3TDUC

N-terminal acetylation acts as an avidity enhancer within an interconnected multiprotein complex: structure of a human cul1whb-dcn1p-acetylated ubc12n complex
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
75
structure length
75
Chain Sequence
NIEEDRKLLIQAAIVRIMKMRKVLKHQQLLGEVLTQLSSRFKPRVPVIKKCIDILIEKEYLERVDGEKDTYSYLA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords DCN1-like protein 1
publication title N-terminal acetylation acts as an avidity enhancer within an interconnected multiprotein complex.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Ligase/protein binding
total genus 26
structure length 75
sequence length 75
chains with identical sequence D
ec nomenclature
pdb deposition date 2011-08-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF10557 Cullin_Nedd8 Cullin protein neddylation domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 3tduC00
2D1VA 2RV8A 1FYMA 4OMYA 4UNOA 2ZO4A 1LQ1A 4YG2F 1R5HA 3W6KB 3GF2A 1IN8A 3ZN0A 4U7DA 2F5FA 2MBFA 4KT5C 3E5XA 1XSDA 3V7SA 2GZWA 2EWNA 2KKOA 4M9ZA 4L0YB 3P9IA 4AIJA 5DCFA 1MJ9A 2DBBA 2R3SA 4WX9A 3EETA 2YU3A 4HDUA 2LDUA 4EJWA 2EV6A 5HDGA 5HDNA 5DUKA 3CO6C 3NQOA 3SHFA 2XHKA 5L3BA 1XN7A 2L54A 4MQVA 5H20A 3IRQA 5EEHA 1EV7A 3WODF 4Q48A 3HRMA 1U6GA 3E6CC 1HW1A 2WC2A 2XKPA 5CVVA 3FMSA 1LNWA 4HBLA 2DQRA 2VE8A 3RIRA 5BMZA 1NHAA 3CDHA 1YW9A 2G7HA 4A5MA 2FEZA 4I2OA 1MJBA 3DF8A 5DV5A 2BGCA 1USSA 4IRIA 3L9FA 3BY6A 3GFJA 1KA8A 1GHCA 2ELHA 4GYIA 3HRSA 2P8TA 4AIKA 1XGMA 1IXCA 2IPQX 4IXAA 3JW4A 3K2ZA 3SQNA 4HF1A 4OIRF 2QVOA 4WXHA 2A07F 1IW7F 2Q2EA 3OOPA 5LEJA 4KA4A 4M74A 1I6XA 1OR7A 3DQVC 3RKXA 5L3CA 3KCCA 2JPCA 1QZYA 1U3EM 1QNTA 1ZHFA 2YSRA 2XIGA 3LWFA 3WU0A 1XCVA 4O5VA 1Q1HA 1STZA 1KGSA 2HDCA 4G6QA 1SD6A 4L18B 3WTUC 3IC7A 5JI6A 2EV5A 2ZMEA 1O57A 1RUNA 3I0TA 4MQ9F 2XAJA 1Z91A 2A3SA 3GZ5A 2JTVA 5LRRA 1XB4A 1GXPA 2QM3A 3KE2A 2DPUA 2QBYB 1B9MA 4AVPA 3K1NA 2MA3A 3WTSC 4D0PA 1XMAA 4A6DA 2E1NA 2CG4A 3PQJA 3GXOA 3ZPLA 3WTWC 4G7ZF 3V8KA 3MZYA 3BJOA 3GYHX 4BHBA 4G6DA 1P92A 4XRFA 1WSUA 3BDDA 1XGNA 4BYYA 1ZGAA 2KJBA 4RAZA 3B02A 4ASNA 4HYEA 2LNBA 4IVNA 4Y15A 5HDKA 5HS9A 3VODA 2W24A 1SFXA 1XDSA 1BM9A 4A12A 1Y0UA 3D5LA 5BPDA 1R1VA 3B73A 4RB1A 2ZNZA 4Y17A 4ZH4F 3VOEA 2J5OA 1C0WA 4LG0B 5BOXA 3F6VA 4A0YA 3BWGA 2CFXA 2E1CA 3ZP5A 4NB5A 4LB6B 1WI9A 1FSHA 1LEAA 5K1YA 5D6FA 3JTHA 3ZMTA 3GO5A 1D5VA 1TNTA 1YIOA 1O3TA 5ICGA 2Y48A 2HYGD 4KNYA 2K7LA 2HS5A 2VOPA 1XDUA 4B8XA 3QAHA 4CDGA 4I0AA 2ZCWA 2PQ8A 4KDPA 1P2FA 4HQEA 1FBUA 3I53A 1YG2A 4RAYA 5ICEA 5DEQA 3E3VA 4HF2A 4JBAA 3HTUA 2FBHA 1RI7A 4ON0A 3QU6A 1E2XA 2AXLA 2VBXA 1JGSA 1J5YA 4B09A 2CW0F 1ULYA 4U88A 4WWCA 3J7AO 2CWEA 5E20A 2QENA 3DPLC 4IJAA 1Z05A 5LGUA 2EA2A 1R7JA 2O03A 3KEQA 2GIVA 4EM1A 5ICFA 3REOA 2MLKA 1RUOA 1KQ9A 5F6FA 3I71A 1W7PD 3GVAA 1FY7A 2A69F 5F1RA 2OZ6A 2W84A 1I27A 1HBXG 4EM2A 1O7FA 3LSTA 3KP5A 1HKTA 1ZARA 4TV7A 5K5OA 4M71A 3GW2A 1S7OA 4U0VA 4G8XA 5D5VB 1BBYA 3ECOA 2NNYA 1IZ1A 2A6HF 4LD5A 2UXXA 3RJPA 4HAMA 3TOBA 4EVIA 1FWZA 2GA1A 2LKPA 1YS6A 2PEXA 1A04A 4ESJA 4EM0B 5DCMA 5D4RA 2C6YA 3V7RA 2P5KA 5HS7A 3LAPA 3O2PE 1DPUA 1XCBA 3F22A 2OZUA 3IKVA 3MQ0A 6PAXA 1KYWA 1T38A 1HW5A 3TGNA 1FBSA 3KETA 1XD7A 4G7OF 4ESFA 5DUIA 4JK1X 4ETSA 1WWXA 2UZKA 2F2EA 1U5TB 1Z7UA 4CZZA 4I01A 2PMHA 2VT3A 2O3FA 1GXQA 2GA2A 4HQMA 3L2CA 1HKQA 4CICA 2DW4A 2ETHA 5A2QK 3ZQ7A 5D5XB 2QZ8A 3IKTA 3I4PA 2P6SA 2V1UA 3BPXA 2K02A 4L9TA 2W85A 4M9SA 3KFWX 1SMTA 2Q8KA 2KJCA 2MH2A 2M87A 3WTTC 1FOKA 1RZ4A 5D5UB 5BQTA 1FLIA 2W25A 4RGSA 5E1XA 1BI2A 1GVJA 3RI4A 2EV0A 2RC4A 3MWMA 2ACJA 4EV0A 1ZG1A 4M6YA 2XAHA 3C3WA 3F8FA 1YTYA 2STTA 4HF0A 2RGVA 3NEUA 2WV0A 1W5TA 3IRRA 3MEXA 1X3UA 3L7WA 1FYKA 3KP2A 3M8EA 1H9TA 4CGZA 3DPTA 3KP6A 2VBZA 1MZBA 3FM5A 2DPDA 4HW0A 3L09A 5BS6A 5FD5A 4UV9A 4CYDA 1UHMA 2HEOA 3HUGA 2P4WA 1T2KA 1G3SA 4IPAA 4XBFA 1B6AA 1XSVA 1S3JA 4EQQA 1BI0A 2KRFA 2V6CA 2ZNYA 2O6GE 3R4KA 3BPVA 3RYPA 1ZG5A 4A0ZA 5LGNA 3K1MA 2OQRA 2O8XA 3QU3A 5FO5A 1Z1DA 4OU0A 2OA4A 2FRHA 2F5DA 2DAOA 3M8FA 4EJTA 4RB0A 2TDXA 1HW2A 2L02A 2QLZA 3VB2A 4HOBA 2V9VA 1G3YA 3SZPA 4EGYA 3WE2A 2D45A 2M30A 4MNUA 4BNCA 3ZN1A 4UVAA 3I59A 3G73A 1OYYA 5E1WA 4FHTA 3O3KA 5LHHA 5ILVA 3KP3A 2P6TA 2IVMA 1IAWA 1MGTA 2WTEA 1E17A 1W4MA 2JZYA 3LQQA 2HWVA 3PFIA 3KLNA 1QO0D 1G3WA 2OD5A 4HLYA 3W6JB 1AWCA 4L9NA 1AOYA 1W5SA 1BIAA 2P7CB 2YX7A 3WTVC 4RGUA 5ICCA 3GFIA 4KFCA 4NQWA 4R8HA 2VODA 5AIPA 2IT0A 3M9AA 4UV8A 4IF4A 1U8RA 4BQAA 2DT5A 1IXSB 3J80K 1DUXC 3ROUA 3C1DA 4BXUA 1EH6A 2DQLA 1PDNC 4G7HF 3T5XA 1QPMA 3WU1B 1OYIA 1TQIA 1RNLA 3BZ6A 3P9CA 2STWA 3GLXA 2H94A 2XAQA 1IF1A 5ERIA 3CUQA 1MDMA 2VE9A 4HX7A 2DI3A 2ZJ2A 1YS7A 2HKOA 2UWMA 3LFKA 2V1DA 4O3MA 2JRTA 1USTA 3PQKA 1FZPB 5FD6A 3JAMZ 1SD7A 2EFOA 4HA8A 3F8MA 2VT2A 3V8JA 5ED4A 4KUMA 2B0LA 2GWRA 2M1BA 1F9NA 3T1BA 5F64A 2IA2A 4KIGA 2GAUA 4KN4X 3COAC 1D8KA 4ZYGA 4GYGA 3VEPA 4I98B 3GEZA 2RVCA 3LA7A 4EGZA 1U78A 3GUDA 5HOOA 5EEGA 3G3ZA 3FF5A 2Z9OA 1OYWA 5KVRA 2RQPA 1XMKA 5D8KB 3NRVA 1D3YA 1WQ2A 1P6RA 2LF8A 2A5YB 4RGRA 3L00A 3WG9A 5K5QA 2HFHA 3U1DA 3CUQB 2ZMEB 5HLGA 2LF7A 4MHGA 2XAFA 5L3GA 4ZZLA 1B4AA 2OU2A 4PCQA 3ISPA 4G9YA 5J8CA 2EB7A 2QYOA 3TO6A 2OBPA 2FE3A 2QQ9A 5FLXZ 3ELKA 4GGGA 3WGHA 4LLGF 5L3DA 2IP2A 1W7PA 4PGGA 1TQMA 1L0OC 1FT9A 2DK5A 2A61A 2L4MA 3R0AA 2VBYA 2QQAA 1ZRFA 2HQNA 2ESNA 1U5TC 2VBWA 4P5OA 1I5ZA 5IT9K 2FU4A 1J0RA 5J6XA 3LAJA 4YFKF 2VC0A 5K5RA 3EQLF 4MTDA 1YO5C 2A6EF 4RB2C 2EFQA 4FT8A 3ABTA 3K69A 3I58A 4UVCA 4BHPA 1CF7A 3C7JA 3H92A 1T39A 1FYLA 3HHHA 4MEYF 1ZRCA 2DLLA 4XLPF 2P5VA 3GFLA 1IN7A 1QZZA 2BBYA 5JFRA 4LFUA 4A6EA 4WXDA 4PGHA 5HVQC 1YQAA 4R79A 1H0MA 2HZTA 5TRDA 1KU7A 1SFEA 4OIPF 1FP1D 2HTJA 3C18A 3P9KA 3QRFF 3M1EA 4JQFA 2NS0A 3R0JA 1KU3A 4WXCA 4A0XA 4F7ZA 2HKXA 2CGPA 4XLNF 1U2WA 3AAFA 2Z5UA 1J75A 5LRSA 3FZVA 3BOQA 2CSOA 1R1TA 1BI1A 5LGTA 1YW8A 4LJZF 5CVRA 2A68F 3F8CA 2DK8A 3ZMZA 2PFBA 1ZG3A 5DD8A 2ADUA 4I02A 2JT1A 3LQRA 5H6RA 4MTEA 3K0LA 3FXUA 3HRUA 1SD5A 2IA1A 3IWFA 3HYIA 5E18F 3O6BB 2Y75A 3F21A 3CLOA 2OAZA 4PZJA 2NNNA 3F72A 2QUFA 1DDNA 2HQRA 3TQNA 1EH7A 1QBJA 4HX8A 1S29A 2PLYA 5HLHA 4ESBA 1P4XA 1ZAOA 2IJLA 4HLXA 3KP7A 1EH8A 3QP5A 4M72A 4L9VA 4ENNA 2H6CA 4P96A 4EJVA 3CUOA 1R36A 3KZZA 4LK1F 4N9HA 2NAZA 2BEOA 1IRGA 3I54A 2CQKA 4YFXF 3U2RA 4AIHA 1IN5A 4LB5A 1IN6A 2VOOA 5TJJA 3H3ZA 2CYYA 5CLSA 2H09A 1T98A 4YIIA 2Z99A 3P7NA 3HSRA 5DCMB 3MZHA 1K6OA 3F6OA 4HV5A 5CVJA 2FMLA 4O6JA 5D5WB 5JR3A 1J7KA 1LDKB 2GXBA 4KIBA 1HSJA 3T0YA 1MD0A 4LLNA 4N9IA 4FX0A 1F1ZA 1TW2A 3FX3A 2COMA 4A2UA 2QQBA 3WGGA 3FM3A 2L01A 1F5TA 1O3QA 3HIFA 4IHTA 3FMQA 1ZN2A 2YPRA 3Q5FA 2P7VB 3JSOA 2X0LA 2YX4A 4RB3C 2KIUA 5IT9Z 5BPIA 5HLIA 2GXGA 1L3LA 3LA3A 1REPC 3GFMA 4HDVA 3ABUA 3KZYA 3I5UA 1TLHB 2ZBKA 5H6QA 4XSZF 2IW5A 1XGSA 3TDUC 1FC3A 4MEXF 2FOKA 4OOIA 2EK5A 5ILSA 3N97A 1SAXA 2NYXA 4GCVA 4ENJA 1I1GA 3ECHA 2L3DA 2K4JA 5FFXA 1RIOH 2W57A 2UXNA 4P9FA 2DTRA 4S04A 1OKRA 1QGPA 1LDDA 3RKYA 4OMZA 5CVIA 3TDZC 3JTGA 1ZRDA 4WK8F 1D8JA 5AONA 4NHJA 1G6NA 4U0WA 1Z6RA 1ODDA 4R1HA 1BOAA 1XSXA 5DD4A 4L0ZB 3JSPA 1FPQA 2BE5F 4ZYDA 3DXJF 1FSEA 3CO7C 1LEBA 4RS8A 3ZMSA 3CUQC 4G94A 1MJAA 2Q0OA 1ZLKA 4KN7X 2FBKA 4YIFA 4UUVA 3GX4X 4I7HA 5LEKA 3MCZA 4YFNF 1TQPA 3HOTA 4HV6A 4ENMA 2OQGA 3T8RA 2O61A 3BP8A 5D8LB 2PMUA 2WWYA 2KIMA 3K1PA 5KK1A 2QBYA 5FB2A 3WE3A 1ZREA 2XKOA 3S2WA 4BAYA 4L5JA 3RTRA 3HSEA 1R1UA 1KU2A 2AS5F 2PN6A 2EFNA 1BC8C 4M6XA 4CXFA 2RNJA 3LA2A 1I1SA 2QWWA 4Q4ZF 4EMSA 4E70A 2ZKZA 3V8LA 3IHUA 2CO5A 3SXYA 2FXAA 1T6SA 2XVCA 2R7FA 1BIBA 2H6BA 4GXOA 4PDKA 3MFKA 1XGOA 2F5CA 2PI0A 3QPTA 3KP4A 1IUYA 1WRJA 2E7WA 3GWZA 1TTYA 2FQ3A 2RKHA 3I59B 1Z9CA 1JE8A 4HZFA 2MLGA 2KIFA 1IRFA 3U9GA 1R22A 1JHFA 4LG0A 3DFGA 5A2QZ 1K7AA 4L9JA 4BH9A 5D6EA 2EFWA 3WTYC 1F4KA 3CTAA 3WGIA 2ISYA 1K78A 3SFZA 2P5LC 3CJNA 3E5QA 1S7AA 2VONA 3TO9A 3DKWA 1ZGJA 2ISZA 4KMFA 3I64A 5HS8A 4LGWA 1B59A 5JVTA 4GO1A 2EFPA 4IRHA 3RPUA 2DU9A 1QQIA 2Y0MA 4IRGA 5LBQA 4Q5SF 1R00A 5FFZA 5LHIA 1ZH5A 3SZTA 3F8BA 3J81K 2FNAA 2PJPA 1DPRA 3F8NA 2L4AA 2Z3YA 1G4DA 3HOSA 1J2XA 1Z6TA 1OPCA 3RDIA 1MDMB 4QWQA 2MH9A 2G7UA 3HHGA 5CJ9A 5E8GA 1ONVA 3GZ6A 2XASA 1WKMA 4LMYA 5LHGA 2H27A 3E6BA 1K78B 5D4SA 2V1XA 1LDJA 2XAGA 5DDGA 2VXZA 4I09A 5IT3A 3E97A 2GQQA 2JPBA 4P55A 5FGMA 5E1ZB 4ZZDA 1O3SA 1SMYF 3ML6A 5LLQA 1JHHA 1HXDA 1T0FA 4U0YA 1JXSA 3Q9SA 2M8EA 2O0YA 2NRAC 1ON2A 2J5PA 3K9TA 1S6LA 3FXQA 4DQ2A 4HX4A 3DEUA 1OMIA 4EJUA 3TO7A 2XRNA 2HTSA 1CGPA 4H0EA 1G3TA 5J8FA 2HGCA 2IA0A 1BI3A 3EYYA 2FBIA 1S8NA 3ERED 4U7BA 1KYZA 4WF2A 2FMYA 4IHSA 2M5WA 1ON1A 3BJAA 3DP7A 4AD9A 4L5IA 3WTXC 2HR3A 1VTNC 2X4HA 1W7PB 4UVBA 2ESHA 3N4MA 4RGXA 4MGRA 2K86A 2FA5A 1IN4A 3VFZA 1YW7A 3TKYA 3V7CA 2XUBA 1IXRC 5CVUA 3M7GA 4A5NA 4LK0F 3QP6A 1U5TA 2RN7A 2DO7A 1YFHA 3Q9VA 2R7DA 3ULQB 3QOPA 1CF7B 3EDPA 3RYRA 4Y13A 3J80Z 2K4BA 3E5UA 5ILUA 3FXRA 1UHWA 4BHCA 3HRTA 2G9WA 2ZFWA 4UHTA 2MC3A 1J59A 1ZYRF 3FMRA 3RKWA 4ZYHA 1FBQA 3DV8A 2F5EA 4OIQF 1BJAA 1R58A 3ZMDA 2LSOA 1UCRA 1V4RA 3FWEA 3D0SA 1FP2A 2E7XA 2JSCA 2XV4S 4K2EA 1V3FA 4CHUA 2FSWA 1FX7A 2V79A 1R23A 4I0BA 4EJOA 3KLOA 1MKMA 1PP8F 3IWZA 3RPQA 1DP7P 2VC1A 2MD5A 1KU9A 4OINF 3IL2A 2IRFG 3E6DA 3H3UA 1ZLJA 5JHUA 2PBIA 3EUHA 4CO8A 1O7LA 2EA4A 5AIQA 3EYIA 2Z33A 1TW3A 4QLCU 1FNNA 1YYVA 1P4AA 1BN5A 5CYVA 3T8TA 4LLLA 1UFMA 1SD4A 2BYVE 3R60A 3F3XA 3F23A 1TNSA 2FF4A 2DFIA 4Q47A 3HTSB 2HYFA 1B9NA 1TBXA 5E8IA 3E6MA 1HKSA 3ZMUA 3JAMK 4M73A 4ENKA 3J81Z 1KQ0A 4DNCA 1KQ8A 1LVAA 1P4WA 3TOAA 4UXNA 2VN2A 1LB2A 4M9XA 2M45A 1J9IA 3R6SA 2RDPA 1HSTA 2YR2A 2D2WA 1LJ9A 4KIFA 4AWXB 4FX4A 1PUEE 3BROA 2PG4A 2HOEA 5E17F 3V4GA 1R5GA 1BC7C 2ZXJA 3R61A 1O3RA 1K79A 5DYMA 2D1HA 4KYWA 4KICA 2K27A 3KEOA 1UB9A 5L3FA 4ZYEA 3QPHA 1SFUA 3WTZA 3HSFA 4N0BA 3FHZA 1B1BA 4S05A 4OIOF 3OV8A 4WCGA 3MAJA 1HQCA 1H9GA 2EJRA 4Z2YA 5L3EA 2FNPA 5FLXK 2XROA 4KMUX 2XGXA 4XSXF 4P9UA 3ZMVA 3BJ6A 2BV6A 1YLFA 1PP7U
chains in the Genus database with same CATH superfamily
2D1VA 2RV8A 1FYMA 4OMYA 4ZYAA 4UNOA 2ZO4A 4A3EJ 4YG2F 1LQ1A 1R5HA 3W6KB 3GF2A 1IN8A 3ZN0A 1HCRA 3K70C 3PIPF 2BHZA 4U7DA 2F5FA 2E5ZA 4IHWA 2MBFA 4KT5C 2OF7A 3E5XA 1TWCJ 2OTJI 1LVKA 1XSDA 2NOGA 2CW8A 3V7SA 3NARA 4IOCF 1IG7A 3DCFA 2GZWA 2EWNA 2KKOA 4M9ZA 4L0YB 3P9IA 4AIJA 1YIJI 2WADA 3QPSA 5DCFA 3DBRB 2LFBA 1MJ9A 2DBBA 2R3SA 1H88C 3C2HA 2IGNA 4WX9A 3EETA 4PJLA 2YU3A 4F52A 3HXLA 4B48A 2R7VA 4HDUA 2LDUA 4EJWA 2QQ8A 3OIQA 2EV6A 1MBJA 3BTIA 5HDGA 1IO2A 5DUKA 5HDNA 3CO6C 3LSPA 2NVQJ 2X6OA 5GAEJ 2JA2A 3PL8A 4QPOA 3NQOA 3SHFA 2EILH 4E4HA 3ABLH 2XHKA 2CUFA 3FKIJ 1Z7LA 5EJCA 5L3BA 1XN7A 1P9QC 3JCUC 2L54A 4MQVA 1BJZA 5H20A 1RR7A 5EEHA 3IRQA 1EV7A 5JLXA 4ABZA 3WODF 4Q48A 3HRMA 1OCCH 1U6GA 3E6CC 1HW1A 2WC2A 2BVMA 2M0CA 2XKPA 1IV6A 2DA5A 5CVVA 1YHQI 3FMSA 4B43A 1VQMI 1LNWA 3OMYA 3BR6A 1LPQA 4HBLA 1LUJB 1VQ5I 4AVZA 5F0HA 3PNVA 3K4MA 2DQRA 1ETWA 2VE8A 1AHDP 3RIRA 5BMZA 1NHAA 3CDHA 1YW9A 2G7HA 4A5MA 2FEZA 1T8IA 2LLKA 4I2OA 1MJBA 1JUMA 4C2MJ 3JREA 3DF8A 5DV5A 2BGCA 1USSA 4W1UA 4GFBA 4IRIA 3L9FA 2HOSA 1LFBA 1I3QJ 3BY6A 1KA8A 3GFJA 2X9DA 1GHCA 2KFDA 1UHSA 2MYSA 3FBIB 2ELHA 2F5VA 3ZRGA 4BBSJ 4GYIA 3HRSA 4A3IJ 4BXXJ 2P8TA 4AIKA 1XGMA 1IXCA 2IPQX 3FXJA 4IXAA 2LKXA 3JW4A 3K2ZA 3SQNA 4HF1A 1MMGA 2BW3B 4OIRF 1ZGWA 4RAGA 2QVOA 3CJTB 4WXHA 2A07F 3RCOA 2F4MB 1IW7F 4HNTA 2Q2EA 3S2HJ 4LOCA 4CCLA 3MVPA 2OC6A 3ONQA 3OOPA 5LEJA 4KA4A 3JRIA 4XKVA 2E1OA 4M74A 3HKZN 1I6XA 1OR7A 3DQVC 3RKXA 1CQTA 5L3CA 3KCCA 2JPCA 1QZYA 3M3YJ 1R6RA 1U3EM 5IP9J 3TMOA 1QNTA 1ZHFA 2GM4A 2JUCA 2YSRA 1S9HA 2XIGA 1W36C 3AG4H 3LWFA 2XPVA 2WY8Q 3WU0A 3RZDJ 1XCVA 2XSJC 4O5VA 2XB5A 3NWSA 1Q1HA 3ABMH 2YU9J 1Z67A 1STZA 1KGSA 2HDCA 4G6QA 1SD6A 4L18B 3WTUC 3IC7A 3MMYB 2EV5A 5JI6A 2KLOA 2ZMEA 3CJQB 3JRCA 2YS9A 1O57A 1RUNA 3I0TA 4MQ9F 2XAJA 2OCEA 3G1MA 3M07A 2RNGA 3A0BC 5EDNA 1Z91A 2A3SA 3GZ5A 2JTVA 2R5ZA 3I56I 5LRRA 1XB4A 3SEZA 1N77A 1X4PA 4V2FA 1GXPA 2QM3A 3KE2A 4P1WA 2DPUA 2QBYB 1B9MA 4AVPA 2FQ4A 3K1NA 1S5LC 2MA3A 1B8IA 1P7IA 5EGOB 3WTSC 4D0PA 2CFOA 1XMAA 1Y1VJ 2E1NA 4A6DA 2VPLA 4XL9A 2CG4A 3PQJA 4C3IJ 3GXOA 3ZPLA 4IHVA 5B1AH 3BG5A 3WTWC 4G7ZF 1O4XA 3GTPJ 3K70D 3V8KA 3MZYA 2VKDA 3OYKA 2WV1A 1T0FC 3BJOA 3GYHX 4BHBA 1YRNB 4G6DA 4IEJA 2EZKA 3V42A 2LK2A 1P92A 4XRFA 3CCSI 2KISA 1YITI 1WSUA 3BDDA 1XGNA 4BYYA 1ZGAA 2CMPA 2ICWG 2KJBA 3VYUB 4RAZA 3B02A 3OR1C 4ASNA 4ZC3A 2W48A 4HYEA 2LNBA 4IVNA 4Y15A 5HDKA 2HZDA 3EUAA 5K7ZA 5HS9A 1FTZA 2X48A 3VODA 2W24A 5GPAA 4DZJA 1H8AC 1SFXA 1XDSA 1BM9A 4A12A 1Y0UA 1FOYA 2HNHA 3D5LA 5BPDA 1WHUA 2KHMA 3M1CA 1MIJA 1HC8A 1R1VA 4M3EA 3B73A 4RB1A 3F9KA 1XMXA 2ZNZA 4Y17A 4ZH4F 3VOEA 3CCEI 3OY9A 2J5OA 1C0WA 4LG0B 4M6VA 3X2QH 5BOXA 2PMZN 3F6VA 2F48A 2R7OA 1XPXA 4A0YA 2LREA 3BWGA 1T95A 2CFXA 2E1CA 1FJLA 1V5GA 3FXLA 3ZP5A 4NC8A 4CCMA 4NB5A 4RMNA 1MNMC 2H8RA 4LB6B 3MKLA 1WI9A 1FSHA 2R5ZB 1WPKA 1LEAA 1ZK8A 4E7HA 3H35A 5EZHA 5K1YA 1JTYA 5D6FA 1HDDC 3VWBA 4BQQA 3JTHA 4IQJA 3ZMTA 3GO5A 1D5VA 2VKEA 1TNTA 3RZOJ 2DDAA 2DXIA 1D0YA 1YIOA 1O3TA 5ICGA 1IV8A 3SDBA 3QODA 3OYMA 1BW6A 2Y48A 2HYGD 4KNYA 1QZEA 5FRMA 1OCPA 2K7LA 2HS5A 2VOPA 1XDUA 1GT0C 1X2MA 4B8XA 2WB1N 3DWLE 3QAHA 4CDGA 4BDZA 4I0AA 3PUBA 2ZCWA 1UG2A 2PQ8A 4EATA 5IP7J 4J00A 4KDPA 5J47A 3H9GA 3KEYA 1P2FA 4HQEA 5DS9A 1FBUA 2BXZA 3I53A 2R0QC 4A3JJ 1YG2A 4RAYA 5ICEA 3HPHA 5DEQA 3FHNA 4FQGA 2QSFX 3E3VA 4HF2A 2M3AA 4JBAA 4NUBA 2L7KA 3HTUA 2FBHA 1MW7A 1RI7A 4ON0A 3HKZA 3QU6A 1VQNI 1E2XA 3H0GJ 2AXLA 2VBXA 4EEFG 4A3LJ 1DGWY 1JGSA 3G1OA 4E7KA 1J5YA 4B09A 2CW0F 1ULYA 4U88A 4WWCA 1W36D 3H5NA 4U87A 1VQ7I 1VQ6I 1PJRA 3F0CA 3J7AO 4XRSA 2CWEA 2DTZA 2QENA 5E20A 3HDDA 3W6VA 1E3HA 3DPLC 4IJAA 1WFXA 4IHYA 1Z05A 4QIWN 2I8DA 3A01A 5LGUA 2EA2A 3ERMA 5IP6A 4G6TB 2O5RA 2W00A 2LKSA 2DA6A 1JJ6C 1R7JA 2O03A 3KEQA 1OCZH 2GIVA 3BTJA 4EM1A 5ICFA 1XS9A 3REOA 2MLKA 2B63J 3BQYA 1RUOA 1KQ9A 2LRDA 1K4TA 5F6FA 3I71A 1W7PD 3GVAA 2OTLI 1FY7A 2A69F 3FXKA 4B44A 5F1RA 2OZ6A 1R49A 2W84A 1UZCA 1I27A 3AKZA 1HBXG 1JKRC 4EM2A 4A3FJ 1O7FA 2CUEA 2EZHA 3LSTA 3KP5A 3DU5A 1HKTA 3K6GA 2OJED 2K5CA 1ZARA 3I4NJ 4TV7A 3DKXA 3C2GA 5K5OA 4M3FA 1WJ5A 2JK3A 2L9RA 4HSTA 3OSGA 4JYKA 2VUMJ 4M71A 3GW2A 2G0EA 1S7OA 4RLFA 1RPWA 4U0VA 4G8XA 5D5VB 5KNLA 1BBYA 3ECOA 2VPRA 5FROA 3ZQFA 5DM7F 2NNYA 2IS1A 5JLWA 1OISA 1IZ1A 2A6HF 4LD5A 3TBIA 5K7FA 1RKTA 2UXXA 1MSFC 2E34A 2L2OA 4XKWA 3LSIA 3A2KA 2H8WA 3WU2C 3RJPA 2LTPA 3E1SA 4HAMA 3TOBA 1B72A 4EVIA 2L0KA 1ETQA 1FWZA 2Y69H 4FE7A 2GA1A 3OIOA 2MFZA 4A3MJ 1G2HA 2LKPA 3NAUA 1OLTA 2QGUA 1YS6A 1SANA 3ZXSA 1ZELA 2PEXA 1ETOA 1A36A 1A04A 4ESJA 4EM0B 5DCMA 1JGGA 5D4RA 1WZ2A 2C6YA 4A3GJ 3ZQHA 3W2AA 3V7RA 2JN6A 2P5KA 5HS7A 4YELA 2JA5J 4D5CA 3LAPA 3K4LA 2WAEA 2ZSHB 3RQ4A 2ME0A 3O2PE 1DPUA 1XCBA 3F22A 2OZUA 3IKVA 1SFOJ 3MQ0A 6PAXA 1KYWA 2PMZA 3OYLA 1T38A 1HW5A 2LMDA 3TGNA 5IPAA 1FBSA 3KETA 1DGRM 1XD7A 3MKWB 4G7OF 3S1RJ 4ESFA 3QWLA 1OQYA 4GRIA 5DUIA 4JK1X 4G12A 4ETSA 3ZGKA 3HL2A 1WWXA 3TL4X 2UZKA 2F2EA 5C4XJ 1U5TB 1VQKI 2E2JJ 1Z7UA 4CZZA 4I01A 2PMHA 2VT3A 3S3MA 2O3FA 4S0HB 2CJJA 3CJRB 4IKFA 1GXQA 2GA2A 2KZVA 4MLOA 4HQMA 3L2CA 1HKQA 2VL8A 3Q0VA 4II2A 4Y33A 2XGEA 4CICA 2DW4A 3W2VA 2ETHA 4NC7A 5A2QK 3ZQ7A 5D5XB 2M34A 1WH5A 2VQGA 2XSDC 2QZ8A 3IKTA 1NTCA 4LITA 2HQ5A 3I4PA 2P6SA 2V1UA 2LC2A 3BR3A 4DZPA 1M1EB 3BPXA 3OL4A 5GPCA 2K02A 3MN2A 3OYJA 4L9TA 2W85A 1R9TJ 4M9SA 3KX2A 3KFWX 2ZFUA 1SMTA 5CQEA 1Y56A 2Q8KA 3L2VA 2KJCA 2MH2A 4DYRA 2M87A 3WTTC 4LIUA 1FOKA 2DMTA 5F27A 3IH3A 1RZ4A 5D5UB 3OYFA 1MMAA 5BQTA 4DYCA 1SEUA 4M3BA 1MBGA 1FLIA 2W25A 4RGSA 3VYSB 3KYDB 5E1XA 1BI2A 1Z3YA 2VKVA 3BT9A 4C2UA 2FOWA 4UB6C 2VASA 3OS2A 1POGA 1ENHA 3HC7A 1VQ4I 1GVJA 2CH0A 4XQFA 3RI4A 1QHHD 4ZTJA 2EV0A 2RC4A 3MWMA 4HNUA 2ACJA 4CA0A 3GTOJ 4EV0A 1ZG1A 3BQZA 3E7LA 2I5UA 4BEHA 5EG0A 2HU9A 2H1KA 3I3LA 4M6YA 2XAHA 2E71A 3CCYA 2M8GX 3C3WA 3F8FA 4M3GA 1YTYA 1N75A 1UMQA 2STTA 4HF0A 2RGVA 3NEUA 3CC7I 4BQNA 1ACIA 2WV0A 1W5TA 2V1NA 3I55I 3IRRA 3MEXA 9ANTA 1X3UA 3L7WA 2IS4A 1FYKA 3VDXA 3KP2A 2HOAA 1DU0A 3M8EA 1H9TA 2IAIA 1SVOA 4CGZA 1D5YA 4AYBN 3DPTA 1HDPA 3KP6A 2HVQA 2VBZA 3H5RA 3ABKH 1MZBA 3FM5A 2M0MA 3WG7H 2DPDA 4HW0A 2Q1ZB 3BR2A 5GTIC 2GBYA 3H3VK 3CCMI 2K9NA 5FKOA 3L09A 5BS6A 5FD5A 1G8XA 2Y9ZA 3BTCA 4UV9A 1QPIA 4CYDA 4CH7A 1UHMA 2HEOA 3HUGA 4HNVA 1TWGJ 1E3OC 3HM5A 3OL3A 2R93J 2P4WA 1T2KA 1G3SA 4IPAA 4XBFA 5FLVA 1B6AA 2ZJQF 1XSVA 3OYNA 1S3JA 2OUMA 4EQQA 4UUSA 2MW8A 4A3CJ 1BI0A 2KRFA 2V6CA 2XGDA 2ZNYA 2O6GE 3R4KA 3BPVA 3RYPA 5J1YA 1ZG5A 3JRHA 4A0ZA 5LGNA 4BACA 2JVGA 3L2QA 1HA8A 3K1MA 2CUJA 3K4NA 3OYEA 2EH3A 4HPQA 2O7OA 4YIRX 5IOZA 3FIWA 2OQRA 5IYCJ 2O8XA 3QU3A 2IS6A 5FO5A 4F92B 1Z1DA 1ETYA 4BUPA 4FTHA 3DKYA 4OU0A 5EG0B 2E35A 2OA4A 3CLQA 3BCAA 2FRHA 1VFCA 2F5DA 2DAOA 3DBHB 1JTXA 3M8FA 2EIJH 4EJTA 4RB0A 2TDXA 3PSFA 1HW2A 3FK6A 2IGMA 2L02A 2QLZA 3VB2A 3VPRA 4HOBA 2V9VA 4D9JA 2R92J 1G3YA 1XTAA 3JRBA 3SZPA 4EGYA 1RKWA 3WE2A 2D45A 2M30A 5B66C 2EINH 4MNUA 2R5YB 4BNCA 3ZN1A 3IAM2 4UVAA 3I59A 2ZMEC 3J7YJ 4X1EA 3G73A 1OYYA 5E1WA 3L2UA 4FHTA 3O3KA 5LHHA 5ILVA 3KP3A 3Q0WA 2P6TA 2IVMA 2ME6A 4JX6A 4RM2A 4LG3A 1IAWA 5KAFC 1MGTA 1RESA 2WTEA 3ZQLA 1FMVA 3QYBA 1E17A 1W4MA 2DCEA 2JZYA 3LQQA 2M9HA 2E1MC 4BY7J 2HWVA 1BR2A 3PFIA 3KLNA 1QO0D 1G3WA 2OD5A 4XONA 3W6JB 4HLYA 1AWCA 4L9NA 1TC3C 1GDTA 1AOYA 1W5SA 3PM1A 4A69C 1BIAA 3ASNH 2P7CB 2YX7A 4HEA2 4PUSA 3WTVC 3CF5F 4XRSG 5BNGA 3CMYA 4RGUA 4AM3A 2JQ7A 5ICCA 2DT7B 2ECBA 3GFIA 2WAQN 4KFCA 4FETA 4NQWA 2H1LA 4R8HA 5AIPA 3OYCA 3CCUI 4E7LA 2IT0A 2VODA 3M9AA 2DA7A 5CQGA 4UV8A 1ZTRA 4IF4A 2VJ5A 1U8RA 2WY7Q 1MMNA 2R7SA 1WJDA 4BQAA 4HRIA 1YJWI 3JR9A 2DT5A 1IXSB 2DA4A 1HOMA 3J80K 2D5VA 5CPRB 3JRGA 1DUXC 3ROUA 3C1DA 4BXUA 1EH6A 2DQLA 1PDNC 4FISA 1W0UA 5J1UA 2WAFA 4G7HF 5J4YA 1FIAA 3T5XA 1QPMA 3WU1B 1OYIA 1TQIA 3D1NI 1RNLA 4ZDOA 3BZ6A 3P9CA 4CYCA 3BZKA 1X4OA 3JRAA 2STWA 3A0HC 5J1RA 1XX5A 3GLXA 3UR3C 2H94A 1A6IA 2XAQA 1IF1A 5ERIA 3CUQA 2KDZA 1MDMA 2VE9A 4HX7A 2DI3A 2ZJ2A 1YS7A 2HKOA 4YRVA 2XPWA 2FJ1A 4MO7A 4A93J 1QU3A 2UWMA 1FTTA 3LFKA 2V1DA 1DU6A 1N25A 3TW7A 1AU7A 4O3MA 4E7JA 2JRTA 1USTA 3PQKA 3I4MJ 1FZPB 5F04A 4NDLA 4ZDPA 5FD6A 3JAMZ 1WJCA 1JUPA 4XR6A 4C3JJ 1SD7A 2EFOA 4HA8A 4AYBA 1MBKA 2VKHA 5M5WJ 1E3PA 2X1DA 3F8MA 1R4NB 2VT2A 1TL8A 4UY8I 3S16J 3CDIA 3V8JA 5ED4A 4KUMA 1D0XA 2B0LA 2GWRA 1NK3P 1F43A 3OYBA 2E36A 2M1BA 3U1KA 4XKBA 4XLCA 2DA2A 1F9NA 3T1BA 4Y7NJ 5KAIC 1ZQ3P 5F64A 2IA2A 3PUFA 4KIGA 3OYHA 2GAUA 4KN4X 4RLQA 3COAC 1D8KA 3TP0A 4ZYGA 2VQCA 1KONA 4GYGA 4E7SA 4CZCA 3AL0B 2Q2EB 3VEPA 1MNDA 4I98B 4Y52J 3GEZA 2EPFA 2RVCA 1PUFA 3LA7A 4EGZA 1U78A 3GUDA 1FOXA 1I39A 5HOOA 3L2WA 4PJJA 5EEGA 3ZCOA 3G3ZA 1VNDA 3FF5A 2Z9OA 1OYWA 5KVRA 2XAUA 1D1BA 3KZIC 2RQPA 1XMKA 1FOWA 5D8KB 3NRVA 1D3YA 1WQ2A 1P6RA 3KYLA 2BHYA 2LF8A 2A5YB 4RGRA 3L00A 3ZQGA 3WG9A 5K5QA 5E3OA 1GVDA 2Z1DA 2HFHA 3U1DA 3CUQB 2ZMEB 5JHFA 5HLGA 2LF7A 2X6XA 4MHGA 2XAFA 3OYAA 5L3GA 1ERDA 4ZZLA 2X6YA 1B4AA 2OU2A 4PCQA 1RRJA 3CF2A 2IGOA 4ZDLA 3ISPA 3AFHA 1EKEA 1OCRH 4G9YA 1JI8A 5EZGA 5J8CA 5IY5H 1ZR2A 2EB7A 2E19A 2QYOA 3TO6A 2OBPA 2R7ZJ 2FE3A 2QQ9A 3A4CA 2E1MB 5FLXZ 3ELKA 4PJMA 4GGGA 3WGHA 1B8IB 4LLGF 5L3DA 2IP2A 1W7PA 1A31A 4PGGA 4PJNA 1TQMA 1L0OC 1FT9A 1IJWC 3J7AY 2DK5A 2A61A 1U9NA 4DIQA 5J40A 4B4CA 2L4MA 3R0AA 2VBYA 2QQAA 1ZRFA 2HQNA 3WHBA 2ESNA 1U5TC 2VBWA 4BY1J 1K6YA 2X1EA 4P5OA 4JX5A 3S2DJ 3GTLJ 1I5ZA 5K7HA 5H2FC 2QEXI 5IT9K 2FU4A 5F0CA 1J0RA 5J6XA 2FD5A 3LAJA 3CP8A 2L7ZA 1SVMA 1RETA 3DPUA 1TP4A 2VC0A 3RPUD 3EQLF 4YFKF 5K5RA 4II3A 4MTDA 2A6EF 2LY2A 1YO5C 3S17J 1A6QA 4RB2C 1WVRA 2LY1A 2EFQA 4FT8A 3Q0UA 2WAQA 2BY1A 3ABTA 3K69A 3I58A 4UVCA 4BHPA 4BQOA 3BC8A 1CF7A 2GOMA 3C7JA 3H92A 1T39A 4PSXA 5F0FA 1FYLA 3HHHA 4MEYF 1ZRCA 2E60A 5IYDJ 2DFFA 4UB8C 4DW6A 1JT6A 3CDLA 2PX9A 2DLLA 3QYFA 4XLPF 2P5VA 3GFLA 2VI6A 1IN7A 1YI2I 1QZZA 2BBYA 2NXNB 3PO2J 1Y39A 3HOVJ 5JFRA 3BCBA 2Y9YA 4LFUA 4A6EA 2ZSIB 3K7AJ 4WXDA 3IP4B 3FBNB 3CMAI 4PGHA 5HVQC 1YQAA 3KPHA 4R79A 1VI0A 1H0MA 2L7MP 5JVGF 1BA5A 2NS7A 2HZTA 4OAYA 5TRDA 2HPIA 3RSNA 1KU7A 3LSRA 2QA4I 1SFEA 3LSGA 4D1QA 2HVSA 4OIPF 2DODA 1FP1D 2HTJA 3C18A 2L7FP 5FRNA 1IUFA 3P9KA 5C44J 1LFUP 1H89C 4BXFA 3M1EA 3QRFF 4JQFA 3PJRA 2NS0A 1ETKA 4CUGA 2BOLA 2NS8A 3OOUA 3QOEA 3R0JA 2K9QA 5M5XJ 1KU3A 4WXCA 3EUHC 4A0XA 1V54H 1A35A 2RREA 2HKXA 2JMWA 3S8PA 4F7ZA 3S3NA 1JKPC 2CGPA 3LNQA 2CV2A 1X3ZB 4XLNF 4XRMA 1U2WA 2ID6A 3AAFA 2Z5UA 1J75A 2DYRH 5LRSA 3CCJI 3FZVA 3CC2I 4NBQA 3OYGA 3BOQA 4RBOA 3BLYA 2CSOA 1R1TA 1BI1A 3HPGA 5LGTA 1EA3A 2WBMA 1YW8A 4LJZF 5CVRA 2A68F 3F8CA 2DK8A 3ZMZA 1BW5A 2PFBA 1ZG3A 2F4OB 2KIQA 2HPMA 4FE4A 5DD8A 2ADUA 4I02A 2JT1A 2BY2A 4JOMA 3LQRA 2HXIA 3DEEA 5H6RA 4MTEA 3J7ZI 2VJJA 1U8BA 1T56A 3K0LA 3FXUA 4BDYA 3HRUA 1SD5A 2IA1A 4A3BJ 2KRCA 3IWFA 1NG6A 3HYIA 1WJAA 3M8JA 1X19A 2JUGA 2YUSA 5E18F 3O6BB 3B6AA 2M7AA 2RAEA 2Y75A 3IAS2 2W4SA 2B7EA 3G2BA 3CP2A 2TRTA 3F21A 2VIXA 3CLOA 2OAZA 4PZJA 5IYBJ 4C9YA 2NNNA 1G59A 3F72A 2QUFA 3HOXJ 3I9V2 2E5NA 3P5JA 4KJZA 1DDNA 3A01B 2HQRA 3KYCB 3TQNA 1EH7A 1QBJA 4ZJZA 4KITB 4HX8A 2DN0A 2KP6A 1S29A 1SAUA 2JA6J 3SZGA 2L9SA 3IH2A 2PLYA 2ZB9A 5HLHA 1X1CA 4ESBA 1TWAJ 3BR5A 1MMSA 4NC6A 1P4XA 1ZAOA 1YJ9I 3BG6A 3HJEA 2IJLA 4HLXA 1APLC 1VQLI 2LG4A 4BKXA 5C4JJ 1X3WB 3KP7A 3HEFA 1EH8A 3QP5A 2EBIA 4M72A 1S72I 1IRXA 4L9VA 4ENNA 2H6CA 4P96A 1JT0A 3S15J 2IXSA 3A1YA 4EJVA 2CRGA 4I76A 3CUOA 1R36A 3KZZA 2V4JC 1RC9A 4LK1F 4ANJA 4N9HA 3PFYA 5B3SH 2NAZA 2NVXJ 2BEOA 1IRGA 3I54A 4IZZA 3AG1H 5DTDA 3H5AA 4F55A 2CQKA 4YFXF 3U2RA 4AIHA 1A5JA 1U0JA 3K4BA 4E7IA 1IN5A 3OIPA 2CQQA 5J4VA 3DTKA 3TW6A 4LB5A 3CMMA 3A03A 3EPZA 1WGXA 1IN6A 1GV2A 2VOOA 2X51A 5TJJA 2IBDA 3H3ZA 2CYYA 2DYSH 2LYCA 1B72B 3DLLF 2KQRA 2RQQA 4H4KC 5TGTA 5CLSA 2M7BA 3MKYB 2H09A 1T98A 2LH9A 3LOCA 4YIIA 2Z99A 3GTKJ 1S7EA 1BOBA 3P7NA 3HSRA 1MNEA 2LP0A 1VQPI 5DCMB 3H0DA 3MZHA 1K6OA 3F6OA 4HV5A 5CVJA 2FMLA 4O6JA 5D5WB 5JR3A 1GUUA 1J7KA 1LDKB 1U9OA 4XLAA 5FJ8J 3HOUJ 2GXBA 2V6EA 3OYIA 4KIBA 1Y0NA 1HSJA 4IO9F 2BXYA 3T0YA 5DM6F 3HGYA 4V2GA 1I50J 4W97A 2W7NA 3ASOH 1MD0A 4LLNA 2EIMH 1W0TA 4A3KJ 4IHXA 4N9IA 4FX0A 1F1ZA 1TW2A 2X1CA 2R7RA 3BG7A 4XLFA 3FX3A 2COMA 2LOOA 4A2UA 2QQBA 3GLLA 3WGGA 2IS2A 3FM3A 2L01A 1F5TA 1O3QA 3HIFA 3FXOA 2MGQA 3M4OJ 4IHTA 3FMQA 1ZN2A 1Z3XA 2VQHA 2YPRA 5EYRA 4CCJA 3Q5FA 2P7VB 3JSOA 2X0LA 1Y1WJ 2YX4A 1X1AA 4RB3C 4XICA 1TWFJ 2FUG2 2KIUA 3QPLA 4B47A 2QSHX 1IC8A 4L5EA 1TT0A 3ZR8X 4PFOA 2FX0A 5BPIA 2PJRA 4XMYA 5IT9Z 5HLIA 2GXGA 4X0GA 4BS9A 3MD2A 1L3LA 3LA3A 1REPC 3GFMA 4HDVA 3ABUA 3KZYA 2QKLB 3I5UA 5LD2C 1TLHB 2VQLA 2LBFA 2ZBKA 4KT6A 2ZXIA 5H6QA 2X85A 4CCKA 2DOEA 2HDWA 2KT0A 4XSZF 4KISA 3O8GA 2IW5A 3FDYA 3TP3A 1XGSA 3S1MJ 3D5RC 3TDUC 5HNFA 1FC3A 1OJLA 2ZJRF 2FOKA 4MEXF 4RA2A 4OOIA 2EK5A 5ILSA 3N97A 2HYJA 3ZQIA 3H9QA 4XLEA 1SAXA 2NYXA 4C2TA 2MD0A 3U21A 3MZ8A 2A6TA 5FKNA 1QRYA 2F6CA 4GCVA 1WJFA 4ENJA 2O9LA 2B9SA 1I1GA 1D0ZA 3ECHA 4XN3A 3CD6I 2L3DA 2K4JA 3LL7A 5FFXA 1RIOH 4XIDA 3AL0C 5GTHC 1VF9A 1EF4A 2W57A 2CU7A 2UXNA 4N4OB 4P9FA 2DTRA 2BW3A 4S04A 1OKRA 1QGPA 1LDDA 1D1CA 1MH4A 1OR7C 3RKYA 3S32A 4BEHB 4OMZA 5CVIA 3TDZC 3GTGJ 3JTGA 2CQXA 1ZRDA 3EUKL 4WK8F 1D8JA 5AONA 4NHJA 1G6NA 4U0WA 1TWHJ 1Z6RA 1ODDA 4D5FA 1MBHA 4R1HA 1BOAA 1XSXA 5DD4A 5GADJ 4L0ZB 3JSPA 2VLAA 1FPQA 2BE5F 4F91B 3PNYA 4I99C 3DXJF 4ZYDA 1FSEA 4IOAF 3CO7C 1DQUA 2CW7A 4DYQA 5B5EC 1LEBA 4D7NA 4RS8A 3Q3SA 3ZMSA 3CUQC 4G94A 1MJAA 2Q0OA 1NH3A 1ZLKA 4GDFA 4E6KG 4KN7X 2FBKA 2PJRB 4YIFA 4UUVA 3RKQA 2M4KA 3DBLB 1N78A 4MFDA 3GX4X 4I7HA 5LEKA 2DJNA 2DMPA 2BY0A 3MCZA 4YFNF 1TQPA 1VQOI 3HOTA 2LBFB 4BE1A 1KZHA 1X58A 3HUGB 1MMDA 2ID3A 4HV6A 1Q1VA 2ELJA 2DMUA 3SDGA 4BJTA 4ENMA 1GV5A 2OQGA 3T8RA 2O61A 3BP8A 1R5ID 5D8LB 2PMUA 2NVYJ 2WWYA 2KIMA 5M5YJ 4UUSB 3K1PA 5KK1A 1ZKGA 2QBYA 1F36A 3WE3A 5FB2A 1ZREA 4J19A 2XKOA 1W5CC 1T08B 1UJ8A 4MFEA 5C3EJ 2UV1A 5EGOA 1PVEA 3S2WA 4Y3OA 4ITVA 4JP0A 4BAYA 4L5JA 4OAZA 1V55H 3DU6A 3G1LA 2L9VA 3RTRA 1X2NA 3HSEA 4BL0B 5FKMA 1R1UA 1KU2A 2AS5F 2PN6A 3S1QJ 2EFNA 1BC8C 4M6XA 4CXFA 2RNJA 1X1DA 3LA2A 1I1SA 2QWWA 1YRNA 4Q4ZF 4EMSA 1IRZA 2Y31A 2QKMB 1YJNI 5E3NA 4E70A 2ZKZA 3V8LA 3IHUA 1WI3A 1XG1A 5IOYA 3LSMA 1LE8A 1NG7A 2BVLA 2CO5A 3SXYA 2V9KA 2FXAA 1T6SA 2XVCA 2HQAA 2R7FA 1BIBA 2H6BA 3K4CA 4GXOA 4YEJA 2AXTC 4PDKA 1T33A 2BY3A 3MFKA 1XGOA 2F5CA 2PI0A 3L1PA 3QPTA 1V5EA 3KP4A 1IUYA 1WRJA 2E7WA 3ZQQA 3FK7A 3GWZA 4F3QA 5GAGJ 3A02A 1TTYA 2FQ3A 2RKHA 3I59B 2MG4A 4OWRB 4AC0A 1Z9CA 4HZFA 2VB6A 1JE8A 1FEXA 2MLGA 5KCMA 2KIFA 1IRFA 2KPMA 1OCOH 3U9GA 1R22A 1JHFA 4LG0A 1W1WE 3DFGA 5A2QZ 5M3MJ 5FKKA 2X6WA 2DOFA 1K7AA 4L9JA 4BH9A 5D6EA 2EFWA 2KL4A 1IDZA 3WTYC 1F4KA 3CTAA 3WGIA 2ISYA 1K78A 3SFZA 3GCMA 3CESA 2XPUA 4NNJA 2P5LC 3CJNA 2XGCA 1AA7A 3E5QA 4RM3A 1Y6IA 2GXAA 1S7AA 1ETVA 2VONA 3TO9A 3DKWA 2K40A 1HLVA 5KHDA 3IV5A 4V19K 2Y2ZA 1ZGJA 4IX7A 2ISZA 3D5SC 4KMFA 3GBGA 3I64A 4NQWB 4IQ4A 5HS8A 4LGWA 4QTRA 1B59A 5JVTA 2XC7A 4J01A 2O8KA 2P81A 2AO9A 4GO1A 1LKXA 2K9LA 1YX3A 2EFPA 1QVUA 4IRHA 4UUTA 3RPUA 2DU9A 1QQIA 2Y0MA 4IRGA 3GTMJ 2DDBA 5LBQA 4Q5SF 1OFCX 1R00A 5FFZA 5LHIA 5TISC 1ZH5A 3SZTA 3F8BA 4JX4A 3J81K 2FNAA 2PJPA 1MBFA 3NWTA 3AG3H 2K9MA 5GP9A 1LE8B 1DPRA 1XC5A 3CZ6A 5EEAA 3FISA 4CYCB 4F93B 3F8NA 2L4AA 3KIOA 1Z0XA 2Z3YA 3FXMA 1G4DA 3HOSA 1J2XA 1VZ0A 3QYEA 1Z6TA 4XK4A 2ZXHA 1OPCA 3RDIA 1MDMB 4QWQA 3N05A 2MH9A 4C30A 2G7UA 3HHGA 5CJ9A 5E8GA 1ZR4A 1FIPA 2LY9A 1ONVA 2VXDA 2HXOA 3BG3A 4CSWA 3GZ6A 3K4KA 4AIDA 5GAHJ 2KRHA 2XASA 1WKMA 1QHGA 5FKLA 3UKGA 4LMYA 3VSKA 5LHGA 1HF0A 2IEKA 3LSKA 2H27A 3E6BA 1GLNA 4FCYA 1K78B 5D4SA 1X1PA 1Y8QB 2LR8A 2LVSA 1LDJA 1JUSA 2V1XA 3AG2H 2HI3A 2MSYA 2XAGA 4XORA 2XDVA 5DDGA 2VXZA 2ZXWH 4Y4RA 3GTQJ 4I09A 5IT3A 2MABA 3E97A 2GQQA 2JPBA 4P55A 3K2AA 5FGMA 5E1ZB 4CCOA 3SEQA 4ZZDA 2QSGX 1O3SA 1VQ9I 1SMYF 2JRMA 1JJ8C 3ML6A 3OSFA 5LLQA 1PUFB 1JHHA 3CCQI 1HXDA 2ZC2A 1SC7A 1T0FA 4A3DJ 5F08A 3BG9A 1MSEC 4U0YA 1JXSA 1UAAA 3H36A 3Q9SA 2M8EA 4RDUA 2O0YA 2CV1A 2Y0SN 2NRAC 1ON2A 2J5PA 1FMWA 3K9TA 1S6LA 3FXQA 4DQ2A 3S3OA 3O8HA 2K85A 2ELKA 2A05A 5J3LA 4HX4A 2DA1A 5HLTA 2R7XA 3DEUA 1OMIA 2XRLA 4EJUA 3TO7A 2XRNA 5HNHA 2HTSA 1MBEA 1CGPA 4H0EA 2DFEA 1G3TA 4BE2A 5J8FA 1R4MB 3B6CA 5EF6A 2HGCA 2CUZA 2CQ7A 4XN0A 3G4SI 1MH3A 2IA0A 1SVLA 1BI3A 3EYYA 4AUXA 2FBIA 1S8NA 2XB0X 2V7FA 3ERED 4U7BA 1KYZA 3H9JA 4WF2A 2FMYA 4IHSA 2M5WA 4Z6YA 3K10A 4DOZA 1ON1A 2LD5A 3BJAA 3S1NJ 3DP7A 4AD9A 4B3AA 4L5IA 3WTXC 2HR3A 3SFIA 2X4HA 1VTNC 3HOWJ 2R7WA 1W7PB 1D1AA 2R4GA 2KMUA 4UVBA 5E3MA 1YE9A 2ESHA 1V5FA 4HG2A 3N4MA 4RGXA 3QQAA 4E7ZA 3PIOF 4MGRA 1ITYA 2K86A 2FA5A 1IN4A 3BR1A 1Y8RB 3HG9A 2P0WA 3LFUA 3VFZA 4DBQA 4BGDA 1VQ8I 1QVTA 4HSRA 3BR0A 5B1BH 2E2HJ 1YW7A 3LMMA 3OYDA 3TKYA 3HB9A 3V7CA 2XUBA 1AKHA 1K83J 1IXRC 1J09A 5CVUA 4AU7A 3M7GA 4A5NA 2DA3A 4LK0F 3QP6A 2EZLA 2VJIA 1U5TA 2RN7A 2XF6A 2E2IJ 1LFPA 2DO7A 1YFHA 2R7UA 2L9NA 3Q9VA 2GIZA 3BTLA 2KZGA 2R7DA 2L5QA 3SYTA 3ULQB 3QOPA 1CF7B 3LSHA 3CCLI 3EDPA 3BZCA 2V26A 3UNGC 1IGNA 3RYRA 4Y13A 3J80Z 2TCTA 2K4BA 3E5UA 5ILUA 2N8GA 3FXRA 1UHWA 4BHCA 4MIMA 3HRTA 3RQIA 2VJ4A 2G9WA 4XOPA 2W82A 2ZFWA 4UHTA 2MC3A 1J59A 1ZYRF 3FMRA 3RKWA 4ZYHA 1FBQA 3DV8A 3L2RA 2F5EA 4OIQF 4DGWB 1BJAA 1PYVA 3OWTA 3ZOBA 1R71A 4BJ5C 2JJ7A 5E79C 1R58A 3ZMDA 2LSOA 1UCRA 1V4RA 3FWEA 3D0SA 1FP2A 2E7XA 2JSCA 3PSIA 2BZTA 2XV4S 2AQFA 4K2EA 1V3FA 4CHUA 2R7TA 3G6EI 2FSWA 1FX7A 2V79A 3OR2C 3W3CA 1R23A 4I0BA 4EJOA 4B3XA 3H1CA 3KLOA 1E0EA 2K3PA 2JA7J 3HBLA 2K3FA 3S14J 1MKMA 4QSHA 3IWZA 3RPQA 1PP8F 2VC1A 1DP7P 2MD5A 2NVTJ 1KU9A 2CQNA 4OINF 3JRFA 3IL2A 2IRFG 4M3DA 1OCTC 3E6DA 3H3UA 3IH4A 1UG0A 1NK2P 5FLMJ 3CC4I 1ZLJA 5JHUA 1K61A 4DBRA 4BU2A 2PBIA 3EUHA 4CO8A 2CS3A 2M2EA 1O7LA 2EA4A 2ECCA 3VYRB 4PFPA 5AIQA 3EYIA 2Z16A 2AQEA 1ETXA 2GOXB 2JSPA 2Z33A 5F1JA 1TW3A 4QLCU 4QPQA 3FKJA 3E0JB 2EIKH 1AKHB 1WCMJ 1Z77A 1FNNA 1YYVA 2QCOA 4XKCA 3GTJJ 1P4AA 3CMEI 2ZJPF 3GMEA 1BN5A 5CYVA 3HOZJ 3T8TA 4BE0A 1BR1A 3DTEA 4LLLA 1UFMA 1SD4A 3MKZA 2BYVE 1Z21A 3R60A 3F3XA 2EZIA 3F23A 1ORKA 1WJEA 1TNSA 1TT5B 1UELB 2DFIA 2FF4A 1EJ9A 1I6HJ 4Q47A 2DOAA 4DJAA 3HTSB 2HYFA 1JKQC 1B9NA 1TBXA 1QA6A 5E8IA 4BBRJ 4XOTA 3E6MA 1HKSA 2R7QA 4FASD 2COBA 4RAFA 3ZMUA 3C2BA 3JAMK 4M73A 4ENKA 3HOYJ 4CCNA 2Y0SA 3J81Z 2WB1A 1KQ0A 4C3HJ 3SJMA 1SFKA 3IUOA 5E3LA 2CV0A 4DNCA 4LIVA 5M3FJ 2Y30A 1KQ8A 2HDDA 4X6AJ 2XF5A 1LVAA 1P4WA 1BL0A 2JWTA 3TOAA 3K4JA 3CCVI 2GLOA 4UXNA 2HVRA 2VN2A 1LB2A 2AHQA 3PO3J 2V9PA 4M9XA 2M45A 1J9IA 3OS1A 4PSWA 3R6SA 2RDPA 3S93A 3ESWB 3TEDA 5HODA 1HSTA 2OV7A 4I6ZA 2QF7A 2HOTA 2YR2A 4N4NB 2D2WA 3LSJA 3CCRI 1LJ9A 4KIFA 4AWXB 1IDYA 1X1BA 3JRDA 4FX4A 5CKTA 1PUEE 1WH7A 3BROA 2PG4A 2M4GA 1YOVB 4D7MA 2HOEA 2Z2SB 3G71I 4PJ0C 5E17F 3V4GA 1YX5A 1K4SA 1R5GA 1BC7C 2ZXJA 3R61A 1O3RA 1K79A 2WA0A 2IGKA 3HGGA 2MC4A 5DYMA 2EQRA 2D1HA 2F4IA 4KYWA 2JVHA 4KICA 2K27A 1BR4A 3KEOA 3HZJA 1UB9A 5L3FA 4ZYEA 3QPHA 1DP3A 4XM3A 1SFUA 2K9SA 1TZLA 3WTZA 1P7JA 1JKOC 1I3AA 3HSFA 4N0BA 2OCCH 4XNFA 1B1BA 3FHZA 2W1OA 2DMNA 2KDOA 3VSLA 4S05A 2DT6A 3GZNB 4OIOF 1RR8C 2XF7A 3OV8A 4WCGA 3MAJA 2UUZA 3CQZJ 2A5WA 2DJIA 2I10A 3DEWA 4PK4A 2R5YA 2JA8J 4B1RA 4BJ6C 1HQCA 3VYTB 3DTIA 1H9GA 2EJRA 3PNTA 3W2WA 2OPTA 4Z2YA 5L3EA 2FNPA 1WJBA 4IL6C 4ZTFA 2NOJB 5FLXK 2XROA 3OS0A 4KMUX 2DMQA 5LFAA 2XGXA 4XLHA 4XSXF 4P9UA 3WHCA 3BJ6A 3ZMVA 2BV6A 2NVUB 3ZQCA 1YLFA 2DFHA 1PP7U 3DLAA
chains in the Genus database with same CATH topology
2D1VA 2RV8A 1FYMA 4OMYA 4UNOA 2ZO4A 1LQ1A 4YG2F 1R5HA 3W6KB 3GF2A 1IN8A 3ZN0A 4U7DA 2F5FA 2MBFA 4KT5C 3E5XA 1XSDA 3V7SA 2GZWA 2EWNA 2KKOA 4M9ZA 4L0YB 3P9IA 4AIJA 5DCFA 1MJ9A 2DBBA 2R3SA 4WX9A 3EETA 2YU3A 4HDUA 2LDUA 4EJWA 2EV6A 5HDGA 5HDNA 5DUKA 3CO6C 3NQOA 3SHFA 2XHKA 5L3BA 1XN7A 2L54A 4MQVA 5H20A 3IRQA 5EEHA 1EV7A 3WODF 4Q48A 3HRMA 1U6GA 3E6CC 1HW1A 2WC2A 2XKPA 5CVVA 3FMSA 1LNWA 4HBLA 2DQRA 2VE8A 3RIRA 5BMZA 1NHAA 3CDHA 1YW9A 2G7HA 4A5MA 2FEZA 4I2OA 1MJBA 3DF8A 5DV5A 2BGCA 1USSA 4IRIA 3L9FA 3BY6A 3GFJA 1KA8A 1GHCA 2ELHA 4GYIA 3HRSA 2P8TA 4AIKA 1XGMA 1IXCA 2IPQX 4IXAA 3JW4A 3K2ZA 3SQNA 4HF1A 4OIRF 2QVOA 4WXHA 2A07F 1IW7F 2Q2EA 3OOPA 5LEJA 4KA4A 4M74A 1I6XA 1OR7A 3DQVC 3RKXA 5L3CA 3KCCA 2JPCA 1QZYA 1U3EM 1QNTA 1ZHFA 2YSRA 2XIGA 3LWFA 3WU0A 1XCVA 4O5VA 1Q1HA 1STZA 1KGSA 2HDCA 4G6QA 1SD6A 4L18B 3WTUC 3IC7A 5JI6A 2EV5A 2ZMEA 1O57A 1RUNA 3I0TA 4MQ9F 2XAJA 1Z91A 2A3SA 3GZ5A 2JTVA 5LRRA 1XB4A 1GXPA 2QM3A 3KE2A 2DPUA 2QBYB 1B9MA 4AVPA 3K1NA 2MA3A 3WTSC 4D0PA 1XMAA 4A6DA 2E1NA 2CG4A 3PQJA 3GXOA 3ZPLA 3WTWC 4G7ZF 3V8KA 3MZYA 3BJOA 3GYHX 4BHBA 4G6DA 1P92A 4XRFA 1WSUA 3BDDA 1XGNA 4BYYA 1ZGAA 2KJBA 4RAZA 3B02A 4ASNA 4HYEA 2LNBA 4IVNA 4Y15A 5HDKA 5HS9A 3VODA 2W24A 1SFXA 1XDSA 1BM9A 4A12A 1Y0UA 3D5LA 5BPDA 1R1VA 3B73A 4RB1A 2ZNZA 4Y17A 4ZH4F 3VOEA 2J5OA 1C0WA 4LG0B 5BOXA 3F6VA 4A0YA 3BWGA 2CFXA 2E1CA 3ZP5A 4NB5A 4LB6B 1WI9A 1FSHA 1LEAA 5K1YA 5D6FA 3JTHA 3ZMTA 3GO5A 1D5VA 1TNTA 1YIOA 1O3TA 5ICGA 2Y48A 2HYGD 4KNYA 2K7LA 2HS5A 2VOPA 1XDUA 4B8XA 3QAHA 4CDGA 4I0AA 2ZCWA 2PQ8A 4KDPA 1P2FA 4HQEA 1FBUA 3I53A 1YG2A 4RAYA 5ICEA 5DEQA 3E3VA 4HF2A 4JBAA 3HTUA 2FBHA 1RI7A 4ON0A 3QU6A 1E2XA 2AXLA 2VBXA 1JGSA 1J5YA 4B09A 2CW0F 1ULYA 4U88A 4WWCA 3J7AO 2CWEA 5E20A 2QENA 3DPLC 4IJAA 1Z05A 5LGUA 2EA2A 1R7JA 2O03A 3KEQA 2GIVA 4EM1A 5ICFA 3REOA 2MLKA 1RUOA 1KQ9A 5F6FA 3I71A 1W7PD 3GVAA 1FY7A 2A69F 5F1RA 2OZ6A 2W84A 1I27A 1HBXG 4EM2A 1O7FA 3LSTA 3KP5A 1HKTA 1ZARA 4TV7A 5K5OA 4M71A 3GW2A 1S7OA 4U0VA 4G8XA 5D5VB 1BBYA 3ECOA 2NNYA 1IZ1A 2A6HF 4LD5A 2UXXA 3RJPA 4HAMA 3TOBA 4EVIA 1FWZA 2GA1A 2LKPA 1YS6A 2PEXA 1A04A 4ESJA 4EM0B 5DCMA 5D4RA 2C6YA 3V7RA 2P5KA 5HS7A 3LAPA 3O2PE 1DPUA 1XCBA 3F22A 2OZUA 3IKVA 3MQ0A 6PAXA 1KYWA 1T38A 1HW5A 3TGNA 1FBSA 3KETA 1XD7A 4G7OF 4ESFA 5DUIA 4JK1X 4ETSA 1WWXA 2UZKA 2F2EA 1U5TB 1Z7UA 4CZZA 4I01A 2PMHA 2VT3A 2O3FA 1GXQA 2GA2A 4HQMA 3L2CA 1HKQA 4CICA 2DW4A 2ETHA 5A2QK 3ZQ7A 5D5XB 2QZ8A 3IKTA 3I4PA 2P6SA 2V1UA 3BPXA 2K02A 4L9TA 2W85A 4M9SA 3KFWX 1SMTA 2Q8KA 2KJCA 2MH2A 2M87A 3WTTC 1FOKA 1RZ4A 5D5UB 5BQTA 1FLIA 2W25A 4RGSA 5E1XA 1BI2A 1GVJA 3RI4A 2EV0A 2RC4A 3MWMA 2ACJA 4EV0A 1ZG1A 4M6YA 2XAHA 3C3WA 3F8FA 1YTYA 2STTA 4HF0A 2RGVA 3NEUA 2WV0A 1W5TA 3IRRA 3MEXA 1X3UA 3L7WA 1FYKA 3KP2A 3M8EA 1H9TA 4CGZA 3DPTA 3KP6A 2VBZA 1MZBA 3FM5A 2DPDA 4HW0A 3L09A 5BS6A 5FD5A 4UV9A 4CYDA 1UHMA 2HEOA 3HUGA 2P4WA 1T2KA 1G3SA 4IPAA 4XBFA 1B6AA 1XSVA 1S3JA 4EQQA 1BI0A 2KRFA 2V6CA 2ZNYA 2O6GE 3R4KA 3BPVA 3RYPA 1ZG5A 4A0ZA 5LGNA 3K1MA 2OQRA 2O8XA 3QU3A 5FO5A 1Z1DA 4OU0A 2OA4A 2FRHA 2F5DA 2DAOA 3M8FA 4EJTA 4RB0A 2TDXA 1HW2A 2L02A 2QLZA 3VB2A 4HOBA 2V9VA 1G3YA 3SZPA 4EGYA 3WE2A 2D45A 2M30A 4MNUA 4BNCA 3ZN1A 4UVAA 3I59A 3G73A 1OYYA 5E1WA 4FHTA 3O3KA 5LHHA 5ILVA 3KP3A 2P6TA 2IVMA 1IAWA 1MGTA 2WTEA 1E17A 1W4MA 2JZYA 3LQQA 2HWVA 3PFIA 3KLNA 1QO0D 1G3WA 2OD5A 4HLYA 3W6JB 1AWCA 4L9NA 1AOYA 1W5SA 1BIAA 2P7CB 2YX7A 3WTVC 4RGUA 5ICCA 3GFIA 4KFCA 4NQWA 4R8HA 2VODA 5AIPA 2IT0A 3M9AA 4UV8A 4IF4A 1U8RA 4BQAA 2DT5A 1IXSB 3J80K 1DUXC 3ROUA 3C1DA 4BXUA 1EH6A 2DQLA 1PDNC 4G7HF 3T5XA 1QPMA 3WU1B 1OYIA 1TQIA 1RNLA 3BZ6A 3P9CA 2STWA 3GLXA 2H94A 2XAQA 1IF1A 5ERIA 3CUQA 1MDMA 2VE9A 4HX7A 2DI3A 2ZJ2A 1YS7A 2HKOA 2UWMA 3LFKA 2V1DA 4O3MA 2JRTA 1USTA 3PQKA 1FZPB 5FD6A 3JAMZ 1SD7A 2EFOA 4HA8A 3F8MA 2VT2A 3V8JA 5ED4A 4KUMA 2B0LA 2GWRA 2M1BA 1F9NA 3T1BA 5F64A 2IA2A 4KIGA 2GAUA 4KN4X 3COAC 1D8KA 4ZYGA 4GYGA 3VEPA 4I98B 3GEZA 2RVCA 3LA7A 4EGZA 1U78A 3GUDA 5HOOA 5EEGA 3G3ZA 3FF5A 2Z9OA 1OYWA 5KVRA 2RQPA 1XMKA 5D8KB 3NRVA 1D3YA 1WQ2A 1P6RA 2LF8A 2A5YB 4RGRA 3L00A 3WG9A 5K5QA 2HFHA 3U1DA 3CUQB 2ZMEB 5HLGA 2LF7A 4MHGA 2XAFA 5L3GA 4ZZLA 1B4AA 2OU2A 4PCQA 3ISPA 4G9YA 5J8CA 2EB7A 2QYOA 3TO6A 2OBPA 2FE3A 2QQ9A 5FLXZ 3ELKA 4GGGA 3WGHA 4LLGF 5L3DA 2IP2A 1W7PA 4PGGA 1TQMA 1L0OC 1FT9A 2DK5A 2A61A 2L4MA 3R0AA 2VBYA 2QQAA 1ZRFA 2HQNA 2ESNA 1U5TC 2VBWA 4P5OA 1I5ZA 5IT9K 2FU4A 1J0RA 5J6XA 3LAJA 4YFKF 2VC0A 5K5RA 3EQLF 4MTDA 1YO5C 2A6EF 4RB2C 2EFQA 4FT8A 3ABTA 3K69A 3I58A 4UVCA 4BHPA 1CF7A 3C7JA 3H92A 1T39A 1FYLA 3HHHA 4MEYF 1ZRCA 2DLLA 4XLPF 2P5VA 3GFLA 1IN7A 1QZZA 2BBYA 5JFRA 4LFUA 4A6EA 4WXDA 4PGHA 5HVQC 1YQAA 4R79A 1H0MA 2HZTA 5TRDA 1KU7A 1SFEA 4OIPF 1FP1D 2HTJA 3C18A 3P9KA 3QRFF 3M1EA 4JQFA 2NS0A 3R0JA 1KU3A 4WXCA 4A0XA 4F7ZA 2HKXA 2CGPA 4XLNF 1U2WA 3AAFA 2Z5UA 1J75A 5LRSA 3FZVA 3BOQA 2CSOA 1R1TA 1BI1A 5LGTA 1YW8A 4LJZF 5CVRA 2A68F 3F8CA 2DK8A 3ZMZA 2PFBA 1ZG3A 5DD8A 2ADUA 4I02A 2JT1A 3LQRA 5H6RA 4MTEA 3K0LA 3FXUA 3HRUA 1SD5A 2IA1A 3IWFA 3HYIA 5E18F 3O6BB 2Y75A 3F21A 3CLOA 2OAZA 4PZJA 2NNNA 3F72A 2QUFA 1DDNA 2HQRA 3TQNA 1EH7A 1QBJA 4HX8A 1S29A 2PLYA 5HLHA 4ESBA 1P4XA 1ZAOA 2IJLA 4HLXA 3KP7A 1EH8A 3QP5A 4M72A 4L9VA 4ENNA 2H6CA 4P96A 4EJVA 3CUOA 1R36A 3KZZA 4LK1F 4N9HA 2NAZA 2BEOA 1IRGA 3I54A 2CQKA 4YFXF 3U2RA 4AIHA 1IN5A 4LB5A 1IN6A 2VOOA 5TJJA 3H3ZA 2CYYA 5CLSA 2H09A 1T98A 4YIIA 2Z99A 3P7NA 3HSRA 5DCMB 3MZHA 1K6OA 3F6OA 4HV5A 5CVJA 2FMLA 4O6JA 5D5WB 5JR3A 1J7KA 1LDKB 2GXBA 4KIBA 1HSJA 3T0YA 1MD0A 4LLNA 4N9IA 4FX0A 1F1ZA 1TW2A 3FX3A 2COMA 4A2UA 2QQBA 3WGGA 3FM3A 2L01A 1F5TA 1O3QA 3HIFA 4IHTA 3FMQA 1ZN2A 2YPRA 3Q5FA 2P7VB 3JSOA 2X0LA 2YX4A 4RB3C 2KIUA 5IT9Z 5BPIA 5HLIA 2GXGA 1L3LA 3LA3A 1REPC 3GFMA 4HDVA 3ABUA 3KZYA 3I5UA 1TLHB 2ZBKA 5H6QA 4XSZF 2IW5A 1XGSA 3TDUC 1FC3A 4MEXF 2FOKA 4OOIA 2EK5A 5ILSA 3N97A 1SAXA 2NYXA 4GCVA 4ENJA 1I1GA 3ECHA 2L3DA 2K4JA 5FFXA 1RIOH 2W57A 2UXNA 4P9FA 2DTRA 4S04A 1OKRA 1QGPA 1LDDA 3RKYA 4OMZA 5CVIA 3TDZC 3JTGA 1ZRDA 4WK8F 1D8JA 5AONA 4NHJA 1G6NA 4U0WA 1Z6RA 1ODDA 4R1HA 1BOAA 1XSXA 5DD4A 4L0ZB 3JSPA 1FPQA 2BE5F 4ZYDA 3DXJF 1FSEA 3CO7C 1LEBA 4RS8A 3ZMSA 3CUQC 4G94A 1MJAA 2Q0OA 1ZLKA 4KN7X 2FBKA 4YIFA 4UUVA 3GX4X 4I7HA 5LEKA 3MCZA 4YFNF 1TQPA 3HOTA 4HV6A 4ENMA 2OQGA 3T8RA 2O61A 3BP8A 5D8LB 2PMUA 2WWYA 2KIMA 3K1PA 5KK1A 2QBYA 5FB2A 3WE3A 1ZREA 2XKOA 3S2WA 4BAYA 4L5JA 3RTRA 3HSEA 1R1UA 1KU2A 2AS5F 2PN6A 2EFNA 1BC8C 4M6XA 4CXFA 2RNJA 3LA2A 1I1SA 2QWWA 4Q4ZF 4EMSA 4E70A 2ZKZA 3V8LA 3IHUA 2CO5A 3SXYA 2FXAA 1T6SA 2XVCA 2R7FA 1BIBA 2H6BA 4GXOA 4PDKA 3MFKA 1XGOA 2F5CA 2PI0A 3QPTA 3KP4A 1IUYA 1WRJA 2E7WA 3GWZA 1TTYA 2FQ3A 2RKHA 3I59B 1Z9CA 1JE8A 4HZFA 2MLGA 2KIFA 1IRFA 3U9GA 1R22A 1JHFA 4LG0A 3DFGA 5A2QZ 1K7AA 4L9JA 4BH9A 5D6EA 2EFWA 3WTYC 1F4KA 3CTAA 3WGIA 2ISYA 1K78A 3SFZA 2P5LC 3CJNA 3E5QA 1S7AA 2VONA 3TO9A 3DKWA 1ZGJA 2ISZA 4KMFA 3I64A 5HS8A 4LGWA 1B59A 5JVTA 4GO1A 2EFPA 4IRHA 3RPUA 2DU9A 1QQIA 2Y0MA 4IRGA 5LBQA 4Q5SF 1R00A 5FFZA 5LHIA 1ZH5A 3SZTA 3F8BA 3J81K 2FNAA 2PJPA 1DPRA 3F8NA 2L4AA 2Z3YA 1G4DA 3HOSA 1J2XA 1Z6TA 1OPCA 3RDIA 1MDMB 4QWQA 2MH9A 2G7UA 3HHGA 5CJ9A 5E8GA 1ONVA 3GZ6A 2XASA 1WKMA 4LMYA 5LHGA 2H27A 3E6BA 1K78B 5D4SA 2V1XA 1LDJA 2XAGA 5DDGA 2VXZA 4I09A 5IT3A 3E97A 2GQQA 2JPBA 4P55A 5FGMA 5E1ZB 4ZZDA 1O3SA 1SMYF 3ML6A 5LLQA 1JHHA 1HXDA 1T0FA 4U0YA 1JXSA 3Q9SA 2M8EA 2O0YA 2NRAC 1ON2A 2J5PA 3K9TA 1S6LA 3FXQA 4DQ2A 4HX4A 3DEUA 1OMIA 4EJUA 3TO7A 2XRNA 2HTSA 1CGPA 4H0EA 1G3TA 5J8FA 2HGCA 2IA0A 1BI3A 3EYYA 2FBIA 1S8NA 3ERED 4U7BA 1KYZA 4WF2A 2FMYA 4IHSA 2M5WA 1ON1A 3BJAA 3DP7A 4AD9A 4L5IA 3WTXC 2HR3A 1VTNC 2X4HA 1W7PB 4UVBA 2ESHA 3N4MA 4RGXA 4MGRA 2K86A 2FA5A 1IN4A 3VFZA 1YW7A 3TKYA 3V7CA 2XUBA 1IXRC 5CVUA 3M7GA 4A5NA 4LK0F 3QP6A 1U5TA 2RN7A 2DO7A 1YFHA 3Q9VA 2R7DA 3ULQB 3QOPA 1CF7B 3EDPA 3RYRA 4Y13A 3J80Z 2K4BA 3E5UA 5ILUA 3FXRA 1UHWA 4BHCA 3HRTA 2G9WA 2ZFWA 4UHTA 2MC3A 1J59A 1ZYRF 3FMRA 3RKWA 4ZYHA 1FBQA 3DV8A 2F5EA 4OIQF 1BJAA 1R58A 3ZMDA 2LSOA 1UCRA 1V4RA 3FWEA 3D0SA 1FP2A 2E7XA 2JSCA 2XV4S 4K2EA 1V3FA 4CHUA 2FSWA 1FX7A 2V79A 1R23A 4I0BA 4EJOA 3KLOA 1MKMA 1PP8F 3IWZA 3RPQA 1DP7P 2VC1A 2MD5A 1KU9A 4OINF 3IL2A 2IRFG 3E6DA 3H3UA 1ZLJA 5JHUA 2PBIA 3EUHA 4CO8A 1O7LA 2EA4A 5AIQA 3EYIA 2Z33A 1TW3A 4QLCU 1FNNA 1YYVA 1P4AA 1BN5A 5CYVA 3T8TA 4LLLA 1UFMA 1SD4A 2BYVE 3R60A 3F3XA 3F23A 1TNSA 2FF4A 2DFIA 4Q47A 3HTSB 2HYFA 1B9NA 1TBXA 5E8IA 3E6MA 1HKSA 3ZMUA 3JAMK 4M73A 4ENKA 3J81Z 1KQ0A 4DNCA 1KQ8A 1LVAA 1P4WA 3TOAA 4UXNA 2VN2A 1LB2A 4M9XA 2M45A 1J9IA 3R6SA 2RDPA 1HSTA 2YR2A 2D2WA 1LJ9A 4KIFA 4AWXB 4FX4A 1PUEE 3BROA 2PG4A 2HOEA 5E17F 3V4GA 1R5GA 1BC7C 2ZXJA 3R61A 1O3RA 1K79A 5DYMA 2D1HA 4KYWA 4KICA 2K27A 3KEOA 1UB9A 5L3FA 4ZYEA 3QPHA 1SFUA 3WTZA 3HSFA 4N0BA 3FHZA 1B1BA 4S05A 4OIOF 3OV8A 4WCGA 3MAJA 1HQCA 1H9GA 2EJRA 4Z2YA 5L3EA 2FNPA 5FLXK 2XROA 4KMUX 2XGXA 4XSXF 4P9UA 3ZMVA 3BJ6A 2BV6A 1YLFA 1PP7U
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2D1V A;  2RV8 A;  1FYM A;  4OMY A;  4UNO A;  2ZO4 A;  1LQ1 A;  4YG2 F;  1R5H A;  3W6K B;  3GF2 A;  1IN8 A;  3ZN0 A;  4U7D A;  2F5F A;  2MBF A;  4KT5 C;  3E5X A;  1XSD A;  3V7S A;  2GZW A;  2EWN A;  2KKO A;  4M9Z A;  4L0Y B;  3P9I A;  4AIJ A;  5DCF A;  1MJ9 A;  2DBB A;  2R3S A;  4WX9 A;  3EET A;  2YU3 A;  4HDU A;  2LDU A;  4EJW A;  2EV6 A;  5HDG A;  5HDN A;  5DUK A;  3CO6 C;  3NQO A;  3SHF A;  2XHK A;  5L3B A;  1XN7 A;  2L54 A;  4MQV A;  5H20 A;  3IRQ A;  5EEH A;  1EV7 A;  3WOD F;  4Q48 A;  3HRM A;  1U6G A;  3E6C C;  1HW1 A;  2WC2 A;  2XKP A;  5CVV A;  3FMS A;  1LNW A;  4HBL A;  2DQR A;  2VE8 A;  3RIR A;  5BMZ A;  1NHA A;  3CDH A;  1YW9 A;  2G7H A;  4A5M A;  2FEZ A;  4I2O A;  1MJB A;  3DF8 A;  5DV5 A;  2BGC A;  1USS A;  4IRI A;  3L9F A;  3BY6 A;  3GFJ A;  1KA8 A;  1GHC A;  2ELH A;  4GYI A;  3HRS A;  2P8T A;  4AIK A;  1XGM A;  1IXC A;  2IPQ X;  4IXA A;  3JW4 A;  3K2Z A;  3SQN A;  4HF1 A;  4OIR F;  2QVO A;  4WXH A;  2A07 F;  1IW7 F;  2Q2E A;  3OOP A;  5LEJ A;  4KA4 A;  4M74 A;  1I6X A;  1OR7 A;  3DQV C;  3RKX A;  5L3C A;  3KCC A;  2JPC A;  1QZY A;  1U3E M;  1QNT A;  1ZHF A;  2YSR A;  2XIG A;  3LWF A;  3WU0 A;  1XCV A;  4O5V A;  1Q1H A;  1STZ A;  1KGS A;  2HDC A;  4G6Q A;  1SD6 A;  4L18 B;  3WTU C;  3IC7 A;  5JI6 A;  2EV5 A;  2ZME A;  1O57 A;  1RUN A;  3I0T A;  4MQ9 F;  2XAJ A;  1Z91 A;  2A3S A;  3GZ5 A;  2JTV A;  5LRR A;  1XB4 A;  1GXP A;  2QM3 A;  3KE2 A;  2DPU A;  2QBY B;  1B9M A;  4AVP A;  3K1N A;  2MA3 A;  3WTS C;  4D0P A;  1XMA A;  4A6D A;  2E1N A;  2CG4 A;  3PQJ A;  3GXO A;  3ZPL A;  3WTW C;  4G7Z F;  3V8K A;  3MZY A;  3BJO A;  3GYH X;  4BHB A;  4G6D A;  1P92 A;  4XRF A;  1WSU A;  3BDD A;  1XGN A;  4BYY A;  1ZGA A;  2KJB A;  4RAZ A;  3B02 A;  4ASN A;  4HYE A;  2LNB A;  4IVN A;  4Y15 A;  5HDK A;  5HS9 A;  3VOD A;  2W24 A;  1SFX A;  1XDS A;  1BM9 A;  4A12 A;  1Y0U A;  3D5L A;  5BPD A;  1R1V A;  3B73 A;  4RB1 A;  2ZNZ A;  4Y17 A;  4ZH4 F;  3VOE A;  2J5O A;  1C0W A;  4LG0 B;  5BOX A;  3F6V A;  4A0Y A;  3BWG A;  2CFX A;  2E1C A;  3ZP5 A;  4NB5 A;  4LB6 B;  1WI9 A;  1FSH A;  1LEA A;  5K1Y A;  5D6F A;  3JTH A;  3ZMT A;  3GO5 A;  1D5V A;  1TNT A;  1YIO A;  1O3T A;  5ICG A;  2Y48 A;  2HYG D;  4KNY A;  2K7L A;  2HS5 A;  2VOP A;  1XDU A;  4B8X A;  3QAH A;  4CDG A;  4I0A A;  2ZCW A;  2PQ8 A;  4KDP A;  1P2F A;  4HQE A;  1FBU A;  3I53 A;  1YG2 A;  4RAY A;  5ICE A;  5DEQ A;  3E3V A;  4HF2 A;  4JBA A;  3HTU A;  2FBH A;  1RI7 A;  4ON0 A;  3QU6 A;  1E2X A;  2AXL A;  2VBX A;  1JGS A;  1J5Y A;  4B09 A;  2CW0 F;  1ULY A;  4U88 A;  4WWC A;  3J7A O;  2CWE A;  5E20 A;  2QEN A;  3DPL C;  4IJA A;  1Z05 A;  5LGU A;  2EA2 A;  1R7J A;  2O03 A;  3KEQ A;  2GIV A;  4EM1 A;  5ICF A;  3REO A;  2MLK A;  1RUO A;  1KQ9 A;  5F6F A;  3I71 A;  1W7P D;  3GVA A;  1FY7 A;  2A69 F;  5F1R A;  2OZ6 A;  2W84 A;  1I27 A;  1HBX G;  4EM2 A;  1O7F A;  3LST A;  3KP5 A;  1HKT A;  1ZAR A;  4TV7 A;  5K5O A;  4M71 A;  3GW2 A;  1S7O A;  4U0V A;  4G8X A;  5D5V B;  1BBY A;  3ECO A;  2NNY A;  1IZ1 A;  2A6H F;  4LD5 A;  2UXX A;  3RJP A;  4HAM A;  3TOB A;  4EVI A;  1FWZ A;  2GA1 A;  2LKP A;  1YS6 A;  2PEX A;  1A04 A;  4ESJ A;  4EM0 B;  5DCM A;  5D4R A;  2C6Y A;  3V7R A;  2P5K A;  5HS7 A;  3LAP A;  3O2P E;  1DPU A;  1XCB A;  3F22 A;  2OZU A;  3IKV A;  3MQ0 A;  6PAX A;  1KYW A;  1T38 A;  1HW5 A;  3TGN A;  1FBS A;  3KET A;  1XD7 A;  4G7O F;  4ESF A;  5DUI A;  4JK1 X;  4ETS A;  1WWX A;  2UZK A;  2F2E A;  1U5T B;  1Z7U A;  4CZZ A;  4I01 A;  2PMH A;  2VT3 A;  2O3F A;  1GXQ A;  2GA2 A;  4HQM A;  3L2C A;  1HKQ A;  4CIC A;  2DW4 A;  2ETH A;  5A2Q K;  3ZQ7 A;  5D5X B;  2QZ8 A;  3IKT A;  3I4P A;  2P6S A;  2V1U A;  3BPX A;  2K02 A;  4L9T A;  2W85 A;  4M9S A;  3KFW X;  1SMT A;  2Q8K A;  2KJC A;  2MH2 A;  2M87 A;  3WTT C;  1FOK A;  1RZ4 A;  5D5U B;  5BQT A;  1FLI A;  2W25 A;  4RGS A;  5E1X A;  1BI2 A;  1GVJ A;  3RI4 A;  2EV0 A;  2RC4 A;  3MWM A;  2ACJ A;  4EV0 A;  1ZG1 A;  4M6Y A;  2XAH A;  3C3W A;  3F8F A;  1YTY A;  2STT A;  4HF0 A;  2RGV A;  3NEU A;  2WV0 A;  1W5T A;  3IRR A;  3MEX A;  1X3U A;  3L7W A;  1FYK A;  3KP2 A;  3M8E A;  1H9T A;  4CGZ A;  3DPT A;  3KP6 A;  2VBZ A;  1MZB A;  3FM5 A;  2DPD A;  4HW0 A;  3L09 A;  5BS6 A;  5FD5 A;  4UV9 A;  4CYD A;  1UHM A;  2HEO A;  3HUG A;  2P4W A;  1T2K A;  1G3S A;  4IPA A;  4XBF A;  1B6A A;  1XSV A;  1S3J A;  4EQQ A;  1BI0 A;  2KRF A;  2V6C A;  2ZNY A;  2O6G E;  3R4K A;  3BPV A;  3RYP A;  1ZG5 A;  4A0Z A;  5LGN A;  3K1M A;  2OQR A;  2O8X A;  3QU3 A;  5FO5 A;  1Z1D A;  4OU0 A;  2OA4 A;  2FRH A;  2F5D A;  2DAO A;  3M8F A;  4EJT A;  4RB0 A;  2TDX A;  1HW2 A;  2L02 A;  2QLZ A;  3VB2 A;  4HOB A;  2V9V A;  1G3Y A;  3SZP A;  4EGY A;  3WE2 A;  2D45 A;  2M30 A;  4MNU A;  4BNC A;  3ZN1 A;  4UVA A;  3I59 A;  3G73 A;  1OYY A;  5E1W A;  4FHT A;  3O3K A;  5LHH A;  5ILV A;  3KP3 A;  2P6T A;  2IVM A;  1IAW A;  1MGT A;  2WTE A;  1E17 A;  1W4M A;  2JZY A;  3LQQ A;  2HWV A;  3PFI A;  3KLN A;  1QO0 D;  1G3W A;  2OD5 A;  4HLY A;  3W6J B;  1AWC A;  4L9N A;  1AOY A;  1W5S A;  1BIA A;  2P7C B;  2YX7 A;  3WTV C;  4RGU A;  5ICC A;  3GFI A;  4KFC A;  4NQW A;  4R8H A;  2VOD A;  5AIP A;  2IT0 A;  3M9A A;  4UV8 A;  4IF4 A;  1U8R A;  4BQA A;  2DT5 A;  1IXS B;  3J80 K;  1DUX C;  3ROU A;  3C1D A;  4BXU A;  1EH6 A;  2DQL A;  1PDN C;  4G7H F;  3T5X A;  1QPM A;  3WU1 B;  1OYI A;  1TQI A;  1RNL A;  3BZ6 A;  3P9C A;  2STW A;  3GLX A;  2H94 A;  2XAQ A;  1IF1 A;  5ERI A;  3CUQ A;  1MDM A;  2VE9 A;  4HX7 A;  2DI3 A;  2ZJ2 A;  1YS7 A;  2HKO A;  2UWM A;  3LFK A;  2V1D A;  4O3M A;  2JRT A;  1UST A;  3PQK A;  1FZP B;  5FD6 A;  3JAM Z;  1SD7 A;  2EFO A;  4HA8 A;  3F8M A;  2VT2 A;  3V8J A;  5ED4 A;  4KUM A;  2B0L A;  2GWR A;  2M1B A;  1F9N A;  3T1B A;  5F64 A;  2IA2 A;  4KIG A;  2GAU A;  4KN4 X;  3COA C;  1D8K A;  4ZYG A;  4GYG A;  3VEP A;  4I98 B;  3GEZ A;  2RVC A;  3LA7 A;  4EGZ A;  1U78 A;  3GUD A;  5HOO A;  5EEG A;  3G3Z A;  3FF5 A;  2Z9O A;  1OYW A;  5KVR A;  2RQP A;  1XMK A;  5D8K B;  3NRV A;  1D3Y A;  1WQ2 A;  1P6R A;  2LF8 A;  2A5Y B;  4RGR A;  3L00 A;  3WG9 A;  5K5Q A;  2HFH A;  3U1D A;  3CUQ B;  2ZME B;  5HLG A;  2LF7 A;  4MHG A;  2XAF A;  5L3G A;  4ZZL A;  1B4A A;  2OU2 A;  4PCQ A;  3ISP A;  4G9Y A;  5J8C A;  2EB7 A;  2QYO A;  3TO6 A;  2OBP A;  2FE3 A;  2QQ9 A;  5FLX Z;  3ELK A;  4GGG A;  3WGH A;  4LLG F;  5L3D A;  2IP2 A;  1W7P A;  4PGG A;  1TQM A;  1L0O C;  1FT9 A;  2DK5 A;  2A61 A;  2L4M A;  3R0A A;  2VBY A;  2QQA A;  1ZRF A;  2HQN A;  2ESN A;  1U5T C;  2VBW A;  4P5O A;  1I5Z A;  5IT9 K;  2FU4 A;  1J0R A;  5J6X A;  3LAJ A;  4YFK F;  2VC0 A;  5K5R A;  3EQL F;  4MTD A;  1YO5 C;  2A6E F;  4RB2 C;  2EFQ A;  4FT8 A;  3ABT A;  3K69 A;  3I58 A;  4UVC A;  4BHP A;  1CF7 A;  3C7J A;  3H92 A;  1T39 A;  1FYL A;  3HHH A;  4MEY F;  1ZRC A;  2DLL A;  4XLP F;  2P5V A;  3GFL A;  1IN7 A;  1QZZ A;  2BBY A;  5JFR A;  4LFU A;  4A6E A;  4WXD A;  4PGH A;  5HVQ C;  1YQA A;  4R79 A;  1H0M A;  2HZT A;  5TRD A;  1KU7 A;  1SFE A;  4OIP F;  1FP1 D;  2HTJ A;  3C18 A;  3P9K A;  3QRF F;  3M1E A;  4JQF A;  2NS0 A;  3R0J A;  1KU3 A;  4WXC A;  4A0X A;  4F7Z A;  2HKX A;  2CGP A;  4XLN F;  1U2W A;  3AAF A;  2Z5U A;  1J75 A;  5LRS A;  3FZV A;  3BOQ A;  2CSO A;  1R1T A;  1BI1 A;  5LGT A;  1YW8 A;  4LJZ F;  5CVR A;  2A68 F;  3F8C A;  2DK8 A;  3ZMZ A;  2PFB A;  1ZG3 A;  5DD8 A;  2ADU A;  4I02 A;  2JT1 A;  3LQR A;  5H6R A;  4MTE A;  3K0L A;  3FXU A;  3HRU A;  1SD5 A;  2IA1 A;  3IWF A;  3HYI A;  5E18 F;  3O6B B;  2Y75 A;  3F21 A;  3CLO A;  2OAZ A;  4PZJ A;  2NNN A;  3F72 A;  2QUF A;  1DDN A;  2HQR A;  3TQN A;  1EH7 A;  1QBJ A;  4HX8 A;  1S29 A;  2PLY A;  5HLH A;  4ESB A;  1P4X A;  1ZAO A;  2IJL A;  4HLX A;  3KP7 A;  1EH8 A;  3QP5 A;  4M72 A;  4L9V A;  4ENN A;  2H6C A;  4P96 A;  4EJV A;  3CUO A;  1R36 A;  3KZZ A;  4LK1 F;  4N9H A;  2NAZ A;  2BEO A;  1IRG A;  3I54 A;  2CQK A;  4YFX F;  3U2R A;  4AIH A;  1IN5 A;  4LB5 A;  1IN6 A;  2VOO A;  5TJJ A;  3H3Z A;  2CYY A;  5CLS A;  2H09 A;  1T98 A;  4YII A;  2Z99 A;  3P7N A;  3HSR A;  5DCM B;  3MZH A;  1K6O A;  3F6O A;  4HV5 A;  5CVJ A;  2FML A;  4O6J A;  5D5W B;  5JR3 A;  1J7K A;  1LDK B;  2GXB A;  4KIB A;  1HSJ A;  3T0Y A;  1MD0 A;  4LLN A;  4N9I A;  4FX0 A;  1F1Z A;  1TW2 A;  3FX3 A;  2COM A;  4A2U A;  2QQB A;  3WGG A;  3FM3 A;  2L01 A;  1F5T A;  1O3Q A;  3HIF A;  4IHT A;  3FMQ A;  1ZN2 A;  2YPR A;  3Q5F A;  2P7V B;  3JSO A;  2X0L A;  2YX4 A;  4RB3 C;  2KIU A;  5IT9 Z;  5BPI A;  5HLI A;  2GXG A;  1L3L A;  3LA3 A;  1REP C;  3GFM A;  4HDV A;  3ABU A;  3KZY A;  3I5U A;  1TLH B;  2ZBK A;  5H6Q A;  4XSZ F;  2IW5 A;  1XGS A;  3TDU C;  1FC3 A;  4MEX F;  2FOK A;  4OOI A;  2EK5 A;  5ILS A;  3N97 A;  1SAX A;  2NYX A;  4GCV A;  4ENJ A;  1I1G A;  3ECH A;  2L3D A;  2K4J A;  5FFX A;  1RIO H;  2W57 A;  2UXN A;  4P9F A;  2DTR A;  4S04 A;  1OKR A;  1QGP A;  1LDD A;  3RKY A;  4OMZ A;  5CVI A;  3TDZ C;  3JTG A;  1ZRD A;  4WK8 F;  1D8J A;  5AON A;  4NHJ A;  1G6N A;  4U0W A;  1Z6R A;  1ODD A;  4R1H A;  1BOA A;  1XSX A;  5DD4 A;  4L0Z B;  3JSP A;  1FPQ A;  2BE5 F;  4ZYD A;  3DXJ F;  1FSE A;  3CO7 C;  1LEB A;  4RS8 A;  3ZMS A;  3CUQ C;  4G94 A;  1MJA A;  2Q0O A;  1ZLK A;  4KN7 X;  2FBK A;  4YIF A;  4UUV A;  3GX4 X;  4I7H A;  5LEK A;  3MCZ A;  4YFN F;  1TQP A;  3HOT A;  4HV6 A;  4ENM A;  2OQG A;  3T8R A;  2O61 A;  3BP8 A;  5D8L B;  2PMU A;  2WWY A;  2KIM A;  3K1P A;  5KK1 A;  2QBY A;  5FB2 A;  3WE3 A;  1ZRE A;  2XKO A;  3S2W A;  4BAY A;  4L5J A;  3RTR A;  3HSE A;  1R1U A;  1KU2 A;  2AS5 F;  2PN6 A;  2EFN A;  1BC8 C;  4M6X A;  4CXF A;  2RNJ A;  3LA2 A;  1I1S A;  2QWW A;  4Q4Z F;  4EMS A;  4E70 A;  2ZKZ A;  3V8L A;  3IHU A;  2CO5 A;  3SXY A;  2FXA A;  1T6S A;  2XVC A;  2R7F A;  1BIB A;  2H6B A;  4GXO A;  4PDK A;  3MFK A;  1XGO A;  2F5C A;  2PI0 A;  3QPT A;  3KP4 A;  1IUY A;  1WRJ A;  2E7W A;  3GWZ A;  1TTY A;  2FQ3 A;  2RKH A;  3I59 B;  1Z9C A;  1JE8 A;  4HZF A;  2MLG A;  2KIF A;  1IRF A;  3U9G A;  1R22 A;  1JHF A;  4LG0 A;  3DFG A;  5A2Q Z;  1K7A A;  4L9J A;  4BH9 A;  5D6E A;  2EFW A;  3WTY C;  1F4K A;  3CTA A;  3WGI A;  2ISY A;  1K78 A;  3SFZ A;  2P5L C;  3CJN A;  3E5Q A;  1S7A A;  2VON A;  3TO9 A;  3DKW A;  1ZGJ A;  2ISZ A;  4KMF A;  3I64 A;  5HS8 A;  4LGW A;  1B59 A;  5JVT A;  4GO1 A;  2EFP A;  4IRH A;  3RPU A;  2DU9 A;  1QQI A;  2Y0M A;  4IRG A;  5LBQ A;  4Q5S F;  1R00 A;  5FFZ A;  5LHI A;  1ZH5 A;  3SZT A;  3F8B A;  3J81 K;  2FNA A;  2PJP A;  1DPR A;  3F8N A;  2L4A A;  2Z3Y A;  1G4D A;  3HOS A;  1J2X A;  1Z6T A;  1OPC A;  3RDI A;  1MDM B;  4QWQ A;  2MH9 A;  2G7U A;  3HHG A;  5CJ9 A;  5E8G A;  1ONV A;  3GZ6 A;  2XAS A;  1WKM A;  4LMY A;  5LHG A;  2H27 A;  3E6B A;  1K78 B;  5D4S A;  2V1X A;  1LDJ A;  2XAG A;  5DDG A;  2VXZ A;  4I09 A;  5IT3 A;  3E97 A;  2GQQ A;  2JPB A;  4P55 A;  5FGM A;  5E1Z B;  4ZZD A;  1O3S A;  1SMY F;  3ML6 A;  5LLQ A;  1JHH A;  1HXD A;  1T0F A;  4U0Y A;  1JXS A;  3Q9S A;  2M8E A;  2O0Y A;  2NRA C;  1ON2 A;  2J5P A;  3K9T A;  1S6L A;  3FXQ A;  4DQ2 A;  4HX4 A;  3DEU A;  1OMI A;  4EJU A;  3TO7 A;  2XRN A;  2HTS A;  1CGP A;  4H0E A;  1G3T A;  5J8F A;  2HGC A;  2IA0 A;  1BI3 A;  3EYY A;  2FBI A;  1S8N A;  3ERE D;  4U7B A;  1KYZ A;  4WF2 A;  2FMY A;  4IHS A;  2M5W A;  1ON1 A;  3BJA A;  3DP7 A;  4AD9 A;  4L5I A;  3WTX C;  2HR3 A;  1VTN C;  2X4H A;  1W7P B;  4UVB A;  2ESH A;  3N4M A;  4RGX A;  4MGR A;  2K86 A;  2FA5 A;  1IN4 A;  3VFZ A;  1YW7 A;  3TKY A;  3V7C A;  2XUB A;  1IXR C;  5CVU A;  3M7G A;  4A5N A;  4LK0 F;  3QP6 A;  1U5T A;  2RN7 A;  2DO7 A;  1YFH A;  3Q9V A;  2R7D A;  3ULQ B;  3QOP A;  1CF7 B;  3EDP A;  3RYR A;  4Y13 A;  3J80 Z;  2K4B A;  3E5U A;  5ILU A;  3FXR A;  1UHW A;  4BHC A;  3HRT A;  2G9W A;  2ZFW A;  4UHT A;  2MC3 A;  1J59 A;  1ZYR F;  3FMR A;  3RKW A;  4ZYH A;  1FBQ A;  3DV8 A;  2F5E A;  4OIQ F;  1BJA A;  1R58 A;  3ZMD A;  2LSO A;  1UCR A;  1V4R A;  3FWE A;  3D0S A;  1FP2 A;  2E7X A;  2JSC A;  2XV4 S;  4K2E A;  1V3F A;  4CHU A;  2FSW A;  1FX7 A;  2V79 A;  1R23 A;  4I0B A;  4EJO A;  3KLO A;  1MKM A;  1PP8 F;  3IWZ A;  3RPQ A;  1DP7 P;  2VC1 A;  2MD5 A;  1KU9 A;  4OIN F;  3IL2 A;  2IRF G;  3E6D A;  3H3U A;  1ZLJ A;  5JHU A;  2PBI A;  3EUH A;  4CO8 A;  1O7L A;  2EA4 A;  5AIQ A;  3EYI A;  2Z33 A;  1TW3 A;  4QLC U;  1FNN A;  1YYV A;  1P4A A;  1BN5 A;  5CYV A;  3T8T A;  4LLL A;  1UFM A;  1SD4 A;  2BYV E;  3R60 A;  3F3X A;  3F23 A;  1TNS A;  2FF4 A;  2DFI A;  4Q47 A;  3HTS B;  2HYF A;  1B9N A;  1TBX A;  5E8I A;  3E6M A;  1HKS A;  3ZMU A;  3JAM K;  4M73 A;  4ENK A;  3J81 Z;  1KQ0 A;  4DNC A;  1KQ8 A;  1LVA A;  1P4W A;  3TOA A;  4UXN A;  2VN2 A;  1LB2 A;  4M9X A;  2M45 A;  1J9I A;  3R6S A;  2RDP A;  1HST A;  2YR2 A;  2D2W A;  1LJ9 A;  4KIF A;  4AWX B;  4FX4 A;  1PUE E;  3BRO A;  2PG4 A;  2HOE A;  5E17 F;  3V4G A;  1R5G A;  1BC7 C;  2ZXJ A;  3R61 A;  1O3R A;  1K79 A;  5DYM A;  2D1H A;  4KYW A;  4KIC A;  2K27 A;  3KEO A;  1UB9 A;  5L3F A;  4ZYE A;  3QPH A;  1SFU A;  3WTZ A;  3HSF A;  4N0B A;  3FHZ A;  1B1B A;  4S05 A;  4OIO F;  3OV8 A;  4WCG A;  3MAJ A;  1HQC A;  1H9G A;  2EJR A;  4Z2Y A;  5L3E A;  2FNP A;  5FLX K;  2XRO A;  4KMU X;  2XGX A;  4XSX F;  4P9U A;  3ZMV A;  3BJ6 A;  2BV6 A;  1YLF A;  1PP7 U; 
#chains in the Genus database with same CATH topology
 2D1V A;  2RV8 A;  1FYM A;  4OMY A;  4ZYA A;  4UNO A;  2ZO4 A;  4A3E J;  4YG2 F;  1LQ1 A;  1R5H A;  3W6K B;  3GF2 A;  1IN8 A;  3ZN0 A;  1HCR A;  3K70 C;  3PIP F;  2BHZ A;  4U7D A;  2F5F A;  2E5Z A;  4IHW A;  2MBF A;  4KT5 C;  2OF7 A;  3E5X A;  1TWC J;  2OTJ I;  1LVK A;  1XSD A;  2NOG A;  2CW8 A;  3V7S A;  3NAR A;  4IOC F;  1IG7 A;  3DCF A;  2GZW A;  2EWN A;  2KKO A;  4M9Z A;  4L0Y B;  3P9I A;  4AIJ A;  1YIJ I;  2WAD A;  3QPS A;  5DCF A;  3DBR B;  2LFB A;  1MJ9 A;  2DBB A;  2R3S A;  1H88 C;  3C2H A;  2IGN A;  4WX9 A;  3EET A;  4PJL A;  2YU3 A;  4F52 A;  3HXL A;  4B48 A;  2R7V A;  4HDU A;  2LDU A;  4EJW A;  2QQ8 A;  3OIQ A;  2EV6 A;  1MBJ A;  3BTI A;  5HDG A;  1IO2 A;  5DUK A;  5HDN A;  3CO6 C;  3LSP A;  2NVQ J;  2X6O A;  5GAE J;  2JA2 A;  3PL8 A;  4QPO A;  3NQO A;  3SHF A;  2EIL H;  4E4H A;  3ABL H;  2XHK A;  2CUF A;  3FKI J;  1Z7L A;  5EJC A;  5L3B A;  1XN7 A;  1P9Q C;  3JCU C;  2L54 A;  4MQV A;  1BJZ A;  5H20 A;  1RR7 A;  5EEH A;  3IRQ A;  1EV7 A;  5JLX A;  4ABZ A;  3WOD F;  4Q48 A;  3HRM A;  1OCC H;  1U6G A;  3E6C C;  1HW1 A;  2WC2 A;  2BVM A;  2M0C A;  2XKP A;  1IV6 A;  2DA5 A;  5CVV A;  1YHQ I;  3FMS A;  4B43 A;  1VQM I;  1LNW A;  3OMY A;  3BR6 A;  1LPQ A;  4HBL A;  1LUJ B;  1VQ5 I;  4AVZ A;  5F0H A;  3PNV A;  3K4M A;  2DQR A;  1ETW A;  2VE8 A;  1AHD P;  3RIR A;  5BMZ A;  1NHA A;  3CDH A;  1YW9 A;  2G7H A;  4A5M A;  2FEZ A;  1T8I A;  2LLK A;  4I2O A;  1MJB A;  1JUM A;  4C2M J;  3JRE A;  3DF8 A;  5DV5 A;  2BGC A;  1USS A;  4W1U A;  4GFB A;  4IRI A;  3L9F A;  2HOS A;  1LFB A;  1I3Q J;  3BY6 A;  1KA8 A;  3GFJ A;  2X9D A;  1GHC A;  2KFD A;  1UHS A;  2MYS A;  3FBI B;  2ELH A;  2F5V A;  3ZRG A;  4BBS J;  4GYI A;  3HRS A;  4A3I J;  4BXX J;  2P8T A;  4AIK A;  1XGM A;  1IXC A;  2IPQ X;  3FXJ A;  4IXA A;  2LKX A;  3JW4 A;  3K2Z A;  3SQN A;  4HF1 A;  1MMG A;  2BW3 B;  4OIR F;  1ZGW A;  4RAG A;  2QVO A;  3CJT B;  4WXH A;  2A07 F;  3RCO A;  2F4M B;  1IW7 F;  4HNT A;  2Q2E A;  3S2H J;  4LOC A;  4CCL A;  3MVP A;  2OC6 A;  3ONQ A;  3OOP A;  5LEJ A;  4KA4 A;  3JRI A;  4XKV A;  2E1O A;  4M74 A;  3HKZ N;  1I6X A;  1OR7 A;  3DQV C;  3RKX A;  1CQT A;  5L3C A;  3KCC A;  2JPC A;  1QZY A;  3M3Y J;  1R6R A;  1U3E M;  5IP9 J;  3TMO A;  1QNT A;  1ZHF A;  2GM4 A;  2JUC A;  2YSR A;  1S9H A;  2XIG A;  1W36 C;  3AG4 H;  3LWF A;  2XPV A;  2WY8 Q;  3WU0 A;  3RZD J;  1XCV A;  2XSJ C;  4O5V A;  2XB5 A;  3NWS A;  1Q1H A;  3ABM H;  2YU9 J;  1Z67 A;  1STZ A;  1KGS A;  2HDC A;  4G6Q A;  1SD6 A;  4L18 B;  3WTU C;  3IC7 A;  3MMY B;  2EV5 A;  5JI6 A;  2KLO A;  2ZME A;  3CJQ B;  3JRC A;  2YS9 A;  1O57 A;  1RUN A;  3I0T A;  4MQ9 F;  2XAJ A;  2OCE A;  3G1M A;  3M07 A;  2RNG A;  3A0B C;  5EDN A;  1Z91 A;  2A3S A;  3GZ5 A;  2JTV A;  2R5Z A;  3I56 I;  5LRR A;  1XB4 A;  3SEZ A;  1N77 A;  1X4P A;  4V2F A;  1GXP A;  2QM3 A;  3KE2 A;  4P1W A;  2DPU A;  2QBY B;  1B9M A;  4AVP A;  2FQ4 A;  3K1N A;  1S5L C;  2MA3 A;  1B8I A;  1P7I A;  5EGO B;  3WTS C;  4D0P A;  2CFO A;  1XMA A;  1Y1V J;  2E1N A;  4A6D A;  2VPL A;  4XL9 A;  2CG4 A;  3PQJ A;  4C3I J;  3GXO A;  3ZPL A;  4IHV A;  5B1A H;  3BG5 A;  3WTW C;  4G7Z F;  1O4X A;  3GTP J;  3K70 D;  3V8K A;  3MZY A;  2VKD A;  3OYK A;  2WV1 A;  1T0F C;  3BJO A;  3GYH X;  4BHB A;  1YRN B;  4G6D A;  4IEJ A;  2EZK A;  3V42 A;  2LK2 A;  1P92 A;  4XRF A;  3CCS I;  2KIS A;  1YIT I;  1WSU A;  3BDD A;  1XGN A;  4BYY A;  1ZGA A;  2CMP A;  2ICW G;  2KJB A;  3VYU B;  4RAZ A;  3B02 A;  3OR1 C;  4ASN A;  4ZC3 A;  2W48 A;  4HYE A;  2LNB A;  4IVN A;  4Y15 A;  5HDK A;  2HZD A;  3EUA A;  5K7Z A;  5HS9 A;  1FTZ A;  2X48 A;  3VOD A;  2W24 A;  5GPA A;  4DZJ A;  1H8A C;  1SFX A;  1XDS A;  1BM9 A;  4A12 A;  1Y0U A;  1FOY A;  2HNH A;  3D5L A;  5BPD A;  1WHU A;  2KHM A;  3M1C A;  1MIJ A;  1HC8 A;  1R1V A;  4M3E A;  3B73 A;  4RB1 A;  3F9K A;  1XMX A;  2ZNZ A;  4Y17 A;  4ZH4 F;  3VOE A;  3CCE I;  3OY9 A;  2J5O A;  1C0W A;  4LG0 B;  4M6V A;  3X2Q H;  5BOX A;  2PMZ N;  3F6V A;  2F48 A;  2R7O A;  1XPX A;  4A0Y A;  2LRE A;  3BWG A;  1T95 A;  2CFX A;  2E1C A;  1FJL A;  1V5G A;  3FXL A;  3ZP5 A;  4NC8 A;  4CCM A;  4NB5 A;  4RMN A;  1MNM C;  2H8R A;  4LB6 B;  3MKL A;  1WI9 A;  1FSH A;  2R5Z B;  1WPK A;  1LEA A;  1ZK8 A;  4E7H A;  3H35 A;  5EZH A;  5K1Y A;  1JTY A;  5D6F A;  1HDD C;  3VWB A;  4BQQ A;  3JTH A;  4IQJ A;  3ZMT A;  3GO5 A;  1D5V A;  2VKE A;  1TNT A;  3RZO J;  2DDA A;  2DXI A;  1D0Y A;  1YIO A;  1O3T A;  5ICG A;  1IV8 A;  3SDB A;  3QOD A;  3OYM A;  1BW6 A;  2Y48 A;  2HYG D;  4KNY A;  1QZE A;  5FRM A;  1OCP A;  2K7L A;  2HS5 A;  2VOP A;  1XDU A;  1GT0 C;  1X2M A;  4B8X A;  2WB1 N;  3DWL E;  3QAH A;  4CDG A;  4BDZ A;  4I0A A;  3PUB A;  2ZCW A;  1UG2 A;  2PQ8 A;  4EAT A;  5IP7 J;  4J00 A;  4KDP A;  5J47 A;  3H9G A;  3KEY A;  1P2F A;  4HQE A;  5DS9 A;  1FBU A;  2BXZ A;  3I53 A;  2R0Q C;  4A3J J;  1YG2 A;  4RAY A;  5ICE A;  3HPH A;  5DEQ A;  3FHN A;  4FQG A;  2QSF X;  3E3V A;  4HF2 A;  2M3A A;  4JBA A;  4NUB A;  2L7K A;  3HTU A;  2FBH A;  1MW7 A;  1RI7 A;  4ON0 A;  3HKZ A;  3QU6 A;  1VQN I;  1E2X A;  3H0G J;  2AXL A;  2VBX A;  4EEF G;  4A3L J;  1DGW Y;  1JGS A;  3G1O A;  4E7K A;  1J5Y A;  4B09 A;  2CW0 F;  1ULY A;  4U88 A;  4WWC A;  1W36 D;  3H5N A;  4U87 A;  1VQ7 I;  1VQ6 I;  1PJR A;  3F0C A;  3J7A O;  4XRS A;  2CWE A;  2DTZ A;  2QEN A;  5E20 A;  3HDD A;  3W6V A;  1E3H A;  3DPL C;  4IJA A;  1WFX A;  4IHY A;  1Z05 A;  4QIW N;  2I8D A;  3A01 A;  5LGU A;  2EA2 A;  3ERM A;  5IP6 A;  4G6T B;  2O5R A;  2W00 A;  2LKS A;  2DA6 A;  1JJ6 C;  1R7J A;  2O03 A;  3KEQ A;  1OCZ H;  2GIV A;  3BTJ A;  4EM1 A;  5ICF A;  1XS9 A;  3REO A;  2MLK A;  2B63 J;  3BQY A;  1RUO A;  1KQ9 A;  2LRD A;  1K4T A;  5F6F A;  3I71 A;  1W7P D;  3GVA A;  2OTL I;  1FY7 A;  2A69 F;  3FXK A;  4B44 A;  5F1R A;  2OZ6 A;  1R49 A;  2W84 A;  1UZC A;  1I27 A;  3AKZ A;  1HBX G;  1JKR C;  4EM2 A;  4A3F J;  1O7F A;  2CUE A;  2EZH A;  3LST A;  3KP5 A;  3DU5 A;  1HKT A;  3K6G A;  2OJE D;  2K5C A;  1ZAR A;  3I4N J;  4TV7 A;  3DKX A;  3C2G A;  5K5O A;  4M3F A;  1WJ5 A;  2JK3 A;  2L9R A;  4HST A;  3OSG A;  4JYK A;  2VUM J;  4M71 A;  3GW2 A;  2G0E A;  1S7O A;  4RLF A;  1RPW A;  4U0V A;  4G8X A;  5D5V B;  5KNL A;  1BBY A;  3ECO A;  2VPR A;  5FRO A;  3ZQF A;  5DM7 F;  2NNY A;  2IS1 A;  5JLW A;  1OIS A;  1IZ1 A;  2A6H F;  4LD5 A;  3TBI A;  5K7F A;  1RKT A;  2UXX A;  1MSF C;  2E34 A;  2L2O A;  4XKW A;  3LSI A;  3A2K A;  2H8W A;  3WU2 C;  3RJP A;  2LTP A;  3E1S A;  4HAM A;  3TOB A;  1B72 A;  4EVI A;  2L0K A;  1ETQ A;  1FWZ A;  2Y69 H;  4FE7 A;  2GA1 A;  3OIO A;  2MFZ A;  4A3M J;  1G2H A;  2LKP A;  3NAU A;  1OLT A;  2QGU A;  1YS6 A;  1SAN A;  3ZXS A;  1ZEL A;  2PEX A;  1ETO A;  1A36 A;  1A04 A;  4ESJ A;  4EM0 B;  5DCM A;  1JGG A;  5D4R A;  1WZ2 A;  2C6Y A;  4A3G J;  3ZQH A;  3W2A A;  3V7R A;  2JN6 A;  2P5K A;  5HS7 A;  4YEL A;  2JA5 J;  4D5C A;  3LAP A;  3K4L A;  2WAE A;  2ZSH B;  3RQ4 A;  2ME0 A;  3O2P E;  1DPU A;  1XCB A;  3F22 A;  2OZU A;  3IKV A;  1SFO J;  3MQ0 A;  6PAX A;  1KYW A;  2PMZ A;  3OYL A;  1T38 A;  1HW5 A;  2LMD A;  3TGN A;  5IPA A;  1FBS A;  3KET A;  1DGR M;  1XD7 A;  3MKW B;  4G7O F;  3S1R J;  4ESF A;  3QWL A;  1OQY A;  4GRI A;  5DUI A;  4JK1 X;  4G12 A;  4ETS A;  3ZGK A;  3HL2 A;  1WWX A;  3TL4 X;  2UZK A;  2F2E A;  5C4X J;  1U5T B;  1VQK I;  2E2J J;  1Z7U A;  4CZZ A;  4I01 A;  2PMH A;  2VT3 A;  3S3M A;  2O3F A;  4S0H B;  2CJJ A;  3CJR B;  4IKF A;  1GXQ A;  2GA2 A;  2KZV A;  4MLO A;  4HQM A;  3L2C A;  1HKQ A;  2VL8 A;  3Q0V A;  4II2 A;  4Y33 A;  2XGE A;  4CIC A;  2DW4 A;  3W2V A;  2ETH A;  4NC7 A;  5A2Q K;  3ZQ7 A;  5D5X B;  2M34 A;  1WH5 A;  2VQG A;  2XSD C;  2QZ8 A;  3IKT A;  1NTC A;  4LIT A;  2HQ5 A;  3I4P A;  2P6S A;  2V1U A;  2LC2 A;  3BR3 A;  4DZP A;  1M1E B;  3BPX A;  3OL4 A;  5GPC A;  2K02 A;  3MN2 A;  3OYJ A;  4L9T A;  2W85 A;  1R9T J;  4M9S A;  3KX2 A;  3KFW X;  2ZFU A;  1SMT A;  5CQE A;  1Y56 A;  2Q8K A;  3L2V A;  2KJC A;  2MH2 A;  4DYR A;  2M87 A;  3WTT C;  4LIU A;  1FOK A;  2DMT A;  5F27 A;  3IH3 A;  1RZ4 A;  5D5U B;  3OYF A;  1MMA A;  5BQT A;  4DYC A;  1SEU A;  4M3B A;  1MBG A;  1FLI A;  2W25 A;  4RGS A;  3VYS B;  3KYD B;  5E1X A;  1BI2 A;  1Z3Y A;  2VKV A;  3BT9 A;  4C2U A;  2FOW A;  4UB6 C;  2VAS A;  3OS2 A;  1POG A;  1ENH A;  3HC7 A;  1VQ4 I;  1GVJ A;  2CH0 A;  4XQF A;  3RI4 A;  1QHH D;  4ZTJ A;  2EV0 A;  2RC4 A;  3MWM A;  4HNU A;  2ACJ A;  4CA0 A;  3GTO J;  4EV0 A;  1ZG1 A;  3BQZ A;  3E7L A;  2I5U A;  4BEH A;  5EG0 A;  2HU9 A;  2H1K A;  3I3L A;  4M6Y A;  2XAH A;  2E71 A;  3CCY A;  2M8G X;  3C3W A;  3F8F A;  4M3G A;  1YTY A;  1N75 A;  1UMQ A;  2STT A;  4HF0 A;  2RGV A;  3NEU A;  3CC7 I;  4BQN A;  1ACI A;  2WV0 A;  1W5T A;  2V1N A;  3I55 I;  3IRR A;  3MEX A;  9ANT A;  1X3U A;  3L7W A;  2IS4 A;  1FYK A;  3VDX A;  3KP2 A;  2HOA A;  1DU0 A;  3M8E A;  1H9T A;  2IAI A;  1SVO A;  4CGZ A;  1D5Y A;  4AYB N;  3DPT A;  1HDP A;  3KP6 A;  2HVQ A;  2VBZ A;  3H5R A;  3ABK H;  1MZB A;  3FM5 A;  2M0M A;  3WG7 H;  2DPD A;  4HW0 A;  2Q1Z B;  3BR2 A;  5GTI C;  2GBY A;  3H3V K;  3CCM I;  2K9N A;  5FKO A;  3L09 A;  5BS6 A;  5FD5 A;  1G8X A;  2Y9Z A;  3BTC A;  4UV9 A;  1QPI A;  4CYD A;  4CH7 A;  1UHM A;  2HEO A;  3HUG A;  4HNV A;  1TWG J;  1E3O C;  3HM5 A;  3OL3 A;  2R93 J;  2P4W A;  1T2K A;  1G3S A;  4IPA A;  4XBF A;  5FLV A;  1B6A A;  2ZJQ F;  1XSV A;  3OYN A;  1S3J A;  2OUM A;  4EQQ A;  4UUS A;  2MW8 A;  4A3C J;  1BI0 A;  2KRF A;  2V6C A;  2XGD A;  2ZNY A;  2O6G E;  3R4K A;  3BPV A;  3RYP A;  5J1Y A;  1ZG5 A;  3JRH A;  4A0Z A;  5LGN A;  4BAC A;  2JVG A;  3L2Q A;  1HA8 A;  3K1M A;  2CUJ A;  3K4N A;  3OYE A;  2EH3 A;  4HPQ A;  2O7O A;  4YIR X;  5IOZ A;  3FIW A;  2OQR A;  5IYC J;  2O8X A;  3QU3 A;  2IS6 A;  5FO5 A;  4F92 B;  1Z1D A;  1ETY A;  4BUP A;  4FTH A;  3DKY A;  4OU0 A;  5EG0 B;  2E35 A;  2OA4 A;  3CLQ A;  3BCA A;  2FRH A;  1VFC A;  2F5D A;  2DAO A;  3DBH B;  1JTX A;  3M8F A;  2EIJ H;  4EJT A;  4RB0 A;  2TDX A;  3PSF A;  1HW2 A;  3FK6 A;  2IGM A;  2L02 A;  2QLZ A;  3VB2 A;  3VPR A;  4HOB A;  2V9V A;  4D9J A;  2R92 J;  1G3Y A;  1XTA A;  3JRB A;  3SZP A;  4EGY A;  1RKW A;  3WE2 A;  2D45 A;  2M30 A;  5B66 C;  2EIN H;  4MNU A;  2R5Y B;  4BNC A;  3ZN1 A;  3IAM 2;  4UVA A;  3I59 A;  2ZME C;  3J7Y J;  4X1E A;  3G73 A;  1OYY A;  5E1W A;  3L2U A;  4FHT A;  3O3K A;  5LHH A;  5ILV A;  3KP3 A;  3Q0W A;  2P6T A;  2IVM A;  2ME6 A;  4JX6 A;  4RM2 A;  4LG3 A;  1IAW A;  5KAF C;  1MGT A;  1RES A;  2WTE A;  3ZQL A;  1FMV A;  3QYB A;  1E17 A;  1W4M A;  2DCE A;  2JZY A;  3LQQ A;  2M9H A;  2E1M C;  4BY7 J;  2HWV A;  1BR2 A;  3PFI A;  3KLN A;  1QO0 D;  1G3W A;  2OD5 A;  4XON A;  3W6J B;  4HLY A;  1AWC A;  4L9N A;  1TC3 C;  1GDT A;  1AOY A;  1W5S A;  3PM1 A;  4A69 C;  1BIA A;  3ASN H;  2P7C B;  2YX7 A;  4HEA 2;  4PUS A;  3WTV C;  3CF5 F;  4XRS G;  5BNG A;  3CMY A;  4RGU A;  4AM3 A;  2JQ7 A;  5ICC A;  2DT7 B;  2ECB A;  3GFI A;  2WAQ N;  4KFC A;  4FET A;  4NQW A;  2H1L A;  4R8H A;  5AIP A;  3OYC A;  3CCU I;  4E7L A;  2IT0 A;  2VOD A;  3M9A A;  2DA7 A;  5CQG A;  4UV8 A;  1ZTR A;  4IF4 A;  2VJ5 A;  1U8R A;  2WY7 Q;  1MMN A;  2R7S A;  1WJD A;  4BQA A;  4HRI A;  1YJW I;  3JR9 A;  2DT5 A;  1IXS B;  2DA4 A;  1HOM A;  3J80 K;  2D5V A;  5CPR B;  3JRG A;  1DUX C;  3ROU A;  3C1D A;  4BXU A;  1EH6 A;  2DQL A;  1PDN C;  4FIS A;  1W0U A;  5J1U A;  2WAF A;  4G7H F;  5J4Y A;  1FIA A;  3T5X A;  1QPM A;  3WU1 B;  1OYI A;  1TQI A;  3D1N I;  1RNL A;  4ZDO A;  3BZ6 A;  3P9C A;  4CYC A;  3BZK A;  1X4O A;  3JRA A;  2STW A;  3A0H C;  5J1R A;  1XX5 A;  3GLX A;  3UR3 C;  2H94 A;  1A6I A;  2XAQ A;  1IF1 A;  5ERI A;  3CUQ A;  2KDZ A;  1MDM A;  2VE9 A;  4HX7 A;  2DI3 A;  2ZJ2 A;  1YS7 A;  2HKO A;  4YRV A;  2XPW A;  2FJ1 A;  4MO7 A;  4A93 J;  1QU3 A;  2UWM A;  1FTT A;  3LFK A;  2V1D A;  1DU6 A;  1N25 A;  3TW7 A;  1AU7 A;  4O3M A;  4E7J A;  2JRT A;  1UST A;  3PQK A;  3I4M J;  1FZP B;  5F04 A;  4NDL A;  4ZDP A;  5FD6 A;  3JAM Z;  1WJC A;  1JUP A;  4XR6 A;  4C3J J;  1SD7 A;  2EFO A;  4HA8 A;  4AYB A;  1MBK A;  2VKH A;  5M5W J;  1E3P A;  2X1D A;  3F8M A;  1R4N B;  2VT2 A;  1TL8 A;  4UY8 I;  3S16 J;  3CDI A;  3V8J A;  5ED4 A;  4KUM A;  1D0X A;  2B0L A;  2GWR A;  1NK3 P;  1F43 A;  3OYB A;  2E36 A;  2M1B A;  3U1K A;  4XKB A;  4XLC A;  2DA2 A;  1F9N A;  3T1B A;  4Y7N J;  5KAI C;  1ZQ3 P;  5F64 A;  2IA2 A;  3PUF A;  4KIG A;  3OYH A;  2GAU A;  4KN4 X;  4RLQ A;  3COA C;  1D8K A;  3TP0 A;  4ZYG A;  2VQC A;  1KON A;  4GYG A;  4E7S A;  4CZC A;  3AL0 B;  2Q2E B;  3VEP A;  1MND A;  4I98 B;  4Y52 J;  3GEZ A;  2EPF A;  2RVC A;  1PUF A;  3LA7 A;  4EGZ A;  1U78 A;  3GUD A;  1FOX A;  1I39 A;  5HOO A;  3L2W A;  4PJJ A;  5EEG A;  3ZCO A;  3G3Z A;  1VND A;  3FF5 A;  2Z9O A;  1OYW A;  5KVR A;  2XAU A;  1D1B A;  3KZI C;  2RQP A;  1XMK A;  1FOW A;  5D8K B;  3NRV A;  1D3Y A;  1WQ2 A;  1P6R A;  3KYL A;  2BHY A;  2LF8 A;  2A5Y B;  4RGR A;  3L00 A;  3ZQG A;  3WG9 A;  5K5Q A;  5E3O A;  1GVD A;  2Z1D A;  2HFH A;  3U1D A;  3CUQ B;  2ZME B;  5JHF A;  5HLG A;  2LF7 A;  2X6X A;  4MHG A;  2XAF A;  3OYA A;  5L3G A;  1ERD A;  4ZZL A;  2X6Y A;  1B4A A;  2OU2 A;  4PCQ A;  1RRJ A;  3CF2 A;  2IGO A;  4ZDL A;  3ISP A;  3AFH A;  1EKE A;  1OCR H;  4G9Y A;  1JI8 A;  5EZG A;  5J8C A;  5IY5 H;  1ZR2 A;  2EB7 A;  2E19 A;  2QYO A;  3TO6 A;  2OBP A;  2R7Z J;  2FE3 A;  2QQ9 A;  3A4C A;  2E1M B;  5FLX Z;  3ELK A;  4PJM A;  4GGG A;  3WGH A;  1B8I B;  4LLG F;  5L3D A;  2IP2 A;  1W7P A;  1A31 A;  4PGG A;  4PJN A;  1TQM A;  1L0O C;  1FT9 A;  1IJW C;  3J7A Y;  2DK5 A;  2A61 A;  1U9N A;  4DIQ A;  5J40 A;  4B4C A;  2L4M A;  3R0A A;  2VBY A;  2QQA A;  1ZRF A;  2HQN A;  3WHB A;  2ESN A;  1U5T C;  2VBW A;  4BY1 J;  1K6Y A;  2X1E A;  4P5O A;  4JX5 A;  3S2D J;  3GTL J;  1I5Z A;  5K7H A;  5H2F C;  2QEX I;  5IT9 K;  2FU4 A;  5F0C A;  1J0R A;  5J6X A;  2FD5 A;  3LAJ A;  3CP8 A;  2L7Z A;  1SVM A;  1RET A;  3DPU A;  1TP4 A;  2VC0 A;  3RPU D;  3EQL F;  4YFK F;  5K5R A;  4II3 A;  4MTD A;  2A6E F;  2LY2 A;  1YO5 C;  3S17 J;  1A6Q A;  4RB2 C;  1WVR A;  2LY1 A;  2EFQ A;  4FT8 A;  3Q0U A;  2WAQ A;  2BY1 A;  3ABT A;  3K69 A;  3I58 A;  4UVC A;  4BHP A;  4BQO A;  3BC8 A;  1CF7 A;  2GOM A;  3C7J A;  3H92 A;  1T39 A;  4PSX A;  5F0F A;  1FYL A;  3HHH A;  4MEY F;  1ZRC A;  2E60 A;  5IYD J;  2DFF A;  4UB8 C;  4DW6 A;  1JT6 A;  3CDL A;  2PX9 A;  2DLL A;  3QYF A;  4XLP F;  2P5V A;  3GFL A;  2VI6 A;  1IN7 A;  1YI2 I;  1QZZ A;  2BBY A;  2NXN B;  3PO2 J;  1Y39 A;  3HOV J;  5JFR A;  3BCB A;  2Y9Y A;  4LFU A;  4A6E A;  2ZSI B;  3K7A J;  4WXD A;  3IP4 B;  3FBN B;  3CMA I;  4PGH A;  5HVQ C;  1YQA A;  3KPH A;  4R79 A;  1VI0 A;  1H0M A;  2L7M P;  5JVG F;  1BA5 A;  2NS7 A;  2HZT A;  4OAY A;  5TRD A;  2HPI A;  3RSN A;  1KU7 A;  3LSR A;  2QA4 I;  1SFE A;  3LSG A;  4D1Q A;  2HVS A;  4OIP F;  2DOD A;  1FP1 D;  2HTJ A;  3C18 A;  2L7F P;  5FRN A;  1IUF A;  3P9K A;  5C44 J;  1LFU P;  1H89 C;  4BXF A;  3M1E A;  3QRF F;  4JQF A;  3PJR A;  2NS0 A;  1ETK A;  4CUG A;  2BOL A;  2NS8 A;  3OOU A;  3QOE A;  3R0J A;  2K9Q A;  5M5X J;  1KU3 A;  4WXC A;  3EUH C;  4A0X A;  1V54 H;  1A35 A;  2RRE A;  2HKX A;  2JMW A;  3S8P A;  4F7Z A;  3S3N A;  1JKP C;  2CGP A;  3LNQ A;  2CV2 A;  1X3Z B;  4XLN F;  4XRM A;  1U2W A;  2ID6 A;  3AAF A;  2Z5U A;  1J75 A;  2DYR H;  5LRS A;  3CCJ I;  3FZV A;  3CC2 I;  4NBQ A;  3OYG A;  3BOQ A;  4RBO A;  3BLY A;  2CSO A;  1R1T A;  1BI1 A;  3HPG A;  5LGT A;  1EA3 A;  2WBM A;  1YW8 A;  4LJZ F;  5CVR A;  2A68 F;  3F8C A;  2DK8 A;  3ZMZ A;  1BW5 A;  2PFB A;  1ZG3 A;  2F4O B;  2KIQ A;  2HPM A;  4FE4 A;  5DD8 A;  2ADU A;  4I02 A;  2JT1 A;  2BY2 A;  4JOM A;  3LQR A;  2HXI A;  3DEE A;  5H6R A;  4MTE A;  3J7Z I;  2VJJ A;  1U8B A;  1T56 A;  3K0L A;  3FXU A;  4BDY A;  3HRU A;  1SD5 A;  2IA1 A;  4A3B J;  2KRC A;  3IWF A;  1NG6 A;  3HYI A;  1WJA A;  3M8J A;  1X19 A;  2JUG A;  2YUS A;  5E18 F;  3O6B B;  3B6A A;  2M7A A;  2RAE A;  2Y75 A;  3IAS 2;  2W4S A;  2B7E A;  3G2B A;  3CP2 A;  2TRT A;  3F21 A;  2VIX A;  3CLO A;  2OAZ A;  4PZJ A;  5IYB J;  4C9Y A;  2NNN A;  1G59 A;  3F72 A;  2QUF A;  3HOX J;  3I9V 2;  2E5N A;  3P5J A;  4KJZ A;  1DDN A;  3A01 B;  2HQR A;  3KYC B;  3TQN A;  1EH7 A;  1QBJ A;  4ZJZ A;  4KIT B;  4HX8 A;  2DN0 A;  2KP6 A;  1S29 A;  1SAU A;  2JA6 J;  3SZG A;  2L9S A;  3IH2 A;  2PLY A;  2ZB9 A;  5HLH A;  1X1C A;  4ESB A;  1TWA J;  3BR5 A;  1MMS A;  4NC6 A;  1P4X A;  1ZAO A;  1YJ9 I;  3BG6 A;  3HJE A;  2IJL A;  4HLX A;  1APL C;  1VQL I;  2LG4 A;  4BKX A;  5C4J J;  1X3W B;  3KP7 A;  3HEF A;  1EH8 A;  3QP5 A;  2EBI A;  4M72 A;  1S72 I;  1IRX A;  4L9V A;  4ENN A;  2H6C A;  4P96 A;  1JT0 A;  3S15 J;  2IXS A;  3A1Y A;  4EJV A;  2CRG A;  4I76 A;  3CUO A;  1R36 A;  3KZZ A;  2V4J C;  1RC9 A;  4LK1 F;  4ANJ A;  4N9H A;  3PFY A;  5B3S H;  2NAZ A;  2NVX J;  2BEO A;  1IRG A;  3I54 A;  4IZZ A;  3AG1 H;  5DTD A;  3H5A A;  4F55 A;  2CQK A;  4YFX F;  3U2R A;  4AIH A;  1A5J A;  1U0J A;  3K4B A;  4E7I A;  1IN5 A;  3OIP A;  2CQQ A;  5J4V A;  3DTK A;  3TW6 A;  4LB5 A;  3CMM A;  3A03 A;  3EPZ A;  1WGX A;  1IN6 A;  1GV2 A;  2VOO A;  2X51 A;  5TJJ A;  2IBD A;  3H3Z A;  2CYY A;  2DYS H;  2LYC A;  1B72 B;  3DLL F;  2KQR A;  2RQQ A;  4H4K C;  5TGT A;  5CLS A;  2M7B A;  3MKY B;  2H09 A;  1T98 A;  2LH9 A;  3LOC A;  4YII A;  2Z99 A;  3GTK J;  1S7E A;  1BOB A;  3P7N A;  3HSR A;  1MNE A;  2LP0 A;  1VQP I;  5DCM B;  3H0D A;  3MZH A;  1K6O A;  3F6O A;  4HV5 A;  5CVJ A;  2FML A;  4O6J A;  5D5W B;  5JR3 A;  1GUU A;  1J7K A;  1LDK B;  1U9O A;  4XLA A;  5FJ8 J;  3HOU J;  2GXB A;  2V6E A;  3OYI A;  4KIB A;  1Y0N A;  1HSJ A;  4IO9 F;  2BXY A;  3T0Y A;  5DM6 F;  3HGY A;  4V2G A;  1I50 J;  4W97 A;  2W7N A;  3ASO H;  1MD0 A;  4LLN A;  2EIM H;  1W0T A;  4A3K J;  4IHX A;  4N9I A;  4FX0 A;  1F1Z A;  1TW2 A;  2X1C A;  2R7R A;  3BG7 A;  4XLF A;  3FX3 A;  2COM A;  2LOO A;  4A2U A;  2QQB A;  3GLL A;  3WGG A;  2IS2 A;  3FM3 A;  2L01 A;  1F5T A;  1O3Q A;  3HIF A;  3FXO A;  2MGQ A;  3M4O J;  4IHT A;  3FMQ A;  1ZN2 A;  1Z3X A;  2VQH A;  2YPR A;  5EYR A;  4CCJ A;  3Q5F A;  2P7V B;  3JSO A;  2X0L A;  1Y1W J;  2YX4 A;  1X1A A;  4RB3 C;  4XIC A;  1TWF J;  2FUG 2;  2KIU A;  3QPL A;  4B47 A;  2QSH X;  1IC8 A;  4L5E A;  1TT0 A;  3ZR8 X;  4PFO A;  2FX0 A;  5BPI A;  2PJR A;  4XMY A;  5IT9 Z;  5HLI A;  2GXG A;  4X0G A;  4BS9 A;  3MD2 A;  1L3L A;  3LA3 A;  1REP C;  3GFM A;  4HDV A;  3ABU A;  3KZY A;  2QKL B;  3I5U A;  5LD2 C;  1TLH B;  2VQL A;  2LBF A;  2ZBK A;  4KT6 A;  2ZXI A;  5H6Q A;  2X85 A;  4CCK A;  2DOE A;  2HDW A;  2KT0 A;  4XSZ F;  4KIS A;  3O8G A;  2IW5 A;  3FDY A;  3TP3 A;  1XGS A;  3S1M J;  3D5R C;  3TDU C;  5HNF A;  1FC3 A;  1OJL A;  2ZJR F;  2FOK A;  4MEX F;  4RA2 A;  4OOI A;  2EK5 A;  5ILS A;  3N97 A;  2HYJ A;  3ZQI A;  3H9Q A;  4XLE A;  1SAX A;  2NYX A;  4C2T A;  2MD0 A;  3U21 A;  3MZ8 A;  2A6T A;  5FKN A;  1QRY A;  2F6C A;  4GCV A;  1WJF A;  4ENJ A;  2O9L A;  2B9S A;  1I1G A;  1D0Z A;  3ECH A;  4XN3 A;  3CD6 I;  2L3D A;  2K4J A;  3LL7 A;  5FFX A;  1RIO H;  4XID A;  3AL0 C;  5GTH C;  1VF9 A;  1EF4 A;  2W57 A;  2CU7 A;  2UXN A;  4N4O B;  4P9F A;  2DTR A;  2BW3 A;  4S04 A;  1OKR A;  1QGP A;  1LDD A;  1D1C A;  1MH4 A;  1OR7 C;  3RKY A;  3S32 A;  4BEH B;  4OMZ A;  5CVI A;  3TDZ C;  3GTG J;  3JTG A;  2CQX A;  1ZRD A;  3EUK L;  4WK8 F;  1D8J A;  5AON A;  4NHJ A;  1G6N A;  4U0W A;  1TWH J;  1Z6R A;  1ODD A;  4D5F A;  1MBH A;  4R1H A;  1BOA A;  1XSX A;  5DD4 A;  5GAD J;  4L0Z B;  3JSP A;  2VLA A;  1FPQ A;  2BE5 F;  4F91 B;  3PNY A;  4I99 C;  3DXJ F;  4ZYD A;  1FSE A;  4IOA F;  3CO7 C;  1DQU A;  2CW7 A;  4DYQ A;  5B5E C;  1LEB A;  4D7N A;  4RS8 A;  3Q3S A;  3ZMS A;  3CUQ C;  4G94 A;  1MJA A;  2Q0O A;  1NH3 A;  1ZLK A;  4GDF A;  4E6K G;  4KN7 X;  2FBK A;  2PJR B;  4YIF A;  4UUV A;  3RKQ A;  2M4K A;  3DBL B;  1N78 A;  4MFD A;  3GX4 X;  4I7H A;  5LEK A;  2DJN A;  2DMP A;  2BY0 A;  3MCZ A;  4YFN F;  1TQP A;  1VQO I;  3HOT A;  2LBF B;  4BE1 A;  1KZH A;  1X58 A;  3HUG B;  1MMD A;  2ID3 A;  4HV6 A;  1Q1V A;  2ELJ A;  2DMU A;  3SDG A;  4BJT A;  4ENM A;  1GV5 A;  2OQG A;  3T8R A;  2O61 A;  3BP8 A;  1R5I D;  5D8L B;  2PMU A;  2NVY J;  2WWY A;  2KIM A;  5M5Y J;  4UUS B;  3K1P A;  5KK1 A;  1ZKG A;  2QBY A;  1F36 A;  3WE3 A;  5FB2 A;  1ZRE A;  4J19 A;  2XKO A;  1W5C C;  1T08 B;  1UJ8 A;  4MFE A;  5C3E J;  2UV1 A;  5EGO A;  1PVE A;  3S2W A;  4Y3O A;  4ITV A;  4JP0 A;  4BAY A;  4L5J A;  4OAZ A;  1V55 H;  3DU6 A;  3G1L A;  2L9V A;  3RTR A;  1X2N A;  3HSE A;  4BL0 B;  5FKM A;  1R1U A;  1KU2 A;  2AS5 F;  2PN6 A;  3S1Q J;  2EFN A;  1BC8 C;  4M6X A;  4CXF A;  2RNJ A;  1X1D A;  3LA2 A;  1I1S A;  2QWW A;  1YRN A;  4Q4Z F;  4EMS A;  1IRZ A;  2Y31 A;  2QKM B;  1YJN I;  5E3N A;  4E70 A;  2ZKZ A;  3V8L A;  3IHU A;  1WI3 A;  1XG1 A;  5IOY A;  3LSM A;  1LE8 A;  1NG7 A;  2BVL A;  2CO5 A;  3SXY A;  2V9K A;  2FXA A;  1T6S A;  2XVC A;  2HQA A;  2R7F A;  1BIB A;  2H6B A;  3K4C A;  4GXO A;  4YEJ A;  2AXT C;  4PDK A;  1T33 A;  2BY3 A;  3MFK A;  1XGO A;  2F5C A;  2PI0 A;  3L1P A;  3QPT A;  1V5E A;  3KP4 A;  1IUY A;  1WRJ A;  2E7W A;  3ZQQ A;  3FK7 A;  3GWZ A;  4F3Q A;  5GAG J;  3A02 A;  1TTY A;  2FQ3 A;  2RKH A;  3I59 B;  2MG4 A;  4OWR B;  4AC0 A;  1Z9C A;  4HZF A;  2VB6 A;  1JE8 A;  1FEX A;  2MLG A;  5KCM A;  2KIF A;  1IRF A;  2KPM A;  1OCO H;  3U9G A;  1R22 A;  1JHF A;  4LG0 A;  1W1W E;  3DFG A;  5A2Q Z;  5M3M J;  5FKK A;  2X6W A;  2DOF A;  1K7A A;  4L9J A;  4BH9 A;  5D6E A;  2EFW A;  2KL4 A;  1IDZ A;  3WTY C;  1F4K A;  3CTA A;  3WGI A;  2ISY A;  1K78 A;  3SFZ A;  3GCM A;  3CES A;  2XPU A;  4NNJ A;  2P5L C;  3CJN A;  2XGC A;  1AA7 A;  3E5Q A;  4RM3 A;  1Y6I A;  2GXA A;  1S7A A;  1ETV A;  2VON A;  3TO9 A;  3DKW A;  2K40 A;  1HLV A;  5KHD A;  3IV5 A;  4V19 K;  2Y2Z A;  1ZGJ A;  4IX7 A;  2ISZ A;  3D5S C;  4KMF A;  3GBG A;  3I64 A;  4NQW B;  4IQ4 A;  5HS8 A;  4LGW A;  4QTR A;  1B59 A;  5JVT A;  2XC7 A;  4J01 A;  2O8K A;  2P81 A;  2AO9 A;  4GO1 A;  1LKX A;  2K9L A;  1YX3 A;  2EFP A;  1QVU A;  4IRH A;  4UUT A;  3RPU A;  2DU9 A;  1QQI A;  2Y0M A;  4IRG A;  3GTM J;  2DDB A;  5LBQ A;  4Q5S F;  1OFC X;  1R00 A;  5FFZ A;  5LHI A;  5TIS C;  1ZH5 A;  3SZT A;  3F8B A;  4JX4 A;  3J81 K;  2FNA A;  2PJP A;  1MBF A;  3NWT A;  3AG3 H;  2K9M A;  5GP9 A;  1LE8 B;  1DPR A;  1XC5 A;  3CZ6 A;  5EEA A;  3FIS A;  4CYC B;  4F93 B;  3F8N A;  2L4A A;  3KIO A;  1Z0X A;  2Z3Y A;  3FXM A;  1G4D A;  3HOS A;  1J2X A;  1VZ0 A;  3QYE A;  1Z6T A;  4XK4 A;  2ZXH A;  1OPC A;  3RDI A;  1MDM B;  4QWQ A;  3N05 A;  2MH9 A;  4C30 A;  2G7U A;  3HHG A;  5CJ9 A;  5E8G A;  1ZR4 A;  1FIP A;  2LY9 A;  1ONV A;  2VXD A;  2HXO A;  3BG3 A;  4CSW A;  3GZ6 A;  3K4K A;  4AID A;  5GAH J;  2KRH A;  2XAS A;  1WKM A;  1QHG A;  5FKL A;  3UKG A;  4LMY A;  3VSK A;  5LHG A;  1HF0 A;  2IEK A;  3LSK A;  2H27 A;  3E6B A;  1GLN A;  4FCY A;  1K78 B;  5D4S A;  1X1P A;  1Y8Q B;  2LR8 A;  2LVS A;  1LDJ A;  1JUS A;  2V1X A;  3AG2 H;  2HI3 A;  2MSY A;  2XAG A;  4XOR A;  2XDV A;  5DDG A;  2VXZ A;  2ZXW H;  4Y4R A;  3GTQ J;  4I09 A;  5IT3 A;  2MAB A;  3E97 A;  2GQQ A;  2JPB A;  4P55 A;  3K2A A;  5FGM A;  5E1Z B;  4CCO A;  3SEQ A;  4ZZD A;  2QSG X;  1O3S A;  1VQ9 I;  1SMY F;  2JRM A;  1JJ8 C;  3ML6 A;  3OSF A;  5LLQ A;  1PUF B;  1JHH A;  3CCQ I;  1HXD A;  2ZC2 A;  1SC7 A;  1T0F A;  4A3D J;  5F08 A;  3BG9 A;  1MSE C;  4U0Y A;  1JXS A;  1UAA A;  3H36 A;  3Q9S A;  2M8E A;  4RDU A;  2O0Y A;  2CV1 A;  2Y0S N;  2NRA C;  1ON2 A;  2J5P A;  1FMW A;  3K9T A;  1S6L A;  3FXQ A;  4DQ2 A;  3S3O A;  3O8H A;  2K85 A;  2ELK A;  2A05 A;  5J3L A;  4HX4 A;  2DA1 A;  5HLT A;  2R7X A;  3DEU A;  1OMI A;  2XRL A;  4EJU A;  3TO7 A;  2XRN A;  5HNH A;  2HTS A;  1MBE A;  1CGP A;  4H0E A;  2DFE A;  1G3T A;  4BE2 A;  5J8F A;  1R4M B;  3B6C A;  5EF6 A;  2HGC A;  2CUZ A;  2CQ7 A;  4XN0 A;  3G4S I;  1MH3 A;  2IA0 A;  1SVL A;  1BI3 A;  3EYY A;  4AUX A;  2FBI A;  1S8N A;  2XB0 X;  2V7F A;  3ERE D;  4U7B A;  1KYZ A;  3H9J A;  4WF2 A;  2FMY A;  4IHS A;  2M5W A;  4Z6Y A;  3K10 A;  4DOZ A;  1ON1 A;  2LD5 A;  3BJA A;  3S1N J;  3DP7 A;  4AD9 A;  4B3A A;  4L5I A;  3WTX C;  2HR3 A;  3SFI A;  2X4H A;  1VTN C;  3HOW J;  2R7W A;  1W7P B;  1D1A A;  2R4G A;  2KMU A;  4UVB A;  5E3M A;  1YE9 A;  2ESH A;  1V5F A;  4HG2 A;  3N4M A;  4RGX A;  3QQA A;  4E7Z A;  3PIO F;  4MGR A;  1ITY A;  2K86 A;  2FA5 A;  1IN4 A;  3BR1 A;  1Y8R B;  3HG9 A;  2P0W A;  3LFU A;  3VFZ A;  4DBQ A;  4BGD A;  1VQ8 I;  1QVT A;  4HSR A;  3BR0 A;  5B1B H;  2E2H J;  1YW7 A;  3LMM A;  3OYD A;  3TKY A;  3HB9 A;  3V7C A;  2XUB A;  1AKH A;  1K83 J;  1IXR C;  1J09 A;  5CVU A;  4AU7 A;  3M7G A;  4A5N A;  2DA3 A;  4LK0 F;  3QP6 A;  2EZL A;  2VJI A;  1U5T A;  2RN7 A;  2XF6 A;  2E2I J;  1LFP A;  2DO7 A;  1YFH A;  2R7U A;  2L9N A;  3Q9V A;  2GIZ A;  3BTL A;  2KZG A;  2R7D A;  2L5Q A;  3SYT A;  3ULQ B;  3QOP A;  1CF7 B;  3LSH A;  3CCL I;  3EDP A;  3BZC A;  2V26 A;  3UNG C;  1IGN A;  3RYR A;  4Y13 A;  3J80 Z;  2TCT A;  2K4B A;  3E5U A;  5ILU A;  2N8G A;  3FXR A;  1UHW A;  4BHC A;  4MIM A;  3HRT A;  3RQI A;  2VJ4 A;  2G9W A;  4XOP A;  2W82 A;  2ZFW A;  4UHT A;  2MC3 A;  1J59 A;  1ZYR F;  3FMR A;  3RKW A;  4ZYH A;  1FBQ A;  3DV8 A;  3L2R A;  2F5E A;  4OIQ F;  4DGW B;  1BJA A;  1PYV A;  3OWT A;  3ZOB A;  1R71 A;  4BJ5 C;  2JJ7 A;  5E79 C;  1R58 A;  3ZMD A;  2LSO A;  1UCR A;  1V4R A;  3FWE A;  3D0S A;  1FP2 A;  2E7X A;  2JSC A;  3PSI A;  2BZT A;  2XV4 S;  2AQF A;  4K2E A;  1V3F A;  4CHU A;  2R7T A;  3G6E I;  2FSW A;  1FX7 A;  2V79 A;  3OR2 C;  3W3C A;  1R23 A;  4I0B A;  4EJO A;  4B3X A;  3H1C A;  3KLO A;  1E0E A;  2K3P A;  2JA7 J;  3HBL A;  2K3F A;  3S14 J;  1MKM A;  4QSH A;  3IWZ A;  3RPQ A;  1PP8 F;  2VC1 A;  1DP7 P;  2MD5 A;  2NVT J;  1KU9 A;  2CQN A;  4OIN F;  3JRF A;  3IL2 A;  2IRF G;  4M3D A;  1OCT C;  3E6D A;  3H3U A;  3IH4 A;  1UG0 A;  1NK2 P;  5FLM J;  3CC4 I;  1ZLJ A;  5JHU A;  1K61 A;  4DBR A;  4BU2 A;  2PBI A;  3EUH A;  4CO8 A;  2CS3 A;  2M2E A;  1O7L A;  2EA4 A;  2ECC A;  3VYR B;  4PFP A;  5AIQ A;  3EYI A;  2Z16 A;  2AQE A;  1ETX A;  2GOX B;  2JSP A;  2Z33 A;  5F1J A;  1TW3 A;  4QLC U;  4QPQ A;  3FKJ A;  3E0J B;  2EIK H;  1AKH B;  1WCM J;  1Z77 A;  1FNN A;  1YYV A;  2QCO A;  4XKC A;  3GTJ J;  1P4A A;  3CME I;  2ZJP F;  3GME A;  1BN5 A;  5CYV A;  3HOZ J;  3T8T A;  4BE0 A;  1BR1 A;  3DTE A;  4LLL A;  1UFM A;  1SD4 A;  3MKZ A;  2BYV E;  1Z21 A;  3R60 A;  3F3X A;  2EZI A;  3F23 A;  1ORK A;  1WJE A;  1TNS A;  1TT5 B;  1UEL B;  2DFI A;  2FF4 A;  1EJ9 A;  1I6H J;  4Q47 A;  2DOA A;  4DJA A;  3HTS B;  2HYF A;  1JKQ C;  1B9N A;  1TBX A;  1QA6 A;  5E8I A;  4BBR J;  4XOT A;  3E6M A;  1HKS A;  2R7Q A;  4FAS D;  2COB A;  4RAF A;  3ZMU A;  3C2B A;  3JAM K;  4M73 A;  4ENK A;  3HOY J;  4CCN A;  2Y0S A;  3J81 Z;  2WB1 A;  1KQ0 A;  4C3H J;  3SJM A;  1SFK A;  3IUO A;  5E3L A;  2CV0 A;  4DNC A;  4LIV A;  5M3F J;  2Y30 A;  1KQ8 A;  2HDD A;  4X6A J;  2XF5 A;  1LVA A;  1P4W A;  1BL0 A;  2JWT A;  3TOA A;  3K4J A;  3CCV I;  2GLO A;  4UXN A;  2HVR A;  2VN2 A;  1LB2 A;  2AHQ A;  3PO3 J;  2V9P A;  4M9X A;  2M45 A;  1J9I A;  3OS1 A;  4PSW A;  3R6S A;  2RDP A;  3S93 A;  3ESW B;  3TED A;  5HOD A;  1HST A;  2OV7 A;  4I6Z A;  2QF7 A;  2HOT A;  2YR2 A;  4N4N B;  2D2W A;  3LSJ A;  3CCR I;  1LJ9 A;  4KIF A;  4AWX B;  1IDY A;  1X1B A;  3JRD A;  4FX4 A;  5CKT A;  1PUE E;  1WH7 A;  3BRO A;  2PG4 A;  2M4G A;  1YOV B;  4D7M A;  2HOE A;  2Z2S B;  3G71 I;  4PJ0 C;  5E17 F;  3V4G A;  1YX5 A;  1K4S A;  1R5G A;  1BC7 C;  2ZXJ A;  3R61 A;  1O3R A;  1K79 A;  2WA0 A;  2IGK A;  3HGG A;  2MC4 A;  5DYM A;  2EQR A;  2D1H A;  2F4I A;  4KYW A;  2JVH A;  4KIC A;  2K27 A;  1BR4 A;  3KEO A;  3HZJ A;  1UB9 A;  5L3F A;  4ZYE A;  3QPH A;  1DP3 A;  4XM3 A;  1SFU A;  2K9S A;  1TZL A;  3WTZ A;  1P7J A;  1JKO C;  1I3A A;  3HSF A;  4N0B A;  2OCC H;  4XNF A;  1B1B A;  3FHZ A;  2W1O A;  2DMN A;  2KDO A;  3VSL A;  4S05 A;  2DT6 A;  3GZN B;  4OIO F;  1RR8 C;  2XF7 A;  3OV8 A;  4WCG A;  3MAJ A;  2UUZ A;  3CQZ J;  2A5W A;  2DJI A;  2I10 A;  3DEW A;  4PK4 A;  2R5Y A;  2JA8 J;  4B1R A;  4BJ6 C;  1HQC A;  3VYT B;  3DTI A;  1H9G A;  2EJR A;  3PNT A;  3W2W A;  2OPT A;  4Z2Y A;  5L3E A;  2FNP A;  1WJB A;  4IL6 C;  4ZTF A;  2NOJ B;  5FLX K;  2XRO A;  3OS0 A;  4KMU X;  2DMQ A;  5LFA A;  2XGX A;  4XLH A;  4XSX F;  4P9U A;  3WHC A;  3BJ6 A;  3ZMV A;  2BV6 A;  2NVU B;  3ZQC A;  1YLF A;  2DFH A;  1PP7 U;  3DLA A; 
#chains in the Genus database with same CATH homology
 2D1V A;  2RV8 A;  1FYM A;  4OMY A;  4UNO A;  2ZO4 A;  1LQ1 A;  4YG2 F;  1R5H A;  3W6K B;  3GF2 A;  1IN8 A;  3ZN0 A;  4U7D A;  2F5F A;  2MBF A;  4KT5 C;  3E5X A;  1XSD A;  3V7S A;  2GZW A;  2EWN A;  2KKO A;  4M9Z A;  4L0Y B;  3P9I A;  4AIJ A;  5DCF A;  1MJ9 A;  2DBB A;  2R3S A;  4WX9 A;  3EET A;  2YU3 A;  4HDU A;  2LDU A;  4EJW A;  2EV6 A;  5HDG A;  5HDN A;  5DUK A;  3CO6 C;  3NQO A;  3SHF A;  2XHK A;  5L3B A;  1XN7 A;  2L54 A;  4MQV A;  5H20 A;  3IRQ A;  5EEH A;  1EV7 A;  3WOD F;  4Q48 A;  3HRM A;  1U6G A;  3E6C C;  1HW1 A;  2WC2 A;  2XKP A;  5CVV A;  3FMS A;  1LNW A;  4HBL A;  2DQR A;  2VE8 A;  3RIR A;  5BMZ A;  1NHA A;  3CDH A;  1YW9 A;  2G7H A;  4A5M A;  2FEZ A;  4I2O A;  1MJB A;  3DF8 A;  5DV5 A;  2BGC A;  1USS A;  4IRI A;  3L9F A;  3BY6 A;  3GFJ A;  1KA8 A;  1GHC A;  2ELH A;  4GYI A;  3HRS A;  2P8T A;  4AIK A;  1XGM A;  1IXC A;  2IPQ X;  4IXA A;  3JW4 A;  3K2Z A;  3SQN A;  4HF1 A;  4OIR F;  2QVO A;  4WXH A;  2A07 F;  1IW7 F;  2Q2E A;  3OOP A;  5LEJ A;  4KA4 A;  4M74 A;  1I6X A;  1OR7 A;  3DQV C;  3RKX A;  5L3C A;  3KCC A;  2JPC A;  1QZY A;  1U3E M;  1QNT A;  1ZHF A;  2YSR A;  2XIG A;  3LWF A;  3WU0 A;  1XCV A;  4O5V A;  1Q1H A;  1STZ A;  1KGS A;  2HDC A;  4G6Q A;  1SD6 A;  4L18 B;  3WTU C;  3IC7 A;  5JI6 A;  2EV5 A;  2ZME A;  1O57 A;  1RUN A;  3I0T A;  4MQ9 F;  2XAJ A;  1Z91 A;  2A3S A;  3GZ5 A;  2JTV A;  5LRR A;  1XB4 A;  1GXP A;  2QM3 A;  3KE2 A;  2DPU A;  2QBY B;  1B9M A;  4AVP A;  3K1N A;  2MA3 A;  3WTS C;  4D0P A;  1XMA A;  4A6D A;  2E1N A;  2CG4 A;  3PQJ A;  3GXO A;  3ZPL A;  3WTW C;  4G7Z F;  3V8K A;  3MZY A;  3BJO A;  3GYH X;  4BHB A;  4G6D A;  1P92 A;  4XRF A;  1WSU A;  3BDD A;  1XGN A;  4BYY A;  1ZGA A;  2KJB A;  4RAZ A;  3B02 A;  4ASN A;  4HYE A;  2LNB A;  4IVN A;  4Y15 A;  5HDK A;  5HS9 A;  3VOD A;  2W24 A;  1SFX A;  1XDS A;  1BM9 A;  4A12 A;  1Y0U A;  3D5L A;  5BPD A;  1R1V A;  3B73 A;  4RB1 A;  2ZNZ A;  4Y17 A;  4ZH4 F;  3VOE A;  2J5O A;  1C0W A;  4LG0 B;  5BOX A;  3F6V A;  4A0Y A;  3BWG A;  2CFX A;  2E1C A;  3ZP5 A;  4NB5 A;  4LB6 B;  1WI9 A;  1FSH A;  1LEA A;  5K1Y A;  5D6F A;  3JTH A;  3ZMT A;  3GO5 A;  1D5V A;  1TNT A;  1YIO A;  1O3T A;  5ICG A;  2Y48 A;  2HYG D;  4KNY A;  2K7L A;  2HS5 A;  2VOP A;  1XDU A;  4B8X A;  3QAH A;  4CDG A;  4I0A A;  2ZCW A;  2PQ8 A;  4KDP A;  1P2F A;  4HQE A;  1FBU A;  3I53 A;  1YG2 A;  4RAY A;  5ICE A;  5DEQ A;  3E3V A;  4HF2 A;  4JBA A;  3HTU A;  2FBH A;  1RI7 A;  4ON0 A;  3QU6 A;  1E2X A;  2AXL A;  2VBX A;  1JGS A;  1J5Y A;  4B09 A;  2CW0 F;  1ULY A;  4U88 A;  4WWC A;  3J7A O;  2CWE A;  5E20 A;  2QEN A;  3DPL C;  4IJA A;  1Z05 A;  5LGU A;  2EA2 A;  1R7J A;  2O03 A;  3KEQ A;  2GIV A;  4EM1 A;  5ICF A;  3REO A;  2MLK A;  1RUO A;  1KQ9 A;  5F6F A;  3I71 A;  1W7P D;  3GVA A;  1FY7 A;  2A69 F;  5F1R A;  2OZ6 A;  2W84 A;  1I27 A;  1HBX G;  4EM2 A;  1O7F A;  3LST A;  3KP5 A;  1HKT A;  1ZAR A;  4TV7 A;  5K5O A;  4M71 A;  3GW2 A;  1S7O A;  4U0V A;  4G8X A;  5D5V B;  1BBY A;  3ECO A;  2NNY A;  1IZ1 A;  2A6H F;  4LD5 A;  2UXX A;  3RJP A;  4HAM A;  3TOB A;  4EVI A;  1FWZ A;  2GA1 A;  2LKP A;  1YS6 A;  2PEX A;  1A04 A;  4ESJ A;  4EM0 B;  5DCM A;  5D4R A;  2C6Y A;  3V7R A;  2P5K A;  5HS7 A;  3LAP A;  3O2P E;  1DPU A;  1XCB A;  3F22 A;  2OZU A;  3IKV A;  3MQ0 A;  6PAX A;  1KYW A;  1T38 A;  1HW5 A;  3TGN A;  1FBS A;  3KET A;  1XD7 A;  4G7O F;  4ESF A;  5DUI A;  4JK1 X;  4ETS A;  1WWX A;  2UZK A;  2F2E A;  1U5T B;  1Z7U A;  4CZZ A;  4I01 A;  2PMH A;  2VT3 A;  2O3F A;  1GXQ A;  2GA2 A;  4HQM A;  3L2C A;  1HKQ A;  4CIC A;  2DW4 A;  2ETH A;  5A2Q K;  3ZQ7 A;  5D5X B;  2QZ8 A;  3IKT A;  3I4P A;  2P6S A;  2V1U A;  3BPX A;  2K02 A;  4L9T A;  2W85 A;  4M9S A;  3KFW X;  1SMT A;  2Q8K A;  2KJC A;  2MH2 A;  2M87 A;  3WTT C;  1FOK A;  1RZ4 A;  5D5U B;  5BQT A;  1FLI A;  2W25 A;  4RGS A;  5E1X A;  1BI2 A;  1GVJ A;  3RI4 A;  2EV0 A;  2RC4 A;  3MWM A;  2ACJ A;  4EV0 A;  1ZG1 A;  4M6Y A;  2XAH A;  3C3W A;  3F8F A;  1YTY A;  2STT A;  4HF0 A;  2RGV A;  3NEU A;  2WV0 A;  1W5T A;  3IRR A;  3MEX A;  1X3U A;  3L7W A;  1FYK A;  3KP2 A;  3M8E A;  1H9T A;  4CGZ A;  3DPT A;  3KP6 A;  2VBZ A;  1MZB A;  3FM5 A;  2DPD A;  4HW0 A;  3L09 A;  5BS6 A;  5FD5 A;  4UV9 A;  4CYD A;  1UHM A;  2HEO A;  3HUG A;  2P4W A;  1T2K A;  1G3S A;  4IPA A;  4XBF A;  1B6A A;  1XSV A;  1S3J A;  4EQQ A;  1BI0 A;  2KRF A;  2V6C A;  2ZNY A;  2O6G E;  3R4K A;  3BPV A;  3RYP A;  1ZG5 A;  4A0Z A;  5LGN A;  3K1M A;  2OQR A;  2O8X A;  3QU3 A;  5FO5 A;  1Z1D A;  4OU0 A;  2OA4 A;  2FRH A;  2F5D A;  2DAO A;  3M8F A;  4EJT A;  4RB0 A;  2TDX A;  1HW2 A;  2L02 A;  2QLZ A;  3VB2 A;  4HOB A;  2V9V A;  1G3Y A;  3SZP A;  4EGY A;  3WE2 A;  2D45 A;  2M30 A;  4MNU A;  4BNC A;  3ZN1 A;  4UVA A;  3I59 A;  3G73 A;  1OYY A;  5E1W A;  4FHT A;  3O3K A;  5LHH A;  5ILV A;  3KP3 A;  2P6T A;  2IVM A;  1IAW A;  1MGT A;  2WTE A;  1E17 A;  1W4M A;  2JZY A;  3LQQ A;  2HWV A;  3PFI A;  3KLN A;  1QO0 D;  1G3W A;  2OD5 A;  4HLY A;  3W6J B;  1AWC A;  4L9N A;  1AOY A;  1W5S A;  1BIA A;  2P7C B;  2YX7 A;  3WTV C;  4RGU A;  5ICC A;  3GFI A;  4KFC A;  4NQW A;  4R8H A;  2VOD A;  5AIP A;  2IT0 A;  3M9A A;  4UV8 A;  4IF4 A;  1U8R A;  4BQA A;  2DT5 A;  1IXS B;  3J80 K;  1DUX C;  3ROU A;  3C1D A;  4BXU A;  1EH6 A;  2DQL A;  1PDN C;  4G7H F;  3T5X A;  1QPM A;  3WU1 B;  1OYI A;  1TQI A;  1RNL A;  3BZ6 A;  3P9C A;  2STW A;  3GLX A;  2H94 A;  2XAQ A;  1IF1 A;  5ERI A;  3CUQ A;  1MDM A;  2VE9 A;  4HX7 A;  2DI3 A;  2ZJ2 A;  1YS7 A;  2HKO A;  2UWM A;  3LFK A;  2V1D A;  4O3M A;  2JRT A;  1UST A;  3PQK A;  1FZP B;  5FD6 A;  3JAM Z;  1SD7 A;  2EFO A;  4HA8 A;  3F8M A;  2VT2 A;  3V8J A;  5ED4 A;  4KUM A;  2B0L A;  2GWR A;  2M1B A;  1F9N A;  3T1B A;  5F64 A;  2IA2 A;  4KIG A;  2GAU A;  4KN4 X;  3COA C;  1D8K A;  4ZYG A;  4GYG A;  3VEP A;  4I98 B;  3GEZ A;  2RVC A;  3LA7 A;  4EGZ A;  1U78 A;  3GUD A;  5HOO A;  5EEG A;  3G3Z A;  3FF5 A;  2Z9O A;  1OYW A;  5KVR A;  2RQP A;  1XMK A;  5D8K B;  3NRV A;  1D3Y A;  1WQ2 A;  1P6R A;  2LF8 A;  2A5Y B;  4RGR A;  3L00 A;  3WG9 A;  5K5Q A;  2HFH A;  3U1D A;  3CUQ B;  2ZME B;  5HLG A;  2LF7 A;  4MHG A;  2XAF A;  5L3G A;  4ZZL A;  1B4A A;  2OU2 A;  4PCQ A;  3ISP A;  4G9Y A;  5J8C A;  2EB7 A;  2QYO A;  3TO6 A;  2OBP A;  2FE3 A;  2QQ9 A;  5FLX Z;  3ELK A;  4GGG A;  3WGH A;  4LLG F;  5L3D A;  2IP2 A;  1W7P A;  4PGG A;  1TQM A;  1L0O C;  1FT9 A;  2DK5 A;  2A61 A;  2L4M A;  3R0A A;  2VBY A;  2QQA A;  1ZRF A;  2HQN A;  2ESN A;  1U5T C;  2VBW A;  4P5O A;  1I5Z A;  5IT9 K;  2FU4 A;  1J0R A;  5J6X A;  3LAJ A;  4YFK F;  2VC0 A;  5K5R A;  3EQL F;  4MTD A;  1YO5 C;  2A6E F;  4RB2 C;  2EFQ A;  4FT8 A;  3ABT A;  3K69 A;  3I58 A;  4UVC A;  4BHP A;  1CF7 A;  3C7J A;  3H92 A;  1T39 A;  1FYL A;  3HHH A;  4MEY F;  1ZRC A;  2DLL A;  4XLP F;  2P5V A;  3GFL A;  1IN7 A;  1QZZ A;  2BBY A;  5JFR A;  4LFU A;  4A6E A;  4WXD A;  4PGH A;  5HVQ C;  1YQA A;  4R79 A;  1H0M A;  2HZT A;  5TRD A;  1KU7 A;  1SFE A;  4OIP F;  1FP1 D;  2HTJ A;  3C18 A;  3P9K A;  3QRF F;  3M1E A;  4JQF A;  2NS0 A;  3R0J A;  1KU3 A;  4WXC A;  4A0X A;  4F7Z A;  2HKX A;  2CGP A;  4XLN F;  1U2W A;  3AAF A;  2Z5U A;  1J75 A;  5LRS A;  3FZV A;  3BOQ A;  2CSO A;  1R1T A;  1BI1 A;  5LGT A;  1YW8 A;  4LJZ F;  5CVR A;  2A68 F;  3F8C A;  2DK8 A;  3ZMZ A;  2PFB A;  1ZG3 A;  5DD8 A;  2ADU A;  4I02 A;  2JT1 A;  3LQR A;  5H6R A;  4MTE A;  3K0L A;  3FXU A;  3HRU A;  1SD5 A;  2IA1 A;  3IWF A;  3HYI A;  5E18 F;  3O6B B;  2Y75 A;  3F21 A;  3CLO A;  2OAZ A;  4PZJ A;  2NNN A;  3F72 A;  2QUF A;  1DDN A;  2HQR A;  3TQN A;  1EH7 A;  1QBJ A;  4HX8 A;  1S29 A;  2PLY A;  5HLH A;  4ESB A;  1P4X A;  1ZAO A;  2IJL A;  4HLX A;  3KP7 A;  1EH8 A;  3QP5 A;  4M72 A;  4L9V A;  4ENN A;  2H6C A;  4P96 A;  4EJV A;  3CUO A;  1R36 A;  3KZZ A;  4LK1 F;  4N9H A;  2NAZ A;  2BEO A;  1IRG A;  3I54 A;  2CQK A;  4YFX F;  3U2R A;  4AIH A;  1IN5 A;  4LB5 A;  1IN6 A;  2VOO A;  5TJJ A;  3H3Z A;  2CYY A;  5CLS A;  2H09 A;  1T98 A;  4YII A;  2Z99 A;  3P7N A;  3HSR A;  5DCM B;  3MZH A;  1K6O A;  3F6O A;  4HV5 A;  5CVJ A;  2FML A;  4O6J A;  5D5W B;  5JR3 A;  1J7K A;  1LDK B;  2GXB A;  4KIB A;  1HSJ A;  3T0Y A;  1MD0 A;  4LLN A;  4N9I A;  4FX0 A;  1F1Z A;  1TW2 A;  3FX3 A;  2COM A;  4A2U A;  2QQB A;  3WGG A;  3FM3 A;  2L01 A;  1F5T A;  1O3Q A;  3HIF A;  4IHT A;  3FMQ A;  1ZN2 A;  2YPR A;  3Q5F A;  2P7V B;  3JSO A;  2X0L A;  2YX4 A;  4RB3 C;  2KIU A;  5IT9 Z;  5BPI A;  5HLI A;  2GXG A;  1L3L A;  3LA3 A;  1REP C;  3GFM A;  4HDV A;  3ABU A;  3KZY A;  3I5U A;  1TLH B;  2ZBK A;  5H6Q A;  4XSZ F;  2IW5 A;  1XGS A;  3TDU C;  1FC3 A;  4MEX F;  2FOK A;  4OOI A;  2EK5 A;  5ILS A;  3N97 A;  1SAX A;  2NYX A;  4GCV A;  4ENJ A;  1I1G A;  3ECH A;  2L3D A;  2K4J A;  5FFX A;  1RIO H;  2W57 A;  2UXN A;  4P9F A;  2DTR A;  4S04 A;  1OKR A;  1QGP A;  1LDD A;  3RKY A;  4OMZ A;  5CVI A;  3TDZ C;  3JTG A;  1ZRD A;  4WK8 F;  1D8J A;  5AON A;  4NHJ A;  1G6N A;  4U0W A;  1Z6R A;  1ODD A;  4R1H A;  1BOA A;  1XSX A;  5DD4 A;  4L0Z B;  3JSP A;  1FPQ A;  2BE5 F;  4ZYD A;  3DXJ F;  1FSE A;  3CO7 C;  1LEB A;  4RS8 A;  3ZMS A;  3CUQ C;  4G94 A;  1MJA A;  2Q0O A;  1ZLK A;  4KN7 X;  2FBK A;  4YIF A;  4UUV A;  3GX4 X;  4I7H A;  5LEK A;  3MCZ A;  4YFN F;  1TQP A;  3HOT A;  4HV6 A;  4ENM A;  2OQG A;  3T8R A;  2O61 A;  3BP8 A;  5D8L B;  2PMU A;  2WWY A;  2KIM A;  3K1P A;  5KK1 A;  2QBY A;  5FB2 A;  3WE3 A;  1ZRE A;  2XKO A;  3S2W A;  4BAY A;  4L5J A;  3RTR A;  3HSE A;  1R1U A;  1KU2 A;  2AS5 F;  2PN6 A;  2EFN A;  1BC8 C;  4M6X A;  4CXF A;  2RNJ A;  3LA2 A;  1I1S A;  2QWW A;  4Q4Z F;  4EMS A;  4E70 A;  2ZKZ A;  3V8L A;  3IHU A;  2CO5 A;  3SXY A;  2FXA A;  1T6S A;  2XVC A;  2R7F A;  1BIB A;  2H6B A;  4GXO A;  4PDK A;  3MFK A;  1XGO A;  2F5C A;  2PI0 A;  3QPT A;  3KP4 A;  1IUY A;  1WRJ A;  2E7W A;  3GWZ A;  1TTY A;  2FQ3 A;  2RKH A;  3I59 B;  1Z9C A;  1JE8 A;  4HZF A;  2MLG A;  2KIF A;  1IRF A;  3U9G A;  1R22 A;  1JHF A;  4LG0 A;  3DFG A;  5A2Q Z;  1K7A A;  4L9J A;  4BH9 A;  5D6E A;  2EFW A;  3WTY C;  1F4K A;  3CTA A;  3WGI A;  2ISY A;  1K78 A;  3SFZ A;  2P5L C;  3CJN A;  3E5Q A;  1S7A A;  2VON A;  3TO9 A;  3DKW A;  1ZGJ A;  2ISZ A;  4KMF A;  3I64 A;  5HS8 A;  4LGW A;  1B59 A;  5JVT A;  4GO1 A;  2EFP A;  4IRH A;  3RPU A;  2DU9 A;  1QQI A;  2Y0M A;  4IRG A;  5LBQ A;  4Q5S F;  1R00 A;  5FFZ A;  5LHI A;  1ZH5 A;  3SZT A;  3F8B A;  3J81 K;  2FNA A;  2PJP A;  1DPR A;  3F8N A;  2L4A A;  2Z3Y A;  1G4D A;  3HOS A;  1J2X A;  1Z6T A;  1OPC A;  3RDI A;  1MDM B;  4QWQ A;  2MH9 A;  2G7U A;  3HHG A;  5CJ9 A;  5E8G A;  1ONV A;  3GZ6 A;  2XAS A;  1WKM A;  4LMY A;  5LHG A;  2H27 A;  3E6B A;  1K78 B;  5D4S A;  2V1X A;  1LDJ A;  2XAG A;  5DDG A;  2VXZ A;  4I09 A;  5IT3 A;  3E97 A;  2GQQ A;  2JPB A;  4P55 A;  5FGM A;  5E1Z B;  4ZZD A;  1O3S A;  1SMY F;  3ML6 A;  5LLQ A;  1JHH A;  1HXD A;  1T0F A;  4U0Y A;  1JXS A;  3Q9S A;  2M8E A;  2O0Y A;  2NRA C;  1ON2 A;  2J5P A;  3K9T A;  1S6L A;  3FXQ A;  4DQ2 A;  4HX4 A;  3DEU A;  1OMI A;  4EJU A;  3TO7 A;  2XRN A;  2HTS A;  1CGP A;  4H0E A;  1G3T A;  5J8F A;  2HGC A;  2IA0 A;  1BI3 A;  3EYY A;  2FBI A;  1S8N A;  3ERE D;  4U7B A;  1KYZ A;  4WF2 A;  2FMY A;  4IHS A;  2M5W A;  1ON1 A;  3BJA A;  3DP7 A;  4AD9 A;  4L5I A;  3WTX C;  2HR3 A;  1VTN C;  2X4H A;  1W7P B;  4UVB A;  2ESH A;  3N4M A;  4RGX A;  4MGR A;  2K86 A;  2FA5 A;  1IN4 A;  3VFZ A;  1YW7 A;  3TKY A;  3V7C A;  2XUB A;  1IXR C;  5CVU A;  3M7G A;  4A5N A;  4LK0 F;  3QP6 A;  1U5T A;  2RN7 A;  2DO7 A;  1YFH A;  3Q9V A;  2R7D A;  3ULQ B;  3QOP A;  1CF7 B;  3EDP A;  3RYR A;  4Y13 A;  3J80 Z;  2K4B A;  3E5U A;  5ILU A;  3FXR A;  1UHW A;  4BHC A;  3HRT A;  2G9W A;  2ZFW A;  4UHT A;  2MC3 A;  1J59 A;  1ZYR F;  3FMR A;  3RKW A;  4ZYH A;  1FBQ A;  3DV8 A;  2F5E A;  4OIQ F;  1BJA A;  1R58 A;  3ZMD A;  2LSO A;  1UCR A;  1V4R A;  3FWE A;  3D0S A;  1FP2 A;  2E7X A;  2JSC A;  2XV4 S;  4K2E A;  1V3F A;  4CHU A;  2FSW A;  1FX7 A;  2V79 A;  1R23 A;  4I0B A;  4EJO A;  3KLO A;  1MKM A;  1PP8 F;  3IWZ A;  3RPQ A;  1DP7 P;  2VC1 A;  2MD5 A;  1KU9 A;  4OIN F;  3IL2 A;  2IRF G;  3E6D A;  3H3U A;  1ZLJ A;  5JHU A;  2PBI A;  3EUH A;  4CO8 A;  1O7L A;  2EA4 A;  5AIQ A;  3EYI A;  2Z33 A;  1TW3 A;  4QLC U;  1FNN A;  1YYV A;  1P4A A;  1BN5 A;  5CYV A;  3T8T A;  4LLL A;  1UFM A;  1SD4 A;  2BYV E;  3R60 A;  3F3X A;  3F23 A;  1TNS A;  2FF4 A;  2DFI A;  4Q47 A;  3HTS B;  2HYF A;  1B9N A;  1TBX A;  5E8I A;  3E6M A;  1HKS A;  3ZMU A;  3JAM K;  4M73 A;  4ENK A;  3J81 Z;  1KQ0 A;  4DNC A;  1KQ8 A;  1LVA A;  1P4W A;  3TOA A;  4UXN A;  2VN2 A;  1LB2 A;  4M9X A;  2M45 A;  1J9I A;  3R6S A;  2RDP A;  1HST A;  2YR2 A;  2D2W A;  1LJ9 A;  4KIF A;  4AWX B;  4FX4 A;  1PUE E;  3BRO A;  2PG4 A;  2HOE A;  5E17 F;  3V4G A;  1R5G A;  1BC7 C;  2ZXJ A;  3R61 A;  1O3R A;  1K79 A;  5DYM A;  2D1H A;  4KYW A;  4KIC A;  2K27 A;  3KEO A;  1UB9 A;  5L3F A;  4ZYE A;  3QPH A;  1SFU A;  3WTZ A;  3HSF A;  4N0B A;  3FHZ A;  1B1B A;  4S05 A;  4OIO F;  3OV8 A;  4WCG A;  3MAJ A;  1HQC A;  1H9G A;  2EJR A;  4Z2Y A;  5L3E A;  2FNP A;  5FLX K;  2XRO A;  4KMU X;  2XGX A;  4XSX F;  4P9U A;  3ZMV A;  3BJ6 A;  2BV6 A;  1YLF A;  1PP7 U; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...