2R0QC

Crystal structure of a serine recombinase- dna regulatory complex
Total Genus 67
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
67
sequence length
200
structure length
193
Chain Sequence
MIIGYARVSSLDQNLERQLENLKTFGAEKIFTEKNRPILQKALNFVRMGDRFIVESIDRLGRNYNEVIHTVNYLKDKEVQLMITSLPMMNEVIGNPLLDKFMKDLIIQILAMVSEQERNESKRRQAQGIQVAKEKGVYKGRPLLYSPNAKDPQKRVIYHRVVEMLEEGQAISKIAKEVNITRQTVYRIKHDNG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Architecture of a serine recombinase-DNA regulatory complex.
pubmed doi rcsb
source organism Staphylococcus aureus
molecule tags Recombination/dna
molecule keywords 31-MER
total genus 67
structure length 193
sequence length 200
chains with identical sequence D, E, F
ec nomenclature
pdb deposition date 2007-08-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00239 Resolvase Resolvase, N terminal domain
C PF02796 HTH_7 Helix-turn-helix domain of resolvase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.60 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Homeodomain-like 2r0qC02
3.40.50.1390 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 2r0qC01
1UG2A 3F0CA 2FD5A 1JUSA 5FKNA 4QTRA 2P81A 3CDLA 3MN2A 1OCPA 5M5WJ 5J1YA 3O8GA 4NDLA 3QPLA 4C3JJ 2CUEA 3JREA 1O4XA 3BR3A 4BY7J 5C3EJ 2DA6A 1H89C 2H1KA 2L7FP 2R5YA 1RPWA 1JT6A 5EGOA 1BL0A 3TEDA 1JKRC 2QCOA 3TW7A 2M9HA 2ID3A 2XPVA 2L7ZA 1TC3C 4A3BJ 1QRYA 2L0KA 3S15J 5C4JJ 1H88C 2OF7A 3ZQIA 1GDTA 2DJNA 3HOWJ 5DS9A 5BNGA 1FIPA 3CMYA 5FKOA 2EZKA 2XB0X 2K40A 4RBOA 2IEKA 2E2IJ 1TWCJ 3OIOA 4FISA 1Z0XA 3GTPJ 3LSPA 3H3VK 1MNMC 2DA5A 3HBLA 3IV5A 5K7HA 4BXXJ 5J1UA 5K7ZA 4BBSJ 3QQAA 2EQRA 1GV5A 1R9TJ 3TW6A 5FLMJ 3HKZN 4M6VA 3ZQHA 3GUVA 2YU9J 4IHXA 1I3QJ 1S7EA 3PO2J 3LHFA 2EZLA 4ABZA 1POGA 1IDZA 2E19A 4DZPA 5IP7J 4JX5A 1IV6A 4A3IJ 1AHDP 1QVUA 1AKHB 2R7ZJ 1FTZA 3JRGA 1IRZA 3H0GJ 2NS7A 1BW5A 2AO9A 1MSFC 3HB9A 5E3MA 4D5FA 2HDDA 1HCRA 2D5VA 2ME6A 1RESA 5E3NA 1YRNA 2L7MP 3BG3A 3PO3J 3JRHA 3G1OA 1ZKGA 5IP9J 3RZOJ 2HXIA 5C44J 1ETVA 3IH3A 1X58A 4I6ZA 4JYKA 2EZHA 1ZK8A 3BTLA 5M5YJ 1SANA 1Z77A 2GBYA 1ZGWA 1Y1WJ 1IUFA 4AYBN 5IYBJ 3JRAA 4S0HB 1UHSA 3B6AA 1APLC 2DA1A 1WGXA 3CQZJ 1U8BA 5EYRA 2Y30A 1W0UA 1ZQ3P 4A3GJ 3LSGA 1HDDC 1BW6A 1RKTA 2M34A 2M8GX 1HX7A 1LE8B 2HYJA 4A3DJ 1B8IA 1EF4A 3IH2A 2DA4A 4X1EA 3G1LA 2CQXA 4G12A 2JN6A 4FCYA 2JA7J 2XPUA 4FE4A 1XS9A 1GHTA 2GM5A 1JGGA 2XGEA 1RETA 3GTJJ 2XGCA 4M3EA 1TWAJ 3NARA 3HOYJ 3TP0A 1FJLA 4D7MA 3S1NJ 1DU6A 1VFCA 1FEXA 1HOMA 3GTQJ 4Y52J 5EEAA 3HOZJ 2RAEA 4A3JJ 5C34B 4MO7A 2H8RA 3K2AA 2HXOA 5EF6A 4A3FJ 2WV1A 1IC8A 1TWHJ 4AUXA 2XPWA 1OFCX 4BBRJ 4A93J 5FKMA 2JA5J 4W97A 3HGGA 2QF7A 1U9NA 2DA3A 3IH4A 2X9DA 5F04A 5EG0A 3A01A 1GV2A 3BG5A 3BTIA 3MVPA 5IOYA 2X48A 2R5ZB 1OCTC 1NK3P 1B8IB 1VF9A 2O9LA 2NVXJ 2YUSA 4M3BA 1BJZA 2R5ZA 2EZIA 3SJMA 2JWTA 2AHQA 3PM1A 1HLVA 1JT0A 2K9QA 3QPSA 2HOSA 2KT0A 3BR2A 1JTXA 3W6VA 3GTKJ 1VI0A 2PMZN 5FKKA 5HODA 1ETYA 1A5JA 2RSLA 3FK6A 2NVYJ 4JP0A 1K61A 1QVTA 2TRTA 3DCFA 4CYCB 3HOVJ 3WHBA 1ITYA 3GTLJ 1ZTRA 2XSDC 1MBJA 4RDUA 5EZGA 3LSRA 2COBA 2M2EA 2K9NA 3LOCA 4XRSA 4BQQA 4LOCA 2DMUA 1TWGJ 4MIMA 4D5CA 3RQIA 3ZQGA 4IEJA 2YS9A 4GFBA 1HF0A 2E2JJ 4IHVA 4JX4A 2NVTJ 2DA2A 3BTCA 3UKGA 2JA6J 2JA8J 1AKHA 2FX0A 4FE7A 1ETOA 1ETWA 2B63J 5IPAA 4X6AJ 3BG9A 1F36A 2Y0SN 1E3OC 4M3GA 5F27A 2XRLA 4BKXA 4XRMA 5C4XJ 4HNVA 5GPCA 5E3OA 1JKQC 3S17J 2LD5A 3S2DJ 3BR0A 3NAUA 2ME0A 3GTGJ 2HOTA 2EH3A 1UMQA 2MSYA 2VUMJ 3LSJA 2CJJA 1MBFA 1U78A 1P7JA 1LE8A 3MKLA 3G13A 4J19A 3LNQA 3WHCA 3PKZA 2ECBA 2R92J 2FJ1A 1JTYA 4QSHA 3K7AJ 2E2HJ 3I4NJ 5DTDA 2Y31A 1GVDA 3BT9A 5EG0B 5F0HA 1BA5A 4IHWA 3G1MA 9ANTA 3S1QJ 3FISA 4M3FA 3HOXJ 1IDYA 4A3KJ 1XG1A 4DZJA 1TWFJ 2VPRA 3JRIA 5M3FJ 2VI6A 2K9SA 1T56A 2M0CA 5FJ8J 4A3LJ 3HGYA 3S14J 2MHCA 5C31A 1MBKA 1FIAA 3GTOJ 1MSEC 4JX6A 3BQYA 5GPAA 2CU7A 1ETQA 1YRNB 1DU0A 5EGOB 2LKXA 3O8HA 2X6OA 3ZQCA 1U9OA 5EZHA 2Y9ZA 3JR9A 3FIWA 5JLXA 1JKPC 1K83J 1PUFB 1IGNA 2I10A 3CCYA 5JLWA 4CYCA 4XICA 3Q0WA 1P7IA 4A3MJ 3Q0UA 2ELKA 5M5XJ 3A02A 2XGDA 1A6IA 3I4MJ 3FK7A 3OOUA 1I50J 1VNDA 5F1JA 5FLVA 4W1UA 2Y9YA 1D5YA 5FKLA 5J3LA 4EEFG 3D1NI 1JUPA 3LHKA 2HQ5A 1JKOC 4QIWN 2R0QC 3C2BA 5M3MJ 3HEFA 2JK3A 2MW8A 2Y2ZA 2LK2A 1B72A 2VKVA 4M3DA 3BTJA 2E1OA 4V2FA 1FTTA 5C35A 3UJ3X 1CQTA 3A03A 2EBIA 3BR1A 3ZQFA 3FKIJ 3JRCA 2JJ7A 1JJ8C 5IOZA 1OJLA 2CRGA 3S1MJ 3ILXA 3JRDA 1MBEA 4AC0A 3JRFA 3HDDA 2LTPA 1ETXA 1MH3A 4UUSB 1JJ6C 3RKQA 1LFBA 1X2NA 2N8GA 4D7NA 4B4CA 1QPIA 2NS8A 4L5EA 4C3IJ 5K7FA 1RR7A 1F43A 4MLOA 1RKWA 2VKEA 4IHYA 4FTHA 2MGQA 5F0CA 4DYQA 3S1RJ 2LP0A 1ETKA 5IP6A 3OSFA 3HOUJ 3A01B 3RZDJ 4Y7NJ 1IJWC 3B6CA 3SFIA 4DYCA 5IYDJ 1NTCA 2FQ4A 2G0EA 2GM4A 2IBDA 1T33A 2CQQA 1XC5A 3M4OJ 4C3HJ 3SDGA 1GUUA 2DMPA 2O7OA 4XIDA 3ZQLA 4DW6A 2MG4A 1PUFA 2ZB9A 4MFEA 1WH7A 2HOAA 4I76A 1WPKA 4C2MJ 1AU7A 2L9RA 3L1PA 3ZOBA 2NVQJ 1X2MA 3HM5A 4B1RA 3BVPA 5E3LA 4UUSA 3Q0VA 1GT0C 3JRBA 1WI3A 1NK2P 4XRSG 2ECCA 2W48A 4XK4A 2GLOA 4UUTA 3GTMJ 5EDNA 2DN0A 5IYCJ 2LY9A 2DA7A 2NOGA 3DEWA 2IAIA 2XB5A 4MFDA 3VPRA 3BR5A 1W0TA 1Q1VA 5GP9A 5F08A 1H8AC 3M3YJ 1JUMA 1G2HA 3BR6A 2KDZA 2HI3A 5F0FA 2LVSA 3OSGA 5C32A 3Q3SA 2WB1N 4V2GA 1ZR4A 4B3AA 1HDPA 3E7LA 1B72B 4DYRA 2LFBA 2R5YB 5J1RA 4A3EJ 1ENHA 1MBHA 1WCMJ 3BQZA 1MH4A 2DMNA 1ZR2A 4A3CJ 2DMTA 3S16J 1IG7A 2ID6A 1Y1VJ 2DMQA 3TP3A 1LFUP 3GBGA 1WH5A 3S2HJ 2WAQN 1SFOJ 2DTZA 2JMWA 2TCTA 2CUFA 4BY1J 2LR8A 2OPTA 2O8KA 2R93J 4A69C 1I6HJ 2LLKA 1ORKA 1MBGA
chains in the Genus database with same CATH superfamily
5B6PA 2Z3ZA 1Y5LA 2N42A 2J9FA 1MZVA 1KS2A 2OOKA 1KSJA 2I6UA 2R85A 4IDDA 2DJIA 1I1HA 3GMIA 1PK7A 3JQQA 3N3AC 3EGDB 3C24A 4MWEA 5CLQA 4DR4B 3ZEIA 4JXXA 1LNQA 1IXKA 3I9V2 1YZKA 2WC1A 1QPMA 3PDIB 1GQ2A 4TV7A 1KI8A 2GA2A 4I81A 2Z33A 5C8YB 2HZBA 4YRFA 2VXDA 2OBLA 4KKXB 4ON0A 2VT7A 5EGOA 2HIAA 2Q21A 5F6FA 1UZNA 1ZC3A 3TZKA 3ZQJA 4EELA 2H6CA 1W8DA 2HB6A 5L45A 5E2AA 1TUEA 4RB1A 2WKWA 4BNZA 1J0EA 3IUMA 3KHSA 4Z4IA 4PGHA 4U7FA 1ZUWA 1W76A 1ZM7A 4MB0A 3HJNA 5LEJA 2ZRNA 4O5VA 2ZIVB 1U3WA 1IUKA 3O93A 3T1YB 2JAQA 4N5NA 1TRHA 3VYRB 5BNGA 4EB6B 1J06A 3K5HA 2GN1A 2ZSHA 4LJ4A 1ZX1A 2KFDA 4P4TA 5HQ3B 5INTA 1VL0A 4JL6A 4GPEA 4UVHA 3ROQA 4TMYA 5JS7A 4ER7A 1K5DA 1ZARA 2E2IJ 3D7SA 4EHHA 1HI9A 1O6BA 2BE5F 2UVPB 1CEEA 1ZMXA 1Z0XA 3HO8A 4Q5SF 1HXDA 2X22A 1JP7A 4JCCA 1JEAA 4M9RA 4NECA 2XKOA 2ATXA 3BXFA 4MRAA 3PGVA 1WKMA 2DKNA 2E1MB 2W5UA 5J63A 1ELOA 2RNJA 4FMDB 3RV3A 1C1DA 2UUCB 1O95D 2XRFA 1Z7UA 3HPQA 3IJRA 4LBVA 5DGCA 2UYCA 4OAZA 3NNDA 3QOEA 1HPLA 3TW6A 1LB1B 1UEJA 3AONB 3Q3IA 4YJFB 5DLYA 1GL7A 4ZYDA 4P5DA 2VC2B 3UIEA 3GLGA 1GNTA 1WVRA 3DE6X 4FYHA 4ZV9A 3BXHA 4RE6A 3VUFA 2PUDA 4B3RB 2JI6A 1N4DA 2VDPB 3Q10A 3VJKA 4C1NA 3VZSA 3LXXA 3N70A 5AOVA 1SJ9A 1THMA 3NT4A 5C1OA 4QXQA 1KYVA 4BVEA 5C7OO 2FI1A 1DEHA 1HEUA 2VK1A 3CO6C 4WFIA 2HSEA 1U2PA 5DTMA 3FZQA 1E0EA 4OL9A 3DBVO 5IP7J 1LA2A 1NU6A 1LDGA 3HPRA 4BFTA 4FINA 1WBBA 3BM5A 2HPMA 3DKPA 1AKTA 5JJKA 1BMFA 3WLEA 4BMYA 2BTEA 3FM9A 5DYTA 1TUBB 1JZQA 5IAGA 3SQMA 5JQGB 1KEEA 4KMMA 4TQ9A 3SYLA 3VU1A 2ZWIA 2J4CA 1D1SA 1XB2A 2YIVX 4IV5A 3A0BC 5L3CA 2G7UA 1WQ4A 2R1VB 4JBLA 4MGHA 5EI5A 2HK9A 3K5PA 2HJSA 4OIFA 4UVCA 3RPUD 4QFMA 3RUFA 4E51A 5EJ5A 1CZKA 2WBMA 2R7QA 1ECGA 1SUWA 4ZZ1A 2GN9A 2RHLA 4C6SA 1EA7A 2YV4A 2R9VA 1KFCB 5ALWA 1JT2A 4DFDA 4OK5A 5FL7D 2NMVA 1BXGB 2P7HA 3BXZA 2EERA 1AMOA 1MVLA 2AQFA 1ZUNB 1OXTA 2GFIA 2ZJ0A 3IVRA 2ECFA 4UARA 3ZEAA 1HBJA 2H08A 5FO5A 3G1OA 2ZYAA 4IDOA 2ZQZA 3MAGA 4J4TA 2DECA 4C2UA 1C7RA 1TM5E 4BVFA 4CIBA 1E9EA 3AERA 4MYCA 3KVYA 2MINB 2E3JA 2HHCA 4Q4HA 3OA0A 2JLCA 1UM8A 5L7YA 1F4PA 1XAHA 2XTAA 4YRJA 3QE9Y 4DDWA 1W1UA 2NPOA 4E7OA 8OHMA 1OYVA 1EM8B 5DFAA 3R9WA 4U5QA 4EY6A 4JXZA 2AI1A 2BFNA 3DQVC 2PKQP 1ACJA 2ATCA 2M8EA 2Z5LA 4AJHA 1QH0A 3CQZJ 3DDCA 1J1IA 1AV6A 1RD4A 3SVTA 1TTHA 4A3GJ 1CR1A 2P4EA 5BW6B 1VOTA 4ZVPA 2Z3WA 3WGNA 1NQAO 1LEAA 4D8UA 2OAP1 4MUBA 4OMYA 2BGIA 4V38A 1O57A 3DXFA 1CB0A 1NVEA 1LPPA 1OQYA 3I2FA 3G5MA 3LUCA 1JPNA 4ND5A 4PANA 5KAFC 1JAZA 3KKLA 1GZ6A 4IHTA 3NIFB 3AVXA 1EUCB 2VUUA 4EA7A 5A3JA 1TJ4A 2XV4S 1U7TA 1SXJD 3FNQA 1JGGA 3HKDA 2EWVA 4ENMA 1AQIA 1UFMA 1Z73A 1OYYA 1ENZA 1T5TA 2V98A 1OJ7A 3L7JA 4R8MA 5F2OA 4H7HA 1BIFA 4R2JA 1WSBA 3PXGA 4D7MA 1X7YB 3S1NJ 4LECA 2HQAA 2X3UA 1HOMA 3IUYA 1UM9A 2DBQA 4YR9A 5JZSA 1THTA 1YTYA 2CHVA 1PGOA 1UWCA 2P6OA 3IDOA 3KCQA 2HJVA 1YONA 4JC5A 2ZUDA 4HX9A 2GCPA 2VLAA 4D0SA 1E1QD 1EK6A 2A1UB 5EC8A 4BAGA 3WS7A 4XSXF 1EWYA 1XVUA 2R60A 3R24A 5F5NA 2C5LA 3MBOA 2MU1A 1DP4A 1HQYE 4P33A 1NBEA 4EO4A 1W7PA 2MD5A 1HDYA 2EOAA 1R88A 4N18A 3C1OA 3IUNA 4O4IA 2Q5HA 2NU9B 1DRVA 1LJ9A 3OFSA 1P9RA 3QKRA 4Y2SA 5E8JA 1XROA 1O0SA 1XVVA 3WZMA 4OVKA 2FZCA 3RUIA 3VAYA 1N4AA 3EXIA 3D8RA 4RMJA 1P8JA 1EM6A 4CF3A 2Q50A 5EVCA 2GLUA 3T1OA 1P7CA 1PE0A 4HAUA 3DV2A 4OYLA 3GVAA 3E7XA 5G0WA 2JFBA 2MR5A 4D5GA 4TMWA 3L18A 2WUGA 5CLSA 3OIVA 2QLJA 2JAXA 3HKEB 4LFBB 1XA0A 2ZQ5A 3FMOB 2FQQA 1C50A 3PXBA 3QEOA 4LSWA 3VC3A 1XRJA 5CM2Z 3ICQB 5D2CA 5IBCA 1Q1NA 2HU7A 3JD0A 3N9IA 4GZLA 1DC6A 2VZ8A 4OBEA 5FTKA 5D84A 1D0ZA 1JNYA 3GZ5A 2Q9UA 3ZQQA 4WINA 3RSZA 4OU0A 1PL8A 2HSJA 3EFBA 5IC6A 4BFCA 4C6RA 3ASUA 3F9KA 1ZVKA 3PQ6A 4P2GA 3TLGA 2ID8A 2DH5A 3AUUA 4UE2A 2BE9A 2ZTMA 3T7SA 5I8WA 1BJZA 2Q27A 2I4OA 2R5ZA 3IFSA 3HSFA 3JARA 3PHJA 2IUTA 5CJ2A 1REPC 1WUTA 2ZDGA 3F1KA 3T7TA 4BMXA 2ASEA 1AQNA 2VQ3A 1R9GA 2P9CA 1D4FA 3CLUC 2PCJA 1XN7A 2PSSA 3TW8A 3RCBA 2I1QA 2R7NA 2EKLA 3QPSA 3Q88A 4FPXA 2W0SA 4J3NA 1M2VA 2B3DA 1CUJA 4R8RA 2PMZN 5BQTA 3UGJA 2PJRA 4DWOA 2NO7A 5I7VA 3GRRA 2QPOA 2WWIA 4ZIRB 3TUIC 5KOIA 3TNFA 3BT7A 4RU1A 4CDNA 4NEQA 1ESDA 5DNUA 3O1HB 5DASA 5I9NA 3DDZX 1D7OA 4LSMA 4E07A 5HJEA 3VNVA 2GSWA 2JIQA 3SS7X 2J5KA 2PU7A 2QR5A 4DRXB 2BTOA 4YYZA 4IICA 1H4QA 3O6BB 3UBTA 1XFAA 3GPBA 3RRJA 5KHAA 4NCBA 4B82A 4HRIA 4IIYA 1Z37A 3AESB 1HQCA 1LDNA 3IEPA 1M74A 5DGHA 4EM0B 1JKJB 2B5WA 3JAMA 2CCGA 1BDHA 1C5KA 4K3VA 4I02A 3AO0B 4EL0A 3YASA 1KC1A 1ZI6A 3OT4A 4RPGA 2FSHA 2WWFA 3FDZB 3DMNA 1NRJB 2L19A 4J7XA 4PS0A 2WIFA 4TVOA 5JAZA 2O0HA 5KYGA 4BVHA 2HOEA 3FYSA 5KYXA 5FBHA 1LI5A 4HZUB 2CN1A 4JJ8A 4YX9A 4ZK6A 1NE7A 2R7MA 1SD6A 1GRQA 1EFHA 1XD8A 3UGTA 3VTAA 2DB3A 3U1DA 1DIRA 4Q9JA 3K4JA 2OXEA 5FROA 4YIRX 1BS9A 4HPJB 4R4JA 1HE3A 4JLJA 5ALPA 1LTKA 1P1JA 3FPBA 3PG5A 4CPDA 5LRRA 1M2VB 5EE1A 4B3XA 1JIIA 3E0QA 1VJRA 1OTHA 3EEQA 3NBUA 5HBGA 3U19A 4FBGA 2PVCA 1KE2A 1LNWA 5EIAA 1Y8CA 4HH4A 1PLJA 4HZGA 4IFIA 5D8DA 5C1IA 4QT4A 5JC1A 4IXWA 2OGZA 5LVAA 1MJ9A 1QYDA 3EF3A 1U8XX 1MDMA 2XHKA 1ORWA 5AK3A 1A71A 4MVJG 1TTTA 3G13A 3ZJ4A 3DT6A 1LBHA 1B6GA 1ISFA 1ON1A 3LT4A 2PV0A 3FN4A 4LWQA 4Q7KA 3T9CA 3KJNA 4N7BA 1VCOA 3ZS8A 2NPIA 2FJ1A 2DFPA 1OREA 4HDAA 2G71A 1GKIA 5K01A 3MMNA 2YUIA 1GVDA 3ZP5A 3ROUA 1Q15A 4RF2A 3WBKA 2I7DA 4DV4B 1JDVA 3TTWA 1NBMD 1U1GA 1FS4A 1SK9A 2WIJA 4K8RB 1SKAA 4LSZA 1R36A 4M3FA 4NFHA 4QTXA 5DM70 2WI8A 4QLOA 1PJCA 3KYJB 2NVUB 1Z16A 2JS7A 2QU7A 5CM8B 5K51A 5HX7A 2XCTB 1ORIA 3CLSC 3KTAB 5KQSA 4QGHA 2JPDA 4RAZA 4FDAA 2RGGA 3GFQA 1UQRA 3B38A 4MPDA 3WL3A 4F3RA 4CUZA 4F4UA 5AVUA 2IBTA 2WU4A 2O4UX 3UT5B 2I8CA 3PE3A 4LRTB 3BQYA 1RFLA 4A8JA 3F67A 3DTVD 5K3EA 4EEKA 2CFTA 4KXXA 4XCVA 1FNMA 2I99A 2FLWA 2L2QA 1DU0A 4QU9A 2MT9A 2YXPX 3CNLA 2CV1A 4ZI7F 1S2OA 2H1VA 1D04A 3QLTA 5HGXA 5I9IA 3R9KA 1XXLA 2DM6A 4A16A 3ZHQA 2CEAA 1RP7A 4M0LA 2E87A 4MMZB 4MQUA 3JR9A 2GO1A 1H69A 2CUKA 2XAGA 2UXXA 1QWSA 1V8DA 5D8KB 1ZUD1 2CGEA 4EM2A 1M73E 3AR6A 3F4KA 3I5MA 5FP0A 5E1WA 3OT5A 5LLDA 3ZVMA 4OJQA 1R3DA 1JFVA 1T4CA 1UMDA 3TZEA 3CF5F 1ERDA 1VHQA 3GIWA 5DTQA 1L5RA 1L5FA 1M6WA 4Q15A 1ESEA 1RBMA 4L2IA 2B7LA 2REXB 2VNJA 3AOEC 3IB6A 2C4WA 3QLVC 4KGXA 1XTZA 1OCCH 2ZRMA 3K15A 2OAEA 1DZ3A 4TTAA 4FEYA 1WQ1R 1QBJA 2OV8A 4HT3B 3OCWA 2H8GA 1KXZA 2J3QA 4P81A 3CWZA 4C4ZA 2NQ2C 2H27A 1NI4B 4KDEA 4B7XA 1DU4A 3FK7A 1HYQA 2YQZA 3UMSA 4ZZ3A 1XK6A 2CXHA 2D2VA 2CNWA 3L2OB 4H1VA 3AG1H 3GLIE 4XCXA 5ALKA 5IYZF 2OQVA 3MRTA 1R9MA 2IZZA 3EFHA 4JUFA 3A1EA 4UQOA 3ZE1B 2ECQA 4I5GA 2WJ6A 1QLWA 3SKXA 2X4GA 2VKTA 1YR3A 3OYNA 4M1WA 3HDQA 5KMGB 3TE7A 4NCHA 3RG2A 3SX0A 4UTXA 4CLXA 4D4LA 4DNPA 3HXTA 5AIAA 4F60A 5CH5A 2D1RA 4HDMA 3AKCA 4L50A 4OM7A 2IP4A 3B9QA 2IS1A 1C3XA 4CSWA 3QH4A 2YHSA 2WD7A 3KQTA 4B3DA 1MJNA 2EBFX 3BK1A 1YAJA 2DCEA 1GTSA 2QRKA 2CF6A 4XKWA 2XTNA 2JGFA 3A6JA 4Q34A 2ODAA 2HHAA 5BUSA 4DBRA 1ZKDA 2IS4A 2J46A 2W9XA 3QX3A 1IIBA 3NV7A 1G64A 2KJBA 3N0TA 2W6JD 3UXMA 2FP4A 3LOQA 4BV3A 4CXMA 3GXOA 1JHOA 1W581 3ILXA 3CX8A 1XRNA 1ZBDA 4GXNA 4LFCB 3C7JA 4ALLA 1MNQA 3E7WA 2R2GA 3FPEA 1RRPA 2VWPA 1VYTA 2ZB3A 3Q0IA 1YVEI 4XLLA 2J7PD 1SC1A 2NO5A 5HUJA 3PC4A 5EJ7A 5LQRA 4E33A 4M8NE 3D7NA 1Y8QA 3KSDO 4U02A 3H1BA 3VR4D 3PNMA 4QYWA 4HD8A 4DT1B 1CP3A 4DXDA 1EFDN 4P3XA 4CLOB 4PSKA 4BFUA 4IGAA 4OIRF 3E84A 1IHUA 4IO0A 3ZHYA 1RKWA 4IHYA 3OJWA 5BS6A 3IMGA 3FMPB 3C87A 1KXJA 3IP6A 2R5FA 2J0EA 5DBHX 2XXAB 1X6VA 3ZXXA 2QD1A 4YJGA 5EFOA 1PGJA 4AWBA 5A4MS 1RRCA 3ELBA 3R0XA 3UWMA 2BXYA 5JFRA 4NQZA 4B5KA 3HG7A 3I4FA 4IZZA 2IBDA 5HW0A 4PF1A 4MV4A 3MMPA 4R2IA 1NH3A 1IONA 3MWYW 1RRVA 3IMEA 3LKDA 2DMPA 1U0JA 3D2AA 3JWJA 3DUWA 3OU7A 2UUBB 3CDIA 4LWZA 3MLEA 4I76A 1WPKA 1MOQA 4Y9TA 5BVGA 1O3RA 1E8DA 4DBLE 4P54A 4IL6C 1X2MA 4OHMA 1ZW6A 4B1RA 4DNCA 1N1MA 1U0EA 3DV8A 4LZWA 4C6TB 1L5SA 1WNTA 3W06A 4PSXA 1HC8A 2R7AA 3ZIAD 4K28A 3R1IA 4I1VA 4IF6A 2R7LA 1BS2A 3VYUB 2PBLA 3WIOA 1LBEA 2P1RA 1G0OA 4RZUA 1EA3A 5CVIA 2QUZA 5AH0A 4UUVA 3R2JA 1YRWA 3TJMA 2GZ2A 2YN0A 3P2JA 3AKDA 1DWUA 2HDCA 3DDUA 1EK5A 4TYNA 4MFDA 1WUIS 1XWIA 4HMOA 3GK3A 4NE9A 1LPAB 1ZNQO 2P9TA 4TS1A 4Z9FA 1OKRA 521PA 3TIGA 2FJPA 3ND5A 3ZR4B 4EGJA 4Z6KA 3AVWA 4Y6OA 5GVRA 4UNRA 1HY3A 1UL1X 5LQKA 1XLTC 2JLVA 2A1TS 1W4BA 2B34A 3L04A 3OV8A 1JE1A 3P96A 5H7XA 1PS0A 2RVCA 1GT6A 2JIDA 2VDNB 2XEDA 4YT5A 2LNBA 5LMUB 1E0AA 4BO5A 1OIWA 4ZZDA 4IIJB 2ZNYA 2V45A 2UV1A 1T9HA 1R8QA 1DDNA 1UJ6A 5IKXA 1CF7A 4XOTA 2J0UA 3PC8A 1AKMA 1KI1A 1V16A 4G7HF 1XAIA 3MZ8A 1VTNC 3LP6A 1I6XA 3P52A 1DWQA 4HLCA 4EBBA 3L6CA 4BMVA 4RZ2A 1UDAA 2C0PA 3G8AA 1U98A 1NWCA 3HEBA 5C8DA 5KYYA 1RWXA 3PGJA 2L7KA 3THSA 1T5IA 2BEOA 4ZVMA 3WNQA 3HNPA 5PGMA 3KQPA 4TWJA 1I7PA 1Q20A 1B26A 1KWGA 2QLTA 5AVYA 3A6ZA 1MOZA 3JCZA 3QBVA 2PFKA 5IDXA 5GTIC 3RC1A 2FDCA 4B73A 3FOBA 4F3YA 2JIOA 2PUTA 2O8KA 1PP8F 2QQBA 3HADA 221PA 3NDRA 3PQEA 4EUFA 3DDWA 2ZE5A 1JWBB 4EY7A 4YUWA 1LW6E 4WDQA 2Z1DA 1FTNA 1RRFA 3ROZA 3E9NA 3U4HA 3W78A 1FFDA 3SNKA 4YJ2B 3ZGOA 3SOZA 2NW6A 1ZAOA 3CDLA 3SGLA 1WR8A 2CSUA 5K0JA 3A58B 3H42B 5LGUA 1OBOA 2B36A 4J2OA 3JQFC 3MN1A 5KTYA 3NDBB 4RD2A 3X1DA 4C3JJ 1O4XA 3N2IA 1Y9EA 1AKQA 4B74A 3O2JA 2WKQA 4WADA 4MKGA 5F7XA 4Y9DA 3T3MB 4FFLA 2Y76A 4IDQA 2L7FP 1VIDA 2P2ZA 2FPOA 2QI9C 3U9SA 3KYBA 4HDRA 6PFKA 2PL1A 4LD5A 4O6VA 1JKJA 3MOGA 4P5PA 4WT7A 2W2KA 4M60A 4CMEA 1JFRA 1QFMA 4ZA2A 3FXMA 4X8LA 5AKJA 2L7ZA 1E6LA 2O8FB 1N6KA 3HZHA 2D2WA 3S15J 3KB8A 5EE5B 1PWXA 1MF7A 4ZFNA 2IDJA 2H7VA 1PR6A 2UYGA 3FCXA 1IK6A 3DDHA 1QIEA 3U7HB 2W7TA 2XMBA 3G5TA 2H00A 2VASA 4XLPF 5EHXA 1KAOA 1MMAA 1QWOA 2DT5A 1SBZA 4M8IA 3ZI0A 2ZI6A 1AXEA 4JR0A 3TBHA 3KEFA 1P0MA 2EA4A 4IDCA 5ALDA 4BX9A 2NYVA 2J0SA 2O8FA 4PCQA 5TQ2B 2XB8A 5JVTA 3MRVA 2JGDA 2QRUA 3H4IA 1NXWA 5BQOA 4TKUB 5DOVA 4I1PA 4OMUA 3E3AA 4J1QA 4BNFA 1LQ2A 1PFKA 4CFZA 3IV5A 2F5CA 4TM7A 5SY6A 3U1TA 4JASB 1QX3A 3A25A 4UCQA 3G8BA 5F33A 2IY7A 1K0FA 2PX0A 4JOCA 4TV9B 3K92A 1IZ9A 1Z2OX 4LGWA 3NOOA 2A6TA 4BGIA 1CY0A 3L7IA 1NQTA 4LDPA 5FQNA 1F06A 1FCJA 4JSTA 4F4JA 3UNXA 4CFYA 5B4VA 3CJRA 3QOXA 1N2BA 3HYLA 2PZMA 5JYCA 2XUOA 1IB0A 4QU5A 5LOVA 2HQRA 1W5EA 4LNUA 2I66A 4YELA 4ERXA 3MJVA 5IM4A 3NHLA 3LW7A 3D6JA 4D0RA 3K0LA 4ZDOA 1FUEA 1RKUA 2R6JA 3AMVA 1RHQA 5E6SA 3CCMI 1E69A 3U7JA 1KQGA 4D56A 4NZYA 5A5FA 3LDFA 2Y0CA 3PLAE 1TUIA 2B83A 2Z58A 1XQ9A 1G8FA 1L5ZA 3G9UA 4FGSA 1JF8A 4R3NA 2OC9A 3BE6A 1QAMA 1H3FA 5NULA 1IRZA 4RL6A 4TTPA 3KO8A 3LAJA 4CL3A 2WWRA 4GMKA 3OFNA 3QX9A 1PO7A 2PJUA 4F9TA 3U3DA 5E3MA 2XX3A 1Y1KE 2DEUA 1GARA 3K4QA 3TNLA 2Z04A 4JLBA 1IN5A 1YZVA 1L6RA 1ZP6A 2JAPA 4DCMA 3ZN0A 1NDHA 2AS0A 5KNDD 5P21A 3LP5A 5HNHA 1JHPA 4RA9A 4CMCA 2D1HA 2ZBUA 3GJZA 2D5CA 3GLSA 4FU0A 4NFSA 1DUSA 1IRXA 3OEWA 4MI6A 3DTTA 5GADJ 1ADCA 3MWKA 4MEJA 3FXKA 4QARA 4RADA 4N12A 1XLTA 5EJ4A 1Y6FA 1GDHA 4I1UA 3EUAA 4GW3A 5EMJA 1QS0B 1N2IA 1UM9B 3N5CA 4LBZA 4NCXA 4NTZA 2BM9A 2WU1A 1X1AA 2A1IA 4YQYA 3VPCA 1DAMA 5HS4A 4G6QA 4N41A 1USWA 3WHPA 4KQ2A 3I4CA 2DYRH 3KXLA 4WASA 1E6KA 2AMJA 2VQGA 2IYQA 1NUQA 2OWDA 4PAGA 4RK7A 4RV9A 5JWRA 4URHA 1Z8NA 1U9JA 3ZMUA 1NL3A 5JJIA 2KS6A 1E1QA 3OQBA 1L8QA 5CURA 3S2UA 2P4UA 4BVJA 2HNAA 4QEDA 4WESA 4D6YA 1BI3A 3CCEI 3LQFA 1J7JA 3BFJA 1HX7A 2CHQA 1DJQA 3TGWA 5HKAA 1SFKA 5TMDA 1XZMA 3T9DA 5BVGB 4HDSB 2ZJ2A 1CRLA 3IIJA 1NVAA 3IPXA 1XGMA 3AVPA 3LC0A 4Q21A 5DGXA 4JU8A 3CEMA 5IKMA 4N7JA 2HWKA 4BLUA 1QK5A 1SXJA 2IV2X 1ZYUA 4RVDA 4Q9IA 4BO6A 4LKRA 2H5IA 3PFBA 5ENDA 3OTOB 1Z2EA 3F7MA 3TIXB 3GZNB 1M3SA 3DXXA 5AVWA 4JC0A 2D54A 2QTHA 3R20A 5IT5A 1P2DA 5I01A 2Q6LA 3HYRA 4B6EA 3OZSA 1H2YA 2J09A 4IRXA 1FOXA 4FX4A 4JDUA 4I4TF 3ZHRA 3K6GA 2JH8A 2WU8A 4KGVA 3T35A 1BH6A 3BWEA 4RDIA 4BBZA 1AHIA 2I71A 3NTXA 1SHTX 4X1KA 4YFVA 3DOIA 2DCUA 1H0MA 1WRBA 1U02A 1VLJA 5CTAA 4CMGA 3GJXC 3VHRA 4CDRA 5B4TA 1HM5A 2V79A 2YVLA 2PMBA 4B87A 1QHIA 3ZH2A 3ONQA 4IWXA 2WV1A 4IQ0A 1RI2A 3WWEA 5JAQA 1U81A 1WF6A 4P35A 4XEUA 5JATA 1T98A 4KWIA 5ERYA 5B6JA 1SXQA 1VLLA 3KK0A 1ZM3A 2AZMA 2IVZA 3LYAA 1NV9A 3KE2A 4XN3A 2X23A 2EA2A 4WX2B 1SR8A 1NZDA 3HOTA 5C80A 3LGSA 3AJEA 3DEAA 3A9TA 2F9MA 3HGGA 4JVOA 3SEAA 1GRCA 1GY8A 3KZKA 3LSHA 1LS1A 1EUDA 3W1VA 4AMGA 2OHHA 3E05A 3ESWB 1IUYA 3R5JA 3CCFA 3CZMA 3K0SA 2G1KA 1OFUA 5D85A 2X9DA 1C3EA 2M2IA 1N7GA 1C3VA 1VQLI 2AUMA 4YRZA 1RCFA 1Y1QA 2WB2A 1DINA 3PDHA 2QAGA 2YDXA 1AIPA 3NATA 4JYPA 3PC3A 2AJBA 1XTIA 1R6UA 5F3DA 1HYHA 5A6VA 2XUHA 4OUDB 2O2GA 3IQHX 2P3SA 4MAFA 5AI4A 3LXUX 5K3AA 1ZOSA 3Q7RA 3D7RA 5DDGA 2CVHA 4DE5A 4QUHA 4MIYA 1BXRA 3IESA 4HN9A 1O96B 3D2LA 3QUBA 2JANA 3NDJA 4KNVA 5HQTA 4WERA 4EHFA 4D2IA 5E95A 1TYCA 5LP6B 2FXIA 4WLFA 2KT0A 1NI4A 2V65A 3W6VA 4N5DA 5L4SA 2IXGA 4WXHA 2ZRKA 5HODA 3MK31 1LTQA 1G55A 1JEEA 3MBKA 4Q4HB 4RPLA 3FXRA 2BAGA 2VP9A 2PKEA 3V4SA 3RYPA 2X3FA 4V19K 1U8ZA 3EQLF 3SJBA 1N7JA 1D0VA 3TQCA 4Q03A 3VNRA 4B3JA 1R8YA 3OX4A 3GFSA 4LITA 5A71A 5BNWA 1R27A 2HHLA 4YUYA 5IW8A 4IXMA 1WWXA 1JXSA 3VXKA 1XX6A 1RABA 1D0SA 2O48X 1SCNE 2DUMA 3G2OA 2AOUA 3HKBB 4R5HA 1VM6A 2H85A 4IFEA 1Z0AA 4IRMA 3SJ7A 3SN6A 3I1YA 1N36B 4MW9A 1RWWA 4JB0A 1ISJA 1VZ3A 1UINA 1C8BA 2FZ5A 4NCAA 1T4DA 1YX5A 2QQ9A 2W2MA 3M4ZA 3U9LA 5LM3A 4DSUA 1FYKA 4G09A 4RMGA 3ZQGA 1ZIPA 1NQVA 2OK7A 3A9RA 3COYA 2AR7A 1JI8A 2IY8A 1HF0A 4IHVA 1F14A 3GC6A 5EWMB 3I8SA 3L5OA 5ITZA 4LLLA 2Q1TA 2ZTVA 4BRWA 4D3ZA 4HEA2 2ZI7A 2BFOA 1MOPA 4MWSA 1V6AA 3MNFA 4IH4A 5CT9A 2B63J 2FLVA 4P55A 2FPSA 3PEFA 4P2BA 4CI0B 4WXPA 3H1TA 4TTQA 3M8EA 3WLFA 2NNLD 2GNOA 1KK0A 3UH0A 3ZWWA 2Y0SN 3VKFA 2ZYTX 4QE3A 1KJNA 3QOWA 1AGPA 2QLMA 1PWHA 4ENKA 1BE0A 2X5JO 3PUZA 5BURA 5CNJA 2F62A 1D6MA 1MX1A 1M2KA 4A0QA 4DYVA 1WB5A 3J80Z 3BG6A 1U3VA 1LSOA 2QRLA 3A2MA 4G0ZA 4NCKA 4YJFA 2P2DA 2H4HA 1W2GA 4F6RB 2CWDA 1CS0B 1WMBA 5CKTA 2B1GA 3GN2A 3WWDA 5CITA 1SBIA 5DBEX 3MKLA 1FFEA 4P34A 4OK3A 4HUTA 3QV2A 1MH1A 3RVRA 5JCOC 4YDHB 1JEQA 3PKZA 2ECOA 4KRFA 1F2DA 1LNZA 2REQB 3QLEA 4FEGA 4RKYA 5E2BA 3VO1A 5IKPA 3CUSA 3BT9A 1KZ9A 1WTCA 3GLRA 3NR2A 3ZW9A 3C3WA 3G1MA 1WEKA 9ANTA 3SF8A 3ADBA 2D45A 3R76A 3W4JA 3OCJA 1JWAB 4I55F 2EX0A 1IDYA 4FDTA 4OMFG 1GADO 2JBWA 1J7KA 3HDTA 1NZFA 3O9MA 4ML3A 5EJ9A 4W9RA 4ZXFA 3I2HA 4DMCA 1Y4UA 5AQEA 4ZI7A 2CCKA 1R8SA 3ABTA 1WW2A 1SCUB 2ZB4A 3FPSA 2ZSJA 1XMSA 3L7LA 2Q2EA 4L7QA 5AVKA 5JASA 1AO0A 2ZSBA 4RGXA 2RKBA 5TS2A 3N6RA 3Q3HA 1QLJA 4JYZA 1FP7A 2UXBB 1GAXA 1U80A 4ESJA 1Z15A 2YWRA 5K5OA 1B16A 1VQMI 1P7ZA 4G81A 4BJ5A 2J3LA 4M9UA 2DU8A 4O1MA 2G8NA 2C78A 3D8NA 3Q85A 4ETMA 3NHRA 1GZUA 1F9EA 1Q50A 4DBQA 2O1EA 4W8HA 2CKMA 5EZHA 5EZQA 2VTBA 5AW8A 3F6SA 2YXLA 1QIHA 2HJHA 5BWBA 2H1CA 5FYDA 3TLYA 2J9FB 4GBMA 4IHAA 1T1SA 2FDRA 4ARZA 3JYQA 4EJSA 2EFHB 2K7ZA 3WDLA 4ZHSA 2ZROA 2JUGA 2IZ1A 4TYPA 4QLCU 4ZVQA 1YS9A 2D8AA 2O6GE 5MFZA 2ZB7A 3PIRA 1A50B 1ZA1A 2KJCA 3G73A 2AC4A 3A3PA 4M6YA 4FHCA 4QASA 5JANA 1OAKA 4G6ZA 4G85A 2C54A 3BP8A 4QQFA 3ETCA 5SICE 4Z51A 2H4YA 2Y0DA 2ZITA 5AXAA 4CV3A 2IYRA 1N3YA 2NZYA 2ADUA 4F21A 5LMZA 2DFDA 3U7FB 2OVBA 3R61A 4BS9A 2PD4A 1M2EA 1P60A 1LLUA 4MP8A 2WKSA 4NK4A 4TVKA 2QBYA 1XRRA 2PPLA 2PMHA 3INYA 1R16A 4RH0A 1LV8A 2FNAA 2ZXFA 5HKBA 4PTZA 5JFOA 5AVOA 2YL2A 1N5RA 2XUZA 4RAGA 1H9GA 2XTZA 3M1LA 4HUQA 4JT2A 1Z0ZA 4RLQA 4J16A 1RVV1 1SKYB 2G5TA 5B12A 4M3DA 4HZFA 3F3YA 1ISHA 5CK5A 2QTNA 2WWWA 2NOJB 1I4EB 4JQSA 3P0IA 4CMBA 1W7PD 5EZ5A 3UKJA 1KERA 4AYBA 1N32B 1NXOA 5EY5B 3KQKA 4PYKA 1UJBA 1QH1B 2LXNA 1E6WA 1QAQA 5JEDA 5J2TA 1UC4B 2VH2A 1TPYA 1IL0A 3H7AA 1A77A 2V7UA 3JALA 4EG5A 1OJLA 2CRGA 3CUTA 3OX2A 4FSHA 1OYIA 3JRDA 4ZT4A 4MS3A 2A67A 2HWUA 4EYGA 2XWQA 3VU3A 4Y3OA 2DW4A 3AY7A 5EMNA 3QKRB 4LJ5A 3RE1A 2P6SA 1J21A 4KMFA 3HEMA 4RFSA 2EW2A 1A27A 3ULKA 4LRQA 3RYFA 3GH3A 3HNOA 4XVRA 4C9BA 4DZTA 1G8YA 4ZDWA 2HCRA 4ZVRA 2WJAA 5BOSA 1YW8A 4O25A 3RRNA 4YCNA 1QGED 4JHXA 1ZD4A 4X7MA 3GGSA 5SZIA 2XHEA 3CKMA 1SD4A 2LRDA 2E5FA 2X6QA 3QFRA 4OY3A 4PBSA 5IBRA 5JXJA 2CW5A 2VKEA 2JLRA 1FUKA 1QKKA 3GJSA 3SAJA 4Y33A 3QP6A 4I4CA 4CM3A 5HVQC 3IAAA 5B64A 2V7WA 3RABA 3TAXA 1RXWA 1LK5A 2HPAA 3F4LA 3OEEA 4QUEA 5B2ZA 3DS8A 3ZNOA 2BKLA 2NG1A 1ISGA 1NSYA 1YR6A 4MX8A 3P2YA 5GP1A 2QVZX 3U60B 2O8XA 2SHKA 4FZVA 1I14A 1PT6A 4LK1F 1SQSA 1XMVA 4WFKA 4C21A 1DADA 5KVRA 1E6CA 4WWHA 3TPZA 5MN4A 1GUUA 5H20A 1TA0A 2AG8A 3DFMA 2O1SA 2V59A 2VODA 4TLMB 4V0MA 4MFEA 4LA4A 3IRRA 2FSVC 2OYCA 4FJ2A 3TUZC 3JQ9A 1D9XA 1HSOA 4R16A 4EJ6A 2G6TA 3PNTA 1FSGA 1E2JA 3CXRA 4KH1A 2W83A 3TOZA 3Q0VA 1CW2B 4J75A 4M37A 3BTOA 4AK9A 4CUJA 4F1JA 1OBFO 5I7RA 1Z07A 1JMYA 1N6HA 1TCUA 4N5MA 2F3PA 5JO9A 5TQ0B 1BE8A 1NMYA 3SQDA 2YZNA 2EV5A 5HIAA 3L7OA 2QMYA 4X97A 4X91A 3AP3A 3MOSA 2VOOA 3AI2A 1RAFA 4L74A 2GUWA 3IHWA 4K5QA 4NESA 4WNIA 2Z6UA 3L6OO 2UXDB 2XB5A 1XDWA 1ZD3A 3G0IA 3P9RA 4HTAA 2ROQA 2IYTA 1OWPA 2E4VA 2VXCA 5EKTA 2MLGA 5DN6A 4FX0A 2YVUA 2IHJA 3LU1A 4QYIB 1G2HA 2QXUA 4G5QA 3IPRA 4HI0E 2H5JA 4RDCA 4PPGA 5GVSA 1NA5A 1Q91A 3K5IA 1HG0A 4KCGA 3UTDA 1ZAKA 5JXGA 1DJOA 1YR1A 3VYVA 3ORHA 3GMSA 3RYHA 3V8JA 5K5QA 2NQ8A 2W4QA 5J2UB 1RIOH 1G16A 1ONOA 1T3SA 4GI1A 3STXA 2FMHA 1MB2A 3JTHA 1PJZA 2NLOA 3WG9A 1O94D 2AT1A 2DMTA 3W2VA 2H3EA 3EG9A 5ESXA 1YXMA 3O92A 2C92A 4RZXA 4FVTA 2K5CA 2VNAA 1V6SA 1MA3A 3DC2A 4O2BB 5TGTA 2FBIA 4XIJA 2M6KA 4PRLA 3LHIA 1BQ4A 4MCHA 3CRZA 1LB2A 3E3MA 4E7SA 1V1MB 3EHEA 2Q5OA 4PW0A 1DI0A 4BP1A 3VKWA 1VRVA 5BNFA 1TJPB 4OHWA 3X0DA 4NAHA 4TLCA 3SK0A 1HT1E 4BZWA 5D3KA 2GJSA 4U2GA 4XLCA 2BI8A 3BFKA 3NC1C 4FGUA 4CMJA 4I3HA 3ZQ7A 5BYBA 1TK3A 2WHXA 1MTZA 4YJGB 4E7ZA 5C1DA 1U0FA 5DEIA 4BTEA 2FD5A 5HDKA 2NOAA 2QZ9A 1K2WA 1JDBC 4MW0A 2P81A 3UJHA 1QO0A 2CNDA 1JA0A 1FMLA 3D8HA 4G9BA 2FF4A 3V2IA 4DBVO 2CLOB 3QF4A 3UWPA 3UVEA 2XE8A 2FWBA 3FTQA 5A0FA 4LDJA 5IVHA 4TZKA 3SSAA 2P0EA 2PLNA 3K1TA 3SICE 5LR6A 3LQRA 4IKPA 4K9NA 5DYNA 1Y63A 3HK2A 2DA6A 2HMWA 2QYTA 3OCCA 4PR3A 4QEZA 3ZGZA 4J7CA 1ZK4A 1ESCA 4K81B 1SVSA 1C7EA 4I8XA 5KOJA 3JPYA 5IYZA 3QG5A 4IWNA 4UAGA 5EMLA 5T4HA 4MDFA 5KAIC 2J0VA 1TC3C 1Z6XA 5DK6A 5TVKA 4U7BA 5GAHJ 3ZE9A 4BEJA 1GDTA 4IBOA 3EARA 5BXQC 4K6FA 5AKKA 2O2JA 4YJ3A 1R18A 4MJ7A 2HY7A 4ZTBA 3W5VA 2HMYB 5KWJA 4RTRA 4RAOA 2B69A 3WDSA 4ZANA 4H6WA 4E09A 1KEUA 1EGAA 2V1NA 5L40A 1GDDA 1MTOA 1OI2A 3I0NA 3PFHA 4LTMA 4CMHA 4S1OA 5IBQA 3G59A 3N5KA 1T1GA 3QYJA 4Q00A 5SY9A 1SGWA 4BFZA 3JQ7B 4CF4A 5A4KA 3ESCA 5G1NA 5KQRA 2NNWB 3LSPA 3OWXA 4B09A 1YRLA 3TLZA 1ON2A 4Z1MD 1E2IA 5EJIA 1BHO1 2WUEA 5K3SA 4EEXA 5A2QA 3MUFA 3FTDA 2CUTA 5DHAA 3X2SA 5FB2A 2QK4A 2WG0A 4TUYA 3TXXA 1JEYA 1LLCA 3A6GA 3L8ZA 2PJPA 2IPOA 4J9UE 1AQYA 2WUWE 2HUPA 5L4LA 2P90A 4MRSA 6LDHA 4MYHA 1CLUA 1OVMA 2YFKA 4NDNE 5BR4A 3JWHA 4E94A 3T1QA 2Z3YA 4H15A 3UJ9A 2YX1A 2EZLA 3AR8A 4R31A 1OLOA 1V1JA 2C4VA 1ILWA 4EYKA 3DXYA 3N2GB 4EZEA 1V4BA 1QP4A 1IV6A 3CTAA 2C3YA 3CVOA 3TR0A 3UMVA 4IP0A 4QOSA 4PC2A 3EVFA 1GTZA 1RI4A 1K7SN 3FZNA 2Z8YM 1QV7A 3KJIA 3NHSA 5CDSA 1FYFA 3Q41A 5KSOA 1FDOA 1G5FA 4UE3S 4CM6A 2AUNA 3H92A 1FFXB 1NUHA 5HS6A 2RQPA 1UDBA 2J3KA 4DDMA 3NWJA 1AX9A 4JQYA 1NAHA 4M7WA 2H59A 5EPOA 3X2FA 2O0MA 3RYFB 3ORQA 2XCOA 5LQNA 1ZGCA 2OORA 5FL3A 1LXCA 4QHTA 5LLSA 4POOA 7REQB 2ACKA 3ACBA 2Q4BA 4PGFA 3T1VA 2CSOA 2A3NA 3WY9A 5L3SA 3L7WA 3TWOA 3W2GA 3ENKA 2YY6A 5CIYA 2IPLA 2ZRQA 1GNLA 2M32A 4TX1A 5IULC 3ZR8X 4HV4A 3W3AD 3PFIA 2GMWA 3S2EA 3L05A 5DHSA 1UJNA 5C44J 3DOOA 2JT1A 5BYKA 5B2FA 4LQLA 2L2OA 1SOVA 4QUBA 2ZM6B 4G0WA 2EQ5A 5FOWA 4JIGA 1VQ8I 2BGNA 3ZLVA 5K0SA 2HIGA 3A1NA 3C8DA 1A69A 1J49A 2DA1A 2YFHA 4UHBA 1WGXA 2ZOSA 4HUQB 4IINA 3MCAA 4MUEA 5J23A 1W88A 2PZGA 3RC8A 1G8GA 1HRKA 3RO7A 4HVLA 4L9NA 1JECA 4U0KA 4OIOF 3BXEA 4A8PA 3P9XA 2A14A 3MWDB 3D6MA 4XKBA 3FPHA 4QXPA 5AW0A 2TDXA 3JARB 1JQEA 3WTBA 4A3DJ 4CV1A 2OO7A 4PN3A 1F3LA 3I1FA 5JIBA 2IU3A 1VQ1A 5F35A 2DFLA 3SF0A 3UT6A 1U9YA 4UMDA 1B3BA 1GPDG 1QPZA 3JYNA 1XNGA 2LKPA 5JO0A 5IH3A 3HBMA 1MC8A 3K70D 2IEYA 1ZA2A 2VJAA 3H75A 3JD1A 4EKIA 4MQEB 2E1PA 3GUCA 3BHNA 2XGCA 5FLXZ 3DYIA 4I1RA 4J0IA 3WHLA 4OK6A 1AE1A 2YVKA 2FMKA 3WJAA 4F5DA 3G89A 2G9QA 4HC4A 3VKHA 1X3SA 2C57A 4R98A 2NTYC 3V7CA 1GKUB 2DOKA 2O5RA 1P29A 3OX3A 4BMPB 5CDFE 4GVPA 4J76A 2AOXA 2ETVA 4UDYX 2H2HA 2XQJA 3EDPA 4IRHA 3GA7A 3EXIB 3IBCA 1H6AA 2X1EA 4C30A 4LMYA 2WFMA 5D5UB 2YXDA 2HXOA 5EF6A 5H70A 4WLEA 4RVOA 4C0QC 4RB0A 1W94A 3ESZA 3L0BA 4K9RA 3VSBA 2R87A 2VDOB 3ORRA 4ZO7A 3PUIA 2TECE 1VLVA 4BB5A 3WYGA 1TOAA 2KIMA 5F64A 4ZH4F 3HUGA 3TW0A 4UM5A 1EFAA 3QWIA 2IH5A 5K8LA 3ACCA 3HN7A 1TIBA 3O8LA 2Y77A 4XD7D 4BMOB 1JG2A 3I62A 4XR6A 1A4XA 2FN9A 1GNVA 2QF7A 5CYVA 2ACVA 2D62A 1O7LA 3BGOS 2PEYA 3GUUA 4WUTA 3CZ6A 4YLEA 2H1HA 3TF5A 5KNBH 2ZJAA 4II2A 1BN6A 2DY0A 3HS3A 1PFVA 3R0JA 1XTTA 1VPDA 2ADOA 1PSZA 2I80A 3CZPA 4KN8A 1F60A 4OATA 4OYHA 2N1BA 2XVYA 5LD2C 2VNSA 3GUDA 2PXXA 4GICA 2NVWA 4KJXA 4WK2B 2JFNA 2ZAGA 2Q49A 3M9LA 2VJDA 3H3FA 4N3BA 1RLTA 1SVOA 1GV2A 2VSFA 5BV1A 3BTIA 5IXJA 3MVPA 2X9QA 3ZNPA 3T4PA 2K02A 2E7ZA 2FBKA 1OCTC 1FRVA 2FETA 2Y68A 3GVPA 2O7QA 3GZJA 3EISA 1FBQA 1FXUA 1P5JA 1QONA 2H2GA 3FUXA 1T0JB 4Z0TA 1S3SA 2GJ4A 3KALA 4R40A 3OKPA 4U39A 4AWXA 4C05A 5JMOA 3L1KA 4RTQA 3EX7C 4EGQA 1L7VC 1DDIA 5DCWA 5CYGA 1UPXA 2GEUA 3GX4X 5P8WA 4IRIA 1P31A 3DMTA 3QKSB 4P7BA 4P3KA 3MZ0A 1EFKA 1UC8A 1ZD2P 1WXWA 1GGVA 1YBMA 2BBWA 4I4LA 3QEMA 5CXXA 4D3SA 5CFQA 3VH3A 3O4IA 2QX6A 2Y1EA 4QFCA 5J9FA 3LT0A 4V0SA 4UBJA 1R6RA 1HFJA 3SM9A 3T7JA 4YEJA 4HHEA 4DZZA 2IHNA 4X71A 4BLWA 4IJVA 5JARA 3VM6A 1RCUA 5LUBA 1YS1X 2G17A 4PJJA 3WHBA 2BP7A 2PKRA 3BGDA 4L08A 5DWQA 3H4VA 4KODA 3RK0A 4BJTA 2RGAA 5JW6A 3DBOB 4MS4A 2CNKA 4J0QA 4OQZA 3ZCQA 3FOWA 4H18A 3SQLA 5B1BH 3P19A 3ZDDA 5KX5B 2Q4OA 2M2EA 4MWZA 3LOCA 1E1NA 3D0RA 1E18A 5EZYF 4AS1A 1QF6A 3J7AY 1HFWA 4A9AA 4CETA 1R4MA 4UC0A 3ITNA 1L5WA 2C2BA 4C89A 4U6QA 1SEPA 3D7LA 4HCJA 4DIEA 2QD2A 1PFUA 2DA2A 2GAJA 2GN4A 2PU5A 3QA3E 4F2WA 3EFOB 4RWZA 4WCFC 1DJMA 3ETEA 1IBCA 3LYLA 3VR2A 1SWVA 1RXEA 1SOWA 3DJYA 4R9VA 2X2OA 4N0PA 1HDRA 5JBNA 4UD6A 3V1NA 4RC9A 3RSSA 5BMOA 3UPTA 4E5UA 3NJ4A 1UMCA 4CCYB 2IQIA 4GQBA 3H5AA 2F8LA 3ZX4A 3KKMA 5A0TA 3WISA 3VR1A 5LXTF 2PGIA 3GDWA 2CZGA 4WKPA 5H6QA 3T8TA 1P0IA 4FLMA 1VJ0A 2LR0A 2YDYA 1I3OA 3FMQA 3JYPA 3ZIUA 3GLGB 3ENWA 2MSYA 3Q3JB 5ESRA 5H8WA 3SHWA 1JFFA 4DG9A 2P6NA 3IAM1 1JTEA 4CHUA 4D1YA 3LA3A 2G63A 1XA3A 3FJOA 3MC1A 1TZMA 4WN9B 5B1HA 3RYIB 3GMTA 5MF6A 3MKZA 2BKUA 3V8LA 1Z82A 3KETA 4GXOA 1FMVA 1FVXA 2FZ4A 2F3SA 2PBFA 3HB0A 2Y31A 2ZCUA 3KUXA 5G1PA 3RNOA 2QTZA 5AOAA 1GPMA 1OFGA 5TF4A 4IZOA 4YUZA 5KSYA 3UNGC 2D7CA 1UCFA 4H35A 1RWVA 2SCUB 5LHHA 2DQKA 4G7OF 4HAMA 2C99A 1LKXA 2H52A 4DZJA 3LE8A 2IYFA 4N65A 1IU9A 2DKFA 4M22A 5H4HA 3DE7X 4MR9A 3W6OA 4EQQA 1ZK2A 3KKEA 2YS7A 4E88A 4EB8A 1Z0SA 3BDVA 1YWGO 4HLUA 4KW7A 4M88A 4A3LJ 4KOAA 2PSJA 4PC7A 5ALXA 1CULC 1V47A 3TCKA 4J0HA 1Q1AA 2JFQA 2C3PA 1MSEC 3ZHVA 1BCRA 5BR1A 3EUFA 1JJ7A 2Y66A 3BQMB 4AZ3A 4NJMA 3K8QA 3ER6A 5KTKA 3CPJB 3DZIA 5E6RB 4O29A 1R4MB 3TIVA 3UWSA 5KWIA 4BO0A 2ZVJA 3OR2C 4WZBB 5IABA 3KSRA 5C2JB 2ZK7A 2J9XB 5FPYA 5LA6A 1U8FO 2HEOA 2UYYA 4M49A 3ABLH 2E21A 2W82A 1ZH2A 5I5EA 5CXSA 3ZDBA 3FSGA 3BPXA 2DSNA 3IV9A 1ZRNA 2WJPA 4MVJE 1J23A 4RHUA 4W1PA 3ZGVA 4ZPXA 5TV2A 2JASA 2XCIA 3SC6A 1T8RA 5JZ9A 1H2XA 3CNEA 2XVCA 2BFDB 3DZJA 4MQ6A 5JECA 5MN6A 1JH9A 1I5RA 3ONWA 3OVMA 4UU8A 3IR6A 5H6RA 5L4NA 3CLRD 3MWMA 4IJWA 3M1YA 2PY6A 4QDUA 1J2EA 3NBYC 2AKYA 2O0KA 3PDCA 4J0FA 3L49A 5ILSA 4R83A 5EIBC 4E5VA 5IANA 3IUBA 1XDSA 2ODPA 1MQ8B 2NVOA 2VDQB 2ZR9A 2LRHA 4DTCA 4OCZA 2ZRAA 1EP1B 2W6ZA 4C03A 2GS9A 1S96A 3GZ4A 4LK0F 2VTKA 3A0UA 4G0YA 2IF2A 5CX1B 3DQPA 4E6PA 4ZOQI 1TW3A 5LQJA 3NUQA 4Q39A 3RLFA 2ZCJA 3KZOA 4JA2A 1EXVA 1G21A 1P19A 1TVKB 4BEVA 4BRSA 4NYJR 1F5TA 1FDWA 2X5OA 4X45A 1BIAA 3LHKA 4JXKA 5DYYA 2XVXA 1L3IA 2Q2OA 4JLDA 4MWOA 4Q4JA 4BATA 5C1BA 1JA9A 4RKEA 4ZC3A 1BRMA 2Z43A 1KKLA 3H9GA 2QY6A 3EAQA 4JNKA 3HGQA 2EJVA 2JK3A 4PUSA 1EVQA 1BRTA 1RPNA 2XJ9A 1OLSB 3Q9UA 2BFMA 4OU5A 4UJ5A 3ONNA 1YU6A 3QW2A 3SXJA 2VKVA 4JGGA 3OMLA 3HZJA 1C41A 4TS3A 3TI9A 4QTYA 5FUYA 1UBMS 2Y6UA 4BXFA 3E5RA 4TZ6A 4KQHA 1DDOA 3V1TC 3C5CA 4B84A 3K4BA 2R8ZA 1ESNA 2GPJA 3C8MA 4QTZA 3PSHA 5KVCA 5DNWA 2BGUA 2F7SA 2O8CB 1L4KA 2I34A 2B99A 2RDMA 2W43A 3L0IB 4JWKA 3WL8A 4XYLA 4CHTA 5JBQA 3NRBA 4AWXB 1CNEA 3CNNA 1IMOA 3QYFA 3ELUA 3CZQA 2HCJB 1IN8A 3RQ4A 4E6KG 1BWQA 2B8EA 4DPMA 4EYEA 5BSFA 2B61A 1Q2XA 5AK0A 5HF5A 3P94A 2KRCA 5TPZD 4Y1FA 1ZJYA 2PAAA 4II3A 3DBLA 4GT1A 3KBBA 3ROMA 5IAJA 3Q12A 3WFIA 3HSYA 1QPIA 5CBKA 4ZAWA 4JI1B 1VA4A 1C3LA 3AYZB 1FFAA 2V55B 3HN6A 3ZDEA 4F6LA 2R6R1 3GLLA 2XQIA 4D4GA 1SBQA 3H13A 3HTSB 3GV0A 3I01M 3VR5H 1UG0A 2B4QA 5EIXA 3C8ZA 3OZBA 4JC4A 4PG4A 2C42A 5F0CA 1CY8A 2FYTA 3JD3A 3ZCPA 5JC8A 3I04A 4O5OA 5CD1A 4YWJA 1XNRB 5IP6A 3CR8A 3A01B 1ANKA 2HZDA 4BYGA 1HLPA 1MX3A 2JCXA 2RH4A 3LNTA 3QU5A 2Y2VA 4B3IA 1I2MA 3QI7A 5TGZA 1H0HA 5K2OA 3TRIA 3A1YA 2FPXA 2BFCB 1EFLA 2MSNA 2C9BA 1R5ID 2CNNA 2IKQA 3GZTB 4XIIA 3SZGA 4ZCMA 3R6DA 2G1JA 2P67A 1IEWA 1ODTC 3U7IA 1U9IA 4R1UA 4PPNA 2G4LA 3PQJA 3RYCA 3CO5A 1PDOA 4HQMA 3EIXA 4O0MA 3KR1A 2ZIWB 2F4NA 4PLPA 4G5RA 3T5GA 3UMFA 3QMWA 1Z34A 1TQ2A 4MQ9F 3I3SR 2Q0OA 3IKMB 4BL5A 1LC0A 1QTRA 7MDHA 5C51B 1MD0A 3O2NA 2QA4I 4OQYA 3NO4A 3VH1A 4XRSG 4AIRA 5CA1B 4RGRA 3AFMA 2Y67A 2F5FA 4XK4A 3BGSA 3R0IA 3FHOA 5UKDA 1AA9A 2BFFB 2WVAA 5JXWA 5IC4A 1FY7A 5KDLA 3TFWA 1ODCA 1TYDE 1HDOA 4NYJQ 2GBIA 3GP3A 3NAQA 3C6ZA 4MR7B 4Y1RB 4MO9A 2OA0A 3VO8A 1SVLA 3L2RA 1J9EA 1N9GB 3CR3C 3N7TA 1IH8A 1PN3A 4L5CA 3ZWKA 3B1KA 3VPRA 2L42A 1Q1VA 2PMZA 3CIOA 2LVBA 3PJEA 1KRXA 3K1PA 3M6LA 3ML6A 3DTNA 4CKCA 1QA6A 2EXXA 5A4AA 4HG2A 3MKWB 1XMAA 2KDZA 4E7HA 1K3FA 2R1TA 2L01A 3KZVA 2JH3A 4I55A 3TSCA 3AFGA 2PMKA 3FAKA 5H5JA 5B7PA 2Z1NA 1J25A 4TMFA 4DYRA 3Q9LA 3PQ3A 1K8YB 3LVQE 3UCXA 3OUTA 2A5DA 1X2BA 4IRGA 3VEPA 2J45A 4XVQA 4EKDA 3BX1A 3IH5A 2A30A 1FYEA 2QRVB 4X6YA 1C4OA 4L7VA 4WCGA 5D5QA 2Z9DA 4L4ZA 5TPWB 3WGOA 1LPBB 1X7ZA 3B1WA 3GEIA 4FEAA 1ZOPA 1ZGZA 4IJMA 1GPH1 4EPXA 2WDZA 4MVJD 5IFLA 4TPKA 4JR2A 1EV7A 5D5WB 4EF6A 1SEUA 4H0NA 1P6RA 3M3DA 3SC3A 3INTA 4ZCQA 3WRWA 2Q2NA 4NXMB 2FVXA 3W3AA 4ND8B 2CSXA 3IQGX 4BKRA 4LRUA 2HFHA 3U44B 5EJEA 2YR2A 3WMXA 5TGDA 1N3IA 3R3UA 2OPTA 4DLXA 2ZWVA 4A69C 4RANA 2EBWA 2P2YA 4QO7A 4AJOA 4UQLA 3HBAA 4F1WA 2Q7DA 4MKIA 2OGSA 4LHXA 4D4MA 2HRCA 1ENPA 2L0XA 3M6XA 3NBFA 4RQAA 2WJJA 1E0KA 3BL5A 4FNAA 3RFFA 1Z2AA 1BWSA 1XGKA 2QW0X 4MVJM 4HNHA 1E63A 1HSTA 5L8VA 4DUGA 1ZBQA 3BYZA 1F1JA 1A31A 4TUYB 5THXA 4N4OB 4PN7A 1VHJA 3H18A 4B8WA 3ANYB 4MLZA 2HFKA 1WUYA 3JAWA 3K0FA 2W2LD 2Y0EA 3ABSB 3L0OA 3H87A 3RC3A 3ZGLA 3JVUA 1VL5A 2VQ6A 1YB5A 3M3HA 4KVGA 4O2AB 3U48A 5A4JA 2V0GA 4AN4A 3N07A 5CLHA 1RLMA 2HVRA 1C0LA 2AC2A 2M9MA 3DM5A 3GD7A 2W22A 1ADFA 1KYYA 4GF5A 5D7NA 4MJXA 2AG0A 3O47A 4AULA 3I54A 1M2HA 2CEKA 1KY2A 2P2GA 2WYVA 4LFUA 4Y2TA 4DJDC 5C4JJ 2COUA 3HRTA 3GLTA 4QPNA 3WLIA 2GF9A 3DMRA 3RDPA 3V6MA 1FJHA 1LJUA 2ZYUX 4Z9XA 4MVCA 4BMCA 2OYSA 4PYOA 4YRTA 3G7UA 1E3HA 2CO5A 2PGLA 5FKOA 2I2BA 2XVZA 2A33A 2CC2A 2YV2A 3GJ0A 5AR1A 3HE3A 5REQA 2RE8A 2ZPAA 1V54H 2JGLA 3AB7A 1IHOA 3GW2A 1IZZA 4EQ6A 2L3DA 3IHLA 4HVAA 2VT2A 1Y3BE 5IKOA 3W7BA 3S3OA 2HI0A 4JJKA 5FO0A 4RAYA 1YTLA 3IBFA 4RO0A 5COAA 3GRKA 1RAEA 2XDWA 3EIEA 4Z9BA 1PZEA 4WKBA 4XOPA 1AHHA 1AY0A 3AI3A 2ZJRF 3GHHA 3MXTA 4RHEA 4WK0B 4XM1A 2P5SA 4TGLA 1Q16A 5HG0A 2PZFA 4AZSA 1PD0A 3ZE0B 5AW4A 3ETDA 5TMPA 1GV5A 1UOOA 4B4OA 3DEEA 1DAKA 1BWPA 1JHDA 2AI2A 2KRFA 3BCRA 5HDQA 2OMKA 1YKFA 3AUTA 2M87A 4G97A 5JPIA 3O8QB 4J94A 4TYMA 3G0HA 1J0DA 1F17A 3D3WA 4KRXA 4P9FA 1RLIA 2L02A 2R96A 2RONA 1WMEA 2AOTA 2PSDA 4GL2A 4OKNA 5THQA 2ZTSA 2FWIA 2VK2A 4FMDF 3WIBA 3IEMA 2D74A 2HMVA 1TZLA 3SHQA 3C6QA 3D54D 3EUEA 1NGSA 3EGOA 4N0QA 3R8CA 3D6HA 1MX5A 1X8LA 2V7XA 4Y67A 1AHDP 4G24A 1RTTA 5IVDA 721PA 1AKHB 1HRDA 3EGWA 2V8BA 2VK4A 3M2TA 3R4CA 4I9UA 2OCBA 4GCVA 2O07A 1SKUA 1BW5A 3H8SA 3EY9A 1XD2B 2IJGX 2QB5A 5EXXA 1HT2E 3CCLI 5M04A 4C3ZA 1OYWA 1KTIA 3Q5EA 1VQNI 1F5NA 4C2AA 4L8FA 3R7SA 1P7WA 2O7RA 4HRYA 4U0JA 3W7AA 1O4WA 2WP8J 4V39A 1FMTA 5C5CA 4Z0NA 1RMTA 3L1HA 4AU1A 3QSGA 1VB5A 3O4FA 4YT8A 1CDEA 1GD1O 4FNGA 1I0LA 2C7PA 4H1WA 5HF6A 5JS8A 1RC0A 3Q0EA 3ZXUB 3Q8MA 4A8JC 2BF7A 3QZUA 4HRXA 3L2VA 4YP6A 4HA8A 2GXBA 2ESRA 4DSZA 4YRGA 3HYSA 3E3LA 5M5YJ 4YCDA 2F5DA 3PUBA 1RQLA 5T64A 2VP0A 3BBPA 3HV2A 4ZAVA 1G9TA 1HE2A 3OQIA 1UHSA 5K8IA 2QP3A 4BB6A 1Z28A 4IHJF 3EPHA 1PQUA 2XAAA 2NVBA 5EKSA 1AMNA 2CLKB 4I2OA 2C4NA 2GJ9A 3HJRA 3B8EA 4CQMB 3NUGA 2R8RA 4UNNA 5E3HA 3DV0B 5B58C 3CF4G 1YU9A 3Q15C 1WO8A 2M34A 4IWYA 1OH5A 3P5BA 1N5JA 5BV8A 2LGJA 5F3RA 2OKGA 1PZMA 3TTSA 1M66A 1JGTA 1ICEA 5JHGB 2WMOB 2CE7A 4CU5A 4ECAA 1DIGA 4NMWA 4P4NA 1G8PA 2JA7J 1E3JA 1NZJA 4FE4A 2H4ZA 2OCKA 3WTYC 2VHUA 3CJTA 4G5SA 4PBTA 3TRFA 5HF8A 2Z5FA 4N47A 3PV0A 2WOJA 1R5GA 5SZKB 2JG3A 1LU9A 2NV0A 1JMVA 3B3AA 4RV4A 3AVTA 4YASA 1PNVA 4LYEA 1DU6A 4BNGA 2Q3CA 3RHSA 1FEXA 2EG5A 1IK4A 2IIBA 3P9YA 4LCBA 1Y4SA 4PZDA 2HS5A 4XWYA 2DAOA 3FTFA 2OUIA 5HUQA 4DSTA 2XAHA 3L82B 4A3JJ 4GYGA 1Z4OA 2X7XA 1TPZA 2BEUB 2AFHB 4KQIA 4AJLA 4ZMRA 4A15A 3A7EA 4JVMA 3CVXA 4A0XA 4RORA 4JGBA 5HIMA 1IM8A 1ST2A 1YDWA 2JBHA 1E32A 2IPQX 4QX6A 3FOFC 1XZ8A 1YE5A 3V4OA 3M4YA 1Y33E 1JYEA 3M6MD 1IQ0A 2BHNA 3DWLE 4GPZA 3TLGB 5EUCA 3V1LA 5FOQA 5FLXA 3RIRA 2XDYA 3OUZA 2OCAA 1K7CA 2CXSA 4HXFB 4FHTA 3NEJA 3OJ0A 3O9VA 4MWDA 5AKYA 1II8A 4FX5A 1HSJA 4RPKA 1SEVA 3DCNA 2BEVA 1FBUA 3C8HA 4GZMA 4RKQA 4Q4ZF 2XB9A 3QVJA 5LDGA 2FWJA 4L3VA 121PA 3JQGA 4ROSA 3RTDA 2GUGA 1ZCJA 3W04A 3TR6A 4OHBA 3WU2C 1CQIA 4D9EA 3HYNA 1Z7LA 2DA3A 1PYDA 3AVVA 3NOVA 3ICCA 4BUPA 2EEPA 3BJEA 3FYTA 4PFOA 5DCYA 1DC7A 3JAKB 4O4LA 4PYIA 1MV8A 4WOBA 1KIFA 4LVCA 3MTGA 1XEWY 2PAFA 1KY4A 3DVAA 1L4YA 1RYNA 4G7ZF 2VXYA 3HWRA 4C2BA 5HWSA 1W9HA 1KDTA 1RPAA 4X63A 1YBHA 1NW8A 3GLVA 4OXNA 1GLNA 5IDVA 1H9AA 2MC3A 4YMUA 2YUSA 5DTIA 3V3KA 5TRDA 3G6KA 1U11A 4BO7A 2BC9A 2PUGA 1RU3A 1MQSA 3AP2A 3H16A 3R0QA 1IZYA 5GJCA 1E0DA 2ZSFA 1NXTA 2ODQA 3PGA1 2Y8EA 5IJZA 1I3MA 1ABFA 1FYDA 1B00A 3H2YA 1FYWA 2EF1A 3JYHA 1SPXA 3PSIA 4I9GA 1F4KA 2CUZA 2XGGA 1JTXA 2C8KA 2R84A 2XMRA 3E15A 3KOMA 4KVFA 4U2KA 4LF8B 3A6KA 4BZZA 1WZ2A 3LLVA 3ZZ0A 3P20A 5KHDA 1QB8A 1BN5A 1HMPA 3C3MA 5BYJA 3QFFA 4R1SA 1QRTA 3GFBA 1I7NA 2WK1A 3QYAA 4F6CA 2JJ8A 2WWTA 4UU7A 3GNQA 2ZBGA 1ZRHA 1DPRA 4MEBA 1IMJA 2J9GA 2WE7A 3L02A 3UV7A 4S1NA 2E6KA 4HLXA 3P8ZA 4CICA 1YR7A 1QDUA 2OBXA 2K4BA 3HZRA 4JLOA 4JKIA 4Q16A 1ZTRA 1DLIA 3M8KA 2QWXA 1ML4A 3GO4A 1AHPA 3EVNA 1XSEA 1ACMA 4RSRA 2D4HA 4HSEA 2J9YB 4RLFA 2C2HA 3HXLA 1PNOA 2ZAMA 3IJPA 4L4YA 3EUHC 4G4GA 2Z2JA 4FMCF 4WOKA 3GN1A 3HJGA 4UZFA 1BFDA 3LCJA 3OUUA 2YS9A 5FQOA 3RUEA 1M2GA 1XF1A 4LJAA 4X00A 1JTVA 4R1LA 2NVTJ 2JW5A 2FKNA 3DYVA 3P2IA 2L5QA 2ZBPA 2JA8J 2CVQA 2W8BA 4HNQA 4YFXF 4JY7A 4PZLA 5AJTA 1RJDA 1Z6QA 5ALLA 5ARCA 1ZHFA 1TL7C 2QP4A 3VOSA 3VAZA 4CMKA 5IPAA 5JDIC 2CMKA 2HSGA 4UNOA 4YMWA 4MW4A 5HZMA 5F2KA 4RCYA 5F5XA 2EZTA 1KH1A 3JWEA 3SIRA 3OD5A 5HMMA 4H7PA 2HA2A 4YB8A 2OA4A 4KDCA 2PSEA 4HDQB 5GPCA 3THOA 5E3OA 4FT8A 2OSVA 3GLHA 4D79A 2AOVA 3FHTA 2LD5A 3SD7A 3KZYA 4WCDA 4BGEA 4TXJA 3GF2A 4MUNA 2AFIB 2ERCA 1NRWA 3HRKA 3D8TA 2AWOA 3Q87B 1HUQA 4N8SA 1MBFA 4RK0A 5AI9A 4XIGS 3UMGA 2NZ8A 1FSEA 1U2GC 2NRAC 2XUPA 2X1DA 3A0RB 3I72A 4GOOD 1J6UA 2A9PA 3P2KA 2P4SA 4FFNA 2OC6A 1WCIA 3EZYA 4L07A 4OEHA 4KIJA 4F86A 1NVBA 1ULZA 3LL7A 3I4NJ 4V3CA 5JEEA 4E46A 1RMQA 3HSSA 4H4DA 4ZV4A 3HN2A 4AM3A 3JVIA 4KVZA 3S1QJ 2F3UA 3GX1A 1SXGA 3FYDA 3KUUA 1NW7A 1SXJE 2KYRA 2R8EA 3KU1A 4FFMA 4FMCB 3ZV6A 3L0DA 3P9KA 2XYQA 3G8DA 1LLFA 2RK3A 3JV7A 3NGMA 4XJSA 5AO9A 2C2WA 1SD5A 1T56A 2CG4A 3KYLA 3I1IA 4WZBE 3HGYA 3QWLA 2C8VA 4J3JA 4ZP1A 3TVYA 2CV0A 3OT1A 4JR1A 4K6GA 4CCWA 2E1NA 5IDWA 4XYGA 4JX6A 1RJEA 5GPAA 3MWEA 4DCPA 1XTRA 2I3BA 5BT9A 3S28A 1TMYA 2E34A 2YHIA 4M0KA 3TVDA 1C2TA 3H5VA 4BVLA 1UOQA 1A97A 1N25A 2EKPA 2QV7A 2WM8A 3UR3C 3OMXA 5TJHA 1JXQA 4ILKA 4M72A 2EJTA 3M6WA 4E32A 3LF2A 2FPGA 2JI8A 3O8HA 3P7NA 1P0FA 1XZEA 4QA9A 2QTRA 3EGXB 1NYQA 1QBGA 4B9AA 1ZISA 3IBYA 4R1QA 2GD6A 5CX4A 3WWCA 3C6KA 5AW3A 1P72A 1VSUA 1PUFB 2HK6A 4XORA 2LKDA 4P7FA 5I7HA 1BI2A 2PWPA 5LXTA 3N0RA 3LD9A 5JLWA 4RQBA 5MHTA 4MNUA 4NICA 2AXLA 1L4NA 2WTMA 4P80A 4ZT7A 2BOVA 4WNAA 4HBLA 4B3MB 3O74A 1IAQA 3E9DA 2ZRPA 4X0GA 3LPNA 4R54A 1DKMA 3EZ7A 4NQWB 2WY2D 2FX5A 5DTRA 4LZJA 5AONA 1XOIA 3FNGA 1WQ3A 2BW3A 4J2TA 1NR1A 2X6TA 3PI7A 4W6ZA 5ELLA 4WXYB 5TEWA 5F1JA 1LVAA 2AS5F 4JT9A 4HB3A 5EMMA 3PYLA 2Y9YA 2EKZA 2X7HA 4A2QA 5FTNA 5JZMA 3GU3A 5L3BA 5J3LA 4AN1A 1H2FA 1H2RS 4AUKA 3LIPA 4RYDA 1JUPA 4NS4A 2AG1A 4F46A 2PZAA 4F5YA 1X1DA 3KP1A 4HMPA 4KXMA 2KIUA 3DZFA 1YE9A 1GNSA 2CS3A 1N1DA 2ZUBA 4WH0A 1T3LA 1A1SA 1IUPA 1TZBA 4RTMA 1B72A 3PICA 4IAOA 1A9YA 4CEJA 3V8VA 3JW8A 3PRHA 4AS3A 3COZA 1GUZA 1ZJWA 2XE6A 3AM1A 3UK6A 3VR3A 1E92A 2P6PA 5CLIA 5I7AA 3GW8A 4KRGA 2ZJ6A 1LPOA 1XQVA 4BLPA 1BHJA 4C78A 4GHWA 1N2ZA 2V7EA 3TTUA 4ARCA 4HSTA 3I4PA 3QOPA 3CSDA 4FMPA 3UAZA 5CPRB 1DEOA 4Z0HO 4IGKA 5KO2A 1ZONA 1OA1A 2CLFB 3JWGA 3S1MJ 1G98A 3KPVA 4HDNB 5E6UA 2ADFA 2IXSA 2LWIA 1GQFA 3G17A 1VE3A 4IVRA 3ULQB 4JJ4A 4KE9A 4JQZA 3N97A 4LKOA 4NSNA 4RGUA 3FB1A 5DB4A 1P0CA 3INNA 1Z0FA 4F9FA 5EJFA 1Z75A 5J58A 4N5HX 1LFBA 5KPDA 3AVYA 3G2HA 1GZ7A 4ND2A 4RTKA 2YS6A 3WU1B 4M98A 4LWPA 4MNTA 2DT7B 4CM5A 1MJGA 1Q1ZA 1GZ5A 2AFHE 2GBLC 1UDRA 3J81K 2O3SA 3KQYA 4QUAA 2ZYRA 4BEBA 5IDQA 3RVDA 2VT6A 1GSIA 2MR6A 5AJYA 3CDHA 3IO3A 2RHWA 2HUNA 3DAFA 1OBCA 3NGXA 4ZKEA 3GT7A 4PFSA 1L5HB 1M6HA 3RZDJ 3KCNA 3WR5A 3MG9A 5K9ZA 4GKJB 1KU7A 4KMOA 1X7XB 1IJWC 2BI7A 4MPTA 5LSAA 3OLXA 4UMEA 1BMTA 5L7WA 1U6GA 3B6CA 2DJ5A 1P9NA 4IS3A 3W9UA 2JC3A 3A2KA 3OYGA 1JDUA 1NONA 2C4KA 4MKHA 5EXTA 3BJ6A 2UZ1A 4CMIA 5CFZA 2I2CA 4YP5A 4IHJB 4XIDA 3UJ6A 3CRNA 3ZQLA 2VSYA 3U3MA 5L7TA 4I2NA 1M6EX 4K86A 4E2ZA 1XMJA 3QE4A 3MHTA 1WH7A 2HJGA 1AU7A 1FSFA 2JJ1A 1CUUA 3BXOA 3H1PA 1CEQA 4BAUA 2APJA 2FWNA 2DQSA 1LJLA 4EUHA 4G84A 3ZLUA 4LHWA 5E3LA 2BR5A 5JALA 4GBGA 4PJNA 4BNVA 3D5EA 1ORTA 5IT9K 3L4SO 2YNMC 5HIJA 3L07A 2HD4A 1VGVA 4BUCA 2LG4A 2ZMEB 4H3HB 1ZH6A 3U61B 2E89A 3MQ4A 1BW9B 1RI3A 3ZDCA 1XL0A 3ABUA 1LPSA 2QTGA 1TLTA 4OQMA 3BR5A 4Q3BA 1LDEA 3TB4A 2VBIA 4R2WA 2SICE 4JI5B 4ESFA 3AM3A 1T1JA 2CFSA 3NRVA 3PPVA 1Q22A 5C32A 2KLHA 4B85A 1X8JA 4BAYA 2YY7A 4RUKA 3UAOA 2GZDA 4RA9B 4RBNA 4JL5A 5D3MB 1UKZA 1A8UA 4RGSA 1O2DA 2OBPA 2RGWA 3QVGB 1PYOA 1S29A 1R66A 1VSQA 1VPVA 1WQ2A 3ONEA 3KX2A 4HMQA 4IMIB 4PCVA 3BQZA 1EH6A 3AG3H 1FX0B 4F92B 2DVMA 2JEZA 1PUJA 3A05A 5EXDA 2E1RA 3WLQA 2ZFUA 1GM5A 3KLNA 4DY4A 5AM2A 3LVRE 3MGGA 4JBGA 3CZRA 2X5NA 5ALTA 1QZZA 1L7AA 4N4NB 4A26A 4DA8A 4ZHQF 1D3YA 3PEVA 2RB5A 1G5QA 3S2HJ 2WTAA 3GPCA 3OOHA 2YW9A 1DHTA 5EWJA 2DI3A 1J8FA 3OLQA 2VYQA 5LA6F 4E11A 5G2OA 1FSSA 4BBJA 4KTVE 2HKOA 1FL9A 3G5AA 1YRYE 5JMWA 1P6UA 2FN4A 2ZIAA 4MW2A 3QEJA 4R51A 2WZCA 1L3CA 1F2UA 2RHCA 1GZ3A 2WADA 2ZREA 1ZD8A 1QF9A 3N8DA 1YJQA 4H4EA 3TOVA 5CAEB 2G7MC 2NXJA 1EX1A 2ZXWH 1W48A 4ARIA 1VHWA 3ZVRA 4IDEA 2YXNA 3JATA 4ZTZB 2C61A 3K6SA 3KOXA 3BCAA 3PQ8A 4FJ0A 4FUQA 4MK4A 5J1YA 1CQZA 4BRZA 5TISC 3PP8A 2C7GA 3OQJA 3OKFA 3QXGA 5KYWA 3O0TA 3BR3A 1UANA 3PRKE 4IOMA 4MVJI 1XE3A 2G80A 3AYXB 1JQ5A 2LIVA 3OQVA 4NFLA 4YECA 2ZMEC 1PHPA 2YIDA 4RMIA 1I7QB 3IDSA 4WECA 3TEDA 1VG1A 1A8QA 2QHXA 2QZJA 2Q3LA 4U3JB 3NHKA 5EUBA 3W6PA 2XEXA 3OZFA 1DTSA 4M74A 1GR1A 2A9RA 3LWDA 4M3NA 4RGBA 1SC6A 5DP2A 4S12A 4AO7A 1QO9A 2CXTA 3THYB 5A6SA 2OF7A 1AK9A 4UVEA 2G08A 5KOHB 4E2YA 5F7OA 5LKRA 3HOWJ 3LFKA 1E1LA 1UBGA 1K6JA 2IEBA 2O5CA 3WYDA 1NLMA 2IZ6A 1XJCA 3LUPA 1NHWA 1P18A 2PUFA 4L22A 2LDXA 1QO7A 2XB0X 1U8UA 3OM0A 3TAHA 5A03A 3ROPA 4PIPA 4UVBA 1PZNA 1T26A 1VBFA 3H1EA 3WLHA 1JAIA 4ZJPA 3DEKA 5K3BA 2DO7A 5GAGJ 2ZRGA 3HBLA 3KDSE 2NP6A 4MLPA 1J24A 3QEKA 4WCFB 4WA7A 3I23A 3S2ZA 3PK0A 3UFXB 1MNAA 3MRXA 3ORYA 5DF1A 4BNMA 3GLQA 4XASA 3CT4A 4BEHB 3JQEA 1Y6GA 2E5ZA 1SELA 1YX3A 4TVBA 4X7BA 5EIFA 3HABA 1GL3A 1S8OA 4A0YA 5J4KA 3VI3B 2EFPA 3ZQHA 1WULS 2FQXA 3A2LA 2QV0A 2ZT6A 1QC5A 1I3QJ 1QNTA 2NXNB 1D2MA 2VJQA 1KR5A 4UBMA 5IT9A 2AR0A 4FTWA 1X13A 2XTJA 2ZJ7A 4KU4A 3F8BA 2J6IA 2V7VA 4DV5B 4QVKA 2I67A 5CG2A 4AKHA 3L6UA 4QAJA 1XB4A 2E37A 3ZWMA 2O8BB 5H2FC 5H3HA 4LB6B 4A3IJ 1RWPA 3QLUC 1QVUA 1JBEA 1KEZA 3V7UA 2A0WA 3S40A 4BNTA 1T13A 4RH3A 3V97A 5KYYB 1QHEA 3AR2A 2C0QA 1E2EA 2EFDB 1NR5A 2OUKA 2VUHB 5A4DA 2QR3A 1NTOA 1XMKA 1MSFC 2Q5IA 1RHMA 3DG9A 3B52X 4MB2A 4HWKA 3JZDA 4DAEA 4YAKA 4B71A 3PIIA 2F55A 1CF7B 3KEQA 3MQ0A 2OTLI 2VJIA 2D5VA 1CHDA 2I03A 2ATVA 2VZ0A 1TT0A 2PFSA