U88 A;  4DIQ A;  2DTR A;  2DOD A;  2RQQ A;  5D4R A;  4M6X A;  2L5Q A;  2RVC A;  1WQ2 A;  4KIG A;  3WHC A;  3ASO H;  4NQW A;  2NNN A;  3QPS A;  4LMY A;  2YS9 A;  2GQQ A;  3LSI A;  1U78 A;  4M6Y A;  3HL2 A;  4JYK A;  1DPU A;  5EG0 A;  3ZN0 A;  4GFB A;  4I09 A;  3VFZ A;  3HB9 A;  4B4C A;  3KFW X;  5C4X J;  2ZJ2 A;  3MZ8 A;  3V8L A;  2GWR A;  2OTJ I;  2OD5 A;  1ERD A;  1XGM A;  5CVI A;  1X1P A;  4E7Z A;  1JKP C;  2FX0 A;  2XB5 A;  4X0G A;  1CF7 A;  1FX7 A;  3A0B C;  2ICW G;  2GOM A;  3IHU A;  4UVC A;  4FQG A;  3JSO A;  4I6Z A;  3GTO J;  2FOK A;  3H3U A;  5F04 A;  1SVM A;  2WAQ N;  1RNL A;  1JXS A;  5GAE J;  3I4M J;  3OMY A;  1UMQ A;  3OOP A;  4M3E A;  1DGR M;  2JA5 J;  4ZYG A;  4HNV A;  1B8I A;  1ZK8 A;  1W5T A;  1QVT A;  2L7M P;  2NOG A;  3ZQ7 A;  4PCQ A;  4BQQ A;  4RM2 A;  2LLK A;  3VOD A;  5J47 A;  5E3N A;  1JI8 A;  4YEL A;  3GW2 A;  1M1E B;  2Y31 A;  2DU9 A;  2FBH A;  1MBK A;  5K5Q A;  2A6E F;  3AL0 C;  4AIK A;  2X6W A;  3JSP A;  2OQG A;  3KX2 A;  4KIF A;  1SVL A;  2I5U A;  2XUB A;  2OBP A;  1HF0 A;  4HRI A;  4IJA A;  1N77 A;  2IBD A;  2M5W A;  4M3B A;  1MBJ A;  3FMQ A;  1MBH A;  2CJJ A;  2FU4 A;  2M7B A;  2NNY A;  5FRM A;  3FK6 A;  3SDB A;  3PFY A;  1IW7 F;  1WJ5 A;  3DKX A;  5M3M J;  1OR7 A;  2IJL A;  3K70 C;  3OS2 A;  3IC7 A;  3GX4 X;  4XOP A;  4XN0 A;  1I6H J;  4EM0 B;  5EEH A;  1DP3 A;  3A4C A;  3DLL F;  4HZF A;  5FGM A;  4FAS D;  1APL C;  5LGN A;  4DNC A;  1WZ2 A;  3NRV A;  4Z6Y A;  2QQB A;  1I39 A;  1K7A A;  1CGP A;  1VQN I;  4EV0 A;  1BBY A;  2VT3 A;  1J2X A;  4DW6 A;  1KON A;  1QZE A;  4AUX A;  2JUG A;  3WGG A;  2DA6 A;  5KAF C;  4HLX A;  1FYK A;  2EIM H;  1P92 A;  2Y30 A;  3PQJ A;  3FZV A;  2RN7 A;  3FBN B;  5GPC A;  1VQ4 I;  3H9Q A;  3OR2 C;  1QVU A;  1D5Y A;  2QQ9 A;  4IZZ A;  3CLQ A;  3VYR B;  4IRG A;  3JRC A;  1YHQ I;  1OCR H;  4RM3 A;  4BAC A;  3BPX A;  2XPW A;  4BQA A;  2PJP A;  3HOZ J;  2DI3 A;  3WHB A;  3S15 J;  2BE5 F;  4X1E A;  5KNL A;  2PFB A;  4UB6 C;  1ZGA A;  2BBY A;  2XDV A;  5D8L B;  3GTK J;  3CJT B;  5JR3 A;  2XIG A;  4XON A;  1R5G A;  4UY8 I;  3W6K B;  3G3Z A;  2HDD A;  3KZZ A;  5GTI C;  3S3N A;  4A0Z A;  1STZ A;  3O2P E;  3OS0 A;  1E17 A;  3BCA A;  3QPT A;  2X1E A;  2VL8 A;  2V9P A;  3VYS B;  3V7R A;  2WB1 N;  1A6Q A;  3Q5F A;  2HPI A;  1Z7U A;  3E6M A;  1NG7 A;  1I1G A;  1L0O C;  2B9S A;  1ITY A;  2ZJQ F;  3MKZ A;  2VC0 A;  1SMY F;  3H5R A;  3D5S C;  3VOE A;  4B48 A;  2QEX I;  1YFH A;  2HYG D;  4HOB A;  2Q0O A;  2D1H A;  2ZNY A;  4LB5 A;  1I50 J;  3G1O A;  1TC3 C;  1S7O A;  4IL6 C;  4YFN F;  3BTI A;  3TOA A;  3HRM A;  4XNF A;  5BPD A;  3ZXS A;  3BR3 A;  2XAQ A;  4PUS A;  3F8N A;  2OPT A;  3K69 A;  3P9C A;  2EFQ A;  2QBY A;  4HA8 A;  2RKH A;  1S3J A;  4P5O A;  3SEZ A;  3I64 A;  3PNV A;  4LIV A;  2JK3 A;  5M5Y J;  2JTV A;  3K2Z A;  5HOO A;  3JAM K;  1HDD C;  1LEB A;  3TQN A;  1WH5 A;  1QA6 A;  2XAJ A;  2CUZ A;  1FC3 A;  1J5Y A;  2EFP A;  2X85 A;  2WAD A;  1ZAR A;  5E3O A;  2OTL I;  1QU3 A;  1TQM A;  2ECB A;  3K4J A;  3W2A A;  4L0Y B;  3PJR A;  2IS6 A;  3FKJ A;  4BBR J;  4DJA A;  3DEU A;  2P8T A;  3H0G J;  1FIP A;  1MBF A;  3N97 A;  2GM4 A;  2NVQ J;  2Z3Y A;  1ZAO A;  3DP7 A;  1G3Y A;  4BU2 A;  4BGD A;  4ESF A;  2J5O A;  2LDU A;  1K61 A;  1I6X A;  3FXM A;  3PSI A;  2R7O A;  3I54 A;  1Q1H A;  4C30 A;  2A68 F;  5F0C A;  4XLE A;  5CVJ A;  1DU6 A;  1GV5 A;  3EUH C;  4Q47 A;  4L9J A;  4A3L J;  3S1Q J;  1MMG A;  1RIO H;  3MEX A;  3E5Q A;  4XMY A;  2DN0 A;  3SJM A;  1Q1V A;  3TO7 A;  2JUC A;  2KHM A;  2KPM A;  3CZ6 A;  3G73 A;  4P96 A;  3VEP A;  1Z6T A;  4M71 A;  4I01 A;  2W48 A;  2E1C A;  3SQN A;  3REO A;  4XID A;  4J19 A;  2ZXI A;  2HU9 A;  4XLC A;  5JI6 A;  2LH9 A;  1X1D A;  2K9M A;  1T0F C;  2EA4 A;  2HZT A;  4LD5 A;  2NVT J;  1LJ9 A;  1ODD A;  1ZRE A;  2GOX B;  4FHT A;  4PGG A;  2LG4 A;  2MLK A;  5A2Q Z;  3FXK A;  3GLX A;  1HKT A;  1HW5 A;  1XDU A;  3SDG A;  3BWG A;  2BEO A;  2GA2 A;  2KRH A;  2L4M A;  1T39 A;  1H88 C;  3BZC A;  2ZXJ A;  1NH3 A;  2EPF A;  1T2K A;  4HEA 2;  2PJR B;  2K5C A;  3WGI A;  3KYL A;  3R4K A;  5FO5 A;  4M3D A;  3CCV I;  1HLV A;  1Z0X A;  2P5K A;  2ME6 A;  2RGV A;  5DV5 A;  2AS5 F;  3WTW C;  1JJ8 C;  1R22 A;  3CDH A;  3AG3 H;  1F4K A;  1CQT A;  1SMT A;  3OYB A;  2AXL A;  3FHZ A;  3DQV C;  4CDG A;  2HPM A;  4V2G A;  2JVG A;  2VLA A;  2COM A;  2NYX A;  4RB0 A;  3CJR B;  3WG7 H;  2EZL A;  2NVU B;  2O5R A;  4BL0 B;  2MG4 A;  2OZU A;  4NC6 A;  3CC2 I;  1E3H A;  4FE7 A;  4H4K C;  4LG3 A;  4M72 A;  2KP6 A;  3GFI A;  3AG4 H;  5DD4 A;  1PJR A;  2K9N A;  2ZJR F;  5JHU A;  2H8R A;  2EIJ H;  2IAI A;  3GO5 A;  3RPU A;  4S04 A;  1ORK A;  1FY7 A;  1R9T J;  1LE8 B;  2EIN H;  1IRZ A;  3WTS C;  3WU1 B;  3H3Z A;  3BG3 A;  4AIH A;  2QF7 A;  3QYB A;  5J4Y A;  5E18 F;  1S5L C;  2WBM A;  4I99 C;  2E5N A;  3KLO A;  3KIO A;  2Y69 H;  3BOQ A;  4U0W A;  2ME0 A;  1LDJ A;  3HPH A;  5HLI A;  5M3F J;  4IOC F;  2L02 A;  2HXI A;  3CMA I;  3DXJ F;  4QLC U;  3KLN A;  2VOO A;  4Y3O A;  2F4O B;  4F7Z A;  1P4A A;  2DXI A;  5TRD A;  1A36 A;  1AWC A;  3VDX A;  3R60 A;  2RNG A;  4G6T B;  1HDP A;  1KGS A;  2BV6 A;  4N9I A;  1W36 D;  2LC2 A;  3ZMT A;  3F22 A;  1PUE E;  4IQJ A;  5J6X A;  2L9N A;  2W7N A;  2TRT A;  4Q5S F;  3BG6 A;  2JPB A;  4AIJ A;  3RPQ A;  1G4D A;  4E7I A;  4EM2 A;  2V1N A;  5H2F C;  4RBO A;  3CUO A;  2RV8 A;  4A12 A;  3HOS A;  1B72 B;  1P6R A;  1R4N B;  3SZG A;  2K4J A;  1FOX A;  1QHG A;  2LRE A;  4F92 B;  1ETK A;  3MN2 A;  2WV0 A;  2R7Z J;  3ECH A;  2ZC2 A;  2MD5 A;  4RLF A;  4PZJ A;  2K7L A;  4UV9 A;  2HVR A;  3CUQ C;  2A6H F;  2XPV A;  1MDM B;  3GXO A;  1LE8 A;  4D5F A;  2A5W A;  5IPA A;  4GYG A;  2E2I J;  3FWE A;  3WTV C;  1BN5 A;  4LIU A;  3NQO A;  3H9G A;  2XSJ C;  3MWM A;  5D6E A;  3ROU A;  3WG9 A;  1LQ1 A;  2R3S A;  2ZSH B;  5BMZ A;  3JTG A;  2IXS A;  2BHZ A;  2DFH A;  4EGZ A;  1DPR A;  4WX9 A;  2XKO A;  5EJC A;  2Z1D A;  5FLM J;  4YEJ A;  3BRO A;  3F9K A;  2XF7 A;  5A2Q K;  1YIO A;  3KP6 A;  1X1A A;  5IT3 A;  2KIQ A;  2RDP A;  3KEY A;  3X2Q H;  2K9L A;  4F55 A;  3RI4 A;  3M8E A;  1P9Q C;  4XN3 A;  1B72 A;  3OIP A;  4MHG A;  1G6N A;  1FSE A;  4CCM A;  3CJN A;  2WWY A;  3LFU A;  2DYS H;  5J1U A;  5GTH C;  1UG0 A;  3HXL A;  3DKW A;  1AU7 A;  3HOT A;  3E3V A;  2K3F A;  4UB8 C;  1U5T B;  1UCR A;  1HA8 A;  1HBX G;  3CP2 A;  2P81 A;  3D5R C;  3M8F A;  1PUF A;  1P4W A;  1BM9 A;  2OC6 A;  4P9F A;  5F1R A;  1Y8R B;  4ZJZ A;  2NVY J;  1OIS A;  5IYB J;  3OYK A;  4L0Z B;  5FRO A;  3HYI A;  4YRV A;  1F43 A;  4RAY A;  2HDW A;  4RA2 A;  4PK4 A;  4M9Z A;  2KIU A;  2YX7 A;  4IRI A;  4RAZ A;  3AFH A;  3OWT A;  2JVH A;  4XKB A;  3ZQL A;  3W6V A;  1G2H A;  4XLN F;  1KQ9 A;  1KQ0 A;  2VPR A;  3ZQQ A;  4BKX A;  3OYH A;  1MKM A;  3IWZ A;  3PFI A;  3JRB A;  1BR4 A;  4YFK F;  2NAZ A;  1TWF J;  2QSG X;  1ETW A;  3KE2 A;  4HF2 A;  3B02 A;  2FOW A;  3I9V 2;  2Q1Z B;  4V2F A;  2VI6 A;  1Z21 A;  3CF2 A;  2F5F A;  1DDN A;  2CV0 A;  2QYO A;  2Z5U A;  5LHH A;  3ZMZ A;  5J8F A;  2VUM J;  1GVD A;  4OIR F;  1XTA A;  4BEH A;  3OIO A;  2VKV A;  1X58 A;  3CDL A;  2LY9 A;  1FMV A;  2L3D A;  2P6T A;  5CVV A;  4Y13 A;  3JRA A;  2DA4 A;  4OMZ A;  5DUI A;  3QU3 A;  4JK1 X;  3HRT A;  2IP2 A;  4UXN A;  2IGN A;  2M0C A;  5DM7 F;  3M3Y J;  5E3M A;  4ZDO A;  3KZY A;  4L5E A;  5LRR A;  1HW2 A;  2HOE A;  1IRX A;  3OL4 A;  2E71 A;  2FQ4 A;  1WKM A;  3RZD J;  2E36 A;  2XB0 X;  1IUY A;  1F36 A;  1YIJ I;  3K70 D;  2IS2 A;  1B59 A;  2DAO A;  2BYV E;  4MTD A;  3ABU A;  4IQ4 A;  3RKQ A;  3M1C A;  1XG1 A;  1YYV A;  2NOJ B;  2ADU A;  3K1P A;  4A6E A;  2O6G E;  3S8P A;  3DPT A;  2A05 A;  1JKR C;  1R6R A;  4KIS A;  1UHM A;  2ESN A;  2AXT C;  2QCO A;  4TV7 A;  5D5X B;  2DQR A;  1XN7 A;  2P5V A;  4ASN A;  2VQL A;  2EA2 A;  4PGH A;  3WU0 A;  3E0J B;  2VOD A;  4A93 J;  4AM3 A;  2FA5 A;  2F5D A;  3MCZ A;  4Z2Y A;  2VJI A;  5EZH A;  1D0X A;  1EH8 A;  2YU3 A;  1E0E A;  1QQI A;  4HQE A;  2M45 A;  4MNU A;  2FUG 2;  3IKT A;  4B3A A;  1BI1 A;  3DTE A;  1FJL A;  4IXA A;  2H6C A;  2XHK A;  5E79 C;  2LP0 A;  2KJB A;  3J7Z I;  2PI0 A;  1LDK B;  1GT0 C;  3BG5 A;  3CJQ B;  1VQL I;  5J3L A;  4ZTJ A;  2R7S A;  5K7Z A;  1OFC X;  1QHH D;  2DQL A;  4LJZ F;  3SFI A;  1V5G A;  4LK0 F;  4ZDP A;  1T8I A;  3IH3 A;  2JN6 A;  1J9I A;  3HSE A;  3OYD A;  4IHS A;  4U7B A;  3U9G A;  2Y2Z A;  3OYF A;  1UST A;  3CCE I;  1BL0 A;  1VFC A;  4HV5 A;  2W82 A;  3E6B A;  2E1M B;  3RDI A;  4MEX F;  4G7H F;  2DA7 A;  4IEJ A;  4XK4 A;  1MNE A;  3DTK A;  5D5V B;  1JT6 A;  2HYF A;  3FM3 A;  5IOZ A;  5F6F A;  2M30 A;  4XRS G;  3M7G A;  1WJA A;  4FX4 A;  1ENH A;  2F5V A;  1MMS A;  3GZ5 A;  3LSH A;  4N9H A;  3VWB A;  4AU7 A;  2X6O A;  3CUQ A;  3AG1 H;  1LFP A;  3F72 A;  3S1N J;  1X3W B;  3L2C A;  4XSZ F;  3C2B A;  2R5Y B;  4CZC A;  2BHY A;  1SFO J;  5H20 A;  2O7O A;  3BLY A;  3KP3 A;  4Y33 A;  3Q9S A;  4IHX A;  1TQI A;  3HEF A;  2UXX A;  2RNJ A;  2WTE A;  1J09 A;  2PMU A;  5B3S H;  2K85 A;  5C4J J;  1FOY A;  2KKO A;  2HQN A;  5FFX A;  2R92 J;  4MFE A;  5HVQ C;  4OIO F;  3F6V A;  5J4V A;  3ISP A;  3E6C C;  5E3L A;  2KLO A;  4WF2 A;  4CUG A;  4BE1 A;  2JA2 A;  3DCF A;  4EAT A;  2K40 A;  2V1D A;  4RGU A;  4C2U A;  4G9Y A;  1J59 A;  2J5P A;  3F0C A;  2KIF A;  2DA5 A;  3IH2 A;  2HVS A;  3BPV A;  4D7M A;  3HDD A;  2FBK A;  2VN2 A;  2ZKZ A;  3H36 A;  2F5E A;  4I98 B;  3QP6 A;  3PL8 A;  1AHD P;  1IG7 A;  1WJF A;  5IYC J;  4Y7N J;  3OSF A;  4HG2 A;  5TJJ A;  4RS8 A;  3HG9 A;  2V1X A;  2R5Z A;  3HM5 A;  4UVB A;  4A3E J;  1XGN A;  1KU9 A;  2M2E A;  2L01 A;  1WWX A;  3UR3 C;  2UZK A;  5CJ9 A;  1IN5 A;  3SXY A;  2BW3 B;  2GXA A;  1D8K A;  1SEU A;  2E7W A;  1FYL A;  4B1R A;  4UNO A;  5HDN A;  3J80 K;  4BY7 J;  4LIT A;  3E97 A;  3MD2 A;  5DM6 F;  1B4A A;  1JUP A;  4A3C J;  3OR1 C;  4I2O A;  1KU7 A;  3JRI A;  2IEK A;  4MQV A;  3OYC A;  4EJU A;  3K4M A;  4D1Q A;  3MKY B;  3GF2 A;  3T8R A;  4YG2 F;  1YLF A;  2M9H A;  1KYZ A;  1YS7 A;  2KZV A;  4O6J A;  5E1Z B;  2VBZ A;  1UG2 A;  3RJP A;  2X1C A;  4MO7 A;  3GZ6 A;  1OCC H;  1JGS A;  2JMW A;  1WHU A;  2XVC A;  4QIW N;  2CQN A;  4U87 A;  5J1Y A;  3J81 Z;  2GLO A;  3D0S A;  4RGR A;  4WCG A;  4HNU A;  3HBL A;  4OAZ A;  4KN7 X;  4WK8 F;  1MSF C;  3U21 A;  4A5M A;  3UNG C;  1W1W E;  3GTG J;  1Z67 A;  3SHF A;  4HDV A;  1AKH A;  3VPR A;  1YG2 A;  1K78 B;  3D5L A;  3EUA A;  3V7S A;  3BQY A;  4BE0 A;  4ZYH A;  1ZHF A;  2VQH A;  4CSW A;  1NK3 P;  4A5N A;  3C2H A;  1JKQ C;  1FZP B;  2GXG A;  2ZFW A;  2FJ1 A;  1BOB A;  1YX5 A;  2LKS A;  2LK2 A;  2L9V A;  4OWR B;  1U8R A;  1ETX A;  1S6L A;  5J40 A;  3DFG A;  2R7T A;  5BS6 A;  4XR6 A;  3G6E I;  1GHC A;  4A0X A;  2D45 A;  1WSU A;  3D1N I;  1IDZ A;  4GYI A;  1R1V A;  5D6F A;  1FEX A;  2ISZ A;  2X51 A;  3QPH A;  2AQE A;  4BHP A;  2ZXW H;  3IL2 A;  1ZTR A;  4EJV A;  1ETQ A;  4HPQ A;  2R5Y A;  2FEZ A;  3CCJ I;  1IXC A;  4HX4 A;  1Z6R A;  3CMM A;  2HXO A;  4OOI A;  4JP0 A;  3DPL C;  2KRF A;  1GXQ A;  3GEZ A;  3I58 A;  3L2V A;  4ZZL A;  3W2V A;  2QEN A;  1HCR A;  3CF5 F;  3EDP A;  1SD4 A;  1OR7 C;  2CUE A;  3JRH A;  3HOX J;  3LL7 A;  4DGW B;  1BA5 A;  2P7C B;  5ILV A;  3UKG A;  2VOP A;  3RQI A;  5EG0 B;  4LGW A;  4M3G A;  4GRI A;  4QTR A;  1YQA A;  3PM1 A;  1DQU A;  3FKI J;  2L7K A;  1S7E A;  3K1N A;  3BZK A;  2CQ7 A;  5DCF A;  2HTJ A;  4IHW A;  1R7J A;  2IA0 A;  1YIT I;  1K4S A;  3GVA A;  1B1B A;  2IA1 A;  4E6K G;  3HOV J;  1TWA J;  3DBR B;  2A69 F;  1LPQ A;  2W57 A;  3C3W A;  1RET A;  4B8X A;  3FM5 A;  2K27 A;  3BZ6 A;  4CCL A;  3QPL A;  3KP7 A;  3PO3 J;  3O3K A;  1KZH A;  2IS1 A;  1B9M A;  3B73 A;  3IAM 2;  4L9N A;  2DMP A;  3CCR I;  3V8K A;  4HV6 A;  2QWW A;  2W24 A;  1AA7 A;  3DEE A;  3W6J B;  1O3R A;  4PJ0 C;  1TT0 A;  2UWM A;  3L2W A;  2JPC A;  1G3W A;  4OIN F;  2M0M A;  1Y1V J;  1W4M A;  2TDX A;  4ZYA A;  3CME I;  3ZN1 A;  4M9S A;  1R1T A;  3TMO A;  1GXP A;  3S2W A;  1UB9 A;  3BTJ A;  1SD6 A;  2E2H J;  1I1S A;  1RR7 A;  2ZFU A;  3ML6 A;  3JTH A;  3E1S A;  3R0J A;  3HSR A;  4OAY A;  3RTR A;  1PUF B;  5ICG A;  5CKT A;  2XRL A;  4HLY A;  4U0Y A;  4G12 A;  1XMX A;  3CC4 I;  2G7H A;  1O7L A;  2DFE A;  2DOE A;  2MC4 A;  1IXR C;  1V55 H;  3GLL A;  3V8J A;  4PJL A;  1RPW A;  2CFX A;  4A3D J;  4HF0 A;  2KQR A;  3AAF A;  1QRY A;  2FE3 A;  2YPR A;  1V5F A;  2JWT A;  2Q8K A;  1ZEL A;  1I27 A;  4CGZ A;  4C2T A;  4FET A;  1ZRC A;  1BJZ A;  3PNY A;  4B44 A;  1WI9 A;  2DK5 A;  4HQM A;  4KUM A;  4HAM A;  3FDY A;  4BNC A;  2PX9 A;  3ZP5 A;  1WI3 A;  3IV5 A;  3R0A A;  4CCJ A;  2M87 A;  5HLH A;  1MD0 A;  1ON2 A;  2KJC A;  1PP7 U;  3KP4 A;  1A6I A;  2EFW A;  4A3I J;  1X2N A;  3KPH A;  2VPL A;  4ZC3 A;  1F5T A;  3JRF A;  3FBI B;  2M7A A;  2XAG A;  1UFM A;  1LFU P;  2QSF X;  4RB1 A;  3I4N J;  4XLP F;  1BR1 A;  4FE4 A;  2HYJ A;  4IX7 A;  2YX4 A;  4PFP A;  3PIO F;  1YW9 A;  2R93 J;  1D0Z A;  5IYD J;  2RAE A;  3QRF F;  2QSH X;  3TW6 A;  5D4S A;  3JCU C;  4PDK A;  2D2W A;  5EF6 A;  1TZL A;  3JRD A;  4C9Y A;  2XKP A;  1VI0 A;  3HPG A;  3O6B B;  1R4M B;  1ON1 A;  5K5R A;  3K4B A;  3MVP A;  2P5L C;  2WC2 A;  4M3F A;  2HOS A;  2IRF G;  1MJ9 A;  2CW8 A;  2H6B A;  2VJ4 A;  3H92 A;  3MAJ A;  2HZD A;  5KHD A;  1YJ9 I;  4I02 A;  4OIP F;  4CCK A;  3TO9 A;  5F1J A;  3A0H C;  2HR3 A;  5CPR B;  1J0R A;  5L3F A;  2Z99 A;  1S72 I;  2XAS A;  5HDG A;  3QOP A;  1NTC A;  1OLT A;  1DGW Y;  2FNA A;  3TDZ C;  3J7A Y;  5DUK A;  2WY7 Q;  1U9O A;  1U5T A;  1SFE A;  1BR2 A;  5ICF A;  4HNT A;  2HOA A;  3CCY A;  1BJA A;  4CYD A;  1SVO A;  2E19 A;  3QOD A;  3GFJ A;  3VSK A;  4FCY A;  3F8M A;  3RSN A;  3E7L A;  1R71 A;  2WB1 A;  4BHC A;  2HFH A;  1EJ9 A;  2ZME C;  5LHG A;  3JR9 A;  3BR1 A;  4MTE A;  3RKY A;  4KA4 A;  2KDO A;  4BDY A;  4UVA A;  1ZLK A;  2DCE A;  1BW6 A;  2GAU A;  1FP2 A;  4AID A;  3DU6 A;  3L7W A;  4M9X A;  3H0D A;  1LB2 A;  1E3P A;  2CUJ A;  4ZH4 F;  4FIS A;  1XSX A;  1H9T A;  1W7P D;  2R7W A;  2V7F A;  3CQZ J;  3PUB A;  2BY2 A;  3M1E A;  1IRG A;  4LLG F;  2K3P A;  2DA1 A;  3A03 A;  5FKN A;  1FSH A;  4BXF A;  4ABZ A;  1T08 B;  5E8I A;  3J7Y J;  2JJ7 A;  4RGS A;  2E34 A;  5HLG A;  1MBG A;  5F0H A;  3EYI A;  1ZR4 A;  3DWL E;  2PMZ N;  3G71 I;  2O03 A;  1RKW A;  2GXB A;  1MIJ A;  2VKH A;  3P7N A;  4UUT A;  2X0L A;  4EQQ A;  5FB2 A;  5KK1 A;  3F21 A;  1EV7 A;  1W36 C;  2DO7 A;  1WJB A;  1NHA A;  1SFU A;  5E8G A;  1FLI A;  4CYC B;  4G7Z F;  4W1U A;  1X1B A;  2DK8 A;  1DU0 A;  1GDT A;  3WOD F;  4IKF A;  4MLO A;  5B1A H;  1T38 A;  2A61 A;  5HS8 A;  5LEK A;  2O61 A;  5AON A;  2F5C A;  2CWE A;  3JRG A;  1KYW A;  4LLN A;  3PO2 J;  5LLQ A;  4G6Q A;  1DP7 P;  1X3U A;  3CES A;  2LF8 A;  1OCT C;  3ULQ B;  2DPU A;  3GZN B;  4IVN A;  4XOT A;  4HST A;  2YSR A;  1XSV A;  4HW0 A;  3HUG B;  3TDU C;  3ZQH A;  3I4P A;  2JA6 J;  3FHN A;  2BW3 A;  5D5W B;  1HQC A;  3I3L A;  1SFK A;  1LUJ B;  2RC4 A;  3PQK A;  1H8A C;  3I53 A;  1QO0 D;  3HOU J;  2O9L A;  4HF1 A;  3FXJ A;  3LSM A;  3T1B A;  4ZYD A;  2ELK A;  2BOL A;  1W7P B;  4LG0 B;  2ISY A;  1NG6 A;  3BR0 A;  1FPQ A;  2UV1 A;  2K9Q A;  1W0T A;  1TQP A;  4KYW A;  5M5W J;  4MGR A;  5FFZ A;  3IKV A;  2OV7 A;  3I59 A;  4XKC A;  2P0W A;  5L3D A;  3ABT A;  2PMZ A;  1YI2 I;  2E1O A;  5EGO A;  3S2D J;  3HJE A;  3OY9 A;  2WAQ A;  1O7F A;  1FIA A;  2IS4 A;  4Y4R A;  3BJA A;  4PFO A;  1XMA A;  3ZMV A;  3MKL A;  2LKX A;  1N78 A;  1S9H A;  2VT2 A;  1ZGJ A;  4XSX F;  3FMS A;  1HXD A;  2K9S A;  3DU5 A;  3S32 A;  4DZP A;  1WRJ A;  1K79 A;  2V4J C;  1ZG1 A;  2VBW A;  1O57 A;  5C3E J;  1JE8 A;  3CTA A;  1N75 A;  2P6S A;  1ONV A;  5EEG A;  2KFD A;  2OCC H;  2DA3 A;  1OPC A;  2QBY B;  3DBH B;  2EK5 A;  1Z7L A;  4AVP A;  5HLT A;  3S16 J;  1A5J A;  3KP2 A;  4K2E A;  1U5T C;  1HW1 A;  4KIB A;  2LSO A;  3FXU A;  3TO6 A;  2E2J J;  2N8G A;  3C1D A;  2HQA A;  4UUS A;  2MBF A;  2V1U A;  9ANT A;  1E3O C;  2XAH A;  2HNH A;  2D5V A;  1YS6 A;  2M8G X;  1R5H A;  5CVR A;  4L5J A;  1U3E M;  2HEO A;  1U2W A;  2GIZ A;  4A3G J;  3HKZ N;  1YRN B;  2CMP A;  3BP8 A;  4XOR A;  3RIR A;  3W2W A;  1REP C;  4FX0 A;  5BQT A;  1MND A;  2FXA A;  3ZQC A;  2ACJ A;  3BG9 A;  2E35 A;  4PJN A;  3NWS A;  1QZY A;  1Z1D A;  3CCU I;  1XDS A;  2R5Z B;  2CV1 A;  1AOY A;  2R7U A;  2BVL A;  3B6A A;  3WU2 C;  5JVT A;  2ID6 A;  1H89 C;  3MQ0 A;  4RLQ A;  1PVE A;  4QWQ A;  2HGC A;  2EV0 A;  2LR8 A;  4IOA F;  4P9U A;  1D3Y A;  4JX5 A;  5IP7 J;  1J75 A;  2W25 A;  4NBQ A;  2DJI A;  3DKY A;  1FBU A;  3M4O J;  2EIK H;  1VQ5 I;  2JT1 A;  2XGC A;  1GUU A;  2HKO A;  4N4O B;  3LAP A;  3CMY A;  2W00 A;  2DYR H;  4UUS B;  2DDA A;  3FK7 A;  1X4O A;  4G7O F;  2CYY A;  1Y6I A;  2FRH A;  3LNQ A;  5IT9 Z;  1O3T A;  1YX3 A;  1ZRD A;  2H1K A;  4CXF A;  4WXD A;  2BXY A;  2I10 A;  5CQG A;  5FJ8 J;  1QPM A;  2HVQ A;  3C18 A;  5FKL A;  1BIB A;  2E5Z A;  3TL4 X;  3FF5 A;  4YIR X;  2BY0 A;  2L9S A;  2LF7 A;  1BC7 C;  2R7Q A;  3J80 Z;  1TW2 A;  1VQ9 I;  2O8K A;  5ILU A;  2JRT A;  1EH6 A;  1OYI A;  4BJ5 C;  2PQ8 A;  4NC8 A;  3P5J A;  1W0U A;  5CVU A;  3AL0 B;  3ERM A;  2QQ8 A;  1T6S A;  2KL4 A;  2OF7 A;  1FBQ A;  5LBQ A;  4KFC A;  2LMD A;  1I3A A;  2C6Y A;  4E70 A;  2EV6 A;  3GTM J;  2IW5 A;  3BR6 A;  3K4N A;  2B7E A;  2V9V A;  3Q9V A;  5FLV A;  2M4G A;  1IZ1 A;  2BXZ A;  3ABK H;  4DYR A;  4BXX J;  2ESH A;  4FTH A;  2CRG A;  5GP9 A;  5EGO B;  4EJO A;  2ELH A;  5KCM A;  1ZYR F;  3TGN A;  1X3Z B;  4MEY F;  4NB5 A;  3OV8 A;  5IOY A;  1MZB A;  1B8I B;  2CGP A;  1XMK A;  1W7P A;  2FMY A;  3BY6 A;  1R58 A;  3T0Y A;  4QSH A;  3FIW A;  1YJW I;  4F91 B;  1TNS A;  2LY2 A;  2CS3 A;  4I76 A;  2LVS A;  3ZQG A;  2ELJ A;  2MLG A;  2AHQ A;  5HS7 A;  5KVR A;  1V5E A;  3PUF A;  3ZQF A;  1UJ8 A;  5FRN A;  1MBE A;  1J7K A;  3IH4 A;  4II2 A;  3HSF A;  3QP5 A;  1OMI A;  4JX6 A;  1VQO I;  4DQ2 A;  1Z3Y A;  2LFB A;  1IJW C;  3GME A;  5F64 A;  5JLX A;  1FOK A;  2Z9O A;  4CCO A;  2VXZ A;  3TP3 A;  2NS8 A;  3S17 J;  2COB A;  3S93 A;  3ZOB A;  1K6Y A;  1Z77 A;  3JAM Z;  4I0A A;  3DV8 A;  2GBY A;  2VBX A;  2XGD A;  1WJE A;  4IHY A;  5L3C A;  1D1B A;  5FLX Z;  4E7L A;  5FKK A;  3QQA A;  2EQR A;  2O3F A;  4NQW B;  1XCV A;  2GIV A;  3K0L A;  1TNT A;  4A3K J;  2V6C A;  4A3B J;  2E1N A;  3NEU A;  5L3G A;  1VQK I;  4KMF A;  1MJB A;  1R1U A;  3TP0 A;  5F27 A;  3K1M A;  1S7A A;  2EB7 A;  3G2B A;  3IP4 B;  1R49 A;  3K4K A;  4CO8 A;  1UAA A;  1LNW A;  1Z91 A;  3WTU C;  3DF8 A;  1LFB A;  2MA3 A;  4HDU A;  4XRF A;  4ZTF A;  2F2E A;  5DS9 A;  5EEA A;  3QOE A;  2XV4 S;  3ZMU A;  4LB6 B;  4A69 C;  2EZI A;  2K02 A;  5DDG A;  4PSW A;  2G0E A;  2IGM A;  4KDP A;  3MKW B;  3R6S A;  3OYG A;  4NC7 A;  3QU6 A;  1MMA A;  2XGE A;  2EBI A;  1FBS A;  4D0P A;  2QLZ A;  4N0B A;  2ZO4 A;  5FKM A;  1IV6 A;  3BC8 A;  5D5U B;  3HOY J;  3QYF A;  2ZME B;  3GTQ J;  4LG0 A;  3RYR A;  2UXN A;  3MMY B;  3RKX A;  5TIS C;  2BZT A;  3J81 K;  2DFI A;  1MJA A;  2IGO A;  1T95 A;  1YW7 A;  4D9J A;  3ECO A;  1XX5 A;  2G7U A;  2R7X A;  2BGC A;  1Y56 A;  2WAE A;  1KA8 A;  2DDB A;  5JHF A;  1ZRF A;  4BDZ A;  2OQR A;  2IA2 A;  3KP5 A;  4M74 A;  4NNJ A;  1O3Q A;  1IC8 A;  4A2U A;  3G1M A;  3V4G A;  4AYB N;  2DJN A;  1HST A;  3SZP A;  4MFD A;  1IV8 A;  1UHS A;  2QKM B;  1IAW A;  4H0E A; 
#chains in the Genus database with same CATH homology
 5ED4 A;  4OIQ F;  1YW8 A;  4BXU A;  2O0Y A;  2Z33 A;  1A04 A;  1B9N A;  2LNB A;  3M9A A;  3FXQ A;  4OU0 A;  5DYM A;  1Z05 A;  4A6D A;  3ZMS A;  4R79 A;  2R7F A;  3P9K A;  2O8X A;  5FLX K;  1P2F A;  3LA3 A;  5E17 F;  3F6O A;  3F8B A;  1IXS B;  5LHI A;  1QNT A;  2DPD A;  3LQQ A;  4KMU X;  4R8H A;  2GZW A;  1S29 A;  4ENK A;  2YR2 A;  1IN4 A;  5K5O A;  3P9I A;  3HHG A;  2W84 A;  5HS9 A;  1XGS A;  3IRQ A;  1TBX A;  2HQR A;  4HX7 A;  4CHU A;  1GVJ A;  3KEO A;  3U2R A;  1JHH A;  1FYM A;  1RI7 A;  2FML A;  4GGG A;  3RYP A;  1TLH B;  5LEJ A;  3U1D A;  1KU3 A;  2PMH A;  4U0V A;  1SAX A;  2IVM A;  1HKQ A;  3HTS B;  5FD5 A;  3L9F A;  5LGU A;  1L3L A;  2HDC A;  1QZZ A;  3ELK A;  3LWF A;  2L4A A;  4KN4 X;  3E5U A;  2DW4 A;  2P4W A;  3LFK A;  4ESB A;  5JFR A;  1R23 A;  2H27 A;  1BC8 C;  3VB2 A;  2QVO A;  4UUV A;  1OYY A;  1F1Z A;  4Y17 A;  1XSD A;  3ZMD A;  1BOA A;  1V3F A;  2G9W A;  2E7X A;  4ZZD A;  2XGX A;  4I7H A;  1ZG3 A;  4R1H A;  4WXH A;  4O3M A;  1IN8 A;  2ZCW A;  1B6A A;  5FD6 A;  1YO5 C;  6PAX A;  1IRF A;  2K86 A;  4U7D A;  3F8F A;  2HS5 A;  4BHB A;  3E5X A;  4UV8 A;  3WTT C;  1FT9 A;  1ZG5 A;  4EVI A;  4ENN A;  1XGO A;  2L54 A;  4HYE A;  5ERI A;  2NS0 A;  4RGX A;  2Q2E A;  3BJO A;  1I5Z A;  5DD8 A;  1LDD A;  3R61 A;  2KIM A;  3SZT A;  3N4M A;  2MH9 A;  1EH7 A;  3T8T A;  3V7C A;  4EGY A;  2FBI A;  2H09 A;  2HKX A;  4HBL A;  4EJW A;  1QBJ A;  1UHW A;  3GYH X;  2R7D A;  2VE9 A;  2QQA A;  3CO7 C;  3WTZ A;  1C0W A;  2V79 A;  2MH2 A;  4L18 B;  4L9V A;  5E1W A;  1ZLJ A;  2OAZ A;  2M1B A;  1T0F A;  2JSC A;  1BI0 A;  1R00 A;  3T5X A;  3QAH A;  4LFU A;  4Q4Z F;  1H9G A;  2PN6 A;  5AIP A;  4JBA A;  5CLS A;  5D8K B;  3WGH A;  1H0M A;  3BDD A;  2IT0 A;  2ZNZ A;  2GA1 A;  2A5Y B;  3WTX C;  4BAY A;  4UHT A;  1O3S A;  5E20 A;  1KU2 A;  3GFM A;  2P7V B;  1FWZ A;  2QUF A;  1XB4 A;  3L00 A;  5E1X A;  2K4B A;  1ZH5 A;  5BOX A;  1OYW A;  1BIA A;  1BI3 A;  3I59 B;  2OA4 A;  2D1V A;  1K78 A;  1Z9C A;  3BJ6 A;  3E6D A;  2A3S A;  3KET A;  3GWZ A;  2MC3 A;  1QGP A;  4S05 A;  3EQL F;  1SD5 A;  2Y75 A;  4ON0 A;  4I0B A;  3HUG A;  2NRA C;  1XD7 A;  1RUN A;  2PEX A;  4OMY A;  5HDK A;  4CIC A;  2DBB A;  1RUO A;  2ETH A;  1P4X A;  3LQR A;  5L3E A;  2VE8 A;  2RQP A;  4EJT A;  5J8C A;  4EM1 A;  3WE3 A;  3LA2 A;  1S8N A;  4A0Y A;  2FNP A;  4IF4 A;  2VON A;  1DUX C;  2QZ8 A;  1JHF A;  1PP8 F;  3HHH A;  3ERE D;  4GO1 A;  4GXO A;  3F8C A;  1G3S A;  4ETS A;  1IF1 A;  1OKR A;  3LAJ A;  1FP1 D;  4G8X A;  4L5I A;  4AD9 A;  4M73 A;  1ULY A;  1TTY A;  4B09 A;  5DEQ A;  4Q48 A;  2FSW A;  4G94 A;  3K9T A;  1USS A;  1VTN C;  4ENJ A;  5ILS A;  5IT9 K;  4KIC A;  4WXC A;  4XBF A;  1BI2 A;  4AWX B;  3L09 A;  1HKS A;  1IN7 A;  1CF7 B;  3HTU A;  2A07 F;  2LKP A;  4O5V A;  3CUQ B;  5L3B A;  1Y0U A;  4GCV A;  1U6G A;  2CG4 A;  2EFN A;  2PLY A;  4RB3 C;  3RKW A;  3I5U A;  5DCM A;  3ZPL A;  3JW4 A;  1XCB A;  1SD7 A;  3MFK A;  5BPI A;  1G3T A;  1PDN C;  4JQF A;  3C7J A;  3HRU A;  3FX3 A;  2EFO A;  2STW A;  5LGT A;  1D5V A;  4IRH A;  4Y15 A;  3EET A;  1TW3 A;  2STT A;  2VBY A;  2CSO A;  3TKY A;  2JZY A;  2XRN A;  1R36 A;  2DT5 A;  4YIF A;  2M8E A;  2CO5 A;  3WE2 A;  2CQK A;  2VC1 A;  4P55 A;  3CO6 C;  3F3X A;  4BH9 A;  4BYY A;  1KQ8 A;  4ENM A;  2XRO A;  2B0L A;  2EV5 A;  3COA C;  1W5S A;  2Y0M A;  2Y48 A;  3GFL A;  5CYV A;  1F9N A;  3IRR A;  3FXR A;  3SFZ A;  2H94 A;  1LEA A;  2HWV A;  4IHT A;  5K1Y A;  3J7A O;  1LVA A;  3MZH A;  4LK1 F;  2FQ3 A;  4KT5 C;  4CZZ A;  2PBI A;  1FNN A;  4NHJ A;  5ICC A;  3LA7 A;  1MDM A;  2QM3 A;  3LST A;  4HX8 A;  3GUD A;  2HTS A;  2X4H A;  4WWC A;  3I0T A;  5H6Q A;  3KEQ A;  5H6R A;  1RZ4 A;  4EMS A;  1D8J A;  4ZYE A;  4IPA A;  3IWF A;  1K6O A;  3KCC A;  4KNY A;  4RB2 C;  5DCM B;  3EYY A;  3EUH A;  2DLL A;  3I71 A;  2EJR A;  4YII A;  3HIF A;  1SFX A;  4L9T A;  1V4R A;  4YFX F;  3HRS A;  5ICE A;  3F23 A;  1YTY A;  2OZ6 A;  2ZBK A;  3WTY C;  5LRS A;  4LLL A;  4MQ9 F;  2ZME A;  1IN6 A;  3FMR A;  1HSJ A;  5AIQ A;  3TOB A;  2FF4 A;  3MZY A;  4FT8 A;  4ESJ A;  2OU2 A;  2XAF A;  3CLO A;  2PG4 A;  4G6D A;  2W85 A;  1T98 A;  2EWN A;  2IPQ X;  1MGT A;  1ZN2 A;  1E2X A;  2CW0 F;  4U88 A;  2DTR A;  5D4R A;  4M6X A;  2RVC A;  1WQ2 A;  4KIG A;  4NQW A;  2NNN A;  4LMY A;  2GQQ A;  1U78 A;  4M6Y A;  1DPU A;  3ZN0 A;  4I09 A;  3VFZ A;  3KFW X;  2ZJ2 A;  3V8L A;  2GWR A;  2OD5 A;  1XGM A;  5CVI A;  1CF7 A;  1FX7 A;  3IHU A;  4UVC A;  3JSO A;  2FOK A;  3H3U A;  1RNL A;  1JXS A;  3OOP A;  4ZYG A;  1W5T A;  3ZQ7 A;  4PCQ A;  3VOD A;  3GW2 A;  2DU9 A;  5K5Q A;  2FBH A;  2A6E F;  4AIK A;  3JSP A;  2OQG A;  4KIF A;  2XUB A;  2OBP A;  4IJA A;  2M5W A;  3FMQ A;  2FU4 A;  2NNY A;  1IW7 F;  1OR7 A;  2IJL A;  3IC7 A;  3GX4 X;  4EM0 B;  5EEH A;  4HZF A;  5FGM A;  5LGN A;  4DNC A;  3NRV A;  2QQB A;  1K7A A;  1CGP A;  4EV0 A;  1BBY A;  2VT3 A;  1J2X A;  3WGG A;  4HLX A;  1FYK A;  1P92 A;  3PQJ A;  3FZV A;  2RN7 A;  2QQ9 A;  4IRG A;  3BPX A;  4BQA A;  2PJP A;  2DI3 A;  2BE5 F;  2PFB A;  1ZGA A;  2BBY A;  5D8L B;  5JR3 A;  2XIG A;  1R5G A;  3W6K B;  3G3Z A;  3KZZ A;  4A0Z A;  1STZ A;  3O2P E;  1E17 A;  3QPT A;  3V7R A;  3Q5F A;  1Z7U A;  3E6M A;  1I1G A;  1L0O C;  2VC0 A;  1SMY F;  3VOE A;  1YFH A;  2HYG D;  4HOB A;  2Q0O A;  2D1H A;  2ZNY A;  4LB5 A;  1S7O A;  4YFN F;  3TOA A;  3HRM A;  5BPD A;  2XAQ A;  3F8N A;  3K69 A;  3P9C A;  2EFQ A;  2QBY A;  4HA8 A;  2RKH A;  1S3J A;  4P5O A;  3I64 A;  2JTV A;  3K2Z A;  5HOO A;  3JAM K;  1LEB A;  3TQN A;  2XAJ A;  1FC3 A;  1J5Y A;  2EFP A;  1ZAR A;  1TQM A;  4L0Y B;  3DEU A;  2P8T A;  3N97 A;  2Z3Y A;  1ZAO A;  3DP7 A;  1G3Y A;  4ESF A;  2J5O A;  2LDU A;  1I6X A;  3I54 A;  1Q1H A;  2A68 F;  5CVJ A;  4Q47 A;  4L9J A;  1RIO H;  3MEX A;  3E5Q A;  3TO7 A;  3G73 A;  4P96 A;  3VEP A;  1Z6T A;  4M71 A;  4I01 A;  2E1C A;  3SQN A;  3REO A;  5JI6 A;  2EA4 A;  2HZT A;  4LD5 A;  1LJ9 A;  1ODD A;  1ZRE A;  4FHT A;  4PGG A;  5A2Q Z;  2MLK A;  3GLX A;  1HKT A;  1HW5 A;  1XDU A;  3BWG A;  2BEO A;  2GA2 A;  2L4M A;  1T39 A;  2ZXJ A;  1T2K A;  3WGI A;  3R4K A;  5FO5 A;  2P5K A;  2RGV A;  5DV5 A;  2AS5 F;  3WTW C;  1R22 A;  3CDH A;  1F4K A;  1SMT A;  2AXL A;  3FHZ A;  3DQV C;  4CDG A;  2COM A;  2NYX A;  4RB0 A;  2OZU A;  4M72 A;  3GFI A;  5DD4 A;  5JHU A;  3GO5 A;  3RPU A;  4S04 A;  1FY7 A;  3WTS C;  3WU1 B;  3H3Z A;  4AIH A;  5E18 F;  3KLO A;  3BOQ A;  4U0W A;  1LDJ A;  5HLI A;  2L02 A;  3DXJ F;  4QLC U;  3KLN A;  2VOO A;  4F7Z A;  1P4A A;  5TRD A;  1AWC A;  3R60 A;  1KGS A;  2BV6 A;  4N9I A;  3ZMT A;  3F22 A;  1PUE E;  5J6X A;  4Q5S F;  2JPB A;  4AIJ A;  3RPQ A;  1G4D A;  4EM2 A;  3CUO A;  2RV8 A;  4A12 A;  3HOS A;  1P6R A;  2K4J A;  2WV0 A;  3ECH A;  4UV9 A;  2MD5 A;  4PZJ A;  2K7L A;  3CUQ C;  2A6H F;  1MDM B;  3GXO A;  4GYG A;  3FWE A;  3WTV C;  1BN5 A;  3NQO A;  5D6E A;  3MWM A;  3ROU A;  3WG9 A;  1LQ1 A;  2R3S A;  5BMZ A;  3JTG A;  4EGZ A;  1DPR A;  4WX9 A;  2XKO A;  3BRO A;  5A2Q K;  1YIO A;  3KP6 A;  5IT3 A;  2RDP A;  3RI4 A;  3M8E A;  4MHG A;  1G6N A;  1FSE A;  3CJN A;  2WWY A;  3DKW A;  3HOT A;  3E3V A;  1U5T B;  1UCR A;  1HBX G;  3M8F A;  1P4W A;  1BM9 A;  4P9F A;  5F1R A;  4L0Z B;  3HYI A;  4RAY A;  4M9Z A;  2KIU A;  2YX7 A;  4IRI A;  4RAZ A;  4XLN F;  1KQ9 A;  1KQ0 A;  1MKM A;  3IWZ A;  3PFI A;  4YFK F;  2NAZ A;  3KE2 A;  4HF2 A;  3B02 A;  2F5F A;  1DDN A;  2QYO A;  2Z5U A;  5LHH A;  3ZMZ A;  5J8F A;  4OIR F;  2L3D A;  2P6T A;  5CVV A;  4Y13 A;  4OMZ A;  5DUI A;  3QU3 A;  4JK1 X;  3HRT A;  2IP2 A;  4UXN A;  3KZY A;  1HW2 A;  5LRR A;  2HOE A;  1WKM A;  1IUY A;  1B59 A;  2DAO A;  2BYV E;  4MTD A;  3ABU A;  1YYV A;  2ADU A;  3K1P A;  4A6E A;  2O6G E;  3DPT A;  1UHM A;  2ESN A;  4TV7 A;  5D5X B;  2DQR A;  1XN7 A;  2P5V A;  4ASN A;  2EA2 A;  4PGH A;  3WU0 A;  2VOD A;  2FA5 A;  2F5D A;  3MCZ A;  4Z2Y A;  1EH8 A;  2YU3 A;  1QQI A;  4HQE A;  2M45 A;  4MNU A;  3IKT A;  1BI1 A;  4IXA A;  2H6C A;  2XHK A;  2KJB A;  2PI0 A;  1LDK B;  2DQL A;  4LJZ F;  1J9I A;  4LK0 F;  3HSE A;  4IHS A;  4U7B A;  3U9G A;  1UST A;  4HV5 A;  3E6B A;  3RDI A;  4MEX F;  4G7H F;  5D5V B;  2HYF A;  3FM3 A;  5F6F A;  2M30 A;  3M7G A;  4FX4 A;  3GZ5 A;  4N9H A;  3CUQ A;  3F72 A;  3L2C A;  4XSZ F;  5H20 A;  3KP3 A;  3Q9S A;  1TQI A;  2UXX A;  2RNJ A;  2WTE A;  2PMU A;  2KKO A;  2HQN A;  5FFX A;  4OIO F;  5HVQ C;  3F6V A;  3ISP A;  3E6C C;  4WF2 A;  2V1D A;  4RGU A;  4G9Y A;  1J59 A;  2J5P A;  2KIF A;  3BPV A;  2FBK A;  2VN2 A;  2ZKZ A;  2F5E A;  4I98 B;  3QP6 A;  5TJJ A;  4RS8 A;  2V1X A;  4UVB A;  1XGN A;  1KU9 A;  2L01 A;  1WWX A;  2UZK A;  5CJ9 A;  1IN5 A;  3SXY A;  1D8K A;  2E7W A;  1FYL A;  4UNO A;  5HDN A;  3J80 K;  3E97 A;  1B4A A;  4I2O A;  1KU7 A;  4MQV A;  4EJU A;  3GF2 A;  3T8R A;  4YG2 F;  1YLF A;  1KYZ A;  1YS7 A;  4O6J A;  5E1Z B;  2VBZ A;  3RJP A;  3GZ6 A;  1JGS A;  2XVC A;  3J81 Z;  3D0S A;  4RGR A;  4WCG A;  4KN7 X;  4WK8 F;  4A5M A;  3SHF A;  4HDV A;  1YG2 A;  1K78 B;  3D5L A;  3V7S A;  4ZYH A;  1ZHF A;  4A5N A;  1FZP B;  2GXG A;  2ZFW A;  1U8R A;  1S6L A;  3DFG A;  5BS6 A;  1GHC A;  4A0X A;  2D45 A;  1WSU A;  4GYI A;  1R1V A;  5D6F A;  2ISZ A;  3QPH A;  4BHP A;  3IL2 A;  4EJV A;  2FEZ A;  1IXC A;  4HX4 A;  1Z6R A;  4OOI A;  3DPL C;  2KRF A;  1GXQ A;  3GEZ A;  3I58 A;  4ZZL A;  2QEN A;  3EDP A;  1SD4 A;  2P7C B;  5ILV A;  2VOP A;  4LGW A;  1YQA A;  3K1N A;  5DCF A;  2HTJ A;  1R7J A;  2IA0 A;  3GVA A;  1B1B A;  2IA1 A;  2A69 F;  2W57 A;  3C3W A;  4B8X A;  3FM5 A;  2K27 A;  3BZ6 A;  3KP7 A;  3O3K A;  1B9M A;  3B73 A;  4L9N A;  3V8K A;  4HV6 A;  2QWW A;  2W24 A;  3W6J B;  1O3R A;  2UWM A;  2JPC A;  1G3W A;  4OIN F;  1W4M A;  2TDX A;  3ZN1 A;  4M9S A;  1R1T A;  1GXP A;  3S2W A;  1UB9 A;  1I1S A;  1SD6 A;  3ML6 A;  3JTH A;  3R0J A;  3HSR A;  3RTR A;  5ICG A;  4HLY A;  4U0Y A;  2G7H A;  1O7L A;  1IXR C;  3V8J A;  2CFX A;  4HF0 A;  3AAF A;  2YPR A;  2FE3 A;  2Q8K A;  1I27 A;  4CGZ A;  1ZRC A;  1WI9 A;  2DK5 A;  4HQM A;  4KUM A;  4HAM A;  4BNC A;  3ZP5 A;  3R0A A;  2M87 A;  5HLH A;  1MD0 A;  1ON2 A;  2KJC A;  1PP7 U;  3KP4 A;  2EFW A;  1F5T A;  2XAG A;  1UFM A;  4RB1 A;  4XLP F;  2YX4 A;  1YW9 A;  3QRF F;  5D4S A;  4PDK A;  2D2W A;  2XKP A;  3O6B B;  1ON1 A;  5K5R A;  2P5L C;  2WC2 A;  2IRF G;  1MJ9 A;  2H6B A;  3MAJ A;  3H92 A;  4I02 A;  4OIP F;  3TO9 A;  2HR3 A;  1J0R A;  5L3F A;  2Z99 A;  2XAS A;  5HDG A;  3QOP A;  2FNA A;  3TDZ C;  5DUK A;  1U5T A;  1SFE A;  5ICF A;  1BJA A;  4CYD A;  3GFJ A;  3F8M A;  4BHC A;  2HFH A;  5LHG A;  4MTE A;  3RKY A;  4KA4 A;  4UVA A;  1ZLK A;  2GAU A;  1FP2 A;  3L7W A;  4M9X A;  1LB2 A;  4ZH4 F;  1XSX A;  1H9T A;  1W7P D;  3M1E A;  1IRG A;  4LLG F;  1FSH A;  5E8I A;  4RGS A;  5HLG A;  3EYI A;  2GXB A;  2O03 A;  3P7N A;  4EQQ A;  2X0L A;  5FB2 A;  5KK1 A;  3F21 A;  1EV7 A;  2DO7 A;  1SFU A;  1NHA A;  1FLI A;  5E8G A;  4G7Z F;  2DK8 A;  3WOD F;  1T38 A;  2A61 A;  5HS8 A;  5LEK A;  2O61 A;  5AON A;  2F5C A;  2CWE A;  1KYW A;  4LLN A;  5LLQ A;  4G6Q A;  1DP7 P;  1X3U A;  2LF8 A;  3ULQ B;  2DPU A;  4IVN A;  2YSR A;  1XSV A;  4HW0 A;  3TDU C;  3I4P A;  5D5W B;  1HQC A;  2RC4 A;  3PQK A;  3I53 A;  1QO0 D;  4HF1 A;  3T1B A;  4ZYD A;  1W7P B;  4LG0 B;  2ISY A;  1FPQ A;  1TQP A;  4KYW A;  4MGR A;  5FFZ A;  3IKV A;  3I59 A;  5L3D A;  3ABT A;  1O7F A;  3BJA A;  1XMA A;  3ZMV A;  2VT2 A;  1ZGJ A;  4XSX F;  3FMS A;  1HXD A;  1WRJ A;  1K79 A;  1ZG1 A;  2VBW A;  1O57 A;  1JE8 A;  3CTA A;  2P6S A;  1ONV A;  5EEG A;  1OPC A;  2QBY B;  2EK5 A;  4AVP A;  3KP2 A;  4K2E A;  1U5T C;  1HW1 A;  4KIB A;  2LSO A;  3FXU A;  3TO6 A;  3C1D A;  2MBF A;  2V1U A;  2XAH A;  1YS6 A;  1R5H A;  5CVR A;  4L5J A;  1U3E M;  2HEO A;  1U2W A;  3BP8 A;  3RIR A;  1REP C;  4FX0 A;  5BQT A;  2FXA A;  2ACJ A;  1QZY A;  1Z1D A;  1XDS A;  1AOY A;  5JVT A;  3MQ0 A;  4QWQ A;  2HGC A;  2EV0 A;  4P9U A;  1D3Y A;  1J75 A;  2W25 A;  1FBU A;  2JT1 A;  2HKO A;  3LAP A;  4G7O F;  2CYY A;  2FRH A;  5IT9 Z;  1O3T A;  1ZRD A;  4CXF A;  4WXD A;  1QPM A;  3C18 A;  1BIB A;  3FF5 A;  2LF7 A;  1BC7 C;  3J80 Z;  1TW2 A;  5ILU A;  2JRT A;  1EH6 A;  1OYI A;  2PQ8 A;  5CVU A;  1T6S A;  4KFC A;  1FBQ A;  5LBQ A;  2C6Y A;  4E70 A;  2EV6 A;  2IW5 A;  2V9V A;  3Q9V A;  1IZ1 A;  2ESH A;  4EJO A;  2ELH A;  1ZYR F;  3TGN A;  4MEY F;  4NB5 A;  3OV8 A;  1MZB A;  2CGP A;  1XMK A;  1W7P A;  2FMY A;  3BY6 A;  1R58 A;  3T0Y A;  1TNS A;  2MLG A;  5HS7 A;  5KVR A;  1J7K A;  3HSF A;  3QP5 A;  1OMI A;  4DQ2 A;  5F64 A;  1FOK A;  2Z9O A;  2VXZ A;  3JAM Z;  4I0A A;  3DV8 A;  2VBX A;  5L3C A;  5FLX Z;  2O3F A;  1XCV A;  2GIV A;  3K0L A;  1TNT A;  2V6C A;  2E1N A;  3NEU A;  5L3G A;  4KMF A;  1MJB A;  1R1U A;  3K1M A;  1S7A A;  2EB7 A;  4CO8 A;  1LNW A;  1Z91 A;  3WTU C;  3DF8 A;  2MA3 A;  4HDU A;  4XRF A;  2F2E A;  2XV4 S;  3ZMU A;  4LB6 B;  2K02 A;  5DDG A;  4KDP A;  3R6S A;  3QU6 A;  1FBS A;  4D0P A;  2QLZ A;  4N0B A;  2ZO4 A;  5D5U B;  2ZME B;  4LG0 A;  3RYR A;  2UXN A;  3RKX A;  3J81 K;  2DFI A;  1MJA A;  1YW7 A;  3ECO A;  2G7U A;  2BGC A;  1KA8 A;  1ZRF A;  2OQR A;  2IA2 A;  3KP5 A;  4M74 A;  1O3Q A;  4A2U A;  3V4G A;  1HST A;  3SZP A;  1IAW A;  4H0E A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...