4AIKA

Crystal structure of rova from yersinia in complex with an invasin promoter fragment
Total Genus 52
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
52
sequence length
139
structure length
139
Chain Sequence
STLGSDLARLVRVWRALIDHRLKPLELTQTHWVTLYNINRLPPEQSQIQLAKAIGIEQPSLVRTLDQLEEKGLITRHTSANDRRAKRIKLTEQSSPIIEQVDGVISSTRKEILGGISSDEIAVLSGLIDKLEKNIIQLQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural Basis for Intrinsic Thermosensing by the Master Virulence Regulator Rova of Yersinia.
pubmed doi rcsb
source organism Yersinia pseudotuberculosis
molecule tags Transcription
molecule keywords TRANSCRIPTIONAL REGULATOR SLYA
total genus 52
structure length 139
sequence length 139
chains with identical sequence B
ec nomenclature
pdb deposition date 2012-02-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01047 MarR MarR family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 4aikA00
5LHGA 1XMKA 1IN7A 4MNUA 3ZMTA 1RZ4A 3NRVA 1PUEE 4CHUA 1S29A 2HR3A 4I02A 5CVJA 1YTYA 3ABUA 1KQ8A 2F5DA 2PBIA 2VBWA 4ESFA 2HWVA 2YR2A 3C3WA 1S6LA 1KYWA 2PEXA 2FBHA 1ZLJA 1F4KA 2EWNA 1OYWA 4P55A 1K6OA 1I6XA 3GEZA 3COAC 1IAWA 1DDNA 2J5OA 2QUFA 4L9JA 2UXNA 2W84A 1D8KA 2J5PA 5E18F 1R1VA 3F22A 3KP5A 2V1UA 3IKVA 4OIRF 3I5UA 5D5UB 3K9TA 3LFKA 1HSTA 1USTA 4ENKA 2XKPA 4ASNA 4KN4X 3KLOA 1LEAA 2Y75A 3R61A 4B09A 5IT9K 2IJLA 1IN6A 1JGSA 2PFBA 3SHFA 4UUVA 3V7RA 2COMA 3ZMUA 5HVQC 1BI1A 3J81K 1ZHFA 5D8KB 1J9IA 1XMAA 2P6TA 1SD4A 3GFIA 1TBXA 1RIOH 3QPTA 5HOOA 3WE3A 4HOBA 2PN6A 4ZYHA 5E17F 4BHPA 1F9NA 5FLXZ 3WTWC 1KA8A 3LAJA 4GGGA 2PG4A 3VOEA 1FOKA 2O61A 3FXRA 2ZFWA 1ZREA 1XSVA 1XDSA 3SQNA 1GVJA 3C1DA 4FX0A 5E1ZB 5FB2A 1SFUA 2WWYA 2VT2A 1FPQA 4L0ZB 2ESNA 3K0LA 3HOTA 3BDDA 3KP7A 1R5HA 3GVAA 1YLFA 2KKOA 1P4XA 4RB1A 2W85A 2QWWA 2ELHA 3WG9A 3TGNA 4A12A 1JXSA 2FMYA 4HF1A 5DUIA 1J2XA 3JTHA 2RDPA 3L7WA 3WGHA 2WV0A 1UCRA 4KMFA 1J59A 2FBIA 2GXBA 2YX7A 4YFXF 2FF4A 2DO7A 4WXHA 3TOBA 2BE5F 4XSXF 5E1XA 2VBXA 2HQNA 4KFCA 2UWMA 3WTTC 4ON0A 1ZRDA 1D8JA 5K5QA 3F3XA 2P7CB 2VC1A 4HQMA 5ERIA 4HV6A 4KIGA 1R58A 2EK5A 1IXSB 5KK1A 1R22A 3HIFA 2VONA 2A6HF 3G3ZA 2MH9A 2XAQA 4XRFA 1DPUA 1O3QA 4EJTA 2G9WA 3BPXA 1SFXA 5DDGA 2NS0A 2XASA 1G3SA 1IRFA 3JTGA 3IWFA 1H9TA 1GXQA 2ISZA 3GWZA 5FFXA 1ULYA 2CO5A 3ZMDA 1KYZA 2ZO4A 1HSJA 4EM2A 2D1VA 2A3SA 5JR3A 3N4MA 4XLPF 2H6BA 1E17A 2F5FA 1QBJA 1KGSA 5E8IA 1W7PB 1STZA 1BI0A 4HQEA 2IA0A 1R1UA 1ZG1A 2Z33A 4UVCA 3H92A 4P9FA 4AIJA 1J0RA 3HTSB 3CUQB 2BYVE 3DF8A 2FA5A 5K5RA 2H27A 4P96A 3B73A 2K27A 1B1BA 2FOKA 4NHJA 2DK8A 3CJNA 1IXCA 2CSOA 4U0YA 1J5YA 4LLNA 4A2UA 2EFOA 4IRIA 3F8FA 1XGOA 5DUKA 2MA3A 1JHHA 3G73A 4U0WA 2HS5A 4HA8A 2DBBA 4DQ2A 1FZPB 2KIMA 5CVIA 5DCMA 5DCMB 5HDNA 1YG2A 1HW1A 1Z1DA 2FSWA 2ZNYA 3I54A 2ZCWA 3BJ6A 3FHZA 2WTEA 4LB6B 1V3FA 2P5VA 3R4KA 2XAJA 1WSUA 3F8BA 4HLXA 1ZRFA 4AVPA 3SZPA 3TO9A 5FO5A 4S04A 1XN7A 4JBAA 3OOPA 1U2WA 1T39A 5DEQA 3LA7A 2GA2A 3O6BB 2RNJA 4ETSA 4M71A 1FC3A 5K1YA 5HDKA 2C6YA 5ICCA 1SMYF 4G8XA 4CGZA 4NQWA 4TV7A 4RS8A 2MLKA 3TO7A 4DNCA 5L3DA 3DFGA 1WQ2A 4KMUX 1FNNA 5AIPA 1RI7A 2OZ6A 2LDUA 5F6FA 5H20A 3KP4A 4RGUA 4AIKA 4OIPF 4KDPA 4ENJA 5ILSA 3WGGA 2EA4A 1XDUA 4LK1F 2CFXA 4EJWA 1NHAA 2HTSA 1FT9A 3LA2A 3OV8A 4L0YB 1QGPA 5HS8A 2Z99A 5D4RA 4BYYA 3KFWX 2JSCA 1CF7A 2VOPA 2JPBA 1U5TA 4KT5C 3WTUC 2NAZA 4Z2YA 3KZYA 1W4MA 5HS9A 3FMQA 5LHIA 3FXUA 3R60A 1HKSA 1QZZA 5LHHA 4HX4A 4HYEA 2H09A 4KNYA 5CYVA 3U9GA 1ZG3A 3FMSA 4MQVA 1D5VA 4YFNF 3ROUA 2RKHA 1TW3A 4I98B 3GO5A 1YFHA 5DV5A 4HZFA 4Q48A 4ZYEA 2DPUA 2M5WA 3T0YA 4UV9A 4M9XA 3CUQC 1HW2A 3BJOA 3FM3A 3I58A 4RGRA 4U7BA 5BMZA 1ODDA 5E8GA 2X0LA 2F5EA 2V1DA 3DEUA 2ADUA 2OU2A 4R1HA 3KP2A 1G3YA 3F8MA 4EJVA 1YS7A 1HKQA 2B0LA 3ECOA 4WXDA 1Y0UA 3JSPA 2GZWA 1FYMA 2RGVA 1OR7A 3RPUA 2HTJA 2QQ9A 1PP8F 2DAOA 1ZAOA 2OBPA 2XKOA 2FU4A 2R3SA 3GFJA 1I1GA 1VTNC 5D6FA 3I59B 2L01A 3IL2A 4Y15A 2QZ8A 1U6GA 1W7PD 2MLGA 4QWQA 3E97A 2DTRA 3KP3A 1S8NA 4HW0A 1JE8A 1QPMA 3PFIA 2P4WA 4EVIA 3WE2A 4LJZF 3E5XA 2EV5A 1I5ZA 1MKMA 4GYIA 1S7AA 1BC8C 2ZXJA 4G7HF 3V8KA 2RVCA 3EQLF 3M7GA 3V8JA 3ML6A 1X3UA 4BH9A 3GZ5A 1XSDA 4G7ZF 4L18B 2VE9A 1G4DA 1XGSA 4CXFA 2QQBA 3TQNA 1PDNC 4IHSA 1FYLA 3JAMK 3RIRA 2OD5A 3W6KB 3WGIA 2IP2A 3D0SA 3LQQA 5ILVA 5HLHA 2CYYA 4QLCU 1UFMA 1UHWA 4EGYA 5LRSA 2H6CA 2EFPA 1LJ9A 1WKMA 4OIOF 4M73A 1G3WA 2QVOA 3F6OA 5AONA 1K7AA 4HLYA 3T1BA 4ZYGA 2VOOA 1ZARA 1WRJA 2O6GE 4YIFA 2PMUA 1P2FA 1FSEA 2DK5A 2MBFA 4HF0A 4LMYA 4YIIA 1T6SA 2V6CA 4LB5A 5LGNA 4Q4ZF 3RKYA 3VEPA 4LD5A 1MD0A 3TDUC 1BIAA 2A69F 2Y48A 3IWZA 1ZH5A 3REOA 1IXRC 3CO7C 3DQVC 4S05A 3TO6A 2FE3A 4IPAA 1ZGJA 5ICFA 2YU3A 4A5NA 4LGWA 3E5UA 2LNBA 4RB3C 1SAXA 1ZG5A 1YW7A 3FXQA 3Q9VA 5LEJA 2Y0MA 1IW7F 2ZKZA 4KIFA 3K1PA 2Z5UA 4EQQA 2IA2A 3EDPA 5JVTA 5D4SA 4ZH4F 3K1MA 3M9AA 3GF2A 4LG0B 4EJUA 1O3SA 4OU0A 1IZ1A 4KUMA 2GWRA 2FBKA 3SFZA 3ZN0A 4H0EA 2GAUA 3GW2A 4A6DA 3R0AA 3I0TA 1XGNA 3WU1B 3ZMVA 4CICA 3K2ZA 1K78A 1UHMA 3C7JA 1QZYA 2HDCA 3GFLA 5BS6A 3L9FA 1FX7A 2EA2A 3P9KA 1A04A 2RV8A 4Y13A 1MJ9A 4D0PA 4HAMA 5J6XA 1IRGA 3PQKA 4F7ZA 3H3UA 5D5XB 4UV8A 4KICA 1ON1A 4PDKA 2IRFG 3F21A 4BAYA 1SMTA 4WK8F 4HX8A 2HFHA 3MZYA 3W6JB 2NNYA 3HUGA 2JRTA 2M1BA 4XLNF 4I09A 2XV4S 1YO5C 2W24A 1BI3A 1L0OC 2AS5F 4ZZDA 3GLXA 1BC7C 1XCVA 3J80K 3DKWA 2A68F 1HW5A 2KIUA 4LG0A 3NQOA 2P6SA 1U5TB 3AAFA 5CVRA 1TLHB 1OMIA 3K69A 1G3TA 3RTRA 1U5TC 5KVRA 2X4HA 4L9NA 4U0VA 4R8HA 5D5WB 1AOYA 2ESHA 4OMYA 1TNTA 2STTA 3IHUA 1REPC 4ENMA 4UNOA 2Q2EA 3KETA 4M6XA 1LDDA 4I01A 2RQPA 4I7HA 1B9NA 1J7KA 3LWFA 3HRSA 4IJAA 3VB2A 3E6DA 2QENA 3V7CA 1HKTA 1U8RA 1XB4A 5DCFA 2FXAA 4M9SA 4A5MA 3ISPA 3F72A 1FSHA 5ED4A 3ZQ7A 3L2CA 3U2RA 3E6BA 4CYDA 4M72A 2EJRA 2YX4A 3TOAA 4OOIA 3GUDA 2KIFA 2HGCA 5HLIA 3HHHA 2GA1A 4GYGA 2QLZA 3QPHA 2OQRA 3MEXA 4RAYA 3RDIA 3TDZC 3E6MA 3KZZA 3DV8A 4IVNA 3EYIA 2ZMEA 4U7DA 1EH7A 4PCQA 4AWXB 2EFNA 3Q9SA 4FX4A 4EM0B 1SFEA 3LAPA 5CVVA 3JW4A 1F1ZA 2HOEA 3GFMA 5A2QZ 1BM9A 1SD7A 3M8EA 5F1RA 1IUYA 1MGTA 4WX9A 3RKWA 3B02A 3RI4A 3F6VA 3KP6A 2FRHA 1HBXG 4ESJA 2WC2A 2Z3YA 1Z6TA 3N97A 2VXZA 1HQCA 2CG4A 4O6JA 2VE8A 4XSZF 4NB5A 5LGTA 2IW5A 5FD6A 1IF1A 3DP7A 1FBSA 2PJPA 4UXNA 1KU3A 1GXPA 1XCBA 3L00A 3QP6A 2YPRA 5J8CA 3CDHA 4GO1A 4OINF 4HDUA 2Z9OA 1CF7B 1LQ1A 4BHBA 2MD5A 4CO8A 4G6QA 5L3BA 3ZP5A 5D6EA 2FQ3A 2PMHA 5ICGA 3PQJA 2O3FA 4KIBA 1B59A 3I4PA 3MQ0A 2XVCA 3GZ6A 4IF4A 3FM5A 2XAHA 4K2EA 4BXUA 5FLXK 2E1NA 5JFRA 2XIGA 1H0MA 1B9MA 1T0FA 2L3DA 3QU3A 4RAZA 2R7DA 4MGRA 4O5VA 5D8LB 4IRHA 3I64A 2ZNZA 2DQLA 2VODA 1EH8A 1B4AA 2NYXA 4AD9A 1FP2A 3V7SA 3WTYC 1EH6A 2QBYA 1KU2A 5BOXA 2HYGD 2M30A 2H94A 1JHFA 2L4MA 2E7XA 2G7HA 3TKYA 2HZTA 4G9YA 1YW9A 1IN5A 2Q8KA 4WF2A 1LDKB 3BP8A 1O3RA 1UB9A 1FYKA 4B8XA 4IHTA 1FY7A 4IXAA 3HSRA 1GHCA 4I0BA 5CLSA 1Z91A 3CUQA 1R1TA 4M9ZA 2LF8A 3WTXC 2HKXA 1R5GA 2NRAC 3WODF 1FWZA 4UHTA 1W7PA 2ZMEB 2OZUA 1R00A 4ENNA 1HXDA 3WTSC 2OA4A 5TJJA 2XROA 3IRQA 5BPDA 4EJOA 3GYHX 4RB0A 2MC3A 2JT1A 1Z7UA 4CZZA 1U3EM 1ZGAA 4N9HA 3RJPA 4OIQF 4ZZLA 3WTZA 5TRDA 3ULQB 2LKPA 1WI9A 4UVBA 5ILUA 5BPIA 1S3JA 3KEQA 2VBYA 3RYPA 3BWGA 3QRFF 1Q1HA 2DFIA 3BY6A 4L9TA 3K1NA 4XBFA 1KU7A 2GXGA 2ZJ2A 1R23A 3LQRA 1KQ0A 3FWEA 2HQRA 3F8CA 2OAZA 2FEZA 2QQAA 3P7NA 2RN7A 4Y17A 3MCZA 3SXYA 1RNLA 2BGCA 3NEUA 1BOAA 3FX3A 2RC4A 3RPQA 3HTUA 2KRFA 1O7LA 3D5LA 5DYMA 1P92A 2FMLA 5JHUA 2YSRA 3BZ6A 3CUOA 4MEYF 2IA1A 3J81Z 2A5YB 2V1XA 5L3GA 1PP7U 2JPCA 4L9VA 4PGHA 3QU6A 3E5QA 1I1SA 5FGMA 2CWEA 2CW0F 3EUHA 1XSXA 4BHCA 1WWXA 1MJAA 1USSA 5HS7A 4R79A 3P9CA 2M45A 3DXJF 1FBQA 1YW8A 2NNNA 1S7OA 1FP1D 2QM3A 1T38A 4LLLA 4KN7X 3R6SA 1ZRCA 4L5IA 3WTVC 2QBYB 3BJAA 2XAFA 3QOPA 3LA3A 4MEXF 1K78B 2G7UA 2E1CA 1OKRA 1Z05A 5K5OA 2K4BA 3VFZA 1L3LA 3ZPLA 5LGUA 4L5JA 3L09A 1XGMA 1T2KA 3EYYA 1D3YA 1KU9A 2V9VA 3U1DA 2R7FA 2PQ8A 1TQIA 1LDJA 2F2EA 1QQIA 2IPQX 1MDMB 1BI2A 2EFWA 4FHTA 3ZN1A 2EFQA 2DLLA 4MHGA 3EETA 1KQ9A 1QO0D 5FFZA 5H6QA 4A0XA 2STWA 4Q47A 4FT8A 1FLIA 3VODA 3F8NA 2DI3A 4ZYDA 4MQ9F 2L4AA 2GIVA 4IRGA 2LSOA 2IT0A 1TW2A 2L02A 2P5KA 1P4AA 3BPVA 4RGXA 5EEGA 1DPRA 3GX4X 4JK1X 1V4RA 5E1WA 4WXCA 2ZBKA 2Q0OA 3HRMA 2KJCA 4P5OA 2FNAA 4LK0F 1O7FA 4M6YA 1E2XA 2DT5A 4RGSA 4G7OF 3ZMSA 2DU9A 2F5CA 4RB2C 3IRRA 2CGPA 4P9UA 4OMZA 2K7LA 5L3CA 1BIBA 5A2QK 3CO6C 2VT3A 1YQAA 1F5TA 2EV0A 5HLGA 2VBZA 3DPLC 3KCCA 5AIQA 3GXOA 3JAMZ 2K86A 1RUNA 4MTDA 2LF7A 2GQQA 3FZVA 3S2WA 6PAXA 1YS6A 1XD7A 4G94A 3T8TA 4E70A 2HKOA 4UVAA 1LB2A 1U78A 3HRUA 2O0YA 3V4GA 4I0AA 1ZYRF 3T5XA 2BEOA 3O2PE 4MTEA 4I2OA 2IVMA 3QAHA 2XGXA 1Z9CA 1OPCA 3IC7A 4A6EA 3T8RA 2EB7A 1I27A 1MJBA 3WU0A 5L3FA 1AWCA 1IN8A 3O3KA 5IT3A 1BBYA 2KJBA 4BQAA 1RUOA 3C18A 2QYOA 4BNCA 1MZBA 3HSEA 2XHKA 2DQRA 2AXLA 3MZHA 1LNWA 2DW4A 4JQFA 4A0ZA 5LBQA 4HV5A 2W25A 2W57A 1BN5A 4GCVA 1OYYA 2ISYA 4WCGA 1O3TA 1IN4A 2BV6A 5JI6A 2HEOA 1R36A 5LLQA 2JZYA 2M8EA 3CTAA 5IT9Z 4AIHA 1W5SA 2V79A 3ERED 1ZN2A 3J80Z 4EMSA 4O3MA 5DD4A 2O8XA 4KYWA 2EV6A 2XUBA 5H6RA 4G6DA 4LFUA 1SD5A 4LLGF 4WWCA 2P5LC 3HRTA 1DP7P 2A61A 5CJ9A 1YYVA 3KLNA 2D1HA 4Q5SF 3RYRA 3HYIA 4U88A 3I71A 3ZMZA 2M87A 4HBLA 1W5TA 2L54A 2XAGA 3M1EA 4HX7A 1CGPA 5DD8A 3F23A 4EM1A 4EV0A 3BROA 1EV7A 2JTVA 1TQPA 3ECHA 3Q5FA 4KA4A 1T98A 5LRRA 4EGZA 3M8FA 1O57A 3RKXA 3MAJA 3KE2A 4HDVA 3HHGA 2PLYA 3H3ZA 2ETHA 5HDGA 5BQTA 3P9IA 2OQGA 1H9GA 1P4WA 4A0YA 4YFKF 1YIOA 5L3EA 5LEKA 3LSTA 3ELKA 3MWMA 1B6AA 4ESBA 2TDXA 3J7AO 1BJAA 3CLOA 3V8LA 1ON2A 1R7JA 5CVUA 4N0BA 2HYFA 1ONVA 2ACJA 1K79A 1OYIA 2CQKA 4PZJA 1TNSA 2MH2A 1C0WA 4PGGA 1FBUA 2XRNA 2P7VB 5ICEA 3QP5A 5EEHA 2VC0A 3E6CC 2E7WA 3R0JA 4N9IA 3BOQA 5J8FA 2PI0A 2D2WA 2P8TA 1Z6RA 3FMRA 2D45A 3I59A 1QNTA 5E20A 4GXOA 1TTYA 2K02A 3ABTA 4CDGA 5FD5A 3MFKA 2UXXA 2DPDA 4HF2A 1LVAA 3HSFA 3E3VA 3HOSA 3KEOA 5D5VB 2BBYA 3I53A 5F64A 2A07F 2VN2A 1MDMA 1P6RA 3SZTA 2FNPA 1ZLKA 1LEBA 4M74A 1SD6A 3IKTA 3JSOA 1TQMA 2UZKA 2A6EF 3DPTA 2O03A 4YG2F 1J75A 2K4JA 1DUXC 3FF5A 1G6NA
chains in the Genus database with same CATH superfamily
2DMTA 4IEJA 1P7IA 5LHGA 1QU3A 1XMKA 4AC0A 1IN7A 4PSWA 2Z1DA 4MNUA 3ZMTA 1RZ4A 3LOCA 3NRVA 1UJ8A 4AM3A 4LIUA 5B1AH 1PUEE 3B6AA 5EF6A 4CHUA 1GV2A 1S29A 2HR3A 3OSFA 4I02A 2A5WA 5CVJA 1YTYA 3HB9A 3ABUA 3CJRB 1KQ8A 2F5DA 3GZNB 2PBIA 2VPLA 3AG4H 2VBWA 3G1LA 4ESFA 2HWVA 2YR2A 2EILH 5J4VA 2LYCA 2KDOA 3JRHA 1T8IA 1J09A 3C3WA 3C2BA 3L1PA 2VKEA 3OYDA 2VKVA 4YIRX 1IJWC 1S6LA 2L0KA 1KYWA 2PEXA 3C2HA 2FBHA 1ZLJA 1F4KA 2EWNA 1OYWA 2KDZA 1IC8A 2XSDC 4P55A 2X1DA 1O4XA 2XDVA 1X2NA 1K6OA 2PJRA 1I6XA 3GEZA 5JVGF 5IYCJ 3COAC 1IAWA 1DDNA 3FDYA 2E34A 4A93J 2J5OA 2WAQN 1MBKA 2ELJA 2QUFA 4L9JA 2UXNA 2W84A 1VQMI 1D8KA 2J5PA 3K6GA 1R1VA 5E18F 3F22A 2IGOA 3KP5A 2V1UA 5E79C 3IAS2 1UHSA 3IKVA 4OIRF 1T95A 3I5UA 1EA3A 1MBHA 1BR2A 4N4NB 5D5UB 2DMQA 3G1MA 3H5AA 3K9TA 3IV5A 3LFKA 1HSTA 1HDDC 2NVXJ 1USTA 2UV1A 4ENKA 1FEXA 2XKPA 2AO9A 1TWGJ 2HOTA 4ASNA 3PIPF 4CSWA 4Y4RA 3HPGA 3OYBA 4KN4X 3KLOA 1LEAA 2Y75A 3R61A 3OIPA 4B09A 4A3BJ 3ZQFA 5HNHA 2DTZA 3OYAA 3S14J 5IT9K 2JK3A 4UB8C 2IJLA 3TW7A 1IN6A 1JGSA 3S3OA 1P9QC 2HVRA 2PFBA 3SHFA 4UUVA 5FKNA 4XK4A 5B3SH 5EGOA 4AYBN 4XR6A 4MIMA 5DTDA 3V7RA 2IGNA 2COMA 1U9NA 3ZMUA 4IHXA 5HVQC 4XKVA 1BI1A 3J81K 1ZHFA 4PJLA 5D8KB 4YRVA 1J9IA 1XMAA 2MC4A 2P6TA 3QPLA 1SD4A 1DGRM 3GFIA 1TBXA 1RIOH 3QPTA 3HGGA 3A03A 5HOOA 3WE3A 4HOBA 2PN6A 4ZYHA 2DN0A 5E17F 4BHPA 1F9NA 4BQOA 5IOZA 2LLKA 5FLXZ 3WTWC 1KA8A 3LAJA 3LSPA 4GGGA 3CCYA 2PG4A 1JUPA 2L9VA 3VOEA 2E71A 1FOKA 2O61A 3FXRA 3K4MA 2ZFWA 1ZREA 3SZGA 1U0JA 1XSVA 2COBA 1XDSA 4LOCA 5F1JA 4J00A 2R7XA 2FX0A 3SQNA 1GVJA 3C1DA 3MN2A 4FX0A 5E1ZB 1PUFB 5FB2A 1SFUA 3G1OA 1QHHD 2WWYA 2VT2A 1FPQA 5FRNA 4L0ZB 2LR8A 2ESNA 3K0LA 3HOTA 3BDDA 3KP7A 1R5HA 3GVAA 2LVSA 1YLFA 2KKOA 4HSTA 4BJ5C 1P4XA 5IP6A 3AL0C 2CQXA 4RB1A 2K9SA 4I76A 2DA1A 2W85A 2AQFA 2QWWA 3BG7A 2ELHA 4DJAA 3H3VK 3H35A 3CMAI 3WG9A 3NARA 2VLAA 3HJEA 3ABLH 2KPMA 3BT9A 2XC7A 3TGNA 4A12A 1ERDA 1JXSA 2FMYA 4HF1A 5DUIA 2TRTA 1J2XA 1G59A 1V54H 1JGGA 3M4OJ 1NH3A 4ITVA 2M0CA 2EIJH 2L9NA 1OCRH 3JTHA 4ZDLA 2RDPA 4NNJA 3L7WA 3WGHA 3OWTA 2WV0A 1UCRA 4KMFA 1J59A 3OMYA 2FBIA 1WH7A 3DBHB 5FJ8J 2BHYA 2LREA 3OSGA 2GXBA 2YX7A 4YFXF 3E0JB 3S1NJ 2FF4A 2DO7A 3FK7A 4WXHA 4RLQA 2ZSHB 3TOBA 2BE5F 4XSXF 5E1XA 2LC2A 2W1OA 2X6XA 4Y33A 2VBXA 2HQNA 3SDGA 4KFCA 2UWMA 3ZQIA 2HI3A 3WTTC 4M3BA 4BUPA 4ON0A 1ZRDA 1D8JA 2HU9A 1YJWI 5K5QA 2HDWA 4F52A 2K9QA 3F3XA 2P7CB 2DMPA 2VC1A 4HQMA 4BY1J 3KYDB 5ERIA 4HV6A 2DFHA 4KIGA 4B48A 1R58A 2EK5A 2KIQA 3J7ZI 1IXSB 5J1YA 1JJ6C 5C3EJ 5KK1A 1R22A 5F0HA 2Q2EB 3HIFA 2VONA 2A6HF 3G3ZA 2MH9A 2XAQA 2EIKH 3BQZA 4XRFA 4PSXA 1DPUA 3OYHA 1O3QA 4EJTA 1UZCA 2G9WA 3BPXA 1SFXA 4HG2A 5DDGA 2ECBA 2NS0A 3UR3C 1MMDA 4PFPA 3N05A 2DA5A 2XASA 1G3SA 1IRFA 3X2QH 3JTGA 1OISA 3IWFA 1H9TA 1GXQA 2LD5A 2ISZA 4RA2A 3VSKA 3GWZA 1UG2A 5FFXA 3CF2A 1X2MA 3KEYA 1ULYA 2CO5A 2RREA 1MMGA 1QRYA 3ZMDA 2VJ5A 1KYZA 2ZO4A 2CUZA 1HSJA 4EM2A 2D1VA 2A3SA 3FXLA 5JR3A 3N4MA 4XLPF 1JKPC 1RKWA 5EG0A 2H6BA 1E17A 2F5FA 4NC7A 4D7NA 2LFBA 1K83J 3RSNA 1QBJA 1KGSA 3FXKA 5E8IA 1W7PB 1STZA 1BI0A 2IA0A 3C2GA 4HQEA 1R1UA 1TWFJ 1ZG1A 1V5EA 2Z33A 2IS2A 4ZDOA 2RNGA 4UVCA 4CCOA 2NS8A 3H92A 4P9FA 4AIJA 2DCEA 1J0RA 3ASNH 3HTSB 2X6OA 3CUQB 2LRDA 2BYVE 3DF8A 4BJ6C 4ABZA 2FA5A 5K5RA 2H27A 4CCKA 1YI2I 3Q0WA 4BQQA 4UUTA 1W1WE 4AU7A 1JTYA 1FJLA 3EPZA 3K70D 5FKMA 5FLVA 2LTPA 4P96A 3B73A 4W1UA 5JLWA 2F5VA 2K27A 1B1BA 2B9SA 1GDTA 3OYGA 2FOKA 4NHJA 2DK8A 2B7EA 1K61A 4FETA 1FOWA 3CJNA 1IXCA 3H0GJ 1Y8RB 2CSOA 4U0YA 3BTLA 1J5YA 4RLFA 4LLNA 4A2UA 3DKYA 2EFOA 4IRIA 3F8FA 1XGOA 5DUKA 2MA3A 4CCNA 1JHHA 3G73A 4U0WA 2HS5A 4HA8A 2JWTA 2A6TA 2R7QA 3D5RC 3QODA 2DBBA 4DQ2A 3MKYB 2ZMEC 3BG9A 4XORA 4EEFG 3ZQCA 2BY1A 1FZPB 1VQKI 4IL6C 4DBRA 2KIMA 5CVIA 3K4KA 5DCMA 4CYCA 3JRBA 1BW6A 5DCMB 4D5CA 4CYCB 2WB1N 2O9LA 1MMAA 5HDNA 3DCFA 1U8BA 1YG2A 1HW1A 1Z1DA 4A3KJ 1I6HJ 2FSWA 2ZNYA 3I54A 5K7HA 4B43A 2ZCWA 3OYIA 3BJ6A 3FHZA 2WTEA 4LB6B 2PJRB 1V3FA 4XRSA 2GIZA 2P5VA 3R4KA 2XAJA 1WSUA 4LITA 4C9YA 3F8BA 3LFUA 4HLXA 3RKQA 1ZRFA 4MFDA 1YX3A 4AVPA 3SZPA 2LG4A 1ETXA 3TO9A 5FO5A 4S04A 1XN7A 4JBAA 1JJ8C 3OOPA 2HOSA 1U2WA 4C3JJ 3KIOA 1T39A 2ZJQF 5DEQA 3LA7A 2GA2A 5GPCA 3O6BB 3S1RJ 2RNJA 2XF7A 4ETSA 4BE0A 1FMVA 4M71A 1FC3A 2Y2ZA 2HQAA 3L2RA 3H9GA 5K1YA 5B1BH 5HDKA 2F4IA 3S17J 2C6YA 4IHWA 1OCOH 5ICCA 2QEXI 3QWLA 1SMYF 3EUHC 4G8XA 3HKZA 4CGZA 4NQWA 4TV7A 4RS8A 2MLKA 3TO7A 3PIOF 4DNCA 2DMUA 5L3DA 3DFGA 1WQ2A 2R7TA 4KMUX 1FNNA 5AIPA 1RI7A 4E7IA 1BA5A 2OZ6A 2LDUA 5F6FA 1ETYA 4OWRB 5H20A 3CCUI 1IUFA 5GTHC 3KP4A 2JMWA 4RGUA 4XKWA 4AIKA 4OIPF 4KDPA 1MMSA 1VQ7I 4ENJA 5ILSA 4KT6A 1ZQ3P 3WGGA 2CW7A 3BC8A 2MFZA 2EA4A 1LE8B 1XDUA 2NVQJ 1ZK8A 3GBGA 4LK1F 2CFXA 4EJWA 1NHAA 3M3YJ 4QIWN 2HTSA 1FT9A 2E5NA 1S72I 4XNFA 3LA2A 3I3LA 3OV8A 4L0YB 1QGPA 5HS8A 4A3LJ 2Z99A 2DJIA 5D4RA 4BYYA 1GVDA 3KFWX 2JSCA 1CF7A 2VJJA 4FCYA 1LFPA 2OF7A 2VOPA 2JPBA 1U5TA 3AFHA 3PM1A 4KT5C 4II3A 4BE1A 3WTUC 2NAZA 4Z2YA 1MBEA 2E1OA 4D7MA 3CC7I 3OOUA 1Z3XA 3KZYA 1OCZH 1W4MA 1R49A 5HS9A 2R5ZA 1A35A 3FMQA 2Z16A 2R7RA 5LHIA 3FXUA 3R60A 1HKSA 1QZZA 5LHHA 2H1LA 3KX2A 4HX4A 1MNEA 1W5CC 2I5UA 3GLLA 4HYEA 1PUFA 2OTJI 5GADJ 2JA6J 2H09A 4KNYA 5CYVA 3U9GA 1ZG3A 1W36C 3FMSA 4MQVA 1D5VA 1AKHB 4YFNF 3ROUA 2LH9A 2RKHA 1TW3A 4I98B 3HOUJ 3GO5A 1WJBA 1YFHA 2BXZA 2AQEA 5DV5A 1JUMA 3I56I 4HZFA 2W82A 4B44A 4Q48A 4ZYEA 4IOCF 2DPUA 2M5WA 5DS9A 3T0YA 4UV9A 4M9XA 3CC2I 2KLOA 2MABA 3CUQC 1HW2A 3BJOA 3FM3A 1YE9A 3I58A 4RGRA 4U7BA 5BMZA 1ODDA 5E8GA 2X0LA 4IZZA 1H8AC 4HNVA 2F5EA 2DOFA 1JKOC 2V1DA 3DEUA 1XPXA 5FKLA 2LKSA 3CDIA 2ADUA 5H2FC 2OU2A 4R1HA 3KP2A 1G3YA 2OUMA 1X3ZB 3F8MA 4EJVA 1YS7A 1HKQA 2LMDA 4M6VA 2B0LA 1PJRA 3ECOA 4WXDA 1Y0UA 4AVZA 3JSPA 2GZWA 2L9RA 2L7MP 1PVEA 1FYMA 2RGVA 4BDYA 3H1CA 1OR7A 3RPUA 2HTJA 2QQ9A 1PP8F 3LSRA 2DAOA 2QSGX 1ZAOA 5BNGA 2OBPA 2XKOA 1VQ4I 2FU4A 2R3SA 3GFJA 1I1GA 1VTNC 5D6FA 3I59B 2L01A 3IL2A 4PJ0C 4Y15A 2JN6A 1U6GA 2QZ8A 2X6YA 1W7PD 1D1AA 2L7ZA 5JHFA 2MLGA 4ZYAA 4QWQA 3BR0A 2V7FA 3E97A 1XS9A 3OYFA 2DTRA 2IBDA 1BJZA 2EIMH 5HLTA 2IS6A 5TISC 3KP3A 1S8NA 4HW0A 1JE8A 1QPMA 3K10A 5KCMA 3K7AJ 3PFIA 2P4WA 2CS3A 4EVIA 1DGWY 2Y69H 4PUSA 3WE2A 4LJZF 3E5XA 2EV5A 4A3EJ 1I5ZA 1MKMA 1WVRA 4GYIA 1LUJB 1S7AA 1BC8C 1S5LC 2ZXJA 4G7HF 2NVYJ 2RVCA 3V8KA 3EQLF 2CRGA 2BY3A 3M7GA 3V8JA 3ML6A 1X3UA 4JOMA 4BH9A 4D9JA 3GZ5A 1XSDA 4G7ZF 2QCOA 4L18B 2VE9A 1G4DA 1XGSA 4A3JJ 1MH4A 5FKOA 4CXFA 3OYKA 3OYNA 3PUFA 2Q1ZB 2QQBA 3TQNA 3Q0UA 1PDNC 4RDUA 4IHSA 1FYLA 3JAMK 3RIRA 2OD5A 3W6KB 2QA4I 1Y39A 3WGIA 2E19A 2IP2A 4OAYA 3D0SA 1U9OA 1N78A 2KZVA 3LQQA 2WA0A 3M1CA 1WHUA 1VQ8I 5ILVA 5HLHA 4BDZA 2HOAA 2CYYA 4QLCU 1UFMA 2NXNB 1UHWA 2XRLA 4EGYA 2QF7A 5LRSA 2VQCA 5K7FA 2E2IJ 4FE4A 2H6CA 2EFPA 3QYBA 1LJ9A 1WKMA 1X1PA 3K2AA 3AG2H 5E3OA 2ZFUA 4M73A 1G3WA 1YIJI 4OIOF 4XLHA 2QVOA 2CQ7A 3F6OA 5AONA 1K7AA 4PFOA 4HLYA 3T1BA 4ZYGA 2AXTC 2VOOA 1ZARA 2F4MB 1WRJA 1D5YA 2O6GE 5IPAA 1DP3A 3SDBA 4YIFA 2PMUA 1P2FA 3HGYA 2Y0SN 5KHDA 1Q1VA 2NOJB 3RCOA 1FSEA 4BEHA 1R5ID 2DK5A 2MBFA 2Y31A 3A4CA 3WHCA 2WAQA 2AHQA 5IYDJ 2M9HA 2WB1A 4HF0A 4LMYA 4YIIA 2ID3A 3OYLA 1T6SA 2V6CA 1IO2A 4LB5A 5LGNA 4Q4ZF 3HBLA 3RKYA 2V4JC 4A3GJ 3A0BC 2OV7A 3ABKH 4XLEA 3VEPA 2KP6A 4LD5A 3UKGA 1MD0A 3TDUC 4QTRA 1BIAA 2A69F 1Z7LA 5EEAA 4IOAF 5M3MJ 1IV6A 2W48A 1BR4A 2Y48A 3IWZA 1ZH5A 4BBRJ 3OIQA 3GCMA 4DOZA 4ZJZA 3REOA 2XF5A 4XL9A 2M34A 1IXRC 3CO7C 2IS1A 3DQVC 2R7OA 4S05A 3ZQQA 2K9LA 2WV1A 3TO6A 3OYMA 2FE3A 1VFCA 1NG6A 4IPAA 1ZGJA 5ICFA 2YU3A 2LKXA 4A5NA 4RMNA 4LGWA 2OTLI 1WFXA 3E5UA 5JLXA 3CCMI 2LNBA 2CU7A 4RB3C 2ZSIB 1SAXA 1ZG5A 2EZIA 3G6EI 1YW7A 2FQ4A 2X9DA 3FXQA 3Q9VA 5IP7J 1SVLA 5LEJA 4C30A 2Y0MA 2DA4A 1IW7F 2ZKZA 4KIFA 1VQ6I 3K1PA 1LFBA 3AL0B 3I4NJ 5TGTA 2Z5UA 4EQQA 2IA2A 3EDPA 5JVTA 5D4SA 3DTKA 2CMPA 1WI3A 1UELB 4ZH4F 3K1MA 1ETOA 3M9AA 3GF2A 1T33A 2D5VA 4EJUA 2GXAA 1O3SA 4LG0B 2K3FA 1UG0A 4OU0A 1IZ1A 4KUMA 3ZQHA 2GWRA 2X85A 2FBKA 3SFZA 3ZN0A 4H0EA 3FXOA 3ZXSA 2GAUA 3DBLB 3CQZJ 3GW2A 4A6DA 4AYBA 1RRJA 3R0AA 3I0TA 3HZJA 1XGNA 3WU1B 4ZC3A 3QOEA 2K9NA 2DOAA 3ZMVA 4CICA 3K2ZA 4B3XA 1K78A 1UHMA 3C7JA 1QZYA 2HDCA 4Y52J 3GFLA 4FQGA 1WJCA 5BS6A 3L9FA 1FX7A 2EA2A 3P9KA 1A04A 2Y0SA 3ABMH 2DYSH 3JRDA 2RV8A 3QYEA 4X0GA 3OL4A 1XG1A 3UNGC 4Y13A 3AKZA 1MJ9A 4D0PA 4X6AJ 4HAMA 5J6XA 1E0EA 4HEA2 1IRGA 3PQKA 2PMZN 5GP9A 4F7ZA 3H3UA 5D5XB 4UV8A 4KICA 4JP0A 3BQYA 2DOEA 3BTCA 4H4KC 2XF6A 5FLMJ 1ON1A 4PDKA 1IGNA 2R5ZB 2M7AA 3JRIA 2IRFG 3F21A 2BY0A 4BAYA 1SMTA 2RQQA 4WK8F 3KYCB 3G4SI 4HX8A 2HFHA 3MZYA 3W6JB 2NNYA 2BZTA 3HUGB 3FBNB 2BHZA 3HUGA 2WY7Q 2JRTA 2KQRA 4E7SA 1VQNI 2ICWG 3CMMA 1DU0A 1VNDA 3TMOA 1QZEA 2M1BA 4XLNF 5EGOB 2JUGA 4I09A 3SJMA 2IS4A 2L7FP 2L5QA 3IP4B 2XV4S 3L2UA 4QPQA 1YO5C 3DLAA 2W24A 1BI3A 1L0OC 2AS5F 3I4MJ 4ZZDA 4D5FA 3GLXA 1BC7C 5GAGJ 2R7SA 1HOMA 1XCVA 3BZCA 3HKZN 2JUCA 3J80K 1B8IA 1VI0A 2FD5A 2A68F 3DKWA 1HW5A 2KIUA 1NG7A 4LG0A 2JQ7A 1V55H 3GTLJ 3CJQB 1GLNA 3CCQI 1JTXA 1LFUP 3NQOA 2P6SA 1U5TB 3E1SA 3OY9A 3I55I 5CVRA 1TLHB 3AAFA 1OMIA 1TC3C 2Y9YA 4W97A 3K69A 1G3TA 4P1WA 2X1CA 4XICA 3RTRA 4NBQA 2EZKA 1U5TC 5KVRA 2X4HA 3FISA 2R7ZJ 4L9NA 4U0VA 4R8HA 1W0TA 3K4LA 1R6RA 3H0DA 5D5WB 1BW5A 1AOYA 4FASD 5HNFA 2ESHA 2WY8Q 4OMYA 2XGCA 2O7OA 1TNTA 2STTA 1JKQC 3IHUA 1BR1A 1REPC 3K70C 4ENMA 2F48A 4UNOA 3OR1C 2Q2EA 3KETA 2H1KA 3GTGJ 4M6XA 1XMXA 1LDDA 3QYFA 1KZHA 3DTEA 4I01A 1FIAA 1ZR2A 2RQPA 4I7HA 1B9NA 1J7KA 3TBIA 3DPUA 2MD0A 3DWLE 2TCTA 1WPKA 5FRMA 4V19K 3BG3A 3W3CA 3LWFA 1RKTA 3HRSA 5CQEA 3SEQA 1WJFA 2JSPA 3FBIB 4IJAA 3VB2A 1F43A 3EUAA 3E6DA 2GOXB 2BY2A 2QENA 2XGEA 3VWBA 3DEWA 3MKWB 3V7CA 2JA2A 1HKTA 3PSFA 1TWHJ 1U8RA 1XB4A 4MLOA 1TT5B 1FOXA 5DCFA 2M4KA 2FXAA 2L2OA 4M9SA 1VQOI 3GTMJ 4A5MA 4ZDPA 1VZ0A 3JRFA 3ISPA 3F72A 4BBSJ 1K6YA 1FSHA 2M0MA 3ERMA 4BKXA 4PJNA 5IP9J 3ZQ7A 5ED4A 1AHDP 3L2CA 3U2RA 3WU2C 1RC9A 3E6BA 4RAGA 4CYDA 2ZJPF 4BL0B 4M72A 3CZ6A 2EJRA 2YX4A 3TOAA 1ZTRA 4IHVA 4OOIA 3GUDA 2KIFA 2HGCA 5HLIA 1ETWA 3HHHA 3PO2J 4DZJA 2GA1A 4GYGA 2QLZA 3QPHA 2OQRA 3MEXA 5J1UA 3S2HJ 4RAYA 3RDIA 3TDZC 5E3NA 3E6MA 3CLQA 3KZZA 1IDYA 4JX6A 4DGWB 1HDPA 3DV8A 4IVNA 1V5FA 3EYIA 4QSHA 2VXDA 2ZMEA 4U7DA 4DZPA 2EINH 2LK2A 3FHNA 2OJED 1EH7A 2E5ZA 4CCMA 4PCQA 4AWXB 5CPRB 2EFNA 4XN0A 3EUKL 1B72B 3LSJA 4DYRA 4EATA 2A05A 5LD2C 1MH3A 5GPAA 3K4BA 3Q9SA 4AUXA 4FX4A 1S7EA 4EM0B 1SFEA 3CC4I 2W4SA 3LAPA 5CVVA 3JW4A 1F1ZA 2HOEA 1W0UA 2HDDA 3GFMA 5A2QZ 1T0FC 1BM9A 3OS0A 1SD7A 3M8EA 1DQUA 5F1RA 1IUYA 1ZELA 1MGTA 1YRNB 2KZGA 4WX9A 3RKWA 3B02A 3ZQGA 3ONQA 3RI4A 3F6VA 3KP6A 2CJJA 2KMUA 2FRHA 1HBXG 1LKXA 1A31A 4A3DJ 4ESJA 2WC2A 2Z3YA 1Z6TA 3TW6A 5E3MA 1VQ5I 1VF9A 3N97A 4BJTA 2XPUA 2ZXWH 2VXZA 1HQCA 2CG4A 3BR6A 1WJ5A 3M8JA 4O6JA 2VE8A 4ANJA 1RPWA 2MW8A 4XONA 3S93A 2ECCA 4XSZF 4NB5A 3GMEA 5LGTA 5EG0B 2IW5A 5FD6A 1IF1A 4IKFA 3DP7A 4F3QA 2E1MC 1FBSA 2PJPA 4E7JA 1S9HA 1KU3A 4UXNA 1TL8A 1R4NB 1GXPA 1XCBA 3L00A 2NS7A 3PNVA 3QP6A 5GTIC 1I39A 1N75A 1I50J 2YPRA 5J8CA 3CDHA 4GO1A 4CCLA 2ZXIA 5FKKA 2V1NA 1B8IB 2EZHA 2CUFA 1AU7A 4JYKA 4OINF 4HDUA 2Z9OA 3U21A 4BU2A 1CF7B 1LQ1A 4BHBA 1P7JA 2MD5A 4CO8A 1OFCX 4G6QA 3S1MJ 3DTIA 5F04A 3O8HA 5L3BA 2X48A 3H9QA 2OC6A 3ZP5A 4XRMA 5D6EA 2FQ3A 2PMHA 5ICGA 1UAAA 1YRNA 3PQJA 2O3FA 4UY8I 4KIBA 1JI8A 1B59A 3I4PA 3MQ0A 3SEZA 2XVCA 3GZ6A 4IF4A 3FM5A 1FTZA 1X1BA 2XAHA 1HLVA 4K2EA 4BXUA 4C3HJ 5FLXK 2E1NA 5JFRA 2XIGA 1KONA 2KL4A 2W7NA 3BLYA 1H0MA 1B9MA 1T0FA 2L3DA 1K4SA 3QU3A 4RAZA 4XQFA 2BOLA 1SEUA 2R7DA 4MGRA 4O5VA 5EYRA 2I8DA 5D8LB 4M3DA 3F0CA 4IRHA 5EZHA 3IUOA 2H8RA 3I64A 2ZNZA 2LOOA 2DQLA 2VODA 1EH8A 1B4AA 3L2WA 2NYXA 4AD9A 3W2WA 3GTKJ 1G2HA 4BACA 1FP2A 3V7SA 3WTYC 4RAFA 2KISA 1YHQI 1EH6A 3L2QA 2QBYA 3HXLA 1KU2A 3BTIA 2K9MA 5BOXA 2HYGD 1X1CA 2CUJA 2M30A 2M3AA 2H94A 3K4JA 1JHFA 3OR2C 2L4MA 3IH4A 3PSIA 3CCLI 2E7XA 1A5JA 2G7HA 3JRCA 2L9SA 2V9KA 3TKYA 2HZTA 4G9YA 2HNHA 1YW9A 2HVSA 1IN5A 2HXOA 3LSHA 2Q8KA 2VASA 4WF2A 3RQ4A 2GM4A 1Y8QB 1LDKB 3BP8A 1O3RA 2BXYA 3S2DJ 1UB9A 1FYKA 1FMWA 4B8XA 3FK6A 4IHTA 1FY7A 3IAM2 3OYCA 3G2BA 4IXAA 5B5EC 3HSRA 2XB0X 4IQ4A 1GHCA 4I0BA 5CLSA 2MYSA 3WG7H 1Z91A 3PJRA 5K7ZA 5DM7F 4N4OB 2EBIA 3TL4X 3CUQA 2CV0A 4J19A 1R1TA 3WHBA 2E36A 4NDLA 3CDLA 4E7LA 4M9ZA 2DA2A 2LF8A 1XTAA 3WTXC 2HKXA 1R5GA 2NRAC 1X1DA 3WODF 3K4CA 1FWZA 2E2HJ 4UHTA 2UUZA 1W7PA 4J01A 5C4XJ 3I9V2 2IEKA 4XRSG 1Y6IA 2VB6A 2ZMEB 2OZUA 3GTPJ 2ZJRF 2ELKA 3H9JA 1R00A 1EJ9A 4ENNA 1HXDA 4NC6A 1G8XA 3WTSC 1A6QA 3BR5A 5DM6F 2CUEA 2VQLA 4B47A 3ZOBA 3JREA 3LNQA 2OA4A 5TJJA 2XROA 3O8GA 3IRQA 4A69C 5BPDA 3FKJA 1TWCJ 4XKCA 1BL0A 4EJOA 3GYHX 4RB0A 3HOYJ 2M4GA 4UUSA 3OS1A 2MC3A 3BZKA 2JT1A 3RZOJ 1Z7UA 4CZZA 1U3EM 1FOYA 1ZGAA 4F55A 3HC7A 4N9HA 2LBFB 2XAUA 3RJPA 5KAIC 4ZZLA 3WTZA 5TRDA 4OIQF 3ULQB 2LKPA 3VYTB 1WI9A 2E2JJ 3CF5F 4UVBA 1YITI 5ILUA 4MO7A 4HRIA 5BPIA 4F91B 1S3JA 4BS9A 3KEQA 2X1EA 2VUMJ 2VBYA 4JX5A 5CKTA 3RYPA 3BWGA 3QRFF 3SFIA 4AIDA 1D0YA 3MKLA 1Q1HA 2DFIA 3DKXA 1SC7A 3BY6A 4L9TA 3VYUB 3F9KA 3BG5A 3K1NA 1ETQA 1JT6A 4XBFA 2XSJC 1KU7A 2GXGA 2ZJ2A 1R23A 3BR2A 3LQRA 3TP0A 1VQPI 1EF4A 2R7UA 1KQ0A 3FWEA 1SFKA 2HQRA 2M7BA 2OAZA 3F8CA 2FEZA 3DBRB 3BCAA 3A02A 2QQAA 3P7NA 2G0EA 2RN7A 4Y17A 3MCZA 4XOPA 1X1AA 1WJAA 2HZDA 3SXYA 3ZGKA 4Y7NJ 2X6WA 3VSLA 1D0XA 2R5YB 1RNLA 2BW3B 1MW7A 2BGCA 3NEUA 4XIDA 1BOAA 3FX3A 1F36A 3VYSB 1GUUA 2RC4A 3RPQA 3OYJA 3HTUA 2KRFA 3A01B 1O7LA 2EH3A 3D5LA 4E4HA 5DYMA 1Z3YA 2WAEA 1D1CA 1OJLA 3LSGA 1P92A 2FMLA 2ME0A 5JHUA 2FOWA 2LY1A 2YSRA 3A0HC 3BZ6A 3CUOA 1N77A 1RR8C 2OCCH 4MEYF 2IA1A 3J81Z 2A5YB 2V1XA 3HM5A 5L3GA 1PP7U 3JR9A 2DDAA 2BW3A 2JPCA 4L9VA 4PGHA 3QU6A 3E5QA 1QHGA 2VI6A 1WZ2A 2ZB9A 1I1SA 1SVOA 2CQNA 3G71I 2JVGA 5FGMA 2DA7A 2M2EA 2CWEA 2IGMA 2DXIA 4ZTFA 1Z21A 2CW0F 4B1RA 1ETVA 4YEJA 4L5EA 2LY9A 4XLAA 2R7VA 3EUHA 3HDDA 4A3IJ 2LP0A 1XSXA 4BHCA 1WWXA 3MKZA 1MJAA 1USSA 3ESWB 3KZIC 4OAZA 4HPQA 5HS7A 2XPWA 2MGQA 2KT0A 5IYBJ 1MIJA 1H89C 4DIQA 4R79A 3P9CA 4E6KG 1MSFC 2JA7J 3FXJA 2M45A 3GTOJ 2JVHA 3DXJF 1FBQA 1YW8A 3H36A 2NNNA 2X51A 4Z6YA 1E3HA 3PL8A 4ZTJA 4U87A 1S7OA 4PJJA 4C3IJ 3J7YJ 4I6ZA 1OLTA 1FP1D 2QM3A 4G12A 1T38A 4LLLA 2CV2A 4KN7X 5IY5H 4CZCA 2F6CA 3R6SA 3CP2A 1ZRCA 1ZR4A 4L5IA 3WTVC 2QBYB 3BJAA 3TP3A 2XAFA 9ANTA 3QOPA 3LA3A 1QA6A 4MEXF 2KHMA 1K78B 2G7UA 2E1CA 4JX4A 3D1NI 1OKRA 3K4NA 1OCTC 2VKHA 1HF0A 1FTTA 4PJMA 1Z05A 1JUSA 2W00A 5K5OA 3KYLA 2K4BA 3VFZA 1L3LA 3QQAA 3ZPLA 5LGUA 2HYJA 4L5JA 5C4JJ 4XMYA 2WAFA 1IRXA 3L09A 2OCEA 1XGMA 2MG4A 1T2KA 3EYYA 2EQRA 2QKMB 1D3YA 3NWTA 1KU9A 2V9VA 3U1DA 2WBMA 5GAHJ 2R7FA 2PQ8A 1WJEA 1TQIA 1LDJA 2F2EA 1QQIA 2IPQX 3Q0VA 1MDMB 1H88C 1T56A 1Z67A 5B66C 1YJ9I 1BI2A 4C2MJ 1E3OC 2EFWA 1GT0C 4FHTA 1E3PA 3DLLF 3ZN1A 2EFQA 2DLLA 4MHGA 3EETA 3AG1H 3MMYB 1KQ9A 1QO0D 5FFZA 5H6QA 4A0XA 3PUBA 2STWA 3V42A 1MBJA 4Q47A 1MMNA 3H5RA 4FT8A 3A01A 2R4GA 2P81A 1FLIA 3OYEA 3VODA 5LFAA 3F8NA 2O5RA 2DI3A 1POGA 1NTCA 2PMZA 4MQ9F 4ZYDA 3CMYA 1Z0XA 5CQGA 1OCPA 2L4AA 2NVUB 2GIVA 4IRGA 2LSOA 2IT0A 1A6IA 1OR7C 2VPRA 3IH2A 2ZC2A 1TW2A 5EJCA 2L02A 3HOZJ 4UB6C 1IV8A 3S1QJ 3LSMA 3OS2A 2P5KA 4C2UA 3CD6I 1P4AA 4F92B 3BPVA 5M5WJ 2F4OB 4M3EA 3CCVI 4RGXA 4M3FA 4V2FA 5EEGA 1SFOJ 1VQ9I 1DPRA 3GX4X 4JK1X 3P5JA 2K40A 1V4RA 5E1WA 3CP8A 2EPFA 2ZBKA 2Q0OA 3HRMA 4WXCA 2KJCA 5M5XJ 3S8PA 4P5OA 1DU6A 3BCBA 2FNAA 1CQTA 3A1YA 4LK0F 1O7FA 4F93B 4M6YA 1E2XA 1OCCH 2DT5A 4XKBA 4DYCA 4RGSA 1WGXA 4G7OF 3VPRA 4E7HA 3ZMSA 2DU9A 3NAUA 4GRIA 2Y9ZA 4XLCA 4FE7A 2F5CA 4RB2C 3IRRA 1MSEC 1R4MB 2HVQA 2CGPA 4P9UA 2B63J 4OMZA 2K7LA 3DEEA 5L3CA 1BIBA 1Z77A 5A2QK 2GLOA 4C2TA 3NWSA 3CO6C 4DYQA 1OQYA 2VT3A 1YQAA 3LL7A 1F5TA 2DODA 2EV0A 4BXXJ 4IQJA 5HLGA 2VBZA 3MVPA 4UUSB 2ID6A 4IO9F 3HG9A 3DPLC 2XGDA 3KCCA 4NC8A 5AIQA 4E7KA 2DT6A 4BQNA 2HPIA 4HNTA 3GXOA 3TEDA 2VQGA 1M1EB 3S3MA 3JAMZ 2K86A 3RZDJ 1RESA 1RUNA 4MTDA 2LF7A 2BVMA 2GQQA 4GFBA 3FZVA 3SYTA 1RETA 3ZQLA 3S2WA 5HODA 6PAXA 1YS6A 3M07A 1XD7A 1K4TA 1Y0NA 4G94A 3T8TA 1QVTA 1MBFA 3MZ8A 5KAFC 2CV1A 4E70A 2HXIA 5M3FJ 4GDFA 3W6VA 2HKOA 4UVAA 1X4PA 1LB2A 1U78A 3HRUA 2O0YA 3V4GA 1QPIA 5F27A 4I0AA 1R9TJ 1SVMA 1ZYRF 3CESA 3T5XA 3U1KA 2BEOA 1I3AA 3O2PE 4MTEA 4XN3A 4I2OA 1IDZA 2IVMA 2CH0A 3QAHA 4NUBA 1IG7A 3J7AY 3VYRB 3AG3H 2XGXA 1Z9CA 1OPCA 4YELA 3PNYA 3OL3A 3IC7A 4A6EA 3T8RA 4CA0A 2EB7A 1I27A 1MJBA 3IH3A 3WU0A 5L3FA 1AWCA 3ZRGA 1IN8A 3O3KA 4B3AA 5IT3A 1BBYA 2I10A 1YJNI 3BR1A 2KJBA 4CH7A 4S0HB 1AA7A 3FIWA 1Y1WJ 4BQAA 2EZLA 1RUOA 1SANA 3C18A 2L7KA 2QYOA 3W2VA 4BNCA 3PNTA 4BXFA 3HL2A 3HEFA 1EKEA 1MZBA 2MSYA 4BEHB 5IOYA 2CQQA 3HSEA 2XHKA 2R5YA 2NVTJ 4KISA 4FTHA 2DQRA 2VJIA 2AXLA 3MZHA 2YS9A 3BTJA 5J47A 2Y30A 4HSRA 3VDXA 1LNWA 2DW4A 4JQFA 1TT0A 4NQWB 1D0ZA 1TZLA 4A0ZA 5LBQA 2K3PA 5F0FA 4HV5A 2E1MB 2W25A 2QSHX 2W57A 4QPOA 1HA8A 4Y3OA 1BN5A 2PX9A 1OYYA 2ISYA 4GCVA 4WCGA 2M8GX 1O3TA 1IN4A 1X58A 3BG6A 2BV6A 2VQHA 5JI6A 2HEOA 2NOGA 1WJDA 2KRCA 1R36A 4XM3A 2XB5A 5LLQA 2JZYA 2DT7B 4DW6A 1D1BA 1HC8A 2M8EA 2BVLA 2R92J 3CTAA 5IT9Z 1X3WB 1YOVB 1AKHA 1ORKA 3W2AA 4AIHA 4LIVA 3RQIA 1W5SA 2V79A 3LSKA 2H8WA 4I99C 3ERED 2V9PA 2GBYA 4BGDA 1ZN2A 3J80Z 2JA5J 4EMSA 2IGKA 1MBGA 2QQ8A 4O3MA 3HOWJ 5DD4A 2O8XA 4KYWA 2EV6A 2XUBA 5KNLA 2OPTA 5H6RA 2R0QC 1X4OA 4G6DA 3S3NA 4M3GA 1IRZA 4LFUA 1SD5A 1YX5A 2QSFX 4LLGF 1TWAJ 4WWCA 2P5LC 4A3CJ 3HRTA 3PFYA 1DP7P 4B4CA 2YU9J 2V26A 3B6CA 2A61A 5F08A 5CJ9A 1YYVA 1ENHA 3KLNA 2GOMA 2D1HA 4IHYA 1A36A 4Q5SF 1XX5A 1ZGWA 3RYRA 1UMQA 2IXSA 1NK3P 2JA8J 2VIXA 3HYIA 4PK4A 4U88A 2VJ4A 3I71A 5M5YJ 4BE2A 3ZMZA 5EDNA 2LBFA 2M87A 4HBLA 1W5TA 2L54A 2XAGA 3M1EA 1HCRA 4HX7A 4A3MJ 1CGPA 5DD8A 3F23A 4EM1A 4EV0A 1V5GA 3BROA 1EV7A 1WH5A 4XLFA 5GAEJ 2JTVA 4MFEA 4RM3A 1TQPA 3ECHA 4CCJA 3Q5FA 1LVKA 1LE8A 5J1RA 4KA4A 1T98A 2DJNA 5LRRA 3FKIJ 3M8FA 4EGZA 4A3FJ 1ETKA 1O57A 3RKXA 3CCJI 1X19A 2V6EA 1GV5A 2DFFA 2KRHA 3HOVJ 2JJ7A 3MAJA 1T08B 2FJ1A 3KE2A 4HDVA 4KJZA 1VQLI 3E7LA 3S32A 1RR7A 1MNDA 3HHGA 3H3ZA 5J4YA 2ETHA 5HDGA 5BQTA 4KITB 2PLYA 3S15J 1SAUA 2LY2A 3OIOA 5F0CA 5E3LA 3P9IA 2K5CA 2OQGA 1H9GA 1FIPA 1P4WA 4A0YA 4YFKF 5J40A 1YIOA 2K85A 3JCUC 3CMEI 5L3EA 2QKLB 5LEKA 3GTJJ 3LSTA 2DDBA 2JRMA 3GTQJ 2CW8A 3ELKA 3QPSA 2QGUA 3MWMA 1B6AA 3RPUD 4ESBA 4BY7J 3ZR8X 3S16J 1TP4A 2TDXA 3J7AO 4D1QA 1BJAA 3CLOA 3V8LA 1ON2A 1I3QJ 1R7JA 4RBOA 3L2VA 5CVUA 1R71A 3JRGA 4N0BA 2HYFA 1ONVA 5EZGA 2ACJA 1K79A 1BOBA 1OYIA 3FXMA 2CQKA 4PZJA 1TNSA 2MH2A 1W36D 1APLC 1C0WA 2O8KA 3D5SC 2DYRH 4PGGA 1FBUA 2N8GA 4G6TB 2P0WA 1Y56A 2DA6A 2P7VB 2XRNA 5ICEA 2CFOA 3QP5A 3Q3SA 2HPMA 5EEHA 2VC0A 2E60A 3E6CC 1Y1VJ 3MD2A 1ITYA 2E7WA 3CCEI 3R0JA 3PO3J 4N9IA 1LPQA 3JRAA 2ZXHA 3BOQA 5J8FA 3CCRI 2Z2SB 2ME6A 2RAEA 5FROA 2HQ5A 4IX7A 3ASOH 2PI0A 5J3LA 2D2WA 1ACIA 1ZKGA 4V2GA 1XC5A 2P8TA 1Z6RA 3FMRA 2D45A 1NK2P 2R93J 3I59A 4RM2A 3LMMA 1QNTA 5E20A 4GXOA 3KPHA 1TTYA 3BR3A 2FUG2 2VL8A 4E7ZA 2K02A 3ABTA 4DBQA 1N25A 3H5NA 4CDGA 2WADA 4X1EA 5C44J 2E35A 5FD5A 3MFKA 4LG3A 3CJTB 1JKRC 4II2A 2DMNA 2UXXA 2DPDA 4HF2A 1LVAA 1MNMC 3HSFA 3A2KA 2DFEA 3E3VA 3HOSA 2VKDA 2IAIA 3KEOA 5D5VB 2BBYA 3I53A 5F64A 2A07F 3CCSI 2XPVA 2VN2A 1MDMA 4XOTA 3HOXJ 1B72A 4HNUA 4FISA 1P6RA 3SZTA 2FNPA 1ZLKA 2R7WA 3HPHA 4CUGA 1LEBA 4M74A 2YUSA 3DU6A 1SD6A 3IKTA 3DU5A 3LSIA 1TQMA 3JSOA 2UZKA 3ZCOA 2A6EF 3DPTA 1JT0A 2DA3A 1QVUA 2O03A 4YG2F 1J75A 2K4JA 1DUXC 2KFDA 3FF5A 1WCMJ 1PYVA 1G6NA
chains in the Genus database with same CATH topology
5LHGA 1XMKA 1IN7A 4MNUA 3ZMTA 1RZ4A 3NRVA 1PUEE 4CHUA 1S29A 2HR3A 4I02A 5CVJA 1YTYA 3ABUA 1KQ8A 2F5DA 2PBIA 2VBWA 4ESFA 2HWVA 2YR2A 3C3WA 1S6LA 1KYWA 2PEXA 2FBHA 1ZLJA 1F4KA 2EWNA 1OYWA 4P55A 1K6OA 1I6XA 3GEZA 3COAC 1IAWA 1DDNA 2J5OA 2QUFA 4L9JA 2UXNA 2W84A 1D8KA 2J5PA 5E18F 1R1VA 3F22A 3KP5A 2V1UA 3IKVA 4OIRF 3I5UA 5D5UB 3K9TA 3LFKA 1HSTA 1USTA 4ENKA 2XKPA 4ASNA 4KN4X 3KLOA 1LEAA 2Y75A 3R61A 4B09A 5IT9K 2IJLA 1IN6A 1JGSA 2PFBA 3SHFA 4UUVA 3V7RA 2COMA 3ZMUA 5HVQC 1BI1A 3J81K 1ZHFA 5D8KB 1J9IA 1XMAA 2P6TA 1SD4A 3GFIA 1TBXA 1RIOH 3QPTA 5HOOA 3WE3A 4HOBA 2PN6A 4ZYHA 5E17F 4BHPA 1F9NA 5FLXZ 3WTWC 1KA8A 3LAJA 4GGGA 2PG4A 3VOEA 1FOKA 2O61A 3FXRA 2ZFWA 1ZREA 1XSVA 1XDSA 3SQNA 1GVJA 3C1DA 4FX0A 5E1ZB 5FB2A 1SFUA 2WWYA 2VT2A 1FPQA 4L0ZB 2ESNA 3K0LA 3HOTA 3BDDA 3KP7A 1R5HA 3GVAA 1YLFA 2KKOA 1P4XA 4RB1A 2W85A 2QWWA 2ELHA 3WG9A 3TGNA 4A12A 1JXSA 2FMYA 4HF1A 5DUIA 1J2XA 3JTHA 2RDPA 3L7WA 3WGHA 2WV0A 1UCRA 4KMFA 1J59A 2FBIA 2GXBA 2YX7A 4YFXF 2FF4A 2DO7A 4WXHA 3TOBA 2BE5F 4XSXF 5E1XA 2VBXA 2HQNA 4KFCA 2UWMA 3WTTC 4ON0A 1ZRDA 1D8JA 5K5QA 3F3XA 2P7CB 2VC1A 4HQMA 5ERIA 4HV6A 4KIGA 1R58A 2EK5A 1IXSB 5KK1A 1R22A 3HIFA 2VONA 2A6HF 3G3ZA 2MH9A 2XAQA 4XRFA 1DPUA 1O3QA 4EJTA 2G9WA 3BPXA 1SFXA 5DDGA 2NS0A 2XASA 1G3SA 1IRFA 3JTGA 3IWFA 1H9TA 1GXQA 2ISZA 3GWZA 5FFXA 1ULYA 2CO5A 3ZMDA 1KYZA 2ZO4A 1HSJA 4EM2A 2D1VA 2A3SA 5JR3A 3N4MA 4XLPF 2H6BA 1E17A 2F5FA 1QBJA 1KGSA 5E8IA 1W7PB 1STZA 1BI0A 4HQEA 2IA0A 1R1UA 1ZG1A 2Z33A 4UVCA 3H92A 4P9FA 4AIJA 1J0RA 3HTSB 3CUQB 2BYVE 3DF8A 2FA5A 5K5RA 2H27A 4P96A 3B73A 2K27A 1B1BA 2FOKA 4NHJA 2DK8A 3CJNA 1IXCA 2CSOA 4U0YA 1J5YA 4LLNA 4A2UA 2EFOA 4IRIA 3F8FA 1XGOA 5DUKA 2MA3A 1JHHA 3G73A 4U0WA 2HS5A 4HA8A 2DBBA 4DQ2A 1FZPB 2KIMA 5CVIA 5DCMA 5DCMB 5HDNA 1YG2A 1HW1A 1Z1DA 2FSWA 2ZNYA 3I54A 2ZCWA 3BJ6A 3FHZA 2WTEA 4LB6B 1V3FA 2P5VA 3R4KA 2XAJA 1WSUA 3F8BA 4HLXA 1ZRFA 4AVPA 3SZPA 3TO9A 5FO5A 4S04A 1XN7A 4JBAA 3OOPA 1U2WA 1T39A 5DEQA 3LA7A 2GA2A 3O6BB 2RNJA 4ETSA 4M71A 1FC3A 5K1YA 5HDKA 2C6YA 5ICCA 1SMYF 4G8XA 4CGZA 4NQWA 4TV7A 4RS8A 2MLKA 3TO7A 4DNCA 5L3DA 3DFGA 1WQ2A 4KMUX 1FNNA 5AIPA 1RI7A 2OZ6A 2LDUA 5F6FA 5H20A 3KP4A 4RGUA 4AIKA 4OIPF 4KDPA 4ENJA 5ILSA 3WGGA 2EA4A 1XDUA 4LK1F 2CFXA 4EJWA 1NHAA 2HTSA 1FT9A 3LA2A 3OV8A 4L0YB 1QGPA 5HS8A 2Z99A 5D4RA 4BYYA 3KFWX 2JSCA 1CF7A 2VOPA 2JPBA 1U5TA 4KT5C 3WTUC 2NAZA 4Z2YA 3KZYA 1W4MA 5HS9A 3FMQA 5LHIA 3FXUA 3R60A 1HKSA 1QZZA 5LHHA 4HX4A 4HYEA 2H09A 4KNYA 5CYVA 3U9GA 1ZG3A 3FMSA 4MQVA 1D5VA 4YFNF 3ROUA 2RKHA 1TW3A 4I98B 3GO5A 1YFHA 5DV5A 4HZFA 4Q48A 4ZYEA 2DPUA 2M5WA 3T0YA 4UV9A 4M9XA 3CUQC 1HW2A 3BJOA 3FM3A 3I58A 4RGRA 4U7BA 5BMZA 1ODDA 5E8GA 2X0LA 2F5EA 2V1DA 3DEUA 2ADUA 2OU2A 4R1HA 3KP2A 1G3YA 3F8MA 4EJVA 1YS7A 1HKQA 2B0LA 3ECOA 4WXDA 1Y0UA 3JSPA 2GZWA 1FYMA 2RGVA 1OR7A 3RPUA 2HTJA 2QQ9A 1PP8F 2DAOA 1ZAOA 2OBPA 2XKOA 2FU4A 2R3SA 3GFJA 1I1GA 1VTNC 5D6FA 3I59B 2L01A 3IL2A 4Y15A 2QZ8A 1U6GA 1W7PD 2MLGA 4QWQA 3E97A 2DTRA 3KP3A 1S8NA 4HW0A 1JE8A 1QPMA 3PFIA 2P4WA 4EVIA 3WE2A 4LJZF 3E5XA 2EV5A 1I5ZA 1MKMA 4GYIA 1S7AA 1BC8C 2ZXJA 4G7HF 3V8KA 2RVCA 3EQLF 3M7GA 3V8JA 3ML6A 1X3UA 4BH9A 3GZ5A 1XSDA 4G7ZF 4L18B 2VE9A 1G4DA 1XGSA 4CXFA 2QQBA 3TQNA 1PDNC 4IHSA 1FYLA 3JAMK 3RIRA 2OD5A 3W6KB 3WGIA 2IP2A 3D0SA 3LQQA 5ILVA 5HLHA 2CYYA 4QLCU 1UFMA 1UHWA 4EGYA 5LRSA 2H6CA 2EFPA 1LJ9A 1WKMA 4OIOF 4M73A 1G3WA 2QVOA 3F6OA 5AONA 1K7AA 4HLYA 3T1BA 4ZYGA 2VOOA 1ZARA 1WRJA 2O6GE 4YIFA 2PMUA 1P2FA 1FSEA 2DK5A 2MBFA 4HF0A 4LMYA 4YIIA 1T6SA 2V6CA 4LB5A 5LGNA 4Q4ZF 3RKYA 3VEPA 4LD5A 1MD0A 3TDUC 1BIAA 2A69F 2Y48A 3IWZA 1ZH5A 3REOA 1IXRC 3CO7C 3DQVC 4S05A 3TO6A 2FE3A 4IPAA 1ZGJA 5ICFA 2YU3A 4A5NA 4LGWA 3E5UA 2LNBA 4RB3C 1SAXA 1ZG5A 1YW7A 3FXQA 3Q9VA 5LEJA 2Y0MA 1IW7F 2ZKZA 4KIFA 3K1PA 2Z5UA 4EQQA 2IA2A 3EDPA 5JVTA 5D4SA 4ZH4F 3K1MA 3M9AA 3GF2A 4LG0B 4EJUA 1O3SA 4OU0A 1IZ1A 4KUMA 2GWRA 2FBKA 3SFZA 3ZN0A 4H0EA 2GAUA 3GW2A 4A6DA 3R0AA 3I0TA 1XGNA 3WU1B 3ZMVA 4CICA 3K2ZA 1K78A 1UHMA 3C7JA 1QZYA 2HDCA 3GFLA 5BS6A 3L9FA 1FX7A 2EA2A 3P9KA 1A04A 2RV8A 4Y13A 1MJ9A 4D0PA 4HAMA 5J6XA 1IRGA 3PQKA 4F7ZA 3H3UA 5D5XB 4UV8A 4KICA 1ON1A 4PDKA 2IRFG 3F21A 4BAYA 1SMTA 4WK8F 4HX8A 2HFHA 3MZYA 3W6JB 2NNYA 3HUGA 2JRTA 2M1BA 4XLNF 4I09A 2XV4S 1YO5C 2W24A 1BI3A 1L0OC 2AS5F 4ZZDA 3GLXA 1BC7C 1XCVA 3J80K 3DKWA 2A68F 1HW5A 2KIUA 4LG0A 3NQOA 2P6SA 1U5TB 3AAFA 5CVRA 1TLHB 1OMIA 3K69A 1G3TA 3RTRA 1U5TC 5KVRA 2X4HA 4L9NA 4U0VA 4R8HA 5D5WB 1AOYA 2ESHA 4OMYA 1TNTA 2STTA 3IHUA 1REPC 4ENMA 4UNOA 2Q2EA 3KETA 4M6XA 1LDDA 4I01A 2RQPA 4I7HA 1B9NA 1J7KA 3LWFA 3HRSA 4IJAA 3VB2A 3E6DA 2QENA 3V7CA 1HKTA 1U8RA 1XB4A 5DCFA 2FXAA 4M9SA 4A5MA 3ISPA 3F72A 1FSHA 5ED4A 3ZQ7A 3L2CA 3U2RA 3E6BA 4CYDA 4M72A 2EJRA 2YX4A 3TOAA 4OOIA 3GUDA 2KIFA 2HGCA 5HLIA 3HHHA 2GA1A 4GYGA 2QLZA 3QPHA 2OQRA 3MEXA 4RAYA 3RDIA 3TDZC 3E6MA 3KZZA 3DV8A 4IVNA 3EYIA 2ZMEA 4U7DA 1EH7A 4PCQA 4AWXB 2EFNA 3Q9SA 4FX4A 4EM0B 1SFEA 3LAPA 5CVVA 3JW4A 1F1ZA 2HOEA 3GFMA 5A2QZ 1BM9A 1SD7A 3M8EA 5F1RA 1IUYA 1MGTA 4WX9A 3RKWA 3B02A 3RI4A 3F6VA 3KP6A 2FRHA 1HBXG 4ESJA 2WC2A 2Z3YA 1Z6TA 3N97A 2VXZA 1HQCA 2CG4A 4O6JA 2VE8A 4XSZF 4NB5A 5LGTA 2IW5A 5FD6A 1IF1A 3DP7A 1FBSA 2PJPA 4UXNA 1KU3A 1GXPA 1XCBA 3L00A 3QP6A 2YPRA 5J8CA 3CDHA 4GO1A 4OINF 4HDUA 2Z9OA 1CF7B 1LQ1A 4BHBA 2MD5A 4CO8A 4G6QA 5L3BA 3ZP5A 5D6EA 2FQ3A 2PMHA 5ICGA 3PQJA 2O3FA 4KIBA 1B59A 3I4PA 3MQ0A 2XVCA 3GZ6A 4IF4A 3FM5A 2XAHA 4K2EA 4BXUA 5FLXK 2E1NA 5JFRA 2XIGA 1H0MA 1B9MA 1T0FA 2L3DA 3QU3A 4RAZA 2R7DA 4MGRA 4O5VA 5D8LB 4IRHA 3I64A 2ZNZA 2DQLA 2VODA 1EH8A 1B4AA 2NYXA 4AD9A 1FP2A 3V7SA 3WTYC 1EH6A 2QBYA 1KU2A 5BOXA 2HYGD 2M30A 2H94A 1JHFA 2L4MA 2E7XA 2G7HA 3TKYA 2HZTA 4G9YA 1YW9A 1IN5A 2Q8KA 4WF2A 1LDKB 3BP8A 1O3RA 1UB9A 1FYKA 4B8XA 4IHTA 1FY7A 4IXAA 3HSRA 1GHCA 4I0BA 5CLSA 1Z91A 3CUQA 1R1TA 4M9ZA 2LF8A 3WTXC 2HKXA 1R5GA 2NRAC 3WODF 1FWZA 4UHTA 1W7PA 2ZMEB 2OZUA 1R00A 4ENNA 1HXDA 3WTSC 2OA4A 5TJJA 2XROA 3IRQA 5BPDA 4EJOA 3GYHX 4RB0A 2MC3A 2JT1A 1Z7UA 4CZZA 1U3EM 1ZGAA 4N9HA 3RJPA 4OIQF 4ZZLA 3WTZA 5TRDA 3ULQB 2LKPA 1WI9A 4UVBA 5ILUA 5BPIA 1S3JA 3KEQA 2VBYA 3RYPA 3BWGA 3QRFF 1Q1HA 2DFIA 3BY6A 4L9TA 3K1NA 4XBFA 1KU7A 2GXGA 2ZJ2A 1R23A 3LQRA 1KQ0A 3FWEA 2HQRA 3F8CA 2OAZA 2FEZA 2QQAA 3P7NA 2RN7A 4Y17A 3MCZA 3SXYA 1RNLA 2BGCA 3NEUA 1BOAA 3FX3A 2RC4A 3RPQA 3HTUA 2KRFA 1O7LA 3D5LA 5DYMA 1P92A 2FMLA 5JHUA 2YSRA 3BZ6A 3CUOA 4MEYF 2IA1A 3J81Z 2A5YB 2V1XA 5L3GA 1PP7U 2JPCA 4L9VA 4PGHA 3QU6A 3E5QA 1I1SA 5FGMA 2CWEA 2CW0F 3EUHA 1XSXA 4BHCA 1WWXA 1MJAA 1USSA 5HS7A 4R79A 3P9CA 2M45A 3DXJF 1FBQA 1YW8A 2NNNA 1S7OA 1FP1D 2QM3A 1T38A 4LLLA 4KN7X 3R6SA 1ZRCA 4L5IA 3WTVC 2QBYB 3BJAA 2XAFA 3QOPA 3LA3A 4MEXF 1K78B 2G7UA 2E1CA 1OKRA 1Z05A 5K5OA 2K4BA 3VFZA 1L3LA 3ZPLA 5LGUA 4L5JA 3L09A 1XGMA 1T2KA 3EYYA 1D3YA 1KU9A 2V9VA 3U1DA 2R7FA 2PQ8A 1TQIA 1LDJA 2F2EA 1QQIA 2IPQX 1MDMB 1BI2A 2EFWA 4FHTA 3ZN1A 2EFQA 2DLLA 4MHGA 3EETA 1KQ9A 1QO0D 5FFZA 5H6QA 4A0XA 2STWA 4Q47A 4FT8A 1FLIA 3VODA 3F8NA 2DI3A 4ZYDA 4MQ9F 2L4AA 2GIVA 4IRGA 2LSOA 2IT0A 1TW2A 2L02A 2P5KA 1P4AA 3BPVA 4RGXA 5EEGA 1DPRA 3GX4X 4JK1X 1V4RA 5E1WA 4WXCA 2ZBKA 2Q0OA 3HRMA 2KJCA 4P5OA 2FNAA 4LK0F 1O7FA 4M6YA 1E2XA 2DT5A 4RGSA 4G7OF 3ZMSA 2DU9A 2F5CA 4RB2C 3IRRA 2CGPA 4P9UA 4OMZA 2K7LA 5L3CA 1BIBA 5A2QK 3CO6C 2VT3A 1YQAA 1F5TA 2EV0A 5HLGA 2VBZA 3DPLC 3KCCA 5AIQA 3GXOA 3JAMZ 2K86A 1RUNA 4MTDA 2LF7A 2GQQA 3FZVA 3S2WA 6PAXA 1YS6A 1XD7A 4G94A 3T8TA 4E70A 2HKOA 4UVAA 1LB2A 1U78A 3HRUA 2O0YA 3V4GA 4I0AA 1ZYRF 3T5XA 2BEOA 3O2PE 4MTEA 4I2OA 2IVMA 3QAHA 2XGXA 1Z9CA 1OPCA 3IC7A 4A6EA 3T8RA 2EB7A 1I27A 1MJBA 3WU0A 5L3FA 1AWCA 1IN8A 3O3KA 5IT3A 1BBYA 2KJBA 4BQAA 1RUOA 3C18A 2QYOA 4BNCA 1MZBA 3HSEA 2XHKA 2DQRA 2AXLA 3MZHA 1LNWA 2DW4A 4JQFA 4A0ZA 5LBQA 4HV5A 2W25A 2W57A 1BN5A 4GCVA 1OYYA 2ISYA 4WCGA 1O3TA 1IN4A 2BV6A 5JI6A 2HEOA 1R36A 5LLQA 2JZYA 2M8EA 3CTAA 5IT9Z 4AIHA 1W5SA 2V79A 3ERED 1ZN2A 3J80Z 4EMSA 4O3MA 5DD4A 2O8XA 4KYWA 2EV6A 2XUBA 5H6RA 4G6DA 4LFUA 1SD5A 4LLGF 4WWCA 2P5LC 3HRTA 1DP7P 2A61A 5CJ9A 1YYVA 3KLNA 2D1HA 4Q5SF 3RYRA 3HYIA 4U88A 3I71A 3ZMZA 2M87A 4HBLA 1W5TA 2L54A 2XAGA 3M1EA 4HX7A 1CGPA 5DD8A 3F23A 4EM1A 4EV0A 3BROA 1EV7A 2JTVA 1TQPA 3ECHA 3Q5FA 4KA4A 1T98A 5LRRA 4EGZA 3M8FA 1O57A 3RKXA 3MAJA 3KE2A 4HDVA 3HHGA 2PLYA 3H3ZA 2ETHA 5HDGA 5BQTA 3P9IA 2OQGA 1H9GA 1P4WA 4A0YA 4YFKF 1YIOA 5L3EA 5LEKA 3LSTA 3ELKA 3MWMA 1B6AA 4ESBA 2TDXA 3J7AO 1BJAA 3CLOA 3V8LA 1ON2A 1R7JA 5CVUA 4N0BA 2HYFA 1ONVA 2ACJA 1K79A 1OYIA 2CQKA 4PZJA 1TNSA 2MH2A 1C0WA 4PGGA 1FBUA 2XRNA 2P7VB 5ICEA 3QP5A 5EEHA 2VC0A 3E6CC 2E7WA 3R0JA 4N9IA 3BOQA 5J8FA 2PI0A 2D2WA 2P8TA 1Z6RA 3FMRA 2D45A 3I59A 1QNTA 5E20A 4GXOA 1TTYA 2K02A 3ABTA 4CDGA 5FD5A 3MFKA 2UXXA 2DPDA 4HF2A 1LVAA 3HSFA 3E3VA 3HOSA 3KEOA 5D5VB 2BBYA 3I53A 5F64A 2A07F 2VN2A 1MDMA 1P6RA 3SZTA 2FNPA 1ZLKA 1LEBA 4M74A 1SD6A 3IKTA 3JSOA 1TQMA 2UZKA 2A6EF 3DPTA 2O03A 4YG2F 1J75A 2K4JA 1DUXC 3FF5A 1G6NA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5LHG A;  1XMK A;  1IN7 A;  4MNU A;  3ZMT A;  1RZ4 A;  3NRV A;  1PUE E;  4CHU A;  1S29 A;  2HR3 A;  4I02 A;  5CVJ A;  1YTY A;  3ABU A;  1KQ8 A;  2F5D A;  2PBI A;  2VBW A;  4ESF A;  2HWV A;  2YR2 A;  3C3W A;  1S6L A;  1KYW A;  2PEX A;  2FBH A;  1ZLJ A;  1F4K A;  2EWN A;  1OYW A;  4P55 A;  1K6O A;  1I6X A;  3GEZ A;  3COA C;  1IAW A;  1DDN A;  2J5O A;  2QUF A;  4L9J A;  2UXN A;  2W84 A;  1D8K A;  2J5P A;  5E18 F;  1R1V A;  3F22 A;  3KP5 A;  2V1U A;  3IKV A;  4OIR F;  3I5U A;  5D5U B;  3K9T A;  3LFK A;  1HST A;  1UST A;  4ENK A;  2XKP A;  4ASN A;  4KN4 X;  3KLO A;  1LEA A;  2Y75 A;  3R61 A;  4B09 A;  5IT9 K;  2IJL A;  1IN6 A;  1JGS A;  2PFB A;  3SHF A;  4UUV A;  3V7R A;  2COM A;  3ZMU A;  5HVQ C;  1BI1 A;  3J81 K;  1ZHF A;  5D8K B;  1J9I A;  1XMA A;  2P6T A;  1SD4 A;  3GFI A;  1TBX A;  1RIO H;  3QPT A;  5HOO A;  3WE3 A;  4HOB A;  2PN6 A;  4ZYH A;  5E17 F;  4BHP A;  1F9N A;  5FLX Z;  3WTW C;  1KA8 A;  3LAJ A;  4GGG A;  2PG4 A;  3VOE A;  1FOK A;  2O61 A;  3FXR A;  2ZFW A;  1ZRE A;  1XSV A;  1XDS A;  3SQN A;  1GVJ A;  3C1D A;  4FX0 A;  5E1Z B;  5FB2 A;  1SFU A;  2WWY A;  2VT2 A;  1FPQ A;  4L0Z B;  2ESN A;  3K0L A;  3HOT A;  3BDD A;  3KP7 A;  1R5H A;  3GVA A;  1YLF A;  2KKO A;  1P4X A;  4RB1 A;  2W85 A;  2QWW A;  2ELH A;  3WG9 A;  3TGN A;  4A12 A;  1JXS A;  2FMY A;  4HF1 A;  5DUI A;  1J2X A;  3JTH A;  2RDP A;  3L7W A;  3WGH A;  2WV0 A;  1UCR A;  4KMF A;  1J59 A;  2FBI A;  2GXB A;  2YX7 A;  4YFX F;  2FF4 A;  2DO7 A;  4WXH A;  3TOB A;  2BE5 F;  4XSX F;  5E1X A;  2VBX A;  2HQN A;  4KFC A;  2UWM A;  3WTT C;  4ON0 A;  1ZRD A;  1D8J A;  5K5Q A;  3F3X A;  2P7C B;  2VC1 A;  4HQM A;  5ERI A;  4HV6 A;  4KIG A;  1R58 A;  2EK5 A;  1IXS B;  5KK1 A;  1R22 A;  3HIF A;  2VON A;  2A6H F;  3G3Z A;  2MH9 A;  2XAQ A;  4XRF A;  1DPU A;  1O3Q A;  4EJT A;  2G9W A;  3BPX A;  1SFX A;  5DDG A;  2NS0 A;  2XAS A;  1G3S A;  1IRF A;  3JTG A;  3IWF A;  1H9T A;  1GXQ A;  2ISZ A;  3GWZ A;  5FFX A;  1ULY A;  2CO5 A;  3ZMD A;  1KYZ A;  2ZO4 A;  1HSJ A;  4EM2 A;  2D1V A;  2A3S A;  5JR3 A;  3N4M A;  4XLP F;  2H6B A;  1E17 A;  2F5F A;  1QBJ A;  1KGS A;  5E8I A;  1W7P B;  1STZ A;  1BI0 A;  4HQE A;  2IA0 A;  1R1U A;  1ZG1 A;  2Z33 A;  4UVC A;  3H92 A;  4P9F A;  4AIJ A;  1J0R A;  3HTS B;  3CUQ B;  2BYV E;  3DF8 A;  2FA5 A;  5K5R A;  2H27 A;  4P96 A;  3B73 A;  2K27 A;  1B1B A;  2FOK A;  4NHJ A;  2DK8 A;  3CJN A;  1IXC A;  2CSO A;  4U0Y A;  1J5Y A;  4LLN A;  4A2U A;  2EFO A;  4IRI A;  3F8F A;  1XGO A;  5DUK A;  2MA3 A;  1JHH A;  3G73 A;  4U0W A;  2HS5 A;  4HA8 A;  2DBB A;  4DQ2 A;  1FZP B;  2KIM A;  5CVI A;  5DCM A;  5DCM B;  5HDN A;  1YG2 A;  1HW1 A;  1Z1D A;  2FSW A;  2ZNY A;  3I54 A;  2ZCW A;  3BJ6 A;  3FHZ A;  2WTE A;  4LB6 B;  1V3F A;  2P5V A;  3R4K A;  2XAJ A;  1WSU A;  3F8B A;  4HLX A;  1ZRF A;  4AVP A;  3SZP A;  3TO9 A;  5FO5 A;  4S04 A;  1XN7 A;  4JBA A;  3OOP A;  1U2W A;  1T39 A;  5DEQ A;  3LA7 A;  2GA2 A;  3O6B B;  2RNJ A;  4ETS A;  4M71 A;  1FC3 A;  5K1Y A;  5HDK A;  2C6Y A;  5ICC A;  1SMY F;  4G8X A;  4CGZ A;  4NQW A;  4TV7 A;  4RS8 A;  2MLK A;  3TO7 A;  4DNC A;  5L3D A;  3DFG A;  1WQ2 A;  4KMU X;  1FNN A;  5AIP A;  1RI7 A;  2OZ6 A;  2LDU A;  5F6F A;  5H20 A;  3KP4 A;  4RGU A;  4AIK A;  4OIP F;  4KDP A;  4ENJ A;  5ILS A;  3WGG A;  2EA4 A;  1XDU A;  4LK1 F;  2CFX A;  4EJW A;  1NHA A;  2HTS A;  1FT9 A;  3LA2 A;  3OV8 A;  4L0Y B;  1QGP A;  5HS8 A;  2Z99 A;  5D4R A;  4BYY A;  3KFW X;  2JSC A;  1CF7 A;  2VOP A;  2JPB A;  1U5T A;  4KT5 C;  3WTU C;  2NAZ A;  4Z2Y A;  3KZY A;  1W4M A;  5HS9 A;  3FMQ A;  5LHI A;  3FXU A;  3R60 A;  1HKS A;  1QZZ A;  5LHH A;  4HX4 A;  4HYE A;  2H09 A;  4KNY A;  5CYV A;  3U9G A;  1ZG3 A;  3FMS A;  4MQV A;  1D5V A;  4YFN F;  3ROU A;  2RKH A;  1TW3 A;  4I98 B;  3GO5 A;  1YFH A;  5DV5 A;  4HZF A;  4Q48 A;  4ZYE A;  2DPU A;  2M5W A;  3T0Y A;  4UV9 A;  4M9X A;  3CUQ C;  1HW2 A;  3BJO A;  3FM3 A;  3I58 A;  4RGR A;  4U7B A;  5BMZ A;  1ODD A;  5E8G A;  2X0L A;  2F5E A;  2V1D A;  3DEU A;  2ADU A;  2OU2 A;  4R1H A;  3KP2 A;  1G3Y A;  3F8M A;  4EJV A;  1YS7 A;  1HKQ A;  2B0L A;  3ECO A;  4WXD A;  1Y0U A;  3JSP A;  2GZW A;  1FYM A;  2RGV A;  1OR7 A;  3RPU A;  2HTJ A;  2QQ9 A;  1PP8 F;  2DAO A;  1ZAO A;  2OBP A;  2XKO A;  2FU4 A;  2R3S A;  3GFJ A;  1I1G A;  1VTN C;  5D6F A;  3I59 B;  2L01 A;  3IL2 A;  4Y15 A;  2QZ8 A;  1U6G A;  1W7P D;  2MLG A;  4QWQ A;  3E97 A;  2DTR A;  3KP3 A;  1S8N A;  4HW0 A;  1JE8 A;  1QPM A;  3PFI A;  2P4W A;  4EVI A;  3WE2 A;  4LJZ F;  3E5X A;  2EV5 A;  1I5Z A;  1MKM A;  4GYI A;  1S7A A;  1BC8 C;  2ZXJ A;  4G7H F;  3V8K A;  2RVC A;  3EQL F;  3M7G A;  3V8J A;  3ML6 A;  1X3U A;  4BH9 A;  3GZ5 A;  1XSD A;  4G7Z F;  4L18 B;  2VE9 A;  1G4D A;  1XGS A;  4CXF A;  2QQB A;  3TQN A;  1PDN C;  4IHS A;  1FYL A;  3JAM K;  3RIR A;  2OD5 A;  3W6K B;  3WGI A;  2IP2 A;  3D0S A;  3LQQ A;  5ILV A;  5HLH A;  2CYY A;  4QLC U;  1UFM A;  1UHW A;  4EGY A;  5LRS A;  2H6C A;  2EFP A;  1LJ9 A;  1WKM A;  4OIO F;  4M73 A;  1G3W A;  2QVO A;  3F6O A;  5AON A;  1K7A A;  4HLY A;  3T1B A;  4ZYG A;  2VOO A;  1ZAR A;  1WRJ A;  2O6G E;  4YIF A;  2PMU A;  1P2F A;  1FSE A;  2DK5 A;  2MBF A;  4HF0 A;  4LMY A;  4YII A;  1T6S A;  2V6C A;  4LB5 A;  5LGN A;  4Q4Z F;  3RKY A;  3VEP A;  4LD5 A;  1MD0 A;  3TDU C;  1BIA A;  2A69 F;  2Y48 A;  3IWZ A;  1ZH5 A;  3REO A;  1IXR C;  3CO7 C;  3DQV C;  4S05 A;  3TO6 A;  2FE3 A;  4IPA A;  1ZGJ A;  5ICF A;  2YU3 A;  4A5N A;  4LGW A;  3E5U A;  2LNB A;  4RB3 C;  1SAX A;  1ZG5 A;  1YW7 A;  3FXQ A;  3Q9V A;  5LEJ A;  2Y0M A;  1IW7 F;  2ZKZ A;  4KIF A;  3K1P A;  2Z5U A;  4EQQ A;  2IA2 A;  3EDP A;  5JVT A;  5D4S A;  4ZH4 F;  3K1M A;  3M9A A;  3GF2 A;  4LG0 B;  4EJU A;  1O3S A;  4OU0 A;  1IZ1 A;  4KUM A;  2GWR A;  2FBK A;  3SFZ A;  3ZN0 A;  4H0E A;  2GAU A;  3GW2 A;  4A6D A;  3R0A A;  3I0T A;  1XGN A;  3WU1 B;  3ZMV A;  4CIC A;  3K2Z A;  1K78 A;  1UHM A;  3C7J A;  1QZY A;  2HDC A;  3GFL A;  5BS6 A;  3L9F A;  1FX7 A;  2EA2 A;  3P9K A;  1A04 A;  2RV8 A;  4Y13 A;  1MJ9 A;  4D0P A;  4HAM A;  5J6X A;  1IRG A;  3PQK A;  4F7Z A;  3H3U A;  5D5X B;  4UV8 A;  4KIC A;  1ON1 A;  4PDK A;  2IRF G;  3F21 A;  4BAY A;  1SMT A;  4WK8 F;  4HX8 A;  2HFH A;  3MZY A;  3W6J B;  2NNY A;  3HUG A;  2JRT A;  2M1B A;  4XLN F;  4I09 A;  2XV4 S;  1YO5 C;  2W24 A;  1BI3 A;  1L0O C;  2AS5 F;  4ZZD A;  3GLX A;  1BC7 C;  1XCV A;  3J80 K;  3DKW A;  2A68 F;  1HW5 A;  2KIU A;  4LG0 A;  3NQO A;  2P6S A;  1U5T B;  3AAF A;  5CVR A;  1TLH B;  1OMI A;  3K69 A;  1G3T A;  3RTR A;  1U5T C;  5KVR A;  2X4H A;  4L9N A;  4U0V A;  4R8H A;  5D5W B;  1AOY A;  2ESH A;  4OMY A;  1TNT A;  2STT A;  3IHU A;  1REP C;  4ENM A;  4UNO A;  2Q2E A;  3KET A;  4M6X A;  1LDD A;  4I01 A;  2RQP A;  4I7H A;  1B9N A;  1J7K A;  3LWF A;  3HRS A;  4IJA A;  3VB2 A;  3E6D A;  2QEN A;  3V7C A;  1HKT A;  1U8R A;  1XB4 A;  5DCF A;  2FXA A;  4M9S A;  4A5M A;  3ISP A;  3F72 A;  1FSH A;  5ED4 A;  3ZQ7 A;  3L2C A;  3U2R A;  3E6B A;  4CYD A;  4M72 A;  2EJR A;  2YX4 A;  3TOA A;  4OOI A;  3GUD A;  2KIF A;  2HGC A;  5HLI A;  3HHH A;  2GA1 A;  4GYG A;  2QLZ A;  3QPH A;  2OQR A;  3MEX A;  4RAY A;  3RDI A;  3TDZ C;  3E6M A;  3KZZ A;  3DV8 A;  4IVN A;  3EYI A;  2ZME A;  4U7D A;  1EH7 A;  4PCQ A;  4AWX B;  2EFN A;  3Q9S A;  4FX4 A;  4EM0 B;  1SFE A;  3LAP A;  5CVV A;  3JW4 A;  1F1Z A;  2HOE A;  3GFM A;  5A2Q Z;  1BM9 A;  1SD7 A;  3M8E A;  5F1R A;  1IUY A;  1MGT A;  4WX9 A;  3RKW A;  3B02 A;  3RI4 A;  3F6V A;  3KP6 A;  2FRH A;  1HBX G;  4ESJ A;  2WC2 A;  2Z3Y A;  1Z6T A;  3N97 A;  2VXZ A;  1HQC A;  2CG4 A;  4O6J A;  2VE8 A;  4XSZ F;  4NB5 A;  5LGT A;  2IW5 A;  5FD6 A;  1IF1 A;  3DP7 A;  1FBS A;  2PJP A;  4UXN A;  1KU3 A;  1GXP A;  1XCB A;  3L00 A;  3QP6 A;  2YPR A;  5J8C A;  3CDH A;  4GO1 A;  4OIN F;  4HDU A;  2Z9O A;  1CF7 B;  1LQ1 A;  4BHB A;  2MD5 A;  4CO8 A;  4G6Q A;  5L3B A;  3ZP5 A;  5D6E A;  2FQ3 A;  2PMH A;  5ICG A;  3PQJ A;  2O3F A;  4KIB A;  1B59 A;  3I4P A;  3MQ0 A;  2XVC A;  3GZ6 A;  4IF4 A;  3FM5 A;  2XAH A;  4K2E A;  4BXU A;  5FLX K;  2E1N A;  5JFR A;  2XIG A;  1H0M A;  1B9M A;  1T0F A;  2L3D A;  3QU3 A;  4RAZ A;  2R7D A;  4MGR A;  4O5V A;  5D8L B;  4IRH A;  3I64 A;  2ZNZ A;  2DQL A;  2VOD A;  1EH8 A;  1B4A A;  2NYX A;  4AD9 A;  1FP2 A;  3V7S A;  3WTY C;  1EH6 A;  2QBY A;  1KU2 A;  5BOX A;  2HYG D;  2M30 A;  2H94 A;  1JHF A;  2L4M A;  2E7X A;  2G7H A;  3TKY A;  2HZT A;  4G9Y A;  1YW9 A;  1IN5 A;  2Q8K A;  4WF2 A;  1LDK B;  3BP8 A;  1O3R A;  1UB9 A;  1FYK A;  4B8X A;  4IHT A;  1FY7 A;  4IXA A;  3HSR A;  1GHC A;  4I0B A;  5CLS A;  1Z91 A;  3CUQ A;  1R1T A;  4M9Z A;  2LF8 A;  3WTX C;  2HKX A;  1R5G A;  2NRA C;  3WOD F;  1FWZ A;  4UHT A;  1W7P A;  2ZME B;  2OZU A;  1R00 A;  4ENN A;  1HXD A;  3WTS C;  2OA4 A;  5TJJ A;  2XRO A;  3IRQ A;  5BPD A;  4EJO A;  3GYH X;  4RB0 A;  2MC3 A;  2JT1 A;  1Z7U A;  4CZZ A;  1U3E M;  1ZGA A;  4N9H A;  3RJP A;  4OIQ F;  4ZZL A;  3WTZ A;  5TRD A;  3ULQ B;  2LKP A;  1WI9 A;  4UVB A;  5ILU A;  5BPI A;  1S3J A;  3KEQ A;  2VBY A;  3RYP A;  3BWG A;  3QRF F;  1Q1H A;  2DFI A;  3BY6 A;  4L9T A;  3K1N A;  4XBF A;  1KU7 A;  2GXG A;  2ZJ2 A;  1R23 A;  3LQR A;  1KQ0 A;  3FWE A;  2HQR A;  3F8C A;  2OAZ A;  2FEZ A;  2QQA A;  3P7N A;  2RN7 A;  4Y17 A;  3MCZ A;  3SXY A;  1RNL A;  2BGC A;  3NEU A;  1BOA A;  3FX3 A;  2RC4 A;  3RPQ A;  3HTU A;  2KRF A;  1O7L A;  3D5L A;  5DYM A;  1P92 A;  2FML A;  5JHU A;  2YSR A;  3BZ6 A;  3CUO A;  4MEY F;  2IA1 A;  3J81 Z;  2A5Y B;  2V1X A;  5L3G A;  1PP7 U;  2JPC A;  4L9V A;  4PGH A;  3QU6 A;  3E5Q A;  1I1S A;  5FGM A;  2CWE A;  2CW0 F;  3EUH A;  1XSX A;  4BHC A;  1WWX A;  1MJA A;  1USS A;  5HS7 A;  4R79 A;  3P9C A;  2M45 A;  3DXJ F;  1FBQ A;  1YW8 A;  2NNN A;  1S7O A;  1FP1 D;  2QM3 A;  1T38 A;  4LLL A;  4KN7 X;  3R6S A;  1ZRC A;  4L5I A;  3WTV C;  2QBY B;  3BJA A;  2XAF A;  3QOP A;  3LA3 A;  4MEX F;  1K78 B;  2G7U A;  2E1C A;  1OKR A;  1Z05 A;  5K5O A;  2K4B A;  3VFZ A;  1L3L A;  3ZPL A;  5LGU A;  4L5J A;  3L09 A;  1XGM A;  1T2K A;  3EYY A;  1D3Y A;  1KU9 A;  2V9V A;  3U1D A;  2R7F A;  2PQ8 A;  1TQI A;  1LDJ A;  2F2E A;  1QQI A;  2IPQ X;  1MDM B;  1BI2 A;  2EFW A;  4FHT A;  3ZN1 A;  2EFQ A;  2DLL A;  4MHG A;  3EET A;  1KQ9 A;  1QO0 D;  5FFZ A;  5H6Q A;  4A0X A;  2STW A;  4Q47 A;  4FT8 A;  1FLI A;  3VOD A;  3F8N A;  2DI3 A;  4ZYD A;  4MQ9 F;  2L4A A;  2GIV A;  4IRG A;  2LSO A;  2IT0 A;  1TW2 A;  2L02 A;  2P5K A;  1P4A A;  3BPV A;  4RGX A;  5EEG A;  1DPR A;  3GX4 X;  4JK1 X;  1V4R A;  5E1W A;  4WXC A;  2ZBK A;  2Q0O A;  3HRM A;  2KJC A;  4P5O A;  2FNA A;  4LK0 F;  1O7F A;  4M6Y A;  1E2X A;  2DT5 A;  4RGS A;  4G7O F;  3ZMS A;  2DU9 A;  2F5C A;  4RB2 C;  3IRR A;  2CGP A;  4P9U A;  4OMZ A;  2K7L A;  5L3C A;  1BIB A;  5A2Q K;  3CO6 C;  2VT3 A;  1YQA A;  1F5T A;  2EV0 A;  5HLG A;  2VBZ A;  3DPL C;  3KCC A;  5AIQ A;  3GXO A;  3JAM Z;  2K86 A;  1RUN A;  4MTD A;  2LF7 A;  2GQQ A;  3FZV A;  3S2W A;  6PAX A;  1YS6 A;  1XD7 A;  4G94 A;  3T8T A;  4E70 A;  2HKO A;  4UVA A;  1LB2 A;  1U78 A;  3HRU A;  2O0Y A;  3V4G A;  4I0A A;  1ZYR F;  3T5X A;  2BEO A;  3O2P E;  4MTE A;  4I2O A;  2IVM A;  3QAH A;  2XGX A;  1Z9C A;  1OPC A;  3IC7 A;  4A6E A;  3T8R A;  2EB7 A;  1I27 A;  1MJB A;  3WU0 A;  5L3F A;  1AWC A;  1IN8 A;  3O3K A;  5IT3 A;  1BBY A;  2KJB A;  4BQA A;  1RUO A;  3C18 A;  2QYO A;  4BNC A;  1MZB A;  3HSE A;  2XHK A;  2DQR A;  2AXL A;  3MZH A;  1LNW A;  2DW4 A;  4JQF A;  4A0Z A;  5LBQ A;  4HV5 A;  2W25 A;  2W57 A;  1BN5 A;  4GCV A;  1OYY A;  2ISY A;  4WCG A;  1O3T A;  1IN4 A;  2BV6 A;  5JI6 A;  2HEO A;  1R36 A;  5LLQ A;  2JZY A;  2M8E A;  3CTA A;  5IT9 Z;  4AIH A;  1W5S A;  2V79 A;  3ERE D;  1ZN2 A;  3J80 Z;  4EMS A;  4O3M A;  5DD4 A;  2O8X A;  4KYW A;  2EV6 A;  2XUB A;  5H6R A;  4G6D A;  4LFU A;  1SD5 A;  4LLG F;  4WWC A;  2P5L C;  3HRT A;  1DP7 P;  2A61 A;  5CJ9 A;  1YYV A;  3KLN A;  2D1H A;  4Q5S F;  3RYR A;  3HYI A;  4U88 A;  3I71 A;  3ZMZ A;  2M87 A;  4HBL A;  1W5T A;  2L54 A;  2XAG A;  3M1E A;  4HX7 A;  1CGP A;  5DD8 A;  3F23 A;  4EM1 A;  4EV0 A;  3BRO A;  1EV7 A;  2JTV A;  1TQP A;  3ECH A;  3Q5F A;  4KA4 A;  1T98 A;  5LRR A;  4EGZ A;  3M8F A;  1O57 A;  3RKX A;  3MAJ A;  3KE2 A;  4HDV A;  3HHG A;  2PLY A;  3H3Z A;  2ETH A;  5HDG A;  5BQT A;  3P9I A;  2OQG A;  1H9G A;  1P4W A;  4A0Y A;  4YFK F;  1YIO A;  5L3E A;  5LEK A;  3LST A;  3ELK A;  3MWM A;  1B6A A;  4ESB A;  2TDX A;  3J7A O;  1BJA A;  3CLO A;  3V8L A;  1ON2 A;  1R7J A;  5CVU A;  4N0B A;  2HYF A;  1ONV A;  2ACJ A;  1K79 A;  1OYI A;  2CQK A;  4PZJ A;  1TNS A;  2MH2 A;  1C0W A;  4PGG A;  1FBU A;  2XRN A;  2P7V B;  5ICE A;  3QP5 A;  5EEH A;  2VC0 A;  3E6C C;  2E7W A;  3R0J A;  4N9I A;  3BOQ A;  5J8F A;  2PI0 A;  2D2W A;  2P8T A;  1Z6R A;  3FMR A;  2D45 A;  3I59 A;  1QNT A;  5E20 A;  4GXO A;  1TTY A;  2K02 A;  3ABT A;  4CDG A;  5FD5 A;  3MFK A;  2UXX A;  2DPD A;  4HF2 A;  1LVA A;  3HSF A;  3E3V A;  3HOS A;  3KEO A;  5D5V B;  2BBY A;  3I53 A;  5F64 A;  2A07 F;  2VN2 A;  1MDM A;  1P6R A;  3SZT A;  2FNP A;  1ZLK A;  1LEB A;  4M74 A;  1SD6 A;  3IKT A;  3JSO A;  1TQM A;  2UZK A;  2A6E F;  3DPT A;  2O03 A;  4YG2 F;  1J75 A;  2K4J A;  1DUX C;  3FF5 A;  1G6N A; 
#chains in the Genus database with same CATH topology
 2DMT A;  4IEJ A;  1P7I A;  5LHG A;  1QU3 A;  1XMK A;  4AC0 A;  1IN7 A;  4PSW A;  2Z1D A;  4MNU A;  3ZMT A;  1RZ4 A;  3LOC A;  3NRV A;  1UJ8 A;  4AM3 A;  4LIU A;  5B1A H;  1PUE E;  3B6A A;  5EF6 A;  4CHU A;  1GV2 A;  1S29 A;  2HR3 A;  3OSF A;  4I02 A;  2A5W A;  5CVJ A;  1YTY A;  3HB9 A;  3ABU A;  3CJR B;  1KQ8 A;  2F5D A;  3GZN B;  2PBI A;  2VPL A;  3AG4 H;  2VBW A;  3G1L A;  4ESF A;  2HWV A;  2YR2 A;  2EIL H;  5J4V A;  2LYC A;  2KDO A;  3JRH A;  1T8I A;  1J09 A;  3C3W A;  3C2B A;  3L1P A;  2VKE A;  3OYD A;  2VKV A;  4YIR X;  1IJW C;  1S6L A;  2L0K A;  1KYW A;  2PEX A;  3C2H A;  2FBH A;  1ZLJ A;  1F4K A;  2EWN A;  1OYW A;  2KDZ A;  1IC8 A;  2XSD C;  4P55 A;  2X1D A;  1O4X A;  2XDV A;  1X2N A;  1K6O A;  2PJR A;  1I6X A;  3GEZ A;  5JVG F;  5IYC J;  3COA C;  1IAW A;  1DDN A;  3FDY A;  2E34 A;  4A93 J;  2J5O A;  2WAQ N;  1MBK A;  2ELJ A;  2QUF A;  4L9J A;  2UXN A;  2W84 A;  1VQM I;  1D8K A;  2J5P A;  3K6G A;  1R1V A;  5E18 F;  3F22 A;  2IGO A;  3KP5 A;  2V1U A;  5E79 C;  3IAS 2;  1UHS A;  3IKV A;  4OIR F;  1T95 A;  3I5U A;  1EA3 A;  1MBH A;  1BR2 A;  4N4N B;  5D5U B;  2DMQ A;  3G1M A;  3H5A A;  3K9T A;  3IV5 A;  3LFK A;  1HST A;  1HDD C;  2NVX J;  1UST A;  2UV1 A;  4ENK A;  1FEX A;  2XKP A;  2AO9 A;  1TWG J;  2HOT A;  4ASN A;  3PIP F;  4CSW A;  4Y4R A;  3HPG A;  3OYB A;  4KN4 X;  3KLO A;  1LEA A;  2Y75 A;  3R61 A;  3OIP A;  4B09 A;  4A3B J;  3ZQF A;  5HNH A;  2DTZ A;  3OYA A;  3S14 J;  5IT9 K;  2JK3 A;  4UB8 C;  2IJL A;  3TW7 A;  1IN6 A;  1JGS A;  3S3O A;  1P9Q C;  2HVR A;  2PFB A;  3SHF A;  4UUV A;  5FKN A;  4XK4 A;  5B3S H;  5EGO A;  4AYB N;  4XR6 A;  4MIM A;  5DTD A;  3V7R A;  2IGN A;  2COM A;  1U9N A;  3ZMU A;  4IHX A;  5HVQ C;  4XKV A;  1BI1 A;  3J81 K;  1ZHF A;  4PJL A;  5D8K B;  4YRV A;  1J9I A;  1XMA A;  2MC4 A;  2P6T A;  3QPL A;  1SD4 A;  1DGR M;  3GFI A;  1TBX A;  1RIO H;  3QPT A;  3HGG A;  3A03 A;  5HOO A;  3WE3 A;  4HOB A;  2PN6 A;  4ZYH A;  2DN0 A;  5E17 F;  4BHP A;  1F9N A;  4BQO A;  5IOZ A;  2LLK A;  5FLX Z;  3WTW C;  1KA8 A;  3LAJ A;  3LSP A;  4GGG A;  3CCY A;  2PG4 A;  1JUP A;  2L9V A;  3VOE A;  2E71 A;  1FOK A;  2O61 A;  3FXR A;  3K4M A;  2ZFW A;  1ZRE A;  3SZG A;  1U0J A;  1XSV A;  2COB A;  1XDS A;  4LOC A;  5F1J A;  4J00 A;  2R7X A;  2FX0 A;  3SQN A;  1GVJ A;  3C1D A;  3MN2 A;  4FX0 A;  5E1Z B;  1PUF B;  5FB2 A;  1SFU A;  3G1O A;  1QHH D;  2WWY A;  2VT2 A;  1FPQ A;  5FRN A;  4L0Z B;  2LR8 A;  2ESN A;  3K0L A;  3HOT A;  3BDD A;  3KP7 A;  1R5H A;  3GVA A;  2LVS A;  1YLF A;  2KKO A;  4HST A;  4BJ5 C;  1P4X A;  5IP6 A;  3AL0 C;  2CQX A;  4RB1 A;  2K9S A;  4I76 A;  2DA1 A;  2W85 A;  2AQF A;  2QWW A;  3BG7 A;  2ELH A;  4DJA A;  3H3V K;  3H35 A;  3CMA I;  3WG9 A;  3NAR A;  2VLA A;  3HJE A;  3ABL H;  2KPM A;  3BT9 A;  2XC7 A;  3TGN A;  4A12 A;  1ERD A;  1JXS A;  2FMY A;  4HF1 A;  5DUI A;  2TRT A;  1J2X A;  1G59 A;  1V54 H;  1JGG A;  3M4O J;  1NH3 A;  4ITV A;  2M0C A;  2EIJ H;  2L9N A;  1OCR H;  3JTH A;  4ZDL A;  2RDP A;  4NNJ A;  3L7W A;  3WGH A;  3OWT A;  2WV0 A;  1UCR A;  4KMF A;  1J59 A;  3OMY A;  2FBI A;  1WH7 A;  3DBH B;  5FJ8 J;  2BHY A;  2LRE A;  3OSG A;  2GXB A;  2YX7 A;  4YFX F;  3E0J B;  3S1N J;  2FF4 A;  2DO7 A;  3FK7 A;  4WXH A;  4RLQ A;  2ZSH B;  3TOB A;  2BE5 F;  4XSX F;  5E1X A;  2LC2 A;  2W1O A;  2X6X A;  4Y33 A;  2VBX A;  2HQN A;  3SDG A;  4KFC A;  2UWM A;  3ZQI A;  2HI3 A;  3WTT C;  4M3B A;  4BUP A;  4ON0 A;  1ZRD A;  1D8J A;  2HU9 A;  1YJW I;  5K5Q A;  2HDW A;  4F52 A;  2K9Q A;  3F3X A;  2P7C B;  2DMP A;  2VC1 A;  4HQM A;  4BY1 J;  3KYD B;  5ERI A;  4HV6 A;  2DFH A;  4KIG A;  4B48 A;  1R58 A;  2EK5 A;  2KIQ A;  3J7Z I;  1IXS B;  5J1Y A;  1JJ6 C;  5C3E J;  5KK1 A;  1R22 A;  5F0H A;  2Q2E B;  3HIF A;  2VON A;  2A6H F;  3G3Z A;  2MH9 A;  2XAQ A;  2EIK H;  3BQZ A;  4XRF A;  4PSX A;  1DPU A;  3OYH A;  1O3Q A;  4EJT A;  1UZC A;  2G9W A;  3BPX A;  1SFX A;  4HG2 A;  5DDG A;  2ECB A;  2NS0 A;  3UR3 C;  1MMD A;  4PFP A;  3N05 A;  2DA5 A;  2XAS A;  1G3S A;  1IRF A;  3X2Q H;  3JTG A;  1OIS A;  3IWF A;  1H9T A;  1GXQ A;  2LD5 A;  2ISZ A;  4RA2 A;  3VSK A;  3GWZ A;  1UG2 A;  5FFX A;  3CF2 A;  1X2M A;  3KEY A;  1ULY A;  2CO5 A;  2RRE A;  1MMG A;  1QRY A;  3ZMD A;  2VJ5 A;  1KYZ A;  2ZO4 A;  2CUZ A;  1HSJ A;  4EM2 A;  2D1V A;  2A3S A;  3FXL A;  5JR3 A;  3N4M A;  4XLP F;  1JKP C;  1RKW A;  5EG0 A;  2H6B A;  1E17 A;  2F5F A;  4NC7 A;  4D7N A;  2LFB A;  1K83 J;  3RSN A;  1QBJ A;  1KGS A;  3FXK A;  5E8I A;  1W7P B;  1STZ A;  1BI0 A;  2IA0 A;  3C2G A;  4HQE A;  1R1U A;  1TWF J;  1ZG1 A;  1V5E A;  2Z33 A;  2IS2 A;  4ZDO A;  2RNG A;  4UVC A;  4CCO A;  2NS8 A;  3H92 A;  4P9F A;  4AIJ A;  2DCE A;  1J0R A;  3ASN H;  3HTS B;  2X6O A;  3CUQ B;  2LRD A;  2BYV E;  3DF8 A;  4BJ6 C;  4ABZ A;  2FA5 A;  5K5R A;  2H27 A;  4CCK A;  1YI2 I;  3Q0W A;  4BQQ A;  4UUT A;  1W1W E;  4AU7 A;  1JTY A;  1FJL A;  3EPZ A;  3K70 D;  5FKM A;  5FLV A;  2LTP A;  4P96 A;  3B73 A;  4W1U A;  5JLW A;  2F5V A;  2K27 A;  1B1B A;  2B9S A;  1GDT A;  3OYG A;  2FOK A;  4NHJ A;  2DK8 A;  2B7E A;  1K61 A;  4FET A;  1FOW A;  3CJN A;  1IXC A;  3H0G J;  1Y8R B;  2CSO A;  4U0Y A;  3BTL A;  1J5Y A;  4RLF A;  4LLN A;  4A2U A;  3DKY A;  2EFO A;  4IRI A;  3F8F A;  1XGO A;  5DUK A;  2MA3 A;  4CCN A;  1JHH A;  3G73 A;  4U0W A;  2HS5 A;  4HA8 A;  2JWT A;  2A6T A;  2R7Q A;  3D5R C;  3QOD A;  2DBB A;  4DQ2 A;  3MKY B;  2ZME C;  3BG9 A;  4XOR A;  4EEF G;  3ZQC A;  2BY1 A;  1FZP B;  1VQK I;  4IL6 C;  4DBR A;  2KIM A;  5CVI A;  3K4K A;  5DCM A;  4CYC A;  3JRB A;  1BW6 A;  5DCM B;  4D5C A;  4CYC B;  2WB1 N;  2O9L A;  1MMA A;  5HDN A;  3DCF A;  1U8B A;  1YG2 A;  1HW1 A;  1Z1D A;  4A3K J;  1I6H J;  2FSW A;  2ZNY A;  3I54 A;  5K7H A;  4B43 A;  2ZCW A;  3OYI A;  3BJ6 A;  3FHZ A;  2WTE A;  4LB6 B;  2PJR B;  1V3F A;  4XRS A;  2GIZ A;  2P5V A;  3R4K A;  2XAJ A;  1WSU A;  4LIT A;  4C9Y A;  3F8B A;  3LFU A;  4HLX A;  3RKQ A;  1ZRF A;  4MFD A;  1YX3 A;  4AVP A;  3SZP A;  2LG4 A;  1ETX A;  3TO9 A;  5FO5 A;  4S04 A;  1XN7 A;  4JBA A;  1JJ8 C;  3OOP A;  2HOS A;  1U2W A;  4C3J J;  3KIO A;  1T39 A;  2ZJQ F;  5DEQ A;  3LA7 A;  2GA2 A;  5GPC A;  3O6B B;  3S1R J;  2RNJ A;  2XF7 A;  4ETS A;  4BE0 A;  1FMV A;  4M71 A;  1FC3 A;  2Y2Z A;  2HQA A;  3L2R A;  3H9G A;  5K1Y A;  5B1B H;  5HDK A;  2F4I A;  3S17 J;  2C6Y A;  4IHW A;  1OCO H;  5ICC A;  2QEX I;  3QWL A;  1SMY F;  3EUH C;  4G8X A;  3HKZ A;  4CGZ A;  4NQW A;  4TV7 A;  4RS8 A;  2MLK A;  3TO7 A;  3PIO F;  4DNC A;  2DMU A;  5L3D A;  3DFG A;  1WQ2 A;  2R7T A;  4KMU X;  1FNN A;  5AIP A;  1RI7 A;  4E7I A;  1BA5 A;  2OZ6 A;  2LDU A;  5F6F A;  1ETY A;  4OWR B;  5H20 A;  3CCU I;  1IUF A;  5GTH C;  3KP4 A;  2JMW A;  4RGU A;  4XKW A;  4AIK A;  4OIP F;  4KDP A;  1MMS A;  1VQ7 I;  4ENJ A;  5ILS A;  4KT6 A;  1ZQ3 P;  3WGG A;  2CW7 A;  3BC8 A;  2MFZ A;  2EA4 A;  1LE8 B;  1XDU A;  2NVQ J;  1ZK8 A;  3GBG A;  4LK1 F;  2CFX A;  4EJW A;  1NHA A;  3M3Y J;  4QIW N;  2HTS A;  1FT9 A;  2E5N A;  1S72 I;  4XNF A;  3LA2 A;  3I3L A;  3OV8 A;  4L0Y B;  1QGP A;  5HS8 A;  4A3L J;  2Z99 A;  2DJI A;  5D4R A;  4BYY A;  1GVD A;  3KFW X;  2JSC A;  1CF7 A;  2VJJ A;  4FCY A;  1LFP A;  2OF7 A;  2VOP A;  2JPB A;  1U5T A;  3AFH A;  3PM1 A;  4KT5 C;  4II3 A;  4BE1 A;  3WTU C;  2NAZ A;  4Z2Y A;  1MBE A;  2E1O A;  4D7M A;  3CC7 I;  3OOU A;  1Z3X A;  3KZY A;  1OCZ H;  1W4M A;  1R49 A;  5HS9 A;  2R5Z A;  1A35 A;  3FMQ A;  2Z16 A;  2R7R A;  5LHI A;  3FXU A;  3R60 A;  1HKS A;  1QZZ A;  5LHH A;  2H1L A;  3KX2 A;  4HX4 A;  1MNE A;  1W5C C;  2I5U A;  3GLL A;  4HYE A;  1PUF A;  2OTJ I;  5GAD J;  2JA6 J;  2H09 A;  4KNY A;  5CYV A;  3U9G A;  1ZG3 A;  1W36 C;  3FMS A;  4MQV A;  1D5V A;  1AKH B;  4YFN F;  3ROU A;  2LH9 A;  2RKH A;  1TW3 A;  4I98 B;  3HOU J;  3GO5 A;  1WJB A;  1YFH A;  2BXZ A;  2AQE A;  5DV5 A;  1JUM A;  3I56 I;  4HZF A;  2W82 A;  4B44 A;  4Q48 A;  4ZYE A;  4IOC F;  2DPU A;  2M5W A;  5DS9 A;  3T0Y A;  4UV9 A;  4M9X A;  3CC2 I;  2KLO A;  2MAB A;  3CUQ C;  1HW2 A;  3BJO A;  3FM3 A;  1YE9 A;  3I58 A;  4RGR A;  4U7B A;  5BMZ A;  1ODD A;  5E8G A;  2X0L A;  4IZZ A;  1H8A C;  4HNV A;  2F5E A;  2DOF A;  1JKO C;  2V1D A;  3DEU A;  1XPX A;  5FKL A;  2LKS A;  3CDI A;  2ADU A;  5H2F C;  2OU2 A;  4R1H A;  3KP2 A;  1G3Y A;  2OUM A;  1X3Z B;  3F8M A;  4EJV A;  1YS7 A;  1HKQ A;  2LMD A;  4M6V A;  2B0L A;  1PJR A;  3ECO A;  4WXD A;  1Y0U A;  4AVZ A;  3JSP A;  2GZW A;  2L9R A;  2L7M P;  1PVE A;  1FYM A;  2RGV A;  4BDY A;  3H1C A;  1OR7 A;  3RPU A;  2HTJ A;  2QQ9 A;  1PP8 F;  3LSR A;  2DAO A;  2QSG X;  1ZAO A;  5BNG A;  2OBP A;  2XKO A;  1VQ4 I;  2FU4 A;  2R3S A;  3GFJ A;  1I1G A;  1VTN C;  5D6F A;  3I59 B;  2L01 A;  3IL2 A;  4PJ0 C;  4Y15 A;  2JN6 A;  1U6G A;  2QZ8 A;  2X6Y A;  1W7P D;  1D1A A;  2L7Z A;  5JHF A;  2MLG A;  4ZYA A;  4QWQ A;  3BR0 A;  2V7F A;  3E97 A;  1XS9 A;  3OYF A;  2DTR A;  2IBD A;  1BJZ A;  2EIM H;  5HLT A;  2IS6 A;  5TIS C;  3KP3 A;  1S8N A;  4HW0 A;  1JE8 A;  1QPM A;  3K10 A;  5KCM A;  3K7A J;  3PFI A;  2P4W A;  2CS3 A;  4EVI A;  1DGW Y;  2Y69 H;  4PUS A;  3WE2 A;  4LJZ F;  3E5X A;  2EV5 A;  4A3E J;  1I5Z A;  1MKM A;  1WVR A;  4GYI A;  1LUJ B;  1S7A A;  1BC8 C;  1S5L C;  2ZXJ A;  4G7H F;  2NVY J;  2RVC A;  3V8K A;  3EQL F;  2CRG A;  2BY3 A;  3M7G A;  3V8J A;  3ML6 A;  1X3U A;  4JOM A;  4BH9 A;  4D9J A;  3GZ5 A;  1XSD A;  4G7Z F;  2QCO A;  4L18 B;  2VE9 A;  1G4D A;  1XGS A;  4A3J J;  1MH4 A;  5FKO A;  4CXF A;  3OYK A;  3OYN A;  3PUF A;  2Q1Z B;  2QQB A;  3TQN A;  3Q0U A;  1PDN C;  4RDU A;  4IHS A;  1FYL A;  3JAM K;  3RIR A;  2OD5 A;  3W6K B;  2QA4 I;  1Y39 A;  3WGI A;  2E19 A;  2IP2 A;  4OAY A;  3D0S A;  1U9O A;  1N78 A;  2KZV A;  3LQQ A;  2WA0 A;  3M1C A;  1WHU A;  1VQ8 I;  5ILV A;  5HLH A;  4BDZ A;  2HOA A;  2CYY A;  4QLC U;  1UFM A;  2NXN B;  1UHW A;  2XRL A;  4EGY A;  2QF7 A;  5LRS A;  2VQC A;  5K7F A;  2E2I J;  4FE4 A;  2H6C A;  2EFP A;  3QYB A;  1LJ9 A;  1WKM A;  1X1P A;  3K2A A;  3AG2 H;  5E3O A;  2ZFU A;  4M73 A;  1G3W A;  1YIJ I;  4OIO F;  4XLH A;  2QVO A;  2CQ7 A;  3F6O A;  5AON A;  1K7A A;  4PFO A;  4HLY A;  3T1B A;  4ZYG A;  2AXT C;  2VOO A;  1ZAR A;  2F4M B;  1WRJ A;  1D5Y A;  2O6G E;  5IPA A;  1DP3 A;  3SDB A;  4YIF A;  2PMU A;  1P2F A;  3HGY A;  2Y0S N;  5KHD A;  1Q1V A;  2NOJ B;  3RCO A;  1FSE A;  4BEH A;  1R5I D;  2DK5 A;  2MBF A;  2Y31 A;  3A4C A;  3WHC A;  2WAQ A;  2AHQ A;  5IYD J;  2M9H A;  2WB1 A;  4HF0 A;  4LMY A;  4YII A;  2ID3 A;  3OYL A;  1T6S A;  2V6C A;  1IO2 A;  4LB5 A;  5LGN A;  4Q4Z F;  3HBL A;  3RKY A;  2V4J C;  4A3G J;  3A0B C;  2OV7 A;  3ABK H;  4XLE A;  3VEP A;  2KP6 A;  4LD5 A;  3UKG A;  1MD0 A;  3TDU C;  4QTR A;  1BIA A;  2A69 F;  1Z7L A;  5EEA A;  4IOA F;  5M3M J;  1IV6 A;  2W48 A;  1BR4 A;  2Y48 A;  3IWZ A;  1ZH5 A;  4BBR J;  3OIQ A;  3GCM A;  4DOZ A;  4ZJZ A;  3REO A;  2XF5 A;  4XL9 A;  2M34 A;  1IXR C;  3CO7 C;  2IS1 A;  3DQV C;  2R7O A;  4S05 A;  3ZQQ A;  2K9L A;  2WV1 A;  3TO6 A;  3OYM A;  2FE3 A;  1VFC A;  1NG6 A;  4IPA A;  1ZGJ A;  5ICF A;  2YU3 A;  2LKX A;  4A5N A;  4RMN A;  4LGW A;  2OTL I;  1WFX A;  3E5U A;  5JLX A;  3CCM I;  2LNB A;  2CU7 A;  4RB3 C;  2ZSI B;  1SAX A;  1ZG5 A;  2EZI A;  3G6E I;  1YW7 A;  2FQ4 A;  2X9D A;  3FXQ A;  3Q9V A;  5IP7 J;  1SVL A;  5LEJ A;  4C30 A;  2Y0M A;  2DA4 A;  1IW7 F;  2ZKZ A;  4KIF A;  1VQ6 I;  3K1P A;  1LFB A;  3AL0 B;  3I4N J;  5TGT A;  2Z5U A;  4EQQ A;  2IA2 A;  3EDP A;  5JVT A;  5D4S A;  3DTK A;  2CMP A;  1WI3 A;  1UEL B;  4ZH4 F;  3K1M A;  1ETO A;  3M9A A;  3GF2 A;  1T33 A;  2D5V A;  4EJU A;  2GXA A;  1O3S A;  4LG0 B;  2K3F A;  1UG0 A;  4OU0 A;  1IZ1 A;  4KUM A;  3ZQH A;  2GWR A;  2X85 A;  2FBK A;  3SFZ A;  3ZN0 A;  4H0E A;  3FXO A;  3ZXS A;  2GAU A;  3DBL B;  3CQZ J;  3GW2 A;  4A6D A;  4AYB A;  1RRJ A;  3R0A A;  3I0T A;  3HZJ A;  1XGN A;  3WU1 B;  4ZC3 A;  3QOE A;  2K9N A;  2DOA A;  3ZMV A;  4CIC A;  3K2Z A;  4B3X A;  1K78 A;  1UHM A;  3C7J A;  1QZY A;  2HDC A;  4Y52 J;  3GFL A;  4FQG A;  1WJC A;  5BS6 A;  3L9F A;  1FX7 A;  2EA2 A;  3P9K A;  1A04 A;  2Y0S A;  3ABM H;  2DYS H;  3JRD A;  2RV8 A;  3QYE A;  4X0G A;  3OL4 A;  1XG1 A;  3UNG C;  4Y13 A;  3AKZ A;  1MJ9 A;  4D0P A;  4X6A J;  4HAM A;  5J6X A;  1E0E A;  4HEA 2;  1IRG A;  3PQK A;  2PMZ N;  5GP9 A;  4F7Z A;  3H3U A;  5D5X B;  4UV8 A;  4KIC A;  4JP0 A;  3BQY A;  2DOE A;  3BTC A;  4H4K C;  2XF6 A;  5FLM J;  1ON1 A;  4PDK A;  1IGN A;  2R5Z B;  2M7A A;  3JRI A;  2IRF G;  3F21 A;  2BY0 A;  4BAY A;  1SMT A;  2RQQ A;  4WK8 F;  3KYC B;  3G4S I;  4HX8 A;  2HFH A;  3MZY A;  3W6J B;  2NNY A;  2BZT A;  3HUG B;  3FBN B;  2BHZ A;  3HUG A;  2WY7 Q;  2JRT A;  2KQR A;  4E7S A;  1VQN I;  2ICW G;  3CMM A;  1DU0 A;  1VND A;  3TMO A;  1QZE A;  2M1B A;  4XLN F;  5EGO B;  2JUG A;  4I09 A;  3SJM A;  2IS4 A;  2L7F P;  2L5Q A;  3IP4 B;  2XV4 S;  3L2U A;  4QPQ A;  1YO5 C;  3DLA A;  2W24 A;  1BI3 A;  1L0O C;  2AS5 F;  3I4M J;  4ZZD A;  4D5F A;  3GLX A;  1BC7 C;  5GAG J;  2R7S A;  1HOM A;  1XCV A;  3BZC A;  3HKZ N;  2JUC A;  3J80 K;  1B8I A;  1VI0 A;  2FD5 A;  2A68 F;  3DKW A;  1HW5 A;  2KIU A;  1NG7 A;  4LG0 A;  2JQ7 A;  1V55 H;  3GTL J;  3CJQ B;  1GLN A;  3CCQ I;  1JTX A;  1LFU P;  3NQO A;  2P6S A;  1U5T B;  3E1S A;  3OY9 A;  3I55 I;  5CVR A;  1TLH B;  3AAF A;  1OMI A;  1TC3 C;  2Y9Y A;  4W97 A;  3K69 A;  1G3T A;  4P1W A;  2X1C A;  4XIC A;  3RTR A;  4NBQ A;  2EZK A;  1U5T C;  5KVR A;  2X4H A;  3FIS A;  2R7Z J;  4L9N A;  4U0V A;  4R8H A;  1W0T A;  3K4L A;  1R6R A;  3H0D A;  5D5W B;  1BW5 A;  1AOY A;  4FAS D;  5HNF A;  2ESH A;  2WY8 Q;  4OMY A;  2XGC A;  2O7O A;  1TNT A;  2STT A;  1JKQ C;  3IHU A;  1BR1 A;  1REP C;  3K70 C;  4ENM A;  2F48 A;  4UNO A;  3OR1 C;  2Q2E A;  3KET A;  2H1K A;  3GTG J;  4M6X A;  1XMX A;  1LDD A;  3QYF A;  1KZH A;  3DTE A;  4I01 A;  1FIA A;  1ZR2 A;  2RQP A;  4I7H A;  1B9N A;  1J7K A;  3TBI A;  3DPU A;  2MD0 A;  3DWL E;  2TCT A;  1WPK A;  5FRM A;  4V19 K;  3BG3 A;  3W3C A;  3LWF A;  1RKT A;  3HRS A;  5CQE A;  3SEQ A;  1WJF A;  2JSP A;  3FBI B;  4IJA A;  3VB2 A;  1F43 A;  3EUA A;  3E6D A;  2GOX B;  2BY2 A;  2QEN A;  2XGE A;  3VWB A;  3DEW A;  3MKW B;  3V7C A;  2JA2 A;  1HKT A;  3PSF A;  1TWH J;  1U8R A;  1XB4 A;  4MLO A;  1TT5 B;  1FOX A;  5DCF A;  2M4K A;  2FXA A;  2L2O A;  4M9S A;  1VQO I;  3GTM J;  4A5M A;  4ZDP A;  1VZ0 A;  3JRF A;  3ISP A;  3F72 A;  4BBS J;  1K6Y A;  1FSH A;  2M0M A;  3ERM A;  4BKX A;  4PJN A;  5IP9 J;  3ZQ7 A;  5ED4 A;  1AHD P;  3L2C A;  3U2R A;  3WU2 C;  1RC9 A;  3E6B A;  4RAG A;  4CYD A;  2ZJP F;  4BL0 B;  4M72 A;  3CZ6 A;  2EJR A;  2YX4 A;  3TOA A;  1ZTR A;  4IHV A;  4OOI A;  3GUD A;  2KIF A;  2HGC A;  5HLI A;  1ETW A;  3HHH A;  3PO2 J;  4DZJ A;  2GA1 A;  4GYG A;  2QLZ A;  3QPH A;  2OQR A;  3MEX A;  5J1U A;  3S2H J;  4RAY A;  3RDI A;  3TDZ C;  5E3N A;  3E6M A;  3CLQ A;  3KZZ A;  1IDY A;  4JX6 A;  4DGW B;  1HDP A;  3DV8 A;  4IVN A;  1V5F A;  3EYI A;  4QSH A;  2VXD A;  2ZME A;  4U7D A;  4DZP A;  2EIN H;  2LK2 A;  3FHN A;  2OJE D;  1EH7 A;  2E5Z A;  4CCM A;  4PCQ A;  4AWX B;  5CPR B;  2EFN A;  4XN0 A;  3EUK L;  1B72 B;  3LSJ A;  4DYR A;  4EAT A;  2A05 A;  5LD2 C;  1MH3 A;  5GPA A;  3K4B A;  3Q9S A;  4AUX A;  4FX4 A;  1S7E A;  4EM0 B;  1SFE A;  3CC4 I;  2W4S A;  3LAP A;  5CVV A;  3JW4 A;  1F1Z A;  2HOE A;  1W0U A;  2HDD A;  3GFM A;  5A2Q Z;  1T0F C;  1BM9 A;  3OS0 A;  1SD7 A;  3M8E A;  1DQU A;  5F1R A;  1IUY A;  1ZEL A;  1MGT A;  1YRN B;  2KZG A;  4WX9 A;  3RKW A;  3B02 A;  3ZQG A;  3ONQ A;  3RI4 A;  3F6V A;  3KP6 A;  2CJJ A;  2KMU A;  2FRH A;  1HBX G;  1LKX A;  1A31 A;  4A3D J;  4ESJ A;  2WC2 A;  2Z3Y A;  1Z6T A;  3TW6 A;  5E3M A;  1VQ5 I;  1VF9 A;  3N97 A;  4BJT A;  2XPU A;  2ZXW H;  2VXZ A;  1HQC A;  2CG4 A;  3BR6 A;  1WJ5 A;  3M8J A;  4O6J A;  2VE8 A;  4ANJ A;  1RPW A;  2MW8 A;  4XON A;  3S93 A;  2ECC A;  4XSZ F;  4NB5 A;  3GME A;  5LGT A;  5EG0 B;  2IW5 A;  5FD6 A;  1IF1 A;  4IKF A;  3DP7 A;  4F3Q A;  2E1M C;  1FBS A;  2PJP A;  4E7J A;  1S9H A;  1KU3 A;  4UXN A;  1TL8 A;  1R4N B;  1GXP A;  1XCB A;  3L00 A;  2NS7 A;  3PNV A;  3QP6 A;  5GTI C;  1I39 A;  1N75 A;  1I50 J;  2YPR A;  5J8C A;  3CDH A;  4GO1 A;  4CCL A;  2ZXI A;  5FKK A;  2V1N A;  1B8I B;  2EZH A;  2CUF A;  1AU7 A;  4JYK A;  4OIN F;  4HDU A;  2Z9O A;  3U21 A;  4BU2 A;  1CF7 B;  1LQ1 A;  4BHB A;  1P7J A;  2MD5 A;  4CO8 A;  1OFC X;  4G6Q A;  3S1M J;  3DTI A;  5F04 A;  3O8H A;  5L3B A;  2X48 A;  3H9Q A;  2OC6 A;  3ZP5 A;  4XRM A;  5D6E A;  2FQ3 A;  2PMH A;  5ICG A;  1UAA A;  1YRN A;  3PQJ A;  2O3F A;  4UY8 I;  4KIB A;  1JI8 A;  1B59 A;  3I4P A;  3MQ0 A;  3SEZ A;  2XVC A;  3GZ6 A;  4IF4 A;  3FM5 A;  1FTZ A;  1X1B A;  2XAH A;  1HLV A;  4K2E A;  4BXU A;  4C3H J;  5FLX K;  2E1N A;  5JFR A;  2XIG A;  1KON A;  2KL4 A;  2W7N A;  3BLY A;  1H0M A;  1B9M A;  1T0F A;  2L3D A;  1K4S A;  3QU3 A;  4RAZ A;  4XQF A;  2BOL A;  1SEU A;  2R7D A;  4MGR A;  4O5V A;  5EYR A;  2I8D A;  5D8L B;  4M3D A;  3F0C A;  4IRH A;  5EZH A;  3IUO A;  2H8R A;  3I64 A;  2ZNZ A;  2LOO A;  2DQL A;  2VOD A;  1EH8 A;  1B4A A;  3L2W A;  2NYX A;  4AD9 A;  3W2W A;  3GTK J;  1G2H A;  4BAC A;  1FP2 A;  3V7S A;  3WTY C;  4RAF A;  2KIS A;  1YHQ I;  1EH6 A;  3L2Q A;  2QBY A;  3HXL A;  1KU2 A;  3BTI A;  2K9M A;  5BOX A;  2HYG D;  1X1C A;  2CUJ A;  2M30 A;  2M3A A;  2H94 A;  3K4J A;  1JHF A;  3OR2 C;  2L4M A;  3IH4 A;  3PSI A;  3CCL I;  2E7X A;  1A5J A;  2G7H A;  3JRC A;  2L9S A;  2V9K A;  3TKY A;  2HZT A;  4G9Y A;  2HNH A;  1YW9 A;  2HVS A;  1IN5 A;  2HXO A;  3LSH A;  2Q8K A;  2VAS A;  4WF2 A;  3RQ4 A;  2GM4 A;  1Y8Q B;  1LDK B;  3BP8 A;  1O3R A;  2BXY A;  3S2D J;  1UB9 A;  1FYK A;  1FMW A;  4B8X A;  3FK6 A;  4IHT A;  1FY7 A;  3IAM 2;  3OYC A;  3G2B A;  4IXA A;  5B5E C;  3HSR A;  2XB0 X;  4IQ4 A;  1GHC A;  4I0B A;  5CLS A;  2MYS A;  3WG7 H;  1Z91 A;  3PJR A;  5K7Z A;  5DM7 F;  4N4O B;  2EBI A;  3TL4 X;  3CUQ A;  2CV0 A;  4J19 A;  1R1T A;  3WHB A;  2E36 A;  4NDL A;  3CDL A;  4E7L A;  4M9Z A;  2DA2 A;  2LF8 A;  1XTA A;  3WTX C;  2HKX A;  1R5G A;  2NRA C;  1X1D A;  3WOD F;  3K4C A;  1FWZ A;  2E2H J;  4UHT A;  2UUZ A;  1W7P A;  4J01 A;  5C4X J;  3I9V 2;  2IEK A;  4XRS G;  1Y6I A;  2VB6 A;  2ZME B;  2OZU A;  3GTP J;  2ZJR F;  2ELK A;  3H9J A;  1R00 A;  1EJ9 A;  4ENN A;  1HXD A;  4NC6 A;  1G8X A;  3WTS C;  1A6Q A;  3BR5 A;  5DM6 F;  2CUE A;  2VQL A;  4B47 A;  3ZOB A;  3JRE A;  3LNQ A;  2OA4 A;  5TJJ A;  2XRO A;  3O8G A;  3IRQ A;  4A69 C;  5BPD A;  3FKJ A;  1TWC J;  4XKC A;  1BL0 A;  4EJO A;  3GYH X;  4RB0 A;  3HOY J;  2M4G A;  4UUS A;  3OS1 A;  2MC3 A;  3BZK A;  2JT1 A;  3RZO J;  1Z7U A;  4CZZ A;  1U3E M;  1FOY A;  1ZGA A;  4F55 A;  3HC7 A;  4N9H A;  2LBF B;  2XAU A;  3RJP A;  5KAI C;  4ZZL A;  3WTZ A;  5TRD A;  4OIQ F;  3ULQ B;  2LKP A;  3VYT B;  1WI9 A;  2E2J J;  3CF5 F;  4UVB A;  1YIT I;  5ILU A;  4MO7 A;  4HRI A;  5BPI A;  4F91 B;  1S3J A;  4BS9 A;  3KEQ A;  2X1E A;  2VUM J;  2VBY A;  4JX5 A;  5CKT A;  3RYP A;  3BWG A;  3QRF F;  3SFI A;  4AID A;  1D0Y A;  3MKL A;  1Q1H A;  2DFI A;  3DKX A;  1SC7 A;  3BY6 A;  4L9T A;  3VYU B;  3F9K A;  3BG5 A;  3K1N A;  1ETQ A;  1JT6 A;  4XBF A;  2XSJ C;  1KU7 A;  2GXG A;  2ZJ2 A;  1R23 A;  3BR2 A;  3LQR A;  3TP0 A;  1VQP I;  1EF4 A;  2R7U A;  1KQ0 A;  3FWE A;  1SFK A;  2HQR A;  2M7B A;  2OAZ A;  3F8C A;  2FEZ A;  3DBR B;  3BCA A;  3A02 A;  2QQA A;  3P7N A;  2G0E A;  2RN7 A;  4Y17 A;  3MCZ A;  4XOP A;  1X1A A;  1WJA A;  2HZD A;  3SXY A;  3ZGK A;  4Y7N J;  2X6W A;  3VSL A;  1D0X A;  2R5Y B;  1RNL A;  2BW3 B;  1MW7 A;  2BGC A;  3NEU A;  4XID A;  1BOA A;  3FX3 A;  1F36 A;  3VYS B;  1GUU A;  2RC4 A;  3RPQ A;  3OYJ A;  3HTU A;  2KRF A;  3A01 B;  1O7L A;  2EH3 A;  3D5L A;  4E4H A;  5DYM A;  1Z3Y A;  2WAE A;  1D1C A;  1OJL A;  3LSG A;  1P92 A;  2FML A;  2ME0 A;  5JHU A;  2FOW A;  2LY1 A;  2YSR A;  3A0H C;  3BZ6 A;  3CUO A;  1N77 A;  1RR8 C;  2OCC H;  4MEY F;  2IA1 A;  3J81 Z;  2A5Y B;  2V1X A;  3HM5 A;  5L3G A;  1PP7 U;  3JR9 A;  2DDA A;  2BW3 A;  2JPC A;  4L9V A;  4PGH A;  3QU6 A;  3E5Q A;  1QHG A;  2VI6 A;  1WZ2 A;  2ZB9 A;  1I1S A;  1SVO A;  2CQN A;  3G71 I;  2JVG A;  5FGM A;  2DA7 A;  2M2E A;  2CWE A;  2IGM A;  2DXI A;  4ZTF A;  1Z21 A;  2CW0 F;  4B1R A;  1ETV A;  4YEJ A;  4L5E A;  2LY9 A;  4XLA A;  2R7V A;  3EUH A;  3HDD A;  4A3I J;  2LP0 A;  1XSX A;  4BHC A;  1WWX A;  3MKZ A;  1MJA A;  1USS A;  3ESW B;  3KZI C;  4OAZ A;  4HPQ A;  5HS7 A;  2XPW A;  2MGQ A;  2KT0 A;  5IYB J;  1MIJ A;  1H89 C;  4DIQ A;  4R79 A;  3P9C A;  4E6K G;  1MSF C;  2JA7 J;  3FXJ A;  2M45 A;  3GTO J;  2JVH A;  3DXJ F;  1FBQ A;  1YW8 A;  3H36 A;  2NNN A;  2X51 A;  4Z6Y A;  1E3H A;  3PL8 A;  4ZTJ A;  4U87 A;  1S7O A;  4PJJ A;  4C3I J;  3J7Y J;  4I6Z A;  1OLT A;  1FP1 D;  2QM3 A;  4G12 A;  1T38 A;  4LLL A;  2CV2 A;  4KN7 X;  5IY5 H;  4CZC A;  2F6C A;  3R6S A;  3CP2 A;  1ZRC A;  1ZR4 A;  4L5I A;  3WTV C;  2QBY B;  3BJA A;  3TP3 A;  2XAF A;  9ANT A;  3QOP A;  3LA3 A;  1QA6 A;  4MEX F;  2KHM A;  1K78 B;  2G7U A;  2E1C A;  4JX4 A;  3D1N I;  1OKR A;  3K4N A;  1OCT C;  2VKH A;  1HF0 A;  1FTT A;  4PJM A;  1Z05 A;  1JUS A;  2W00 A;  5K5O A;  3KYL A;  2K4B A;  3VFZ A;  1L3L A;  3QQA A;  3ZPL A;  5LGU A;  2HYJ A;  4L5J A;  5C4J J;  4XMY A;  2WAF A;  1IRX A;  3L09 A;  2OCE A;  1XGM A;  2MG4 A;  1T2K A;  3EYY A;  2EQR A;  2QKM B;  1D3Y A;  3NWT A;  1KU9 A;  2V9V A;  3U1D A;  2WBM A;  5GAH J;  2R7F A;  2PQ8 A;  1WJE A;  1TQI A;  1LDJ A;  2F2E A;  1QQI A;  2IPQ X;  3Q0V A;  1MDM B;  1H88 C;  1T56 A;  1Z67 A;  5B66 C;  1YJ9 I;  1BI2 A;  4C2M J;  1E3O C;  2EFW A;  1GT0 C;  4FHT A;  1E3P A;  3DLL F;  3ZN1 A;  2EFQ A;  2DLL A;  4MHG A;  3EET A;  3AG1 H;  3MMY B;  1KQ9 A;  1QO0 D;  5FFZ A;  5H6Q A;  4A0X A;  3PUB A;  2STW A;  3V42 A;  1MBJ A;  4Q47 A;  1MMN A;  3H5R A;  4FT8 A;  3A01 A;  2R4G A;  2P81 A;  1FLI A;  3OYE A;  3VOD A;  5LFA A;  3F8N A;  2O5R A;  2DI3 A;  1POG A;  1NTC A;  2PMZ A;  4MQ9 F;  4ZYD A;  3CMY A;  1Z0X A;  5CQG A;  1OCP A;  2L4A A;  2NVU B;  2GIV A;  4IRG A;  2LSO A;  2IT0 A;  1A6I A;  1OR7 C;  2VPR A;  3IH2 A;  2ZC2 A;  1TW2 A;  5EJC A;  2L02 A;  3HOZ J;  4UB6 C;  1IV8 A;  3S1Q J;  3LSM A;  3OS2 A;  2P5K A;  4C2U A;  3CD6 I;  1P4A A;  4F92 B;  3BPV A;  5M5W J;  2F4O B;  4M3E A;  3CCV I;  4RGX A;  4M3F A;  4V2F A;  5EEG A;  1SFO J;  1VQ9 I;  1DPR A;  3GX4 X;  4JK1 X;  3P5J A;  2K40 A;  1V4R A;  5E1W A;  3CP8 A;  2EPF A;  2ZBK A;  2Q0O A;  3HRM A;  4WXC A;  2KJC A;  5M5X J;  3S8P A;  4P5O A;  1DU6 A;  3BCB A;  2FNA A;  1CQT A;  3A1Y A;  4LK0 F;  1O7F A;  4F93 B;  4M6Y A;  1E2X A;  1OCC H;  2DT5 A;  4XKB A;  4DYC A;  4RGS A;  1WGX A;  4G7O F;  3VPR A;  4E7H A;  3ZMS A;  2DU9 A;  3NAU A;  4GRI A;  2Y9Z A;  4XLC A;  4FE7 A;  2F5C A;  4RB2 C;  3IRR A;  1MSE C;  1R4M B;  2HVQ A;  2CGP A;  4P9U A;  2B63 J;  4OMZ A;  2K7L A;  3DEE A;  5L3C A;  1BIB A;  1Z77 A;  5A2Q K;  2GLO A;  4C2T A;  3NWS A;  3CO6 C;  4DYQ A;  1OQY A;  2VT3 A;  1YQA A;  3LL7 A;  1F5T A;  2DOD A;  2EV0 A;  4BXX J;  4IQJ A;  5HLG A;  2VBZ A;  3MVP A;  4UUS B;  2ID6 A;  4IO9 F;  3HG9 A;  3DPL C;  2XGD A;  3KCC A;  4NC8 A;  5AIQ A;  4E7K A;  2DT6 A;  4BQN A;  2HPI A;  4HNT A;  3GXO A;  3TED A;  2VQG A;  1M1E B;  3S3M A;  3JAM Z;  2K86 A;  3RZD J;  1RES A;  1RUN A;  4MTD A;  2LF7 A;  2BVM A;  2GQQ A;  4GFB A;  3FZV A;  3SYT A;  1RET A;  3ZQL A;  3S2W A;  5HOD A;  6PAX A;  1YS6 A;  3M07 A;  1XD7 A;  1K4T A;  1Y0N A;  4G94 A;  3T8T A;  1QVT A;  1MBF A;  3MZ8 A;  5KAF C;  2CV1 A;  4E70 A;  2HXI A;  5M3F J;  4GDF A;  3W6V A;  2HKO A;  4UVA A;  1X4P A;  1LB2 A;  1U78 A;  3HRU A;  2O0Y A;  3V4G A;  1QPI A;  5F27 A;  4I0A A;  1R9T J;  1SVM A;  1ZYR F;  3CES A;  3T5X A;  3U1K A;  2BEO A;  1I3A A;  3O2P E;  4MTE A;  4XN3 A;  4I2O A;  1IDZ A;  2IVM A;  2CH0 A;  3QAH A;  4NUB A;  1IG7 A;  3J7A Y;  3VYR B;  3AG3 H;  2XGX A;  1Z9C A;  1OPC A;  4YEL A;  3PNY A;  3OL3 A;  3IC7 A;  4A6E A;  3T8R A;  4CA0 A;  2EB7 A;  1I27 A;  1MJB A;  3IH3 A;  3WU0 A;  5L3F A;  1AWC A;  3ZRG A;  1IN8 A;  3O3K A;  4B3A A;  5IT3 A;  1BBY A;  2I10 A;  1YJN I;  3BR1 A;  2KJB A;  4CH7 A;  4S0H B;  1AA7 A;  3FIW A;  1Y1W J;  4BQA A;  2EZL A;  1RUO A;  1SAN A;  3C18 A;  2L7K A;  2QYO A;  3W2V A;  4BNC A;  3PNT A;  4BXF A;  3HL2 A;  3HEF A;  1EKE A;  1MZB A;  2MSY A;  4BEH B;  5IOY A;  2CQQ A;  3HSE A;  2XHK A;  2R5Y A;  2NVT J;  4KIS A;  4FTH A;  2DQR A;  2VJI A;  2AXL A;  3MZH A;  2YS9 A;  3BTJ A;  5J47 A;  2Y30 A;  4HSR A;  3VDX A;  1LNW A;  2DW4 A;  4JQF A;  1TT0 A;  4NQW B;  1D0Z A;  1TZL A;  4A0Z A;  5LBQ A;  2K3P A;  5F0F A;  4HV5 A;  2E1M B;  2W25 A;  2QSH X;  2W57 A;  4QPO A;  1HA8 A;  4Y3O A;  1BN5 A;  2PX9 A;  1OYY A;  2ISY A;  4GCV A;  4WCG A;  2M8G X;  1O3T A;  1IN4 A;  1X58 A;  3BG6 A;  2BV6 A;  2VQH A;  5JI6 A;  2HEO A;  2NOG A;  1WJD A;  2KRC A;  1R36 A;  4XM3 A;  2XB5 A;  5LLQ A;  2JZY A;  2DT7 B;  4DW6 A;  1D1B A;  1HC8 A;  2M8E A;  2BVL A;  2R92 J;  3CTA A;  5IT9 Z;  1X3W B;  1YOV B;  1AKH A;  1ORK A;  3W2A A;  4AIH A;  4LIV A;  3RQI A;  1W5S A;  2V79 A;  3LSK A;  2H8W A;  4I99 C;  3ERE D;  2V9P A;  2GBY A;  4BGD A;  1ZN2 A;  3J80 Z;  2JA5 J;  4EMS A;  2IGK A;  1MBG A;  2QQ8 A;  4O3M A;  3HOW J;  5DD4 A;  2O8X A;  4KYW A;  2EV6 A;  2XUB A;  5KNL A;  2OPT A;  5H6R A;  2R0Q C;  1X4O A;  4G6D A;  3S3N A;  4M3G A;  1IRZ A;  4LFU A;  1SD5 A;  1YX5 A;  2QSF X;  4LLG F;  1TWA J;  4WWC A;  2P5L C;  4A3C J;  3HRT A;  3PFY A;  1DP7 P;  4B4C A;  2YU9 J;  2V26 A;  3B6C A;  2A61 A;  5F08 A;  5CJ9 A;  1YYV A;  1ENH A;  3KLN A;  2GOM A;  2D1H A;  4IHY A;  1A36 A;  4Q5S F;  1XX5 A;  1ZGW A;  3RYR A;  1UMQ A;  2IXS A;  1NK3 P;  2JA8 J;  2VIX A;  3HYI A;  4PK4 A;  4U88 A;  2VJ4 A;  3I71 A;  5M5Y J;  4BE2 A;  3ZMZ A;  5EDN A;  2LBF A;  2M87 A;  4HBL A;  1W5T A;  2L54 A;  2XAG A;  3M1E A;  1HCR A;  4HX7 A;  4A3M J;  1CGP A;  5DD8 A;  3F23 A;  4EM1 A;  4EV0 A;  1V5G A;  3BRO A;  1EV7 A;  1WH5 A;  4XLF A;  5GAE J;  2JTV A;  4MFE A;  4RM3 A;  1TQP A;  3ECH A;  4CCJ A;  3Q5F A;  1LVK A;  1LE8 A;  5J1R A;  4KA4 A;  1T98 A;  2DJN A;  5LRR A;  3FKI J;  3M8F A;  4EGZ A;  4A3F J;  1ETK A;  1O57 A;  3RKX A;  3CCJ I;  1X19 A;  2V6E A;  1GV5 A;  2DFF A;  2KRH A;  3HOV J;  2JJ7 A;  3MAJ A;  1T08 B;  2FJ1 A;  3KE2 A;  4HDV A;  4KJZ A;  1VQL I;  3E7L A;  3S32 A;  1RR7 A;  1MND A;  3HHG A;  3H3Z A;  5J4Y A;  2ETH A;  5HDG A;  5BQT A;  4KIT B;  2PLY A;  3S15 J;  1SAU A;  2LY2 A;  3OIO A;  5F0C A;  5E3L A;  3P9I A;  2K5C A;  2OQG A;  1H9G A;  1FIP A;  1P4W A;  4A0Y A;  4YFK F;  5J40 A;  1YIO A;  2K85 A;  3JCU C;  3CME I;  5L3E A;  2QKL B;  5LEK A;  3GTJ J;  3LST A;  2DDB A;  2JRM A;  3GTQ J;  2CW8 A;  3ELK A;  3QPS A;  2QGU A;  3MWM A;  1B6A A;  3RPU D;  4ESB A;  4BY7 J;  3ZR8 X;  3S16 J;  1TP4 A;  2TDX A;  3J7A O;  4D1Q A;  1BJA A;  3CLO A;  3V8L A;  1ON2 A;  1I3Q J;  1R7J A;  4RBO A;  3L2V A;  5CVU A;  1R71 A;  3JRG A;  4N0B A;  2HYF A;  1ONV A;  5EZG A;  2ACJ A;  1K79 A;  1BOB A;  1OYI A;  3FXM A;  2CQK A;  4PZJ A;  1TNS A;  2MH2 A;  1W36 D;  1APL C;  1C0W A;  2O8K A;  3D5S C;  2DYR H;  4PGG A;  1FBU A;  2N8G A;  4G6T B;  2P0W A;  1Y56 A;  2DA6 A;  2P7V B;  2XRN A;  5ICE A;  2CFO A;  3QP5 A;  3Q3S A;  2HPM A;  5EEH A;  2VC0 A;  2E60 A;  3E6C C;  1Y1V J;  3MD2 A;  1ITY A;  2E7W A;  3CCE I;  3R0J A;  3PO3 J;  4N9I A;  1LPQ A;  3JRA A;  2ZXH A;  3BOQ A;  5J8F A;  3CCR I;  2Z2S B;  2ME6 A;  2RAE A;  5FRO A;  2HQ5 A;  4IX7 A;  3ASO H;  2PI0 A;  5J3L A;  2D2W A;  1ACI A;  1ZKG A;  4V2G A;  1XC5 A;  2P8T A;  1Z6R A;  3FMR A;  2D45 A;  1NK2 P;  2R93 J;  3I59 A;  4RM2 A;  3LMM A;  1QNT A;  5E20 A;  4GXO A;  3KPH A;  1TTY A;  3BR3 A;  2FUG 2;  2VL8 A;  4E7Z A;  2K02 A;  3ABT A;  4DBQ A;  1N25 A;  3H5N A;  4CDG A;  2WAD A;  4X1E A;  5C44 J;  2E35 A;  5FD5 A;  3MFK A;  4LG3 A;  3CJT B;  1JKR C;  4II2 A;  2DMN A;  2UXX A;  2DPD A;  4HF2 A;  1LVA A;  1MNM C;  3HSF A;  3A2K A;  2DFE A;  3E3V A;  3HOS A;  2VKD A;  2IAI A;  3KEO A;  5D5V B;  2BBY A;  3I53 A;  5F64 A;  2A07 F;  3CCS I;  2XPV A;  2VN2 A;  1MDM A;  4XOT A;  3HOX J;  1B72 A;  4HNU A;  4FIS A;  1P6R A;  3SZT A;  2FNP A;  1ZLK A;  2R7W A;  3HPH A;  4CUG A;  1LEB A;  4M74 A;  2YUS A;  3DU6 A;  1SD6 A;  3IKT A;  3DU5 A;  3LSI A;  1TQM A;  3JSO A;  2UZK A;  3ZCO A;  2A6E F;  3DPT A;  1JT0 A;  2DA3 A;  1QVU A;  2O03 A;  4YG2 F;  1J75 A;  2K4J A;  1DUX C;  2KFD A;  3FF5 A;  1WCM J;  1PYV A;  1G6N A; 
#chains in the Genus database with same CATH homology
 5LHG A;  1XMK A;  1IN7 A;  4MNU A;  3ZMT A;  1RZ4 A;  3NRV A;  1PUE E;  4CHU A;  1S29 A;  2HR3 A;  4I02 A;  5CVJ A;  1YTY A;  3ABU A;  1KQ8 A;  2F5D A;  2PBI A;  2VBW A;  4ESF A;  2HWV A;  2YR2 A;  3C3W A;  1S6L A;  1KYW A;  2PEX A;  2FBH A;  1ZLJ A;  1F4K A;  2EWN A;  1OYW A;  4P55 A;  1K6O A;  1I6X A;  3GEZ A;  3COA C;  1IAW A;  1DDN A;  2J5O A;  2QUF A;  4L9J A;  2UXN A;  2W84 A;  1D8K A;  2J5P A;  5E18 F;  1R1V A;  3F22 A;  3KP5 A;  2V1U A;  3IKV A;  4OIR F;  3I5U A;  5D5U B;  3K9T A;  3LFK A;  1HST A;  1UST A;  4ENK A;  2XKP A;  4ASN A;  4KN4 X;  3KLO A;  1LEA A;  2Y75 A;  3R61 A;  4B09 A;  5IT9 K;  2IJL A;  1IN6 A;  1JGS A;  2PFB A;  3SHF A;  4UUV A;  3V7R A;  2COM A;  3ZMU A;  5HVQ C;  1BI1 A;  3J81 K;  1ZHF A;  5D8K B;  1J9I A;  1XMA A;  2P6T A;  1SD4 A;  3GFI A;  1TBX A;  1RIO H;  3QPT A;  5HOO A;  3WE3 A;  4HOB A;  2PN6 A;  4ZYH A;  5E17 F;  4BHP A;  1F9N A;  5FLX Z;  3WTW C;  1KA8 A;  3LAJ A;  4GGG A;  2PG4 A;  3VOE A;  1FOK A;  2O61 A;  3FXR A;  2ZFW A;  1ZRE A;  1XSV A;  1XDS A;  3SQN A;  1GVJ A;  3C1D A;  4FX0 A;  5E1Z B;  5FB2 A;  1SFU A;  2WWY A;  2VT2 A;  1FPQ A;  4L0Z B;  2ESN A;  3K0L A;  3HOT A;  3BDD A;  3KP7 A;  1R5H A;  3GVA A;  1YLF A;  2KKO A;  1P4X A;  4RB1 A;  2W85 A;  2QWW A;  2ELH A;  3WG9 A;  3TGN A;  4A12 A;  1JXS A;  2FMY A;  4HF1 A;  5DUI A;  1J2X A;  3JTH A;  2RDP A;  3L7W A;  3WGH A;  2WV0 A;  1UCR A;  4KMF A;  1J59 A;  2FBI A;  2GXB A;  2YX7 A;  4YFX F;  2FF4 A;  2DO7 A;  4WXH A;  3TOB A;  2BE5 F;  4XSX F;  5E1X A;  2VBX A;  2HQN A;  4KFC A;  2UWM A;  3WTT C;  4ON0 A;  1ZRD A;  1D8J A;  5K5Q A;  3F3X A;  2P7C B;  2VC1 A;  4HQM A;  5ERI A;  4HV6 A;  4KIG A;  1R58 A;  2EK5 A;  1IXS B;  5KK1 A;  1R22 A;  3HIF A;  2VON A;  2A6H F;  3G3Z A;  2MH9 A;  2XAQ A;  4XRF A;  1DPU A;  1O3Q A;  4EJT A;  2G9W A;  3BPX A;  1SFX A;  5DDG A;  2NS0 A;  2XAS A;  1G3S A;  1IRF A;  3JTG A;  3IWF A;  1H9T A;  1GXQ A;  2ISZ A;  3GWZ A;  5FFX A;  1ULY A;  2CO5 A;  3ZMD A;  1KYZ A;  2ZO4 A;  1HSJ A;  4EM2 A;  2D1V A;  2A3S A;  5JR3 A;  3N4M A;  4XLP F;  2H6B A;  1E17 A;  2F5F A;  1QBJ A;  1KGS A;  5E8I A;  1W7P B;  1STZ A;  1BI0 A;  4HQE A;  2IA0 A;  1R1U A;  1ZG1 A;  2Z33 A;  4UVC A;  3H92 A;  4P9F A;  4AIJ A;  1J0R A;  3HTS B;  3CUQ B;  2BYV E;  3DF8 A;  2FA5 A;  5K5R A;  2H27 A;  4P96 A;  3B73 A;  2K27 A;  1B1B A;  2FOK A;  4NHJ A;  2DK8 A;  3CJN A;  1IXC A;  2CSO A;  4U0Y A;  1J5Y A;  4LLN A;  4A2U A;  2EFO A;  4IRI A;  3F8F A;  1XGO A;  5DUK A;  2MA3 A;  1JHH A;  3G73 A;  4U0W A;  2HS5 A;  4HA8 A;  2DBB A;  4DQ2 A;  1FZP B;  2KIM A;  5CVI A;  5DCM A;  5DCM B;  5HDN A;  1YG2 A;  1HW1 A;  1Z1D A;  2FSW A;  2ZNY A;  3I54 A;  2ZCW A;  3BJ6 A;  3FHZ A;  2WTE A;  4LB6 B;  1V3F A;  2P5V A;  3R4K A;  2XAJ A;  1WSU A;  3F8B A;  4HLX A;  1ZRF A;  4AVP A;  3SZP A;  3TO9 A;  5FO5 A;  4S04 A;  1XN7 A;  4JBA A;  3OOP A;  1U2W A;  1T39 A;  5DEQ A;  3LA7 A;  2GA2 A;  3O6B B;  2RNJ A;  4ETS A;  4M71 A;  1FC3 A;  5K1Y A;  5HDK A;  2C6Y A;  5ICC A;  1SMY F;  4G8X A;  4CGZ A;  4NQW A;  4TV7 A;  4RS8 A;  2MLK A;  3TO7 A;  4DNC A;  5L3D A;  3DFG A;  1WQ2 A;  4KMU X;  1FNN A;  5AIP A;  1RI7 A;  2OZ6 A;  2LDU A;  5F6F A;  5H20 A;  3KP4 A;  4RGU A;  4AIK A;  4OIP F;  4KDP A;  4ENJ A;  5ILS A;  3WGG A;  2EA4 A;  1XDU A;  4LK1 F;  2CFX A;  4EJW A;  1NHA A;  2HTS A;  1FT9 A;  3LA2 A;  3OV8 A;  4L0Y B;  1QGP A;  5HS8 A;  2Z99 A;  5D4R A;  4BYY A;  3KFW X;  2JSC A;  1CF7 A;  2VOP A;  2JPB A;  1U5T A;  4KT5 C;  3WTU C;  2NAZ A;  4Z2Y A;  3KZY A;  1W4M A;  5HS9 A;  3FMQ A;  5LHI A;  3FXU A;  3R60 A;  1HKS A;  1QZZ A;  5LHH A;  4HX4 A;  4HYE A;  2H09 A;  4KNY A;  5CYV A;  3U9G A;  1ZG3 A;  3FMS A;  4MQV A;  1D5V A;  4YFN F;  3ROU A;  2RKH A;  1TW3 A;  4I98 B;  3GO5 A;  1YFH A;  5DV5 A;  4HZF A;  4Q48 A;  4ZYE A;  2DPU A;  2M5W A;  3T0Y A;  4UV9 A;  4M9X A;  3CUQ C;  1HW2 A;  3BJO A;  3FM3 A;  3I58 A;  4RGR A;  4U7B A;  5BMZ A;  1ODD A;  5E8G A;  2X0L A;  2F5E A;  2V1D A;  3DEU A;  2ADU A;  2OU2 A;  4R1H A;  3KP2 A;  1G3Y A;  3F8M A;  4EJV A;  1YS7 A;  1HKQ A;  2B0L A;  3ECO A;  4WXD A;  1Y0U A;  3JSP A;  2GZW A;  1FYM A;  2RGV A;  1OR7 A;  3RPU A;  2HTJ A;  2QQ9 A;  1PP8 F;  2DAO A;  1ZAO A;  2OBP A;  2XKO A;  2FU4 A;  2R3S A;  3GFJ A;  1I1G A;  1VTN C;  5D6F A;  3I59 B;  2L01 A;  3IL2 A;  4Y15 A;  2QZ8 A;  1U6G A;  1W7P D;  2MLG A;  4QWQ A;  3E97 A;  2DTR A;  3KP3 A;  1S8N A;  4HW0 A;  1JE8 A;  1QPM A;  3PFI A;  2P4W A;  4EVI A;  3WE2 A;  4LJZ F;  3E5X A;  2EV5 A;  1I5Z A;  1MKM A;  4GYI A;  1S7A A;  1BC8 C;  2ZXJ A;  4G7H F;  3V8K A;  2RVC A;  3EQL F;  3M7G A;  3V8J A;  3ML6 A;  1X3U A;  4BH9 A;  3GZ5 A;  1XSD A;  4G7Z F;  4L18 B;  2VE9 A;  1G4D A;  1XGS A;  4CXF A;  2QQB A;  3TQN A;  1PDN C;  4IHS A;  1FYL A;  3JAM K;  3RIR A;  2OD5 A;  3W6K B;  3WGI A;  2IP2 A;  3D0S A;  3LQQ A;  5ILV A;  5HLH A;  2CYY A;  4QLC U;  1UFM A;  1UHW A;  4EGY A;  5LRS A;  2H6C A;  2EFP A;  1LJ9 A;  1WKM A;  4OIO F;  4M73 A;  1G3W A;  2QVO A;  3F6O A;  5AON A;  1K7A A;  4HLY A;  3T1B A;  4ZYG A;  2VOO A;  1ZAR A;  1WRJ A;  2O6G E;  4YIF A;  2PMU A;  1P2F A;  1FSE A;  2DK5 A;  2MBF A;  4HF0 A;  4LMY A;  4YII A;  1T6S A;  2V6C A;  4LB5 A;  5LGN A;  4Q4Z F;  3RKY A;  3VEP A;  4LD5 A;  1MD0 A;  3TDU C;  1BIA A;  2A69 F;  2Y48 A;  3IWZ A;  1ZH5 A;  3REO A;  1IXR C;  3CO7 C;  3DQV C;  4S05 A;  3TO6 A;  2FE3 A;  4IPA A;  1ZGJ A;  5ICF A;  2YU3 A;  4A5N A;  4LGW A;  3E5U A;  2LNB A;  4RB3 C;  1SAX A;  1ZG5 A;  1YW7 A;  3FXQ A;  3Q9V A;  5LEJ A;  2Y0M A;  1IW7 F;  2ZKZ A;  4KIF A;  3K1P A;  2Z5U A;  4EQQ A;  2IA2 A;  3EDP A;  5JVT A;  5D4S A;  4ZH4 F;  3K1M A;  3M9A A;  3GF2 A;  4LG0 B;  4EJU A;  1O3S A;  4OU0 A;  1IZ1 A;  4KUM A;  2GWR A;  2FBK A;  3SFZ A;  3ZN0 A;  4H0E A;  2GAU A;  3GW2 A;  4A6D A;  3R0A A;  3I0T A;  1XGN A;  3WU1 B;  3ZMV A;  4CIC A;  3K2Z A;  1K78 A;  1UHM A;  3C7J A;  1QZY A;  2HDC A;  3GFL A;  5BS6 A;  3L9F A;  1FX7 A;  2EA2 A;  3P9K A;  1A04 A;  2RV8 A;  4Y13 A;  1MJ9 A;  4D0P A;  4HAM A;  5J6X A;  1IRG A;  3PQK A;  4F7Z A;  3H3U A;  5D5X B;  4UV8 A;  4KIC A;  1ON1 A;  4PDK A;  2IRF G;  3F21 A;  4BAY A;  1SMT A;  4WK8 F;  4HX8 A;  2HFH A;  3MZY A;  3W6J B;  2NNY A;  3HUG A;  2JRT A;  2M1B A;  4XLN F;  4I09 A;  2XV4 S;  1YO5 C;  2W24 A;  1BI3 A;  1L0O C;  2AS5 F;  4ZZD A;  3GLX A;  1BC7 C;  1XCV A;  3J80 K;  3DKW A;  2A68 F;  1HW5 A;  2KIU A;  4LG0 A;  3NQO A;  2P6S A;  1U5T B;  3AAF A;  5CVR A;  1TLH B;  1OMI A;  3K69 A;  1G3T A;  3RTR A;  1U5T C;  5KVR A;  2X4H A;  4L9N A;  4U0V A;  4R8H A;  5D5W B;  1AOY A;  2ESH A;  4OMY A;  1TNT A;  2STT A;  3IHU A;  1REP C;  4ENM A;  4UNO A;  2Q2E A;  3KET A;  4M6X A;  1LDD A;  4I01 A;  2RQP A;  4I7H A;  1B9N A;  1J7K A;  3LWF A;  3HRS A;  4IJA A;  3VB2 A;  3E6D A;  2QEN A;  3V7C A;  1HKT A;  1U8R A;  1XB4 A;  5DCF A;  2FXA A;  4M9S A;  4A5M A;  3ISP A;  3F72 A;  1FSH A;  5ED4 A;  3ZQ7 A;  3L2C A;  3U2R A;  3E6B A;  4CYD A;  4M72 A;  2EJR A;  2YX4 A;  3TOA A;  4OOI A;  3GUD A;  2KIF A;  2HGC A;  5HLI A;  3HHH A;  2GA1 A;  4GYG A;  2QLZ A;  3QPH A;  2OQR A;  3MEX A;  4RAY A;  3RDI A;  3TDZ C;  3E6M A;  3KZZ A;  3DV8 A;  4IVN A;  3EYI A;  2ZME A;  4U7D A;  1EH7 A;  4PCQ A;  4AWX B;  2EFN A;  3Q9S A;  4FX4 A;  4EM0 B;  1SFE A;  3LAP A;  5CVV A;  3JW4 A;  1F1Z A;  2HOE A;  3GFM A;  5A2Q Z;  1BM9 A;  1SD7 A;  3M8E A;  5F1R A;  1IUY A;  1MGT A;  4WX9 A;  3RKW A;  3B02 A;  3RI4 A;  3F6V A;  3KP6 A;  2FRH A;  1HBX G;  4ESJ A;  2WC2 A;  2Z3Y A;  1Z6T A;  3N97 A;  2VXZ A;  1HQC A;  2CG4 A;  4O6J A;  2VE8 A;  4XSZ F;  4NB5 A;  5LGT A;  2IW5 A;  5FD6 A;  1IF1 A;  3DP7 A;  1FBS A;  2PJP A;  4UXN A;  1KU3 A;  1GXP A;  1XCB A;  3L00 A;  3QP6 A;  2YPR A;  5J8C A;  3CDH A;  4GO1 A;  4OIN F;  4HDU A;  2Z9O A;  1CF7 B;  1LQ1 A;  4BHB A;  2MD5 A;  4CO8 A;  4G6Q A;  5L3B A;  3ZP5 A;  5D6E A;  2FQ3 A;  2PMH A;  5ICG A;  3PQJ A;  2O3F A;  4KIB A;  1B59 A;  3I4P A;  3MQ0 A;  2XVC A;  3GZ6 A;  4IF4 A;  3FM5 A;  2XAH A;  4K2E A;  4BXU A;  5FLX K;  2E1N A;  5JFR A;  2XIG A;  1H0M A;  1B9M A;  1T0F A;  2L3D A;  3QU3 A;  4RAZ A;  2R7D A;  4MGR A;  4O5V A;  5D8L B;  4IRH A;  3I64 A;  2ZNZ A;  2DQL A;  2VOD A;  1EH8 A;  1B4A A;  2NYX A;  4AD9 A;  1FP2 A;  3V7S A;  3WTY C;  1EH6 A;  2QBY A;  1KU2 A;  5BOX A;  2HYG D;  2M30 A;  2H94 A;  1JHF A;  2L4M A;  2E7X A;  2G7H A;  3TKY A;  2HZT A;  4G9Y A;  1YW9 A;  1IN5 A;  2Q8K A;  4WF2 A;  1LDK B;  3BP8 A;  1O3R A;  1UB9 A;  1FYK A;  4B8X A;  4IHT A;  1FY7 A;  4IXA A;  3HSR A;  1GHC A;  4I0B A;  5CLS A;  1Z91 A;  3CUQ A;  1R1T A;  4M9Z A;  2LF8 A;  3WTX C;  2HKX A;  1R5G A;  2NRA C;  3WOD F;  1FWZ A;  4UHT A;  1W7P A;  2ZME B;  2OZU A;  1R00 A;  4ENN A;  1HXD A;  3WTS C;  2OA4 A;  5TJJ A;  2XRO A;  3IRQ A;  5BPD A;  4EJO A;  3GYH X;  4RB0 A;  2MC3 A;  2JT1 A;  1Z7U A;  4CZZ A;  1U3E M;  1ZGA A;  4N9H A;  3RJP A;  4OIQ F;  4ZZL A;  3WTZ A;  5TRD A;  3ULQ B;  2LKP A;  1WI9 A;  4UVB A;  5ILU A;  5BPI A;  1S3J A;  3KEQ A;  2VBY A;  3RYP A;  3BWG A;  3QRF F;  1Q1H A;  2DFI A;  3BY6 A;  4L9T A;  3K1N A;  4XBF A;  1KU7 A;  2GXG A;  2ZJ2 A;  1R23 A;  3LQR A;  1KQ0 A;  3FWE A;  2HQR A;  3F8C A;  2OAZ A;  2FEZ A;  2QQA A;  3P7N A;  2RN7 A;  4Y17 A;  3MCZ A;  3SXY A;  1RNL A;  2BGC A;  3NEU A;  1BOA A;  3FX3 A;  2RC4 A;  3RPQ A;  3HTU A;  2KRF A;  1O7L A;  3D5L A;  5DYM A;  1P92 A;  2FML A;  5JHU A;  2YSR A;  3BZ6 A;  3CUO A;  4MEY F;  2IA1 A;  3J81 Z;  2A5Y B;  2V1X A;  5L3G A;  1PP7 U;  2JPC A;  4L9V A;  4PGH A;  3QU6 A;  3E5Q A;  1I1S A;  5FGM A;  2CWE A;  2CW0 F;  3EUH A;  1XSX A;  4BHC A;  1WWX A;  1MJA A;  1USS A;  5HS7 A;  4R79 A;  3P9C A;  2M45 A;  3DXJ F;  1FBQ A;  1YW8 A;  2NNN A;  1S7O A;  1FP1 D;  2QM3 A;  1T38 A;  4LLL A;  4KN7 X;  3R6S A;  1ZRC A;  4L5I A;  3WTV C;  2QBY B;  3BJA A;  2XAF A;  3QOP A;  3LA3 A;  4MEX F;  1K78 B;  2G7U A;  2E1C A;  1OKR A;  1Z05 A;  5K5O A;  2K4B A;  3VFZ A;  1L3L A;  3ZPL A;  5LGU A;  4L5J A;  3L09 A;  1XGM A;  1T2K A;  3EYY A;  1D3Y A;  1KU9 A;  2V9V A;  3U1D A;  2R7F A;  2PQ8 A;  1TQI A;  1LDJ A;  2F2E A;  1QQI A;  2IPQ X;  1MDM B;  1BI2 A;  2EFW A;  4FHT A;  3ZN1 A;  2EFQ A;  2DLL A;  4MHG A;  3EET A;  1KQ9 A;  1QO0 D;  5FFZ A;  5H6Q A;  4A0X A;  2STW A;  4Q47 A;  4FT8 A;  1FLI A;  3VOD A;  3F8N A;  2DI3 A;  4ZYD A;  4MQ9 F;  2L4A A;  2GIV A;  4IRG A;  2LSO A;  2IT0 A;  1TW2 A;  2L02 A;  2P5K A;  1P4A A;  3BPV A;  4RGX A;  5EEG A;  1DPR A;  3GX4 X;  4JK1 X;  1V4R A;  5E1W A;  4WXC A;  2ZBK A;  2Q0O A;  3HRM A;  2KJC A;  4P5O A;  2FNA A;  4LK0 F;  1O7F A;  4M6Y A;  1E2X A;  2DT5 A;  4RGS A;  4G7O F;  3ZMS A;  2DU9 A;  2F5C A;  4RB2 C;  3IRR A;  2CGP A;  4P9U A;  4OMZ A;  2K7L A;  5L3C A;  1BIB A;  5A2Q K;  3CO6 C;  2VT3 A;  1YQA A;  1F5T A;  2EV0 A;  5HLG A;  2VBZ A;  3DPL C;  3KCC A;  5AIQ A;  3GXO A;  3JAM Z;  2K86 A;  1RUN A;  4MTD A;  2LF7 A;  2GQQ A;  3FZV A;  3S2W A;  6PAX A;  1YS6 A;  1XD7 A;  4G94 A;  3T8T A;  4E70 A;  2HKO A;  4UVA A;  1LB2 A;  1U78 A;  3HRU A;  2O0Y A;  3V4G A;  4I0A A;  1ZYR F;  3T5X A;  2BEO A;  3O2P E;  4MTE A;  4I2O A;  2IVM A;  3QAH A;  2XGX A;  1Z9C A;  1OPC A;  3IC7 A;  4A6E A;  3T8R A;  2EB7 A;  1I27 A;  1MJB A;  3WU0 A;  5L3F A;  1AWC A;  1IN8 A;  3O3K A;  5IT3 A;  1BBY A;  2KJB A;  4BQA A;  1RUO A;  3C18 A;  2QYO A;  4BNC A;  1MZB A;  3HSE A;  2XHK A;  2DQR A;  2AXL A;  3MZH A;  1LNW A;  2DW4 A;  4JQF A;  4A0Z A;  5LBQ A;  4HV5 A;  2W25 A;  2W57 A;  1BN5 A;  4GCV A;  1OYY A;  2ISY A;  4WCG A;  1O3T A;  1IN4 A;  2BV6 A;  5JI6 A;  2HEO A;  1R36 A;  5LLQ A;  2JZY A;  2M8E A;  3CTA A;  5IT9 Z;  4AIH A;  1W5S A;  2V79 A;  3ERE D;  1ZN2 A;  3J80 Z;  4EMS A;  4O3M A;  5DD4 A;  2O8X A;  4KYW A;  2EV6 A;  2XUB A;  5H6R A;  4G6D A;  4LFU A;  1SD5 A;  4LLG F;  4WWC A;  2P5L C;  3HRT A;  1DP7 P;  2A61 A;  5CJ9 A;  1YYV A;  3KLN A;  2D1H A;  4Q5S F;  3RYR A;  3HYI A;  4U88 A;  3I71 A;  3ZMZ A;  2M87 A;  4HBL A;  1W5T A;  2L54 A;  2XAG A;  3M1E A;  4HX7 A;  1CGP A;  5DD8 A;  3F23 A;  4EM1 A;  4EV0 A;  3BRO A;  1EV7 A;  2JTV A;  1TQP A;  3ECH A;  3Q5F A;  4KA4 A;  1T98 A;  5LRR A;  4EGZ A;  3M8F A;  1O57 A;  3RKX A;  3MAJ A;  3KE2 A;  4HDV A;  3HHG A;  2PLY A;  3H3Z A;  2ETH A;  5HDG A;  5BQT A;  3P9I A;  2OQG A;  1H9G A;  1P4W A;  4A0Y A;  4YFK F;  1YIO A;  5L3E A;  5LEK A;  3LST A;  3ELK A;  3MWM A;  1B6A A;  4ESB A;  2TDX A;  3J7A O;  1BJA A;  3CLO A;  3V8L A;  1ON2 A;  1R7J A;  5CVU A;  4N0B A;  2HYF A;  1ONV A;  2ACJ A;  1K79 A;  1OYI A;  2CQK A;  4PZJ A;  1TNS A;  2MH2 A;  1C0W A;  4PGG A;  1FBU A;  2XRN A;  2P7V B;  5ICE A;  3QP5 A;  5EEH A;  2VC0 A;  3E6C C;  2E7W A;  3R0J A;  4N9I A;  3BOQ A;  5J8F A;  2PI0 A;  2D2W A;  2P8T A;  1Z6R A;  3FMR A;  2D45 A;  3I59 A;  1QNT A;  5E20 A;  4GXO A;  1TTY A;  2K02 A;  3ABT A;  4CDG A;  5FD5 A;  3MFK A;  2UXX A;  2DPD A;  4HF2 A;  1LVA A;  3HSF A;  3E3V A;  3HOS A;  3KEO A;  5D5V B;  2BBY A;  3I53 A;  5F64 A;  2A07 F;  2VN2 A;  1MDM A;  1P6R A;  3SZT A;  2FNP A;  1ZLK A;  1LEB A;  4M74 A;  1SD6 A;  3IKT A;  3JSO A;  1TQM A;  2UZK A;  2A6E F;  3DPT A;  2O03 A;  4YG2 F;  1J75 A;  2K4J A;  1DUX C;  3FF5 A;  1G6N A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...