3ZOBA

Solution structure of chicken engrailed 2 homeodomain
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
67
structure length
67
Chain Sequence
GPMASDKRPRTAFTAEQLQRLKAEFQTNRYLTEQRRQSLAQELGLNESQIKIWFQNKRAKIKKATQA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Dna binding protein
molecule keywords HOMEOBOX PROTEIN ENGRAILED-2
publication title Investigation of Homeodomain Membrane Translocation Properties: Insights from the Structure Determination of Engrailed-2 Homeodomain in Aqueous and Membrane-Mimetic Environments.
pubmed doi rcsb
source organism Gallus gallus
total genus 13
structure length 67
sequence length 67
ec nomenclature
pdb deposition date 2013-02-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00046 Homeodomain Homeodomain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.60 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Homeodomain-like 3zobA00
5F27A 5BNGA 1U8BA 1BL0A 3W6VA 4QTRA 5DTDA 3LOCA 3HB9A 4I6ZA 3G1MA 5E3OA 3CQZJ 1B8IA 3O8HA 1BJZA 1MBFA 3S2HJ 4A93J 2O9LA 2RAEA 3HDDA 4XRSA 1ETQA 5JLXA 3DCFA 3JRDA 4B3AA 3FK7A 1MBGA 4A3CJ 1RETA 3HGGA 2Y31A 4DYRA 1DU6A 4A3EJ 5EF6A 4BY1J 5GPAA 1QPIA 3GTPJ 2KT0A 2XGDA 1U9OA 2K9NA 3MN2A 1PUFB 1QVTA 1WH5A 2CRGA 2L7MP 2O7OA 2O8KA 1GVDA 1ETVA 2MG4A 2M2EA 1TWHJ 1B8IB 1JKPC 2MSYA 1SFOJ 3HOVJ 3JRFA 3A03A 2JMWA 2HOSA 2XPUA 1JJ6C 1A6IA 1VFCA 3OSFA 3ZQIA 1LE8A 5GPCA 3GTKJ 3IV5A 1AHDP 3BR1A 1H88C 2DA3A 5E3NA 2FQ4A 1R9TJ 1RKTA 1T56A 5C4JJ 2WAQN 1TWFJ 2VKEA 1A5JA 3MKLA 2FX0A 4DZJA 2LP0A 4A3KJ 2Y30A 3K2AA 1OFCX 4W1UA 4NDLA 3TW7A 2VPRA 1TWGJ 3BG9A 2XB5A 5J1UA 1JT0A 3A02A 5C3EJ 2R5YA 5IP7J 5IP9J 4AYBN 3DEWA 1NTCA 1LE8B 1Y1VJ 2JJ7A 2LKXA 1IGNA 2L0KA 1S7EA 3BR2A 3HEFA 4C2MJ 1FIAA 4UUSB 4XICA 5C4XJ 4XK4A 2AHQA 5EGOA 3ZQLA 3Q0UA 5FKLA 3TP3A 4MO7A 2CQXA 3O8GA 3BTIA 2JA6J 4ABZA 4XRSG 2HDDA 3OIOA 4W97A 3ZQCA 4C3JJ 1UHSA 4QSHA 4CYCA 3IH2A 3C2BA 3Q0VA 1IC8A 1FTTA 4DW6A 2Y9YA 5IYCJ 3GTJJ 4A69C 3JRAA 2NVYJ 1AU7A 1ZTRA 5IOZA 2PMZN 1JJ8C 1NK2P 5K7HA 5EYRA 4BBSJ 2EQRA 5EGOB 4AC0A 4X1EA 1BW5A 2B63J 1ETYA 2X48A 2CQQA 4FISA 3BTCA 2GM4A 5F04A 3NARA 4D5FA 2NOGA 3UKGA 5M5XJ 2N8GA 2COBA 1MH3A 3S15J 2XPVA 2DJNA 2WV1A 2R7ZJ 2LY9A 4BKXA 2LFBA 2DN0A 4Y52J 3GTMJ 2G0EA 4D7NA 1SANA 1JTXA 2DMTA 1MBJA 4EEFG 3GTQJ 5IYBJ 3QPSA 1LFUP 2LD5A 3HM5A 5IYDJ 2Y0SN 3FKIJ 1I50J 2D5VA 5EZHA 2XB0X 2AO9A 2DMNA 3BR5A 3BQYA 2JK3A 3S14J 4RDUA 4L5EA 5J1RA 4C3HJ 1UMQA 5FLVA 2L7ZA 2CJJA 4IHXA 1B72A 4IEJA 3ZQGA 1ORKA 3QPLA 1HLVA 3BT9A 4AUXA 4M3EA 3S1QJ 4GFBA 5F0CA 1ETXA 1IUFA 4FCYA 2EZLA 1UG2A 3F0CA 4C3IJ 2ZB9A 5M5YJ 1P7IA 2OF7A 3FIWA 4HNVA 2H8RA 1ETWA 3S16J 1AKHA 3BR6A 1GDTA 1MH4A 3BTJA 5IOYA 4DYQA 2Y9ZA 2HXOA 2E2HJ 3QQAA 2JN6A 1JUSA 1JKOC 2YU9J 2IAIA 2K9SA 2XSDC 3JREA 3OSGA 1TC3C 2EH3A 3PO3J 1JUPA 3GTGJ 3H3VK 1JKQC 3JRCA 2DA7A 2OPTA 1D5YA 5K7ZA 1T33A 2JA5J 3CMYA 1QVUA 3HOZJ 5JLWA 1XC5A 4D5CA 3LSGA 3Q0WA 2HQ5A 2R5ZA 1H89C 1MSFC 2HOAA 1AKHB 1MNMC 2DMUA 3GBGA 3GTOJ 1JTYA 1Z77A 1QRYA 3IH3A 3K7AJ 3HOWJ 3HOUJ 1OCPA 5M5WJ 2JWTA 3JRGA 4A3BJ 2VKVA 2IBDA 2NVQJ 4JP0A 2EZIA 4MFEA 4DZPA 3SJMA 1ZR4A 4IHWA 4MLOA 3A01A 2MGQA 3RZOJ 1RKWA 2X6OA 1WPKA 2DA1A 3BG3A 3BR0A 5IPAA 2R5YB 4J19A 3RKQA 1Q1VA 1IDYA 4MIMA 1G2HA 5F1JA 4V2FA 2P81A 2W48A 2XGEA 4A3DJ 3HOYJ 5DS9A 3HKZN 3WHCA 1IJWC 5GP9A 2EZHA 3HOXJ 2HXIA 2NVXJ 2XGCA 3M3YJ 2E1OA 1F36A 1IG7A 1HDPA 3PM1A 5FKKA 4A3FJ 1W0UA 3LSPA 1X2NA 5EDNA 1MSEC 1I3QJ 5E3LA 1APLC 2X9DA 5FKMA 2YS9A 4CYCB 3I4MJ 3A01B 1TWAJ 1GV5A 2VI6A 4V2GA 2DA6A 4M3FA 3S1NJ 1RR7A 2DTZA 2ME0A 3S1RJ 1WI3A 3LSRA 1POGA 1LFBA 1VI0A 2QF7A 3NAUA 1TWCJ 4A3GJ 1EF4A 2TRTA 2R93J 4MFDA 2ELKA 1BW6A 1HF0A 5E3MA 3H0GJ 2ECCA 2E2JJ 1OJLA 1HOMA 1JKRC 3JRHA 9ANTA 2CUEA 4I76A 3ZQFA 1FTZA 1DU0A 4XIDA 2NS7A 1RPWA 3I4NJ 1NK3P 3CDLA 3BG5A 1PUFA 1HDDC 3ZQHA 1IV6A 4DYCA 2CUFA 4Y7NJ 4M3BA 5IP6A 3ZOBA 3GTLJ 3M4OJ 1ENHA 3VPRA 1ZR2A 1HCRA 3L1PA 3HBLA 2EZKA 3JR9A 1IDZA 4IHVA 1X2MA 3Q3SA 3JRBA 3S1MJ 1RESA 4M6VA 2NS8A 3TP0A 5FJ8J 1XS9A 4B4CA 2NVTJ 1U9NA 2K9QA 5EZGA 3OOUA 1GUUA 1XG1A 2IEKA 2HOTA 4A3LJ 3RQIA 3B6AA 4JX5A 1O4XA 1IRZA 2LTPA 3D1NI 3PO2J 2FJ1A 1Y1WJ 1MBHA 3B6CA 2Y2ZA 1I6HJ 1B72B 2EBIA 2QCOA 2KDZA 4BXXJ 1OCTC 3CCYA 3FISA 2ECBA 2LLKA 2WB1N 3FK6A 3LNQA 2E19A 1VF9A 4G12A 1YRNA 2VUMJ 5FKOA 3RZDJ 1WH7A 2DMPA 4FTHA 1ITYA 1H8AC 4UUSA 1GV2A 1E3OC 3LSJA 5J1YA 1MBEA 3IH4A 5F0FA 4B1RA 4BBRJ 1K83J 2I10A 4FE4A 1GT0C 2JA8J 2TCTA 5EG0A 2DA5A 2M9HA 1FJLA 3G1OA 5EEAA 2K40A 2GLOA 2XPWA 4S0HB 3BR3A 1ETOA 3BQZA 5F0HA 3TEDA 2R92J 2DMQA 1K61A 5FKNA 2M0CA 2MW8A 3SFIA 1U78A 2LR8A 1YRNB 1BA5A 5FLMJ 4BY7J 1X58A 4A3IJ 2R5ZB 1ETKA 4M3GA 2L7FP 4X6AJ 4D7MA 1WCMJ 2DA2A 1WGXA 3WHBA 2LK2A 5EG0B 3S2DJ 3HGYA 1ZQ3P 3S17J 2R0QC 2FD5A 1CQTA 1F43A 3E7LA 2E2IJ 4QIWN 3TW6A 3JRIA 4A3MJ 3BTLA 1P7JA 4IHYA 5F08A 5C44J 2M8GX 1FEXA 1W0TA 4LOCA 1JGGA 2HI3A 2ID6A 2M34A 3G1LA 4FE7A 2YUSA 5M3FJ 2ID3A 4JX6A 1ZGWA 2JA7J 1VNDA 3MVPA 1MBKA 4A3JJ 2ME6A 2L9RA 2H1KA 2GBYA 5K7FA 4UUTA 4RBOA 2LVSA 4JX4A 4M3DA 3SDGA 5M3MJ 2DA4A 4XRMA 1ZK8A 4JYKA 1JUMA 2CU7A 1ZKGA 1FIPA 2XRLA 5J3LA 1Z0XA 2HYJA 1JT6A 5HODA
chains in the Genus database with same CATH superfamily
5F27A 4KA4A 1P4XA 4OMYA 3U2RA 2ZXWH 3VFZA 3L9FA 5LLQA 3RSNA 3ZQ7A 3HB9A 4I02A 4I6ZA 2QVOA 1ZN2A 4XN0A 1BJZA 2KJCA 3DBLB 2BHYA 2RAEA 2M4GA 1FBQA 4Y4RA 5DCMA 2WY8Q 4A3CJ 1XMAA 5FRMA 3BCAA 4A3EJ 1Z21A 2HQNA 5EF6A 3K6GA 1K78A 4BY1J 5LFAA 2JZYA 2ZKZA 2P6TA 4ITVA 4QWQA 2XROA 3BZKA 2W1OA 3K4LA 4KUMA 3ZMZA 2FNAA 1GXQA 2XGDA 3WE3A 1PUFB 1FP2A 2O7OA 1ETVA 2CYYA 2MG4A 2RNJA 3KP7A 2B7EA 2KIUA 2M2EA 2HTSA 5EJCA 1JKPC 3RDIA 2DJIA 4PJNA 3COAC 3JRFA 1W7PD 3A03A 1UG0A 2JMWA 2RQQA 1A6IA 3GWZA 4HW0A 1L0OC 1LE8A 1Y56A 2JTVA 1V54H 2HEOA 3BR1A 4N9HA 4RAFA 5CVJA 3UR3C 2BY2A 3RIRA 5E3NA 2WV0A 1R9TJ 1RKTA 3FXQA 5C4JJ 2JPBA 3E5QA 3SZPA 1TWFJ 1A5JA 4HNUA 1YO5C 3S93A 2EA2A 3DTKA 1TWGJ 2LSOA 3LSTA 1J75A 5J1UA 2KHMA 3OOPA 3FMRA 1FOWA 2Z33A 5C3EJ 2K3FA 3D5SC 4YIRX 2F5VA 3R61A 1SD6A 4AYBN 4GYGA 3DEWA 5ICCA 1LE8B 3K1MA 2DOAA 4EJVA 1O3QA 1DP7P 5HNFA 1ZLKA 3EUAA 3Q9SA 1P4WA 3AG2H 1J2XA 1OLTA 5EGOA 3Q0UA 2JQ7A 4MO7A 2CQXA 4BQAA 2JA6J 2NYXA 2BXZA 3OIOA 5LHGA 2V1DA 3KP2A 3ZQCA 1SMTA 3QYFA 1EV7A 1H9TA 3L00A 4CYCA 3C2BA 2PFBA 1HKQA 1TQIA 4G7ZF 2XGXA 4KMUX 3CO7C 2JRTA 1TTYA 4AIDA 3A0HC 2QQ8A 3GTJJ 4A69C 2WADA 2NVYJ 2XSJC 2KPMA 1ZTRA 3OMYA 4PCQA 1AU7A 3KZYA 3K1PA 4KFCA 1NK2P 3GZNB 1YX5A 3O3KA 3QP5A 2E35A 3M7GA 5E8GA 2DT5A 4AC0A 5EGOB 2L3DA 2EFOA 5D4RA 1XSXA 2EB7A 3EPZA 4BJTA 4FISA 5F04A 1GXPA 4D5FA 2FU4A 3F8BA 3L2QA 3UKGA 1G3SA 2RDPA 3G3ZA 4XLPF 2KJBA 2N8GA 2KQRA 4ESJA 4ENNA 4LD5A 4IXAA 2DJNA 2E36A 4HX7A 4HF0A 2BZTA 1WJDA 4A2UA 2FBHA 4Y52J 5HS9A 5KHDA 1HKTA 1AOYA 4P9FA 4B3XA 1S8NA 3BCBA 3M07A 4EM1A 3FMSA 2VC1A 2NS0A 1DUXC 4D7NA 2PJRA 1JTXA 2DMTA 3FXKA 2XASA 1ON1A 4GYIA 5CVUA 5BPIA 3GTQJ 2KISA 1KU3A 2Y0SN 4G9YA 1I50J 3AG4H 1MNEA 5EZHA 2D5VA 2DMNA 2CFXA 2JK3A 3E5XA 5L3EA 2Y0MA 1QPMA 3LSIA 4RDUA 3O6BB 3I5UA 1WRJA 3FXUA 2EJRA 2F6CA 5CVRA 1SD5A 3U1KA 3H1CA 3CF5F 2JSPA 3Q5FA 3K10A 3QPLA 3ZPLA 4IHTA 3MZHA 3L2WA 2CUJA 3CCEI 4A6DA 3HOSA 2EZLA 1OYWA 4ZTJA 4M72A 2ZB9A 2FE3A 3TL4X 4IL6C 1P7IA 5JHFA 2IS2A 2QSFX 4YG2F 3CJNA 4N4OB 2A69F 2E1CA 1YQAA 1GDTA 4UB6C 2QUFA 3P9KA 3GZ6A 5DEQA 4DYQA 2AXLA 2VQGA 5B3SH 1TNSA 1IF1A 1RUNA 3VB2A 3CCQI 1Z3YA 2R7RA 4L9TA 4RS8A 3UNGC 1KZHA 1NHAA 3VDXA 5L3BA 4IQJA 2WA0A 2H8WA 3H3UA 4BE2A 1IN6A 2YU9J 1QHHD 3H9GA 2L5QA 3GTGJ 1R1TA 4PGGA 3KLNA 1Y6IA 1X1CA 3H3VK 1E3HA 3W2WA 2WWYA 5K7ZA 1T33A 1ZAOA 1UJ8A 4WF2A 1XC5A 3RKYA 3FHZA 3Q0WA 3T8RA 1ZG5A 4O3MA 4IRIA 2QWWA 1MNMC 5B5EC 4ENMA 1E2XA 3FMQA 1JTYA 1QRYA 3HOWJ 2X4HA 2MD0A 3FBNB 3D5LA 3E3VA 1D0ZA 2VIXA 4XSZF 3JRGA 4E70A 2KKOA 3FXOA 1VQKI 2NVQJ 1W7PA 2Z2SB 3KZIC 4XLEA 5IT9K 2WAEA 2EZIA 4JOMA 2V7FA 4Y17A 4CGZA 1FT9A 1HA8A 3KFWX 5H6RA 4MLOA 1Z7LA 2XIGA 3TMOA 2X6OA 3ZN1A 5IPAA 2DCEA 4F91B 1FY7A 1IDYA 2FBIA 4BUPA 2PX9A 2XGEA 4A3DJ 2O8XA 3EETA 2M45A 3QP6A 2V79A 4U88A 3RKWA 2HS5A 5D5VB 4PJMA 5GP9A 3HOXJ 4FQGA 3TDUC 2LY2A 5IT3A 3M3YJ 3WGHA 4MQ9F 1LB2A 3PM1A 4M73A 4A3FJ 2BY1A 1NG6A 3LSPA 5EDNA 1I3QJ 2M30A 3KPHA 2GQQA 4CCJA 4U7BA 1APLC 1MMNA 4CYDA 4DBQA 2UXXA 3QU3A 4ETSA 1FLIA 1SMYF 4XKBA 1M1EB 4E7JA 1YE9A 2DA6A 3J81Z 4Y13A 1VQLI 1POGA 2GXAA 4JQFA 4I2OA 2QF7A 1R23A 1ZRCA 2TRTA 2PN6A 2R93J 1V4RA 4I7HA 5AIQA 3MQ0A 4NHJA 3F8MA 4AYBA 1YITI 2RREA 3H0GJ 1O57A 3HL2A 3CCMI 3JRHA 4HOBA 2E1MB 4XNFA 3P7NA 4TV7A 1G59A 1DU0A 2QGUA 4XIDA 4JBAA 3CD6I 4NC6A 2L4MA 4BEHA 4EVIA 4XMYA 3CDLA 3BG5A 1IV6A 1VQNI 4CICA 2LDUA 2CUFA 4Y7NJ 1HKSA 2OBPA 3K4CA 1HC8A 2F5DA 1D1BA 2KLOA 3GTLJ 3HRUA 4HQMA 1OCZH 1MJAA 4YFKF 5J8FA 1TBXA 1SD4A 1HCRA 3BOQA 3L1PA 5ILSA 4BDZA 1X1BA 2EZKA 3VSKA 1ZRDA 1BR1A 2VPLA 2OC6A 5J4YA 4BS9A 2H6BA 1KU2A 1XS9A 2V4JC 4U0VA 2HQRA 2WBMA 2CWEA 3BWGA 2K9QA 3DWLE 3ECHA 4BEHB 5E18F 2HOTA 3I55I 3QWLA 4OINF 3RQIA 1PJRA 3B6AA 4MQVA 4ESFA 2W00A 1FYMA 2R7OA 4LITA 2O6GE 1O4XA 1IRZA 3E6BA 3FHNA 4IHSA 2FJ1A 2ZJQF 3B6CA 2LYCA 4HLXA 5DD4A 1YJ9I 4KITB 1TT5B 2VJJA 1K6OA 2X1DA 2OA4A 4RLQA 2CW8A 4IPAA 1W5CC 2A5WA 3ASNH 1XGMA 2ECBA 2FSWA 1JE8A 4RMNA 2ISYA 4G12A 3V8JA 4AU7A 1I6XA 2WAFA 3CCSI 5DCFA 1SAXA 4M74A 2E7XA 1I27A 2W7NA 3S3MA 4IKFA 3QODA 5F0FA 3ZMDA 1PP7U 4UHTA 2JPCA 3H5RA 4MNUA 2R3SA 2Y0SA 2JA8J 2DA5A 3G1OA 1X3UA 4S0HB 2FQ3A 2MD5A 3V8KA 3BR3A 2NRAC 3PIOF 2M7BA 3A4CA 3BQZA 3OL4A 1S72I 2YX4A 4WXDA 2R92J 4RAGA 3VYSB 2M0CA 3NEUA 4L9NA 5LHHA 3ABLH 4Y33A 1U78A 1IAWA 5FLMJ 3DPUA 1IXRC 4I01A 1X58A 2MC4A 2P5VA 3MKWB 4M3GA 2R5ZB 4A3IJ 4I99C 2HDCA 5F1RA 3CESA 4WCGA 4X6AJ 4D7MA 1WCMJ 3VYTB 3T1BA 4PFOA 5BQTA 2ZFWA 3T5XA 4A0YA 3MKYB 4Q48A 4E7LA 1TP4A 2KIFA 3DEUA 3E7LA 1MMGA 1FSHA 2DFHA 4ANJA 3DQVC 5F08A 5B1BH 4D9JA 3IRQA 5C44J 3WTWC 1FEXA 2QYOA 2Z1DA 1JGGA 2V9PA 2VBXA 2V26A 2GWRA 2LC2A 3JTHA 2YUSA 2QBYA 1W5TA 2RNGA 3PNTA 2QKMB 2X85A 3QAHA 1HW2A 3KLOA 5K1YA 2P7CB 1IO2A 5KAFC 3OYMA 2X6XA 2CG4A 1FYLA 4XRMA 2NOJB 4EM0B 1YYVA 1FIPA 2A07F 4ZC3A 1JT6A 5HODA 1U8BA 2V1NA 4QTRA 2YR2A 3RTRA 2XF7A 3GVAA 4LG3A 2WY7Q 5D6FA 5E3OA 3O8HA 2CSOA 3S2HJ 3K0LA 3ABKH 2F48A 1N77A 2QBYB 5LEJA 3KP4A 4XRSA 2MFZA 2HPMA 3DCFA 2CQNA 2DTRA 2L02A 3DXJF 2IS6A 3FK7A 4F52A 4UVCA 2STTA 2IGNA 1DU6A 3M9AA 2M0MA 1FSEA 3JCUC 4KJZA 3I59A 3ZXSA 2OQRA 3H36A 1YIOA 3GTPJ 2PQ8A 2LH9A 2DPDA 5L3GA 3MN2A 1AA7A 1QVTA 3F8CA 5LD2C 3AG3H 1SAUA 1R58A 2EK5A 2LF8A 2MSYA 4YIIA 2XPUA 1Y0UA 3PNYA 1JJ6C 1IUYA 4IZZA 1Y8RB 5TRDA 2WTEA 3OSFA 4QPOA 5GPCA 3GTKJ 1Y8QB 4BQQA 2HKOA 3IV5A 2IXSA 1AHDP 4CZZA 3I59B 2DA3A 4RAZA 4IVNA 2FQ4A 1X4PA 2FUG2 1OCRH 1T56A 4HQEA 5JHUA 2Z9OA 3GFMA 2EFPA 2L4AA 4BACA 2VKEA 2E60A 4DZJA 1R1UA 2LP0A 2JVHA 3LFKA 1A36A 1MW7A 2O0YA 4BJ6C 4W1UA 4NDLA 3EYIA 2VPRA 2DO7A 2XRNA 4E6KG 1YX3A 5JVTA 2HFHA 3A02A 1VQ4I 3CCJI 2R5YA 5IP7J 2HKXA 1YFHA 3SHFA 1U0JA 5D4SA 1Y1VJ 5KK1A 1IGNA 3OYDA 2OUMA 3DLLF 2UUZA 4S05A 5DUKA 2XHKA 1YHQI 1QU3A 3DBRB 3HEFA 1FIAA 4UUSB 4XICA 5C4XJ 3LMMA 3ZQLA 3HTSB 5FKLA 3TP3A 2EFQA 1FBUA 2O03A 2E5ZA 3DP7A 2K27A 2IVMA 1T39A 3K4BA 2W24A 3G71I 3FM5A 4C3JJ 4QSHA 3IH2A 3Q0VA 1Z0XA 1FBSA 1H0MA 5IYCJ 1P6RA 2RKHA 1GHCA 3C2GA 1WSUA 4BHPA 2L9SA 5J47A 4HPQA 2DFFA 5EYRA 4RLFA 4LB5A 4NC8A 3ZN0A 4E7IA 3OV8A 2B63J 4KT5C 4DGWB 2CQQA 3DEEA 3OL3A 2I5UA 3BTCA 2GM4A 3V7RA 2ESNA 1U5TA 2CUZA 1U8RA 4GRIA 2VT3A 1D1AA 2R7FA 4KIFA 2XAUA 5M5XJ 1W36C 2WV1A 2X1EA 2R7ZJ 3K2ZA 4UUVA 1F4KA 4BKXA 1LUJB 1I39A 1P2FA 4RA2A 3J7AO 4HSRA 2FEZA 2ZJRF 4XKWA 3OR1C 1I3AA 2G0EA 1P4AA 3PQKA 1QZYA 2A3SA 1R71A 2XAFA 3ZMVA 4GCVA 1REPC 2XKPA 1MBJA 1RUOA 4MEXF 1XDUA 1GVJA 2V9KA 2LD5A 2UWMA 2PBIA 5IYDJ 1FP1D 1Y39A 3BY6A 1MIJA 3VSLA 3V8LA 1R5ID 1K6YA 1U5TB 3FX3A 2GZWA 3RYRA 3WGGA 3BQYA 2QENA 2FA5A 1W1WE 2XAJA 3FF5A 1LDJA 1D5VA 3HSEA 3TO6A 3CDHA 1KONA 1Z7UA 1TNTA 5J1RA 2Z3YA 2DAOA 4C3HJ 5FLVA 3H0DA 2L7ZA 3H5AA 2CJJA 4IHXA 5KAIC 2CW0F 1ORKA 2XF6A 4BDYA 3IRRA 4XORA 1HLVA 4AUXA 2R7XA 4G94A 4U0YA 4GFBA 3G73A 2NNYA 1TW2A 5GTHC 3ZMSA 4LMYA 4C3IJ 4WXHA 5DCMB 5TJJA 1FYKA 4IF4A 1X1PA 3I56I 3L2VA 2H8RA 2ZSIB 3MWMA 2LKPA 1Z9CA 3BTJA 1K78B 2MBFA 3F21A 5FLXK 3R0AA 2JUGA 1DP3A 3GEZA 2MH9A 2CS3A 3TDZC 3WTVC 2XAQA 2CQ7A 2E2HJ 4K2EA 1JUSA 3V42A 1QA6A 3CJQB 1BI1A 2IAIA 2K9SA 3JREA 1R5HA 4BAYA 2OAZA 3OSGA 4A0ZA 5J8CA 3K70D 2OU2A 4XLCA 3MKZA 3PO3J 1JUPA 5FFXA 1XPXA 4LG0A 3JRCA 4AIKA 4N0BA 1LFPA 1QGPA 4LFUA 1J0RA 4WX9A 3I64A 2R7UA 5JLWA 2MYSA 1ZGAA 2IS4A 1XCVA 5E17F 3C18A 1VTNC 4OIQF 3GBGA 2VJIA 3GTOJ 3IH3A 4HX8A 1B59A 1UFMA 2IGMA 2LKSA 3RCOA 1OR7A 5LRRA 2IBDA 4DOZA 1MJBA 2JUCA 1BBYA 3KEYA 4BHBA 4L18B 4ZZDA 4DZPA 4C2UA 3SJMA 4UVAA 2K4JA 3M1CA 4IOCF 1ZR4A 3ESWB 4LG0B 4IHWA 3RZOJ 1RKWA 2DA1A 3BG3A 2OD5A 4XQFA 3N97A 3J80Z 4V2FA 5KVRA 4L9VA 3JAMK 3OYAA 5BPDA 3C1DA 4FX0A 2E5NA 3RI4A 2QZ8A 1EKEA 2F4OB 3K4MA 4I0AA 1F9NA 1Y0NA 3FXRA 4UB8C 5E1ZB 5D5XB 2XGCA 2E1OA 3E0JB 4HNTA 3CUQA 1K7AA 5FKKA 1XGSA 3CLQA 4UV9A 2G7HA 1MSEC 4XONA 3SZGA 5E3LA 3WODF 3EYYA 5FKMA 3FXJA 4CYCB 4II3A 4PSXA 3I4MJ 4YFXF 3F8NA 1QZZA 2OQGA 4OIOF 1GV5A 2Q2EA 2X1CA 3HJEA 4LLGF 3RPUD 1YOVB 4HRIA 2DTZA 4KIBA 2FXAA 2QEXI 4UVBA 3F9KA 2M7AA 2LNBA 1VI0A 3LWFA 1TWCJ 4A3GJ 1EF4A 2H6CA 2L7KA 4LB6B 5BOXA 4XN3A 5LEKA 3F22A 2CMPA 2ELKA 4U7DA 5E3MA 2ECCA 1IRFA 3SDBA 1OJLA 2E2JJ 1WJBA 4I76A 1G8XA 3ZQFA 1FTZA 1Z6RA 2GOXB 4DNCA 4XR6A 2VE9A 1H9GA 2RGVA 1ERDA 3HZJA 2CGPA 5EEGA 2E1MC 3I4NJ 2P5KA 1HDDC 3ZQHA 3PFYA 2GIZA 2DBBA 2VQLA 2Q2EB 4Z6YA 2DI3A 2HOEA 3WTXC 2AXTC 2KDOA 2YSRA 2ELJA 3I53A 4AIHA 4RM3A 1S29A 4MTEA 3VPRA 1ZR2A 4LIUA 1O3RA 3HBLA 1BIBA 2DYRH 3JRBA 2LREA 4CCKA 1RESA 4M6VA 4BH9A 3M1EA 3TP0A 2PJRB 4G6TB 1BOAA 5K5QA 4QLCU 2HQAA 1SEUA 5FRNA 5L3DA 4ZDPA 5EZGA 3KYCB 3KX2A 2W84A 2V9VA 1GUUA 4PJ0C 5D5UB 3OS2A 4CCMA 1OPCA 3CJRB 3H35A 4XLNF 4J01A 1PP8F 3IHUA 4B8XA 2LTPA 3D1NI 3PO2J 2D1VA 2P6SA 3TOAA 1Y1WJ 1PDNC 2HVRA 3C2HA 2EIKH 1I6HJ 2IW5A 2QCOA 3HPGA 1YLFA 2QQAA 4YIFA 1WKMA 3CCYA 1F5TA 2EPFA 1F1ZA 2DK8A 3F72A 4CCOA 2VUMJ 5FKOA 3GFLA 5L3CA 2DMPA 3WTUC 4NC7A 1ITYA 1GV2A 3HSFA 5HS8A 5CJ9A 4HYEA 4BBRJ 4HG2A 4FE4A 5A2QZ 1XSVA 4IOAF 4NQWA 5EEAA 4ZJZA 1MD0A 2G9WA 2COMA 4U0WA 5EEHA 1N75A 4KICA 2H27A 2DMQA 1K61A 1B6AA 2KMUA 1FMWA 3BLYA 1IXCA 1Z3XA 2LR8A 1NH3A 1OISA 4PGHA 2GA2A 2B0LA 3SXYA 2A61A 2GOMA 2V1XA 4HEA2 2ISZA 2DA2A 1SVMA 1WGXA 2EFNA 5TISC 3PUFA 2ZMEC 4HBLA 3ZP5A 2YX7A 3SZTA 1IV8A 1ZQ3P 3CZ6A 1W7PB 2A68F 5LGNA 2R0QC 1TT0A 4MTDA 2HNHA 1CQTA 1F43A 4QIWN 1T6SA 3TW6A 3JRIA 3CMAI 4A3MJ 1FWZA 4QPQA 3CLOA 1HW1A 3OYEA 3MZYA 2M8GX 5JR3A 4E4HA 4FE7A 1ON2A 2EA4A 1R5GA 1EH8A 4JK1X 4JX6A 1YTYA 1ZGWA 1YW9A 3VEPA 2HZTA 2L9VA 2X6YA 5ERIA 1R00A 1MBKA 4A3JJ 2KP6A 5E1XA 3HTUA 1I5ZA 2ME6A 2L9RA 2O3FA 1UAAA 1MMDA 1E3PA 3BZ6A 4UUTA 4Q47A 4M71A 4AD9A 2D2WA 1I1GA 3K4KA 2LVSA 4M3DA 3WG7H 5M3MJ 4PJLA 1I1SA 4BU2A 4C9YA 2RN7A 1T8IA 1ZK8A 2CU7A 3FZVA 2XRLA 2HYJA 2VE8A 5GAGJ 2PEXA 1BL0A 5H6QA 4E7HA 2HVSA 2UXNA 4L9JA 5DTDA 2R7WA 3LOCA 2DXIA 5LRSA 2ZNYA 3ZR8X 4G8XA 3IKTA 3S3NA 3WTSC 1B8IA 3OYFA 1MBFA 1D1CA 4Z2YA 4KISA 1V5EA 4OMZA 1CGPA 2Y48A 1ETQA 1UCRA 3BG7A 3CDIA 3K1NA 4RB0A 3OYGA 4BE0A 1LQ1A 3OR2C 2ADUA 2MLKA 4HX4A 3JRDA 1MBGA 3CC4I 1RETA 3BDDA 4C2TA 3ZGKA 1OYYA 1SFXA 1Z6TA 1IN5A 3KETA 1WJ5A 5GPAA 1QPIA 4NUBA 4M6XA 3CMMA 1U3EM 4F3QA 1USSA 2VBZA 3P9CA 2GAUA 4IX7A 1RRJA 1N78A 4PZJA 3RPUA 1BR2A 3X2QH 4NNJA 4KT6A 2K9NA 3CC2I 2CRGA 2L7MP 3B02A 2O8KA 2RVCA 3IP4B 4IQ4A 1Z1DA 5KNLA 2XAHA 4B47A 1B8IB 1TWHJ 2W4SA 3HOVJ 4IRHA 3A1YA 3DKYA 1LPQA 3W3CA 2VOOA 4P1WA 4DJAA 4HV6A 4AWXB 4BXUA 5FD6A 1VFCA 1OQYA 2UV1A 2K85A 1KU9A 2VODA 5JVGF 1KQ8A 3OYBA 1ONVA 3GX4X 1KA8A 1IN4A 1H88C 4LLLA 5DM6F 2IA1A 3QOPA 2QQ9A 2OCEA 2K4BA 2WAQN 2ZMEA 3OY9A 3B73A 4OAZA 3DV8A 3K9TA 4LK0F 2FX0A 4M9SA 3SYTA 3K2AA 2P7VB 5AONA 1OFCX 1ZYRF 5FD5A 1HQCA 2XDVA 4G6DA 4F92B 3J7YJ 2B9SA 1YG2A 1JT0A 3G6EI 2R7TA 1GLNA 5IP9J 3I9V2 1EJ9A 1ZREA 2BV6A 3O2PE 3OYHA 3EUKL 1QO0D 3EUHC 3RQ4A 2L0KA 1Z91A 2VB6A 1DQUA 4G7OF 3ULQB 1VQOI 4FASD 3KCCA 3U21A 4C2MJ 3CC7I 3JTGA 3BJAA 3R6SA 1G6NA 2AHQA 3R60A 2ZMEB 3DTEA 3SEZA 4D0PA 3O8GA 2W85A 3BTIA 3WG9A 3I3LA 1WJCA 2RV8A 4XL9A 2VXZA 2CFOA 3NQOA 1LEAA 2K7LA 1UHSA 5FFZA 3T8TA 3HRMA 2GA1A 2L9NA 3C3WA 2ZJ2A 3FDYA 3PNVA 4EJTA 1IC8A 4EM2A 5H20A 1FTTA 1IN7A 2Y9YA 3TOBA 4MHGA 4H0EA 3OWTA 3N05A 2BEOA 4EQQA 1R4MB 1SVLA 5ED4A 1QNTA 1G3TA 5IOZA 2E71A 2VLAA 2DODA 2FRHA 2VASA 1LDKB 2KZVA 2QQBA 2MH2A 4X1EA 3IAS2 5LHIA 2OV7A 1ETYA 3HUGA 5HLIA 2PJPA 2X48A 4HF1A 2VQHA 1S7OA 4WK8F 1AWCA 1JI8A 3NARA 3ZCOA 1UB9A 3BG6A 4RGSA 4R79A 3QYEA 2KL4A 4IJAA 2ACJA 4OIRF 3DBHB 3S15J 1CF7A 2XPVA 2A5YB 4WXCA 2LY9A 3ABUA 3MD2A 2LFBA 1T0FC 3C7JA 5HNHA 3VWBA 2HVQA 3LA3A 2BBYA 5F6FA 2BXYA 5CKTA 1WJEA 2FNPA 3GTMJ 2JA2A 4O5VA 4DQ2A 1Z05A 2H94A 1J5YA 1LNWA 2LBFA 4EEFG 4KMFA 3QPSA 4IRGA 1LFUP 3JSPA 1V5FA 3HM5A 3MCZA 3FKIJ 1SC7A 1P92A 4MEYF 2XB0X 2IP2A 2AO9A 3BR5A 3CMEI 2VKDA 3S32A 3S14J 2J5OA 2KRFA 2PMHA 4F7ZA 1PYVA 3R0JA 1U5TC 4GXOA 2M4KA 5DV5A 1B1BA 5L3FA 4FETA 1FOKA 4OIPF 4YEJA 1UMQA 2KRHA 3LFUA 1B72A 3ZQGA 4PFPA 4RGUA 4KDPA 5HLTA 3S1QJ 1ETXA 1YS7A 2EV0A 2BHZA 1WWXA 1IUFA 3EQLF 3EUHA 1BN5A 4FCYA 1UG2A 5M5YJ 1K79A 3T0YA 2M3AA 1IRXA 2R7QA 2OF7A 4KIGA 3CUOA 1KGSA 4HNVA 1ETWA 1S9HA 3KEOA 3LAJA 1KQ0A 1J7KA 4GDFA 3HYIA 1MH4A 2P0WA 1ZELA 3TO7A 5IOYA 3HRSA 1PUEE 5J4VA 2Y9ZA 3CTAA 3WU1B 4ZTFA 1LVKA 1ACIA 1ODDA 3QQAA 1KQ9A 2H1LA 3J7AY 3P5JA 4L0ZB 1TC3C 2EH3A 2H09A 4HF2A 3CP8A 2DA7A 2OPTA 2OTLI 2KZGA 1MJ9A 2JA5J 3CMYA 3HOZJ 4D5CA 4RGXA 1BOBA 3QPTA 4ZYEA 1H89C 1S3JA 1SD7A 1MSFC 3IWZA 2R4GA 2X0LA 3HPHA 2DMUA 3ZQQA 3FXLA 3K7AJ 3J81K 1UHWA 3BPVA 1QBJA 4HDUA 3KYLA 3GMEA 3NWSA 4BQOA 3K69A 4A3BJ 2E7WA 2VKVA 3DFGA 3RKXA 1BM9A 3KE2A 1X3WB 2IGOA 4JP0A 4NBQA 4P55A 4CA0A 4ZZLA 5B66C 4MGRA 2DDAA 1ZH5A 5J6XA 4UXNA 2V6CA 1FNNA 1T0FA 1WPKA 1XGNA 4E7SA 3RKQA 2R5YB 2W57A 1Q1VA 1XCBA 3IC7A 3CCRI 4MIMA 3WU0A 1TW3A 3K4JA 1R6RA 4B44A 1MDMA 2KRCA 3MZ8A 3Q9VA 1Z67A 5CVVA 4AVZA 3HKZN 3WHCA 1DGRM 4HDVA 3IKVA 3MFKA 1ZG3A 2A6HF 2EZHA 1VQ6I 5BMZA 2NVXJ 4CO8A 2HGCA 1ULYA 2E1NA 1F36A 3QU6A 2NVUB 1VQ5I 1HDPA 1W0UA 1SFEA 3GCMA 1OR7C 1X2NA 5D8LB 3VYRB 2WAQA 1FOYA 3W6KB 4CCLA 1TWAJ 3BP8A 2ESHA 2LG4A 4V2GA 4EGYA 4M3FA 4M9XA 1RR7A 1WI3A 5GAEJ 3LSRA 1MDMB 3WTYC 1SFKA 3DLAA 3ASOH 4J00A 4ZYDA 2IA2A 5IT9Z 2IGKA 1S5LC 4PSWA 1IRGA 1J09A 1T98A 1X19A 4PJJA 1JKRC 1HOMA 4RB2C 1WJFA 5LGUA 1W4MA 2ZXHA 4Y3OA 3G2BA 4I0BA 2X6WA 3CUQC 1PUFA 2M5WA 1RI7A 4CSWA 2VN2A 2K9MA 1VQ7I 4DYCA 4BL0B 1R4NB 4M3BA 5IP6A 4RM2A 1DPRA 4H4KC 5JI6A 1D3YA 1ENHA 1O3SA 2LMDA 3HIFA 3FWEA 1WQ2A 3GW2A 2LOOA 3CF2A 1TL8A 3I4PA 1RZ4A 5ICFA 1OCOH 3S1MJ 1X2MA 2BGCA 2O61A 5FB2A 2NS8A 5FJ8J 1LEBA 1W5SA 4B4CA 1EH6A 4E7ZA 3RPQA 2ZXJA 1FOXA 3OOUA 2IA0A 1XG1A 3GF2A 4A3LJ 3DKXA 3ISPA 1JGSA 2XAGA 2AS5F 1UHMA 3S3OA 2EBIA 2UZKA 3KIOA 4XRFA 4Q4ZF 4I09A 2KDZA 2E34A 1OCTC 2VC0A 5FO5A 2VBWA 1SVOA 2WB1N 1JXSA 3LNQA 3AL0C 1HW5A 1DPUA 1PVEA 4BYYA 1X3ZB 3RZDJ 1WH7A 5K5RA 5E1WA 3U1DA 4FTHA 1ZG1A 4RAYA 4ZDLA 1H8AC 3H9QA 3LSJA 3V4GA 5CQEA 3IH4A 1U6GA 5KCMA 4P5OA 2I10A 2VBYA 3QRFF 3D5RC 1LKXA 3S8PA 2M9HA 4A5MA 2Z16A 2M8EA 1R1VA 4EJWA 2K40A 3L2RA 2HR3A 1FJLA 2XPWA 3NRVA 2GLOA 2P4WA 3MMYB 1YW7A 3E1SA 2ELHA 4BE1A 3GXOA 2DK5A 3OIPA 5F0HA 3TEDA 1S7AA 3WU2C 1T38A 5FKNA 1T08B 1HSJA 1BA5A 2K02A 3KP5A 2R7SA 4BY7J 3GFJA 3LSMA 3LA7A 4XLFA 3F3XA 4B09A 1DDNA 2BY0A 1BJAA 3HG9A 3TO9A 3WHBA 2LK2A 4AVPA 3S2DJ 1IW7F 1STZA 3HGYA 4KYWA 1T95A 2FD5A 3MEXA 2ZBKA 1BI0A 1V55H 3LSKA 2E2IJ 3GZ5A 1BC8C 2C6YA 3CCUI 1TZLA 3SQNA 3BTLA 2HPIA 3A0BC 1VQMI 2BE5F 1P7JA 2HYGD 3TGNA 1E17A 2DOEA 2KIMA 2V1UA 4IHYA 4XKVA 2FMLA 3K4NA 2HI3A 3I71A 1R36A 3SEQA 3CP2A 2ID6A 2M34A 3G1LA 5HDNA 5HLHA 1YJWI 5M3FJ 1YIJI 2JA7J 1ZRFA 2L2OA 2G7UA 2AQEA 5TGTA 1J9IA 1D8JA 5K7FA 4M9ZA 3H5NA 3BPXA 3SDGA 2JRMA 3E97A 4JX4A 3ABTA 1LVAA 2DA4A 3D0SA 3WTZA 3CUQB 3A2KA 3HSRA 4JYKA 1HBXG 1JUMA 5JFRA 5J3LA 2EIMH 3K70C 5BNGA 2EWNA 3ROUA 5DDGA 4BJ5C 2JVGA 3LSHA 2CW7A 3W6VA 3TKYA 2Y69H 4AIJA 3ZRGA 3SFZA 3JW4A 3G1MA 3CQZJ 2D45A 1TQPA 3TQNA 4A93J 4A12A 2F2EA 2DYSH 2O9LA 3GLXA 1V5GA 2KIQA 3DF8A 1JHFA 3HDDA 2A6EF 1N25A 1XGOA 5JLXA 2FOWA 2HU9A 1BR4A 2Y75A 3GUDA 4B3AA 1A31A 3HGGA 2Y31A 4DYRA 4WWCA 4P96A 4HLYA 2HYFA 3PIPF 4RB1A 3HKZA 5HS7A 2KT0A 2F4IA 3F6VA 2BOLA 2I8DA 2HDWA 1U9OA 2M1BA 1WH5A 1R49A 1G3WA 4IO9F 1GVDA 4CDGA 4RB3C 4UV8A 3L2UA 4ZYAA 2STWA 5ILUA 1IZ1A 1SFOJ 4YFNF 3DTIA 3IL2A 2P8TA 1WI9A 4Q5SF 2QM3A 2CV2A 2HOSA 1DGWY 4OWRB 3AL0B 5CQGA 3CCVI 3L09A 2OJED 3OYIA 3ZQIA 2YPRA 3F6OA 5ICEA 1HXDA 4E7KA 2YU3A 3H9JA 4PUSA 1XB4A 1G3YA 4ZDOA 2K5CA 3MKLA 2ZC2A 4ZYGA 5ICGA 4A3KJ 2Y30A 3HHHA 4ASNA 3PJRA 3PL8A 2ZFUA 2Z5UA 3TW7A 2ZNZA 3BG9A 2XB5A 5CYVA 2JT1A 3DKWA 4DBRA 4LJZF 1A6QA 1C0WA 4AM3A 1JHHA 3DPLC 3AFHA 2MABA 3FBIB 3OYKA 1NTCA 2DW4A 2JJ7A 4OAYA 2LKXA 1FZPB 1YS6A 4HAMA 1A35A 2A6TA 3I54A 1S7EA 4RGRA 2HWVA 2IRFG 3BR2A 1KU7A 4FHTA 3R4KA 4BXFA 2BVLA 1YW8A 4XK4A 2QA4I 5FGMA 5HLGA 1R7JA 3VYUB 4BNCA 4XOPA 4ABZA 4XRSG 4C30A 2HDDA 4W97A 2QSHX 5E79C 4NQWB 2A05A 3BC8A 4EATA 4XKCA 3L2CA 1VQ8I 4DW6A 4FX4A 1OMIA 1USTA 1RIOH 2DU9A 5E8IA 3CCLI 1MNDA 3HHGA 2L54A 2VXDA 3IAM2 1XMKA 2GXBA 3JRAA 2PMZN 1JJ8C 2Z99A 5K7HA 4EJOA 4BBSJ 4CUGA 2EQRA 2WB1A 4LGWA 2VONA 1X4OA 1BW5A 1ZGJA 1EH7A 1QQIA 4LIVA 2NOGA 3RYPA 3PQJA 2COBA 1MH3A 5HDGA 4YRVA 2XVCA 2DN0A 3H3ZA 4L5IA 1BC7C 1IN8A 3RJPA 2VQCA 4S04A 5LBQA 3FM3A 3LAPA 3L7WA 2HTJA 1SANA 4A5NA 5IYBJ 1OKRA 1MGTA 4GGGA 4BQNA 3VODA 4XLAA 1S6LA 4L5EA 2JSCA 3HXLA 5D5WB 5DYMA 5AIPA 1OYIA 3ML6A 1Q1HA 1B9NA 4IEJA 1T2KA 1BI2A 3VOEA 1L3LA 3BT9A 1RR8C 4M3EA 5F0CA 2OTJI 4EJUA 4I98B 3F0CA 3LQRA 3FIWA 6PAXA 3S16J 2EFWA 1AKHA 5LGTA 3BR6A 5CVIA 3TBIA 1V3FA 3J80K 3PFIA 2CV0A 1EA3A 2DQLA 2HXOA 1MZBA 3IWFA 3REOA 1TQMA 4EGZA 3KP3A 1IXSB 3KEQA 2JN6A 3F23A 5H2FC 3OYJA 1JKOC 4XSXF 2Q8KA 3WGIA 3LQQA 2XSDC 3HC7A 4LLNA 1ZHFA 1JKQC 1KYWA 4F93B 1D5YA 5ILVA 3G4SI 1QVUA 3LSGA 2HQ5A 2R5ZA 2HOAA 4PDKA 1AKHB 2DQRA 2M87A 2ZXIA 1Z77A 3CJTB 2NNNA 4D1QA 3HOUJ 1OCPA 4Y15A 5M5WJ 3NWTA 2JWTA 4BGDA 3U9GA 2VL8A 2FF4A 1BIAA 2ETHA 4XLHA 5D6EA 2QKLB 3WE2A 5CPRB 2OCCH 2XV4S 2LY1A 4MFEA 2DPUA 4OU0A 3PUBA 2QSGX 3A01A 2MGQA 4KN7X 4J19A 1XN7A 3BR0A 2MC3A 3M8JA 2K3PA 1G2HA 5FLXZ 5F1JA 2IS1A 3GFIA 1NG7A 2P81A 2W48A 5D8KB 1UELB 3HOTA 1WVRA 5GTIC 2ZJPF 3HOYJ 5DS9A 1G4DA 1IJWC 3E6DA 3HRTA 2ZCWA 4ON0A 2BY3A 4HZFA 1FX7A 1LJ9A 3AG1H 1K4SA 1WFXA 3KZZA 1VQ9I 2HXIA 1K4TA 2W82A 4V19K 2XKOA 2IT0A 1WHUA 2ICWG 1IG7A 5B1AH 1XTAA 1ZARA 2VJ5A 2DDBA 3CO6C 4U87A 2XF5A 2LRDA 2X9DA 4O6JA 4CHUA 2YS9A 2FBKA 4P9UA 4ZYHA 3A01B 1YI2I 1UZCA 3J7ZI 2VI6A 4L0YB 4KNYA 3S1NJ 1XMXA 4CZCA 2ME0A 4DIQA 3S1RJ 4ENJA 4PK4A 2DT6A 1LFBA 2RC4A 2V6EA 1FC3A 3QOEA 3NAUA 4LK1F 5E20A 5BS6A 2X51A 2PLYA 1O7FA 1B9MA 3FXMA 4MFDA 1J59A 1BW6A 1X1AA 1HF0A 3E6CC 4KN4X 2CO5A 4XBFA 3V7SA 5HOOA 2DFEA 3LA2A 9ANTA 2CUEA 4G7HF 2CH0A 1BI3A 3DU5A 3HUGB 2F4MB 2AQFA 2NS7A 2DOFA 2FOKA 3M8EA 1RPWA 4X0GA 3E5UA 1D8KA 1NK3P 3JSOA 3P9IA 1ZLJA 2QLZA 3BJ6A 3JAMZ 3MAJA 4G6QA 1XDSA 1CF7B 2MLGA 4CH7A 3ZOBA 1XX5A 2K9LA 4XOTA 3EDPA 3M4OJ 5A2QK 1MKMA 2VOPA 4HV5A 2K86A 2KFDA 3JR9A 3PSIA 1E0EA 1IDZA 4IHVA 3Q3SA 3W2AA 4ZH4F 2WC2A 2TDXA 2F5FA 3BJOA 2Q0OA 3AAFA 2LBFB 3AKZA 4L5JA 2NVTJ 2PMZA 1U2WA 4GO1A 1U9NA 4BHCA 3OYCA 2GIVA 2MA3A 2IEKA 4B48A 3GLLA 2W25A 2R7DA 1P9QC 4JX5A 3IUOA 1MMSA 2VJ4A 3OIQA 2NAZA 5DUIA 4XM3A 3DPTA 3F8FA 1MBHA 1B4AA 1RNLA 2Y2ZA 4A6EA 2CV1A 4UY8I 3ZMTA 2PMUA 4UNOA 1B72B 1QZEA 3DU6A 3KP6A 1W36D 5IY5H 3BZCA 2HZDA 2L01A 5GAHJ 4BXXJ 3QYBA 2IJLA 2D1HA 3FISA 2LLKA 3ELKA 3OS0A 1VZ0A 3FK6A 2E19A 1VF9A 2VKHA 3KYDB 3WTTC 1YRNA 2EIJH 3ABMH 2IPQX 2R7VA 5DM7F 5K5OA 3BROA 4YELA 4UUSA 5CLSA 1E3OC 3PSFA 3W6JB 5J1YA 1MBEA 5DD8A 3ERED 4ENKA 4N4NB 4B1RA 1K83J 1GT0C 2GXGA 4F55A 4CXFA 2TCTA 1WJAA 5EG0A 3GYHX 1MMAA 4R1HA 1O3TA 5HDKA 2DT7B 1X1DA 5J40A 2EILH 1ETOA 4R8HA 2OZ6A 4ESBA 2EINH 3ZMUA 4M6YA 3W2VA 1O7LA 3FKJA 1SFUA 2VT2A 3ERMA 2P5LC 4B43A 4NB5A 2MW8A 3SFIA 1YRNB 2Q1ZB 2BYVE 1ETKA 1TLHB 1A04A 2EV5A 2L7FP 4OOIA 2CQKA 1XSDA 3I58A 3LL7A 5EG0B 2XC7A 2PI0A 2FMYA 3S17J 4HA8A 3V7CA 2RQPA 2LF7A 2F5CA 1D0YA 2BW3A 4II2A 3OYLA 3E6MA 1QHGA 4N9IA 3OYNA 1YJNI 2PG4A 2ZSHB 3QPHA 1WZ2A 2DFIA 1FMVA 2OZUA 3H92A 1LDDA 2NXNB 5F64A 2O5RA 1W0TA 4LOCA 1XD7A 2ZO4A 1RC9A 4EMSA 3GO5A 4HSTA 2ID3A 4A0XA 2J5PA 5FROA 3OS1A 3M8FA 1KYZA 1VNDA 3MVPA 1D0XA 1HSTA 3S2WA 5GADJ 3ONQA 2EV6A 1FPQA 2H1KA 2GBYA 1VQPI 5HVQC 4RBOA 2XUBA 3ECOA 3N4MA 1OCCH 4EV0A 4FT8A 1R22A 2BW3B 1ZKGA 2DLLA 4CCNA 2BVMA 2F5EA 3I0TA
chains in the Genus database with same CATH topology
5F27A 5BNGA 1U8BA 1BL0A 3W6VA 4QTRA 5DTDA 3LOCA 3HB9A 4I6ZA 3G1MA 5E3OA 3CQZJ 1B8IA 3O8HA 1BJZA 1MBFA 3S2HJ 4A93J 2O9LA 2RAEA 3HDDA 4XRSA 1ETQA 5JLXA 3DCFA 3JRDA 4B3AA 3FK7A 1MBGA 4A3CJ 1RETA 3HGGA 2Y31A 4DYRA 1DU6A 4A3EJ 5EF6A 4BY1J 5GPAA 1QPIA 3GTPJ 2KT0A 2XGDA 1U9OA 2K9NA 3MN2A 1PUFB 1QVTA 1WH5A 2CRGA 2L7MP 2O7OA 2O8KA 1GVDA 1ETVA 2MG4A 2M2EA 1TWHJ 1B8IB 1JKPC 2MSYA 1SFOJ 3HOVJ 3JRFA 3A03A 2JMWA 2HOSA 2XPUA 1JJ6C 1A6IA 1VFCA 3OSFA 3ZQIA 1LE8A 5GPCA 3GTKJ 3IV5A 1AHDP 3BR1A 1H88C 2DA3A 5E3NA 2FQ4A 1R9TJ 1RKTA 1T56A 5C4JJ 2WAQN 1TWFJ 2VKEA 1A5JA 3MKLA 2FX0A 4DZJA 2LP0A 4A3KJ 2Y30A 3K2AA 1OFCX 4W1UA 4NDLA 3TW7A 2VPRA 1TWGJ 3BG9A 2XB5A 5J1UA 1JT0A 3A02A 5C3EJ 2R5YA 5IP7J 5IP9J 4AYBN 3DEWA 1NTCA 1LE8B 1Y1VJ 2JJ7A 2LKXA 1IGNA 2L0KA 1S7EA 3BR2A 3HEFA 4C2MJ 1FIAA 4UUSB 4XICA 5C4XJ 4XK4A 2AHQA 5EGOA 3ZQLA 3Q0UA 5FKLA 3TP3A 4MO7A 2CQXA 3O8GA 3BTIA 2JA6J 4ABZA 4XRSG 2HDDA 3OIOA 4W97A 3ZQCA 4C3JJ 1UHSA 4QSHA 4CYCA 3IH2A 3C2BA 3Q0VA 1IC8A 1FTTA 4DW6A 2Y9YA 5IYCJ 3GTJJ 4A69C 3JRAA 2NVYJ 1AU7A 1ZTRA 5IOZA 2PMZN 1JJ8C 1NK2P 5K7HA 5EYRA 4BBSJ 2EQRA 5EGOB 4AC0A 4X1EA 1BW5A 2B63J 1ETYA 2X48A 2CQQA 4FISA 3BTCA 2GM4A 5F04A 3NARA 4D5FA 2NOGA 3UKGA 5M5XJ 2N8GA 2COBA 1MH3A 3S15J 2XPVA 2DJNA 2WV1A 2R7ZJ 2LY9A 4BKXA 2LFBA 2DN0A 4Y52J 3GTMJ 2G0EA 4D7NA 1SANA 1JTXA 2DMTA 1MBJA 4EEFG 3GTQJ 5IYBJ 3QPSA 1LFUP 2LD5A 3HM5A 5IYDJ 2Y0SN 3FKIJ 1I50J 2D5VA 5EZHA 2XB0X 2AO9A 2DMNA 3BR5A 3BQYA 2JK3A 3S14J 4RDUA 4L5EA 5J1RA 4C3HJ 1UMQA 5FLVA 2L7ZA 2CJJA 4IHXA 1B72A 4IEJA 3ZQGA 1ORKA 3QPLA 1HLVA 3BT9A 4AUXA 4M3EA 3S1QJ 4GFBA 5F0CA 1ETXA 1IUFA 4FCYA 2EZLA 1UG2A 3F0CA 4C3IJ 2ZB9A 5M5YJ 1P7IA 2OF7A 3FIWA 4HNVA 2H8RA 1ETWA 3S16J 1AKHA 3BR6A 1GDTA 1MH4A 3BTJA 5IOYA 4DYQA 2Y9ZA 2HXOA 2E2HJ 3QQAA 2JN6A 1JUSA 1JKOC 2YU9J 2IAIA 2K9SA 2XSDC 3JREA 3OSGA 1TC3C 2EH3A 3PO3J 1JUPA 3GTGJ 3H3VK 1JKQC 3JRCA 2DA7A 2OPTA 1D5YA 5K7ZA 1T33A 2JA5J 3CMYA 1QVUA 3HOZJ 5JLWA 1XC5A 4D5CA 3LSGA 3Q0WA 2HQ5A 2R5ZA 1H89C 1MSFC 2HOAA 1AKHB 1MNMC 2DMUA 3GBGA 3GTOJ 1JTYA 1Z77A 1QRYA 3IH3A 3K7AJ 3HOWJ 3HOUJ 1OCPA 5M5WJ 2JWTA 3JRGA 4A3BJ 2VKVA 2IBDA 2NVQJ 4JP0A 2EZIA 4MFEA 4DZPA 3SJMA 1ZR4A 4IHWA 4MLOA 3A01A 2MGQA 3RZOJ 1RKWA 2X6OA 1WPKA 2DA1A 3BG3A 3BR0A 5IPAA 2R5YB 4J19A 3RKQA 1Q1VA 1IDYA 4MIMA 1G2HA 5F1JA 4V2FA 2P81A 2W48A 2XGEA 4A3DJ 3HOYJ 5DS9A 3HKZN 3WHCA 1IJWC 5GP9A 2EZHA 3HOXJ 2HXIA 2NVXJ 2XGCA 3M3YJ 2E1OA 1F36A 1IG7A 1HDPA 3PM1A 5FKKA 4A3FJ 1W0UA 3LSPA 1X2NA 5EDNA 1MSEC 1I3QJ 5E3LA 1APLC 2X9DA 5FKMA 2YS9A 4CYCB 3I4MJ 3A01B 1TWAJ 1GV5A 2VI6A 4V2GA 2DA6A 4M3FA 3S1NJ 1RR7A 2DTZA 2ME0A 3S1RJ 1WI3A 3LSRA 1POGA 1LFBA 1VI0A 2QF7A 3NAUA 1TWCJ 4A3GJ 1EF4A 2TRTA 2R93J 4MFDA 2ELKA 1BW6A 1HF0A 5E3MA 3H0GJ 2ECCA 2E2JJ 1OJLA 1HOMA 1JKRC 3JRHA 9ANTA 2CUEA 4I76A 3ZQFA 1FTZA 1DU0A 4XIDA 2NS7A 1RPWA 3I4NJ 1NK3P 3CDLA 3BG5A 1PUFA 1HDDC 3ZQHA 1IV6A 4DYCA 2CUFA 4Y7NJ 4M3BA 5IP6A 3ZOBA 3GTLJ 3M4OJ 1ENHA 3VPRA 1ZR2A 1HCRA 3L1PA 3HBLA 2EZKA 3JR9A 1IDZA 4IHVA 1X2MA 3Q3SA 3JRBA 3S1MJ 1RESA 4M6VA 2NS8A 3TP0A 5FJ8J 1XS9A 4B4CA 2NVTJ 1U9NA 2K9QA 5EZGA 3OOUA 1GUUA 1XG1A 2IEKA 2HOTA 4A3LJ 3RQIA 3B6AA 4JX5A 1O4XA 1IRZA 2LTPA 3D1NI 3PO2J 2FJ1A 1Y1WJ 1MBHA 3B6CA 2Y2ZA 1I6HJ 1B72B 2EBIA 2QCOA 2KDZA 4BXXJ 1OCTC 3CCYA 3FISA 2ECBA 2LLKA 2WB1N 3FK6A 3LNQA 2E19A 1VF9A 4G12A 1YRNA 2VUMJ 5FKOA 3RZDJ 1WH7A 2DMPA 4FTHA 1ITYA 1H8AC 4UUSA 1GV2A 1E3OC 3LSJA 5J1YA 1MBEA 3IH4A 5F0FA 4B1RA 4BBRJ 1K83J 2I10A 4FE4A 1GT0C 2JA8J 2TCTA 5EG0A 2DA5A 2M9HA 1FJLA 3G1OA 5EEAA 2K40A 2GLOA 2XPWA 4S0HB 3BR3A 1ETOA 3BQZA 5F0HA 3TEDA 2R92J 2DMQA 1K61A 5FKNA 2M0CA 2MW8A 3SFIA 1U78A 2LR8A 1YRNB 1BA5A 5FLMJ 4BY7J 1X58A 4A3IJ 2R5ZB 1ETKA 4M3GA 2L7FP 4X6AJ 4D7MA 1WCMJ 2DA2A 1WGXA 3WHBA 2LK2A 5EG0B 3S2DJ 3HGYA 1ZQ3P 3S17J 2R0QC 2FD5A 1CQTA 1F43A 3E7LA 2E2IJ 4QIWN 3TW6A 3JRIA 4A3MJ 3BTLA 1P7JA 4IHYA 5F08A 5C44J 2M8GX 1FEXA 1W0TA 4LOCA 1JGGA 2HI3A 2ID6A 2M34A 3G1LA 4FE7A 2YUSA 5M3FJ 2ID3A 4JX6A 1ZGWA 2JA7J 1VNDA 3MVPA 1MBKA 4A3JJ 2ME6A 2L9RA 2H1KA 2GBYA 5K7FA 4UUTA 4RBOA 2LVSA 4JX4A 4M3DA 3SDGA 5M3MJ 2DA4A 4XRMA 1ZK8A 4JYKA 1JUMA 2CU7A 1ZKGA 1FIPA 2XRLA 5J3LA 1Z0XA 2HYJA 1JT6A 5HODA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5F27 A;  5BNG A;  1U8B A;  1BL0 A;  3W6V A;  4QTR A;  5DTD A;  3LOC A;  3HB9 A;  4I6Z A;  3G1M A;  5E3O A;  3CQZ J;  1B8I A;  3O8H A;  1BJZ A;  1MBF A;  3S2H J;  4A93 J;  2O9L A;  2RAE A;  3HDD A;  4XRS A;  1ETQ A;  5JLX A;  3DCF A;  3JRD A;  4B3A A;  3FK7 A;  1MBG A;  4A3C J;  1RET A;  3HGG A;  2Y31 A;  4DYR A;  1DU6 A;  4A3E J;  5EF6 A;  4BY1 J;  5GPA A;  1QPI A;  3GTP J;  2KT0 A;  2XGD A;  1U9O A;  2K9N A;  3MN2 A;  1PUF B;  1QVT A;  1WH5 A;  2CRG A;  2L7M P;  2O7O A;  2O8K A;  1GVD A;  1ETV A;  2MG4 A;  2M2E A;  1TWH J;  1B8I B;  1JKP C;  2MSY A;  1SFO J;  3HOV J;  3JRF A;  3A03 A;  2JMW A;  2HOS A;  2XPU A;  1JJ6 C;  1A6I A;  1VFC A;  3OSF A;  3ZQI A;  1LE8 A;  5GPC A;  3GTK J;  3IV5 A;  1AHD P;  3BR1 A;  1H88 C;  2DA3 A;  5E3N A;  2FQ4 A;  1R9T J;  1RKT A;  1T56 A;  5C4J J;  2WAQ N;  1TWF J;  2VKE A;  1A5J A;  3MKL A;  2FX0 A;  4DZJ A;  2LP0 A;  4A3K J;  2Y30 A;  3K2A A;  1OFC X;  4W1U A;  4NDL A;  3TW7 A;  2VPR A;  1TWG J;  3BG9 A;  2XB5 A;  5J1U A;  1JT0 A;  3A02 A;  5C3E J;  2R5Y A;  5IP7 J;  5IP9 J;  4AYB N;  3DEW A;  1NTC A;  1LE8 B;  1Y1V J;  2JJ7 A;  2LKX A;  1IGN A;  2L0K A;  1S7E A;  3BR2 A;  3HEF A;  4C2M J;  1FIA A;  4UUS B;  4XIC A;  5C4X J;  4XK4 A;  2AHQ A;  5EGO A;  3ZQL A;  3Q0U A;  5FKL A;  3TP3 A;  4MO7 A;  2CQX A;  3O8G A;  3BTI A;  2JA6 J;  4ABZ A;  4XRS G;  2HDD A;  3OIO A;  4W97 A;  3ZQC A;  4C3J J;  1UHS A;  4QSH A;  4CYC A;  3IH2 A;  3C2B A;  3Q0V A;  1IC8 A;  1FTT A;  4DW6 A;  2Y9Y A;  5IYC J;  3GTJ J;  4A69 C;  3JRA A;  2NVY J;  1AU7 A;  1ZTR A;  5IOZ A;  2PMZ N;  1JJ8 C;  1NK2 P;  5K7H A;  5EYR A;  4BBS J;  2EQR A;  5EGO B;  4AC0 A;  4X1E A;  1BW5 A;  2B63 J;  1ETY A;  2X48 A;  2CQQ A;  4FIS A;  3BTC A;  2GM4 A;  5F04 A;  3NAR A;  4D5F A;  2NOG A;  3UKG A;  5M5X J;  2N8G A;  2COB A;  1MH3 A;  3S15 J;  2XPV A;  2DJN A;  2WV1 A;  2R7Z J;  2LY9 A;  4BKX A;  2LFB A;  2DN0 A;  4Y52 J;  3GTM J;  2G0E A;  4D7N A;  1SAN A;  1JTX A;  2DMT A;  1MBJ A;  4EEF G;  3GTQ J;  5IYB J;  3QPS A;  1LFU P;  2LD5 A;  3HM5 A;  5IYD J;  2Y0S N;  3FKI J;  1I50 J;  2D5V A;  5EZH A;  2XB0 X;  2AO9 A;  2DMN A;  3BR5 A;  3BQY A;  2JK3 A;  3S14 J;  4RDU A;  4L5E A;  5J1R A;  4C3H J;  1UMQ A;  5FLV A;  2L7Z A;  2CJJ A;  4IHX A;  1B72 A;  4IEJ A;  3ZQG A;  1ORK A;  3QPL A;  1HLV A;  3BT9 A;  4AUX A;  4M3E A;  3S1Q J;  4GFB A;  5F0C A;  1ETX A;  1IUF A;  4FCY A;  2EZL A;  1UG2 A;  3F0C A;  4C3I J;  2ZB9 A;  5M5Y J;  1P7I A;  2OF7 A;  3FIW A;  4HNV A;  2H8R A;  1ETW A;  3S16 J;  1AKH A;  3BR6 A;  1GDT A;  1MH4 A;  3BTJ A;  5IOY A;  4DYQ A;  2Y9Z A;  2HXO A;  2E2H J;  3QQA A;  2JN6 A;  1JUS A;  1JKO C;  2YU9 J;  2IAI A;  2K9S A;  2XSD C;  3JRE A;  3OSG A;  1TC3 C;  2EH3 A;  3PO3 J;  1JUP A;  3GTG J;  3H3V K;  1JKQ C;  3JRC A;  2DA7 A;  2OPT A;  1D5Y A;  5K7Z A;  1T33 A;  2JA5 J;  3CMY A;  1QVU A;  3HOZ J;  5JLW A;  1XC5 A;  4D5C A;  3LSG A;  3Q0W A;  2HQ5 A;  2R5Z A;  1H89 C;  1MSF C;  2HOA A;  1AKH B;  1MNM C;  2DMU A;  3GBG A;  3GTO J;  1JTY A;  1Z77 A;  1QRY A;  3IH3 A;  3K7A J;  3HOW J;  3HOU J;  1OCP A;  5M5W J;  2JWT A;  3JRG A;  4A3B J;  2VKV A;  2IBD A;  2NVQ J;  4JP0 A;  2EZI A;  4MFE A;  4DZP A;  3SJM A;  1ZR4 A;  4IHW A;  4MLO A;  3A01 A;  2MGQ A;  3RZO J;  1RKW A;  2X6O A;  1WPK A;  2DA1 A;  3BG3 A;  3BR0 A;  5IPA A;  2R5Y B;  4J19 A;  3RKQ A;  1Q1V A;  1IDY A;  4MIM A;  1G2H A;  5F1J A;  4V2F A;  2P81 A;  2W48 A;  2XGE A;  4A3D J;  3HOY J;  5DS9 A;  3HKZ N;  3WHC A;  1IJW C;  5GP9 A;  2EZH A;  3HOX J;  2HXI A;  2NVX J;  2XGC A;  3M3Y J;  2E1O A;  1F36 A;  1IG7 A;  1HDP A;  3PM1 A;  5FKK A;  4A3F J;  1W0U A;  3LSP A;  1X2N A;  5EDN A;  1MSE C;  1I3Q J;  5E3L A;  1APL C;  2X9D A;  5FKM A;  2YS9 A;  4CYC B;  3I4M J;  3A01 B;  1TWA J;  1GV5 A;  2VI6 A;  4V2G A;  2DA6 A;  4M3F A;  3S1N J;  1RR7 A;  2DTZ A;  2ME0 A;  3S1R J;  1WI3 A;  3LSR A;  1POG A;  1LFB A;  1VI0 A;  2QF7 A;  3NAU A;  1TWC J;  4A3G J;  1EF4 A;  2TRT A;  2R93 J;  4MFD A;  2ELK A;  1BW6 A;  1HF0 A;  5E3M A;  3H0G J;  2ECC A;  2E2J J;  1OJL A;  1HOM A;  1JKR C;  3JRH A;  9ANT A;  2CUE A;  4I76 A;  3ZQF A;  1FTZ A;  1DU0 A;  4XID A;  2NS7 A;  1RPW A;  3I4N J;  1NK3 P;  3CDL A;  3BG5 A;  1PUF A;  1HDD C;  3ZQH A;  1IV6 A;  4DYC A;  2CUF A;  4Y7N J;  4M3B A;  5IP6 A;  3ZOB A;  3GTL J;  3M4O J;  1ENH A;  3VPR A;  1ZR2 A;  1HCR A;  3L1P A;  3HBL A;  2EZK A;  3JR9 A;  1IDZ A;  4IHV A;  1X2M A;  3Q3S A;  3JRB A;  3S1M J;  1RES A;  4M6V A;  2NS8 A;  3TP0 A;  5FJ8 J;  1XS9 A;  4B4C A;  2NVT J;  1U9N A;  2K9Q A;  5EZG A;  3OOU A;  1GUU A;  1XG1 A;  2IEK A;  2HOT A;  4A3L J;  3RQI A;  3B6A A;  4JX5 A;  1O4X A;  1IRZ A;  2LTP A;  3D1N I;  3PO2 J;  2FJ1 A;  1Y1W J;  1MBH A;  3B6C A;  2Y2Z A;  1I6H J;  1B72 B;  2EBI A;  2QCO A;  2KDZ A;  4BXX J;  1OCT C;  3CCY A;  3FIS A;  2ECB A;  2LLK A;  2WB1 N;  3FK6 A;  3LNQ A;  2E19 A;  1VF9 A;  4G12 A;  1YRN A;  2VUM J;  5FKO A;  3RZD J;  1WH7 A;  2DMP A;  4FTH A;  1ITY A;  1H8A C;  4UUS A;  1GV2 A;  1E3O C;  3LSJ A;  5J1Y A;  1MBE A;  3IH4 A;  5F0F A;  4B1R A;  4BBR J;  1K83 J;  2I10 A;  4FE4 A;  1GT0 C;  2JA8 J;  2TCT A;  5EG0 A;  2DA5 A;  2M9H A;  1FJL A;  3G1O A;  5EEA A;  2K40 A;  2GLO A;  2XPW A;  4S0H B;  3BR3 A;  1ETO A;  3BQZ A;  5F0H A;  3TED A;  2R92 J;  2DMQ A;  1K61 A;  5FKN A;  2M0C A;  2MW8 A;  3SFI A;  1U78 A;  2LR8 A;  1YRN B;  1BA5 A;  5FLM J;  4BY7 J;  1X58 A;  4A3I J;  2R5Z B;  1ETK A;  4M3G A;  2L7F P;  4X6A J;  4D7M A;  1WCM J;  2DA2 A;  1WGX A;  3WHB A;  2LK2 A;  5EG0 B;  3S2D J;  3HGY A;  1ZQ3 P;  3S17 J;  2R0Q C;  2FD5 A;  1CQT A;  1F43 A;  3E7L A;  2E2I J;  4QIW N;  3TW6 A;  3JRI A;  4A3M J;  3BTL A;  1P7J A;  4IHY A;  5F08 A;  5C44 J;  2M8G X;  1FEX A;  1W0T A;  4LOC A;  1JGG A;  2HI3 A;  2ID6 A;  2M34 A;  3G1L A;  4FE7 A;  2YUS A;  5M3F J;  2ID3 A;  4JX6 A;  1ZGW A;  2JA7 J;  1VND A;  3MVP A;  1MBK A;  4A3J J;  2ME6 A;  2L9R A;  2H1K A;  2GBY A;  5K7F A;  4UUT A;  4RBO A;  2LVS A;  4JX4 A;  4M3D A;  3SDG A;  5M3M J;  2DA4 A;  4XRM A;  1ZK8 A;  4JYK A;  1JUM A;  2CU7 A;  1ZKG A;  1FIP A;  2XRL A;  5J3L A;  1Z0X A;  2HYJ A;  1JT6 A;  5HOD A; 
#chains in the Genus database with same CATH topology
 5F27 A;  4KA4 A;  1P4X A;  4OMY A;  3U2R A;  2ZXW H;  3VFZ A;  3L9F A;  5LLQ A;  3RSN A;  3ZQ7 A;  3HB9 A;  4I02 A;  4I6Z A;  2QVO A;  1ZN2 A;  4XN0 A;  1BJZ A;  2KJC A;  3DBL B;  2BHY A;  2RAE A;  2M4G A;  1FBQ A;  4Y4R A;  5DCM A;  2WY8 Q;  4A3C J;  1XMA A;  5FRM A;  3BCA A;  4A3E J;  1Z21 A;  2HQN A;  5EF6 A;  3K6G A;  1K78 A;  4BY1 J;  5LFA A;  2JZY A;  2ZKZ A;  2P6T A;  4ITV A;  4QWQ A;  2XRO A;  3BZK A;  2W1O A;  3K4L A;  4KUM A;  3ZMZ A;  2FNA A;  1GXQ A;  2XGD A;  3WE3 A;  1PUF B;  1FP2 A;  2O7O A;  1ETV A;  2CYY A;  2MG4 A;  2RNJ A;  3KP7 A;  2B7E A;  2KIU A;  2M2E A;  2HTS A;  5EJC A;  1JKP C;  3RDI A;  2DJI A;  4PJN A;  3COA C;  3JRF A;  1W7P D;  3A03 A;  1UG0 A;  2JMW A;  2RQQ A;  1A6I A;  3GWZ A;  4HW0 A;  1L0O C;  1LE8 A;  1Y56 A;  2JTV A;  1V54 H;  2HEO A;  3BR1 A;  4N9H A;  4RAF A;  5CVJ A;  3UR3 C;  2BY2 A;  3RIR A;  5E3N A;  2WV0 A;  1R9T J;  1RKT A;  3FXQ A;  5C4J J;  2JPB A;  3E5Q A;  3SZP A;  1TWF J;  1A5J A;  4HNU A;  1YO5 C;  3S93 A;  2EA2 A;  3DTK A;  1TWG J;  2LSO A;  3LST A;  1J75 A;  5J1U A;  2KHM A;  3OOP A;  3FMR A;  1FOW A;  2Z33 A;  5C3E J;  2K3F A;  3D5S C;  4YIR X;  2F5V A;  3R61 A;  1SD6 A;  4AYB N;  4GYG A;  3DEW A;  5ICC A;  1LE8 B;  3K1M A;  2DOA A;  4EJV A;  1O3Q A;  1DP7 P;  5HNF A;  1ZLK A;  3EUA A;  3Q9S A;  1P4W A;  3AG2 H;  1J2X A;  1OLT A;  5EGO A;  3Q0U A;  2JQ7 A;  4MO7 A;  2CQX A;  4BQA A;  2JA6 J;  2NYX A;  2BXZ A;  3OIO A;  5LHG A;  2V1D A;  3KP2 A;  3ZQC A;  1SMT A;  3QYF A;  1EV7 A;  1H9T A;  3L00 A;  4CYC A;  3C2B A;  2PFB A;  1HKQ A;  1TQI A;  4G7Z F;  2XGX A;  4KMU X;  3CO7 C;  2JRT A;  1TTY A;  4AID A;  3A0H C;  2QQ8 A;  3GTJ J;  4A69 C;  2WAD A;  2NVY J;  2XSJ C;  2KPM A;  1ZTR A;  3OMY A;  4PCQ A;  1AU7 A;  3KZY A;  3K1P A;  4KFC A;  1NK2 P;  3GZN B;  1YX5 A;  3O3K A;  3QP5 A;  2E35 A;  3M7G A;  5E8G A;  2DT5 A;  4AC0 A;  5EGO B;  2L3D A;  2EFO A;  5D4R A;  1XSX A;  2EB7 A;  3EPZ A;  4BJT A;  4FIS A;  5F04 A;  1GXP A;  4D5F A;  2FU4 A;  3F8B A;  3L2Q A;  3UKG A;  1G3S A;  2RDP A;  3G3Z A;  4XLP F;  2KJB A;  2N8G A;  2KQR A;  4ESJ A;  4ENN A;  4LD5 A;  4IXA A;  2DJN A;  2E36 A;  4HX7 A;  4HF0 A;  2BZT A;  1WJD A;  4A2U A;  2FBH A;  4Y52 J;  5HS9 A;  5KHD A;  1HKT A;  1AOY A;  4P9F A;  4B3X A;  1S8N A;  3BCB A;  3M07 A;  4EM1 A;  3FMS A;  2VC1 A;  2NS0 A;  1DUX C;  4D7N A;  2PJR A;  1JTX A;  2DMT A;  3FXK A;  2XAS A;  1ON1 A;  4GYI A;  5CVU A;  5BPI A;  3GTQ J;  2KIS A;  1KU3 A;  2Y0S N;  4G9Y A;  1I50 J;  3AG4 H;  1MNE A;  5EZH A;  2D5V A;  2DMN A;  2CFX A;  2JK3 A;  3E5X A;  5L3E A;  2Y0M A;  1QPM A;  3LSI A;  4RDU A;  3O6B B;  3I5U A;  1WRJ A;  3FXU A;  2EJR A;  2F6C A;  5CVR A;  1SD5 A;  3U1K A;  3H1C A;  3CF5 F;  2JSP A;  3Q5F A;  3K10 A;  3QPL A;  3ZPL A;  4IHT A;  3MZH A;  3L2W A;  2CUJ A;  3CCE I;  4A6D A;  3HOS A;  2EZL A;  1OYW A;  4ZTJ A;  4M72 A;  2ZB9 A;  2FE3 A;  3TL4 X;  4IL6 C;  1P7I A;  5JHF A;  2IS2 A;  2QSF X;  4YG2 F;  3CJN A;  4N4O B;  2A69 F;  2E1C A;  1YQA A;  1GDT A;  4UB6 C;  2QUF A;  3P9K A;  3GZ6 A;  5DEQ A;  4DYQ A;  2AXL A;  2VQG A;  5B3S H;  1TNS A;  1IF1 A;  1RUN A;  3VB2 A;  3CCQ I;  1Z3Y A;  2R7R A;  4L9T A;  4RS8 A;  3UNG C;  1KZH A;  1NHA A;  3VDX A;  5L3B A;  4IQJ A;  2WA0 A;  2H8W A;  3H3U A;  4BE2 A;  1IN6 A;  2YU9 J;  1QHH D;  3H9G A;  2L5Q A;  3GTG J;  1R1T A;  4PGG A;  3KLN A;  1Y6I A;  1X1C A;  3H3V K;  1E3H A;  3W2W A;  2WWY A;  5K7Z A;  1T33 A;  1ZAO A;  1UJ8 A;  4WF2 A;  1XC5 A;  3RKY A;  3FHZ A;  3Q0W A;  3T8R A;  1ZG5 A;  4O3M A;  4IRI A;  2QWW A;  1MNM C;  5B5E C;  4ENM A;  1E2X A;  3FMQ A;  1JTY A;  1QRY A;  3HOW J;  2X4H A;  2MD0 A;  3FBN B;  3D5L A;  3E3V A;  1D0Z A;  2VIX A;  4XSZ F;  3JRG A;  4E70 A;  2KKO A;  3FXO A;  1VQK I;  2NVQ J;  1W7P A;  2Z2S B;  3KZI C;  4XLE A;  5IT9 K;  2WAE A;  2EZI A;  4JOM A;  2V7F A;  4Y17 A;  4CGZ A;  1FT9 A;  1HA8 A;  3KFW X;  5H6R A;  4MLO A;  1Z7L A;  2XIG A;  3TMO A;  2X6O A;  3ZN1 A;  5IPA A;  2DCE A;  4F91 B;  1FY7 A;  1IDY A;  2FBI A;  4BUP A;  2PX9 A;  2XGE A;  4A3D J;  2O8X A;  3EET A;  2M45 A;  3QP6 A;  2V79 A;  4U88 A;  3RKW A;  2HS5 A;  5D5V B;  4PJM A;  5GP9 A;  3HOX J;  4FQG A;  3TDU C;  2LY2 A;  5IT3 A;  3M3Y J;  3WGH A;  4MQ9 F;  1LB2 A;  3PM1 A;  4M73 A;  4A3F J;  2BY1 A;  1NG6 A;  3LSP A;  5EDN A;  1I3Q J;  2M30 A;  3KPH A;  2GQQ A;  4CCJ A;  4U7B A;  1APL C;  1MMN A;  4CYD A;  4DBQ A;  2UXX A;  3QU3 A;  4ETS A;  1FLI A;  1SMY F;  4XKB A;  1M1E B;  4E7J A;  1YE9 A;  2DA6 A;  3J81 Z;  4Y13 A;  1VQL I;  1POG A;  2GXA A;  4JQF A;  4I2O A;  2QF7 A;  1R23 A;  1ZRC A;  2TRT A;  2PN6 A;  2R93 J;  1V4R A;  4I7H A;  5AIQ A;  3MQ0 A;  4NHJ A;  3F8M A;  4AYB A;  1YIT I;  2RRE A;  3H0G J;  1O57 A;  3HL2 A;  3CCM I;  3JRH A;  4HOB A;  2E1M B;  4XNF A;  3P7N A;  4TV7 A;  1G59 A;  1DU0 A;  2QGU A;  4XID A;  4JBA A;  3CD6 I;  4NC6 A;  2L4M A;  4BEH A;  4EVI A;  4XMY A;  3CDL A;  3BG5 A;  1IV6 A;  1VQN I;  4CIC A;  2LDU A;  2CUF A;  4Y7N J;  1HKS A;  2OBP A;  3K4C A;  1HC8 A;  2F5D A;  1D1B A;  2KLO A;  3GTL J;  3HRU A;  4HQM A;  1OCZ H;  1MJA A;  4YFK F;  5J8F A;  1TBX A;  1SD4 A;  1HCR A;  3BOQ A;  3L1P A;  5ILS A;  4BDZ A;  1X1B A;  2EZK A;  3VSK A;  1ZRD A;  1BR1 A;  2VPL A;  2OC6 A;  5J4Y A;  4BS9 A;  2H6B A;  1KU2 A;  1XS9 A;  2V4J C;  4U0V A;  2HQR A;  2WBM A;  2CWE A;  3BWG A;  2K9Q A;  3DWL E;  3ECH A;  4BEH B;  5E18 F;  2HOT A;  3I55 I;  3QWL A;  4OIN F;  3RQI A;  1PJR A;  3B6A A;  4MQV A;  4ESF A;  2W00 A;  1FYM A;  2R7O A;  4LIT A;  2O6G E;  1O4X A;  1IRZ A;  3E6B A;  3FHN A;  4IHS A;  2FJ1 A;  2ZJQ F;  3B6C A;  2LYC A;  4HLX A;  5DD4 A;  1YJ9 I;  4KIT B;  1TT5 B;  2VJJ A;  1K6O A;  2X1D A;  2OA4 A;  4RLQ A;  2CW8 A;  4IPA A;  1W5C C;  2A5W A;  3ASN H;  1XGM A;  2ECB A;  2FSW A;  1JE8 A;  4RMN A;  2ISY A;  4G12 A;  3V8J A;  4AU7 A;  1I6X A;  2WAF A;  3CCS I;  5DCF A;  1SAX A;  4M74 A;  2E7X A;  1I27 A;  2W7N A;  3S3M A;  4IKF A;  3QOD A;  5F0F A;  3ZMD A;  1PP7 U;  4UHT A;  2JPC A;  3H5R A;  4MNU A;  2R3S A;  2Y0S A;  2JA8 J;  2DA5 A;  3G1O A;  1X3U A;  4S0H B;  2FQ3 A;  2MD5 A;  3V8K A;  3BR3 A;  2NRA C;  3PIO F;  2M7B A;  3A4C A;  3BQZ A;  3OL4 A;  1S72 I;  2YX4 A;  4WXD A;  2R92 J;  4RAG A;  3VYS B;  2M0C A;  3NEU A;  4L9N A;  5LHH A;  3ABL H;  4Y33 A;  1U78 A;  1IAW A;  5FLM J;  3DPU A;  1IXR C;  4I01 A;  1X58 A;  2MC4 A;  2P5V A;  3MKW B;  4M3G A;  2R5Z B;  4A3I J;  4I99 C;  2HDC A;  5F1R A;  3CES A;  4WCG A;  4X6A J;  4D7M A;  1WCM J;  3VYT B;  3T1B A;  4PFO A;  5BQT A;  2ZFW A;  3T5X A;  4A0Y A;  3MKY B;  4Q48 A;  4E7L A;  1TP4 A;  2KIF A;  3DEU A;  3E7L A;  1MMG A;  1FSH A;  2DFH A;  4ANJ A;  3DQV C;  5F08 A;  5B1B H;  4D9J A;  3IRQ A;  5C44 J;  3WTW C;  1FEX A;  2QYO A;  2Z1D A;  1JGG A;  2V9P A;  2VBX A;  2V26 A;  2GWR A;  2LC2 A;  3JTH A;  2YUS A;  2QBY A;  1W5T A;  2RNG A;  3PNT A;  2QKM B;  2X85 A;  3QAH A;  1HW2 A;  3KLO A;  5K1Y A;  2P7C B;  1IO2 A;  5KAF C;  3OYM A;  2X6X A;  2CG4 A;  1FYL A;  4XRM A;  2NOJ B;  4EM0 B;  1YYV A;  1FIP A;  2A07 F;  4ZC3 A;  1JT6 A;  5HOD A;  1U8B A;  2V1N A;  4QTR A;  2YR2 A;  3RTR A;  2XF7 A;  3GVA A;  4LG3 A;  2WY7 Q;  5D6F A;  5E3O A;  3O8H A;  2CSO A;  3S2H J;  3K0L A;  3ABK H;  2F48 A;  1N77 A;  2QBY B;  5LEJ A;  3KP4 A;  4XRS A;  2MFZ A;  2HPM A;  3DCF A;  2CQN A;  2DTR A;  2L02 A;  3DXJ F;  2IS6 A;  3FK7 A;  4F52 A;  4UVC A;  2STT A;  2IGN A;  1DU6 A;  3M9A A;  2M0M A;  1FSE A;  3JCU C;  4KJZ A;  3I59 A;  3ZXS A;  2OQR A;  3H36 A;  1YIO A;  3GTP J;  2PQ8 A;  2LH9 A;  2DPD A;  5L3G A;  3MN2 A;  1AA7 A;  1QVT A;  3F8C A;  5LD2 C;  3AG3 H;  1SAU A;  1R58 A;  2EK5 A;  2LF8 A;  2MSY A;  4YII A;  2XPU A;  1Y0U A;  3PNY A;  1JJ6 C;  1IUY A;  4IZZ A;  1Y8R B;  5TRD A;  2WTE A;  3OSF A;  4QPO A;  5GPC A;  3GTK J;  1Y8Q B;  4BQQ A;  2HKO A;  3IV5 A;  2IXS A;  1AHD P;  4CZZ A;  3I59 B;  2DA3 A;  4RAZ A;  4IVN A;  2FQ4 A;  1X4P A;  2FUG 2;  1OCR H;  1T56 A;  4HQE A;  5JHU A;  2Z9O A;  3GFM A;  2EFP A;  2L4A A;  4BAC A;  2VKE A;  2E60 A;  4DZJ A;  1R1U A;  2LP0 A;  2JVH A;  3LFK A;  1A36 A;  1MW7 A;  2O0Y A;  4BJ6 C;  4W1U A;  4NDL A;  3EYI A;  2VPR A;  2DO7 A;  2XRN A;  4E6K G;  1YX3 A;  5JVT A;  2HFH A;  3A02 A;  1VQ4 I;  3CCJ I;  2R5Y A;  5IP7 J;  2HKX A;  1YFH A;  3SHF A;  1U0J A;  5D4S A;  1Y1V J;  5KK1 A;  1IGN A;  3OYD A;  2OUM A;  3DLL F;  2UUZ A;  4S05 A;  5DUK A;  2XHK A;  1YHQ I;  1QU3 A;  3DBR B;  3HEF A;  1FIA A;  4UUS B;  4XIC A;  5C4X J;  3LMM A;  3ZQL A;  3HTS B;  5FKL A;  3TP3 A;  2EFQ A;  1FBU A;  2O03 A;  2E5Z A;  3DP7 A;  2K27 A;  2IVM A;  1T39 A;  3K4B A;  2W24 A;  3G71 I;  3FM5 A;  4C3J J;  4QSH A;  3IH2 A;  3Q0V A;  1Z0X A;  1FBS A;  1H0M A;  5IYC J;  1P6R A;  2RKH A;  1GHC A;  3C2G A;  1WSU A;  4BHP A;  2L9S A;  5J47 A;  4HPQ A;  2DFF A;  5EYR A;  4RLF A;  4LB5 A;  4NC8 A;  3ZN0 A;  4E7I A;  3OV8 A;  2B63 J;  4KT5 C;  4DGW B;  2CQQ A;  3DEE A;  3OL3 A;  2I5U A;  3BTC A;  2GM4 A;  3V7R A;  2ESN A;  1U5T A;  2CUZ A;  1U8R A;  4GRI A;  2VT3 A;  1D1A A;  2R7F A;  4KIF A;  2XAU A;  5M5X J;  1W36 C;  2WV1 A;  2X1E A;  2R7Z J;  3K2Z A;  4UUV A;  1F4K A;  4BKX A;  1LUJ B;  1I39 A;  1P2F A;  4RA2 A;  3J7A O;  4HSR A;  2FEZ A;  2ZJR F;  4XKW A;  3OR1 C;  1I3A A;  2G0E A;  1P4A A;  3PQK A;  1QZY A;  2A3S A;  1R71 A;  2XAF A;  3ZMV A;  4GCV A;  1REP C;  2XKP A;  1MBJ A;  1RUO A;  4MEX F;  1XDU A;  1GVJ A;  2V9K A;  2LD5 A;  2UWM A;  2PBI A;  5IYD J;  1FP1 D;  1Y39 A;  3BY6 A;  1MIJ A;  3VSL A;  3V8L A;  1R5I D;  1K6Y A;  1U5T B;  3FX3 A;  2GZW A;  3RYR A;  3WGG A;  3BQY A;  2QEN A;  2FA5 A;  1W1W E;  2XAJ A;  3FF5 A;  1LDJ A;  1D5V A;  3HSE A;  3TO6 A;  3CDH A;  1KON A;  1Z7U A;  1TNT A;  5J1R A;  2Z3Y A;  2DAO A;  4C3H J;  5FLV A;  3H0D A;  2L7Z A;  3H5A A;  2CJJ A;  4IHX A;  5KAI C;  2CW0 F;  1ORK A;  2XF6 A;  4BDY A;  3IRR A;  4XOR A;  1HLV A;  4AUX A;  2R7X A;  4G94 A;  4U0Y A;  4GFB A;  3G73 A;  2NNY A;  1TW2 A;  5GTH C;  3ZMS A;  4LMY A;  4C3I J;  4WXH A;  5DCM B;  5TJJ A;  1FYK A;  4IF4 A;  1X1P A;  3I56 I;  3L2V A;  2H8R A;  2ZSI B;  3MWM A;  2LKP A;  1Z9C A;  3BTJ A;  1K78 B;  2MBF A;  3F21 A;  5FLX K;  3R0A A;  2JUG A;  1DP3 A;  3GEZ A;  2MH9 A;  2CS3 A;  3TDZ C;  3WTV C;  2XAQ A;  2CQ7 A;  2E2H J;  4K2E A;  1JUS A;  3V42 A;  1QA6 A;  3CJQ B;  1BI1 A;  2IAI A;  2K9S A;  3JRE A;  1R5H A;  4BAY A;  2OAZ A;  3OSG A;  4A0Z A;  5J8C A;  3K70 D;  2OU2 A;  4XLC A;  3MKZ A;  3PO3 J;  1JUP A;  5FFX A;  1XPX A;  4LG0 A;  3JRC A;  4AIK A;  4N0B A;  1LFP A;  1QGP A;  4LFU A;  1J0R A;  4WX9 A;  3I64 A;  2R7U A;  5JLW A;  2MYS A;  1ZGA A;  2IS4 A;  1XCV A;  5E17 F;  3C18 A;  1VTN C;  4OIQ F;  3GBG A;  2VJI A;  3GTO J;  3IH3 A;  4HX8 A;  1B59 A;  1UFM A;  2IGM A;  2LKS A;  3RCO A;  1OR7 A;  5LRR A;  2IBD A;  4DOZ A;  1MJB A;  2JUC A;  1BBY A;  3KEY A;  4BHB A;  4L18 B;  4ZZD A;  4DZP A;  4C2U A;  3SJM A;  4UVA A;  2K4J A;  3M1C A;  4IOC F;  1ZR4 A;  3ESW B;  4LG0 B;  4IHW A;  3RZO J;  1RKW A;  2DA1 A;  3BG3 A;  2OD5 A;  4XQF A;  3N97 A;  3J80 Z;  4V2F A;  5KVR A;  4L9V A;  3JAM K;  3OYA A;  5BPD A;  3C1D A;  4FX0 A;  2E5N A;  3RI4 A;  2QZ8 A;  1EKE A;  2F4O B;  3K4M A;  4I0A A;  1F9N A;  1Y0N A;  3FXR A;  4UB8 C;  5E1Z B;  5D5X B;  2XGC A;  2E1O A;  3E0J B;  4HNT A;  3CUQ A;  1K7A A;  5FKK A;  1XGS A;  3CLQ A;  4UV9 A;  2G7H A;  1MSE C;  4XON A;  3SZG A;  5E3L A;  3WOD F;  3EYY A;  5FKM A;  3FXJ A;  4CYC B;  4II3 A;  4PSX A;  3I4M J;  4YFX F;  3F8N A;  1QZZ A;  2OQG A;  4OIO F;  1GV5 A;  2Q2E A;  2X1C A;  3HJE A;  4LLG F;  3RPU D;  1YOV B;  4HRI A;  2DTZ A;  4KIB A;  2FXA A;  2QEX I;  4UVB A;  3F9K A;  2M7A A;  2LNB A;  1VI0 A;  3LWF A;  1TWC J;  4A3G J;  1EF4 A;  2H6C A;  2L7K A;  4LB6 B;  5BOX A;  4XN3 A;  5LEK A;  3F22 A;  2CMP A;  2ELK A;  4U7D A;  5E3M A;  2ECC A;  1IRF A;  3SDB A;  1OJL A;  2E2J J;  1WJB A;  4I76 A;  1G8X A;  3ZQF A;  1FTZ A;  1Z6R A;  2GOX B;  4DNC A;  4XR6 A;  2VE9 A;  1H9G A;  2RGV A;  1ERD A;  3HZJ A;  2CGP A;  5EEG A;  2E1M C;  3I4N J;  2P5K A;  1HDD C;  3ZQH A;  3PFY A;  2GIZ A;  2DBB A;  2VQL A;  2Q2E B;  4Z6Y A;  2DI3 A;  2HOE A;  3WTX C;  2AXT C;  2KDO A;  2YSR A;  2ELJ A;  3I53 A;  4AIH A;  4RM3 A;  1S29 A;  4MTE A;  3VPR A;  1ZR2 A;  4LIU A;  1O3R A;  3HBL A;  1BIB A;  2DYR H;  3JRB A;  2LRE A;  4CCK A;  1RES A;  4M6V A;  4BH9 A;  3M1E A;  3TP0 A;  2PJR B;  4G6T B;  1BOA A;  5K5Q A;  4QLC U;  2HQA A;  1SEU A;  5FRN A;  5L3D A;  4ZDP A;  5EZG A;  3KYC B;  3KX2 A;  2W84 A;  2V9V A;  1GUU A;  4PJ0 C;  5D5U B;  3OS2 A;  4CCM A;  1OPC A;  3CJR B;  3H35 A;  4XLN F;  4J01 A;  1PP8 F;  3IHU A;  4B8X A;  2LTP A;  3D1N I;  3PO2 J;  2D1V A;  2P6S A;  3TOA A;  1Y1W J;  1PDN C;  2HVR A;  3C2H A;  2EIK H;  1I6H J;  2IW5 A;  2QCO A;  3HPG A;  1YLF A;  2QQA A;  4YIF A;  1WKM A;  3CCY A;  1F5T A;  2EPF A;  1F1Z A;  2DK8 A;  3F72 A;  4CCO A;  2VUM J;  5FKO A;  3GFL A;  5L3C A;  2DMP A;  3WTU C;  4NC7 A;  1ITY A;  1GV2 A;  3HSF A;  5HS8 A;  5CJ9 A;  4HYE A;  4BBR J;  4HG2 A;  4FE4 A;  5A2Q Z;  1XSV A;  4IOA F;  4NQW A;  5EEA A;  4ZJZ A;  1MD0 A;  2G9W A;  2COM A;  4U0W A;  5EEH A;  1N75 A;  4KIC A;  2H27 A;  2DMQ A;  1K61 A;  1B6A A;  2KMU A;  1FMW A;  3BLY A;  1IXC A;  1Z3X A;  2LR8 A;  1NH3 A;  1OIS A;  4PGH A;  2GA2 A;  2B0L A;  3SXY A;  2A61 A;  2GOM A;  2V1X A;  4HEA 2;  2ISZ A;  2DA2 A;  1SVM A;  1WGX A;  2EFN A;  5TIS C;  3PUF A;  2ZME C;  4HBL A;  3ZP5 A;  2YX7 A;  3SZT A;  1IV8 A;  1ZQ3 P;  3CZ6 A;  1W7P B;  2A68 F;  5LGN A;  2R0Q C;  1TT0 A;  4MTD A;  2HNH A;  1CQT A;  1F43 A;  4QIW N;  1T6S A;  3TW6 A;  3JRI A;  3CMA I;  4A3M J;  1FWZ A;  4QPQ A;  3CLO A;  1HW1 A;  3OYE A;  3MZY A;  2M8G X;  5JR3 A;  4E4H A;  4FE7 A;  1ON2 A;  2EA4 A;  1R5G A;  1EH8 A;  4JK1 X;  4JX6 A;  1YTY A;  1ZGW A;  1YW9 A;  3VEP A;  2HZT A;  2L9V A;  2X6Y A;  5ERI A;  1R00 A;  1MBK A;  4A3J J;  2KP6 A;  5E1X A;  3HTU A;  1I5Z A;  2ME6 A;  2L9R A;  2O3F A;  1UAA A;  1MMD A;  1E3P A;  3BZ6 A;  4UUT A;  4Q47 A;  4M71 A;  4AD9 A;  2D2W A;  1I1G A;  3K4K A;  2LVS A;  4M3D A;  3WG7 H;  5M3M J;  4PJL A;  1I1S A;  4BU2 A;  4C9Y A;  2RN7 A;  1T8I A;  1ZK8 A;  2CU7 A;  3FZV A;  2XRL A;  2HYJ A;  2VE8 A;  5GAG J;  2PEX A;  1BL0 A;  5H6Q A;  4E7H A;  2HVS A;  2UXN A;  4L9J A;  5DTD A;  2R7W A;  3LOC A;  2DXI A;  5LRS A;  2ZNY A;  3ZR8 X;  4G8X A;  3IKT A;  3S3N A;  3WTS C;  1B8I A;  3OYF A;  1MBF A;  1D1C A;  4Z2Y A;  4KIS A;  1V5E A;  4OMZ A;  1CGP A;  2Y48 A;  1ETQ A;  1UCR A;  3BG7 A;  3CDI A;  3K1N A;  4RB0 A;  3OYG A;  4BE0 A;  1LQ1 A;  3OR2 C;  2ADU A;  2MLK A;  4HX4 A;  3JRD A;  1MBG A;  3CC4 I;  1RET A;  3BDD A;  4C2T A;  3ZGK A;  1OYY A;  1SFX A;  1Z6T A;  1IN5 A;  3KET A;  1WJ5 A;  5GPA A;  1QPI A;  4NUB A;  4M6X A;  3CMM A;  1U3E M;  4F3Q A;  1USS A;  2VBZ A;  3P9C A;  2GAU A;  4IX7 A;  1RRJ A;  1N78 A;  4PZJ A;  3RPU A;  1BR2 A;  3X2Q H;  4NNJ A;  4KT6 A;  2K9N A;  3CC2 I;  2CRG A;  2L7M P;  3B02 A;  2O8K A;  2RVC A;  3IP4 B;  4IQ4 A;  1Z1D A;  5KNL A;  2XAH A;  4B47 A;  1B8I B;  1TWH J;  2W4S A;  3HOV J;  4IRH A;  3A1Y A;  3DKY A;  1LPQ A;  3W3C A;  2VOO A;  4P1W A;  4DJA A;  4HV6 A;  4AWX B;  4BXU A;  5FD6 A;  1VFC A;  1OQY A;  2UV1 A;  2K85 A;  1KU9 A;  2VOD A;  5JVG F;  1KQ8 A;  3OYB A;  1ONV A;  3GX4 X;  1KA8 A;  1IN4 A;  1H88 C;  4LLL A;  5DM6 F;  2IA1 A;  3QOP A;  2QQ9 A;  2OCE A;  2K4B A;  2WAQ N;  2ZME A;  3OY9 A;  3B73 A;  4OAZ A;  3DV8 A;  3K9T A;  4LK0 F;  2FX0 A;  4M9S A;  3SYT A;  3K2A A;  2P7V B;  5AON A;  1OFC X;  1ZYR F;  5FD5 A;  1HQC A;  2XDV A;  4G6D A;  4F92 B;  3J7Y J;  2B9S A;  1YG2 A;  1JT0 A;  3G6E I;  2R7T A;  1GLN A;  5IP9 J;  3I9V 2;  1EJ9 A;  1ZRE A;  2BV6 A;  3O2P E;  3OYH A;  3EUK L;  1QO0 D;  3EUH C;  3RQ4 A;  2L0K A;  1Z91 A;  2VB6 A;  1DQU A;  4G7O F;  3ULQ B;  1VQO I;  4FAS D;  3KCC A;  3U21 A;  4C2M J;  3CC7 I;  3JTG A;  3BJA A;  3R6S A;  1G6N A;  2AHQ A;  3R60 A;  2ZME B;  3DTE A;  3SEZ A;  4D0P A;  3O8G A;  2W85 A;  3BTI A;  3WG9 A;  3I3L A;  1WJC A;  2RV8 A;  4XL9 A;  2VXZ A;  2CFO A;  3NQO A;  1LEA A;  2K7L A;  1UHS A;  5FFZ A;  3T8T A;  3HRM A;  2GA1 A;  2L9N A;  3C3W A;  2ZJ2 A;  3FDY A;  3PNV A;  4EJT A;  1IC8 A;  4EM2 A;  5H20 A;  1FTT A;  1IN7 A;  2Y9Y A;  3TOB A;  4MHG A;  4H0E A;  3OWT A;  3N05 A;  2BEO A;  4EQQ A;  1R4M B;  1SVL A;  5ED4 A;  1QNT A;  1G3T A;  5IOZ A;  2E71 A;  2VLA A;  2DOD A;  2FRH A;  2VAS A;  1LDK B;  2KZV A;  2QQB A;  2MH2 A;  4X1E A;  3IAS 2;  5LHI A;  2OV7 A;  1ETY A;  3HUG A;  5HLI A;  2PJP A;  2X48 A;  4HF1 A;  2VQH A;  1S7O A;  4WK8 F;  1AWC A;  1JI8 A;  3NAR A;  3ZCO A;  1UB9 A;  3BG6 A;  4RGS A;  4R79 A;  3QYE A;  2KL4 A;  4IJA A;  2ACJ A;  4OIR F;  3DBH B;  3S15 J;  1CF7 A;  2XPV A;  2A5Y B;  4WXC A;  2LY9 A;  3ABU A;  3MD2 A;  2LFB A;  1T0F C;  3C7J A;  5HNH A;  3VWB A;  2HVQ A;  3LA3 A;  2BBY A;  5F6F A;  2BXY A;  5CKT A;  1WJE A;  2FNP A;  3GTM J;  2JA2 A;  4O5V A;  4DQ2 A;  1Z05 A;  2H94 A;  1J5Y A;  1LNW A;  2LBF A;  4EEF G;  4KMF A;  3QPS A;  4IRG A;  1LFU P;  3JSP A;  1V5F A;  3HM5 A;  3MCZ A;  3FKI J;  1SC7 A;  1P92 A;  4MEY F;  2XB0 X;  2IP2 A;  2AO9 A;  3BR5 A;  3CME I;  2VKD A;  3S32 A;  3S14 J;  2J5O A;  2KRF A;  2PMH A;  4F7Z A;  1PYV A;  3R0J A;  1U5T C;  4GXO A;  2M4K A;  5DV5 A;  1B1B A;  5L3F A;  4FET A;  1FOK A;  4OIP F;  4YEJ A;  1UMQ A;  2KRH A;  3LFU A;  1B72 A;  3ZQG A;  4PFP A;  4RGU A;  4KDP A;  5HLT A;  3S1Q J;  1ETX A;  1YS7 A;  2EV0 A;  2BHZ A;  1WWX A;  1IUF A;  3EQL F;  3EUH A;  1BN5 A;  4FCY A;  1UG2 A;  5M5Y J;  1K79 A;  3T0Y A;  2M3A A;  1IRX A;  2R7Q A;  2OF7 A;  4KIG A;  3CUO A;  1KGS A;  4HNV A;  1ETW A;  1S9H A;  3KEO A;  3LAJ A;  1KQ0 A;  1J7K A;  4GDF A;  3HYI A;  1MH4 A;  2P0W A;  1ZEL A;  3TO7 A;  5IOY A;  3HRS A;  1PUE E;  5J4V A;  2Y9Z A;  3CTA A;  3WU1 B;  4ZTF A;  1LVK A;  1ACI A;  1ODD A;  3QQA A;  1KQ9 A;  2H1L A;  3J7A Y;  3P5J A;  4L0Z B;  1TC3 C;  2EH3 A;  2H09 A;  4HF2 A;  3CP8 A;  2DA7 A;  2OPT A;  2OTL I;  2KZG A;  1MJ9 A;  2JA5 J;  3CMY A;  3HOZ J;  4D5C A;  4RGX A;  1BOB A;  3QPT A;  4ZYE A;  1H89 C;  1S3J A;  1SD7 A;  1MSF C;  3IWZ A;  2R4G A;  2X0L A;  3HPH A;  2DMU A;  3ZQQ A;  3FXL A;  3K7A J;  3J81 K;  1UHW A;  3BPV A;  1QBJ A;  4HDU A;  3KYL A;  3GME A;  3NWS A;  4BQO A;  3K69 A;  4A3B J;  2E7W A;  2VKV A;  3DFG A;  3RKX A;  1BM9 A;  3KE2 A;  1X3W B;  2IGO A;  4JP0 A;  4NBQ A;  4P55 A;  4CA0 A;  4ZZL A;  5B66 C;  4MGR A;  2DDA A;  1ZH5 A;  5J6X A;  4UXN A;  2V6C A;  1FNN A;  1T0F A;  1WPK A;  1XGN A;  4E7S A;  3RKQ A;  2R5Y B;  2W57 A;  1Q1V A;  1XCB A;  3IC7 A;  3CCR I;  4MIM A;  3WU0 A;  1TW3 A;  3K4J A;  1R6R A;  4B44 A;  1MDM A;  2KRC A;  3MZ8 A;  3Q9V A;  1Z67 A;  5CVV A;  4AVZ A;  3HKZ N;  3WHC A;  1DGR M;  4HDV A;  3IKV A;  3MFK A;  1ZG3 A;  2A6H F;  2EZH A;  1VQ6 I;  5BMZ A;  2NVX J;  4CO8 A;  2HGC A;  1ULY A;  2E1N A;  1F36 A;  3QU6 A;  2NVU B;  1VQ5 I;  1HDP A;  1W0U A;  1SFE A;  3GCM A;  1OR7 C;  1X2N A;  5D8L B;  3VYR B;  2WAQ A;  1FOY A;  3W6K B;  4CCL A;  1TWA J;  3BP8 A;  2ESH A;  2LG4 A;  4V2G A;  4EGY A;  4M3F A;  4M9X A;  1RR7 A;  1WI3 A;  5GAE J;  3LSR A;  1MDM B;  3WTY C;  1SFK A;  3DLA A;  3ASO H;  4J00 A;  4ZYD A;  2IA2 A;  5IT9 Z;  2IGK A;  1S5L C;  4PSW A;  1IRG A;  1J09 A;  1T98 A;  1X19 A;  4PJJ A;  1JKR C;  1HOM A;  4RB2 C;  1WJF A;  5LGU A;  1W4M A;  2ZXH A;  4Y3O A;  3G2B A;  4I0B A;  2X6W A;  3CUQ C;  1PUF A;  2M5W A;  1RI7 A;  4CSW A;  2VN2 A;  2K9M A;  1VQ7 I;  4DYC A;  4BL0 B;  1R4N B;  4M3B A;  5IP6 A;  4RM2 A;  1DPR A;  4H4K C;  5JI6 A;  1D3Y A;  1ENH A;  1O3S A;  2LMD A;  3HIF A;  3FWE A;  1WQ2 A;  3GW2 A;  2LOO A;  3CF2 A;  1TL8 A;  3I4P A;  1RZ4 A;  5ICF A;  1OCO H;  3S1M J;  1X2M A;  2BGC A;  2O61 A;  5FB2 A;  2NS8 A;  5FJ8 J;  1LEB A;  1W5S A;  4B4C A;  1EH6 A;  4E7Z A;  3RPQ A;  2ZXJ A;  1FOX A;  3OOU A;  2IA0 A;  1XG1 A;  3GF2 A;  4A3L J;  3DKX A;  3ISP A;  1JGS A;  2XAG A;  2AS5 F;  1UHM A;  3S3O A;  2EBI A;  2UZK A;  3KIO A;  4XRF A;  4Q4Z F;  4I09 A;  2KDZ A;  2E34 A;  1OCT C;  2VC0 A;  5FO5 A;  2VBW A;  1SVO A;  2WB1 N;  1JXS A;  3LNQ A;  3AL0 C;  1HW5 A;  1DPU A;  1PVE A;  4BYY A;  1X3Z B;  3RZD J;  1WH7 A;  5K5R A;  5E1W A;  3U1D A;  4FTH A;  1ZG1 A;  4RAY A;  4ZDL A;  1H8A C;  3H9Q A;  3LSJ A;  3V4G A;  5CQE A;  3IH4 A;  1U6G A;  5KCM A;  4P5O A;  2I10 A;  2VBY A;  3QRF F;  3D5R C;  1LKX A;  3S8P A;  2M9H A;  4A5M A;  2Z16 A;  2M8E A;  1R1V A;  4EJW A;  2K40 A;  3L2R A;  2HR3 A;  1FJL A;  2XPW A;  3NRV A;  2GLO A;  2P4W A;  3MMY B;  1YW7 A;  3E1S A;  2ELH A;  4BE1 A;  3GXO A;  2DK5 A;  3OIP A;  5F0H A;  3TED A;  1S7A A;  3WU2 C;  1T38 A;  5FKN A;  1T08 B;  1HSJ A;  1BA5 A;  2K02 A;  3KP5 A;  2R7S A;  4BY7 J;  3GFJ A;  3LSM A;  3LA7 A;  4XLF A;  3F3X A;  4B09 A;  1DDN A;  2BY0 A;  1BJA A;  3HG9 A;  3TO9 A;  3WHB A;  2LK2 A;  4AVP A;  3S2D J;  1IW7 F;  1STZ A;  3HGY A;  4KYW A;  1T95 A;  2FD5 A;  3MEX A;  2ZBK A;  1BI0 A;  1V55 H;  3LSK A;  2E2I J;  3GZ5 A;  1BC8 C;  2C6Y A;  3CCU I;  1TZL A;  3SQN A;  3BTL A;  2HPI A;  3A0B C;  1VQM I;  2BE5 F;  1P7J A;  2HYG D;  3TGN A;  1E17 A;  2DOE A;  2KIM A;  2V1U A;  4IHY A;  4XKV A;  2FML A;  3K4N A;  2HI3 A;  3I71 A;  1R36 A;  3SEQ A;  3CP2 A;  2ID6 A;  2M34 A;  3G1L A;  5HDN A;  5HLH A;  1YJW I;  5M3F J;  1YIJ I;  2JA7 J;  1ZRF A;  2L2O A;  2G7U A;  2AQE A;  5TGT A;  1J9I A;  1D8J A;  5K7F A;  4M9Z A;  3H5N A;  3BPX A;  3SDG A;  2JRM A;  3E97 A;  4JX4 A;  3ABT A;  1LVA A;  2DA4 A;  3D0S A;  3WTZ A;  3CUQ B;  3A2K A;  3HSR A;  4JYK A;  1HBX G;  1JUM A;  5JFR A;  5J3L A;  2EIM H;  3K70 C;  5BNG A;  2EWN A;  3ROU A;  5DDG A;  4BJ5 C;  2JVG A;  3LSH A;  2CW7 A;  3W6V A;  3TKY A;  2Y69 H;  4AIJ A;  3ZRG A;  3SFZ A;  3JW4 A;  3G1M A;  3CQZ J;  2D45 A;  1TQP A;  3TQN A;  4A93 J;  4A12 A;  2F2E A;  2DYS H;  2O9L A;  3GLX A;  1V5G A;  2KIQ A;  3DF8 A;  1JHF A;  3HDD A;  2A6E F;  1N25 A;  1XGO A;  5JLX A;  2FOW A;  2HU9 A;  1BR4 A;  2Y75 A;  3GUD A;  4B3A A;  1A31 A;  3HGG A;  2Y31 A;  4DYR A;  4WWC A;  4P96 A;  4HLY A;  2HYF A;  3PIP F;  4RB1 A;  3HKZ A;  5HS7 A;  2KT0 A;  2F4I A;  3F6V A;  2BOL A;  2I8D A;  2HDW A;  1U9O A;  2M1B A;  1WH5 A;  1R49 A;  1G3W A;  4IO9 F;  1GVD A;  4CDG A;  4RB3 C;  4UV8 A;  3L2U A;  4ZYA A;  2STW A;  5ILU A;  1IZ1 A;  1SFO J;  4YFN F;  3DTI A;  3IL2 A;  2P8T A;  1WI9 A;  4Q5S F;  2QM3 A;  2CV2 A;  2HOS A;  1DGW Y;  4OWR B;  3AL0 B;  5CQG A;  3CCV I;  3L09 A;  2OJE D;  3OYI A;  3ZQI A;  2YPR A;  3F6O A;  5ICE A;  1HXD A;  4E7K A;  2YU3 A;  3H9J A;  4PUS A;  1XB4 A;  1G3Y A;  4ZDO A;  2K5C A;  3MKL A;  2ZC2 A;  4ZYG A;  5ICG A;  4A3K J;  2Y30 A;  3HHH A;  4ASN A;  3PJR A;  3PL8 A;  2ZFU A;  2Z5U A;  3TW7 A;  2ZNZ A;  3BG9 A;  2XB5 A;  5CYV A;  2JT1 A;  3DKW A;  4DBR A;  4LJZ F;  1A6Q A;  1C0W A;  4AM3 A;  1JHH A;  3DPL C;  3AFH A;  2MAB A;  3FBI B;  3OYK A;  1NTC A;  2DW4 A;  2JJ7 A;  4OAY A;  2LKX A;  1FZP B;  1YS6 A;  4HAM A;  1A35 A;  2A6T A;  3I54 A;  1S7E A;  4RGR A;  2HWV A;  2IRF G;  3BR2 A;  1KU7 A;  4FHT A;  3R4K A;  4BXF A;  2BVL A;  1YW8 A;  4XK4 A;  2QA4 I;  5FGM A;  5HLG A;  1R7J A;  3VYU B;  4BNC A;  4XOP A;  4ABZ A;  4XRS G;  4C30 A;  2HDD A;  4W97 A;  2QSH X;  5E79 C;  4NQW B;  2A05 A;  3BC8 A;  4EAT A;  4XKC A;  3L2C A;  1VQ8 I;  4DW6 A;  4FX4 A;  1OMI A;  1UST A;  1RIO H;  2DU9 A;  5E8I A;  3CCL I;  1MND A;  3HHG A;  2L54 A;  2VXD A;  3IAM 2;  1XMK A;  2GXB A;  3JRA A;  2PMZ N;  1JJ8 C;  2Z99 A;  5K7H A;  4EJO A;  4BBS J;  4CUG A;  2EQR A;  2WB1 A;  4LGW A;  2VON A;  1X4O A;  1BW5 A;  1ZGJ A;  1EH7 A;  1QQI A;  4LIV A;  2NOG A;  3RYP A;  3PQJ A;  2COB A;  1MH3 A;  5HDG A;  4YRV A;  2XVC A;  2DN0 A;  3H3Z A;  4L5I A;  1BC7 C;  1IN8 A;  3RJP A;  2VQC A;  4S04 A;  5LBQ A;  3FM3 A;  3LAP A;  3L7W A;  2HTJ A;  1SAN A;  4A5N A;  5IYB J;  1OKR A;  1MGT A;  4GGG A;  4BQN A;  3VOD A;  4XLA A;  1S6L A;  4L5E A;  2JSC A;  3HXL A;  5D5W B;  5DYM A;  5AIP A;  1OYI A;  3ML6 A;  1Q1H A;  1B9N A;  4IEJ A;  1T2K A;  1BI2 A;  3VOE A;  1L3L A;  3BT9 A;  1RR8 C;  4M3E A;  5F0C A;  2OTJ I;  4EJU A;  4I98 B;  3F0C A;  3LQR A;  3FIW A;  6PAX A;  3S16 J;  2EFW A;  1AKH A;  5LGT A;  3BR6 A;  5CVI A;  3TBI A;  1V3F A;  3J80 K;  3PFI A;  2CV0 A;  1EA3 A;  2DQL A;  2HXO A;  1MZB A;  3IWF A;  3REO A;  1TQM A;  4EGZ A;  3KP3 A;  1IXS B;  3KEQ A;  2JN6 A;  3F23 A;  5H2F C;  3OYJ A;  1JKO C;  4XSX F;  2Q8K A;  3WGI A;  3LQQ A;  2XSD C;  3HC7 A;  4LLN A;  1ZHF A;  1JKQ C;  1KYW A;  4F93 B;  1D5Y A;  5ILV A;  3G4S I;  1QVU A;  3LSG A;  2HQ5 A;  2R5Z A;  2HOA A;  4PDK A;  1AKH B;  2DQR A;  2M87 A;  2ZXI A;  1Z77 A;  3CJT B;  2NNN A;  4D1Q A;  3HOU J;  1OCP A;  4Y15 A;  5M5W J;  3NWT A;  2JWT A;  4BGD A;  3U9G A;  2VL8 A;  2FF4 A;  1BIA A;  2ETH A;  4XLH A;  5D6E A;  2QKL B;  3WE2 A;  5CPR B;  2OCC H;  2XV4 S;  2LY1 A;  4MFE A;  2DPU A;  4OU0 A;  3PUB A;  2QSG X;  3A01 A;  2MGQ A;  4KN7 X;  4J19 A;  1XN7 A;  3BR0 A;  2MC3 A;  3M8J A;  2K3P A;  1G2H A;  5FLX Z;  5F1J A;  2IS1 A;  3GFI A;  1NG7 A;  2P81 A;  2W48 A;  5D8K B;  1UEL B;  3HOT A;  1WVR A;  5GTI C;  2ZJP F;  3HOY J;  5DS9 A;  1G4D A;  1IJW C;  3E6D A;  3HRT A;  2ZCW A;  4ON0 A;  2BY3 A;  4HZF A;  1FX7 A;  1LJ9 A;  3AG1 H;  1K4S A;  1WFX A;  3KZZ A;  1VQ9 I;  2HXI A;  1K4T A;  2W82 A;  4V19 K;  2XKO A;  2IT0 A;  1WHU A;  2ICW G;  1IG7 A;  5B1A H;  1XTA A;  1ZAR A;  2VJ5 A;  2DDB A;  3CO6 C;  4U87 A;  2XF5 A;  2LRD A;  2X9D A;  4O6J A;  4CHU A;  2YS9 A;  2FBK A;  4P9U A;  4ZYH A;  3A01 B;  1YI2 I;  1UZC A;  3J7Z I;  2VI6 A;  4L0Y B;  4KNY A;  3S1N J;  1XMX A;  4CZC A;  2ME0 A;  4DIQ A;  3S1R J;  4ENJ A;  4PK4 A;  2DT6 A;  1LFB A;  2RC4 A;  2V6E A;  1FC3 A;  3QOE A;  3NAU A;  4LK1 F;  5E20 A;  5BS6 A;  2X51 A;  2PLY A;  1O7F A;  1B9M A;  3FXM A;  4MFD A;  1J59 A;  1BW6 A;  1X1A A;  1HF0 A;  3E6C C;  4KN4 X;  2CO5 A;  4XBF A;  3V7S A;  5HOO A;  2DFE A;  3LA2 A;  9ANT A;  2CUE A;  4G7H F;  2CH0 A;  1BI3 A;  3DU5 A;  3HUG B;  2F4M B;  2AQF A;  2NS7 A;  2DOF A;  2FOK A;  3M8E A;  1RPW A;  4X0G A;  3E5U A;  1D8K A;  1NK3 P;  3JSO A;  3P9I A;  1ZLJ A;  2QLZ A;  3BJ6 A;  3JAM Z;  3MAJ A;  4G6Q A;  1XDS A;  1CF7 B;  2MLG A;  4CH7 A;  3ZOB A;  1XX5 A;  2K9L A;  4XOT A;  3EDP A;  3M4O J;  5A2Q K;  1MKM A;  2VOP A;  4HV5 A;  2K86 A;  2KFD A;  3JR9 A;  3PSI A;  1E0E A;  1IDZ A;  4IHV A;  3Q3S A;  3W2A A;  4ZH4 F;  2WC2 A;  2TDX A;  2F5F A;  3BJO A;  2Q0O A;  3AAF A;  2LBF B;  3AKZ A;  4L5J A;  2NVT J;  2PMZ A;  1U2W A;  4GO1 A;  1U9N A;  4BHC A;  3OYC A;  2GIV A;  2MA3 A;  2IEK A;  4B48 A;  3GLL A;  2W25 A;  2R7D A;  1P9Q C;  4JX5 A;  3IUO A;  1MMS A;  2VJ4 A;  3OIQ A;  2NAZ A;  5DUI A;  4XM3 A;  3DPT A;  3F8F A;  1MBH A;  1B4A A;  1RNL A;  2Y2Z A;  4A6E A;  2CV1 A;  4UY8 I;  3ZMT A;  2PMU A;  4UNO A;  1B72 B;  1QZE A;  3DU6 A;  3KP6 A;  1W36 D;  5IY5 H;  3BZC A;  2HZD A;  2L01 A;  5GAH J;  4BXX J;  3QYB A;  2IJL A;  2D1H A;  3FIS A;  2LLK A;  3ELK A;  3OS0 A;  1VZ0 A;  3FK6 A;  2E19 A;  1VF9 A;  2VKH A;  3KYD B;  3WTT C;  1YRN A;  2EIJ H;  3ABM H;  2IPQ X;  2R7V A;  5DM7 F;  5K5O A;  3BRO A;  4YEL A;  4UUS A;  5CLS A;  1E3O C;  3PSF A;  3W6J B;  5J1Y A;  1MBE A;  5DD8 A;  3ERE D;  4ENK A;  4N4N B;  4B1R A;  1K83 J;  1GT0 C;  2GXG A;  4F55 A;  4CXF A;  2TCT A;  1WJA A;  5EG0 A;  3GYH X;  1MMA A;  4R1H A;  1O3T A;  5HDK A;  2DT7 B;  1X1D A;  5J40 A;  2EIL H;  1ETO A;  4R8H A;  2OZ6 A;  4ESB A;  2EIN H;  3ZMU A;  4M6Y A;  3W2V A;  1O7L A;  3FKJ A;  1SFU A;  2VT2 A;  3ERM A;  2P5L C;  4B43 A;  4NB5 A;  2MW8 A;  3SFI A;  1YRN B;  2Q1Z B;  2BYV E;  1ETK A;  1TLH B;  1A04 A;  2EV5 A;  2L7F P;  4OOI A;  2CQK A;  1XSD A;  3I58 A;  3LL7 A;  5EG0 B;  2XC7 A;  2PI0 A;  2FMY A;  3S17 J;  4HA8 A;  3V7C A;  2RQP A;  2LF7 A;  2F5C A;  1D0Y A;  2BW3 A;  4II2 A;  3OYL A;  3E6M A;  1QHG A;  4N9I A;  3OYN A;  1YJN I;  2PG4 A;  2ZSH B;  3QPH A;  1WZ2 A;  2DFI A;  1FMV A;  2OZU A;  3H92 A;  1LDD A;  2NXN B;  5F64 A;  2O5R A;  1W0T A;  4LOC A;  1XD7 A;  2ZO4 A;  1RC9 A;  4EMS A;  3GO5 A;  4HST A;  2ID3 A;  4A0X A;  2J5P A;  5FRO A;  3OS1 A;  3M8F A;  1KYZ A;  1VND A;  3MVP A;  1D0X A;  1HST A;  3S2W A;  5GAD J;  3ONQ A;  2EV6 A;  1FPQ A;  2H1K A;  2GBY A;  1VQP I;  5HVQ C;  4RBO A;  2XUB A;  3ECO A;  3N4M A;  1OCC H;  4EV0 A;  4FT8 A;  1R22 A;  2BW3 B;  1ZKG A;  2DLL A;  4CCN A;  2BVM A;  2F5E A;  3I0T A; 
#chains in the Genus database with same CATH homology
 5F27 A;  5BNG A;  1U8B A;  1BL0 A;  3W6V A;  4QTR A;  5DTD A;  3LOC A;  3HB9 A;  4I6Z A;  3G1M A;  5E3O A;  3CQZ J;  1B8I A;  3O8H A;  1BJZ A;  1MBF A;  3S2H J;  4A93 J;  2O9L A;  2RAE A;  3HDD A;  4XRS A;  1ETQ A;  5JLX A;  3DCF A;  3JRD A;  4B3A A;  3FK7 A;  1MBG A;  4A3C J;  1RET A;  3HGG A;  2Y31 A;  4DYR A;  1DU6 A;  4A3E J;  5EF6 A;  4BY1 J;  5GPA A;  1QPI A;  3GTP J;  2KT0 A;  2XGD A;  1U9O A;  2K9N A;  3MN2 A;  1PUF B;  1QVT A;  1WH5 A;  2CRG A;  2L7M P;  2O7O A;  2O8K A;  1GVD A;  1ETV A;  2MG4 A;  2M2E A;  1TWH J;  1B8I B;  1JKP C;  2MSY A;  1SFO J;  3HOV J;  3JRF A;  3A03 A;  2JMW A;  2HOS A;  2XPU A;  1JJ6 C;  1A6I A;  1VFC A;  3OSF A;  3ZQI A;  1LE8 A;  5GPC A;  3GTK J;  3IV5 A;  1AHD P;  3BR1 A;  1H88 C;  2DA3 A;  5E3N A;  2FQ4 A;  1R9T J;  1RKT A;  1T56 A;  5C4J J;  2WAQ N;  1TWF J;  2VKE A;  1A5J A;  3MKL A;  2FX0 A;  4DZJ A;  2LP0 A;  4A3K J;  2Y30 A;  3K2A A;  1OFC X;  4W1U A;  4NDL A;  3TW7 A;  2VPR A;  1TWG J;  3BG9 A;  2XB5 A;  5J1U A;  1JT0 A;  3A02 A;  5C3E J;  2R5Y A;  5IP7 J;  5IP9 J;  4AYB N;  3DEW A;  1NTC A;  1LE8 B;  1Y1V J;  2JJ7 A;  2LKX A;  1IGN A;  2L0K A;  1S7E A;  3BR2 A;  3HEF A;  4C2M J;  1FIA A;  4UUS B;  4XIC A;  5C4X J;  4XK4 A;  2AHQ A;  5EGO A;  3ZQL A;  3Q0U A;  5FKL A;  3TP3 A;  4MO7 A;  2CQX A;  3O8G A;  3BTI A;  2JA6 J;  4ABZ A;  4XRS G;  2HDD A;  3OIO A;  4W97 A;  3ZQC A;  4C3J J;  1UHS A;  4QSH A;  4CYC A;  3IH2 A;  3C2B A;  3Q0V A;  1IC8 A;  1FTT A;  4DW6 A;  2Y9Y A;  5IYC J;  3GTJ J;  4A69 C;  3JRA A;  2NVY J;  1AU7 A;  1ZTR A;  5IOZ A;  2PMZ N;  1JJ8 C;  1NK2 P;  5K7H A;  5EYR A;  4BBS J;  2EQR A;  5EGO B;  4AC0 A;  4X1E A;  1BW5 A;  2B63 J;  1ETY A;  2X48 A;  2CQQ A;  4FIS A;  3BTC A;  2GM4 A;  5F04 A;  3NAR A;  4D5F A;  2NOG A;  3UKG A;  5M5X J;  2N8G A;  2COB A;  1MH3 A;  3S15 J;  2XPV A;  2DJN A;  2WV1 A;  2R7Z J;  2LY9 A;  4BKX A;  2LFB A;  2DN0 A;  4Y52 J;  3GTM J;  2G0E A;  4D7N A;  1SAN A;  1JTX A;  2DMT A;  1MBJ A;  4EEF G;  3GTQ J;  5IYB J;  3QPS A;  1LFU P;  2LD5 A;  3HM5 A;  5IYD J;  2Y0S N;  3FKI J;  1I50 J;  2D5V A;  5EZH A;  2XB0 X;  2AO9 A;  2DMN A;  3BR5 A;  3BQY A;  2JK3 A;  3S14 J;  4RDU A;  4L5E A;  5J1R A;  4C3H J;  1UMQ A;  5FLV A;  2L7Z A;  2CJJ A;  4IHX A;  1B72 A;  4IEJ A;  3ZQG A;  1ORK A;  3QPL A;  1HLV A;  3BT9 A;  4AUX A;  4M3E A;  3S1Q J;  4GFB A;  5F0C A;  1ETX A;  1IUF A;  4FCY A;  2EZL A;  1UG2 A;  3F0C A;  4C3I J;  2ZB9 A;  5M5Y J;  1P7I A;  2OF7 A;  3FIW A;  4HNV A;  2H8R A;  1ETW A;  3S16 J;  1AKH A;  3BR6 A;  1GDT A;  1MH4 A;  3BTJ A;  5IOY A;  4DYQ A;  2Y9Z A;  2HXO A;  2E2H J;  3QQA A;  2JN6 A;  1JUS A;  1JKO C;  2YU9 J;  2IAI A;  2K9S A;  2XSD C;  3JRE A;  3OSG A;  1TC3 C;  2EH3 A;  3PO3 J;  1JUP A;  3GTG J;  3H3V K;  1JKQ C;  3JRC A;  2DA7 A;  2OPT A;  1D5Y A;  5K7Z A;  1T33 A;  2JA5 J;  3CMY A;  1QVU A;  3HOZ J;  5JLW A;  1XC5 A;  4D5C A;  3LSG A;  3Q0W A;  2HQ5 A;  2R5Z A;  1H89 C;  1MSF C;  2HOA A;  1AKH B;  1MNM C;  2DMU A;  3GBG A;  3GTO J;  1JTY A;  1Z77 A;  1QRY A;  3IH3 A;  3K7A J;  3HOW J;  3HOU J;  1OCP A;  5M5W J;  2JWT A;  3JRG A;  4A3B J;  2VKV A;  2IBD A;  2NVQ J;  4JP0 A;  2EZI A;  4MFE A;  4DZP A;  3SJM A;  1ZR4 A;  4IHW A;  4MLO A;  3A01 A;  2MGQ A;  3RZO J;  1RKW A;  2X6O A;  1WPK A;  2DA1 A;  3BG3 A;  3BR0 A;  5IPA A;  2R5Y B;  4J19 A;  3RKQ A;  1Q1V A;  1IDY A;  4MIM A;  1G2H A;  5F1J A;  4V2F A;  2P81 A;  2W48 A;  2XGE A;  4A3D J;  3HOY J;  5DS9 A;  3HKZ N;  3WHC A;  1IJW C;  5GP9 A;  2EZH A;  3HOX J;  2HXI A;  2NVX J;  2XGC A;  3M3Y J;  2E1O A;  1F36 A;  1IG7 A;  1HDP A;  3PM1 A;  5FKK A;  4A3F J;  1W0U A;  3LSP A;  1X2N A;  5EDN A;  1MSE C;  1I3Q J;  5E3L A;  1APL C;  2X9D A;  5FKM A;  2YS9 A;  4CYC B;  3I4M J;  3A01 B;  1TWA J;  1GV5 A;  2VI6 A;  4V2G A;  2DA6 A;  4M3F A;  3S1N J;  1RR7 A;  2DTZ A;  2ME0 A;  3S1R J;  1WI3 A;  3LSR A;  1POG A;  1LFB A;  1VI0 A;  2QF7 A;  3NAU A;  1TWC J;  4A3G J;  1EF4 A;  2TRT A;  2R93 J;  4MFD A;  2ELK A;  1BW6 A;  1HF0 A;  5E3M A;  3H0G J;  2ECC A;  2E2J J;  1OJL A;  1HOM A;  1JKR C;  3JRH A;  9ANT A;  2CUE A;  4I76 A;  3ZQF A;  1FTZ A;  1DU0 A;  4XID A;  2NS7 A;  1RPW A;  3I4N J;  1NK3 P;  3CDL A;  3BG5 A;  1PUF A;  1HDD C;  3ZQH A;  1IV6 A;  4DYC A;  2CUF A;  4Y7N J;  4M3B A;  5IP6 A;  3ZOB A;  3GTL J;  3M4O J;  1ENH A;  3VPR A;  1ZR2 A;  1HCR A;  3L1P A;  3HBL A;  2EZK A;  3JR9 A;  1IDZ A;  4IHV A;  1X2M A;  3Q3S A;  3JRB A;  3S1M J;  1RES A;  4M6V A;  2NS8 A;  3TP0 A;  5FJ8 J;  1XS9 A;  4B4C A;  2NVT J;  1U9N A;  2K9Q A;  5EZG A;  3OOU A;  1GUU A;  1XG1 A;  2IEK A;  2HOT A;  4A3L J;  3RQI A;  3B6A A;  4JX5 A;  1O4X A;  1IRZ A;  2LTP A;  3D1N I;  3PO2 J;  2FJ1 A;  1Y1W J;  1MBH A;  3B6C A;  2Y2Z A;  1I6H J;  1B72 B;  2EBI A;  2QCO A;  2KDZ A;  4BXX J;  1OCT C;  3CCY A;  3FIS A;  2ECB A;  2LLK A;  2WB1 N;  3FK6 A;  3LNQ A;  2E19 A;  1VF9 A;  4G12 A;  1YRN A;  2VUM J;  5FKO A;  3RZD J;  1WH7 A;  2DMP A;  4FTH A;  1ITY A;  1H8A C;  4UUS A;  1GV2 A;  1E3O C;  3LSJ A;  5J1Y A;  1MBE A;  3IH4 A;  5F0F A;  4B1R A;  4BBR J;  1K83 J;  2I10 A;  4FE4 A;  1GT0 C;  2JA8 J;  2TCT A;  5EG0 A;  2DA5 A;  2M9H A;  1FJL A;  3G1O A;  5EEA A;  2K40 A;  2GLO A;  2XPW A;  4S0H B;  3BR3 A;  1ETO A;  3BQZ A;  5F0H A;  3TED A;  2R92 J;  2DMQ A;  1K61 A;  5FKN A;  2M0C A;  2MW8 A;  3SFI A;  1U78 A;  2LR8 A;  1YRN B;  1BA5 A;  5FLM J;  4BY7 J;  1X58 A;  4A3I J;  2R5Z B;  1ETK A;  4M3G A;  2L7F P;  4X6A J;  4D7M A;  1WCM J;  2DA2 A;  1WGX A;  3WHB A;  2LK2 A;  5EG0 B;  3S2D J;  3HGY A;  1ZQ3 P;  3S17 J;  2R0Q C;  2FD5 A;  1CQT A;  1F43 A;  3E7L A;  2E2I J;  4QIW N;  3TW6 A;  3JRI A;  4A3M J;  3BTL A;  1P7J A;  4IHY A;  5F08 A;  5C44 J;  2M8G X;  1FEX A;  1W0T A;  4LOC A;  1JGG A;  2HI3 A;  2ID6 A;  2M34 A;  3G1L A;  4FE7 A;  2YUS A;  5M3F J;  2ID3 A;  4JX6 A;  1ZGW A;  2JA7 J;  1VND A;  3MVP A;  1MBK A;  4A3J J;  2ME6 A;  2L9R A;  2H1K A;  2GBY A;  5K7F A;  4UUT A;  4RBO A;  2LVS A;  4JX4 A;  4M3D A;  3SDG A;  5M3M J;  2DA4 A;  4XRM A;  1ZK8 A;  4JYK A;  1JUM A;  2CU7 A;  1ZKG A;  1FIP A;  2XRL A;  5J3L A;  1Z0X A;  2HYJ A;  1JT6 A;  5HOD A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...