3ZOBA

Solution structure of chicken engrailed 2 homeodomain
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
67
structure length
67
Chain Sequence
b'GPMASDKRPRTAFTAEQLQRLKAEFQTNRYLTEQRRQSLAQELGLNESQIKIWFQNKRAKIKKATQA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords HOMEOBOX PROTEIN ENGRAILED-2
publication title Investigation of Homeodomain Membrane Translocation Properties: Insights from the Structure Determination of Engrailed-2 Homeodomain in Aqueous and Membrane-Mimetic Environments.
pubmed doi rcsb
source organism Gallus gallus
molecule tags Dna binding protein
total genus 13
structure length 67
sequence length 67
ec nomenclature
pdb deposition date 2013-02-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00046 Homeodomain Homeodomain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.60 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Homeodomain-like 3zobA00
2NS8A 2WB1N 1HDPA 3WHCA 1JKRC 2AHQA 3H0GJ 2CU7A 1MBJA 3IV5A 1K83J 1MBHA 1VI0A 2IEKA 1FTZA 1GV2A 2E1OA 1MSFC 2ME0A 1WGXA 2COBA 4B4CA 3OSFA 4B3AA 1B72B 3A02A 2OPTA 2R5ZA 3OOUA 2L9RA 3BTLA 2DA2A 2K40A 4DW6A 4X1EA 5J3LA 1F43A 4IHWA 5F1JA 3M3YJ 2DTZA 1MBFA 3BR5A 1HCRA 1VFCA 2M2EA 1LFUP 1IC8A 1P7JA 5EF6A 3FKIJ 2JMWA 4QTRA 1APLC 1I3QJ 1OFCX 5M5YJ 1FIAA 4AYBN 3BTIA 3CMYA 4A3CJ 1LE8A 1TWHJ 3S15J 1HOMA 1RETA 1TWAJ 1WH7A 4M3FA 3JRHA 1JTXA 4XIDA 3BG5A 1ETVA 2NOGA 2CRGA 5K7ZA 2QCOA 2XPVA 5J1YA 4MIMA 2LD5A 2H8RA 1R9TJ 1GV5A 1UHSA 1ETWA 3S1RJ 1Q1VA 3BR6A 5E3LA 5GPAA 1NTCA 5IP6A 5F27A 2ID6A 1IJWC 1ETKA 1E3OC 4JX5A 5C3EJ 2DA1A 2I10A 2MSYA 1DU6A 2EZHA 1AU7A 2VI6A 3RZOJ 4IHXA 1QPIA 2HXIA 3LNQA 3BQZA 2Y31A 4AC0A 2EQRA 1ORKA 1Y1WJ 4BBRJ 3JRIA 1EF4A 3BTCA 1WH5A 4A3GJ 1NK2P 5K7HA 1GUUA 3OSGA 4RDUA 1CQTA 2DMQA 1BW6A 3HOUJ 4D7NA 1FIPA 1RPWA 3DCFA 4DZPA 1TWCJ 3S14J 1S7EA 5EDNA 5FKNA 2TRTA 1AHDP 1P7IA 3PO3J 2E2IJ 3F0CA 3JR9A 1HF0A 2DA5A 2XPWA 1D5YA 1QVUA 2E2HJ 1ETQA 5M5WJ 3O8GA 1AKHA 1U8BA 1T56A 2M0CA 3I4NJ 3ZQIA 1A5JA 3SFIA 3BQYA 4A3JJ 2DJNA 2DMUA 3FK6A 4M3GA 1ENHA 4A3IJ 3S1QJ 2ME6A 4W1UA 3BG3A 1ZTRA 4A3EJ 5EEAA 4QSHA 2XGCA 2R5ZB 2RAEA 2DMPA 4NDLA 4BY7J 2HDDA 2DN0A 2WAQN 1G2HA 2LVSA 1IUFA 3OIOA 1A6IA 1POGA 2L7FP 1TC3C 1MBEA 1JUSA 1U9OA 2DA7A 4IHVA 1BW5A 1JJ8C 2TCTA 3VPRA 2EH3A 1WPKA 1XG1A 3QPLA 3G1MA 2M8GX 3ZQLA 2IAIA 2XRLA 1QVTA 3RKQA 1WCMJ 4JP0A 1Z77A 3C2BA 1HDDC 3K7AJ 3Q0VA 2CQXA 4BXXJ 4D5CA 1LE8B 1IG7A 1SFOJ 2LR8A 3IH2A 1H8AC 4J19A 3D1NI 2W48A 1MH4A 1XS9A 3IH4A 2D5VA 2LFBA 1I6HJ 1RKWA 1U9NA 3JREA 1BA5A 2JA7J 3GTPJ 3A01A 3W6VA 1VNDA 5FLMJ 3IH3A 1JT6A 1UG2A 1MBKA 1RESA 2ELKA 4XRSA 1IGNA 3HOVJ 4DYRA 5K7FA 1XC5A 3HOZJ 3BT9A 1X2MA 2YU9J 2HI3A 2DMNA 4IHYA 1IDZA 1MNMC 3JRFA 4I76A 3JRGA 1HLVA 3MN2A 2EZKA 4W97A 2GLOA 2CJJA 5C4JJ 3HOYJ 1JKOC 3MKLA 2GBYA 2ID3A 1X58A 3NARA 2R5YA 3JRDA 2JWTA 3ZQHA 3S1NJ 3LSRA 1ZK8A 5IYBJ 5GPCA 5EG0B 3GBGA 3BTJA 1PUFA 1GT0C 3S1MJ 1I50J 4D7MA 2HOAA 2DA3A 4BY1J 3HEFA 1RR7A 4S0HB 1AKHB 5JLXA 1ZR4A 1JUMA 3GTGJ 5EYRA 1TWFJ 5E3NA 2FX0A 5IYCJ 3GTQJ 4M3DA 3G1LA 1GDTA 5BNGA 3JRCA 4CYCA 5EZHA 3S16J 2MGQA 2Y9ZA 4C3JJ 2Y30A 2YUSA 5IP7J 2VKEA 1ETYA 5J1UA 3L1PA 2G0EA 3TW6A 2K9NA 1T33A 1FEXA 2LLKA 2R93J 3CQZJ 2WV1A 2VUMJ 4UUTA 3LSGA 2JA5J 2HYJA 1SANA 1IRZA 3HBLA 5EG0A 2DMTA 4JX4A 4XICA 4LOCA 2H1KA 1ETXA 3FISA 3HM5A 4FE7A 4XK4A 2NVTJ 3HOWJ 3DEWA 2HQ5A 5F0HA 2YS9A 2P81A 2XB0X 4A3MJ 4D5FA 3A01B 4DZJA 2NS7A 3JRAA 2R7ZJ 3HDDA 4A93J 1MSEC 2LTPA 5FJ8J 2XB5A 1JGGA 5EGOA 4V2FA 5M3FJ 1ITYA 2ZB9A 4JX6A 2CUFA 3Q0WA 3LOCA 4MO7A 3BR1A 2FJ1A 5J1RA 2L0KA 1ZQ3P 3HKZN 3I4MJ 4FE4A 2X48A 2HOSA 1WI3A 4C3IJ 4ABZA 3UKGA 1DU0A 4BBSJ 2HOTA 3G1OA 5HODA 1FJLA 2R5YB 2JA8J 4MFEA 2JN6A 2MW8A 5F0FA 3PM1A 2L7MP 3HGGA 1QRYA 1PUFB 3A03A 1JJ6C 2OF7A 1B8IB 2HXOA 4M3EA 4C2MJ 4DYCA 2JA6J 4M6VA 5F04A 3ZQGA 4I6ZA 1X2NA 2E19A 2FQ4A 3WHBA 4QIWN 5F08A 2KT0A 2L7ZA 5IOZA 4JYKA 3B6AA 3RQIA 3PO2J 2VPRA 4Y7NJ 2E2JJ 4CYCB 3LSJA 4IEJA 5EZGA 1Y1VJ 5FKLA 1ETOA 2Y9YA 1JKPC 2B63J 3GTKJ 1JKQC 3JRBA 2EZLA 2LKXA 1Z0XA 3SDGA 1YRNB 4G12A 3CDLA 2R0QC 5M5XJ 4FISA 1NK3P 1MH3A 2JJ7A 5IOYA 1W0UA 4A69C 1OJLA 2NVXJ 5DS9A 4UUSB 2XSDC 3GTMJ 3BG9A 2X6OA 5IPAA 2O7OA 4A3BJ 2GM4A 1ZGWA 1F36A 1JUPA 2DA4A 1RKTA 4B1RA 1GVDA 2XGEA 5FKOA 5FKKA 1UMQA 4FCYA 1TWGJ 2NVYJ 3Q0UA 1B8IA 1K61A 1LFBA 3K2AA 2LY9A 3QQAA 3TEDA 3S17J 2EBIA 3FIWA 5C44J 5DTDA 2K9QA 3BR0A 5E3MA 2KDZA 4V2GA 5F0CA 4BKXA 1IV6A 4A3DJ 3MVPA 2Y0SN 4X6AJ 2QF7A 5GP9A 5EGOB 2FD5A 3ZOBA 3BR3A 3HOXJ 1YRNA 2K9SA 1FTTA 1BL0A 4A3FJ 1H88C 2ECBA 4FTHA 3LSPA 3E7LA 1O4XA 4Y52J 2M34A 5E3OA 3RZDJ 1BJZA 4RBOA 4UUSA 1B72A 1IDYA 5FLVA 4DYQA 2AO9A 2EZIA 1OCPA 3NAUA 5IP9J 3TP0A 2ECCA 4HNVA 3M4OJ 1OCTC 1U78A 5JLWA 1JT0A 3ZQFA 3GTLJ 2MG4A 3BR2A 3ZQCA 4A3LJ 2O8KA 4L5EA 4MLOA 2JK3A 2VKVA 2XGDA 2Y2ZA 2LP0A 2DA6A 2LK2A 3O8HA 2O9LA 4A3KJ 1H89C 3GTOJ 1JTYA 4AUXA 2PMZN 3B6CA 4MFDA 3CCYA 3SJMA 3FK7A 4EEFG 5IYDJ 1ZKGA 2R92J 3TW7A 5C4XJ 9ANTA 3TP3A 3S2DJ 3S2HJ 5M3MJ 3HB9A 2X9DA 3QPSA 1ZR2A 4C3HJ 2XPUA 1MBGA 4M3BA 3HGYA 2CQQA 3Q3SA 1VF9A 4XRSG 2CUEA 3GTJJ 5FKMA 2NVQJ 2N8GA 2IBDA 4XRMA 1W0TA 3H3VK 2M9HA 4GFBA
chains in the Genus database with same CATH superfamily
4P55A 2WB1N 2CQ7A 2BBYA 1FX7A 2LOOA 3F22A 1R1TA 3PNVA 2VBWA 5KAFC 2AHQA 4IJAA 3OIPA 3P9CA 3QYFA 1MBJA 4BEHA 2QBYA 1JXSA 1K83J 5D5WB 3B73A 1YQAA 1VQ6I 3FM5A 3MMYB 3OY9A 1RZ4A 4B09A 3RIRA 1SD7A 4F52A 2EIMH 2E7WA 2RQPA 3MFKA 4IZZA 4XONA 3K70C 2BV6A 2R5ZA 3OOUA 1FNNA 1WI9A 2K40A 3OYMA 4CSWA 3MKZA 1BR1A 3V7RA 5D8KB 4IHWA 1FP1D 2DTZA 5DCFA 3NQOA 4C30A 3T8RA 4KIFA 2ESNA 4HG2A 3SZGA 2FOKA 2HS5A 1TT5B 2L2OA 2LY2A 4LK1F 5EF6A 4IKFA 3KP4A 2W82A 1ULYA 5F6FA 2CW7A 1H9TA 5M5YJ 3BDDA 3ELKA 3LFKA 2HDCA 2QKLB 3PNTA 2NVUB 3F8NA 3GXOA 1HOMA 3JRHA 1JTXA 4XIDA 2HQAA 2AXTC 2DFIA 3WTZA 4DOZA 3HOSA 5FD5A 3HIFA 3HHHA 2CH0A 1BJAA 5K5QA 4BS9A 4MIMA 2H8RA 4RGSA 1UHSA 3S1RJ 2RNJA 3BR6A 4UV9A 2MA3A 3S93A 3JSOA 3IWFA 2MSYA 3K1PA 4IF4A 3RTRA 3WU0A 2ZXJA 4CDGA 2BHZA 1Z1DA 5FO5A 3F23A 1UHWA 2ZJQF 1WH5A 3HL2A 3CC4I 5K7HA 4YG2F 2M7BA 3OSGA 4RDUA 2ACJA 1UCRA 1Z7LA 3HOUJ 1RPWA 4ZYHA 1TWCJ 1LUJB 4C9YA 1Z6TA 2LYCA 2TRTA 3HG9A 2MD0A 3LSMA 3F0CA 4U88A 2E2IJ 2DA5A 3DU6A 2PJPA 5A2QK 4I7HA 2M4GA 3BWGA 4GRIA 1QVUA 3O8GA 2LKPA 2VJIA 3HTUA 3OYHA 3ZQIA 2UWMA 3BQYA 5LGUA 2H09A 4A3IJ 1YW8A 3C1DA 4W1UA 1JHFA 1UZCA 1EA3A 5ICEA 4YELA 4HOBA 4QSHA 1J7KA 2QENA 3W2AA 2WADA 2IS6A 3QRFF 3H92A 5ERIA 2CG4A 1G3SA 1KQ0A 4P96A 4BY7J 4YFXF 2HKOA 2WBMA 4A2UA 4ZYAA 4L5IA 3E3VA 1MDMB 2LVSA 2L4AA 2GXAA 1A6IA 3D5SC 1CF7A 2FBIA 2RGVA 1TC3C 3OYBA 3LA7A 3DBHB 2CV0A 1WJDA 2TCTA 4HEA2 1ZRFA 3K2ZA 1FZPB 3VPRA 3CJNA 3LA2A 3G1MA 2JUCA 4PGGA 3VDXA 3KZZA 4CZZA 5KNLA 2IAIA 1ZRDA 3RKQA 1V54H 4XLCA 2CQXA 3PFYA 1ZHFA 3CP8A 4BXXJ 1XGMA 2K85A 3DTKA 1IG7A 2OV7A 4J19A 5J4VA 1WJ5A 3D1NI 4M6YA 3I56I 3NWTA 3CUOA 1SMYF 2NRAC 1LVKA 4JOMA 4EJVA 3X2QH 1I6HJ 2HTJA 3H3UA 2KRCA 4KUMA 3CJQB 4ZYEA 3W6VA 1UG2A 2NOJB 2NAZA 2RNGA 4M74A 5H20A 3OMYA 1IGNA 4OIQF 3M8JA 4L5JA 3VYUB 4DYRA 4X0GA 5K7FA 1XC5A 3CMAI 2XAHA 2IGOA 3AAFA 1FYKA 1VTNC 5LRSA 4HX4A 1IDZA 2GQQA 2KLOA 3JRGA 1J09A 1W4MA 2E5NA 1MKMA 3M07A 4ZC3A 1XDSA 4H4KC 1J9IA 1HW2A 3ZMTA 2IS1A 3MKLA 2R7RA 1KONA 4MHGA 2EA2A 3LQQA 1BOBA 3HYIA 1FC3A 1X3UA 3S1MJ 1I50J 4M71A 3PIPF 3ZMVA 1X3WB 2TDXA 1AKHB 2ICWG 1ZR4A 4G8XA 2IVMA 2K3PA 1JUMA 4PJMA 3GTGJ 2MFZA 1LEAA 1XDUA 2FX0A 5E3NA 1K4SA 3GTQJ 2XGXA 2EFNA 4M3DA 3G1LA 2IRFG 2KZVA 1YW9A 3GCMA 4CYCA 2JT1A 3QP6A 4KMUX 3G2BA 2OBPA 4ZTJA 2Y9ZA 2IS4A 4C3JJ 4BQOA 1TQPA 1BI0A 4RGRA 3N97A 5IP7J 3K0LA 4NQWA 5J1UA 2F5VA 3IC7A 2K9NA 1XCVA 2HYFA 1DDNA 2CSOA 3E0JB 1WZ2A 2R93J 1SVMA 4L9NA 2MC3A 2FBHA 3HKZA 4OWRB 1BR2A 2NNYA 2JA5J 1F5TA 3I64A 2ELJA 1SANA 3M1EA 4I0BA 2A07F 3HBLA 1B9NA 4E7ZA 2DMTA 4HLXA 3R6SA 2PG4A 3EDPA 2DBBA 1K6OA 3S8PA 2L4MA 1CGPA 4Q5SF 1ETXA 3FISA 4FE7A 3OL3A 3HOWJ 3DEWA 1R6RA 3KEOA 3C2GA 2V1XA 1IXCA 4P5OA 2ZNYA 3WTSC 4A3MJ 1ZELA 5K5RA 5TGTA 1MMSA 3ESWB 2NS7A 3F3XA 3JRAA 3VEPA 2W84A 2M4KA 1UAAA 2XB5A 5EGOA 1ITYA 1FOWA 4D1QA 3VODA 3GZ5A 2CUFA 1MMGA 5FFXA 1OYYA 3LOCA 5D5XB 4CUGA 2BYVE 4XL9A 2L0KA 4G6DA 3HKZN 4XSZF 2HOSA 1IAWA 1ON1A 2HVRA 4BBSJ 3VYRB 3H9QA 5HODA 3G73A 1KQ8A 2MW8A 5JVTA 5EEGA 2B0LA 4E7HA 1R5ID 3HGGA 2PX9A 1PUFB 1I6XA 2PFBA 5K5OA 4ASNA 1FMWA 2EFQA 1BIBA 2JTVA 2OF7A 1B8IB 2KRFA 4M3EA 4DYCA 4CH7A 4M6VA 3ZQGA 5BPIA 2HTSA 4EM1A 2L7ZA 4PFPA 1IW7F 2BW3A 2DTRA 1S3JA 3B6AA 1F9NA 4Y7NJ 1KQ9A 3GVAA 3F9KA 3WTYC 2IXSA 4PJNA 3ZP5A 1W7PD 1Y1VJ 4HX8A 5L3EA 2Y0SA 3GTKJ 2XASA 2M30A 2L3DA 3ASOH 4II3A 3S3OA 1DUXC 4XLFA 1N77A 3AG1H 2ZJ2A 2OA4A 3KZYA 4L9TA 1VQ7I 3QU6A 2KIFA 1W0UA 5DD8A 1OJLA 3BJOA 2IT0A 5CLSA 3H9GA 3LSHA 2DJIA 4HNUA 1QO0D 2JVHA 1FBSA 3MAJA 3L09A 3BG9A 4E6KG 3OYLA 5IPAA 2GM4A 1MD0A 1KZHA 4EJOA 3ML6A 1E3HA 4B43A 2EIKH 5FKKA 4JK1X 5DD4A 1KU9A 1O7FA 1K61A 1B8IA 3K2AA 4BL0B 2LY9A 3JAMZ 2CUZA 2Y0MA 3F6OA 3FIWA 4I09A 3DF8A 1YS6A 5C44J 2BGCA 2K9QA 4DQ2A 1PDNC 1YS7A 2O6GE 2Y0SN 4ZYDA 3RKWA 2QF7A 2QUFA 4CXFA 2DYSH 2BOLA 3FHNA 3BJ6A 4GDFA 3DKWA 3VYSB 1Y0NA 3PNYA 1Y8RB 1ZARA 3ONQA 3BR3A 4N4NB 3HOXJ 4AIJA 2ZNZA 2P5LC 2VPLA 1H88C 2AXLA 2ECBA 3N05A 2M34A 5FFZA 3COAC 2HPMA 5ILVA 3V8LA 2HQNA 2ZJPF 2Z2SB 3RCOA 2F5CA 3KP6A 1OCPA 2JSPA 2E1MB 3L2WA 2VE8A 1BOAA 1S29A 5GAHJ 2VLAA 4C2UA 1K78B 2F5FA 3M7GA 4HNVA 3M4OJ 1TLHB 1XSXA 2DT5A 2GAUA 2VN2A 1JT0A 5TRDA 1MJBA 2QSFX 1WSUA 2DPUA 4XRFA 3K4KA 3E1SA 1WQ2A 2O8KA 2JK3A 3W2VA 5DUIA 2XGDA 2K5CA 3A4CA 3JAMK 2VC1A 2BZTA 2LP0A 3ZMDA 3O8HA 5HNHA 2CMPA 1WJCA 1ODDA 3ZR8X 3T0YA 4BU2A 3FWEA 2OCEA 3TKYA 5GTIC 2W85A 4LG0B 1OMIA 4HSTA 2XRNA 1VQOI 3CC7I 4AIKA 3DEUA 1XCBA 3TW7A 5C4XJ 5TJJA 2QYOA 4XOTA 2X9DA 5DUKA 2EV0A 1REPC 1BIAA 3GUDA 3ZMUA 4M9ZA 4HBLA 1KU2A 3TO7A 3HGYA 1K78A 2EV6A 3DPLC 2A6EF 2E1NA 3KIOA 5ICGA 3Q3SA 3GFJA 2OJED 4HDUA 2LSOA 3GTJJ 4M73A 4PSXA 4E7JA 4G94A 4XRMA 2ZC2A 3CUQB 4XN3A 3L00A 2ELHA 4CCJA 2BY1A 4FHTA 5L3CA 2QQ9A 1XGNA 2HGCA 2WAEA 4LD5A 3C3WA 1V5EA 1TL8A 4NC8A 1JKRC 2CU7A 2ISYA 1LB2A 1ZGAA 1R23A 4WXHA 4CCLA 3IV5A 1HA8A 2R7QA 4HX7A 5HLGA 4FQGA 4PCQA 2K02A 1GV2A 4A5NA 1GXQA 2E1OA 2EFOA 2BVLA 1MSFC 1MJ9A 1FBQA 1WGXA 2KPMA 2JSCA 3I5UA 1HW1A 2IJLA 1F4KA 3KLNA 3FMSA 4FETA 1QGPA 4NHJA 3DXJF 2COMA 5E8IA 1V5FA 4PSWA 4DW6A 4X1EA 1F43A 1U3EM 1BI2A 4HA8A 2BY2A 4WX9A 1SAXA 2FRHA 3D5RC 3PL8A 3FXQA 1MBFA 1H9GA 5KCMA 2YSRA 1AA7A 3RSNA 2CS3A 1S5LC 1RI7A 5HDGA 2XKOA 3IUOA 2X6XA 1APLC 3KEYA 3GWZA 1XMAA 2K3FA 2IP2A 3BTIA 3CMYA 2HQRA 1P4XA 3OS2A 2L5QA 1Z3XA 1C0WA 1RETA 1TWAJ 1WH7A 1R7JA 4U87A 2NOGA 2CRGA 3HUGB 2QCOA 2VKHA 3IRQA 4H0EA 2PJRB 1Z7UA 3CDIA 4XKCA 4RB3C 1ETWA 3QOPA 5F1RA 3L2RA 2LBFA 4BHPA 5E20A 3PSIA 5GPAA 1RRJA 2ID6A 3G3ZA 4JBAA 5LRRA 5CPRB 3TQNA 1JI8A 1MMNA 3FBIB 3P7NA 4AVZA 2VI6A 4ZH4F 1QPIA 2HXIA 3LNQA 3ZN1A 5BOXA 2M7AA 1ORKA 5GAGJ 1R71A 1EF4A 1U8RA 3TOAA 3BTCA 4WK8F 1TNSA 2F5DA 3IRRA 1GUUA 2W7NA 1YOVB 2QSGX 1XN7A 2E35A 2RN7A 4D7NA 1FIPA 2Z5UA 1G3TA 4DZPA 1S7EA 2UV1A 4PJ0C 5FKNA 3W6JB 2XROA 1AHDP 3WTVC 4Q4ZF 2CW8A 3VFZA 4K2EA 4BEHB 2XPWA 4EV0A 1U8BA 3LMMA 1SD4A 3HUGA 1A5JA 1U2WA 5FRMA 2J5OA 3J7YJ 3FK6A 2DMUA 2KKOA 3S1QJ 2BXYA 4XKWA 1S8NA 2CW0F 4I98B 3CF5F 5EEAA 3L2CA 3V8KA 5FB2A 2P0WA 2R5ZB 2R7OA 4NDLA 2KFDA 3CO6C 5FGMA 1G59A 2P7VB 1MGTA 2YX7A 3MZ8A 4ZYGA 4Y13A 3DQVC 1POGA 3F8CA 2VOPA 1U9OA 3F8MA 1BW5A 3LL7A 3DPUA 4XMYA 3IWZA 3GFIA 3JSPA 2DYRH 2IPQX 1XG1A 2JPBA 2M87A 2XRLA 1QVTA 4DNCA 3C2BA 1HDDC 3K7AJ 2B7EA 1HSJA 4LLGF 2KDOA 1XS9A 3IH4A 2QM3A 4HDVA 4G9YA 2HVSA 4ENKA 1QBJA 4HV6A 3ZMSA 3QODA 1LPQA 2JA7J 3OR1C 1N78A 3BZCA 5JHUA 5FLMJ 3IH3A 2VQGA 5HDKA 4L0YB 5DM7F 1EJ9A 3ZQQA 3HOVJ 4RLQA 3HOZJ 2EPFA 3QPHA 3BT9A 4EJUA 1FWZA 3RQ4A 4IHTA 2FEZA 2DMNA 3FM3A 3PJRA 2K9MA 1D3YA 3GMEA 1X4PA 2KIMA 1QZYA 3ERED 1QZZA 2FU4A 3AFHA 3C2HA 2CJJA 4KDPA 1VQMI 2W57A 1DQUA 2K9LA 3V8JA 2W25A 2GBYA 2PN6A 3NARA 3SZTA 4ANJA 3SEQA 2R5YA 3KLOA 4HZFA 1ZG5A 2EV5A 3S1NJ 3LSRA 3CCMI 5IYBJ 3DKXA 3GBGA 5KAIC 2WY7Q 1ERDA 2QKMB 3FBNB 5ED4A 1N25A 3D5LA 1FT9A 2P5KA 5EYRA 5JVGF 3M8FA 3CMMA 5IYCJ 2V4JC 4MQVA 4J00A 1VQPI 2BEOA 3RPQA 3GW2A 5LHIA 3JRCA 5IY5H 1XMXA 5LHHA 1BR4A 1FSEA 1GHCA 2QGUA 3CMEI 4KISA 2X85A 2Z33A 2YUSA 2A69F 5L3GA 1CF7B 3KCCA 3TMOA 3AG2H 2VKEA 1O3RA 4AD9A 4AIHA 4CZCA 3L1PA 3ECHA 3BCBA 2DODA 3DEEA 5DYMA 1G3WA 1DGRM 3G4SI 1BI1A 2O0YA 2NXNB 3HRSA 4G6QA 1T98A 4CGZA 3I53A 2Y69H 4GYIA 2VUMJ 5HOOA 3ROUA 2HVQA 3GZ6A 1Z6RA 4F55A 1IXSB 3DWLE 3QAHA 4BE2A 2R7TA 1J75A 1LFPA 2HZDA 1ZH5A 2LNBA 4IX7A 3EYIA 3H5NA 2YS9A 2XB0X 3KP2A 5E8GA 2V7FA 4D5FA 4M9XA 4LJZF 3HDDA 4A93J 1O57A 1ZREA 4KT6A 4KJZA 2P7CB 1MNDA 3KP7A 1HKQA 4V2FA 1A04A 2VT3A 2MC4A 3CJTB 4JX6A 1IRFA 1R1UA 2P6TA 2QEXI 3QYBA 4HF1A 4EJTA 3BR1A 4KIGA 3VWBA 1E17A 3OIQA 1STZA 3BP8A 1ZQ3P 3NRVA 3I4MJ 4E70A 1PUEE 4OMYA 2RC4A 5DM6F 1FY7A 4ABZA 1R22A 3MEXA 2HOTA 2BXZA 1XMKA 2ZCWA 3DPTA 4PGHA 2AQEA 2GXGA 2PI0A 1G8XA 3F8FA 3EUKL 1L0OC 3CJRB 3BROA 4XR6A 3E5QA 3TL4X 4DGWB 3E5UA 4DBRA 2JA6J 4BQNA 2V6EA 5D8LB 3ZMZA 2O03A 5F08A 2KT0A 4NUBA 4CYDA 1XX5A 2FF4A 3U2RA 2A5WA 4MTEA 5BQTA 4CYCB 3SDBA 4XQFA 4A6EA 5GTHC 4IPAA 1HBXG 3LWFA 5FKLA 3K10A 1RC9A 4HRIA 1JKQC 3K1NA 1XD7A 2EZLA 4NC7A 1Z0XA 3SDGA 4NQWB 4G12A 2GXBA 1QNTA 3RPUA 3AKZA 3F21A 2I5UA 1EH6A 1NK3P 3R61A 5IOYA 2V1DA 2VQHA 1P9QC 3O6BB 2JQ7A 5DS9A 2XF6A 3O3KA 2FUG2 1OPCA 4UUSB 3F8BA 3CD6I 4F3QA 4BUPA 2XSDC 2H6CA 3KEQA 2STTA 4KYWA 6PAXA 4EM2A 4A3BJ 4M72A 2VBZA 3GZNB 1QPMA 4HQEA 4G7OF 2VKDA 1UMQA 1TWGJ 4XLPF 2JZYA 2VJ4A 2DI3A 2V9PA 3EQLF 3QQAA 1OCCH 2FMLA 2EBIA 3J7ZI 1XB4A 5DTDA 3BR0A 3LSKA 3L2QA 2KDZA 4PDKA 4PUSA 4V2GA 3KETA 2RVCA 4A3DJ 3MVPA 2CUJA 4X6AJ 4QPOA 1TW3A 5EGOB 1YYVA 3ABKH 4ESBA 3L2UA 2FD5A 1LVAA 2VL8A 5CQGA 4A0YA 4B8XA 1QU3A 4CICA 2R7DA 1BL0A 4O6JA 5D5UB 4OAZA 3WE3A 1BJZA 2R7XA 1DP3A 2O8XA 3RKYA 2QQAA 4UUSA 1B72A 5FLVA 3QU3A 2M45A 3GEZA 1BC7C 2E1CA 2QQ8A 3NAUA 4BJ6C 1BBYA 3IHUA 2M3AA 3CCSI 3BJAA 1FBUA 4BH9A 4G7ZF 1EV7A 3OYGA 4IO9F 4ZDOA 3GTLJ 4I2OA 2MG4A 3BR2A 4LLNA 3JW4A 4A3LJ 4L5EA 4LFUA 4EQQA 2BW3B 5E1WA 2GOMA 3U9GA 2AS5F 3GX4X 5AIPA 4QLCU 3W3CA 3OWTA 3V7SA 2LK2A 4M9SA 1I5ZA 4LB5A 3WTTC 4OIRF 4KICA 4OU0A 4G7HF 3FXUA 2VXDA 4Y15A 3REOA 4MFDA 3CCYA 4RB1A 3FK7A 2WTEA 5IYDJ 3TBIA 3W6KB 2R92J 1MNEA 4PFOA 2M1BA 3ZQ7A 2QZ8A 3CLQA 3GF2A 4ETSA 5LGNA 1YTYA 2Y48A 2ZBKA 1O7LA 4IXAA 1HXDA 4M3BA 2LG4A 3CLOA 4R1HA 3G71I 5L3BA 1S7AA 5B66C 3H36A 2KIUA 3I59A 3JTHA 2DO7A 4RMNA 2XF5A 3C18A 2ADUA 4XRSG 2CUEA 1P4AA 3NWSA 4HAMA 1YX5A 3N4MA 5ICCA 1X1PA 2N8GA 5LEJA 2VXZA 2FQ3A 3CF2A 1KGSA 2OCCH 3PIOF 3U1DA 1I39A 3KX2A 4CHUA 1VQ4I 1YI2I 1TT0A 3WHCA 4Y33A 2VC0A 1LDKB 2YR2A 1KU7A 4AYBA 1LJ9A 1IF1A 2ETHA 1MBHA 3FXOA 1Z3YA 1FLIA 2COBA 4B4CA 4OAYA 2KQRA 3V42A 1SMTA 2A61A 2G7UA 5E79C 4Z6YA 2A5YB 3SEZA 1BC8C 4BXUA 2ESHA 1R58A 2L9RA 3L9FA 4OIOF 1A35A 1TTYA 1X1DA 1SFXA 2MH9A 3T5XA 3M3YJ 3E6BA 1OCZH 3I4PA 2UXNA 2DOEA 3BY6A 1HCRA 1UFMA 1VFCA 4LG3A 1IN5A 2HPIA 1OCOH 4AIDA 1IC8A 2IGMA 3FXMA 1KA8A 3BG7A 3D0SA 2D2WA 2JMWA 3IAM2 3FDYA 4QTRA 4N0BA 1OYWA 2BY0A 4EMSA 2HU9A 4AYBN 5JI6A 1TQMA 4UV8A 1LE8A 3LSIA 3S15J 2ZXIA 3OYKA 2MBFA 2E7XA 1T08B 3A0HC 1ZYRF 1TNTA 2V6CA 2HKXA 1ETVA 5K7ZA 1ZAOA 3ABMH 2XPVA 5J1YA 3AG4H 4IL6C 3E6DA 1R9TJ 1K79A 3BLYA 2H27A 2CFOA 3SFZA 2EILH 4IRIA 1NTCA 2ISZA 1V55H 3BZ6A 3HOTA 1ETKA 2EB7A 1IJWC 1E3OC 2I10A 3A0BC 2JRMA 2EZHA 2PEXA 1MW7A 2FBKA 3OR2C 3RZOJ 4IHXA 1DU6A 3SQNA 1LNWA 3H1CA 5DCMA 3BQZA 1YJNI 3M8EA 4XKVA 5FROA 2Y31A 1FOKA 1XTAA 3HTSB 2EQRA 1HW5A 4XORA 1MJAA 2H6BA 3CO7C 2DT7B 2RQQA 4BBRJ 3JRIA 1Y1WJ 3P9KA 4BYYA 4MNUA 3H3ZA 1LEBA 3M9AA 2VJJA 1NK2P 2CV2A 4GGGA 1FPQA 5FLXZ 1CQTA 4AU7A 2DMQA 1BW6A 4LLLA 3GYHX 4YRVA 2VONA 1WHUA 2XKPA 3DCFA 1YITI 4FX4A 4UB8C 1ZRCA 2V1NA 3IKVA 2GWRA 4B44A 1UJ8A 3CCRI 1P7IA 2FOWA 3ZXSA 5KVRA 1R5HA 1T6SA 3CCVI 2QA4I 3L2VA 2X1EA 2E2HJ 1ETQA 3I4NJ 4IQ4A 2M0CA 3QWLA 3J7AO 4L18B 1V5GA 2XHKA 5GADJ 4YIFA 4Y3OA 4A3JJ 2DJNA 1MMAA 4M3GA 1ENHA 1E0EA 1D0ZA 2BE5F 3DKYA 2DCEA 4A12A 4HNTA 2XGCA 2K86A 1B6AA 2RAEA 1AOYA 4D9JA 2HDDA 1EH8A 4CO8A 3OS1A 5CQEA 3U1KA 3OV8A 2PQ8A 5EJCA 2OQRA 2G9WA 1MMDA 1J59A 1IUFA 1D8KA 2LDUA 4L9VA 1IUYA 3HJEA 2G7HA 2ZMEA 1MBEA 1MIJA 1A6QA 2VIXA 4II2A 2R7UA 2W4SA 5J4YA 4BQAA 3FXKA 1WPKA 3QPLA 3V4GA 3BCAA 2M8GX 5FRNA 3EUHA 4UXNA 3ZQLA 1SD6A 4JP0A 2L01A 2ZKZA 1YHQI 4YIRX 4IOCF 1O3QA 1K4TA 2OUMA 4D5CA 2CQKA 5FLXK 1SFOJ 2OU2A 2ZXWH 4LIVA 4BJTA 4GXOA 4YIIA 2P6SA 1UHMA 2YU3A 1R5GA 2ZMEC 3Q9VA 3J81Z 3F72A 2D5VA 2LFBA 1X1CA 1RKWA 1BI3A 1HKTA 3T1BA 3JREA 3FHZA 3MZHA 1BA5A 1D1AA 2LBFB 3A01A 3EUHC 1VNDA 3PSFA 1RUOA 1Y0UA 1X3ZB 3HZJA 3DBRB 4S04A 4BE1A 4L0ZB 2ELKA 4XRSA 3HRUA 2GA2A 3HXLA 4RAGA 2XC7A 4P9FA 1X2MA 2L54A 1M1EB 4M6XA 2YU9J 2VBYA 1FOYA 3RDIA 2HNHA 1MNMC 3TOBA 3I0TA 4WXDA 3JRFA 2A05A 3UNGC 2MABA 4U0WA 5HLTA 2EFPA 5C4JJ 4JQFA 3ZCOA 2A68F 2JPCA 2ID3A 1X58A 3CZ6A 3HSEA 2CGPA 3JRDA 2JWTA 1DP7P 3ZQHA 4F93B 1ZK8A 2DOAA 3BTJA 1ZG3A 1GT0C 1NG6A 4E4HA 3WTXC 2PMUA 4DIQA 5J40A 3KE2A 2E34A 4D7MA 1YO5C 1GXPA 2DA3A 1VQKI 2IA1A 1RR7A 4S0HB 3MZYA 2DLLA 4UY8I 4OIPF 5LGTA 2KP6A 3J81K 5J8FA 3OYJA 4ESJA 1GDTA 2MH2A 3LQRA 3LAPA 1W36D 2R3SA 3S16J 1FP2A 5B3SH 2EK5A 2MGQA 3DTEA 5E17F 2Y30A 3K4CA 1K7AA 4UVCA 1ETYA 3VSKA 4FX0A 2G0EA 2V9KA 3RYPA 3TW6A 5CJ9A 2NNNA 1FEXA 3R0JA 3KP5A 2LLKA 1UELB 4ZZDA 1D1BA 3MKYB 3TO6A 1WWXA 4ENJA 1OKRA 3K4LA 5IT3A 4BHCA 2HYJA 3BZKA 3WG7H 4PJLA 1VQ9I 3CCUI 1VQNI 1IRXA 1YE9A 3H35A 1QQIA 4HYEA 2D1VA 2OD5A 4JX4A 5H6RA 4XICA 1NHAA 4BGDA 2DFEA 1KU3A 4NNJA 2LRDA 1U6GA 2HQ5A 1ZLKA 5F0HA 1ZGJA 1QHHD 4HV5A 1IN4A 2P81A 2W00A 3R0AA 4E7LA 1E3PA 4UUVA 2R7ZJ 3LAJA 4RS8A 3OYIA 1MSEC 4UHTA 2LTPA 5FJ8J 2XSJC 1OLTA 2H94A 1JGGA 2VOOA 1D8JA 3EYYA 4KITB 2ZB9A 1W7PA 4LGWA 2Z9OA 2WA0A 1V4RA 5BS6A 1PVEA 3EPZA 4MO7A 1B59A 1SFKA 2FJ1A 4U0VA 4ZDLA 5J1RA 1FMVA 1U5TC 4FE4A 1S9HA 4CA0A 3IKTA 5D4SA 4C3IJ 3UKGA 1DU0A 3HHGA 1P4WA 2F6CA 4RAZA 5K1YA 2F2EA 1S6LA 2R5YB 4Q48A 2JA8J 1ONVA 2JN6A 2QQBA 5F0FA 3S3NA 4ESFA 3PM1A 2V79A 2L7MP 3KP3A 1P92A 1QRYA 3PUFA 2O3FA 3E6CC 3A03A 3A2KA 1WJBA 2UUZA 2GIVA 3HSRA 1I3AA 2GZWA 5F04A 4B3XA 2MD5A 4I6ZA 2CV1A 1NG7A 2E19A 4QIWN 2LC2A 2V26A 1E2XA 4RAFA 5IOZA 3IP4B 3P9IA 3E6MA 4JYKA 2FSWA 3DFGA 4BDZA 5HS9A 3PO2J 3RQIA 2P4WA 4S05A 1H0MA 4Z2YA 4A6DA 3LSJA 3HRMA 3K4JA 2LF8A 2WAFA 4P1WA 2DFHA 2Y9YA 3AL0C 1RNLA 2ZO4A 3FMQA 3CCJI 1DPUA 1VZ0A 2L9SA 2LKXA 1YRNB 2IW5A 3CDLA 1T8IA 2HEOA 5M5XJ 4FISA 1LDJA 4MEYF 5DEQA 1R4NB 2FNAA 5D5VB 4A69C 1NH3A 1XPXA 1T0FC 3I58A 4IRGA 4UVAA 4U7BA 3HSFA 2X6OA 2UXXA 2AQFA 4QPQA 2O7OA 3HPHA 1F36A 1JUPA 2DA4A 2M0MA 1RKTA 3DU5A 3ECOA 3O2PE 1WJEA 2WV0A 3I3LA 4B1RA 4DBQA 5KHDA 1XSDA 5HS7A 1Z21A 3I54A 2E71A 2NVYJ 3E5XA 3Q0UA 3BC8A 3S17J 3HRTA 1XGOA 2A6TA 2X6WA 2JRTA 2UZKA 4TV7A 3I55I 1IV6A 3IAS2 1IN6A 4OOIA 5A2QZ 5HDNA 5GP9A 3TGNA 1USTA 4OINF 4CCNA 5L3DA 2VBXA 2STWA 2H8WA 3BG6A 2GOXB 3CCEI 1YRNA 2K9SA 4RAYA 4KMFA 1Y39A 4A3FJ 3FXRA 4FTHA 3KZIC 3LSPA 4HLYA 3E7LA 4Y52J 3J80Z 3Q9SA 3CCLI 1SD5A 5CVUA 1G3YA 1IDYA 5LHGA 5BMZA 1OR7A 1TP4A 2EZIA 1L3LA 4RGXA 3U21A 3ZRGA 3TP0A 4L9JA 5FD6A 5HS8A 3OS0A 4MEXF 2JVGA 1D0XA 1U78A 5JLWA 4MGRA 2F5EA 2VT2A 1YX3A 2F48A 2Q8KA 2GIZA 4MLOA 5EEHA 2VKVA 2RKHA 2MLGA 1OR7C 2DDAA 3Q5FA 5D6FA 4KN7X 2R7VA 4E7SA 1BM9A 4LMYA 3QPTA 4A3KJ 1H89C 3GTOJ 1JTYA 4AUXA 4DJAA 4RM2A 5J6XA 3SJMA 2F4MB 1ZKGA 3F6VA 3TDZC 1QHGA 3TP3A 3LSTA 1SVOA 3S2DJ 3S2HJ 2CFXA 4KN4X 4XM3A 4LK0F 4BHBA 1ZR2A 4N9IA 3J80K 4XLNF 2LREA 4C3HJ 2XVCA 4E7IA 2CWEA 3QP5A 5GAEJ 2DOFA 2QLZA 3WODF 3UR3C 2WWYA 2KISA 4PK4A 2HYGD 1RR8C 1VF9A 3OYAA 3SHFA 5FKMA 3J7AY 2NVQJ 3WGGA 2Z3YA 3ZPLA 3H3VK 2CO5A 2X0LA 1X1AA 4F92B 5HLHA 4ZDPA 3SZPA 2NS8A 5CVRA 2KRHA 1HDPA 1SVLA 5LFAA 3H0GJ 3RYRA 4FASD 2NYXA 5DV5A 5CVIA 3FF5A 3QYEA 2P8TA 3DLLF 2XAUA 1VI0A 4U0YA 2DFFA 4EGZA 4F7ZA 2IEKA 1FTZA 4AWXB 3IL2A 1K6YA 2ME0A 2OZ6A 2XIGA 4RGUA 5TISC 5KK1A 2ZSIB 1HC8A 4FT8A 4NBQA 1IN8A 2HZTA 2XAJA 3OSFA 4B3AA 1B72B 2PMHA 4AVPA 1P2FA 3A02A 2OPTA 1YJWI 4ENMA 2BHYA 3PQKA 3BTLA 2Q0OA 4NC6A 1Z9CA 2DA2A 1GLNA 3K69A 3VYTB 4D0PA 2E60A 1QZEA 1PYVA 5J3LA 3C7JA 2KMUA 2JA2A 1MDMA 5F1JA 4HPQA 3BR5A 3CESA 4C2TA 2M2EA 3ERMA 1VQ8I 3BPXA 1LFUP 1P7JA 4J01A 1D0YA 3FKIJ 1B9MA 4XLEA 4UNOA 1U0JA 2D45A 1IO2A 4LB6B 1I3QJ 1OFCX 2O5RA 1FIAA 2R4GA 4A3CJ 4KT5C 1W36C 2RV8A 1A31A 1TWHJ 1V3FA 1JGSA 3BPVA 3BOQA 4M3FA 4I0AA 3BG5A 2D1HA 4N4OB 1RIOH 3OL4A 1YW7A 4BE0A 3CDHA 1RUNA 2DT6A 3FMRA 4B48A 1I1SA 2LD5A 1FYLA 2R7SA 1GV5A 4WF2A 1Q1VA 4HF0A 5E3LA 3OYFA 5IP6A 4LITA 5F27A 2KJCA 4JX5A 2DA1A 2Q2EB 5C3EJ 1O3TA 1AU7A 3S3MA 1VQ5I 3P5JA 4AC0A 1USSA 3DBLB 3MD2A 3I59B 2VJ5A 3KYDB 2WAQA 4LIUA 3MKWB 4A3GJ 1OISA 4HSRA 1SEUA 5ILSA 5JHFA 5J8CA 4CCMA 2LH9A 2XF7A 1D5VA 1WKMA 3S14J 2FXAA 5EDNA 2OC6A 3PO3J 1J0RA 2QWWA 1HF0A 3JR9A 1JE8A 2X51A 1D5YA 1J5YA 1KYZA 2XAQA 3GLXA 3WG9A 3OYCA 5M5WJ 1AKHA 1T56A 1ON2A 2HWVA 3SFIA 4I99C 3WGIA 2ME6A 1W5CC 3BG3A 1ZTRA 2R7WA 3ZGKA 4A3EJ 5BPDA 2Y75A 3VOEA 2OAZA 3RKXA 3HC7A 2W1OA 2Q2EA 2DMPA 3JCUC 4ON0A 4EJWA 2DN0A 2DK8A 4F91B 1TZLA 2WAQN 2YPRA 1G2HA 2KL4A 1SAUA 3OIOA 1ZN2A 2L7FP 2FMYA 2PLYA 4KFCA 1JUSA 1YIOA 2DA7A 3AG3H 4XN0A 4IHVA 3R4KA 3SXYA 1JJ8C 1FOXA 2EH3A 3H9JA 4CCOA 2XUBA 1HKSA 1WCMJ 1Z77A 2DPDA 3VSLA 3Q0VA 4GYGA 4RB0A 4BNCA 3DLAA 2IS2A 1LE8B 5B1AH 5LEKA 2LR8A 3IH2A 1H8AC 5CVJA 3EETA 2W48A 1MH4A 3A1YA 2WY8Q 1W5SA 1FYMA 4RA2A 4PZJA 2V1UA 1TBXA 2E5ZA 1XSVA 2IA0A 2VQCA 1OQYA 1U9NA 1WFXA 3PUBA 4PJJA 1F1ZA 3GTPJ 2PBIA 4MTDA 1WJAA 1VQLI 3I71A 1JT6A 3WGHA 4KA4A 2FA5A 4XBFA 1O3SA 1B4AA 1MBKA 2Q1ZB 1RESA 3RI4A 3E97A 4A0ZA 1X19A 3CCQI 2Z99A 5DCMB 2M5WA 5HLIA 4MQ9F 3ULQB 4WCGA 4N9HA 2HI3A 2KZGA 4O3MA 4XLAA 2ZXHA 1HSTA 4IHYA 4I76A 1HLVA 3MN2A 2P5VA 4YFNF 2EZKA 4W97A 4XOPA 4EGYA 2KHMA 2GLOA 1SFEA 3K70D 1YJ9I 3HOYJ 1OYIA 3K4MA 1JKOC 2IGKA 1HQCA 2XAGA 2X6YA 2F4IA 3WE2A 1W5TA 2L9NA 5EG0B 5GPCA 4U7DA 2FNPA 2J5PA 1N75A 4QWQA 1PUFA 4GO1A 1LKXA 2DU9A 3WTUC 3PQJA 2HOAA 4BY1J 3HEFA 2LKSA 5JLXA 3FZVA 4WXCA 3V7CA 4R79A 3K1MA 2K4BA 2ZFWA 1TWFJ 3DV8A 1X4OA 2F4OB 4EM0B 2B9SA 1R4MB 3NEUA 5BNGA 2DXIA 2GA1A 1R36A 2KIQA 2X1CA 3ZN0A 1PJRA 4BDYA 5EZHA 3K9TA 3T8TA 2VE9A 2I8DA 2KJBA 4YFKF 2A6HF 1X1BA 2ZMEB 2XAFA 2XV4S 4XSXF 1ZG1A 1T38A 5B5EC 3OYDA 1T33A 3JTGA 1YIJI 1Q1HA 3HPGA 3FX3A 5D4RA 2DQLA 2BY3A 3CQZJ 3FKJA 2VASA 2ZSHB 2WV1A 3PFIA 4RB2C 1UB9A 4ZTFA 2L02A 2V9VA 2OZUA 4UUTA 3LSGA 3MQ0A 4R8HA 1IRZA 3H0DA 5EG0A 3FXJA 3CTAA 2A3SA 1TQIA 2DQRA 1I27A 2QVOA 1Z05A 4LOCA 4EVIA 2H1KA 4HF2A 3CC2I 2L7KA 4RLFA 2ZFUA 3HM5A 3K6GA 4GCVA 4XK4A 2NVTJ 4ENNA 5IT9Z 2E36A 3ISPA 5CYVA 3CP2A 3A01B 4DZJA 1UG0A 1G4DA 1S7OA 2OQGA 5CVVA 1WVRA 1XGSA 5M3FJ 3Q0WA 1LDDA 4UVBA 3K4BA 2EJRA 4V19K 5LD2C 2EWNA 1WJFA 5E1XA 4ZZLA 4YEJA 3KPHA 1Y6IA 2X48A 1EKEA 1WI3A 1T2KA 3G6EI 2VQLA 3G1OA 1FJLA 4CCKA 2O61A 4MFEA 2HFHA 5B1BH 2X1DA 1D1CA 5LBQA 3WU2C 2K4JA 4KIBA 5HNFA 4IQJA 4XNFA 3QOEA 2YX4A 2LMDA 1JJ6C 3OYNA 5H6QA 2HXOA 4C2MJ 1JHHA 1I1GA 1X2NA 3WHBA 2FQ4A 3ABLH 5E18F 1A36A 3S32A 2IGNA 1KYWA 3TO9A 2OTLI 2VPRA 4P9UA 5E1ZB 2E2JJ 5IT9K 1IV8A 4IEJA 5EZGA 1ETOA 2DDBA 2E1MC 1JKPC 2B63J 3JRBA 2MLKA 1IXRC 1SC7A 4HQMA 1YLFA 4LG0A 1QA6A 2XDVA 4HW0A 2R0QC 3FXLA 1YG2A 4Y4RA 2L9VA 2Z16A 4KNYA 3I9V2 1MH3A 4XLHA 2JJ7A 2HDWA 1WRJA 1P6RA 3S2WA 5AIQA 2NVXJ 4IOAF 3GTMJ 5DDGA 2Z1DA 4G6TB 4UB6C 1ZGWA 1YFHA 1S72I 1GVDA 2LF7A 2XGEA 5FKOA 4FCYA 1EH7A 2RREA 2FE3A 2DAOA 1AWCA 1U5TB 1IRGA 1LFBA 1W1WE 3OYEA 3WU1B 3TEDA 5CKTA 2EIJH 2C6YA 4A5MA 5LLQA 5E3MA 5L3FA 3CUQA 1GVJA 5F0CA 4BKXA 4WWCA 3H5RA 2CQNA 3L7WA 4IRHA 1R1VA 5J47A 5JR3A 1G6NA 1DPRA 5H2FC 2JUGA 1ZLJA 4NB5A 1SFUA 4I02A 1W7PB 3GLLA 3ZOBA 3WTWC 1R49A 2ZJRF 3DTIA 3KYLA 1TW2A 3RJPA 3GFLA 1FTTA 2M8EA 3RPUD 3SYTA 5D6EA 2VODA 1Y8QB 3LA3A 4EATA 2X4HA 3KYCB 1O4XA 5E3OA 5ICFA 3ASNH 3RZDJ 1PP8F 2PMZA 4RM3A 1Y56A 1PP7U 2LY1A 3H5AA 4I01A 4RBOA 2HR3A 3CUQC 4IHSA 3ABTA 4O5VA 4DYQA 2HOEA 2AO9A 3GFMA 4Q47A 4BJ5C 5IP9J 2EINH 2K7LA 3AL0B 1J2XA 2IA2A 1Z91A 2ECCA 4B47A 2RDPA 3W2WA 3MWMA 1OCTC 1R00A 3DP7A 1T39A 4BACA 3ZQFA 1U5TA 5HVQC 1MZBA 3ZQCA 1IN7A 3B02A 5JFRA 1B1BA 2DK5A 3VB2A 2W24A 2Y2ZA 3LFUA 2NS0A 4IVNA 4ITVA 4AM3A 2CYYA 2DA6A 3GO5A 1IZ1A 3KFWX 2EFWA 2VB6A 2WB1A 4BXFA 1ACIA 2O9LA 2QBYB 2DW4A 2OTJI 1DGWY 2PMZN 3B6CA 4Y17A 4E7KA 3MCZA 2EA4A 1BN5A 4EEFG 2H1LA 3EUAA 3K4NA 2PJRA 1Z67A 2MYSA 3M1CA 9ANTA 5M3MJ 3HB9A 3QPSA 1T95A 5AONA 5ILUA 4BQQA 2XPUA 1MBGA 1LQ1A 2K27A 2CQQA 2QSHX 4XKBA 2BVMA 3TDUC 4A0XA 1OCRH 2R7FA 2WC2A 5F64A 1FSHA 3ABUA 2IBDA 4BAYA 1T0FA 3OOPA 3R60A 4OMZA 1W0TA 4ZJZA 2M9HA 4GFBA
chains in the Genus database with same CATH topology
2NS8A 2WB1N 1HDPA 3WHCA 1JKRC 2AHQA 3H0GJ 2CU7A 1MBJA 3IV5A 1K83J 1MBHA 1VI0A 2IEKA 1FTZA 1GV2A 2E1OA 1MSFC 2ME0A 1WGXA 2COBA 4B4CA 3OSFA 4B3AA 1B72B 3A02A 2OPTA 2R5ZA 3OOUA 2L9RA 3BTLA 2DA2A 2K40A 4DW6A 4X1EA 5J3LA 1F43A 4IHWA 5F1JA 3M3YJ 2DTZA 1MBFA 3BR5A 1HCRA 1VFCA 2M2EA 1LFUP 1IC8A 1P7JA 5EF6A 3FKIJ 2JMWA 4QTRA 1APLC 1I3QJ 1OFCX 5M5YJ 1FIAA 4AYBN 3BTIA 3CMYA 4A3CJ 1LE8A 1TWHJ 3S15J 1HOMA 1RETA 1TWAJ 1WH7A 4M3FA 3JRHA 1JTXA 4XIDA 3BG5A 1ETVA 2NOGA 2CRGA 5K7ZA 2QCOA 2XPVA 5J1YA 4MIMA 2LD5A 2H8RA 1R9TJ 1GV5A 1UHSA 1ETWA 3S1RJ 1Q1VA 3BR6A 5E3LA 5GPAA 1NTCA 5IP6A 5F27A 2ID6A 1IJWC 1ETKA 1E3OC 4JX5A 5C3EJ 2DA1A 2I10A 2MSYA 1DU6A 2EZHA 1AU7A 2VI6A 3RZOJ 4IHXA 1QPIA 2HXIA 3LNQA 3BQZA 2Y31A 4AC0A 2EQRA 1ORKA 1Y1WJ 4BBRJ 3JRIA 1EF4A 3BTCA 1WH5A 4A3GJ 1NK2P 5K7HA 1GUUA 3OSGA 4RDUA 1CQTA 2DMQA 1BW6A 3HOUJ 4D7NA 1FIPA 1RPWA 3DCFA 4DZPA 1TWCJ 3S14J 1S7EA 5EDNA 5FKNA 2TRTA 1AHDP 1P7IA 3PO3J 2E2IJ 3F0CA 3JR9A 1HF0A 2DA5A 2XPWA 1D5YA 1QVUA 2E2HJ 1ETQA 5M5WJ 3O8GA 1AKHA 1U8BA 1T56A 2M0CA 3I4NJ 3ZQIA 1A5JA 3SFIA 3BQYA 4A3JJ 2DJNA 2DMUA 3FK6A 4M3GA 1ENHA 4A3IJ 3S1QJ 2ME6A 4W1UA 3BG3A 1ZTRA 4A3EJ 5EEAA 4QSHA 2XGCA 2R5ZB 2RAEA 2DMPA 4NDLA 4BY7J 2HDDA 2DN0A 2WAQN 1G2HA 2LVSA 1IUFA 3OIOA 1A6IA 1POGA 2L7FP 1TC3C 1MBEA 1JUSA 1U9OA 2DA7A 4IHVA 1BW5A 1JJ8C 2TCTA 3VPRA 2EH3A 1WPKA 1XG1A 3QPLA 3G1MA 2M8GX 3ZQLA 2IAIA 2XRLA 1QVTA 3RKQA 1WCMJ 4JP0A 1Z77A 3C2BA 1HDDC 3K7AJ 3Q0VA 2CQXA 4BXXJ 4D5CA 1LE8B 1IG7A 1SFOJ 2LR8A 3IH2A 1H8AC 4J19A 3D1NI 2W48A 1MH4A 1XS9A 3IH4A 2D5VA 2LFBA 1I6HJ 1RKWA 1U9NA 3JREA 1BA5A 2JA7J 3GTPJ 3A01A 3W6VA 1VNDA 5FLMJ 3IH3A 1JT6A 1UG2A 1MBKA 1RESA 2ELKA 4XRSA 1IGNA 3HOVJ 4DYRA 5K7FA 1XC5A 3HOZJ 3BT9A 1X2MA 2YU9J 2HI3A 2DMNA 4IHYA 1IDZA 1MNMC 3JRFA 4I76A 3JRGA 1HLVA 3MN2A 2EZKA 4W97A 2GLOA 2CJJA 5C4JJ 3HOYJ 1JKOC 3MKLA 2GBYA 2ID3A 1X58A 3NARA 2R5YA 3JRDA 2JWTA 3ZQHA 3S1NJ 3LSRA 1ZK8A 5IYBJ 5GPCA 5EG0B 3GBGA 3BTJA 1PUFA 1GT0C 3S1MJ 1I50J 4D7MA 2HOAA 2DA3A 4BY1J 3HEFA 1RR7A 4S0HB 1AKHB 5JLXA 1ZR4A 1JUMA 3GTGJ 5EYRA 1TWFJ 5E3NA 2FX0A 5IYCJ 3GTQJ 4M3DA 3G1LA 1GDTA 5BNGA 3JRCA 4CYCA 5EZHA 3S16J 2MGQA 2Y9ZA 4C3JJ 2Y30A 2YUSA 5IP7J 2VKEA 1ETYA 5J1UA 3L1PA 2G0EA 3TW6A 2K9NA 1T33A 1FEXA 2LLKA 2R93J 3CQZJ 2WV1A 2VUMJ 4UUTA 3LSGA 2JA5J 2HYJA 1SANA 1IRZA 3HBLA 5EG0A 2DMTA 4JX4A 4XICA 4LOCA 2H1KA 1ETXA 3FISA 3HM5A 4FE7A 4XK4A 2NVTJ 3HOWJ 3DEWA 2HQ5A 5F0HA 2YS9A 2P81A 2XB0X 4A3MJ 4D5FA 3A01B 4DZJA 2NS7A 3JRAA 2R7ZJ 3HDDA 4A93J 1MSEC 2LTPA 5FJ8J 2XB5A 1JGGA 5EGOA 4V2FA 5M3FJ 1ITYA 2ZB9A 4JX6A 2CUFA 3Q0WA 3LOCA 4MO7A 3BR1A 2FJ1A 5J1RA 2L0KA 1ZQ3P 3HKZN 3I4MJ 4FE4A 2X48A 2HOSA 1WI3A 4C3IJ 4ABZA 3UKGA 1DU0A 4BBSJ 2HOTA 3G1OA 5HODA 1FJLA 2R5YB 2JA8J 4MFEA 2JN6A 2MW8A 5F0FA 3PM1A 2L7MP 3HGGA 1QRYA 1PUFB 3A03A 1JJ6C 2OF7A 1B8IB 2HXOA 4M3EA 4C2MJ 4DYCA 2JA6J 4M6VA 5F04A 3ZQGA 4I6ZA 1X2NA 2E19A 2FQ4A 3WHBA 4QIWN 5F08A 2KT0A 2L7ZA 5IOZA 4JYKA 3B6AA 3RQIA 3PO2J 2VPRA 4Y7NJ 2E2JJ 4CYCB 3LSJA 4IEJA 5EZGA 1Y1VJ 5FKLA 1ETOA 2Y9YA 1JKPC 2B63J 3GTKJ 1JKQC 3JRBA 2EZLA 2LKXA 1Z0XA 3SDGA 1YRNB 4G12A 3CDLA 2R0QC 5M5XJ 4FISA 1NK3P 1MH3A 2JJ7A 5IOYA 1W0UA 4A69C 1OJLA 2NVXJ 5DS9A 4UUSB 2XSDC 3GTMJ 3BG9A 2X6OA 5IPAA 2O7OA 4A3BJ 2GM4A 1ZGWA 1F36A 1JUPA 2DA4A 1RKTA 4B1RA 1GVDA 2XGEA 5FKOA 5FKKA 1UMQA 4FCYA 1TWGJ 2NVYJ 3Q0UA 1B8IA 1K61A 1LFBA 3K2AA 2LY9A 3QQAA 3TEDA 3S17J 2EBIA 3FIWA 5C44J 5DTDA 2K9QA 3BR0A 5E3MA 2KDZA 4V2GA 5F0CA 4BKXA 1IV6A 4A3DJ 3MVPA 2Y0SN 4X6AJ 2QF7A 5GP9A 5EGOB 2FD5A 3ZOBA 3BR3A 3HOXJ 1YRNA 2K9SA 1FTTA 1BL0A 4A3FJ 1H88C 2ECBA 4FTHA 3LSPA 3E7LA 1O4XA 4Y52J 2M34A 5E3OA 3RZDJ 1BJZA 4RBOA 4UUSA 1B72A 1IDYA 5FLVA 4DYQA 2AO9A 2EZIA 1OCPA 3NAUA 5IP9J 3TP0A 2ECCA 4HNVA 3M4OJ 1OCTC 1U78A 5JLWA 1JT0A 3ZQFA 3GTLJ 2MG4A 3BR2A 3ZQCA 4A3LJ 2O8KA 4L5EA 4MLOA 2JK3A 2VKVA 2XGDA 2Y2ZA 2LP0A 2DA6A 2LK2A 3O8HA 2O9LA 4A3KJ 1H89C 3GTOJ 1JTYA 4AUXA 2PMZN 3B6CA 4MFDA 3CCYA 3SJMA 3FK7A 4EEFG 5IYDJ 1ZKGA 2R92J 3TW7A 5C4XJ 9ANTA 3TP3A 3S2DJ 3S2HJ 5M3MJ 3HB9A 2X9DA 3QPSA 1ZR2A 4C3HJ 2XPUA 1MBGA 4M3BA 3HGYA 2CQQA 3Q3SA 1VF9A 4XRSG 2CUEA 3GTJJ 5FKMA 2NVQJ 2N8GA 2IBDA 4XRMA 1W0TA 3H3VK 2M9HA 4GFBA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2NS8 A;  2WB1 N;  1HDP A;  3WHC A;  1JKR C;  2AHQ A;  3H0G J;  2CU7 A;  1MBJ A;  3IV5 A;  1K83 J;  1MBH A;  1VI0 A;  2IEK A;  1FTZ A;  1GV2 A;  2E1O A;  1MSF C;  2ME0 A;  1WGX A;  2COB A;  4B4C A;  3OSF A;  4B3A A;  1B72 B;  3A02 A;  2OPT A;  2R5Z A;  3OOU A;  2L9R A;  3BTL A;  2DA2 A;  2K40 A;  4DW6 A;  4X1E A;  5J3L A;  1F43 A;  4IHW A;  5F1J A;  3M3Y J;  2DTZ A;  1MBF A;  3BR5 A;  1HCR A;  1VFC A;  2M2E A;  1LFU P;  1IC8 A;  1P7J A;  5EF6 A;  3FKI J;  2JMW A;  4QTR A;  1APL C;  1I3Q J;  1OFC X;  5M5Y J;  1FIA A;  4AYB N;  3BTI A;  3CMY A;  4A3C J;  1LE8 A;  1TWH J;  3S15 J;  1HOM A;  1RET A;  1TWA J;  1WH7 A;  4M3F A;  3JRH A;  1JTX A;  4XID A;  3BG5 A;  1ETV A;  2NOG A;  2CRG A;  5K7Z A;  2QCO A;  2XPV A;  5J1Y A;  4MIM A;  2LD5 A;  2H8R A;  1R9T J;  1GV5 A;  1UHS A;  1ETW A;  3S1R J;  1Q1V A;  3BR6 A;  5E3L A;  5GPA A;  1NTC A;  5IP6 A;  5F27 A;  2ID6 A;  1IJW C;  1ETK A;  1E3O C;  4JX5 A;  5C3E J;  2DA1 A;  2I10 A;  2MSY A;  1DU6 A;  2EZH A;  1AU7 A;  2VI6 A;  3RZO J;  4IHX A;  1QPI A;  2HXI A;  3LNQ A;  3BQZ A;  2Y31 A;  4AC0 A;  2EQR A;  1ORK A;  1Y1W J;  4BBR J;  3JRI A;  1EF4 A;  3BTC A;  1WH5 A;  4A3G J;  1NK2 P;  5K7H A;  1GUU A;  3OSG A;  4RDU A;  1CQT A;  2DMQ A;  1BW6 A;  3HOU J;  4D7N A;  1FIP A;  1RPW A;  3DCF A;  4DZP A;  1TWC J;  3S14 J;  1S7E A;  5EDN A;  5FKN A;  2TRT A;  1AHD P;  1P7I A;  3PO3 J;  2E2I J;  3F0C A;  3JR9 A;  1HF0 A;  2DA5 A;  2XPW A;  1D5Y A;  1QVU A;  2E2H J;  1ETQ A;  5M5W J;  3O8G A;  1AKH A;  1U8B A;  1T56 A;  2M0C A;  3I4N J;  3ZQI A;  1A5J A;  3SFI A;  3BQY A;  4A3J J;  2DJN A;  2DMU A;  3FK6 A;  4M3G A;  1ENH A;  4A3I J;  3S1Q J;  2ME6 A;  4W1U A;  3BG3 A;  1ZTR A;  4A3E J;  5EEA A;  4QSH A;  2XGC A;  2R5Z B;  2RAE A;  2DMP A;  4NDL A;  4BY7 J;  2HDD A;  2DN0 A;  2WAQ N;  1G2H A;  2LVS A;  1IUF A;  3OIO A;  1A6I A;  1POG A;  2L7F P;  1TC3 C;  1MBE A;  1JUS A;  1U9O A;  2DA7 A;  4IHV A;  1BW5 A;  1JJ8 C;  2TCT A;  3VPR A;  2EH3 A;  1WPK A;  1XG1 A;  3QPL A;  3G1M A;  2M8G X;  3ZQL A;  2IAI A;  2XRL A;  1QVT A;  3RKQ A;  1WCM J;  4JP0 A;  1Z77 A;  3C2B A;  1HDD C;  3K7A J;  3Q0V A;  2CQX A;  4BXX J;  4D5C A;  1LE8 B;  1IG7 A;  1SFO J;  2LR8 A;  3IH2 A;  1H8A C;  4J19 A;  3D1N I;  2W48 A;  1MH4 A;  1XS9 A;  3IH4 A;  2D5V A;  2LFB A;  1I6H J;  1RKW A;  1U9N A;  3JRE A;  1BA5 A;  2JA7 J;  3GTP J;  3A01 A;  3W6V A;  1VND A;  5FLM J;  3IH3 A;  1JT6 A;  1UG2 A;  1MBK A;  1RES A;  2ELK A;  4XRS A;  1IGN A;  3HOV J;  4DYR A;  5K7F A;  1XC5 A;  3HOZ J;  3BT9 A;  1X2M A;  2YU9 J;  2HI3 A;  2DMN A;  4IHY A;  1IDZ A;  1MNM C;  3JRF A;  4I76 A;  3JRG A;  1HLV A;  3MN2 A;  2EZK A;  4W97 A;  2GLO A;  2CJJ A;  5C4J J;  3HOY J;  1JKO C;  3MKL A;  2GBY A;  2ID3 A;  1X58 A;  3NAR A;  2R5Y A;  3JRD A;  2JWT A;  3ZQH A;  3S1N J;  3LSR A;  1ZK8 A;  5IYB J;  5GPC A;  5EG0 B;  3GBG A;  3BTJ A;  1PUF A;  1GT0 C;  3S1M J;  1I50 J;  4D7M A;  2HOA A;  2DA3 A;  4BY1 J;  3HEF A;  1RR7 A;  4S0H B;  1AKH B;  5JLX A;  1ZR4 A;  1JUM A;  3GTG J;  5EYR A;  1TWF J;  5E3N A;  2FX0 A;  5IYC J;  3GTQ J;  4M3D A;  3G1L A;  1GDT A;  5BNG A;  3JRC A;  4CYC A;  5EZH A;  3S16 J;  2MGQ A;  2Y9Z A;  4C3J J;  2Y30 A;  2YUS A;  5IP7 J;  2VKE A;  1ETY A;  5J1U A;  3L1P A;  2G0E A;  3TW6 A;  2K9N A;  1T33 A;  1FEX A;  2LLK A;  2R93 J;  3CQZ J;  2WV1 A;  2VUM J;  4UUT A;  3LSG A;  2JA5 J;  2HYJ A;  1SAN A;  1IRZ A;  3HBL A;  5EG0 A;  2DMT A;  4JX4 A;  4XIC A;  4LOC A;  2H1K A;  1ETX A;  3FIS A;  3HM5 A;  4FE7 A;  4XK4 A;  2NVT J;  3HOW J;  3DEW A;  2HQ5 A;  5F0H A;  2YS9 A;  2P81 A;  2XB0 X;  4A3M J;  4D5F A;  3A01 B;  4DZJ A;  2NS7 A;  3JRA A;  2R7Z J;  3HDD A;  4A93 J;  1MSE C;  2LTP A;  5FJ8 J;  2XB5 A;  1JGG A;  5EGO A;  4V2F A;  5M3F J;  1ITY A;  2ZB9 A;  4JX6 A;  2CUF A;  3Q0W A;  3LOC A;  4MO7 A;  3BR1 A;  2FJ1 A;  5J1R A;  2L0K A;  1ZQ3 P;  3HKZ N;  3I4M J;  4FE4 A;  2X48 A;  2HOS A;  1WI3 A;  4C3I J;  4ABZ A;  3UKG A;  1DU0 A;  4BBS J;  2HOT A;  3G1O A;  5HOD A;  1FJL A;  2R5Y B;  2JA8 J;  4MFE A;  2JN6 A;  2MW8 A;  5F0F A;  3PM1 A;  2L7M P;  3HGG A;  1QRY A;  1PUF B;  3A03 A;  1JJ6 C;  2OF7 A;  1B8I B;  2HXO A;  4M3E A;  4C2M J;  4DYC A;  2JA6 J;  4M6V A;  5F04 A;  3ZQG A;  4I6Z A;  1X2N A;  2E19 A;  2FQ4 A;  3WHB A;  4QIW N;  5F08 A;  2KT0 A;  2L7Z A;  5IOZ A;  4JYK A;  3B6A A;  3RQI A;  3PO2 J;  2VPR A;  4Y7N J;  2E2J J;  4CYC B;  3LSJ A;  4IEJ A;  5EZG A;  1Y1V J;  5FKL A;  1ETO A;  2Y9Y A;  1JKP C;  2B63 J;  3GTK J;  1JKQ C;  3JRB A;  2EZL A;  2LKX A;  1Z0X A;  3SDG A;  1YRN B;  4G12 A;  3CDL A;  2R0Q C;  5M5X J;  4FIS A;  1NK3 P;  1MH3 A;  2JJ7 A;  5IOY A;  1W0U A;  4A69 C;  1OJL A;  2NVX J;  5DS9 A;  4UUS B;  2XSD C;  3GTM J;  3BG9 A;  2X6O A;  5IPA A;  2O7O A;  4A3B J;  2GM4 A;  1ZGW A;  1F36 A;  1JUP A;  2DA4 A;  1RKT A;  4B1R A;  1GVD A;  2XGE A;  5FKO A;  5FKK A;  1UMQ A;  4FCY A;  1TWG J;  2NVY J;  3Q0U A;  1B8I A;  1K61 A;  1LFB A;  3K2A A;  2LY9 A;  3QQA A;  3TED A;  3S17 J;  2EBI A;  3FIW A;  5C44 J;  5DTD A;  2K9Q A;  3BR0 A;  5E3M A;  2KDZ A;  4V2G A;  5F0C A;  4BKX A;  1IV6 A;  4A3D J;  3MVP A;  2Y0S N;  4X6A J;  2QF7 A;  5GP9 A;  5EGO B;  2FD5 A;  3ZOB A;  3BR3 A;  3HOX J;  1YRN A;  2K9S A;  1FTT A;  1BL0 A;  4A3F J;  1H88 C;  2ECB A;  4FTH A;  3LSP A;  3E7L A;  1O4X A;  4Y52 J;  2M34 A;  5E3O A;  3RZD J;  1BJZ A;  4RBO A;  4UUS A;  1B72 A;  1IDY A;  5FLV A;  4DYQ A;  2AO9 A;  2EZI A;  1OCP A;  3NAU A;  5IP9 J;  3TP0 A;  2ECC A;  4HNV A;  3M4O J;  1OCT C;  1U78 A;  5JLW A;  1JT0 A;  3ZQF A;  3GTL J;  2MG4 A;  3BR2 A;  3ZQC A;  4A3L J;  2O8K A;  4L5E A;  4MLO A;  2JK3 A;  2VKV A;  2XGD A;  2Y2Z A;  2LP0 A;  2DA6 A;  2LK2 A;  3O8H A;  2O9L A;  4A3K J;  1H89 C;  3GTO J;  1JTY A;  4AUX A;  2PMZ N;  3B6C A;  4MFD A;  3CCY A;  3SJM A;  3FK7 A;  4EEF G;  5IYD J;  1ZKG A;  2R92 J;  3TW7 A;  5C4X J;  9ANT A;  3TP3 A;  3S2D J;  3S2H J;  5M3M J;  3HB9 A;  2X9D A;  3QPS A;  1ZR2 A;  4C3H J;  2XPU A;  1MBG A;  4M3B A;  3HGY A;  2CQQ A;  3Q3S A;  1VF9 A;  4XRS G;  2CUE A;  3GTJ J;  5FKM A;  2NVQ J;  2N8G A;  2IBD A;  4XRM A;  1W0T A;  3H3V K;  2M9H A;  4GFB A; 
#chains in the Genus database with same CATH topology
 4P55 A;  2WB1 N;  2CQ7 A;  2BBY A;  1FX7 A;  2LOO A;  3F22 A;  1R1T A;  3PNV A;  2VBW A;  5KAF C;  2AHQ A;  4IJA A;  3OIP A;  3P9C A;  3QYF A;  1MBJ A;  4BEH A;  2QBY A;  1JXS A;  1K83 J;  5D5W B;  3B73 A;  1YQA A;  1VQ6 I;  3FM5 A;  3MMY B;  3OY9 A;  1RZ4 A;  4B09 A;  3RIR A;  1SD7 A;  4F52 A;  2EIM H;  2E7W A;  2RQP A;  3MFK A;  4IZZ A;  4XON A;  3K70 C;  2BV6 A;  2R5Z A;  3OOU A;  1FNN A;  1WI9 A;  2K40 A;  3OYM A;  4CSW A;  3MKZ A;  1BR1 A;  3V7R A;  5D8K B;  4IHW A;  1FP1 D;  2DTZ A;  5DCF A;  3NQO A;  4C30 A;  3T8R A;  4KIF A;  2ESN A;  4HG2 A;  3SZG A;  2FOK A;  2HS5 A;  1TT5 B;  2L2O A;  2LY2 A;  4LK1 F;  5EF6 A;  4IKF A;  3KP4 A;  2W82 A;  1ULY A;  5F6F A;  2CW7 A;  1H9T A;  5M5Y J;  3BDD A;  3ELK A;  3LFK A;  2HDC A;  2QKL B;  3PNT A;  2NVU B;  3F8N A;  3GXO A;  1HOM A;  3JRH A;  1JTX A;  4XID A;  2HQA A;  2AXT C;  2DFI A;  3WTZ A;  4DOZ A;  3HOS A;  5FD5 A;  3HIF A;  3HHH A;  2CH0 A;  1BJA A;  5K5Q A;  4BS9 A;  4MIM A;  2H8R A;  4RGS A;  1UHS A;  3S1R J;  2RNJ A;  3BR6 A;  4UV9 A;  2MA3 A;  3S93 A;  3JSO A;  3IWF A;  2MSY A;  3K1P A;  4IF4 A;  3RTR A;  3WU0 A;  2ZXJ A;  4CDG A;  2BHZ A;  1Z1D A;  5FO5 A;  3F23 A;  1UHW A;  2ZJQ F;  1WH5 A;  3HL2 A;  3CC4 I;  5K7H A;  4YG2 F;  2M7B A;  3OSG A;  4RDU A;  2ACJ A;  1UCR A;  1Z7L A;  3HOU J;  1RPW A;  4ZYH A;  1TWC J;  1LUJ B;  4C9Y A;  1Z6T A;  2LYC A;  2TRT A;  3HG9 A;  2MD0 A;  3LSM A;  3F0C A;  4U88 A;  2E2I J;  2DA5 A;  3DU6 A;  2PJP A;  5A2Q K;  4I7H A;  2M4G A;  3BWG A;  4GRI A;  1QVU A;  3O8G A;  2LKP A;  2VJI A;  3HTU A;  3OYH A;  3ZQI A;  2UWM A;  3BQY A;  5LGU A;  2H09 A;  4A3I J;  1YW8 A;  3C1D A;  4W1U A;  1JHF A;  1UZC A;  1EA3 A;  5ICE A;  4YEL A;  4HOB A;  4QSH A;  1J7K A;  2QEN A;  3W2A A;  2WAD A;  2IS6 A;  3QRF F;  3H92 A;  5ERI A;  2CG4 A;  1G3S A;  1KQ0 A;  4P96 A;  4BY7 J;  4YFX F;  2HKO A;  2WBM A;  4A2U A;  4ZYA A;  4L5I A;  3E3V A;  1MDM B;  2LVS A;  2L4A A;  2GXA A;  1A6I A;  3D5S C;  1CF7 A;  2FBI A;  2RGV A;  1TC3 C;  3OYB A;  3LA7 A;  3DBH B;  2CV0 A;  1WJD A;  2TCT A;  4HEA 2;  1ZRF A;  3K2Z A;  1FZP B;  3VPR A;  3CJN A;  3LA2 A;  3G1M A;  2JUC A;  4PGG A;  3VDX A;  3KZZ A;  4CZZ A;  5KNL A;  2IAI A;  1ZRD A;  3RKQ A;  1V54 H;  4XLC A;  2CQX A;  3PFY A;  1ZHF A;  3CP8 A;  4BXX J;  1XGM A;  2K85 A;  3DTK A;  1IG7 A;  2OV7 A;  4J19 A;  5J4V A;  1WJ5 A;  3D1N I;  4M6Y A;  3I56 I;  3NWT A;  3CUO A;  1SMY F;  2NRA C;  1LVK A;  4JOM A;  4EJV A;  3X2Q H;  1I6H J;  2HTJ A;  3H3U A;  2KRC A;  4KUM A;  3CJQ B;  4ZYE A;  3W6V A;  1UG2 A;  2NOJ B;  2NAZ A;  2RNG A;  4M74 A;  5H20 A;  3OMY A;  1IGN A;  4OIQ F;  3M8J A;  4L5J A;  3VYU B;  4DYR A;  4X0G A;  5K7F A;  1XC5 A;  3CMA I;  2XAH A;  2IGO A;  3AAF A;  1FYK A;  1VTN C;  5LRS A;  4HX4 A;  1IDZ A;  2GQQ A;  2KLO A;  3JRG A;  1J09 A;  1W4M A;  2E5N A;  1MKM A;  3M07 A;  4ZC3 A;  1XDS A;  4H4K C;  1J9I A;  1HW2 A;  3ZMT A;  2IS1 A;  3MKL A;  2R7R A;  1KON A;  4MHG A;  2EA2 A;  3LQQ A;  1BOB A;  3HYI A;  1FC3 A;  1X3U A;  3S1M J;  1I50 J;  4M71 A;  3PIP F;  3ZMV A;  1X3W B;  2TDX A;  1AKH B;  2ICW G;  1ZR4 A;  4G8X A;  2IVM A;  2K3P A;  1JUM A;  4PJM A;  3GTG J;  2MFZ A;  1LEA A;  1XDU A;  2FX0 A;  5E3N A;  1K4S A;  3GTQ J;  2XGX A;  2EFN A;  4M3D A;  3G1L A;  2IRF G;  2KZV A;  1YW9 A;  3GCM A;  4CYC A;  2JT1 A;  3QP6 A;  4KMU X;  3G2B A;  2OBP A;  4ZTJ A;  2Y9Z A;  2IS4 A;  4C3J J;  4BQO A;  1TQP A;  1BI0 A;  4RGR A;  3N97 A;  5IP7 J;  3K0L A;  4NQW A;  5J1U A;  2F5V A;  3IC7 A;  2K9N A;  1XCV A;  2HYF A;  1DDN A;  2CSO A;  3E0J B;  1WZ2 A;  2R93 J;  1SVM A;  4L9N A;  2MC3 A;  2FBH A;  3HKZ A;  4OWR B;  1BR2 A;  2NNY A;  2JA5 J;  1F5T A;  3I64 A;  2ELJ A;  1SAN A;  3M1E A;  4I0B A;  2A07 F;  3HBL A;  1B9N A;  4E7Z A;  2DMT A;  4HLX A;  3R6S A;  2PG4 A;  3EDP A;  2DBB A;  1K6O A;  3S8P A;  2L4M A;  1CGP A;  4Q5S F;  1ETX A;  3FIS A;  4FE7 A;  3OL3 A;  3HOW J;  3DEW A;  1R6R A;  3KEO A;  3C2G A;  2V1X A;  1IXC A;  4P5O A;  2ZNY A;  3WTS C;  4A3M J;  1ZEL A;  5K5R A;  5TGT A;  1MMS A;  3ESW B;  2NS7 A;  3F3X A;  3JRA A;  3VEP A;  2W84 A;  2M4K A;  1UAA A;  2XB5 A;  5EGO A;  1ITY A;  1FOW A;  4D1Q A;  3VOD A;  3GZ5 A;  2CUF A;  1MMG A;  5FFX A;  1OYY A;  3LOC A;  5D5X B;  4CUG A;  2BYV E;  4XL9 A;  2L0K A;  4G6D A;  3HKZ N;  4XSZ F;  2HOS A;  1IAW A;  1ON1 A;  2HVR A;  4BBS J;  3VYR B;  3H9Q A;  5HOD A;  3G73 A;  1KQ8 A;  2MW8 A;  5JVT A;  5EEG A;  2B0L A;  4E7H A;  1R5I D;  3HGG A;  2PX9 A;  1PUF B;  1I6X A;  2PFB A;  5K5O A;  4ASN A;  1FMW A;  2EFQ A;  1BIB A;  2JTV A;  2OF7 A;  1B8I B;  2KRF A;  4M3E A;  4DYC A;  4CH7 A;  4M6V A;  3ZQG A;  5BPI A;  2HTS A;  4EM1 A;  2L7Z A;  4PFP A;  1IW7 F;  2BW3 A;  2DTR A;  1S3J A;  3B6A A;  1F9N A;  4Y7N J;  1KQ9 A;  3GVA A;  3F9K A;  3WTY C;  2IXS A;  4PJN A;  3ZP5 A;  1W7P D;  1Y1V J;  4HX8 A;  5L3E A;  2Y0S A;  3GTK J;  2XAS A;  2M30 A;  2L3D A;  3ASO H;  4II3 A;  3S3O A;  1DUX C;  4XLF A;  1N77 A;  3AG1 H;  2ZJ2 A;  2OA4 A;  3KZY A;  4L9T A;  1VQ7 I;  3QU6 A;  2KIF A;  1W0U A;  5DD8 A;  1OJL A;  3BJO A;  2IT0 A;  5CLS A;  3H9G A;  3LSH A;  2DJI A;  4HNU A;  1QO0 D;  2JVH A;  1FBS A;  3MAJ A;  3L09 A;  3BG9 A;  4E6K G;  3OYL A;  5IPA A;  2GM4 A;  1MD0 A;  1KZH A;  4EJO A;  3ML6 A;  1E3H A;  4B43 A;  2EIK H;  5FKK A;  4JK1 X;  5DD4 A;  1KU9 A;  1O7F A;  1K61 A;  1B8I A;  3K2A A;  4BL0 B;  2LY9 A;  3JAM Z;  2CUZ A;  2Y0M A;  3F6O A;  3FIW A;  4I09 A;  3DF8 A;  1YS6 A;  5C44 J;  2BGC A;  2K9Q A;  4DQ2 A;  1PDN C;  1YS7 A;  2O6G E;  2Y0S N;  4ZYD A;  3RKW A;  2QF7 A;  2QUF A;  4CXF A;  2DYS H;  2BOL A;  3FHN A;  3BJ6 A;  4GDF A;  3DKW A;  3VYS B;  1Y0N A;  3PNY A;  1Y8R B;  1ZAR A;  3ONQ A;  3BR3 A;  4N4N B;  3HOX J;  4AIJ A;  2ZNZ A;  2P5L C;  2VPL A;  1H88 C;  2AXL A;  2ECB A;  3N05 A;  2M34 A;  5FFZ A;  3COA C;  2HPM A;  5ILV A;  3V8L A;  2HQN A;  2ZJP F;  2Z2S B;  3RCO A;  2F5C A;  3KP6 A;  1OCP A;  2JSP A;  2E1M B;  3L2W A;  2VE8 A;  1BOA A;  1S29 A;  5GAH J;  2VLA A;  4C2U A;  1K78 B;  2F5F A;  3M7G A;  4HNV A;  3M4O J;  1TLH B;  1XSX A;  2DT5 A;  2GAU A;  2VN2 A;  1JT0 A;  5TRD A;  1MJB A;  2QSF X;  1WSU A;  2DPU A;  4XRF A;  3K4K A;  3E1S A;  1WQ2 A;  2O8K A;  2JK3 A;  3W2V A;  5DUI A;  2XGD A;  2K5C A;  3A4C A;  3JAM K;  2VC1 A;  2BZT A;  2LP0 A;  3ZMD A;  3O8H A;  5HNH A;  2CMP A;  1WJC A;  1ODD A;  3ZR8 X;  3T0Y A;  4BU2 A;  3FWE A;  2OCE A;  3TKY A;  5GTI C;  2W85 A;  4LG0 B;  1OMI A;  4HST A;  2XRN A;  1VQO I;  3CC7 I;  4AIK A;  3DEU A;  1XCB A;  3TW7 A;  5C4X J;  5TJJ A;  2QYO A;  4XOT A;  2X9D A;  5DUK A;  2EV0 A;  1REP C;  1BIA A;  3GUD A;  3ZMU A;  4M9Z A;  4HBL A;  1KU2 A;  3TO7 A;  3HGY A;  1K78 A;  2EV6 A;  3DPL C;  2A6E F;  2E1N A;  3KIO A;  5ICG A;  3Q3S A;  3GFJ A;  2OJE D;  4HDU A;  2LSO A;  3GTJ J;  4M73 A;  4PSX A;  4E7J A;  4G94 A;  4XRM A;  2ZC2 A;  3CUQ B;  4XN3 A;  3L00 A;  2ELH A;  4CCJ A;  2BY1 A;  4FHT A;  5L3C A;  2QQ9 A;  1XGN A;  2HGC A;  2WAE A;  4LD5 A;  3C3W A;  1V5E A;  1TL8 A;  4NC8 A;  1JKR C;  2CU7 A;  2ISY A;  1LB2 A;  1ZGA A;  1R23 A;  4WXH A;  4CCL A;  3IV5 A;  1HA8 A;  2R7Q A;  4HX7 A;  5HLG A;  4FQG A;  4PCQ A;  2K02 A;  1GV2 A;  4A5N A;  1GXQ A;  2E1O A;  2EFO A;  2BVL A;  1MSF C;  1MJ9 A;  1FBQ A;  1WGX A;  2KPM A;  2JSC A;  3I5U A;  1HW1 A;  2IJL A;  1F4K A;  3KLN A;  3FMS A;  4FET A;  1QGP A;  4NHJ A;  3DXJ F;  2COM A;  5E8I A;  1V5F A;  4PSW A;  4DW6 A;  4X1E A;  1F43 A;  1U3E M;  1BI2 A;  4HA8 A;  2BY2 A;  4WX9 A;  1SAX A;  2FRH A;  3D5R C;  3PL8 A;  3FXQ A;  1MBF A;  1H9G A;  5KCM A;  2YSR A;  1AA7 A;  3RSN A;  2CS3 A;  1S5L C;  1RI7 A;  5HDG A;  2XKO A;  3IUO A;  2X6X A;  1APL C;  3KEY A;  3GWZ A;  1XMA A;  2K3F A;  2IP2 A;  3BTI A;  3CMY A;  2HQR A;  1P4X A;  3OS2 A;  2L5Q A;  1Z3X A;  1C0W A;  1RET A;  1TWA J;  1WH7 A;  1R7J A;  4U87 A;  2NOG A;  2CRG A;  3HUG B;  2QCO A;  2VKH A;  3IRQ A;  4H0E A;  2PJR B;  1Z7U A;  3CDI A;  4XKC A;  4RB3 C;  1ETW A;  3QOP A;  5F1R A;  3L2R A;  2LBF A;  4BHP A;  5E20 A;  3PSI A;  5GPA A;  1RRJ A;  2ID6 A;  3G3Z A;  4JBA A;  5LRR A;  5CPR B;  3TQN A;  1JI8 A;  1MMN A;  3FBI B;  3P7N A;  4AVZ A;  2VI6 A;  4ZH4 F;  1QPI A;  2HXI A;  3LNQ A;  3ZN1 A;  5BOX A;  2M7A A;  1ORK A;  5GAG J;  1R71 A;  1EF4 A;  1U8R A;  3TOA A;  3BTC A;  4WK8 F;  1TNS A;  2F5D A;  3IRR A;  1GUU A;  2W7N A;  1YOV B;  2QSG X;  1XN7 A;  2E35 A;  2RN7 A;  4D7N A;  1FIP A;  2Z5U A;  1G3T A;  4DZP A;  1S7E A;  2UV1 A;  4PJ0 C;  5FKN A;  3W6J B;  2XRO A;  1AHD P;  3WTV C;  4Q4Z F;  2CW8 A;  3VFZ A;  4K2E A;  4BEH B;  2XPW A;  4EV0 A;  1U8B A;  3LMM A;  1SD4 A;  3HUG A;  1A5J A;  1U2W A;  5FRM A;  2J5O A;  3J7Y J;  3FK6 A;  2DMU A;  2KKO A;  3S1Q J;  2BXY A;  4XKW A;  1S8N A;  2CW0 F;  4I98 B;  3CF5 F;  5EEA A;  3L2C A;  3V8K A;  5FB2 A;  2P0W A;  2R5Z B;  2R7O A;  4NDL A;  2KFD A;  3CO6 C;  5FGM A;  1G59 A;  2P7V B;  1MGT A;  2YX7 A;  3MZ8 A;  4ZYG A;  4Y13 A;  3DQV C;  1POG A;  3F8C A;  2VOP A;  1U9O A;  3F8M A;  1BW5 A;  3LL7 A;  3DPU A;  4XMY A;  3IWZ A;  3GFI A;  3JSP A;  2DYR H;  2IPQ X;  1XG1 A;  2JPB A;  2M87 A;  2XRL A;  1QVT A;  4DNC A;  3C2B A;  1HDD C;  3K7A J;  2B7E A;  1HSJ A;  4LLG F;  2KDO A;  1XS9 A;  3IH4 A;  2QM3 A;  4HDV A;  4G9Y A;  2HVS A;  4ENK A;  1QBJ A;  4HV6 A;  3ZMS A;  3QOD A;  1LPQ A;  2JA7 J;  3OR1 C;  1N78 A;  3BZC A;  5JHU A;  5FLM J;  3IH3 A;  2VQG A;  5HDK A;  4L0Y B;  5DM7 F;  1EJ9 A;  3ZQQ A;  3HOV J;  4RLQ A;  3HOZ J;  2EPF A;  3QPH A;  3BT9 A;  4EJU A;  1FWZ A;  3RQ4 A;  4IHT A;  2FEZ A;  2DMN A;  3FM3 A;  3PJR A;  2K9M A;  1D3Y A;  3GME A;  1X4P A;  2KIM A;  1QZY A;  3ERE D;  1QZZ A;  2FU4 A;  3AFH A;  3C2H A;  2CJJ A;  4KDP A;  1VQM I;  2W57 A;  1DQU A;  2K9L A;  3V8J A;  2W25 A;  2GBY A;  2PN6 A;  3NAR A;  3SZT A;  4ANJ A;  3SEQ A;  2R5Y A;  3KLO A;  4HZF A;  1ZG5 A;  2EV5 A;  3S1N J;  3LSR A;  3CCM I;  5IYB J;  3DKX A;  3GBG A;  5KAI C;  2WY7 Q;  1ERD A;  2QKM B;  3FBN B;  5ED4 A;  1N25 A;  3D5L A;  1FT9 A;  2P5K A;  5EYR A;  5JVG F;  3M8F A;  3CMM A;  5IYC J;  2V4J C;  4MQV A;  4J00 A;  1VQP I;  2BEO A;  3RPQ A;  3GW2 A;  5LHI A;  3JRC A;  5IY5 H;  1XMX A;  5LHH A;  1BR4 A;  1FSE A;  1GHC A;  2QGU A;  3CME I;  4KIS A;  2X85 A;  2Z33 A;  2YUS A;  2A69 F;  5L3G A;  1CF7 B;  3KCC A;  3TMO A;  3AG2 H;  2VKE A;  1O3R A;  4AD9 A;  4AIH A;  4CZC A;  3L1P A;  3ECH A;  3BCB A;  2DOD A;  3DEE A;  5DYM A;  1G3W A;  1DGR M;  3G4S I;  1BI1 A;  2O0Y A;  2NXN B;  3HRS A;  4G6Q A;  1T98 A;  4CGZ A;  3I53 A;  2Y69 H;  4GYI A;  2VUM J;  5HOO A;  3ROU A;  2HVQ A;  3GZ6 A;  1Z6R A;  4F55 A;  1IXS B;  3DWL E;  3QAH A;  4BE2 A;  2R7T A;  1J75 A;  1LFP A;  2HZD A;  1ZH5 A;  2LNB A;  4IX7 A;  3EYI A;  3H5N A;  2YS9 A;  2XB0 X;  3KP2 A;  5E8G A;  2V7F A;  4D5F A;  4M9X A;  4LJZ F;  3HDD A;  4A93 J;  1O57 A;  1ZRE A;  4KT6 A;  4KJZ A;  2P7C B;  1MND A;  3KP7 A;  1HKQ A;  4V2F A;  1A04 A;  2VT3 A;  2MC4 A;  3CJT B;  4JX6 A;  1IRF A;  1R1U A;  2P6T A;  2QEX I;  3QYB A;  4HF1 A;  4EJT A;  3BR1 A;  4KIG A;  3VWB A;  1E17 A;  3OIQ A;  1STZ A;  3BP8 A;  1ZQ3 P;  3NRV A;  3I4M J;  4E70 A;  1PUE E;  4OMY A;  2RC4 A;  5DM6 F;  1FY7 A;  4ABZ A;  1R22 A;  3MEX A;  2HOT A;  2BXZ A;  1XMK A;  2ZCW A;  3DPT A;  4PGH A;  2AQE A;  2GXG A;  2PI0 A;  1G8X A;  3F8F A;  3EUK L;  1L0O C;  3CJR B;  3BRO A;  4XR6 A;  3E5Q A;  3TL4 X;  4DGW B;  3E5U A;  4DBR A;  2JA6 J;  4BQN A;  2V6E A;  5D8L B;  3ZMZ A;  2O03 A;  5F08 A;  2KT0 A;  4NUB A;  4CYD A;  1XX5 A;  2FF4 A;  3U2R A;  2A5W A;  4MTE A;  5BQT A;  4CYC B;  3SDB A;  4XQF A;  4A6E A;  5GTH C;  4IPA A;  1HBX G;  3LWF A;  5FKL A;  3K10 A;  1RC9 A;  4HRI A;  1JKQ C;  3K1N A;  1XD7 A;  2EZL A;  4NC7 A;  1Z0X A;  3SDG A;  4NQW B;  4G12 A;  2GXB A;  1QNT A;  3RPU A;  3AKZ A;  3F21 A;  2I5U A;  1EH6 A;  1NK3 P;  3R61 A;  5IOY A;  2V1D A;  2VQH A;  1P9Q C;  3O6B B;  2JQ7 A;  5DS9 A;  2XF6 A;  3O3K A;  2FUG 2;  1OPC A;  4UUS B;  3F8B A;  3CD6 I;  4F3Q A;  4BUP A;  2XSD C;  2H6C A;  3KEQ A;  2STT A;  4KYW A;  6PAX A;  4EM2 A;  4A3B J;  4M72 A;  2VBZ A;  3GZN B;  1QPM A;  4HQE A;  4G7O F;  2VKD A;  1UMQ A;  1TWG J;  4XLP F;  2JZY A;  2VJ4 A;  2DI3 A;  2V9P A;  3EQL F;  3QQA A;  1OCC H;  2FML A;  2EBI A;  3J7Z I;  1XB4 A;  5DTD A;  3BR0 A;  3LSK A;  3L2Q A;  2KDZ A;  4PDK A;  4PUS A;  4V2G A;  3KET A;  2RVC A;  4A3D J;  3MVP A;  2CUJ A;  4X6A J;  4QPO A;  1TW3 A;  5EGO B;  1YYV A;  3ABK H;  4ESB A;  3L2U A;  2FD5 A;  1LVA A;  2VL8 A;  5CQG A;  4A0Y A;  4B8X A;  1QU3 A;  4CIC A;  2R7D A;  1BL0 A;  4O6J A;  5D5U B;  4OAZ A;  3WE3 A;  1BJZ A;  2R7X A;  1DP3 A;  2O8X A;  3RKY A;  2QQA A;  4UUS A;  1B72 A;  5FLV A;  3QU3 A;  2M45 A;  3GEZ A;  1BC7 C;  2E1C A;  2QQ8 A;  3NAU A;  4BJ6 C;  1BBY A;  3IHU A;  2M3A A;  3CCS I;  3BJA A;  1FBU A;  4BH9 A;  4G7Z F;  1EV7 A;  3OYG A;  4IO9 F;  4ZDO A;  3GTL J;  4I2O A;  2MG4 A;  3BR2 A;  4LLN A;  3JW4 A;  4A3L J;  4L5E A;  4LFU A;  4EQQ A;  2BW3 B;  5E1W A;  2GOM A;  3U9G A;  2AS5 F;  3GX4 X;  5AIP A;  4QLC U;  3W3C A;  3OWT A;  3V7S A;  2LK2 A;  4M9S A;  1I5Z A;  4LB5 A;  3WTT C;  4OIR F;  4KIC A;  4OU0 A;  4G7H F;  3FXU A;  2VXD A;  4Y15 A;  3REO A;  4MFD A;  3CCY A;  4RB1 A;  3FK7 A;  2WTE A;  5IYD J;  3TBI A;  3W6K B;  2R92 J;  1MNE A;  4PFO A;  2M1B A;  3ZQ7 A;  2QZ8 A;  3CLQ A;  3GF2 A;  4ETS A;  5LGN A;  1YTY A;  2Y48 A;  2ZBK A;  1O7L A;  4IXA A;  1HXD A;  4M3B A;  2LG4 A;  3CLO A;  4R1H A;  3G71 I;  5L3B A;  1S7A A;  5B66 C;  3H36 A;  2KIU A;  3I59 A;  3JTH A;  2DO7 A;  4RMN A;  2XF5 A;  3C18 A;  2ADU A;  4XRS G;  2CUE A;  1P4A A;  3NWS A;  4HAM A;  1YX5 A;  3N4M A;  5ICC A;  1X1P A;  2N8G A;  5LEJ A;  2VXZ A;  2FQ3 A;  3CF2 A;  1KGS A;  2OCC H;  3PIO F;  3U1D A;  1I39 A;  3KX2 A;  4CHU A;  1VQ4 I;  1YI2 I;  1TT0 A;  3WHC A;  4Y33 A;  2VC0 A;  1LDK B;  2YR2 A;  1KU7 A;  4AYB A;  1LJ9 A;  1IF1 A;  2ETH A;  1MBH A;  3FXO A;  1Z3Y A;  1FLI A;  2COB A;  4B4C A;  4OAY A;  2KQR A;  3V42 A;  1SMT A;  2A61 A;  2G7U A;  5E79 C;  4Z6Y A;  2A5Y B;  3SEZ A;  1BC8 C;  4BXU A;  2ESH A;  1R58 A;  2L9R A;  3L9F A;  4OIO F;  1A35 A;  1TTY A;  1X1D A;  1SFX A;  2MH9 A;  3T5X A;  3M3Y J;  3E6B A;  1OCZ H;  3I4P A;  2UXN A;  2DOE A;  3BY6 A;  1HCR A;  1UFM A;  1VFC A;  4LG3 A;  1IN5 A;  2HPI A;  1OCO H;  4AID A;  1IC8 A;  2IGM A;  3FXM A;  1KA8 A;  3BG7 A;  3D0S A;  2D2W A;  2JMW A;  3IAM 2;  3FDY A;  4QTR A;  4N0B A;  1OYW A;  2BY0 A;  4EMS A;  2HU9 A;  4AYB N;  5JI6 A;  1TQM A;  4UV8 A;  1LE8 A;  3LSI A;  3S15 J;  2ZXI A;  3OYK A;  2MBF A;  2E7X A;  1T08 B;  3A0H C;  1ZYR F;  1TNT A;  2V6C A;  2HKX A;  1ETV A;  5K7Z A;  1ZAO A;  3ABM H;  2XPV A;  5J1Y A;  3AG4 H;  4IL6 C;  3E6D A;  1R9T J;  1K79 A;  3BLY A;  2H27 A;  2CFO A;  3SFZ A;  2EIL H;  4IRI A;  1NTC A;  2ISZ A;  1V55 H;  3BZ6 A;  3HOT A;  1ETK A;  2EB7 A;  1IJW C;  1E3O C;  2I10 A;  3A0B C;  2JRM A;  2EZH A;  2PEX A;  1MW7 A;  2FBK A;  3OR2 C;  3RZO J;  4IHX A;  1DU6 A;  3SQN A;  1LNW A;  3H1C A;  5DCM A;  3BQZ A;  1YJN I;  3M8E A;  4XKV A;  5FRO A;  2Y31 A;  1FOK A;  1XTA A;  3HTS B;  2EQR A;  1HW5 A;  4XOR A;  1MJA A;  2H6B A;  3CO7 C;  2DT7 B;  2RQQ A;  4BBR J;  3JRI A;  1Y1W J;  3P9K A;  4BYY A;  4MNU A;  3H3Z A;  1LEB A;  3M9A A;  2VJJ A;  1NK2 P;  2CV2 A;  4GGG A;  1FPQ A;  5FLX Z;  1CQT A;  4AU7 A;  2DMQ A;  1BW6 A;  4LLL A;  3GYH X;  4YRV A;  2VON A;  1WHU A;  2XKP A;  3DCF A;  1YIT I;  4FX4 A;  4UB8 C;  1ZRC A;  2V1N A;  3IKV A;  2GWR A;  4B44 A;  1UJ8 A;  3CCR I;  1P7I A;  2FOW A;  3ZXS A;  5KVR A;  1R5H A;  1T6S A;  3CCV I;  2QA4 I;  3L2V A;  2X1E A;  2E2H J;  1ETQ A;  3I4N J;  4IQ4 A;  2M0C A;  3QWL A;  3J7A O;  4L18 B;  1V5G A;  2XHK A;  5GAD J;  4YIF A;  4Y3O A;  4A3J J;  2DJN A;  1MMA A;  4M3G A;  1ENH A;  1E0E A;  1D0Z A;  2BE5 F;  3DKY A;  2DCE A;  4A12 A;  4HNT A;  2XGC A;  2K86 A;  1B6A A;  2RAE A;  1AOY A;  4D9J A;  2HDD A;  1EH8 A;  4CO8 A;  3OS1 A;  5CQE A;  3U1K A;  3OV8 A;  2PQ8 A;  5EJC A;  2OQR A;  2G9W A;  1MMD A;  1J59 A;  1IUF A;  1D8K A;  2LDU A;  4L9V A;  1IUY A;  3HJE A;  2G7H A;  2ZME A;  1MBE A;  1MIJ A;  1A6Q A;  2VIX A;  4II2 A;  2R7U A;  2W4S A;  5J4Y A;  4BQA A;  3FXK A;  1WPK A;  3QPL A;  3V4G A;  3BCA A;  2M8G X;  5FRN A;  3EUH A;  4UXN A;  3ZQL A;  1SD6 A;  4JP0 A;  2L01 A;  2ZKZ A;  1YHQ I;  4YIR X;  4IOC F;  1O3Q A;  1K4T A;  2OUM A;  4D5C A;  2CQK A;  5FLX K;  1SFO J;  2OU2 A;  2ZXW H;  4LIV A;  4BJT A;  4GXO A;  4YII A;  2P6S A;  1UHM A;  2YU3 A;  1R5G A;  2ZME C;  3Q9V A;  3J81 Z;  3F72 A;  2D5V A;  2LFB A;  1X1C A;  1RKW A;  1BI3 A;  1HKT A;  3T1B A;  3JRE A;  3FHZ A;  3MZH A;  1BA5 A;  1D1A A;  2LBF B;  3A01 A;  3EUH C;  1VND A;  3PSF A;  1RUO A;  1Y0U A;  1X3Z B;  3HZJ A;  3DBR B;  4S04 A;  4BE1 A;  4L0Z B;  2ELK A;  4XRS A;  3HRU A;  2GA2 A;  3HXL A;  4RAG A;  2XC7 A;  4P9F A;  1X2M A;  2L54 A;  1M1E B;  4M6X A;  2YU9 J;  2VBY A;  1FOY A;  3RDI A;  2HNH A;  1MNM C;  3TOB A;  3I0T A;  4WXD A;  3JRF A;  2A05 A;  3UNG C;  2MAB A;  4U0W A;  5HLT A;  2EFP A;  5C4J J;  4JQF A;  3ZCO A;  2A68 F;  2JPC A;  2ID3 A;  1X58 A;  3CZ6 A;  3HSE A;  2CGP A;  3JRD A;  2JWT A;  1DP7 P;  3ZQH A;  4F93 B;  1ZK8 A;  2DOA A;  3BTJ A;  1ZG3 A;  1GT0 C;  1NG6 A;  4E4H A;  3WTX C;  2PMU A;  4DIQ A;  5J40 A;  3KE2 A;  2E34 A;  4D7M A;  1YO5 C;  1GXP A;  2DA3 A;  1VQK I;  2IA1 A;  1RR7 A;  4S0H B;  3MZY A;  2DLL A;  4UY8 I;  4OIP F;  5LGT A;  2KP6 A;  3J81 K;  5J8F A;  3OYJ A;  4ESJ A;  1GDT A;  2MH2 A;  3LQR A;  3LAP A;  1W36 D;  2R3S A;  3S16 J;  1FP2 A;  5B3S H;  2EK5 A;  2MGQ A;  3DTE A;  5E17 F;  2Y30 A;  3K4C A;  1K7A A;  4UVC A;  1ETY A;  3VSK A;  4FX0 A;  2G0E A;  2V9K A;  3RYP A;  3TW6 A;  5CJ9 A;  2NNN A;  1FEX A;  3R0J A;  3KP5 A;  2LLK A;  1UEL B;  4ZZD A;  1D1B A;  3MKY B;  3TO6 A;  1WWX A;  4ENJ A;  1OKR A;  3K4L A;  5IT3 A;  4BHC A;  2HYJ A;  3BZK A;  3WG7 H;  4PJL A;  1VQ9 I;  3CCU I;  1VQN I;  1IRX A;  1YE9 A;  3H35 A;  1QQI A;  4HYE A;  2D1V A;  2OD5 A;  4JX4 A;  5H6R A;  4XIC A;  1NHA A;  4BGD A;  2DFE A;  1KU3 A;  4NNJ A;  2LRD A;  1U6G A;  2HQ5 A;  1ZLK A;  5F0H A;  1ZGJ A;  1QHH D;  4HV5 A;  1IN4 A;  2P81 A;  2W00 A;  3R0A A;  4E7L A;  1E3P A;  4UUV A;  2R7Z J;  3LAJ A;  4RS8 A;  3OYI A;  1MSE C;  4UHT A;  2LTP A;  5FJ8 J;  2XSJ C;  1OLT A;  2H94 A;  1JGG A;  2VOO A;  1D8J A;  3EYY A;  4KIT B;  2ZB9 A;  1W7P A;  4LGW A;  2Z9O A;  2WA0 A;  1V4R A;  5BS6 A;  1PVE A;  3EPZ A;  4MO7 A;  1B59 A;  1SFK A;  2FJ1 A;  4U0V A;  4ZDL A;  5J1R A;  1FMV A;  1U5T C;  4FE4 A;  1S9H A;  4CA0 A;  3IKT A;  5D4S A;  4C3I J;  3UKG A;  1DU0 A;  3HHG A;  1P4W A;  2F6C A;  4RAZ A;  5K1Y A;  2F2E A;  1S6L A;  2R5Y B;  4Q48 A;  2JA8 J;  1ONV A;  2JN6 A;  2QQB A;  5F0F A;  3S3N A;  4ESF A;  3PM1 A;  2V79 A;  2L7M P;  3KP3 A;  1P92 A;  1QRY A;  3PUF A;  2O3F A;  3E6C C;  3A03 A;  3A2K A;  1WJB A;  2UUZ A;  2GIV A;  3HSR A;  1I3A A;  2GZW A;  5F04 A;  4B3X A;  2MD5 A;  4I6Z A;  2CV1 A;  1NG7 A;  2E19 A;  4QIW N;  2LC2 A;  2V26 A;  1E2X A;  4RAF A;  5IOZ A;  3IP4 B;  3P9I A;  3E6M A;  4JYK A;  2FSW A;  3DFG A;  4BDZ A;  5HS9 A;  3PO2 J;  3RQI A;  2P4W A;  4S05 A;  1H0M A;  4Z2Y A;  4A6D A;  3LSJ A;  3HRM A;  3K4J A;  2LF8 A;  2WAF A;  4P1W A;  2DFH A;  2Y9Y A;  3AL0 C;  1RNL A;  2ZO4 A;  3FMQ A;  3CCJ I;  1DPU A;  1VZ0 A;  2L9S A;  2LKX A;  1YRN B;  2IW5 A;  3CDL A;  1T8I A;  2HEO A;  5M5X J;  4FIS A;  1LDJ A;  4MEY F;  5DEQ A;  1R4N B;  2FNA A;  5D5V B;  4A69 C;  1NH3 A;  1XPX A;  1T0F C;  3I58 A;  4IRG A;  4UVA A;  4U7B A;  3HSF A;  2X6O A;  2UXX A;  2AQF A;  4QPQ A;  2O7O A;  3HPH A;  1F36 A;  1JUP A;  2DA4 A;  2M0M A;  1RKT A;  3DU5 A;  3ECO A;  3O2P E;  1WJE A;  2WV0 A;  3I3L A;  4B1R A;  4DBQ A;  5KHD A;  1XSD A;  5HS7 A;  1Z21 A;  3I54 A;  2E71 A;  2NVY J;  3E5X A;  3Q0U A;  3BC8 A;  3S17 J;  3HRT A;  1XGO A;  2A6T A;  2X6W A;  2JRT A;  2UZK A;  4TV7 A;  3I55 I;  1IV6 A;  3IAS 2;  1IN6 A;  4OOI A;  5A2Q Z;  5HDN A;  5GP9 A;  3TGN A;  1UST A;  4OIN F;  4CCN A;  5L3D A;  2VBX A;  2STW A;  2H8W A;  3BG6 A;  2GOX B;  3CCE I;  1YRN A;  2K9S A;  4RAY A;  4KMF A;  1Y39 A;  4A3F J;  3FXR A;  4FTH A;  3KZI C;  3LSP A;  4HLY A;  3E7L A;  4Y52 J;  3J80 Z;  3Q9S A;  3CCL I;  1SD5 A;  5CVU A;  1G3Y A;  1IDY A;  5LHG A;  5BMZ A;  1OR7 A;  1TP4 A;  2EZI A;  1L3L A;  4RGX A;  3U21 A;  3ZRG A;  3TP0 A;  4L9J A;  5FD6 A;  5HS8 A;  3OS0 A;  4MEX F;  2JVG A;  1D0X A;  1U78 A;  5JLW A;  4MGR A;  2F5E A;  2VT2 A;  1YX3 A;  2F48 A;  2Q8K A;  2GIZ A;  4MLO A;  5EEH A;  2VKV A;  2RKH A;  2MLG A;  1OR7 C;  2DDA A;  3Q5F A;  5D6F A;  4KN7 X;  2R7V A;  4E7S A;  1BM9 A;  4LMY A;  3QPT A;  4A3K J;  1H89 C;  3GTO J;  1JTY A;  4AUX A;  4DJA A;  4RM2 A;  5J6X A;  3SJM A;  2F4M B;  1ZKG A;  3F6V A;  3TDZ C;  1QHG A;  3TP3 A;  3LST A;  1SVO A;  3S2D J;  3S2H J;  2CFX A;  4KN4 X;  4XM3 A;  4LK0 F;  4BHB A;  1ZR2 A;  4N9I A;  3J80 K;  4XLN F;  2LRE A;  4C3H J;  2XVC A;  4E7I A;  2CWE A;  3QP5 A;  5GAE J;  2DOF A;  2QLZ A;  3WOD F;  3UR3 C;  2WWY A;  2KIS A;  4PK4 A;  2HYG D;  1RR8 C;  1VF9 A;  3OYA A;  3SHF A;  5FKM A;  3J7A Y;  2NVQ J;  3WGG A;  2Z3Y A;  3ZPL A;  3H3V K;  2CO5 A;  2X0L A;  1X1A A;  4F92 B;  5HLH A;  4ZDP A;  3SZP A;  2NS8 A;  5CVR A;  2KRH A;  1HDP A;  1SVL A;  5LFA A;  3H0G J;  3RYR A;  4FAS D;  2NYX A;  5DV5 A;  5CVI A;  3FF5 A;  3QYE A;  2P8T A;  3DLL F;  2XAU A;  1VI0 A;  4U0Y A;  2DFF A;  4EGZ A;  4F7Z A;  2IEK A;  1FTZ A;  4AWX B;  3IL2 A;  1K6Y A;  2ME0 A;  2OZ6 A;  2XIG A;  4RGU A;  5TIS C;  5KK1 A;  2ZSI B;  1HC8 A;  4FT8 A;  4NBQ A;  1IN8 A;  2HZT A;  2XAJ A;  3OSF A;  4B3A A;  1B72 B;  2PMH A;  4AVP A;  1P2F A;  3A02 A;  2OPT A;  1YJW I;  4ENM A;  2BHY A;  3PQK A;  3BTL A;  2Q0O A;  4NC6 A;  1Z9C A;  2DA2 A;  1GLN A;  3K69 A;  3VYT B;  4D0P A;  2E60 A;  1QZE A;  1PYV A;  5J3L A;  3C7J A;  2KMU A;  2JA2 A;  1MDM A;  5F1J A;  4HPQ A;  3BR5 A;  3CES A;  4C2T A;  2M2E A;  3ERM A;  1VQ8 I;  3BPX A;  1LFU P;  1P7J A;  4J01 A;  1D0Y A;  3FKI J;  1B9M A;  4XLE A;  4UNO A;  1U0J A;  2D45 A;  1IO2 A;  4LB6 B;  1I3Q J;  1OFC X;  2O5R A;  1FIA A;  2R4G A;  4A3C J;  4KT5 C;  1W36 C;  2RV8 A;  1A31 A;  1TWH J;  1V3F A;  1JGS A;  3BPV A;  3BOQ A;  4M3F A;  4I0A A;  3BG5 A;  2D1H A;  4N4O B;  1RIO H;  3OL4 A;  1YW7 A;  4BE0 A;  3CDH A;  1RUN A;  2DT6 A;  3FMR A;  4B48 A;  1I1S A;  2LD5 A;  1FYL A;  2R7S A;  1GV5 A;  4WF2 A;  1Q1V A;  4HF0 A;  5E3L A;  3OYF A;  5IP6 A;  4LIT A;  5F27 A;  2KJC A;  4JX5 A;  2DA1 A;  2Q2E B;  5C3E J;  1O3T A;  1AU7 A;  3S3M A;  1VQ5 I;  3P5J A;  4AC0 A;  1USS A;  3DBL B;  3MD2 A;  3I59 B;  2VJ5 A;  3KYD B;  2WAQ A;  4LIU A;  3MKW B;  4A3G J;  1OIS A;  4HSR A;  1SEU A;  5ILS A;  5JHF A;  5J8C A;  4CCM A;  2LH9 A;  2XF7 A;  1D5V A;  1WKM A;  3S14 J;  2FXA A;  5EDN A;  2OC6 A;  3PO3 J;  1J0R A;  2QWW A;  1HF0 A;  3JR9 A;  1JE8 A;  2X51 A;  1D5Y A;  1J5Y A;  1KYZ A;  2XAQ A;  3GLX A;  3WG9 A;  3OYC A;  5M5W J;  1AKH A;  1T56 A;  1ON2 A;  2HWV A;  3SFI A;  4I99 C;  3WGI A;  2ME6 A;  1W5C C;  3BG3 A;  1ZTR A;  2R7W A;  3ZGK A;  4A3E J;  5BPD A;  2Y75 A;  3VOE A;  2OAZ A;  3RKX A;  3HC7 A;  2W1O A;  2Q2E A;  2DMP A;  3JCU C;  4ON0 A;  4EJW A;  2DN0 A;  2DK8 A;  4F91 B;  1TZL A;  2WAQ N;  2YPR A;  1G2H A;  2KL4 A;  1SAU A;  3OIO A;  1ZN2 A;  2L7F P;  2FMY A;  2PLY A;  4KFC A;  1JUS A;  1YIO A;  2DA7 A;  3AG3 H;  4XN0 A;  4IHV A;  3R4K A;  3SXY A;  1JJ8 C;  1FOX A;  2EH3 A;  3H9J A;  4CCO A;  2XUB A;  1HKS A;  1WCM J;  1Z77 A;  2DPD A;  3VSL A;  3Q0V A;  4GYG A;  4RB0 A;  4BNC A;  3DLA A;  2IS2 A;  1LE8 B;  5B1A H;  5LEK A;  2LR8 A;  3IH2 A;  1H8A C;  5CVJ A;  3EET A;  2W48 A;  1MH4 A;  3A1Y A;  2WY8 Q;  1W5S A;  1FYM A;  4RA2 A;  4PZJ A;  2V1U A;  1TBX A;  2E5Z A;  1XSV A;  2IA0 A;  2VQC A;  1OQY A;  1U9N A;  1WFX A;  3PUB A;  4PJJ A;  1F1Z A;  3GTP J;  2PBI A;  4MTD A;  1WJA A;  1VQL I;  3I71 A;  1JT6 A;  3WGH A;  4KA4 A;  2FA5 A;  4XBF A;  1O3S A;  1B4A A;  1MBK A;  2Q1Z B;  1RES A;  3RI4 A;  3E97 A;  4A0Z A;  1X19 A;  3CCQ I;  2Z99 A;  5DCM B;  2M5W A;  5HLI A;  4MQ9 F;  3ULQ B;  4WCG A;  4N9H A;  2HI3 A;  2KZG A;  4O3M A;  4XLA A;  2ZXH A;  1HST A;  4IHY A;  4I76 A;  1HLV A;  3MN2 A;  2P5V A;  4YFN F;  2EZK A;  4W97 A;  4XOP A;  4EGY A;  2KHM A;  2GLO A;  1SFE A;  3K70 D;  1YJ9 I;  3HOY J;  1OYI A;  3K4M A;  1JKO C;  2IGK A;  1HQC A;  2XAG A;  2X6Y A;  2F4I A;  3WE2 A;  1W5T A;  2L9N A;  5EG0 B;  5GPC A;  4U7D A;  2FNP A;  2J5P A;  1N75 A;  4QWQ A;  1PUF A;  4GO1 A;  1LKX A;  2DU9 A;  3WTU C;  3PQJ A;  2HOA A;  4BY1 J;  3HEF A;  2LKS A;  5JLX A;  3FZV A;  4WXC A;  3V7C A;  4R79 A;  3K1M A;  2K4B A;  2ZFW A;  1TWF J;  3DV8 A;  1X4O A;  2F4O B;  4EM0 B;  2B9S A;  1R4M B;  3NEU A;  5BNG A;  2DXI A;  2GA1 A;  1R36 A;  2KIQ A;  2X1C A;  3ZN0 A;  1PJR A;  4BDY A;  5EZH A;  3K9T A;  3T8T A;  2VE9 A;  2I8D A;  2KJB A;  4YFK F;  2A6H F;  1X1B A;  2ZME B;  2XAF A;  2XV4 S;  4XSX F;  1ZG1 A;  1T38 A;  5B5E C;  3OYD A;  1T33 A;  3JTG A;  1YIJ I;  1Q1H A;  3HPG A;  3FX3 A;  5D4R A;  2DQL A;  2BY3 A;  3CQZ J;  3FKJ A;  2VAS A;  2ZSH B;  2WV1 A;  3PFI A;  4RB2 C;  1UB9 A;  4ZTF A;  2L02 A;  2V9V A;  2OZU A;  4UUT A;  3LSG A;  3MQ0 A;  4R8H A;  1IRZ A;  3H0D A;  5EG0 A;  3FXJ A;  3CTA A;  2A3S A;  1TQI A;  2DQR A;  1I27 A;  2QVO A;  1Z05 A;  4LOC A;  4EVI A;  2H1K A;  4HF2 A;  3CC2 I;  2L7K A;  4RLF A;  2ZFU A;  3HM5 A;  3K6G A;  4GCV A;  4XK4 A;  2NVT J;  4ENN A;  5IT9 Z;  2E36 A;  3ISP A;  5CYV A;  3CP2 A;  3A01 B;  4DZJ A;  1UG0 A;  1G4D A;  1S7O A;  2OQG A;  5CVV A;  1WVR A;  1XGS A;  5M3F J;  3Q0W A;  1LDD A;  4UVB A;  3K4B A;  2EJR A;  4V19 K;  5LD2 C;  2EWN A;  1WJF A;  5E1X A;  4ZZL A;  4YEJ A;  3KPH A;  1Y6I A;  2X48 A;  1EKE A;  1WI3 A;  1T2K A;  3G6E I;  2VQL A;  3G1O A;  1FJL A;  4CCK A;  2O61 A;  4MFE A;  2HFH A;  5B1B H;  2X1D A;  1D1C A;  5LBQ A;  3WU2 C;  2K4J A;  4KIB A;  5HNF A;  4IQJ A;  4XNF A;  3QOE A;  2YX4 A;  2LMD A;  1JJ6 C;  3OYN A;  5H6Q A;  2HXO A;  4C2M J;  1JHH A;  1I1G A;  1X2N A;  3WHB A;  2FQ4 A;  3ABL H;  5E18 F;  1A36 A;  3S32 A;  2IGN A;  1KYW A;  3TO9 A;  2OTL I;  2VPR A;  4P9U A;  5E1Z B;  2E2J J;  5IT9 K;  1IV8 A;  4IEJ A;  5EZG A;  1ETO A;  2DDB A;  2E1M C;  1JKP C;  2B63 J;  3JRB A;  2MLK A;  1IXR C;  1SC7 A;  4HQM A;  1YLF A;  4LG0 A;  1QA6 A;  2XDV A;  4HW0 A;  2R0Q C;  3FXL A;  1YG2 A;  4Y4R A;  2L9V A;  2Z16 A;  4KNY A;  3I9V 2;  1MH3 A;  4XLH A;  2JJ7 A;  2HDW A;  1WRJ A;  1P6R A;  3S2W A;  5AIQ A;  2NVX J;  4IOA F;  3GTM J;  5DDG A;  2Z1D A;  4G6T B;  4UB6 C;  1ZGW A;  1YFH A;  1S72 I;  1GVD A;  2LF7 A;  2XGE A;  5FKO A;  4FCY A;  1EH7 A;  2RRE A;  2FE3 A;  2DAO A;  1AWC A;  1U5T B;  1IRG A;  1LFB A;  1W1W E;  3OYE A;  3WU1 B;  3TED A;  5CKT A;  2EIJ H;  2C6Y A;  4A5M A;  5LLQ A;  5E3M A;  5L3F A;  3CUQ A;  1GVJ A;  5F0C A;  4BKX A;  4WWC A;  3H5R A;  2CQN A;  3L7W A;  4IRH A;  1R1V A;  5J47 A;  5JR3 A;  1G6N A;  1DPR A;  5H2F C;  2JUG A;  1ZLJ A;  4NB5 A;  1SFU A;  4I02 A;  1W7P B;  3GLL A;  3ZOB A;  3WTW C;  1R49 A;  2ZJR F;  3DTI A;  3KYL A;  1TW2 A;  3RJP A;  3GFL A;  1FTT A;  2M8E A;  3RPU D;  3SYT A;  5D6E A;  2VOD A;  1Y8Q B;  3LA3 A;  4EAT A;  2X4H A;  3KYC B;  1O4X A;  5E3O A;  5ICF A;  3ASN H;  3RZD J;  1PP8 F;  2PMZ A;  4RM3 A;  1Y56 A;  1PP7 U;  2LY1 A;  3H5A A;  4I01 A;  4RBO A;  2HR3 A;  3CUQ C;  4IHS A;  3ABT A;  4O5V A;  4DYQ A;  2HOE A;  2AO9 A;  3GFM A;  4Q47 A;  4BJ5 C;  5IP9 J;  2EIN H;  2K7L A;  3AL0 B;  1J2X A;  2IA2 A;  1Z91 A;  2ECC A;  4B47 A;  2RDP A;  3W2W A;  3MWM A;  1OCT C;  1R00 A;  3DP7 A;  1T39 A;  4BAC A;  3ZQF A;  1U5T A;  5HVQ C;  1MZB A;  3ZQC A;  1IN7 A;  3B02 A;  5JFR A;  1B1B A;  2DK5 A;  3VB2 A;  2W24 A;  2Y2Z A;  3LFU A;  2NS0 A;  4IVN A;  4ITV A;  4AM3 A;  2CYY A;  2DA6 A;  3GO5 A;  1IZ1 A;  3KFW X;  2EFW A;  2VB6 A;  2WB1 A;  4BXF A;  1ACI A;  2O9L A;  2QBY B;  2DW4 A;  2OTJ I;  1DGW Y;  2PMZ N;  3B6C A;  4Y17 A;  4E7K A;  3MCZ A;  2EA4 A;  1BN5 A;  4EEF G;  2H1L A;  3EUA A;  3K4N A;  2PJR A;  1Z67 A;  2MYS A;  3M1C A;  9ANT A;  5M3M J;  3HB9 A;  3QPS A;  1T95 A;  5AON A;  5ILU A;  4BQQ A;  2XPU A;  1MBG A;  1LQ1 A;  2K27 A;  2CQQ A;  2QSH X;  4XKB A;  2BVM A;  3TDU C;  4A0X A;  1OCR H;  2R7F A;  2WC2 A;  5F64 A;  1FSH A;  3ABU A;  2IBD A;  4BAY A;  1T0F A;  3OOP A;  3R60 A;  4OMZ A;  1W0T A;  4ZJZ A;  2M9H A;  4GFB A; 
#chains in the Genus database with same CATH homology
 2NS8 A;  2WB1 N;  1HDP A;  3WHC A;  1JKR C;  2AHQ A;  3H0G J;  2CU7 A;  1MBJ A;  3IV5 A;  1K83 J;  1MBH A;  1VI0 A;  2IEK A;  1FTZ A;  1GV2 A;  2E1O A;  1MSF C;  2ME0 A;  1WGX A;  2COB A;  4B4C A;  3OSF A;  4B3A A;  1B72 B;  3A02 A;  2OPT A;  2R5Z A;  3OOU A;  2L9R A;  3BTL A;  2DA2 A;  2K40 A;  4DW6 A;  4X1E A;  5J3L A;  1F43 A;  4IHW A;  5F1J A;  3M3Y J;  2DTZ A;  1MBF A;  3BR5 A;  1HCR A;  1VFC A;  2M2E A;  1LFU P;  1IC8 A;  1P7J A;  5EF6 A;  3FKI J;  2JMW A;  4QTR A;  1APL C;  1I3Q J;  1OFC X;  5M5Y J;  1FIA A;  4AYB N;  3BTI A;  3CMY A;  4A3C J;  1LE8 A;  1TWH J;  3S15 J;  1HOM A;  1RET A;  1TWA J;  1WH7 A;  4M3F A;  3JRH A;  1JTX A;  4XID A;  3BG5 A;  1ETV A;  2NOG A;  2CRG A;  5K7Z A;  2QCO A;  2XPV A;  5J1Y A;  4MIM A;  2LD5 A;  2H8R A;  1R9T J;  1GV5 A;  1UHS A;  1ETW A;  3S1R J;  1Q1V A;  3BR6 A;  5E3L A;  5GPA A;  1NTC A;  5IP6 A;  5F27 A;  2ID6 A;  1IJW C;  1ETK A;  1E3O C;  4JX5 A;  5C3E J;  2DA1 A;  2I10 A;  2MSY A;  1DU6 A;  2EZH A;  1AU7 A;  2VI6 A;  3RZO J;  4IHX A;  1QPI A;  2HXI A;  3LNQ A;  3BQZ A;  2Y31 A;  4AC0 A;  2EQR A;  1ORK A;  1Y1W J;  4BBR J;  3JRI A;  1EF4 A;  3BTC A;  1WH5 A;  4A3G J;  1NK2 P;  5K7H A;  1GUU A;  3OSG A;  4RDU A;  1CQT A;  2DMQ A;  1BW6 A;  3HOU J;  4D7N A;  1FIP A;  1RPW A;  3DCF A;  4DZP A;  1TWC J;  3S14 J;  1S7E A;  5EDN A;  5FKN A;  2TRT A;  1AHD P;  1P7I A;  3PO3 J;  2E2I J;  3F0C A;  3JR9 A;  1HF0 A;  2DA5 A;  2XPW A;  1D5Y A;  1QVU A;  2E2H J;  1ETQ A;  5M5W J;  3O8G A;  1AKH A;  1U8B A;  1T56 A;  2M0C A;  3I4N J;  3ZQI A;  1A5J A;  3SFI A;  3BQY A;  4A3J J;  2DJN A;  2DMU A;  3FK6 A;  4M3G A;  1ENH A;  4A3I J;  3S1Q J;  2ME6 A;  4W1U A;  3BG3 A;  1ZTR A;  4A3E J;  5EEA A;  4QSH A;  2XGC A;  2R5Z B;  2RAE A;  2DMP A;  4NDL A;  4BY7 J;  2HDD A;  2DN0 A;  2WAQ N;  1G2H A;  2LVS A;  1IUF A;  3OIO A;  1A6I A;  1POG A;  2L7F P;  1TC3 C;  1MBE A;  1JUS A;  1U9O A;  2DA7 A;  4IHV A;  1BW5 A;  1JJ8 C;  2TCT A;  3VPR A;  2EH3 A;  1WPK A;  1XG1 A;  3QPL A;  3G1M A;  2M8G X;  3ZQL A;  2IAI A;  2XRL A;  1QVT A;  3RKQ A;  1WCM J;  4JP0 A;  1Z77 A;  3C2B A;  1HDD C;  3K7A J;  3Q0V A;  2CQX A;  4BXX J;  4D5C A;  1LE8 B;  1IG7 A;  1SFO J;  2LR8 A;  3IH2 A;  1H8A C;  4J19 A;  3D1N I;  2W48 A;  1MH4 A;  1XS9 A;  3IH4 A;  2D5V A;  2LFB A;  1I6H J;  1RKW A;  1U9N A;  3JRE A;  1BA5 A;  2JA7 J;  3GTP J;  3A01 A;  3W6V A;  1VND A;  5FLM J;  3IH3 A;  1JT6 A;  1UG2 A;  1MBK A;  1RES A;  2ELK A;  4XRS A;  1IGN A;  3HOV J;  4DYR A;  5K7F A;  1XC5 A;  3HOZ J;  3BT9 A;  1X2M A;  2YU9 J;  2HI3 A;  2DMN A;  4IHY A;  1IDZ A;  1MNM C;  3JRF A;  4I76 A;  3JRG A;  1HLV A;  3MN2 A;  2EZK A;  4W97 A;  2GLO A;  2CJJ A;  5C4J J;  3HOY J;  1JKO C;  3MKL A;  2GBY A;  2ID3 A;  1X58 A;  3NAR A;  2R5Y A;  3JRD A;  2JWT A;  3ZQH A;  3S1N J;  3LSR A;  1ZK8 A;  5IYB J;  5GPC A;  5EG0 B;  3GBG A;  3BTJ A;  1PUF A;  1GT0 C;  3S1M J;  1I50 J;  4D7M A;  2HOA A;  2DA3 A;  4BY1 J;  3HEF A;  1RR7 A;  4S0H B;  1AKH B;  5JLX A;  1ZR4 A;  1JUM A;  3GTG J;  5EYR A;  1TWF J;  5E3N A;  2FX0 A;  5IYC J;  3GTQ J;  4M3D A;  3G1L A;  1GDT A;  5BNG A;  3JRC A;  4CYC A;  5EZH A;  3S16 J;  2MGQ A;  2Y9Z A;  4C3J J;  2Y30 A;  2YUS A;  5IP7 J;  2VKE A;  1ETY A;  5J1U A;  3L1P A;  2G0E A;  3TW6 A;  2K9N A;  1T33 A;  1FEX A;  2LLK A;  2R93 J;  3CQZ J;  2WV1 A;  2VUM J;  4UUT A;  3LSG A;  2JA5 J;  2HYJ A;  1SAN A;  1IRZ A;  3HBL A;  5EG0 A;  2DMT A;  4JX4 A;  4XIC A;  4LOC A;  2H1K A;  1ETX A;  3FIS A;  3HM5 A;  4FE7 A;  4XK4 A;  2NVT J;  3HOW J;  3DEW A;  2HQ5 A;  5F0H A;  2YS9 A;  2P81 A;  2XB0 X;  4A3M J;  4D5F A;  3A01 B;  4DZJ A;  2NS7 A;  3JRA A;  2R7Z J;  3HDD A;  4A93 J;  1MSE C;  2LTP A;  5FJ8 J;  2XB5 A;  1JGG A;  5EGO A;  4V2F A;  5M3F J;  1ITY A;  2ZB9 A;  4JX6 A;  2CUF A;  3Q0W A;  3LOC A;  4MO7 A;  3BR1 A;  2FJ1 A;  5J1R A;  2L0K A;  1ZQ3 P;  3HKZ N;  3I4M J;  4FE4 A;  2X48 A;  2HOS A;  1WI3 A;  4C3I J;  4ABZ A;  3UKG A;  1DU0 A;  4BBS J;  2HOT A;  3G1O A;  5HOD A;  1FJL A;  2R5Y B;  2JA8 J;  4MFE A;  2JN6 A;  2MW8 A;  5F0F A;  3PM1 A;  2L7M P;  3HGG A;  1QRY A;  1PUF B;  3A03 A;  1JJ6 C;  2OF7 A;  1B8I B;  2HXO A;  4M3E A;  4C2M J;  4DYC A;  2JA6 J;  4M6V A;  5F04 A;  3ZQG A;  4I6Z A;  1X2N A;  2E19 A;  2FQ4 A;  3WHB A;  4QIW N;  5F08 A;  2KT0 A;  2L7Z A;  5IOZ A;  4JYK A;  3B6A A;  3RQI A;  3PO2 J;  2VPR A;  4Y7N J;  2E2J J;  4CYC B;  3LSJ A;  4IEJ A;  5EZG A;  1Y1V J;  5FKL A;  1ETO A;  2Y9Y A;  1JKP C;  2B63 J;  3GTK J;  1JKQ C;  3JRB A;  2EZL A;  2LKX A;  1Z0X A;  3SDG A;  1YRN B;  4G12 A;  3CDL A;  2R0Q C;  5M5X J;  4FIS A;  1NK3 P;  1MH3 A;  2JJ7 A;  5IOY A;  1W0U A;  4A69 C;  1OJL A;  2NVX J;  5DS9 A;  4UUS B;  2XSD C;  3GTM J;  3BG9 A;  2X6O A;  5IPA A;  2O7O A;  4A3B J;  2GM4 A;  1ZGW A;  1F36 A;  1JUP A;  2DA4 A;  1RKT A;  4B1R A;  1GVD A;  2XGE A;  5FKO A;  5FKK A;  1UMQ A;  4FCY A;  1TWG J;  2NVY J;  3Q0U A;  1B8I A;  1K61 A;  1LFB A;  3K2A A;  2LY9 A;  3QQA A;  3TED A;  3S17 J;  2EBI A;  3FIW A;  5C44 J;  5DTD A;  2K9Q A;  3BR0 A;  5E3M A;  2KDZ A;  4V2G A;  5F0C A;  4BKX A;  1IV6 A;  4A3D J;  3MVP A;  2Y0S N;  4X6A J;  2QF7 A;  5GP9 A;  5EGO B;  2FD5 A;  3ZOB A;  3BR3 A;  3HOX J;  1YRN A;  2K9S A;  1FTT A;  1BL0 A;  4A3F J;  1H88 C;  2ECB A;  4FTH A;  3LSP A;  3E7L A;  1O4X A;  4Y52 J;  2M34 A;  5E3O A;  3RZD J;  1BJZ A;  4RBO A;  4UUS A;  1B72 A;  1IDY A;  5FLV A;  4DYQ A;  2AO9 A;  2EZI A;  1OCP A;  3NAU A;  5IP9 J;  3TP0 A;  2ECC A;  4HNV A;  3M4O J;  1OCT C;  1U78 A;  5JLW A;  1JT0 A;  3ZQF A;  3GTL J;  2MG4 A;  3BR2 A;  3ZQC A;  4A3L J;  2O8K A;  4L5E A;  4MLO A;  2JK3 A;  2VKV A;  2XGD A;  2Y2Z A;  2LP0 A;  2DA6 A;  2LK2 A;  3O8H A;  2O9L A;  4A3K J;  1H89 C;  3GTO J;  1JTY A;  4AUX A;  2PMZ N;  3B6C A;  4MFD A;  3CCY A;  3SJM A;  3FK7 A;  4EEF G;  5IYD J;  1ZKG A;  2R92 J;  3TW7 A;  5C4X J;  9ANT A;  3TP3 A;  3S2D J;  3S2H J;  5M3M J;  3HB9 A;  2X9D A;  3QPS A;  1ZR2 A;  4C3H J;  2XPU A;  1MBG A;  4M3B A;  3HGY A;  2CQQ A;  3Q3S A;  1VF9 A;  4XRS G;  2CUE A;  3GTJ J;  5FKM A;  2NVQ J;  2N8G A;  2IBD A;  4XRM A;  1W0T A;  3H3V K;  2M9H A;  4GFB A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...