3ZOBA

Solution structure of chicken engrailed 2 homeodomain
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
67
structure length
67
Chain Sequence
GPMASDKRPRTAFTAEQLQRLKAEFQTNRYLTEQRRQSLAQELGLNESQIKIWFQNKRAKIKKATQA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords HOMEOBOX PROTEIN ENGRAILED-2
publication title Investigation of Homeodomain Membrane Translocation Properties: Insights from the Structure Determination of Engrailed-2 Homeodomain in Aqueous and Membrane-Mimetic Environments.
pubmed doi rcsb
source organism Gallus gallus
molecule tags Dna binding protein
total genus 13
structure length 67
sequence length 67
ec nomenclature
pdb deposition date 2013-02-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00046 Homeodomain Homeodomain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.60 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Homeodomain-like 3zobA00
3SJMA 2LK2A 3O8GA 4D7NA 2QF7A 2ME0A 3LOCA 3TP3A 1A5JA 2QCOA 4MIMA 3BR2A 1OJLA 2L7MP 1MH4A 1IUFA 4I6ZA 5FKLA 3M4OJ 1ZTRA 5EEAA 1APLC 2FD5A 2NS8A 3IH3A 1OCPA 1X2NA 1AKHB 2E2IJ 2H8RA 3BR0A 3K7AJ 3MKLA 2LKXA 1ETKA 1X58A 1RR7A 1ETVA 1TWGJ 2IAIA 3QPLA 2DTZA 1QVTA 3TW7A 1FIAA 3UKGA 1B72B 2HDDA 4V2GA 5HODA 1HOMA 2NVQJ 4C2MJ 1VI0A 2E19A 1ZGWA 4X1EA 1GV5A 2K9NA 1WI3A 3VPRA 4XRMA 5E3NA 5EZHA 5IPAA 3BT9A 5E3MA 3BTLA 3G1MA 4QTRA 2E2JJ 4XK4A 4IHXA 1ETWA 2CQXA 2VUMJ 3BR3A 4D5CA 1UMQA 5F0CA 2MW8A 5C4JJ 1GDTA 2JA6J 9ANTA 1JT0A 1MNMC 1ZR4A 5E3OA 3GTJJ 2EZIA 3SDGA 5IYBJ 3GTLJ 1ETOA 2EQRA 3NARA 1AHDP 4A69C 2L9RA 5IP9J 1FTTA 3S14J 4FE7A 3BQZA 2K40A 1K61A 1NK2P 2VPRA 1P7JA 2ELKA 4RDUA 1UHSA 2K9SA 3Q0VA 3Q0UA 1H88C 5FKKA 3FKIJ 4MO7A 1F36A 4D5FA 2HOSA 4DYRA 2Y0SN 2COBA 1IC8A 1ENHA 4IHWA 1YRNB 3BR5A 4MLOA 4DYCA 2DN0A 2HXOA 5F08A 3S15J 5IYDJ 4XRSG 4XICA 1X2MA 1ZK8A 2DA1A 2XPUA 5GPCA 1FTZA 3BQYA 1MBEA 5EGOA 3DEWA 5K7HA 3HDDA 2EH3A 2Y2ZA 5IOYA 4Y7NJ 1HF0A 3HOVJ 4IHVA 1HLVA 5EDNA 1JT6A 4A3GJ 3PO3J 4A3FJ 3RZDJ 2DA7A 3TP0A 1RETA 3S1MJ 4A93J 3MVPA 2EBIA 3BG5A 3LSPA 2CUFA 1H89C 3S2HJ 3F0CA 5EG0A 2LY9A 3DCFA 1GT0C 2E1OA 4DZJA 1HDDC 3HGYA 1TWHJ 1TC3C 5DS9A 2RAEA 2B63J 5EGOB 2Y9YA 3LSGA 1O4XA 1GV2A 2XRLA 2JMWA 1G2HA 3ZQHA 5FJ8J 4IHYA 2DMUA 3S2DJ 2LTPA 4X6AJ 3HKZN 2R5YA 3BTJA 2FJ1A 1VF9A 1UG2A 1JKPC 1VNDA 2YU9J 3HOWJ 1I50J 2CUEA 3S17J 2L7FP 5IOZA 2CU7A 2AO9A 2X48A 4L5EA 4BBRJ 2R92J 3I4NJ 1HDPA 3GTGJ 3PO2J 3BG9A 3ZQFA 3JRBA 2CRGA 2K9QA 2Y9ZA 5IP7J 1XG1A 2JA5J 2MSYA 4S0HB 1IRZA 2DJNA 3B6CA 4C3JJ 4FE4A 2NVXJ 2LLKA 3Q0WA 2R5YB 2PMZN 3E7LA 1B8IA 2E2HJ 5C44J 3HB9A 1Y1VJ 4HNVA 2JK3A 3IH2A 2VKVA 2HQ5A 3GBGA 5F04A 5FKMA 5JLWA 4A3KJ 1JJ6C 2HOTA 4QIWN 3JRDA 1AU7A 2R5ZA 3HOUJ 4BKXA 2JA8J 4MFEA 1LE8A 2TCTA 1BA5A 3JRCA 3FK7A 5GP9A 3LNQA 3CMYA 3O8HA 1WH5A 4LOCA 4RBOA 3OSFA 1U9OA 1NTCA 4W1UA 2EZKA 2XPVA 1JKQC 1IGNA 2IEKA 3ZQCA 3I4MJ 4DZPA 1I3QJ 1JUMA 1RKTA 4I76A 3L1PA 1JTYA 3BTCA 3GTMJ 3MN2A 3CQZJ 2XB0X 2ECBA 4MFDA 2MGQA 3GTQJ 2R5ZB 3FISA 1LE8B 3RQIA 3A02A 1JJ8C 5EYRA 1EF4A 1PUFA 1FIPA 2X9DA 3RZOJ 1TWFJ 1NK3P 1Z77A 5IP6A 4G12A 2L0KA 1IDZA 2FX0A 1IV6A 3SFIA 5M3MJ 3LSRA 1E3OC 2L7ZA 2NS7A 4AC0A 2YS9A 1T56A 2JA7J 3S1NJ 1MBKA 1T33A 1ZR2A 3WHCA 5JLXA 2JJ7A 3JR9A 4GFBA 3B6AA 2R7ZJ 4JX5A 4FCYA 2HXIA 3OOUA 4JX6A 5F0HA 4M3EA 4BY1J 1PUFB 3IH4A 2ZB9A 3JRIA 1MSFC 3G1OA 2HI3A 3FIWA 2KDZA 4M3DA 1QPIA 5J1YA 2X6OA 4M3BA 3OSGA 4M6VA 2D5VA 1ORKA 3JRFA 4BY7J 5J1UA 1MBJA 1MBGA 4JX4A 2NOGA 4CYCA 4A3LJ 2DMQA 1GVDA 1U9NA 4A3EJ 3H3VK 2Y31A 1OFCX 2CJJA 3D1NI 3HOXJ 2ID6A 1BJZA 2JN6A 3BG3A 2GLOA 4A3MJ 1D5YA 2HOAA 1ITYA 2ME6A 5EG0B 1JGGA 1CQTA 1BW5A 1XC5A 5DTDA 1GUUA 2DA4A 1W0UA 3TW6A 1Y1WJ 3A01A 2H1KA 3HEFA 2CQQA 2Y30A 1JKOC 3PM1A 2LP0A 3JREA 4Y52J 2WB1N 4CYCB 1WPKA 4A3DJ 3CCYA 1U8BA 3BR1A 4FTHA 2EZHA 1MH3A 5BNGA 1K83J 2XSDC 2IBDA 3HOYJ 1ZQ3P 3M3YJ 1XS9A 2NVTJ 4BXXJ 2DMPA 2GBYA 1LFBA 3H0GJ 1TWAJ 5FLMJ 3W6VA 1F43A 3A01B 4J19A 1JTXA 1SANA 1DU6A 3CDLA 5E3LA 2O9LA 2DA6A 2M0CA 4B4CA 1ETXA 5F27A 4EEFG 2OPTA 2N8GA 3GTPJ 3Q3SA 5M3FJ 3TEDA 5M5XJ 4B1RA 4XRSA 2O8KA 4B3AA 1S7EA 3ZQLA 1R9TJ 1B8IB 4QSHA 4IEJA 2AHQA 2O7OA 5F0FA 3IV5A 4A3JJ 5M5WJ 5J3LA 2JWTA 2XB5A 3S16J 2G0EA 1LFUP 2LR8A 5FKOA 1WCMJ 2MG4A 4DYQA 4AUXA 2DMTA 3ZQGA 1VFCA 3C2BA 1YRNA 1TWCJ 1MBFA 4A3IJ 1RKWA 2FQ4A 5GPAA 1MBHA 2NVYJ 4V2FA 1P7IA 2M34A 1DU0A 1ETQA 1Q1VA 3A03A 1H8AC 2HYJA 2DA5A 2P81A 3GTKJ 4C3IJ 2TRTA 2DMNA 1U78A 1BL0A 3NAUA 4UUSA 3S1QJ 4A3BJ 2LFBA 3RKQA 5K7ZA 1A6IA 2XPWA 2LVSA 5K7FA 1IJWC 1RESA 2ID3A 4XIDA 4W97A 5M5YJ 2M2EA 1IDYA 3S1RJ 4AYBN 1IG7A 1MSEC 1ZKGA 3GTOJ 4D7MA 2XGDA 4DW6A 2WV1A 2KT0A 5C4XJ 3ZOBA 3HGGA 2XGEA 2LD5A 3QPSA 5EF6A 4FISA 1ETYA 4UUSB 5FKNA 4A3CJ 3ZQIA 4M3FA 2M8GX 5IYCJ 1POGA 2EZLA 3FK6A 1QVUA 3JRHA 4ABZA 2XGCA 3OIOA 4JP0A 1HCRA 2GM4A 4NDLA 3BR6A 5C3EJ 2WAQN 2DA3A 5F1JA 1JKRC 4JYKA 3LSJA 3JRAA 1I6HJ 4UUTA 1Z0XA 4BBSJ 1BW6A 2DA2A 1JUPA 4C3HJ 3HBLA 3WHBA 1RPWA 3HOZJ 5J1RA 3BTIA 2W48A 3HM5A 1WGXA 2VI6A 1JUSA 2OF7A 1W0TA 1FEXA 4M3GA 5FLVA 2ECCA 1AKHA 1SFOJ 2I10A 3K2AA 3QQAA 3G1LA 5EZGA 1WH7A 1FJLA 1QRYA 2R93J 2R0QC 1B72A 2VKEA 2M9HA 3JRGA 1OCTC 2YUSA
chains in the Genus database with same CATH superfamily
4LK0F 3H1CA 2K7LA 2B7EA 3O8GA 2QF7A 3TGNA 5L3GA 2VC1A 4ENJA 3BR2A 3EDPA 5D8LB 1V55H 1T95A 1MH4A 1IUFA 5E8IA 2VQGA 2R7XA 1G59A 3R0AA 4MTDA 2JRTA 1OCPA 1Z6TA 3LSHA 5B1BH 3ML6A 3WU0A 1XB4A 2KKOA 3BR0A 3K7AJ 2Z1DA 1J2XA 2LKXA 4H0EA 1QA6A 3IAS2 3T8RA 2M7BA 3TW7A 5CQEA 3QOEA 1DPRA 4V2GA 2DI3A 4AWXB 4XMYA 5JI6A 2K9NA 1HKSA 5E3NA 2LNBA 3HHGA 3MD2A 1T2KA 1TP4A 5EZHA 5LBQA 5IPAA 4CZCA 1XGMA 2MFZA 3BTLA 3G1MA 4QTRA 3OS1A 1VQMI 4GXOA 2PJRB 2AS5F 2VUMJ 1ETWA 2X1CA 1UMQA 1MDMA 5C4JJ 3RI4A 2JA6J 2P7VB 1MJAA 1FT9A 1ZR4A 2ZNZA 3PNTA 1P92A 3SDGA 4AU7A 2E5ZA 1WRJA 2VBYA 2R7UA 2BYVE 3HSFA 3AAFA 1Z7UA 3NARA 2EK5A 4BGDA 2VE8A 4RDUA 1P4XA 1XGOA 2K4BA 4WCGA 5DM7F 3Q0UA 1C0WA 1H88C 2YU3A 2HPIA 2H27A 2Q2EA 4D5FA 4I98B 4DYRA 2WV0A 2MLKA 2COBA 2VL8A 3BJOA 3LQQA 1YRNB 2XKPA 1YTYA 1RNLA 3GMEA 2CH0A 3EUAA 5IYDJ 4XRSG 4BHCA 2ZJ2A 1KYZA 5JFRA 5LGNA 4HDUA 5FD5A 1BI3A 1QPMA 1FTZA 5FLXZ 2ADUA 1Z9CA 4XLPF 3C1DA 4BXUA 5K7HA 3HDDA 2ZJPF 1HF0A 4Y7NJ 3S3OA 1HSJA 2ZO4A 2WA0A 2X0LA 2DK8A 4BL0B 2GA2A 4D0PA 3TP0A 4XLEA 2M5WA 4L9JA 1IRXA 4Y15A 1OYIA 3OYMA 4A93J 2XSJC 2EBIA 3LSPA 1YE9A 1LQ1A 2Y48A 3DCFA 1RRJA 2QVOA 2FNAA 2F2EA 1R6RA 3HGYA 3CO7C 1VQNI 2HOEA 1TC3C 3F3XA 4AIJA 2B63J 1ZG3A 2OCCH 1SD6A 2Y9YA 3AKZA 3LSGA 2XRLA 2JMWA 3L2CA 2XRNA 2RGVA 5FJ8J 1IXRC 1AOYA 3S2DJ 2LTPA 1MIJA 4HX4A 2DLLA 1K78B 1FYMA 1VF9A 3QAHA 1VNDA 2YU9J 2CUEA 1OR7A 3V7RA 1HXDA 3J7ZI 2P5VA 4NC8A 4B47A 1OCRH 2CU7A 3FXOA 2X48A 4L5EA 2F6CA 3HXLA 3S3MA 2DTRA 2R7WA 2JT1A 3GTGJ 2PQ8A 3KE2A 3U1KA 5CPRB 2VODA 4OU0A 1R5HA 2W1OA 4BNCA 5GAEJ 1U2WA 1QZEA 3HRSA 2JA5J 1WWXA 1X4OA 1WJCA 1R5ID 4EM2A 5J47A 3KP4A 1OR7C 2WWYA 2WBMA 1MMAA 3OL3A 3V8LA 4C3JJ 5HLGA 1IAWA 2NVXJ 3ZRGA 2R5YB 2CMPA 4IO9F 2GOMA 2PMUA 3E7LA 4WXCA 2DOEA 3H5RA 1B8IA 3NQOA 4O6JA 5C44J 2BZTA 1OCCH 2BEOA 4U88A 3K0LA 3PL8A 3L2VA 2HQ5A 1SMTA 2NXNB 2OU2A 1OCZH 4QIWN 1FSEA 5HS9A 4NNJA 3JRDA 4GDFA 4L0ZB 2RDPA 2MYSA 4BKXA 3L2RA 2JA8J 1HW5A 1XD7A 2TCTA 1BR4A 3CMYA 4M9SA 3HOSA 3CMEI 3P9IA 4YIRX 2V6CA 3CJRB 3OSFA 2K02A 3BC8A 1FX7A 1D1AA 4RB1A 3F8BA 1NG7A 1U6GA 4NUBA 4KICA 3H92A 3BTCA 3VYSB 1B9MA 1Z91A 3EUHA 2RV8A 4II2A 3OY9A 2XB0X 1P9QC 2LF7A 4MFDA 3PQJA 3KLNA 3DLAA 2R5ZB 3I71A 1KYWA 1RUNA 3RQIA 3A02A 2OQGA 3N97A 3RZOJ 1TWFJ 2LG4A 2IT0A 3U2RA 1QBJA 1FP1D 1MJ9A 3KP6A 5LFAA 4F92B 2ESNA 2LC2A 2E1MC 3EUHC 4YEJA 4I0BA 4KMUX 3SZPA 3RKYA 1Z05A 3WE3A 5M3MJ 4C2TA 2R7VA 4LB6B 4YFKF 4PJMA 2L7ZA 5CKTA 2GA1A 1WZ2A 4GRIA 4ZDOA 4AC0A 4HLXA 2YS9A 1T56A 1MBKA 3KZYA 2K85A 4HYEA 5JVTA 2CUJA 2Y0SA 2HTSA 2ZNYA 3I58A 4CCLA 2ISZA 2XAGA 3MFKA 1OQYA 5ILUA 3DTIA 1P6RA 1YLFA 4XSXF 1U5TA 2Q2EB 5F0HA 1PUFB 3IH4A 2F5VA 2ZB9A 1MSFC 2KRFA 3QP5A 3FIWA 2EFOA 1TNSA 2KDZA 4M3DA 5A2QZ 5HLIA 1WHUA 2W25A 4M6VA 4EM1A 2L9SA 3V8KA 4BY7J 1O3RA 4G94A 2FE3A 1U5TC 4E7ZA 4AVZA 4A3LJ 1GVDA 1B59A 1U9NA 2A6TA 5DM6F 1FPQA 4OWRB 1VQLI 1SD4A 3OYKA 1S29A 4CUGA 3H3VK 2STWA 2EINH 3K10A 4C30A 3BG3A 3I59A 4A3MJ 2XVCA 1T38A 1YI2I 3RIRA 2DW4A 4A0ZA 4XSZF 1CQTA 2BY3A 2EIKH 1XC5A 2KQRA 4JK1X 2V4JC 2DA4A 4E7IA 2VPLA 2AQEA 5H6QA 3MKYB 2A05A 2Y30A 3PM1A 3JREA 3QOPA 4IKFA 4MGRA 2LKPA 2DQLA 1ZG1A 2DJIA 4CYCB 4ZTJA 1W1WE 4A3DJ 5D8KB 3BDDA 1MZBA 4XLHA 1Y0NA 2VT3A 1MH3A 1FYKA 2GXBA 1FMVA 2XSDC 2VOPA 4CA0A 1ZQ3P 1XS9A 3W2AA 3KFWX 4WX9A 2GBYA 3KZZA 4RAFA 1VQOI 2FXAA 3CLQA 4LIUA 5FLMJ 1YG2A 4XQFA 5E20A 2X51A 3FXUA 5D5VB 4J19A 4CCKA 1SANA 2Z3YA 5E3LA 1G3WA 1YW8A 1Y39A 1ETXA 5F27A 5B3SH 2W57A 4L9TA 1XCBA 4P9UA 2OPTA 1J0RA 2E71A 4U0WA 5HS7A 3K69A 3Q3SA 3OR1C 5M5XJ 2Z99A 3LA3A 4H4KC 1FBSA 4HNUA 2V6EA 3A2KA 3ERMA 1IO2A 3CCJI 1A04A 2K4JA 4IEJA 4OMZA 1B8IB 4A5MA 3DV8A 2HFHA 4IJAA 2ZCWA 4V19K 3QU3A 3E0JB 5J3LA 2XB5A 3L2WA 4BDYA 3S16J 2OCEA 2LR8A 2JTVA 4CGZA 3I54A 2R7SA 4OINF 2FEZA 1QHGA 2DMTA 2KJBA 5HNHA 5FRMA 3ZQGA 2KIFA 3C2BA 1FBUA 2A5WA 2R7QA 4NBQA 4A3IJ 2RNGA 5GPAA 4OIRF 1MBHA 2FF4A 2NVYJ 1P7IA 2ZJRF 1DU0A 1Q1VA 1RC9A 1XX5A 1KA8A 3BG6A 3CCEI 3GTKJ 4XR6A 4EJTA 4BEHA 1Z67A 2V7FA 3DU6A 1U78A 2M3AA 2QQAA 1MW7A 1BL0A 4OOIA 3S1QJ 4OIQF 3RKQA 2NS0A 1BC8C 1XMKA 1A35A 3DKWA 2QKLB 1ZN2A 2K27A 1IXSB 2JPCA 5LHGA 1TQPA 2KHMA 3WGHA 3RYPA 4B48A 3GTOJ 2O0YA 1OKRA 2KT0A 4LLGF 1HW1A 2MC3A 3HRMA 2YPRA 1RR8C 4M74A 1I27A 3CDIA 1ONVA 2IPQX 3DKYA 5FKNA 4A6EA 3F22A 2HKXA 2M87A 2EV5A 2M7AA 3GLXA 3BP8A 3ASNH 3JRHA 1W5CC 4LLLA 4EQQA 3E6BA 3NWTA 3FDYA 2GM4A 1I39A 1D8KA 2QLZA 4ZH4F 2VBWA 1EH8A 4Y4RA 1GLNA 3LSJA 3H0DA 2L4AA 3MZYA 1V5FA 2LBFA 3DXJF 4GGGA 3U21A 4HZFA 1O57A 1XTAA 1USTA 2UUZA 3FXKA 1HBXG 2DCEA 3GW2A 3GZNB 3H3UA 5LD2C 2IS4A 2W48A 3HM5A 3MQ0A 4YIFA 2BE5F 3FXJA 3JCUC 4E4HA 1VQ5I 4DNCA 4PDKA 1KU7A 4E7SA 5DD8A 5DYMA 3LL7A 5F64A 3K2AA 1ZRCA 1CGPA 2ZBKA 5EZGA 1FJLA 4OMYA 5J4VA 1QRYA 4I09A 2W4SA 2GIVA 5CVUA 2R0QC 2WAEA 1B1BA 3HJEA 2M9HA 3AG4H 2IXSA 2CQNA 3PQKA 2LY2A 2VQHA 2ETHA 3CZ6A 3VYUB 4KDPA 4O5VA 4PJ0C 4IF4A 2ME0A 3LOCA 4UB8C 2QCOA 3O6BB 1FWZA 4MIMA 3WTYC 2UZKA 2PJRA 3K6GA 1ZELA 1R4MB 2FD5A 4L18B 3IH3A 2E2IJ 1UHMA 2M4KA 1VQKI 3EYIA 1TWGJ 3SZTA 3QPLA 1HOMA 3HUGA 3DQVC 5FROA 3PSIA 2X6XA 3RQ4A 4UXNA 4X1EA 4DOZA 1GV5A 3VPRA 1SAXA 1GHCA 3CP2A 4BXFA 2G9WA 1REPC 3BLYA 1XSXA 3FM5A 4FT8A 1MMNA 2H94A 1IRGA 1TBXA 3FKJA 4KIBA 3CC4I 5GTIC 2XKOA 4HW0A 2DO7A 1E3HA 1XDUA 3BR3A 3CJNA 4D5CA 5HVQC 2MW8A 5D5WB 1P2FA 5GAGJ 1GDTA 9ANTA 2PN6A 4CXFA 5E3OA 3ZGKA 4HF0A 2EZIA 4XNFA 2QSHX 2OAZA 4IOCF 1FOWA 4XOPA 2V9PA 1AHDP 1UB9A 2L9RA 1Z3YA 3F9KA 5IP9J 3IKTA 4BE1A 3S14J 2K40A 3DKXA 1P7JA 1IN4A 2ELKA 1XMXA 1R71A 4E7HA 3QPTA 5FKKA 5F6FA 3HIFA 1SD7A 4CSWA 2KZGA 5JR3A 3GFJA 3DF8A 4BACA 2Y0SN 4BHBA 1FMWA 2KJCA 1O7FA 1UG0A 1ENHA 3KX2A 1IC8A 1OLTA 4U87A 5L3EA 4YRVA 2G7HA 3EETA 3CMAI 1V3FA 2X85A 4DYCA 2DU9A 1W5SA 2HU9A 2XDVA 2XPUA 3F6VA 2F48A 3KPHA 3OV8A 1K4TA 4BJ6C 1SFXA 4HQMA 5E1ZB 4G7ZF 3V7CA 3CJTB 2EV6A 2Y2ZA 4XBFA 3F8NA 3HOVJ 3E3VA 3JTHA 1HLVA 1I3AA 5EDNA 1JT6A 4AYBA 4X0GA 1YJWI 4A3GJ 3K1NA 3I9V2 1YX3A 5KAIC 2DA7A 2LY1A 2BXYA 3GXOA 3DEEA 3OR2C 2PLYA 2E60A 4M71A 1EA3A 1ACIA 3BG5A 3DEUA 5J8CA 3NRVA 2CUFA 1U0JA 1GT0C 4F3QA 2FBHA 4XKVA 5DUKA 2IA2A 2DT7B 1HDDC 3ROUA 4A6DA 1TWHJ 3V4GA 2A07F 1YQAA 3ZP5A 2CV2A 2BOLA 5CQGA 4IX7A 2IP2A 1GV2A 4NHJA 5L3DA 4IXAA 2B9SA 3FXRA 4X6AJ 3RCOA 3BTJA 2R5YA 1U8RA 3M7GA 1N75A 4ZTFA 2FJ1A 2YSRA 1ZRDA 1ON2A 1ZLJA 2PMHA 2L7FP 3P7NA 5IOZA 2Z33A 4CZZA 1V5GA 1RI7A 2LBFB 2R92J 2I8DA 1W36D 4HX7A 4CCMA 1FC3A 3BG9A 3LSIA 3Q9VA 3JRBA 4BJ5C 2MD0A 2E1NA 2CRGA 4HX8A 2OQRA 3M8EA 3DBHB 3FM3A 2DODA 3KEOA 4MNUA 3W2WA 3I55I 1IRZA 1HKTA 3ONQA 2FNPA 4N9HA 5LLQA 5BPIA 3Q0WA 1NHAA 2A3SA 4HA8A 3HB9A 1LVAA 1IV8A 1Y1VJ 3MWMA 4OIOF 3O3KA 5DD4A 3IH2A 1BI2A 3F21A 3TO7A 2VKVA 3H35A 3CCMI 3GBGA 2L3DA 5A2QK 5ICFA 5ICGA 4A3KJ 2O03A 1JJ6C 1OYYA 3RYRA 2OA4A 4EJOA 3IRQA 1AU7A 2R5ZA 3VWBA 3KZIC 3IUOA 2IS6A 3PFYA 5D4RA 3PNVA 4MFEA 2W00A 1DUXC 2A6HF 4LB5A 3R60A 4OAYA 3LNQA 2W85A 1FOKA 3O8HA 1O3TA 2FBIA 4RBOA 2EIJH 3OYHA 2XF7A 3PJRA 4LD5A 5J6XA 2IGOA 2EZKA 2XPVA 1JKQC 1IGNA 2DBBA 3ZQCA 3I4MJ 1KZHA 5ILSA 1JHHA 1JUMA 2RNJA 5FFXA 4RS8A 4I76A 3S32A 1JTYA 1X1BA 4FQGA 2AXTC 1YFHA 4XONA 3HUGB 3KP5A 4GCVA 3FMQA 3DTEA 4P96A 2MGQA 1S9HA 3I4PA 4P55A 4ZYAA 2NAZA 1LE8B 4G6TB 4UV8A 1PUFA 1FIPA 1EF4A 5B1AH 3GCMA 2XASA 1SEUA 3VSKA 3R61A 4BQQA 3PSFA 2GWRA 1IV6A 1BOAA 2RVCA 3LSRA 1ERDA 3P9KA 1XPXA 4BAYA 2EV0A 1E3OC 1RIOH 3RPUA 3JSPA 4PFOA 1VZ0A 3MKWB 3TO6A 2JA7J 3S1NJ 1T33A 5JLXA 1UCRA 2DOFA 4XL9A 3TDZC 5HNFA 2R7ZJ 3B6AA 1J9IA 3OL4A 2XROA 3OOUA 4JX6A 4M3EA 3KYDB 2QENA 3CC7I 1E2XA 3BZ6A 3VB2A 1ZHFA 4ESFA 4KITB 1UELB 4XKCA 5FRNA 1QPIA 1BJAA 5J1YA 1E17A 4LIVA 2X6OA 3WGIA 2MC4A 2RC4A 3A4CA 3EYYA 3QP6A 2D5VA 4Q47A 1LEAA 3JRFA 4A0XA 3UR3C 3C18A 5J1UA 3D5RC 1J75A 3ZMUA 4E70A 4CYCA 1BIBA 1HW2A 3RSNA 4IRHA 1G8XA 2Y31A 4Z2YA 2C6YA 2HWVA 4EV0A 1Y56A 1V4RA 1SVOA 1MJBA 2ID6A 1BJZA 3LA2A 1X4PA 4EJVA 2JN6A 2BY1A 2GLOA 4OAZA 2HOAA 3TQNA 3IRRA 1IN5A 5HDKA 1P4WA 3K1PA 3I3LA 2EJRA 1WJFA 2XAFA 2X4HA 2H1KA 2NRAC 1XSVA 3HOTA 2DPDA 2LP0A 1F4KA 2FMLA 3HZJA 3ZMDA 3LSTA 1R5GA 2HR3A 3HKZA 2GOXB 3C2GA 3BZCA 1H9TA 4HV6A 1Z3XA 1U8BA 1D0ZA 5AONA 4RLFA 4DBQA 2EZHA 5D5UB 2CQ7A 2FUG2 1GXPA 2QBYA 3PIOF 4KISA 4DJAA 1R49A 2F5CA 3G3ZA 3GF2A 2OD5A 4AIDA 1LB2A 4L0YB 2FU4A 4UVBA 2P0WA 1G6NA 3H0GJ 3HPGA 3J7AY 1QQIA 2IA0A 3W6VA 2G7UA 2R7RA 4E7JA 1O3QA 1S7OA 2M4GA 1JTXA 3CDLA 5L3BA 2KRCA 2DA6A 2FOWA 3K4KA 4B4CA 5FB2A 1ZAOA 3OYIA 4U0YA 2ISYA 1CF7A 3GTPJ 5KCMA 3F8CA 4YFNF 3TEDA 1P4AA 1IUYA 4ASNA 2V1DA 4BE0A 2O8KA 1IN8A 3ZQLA 5E17F 3SEQA 1KQ9A 1T6SA 1FNNA 3WU2C 2VJ5A 4EVIA 3CTAA 3I53A 5ICCA 3IV5A 4BDZA 4A3JJ 5M5WJ 4B3XA 4WXDA 2JWTA 3CCVI 5H2FC 1MGTA 2G0EA 3JSOA 3K4JA 5FKOA 4NC6A 3RJPA 1WCMJ 2R7DA 3ABTA 3MAJA 3W3CA 3BG7A 4QPQA 4IVNA 3VYRB 3OIPA 4AUXA 3A1YA 2PG4A 3HYIA 1VFCA 3GVAA 1E0EA 3PNYA 3VODA 2H8WA 1Y6IA 2LH9A 2W82A 4L9NA 2AQFA 1S8NA 2ZFWA 4V2FA 2VBXA 2ZXHA 3A03A 4RM3A 3RPUD 2Z16A 2DA5A 3D5SC 4C9YA 3OYCA 4HRIA 2QQ8A 3JW4A 4ETSA 2UXXA 1AWCA 1A6IA 4G9YA 3ASOH 3ULQB 1SMYF 4W97A 4XIDA 4LG0B 4NQWB 2M2EA 2QM3A 5HLHA 4AYBN 4OIPF 5TISC 1IG7A 4B44A 2BHYA 1LDDA 2VQLA 4KIGA 2LMDA 2R7FA 2QEXI 2WV1A 1Z1DA 1T08B 5C4XJ 2FRHA 4YELA 3ZOBA 3HGGA 2XGEA 4BYYA 1I1GA 1H0MA 4LJZF 2V1NA 4GYIA 4FISA 1ON1A 2MH9A 2DFFA 4N9IA 1M1EB 4M3FA 3ZQIA 1YIOA 3K70C 1I6XA 4Y3OA 3CLOA 1POGA 2EZLA 3CJQB 2L5QA 4G7OF 4ABZA 3Q9SA 2BHZA 4KIFA 3CUQB 3B73A 5IY5H 3BR6A 2F5EA 2DA3A 2K9MA 5F1JA 3EQLF 5FFZA 4DIQA 1EH6A 4A5NA 2CG4A 1ZLKA 1B4AA 1R22A 4UUTA 3LAPA 1Z0XA 5DUIA 4BBSJ 2DA2A 2K3FA 2V26A 4C3HJ 3WHBA 3P5JA 5J1RA 3FZVA 3L7WA 1JE8A 1R00A 2PJPA 1WGXA 2VI6A 5L3CA 4LFUA 4E6KG 2NOJB 1JGSA 3EUKL 2OF7A 1W0TA 4O3MA 1FEXA 1S72I 5FLVA 2OTLI 1HKQA 2HZDA 3QQAA 5D5XB 1K4SA 4XN0A 1WH7A 4UB6C 1V54H 2ZJQF 2A5YB 4LLNA 4PZJA 2E36A 1MKMA 3B02A 2OV7A 2IGMA 3SJMA 3SYTA 3OMYA 3GUDA 4RB2C 4D7NA 1D5VA 2Z2SB 1WKMA 3ZMVA 1A5JA 1WVRA 1XN7A 1TW2A 2CW0F 1OJLA 2L7MP 2J5OA 5FKLA 4PFPA 2FA5A 4TV7A 3M4OJ 2XV4S 4PJLA 2CV0A 5J4YA 2HZTA 1TZLA 1YW7A 4I01A 3OYGA 2DT5A 5TGTA 1ETKA 1X58A 2IAIA 4HV5A 2Q0OA 4S04A 3KEYA 4FX4A 1B72B 2HDDA 2QBYB 3K1MA 5HODA 2NVQJ 1VI0A 2E19A 4PGHA 1WI3A 4XRMA 3GFLA 4DQ2A 1J7KA 2WY8Q 2DT6A 1KQ0A 3E6CC 2VBZA 2QUFA 2KDOA 3E6DA 2E2JJ 4FX0A 2ZSHB 3W6JB 2ESHA 5F1RA 4IHXA 3ABLH 4ESJA 2IW5A 2MA3A 1JT0A 3O2PE 1CF7B 1MNMC 2CFOA 2DYRH 3CO6C 3TDUC 5BOXA 5DDGA 3CC2I 3LMMA 5IYBJ 3GTLJ 5CJ9A 3BPXA 4A69C 2EB7A 2KFDA 2OZ6A 3LWFA 2FSWA 3BQZA 1K61A 1VQPI 1UHSA 2VN2A 2K9SA 3COAC 3KETA 2OJED 2JRMA 3FKIJ 1IW7F 2ACJA 1VQ6I 1EKEA 2HOSA 1SFUA 3K70D 1Q1HA 4RA2A 2HQAA 2F5FA 2KIUA 4KT5C 2Q1ZB 4IHWA 5DCMB 4MLOA 1YO5C 3ZCOA 3GWZA 2DN0A 4XRFA 5F08A 1XGSA 4XICA 3AG3H 1ZK8A 2DA1A 4GO1A 5GPCA 1MBEA 2EILH 4Q5SF 3DEWA 4PJNA 5H6RA 2DPUA 1MNEA 4L9VA 1IF1A 1PUEE 4XLFA 3V7SA 3PO3J 4A3FJ 3J7AO 2CO5A 1RETA 3FMSA 3W2VA 4RB0A 1MNDA 3JAMK 2E34A 3H3ZA 3M1EA 5HS8A 3BJ6A 2XF5A 1H89C 5EG0A 4KUMA 3S2HJ 2E1OA 3RTRA 1F9NA 1TT0A 3ZN1A 2VLAA 2JVHA 5AIPA 1QZYA 1QO0D 3BJAA 3FXQA 2CSOA 2H1LA 2QGUA 5EGOB 2CV1A 4ZYGA 2KIMA 5K1YA 5FGMA 1L0OC 3WTSC 2CGPA 4WWCA 1G2HA 4A12A 1D0XA 3KLOA 1BOBA 1VQ7I 4IHYA 2WAQA 5JHUA 3HKZN 1LUJB 1UG2A 3S17J 3HOWJ 2CYYA 4RM2A 2M0MA 3WG7H 4JQFA 2AXLA 5JVGF 3HRTA 1IN7A 4J01A 4PGGA 1XMAA 3I4NJ 5LRRA 1WJBA 3DPTA 5KVRA 2MLGA 4DGWB 5LGTA 2Y9ZA 1OMIA 3AG2H 4QPOA 3TKYA 1XG1A 2MSYA 4S0HB 2QSGX 3GFIA 2DFIA 2BGCA 1HSTA 2DJNA 1UHWA 1WI9A 4M72A 4ENMA 1SC7A 2EFQA 4FE4A 2MBFA 1X1AA 1ZARA 3QWLA 1XDSA 1E3PA 4HNVA 5IT9Z 3IKVA 4RGRA 3LA7A 5F04A 5FKMA 5LHHA 2VIXA 1W36C 1MD0A 1FOXA 1XSDA 1LE8A 1FP2A 2JZYA 1Y0UA 3FK7A 5GP9A 1WH5A 2XUBA 4UVAA 1YS6A 1YJ9I 1U9OA 1H9GA 4W1UA 2KZVA 1J09A 2IEKA 2I5UA 2F5DA 3KP2A 1RKTA 4HOBA 5FD6A 4IHSA 4U7BA 4UV9A 2D45A 4JOMA 1K6YA 2FQ3A 4LG3A 2ECBA 2ELHA 3HL2A 1YIJI 3BCAA 3GTQJ 3FISA 3G71I 5ICEA 1N78A 5DCFA 1JJ8C 2P7CB 3N05A 2O6GE 2X9DA 2KP6A 1NK3P 3M9AA 2P6TA 5BQTA 4G12A 2BBYA 5TJJA 2LKSA 2ZKZA 1XCVA 2L7KA 2L4MA 1R23A 2VB6A 3SHFA 2D1HA 2ZMEB 1GVJA 5CVRA 3DPLC 3OS0A 3C3WA 4KA4A 3ZXSA 2EFWA 4MQ9F 1IRFA 2NS7A 1D0YA 2EIMH 1RZ4A 3ZN0A 5CVVA 5EEGA 1WJ5A 4ON0A 3OYLA 1PP7U 1ULYA 2HVRA 5LEJA 4JX5A 1WQ2A 3FMRA 1X19A 4FCYA 2HXIA 1SAUA 2LSOA 2HYGD 3JRIA 2F4IA 2M1BA 3GYHX 4XORA 3DP7A 3ZQQA 3SEZA 2HGCA 4IRGA 2M45A 4WXHA 4I2OA 2KIQA 3J7YJ 2O61A 3OSGA 2ICWG 4MEXF 4B8XA 5K5RA 1HC8A 2V9VA 1ORKA 4BUPA 2CFXA 2V1XA 1BR1A 1MBJA 4M73A 5BPDA 1VQ4I 2NOGA 1GXQA 2DDBA 1IN6A 2QQ9A 3L09A 2DFHA 4N4OB 4RLQA 1W7PD 3ERED 4A3EJ 2MD5A 2KISA 4ZZDA 3D1NI 3T1BA 3HOXJ 3WODF 4Q48A 2HVQA 2XHKA 3HRUA 4PK4A 2DXIA 1USSA 3R4KA 3KYCB 3TL4X 4G8XA 5EG0B 2Z9OA 3ISPA 2BVLA 3DBLB 3SDBA 1FZPB 2HYFA 4EM0B 1GUUA 3GFMA 2QA4I 2VT2A 3TW6A 1Y1WJ 1MMSA 2RKHA 3HEFA 3I5UA 2CQQA 1JKOC 2CS3A 2E7XA 2FBKA 2LOOA 1AA7A 4D1QA 2IGKA 3K4LA 3WTXC 4YG2F 3CCYA 2A68F 1YHQI 2H6BA 2UXNA 1JXSA 2PEXA 4FTHA 2P4WA 2QZ8A 5BNGA 1J59A 1W7PB 3H5AA 1WFXA 3KP3A 3M3YJ 4JBAA 1LVKA 5D6EA 2DMPA 3TO9A 1OYWA 5LRSA 1XGNA 3QYBA 4L5JA 1F43A 1R36A 2BY2A 3KIOA 3A01B 2DYSH 5ILVA 4RAGA 5LHIA 2M0CA 3K4NA 2ZC2A 4FASD 2PMZA 3HTUA 3JAMZ 4I7HA 3QYEA 4ANJA 4B1RA 1QHHD 2LDUA 4QSHA 2AHQA 4KMFA 3F8FA 4BJTA 2O7OA 3KCCA 5F0FA 3IC7A 3SXYA 2ELJA 2ZFUA 4XLAA 2ZXIA 1LFUP 2HS5A 3CESA 3ABKH 4LG0A 4NQWA 3VEPA 4M9ZA 1DQUA 3HTSB 4U0VA 2BVMA 3BCBA 2Q8KA 2JVGA 1TWCJ 1B6AA 1MBFA 2CQKA 3RKWA 3S2WA 1RKWA 1BR2A 2RN7A 4M9XA 4UNOA 4F7ZA 1W4MA 2D1VA 3IWZA 3TOBA 2NVUB 1H8AC 2HYJA 1LEBA 5IT3A 4C3IJ 5HDGA 5KAFC 2DMNA 2HPMA 3EPZA 3IHUA 1OCOH 2JA2A 4P5OA 2LFBA 5K7ZA 2JSCA 2XPWA 3CMMA 3S8PA 2LVSA 5K7FA 1F1ZA 2ID3A 2YX7A 5M5YJ 1QNTA 1SFKA 2EFPA 1OPCA 4HBLA 1PYVA 3CUQA 4MQVA 2H09A 1WJAA 1MSEC 3G73A 2L54A 3J80Z 2HNHA 1ZKGA 2XGDA 2HEOA 1RUOA 1Z6RA 2YR2A 2OUMA 4IRIA 1R7JA 2QQBA 1VQ9I 4XM3A 5CVIA 3QPSA 2EPFA 2VKHA 2X1DA 5FO5A 3FF5A 4CICA 1G3SA 1G3YA 4UUSB 1ZG5A 2E5NA 3S3NA 3CUQC 3RDIA 2X6YA 1YJNI 2M8GX 5IYCJ 4HSTA 3J81Z 2WTEA 3FK6A 2PI0A 1QVUA 1HCRA 5C3EJ 2K86A 1ODDA 2WAQN 2PFBA 1TL8A 1STZA 2X1EA 3LSMA 4PUSA 1LFPA 4Q4ZF 2JQ7A 5DV5A 2LRDA 4EMSA 3HPHA 1TT5B 1G3TA 3OS2A 1BW6A 2DFEA 4KJZA 2RREA 4QWQA 1JUPA 5E8GA 2BV6A 5CLSA 1RPWA 3HOZJ 5KNLA 3PUBA 3ZMZA 4IL6C 2EWNA 1BI1A 2L9NA 5HLTA 1JUSA 4E7LA 1IZ1A 1O3SA 2VOOA 2OBPA 4M3GA 2GXAA 5EJCA 2GAUA 5J8FA 1JHFA 1SFOJ 1O7LA 2XAQA 5EEHA 3G1LA 1VTNC 1EH7A 4AIKA 3CCQI 6PAXA 1B72A 2VKEA 1OCTC 2VASA 2GIZA 2PX9A 2LREA 4G6DA 4AIHA 1I5ZA 2DDAA 4NB5A 2LK2A 4ZC3A 4HAMA 3H9JA 4RAYA 3TP3A 2WB1A 4WF2A 3WTWC 2R7TA 5GAHJ 1R4NB 4RGXA 4CO8A 5E18F 2TDXA 4I6ZA 3CD6I 3DLLF 1KU9A 1ZTRA 5EEAA 3E5UA 1KU3A 3RPQA 1LKXA 2NS8A 1APLC 4ZJZA 1X2NA 2W7NA 1AKHB 2H8RA 3T8TA 2DAOA 3MKLA 1K79A 3LFKA 4ENKA 1HQCA 1RR7A 1ETVA 4EGZA 1D8JA 3M1CA 4I02A 3LAJA 3IL2A 2DTZA 1QVTA 3UKGA 1FIAA 3QODA 4HF1A 2XF6A 4C2MJ 1ZGWA 4Y33A 2W24A 2GQQA 1FBQA 3ESWB 4K2EA 3BT9A 5E3MA 1U3EM 2VC0A 3ZMTA 3KEQA 3CCSI 4XK4A 2CQXA 3UNGC 1G4DA 1YYVA 4YFXF 3ZPLA 5F0CA 5DCMA 1EV7A 1T8IA 3DTKA 4UUVA 3NWSA 3GTJJ 2E35A 4FHTA 2BXZA 2V79A 3CF5F 1ETOA 2EQRA 5E1WA 1TQMA 2CW7A 4YIIA 1FTTA 2Y0MA 2VJIA 3KP7A 1VQ8I 3F6OA 3PUFA 4FE7A 4HNTA 1NK2P 2VPRA 2W84A 2HTJA 4PSWA 4KN7X 1ZYRF 2QYOA 3Q0VA 5LEKA 4HF2A 4B43A 2O8XA 4LMYA 4MO7A 1F36A 2MABA 1BN5A 1KGSA 2V1UA 4R79A 1A31A 1SFEA 4ESBA 3CUOA 2GXGA 3HC7A 3SFZA 3WTTC 1LDKB 2RQPA 3GEZA 3BR5A 1MDMB 3OWTA 2VE9A 2XAUA 2CW8A 2NNYA 2HXOA 3S15J 2J5PA 5GTHC 3C2HA 1X2MA 3MZHA 3FXLA 5IT9K 3CDHA 2H6CA 3MMYB 1A36A 3BQYA 1IXCA 2A61A 4XKBA 1S3JA 5EGOA 2NYXA 2EH3A 5IOYA 1DPUA 3PIPF 1R1UA 4IHVA 4N0BA 4RMNA 1N25A 4IQJA 3OOPA 3MCZA 5H20A 2K9LA 3E97A 3RZDJ 1DDNA 4C2UA 3OYNA 2O5RA 3S1MJ 4HG2A 3JTGA 3ECHA 3ECOA 3VSLA 4BH9A 1UFMA 4ITVA 3MVPA 3ZQ7A 3F0CA 4BQNA 2LY9A 4EJWA 1Z7LA 1FOYA 4XLCA 4DBRA 3L2UA 2O3FA 4F93B 4DZJA 2VJ4A 2HQRA 1KONA 5DS9A 4J00A 2RAEA 2XAJA 2KMUA 2WAFA 2R3SA 4IPAA 2VKDA 4MEYF 2PBIA 1O4XA 4P9FA 4R1HA 1BI0A 3ZQHA 4KT6A 2DMUA 1KQ8A 2L01A 4N4NB 2FOKA 1Y8QB 4A2UA 5GADJ 1NH3A 1T98A 1JKPC 1I50J 4ZDLA 5LGUA 3R0JA 4I99C 1EJ9A 1BIAA 3CF2A 1PJRA 4PSXA 2AO9A 4MHGA 2A69F 5ERIA 1B9NA 4UVCA 3DWLE 4BBRJ 4CCOA 5CVJA 2LF8A 1HDPA 3CP8A 1DP3A 3PO2J 1PP8F 4A0YA 1X3ZB 3ZQFA 3I64A 2K9QA 4XN3A 5IP7J 5E79C 4EGYA 4KFCA 3WTZA 5BMZA 4EJUA 1X3UA 1D1BA 2NNNA 3BPVA 3B6CA 1LJ9A 1ZGAA 2LLKA 2PMZN 3ELKA 2E2HJ 1BC7C 3LQRA 5L3FA 2P5LC 3WGGA 2A6EF 4IOAF 4IHTA 4BQAA 2JK3A 2WADA 4M6XA 3VFZA 1FLIA 4P1WA 2Y69H 1YX5A 2L02A 3DU5A 3AG1H 5JLWA 2HOTA 1LNWA 4MTEA 2IJLA 3BROA 3HOUJ 3GZ5A 4F55A 4UY8I 1NG6A 4IQ4A 2EA2A 1BA5A 3JRCA 3E1SA 3T5XA 2LYCA 4R8HA 4LOCA 1HA8A 3IP4B 1NTCA 5TRDA 4BHPA 3IWFA 2HVSA 3M07A 4DZPA 2ZMEA 2BW3A 1I3QJ 4XKWA 4BQOA 5D4SA 3C7JA 4U7DA 1L3LA 1QGPA 3L1PA 4HPQA 3GTMJ 3MN2A 3CQZJ 3TMOA 4L5IA 1PVEA 4CH7A 3LSKA 4B09A 1ZREA 3FWEA 2QKMB 4XLNF 3SZGA 5EYRA 2ZMEC 1SD5A 2XAHA 3AL0C 1Z77A 2F4OB 5IP6A 3G4SI 2L0KA 1IDZA 3K4CA 5B5EC 2P6SA 2OTJI 5KHDA 2RQQA 3E6MA 3DFGA 2FX0A 2UV1A 3SFIA 4CCJA 2IVMA 3WE2A 3FHNA 3F8MA 2QWWA 1A6QA 2E1MB 1FY7A 3N4MA 2M8EA 3QRFF 3CCRI 1ZR2A 3WHCA 2JJ7A 3JR9A 5D6FA 2HQNA 4GFBA 2VXZA 2JPBA 3OYFA 1D3YA 3GZ6A 4BY1J 3H36A 3G1OA 3OYDA 2HI3A 2STTA 2IS2A 4CDGA 2EFNA 3BOQA 2IRFG 4ZYDA 4HSRA 4ZZLA 4M3BA 4LITA 4F91B 3L9FA 3AFHA 1BM9A 3REOA 2BY0A 3D0SA 1MBGA 2X6WA 4JX4A 5KK1A 5ED4A 2HDCA 4Y17A 2DMQA 1Z21A 4PJJA 1OFCX 3ABMH 2CJJA 3TOAA 1X1PA 2B0LA 4BS9A 3MZ8A 1U5TB 4CCNA 2ZXJA 1W7PA 2KL4A 2M30A 1LDJA 5E1XA 3V42A 1D5YA 3U9GA 3CCUI 3OYJA 3T0YA 1ITYA 5K5QA 1T39A 3NEUA 2ME6A 1JGGA 1R1TA 3S93A 2JUGA 1BW5A 5DTDA 3G2BA 4D9JA 1W0UA 2CWEA 2K5CA 1YOVB 3K4BA 1ZGJA 3A01A 4HLYA 1UJ8A 4BU2A 1DGWY 4EATA 4CHUA 1UZCA 3V8JA 4Y52J 3OYEA 1S6LA 2IA1A 2WB1N 2Y75A 1OISA 4ZYEA 3D5LA 4CYDA 3PFIA 1WPKA 4HEA2 3BR1A 3VOEA 1X1CA 4UHTA 1YW9A 1R1VA 2CUZA 1V5EA 3J80K 1TQIA 1YS7A 4Y13A 1K83J 2YX4A 3FX3A 2KLOA 3HG9A 5HOOA 2IBDA 3I59B 3IAM2 3W6KB 3HOYJ 3L00A 3E5QA 2NVTJ 1I1SA 1TTYA 4BXXJ 3HSRA 2L2OA 3FXMA 4QLCU 1LFBA 3I0TA 5JHFA 1J5YA 1QZZA 3SQNA 3ZMSA 3L2QA 5FLXK 1TWAJ 3G6EI 4AD9A 3FHZA 3HSEA 2GZWA 1QU3A 3OYBA 1WSUA 4E7KA 4G7HF 1DU6A 2E1CA 3H5NA 2O9LA 3WTVC 1TW3A 1SVMA 4EEFG 1Y8RB 3J81K 2N8GA 3U1DA 3A0HC 2FMYA 2JUCA 5M3FJ 1YITI 4XRSA 4B3AA 1S7EA 5BS6A 2VONA 2F4MB 3A0BC 1R9TJ 1WJEA 3DBRB 4M6YA 1DP7P 4F52A 3FBIB 3H9QA 2ZSIB 3R6SA 3MKZA 4II3A 1MMGA 1SVLA 2MG4A 1ZRFA 4LK1F 4I0AA 3CCLI 1WJDA 2R7OA 4DYQA 3M8JA 2ZXWH 4XOTA 3I56I 2QSFX 3WG9A 1YRNA 4KNYA 3K2ZA 2FQ4A 1PDNC 2M34A 4WK8F 1ETQA 4S05A 3QU6A 3RKXA 1LPQA 2P81A 5CYVA 2BW3B 3KYLA 3GLLA 2TRTA 3AL0B 2VQCA 2VXDA 4RB3C 2L9VA 3NAUA 4UUSA 4A3BJ 3OIQA 3VDXA 1R58A 1IJWC 1FYLA 1RESA 2IGNA 3WTUC 2DOAA 1TLHB 1IDYA 1TNTA 3S1RJ 3LFUA 5DEQA 4ZDPA 5AIQA 2P8TA 3P9CA 3Q5FA 1N77A 4D7MA 1FSHA 1K7AA 1UAAA 4RGSA 4DW6A 2WC2A 1MMDA 1KU2A 2P5KA 2OC6A 4RGUA 4AVPA 1S7AA 2LD5A 4FETA 1ZH5A 4HQEA 2V9KA 3ABUA 4BEHB 2UWMA 2XGXA 1T0FA 1D1CA 1X3WB 5EF6A 5HDNA 2KRHA 3OYAA 4AM3A 1ETYA 2WY7Q 1K6OA 2OZUA 4A3CJ 2R4GA 2E7WA 4RAZA 4ENNA 2IS1A 4GYGA 1K78A 3ZR8X 2D2WA 1JI8A 4BE2A 3GO5A 4Z6YA 2XGCA 3OIOA 1BBYA 4PCQA 4JP0A 5K5OA 4HDVA 4NDLA 3WU1B 3HHHA 1JKRC 4JYKA 1S5LC 2K3PA 3F72A 4LGWA 5J40A 1T0FC 3JRAA 3QYFA 4NC7A 3BWGA 1I6HJ 3QPHA 3E5XA 2DQRA 2VJJA 3BY6A 2MH2A 3X2QH 4KN4X 4KYWA 2XC7A 2EA4A 1F5TA 2COMA 3HBLA 3F23A 4IZZA 3BZKA 3TBIA 3BTIA 3K9TA 3VYTB 5B66C 2HDWA 2HKOA 2XIGA 3H9GA 3DPUA 3GX4X 2ECCA 3MEXA 2KPMA 2JSPA 4ZYHA 3K4MA 3M8FA 2I10A 1X1DA 1AKHA 2Z5UA 4G6QA 2DK5A 3FBNB 1W5TA 2R93J 1DGRM 3JRGA 2YUSA
chains in the Genus database with same CATH topology
3SJMA 2LK2A 3O8GA 4D7NA 2QF7A 2ME0A 3LOCA 3TP3A 1A5JA 2QCOA 4MIMA 3BR2A 1OJLA 2L7MP 1MH4A 1IUFA 4I6ZA 5FKLA 3M4OJ 1ZTRA 5EEAA 1APLC 2FD5A 2NS8A 3IH3A 1OCPA 1X2NA 1AKHB 2E2IJ 2H8RA 3BR0A 3K7AJ 3MKLA 2LKXA 1ETKA 1X58A 1RR7A 1ETVA 1TWGJ 2IAIA 3QPLA 2DTZA 1QVTA 3TW7A 1FIAA 3UKGA 1B72B 2HDDA 4V2GA 5HODA 1HOMA 2NVQJ 4C2MJ 1VI0A 2E19A 1ZGWA 4X1EA 1GV5A 2K9NA 1WI3A 3VPRA 4XRMA 5E3NA 5EZHA 5IPAA 3BT9A 5E3MA 3BTLA 3G1MA 4QTRA 2E2JJ 4XK4A 4IHXA 1ETWA 2CQXA 2VUMJ 3BR3A 4D5CA 1UMQA 5F0CA 2MW8A 5C4JJ 1GDTA 2JA6J 9ANTA 1JT0A 1MNMC 1ZR4A 5E3OA 3GTJJ 2EZIA 3SDGA 5IYBJ 3GTLJ 1ETOA 2EQRA 3NARA 1AHDP 4A69C 2L9RA 5IP9J 1FTTA 3S14J 4FE7A 3BQZA 2K40A 1K61A 1NK2P 2VPRA 1P7JA 2ELKA 4RDUA 1UHSA 2K9SA 3Q0VA 3Q0UA 1H88C 5FKKA 3FKIJ 4MO7A 1F36A 4D5FA 2HOSA 4DYRA 2Y0SN 2COBA 1IC8A 1ENHA 4IHWA 1YRNB 3BR5A 4MLOA 4DYCA 2DN0A 2HXOA 5F08A 3S15J 5IYDJ 4XRSG 4XICA 1X2MA 1ZK8A 2DA1A 2XPUA 5GPCA 1FTZA 3BQYA 1MBEA 5EGOA 3DEWA 5K7HA 3HDDA 2EH3A 2Y2ZA 5IOYA 4Y7NJ 1HF0A 3HOVJ 4IHVA 1HLVA 5EDNA 1JT6A 4A3GJ 3PO3J 4A3FJ 3RZDJ 2DA7A 3TP0A 1RETA 3S1MJ 4A93J 3MVPA 2EBIA 3BG5A 3LSPA 2CUFA 1H89C 3S2HJ 3F0CA 5EG0A 2LY9A 3DCFA 1GT0C 2E1OA 4DZJA 1HDDC 3HGYA 1TWHJ 1TC3C 5DS9A 2RAEA 2B63J 5EGOB 2Y9YA 3LSGA 1O4XA 1GV2A 2XRLA 2JMWA 1G2HA 3ZQHA 5FJ8J 4IHYA 2DMUA 3S2DJ 2LTPA 4X6AJ 3HKZN 2R5YA 3BTJA 2FJ1A 1VF9A 1UG2A 1JKPC 1VNDA 2YU9J 3HOWJ 1I50J 2CUEA 3S17J 2L7FP 5IOZA 2CU7A 2AO9A 2X48A 4L5EA 4BBRJ 2R92J 3I4NJ 1HDPA 3GTGJ 3PO2J 3BG9A 3ZQFA 3JRBA 2CRGA 2K9QA 2Y9ZA 5IP7J 1XG1A 2JA5J 2MSYA 4S0HB 1IRZA 2DJNA 3B6CA 4C3JJ 4FE4A 2NVXJ 2LLKA 3Q0WA 2R5YB 2PMZN 3E7LA 1B8IA 2E2HJ 5C44J 3HB9A 1Y1VJ 4HNVA 2JK3A 3IH2A 2VKVA 2HQ5A 3GBGA 5F04A 5FKMA 5JLWA 4A3KJ 1JJ6C 2HOTA 4QIWN 3JRDA 1AU7A 2R5ZA 3HOUJ 4BKXA 2JA8J 4MFEA 1LE8A 2TCTA 1BA5A 3JRCA 3FK7A 5GP9A 3LNQA 3CMYA 3O8HA 1WH5A 4LOCA 4RBOA 3OSFA 1U9OA 1NTCA 4W1UA 2EZKA 2XPVA 1JKQC 1IGNA 2IEKA 3ZQCA 3I4MJ 4DZPA 1I3QJ 1JUMA 1RKTA 4I76A 3L1PA 1JTYA 3BTCA 3GTMJ 3MN2A 3CQZJ 2XB0X 2ECBA 4MFDA 2MGQA 3GTQJ 2R5ZB 3FISA 1LE8B 3RQIA 3A02A 1JJ8C 5EYRA 1EF4A 1PUFA 1FIPA 2X9DA 3RZOJ 1TWFJ 1NK3P 1Z77A 5IP6A 4G12A 2L0KA 1IDZA 2FX0A 1IV6A 3SFIA 5M3MJ 3LSRA 1E3OC 2L7ZA 2NS7A 4AC0A 2YS9A 1T56A 2JA7J 3S1NJ 1MBKA 1T33A 1ZR2A 3WHCA 5JLXA 2JJ7A 3JR9A 4GFBA 3B6AA 2R7ZJ 4JX5A 4FCYA 2HXIA 3OOUA 4JX6A 5F0HA 4M3EA 4BY1J 1PUFB 3IH4A 2ZB9A 3JRIA 1MSFC 3G1OA 2HI3A 3FIWA 2KDZA 4M3DA 1QPIA 5J1YA 2X6OA 4M3BA 3OSGA 4M6VA 2D5VA 1ORKA 3JRFA 4BY7J 5J1UA 1MBJA 1MBGA 4JX4A 2NOGA 4CYCA 4A3LJ 2DMQA 1GVDA 1U9NA 4A3EJ 3H3VK 2Y31A 1OFCX 2CJJA 3D1NI 3HOXJ 2ID6A 1BJZA 2JN6A 3BG3A 2GLOA 4A3MJ 1D5YA 2HOAA 1ITYA 2ME6A 5EG0B 1JGGA 1CQTA 1BW5A 1XC5A 5DTDA 1GUUA 2DA4A 1W0UA 3TW6A 1Y1WJ 3A01A 2H1KA 3HEFA 2CQQA 2Y30A 1JKOC 3PM1A 2LP0A 3JREA 4Y52J 2WB1N 4CYCB 1WPKA 4A3DJ 3CCYA 1U8BA 3BR1A 4FTHA 2EZHA 1MH3A 5BNGA 1K83J 2XSDC 2IBDA 3HOYJ 1ZQ3P 3M3YJ 1XS9A 2NVTJ 4BXXJ 2DMPA 2GBYA 1LFBA 3H0GJ 1TWAJ 5FLMJ 3W6VA 1F43A 3A01B 4J19A 1JTXA 1SANA 1DU6A 3CDLA 5E3LA 2O9LA 2DA6A 2M0CA 4B4CA 1ETXA 5F27A 4EEFG 2OPTA 2N8GA 3GTPJ 3Q3SA 5M3FJ 3TEDA 5M5XJ 4B1RA 4XRSA 2O8KA 4B3AA 1S7EA 3ZQLA 1R9TJ 1B8IB 4QSHA 4IEJA 2AHQA 2O7OA 5F0FA 3IV5A 4A3JJ 5M5WJ 5J3LA 2JWTA 2XB5A 3S16J 2G0EA 1LFUP 2LR8A 5FKOA 1WCMJ 2MG4A 4DYQA 4AUXA 2DMTA 3ZQGA 1VFCA 3C2BA 1YRNA 1TWCJ 1MBFA 4A3IJ 1RKWA 2FQ4A 5GPAA 1MBHA 2NVYJ 4V2FA 1P7IA 2M34A 1DU0A 1ETQA 1Q1VA 3A03A 1H8AC 2HYJA 2DA5A 2P81A 3GTKJ 4C3IJ 2TRTA 2DMNA 1U78A 1BL0A 3NAUA 4UUSA 3S1QJ 4A3BJ 2LFBA 3RKQA 5K7ZA 1A6IA 2XPWA 2LVSA 5K7FA 1IJWC 1RESA 2ID3A 4XIDA 4W97A 5M5YJ 2M2EA 1IDYA 3S1RJ 4AYBN 1IG7A 1MSEC 1ZKGA 3GTOJ 4D7MA 2XGDA 4DW6A 2WV1A 2KT0A 5C4XJ 3ZOBA 3HGGA 2XGEA 2LD5A 3QPSA 5EF6A 4FISA 1ETYA 4UUSB 5FKNA 4A3CJ 3ZQIA 4M3FA 2M8GX 5IYCJ 1POGA 2EZLA 3FK6A 1QVUA 3JRHA 4ABZA 2XGCA 3OIOA 4JP0A 1HCRA 2GM4A 4NDLA 3BR6A 5C3EJ 2WAQN 2DA3A 5F1JA 1JKRC 4JYKA 3LSJA 3JRAA 1I6HJ 4UUTA 1Z0XA 4BBSJ 1BW6A 2DA2A 1JUPA 4C3HJ 3HBLA 3WHBA 1RPWA 3HOZJ 5J1RA 3BTIA 2W48A 3HM5A 1WGXA 2VI6A 1JUSA 2OF7A 1W0TA 1FEXA 4M3GA 5FLVA 2ECCA 1AKHA 1SFOJ 2I10A 3K2AA 3QQAA 3G1LA 5EZGA 1WH7A 1FJLA 1QRYA 2R93J 2R0QC 1B72A 2VKEA 2M9HA 3JRGA 1OCTC 2YUSA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3SJM A;  2LK2 A;  3O8G A;  4D7N A;  2QF7 A;  2ME0 A;  3LOC A;  3TP3 A;  1A5J A;  2QCO A;  4MIM A;  3BR2 A;  1OJL A;  2L7M P;  1MH4 A;  1IUF A;  4I6Z A;  5FKL A;  3M4O J;  1ZTR A;  5EEA A;  1APL C;  2FD5 A;  2NS8 A;  3IH3 A;  1OCP A;  1X2N A;  1AKH B;  2E2I J;  2H8R A;  3BR0 A;  3K7A J;  3MKL A;  2LKX A;  1ETK A;  1X58 A;  1RR7 A;  1ETV A;  1TWG J;  2IAI A;  3QPL A;  2DTZ A;  1QVT A;  3TW7 A;  1FIA A;  3UKG A;  1B72 B;  2HDD A;  4V2G A;  5HOD A;  1HOM A;  2NVQ J;  4C2M J;  1VI0 A;  2E19 A;  1ZGW A;  4X1E A;  1GV5 A;  2K9N A;  1WI3 A;  3VPR A;  4XRM A;  5E3N A;  5EZH A;  5IPA A;  3BT9 A;  5E3M A;  3BTL A;  3G1M A;  4QTR A;  2E2J J;  4XK4 A;  4IHX A;  1ETW A;  2CQX A;  2VUM J;  3BR3 A;  4D5C A;  1UMQ A;  5F0C A;  2MW8 A;  5C4J J;  1GDT A;  2JA6 J;  9ANT A;  1JT0 A;  1MNM C;  1ZR4 A;  5E3O A;  3GTJ J;  2EZI A;  3SDG A;  5IYB J;  3GTL J;  1ETO A;  2EQR A;  3NAR A;  1AHD P;  4A69 C;  2L9R A;  5IP9 J;  1FTT A;  3S14 J;  4FE7 A;  3BQZ A;  2K40 A;  1K61 A;  1NK2 P;  2VPR A;  1P7J A;  2ELK A;  4RDU A;  1UHS A;  2K9S A;  3Q0V A;  3Q0U A;  1H88 C;  5FKK A;  3FKI J;  4MO7 A;  1F36 A;  4D5F A;  2HOS A;  4DYR A;  2Y0S N;  2COB A;  1IC8 A;  1ENH A;  4IHW A;  1YRN B;  3BR5 A;  4MLO A;  4DYC A;  2DN0 A;  2HXO A;  5F08 A;  3S15 J;  5IYD J;  4XRS G;  4XIC A;  1X2M A;  1ZK8 A;  2DA1 A;  2XPU A;  5GPC A;  1FTZ A;  3BQY A;  1MBE A;  5EGO A;  3DEW A;  5K7H A;  3HDD A;  2EH3 A;  2Y2Z A;  5IOY A;  4Y7N J;  1HF0 A;  3HOV J;  4IHV A;  1HLV A;  5EDN A;  1JT6 A;  4A3G J;  3PO3 J;  4A3F J;  3RZD J;  2DA7 A;  3TP0 A;  1RET A;  3S1M J;  4A93 J;  3MVP A;  2EBI A;  3BG5 A;  3LSP A;  2CUF A;  1H89 C;  3S2H J;  3F0C A;  5EG0 A;  2LY9 A;  3DCF A;  1GT0 C;  2E1O A;  4DZJ A;  1HDD C;  3HGY A;  1TWH J;  1TC3 C;  5DS9 A;  2RAE A;  2B63 J;  5EGO B;  2Y9Y A;  3LSG A;  1O4X A;  1GV2 A;  2XRL A;  2JMW A;  1G2H A;  3ZQH A;  5FJ8 J;  4IHY A;  2DMU A;  3S2D J;  2LTP A;  4X6A J;  3HKZ N;  2R5Y A;  3BTJ A;  2FJ1 A;  1VF9 A;  1UG2 A;  1JKP C;  1VND A;  2YU9 J;  3HOW J;  1I50 J;  2CUE A;  3S17 J;  2L7F P;  5IOZ A;  2CU7 A;  2AO9 A;  2X48 A;  4L5E A;  4BBR J;  2R92 J;  3I4N J;  1HDP A;  3GTG J;  3PO2 J;  3BG9 A;  3ZQF A;  3JRB A;  2CRG A;  2K9Q A;  2Y9Z A;  5IP7 J;  1XG1 A;  2JA5 J;  2MSY A;  4S0H B;  1IRZ A;  2DJN A;  3B6C A;  4C3J J;  4FE4 A;  2NVX J;  2LLK A;  3Q0W A;  2R5Y B;  2PMZ N;  3E7L A;  1B8I A;  2E2H J;  5C44 J;  3HB9 A;  1Y1V J;  4HNV A;  2JK3 A;  3IH2 A;  2VKV A;  2HQ5 A;  3GBG A;  5F04 A;  5FKM A;  5JLW A;  4A3K J;  1JJ6 C;  2HOT A;  4QIW N;  3JRD A;  1AU7 A;  2R5Z A;  3HOU J;  4BKX A;  2JA8 J;  4MFE A;  1LE8 A;  2TCT A;  1BA5 A;  3JRC A;  3FK7 A;  5GP9 A;  3LNQ A;  3CMY A;  3O8H A;  1WH5 A;  4LOC A;  4RBO A;  3OSF A;  1U9O A;  1NTC A;  4W1U A;  2EZK A;  2XPV A;  1JKQ C;  1IGN A;  2IEK A;  3ZQC A;  3I4M J;  4DZP A;  1I3Q J;  1JUM A;  1RKT A;  4I76 A;  3L1P A;  1JTY A;  3BTC A;  3GTM J;  3MN2 A;  3CQZ J;  2XB0 X;  2ECB A;  4MFD A;  2MGQ A;  3GTQ J;  2R5Z B;  3FIS A;  1LE8 B;  3RQI A;  3A02 A;  1JJ8 C;  5EYR A;  1EF4 A;  1PUF A;  1FIP A;  2X9D A;  3RZO J;  1TWF J;  1NK3 P;  1Z77 A;  5IP6 A;  4G12 A;  2L0K A;  1IDZ A;  2FX0 A;  1IV6 A;  3SFI A;  5M3M J;  3LSR A;  1E3O C;  2L7Z A;  2NS7 A;  4AC0 A;  2YS9 A;  1T56 A;  2JA7 J;  3S1N J;  1MBK A;  1T33 A;  1ZR2 A;  3WHC A;  5JLX A;  2JJ7 A;  3JR9 A;  4GFB A;  3B6A A;  2R7Z J;  4JX5 A;  4FCY A;  2HXI A;  3OOU A;  4JX6 A;  5F0H A;  4M3E A;  4BY1 J;  1PUF B;  3IH4 A;  2ZB9 A;  3JRI A;  1MSF C;  3G1O A;  2HI3 A;  3FIW A;  2KDZ A;  4M3D A;  1QPI A;  5J1Y A;  2X6O A;  4M3B A;  3OSG A;  4M6V A;  2D5V A;  1ORK A;  3JRF A;  4BY7 J;  5J1U A;  1MBJ A;  1MBG A;  4JX4 A;  2NOG A;  4CYC A;  4A3L J;  2DMQ A;  1GVD A;  1U9N A;  4A3E J;  3H3V K;  2Y31 A;  1OFC X;  2CJJ A;  3D1N I;  3HOX J;  2ID6 A;  1BJZ A;  2JN6 A;  3BG3 A;  2GLO A;  4A3M J;  1D5Y A;  2HOA A;  1ITY A;  2ME6 A;  5EG0 B;  1JGG A;  1CQT A;  1BW5 A;  1XC5 A;  5DTD A;  1GUU A;  2DA4 A;  1W0U A;  3TW6 A;  1Y1W J;  3A01 A;  2H1K A;  3HEF A;  2CQQ A;  2Y30 A;  1JKO C;  3PM1 A;  2LP0 A;  3JRE A;  4Y52 J;  2WB1 N;  4CYC B;  1WPK A;  4A3D J;  3CCY A;  1U8B A;  3BR1 A;  4FTH A;  2EZH A;  1MH3 A;  5BNG A;  1K83 J;  2XSD C;  2IBD A;  3HOY J;  1ZQ3 P;  3M3Y J;  1XS9 A;  2NVT J;  4BXX J;  2DMP A;  2GBY A;  1LFB A;  3H0G J;  1TWA J;  5FLM J;  3W6V A;  1F43 A;  3A01 B;  4J19 A;  1JTX A;  1SAN A;  1DU6 A;  3CDL A;  5E3L A;  2O9L A;  2DA6 A;  2M0C A;  4B4C A;  1ETX A;  5F27 A;  4EEF G;  2OPT A;  2N8G A;  3GTP J;  3Q3S A;  5M3F J;  3TED A;  5M5X J;  4B1R A;  4XRS A;  2O8K A;  4B3A A;  1S7E A;  3ZQL A;  1R9T J;  1B8I B;  4QSH A;  4IEJ A;  2AHQ A;  2O7O A;  5F0F A;  3IV5 A;  4A3J J;  5M5W J;  5J3L A;  2JWT A;  2XB5 A;  3S16 J;  2G0E A;  1LFU P;  2LR8 A;  5FKO A;  1WCM J;  2MG4 A;  4DYQ A;  4AUX A;  2DMT A;  3ZQG A;  1VFC A;  3C2B A;  1YRN A;  1TWC J;  1MBF A;  4A3I J;  1RKW A;  2FQ4 A;  5GPA A;  1MBH A;  2NVY J;  4V2F A;  1P7I A;  2M34 A;  1DU0 A;  1ETQ A;  1Q1V A;  3A03 A;  1H8A C;  2HYJ A;  2DA5 A;  2P81 A;  3GTK J;  4C3I J;  2TRT A;  2DMN A;  1U78 A;  1BL0 A;  3NAU A;  4UUS A;  3S1Q J;  4A3B J;  2LFB A;  3RKQ A;  5K7Z A;  1A6I A;  2XPW A;  2LVS A;  5K7F A;  1IJW C;  1RES A;  2ID3 A;  4XID A;  4W97 A;  5M5Y J;  2M2E A;  1IDY A;  3S1R J;  4AYB N;  1IG7 A;  1MSE C;  1ZKG A;  3GTO J;  4D7M A;  2XGD A;  4DW6 A;  2WV1 A;  2KT0 A;  5C4X J;  3ZOB A;  3HGG A;  2XGE A;  2LD5 A;  3QPS A;  5EF6 A;  4FIS A;  1ETY A;  4UUS B;  5FKN A;  4A3C J;  3ZQI A;  4M3F A;  2M8G X;  5IYC J;  1POG A;  2EZL A;  3FK6 A;  1QVU A;  3JRH A;  4ABZ A;  2XGC A;  3OIO A;  4JP0 A;  1HCR A;  2GM4 A;  4NDL A;  3BR6 A;  5C3E J;  2WAQ N;  2DA3 A;  5F1J A;  1JKR C;  4JYK A;  3LSJ A;  3JRA A;  1I6H J;  4UUT A;  1Z0X A;  4BBS J;  1BW6 A;  2DA2 A;  1JUP A;  4C3H J;  3HBL A;  3WHB A;  1RPW A;  3HOZ J;  5J1R A;  3BTI A;  2W48 A;  3HM5 A;  1WGX A;  2VI6 A;  1JUS A;  2OF7 A;  1W0T A;  1FEX A;  4M3G A;  5FLV A;  2ECC A;  1AKH A;  1SFO J;  2I10 A;  3K2A A;  3QQA A;  3G1L A;  5EZG A;  1WH7 A;  1FJL A;  1QRY A;  2R93 J;  2R0Q C;  1B72 A;  2VKE A;  2M9H A;  3JRG A;  1OCT C;  2YUS A; 
#chains in the Genus database with same CATH topology
 4LK0 F;  3H1C A;  2K7L A;  2B7E A;  3O8G A;  2QF7 A;  3TGN A;  5L3G A;  2VC1 A;  4ENJ A;  3BR2 A;  3EDP A;  5D8L B;  1V55 H;  1T95 A;  1MH4 A;  1IUF A;  5E8I A;  2VQG A;  2R7X A;  1G59 A;  3R0A A;  4MTD A;  2JRT A;  1OCP A;  1Z6T A;  3LSH A;  5B1B H;  3ML6 A;  3WU0 A;  1XB4 A;  2KKO A;  3BR0 A;  3K7A J;  2Z1D A;  1J2X A;  2LKX A;  4H0E A;  1QA6 A;  3IAS 2;  3T8R A;  2M7B A;  3TW7 A;  5CQE A;  3QOE A;  1DPR A;  4V2G A;  2DI3 A;  4AWX B;  4XMY A;  5JI6 A;  2K9N A;  1HKS A;  5E3N A;  2LNB A;  3HHG A;  3MD2 A;  1T2K A;  1TP4 A;  5EZH A;  5LBQ A;  5IPA A;  4CZC A;  1XGM A;  2MFZ A;  3BTL A;  3G1M A;  4QTR A;  3OS1 A;  1VQM I;  4GXO A;  2PJR B;  2AS5 F;  2VUM J;  1ETW A;  2X1C A;  1UMQ A;  1MDM A;  5C4J J;  3RI4 A;  2JA6 J;  2P7V B;  1MJA A;  1FT9 A;  1ZR4 A;  2ZNZ A;  3PNT A;  1P92 A;  3SDG A;  4AU7 A;  2E5Z A;  1WRJ A;  2VBY A;  2R7U A;  2BYV E;  3HSF A;  3AAF A;  1Z7U A;  3NAR A;  2EK5 A;  4BGD A;  2VE8 A;  4RDU A;  1P4X A;  1XGO A;  2K4B A;  4WCG A;  5DM7 F;  3Q0U A;  1C0W A;  1H88 C;  2YU3 A;  2HPI A;  2H27 A;  2Q2E A;  4D5F A;  4I98 B;  4DYR A;  2WV0 A;  2MLK A;  2COB A;  2VL8 A;  3BJO A;  3LQQ A;  1YRN B;  2XKP A;  1YTY A;  1RNL A;  3GME A;  2CH0 A;  3EUA A;  5IYD J;  4XRS G;  4BHC A;  2ZJ2 A;  1KYZ A;  5JFR A;  5LGN A;  4HDU A;  5FD5 A;  1BI3 A;  1QPM A;  1FTZ A;  5FLX Z;  2ADU A;  1Z9C A;  4XLP F;  3C1D A;  4BXU A;  5K7H A;  3HDD A;  2ZJP F;  1HF0 A;  4Y7N J;  3S3O A;  1HSJ A;  2ZO4 A;  2WA0 A;  2X0L A;  2DK8 A;  4BL0 B;  2GA2 A;  4D0P A;  3TP0 A;  4XLE A;  2M5W A;  4L9J A;  1IRX A;  4Y15 A;  1OYI A;  3OYM A;  4A93 J;  2XSJ C;  2EBI A;  3LSP A;  1YE9 A;  1LQ1 A;  2Y48 A;  3DCF A;  1RRJ A;  2QVO A;  2FNA A;  2F2E A;  1R6R A;  3HGY A;  3CO7 C;  1VQN I;  2HOE A;  1TC3 C;  3F3X A;  4AIJ A;  2B63 J;  1ZG3 A;  2OCC H;  1SD6 A;  2Y9Y A;  3AKZ A;  3LSG A;  2XRL A;  2JMW A;  3L2C A;  2XRN A;  2RGV A;  5FJ8 J;  1IXR C;  1AOY A;  3S2D J;  2LTP A;  1MIJ A;  4HX4 A;  2DLL A;  1K78 B;  1FYM A;  1VF9 A;  3QAH A;  1VND A;  2YU9 J;  2CUE A;  1OR7 A;  3V7R A;  1HXD A;  3J7Z I;  2P5V A;  4NC8 A;  4B47 A;  1OCR H;  2CU7 A;  3FXO A;  2X48 A;  4L5E A;  2F6C A;  3HXL A;  3S3M A;  2DTR A;  2R7W A;  2JT1 A;  3GTG J;  2PQ8 A;  3KE2 A;  3U1K A;  5CPR B;  2VOD A;  4OU0 A;  1R5H A;  2W1O A;  4BNC A;  5GAE J;  1U2W A;  1QZE A;  3HRS A;  2JA5 J;  1WWX A;  1X4O A;  1WJC A;  1R5I D;  4EM2 A;  5J47 A;  3KP4 A;  1OR7 C;  2WWY A;  2WBM A;  1MMA A;  3OL3 A;  3V8L A;  4C3J J;  5HLG A;  1IAW A;  2NVX J;  3ZRG A;  2R5Y B;  2CMP A;  4IO9 F;  2GOM A;  2PMU A;  3E7L A;  4WXC A;  2DOE A;  3H5R A;  1B8I A;  3NQO A;  4O6J A;  5C44 J;  2BZT A;  1OCC H;  2BEO A;  4U88 A;  3K0L A;  3PL8 A;  3L2V A;  2HQ5 A;  1SMT A;  2NXN B;  2OU2 A;  1OCZ H;  4QIW N;  1FSE A;  5HS9 A;  4NNJ A;  3JRD A;  4GDF A;  4L0Z B;  2RDP A;  2MYS A;  4BKX A;  3L2R A;  2JA8 J;  1HW5 A;  1XD7 A;  2TCT A;  1BR4 A;  3CMY A;  4M9S A;  3HOS A;  3CME I;  3P9I A;  4YIR X;  2V6C A;  3CJR B;  3OSF A;  2K02 A;  3BC8 A;  1FX7 A;  1D1A A;  4RB1 A;  3F8B A;  1NG7 A;  1U6G A;  4NUB A;  4KIC A;  3H92 A;  3BTC A;  3VYS B;  1B9M A;  1Z91 A;  3EUH A;  2RV8 A;  4II2 A;  3OY9 A;  2XB0 X;  1P9Q C;  2LF7 A;  4MFD A;  3PQJ A;  3KLN A;  3DLA A;  2R5Z B;  3I71 A;  1KYW A;  1RUN A;  3RQI A;  3A02 A;  2OQG A;  3N97 A;  3RZO J;  1TWF J;  2LG4 A;  2IT0 A;  3U2R A;  1QBJ A;  1FP1 D;  1MJ9 A;  3KP6 A;  5LFA A;  4F92 B;  2ESN A;  2LC2 A;  2E1M C;  3EUH C;  4YEJ A;  4I0B A;  4KMU X;  3SZP A;  3RKY A;  1Z05 A;  3WE3 A;  5M3M J;  4C2T A;  2R7V A;  4LB6 B;  4YFK F;  4PJM A;  2L7Z A;  5CKT A;  2GA1 A;  1WZ2 A;  4GRI A;  4ZDO A;  4AC0 A;  4HLX A;  2YS9 A;  1T56 A;  1MBK A;  3KZY A;  2K85 A;  4HYE A;  5JVT A;  2CUJ A;  2Y0S A;  2HTS A;  2ZNY A;  3I58 A;  4CCL A;  2ISZ A;  2XAG A;  3MFK A;  1OQY A;  5ILU A;  3DTI A;  1P6R A;  1YLF A;  4XSX F;  1U5T A;  2Q2E B;  5F0H A;  1PUF B;  3IH4 A;  2F5V A;  2ZB9 A;  1MSF C;  2KRF A;  3QP5 A;  3FIW A;  2EFO A;  1TNS A;  2KDZ A;  4M3D A;  5A2Q Z;  5HLI A;  1WHU A;  2W25 A;  4M6V A;  4EM1 A;  2L9S A;  3V8K A;  4BY7 J;  1O3R A;  4G94 A;  2FE3 A;  1U5T C;  4E7Z A;  4AVZ A;  4A3L J;  1GVD A;  1B59 A;  1U9N A;  2A6T A;  5DM6 F;  1FPQ A;  4OWR B;  1VQL I;  1SD4 A;  3OYK A;  1S29 A;  4CUG A;  3H3V K;  2STW A;  2EIN H;  3K10 A;  4C30 A;  3BG3 A;  3I59 A;  4A3M J;  2XVC A;  1T38 A;  1YI2 I;  3RIR A;  2DW4 A;  4A0Z A;  4XSZ F;  1CQT A;  2BY3 A;  2EIK H;  1XC5 A;  2KQR A;  4JK1 X;  2V4J C;  2DA4 A;  4E7I A;  2VPL A;  2AQE A;  5H6Q A;  3MKY B;  2A05 A;  2Y30 A;  3PM1 A;  3JRE A;  3QOP A;  4IKF A;  4MGR A;  2LKP A;  2DQL A;  1ZG1 A;  2DJI A;  4CYC B;  4ZTJ A;  1W1W E;  4A3D J;  5D8K B;  3BDD A;  1MZB A;  4XLH A;  1Y0N A;  2VT3 A;  1MH3 A;  1FYK A;  2GXB A;  1FMV A;  2XSD C;  2VOP A;  4CA0 A;  1ZQ3 P;  1XS9 A;  3W2A A;  3KFW X;  4WX9 A;  2GBY A;  3KZZ A;  4RAF A;  1VQO I;  2FXA A;  3CLQ A;  4LIU A;  5FLM J;  1YG2 A;  4XQF A;  5E20 A;  2X51 A;  3FXU A;  5D5V B;  4J19 A;  4CCK A;  1SAN A;  2Z3Y A;  5E3L A;  1G3W A;  1YW8 A;  1Y39 A;  1ETX A;  5F27 A;  5B3S H;  2W57 A;  4L9T A;  1XCB A;  4P9U A;  2OPT A;  1J0R A;  2E71 A;  4U0W A;  5HS7 A;  3K69 A;  3Q3S A;  3OR1 C;  5M5X J;  2Z99 A;  3LA3 A;  4H4K C;  1FBS A;  4HNU A;  2V6E A;  3A2K A;  3ERM A;  1IO2 A;  3CCJ I;  1A04 A;  2K4J A;  4IEJ A;  4OMZ A;  1B8I B;  4A5M A;  3DV8 A;  2HFH A;  4IJA A;  2ZCW A;  4V19 K;  3QU3 A;  3E0J B;  5J3L A;  2XB5 A;  3L2W A;  4BDY A;  3S16 J;  2OCE A;  2LR8 A;  2JTV A;  4CGZ A;  3I54 A;  2R7S A;  4OIN F;  2FEZ A;  1QHG A;  2DMT A;  2KJB A;  5HNH A;  5FRM A;  3ZQG A;  2KIF A;  3C2B A;  1FBU A;  2A5W A;  2R7Q A;  4NBQ A;  4A3I J;  2RNG A;  5GPA A;  4OIR F;  1MBH A;  2FF4 A;  2NVY J;  1P7I A;  2ZJR F;  1DU0 A;  1Q1V A;  1RC9 A;  1XX5 A;  1KA8 A;  3BG6 A;  3CCE I;  3GTK J;  4XR6 A;  4EJT A;  4BEH A;  1Z67 A;  2V7F A;  3DU6 A;  1U78 A;  2M3A A;  2QQA A;  1MW7 A;  1BL0 A;  4OOI A;  3S1Q J;  4OIQ F;  3RKQ A;  2NS0 A;  1BC8 C;  1XMK A;  1A35 A;  3DKW A;  2QKL B;  1ZN2 A;  2K27 A;  1IXS B;  2JPC A;  5LHG A;  1TQP A;  2KHM A;  3WGH A;  3RYP A;  4B48 A;  3GTO J;  2O0Y A;  1OKR A;  2KT0 A;  4LLG F;  1HW1 A;  2MC3 A;  3HRM A;  2YPR A;  1RR8 C;  4M74 A;  1I27 A;  3CDI A;  1ONV A;  2IPQ X;  3DKY A;  5FKN A;  4A6E A;  3F22 A;  2HKX A;  2M87 A;  2EV5 A;  2M7A A;  3GLX A;  3BP8 A;  3ASN H;  3JRH A;  1W5C C;  4LLL A;  4EQQ A;  3E6B A;  3NWT A;  3FDY A;  2GM4 A;  1I39 A;  1D8K A;  2QLZ A;  4ZH4 F;  2VBW A;  1EH8 A;  4Y4R A;  1GLN A;  3LSJ A;  3H0D A;  2L4A A;  3MZY A;  1V5F A;  2LBF A;  3DXJ F;  4GGG A;  3U21 A;  4HZF A;  1O57 A;  1XTA A;  1UST A;  2UUZ A;  3FXK A;  1HBX G;  2DCE A;  3GW2 A;  3GZN B;  3H3U A;  5LD2 C;  2IS4 A;  2W48 A;  3HM5 A;  3MQ0 A;  4YIF A;  2BE5 F;  3FXJ A;  3JCU C;  4E4H A;  1VQ5 I;  4DNC A;  4PDK A;  1KU7 A;  4E7S A;  5DD8 A;  5DYM A;  3LL7 A;  5F64 A;  3K2A A;  1ZRC A;  1CGP A;  2ZBK A;  5EZG A;  1FJL A;  4OMY A;  5J4V A;  1QRY A;  4I09 A;  2W4S A;  2GIV A;  5CVU A;  2R0Q C;  2WAE A;  1B1B A;  3HJE A;  2M9H A;  3AG4 H;  2IXS A;  2CQN A;  3PQK A;  2LY2 A;  2VQH A;  2ETH A;  3CZ6 A;  3VYU B;  4KDP A;  4O5V A;  4PJ0 C;  4IF4 A;  2ME0 A;  3LOC A;  4UB8 C;  2QCO A;  3O6B B;  1FWZ A;  4MIM A;  3WTY C;  2UZK A;  2PJR A;  3K6G A;  1ZEL A;  1R4M B;  2FD5 A;  4L18 B;  3IH3 A;  2E2I J;  1UHM A;  2M4K A;  1VQK I;  3EYI A;  1TWG J;  3SZT A;  3QPL A;  1HOM A;  3HUG A;  3DQV C;  5FRO A;  3PSI A;  2X6X A;  3RQ4 A;  4UXN A;  4X1E A;  4DOZ A;  1GV5 A;  3VPR A;  1SAX A;  1GHC A;  3CP2 A;  4BXF A;  2G9W A;  1REP C;  3BLY A;  1XSX A;  3FM5 A;  4FT8 A;  1MMN A;  2H94 A;  1IRG A;  1TBX A;  3FKJ A;  4KIB A;  3CC4 I;  5GTI C;  2XKO A;  4HW0 A;  2DO7 A;  1E3H A;  1XDU A;  3BR3 A;  3CJN A;  4D5C A;  5HVQ C;  2MW8 A;  5D5W B;  1P2F A;  5GAG J;  1GDT A;  9ANT A;  2PN6 A;  4CXF A;  5E3O A;  3ZGK A;  4HF0 A;  2EZI A;  4XNF A;  2QSH X;  2OAZ A;  4IOC F;  1FOW A;  4XOP A;  2V9P A;  1AHD P;  1UB9 A;  2L9R A;  1Z3Y A;  3F9K A;  5IP9 J;  3IKT A;  4BE1 A;  3S14 J;  2K40 A;  3DKX A;  1P7J A;  1IN4 A;  2ELK A;  1XMX A;  1R71 A;  4E7H A;  3QPT A;  5FKK A;  5F6F A;  3HIF A;  1SD7 A;  4CSW A;  2KZG A;  5JR3 A;  3GFJ A;  3DF8 A;  4BAC A;  2Y0S N;  4BHB A;  1FMW A;  2KJC A;  1O7F A;  1UG0 A;  1ENH A;  3KX2 A;  1IC8 A;  1OLT A;  4U87 A;  5L3E A;  4YRV A;  2G7H A;  3EET A;  3CMA I;  1V3F A;  2X85 A;  4DYC A;  2DU9 A;  1W5S A;  2HU9 A;  2XDV A;  2XPU A;  3F6V A;  2F48 A;  3KPH A;  3OV8 A;  1K4T A;  4BJ6 C;  1SFX A;  4HQM A;  5E1Z B;  4G7Z F;  3V7C A;  3CJT B;  2EV6 A;  2Y2Z A;  4XBF A;  3F8N A;  3HOV J;  3E3V A;  3JTH A;  1HLV A;  1I3A A;  5EDN A;  1JT6 A;  4AYB A;  4X0G A;  1YJW I;  4A3G J;  3K1N A;  3I9V 2;  1YX3 A;  5KAI C;  2DA7 A;  2LY1 A;  2BXY A;  3GXO A;  3DEE A;  3OR2 C;  2PLY A;  2E60 A;  4M71 A;  1EA3 A;  1ACI A;  3BG5 A;  3DEU A;  5J8C A;  3NRV A;  2CUF A;  1U0J A;  1GT0 C;  4F3Q A;  2FBH A;  4XKV A;  5DUK A;  2IA2 A;  2DT7 B;  1HDD C;  3ROU A;  4A6D A;  1TWH J;  3V4G A;  2A07 F;  1YQA A;  3ZP5 A;  2CV2 A;  2BOL A;  5CQG A;  4IX7 A;  2IP2 A;  1GV2 A;  4NHJ A;  5L3D A;  4IXA A;  2B9S A;  3FXR A;  4X6A J;  3RCO A;  3BTJ A;  2R5Y A;  1U8R A;  3M7G A;  1N75 A;  4ZTF A;  2FJ1 A;  2YSR A;  1ZRD A;  1ON2 A;  1ZLJ A;  2PMH A;  2L7F P;  3P7N A;  5IOZ A;  2Z33 A;  4CZZ A;  1V5G A;  1RI7 A;  2LBF B;  2R92 J;  2I8D A;  1W36 D;  4HX7 A;  4CCM A;  1FC3 A;  3BG9 A;  3LSI A;  3Q9V A;  3JRB A;  4BJ5 C;  2MD0 A;  2E1N A;  2CRG A;  4HX8 A;  2OQR A;  3M8E A;  3DBH B;  3FM3 A;  2DOD A;  3KEO A;  4MNU A;  3W2W A;  3I55 I;  1IRZ A;  1HKT A;  3ONQ A;  2FNP A;  4N9H A;  5LLQ A;  5BPI A;  3Q0W A;  1NHA A;  2A3S A;  4HA8 A;  3HB9 A;  1LVA A;  1IV8 A;  1Y1V J;  3MWM A;  4OIO F;  3O3K A;  5DD4 A;  3IH2 A;  1BI2 A;  3F21 A;  3TO7 A;  2VKV A;  3H35 A;  3CCM I;  3GBG A;  2L3D A;  5A2Q K;  5ICF A;  5ICG A;  4A3K J;  2O03 A;  1JJ6 C;  1OYY A;  3RYR A;  2OA4 A;  4EJO A;  3IRQ A;  1AU7 A;  2R5Z A;  3VWB A;  3KZI C;  3IUO A;  2IS6 A;  3PFY A;  5D4R A;  3PNV A;  4MFE A;  2W00 A;  1DUX C;  2A6H F;  4LB5 A;  3R60 A;  4OAY A;  3LNQ A;  2W85 A;  1FOK A;  3O8H A;  1O3T A;  2FBI A;  4RBO A;  2EIJ H;  3OYH A;  2XF7 A;  3PJR A;  4LD5 A;  5J6X A;  2IGO A;  2EZK A;  2XPV A;  1JKQ C;  1IGN A;  2DBB A;  3ZQC A;  3I4M J;  1KZH A;  5ILS A;  1JHH A;  1JUM A;  2RNJ A;  5FFX A;  4RS8 A;  4I76 A;  3S32 A;  1JTY A;  1X1B A;  4FQG A;  2AXT C;  1YFH A;  4XON A;  3HUG B;  3KP5 A;  4GCV A;  3FMQ A;  3DTE A;  4P96 A;  2MGQ A;  1S9H A;  3I4P A;  4P55 A;  4ZYA A;  2NAZ A;  1LE8 B;  4G6T B;  4UV8 A;  1PUF A;  1FIP A;  1EF4 A;  5B1A H;  3GCM A;  2XAS A;  1SEU A;  3VSK A;  3R61 A;  4BQQ A;  3PSF A;  2GWR A;  1IV6 A;  1BOA A;  2RVC A;  3LSR A;  1ERD A;  3P9K A;  1XPX A;  4BAY A;  2EV0 A;  1E3O C;  1RIO H;  3RPU A;  3JSP A;  4PFO A;  1VZ0 A;  3MKW B;  3TO6 A;  2JA7 J;  3S1N J;  1T33 A;  5JLX A;  1UCR A;  2DOF A;  4XL9 A;  3TDZ C;  5HNF A;  2R7Z J;  3B6A A;  1J9I A;  3OL4 A;  2XRO A;  3OOU A;  4JX6 A;  4M3E A;  3KYD B;  2QEN A;  3CC7 I;  1E2X A;  3BZ6 A;  3VB2 A;  1ZHF A;  4ESF A;  4KIT B;  1UEL B;  4XKC A;  5FRN A;  1QPI A;  1BJA A;  5J1Y A;  1E17 A;  4LIV A;  2X6O A;  3WGI A;  2MC4 A;  2RC4 A;  3A4C A;  3EYY A;  3QP6 A;  2D5V A;  4Q47 A;  1LEA A;  3JRF A;  4A0X A;  3UR3 C;  3C18 A;  5J1U A;  3D5R C;  1J75 A;  3ZMU A;  4E70 A;  4CYC A;  1BIB A;  1HW2 A;  3RSN A;  4IRH A;  1G8X A;  2Y31 A;  4Z2Y A;  2C6Y A;  2HWV A;  4EV0 A;  1Y56 A;  1V4R A;  1SVO A;  1MJB A;  2ID6 A;  1BJZ A;  3LA2 A;  1X4P A;  4EJV A;  2JN6 A;  2BY1 A;  2GLO A;  4OAZ A;  2HOA A;  3TQN A;  3IRR A;  1IN5 A;  5HDK A;  1P4W A;  3K1P A;  3I3L A;  2EJR A;  1WJF A;  2XAF A;  2X4H A;  2H1K A;  2NRA C;  1XSV A;  3HOT A;  2DPD A;  2LP0 A;  1F4K A;  2FML A;  3HZJ A;  3ZMD A;  3LST A;  1R5G A;  2HR3 A;  3HKZ A;  2GOX B;  3C2G A;  3BZC A;  1H9T A;  4HV6 A;  1Z3X A;  1U8B A;  1D0Z A;  5AON A;  4RLF A;  4DBQ A;  2EZH A;  5D5U B;  2CQ7 A;  2FUG 2;  1GXP A;  2QBY A;  3PIO F;  4KIS A;  4DJA A;  1R49 A;  2F5C A;  3G3Z A;  3GF2 A;  2OD5 A;  4AID A;  1LB2 A;  4L0Y B;  2FU4 A;  4UVB A;  2P0W A;  1G6N A;  3H0G J;  3HPG A;  3J7A Y;  1QQI A;  2IA0 A;  3W6V A;  2G7U A;  2R7R A;  4E7J A;  1O3Q A;  1S7O A;  2M4G A;  1JTX A;  3CDL A;  5L3B A;  2KRC A;  2DA6 A;  2FOW A;  3K4K A;  4B4C A;  5FB2 A;  1ZAO A;  3OYI A;  4U0Y A;  2ISY A;  1CF7 A;  3GTP J;  5KCM A;  3F8C A;  4YFN F;  3TED A;  1P4A A;  1IUY A;  4ASN A;  2V1D A;  4BE0 A;  2O8K A;  1IN8 A;  3ZQL A;  5E17 F;  3SEQ A;  1KQ9 A;  1T6S A;  1FNN A;  3WU2 C;  2VJ5 A;  4EVI A;  3CTA A;  3I53 A;  5ICC A;  3IV5 A;  4BDZ A;  4A3J J;  5M5W J;  4B3X A;  4WXD A;  2JWT A;  3CCV I;  5H2F C;  1MGT A;  2G0E A;  3JSO A;  3K4J A;  5FKO A;  4NC6 A;  3RJP A;  1WCM J;  2R7D A;  3ABT A;  3MAJ A;  3W3C A;  3BG7 A;  4QPQ A;  4IVN A;  3VYR B;  3OIP A;  4AUX A;  3A1Y A;  2PG4 A;  3HYI A;  1VFC A;  3GVA A;  1E0E A;  3PNY A;  3VOD A;  2H8W A;  1Y6I A;  2LH9 A;  2W82 A;  4L9N A;  2AQF A;  1S8N A;  2ZFW A;  4V2F A;  2VBX A;  2ZXH A;  3A03 A;  4RM3 A;  3RPU D;  2Z16 A;  2DA5 A;  3D5S C;  4C9Y A;  3OYC A;  4HRI A;  2QQ8 A;  3JW4 A;  4ETS A;  2UXX A;  1AWC A;  1A6I A;  4G9Y A;  3ASO H;  3ULQ B;  1SMY F;  4W97 A;  4XID A;  4LG0 B;  4NQW B;  2M2E A;  2QM3 A;  5HLH A;  4AYB N;  4OIP F;  5TIS C;  1IG7 A;  4B44 A;  2BHY A;  1LDD A;  2VQL A;  4KIG A;  2LMD A;  2R7F A;  2QEX I;  2WV1 A;  1Z1D A;  1T08 B;  5C4X J;  2FRH A;  4YEL A;  3ZOB A;  3HGG A;  2XGE A;  4BYY A;  1I1G A;  1H0M A;  4LJZ F;  2V1N A;  4GYI A;  4FIS A;  1ON1 A;  2MH9 A;  2DFF A;  4N9I A;  1M1E B;  4M3F A;  3ZQI A;  1YIO A;  3K70 C;  1I6X A;  4Y3O A;  3CLO A;  1POG A;  2EZL A;  3CJQ B;  2L5Q A;  4G7O F;  4ABZ A;  3Q9S A;  2BHZ A;  4KIF A;  3CUQ B;  3B73 A;  5IY5 H;  3BR6 A;  2F5E A;  2DA3 A;  2K9M A;  5F1J A;  3EQL F;  5FFZ A;  4DIQ A;  1EH6 A;  4A5N A;  2CG4 A;  1ZLK A;  1B4A A;  1R22 A;  4UUT A;  3LAP A;  1Z0X A;  5DUI A;  4BBS J;  2DA2 A;  2K3F A;  2V26 A;  4C3H J;  3WHB A;  3P5J A;  5J1R A;  3FZV A;  3L7W A;  1JE8 A;  1R00 A;  2PJP A;  1WGX A;  2VI6 A;  5L3C A;  4LFU A;  4E6K G;  2NOJ B;  1JGS A;  3EUK L;  2OF7 A;  1W0T A;  4O3M A;  1FEX A;  1S72 I;  5FLV A;  2OTL I;  1HKQ A;  2HZD A;  3QQA A;  5D5X B;  1K4S A;  4XN0 A;  1WH7 A;  4UB6 C;  1V54 H;  2ZJQ F;  2A5Y B;  4LLN A;  4PZJ A;  2E36 A;  1MKM A;  3B02 A;  2OV7 A;  2IGM A;  3SJM A;  3SYT A;  3OMY A;  3GUD A;  4RB2 C;  4D7N A;  1D5V A;  2Z2S B;  1WKM A;  3ZMV A;  1A5J A;  1WVR A;  1XN7 A;  1TW2 A;  2CW0 F;  1OJL A;  2L7M P;  2J5O A;  5FKL A;  4PFP A;  2FA5 A;  4TV7 A;  3M4O J;  2XV4 S;  4PJL A;  2CV0 A;  5J4Y A;  2HZT A;  1TZL A;  1YW7 A;  4I01 A;  3OYG A;  2DT5 A;  5TGT A;  1ETK A;  1X58 A;  2IAI A;  4HV5 A;  2Q0O A;  4S04 A;  3KEY A;  4FX4 A;  1B72 B;  2HDD A;  2QBY B;  3K1M A;  5HOD A;  2NVQ J;  1VI0 A;  2E19 A;  4PGH A;  1WI3 A;  4XRM A;  3GFL A;  4DQ2 A;  1J7K A;  2WY8 Q;  2DT6 A;  1KQ0 A;  3E6C C;  2VBZ A;  2QUF A;  2KDO A;  3E6D A;  2E2J J;  4FX0 A;  2ZSH B;  3W6J B;  2ESH A;  5F1R A;  4IHX A;  3ABL H;  4ESJ A;  2IW5 A;  2MA3 A;  1JT0 A;  3O2P E;  1CF7 B;  1MNM C;  2CFO A;  2DYR H;  3CO6 C;  3TDU C;  5BOX A;  5DDG A;  3CC2 I;  3LMM A;  5IYB J;  3GTL J;  5CJ9 A;  3BPX A;  4A69 C;  2EB7 A;  2KFD A;  2OZ6 A;  3LWF A;  2FSW A;  3BQZ A;  1K61 A;  1VQP I;  1UHS A;  2VN2 A;  2K9S A;  3COA C;  3KET A;  2OJE D;  2JRM A;  3FKI J;  1IW7 F;  2ACJ A;  1VQ6 I;  1EKE A;  2HOS A;  1SFU A;  3K70 D;  1Q1H A;  4RA2 A;  2HQA A;  2F5F A;  2KIU A;  4KT5 C;  2Q1Z B;  4IHW A;  5DCM B;  4MLO A;  1YO5 C;  3ZCO A;  3GWZ A;  2DN0 A;  4XRF A;  5F08 A;  1XGS A;  4XIC A;  3AG3 H;  1ZK8 A;  2DA1 A;  4GO1 A;  5GPC A;  1MBE A;  2EIL H;  4Q5S F;  3DEW A;  4PJN A;  5H6R A;  2DPU A;  1MNE A;  4L9V A;  1IF1 A;  1PUE E;  4XLF A;  3V7S A;  3PO3 J;  4A3F J;  3J7A O;  2CO5 A;  1RET A;  3FMS A;  3W2V A;  4RB0 A;  1MND A;  3JAM K;  2E34 A;  3H3Z A;  3M1E A;  5HS8 A;  3BJ6 A;  2XF5 A;  1H89 C;  5EG0 A;  4KUM A;  3S2H J;  2E1O A;  3RTR A;  1F9N A;  1TT0 A;  3ZN1 A;  2VLA A;  2JVH A;  5AIP A;  1QZY A;  1QO0 D;  3BJA A;  3FXQ A;  2CSO A;  2H1L A;  2QGU A;  5EGO B;  2CV1 A;  4ZYG A;  2KIM A;  5K1Y A;  5FGM A;  1L0O C;  3WTS C;  2CGP A;  4WWC A;  1G2H A;  4A12 A;  1D0X A;  3KLO A;  1BOB A;  1VQ7 I;  4IHY A;  2WAQ A;  5JHU A;  3HKZ N;  1LUJ B;  1UG2 A;  3S17 J;  3HOW J;  2CYY A;  4RM2 A;  2M0M A;  3WG7 H;  4JQF A;  2AXL A;  5JVG F;  3HRT A;  1IN7 A;  4J01 A;  4PGG A;  1XMA A;  3I4N J;  5LRR A;  1WJB A;  3DPT A;  5KVR A;  2MLG A;  4DGW B;  5LGT A;  2Y9Z A;  1OMI A;  3AG2 H;  4QPO A;  3TKY A;  1XG1 A;  2MSY A;  4S0H B;  2QSG X;  3GFI A;  2DFI A;  2BGC A;  1HST A;  2DJN A;  1UHW A;  1WI9 A;  4M72 A;  4ENM A;  1SC7 A;  2EFQ A;  4FE4 A;  2MBF A;  1X1A A;  1ZAR A;  3QWL A;  1XDS A;  1E3P A;  4HNV A;  5IT9 Z;  3IKV A;  4RGR A;  3LA7 A;  5F04 A;  5FKM A;  5LHH A;  2VIX A;  1W36 C;  1MD0 A;  1FOX A;  1XSD A;  1LE8 A;  1FP2 A;  2JZY A;  1Y0U A;  3FK7 A;  5GP9 A;  1WH5 A;  2XUB A;  4UVA A;  1YS6 A;  1YJ9 I;  1U9O A;  1H9G A;  4W1U A;  2KZV A;  1J09 A;  2IEK A;  2I5U A;  2F5D A;  3KP2 A;  1RKT A;  4HOB A;  5FD6 A;  4IHS A;  4U7B A;  4UV9 A;  2D45 A;  4JOM A;  1K6Y A;  2FQ3 A;  4LG3 A;  2ECB A;  2ELH A;  3HL2 A;  1YIJ I;  3BCA A;  3GTQ J;  3FIS A;  3G71 I;  5ICE A;  1N78 A;  5DCF A;  1JJ8 C;  2P7C B;  3N05 A;  2O6G E;  2X9D A;  2KP6 A;  1NK3 P;  3M9A A;  2P6T A;  5BQT A;  4G12 A;  2BBY A;  5TJJ A;  2LKS A;  2ZKZ A;  1XCV A;  2L7K A;  2L4M A;  1R23 A;  2VB6 A;  3SHF A;  2D1H A;  2ZME B;  1GVJ A;  5CVR A;  3DPL C;  3OS0 A;  3C3W A;  4KA4 A;  3ZXS A;  2EFW A;  4MQ9 F;  1IRF A;  2NS7 A;  1D0Y A;  2EIM H;  1RZ4 A;  3ZN0 A;  5CVV A;  5EEG A;  1WJ5 A;  4ON0 A;  3OYL A;  1PP7 U;  1ULY A;  2HVR A;  5LEJ A;  4JX5 A;  1WQ2 A;  3FMR A;  1X19 A;  4FCY A;  2HXI A;  1SAU A;  2LSO A;  2HYG D;  3JRI A;  2F4I A;  2M1B A;  3GYH X;  4XOR A;  3DP7 A;  3ZQQ A;  3SEZ A;  2HGC A;  4IRG A;  2M45 A;  4WXH A;  4I2O A;  2KIQ A;  3J7Y J;  2O61 A;  3OSG A;  2ICW G;  4MEX F;  4B8X A;  5K5R A;  1HC8 A;  2V9V A;  1ORK A;  4BUP A;  2CFX A;  2V1X A;  1BR1 A;  1MBJ A;  4M73 A;  5BPD A;  1VQ4 I;  2NOG A;  1GXQ A;  2DDB A;  1IN6 A;  2QQ9 A;  3L09 A;  2DFH A;  4N4O B;  4RLQ A;  1W7P D;  3ERE D;  4A3E J;  2MD5 A;  2KIS A;  4ZZD A;  3D1N I;  3T1B A;  3HOX J;  3WOD F;  4Q48 A;  2HVQ A;  2XHK A;  3HRU A;  4PK4 A;  2DXI A;  1USS A;  3R4K A;  3KYC B;  3TL4 X;  4G8X A;  5EG0 B;  2Z9O A;  3ISP A;  2BVL A;  3DBL B;  3SDB A;  1FZP B;  2HYF A;  4EM0 B;  1GUU A;  3GFM A;  2QA4 I;  2VT2 A;  3TW6 A;  1Y1W J;  1MMS A;  2RKH A;  3HEF A;  3I5U A;  2CQQ A;  1JKO C;  2CS3 A;  2E7X A;  2FBK A;  2LOO A;  1AA7 A;  4D1Q A;  2IGK A;  3K4L A;  3WTX C;  4YG2 F;  3CCY A;  2A68 F;  1YHQ I;  2H6B A;  2UXN A;  1JXS A;  2PEX A;  4FTH A;  2P4W A;  2QZ8 A;  5BNG A;  1J59 A;  1W7P B;  3H5A A;  1WFX A;  3KP3 A;  3M3Y J;  4JBA A;  1LVK A;  5D6E A;  2DMP A;  3TO9 A;  1OYW A;  5LRS A;  1XGN A;  3QYB A;  4L5J A;  1F43 A;  1R36 A;  2BY2 A;  3KIO A;  3A01 B;  2DYS H;  5ILV A;  4RAG A;  5LHI A;  2M0C A;  3K4N A;  2ZC2 A;  4FAS D;  2PMZ A;  3HTU A;  3JAM Z;  4I7H A;  3QYE A;  4ANJ A;  4B1R A;  1QHH D;  2LDU A;  4QSH A;  2AHQ A;  4KMF A;  3F8F A;  4BJT A;  2O7O A;  3KCC A;  5F0F A;  3IC7 A;  3SXY A;  2ELJ A;  2ZFU A;  4XLA A;  2ZXI A;  1LFU P;  2HS5 A;  3CES A;  3ABK H;  4LG0 A;  4NQW A;  3VEP A;  4M9Z A;  1DQU A;  3HTS B;  4U0V A;  2BVM A;  3BCB A;  2Q8K A;  2JVG A;  1TWC J;  1B6A A;  1MBF A;  2CQK A;  3RKW A;  3S2W A;  1RKW A;  1BR2 A;  2RN7 A;  4M9X A;  4UNO A;  4F7Z A;  1W4M A;  2D1V A;  3IWZ A;  3TOB A;  2NVU B;  1H8A C;  2HYJ A;  1LEB A;  5IT3 A;  4C3I J;  5HDG A;  5KAF C;  2DMN A;  2HPM A;  3EPZ A;  3IHU A;  1OCO H;  2JA2 A;  4P5O A;  2LFB A;  5K7Z A;  2JSC A;  2XPW A;  3CMM A;  3S8P A;  2LVS A;  5K7F A;  1F1Z A;  2ID3 A;  2YX7 A;  5M5Y J;  1QNT A;  1SFK A;  2EFP A;  1OPC A;  4HBL A;  1PYV A;  3CUQ A;  4MQV A;  2H09 A;  1WJA A;  1MSE C;  3G73 A;  2L54 A;  3J80 Z;  2HNH A;  1ZKG A;  2XGD A;  2HEO A;  1RUO A;  1Z6R A;  2YR2 A;  2OUM A;  4IRI A;  1R7J A;  2QQB A;  1VQ9 I;  4XM3 A;  5CVI A;  3QPS A;  2EPF A;  2VKH A;  2X1D A;  5FO5 A;  3FF5 A;  4CIC A;  1G3S A;  1G3Y A;  4UUS B;  1ZG5 A;  2E5N A;  3S3N A;  3CUQ C;  3RDI A;  2X6Y A;  1YJN I;  2M8G X;  5IYC J;  4HST A;  3J81 Z;  2WTE A;  3FK6 A;  2PI0 A;  1QVU A;  1HCR A;  5C3E J;  2K86 A;  1ODD A;  2WAQ N;  2PFB A;  1TL8 A;  1STZ A;  2X1E A;  3LSM A;  4PUS A;  1LFP A;  4Q4Z F;  2JQ7 A;  5DV5 A;  2LRD A;  4EMS A;  3HPH A;  1TT5 B;  1G3T A;  3OS2 A;  1BW6 A;  2DFE A;  4KJZ A;  2RRE A;  4QWQ A;  1JUP A;  5E8G A;  2BV6 A;  5CLS A;  1RPW A;  3HOZ J;  5KNL A;  3PUB A;  3ZMZ A;  4IL6 C;  2EWN A;  1BI1 A;  2L9N A;  5HLT A;  1JUS A;  4E7L A;  1IZ1 A;  1O3S A;  2VOO A;  2OBP A;  4M3G A;  2GXA A;  5EJC A;  2GAU A;  5J8F A;  1JHF A;  1SFO J;  1O7L A;  2XAQ A;  5EEH A;  3G1L A;  1VTN C;  1EH7 A;  4AIK A;  3CCQ I;  6PAX A;  1B72 A;  2VKE A;  1OCT C;  2VAS A;  2GIZ A;  2PX9 A;  2LRE A;  4G6D A;  4AIH A;  1I5Z A;  2DDA A;  4NB5 A;  2LK2 A;  4ZC3 A;  4HAM A;  3H9J A;  4RAY A;  3TP3 A;  2WB1 A;  4WF2 A;  3WTW C;  2R7T A;  5GAH J;  1R4N B;  4RGX A;  4CO8 A;  5E18 F;  2TDX A;  4I6Z A;  3CD6 I;  3DLL F;  1KU9 A;  1ZTR A;  5EEA A;  3E5U A;  1KU3 A;  3RPQ A;  1LKX A;  2NS8 A;  1APL C;  4ZJZ A;  1X2N A;  2W7N A;  1AKH B;  2H8R A;  3T8T A;  2DAO A;  3MKL A;  1K79 A;  3LFK A;  4ENK A;  1HQC A;  1RR7 A;  1ETV A;  4EGZ A;  1D8J A;  3M1C A;  4I02 A;  3LAJ A;  3IL2 A;  2DTZ A;  1QVT A;  3UKG A;  1FIA A;  3QOD A;  4HF1 A;  2XF6 A;  4C2M J;  1ZGW A;  4Y33 A;  2W24 A;  2GQQ A;  1FBQ A;  3ESW B;  4K2E A;  3BT9 A;  5E3M A;  1U3E M;  2VC0 A;  3ZMT A;  3KEQ A;  3CCS I;  4XK4 A;  2CQX A;  3UNG C;  1G4D A;  1YYV A;  4YFX F;  3ZPL A;  5F0C A;  5DCM A;  1EV7 A;  1T8I A;  3DTK A;  4UUV A;  3NWS A;  3GTJ J;  2E35 A;  4FHT A;  2BXZ A;  2V79 A;  3CF5 F;  1ETO A;  2EQR A;  5E1W A;  1TQM A;  2CW7 A;  4YII A;  1FTT A;  2Y0M A;  2VJI A;  3KP7 A;  1VQ8 I;  3F6O A;  3PUF A;  4FE7 A;  4HNT A;  1NK2 P;  2VPR A;  2W84 A;  2HTJ A;  4PSW A;  4KN7 X;  1ZYR F;  2QYO A;  3Q0V A;  5LEK A;  4HF2 A;  4B43 A;  2O8X A;  4LMY A;  4MO7 A;  1F36 A;  2MAB A;  1BN5 A;  1KGS A;  2V1U A;  4R79 A;  1A31 A;  1SFE A;  4ESB A;  3CUO A;  2GXG A;  3HC7 A;  3SFZ A;  3WTT C;  1LDK B;  2RQP A;  3GEZ A;  3BR5 A;  1MDM B;  3OWT A;  2VE9 A;  2XAU A;  2CW8 A;  2NNY A;  2HXO A;  3S15 J;  2J5P A;  5GTH C;  3C2H A;  1X2M A;  3MZH A;  3FXL A;  5IT9 K;  3CDH A;  2H6C A;  3MMY B;  1A36 A;  3BQY A;  1IXC A;  2A61 A;  4XKB A;  1S3J A;  5EGO A;  2NYX A;  2EH3 A;  5IOY A;  1DPU A;  3PIP F;  1R1U A;  4IHV A;  4N0B A;  4RMN A;  1N25 A;  4IQJ A;  3OOP A;  3MCZ A;  5H20 A;  2K9L A;  3E97 A;  3RZD J;  1DDN A;  4C2U A;  3OYN A;  2O5R A;  3S1M J;  4HG2 A;  3JTG A;  3ECH A;  3ECO A;  3VSL A;  4BH9 A;  1UFM A;  4ITV A;  3MVP A;  3ZQ7 A;  3F0C A;  4BQN A;  2LY9 A;  4EJW A;  1Z7L A;  1FOY A;  4XLC A;  4DBR A;  3L2U A;  2O3F A;  4F93 B;  4DZJ A;  2VJ4 A;  2HQR A;  1KON A;  5DS9 A;  4J00 A;  2RAE A;  2XAJ A;  2KMU A;  2WAF A;  2R3S A;  4IPA A;  2VKD A;  4MEY F;  2PBI A;  1O4X A;  4P9F A;  4R1H A;  1BI0 A;  3ZQH A;  4KT6 A;  2DMU A;  1KQ8 A;  2L01 A;  4N4N B;  2FOK A;  1Y8Q B;  4A2U A;  5GAD J;  1NH3 A;  1T98 A;  1JKP C;  1I50 J;  4ZDL A;  5LGU A;  3R0J A;  4I99 C;  1EJ9 A;  1BIA A;  3CF2 A;  1PJR A;  4PSX A;  2AO9 A;  4MHG A;  2A69 F;  5ERI A;  1B9N A;  4UVC A;  3DWL E;  4BBR J;  4CCO A;  5CVJ A;  2LF8 A;  1HDP A;  3CP8 A;  1DP3 A;  3PO2 J;  1PP8 F;  4A0Y A;  1X3Z B;  3ZQF A;  3I64 A;  2K9Q A;  4XN3 A;  5IP7 J;  5E79 C;  4EGY A;  4KFC A;  3WTZ A;  5BMZ A;  4EJU A;  1X3U A;  1D1B A;  2NNN A;  3BPV A;  3B6C A;  1LJ9 A;  1ZGA A;  2LLK A;  2PMZ N;  3ELK A;  2E2H J;  1BC7 C;  3LQR A;  5L3F A;  2P5L C;  3WGG A;  2A6E F;  4IOA F;  4IHT A;  4BQA A;  2JK3 A;  2WAD A;  4M6X A;  3VFZ A;  1FLI A;  4P1W A;  2Y69 H;  1YX5 A;  2L02 A;  3DU5 A;  3AG1 H;  5JLW A;  2HOT A;  1LNW A;  4MTE A;  2IJL A;  3BRO A;  3HOU J;  3GZ5 A;  4F55 A;  4UY8 I;  1NG6 A;  4IQ4 A;  2EA2 A;  1BA5 A;  3JRC A;  3E1S A;  3T5X A;  2LYC A;  4R8H A;  4LOC A;  1HA8 A;  3IP4 B;  1NTC A;  5TRD A;  4BHP A;  3IWF A;  2HVS A;  3M07 A;  4DZP A;  2ZME A;  2BW3 A;  1I3Q J;  4XKW A;  4BQO A;  5D4S A;  3C7J A;  4U7D A;  1L3L A;  1QGP A;  3L1P A;  4HPQ A;  3GTM J;  3MN2 A;  3CQZ J;  3TMO A;  4L5I A;  1PVE A;  4CH7 A;  3LSK A;  4B09 A;  1ZRE A;  3FWE A;  2QKM B;  4XLN F;  3SZG A;  5EYR A;  2ZME C;  1SD5 A;  2XAH A;  3AL0 C;  1Z77 A;  2F4O B;  5IP6 A;  3G4S I;  2L0K A;  1IDZ A;  3K4C A;  5B5E C;  2P6S A;  2OTJ I;  5KHD A;  2RQQ A;  3E6M A;  3DFG A;  2FX0 A;  2UV1 A;  3SFI A;  4CCJ A;  2IVM A;  3WE2 A;  3FHN A;  3F8M A;  2QWW A;  1A6Q A;  2E1M B;  1FY7 A;  3N4M A;  2M8E A;  3QRF F;  3CCR I;  1ZR2 A;  3WHC A;  2JJ7 A;  3JR9 A;  5D6F A;  2HQN A;  4GFB A;  2VXZ A;  2JPB A;  3OYF A;  1D3Y A;  3GZ6 A;  4BY1 J;  3H36 A;  3G1O A;  3OYD A;  2HI3 A;  2STT A;  2IS2 A;  4CDG A;  2EFN A;  3BOQ A;  2IRF G;  4ZYD A;  4HSR A;  4ZZL A;  4M3B A;  4LIT A;  4F91 B;  3L9F A;  3AFH A;  1BM9 A;  3REO A;  2BY0 A;  3D0S A;  1MBG A;  2X6W A;  4JX4 A;  5KK1 A;  5ED4 A;  2HDC A;  4Y17 A;  2DMQ A;  1Z21 A;  4PJJ A;  1OFC X;  3ABM H;  2CJJ A;  3TOA A;  1X1P A;  2B0L A;  4BS9 A;  3MZ8 A;  1U5T B;  4CCN A;  2ZXJ A;  1W7P A;  2KL4 A;  2M30 A;  1LDJ A;  5E1X A;  3V42 A;  1D5Y A;  3U9G A;  3CCU I;  3OYJ A;  3T0Y A;  1ITY A;  5K5Q A;  1T39 A;  3NEU A;  2ME6 A;  1JGG A;  1R1T A;  3S93 A;  2JUG A;  1BW5 A;  5DTD A;  3G2B A;  4D9J A;  1W0U A;  2CWE A;  2K5C A;  1YOV B;  3K4B A;  1ZGJ A;  3A01 A;  4HLY A;  1UJ8 A;  4BU2 A;  1DGW Y;  4EAT A;  4CHU A;  1UZC A;  3V8J A;  4Y52 J;  3OYE A;  1S6L A;  2IA1 A;  2WB1 N;  2Y75 A;  1OIS A;  4ZYE A;  3D5L A;  4CYD A;  3PFI A;  1WPK A;  4HEA 2;  3BR1 A;  3VOE A;  1X1C A;  4UHT A;  1YW9 A;  1R1V A;  2CUZ A;  1V5E A;  3J80 K;  1TQI A;  1YS7 A;  4Y13 A;  1K83 J;  2YX4 A;  3FX3 A;  2KLO A;  3HG9 A;  5HOO A;  2IBD A;  3I59 B;  3IAM 2;  3W6K B;  3HOY J;  3L00 A;  3E5Q A;  2NVT J;  1I1S A;  1TTY A;  4BXX J;  3HSR A;  2L2O A;  3FXM A;  4QLC U;  1LFB A;  3I0T A;  5JHF A;  1J5Y A;  1QZZ A;  3SQN A;  3ZMS A;  3L2Q A;  5FLX K;  1TWA J;  3G6E I;  4AD9 A;  3FHZ A;  3HSE A;  2GZW A;  1QU3 A;  3OYB A;  1WSU A;  4E7K A;  4G7H F;  1DU6 A;  2E1C A;  3H5N A;  2O9L A;  3WTV C;  1TW3 A;  1SVM A;  4EEF G;  1Y8R B;  3J81 K;  2N8G A;  3U1D A;  3A0H C;  2FMY A;  2JUC A;  5M3F J;  1YIT I;  4XRS A;  4B3A A;  1S7E A;  5BS6 A;  2VON A;  2F4M B;  3A0B C;  1R9T J;  1WJE A;  3DBR B;  4M6Y A;  1DP7 P;  4F52 A;  3FBI B;  3H9Q A;  2ZSI B;  3R6S A;  3MKZ A;  4II3 A;  1MMG A;  1SVL A;  2MG4 A;  1ZRF A;  4LK1 F;  4I0A A;  3CCL I;  1WJD A;  2R7O A;  4DYQ A;  3M8J A;  2ZXW H;  4XOT A;  3I56 I;  2QSF X;  3WG9 A;  1YRN A;  4KNY A;  3K2Z A;  2FQ4 A;  1PDN C;  2M34 A;  4WK8 F;  1ETQ A;  4S05 A;  3QU6 A;  3RKX A;  1LPQ A;  2P81 A;  5CYV A;  2BW3 B;  3KYL A;  3GLL A;  2TRT A;  3AL0 B;  2VQC A;  2VXD A;  4RB3 C;  2L9V A;  3NAU A;  4UUS A;  4A3B J;  3OIQ A;  3VDX A;  1R58 A;  1IJW C;  1FYL A;  1RES A;  2IGN A;  3WTU C;  2DOA A;  1TLH B;  1IDY A;  1TNT A;  3S1R J;  3LFU A;  5DEQ A;  4ZDP A;  5AIQ A;  2P8T A;  3P9C A;  3Q5F A;  1N77 A;  4D7M A;  1FSH A;  1K7A A;  1UAA A;  4RGS A;  4DW6 A;  2WC2 A;  1MMD A;  1KU2 A;  2P5K A;  2OC6 A;  4RGU A;  4AVP A;  1S7A A;  2LD5 A;  4FET A;  1ZH5 A;  4HQE A;  2V9K A;  3ABU A;  4BEH B;  2UWM A;  2XGX A;  1T0F A;  1D1C A;  1X3W B;  5EF6 A;  5HDN A;  2KRH A;  3OYA A;  4AM3 A;  1ETY A;  2WY7 Q;  1K6O A;  2OZU A;  4A3C J;  2R4G A;  2E7W A;  4RAZ A;  4ENN A;  2IS1 A;  4GYG A;  1K78 A;  3ZR8 X;  2D2W A;  1JI8 A;  4BE2 A;  3GO5 A;  4Z6Y A;  2XGC A;  3OIO A;  1BBY A;  4PCQ A;  4JP0 A;  5K5O A;  4HDV A;  4NDL A;  3WU1 B;  3HHH A;  1JKR C;  4JYK A;  1S5L C;  2K3P A;  3F72 A;  4LGW A;  5J40 A;  1T0F C;  3JRA A;  3QYF A;  4NC7 A;  3BWG A;  1I6H J;  3QPH A;  3E5X A;  2DQR A;  2VJJ A;  3BY6 A;  2MH2 A;  3X2Q H;  4KN4 X;  4KYW A;  2XC7 A;  2EA4 A;  1F5T A;  2COM A;  3HBL A;  3F23 A;  4IZZ A;  3BZK A;  3TBI A;  3BTI A;  3K9T A;  3VYT B;  5B66 C;  2HDW A;  2HKO A;  2XIG A;  3H9G A;  3DPU A;  3GX4 X;  2ECC A;  3MEX A;  2KPM A;  2JSP A;  4ZYH A;  3K4M A;  3M8F A;  2I10 A;  1X1D A;  1AKH A;  2Z5U A;  4G6Q A;  2DK5 A;  3FBN B;  1W5T A;  2R93 J;  1DGR M;  3JRG A;  2YUS A; 
#chains in the Genus database with same CATH homology
 3SJM A;  2LK2 A;  3O8G A;  4D7N A;  2QF7 A;  2ME0 A;  3LOC A;  3TP3 A;  1A5J A;  2QCO A;  4MIM A;  3BR2 A;  1OJL A;  2L7M P;  1MH4 A;  1IUF A;  4I6Z A;  5FKL A;  3M4O J;  1ZTR A;  5EEA A;  1APL C;  2FD5 A;  2NS8 A;  3IH3 A;  1OCP A;  1X2N A;  1AKH B;  2E2I J;  2H8R A;  3BR0 A;  3K7A J;  3MKL A;  2LKX A;  1ETK A;  1X58 A;  1RR7 A;  1ETV A;  1TWG J;  2IAI A;  3QPL A;  2DTZ A;  1QVT A;  3TW7 A;  1FIA A;  3UKG A;  1B72 B;  2HDD A;  4V2G A;  5HOD A;  1HOM A;  2NVQ J;  4C2M J;  1VI0 A;  2E19 A;  1ZGW A;  4X1E A;  1GV5 A;  2K9N A;  1WI3 A;  3VPR A;  4XRM A;  5E3N A;  5EZH A;  5IPA A;  3BT9 A;  5E3M A;  3BTL A;  3G1M A;  4QTR A;  2E2J J;  4XK4 A;  4IHX A;  1ETW A;  2CQX A;  2VUM J;  3BR3 A;  4D5C A;  1UMQ A;  5F0C A;  2MW8 A;  5C4J J;  1GDT A;  2JA6 J;  9ANT A;  1JT0 A;  1MNM C;  1ZR4 A;  5E3O A;  3GTJ J;  2EZI A;  3SDG A;  5IYB J;  3GTL J;  1ETO A;  2EQR A;  3NAR A;  1AHD P;  4A69 C;  2L9R A;  5IP9 J;  1FTT A;  3S14 J;  4FE7 A;  3BQZ A;  2K40 A;  1K61 A;  1NK2 P;  2VPR A;  1P7J A;  2ELK A;  4RDU A;  1UHS A;  2K9S A;  3Q0V A;  3Q0U A;  1H88 C;  5FKK A;  3FKI J;  4MO7 A;  1F36 A;  4D5F A;  2HOS A;  4DYR A;  2Y0S N;  2COB A;  1IC8 A;  1ENH A;  4IHW A;  1YRN B;  3BR5 A;  4MLO A;  4DYC A;  2DN0 A;  2HXO A;  5F08 A;  3S15 J;  5IYD J;  4XRS G;  4XIC A;  1X2M A;  1ZK8 A;  2DA1 A;  2XPU A;  5GPC A;  1FTZ A;  3BQY A;  1MBE A;  5EGO A;  3DEW A;  5K7H A;  3HDD A;  2EH3 A;  2Y2Z A;  5IOY A;  4Y7N J;  1HF0 A;  3HOV J;  4IHV A;  1HLV A;  5EDN A;  1JT6 A;  4A3G J;  3PO3 J;  4A3F J;  3RZD J;  2DA7 A;  3TP0 A;  1RET A;  3S1M J;  4A93 J;  3MVP A;  2EBI A;  3BG5 A;  3LSP A;  2CUF A;  1H89 C;  3S2H J;  3F0C A;  5EG0 A;  2LY9 A;  3DCF A;  1GT0 C;  2E1O A;  4DZJ A;  1HDD C;  3HGY A;  1TWH J;  1TC3 C;  5DS9 A;  2RAE A;  2B63 J;  5EGO B;  2Y9Y A;  3LSG A;  1O4X A;  1GV2 A;  2XRL A;  2JMW A;  1G2H A;  3ZQH A;  5FJ8 J;  4IHY A;  2DMU A;  3S2D J;  2LTP A;  4X6A J;  3HKZ N;  2R5Y A;  3BTJ A;  2FJ1 A;  1VF9 A;  1UG2 A;  1JKP C;  1VND A;  2YU9 J;  3HOW J;  1I50 J;  2CUE A;  3S17 J;  2L7F P;  5IOZ A;  2CU7 A;  2AO9 A;  2X48 A;  4L5E A;  4BBR J;  2R92 J;  3I4N J;  1HDP A;  3GTG J;  3PO2 J;  3BG9 A;  3ZQF A;  3JRB A;  2CRG A;  2K9Q A;  2Y9Z A;  5IP7 J;  1XG1 A;  2JA5 J;  2MSY A;  4S0H B;  1IRZ A;  2DJN A;  3B6C A;  4C3J J;  4FE4 A;  2NVX J;  2LLK A;  3Q0W A;  2R5Y B;  2PMZ N;  3E7L A;  1B8I A;  2E2H J;  5C44 J;  3HB9 A;  1Y1V J;  4HNV A;  2JK3 A;  3IH2 A;  2VKV A;  2HQ5 A;  3GBG A;  5F04 A;  5FKM A;  5JLW A;  4A3K J;  1JJ6 C;  2HOT A;  4QIW N;  3JRD A;  1AU7 A;  2R5Z A;  3HOU J;  4BKX A;  2JA8 J;  4MFE A;  1LE8 A;  2TCT A;  1BA5 A;  3JRC A;  3FK7 A;  5GP9 A;  3LNQ A;  3CMY A;  3O8H A;  1WH5 A;  4LOC A;  4RBO A;  3OSF A;  1U9O A;  1NTC A;  4W1U A;  2EZK A;  2XPV A;  1JKQ C;  1IGN A;  2IEK A;  3ZQC A;  3I4M J;  4DZP A;  1I3Q J;  1JUM A;  1RKT A;  4I76 A;  3L1P A;  1JTY A;  3BTC A;  3GTM J;  3MN2 A;  3CQZ J;  2XB0 X;  2ECB A;  4MFD A;  2MGQ A;  3GTQ J;  2R5Z B;  3FIS A;  1LE8 B;  3RQI A;  3A02 A;  1JJ8 C;  5EYR A;  1EF4 A;  1PUF A;  1FIP A;  2X9D A;  3RZO J;  1TWF J;  1NK3 P;  1Z77 A;  5IP6 A;  4G12 A;  2L0K A;  1IDZ A;  2FX0 A;  1IV6 A;  3SFI A;  5M3M J;  3LSR A;  1E3O C;  2L7Z A;  2NS7 A;  4AC0 A;  2YS9 A;  1T56 A;  2JA7 J;  3S1N J;  1MBK A;  1T33 A;  1ZR2 A;  3WHC A;  5JLX A;  2JJ7 A;  3JR9 A;  4GFB A;  3B6A A;  2R7Z J;  4JX5 A;  4FCY A;  2HXI A;  3OOU A;  4JX6 A;  5F0H A;  4M3E A;  4BY1 J;  1PUF B;  3IH4 A;  2ZB9 A;  3JRI A;  1MSF C;  3G1O A;  2HI3 A;  3FIW A;  2KDZ A;  4M3D A;  1QPI A;  5J1Y A;  2X6O A;  4M3B A;  3OSG A;  4M6V A;  2D5V A;  1ORK A;  3JRF A;  4BY7 J;  5J1U A;  1MBJ A;  1MBG A;  4JX4 A;  2NOG A;  4CYC A;  4A3L J;  2DMQ A;  1GVD A;  1U9N A;  4A3E J;  3H3V K;  2Y31 A;  1OFC X;  2CJJ A;  3D1N I;  3HOX J;  2ID6 A;  1BJZ A;  2JN6 A;  3BG3 A;  2GLO A;  4A3M J;  1D5Y A;  2HOA A;  1ITY A;  2ME6 A;  5EG0 B;  1JGG A;  1CQT A;  1BW5 A;  1XC5 A;  5DTD A;  1GUU A;  2DA4 A;  1W0U A;  3TW6 A;  1Y1W J;  3A01 A;  2H1K A;  3HEF A;  2CQQ A;  2Y30 A;  1JKO C;  3PM1 A;  2LP0 A;  3JRE A;  4Y52 J;  2WB1 N;  4CYC B;  1WPK A;  4A3D J;  3CCY A;  1U8B A;  3BR1 A;  4FTH A;  2EZH A;  1MH3 A;  5BNG A;  1K83 J;  2XSD C;  2IBD A;  3HOY J;  1ZQ3 P;  3M3Y J;  1XS9 A;  2NVT J;  4BXX J;  2DMP A;  2GBY A;  1LFB A;  3H0G J;  1TWA J;  5FLM J;  3W6V A;  1F43 A;  3A01 B;  4J19 A;  1JTX A;  1SAN A;  1DU6 A;  3CDL A;  5E3L A;  2O9L A;  2DA6 A;  2M0C A;  4B4C A;  1ETX A;  5F27 A;  4EEF G;  2OPT A;  2N8G A;  3GTP J;  3Q3S A;  5M3F J;  3TED A;  5M5X J;  4B1R A;  4XRS A;  2O8K A;  4B3A A;  1S7E A;  3ZQL A;  1R9T J;  1B8I B;  4QSH A;  4IEJ A;  2AHQ A;  2O7O A;  5F0F A;  3IV5 A;  4A3J J;  5M5W J;  5J3L A;  2JWT A;  2XB5 A;  3S16 J;  2G0E A;  1LFU P;  2LR8 A;  5FKO A;  1WCM J;  2MG4 A;  4DYQ A;  4AUX A;  2DMT A;  3ZQG A;  1VFC A;  3C2B A;  1YRN A;  1TWC J;  1MBF A;  4A3I J;  1RKW A;  2FQ4 A;  5GPA A;  1MBH A;  2NVY J;  4V2F A;  1P7I A;  2M34 A;  1DU0 A;  1ETQ A;  1Q1V A;  3A03 A;  1H8A C;  2HYJ A;  2DA5 A;  2P81 A;  3GTK J;  4C3I J;  2TRT A;  2DMN A;  1U78 A;  1BL0 A;  3NAU A;  4UUS A;  3S1Q J;  4A3B J;  2LFB A;  3RKQ A;  5K7Z A;  1A6I A;  2XPW A;  2LVS A;  5K7F A;  1IJW C;  1RES A;  2ID3 A;  4XID A;  4W97 A;  5M5Y J;  2M2E A;  1IDY A;  3S1R J;  4AYB N;  1IG7 A;  1MSE C;  1ZKG A;  3GTO J;  4D7M A;  2XGD A;  4DW6 A;  2WV1 A;  2KT0 A;  5C4X J;  3ZOB A;  3HGG A;  2XGE A;  2LD5 A;  3QPS A;  5EF6 A;  4FIS A;  1ETY A;  4UUS B;  5FKN A;  4A3C J;  3ZQI A;  4M3F A;  2M8G X;  5IYC J;  1POG A;  2EZL A;  3FK6 A;  1QVU A;  3JRH A;  4ABZ A;  2XGC A;  3OIO A;  4JP0 A;  1HCR A;  2GM4 A;  4NDL A;  3BR6 A;  5C3E J;  2WAQ N;  2DA3 A;  5F1J A;  1JKR C;  4JYK A;  3LSJ A;  3JRA A;  1I6H J;  4UUT A;  1Z0X A;  4BBS J;  1BW6 A;  2DA2 A;  1JUP A;  4C3H J;  3HBL A;  3WHB A;  1RPW A;  3HOZ J;  5J1R A;  3BTI A;  2W48 A;  3HM5 A;  1WGX A;  2VI6 A;  1JUS A;  2OF7 A;  1W0T A;  1FEX A;  4M3G A;  5FLV A;  2ECC A;  1AKH A;  1SFO J;  2I10 A;  3K2A A;  3QQA A;  3G1L A;  5EZG A;  1WH7 A;  1FJL A;  1QRY A;  2R93 J;  2R0Q C;  1B72 A;  2VKE A;  2M9H A;  3JRG A;  1OCT C;  2YUS A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...