2R0QC

Crystal structure of a serine recombinase- dna regulatory complex
Total Genus 67
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
67
sequence length
200
structure length
193
Chain Sequence
MIIGYARVSSLDQNLERQLENLKTFGAEKIFTEKNRPILQKALNFVRMGDRFIVESIDRLGRNYNEVIHTVNYLKDKEVQLMITSLPMMNEVIGNPLLDKFMKDLIIQILAMVSEQERNESKRRQAQGIQVAKEKGVYKGRPLLYSPNAKDPQKRVIYHRVVEMLEEGQAISKIAKEVNITRQTVYRIKHDNG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Recombination/dna
molecule keywords 31-MER
publication title Architecture of a serine recombinase-DNA regulatory complex.
pubmed doi rcsb
source organism Staphylococcus aureus
total genus 67
structure length 193
sequence length 200
chains with identical sequence D, E, F
ec nomenclature
pdb deposition date 2007-08-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00239 Resolvase Resolvase, N terminal domain
C PF02796 HTH_7 Helix-turn-helix domain of resolvase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.60 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Homeodomain-like 2r0qC02
3.40.50.1390 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 2r0qC01
1MNMC 2VUMJ 3HBLA 3QPSA 3SFIA 3CMYA 2CQQA 2OF7A 5IYDJ 5IP6A 4A3EJ 1JT0A 5JLWA 1A5JA 3BG3A 2MHCA 2LLKA 3G13A 1F36A 2LR8A 1ENHA 5DS9A 4Y52J 2WAQN 5M5XJ 5K7HA 1JUPA 4A3LJ 1BW6A 2IEKA 1D5YA 4RBOA 3MN2A 3H0GJ 1ETKA 2W48A 3I4MJ 5F0HA 1HDDC 5C35A 2XPVA 3S17J 1ZQ3P 2LTPA 4DW6A 4ABZA 4V2FA 4XICA 1X2NA 5C31A 1NK3P 1ZR2A 1P7JA 1XC5A 1T33A 2E2IJ 5F08A 2COBA 2EH3A 3MVPA 5EZHA 4C2MJ 2O8KA 2DMUA 3B6AA 1WI3A 1ZGWA 3A03A 3PKZA 2MW8A 3JRCA 4XK4A 1Y1WJ 9ANTA 2KT0A 4BY1J 1RR7A 1OFCX 1JTYA 4BQQA 4MFDA 2FJ1A 1K83J 3BVPA 1FIPA 4G12A 2L7FP 4MIMA 2X9DA 2E1OA 1JKOC 3LOCA 5EGOB 1MBHA 1DU0A 2QF7A 3OIOA 4FISA 1ETWA 5J1UA 2NVTJ 2GM4A 2NVQJ 2K40A 1IDYA 1WH5A 2VKEA 4UUTA 3W6VA 1ETYA 1QRYA 4C3IJ 1RESA 3FK6A 1LFUP 2HOTA 3Q0UA 3S1NJ 1ZK8A 1X2MA 3IH2A 3NARA 1TWAJ 1JJ6C 3HKZN 1QVUA 1Y1VJ 3RZDJ 2ECBA 2YS9A 2GBYA 1IUFA 2DA6A 2H8RA 3TW7A 3HGGA 3JRGA 1WCMJ 2FX0A 4I76A 1PUFA 3NAUA 2TCTA 3IV5A 2EZKA 1LFBA 2QCOA 5FKLA 3LSJA 5EGOA 1E3OC 1Z0XA 2DMPA 1ETXA 3GTQJ 2M0CA 1RKWA 3S16J 3M4OJ 5M3MJ 4BBSJ 1AU7A 3QPLA 2FD5A 3RQIA 5EF6A 2E2HJ 5F0FA 1GDTA 3GTJJ 2DMNA 2XPWA 3BR3A 1B72B 1R9TJ 2HQ5A 3A01B 2DMQA 3UJ3X 4JX5A 4AC0A 4QSHA 3BTJA 1MH4A 2WB1N 5IP7J 1U8BA 5IOZA 1JUSA 4GFBA 5K7FA 2ECCA 5F1JA 1BL0A 5FLMJ 5F0CA 2L9RA 4NDLA 1EF4A 3VPRA 5E3OA 1WGXA 1IGNA 3Q0WA 2O9LA 2M34A 5FKOA 3JRDA 1Q1VA 4D5CA 3BTIA 3BR0A 1P7IA 4HNVA 5E3NA 1DU6A 3BT9A 2K9NA 1JTXA 2NOGA 5EDNA 2LVSA 3JRFA 4XRSA 5FKNA 5BNGA 5EEAA 1JT6A 4DZJA 1JKPC 1B72A 1H89C 1AHDP 3A01A 1W0UA 2ME6A 5C3EJ 3LHFA 3BG5A 4B3AA 3ILXA 5K7ZA 2CUFA 1HLVA 1GVDA 4B1RA 2LFBA 1T56A 3LSRA 3PO3J 2TRTA 1OCPA 2MGQA 5GPAA 1HCRA 5GP9A 1TWHJ 3FK7A 5IPAA 3PO2J 1UHSA 2JA7J 3HEFA 1ETQA 3JRHA 5E3LA 1TWFJ 1GUUA 4DYCA 1BA5A 2ME0A 2HOAA 1AKHB 4W97A 2RSLA 2KDZA 4A93J 4JP0A 4X6AJ 5IYBJ 2JN6A 1MSFC 2FQ4A 2DN0A 1MH3A 4CYCB 3FIWA 2XB5A 3GTMJ 5E3MA 4M3FA 3JR9A 2X48A 1WH7A 2JMWA 4J19A 3CCYA 1VNDA 1PUFB 1GV2A 3JRIA 5C44J 4UUSB 4BBRJ 1MBGA 3HOXJ 3M3YJ 2M9HA 2GM5A 3ZQIA 3S1RJ 1WPKA 2CRGA 2P81A 2R7ZJ 4BY7J 3WHCA 2Y30A 1AKHA 1I3QJ 2JA5J 2VKVA 3E7LA 3S1QJ 2XGDA 5IOYA 5F04A 5FKKA 2EQRA 1MBKA 2L7ZA 2JA8J 5J3LA 3UKGA 1H88C 2D5VA 4A3IJ 1IDZA 4CYCA 2NVYJ 3A02A 2M2EA 3CQZJ 4QTRA 2R5YA 3SJMA 4QIWN 1RPWA 2HXOA 2Y2ZA 4FE7A 4A3JJ 3G1LA 1GHTA 4A3DJ 2DA5A 1VI0A 1IC8A 4UUSA 1W0TA 2G0EA 3S14J 2R93J 4L5EA 1JKRC 3G1MA 1ETVA 1Z77A 1VFCA 2DJNA 2L7MP 3BTCA 3ZQFA 4BXXJ 2OPTA 1BW5A 1U9OA 1FJLA 2XB0X 2M8GX 2ELKA 5EZGA 3BQZA 4DZPA 2CUEA 2AHQA 4MFEA 1HOMA 1FIAA 3OOUA 4D5FA 1ITYA 4JX6A 1I50J 4M6VA 2EBIA 2X6OA 4A3KJ 4A3GJ 4S0HB 3S1MJ 2R5ZB 3TEDA 4D7MA 2LK2A 3BTLA 1F43A 2JJ7A 1G2HA 5C4JJ 4JYKA 3LNQA 2MSYA 4EEFG 3D1NI 3C2BA 4XRMA 1A6IA 1B8IA 2HDDA 2YU9J 2LY9A 1TC3C 1CQTA 2JA6J 3DEWA 1QPIA 3S2DJ 3S2HJ 2Y31A 4M3DA 1LE8B 4IHWA 2XRLA 5M3FJ 1YRNA 1JGGA 5DTDA 2YUSA 1JUMA 2DA4A 3DCFA 3GUVA 2RAEA 4FCYA 4I6ZA 4B4CA 2VI6A 5IYCJ 3ZQCA 2IAIA 2R92J 3Q0VA 2H1KA 1QVTA 5C4XJ 3RKQA 4IHYA 5M5YJ 4XIDA 5C32A 3JRBA 3IH3A 4V2GA 4FTHA 5J1RA 3HGYA 4M3BA 3SDGA 5FLVA 3Q3SA 5GPCA 4IHXA 4X1EA 2R5ZA 3GTOJ 5J1YA 4D7NA 1RKTA 1APLC 2Y9ZA 2ID3A 1SFOJ 2NS8A 4A3FJ 3IH4A 2LP0A 2ID6A 1TWCJ 1BJZA 1IG7A 4BKXA 2EZHA 2EZLA 3G1OA 1FTZA 4A3MJ 2K9QA 1LE8A 3H3VK 1MBJA 3CDLA 4C3HJ 1JKQC 1IJWC 5HODA 3HB9A 2HI3A 3BQYA 3LHKA 1MSEC 4M3EA 1ZTRA 2I10A 2IBDA 3LSPA 3ZQHA 2R5YB 1U78A 2DA7A 1MBFA 2CQXA 4C3JJ 2DMTA 3WHBA 5FKMA 3JRAA 5M5WJ 4A3CJ 3TP3A 1I6HJ 1HF0A 3PM1A 2HYJA 3BG9A 2PMZN 4AUXA 4MLOA 3GTGJ 3O8HA 1ETOA 3GTPJ 2E2JJ 2CU7A 2E19A 3MKLA 1OCTC 2DA2A 2XSDC 4W1UA 2CJJA 4AYBN 2B63J 2WV1A 3GBGA 1S7EA 2Y0SN 2VPRA 3BR1A 5EYRA 2XGEA 2GLOA 1XG1A 3S15J 3K2AA 2L0KA 1ORKA 4JX4A 3JREA 3HOWJ 3HOYJ 5F27A 3K7AJ 1FTTA 3BR6A 3L1PA 1IRZA 3BR5A 3HDDA 3ZOBA 3HOUJ 2HOSA 1VF9A 4IHVA 5C34B 2DA3A 4A69C 2XPUA 2JWTA 4M3GA 4IEJA 2N8GA 1ZR4A 1TWGJ 2XGCA 2HXIA 1B8IB 5FJ8J 3HM5A 5EG0B 1YRNB 1HDPA 3OSGA 1MBEA 5JLXA 2JK3A 3I4NJ 1X58A 2K9SA 2EZIA 2DTZA 3BR2A 3GTKJ 4Y7NJ 3LSGA 4RDUA 4DYRA 1GV5A 3HOVJ 1ZKGA 2NS7A 1SANA 3HOZJ 3ZQLA 2NVXJ 3GTLJ 3TW6A 1RETA 1U9NA 2ZB9A 1UG2A 2DA1A 1XS9A 2R0QC 1NTCA 2AO9A 1UMQA 3QQAA 5IP9J 1K61A 1JJ8C 1O4XA 2LD5A 5EG0A 1POGA 3F0CA 3FKIJ 1H8AC 1NK2P 4A3BJ 3B6CA 3RZOJ 4DYQA 3OSFA 3O8GA 4MO7A 2O7OA 4XRSG 1GT0C 1IV6A 1FEXA 2Y9YA 2LKXA 1OJLA 2MG4A 1HX7A 4LOCA 3TP0A 4FE4A 3FISA 3ZQGA
chains in the Genus database with same CATH superfamily
4X24A 1YGPA 2B83A 1D1SA 1Z2EA 1OVMA 3PXBA 3QI7A 1IB6A 2HL6A 2QK4A 2NAFA 4FXOA 3B53X 4WINA 1IXSB 3OTWA 4LJSA 5F77A 3F7MA 2CJWA 2XAHA 4LY9A 1KI4A 1QKIA 2Q9CA 3FDYA 3G2KA 1MZVA 4Q05A 2YBEA 3BAFA 4XK4A 5SZJA 1XWFA 2X0IA 3Q2IA 3WIUA 1JEQA 2COUA 2PH7A 5AUOB 1WJDA 2RHDA 3PR2B 3R6LA 5A5DA 1KQ9A 3ZR8X 1DJNA 4AKIA 1IDYA 1A5BB 3WMWA 2W6ID 3HA5A 3F8CA 1Q0UA 3LPLA 3PNKA 3DGFC 1N2SA 1DU4A 1QVUA 3CE6A 3U61B 2B69A 1Q92A 4B48A 1IUFA 2PZJA 1TQHA 1EM8A 3EAFA 3IUJA 4EO7A 2I54A 4FEAA 1XGNA 5DSZA 1JG2A 3I04M 4URWR 1J09A 2XF7A 2O9JA 1LF0A 4RLQA 3Q2OA 2CMDA 3N58A 1W4MA 2YFYA 1AMNA 2WU1A 1CC1S 4GDMA 4TT3D 3SVTA 1S5LC 4RIFA 5KQMA 4NDLA 1W4CA 3CS3A 5F98A 1I6XA 2EWNA 3L7JA 4P7BA 4RJIA 3DKIA 2DOFA 2DK5A 2RE8A 3FI9A 1GWNA 3GA0A 2QLFA 3K0LA 4LKRA 2XDQA 4BEWA 4A8TA 4LD5A 2I4NA 2LD4A 4JJFA 5HK8A 2PRSA 5BMVA 3TTUA 5DYTA 4JI4B 4NU8X 4OXQA 2OENG 2QTFA 5TJHA 1ADYA 1RJEA 1FFWA 4OQFA 1LPPA 1M34E 1PFKA 3RTGA 3RGGA 4LDAA 4B73A 5E3MA 1JU9A 5DEIA 3SDSA 1G8YA 1W4LA 3FWEA 4QHTA 3ZZTA 1W6RA 2FZ5A 1T9ZA 3Q1LA 3F2IA 2G67A 2ICAA 3RYFA 1XQXA 3FCUB 3WWEA 3ZN2A 5THXA 4BUZA 1UG0A 5DBOA 2DHQA 1IDZA 1VPLA 1PG2A 4G1BA 4WL0A 2OFXA 3ICOA 1Y4AE 4HNAB 4AZWA 3JAMZ 4KQIA 4YCBA 3M3PA 5LZ8A 5TE9A 2XYHA 2ZS8A 2LVBA 3UAOA 2X40A 5C7OO 1NZDA 2O57A 4ZI7A 4WKBA 3B3JA 2POCA 4PZDA 1HE8B 4C0XA 4PYIA 4W5TA 3TMOA 3EN0A 3EY9A 4IFIA 1X86B 2OUIA 1N8NA 2WAFA 3IQDB 1EAYA 3OEEA 2FOKA 1YVUA 4DIQA 4IJVA 4MUGA 4JENA 1E8DA 4RS8A 1O95D 2Y31A 1AT1A 5CX1B 3D4OA 2A1TS 3FWKA 2DA4A 5FBVB 2EGUA 4WASA 3V9PA 2OOSA 2ZBPA 1QANA 4FCCA 3QODA 1E3MA 4FTHA 4IEFB 1T24A 3VC7A 3GYBA 1GTMA 2ZT8A 4X45A 2XAGA 4YI5A 3MQ0A 4OIOF 2XNCA 2UVPA 1GCOA 1X7XB 2IC5A 2EFOA 3HUTA 3WZMA 3UHJA 1II9A 3ZEIA 1EK5A 2EFGA 5FROA 5B57C 3NWSA 1QB7A 2ZIVB 1HEIA 3KP1A 3RKXA 4DN6A 2QRNA 3U3XA 2ZBRA 1Y8RB 2M9MA 4G0YA 2FPIB 4IG4A 1TW3A 2WWYA 1S7CA 3DE3X 1CDEA 2HHJA 2Q6TA 4AO7A 2QLJA 4R40A 3UK7A 2P8TA 1CJMA 3SC6A 3KALA 1E3QA 1IEQA 3B3AA 3L1PA 4F3QA 3M8KA 2FDRA 1WXGA 4XH9B 4GBGA 4TTVA 4ENJA 2F43B 1HKHA 4P82A 5DGDA 5LZ9A 2YHSA 3UT0A 4JYPA 4DRZA 3O8QA 1JJIA 3AB3A 3G8BA 4ENPA 3RUAA 4NOJA 4AKSA 4IQFA 1GY8A 2DP4E 3WTTC 4JBGA 3RC7A 1B1CA 3HLKA 3ER9A 1NJ2A 3NUZA 5ESRA 4OHOA 4AD8A 4RA6A 3SPXA 4JVLA 4PWZA 2RHLA 2VJMB 4Y9UA 2G36A 5SYAA 3KCCA 4HEA1 3RTDA 1G20E 4HYQA 3ANSA 4F3YA 1K06A 1SQ5A 2JCVA 2PTGA 1VIYA 3LQRA 2O1XA 4JX9A 1ENHA 3FHOA 4I7EA 5JS2A 1RNLA 4EH1A 4US2R 5IAKA 4AIKA 2GM3A 3RKWA 3WSWA 4J0GA 1JPNA 2OHHA 4IRMA 1HM5A 3WMXA 5BO5A 2D1HA 1SR8A 3FNGA 3INTA 1EB9A 2JKYA 2PZBA 3UICA 3F6VA 2YJGA 4E7SA 1M34A 4B75A 3A0RB 4JI1B 1SMKA 1W4BA 2WD8A 4TLAA 5KTYA 3FPGA 1UJ2A 2X0EA 1YA8A 3AOEA 2H1SA 5K6RA 1BYIA 1SAUA 2J5KA 3NARA 3OPYA 5LDDC 3NV9A 4OMUA 3QPDA 1YB5A 4MR8B 1R0LA 4PFQA 2RQPA 1SXJA 1ULHA 5JI2E 4OGFA 2H54A 4DNCA 1X7GA 1R9TJ 4OM8A 5B7QA 4Z4EA 1MB0A 3LM8A 2MIIA 4GF5A 2L54A 4REQB 2FR8C 4AJHA 1DCKA 3M6FA 3TQOA 2BEWB 4OYHA 4EG0A 3CVXA 2P6SA 4ZOLB 4WUTA 5JEEA 4IBOA 1JTXA 4WXYB 1VLZA 3WGLA 1SFEA 5FKNA 2Z04A 1JT6A 3PU6A 4MGHA 3ZWPA 1WZUA 5FI0B 1XYVA 2HKXA 3TCXB 2O6HA 2AYYA 2YR2A 5IAAA 4CEIA 2GT1A 5CAEB 1Y42X 1JAZA 4B2YA 1O4VA 3VC3A 1DDOA 1IN8A 2AXEA 4X3CA 1AQ6A 4TV8B 2MMCA 2YS7A 4EQ6A 3K4LA 1QRTA 3KFXA 4IIHA 4OH7A 1ZEJA 1E2IA 4YH1A 1T2KA 1Y8ZA 1RDFA 4J3JA 2ZDQA 3EPPA 3FMPB 1WHSA 2JGIA 3VB2A 3ZS9A 3JSXA 2RGEA 5AVUA 5EJCA 5IOYA 1NYRA 1PK8A 4YQZA 4XI9A 3NHWA 2DI3A 3I61A 5B7GA 2Y2ZA 4M0EA 4LXHA 3GDGA 5LQUA 2PBZA 2QMQA 2BPOA 5C7LO 2VQEB 1XHFA 1KA9H 4QD3A 2H1CA 5GGYA 3MGAA 1DELA 2PVSA 3AZOA 3U13A 3P20A 2HFHA 1M67A 1MOQA 3AG6A 4BGVA 1EA3A 2J7PA 2X3FA 2IDJA 2W2OA 3OD1A 3ZWMA 4NFSA 3QVTA 4ML3A 3AJ9A 1PVDA 4N6GA 2FSPA 3RYCB 3TTXA 5JSZB 4CFSA 2PS0A 3VBEA 5BXQC 2VKQA 4JQSA 3PUFA 3RVMA 1L5WA 2IEZA 3HIFA 1H1LA 2H8KA 4D9EA 4EY7A 3VBCA 4ZDLA 1EZ1A 2HBQA 3RIYA 1ILEA 5FFXA 3UMYA 1DKUA 1T0FC 2Q6IA 1WCV1 1FUYB 4XNFA 5FB3A 4D81A 3BWXA 5H3LA 4W9RA 3A1DA 3WLLA 3HADA 1SRQA 1YRQA 1FDOA 4I3GA 2CF5A 5JPCA 3PT9A 1AD2A 2VR1A 1KEWA 3EGCA 2FA5A 2O19A 1XG1A 3PIOF 2WTEA 2ZRGA 1YJNI 1I5EA 2B4AA 3OYNA 3PUWA 2V6EA 5TQ2A 2NOAA 4U7JA 1RRVA 1BBYA 2QTAA 1YIOA 2PKQP 3OT5A 4B79A 2VDOB 1LPQA 3QVGA 1Z0UA 2GHIA 3CWQA 4FMDF 2YIDA 2NVXJ 2CHQA 1OOEA 1FX7A 4E1AA 5AM0A 4IDEA 3FY4A 4WY8A 1W88A 3P9ZA 1QBJA 2PSSA 4HXEB 3D6NB 1H3FA 3NYQA 3HVHA 4TLEA 5GADl 1BVYF 4FYKA 4TM7A 3N2KA 2EJBA 1BWPA 4GP6A 3G1WA 4AP5A 2X2FA 2X14A 1L4EA 3VPSA 4QYIA 1HX7A 4MQ9F 1E6KA 2B9VA 2VIXA 1SC3A 4IXMA 3LGSA 2FEOA 3WMRA 4ZDKA 4U2EA 4JY7A 1SOAA 4DMKA 2VCHA 2OZLA 4IIJB 1VZ0A 4MO2A 3SDBA 1ZN8A 4KRYA 1Z26A 4XVHA 3H5VA 4IOCF 4AX4A 1LSUA 1E66A 1Z22A 2Z98A 1CJUC 4IM7A 2EINH 4IGEA 1OLUA 3F6YA 1IN5A 1MNAA 1KJIA 3EYWA 1I9GA 3FRIA 3VU3A 3L9WA 5EA2A 3NHZA 3AV3A 1W0JD 4A3SA 2PZEA 2XB9A 2P9EA 3QE9Y 1GGHA 2WLTA 1ZK8A 1IIBA 2H08A 3LXMA 3WLMA 1WSWA 1Q0LA 3E0XA 1J0AA 1PBTA 4G4GA 4Y6RA 4QTXA 4AMGA 3LA8A 1ZCJA 4Z9FA 3RC9A 4JZYA 4D96A 3HXTA 4XWAA 4DNOA 3DJYA 5FI3A 1BDBA 1CQJB 1V1RA 3KPUA 4KV9A 5D5QA 3PYLA 1BN6A 1THGA 2JIDA 3TO5A 1OYWA 1RWWA 5C8YF 1K7EB 1KK1A 3OTIA 1DBSA 3WB0A 1N92A 2G77B 1ORTA 4GLBA 4PC6A 2WSBA 4CMJA 4DBLC 3LAJA 4AO8A 4B6OA 1XKLA 4RC9A 3JRFA 2JFWA 2QQ0A 4LTDA 1QHIA 2F8SA 3DEFA 3HHHA 4UM9D 2AOTA 2IHVA 4CCLA 3EASA 1YW7A 1DFGA 1IE3A 2H3HA 4DY6A 2P11A 3F5SA 4DZZA 2WAMA 3CKKA 5CG1A 1Z3IX 1I4WA 4JJGA 3WRWA 4PZJA 2PH1A 3WE2A 5DGCA 5DI3A 2VYVD 3TI7A 4FJ1A 1DOZA 5C51B 5CD1A 4PX5A 3MILA 3MELA 3SZLA 3LRTA 4RY0A 3B9QA 3GT0A 2VT3A 4I99C 1NVAA 5F78A 1IY8A 4Q3CA 3C7DB 2MYSA 3OOEA 5JR3A 4DEXA 2BFWA 1EEXB 4FB5A 1VL1A 4GQAA 4HATA 3WGHA 2FJPA 3VO9A 1TO2E 1JKRC 1ZMBA 4GMDA 1WCWA 3OZCA 3EVDA 2ERXA 3AIMA 4FNMA 2JGJA 3JSAA 3BQZA 2G6BA 4KDEA 3RASA 2B8TA 2PWZA 2BEOA 2XVYA 2MC4A 1G7TA 2A6PA 4I55B 4JSRA 2B21A 1E6WA 5BPFA 3AZQA 2QLNA 5KDLA 5K20A 1K4YA 3WAGA 4ZV4A 1BI2A 3K4BA 3F5FA 2N42A 4QZVA 5BV1A 1THTA 1QVTA 3W6OA 4N9IA 3B5JA 2CXXA 5TMEA 3CMAI 4G5SA 3BTVA 5KSWB 1PLLA 3FPHA 3ZHRA 3OKPA 4LITA 3B13B 4Z4HA 2JJMA 1LDDA 2W2PA 1NJGA 3ONNA 5T7BA 3EFOA 1A7KA 4CMBA 3FKJA 1TPYA 1D1TA 3D5QA 4NENB 2LR0A 2OV6A 1SULA 3R9XA 1ZFNA 2VZEA 3TX6A 1TD1A 4ZRDA 3D64A 4IOKA 4DWVA 2QKYA 2O5RA 1OT5A 2VHXA 1SUBA 2IY8A 1FNCA 4IOMA 1FFXA 4G0OA 5FL7A 1Y7HA 1XDWA 2AE1A 1VRVA 3GEMA 1KDOA 4MHGA 1ACJA 4N0PA 2WHPA 4BMVA 4O33A 3NBMA 4CM1A 4A69C 2PS1A 4TROA 3I5XA 1H66A 3TLGA 3AUTA 3CCJI 2QP9X 2EBUA 2JL1A 4JKIA 4LRXA 3D8SA 4U4AA 3NONA 1KJJA 1NI3A 4KPFC 1NNSA 3WGTA 5BORA 1FB5A 1ZINA 2LF7A 1T9GS 5TEVA 2ZIZA 4CLHA 3R0IA 1BIFA 4A3BJ 4DUPA 2JFVA 3GFPA 2ILVA 4GX2A 3D8TA 3OY9A 1AB6A 5IDWA 2M7AA 4BJ3A 5J58A 2HMTA 2ZBQA 2PT6A 1TQ2A 2JBWA 2I4OA 2H2IA 4PLYA 4QX6A 1E94E 4OIQF 4D4HA 4N7RA 3QKSB 5TIIA 1EJ6A 2FPPA 2X1MA 4LG3A 3CA8A 4ND6A 3OCWA 4BEBA 3LC0A 3TQNA 2HUNA 3G68A 1XC5A 4TXMA 4EY4A 2C7BA 5HDNA 5FV4A 4D97A 2XGGA 2PGAA 4DYVA 1CNMA 3EDYA 1TYEB 1YITI 4PZYA 5HKLA 2IUYA 1ICEA 4C3VA 4N0MA 5FTLA 1FQWA 4I4IA 4MS4A 4BAZA 2R00A 5JECA 3OQPA 4H6VA 3UOGA 3KTDA 1N3YA 1WUTA 5EKXA 4XR4A 3LLVA 4PDKA 3CUWA 4R83A 1LK7A 1YMQA 5FTKA 4AKGA 3RRJA 4I98B 3TNDA 1JW9B 4J16C 3KQOA 1OCEA 3EZ6A 3QU5A 4QSHA 2PL9A 1KFEB 4GI5A 1YQQA 1OPXA 2H0QA 1Z2AA 3LO5A 3EQ8A 2FZCA 1UIRA 4MUIA 3Q0WA 5HSGA 1TCVA 5F5LA 5HM6A 1OU0A 3TLEA 5FOWA 4KWIA 3UAWA 3MRSA 1JQJC 3RU7A 1MG0A 3Q11A 5JD5A 3REFA 2MSKA 2HR3A 4CPDA 3SOZA 4Q7MB 4F5EA 3KHSA 2FF7A 1X3ZB 5BQTA 5BR8B 3DAPA 1EK0A 4GYGA 3ZWVA 4F71A 2I7DA 2QYTA 2BMWA 4LRSB 4P4GA 4YRJA 5LR6A 1YL7A 3EUFA 2SECE 1U8AA 4X60A 4AMVA 5HS8A 1FX0A 1MH3A 3NXKA 1LFDB 1W0CA 1SCQA 3T4UA 2V55B 4TV9A 3OP1A 3VQTA 1F3LA 5DWDA 2Q0SA 2XMQA 3OIVA 2MSWA 3DM5A 2Q6LA 4NSNA 5I9TA 4TMVA 2XE6A 5AJZA 2ZI4A 2XGOA 1T0BA 1UK7A 3M1IA 1BVRA 1UKYA 2G1PA 2JCXA 2CL6X 3BRWD 3S2WA 3KQLA 3Q6IA 3KKKA 1L8LA 3DMGA 1BKYA 2NXCA 2VP9A 4MFEA 1CR6A 4C4TA 1OREA 1OCRH 4FYPA 3ZZMA 2W43A 3HJHA 1A6IA 2GVDC 3RAJA 5KC9A 4EQZA 5IKEA 4C2BA 4M0FA 1RCTE 1A31A 2I9PA 3EDQA 3ZZUA 3QOEA 2BGNA 4OA8A 3ILVA 2J4CA 4XONA 5DH9A 2VE9A 2O6GE 1QQ6A 2NTNA 2BJVA 3F9CA 4BE7B 2PD6A 2CCGA 1J2RA 3PVSA 4PPNA 2OTJI 4MLPA 2VSYA 3DMPA 2Q1WA 3ZUPA 5G3YA 1G8KA 2I2FA 4X1IA 1W7PB 3K1JA 4M3EA 1JU4A 5ALUA 3RKYA 3HL4A 1U7UA 2JATA 3SEAA 4BV8A 3VDRA 3OYJA 4YAEA 5LP6A 4ZU6X 4U6QA 3UBTA 2Q3HA 5FKJA 4LYEA 1NPTO 4UUVA 3BHMA 1E4YA 5TLSA 1NT2A 3N59A 5LOVF 3DBHB 2ECKA 3DT6A 2PX8A 1VKOA 3P9IA 1FLNA 1Z2DA 3CHYA 4WZ6A 4HEA6 2L7KA 1HURA 2JF0A 1LNQA 2NUAB 4Y15A 1BYUA 4YRSA 1CUAA 3RKSA 1MJFA 3MJSA 3AF5A 2J6BA 4O5AA 3ZE7A 4IHJF 4QWQA 4U6NA 2IZ7A 1JVNA 1TM2A 3EH2A 4DG9A 4K6KA 4C08A 1OWNA 2CWWA 4BQAA 4RQTA 4PHTA 4ERXA 4D44A 1I0LA 3F67A 1FSSA 4Z9XA 4OREX 3J80K 4MV8A 3ETCA 3RS8A 1SHLA 4PQEA 2VNJA 4BRZA 2GPYA 1US8A 3I5YA 2ACWA 4K5QA 3U6KA 2N46A 4OMZA 2NQ2C 3ICVA 1G3RA 3JPYA 3AX6A 3H97A 3AEKA 3GCXA 5C31A 2VDJA 2CXRA 5EE5B 5BW4A 3A0HC 4LNUB 3GA5A 4EEKA 1S29A 3PFWO 2D2EA 4URFA 1ELOA 3K71B 3C45A 4FZVA 1TNSA 1TAHA 4R0MA 1QP0A 4DHEA 4R2WA 3K92A 1ZCFA 3I5UA 1XWIA 2Y1WA 1ID1A 2VBCA 1T8IA 1Y1VJ 5C9ZA 2WSSD 1O0CA 3I0TA 4KDFA 3Q8MA 1R1VA 5LA6A 1Y37A 4G07A 5E6RA 3NTVA 1CJSA 2AOWA 4II7A 4L76A 2VNSA 3LDGA 5KIAA 3BC1A 2Q4RA 5T67A 3GH3A 4JGGA 2NUTB 1AA6A 3OT1A 3ZZ0A 5IP7J 4CMIA 4G7OF 1JI3A 3NZEA 2HCTA 4ZI5A 3NRCA 5H82A 4M37A 3PEVA 6PFKA 5BNGA 2H2GA 1XJWA 4XB1A 4IIUA 1DPRA 2LFBA 4QLOA 2EW2A 5L4SA 5COAA 3GW8A 13PKA 3HO1A 4M76B 5CYPA 1T5LA 2EV5A 1BEZA 3U31A 1OIVA 4P32A 3BXHA 5IYBJ 3GNTA 3IUOA 3BIWA 3EHEA 1A4UA 4HBGA 4M9UA 5D1HA 2QP3A 1OLXA 3JR9A 5F2EA 2ZT5A 1JA9A 3H9QA 2X1VA 4W9MC 4C89A 4QASA 4G1MB 3VYUB 1HC7A 2XV1A 5FTNA 3A9TA 3LD9A 1P1IA 2RHGB 3MTBA 3CH4B 3W9YA 3O8RA 3F8WA 1MZBA 4DQ2A 1ZUNB 4DM3A 4J0EA 1NNEA 3TJMA 4I4TF 2Z3VA 4XWWA 1TIKA 5AUQA 3EQZA 1KEEA 3IUQA 3RW9A 4AZTA 2KHZA 4V0ME 2C1ZA 3RI4A 1P4GA 4YBZA 5KMGB 2XHZA 2FE4A 4C14A 2ZANA 1FIAA 1M2OA 1B7GO 5DCFA 1R10A 2FFJA 2XOEA 3EYAA 2VTBA 4NBTA 3OFSA 2XXJA 2FEZA 1RJGA 3ITDA 2EV6A 3K9HA 3TZBA 4CF3A 1RBMA 1T6YA 1P62B 4DSTA 3AO0B 2GETA 2Z6UA 3E81A 3QPUA 1W9HA 2I1LA 3RRNA 1GQRA 4K9SA 1KQOA 2ZQYA 2VDPB 5DHTA 5EN4A 1R8SA 3Q9UA 1AKVA 1ND6A 3Q3SA 1CRZA 3TKAA 4C87A 2XIJA 4TWBA 3MBKA 3LSPA 3T0YA 2OTCA 1QV9A 3K0FA 4PSAA 3WLSA 1CCWA 1FPMA 2M4GA 1EBUA 5LP1A 4P3OA 4C7OB 2HLNA 3IP6A 3O4GA 2O4UX 1E7QA 3P96A 2PZ8A 4MEAA 1ML4A 4F06A 3A1UA 1EKEA 3FOEC 2VS1A 1RYDA 1T9CA 4XUCA 2DFHA 3EXG2 4PPFA 3IQZA 3T8RA 3B12A 1LBIA 1L5MA 2IYZA 1S02A 1UODA 4JJZA 1NM5C 4HADA 1VQOI 4MI6A 3FXLA 4KIFA 3NH9A 4JBXA 1KOGA 4MTLA 1UMDB 2JK3A 3LJKA 4HDNB 1UPAA 3W6PA 4ZO7A 1BI0A 3EFEA 3VH1A 4DAOA 4EYQA 4NBVA 1CSEE 3H5TA 4WBSA 1U9NA 1SEPA 3PDHA 4HP8A 4OX9Y 2N1BA 3VU8A 1XZEA 3QJYA 4UHCA 3QQAA 4G84A 1AK1A 2Y9MB 3A9UA 3P5SA 2H2AA 4FMPA 1XQ6A 4JLMA 3NEAA 3C1TA 1X7HA 4IJMA 1RYYA 3N39C 1TQMA 2RFLA 3S3TA 4GYJA 1KZ9A 3QSYA 1PO7A 2OXTA 2BF7A 3HC7A 2ZXHA 1H85A 2Y4NA 2FA9A 3DVAA 3O7WA 2VP2A 4MW6A 1UBGA 4HMPA 1U28A 4KXXA 4KR7A 3ZY6A 3WHLA 1PL6A 4NE7A 4UMDA 2ACEA 1P60A 2IZ6A 4I9UA 1A1SA 3Q10A 1RFLA 3ZJ5A 3S28A 2QRPA 3CZQA 1QIMA 1FS6A 1MF7A 2V9KA 3ZXXA 2X9DA 2XCTB 3L04A 4NL4H 4CZ2A 4EMUA 5JVGF 3KYJB 1NN5A 3LPNA 4CCJA 5SZIA 3O82A 3WLAA 5DNYB 1NXOA 4TTQA 5K0ZA 3HN7A 5F52A 3K5WA 4GX1A 121PA 5JBQA 1GUYA 2XPCA 3BPXA 1JHOA 1LSOA 3OYLA 5FEUA 2AN4A 1Z4LA 2WB1N 1T9GR 2QN7A 4JP1A 2UV1A 2YY6A 4OGGA 1GRCA 4Q66C 4M8KA 3SYRA 2BW3B 5COQA 5E3NA 1NV9A 5ELMA 3CLUD 3HJUA 4D3ZA 4TRJA 1F5NA 3AUUA 1R0CA 2FXAA 2RNGA 1KNQA 2QQAA 1L1QA 2FFQA 3HZOA 4MUJA 4ER6A 3E7WA 3R5JA 3BJMA 3DWIA 1BWQA 1PTKA 1Y98A 3QELA 1XD7A 3VR6D 4JT8A 1SUFA 1ODKA 2C77A 5L45A 2WJIA 4C01A 2BGIA 4JJKA 1PR4A 4BDSA 3WHKA 3EYYA 3HI6A 3HABA 3H0KA 4U0WA 3AEQA 3L06A 2QPTA 3GLUA 4MEXF 3H4VA 4P7KA 4G6QA 1YAJA 2WU3A 3WLOA 5HILA 3P52A 3UKGA 1H88C 3JASB 3NDBB 2AA3A 1DO8A 3CUQB 4KJZA 5ICMA 1Z06A 4XLCA 2C4KA 2RVCA 5H6QA 1Z91A 4MTDA 3BUSA 3IAS2 4HMOA 2KP6A 4F2WA 2BBWA 1C0PA 2O2SA 3WYDA 1DC7A 3FZEA 4ACBA 3I0NA 1VJDA 4IUCS 4G0QA 4AJLA 2OWEA 4D8VA 1NFQA 1CS4C 4MQMA 3F96A 1UDRA 3VC1A 4F1WA 5DW3A 3W2WA 4J03A 4NCJA 3JQFC 4AG3A 5ELLA 5CLSA 1K88A 4BGIA 1N77A 3RT7A 1PV4A 5M5YJ 3A06A 3TDZC 2YNMC 3EXFB 1NBWB 3AEXA 3QTBA 1F38A 1ZH8A 5K3SA 1VG0B 3FM3A 1YZQA 2J0VA 4D7AA 3OLQA 3O8BA 2F67A 1SD6A 2V3VA 4A7PA 1DDIA 3E03A 4H6WA 5JDIC 5A4DA 4Z6KA 1RI5A 2QP4A 2Z2ZA 3GDHA 1VGRA 1ZRCA 1KYYA 2BAGA 1VSQA 1BMTA 2ESHA 3CCMI 5FI1B 1ZX1A 1X77A 2DFKB 2O3TA 2P6PA 3FBGA 3WJ2A 1XUOA 3KOUA 4E6EA 4IQ8A 3L8YA 2GN1A 1AUQA 5E4TA 4J01A 1YDFA 4N47A 3BWCA 4ZYEA 3K9NA 8ATCA 4Q12A 1GZ4A 1DMRA 1QH1A 2E82A 5HYVA 3ZWWA 2XZPA 3S3OA 3EQ6A 2HH9A 3ZHTA 1FSEA 2FKNA 5F73A 4LG1A 5HZGA 1FTYA 1U0TA 1X2EA 4C4YA 2ZT7A 2XITA 3FFTA 5G4KA 4BU1A 4FVTA 3WKDA 2B8NA 1GN8A 3UJNA 1G21E 1PP8F 4CN8A 2GFHA 5KJFA 1OTYA 2MU1A 1G6NA 1NG1A 2WFMA 1OLSB 2ZITA 5E9WA 1L5NA 4EHAA 2BHYA 1Z34A 4EPYA 1PWXA 2ZM6B 3R2JA 3MPOA 3U4QB 1CBUA 4CG2A 4NICA 3EWSA 2PKWA 5JLWA 1SC7A 1RYBA 3MOSA 3WYFA 2IDZA 2BKUA 1X1CA 1BW6A 3MINB 2WABA 2D5CA 1CK4A 1Y6JA 3KRTA 1RC1A 3DZCA 3DLAA 1PGPA 5KYUA 5EQJB 2XKJE 2HK6A 4F1JA 4J75A 5CUQA 1T9HA 3ABRB 2BMFA 1Y1WJ 4N4OB 1D3AA 1OW3B 3K69A 3GRUA 2C95A 1VHQA 1Z5UA 4U2BA 2AEFA 2QTHA 4QG3A 2ZRAA 2PUBA 2WG0A 4L6CA 1UZLA 3OU2A 4H31A 3HWRA 4A6DA 2DBQA 4IXDA 2H2DA 1G5HA 2BEJA 1LTQA 3B2EA 1FUIA 1EXMA 2VH1A 3MS4A 3DYVA 1RYEA 4QXAA 3PQ5A 1YQEA 2C8VA 3QKRB 3SI7A 5AT1A 1GN9A 1X3UA 3X1WA 4JU8A 4EPVA 1IULA 1GGEA 2TRSB 3G0BA 3CESA 4KI7A 3K53A 2FYTA 1YI0A 1Z0IA 5KQPA 4R1NA 1H8HA 1L6RA 1L7EA 4BNJA 5DO9A 2LPMA 1GIAA 2ECCA 1X39A 1S3IA 4BLTA 1KSHA 2WK1A 3PDJA 1L5SA 1NY6A 2RDPA 4D8XA 4BTEA 2W84A 1IAWA 1TQ6A 3DOCA 3Q87B 4XUDA 5LKAA 2IOFK 2VHCA 4EJSA 5BVHB 2BEKA 3DV2A 4IVPA 2OAEA 2WYHA 1C0WA 4H0CA 1EJBA 1E9RA 1HY3A 4ZO8A 1ZOLA 3VR0A 1ZUHA 2VTEA 4HH3C 2O8BB 4FLEA 4NZZA 3O1JC 3LKZA 4GGOA 4AS1A 2EF0A 3CFYA 5CBPB 4PLTA 1MCZA 4KFTA 1C9NA 4YRDA 4W8HA 1HLDA 1NR7A 3ZXSA 3I01A 2YZ7A 4JEMA 2PFGA 4B83A 1MHPA 4Q7QA 5IT0A 1NUHA 2X9VA 3FNBA 4KREA 4UPVA 2INGX 4YEJA 2NTVA 2YZ2A 3MN1A 2DQRA 3Q2KA 1E1CB 2Y30A 2IEDA 1TQIA 2LSOA 4K86A 2M0MA 3BCAA 3WIVA 5AW4A 1QGPA 2EBFX 3SJMA 1G1AA 5IJ9A 4C6TB 5JCOA 1UXIA 4B09A 1AKMA 4XKCA 2I6FA 4XB6B 2Q0QA 1ETVA 4N5LA 1Y56A 5LC1A 3TO6A 2RH4A 3R0JA 1U5TA 2ISZA 4EJ6A 5DT9A 2FXIA 1U3DA 5FFMA 2H29A 3AZPA 3KL4A 1CE8B 5M5BA 2C9CA 5LXTA 4X63A 2KL4A 1WUHS 1G21A 5AQEA 1Q0ZA 4B3BA 1Q74A 1RM0A 2CD7A 1CDOA 1GPUA 2CXSA 4QBIA 5M7EA 5KUTA 5WRFA 5JC1A 4C5CA 4DABA 1L8XA 1EQ2A 3PXEA 2QB5A 5DM7F 1QE5A 8ADHA 4YMTA 3JQRA 3TLKA 1FNSA 1EPUA 2GEDA 5LQMA 3VSKA 1FTZA 3IEIA 3T9FA 5D5UB 4YCLA 3PC8C 3AEZA 3WDSA 3EIXA 4NU5A 2J41A 2HSGA 5AI6A 4MHTA 3CISA 3AKDA 4ZAFA 1ZCBA 5ALJA 3HSYA 3TP3A 2WG2A 3FHLA 3W7BA 4C4AA 4ZKEA 1FA9A 3IQXA 4LGMA 3T12A 1C7IA 3ESQA 2DUJA 3HMQA 3V2GA 5U4QA 3GMDA 4KXMA 4DR1B 1G66A 1MIOB 3BR5A 5CVVA 4EM1A 2BW0A 3RS5A 3HRKA 3UKDA 1Y4DE 4NJMA 4XYLA 2JTVA 3HBAA 2B4YA 2OV3A 4PLVA 1U0LA 4KN6A 3I4NJ 4M60A 2V7GA 4DPMA 3DYBA 2X22A 3HUGB 1VLHA 4IRIA 1NLFA 2X13A 2Q8PA 5SV2A 1B2LA 2FU5C 1Z0KA 2O20A 5EMMA 2H5JA 1XEXB 2VHVA 4PO3X 2PCLA 4FMCB 4TXNA 1ZK3A 4FLFA 4Y8VA 2I3GA 1OJLA 1N0UA 4PSDA 1HL3A 3AVXA 2C0QA 4ZCIA 4G0UA 3GJYA 1A5JA 4J4HA 3ZLJA 5HNHA 1X74A 2XDVA 5KVQA 1H4VB 5JEDA 4G5GA 4KXLA 5JNRA 3JAWB 4ZAYA 3SC4A 3NIGB 3KZZA 4RKRA 3R4KA 3T4PA 4LRYA 5LL6P 4PSWA 4QELA 2AQEA 1VKZA 1NQTA 1JSRA 3BTSA 4PBRA 2WLSA 3TPZA 5B4UA 4E6KG 2LCIA 4NMLA 3FD8A 3OZWA 2KM1A 3ESDA 3FWNA 1M6WA 3K1YA 4WY5A 1RRKA 2CXTA 4OFWA 4E5PA 2M7BA 4CF5A 1PJTA 1U3TA 1N57A 1WVMA 2GPSA 2PKEA 3KJHA 2A4MA 4ARIA 1M1NA 1FVXA 4HQMA 4JA0A 3HYIA 3EVFA 4Q9NA 2ZMEB 2XYQA 2PN6A 4CTJA 1EHYA 3E9QA 4OIMA 4EHJA 1CQPA 4BHTA 2FMHA 1HNXB 4OXXA 1JA0A 4BX9A 1Z6RA 3IAXA 3N0TA 4XB2A 1KSFX 1MQ8B 4QGFA 3HNRA 4JHLA 5JNSA 2BM1A 1XTUA 1G59A 2FPUA 4KYWA 2C5FA 3RIEA 2UYYA 4ARZB 3JQ6A 1HKQA 5DDGA 5EIHA 1A4XA 1P5JA 5IF9A 2IYFA 2BSXA 3ZNNA 1ECLA 3FLEA 3FWHA 4CM4B 5K7ZA 4CGZA 2YXBA 2FQ3A 5EZQA 1VMAA 4IQJA 4N3BA 2BYTA 3UVEA 5K0FA 1G291 4RX1A 5HX7A 3P0JA 1ZBQA 2PQ8A 3EPHA 4LWQA 1O9HA 1OI4A 2L82A 1YZVA 1GFIA 3EF0A 1TQ4A 4FIDA 3NBYC 1C8VB 4Q34A 3MBOA 3DOJA 5G2OA 1WZ2A 3NATA 4RJTA 2XBUA 1XGOA 3LSMA 3DE0X 3HXQA 5EXTA 1MBKA 3CGWA 2BTEA 2D5VA 4EMSA 1O9GA 1IEWA 2DR0A 2HPZA 5DISB 4PU0A 5I7HA 3OT4A 3IC7A 4J9VA 2ZYAA 2O23A 1BX1A 3MWYW 4LYYA 1PGJA 5H1YA 2LOOA 5HF6A 6ABPA 4P83A 4WNIA 4MA4A 2QR3A 2FEXA 4E32A 1JN0A 4WXCA 5DUKA 1OI7A 3EF1A 2VJNA 4FFRA 3EZ2A 3K4JA 1DJMA 1YR8A 1IATA 4EL5A 3HCWA 5CT8A 4P4NA 2VKTA 2MSYA 1C0EA 3LL4A 2ZIFA 1EX6A 3HDQA 2BKAA 3PHCA 2Q5EA 2GMWA 3NWEA 4KMRA 4D6XA 1KJWA 4ZCMA 5AIAA 1FDUA 1ZW1A 3H5OA 4TKVA 1A9SA 3GJ7A 5JS8A 4QBTA 2ECOA 4MQLA 4E7KA 1E1QA 3BL5A 2O8DB 2OCLA 3CCSI 4IOLA 3ZN0A 2XUPA 1VJGA 2QM8A 3KSDO 5ICSA 1QFMA 5SY4A 4PVCA 3NKFA 1QPBA 4TZKA 1KY3A 3WNBA 2C2GA 2XE4A 1D2HA 3WLNA 1GFSA 3GPIA 4LQCA 2PMZN 1B76A 3GTGJ 2ZU6A 3W5CA 5P8WA 4OQLA 3QEJA 5EWLA 4BQSA 2WV1A 1PE0A 3AR4A 3V4GA 1U11A 2IYVA 3B1VA 2ZRHA 1E0SA 2HHCA 2CXUA 4DMLA 5IM4A 2WTNA 3K7AJ 1HSTA 3D6MA 5LD2B 2AJ8A 3FLBA 1UF9A 4Y9RA 3T3DA 3FAKA 2VHYA 5JLXA 1KI1A 1NNUA 1A71A 3EZLA 3GUCA 3ELKA 4Y7NJ 5JATA 3WMFA 1JA1A 4KJXA 3H0EA 1MC8A 2LV8A 2QVGA 4H4KC 4OMFG 3R9KA 3IIIA 1ZW6A 1N75A 2YRXA 1X1QA 2QJOA 4IZZA 3GJ0A 2FPXA 4ZDIA 1S6LA 4DCTA 3AM3A 3G6KA 4DRYA 4O63O 4D4LA 3S27A 3B20A 2X51A 3NEYA 3U3JA 5JVDA 3I9FA 4AZ0B 3PI6A 3EIFA 3W4KA 2WF5A 2QMUA 5KAFC 2UZ3A 1S9DA 4I66A 1ZJZA 1A2OA 4OHKA 4G6ZA 1N6KA 2AQFA 2XAJA 5AVJA 4KNYA 4O4JB 5FBWB 3LT0A 2F2TA 5L3QA 4TSFA 4PAQA 2C4MA 2FW6A 4MFDA 5KOYA 4EUNA 2Y93A 5T64A 3KSMA 1YHYA 2GQQA 4JLDA 2ZFUA 1MABB 1WHTB 5C53B 2HHHB 2HQBA 1A98A 1L7VC 2OYRA 4AP6A 3ON5A 221PA 3WU0A 1A77A 4JHXA 1C8KA 4PFOA 1H9BA 4KN8A 5A3VA 4Z0TA 2QGFA 3QYFA 5GJBA 2H63A 1B00A 1PHRA 3WWPA 2Q1TA 3HCCA 3ZGLA 2YIJA 1B72B 1SBHA 1CUJA 3VU9A 1KQ8A 1QHNA 2Y77A 4QNRA 5FPKA 4IX7A 2ZI6A 1RZRA 4Z8XA 5H80A 3IPAA 4WH0A 3DBRB 1KO7A 3PS9A 2WZDA 3B73A 2EV9A 4D42A 1CNFA 1E6EA 1JL3A 2JIOA 1FNNA 1WCIA 4J0QA 4XR9A 3HJTA 2ODBA 4YWHA 5KVVA 5BWOA 2ZTVA 1SB8A 1TJNA 3HP4A 3DMTC 2BFCA 3LH5A 3ETGA 4FN5A 3JRNA 5GPAA 4KAXA 4MICA 4YFXF 1W4ZA 2O0HA 4HX9A 1SD2A 1G20A 1SUIA 3R3XA 1RQXA 4MTCA 3RV3A 3T52A 4IV0A 5H16A 3P97A 3N2GB 2A94A 4B4WA 5LYJB 3A6KA 1CIJA 2QG9A 3K0HA 3OIDA 3MKWB 3VPCA 1PK7A 4ANJA 3ECAA 2VH5R 3ZX4A 4N0QA 2OLEA 2IYOA 2X1EA 1Q2XA 4M74A 1NSTA 5F04A 4CQJA 5AUPB 2WF6A 4FYHA 1YBMA 2Y75A 1F2TA 3N28A 2IS6A 2F8MA 3AVQA 3KEYA 3L4JA 4CKWB 4JYBA 1XNHA 5EE1A 1ODCA 4RGYA 1G64A 3JAKB 5KAIC 3PPYA 4YMWA 5TPZD 1JH9A 4LJ9A 4TRNA 5LQNA 1RKUA 1AKTA 3OCZA 4CIWA 2YBDA 3BTLA 4BZXA 5BR7A 3GLTA 4NQWA 5EZYB 3DV0A 1UPTA 2CBXA 3MF4A 2IY9A 2SKDA 1GKIA 4MARA 3DTVD 1P6UA 3MRTA 1JHFA 5C4XJ 1J0XO 2VP4A 1ADJA 1H2ZA 1S2MA 4HGYA 2P9FA 2W2LD 3DDOA 4JUDX 4IS2A 4MGKR 4NZPA 4EG7A 1IXRC 1A2QA 1GZ3A 4R1QA 3E1GA 4GP9A 2HREA 5FCDA 2PA0A 4Q1AA 5HGXA 1VDMA 1KKMA 4UJ5A 5GONA 1YCDA 4LOLA 5FNVF 3R0AA 3CF4G 4TT8A 4I0WB 2NIPA 1MG5A 2HOQA 1IHDA 1NLYA 3HMKA 1EVEA 4O2AA 3NHRA 3FRJA 4A8JA 5CNMA 1XL1A 3QFCA 4NOMA 2PZKA 3RCOA 5I7UA 1FMLA 4JR2A 2NN3C 1AE1A 4F8YA 4IMPA 3EQLF 4U0KA 2GBFA 5AM4A 2XF5A 4P55A 1I94B 4MQ6A 3O3KA 2X8JA 1H5UA 2WQ6A 4KPUB 3VU1A 4DTCA 2OCPA 2W6OA 3C6BA 2EC5A 2NLOA 2O0MA 2J3QA 4C3ZA 1R1DA 1CF9A 1XALA 1DIRA 3NDJA 4ZICA 1J2JA 2NGRA 1SD5A 1H8AC 1XZ8A 2YHBA 4L9JA 5CQEA 4Y2UA 1YDGA 3IKLA 4EFKA 5HKOA 4XSGA 1KVSA 5CFOA 2G06A 3ZWXA 4GCVA 3RGWS 3VKGA 2B34A 4II2A 1CEXA 4PAWA 5E4YA 4QU5A 5B53A 3KHUA 3ROXA 3LHIA 4GYKA 3UYLA 2WJAA 1ZESA 3PNSA 3PPXA 4Q4AB 3V1NA 3BKXA 4XD7D 3F8FA 5ILSA 4TWRA 2KIMA 2JLVA 3KJZA 3FMQA 5L3DA 2W8ZA 4R98A 4TKUB 1USUA 5CLFA 3WLHA 2WZQA 4UTZA 2OCCH 3JRCA 5KDOA 1ZN2A 4B4DA 1C41A 2V6BA 1QZTA 5BWLA 3CLVA 2P78A 1D0IA 2E1OA 5BYJA 2QIPA 4LRWA 2JRTA 2VOJA 1FYDA 3HSRA 2ORED 3PYXA 4EF4A 4YIKA 3B3FA 1P31A 1LFUP 4C76A 4JODA 1PV2A 1GGFA 3KLOA 4KPEC 4I9GA 4NATA 1Y1LA 1GLVA 1PWEA 2EJTA 1AQLA 1X7YA 1YR1A 5F0FA 1GAJA 4I2NA 3S5UA 3A01B 4IHKA 3H5IA 3BFJA 4IWNA 3BJAA 5TT1A 4G41A 1XZDA 1JUSA 4MV9A 4AJEA 3KP3A 3OLYA 4DE5A 3U9GA 4LX8A 4QBGB 3BXFA 1C9EA 4PZEA 2R7SA 1U8XX 3WB9A 5EEAA 1J20A 3OKFA 2I2AA 4HXYA 3A58B 2XRNA 2IT1A 5DMXA 3HP1A 3PB3A 3ANMA 3BCSA 1K7XB 3GEGA 5SY6A 2O2HA 2PFKA 3GGPA 4OMCA 2G7HA 2EJUA 3CCBA 3A1TA 5I5EA 4RXUA 1DX4A 2KX7A 3ROEA 1KO4A 4W5WA 3GZ6A 1QGUB 1V1JA 3UKJA 2YZMA 5DNAA 4U63A 5I8ZA 5ER6A 4R1LA 4O25A 2LWIA 3I23A 2UZ1A 821PA 3CC4I 2CLKB 3KSUA 3FDFA 4AWAA 4BY7J 4X65B 4MP3A 5FKKA 1P7VA 4AM3A 1QAOA 2Y0MA 3CQZJ 5B1EA 3D5RC 4ILKA 2P2NA 4MWOA 1ZY2A 3UMBA 3H65A 3JX9A 1T5OA 3TOCA 5L7WA 2DA5A 2HFKA 2G9UA 2H4FA 4P0PB 1W96A 2FWNA 3ZGZA 4B2LA 2Z9OA 1U1GA 2B8WA 4U39A 4C7VA 5AMXA 1TCBA 3I1IA 4HLUA 2QAGA 2P4QA 1OX4A 3KTAA 3QKTA 1SU7A 3FCCA 3ROUA 1NL3A 1FC3A 5F1PA 3UPDA 4LBVA 1OBOA 4BNMA 1USGA 1TFUA 1LLUA 1M6HA 5CJJA 5KTMA 1ZMRA 3TOXA 5G02A 1N1MA 1P45A 3OOJA 1NIPA 4J7XA 2OZPA 10MHA 4O3MA 3EVZA 1E61A 3S8YA 3E8XA 4NQZA 4J0KA 2A1TR 4XX0A 1R22A 2VI6A 4G97A 4ZJZA 3IBGA 1T5BA 4FZ5A 2C1EA 1S1MA 4HDMA 2H31A 4GSYA 3WBJA 3HGQA 5B4TA 1U3WA 1FQKA 3NO4A 4ZQIA 3JATB 1DIAA 3COYA 4NMMA 4LWZA 4O29A 4XQ0A 1LE8A 3IJPA 5EWJA 1P2SA 2AEMA 3DKKA 1ZD1A 4OCZA 1WA5A 4L0MA 3CLKA 5CDFE 4P54A 5HJ7A 2QTRA 1NKVA 1PWZA 2JVJA 4DF3A 5ALHA 4ARBA 5A3SA 3Q88A 1J8FA 3AP2A 4BE2A 3ZE2B 2DLNA 4D43A 1KGDA 4RO0A 3C5HA 5DCYA 2R1VA 3ZHXA 1R0WA 3NAQA 3I1FA 1JNXX 4ID3A 4OKNA 1OFUX 3CUUA 5JAHA 2JFQA 1WKBA 4EFMA 4Q47A 1GV1A 2A0YA 3DBIA 4K9PA 2EHJA 1V25A 4IQGA 3TDKA 4J0HA 1C1DA 4UUOA 5K51A 1W85A 3RFUA 2XWSA 2AEJA 2X19A 1ZVMA 2ZUDA 1LDKB 3O21A 2Q8KA 2J5XA 2ID7A 3A7EA 3EBOA 4E94A 5GZ1A 4RA9A 3BA6A 1NVVR 2ZAMA 2NXNB 3COZA 1AXRA 3EZYA 4NV0A 4CKZA 2WFLB 3QU4A 2A67A 1KPIA 1V37A 2Z5LA 2ZYVX 3EG9A 4UXJA 3TSAA 3RIGA 4Q7KA 1QDUA 2O8NA 4NDZA 1U2DA 4ZT4A 2VP3A 1UOQA 3NEPX 1BC7C 2WAQN 2DR3A 1FYLA 3TBKA 2DYRH 4MV7A 4IWXA 5JZMA 2WWHA 4F5YA 2L9SA 4MQEB 1I7SB 1DAGA 2B0JA 1Z4JA 2NU7B 4UCWA 2SNIE 2OZVA 2R6HA 5ALTA 4CT0A 1V6AA 3MJVA 3OBIA 2XGXA 4PO9A 5BV7A 5LFAA 2TECE 1U2WA 2DM6A 2AMYA 4LUCA 1ZJWA 1HBXG 3G2NA 1DAKA 1D07A 1VRCA 3THWA 4PIPA 2SBTA 3L8ZA 1GQ2A 3ABQB 2QVBA 2RGAA 3BULA 2NQTA 1LUAA 5CKTA 1AUVA 1SA0B 5GVRA 5BMVF 3N2ZB 1BCRB 2Z9CA 4OHRA 3S4YA 1QO0A 4ZYHA 4JL8A 1IVSA 3Q5GA 4MW5A 2ZPTX 4Y4RA 1R5BA 5B3AA 4AZ3B 1H42A 3ZC3A 2J9GA 4Q3NA 2SHKA 1U0BB 2QJFA 2ETXA 4QICA 4GD3Q 2V0CA 1MHTA 1GRQA 3OOPA 4HBZA 3MYYA 3O3MB 1ZLXA 5A5GA 2C9DA 2G5PA 4BNWA 3H18A 4LYJA 5DTJA 4H15A 1MMNA 2KHMA 3EF3A 1YWGO 3JD0A 1PQUA 3PUBA 2XQKA 4I5GA 1JZTA 2EFQA 5A04A 4Z51A 1H89C 3AF1A 3LUBA 1GZHB 3VEPA 3FNQA 3TXYA 4E07A 2GFIA 4BNXA 1UANA 5JALA 1TM3E 4ZI7F 2OO5A 4D9BA 3J7TA 3ABOB 5BW5A 4PNHA 1NMEA 3K09A 4I50B 3ROZA 4JB2A 4PRKA 1XSDA 4LZWA 3SZPA 1QS0B 4KYIB 3LPDA 1QHYA 3VHXB 1T91A 4LYGA 4HWOA 1X1PA 4NFYA 3FHTA 1WXIA 4OHYA 4PIVA 4ZTFA 4DA7A 3OG9A 3M4YA 2P2CA 3OSZA 1UQRA 3KZKA 2E48A 4IICA 3RQSA 1E3HA 3S14J 4NBNA 5LCXA 5IVDA 2X6XA 2B20A 3MLEA 1Z21A 1ULTA 4WXRA 1MNDA 3JQ9C 1U2GA 2HSWA 1YJ9I 3THOA 4CLOA 1TIBA 3ZI0A 1E3TA 2O2GA 4Z86A 3T0FA 4CL3A 2D1SA 4F5ZA 3VR2A 4YJDA 2PT9A 4D4IA 1VB3A 4D1YA 3JWGA 2ZRPA 5BRAA 3ZDCA 2II6A 1SY7A 1SZDA 3KC2A 3RRMA 4KLRA 3MTDA 4JXKA 5FGMA 3OUUA 3TRJA 5BT8A 3IHTA 3I6MA 3KM0A 3LQQA 4UEWA 3WA6A 2HPHA 4EHNA 2XA2A 2UZ0A 1N36B 3UHAA 3DWEX 5ALQA 2NPIA 6AT1A 3T1NA 4PG6A 4C07A 2CHVA 3HCEA 1PEYA 4IDOA 2BFBB 3AXTA 3LF2A 1Y5MA 3OP4A 3OZBA 4IJAA 3S1LA 2PLWA 1NVBA 4TZ0A 3T3MB 3O94A 5EYRA 3QFSA 5DM60 5EMJA 3P2JA 4M86A 2EFDB 1LBHA 3H36A 2VL8A 4DGWB 4ZT6A 2VK2A 1UOOA 4OB6A 2A59A 1K8YB 3PC3A 5LDGA 3RBVA 3K1AB 1XD2B 3EUHA 2BFNA 4WZAB 1VL2A 3PG5A 3CNBA 4GLJA 1H6CA 4W6QA 4DR7B 1DWQA 3GDOA 3M7GA 3JQ8B 3JWPA 4LK0F 4BB5A 3DKXA 4GEGA 2C20A 3VZCA 2C78A 4R68A 3NHJA 3O93A 5FXMA 2XUDA 5HKKA 1ZCZA 2BV6A 9MHTA 1LX7A 1EGVB 5CH8A 2FSFA 3P9KA 2Z83A 3GX1A 1SG0A 2CMPA 3CG4A 2ONCA 1Z37A 4QYXA 1QHFA 2G1UA 4NDNE 4RJJA 3ASZA 1OGYA 1EINA 2G71A 4D0NA 2EIKH 3LDAA 3VNVA 3N2EA 1I1QB 4DA8A 1C3EA 1CP3A 3GC6A 2JARA 1M2HA 4N8EA 5CCEA 1HQYE 4MS3B 4XPZA 3HR8A 4EGZA 5CFQA 3TD9A 3VZRA 1ODIA 4BO1A 3Q3GE 3K70B 4IQ4A 1HDCA 4IUDS 1SUSA 4CM8A 5K6TA 2XCRB 1E0JA 1K0UA 1X1BA 2I9KA 2W6NA 1LH0A 2C2YA 3BJ6A 2ORWA 1BXRA 2E37A 2VIIA 1R71A 2DTRA 2FUKA 4J1TA 3DZ8A 1R8QA 3IURA 1R15A 1WNFA 3B9BA 3L6DA 1ZJ5A 2Y6VA 1N2GA 3RJ5A 2G6TA 1Y4ZA 2J09A 2IPOA 2H8RA 4OQYA 4HRAA 2HA6A 3PQ8A 4D5GA 2FP4A 1WP4A 3EMVA 3ZVRA 1W4RA 2M0CA 1YI8A 2IW5A 4P5OA 1SM4A 3S2GA 2QRMA 7ABPA 4CFZA 1IW7F 2YN2A 4WOJA 3SHOA 3THXB 2PJPA 2HGZA 3V8EA 3MUEA 1ORRA 2BMJA 4KE9A 3PUHA 3DBLB 1P3JA 4W1SA 1MNEA 1DZ3A 4D5CA 1REQA 5K8IA 1RRPA 4GXOA 5KNCD 1GCIA 5FWYB 3CPEA 4X6UA 3LU1A 4ZVQA 1GQSA 3LZDA 1KC3A 2GH1A 2AC2A 2R25B 4UVDA 2Z2IA 1Z25A 4Z5XA 3EVBA 4HZGA 1YVEI 3FKSA 4GL4A 5FBLB 2HA5A 1MSFC 2CE7A 3T3GA 3ZU4A 2R7WA 3BCHA 5J59A 4ZVUA 2HWVA 3P0EA 2EX0A 3KVYA 3CR3C 3BWVA 4B2IA 3KHKA 4Q9JA 2RHTA 5C5IA 1J5PA 3QUCA 4EK9A 2HZ7A 2FN3A 1WF6A 4OXNA 1H4TA 2VZ9A 3V7RA 4EJOA 1NMYA 4DXHA 5K3DA 4LF5B 1Z7WA 3GJTA 4G56A 1ZHFA 2VDLB 1AOYA 2HXOA 4LJ5A 4WJKB 3A25A 3QLUC 4BXUA 4KN9S 1LJUA 5IKMA 2ZJ8A 1SHJA 4Z0HO 3NC4A 1Z7EA 3AF4A 3D31A 4RD2A 4RYDA 2YQZA 3L7LA 1JDTA 3LSTA 3QP6A 4NI5A 1G7CA 1F8FA 4V3CA 2HQRA 1YK1A 3PLNA 3HU2A 2LKSA 3V1KA 3E9YA 4UMVA 2O4CA 5BN4A 3I1JA 3UNGC 1SKYE 1AK2A 2IFTA 3V5NA 1UXJA 2MYTA 4CIAA 4OAYA 1RBZA 5F4BA 4YRAA 2CK3A 1EH6A 4DVJA 2GOYA 4K9OA 2JLXA 2QUIA 2J0QA 1RWKA 4BTLA 5IPFA 2CFRA 1UJBA 4EV0A 5ED4A 3OQJA 1RD4A 2NYVA 1SFRA 1JHQA 4GYWA 5FHRA 3A3KA 4WADA 3ZWDA 4B3MB 4HH0A 3PUJA 4MPDA 1N6PA 1IZ8A 2IYNA 4KGZA 4L0ZB 3SZOA 2VSQA 2CE2X 2ELJA 1NLUA 2COEA 2H17A 2JGMA 1BDIA 2IHTA 4UDNA 2NW6A 4TTJA 4JT4A 3JQ7B 3B89A 3GLVA 3DB2A 3ZLVA 3OLCX 2PL3A 3KR9A 1PW7A 4AMUA 1O94C 4CQMA 5C5DA 4B44A 3U44A 2YV5A 2N0SA 2R0QC 2F1OA 2NVBA 1J22A 1X1SA 3R6TA 3E84A 1D1BA 5D1NA 3ZDRA 2QEXI 4XKBA 4Z3KA 1EBBA 3OTGA 1TAQA 4V0MA 1VLVA 1XNQB 1EFCA 4OH1A 4CLRA 4RAFA 1P1JA 3STXA 4YRVA 2OEPA 2LKXA 1U7HA 3CJTA 3O75A 5AONA 3D3KA 2PD4A 4Z54A 4BACA 3E1SA 3GWZA 3LTNC 1OXBB 4GYYA 4WCFB 5SY9A 3S2ZA 1A9TA 4UKDA 1BHO1 4YFNF 4WXMA 2LYCA 2B99A 1XR3A 5HW0A 3SQXA 1GA4A 2X86A 4RMNA 5F3RA 2MH9A 2C6YA 1JMVA 5IH3A 3QUTA 5BOSA 5K1YA 3MJRA 4X8OA 5F08A 4A15A 4WESA 1KDPA 3H4TA 1JQBA 3OZAA 2CXOA 2PUFA 4M7PA 1UL1X 4RHXA 2XDAA 4DCMA 4IRHA 5HJ2A 1Z6AA 3GU3A 9ATCA 1ETWA 3SC2B 4CQLB 2M4KA 1ZPDA 4I4CA 2X6RA 1VMDA 3HBFA 2V1NA 4PNZA 4Z1MD 1QYVA 3HB5X 3OMXA 1Y8AA 4PFSA 4FDMA 4RZQA 1Z0XA 3B6EA 3F23A 3RODA 2JT1A 1AU7A 3K9QO 2HEIA 3EEFA 2X8BA 4A91A 1IJKA 4QOSA 1VE1A 2G8NA 2CJPA 3IVXA 2FNAA 2VHEA 4GC9A 4N49A 1NYTA 4RTNA 2EP5A 2NSLA 2OILA 4OXIA 4HOBA 4HCJA 4PHGA 1P7YA 2ZE8A 4XTCS 3W9UA 2WIJA 3FX2A 4HLCA 4RXMA 3QWIA 3W8RA 2HVQA 1KMCA 1SK9A 3QM1A 1KVQA 2QVCA 1VLJA 3AG1H 4DILA 4H35A 1VTNC 2HGSA 1AKHB 1BKSB 4MROA 2KW5A 1ZWKA 4S1NA 2C8JA 5IC4A 2XRFA 1VBNA 3VDMA 2FFRA 1CF4A 5TMPA 1QOQB 3VMMA 4NMHA 4S2EA 3L6BA 1M2EA 3T5BA 2DYKA 4TWJA 2Z57A 5J1TB 5FUBA 1CFZA 4CU5A 4FD3A 1IQPA 2P5TB 1KI3A 2XGDA 2P0EA 5DM0A 1T8PA 4AJ1A 4EY5A 1TU4A 3AV0B 1B1BA 4ZMSA 3BH6A 1H9GA 1NXWA 4TUYF 3TAHA 4ZVTA 1BH2A 5KJCA 3IMKA 1Q1ZA 3S32A 3O9MA 3C4QA 2Y3IA 4Q93A 1ISFA 1Z45A 1VOTA 1FF9A 2QX7A 1U80A 3HPHA 4LRUA 4XAQA 1M8KA 5JAIA 5KWJA 4H7HA 1FY7A 4JC0A 5M2QA 5D2CA 2X9LA 5BV0A 4AJOA 5EHIA 2LY9A 3WB2A 1YS1X 1L5KA 3WP0A 2HR1A 3OCXA 4KMSA 1UMKA 2EFHB 2G70A 5IBRA 4B32A 3AILA 5AK6A 4BUPA 2M30A 4CICA 4M53A 2X1HA 5GPCA 2ZYIA 1C30B 4AJNA 2ADMA 3K8OE 2XJ4A 2WF9A 1W1UA 4MKHA 1F4LA 2IPLA 4KN4X 2PV7A 2DE0X 1WXWA 2JVGA 2XVMA 2OKGA 1HF0A 1Z36A 1G4DA 4TKZA 3TZEA 1DJQA 4MHSA 5IT9K 4C2AA 4OK6A 1P0FA 4OF4A 2XSDC 3C5VA 2WVJA 2YC4C 3BA1A 1EGAA 1G5TA 2G5CA 3M1YA 4OM7A 1WDMA 3MKZA 4Z99A 4MQ4A 3CB2A 4FDAA 3UJCA 1W2WB 2DUUA 5EL0A 2FTKE 5NLLA 1HXHA 2VQFB 1TMOA 1WF3A 4N48A 4EUEA 1E63A 3KQWA 1QM5A 2HJSA 1NMZA 3SHWA 3IDOA 3ZKWB 3ANLA 1GT6A 5K0TA 1YQXA 1G42A 3H13A 1MORA 1ZIYA 1SQFA 2AUNA 2WUDA 1LPMA 3CYFA 1J2TA 4QJ5A 1WOYA 1UKVY 1CDZA 3G8YA 1BXGA 4ZDWA 3G7SA 5FUWA 5A71A 2W2MA 3NNDA 4XDHA 2DC1A 3LBNA 5I4IA 3HGTA 2HRBA 1OX5A 3TP0A 2XQVA 1U3EM 4WFKA 2EWWA 3RVSA 4O1HA 3BXPA 1E3SA 1IY9A 3IVGA 2LLKA 2C4HA 1WB5A 3R7WB 2QZ4A 3REQB 4RD6A 3VSEA 2FMIA 2J85A 3KJNA 2BCJQ 4OUDB 2FSHA 2W2NA 4YLGA 1IBLB 3IV6A 3ZI7A 2PSHA 2OMEA 1BU8A 1ZR2A 1FYWA 4HRXA 3ZJ4A 2MLGA 3LA6A 2E2IJ 3QFTA 1K6IA 1A7JA 1DCTA 2A0UA 4UUNA 3LA3A 3LZCA 4O4LA 1AV7A 4JK1X 3GVCA 2DH5A 4KEAA 1W5EA 3D1JA 2BFFB 1XSEA 4J6FA 5EIWA 4RFSA 4FHDA 3F90A 2NVTJ 4Y2PA 4YLEA 4RIEA 3W6VA 2VNAA 3JQEA 2DFPA 4DAEA 1W5CC 2BGGA 2C5GA 1A8HA 5TMBA 3REOA 5HQ3B 5J8FA 1NBAA 4FR5A 2CDBA 4QUBA 3PT5A 4BKOA 3ZQUA 2OV8A 4LBZA 1YT5A 4HSRA 3EPZA 2ZRLA 3JQAD 2YPRA 1TLHB 4I5FA 4JC5A 1TAUA 4HH1A 2R84A 1DRKA 4E2WA 1HDRA 1CG6A 3TH5A 4F9EA 5JY1A 2YOHA 4G8XA 3MT0A 2HVRA 4TV9F 1K7CA 1O1YA 3NBAA 2H6BA 4Q4LA 3KDPA 4KBYA 4A92A 2ID8A 2J3MA 1PYDA 4PC3A 4PW0A 4K0KB 4UUPA 2CUTA 3FPCA 5ICEA 1R0SA 2QZSA 4WOKA 2BVNA 1Z16A 4D57A 5IX8A 1OAOC 1TBXA 3TGPA 4EJUA 3GBPA 3KIOA 1II8A 1R0RE 4A2QA 3V4VB 4JL5A 3OOYA 1TCUA 1O8CA 3O3CA 3PLAE 1TWFJ 4RD1A 5IRCD 2PKXA 1QC5A 1IHYA 1AN9A 1J56A 2IYRA 1L5VA 2AB0A 5J5AA 3PQ6A 2HO4A 5JNLA 4ATNA 3IBYA 2JK0A 2J31A 5DWVA 1LS6A 2QX6A 3P9NA 1D0YA 3Q3EA 2HY7A 1Z7GA 3TRIA 5AM2A 1QRDA 1B6AA 1HWYA 2JD1A 3FPFA 4V2UA 4LPSA 1JEDA 3E3NA 2VAMA 2P8SA 2GLXA 2NRAC 3GCZA 4I9NA 4YJ2B 2Q1YA 2IEBA 2P2GA 4NXNB 1Z6ZA 5LP6F 4N9QA 3DE2X 4KAAA 1EUCB 1RRFA 1RXEA 3BWMA 1VC2A 1IBKB 4UPDA 3UZUA 2NO7A 5I45A 2EJVA 4DGSA 4LY6A 3B7WA 1XDGA 1IHOA 1QYIA 4PRLA 4AKHA 2EKZA 5ISMA 2WTUA 1V4RA 5BVGB 4HKTA 1E5DA 1HKTA 1KMIY 3AHDA 1GGNA 3BGVA 2FJ0A 1WDLA 3G3EA 4HDSA 2OB1A 2Q99A 3GRAA 3F0TA 5CFMA 2BFMA 4OGLA 3IXMA 4EM0B 2BY2A 4J90A 4U2KA 4WK4B 2O6LA 1YD7A 1IOWA 1SBYA 3W2VA 5I9BA 3AETB 4BQRA 4Z49A 2WC1A 1TLLA 3N74A 4MZXA 3ADPA 4HUTA 5C8XA 5DT2A 4CDGA 3PXCX 4WOBA 1NQAO 5IJZA 4EENA 4M4SA 3TIGA 4HL6A 3I4PA 4G9GA 4HAMA 2WD7A 2QBYB 2Q28A 1I3AA 4H60A 2P2YA 3FM9A 1SXIA 3OWXA 3E8SA 3ZHCA 5IFLA 3ND7A 4BRSA 3B6CA 2VK1A 2BWJA 3IILA 4JBWA 1IV6A 2F9MA 4JLOA 4TZTA 2C59A 3IQWA 4Q15A 5KHDA 2VUMJ 2AQKA 1J23A 1T2EA 2A2ZA 3STYA 4QPZA 1DP4A 2OF7A 4QOIA 1R5JA 4IWYA 1GCAA 3TLZA 1OV6A 2QV0A 1CHDA 2L4AA 1JLRA 3UMSA 4RTRA 2YWDA 3S17J 1XMPA 2IKQA 5HUHA 3OLZA 3C6MA 4KICA 2SCUA 1A9PA 1J7JA 2PGJA 3K0EA 2FMLA 3PYMA 1S4QA 4FNGA 5CEJA 3T1TA 4JVOA 3FXJA 1P81A 2Q5FA 4XW2A 3DHNA 3NWTA 2C5LA 2QN9A 4H1HA 4HG2A 4ZMBA 4B3SB 3A1YA 1NYLA 3RLIA 4AWXA 3EZFA 3EUEA 3JWEA 3B6ZA 2NO4A 3GFBA 4Q7EA 3WXBA 3ECSA 3L40A 5REQB 2NUPB 1KI8A 1BGXT 3R5KA 1VGQA 4QM6A 3C1OA 1P9NA 4GKBA 3QWBA 4RIGA 4GUDA 2CFOA 4CRWB 5BSUA 1Y3DE 3KWJA 2XX3A 2VUHB 3W7AA 2VBWA 4YBRA 1DWPA 4W6ZA 1RACA 2JHFA 3A14A 4DWWA 4BJ6C 1FLAA 2J6HA 1EEHA 3T3HA 3TIFA 4AVZA 1IGNA 3BORA 3ZHUA 1AHHA 1FMVA 2PGOA 1LGYA 1WOMA 2FZGA 2ZSIA 7GPBA 2Z0MA 3E9MA 1XZCA 4HNUA 1YIJI 1YB6A 1RQLA 4Z7QB 3C8HA 4GVXA 5E1OA 3OS2A 4FFSA 5KYYA 1FUUA 2XHEA 4YXWA 4CMGA 3NTUA 1E1YA 4UEQA 3ZNQA 3TIXB 3SIXA 2R97A 2CBZA 1NLMA 4UBJA 4BN0A 4BWVA 2Y68A 3AH8A 1WW8A 1Y7TA 3W6KB 1NI4A 1W7AA 3BRSA 4BMDA 3HS3A 4QO7A 2DO7A 2PPVA 4DANA 5KYWA 4W5NA 4O4HB 1P7ZA 1YBVA 2ZYTX 1MJBA 3FR7A 5CYGA 5KX5B 3QXCA 2M2EA 3WQSB 5EJFA 4GI1A 5J9FA 2AXLA 2GZ3A 2RCYA 1PG5A 1C3OA 2BRUA 1VL0A 2J5BA 2QLBA 2Y05A 3Q8XB 2OK8A 4J7CA 2PX2A 1VJ5A 2P6NA 1D8KA 3FOFC 1PUEE 2NVWA 1FTWA 4PR3A 5AHRA 4F5WA 3IAFA 2AMJA 1Z5PA 3A6DA 2IVZA 5IT4A 2W4QA 4RSRA 3FCSB 1A8SA 5JU6A 1QDEA 1WKMA 3ZK9A 4AZVA 1GGVA 1QV6A 5IAEA 2OP1A 3JVEA 5HA5A 1H8EA 4RVSA 2RGNA 3U7JA 3ZCVA 4XOTA 1NX9A 4UVIA 4WBXC 5G1OA 3UO8B 2CCKA 1X7ZA 4AS3A 4V2IA 5JV5A 2DMRA 4V2GA 1OJ7A 3HCRA 3VJMA 3H42B 4WCGA 4U5XA 2ZG6A 3B9PA 2E87A 3F74A 4B4VA 1EWQA 4JR1A 5JHFA 1I5RA 2XNDA 3HWSA 4IJUA 2AK3A 2O50A 4EB3A 1I51A 1U78A 5AHWA 2QLTA 3MEQA 2QA4I 3S1AA 4NCAA 4IDBA 3C8MA 4LFCB 4AP9A 3WK6A 3W3AH 2WM2A 5AKLA 4EJMA 3MWDA 1L7BA 3FXAA 2PS9A 3VAYA 5G3ZA 1UPUA 4G4SO 2Q41A 4OHZA 2Q4EA 1VPVA 4ZQBA 2CWEA 5TQ0A 1CY4A 4IINA 3DPIA 3JU3A 4XVQA 4BP9A 2QNIA 4KUHA 1Q11A 4PY2A 1N0IA 4NVRA 2VJIA 2PA3A 1D6NA 3U16A 2BXZA 2QDKA 3PDIA 2BLLA 1G38A 4MVXA 2Y9PB 3V8PA 3TTVA 2FDXA 1RQ7A 4G3XA 4YEDA 2HDHA 4P4SB 3RAGA 1V9LA 4L0CA 4OXKA 3KELA 3OMWA 2FUG1 4JC8A 3KQSA 3OPMA 4HZIA 4KXNA 4N39A 1GSOA 1L5YA 4MRRA 3PZBA 3A26A 4GWLA 3GJRA 2GHQA 1OILA 1N6IA 3Q9NA 1KI6A 4R81A 1W46A 5K7HA 4BNGA 4LISA 3K2IA 1P29A 4HQEA 1JJFA 5BT9A 3TIVA 4URVR 1E5TA 1P7JA 4ED9A 4JBYA 3PVZA 1BN5A 4QC2A 2R44A 1JPJA 2DMUA 2WVGA 1YLFA 3NS7A 3VTAA 4D74A 4KODA 4OI0A 2C9YA 4LAFA 1Q0HA 1Z1DA 2WTXA 4C04A 1H5QA 4OBWA 5IANA 3NTRA 1WB6A 2UZIR 1XL0A 1QVZA 3CNEA 3TD6A 2HCBA 1KY2A 2FN4A 1IG0A 2F4MB 3PA6A 1DUIA 4JL6A 5EJ6A 1D2AA 4WECA 1YE8A 4I76A 5JDCA 1NG7A 4MVJG 4DBZA 1RI7A 5HDGA 4TVBA 1KYWA 2EX1A 2YYAA 1YB4A 1GVJA 1IBCA 4KOAA 2R7FA 4O0LA 2UUZA 4LQ4A 3OPNA 1D0ZA 1IZ9A 1M6VA 4GOKA 4UM9B 3RFCA 3GEIA 2AOXA 4X44A 1KU0A 3AAFA 4NF2A 2Z08A 2GVZC 3S2IA 2ZVJA 2XUAA 4IIEA 3E3OA 1EX1A 1N9GB 3K2QA 3HJCA 2I55A 2ACKA 2GXSA 5FJIA 1T39A 4IEEA 3EPRA 1T43A 4D4MA 4DCVA 2AR7A 1TWHJ 4Y30A 4Z0NA 3N0VA 1XJQA 5EHQA 4YUXA 2XYVA 4DCGA 5JASA 5BSWA 1DC6A 4R9NA 4QYMA 4LRQA 4TLBA 1Z39A 1EHIA 2ZYSA 1P92A 4GRDA 3AVPA 4KZKA 1NHWA 1VKRA 3DPSA 1N2JA 5F5NA 5BV2P 2W6ZA 3BSSA 4U7GA 1QYDA 4LB6B 2X0LA 4EJVA 4A27A 3ECCA 2OBLA 3FCYA 2ZXUA 3NWPA 2ERYA 1JSZA 4JELA 1SKUA 3AYXB 1W59A 5DXAA 2F00A 2NV6A 2CVOA 3UJ9A 1MEJA 5C46F 4JLNA 4NC8A 5AXBA 2OK7A 3GPCA 5JVTA 1SKMA 3R7DA 3ZMZA 4HLQB 4MVYA 4KQFA 3NAZA 2QORA 4X1KB 1G8JA 2XQGA 1HZZC 3I9MA 5HF5A 4TN1A 2YVLA 1BMQA 1P4WA 3DAYA 5JMOA 5FRNA 3TE6A 4DG5A 2Q3MA 2PJZA 4L6AA 2XMZA 4AU1A 4LFBB 1U8YA 3AHIA 3CW9A 4QDOA 2ZCUA 2BZ0A 2V74B 1J49A 1SBTA 1MDBA 1R8YA 5J1RA 5BWBA 4PQFA 3ZCUA 5EE9A 5KWVA 4YMVA 4RF2A 5FULA 4NBRA 4GGGA 3PNPA 4EPRA 5BSKA 1K7YA 4Q1FA 4NPHA 3LHKA 1TTYA 4F72A 4OJTA 4CLXA 4CR6A 1KZYC 2IBSA 3WX0A 2QYSA 1N5MA 2FH5B 4KR2A 3L1VA 5DTMA 5FLXA 2G76A 1TZ2A 2WBLC 4JUCA 3IIKA 1PLKA 1SHZA 3GLHB 1SCBA 3M70A 1JQ5A 3K6SA 3PSAA 3DVQX 4HQ6A 1OTXA 3M8FA 1J90A 4QU0A 3WICA 1SUDA 3UJ6A 3B1YA 2GJ8A 7REQB 2AUMA 2RNJA 2D0DA 3OLWA 2OM2A 1E3IA 2O7NA 1P7CA 3LRXA 2AOUB 3OPXA 3P19A 1VXRA 2ZE7A 3RTRA 5CHEA 1T9BA 1EWYA 3UUGA 3ULQB 3GFGA 1K61A 1HTWA 3KAJA 5L3SA 2RGGA 2UYQA 4QJIA 2PQ6A 3IPRA 2DKFA 4BFCA 3L0ZA 3L2WA 3H1FA 5T6MA 4WA7A 3L7DA 1JMYA 2XD4A 4HDKA 4MYCA 1GLNA 1M6EX 1P0MA 2LR8A 1ORWA 5KNDA 1C0LA 5INTA 5ECGC 4I5DA 1RYHA 2ZI7A 5C35A 1RPAA 1E99A 4A12A 5LHHA 3VDNB 2ZUWA 1GTL1 2IS2A 4S2UA 3H1EA 3IMGA 1NK3P 2C94A 1YQWA 3KPHA 2VPQA 1MQSA 1MC1A 4BIMA 2G04A 2GDJA 5FOQA 4L9VA 2HA0A 2JKVA 2QKLB 2LTAA 2NZ2A 5IJ0B 3QPAA 3GY0A 4E5MA 2C54A 1EFLA 4HAYA 3QX8A 3TDUC 3TQQA 3Q3HA 1X8JA 3FOWA 2DQKA 4MIMA 3NAMA 1R4AA 4H7PA 1AUXA 5ITZB 1ZK4A 4MR7A 3QH4A 3H3UA 4BJHB 2ZCWA 4NZOA 3GZTB 4RHFA 1T4MA 1X2MA 2A8YA 2OP0A 3ZVLA 4UHDA 5D4SA 1JX6A 4EZEA 1CZOA 4IV8A 4YROA 3IHKA 4ZK2A 4EG8A 4BCCA 2XWPA 4YCMA 2MT9A 3WG9A 4FD2A 1UPCA 2Q5QA 3TE7A 3AJDA 1MW8X 2WA1A 5CA0A 3QPLA 2V3CC 2BHNA 1DC5A 2O2YA 2OXIA 1YJBA 2IUEA 1FTNA 5IUJC 1NVGA 2I33A 4HNQA 5BQ3A 1T13A 1M6NA 2HIMA 1G60A 4WN9A 3K10A 2YHIB 3BT9A 3TLBA 5EDNA 1PFUA 2YU3A 1FFAA 3CCCA 2V7BA 1ZD5A 1Y1KE 1NF3A 4TL9A 4IH1A 3ASVA 3NVMB 4RMGA 1STOA 3QBJA 1KGSA 5TVKA 2YASA 1BHQ1 1S6YA 2NX2A 6REQB 4DYCA 2C8LA 1F2UB 1Y1TA 2HNBA 2GK4A 2EILH 3F6RA 1P7WA 4QIHA 3LNTA 3NHUA 3OQIA 4UY8I 5LXTF 4BJ5A 1VMEA 2HAEA 3GNLA 4NHJA 2JA1A 3TLAA 4X0EA 2E1CA 4WWHA 3HLYA 1J25A 4TLCA 2QL6A 4WBNA 5CA1B 4Z7NB 1SVOA 1AWCA 1LF5A 2PX6A 3H0DA 1QX4A 1V96A 2QE7A 3EIHA 1TX4B 1I4OA 2V0NA 4Y2TA 2GO1A 4BASA 4FYWA 4UATA 3FGOA 2IJLA 5D8LB 4BXXJ 5EMNA 3WYNA 4R16A 3RIRA 3AR5A 2G83A 2PJDA 4D5FA 2P68A 1PYGA 4HD8A 3KPVA 3HXLA 4KRGA 1KK0A 1KRXA 2VODA 3V1MA 3MJCA 1XEAA 1J1IA 4MAAA 1NUQA 3S44A 5HEKA 3JVIA 4MB2A 1WDTA 3W5BA 1L7QA 4FB4A 5FL3A 2VOOA 2PU5A 1EGQA 5E6SB 3BT7A 2O59A 2C0PA 2FQYA 3OZVA 5GJVC 2AK2A 3OC6A 1P4XA 1NIJA 5J1YA 3CNQS 2QUJA 2AG0A 1X15A 4LJLA 2WRZA 5C37A 4JAVC 5HCNA 3H3VK 3QYBA 3U7EB 4RXTA 5AKYA 2H4JA 4C0WA 4C6RA 4BP3A 1JHAA 5GV8A 3ZDXB 2QN3A 5TARA 3WTUC 3CUQC 4P38A 5A2QZ 2P2DA 2BFDA 4KQXA 4MLCA 4WKGA 2XTAA 2Z2YA 3WAKA 3F5QA 2ZJ6A 1S2OA 4I8XA 5G0SA 4X41A 3K2AA 3T7TA 2FETA 3VJKA 3ROGA 1PP4A 4YMUA 4GLLA 2JSPA 3RU3A 3H9BA 1XXLA 4ARCA 3RJPA 4HQRA 3JRXA 4RADA 3ITEA 3O83A 2Y1OA 2WIFA 4WXHA 2V79A 1RCUA 1I1SA 3WMEA 3T9DA 2GAJA 4PAOA 4XM1A 3ZGOA 4IILA 4CKYA 3X1YA 4O4IA 3IUPA 4XSZF 4LOKA 3MXTA 2XADA 3ICWA 2ODPA 5FD6A 3CTMA 5ICCA 4L7VA 2VNIA 3HB0A 4F3TA 4PM4A 4ETMA 4AIJA 4NEQA 2FR0A 1CUVA 1FEXA 3OPYI 3CTPA 1XXHB 4Y9TA 3M9LA 1TYAE 2P6MA 5HIKA 1LZLA 5AP9A 2NYRA 4Q9AA 4UE3S 4V19K