3TDUC

N-terminal acetylation acts as an avidity enhancer within an interconnected multiprotein complex: structure of a human cul1whb-dcn1p-acetylated ubc12n complex
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
75
structure length
75
Chain Sequence
NIEEDRKLLIQAAIVRIMKMRKVLKHQQLLGEVLTQLSSRFKPRVPVIKKCIDILIEKEYLERVDGEKDTYSYLA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Ligase/protein binding
molecule keywords DCN1-like protein 1
publication title N-terminal acetylation acts as an avidity enhancer within an interconnected multiprotein complex.
pubmed doi rcsb
source organism Homo sapiens
total genus 26
structure length 75
sequence length 75
chains with identical sequence D
ec nomenclature
pdb deposition date 2011-08-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF10557 Cullin_Nedd8 Cullin protein neddylation domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 3tduC00
4BNCA 1XGSA 4OIQF 3P7NA 4P5OA 3RI4A 3ZN1A 4R79A 3RIRA 4K2EA 1QBJA 1DPRA 1QGPA 5FLXZ 4Q48A 3KP3A 1HQCA 2OAZA 2VC1A 2IVMA 2KIUA 4BXUA 1WQ2A 5D6FA 2DPDA 4BHPA 5F1RA 4IRGA 2KIMA 1U5TA 4HA8A 5D4SA 3KETA 1B9MA 3T5XA 3U2RA 2EB7A 3WGIA 2EA2A 1WI9A 2E1NA 3R4KA 3JSOA 4IXAA 1ZAOA 3H92A 2EK5A 5BOXA 2O03A 5ILUA 2TDXA 5A2QK 2DBBA 3FM5A 3F8NA 2FOKA 3FZVA 2ISZA 2DQLA 3C1DA 2H94A 1P4WA 3SFZA 2OQRA 1ZG1A 3RTRA 2VODA 3K1NA 3ZMTA 2NRAC 5ICCA 3PFIA 2FSWA 2GA2A 2HFHA 2DK8A 1ULYA 3KZYA 3I59A 5DCFA 5DV5A 3LQQA 2IT0A 3TO7A 3P9CA 5D5XB 4EJWA 3V8JA 4EM1A 1ZGJA 1ZRCA 3Q9SA 5ICEA 2D1HA 3QU6A 4I01A 2A07F 4Y13A 4KIFA 3WE2A 1KA8A 2F2EA 3Q5FA 4ZZDA 2OD5A 1Q1HA 1RUOA 1J0RA 1XGMA 4ENKA 1IN4A 2ESNA 1FBQA 5JFRA 1WSUA 3ZMDA 1YW8A 2XIGA 4A12A 2LDUA 3U9GA 4Z2YA 3IKTA 3WTVC 4G6DA 5CVRA 5HDKA 3WU0A 2YR2A 4KUMA 4MGRA 4I7HA 2ZMEB 4L9VA 4HYEA 1QZZA 2EWNA 1QQIA 3TDUC 1H9GA 1F5TA 1HXDA 1ONVA 1DUXC 4U7BA 3V7CA 3DFGA 4HQEA 1ON1A 3L9FA 3IWFA 1TQMA 4ZYHA 3GFLA 4M73A 3QPTA 1K7AA 3RDIA 1MKMA 3GW2A 1KQ0A 5K1YA 4WF2A 2NS0A 2D45A 3LAPA 2XHKA 1G4DA 4FHTA 2HKOA 4AIHA 1EH6A 1YS6A 4KIGA 3V7SA 2VOPA 3ZMZA 4ON0A 3KE2A 3FHZA 4R8HA 4UXNA 1ZG5A 2RV8A 4ENJA 2DAOA 1QO0D 4CICA 3V7RA 2YX4A 3BROA 3WG9A 3HSFA 2P7CB 3DKWA 5JI6A 3SHFA 2OBPA 3DV8A 4A5NA 3FF5A 4EJUA 4WCGA 4MEYF 4A0YA 2LF8A 3BOQA 5HS8A 4M9ZA 3EDPA 1BBYA 3CUQA 5FD5A 2BGCA 5FFZA 1IF1A 4AVPA 3ZP5A 2EV5A 3E5XA 4U7DA 1FSEA 1FP2A 4LGWA 1W5SA 1STZA 3ML6A 1HW2A 5E1WA 5DCMA 5LLQA 2WV0A 3W6KB 1R23A 3M8FA 4EVIA 4AD9A 5CVUA 2IP2A 3MFKA 5AONA 4XSXF 2HYGD 1ZG3A 1SD5A 2DI3A 3KP2A 3DP7A 3FMSA 2EA4A 2K27A 1ZARA 4AIJA 2FA5A 4L18B 1J75A 4EGYA 1T2KA 2EV6A 4UV8A 3BJAA 1XSDA 1ZYRF 3J81K 1B6AA 4U0VA 4F7ZA 3GLXA 2XAQA 2QZ8A 1JHHA 1SFUA 3F8FA 4UV9A 2HDCA 1P6RA 2JPBA 1J5YA 2CWEA 2RN7A 3ERED 4IHTA 3REOA 3TO6A 1L0OC 2ESHA 2GA1A 1K79A 1FBUA 5E17F 1IUYA 1J7KA 4PGGA 3MAJA 3EETA 1E17A 1E2XA 1MJBA 1XSXA 4DQ2A 5H6QA 3HTUA 3MWMA 3GZ5A 1I1GA 1IRGA 3GYHX 2RDPA 2PMHA 5BQTA 2GQQA 5L3BA 4M74A 2XV4S 2BE5F 1U6GA 3I54A 4EJVA 5KVRA 4UNOA 2AXLA 2BYVE 2A5YB 1OYIA 3B73A 4CGZA 4FX4A 2O6GE 2JZYA 3ABUA 2Q2EA 2FF4A 2KIFA 3JAMK 3KP6A 3LWFA 1YS7A 2VBWA 4KT5C 5FD6A 1WWXA 2MH2A 5LGTA 2YX7A 2PBIA 5D5UB 3N4MA 1OPCA 2ISYA 1R22A 1LDJA 2P4WA 2FBIA 1TQIA 3KP7A 3BPXA 3F22A 1EH8A 4WWCA 3T8TA 2VT3A 1YG2A 5K5OA 3R0JA 4OMYA 3WU1B 2D2WA 1UB9A 4IVNA 2GWRA 4G7OF 1ZH5A 3TDZC 2Z9OA 2QLZA 2IPQX 4HV6A 1GXPA 3KP4A 4KMFA 2FBHA 4ASNA 2V6CA 1R36A 3WTTC 2VN2A 1KGSA 1UFMA 3WTWC 1MDMA 3E97A 4EMSA 1DDNA 1GXQA 1EH7A 1XSVA 2MC3A 5LHHA 2A6HF 3K69A 3M7GA 3HOSA 3QOPA 5D8KB 2Z99A 2DFIA 4S04A 1ZN2A 4R1HA 1Z6RA 2O8XA 2VXZA 4OINF 3LAJA 2L54A 3TKYA 5H6RA 1BIAA 4KDPA 1S6LA 3E6CC 3H3UA 4IRHA 2JTVA 2W57A 1J9IA 4XSZF 2AS5F 4RGRA 3KZZA 3I64A 2QUFA 5DDGA 1USSA 3BZ6A 3J81Z 4HV5A 4HBLA 2PG4A 2CFXA 1KU2A 1S3JA 3MEXA 1RI7A 4IJAA 4HLYA 4BHBA 2EFNA 1SFXA 1I1SA 1FT9A 3DXJF 2WWYA 2VBXA 2GXBA 3RPUA 3CUOA 1P2FA 5CVVA 4GGGA 5J6XA 4OU0A 3WTYC 2MLGA 2XROA 3L00A 3L7WA 2V1XA 5LHGA 4S05A 4JK1X 4G7ZF 3TQNA 4Q5SF 1LB2A 4HF2A 3I58A 3KLNA 2XKPA 1XN7A 2Q0OA 2M8EA 4B8XA 2STTA 1SD4A 1EV7A 3IRQA 4FX0A 1BI0A 3P9KA 2G7HA 1R1UA 2OU2A 1LDKB 4L9JA 1OMIA 1X3UA 3M1EA 1LVAA 3HSEA 2QBYA 3SZPA 1U2WA 4KN4X 4HDUA 3VODA 2GIVA 3R61A 3COAC 5FB2A 3H3ZA 4BHCA 5DUIA 2VE9A 5FGMA 4YFKF 5DD4A 3SZTA 4M6YA 1R58A 3HRTA 1IN8A 1Z05A 1F9NA 3TOAA 4CHUA 4KN7X 2F5FA 3CTAA 2H6CA 4ZYGA 1KYWA 3GO5A 1HKQA 1R5HA 1YFHA 1B59A 4OIRF 2O61A 5BS6A 4RGXA 4CYDA 1Y0UA 1AOYA 2DTRA 1O3RA 2A61A 4ESJA 1TTYA 4HAMA 1XCBA 3Q9VA 3G73A 1OYWA 3RYRA 4Q47A 5LRSA 1YLFA 3E5QA 2E1CA 3OV8A 5D6EA 3I0TA 3QU3A 5IT9K 3F3XA 4LG0B 3KEOA 4MTEA 3IC7A 2KJCA 4LJZF 2X0LA 3U1DA 1ON2A 2VOOA 1HSJA 4M9XA 4AIKA 2WTEA 2MA3A 5CLSA 1I27A 3EUHA 4I98B 1AWCA 3CUQC 2HWVA 4MNUA 3J80K 1BI2A 3GX4X 3BJ6A 3E3VA 3BDDA 2K7LA 4G7HF 2H27A 2PMUA 5KK1A 4HOBA 5LBQA 2ADUA 1P4AA 2ZFWA 2HQRA 1SAXA 2DQRA 3LFKA 1K78B 4IF4A 4HX4A 5LEJA 3C7JA 2R7FA 3R60A 4GO1A 4ZYDA 3G3ZA 2QQ9A 3HOTA 2GAUA 2LF7A 4BQAA 2Z3YA 2KRFA 5L3EA 4EV0A 5H20A 2ZKZA 2CO5A 1T39A 1LNWA 4LK1F 1GHCA 2CYYA 1OKRA 1FYKA 3O3KA 3BJOA 4Y17A 1F4KA 2W25A 3MZYA 1UCRA 2IRFG 2KKOA 2DT5A 4GYGA 2V1UA 2K4BA 4ESFA 4G8XA 1XDUA 5ILSA 4HW0A 4P9FA 3VB2A 4P96A 1U5TB 5D4RA 1HSTA 1DPUA 1NHAA 2FEZA 5L3CA 1VTNC 3K1MA 2XGXA 3RPQA 3HRSA 2FXAA 3T0YA 4M6XA 4EJOA 5TRDA 2XKOA 1LEBA 2LSOA 4LK0F 4L0YB 1P4XA 4I2OA 2CGPA 2M5WA 5A2QZ 4CXFA 3DF8A 1MGTA 4LLGF 4CZZA 1JGSA 2QWWA 4UVCA 1QNTA 1UHWA 3GF2A 2NAZA 1TBXA 2XASA 1S29A 2VC0A 3WTUC 4HF1A 3M8EA 1W7PD 5E1XA 2QYOA 5CYVA 3GFJA 3EQLF 2GZWA 2O3FA 3JTGA 2HOEA 3WTXC 1RIOH 4NB5A 2HTJA 3E6BA 4G9YA 2V9VA 4RGSA 5IT9Z 4HZFA 3E5UA 2VBZA 5HOOA 2L3DA 2FMYA 5LGNA 3FXQA 4OIOF 5DD8A 2OZUA 2ELHA 4PGHA 4RS8A 1BI1A 1IAWA 3SXYA 3J80Z 3MCZA 4EM0B 2EFPA 3TO9A 1ZLJA 4LMYA 1BN5A 1O7LA 4U88A 3HTSB 3HHHA 1XMAA 4XLPF 1SD7A 2FU4A 3P9IA 4KIBA 1LDDA 2BBYA 3D5LA 4DNCA 3AAFA 1R00A 1OYYA 1WRJA 4UVBA 4EQQA 1G3TA 4ZZLA 2HR3A 4ENMA 2P5LC 5L3FA 3WTZA 5HS7A 1FSHA 3KLOA 1KU9A 2WC2A 5L3GA 3GWZA 2PN6A 5FFXA 3S2WA 3QRFF 1Z91A 4YFNF 1TW2A 3LA7A 4UVAA 3ZN0A 4KICA 4BH9A 5LHIA 1H0MA 2J5OA 3QP6A 1TW3A 3IRRA 2UZKA 1Z6TA 5DYMA 5E18F 1G3YA 3K9TA 3F6VA 2DK5A 2G7UA 4GCVA 5ICGA 1FZPB 3GUDA 3ZPLA 1CGPA 3GVAA 1O7FA 3BPVA 2Y75A 2C6YA 3V4GA 3DEUA 1XGNA 4I0AA 1IZ1A 2ZBKA 3TOBA 4I0BA 1J2XA 2FMLA 4KMUX 5E8IA 3DPTA 4L0ZB 1YYVA 1YIOA 3QPHA 4RB1A 2FBKA 3FX3A 2ZO4A 3KEQA 5F6FA 2VE8A 1PP7U 3ZMSA 3CUQB 2ACJA 2RVCA 1D8KA 1HBXG 1U3EM 3L09A 1SD6A 1O57A 2BEOA 2ZCWA 4QLCU 3B02A 4RAYA 2L01A 2R3SA 2E7WA 5DCMB 5AIQA 1W5TA 1D8JA 3FWEA 1JHFA 1J59A 2MBFA 2O0YA 1KQ8A 3ZMVA 3C18A 3CDHA 2ZNZA 2L02A 2DO7A 1L3LA 4NQWA 4B09A 4P55A 5K5RA 5K5QA 3ISPA 4HF0A 1G6NA 2NYXA 1D3YA 2DU9A 1IN7A 4ZYEA 4BYYA 3GFMA 2H09A 3E6MA 4N9HA 3WGGA 1FY7A 2MH9A 3IKVA 2Z5UA 1P92A 1WKMA 4O3MA 3WGHA 1YQAA 1FYLA 3O2PE 1TNSA 5HLIA 1Z1DA 4KA4A 3ZQ7A 2M87A 3HSRA 2PFBA 3SQNA 2IA2A 2IW5A 1K78A 2XAFA 1CF7B 3NQOA 1U78A 1TNTA 2CSOA 2RQPA 1OR7A 3RJPA 3RKWA 4KNYA 3LQRA 3R6SA 1I5ZA 3FXRA 4WX9A 5HLGA 3PQKA 1ZHFA 2A6EF 4EJTA 3L2CA 3CJNA 2LKPA 2QVOA 3GFIA 2ZMEA 1SMYF 1K6OA 2FQ3A 3DQVC 1S7AA 1V4RA 3D0SA 3VFZA 3T1BA 3JAMZ 5E20A 1B1BA 1REPC 4I09A 1HKSA 2XAGA 2PQ8A 4MTDA 4EM2A 1A04A 3ECOA 4M71A 2DW4A 1RNLA 4HDVA 2Q8KA 1LQ1A 2HEOA 2HS5A 1TQPA 2Z33A 1MD0A 3BY6A 4H0EA 1MJAA 2D1VA 4P9UA 1R7JA 2HTSA 2R7DA 4OMZA 4Y15A 1FP1D 2P7VB 3HUGA 2L4AA 3WTSC 4TV7A 2OQGA 1ZREA 1G3SA 2F5EA 2NNNA 2UWMA 5F64A 4A2UA 3ZMUA 2CW0F 3C3WA 3PQJA 4I02A 1ODDA 5ILVA 4ENNA 4Q4ZF 1MDMB 3ROUA 3KP5A 4LLLA 2L4MA 1D5VA 5BMZA 2ZNYA 4O6JA 2IJLA 2LNBA 4ESBA 3FMQA 3IHUA 1O3QA 4RAZA 1XD7A 1FNNA 2W24A 1R5GA 5EEHA 3F8CA 2QQBA 3RYPA 3IL2A 2OA4A 4CDGA 2KJBA 3ULQB 4KFCA 4M9SA 2K86A 2VONA 2YSRA 4L5JA 1FPQA 3QP5A 4FT8A 2MLKA 3J7AO 1W7PB 1XDSA 4MQVA 3T8RA 1IXSB 2A68F 1B9NA 5J8CA 5TJJA 4IPAA 3VOEA 2BV6A 2EFOA 1Z9CA 5JHUA 3BP8A 4U0YA 2W84A 4D0PA 3FXUA 5BPIA 4A6DA 3I4PA 4GXOA 3F8BA 3GZ6A 2HYFA 2GXGA 1GVJA 5D8LB 1BC7C 4RB3C 1RZ4A 3MZHA 3HHGA 3HRMA 5HDGA 1S7OA 1IXCA 1BOAA 2UXXA 2B0LA 3WE3A 2HKXA 5HDNA 4N9IA 1USTA 2DLLA 4GYIA 3KFWX 3E6DA 2FE3A 2COMA 2J5PA 4KYWA 4NHJA 2VT2A 2F5DA 5CVIA 3RKYA 4LD5A 1H9TA 3EYYA 3K2ZA 2P5KA 3O6BB 1HKTA 4UUVA 1BM9A 1LJ9A 2PLYA 3GXOA 1RUNA 2K4JA 4A0ZA 4MEXF 2YU3A 3KCCA 2QBYB 5ERIA 4RB0A 3I5UA 2JT1A 4JBAA 2EV0A 4E70A 5EEGA 1MJ9A 3QAHA 1SMTA 1U8RA 2IA0A 3F6OA 2QENA 4N0BA 1YW7A 3F8MA 2XUBA 2MD5A 4IHSA 4RB2C 4XBFA 4A0XA 2EFQA 2E7XA 2P6SA 1XGOA 2FNPA 2STWA 1W4MA 2DPUA 4PCQA 1FLIA 4BAYA 4YFXF 2M45A 2QM3A 1R1VA 2P6TA 1BC8C 2ETHA 2F5CA 3ECHA 1B4AA 6PAXA 5E8GA 3I59B 3LSTA 1T6SA 4M72A 1G3WA 5JVTA 4EGZA 3M9AA 3FM3A 3JSPA 2HQNA 2XVCA 4G94A 1Z7UA 1FC3A 4XRFA 5HVQC 5E1ZB 5JR3A 3RKXA 5CVJA 1T0FA 2FRHA 2XAHA 5LRRA 3MQ0A 1IRFA 1FWZA 5LGUA 2JRTA 2VBYA 4IRIA 4ZH4F 1R1TA 2JPCA 4PZJA 1IW7F 2ZXJA 1JE8A 4AWXB 2ZJ2A 2CQKA 2V1DA 1DP7P 4WXHA 4A6EA 1XMKA 1IN6A 1UHMA 1KU3A 5HS9A 3VEPA 3GEZA 3K1PA 5FO5A 1T38A 1KQ9A 2A3SA 3FMRA 5DEQA 2NNYA 3HIFA 3JW4A 1YO5C 1KU7A 1S8NA 3OOPA 2UXNA 4HX8A 1T98A 1CF7A 1ZRDA 5ED4A 1QPMA 3NEUA 4WXDA 4WK8F 3HYIA 4HX7A 3F21A 5FLXK 1YW9A 2OZ6A 4ETSA 2W85A 1FBSA 3N97A 1QZYA 1XCVA 1BI3A 4LB5A 1IN5A 2PJPA 1FOKA 3I53A 3JTHA 1ZLKA 1C0WA 4L5IA 1JXSA 4LFUA 3K0LA 3EYIA 3F23A 3R0AA 1ZGAA 5D5WB 3DPLC 2H6BA 4LLNA 2Y48A 1O3TA 2IA1A 4RGUA 4HLXA 4UHTA 3CO6C 5CJ9A 2FNAA 2Y0MA 1PUEE 4OOIA 4YIFA 4JQFA 5L3DA 2PI0A 4MQ9F 3BWGA 3V8KA 2M1BA 3CLOA 2RC4A 2X4HA 1SFEA 1U5TC 2P8TA 2RNJA 4WXCA 1PP8F 3F72A 2P5VA 3TGNA 1O3SA 1FYMA 1TLHB 1YTYA 3W6JB 2RGVA 4LB6B 5HLHA 5IT3A 2PEXA 2EFWA 2CG4A 3NRVA 4XLNF 3I71A 3LA3A 5LEKA 5J8FA 5AIPA 3LA2A 2M30A 2XAJA 5DUKA 4LG0A 1KYZA 2G9WA 5BPDA 4OIPF 2RKHA 1ZRFA 1BIBA 4QWQA 2HZTA 1MZBA 1HW1A 1W7PA 4L9TA 1I6XA 3ELKA 4L9NA 2HGCA 4HQMA 4CO8A 3ABTA 1LEAA 2QQAA 1F1ZA 2EJRA 2JSCA 4MHGA 1HW5A 3IWZA 3WODF 3HRUA 2A69F 1XB4A 1IXRC 4A5MA 4O5VA 1FX7A 4YIIA 4PDKA 1PDNC 4U0WA 3V8LA 2YPRA 3CO7C 5D5VB 2K02A 4YG2F 1V3FA 2XRNA 5ICFA 1BJAA 4G6QA 2V79A
chains in the Genus database with same CATH superfamily
1I39A 2CW8A 2CUEA 2RNGA 4BNCA 1XGSA 2CMPA 4OIQF 3P7NA 4P5OA 3ONQA 1TC3C 3RI4A 3ZN1A 4R79A 2ME0A 3A0BC 2MABA 3K4BA 3RIRA 1VQ4I 4K2EA 4S0HB 4DGWB 3GCMA 3QQAA 4XNFA 4NNJA 1QBJA 2LVSA 2OUMA 4N4NB 1DPRA 1QGPA 2XF5A 5FLXZ 4Q48A 3KP3A 2ME6A 5C3EJ 3NARA 4BDZA 5IOYA 3W2AA 1HQCA 2OAZA 3FBIB 4BE2A 1OCOH 4CCNA 2VC1A 3TP3A 2IVMA 2KIUA 4QIWN 4BXUA 2DODA 1Z67A 1WQ2A 4M3EA 1A31A 5D6FA 2DPDA 3D5SC 5IYDJ 4BHPA 5F1RA 2CS3A 1A36A 2BW3A 4IRGA 4CCKA 2NVYJ 2KIMA 1U5TA 1RETA 1E3HA 4HA8A 5DM6F 5D4SA 3KETA 1YITI 3OS0A 1B9MA 3G1LA 3T5XA 2Y30A 1AHDP 3U2RA 2EB7A 4FETA 3WGIA 2EA2A 1WI9A 3DTKA 1ETVA 2Z1DA 2E1NA 1MBEA 3A4CA 1Q1VA 1IJWC 3R4KA 3MKLA 3JSOA 1W1WE 2L7ZA 2I8DA 4IXAA 1LPQA 3CDIA 2IGOA 1ZAOA 3H92A 2HI3A 2QA4I 2EK5A 4A93J 3G1OA 5BOXA 2HOSA 3O8HA 4JYKA 2O03A 1PYVA 2TDXA 5ILUA 3H36A 2LFBA 5A2QK 2R5YA 5M5YJ 2DBBA 3FM5A 3F8NA 2FOKA 3ZOBA 1EJ9A 3FZVA 1UMQA 2ISZA 2DQLA 2VKHA 3C1DA 2JQ7A 4NBQA 2LMDA 2H94A 1P4WA 3CCVI 2CV0A 1RC9A 3SDBA 2M9HA 1PJRA 2OQRA 3SFZA 1ZG1A 2CH0A 1WJDA 3X2QH 3PSFA 3RTRA 2VODA 5CQEA 4CZCA 3K1NA 3FHNA 3ZMTA 5KAIC 4DOZA 3LSKA 3PFIA 5ICCA 2R0QC 1YRNB 2NRAC 2FSWA 4B48A 2GA2A 2HFHA 1D1AA 2IBDA 4NC8A 4NQWB 2DK8A 1ULYA 3ABLH 3KZYA 1IGNA 4I6ZA 1FMVA 3I59A 5DCFA 3HOYJ 1BA5A 5DV5A 3CCLI 3CQZJ 4BQOA 1WGXA 1XTAA 4XONA 4E7LA 4IZZA 4F93B 3LQQA 1X1PA 2L0KA 4GFBA 3AFHA 3OYKA 1E3PA 2IT0A 2X6XA 3TO7A 5DTDA 3P9CA 5D5XB 4EJWA 3V8JA 3I56I 3CP8A 4ABZA 4PJLA 3W6VA 4DYCA 3PIPF 1I50J 1QHGA 1ZGJA 2NS8A 4EM1A 1ZRCA 3Q9SA 5ICEA 3H5NA 2D1HA 1YJ9I 2X1CA 3QU6A 3CDLA 4I01A 2A07F 1JKOC 1I3AA 2ZC2A 4Y13A 4KIFA 2KDOA 2JSPA 3A1YA 1JGGA 3WE2A 1KA8A 1GVDA 2DT6A 2F2EA 3Q5FA 1Y8QB 9ANTA 4XM3A 2BXYA 4ZZDA 2OD5A 1JKPC 1Q1HA 1JKQC 1RUOA 1J0RA 1XGMA 4ENKA 4DBQA 4M3DA 1IN4A 1X1BA 3CCSI 1ZTRA 2K9NA 4E7ZA 4NC6A 3ZQFA 3CCEI 1JJ8C 2ESNA 2L7KA 2V9KA 1FBQA 1P7IA 1K61A 5JFRA 1WCMJ 1WSUA 2V9PA 3K2AA 2OCCH 3ZMDA 1JUMA 3G4SI 1HDDC 1QVUA 1YW8A 5EGOB 2XIGA 4A12A 2LDUA 2VQLA 3FK7A 3U9GA 4Z2YA 3IKTA 3WTVC 3CJQB 3AKZA 2F5VA 4G6DA 5CVRA 3HJEA 1ORKA 4BY7J 3HL2A 4BL0B 5HDKA 1MMAA 1T0FC 3WU0A 2YR2A 4KUMA 4MGRA 4BJTA 4I7HA 2ZMEB 4L9VA 4HYEA 3W3CA 1QZZA 1OCPA 3OYDA 2VKEA 2EWNA 1QQIA 2FQ4A 3ZQLA 2E36A 1H9GA 3TDUC 1F5TA 1FTZA 4XLFA 1HXDA 1ONVA 2BY0A 2VL8A 4RMNA 1DUXC 4U7BA 3V7CA 3DFGA 2CUZA 3HOWJ 4D7NA 5JHFA 1QA6A 4HQEA 1ON1A 3SFIA 3L9FA 1GV2A 2DA1A 2K9LA 3IWFA 1TQMA 2JUGA 3D1NI 2V4JC 2DJNA 4C2UA 5M3MJ 1QU3A 4XOTA 3TP0A 4MIMA 4ZYHA 3SEQA 3GFLA 4M73A 3QPTA 2W4SA 3A0HC 3K7AJ 1K7AA 3RDIA 1MKMA 3GW2A 1KQ0A 2DXIA 1KONA 5K1YA 4WF2A 2NS0A 2D45A 3LAPA 3BC8A 3VDXA 2XHKA 4YEJA 3MN2A 3W2VA 1G4DA 1DQUA 4FHTA 2HKOA 1UHSA 4AIHA 3BR5A 1EH6A 1YS6A 4KIGA 1DGWY 5HNHA 3HUGB 3V7SA 2R7TA 2VXDA 1MMSA 3VYTB 2VOPA 1TWAJ 3ZMZA 4ON0A 2PMZN 3KE2A 1IRZA 1ETWA 3FHZA 4R8HA 4XKWA 4UXNA 1ZG5A 1SFOJ 1VQ8I 5KAFC 5E3OA 2ZXIA 2RV8A 4ENJA 1QPIA 2DAOA 2K40A 3KYDB 1QO0D 2R7QA 4CICA 3V7RA 2YX4A 3BROA 3WG9A 3HSFA 2Y9ZA 2P7CB 3DKWA 4YELA 3SJMA 5JI6A 4XLHA 2M7AA 2OBPA 1HDPA 3SHFA 4ZTJA 3FXJA 3DV8A 4A5NA 3FF5A 2KZGA 4EJUA 4WCGA 4MEYF 3K10A 4UUTA 2LF8A 2K9MA 3BOQA 4A0YA 5HS8A 4YIRX 4M9ZA 4IQ4A 3ZQIA 1Z77A 2F4IA 1V5EA 3DEWA 1GDTA 3EDPA 1BBYA 4LIUA 3CUQA 4OWRB 1YHQI 5FD5A 2BGCA 3LSJA 5FFZA 1IF1A 2ECCA 1XPXA 4AVPA 3ZP5A 1JT6A 2EV5A 3E5XA 3U1KA 3E7LA 2ELJA 4U7DA 1FSEA 1FP2A 4DIQA 1ENHA 4LGWA 1W5SA 1STZA 1UG2A 3ML6A 1HW2A 2BHZA 2QSFX 5E1WA 5DCMA 5LLQA 2VPLA 2WV0A 1VQKI 1DP3A 4UUSB 3W6KB 3A01A 1R23A 5LD2C 4GDFA 3M8FA 2XDVA 3BZCA 3QYBA 4AD9A 5CVUA 1BOBA 4EVIA 2IP2A 3MFKA 5AONA 4XSXF 4D7MA 2DMQA 2HYGD 1ZG3A 1SD5A 2DI3A 3Q0WA 3KP2A 3DP7A 1D0XA 3FMSA 4MFEA 1WHUA 1JUPA 1WPKA 2F4OB 2M0MA 4XL9A 2EA4A 1VQLI 4FQGA 2K27A 1ZARA 2EBIA 4G12A 4AIJA 2FA5A 4L18B 1MBKA 2YS9A 2Y69H 3H0GJ 2DDAA 3OSFA 1OQYA 1J75A 2R5ZA 4EGYA 1T2KA 1OCZH 2EV6A 3JREA 3H1CA 4UV8A 3HOXJ 3CLQA 3BJAA 1ZYRF 3J81K 4J01A 1XSDA 3CC2I 3S15J 1B6AA 1QVTA 2BVLA 2E5ZA 4U0VA 4F7ZA 3GLXA 2XAQA 2QZ8A 1SVMA 1JHHA 2GOXB 4CH7A 1DU0A 2BVMA 4BBRJ 1SFUA 3CZ6A 3F8FA 3H9JA 4UV9A 2HDCA 1P6RA 2JPBA 1J5YA 1WH7A 2CWEA 2RN7A 3ZR8X 3ERED 4IHTA 1IUFA 3REOA 5EZGA 3TO6A 4H4KC 3CCUI 1L0OC 2JMWA 2ESHA 2GA1A 1K79A 1FBUA 1UZCA 5E17F 3HB9A 2XGDA 3J7ZI 1IUYA 1J7KA 1SVLA 4PGGA 3ASOH 2YU9J 3MAJA 5GP9A 2W48A 3EETA 2RQQA 2KIQA 3WHCA 1T95A 3JRIA 1E17A 2NOGA 4ZYAA 5FRMA 1SC7A 1E2XA 1MJBA 1K83J 1XSXA 2UV1A 4B1RA 3OIPA 4DQ2A 5H6QA 1MH3A 2OC6A 3HTUA 4X6AJ 3MWMA 4AIDA 4A3CJ 3GZ5A 1I1GA 1D0ZA 4IO9F 1IRGA 1T56A 3GYHX 1UG0A 2RDPA 5TGTA 3FIWA 4LG3A 1B8IB 2PMHA 5BQTA 2GQQA 5L3BA 4M74A 2XV4S 2BE5F 2QF7A 2LG4A 1U6GA 3I54A 4EJVA 3RZOJ 3OR2C 1BL0A 2HDDA 5KVRA 2WBMA 2DMNA 4UNOA 3LSPA 2AXLA 2BYVE 2A5YB 3BTJA 4BXFA 3WHBA 1OYIA 3B73A 1V5GA 2DYSH 5J3LA 4FX4A 4CGZA 2O6GE 2JZYA 3JRDA 3S1RJ 3ABUA 1S7EA 2Q2EA 2NXNB 3ZXSA 2FF4A 2KIFA 3LWFA 3KP6A 3BQZA 5CPRB 1YS7A 3HKZA 3JAMK 2VBWA 5JLWA 4KT5C 5FD6A 3K70D 1RPWA 1NG7A 1WWXA 3UNGC 4PK4A 2MH2A 2ZSHB 3F0CA 2YX7A 5LGTA 5EF6A 3CJTB 2PBIA 5D5UB 4X0GA 2WAQA 1ZKGA 3GTLJ 2K85A 3N4MA 1OPCA 2DA3A 2ISYA 2B9SA 1R22A 1LDJA 2P4WA 2FBIA 3FDYA 1TQIA 4P1WA 3KP7A 3BPXA 3F22A 1EH8A 4WWCA 2EZHA 1X1CA 3T8TA 2VT3A 5EYRA 1YG2A 5K5OA 1VQPI 3R0JA 4OMYA 3WU1B 1T8IA 2D2WA 2KL4A 1UB9A 4IVNA 4Y3OA 2LBFB 2GWRA 2LTPA 2KPMA 3U21A 4D5FA 3K4KA 4G7OF 4AU7A 2F48A 1ZH5A 1MW7A 1POGA 2NVUB 3TDZC 2XB0X 4D5CA 2K3FA 2Z9OA 4AYBA 2R92J 4BACA 3Q0VA 2QLZA 2IPQX 2E71A 4RAGA 4HV6A 4PJMA 4Z6YA 2L7FP 1WJ5A 1GXPA 5KHDA 4IQJA 3S1QJ 2R7ZJ 3KP4A 2GM4A 4KMFA 2FBHA 2H8WA 4ASNA 2V6CA 1IC8A 3N05A 4JX5A 3HDDA 4FTHA 1R36A 2CQ7A 2VQGA 3WTTC 2VN2A 1ACIA 1KGSA 1UFMA 3WTWC 5F08A 1XMXA 1MDMA 3IH4A 3E97A 4II3A 4EMSA 2A05A 2A6TA 5FKKA 1DDNA 3HPGA 4MFDA 1GXQA 1EH7A 1XSVA 1XS9A 2MC3A 5LHHA 2A6HF 3K69A 3M7GA 3HOSA 2R7XA 3QOPA 1A6QA 3OL3A 3RZDJ 5D8KB 2MSYA 2Z99A 2DFIA 4JX4A 1ZN2A 4R1HA 4S04A 1Z6RA 2O8XA 2DOAA 1X1DA 2CJJA 2VXZA 3ZQCA 2H1LA 4OINF 3LAJA 2VASA 2Y9YA 4LIVA 2L54A 2DJIA 3TKYA 5FRNA 1Z21A 5H6RA 4HNTA 3TMOA 1BIAA 2CUFA 4KDPA 1S6LA 5EG0B 3E6CC 4UB8C 4CYCA 3H3UA 1AKHB 2QEXI 4IRHA 2JTVA 2W57A 2Y0SN 1J9IA 4XSZF 1UAAA 2AS5F 4RGRA 2E2IJ 3KZZA 3AL0B 2L9SA 2QSGX 3I64A 2JA6J 2HVRA 2BXZA 2QUFA 5DDGA 4U87A 3BTCA 1USSA 3BZ6A 3J81Z 1SEUA 4HV5A 2MG4A 4HBLA 2PG4A 2CFXA 4AYBN 5M5WJ 1H8AC 1KU2A 4QSHA 4Y4RA 1S3JA 4BE0A 3MEXA 1RI7A 2OCEA 3BZKA 4JOMA 4IJAA 3JRCA 2QSHX 3BG7A 4DW6A 4HLYA 1HCRA 2KLOA 4BHBA 3GZNB 2EFNA 2RREA 3TW7A 1SFXA 4A3KJ 1I1SA 1FT9A 3VYUB 3HC7A 3DXJF 2WWYA 2VBXA 2GXBA 3RPUA 3VYRB 3CUOA 1P2FA 3QWLA 4HEA2 5CVVA 1OCCH 2OJED 3LSGA 4GGGA 4M3FA 1JI8A 5IPAA 4MO7A 5J6XA 3DWLE 4OU0A 2BHYA 3WTYC 2UUZA 1BR2A 5K7HA 4XRSA 1R6RA 1QRYA 4N4OB 2MLGA 2XROA 3L00A 4Y7NJ 2CU7A 3L7WA 2V1XA 2LREA 5LHGA 3KPHA 4S05A 4JK1X 2X1DA 2AO9A 4G7ZF 3ZQGA 3OY9A 5IP7J 1X2MA 3TQNA 5J1RA 1RESA 1SANA 4Q5SF 1LB2A 4HF2A 3I58A 4CSWA 3KLNA 2XKPA 1HA8A 1XN7A 5GAGJ 1N75A 2Q0OA 3KYCB 2M8EA 4B8XA 3CD6I 4XKCA 2STTA 3DTIA 4CCJA 1SD4A 1D1CA 1EV7A 3ERMA 3IRQA 4AUXA 3G71I 1B72B 3BLYA 3GTPJ 1HOMA 4FX0A 1BI0A 4XK4A 1V54H 1WJFA 3P9KA 2G7HA 1R1UA 2OU2A 1LDKB 2MD0A 4L9JA 1LFUP 4IHWA 4NUBA 1OMIA 1X3UA 3BR3A 3M1EA 1APLC 1LVAA 5CQGA 1FJLA 3HSEA 2QBYA 3SZPA 1U2WA 4KN4X 3CCRI 4HDUA 1G8XA 2Z16A 4D9JA 3VODA 1U9OA 3I55I 2GIVA 2HDWA 4XR6A 3R61A 3COAC 5FB2A 1VNDA 3H3ZA 4C3HJ 3LFUA 4BHCA 4DYRA 5DUIA 2QQ8A 5C4JJ 2VE9A 1VFCA 1W36C 3HOZJ 3NWTA 3TW6A 5FGMA 4YFKF 1EA3A 5DD4A 3SZTA 4M6YA 5GAEJ 1R58A 3HRTA 1IN8A 1Z05A 1F9NA 3TOAA 2YUSA 4CHUA 1Y56A 4KN7X 2F5FA 1AA7A 2CV1A 3IAS2 3CTAA 1JKRC 2H6CA 4ZYGA 1KYWA 1FOYA 3GO5A 1HKQA 3NWSA 1R5HA 1YFHA 1B59A 1DGRM 3UKGA 4OIRF 2O61A 5BS6A 2VI6A 2DMTA 1SFKA 3CMYA 4RGXA 1MBHA 1YOVB 2LY1A 1HF0A 4CYDA 4KT6A 1Y0UA 1AOYA 1Z7LA 2DTRA 3GTOJ 1N78A 3A03A 1O3RA 2A61A 1SVOA 4ESJA 3S16J 1TTYA 3S14J 1UJ8A 2IS1A 4HAMA 1XCBA 3Q9VA 3OYAA 3G73A 4FE7A 1XC5A 4W1UA 3CCMI 1X3ZB 5FLMJ 3JCUC 4HNVA 1OYWA 3RYRA 5GPAA 3FISA 4Q47A 5HODA 4IHYA 2XSDC 5LRSA 1YLFA 4EATA 3E5QA 1WJCA 2XGCA 4BGDA 1TL8A 2E1CA 2FOWA 1X4OA 2H1KA 3OV8A 5D6EA 3I0TA 3QU3A 1ETXA 3VYSB 3I9V2 5IT9K 4ZDOA 2KRHA 3F3XA 4LG0B 2E34A 3KEOA 4MTEA 3IC7A 2KJCA 2JN6A 4LJZF 2X0LA 3DLLF 3B6AA 1R5ID 3U1DA 5B3SH 1ON2A 1IG7A 2VOOA 5E3NA 1HSJA 2XSJC 4M9XA 1IV8A 4AIKA 2WTEA 2MA3A 5CLSA 2KDZA 1I27A 3EUHA 3PNVA 4I98B 4A69C 3CCYA 1WJBA 1AWCA 4BY1J 3EUKL 3CUQC 2HWVA 2R7OA 1GT0C 4MNUA 3J80K 1BI2A 3GX4X 4E7KA 3BJ6A 4QTRA 3E3VA 2X51A 3BDDA 2K7LA 1YE9A 2XAUA 3DU5A 4G7HF 3H5AA 2H27A 1K6YA 2PMUA 5KK1A 4HOBA 5LBQA 2ADUA 1P4AA 3D5RC 2ZFWA 2HQRA 4BKXA 1SAXA 4XORA 2W7NA 1PUFB 2DQRA 3LFKA 1K78B 4C30A 2PMZA 4RLQA 4IF4A 4HX4A 5LEJA 3S3OA 3C7JA 3QPLA 2R7FA 2DA2A 2IEKA 3J7YJ 1G2HA 3CC4I 3R60A 4GO1A 4ZYDA 1NK3P 3BCAA 2QQ9A 3G3ZA 3HOTA 3TBIA 5FKLA 2HZDA 3S3NA 2XF6A 2GAUA 2LF7A 4BQAA 4UB6C 2Z3YA 2KRFA 1ETOA 3K4NA 3Q3SA 5L3EA 4EV0A 2JA5J 3OYHA 5H20A 2ZKZA 2CO5A 3OS2A 1JTXA 1MNEA 2KRCA 1T39A 1LNWA 4LK1F 1SAUA 2VJ5A 4RLFA 1R4MB 1GHCA 1XX5A 2CYYA 2LY2A 1OKRA 3PSIA 3LOCA 1FYKA 3O3KA 4DZPA 3LL7A 2DT7B 3PFYA 3FKIJ 3BJOA 4Y17A 2GBYA 1F4KA 1ETYA 2W25A 3MZYA 2XC7A 1UCRA 3PNTA 2IRFG 2KKOA 4HSTA 4ZDLA 2DT5A 3CP2A 3ASNH 4GYGA 2V1UA 3RQ4A 2GLOA 2K4BA 4ESFA 4G8XA 1XDUA 3VSKA 2KQRA 5ILSA 2L7MP 3HEFA 2DTZA 4HW0A 4IL6C 4P9FA 1A35A 4F3QA 3VB2A 1V55H 4P96A 1U5TB 1R71A 5D4RA 2LKXA 1R9TJ 3PM1A 1HSTA 1DPUA 1F43A 1NHAA 2FEZA 2V26A 2ID6A 1R49A 3G2BA 5L3CA 1S9HA 1VTNC 3K1MA 2XGXA 3RPQA 3HRSA 4AM3A 3K6GA 2FXAA 3OIQA 3T0YA 4M6XA 1N77A 3OYLA 2WB1N 4EJOA 4I99C 4A3DJ 5TRDA 1A5JA 2IAIA 2XPWA 2XKOA 2X9DA 1Y1WJ 1LEBA 2LSOA 4LK0F 4L0YB 3FXMA 1P4XA 4I2OA 2CGPA 2M5WA 3DF8A 4CXFA 5A2QZ 1MGTA 4LLGF 5GPCA 2WAEA 2R5YB 4CZZA 2N8GA 1JGSA 2QWWA 4UVCA 1FOWA 1VF9A 2FUG2 1QNTA 1UHWA 3BTIA 4HNUA 3L2VA 3GF2A 2NAZA 1TBXA 2XASA 1RR8C 1CQTA 2M7BA 2MC4A 1S29A 2ZJPF 2HU9A 2BY2A 3KYLA 1WFXA 2VC0A 3WTUC 4HF1A 1TWHJ 4PJNA 3M8EA 3MMYB 1W7PD 4XLEA 5E1XA 2QYOA 5CYVA 3H5RA 3GFJA 3EQLF 1IDYA 2GZWA 2EIMH 2O3FA 2PJRA 2VQHA 5J40A 4CCMA 3JTGA 2HOEA 3WTXC 3BG3A 3M3YJ 4BQNA 2PX9A 3FXKA 1RIOH 5K7FA 4NB5A 2HTJA 3E1SA 3E6BA 3IV5A 1VQ9I 3QYFA 2LP0A 4BS9A 3H3VK 2BY1A 5FLVA 4G9YA 2V9VA 2E35A 3SDGA 4RGSA 5IT9Z 4XN3A 4HZFA 3DPUA 3E5UA 2VBZA 2ZB9A 3WU2C 5FJ8J 4HG2A 4E7HA 5HOOA 3BQYA 2L3DA 4HSRA 2FMYA 3BR6A 5LGNA 5TISC 3OYEA 3FXQA 4OIOF 5DD8A 2KFDA 2OZUA 2EZKA 4BEHA 2ELHA 2WADA 4PGHA 4RS8A 4Y33A 1MBJA 1A6IA 1BI1A 1IAWA 3S1NJ 3SXYA 3K4CA 2X6OA 2V7FA 3J80Z 3H35A 2Z2SB 3MCZA 5KNLA 4BE1A 4EM0B 2DMPA 4FASD 2EFPA 3TO9A 1ZLJA 4LMYA 3LSHA 1BN5A 1O7LA 4U88A 3CMEI 3HTSB 3HHHA 1LUJB 1XMAA 4XLPF 4BQQA 4CCLA 1Y8RB 2LR8A 1M1EB 1SD7A 2FU4A 3P9IA 4KIBA 1LDDA 2BBYA 3D5LA 2K9SA 4XRSG 4DNCA 4ZTFA 3AAFA 1LVKA 1R00A 4DYQA 1OYYA 1WRJA 2Y2ZA 4UVBA 4EQQA 2O9LA 1YJNI 4QPQA 1G3TA 4ZZLA 3Q0UA 2HR3A 4ENMA 2P5LC 5J4YA 1ZELA 5L3FA 3WTZA 5HS7A 1FSHA 3KLOA 1KU9A 2WC2A 5L3GA 3GWZA 4B4CA 2PN6A 5FFXA 3S2WA 3QRFF 4DJAA 3C2HA 3MKYB 1RR7A 1Z91A 4YFNF 3DBRB 3CF5F 2XB5A 1TW2A 3LA7A 1S72I 4UVAA 3ZN0A 4KICA 4BH9A 5LHIA 1H0MA 1G59A 3C2BA 2J5OA 3QP6A 1TW3A 2KT0A 4XOPA 1J09A 1MSFC 3IRRA 2JUCA 2UZKA 1Z6TA 1W0TA 5DYMA 5E18F 2JA2A 5FKNA 1G3YA 3K9TA 3L2WA 3F6VA 2DK5A 5IP6A 2QKLB 2QKMB 4JP0A 2G7UA 2OF7A 2V1NA 1Y39A 4GCVA 5ICGA 4C2MJ 1FZPB 3GUDA 1V5FA 3ZPLA 2EIJH 3LNQA 1CGPA 3GVAA 1O7FA 2ICWG 3BPVA 2Y75A 2E1OA 2C6YA 3V4GA 2GOMA 2R7WA 1RKWA 3PO2J 1X3WB 3DEUA 5J1UA 3ZGKA 2HPMA 1XGNA 4I0AA 1IZ1A 2Y0SA 2ZBKA 3TOBA 2VLAA 4I0BA 4ZDPA 1J2XA 2VJIA 2FMLA 4KMUX 5E8IA 1X58A 1LE8B 4IX7A 3DPTA 4L0ZB 1YYVA 2F6CA 1YIOA 3BTLA 3QPHA 4HPQA 4RB1A 2FBKA 2IS2A 3FX3A 2ZO4A 3KEQA 5B5EC 1P7JA 5GTIC 2R7RA 5F6FA 3OYIA 2VE8A 4PFOA 3CESA 1PP7U 2M2EA 3ZMSA 2LY9A 3CUQB 2IS4A 2LH9A 2ACJA 2RVCA 4XRMA 3MKZA 1D8KA 1OCRH 1HBXG 1U3EM 4BXXJ 3L09A 1SD6A 1O57A 2R7SA 1TT0A 3CCJI 3CJRB 2BEOA 4E7SA 2ZCWA 4QLCU 3B02A 4RAYA 4AC0A 2L01A 2R3SA 2E7WA 5DCMB 3RSNA 3A01B 1WJAA 5AIQA 4F91B 1W5TA 1D8JA 1FIAA 3FWEA 1JHFA 5J47A 1J59A 2MBFA 2O0YA 3IP4B 4PSXA 3L1PA 3ZMVA 2E2JJ 1KQ8A 4IOAF 2A5WA 3H0DA 3PUFA 2ZJRF 3C18A 1YRNA 3CDHA 2ZNZA 4ZJZA 2L02A 2MYSA 2DO7A 3GTQJ 1L3LA 4NQWA 4B09A 4P55A 1D5YA 5K5RA 2HPIA 3ISPA 5K5QA 4HF0A 1G6NA 3KEYA 2NYXA 1D3YA 2R5ZB 2DU9A 1IN7A 4ZYEA 4BYYA 3HOVJ 2R4GA 2Y31A 5E3MA 1NH3A 3GFMA 2VJJA 1W36D 1YI2I 2H09A 3S1MJ 2NOJB 3E6MA 4N9HA 3WGGA 5M3FJ 4A3LJ 3OOUA 1FY7A 2MH9A 3IKVA 3NAUA 4FE4A 5F0HA 3L2RA 2E5NA 3LSMA 2Z5UA 1P92A 2BOLA 2EINH 5FKMA 1WKMA 3A02A 4O3MA 3WGHA 1YQAA 2P0WA 1FYLA 2KZVA 4L5EA 3O2PE 1TNSA 4C9YA 1K4SA 3OS1A 5HLIA 3ESWB 3BR0A 1Z1DA 4KA4A 2ECBA 3MKWB 5F1JA 3DBLB 3ZQ7A 2M87A 3HSRA 2PFBA 2DN0A 3SQNA 2IA2A 2IW5A 4E7IA 1H88C 2AXTC 1KZHA 2IGMA 1PUFA 1K78A 2XAFA 1CF7B 3HBLA 3NQOA 1U78A 3S2DJ 1TNTA 2CSOA 3DBHB 2RQPA 1OR7A 2LK2A 5EGOA 1O4XA 2K3PA 3RJPA 3RKWA 4KNYA 3LQRA 3R6SA 5LFAA 3EUHC 5KCMA 1I5ZA 3FXRA 1DU6A 4WX9A 5HLGA 3PQKA 1RKTA 2FJ1A 1ZHFA 2EZIA 2A6EF 4BBSJ 4EJTA 3L2CA 3CJNA 2LKPA 3GTMJ 1P9QC 2BZTA 2ZMEA 2QVOA 4I76A 3GFIA 2L2OA 4A3JJ 1VZ0A 4C2TA 1SMYF 5HLTA 1K6OA 2FQ3A 1MNDA 1YX3A 3DQVC 3UR3C 1S7AA 1V4RA 4B43A 1Z3XA 4B3XA 3D0SA 1S5LC 2HVSA 3VFZA 2CQQA 2VQCA 4LITA 3T1BA 5E20A 1B1BA 3SEZA 3JAMZ 2Q2EB 1REPC 1R4NB 1MMGA 4I09A 1VQNI 2CQXA 1HKSA 2XAGA 3P5JA 4NDLA 2PQ8A 3DEEA 4MTDA 3L2UA 4V19K 1LKXA 2DYRH 4EM2A 3TEDA 1ERDA 4EEFG 3L2QA 2WA0A 3BG6A 2R7UA 1A04A 3ECOA 4M71A 4XKBA 1WZ2A 2OPTA 5BNGA 4CCOA 3TL4X 2DW4A 2K5CA 1RNLA 5JVGF 1MSEC 4HDVA 1GLNA 2Q8KA 3FK6A 1LQ1A 2HS5A 2HEOA 1TQPA 4BU2A 2Z33A 1ZQ3P 1MD0A 4J00A 3BY6A 3AG2H 2X6WA 4H0EA 1MJAA 2D1VA 1LFPA 1YX5A 4V2GA 1ETKA 5GTHC 4P9UA 1JT0A 1Z3YA 2I5UA 2KMUA 1R7JA 2HTSA 2R7DA 4OMZA 3CCQI 4Y15A 1FP1D 2DA4A 2P7VB 2ZXWH 3HUGA 2L4AA 1IRXA 2GXAA 3WTSC 4TV7A 3BG5A 4KJZA 2OQGA 1ZREA 1TWGJ 1G3SA 1T33A 2HXOA 3WG7H 2F5EA 2NNNA 2UWMA 2JVHA 5F64A 4A2UA 4YRVA 1IDZA 3ZMUA 3K4JA 2EZLA 4DBRA 4PJJA 2CW0F 2CRGA 3C3WA 3PQJA 3OYJA 3CF2A 2E19A 4I02A 1FIPA 1ODDA 5E79C 5FROA 5ILVA 3JRHA 2HYJA 4ENNA 4BJ6C 4Q4ZF 1MDMB 5IY5H 2OTLI 3ROUA 2LLKA 4DZJA 3KP5A 5DS9A 3K4LA 4LLLA 3EUAA 3KIOA 2L4MA 3KZIC 1D5VA 5BMZA 3OYNA 2ZNYA 4O6JA 2IJLA 2LNBA 4ESBA 3FMQA 2R7VA 3IHUA 2B7EA 1O3QA 5F04A 2DA6A 3OWTA 1XD7A 1FNNA 4RAZA 2W24A 1R5GA 5EEHA 3F8CA 3BR2A 2QQBA 1VQ5I 3HGYA 3BG9A 1YIJI 3RYPA 3IL2A 1I3QJ 2OA4A 4CUGA 3M07A 4CDGA 1LFBA 2KJBA 3ULQB 4KFCA 5EEAA 1W5CC 1ZK8A 4M9SA 2K86A 1U9NA 2K9QA 2YSRA 2VONA 4L5JA 4CYCB 4UUSA 3S8PA 3GBGA 1FPQA 2DA5A 2CV2A 3QP5A 4FT8A 3JRAA 2HVQA 3LSRA 2MLKA 3J7AO 1W7PB 1XDSA 4MQVA 1YJWI 4KISA 3T8RA 1Y0NA 2W00A 1IV6A 1IXSB 4XIDA 5EDNA 2X6YA 4GRIA 2A68F 1WVRA 5M5XJ 3GTKJ 3BT9A 2TCTA 1B9NA 4C3IJ 5J8CA 5TJJA 2E1MC 4IPAA 3VOEA 3PJRA 2BV6A 4LOCA 2EFOA 1Z9CA 2QCOA 5JHUA 2MFZA 4RBOA 2JWTA 3BP8A 4U0YA 2W84A 4D0PA 3FXUA 3FXOA 2KISA 2HNHA 5BPIA 2XPVA 4A6DA 2XPUA 3I4PA 4XICA 4GXOA 4B44A 4KITB 2E60A 2WB1A 1ITYA 3F8BA 3ZQQA 2HYFA 3GZ6A 2XF7A 2W1OA 2LC2A 1MMNA 2GXGA 1GVJA 2DA7A 5D8LB 3CMMA 1BC7C 2MW8A 4QPOA 1RZ4A 2LYCA 4RB3C 3MZHA 3HHGA 3HRMA 5E3LA 2XRLA 3AG3H 5HDGA 1S7OA 5K7ZA 4E7JA 3EPZA 5IOZA 1FTTA 4A3BJ 1IXCA 1BOAA 2TRTA 3BCBA 2UXXA 2B0LA 4M3GA 3WE3A 2HKXA 1BJZA 5HDNA 4N9IA 1USTA 2DLLA 4GYIA 3KFWX 3RCOA 2VKDA 2FE3A 3E6DA 2COMA 2J5PA 4KYWA 1ZR2A 4NHJA 4ZC3A 1TZLA 3ZQHA 2X48A 2DCEA 3JRBA 1Z0XA 2VT2A 2F5DA 5CVIA 3RKYA 4A3IJ 4LD5A 1H9TA 3EYYA 3K2ZA 4M6VA 2P5KA 1MMDA 3O6BB 4PJ0C 1MH4A 3AL0C 4XMYA 1HKTA 3HGGA 4UUVA 1BM9A 1LJ9A 1B8IA 2PLYA 1PVEA 1EF4A 3GXOA 4B3AA 2CFOA 1RUNA 2K4JA 3RQIA 4A0ZA 4MEXF 4NC7A 5F0CA 3RKQA 2BW3B 2YU3A 3KCCA 2QBYB 4C3JJ 2ID3A 5ERIA 4RB0A 4RM3A 1WJEA 3I5UA 2JT1A 4JBAA 2EV0A 5GADJ 1W0UA 4E70A 5EEGA 1MIJA 1MJ9A 3QAHA 1SMTA 2VB6A 1U8RA 2IA0A 1U0JA 2DFFA 3F6OA 3IH2A 2QENA 4N0BA 4OAYA 1YW7A 5C44J 1HLVA 2EQRA 2VJ4A 3F8MA 3JR9A 4PSWA 4XKVA 2DFHA 2XUBA 2MD5A 4IHSA 4RB2C 2JK3A 1E3OC 4XBFA 1NTCA 2NVTJ 4A0XA 4PFPA 2EFQA 1E0EA 2E7XA 2P6SA 1XGOA 2FNPA 2FX0A 2STWA 1N25A 1W4MA 3BR1A 2DPUA 4PCQA 2JVGA 2LBFA 3G6EI 1FLIA 3VPRA 4BAYA 3S32A 1U8BA 4YFXF 3DLAA 2M45A 2QM3A 1LE8A 2NVQJ 4X1EA 1R1VA 2P6TA 3HM5A 4G6TB 1BC8C 1FOXA 2ETHA 2F5CA 3ECHA 1B4AA 4AVZA 1K4TA 5B1AH 2ELKA 6PAXA 5E8GA 5JLXA 3CC7I 3I59B 1UELB 3DU6A 1Y1VJ 3LSTA 3S17J 1D0YA 4F92B 4RAFA 2HOTA 1T6SA 4M72A 1XG1A 1BR4A 1G3WA 4IKFA 5JVTA 4EGZA 2VUMJ 2WV1A 3GTGJ 1Y6IA 3M9AA 1OISA 2NVXJ 2JJ7A 4IOCF 3FM3A 3RPUD 1WH5A 2HQNA 2XVCA 3JSPA 3IH3A 4A3FJ 4G94A 3GTJJ 2FD5A 1Z7UA 1TT5B 1QZEA 3KX2A 3GLLA 1FC3A 4ANJA 1JUSA 2X1EA 4XRFA 5HVQC 5J4VA 5E1ZB 2LOOA 2GIZA 5JR3A 5F27A 3RKXA 3IAM2 2QGUA 5CVJA 2OTJI 2AQFA 1T0FA 2AHQA 3A2KA 5EG0A 2O7OA 2OV7A 3OYGA 2FRHA 3PO3J 2G0EA 2M4GA 1AKHA 1HC8A 4CA0A 1F36A 2M34A 3ZRGA 3HG9A 2XAHA 3HZJA 5LRRA 3MQ0A 1AU7A 1TP4A 1IRFA 2JA8J 5DM7F 4Y52J 1FWZA 3OL4A 5LGUA 4A3MJ 2JRTA 1WI3A 2DDBA 2VBYA 4IRIA 2HQ5A 4ZH4F 1R1TA 3I4MJ 3S3MA 2RAEA 3MD2A 2JPCA 4PZJA 3O8GA 1IW7F 2ZXJA 1JE8A 3SZGA 1D1BA 2B63J 4AWXB 2ZJ2A 2ZJQF 4FISA 1NK2P 2CQKA 2V1DA 1DP7P 1X19A 4WXHA 4A6EA 4IHXA 1I6HJ 2LKSA 1BR1A 1IN6A 1XMKA 3M8JA 3QPSA 1UHMA 1KU3A 3FKJA 5HS9A 3VEPA 3GEZA 3K1PA 2P81A 5FO5A 1T38A 3W2WA 3I3LA 1KQ9A 2A3SA 3FMRA 5DEQA 2NNYA 3HIFA 3JRFA 3JW4A 1YO5C 5HNFA 1OJLA 1FMWA 1KU7A 4IHVA 1S8NA 3OYBA 3JRGA 3OOPA 2UXNA 4F55A 5GAHJ 4HX8A 1T98A 5J1YA 1CF7A 1VQ7I 1ZRDA 3DTEA 2WY7Q 3DKYA 2WAFA 3G1MA 5ED4A 1QPMA 2AQEA 3NEUA 4WXDA 2JRMA 4IEJA 4WK8F 3HYIA 3S2HJ 3CMAI 2VKVA 4HRIA 4UY8I 1QHHD 4V2FA 4HX7A 1MBFA 1VI0A 5IYBJ 4BJ5C 2HOAA 2CW7A 5B66C 3H9GA 3F21A 5FLXK 1YW9A 3AG1H 2OZ6A 4ITVA 4ETSA 1OLTA 3ZCOA 2W85A 1FBSA 4XQFA 1GV5A 2IGKA 3N97A 3LMMA 1B72A 1QZYA 1XCVA 3OYMA 1BI3A 4BDYA 2KHMA 4LB5A 1IN5A 3HPHA 1OR7C 2F4MB 2IGNA 2PJPA 1FOKA 4A3GJ 3I53A 4RA2A 1OFCX 3JTHA 2ZSIB 2BY3A 4JX6A 4MLOA 2I10A 2M4KA 1ZLKA 3MVPA 3M4OJ 3VSLA 4A3EJ 2DOFA 2ZMEC 2LD5A 3E0JB 1C0WA 1ZGWA 4L5IA 2EILH 1JXSA 2IS6A 2W82A 4LFUA 3K0LA 3EYIA 1OCTC 5F0FA 3K4MA 1JTYA 4J19A 2M8GX 3C2GA 3F23A 1T08B 3R0AA 1ZGAA 3QYEA 5D5WB 3DPLC 2H6BA 4E4HA 3QOEA 2VPRA 2HQAA 4LLNA 3OYCA 3VWBA 2Y48A 2L9NA 1O3TA 3GMEA 2D5VA 2EPFA 2HXIA 3PNYA 1VQ6I 2E2HJ 2IA1A 2IXSA 4RGUA 2JA7J 2R93J 5IYCJ 4HLXA 4FCYA 4UHTA 3CO6C 5CJ9A 2FNAA 2Y0MA 1PUEE 2E1MB 5H2FC 4OOIA 4PUSA 3H9QA 4YIFA 3OIOA 4JQFA 5L3DA 1FEXA 2O5RA 2PI0A 4MQ9F 4M3BA 2PJRB 2NS7A 2DMUA 5B1BH 2L5QA 3BWGA 3SYTA 2DOEA 3PL8A 3V8KA 2M1BA 3CLOA 2RC4A 1X2NA 2X4HA 1SFEA 3OYFA 1U5TC 1BW6A 2P8TA 2RNJA 4WXCA 3S93A 1IO2A 3F72A 2P5VA 1PP8F 2V6EA 4XN0A 2EIKH 3HXLA 3TGNA 1TWCJ 1O3SA 1FYMA 1TLHB 1YTYA 4E6KG 3W6JB 4BUPA 3HKZN 4XLAA 2RGVA 4LB6B 5HLHA 5IT3A 2CQNA 2PEXA 2KP6A 2EFWA 2CG4A 1X4PA 3NRVA 3QODA 3I71A 3LA3A 4XLNF 3FXLA 5LEKA 1NG6A 4BEHB 3HOUJ 5J8FA 3AG4H 2MGQA 2Q1ZB 5AIPA 2WAQN 2L9VA 3LA2A 2M30A 4RDUA 2XAJA 5DUKA 4LG0A 1KYZA 4W97A 2G9WA 3FBNB 5BPDA 2M0CA 4II2A 4OIPF 1JJ6C 2ZXHA 5C4XJ 2RKHA 1ZRFA 1BIBA 2VIXA 3B6CA 3K70C 2DFEA 4QWQA 1TWFJ 3J7AY 2COBA 2HZTA 3PIOF 3ABKH 2X85A 4OAZA 1MZBA 1BW5A 1VQMI 2ZFUA 1HW1A 1W7PA 3OMYA 4L9TA 5EJCA 4F52A 4D1QA 3F9KA 3IUOA 4XLCA 3LSIA 1I6XA 1H89C 1VQOI 3ELKA 1ETQA 1MBGA 2WY8Q 4L9NA 5CKTA 2HGCA 4HQMA 1RRJA 4CO8A 2L9RA 3ABTA 1LEAA 1EKEA 1MNMC 3MZ8A 3ABMH 2QQAA 1F1ZA 2CUJA 2O8KA 3V42A 2XGEA 4RM2A 3OR1C 2EH3A 2EJRA 2JSCA 2LRDA 4MHGA 2H8RA 3I4NJ 1HW5A 3DKXA 1GUUA 3IWZA 1ZR4A 5EZHA 3WODF 3HRUA 2A69F 1XB4A 1IXRC 3OSGA 4A5MA 5FKOA 1X1AA 3M1CA 3PUBA 4B47A 4O5VA 1FX7A 4YIIA 5IP9J 4PDKA 1PDNC 4U0WA 3V8LA 2YPRA 3DCFA 5D5VB 2K02A 2XRNA 1V3FA 4YG2F 3CO7C 5ICFA 1BJAA 4G6QA 2V79A 2M3AA
chains in the Genus database with same CATH topology
4BNCA 1XGSA 4OIQF 3P7NA 4P5OA 3RI4A 3ZN1A 4R79A 3RIRA 4K2EA 1QBJA 1DPRA 1QGPA 5FLXZ 4Q48A 3KP3A 1HQCA 2OAZA 2VC1A 2IVMA 2KIUA 4BXUA 1WQ2A 5D6FA 2DPDA 4BHPA 5F1RA 4IRGA 2KIMA 1U5TA 4HA8A 5D4SA 3KETA 1B9MA 3T5XA 3U2RA 2EB7A 3WGIA 2EA2A 1WI9A 2E1NA 3R4KA 3JSOA 4IXAA 1ZAOA 3H92A 2EK5A 5BOXA 2O03A 5ILUA 2TDXA 5A2QK 2DBBA 3FM5A 3F8NA 2FOKA 3FZVA 2ISZA 2DQLA 3C1DA 2H94A 1P4WA 3SFZA 2OQRA 1ZG1A 3RTRA 2VODA 3K1NA 3ZMTA 2NRAC 5ICCA 3PFIA 2FSWA 2GA2A 2HFHA 2DK8A 1ULYA 3KZYA 3I59A 5DCFA 5DV5A 3LQQA 2IT0A 3TO7A 3P9CA 5D5XB 4EJWA 3V8JA 4EM1A 1ZGJA 1ZRCA 3Q9SA 5ICEA 2D1HA 3QU6A 4I01A 2A07F 4Y13A 4KIFA 3WE2A 1KA8A 2F2EA 3Q5FA 4ZZDA 2OD5A 1Q1HA 1RUOA 1J0RA 1XGMA 4ENKA 1IN4A 2ESNA 1FBQA 5JFRA 1WSUA 3ZMDA 1YW8A 2XIGA 4A12A 2LDUA 3U9GA 4Z2YA 3IKTA 3WTVC 4G6DA 5CVRA 5HDKA 3WU0A 2YR2A 4KUMA 4MGRA 4I7HA 2ZMEB 4L9VA 4HYEA 1QZZA 2EWNA 1QQIA 3TDUC 1H9GA 1F5TA 1HXDA 1ONVA 1DUXC 4U7BA 3V7CA 3DFGA 4HQEA 1ON1A 3L9FA 3IWFA 1TQMA 4ZYHA 3GFLA 4M73A 3QPTA 1K7AA 3RDIA 1MKMA 3GW2A 1KQ0A 5K1YA 4WF2A 2NS0A 2D45A 3LAPA 2XHKA 1G4DA 4FHTA 2HKOA 4AIHA 1EH6A 1YS6A 4KIGA 3V7SA 2VOPA 3ZMZA 4ON0A 3KE2A 3FHZA 4R8HA 4UXNA 1ZG5A 2RV8A 4ENJA 2DAOA 1QO0D 4CICA 3V7RA 2YX4A 3BROA 3WG9A 3HSFA 2P7CB 3DKWA 5JI6A 3SHFA 2OBPA 3DV8A 4A5NA 3FF5A 4EJUA 4WCGA 4MEYF 4A0YA 2LF8A 3BOQA 5HS8A 4M9ZA 3EDPA 1BBYA 3CUQA 5FD5A 2BGCA 5FFZA 1IF1A 4AVPA 3ZP5A 2EV5A 3E5XA 4U7DA 1FSEA 1FP2A 4LGWA 1W5SA 1STZA 3ML6A 1HW2A 5E1WA 5DCMA 5LLQA 2WV0A 3W6KB 1R23A 3M8FA 4EVIA 4AD9A 5CVUA 2IP2A 3MFKA 5AONA 4XSXF 2HYGD 1ZG3A 1SD5A 2DI3A 3KP2A 3DP7A 3FMSA 2EA4A 2K27A 1ZARA 4AIJA 2FA5A 4L18B 1J75A 4EGYA 1T2KA 2EV6A 4UV8A 3BJAA 1XSDA 1ZYRF 3J81K 1B6AA 4U0VA 4F7ZA 3GLXA 2XAQA 2QZ8A 1JHHA 1SFUA 3F8FA 4UV9A 2HDCA 1P6RA 2JPBA 1J5YA 2CWEA 2RN7A 3ERED 4IHTA 3REOA 3TO6A 1L0OC 2ESHA 2GA1A 1K79A 1FBUA 5E17F 1IUYA 1J7KA 4PGGA 3MAJA 3EETA 1E17A 1E2XA 1MJBA 1XSXA 4DQ2A 5H6QA 3HTUA 3MWMA 3GZ5A 1I1GA 1IRGA 3GYHX 2RDPA 2PMHA 5BQTA 2GQQA 5L3BA 4M74A 2XV4S 2BE5F 1U6GA 3I54A 4EJVA 5KVRA 4UNOA 2AXLA 2BYVE 2A5YB 1OYIA 3B73A 4CGZA 4FX4A 2O6GE 2JZYA 3ABUA 2Q2EA 2FF4A 2KIFA 3JAMK 3KP6A 3LWFA 1YS7A 2VBWA 4KT5C 5FD6A 1WWXA 2MH2A 5LGTA 2YX7A 2PBIA 5D5UB 3N4MA 1OPCA 2ISYA 1R22A 1LDJA 2P4WA 2FBIA 1TQIA 3KP7A 3BPXA 3F22A 1EH8A 4WWCA 3T8TA 2VT3A 1YG2A 5K5OA 3R0JA 4OMYA 3WU1B 2D2WA 1UB9A 4IVNA 2GWRA 4G7OF 1ZH5A 3TDZC 2Z9OA 2QLZA 2IPQX 4HV6A 1GXPA 3KP4A 4KMFA 2FBHA 4ASNA 2V6CA 1R36A 3WTTC 2VN2A 1KGSA 1UFMA 3WTWC 1MDMA 3E97A 4EMSA 1DDNA 1GXQA 1EH7A 1XSVA 2MC3A 5LHHA 2A6HF 3K69A 3M7GA 3HOSA 3QOPA 5D8KB 2Z99A 2DFIA 4S04A 1ZN2A 4R1HA 1Z6RA 2O8XA 2VXZA 4OINF 3LAJA 2L54A 3TKYA 5H6RA 1BIAA 4KDPA 1S6LA 3E6CC 3H3UA 4IRHA 2JTVA 2W57A 1J9IA 4XSZF 2AS5F 4RGRA 3KZZA 3I64A 2QUFA 5DDGA 1USSA 3BZ6A 3J81Z 4HV5A 4HBLA 2PG4A 2CFXA 1KU2A 1S3JA 3MEXA 1RI7A 4IJAA 4HLYA 4BHBA 2EFNA 1SFXA 1I1SA 1FT9A 3DXJF 2WWYA 2VBXA 2GXBA 3RPUA 3CUOA 1P2FA 5CVVA 4GGGA 5J6XA 4OU0A 3WTYC 2MLGA 2XROA 3L00A 3L7WA 2V1XA 5LHGA 4S05A 4JK1X 4G7ZF 3TQNA 4Q5SF 1LB2A 4HF2A 3I58A 3KLNA 2XKPA 1XN7A 2Q0OA 2M8EA 4B8XA 2STTA 1SD4A 1EV7A 3IRQA 4FX0A 1BI0A 3P9KA 2G7HA 1R1UA 2OU2A 1LDKB 4L9JA 1OMIA 1X3UA 3M1EA 1LVAA 3HSEA 2QBYA 3SZPA 1U2WA 4KN4X 4HDUA 3VODA 2GIVA 3R61A 3COAC 5FB2A 3H3ZA 4BHCA 5DUIA 2VE9A 5FGMA 4YFKF 5DD4A 3SZTA 4M6YA 1R58A 3HRTA 1IN8A 1Z05A 1F9NA 3TOAA 4CHUA 4KN7X 2F5FA 3CTAA 2H6CA 4ZYGA 1KYWA 3GO5A 1HKQA 1R5HA 1YFHA 1B59A 4OIRF 2O61A 5BS6A 4RGXA 4CYDA 1Y0UA 1AOYA 2DTRA 1O3RA 2A61A 4ESJA 1TTYA 4HAMA 1XCBA 3Q9VA 3G73A 1OYWA 3RYRA 4Q47A 5LRSA 1YLFA 3E5QA 2E1CA 3OV8A 5D6EA 3I0TA 3QU3A 5IT9K 3F3XA 4LG0B 3KEOA 4MTEA 3IC7A 2KJCA 4LJZF 2X0LA 3U1DA 1ON2A 2VOOA 1HSJA 4M9XA 4AIKA 2WTEA 2MA3A 5CLSA 1I27A 3EUHA 4I98B 1AWCA 3CUQC 2HWVA 4MNUA 3J80K 1BI2A 3GX4X 3BJ6A 3E3VA 3BDDA 2K7LA 4G7HF 2H27A 2PMUA 5KK1A 4HOBA 5LBQA 2ADUA 1P4AA 2ZFWA 2HQRA 1SAXA 2DQRA 3LFKA 1K78B 4IF4A 4HX4A 5LEJA 3C7JA 2R7FA 3R60A 4GO1A 4ZYDA 3G3ZA 2QQ9A 3HOTA 2GAUA 2LF7A 4BQAA 2Z3YA 2KRFA 5L3EA 4EV0A 5H20A 2ZKZA 2CO5A 1T39A 1LNWA 4LK1F 1GHCA 2CYYA 1OKRA 1FYKA 3O3KA 3BJOA 4Y17A 1F4KA 2W25A 3MZYA 1UCRA 2IRFG 2KKOA 2DT5A 4GYGA 2V1UA 2K4BA 4ESFA 4G8XA 1XDUA 5ILSA 4HW0A 4P9FA 3VB2A 4P96A 1U5TB 5D4RA 1HSTA 1DPUA 1NHAA 2FEZA 5L3CA 1VTNC 3K1MA 2XGXA 3RPQA 3HRSA 2FXAA 3T0YA 4M6XA 4EJOA 5TRDA 2XKOA 1LEBA 2LSOA 4LK0F 4L0YB 1P4XA 4I2OA 2CGPA 2M5WA 5A2QZ 4CXFA 3DF8A 1MGTA 4LLGF 4CZZA 1JGSA 2QWWA 4UVCA 1QNTA 1UHWA 3GF2A 2NAZA 1TBXA 2XASA 1S29A 2VC0A 3WTUC 4HF1A 3M8EA 1W7PD 5E1XA 2QYOA 5CYVA 3GFJA 3EQLF 2GZWA 2O3FA 3JTGA 2HOEA 3WTXC 1RIOH 4NB5A 2HTJA 3E6BA 4G9YA 2V9VA 4RGSA 5IT9Z 4HZFA 3E5UA 2VBZA 5HOOA 2L3DA 2FMYA 5LGNA 3FXQA 4OIOF 5DD8A 2OZUA 2ELHA 4PGHA 4RS8A 1BI1A 1IAWA 3SXYA 3J80Z 3MCZA 4EM0B 2EFPA 3TO9A 1ZLJA 4LMYA 1BN5A 1O7LA 4U88A 3HTSB 3HHHA 1XMAA 4XLPF 1SD7A 2FU4A 3P9IA 4KIBA 1LDDA 2BBYA 3D5LA 4DNCA 3AAFA 1R00A 1OYYA 1WRJA 4UVBA 4EQQA 1G3TA 4ZZLA 2HR3A 4ENMA 2P5LC 5L3FA 3WTZA 5HS7A 1FSHA 3KLOA 1KU9A 2WC2A 5L3GA 3GWZA 2PN6A 5FFXA 3S2WA 3QRFF 1Z91A 4YFNF 1TW2A 3LA7A 4UVAA 3ZN0A 4KICA 4BH9A 5LHIA 1H0MA 2J5OA 3QP6A 1TW3A 3IRRA 2UZKA 1Z6TA 5DYMA 5E18F 1G3YA 3K9TA 3F6VA 2DK5A 2G7UA 4GCVA 5ICGA 1FZPB 3GUDA 3ZPLA 1CGPA 3GVAA 1O7FA 3BPVA 2Y75A 2C6YA 3V4GA 3DEUA 1XGNA 4I0AA 1IZ1A 2ZBKA 3TOBA 4I0BA 1J2XA 2FMLA 4KMUX 5E8IA 3DPTA 4L0ZB 1YYVA 1YIOA 3QPHA 4RB1A 2FBKA 3FX3A 2ZO4A 3KEQA 5F6FA 2VE8A 1PP7U 3ZMSA 3CUQB 2ACJA 2RVCA 1D8KA 1HBXG 1U3EM 3L09A 1SD6A 1O57A 2BEOA 2ZCWA 4QLCU 3B02A 4RAYA 2L01A 2R3SA 2E7WA 5DCMB 5AIQA 1W5TA 1D8JA 3FWEA 1JHFA 1J59A 2MBFA 2O0YA 1KQ8A 3ZMVA 3C18A 3CDHA 2ZNZA 2L02A 2DO7A 1L3LA 4NQWA 4B09A 4P55A 5K5RA 5K5QA 3ISPA 4HF0A 1G6NA 2NYXA 1D3YA 2DU9A 1IN7A 4ZYEA 4BYYA 3GFMA 2H09A 3E6MA 4N9HA 3WGGA 1FY7A 2MH9A 3IKVA 2Z5UA 1P92A 1WKMA 4O3MA 3WGHA 1YQAA 1FYLA 3O2PE 1TNSA 5HLIA 1Z1DA 4KA4A 3ZQ7A 2M87A 3HSRA 2PFBA 3SQNA 2IA2A 2IW5A 1K78A 2XAFA 1CF7B 3NQOA 1U78A 1TNTA 2CSOA 2RQPA 1OR7A 3RJPA 3RKWA 4KNYA 3LQRA 3R6SA 1I5ZA 3FXRA 4WX9A 5HLGA 3PQKA 1ZHFA 2A6EF 4EJTA 3L2CA 3CJNA 2LKPA 2QVOA 3GFIA 2ZMEA 1SMYF 1K6OA 2FQ3A 3DQVC 1S7AA 1V4RA 3D0SA 3VFZA 3T1BA 3JAMZ 5E20A 1B1BA 1REPC 4I09A 1HKSA 2XAGA 2PQ8A 4MTDA 4EM2A 1A04A 3ECOA 4M71A 2DW4A 1RNLA 4HDVA 2Q8KA 1LQ1A 2HEOA 2HS5A 1TQPA 2Z33A 1MD0A 3BY6A 4H0EA 1MJAA 2D1VA 4P9UA 1R7JA 2HTSA 2R7DA 4OMZA 4Y15A 1FP1D 2P7VB 3HUGA 2L4AA 3WTSC 4TV7A 2OQGA 1ZREA 1G3SA 2F5EA 2NNNA 2UWMA 5F64A 4A2UA 3ZMUA 2CW0F 3C3WA 3PQJA 4I02A 1ODDA 5ILVA 4ENNA 4Q4ZF 1MDMB 3ROUA 3KP5A 4LLLA 2L4MA 1D5VA 5BMZA 2ZNYA 4O6JA 2IJLA 2LNBA 4ESBA 3FMQA 3IHUA 1O3QA 4RAZA 1XD7A 1FNNA 2W24A 1R5GA 5EEHA 3F8CA 2QQBA 3RYPA 3IL2A 2OA4A 4CDGA 2KJBA 3ULQB 4KFCA 4M9SA 2K86A 2VONA 2YSRA 4L5JA 1FPQA 3QP5A 4FT8A 2MLKA 3J7AO 1W7PB 1XDSA 4MQVA 3T8RA 1IXSB 2A68F 1B9NA 5J8CA 5TJJA 4IPAA 3VOEA 2BV6A 2EFOA 1Z9CA 5JHUA 3BP8A 4U0YA 2W84A 4D0PA 3FXUA 5BPIA 4A6DA 3I4PA 4GXOA 3F8BA 3GZ6A 2HYFA 2GXGA 1GVJA 5D8LB 1BC7C 4RB3C 1RZ4A 3MZHA 3HHGA 3HRMA 5HDGA 1S7OA 1IXCA 1BOAA 2UXXA 2B0LA 3WE3A 2HKXA 5HDNA 4N9IA 1USTA 2DLLA 4GYIA 3KFWX 3E6DA 2FE3A 2COMA 2J5PA 4KYWA 4NHJA 2VT2A 2F5DA 5CVIA 3RKYA 4LD5A 1H9TA 3EYYA 3K2ZA 2P5KA 3O6BB 1HKTA 4UUVA 1BM9A 1LJ9A 2PLYA 3GXOA 1RUNA 2K4JA 4A0ZA 4MEXF 2YU3A 3KCCA 2QBYB 5ERIA 4RB0A 3I5UA 2JT1A 4JBAA 2EV0A 4E70A 5EEGA 1MJ9A 3QAHA 1SMTA 1U8RA 2IA0A 3F6OA 2QENA 4N0BA 1YW7A 3F8MA 2XUBA 2MD5A 4IHSA 4RB2C 4XBFA 4A0XA 2EFQA 2E7XA 2P6SA 1XGOA 2FNPA 2STWA 1W4MA 2DPUA 4PCQA 1FLIA 4BAYA 4YFXF 2M45A 2QM3A 1R1VA 2P6TA 1BC8C 2ETHA 2F5CA 3ECHA 1B4AA 6PAXA 5E8GA 3I59B 3LSTA 1T6SA 4M72A 1G3WA 5JVTA 4EGZA 3M9AA 3FM3A 3JSPA 2HQNA 2XVCA 4G94A 1Z7UA 1FC3A 4XRFA 5HVQC 5E1ZB 5JR3A 3RKXA 5CVJA 1T0FA 2FRHA 2XAHA 5LRRA 3MQ0A 1IRFA 1FWZA 5LGUA 2JRTA 2VBYA 4IRIA 4ZH4F 1R1TA 2JPCA 4PZJA 1IW7F 2ZXJA 1JE8A 4AWXB 2ZJ2A 2CQKA 2V1DA 1DP7P 4WXHA 4A6EA 1XMKA 1IN6A 1UHMA 1KU3A 5HS9A 3VEPA 3GEZA 3K1PA 5FO5A 1T38A 1KQ9A 2A3SA 3FMRA 5DEQA 2NNYA 3HIFA 3JW4A 1YO5C 1KU7A 1S8NA 3OOPA 2UXNA 4HX8A 1T98A 1CF7A 1ZRDA 5ED4A 1QPMA 3NEUA 4WXDA 4WK8F 3HYIA 4HX7A 3F21A 5FLXK 1YW9A 2OZ6A 4ETSA 2W85A 1FBSA 3N97A 1QZYA 1XCVA 1BI3A 4LB5A 1IN5A 2PJPA 1FOKA 3I53A 3JTHA 1ZLKA 1C0WA 4L5IA 1JXSA 4LFUA 3K0LA 3EYIA 3F23A 3R0AA 1ZGAA 5D5WB 3DPLC 2H6BA 4LLNA 2Y48A 1O3TA 2IA1A 4RGUA 4HLXA 4UHTA 3CO6C 5CJ9A 2FNAA 2Y0MA 1PUEE 4OOIA 4YIFA 4JQFA 5L3DA 2PI0A 4MQ9F 3BWGA 3V8KA 2M1BA 3CLOA 2RC4A 2X4HA 1SFEA 1U5TC 2P8TA 2RNJA 4WXCA 1PP8F 3F72A 2P5VA 3TGNA 1O3SA 1FYMA 1TLHB 1YTYA 3W6JB 2RGVA 4LB6B 5HLHA 5IT3A 2PEXA 2EFWA 2CG4A 3NRVA 4XLNF 3I71A 3LA3A 5LEKA 5J8FA 5AIPA 3LA2A 2M30A 2XAJA 5DUKA 4LG0A 1KYZA 2G9WA 5BPDA 4OIPF 2RKHA 1ZRFA 1BIBA 4QWQA 2HZTA 1MZBA 1HW1A 1W7PA 4L9TA 1I6XA 3ELKA 4L9NA 2HGCA 4HQMA 4CO8A 3ABTA 1LEAA 2QQAA 1F1ZA 2EJRA 2JSCA 4MHGA 1HW5A 3IWZA 3WODF 3HRUA 2A69F 1XB4A 1IXRC 4A5MA 4O5VA 1FX7A 4YIIA 4PDKA 1PDNC 4U0WA 3V8LA 2YPRA 3CO7C 5D5VB 2K02A 4YG2F 1V3FA 2XRNA 5ICFA 1BJAA 4G6QA 2V79A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4BNC A;  1XGS A;  4OIQ F;  3P7N A;  4P5O A;  3RI4 A;  3ZN1 A;  4R79 A;  3RIR A;  4K2E A;  1QBJ A;  1DPR A;  1QGP A;  5FLX Z;  4Q48 A;  3KP3 A;  1HQC A;  2OAZ A;  2VC1 A;  2IVM A;  2KIU A;  4BXU A;  1WQ2 A;  5D6F A;  2DPD A;  4BHP A;  5F1R A;  4IRG A;  2KIM A;  1U5T A;  4HA8 A;  5D4S A;  3KET A;  1B9M A;  3T5X A;  3U2R A;  2EB7 A;  3WGI A;  2EA2 A;  1WI9 A;  2E1N A;  3R4K A;  3JSO A;  4IXA A;  1ZAO A;  3H92 A;  2EK5 A;  5BOX A;  2O03 A;  5ILU A;  2TDX A;  5A2Q K;  2DBB A;  3FM5 A;  3F8N A;  2FOK A;  3FZV A;  2ISZ A;  2DQL A;  3C1D A;  2H94 A;  1P4W A;  3SFZ A;  2OQR A;  1ZG1 A;  3RTR A;  2VOD A;  3K1N A;  3ZMT A;  2NRA C;  5ICC A;  3PFI A;  2FSW A;  2GA2 A;  2HFH A;  2DK8 A;  1ULY A;  3KZY A;  3I59 A;  5DCF A;  5DV5 A;  3LQQ A;  2IT0 A;  3TO7 A;  3P9C A;  5D5X B;  4EJW A;  3V8J A;  4EM1 A;  1ZGJ A;  1ZRC A;  3Q9S A;  5ICE A;  2D1H A;  3QU6 A;  4I01 A;  2A07 F;  4Y13 A;  4KIF A;  3WE2 A;  1KA8 A;  2F2E A;  3Q5F A;  4ZZD A;  2OD5 A;  1Q1H A;  1RUO A;  1J0R A;  1XGM A;  4ENK A;  1IN4 A;  2ESN A;  1FBQ A;  5JFR A;  1WSU A;  3ZMD A;  1YW8 A;  2XIG A;  4A12 A;  2LDU A;  3U9G A;  4Z2Y A;  3IKT A;  3WTV C;  4G6D A;  5CVR A;  5HDK A;  3WU0 A;  2YR2 A;  4KUM A;  4MGR A;  4I7H A;  2ZME B;  4L9V A;  4HYE A;  1QZZ A;  2EWN A;  1QQI A;  3TDU C;  1H9G A;  1F5T A;  1HXD A;  1ONV A;  1DUX C;  4U7B A;  3V7C A;  3DFG A;  4HQE A;  1ON1 A;  3L9F A;  3IWF A;  1TQM A;  4ZYH A;  3GFL A;  4M73 A;  3QPT A;  1K7A A;  3RDI A;  1MKM A;  3GW2 A;  1KQ0 A;  5K1Y A;  4WF2 A;  2NS0 A;  2D45 A;  3LAP A;  2XHK A;  1G4D A;  4FHT A;  2HKO A;  4AIH A;  1EH6 A;  1YS6 A;  4KIG A;  3V7S A;  2VOP A;  3ZMZ A;  4ON0 A;  3KE2 A;  3FHZ A;  4R8H A;  4UXN A;  1ZG5 A;  2RV8 A;  4ENJ A;  2DAO A;  1QO0 D;  4CIC A;  3V7R A;  2YX4 A;  3BRO A;  3WG9 A;  3HSF A;  2P7C B;  3DKW A;  5JI6 A;  3SHF A;  2OBP A;  3DV8 A;  4A5N A;  3FF5 A;  4EJU A;  4WCG A;  4MEY F;  4A0Y A;  2LF8 A;  3BOQ A;  5HS8 A;  4M9Z A;  3EDP A;  1BBY A;  3CUQ A;  5FD5 A;  2BGC A;  5FFZ A;  1IF1 A;  4AVP A;  3ZP5 A;  2EV5 A;  3E5X A;  4U7D A;  1FSE A;  1FP2 A;  4LGW A;  1W5S A;  1STZ A;  3ML6 A;  1HW2 A;  5E1W A;  5DCM A;  5LLQ A;  2WV0 A;  3W6K B;  1R23 A;  3M8F A;  4EVI A;  4AD9 A;  5CVU A;  2IP2 A;  3MFK A;  5AON A;  4XSX F;  2HYG D;  1ZG3 A;  1SD5 A;  2DI3 A;  3KP2 A;  3DP7 A;  3FMS A;  2EA4 A;  2K27 A;  1ZAR A;  4AIJ A;  2FA5 A;  4L18 B;  1J75 A;  4EGY A;  1T2K A;  2EV6 A;  4UV8 A;  3BJA A;  1XSD A;  1ZYR F;  3J81 K;  1B6A A;  4U0V A;  4F7Z A;  3GLX A;  2XAQ A;  2QZ8 A;  1JHH A;  1SFU A;  3F8F A;  4UV9 A;  2HDC A;  1P6R A;  2JPB A;  1J5Y A;  2CWE A;  2RN7 A;  3ERE D;  4IHT A;  3REO A;  3TO6 A;  1L0O C;  2ESH A;  2GA1 A;  1K79 A;  1FBU A;  5E17 F;  1IUY A;  1J7K A;  4PGG A;  3MAJ A;  3EET A;  1E17 A;  1E2X A;  1MJB A;  1XSX A;  4DQ2 A;  5H6Q A;  3HTU A;  3MWM A;  3GZ5 A;  1I1G A;  1IRG A;  3GYH X;  2RDP A;  2PMH A;  5BQT A;  2GQQ A;  5L3B A;  4M74 A;  2XV4 S;  2BE5 F;  1U6G A;  3I54 A;  4EJV A;  5KVR A;  4UNO A;  2AXL A;  2BYV E;  2A5Y B;  1OYI A;  3B73 A;  4CGZ A;  4FX4 A;  2O6G E;  2JZY A;  3ABU A;  2Q2E A;  2FF4 A;  2KIF A;  3JAM K;  3KP6 A;  3LWF A;  1YS7 A;  2VBW A;  4KT5 C;  5FD6 A;  1WWX A;  2MH2 A;  5LGT A;  2YX7 A;  2PBI A;  5D5U B;  3N4M A;  1OPC A;  2ISY A;  1R22 A;  1LDJ A;  2P4W A;  2FBI A;  1TQI A;  3KP7 A;  3BPX A;  3F22 A;  1EH8 A;  4WWC A;  3T8T A;  2VT3 A;  1YG2 A;  5K5O A;  3R0J A;  4OMY A;  3WU1 B;  2D2W A;  1UB9 A;  4IVN A;  2GWR A;  4G7O F;  1ZH5 A;  3TDZ C;  2Z9O A;  2QLZ A;  2IPQ X;  4HV6 A;  1GXP A;  3KP4 A;  4KMF A;  2FBH A;  4ASN A;  2V6C A;  1R36 A;  3WTT C;  2VN2 A;  1KGS A;  1UFM A;  3WTW C;  1MDM A;  3E97 A;  4EMS A;  1DDN A;  1GXQ A;  1EH7 A;  1XSV A;  2MC3 A;  5LHH A;  2A6H F;  3K69 A;  3M7G A;  3HOS A;  3QOP A;  5D8K B;  2Z99 A;  2DFI A;  4S04 A;  1ZN2 A;  4R1H A;  1Z6R A;  2O8X A;  2VXZ A;  4OIN F;  3LAJ A;  2L54 A;  3TKY A;  5H6R A;  1BIA A;  4KDP A;  1S6L A;  3E6C C;  3H3U A;  4IRH A;  2JTV A;  2W57 A;  1J9I A;  4XSZ F;  2AS5 F;  4RGR A;  3KZZ A;  3I64 A;  2QUF A;  5DDG A;  1USS A;  3BZ6 A;  3J81 Z;  4HV5 A;  4HBL A;  2PG4 A;  2CFX A;  1KU2 A;  1S3J A;  3MEX A;  1RI7 A;  4IJA A;  4HLY A;  4BHB A;  2EFN A;  1SFX A;  1I1S A;  1FT9 A;  3DXJ F;  2WWY A;  2VBX A;  2GXB A;  3RPU A;  3CUO A;  1P2F A;  5CVV A;  4GGG A;  5J6X A;  4OU0 A;  3WTY C;  2MLG A;  2XRO A;  3L00 A;  3L7W A;  2V1X A;  5LHG A;  4S05 A;  4JK1 X;  4G7Z F;  3TQN A;  4Q5S F;  1LB2 A;  4HF2 A;  3I58 A;  3KLN A;  2XKP A;  1XN7 A;  2Q0O A;  2M8E A;  4B8X A;  2STT A;  1SD4 A;  1EV7 A;  3IRQ A;  4FX0 A;  1BI0 A;  3P9K A;  2G7H A;  1R1U A;  2OU2 A;  1LDK B;  4L9J A;  1OMI A;  1X3U A;  3M1E A;  1LVA A;  3HSE A;  2QBY A;  3SZP A;  1U2W A;  4KN4 X;  4HDU A;  3VOD A;  2GIV A;  3R61 A;  3COA C;  5FB2 A;  3H3Z A;  4BHC A;  5DUI A;  2VE9 A;  5FGM A;  4YFK F;  5DD4 A;  3SZT A;  4M6Y A;  1R58 A;  3HRT A;  1IN8 A;  1Z05 A;  1F9N A;  3TOA A;  4CHU A;  4KN7 X;  2F5F A;  3CTA A;  2H6C A;  4ZYG A;  1KYW A;  3GO5 A;  1HKQ A;  1R5H A;  1YFH A;  1B59 A;  4OIR F;  2O61 A;  5BS6 A;  4RGX A;  4CYD A;  1Y0U A;  1AOY A;  2DTR A;  1O3R A;  2A61 A;  4ESJ A;  1TTY A;  4HAM A;  1XCB A;  3Q9V A;  3G73 A;  1OYW A;  3RYR A;  4Q47 A;  5LRS A;  1YLF A;  3E5Q A;  2E1C A;  3OV8 A;  5D6E A;  3I0T A;  3QU3 A;  5IT9 K;  3F3X A;  4LG0 B;  3KEO A;  4MTE A;  3IC7 A;  2KJC A;  4LJZ F;  2X0L A;  3U1D A;  1ON2 A;  2VOO A;  1HSJ A;  4M9X A;  4AIK A;  2WTE A;  2MA3 A;  5CLS A;  1I27 A;  3EUH A;  4I98 B;  1AWC A;  3CUQ C;  2HWV A;  4MNU A;  3J80 K;  1BI2 A;  3GX4 X;  3BJ6 A;  3E3V A;  3BDD A;  2K7L A;  4G7H F;  2H27 A;  2PMU A;  5KK1 A;  4HOB A;  5LBQ A;  2ADU A;  1P4A A;  2ZFW A;  2HQR A;  1SAX A;  2DQR A;  3LFK A;  1K78 B;  4IF4 A;  4HX4 A;  5LEJ A;  3C7J A;  2R7F A;  3R60 A;  4GO1 A;  4ZYD A;  3G3Z A;  2QQ9 A;  3HOT A;  2GAU A;  2LF7 A;  4BQA A;  2Z3Y A;  2KRF A;  5L3E A;  4EV0 A;  5H20 A;  2ZKZ A;  2CO5 A;  1T39 A;  1LNW A;  4LK1 F;  1GHC A;  2CYY A;  1OKR A;  1FYK A;  3O3K A;  3BJO A;  4Y17 A;  1F4K A;  2W25 A;  3MZY A;  1UCR A;  2IRF G;  2KKO A;  2DT5 A;  4GYG A;  2V1U A;  2K4B A;  4ESF A;  4G8X A;  1XDU A;  5ILS A;  4HW0 A;  4P9F A;  3VB2 A;  4P96 A;  1U5T B;  5D4R A;  1HST A;  1DPU A;  1NHA A;  2FEZ A;  5L3C A;  1VTN C;  3K1M A;  2XGX A;  3RPQ A;  3HRS A;  2FXA A;  3T0Y A;  4M6X A;  4EJO A;  5TRD A;  2XKO A;  1LEB A;  2LSO A;  4LK0 F;  4L0Y B;  1P4X A;  4I2O A;  2CGP A;  2M5W A;  5A2Q Z;  4CXF A;  3DF8 A;  1MGT A;  4LLG F;  4CZZ A;  1JGS A;  2QWW A;  4UVC A;  1QNT A;  1UHW A;  3GF2 A;  2NAZ A;  1TBX A;  2XAS A;  1S29 A;  2VC0 A;  3WTU C;  4HF1 A;  3M8E A;  1W7P D;  5E1X A;  2QYO A;  5CYV A;  3GFJ A;  3EQL F;  2GZW A;  2O3F A;  3JTG A;  2HOE A;  3WTX C;  1RIO H;  4NB5 A;  2HTJ A;  3E6B A;  4G9Y A;  2V9V A;  4RGS A;  5IT9 Z;  4HZF A;  3E5U A;  2VBZ A;  5HOO A;  2L3D A;  2FMY A;  5LGN A;  3FXQ A;  4OIO F;  5DD8 A;  2OZU A;  2ELH A;  4PGH A;  4RS8 A;  1BI1 A;  1IAW A;  3SXY A;  3J80 Z;  3MCZ A;  4EM0 B;  2EFP A;  3TO9 A;  1ZLJ A;  4LMY A;  1BN5 A;  1O7L A;  4U88 A;  3HTS B;  3HHH A;  1XMA A;  4XLP F;  1SD7 A;  2FU4 A;  3P9I A;  4KIB A;  1LDD A;  2BBY A;  3D5L A;  4DNC A;  3AAF A;  1R00 A;  1OYY A;  1WRJ A;  4UVB A;  4EQQ A;  1G3T A;  4ZZL A;  2HR3 A;  4ENM A;  2P5L C;  5L3F A;  3WTZ A;  5HS7 A;  1FSH A;  3KLO A;  1KU9 A;  2WC2 A;  5L3G A;  3GWZ A;  2PN6 A;  5FFX A;  3S2W A;  3QRF F;  1Z91 A;  4YFN F;  1TW2 A;  3LA7 A;  4UVA A;  3ZN0 A;  4KIC A;  4BH9 A;  5LHI A;  1H0M A;  2J5O A;  3QP6 A;  1TW3 A;  3IRR A;  2UZK A;  1Z6T A;  5DYM A;  5E18 F;  1G3Y A;  3K9T A;  3F6V A;  2DK5 A;  2G7U A;  4GCV A;  5ICG A;  1FZP B;  3GUD A;  3ZPL A;  1CGP A;  3GVA A;  1O7F A;  3BPV A;  2Y75 A;  2C6Y A;  3V4G A;  3DEU A;  1XGN A;  4I0A A;  1IZ1 A;  2ZBK A;  3TOB A;  4I0B A;  1J2X A;  2FML A;  4KMU X;  5E8I A;  3DPT A;  4L0Z B;  1YYV A;  1YIO A;  3QPH A;  4RB1 A;  2FBK A;  3FX3 A;  2ZO4 A;  3KEQ A;  5F6F A;  2VE8 A;  1PP7 U;  3ZMS A;  3CUQ B;  2ACJ A;  2RVC A;  1D8K A;  1HBX G;  1U3E M;  3L09 A;  1SD6 A;  1O57 A;  2BEO A;  2ZCW A;  4QLC U;  3B02 A;  4RAY A;  2L01 A;  2R3S A;  2E7W A;  5DCM B;  5AIQ A;  1W5T A;  1D8J A;  3FWE A;  1JHF A;  1J59 A;  2MBF A;  2O0Y A;  1KQ8 A;  3ZMV A;  3C18 A;  3CDH A;  2ZNZ A;  2L02 A;  2DO7 A;  1L3L A;  4NQW A;  4B09 A;  4P55 A;  5K5R A;  5K5Q A;  3ISP A;  4HF0 A;  1G6N A;  2NYX A;  1D3Y A;  2DU9 A;  1IN7 A;  4ZYE A;  4BYY A;  3GFM A;  2H09 A;  3E6M A;  4N9H A;  3WGG A;  1FY7 A;  2MH9 A;  3IKV A;  2Z5U A;  1P92 A;  1WKM A;  4O3M A;  3WGH A;  1YQA A;  1FYL A;  3O2P E;  1TNS A;  5HLI A;  1Z1D A;  4KA4 A;  3ZQ7 A;  2M87 A;  3HSR A;  2PFB A;  3SQN A;  2IA2 A;  2IW5 A;  1K78 A;  2XAF A;  1CF7 B;  3NQO A;  1U78 A;  1TNT A;  2CSO A;  2RQP A;  1OR7 A;  3RJP A;  3RKW A;  4KNY A;  3LQR A;  3R6S A;  1I5Z A;  3FXR A;  4WX9 A;  5HLG A;  3PQK A;  1ZHF A;  2A6E F;  4EJT A;  3L2C A;  3CJN A;  2LKP A;  2QVO A;  3GFI A;  2ZME A;  1SMY F;  1K6O A;  2FQ3 A;  3DQV C;  1S7A A;  1V4R A;  3D0S A;  3VFZ A;  3T1B A;  3JAM Z;  5E20 A;  1B1B A;  1REP C;  4I09 A;  1HKS A;  2XAG A;  2PQ8 A;  4MTD A;  4EM2 A;  1A04 A;  3ECO A;  4M71 A;  2DW4 A;  1RNL A;  4HDV A;  2Q8K A;  1LQ1 A;  2HEO A;  2HS5 A;  1TQP A;  2Z33 A;  1MD0 A;  3BY6 A;  4H0E A;  1MJA A;  2D1V A;  4P9U A;  1R7J A;  2HTS A;  2R7D A;  4OMZ A;  4Y15 A;  1FP1 D;  2P7V B;  3HUG A;  2L4A A;  3WTS C;  4TV7 A;  2OQG A;  1ZRE A;  1G3S A;  2F5E A;  2NNN A;  2UWM A;  5F64 A;  4A2U A;  3ZMU A;  2CW0 F;  3C3W A;  3PQJ A;  4I02 A;  1ODD A;  5ILV A;  4ENN A;  4Q4Z F;  1MDM B;  3ROU A;  3KP5 A;  4LLL A;  2L4M A;  1D5V A;  5BMZ A;  2ZNY A;  4O6J A;  2IJL A;  2LNB A;  4ESB A;  3FMQ A;  3IHU A;  1O3Q A;  4RAZ A;  1XD7 A;  1FNN A;  2W24 A;  1R5G A;  5EEH A;  3F8C A;  2QQB A;  3RYP A;  3IL2 A;  2OA4 A;  4CDG A;  2KJB A;  3ULQ B;  4KFC A;  4M9S A;  2K86 A;  2VON A;  2YSR A;  4L5J A;  1FPQ A;  3QP5 A;  4FT8 A;  2MLK A;  3J7A O;  1W7P B;  1XDS A;  4MQV A;  3T8R A;  1IXS B;  2A68 F;  1B9N A;  5J8C A;  5TJJ A;  4IPA A;  3VOE A;  2BV6 A;  2EFO A;  1Z9C A;  5JHU A;  3BP8 A;  4U0Y A;  2W84 A;  4D0P A;  3FXU A;  5BPI A;  4A6D A;  3I4P A;  4GXO A;  3F8B A;  3GZ6 A;  2HYF A;  2GXG A;  1GVJ A;  5D8L B;  1BC7 C;  4RB3 C;  1RZ4 A;  3MZH A;  3HHG A;  3HRM A;  5HDG A;  1S7O A;  1IXC A;  1BOA A;  2UXX A;  2B0L A;  3WE3 A;  2HKX A;  5HDN A;  4N9I A;  1UST A;  2DLL A;  4GYI A;  3KFW X;  3E6D A;  2FE3 A;  2COM A;  2J5P A;  4KYW A;  4NHJ A;  2VT2 A;  2F5D A;  5CVI A;  3RKY A;  4LD5 A;  1H9T A;  3EYY A;  3K2Z A;  2P5K A;  3O6B B;  1HKT A;  4UUV A;  1BM9 A;  1LJ9 A;  2PLY A;  3GXO A;  1RUN A;  2K4J A;  4A0Z A;  4MEX F;  2YU3 A;  3KCC A;  2QBY B;  5ERI A;  4RB0 A;  3I5U A;  2JT1 A;  4JBA A;  2EV0 A;  4E70 A;  5EEG A;  1MJ9 A;  3QAH A;  1SMT A;  1U8R A;  2IA0 A;  3F6O A;  2QEN A;  4N0B A;  1YW7 A;  3F8M A;  2XUB A;  2MD5 A;  4IHS A;  4RB2 C;  4XBF A;  4A0X A;  2EFQ A;  2E7X A;  2P6S A;  1XGO A;  2FNP A;  2STW A;  1W4M A;  2DPU A;  4PCQ A;  1FLI A;  4BAY A;  4YFX F;  2M45 A;  2QM3 A;  1R1V A;  2P6T A;  1BC8 C;  2ETH A;  2F5C A;  3ECH A;  1B4A A;  6PAX A;  5E8G A;  3I59 B;  3LST A;  1T6S A;  4M72 A;  1G3W A;  5JVT A;  4EGZ A;  3M9A A;  3FM3 A;  3JSP A;  2HQN A;  2XVC A;  4G94 A;  1Z7U A;  1FC3 A;  4XRF A;  5HVQ C;  5E1Z B;  5JR3 A;  3RKX A;  5CVJ A;  1T0F A;  2FRH A;  2XAH A;  5LRR A;  3MQ0 A;  1IRF A;  1FWZ A;  5LGU A;  2JRT A;  2VBY A;  4IRI A;  4ZH4 F;  1R1T A;  2JPC A;  4PZJ A;  1IW7 F;  2ZXJ A;  1JE8 A;  4AWX B;  2ZJ2 A;  2CQK A;  2V1D A;  1DP7 P;  4WXH A;  4A6E A;  1XMK A;  1IN6 A;  1UHM A;  1KU3 A;  5HS9 A;  3VEP A;  3GEZ A;  3K1P A;  5FO5 A;  1T38 A;  1KQ9 A;  2A3S A;  3FMR A;  5DEQ A;  2NNY A;  3HIF A;  3JW4 A;  1YO5 C;  1KU7 A;  1S8N A;  3OOP A;  2UXN A;  4HX8 A;  1T98 A;  1CF7 A;  1ZRD A;  5ED4 A;  1QPM A;  3NEU A;  4WXD A;  4WK8 F;  3HYI A;  4HX7 A;  3F21 A;  5FLX K;  1YW9 A;  2OZ6 A;  4ETS A;  2W85 A;  1FBS A;  3N97 A;  1QZY A;  1XCV A;  1BI3 A;  4LB5 A;  1IN5 A;  2PJP A;  1FOK A;  3I53 A;  3JTH A;  1ZLK A;  1C0W A;  4L5I A;  1JXS A;  4LFU A;  3K0L A;  3EYI A;  3F23 A;  3R0A A;  1ZGA A;  5D5W B;  3DPL C;  2H6B A;  4LLN A;  2Y48 A;  1O3T A;  2IA1 A;  4RGU A;  4HLX A;  4UHT A;  3CO6 C;  5CJ9 A;  2FNA A;  2Y0M A;  1PUE E;  4OOI A;  4YIF A;  4JQF A;  5L3D A;  2PI0 A;  4MQ9 F;  3BWG A;  3V8K A;  2M1B A;  3CLO A;  2RC4 A;  2X4H A;  1SFE A;  1U5T C;  2P8T A;  2RNJ A;  4WXC A;  1PP8 F;  3F72 A;  2P5V A;  3TGN A;  1O3S A;  1FYM A;  1TLH B;  1YTY A;  3W6J B;  2RGV A;  4LB6 B;  5HLH A;  5IT3 A;  2PEX A;  2EFW A;  2CG4 A;  3NRV A;  4XLN F;  3I71 A;  3LA3 A;  5LEK A;  5J8F A;  5AIP A;  3LA2 A;  2M30 A;  2XAJ A;  5DUK A;  4LG0 A;  1KYZ A;  2G9W A;  5BPD A;  4OIP F;  2RKH A;  1ZRF A;  1BIB A;  4QWQ A;  2HZT A;  1MZB A;  1HW1 A;  1W7P A;  4L9T A;  1I6X A;  3ELK A;  4L9N A;  2HGC A;  4HQM A;  4CO8 A;  3ABT A;  1LEA A;  2QQA A;  1F1Z A;  2EJR A;  2JSC A;  4MHG A;  1HW5 A;  3IWZ A;  3WOD F;  3HRU A;  2A69 F;  1XB4 A;  1IXR C;  4A5M A;  4O5V A;  1FX7 A;  4YII A;  4PDK A;  1PDN C;  4U0W A;  3V8L A;  2YPR A;  3CO7 C;  5D5V B;  2K02 A;  4YG2 F;  1V3F A;  2XRN A;  5ICF A;  1BJA A;  4G6Q A;  2V79 A; 
#chains in the Genus database with same CATH topology
 1I39 A;  2CW8 A;  2CUE A;  2RNG A;  4BNC A;  1XGS A;  2CMP A;  4OIQ F;  3P7N A;  4P5O A;  3ONQ A;  1TC3 C;  3RI4 A;  3ZN1 A;  4R79 A;  2ME0 A;  3A0B C;  2MAB A;  3K4B A;  3RIR A;  1VQ4 I;  4K2E A;  4S0H B;  4DGW B;  3GCM A;  3QQA A;  4XNF A;  4NNJ A;  1QBJ A;  2LVS A;  2OUM A;  4N4N B;  1DPR A;  1QGP A;  2XF5 A;  5FLX Z;  4Q48 A;  3KP3 A;  2ME6 A;  5C3E J;  3NAR A;  4BDZ A;  5IOY A;  3W2A A;  1HQC A;  2OAZ A;  3FBI B;  4BE2 A;  1OCO H;  4CCN A;  2VC1 A;  3TP3 A;  2IVM A;  2KIU A;  4QIW N;  4BXU A;  2DOD A;  1Z67 A;  1WQ2 A;  4M3E A;  1A31 A;  5D6F A;  2DPD A;  3D5S C;  5IYD J;  4BHP A;  5F1R A;  2CS3 A;  1A36 A;  2BW3 A;  4IRG A;  4CCK A;  2NVY J;  2KIM A;  1U5T A;  1RET A;  1E3H A;  4HA8 A;  5DM6 F;  5D4S A;  3KET A;  1YIT I;  3OS0 A;  1B9M A;  3G1L A;  3T5X A;  2Y30 A;  1AHD P;  3U2R A;  2EB7 A;  4FET A;  3WGI A;  2EA2 A;  1WI9 A;  3DTK A;  1ETV A;  2Z1D A;  2E1N A;  1MBE A;  3A4C A;  1Q1V A;  1IJW C;  3R4K A;  3MKL A;  3JSO A;  1W1W E;  2L7Z A;  2I8D A;  4IXA A;  1LPQ A;  3CDI A;  2IGO A;  1ZAO A;  3H92 A;  2HI3 A;  2QA4 I;  2EK5 A;  4A93 J;  3G1O A;  5BOX A;  2HOS A;  3O8H A;  4JYK A;  2O03 A;  1PYV A;  2TDX A;  5ILU A;  3H36 A;  2LFB A;  5A2Q K;  2R5Y A;  5M5Y J;  2DBB A;  3FM5 A;  3F8N A;  2FOK A;  3ZOB A;  1EJ9 A;  3FZV A;  1UMQ A;  2ISZ A;  2DQL A;  2VKH A;  3C1D A;  2JQ7 A;  4NBQ A;  2LMD A;  2H94 A;  1P4W A;  3CCV I;  2CV0 A;  1RC9 A;  3SDB A;  2M9H A;  1PJR A;  2OQR A;  3SFZ A;  1ZG1 A;  2CH0 A;  1WJD A;  3X2Q H;  3PSF A;  3RTR A;  2VOD A;  5CQE A;  4CZC A;  3K1N A;  3FHN A;  3ZMT A;  5KAI C;  4DOZ A;  3LSK A;  3PFI A;  5ICC A;  2R0Q C;  1YRN B;  2NRA C;  2FSW A;  4B48 A;  2GA2 A;  2HFH A;  1D1A A;  2IBD A;  4NC8 A;  4NQW B;  2DK8 A;  1ULY A;  3ABL H;  3KZY A;  1IGN A;  4I6Z A;  1FMV A;  3I59 A;  5DCF A;  3HOY J;  1BA5 A;  5DV5 A;  3CCL I;  3CQZ J;  4BQO A;  1WGX A;  1XTA A;  4XON A;  4E7L A;  4IZZ A;  4F93 B;  3LQQ A;  1X1P A;  2L0K A;  4GFB A;  3AFH A;  3OYK A;  1E3P A;  2IT0 A;  2X6X A;  3TO7 A;  5DTD A;  3P9C A;  5D5X B;  4EJW A;  3V8J A;  3I56 I;  3CP8 A;  4ABZ A;  4PJL A;  3W6V A;  4DYC A;  3PIP F;  1I50 J;  1QHG A;  1ZGJ A;  2NS8 A;  4EM1 A;  1ZRC A;  3Q9S A;  5ICE A;  3H5N A;  2D1H A;  1YJ9 I;  2X1C A;  3QU6 A;  3CDL A;  4I01 A;  2A07 F;  1JKO C;  1I3A A;  2ZC2 A;  4Y13 A;  4KIF A;  2KDO A;  2JSP A;  3A1Y A;  1JGG A;  3WE2 A;  1KA8 A;  1GVD A;  2DT6 A;  2F2E A;  3Q5F A;  1Y8Q B;  9ANT A;  4XM3 A;  2BXY A;  4ZZD A;  2OD5 A;  1JKP C;  1Q1H A;  1JKQ C;  1RUO A;  1J0R A;  1XGM A;  4ENK A;  4DBQ A;  4M3D A;  1IN4 A;  1X1B A;  3CCS I;  1ZTR A;  2K9N A;  4E7Z A;  4NC6 A;  3ZQF A;  3CCE I;  1JJ8 C;  2ESN A;  2L7K A;  2V9K A;  1FBQ A;  1P7I A;  1K61 A;  5JFR A;  1WCM J;  1WSU A;  2V9P A;  3K2A A;  2OCC H;  3ZMD A;  1JUM A;  3G4S I;  1HDD C;  1QVU A;  1YW8 A;  5EGO B;  2XIG A;  4A12 A;  2LDU A;  2VQL A;  3FK7 A;  3U9G A;  4Z2Y A;  3IKT A;  3WTV C;  3CJQ B;  3AKZ A;  2F5V A;  4G6D A;  5CVR A;  3HJE A;  1ORK A;  4BY7 J;  3HL2 A;  4BL0 B;  5HDK A;  1MMA A;  1T0F C;  3WU0 A;  2YR2 A;  4KUM A;  4MGR A;  4BJT A;  4I7H A;  2ZME B;  4L9V A;  4HYE A;  3W3C A;  1QZZ A;  1OCP A;  3OYD A;  2VKE A;  2EWN A;  1QQI A;  2FQ4 A;  3ZQL A;  2E36 A;  1H9G A;  3TDU C;  1F5T A;  1FTZ A;  4XLF A;  1HXD A;  1ONV A;  2BY0 A;  2VL8 A;  4RMN A;  1DUX C;  4U7B A;  3V7C A;  3DFG A;  2CUZ A;  3HOW J;  4D7N A;  5JHF A;  1QA6 A;  4HQE A;  1ON1 A;  3SFI A;  3L9F A;  1GV2 A;  2DA1 A;  2K9L A;  3IWF A;  1TQM A;  2JUG A;  3D1N I;  2V4J C;  2DJN A;  4C2U A;  5M3M J;  1QU3 A;  4XOT A;  3TP0 A;  4MIM A;  4ZYH A;  3SEQ A;  3GFL A;  4M73 A;  3QPT A;  2W4S A;  3A0H C;  3K7A J;  1K7A A;  3RDI A;  1MKM A;  3GW2 A;  1KQ0 A;  2DXI A;  1KON A;  5K1Y A;  4WF2 A;  2NS0 A;  2D45 A;  3LAP A;  3BC8 A;  3VDX A;  2XHK A;  4YEJ A;  3MN2 A;  3W2V A;  1G4D A;  1DQU A;  4FHT A;  2HKO A;  1UHS A;  4AIH A;  3BR5 A;  1EH6 A;  1YS6 A;  4KIG A;  1DGW Y;  5HNH A;  3HUG B;  3V7S A;  2R7T A;  2VXD A;  1MMS A;  3VYT B;  2VOP A;  1TWA J;  3ZMZ A;  4ON0 A;  2PMZ N;  3KE2 A;  1IRZ A;  1ETW A;  3FHZ A;  4R8H A;  4XKW A;  4UXN A;  1ZG5 A;  1SFO J;  1VQ8 I;  5KAF C;  5E3O A;  2ZXI A;  2RV8 A;  4ENJ A;  1QPI A;  2DAO A;  2K40 A;  3KYD B;  1QO0 D;  2R7Q A;  4CIC A;  3V7R A;  2YX4 A;  3BRO A;  3WG9 A;  3HSF A;  2Y9Z A;  2P7C B;  3DKW A;  4YEL A;  3SJM A;  5JI6 A;  4XLH A;  2M7A A;  2OBP A;  1HDP A;  3SHF A;  4ZTJ A;  3FXJ A;  3DV8 A;  4A5N A;  3FF5 A;  2KZG A;  4EJU A;  4WCG A;  4MEY F;  3K10 A;  4UUT A;  2LF8 A;  2K9M A;  3BOQ A;  4A0Y A;  5HS8 A;  4YIR X;  4M9Z A;  4IQ4 A;  3ZQI A;  1Z77 A;  2F4I A;  1V5E A;  3DEW A;  1GDT A;  3EDP A;  1BBY A;  4LIU A;  3CUQ A;  4OWR B;  1YHQ I;  5FD5 A;  2BGC A;  3LSJ A;  5FFZ A;  1IF1 A;  2ECC A;  1XPX A;  4AVP A;  3ZP5 A;  1JT6 A;  2EV5 A;  3E5X A;  3U1K A;  3E7L A;  2ELJ A;  4U7D A;  1FSE A;  1FP2 A;  4DIQ A;  1ENH A;  4LGW A;  1W5S A;  1STZ A;  1UG2 A;  3ML6 A;  1HW2 A;  2BHZ A;  2QSF X;  5E1W A;  5DCM A;  5LLQ A;  2VPL A;  2WV0 A;  1VQK I;  1DP3 A;  4UUS B;  3W6K B;  3A01 A;  1R23 A;  5LD2 C;  4GDF A;  3M8F A;  2XDV A;  3BZC A;  3QYB A;  4AD9 A;  5CVU A;  1BOB A;  4EVI A;  2IP2 A;  3MFK A;  5AON A;  4XSX F;  4D7M A;  2DMQ A;  2HYG D;  1ZG3 A;  1SD5 A;  2DI3 A;  3Q0W A;  3KP2 A;  3DP7 A;  1D0X A;  3FMS A;  4MFE A;  1WHU A;  1JUP A;  1WPK A;  2F4O B;  2M0M A;  4XL9 A;  2EA4 A;  1VQL I;  4FQG A;  2K27 A;  1ZAR A;  2EBI A;  4G12 A;  4AIJ A;  2FA5 A;  4L18 B;  1MBK A;  2YS9 A;  2Y69 H;  3H0G J;  2DDA A;  3OSF A;  1OQY A;  1J75 A;  2R5Z A;  4EGY A;  1T2K A;  1OCZ H;  2EV6 A;  3JRE A;  3H1C A;  4UV8 A;  3HOX J;  3CLQ A;  3BJA A;  1ZYR F;  3J81 K;  4J01 A;  1XSD A;  3CC2 I;  3S15 J;  1B6A A;  1QVT A;  2BVL A;  2E5Z A;  4U0V A;  4F7Z A;  3GLX A;  2XAQ A;  2QZ8 A;  1SVM A;  1JHH A;  2GOX B;  4CH7 A;  1DU0 A;  2BVM A;  4BBR J;  1SFU A;  3CZ6 A;  3F8F A;  3H9J A;  4UV9 A;  2HDC A;  1P6R A;  2JPB A;  1J5Y A;  1WH7 A;  2CWE A;  2RN7 A;  3ZR8 X;  3ERE D;  4IHT A;  1IUF A;  3REO A;  5EZG A;  3TO6 A;  4H4K C;  3CCU I;  1L0O C;  2JMW A;  2ESH A;  2GA1 A;  1K79 A;  1FBU A;  1UZC A;  5E17 F;  3HB9 A;  2XGD A;  3J7Z I;  1IUY A;  1J7K A;  1SVL A;  4PGG A;  3ASO H;  2YU9 J;  3MAJ A;  5GP9 A;  2W48 A;  3EET A;  2RQQ A;  2KIQ A;  3WHC A;  1T95 A;  3JRI A;  1E17 A;  2NOG A;  4ZYA A;  5FRM A;  1SC7 A;  1E2X A;  1MJB A;  1K83 J;  1XSX A;  2UV1 A;  4B1R A;  3OIP A;  4DQ2 A;  5H6Q A;  1MH3 A;  2OC6 A;  3HTU A;  4X6A J;  3MWM A;  4AID A;  4A3C J;  3GZ5 A;  1I1G A;  1D0Z A;  4IO9 F;  1IRG A;  1T56 A;  3GYH X;  1UG0 A;  2RDP A;  5TGT A;  3FIW A;  4LG3 A;  1B8I B;  2PMH A;  5BQT A;  2GQQ A;  5L3B A;  4M74 A;  2XV4 S;  2BE5 F;  2QF7 A;  2LG4 A;  1U6G A;  3I54 A;  4EJV A;  3RZO J;  3OR2 C;  1BL0 A;  2HDD A;  5KVR A;  2WBM A;  2DMN A;  4UNO A;  3LSP A;  2AXL A;  2BYV E;  2A5Y B;  3BTJ A;  4BXF A;  3WHB A;  1OYI A;  3B73 A;  1V5G A;  2DYS H;  5J3L A;  4FX4 A;  4CGZ A;  2O6G E;  2JZY A;  3JRD A;  3S1R J;  3ABU A;  1S7E A;  2Q2E A;  2NXN B;  3ZXS A;  2FF4 A;  2KIF A;  3LWF A;  3KP6 A;  3BQZ A;  5CPR B;  1YS7 A;  3HKZ A;  3JAM K;  2VBW A;  5JLW A;  4KT5 C;  5FD6 A;  3K70 D;  1RPW A;  1NG7 A;  1WWX A;  3UNG C;  4PK4 A;  2MH2 A;  2ZSH B;  3F0C A;  2YX7 A;  5LGT A;  5EF6 A;  3CJT B;  2PBI A;  5D5U B;  4X0G A;  2WAQ A;  1ZKG A;  3GTL J;  2K85 A;  3N4M A;  1OPC A;  2DA3 A;  2ISY A;  2B9S A;  1R22 A;  1LDJ A;  2P4W A;  2FBI A;  3FDY A;  1TQI A;  4P1W A;  3KP7 A;  3BPX A;  3F22 A;  1EH8 A;  4WWC A;  2EZH A;  1X1C A;  3T8T A;  2VT3 A;  5EYR A;  1YG2 A;  5K5O A;  1VQP I;  3R0J A;  4OMY A;  3WU1 B;  1T8I A;  2D2W A;  2KL4 A;  1UB9 A;  4IVN A;  4Y3O A;  2LBF B;  2GWR A;  2LTP A;  2KPM A;  3U21 A;  4D5F A;  3K4K A;  4G7O F;  4AU7 A;  2F48 A;  1ZH5 A;  1MW7 A;  1POG A;  2NVU B;  3TDZ C;  2XB0 X;  4D5C A;  2K3F A;  2Z9O A;  4AYB A;  2R92 J;  4BAC A;  3Q0V A;  2QLZ A;  2IPQ X;  2E71 A;  4RAG A;  4HV6 A;  4PJM A;  4Z6Y A;  2L7F P;  1WJ5 A;  1GXP A;  5KHD A;  4IQJ A;  3S1Q J;  2R7Z J;  3KP4 A;  2GM4 A;  4KMF A;  2FBH A;  2H8W A;  4ASN A;  2V6C A;  1IC8 A;  3N05 A;  4JX5 A;  3HDD A;  4FTH A;  1R36 A;  2CQ7 A;  2VQG A;  3WTT C;  2VN2 A;  1ACI A;  1KGS A;  1UFM A;  3WTW C;  5F08 A;  1XMX A;  1MDM A;  3IH4 A;  3E97 A;  4II3 A;  4EMS A;  2A05 A;  2A6T A;  5FKK A;  1DDN A;  3HPG A;  4MFD A;  1GXQ A;  1EH7 A;  1XSV A;  1XS9 A;  2MC3 A;  5LHH A;  2A6H F;  3K69 A;  3M7G A;  3HOS A;  2R7X A;  3QOP A;  1A6Q A;  3OL3 A;  3RZD J;  5D8K B;  2MSY A;  2Z99 A;  2DFI A;  4JX4 A;  1ZN2 A;  4R1H A;  4S04 A;  1Z6R A;  2O8X A;  2DOA A;  1X1D A;  2CJJ A;  2VXZ A;  3ZQC A;  2H1L A;  4OIN F;  3LAJ A;  2VAS A;  2Y9Y A;  4LIV A;  2L54 A;  2DJI A;  3TKY A;  5FRN A;  1Z21 A;  5H6R A;  4HNT A;  3TMO A;  1BIA A;  2CUF A;  4KDP A;  1S6L A;  5EG0 B;  3E6C C;  4UB8 C;  4CYC A;  3H3U A;  1AKH B;  2QEX I;  4IRH A;  2JTV A;  2W57 A;  2Y0S N;  1J9I A;  4XSZ F;  1UAA A;  2AS5 F;  4RGR A;  2E2I J;  3KZZ A;  3AL0 B;  2L9S A;  2QSG X;  3I64 A;  2JA6 J;  2HVR A;  2BXZ A;  2QUF A;  5DDG A;  4U87 A;  3BTC A;  1USS A;  3BZ6 A;  3J81 Z;  1SEU A;  4HV5 A;  2MG4 A;  4HBL A;  2PG4 A;  2CFX A;  4AYB N;  5M5W J;  1H8A C;  1KU2 A;  4QSH A;  4Y4R A;  1S3J A;  4BE0 A;  3MEX A;  1RI7 A;  2OCE A;  3BZK A;  4JOM A;  4IJA A;  3JRC A;  2QSH X;  3BG7 A;  4DW6 A;  4HLY A;  1HCR A;  2KLO A;  4BHB A;  3GZN B;  2EFN A;  2RRE A;  3TW7 A;  1SFX A;  4A3K J;  1I1S A;  1FT9 A;  3VYU B;  3HC7 A;  3DXJ F;  2WWY A;  2VBX A;  2GXB A;  3RPU A;  3VYR B;  3CUO A;  1P2F A;  3QWL A;  4HEA 2;  5CVV A;  1OCC H;  2OJE D;  3LSG A;  4GGG A;  4M3F A;  1JI8 A;  5IPA A;  4MO7 A;  5J6X A;  3DWL E;  4OU0 A;  2BHY A;  3WTY C;  2UUZ A;  1BR2 A;  5K7H A;  4XRS A;  1R6R A;  1QRY A;  4N4O B;  2MLG A;  2XRO A;  3L00 A;  4Y7N J;  2CU7 A;  3L7W A;  2V1X A;  2LRE A;  5LHG A;  3KPH A;  4S05 A;  4JK1 X;  2X1D A;  2AO9 A;  4G7Z F;  3ZQG A;  3OY9 A;  5IP7 J;  1X2M A;  3TQN A;  5J1R A;  1RES A;  1SAN A;  4Q5S F;  1LB2 A;  4HF2 A;  3I58 A;  4CSW A;  3KLN A;  2XKP A;  1HA8 A;  1XN7 A;  5GAG J;  1N75 A;  2Q0O A;  3KYC B;  2M8E A;  4B8X A;  3CD6 I;  4XKC A;  2STT A;  3DTI A;  4CCJ A;  1SD4 A;  1D1C A;  1EV7 A;  3ERM A;  3IRQ A;  4AUX A;  3G71 I;  1B72 B;  3BLY A;  3GTP J;  1HOM A;  4FX0 A;  1BI0 A;  4XK4 A;  1V54 H;  1WJF A;  3P9K A;  2G7H A;  1R1U A;  2OU2 A;  1LDK B;  2MD0 A;  4L9J A;  1LFU P;  4IHW A;  4NUB A;  1OMI A;  1X3U A;  3BR3 A;  3M1E A;  1APL C;  1LVA A;  5CQG A;  1FJL A;  3HSE A;  2QBY A;  3SZP A;  1U2W A;  4KN4 X;  3CCR I;  4HDU A;  1G8X A;  2Z16 A;  4D9J A;  3VOD A;  1U9O A;  3I55 I;  2GIV A;  2HDW A;  4XR6 A;  3R61 A;  3COA C;  5FB2 A;  1VND A;  3H3Z A;  4C3H J;  3LFU A;  4BHC A;  4DYR A;  5DUI A;  2QQ8 A;  5C4J J;  2VE9 A;  1VFC A;  1W36 C;  3HOZ J;  3NWT A;  3TW6 A;  5FGM A;  4YFK F;  1EA3 A;  5DD4 A;  3SZT A;  4M6Y A;  5GAE J;  1R58 A;  3HRT A;  1IN8 A;  1Z05 A;  1F9N A;  3TOA A;  2YUS A;  4CHU A;  1Y56 A;  4KN7 X;  2F5F A;  1AA7 A;  2CV1 A;  3IAS 2;  3CTA A;  1JKR C;  2H6C A;  4ZYG A;  1KYW A;  1FOY A;  3GO5 A;  1HKQ A;  3NWS A;  1R5H A;  1YFH A;  1B59 A;  1DGR M;  3UKG A;  4OIR F;  2O61 A;  5BS6 A;  2VI6 A;  2DMT A;  1SFK A;  3CMY A;  4RGX A;  1MBH A;  1YOV B;  2LY1 A;  1HF0 A;  4CYD A;  4KT6 A;  1Y0U A;  1AOY A;  1Z7L A;  2DTR A;  3GTO J;  1N78 A;  3A03 A;  1O3R A;  2A61 A;  1SVO A;  4ESJ A;  3S16 J;  1TTY A;  3S14 J;  1UJ8 A;  2IS1 A;  4HAM A;  1XCB A;  3Q9V A;  3OYA A;  3G73 A;  4FE7 A;  1XC5 A;  4W1U A;  3CCM I;  1X3Z B;  5FLM J;  3JCU C;  4HNV A;  1OYW A;  3RYR A;  5GPA A;  3FIS A;  4Q47 A;  5HOD A;  4IHY A;  2XSD C;  5LRS A;  1YLF A;  4EAT A;  3E5Q A;  1WJC A;  2XGC A;  4BGD A;  1TL8 A;  2E1C A;  2FOW A;  1X4O A;  2H1K A;  3OV8 A;  5D6E A;  3I0T A;  3QU3 A;  1ETX A;  3VYS B;  3I9V 2;  5IT9 K;  4ZDO A;  2KRH A;  3F3X A;  4LG0 B;  2E34 A;  3KEO A;  4MTE A;  3IC7 A;  2KJC A;  2JN6 A;  4LJZ F;  2X0L A;  3DLL F;  3B6A A;  1R5I D;  3U1D A;  5B3S H;  1ON2 A;  1IG7 A;  2VOO A;  5E3N A;  1HSJ A;  2XSJ C;  4M9X A;  1IV8 A;  4AIK A;  2WTE A;  2MA3 A;  5CLS A;  2KDZ A;  1I27 A;  3EUH A;  3PNV A;  4I98 B;  4A69 C;  3CCY A;  1WJB A;  1AWC A;  4BY1 J;  3EUK L;  3CUQ C;  2HWV A;  2R7O A;  1GT0 C;  4MNU A;  3J80 K;  1BI2 A;  3GX4 X;  4E7K A;  3BJ6 A;  4QTR A;  3E3V A;  2X51 A;  3BDD A;  2K7L A;  1YE9 A;  2XAU A;  3DU5 A;  4G7H F;  3H5A A;  2H27 A;  1K6Y A;  2PMU A;  5KK1 A;  4HOB A;  5LBQ A;  2ADU A;  1P4A A;  3D5R C;  2ZFW A;  2HQR A;  4BKX A;  1SAX A;  4XOR A;  2W7N A;  1PUF B;  2DQR A;  3LFK A;  1K78 B;  4C30 A;  2PMZ A;  4RLQ A;  4IF4 A;  4HX4 A;  5LEJ A;  3S3O A;  3C7J A;  3QPL A;  2R7F A;  2DA2 A;  2IEK A;  3J7Y J;  1G2H A;  3CC4 I;  3R60 A;  4GO1 A;  4ZYD A;  1NK3 P;  3BCA A;  2QQ9 A;  3G3Z A;  3HOT A;  3TBI A;  5FKL A;  2HZD A;  3S3N A;  2XF6 A;  2GAU A;  2LF7 A;  4BQA A;  4UB6 C;  2Z3Y A;  2KRF A;  1ETO A;  3K4N A;  3Q3S A;  5L3E A;  4EV0 A;  2JA5 J;  3OYH A;  5H20 A;  2ZKZ A;  2CO5 A;  3OS2 A;  1JTX A;  1MNE A;  2KRC A;  1T39 A;  1LNW A;  4LK1 F;  1SAU A;  2VJ5 A;  4RLF A;  1R4M B;  1GHC A;  1XX5 A;  2CYY A;  2LY2 A;  1OKR A;  3PSI A;  3LOC A;  1FYK A;  3O3K A;  4DZP A;  3LL7 A;  2DT7 B;  3PFY A;  3FKI J;  3BJO A;  4Y17 A;  2GBY A;  1F4K A;  1ETY A;  2W25 A;  3MZY A;  2XC7 A;  1UCR A;  3PNT A;  2IRF G;  2KKO A;  4HST A;  4ZDL A;  2DT5 A;  3CP2 A;  3ASN H;  4GYG A;  2V1U A;  3RQ4 A;  2GLO A;  2K4B A;  4ESF A;  4G8X A;  1XDU A;  3VSK A;  2KQR A;  5ILS A;  2L7M P;  3HEF A;  2DTZ A;  4HW0 A;  4IL6 C;  4P9F A;  1A35 A;  4F3Q A;  3VB2 A;  1V55 H;  4P96 A;  1U5T B;  1R71 A;  5D4R A;  2LKX A;  1R9T J;  3PM1 A;  1HST A;  1DPU A;  1F43 A;  1NHA A;  2FEZ A;  2V26 A;  2ID6 A;  1R49 A;  3G2B A;  5L3C A;  1S9H A;  1VTN C;  3K1M A;  2XGX A;  3RPQ A;  3HRS A;  4AM3 A;  3K6G A;  2FXA A;  3OIQ A;  3T0Y A;  4M6X A;  1N77 A;  3OYL A;  2WB1 N;  4EJO A;  4I99 C;  4A3D J;  5TRD A;  1A5J A;  2IAI A;  2XPW A;  2XKO A;  2X9D A;  1Y1W J;  1LEB A;  2LSO A;  4LK0 F;  4L0Y B;  3FXM A;  1P4X A;  4I2O A;  2CGP A;  2M5W A;  3DF8 A;  4CXF A;  5A2Q Z;  1MGT A;  4LLG F;  5GPC A;  2WAE A;  2R5Y B;  4CZZ A;  2N8G A;  1JGS A;  2QWW A;  4UVC A;  1FOW A;  1VF9 A;  2FUG 2;  1QNT A;  1UHW A;  3BTI A;  4HNU A;  3L2V A;  3GF2 A;  2NAZ A;  1TBX A;  2XAS A;  1RR8 C;  1CQT A;  2M7B A;  2MC4 A;  1S29 A;  2ZJP F;  2HU9 A;  2BY2 A;  3KYL A;  1WFX A;  2VC0 A;  3WTU C;  4HF1 A;  1TWH J;  4PJN A;  3M8E A;  3MMY B;  1W7P D;  4XLE A;  5E1X A;  2QYO A;  5CYV A;  3H5R A;  3GFJ A;  3EQL F;  1IDY A;  2GZW A;  2EIM H;  2O3F A;  2PJR A;  2VQH A;  5J40 A;  4CCM A;  3JTG A;  2HOE A;  3WTX C;  3BG3 A;  3M3Y J;  4BQN A;  2PX9 A;  3FXK A;  1RIO H;  5K7F A;  4NB5 A;  2HTJ A;  3E1S A;  3E6B A;  3IV5 A;  1VQ9 I;  3QYF A;  2LP0 A;  4BS9 A;  3H3V K;  2BY1 A;  5FLV A;  4G9Y A;  2V9V A;  2E35 A;  3SDG A;  4RGS A;  5IT9 Z;  4XN3 A;  4HZF A;  3DPU A;  3E5U A;  2VBZ A;  2ZB9 A;  3WU2 C;  5FJ8 J;  4HG2 A;  4E7H A;  5HOO A;  3BQY A;  2L3D A;  4HSR A;  2FMY A;  3BR6 A;  5LGN A;  5TIS C;  3OYE A;  3FXQ A;  4OIO F;  5DD8 A;  2KFD A;  2OZU A;  2EZK A;  4BEH A;  2ELH A;  2WAD A;  4PGH A;  4RS8 A;  4Y33 A;  1MBJ A;  1A6I A;  1BI1 A;  1IAW A;  3S1N J;  3SXY A;  3K4C A;  2X6O A;  2V7F A;  3J80 Z;  3H35 A;  2Z2S B;  3MCZ A;  5KNL A;  4BE1 A;  4EM0 B;  2DMP A;  4FAS D;  2EFP A;  3TO9 A;  1ZLJ A;  4LMY A;  3LSH A;  1BN5 A;  1O7L A;  4U88 A;  3CME I;  3HTS B;  3HHH A;  1LUJ B;  1XMA A;  4XLP F;  4BQQ A;  4CCL A;  1Y8R B;  2LR8 A;  1M1E B;  1SD7 A;  2FU4 A;  3P9I A;  4KIB A;  1LDD A;  2BBY A;  3D5L A;  2K9S A;  4XRS G;  4DNC A;  4ZTF A;  3AAF A;  1LVK A;  1R00 A;  4DYQ A;  1OYY A;  1WRJ A;  2Y2Z A;  4UVB A;  4EQQ A;  2O9L A;  1YJN I;  4QPQ A;  1G3T A;  4ZZL A;  3Q0U A;  2HR3 A;  4ENM A;  2P5L C;  5J4Y A;  1ZEL A;  5L3F A;  3WTZ A;  5HS7 A;  1FSH A;  3KLO A;  1KU9 A;  2WC2 A;  5L3G A;  3GWZ A;  4B4C A;  2PN6 A;  5FFX A;  3S2W A;  3QRF F;  4DJA A;  3C2H A;  3MKY B;  1RR7 A;  1Z91 A;  4YFN F;  3DBR B;  3CF5 F;  2XB5 A;  1TW2 A;  3LA7 A;  1S72 I;  4UVA A;  3ZN0 A;  4KIC A;  4BH9 A;  5LHI A;  1H0M A;  1G59 A;  3C2B A;  2J5O A;  3QP6 A;  1TW3 A;  2KT0 A;  4XOP A;  1J09 A;  1MSF C;  3IRR A;  2JUC A;  2UZK A;  1Z6T A;  1W0T A;  5DYM A;  5E18 F;  2JA2 A;  5FKN A;  1G3Y A;  3K9T A;  3L2W A;  3F6V A;  2DK5 A;  5IP6 A;  2QKL B;  2QKM B;  4JP0 A;  2G7U A;  2OF7 A;  2V1N A;  1Y39 A;  4GCV A;  5ICG A;  4C2M J;  1FZP B;  3GUD A;  1V5F A;  3ZPL A;  2EIJ H;  3LNQ A;  1CGP A;  3GVA A;  1O7F A;  2ICW G;  3BPV A;  2Y75 A;  2E1O A;  2C6Y A;  3V4G A;  2GOM A;  2R7W A;  1RKW A;  3PO2 J;  1X3W B;  3DEU A;  5J1U A;  3ZGK A;  2HPM A;  1XGN A;  4I0A A;  1IZ1 A;  2Y0S A;  2ZBK A;  3TOB A;  2VLA A;  4I0B A;  4ZDP A;  1J2X A;  2VJI A;  2FML A;  4KMU X;  5E8I A;  1X58 A;  1LE8 B;  4IX7 A;  3DPT A;  4L0Z B;  1YYV A;  2F6C A;  1YIO A;  3BTL A;  3QPH A;  4HPQ A;  4RB1 A;  2FBK A;  2IS2 A;  3FX3 A;  2ZO4 A;  3KEQ A;  5B5E C;  1P7J A;  5GTI C;  2R7R A;  5F6F A;  3OYI A;  2VE8 A;  4PFO A;  3CES A;  1PP7 U;  2M2E A;  3ZMS A;  2LY9 A;  3CUQ B;  2IS4 A;  2LH9 A;  2ACJ A;  2RVC A;  4XRM A;  3MKZ A;  1D8K A;  1OCR H;  1HBX G;  1U3E M;  4BXX J;  3L09 A;  1SD6 A;  1O57 A;  2R7S A;  1TT0 A;  3CCJ I;  3CJR B;  2BEO A;  4E7S A;  2ZCW A;  4QLC U;  3B02 A;  4RAY A;  4AC0 A;  2L01 A;  2R3S A;  2E7W A;  5DCM B;  3RSN A;  3A01 B;  1WJA A;  5AIQ A;  4F91 B;  1W5T A;  1D8J A;  1FIA A;  3FWE A;  1JHF A;  5J47 A;  1J59 A;  2MBF A;  2O0Y A;  3IP4 B;  4PSX A;  3L1P A;  3ZMV A;  2E2J J;  1KQ8 A;  4IOA F;  2A5W A;  3H0D A;  3PUF A;  2ZJR F;  3C18 A;  1YRN A;  3CDH A;  2ZNZ A;  4ZJZ A;  2L02 A;  2MYS A;  2DO7 A;  3GTQ J;  1L3L A;  4NQW A;  4B09 A;  4P55 A;  1D5Y A;  5K5R A;  2HPI A;  3ISP A;  5K5Q A;  4HF0 A;  1G6N A;  3KEY A;  2NYX A;  1D3Y A;  2R5Z B;  2DU9 A;  1IN7 A;  4ZYE A;  4BYY A;  3HOV J;  2R4G A;  2Y31 A;  5E3M A;  1NH3 A;  3GFM A;  2VJJ A;  1W36 D;  1YI2 I;  2H09 A;  3S1M J;  2NOJ B;  3E6M A;  4N9H A;  3WGG A;  5M3F J;  4A3L J;  3OOU A;  1FY7 A;  2MH9 A;  3IKV A;  3NAU A;  4FE4 A;  5F0H A;  3L2R A;  2E5N A;  3LSM A;  2Z5U A;  1P92 A;  2BOL A;  2EIN H;  5FKM A;  1WKM A;  3A02 A;  4O3M A;  3WGH A;  1YQA A;  2P0W A;  1FYL A;  2KZV A;  4L5E A;  3O2P E;  1TNS A;  4C9Y A;  1K4S A;  3OS1 A;  5HLI A;  3ESW B;  3BR0 A;  1Z1D A;  4KA4 A;  2ECB A;  3MKW B;  5F1J A;  3DBL B;  3ZQ7 A;  2M87 A;  3HSR A;  2PFB A;  2DN0 A;  3SQN A;  2IA2 A;  2IW5 A;  4E7I A;  1H88 C;  2AXT C;  1KZH A;  2IGM A;  1PUF A;  1K78 A;  2XAF A;  1CF7 B;  3HBL A;  3NQO A;  1U78 A;  3S2D J;  1TNT A;  2CSO A;  3DBH B;  2RQP A;  1OR7 A;  2LK2 A;  5EGO A;  1O4X A;  2K3P A;  3RJP A;  3RKW A;  4KNY A;  3LQR A;  3R6S A;  5LFA A;  3EUH C;  5KCM A;  1I5Z A;  3FXR A;  1DU6 A;  4WX9 A;  5HLG A;  3PQK A;  1RKT A;  2FJ1 A;  1ZHF A;  2EZI A;  2A6E F;  4BBS J;  4EJT A;  3L2C A;  3CJN A;  2LKP A;  3GTM J;  1P9Q C;  2BZT A;  2ZME A;  2QVO A;  4I76 A;  3GFI A;  2L2O A;  4A3J J;  1VZ0 A;  4C2T A;  1SMY F;  5HLT A;  1K6O A;  2FQ3 A;  1MND A;  1YX3 A;  3DQV C;  3UR3 C;  1S7A A;  1V4R A;  4B43 A;  1Z3X A;  4B3X A;  3D0S A;  1S5L C;  2HVS A;  3VFZ A;  2CQQ A;  2VQC A;  4LIT A;  3T1B A;  5E20 A;  1B1B A;  3SEZ A;  3JAM Z;  2Q2E B;  1REP C;  1R4N B;  1MMG A;  4I09 A;  1VQN I;  2CQX A;  1HKS A;  2XAG A;  3P5J A;  4NDL A;  2PQ8 A;  3DEE A;  4MTD A;  3L2U A;  4V19 K;  1LKX A;  2DYR H;  4EM2 A;  3TED A;  1ERD A;  4EEF G;  3L2Q A;  2WA0 A;  3BG6 A;  2R7U A;  1A04 A;  3ECO A;  4M71 A;  4XKB A;  1WZ2 A;  2OPT A;  5BNG A;  4CCO A;  3TL4 X;  2DW4 A;  2K5C A;  1RNL A;  5JVG F;  1MSE C;  4HDV A;  1GLN A;  2Q8K A;  3FK6 A;  1LQ1 A;  2HS5 A;  2HEO A;  1TQP A;  4BU2 A;  2Z33 A;  1ZQ3 P;  1MD0 A;  4J00 A;  3BY6 A;  3AG2 H;  2X6W A;  4H0E A;  1MJA A;  2D1V A;  1LFP A;  1YX5 A;  4V2G A;  1ETK A;  5GTH C;  4P9U A;  1JT0 A;  1Z3Y A;  2I5U A;  2KMU A;  1R7J A;  2HTS A;  2R7D A;  4OMZ A;  3CCQ I;  4Y15 A;  1FP1 D;  2DA4 A;  2P7V B;  2ZXW H;  3HUG A;  2L4A A;  1IRX A;  2GXA A;  3WTS C;  4TV7 A;  3BG5 A;  4KJZ A;  2OQG A;  1ZRE A;  1TWG J;  1G3S A;  1T33 A;  2HXO A;  3WG7 H;  2F5E A;  2NNN A;  2UWM A;  2JVH A;  5F64 A;  4A2U A;  4YRV A;  1IDZ A;  3ZMU A;  3K4J A;  2EZL A;  4DBR A;  4PJJ A;  2CW0 F;  2CRG A;  3C3W A;  3PQJ A;  3OYJ A;  3CF2 A;  2E19 A;  4I02 A;  1FIP A;  1ODD A;  5E79 C;  5FRO A;  5ILV A;  3JRH A;  2HYJ A;  4ENN A;  4BJ6 C;  4Q4Z F;  1MDM B;  5IY5 H;  2OTL I;  3ROU A;  2LLK A;  4DZJ A;  3KP5 A;  5DS9 A;  3K4L A;  4LLL A;  3EUA A;  3KIO A;  2L4M A;  3KZI C;  1D5V A;  5BMZ A;  3OYN A;  2ZNY A;  4O6J A;  2IJL A;  2LNB A;  4ESB A;  3FMQ A;  2R7V A;  3IHU A;  2B7E A;  1O3Q A;  5F04 A;  2DA6 A;  3OWT A;  1XD7 A;  1FNN A;  4RAZ A;  2W24 A;  1R5G A;  5EEH A;  3F8C A;  3BR2 A;  2QQB A;  1VQ5 I;  3HGY A;  3BG9 A;  1YIJ I;  3RYP A;  3IL2 A;  1I3Q J;  2OA4 A;  4CUG A;  3M07 A;  4CDG A;  1LFB A;  2KJB A;  3ULQ B;  4KFC A;  5EEA A;  1W5C C;  1ZK8 A;  4M9S A;  2K86 A;  1U9N A;  2K9Q A;  2YSR A;  2VON A;  4L5J A;  4CYC B;  4UUS A;  3S8P A;  3GBG A;  1FPQ A;  2DA5 A;  2CV2 A;  3QP5 A;  4FT8 A;  3JRA A;  2HVQ A;  3LSR A;  2MLK A;  3J7A O;  1W7P B;  1XDS A;  4MQV A;  1YJW I;  4KIS A;  3T8R A;  1Y0N A;  2W00 A;  1IV6 A;  1IXS B;  4XID A;  5EDN A;  2X6Y A;  4GRI A;  2A68 F;  1WVR A;  5M5X J;  3GTK J;  3BT9 A;  2TCT A;  1B9N A;  4C3I J;  5J8C A;  5TJJ A;  2E1M C;  4IPA A;  3VOE A;  3PJR A;  2BV6 A;  4LOC A;  2EFO A;  1Z9C A;  2QCO A;  5JHU A;  2MFZ A;  4RBO A;  2JWT A;  3BP8 A;  4U0Y A;  2W84 A;  4D0P A;  3FXU A;  3FXO A;  2KIS A;  2HNH A;  5BPI A;  2XPV A;  4A6D A;  2XPU A;  3I4P A;  4XIC A;  4GXO A;  4B44 A;  4KIT B;  2E60 A;  2WB1 A;  1ITY A;  3F8B A;  3ZQQ A;  2HYF A;  3GZ6 A;  2XF7 A;  2W1O A;  2LC2 A;  1MMN A;  2GXG A;  1GVJ A;  2DA7 A;  5D8L B;  3CMM A;  1BC7 C;  2MW8 A;  4QPO A;  1RZ4 A;  2LYC A;  4RB3 C;  3MZH A;  3HHG A;  3HRM A;  5E3L A;  2XRL A;  3AG3 H;  5HDG A;  1S7O A;  5K7Z A;  4E7J A;  3EPZ A;  5IOZ A;  1FTT A;  4A3B J;  1IXC A;  1BOA A;  2TRT A;  3BCB A;  2UXX A;  2B0L A;  4M3G A;  3WE3 A;  2HKX A;  1BJZ A;  5HDN A;  4N9I A;  1UST A;  2DLL A;  4GYI A;  3KFW X;  3RCO A;  2VKD A;  2FE3 A;  3E6D A;  2COM A;  2J5P A;  4KYW A;  1ZR2 A;  4NHJ A;  4ZC3 A;  1TZL A;  3ZQH A;  2X48 A;  2DCE A;  3JRB A;  1Z0X A;  2VT2 A;  2F5D A;  5CVI A;  3RKY A;  4A3I J;  4LD5 A;  1H9T A;  3EYY A;  3K2Z A;  4M6V A;  2P5K A;  1MMD A;  3O6B B;  4PJ0 C;  1MH4 A;  3AL0 C;  4XMY A;  1HKT A;  3HGG A;  4UUV A;  1BM9 A;  1LJ9 A;  1B8I A;  2PLY A;  1PVE A;  1EF4 A;  3GXO A;  4B3A A;  2CFO A;  1RUN A;  2K4J A;  3RQI A;  4A0Z A;  4MEX F;  4NC7 A;  5F0C A;  3RKQ A;  2BW3 B;  2YU3 A;  3KCC A;  2QBY B;  4C3J J;  2ID3 A;  5ERI A;  4RB0 A;  4RM3 A;  1WJE A;  3I5U A;  2JT1 A;  4JBA A;  2EV0 A;  5GAD J;  1W0U A;  4E70 A;  5EEG A;  1MIJ A;  1MJ9 A;  3QAH A;  1SMT A;  2VB6 A;  1U8R A;  2IA0 A;  1U0J A;  2DFF A;  3F6O A;  3IH2 A;  2QEN A;  4N0B A;  4OAY A;  1YW7 A;  5C44 J;  1HLV A;  2EQR A;  2VJ4 A;  3F8M A;  3JR9 A;  4PSW A;  4XKV A;  2DFH A;  2XUB A;  2MD5 A;  4IHS A;  4RB2 C;  2JK3 A;  1E3O C;  4XBF A;  1NTC A;  2NVT J;  4A0X A;  4PFP A;  2EFQ A;  1E0E A;  2E7X A;  2P6S A;  1XGO A;  2FNP A;  2FX0 A;  2STW A;  1N25 A;  1W4M A;  3BR1 A;  2DPU A;  4PCQ A;  2JVG A;  2LBF A;  3G6E I;  1FLI A;  3VPR A;  4BAY A;  3S32 A;  1U8B A;  4YFX F;  3DLA A;  2M45 A;  2QM3 A;  1LE8 A;  2NVQ J;  4X1E A;  1R1V A;  2P6T A;  3HM5 A;  4G6T B;  1BC8 C;  1FOX A;  2ETH A;  2F5C A;  3ECH A;  1B4A A;  4AVZ A;  1K4T A;  5B1A H;  2ELK A;  6PAX A;  5E8G A;  5JLX A;  3CC7 I;  3I59 B;  1UEL B;  3DU6 A;  1Y1V J;  3LST A;  3S17 J;  1D0Y A;  4F92 B;  4RAF A;  2HOT A;  1T6S A;  4M72 A;  1XG1 A;  1BR4 A;  1G3W A;  4IKF A;  5JVT A;  4EGZ A;  2VUM J;  2WV1 A;  3GTG J;  1Y6I A;  3M9A A;  1OIS A;  2NVX J;  2JJ7 A;  4IOC F;  3FM3 A;  3RPU D;  1WH5 A;  2HQN A;  2XVC A;  3JSP A;  3IH3 A;  4A3F J;  4G94 A;  3GTJ J;  2FD5 A;  1Z7U A;  1TT5 B;  1QZE A;  3KX2 A;  3GLL A;  1FC3 A;  4ANJ A;  1JUS A;  2X1E A;  4XRF A;  5HVQ C;  5J4V A;  5E1Z B;  2LOO A;  2GIZ A;  5JR3 A;  5F27 A;  3RKX A;  3IAM 2;  2QGU A;  5CVJ A;  2OTJ I;  2AQF A;  1T0F A;  2AHQ A;  3A2K A;  5EG0 A;  2O7O A;  2OV7 A;  3OYG A;  2FRH A;  3PO3 J;  2G0E A;  2M4G A;  1AKH A;  1HC8 A;  4CA0 A;  1F36 A;  2M34 A;  3ZRG A;  3HG9 A;  2XAH A;  3HZJ A;  5LRR A;  3MQ0 A;  1AU7 A;  1TP4 A;  1IRF A;  2JA8 J;  5DM7 F;  4Y52 J;  1FWZ A;  3OL4 A;  5LGU A;  4A3M J;  2JRT A;  1WI3 A;  2DDB A;  2VBY A;  4IRI A;  2HQ5 A;  4ZH4 F;  1R1T A;  3I4M J;  3S3M A;  2RAE A;  3MD2 A;  2JPC A;  4PZJ A;  3O8G A;  1IW7 F;  2ZXJ A;  1JE8 A;  3SZG A;  1D1B A;  2B63 J;  4AWX B;  2ZJ2 A;  2ZJQ F;  4FIS A;  1NK2 P;  2CQK A;  2V1D A;  1DP7 P;  1X19 A;  4WXH A;  4A6E A;  4IHX A;  1I6H J;  2LKS A;  1BR1 A;  1IN6 A;  1XMK A;  3M8J A;  3QPS A;  1UHM A;  1KU3 A;  3FKJ A;  5HS9 A;  3VEP A;  3GEZ A;  3K1P A;  2P81 A;  5FO5 A;  1T38 A;  3W2W A;  3I3L A;  1KQ9 A;  2A3S A;  3FMR A;  5DEQ A;  2NNY A;  3HIF A;  3JRF A;  3JW4 A;  1YO5 C;  5HNF A;  1OJL A;  1FMW A;  1KU7 A;  4IHV A;  1S8N A;  3OYB A;  3JRG A;  3OOP A;  2UXN A;  4F55 A;  5GAH J;  4HX8 A;  1T98 A;  5J1Y A;  1CF7 A;  1VQ7 I;  1ZRD A;  3DTE A;  2WY7 Q;  3DKY A;  2WAF A;  3G1M A;  5ED4 A;  1QPM A;  2AQE A;  3NEU A;  4WXD A;  2JRM A;  4IEJ A;  4WK8 F;  3HYI A;  3S2H J;  3CMA I;  2VKV A;  4HRI A;  4UY8 I;  1QHH D;  4V2F A;  4HX7 A;  1MBF A;  1VI0 A;  5IYB J;  4BJ5 C;  2HOA A;  2CW7 A;  5B66 C;  3H9G A;  3F21 A;  5FLX K;  1YW9 A;  3AG1 H;  2OZ6 A;  4ITV A;  4ETS A;  1OLT A;  3ZCO A;  2W85 A;  1FBS A;  4XQF A;  1GV5 A;  2IGK A;  3N97 A;  3LMM A;  1B72 A;  1QZY A;  1XCV A;  3OYM A;  1BI3 A;  4BDY A;  2KHM A;  4LB5 A;  1IN5 A;  3HPH A;  1OR7 C;  2F4M B;  2IGN A;  2PJP A;  1FOK A;  4A3G J;  3I53 A;  4RA2 A;  1OFC X;  3JTH A;  2ZSI B;  2BY3 A;  4JX6 A;  4MLO A;  2I10 A;  2M4K A;  1ZLK A;  3MVP A;  3M4O J;  3VSL A;  4A3E J;  2DOF A;  2ZME C;  2LD5 A;  3E0J B;  1C0W A;  1ZGW A;  4L5I A;  2EIL H;  1JXS A;  2IS6 A;  2W82 A;  4LFU A;  3K0L A;  3EYI A;  1OCT C;  5F0F A;  3K4M A;  1JTY A;  4J19 A;  2M8G X;  3C2G A;  3F23 A;  1T08 B;  3R0A A;  1ZGA A;  3QYE A;  5D5W B;  3DPL C;  2H6B A;  4E4H A;  3QOE A;  2VPR A;  2HQA A;  4LLN A;  3OYC A;  3VWB A;  2Y48 A;  2L9N A;  1O3T A;  3GME A;  2D5V A;  2EPF A;  2HXI A;  3PNY A;  1VQ6 I;  2E2H J;  2IA1 A;  2IXS A;  4RGU A;  2JA7 J;  2R93 J;  5IYC J;  4HLX A;  4FCY A;  4UHT A;  3CO6 C;  5CJ9 A;  2FNA A;  2Y0M A;  1PUE E;  2E1M B;  5H2F C;  4OOI A;  4PUS A;  3H9Q A;  4YIF A;  3OIO A;  4JQF A;  5L3D A;  1FEX A;  2O5R A;  2PI0 A;  4MQ9 F;  4M3B A;  2PJR B;  2NS7 A;  2DMU A;  5B1B H;  2L5Q A;  3BWG A;  3SYT A;  2DOE A;  3PL8 A;  3V8K A;  2M1B A;  3CLO A;  2RC4 A;  1X2N A;  2X4H A;  1SFE A;  3OYF A;  1U5T C;  1BW6 A;  2P8T A;  2RNJ A;  4WXC A;  3S93 A;  1IO2 A;  3F72 A;  2P5V A;  1PP8 F;  2V6E A;  4XN0 A;  2EIK H;  3HXL A;  3TGN A;  1TWC J;  1O3S A;  1FYM A;  1TLH B;  1YTY A;  4E6K G;  3W6J B;  4BUP A;  3HKZ N;  4XLA A;  2RGV A;  4LB6 B;  5HLH A;  5IT3 A;  2CQN A;  2PEX A;  2KP6 A;  2EFW A;  2CG4 A;  1X4P A;  3NRV A;  3QOD A;  3I71 A;  3LA3 A;  4XLN F;  3FXL A;  5LEK A;  1NG6 A;  4BEH B;  3HOU J;  5J8F A;  3AG4 H;  2MGQ A;  2Q1Z B;  5AIP A;  2WAQ N;  2L9V A;  3LA2 A;  2M30 A;  4RDU A;  2XAJ A;  5DUK A;  4LG0 A;  1KYZ A;  4W97 A;  2G9W A;  3FBN B;  5BPD A;  2M0C A;  4II2 A;  4OIP F;  1JJ6 C;  2ZXH A;  5C4X J;  2RKH A;  1ZRF A;  1BIB A;  2VIX A;  3B6C A;  3K70 C;  2DFE A;  4QWQ A;  1TWF J;  3J7A Y;  2COB A;  2HZT A;  3PIO F;  3ABK H;  2X85 A;  4OAZ A;  1MZB A;  1BW5 A;  1VQM I;  2ZFU A;  1HW1 A;  1W7P A;  3OMY A;  4L9T A;  5EJC A;  4F52 A;  4D1Q A;  3F9K A;  3IUO A;  4XLC A;  3LSI A;  1I6X A;  1H89 C;  1VQO I;  3ELK A;  1ETQ A;  1MBG A;  2WY8 Q;  4L9N A;  5CKT A;  2HGC A;  4HQM A;  1RRJ A;  4CO8 A;  2L9R A;  3ABT A;  1LEA A;  1EKE A;  1MNM C;  3MZ8 A;  3ABM H;  2QQA A;  1F1Z A;  2CUJ A;  2O8K A;  3V42 A;  2XGE A;  4RM2 A;  3OR1 C;  2EH3 A;  2EJR A;  2JSC A;  2LRD A;  4MHG A;  2H8R A;  3I4N J;  1HW5 A;  3DKX A;  1GUU A;  3IWZ A;  1ZR4 A;  5EZH A;  3WOD F;  3HRU A;  2A69 F;  1XB4 A;  1IXR C;  3OSG A;  4A5M A;  5FKO A;  1X1A A;  3M1C A;  3PUB A;  4B47 A;  4O5V A;  1FX7 A;  4YII A;  5IP9 J;  4PDK A;  1PDN C;  4U0W A;  3V8L A;  2YPR A;  3DCF A;  5D5V B;  2K02 A;  2XRN A;  1V3F A;  4YG2 F;  3CO7 C;  5ICF A;  1BJA A;  4G6Q A;  2V79 A;  2M3A A; 
#chains in the Genus database with same CATH homology
 4BNC A;  1XGS A;  4OIQ F;  3P7N A;  4P5O A;  3RI4 A;  3ZN1 A;  4R79 A;  3RIR A;  4K2E A;  1QBJ A;  1DPR A;  1QGP A;  5FLX Z;  4Q48 A;  3KP3 A;  1HQC A;  2OAZ A;  2VC1 A;  2IVM A;  2KIU A;  4BXU A;  1WQ2 A;  5D6F A;  2DPD A;  4BHP A;  5F1R A;  4IRG A;  2KIM A;  1U5T A;  4HA8 A;  5D4S A;  3KET A;  1B9M A;  3T5X A;  3U2R A;  2EB7 A;  3WGI A;  2EA2 A;  1WI9 A;  2E1N A;  3R4K A;  3JSO A;  4IXA A;  1ZAO A;  3H92 A;  2EK5 A;  5BOX A;  2O03 A;  5ILU A;  2TDX A;  5A2Q K;  2DBB A;  3FM5 A;  3F8N A;  2FOK A;  3FZV A;  2ISZ A;  2DQL A;  3C1D A;  2H94 A;  1P4W A;  3SFZ A;  2OQR A;  1ZG1 A;  3RTR A;  2VOD A;  3K1N A;  3ZMT A;  2NRA C;  5ICC A;  3PFI A;  2FSW A;  2GA2 A;  2HFH A;  2DK8 A;  1ULY A;  3KZY A;  3I59 A;  5DCF A;  5DV5 A;  3LQQ A;  2IT0 A;  3TO7 A;  3P9C A;  5D5X B;  4EJW A;  3V8J A;  4EM1 A;  1ZGJ A;  1ZRC A;  3Q9S A;  5ICE A;  2D1H A;  3QU6 A;  4I01 A;  2A07 F;  4Y13 A;  4KIF A;  3WE2 A;  1KA8 A;  2F2E A;  3Q5F A;  4ZZD A;  2OD5 A;  1Q1H A;  1RUO A;  1J0R A;  1XGM A;  4ENK A;  1IN4 A;  2ESN A;  1FBQ A;  5JFR A;  1WSU A;  3ZMD A;  1YW8 A;  2XIG A;  4A12 A;  2LDU A;  3U9G A;  4Z2Y A;  3IKT A;  3WTV C;  4G6D A;  5CVR A;  5HDK A;  3WU0 A;  2YR2 A;  4KUM A;  4MGR A;  4I7H A;  2ZME B;  4L9V A;  4HYE A;  1QZZ A;  2EWN A;  1QQI A;  3TDU C;  1H9G A;  1F5T A;  1HXD A;  1ONV A;  1DUX C;  4U7B A;  3V7C A;  3DFG A;  4HQE A;  1ON1 A;  3L9F A;  3IWF A;  1TQM A;  4ZYH A;  3GFL A;  4M73 A;  3QPT A;  1K7A A;  3RDI A;  1MKM A;  3GW2 A;  1KQ0 A;  5K1Y A;  4WF2 A;  2NS0 A;  2D45 A;  3LAP A;  2XHK A;  1G4D A;  4FHT A;  2HKO A;  4AIH A;  1EH6 A;  1YS6 A;  4KIG A;  3V7S A;  2VOP A;  3ZMZ A;  4ON0 A;  3KE2 A;  3FHZ A;  4R8H A;  4UXN A;  1ZG5 A;  2RV8 A;  4ENJ A;  2DAO A;  1QO0 D;  4CIC A;  3V7R A;  2YX4 A;  3BRO A;  3WG9 A;  3HSF A;  2P7C B;  3DKW A;  5JI6 A;  3SHF A;  2OBP A;  3DV8 A;  4A5N A;  3FF5 A;  4EJU A;  4WCG A;  4MEY F;  4A0Y A;  2LF8 A;  3BOQ A;  5HS8 A;  4M9Z A;  3EDP A;  1BBY A;  3CUQ A;  5FD5 A;  2BGC A;  5FFZ A;  1IF1 A;  4AVP A;  3ZP5 A;  2EV5 A;  3E5X A;  4U7D A;  1FSE A;  1FP2 A;  4LGW A;  1W5S A;  1STZ A;  3ML6 A;  1HW2 A;  5E1W A;  5DCM A;  5LLQ A;  2WV0 A;  3W6K B;  1R23 A;  3M8F A;  4EVI A;  4AD9 A;  5CVU A;  2IP2 A;  3MFK A;  5AON A;  4XSX F;  2HYG D;  1ZG3 A;  1SD5 A;  2DI3 A;  3KP2 A;  3DP7 A;  3FMS A;  2EA4 A;  2K27 A;  1ZAR A;  4AIJ A;  2FA5 A;  4L18 B;  1J75 A;  4EGY A;  1T2K A;  2EV6 A;  4UV8 A;  3BJA A;  1XSD A;  1ZYR F;  3J81 K;  1B6A A;  4U0V A;  4F7Z A;  3GLX A;  2XAQ A;  2QZ8 A;  1JHH A;  1SFU A;  3F8F A;  4UV9 A;  2HDC A;  1P6R A;  2JPB A;  1J5Y A;  2CWE A;  2RN7 A;  3ERE D;  4IHT A;  3REO A;  3TO6 A;  1L0O C;  2ESH A;  2GA1 A;  1K79 A;  1FBU A;  5E17 F;  1IUY A;  1J7K A;  4PGG A;  3MAJ A;  3EET A;  1E17 A;  1E2X A;  1MJB A;  1XSX A;  4DQ2 A;  5H6Q A;  3HTU A;  3MWM A;  3GZ5 A;  1I1G A;  1IRG A;  3GYH X;  2RDP A;  2PMH A;  5BQT A;  2GQQ A;  5L3B A;  4M74 A;  2XV4 S;  2BE5 F;  1U6G A;  3I54 A;  4EJV A;  5KVR A;  4UNO A;  2AXL A;  2BYV E;  2A5Y B;  1OYI A;  3B73 A;  4CGZ A;  4FX4 A;  2O6G E;  2JZY A;  3ABU A;  2Q2E A;  2FF4 A;  2KIF A;  3JAM K;  3KP6 A;  3LWF A;  1YS7 A;  2VBW A;  4KT5 C;  5FD6 A;  1WWX A;  2MH2 A;  5LGT A;  2YX7 A;  2PBI A;  5D5U B;  3N4M A;  1OPC A;  2ISY A;  1R22 A;  1LDJ A;  2P4W A;  2FBI A;  1TQI A;  3KP7 A;  3BPX A;  3F22 A;  1EH8 A;  4WWC A;  3T8T A;  2VT3 A;  1YG2 A;  5K5O A;  3R0J A;  4OMY A;  3WU1 B;  2D2W A;  1UB9 A;  4IVN A;  2GWR A;  4G7O F;  1ZH5 A;  3TDZ C;  2Z9O A;  2QLZ A;  2IPQ X;  4HV6 A;  1GXP A;  3KP4 A;  4KMF A;  2FBH A;  4ASN A;  2V6C A;  1R36 A;  3WTT C;  2VN2 A;  1KGS A;  1UFM A;  3WTW C;  1MDM A;  3E97 A;  4EMS A;  1DDN A;  1GXQ A;  1EH7 A;  1XSV A;  2MC3 A;  5LHH A;  2A6H F;  3K69 A;  3M7G A;  3HOS A;  3QOP A;  5D8K B;  2Z99 A;  2DFI A;  4S04 A;  1ZN2 A;  4R1H A;  1Z6R A;  2O8X A;  2VXZ A;  4OIN F;  3LAJ A;  2L54 A;  3TKY A;  5H6R A;  1BIA A;  4KDP A;  1S6L A;  3E6C C;  3H3U A;  4IRH A;  2JTV A;  2W57 A;  1J9I A;  4XSZ F;  2AS5 F;  4RGR A;  3KZZ A;  3I64 A;  2QUF A;  5DDG A;  1USS A;  3BZ6 A;  3J81 Z;  4HV5 A;  4HBL A;  2PG4 A;  2CFX A;  1KU2 A;  1S3J A;  3MEX A;  1RI7 A;  4IJA A;  4HLY A;  4BHB A;  2EFN A;  1SFX A;  1I1S A;  1FT9 A;  3DXJ F;  2WWY A;  2VBX A;  2GXB A;  3RPU A;  3CUO A;  1P2F A;  5CVV A;  4GGG A;  5J6X A;  4OU0 A;  3WTY C;  2MLG A;  2XRO A;  3L00 A;  3L7W A;  2V1X A;  5LHG A;  4S05 A;  4JK1 X;  4G7Z F;  3TQN A;  4Q5S F;  1LB2 A;  4HF2 A;  3I58 A;  3KLN A;  2XKP A;  1XN7 A;  2Q0O A;  2M8E A;  4B8X A;  2STT A;  1SD4 A;  1EV7 A;  3IRQ A;  4FX0 A;  1BI0 A;  3P9K A;  2G7H A;  1R1U A;  2OU2 A;  1LDK B;  4L9J A;  1OMI A;  1X3U A;  3M1E A;  1LVA A;  3HSE A;  2QBY A;  3SZP A;  1U2W A;  4KN4 X;  4HDU A;  3VOD A;  2GIV A;  3R61 A;  3COA C;  5FB2 A;  3H3Z A;  4BHC A;  5DUI A;  2VE9 A;  5FGM A;  4YFK F;  5DD4 A;  3SZT A;  4M6Y A;  1R58 A;  3HRT A;  1IN8 A;  1Z05 A;  1F9N A;  3TOA A;  4CHU A;  4KN7 X;  2F5F A;  3CTA A;  2H6C A;  4ZYG A;  1KYW A;  3GO5 A;  1HKQ A;  1R5H A;  1YFH A;  1B59 A;  4OIR F;  2O61 A;  5BS6 A;  4RGX A;  4CYD A;  1Y0U A;  1AOY A;  2DTR A;  1O3R A;  2A61 A;  4ESJ A;  1TTY A;  4HAM A;  1XCB A;  3Q9V A;  3G73 A;  1OYW A;  3RYR A;  4Q47 A;  5LRS A;  1YLF A;  3E5Q A;  2E1C A;  3OV8 A;  5D6E A;  3I0T A;  3QU3 A;  5IT9 K;  3F3X A;  4LG0 B;  3KEO A;  4MTE A;  3IC7 A;  2KJC A;  4LJZ F;  2X0L A;  3U1D A;  1ON2 A;  2VOO A;  1HSJ A;  4M9X A;  4AIK A;  2WTE A;  2MA3 A;  5CLS A;  1I27 A;  3EUH A;  4I98 B;  1AWC A;  3CUQ C;  2HWV A;  4MNU A;  3J80 K;  1BI2 A;  3GX4 X;  3BJ6 A;  3E3V A;  3BDD A;  2K7L A;  4G7H F;  2H27 A;  2PMU A;  5KK1 A;  4HOB A;  5LBQ A;  2ADU A;  1P4A A;  2ZFW A;  2HQR A;  1SAX A;  2DQR A;  3LFK A;  1K78 B;  4IF4 A;  4HX4 A;  5LEJ A;  3C7J A;  2R7F A;  3R60 A;  4GO1 A;  4ZYD A;  3G3Z A;  2QQ9 A;  3HOT A;  2GAU A;  2LF7 A;  4BQA A;  2Z3Y A;  2KRF A;  5L3E A;  4EV0 A;  5H20 A;  2ZKZ A;  2CO5 A;  1T39 A;  1LNW A;  4LK1 F;  1GHC A;  2CYY A;  1OKR A;  1FYK A;  3O3K A;  3BJO A;  4Y17 A;  1F4K A;  2W25 A;  3MZY A;  1UCR A;  2IRF G;  2KKO A;  2DT5 A;  4GYG A;  2V1U A;  2K4B A;  4ESF A;  4G8X A;  1XDU A;  5ILS A;  4HW0 A;  4P9F A;  3VB2 A;  4P96 A;  1U5T B;  5D4R A;  1HST A;  1DPU A;  1NHA A;  2FEZ A;  5L3C A;  1VTN C;  3K1M A;  2XGX A;  3RPQ A;  3HRS A;  2FXA A;  3T0Y A;  4M6X A;  4EJO A;  5TRD A;  2XKO A;  1LEB A;  2LSO A;  4LK0 F;  4L0Y B;  1P4X A;  4I2O A;  2CGP A;  2M5W A;  5A2Q Z;  4CXF A;  3DF8 A;  1MGT A;  4LLG F;  4CZZ A;  1JGS A;  2QWW A;  4UVC A;  1QNT A;  1UHW A;  3GF2 A;  2NAZ A;  1TBX A;  2XAS A;  1S29 A;  2VC0 A;  3WTU C;  4HF1 A;  3M8E A;  1W7P D;  5E1X A;  2QYO A;  5CYV A;  3GFJ A;  3EQL F;  2GZW A;  2O3F A;  3JTG A;  2HOE A;  3WTX C;  1RIO H;  4NB5 A;  2HTJ A;  3E6B A;  4G9Y A;  2V9V A;  4RGS A;  5IT9 Z;  4HZF A;  3E5U A;  2VBZ A;  5HOO A;  2L3D A;  2FMY A;  5LGN A;  3FXQ A;  4OIO F;  5DD8 A;  2OZU A;  2ELH A;  4PGH A;  4RS8 A;  1BI1 A;  1IAW A;  3SXY A;  3J80 Z;  3MCZ A;  4EM0 B;  2EFP A;  3TO9 A;  1ZLJ A;  4LMY A;  1BN5 A;  1O7L A;  4U88 A;  3HTS B;  3HHH A;  1XMA A;  4XLP F;  1SD7 A;  2FU4 A;  3P9I A;  4KIB A;  1LDD A;  2BBY A;  3D5L A;  4DNC A;  3AAF A;  1R00 A;  1OYY A;  1WRJ A;  4UVB A;  4EQQ A;  1G3T A;  4ZZL A;  2HR3 A;  4ENM A;  2P5L C;  5L3F A;  3WTZ A;  5HS7 A;  1FSH A;  3KLO A;  1KU9 A;  2WC2 A;  5L3G A;  3GWZ A;  2PN6 A;  5FFX A;  3S2W A;  3QRF F;  1Z91 A;  4YFN F;  1TW2 A;  3LA7 A;  4UVA A;  3ZN0 A;  4KIC A;  4BH9 A;  5LHI A;  1H0M A;  2J5O A;  3QP6 A;  1TW3 A;  3IRR A;  2UZK A;  1Z6T A;  5DYM A;  5E18 F;  1G3Y A;  3K9T A;  3F6V A;  2DK5 A;  2G7U A;  4GCV A;  5ICG A;  1FZP B;  3GUD A;  3ZPL A;  1CGP A;  3GVA A;  1O7F A;  3BPV A;  2Y75 A;  2C6Y A;  3V4G A;  3DEU A;  1XGN A;  4I0A A;  1IZ1 A;  2ZBK A;  3TOB A;  4I0B A;  1J2X A;  2FML A;  4KMU X;  5E8I A;  3DPT A;  4L0Z B;  1YYV A;  1YIO A;  3QPH A;  4RB1 A;  2FBK A;  3FX3 A;  2ZO4 A;  3KEQ A;  5F6F A;  2VE8 A;  1PP7 U;  3ZMS A;  3CUQ B;  2ACJ A;  2RVC A;  1D8K A;  1HBX G;  1U3E M;  3L09 A;  1SD6 A;  1O57 A;  2BEO A;  2ZCW A;  4QLC U;  3B02 A;  4RAY A;  2L01 A;  2R3S A;  2E7W A;  5DCM B;  5AIQ A;  1W5T A;  1D8J A;  3FWE A;  1JHF A;  1J59 A;  2MBF A;  2O0Y A;  1KQ8 A;  3ZMV A;  3C18 A;  3CDH A;  2ZNZ A;  2L02 A;  2DO7 A;  1L3L A;  4NQW A;  4B09 A;  4P55 A;  5K5R A;  5K5Q A;  3ISP A;  4HF0 A;  1G6N A;  2NYX A;  1D3Y A;  2DU9 A;  1IN7 A;  4ZYE A;  4BYY A;  3GFM A;  2H09 A;  3E6M A;  4N9H A;  3WGG A;  1FY7 A;  2MH9 A;  3IKV A;  2Z5U A;  1P92 A;  1WKM A;  4O3M A;  3WGH A;  1YQA A;  1FYL A;  3O2P E;  1TNS A;  5HLI A;  1Z1D A;  4KA4 A;  3ZQ7 A;  2M87 A;  3HSR A;  2PFB A;  3SQN A;  2IA2 A;  2IW5 A;  1K78 A;  2XAF A;  1CF7 B;  3NQO A;  1U78 A;  1TNT A;  2CSO A;  2RQP A;  1OR7 A;  3RJP A;  3RKW A;  4KNY A;  3LQR A;  3R6S A;  1I5Z A;  3FXR A;  4WX9 A;  5HLG A;  3PQK A;  1ZHF A;  2A6E F;  4EJT A;  3L2C A;  3CJN A;  2LKP A;  2QVO A;  3GFI A;  2ZME A;  1SMY F;  1K6O A;  2FQ3 A;  3DQV C;  1S7A A;  1V4R A;  3D0S A;  3VFZ A;  3T1B A;  3JAM Z;  5E20 A;  1B1B A;  1REP C;  4I09 A;  1HKS A;  2XAG A;  2PQ8 A;  4MTD A;  4EM2 A;  1A04 A;  3ECO A;  4M71 A;  2DW4 A;  1RNL A;  4HDV A;  2Q8K A;  1LQ1 A;  2HEO A;  2HS5 A;  1TQP A;  2Z33 A;  1MD0 A;  3BY6 A;  4H0E A;  1MJA A;  2D1V A;  4P9U A;  1R7J A;  2HTS A;  2R7D A;  4OMZ A;  4Y15 A;  1FP1 D;  2P7V B;  3HUG A;  2L4A A;  3WTS C;  4TV7 A;  2OQG A;  1ZRE A;  1G3S A;  2F5E A;  2NNN A;  2UWM A;  5F64 A;  4A2U A;  3ZMU A;  2CW0 F;  3C3W A;  3PQJ A;  4I02 A;  1ODD A;  5ILV A;  4ENN A;  4Q4Z F;  1MDM B;  3ROU A;  3KP5 A;  4LLL A;  2L4M A;  1D5V A;  5BMZ A;  2ZNY A;  4O6J A;  2IJL A;  2LNB A;  4ESB A;  3FMQ A;  3IHU A;  1O3Q A;  4RAZ A;  1XD7 A;  1FNN A;  2W24 A;  1R5G A;  5EEH A;  3F8C A;  2QQB A;  3RYP A;  3IL2 A;  2OA4 A;  4CDG A;  2KJB A;  3ULQ B;  4KFC A;  4M9S A;  2K86 A;  2VON A;  2YSR A;  4L5J A;  1FPQ A;  3QP5 A;  4FT8 A;  2MLK A;  3J7A O;  1W7P B;  1XDS A;  4MQV A;  3T8R A;  1IXS B;  2A68 F;  1B9N A;  5J8C A;  5TJJ A;  4IPA A;  3VOE A;  2BV6 A;  2EFO A;  1Z9C A;  5JHU A;  3BP8 A;  4U0Y A;  2W84 A;  4D0P A;  3FXU A;  5BPI A;  4A6D A;  3I4P A;  4GXO A;  3F8B A;  3GZ6 A;  2HYF A;  2GXG A;  1GVJ A;  5D8L B;  1BC7 C;  4RB3 C;  1RZ4 A;  3MZH A;  3HHG A;  3HRM A;  5HDG A;  1S7O A;  1IXC A;  1BOA A;  2UXX A;  2B0L A;  3WE3 A;  2HKX A;  5HDN A;  4N9I A;  1UST A;  2DLL A;  4GYI A;  3KFW X;  3E6D A;  2FE3 A;  2COM A;  2J5P A;  4KYW A;  4NHJ A;  2VT2 A;  2F5D A;  5CVI A;  3RKY A;  4LD5 A;  1H9T A;  3EYY A;  3K2Z A;  2P5K A;  3O6B B;  1HKT A;  4UUV A;  1BM9 A;  1LJ9 A;  2PLY A;  3GXO A;  1RUN A;  2K4J A;  4A0Z A;  4MEX F;  2YU3 A;  3KCC A;  2QBY B;  5ERI A;  4RB0 A;  3I5U A;  2JT1 A;  4JBA A;  2EV0 A;  4E70 A;  5EEG A;  1MJ9 A;  3QAH A;  1SMT A;  1U8R A;  2IA0 A;  3F6O A;  2QEN A;  4N0B A;  1YW7 A;  3F8M A;  2XUB A;  2MD5 A;  4IHS A;  4RB2 C;  4XBF A;  4A0X A;  2EFQ A;  2E7X A;  2P6S A;  1XGO A;  2FNP A;  2STW A;  1W4M A;  2DPU A;  4PCQ A;  1FLI A;  4BAY A;  4YFX F;  2M45 A;  2QM3 A;  1R1V A;  2P6T A;  1BC8 C;  2ETH A;  2F5C A;  3ECH A;  1B4A A;  6PAX A;  5E8G A;  3I59 B;  3LST A;  1T6S A;  4M72 A;  1G3W A;  5JVT A;  4EGZ A;  3M9A A;  3FM3 A;  3JSP A;  2HQN A;  2XVC A;  4G94 A;  1Z7U A;  1FC3 A;  4XRF A;  5HVQ C;  5E1Z B;  5JR3 A;  3RKX A;  5CVJ A;  1T0F A;  2FRH A;  2XAH A;  5LRR A;  3MQ0 A;  1IRF A;  1FWZ A;  5LGU A;  2JRT A;  2VBY A;  4IRI A;  4ZH4 F;  1R1T A;  2JPC A;  4PZJ A;  1IW7 F;  2ZXJ A;  1JE8 A;  4AWX B;  2ZJ2 A;  2CQK A;  2V1D A;  1DP7 P;  4WXH A;  4A6E A;  1XMK A;  1IN6 A;  1UHM A;  1KU3 A;  5HS9 A;  3VEP A;  3GEZ A;  3K1P A;  5FO5 A;  1T38 A;  1KQ9 A;  2A3S A;  3FMR A;  5DEQ A;  2NNY A;  3HIF A;  3JW4 A;  1YO5 C;  1KU7 A;  1S8N A;  3OOP A;  2UXN A;  4HX8 A;  1T98 A;  1CF7 A;  1ZRD A;  5ED4 A;  1QPM A;  3NEU A;  4WXD A;  4WK8 F;  3HYI A;  4HX7 A;  3F21 A;  5FLX K;  1YW9 A;  2OZ6 A;  4ETS A;  2W85 A;  1FBS A;  3N97 A;  1QZY A;  1XCV A;  1BI3 A;  4LB5 A;  1IN5 A;  2PJP A;  1FOK A;  3I53 A;  3JTH A;  1ZLK A;  1C0W A;  4L5I A;  1JXS A;  4LFU A;  3K0L A;  3EYI A;  3F23 A;  3R0A A;  1ZGA A;  5D5W B;  3DPL C;  2H6B A;  4LLN A;  2Y48 A;  1O3T A;  2IA1 A;  4RGU A;  4HLX A;  4UHT A;  3CO6 C;  5CJ9 A;  2FNA A;  2Y0M A;  1PUE E;  4OOI A;  4YIF A;  4JQF A;  5L3D A;  2PI0 A;  4MQ9 F;  3BWG A;  3V8K A;  2M1B A;  3CLO A;  2RC4 A;  2X4H A;  1SFE A;  1U5T C;  2P8T A;  2RNJ A;  4WXC A;  1PP8 F;  3F72 A;  2P5V A;  3TGN A;  1O3S A;  1FYM A;  1TLH B;  1YTY A;  3W6J B;  2RGV A;  4LB6 B;  5HLH A;  5IT3 A;  2PEX A;  2EFW A;  2CG4 A;  3NRV A;  4XLN F;  3I71 A;  3LA3 A;  5LEK A;  5J8F A;  5AIP A;  3LA2 A;  2M30 A;  2XAJ A;  5DUK A;  4LG0 A;  1KYZ A;  2G9W A;  5BPD A;  4OIP F;  2RKH A;  1ZRF A;  1BIB A;  4QWQ A;  2HZT A;  1MZB A;  1HW1 A;  1W7P A;  4L9T A;  1I6X A;  3ELK A;  4L9N A;  2HGC A;  4HQM A;  4CO8 A;  3ABT A;  1LEA A;  2QQA A;  1F1Z A;  2EJR A;  2JSC A;  4MHG A;  1HW5 A;  3IWZ A;  3WOD F;  3HRU A;  2A69 F;  1XB4 A;  1IXR C;  4A5M A;  4O5V A;  1FX7 A;  4YII A;  4PDK A;  1PDN C;  4U0W A;  3V8L A;  2YPR A;  3CO7 C;  5D5V B;  2K02 A;  4YG2 F;  1V3F A;  2XRN A;  5ICF A;  1BJA A;  4G6Q A;  2V79 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...