2R0QC

Crystal structure of a serine recombinase- dna regulatory complex
Total Genus 67
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
67
sequence length
200
structure length
193
Chain Sequence
b'MIIGYARVSSLDQNLERQLENLKTFGAEKIFTEKNRPILQKALNFVRMGDRFIVESIDRLGRNYNEVIHTVNYLKDKEVQLMITSLPMMNEVIGNPLLDKFMKDLIIQILAMVSEQERNESKRRQAQGIQVAKEKGVYKGRPLLYSPNAKDPQKRVIYHRVVEMLEEGQAISKIAKEVNITRQTVYRIKHDNG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 31-MER
publication title Architecture of a serine recombinase-DNA regulatory complex.
pubmed doi rcsb
source organism Staphylococcus aureus
molecule tags Recombination/dna
total genus 67
structure length 193
sequence length 200
chains with identical sequence D, E, F
ec nomenclature
pdb deposition date 2007-08-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00239 Resolvase Resolvase, N terminal domain
C PF02796 HTH_7 Helix-turn-helix domain of resolvase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.60 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Homeodomain-like 2r0qC02
3.40.50.1390 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 2r0qC01
3OSGA 5JLXA 1IG7A 5J1RA 2E1OA 2E2JJ 3S1RJ 3BTIA 1OCTC 1HOMA 4A3BJ 9ANTA 4BXXJ 5K7ZA 2DA1A 3UKGA 2HOAA 1UHSA 5M3MJ 4X1EA 1H88C 1GT0C 2DA2A 5F27A 2ID3A 2WB1N 1RR7A 3HKZN 1X2MA 2DMUA 1ETVA 1RETA 1B72B 1I50J 1FIAA 1APLC 1XS9A 2R92J 2FJ1A 1MBGA 3K7AJ 4FCYA 5GP9A 1YRNB 2N8GA 2LY9A 3BG3A 2JK3A 5K7FA 1MBHA 2EZHA 2YU9J 3ILXA 1TC3C 1BW5A 3HM5A 3ZQIA 1OFCX 1FTZA 2ZB9A 5FKOA 4X6AJ 1JJ8C 4A3KJ 2X6OA 2LFBA 1W0UA 2COBA 3BR3A 2JA7J 3BTCA 1AU7A 2LP0A 3O8HA 1VNDA 2MGQA 2HOSA 3LOCA 1ZR2A 3A01B 1ORKA 5C34B 3PM1A 2ECCA 4W97A 2DN0A 1NK3P 4M3EA 3ZQFA 2FD5A 1JKQC 1WCMJ 3Q0UA 3HBLA 5C31A 2EQRA 3K2AA 1ETQA 2XPWA 4BQQA 1S7EA 2XPUA 2HXOA 1W0TA 3GTLJ 1Z77A 1QPIA 4GFBA 4LOCA 2CU7A 4I6ZA 2M2EA 1WH7A 4BKXA 3VPRA 1A6IA 4AC0A 4QTRA 2RAEA 1LE8B 2EZLA 5FKMA 2PMZN 5FKNA 2IBDA 2DMNA 3JRIA 3SDGA 2Y30A 4DW6A 2OF7A 4MLOA 3IV5A 3W6VA 4L5EA 2NVXJ 3GTPJ 1FTTA 3LSPA 2M8GX 3BG5A 3JR9A 4IHVA 3Q0VA 5C4XJ 2HYJA 4FE7A 2AO9A 3HDDA 2NS8A 1VI0A 3E7LA 1RPWA 5IYCJ 3LHKA 1IC8A 1GV5A 3BVPA 5F0FA 1AKHB 1O4XA 1BA5A 1BW6A 2CJJA 1K61A 4UUSB 1IV6A 4V2FA 1IDYA 1R9TJ 1CQTA 2L0KA 2Y31A 4JX4A 2ME0A 1DU0A 3PO2J 2XGDA 1JKRC 2H1KA 3IH3A 3F0CA 5EG0B 2M0CA 4XRSA 4V2GA 1HDPA 3PKZA 3LSGA 5EGOB 1PUFB 2X9DA 3MN2A 4IEJA 2R5ZA 2E19A 2DJNA 5M5XJ 5C4JJ 3LSJA 1VFCA 1GHTA 1JTXA 3MVPA 3WHBA 2K9NA 1QVTA 1G2HA 1ITYA 3BR6A 4A69C 5F0HA 2XB5A 4D5FA 2QCOA 3S17J 4CYCB 2Y2ZA 1UMQA 4D5CA 1ZTRA 4A3LJ 1HCRA 1WGXA 2K9QA 2EH3A 4MFDA 3ZQHA 1ZGWA 4J19A 2XPVA 2GLOA 2NS7A 4Y52J 2DMTA 4MFEA 2X48A 4FTHA 2P81A 3G1OA 5C44J 1TWAJ 2HQ5A 1HLVA 4M3FA 1H89C 1XG1A 1NTCA 2NVYJ 2DA3A 1ZKGA 5EF6A 4G12A 4C2MJ 2IAIA 4QSHA 3HGYA 5EGOA 5F1JA 1PUFA 2CQQA 2R5YA 5E3NA 3BQZA 2GM4A 2Y9YA 1ETXA 2KT0A 3B6CA 4MIMA 1MBKA 1MH3A 5E3OA 1DU6A 2TCTA 5F0CA 2O8KA 3S1NJ 3DEWA 3S14J 5DTDA 4NDLA 1K83J 4A3CJ 2LVSA 3HOZJ 2TRTA 1XC5A 5FKKA 2DMPA 4IHYA 1MSEC 2VPRA 2EZIA 5IPAA 3FK7A 3BTLA 1JUMA 1FEXA 4QIWN 3D1NI 1B72A 3ZQGA 5GPCA 1H8AC 3LHFA 2JJ7A 3GTKJ 1JT0A 4IHWA 3TP3A 5BNGA 2O9LA 4A3EJ 2WAQN 5IP6A 1YRNA 3BR2A 3JRFA 3SJMA 1IDZA 2LLKA 2L9RA 1MBJA 3G1LA 1TWHJ 4XICA 5FLVA 3CDLA 1ETOA 1JKPC 1WPKA 1HDDC 1B8IB 3Q3SA 3G13A 5JLWA 4B3AA 3G1MA 3H3VK 3I4NJ 1FJLA 2MW8A 3A01A 2VUMJ 3PO3J 1E3OC 3GTMJ 5FLMJ 3ZQLA 3M3YJ 2HOTA 3S15J 5GPAA 2DA6A 5K7HA 4XRMA 1Z0XA 4M6VA 1MBFA 2CUFA 3B6AA 4JX6A 4I76A 2JA6J 1RESA 3HOVJ 3TEDA 1ZK8A 1ZR4A 4A93J 2K9SA 3BG9A 1MSFC 1BJZA 4A3FJ 4A3IJ 2W48A 2E2IJ 3CQZJ 5EZGA 3RQIA 3JRGA 4DYCA 3GTGJ 2LKXA 1LE8A 1EF4A 1WI3A 2ID6A 1U8BA 5FKLA 2JMWA 2CQXA 2L7FP 3JRHA 5M3FJ 3S2DJ 2RSLA 2R93J 1BL0A 4FISA 4JYKA 4A3MJ 3JRAA 1F36A 2KDZA 2M9HA 2D5VA 1X58A 3HOXJ 4B1RA 1Y1WJ 2Y9ZA 3FISA 4IHXA 2M34A 1T56A 1Y1VJ 1ENHA 3FK6A 4S0HB 1IGNA 3C2BA 3GTJJ 5J3LA 1AKHA 3HEFA 2JA8J 3A03A 1JUSA 3CMYA 1JJ6C 4UUSA 1GDTA 3UJ3X 3BR5A 2E2HJ 3H0GJ 5J1YA 3BT9A 4C3IJ 1SANA 2XGCA 2H8RA 2O7OA 3ZQCA 1GV2A 1NK2P 1OCPA 4M3DA 4ABZA 5EG0A 2MHCA 1QVUA 4XRSG 1I6HJ 1TWCJ 3JRBA 2L7ZA 3BR1A 3O8GA 3LNQA 2R7ZJ 3GBGA 5EYRA 4BY1J 3HOYJ 3FIWA 3QPSA 2LTPA 2ECBA 5C3EJ 2ELKA 1RKTA 2DA7A 2VKVA 3OSFA 1QRYA 3IH2A 3S1QJ 5EZHA 3HB9A 5FJ8J 1GUUA 4XK4A 4C3HJ 4JX5A 2QF7A 5IOZA 3QPLA 5EEAA 1ZQ3P 2HDDA 3RZOJ 4AYBN 3S16J 4CYCA 4RDUA 1GVDA 4DZPA 1JKOC 3L1PA 3HOWJ 1RKWA 4M3BA 5M5WJ 5E3MA 3ZOBA 2FQ4A 3HGGA 3JRDA 1IJWC 2NVTJ 2I10A 1VF9A 2VKEA 4M3GA 4Y7NJ 2GBYA 1WH5A 2MSYA 4C3JJ 1A5JA 4JP0A 5E3LA 3CCYA 3NARA 3OOUA 5J1UA 2HI3A 1JGGA 1POGA 1SFOJ 2Y0SN 1P7IA 2EZKA 2DMQA 2L7MP 3QQAA 4BBSJ 3BQYA 3Q0WA 2AHQA 1U9NA 1P7JA 1T33A 2IEKA 2YUSA 1ETWA 1FIPA 5F04A 5IP7J 2XSDC 1IUFA 2JWTA 1ETYA 1MNMC 3HOUJ 4A3GJ 2R5ZB 3GUVA 2JN6A 2ME6A 5C35A 2B63J 1LFBA 1JUPA 2GM5A 1JTYA 1F43A 1MH4A 2R0QC 4W1UA 3GTQJ 3RKQA 4EEFG 2FX0A 4D7NA 4MO7A 4FE4A 2LK2A 3NAUA 3TP0A 3BTJA 1D5YA 5C32A 3WHCA 2YS9A 4DYQA 5IP9J 1IRZA 5DS9A 2NVQJ 1Q1VA 4B4CA 3TW7A 5M5YJ 5IOYA 2DTZA 2VI6A 3SFIA 2XRLA 1TWGJ 1MBEA 1X2NA 3RZDJ 3MKLA 3JREA 2JA5J 4BY7J 2WV1A 3S2HJ 2XB0X 3OIOA 3S1MJ 2K40A 2DA4A 3DCFA 1HX7A 3FKIJ 2EBIA 2NOGA 3A02A 1UG2A 3IH4A 1OJLA 5IYBJ 1ETKA 2MG4A 4BBRJ 2CRGA 1LFUP 3JRCA 5IYDJ 4UUTA 4RBOA 4DZJA 3LSRA 4XIDA 1U9OA 1AHDP 3M4OJ 1U78A 1B8IA 2DA5A 1I3QJ 4D7MA 4A3JJ 4AUXA 2CUEA 3I4MJ 1TWFJ 2R5YB 3TW6A 2OPTA 4A3DJ 1HF0A 2XGEA 5F08A 4DYRA 1JT6A 5HODA 2LD5A 3GTOJ 2HXIA 4HNVA 5EDNA 2G0EA 3BR0A 2LR8A
chains in the Genus database with same CATH superfamily
1CRPA 2LW7A 2C0PA 5K3CA 4G8CA 5CMLA 4LNAA 2PI0A 3I6QA 3UH1A 5ILVA 4L8FA 1P5FA 3I61A 4EKEA 2Y1EA 1VFPA 1UWCA 3U9GA 4G4JA 3N8KA 3HKEB 1IVSA 3FHOA 1I2ZA 5AQ1A 1YITI 3DOHA 4L2IB 1XRJA 5D8KB 2SBTA 5EWJB 1BFDA 3MCTA 1G9TA 2D0PB 3DTNA 1H0SA 1S2LA 1FIUA 3LCMA 4H6WA 2X1LA 1QNFA 1DO8A 2HXGA 2B35A 4YIKA 1XU4A 4ZVPA 6REQA 3PJRA 4ENUA 1I1NA 4BLPA 1SHKA 3WADA 1DDNA 2WY7Q 3LUGA 2X6RA 4J29A 4CODB 5D85A 4I6ZA 2DWCA 3GEIA 2BGTA 3UFXB 3IBCA 3UG6A 5KYXB 3KD3A 4H15A 2JGLA 5FIUA 4G1EB 4LF7B 5K2MA 5BN4B 4MW4A 1AMOA 3NM4A 2OM6A 3LPNA 1T8UA 3EEBA 5MGNA 3B6IA 3RSOA 3BWCA 2XZTA 4BUZA 2A0YA 5LZ5A 5IYCJ 2OXCA 4URYR 4B4UA 3U7QB 1NOKA 2AEFA 4P7FA 5FPHA 3PHJA 4MW7A 3UKOA 4KT5C 3UQZA 3DJYA 4MVJP 4AZTA 2XGDA 3RTCA 3LOPA 3TBHA 3M07A 3EFHA 1C0LA 3FW1A 4I99C 1U9YA 2OAZA 1T8SA 3HOSA 3TOSA 2VUUA 1H4SA 1VZ0A 1B93A 4YP5A 2JW5A 1NNEA 4LOHA 2PU7A 1V1MA 5CLFA 4LBYA 3J80A 3FNHA 3CE9A 2J3LA 4TMYA 4TSKA 5K1YA 1I7QB 2QT9A 1QKJA 3RYIB 6AT1A 3R3HA 3GJXC 4ARZA 4OHBA 1JDZA 4F84A 1RP7A 4QAQA 4GE3A 3LKZA 1LSSA 1Z7LA 2CQQA 2QLTA 5BMOA 3AUTA 3GK3A 1BWQA 3S29A 4E7JA 4JNKA 4C20A 3ZGVA 2FW9A 4UAGA 3HYNA 4JT8A 4B17A 2STTA 1R64A 3PPVA 4DG9A 1V3FA 2XWSA 4HDRB 4OKSA 5JH7F 1E9CA 2O8CB 1BOBA 5LYJA 5AUNB 3CUVA 3CDLA 6Q21A 1EV7A 3SEZA 1JKPC 3MRVA 3ZCXA 5FXMA 1ZP6A 2LC2A 2J7KA 3A1SA 1ZBDA 1IK4A 5BQPA 3G9QA 2K2WA 1V5WA 5C7LO 1YSCA 1FDSA 4D46A 3VO1A 3AP2A 5EI5A 1RAAA 4OP2A 3B48A 1YR8A 3P19A 5I47A 2G7UA 1HLFA 1CULC 4KDCA 1A7UA 4IQ4A 1JDSA 4US2R 3LWZA 3K1AA 2NVOA 4F3NA 2KDZA 3ONVA 3CP8A 1JKJA 1GU0A 4X97A 1DHTA 3PFBA 4WI1A 2ZI3A 2F4MB 4E1VA 4EG6A 1CYEA 4NQZA 5D6FA 2JANA 2QA5A 1JQDA 2IIPA 2XGCA 3LTNC 2MYUA 1MG5A 1MGOA 4K5QA 3HXMA 2WJAA 2DG2A 3HP4A 1T5BA 3AG3H 6CHYA 5JPCA 1C3VA 1G3QA 2A94A 3PG5A 3VU1A 4TVBA 5F3RA 3FKSD 4TM8A 1ZNZA 2RHGB 4AYBN 1PNTA 3SY8A 5JVDF 5AW1A 4YJ3F 5M2QA 2WD7A 4V2IA 2TYSB 3UICA 4IDPA 1EUDA 2AA3A 4JP0A 4NUBA 1K2WA 2IXDA 4G7ZF 1LW7A 5LJLA 1Q7GA 4P8RA 3GI1A 1W581 1WMAA 2HO4A 4MR7A 1Q1GA 2XYPA 5J58A 1P4RA 1C0KA 2X1CA 3NBAA 3OD1A 1H42A 1NN3A 2X51A 5JHHB 1Z4KA 1Z35A 3HYSA 4UNSA 4Y1RB 3L8ZA 3FA2A 1SRRA 3HDQA 4P53A 4DB4A 3PA8A 4B7ZA 2JGDA 3S55A 5BSEA 1QH9A 2C78A 3A3PA 2FI1A 3X1JA 3F5FA 4CG1A 1PVVA 2VTKA 3DE0X 2DPUA 4Q9HA 4DDTA 5FQOA 2QLJA 1TWFJ 2IS6A 1NVGA 1KU0A 3P45A 5L3QA 3O73A 3TE6A 1HF3A 3BWXA 2LREA 3KYCB 2VZ8A 1RNLA 3EXG2 1FVFA 2IXAA 2F6CA 2R8XA 1ILWA 3N8DA 4HRYA 3S2SA 3STTA 3SX4A 1R6VA 2XZLA 1KVSA 2C2HA 1T9AA 4JEIA 1Q3KA 5ICSA 4IX1A 1QB7A 3M4YA 5AXDA 5EHIA 2QRJA 1HOTA 2Y67A 1EMDA 3DCNA 4BP8A 4Z4IA 3F7OA 3Q3VA 3ROFA 1T6YA 4NCAA 3B8HA 4M0DA 3GD7A 3DMFA 1JFFA 5EUBA 3O2JA 3C43A 1R9MA 1QH1A 1VHTA 4QNRA 2ICWG 3AETA 4JVLA 3CPSA 4N39A 4LYHA 4LY3A 5SY9A 7AT1A 4KLRA 1GAJA 1G8KA 2ODQA 4LVUA 4LWZA 3P2JA 2LY2A 2ZIGA 4C3VA 5IANA 4IOJA 1E94E 4ZJPA 3JVVA 3IBFA 3CZQA 2EV5A 1FJXA 1L8QA 5MN4A 4X6LA 4RZQA 3MJCA 3PKZA 3VKFA 1MC4A 2PWAA 3UMYA 1Z5UA 5KDLA 4RWEA 4OHFA 4LYDA 2JKYA 1TPYA 5LA6B 5EJ5A 2W0SA 2YVQA 3ODPA 4CCAA 2ZUFA 1TFRA 4XN3A 4QULA 3JTGA 3PXAA 4JJKA 3TVDA 4IIXA 4RULA 1R71A 4X1KB 2JL1A 3ZXXA 1ZKGA 5HLTA 2C4UA 4HSEA 5CH8A 4CLOA 1V7CA 1EH7A 3S8EA 3BQZA 1RPAA 2R79A 1E6KA 1WW2A 2PX0A 1JIUA 1R4MB 1G6NA 1KERA 2RAUA 2Z1MA 4UHDA 3A9TA 4C06A 5FA8A 1HI9A 1ZRNA 5DI3A 1YOVA 4BO0A 4EHLA 2JJ2D 3TZQA 2RB5A 4GLJA 5DSZA 2CW8A 4RHCA 3D1NI 2H4WA 3ZY6A 3SXPA 4BZZA 2RAVA 4NZNA 5HDGA 1VSQA 2XAHA 1KAMA 4KYUA 5DM70 1U8RA 2OZLB 4YG2F 3KXPA 2JVKA 2NU8A 9LDTA 2JD1A 4KLCA 2CHVA 4CMIA 4P86A 5G1PA 3V4SA 1Y4SA 2ZYSA 4FEGA 4LG3A 4WCFB 1YE8A 4MS3A 2PZAA 1VJCA 2HU7A 2O07A 2ZQ5A 4EYOA 1Z6QA 2V6GA 5TMBA 4GEGA 1Z29A 1OXTA 1HNNA 4OAPA 3AEUA 2XMGA 4HL6A 4I46A 2D5VA 5LMCA 2DPGA 3CVOA 3U1KA 3FE2A 3VMMA 5FO5A 4LEIA 4U0YA 2HWUA 3LK6A 3ZR8X 4IIGA 5LP6B 2GRUA 2L02A 4CSWA 3BKWA 3CNOA 3K73O 1HBJA 2ZBVA 3L1UA 2Z0MA 3PEVA 4FD3A 3UT5A 3DKYA 1EA5A 1BBYA 4HX2A 3LH5A 3MS2A 3UJDA 2PKQP 2RJNA 5JEDA 3G2NA 2MINB 3ITEA 1WLYA 1QPMA 1ZH8A 3K0CC 5E3MA 4EDFA 5CURA 3IPLA 1C4KA 4TRMA 3HSEA 3TKLA 2KLBA 3GZNA 1QYVA 1XD2A 2YY7A 5IM5A 2O2SA 2I4RA 5DN6A 4IVNA 2VIXA 4X91A 2AFHB 2L7MP 4ZI7A 2OQRA 3QQAA 3ZW8A 3G49A 1WB4A 4Y30A 5TDHA 4J0DA 5EPOA 4AJHA 1ACIA 1EQUA 2WJGA 4TYYA 3IUBA 1KI6A 3T7TA 3F67A 1RTTA 3SR4A 1PVEA 4CICA 2GRJA 2WHYA 3NBXX 3GJ3A 2R00A 1ZCJA 2Q2QA 3KKOA 3CB4A 3KT8A 3VAZA 2WU1A 3A1DA 3CUEF 3SE7A 3D4IA 3P4UA 2O1WA 4JJ4A 2DGDA 4Y9TA 3PXBA 3DWGA 1NI3A 1PO7A 4CV1A 4C01A 2W2OA 1ACLA 2IODA 4MP8A 1I6WA 1E2KA 3I45A 3GC6A 4G5QA 4GI1A 4YH1A 7ADHA 1JR3D 3L8GA 4HATA 1R8SA 2F3QA 1XZCA 1NN0A 2A5GA 2VEDA 4JK1X 1WCIB 2RQQA 3LL7A 4HNVA 3S3TA 4R71A 3IQFA 4OHZA 1JEYA 3DBVO 1JQLB 5AJXA 2FSIA 2YZ7A 1X8LA 3O03A 1ZG1A 3GPCA 2NGRA 1WUJS 4EVSA 4ZOEA 2J0SA 3KOWA 2CUKA 1OU4A 2WB1N 1XN1A 1ULBA 3HU5A 1FIAA 5AJVB 3EHEA 3PC7A 2YMPA 2RN7A 1XD8A 1LI5A 4RVSA 4L85A 2A84A 3SHWA 2M7BA 3CM0A 2AXNA 1UDBA 2AZMA 4GGOA 4M88A 2HREA 5M04A 5D3MB 2Q41A 5K8IA 4JT4A 2RGRA 4M89A 2AR7A 5A9SB 3PDHA 3IUOA 3U09A 2P0YA 2PRIA 4LQDA 3W1EA 2O7VA 1V4RA 2YJZA 1H2WA 1A98A 3HR7A 4DIQA 1PD0A 1SKBA 3FUCA 2WU3A 1RAIA 1SY7A 4QXQA 4D82A 1WMDA 2HGSA 2LVBA 1FZPB 5LYYA 1JU3A 3PJDA 4HRIA 3FJYA 3DMNA 3ZEAA 3V34A 4ARZB 3CTMA 3DHVA 3HXOA 2WTBA 1DRUA 4JR2A 4DQVA 5SY6A 1USIA 1N2BA 1F2UB 3PPXA 2Z56A 1EP9A 1Z0IA 3OWTA 2Y2ZA 5DP2A 3VNUA 1W7PD 3GLHA 1WPXA 4QPJC 4GGMX 3RRJA 4ARIA 5DSXA 1P75A 1YRLA 1UB9A 3RNOA 1AQJA 2V96A 4FW8A 4Y0VA 3C3PA 2VHEA 1F5SA 3DCJA 3PUZA 5J59A 3ESAA 4G12A 1L2TA 1ZEJA 2VXZA 2Z2JA 1QZ3A 2YX4A 4HB3A 2AOTA 4TLCA 4KC0A 3H13A 4KICA 1EVIA 3M6VA 5E3OA 3EYYA 3K6KA 5DHPA 1KKLA 4IZOA 2AMJA 2ZPTX 3I39X 3L2UA 4IVQA 3N8NA 4Q3BA 2C5AA 1JJVA 1OCCH 4MIYA 2B4YA 4GPAA 3O92A 2FDRA 2FETA 2GB4A 1NZFA 1GAWA 2D7DA 3VUEA 5ITZB 1KY4A 1RI5A 3AVWA 5KAPA 3DV8A 2Q1ZB 5LQRA 2WDZA 3EIHA 5EVCA 4W5WA 3E8MA 1HE1C 4ISBA 2BKXA 4N12A 4S0ZA 2CJWA 4V0ME 3FMOB 1M74A 1P2BA 1GGKA 5JNVA 2R8EA 2Z58A 3CUWA 4G1FA 2F8MA 4UVGA 4BEHB 4YRRA 2GZ1A 1H0RA 5CP8A 3GLFA 2AOVA 4AF8A 3M1EA 2NUBA 3ORRA 4EHAA 2CQXA 2JIDA 3BJ6A 1AQUA 4RETA 4Q3DA 1FF9A 3GQBB 4BPRA 3FDYA 2PVCA 3CRW1 5CGQB 4MRPA 4F21A 1N2HA 4RMGA 3N75A 4FEAA 5ALPA 4D9IA 4KQ1A 1Z88A 3CR3C 5CFLA 1MRNA 3ZQCA 4BACA 2B7LA 4YRCA 2IZOA 3BIJA 1U3DA 5JLJA 3DULA 2VOJA 2A6TA 2ZYGA 3PUJA 3RPQA 3TCNA 4MV0A 4HH0A 3UJ6A 1EXMA 3FUXA 1RP1A 4HDKB 2Q07A 2Y0CA 3C1TA 4X66B 4Z9YA 3DCIA 5H82A 1WKVA 5ESRA 2W84A 2F6RA 1QG6A 4URUR 5BNTA 3WBFA 4PC6A 1VHLA 1O94D 1SKYB 3BTVA 4R9UC 3L4SO 4BDYA 3BQYA 2AHQA 3PZRA 1U80A 4J2OA 2FPIB 3RM3A 4YRLA 1BFKA 4HQFA 4ZAXA 2FLVA 4HV5A 4GZ6A 1TQ6A 2LK2A 4EVQA 4BE2A 1BM9A 3UXHA 4BZPA 3BDIA 4B4DA 4MKGA 2IXBA 1E6CA 1W5TA 4OPMA 2HYFA 2FEXA 4YPFA 3DEAA 3DCFA 4ER3A 1MH1A 5C8YB 4MQLA 2WAAA 4RLHA 3PX3A 3V4OA 3BB4A 3ZI7A 5EE5B 3MHPA 1RZRA 2XB6A 1GQYA 2LD5A 3GDGA 3WNQA 2B25A 1QIMA 2HD4A 5DRYA 3SE0A 3B2QA 1OISA 3BTIA 3EZXA 3LUBA 1U2EA 5LC1A 2VSFA 1DBIA 2SKDA 5ALXA 3OLVA 3C3EA 2G70A 4LG1A 4ZDOA 5AK0A 4LBWA 1IXKA 1H22A 3BK7A 4MA4A 2LY9A 4A0ZA 2JCYA 3KKKA 3LAWA 1FUYB 2X6XA 4A3KJ 4ZANA 4CM8B 2P9ZA 3HB1A 5EYPA 2VA9A 4YROA 3C6KA 4RF2A 3ORHA 1D1AA 3SQDA 2R4QA 3RHFA 3GRYA 3RJ5A 1E69A 4QKQA 5A03A 4PLCA 3RT9A 1L7XA 5B3JA 1PKEA 3IPCA 4WINA 4M72A 2JIOA 2VP0A 5GAGJ 3PI6A 4GFBA 2BMWA 5AVKA 1IL0A 2JBWA 1CUSA 1LX7A 3CLUC 2CLSA 3D3KA 3VNBA 1EVEA 2VT2A 4YRTA 1QUEA 4W7SA 4X7RA 1Q91A 1VMIA 4PN3A 4DBZA 3I0MA 3RGGA 4MPJA 5KTRA 2Q3EA 1CZRA 1XRMA 1BOFA 1BVRA 3EGVA 5BNIA 2CXNA 3A4TA 3EXIB 1Z5OA 5AD1A 5GTIC 1GDHA 5LEJA 2IEGA 1HDPA 1WQ3A 4MUJA 3HY4A 3JQ9C 3LSGA 1WEKA 4YGXB 2H57A 3DW1X 5IVIA 4PQEA 2QRGA 3UW1A 2J08A 4BWGA 2ZLBA 3VPHA 3ZV5A 4K9NA 4Z49A 3IA7A 1YFHA 4Y15A 2P67A 1VYVA 2OA4A 2REOA 4UUMA 2ZITA 5KYNA 3G1OA 4BVAA 3GZJA 5T67A 3SLKA 4BN5A 3N8IA 4YUAA 2XAQA 4RGQA 3T4PA 1RQ2A 2RV8A 3ZGYA 3PR1A 1N78A 1GPLA 5IAEA 1TK3A 1JR4A 1H6DA 2YXLA 4FDVA 2D2WA 1QHFA 4P4SB 3OFVA 2P9QA 2X4IA 2BSXA 3OLZA 5DTDA 1KI3A 7REQB 3KOZA 3RIHA 1K3FA 2OFWA 2HRRA 4MS3B 3PGKA 4WA7A 2VJBA 2HLDD 1QK4A 3FSGD 2AF4C 3T15A 1A8IA 4LS3A 3LMMA 2EG9A 2B34A 3BZWA 1WSAA 2PUEA 3M1LA 2HPVA 2GCNA 4WY8A 4CCYA 3TQCA 2V6JA 4D6YA 2V6FA 2JIPA 1KYZA 3M3HA 1VA5A 2VL7A 4WKOA 5HS7A 1CR6A 4BWYA 3HADA 2ONJA 2HXSA 2JQ7A 1KI2A 4MHTA 4I36A 5AVVA 1WDKA 5L6LB 1P2FA 5AKIA 4HR7A 5HDKA 4CT0A 1GSOA 4GGGA 1B15A 4R1HA 1SBHA 3RT7A 4D56A 3F8BA 2Q0SA 1PEDA 5AJHA 1IPEA 1K1EA 1ZEMA 1LE8A 3KPYA 2WWTA 4HD8A 1NUSA 1OBFO 3BXFA 4W5OA 3W5HA 1MAVA 5JJ5A 1GGMA 1KFCB 3E6BA 2HQOA 3T52A 2E1MB 3C48A 1FS4A 3FISA 4QWMA 6ADHA 3VHXA 1KU3A 2GVNA 2FGKA 2L9VA 3EA0A 2Q9BA 3GW8A 4ZC3A 4IWNA 1FNDA 1S2DA 1GILA 4XM0A 4EHIA 4OX9Y 2IU4A 3JQ7B 2QYOA 3A4CA 5JO9A 5AHRA 3DR3A 1Y8CA 5JJKA 2QLMA 4ESEA 2VSNA 3ZY3A 2BDEA 4JUAA 2LYCA 1FLVA 3V4GA 5L45A 1PJSA 3U7HB 3MUOA 2QGFA 4DIUA 2Q4OA 5K8TA 1GUYA 2FGJA 1BS1A 3W5VA 4KGXA 2WJ4A 1J42A 1LZLA 1Z91A 3KEQA 3PS9A 3LF1A 2WAYA 3O38A 1UZMA 2YY6A 5UKDA 4N82A 1HC7A 2IEKA 3GPLA 4HX7A 1PRYA 2FSUA 1E7SA 3B1XA 2K27A 1OGJA 1YNSA 1RKXA 3K1MA 1CG6A 3GO4A 3TL4X 4NJOA 1Y9AA 4R8MA 4W1QA 5GINE 2VTDA 1Z7BA 5C8VA 4YMSA 1VHDA 3WXMA 4R9VA 3TMOA 1K7CA 1J06A 4WCVA 4YTEA 4DW8A 3LGXA 3V2HA 4C03A 3MFKA 2J7PA 2F3SA 4KBFA 4BMCA 1N8TA 4KQ6A 2ZBPA 1XA0A 1KC3A 4UMFA 1EHIA 1TMKA 1E5VA 1T95A 4ENMA 3SZPA 3OM0A 2OPTA 4IGKA 4RDCA 3IAAA 3I4CA 1ZRMA 2W6ID 4RIHA 4XPIB 3KHUA 3D6MA 4GO1A 1OCTC 4QLBA 3G2HA 5L3GA 2Y4NA 3ESDA 1PSZA 3TAUA 5J1SB 4F9EA 2PR7A 4M9RA 2NN3C 3K4JA 2DMUA 2BVNA 2HB6A 1ZQ9A 2XH8A 4IYRA 5IKPA 4I9NA 2HDOA 3D59A 3E7WA 4O4HF 4J1QA 1L5QA 1FRZA 1ONSA 4QUHA 1FTSA 5FTJA 3ROUA 1E92A 3A14A 3DL7A 4C14A 3LUFA 1IRFA 3ENNA 1ZYRF 1WQ2A 4BKOA 4BVLA 2LIPA 3FXJA 1MLDA 4MWDA 4RYLA 5A3QA 4WVLA 2YFQA 5BSVA 2FN3A 4Q1FA 5B30A 3KB1A 5E20A 1V4VA 4RELA 4EJ2A 4W9NA 5CA0F 1XEXB 1XJ0A 1KKUA 4E21A 1XAJA 5E2BA 2DMNA 3HCOA 2JIRA 4DSNA 3GVAA 1FLDA 4F1WA 4DLYA 3PUWA 3HJAA 1PCXA 4L3VA 1YQXA 1U0LA 3WSWA 2VF8A 4EUSA 3QLTA 2ZYDA 3RIRA 3HXTA 5EE0A 1TXGA 2O1EA 3RU2A 1LC3A 5D3KA 1I33A 4TVOA 1Z8FA 1J24A 2RFLA 4B82A 2WU8A 4NIMA 3KDAA 3CDHA 3V7UA 3CLTD 1PI3A 4YV7A 2WTNA 3ER9A 1N1MA 4HZUB 5D1NA 2Q5HA 1YS1X 1BMFA 3K9LA 1SELA 1Z62A 1H2AS 3VOTA 4YAFA 4HQKA 4FR0A 4X63A 1TM7E 4CQNA 1NQVA 2GD2A 4YRFA 1B16A 5JAUA 4DXHA 4E51A 2B2XA 4AK9A 1DIBA 2HMUA 1N6NA 3JARB 1SVMA 1ODIA 5FWAA 2EFWA 4V1CB 5BR1A 1XMXA 1L7DA 1HA3A 2G71A 3EF1A 3ILYA 3EUKL 3H4IA 2H8KA 2IYTA 1XPXA 1PT6A 1LJ9A 4GRIA 3FPGA 1O97C 4R9RA 3I1YA 3L6BA 2JHGA 3OIWA 1ZN2A 2JPBA 3VZRA 3HDYA 3RSZA 1LDJA 1WF6A 4N3BA 1P44A 4FT2A 1QO9A 3V4RA 3N5CA 2YQZA 2IUUA 1NHAA 4L4ZA 1FB5A 1DBSA 3OO0A 2H2HA 3KLMX 4ARSA 3FYTA 1B8IB 5FLYA 2Q2VA 2QROA 4YJHB 1R6UA 2C8LA 2PMZA 3JWJA 3M3YJ 3IELA 3WL3A 1JLKA 4GRAA 1DAMA 1JE8A 4YUYA 1NBIA 2DK5A 3PIRA 4ZVNA 4DNPA 1TNDA 4MNUA 4KDPA 1SXJE 4H0NA 1TEVA 4IFTA 2GA1A 2PGOA 1D04A 3SQMA 1S96A 1N1GA 3KZMA 3VKVA 1XFAA 3S1AB 3KTAB 3WWOA 1WVGA 3BXOA 5CITA 2EK5A 4LKRA 4NBSA 3VFDA 2JLCA 4G0QA 3B5JA 1DXQA 4WACA 2GX6A 2UXDB 4POAA 4XX0A 1ZD3A 3WGHA 1FUUA 3PTAA 3TSYA 4UHJA 5AR1A 1D0YA 4KIFA 5FV4A 3AP3A 2NTYC 5TQ2B 2ZT6A 3H5LA 3OIDA 1ZUHA 3GLSA 1Z05A 3HZOA 4ZGGA 1NLZA 1UP4A 1C0EA 3RQSA 5LRSA 3F97A 4PC1A 2LWIA 4ZAVA 3SC2B 1NATA 3D7KA 2YH2A 1NVDA 1RADA 4CJXA 2VJMB 1CV2A 2YUSA 1J8VA 1BR1A 3ZDQA 2J67A 3VH4A 4C3ZA 2JWTA 4L9TA 3FYCA 4HWPA 3BGVA 3I9JA 4FGWA 3PNLA 5JH7A 3I72A 5DGIA 3JD1A 4H4CA 1U7PA 2MCFA 2Y48A 2VZ0A 3MGKA 3FLBA 2C5FA 4AN1A 5CIYA 1EXNA 1T5DX 2R85A 4MEYF 4GVXA 5DYNA 2HCTA 3HPRA 1E99A 5ADHA 3CMAI 4S3MA 3DDZX 2YXDA 2L54A 3D4LA 3L6UA 3IRUA 2IYSA 4PYNA 5E79C 1UJ4A 2GK7A 3S5JA 4GPIB 5BR7A 4UD6A 4O2RA 3LBNA 3OFND 2NU9A 2I76A 1Z33A 5BWLA 2VP5A 2XCUA 4MIOA 4QXMA 1GKKA 3ILSA 1I32A 2ZRJA 3ZMUA 1SG9A 4MPDA 2POQX 3IIKA 1W96A 2QG6A 2L19A 4CWAA 1KONA 2QT0A 2ZTUA 4G4IA 2W6CX 1K89A 1U0BB 3JCUC 4MO9A 1ORIA 3R5TA 3HDVA 4PG7A 4MR9B 5FNVF 5E1WA 4B7UA 1CNMA 4GW3A 1FFXB 4DG8A 4KHPB 1DLIA 1AA6A 1OWLA 4E31A 4O2AF 1LLDA 4MQBA 4H7FA 4X92A 2F2EA 4Y2VA 4Z4HA 2C4HA 3HDTA 4BNXA 3CUTA 1I0ZA 2YQ4A 3KJHA 2BFFB 2P2NA 1F3LA 5ALMA 1IN6A 1AA7A 3IAM1 5JVDA 3H3UA 4YJ3A 3CXUA 5GZ3A 3PLNA 4QEDA 2X19A 2DDBA 2VF4X 4CIDA 1AGRA 3OCWA 2OILA 5FI1B 1JIJA 4UTOA 2VDWB 4GWLA 3GWGA 3O75A 1LPOA 1YHNA 3E9DA 4I4IA 5J1TB 1Z5VA 4QRIA 4IJ6A 2P4EA 5JFOA 4CIAA 3C7JA 3NKVA 1OYVA 4L9AA 3VNQA 2B36A 1S7OA 3BCRA 3D4OA 3FIJA 4CTNA 4V2FA 4IH1A 4IH4A 3T3DA 4N41A 4BFCA 2H7CA 2QW1A 2UZIR 2WADA 1OH5A 1Q0PA 1J2RA 3KXDA 1T9KA 3E5UA 3WG7H 4YFVA 2HFHA 2ZQYA 2O5RA 5CHEA 1GAXA 4B4OA 3JSPA 5IJXA 1WMSA 4E2ZA 4B71A 4AIIA 4A3LJ 1G19A 4UNNA 4MVJI 4MFDA 3LQ2A 1OXMA 4A2PA 4TMWA 1HR0B 4NPAA 4S05A 3CEPB 2XTNA 3JQ8B 3VQTA 2P62A 4Q3CA 1KZYC 5I7VA 4JELA 1XHEA 4GDMA 4CCYB 4BYYA 3BBPA 2NTEA 3P27A 5FWYB 5KWVA 3V7YA 3HEAA 1PJ2A 1Q2UA 3BJMA 3AVXA 1VQKI 1XD7A 1E4OA 1D6JA 4P1WA 3IIJA 2N75A 2F5VA 2P79A 1E8DA 1GTG1 2K4BA 1UQRA 3RIXA 1U04A 4MS1A 4RV9A 3ICWA 3TEJA 1XC5A 2E35A 1JSXA 2HQAA 1JLLB 1FCJA 1WDTA 1WRJA 1ESZA 3Q7SA 5AP9A 3AR2A 2HV8A 3SJMA 1AKUA 2HUPA 4C4ZA 2EQ5A 3COPA 4BN0A 2ZU6A 2OV8A 1G5RA 4GSKA 3OBBA 1IVNA 4ITUA 1I6LA 2GJ4A 3LP5A 4MEAA 8ABPA 2WQ7A 4U3JA 4PXAA 1W85A 2FR8C 4JQCA 1XDGA 2ISQA 3IHWA 2A6HF 2CMFA 4C6SA 3LYLA 3ILVA 2VHXA 4DLBA 2YBDA 3LFTA 1PFQA 1ABBA 1DI0A 4KJZA 4RD6A 5BOSB 2JMWA 3VRHA 3QG1A 2O8EB 1G8JA 3RS2A 4ARUA 4GSYA 2ZB8A 3GF4A 3PA6A 4HWSA 4FCWA 2LBFB 3H75A 2E2HJ 2QSYA 5J1YA 1XE3A 2JI9A 5BN3B 3KCCA 4ENRA 1IBMB 1XSXA 3CO0S 2DCUA 1G8PA 3QPUA 4IUYA 3GJ0A 3K8ZA 2E5WA 3TAHA 3MB8A 1K2VN 3H6GA 3SKVA 1GFIA 5FUXA 1KXZA 2PL1A 1JZQA 2J3JA 5DHAA 3TPFA 3TWOA 3FETA 4OB6A 3EEIA 3H1AA 4ETNA 3FYUB 1YKFA 2XNDD 4Y2XA 5EIOA 4UATA 2IX3A 3CCCA 2L0XA 4IV8A 4DAEA 5DT9A 4KYIB 4FBGA 2VKDA 3RWBA 5EWMA 3CR8A 4EHNA 3FZGA 3HWWA 3CCFA 1XF1A 3ZE2B 1O2DA 2LBPA 4LWQA 2CXXA 1JVNA 5JYDA 3TG2A 2QTVB 1QHHA 3ROGA 4FE4A 1EVQA 1EBUA 2IYAA 3O8RA 2DDAA 4EA9A 1D4OA 2R7XA 1J0EA 3LT0A 2ACJA 3CMCO 4KPGA 2QRUA 1LEAA 5BXYA 5C5DA 2J48A 3HACA 4MITA 1JLRA 3ZTTA 1G66A 5K3EA 1WU8A 2DOKA 2FDCA 2WBMA 4TV7A 1CNEA 1KI1A 4QDZA 2COEA 3KE2A 4QDKA 4NMXB 1O6BA 3DDOA 1GLNA 2VBCA 2BFNA 3IP8A 2IJLA 3HKDA 4J9UE 1X15A 1LXCA 4KKVA 5JSZA 2C1XA 2OK8A 2QTGA 1UCFA 3UA3A 1JPUA 1XP8A 1LBEA 5FLXA 4EV0A 5DXJA 5F3DA 4ZYLA 5I01A 5B37A 1R22A 4Z7NB 4A8JC 3T7RA 3FUWA 3FWKA 2JK3A 2V7QD 2CUZA 3R44A 3ISTA 4E03A 1V71A 2F1RA 2RC5A 3NJRA 3D1VA 1ZU5A 4KUGA 3MD9A 3REOA 1FDTA 4KJXA 3LKVA 5TNXA 4YBZA 2RB4A 3OCYA 4L74A 3MG9A 5HCIA 3T3EA 2FD5A 1OMOA 3R0XA 2FEWB 1SCJA 2EQRA 3K2AA 2C83A 1T10A 4GUDA 1NRIA 4PZYA 4WLEA 5KPJA 1T3GA 1KI7A 3CKYA 3OJLA 2X0LA 5TT0A 5KSWB 1R49A 1DT3A 2BUAA 2JI7A 3GLKA 3ZZTA 2B9SA 3BPXA 1WJCA 1Q0ZA 5AQEA 1JHRA 3X1KA 3E7LA 4A9AA 3NTXA 1BYUA 5KOHA 4A6XA 1AKHB 4ZTBA 3D4BA 1BH2A 3H99A 3HL4A 2IT0A 5FL7D 2ZWOA 1ESMA 3OX1A 5A4IS 5EXDA 4QXPA 3LLMA 2DP4E 3LNCA 1T3ZA 2GJKA 1Y4UA 4XGRA 3IAS1 2C88A 2VDOB 4EMBA 3V33A 1MJBA 1JG2A 4AURA 2IOYA 3AEKA 4CU5A 1FRVA 1CJBA 1E3DA 1KVTA 2OD5A 4INZA 4PCVA 2Z33A 1UPBA 1N5OX 1YUBA 4YRSA 2DA3A 4Y2YA 5T5QA 4UCQA 1VQ9I 2HLPA 3K9FC 3PYLA 1RRCA 1SC3A 4B8WA 4AG6A 4NULA 2JK0A 2CC2A 2R8ZA 4ABYA 2X6TA 4FCTA 4F3TA 3O8OA 5F76A 1E7YA 3NC1C 4F4DA 3G0BA 4M9XA 4XA8A 1YCFA 1POXA 3W5UA 3IPAA 2XW6A 1TM4E 3SPXA 4U7DA 1OFHA 4BB5A 1W7AA 5DK6A 1FNSA 3PL8A 4UBMA 3GLIA 1LVUA 3FPFA 2ZM6B 1MB2A 2QENA 2CXRA 1SCDA 2YU3A 3W2WA 4MQFB 4YLEA 4PG6A 4HWKA 2OP1A 5A5VA 3SZGA 3B6AA 4HNSA 1DZ3A 3ET5A 4D3XA 4XX0B 2H5LA 4GXQA 1I5RA 4A3FJ 3CX8A 4LHEA 3RYRA 2OV1A 4P54A 1IUYA 4O4LB 2YW2A 5FI5A 2D7CA 2Q49A 3HLYA 1RQGA 4M1ZA 3VWBA 3Q8XB 3C1DA 4B1RA 3WGKA 4ZEOA 2CLMB 2OQ2A 1YRQA 2I55A 3K53A 3MTJA 2W11A 2GYUA 1Y56A 1O9BA 5JBNA 3WE3A 3OOEA 1SANA 1GV2A 4LRUA 1KVUA 2BV3A 4RK6A 5ENVA 2ZZNA 4Y3UA 4C22A 1JF8A 4WLNA 3ZS8A 2CUJA 5C52B 1WV0A 4W99A 2QF7A 3NATA 2I2XB 3K6GA 5CM2Z 3ML6A 4HXYA 2I33A 5B4TA 1PFUA 3RNLA 5BMVF 4D81A 1RLTA 3U9LA 1P7IA 1TQPA 4WDQA 1I39A 4COKA 4K1XA 3ODGA 3CPHA 4EVIA 4FI3F 2KB0A 4DZTA 4JSTA 4J0GA 4A3GJ 4QUDA 1HV8A 3SXJA 2BSAA 2CLIB 1E6EA 1YKGA 3HUDA 4M0KA 2VXCA 2HPIA 1N2CB 2Z2IA 3S2HJ 4CM1A 3E8XA 1WB9A 1GZUA 3H1BA 5FBRB 4OV6B 3B1KA 1JHAA 3OLQA 3U19A 1YD7A 2P5VA 3QVXA 2KIUA 5HODA 3WMEA 4J8PA 2CZCA 4OQLA 4G94A 3OLWA 3I1FA 4HDAA 1IHUA 4PBRA 3DPSA 1NFFA 4GG1A 3NM5A 1SFRA 4P22A 2R84A 5HQ3B 4LFUA 5HKKD 5K4AA 4DVGA 4OQQA 4ZYUA 4Z99A 1GZ7A 4LB6B 5DO9A 3V42A 1Q7CA 3E9RA 1AHIA 1DBWA 5CVVA 3W77A 5K8UA 2CLDX 4LYJA 3TH5A 4HA8A 5DPMA 1B0ZA 4QPCA 4RESA 4YELA 1OLSB 4DBQA 3ZCRA 3H2SA 3B6ZA 1ODJA 1GNQA 1XTZA 1YQ9A 1V37A 5C31A 2R62A 2XEXA 2PUJA 3ZDDA 2NPOA 3GPIA 3VBEA 4RD3A 1J0AA 2PHZA 4BUPA 1POWA 4OI0A 5D5PA 2QM8A 4GYKA 2M2EA 1K8QA 4AZ0A 1PLJA 2PMKA 4ZVVA 2B98A 3EHDA 2JLSA 2E4YA 2DW4A 2VYCA 4FK8A 4BX2A 1FYVA 3K2ZA 5IPFA 4MMYB 1YZYA 5KOJB 2HHJA 2ZUEA 1QFMA 1NQUA 4G5XA 1T2FA 4F6CA 3PZBA 2W70A 3E6CC 3WQHA 3VR5H 1NP7A 1DUXC 2FMIA 2AFVA 4WXRA 3LSJA 4X7BA 3AEYA 4D4GA 2HK8A 1N6KA 4PYRA 4GBMA 3NO4A 4KK4A 4MS1B 4R2WA 3RSFA 1WABA 2G6TA 2QKLB 4EKGA 4DQKA 2CGPA 4Y52J 4CKBB 1E7QA 4C07A 2DF8A 1QQIA 4B3GA 2OC4A 2IY7A 1XOIA 5JSFA 4TM7A 4TTJA 1KFJB 4M3FA 2BFCB 4IHJB 4F7DA 2HHAA 3LCCA 3KWMA 5HNKA 4AJ2A 4XUDA 4MUMA 1G1AA 4KXUA 5KUTA 2B4KA 1S02A 4TMVA 2FFHA 2XKKA 3GH3A 3R3SA 1Q0SA 1K7FB 2H94A 3AF3A 4JLUA 3OJOA 3BERA 3OQIA 2JCGA 2E1NA 2KQUA 4XR4A 3BTLA 2FRDA 4LDJA 2XKOA 5A5EA 4CLDA 5J2UB 4XB6B 1NU8A 4WIAA 1IYZA 4W1RA 1UBMS 2GF2A 3NQOA 2ZP1A 1DCFA 2OO5A 1TVKB 3PQ7A 2JJ8A 5G41A 1U0GA 1G8XA 3GMDA 3KT6A 2Y1OA 4RMHA 3VPGA 1W4MA 1YA6A 1U0HC 1MHTA 5TMEA 2W7NA 1YHQI 2UUPA 2Y68A 1R4AA 3E3NA 2PA3A 2IBTA 2IYNA 1NE7A 5AM2A 3TLZA 5CB8A 3WGMA 2H6EA 3BRWA 5B3AA 4R69A 3T3HA 4KDRA 1E79D 2RMKA 1EUYA 1D2GA 2RREA 3QP5A 3ZJ5A 2OBXA 3S2EA 1TJNA 4L50A 4LY9A 5FNZA 3SJZA 1XDBA 3DMHA 1H94A 2QGZA 3I54A 1G42A 1YV9A 1ID8A 1GG5A 1TIBA 4K0KB 1QAMA 3DEEA 3CGGA 4P38A 3ESBA 4O4JF 1WHSA 1U9IC 2AX4A 4JBYA 3OZCA 2ZYVX 3A2LA 3QBTA 2WWWA 4HFRA 2NUPA 4YRVA 1FX0A 1NJSA 4CBVA 2YN4A 2A6PA 2QQEA 4A0QA 2OHOA 3TRIA 3QPHA 4ZVRA 3F6BX 2FMFA 1TUBA 5BQ5A 3S6JA 4TUYB 2PN1A 3USZA 3GVXA 3TCKA 1L5VA 4BXFA 5EMMA 3LSTA 3HBFA 4C4OA 1F8XA 1NMSA 2VLAA 3K4BA 1T33A 3ZD8A 1N92A 2H2GA 4YRPA 5DUKA 1JMVA 1U28A 2EGUA 3HKDB 1E7RA 4PYIA 1RS0A 3ZMZA 1HE2A 3UCFA 3ELYA 1KYTA 1JQ3A 1U5TA 1T1JA 1VL6A 5H0IA 1UDAA 1T0BA 3W5DA 1NVKA 1FP2A 4UVCA 3STHA 2IVMA 5TIIA 5KYGA 2VKQA 4IHTA 2X2PA 1FL9A 4MWTA 3IUNA 3AFGA 4M36A 4BXOA 3UMSA 3BWVA 3R75A 2GARA 1SHZA 4B6GA 2CG4A 4Q3OA 2WYHA 1SRQA 3AR7A 1ZOPA 4GOND 3M1IA 3MCAA 5HS9A 2XQVA 1XRLA 1XSEA 2C96A 1FVXA 1UHSA 4LISA 1K86A 2OQVA 5EEGA 3QKSB 2IPXA 1Y5RA 1SUWA 2ZPUA 4UTVA 4A0FA 3UJ9A 2DZDA 2GEFA 1A9TA 2GNOA 3COAC 3VKHA 4JASB 5C7YA 4M6YA 3D8UA 3WRYC 1E2NA 3A04A 4ZTUB 1C2TA 4RD4A 1EKXA 2C5BA 3TRKA 4AX8A 1SIOA 3THWB 3IVAA 1W94A 5KSPA 2VPWA 3FZVA 3EK2A 2CNLA 3Q3EA 5IC5A 2ZRBA 1W30A 2GAUA 1HY3A 3O1HB 3JYPA 3TOAA 3AHEA 3CLHA 1ZX1A 3NORA 2DYRH 5BY2A 1P33A 8AT1A 2HHHB 4FYYA 4XUGB 2YNMD 4XRFA 3PFIA 2Q2EA 4ED9A 4U63A 3AL0C 3QOFA 2ON6A 4MB2A 4B2LA 3KUCA 3ECOA 4RM2A 1WB6A 2FWAA 4HKTA 3I05A 2OCLA 3UG7A 5HDNA 4MQ6A 4DCPA 3NDIA 1ORWA 2CCKA 3SC3A 2QZ8A 4OD0A 1ZN9A 3PF9A 3T34A 5KOIA 1WQ4A 1U4NA 3KEFA 1H9AA 5DMHA 1HCRA 2P9CA 3AC0A 5E1MA 2VHZA 2C3UA 4OBEA 3VPCA 2JDIA 1JE0A 4G0OA 1FOXA 1V9CA 4DIFA 1QU2A 2X3YA 6LDHA 4LOLA 2ZRPA 3J81k 3ZX5A 2V03A 5FUQA 4LCEA 4O4HA 3OLYA 3IMGA 5TSDA 3E7PA 1HDXA 5TRTA 4E6EA 3KR1A 3ZXYA 2R4GA 5I7UA 3I01A 1QVWA 1ODLA 3PDIB 1XZIA 5B4VA 4LLGF 3LIIA 5LXTB 5KWEA 3ZDBA 2EFHB 4Q0MA 1J7JA 5EC8A 4F2HA 5LHGA 3NRBA 4WXPA 3HUTA 2IW5A 3ZW7A 3F22A 5A2QA 4QICA 2DA6A 4EITA 3R6GA 3RASA 2A9RA 3BP8A 3PUIA 1O0CA 1CY2A 3SSOA 2BY1A 1MNDA 1CVLA 2BHZA 2JH8A 1PR0A 1DX6A 3OEEA 2HJWA 4GM1A 4GI5A 4WA8A 3RFUA 1OAOC 3EWIA 4HX5A 5CD9A 3HA5A 5JCOA 1VECA 3PT9A 2RSLA 3BJOA 5DEIA 3LY8A 3EETA 4IDHA 1T6NA 3TZBA 4S0HB 3SDZA 1K79A 2ZJ1A 3KQPA 2G5TA 2OCAA 4NCJA 4DWJA 6REQB 4M73A 3RC1A 3RRBA 4BZQA 2YSRA 2O0LA 5ESDA 3CCMI 1BWSA 1I2MA 5E7MA 5LKAA 1U3FA 1CRZA 1F4LA 1FW8A 5FPSA 3SQOA 3DXZA 3V4PB 3HB9A 1SU4A 3UJBA 2L42A 2I7XA 2D00A 4WHMA 4HAUA 3QSYA 1D4ZA 3VFZA 1L4YA 4QE3A 3L82B 4Y2TA 2BKUA 5FQNA 5B7GA 3R7SA 4HDNA 3M2TA 3PR3A 3HZHA 4PTZA 1B9MA 2P4SA 2K3PA 4ASUD 3G6KA 3FXKA 2JRLA 4QT4A 2BGMA 4HAYA 1QB8A 1M0WA 1HDYA 4BVBA 4JA2A 5AI8A 2FZ5A 5K6AC 3OE7D 1I4EB 5JWRA 3MTAA 3NV9A 2HSDA 2RAPA 2QA4I 3URKA 1ONVA 5L3BA 5EJ7A 3OYGA 4HY3A 1O8CA 2WSSA 1Y1KE 2YWDA 5M5YJ 4ZO7A 1V1MB 1JAZA 4ZYHA 3E0QA 1PP7U 2FEMA 5AHOA 4QQKA 1F1ZA 2JHAA 4LGWA 1GR1A 3ABUA 4UXNA 2O3JA 2VDVE 3HUUA 2V1NA 1IBCA 1SIUA 1VKNA 3UPUA 1YQDA 1PT7A 4BJ6C 3MILA 3K9BA 2QTBA 4A2WA 3CF5F 4ZJZA 3I4FA 4NFHA 1IG7A 1XVLA 1X19A 3OFJA 4X1EA 1JUDA 4JL5A 4YRKA 4FB4A 2OSVA 1O6CA 2W6JD 4K9QA 4X3CA 1XS9A 1MBGA 1U9JA 1XEAA 5LYJB 4PX3A 2QHXA 3GLXA 3EXHA 1AZLA 3SNHA 1NH3A 4RO0A 3U26A 2WOJA 2VKHA 2QMQA 4RK1A 1S01A 2IWHA 4KN4X 1YJQA 2IIQA 3A3YA 5JSKA 5J6XA 1V54H 2VR1A 1WCMJ 3C8HA 4IIBA 4UMVA 1ZVMA 3GJTA 3FMSA 3KB2A 1P7WA 3HHEA 4JKYA 4GQBA 4M0LA 4IJAA 2OCXA 3T9FA 2CL0X 3T1HB 4H6XA 1H5QA 2W2KA 1W4BA 3K1AB 5KSYA 3PV0A 2NRAC 4TKVA 3GCMA 3UPDA 1JKJB 1QRDA 1ZM3A 1R8XA 2OV7A 3UWKA 4KPYA 3AIMA 3ZGOA 2PBFA 3Q6NA 3EEYA 4KVZA 4GCVA 4O1HA 3L2RA 1H3NA 4WCDA 2CDAA 4KAFA 2LY1A 5E8JA 3HVUA 3DE4X 2O57A 4CN8A 3HDHA 1QCYA 4MYTA 2OEPA 3ZDZB 2KLOA 3VZCA 2PXCA 4L0ZB 4RQAA 3GOQA 4PANA 1Q1HA 2WD7B 4XORA 1CUEA 1L5MA 1WCV1 3GEHA 1V3QE 4XM3A 2Y2UA 2OG1A 3H2HA 4LRYA 1EUDB 4M0FA 1YBAA 2HTFA 3OOYA 3PX2A 4UHFA 4Y6SA 4MR7B 4BNUA 3FZEA 5FNVA 5F1JA 5EKTA 3ZBTA 4CUZA 1QRAA 4QTZA 1EESA 3RLIA 1A2KC 6NULA 4U2DA 3WZLA 3F6RA 5JFRA 2DFFA 2W2NA 4OGWA 3OOHA 1F14A 2JGDB 1UT8A 2O23A 3EIWA 4WPGA 2BFPA 3I0ZA 4FX5A 3JQPA 1AC5A 3OZGA 2E0IA 1K5GA 2DAPA 3G2OA 4KX3A 3FH0A 1CY0A 2VASA 5HJEA 2NO4A 1M1NA 4QBHA 4WF2A 3IP6A 2Y4OA 5LQKA 1JVSA 1DWQA 1PJZA 1RXCA 3QOYA 4YQYA 3C1UA 4EG4A 3GEMA 5CLLA 5L3QB 3CVWA 5HFNA 4QFBA 2BYTA 1DE0A 4Z3KA 4BV3A 3DT9A 4K28A 2A9PA 2QPTA 1PTJA 3OSZA 4B84A 2I2BA 4TS3A 3GTGJ 2R5FA 4X90A 4N5HX 5CVIA 3VDXA 3C8DA 4ER6A 4RK5A 4RXUA 1ZJ4A 4DARA 5JATA 5TE9A 4DWOA 4IHXA 3O8BA 1ATIA 4W5QA 3HHGA 1NQWA 4L5CA 2YICA 2ZC2A 2EF1A 2WMYA 3N2NA 1GNRA 5IVPA 4EY3A 1JFFB 3ZV4A 1QH1B 4EJSC 4RLQA 3HR8A 4GI7A 3AETB 1RWOA 2FNAA 4JQOA 3KRTA 1FBQA 5I4IA 3KKQA 1KJWA 1GA6A 2AZ4A 3TVYA 1VLVA 1BXRA 5FI0B 2P41A 4MRMA 3DTVA 3E82A 3MINA 2IYWA 4XE5A 5BQTA 3DFUA 1T4GA 3R24A 4BXOB 5JBIA 3U4CA 5BQFA 4BE7B 2Q5FA 3U1BA 4FUTA 3H0KA 1TAGA 2ILVA 3WGQA 4HLYA 1QZTA 2QI9C 2ZJPF 5CAEA 2C2GA 2NXNA 1I3KA 2X1EA 1HQYE 4XLPF 1QXSA 2W85A 4Q3LA 1VQLI 4N0BA 1IBLB 3JTHA 3LQFA 2FX3A 4C4RA 4URFA 5E38A 1Q15A 4JBWA 2WB4A 2JHPA 4MB0A 4N7MA 2IOFA 3D0OA 2X5XA 4FHEA 1P4JA 1TM2A 2F5FA 2E4ZA 4S2EA 4G5RA 1JVBA 2CD7A 1OT5A 4XWOA 1ON2A 4CLOB 1KA9H 4A3JJ 3N0WA 3T61A 3FSEA 4ILEA 1PT8A 4H3HB 1U90A 4A8HA 3KDPA 5FFZA 3OSGA 2DTXA 1K8YB 1X38A 3K7EA 1T08B 3HTUA 2XRMA 5DI3B 1YOVB 3JQAD 3TB6A 4V3BA 221PA 4HLDA 4FQGA 3WYGA 1TQMA 1BIBA 1LDGA 2HIMA 2QPOA 4FCYA 2R6JA 1P5HA 2CHEA 1JHZA 2D62A 5CA1A 1UT6A 3B6JA 1X1EA 1T3SA 1LPMA 4KWHA 5I8ZA 3WTBA 3FTDA 4DZZA 4CQJA 2BGCA 3ER8A 3DL0A 2NU8B 1SXPA 2R6GA 3ZWBA 2O03A 2ZCWA 3ZK7A 4CMIB 4U1RA 4CV0A 5CFQA 1B59A 1GYPA 3H8WA 3HFGA 3FOWA 2ATVA 4E5UA 1E2HA 1KI8A 2W5UA 2QSFX 3KP2A 4UVDA 4B6JA 3AEUB 4MS4A 3ND9A 5BWNA 4AC0A 1E58A 3UJ8A 3V46A 4EG3A 3KKLA 3CIFA 3PNTA 3OFKA 1SFEA 4UULA 3JR9A 4E11A 4QVGA 4B40A 5DUIA 1OH6A 5FWXA 4B09A 2CV2A 3ZWDA 4BHCA 1Z15A 3UT5B 4YP0A 1N32B 4XRSA 3O4RA 1THMA 3CZ9A 5JFTA 2FOIA 2IBSA 4XD2A 3Q2KA 4XDHA 5FL3A 3JALA 3NTRA 4CNBA 5FD6A 4O59O 3ZV6A 3T1YB 2AE1A 1A5TA 3LAPA 2VJPA 2XNHA 1RQLA 3OUUA 3GZNB 1XD2B 3M1AA 1EFKA 4WOKA 4WWCA 3LDGA 3IAS2 1UBSB 1S8FA 4ZI7B 1U4OA 4U2KA 3JD4A 3M5CA 1KI6B 2FP4A 2AXQA 2NT4A 2GWRA 3NBUA 1UDXA 4S2UA 3VNRA 4HH1A 4OHKA 2HM7A 2JUCA 3ADPA 2WVJA 1G4DA 3LJKA 3HY6A 3LQ4A 1EX9A 3LX8A 5H6RA 4H60A 3J7AY 2P2CA 1KSFX 1MMAA 3VR1A 3VPBA 3FOAA 3KALA 1QLWA 2J5KA 3E18A 1V8FA 2PSHA 3RCBA 5MGBA 5AONA 2GAOA 4GLLA 4HI0E 2IT1A 2H4JA 4V0SA 4DV2B 4XM1A 1SUDA 2ZDQA 1MP0A 1RACA 3N0TA 2VBXA 3K09A 4BLWA 3PIOF 2IYZA 1JEYB 1GRRA 3DPLC 1ZOSA 5AW8A 1RWXA 1V39A 1Y3IA 3O3CA 5KTYA 1XKQA 4BB0A 3MJ4A 3EULA 3G68A 2X14A 1Z6RA 4PLPA 3DOIA 2D45A 3TX6A 1A5AB 2YV2A 3EVAA 1WCWA 4MX8A 4NBUA 2EJTA 2CVZA 2RK6A 1Q17A 2GZAA 5U9CA 1ZA2A 2GCIA 5L4LA 4OAZA 4UTNA 1UPTA 1NK2P 2EU8A 2XGJA 2V5AA 1Z5ZA 2XA1A 4GEKA 3KPHA 4A5NA 3F2IA 3HOYJ 4F9TA 1ZKDA 3NEAA 2ELKA 1XRRA 2O3UA 3OIQA 3L4BC 3CCSI 1SBZA 3TQFA 1I8TA 2Q4DA 3IWZA 3HOWJ 4TLAA 4IDFA 2HSWA 2UYOA 1U65A 2PWBA 3F8MA 1GPBA 4ZGBA 2R86A 1LSJA 4FX2A 5TVGA 4LFBB 2HDWA 3KETA 2RH5A 1XZBA 1F9AA 2WHEA 4BNGA 3JW4A 3K2IA 4WEOA 1YRYE 1P7JA 4AD8A 1MD0A 2X7HA 3O7MA 4YP1A 4NYIR 2X9GA 2XCQA 2FV8A 1YB1A 4DEXA 1PS9A 2ZB3A 2GESA 4YALA 3RF6A 1X80A 4AWAA 4F2PA 4R4JA 1KQFA 4AT1A 3GLHB 1NW8A 2QZPA 4MB6A 1DIAA 1ZRCA 4MQVA 1M9NA 4RA9A 4C0SA 5BURA 3QG5A 1GU1A 1M1UA 1Q44A 3M4OJ 4YRAA 3ETDA 1DCTA 2AOTB 1GKYA 2YOGA 3TW6A 1Z17A 1CY1A 3QPDA 1LEBA 1YZUA 1ESNA 3M83A 2IZ7A 4YCMA 2V65A 3N53A 5D4SA 3H5VA 2BEKA 2XDYA 2CBGA 3ZQJA 2I6FA 2QD5A 2HVQA 2LXNA 2LDBA 3PKJA 2EKLA 3RU7A 1GUZA 2NV6A 1JSZA 5HOQA 3BQNB 1WD5A 3LI2A 2D13A 1FMFA 2LFBA 2PCLA 3WBKA 2YJTD 3ETJA 1UXKA 1ZNYA 1XTAA 5JMPA 5FAXA 1NF2A 2V7GA 3TTWA 3TL6A 2OG2A 5DI9A 2CJWB 5DGTA 4JXJA 5KNCH 5BMVA 2OCDA 1BO6A 3BZ6A 1RWVA 3SVTA 1M5TA 5DBGA 2NOJB 3GLFB 1UC9A 2XGSA 4EQ6A 1UJ8A 2PMZN 3K16A 2JI6A 3D2AA 5EG5A 3U48A 2WJ3A 4AS1A 1M34E 5G0SA 3OUZA 2ZE7A 1YR1A 2OLJA 1OROA 4ND2A 3RVKA 1RKUA 2B9EA 4GWKA 4MCAA 2XSZD 3C8UA 1W1WE 1G8YA 1ANKA 1YI1A 5IARA 1KRXA 1B14A 1NW4A 1XHFA 3ZGLA 2E19A 1QFZA 3BXPA 4QUJA 2XA9A 2YVAA 5KPDA 4D5FA 2HVRA 4CGZA 3PEWA 3HGTA 1QPBA 5L3VA 2A5JA 4BUCA 4J19A 2WLSA 4ML3A 5ALZA 1BEZA 1GGNA 3AY7A 4TLEA 2IGTA 3GN1A 1Z12A 4J1SA 4DJTA 4KUEA 3DMYA 4D0RA 1GXPA 3EBPA 4AMBA 2ZYRA 3HVRA 2P9TA 2GLTA 1AN0A 3WYFA 1YS9A 3HMKA 4DJDC 4CG2A 1RXSA 4GKBA 4DB2A 1HYEA 1GPH1 5IVKA 2DBQA 2AC7A 3DZDA 4NR0A 2CJXA 4N40A 3IXMA 3MKWB 2JVJA 1O96A 4IHYA 2W6OA 4UXJA 4XJTA 4FWIB 2W2LD 3F0TA 1CZOA 3RLFA 4UHEA 3GF2A 3WTWC 2GETA 4JJEA 1K7YA 2WUWE 3AJ8A 5FRMA 1TIPA 3UK0A 1OIVA 3ESCA 1CGPA 4KREA 2XODA 3IMCA 4BQEA 3NYQA 1E3OC 3JQEA 1XZAA 4R05A 2YC4C 4U88A 4DJJA 1Y8RA 1IAVA 3UUWA 5GVRA 3DLAA 2YQ5A 4J49A 2LCIA 4TV8F 5GJCA 5A4MS 1XZNA 1IHDA 3MMNA 4D25A 5EZGA 1ZSYA 3PP8A 3C6XA 1T0HB 2YN0A 3MUEA 1YBVA 4U39A 2FEAA 3WRVA 3FZYA 4X8MA 1GARA 4D0NA 1A76A 4JDUA 3BIFA 2DU9A 5EYPB 4HGZA 4L9NA 2KISA 3GYGA 3D8NA 3JTMA 5ALGA 1XTBA 4PG5A 2AG1A 4PSCA 2JGKA 1NNSA 3G17A 5IJZA 2C8VA 1YR6A 1RKTA 1AG9A 4LQLA 2VK1A 2JHCA 2XCLA 3L92A 4GX0A 5JCJD 4IG9A 1RYMA 1X7HA 1GVDA 2UUBB 1TZJA 5EHGA 2ZAGA 1B7GO 2DKFA 4CDMA 3G02A 1VF9A 5JNTA 3EUHA 3WGTA 5IXJA 1L1RA 4WK2B 1MPTA 1D1CA 3BYZA 4AZSA 1JAHA 3MN1A 1ETYA 4UY8I 1QF7A 1CDEA 1C4XA 1DWOA 2UUZA 1U31A 5AJWA 4C4AA 1EJ6A 2R0QC 3TX2A 2EA2A 4FX0A 3W3AD 3ELDA 2UUCB 1EIWA 3RUAA 1RWPA 4RF3A 2IZ5A 2YTZA 5DNDA 1B4DA 2RBGA 3DAOA 3UB2A 3IVRA 2J9FA 1UXGA 2A5YB 3MJEA 1NF3A 1S3GA 3R3JA 1FDRA 4KWTA 4DLSA 2JCXA 1C5KA 4HXFB 3L1HA 1USSA 2AG6A 2JB9A 1TGYA 3I92A 2BY4A 1K06A 1SVNA 4QJIA 521PA 2NO5A 3BD9A 4MW1A 2V9PA 5GONF 2W6QA 5E6UA 4A3BJ 1A5BB 4BXXJ 1I3LA 1F2TA 1TJ3A 4RPKA 3ROKA 3QV2A 3B85A 1GT0C 3WYCA 3H4MA 3TQRA 5DD8A 4NHJA 3GEZA 4MS4B 4C21A 4QFMA 1CRLA 4O4JA 1A82A 3OQVA 1M6YA 3ILXA 1K7XB 3U4MA 3QUQA 2XXJA 4BMVA 4YLYA 2WG1A 1KDVA 3FKJA 1LV8A 8MHTA 2WIAA 2HU5A 5T64A 1PZNA 3FMRA 1ZONA 2G09A 4C0BA 1TADA 3AUKA 3G3EA 3HRHA 1ETQA 3Q12A 1X39A 3P9SA 3U9SA 4HN2A 1L4FA 4KWIA 4QYMA 3R6WA 1QPIA 1Q50A 2PGNA 1ZWLA 3MMXA 2L7KA 1EUZA 1MJNA 3JALB 1RZVA 1XO1A 1LE8B 3ZDFA 3VAYA 4DW6A 2VHUA 3UXMA 3TQHA 4ZAYA 2QTAA 1W75A 2F17A 3IR6A 4P3NA 3VHXB 2UZKA 2V9KA 5HS6A 2WSYB 4D99A 1W9MA 3SICE 4QLOA 5JCXA 1TEXA 1Z3CA 3V7WA 1WHTA 4F52A 4YAJA 4BFLA 1MNAA 2Z16A 2GKOA 2X4GA 1H2RS 5A4KA 1TT7A 1O7JA 5HUJA 1DT5A 1OVGA 1P17A 3JQDA 5AJZA 3TUJC 2WG2A 5K3OA 3CV3A 4BP9A 1HT1E 5KS2A 1GITA 3CUQC 3A1EA 1JXQA 3DLCA 2Z9CA 3ZQQA 4TTQA 4M49A 4B4KA 1Q95A 4JX8A 3GR6A 1V8OA 4DJAA 2ZSKA 3B6CA 2QLBA 3SZRA 4DLUA 3STUA 2ZZMA 4NBWA 4OHVA 3UMBA 3R0VA 2WAEA 1D6MA 2HH9A 1OF1A 1J9GA 4WXHA 3TNLA 1TTYA 1RBZA 3BFXA 4UCWA 1DPUA 2X5JO 1F0NA 1QKIA 1Q14A 4QIWN 4MTCA 4LJ6A 3RVMA 4WFJA 1FRNA 3F3SA 2WD8A 3BGDA 4EJUA 4QSMA 3KAKA 3DLBA 4H0EA 4FLFA 4CFZA 5REQA 3L0SA 2KBEA 2O0HA 1MH9A 3PGJA 4IDNA 4MJLA 4HYYA 1MV8A 3C18A 3EZFA 1U2TA 2JGIA 4F45A 3OAAD 4LHZA 2BZ0A 1KPHA 1IUNA 2GFQA 5MN6A 2CFSA 3C3AA 3T3IA 3W2FA 2N9UA 3KWFA 1TO2E 3KDSE 1DVRA 3EDMA 1XQ6A 2NXCA 2A58A 3OOJA 4I50F 4BQAA 2VDLB 2M9HA 2HL6A 5DHFA 2Q28A 2ZXIA 4CFYA 2CSUA 1R0YA 2ODEA 4Q24A 4BNIA 4P31A 4TWBA 2YNMC 4CN9A 1CDDA 3ZR4B 4D0LB 4PRKA 2ZJAA 1R5HA 5HUQA 4EYSA 1TYAE 2PBZA 1XTTA 4S1PA 3UM9A 4D45A 5EIWA 4F4HA 2IXTA 2OGSA 3CE6A 3S1QJ 2J45A 2IYPA 1H6BA 1JHVA 4KXXA 5K3BA 3OC0A 4OCZA 3NDPA 4L51A 4KT6A 1BWRA 4C7OA 2X0RA 4M37A 4BMOB 3BT7A 2PNJA 1ZD5A 3K96A 3HKCA 4IF4A 1YB6A 1IULA 2R8RA 2CQNA 1IHPA 3VNSA 2V7XA 2OZUA 4AZVA 3TKYA 1O77A 3ZCOA 1UXOA 4P3XA 3AV0B 2GXAA 5KQRA 2HQRA 1LC0A 2M7AA 3JQGA 5JBQA 3GCWA 2ZUSA 3BTJA 2H18A 3D5SC 5C32A 4CM5A 1O0SA 2Z3ZA 2YVKA 2V98A 2XF6A 5T8KC 1RJWA 5CNKA 3N9IA 3QUAA 3IQWA 1YZVA 2VDJA 2R7UA 4RJTA 1JA0A 3G71I 1AE1A 1U78A 3U61B 5K05A 2G1AA 2FWRA 5EXTA 1Y3DE 2CHGA 4BFWA 3R4VA 1NVAA 3T1OA 1MZPA 3G7NA 2YRWA 2NWQA 5DYTA 1NP6A 3I9LA 3TM4A 3QLVA 4GYIA 3BORA 3NAMA 4EQ6B 2AW5A 5EOVA 3OIUA 2DOFA 5TV2A 1A9SA 1QWSA 2NQTA 1GYRA 2OPBA 5ALTA 1VNDA 4UVHA 4M98A 5E4JA 3IT1A 1XTVA 1PFWA 3REGA 4IMJB 1HTBA 3HBLA 4RGYA 2VHTA 1SVWA 1KJ8A 2F4VB 1DO0A 4YRDA 3BBLA 1Q7RA 1NONA 2FW0A 4LVNA 4AJ4A 5JSQA 1LVGA 1O5IA 2FSVA 1UK7A 3CRVA 5BWBA 4D9GA 2XUFA 4IDCA 1QO0D 2MBFA 4B44A 4NP6A 5FH9A 4OK5A 1DBRA 3DXYA 4Z5XA 1KQOA 4C0KA 3IH3A 1IOWA 5K0LA 3V6MA 1Q12A 3TIGA 3RJMA 5J5AA 1E1CA 1R0LA 1KWKA 4PQGA 3VU9A 4UU0A 3THOA 5I5GA 3U0BA 2DFPA 1CUZA 2GKSA 5IJ0A 1NV8A 1D2RA 3JU3A 4JHXA 4K88A 4E46A 2OA0A 1I6KA 1DINA 2RGNA 1UBTS 8ATCA 3RHZA 4P0QB 5JH7B 3LXUX 4BDTA 2BI8A 4DSTA 3S1NJ 1SXJA 2YYAA 3BK2A 2AL7A 2YINC 2QS9A 5CBKA 5CQEA 1HG1A 4KNYA 5A4FS 5BR8B 2WIDA 4C87A 4B6FA 3KYIB 5EE3A 3SXUA 4BAYA 3K0FA 3DVQX 3HCCA 3PXCX 3OKAA 1TTPB 2IYYA 1JDJA 4EO7A 4MLCA 5KYUA 2P2GA 1MABA 4I8IA 2RNGA 1CUCA 4OBWA 5IX8A 1RJEA 1J2JA 2NU9B 5DULA 1LLUA 2HIAA 1L5NA 3EGIA 2XTJA 4NBNA 4NBRA 1ADBA 4FM9A 1NGSA 2RHWA 2IV2X 1WJBA 1D4FA 1RRPA 3EDQA 5AW5A 4OYLA 1I4WA 2C9DA 1XQWA 1XCOA 2O2JA 1YTUA 4DNCA 4XKCA 4U4AA 1R15A 2EHDA 1HMPA 5H6QA 3MCZA 4AJ1A 4IJUA 3T8RA 4FISA 2ECKA 4MZXA 2VT6A 3GIWA 5DM6F 3R20A 1T56A 4MMXB 4WLUA 2I2DA 1TL8A 3PGXA 5CK5A 5KVQA 3ADCA 2ZRGA 5JVDB 2EZ4A 4YJ3B 2MU1A 5FTLA 3AR3A 4HW0A 1O3RA 2V4MA 3BCHA 3FYHA 4XARA 4C7VA 2QVYX 2OHHA 3MYYA 4EO9A 1UEJA 2FZCA 2RCNA 2ZRIA 2OBYA 4XD7D 3IHKA 2JCBA 4UE2A 2I62A 3FOFC 4LYYA 2HDDA 1GFZA 4ECEA 1RIIA 2FZGA 1I9CA 1YFKA 5BRNA 1F8GA 2FMLA 1B3RA 5AW6A 2EIXA 3OCCA 4EX6A 2PKWA 4EM6A 4RMNA 1BNCA 1W44A 2J87A 5E3LA 4KR6A 2HI3A 721PA 2PH3A 1L6RA 1ZD4A 3E84A 1C9KA 1S8AA 3STXA 3E6MA 4W4TA 1XVTA 2CL5A 3NHYA 3HVHA 2BXZA 1D7AA 2B7CA 1VE1A 1VJ0A 4HVAA 2ME6A 2B63J 1EE1A 2YHAA 3WFZA 1X3WB 4QL3A 5E3HA 2VP2A 3HFRA 3GFBA 1YC5A 2CBXA 1I7DA 1F2TB 2JJYA 2COMA 1C7EA 4K1LA 1THTA 4MQEA 3NJ8A 4LE0A 2YOHA 5HOOA 2P6RA 3FHCB 4WADA 3ABIA 1F38A 3OZWA 1EKEA 1N5DA 4E3WA 2ZUTA 1KO5A 1O94C 2J0EA 2ZIWB 3FCCA 3ENWA 3NHLA 3H5IA 5GAEJ 4PVDA 1XDZA 2CBZA 3QYEA 2IS2A 3DAGA 2FSPA 1F4PA 3I8XA 5HUHA 4FYPA 2M8EA 2E2JJ 4XPZA 4QJ4A 4HEJA 1F5TA 1A2BA 3JVUA 3ADBA 3W2AA 2BUCA 1IUPA 1XTRA 1ONNA 4KUHA 2O8XA 2W2XA 1W6UA 2WTMA 1X1QA 3PQDA 1ZESA 1L4GA 1MBHA 1JE1A 4MV1A 3VI4B 3A2NA 1Z28A 3PTLA 3T7JA 2GVZC 3BMQA 1H2ZA 1DUVG 3QE0A 4WD3A 1OKKD 4PIMA 2FPWA 1XV5A 4EGJA 1MZVA 4U3JB 3T12A 2DN0A 1T26A 3ZQFA 1W85B 2QNBA 1G8SA 4K6OA 5CK4A 4DRYA 2E7XA 4KQIA 3C5WP 1OKRA 1MIJA 3JPYA 3GT3A 5E17F 3ANXA 3SSNA 2W71A 3TQQA 1PDWA 2ZT7A 4KO1S 4Z7JA 3TTYA 3FOEC 3I2IA 4DLZA 2XQFA 4G9GA 3PQKA 3OH8A 1EDZA 4IIHA 1U0FA 3N8HA 4EEZA 2XPCA 1IAQA 4BZXA 5HCNA 5DBFA 3PVCA 4R8LA 2Q5JA 2ADUA 4JOMA 4PAMA 1J9ZA 1ORHA 3U40A 4BDSA 3KD2A 2DU8A 1CZHA 5DM4A 1XEWX 5F0HA 4CIVA 4D98A 2YFHA 1R6DA 4L3OA 4KQEA 5CDTA 1D1BA 3F8SA 2K9QA 1T2KA 3UOWA 5AJYA 2DH5A 2JKZA 1LF0A 2XA2A 3RVSA 4AF7A 1HTWA 2XBLA 1RQXA 3GCGA 1M8JA 5EWMB 5FRNA 4GYWA 4A5SA 3EMVA 5EZ6B 3PTZA 3ZYCA 3ZNQA 1JKFA 1GTZA 2OTLI 4AX4A 4LK3A 5ALOA 5GJWC 4O08A 2GIZA 4FSHA 3VZDA 1ETXA 1UK8A 3QW4B 1WFXA 1DSSG 2V7FA 4FW9A 1QHHB 4RD1A 4QARA 4HWRA 3IPRA 1U6KA 1CQZA 1QBJA 2EARA 1HE8B 2EZIA 1LUAA 3M81A 4EW3A 3OZAA 1A9RA 5KTPA 1E1QD 3LKDA 3BE8A 1M5RA 5BUZA 3S2ZA 5EQTA 4AVYA 1I6XA 2P6SA 2PLFA 1LPBB 2FQYA 1VCMA 2DHEA 5JSZB 4QLCU 1JDTA 3ZBPA 2FJPA 3A4IA 1MTZA 3HXQA 2ZFWA 3R3XA 3ZCTA 2JFYA 2QQAA 3B1WA 3IP1A 1NVXQ 5B3SH 4ID3A 2Q2OA 3QNUA 1X0XA 3T3NA 1OXXK 3ZP5A 2WC1A 3UV6A 4Q4DA 1QTNA 5DBOA 4A91A 1X58A 2BZSA 4QYWA 2H65A 2YR0A 3B89A 5HMMA 1NI4A 3NTVA 1KDOA 4F91B 1XF9A 1AO3A 4OJKA 3H5NA 5T57A 3CZMA 4YAUA 4CMAA 4I8DA 4XDZA 4NS1A 3KZCA 3CH5A 1PWXA 5BN1A 1UJNA 3DOEA 4BJ3A 4P0TA 2O6LA 5EEAA 4HF7A 2IHZA 1QZXA 5FF9A 2PUCA 2QV0A 4ZCSA 5K0EA 4R1PA 3E2IA 5KOHB 2C4TA 3DUWA 4N3GA 1Y82A 1WE2A 4TMXA 3GDFA 3M2PA 3UBMA 1NUAA 3QE9Y 2DWUA 1NBMD 2QTTA 3AF0A 5I9BA 3T3PB 2YHUA 4UM5A 2OZKA 1A9PA 4L76A 3CINA 3MFQA 1OXBB 3HG9A 5IP9J 3A0BC 1TTTA 3DDNA 1E61A 3AEKB 1TZCA 3P0IA 4BTVA 1QF6A 4PSUA 3WMRA 2XUGA 5FUVA 5LB2A 3WLOA 4U9IS 1L0BA 3PRKE 4H16A 4BE1A 1JEJA 3I2GA 4HG2A 4G23A 3VODA 2UXCB 3OT4A 4IOMA 4H17A 2VUSA 4BJ5A 5IZ4A 3U1TA 1MB9A 1UZCA 4YRIA 4DCJA 5EDNA 5IF3A 3CEJA 3WTUC 3BICA 3R3VA 3AB8A 1Q77A 3O8OB 5K7ZA 3OYBA 2IHNA 5JAPA 2FDXA 3K6SA 4P34A 4H6PA 3Q7TA 4UHKA 2L3DA 1YLFA 3SYMA 3L6CA 4C5CA 4XSVA 3BMNA 3L0YA 5DTMA 3SP1A 3GLIB 5C53B 4UMDA 3OR2C 4IQGA 3LCVB 4LY0A 1YO5C 3EG5A 1AUOA 5L7TA 4UZFA 3Q88A 5AH0A 4BB6A 4AXXA 3L7DA 2NVWA 4LGMA 1RC1A 2Y69H 3P0JA 4ETWA 1N6HA 2EFJA 3BRQA 5HF6A 3LDAA 3BOQA 3A9UA 4XKVA 2YX1A 3ISPA 5CA0A 1TYCA 3AY0A 2J1LA 1PUXA 2QSGX 1L9XA 4RENA 3IP9A 4EFMA 1Y6IA 2TMYA 4CA0A 3QA3E 4B5KA 3W4IA 3DTTA 3WICA 2GBGA 3RS5A 2A9JA 3ASVA 2PRZA 2QLZA 1DU0A 2A61A 3WGUA 3PC8A 3D3NA 2XKPA 1S2GA 1V7QA 2DFDA 1NN1A 4DGSA 3TCXB 3EDYA 1GTRA 4HWGA 1M2FA 5H4HA 3THSA 2PTHA 3E6DA 3RC8A 3E97A 2X0NA 5EA2A 1FVOA 1VI5A 4PSAA 3JQFC 5LFAA 1VMKA 1PU2A 2YMQA 5FWNA 2P4UA 3OICA 4V02A 1E98A 2RAFA 4ZYTA 4WASA 1V26A 4ZDPA 2LP4Y 3A8TA 1D03A 3KLOA 2PKRA 3SHQA 4RY9A 3Q5FA 1N7JA 4BRZA 2E4AA 5IUKC 1F9NA 2CUTA 1XZ8A 3HKZA 1P19A 4B31A 1QGUA 3N2KA 1UKYA 3GCXA 3KQVA 2P3SA 4YI5A 1RWMA 4K86A 1TQ2A 2ZMEA 3CLTC 3N76A 3E6AA 2XECA 1ZICA 3HA2A 4R0NA 3NBZC 3VR2A 1UBKS 3GMTA 1C50A 2F43A 3T0GA 4W7HA 3FPHA 4JLKA 5EJCA 5G1NA 3TP3A 4F60A 4HK4A 1HFKA 2IVZA 5EJEA 2VK4A 4GKAA 5HZKA 4AU7A 3RFFA 2GPTA 4NENA 3U9TA 4J91A 4Q16A 4RVCA 2PGDA 3WOHA 3BGWA 1AU9A 5LQCA 5JYBA 4P3YA 5AVWA 1ZIOA 2O2XA 3ROZA 4DLRA 1UUFA 3DAPA 1GZ4A 4XWYA 1XDDA 4M8IA 4MTEA 2WABA 4P5PA 3NOOA 3KJZA 4GL2A 3EQLF 4B83A 1AO0A 2C7RA 2J6HA 2P68A 4MR8A 2VNJA 1Q6YA 5ITVA 3T7IA 1R23A 4JLMA 2DUJA 4R81A 2IVFA 3ANYB 5G4LA 4V0LA 3E9MA 3UJ3X 4ZAWA 4TL7A 2YMLA 2D74A 1II9A 4ABZA 2BJHA 2JAOA 4I8XA 1RXWA 5T3YA 1CF2O 2K9MA 4DMMA 2PT7A 2Z9DA 4FHGA 2C7BA 4WGFA 4EELA 3GRVA 1KJ9A 3E4CA 4AZ0B 3QUSA 1ZD1A 1UKVY 1G7TA 2J07A 1AKRA 3QGMA 4X6XA 4KG7A 3NGLA 2GAJA 4HVTA 2YZMA 3MJHA 2H7XA 4PHTA 4IEIA 1Z6TA 1VCOA 2WAFA 4FGZA 5U4QA 4TGLA 5HMLA 1NVVR 4X8HA 2JBAA 3U7GA 5GIPE 4UTRA 2RBKA 1ZJWA 1W1IA 3I5XA 1JA1A 4MH0R 1PQUA 1F4VA 4X3OA 4DIEA 3IAM2 3QY9A 4PG8A 4ZOQI 3R0JA 3IP3A 3VC1A 2B9VA 1X87A 4LHXA 3EXEA 4BO4A 5CG1A 3DHNA 2A0XA 2C9CA 3TTSA 3DXFA 1PQYA 4HQ6A 2HCRA 1VL0A 2P1DA 1MMGA 4C04A 1WNFA 1E2UA 1SIWA 1CDZA 3H6HA 1MBEA 3MGBA 5KNDH 3W9SA 5PNTA 4WX9A 1C4OA 5TX7A 1WDLA 4G9BA 2XITA 4INOA 1I01A 1G2IA 4H3KB 1C0PA 4D96A 4G1CA 2VXDA 4ABTA 3EC2A 1ISPA 2Z4SA 2RCYA 1T0JB 1WZUA 4PHCA 1CUAA 2WKRA 3WK9A 3PNYA 4N0QA 3F96A 2CV1A 3OQIB 3UKGA 4MQ9F 1PJCA 5JZBA 3DKKA 3HCFA 5JZ9A 2RHBA 3N1UA 5CXQA 4IMPA 3R6TA 3EDRA 3K9QO 5TEWA 2BEWA 1I0IA 1KYXA 2DY0A 2HGZA 3HC7A 3M4NA 4WECA 1YI8A 2EKZA 1UEXC 4ONEA 3F8WA 3PEYA 4N03A 1K78A 4Y1FA 4QC2A 4O2AA 2J5PA 2VK2A 1U7ZA 3LO5A 2Q8QA 2JGFA 4IMRA 4NYMR 3DU6A 5IH3A 4P9NA 2IWRA 2PFGA 1IBKB 1A5SB 2XCIA 1ISRA 4JUBA 2VA8A 2K7LA 3DGFC 3ECAA 5DLDA 4BKXA 4OIPF 2H59A 5LWHA 4QWWA 5DBHX 4UJ5A 4LC9A 1L3CA 1LTKA 3ZS9A 1LA2A 2NVXJ 3WTCA 3ZE9A 3DGEC 1YE5A 3OYIA 2FLWA 3IWFA 3M8JA 3DFZA 4PLHA 1KQ9A 5H83A 3OYEA 1SMKA 1CY7A 3WZMA 2HVSA 3O8DA 1SD2A 4NNOA 4CL0A 1WHSB 2XRFA 3MW8A 3PFFA 2GM9A