2R0QC

Crystal structure of a serine recombinase- dna regulatory complex
Total Genus 67
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
67
sequence length
200
structure length
193
Chain Sequence
MIIGYARVSSLDQNLERQLENLKTFGAEKIFTEKNRPILQKALNFVRMGDRFIVESIDRLGRNYNEVIHTVNYLKDKEVQLMITSLPMMNEVIGNPLLDKFMKDLIIQILAMVSEQERNESKRRQAQGIQVAKEKGVYKGRPLLYSPNAKDPQKRVIYHRVVEMLEEGQAISKIAKEVNITRQTVYRIKHDNG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Architecture of a serine recombinase-DNA regulatory complex.
pubmed doi rcsb
source organism Staphylococcus aureus
molecule tags Recombination/dna
molecule keywords 31-MER
total genus 67
structure length 193
sequence length 200
chains with identical sequence D, E, F
ec nomenclature
pdb deposition date 2007-08-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00239 Resolvase Resolvase, N terminal domain
C PF02796 HTH_7 Helix-turn-helix domain of resolvase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.60 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Homeodomain-like 2r0qC02
3.40.50.1390 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 2r0qC01
2IAIA 1RESA 1HLVA 4MIMA 5F0FA 4FE7A 3GTKJ 4AYBN 1JUMA 5FKLA 1LE8A 1IG7A 2ID6A 3GTQJ 4XRSA 1JKOC 1ETKA 3JRIA 1F43A 1MBHA 2E2JJ 3S16J 4I6ZA 2R5YB 5IPAA 1ITYA 2X48A 2CQXA 1UG2A 5F0CA 3S15J 2FQ4A 2NOGA 3BQYA 1ETWA 2LD5A 5DTDA 2LTPA 2AO9A 3QQAA 1JTYA 5FLMJ 1I3QJ 3S1QJ 5GPCA 2M9HA 3ILXA 2RSLA 4IHVA 3JREA 4FTHA 1IV6A 4BY1J 1ENHA 3NARA 2FX0A 2JWTA 3GTGJ 3HOUJ 1OFCX 2PMZN 2EH3A 1X2MA 4A3FJ 3DCFA 5FJ8J 1CQTA 2Y31A 2NS8A 4UUSB 3S2HJ 1GHTA 4RBOA 5F0HA 4W1UA 4I76A 3GTPJ 2EBIA 4X6AJ 2R5ZB 4BQQA 5IP7J 4V2FA 2R7ZJ 2IBDA 3DEWA 3D1NI 1Z77A 2O9LA 3I4MJ 2E2IJ 2Y2ZA 1UMQA 3TEDA 1O4XA 3F0CA 1RKTA 3BG3A 3JRAA 1WI3A 1TWFJ 2FJ1A 3JRFA 4B4CA 2CU7A 1EF4A 2CUEA 4DW6A 1GUUA 3LHFA 3LHKA 5EYRA 5EZGA 5J3LA 3BTIA 3IH3A 2L9RA 3HEFA 1MSFC 2EQRA 3BR2A 1S7EA 3TP0A 4A3JJ 1P7IA 2DA5A 1E3OC 1B72B 2HOTA 1FJLA 4IHYA 5F27A 4DYCA 1K61A 3CCYA 4D5CA 3HGYA 3ZOBA 2WV1A 3ZQGA 3HOWJ 2L7FP 5FKOA 1ZKGA 5IP9J 2Y9ZA 3CQZJ 1MNMC 1JKPC 3HKZN 2QCOA 3GTJJ 1HOMA 5FKKA 4IHWA 3MN2A 3TP3A 2H1KA 5EDNA 4A3IJ 1D5YA 3S14J 4BBSJ 1ZR4A 3G13A 1JUSA 3PKZA 1TC3C 2DA4A 1X2NA 2DMUA 2M2EA 1FEXA 1SANA 5E3MA 4JX4A 3A02A 4BBRJ 2DJNA 2TCTA 2WAQN 3GTOJ 4M3DA 1ZGWA 3OSFA 4LOCA 1AKHB 3BTLA 3BG5A 1U78A 4XICA 1X58A 1BJZA 3BVPA 2NVQJ 1APLC 1QPIA 3BR5A 4C3JJ 3OOUA 2DA6A 3B6AA 1VNDA 5F08A 2EZLA 1IDZA 2XPUA 3HBLA 1B72A 5JLXA 1PUFA 3TW6A 3HOVJ 1I50J 3HOXJ 4DZPA 5C44J 2MSYA 2VI6A 2R93J 2LR8A 2JA6J 1AHDP 3MKLA 3JR9A 3Q0WA 1ETOA 5F04A 4HNVA 2GM4A 1Q1VA 1MBFA 3LSRA 1BW6A 2XGCA 2XPWA 3JRGA 3ZQHA 1B8IB 5C35A 3E7LA 2NVYJ 2ECCA 2MG4A 2OPTA 3SDGA 1LFUP 1MBKA 2DMNA 5M3FJ 1ETQA 5M5XJ 2O8KA 5K7FA 4C3HJ 3FK6A 4A3GJ 1WH5A 5C4JJ 1IDYA 2ECBA 3NAUA 2O7OA 3O8GA 2LY9A 2N8GA 2M8GX 1MH3A 2X6OA 3S17J 4A69C 4C2MJ 2K9SA 3H3VK 1GT0C 5FLVA 3WHCA 1RPWA 2HQ5A 4UUTA 1GVDA 3LSPA 1YRNA 1TWCJ 3Q0UA 1LE8B 2JA8J 1ZTRA 1H88C 2L0KA 4BXXJ 4GFBA 4ABZA 4AC0A 3RZDJ 1FTZA 3OSGA 4CYCA 3S1NJ 5GP9A 3HOYJ 1P7JA 1XG1A 4JX5A 1TWHJ 2CJJA 4EEFG 2MHCA 3A01B 1ETXA 1IRZA 2CRGA 3ZQFA 2KT0A 3JRHA 1OCTC 1VF9A 1OCPA 1IUFA 1FIPA 5C3EJ 4FISA 2M0CA 3OIOA 1TWGJ 5EEAA 3Q3SA 1Y1WJ 5J1YA 3A03A 1RR7A 1MH4A 2M34A 4M3FA 3QPLA 4MLOA 2DTZA 2YUSA 5IOYA 4V2GA 3PM1A 2GBYA 1F36A 2H8RA 1HDPA 5M5WJ 2ME6A 3JRDA 1DU6A 4A3DJ 4UUSA 2L7MP 3HDDA 2ME0A 5EG0B 1IC8A 2I10A 3JRCA 4FE4A 1BA5A 4QTRA 4MFEA 1H8AC 1OJLA 2XGDA 1NTCA 1VI0A 5JLWA 4MO7A 1AU7A 2KDZA 5IYBJ 1A6IA 5K7ZA 4IEJA 3UKGA 2HXIA 3M4OJ 2XB0X 5C4XJ 2D5VA 2LKXA 2R5YA 3LSJA 1HF0A 2JA7J 2TRTA 3G1LA 3RZOJ 2W48A 4A3MJ 3FIWA 2WB1N 1JJ8C 2K40A 2ID3A 2HOAA 3MVPA 1ZQ3P 2L7ZA 2VKEA 5IYDJ 5DS9A 3BR0A 2R0QC 4A3KJ 2K9NA 3L1PA 2E2HJ 3ZQIA 1ORKA 3G1OA 5EG0A 1FTTA 2LFBA 3BR3A 1NK3P 1BW5A 2XGEA 2ZB9A 3IH2A 4D7MA 2B63J 3K2AA 2EZIA 3S1RJ 5K7HA 1JGGA 5C32A 1QRYA 5IYCJ 4DYQA 3M3YJ 1ZK8A 4X1EA 4A3EJ 2ELKA 2YS9A 3LSGA 2JK3A 1T56A 4XK4A 4M3GA 3S2DJ 3Q0VA 2NS7A 5GPAA 3PO2J 1QVUA 3GTMJ 4XRMA 2OF7A 1WGXA 2LLKA 4L5EA 1SFOJ 1GV5A 4A3CJ 1JT0A 3TW7A 3GTLJ 9ANTA 2JN6A 1GV2A 1WPKA 3GBGA 2HXOA 1LFBA 4AUXA 5EF6A 1JJ6C 4JP0A 5E3LA 1MBGA 3GUVA 1Y1VJ 3A01A 5IP6A 1H89C 3BQZA 2YU9J 3HB9A 3RQIA 5M3MJ 4CYCB 3HGGA 3C2BA 3I4NJ 1G2HA 3CDLA 5J1UA 1T33A 1JKRC 1BL0A 1HX7A 2MGQA 2R5ZA 2G0EA 4M3BA 3H0GJ 2VKVA 3HM5A 2NVTJ 1JUPA 2VUMJ 1UHSA 1Z0XA 1ZR2A 4FCYA 1YRNB 3IH4A 1ETYA 2IEKA 2MW8A 2DA3A 4D7NA 4DYRA 4BY7J 1W0TA 3BG9A 2E1OA 4G12A 4IHXA 3SJMA 2CQQA 4M6VA 3QPSA 1FIAA 2HI3A 4B3AA 4A3BJ 5EZHA 2Y9YA 1R9TJ 4NDLA 1NK2P 3B6CA 3G1MA 3PO3J 1QVTA 4BKXA 4B1RA 2DMQA 4JYKA 1HDDC 2K9QA 2JMWA 3LNQA 1B8IA 2RAEA 2DMPA 1K83J 5IOZA 1TWAJ 1DU0A 3O8HA 2XPVA 1U9OA 2VPRA 4QSHA 4A93J 4W97A 5E3OA 2LVSA 5FKNA 5EGOA 1A5JA 1JKQC 4M3EA 5F1JA 3JRBA 2HYJA 4JX6A 1XS9A 3CMYA 3LOCA 2JA5J 4Y52J 1AKHA 3UJ3X 1VFCA 4Y7NJ 2CUFA 3VPRA 1MBEA 2HDDA 3WHBA 5EGOB 3RKQA 2DA2A 3SFIA 5J1RA 2AHQA 1PUFB 1IGNA 1MSEC 5BNGA 2GLOA 3ZQCA 1GDTA 3ZQLA 4RDUA 3FKIJ 5HODA 2DA1A 2QF7A 3BT9A 3FK7A 1POGA 1ETVA 1U9NA 2LP0A 2NVXJ 1WCMJ 1JT6A 2Y0SN 4J19A 4A3LJ 2EZHA 4C3IJ 1WH7A 2LK2A 4QIWN 3S1MJ 2GM5A 5M5YJ 4MFDA 2XB5A 3BR1A 1MBJA 5C31A 2EZKA 4XIDA 2XRLA 1RETA 4DZJA 2P81A 3FISA 1HCRA 5C34B 2Y30A 2DMTA 1IJWC 2E19A 2DA7A 2X9DA 4D5FA 2XSDC 3BTJA 3BTCA 4XRSG 2HOSA 4S0HB 1XC5A 1RKWA 1I6HJ 3HOZJ 3W6VA 2JJ7A 1U8BA 1W0UA 3BR6A 5E3NA 2R92J 3IV5A 1JTXA 5FKMA 2COBA 2DN0A 3K7AJ 2FD5A
chains in the Genus database with same CATH superfamily
5K3EA 3OP1A 5A71A 3T3IA 3ABMH 1U1IA 1A96A 1DE0A 2CDNA 2YJ3A 2PXAA 2CBZA 3PRHA 3R20A 5KNBA 1NJ6A 3JZMA 2B78A 1Z45A 3E9DA 4M2LA 5CCDA 3UMVA 1JBEA 4BCDA 4Q9IA 4Q93A 4IIJF 4CMEA 3C1TA 3LCJA 3X2QH 2OBXA 1F6BA 4NFSA 1OLTA 4D7AA 4HAZA 1QBGA 2A68F 3NIWA 5EIOA 3WWDA 4C01A 1XAHA 4A0HA 5TPWA 5CXQA 5DWQA 1FRZA 1WKVA 1ULHA 1VDMA 4LEIA 1A1VA 4OWRB 3H17A 4LRTB 1T2KA 4CODB 1ETWA 2GKOA 3TTVA 2QUIA 4D0SA 4U2FA 5CVDA 2WTXA 2QX4A 2HK9A 3UHJA 1UHWA 2SKEA 4C4XA 5BP7A 3M8EA 1XWFA 3HKDB 4PZPA 4RTPA 4RTNA 2ZYHA 5DTQA 1GRRA 1N4AA 3RODA 1RBMA 2FZCA 1UBEA 3TRKA 1TRHA 4YONB 5CITA 2C5BA 3L2OB 1KO7A 2FMTA 1UOOA 5KWSA 5BW8A 3EQLF 4EIWA 4FW9A 3DCFA 2IBMA 5M04A 2F3PA 1A5AB 5LBUA 1XB4A 4KC0A 3AV0B 3MW8A 4N49A 1GRNA 4M0UA 2C03A 4S1NA 1WP9A 3G9QA 3L2VA 2JJ8A 2Q4RA 3KOZA 4R8RA 3SC4A 4D9MA 4EYSA 4CN8A 3NTQA 4L8WB 4KMSA 3GA7A 1EG7A 2UZIR 4HV6A 3UR3C 3T5BA 4Q1EA 3DLHA 1AB6A 4YAEA 3DMHA 3I54A 4PRZA 2F4MB 1K63A 3JAWB 3OWOA 4PZ9A 4RHXA 3UVEA 1E0JA 4FQ7A 3KZOA 4NQWA 3I4MJ 4U6QA 2C96A 4PZEA 4JQCA 1IBCA 2OQ2A 2L54A 3TR0A 2OJED 5KBYA 1F5SA 3CX7A 3LLSA 4G9BA 3N58A 1ZGBA 3E6DA 3WGNA 3LOQA 5KYTA 2DT8A 5F98A 2QB5A 4BB9A 1BDMA 2CNWD 4H0FA 3S3TA 1U2GC 2I5PO 4Q00A 4MW4A 3O8DA 4RU1A 4RZ2A 5HWSA 4Q3CA 4I4NA 1YI2I 3JR3A 1OBHA 5EMLA 3RWBA 2VHVA 3V4OA 4ERNA 4CI9A 1O96A 2OCCH 5BPFA 4ZAYA 3VSKA 4AX4A 5KU1A 4MPJA 4FHGA 2GWRA 4OYYA 3D4LA 3FM5A 1PD0A 2H63A 4M87A 4UREA 4XGQA 3T3EA 2RAFA 2YV2A 3HCAA 2B7LA 5HLIA 1FNMA 3WBBA 1Y89A 2FP3A 2YVLA 3R75A 4UZEA 2Z4SA 5IU6A 3TNJA 2DA5A 3RJTA 4NZYA 2G82A 2EERA 4G5FA 2I3ZA 1XQXA 2EG9A 4P1ZA 4L9NA 3O74A 4ZZ0A 4K8OA 4LZLA 5C7LO 5HIJA 2BY1A 2WV1A 2AN4A 3MXTA 4CU5A 5FO5A 4IUYA 4RVSA 2ZREA 1DEXA 3H75A 1U2DA 2L18A 2Z3ZA 3CUYA 3JD4A 1WRJA 4HR7A 2CL7X 5F7ZA 5HGJA 3CRZA 5EZYF 1OB5A 1N5IA 3IB6A 3OEYA 4RIIA 5SZIA 1L5KA 4FE3A 1PWHA 4GR4A 4WESB 5K05A 1F2UA 2BMFA 4KZKA 4V3CA 3UWDA 3V1TC 2Q5QA 4A3IJ 3M34A 2BIFA 2IPQX 1W4LA 3T61A 2ZRPA 4RGSA 2Q6LA 1A4UA 4HNTA 4S0XA 1VQ8I 5DI9A 2FCRA 2JI4A 5BYAA 2CV1A 1T0JB 1WJ5A 5ER9A 4DGSA 1GTSA 2JIPA 4UVBA 4K9KA 5TS3A 1OWLA 5JNUA 5I5EA 3I76A 1G3UA 4LZWA 5JRZA 1RQ7A 2FV8A 2II6A 1ZI6A 3G5UA 2GVNA 1TJPB 4J4BA 4MDHA 4OK5A 2ETVA 3NEYA 5HDQA 2YX4A 4Y6GB 3U4HA 1RIFA 4BMDA 4ZHQB 2AK2A 2R7AA 5IN4A 3KTOA 4P9FA 4E5UA 5FB2A 1Q0ZA 3C3BA 3DO5A 3H5RA 1NN0A 4OXXA 2F5DA 1G8AA 3PUVA 1ZOSA 1KMQA 2PS3A 2R48A 4W7HA 3RRNA 4XOPA 2NO1A 3TYXA 3W5UA 2W6MA 4HBZA 1BTOA 3QVJA 4Q1CA 1MT0A 3QE9Y 4H7PA 3T6KA 1WHSA 3K9GA 3ZWAA 1FB5A 4A15A 5TGDA 5JAIA 1CRLA 4DCNA 2BW3A 1LRKA 3BGSA 4Y67A 5K8JB 1WBDA 3WC4A 4CEIB 2XPUA 2KPMA 2PKYX 4B3TB 2AXPA 5B7GA 5EI5A 3IP7A 2OOSA 1HFKA 1K75A 1SA0B 3IERA 5A62A 1CUZA 3MUNA 4XE5A 4QOFA 1TIPA 3I3SR 3I9V1 4RQAA 3QI2A 4G09A 2MSYA 1RABA 1A4RA 3C8UA 3D6NB 5KTTA 3GVIA 5JXIA 3ZI7A 4QDKA 1QHGA 2WK1A 4AJ9A 1G21E 4RHYA 4M9RA 4LRSB 5FBZA 3DE0X 1DB3A 3URMA 3KQKA 1CQPA 4NAUA 9ABPA 4L0DA 3LMMA 2G83A 4H7EA 4BNHA 2XGCA 2DGDA 4LF8B 3R9XB 2ICAA 3NTRA 3OZGA 2P5TB 1KZ6A 4LN1A 1LU9A 2DJIA 2O1EA 2AT1A 1Z5VA 2P1RA 1GM5A 2IHUA 3RRXA 1XG5A 3SFVA 1ZU5A 3RC3A 3WKDA 3OO1A 3AQIA 5SICE 3B20A 1JAZA 3KVYA 3UUEA 2XOXA 5HK9A 4BJHB 1Y8QA 1E62A 1M75A 4X6XA 3K4NA 3H19A 2TS1A 3CB4A 4QTUB 5DDGA 3WGLA 5K7FA 2NZWA 2PM8A 1ICEA 3FK6A 1WH5A 1NT4A 2I2FA 1FDRA 1X70A 1CJBA 5AI6A 1DJOA 3ZKWB 1ADJA 2IYNA 3I01M 4U0JA 4HB2A 5DM7F 4BDYA 1XZMA 4KR0A 1Y56A 5BQXA 1N2HA 1QP0A 5B7NA 3GARA 2G40A 1S7OA 4AWXB 5DXJA 3ROXA 4GOLD 4DMCA 1A5ZA 2PU7A 4GI7A 4H1VA 2JAOA 2PO7A 3NBQA 1DI0A 1GNLA 2R1ZA 3K2BA 4XYGA 1OB2A 4ENNA 4UM5A 2VDWB 3TD6A 2ELJA 2A4MA 2Q8NA 3AVOA 1A9SA 2ZB8A 1Z5OA 3HVHA 3ROPA 1OA1A 3FLEA 1ANKA 3NOXA 4FUQA 4MKHA 3BF7A 4A5MA 1FTZA 3RVNA 3N0WA 4PWYA 6PAXA 1G1MA 4UHBA 4BDSA 3HOSA 1JALA 2BSAA 1YI0A 4OXQA 4R9RA 3WTZA 5G1OA 3DB2A 3TAXA 2XRMA 3M5DA 4L9TA 1QHHD 2Y77A 3UO8B 3FDJA 4UTOA 1ZDMA 2IVFA 1ZGCA 2JH3A 4N4AA 3E70C 4P58A 4HGQA 2QZ8A 5FNVB 3RKSA 4GWLA 2Y69H 3TFWA 4A0FA 4PHCA 1ZHOA 1KR5A 3M6XA 1IRZA 5DT2A 4UFOA 2CRGA 5IT9K 1JQAA 1GADO 1LPSA 4DEYA 1DZ3A 5KKNB 4JX9A 3IWFA 1MX3A 4A2UA 2DRIA 2EKDA 3BZWA 4NOKA 4U7TB 4YI3A 1V1MA 4ZP1A 1R7JA 4QU9A 4EO9A 5AW8A 2QMOA 3HL0A 2BM0A 3F9IA 4P9UA 1TF5A 5GIOE 1Q7GA 1ODIA 5HTKA 3KQYA 4BNUA 1PLJA 1EVEA 4C30A 1H5NA 3ZN1A 5GM2A 1J8FA 4Q16A 3DAFA 1MIOB 3HDTA 1JFRA 2YHBA 4D6YA 4ZV9A 2RARA 1KVQA 4AECA 5ADWA 3AF4A 1ZH0A 3AK4A 1ISGA 3K4CA 1D2HA 2RGAA 3LGSA 2GJ9A 3LKBA 1B1CA 2K6GA 1KMNA 1AXEA 1Y3BE 3AY3A 4ZO7A 3X1WA 5IVIA 1YS6A 1T35A 4PXSA 1YR7A 2FUG6 2PV0A 3H2JA 3KPUA 3O8OA 3NRVA 2CFCA 3ETLA 1PBNA 1ACMA 1TYZA 2JHGA 3E1KA 1XZLA 3F7TA 3QPUA 5BSGA 1K0UA 1WSAA 3QVKA 2PZJA 4UVIA 1Q77A 4B75A 4CMBA 4X1KA 4R7TA 4URVR 1SCUA 2C3OA 4WW0A 5J3JA 3ZQ6A 1XHEA 5HF9A 1KKUA 4HEHA 4BFUA 1CZHA 1JILA 4FE4A 2R5NA 4FI3F 4QJIA 2B3DA 3ZJ4A 4KN6A 2A0KA 2JUGA 1EFDN 2P91A 4V0NA 3ZGVA 5FI5A 3LP8A 5G0TA 5KNCA 3DDNA 5IJ0B 5L51A 4UASA 1QIKA 1DFGA 1WMFA 3A9RA 3GMTA 4C1NA 2DH6A 1E2QA 3H2GA 3GUYA 3RYCB 2PSSA 2WTEA 2FZEA 2G76A 2ZIAA 2N47A 4N1AA 4TTPA 4ZODA 4ZT5A 4M1KA 3VR1A 1HK7A 4MR9B 2V7PA 3B8HA 1GKYA 5C4XJ 1K5DA 1ZUNA 2DKNA 3GJRA 3GPIA 3BXZA 4QULA 4RVCA 4X61A 1XYVA 1P5RA 4LK2A 4WOCA 4XQFA 2KYRA 3HYIA 1WUYA 2GAAA 4PS0A 1KOFA 3PFGA 4XUDA 2NUTA 1UKAA 1M5TA 2RAVA 3WG7H 2VDLB 1LK5A 1O6CA 5I9TA 1A7UA 1CUIA 3S1SA 2K40A 1FVFA 2RBKA 4MJ7A 4O4JB 1V1RA 4YYEA 4MA0A 4Z9AA 4I50F 5E6RA 1E1CA 4TWJA 1Z05A 3CBQA 4FYKA 4LC1A 4YUWA 2FQQA 3UK0A 3VKGA 3RAJA 1CE8A 4FZVA 4KO4S 3HXPA 3K09A 1PGQA 1X14A 3OSUA 4ESJA 5LLDA 3BXOA 5AVKA 1E0DA 4W1SA 1KDOA 1LKXA 1YBAA 2IHZA 3EQ6A 3LUKA 1PD1A 4JR1A 4K6HA 4RVNA 2FPUA 3V42A 2YVKA 3IMEA 2GZ2A 1NASA 4O1HA 6GPBA 2FEOA 1GA1A 2IQIA 2FDRA 4QOHA 3BZUA 4LE2A 5AYVA 1KI2A 1AC5A 1QG2A 2A2ZA 1E5TA 4ZYDA 1KZYC 1MPTA 1ILWA 2KHZA 2P41A 3ANMA 1O8CA 2JIQA 4R9UC 1VTKA 3ENVA 2QT9A 4GMHA 2MFZA 4OLJA 4HPWA 2BRUA 1DIGA 1N6OA 1J8MF 2CL5A 1F14A 2ZRAA 3AIOA 2ZT7A 4XRMA 1CU1A 3X43A 4D96A 2KFDA 2J5OA 3B7GA 4QEZA 4CMCA 5JHGB 3S2IA 1S8FA 2PH7A 2UZ0A 4ZWNA 5BY2A 1Q57A 1GGHA 4QRDA 3ONQA 4B46A 1APBA 5F21A 4D9HA 2AJLI 1LTQA 3MWDB 4XVQA 1V8ZA 4CQMB 4F9FA 4RQUA 4WBNF 5FWYA 3HYNA 2ZC2A 1U0SY 1OFVA 3GBGA 3R1IA 4MUJA 1DTSA 4OQZA 4CQMA 2HX1A 3A1FA 5FTJA 1E61A 2AQKA 5CA0A 2V7VA 5TQ0B 4F45A 2DERA 4EGYA 2BBOA 1G41A 3IDFA 2A86A 2GCGA 5LPNA 1H89C 4JJFA 3HKZA 3RQIA 5K5QA 3ZZ1A 3TPCA 4HLXA 1P4AA 2C3UA 4AVYA 5MN4A 1V4BA 1U3DA 5AH0A 1IIRA 1T34A 3DDOA 1ORIA 4CWAA 3LT2A 4AJEA 1M6WA 1R6VA 3F3KA 3I9OA 1PJBA 1SXIA 3SKYA 1RBYA 2GM9A 1PNRA 4ZEVA 4TXJA 5FWXA 3SP1A 4HLUC 4P53A 2R6JA 4GMKA 1K6JA 3IP8A 3DTNA 2N46A 1ENPA 2FEXA 2XNJA 2XXBA 4BX9A 1VB3A 4JI7B 2Z5FA 3D8RA 4CDGA 2WA1A 4HH0A 3MT9A 2Q29A 1FNSA 4FCYA 4WFQA 5KOHB 1TL7C 3TE6A 3ZDQA 1FOXA 4JR2A 5L4NA 4PAQA 3TF5A 2WYWA 3D5QA 5DBIA 3WGVA 3DOUA 5JG7A 3C4VA 3U9LA 4IHXA 1HE3A 3VO8A 1QJCA 1AE1A 3W5BA 4AL4A 1KJ8A 3TLKA 5JXWA 4Q18A 1NLMA 1P80A 4IIVA 2GAJA 5LDGA 4EV0A 2INGX 1BRTA 1BQ3A 1O6ZA 2O9JA 3GIDA 3A2LA 2B5VA 4BNGA 3MWLA 4C0BA 4ZCMA 5J4HA 2EGGA 4MQ5A 2O14A 2Q1YA 5EXPA 4B3IA 3ZHCA 4XWGA 4EBBA 3B6CA 4OOIA 5IS2A 3GIWA 1HZZA 1YL5A 4OLFA 2RG1A 2Q8QA 2AF3C 2E35A 4R1PA 5BV7A 3F98A 1A27A 5FTLA 1BCRB 1ZC4A 2BRUC 4DHEA 3COJA 1G2IA 1JHYA 2MBFA 2LXNA 4QJ3A 3ANXA 3KR0A 1O97D 1WX1A 1XZIA 3P9CA 2NW6A 4HAWA 2MC4A 4JLKA 2O0HA 2Q9CA 4JJKA 3TRFA 1QGZA 1YQQA 1EVYA 3UTCA 4W97A 1R8QA 1E3PA 3FR7A 2ZJQF 1I01A 5E3OA 2J30A 4XNFA 3FDFA 3GN2A 5SZHB 3ZU5A 4LOIA 1AQNA 3BEOA 1RRJA 3QPVA 3QYJA 4EUNA 3JRBA 2BMJA 2QYSA 4B7ZA 4D74A 3WSWA 2JA5J 5HS4A 5FB3A 1SY7A 4JB8A 4OI2A 4Q39A 3WZLA 4DRXA 4G01B 3WNQA 4D0LB 4FOPA 1Z3CA 3B1XA 3AY7A 3D59A 2HLNA 2YXPX 5IAAA 4BPRA 4L0YB 1I5ZA 3JASB 1DGWY 2EEPA 4FFNA 4IL6C 3AFMA 3D7RA 2F43B 4WNAB 2JKYA 4CDRA 4EQ6B 1J09A 4XONA 4RCYA 3E2IA 1LJ8A 1NDQA 1Q7TA 2EJUA 3HDYA 3JQBC 3OFNA 3AVTA 1MTZA 2NU6A 5AO9A 3WYAA 3ZIDA 3JATA 1RMYA 4YP6A 1TM4E 3PHGA 4EGZA 1EE2A 5CPBA 3QQPA 1RKBA 4JXJA 1YCHA 4X6YA 5IMSA 1MAAA 2WAAA 4HDRB 2Y0BA 2FHPA 2X6WA 3C8MA 4MLZA 5FPPA 4PSAA 3HN6A 1TP4A 1XTKA 3W9BA 3JQRA 2WIDA 5JNVA 1AUOA 4NZMA 4PYKA 1IWPB 1L5HB 1KBOA 3CZ4A 1KIAA 5I7RA 1SC7A 1DQRA 1Z28A 3A9CA 4GP7A 1OZGA 3GRKA 4KQJA 4N5HX 1ZO8A 3LPAA 3KJQA 4F3RA 4Z3OA 5E7JA 4KREA 3W34A 1MHTA 4GLLA 2H11A 2XUAA 2YVQA 4M1MA 4G5RA 4X85A 1B26A 3BRWA 4JEHA 3EXHC 5B12A 4YWHA 3E58A 3KHSA 1K7EB 2DA7A 1YR8A 2IZ0A 2LIVA 2PH5A 2AFIE 2WD7A 3NGMA 4U39A 5DVZA 3RG2A 3JWEA 2VQEB 5BMZA 1I36A 3ASNH 5BPDA 1UPXA 2CJWA 2HPHA 3PDIB 3W5IA 3TPFA 3GFLA 4TL6A 4DQKA 3I2GA 2HA2A 1GG5A 4Q47A 2B6HA 4IWNA 4J0FA 4GO1A 5BQPA 3LQFA 4LF4B 4DLKA 1LSJA 2QJWA 1SXQA 2OFPA 3PUJA 2R5WA 4WEOA 4H77A 4R1LA 2R751 2BXZA 2DHDA 3EWSA 1JQBA 3E9CA 4RL4A 4XGNA 3CNQS 1PWZA 2VOPA 4RF5A 4ER6A 1JTXA 3KAPA 1X8LA 2EJBA 4A6DA 2JFYA 3MTAA 3NUQA 2X4LA 3PPVA 3GTQJ 4JSTA 5DYYA 1AGRA 1NVEA 4BVGA 4BY9E 1FPQA 4V2UA 4YLGA 4TZKA 2MMCA 2OAEA 2ZJZA 2R7QA 4ROSA 1W96A 4FHEA 2W5UA 5I9IA 5TPZD 2PEYA 3H2SA 4QQRA 1SKYE 3SICE 1W4BA 2EC5A 3UAXA 5JYDA 1SUPA 3C3KA 3FXQA 4FASD 3SF8A 1CK4A 3EZLA 4V0KA 1S3SA 3IJPA 5WRFA 4JXKA 2H17A 2VYND 1O2DA 3TDZC 1WJBA 2FQ1A 4MTLA 4EJ0A 3PL5A 4OGGA 5CD1A 2WU1A 2FRXA 1KQNA 3S16J 2XQVA 4XDGA 3MC1A 1JJ7A 2A35A 2G5TA 3H9JA 2NSDA 2FDCA 3HZJA 3S15J 1PK8A 4XYLA 2R7LA 2IQ5A 3BIJA 1P0FA 2GH1A 2ZSFA 5IEJA 4HB0A 3KKKA 1G8GA 2P1ZA 2R6FA 3FMVA 3PXBA 2F5CA 3NTVA 3CNBA 4OUDA 1L5HA 3VAAA 4DILA 2HQRA 1VQKI 4MYRA 1PR6A 2Y2UA 2HU7A 3S1QJ 4Q12A 4RHFA 1PFQA 5FUBA 4CW7A 1PFWA 1U9IC 2I2AA 3MAJA 3JREA 1IV6A 3FPKA 3ILXA 4K2HA 4K9QA 3SXJA 5HS8A 3M1AA 5CU7A 2XWBF 1X3WB 1NTOA 3FPEA 3PUXA 2JWTA 1UQRA 1P4XA 3ERMA 4O02B 1N2CB 5KC9A 1VQ9I 3HVKA 1RQXA 2E55A 3HI6A 4R40A 1XGKA 1CYEA 2UZAA 2NS8A 4UUSB 2CFIA 2WT9A 4EI9A 1UIMA 5KNDH 3U81A 3PUBA 1QH9A 1QBJA 3GJYA 3IT2A 3AAFA 4BL0B 3RJMA 3TBFA 3LCMA 1JH9A 1KBQA 1OI3A 1OXMA 2XQJA 1ZBDA 3KKZA 4MQFA 4DUGA 4UBMA 1IN4A 5B4VA 4OJNA 2IH4A 3C6KA 5FOSA 2WQ7A 1JP7A 2FEWB 4MEYF 1TRKA 4L3WA 2RHHA 4XPIA 2I8LA 1ADGA 3CYFA 1E7MA 3W2EA 1P2GA 3PYXA 2X6RA 4FFVA 1LLFA 2P0YA 3M5CA 1R4AA 1GLGA 1YDHA 2IHVA 3K1AB 3N70A 1XA0A 2V9ZA 4Z1MA 3JX9A 3RROA 1I2MA 4D43A 2NX2A 1GCIA 2Z83A 4HB3A 4KL8S 1SMTA 3UFXB 5KNCD 1F60A 1B1BA 5D00A 2Q4TA 2QGZA 1YR9A 4WTOA 4M9UA 4J00A 1BCSB 4N7BA 1WDTA 1FSZA 4Y9SA 3DPSA 1T98A 2VC1A 4LHXA 3N2YA 1ID1A 4AAYA 2DMRA 3HKBA 6Q21A 3TNYA 1Y9JA 3ZBTA 5AKKA 3IRVA 4MCAA 4XIJA 1Y0UA 1YCFA 3WHIA 1AJEA 3PC6A 5IWCA 1YRYE 1RWWA 1OIXA 3TP0A 4A3JJ 4FR2A 1UB9A 3O3KA 2CZCA 3I3OA 4OHWA 3W1EA 5LLTA 4JA2A 1GPLA 2ZR7A 1AMOA 4FJ1A 2ZYVX 3OA0A 4GI3A 3Q8XB 2D1QA 3N2KB 3Q5FA 1Q3HA 3THXB 4ENWA 4H18A 1XCPA 5LQMA 4QWMA 1U5TC 3DW1X 4M76B 3EJWA 4PZLA 2V1XA 2Q8KA 4PN7A 4LMPA 4WBNB 1ZNQO 5AKJA 1VP3A 1OZFA 1KI9A 2GTIA 3EH1A 3LUPA 4FBLA 1QYDA 4Z9FA 1M2OA 1G20E 1SBNE 1BMTA 3BRQA 3PGA1 5U4XA 4CKEB 3BOSA 4G1UC 2W6QA 2RDPA 5FLXK 1BVUA 1D5WA 2VJNA 2IXSA 2PLYA 2C1ZA 3M3HA 4P3KA 1DUVG 5DP2A 4B9AA 5LOVA 5CQEA 3SXUB 1MB0A 1N32B 1J42A 5KQGA 4LDZA 2PX2A 3IC5A 4ZYEA 3GGDA 3OEHD 4D81A 2A8YA 4GKJB 2ZBVA 5JYBA 2DJNA 1NRXA 1KZ9A 2WAQN 1L7AA 4DUPA 1XNQB 1E77A 4CSWA 5L4SA 2BMEA 1R5GA 2P9FA 4XCVA 4J75A 4DQLA 4HNQA 1DRWA 1YI8A 5TVKA 3ZNNA 4JI8B 2D0OB 1GL7A 3PXDA 3BTLA 2BPOA 5DHUA 3IAEA 1U78A 4PSXA 1SU8A 3DBHB 1LUAA 2XTJA 3P27A 1MVOA 1SHTX 1ZU4A 1AUQA 2YV5A 4HQ6A 1J2JA 1WCWA 2Q2NA 1O89A 4Q82A 1HT2E 1TU3A 2ID9A 2HNHA 1HSOA 3E9MA 3TGWA 4EM2A 1ZREA 3ZV7A 2PI0A 1J1IA 2DSTA 1LLDA 2H2FA 1TJNA 3R61A 4KQIA 4WWHA 1GEGA 2AK3A 4KBFA 1DG9A 3LE8A 3FXUA 1RC9A 1FYXA 1S0UA 1TKRA 3U37A 4OHYA 4CNBA 2GEFA 2F6CA 3VOBA 3NMUF 1SKBA 3RB8A 4NCNA 2NYUA 3DAGA 3QVVA 3K6JA 2C6YA 1FU4A 1FJ2A 2UUOA 3OJLA 4FMCF 1QLJA 3V6LA 3C41J 1UC8A 1DMSA 4US2R 1XSDA 1W0KD 2HJGA 2ZIGA 1DBPA 1ODSA 1OBCA 1SC6A 2A9FA 3KP2A 3HLKA 3M9XA 5L3ZA 4DLPA 3OOHA 4DBVO 1Q17A 1VIAA 2A57A 2GM4A 1Q1VA 5B1SA 5FBLB 4B6JA 2ZVQX 3K5HA 2RH8A 1XPOA 1QO9A 1VJ1A 2GKGA 3LLCA 1ATZA 1Z6YA 2ZYIA 3FR8A 5F1PA 4LQ4A 4Q37A 2GK3A 4RAQA 4KODA 1LPOA 1PR9A 4PC7A 4CF4A 3TB6A 1GP2A 1Q0RA 2RGNA 3E6MA 1R0KA 3DMPA 4G5HA 1RQRA 4JGGA 3T15A 1UKEA 4A1FA 1KK3A 5DCYA 5CGZA 5M3FJ 4B17A 4I98B 1ETQA 2XRYA 5HSGA 4BCCA 4NVRA 2F5EA 4ENSA 4M74A 1XA3A 2EW8A 2FLKA 4HI0E 4NPCA 4ENQA 1H2WA 3B36A 1E1RD 4DMKA 2VIIA 3HR7A 4WQMA 1DBSA 1O03A 2B8TA 3GA5A 5T3YA 2V6MA 4HV5A 2RHMA 2V7QA 2EV6A 3AR5A 1QHFA 1WEKA 3ED5A 3LV8A 3KR1A 1E3LA 3QTTA 3C3XA 1E4EB 3L0IB 4OGKA 4WLFA 3VPGA 4EY7A 3U2RA 2R7VA 2K4BA 4C2MJ 1GNTA 3HY4A 3F3XA 3OI7A 5H7XA 4FOOA 3VHXB 3VJMA 4BVFA 1QAQA 4CCMA 2VLAA 3SM3A 4D3XA 5JFGA 3UMBA 3SZMA 1B1AA 1YZQA 2IZ7A 4RGBA 3P71T 1GZHB 2OSBA 3HGMA 1SCNE 2SECE 3K20A 1L4YA 4MQMA 4U7PB 1TM1E 4PCQA 2I6UA 4K0RA 4UUMA 3KQWA 1DBRA 4DIUA 3AVYA 2NYVA 2WLSA 1MMNA 3L7CA 4BQFA 1SD5A 1ZTRA 3QPTA 3ZXUB 2CLCX 1WWKA 3WJ7A 1LTKA 3M4JA 2F3QA 1F1ZA 1P7VA 4C43A 4JBXA 4WOBA 3S5JA 2L4MA 3PNTA 1BO6A 1RI4A 4LV8B 4GVPA 4KSBA 1PL8A 2WKPA 1M83A 4CYCA 1IK6A 1YS2X 3C97A 5DD8A 3EXIB 3TSZA 1LJUA 2ZSEA 3ZY3A 2VP4A 1M5UA 3IXQA 4P4TA 3RARA 1PW5A 3A4LA 1G7RA 3DEYX 4C5AA 4KDRA 1OPCA 3L09A 1ULUA 3RS8A 3P26A 2H2AA 5GOZA 5IJWA 2PT9A 2YOHA 2CLLB 1DUXC 4B79A 3JSOA 2ZBGA 4IIYA 2QTVA 4RMHA 4LF6B 4JQYA 2GTPA 1J5XA 2B1QA 4PONA 1OCTC 4BJ3A 2RNGA 1YZ3A 4M1SA 4WZAB 5A5EA 5GV8A 1GXQA 2BKVA 3H9QA 2IXEA 3ACBA 4NB5A 3F4KA 4ZALA 4FISA 4UJ5A 2NO6A 5FWYB 1EX9A 3NGXA 1OLSA 5TNXA 5FADA 2A5YB 1YLFA 2GXSA 3TSOA 4GWGA 3VHQA 4BEJA 4FMBB 3MTEA 1ODKA 1OYWA 3DWGA 3PHIA 3UB4A 4AMVA 4NCIA 2XOKA 5HUJA 3ZWPA 5JCZA 1R10A 4MW9A 3VM6A 3RF6A 5LZ4A 4YCNA 5AXDA 5KSYA 1XRMA 1Z8DA 1A36A 4Q9JA 3T95A 2YUSA 3ULKA 3OD5A 4RANA 1BGVA 3VR5A 2JDIA 4IGEA 3PKJA 1T9GR 4G6ZA 5DLDA 3UW1A 2AFHB 4DBQA 4B85A 2H8RA 3G9XA 4JKYA 3SR3A 4F11A 4YMVA 4DB2A 4CEJA 3B85A 3IAUA 5LA6B 2XWQA 4XQEA 1VHLA 3BJ6A 1W7PD 2FQWA 2QI9F 3A3OA 3CZAA 4MV9A 4QA9A 4WXPA 3S3NA 2GHTA 2VDUE 3WAKA 4NNJA 1W85B 3W05A 3A3KA 4L8LA 3IQIX 3B52X 1ECCA 1WQ3A 5B58T 3UK7A 3U31A 1QC5B 1MAHA 3EPZA 2VP0A 3Q7PA 2O8NA 2QG9A 3FNQA 1DO2A 4OTZA 4PY2A 3SMVA 1WIWA 3K9LA 3W3AA 2JI9A 4FFDA 2R00A 4PNEA 2EA2A 4II7A 2OV1A 4UXJA 1W75A 4JR0A 5K6RA 3UWMA 1KQGA 4J0KA 3T3DA 1I33A 3NT4A 2VOJA 3DA8A 3OURA 2QDXA 4DQ0A 1OROA 1WBJB 3FNHA 2HXIA 5JJIA 4Y2GA 5JW6A 2D5VA 1YZVA 2WWTA 2ZWAA 1M2NA 2DWPA 3FNGA 3TIIA 1E0SA 5ENVA 4DARA 1MJ9A 1HF0A 4DJJA 1BS9A 2UXNA 4HQ0A 2GR9A 4V19K 2C9ZA 2KZVA 2JIZD 3C1OA 1I7SB 1Q0TA 2A0WA 1S8NA 2C8JA 1JJ8C 4MI3A 4LJ4A 5LUAA 3GRPA 5B1AH 5I9LA 1FMVA 3FX3A 1WSUA 4B2LA 3CLTD 4LBZA 1PW7A 2AVDA 2WMNB 4XM1A 2X0FA 4KPYA 1FL9A 4WBXC 1Z6GA 3U3OA 1R0WA 3FUWA 1XCBA 3L1PA 3O73A 1L4BA 3EHEA 3PWKA 5KAPA 4D97A 5KX5F 4MQ9F 2H65A 4WA7A 1VQ5I 2PH3A 4J9UE 1XLVA 4DJAA 2ORED 1G38A 3DWEX 2NV0A 3IP9A 4Z0NA 2WIKA 3RSQA 1IJKA 3O38A 3S1RJ 1C0LA 4F97A 1W36C 2LE0A 4YUAA 4D44A 1ZSVA 5C32A 3ER6A 3GRYA 4EHLA 4CIYA 2GEKA 3T3HA 1H1LA 4DYQA 2WFLA 3TJMA 2ODTX 2QRNA 4A2PA 2CBXA 3ME5A 4P83A 4F9GA 3P9IA 2PH1A 2VFAA 3MHPA 3I01A 2PANA 2QM0A 4BH9A 1CLUA 3MYRA 3Q41A 3AT1A 3R8XA 1TC2A 4UBOA 5CK4A 1VE5A 4HL6A 5ITWA 3DXJF 1IN1A 1S1MA 3QNMA 3EBLA 2G9RA 3AR6A 5K0TA 4LJ9A 5DO9A 1AHNA 1H8EA 2APJA 3L0PA 4OFWA 4JT9A 4PPQA 1XZNA 1DCMA 5JAQA 3VVLA 4IMPA 3RDIA 1UIRA 5BRNA 1K7XB 2DHQA 4NAHA 4N3GA 4PSUA 5KTRA 4UAUA 4XMYA 1YGYA 3BIOA 5KI6A 4JROA 5KNBD 3F8NA 2WU3A 1Z37A 2VPPA 1E0KA 1YRBA 2JDID 3BZKA 1CB0A 3FPFA 4E7JA 3HFSA 4J43A 4RIEA 1SUCA 4ZI7B 2P6UA 2W00A 1H0SA 2QAGA 2FE4A 1JGSA 2XUPA 4EX6A 3DF8A 2VHWA 1RPTA 3H83A 5JNSA 1ESMA 5H9VA 2OM2A 3QBTA 3CRRA 2BZ1A 3EXG1 1E5XA 3LH5A 4MV8A 5AJUA 4M8SA 4QOJA 1RADA 2J3EA 4DDUA 1F20A 4G4JA 5HW0A 2PWBA 5IVDA 3NO4A 2HKIA 4UE2A 4NC8A 3U7FB 4DJ5X 1W46A 3E15A 3UCFA 2R84A 3PFWO 1CIJA 2IDMA 4WKGA 3ZX5A 5LYJB 4BFWA 3ZCQA 4POAA 5HF6A 1HX7A 2R5ZA 1HC8A 1C1XA 3K32A 1GZDA 1PDWA 3HZZA 2NXCA 2I3GA 3KCNA 1USSA 1DFIA 1SCKA 1YJXA 2M4GA 2XDQA 3PR2B 4MCJA 2P0AA 4RLSA 3RBAA 1OHHD 2WY7Q 1WHTB 4FX5A 4GKBA 3LQQA 3RVSA 4CFSA 4F7DA 1NMQA 1TF2A 3MT7A 4MVYA 1DRJA 1E1QA 1G20B 4EM6A 3HSEA 1YASA 3H97A 3RVMA 1N7IA 4NHEA 3N8NA 4FQ8A 2WW8A 4K81B 5TF0A 4B3AA 3DSRA 3R9XA 2L9VA 4QNNA 1ZW6A 3NCHA 4NXNB 2IHNA 1P6QA 4M4SA 4MRVA 3U4DA 5LBTA 3SXYA 1ND6A 1PZXA 3AFIA 5IT9Z 3TM4A 4HDRA 4CIWA 5IHXA 3STTA 3K0SA 2OCLA 4B40A 2DMQA 3M70A 5ALLA 3E18A 2MH2A 2YJ5A 4JLAA 1RYYA 3FZNA 3VDNB 2BGGA 3GLSA 1R12A 4XN0A 3D0KA 1VCHA 1DUSA 4KLNA 1E2XA 4Q3DA 5YASA 1I3LA 4AB1A 2VTBB 1W4MA 3K6KA 1M66A 2PSJA 4DY6A 4MUMA 2H4WA 4PFQA 2ZDHA 1W19A 4RVHA 4JYAB 1EQUA 3OESA 1H0MA 4GLOA 4NENA 1YC5A 1D4OA 5BSMA 4DLAA 3KRTA 4ZZIA 5IYZB 4L8GA 1U5TB 3R3SA 4O3MA 5DNDA 4G9YA 1KAMA 3W06A 3HXQA 1CJKC 2RE8A 4AF6A 3ZVRA 3H6HA 3NHMA 1O94C 1XS9A 1BWPA 2XNDA 2X9LA 2O0JA 3NM5A 4KQHA 1WA5A 2HLDD 2F55A 3O92A 1ESZA 4WKBA 4ZQCB 3RF7A 4BKQA 1EFPA 3CZRA 4UHHA 3KLMX 3ZIUA 1N2EA 3RVKA 4ASUA 2B4AA 1H4SA 3CY6A 5J1RA 2J3LA 3GGCA 4CLRA 3TK1A 5JXJA 4N48A 1TTHA 4HY3A 3DAHA 3UAWA 1T6SA 3HZHA 1EK6A 2FPOA 4H3VA 3E9RA 3LUHA 3ZQQA 3NEJA 4L9AA 3I3LA 1KVRA 5KYYA 2WTAA 2C1EA 1YZYA 1MO4A 2ZYDA 1DPGA 2YC2C 1ZH5A 3DT9A 4N54A 4UDXX 4W1RA 4JI6B 3RSSA 3KOMA 3W1VA 1K92A 2CD7A 3O4HA 1JLRA 2DAPA 1IUPA 4DFDA 3QODA 2GA8A 4EABA 2H8KA 1ISFA 3MJHA 2F2EA 2X0EA 4YRMA 4JLJA 3SFZA 1PZFA 1NXTA 5JNRA 2PXXA 2VDQB 3OY2A 4KN4X 4TSFA 2EA4A 3KETA 2YCBA 5IC6A 3LUAA 1ODFA 1W1IA 2C29D 3O90A 1H8HA 1MH9A 4J0QA 4X1YA 4LXUA 3UV3A 4KYVA 4WJLA 4QPQA 1Z68A 4BMZA 4BMSA 4MVXA 4WDRA 3VOSA 2QTLA 4UV9A 1ZXBA 2DMTA 1XGSA 1WTCA 3EEQA 3L8EA 4ML3A 1DPFA 3WDKA 3N6VA 1THZA 2FEPA 3FVQA 1BX3A 3K53A 4XX0B 3SE0A 3U5ZB 4WN9B 4GX1A 1H3NA 3R0IA 4XRSG 5E8JA 1LQ1A 2J31A 4NOJA 2W8ZA 5HUHA 4G7ZF 221PA 4MIYA 1J8QA 5ESXA 4BGEA 2XVMA 4G67A 5AW2A 3D7LA 3NNNA 3HOZJ 3W6VA 1BVYF 3QAHA 1SKYB 3ZI0A 1ISRA 5ILSA 4C0LA 4JX8A 1CR1A 1UFMA 4ARBA 1HTWA 3BRCA 4ZYGA 5NLLA 5T57A 1RCUA 5JY6A 3EZ9A 5TEVA 4HS4A 4KDCA 1XN7A 2ECOA 4JYCA 1QH8B 5EHQA 4F85A 5K2OA 2RCYA 1E17A 3CP8A 4GZLA 2NU6B 1RWXA 2HOQA 3CT6A 4F3KA 3HL4A 1Q0LA 3KIOA 3E23A 3NTUA 2OB1A 3LA2A 3M6MD 4IEFB 2AKAB 3FRIA 5ISMA 4HDSA 3K0FB 4H9GA 1PZHA 1U7OA 2PJUA 3E27A 2QZ9A 1S72I 1Y8CA 1CQIA 2ET6A 3AESB 5JZ9A 3ELUA 5D5UB 1F8YA 1WHUA 2OY0A 1Z6AA 3KPJA 1IBSA 1HM5A 2DX7A 3OHSX 1XB2A 5CJ2A 5CT4A 3QXGA 1NZJA 4HKTA 4CGYA 4EY5A 5C5DA 1ZHFA 1CUAA 3E61A 4F93B 1HA8A 3DV2A 3I0MA 3KYCA 4JB2A 5J6XA 5HLTA 3F71A 3HUFA 2I2BA 3AP2A 1XAIA 1WKMA 2PMWB 3NC0C 1JEDA 4RE6A 4YELA 3OQVA 1OPXA 3TBHA 4TTVA 2GBIA 1HNXB 3TKYA 1NC3A 1TADA 4TXMA 3BQNB 2V6JA 3C7TA 4MAMA 3Q0TA 5KJ1A 2P6MA 1B59A 2VCEA 3ROUA 4DWWA 5JC1A 2Y31A 1OILA 3BK1A 3ASYA 3U56A 4P4GA 4XQGA 4MDEA 4GRDA 1ZXXA 4EFNA 1X7ZB 5HIMA 4PLTA 1A8PA 1AZLA 2AH5A 4FHZA 1MFZA 4N4NB 1SG6A 3BORA 2R5ZB 4M1TA 2ADUA 2WIBA 3AEUB 4PHTA 1DQPA 4E15A 2DFKB 3BS4A 2QLLA 3H9EO 2NVOA 1PE0A 1H8HD 3HYRA 3JYHA 1M74A 1TK2A 4M7WA 4RTQA 4LPSA 2E5LB 4Q5SF 4KX5A 4QXRA 2VJMA 1J97A 2CYBA 2NNLD 1Q7RA 2HHHB 1BOFA 3PPIA 4UQOA 4IYJA 3PCRB 3B6JA 4O2RA 3ZY2A 3G5TA 3M6WA 1N2JA 2AFIB 2I22A 4GX2A 3UCEA 2I1LA 1P44A 1V55H 4B9EA 2C4MA 2QTCA 3WE7A 1SXHA 5T8KA 2Z9CA 3JRFA 5AD1A 1LBQA 4DBRA 1V95A 4HC4A 1WB6A 3DZGA 2DU9A 2O6GE 2YL2A 3VSBA 2L4AA 3E82A 1JHQA 2RHTA 4P3YA 1GITA 5IT3A 3U19A 2MYPA 2BVNA 3COZA 1NG6A 1RYMA 1WXIA 2E85A 2JZYA 4RABA 3PXGA 4HQNA 2ZXJA 3ULQB 1E2JA 1VZ3A 3SZGA 1LNSA 3PNVA 1SCJA 2Q5OA 2QSUA 3IKJA 3NV7A 1PEYA 1GQOA 4WEQA 3LQKA 4MULA 5TY0A 4AK9A 4XYBA 3CX3A 3AUAA 3ZR8X 3UK1A 1PDVA 2OXEA 4NDZA 2AXEA 5E6SA 4D3YA 3LTEA 1R6AA 2J3MA 4G1EB 4E3WA 5ABPA 5B1EA 2WBMA 4MI9A 2A7QA 2ZSHA 4HZUA 1I27A 2OFXA 3DDSA 5FEUA 1T10A 2QX7A 3AR3A 1NUSA 1TTQB 1W49A 1VG9B 4KWHA 3ZY5A 2QCOA 1QGUA 4AN1A 4F2HA 4ZT3A 1NWHA 1GPDG 3S32A 1QLHA 1UDXA 3JRXA 3HBAA 5AR1A 2GQQA 3GVCA 3LM8A 4GX0A 4K9RA 3DYBA 5JDCC 1Z0KA 5DNAA 3W4IA 5A04A 4EY3A 3A4YA 5LJIA 2NUPA 3PLRA 3ZK9A 1Z6QA 3I2JA 4PJLA 3D0RA 5E6SB 4M6WA 5AXAA 3FVWA 1O9HA 3FYUC 3ONNA 5LRSA 3A02A 5ADHA 1BH6A 1P4JA 2HCFA 1H66A 2IRWA 2QMZA 3MTDA 4OKSA 3VH4A 4CM1A 3VA7A 4I99A 2W6PA 4KXVA 3ENWA 1X94A 1I4TD 4I6EA 1EFVA 4FGZA 1VM6A 1DAGA 4NZZA 2GCPA 3BG5A 4O8ZA 1JQKA 2IOQA 5I8WA 2H16A 1HT0A 1T4CB 1E9RA 1SCDA 1VPDA 3HCCA 2BF4A 2CE7A 2HF2A 3SMQA 4CYDA 1N0VC 3K2EA 5D5XB 4NICA 5TQ2B 2HHAA 3F9CA 3RVQA 3LAJA 2J9FA 4L73A 4PLPA 3CLOA 3HP7A 3PD1A 3TVTA 2EQ5A 5BV2P 2OD2A 4Q1VA 2TMYA 4P35A 4URWR 3ISTA 4KXUA 1N5MA 2BBYA 1E7RA 1N6IA 2M32A 5CQGA 1ZMXA 3PXUA 4M1QA 4B7AA 4OAQA 3ND9A 3TRDA 5C44J 3HPGA 2WPDA 1YWGO 4TWRA 3SQLA 4KMFA 3LRXA 1JSRA 3Q5GA 4IOLA 2OHIA 2HXSA 3PIPF 2NOAA 3CDHA 1N78A 2CNLA 4XVRA 5B1IA 3B9BA 4RADA 4NFLA 3AM4A 3N2LA 1NXPA 1PR5A 1UOQA 3N0RA 1HFEL 2BOLA 4UHTA 3V97A 4QJ5A 3OCJA 3LLMA 4TKVA 2HR1A 2K5CA 4PINA 2WUDA 2WJVA 2Y3IA 2OO7A 2V7WA 2G1PA 4MGHA 2ECCA 1RTKA 1EFRD 2C5FA 1E3QA 2CMGA 2HV9A 3QYEA 2OHVA 2E6KA 2X51A 3CU5A 3PWTA 1P77A 2P9YA 3GRZA 4PIPA 2FWNA 4Y1FA 5CT9A 3H4VA 2PMHA 2P2CA 3MGBA 4AIHA 4NNPA 4D79A 2C2YA 1RLTA 1V7PC 2IJGX 1IDYA 5AUNB 2C2ZA 3BIWA 4B3JA 2BGKA 1OTHA 4RHTA 4MTCA 3CWCA 3W8DA 2IP4A 1QP7A 2M4KA 2M8GX 4KIUA 3KP6A 4OHOA 2RB4A 5DYIA 3SI7A 5K3OA 1QYVA 1JDSA 3E5HA 5G02A 1XD9A 3RNOA 5ICGA 1BE6A 3K2IA 3LIPA 3K16A 3I4FA 3M2PA 2RQQA 1F3OA 2HRBA 1Y1LA 2ZYAA 4GRAA 4U3JA 3I64A 4WD3A 1W5EA 3OYJA 5CT6A 5JBQA 1CQIB 1XYGA 3K1MA 2BI7A 2ZBRA 1QGOA 1ADBA 3BMOB 3AM1A 1LKZA 1XWIA 2PZFA 4ZKEA 5C1DA 1RLOA 2L69A 5C5EA 1TWCJ 3GVHA 1D3YA 2PL1A 2WWRA 1AK2A 3D6JA 4BNZA 1K8QA 5LLSA 3M4ZA 3WLOA 2FXAA 2QUBA 2VWGA 3M8KA 1II8A 5J8CA 1QFXA 1Z9CA 3FDZA 2QZJA 3ER8A 4D3SA 3JWIA 4AC9A 4OA8A 1USTA 3UHFA 3N6RA 4P6VF 1YQ9A 3KEOA 3EIXA 3P0FA 3GLLA 4W7IA 2HRCA 3JARA 1RAEA 3KUDA 2P8JA 4JYMA 4O25A 1CIVA 3IUBA 4WCFC 3VTKA 3X1DA 2QZZA 4I1VA 1FIUA 4I50B 1SVLA 3KJIA 4JHXA 4H16A 3CJQA 4D9GA 5EIXA 4EJTA 2TRSB 5GAEJ 4Y6RA 1U5BA 4KPGA 5JO0A 3BWBA 4NBQA 4YP7A 3ZK7A 1ZISA 4WXCA 2GD0A 3CN9A 5H9WA 1SFEA 3WTSC 3BGOS 3ZGYA 4L15A 2PR7A 4R31A 3QEMA 2I4TA 4XWKA 3VTFA 1QQ5A 4IHJB 3FCEA 3PL1A 1GTVA 2X4DA 3G85A 2F5FA 3ZU4A 2IBTA 3BXPA 4REOA 2LCIA 4Y2TA 3C7JA 1RM4A 3S2ZA 1RYBA 3TLGB 2P8SA 5E6UA 2FFJA 1JAXA 4NYMR 4BNDB 5K0JA 1RR7A 3UWKA 1VPLA 1NSTA 2FUKA 2QPAA 5JSQA 3ABOB 3JD2A 2PK3A 1P1BA 3E8SA 1N2ZA 4MUXA 1LDBA 3WRXC 4YJFB 2Q5LA 4IZZA 1RR6A 5IJAA 1OT3A 2V96A 4JBIA 4JB0A 3ZQ4A 1DINA 4AWXA 4BV8A 2VHYA 2FF7A 5F7XA 2Z9DA 3GV0A 5E79C 4BE2A 4CCOA 3GY0A 4AULA 5K99A 1S7AA 2Y0MA 1EA3A 4S1VA 5ILGA 3RRJA 2ZI3A 3RUFA 1SQFA 2PRZA 2OG1A 3L7YA 3TTTA 4G5SA 2Z2YA 2YIDA 1ORRA 2PBLA 2YV3A 4MGIR 4B87A 4YFYA 4AKIA 1T0FA 1T9GS 2DTXA 1ULSA 2D7CA 3H5IA 4MRMB 4TOIA 2R6ZA 3BCUA 1P62B 2PIAA 4XLTA 4RPLA 3UQZA 2ZRBA 5HJ7A 4PX2A 1OR7C 4XPIB 5EZ6B 4DPMA 3DR3A 5JADA 5FYDA 4TT3A 3DEFA 5IY5H 1H8AC 1UR5A 3KKPA 2XUZA 4O2AB 4MQFB 2E1CA 3UMSA 3ILYA 5JCJD 4TWAA 5J4KA 4C3OB 1TD9A 4JVLA 4U7WA 1RC8A 4CL8A 3G6EI 3BERA 3R9KA 5J2TF 1BJTA 2B8WA 2Y99A 2Z56A 3JRNA 1LBIA 3O4VA 1IY8A 2WE8A 3IMCA 5K7ZA 4OBWA 2IYTA 5EE3A 1E2BA 3M5PA 3M4OJ 1CS0B 1KQOA 1U2SA 4NKRA 4WFKA 1ZINA 4UAGA 3SWWA 5JTTA 2I4LA 3ZS8A 3H9BA 2TRTA 1F8XA 1L7PA 3FCYA 4J4HA 2CN1A 5DIZA 3W2WA 3ELKA 1FRNA 5FR2A 3J7AC 5TIIA 4BFLA 2WB1N 3WL8A 1OUMA 2HK7A 4KPEC 1NVTA 1U7TA 1WCYA 1XALA 2PXCA 3OLYA 2FWJA 1ISJA 1CY1A 2H1VA 3NH9A 4LRYA 1SPBS 4OM7A 2NAPA 4NYJQ 2YNMC 2A07F 3ZWOA 3FMSA 3B89A 5E1WA 4PCVA 4BCBA 2R7XA 3GZ6A 3DFZA 3QHQA 2UYQA 1Z5NA 1JI8A 3DFMA 1JEQA 4BV9A 3KELA 3N9IA 4ATNA 1YACA 4TLEA 2JLWA 2WA0A 1Y1RA 1PAUA 3OU2A 3DU6A 3ADDA 5ER6A 2ZYWX 3QEKA 4BU0A 3M8FA 3IWZA 4GPAA 4YO7A 4CEJB 2PA0A 2B1JA 4KI7A 1OXVA 3BB3A 2R6GA 4JLPA 5JAMA 3CO5A 4IHQA 3ML6A 1ZJ6A 3PR3A 3CVUA 3TTXA 4LVNA 5AW6A 4JY7A 5AMXA 4F2PA 4DIFA 5FOXA 1PL6A 4PG5A 2CWWA 3HRMA 1QVUA 2CUNA 5B55A 4P3XA 3EBPA 5F2OA 4OLHA 4FFBA 3KYLA 4ER0A 1HT1E 2M1ZA 3LYHA 4ILKA 1C2TA 2VOEA 3NYQA 3DEEA 2AOTB 2IA2A 4V0MA 5F12A 3RIMA 4EGJA 3IKVA 2MR6A 2O1WA 3EG9A 5LP1A 1MW8X 3P0IA 6AT1A 1S4MA 2HFKA 2W6OA 2HPVA 3UH0A 4CCYA 4CT0A 1QF6A 2HXOA 4AUXA 2CSUA 3L05A 1PTJA 3PYMA 4H60A 3L0BA 4YP1A 1TNDA 3BSWA 2Q5IA 3DQQA 4EJUA 2FA9A 1U5BB 3T1QA 4GOKA 4YY3B 3I52A 4A0RA 1SELA 2FGKA 2L2QA 2Q3DA 4N0PA 2QK4A 4XB1A 1XSEA 2MSNA 2BSXA 4JQZA 2FPXA 5JD6A 5F5NA 4AD9A 1X13A 1DWQA 2GHRA 4UUVA 3AONB 4FFRA 4GXNA 3FHJA 4EPYA 3AVVA 4JWTA 4KO2S 3QOPA 2LOOA 3REOA 1C30B 1V6SA 3EY4A 5IZCC 2MGQA 4KQCA 4RENA 4KR9A 2LH9A 1EJ6A 2B34A 1A9TA 2IIQA 3H0GJ 5MN5A 4V0ME 1RKQA 2QR3A 1M0TA 1LRLA 1X7YB 1K3TA 1CDOA 1FDUA 1PJ2A 3IUJA 1U9IA 4IMIB 2XVAA 5D5QA 5H3LA 5LC1A 3ROZA 4DANA 4D7NA 2ZUWA 4HLYA 3FPBA 4OHCA 1SBQA 2RAPA 4U3JB 1HOTA 1JG2A 3KEFA 4QYIA 3V4ZA 4I01A 2NO9A 1STZA 5F9FA 1IAVA 1KYXA 2QRVB 4ZU1X 3L77A 3V2GA 4IHKA 3VH2A 4EJSB 1I2ZA 2ZMEC 5KWEA 3M4XA 1VSUA 4A3BJ 3MJ4A 1MW7A 1PL0A 2ERCA 2KM1A 5L7YA 3L7DA 3HGTA 3S2EA 5EHZA 1HLFA 4HYQA 3IQFA 3ILHA 1OE0A 2QQEA 4O4JF 1GHCA 3KB1A 1JHVA 1EGHA 1WUTA 1D04A 1KU7A 1C9EA 1Z0JA 1W2WB 3AHHA 3R4VA 3ZS9A 4EKYA 2I67A 1P92A 3HEAA 2NSHA 4IDNA 3RT9A 2IYVA 1RQPA 1WSDA 4BNYA 5A06A 2HL6A 2I7VA 1PCXA 2XCRB 1JBKA 4TTIA 4XCQA 4LV6A 2GCOB 4WF2A 1UMDA 2JGIA 2ZQZA 1YQWA 5BNIA 3U3ZA 3W9YA 3TUIC 4MEJA 4G0MA 2BYTA 4Y9RA 3VJRA 3IMFA 4HMPA 4BU2A 4N5DA 4RS3A 4HVTA 3ZDEA 3AFGA 1LWOA 2VJYA 2VWHA 3TDMA 1U31A 4AUKA 5B3JC 3PTLA 1LW6E 5EC8A 3VOTA 4ZEXA 1GTL1 5FKNA 1OGYA 2VJLA 4RTSA 2HU5A 2PKQP 4OVKA 2J6HA 1FP1D 4M3EA 1JHOA 1EJ0A 2QSFX 1JTEA 1KO4A 1XZEA 2QE7D 1N5RA 3KYJB 1YRQA 3PX3A 3FFBA 1NN1A 3HSSA 1DP3A 2ZE8A 4QEDA 4EHJA 5LMZA 2H1OA 3LWBA 3QE0A 4FLFA 1GUAA 1DP4A 2EW2A 2W6ID 2JB9A 3JZIA 1KU6A 3PFBA 3QMWA 2VJ4A 3GFBA 4JJ7A 4Q66C 5ESRA 4UNIA 1RRCA 1JSXA 2VOOA 1GPMA 1MX1A 1QF9A 3KL2A 4K9OA 1H6DA 2I54A 2GLOA 1L4LA 1DJQA 1MQSA 2VQ6A 4Z4FA 2M7BA 2V4UA 2UYOA 4BDTA 4NZPA 4KN5A 2R86A 2W42A 3UUGA 4PJMA 1N6KA 2FZVA 3NWBA 4XD2A 3ZUGA 2DQRA 1N5DA 2IY7A 1M6NA 4GGPA 4MROA 3SC3A 5JFTA 1W5BA 3LDAA 4BGVA 4U88A 3VSAA 2PKQO 4IXNA 3UK2A 3FNFA 2ZB4A 1ETVA 4HFMA 1T9HA 5B53A 2NVXJ 1V3UA 2AOUB 4JBGA 1BJAA 5CHEA 1DEAA 4CV2A 1FA9A 3K0KA 2Y71A 4Z4CA 1NJFA 3HLTA 2NZJA 1AKNA 5D86A 4Q15A 1FMFA 1JHZA 1DHRA 3M83A 3FUXA 3NNDA 3QOEA 4OHRA 5C4IA 1KK1A 4XIDA 2C31A 2WHPB 1Y6FA 2XRLA 4DZJA 2B8NA 1U2PA 4Y1EA 4RK1A 4GZMA 4MGZR 3UMRA 4TUYA 2AMVA 1POWA 5CG1A 4M8IA 4DIKA 4R3WA 4CL3A 3P8ZA 4PANA 3OOEA 2YWHA 3DEUA 5D1NA 3GPLA 2X3UA 4A73A 5FV7A 1NU8A 3SHTA 3ABKH 5JJLA 2HOSA 1HDRA 2Q62A 1BEEA 4RKEA 2CLDX 1T4DA 2MWMA 1RKWA 1D3AA 3AF0A 2C4WA 1ZK0A 4GWKA 3UMFA 3UZUA 2NXJA 1PUJA 1U7ZA 2CLFB 1D2GA 2WAQA 2WLTA 3RPEA 2CJPA 1Y4SA 2E48A 3FBNB 1FFEA 1BQEA 2JQ7A 5G1PA 1E4YA 1ZIDA 2CLMB 5EHNA 3VPXA 2ZCUA 3A1CA 3RSNA 5ERIA 1S2OA 1W6UA 4FD3A 5EQDA 3U4IA 1YBVA 1PNOA 2HB6A 4OCZA 3V4FA 2XYHA 3WMWA 3F8FA 2X42A 2C5AA 3ZWQA 1UZLA 1U6GA 2O2CA 3W7BA 2WB1A 1IRGA 2NADA 4MRAA 3WMXA 4BP3A 5KVCA 5L45A 2J0SA 1X3SA 1PSWA 2ZM5A 2UUAB 1LVUA 4BQSA 3LF1A 4ZFNA 4L28A 2VSOA 2E4YA 1ETKA 1XCOA 2XGSA 1DNPA 3JAMZ 16PKA 1RWVA 4OL9A 4M36A 2ECPA 4IIBA 3ZKAA 3DDHA 3EMKA 4AJNA 5JCPA 4ICIA 1UMKA 2IYRA 1QGYA 1ITYA 3Q9SA 1K1EA 1ILEA 1UG2A 1W4CA 1E2PA 2H08A 2NOGA 2FUNB 3DAOA 3F97A 3OZFA 2FMFA 2RONA 1XL1A 2YUIA 1ZICA 4YECA 5DTDA 4IJ6A 1HR0B 1ADYA 3UT0A 1TNTA 4J1SA 4D6XA 3LIIA 4H7HA 5BSWA 5ENDA 2NVUA 3QYFA 1O58A 4IY1A 2RC6A 1HSJA 1BRMA 1T4GA 4B0OA 1L4EA 5H4GA 3LD9A 1DVRA 4S12A 1W1WE 1IZ1A 3I32A 1QANA 3FMRA 2CC2A 3LNTA 1T0UA 3WYEA 2PBZA 1V3FA 2VQ3A 2YWRA 2WIGA 3GT0A 4JVNA 4IFIA 4A8JA 2VNAA 3KL4A 1TYDE 4HWRA 3UXMA 1AXRA 4I76A 5GADJ 1AGXA 1ZD3A 1G18A 4OD0A 3AIKA 2QQGA 4JMLA 1LEHA 4RHCA 3ZCTA 3C3EA 2QSGX 4DDKA 1SK8A 2NM0A 4KAXA 3FKJA 4QRHA 1VL1A 3QJ5A 3WOHA 2P5SA 4ITRC 2X15A 4IXWA 3HCPA 5CBPB 2C07A 2XDAA 3PGLA 1QRUA 4AROA 3QVSA 3FMOB 4J29A 2CF6A 5B1DA 3KE2A 3EAFA 4MB2A 1GQRA 4AURA 3JRAA 4ZJPA 1XK7A 1EXDA 1XQ6A 2K2QB 5F1KA 3WQQA 1HE5A 1XFAA 3L6BA 1GDDA 2WSIA 3JXEA 4QTYA 5D1HA 4ZVUA 5C8YB 4TKZA 4EJSA 1YULA 4KAAA 2JI7A 4KFTA 5EE9A 3VBCA 4Q9KA 3CDIA 1L9XA 2IY9A 2R79A 4YCDA 1UT5A 3CVWA 4B6OA 3GF2A 2C9DA 3V80A 1N36B 1N6RA 2LRDA 2FSVC 3LX4A 3A4CA 4WK8F 1MSFC 1M2VA 4XUGB 3WXMA 2HIGA 4CIDA 4ZIRB 1PV4A 2VPXA 4UCQA 2DUNA 1KYIA 4KHZA 3UFBA 4MUHA 1W5TA 1JG4A 5DASA 4DSNA 4FEEA 1AK1A 2XB4A 1N6LA 5HILA 3IEUA 3F9RA 3HJNA 5ETJA 1CY8A 1ZM4A 3C48A 3FROA 4EB8A 1PQ4A 2W0MA 1T8YA 4I1PA 2JAHA 1G0NA 4CTKA 2OCYC 4DW8A 4E4YA 1PJQA 5THKA 1CUSA 3NX4A 5KYNA 4WN9A 1JTFA 4R8KA 1YDFA 1KI3A 2IU4A 3OHPA 2XUFA 5EOVA 5D5VB 1CZNA 1L7QA 1N2OA 3ZV3A 4DCCA 4YJGA 3D6VA 3P9SA 2Z1DA 1LC3A 4JVSB 1NXSA 4BAGA 2A5LA 1IDOA 4FCTA 5LP6F 2ZDGA 4KNVA 3LFHA 3WODF 4FSHA 3UUWA 1TZCA 4G5QA 3U0BA 3WXBA 2QN9A 1FFXA 3IIIA 4I1RA 3IEMA 1SHJA 1XNHA 4B44A 2YNMA 4BFZA 2FOIA 5BW6B 3WIOA 1H4QA 1T9ZA 2GYYA 4QPDA 4CZ2A 3B7PA 4C0SA 4OLBA 3AB7A 3B1YA 3C8HA 3OX3A 4I3FA 1P8AA 4BBRJ 1FXWF 1KS2A 2ATCA 2N42A 2QW8A 1IBRA 4JL8A 4Q3LA 5H16A 1JW9B 1B7GO 1VI2A 2FCAA 1GAWA 4OIFA 3TQFA 3HO6A 2I62A 2HADA 3FDXA 4EHFA 2RB5A 1G21A 1G5HA 4QHSA 2Y1CA 4DDVA 4I1OA 2DR2A 3HKBB 4LK1F 4KB5A 4DPKA 1E0AA 3LU1A 2FGJA 4DV3B 1Z83A 2PUDA 2QLFA 1QRSA 3FHTA 2CE2X 3TTUA 4B09A 4OI4A 1U4SA 4BGDA 1ZFNA 3AL0C 4QBKA 1CQJA 1N3IA 2V7UA 2PS1A 1Z5WA 1DJMA 3P9XA 4JL6A 4EMTA 3S27A 1CY0A 2DFTA 2RGWA 5KQPA 1P2BA 2G1JA 4F5DA 1WZCA 3I9MA 3UAGA 1K5PA 4L57A 4ESOA 3ST7A 3TZLA 1PEDA 1GVJA 4GBJA 2UXXA 5CJ9A 1S2MA 2VP2A 2XUHA 3IT0A 1KQ8A 4JUDX 3AM3A 3MKLA 4AO7A 2OPBA 1IUKA 4J1QA 1VKRA 2CVPA 2VF5X 4PXYA 5TJ9A 1E18A 2IEYA 3P2YA 4R1UA 2BKLA 1YJ8A 2RJNA 3N8IA 4H4DA 2EBWA 1TM5E 2R65A 1L7RA 3EGXA 3LX6A 3OM8A 1JR2A 4GSLA 3VU0A 3DM9B 2OGWA 1IN6A 1J49A 1QHIA 1GDHA 5EWMB 1NR7A 5KPJA 4XGKA 3HA2A 5ILVA 5IZCA 2DMNA 1P7PA 3CX8A 2Z04A 1IDN1 3KTAA 4U63A 3VR4D 4A9AA 2BT4A 5BW4A 1SQ6A 4CJXA 3L8MA 5ERGB 2KW5A 2D2EA 5DU2A 3UICA 3JAWA 4YGYA 1EIWA 1C3XA 1FNCA 3IVMA 5BN5A 4DQVA 2ECBA 3L7BA 3NAUA 2IKSA 1T5HX 4FEYA 4UAJA 3R3WA 3PSHA 5LHHA 5E7MA 2QNIA 4DSZA 3U60B 1DWUA 5AI4A 4CIBA 3AB8A 4B76A 3BZBA 3MJVA 5IAOA 2ACWA 1USUA 1CY7A 1JR3E 2QLMA 3HPRA 1XDBA 4KFRA 4AJIA 5JAOA 4MOWA 1D4AA 1FBTA 5K7SA 2ONKA 3H5AA 4GOXA 2K9SA 4C2UA 3B3FA 1MMGA 1XEAA 4ZVQA 3R74A 1OZAA 2FPRA 1F9NA 1SVMA 3WHCA 4B47A 1JEJA 2VRBA 4ZU6X 3WLFA 5JMOA 4RB2C 3LPCA 1GVDA 3NYWA 1O5OA 3LNCA 5A5VA 1FDOA 2NVWA 1R5JA 3IAHA 4K2AA 2CCJA 3ZDFA 2OZPA 1XTSA 1WXQA 2VR1A 3JYQA 4HEA1 2D7DA 1R58A 2IYSA 2FF5A 1GTMA 4UD6A 1D0SA 1AGPA 4ON0A 2G0TA 2QLNA 3EA5A 3FCSB 4RH3A 4BLUA 4DNFA 3OJWA 1VSVA 2BHRA 2Y1XA 3UATA 4DV5B 1ZIPA 1QQBA 1CC1S 2PSEA 3NT2A 2FNAA 4H0NA 2A14A 3WTXC 2FETA 4INAA 5DGIA 2PX3A 2AI1A 4HN4B 1E5QA 1HE4A 1MD0A 2W6JD 2Q41A 2Q6IA 3CEJA 3F8TA 5E4YA 3OJ0A 4E94A 2JS7A 1CD5A 4DNXA 2QYOA 4ZYUA 3DC7A 4E1VA 2ZXFA 2YYYA 3AJ8A 3DLLF 3IQWA 3PPYA 3DTIA 3DR5A 4IXTA 2AOXA 2ZJ0A 2JRLA 1A98A 4EITA 4NFYA 1F4KA 3GCZA 4Y9TA 2C54A 2J41A 1FTGA 2ODQA 3N2IA 4DMGA 3PVZA 3ZVMA 5ILUA 5I9SA 4CHGA 1R7RA 3CUKA 4UMVA 1N5OX 3IHLA 3OEWA 3NUZA 4GPIB 4MW5A 4F6LA 3AYXB 3JARB 3GYHX 1N8SA 1OPRA 2B37A 4IS2A 1WW3A 3H4MA 2HIMA 1FDIA 2JRMA 5FI1B 2FW0A 2O2GA 4JJEA 1XYYA 4A2QA 2WF8A 4TTTS 4B73A 2GBGA 3HDQA 4U9IS 3T9BA 1M0WA 1J2UA 2G5GX 4HUQA 5DCWA 5LP6C 2QORA 2B1IA 1GZ7A 3MWGA 3VQTA 1QS0B 5K4AA 2FE3A 1SBHA 4GPEA 3PRKE 5F73A 3HPQA 1I3CA 4UUSA 3AI7A 1H1DA 3MMSA 4EPTA 1KZ4A 1MX9A 3H7AA 4JCOA 4OEHA 5EG0B 4TV9F 3UJ8A 4AN4A 4B1FA 2GDZA 2JFZA 3NR2A 3OC6A 4XWYA 1GJRA 1V7QA 4Z3DA 1F2VA 3KAJA 5ALKA 4WKOA 2X2FA 3RT1A 3TEMA 4CEHB 2YHSA 1HKUA 1MOSA 1QX4A 1CYDA 1RJDA 1HSZA 1QIEA 3K15A 4DR1B 1I8TA 3EG5A 1N2BA 1W9HA 3G1UA 5HCUA 3V34A 2Z5UA 1HKHA 2J9RA 1PJTA 3DFGA 2G06A 3AKEA 3DM5A 4LBWA 3LSTA 2F1RA 2BFCB 2IZOA 3HCDA 1LCIA 1Y7HA 1CETA 4P4SA 2WYOA 5EP3A 4YMLA 1JYSA 2FPLA 4LK3A 2FEAA 1P5ZB 3T9FA 4CUKA 4MP3A 5BUCA 4BQPA 1IUNA 2LNDA 2PGIA 2XB6A 1CUJA 3NWJA 4NCKA 1DC7A 2JZOA 2R5YA 4G07A 4CLEA 4EGQA 5J2TA 1FSPA 1RAAA 3V9AA 3ZGOA 1R6UA 1J8YF 2ZS9A 4Y6QA 3EXHB 3SZTA 1U0HC 2CV0A 2B7BA 3ZE6A 1XP8A 4YMHA 2IH2A 4CKYA 1CUUA 5L3SA 2G08A 1Z08A 2P9TA 4QODA 3Q15C 1CY6A 2X1HA 5IYDJ 2L7ZA 3HVUA 2QPLA 1IZYA 1O7LA 5ARDA 2W84A 4OOEA 4R6WA 1TCAA 2K9NA 5EWJA 3IYLW 1AUVA 1FW8A 1MX5A 3UOAB 3IEPA 3AHDA 1SIOA 3SYMA 3MKZA 2FNPA 1T0HB 1EB9A 2FY8A 3EWNA 3HRIA 3IT3A 3AMVA 4QQFA 2K02A 1FDWA 4IHSA 1X80A 2OORA 3GBVA 4TMXA 2GN0A 1ZRNA 1KDZA 4A1OA 3OQOA 3OQMA 1KONA 5HE9A 2OQIA 3WAJA 4Q4JB 3VVCA 3M9AA 2GA9A 2ZVJA 3DZBA 3G59A 2QAGB 1UZCA 1W2GA 2FZ4A 2RAUA 2A58A 3AYZB 5EGNA 5GJBA 3REQB 3T7AA 1MV8A 4KITB 3O8OB 3QPBA 1KPGA 3HCBA 1FFCA 4QIHA 1QGPA 5JATA 1OSNA 3KP1A 4PLYA 2ZS8A 3TGPA 1YZFA 2FPMA 3K4MA 1EJBA 1QZEA 1WJCA 2GAUA 1MA3A 1QHNA 3ONEA 3GEHA 1C7ZA 1NR1A 3KTDA 1MU0A 1EFVB 1YVDA 2VZLA 1W93A 3NC1C 4RHUA 4YBZA 1GLVA 1Y3IA 2G0NA 5CDHA 1YOVA 4UBKA 2ZJ8A 5H8WA 1SIWA 1EX6A 2E7ZA 2QLBA 3BA6A 2O0KA 2XUGA 2REOA 3OY9A 3DYIA 4BVLA 4CM7A 2XJ4A 4ARSA 9ANTA 4C5BA 3E97A 4G5YA 1CS4C 1CHNA 2X3FA 3DCNA 1KDPA 1VSBA 2NUBA 4H4CA 2C77A 4IMRA 4QYXA 4YUYA 3GLIA 2FPSA 1PO7A 1P1KA 3KHTA 5ALGA 4J7UA 2JAPA 5B30A 2C2GA 4LYEA 4W99A 721PA 2CXUA 1EYZA 2YU9J 4XSGA 3GC6A 5M3MJ 1O4VA 4REQA 2GHQA 1PTKA 3HQ4O 4QOSA 1Y34E 2OQGA 3WFIA 1QKJA 2X4IA 1RIOH 2XYRA 2P1DA 4O4IB 4Z4IA 2ZSHB 1P2VA 2YY7A 3KAQA 1E9VA 4FGKA 4D9BA 1B6TA 1KNXA 4H6WA 2PRIA 4XD7A 1IM8A 2ZRJA 3QV2A 4RDCA 1LPAB 2YWBA 4NQZA 4RA9B 5L3GA 3NAQA 2OO5A 2NUAB 4PPFA 2WNSA 4V0LA 2DLNA 4RZQA 4EG3A 1T8WA 2IA5A 2OFWA 1Z21A 4HZGA 5IXYA 4E5KA 3S2SA 5HQTA 2BUBA 2E4AA 1C3OA 4XA8A 4Y6PA 3IQXA 3QNWA 4UUOA 4G12A 3WAGA 3G7UA 2FFAA 3MKYB 3OS1A 1D1PA 2ZDQA 5FR1A 5J23A 1NQ5A 4PHHA 4I9NA 2PQ2A 3HB0A 2QL9A 2HI3A 5LQUA 4BKRA 3GUHA 4UV8A 3CKLA 2DPLA 3ND8A 2V7XA 1A7KA 4U7HA 3EGOA 3WLQA 4C04A 3L2QA 3SQXA 1Z73A 3PK0A 3TQIA 2Q0QA 2GZHA 2VQGA 3LPLA 4OU5A 3WQHA 1IHDA 1QVAA 4ZZ2A 1IK4A 5F1RA 2LG4A 1WKCA 3WBKA 5CD9A 2XW6A 4II2A 4F72A 1ZRSA 3S2WA 2XYQA 1CTQA 5IBRA 4A2CA 5CPRB 1PT6A 1WZNA 3O1LA 3O8NA 3THWB 1OKKA 1B8IA 3ZC3A 4KISA 3A32A 1NVMB 1IEWA 3QXXA 4OMCA 3O8HA 4ZI7F 4NU5A 5HS6A 2AE1A 4HFRA 1KI4A 3DXFA 5JDIC 2OBMA 1M67A 3MSCA 1DXQA 1GQQA 2BCGY 1U8RA 2MYUA 2EX1A 1A5JA 3R6GA 2BJHA 4LQDA 4PGAA 4R1SA 3ICPA 2CNOA 5EXTA 3ENKA 5F3DA 5AK5A 4N8EA 3LOCA 1GCUA 1Z7UA 3F8SA 2WU0A 1LI7A 3OM9A 1KRXA 2EVWX 2FR8C 4N5IX 4HAOA 1OWPA 1CVIA 5CDFE 3E48A 3SFIA 3WB9A 2DWCA 1IGNA 3ZDCA 5A3JA 3GJ5A 1ORTA 5LKAA 5ALPA 1A97A 1NQXA 4AZ0B 3NWSA 2VIXA 4BO8A 1NF9A 1XAJA 5E38A 4RACA 4L18B 1E2MA 4KN9S 4NV1A 4CCWA 4S05A 4I0BA 1CDZA 4M6WB 4D3DA 3V33A 3E5UA 1LLQA 4S1TA 3F8MA 3LBYA 4LTDA 5C7IO 2H9IA 5HCNA 5ADVA 1I7QB 4CQNA 4C6SA 2XUOA 2K3PA 2O0YA 2OTJI 1D5CA 1JA9A 3F74A 4R2XA 3SCZA 2Q5FA 3U26A 1DRKA 4YVFA 2B82A 1XZKA 1F48A 5AOVA 4HQKA 5TXGA 3VAZA 2VBFA 5JDCA 4A3LJ 2C4HA 2IYZA 2WA2A 3Q7SA 2GTHA 3IAM6 1YE8A 5FP0A 3U3XA 2O8CA 2G8LA 2YCLA 1GTZA 4UATA 4MFDA 4G37A 4D9NA 3FHOA 2IP1A 3PQKA 3U3DA 2CK3A 3FYUA 4PSWA 2V98A 2JBHA 4R2LA 1S9DA 4LG1A 5IT9A 2O2HA 1YUMA 3OE5A 4L5CA 1UBOS 5AOBA 3ZCSA 4F96A 2ZRDA 3ZPLA 2A94A 1IPHA 5JECA 2D1YA 4X84A 2BY4A 2HTFA 3CISA 4G4SO 2H9YA 5C1BA 1YS7A 2D1TA 3HCFA 3H3FA 4AZ3A 2PGJA 4ZOBA 1AS3A 1RXEA 3AHEA 1V1MB 4C6TB 4E5SA 5BSEA 3O4GA 5DBEX 3CO7C 5JBIA 2QM7A 1OCOH 1WZUA 3VZCA 1WY5A 4FLEA 4KVGA 2B83A 4UEQA 3F1LA 4E88A 1NXWA 4OHVA 2XXAA 2UZ4A 1G3IA 4YACA 1U8ZA 5A6VA 1LEAA 1FP2A 3KFVA 5TB5A 1R74A 2BMAA 2GXUA 4HNUA 1DKRA 3BR6A 2H54A 2CB9A 2WDZA 5CVJA 2VSQA 3QFHA 5KVQA 3TE7A 4BP1A 2VK4A 1I6LA 1UK7A 2D5AA 2DY0A 2PY6A 5DM0A 4BFCA 3ZD6A 3LFKA 2E5WA 3GNQA 4YRQA 5KSOA 1XZDA 1VG8A 2IYQA 2Z57A 4Q4DA 3W6KB 4AJ4A 4L0QA 2D1HA 1RZ3A 1VPEA 2ESHA 5BT8A 3VDQA 3KSRA 1USGA 3SIPA 5M7EA 2W4QA 5ERXA 4ZAVA 2PBIA 1TYBE 2X77A 3FWKA 1Z0ZA 5JSZB 3OJEA 4H7DA 4N40A 3PUWA 4HATA 1S2IA 4Q05A 1XCLA 1RWOA 2O2IA 7MDHA 2EPFA 4E13A 2EQAA 3JYLA 4O1IA 4I08A 1ZK1A 4J0GA 1QO7A 4QHTA 3PB3A 1QHYA 4CLXA 4YUZA 2ICWG 3EC2A 4LK0F 3OCYA 2OP1A 3BICA 2R6CA 4MCHA 5LXTB 1Z5ZA 3KQOA 3PQFA 2G25A 4LRWA 4LSGA 3T99A 2F7SA 1Y3CE 2R7SA 1C0IA 2ZWMA 4GVLA 1I1NA 2LD5A 1T25A 3EODA 4RTLA 3PI7A 4WV3A 1E6KA 4JKIA 1Q0SA 2WPNA 4FGSA 3AZQA 2KRFA 3URKA 4Y15A 4KMOA 2VP3A 4DNOA 4BO4A 1ZJYA 3LMKA 2YWCA 3TAUA 4YMTA 4LECA 3H1BA 3WKAA 1DTEA 1MNQA 2FW9A 3LL7A 1EFPB 3OX2A 1BIBA 1V54H 1LI4A 4FZ3A 1ABEA 1T6XA 1RXWA 2H27A 2ZRNA 4F2DA 2GLUA 5KMGB 3SJAA 2HOEA 2IEZA 3K10A 3Q0EA 4JI3B 1JRLA 3CVOA 4HK4A 2WU8A 1X15A 3Q6IA 4RESA 3WLLA 1X2EA 2XE8A 1XD7A 1TQ4A 2CVOA 4MX8A 2RGRA 1VPVA 2QN3A 2ZSIB 1BZYA 2AFHE 2IUSA 2EBIA 3IKMB 4LWPA 1JWBB 4MEBA 4QUGA 2ZUTA 2O3UA 3RO7A 4V2FA 1SHZA 1WPXA 4QSMA 3I5MA 3WLMA 3RJPA 2V6GA 2GGSA 3OOSA 1SXJA 5HF5A 2VB6A 3R7WB 3O8QA 3H1TA 3QE2A 1UC5B 1T2NA 4I5DA 4JUFA 5H20A 3VVBA 2FG7C 1EBBA 2FSFA 3RT7A 2JGFA 5GAJA 4BNDA 3F0CA 4AY4A 2Y48A 1D0IA 1D6NA 5BPHA 5CLFA 2MA3A 3GPDG 1WXWA 5FUQA 1W5SA 3GHYA 2WRZA 3SF8B