4AIKA

Crystal structure of rova from yersinia in complex with an invasin promoter fragment
Total Genus 52
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
52
sequence length
139
structure length
139
Chain Sequence
STLGSDLARLVRVWRALIDHRLKPLELTQTHWVTLYNINRLPPEQSQIQLAKAIGIEQPSLVRTLDQLEEKGLITRHTSANDRRAKRIKLTEQSSPIIEQVDGVISSTRKEILGGISSDEIAVLSGLIDKLEKNIIQLQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural Basis for Intrinsic Thermosensing by the Master Virulence Regulator Rova of Yersinia.
pubmed doi rcsb
source organism Yersinia pseudotuberculosis
molecule tags Transcription
molecule keywords TRANSCRIPTIONAL REGULATOR SLYA
total genus 52
structure length 139
sequence length 139
chains with identical sequence B
ec nomenclature
pdb deposition date 2012-02-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01047 MarR MarR family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 4aikA00
1FP2A 3ZMVA 3ZN1A 1TBXA 4AD9A 2CO5A 4I0AA 3FXQA 4U0WA 1ZG1A 4IF4A 1S3JA 3QPHA 3I59A 1XGMA 4PZJA 2G7UA 1RZ4A 1OYYA 4KIGA 1FPQA 1KYWA 4GYGA 3RTRA 1USTA 4HBLA 5DCFA 2F5CA 4AVPA 1GXPA 3L7WA 2A68F 2KKOA 2VBWA 2WTEA 2M87A 4BHCA 5D5VB 4LG0B 3IHUA 3PQKA 5HVQC 4A0ZA 3U1DA 1P4XA 5F6FA 4S05A 4HX7A 1FT9A 1BOAA 3BWGA 1G6NA 3LFKA 1SD4A 4KFCA 4AIHA 3SFZA 3QP6A 4BYYA 4HYEA 3WTUC 2IT0A 4G6QA 3BZ6A 1MJ9A 4LFUA 3QAHA 4CZZA 4CHUA 5DDGA 4OMYA 3O6BB 4CGZA 4XBFA 1KU7A 4EJWA 2RVCA 2KRFA 2A07F 1ZREA 5IT9Z 2DQLA 4EJOA 2O61A 3HTUA 2M8EA 2FEZA 2AS5F 3HSFA 5ICEA 1I6XA 3RPQA 3LSTA 1SD7A 1JE8A 1K6OA 3BJOA 5FFZA 4A5NA 1U5TC 3I59B 1IXSB 1S7AA 3I54A 1FWZA 4D0PA 1W7PA 3J7AO 2M45A 2Q8KA 3E6BA 4O5VA 1AWCA 1XCVA 3L2CA 1IN5A 1QQIA 4UVCA 3DKWA 2QZ8A 2MH9A 2GWRA 1DDNA 4ESJA 3I53A 1J0RA 1F9NA 4ZZDA 3BOQA 5DV5A 4LJZF 4A5MA 1S8NA 1FBSA 1FBQA 3JSOA 1HSJA 2UXXA 2RQPA 3T1BA 2NNNA 4HF2A 1IN4A 1FY7A 1V4RA 3WTWC 3R6SA 3L9FA 1WQ2A 2O8XA 1EH6A 4P9UA 2QENA 4BHPA 5HLIA 1IXCA 2VBYA 1ZN2A 3OV8A 2OQRA 5DCMA 2W85A 4Q5SF 3TGNA 1R5GA 3LA3A 3E6MA 2EFQA 1HW2A 4K2EA 2LF7A 3J80K 5J8CA 1MDMB 5E8IA 4G7HF 3QU3A 2HDCA 5HS7A 2Z9OA 2FMYA 1D5VA 3ZMZA 3M8EA 1NHAA 3TKYA 1L0OC 2UZKA 1CGPA 2W57A 3K1NA 2W24A 1JHFA 2FBIA 4N9IA 3F3XA 2JSCA 3KP4A 2YX7A 2M5WA 1S29A 2VXZA 2K4JA 2O0YA 1O7LA 4HOBA 3J80Z 4M6XA 1TQIA 4EGYA 4UHTA 5D5WB 2KJCA 3C3WA 1RUOA 2ZNZA 1T2KA 2P8TA 3TOAA 4CDGA 5L3EA 3KLOA 5LHHA 1STZA 1D8JA 1P6RA 4XSXF 1I1SA 4MTDA 2VBXA 3FXUA 3VOEA 1J75A 1QBJA 5J6XA 5TRDA 4ETSA 2PMUA 1VTNC 4QLCU 1IAWA 4OIQF 1Z6RA 4Y15A 3S2WA 4EJVA 1EH7A 1S7OA 4E70A 1XGNA 1EV7A 2XHKA 1R00A 4I2OA 4HF0A 1TLHB 2L54A 3WODF 1RI7A 3TDUC 3ZMTA 3P9KA 2HFHA 2E1NA 1G3WA 2PFBA 5ED4A 2CGPA 4WXHA 3I64A 3IRQA 2HKOA 1O3TA 3WE3A 4EJUA 2VODA 2M30A 3M8FA 4KIBA 4L5JA 4FX4A 2CYYA 2XAGA 4ESBA 3F8CA 4TV7A 4YFNF 1XSVA 3RKWA 3IKTA 3K1PA 2DAOA 2IW5A 3ECOA 1KU2A 1J59A 1HW1A 3HRUA 3R0AA 1XMAA 2DW4A 1H9TA 3GFIA 1WWXA 1Z1DA 4WXCA 2CQKA 2FU4A 1W5TA 3ISPA 4EJTA 2PEXA 1F4KA 4M9SA 3R61A 3ZN0A 5LLQA 5D5UB 3HHGA 3HUGA 2FBHA 5AONA 4OIRF 4UVAA 4ENMA 4O6JA 5LBQA 5IT9K 1YTYA 3V7CA 2ISYA 2OAZA 1IUYA 1ODDA 3CO7C 4IHSA 4M72A 1XMKA 1H9GA 3O2PE 2OU2A 1SFUA 2QBYB 3WTZA 2IA2A 2OZ6A 1TQMA 2PLYA 4FHTA 1I1GA 1SMYF 3Q5FA 4HA8A 3D5LA 2JT1A 4O3MA 3E6DA 2IA1A 5K5OA 4ENKA 1ON2A 4Z2YA 4KMUX 3SHFA 3WGHA 1B1BA 2HTSA 3V8LA 2MLKA 1QZYA 2FRHA 1ZH5A 3KLNA 4XRFA 4A0YA 3GX4X 2HS5A 2V1XA 4Y13A 3CO6C 4PGGA 1T38A 5BQTA 3BDDA 1ZLJA 1Q1HA 2MLGA 4HDUA 2EV5A 2H6CA 1T6SA 2EV0A 1K7AA 1P2FA 1KU9A 3WTYC 2BYVE 2RC4A 2YSRA 5L3FA 2EA4A 2JZYA 3QOPA 2NAZA 1Z7UA 4A0XA 2L3DA 4LLLA 4KUMA 1ZG5A 3T8RA 3H3UA 1FX7A 2GA1A 4FX0A 1GVJA 2QBYA 5LRSA 1QPMA 5A2QK 2R3SA 2FSWA 4OIPF 5H6QA 5JI6A 3VEPA 5H6RA 1K79A 1SFEA 4I98B 4BQAA 3E97A 3WTSC 1G4DA 2CFXA 3LWFA 5BPIA 3I0TA 2K4BA 3MAJA 4MQ9F 4XLNF 3TOBA 2D1VA 3PQJA 2XIGA 4RAZA 3V8KA 5E1XA 1F1ZA 3V4GA 4JQFA 3J81Z 4ON0A 2GZWA 3BROA 5K1YA 1U3EM 4GGGA 4I02A 2XAQA 3HSRA 3F6VA 3ERED 3HYIA 2OA4A 3KP7A 2A3SA 3WTTC 4G7ZF 2HKXA 1P4WA 4RB3C 1MJAA 3TQNA 3H3ZA 1FZPB 3F22A 3FZVA 2HOEA 2PMHA 3KZZA 2ZJ2A 1LEAA 3DP7A 2RGVA 4WCGA 5L3DA 4LMYA 5DYMA 3CUQA 2YU3A 1QNTA 4RGUA 1USSA 2XKOA 6PAXA 2A5YB 3TO9A 4DNCA 2V9VA 5CVUA 4I0BA 4IRGA 3WGIA 2QVOA 1BJAA 2XV4S 1B6AA 3V8JA 2OZUA 4A12A 1KU3A 1XB4A 4KA4A 5ERIA 5FGMA 2DK8A 4HV6A 2LDUA 3KE2A 2HZTA 2L4MA 1R1UA 2XROA 5TJJA 3ELKA 5LEJA 1O7FA 1B4AA 2Y75A 2A61A 5HDNA 4BH9A 2OBPA 4Q47A 3QP5A 3FM5A 2FNPA 1X3UA 2HR3A 2PBIA 2E1CA 1LEBA 1U6GA 3GF2A 2LF8A 1HSTA 3FMQA 3BY6A 3C18A 3E6CC 1W7PD 1K78A 1R7JA 4HQMA 5DCMB 4UV9A 2Z33A 4F7ZA 3GFLA 1KYZA 4UV8A 4I09A 3E5XA 1B59A 4U0VA 3F8MA 1UCRA 2Y48A 3HIFA 4WF2A 3LQQA 2F5FA 3ZP5A 1U5TA 1R5HA 4ZZLA 2L01A 2ZCWA 3CDHA 1FSEA 4GYIA 4Y17A 5BPDA 1HBXG 5BMZA 4H0EA 3LA7A 5F1RA 2FBKA 2A6EF 4KMFA 2O3FA 3JTGA 1PP7U 4RGRA 2RNJA 1XCBA 2D2WA 3HSEA 2ZO4A 2COMA 1LNWA 2JTVA 4GO1A 2CG4A 3HOSA 3QPTA 2YPRA 3BJ6A 3EYIA 1OKRA 1QZZA 4PGHA 2ZKZA 2LSOA 1KQ9A 2GA2A 4EGZA 1ULYA 1S6LA 1KA8A 4HAMA 4HLXA 4LLNA 1YYVA 2ELHA 1ZRFA 2P7VB 1HKSA 5LEKA 1Z6TA 1J2XA 2HYFA 3F8NA 3CJNA 1O3QA 2BV6A 3SQNA 2FQ3A 1HQCA 2Q2EA 2WC2A 2XKPA 3GEZA 3CUOA 3RKYA 1XD7A 2ETHA 4LG0A 5FFXA 5CVJA 5DEQA 2E7XA 3W6KB 1RIOH 2ZBKA 5E20A 5FB2A 1H0MA 1HXDA 3TO6A 3LQRA 2NYXA 3IC7A 2ESHA 3DQVC 2XASA 2DLLA 2R7DA 2UXNA 2EFPA 4LK1F 3DFGA 4L18B 4ZH4F 1TQPA 3H92A 3HRMA 5D5XB 2YR2A 2JPCA 2NS0A 4ZYDA 2EWNA 3WG9A 4G94A 3ZMDA 4L0YB 1XDSA 4MEYF 4WWCA 3N97A 1YW9A 3MCZA 4A6EA 4WK8F 3SZPA 5H20A 1T39A 4GCVA 4L9JA 1UHMA 1GXQA 4NHJA 1P92A 2CW0F 1BC8C 5JR3A 3U2RA 3K9TA 3L09A 1Z91A 1FLIA 4EM0B 3ULQB 2XGXA 1LDDA 1MD0A 3ABTA 3PFIA 5E1ZB 2DPUA 3C1DA 2DO7A 1EH8A 1OR7A 2Y0MA 1RNLA 3MEXA 4M6YA 1BI0A 1U5TB 5CJ9A 5EEHA 3GXOA 5ICFA 1JGSA 5KK1A 1D3YA 1ZGJA 4HQEA 1ZGAA 3KP2A 3EYYA 3IKVA 3R4KA 4PCQA 3R60A 5J8FA 1BI2A 1IRFA 1ZRDA 1ZYRF 1J9IA 1LB2A 2VOPA 1QGPA 2AXLA 1XN7A 3KZYA 2VT3A 3I4PA 1A04A 1KQ0A 4IJAA 2GIVA 2MBFA 2K27A 1IN8A 4CICA 4OIOF 2HYGD 1BBYA 5DUKA 3WE2A 3RDIA 1OPCA 3K1MA 4RGXA 1SD6A 2IA0A 1IZ1A 3RYPA 1ZARA 3RIRA 3LAJA 1W7PB 3JAMZ 4EM1A 1PDNC 1FYKA 1SD5A 1O3SA 1OYIA 2DBBA 3KEOA 1CF7B 3N4MA 2IJLA 1QO0D 1BIBA 3KFWX 5D6FA 4LGWA 2V79A 4CXFA 2Z5UA 3NEUA 4XLPF 3GWZA 2EK5A 1XGSA 3KP3A 5CYVA 1XSDA 4KICA 2V6CA 5K5QA 1BM9A 1REPC 2DQRA 1IF1A 4AIKA 2JPBA 1YW7A 3OOPA 3P9CA 3K2ZA 2K02A 3ABUA 4I01A 2M1BA 4G9YA 5BS6A 1R58A 4HV5A 3T8TA 1R1TA 2FE3A 1BIAA 4IXAA 4YFKF 2QQ9A 4YIIA 2J5OA 4RB2C 2XRNA 1LQ1A 1G3YA 2EFOA 3P9IA 3MZHA 4ESFA 4LB5A 3WGGA 2J5PA 5FLXZ 1E17A 5HDKA 3WU0A 3WTXC 3GVAA 4M71A 3GFJA 3ML6A 1IN6A 2H27A 4WXDA 4R1HA 2EA2A 3GYHX 1SAXA 1KGSA 2A6HF 5ILSA 3LAPA 2W25A 3KEQA 5DD8A 1BI1A 2X0LA 5HLGA 5CVIA 2XAFA 5LGTA 2ZXJA 5D6EA 4KT5C 1XSXA 3M9AA 3BPVA 2KIFA 2QM3A 1IN7A 3DXJF 3V7SA 2ZMEA 3ZQ7A 1ZG3A 4MEXF 3COAC 4Q4ZF 2GQQA 3DPLC 1WSUA 4RB1A 1FSHA 2O6GE 2Z99A 3MZYA 4L5IA 1PUEE 1B9MA 5LHGA 2E7WA 3ZMSA 1UHWA 3JAMK 5LGNA 1P4AA 4B8XA 5F64A 2VBZA 2RV8A 4N9HA 2BBYA 4I7HA 3M1EA 4AIJA 5AIQA 2QWWA 3DF8A 4LK0F 4KIFA 4NQWA 4A2UA 3CLOA 2QLZA 1I27A 2FF4A 2WWYA 4P5OA 1Y0UA 3CUQC 4LD5A 3SZTA 2WV0A 4EVIA 1TTYA 3BPXA 2EFWA 2OD5A 1LDJA 4BXUA 4M9XA 2HQNA 3EUHA 4YFXF 1ON1A 4ZYEA 4GXOA 1FYLA 4L0ZB 1IW7F 3RI4A 3K0LA 2PI0A 3GLXA 4IHTA 4RAYA 3GZ5A 2XUBA 2PQ8A 5E1WA 1YG2A 4P96A 2VC0A 2QYOA 2H6BA 4RGSA 4LB6B 2BE5F 5BOXA 2ESNA 1TW3A 1WRJA 4BHBA 4KYWA 4EM2A 4HW0A 4PDKA 2HTJA 1UB9A 3GUDA 3I58A 3EETA 3T5XA 3F8FA 3VODA 3B73A 3QU6A 4M73A 3F72A 1B9NA 4CYDA 2VT2A 3P7NA 1U2WA 5HS8A 4KNYA 3W6JB 4RS8A 3EQLF 1W4MA 2LKPA 2ZNYA 2D1HA 4YIFA 2RDPA 5K5RA 1IRGA 1BC7C 3IWFA 3I5UA 3R0JA 4P55A 2IRFG 1MGTA 5JFRA 4WX9A 2B0LA 4R79A 4U7DA 1CF7A 2F5EA 2NRAC 2LNBA 4P9FA 5FD5A 2MA3A 3REOA 1HW5A 2STTA 1R23A 1ZHFA 2HWVA 3LA2A 2CSOA 3KETA 4MTEA 1O3RA 1YQAA 3JSPA 5HDGA 3DPTA 4MGRA 3WU1B 3ZPLA 2X4HA 1YIOA 1FNNA 4JK1X 1J5YA 3TO7A 2DT5A 5A2QZ 5LGUA 4HZFA 2L4AA 1YLFA 5CVVA 2Q0OA 1Z05A 2EJRA 3ZMUA 4L9VA 1R22A 1I5ZA 5DD4A 2HGCA 3IRRA 4IRHA 3GW2A 5E8GA 4ENNA 5CVRA 5D8LB 2HEOA 3U9GA 2H94A 5D4SA 2A69F 2KIUA 1FOKA 1U8RA 3FMSA 1TNSA 5FLXK 2P7CB 1MDMA 2D45A 3TDZC 3FM3A 4OU0A 5L3CA 2YX4A 5HS9A 5IT3A 4EQQA 2FOKA 1YO5C 1HKQA 3NRVA 4N0BA 1XGOA 2GAUA 2UWMA 2IVMA 4MQVA 4JBAA 5DUIA 2MH2A 4AWXB 1LDKB 4FT8A 4UNOA 2F5DA 2ADUA 3RPUA 3V7RA 5ILUA 5FD6A 1UFMA 4L9NA 2H09A 3QRFF 3CTAA 2MC3A 2VONA 2RKHA 2PN6A 2C6YA 4KN4X 2FA5A 3NQOA 1LVAA 2P4WA 3K69A 5LRRA 1DP7P 5E17F 3FHZA 3C7JA 4DQ2A 1LJ9A 4U7BA 5JHUA 3AAFA 2EB7A 4M74A 4U88A 1YS7A 1K78B 1C0WA 3VFZA 3KCCA 4B09A 3I71A 2RN7A 4LLGF 2BEOA 4HF1A 1V3FA 2NNYA 2P5LC 2XAHA 4KN7X 2FXAA 1BI3A 5HOOA 2VC1A 3J81K 3ECHA 3WTVC 3MFKA 3HRSA 2DPDA 1T0FA 2P5VA 3IWZA 2FNAA 2DK5A 2ACJA 1MJBA 4ENJA 1YFHA 2ZMEB 2R7FA 2VE9A 3Q9SA 1TNTA 2K86A 4UVBA 2P6TA 1ONVA 4HLYA 4HX8A 1ZRCA 4G7OF 1T98A 2V1UA 3F21A 2HQRA 2GXGA 3FWEA 3GFMA 3FF5A 1PP8F 4L9TA 4OMZA 3HTSB 4UUVA 2VE8A 1FBUA 2XVCA 1E2XA 5FO5A 2BGCA 3BJAA 1W5SA 2O03A 3DEUA 3JW4A 3EDPA 2GXBA 4YG2F 1L3LA 5ILVA 2QQAA 1AOYA 3F23A 3FMRA 3O3KA 4RB0A 3E5QA 5D8KB 2KIMA 4ASNA 2ISZA 3VB2A 4S04A 3GO5A 1J7KA 3HHHA 3IL2A 2OQGA 3Q9VA 3RJPA 2QQBA 2DFIA 2DU9A 2IP2A 3SXYA 1FYMA 2IPQX 4OINF 2P5KA 2DI3A 5CLSA 4OOIA 2P6SA 3T0YA 3KP5A 4EV0A 2PG4A 4IVNA 4BAYA 2G7HA 4UXNA 1R1VA 1G3TA 1WKMA 5JVTA 1XDUA 2TDXA 1O57A 3FX3A 3D0SA 1DUXC 3KP6A 3FXRA 3MWMA 5D4RA 4EMSA 2DTRA 2W84A 1DPUA 1ZAOA 1R36A 2VN2A 4CO8A 2XAJA 4HX4A 1U78A 4ZYHA 1OYWA 1YW8A 2F2EA 2MD5A 1IXRC 2K7LA 3B02A 3E3VA 2ZFWA 3E5UA 3RKXA 5EEGA 1YS6A 1JHHA 4IRIA 3BP8A 5HLHA 2Z3YA 3M7GA 1G3SA 1SMTA 1OMIA 1GHCA 1FC3A 1D8KA 1JXSA 4QWQA 4MNUA 4Q48A 5L3BA 5L3GA 2PJPA 3HOTA 3DV8A 3HRTA 4M9ZA 4BNCA 3F6OA 4A6DA 3F8BA 2V1DA 4NB5A 3MQ0A 5ICCA 5KVRA 4XSZF 2EV6A 3RYRA 4KDPA 2CWEA 3L00A 1ZLKA 3GZ6A 1RUNA 1MKMA 2G9WA 5E18F 4HDVA 4G8XA 4IPAA 5LHIA 2KJBA 3G3ZA 1BN5A 1Z9CA 5AIPA 4R8HA 1DPRA 1WI9A 2JRTA 1KQ8A 1HKTA 4U0YA 2EFNA 1TW2A 4ZYGA 3JTHA 1MZBA 1FP1D 3CUQB 4MHGA 1SFXA 1F5TA 2FMLA 2STWA 5ICGA 3ROUA 4G6DA 2QUFA 2VOOA 3G73A 2L02A
chains in the Genus database with same CATH superfamily
1FP2A 3MKZA 3ZMVA 3ZN1A 1TBXA 4AD9A 2CO5A 4I0AA 3IUOA 1FMWA 3FXQA 4U0WA 1D0XA 1Y6IA 1ZG1A 4IF4A 3IH2A 4IQJA 1S3JA 2LLKA 4ZYAA 2ZSHB 3QPHA 3I59A 1XGMA 4PZJA 2G7UA 1D1CA 1RZ4A 1OYYA 1LFPA 4KIGA 1AKHA 4DBQA 4F91B 1FPQA 3BQZA 1KYWA 4GYGA 4RBOA 2LTPA 2WAEA 3RTRA 1USTA 4HBLA 2AO9A 3Q0WA 2ZXHA 5DCFA 2F5CA 2HXOA 3MMYB 4AVPA 4KITB 1ETWA 2R0QC 1GXPA 3L7WA 2LY9A 2A68F 2KKOA 5GADJ 2FQ4A 2VBWA 2Y0SN 2WTEA 2M87A 1PYVA 1T33A 4E7HA 3BR0A 4BACA 4BHCA 1K6YA 5D5VB 3CF5F 3G4SI 4LG0B 1RPWA 2RQQA 4HSTA 4XLHA 3IHUA 3PQKA 4JX6A 1TWHJ 4PJMA 3SEQA 5HVQC 2DMQA 4A0ZA 3U1DA 1P4XA 5F6FA 4S05A 4HX7A 1FT9A 1BOAA 2V26A 3BWGA 1G6NA 4HNTA 2DOEA 1E0EA 1Y8QB 1ZELA 3LFKA 1SD4A 4KFCA 4QSHA 2QEXI 3NWSA 3Q0UA 3ZOBA 4AIHA 3SFZA 2V1NA 5EZHA 4C3HJ 3QP6A 2VJ4A 3AG1H 3NARA 4BYYA 2VXDA 2GIZA 4HYEA 3WTUC 2IT0A 4G6QA 3BZ6A 1MJ9A 3W2WA 3G71I 3HOYJ 4LFUA 1BR4A 3LSKA 3QAHA 3H1CA 4CZZA 3QQAA 4CHUA 5DDGA 5B3SH 4OMYA 3O6BB 4RLFA 4JX4A 4B48A 4CGZA 3RCOA 1IRXA 2R7ZJ 1MH3A 3OSGA 5C3EJ 4XBFA 1VF9A 1LE8A 1D1AA 1KU7A 4EJWA 3B6CA 2RVCA 2KRFA 2A07F 1ZREA 2DCEA 3ZR8X 2DQLA 5IT9Z 4EJOA 2QSFX 2O61A 3HTUA 2O9LA 4E6KG 2CFOA 4BBSJ 2M8EA 1JKPC 2FEZA 2AS5F 3K70C 3HSFA 5ICEA 1I6XA 3RPQA 3LSTA 1ETQA 4OAYA 3QOEA 4BJ5C 1SD7A 1NG6A 3PL8A 3BJOA 4Z6YA 1JE8A 1K6OA 3BCBA 3FXJA 3CCQI 1X3WB 5FFZA 4A5NA 1U5TC 3I59B 1ETVA 2Y31A 4F52A 3OYFA 1IXSB 1S7AA 3I54A 1FWZA 2VB6A 9ANTA 2KT0A 4D0PA 3I55I 1W7PA 1WGXA 4B1RA 3J7AO 2ZJQF 1JI8A 2M45A 3ZQLA 2Q8KA 4RM3A 3E6BA 3OMYA 5E3OA 4O5VA 1AWCA 1XCVA 3L2CA 1IN5A 1QQIA 4UVCA 3DKWA 2JUCA 2I5UA 2L9RA 2QZ8A 3ZGKA 3NWTA 2MH9A 2XDVA 3S8PA 2GWRA 1DDNA 3QODA 4ESJA 4A69C 3I53A 3GTJJ 1BJZA 4XIDA 2GXAA 3ZXSA 1J0RA 4ANJA 4AC0A 1F9NA 4ZZDA 4EATA 3BOQA 5DV5A 4XRSG 4LJZF 2DA1A 4A5MA 2DA5A 2DXIA 1HDDC 5EDNA 1S8NA 1FBSA 2EZKA 2XAUA 3SDBA 1FBQA 4P1WA 3JSOA 2Y30A 1HSJA 2UXXA 2HQ5A 3X2QH 2F5VA 2RQPA 1EJ9A 4RM2A 3T1BA 2NNNA 4HF2A 2CRGA 4M3GA 1TT5B 2MC4A 2UUZA 1IN4A 3AL0C 2VQLA 4NC8A 1FY7A 1V4RA 2M2EA 4A3GJ 5JLXA 2CV0A 1N78A 1WJCA 3WTWC 2R7XA 5IYCJ 2B9SA 4II2A 2CUFA 3R6SA 4CCNA 4LOCA 1FOXA 3L9FA 2M4GA 3ERMA 1WQ2A 2O8XA 1EH6A 4M6VA 3GZNB 3G6EI 4P9UA 2QENA 2RNGA 3IH4A 4BHPA 2PJRA 5HLIA 4PFOA 1IXCA 2VBYA 1ZN2A 2B63J 1SANA 3OV8A 3GTMJ 2KHMA 5B5EC 2OQRA 1QU3A 3A4CA 5DCMA 1MSFC 3OL3A 2W85A 1I3QJ 1FOYA 1T56A 4Q5SF 2EILH 3TGNA 1R5GA 3LA3A 1LKXA 3E6MA 5FKKA 1DGWY 3VYUB 4I76A 2EFQA 4W97A 4PFPA 1S7EA 4PJJA 2VKDA 1HW2A 4K2EA 2BY0A 3ONQA 2LF7A 2LH9A 1RR7A 2E71A 2R7RA 3PSIA 3J80K 4RAGA 1G59A 2BXYA 2CMPA 5J8CA 1MBFA 2LRDA 1IV6A 1MDMB 5E8IA 4OWRB 3QU3A 4G7HF 4DZJA 2HDCA 3PO2J 2XF7A 5HS7A 2Z9OA 1XC5A 2CS3A 2FMYA 2ZJPF 1D5VA 3OSFA 3ZMZA 3M8EA 5IP9J 3OWTA 1FTTA 1NHAA 3TKYA 2M0CA 4BE0A 1PUFB 2IS2A 1L0OC 2E1MB 3DBLB 1MBHA 2UZKA 1SVLA 1CGPA 2W57A 3K1NA 4XRSA 2O7OA 2W24A 4BGDA 3HOVJ 4W1UA 1JHFA 4F93B 2FBIA 4N9IA 3F3XA 2JSCA 3H36A 2YX7A 3KP4A 2M5WA 1S29A 2VXZA 5KAIC 2FOWA 2K4JA 1IUFA 2O0YA 1EF4A 1VQNI 1O7LA 4HOBA 3J80Z 4M6XA 1TQIA 4EGYA 1ACIA 4UHTA 2AQFA 5D5WB 2A5WA 3QYBA 4C30A 3CCJI 2KJCA 1YE9A 3C3WA 4LIVA 1RUOA 1QRYA 2V9KA 2ZNZA 2P8TA 1T2KA 3TOAA 1Y0NA 1ZQ3P 3MN2A 4A3DJ 1XS9A 4CDGA 1MBEA 3G1MA 5IP7J 5L3EA 2XGDA 3KLOA 5LHHA 2XC7A 1STZA 1VI0A 1D8JA 1P6RA 2CQ7A 4XSXF 1I1SA 4MTDA 3DU6A 2VBXA 3FXUA 3VOEA 2CQQA 1J75A 3PM1A 2ELKA 1QBJA 2JA5J 5J6XA 5TRDA 4C3JJ 1X4PA 4ETSA 4M3EA 2PMUA 2MW8A 1VTNC 4QLCU 4BY7J 1IAWA 5M5YJ 4OIQF 5EJCA 1Z6RA 4Y15A 3S2WA 5KCMA 4EJVA 1T8IA 1EH7A 1S7OA 4E70A 1Z21A 1XGNA 2R7SA 1EV7A 2DT7B 2XHKA 5M3FJ 1R00A 1I3AA 3SFIA 3AG4H 4I2OA 4HF0A 1TLHB 2OC6A 1U0JA 3CCLI 1TWGJ 2L54A 4XNFA 3WODF 1RI7A 3TDUC 5J1YA 4DZPA 3ZMTA 3P9KA 2HFHA 4D9JA 2K40A 2E1NA 4Y7NJ 5IYBJ 1G3WA 2R7VA 2PFBA 2VASA 3CQZJ 5ED4A 2CGPA 1LVKA 1WI3A 4WXHA 3I64A 3IRQA 2HKOA 1O3TA 3WE3A 2ICWG 4EJUA 3KIOA 3TW7A 2VODA 4M3DA 2BVLA 2M30A 3M8FA 2LMDA 1T95A 3DPUA 4KIBA 4L5JA 4FX4A 2CYYA 2XAGA 4ESBA 2R93J 5F0FA 3F8CA 4TV7A 4YFNF 4C9YA 1XSVA 3RKWA 4F92B 1XPXA 3IKTA 3K1PA 2DAOA 2IW5A 4E7ZA 4FE7A 3ECOA 1ZKGA 3OIPA 2BOLA 3KPHA 1KU2A 4DJAA 3ABKH 2H8WA 1J59A 1HF0A 1HW1A 3A0BC 3HRUA 1XMAA 2DW4A 3R0AA 1H9TA 3GFIA 1ZTRA 1WWXA 2QSHX 2HPIA 4XMYA 4E7SA 5TGTA 1Z1DA 4WXCA 2CQKA 2E2IJ 2FU4A 2IBDA 1W5TA 3ISPA 4EJTA 2PEXA 2OUMA 1F4KA 4M9SA 3R61A 3ZN0A 5LLQA 5D5UB 3HHGA 1P7JA 4B3AA 2HOAA 5GAHJ 1D0YA 4BKXA 3HUGA 2LR8A 2JMWA 4AU7A 4JYKA 2FBHA 4BXFA 1V5FA 3BZKA 3I9V2 3OOUA 4HRIA 5AONA 4OIRF 4UVAA 2L02A 4E7JA 4ENMA 4O6JA 4IOCF 4E7LA 3CDLA 5LBQA 5IT9K 1YTYA 3V7CA 2ISYA 2OAZA 3FISA 1ODDA 1BL0A 3CO7C 4IHSA 1IUYA 2W00A 3OYCA 4M72A 1XMKA 1M1EB 2R5YA 1H9GA 4ZTJA 3K4BA 3O2PE 2F4IA 2OU2A 3OYDA 2L7MP 1SFUA 2HI3A 2QBYB 3WTZA 2IA2A 2ECBA 2OZ6A 1AA7A 4V2FA 1SFKA 2LG4A 3WU2C 1TQMA 2PLYA 4FHTA 2LBFA 1I1GA 1SMYF 3Q5FA 4HA8A 3D5LA 2JT1A 4X0GA 2JA8J 4O3MA 4BQNA 1JT0A 3E6DA 3TL4X 2A05A 2IA1A 5K5OA 4ENKA 1ON2A 4Z2YA 4KMUX 3SHFA 1DU6A 4CSWA 1IGNA 3L2WA 3WGHA 1B1BA 3CCRI 2HTSA 3V8LA 2MLKA 4D7NA 1JUSA 3DCFA 2PX9A 5GPCA 3GLLA 1QZYA 2FRHA 5TISC 1ZH5A 3GTLJ 3KLNA 3S1QJ 1V5GA 1TC3C 4A93J 4XRFA 4A0YA 3GX4X 2HS5A 2V1XA 4Y13A 1RKWA 3PIPF 3CO6C 1LE8B 4PGGA 3VWBA 1T38A 3FXLA 3BZCA 5BQTA 1MSEC 4F55A 3BDDA 3AL0B 2NXNB 1GV2A 1ZLJA 2B7EA 4GDFA 1Q1HA 2MLGA 4HDUA 3HB9A 2XPWA 2A6TA 2EV5A 1T6SA 2EV0A 2H6CA 1P2FA 1K7AA 1CQTA 1KU9A 3WTYC 2BYVE 4B4CA 3HXLA 2VQGA 3PO3J 1V5EA 2RC4A 2YSRA 1E3HA 2M7BA 5L3FA 1YRNA 2EA4A 2JZYA 3KZIC 3W2VA 3QOPA 2IGNA 1PVEA 3ZQCA 5HODA 3MKLA 2HQAA 2BVMA 2NAZA 1UG2A 1Z7UA 1U8BA 2VL8A 1WH7A 4A0XA 2L3DA 2M8GX 4LLLA 4KUMA 1ZG5A 3T8RA 2EQRA 2XSJC 3SEZA 4XR6A 3H3UA 1FX7A 2GA1A 2IS4A 4FX0A 2AQEA 1GVJA 2QBYA 5LRSA 1QPMA 5A2QK 2R3SA 2FSWA 4UB6C 4OIPF 5H6QA 5JI6A 3VEPA 4J19A 5H6RA 1K79A 4BUPA 2HYJA 3CZ6A 2JA6J 2L7FP 3JRHA 1SFEA 3CJTB 4I98B 4BQAA 1AKHB 3E97A 3WTSC 1IDYA 4XOTA 2LVSA 1G4DA 1TZLA 4XKCA 2CFXA 2QCOA 3BC8A 3LWFA 4G12A 5BPIA 3I0TA 4CYCA 2K4BA 3MAJA 4MQ9F 4XLNF 4BE1A 2IGKA 3TOBA 2D1VA 3PQJA 1MMGA 2XIGA 4RAZA 3V8KA 2WY8Q 3FKJA 5E1XA 1F1ZA 4XICA 5F0CA 3V4GA 3GTQJ 4DYRA 3BTLA 4JQFA 1Q1VA 3J81Z 4ON0A 2GZWA 3BROA 5K1YA 3GTOJ 1U3EM 4GGGA 4D7MA 3MKWB 3QYFA 4I02A 4S0HB 4XONA 2XAQA 1OCPA 3HSRA 1A5JA 3BR2A 1FTZA 4XKWA 3F6VA 3DWLE 3ERED 3HYIA 2OA4A 3KP7A 2A3SA 5GPAA 3WTTC 4G7ZF 2HKXA 1P4WA 1TP4A 2DMTA 4RB3C 1MJAA 3TQNA 3H3ZA 4HEA2 2EPFA 1FZPB 2WA0A 3F22A 3FZVA 2HOEA 3LSMA 2PMHA 1MNEA 1GUUA 1S72I 2QGUA 2FD5A 5C4XJ 1FIPA 3KZZA 2ZJ2A 1PUFA 1LEAA 3DP7A 2RGVA 2VKHA 2Q1ZB 2L2OA 4WCGA 5L3DA 4LMYA 5DYMA 3CUQA 4XOPA 4PUSA 2YU3A 4XL9A 1QNTA 3LSRA 4RGUA 3PUBA 5B1BH 1USSA 2XKOA 6PAXA 3OIOA 2DTZA 3S3MA 1VQLI 2A5YB 1MMAA 1POGA 3C2GA 1GT0C 1WJ5A 3TO9A 3EUHC 2V4JC 2X48A 2ZXWH 4DNCA 2HOSA 2V9VA 1T0FC 2L7ZA 5CVUA 4I0BA 4IRGA 3WGIA 3GTKJ 3OYKA 2CV1A 2RAEA 2QVOA 1BJAA 2XV4S 1B6AA 3V8JA 3C2BA 4U87A 3S17J 2OZUA 4BEHB 2LY1A 1KONA 3CP2A 4A12A 1KU3A 1XB4A 4KA4A 2KISA 5ERIA 5FGMA 2DFHA 1DP3A 2DK8A 4HV6A 2EZLA 4X6AJ 3CCYA 1N75A 1DU0A 2Y2ZA 1I50J 2LDUA 3OR2C 5F0HA 3AG2H 3FIWA 3KE2A 4HSRA 5GAEJ 2HZTA 2L4MA 1ZGWA 1R1UA 2JJ7A 2XROA 4XKBA 5TJJA 2EIJH 3ELKA 5LEJA 1IDZA 4IHWA 3I4NJ 1O7FA 1B4AA 2MG4A 2Y75A 3L2UA 4CH7A 2CQNA 1UMQA 2A61A 2DA3A 4YIRX 5HDNA 4BH9A 2OBPA 3OYIA 4Q47A 3DEWA 2NS7A 1VQPI 3QP5A 3FM5A 2FNPA 1X3UA 2HR3A 2M0MA 2PBIA 1QPIA 2M7AA 1Z67A 1GV5A 3BR6A 3L1PA 3OS0A 2E1CA 1LEBA 3ASOH 3TBIA 5KHDA 1U6GA 3WHBA 1R4MB 3GF2A 1X3ZB 2LF8A 2QF7A 1HSTA 1PJRA 4C2UA 3H9QA 3PUFA 5IOYA 2NOGA 4A3KJ 2JK3A 3FMQA 3PNTA 3E0JB 3BY6A 2OV7A 3C18A 2TRTA 2FUG2 3E6CC 2G0EA 1OCRH 1TL8A 1W7PD 1YRNB 1ETOA 1K78A 1R7JA 4HQMA 2OTJI 5DCMB 2E5ZA 4UV9A 2Z33A 4F7ZA 4ITVA 1U9OA 3GFLA 4D1QA 1KYZA 4UV8A 1A31A 4I09A 3E5XA 1OR7C 1B59A 4U0VA 4JP0A 3F8MA 4H4KC 3HIFA 1UCRA 2Y48A 4A3IJ 1VQKI 4WF2A 3LQQA 2E60A 2F5FA 3RQ4A 3ZP5A 3EUKL 1U5TA 1JJ6C 1XTAA 3F0CA 5EGOA 5DS9A 1R5HA 2K3PA 1LFUP 4ZZLA 5E3LA 2L01A 2ZCWA 3FXMA 3CDHA 1X19A 1FSEA 4GYIA 4XORA 4Y17A 5BPDA 2KP6A 3BR1A 1HBXG 5BMZA 4H0EA 3LA7A 1NG7A 3JRDA 2DFEA 4V19K 1F36A 5F1RA 4A3CJ 1ERDA 2FBKA 1EKEA 2A6EF 4CYCB 1NH3A 2O3FA 3JTGA 4KMFA 2E36A 2L9NA 3Q3SA 1PP7U 4RGRA 2KRCA 1XCBA 2RNJA 3PNYA 2D2WA 3HSEA 2ZO4A 4DYQA 3DLLF 4BL0B 3HUGB 2COMA 3ABMH 2JUGA 1LNWA 2JTVA 3DLAA 4GO1A 2F4OB 2CG4A 4RDUA 3HOSA 3D1NI 1IG7A 1SAUA 3QPTA 2YPRA 3BJ6A 3EYIA 1OKRA 1QZZA 2CQXA 5J1RA 4PGHA 1ETYA 3BR3A 2ZKZA 2MYSA 1GDTA 3HGGA 2LSOA 3H5RA 2E1OA 3ASNH 3UR3C 1JKRC 1KQ9A 2GA2A 4EGZA 2CU7A 3PIOF 1ULYA 1A6QA 1OLTA 1S6LA 3LSGA 3LSPA 1KA8A 2LD5A 4N4OB 4HAMA 4HLXA 4LLNA 3IAM2 1YYVA 2ELHA 1ZRFA 3PFYA 3OS1A 2W48A 2P7VB 1HKSA 1X1DA 5LEKA 1Z6TA 2CH0A 4DGWB 1QA6A 4IZZA 1J2XA 2HYFA 4AYBN 4CCMA 3F8NA 3CJNA 3GBGA 3L2QA 3OYJA 1O3QA 2BV6A 2E35A 2JVHA 3FHNA 3SQNA 4I6ZA 2FQ3A 1HQCA 3P5JA 4FTHA 2Q2EA 2WC2A 2XKPA 2W1OA 2X6WA 3GEZA 2RREA 3CUOA 3RKYA 3GTPJ 1XD7A 2ETHA 4LG0A 5FFXA 5CVJA 5DEQA 2E7XA 3MD2A 5E79C 3W6KB 4FETA 1RIOH 2VPLA 1BR2A 2CUEA 2ZBKA 3VYRB 4IHXA 5E20A 2VI6A 4MLOA 5FB2A 2LKXA 1H0MA 1HXDA 3TO6A 1O4XA 3LQRA 3G1OA 2NYXA 1B8IA 2VUMJ 1YI2I 3IC7A 3LNQA 5F08A 2ESHA 3DQVC 2YUSA 3BQYA 3CC2I 3QPSA 4XLEA 2XASA 3FKIJ 4BBRJ 2DLLA 1HCRA 3W6VA 2R7DA 2F6CA 4BEHA 2UXNA 2EFPA 4LK1F 4DBRA 5GTHC 2D5VA 4PJLA 3DFGA 2OPTA 4L18B 1N77A 2X51A 4ZJZA 2L9SA 3RQIA 4ZH4F 1TQPA 3H92A 3HRMA 5D5XB 2YR2A 3IP4B 3BG9A 2DDAA 1MBGA 3JRFA 2JPCA 2NS0A 3KYDB 3L2RA 4FASD 3OY9A 3OL4A 1HOMA 4KISA 4ZYDA 1BOBA 2IGMA 2EWNA 3WG9A 3OR1C 4G94A 3OYAA 3ZMDA 1W36C 3CMMA 4L0YB 3G1LA 1XDSA 2VJIA 4MEYF 1YHQI 4WWCA 2EINH 3N97A 1YW9A 2LC2A 3MCZA 3FBNB 4A6EA 4WK8F 5H20A 3SZPA 2M34A 1YIJI 3CC4I 4EEFG 1T39A 4GCVA 4L9JA 2R5ZA 5B66C 1UHMA 1GXQA 4NHJA 1P92A 2CW0F 1W1WE 5E3MA 4CCOA 1BC8C 5JR3A 5K7FA 4NQWB 3U2RA 2JA2A 3K9TA 3L09A 1Z91A 4IO9F 1I39A 1H8AC 1FLIA 4C3IJ 3HKZA 4EM0B 1IRZA 3OYNA 3LSJA 3DBHB 2BHZA 4B47A 3ULQB 3ABLH 3OYLA 2Q2EB 2DYRH 2XGXA 1LDDA 1MD0A 3BT9A 3ABTA 4RLQA 1UHSA 3PFIA 1YJWI 5E1ZB 1BW6A 2DPUA 5K7ZA 4CCKA 1VQ6I 3C1DA 2DO7A 2X1DA 3A0HC 1EH8A 1OR7A 1QVTA 1XX5A 2Y0MA 1RNLA 3L2VA 3MEXA 3CC7I 4M6YA 2LBFB 4CCJA 1BI0A 1MBJA 1U5TB 3BG7A 2M4KA 5CJ9A 1YJ9I 1LFBA 5EEHA 3GXOA 2VPRA 5ICFA 3UNGC 1JGSA 5KK1A 5FROA 1D3YA 3M1CA 1R49A 1ZGJA 5DM7F 1WJFA 5J4YA 4HQEA 3K7AJ 3CMEI 1ZGAA 5CPRB 1R71A 3KP2A 3U21A 4OAZA 3EYYA 2DODA 3IKVA 3R4KA 3FK7A 4PCQA 2ID3A 2XGCA 3R60A 5J8FA 3ZQGA 1BI2A 2R92J 1IRFA 5CQGA 1ZRDA 4FQGA 2BXZA 1P7IA 3DBRB 1ZYRF 1J9IA 1LB2A 1ZK8A 2VOPA 2NVUB 2HOTA 4BXXJ 1QGPA 2DA4A 3A03A 2AXLA 4ZDOA 1XN7A 2DA6A 2QSGX 3H35A 4B43A 2DMPA 4B3XA 3B6AA 3CCSI 2DJNA 3KZYA 2VT3A 3I4PA 4A3FJ 1A04A 2PMZN 1KQ0A 3HG9A 4IJAA 2GIVA 2MBFA 2K27A 3H5AA 2E5NA 3Q0VA 2HVRA 1IN8A 4CICA 4OIOF 2BY2A 2HYGD 3K6GA 3CCVI 1G8XA 3QWLA 3AKZA 1BBYA 5DUKA 4ZC3A 3CJQB 1XG1A 3HZJA 3A2KA 3WE2A 2L0KA 1OPCA 3RDIA 3VSLA 1MMNA 3K1MA 4RGXA 3JRBA 1DGRM 1SD6A 2UV1A 3FBIB 2IA0A 3CF2A 4M3FA 1IZ1A 4NUBA 3RYPA 1ZARA 2K85A 3RPUD 4GFBA 2K5CA 4J01A 3RIRA 5B1AH 1W0UA 3LAJA 1W7PB 2K9QA 3JAMZ 4EM1A 1PDNC 1FYKA 1BA5A 1SD5A 1O3SA 1ENHA 1OYIA 2DBBA 3KEOA 2DYSH 1CF7B 1WHUA 2IJLA 3F9KA 3JRGA 3N4MA 2KMUA 1QO0D 2P81A 1BIBA 3KFWX 5D6FA 1SVMA 1X2MA 4LGWA 2V79A 3BTCA 4CXFA 2DDBA 2Z5UA 3NEUA 4XLPF 4CUGA 1N25A 4MIMA 2EZIA 3GWZA 5C44J 2EK5A 1XGSA 1SC7A 3KP3A 5CYVA 3ZQIA 1JT6A 2ECCA 5IPAA 1XSDA 4KICA 2V6CA 5K5QA 2CV2A 1BM9A 1REPC 1ZR2A 4PJNA 1W0TA 2OF7A 1SVOA 2DJIA 2VQHA 2EZHA 3DTKA 2DQRA 2VLAA 2XPUA 1IF1A 3BLYA 3PNVA 4HG2A 4XRMA 1I6HJ 1GVDA 5F27A 2H1LA 5C4JJ 2JPBA 3BTJA 1OCCH 4AIKA 1YW7A 3S1MJ 2IEKA 3OOPA 3CP8A 1W36D 5FJ8J 3LSHA 3P9CA 3K2ZA 5FKLA 2QQ8A 2K02A 3ABUA 2R7QA 4I01A 2N8GA 2M1BA 4G9YA 2HXIA 5BS6A 2ELJA 1R58A 5FKNA 2R7WA 1Y1WJ 4HV5A 1APLC 3T8TA 1R1TA 5CKTA 2FE3A 4NC7A 1BIAA 3HEFA 4IXAA 5HNHA 4YFKF 2QQ9A 5FRNA 4YIIA 2J5OA 3SZGA 4QIWN 4RB2C 1WZ2A 5FLVA 2XRNA 1LQ1A 3TP3A 4BDZA 1G3YA 2EFOA 3P9IA 2X6YA 3MZHA 1EA3A 2LKSA 5JLWA 2FJ1A 4ESFA 3IV5A 4LB5A 3K4MA 3WGGA 1WPKA 2HDDA 2J5PA 5FLXZ 2XF6A 2K9LA 3S93A 3LSIA 1P9QC 3HOXJ 1E17A 5HDKA 4XN0A 1QVUA 1X58A 3WU0A 3WTXC 1R6RA 4UUSA 1VQ7I 3GVAA 5DM6F 3E1SA 1KZHA 1ETXA 4Y33A 4M71A 3GFJA 1A36A 3ML6A 1IN6A 2H27A 4YRVA 4WXDA 3U1KA 4BU2A 1LPQA 4CCLA 5M3MJ 3K4CA 1VQ9I 4R1HA 2EA2A 3GYHX 1SAXA 1KGSA 2A6HF 5ILSA 3LAPA 4ZTFA 1JGGA 1E3OC 2W25A 1QZEA 2DMNA 2NVQJ 3KEQA 5DD8A 4RAFA 4V2GA 4C2MJ 2HVSA 5JVGF 1MIJA 1BI1A 4II3A 5K7HA 2IGOA 2X0LA 2JA7J 5HLGA 4BJTA 1K4SA 3CMYA 5CVIA 4AVZA 3JRCA 2XAFA 3AFHA 3RKQA 5LGTA 2ZXJA 4BY1J 5D6EA 4KT5C 3HGYA 4G6TB 5FLMJ 2CJJA 4IHVA 1WH5A 1XSXA 3M9AA 3AG3H 2HU9A 3DU5A 1RRJA 1X1BA 3BPVA 2KIFA 2QM3A 2O5RA 3BG3A 1IN7A 3DXJF 3V7SA 2ZMEA 2IS1A 2VKVA 4BJ6C 4A3LJ 2L7KA 3ZQ7A 1ZG3A 1WVRA 2L9VA 5M5XJ 4Q4ZF 3COAC 2GQQA 3DPLC 4NBQA 3M8JA 4E7KA 1WSUA 2R4GA 1FMVA 3K4KA 4RB1A 1FSHA 2O6GE 2Z99A 3MZYA 5CQEA 3H0GJ 2LREA 4L5IA 1PUEE 1R4NB 1B9MA 3VPRA 2BW3A 3BG6A 3CD6I 2R7UA 3OYMA 2IS6A 2CUJA 5LHGA 2E7WA 3ZMSA 1UHWA 4ZDLA 3QYEA 3JAMK 5LGNA 1P4AA 4B8XA 3M3YJ 2BY3A 5F64A 1VQ4I 2VBZA 2RV8A 4N9HA 4IEJA 2BBYA 3G2BA 4I7HA 3JRAA 3HDDA 3M1EA 4AIJA 5AIQA 2WAQN 2QWWA 4DYCA 3DF8A 3K4JA 4LK0F 1YX5A 4KIFA 2ZB9A 2X1CA 2VIXA 3S15J 4NQWA 4A2UA 3CLOA 1FIAA 2QLZA 2I10A 1I27A 4XKVA 2FF4A 2WWYA 4P5OA 1Y0UA 2CW8A 3CUQC 4LD5A 3SZTA 2WV0A 4EVIA 4LITA 1TTYA 3BPXA 2EFWA 3HKZN 1X4OA 1LDJA 2OD5A 1X1PA 3M07A 3A01B 2V7FA 4BE2A 4BXUA 4M9XA 2HQNA 5J40A 4HNUA 2E2JJ 3EUHA 5J3LA 4YFXF 3ZQHA 1VZ0A 1ON1A 4ZYEA 1SEUA 2O8KA 4GXOA 1FYLA 4BS9A 4L0ZB 1NK2P 3EPZA 1IW7F 3I4MJ 2ZMEC 3RI4A 3K0LA 2PI0A 3GLXA 4IHTA 4RAYA 3VDXA 2K9SA 5LFAA 3GZ5A 3FDYA 2XUBA 4QPQA 2F48A 2PQ8A 5E1WA 1YG2A 1D0ZA 2KQRA 2ZSIB 4P96A 2VC0A 2QYOA 2H6BA 4DOZA 1RETA 3K4NA 4RGSA 4LB6B 3J7AY 2P0WA 3O8GA 2BE5F 5BOXA 2BZTA 1TW3A 2ESNA 3CCMI 1WRJA 4QPOA 4BHBA 3S2HJ 4IKFA 3S16J 4KYWA 4EM2A 3LL7A 1RC9A 4HW0A 2TCTA 4MFEA 4PDKA 2OCEA 2HTJA 1UB9A 3GUDA 3I58A 5E3NA 1Y56A 2X85A 1VQMI 1T08B 4IOAF 3EETA 2KDZA 3T5XA 2W7NA 3F8FA 3VODA 1HA8A 5GP9A 3B73A 3QU6A 4M73A 1WJEA 1MNDA 1B9NA 3F72A 4CYDA 2VT2A 3P7NA 2AHQA 4NC6A 1U2WA 3CJRB 2R7OA 5HS8A 4KNYA 3W6JB 4E7IA 3OYGA 3S3NA 1RR8C 2WAQA 3WG7H 3HOWJ 4RS8A 3EQLF 2ZC2A 1W4MA 1WCMJ 2LKPA 4IX7A 2X9DA 4YELA 2W82A 3S14J 2ZNYA 2D1HA 4GRIA 4YIFA 4Y52J 2RDPA 2XB5A 3VYSB 5K5RA 1IRGA 1BC7C 4BQQA 2XGEA 3JRIA 4BDYA 3DTIA 3IWFA 3I5UA 1OCZH 1G2HA 1YJNI 2K3FA 3R0JA 3HPHA 4P55A 2IRFG 3CDIA 1VNDA 2CUZA 2HZDA 5HLTA 5EEAA 1YOVB 3V42A 1OQYA 1MGTA 2DA7A 1VFCA 4I99C 1GLNA 2HVQA 5JFRA 4IHYA 4A3EJ 4WX9A 2B0LA 3VSKA 4R79A 4U7DA 1CF7A 3W2AA 2F5EA 1FOWA 5IOZA 2LFBA 1UAAA 1S9HA 3D5RC 2NRAC 1HDPA 3MKYB 2VJ5A 2LNBA 4N4NB 2VKEA 4P9FA 5FD5A 2ID6A 2Y0SA 2MA3A 4D5FA 3S1RJ 3REOA 1HW5A 4A3JJ 3GMEA 1JKOC 1ITYA 3LFUA 1W5CC 2STTA 1R23A 2KZGA 2LK2A 1ZHFA 1HLVA 2HWVA 2WV1A 5EGOB 1TWFJ 1H89C 3LA2A 1TWCJ 1D5YA 2CSOA 2GLOA 2LY2A 3KETA 4MTEA 1O3RA 1A35A 3OYBA 2MD0A 1YQAA 4AYBA 3JSPA 1OCOH 5HDGA 3DPTA 3MVPA 4MGRA 3WU1B 3ZPLA 2X4HA 1YIOA 1FNNA 1Z0XA 2XB0X 4JK1X 2Z16A 4JOMA 1J5YA 3TO7A 2DT5A 2HDWA 3KX2A 5A2QZ 1MH4A 3OYEA 5LGUA 2DA2A 4HZFA 2L4AA 1YLFA 3OS2A 5CVVA 2Q0OA 2X1EA 5LD2C 1Z05A 1OFCX 2EJRA 3ZMUA 5HNFA 4L9VA 1R22A 1I5ZA 2HNHA 2W4SA 5DD4A 3S2DJ 2HGCA 3IRRA 4IRHA 1S5LC 3GW2A 5E8GA 4ENNA 3I3LA 5CVRA 5D8LB 2HEOA 4XLAA 3U9GA 2QA4I 2H94A 4XN3A 1UG0A 3TEDA 2Y9YA 5D4SA 2LP0A 3KYLA 2A69F 2KIUA 1FOKA 1U8RA 3H3VK 3FMSA 1TNSA 5FLXK 2P7CB 3TW6A 3SYTA 1MDMA 2D45A 1B72A 4X1EA 5H2FC 2DFFA 4IQ4A 3FM3A 3TDZC 4OU0A 3TP0A 5L3CA 2YX4A 1V55H 4ZDPA 2E34A 4LIUA 3FK6A 5HS9A 5IT3A 4EQQA 2FOKA 2PMZA 3RSNA 2WAFA 1YO5C 1HKQA 2E19A 3NRVA 2KRHA 4N0BA 3DKYA 3TMOA 3K70D 1XGOA 3SJMA 4CA0A 3HOUJ 1YX3A 1TT0A 1JTXA 3HJEA 2GAUA 5GAGJ 4LG3A 2UWMA 2IVMA 4MQVA 4JBAA 5DUIA 1VQOI 2MH2A 4AWXB 1LDKB 1A6IA 4FT8A 2ZJRF 4UNOA 2F5DA 1AHDP 2ADUA 4FE4A 3RPUA 3V7RA 1J09A 5ILUA 5FD6A 1BR1A 3W3CA 1UFMA 4L9NA 3ZRGA 2H09A 5J47A 3QRFF 3CTAA 2JWTA 2MC3A 4Y4RA 1JKQC 1H88C 2VONA 2RKHA 2PN6A 2C6YA 4KN4X 2F4MB 2FA5A 3NQOA 1LVAA 2P4WA 3BR5A 4UB8C 3K69A 5LRRA 2JVGA 1DP7P 2JQ7A 3FHZA 3C7JA 5E17F 4DQ2A 2KL4A 4B44A 1LJ9A 3H9GA 2YU9J 4XLFA 1X2NA 3ZCOA 5F1JA 5IYDJ 4ABZA 2NS8A 5JHUA 3IAS2 4U7BA 3AAFA 2EB7A 4AIDA 3PSFA 4M74A 1UELB 4U88A 1YS7A 1K78B 1C0WA 3VFZA 4UUSB 3KCCA 1RESA 2FX0A 2WY7Q 4B09A 5FRMA 3CCEI 3BG5A 2QKLB 3I71A 2LOOA 2RN7A 1X1CA 2R7TA 4LLGF 2BEOA 4HF1A 1V3FA 2NNYA 2P5LC 2XAHA 2NVTJ 4KN7X 4NNJA 4HPQA 5KAFC 4UY8I 2FXAA 2KPMA 3FXOA 1BI3A 1K4TA 3D5SC 5HOOA 4IL6C 2VC1A 3J81K 3ECHA 1AU7A 3WTVC 3MFKA 3PJRA 3HRSA 4RA2A 1B72B 2DMUA 3LMMA 2DPDA 2WADA 1T0FA 4XK4A 5EG0A 2JSPA 2P5VA 1LUJB 1JJ8C 3J7ZI 3IWZA 1BW5A 3BTIA 1JUPA 2FNAA 2DK5A 3ZQQA 2M9HA 3BCAA 2I8DA 2ACJA 1MJBA 1K83J 4J00A 2WB1A 4PJ0C 2YS9A 1Z3YA 3HPGA 3GTGJ 1OISA 4FISA 4PSWA 2Y9ZA 4ENJA 1YFHA 2ZMEB 2R7FA 1K61A 2AXTC 2VE9A 3Q9SA 4XQFA 1TNTA 5GTIC 2X6OA 2K86A 4UVBA 1OJLA 2P6TA 1ONVA 4AUXA 1Z7LA 3J7YJ 4HLYA 4HX8A 3H0DA 1ZRCA 2WB1N 4G7OF 4PK4A 4QTRA 2XSDC 1F43A 3EUAA 1T98A 2XRLA 2V1UA 2DT6A 3F21A 2HPMA 2HQRA 2GXGA 3FWEA 4F3QA 1WFXA 3KEYA 3GFMA 1FJLA 3FF5A 4JX5A 1Y39A 1R9TJ 1FEXA 1PP8F 2DOAA 4L9TA 4OMZA 3HTSB 2KDOA 2GOXB 4Y3OA 3QPLA 4UUVA 2VE8A 3CMAI 1FBUA 1MNMC 2XVCA 4RMNA 2XF5A 1E2XA 5FO5A 2BGCA 4XLCA 4YEJA 3S1NJ 3BJAA 1W5SA 2O03A 1Z3XA 2K9MA 3DEUA 1UJ8A 1JUMA 4KJZA 2V6EA 1QHGA 3JW4A 5IY5H 3EDPA 2GXBA 3OIQA 2EIMH 2R5YB 4YG2F 2VQCA 2LYCA 1L3LA 2ME6A 5ILVA 4AM3A 3H5NA 2QQAA 1AOYA 1Y1VJ 3F23A 3FMRA 3I56I 3K10A 2CW7A 3O3KA 1NK3P 4RB0A 3E5QA 5D8KB 1U9NA 2KIMA 3C2HA 4DW6A 5EG0B 2WBMA 2XPVA 4MO7A 4ASNA 2ISZA 2MABA 2COBA 2EIKH 3S32A 3VB2A 3LOCA 4S04A 1D1BA 5BNGA 3GO5A 3HHHA 1J7KA 1MMDA 3ZQFA 2OQGA 3Q9VA 3IL2A 3JCUC 2GM4A 3RJPA 2QQBA 2Z2SB 2DFIA 3ESWB 2DU9A 2IP2A 1MW7A 3SXYA 1OCTC 1FYMA 3DTEA 2ME0A 2MFZA 3GCMA 3HOZJ 2IPQX 4PSXA 4OINF 2L5QA 2P5KA 4FCYA 3WHCA 2DI3A 3NAUA 5CLSA 4MFDA 4NDLA 4OOIA 3N05A 2ZXIA 2P6SA 3T0YA 2EH3A 3KP5A 1JTYA 4EV0A 2PG4A 2IAIA 4IVNA 1ZR4A 4BAYA 1ORKA 2BY1A 3JREA 2G7HA 1IJWC 2QKMB 4UXNA 1R1VA 3O8HA 1G3TA 1WKMA 5JVTA 1XDUA 2TDXA 3E7LA 5IP6A 1VQ5I 5KNLA 1O57A 3FX3A 3D0SA 1DUXC 3KP6A 2R5ZB 3FXRA 5J1UA 2V9PA 1UZCA 3MWMA 5D4RA 1NTCA 4UUTA 4EMSA 2DTRA 1IC8A 2W84A 1DPUA 1YITI 2H8RA 1ZAOA 1R36A 2VN2A 3S3OA 4CO8A 2XAJA 4HX4A 4C2TA 1U78A 4ZYHA 1OYWA 1YW8A 1IO2A 2F2EA 3DEEA 2MD5A 3HC7A 5FKOA 4A3BJ 1IXRC 4BQOA 3K4LA 2K7LA 4CZCA 3B02A 3E3VA 4KT6A 2ZFWA 2BW3B 2OJED 3E5UA 3RKXA 2VJJA 5EEGA 2GBYA 1YS6A 4DIQA 1JHHA 4IRIA 3BP8A 2KIQA 5HLHA 2H1KA 1HC8A 2Z3YA 5M5WJ 3M7GA 3K2AA 1E3PA 3RZOJ 5DTDA 4E4HA 4HNVA 2ZFUA 2NVYJ 1MMSA 1G3SA 2JN6A 1MBKA 1SMTA 1ETKA 2Z1DA 2JRMA 2K9NA 2EBIA 1OMIA 4MEXF 4M3BA 2MSYA 3HL2A 1GHCA 1FC3A 1D8KA 1JXSA 2KLOA 4QWQA 4MNUA 4Q48A 3SDGA 5L3BA 5L3GA 2IXSA 2PJPA 3IH3A 4A3MJ 5JHFA 3HOTA 1X1AA 3DV8A 3A01A 3DKXA 3HRTA 4M9ZA 4BNCA 3F6OA 1RKTA 4A6DA 2X6XA 3F8BA 2V1DA 1DQUA 4NB5A 3A1YA 3MQ0A 1VQ8I 5ICCA 5KVRA 2MGQA 2DOFA 2E1MC 3CCUI 4XSZF 3MZ8A 2EV6A 3UKGA 3KYCB 3RYRA 4KDPA 1Z77A 2CWEA 2KZVA 1Y8RB 1TWAJ 2GOMA 4L5EA 1WJBA 3L00A 5J4VA 2NVXJ 1B8IB 1ZLKA 3GZ6A 2E2HJ 1RUNA 1MKMA 1QHHD 2G9WA 2OCCH 3CESA 3OYHA 5E18F 4HDVA 4G8XA 4IPAA 5EZGA 5LHIA 3H9JA 3RZDJ 2KJBA 3G3ZA 1BN5A 2KFDA 1R5ID 1Z9CA 1SFOJ 2DN0A 5AIPA 4R8HA 3M4OJ 3JR9A 2BHYA 1DPRA 2OTLI 3CLQA 1WI9A 2M3AA 1WJDA 2JRTA 1KQ8A 1HKTA 4XM3A 4U0YA 2PJRB 2EFNA 3A02A 1TW2A 5EYRA 4ZYGA 5F04A 3JTHA 1MZBA 1FP1D 3CUQB 4MHGA 3VYTB 1SFXA 1F5TA 2FMLA 2NOJB 3HBLA 5EF6A 1V54H 2STWA 5ICGA 5FKMA 2Y69H 1WJAA 3ROUA 3FXKA 4G6DA 1IV8A 1XMXA 4D5CA 2QUFA 2VOOA 3G73A 3HM5A
chains in the Genus database with same CATH topology
1FP2A 3ZMVA 3ZN1A 1TBXA 4AD9A 2CO5A 4I0AA 3FXQA 4U0WA 1ZG1A 4IF4A 1S3JA 3QPHA 3I59A 1XGMA 4PZJA 2G7UA 1RZ4A 1OYYA 4KIGA 1FPQA 1KYWA 4GYGA 3RTRA 1USTA 4HBLA 5DCFA 2F5CA 4AVPA 1GXPA 3L7WA 2A68F 2KKOA 2VBWA 2WTEA 2M87A 4BHCA 5D5VB 4LG0B 3IHUA 3PQKA 5HVQC 4A0ZA 3U1DA 1P4XA 5F6FA 4S05A 4HX7A 1FT9A 1BOAA 3BWGA 1G6NA 3LFKA 1SD4A 4KFCA 4AIHA 3SFZA 3QP6A 4BYYA 4HYEA 3WTUC 2IT0A 4G6QA 3BZ6A 1MJ9A 4LFUA 3QAHA 4CZZA 4CHUA 5DDGA 4OMYA 3O6BB 4CGZA 4XBFA 1KU7A 4EJWA 2RVCA 2KRFA 2A07F 1ZREA 5IT9Z 2DQLA 4EJOA 2O61A 3HTUA 2M8EA 2FEZA 2AS5F 3HSFA 5ICEA 1I6XA 3RPQA 3LSTA 1SD7A 1JE8A 1K6OA 3BJOA 5FFZA 4A5NA 1U5TC 3I59B 1IXSB 1S7AA 3I54A 1FWZA 4D0PA 1W7PA 3J7AO 2M45A 2Q8KA 3E6BA 4O5VA 1AWCA 1XCVA 3L2CA 1IN5A 1QQIA 4UVCA 3DKWA 2QZ8A 2MH9A 2GWRA 1DDNA 4ESJA 3I53A 1J0RA 1F9NA 4ZZDA 3BOQA 5DV5A 4LJZF 4A5MA 1S8NA 1FBSA 1FBQA 3JSOA 1HSJA 2UXXA 2RQPA 3T1BA 2NNNA 4HF2A 1IN4A 1FY7A 1V4RA 3WTWC 3R6SA 3L9FA 1WQ2A 2O8XA 1EH6A 4P9UA 2QENA 4BHPA 5HLIA 1IXCA 2VBYA 1ZN2A 3OV8A 2OQRA 5DCMA 2W85A 4Q5SF 3TGNA 1R5GA 3LA3A 3E6MA 2EFQA 1HW2A 4K2EA 2LF7A 3J80K 5J8CA 1MDMB 5E8IA 4G7HF 3QU3A 2HDCA 5HS7A 2Z9OA 2FMYA 1D5VA 3ZMZA 3M8EA 1NHAA 3TKYA 1L0OC 2UZKA 1CGPA 2W57A 3K1NA 2W24A 1JHFA 2FBIA 4N9IA 3F3XA 2JSCA 3KP4A 2YX7A 2M5WA 1S29A 2VXZA 2K4JA 2O0YA 1O7LA 4HOBA 3J80Z 4M6XA 1TQIA 4EGYA 4UHTA 5D5WB 2KJCA 3C3WA 1RUOA 2ZNZA 1T2KA 2P8TA 3TOAA 4CDGA 5L3EA 3KLOA 5LHHA 1STZA 1D8JA 1P6RA 4XSXF 1I1SA 4MTDA 2VBXA 3FXUA 3VOEA 1J75A 1QBJA 5J6XA 5TRDA 4ETSA 2PMUA 1VTNC 4QLCU 1IAWA 4OIQF 1Z6RA 4Y15A 3S2WA 4EJVA 1EH7A 1S7OA 4E70A 1XGNA 1EV7A 2XHKA 1R00A 4I2OA 4HF0A 1TLHB 2L54A 3WODF 1RI7A 3TDUC 3ZMTA 3P9KA 2HFHA 2E1NA 1G3WA 2PFBA 5ED4A 2CGPA 4WXHA 3I64A 3IRQA 2HKOA 1O3TA 3WE3A 4EJUA 2VODA 2M30A 3M8FA 4KIBA 4L5JA 4FX4A 2CYYA 2XAGA 4ESBA 3F8CA 4TV7A 4YFNF 1XSVA 3RKWA 3IKTA 3K1PA 2DAOA 2IW5A 3ECOA 1KU2A 1J59A 1HW1A 3HRUA 3R0AA 1XMAA 2DW4A 1H9TA 3GFIA 1WWXA 1Z1DA 4WXCA 2CQKA 2FU4A 1W5TA 3ISPA 4EJTA 2PEXA 1F4KA 4M9SA 3R61A 3ZN0A 5LLQA 5D5UB 3HHGA 3HUGA 2FBHA 5AONA 4OIRF 4UVAA 4ENMA 4O6JA 5LBQA 5IT9K 1YTYA 3V7CA 2ISYA 2OAZA 1IUYA 1ODDA 3CO7C 4IHSA 4M72A 1XMKA 1H9GA 3O2PE 2OU2A 1SFUA 2QBYB 3WTZA 2IA2A 2OZ6A 1TQMA 2PLYA 4FHTA 1I1GA 1SMYF 3Q5FA 4HA8A 3D5LA 2JT1A 4O3MA 3E6DA 2IA1A 5K5OA 4ENKA 1ON2A 4Z2YA 4KMUX 3SHFA 3WGHA 1B1BA 2HTSA 3V8LA 2MLKA 1QZYA 2FRHA 1ZH5A 3KLNA 4XRFA 4A0YA 3GX4X 2HS5A 2V1XA 4Y13A 3CO6C 4PGGA 1T38A 5BQTA 3BDDA 1ZLJA 1Q1HA 2MLGA 4HDUA 2EV5A 2H6CA 1T6SA 2EV0A 1K7AA 1P2FA 1KU9A 3WTYC 2BYVE 2RC4A 2YSRA 5L3FA 2EA4A 2JZYA 3QOPA 2NAZA 1Z7UA 4A0XA 2L3DA 4LLLA 4KUMA 1ZG5A 3T8RA 3H3UA 1FX7A 2GA1A 4FX0A 1GVJA 2QBYA 5LRSA 1QPMA 5A2QK 2R3SA 2FSWA 4OIPF 5H6QA 5JI6A 3VEPA 5H6RA 1K79A 1SFEA 4I98B 4BQAA 3E97A 3WTSC 1G4DA 2CFXA 3LWFA 5BPIA 3I0TA 2K4BA 3MAJA 4MQ9F 4XLNF 3TOBA 2D1VA 3PQJA 2XIGA 4RAZA 3V8KA 5E1XA 1F1ZA 3V4GA 4JQFA 3J81Z 4ON0A 2GZWA 3BROA 5K1YA 1U3EM 4GGGA 4I02A 2XAQA 3HSRA 3F6VA 3ERED 3HYIA 2OA4A 3KP7A 2A3SA 3WTTC 4G7ZF 2HKXA 1P4WA 4RB3C 1MJAA 3TQNA 3H3ZA 1FZPB 3F22A 3FZVA 2HOEA 2PMHA 3KZZA 2ZJ2A 1LEAA 3DP7A 2RGVA 4WCGA 5L3DA 4LMYA 5DYMA 3CUQA 2YU3A 1QNTA 4RGUA 1USSA 2XKOA 6PAXA 2A5YB 3TO9A 4DNCA 2V9VA 5CVUA 4I0BA 4IRGA 3WGIA 2QVOA 1BJAA 2XV4S 1B6AA 3V8JA 2OZUA 4A12A 1KU3A 1XB4A 4KA4A 5ERIA 5FGMA 2DK8A 4HV6A 2LDUA 3KE2A 2HZTA 2L4MA 1R1UA 2XROA 5TJJA 3ELKA 5LEJA 1O7FA 1B4AA 2Y75A 2A61A 5HDNA 4BH9A 2OBPA 4Q47A 3QP5A 3FM5A 2FNPA 1X3UA 2HR3A 2PBIA 2E1CA 1LEBA 1U6GA 3GF2A 2LF8A 1HSTA 3FMQA 3BY6A 3C18A 3E6CC 1W7PD 1K78A 1R7JA 4HQMA 5DCMB 4UV9A 2Z33A 4F7ZA 3GFLA 1KYZA 4UV8A 4I09A 3E5XA 1B59A 4U0VA 3F8MA 1UCRA 2Y48A 3HIFA 4WF2A 3LQQA 2F5FA 3ZP5A 1U5TA 1R5HA 4ZZLA 2L01A 2ZCWA 3CDHA 1FSEA 4GYIA 4Y17A 5BPDA 1HBXG 5BMZA 4H0EA 3LA7A 5F1RA 2FBKA 2A6EF 4KMFA 2O3FA 3JTGA 1PP7U 4RGRA 2RNJA 1XCBA 2D2WA 3HSEA 2ZO4A 2COMA 1LNWA 2JTVA 4GO1A 2CG4A 3HOSA 3QPTA 2YPRA 3BJ6A 3EYIA 1OKRA 1QZZA 4PGHA 2ZKZA 2LSOA 1KQ9A 2GA2A 4EGZA 1ULYA 1S6LA 1KA8A 4HAMA 4HLXA 4LLNA 1YYVA 2ELHA 1ZRFA 2P7VB 1HKSA 5LEKA 1Z6TA 1J2XA 2HYFA 3F8NA 3CJNA 1O3QA 2BV6A 3SQNA 2FQ3A 1HQCA 2Q2EA 2WC2A 2XKPA 3GEZA 3CUOA 3RKYA 1XD7A 2ETHA 4LG0A 5FFXA 5CVJA 5DEQA 2E7XA 3W6KB 1RIOH 2ZBKA 5E20A 5FB2A 1H0MA 1HXDA 3TO6A 3LQRA 2NYXA 3IC7A 2ESHA 3DQVC 2XASA 2DLLA 2R7DA 2UXNA 2EFPA 4LK1F 3DFGA 4L18B 4ZH4F 1TQPA 3H92A 3HRMA 5D5XB 2YR2A 2JPCA 2NS0A 4ZYDA 2EWNA 3WG9A 4G94A 3ZMDA 4L0YB 1XDSA 4MEYF 4WWCA 3N97A 1YW9A 3MCZA 4A6EA 4WK8F 3SZPA 5H20A 1T39A 4GCVA 4L9JA 1UHMA 1GXQA 4NHJA 1P92A 2CW0F 1BC8C 5JR3A 3U2RA 3K9TA 3L09A 1Z91A 1FLIA 4EM0B 3ULQB 2XGXA 1LDDA 1MD0A 3ABTA 3PFIA 5E1ZB 2DPUA 3C1DA 2DO7A 1EH8A 1OR7A 2Y0MA 1RNLA 3MEXA 4M6YA 1BI0A 1U5TB 5CJ9A 5EEHA 3GXOA 5ICFA 1JGSA 5KK1A 1D3YA 1ZGJA 4HQEA 1ZGAA 3KP2A 3EYYA 3IKVA 3R4KA 4PCQA 3R60A 5J8FA 1BI2A 1IRFA 1ZRDA 1ZYRF 1J9IA 1LB2A 2VOPA 1QGPA 2AXLA 1XN7A 3KZYA 2VT3A 3I4PA 1A04A 1KQ0A 4IJAA 2GIVA 2MBFA 2K27A 1IN8A 4CICA 4OIOF 2HYGD 1BBYA 5DUKA 3WE2A 3RDIA 1OPCA 3K1MA 4RGXA 1SD6A 2IA0A 1IZ1A 3RYPA 1ZARA 3RIRA 3LAJA 1W7PB 3JAMZ 4EM1A 1PDNC 1FYKA 1SD5A 1O3SA 1OYIA 2DBBA 3KEOA 1CF7B 3N4MA 2IJLA 1QO0D 1BIBA 3KFWX 5D6FA 4LGWA 2V79A 4CXFA 2Z5UA 3NEUA 4XLPF 3GWZA 2EK5A 1XGSA 3KP3A 5CYVA 1XSDA 4KICA 2V6CA 5K5QA 1BM9A 1REPC 2DQRA 1IF1A 4AIKA 2JPBA 1YW7A 3OOPA 3P9CA 3K2ZA 2K02A 3ABUA 4I01A 2M1BA 4G9YA 5BS6A 1R58A 4HV5A 3T8TA 1R1TA 2FE3A 1BIAA 4IXAA 4YFKF 2QQ9A 4YIIA 2J5OA 4RB2C 2XRNA 1LQ1A 1G3YA 2EFOA 3P9IA 3MZHA 4ESFA 4LB5A 3WGGA 2J5PA 5FLXZ 1E17A 5HDKA 3WU0A 3WTXC 3GVAA 4M71A 3GFJA 3ML6A 1IN6A 2H27A 4WXDA 4R1HA 2EA2A 3GYHX 1SAXA 1KGSA 2A6HF 5ILSA 3LAPA 2W25A 3KEQA 5DD8A 1BI1A 2X0LA 5HLGA 5CVIA 2XAFA 5LGTA 2ZXJA 5D6EA 4KT5C 1XSXA 3M9AA 3BPVA 2KIFA 2QM3A 1IN7A 3DXJF 3V7SA 2ZMEA 3ZQ7A 1ZG3A 4MEXF 3COAC 4Q4ZF 2GQQA 3DPLC 1WSUA 4RB1A 1FSHA 2O6GE 2Z99A 3MZYA 4L5IA 1PUEE 1B9MA 5LHGA 2E7WA 3ZMSA 1UHWA 3JAMK 5LGNA 1P4AA 4B8XA 5F64A 2VBZA 2RV8A 4N9HA 2BBYA 4I7HA 3M1EA 4AIJA 5AIQA 2QWWA 3DF8A 4LK0F 4KIFA 4NQWA 4A2UA 3CLOA 2QLZA 1I27A 2FF4A 2WWYA 4P5OA 1Y0UA 3CUQC 4LD5A 3SZTA 2WV0A 4EVIA 1TTYA 3BPXA 2EFWA 2OD5A 1LDJA 4BXUA 4M9XA 2HQNA 3EUHA 4YFXF 1ON1A 4ZYEA 4GXOA 1FYLA 4L0ZB 1IW7F 3RI4A 3K0LA 2PI0A 3GLXA 4IHTA 4RAYA 3GZ5A 2XUBA 2PQ8A 5E1WA 1YG2A 4P96A 2VC0A 2QYOA 2H6BA 4RGSA 4LB6B 2BE5F 5BOXA 2ESNA 1TW3A 1WRJA 4BHBA 4KYWA 4EM2A 4HW0A 4PDKA 2HTJA 1UB9A 3GUDA 3I58A 3EETA 3T5XA 3F8FA 3VODA 3B73A 3QU6A 4M73A 3F72A 1B9NA 4CYDA 2VT2A 3P7NA 1U2WA 5HS8A 4KNYA 3W6JB 4RS8A 3EQLF 1W4MA 2LKPA 2ZNYA 2D1HA 4YIFA 2RDPA 5K5RA 1IRGA 1BC7C 3IWFA 3I5UA 3R0JA 4P55A 2IRFG 1MGTA 5JFRA 4WX9A 2B0LA 4R79A 4U7DA 1CF7A 2F5EA 2NRAC 2LNBA 4P9FA 5FD5A 2MA3A 3REOA 1HW5A 2STTA 1R23A 1ZHFA 2HWVA 3LA2A 2CSOA 3KETA 4MTEA 1O3RA 1YQAA 3JSPA 5HDGA 3DPTA 4MGRA 3WU1B 3ZPLA 2X4HA 1YIOA 1FNNA 4JK1X 1J5YA 3TO7A 2DT5A 5A2QZ 5LGUA 4HZFA 2L4AA 1YLFA 5CVVA 2Q0OA 1Z05A 2EJRA 3ZMUA 4L9VA 1R22A 1I5ZA 5DD4A 2HGCA 3IRRA 4IRHA 3GW2A 5E8GA 4ENNA 5CVRA 5D8LB 2HEOA 3U9GA 2H94A 5D4SA 2A69F 2KIUA 1FOKA 1U8RA 3FMSA 1TNSA 5FLXK 2P7CB 1MDMA 2D45A 3TDZC 3FM3A 4OU0A 5L3CA 2YX4A 5HS9A 5IT3A 4EQQA 2FOKA 1YO5C 1HKQA 3NRVA 4N0BA 1XGOA 2GAUA 2UWMA 2IVMA 4MQVA 4JBAA 5DUIA 2MH2A 4AWXB 1LDKB 4FT8A 4UNOA 2F5DA 2ADUA 3RPUA 3V7RA 5ILUA 5FD6A 1UFMA 4L9NA 2H09A 3QRFF 3CTAA 2MC3A 2VONA 2RKHA 2PN6A 2C6YA 4KN4X 2FA5A 3NQOA 1LVAA 2P4WA 3K69A 5LRRA 1DP7P 5E17F 3FHZA 3C7JA 4DQ2A 1LJ9A 4U7BA 5JHUA 3AAFA 2EB7A 4M74A 4U88A 1YS7A 1K78B 1C0WA 3VFZA 3KCCA 4B09A 3I71A 2RN7A 4LLGF 2BEOA 4HF1A 1V3FA 2NNYA 2P5LC 2XAHA 4KN7X 2FXAA 1BI3A 5HOOA 2VC1A 3J81K 3ECHA 3WTVC 3MFKA 3HRSA 2DPDA 1T0FA 2P5VA 3IWZA 2FNAA 2DK5A 2ACJA 1MJBA 4ENJA 1YFHA 2ZMEB 2R7FA 2VE9A 3Q9SA 1TNTA 2K86A 4UVBA 2P6TA 1ONVA 4HLYA 4HX8A 1ZRCA 4G7OF 1T98A 2V1UA 3F21A 2HQRA 2GXGA 3FWEA 3GFMA 3FF5A 1PP8F 4L9TA 4OMZA 3HTSB 4UUVA 2VE8A 1FBUA 2XVCA 1E2XA 5FO5A 2BGCA 3BJAA 1W5SA 2O03A 3DEUA 3JW4A 3EDPA 2GXBA 4YG2F 1L3LA 5ILVA 2QQAA 1AOYA 3F23A 3FMRA 3O3KA 4RB0A 3E5QA 5D8KB 2KIMA 4ASNA 2ISZA 3VB2A 4S04A 3GO5A 1J7KA 3HHHA 3IL2A 2OQGA 3Q9VA 3RJPA 2QQBA 2DFIA 2DU9A 2IP2A 3SXYA 1FYMA 2IPQX 4OINF 2P5KA 2DI3A 5CLSA 4OOIA 2P6SA 3T0YA 3KP5A 4EV0A 2PG4A 4IVNA 4BAYA 2G7HA 4UXNA 1R1VA 1G3TA 1WKMA 5JVTA 1XDUA 2TDXA 1O57A 3FX3A 3D0SA 1DUXC 3KP6A 3FXRA 3MWMA 5D4RA 4EMSA 2DTRA 2W84A 1DPUA 1ZAOA 1R36A 2VN2A 4CO8A 2XAJA 4HX4A 1U78A 4ZYHA 1OYWA 1YW8A 2F2EA 2MD5A 1IXRC 2K7LA 3B02A 3E3VA 2ZFWA 3E5UA 3RKXA 5EEGA 1YS6A 1JHHA 4IRIA 3BP8A 5HLHA 2Z3YA 3M7GA 1G3SA 1SMTA 1OMIA 1GHCA 1FC3A 1D8KA 1JXSA 4QWQA 4MNUA 4Q48A 5L3BA 5L3GA 2PJPA 3HOTA 3DV8A 3HRTA 4M9ZA 4BNCA 3F6OA 4A6DA 3F8BA 2V1DA 4NB5A 3MQ0A 5ICCA 5KVRA 4XSZF 2EV6A 3RYRA 4KDPA 2CWEA 3L00A 1ZLKA 3GZ6A 1RUNA 1MKMA 2G9WA 5E18F 4HDVA 4G8XA 4IPAA 5LHIA 2KJBA 3G3ZA 1BN5A 1Z9CA 5AIPA 4R8HA 1DPRA 1WI9A 2JRTA 1KQ8A 1HKTA 4U0YA 2EFNA 1TW2A 4ZYGA 3JTHA 1MZBA 1FP1D 3CUQB 4MHGA 1SFXA 1F5TA 2FMLA 2STWA 5ICGA 3ROUA 4G6DA 2QUFA 2VOOA 3G73A 2L02A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1FP2 A;  3ZMV A;  3ZN1 A;  1TBX A;  4AD9 A;  2CO5 A;  4I0A A;  3FXQ A;  4U0W A;  1ZG1 A;  4IF4 A;  1S3J A;  3QPH A;  3I59 A;  1XGM A;  4PZJ A;  2G7U A;  1RZ4 A;  1OYY A;  4KIG A;  1FPQ A;  1KYW A;  4GYG A;  3RTR A;  1UST A;  4HBL A;  5DCF A;  2F5C A;  4AVP A;  1GXP A;  3L7W A;  2A68 F;  2KKO A;  2VBW A;  2WTE A;  2M87 A;  4BHC A;  5D5V B;  4LG0 B;  3IHU A;  3PQK A;  5HVQ C;  4A0Z A;  3U1D A;  1P4X A;  5F6F A;  4S05 A;  4HX7 A;  1FT9 A;  1BOA A;  3BWG A;  1G6N A;  3LFK A;  1SD4 A;  4KFC A;  4AIH A;  3SFZ A;  3QP6 A;  4BYY A;  4HYE A;  3WTU C;  2IT0 A;  4G6Q A;  3BZ6 A;  1MJ9 A;  4LFU A;  3QAH A;  4CZZ A;  4CHU A;  5DDG A;  4OMY A;  3O6B B;  4CGZ A;  4XBF A;  1KU7 A;  4EJW A;  2RVC A;  2KRF A;  2A07 F;  1ZRE A;  5IT9 Z;  2DQL A;  4EJO A;  2O61 A;  3HTU A;  2M8E A;  2FEZ A;  2AS5 F;  3HSF A;  5ICE A;  1I6X A;  3RPQ A;  3LST A;  1SD7 A;  1JE8 A;  1K6O A;  3BJO A;  5FFZ A;  4A5N A;  1U5T C;  3I59 B;  1IXS B;  1S7A A;  3I54 A;  1FWZ A;  4D0P A;  1W7P A;  3J7A O;  2M45 A;  2Q8K A;  3E6B A;  4O5V A;  1AWC A;  1XCV A;  3L2C A;  1IN5 A;  1QQI A;  4UVC A;  3DKW A;  2QZ8 A;  2MH9 A;  2GWR A;  1DDN A;  4ESJ A;  3I53 A;  1J0R A;  1F9N A;  4ZZD A;  3BOQ A;  5DV5 A;  4LJZ F;  4A5M A;  1S8N A;  1FBS A;  1FBQ A;  3JSO A;  1HSJ A;  2UXX A;  2RQP A;  3T1B A;  2NNN A;  4HF2 A;  1IN4 A;  1FY7 A;  1V4R A;  3WTW C;  3R6S A;  3L9F A;  1WQ2 A;  2O8X A;  1EH6 A;  4P9U A;  2QEN A;  4BHP A;  5HLI A;  1IXC A;  2VBY A;  1ZN2 A;  3OV8 A;  2OQR A;  5DCM A;  2W85 A;  4Q5S F;  3TGN A;  1R5G A;  3LA3 A;  3E6M A;  2EFQ A;  1HW2 A;  4K2E A;  2LF7 A;  3J80 K;  5J8C A;  1MDM B;  5E8I A;  4G7H F;  3QU3 A;  2HDC A;  5HS7 A;  2Z9O A;  2FMY A;  1D5V A;  3ZMZ A;  3M8E A;  1NHA A;  3TKY A;  1L0O C;  2UZK A;  1CGP A;  2W57 A;  3K1N A;  2W24 A;  1JHF A;  2FBI A;  4N9I A;  3F3X A;  2JSC A;  3KP4 A;  2YX7 A;  2M5W A;  1S29 A;  2VXZ A;  2K4J A;  2O0Y A;  1O7L A;  4HOB A;  3J80 Z;  4M6X A;  1TQI A;  4EGY A;  4UHT A;  5D5W B;  2KJC A;  3C3W A;  1RUO A;  2ZNZ A;  1T2K A;  2P8T A;  3TOA A;  4CDG A;  5L3E A;  3KLO A;  5LHH A;  1STZ A;  1D8J A;  1P6R A;  4XSX F;  1I1S A;  4MTD A;  2VBX A;  3FXU A;  3VOE A;  1J75 A;  1QBJ A;  5J6X A;  5TRD A;  4ETS A;  2PMU A;  1VTN C;  4QLC U;  1IAW A;  4OIQ F;  1Z6R A;  4Y15 A;  3S2W A;  4EJV A;  1EH7 A;  1S7O A;  4E70 A;  1XGN A;  1EV7 A;  2XHK A;  1R00 A;  4I2O A;  4HF0 A;  1TLH B;  2L54 A;  3WOD F;  1RI7 A;  3TDU C;  3ZMT A;  3P9K A;  2HFH A;  2E1N A;  1G3W A;  2PFB A;  5ED4 A;  2CGP A;  4WXH A;  3I64 A;  3IRQ A;  2HKO A;  1O3T A;  3WE3 A;  4EJU A;  2VOD A;  2M30 A;  3M8F A;  4KIB A;  4L5J A;  4FX4 A;  2CYY A;  2XAG A;  4ESB A;  3F8C A;  4TV7 A;  4YFN F;  1XSV A;  3RKW A;  3IKT A;  3K1P A;  2DAO A;  2IW5 A;  3ECO A;  1KU2 A;  1J59 A;  1HW1 A;  3HRU A;  3R0A A;  1XMA A;  2DW4 A;  1H9T A;  3GFI A;  1WWX A;  1Z1D A;  4WXC A;  2CQK A;  2FU4 A;  1W5T A;  3ISP A;  4EJT A;  2PEX A;  1F4K A;  4M9S A;  3R61 A;  3ZN0 A;  5LLQ A;  5D5U B;  3HHG A;  3HUG A;  2FBH A;  5AON A;  4OIR F;  4UVA A;  4ENM A;  4O6J A;  5LBQ A;  5IT9 K;  1YTY A;  3V7C A;  2ISY A;  2OAZ A;  1IUY A;  1ODD A;  3CO7 C;  4IHS A;  4M72 A;  1XMK A;  1H9G A;  3O2P E;  2OU2 A;  1SFU A;  2QBY B;  3WTZ A;  2IA2 A;  2OZ6 A;  1TQM A;  2PLY A;  4FHT A;  1I1G A;  1SMY F;  3Q5F A;  4HA8 A;  3D5L A;  2JT1 A;  4O3M A;  3E6D A;  2IA1 A;  5K5O A;  4ENK A;  1ON2 A;  4Z2Y A;  4KMU X;  3SHF A;  3WGH A;  1B1B A;  2HTS A;  3V8L A;  2MLK A;  1QZY A;  2FRH A;  1ZH5 A;  3KLN A;  4XRF A;  4A0Y A;  3GX4 X;  2HS5 A;  2V1X A;  4Y13 A;  3CO6 C;  4PGG A;  1T38 A;  5BQT A;  3BDD A;  1ZLJ A;  1Q1H A;  2MLG A;  4HDU A;  2EV5 A;  2H6C A;  1T6S A;  2EV0 A;  1K7A A;  1P2F A;  1KU9 A;  3WTY C;  2BYV E;  2RC4 A;  2YSR A;  5L3F A;  2EA4 A;  2JZY A;  3QOP A;  2NAZ A;  1Z7U A;  4A0X A;  2L3D A;  4LLL A;  4KUM A;  1ZG5 A;  3T8R A;  3H3U A;  1FX7 A;  2GA1 A;  4FX0 A;  1GVJ A;  2QBY A;  5LRS A;  1QPM A;  5A2Q K;  2R3S A;  2FSW A;  4OIP F;  5H6Q A;  5JI6 A;  3VEP A;  5H6R A;  1K79 A;  1SFE A;  4I98 B;  4BQA A;  3E97 A;  3WTS C;  1G4D A;  2CFX A;  3LWF A;  5BPI A;  3I0T A;  2K4B A;  3MAJ A;  4MQ9 F;  4XLN F;  3TOB A;  2D1V A;  3PQJ A;  2XIG A;  4RAZ A;  3V8K A;  5E1X A;  1F1Z A;  3V4G A;  4JQF A;  3J81 Z;  4ON0 A;  2GZW A;  3BRO A;  5K1Y A;  1U3E M;  4GGG A;  4I02 A;  2XAQ A;  3HSR A;  3F6V A;  3ERE D;  3HYI A;  2OA4 A;  3KP7 A;  2A3S A;  3WTT C;  4G7Z F;  2HKX A;  1P4W A;  4RB3 C;  1MJA A;  3TQN A;  3H3Z A;  1FZP B;  3F22 A;  3FZV A;  2HOE A;  2PMH A;  3KZZ A;  2ZJ2 A;  1LEA A;  3DP7 A;  2RGV A;  4WCG A;  5L3D A;  4LMY A;  5DYM A;  3CUQ A;  2YU3 A;  1QNT A;  4RGU A;  1USS A;  2XKO A;  6PAX A;  2A5Y B;  3TO9 A;  4DNC A;  2V9V A;  5CVU A;  4I0B A;  4IRG A;  3WGI A;  2QVO A;  1BJA A;  2XV4 S;  1B6A A;  3V8J A;  2OZU A;  4A12 A;  1KU3 A;  1XB4 A;  4KA4 A;  5ERI A;  5FGM A;  2DK8 A;  4HV6 A;  2LDU A;  3KE2 A;  2HZT A;  2L4M A;  1R1U A;  2XRO A;  5TJJ A;  3ELK A;  5LEJ A;  1O7F A;  1B4A A;  2Y75 A;  2A61 A;  5HDN A;  4BH9 A;  2OBP A;  4Q47 A;  3QP5 A;  3FM5 A;  2FNP A;  1X3U A;  2HR3 A;  2PBI A;  2E1C A;  1LEB A;  1U6G A;  3GF2 A;  2LF8 A;  1HST A;  3FMQ A;  3BY6 A;  3C18 A;  3E6C C;  1W7P D;  1K78 A;  1R7J A;  4HQM A;  5DCM B;  4UV9 A;  2Z33 A;  4F7Z A;  3GFL A;  1KYZ A;  4UV8 A;  4I09 A;  3E5X A;  1B59 A;  4U0V A;  3F8M A;  1UCR A;  2Y48 A;  3HIF A;  4WF2 A;  3LQQ A;  2F5F A;  3ZP5 A;  1U5T A;  1R5H A;  4ZZL A;  2L01 A;  2ZCW A;  3CDH A;  1FSE A;  4GYI A;  4Y17 A;  5BPD A;  1HBX G;  5BMZ A;  4H0E A;  3LA7 A;  5F1R A;  2FBK A;  2A6E F;  4KMF A;  2O3F A;  3JTG A;  1PP7 U;  4RGR A;  2RNJ A;  1XCB A;  2D2W A;  3HSE A;  2ZO4 A;  2COM A;  1LNW A;  2JTV A;  4GO1 A;  2CG4 A;  3HOS A;  3QPT A;  2YPR A;  3BJ6 A;  3EYI A;  1OKR A;  1QZZ A;  4PGH A;  2ZKZ A;  2LSO A;  1KQ9 A;  2GA2 A;  4EGZ A;  1ULY A;  1S6L A;  1KA8 A;  4HAM A;  4HLX A;  4LLN A;  1YYV A;  2ELH A;  1ZRF A;  2P7V B;  1HKS A;  5LEK A;  1Z6T A;  1J2X A;  2HYF A;  3F8N A;  3CJN A;  1O3Q A;  2BV6 A;  3SQN A;  2FQ3 A;  1HQC A;  2Q2E A;  2WC2 A;  2XKP A;  3GEZ A;  3CUO A;  3RKY A;  1XD7 A;  2ETH A;  4LG0 A;  5FFX A;  5CVJ A;  5DEQ A;  2E7X A;  3W6K B;  1RIO H;  2ZBK A;  5E20 A;  5FB2 A;  1H0M A;  1HXD A;  3TO6 A;  3LQR A;  2NYX A;  3IC7 A;  2ESH A;  3DQV C;  2XAS A;  2DLL A;  2R7D A;  2UXN A;  2EFP A;  4LK1 F;  3DFG A;  4L18 B;  4ZH4 F;  1TQP A;  3H92 A;  3HRM A;  5D5X B;  2YR2 A;  2JPC A;  2NS0 A;  4ZYD A;  2EWN A;  3WG9 A;  4G94 A;  3ZMD A;  4L0Y B;  1XDS A;  4MEY F;  4WWC A;  3N97 A;  1YW9 A;  3MCZ A;  4A6E A;  4WK8 F;  3SZP A;  5H20 A;  1T39 A;  4GCV A;  4L9J A;  1UHM A;  1GXQ A;  4NHJ A;  1P92 A;  2CW0 F;  1BC8 C;  5JR3 A;  3U2R A;  3K9T A;  3L09 A;  1Z91 A;  1FLI A;  4EM0 B;  3ULQ B;  2XGX A;  1LDD A;  1MD0 A;  3ABT A;  3PFI A;  5E1Z B;  2DPU A;  3C1D A;  2DO7 A;  1EH8 A;  1OR7 A;  2Y0M A;  1RNL A;  3MEX A;  4M6Y A;  1BI0 A;  1U5T B;  5CJ9 A;  5EEH A;  3GXO A;  5ICF A;  1JGS A;  5KK1 A;  1D3Y A;  1ZGJ A;  4HQE A;  1ZGA A;  3KP2 A;  3EYY A;  3IKV A;  3R4K A;  4PCQ A;  3R60 A;  5J8F A;  1BI2 A;  1IRF A;  1ZRD A;  1ZYR F;  1J9I A;  1LB2 A;  2VOP A;  1QGP A;  2AXL A;  1XN7 A;  3KZY A;  2VT3 A;  3I4P A;  1A04 A;  1KQ0 A;  4IJA A;  2GIV A;  2MBF A;  2K27 A;  1IN8 A;  4CIC A;  4OIO F;  2HYG D;  1BBY A;  5DUK A;  3WE2 A;  3RDI A;  1OPC A;  3K1M A;  4RGX A;  1SD6 A;  2IA0 A;  1IZ1 A;  3RYP A;  1ZAR A;  3RIR A;  3LAJ A;  1W7P B;  3JAM Z;  4EM1 A;  1PDN C;  1FYK A;  1SD5 A;  1O3S A;  1OYI A;  2DBB A;  3KEO A;  1CF7 B;  3N4M A;  2IJL A;  1QO0 D;  1BIB A;  3KFW X;  5D6F A;  4LGW A;  2V79 A;  4CXF A;  2Z5U A;  3NEU A;  4XLP F;  3GWZ A;  2EK5 A;  1XGS A;  3KP3 A;  5CYV A;  1XSD A;  4KIC A;  2V6C A;  5K5Q A;  1BM9 A;  1REP C;  2DQR A;  1IF1 A;  4AIK A;  2JPB A;  1YW7 A;  3OOP A;  3P9C A;  3K2Z A;  2K02 A;  3ABU A;  4I01 A;  2M1B A;  4G9Y A;  5BS6 A;  1R58 A;  4HV5 A;  3T8T A;  1R1T A;  2FE3 A;  1BIA A;  4IXA A;  4YFK F;  2QQ9 A;  4YII A;  2J5O A;  4RB2 C;  2XRN A;  1LQ1 A;  1G3Y A;  2EFO A;  3P9I A;  3MZH A;  4ESF A;  4LB5 A;  3WGG A;  2J5P A;  5FLX Z;  1E17 A;  5HDK A;  3WU0 A;  3WTX C;  3GVA A;  4M71 A;  3GFJ A;  3ML6 A;  1IN6 A;  2H27 A;  4WXD A;  4R1H A;  2EA2 A;  3GYH X;  1SAX A;  1KGS A;  2A6H F;  5ILS A;  3LAP A;  2W25 A;  3KEQ A;  5DD8 A;  1BI1 A;  2X0L A;  5HLG A;  5CVI A;  2XAF A;  5LGT A;  2ZXJ A;  5D6E A;  4KT5 C;  1XSX A;  3M9A A;  3BPV A;  2KIF A;  2QM3 A;  1IN7 A;  3DXJ F;  3V7S A;  2ZME A;  3ZQ7 A;  1ZG3 A;  4MEX F;  3COA C;  4Q4Z F;  2GQQ A;  3DPL C;  1WSU A;  4RB1 A;  1FSH A;  2O6G E;  2Z99 A;  3MZY A;  4L5I A;  1PUE E;  1B9M A;  5LHG A;  2E7W A;  3ZMS A;  1UHW A;  3JAM K;  5LGN A;  1P4A A;  4B8X A;  5F64 A;  2VBZ A;  2RV8 A;  4N9H A;  2BBY A;  4I7H A;  3M1E A;  4AIJ A;  5AIQ A;  2QWW A;  3DF8 A;  4LK0 F;  4KIF A;  4NQW A;  4A2U A;  3CLO A;  2QLZ A;  1I27 A;  2FF4 A;  2WWY A;  4P5O A;  1Y0U A;  3CUQ C;  4LD5 A;  3SZT A;  2WV0 A;  4EVI A;  1TTY A;  3BPX A;  2EFW A;  2OD5 A;  1LDJ A;  4BXU A;  4M9X A;  2HQN A;  3EUH A;  4YFX F;  1ON1 A;  4ZYE A;  4GXO A;  1FYL A;  4L0Z B;  1IW7 F;  3RI4 A;  3K0L A;  2PI0 A;  3GLX A;  4IHT A;  4RAY A;  3GZ5 A;  2XUB A;  2PQ8 A;  5E1W A;  1YG2 A;  4P96 A;  2VC0 A;  2QYO A;  2H6B A;  4RGS A;  4LB6 B;  2BE5 F;  5BOX A;  2ESN A;  1TW3 A;  1WRJ A;  4BHB A;  4KYW A;  4EM2 A;  4HW0 A;  4PDK A;  2HTJ A;  1UB9 A;  3GUD A;  3I58 A;  3EET A;  3T5X A;  3F8F A;  3VOD A;  3B73 A;  3QU6 A;  4M73 A;  3F72 A;  1B9N A;  4CYD A;  2VT2 A;  3P7N A;  1U2W A;  5HS8 A;  4KNY A;  3W6J B;  4RS8 A;  3EQL F;  1W4M A;  2LKP A;  2ZNY A;  2D1H A;  4YIF A;  2RDP A;  5K5R A;  1IRG A;  1BC7 C;  3IWF A;  3I5U A;  3R0J A;  4P55 A;  2IRF G;  1MGT A;  5JFR A;  4WX9 A;  2B0L A;  4R79 A;  4U7D A;  1CF7 A;  2F5E A;  2NRA C;  2LNB A;  4P9F A;  5FD5 A;  2MA3 A;  3REO A;  1HW5 A;  2STT A;  1R23 A;  1ZHF A;  2HWV A;  3LA2 A;  2CSO A;  3KET A;  4MTE A;  1O3R A;  1YQA A;  3JSP A;  5HDG A;  3DPT A;  4MGR A;  3WU1 B;  3ZPL A;  2X4H A;  1YIO A;  1FNN A;  4JK1 X;  1J5Y A;  3TO7 A;  2DT5 A;  5A2Q Z;  5LGU A;  4HZF A;  2L4A A;  1YLF A;  5CVV A;  2Q0O A;  1Z05 A;  2EJR A;  3ZMU A;  4L9V A;  1R22 A;  1I5Z A;  5DD4 A;  2HGC A;  3IRR A;  4IRH A;  3GW2 A;  5E8G A;  4ENN A;  5CVR A;  5D8L B;  2HEO A;  3U9G A;  2H94 A;  5D4S A;  2A69 F;  2KIU A;  1FOK A;  1U8R A;  3FMS A;  1TNS A;  5FLX K;  2P7C B;  1MDM A;  2D45 A;  3TDZ C;  3FM3 A;  4OU0 A;  5L3C A;  2YX4 A;  5HS9 A;  5IT3 A;  4EQQ A;  2FOK A;  1YO5 C;  1HKQ A;  3NRV A;  4N0B A;  1XGO A;  2GAU A;  2UWM A;  2IVM A;  4MQV A;  4JBA A;  5DUI A;  2MH2 A;  4AWX B;  1LDK B;  4FT8 A;  4UNO A;  2F5D A;  2ADU A;  3RPU A;  3V7R A;  5ILU A;  5FD6 A;  1UFM A;  4L9N A;  2H09 A;  3QRF F;  3CTA A;  2MC3 A;  2VON A;  2RKH A;  2PN6 A;  2C6Y A;  4KN4 X;  2FA5 A;  3NQO A;  1LVA A;  2P4W A;  3K69 A;  5LRR A;  1DP7 P;  5E17 F;  3FHZ A;  3C7J A;  4DQ2 A;  1LJ9 A;  4U7B A;  5JHU A;  3AAF A;  2EB7 A;  4M74 A;  4U88 A;  1YS7 A;  1K78 B;  1C0W A;  3VFZ A;  3KCC A;  4B09 A;  3I71 A;  2RN7 A;  4LLG F;  2BEO A;  4HF1 A;  1V3F A;  2NNY A;  2P5L C;  2XAH A;  4KN7 X;  2FXA A;  1BI3 A;  5HOO A;  2VC1 A;  3J81 K;  3ECH A;  3WTV C;  3MFK A;  3HRS A;  2DPD A;  1T0F A;  2P5V A;  3IWZ A;  2FNA A;  2DK5 A;  2ACJ A;  1MJB A;  4ENJ A;  1YFH A;  2ZME B;  2R7F A;  2VE9 A;  3Q9S A;  1TNT A;  2K86 A;  4UVB A;  2P6T A;  1ONV A;  4HLY A;  4HX8 A;  1ZRC A;  4G7O F;  1T98 A;  2V1U A;  3F21 A;  2HQR A;  2GXG A;  3FWE A;  3GFM A;  3FF5 A;  1PP8 F;  4L9T A;  4OMZ A;  3HTS B;  4UUV A;  2VE8 A;  1FBU A;  2XVC A;  1E2X A;  5FO5 A;  2BGC A;  3BJA A;  1W5S A;  2O03 A;  3DEU A;  3JW4 A;  3EDP A;  2GXB A;  4YG2 F;  1L3L A;  5ILV A;  2QQA A;  1AOY A;  3F23 A;  3FMR A;  3O3K A;  4RB0 A;  3E5Q A;  5D8K B;  2KIM A;  4ASN A;  2ISZ A;  3VB2 A;  4S04 A;  3GO5 A;  1J7K A;  3HHH A;  3IL2 A;  2OQG A;  3Q9V A;  3RJP A;  2QQB A;  2DFI A;  2DU9 A;  2IP2 A;  3SXY A;  1FYM A;  2IPQ X;  4OIN F;  2P5K A;  2DI3 A;  5CLS A;  4OOI A;  2P6S A;  3T0Y A;  3KP5 A;  4EV0 A;  2PG4 A;  4IVN A;  4BAY A;  2G7H A;  4UXN A;  1R1V A;  1G3T A;  1WKM A;  5JVT A;  1XDU A;  2TDX A;  1O57 A;  3FX3 A;  3D0S A;  1DUX C;  3KP6 A;  3FXR A;  3MWM A;  5D4R A;  4EMS A;  2DTR A;  2W84 A;  1DPU A;  1ZAO A;  1R36 A;  2VN2 A;  4CO8 A;  2XAJ A;  4HX4 A;  1U78 A;  4ZYH A;  1OYW A;  1YW8 A;  2F2E A;  2MD5 A;  1IXR C;  2K7L A;  3B02 A;  3E3V A;  2ZFW A;  3E5U A;  3RKX A;  5EEG A;  1YS6 A;  1JHH A;  4IRI A;  3BP8 A;  5HLH A;  2Z3Y A;  3M7G A;  1G3S A;  1SMT A;  1OMI A;  1GHC A;  1FC3 A;  1D8K A;  1JXS A;  4QWQ A;  4MNU A;  4Q48 A;  5L3B A;  5L3G A;  2PJP A;  3HOT A;  3DV8 A;  3HRT A;  4M9Z A;  4BNC A;  3F6O A;  4A6D A;  3F8B A;  2V1D A;  4NB5 A;  3MQ0 A;  5ICC A;  5KVR A;  4XSZ F;  2EV6 A;  3RYR A;  4KDP A;  2CWE A;  3L00 A;  1ZLK A;  3GZ6 A;  1RUN A;  1MKM A;  2G9W A;  5E18 F;  4HDV A;  4G8X A;  4IPA A;  5LHI A;  2KJB A;  3G3Z A;  1BN5 A;  1Z9C A;  5AIP A;  4R8H A;  1DPR A;  1WI9 A;  2JRT A;  1KQ8 A;  1HKT A;  4U0Y A;  2EFN A;  1TW2 A;  4ZYG A;  3JTH A;  1MZB A;  1FP1 D;  3CUQ B;  4MHG A;  1SFX A;  1F5T A;  2FML A;  2STW A;  5ICG A;  3ROU A;  4G6D A;  2QUF A;  2VOO A;  3G73 A;  2L02 A; 
#chains in the Genus database with same CATH topology
 1FP2 A;  3MKZ A;  3ZMV A;  3ZN1 A;  1TBX A;  4AD9 A;  2CO5 A;  4I0A A;  3IUO A;  1FMW A;  3FXQ A;  4U0W A;  1D0X A;  1Y6I A;  1ZG1 A;  4IF4 A;  3IH2 A;  4IQJ A;  1S3J A;  2LLK A;  4ZYA A;  2ZSH B;  3QPH A;  3I59 A;  1XGM A;  4PZJ A;  2G7U A;  1D1C A;  1RZ4 A;  1OYY A;  1LFP A;  4KIG A;  1AKH A;  4DBQ A;  4F91 B;  1FPQ A;  3BQZ A;  1KYW A;  4GYG A;  4RBO A;  2LTP A;  2WAE A;  3RTR A;  1UST A;  4HBL A;  2AO9 A;  3Q0W A;  2ZXH A;  5DCF A;  2F5C A;  2HXO A;  3MMY B;  4AVP A;  4KIT B;  1ETW A;  2R0Q C;  1GXP A;  3L7W A;  2LY9 A;  2A68 F;  2KKO A;  5GAD J;  2FQ4 A;  2VBW A;  2Y0S N;  2WTE A;  2M87 A;  1PYV A;  1T33 A;  4E7H A;  3BR0 A;  4BAC A;  4BHC A;  1K6Y A;  5D5V B;  3CF5 F;  3G4S I;  4LG0 B;  1RPW A;  2RQQ A;  4HST A;  4XLH A;  3IHU A;  3PQK A;  4JX6 A;  1TWH J;  4PJM A;  3SEQ A;  5HVQ C;  2DMQ A;  4A0Z A;  3U1D A;  1P4X A;  5F6F A;  4S05 A;  4HX7 A;  1FT9 A;  1BOA A;  2V26 A;  3BWG A;  1G6N A;  4HNT A;  2DOE A;  1E0E A;  1Y8Q B;  1ZEL A;  3LFK A;  1SD4 A;  4KFC A;  4QSH A;  2QEX I;  3NWS A;  3Q0U A;  3ZOB A;  4AIH A;  3SFZ A;  2V1N A;  5EZH A;  4C3H J;  3QP6 A;  2VJ4 A;  3AG1 H;  3NAR A;  4BYY A;  2VXD A;  2GIZ A;  4HYE A;  3WTU C;  2IT0 A;  4G6Q A;  3BZ6 A;  1MJ9 A;  3W2W A;  3G71 I;  3HOY J;  4LFU A;  1BR4 A;  3LSK A;  3QAH A;  3H1C A;  4CZZ A;  3QQA A;  4CHU A;  5DDG A;  5B3S H;  4OMY A;  3O6B B;  4RLF A;  4JX4 A;  4B48 A;  4CGZ A;  3RCO A;  1IRX A;  2R7Z J;  1MH3 A;  3OSG A;  5C3E J;  4XBF A;  1VF9 A;  1LE8 A;  1D1A A;  1KU7 A;  4EJW A;  3B6C A;  2RVC A;  2KRF A;  2A07 F;  1ZRE A;  2DCE A;  3ZR8 X;  2DQL A;  5IT9 Z;  4EJO A;  2QSF X;  2O61 A;  3HTU A;  2O9L A;  4E6K G;  2CFO A;  4BBS J;  2M8E A;  1JKP C;  2FEZ A;  2AS5 F;  3K70 C;  3HSF A;  5ICE A;  1I6X A;  3RPQ A;  3LST A;  1ETQ A;  4OAY A;  3QOE A;  4BJ5 C;  1SD7 A;  1NG6 A;  3PL8 A;  3BJO A;  4Z6Y A;  1JE8 A;  1K6O A;  3BCB A;  3FXJ A;  3CCQ I;  1X3W B;  5FFZ A;  4A5N A;  1U5T C;  3I59 B;  1ETV A;  2Y31 A;  4F52 A;  3OYF A;  1IXS B;  1S7A A;  3I54 A;  1FWZ A;  2VB6 A;  9ANT A;  2KT0 A;  4D0P A;  3I55 I;  1W7P A;  1WGX A;  4B1R A;  3J7A O;  2ZJQ F;  1JI8 A;  2M45 A;  3ZQL A;  2Q8K A;  4RM3 A;  3E6B A;  3OMY A;  5E3O A;  4O5V A;  1AWC A;  1XCV A;  3L2C A;  1IN5 A;  1QQI A;  4UVC A;  3DKW A;  2JUC A;  2I5U A;  2L9R A;  2QZ8 A;  3ZGK A;  3NWT A;  2MH9 A;  2XDV A;  3S8P A;  2GWR A;  1DDN A;  3QOD A;  4ESJ A;  4A69 C;  3I53 A;  3GTJ J;  1BJZ A;  4XID A;  2GXA A;  3ZXS A;  1J0R A;  4ANJ A;  4AC0 A;  1F9N A;  4ZZD A;  4EAT A;  3BOQ A;  5DV5 A;  4XRS G;  4LJZ F;  2DA1 A;  4A5M A;  2DA5 A;  2DXI A;  1HDD C;  5EDN A;  1S8N A;  1FBS A;  2EZK A;  2XAU A;  3SDB A;  1FBQ A;  4P1W A;  3JSO A;  2Y30 A;  1HSJ A;  2UXX A;  2HQ5 A;  3X2Q H;  2F5V A;  2RQP A;  1EJ9 A;  4RM2 A;  3T1B A;  2NNN A;  4HF2 A;  2CRG A;  4M3G A;  1TT5 B;  2MC4 A;  2UUZ A;  1IN4 A;  3AL0 C;  2VQL A;  4NC8 A;  1FY7 A;  1V4R A;  2M2E A;  4A3G J;  5JLX A;  2CV0 A;  1N78 A;  1WJC A;  3WTW C;  2R7X A;  5IYC J;  2B9S A;  4II2 A;  2CUF A;  3R6S A;  4CCN A;  4LOC A;  1FOX A;  3L9F A;  2M4G A;  3ERM A;  1WQ2 A;  2O8X A;  1EH6 A;  4M6V A;  3GZN B;  3G6E I;  4P9U A;  2QEN A;  2RNG A;  3IH4 A;  4BHP A;  2PJR A;  5HLI A;  4PFO A;  1IXC A;  2VBY A;  1ZN2 A;  2B63 J;  1SAN A;  3OV8 A;  3GTM J;  2KHM A;  5B5E C;  2OQR A;  1QU3 A;  3A4C A;  5DCM A;  1MSF C;  3OL3 A;  2W85 A;  1I3Q J;  1FOY A;  1T56 A;  4Q5S F;  2EIL H;  3TGN A;  1R5G A;  3LA3 A;  1LKX A;  3E6M A;  5FKK A;  1DGW Y;  3VYU B;  4I76 A;  2EFQ A;  4W97 A;  4PFP A;  1S7E A;  4PJJ A;  2VKD A;  1HW2 A;  4K2E A;  2BY0 A;  3ONQ A;  2LF7 A;  2LH9 A;  1RR7 A;  2E71 A;  2R7R A;  3PSI A;  3J80 K;  4RAG A;  1G59 A;  2BXY A;  2CMP A;  5J8C A;  1MBF A;  2LRD A;  1IV6 A;  1MDM B;  5E8I A;  4OWR B;  3QU3 A;  4G7H F;  4DZJ A;  2HDC A;  3PO2 J;  2XF7 A;  5HS7 A;  2Z9O A;  1XC5 A;  2CS3 A;  2FMY A;  2ZJP F;  1D5V A;  3OSF A;  3ZMZ A;  3M8E A;  5IP9 J;  3OWT A;  1FTT A;  1NHA A;  3TKY A;  2M0C A;  4BE0 A;  1PUF B;  2IS2 A;  1L0O C;  2E1M B;  3DBL B;  1MBH A;  2UZK A;  1SVL A;  1CGP A;  2W57 A;  3K1N A;  4XRS A;  2O7O A;  2W24 A;  4BGD A;  3HOV J;  4W1U A;  1JHF A;  4F93 B;  2FBI A;  4N9I A;  3F3X A;  2JSC A;  3H36 A;  2YX7 A;  3KP4 A;  2M5W A;  1S29 A;  2VXZ A;  5KAI C;  2FOW A;  2K4J A;  1IUF A;  2O0Y A;  1EF4 A;  1VQN I;  1O7L A;  4HOB A;  3J80 Z;  4M6X A;  1TQI A;  4EGY A;  1ACI A;  4UHT A;  2AQF A;  5D5W B;  2A5W A;  3QYB A;  4C30 A;  3CCJ I;  2KJC A;  1YE9 A;  3C3W A;  4LIV A;  1RUO A;  1QRY A;  2V9K A;  2ZNZ A;  2P8T A;  1T2K A;  3TOA A;  1Y0N A;  1ZQ3 P;  3MN2 A;  4A3D J;  1XS9 A;  4CDG A;  1MBE A;  3G1M A;  5IP7 J;  5L3E A;  2XGD A;  3KLO A;  5LHH A;  2XC7 A;  1STZ A;  1VI0 A;  1D8J A;  1P6R A;  2CQ7 A;  4XSX F;  1I1S A;  4MTD A;  3DU6 A;  2VBX A;  3FXU A;  3VOE A;  2CQQ A;  1J75 A;  3PM1 A;  2ELK A;  1QBJ A;  2JA5 J;  5J6X A;  5TRD A;  4C3J J;  1X4P A;  4ETS A;  4M3E A;  2PMU A;  2MW8 A;  1VTN C;  4QLC U;  4BY7 J;  1IAW A;  5M5Y J;  4OIQ F;  5EJC A;  1Z6R A;  4Y15 A;  3S2W A;  5KCM A;  4EJV A;  1T8I A;  1EH7 A;  1S7O A;  4E70 A;  1Z21 A;  1XGN A;  2R7S A;  1EV7 A;  2DT7 B;  2XHK A;  5M3F J;  1R00 A;  1I3A A;  3SFI A;  3AG4 H;  4I2O A;  4HF0 A;  1TLH B;  2OC6 A;  1U0J A;  3CCL I;  1TWG J;  2L54 A;  4XNF A;  3WOD F;  1RI7 A;  3TDU C;  5J1Y A;  4DZP A;  3ZMT A;  3P9K A;  2HFH A;  4D9J A;  2K40 A;  2E1N A;  4Y7N J;  5IYB J;  1G3W A;  2R7V A;  2PFB A;  2VAS A;  3CQZ J;  5ED4 A;  2CGP A;  1LVK A;  1WI3 A;  4WXH A;  3I64 A;  3IRQ A;  2HKO A;  1O3T A;  3WE3 A;  2ICW G;  4EJU A;  3KIO A;  3TW7 A;  2VOD A;  4M3D A;  2BVL A;  2M30 A;  3M8F A;  2LMD A;  1T95 A;  3DPU A;  4KIB A;  4L5J A;  4FX4 A;  2CYY A;  2XAG A;  4ESB A;  2R93 J;  5F0F A;  3F8C A;  4TV7 A;  4YFN F;  4C9Y A;  1XSV A;  3RKW A;  4F92 B;  1XPX A;  3IKT A;  3K1P A;  2DAO A;  2IW5 A;  4E7Z A;  4FE7 A;  3ECO A;  1ZKG A;  3OIP A;  2BOL A;  3KPH A;  1KU2 A;  4DJA A;  3ABK H;  2H8W A;  1J59 A;  1HF0 A;  1HW1 A;  3A0B C;  3HRU A;  1XMA A;  2DW4 A;  3R0A A;  1H9T A;  3GFI A;  1ZTR A;  1WWX A;  2QSH X;  2HPI A;  4XMY A;  4E7S A;  5TGT A;  1Z1D A;  4WXC A;  2CQK A;  2E2I J;  2FU4 A;  2IBD A;  1W5T A;  3ISP A;  4EJT A;  2PEX A;  2OUM A;  1F4K A;  4M9S A;  3R61 A;  3ZN0 A;  5LLQ A;  5D5U B;  3HHG A;  1P7J A;  4B3A A;  2HOA A;  5GAH J;  1D0Y A;  4BKX A;  3HUG A;  2LR8 A;  2JMW A;  4AU7 A;  4JYK A;  2FBH A;  4BXF A;  1V5F A;  3BZK A;  3I9V 2;  3OOU A;  4HRI A;  5AON A;  4OIR F;  4UVA A;  2L02 A;  4E7J A;  4ENM A;  4O6J A;  4IOC F;  4E7L A;  3CDL A;  5LBQ A;  5IT9 K;  1YTY A;  3V7C A;  2ISY A;  2OAZ A;  3FIS A;  1ODD A;  1BL0 A;  3CO7 C;  4IHS A;  1IUY A;  2W00 A;  3OYC A;  4M72 A;  1XMK A;  1M1E B;  2R5Y A;  1H9G A;  4ZTJ A;  3K4B A;  3O2P E;  2F4I A;  2OU2 A;  3OYD A;  2L7M P;  1SFU A;  2HI3 A;  2QBY B;  3WTZ A;  2IA2 A;  2ECB A;  2OZ6 A;  1AA7 A;  4V2F A;  1SFK A;  2LG4 A;  3WU2 C;  1TQM A;  2PLY A;  4FHT A;  2LBF A;  1I1G A;  1SMY F;  3Q5F A;  4HA8 A;  3D5L A;  2JT1 A;  4X0G A;  2JA8 J;  4O3M A;  4BQN A;  1JT0 A;  3E6D A;  3TL4 X;  2A05 A;  2IA1 A;  5K5O A;  4ENK A;  1ON2 A;  4Z2Y A;  4KMU X;  3SHF A;  1DU6 A;  4CSW A;  1IGN A;  3L2W A;  3WGH A;  1B1B A;  3CCR I;  2HTS A;  3V8L A;  2MLK A;  4D7N A;  1JUS A;  3DCF A;  2PX9 A;  5GPC A;  3GLL A;  1QZY A;  2FRH A;  5TIS C;  1ZH5 A;  3GTL J;  3KLN A;  3S1Q J;  1V5G A;  1TC3 C;  4A93 J;  4XRF A;  4A0Y A;  3GX4 X;  2HS5 A;  2V1X A;  4Y13 A;  1RKW A;  3PIP F;  3CO6 C;  1LE8 B;  4PGG A;  3VWB A;  1T38 A;  3FXL A;  3BZC A;  5BQT A;  1MSE C;  4F55 A;  3BDD A;  3AL0 B;  2NXN B;  1GV2 A;  1ZLJ A;  2B7E A;  4GDF A;  1Q1H A;  2MLG A;  4HDU A;  3HB9 A;  2XPW A;  2A6T A;  2EV5 A;  1T6S A;  2EV0 A;  2H6C A;  1P2F A;  1K7A A;  1CQT A;  1KU9 A;  3WTY C;  2BYV E;  4B4C A;  3HXL A;  2VQG A;  3PO3 J;  1V5E A;  2RC4 A;  2YSR A;  1E3H A;  2M7B A;  5L3F A;  1YRN A;  2EA4 A;  2JZY A;  3KZI C;  3W2V A;  3QOP A;  2IGN A;  1PVE A;  3ZQC A;  5HOD A;  3MKL A;  2HQA A;  2BVM A;  2NAZ A;  1UG2 A;  1Z7U A;  1U8B A;  2VL8 A;  1WH7 A;  4A0X A;  2L3D A;  2M8G X;  4LLL A;  4KUM A;  1ZG5 A;  3T8R A;  2EQR A;  2XSJ C;  3SEZ A;  4XR6 A;  3H3U A;  1FX7 A;  2GA1 A;  2IS4 A;  4FX0 A;  2AQE A;  1GVJ A;  2QBY A;  5LRS A;  1QPM A;  5A2Q K;  2R3S A;  2FSW A;  4UB6 C;  4OIP F;  5H6Q A;  5JI6 A;  3VEP A;  4J19 A;  5H6R A;  1K79 A;  4BUP A;  2HYJ A;  3CZ6 A;  2JA6 J;  2L7F P;  3JRH A;  1SFE A;  3CJT B;  4I98 B;  4BQA A;  1AKH B;  3E97 A;  3WTS C;  1IDY A;  4XOT A;  2LVS A;  1G4D A;  1TZL A;  4XKC A;  2CFX A;  2QCO A;  3BC8 A;  3LWF A;  4G12 A;  5BPI A;  3I0T A;  4CYC A;  2K4B A;  3MAJ A;  4MQ9 F;  4XLN F;  4BE1 A;  2IGK A;  3TOB A;  2D1V A;  3PQJ A;  1MMG A;  2XIG A;  4RAZ A;  3V8K A;  2WY8 Q;  3FKJ A;  5E1X A;  1F1Z A;  4XIC A;  5F0C A;  3V4G A;  3GTQ J;  4DYR A;  3BTL A;  4JQF A;  1Q1V A;  3J81 Z;  4ON0 A;  2GZW A;  3BRO A;  5K1Y A;  3GTO J;  1U3E M;  4GGG A;  4D7M A;  3MKW B;  3QYF A;  4I02 A;  4S0H B;  4XON A;  2XAQ A;  1OCP A;  3HSR A;  1A5J A;  3BR2 A;  1FTZ A;  4XKW A;  3F6V A;  3DWL E;  3ERE D;  3HYI A;  2OA4 A;  3KP7 A;  2A3S A;  5GPA A;  3WTT C;  4G7Z F;  2HKX A;  1P4W A;  1TP4 A;  2DMT A;  4RB3 C;  1MJA A;  3TQN A;  3H3Z A;  4HEA 2;  2EPF A;  1FZP B;  2WA0 A;  3F22 A;  3FZV A;  2HOE A;  3LSM A;  2PMH A;  1MNE A;  1GUU A;  1S72 I;  2QGU A;  2FD5 A;  5C4X J;  1FIP A;  3KZZ A;  2ZJ2 A;  1PUF A;  1LEA A;  3DP7 A;  2RGV A;  2VKH A;  2Q1Z B;  2L2O A;  4WCG A;  5L3D A;  4LMY A;  5DYM A;  3CUQ A;  4XOP A;  4PUS A;  2YU3 A;  4XL9 A;  1QNT A;  3LSR A;  4RGU A;  3PUB A;  5B1B H;  1USS A;  2XKO A;  6PAX A;  3OIO A;  2DTZ A;  3S3M A;  1VQL I;  2A5Y B;  1MMA A;  1POG A;  3C2G A;  1GT0 C;  1WJ5 A;  3TO9 A;  3EUH C;  2V4J C;  2X48 A;  2ZXW H;  4DNC A;  2HOS A;  2V9V A;  1T0F C;  2L7Z A;  5CVU A;  4I0B A;  4IRG A;  3WGI A;  3GTK J;  3OYK A;  2CV1 A;  2RAE A;  2QVO A;  1BJA A;  2XV4 S;  1B6A A;  3V8J A;  3C2B A;  4U87 A;  3S17 J;  2OZU A;  4BEH B;  2LY1 A;  1KON A;  3CP2 A;  4A12 A;  1KU3 A;  1XB4 A;  4KA4 A;  2KIS A;  5ERI A;  5FGM A;  2DFH A;  1DP3 A;  2DK8 A;  4HV6 A;  2EZL A;  4X6A J;  3CCY A;  1N75 A;  1DU0 A;  2Y2Z A;  1I50 J;  2LDU A;  3OR2 C;  5F0H A;  3AG2 H;  3FIW A;  3KE2 A;  4HSR A;  5GAE J;  2HZT A;  2L4M A;  1ZGW A;  1R1U A;  2JJ7 A;  2XRO A;  4XKB A;  5TJJ A;  2EIJ H;  3ELK A;  5LEJ A;  1IDZ A;  4IHW A;  3I4N J;  1O7F A;  1B4A A;  2MG4 A;  2Y75 A;  3L2U A;  4CH7 A;  2CQN A;  1UMQ A;  2A61 A;  2DA3 A;  4YIR X;  5HDN A;  4BH9 A;  2OBP A;  3OYI A;  4Q47 A;  3DEW A;  2NS7 A;  1VQP I;  3QP5 A;  3FM5 A;  2FNP A;  1X3U A;  2HR3 A;  2M0M A;  2PBI A;  1QPI A;  2M7A A;  1Z67 A;  1GV5 A;  3BR6 A;  3L1P A;  3OS0 A;  2E1C A;  1LEB A;  3ASO H;  3TBI A;  5KHD A;  1U6G A;  3WHB A;  1R4M B;  3GF2 A;  1X3Z B;  2LF8 A;  2QF7 A;  1HST A;  1PJR A;  4C2U A;  3H9Q A;  3PUF A;  5IOY A;  2NOG A;  4A3K J;  2JK3 A;  3FMQ A;  3PNT A;  3E0J B;  3BY6 A;  2OV7 A;  3C18 A;  2TRT A;  2FUG 2;  3E6C C;  2G0E A;  1OCR H;  1TL8 A;  1W7P D;  1YRN B;  1ETO A;  1K78 A;  1R7J A;  4HQM A;  2OTJ I;  5DCM B;  2E5Z A;  4UV9 A;  2Z33 A;  4F7Z A;  4ITV A;  1U9O A;  3GFL A;  4D1Q A;  1KYZ A;  4UV8 A;  1A31 A;  4I09 A;  3E5X A;  1OR7 C;  1B59 A;  4U0V A;  4JP0 A;  3F8M A;  4H4K C;  3HIF A;  1UCR A;  2Y48 A;  4A3I J;  1VQK I;  4WF2 A;  3LQQ A;  2E60 A;  2F5F A;  3RQ4 A;  3ZP5 A;  3EUK L;  1U5T A;  1JJ6 C;  1XTA A;  3F0C A;  5EGO A;  5DS9 A;  1R5H A;  2K3P A;  1LFU P;  4ZZL A;  5E3L A;  2L01 A;  2ZCW A;  3FXM A;  3CDH A;  1X19 A;  1FSE A;  4GYI A;  4XOR A;  4Y17 A;  5BPD A;  2KP6 A;  3BR1 A;  1HBX G;  5BMZ A;  4H0E A;  3LA7 A;  1NG7 A;  3JRD A;  2DFE A;  4V19 K;  1F36 A;  5F1R A;  4A3C J;  1ERD A;  2FBK A;  1EKE A;  2A6E F;  4CYC B;  1NH3 A;  2O3F A;  3JTG A;  4KMF A;  2E36 A;  2L9N A;  3Q3S A;  1PP7 U;  4RGR A;  2KRC A;  1XCB A;  2RNJ A;  3PNY A;  2D2W A;  3HSE A;  2ZO4 A;  4DYQ A;  3DLL F;  4BL0 B;  3HUG B;  2COM A;  3ABM H;  2JUG A;  1LNW A;  2JTV A;  3DLA A;  4GO1 A;  2F4O B;  2CG4 A;  4RDU A;  3HOS A;  3D1N I;  1IG7 A;  1SAU A;  3QPT A;  2YPR A;  3BJ6 A;  3EYI A;  1OKR A;  1QZZ A;  2CQX A;  5J1R A;  4PGH A;  1ETY A;  3BR3 A;  2ZKZ A;  2MYS A;  1GDT A;  3HGG A;  2LSO A;  3H5R A;  2E1O A;  3ASN H;  3UR3 C;  1JKR C;  1KQ9 A;  2GA2 A;  4EGZ A;  2CU7 A;  3PIO F;  1ULY A;  1A6Q A;  1OLT A;  1S6L A;  3LSG A;  3LSP A;  1KA8 A;  2LD5 A;  4N4O B;  4HAM A;  4HLX A;  4LLN A;  3IAM 2;  1YYV A;  2ELH A;  1ZRF A;  3PFY A;  3OS1 A;  2W48 A;  2P7V B;  1HKS A;  1X1D A;  5LEK A;  1Z6T A;  2CH0 A;  4DGW B;  1QA6 A;  4IZZ A;  1J2X A;  2HYF A;  4AYB N;  4CCM A;  3F8N A;  3CJN A;  3GBG A;  3L2Q A;  3OYJ A;  1O3Q A;  2BV6 A;  2E35 A;  2JVH A;  3FHN A;  3SQN A;  4I6Z A;  2FQ3 A;  1HQC A;  3P5J A;  4FTH A;  2Q2E A;  2WC2 A;  2XKP A;  2W1O A;  2X6W A;  3GEZ A;  2RRE A;  3CUO A;  3RKY A;  3GTP J;  1XD7 A;  2ETH A;  4LG0 A;  5FFX A;  5CVJ A;  5DEQ A;  2E7X A;  3MD2 A;  5E79 C;  3W6K B;  4FET A;  1RIO H;  2VPL A;  1BR2 A;  2CUE A;  2ZBK A;  3VYR B;  4IHX A;  5E20 A;  2VI6 A;  4MLO A;  5FB2 A;  2LKX A;  1H0M A;  1HXD A;  3TO6 A;  1O4X A;  3LQR A;  3G1O A;  2NYX A;  1B8I A;  2VUM J;  1YI2 I;  3IC7 A;  3LNQ A;  5F08 A;  2ESH A;  3DQV C;  2YUS A;  3BQY A;  3CC2 I;  3QPS A;  4XLE A;  2XAS A;  3FKI J;  4BBR J;  2DLL A;  1HCR A;  3W6V A;  2R7D A;  2F6C A;  4BEH A;  2UXN A;  2EFP A;  4LK1 F;  4DBR A;  5GTH C;  2D5V A;  4PJL A;  3DFG A;  2OPT A;  4L18 B;  1N77 A;  2X51 A;  4ZJZ A;  2L9S A;  3RQI A;  4ZH4 F;  1TQP A;  3H92 A;  3HRM A;  5D5X B;  2YR2 A;  3IP4 B;  3BG9 A;  2DDA A;  1MBG A;  3JRF A;  2JPC A;  2NS0 A;  3KYD B;  3L2R A;  4FAS D;  3OY9 A;  3OL4 A;  1HOM A;  4KIS A;  4ZYD A;  1BOB A;  2IGM A;  2EWN A;  3WG9 A;  3OR1 C;  4G94 A;  3OYA A;  3ZMD A;  1W36 C;  3CMM A;  4L0Y B;  3G1L A;  1XDS A;  2VJI A;  4MEY F;  1YHQ I;  4WWC A;  2EIN H;  3N97 A;  1YW9 A;  2LC2 A;  3MCZ A;  3FBN B;  4A6E A;  4WK8 F;  5H20 A;  3SZP A;  2M34 A;  1YIJ I;  3CC4 I;  4EEF G;  1T39 A;  4GCV A;  4L9J A;  2R5Z A;  5B66 C;  1UHM A;  1GXQ A;  4NHJ A;  1P92 A;  2CW0 F;  1W1W E;  5E3M A;  4CCO A;  1BC8 C;  5JR3 A;  5K7F A;  4NQW B;  3U2R A;  2JA2 A;  3K9T A;  3L09 A;  1Z91 A;  4IO9 F;  1I39 A;  1H8A C;  1FLI A;  4C3I J;  3HKZ A;  4EM0 B;  1IRZ A;  3OYN A;  3LSJ A;  3DBH B;  2BHZ A;  4B47 A;  3ULQ B;  3ABL H;  3OYL A;  2Q2E B;  2DYR H;  2XGX A;  1LDD A;  1MD0 A;  3BT9 A;  3ABT A;  4RLQ A;  1UHS A;  3PFI A;  1YJW I;  5E1Z B;  1BW6 A;  2DPU A;  5K7Z A;  4CCK A;  1VQ6 I;  3C1D A;  2DO7 A;  2X1D A;  3A0H C;  1EH8 A;  1OR7 A;  1QVT A;  1XX5 A;  2Y0M A;  1RNL A;  3L2V A;  3MEX A;  3CC7 I;  4M6Y A;  2LBF B;  4CCJ A;  1BI0 A;  1MBJ A;  1U5T B;  3BG7 A;  2M4K A;  5CJ9 A;  1YJ9 I;  1LFB A;  5EEH A;  3GXO A;  2VPR A;  5ICF A;  3UNG C;  1JGS A;  5KK1 A;  5FRO A;  1D3Y A;  3M1C A;  1R49 A;  1ZGJ A;  5DM7 F;  1WJF A;  5J4Y A;  4HQE A;  3K7A J;  3CME I;  1ZGA A;  5CPR B;  1R71 A;  3KP2 A;  3U21 A;  4OAZ A;  3EYY A;  2DOD A;  3IKV A;  3R4K A;  3FK7 A;  4PCQ A;  2ID3 A;  2XGC A;  3R60 A;  5J8F A;  3ZQG A;  1BI2 A;  2R92 J;  1IRF A;  5CQG A;  1ZRD A;  4FQG A;  2BXZ A;  1P7I A;  3DBR B;  1ZYR F;  1J9I A;  1LB2 A;  1ZK8 A;  2VOP A;  2NVU B;  2HOT A;  4BXX J;  1QGP A;  2DA4 A;  3A03 A;  2AXL A;  4ZDO A;  1XN7 A;  2DA6 A;  2QSG X;  3H35 A;  4B43 A;  2DMP A;  4B3X A;  3B6A A;  3CCS I;  2DJN A;  3KZY A;  2VT3 A;  3I4P A;  4A3F J;  1A04 A;  2PMZ N;  1KQ0 A;  3HG9 A;  4IJA A;  2GIV A;  2MBF A;  2K27 A;  3H5A A;  2E5N A;  3Q0V A;  2HVR A;  1IN8 A;  4CIC A;  4OIO F;  2BY2 A;  2HYG D;  3K6G A;  3CCV I;  1G8X A;  3QWL A;  3AKZ A;  1BBY A;  5DUK A;  4ZC3 A;  3CJQ B;  1XG1 A;  3HZJ A;  3A2K A;  3WE2 A;  2L0K A;  1OPC A;  3RDI A;  3VSL A;  1MMN A;  3K1M A;  4RGX A;  3JRB A;  1DGR M;  1SD6 A;  2UV1 A;  3FBI B;  2IA0 A;  3CF2 A;  4M3F A;  1IZ1 A;  4NUB A;  3RYP A;  1ZAR A;  2K85 A;  3RPU D;  4GFB A;  2K5C A;  4J01 A;  3RIR A;  5B1A H;  1W0U A;  3LAJ A;  1W7P B;  2K9Q A;  3JAM Z;  4EM1 A;  1PDN C;  1FYK A;  1BA5 A;  1SD5 A;  1O3S A;  1ENH A;  1OYI A;  2DBB A;  3KEO A;  2DYS H;  1CF7 B;  1WHU A;  2IJL A;  3F9K A;  3JRG A;  3N4M A;  2KMU A;  1QO0 D;  2P81 A;  1BIB A;  3KFW X;  5D6F A;  1SVM A;  1X2M A;  4LGW A;  2V79 A;  3BTC A;  4CXF A;  2DDB A;  2Z5U A;  3NEU A;  4XLP F;  4CUG A;  1N25 A;  4MIM A;  2EZI A;  3GWZ A;  5C44 J;  2EK5 A;  1XGS A;  1SC7 A;  3KP3 A;  5CYV A;  3ZQI A;  1JT6 A;  2ECC A;  5IPA A;  1XSD A;  4KIC A;  2V6C A;  5K5Q A;  2CV2 A;  1BM9 A;  1REP C;  1ZR2 A;  4PJN A;  1W0T A;  2OF7 A;  1SVO A;  2DJI A;  2VQH A;  2EZH A;  3DTK A;  2DQR A;  2VLA A;  2XPU A;  1IF1 A;  3BLY A;  3PNV A;  4HG2 A;  4XRM A;  1I6H J;  1GVD A;  5F27 A;  2H1L A;  5C4J J;  2JPB A;  3BTJ A;  1OCC H;  4AIK A;  1YW7 A;  3S1M J;  2IEK A;  3OOP A;  3CP8 A;  1W36 D;  5FJ8 J;  3LSH A;  3P9C A;  3K2Z A;  5FKL A;  2QQ8 A;  2K02 A;  3ABU A;  2R7Q A;  4I01 A;  2N8G A;  2M1B A;  4G9Y A;  2HXI A;  5BS6 A;  2ELJ A;  1R58 A;  5FKN A;  2R7W A;  1Y1W J;  4HV5 A;  1APL C;  3T8T A;  1R1T A;  5CKT A;  2FE3 A;  4NC7 A;  1BIA A;  3HEF A;  4IXA A;  5HNH A;  4YFK F;  2QQ9 A;  5FRN A;  4YII A;  2J5O A;  3SZG A;  4QIW N;  4RB2 C;  1WZ2 A;  5FLV A;  2XRN A;  1LQ1 A;  3TP3 A;  4BDZ A;  1G3Y A;  2EFO A;  3P9I A;  2X6Y A;  3MZH A;  1EA3 A;  2LKS A;  5JLW A;  2FJ1 A;  4ESF A;  3IV5 A;  4LB5 A;  3K4M A;  3WGG A;  1WPK A;  2HDD A;  2J5P A;  5FLX Z;  2XF6 A;  2K9L A;  3S93 A;  3LSI A;  1P9Q C;  3HOX J;  1E17 A;  5HDK A;  4XN0 A;  1QVU A;  1X58 A;  3WU0 A;  3WTX C;  1R6R A;  4UUS A;  1VQ7 I;  3GVA A;  5DM6 F;  3E1S A;  1KZH A;  1ETX A;  4Y33 A;  4M71 A;  3GFJ A;  1A36 A;  3ML6 A;  1IN6 A;  2H27 A;  4YRV A;  4WXD A;  3U1K A;  4BU2 A;  1LPQ A;  4CCL A;  5M3M J;  3K4C A;  1VQ9 I;  4R1H A;  2EA2 A;  3GYH X;  1SAX A;  1KGS A;  2A6H F;  5ILS A;  3LAP A;  4ZTF A;  1JGG A;  1E3O C;  2W25 A;  1QZE A;  2DMN A;  2NVQ J;  3KEQ A;  5DD8 A;  4RAF A;  4V2G A;  4C2M J;  2HVS A;  5JVG F;  1MIJ A;  1BI1 A;  4II3 A;  5K7H A;  2IGO A;  2X0L A;  2JA7 J;  5HLG A;  4BJT A;  1K4S A;  3CMY A;  5CVI A;  4AVZ A;  3JRC A;  2XAF A;  3AFH A;  3RKQ A;  5LGT A;  2ZXJ A;  4BY1 J;  5D6E A;  4KT5 C;  3HGY A;  4G6T B;  5FLM J;  2CJJ A;  4IHV A;  1WH5 A;  1XSX A;  3M9A A;  3AG3 H;  2HU9 A;  3DU5 A;  1RRJ A;  1X1B A;  3BPV A;  2KIF A;  2QM3 A;  2O5R A;  3BG3 A;  1IN7 A;  3DXJ F;  3V7S A;  2ZME A;  2IS1 A;  2VKV A;  4BJ6 C;  4A3L J;  2L7K A;  3ZQ7 A;  1ZG3 A;  1WVR A;  2L9V A;  5M5X J;  4Q4Z F;  3COA C;  2GQQ A;  3DPL C;  4NBQ A;  3M8J A;  4E7K A;  1WSU A;  2R4G A;  1FMV A;  3K4K A;  4RB1 A;  1FSH A;  2O6G E;  2Z99 A;  3MZY A;  5CQE A;  3H0G J;  2LRE A;  4L5I A;  1PUE E;  1R4N B;  1B9M A;  3VPR A;  2BW3 A;  3BG6 A;  3CD6 I;  2R7U A;  3OYM A;  2IS6 A;  2CUJ A;  5LHG A;  2E7W A;  3ZMS A;  1UHW A;  4ZDL A;  3QYE A;  3JAM K;  5LGN A;  1P4A A;  4B8X A;  3M3Y J;  2BY3 A;  5F64 A;  1VQ4 I;  2VBZ A;  2RV8 A;  4N9H A;  4IEJ A;  2BBY A;  3G2B A;  4I7H A;  3JRA A;  3HDD A;  3M1E A;  4AIJ A;  5AIQ A;  2WAQ N;  2QWW A;  4DYC A;  3DF8 A;  3K4J A;  4LK0 F;  1YX5 A;  4KIF A;  2ZB9 A;  2X1C A;  2VIX A;  3S15 J;  4NQW A;  4A2U A;  3CLO A;  1FIA A;  2QLZ A;  2I10 A;  1I27 A;  4XKV A;  2FF4 A;  2WWY A;  4P5O A;  1Y0U A;  2CW8 A;  3CUQ C;  4LD5 A;  3SZT A;  2WV0 A;  4EVI A;  4LIT A;  1TTY A;  3BPX A;  2EFW A;  3HKZ N;  1X4O A;  1LDJ A;  2OD5 A;  1X1P A;  3M07 A;  3A01 B;  2V7F A;  4BE2 A;  4BXU A;  4M9X A;  2HQN A;  5J40 A;  4HNU A;  2E2J J;  3EUH A;  5J3L A;  4YFX F;  3ZQH A;  1VZ0 A;  1ON1 A;  4ZYE A;  1SEU A;  2O8K A;  4GXO A;  1FYL A;  4BS9 A;  4L0Z B;  1NK2 P;  3EPZ A;  1IW7 F;  3I4M J;  2ZME C;  3RI4 A;  3K0L A;  2PI0 A;  3GLX A;  4IHT A;  4RAY A;  3VDX A;  2K9S A;  5LFA A;  3GZ5 A;  3FDY A;  2XUB A;  4QPQ A;  2F48 A;  2PQ8 A;  5E1W A;  1YG2 A;  1D0Z A;  2KQR A;  2ZSI B;  4P96 A;  2VC0 A;  2QYO A;  2H6B A;  4DOZ A;  1RET A;  3K4N A;  4RGS A;  4LB6 B;  3J7A Y;  2P0W A;  3O8G A;  2BE5 F;  5BOX A;  2BZT A;  1TW3 A;  2ESN A;  3CCM I;  1WRJ A;  4QPO A;  4BHB A;  3S2H J;  4IKF A;  3S16 J;  4KYW A;  4EM2 A;  3LL7 A;  1RC9 A;  4HW0 A;  2TCT A;  4MFE A;  4PDK A;  2OCE A;  2HTJ A;  1UB9 A;  3GUD A;  3I58 A;  5E3N A;  1Y56 A;  2X85 A;  1VQM I;  1T08 B;  4IOA F;  3EET A;  2KDZ A;  3T5X A;  2W7N A;  3F8F A;  3VOD A;  1HA8 A;  5GP9 A;  3B73 A;  3QU6 A;  4M73 A;  1WJE A;  1MND A;  1B9N A;  3F72 A;  4CYD A;  2VT2 A;  3P7N A;  2AHQ A;  4NC6 A;  1U2W A;  3CJR B;  2R7O A;  5HS8 A;  4KNY A;  3W6J B;  4E7I A;  3OYG A;  3S3N A;  1RR8 C;  2WAQ A;  3WG7 H;  3HOW J;  4RS8 A;  3EQL F;  2ZC2 A;  1W4M A;  1WCM J;  2LKP A;  4IX7 A;  2X9D A;  4YEL A;  2W82 A;  3S14 J;  2ZNY A;  2D1H A;  4GRI A;  4YIF A;  4Y52 J;  2RDP A;  2XB5 A;  3VYS B;  5K5R A;  1IRG A;  1BC7 C;  4BQQ A;  2XGE A;  3JRI A;  4BDY A;  3DTI A;  3IWF A;  3I5U A;  1OCZ H;  1G2H A;  1YJN I;  2K3F A;  3R0J A;  3HPH A;  4P55 A;  2IRF G;  3CDI A;  1VND A;  2CUZ A;  2HZD A;  5HLT A;  5EEA A;  1YOV B;  3V42 A;  1OQY A;  1MGT A;  2DA7 A;  1VFC A;  4I99 C;  1GLN A;  2HVQ A;  5JFR A;  4IHY A;  4A3E J;  4WX9 A;  2B0L A;  3VSK A;  4R79 A;  4U7D A;  1CF7 A;  3W2A A;  2F5E A;  1FOW A;  5IOZ A;  2LFB A;  1UAA A;  1S9H A;  3D5R C;  2NRA C;  1HDP A;  3MKY B;  2VJ5 A;  2LNB A;  4N4N B;  2VKE A;  4P9F A;  5FD5 A;  2ID6 A;  2Y0S A;  2MA3 A;  4D5F A;  3S1R J;  3REO A;  1HW5 A;  4A3J J;  3GME A;  1JKO C;  1ITY A;  3LFU A;  1W5C C;  2STT A;  1R23 A;  2KZG A;  2LK2 A;  1ZHF A;  1HLV A;  2HWV A;  2WV1 A;  5EGO B;  1TWF J;  1H89 C;  3LA2 A;  1TWC J;  1D5Y A;  2CSO A;  2GLO A;  2LY2 A;  3KET A;  4MTE A;  1O3R A;  1A35 A;  3OYB A;  2MD0 A;  1YQA A;  4AYB A;  3JSP A;  1OCO H;  5HDG A;  3DPT A;  3MVP A;  4MGR A;  3WU1 B;  3ZPL A;  2X4H A;  1YIO A;  1FNN A;  1Z0X A;  2XB0 X;  4JK1 X;  2Z16 A;  4JOM A;  1J5Y A;  3TO7 A;  2DT5 A;  2HDW A;  3KX2 A;  5A2Q Z;  1MH4 A;  3OYE A;  5LGU A;  2DA2 A;  4HZF A;  2L4A A;  1YLF A;  3OS2 A;  5CVV A;  2Q0O A;  2X1E A;  5LD2 C;  1Z05 A;  1OFC X;  2EJR A;  3ZMU A;  5HNF A;  4L9V A;  1R22 A;  1I5Z A;  2HNH A;  2W4S A;  5DD4 A;  3S2D J;  2HGC A;  3IRR A;  4IRH A;  1S5L C;  3GW2 A;  5E8G A;  4ENN A;  3I3L A;  5CVR A;  5D8L B;  2HEO A;  4XLA A;  3U9G A;  2QA4 I;  2H94 A;  4XN3 A;  1UG0 A;  3TED A;  2Y9Y A;  5D4S A;  2LP0 A;  3KYL A;  2A69 F;  2KIU A;  1FOK A;  1U8R A;  3H3V K;  3FMS A;  1TNS A;  5FLX K;  2P7C B;  3TW6 A;  3SYT A;  1MDM A;  2D45 A;  1B72 A;  4X1E A;  5H2F C;  2DFF A;  4IQ4 A;  3FM3 A;  3TDZ C;  4OU0 A;  3TP0 A;  5L3C A;  2YX4 A;  1V55 H;  4ZDP A;  2E34 A;  4LIU A;  3FK6 A;  5HS9 A;  5IT3 A;  4EQQ A;  2FOK A;  2PMZ A;  3RSN A;  2WAF A;  1YO5 C;  1HKQ A;  2E19 A;  3NRV A;  2KRH A;  4N0B A;  3DKY A;  3TMO A;  3K70 D;  1XGO A;  3SJM A;  4CA0 A;  3HOU J;  1YX3 A;  1TT0 A;  1JTX A;  3HJE A;  2GAU A;  5GAG J;  4LG3 A;  2UWM A;  2IVM A;  4MQV A;  4JBA A;  5DUI A;  1VQO I;  2MH2 A;  4AWX B;  1LDK B;  1A6I A;  4FT8 A;  2ZJR F;  4UNO A;  2F5D A;  1AHD P;  2ADU A;  4FE4 A;  3RPU A;  3V7R A;  1J09 A;  5ILU A;  5FD6 A;  1BR1 A;  3W3C A;  1UFM A;  4L9N A;  3ZRG A;  2H09 A;  5J47 A;  3QRF F;  3CTA A;  2JWT A;  2MC3 A;  4Y4R A;  1JKQ C;  1H88 C;  2VON A;  2RKH A;  2PN6 A;  2C6Y A;  4KN4 X;  2F4M B;  2FA5 A;  3NQO A;  1LVA A;  2P4W A;  3BR5 A;  4UB8 C;  3K69 A;  5LRR A;  2JVG A;  1DP7 P;  2JQ7 A;  3FHZ A;  3C7J A;  5E17 F;  4DQ2 A;  2KL4 A;  4B44 A;  1LJ9 A;  3H9G A;  2YU9 J;  4XLF A;  1X2N A;  3ZCO A;  5F1J A;  5IYD J;  4ABZ A;  2NS8 A;  5JHU A;  3IAS 2;  4U7B A;  3AAF A;  2EB7 A;  4AID A;  3PSF A;  4M74 A;  1UEL B;  4U88 A;  1YS7 A;  1K78 B;  1C0W A;  3VFZ A;  4UUS B;  3KCC A;  1RES A;  2FX0 A;  2WY7 Q;  4B09 A;  5FRM A;  3CCE I;  3BG5 A;  2QKL B;  3I71 A;  2LOO A;  2RN7 A;  1X1C A;  2R7T A;  4LLG F;  2BEO A;  4HF1 A;  1V3F A;  2NNY A;  2P5L C;  2XAH A;  2NVT J;  4KN7 X;  4NNJ A;  4HPQ A;  5KAF C;  4UY8 I;  2FXA A;  2KPM A;  3FXO A;  1BI3 A;  1K4T A;  3D5S C;  5HOO A;  4IL6 C;  2VC1 A;  3J81 K;  3ECH A;  1AU7 A;  3WTV C;  3MFK A;  3PJR A;  3HRS A;  4RA2 A;  1B72 B;  2DMU A;  3LMM A;  2DPD A;  2WAD A;  1T0F A;  4XK4 A;  5EG0 A;  2JSP A;  2P5V A;  1LUJ B;  1JJ8 C;  3J7Z I;  3IWZ A;  1BW5 A;  3BTI A;  1JUP A;  2FNA A;  2DK5 A;  3ZQQ A;  2M9H A;  3BCA A;  2I8D A;  2ACJ A;  1MJB A;  1K83 J;  4J00 A;  2WB1 A;  4PJ0 C;  2YS9 A;  1Z3Y A;  3HPG A;  3GTG J;  1OIS A;  4FIS A;  4PSW A;  2Y9Z A;  4ENJ A;  1YFH A;  2ZME B;  2R7F A;  1K61 A;  2AXT C;  2VE9 A;  3Q9S A;  4XQF A;  1TNT A;  5GTI C;  2X6O A;  2K86 A;  4UVB A;  1OJL A;  2P6T A;  1ONV A;  4AUX A;  1Z7L A;  3J7Y J;  4HLY A;  4HX8 A;  3H0D A;  1ZRC A;  2WB1 N;  4G7O F;  4PK4 A;  4QTR A;  2XSD C;  1F43 A;  3EUA A;  1T98 A;  2XRL A;  2V1U A;  2DT6 A;  3F21 A;  2HPM A;  2HQR A;  2GXG A;  3FWE A;  4F3Q A;  1WFX A;  3KEY A;  3GFM A;  1FJL A;  3FF5 A;  4JX5 A;  1Y39 A;  1R9T J;  1FEX A;  1PP8 F;  2DOA A;  4L9T A;  4OMZ A;  3HTS B;  2KDO A;  2GOX B;  4Y3O A;  3QPL A;  4UUV A;  2VE8 A;  3CMA I;  1FBU A;  1MNM C;  2XVC A;  4RMN A;  2XF5 A;  1E2X A;  5FO5 A;  2BGC A;  4XLC A;  4YEJ A;  3S1N J;  3BJA A;  1W5S A;  2O03 A;  1Z3X A;  2K9M A;  3DEU A;  1UJ8 A;  1JUM A;  4KJZ A;  2V6E A;  1QHG A;  3JW4 A;  5IY5 H;  3EDP A;  2GXB A;  3OIQ A;  2EIM H;  2R5Y B;  4YG2 F;  2VQC A;  2LYC A;  1L3L A;  2ME6 A;  5ILV A;  4AM3 A;  3H5N A;  2QQA A;  1AOY A;  1Y1V J;  3F23 A;  3FMR A;  3I56 I;  3K10 A;  2CW7 A;  3O3K A;  1NK3 P;  4RB0 A;  3E5Q A;  5D8K B;  1U9N A;  2KIM A;  3C2H A;  4DW6 A;  5EG0 B;  2WBM A;  2XPV A;  4MO7 A;  4ASN A;  2ISZ A;  2MAB A;  2COB A;  2EIK H;  3S32 A;  3VB2 A;  3LOC A;  4S04 A;  1D1B A;  5BNG A;  3GO5 A;  3HHH A;  1J7K A;  1MMD A;  3ZQF A;  2OQG A;  3Q9V A;  3IL2 A;  3JCU C;  2GM4 A;  3RJP A;  2QQB A;  2Z2S B;  2DFI A;  3ESW B;  2DU9 A;  2IP2 A;  1MW7 A;  3SXY A;  1OCT C;  1FYM A;  3DTE A;  2ME0 A;  2MFZ A;  3GCM A;  3HOZ J;  2IPQ X;  4PSX A;  4OIN F;  2L5Q A;  2P5K A;  4FCY A;  3WHC A;  2DI3 A;  3NAU A;  5CLS A;  4MFD A;  4NDL A;  4OOI A;  3N05 A;  2ZXI A;  2P6S A;  3T0Y A;  2EH3 A;  3KP5 A;  1JTY A;  4EV0 A;  2PG4 A;  2IAI A;  4IVN A;  1ZR4 A;  4BAY A;  1ORK A;  2BY1 A;  3JRE A;  2G7H A;  1IJW C;  2QKM B;  4UXN A;  1R1V A;  3O8H A;  1G3T A;  1WKM A;  5JVT A;  1XDU A;  2TDX A;  3E7L A;  5IP6 A;  1VQ5 I;  5KNL A;  1O57 A;  3FX3 A;  3D0S A;  1DUX C;  3KP6 A;  2R5Z B;  3FXR A;  5J1U A;  2V9P A;  1UZC A;  3MWM A;  5D4R A;  1NTC A;  4UUT A;  4EMS A;  2DTR A;  1IC8 A;  2W84 A;  1DPU A;  1YIT I;  2H8R A;  1ZAO A;  1R36 A;  2VN2 A;  3S3O A;  4CO8 A;  2XAJ A;  4HX4 A;  4C2T A;  1U78 A;  4ZYH A;  1OYW A;  1YW8 A;  1IO2 A;  2F2E A;  3DEE A;  2MD5 A;  3HC7 A;  5FKO A;  4A3B J;  1IXR C;  4BQO A;  3K4L A;  2K7L A;  4CZC A;  3B02 A;  3E3V A;  4KT6 A;  2ZFW A;  2BW3 B;  2OJE D;  3E5U A;  3RKX A;  2VJJ A;  5EEG A;  2GBY A;  1YS6 A;  4DIQ A;  1JHH A;  4IRI A;  3BP8 A;  2KIQ A;  5HLH A;  2H1K A;  1HC8 A;  2Z3Y A;  5M5W J;  3M7G A;  3K2A A;  1E3P A;  3RZO J;  5DTD A;  4E4H A;  4HNV A;  2ZFU A;  2NVY J;  1MMS A;  1G3S A;  2JN6 A;  1MBK A;  1SMT A;  1ETK A;  2Z1D A;  2JRM A;  2K9N A;  2EBI A;  1OMI A;  4MEX F;  4M3B A;  2MSY A;  3HL2 A;  1GHC A;  1FC3 A;  1D8K A;  1JXS A;  2KLO A;  4QWQ A;  4MNU A;  4Q48 A;  3SDG A;  5L3B A;  5L3G A;  2IXS A;  2PJP A;  3IH3 A;  4A3M J;  5JHF A;  3HOT A;  1X1A A;  3DV8 A;  3A01 A;  3DKX A;  3HRT A;  4M9Z A;  4BNC A;  3F6O A;  1RKT A;  4A6D A;  2X6X A;  3F8B A;  2V1D A;  1DQU A;  4NB5 A;  3A1Y A;  3MQ0 A;  1VQ8 I;  5ICC A;  5KVR A;  2MGQ A;  2DOF A;  2E1M C;  3CCU I;  4XSZ F;  3MZ8 A;  2EV6 A;  3UKG A;  3KYC B;  3RYR A;  4KDP A;  1Z77 A;  2CWE A;  2KZV A;  1Y8R B;  1TWA J;  2GOM A;  4L5E A;  1WJB A;  3L00 A;  5J4V A;  2NVX J;  1B8I B;  1ZLK A;  3GZ6 A;  2E2H J;  1RUN A;  1MKM A;  1QHH D;  2G9W A;  2OCC H;  3CES A;  3OYH A;  5E18 F;  4HDV A;  4G8X A;  4IPA A;  5EZG A;  5LHI A;  3H9J A;  3RZD J;  2KJB A;  3G3Z A;  1BN5 A;  2KFD A;  1R5I D;  1Z9C A;  1SFO J;  2DN0 A;  5AIP A;  4R8H A;  3M4O J;  3JR9 A;  2BHY A;  1DPR A;  2OTL I;  3CLQ A;  1WI9 A;  2M3A A;  1WJD A;  2JRT A;  1KQ8 A;  1HKT A;  4XM3 A;  4U0Y A;  2PJR B;  2EFN A;  3A02 A;  1TW2 A;  5EYR A;  4ZYG A;  5F04 A;  3JTH A;  1MZB A;  1FP1 D;  3CUQ B;  4MHG A;  3VYT B;  1SFX A;  1F5T A;  2FML A;  2NOJ B;  3HBL A;  5EF6 A;  1V54 H;  2STW A;  5ICG A;  5FKM A;  2Y69 H;  1WJA A;  3ROU A;  3FXK A;  4G6D A;  1IV8 A;  1XMX A;  4D5C A;  2QUF A;  2VOO A;  3G73 A;  3HM5 A; 
#chains in the Genus database with same CATH homology
 1FP2 A;  3ZMV A;  3ZN1 A;  1TBX A;  4AD9 A;  2CO5 A;  4I0A A;  3FXQ A;  4U0W A;  1ZG1 A;  4IF4 A;  1S3J A;  3QPH A;  3I59 A;  1XGM A;  4PZJ A;  2G7U A;  1RZ4 A;  1OYY A;  4KIG A;  1FPQ A;  1KYW A;  4GYG A;  3RTR A;  1UST A;  4HBL A;  5DCF A;  2F5C A;  4AVP A;  1GXP A;  3L7W A;  2A68 F;  2KKO A;  2VBW A;  2WTE A;  2M87 A;  4BHC A;  5D5V B;  4LG0 B;  3IHU A;  3PQK A;  5HVQ C;  4A0Z A;  3U1D A;  1P4X A;  5F6F A;  4S05 A;  4HX7 A;  1FT9 A;  1BOA A;  3BWG A;  1G6N A;  3LFK A;  1SD4 A;  4KFC A;  4AIH A;  3SFZ A;  3QP6 A;  4BYY A;  4HYE A;  3WTU C;  2IT0 A;  4G6Q A;  3BZ6 A;  1MJ9 A;  4LFU A;  3QAH A;  4CZZ A;  4CHU A;  5DDG A;  4OMY A;  3O6B B;  4CGZ A;  4XBF A;  1KU7 A;  4EJW A;  2RVC A;  2KRF A;  2A07 F;  1ZRE A;  5IT9 Z;  2DQL A;  4EJO A;  2O61 A;  3HTU A;  2M8E A;  2FEZ A;  2AS5 F;  3HSF A;  5ICE A;  1I6X A;  3RPQ A;  3LST A;  1SD7 A;  1JE8 A;  1K6O A;  3BJO A;  5FFZ A;  4A5N A;  1U5T C;  3I59 B;  1IXS B;  1S7A A;  3I54 A;  1FWZ A;  4D0P A;  1W7P A;  3J7A O;  2M45 A;  2Q8K A;  3E6B A;  4O5V A;  1AWC A;  1XCV A;  3L2C A;  1IN5 A;  1QQI A;  4UVC A;  3DKW A;  2QZ8 A;  2MH9 A;  2GWR A;  1DDN A;  4ESJ A;  3I53 A;  1J0R A;  1F9N A;  4ZZD A;  3BOQ A;  5DV5 A;  4LJZ F;  4A5M A;  1S8N A;  1FBS A;  1FBQ A;  3JSO A;  1HSJ A;  2UXX A;  2RQP A;  3T1B A;  2NNN A;  4HF2 A;  1IN4 A;  1FY7 A;  1V4R A;  3WTW C;  3R6S A;  3L9F A;  1WQ2 A;  2O8X A;  1EH6 A;  4P9U A;  2QEN A;  4BHP A;  5HLI A;  1IXC A;  2VBY A;  1ZN2 A;  3OV8 A;  2OQR A;  5DCM A;  2W85 A;  4Q5S F;  3TGN A;  1R5G A;  3LA3 A;  3E6M A;  2EFQ A;  1HW2 A;  4K2E A;  2LF7 A;  3J80 K;  5J8C A;  1MDM B;  5E8I A;  4G7H F;  3QU3 A;  2HDC A;  5HS7 A;  2Z9O A;  2FMY A;  1D5V A;  3ZMZ A;  3M8E A;  1NHA A;  3TKY A;  1L0O C;  2UZK A;  1CGP A;  2W57 A;  3K1N A;  2W24 A;  1JHF A;  2FBI A;  4N9I A;  3F3X A;  2JSC A;  3KP4 A;  2YX7 A;  2M5W A;  1S29 A;  2VXZ A;  2K4J A;  2O0Y A;  1O7L A;  4HOB A;  3J80 Z;  4M6X A;  1TQI A;  4EGY A;  4UHT A;  5D5W B;  2KJC A;  3C3W A;  1RUO A;  2ZNZ A;  1T2K A;  2P8T A;  3TOA A;  4CDG A;  5L3E A;  3KLO A;  5LHH A;  1STZ A;  1D8J A;  1P6R A;  4XSX F;  1I1S A;  4MTD A;  2VBX A;  3FXU A;  3VOE A;  1J75 A;  1QBJ A;  5J6X A;  5TRD A;  4ETS A;  2PMU A;  1VTN C;  4QLC U;  1IAW A;  4OIQ F;  1Z6R A;  4Y15 A;  3S2W A;  4EJV A;  1EH7 A;  1S7O A;  4E70 A;  1XGN A;  1EV7 A;  2XHK A;  1R00 A;  4I2O A;  4HF0 A;  1TLH B;  2L54 A;  3WOD F;  1RI7 A;  3TDU C;  3ZMT A;  3P9K A;  2HFH A;  2E1N A;  1G3W A;  2PFB A;  5ED4 A;  2CGP A;  4WXH A;  3I64 A;  3IRQ A;  2HKO A;  1O3T A;  3WE3 A;  4EJU A;  2VOD A;  2M30 A;  3M8F A;  4KIB A;  4L5J A;  4FX4 A;  2CYY A;  2XAG A;  4ESB A;  3F8C A;  4TV7 A;  4YFN F;  1XSV A;  3RKW A;  3IKT A;  3K1P A;  2DAO A;  2IW5 A;  3ECO A;  1KU2 A;  1J59 A;  1HW1 A;  3HRU A;  3R0A A;  1XMA A;  2DW4 A;  1H9T A;  3GFI A;  1WWX A;  1Z1D A;  4WXC A;  2CQK A;  2FU4 A;  1W5T A;  3ISP A;  4EJT A;  2PEX A;  1F4K A;  4M9S A;  3R61 A;  3ZN0 A;  5LLQ A;  5D5U B;  3HHG A;  3HUG A;  2FBH A;  5AON A;  4OIR F;  4UVA A;  4ENM A;  4O6J A;  5LBQ A;  5IT9 K;  1YTY A;  3V7C A;  2ISY A;  2OAZ A;  1IUY A;  1ODD A;  3CO7 C;  4IHS A;  4M72 A;  1XMK A;  1H9G A;  3O2P E;  2OU2 A;  1SFU A;  2QBY B;  3WTZ A;  2IA2 A;  2OZ6 A;  1TQM A;  2PLY A;  4FHT A;  1I1G A;  1SMY F;  3Q5F A;  4HA8 A;  3D5L A;  2JT1 A;  4O3M A;  3E6D A;  2IA1 A;  5K5O A;  4ENK A;  1ON2 A;  4Z2Y A;  4KMU X;  3SHF A;  3WGH A;  1B1B A;  2HTS A;  3V8L A;  2MLK A;  1QZY A;  2FRH A;  1ZH5 A;  3KLN A;  4XRF A;  4A0Y A;  3GX4 X;  2HS5 A;  2V1X A;  4Y13 A;  3CO6 C;  4PGG A;  1T38 A;  5BQT A;  3BDD A;  1ZLJ A;  1Q1H A;  2MLG A;  4HDU A;  2EV5 A;  2H6C A;  1T6S A;  2EV0 A;  1K7A A;  1P2F A;  1KU9 A;  3WTY C;  2BYV E;  2RC4 A;  2YSR A;  5L3F A;  2EA4 A;  2JZY A;  3QOP A;  2NAZ A;  1Z7U A;  4A0X A;  2L3D A;  4LLL A;  4KUM A;  1ZG5 A;  3T8R A;  3H3U A;  1FX7 A;  2GA1 A;  4FX0 A;  1GVJ A;  2QBY A;  5LRS A;  1QPM A;  5A2Q K;  2R3S A;  2FSW A;  4OIP F;  5H6Q A;  5JI6 A;  3VEP A;  5H6R A;  1K79 A;  1SFE A;  4I98 B;  4BQA A;  3E97 A;  3WTS C;  1G4D A;  2CFX A;  3LWF A;  5BPI A;  3I0T A;  2K4B A;  3MAJ A;  4MQ9 F;  4XLN F;  3TOB A;  2D1V A;  3PQJ A;  2XIG A;  4RAZ A;  3V8K A;  5E1X A;  1F1Z A;  3V4G A;  4JQF A;  3J81 Z;  4ON0 A;  2GZW A;  3BRO A;  5K1Y A;  1U3E M;  4GGG A;  4I02 A;  2XAQ A;  3HSR A;  3F6V A;  3ERE D;  3HYI A;  2OA4 A;  3KP7 A;  2A3S A;  3WTT C;  4G7Z F;  2HKX A;  1P4W A;  4RB3 C;  1MJA A;  3TQN A;  3H3Z A;  1FZP B;  3F22 A;  3FZV A;  2HOE A;  2PMH A;  3KZZ A;  2ZJ2 A;  1LEA A;  3DP7 A;  2RGV A;  4WCG A;  5L3D A;  4LMY A;  5DYM A;  3CUQ A;  2YU3 A;  1QNT A;  4RGU A;  1USS A;  2XKO A;  6PAX A;  2A5Y B;  3TO9 A;  4DNC A;  2V9V A;  5CVU A;  4I0B A;  4IRG A;  3WGI A;  2QVO A;  1BJA A;  2XV4 S;  1B6A A;  3V8J A;  2OZU A;  4A12 A;  1KU3 A;  1XB4 A;  4KA4 A;  5ERI A;  5FGM A;  2DK8 A;  4HV6 A;  2LDU A;  3KE2 A;  2HZT A;  2L4M A;  1R1U A;  2XRO A;  5TJJ A;  3ELK A;  5LEJ A;  1O7F A;  1B4A A;  2Y75 A;  2A61 A;  5HDN A;  4BH9 A;  2OBP A;  4Q47 A;  3QP5 A;  3FM5 A;  2FNP A;  1X3U A;  2HR3 A;  2PBI A;  2E1C A;  1LEB A;  1U6G A;  3GF2 A;  2LF8 A;  1HST A;  3FMQ A;  3BY6 A;  3C18 A;  3E6C C;  1W7P D;  1K78 A;  1R7J A;  4HQM A;  5DCM B;  4UV9 A;  2Z33 A;  4F7Z A;  3GFL A;  1KYZ A;  4UV8 A;  4I09 A;  3E5X A;  1B59 A;  4U0V A;  3F8M A;  1UCR A;  2Y48 A;  3HIF A;  4WF2 A;  3LQQ A;  2F5F A;  3ZP5 A;  1U5T A;  1R5H A;  4ZZL A;  2L01 A;  2ZCW A;  3CDH A;  1FSE A;  4GYI A;  4Y17 A;  5BPD A;  1HBX G;  5BMZ A;  4H0E A;  3LA7 A;  5F1R A;  2FBK A;  2A6E F;  4KMF A;  2O3F A;  3JTG A;  1PP7 U;  4RGR A;  2RNJ A;  1XCB A;  2D2W A;  3HSE A;  2ZO4 A;  2COM A;  1LNW A;  2JTV A;  4GO1 A;  2CG4 A;  3HOS A;  3QPT A;  2YPR A;  3BJ6 A;  3EYI A;  1OKR A;  1QZZ A;  4PGH A;  2ZKZ A;  2LSO A;  1KQ9 A;  2GA2 A;  4EGZ A;  1ULY A;  1S6L A;  1KA8 A;  4HAM A;  4HLX A;  4LLN A;  1YYV A;  2ELH A;  1ZRF A;  2P7V B;  1HKS A;  5LEK A;  1Z6T A;  1J2X A;  2HYF A;  3F8N A;  3CJN A;  1O3Q A;  2BV6 A;  3SQN A;  2FQ3 A;  1HQC A;  2Q2E A;  2WC2 A;  2XKP A;  3GEZ A;  3CUO A;  3RKY A;  1XD7 A;  2ETH A;  4LG0 A;  5FFX A;  5CVJ A;  5DEQ A;  2E7X A;  3W6K B;  1RIO H;  2ZBK A;  5E20 A;  5FB2 A;  1H0M A;  1HXD A;  3TO6 A;  3LQR A;  2NYX A;  3IC7 A;  2ESH A;  3DQV C;  2XAS A;  2DLL A;  2R7D A;  2UXN A;  2EFP A;  4LK1 F;  3DFG A;  4L18 B;  4ZH4 F;  1TQP A;  3H92 A;  3HRM A;  5D5X B;  2YR2 A;  2JPC A;  2NS0 A;  4ZYD A;  2EWN A;  3WG9 A;  4G94 A;  3ZMD A;  4L0Y B;  1XDS A;  4MEY F;  4WWC A;  3N97 A;  1YW9 A;  3MCZ A;  4A6E A;  4WK8 F;  3SZP A;  5H20 A;  1T39 A;  4GCV A;  4L9J A;  1UHM A;  1GXQ A;  4NHJ A;  1P92 A;  2CW0 F;  1BC8 C;  5JR3 A;  3U2R A;  3K9T A;  3L09 A;  1Z91 A;  1FLI A;  4EM0 B;  3ULQ B;  2XGX A;  1LDD A;  1MD0 A;  3ABT A;  3PFI A;  5E1Z B;  2DPU A;  3C1D A;  2DO7 A;  1EH8 A;  1OR7 A;  2Y0M A;  1RNL A;  3MEX A;  4M6Y A;  1BI0 A;  1U5T B;  5CJ9 A;  5EEH A;  3GXO A;  5ICF A;  1JGS A;  5KK1 A;  1D3Y A;  1ZGJ A;  4HQE A;  1ZGA A;  3KP2 A;  3EYY A;  3IKV A;  3R4K A;  4PCQ A;  3R60 A;  5J8F A;  1BI2 A;  1IRF A;  1ZRD A;  1ZYR F;  1J9I A;  1LB2 A;  2VOP A;  1QGP A;  2AXL A;  1XN7 A;  3KZY A;  2VT3 A;  3I4P A;  1A04 A;  1KQ0 A;  4IJA A;  2GIV A;  2MBF A;  2K27 A;  1IN8 A;  4CIC A;  4OIO F;  2HYG D;  1BBY A;  5DUK A;  3WE2 A;  3RDI A;  1OPC A;  3K1M A;  4RGX A;  1SD6 A;  2IA0 A;  1IZ1 A;  3RYP A;  1ZAR A;  3RIR A;  3LAJ A;  1W7P B;  3JAM Z;  4EM1 A;  1PDN C;  1FYK A;  1SD5 A;  1O3S A;  1OYI A;  2DBB A;  3KEO A;  1CF7 B;  3N4M A;  2IJL A;  1QO0 D;  1BIB A;  3KFW X;  5D6F A;  4LGW A;  2V79 A;  4CXF A;  2Z5U A;  3NEU A;  4XLP F;  3GWZ A;  2EK5 A;  1XGS A;  3KP3 A;  5CYV A;  1XSD A;  4KIC A;  2V6C A;  5K5Q A;  1BM9 A;  1REP C;  2DQR A;  1IF1 A;  4AIK A;  2JPB A;  1YW7 A;  3OOP A;  3P9C A;  3K2Z A;  2K02 A;  3ABU A;  4I01 A;  2M1B A;  4G9Y A;  5BS6 A;  1R58 A;  4HV5 A;  3T8T A;  1R1T A;  2FE3 A;  1BIA A;  4IXA A;  4YFK F;  2QQ9 A;  4YII A;  2J5O A;  4RB2 C;  2XRN A;  1LQ1 A;  1G3Y A;  2EFO A;  3P9I A;  3MZH A;  4ESF A;  4LB5 A;  3WGG A;  2J5P A;  5FLX Z;  1E17 A;  5HDK A;  3WU0 A;  3WTX C;  3GVA A;  4M71 A;  3GFJ A;  3ML6 A;  1IN6 A;  2H27 A;  4WXD A;  4R1H A;  2EA2 A;  3GYH X;  1SAX A;  1KGS A;  2A6H F;  5ILS A;  3LAP A;  2W25 A;  3KEQ A;  5DD8 A;  1BI1 A;  2X0L A;  5HLG A;  5CVI A;  2XAF A;  5LGT A;  2ZXJ A;  5D6E A;  4KT5 C;  1XSX A;  3M9A A;  3BPV A;  2KIF A;  2QM3 A;  1IN7 A;  3DXJ F;  3V7S A;  2ZME A;  3ZQ7 A;  1ZG3 A;  4MEX F;  3COA C;  4Q4Z F;  2GQQ A;  3DPL C;  1WSU A;  4RB1 A;  1FSH A;  2O6G E;  2Z99 A;  3MZY A;  4L5I A;  1PUE E;  1B9M A;  5LHG A;  2E7W A;  3ZMS A;  1UHW A;  3JAM K;  5LGN A;  1P4A A;  4B8X A;  5F64 A;  2VBZ A;  2RV8 A;  4N9H A;  2BBY A;  4I7H A;  3M1E A;  4AIJ A;  5AIQ A;  2QWW A;  3DF8 A;  4LK0 F;  4KIF A;  4NQW A;  4A2U A;  3CLO A;  2QLZ A;  1I27 A;  2FF4 A;  2WWY A;  4P5O A;  1Y0U A;  3CUQ C;  4LD5 A;  3SZT A;  2WV0 A;  4EVI A;  1TTY A;  3BPX A;  2EFW A;  2OD5 A;  1LDJ A;  4BXU A;  4M9X A;  2HQN A;  3EUH A;  4YFX F;  1ON1 A;  4ZYE A;  4GXO A;  1FYL A;  4L0Z B;  1IW7 F;  3RI4 A;  3K0L A;  2PI0 A;  3GLX A;  4IHT A;  4RAY A;  3GZ5 A;  2XUB A;  2PQ8 A;  5E1W A;  1YG2 A;  4P96 A;  2VC0 A;  2QYO A;  2H6B A;  4RGS A;  4LB6 B;  2BE5 F;  5BOX A;  2ESN A;  1TW3 A;  1WRJ A;  4BHB A;  4KYW A;  4EM2 A;  4HW0 A;  4PDK A;  2HTJ A;  1UB9 A;  3GUD A;  3I58 A;  3EET A;  3T5X A;  3F8F A;  3VOD A;  3B73 A;  3QU6 A;  4M73 A;  3F72 A;  1B9N A;  4CYD A;  2VT2 A;  3P7N A;  1U2W A;  5HS8 A;  4KNY A;  3W6J B;  4RS8 A;  3EQL F;  1W4M A;  2LKP A;  2ZNY A;  2D1H A;  4YIF A;  2RDP A;  5K5R A;  1IRG A;  1BC7 C;  3IWF A;  3I5U A;  3R0J A;  4P55 A;  2IRF G;  1MGT A;  5JFR A;  4WX9 A;  2B0L A;  4R79 A;  4U7D A;  1CF7 A;  2F5E A;  2NRA C;  2LNB A;  4P9F A;  5FD5 A;  2MA3 A;  3REO A;  1HW5 A;  2STT A;  1R23 A;  1ZHF A;  2HWV A;  3LA2 A;  2CSO A;  3KET A;  4MTE A;  1O3R A;  1YQA A;  3JSP A;  5HDG A;  3DPT A;  4MGR A;  3WU1 B;  3ZPL A;  2X4H A;  1YIO A;  1FNN A;  4JK1 X;  1J5Y A;  3TO7 A;  2DT5 A;  5A2Q Z;  5LGU A;  4HZF A;  2L4A A;  1YLF A;  5CVV A;  2Q0O A;  1Z05 A;  2EJR A;  3ZMU A;  4L9V A;  1R22 A;  1I5Z A;  5DD4 A;  2HGC A;  3IRR A;  4IRH A;  3GW2 A;  5E8G A;  4ENN A;  5CVR A;  5D8L B;  2HEO A;  3U9G A;  2H94 A;  5D4S A;  2A69 F;  2KIU A;  1FOK A;  1U8R A;  3FMS A;  1TNS A;  5FLX K;  2P7C B;  1MDM A;  2D45 A;  3TDZ C;  3FM3 A;  4OU0 A;  5L3C A;  2YX4 A;  5HS9 A;  5IT3 A;  4EQQ A;  2FOK A;  1YO5 C;  1HKQ A;  3NRV A;  4N0B A;  1XGO A;  2GAU A;  2UWM A;  2IVM A;  4MQV A;  4JBA A;  5DUI A;  2MH2 A;  4AWX B;  1LDK B;  4FT8 A;  4UNO A;  2F5D A;  2ADU A;  3RPU A;  3V7R A;  5ILU A;  5FD6 A;  1UFM A;  4L9N A;  2H09 A;  3QRF F;  3CTA A;  2MC3 A;  2VON A;  2RKH A;  2PN6 A;  2C6Y A;  4KN4 X;  2FA5 A;  3NQO A;  1LVA A;  2P4W A;  3K69 A;  5LRR A;  1DP7 P;  5E17 F;  3FHZ A;  3C7J A;  4DQ2 A;  1LJ9 A;  4U7B A;  5JHU A;  3AAF A;  2EB7 A;  4M74 A;  4U88 A;  1YS7 A;  1K78 B;  1C0W A;  3VFZ A;  3KCC A;  4B09 A;  3I71 A;  2RN7 A;  4LLG F;  2BEO A;  4HF1 A;  1V3F A;  2NNY A;  2P5L C;  2XAH A;  4KN7 X;  2FXA A;  1BI3 A;  5HOO A;  2VC1 A;  3J81 K;  3ECH A;  3WTV C;  3MFK A;  3HRS A;  2DPD A;  1T0F A;  2P5V A;  3IWZ A;  2FNA A;  2DK5 A;  2ACJ A;  1MJB A;  4ENJ A;  1YFH A;  2ZME B;  2R7F A;  2VE9 A;  3Q9S A;  1TNT A;  2K86 A;  4UVB A;  2P6T A;  1ONV A;  4HLY A;  4HX8 A;  1ZRC A;  4G7O F;  1T98 A;  2V1U A;  3F21 A;  2HQR A;  2GXG A;  3FWE A;  3GFM A;  3FF5 A;  1PP8 F;  4L9T A;  4OMZ A;  3HTS B;  4UUV A;  2VE8 A;  1FBU A;  2XVC A;  1E2X A;  5FO5 A;  2BGC A;  3BJA A;  1W5S A;  2O03 A;  3DEU A;  3JW4 A;  3EDP A;  2GXB A;  4YG2 F;  1L3L A;  5ILV A;  2QQA A;  1AOY A;  3F23 A;  3FMR A;  3O3K A;  4RB0 A;  3E5Q A;  5D8K B;  2KIM A;  4ASN A;  2ISZ A;  3VB2 A;  4S04 A;  3GO5 A;  1J7K A;  3HHH A;  3IL2 A;  2OQG A;  3Q9V A;  3RJP A;  2QQB A;  2DFI A;  2DU9 A;  2IP2 A;  3SXY A;  1FYM A;  2IPQ X;  4OIN F;  2P5K A;  2DI3 A;  5CLS A;  4OOI A;  2P6S A;  3T0Y A;  3KP5 A;  4EV0 A;  2PG4 A;  4IVN A;  4BAY A;  2G7H A;  4UXN A;  1R1V A;  1G3T A;  1WKM A;  5JVT A;  1XDU A;  2TDX A;  1O57 A;  3FX3 A;  3D0S A;  1DUX C;  3KP6 A;  3FXR A;  3MWM A;  5D4R A;  4EMS A;  2DTR A;  2W84 A;  1DPU A;  1ZAO A;  1R36 A;  2VN2 A;  4CO8 A;  2XAJ A;  4HX4 A;  1U78 A;  4ZYH A;  1OYW A;  1YW8 A;  2F2E A;  2MD5 A;  1IXR C;  2K7L A;  3B02 A;  3E3V A;  2ZFW A;  3E5U A;  3RKX A;  5EEG A;  1YS6 A;  1JHH A;  4IRI A;  3BP8 A;  5HLH A;  2Z3Y A;  3M7G A;  1G3S A;  1SMT A;  1OMI A;  1GHC A;  1FC3 A;  1D8K A;  1JXS A;  4QWQ A;  4MNU A;  4Q48 A;  5L3B A;  5L3G A;  2PJP A;  3HOT A;  3DV8 A;  3HRT A;  4M9Z A;  4BNC A;  3F6O A;  4A6D A;  3F8B A;  2V1D A;  4NB5 A;  3MQ0 A;  5ICC A;  5KVR A;  4XSZ F;  2EV6 A;  3RYR A;  4KDP A;  2CWE A;  3L00 A;  1ZLK A;  3GZ6 A;  1RUN A;  1MKM A;  2G9W A;  5E18 F;  4HDV A;  4G8X A;  4IPA A;  5LHI A;  2KJB A;  3G3Z A;  1BN5 A;  1Z9C A;  5AIP A;  4R8H A;  1DPR A;  1WI9 A;  2JRT A;  1KQ8 A;  1HKT A;  4U0Y A;  2EFN A;  1TW2 A;  4ZYG A;  3JTH A;  1MZB A;  1FP1 D;  3CUQ B;  4MHG A;  1SFX A;  1F5T A;  2FML A;  2STW A;  5ICG A;  3ROU A;  4G6D A;  2QUF A;  2VOO A;  3G73 A;  2L02 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...