2R0QC

Crystal structure of a serine recombinase- dna regulatory complex
Total Genus 67
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
67
sequence length
200
structure length
193
Chain Sequence
MIIGYARVSSLDQNLERQLENLKTFGAEKIFTEKNRPILQKALNFVRMGDRFIVESIDRLGRNYNEVIHTVNYLKDKEVQLMITSLPMMNEVIGNPLLDKFMKDLIIQILAMVSEQERNESKRRQAQGIQVAKEKGVYKGRPLLYSPNAKDPQKRVIYHRVVEMLEEGQAISKIAKEVNITRQTVYRIKHDNG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 31-MER
publication title Architecture of a serine recombinase-DNA regulatory complex.
pubmed doi rcsb
source organism Staphylococcus aureus
molecule tags Recombination/dna
total genus 67
structure length 193
sequence length 200
chains with identical sequence D, E, F
ec nomenclature
pdb deposition date 2007-08-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00239 Resolvase Resolvase, N terminal domain
C PF02796 HTH_7 Helix-turn-helix domain of resolvase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.60 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Homeodomain-like 2r0qC02
3.40.50.1390 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 2r0qC01
1RPWA 1ETWA 4C3IJ 4Y7NJ 3ZQGA 1MBJA 3DCFA 1IDYA 1FTTA 3ILXA 5JLXA 2OF7A 3QPLA 4W1UA 2XB5A 1HDDC 2FQ4A 3D1NI 4D5FA 1H8AC 2FJ1A 3TW7A 4BBSJ 5J1RA 5GPCA 3BTJA 2LY9A 4A3IJ 4IHXA 1MH3A 5F0FA 4A93J 2M34A 1H88C 1OFCX 1AU7A 4Y52J 1JGGA 4A3LJ 2Y9YA 1APLC 1TWCJ 3K2AA 5JLWA 2JA5J 3H0GJ 3TP3A 5IP9J 3A02A 2JJ7A 1A5JA 5M5YJ 2NVTJ 2L7MP 2IEKA 4D5CA 4ABZA 1SFOJ 3GTMJ 2GM5A 1HDPA 4M3GA 4S0HB 2Y30A 1CQTA 5C35A 1P7IA 3HEFA 2COBA 1MSEC 1WH5A 2IAIA 1MBKA 1AHDP 2H1KA 3JRHA 4X6AJ 3LOCA 1MBFA 1OJLA 3UKGA 2MSYA 3DEWA 4M6VA 3WHBA 5BNGA 4BY7J 2O8KA 2NS8A 3NARA 5HODA 2X9DA 2LKXA 4JX4A 4CYCA 1RETA 3IH4A 4B1RA 4C2MJ 2NS7A 5K7HA 3SFIA 2HDDA 5FLVA 2DMQA 4A3BJ 2O7OA 3S1MJ 1BA5A 4BBRJ 1IRZA 2VKEA 2ELKA 2JN6A 3HDDA 2L9RA 2TCTA 1QVTA 1AKHB 3RKQA 1ITYA 1U9OA 3G13A 2EZLA 4AUXA 1SANA 1Y1WJ 1LE8B 3JRBA 3OSFA 5E3OA 2JA7J 5M5WJ 3G1MA 1EF4A 3BT9A 1HF0A 4MFEA 1B8IB 2HI3A 4IEJA 4A3DJ 3JRIA 4B4CA 4FE7A 2K9SA 1IJWC 1FJLA 3B6AA 2OPTA 2H8RA 1ETQA 2LFBA 1LFBA 1XS9A 3PO3J 3JRDA 4A3FJ 4XK4A 3CCYA 4A3JJ 3H3VK 3HOVJ 5DTDA 2ZB9A 4XRSA 2YS9A 2E19A 3RZDJ 3FK6A 2MGQA 2ME0A 2Y9ZA 2DMUA 3QPSA 2MW8A 1X2MA 5GPAA 2E1OA 1JKPC 2GLOA 2DA4A 2MHCA 5C34B 1UMQA 2HXOA 3LSJA 3JRCA 2LVSA 4XIDA 1F36A 2ECCA 2R5ZA 1MNMC 1BW6A 3BR0A 1NK3P 2ECBA 1R9TJ 1ZR2A 2R5YA 3JRAA 3ZQCA 1ETKA 4UUSB 2XRLA 4FTHA 4C3JJ 3ZQIA 3HOXJ 2G0EA 4RDUA 3S15J 1ETOA 2QCOA 2VPRA 3TEDA 2VKVA 2Y0SN 1JT0A 3BR1A 4A3CJ 3A03A 3LSPA 3GTJJ 2N8GA 4BKXA 2ID6A 2O9LA 3JRGA 4QSHA 1JUPA 3GTGJ 1ZKGA 3BVPA 4DW6A 1P7JA 1TWGJ 3A01A 1ETYA 4XRSG 5E3NA 3ZOBA 2JA6J 1WI3A 2HOAA 2XPWA 2HOTA 2DA3A 1W0TA 5C31A 1O4XA 2XPUA 5C3EJ 3LSRA 2E2IJ 2CJJA 4QIWN 3HOWJ 5FJ8J 1T56A 2WB1N 2ME6A 1OCPA 1BW5A 1HX7A 1WPKA 5F0CA 1TWFJ 1FIAA 5IOYA 1IC8A 3CMYA 1LFUP 2DA6A 5EZHA 4JYKA 3B6CA 5F1JA 3MN2A 3C2BA 2R93J 1VI0A 2EBIA 3BQYA 2L0KA 2LK2A 4I76A 2JK3A 5J1UA 1W0UA 1DU6A 5EYRA 4BXXJ 2GBYA 2X6OA 1RESA 1JKRC 4FE4A 2VI6A 3JRFA 1JKQC 1YRNA 5IYDJ 1T33A 3S14J 1ZTRA 5FKNA 1IDZA 4A3GJ 2HOSA 1Q1VA 2EQRA 2CRGA 4A69C 5EF6A 1UG2A 2DJNA 5DS9A 1QPIA 2E2JJ 3CDLA 5EG0B 2K9QA 1FTZA 2RAEA 3IH2A 2DMTA 2NVYJ 3M4OJ 5FKKA 5EDNA 2CU7A 3BTCA 2P81A 3BR3A 1PUFA 4DYRA 1F43A 2YUSA 3IH3A 3HB9A 5EGOA 5IP6A 5FKLA 2KDZA 3GUVA 2R7ZJ 3S1RJ 2XB0X 1GHTA 2LLKA 4D7MA 1POGA 3Q3SA 3GTQJ 4JX5A 3JR9A 3F0CA 5K7FA 3FISA 4RBOA 2D5VA 5IYBJ 2CQQA 1HOMA 4V2FA 1JTYA 5M3FJ 2LD5A 2DMPA 1GVDA 3PM1A 1WGXA 4C3HJ 3JREA 1GV2A 2FD5A 1B8IA 2XGEA 4AC0A 4G12A 4MO7A 2VUMJ 3PO2J 1DU0A 2JWTA 2W48A 3ZQLA 3MKLA 2K40A 3O8GA 2R5ZB 1JKOC 4MIMA 4QTRA 2M8GX 4IHWA 3Q0VA 3TW6A 2EZIA 5C32A 1ETVA 3BQZA 1GDTA 1FIPA 1GT0C 2HQ5A 5IP7J 4LOCA 4DZJA 3IV5A 2R5YB 4AYBN 5F27A 3UJ3X 2ID3A 5F08A 1B72A 2LP0A 2NOGA 5J3LA 2DA7A 1JUSA 4A3EJ 3Q0UA 1H89C 1GUUA 1MH4A 3HBLA 2L7FP 2KT0A 1RKWA 1TWAJ 4M3BA 1NK2P 3BG5A 5J1YA 3RZOJ 5E3LA 4V2GA 3S1QJ 5FLMJ 1K83J 1TWHJ 4MFDA 3OIOA 3WHCA 5F0HA 4NDLA 3W6VA 5IOZA 1NTCA 1U9NA 3Q0WA 2GM4A 1XG1A 1BJZA 3G1LA 1MSFC 3GTOJ 3HM5A 2EZKA 2FX0A 2HXIA 4D7NA 5F04A 1ZR4A 3ZQHA 1XC5A 3S2DJ 1X2NA 2XGDA 4A3MJ 5C44J 1VNDA 2RSLA 4M3FA 4A3KJ 5M3MJ 2WAQN 2EH3A 2IBDA 4J19A 3GTKJ 9ANTA 4FISA 2Y31A 1E3OC 3S1NJ 3MVPA 4GFBA 1MBEA 2EZHA 3GTLJ 3HOYJ 2NVQJ 2B63J 4DYQA 1FEXA 3HGYA 2XSDC 1VFCA 2M2EA 1TC3C 1VF9A 5C4XJ 5GP9A 1ORKA 3FK7A 3HGGA 1ETXA 2WV1A 5IPAA 1MBHA 1HCRA 1YRNB 1K61A 3SJMA 3I4NJ 2CUFA 1I6HJ 3FKIJ 1IG7A 1HLVA 1G2HA 1QRYA 2AHQA 5K7ZA 4CYCB 4IHYA 3BG3A 1JJ6C 1BL0A 4M3EA 3I4MJ 4W97A 2NVXJ 5IYCJ 2LTPA 3S16J 2CUEA 5FKOA 2YU9J 2JMWA 3RQIA 1D5YA 3BG9A 3G1OA 1A6IA 1PUFB 1IGNA 2DN0A 5EGOB 2XPVA 3LSGA 1QVUA 5FKMA 1UHSA 3HKZN 4UUTA 4B3AA 1U78A 4DYCA 2TRTA 2PMZN 2X48A 1S7EA 1RR7A 2Y2ZA 3E7LA 3GBGA 5EG0A 1JUMA 1X58A 2I10A 5EEAA 3O8HA 2JA8J 4JX6A 3VPRA 3FIWA 1AKHA 3BR5A 2DA1A 5C4JJ 3PKZA 1ZQ3P 1RKTA 2AO9A 3NAUA 4BY1J 4BQQA 3LHFA 1Y1VJ 3TP0A 2R92J 3BR2A 3CQZJ 1LE8A 3K7AJ 1Z0XA 2K9NA 4X1EA 2L7ZA 1JT6A 4M3DA 3L1PA 1IUFA 2E2HJ 3BTLA 3OSGA 4L5EA 3BTIA 3S2HJ 2QF7A 4IHVA 2DTZA 1JTXA 4FCYA 4DZPA 3SDGA 2LR8A 1MBGA 5M5XJ 3ZQFA 3S17J 2XGCA 1ENHA 4MLOA 3OOUA 3LHKA 1B72B 3M3YJ 2DMNA 2R0QC 2M0CA 5EZGA 1I50J 1OCTC 4XICA 4EEFG 2DA2A 4JP0A 5E3MA 2CQXA 2M9HA 3HOUJ 3LNQA 3GTPJ 1ZGWA 4XRMA 1WH7A 3A01B 1GV5A 3HOZJ 2HYJA 1IV6A 1JJ8C 2MG4A 4UUSA 3BR6A 3QQAA 1WCMJ 4HNVA 1I3QJ 1ZK8A 4I6ZA 1U8BA 2DA5A 1Z77A
chains in the Genus database with same CATH superfamily
2FSVA 2P79A 4IFTA 1H8HD 2A0YA 2A0UA 1GYRA 2P67A 2WYVA 1OPCA 3G9XA 1N4DA 1DC3A 3IDZA 2Y9YA 4WBSA 2I91A 3DLCA 2HA6A 1U8FO 4ZEWA 2XTZA 1MMDA 3CUWA 3R3XA 4UVIA 1X94A 1V47A 1RJFA 4P93A 5CT8A 3QM1A 2FP4A 5BN3A 4C0HA 3NI2A 4K9DA 1FYVA 1VGRA 1SU8A 3NV7A 4CG2A 2DSTA 1L5RA 1YR2A 4PR3A 4D4LA 2BE9A 4EPYA 4H6XA 3HYTA 4C0XA 1T6BY 2WD8A 4NESA 5EUBA 1BYUA 5F76A 3ZXSA 3VI4B 2KIUA 4Z6YA 1BXRA 3SMQA 4BV3A 1ZD8A 1K9SA 2ADUA 3K0CC 2VYNA 1PX2A 2HJSA 4D0NA 5CG1A 3LKZA 5JO9A 1ZD3A 5ALJA 1UFRA 2M7BA 1KP2A 1RWVA 4DR1B 2ZJ4A 4IKOA 2WM2A 2Q6KA 2BJHA 1HMPA 1XVAA 4MVCA 1S8AA 2HSGA 3BR1A 2QSHX 2JGEA 1USKA 1JR3E 2W9XA 4YP6A 3AR5A 2GEBA 4DDKA 5B66C 4DW6A 3FPCA 1OGYA 1QTNA 1B3RA 1L7NA 4ZRDA 1KOJA 4J0JA 3SLGA 2VHYA 1T56A 1H66A 5GJBA 3NDRA 4LF4B 2PI0A 4U1RA 3QPHA 1DO8A 4D4GA 2F8LA 621PA 1DBQA 4M0FA 3VHXB 2FI1A 4AB1A 1K97A 4M1TA 1NBME 2ZQ5A 2C07A 4C9BA 3PRJA 5K3DA 3NC1C 2XKKA 3SC6A 4TTRA 2QLNA 1GGHA 2EILH 3W5CA 1N36B 2C8JA 1IVNA 4ALKA 2FW7A 3USCS 5HDGA 5KYVA 3WISA 3ETHA 3D2AA 4G5OA 3GI1A 3WMWA 3RS3A 2A5FA 4AL4A 5C1PA 1B1CA 4MTLA 2ATEA 4INOA 1WW3A 2Q3JA 4QUJA 5CPRB 2DFLA 4Q7JB 1J06A 2W2LD 2P27A 2FPMA 3GO4A 3JAKB 5C8YB 3LQYA 1J8DA 4R6XA 2DDAA 1VLQA 2VUTA 1Q0PA 4P3YA 1KZYC 1NBOA 4ZYLA 2YNMC 2VTBA 3JQAB 3HVIA 4KK3A 4R3NA 2HBYA 5IP7J 4GVPA 3RSOA 5IDXA 2LR0A 1J0XO 3GA7A 1RHKA 3GJTA 3LJKA 4HDAA 2ZLBA 1QFXA 3FMIA 5AOAA 2OO7A 1EE1A 2JLVA 2EF0A 2JCXA 4I6EA 2QN2A 2O0LA 4RB2C 4K6CA 5BO5A 5AUOB 5T57A 3A0UA 2IEDA 4TYPA 1Z6QA 1XN7A 4BZPA 5K0CA 4QDTA 3ZEIA 4O08A 2CC2A 3OMWA 2QE7D 1U8AA 3BWGA 4LC9A 5E7IA 4RJJA 3WZMA 4DG9A 1RRVA 5AKKA 4NICA 3ZHVA 2DTEA 3EODA 2DWOA 1SRQA 3CMEI 4F04A 4JI0B 2IDJA 2BFEB 2W83A 5CDUA 2JLCA 1WETA 5EXEA 4CMIB 5HZGA 4IRIA 2WJIA 5B5EC 1OI4A 3E6BA 3VEPA 4QUHA 1L7QA 4CF7A 2LXNA 2O8XA 1KXJA 4G7OF 3RTEA 4DZPA 1H2RS 1K8YB 1OYWA 2B1RA 3VM6A 3SC2B 3IPRA 3SJAA 1IY8A 1JKMA 2DA2A 3A6EA 2FF7A 1D0VA 4EJTA 1MC1A 4L8GA 2Z3YA 1IV6A 4F7WA 3K16A 3E3NA 2P0AA 2Q3HA 1BMFA 2AQ8A 1P1JA 4H15A 2OB2A 3QU4A 5HUJA 3S93A 1O97D 2HIAA 2PX5A 1QH8A 3UQYS 4CF3A 1E89A 3EQ7A 5SY6A 2ORVA 3U21A 3KAPA 3PCRB 4YUVA 4L51A 5CLFA 2KE5A 3OZDA 2QENA 1DZIA 3A1WA 1VTNC 1YDEA 3LECA 1JHZA 4LLLA 2TMKA 1UAAA 1AHDP 5CJJA 2QQFA 1E5QA 3LOCA 2VDQB 5IJWA 3E6MA 2ERYA 3EWNA 4YRKA 4F4IA 2LBPA 3GW2A 9ABPA 1VBKA 1RC8A 2K7FA 3TMYA 2XODA 4IIBA 1SANA 1QDEA 5KNCH 1XRNA 1GD1O 3QU7A 2VP9A 2R85A 1LXCA 2HR1A 3ZRGA 3LOQA 1ZMOA 2ZS7A 1KJQA 2HREA 4Q02A 3EEQA 2WWIA 5I7AA 1KI6B 5EEGA 3NVKI 1T2CA 1YOVB 3H5NA 5EPUA 1YR3A 4PEVA 1ZSNA 2W2KB 1XL0A 4QJ3A 2VOOA 4XX0B 1R9TJ 3F72A 5ES4B 3QVGB 4HDMB 1WJEA 4UXNA 3P2YA 1A2KC 2XNDA 3IOYA 1A5BB 3CZRA 5H3HA 1XSDA 4W5RA 2DFPA 2GWRA 5LBQA 3JYQA 2RGYA 2BTQA 3ZOBA 3BTOA 1E64A 3DLAA 1QIKA 1ISHA 1KI8A 1KY3A 3CO0S 4PZUA 2C5FA 4XOTA 1B6RA 5E9AA 4XNFA 2X1CA 3HTSB 2IY8A 3P26A 3N74A 3L18A 2WE7A 3IO3A 4KLZA 2Y4NA 4JJIA 4U7HA 4PAOA 3DDUA 2BLLA 1CRLA 1P9WA 1QQ7A 4LG0A 1Q83A 5A5FA 1KVUA 2EQRA 1JWBB 1NAHA 1FSGA 5TY0A 3ROZA 2C8LA 3N5CA 4U88A 4FT2A 1W581 3KWJA 1SBIA 1SAUA 1BJRE 1Z5WA 1TF5A 4O5AA 1U0JA 2R8BA 3CRMA 2LVBA 4GQBA 2R7ZJ 1QS0A 5FD8A 1YA4A 3AHFA 1HOMA 4JJ7A 3O47A 4BL0B 1TQ2A 4EGZA 3IHUA 3KPVA 3KXLA 1R74A 3NAZA 4K6FA 3OMYA 3I62A 1L5HB 1GGFA 1H8HA 5JYDA 1ECJA 2AS5F 4FM9A 3EPKA 1KJNA 3RTAA 4V3CA 1WJCA 2CVQA 2G82A 5KQGA 5SZHB 5C32A 4RA9A 3FPHA 2PLYA 3COSA 3NWBA 2WMOB 2Y8EA 1NKSA 3DCYA 4PX9A 2XBMA 5H70A 2HDOA 1P81A 3S1QJ 2EEPA 3A6JA 1ZK4A 2Z8XA 1ZO8A 4OB8A 3CF5F 2CFSA 4LF9B 4UUMA 1FU7A 3RD5A 2DPDA 1YOBA 3ENZA 1W44A 1K6YA 5CVIA 2XTNA 4ZKEA 4YYEA 2ZULA 3KT6A 2PYDA 4DV4B 5KJEA 3OQBA 1NXSA 4WDRA 3CCRI 1IB6A 3RVLA 3IE0A 5A6SB 3KM0A 1LJ8A 2P9JA 3DQQA 1EH8A 2BSXA 2VDMB 3OZ7A 2VJLA 1RAAA 3WKEA 4M9XA 4F92B 3FJOA 2PA3A 4Q7MB 4OHFA 3TVDA 4YFYA 2NXNB 4E03A 1BR1A 3O7WA 2BVLA 3TOBA 2EFGA 3P4YA 4EFNA 2FPSA 4DA4A 2ZRJA 2XZPA 4UD2A 4C6HA 3ROMA 1IPFA 4KQ1A 3J7AO 5C4GB 2CB9A 1L5QA 2OKGA 1MJ9A 1UFMA 4NBUA 4U7BA 1DDIA 3LVQE 5MGBA 4OK5A 1R4MA 4QL3A 4WLUA 2VF2A 4RGXA 2A84A 2AUMA 4KPUA 4KYUA 5AKYA 3V42A 2BGCA 1JR4A 1MFZA 3L93A 1LK7A 1GCIA 4O2AB 2I76A 5TGZA 2WC2A 2GZ3A 1E79D 2BXZA 3EDCA 1SH7A 3SS8A 1Z4JA 5ITZB 1AA6A 4KFRA 4B34A 1CP2A 3OEED 5LQDA 1W88A 2PA0A 1AKQA 3OZXA 1U7OA 3SLKA 3AG2H 5BNZA 4REOA 3RS4A 3EDPA 2G1KA 1JEQA 1APLC 4KGDA 3NKFA 1IRIA 3WYEA 4X45A 1J6UA 4ACBA 2BD0A 4MWBA 2Q4OA 3E9RA 5SZIA 2L69A 2GARA 2W2LA 5DXFA 2H1KA 4BQEA 1XA0A 3Q9UA 1OJLA 1U8EA 3NEYA 3IVGA 5HTOA 1U7WA 4AYBA 1TI7A 3VDMA 1YVPA 3L8ZA 4QBIA 4Z9BA 7YASA 1YBVA 3H2ZA 1Z5ZA 2QQAA 1T43A 4J29A 2ZSFA 1N2HA 3CUEF 5HJ7A 1SXIA 4Q39A 2VF7A 3KPWA 3S32A 4PO8A 3FR8A 5BT8A 4MVJI 1M5TA 4UNQA 4IDCA 1PK8A 5LQUA 1XB2A 4EJMA 4ZZ3A 1P18A 3HOVJ 3O8DA 2R7WA 3G8CA 3FPEA 1L0BA 5BWBA 5AICA 5EZQA 3BMOA 2NOJB 2HVQA 1O77A 4R1OA 5FJIA 4UPDA 2XT6A 3D3KA 1E2XA 1FMCA 2FE3A 2WTBA 1PZMA 4MXDA 3EXFB 4PTZA 3BIWA 1P1IA 3DFKA 4KW7A 2HSEA 4X94A 5A02A 2CLSA 5JSUA 1ZKGA 1QQIA 1Q0LA 1HQYE 4MWZA 2QE7A 2BMVA 3ESRA 1SULA 3PR1A 2I8DA 2E2IJ 1C9MA 1AK2A 4ZDKA 4Q9DA 3HPQA 1A4IA 2QM8A 1JQJC 4XGRA 3A2LA 4AVPA 2JKVA 4JYKA 2P7IA 1PFQA 2J9ZB 2V97A 1HE1C 1RWWA 3L2WA 1UAYA 1UANA 2Q5CA 3RBZA 2GZSA 4G26A 3UG6A 2G3YA 3GJRA 3GLTA 4DMHA 4N5MA 5BRAA 3ILVA 1EJ2A 2NZ8A 3P9PA 4N7JA 1GAJA 1ZH2A 4DB2A 1B59A 2W90A 4PS0A 1NJFA 2P77A 4KN8A 1WSWA 4DXAA 2D5VA 4JR0A 4DIOA 1YHQI 3VYVA 4JR1A 3V4ZA 5IAGA 2AOVA 3M6LA 2Y3IA 4F2PA 3WI7A 1VZ2A 1LKZA 5HRCA 4QUIA 2VDRB 2DMRA 1TT7A 1NW8A 3R9XB 4QVGA 3H4MA 5ARDA 3B9PA 5DBOA 5ILQA 1LQ2A 4MDHA 2GNAA 1G5PA 3PUFA 2ORIA 4TQGA 4UUAA 4WPGA 3DCNA 2J3DA 3EN0A 2DZDA 1WDKA 1W5TA 1WI9A 3E4DA 1Y7IA 5FKJA 3GJXC 5TV2A 1M2WA 4V1CA 2IUTA 2QE6A 2HH9A 3COYA 5L3GA 1ZR4A 5KNDH 3SVTA 3CONA 4KUGA 4DY6A 4K9QA 4D92A 4GFBA 3CSSA 2H65A 3I45A 3EEFA 4ND6A 1WB6A 1YDHA 4CXMA 2CUFA 3GWZA 3MS4A 4NHEA 2WD7A 4GYWA 4I50B 3HY4A 1H3EA 2A5LA 4H6PA 1J1IA 3AEQA 1QVUA 4HVCA 3RUIA 2H7XA 1N5MA 2PMZN 3CDHA 4XFKA 4UM5A 3ONVA 3RAJA 3HXTA 3S7TA 1JP7A 3SWWA 1KSFX 4QJ4A 2VTKA 3F7TA 3OZBA 3UANA 4D8VA 3OT5A 2ALJA 3WHKA 4CI0B 2PSHA 2HVRA 2FVYA 3RC7A 3DO8A 2J31A 3IAS2 1JLSA 1GT91 3ESZA 4UARA 2YFQA 2IX9A 4L4YA 4IPAA 4CQMB 1W46A 5AP9A 5DI9A 2FHSA 2WIFA 1ILEA 1R0XA 1Z2EA 4FR0A 3VWBA 5K1ZA 2H2AA 3RM3A 3P5SA 5K2MA 4WX9A 1F12A 2QA4I 3AVOA 4I6ZA 4FMPA 1Z6YA 1ZJ6A 1Y33E 3LUJA 3H0EA 2WUFA 1QH1B 3WB9A 3DAFA 1I7DA 4WWCA 1NJ8A 2J3LA 4HQEA 3WYAA 3LY9A 1WZNA 4I8IA 4UM9B 1CY8A 2MDTA 3NVMB 3T15A 4YG2F 2H94A 1PEDA 4JSTA 4MW2A 3O6VA 2Q7OE 5CFMA 1HT1E 1DJMA 1ZG1A 5KCZA 1L5ZA 3A02A 3WGJA 2WT9A 3C45A 1ZC4A 1ONSA 4YJKA 4YMVA 1WXDA 4P9FA 4LTMA 1KH2A 3UB3A 4F96A 4ZQEA 3FOCA 3PZBA 1SCDA 3P9YA 4IW3B 2R4UA 2QN1A 5EJ9A 2WJ6A 1Z0ZA 1OX5A 5K1YA 1I6WA 3FBNB 3OSFA 4FZRA 1RWBA 4TKUB 3DZHA 2X5JO 2SCUA 4H0NA 1YGPA 4BEHA 4Q4LA 4ZC8A 4ETIA 4K3VA 2I34A 4A3FJ 1W4AA 3I52A 1U3GA 2WMNB 5AXCA 4QLCU 5CURA 1V1MA 3X1WA 4DIKA 5IDQA 1TD1A 2IEIA 3UAZA 1JHVA 2I2XB 1CVRA 4ZCPA 4RAGA 1N5IA 2XGGA 4ZCIA 2AX3A 1TQ4A 4CMEA 4PLFA 3GGJA 2WJWA 1EVJA 2R8XA 2VPPA 2FX3A 3E9DA 1J9GA 1SK8A 1SHKA 4JUIA 3L79A 4OX9B 1F2UB 3UF0A 1UWKA 2VATA 4PZPA 3NVDA 3COAC 1XLWA 1XMAA 5K3FB 2PS1A 2GS9A 2ATXA 3PNLA 4TM8A 1HV8A 2W5UA 3LIPA 3OEWA 2I6SA 3KPHA 4O4JA 2DOFA 3TUIC 4CF4A 2JK3A 1T6ZA 3SYTA 5G1NA 1YFLA 3ZGOA 1FJHA 1J8FA 4HNHA 3EZLA 3E61A 4MJXA 2GK4A 5AVJA 2PO7A 3UMSA 2I6TA 5JV5A 1MO6A 3DDOA 2NRAC 5KEIA 2YHUA 3AEUA 2ISYA 2ID9A 1T91A 3RVJA 4YCCA 3ZLVA 1EXDA 1QCCA 3FLBA 2BFDA 2VPIA 3EFBA 3PFHA 4HGQA 3S68A 1R8XA 3CEAA 4OFXA 2M1XA 4OM7A 2I7VA 1YHZA 1E79A 4L0DA 2WZBA 3QVOA 3P9KA 4JJGA 1HTWA 2PMEA 3BJAA 1WGXA 2XVZA 3OEEA 1GM5A 2MYPA 2W2PA 4A12A 3UCFA 4G12A 3U2QA 1IG0A 3HU2A 4P32A 4MIMA 3M6XA 4DM7A 3TLGB 2V3CC 4X6XA 3CW9A 3AVYA 1FDRA 3Q6IA 4BO4A 4XOUA 1M2KA 1SCUA 2GBGA 1IJEA 1YMUA 1AKRA 2R60A 4ACAA 5ECWA 4RF2A 1XHLA 1VLVA 3ANTA 3CSUA 3OA0A 3U48A 3VVMA 3WTUC 4P6VF 4LJ4A 4BC0A 2QTWB 1K7XB 1WMSA 3GXBA 2VTDA 4J00A 3GTKJ 2BBYA 4RB3C 2VSXA 2DU9A 4N5IX 2HY7A 3NONA 1NG7A 1RYFA 2WTAA 3L6CA 1DOHA 3TDUC 4XKWA 1SBZA 2HCFA 2O05A 3O2PE 2PUWA 4ZH4F 4GYIA 2WF6A 3TKAA 4Q7KA 2GXUA 5KS2A 4AIHA 4L5BA 1VJGA 3L04A 1PJRA 4DAOA 3LRPA 4MB2A 5M7EA 2HM7A 4RMGA 1MAUA 1E2NA 2Q3DA 1OI2A 5D00A 5GGXA 1D5YA 3ADKA 3ND7A 2I87A 4OAYA 2C9CA 2VR1A 3N59A 2A69F 4MS4A 3MJHA 2I10A 2I7DA 2J9FB 1EFVA 5EKXA 2R7LA 1KAGA 3I6IA 3H4VA 4O4HA 1G2PA 2QXYA 2BHRA 3W2WA 4PHCA 4C7OA 3ZTYA 2RHBA 4U7DA 3RREA 4C6RA 4IPTA 2JFGA 3RKRA 5U1PA 5AW2A 1VDMA 2CJXA 3O6BB 2CCKA 4WHMA 2G77B 2Z6UA 3HOUJ 1Y3DE 2D7CA 3B1VA 2VIIA 4Z3KA 3AVVA 3Q3GE 2XWPA 1JAIA 2GAAA 2JEZA 2ZQYA 3CUKA 4RD4A 1LTKA 3DAOA 4IOMA 2X7XA 1RYZA 4A0QA 2WTNA 5JDCC 2YN2A 2FBKA 1XL1A 2M4KA 5K4HA 3E18A 3AM4A 3FTQA 5J4YA 5M29A 3II6X 2KL4A 2Q0QA 5GV7A 4UEJA 4WI1A 1ONPA 3HA2A 3FHTA 4JZYA 3AUSA 4KDRA 2NV2B 2GM5A 2Q0XA 3QU2A 3TR5A 2DOAA 2XUZA 3TLKA 3S44A 1X14A 1MBKA 2J3HA 5SY9A 4KKVA 4EFLA 4CUKA 4XZ3A 1X7HA 4JBIA 1Z7EA 2Q2EA 1A9ZA 4BNIA 1RWNA 3H2YA 5GTDA 7REQB 4KVFA 5EHNA 3QVJA 5JISA 1NUAA 4YP1A 1H9TA 4NARA 4MVJG 1B4AA 3VHRA 2C7QA 3G2KA 4RM2A 3OIYA 2A9VA 5EE0A 2W11A 1W4ZA 3A6DA 1VYUA 4A4DA 4L08A 2ICWG 5JSZB 2DMUA 1KK3A 1RKXA 1H22A 4H4CA 4ZDLA 4EJUA 4MQUA 1OH6A 4YFKF 4ZN6A 2LYCA 2R1VA 2V5UA 1YCGA 4UMFA 1ETKA 1G1AA 5JTUA 3GTJJ 4QTZA 3OIDA 2CXTA 3UXHA 5SZKB 5ICSA 1P7JA 3RGWS 1RKUA 2A1UA 1L1FA 1VQ9I 1F20A 1QH0A 3OSUA 1EVLA 1NR5A 1TA9A 4TUYF 5FROA 1J09A 2ME6A 4ALIA 1YRAA 5AVZA 1AGRA 4LDPA 3ZDEA 1T0FC 4MYHA 4UMDA 3OJ0A 1TGVA 4YX9A 2H6EA 4OYRA 1AS2A 4RANA 3OZAA 4YCJA 3EPPA 2Z9DA 2COKA 3RS8A 3GCDA 3DLTA 4JKIA 4EELA 5PGMA 2F8TA 2YSRA 3X1ZA 2XCRB 3AUJB 3BK1A 1LVGA 4DWVA 2ZI3A 2LDXA 5F1RA 1PDWA 1JU4A 1SVUA 5JFRA 4LMAA 1J1ZA 4ZVPA 5IP6A 4NFYA 4ZZ1A 1A77A 1R27A 4UQOA 1SA0B 4KGZA 3EARA 3G9QA 5KU1A 1YFKA 2DMPA 1U2GC 4ISBA 4I55B 3PO2J 2GSDA 1VPVA 3C6KA 2RREA 5JSQA 3TLCA 2FDRA 3GRPA 4GXQA 4PYRA 2O52A 3ZE2B 3IV5A 4M3NA 3HBFA 5A06A 2DFDA 1UP6A 4FILA 3T61A 1E3JA 4PLYA 1P4WA 1CQJB 4ZTZB 1R6XA 4MUKA 4WKOA 1NTCA 4PCVA 2QN7A 5JQWA 2ZAIA 1TAUA 1HORA 5KWIA 4FHDA 3S2DJ 4QOIA 5FOSA 4FCWA 1M0WA 2ZGVA 2ILTA 1TKBA 4JLVA 3TQTA 1YIOA 1R0CA 1JE1A 3E1GA 4YIHA 4XLFA 3C43A 3Q40A 5IPAA 4F5DA 3WLOA 3ESXA 1QNTA 3LA6A 1ELOA 5JSHA 1F9NA 2OZVA 3H2IA 4RWEA 3EGVA 3GLFE 5BUCA 2MCFA 5IM5A 3VVBA 4OYLA 3JR3A 3IVRA 2NMVA 3CX7A 2Y0SA 4TZTA 3AVWA 3FYHA 2QXTA 2I22A 4OHOA 1MABA 4UUNA 3K8OE 3R8CA 3Q87B 1WQ3A 3ABKH 1JBQA 1GRVA 1D6SA 3D5RC 1T0JB 5JOQA 1ORHA 4PVDA 3FYDA 4IILA 4Y1RB 1M5UA 2CLHB 1PR1A 3HY6A 5ALIA 1I3OA 2L4AA 1IY2A 5GGYA 1O08A 1WV0A 1O54A 1PNVA 1HF3A 4CI9A 3LQ2A 3HBNA 5HS8A 1NJ5A 1WPRA 4QQNA 2A57A 1TC1A 5IAEA 5CIYA 2X1VA 2PZJA 4HVLA 2KM1A 2QN6A 3WQRA 4A91A 3DCFA 4BACA 3EZ7A 3D1NI 2G63A 3PZRA 2OBLA 2FMKA 2NUBA 4A3IJ 3N7TA 1HWYA 3TRFA 2RK6A 2HN9A 2B0JA 3UAXA 4B3FX 4CKWB 4X7RA 1S9DA 3VSKA 5IP9J 4M49A 2SECE 2I33A 4F55A 1U5BB 2ZIXA 3OQPA 4HSGA 4FGSA 3S1SA 5AM3A 1RW4A 1ZM2A 2CMPA 2X8AA 1U2ZA 1RQ7A 1A8SA 4BE9A 3LPDA 2P4HX 4I2OA 4LF5B 2W71A 1W6RA 5H82A 1H6BA 1AKHB 3FA2A 4TS3A 1N25A 3WU0A 4HNAB 1KYVA 3ET4A 3WGUA 4U6NA 3RVNA 3EDRA 5LMUB 2XROA 3PD7A 1FRQA 3N76A 1UK7A 1J8QA 1SC4A 4JLKA 2IYEA 1VE5A 3OEHA 2LVSA 1COWD 5JVDF 1FP4B 2CYAA 2XMDA 3E35A 2B83A 1HRDA 3BPSA 3I01A 2MLGA 5ER9A 4PPYA 5JHUA 2DT7B 3LQKA 1II0A 3RDPA 1HLGA 1W5AA 1ETYA 1Z83A 3QIVA 1RWKA 5CFQA 3NTOA 3UNXA 3EXHA 5T4FA 1P5RA 2EAUA 2Y05A 3AFMA 4DARA 3STYA 1BA3A 2AJCA 4X7MA 3I6BA 5J47A 3HI4A 1OLOA 3HDQA 3R3SA 4G09A 5C52B 1GRNA 1Y0NA 3B02A 1I1SA 4W8HA 2FPIB 4OHBA 2OILA 4U8HA 5BUQA 4B46A 4A69C 2Z95A 1T1IA 5KPDA 4BAGA 4OHWA 3IXMA 1UFQA 3M4OJ 3EC2A 2C2BA 4ER7A 1VE6A 1U99A 2UZ1B 5DO9A 3DEUA 1WS6A 1SR8A 1SHUX 5KYWB 3IMFA 3FCYA 4UUPA 1N1GA 4BFXA 3RJTA 3IVMA 2GAOA 2C3YA 2BR3A 3KLPX 1N0WA 4I9HA 4ZHQA 2XGEA 2W2MA 2QX6A 1XZDA 5ERGB 3ZQLA 2QTAA 3EH1A 3BQZA 3MCUA 2BKUA 4XB6B 1E8MA 4HRYA 1RXCA 4HAOA 2DUNA 2PD4A 4IQ4A 4LJ6A 5FLMJ 1H5QA 4AKHA 4A2CA 4GNKA 1WUJS 4EQQA 5GAEJ 3DBLA 1NUUA 3GJ5A 3JQBC 3KVVA 4ZP1A 2K2QB 3DP7A 3SKVA 1P0IA 1U4OA 3GJ0A 4KO1S 1JIVA 1FA9A 1Y6RA 3QYEA 4RKYA 4XIIA 5DW3A 2GYUA 2FEPA 4N0EA 3I9OA 1POXA 1T9GS 2EJUA 1HDOA 4CHGA 1A8PA 2MSKA 4BNJA 5JAPA 3K4NA 3G49A 3L7LA 1JFLA 4OI1A 4IRMA 5B6IA 1JLLA 2Z4SA 3T5AA 2AF4C 1Z91A 1CJCA 4ZDJA 4H1VA 5JY1A 1UMDA 3JW8A 1YVDA 1RIIA 4PO1A 5CK5A 3TLJA 1EMDA 2XF6A 2EJTA 3HGMA 1FDUA 2J41A 5JNUA 1FL9A 2EW2A 4RDHA 3VFDA 4OCZA 4J7XA 3O8HA 1W5FA 4X1IA 2EQ5A 1KJ8A 3BMNB 4O5OA 2AN5A 1X8JA 3OHPA 4WK6A 5A4IS 2XC7A 3V48A 1RRJA 3IQZA 4RUKA 1G3MA 3VYRB 2XIQA 3DT9A 4IXAA 2YIMA 3WQSB 2EFPA 3OL3A 3MXTA 1HSZA 2PLWA 4JVNA 5IJXA 5FLXZ 2YFKA 2B8TA 2XMRA 2Q5QA 3HKBA 2PL3A 1OH8A 3EIXA 4YIKA 2QSFX 5C80A 4D6XA 1IBSA 4X1KA 5IUNC 3FWPA 2E6KA 4HXYA 4ZOQI 1QX3A 3SS9X 3G73A 1OBHA 2OQIA 4CMJA 2W6PA 3A1DA 3IKTA 1S3IA 3UHPA 5C51B 3O1JC 3C2HA 3NDPA 3QSYA 3IOMA 4BBZA 2XDWA 4F9EA 3QYJA 3GRVA 1U3VA 3SN6A 3IAM1 3KR0A 1UKYA 2Q3EA 3PKJA 1QANA 4KWEA 2VKQA 4N49A 2IJLA 1EBFA 3FLAA 3A6ZA 4EG5A 3OY2A 1SVSA 4LYYA 3H83A 3N7UA 3L7NA 2IFTA 1XN1A 4HK4A 2EDCA 4DHWA 5IANA 4AZ3B 2P7CB 4XB2A 1DBRA 2FN4A 3TJZA 2VAPA 3VX4A 1L7OA 1QK4A 2KW5A 5CH8A 4C4ZA 2F8SA 1GUDA 3DWIA 5JJKA 3A14A 2CFOA 3V9PA 1X80B 2IZZA 2QG9A 4XWWA 1NYTA 4U5QA 3D6HA 1ZL0A 2R7AA 4YXWD 4ZU1X 2ZB9A 5EIOA 4XX1A 2RKHA 1GL9B 1R6AA 3UVEA 3VOBA 4GZ5A 2H16A 2Q6OA 1ZRMA 3P2JA 3GLFB 2GERA 1DI0A 1D5CA 4N8DA 5AVXA 2VJAA 2OMKA 4GRAA 2MSCB 5CYOA 1O57A 5JMOA 4BATA 3H1TA 4GT1A 2YC2C 2GPSA 5IYZB 2UV8A 2GFIA 5K03A 1FP6A 2X6RA 3G2MA 2ZAMA 2DT5A 3L8MA 2ZJ0A 2OBNA 3RJPA 4J94A 1UBNA 3JRWA 3VPBA 4R40A 2AMJA 3WVNA 4DV1B 5ARCA 1AC5A 3PQDA 4WY2A 4I4TA 3EVGA 1DINA 2AQIA 2QYTA 4I3GA 4YPFA 4EW3A 1RESA 4BPBA 3JWPA 1GTMA 3SPXA 1TK9A 2FYTA 1M1YB 2CRGA 1VP3A 2PXCA 2O8EA 2ZJ7A 1X1QA 4OJYA 3WGQA 3IH2A 1L5LA 4PYQA 1Q3HA 1HM5A 3VNQA 5E0OA 3H8WA 3FUCA 3DKYA 2X4DA 2OYCA 3IXLA 1IHDA 3ZHRA 4MK4A 4AIRA 2ZXEA 4U2DA 5JXGA 2Y2VA 3N2GA 1FSSA 1ABEA 2WFZA 5A9SA 3QU5A 3THXA 1K0UA 3LO8A 1JMYA 4EL0A 3I5UA 4QWWA 1GGKA 1MW7A 2VEDA 1SZDA 3GQBA 2PT5A 3VU0A 3CZCA 4P4SA 1R5BA 5JU6A 3C85A 3HPRA 5E1OA 1T4BA 3FI9A 2E60A 2JFBA 1MH1A 4B84A 2Q3BA 1XG1A 3ZW7A 4R2MA 1V8ZA 1JR2A 1HURA 5F78A 3VO9A 5DLEA 3O8LA 4RV9A 3G7NA 3C3YA 4LFAB 1M2HA 3BGOS 3D3WB 5KJFA 2WSSD 1YZTA 3I2KA 3E82A 1E3PA 5G3YA 1JPJA 5ECDA 2AYZA 1JHPA 2E34A 4Y2XA 3M2TA 1MRSA 2FRHA 3RYRA 4ZZIA 5JYBA 2YOFA 1T2AA 2O6GE 2PZAA 4HN4B 1K66A 3UWSA 2DO7A 1FSZA 3ZNPA 4R2LA 4W1PA 4KXQA 3S7ZA 5BN5A 3JY6A 1IQRA 1J0EA 1IC6A 4R8KA 4UCFA 1Y1KE 2GJSA 2VXZA 4NCHA 1OXTA 4E6EA 1QV7A 3K6GA 3JQDA 1CIVA 1COWA 4L7VA 2WWWA 4KQWA 4XQ9A 1W52X 5C2JB 1W4MA 3W05A 2FG5A 1I6KA 1QE5A 2Z99A 3U7GA 4I14A 4BJ3A 1JDJA 2KRCA 3VRHA 2Z2YA 4QPQA 4DUGD 4PGMA 4XVCA 2FUG1 4ZU3A 4CMBA 3BSYA 4IUCS 1KIAA 1ENHA 3HSEA 4IEIA 3T52A 1KYQA 5JBIA 3E0JB 1GAXA 2P68A 1TYBE 1OLUB 5CX1B 5FBVB 3VOSA 5DLPA 4B3RB 2XB8A 4YJ2B 3QQAA 1E20A 4OF4A 2QZSA 1KE1A 5CVDA 4JV5B 1UK9A 4Q4ZF 4G9EA 3TM5A 4NV1A 3IGFA 1ECBA 3ET5A 5ALXA 2XCQA 4R2XA 4IV8A 2PYIA 4WXPA 5TJHA 4BNNA 1RYYA 2ZT8A 2EV9A 5HHTA 4QT4A 4CEHB 4BLTA 1T1RA 3ICCA 5EIXA 1N2BA 3R7DA 4KVZA 3RHTA 4YREA 3B5IA 3ZI0A 2X5KO 5H4HA 3LP6A 1N77A 5DD4A 3S3TA 3RV3A 3NARA 3ZE0B 4TMVA 3LLUA 3JTMA 3BL6A 4XSVA 1GA6A 1Q5PA 2AJ8A 3FOFC 2XT9A 4QICA 2QNBA 1P1RA 3LRXA 3OQOA 3MF4A 3ITNA 3ZBTA 2G70A 4YP7A 3E70C 5CM2Z 3O92A 5HCUA 5CVUA 3V8NA 1KEPA 2PQ2A 4KFUA 2DTRA 3O9VA 4RJKA 1VE3A 2FSPA 4CICA 1P0QA 1H3FA 5FTWA 1DAMA 3GB9A 1XBTA 1YCFA 2V96A 4BNWA 3L6EA 4GSLA 2JAPA 1J42A 3HADA 2PFSA 1WKMA 2ECCA 1VIMA 4FBMA 3GHYA 3T7DA 3WG7H 4BP8A 1YZUA 2DQLA 3EJ6A 1ZVJA 3OM0A 3AY3A 4U3JB 1XDBA 1JT0A 3DMGA 2DP4E 3FROA 3DLPX 2Q1SA 4WMLA 4J0CA 3M0EA 2JA6J 5A3VA 2HOAA 2OCPA 4BO6A 3TEMA 3DCIA 1U98A 2X7JA 5EXDA 1VYVA 1SBQA 5JT1A 1N7IA 2FEKA 4B81A 3N2LA 1E2GA 3J81Z 4R1LA 3X2SA 2D5AA 1QIIA 2QVZX 1ZOIA 4LRQA 5TSDA 1EBUA 4KREA 3FGPA 4L72A 2Z4TA 1YTYA 2B30A 4BO9A 3IB6A 1US8B 4Q4HA 4B0PA 2X2FA 1WA5A 3QPVA 4MGRA 3BJOA 3I6ZA 2ZRMA 4IHJB 3KIOA 4JKOA 2MFZA 1RAHA 2VYCA 1V7QA 3RFTA 4HDNA 1ZNWA 1ZINA 4DMFA 4ENNA 4X20A 3WLJA 1MVLA 3OIUA 2IPAB 1NOIA 2VP6A 3MINB 5A3JA 3F0CA 4NZZA 1ODJA 4JUCA 1TQ8A 5L7YA 2R2AA 3T3DA 3PF8A 4AC0A 1B6AA 1GCAA 4K6GA 3Q6NA 2GA8A 4FYJA 2GT1A 4LJAA 4LXYA 5JJIA 1EFPA 3BH6A 1V41E 4DEVA 3Q0TA 3GFPA 2C6YA 4PHTA 4BZWA 1E66A 2XQFA 3AETB 2C4MA 4XR6A 2C7GA 2CWEA 2XNHA 1ZM3A 2QKYA 1GJRA 2G9ZA 3I0MA 1D6NA 4LBYA 1D1CA 1A1SA 3D02A 4NDLA 2AKYA 5E8JA 2HFHA 3LHIA 5HKLA 4G8JA 1U1IA 2H7CA 1ZD4A 2HI0A 3M1YA 5E9JA 4YAWA 1XGSA 1MB2A 3WNZA 2IXBA 1W93A 4WACA 3GYHX 2AGVA 2V58A 5GAJA 1YKSA 5FFZA 3ACDA 1VOTA 4YXWA 2E7ZA 1NFRA 1NNLA 1DMSA 3E5RA 4UZEA 1OXXK 1WBBA 3WP0A 3U9LA 5ALRA 2Q7XA 2TRTA 1PR6A 1PNQA 2WYHA 3BRCA 1Y8ZA 5IBQA 4LDJA 1YVEI 2BDEA 4WK2B 4JC0A 4UMEA 1ZU5A 1B8VA 3D5LA 3CJQB 2W6QA 2V79A 3WGVA 2R751 4JLOA 2BKLA 2P65A 4WZZA 4NHJA 4H35A 1FPMA 3DYIA 4H7PA 4J6EA 3VPGA 4XYMA 1UC4B 2X0NA 3U3OA 4JVLA 2CW5A 4JU9A 5FHQA 2JD0A 4FZJA 4LI0A 4JQSA 3DTTA 1U0RA 1QAOA 2QW1A 3SHQA 3NEUA 4C3ZA 3W04A 4TPKA 2G9QA 2POQX 1QLWA 4QDJA 1UPUA 1WD5A 1NMZA 2Y69H 5FL7D 1XHEA 3KYLA 4C21A 1P74A 1NXVA 2B20A 4RA2A 2GD0A 1V37A 1XALA 2X1HA 4ALJA 3UFXB 4LOKA 3FBIB 2PWAA 2YCBA 1B8OA 3CZ6A 4MW9A 3W6OA 1W7PD 2RAVA 1RR8C 2UWMA 3LUBA 2C5AA 4HGOA 1OROA 1FFYA 1P7YA 2OU2A 1K5GA 1Y80A 1BN5A 4Y2UA 1XGMA 1NNI1 2X4IA 3TO7A 1FLAA 2WLTA 2C1EA 4DXDA 2XNCA 4W1SA 1HW5A 2IEAA 4BY7J 4YUWA 1FBUA 4Q3KA 3F6VA 2ZAYA 3QXJA 1H05A 4NP6A 1YE9A 3DONA 3SJBA 3DZFA 5J58A 4X62B 5IZ4A 2J46A 2AHRA 3CLSD 1V3TA 2R66A 2FCAA 4JT4A 5CLHA 3VVCA 4BQIA 4PSVA 2J5KA 5E7MA 2G8LA 2HU9A 2REQB 5IFLA 1NW6A 4WERA 1F2DA 3HHPA 3EIUA 3LA2A 3QPSA 2AEJA 3ZN2A 4KFSA 4DY4A 3ZWMA 1AH2A 2WSSA 2NXEA 2F1JA 2YDXA 1ZR2A 4EGSA 4FTHA 1WE2A 2ZUWA 3L1UA 1C0LA 4V2IA 4RK4A 3AJ8A 1JG6A 4EWLA 2GPJA 1QHFA 3BIFA 3K9BA 5E6SB 3TQNA 2C9BA 5ANRB 3IH5A 5AJTA 1O1YA 1F8YA 4WGGA 4FLMA 4PNZA 2CSUA 2L02A 3RSZA 3K5IA 3RHFA 1E2MA 2A30A 3FTCA 1AQ6A 2CUKA 5J2TF 1GUBA 3IDQA 3GRCA 5J6XA 3IJPA 4DUGA 1WKVA 4RSRA 5CH3A 2BHYA 2DUWA 5FWYA 1X3SA 1DBSA 3V4OA 3UUFA 5GOZA 5EF6A 4YRFA 2WG1A 1LWOA 4EHHA 4FHGA 5AXAA 5F35A 5EG0B 3N2KA 3PIIA 2HJVA 4TLEA 3GFSA 1YJ8A 4JP5A 3F6YA 4QU5A 3EDYA 1RXSA 4Q3LA 2EFOA 4B80A 4R2WA 4R8VA 2VJQA 1HYHA 2Z98A 1E2KA 4ZREA 4GC5A 2IDZA 1J39A 4EAQA 5D3ZA 3UK7A 5CH5A 2WA1A 3MNFA 4C3HJ 1YJCA 3D6FA 1SKMA 4KTTE 3IIKA 4QQKA 3T9FA 5G40A 4P96A 2C1XA 3NHRA 1MR3F 4UHHA 4IXNA 1G6NA 4YCBA 4PXYA 4BO8A 2QMHA 4AU1A 1G3UA 4RD2A 4LJRA 4UCXA 2K5CA 2W8ZA 1K83J 1TWHJ 2DETA 1Y56A 3L0SA 3KX2A 2A68F 4G2NA 5LL6P 5J2UA 5LLQA 5C44J 3DULA 2QRVB 3RWOA 3GRAA 2BHLA 2IU6A 4XDGA 2R7UA 3O2QB 1C3XA 4WCFB 4ZEOA 2WFLB 1LA2A 4DCSA 2FR1A 2IF2A 3IVXA 4YCSA 3EPRA 3FKIJ 3PKIA 5HILA 3VA7A 3SZRA 3CMCO 1U6GA 1ODTC 2Q45A 1XMOB 5C5DA 5FKOA 1JFFB 2DPUA 1G4HA 2H1LA 1SCIA 3K5WA 1NG1A 1JIJA 1NW5A 1B0AA 1W5BA 4BJ6C 3C6BA 4MW5A 1EU1A 1L5VA 3L4JA 4BY1J 4LUCA 1ABBA 3VHLB 2IK8A 4JI2B 4HP8A 4HC4A 1KRWA 4GHWA 4R4JA 4Y2SA 1ECFA 1G5FA 4M8LA 1JYSA 1Y82A 4PHFA 3MK31 4HB4A 2JPCA 1LEBA 5DTJA 4PLTA 4ZPJA 2UXXA 1MMFB 3M1EA 3GGCA 4BCCA 4LXQA 3EX7C 4HZUA 1RACA 1OCTC 1A9YA 1TYDE 1V4RA 3GX4X 1UMBA 3BZUA 1D9XA 5LQMA 1U2QA 5EZYA 1Y3CE 4RX1A 4WLOA 4DABA 3LF2A 2G4VA 1WCMJ 5JD4A 4KYVA 3RUHA 1GA4A 1BR2A 2PRYA 4RTPA 4QM7A 4Q5SF 2FFBA 3BFJA 1DAEA 3FZNA 2JLWA 4B2YA 1M8GA 1H9CA 4FJ2A 1GG5A 1QFZA 5C3UA 1PS9A 3T9CA 4F38A 2P90A 1SCJA 4FQ8A 4D5CA 3H99A 4QASA 1PT8A 1IHYA 1KVSA 2Q5IA 3C7AA 1NQAO 2ZCJA 3GFTA 1A69A 3UMRA 4CKYA 1CHNA 1D8TA 2O2HA 3TXYA 2VCHA 1HZJA 2DPGA 3DMTC 1VPTA 2I80A 5CPBA 1XVUA 4RD0A 1FBTA 5DEQA 4J0IA 1DKOA 3BGIA 3CVYA 3IO5A 6LDHA 3WGTA 3T1HB 5IPFA 1C0KA 3JYLA 4UHDA 4QOGA 1BH6A 3JARB 4EKNB 4YRRA 3HVHA 3N8GA 3EGIA 4P4LA 4FE7A 2HPVA 3FNIA 4RDCA 4G36A 1ODSA 4O4JF 2AEMA 4CIAA 2WHYA 2XUQA 3C7DB 1QZZA 2V7FA 2V9KA 1UG0A 1KZHA 4BE1A 2M7AA 2D06A 1LDEA 3QBTA 5JALA 5EYPA 1GXSB 1WXWA 2BE5F 1N0VC 1XRMA 4UUSB 4RKWA 2R8RA 4QHSA 1GPLA 4UHKA 1PEAA 3VYUB 1EUCB 1PFKA 2PZFA 4QYXA 5JW6A 4B6QA 4HDKA 1QQBA 3V7SA 2PRKA 4AMVA 3PD1A 4G5GA 1LDNA 5G0WA 1CEQA 1PTJC 3L3BA 4RTJA 3TQCA 2GBIA 2YN0A 2ODAA 1X77A 3DV0B 3UAWA 1U3CA 3BREA 1T6YA 1VRCA 2NSLA 4IUBS 3OYAA 2V3WA 2BDUA 2YQ4A 3V8QA 4M1EA 1WDLA 4DE5A 4QDOA 2ZBGA 3I28A 1OTHA 3ZU5A 1FYLA 2OZKA 1RLIA 2AQKA 3CEJA 3S14J 2BR4A 5DX8A 1MQ8B 1BCRA 2Y0CA 4YMUA 4H18A 4JJZA 2OC9A 3SDSA 1S2NA 3QEMB 2ZKZA 3Q5GA 4QGAA 4G0ZA 1XAIA 5JC1A 3H8VA 4RVUA 2NP7A 2G67A 2EKQA 3MCZA 3O03A 1DUVG 2YMLA 4X92A 3ELYA 1YD7A 2OHIA 1EP3B 4CLRB 4X7PA 1I3AA 3OZFA 4V19K 5FL7A 3RROA 5K3SA 1MNEA 4NYMR 2WWYA 3MBKA 1D4ZA 5IJ9A 4MIEA 1WMDA 1QQ6A 1I4EB 2W4MA 2YWRA 1Q0TA 4OWRB 3P97A 1DTWB 2DCMA 1Z9BA 1W7PA 2X40A 1XTIA 4D25A 1NVBA 3HUTA 3ZV5A 2JK0A 4I81A 2BEUA 4IZZA 5I3CA 1HNWB 3Q0WA 2X42A 3I5AA 5ALFA 3EXIB 4A7PA 3ORFA 1M2OA 3DWFA 2RH4A 4O4HF 1P17A 2JH9A 1C1XA 2II6A 3Q3VA 4UNNA 2X9LA 1Q15A 3KSZO 2MSWA 4ZVKA 2WYWA 3MMNA 2ZE7A 3QNWA 1TB4A 3FCEA 1SQ0A 2HZDA 2OCDA 3EHEA 5FA6A 4MW0A 1JXMA 5GAHJ 2GD2A 1SZJG 1GZ7A 3MZYA 1ZDMA 3IUSA 3UMMA 2AVDA 3GZTB 2CQ7A 3ORRA 1BL0A 1ZH8A 2G09A 4RCYA 4RE6A 1CF7B 2X1LA 4R6WA 2C9ZA 5ELMA 4ZAXA 4RZ2A 3RSLA 2VLIA 4OI4A 3UN1A 4YRVA 1NP7A 2EG9A 4KWIA 5CHEA 2Y9PB 4AQYB 1MAVA 4OHVA 2XBUA 3GMEA 1LFDB 4IDAA 3NTXA 3D81A 3ZGVA 1JMKC 1ZGGA 4NU8X 3S2GA 1G6Q1 4H7IA 4MA5A 4X54A 4RU1A 3AKYA 3VKUA 3H9JA 1OI3A 1FTNA 3UGJA 5E7QA 1K4YA 3TR0A 1AOYA 4N1AA 3FM9A 1RLTA 3LY7A 5LQAA 2E5FA 3U4GA 1BDIA 2XYRA 3FVVA 1XDSA 2JRMA 5CVTA 3W1EA 2RHRA 3TG8A 3WTVC 1V16A 3UJ8A 4UUVA 4DOMA 4II2A 2XRZA 1RLUA 3ZE9A 2CDRA 3LT2A 5LA6F 1XCBA 4G0QA 2WJ3A 4I9UA 4QDUA 3B2EA 4O4LA 4IMPA 1F38A 2TMDA 4CDGA 4BC1A 2QX8A 1GPKA 4CF5A 3RLIA 3KUDA 1CUYA 1X3LA 1DC5A 3ZCVA 3VR4D 3LC2O 1P4RA 1FOKA 2V74B 2BFFB 1A9QA 2PTHA 5JARA 1NE2A 4S1TA 3IT3A 1JVSA 3S2YA 2IEGA 4W7SA 2MSYA 1UIMA 3NUGA 3WMXA 1KU0A 2JA2A 3GA5A 1U0HC 4HSTA 2PXHA 3H5RA 1UF9A 4Q4DA 1E0SA 2W6NA 1EVEA 2RKOA 4CXFA 4OJNA 4L5JA 3NBFA 4N3AA 3OF5A 3U0VA 2VQCA 3G6WA 1LW7A 3SKXA 3B3JA 2MR5A 3X43A 4FLEA 4FZVA 1HKSA 4NXNB 5H3LA 1JKPC 1P5JA 3R61A 1B1BA 2P6SA 3WJ1A 3TSAA 1JKJB 3OCXA 3L7WA 5DBIA 3WKDA 4UATA 3WICA 5AHWA 1U5TB 3ZXYA 4DKXA 2QVCA 3VDQA 2PFGA 2ZSIB 2JIQA 1WF3A 1HDZA 3WAGA 2RDPA 4AJEA 3E5QA 3NNDA 2D3TA 5DX0A 3K9WA 3VOEA 5AYVA 1NULA 1IYZA 1LH0A 1PJ4A 4MCHA 1NW9B 1DL5A 1EFKA 2R7XA 5JQGB 3NHLA 1Q91A 4OMDA 4RFSA 1WAMA 3F5SA 1RSZA 3W6KB 1ISRA 1TCBA 3EFHA 4CN9A 1T9HA 1G3TA 3V7WA 2VHTA 3CRZA 2PMWB 2VJKA 2V1DA 4MQVA 4B09A 1ODLA 2V54A 1O94D 5FTKA 5E1ZB 5L3QB 4LXIA 4XFJA 2WE8A 2ZWOA 3WX0A 1GTZA 4CCYB 2V9VA 1YDWA 3MT7A 4L9TA 1AX9A 2FK7A 2V7EA 2VQEB 4AD8A 3BF7A 5EJFA 1BVYF 3B9RA 2X9NA 5IAKA 1UM9A 4RYLA 5IYBJ 2CQQA 3G7SA 4DRZA 4D0PA 3IQWA 2BMAA 1NMQA 2YVLA 4P98A 4LK1F 4E0BA 3MPOA 3E1KA 1GLGA 4OBWA 2NT3A 2OGZA 1U8UA 2RN7A 3IIEA 4DVGA 3ISVA 3QPCA 1RZUA 2K3FA 10MHA 5A4MS 5F08A 3JXEA 2L7FP 4N7MA 1UPTA 1ATIA 2OZEA 1UPCA 4MWOA 1ZOSA 1PGNA 4AP5A 3RYHB 4I4NA 4LYEA 4BFYA 4DZRA 2IHVA 2C78A 1P5ZB 3C8DA 4Q16A 1GKYA 1SHZA 3CQ9A 2N1MA 2PWBA 1KJYA 1E18A 4EMUA 4R7ZA 1U0FA 2B35A 2JJ2D 3KZCA 1DGQA 3O3OB 4RHYA 1NC1A 3K1JA 4YALA 4PSUA 2WBLC 3TW8A 4EI7A 2PLRA 3A0HC 1NDQA 1T39A 5IJ0B 3DGEC 5EWLA 5MF6A 3HGTA 4X65B 1AKVA 2P0EA 4LWQA 4Z53A 2B9EA 4IXDA 5JH7B 4Z0NA 5ARBA 4L5AA 4BE2A 5F5XA 5GV8A 4E1AA 3KV1A 1N5LA 4QDZA 5BOSB 3DFGA 3FE2A 4GECA 4N9IA 3EY4A 4FU0A 4OIOF 4YRZA 4RVGA 3TFWA 1Z4OA 1M8FA 4RZHA 1ZQ3P 2Q49A 2R7SA 3WFJA 1JHXA 3OY9A 1TFRA 3S2HJ 1X1CA 4GUDA 3IE2A 2YXNA 3N5KA 4MA4A 1PWYE 4BGIA 1X87A 3GDOA 3RH0A 2BH9A 3MZ8A 4Z6KA 3JD0A 1E4EB 3P0EA 4CL3A 4C7JA 3ZI4A 1NQXA 3A01B 5HCNA 4TL9A 3AF2A 3B53X 3FFBA 4HDSB 5GZ6A 1WVRA 3AV3A 2XJ9A 3OPMA 4BB5A 4D3YA 2V6BA 2P6MA 3HUGA 3H1GA 4ZT7A 4BL5A 2W8BA 4LXXA 3A4CA 5T7BA 3L8HA 4QPZA 2JVIA 2IZ0A 3S2EA 2EU8A 1IWBB 2IHJA 1A5ZA 1M8JA 2VHZA 3LC0A 4PV7A 3WYBA 3RC9A 4RZXA 1O4VA 1IOLA 2E35A 3E9CA 3E7FA 1T4DA 1IY0A 4D8YA 1EK6A 1CW2B 4RPKA 3KFXA 2ZTHA 3I3LA 2R6HA 4R54A 2C4UA 2YYSA 4QQFA 4G81A 3A2MA 2ZI7A 2ZU0C 4AP9A 2PFKA 1M2VB 5DM60 4QDXA 5DV9A 2P3OA 4W9MC 1JG4A 2IHYA 3R7LA 2FX5A 4M1QA 1XEWY 3RSCA 1FFHA 3ZMUA 1SUSA 5CNJA 3EYWA 1N8SA 3T8YA 3QF4A 2QT1A 2XHEA 2FPKA 4ZICA 3GF4A 3JRCA 1NM5C 2UZAA 3U2RA 2ERXA 1PU2A 2G76A 1XTVA 4M76B 3DDHA 3FZGA 2UUAB 4MULA 2I2WA 2XDYA 2HWYA 4B4OA 2ENWA 3W5SA 4QKQA 2WJPA 3UUWA 2P6TA 4RY2A 1V1RB 3GLIE 4KT6A 1PT5A 5JAHA 2CXUA 4Z99A 4Q3DA 1PWEA 2IYNA 2CLIB 3GVPA 4R1SA 1RQRA 4LVOA 1LB2A 2WIJA 3MFQA 3C5WP 2R3SA 3JVEA 1C0IA 4K88A 2PIAA 3DFFA 2GO1A 3Q85A 5FUWA 4C89A 3SYLA 1IZZA 3SIRA 5BVGB 4NY1A 2V7XA 2BBSA 3RF7A 2IH2A 1W0UA 3RBAA 3PQCA 2A35A 3O83A 3NFYA 4OK3A 2VI6A 1TF2A 4YB8A 3TIIA 2EBWA 5KX5B 1IDZA 3F8FA 1LKXA 1QPIA 4ESFA 4BGUA 4ZO7A 1GU7A 3PLAE 4Q9HA 2EARA 2BMDA 4MINA 1GFWA 3IHKA 1X7ZB 4RPIA 4XWYA 3S1RJ 3HJGA 5BV7A 4RTRA 4MROA 3I37X 1JPVA 1NJ1A 1Y8QB 1FDWA 2ZZNA 1JT2A 2OZLB 4XARA 2CO5A 3MCAA 4INZA 2VYQA 1NJ2A 1DJNA 1B8IA 4JJKA 2FU5C 4NC8A 4RTSA 3GA0A 4MQBA 4J0HA 1ZNYA 3ED5A 2ZJAA 2WILA 4U7WA 5A9TA 3ZDAA 1BM9A 4PG5A 1RBMA 3AGPA 2XADA 1G9SA 1ODKA 3Q2IA 5JCXA 2D74A 1KO7A 2AS0A 1JQKA 3VR4A 4QWMA 2RIPA 1M1YE 3SOPA 1LLQA 3ZY4A 1UZAA 5JNWA 2P5TB 5LZ9A 2HXIA 3AEKB 5F04A 1RVDA 2RSLA 3NHKA 2PU7A 3A9RA 4D0GA 5IT4A 1MD9A 3PVZA 2R79A 2F1RA 3DOJA 4TL6A 4I2VA 3U7FB 1LSOA 1FFAA 1C9YA 2BGTA 2JI7A 2WJ4A 2QTMA 1KE2A 1G38A 2IGTA 4C6TB 4IZIA 3UFBA 1CDOA 2H59A 2ZBDA 3STTA 5FO1A 4JSYA 5CD1A 2QKLB 1E6CA 4ND5A 5JYCA 2H06A 4RPLA 4EPXA 2ZK7A 4AS3A 4PLHA 2YIDA 4J0GA 4PN3A 3P0JA 4FFMA 1ZX1A 3P9XA 4PC3A 1W85A 4EG6A 1QHYA 4EKDA 5IKOA 5DCUA 2HIHA 4G89A 4L9VA 2I55A 2C5BA 1BIBA 4FQGA 3JQ8A 1BROA 3W6JB 4K8RB 3G5TA 4D0RA 1VCIA 3MMYB 2ZYDA 3P2IA 3K4JA 2VJ4A 3S8YA 2R1TA 5EMJA 1R1TA 3CPEA 4BJ1A 1PT6A 1FZQA 3OF2A 3RG2A 1U2DA 1RDFA 1JQ3A 3C2QA 3SM3A 4RKFA 3ZQ7A 2BFPA 2BTOA 2MINA 3FTEA 2CLFB 5AIPA 2OE2A 4G25A 4LBZA 2D0DA 1G59A 3L5OA 2R97A 1SFRA 2LP4Y 3E0XA 1QR6A 2NV6A 3MB8A 1O94A 1J2UA 4KSYA 1IDOA 5ALSA 3PL8A 3TFQA 3PQEA 5K0JA 3DEKA 2XDAA 1P91A 1SKYB 1DJLA 2GHIA 1O6ZA 3TRKA 1XEFA 4Q7LA 2W6CX 2GESA 3KZVA 5BUSA 3DZKA 4HGPA 2NU9B 3DC7A 1X1TA 4TVSA 3D43A 2O3TA 5BSUA 2IHZA 3N8NA 3FPAA 2ZI9A 1RI7A 3VR6H 5BNGA 1EFDN 3BFKA 2QAGB 1QLHA 4TVOA 3C1DA 4OFBA 2W37A 2O5EA 2JHFA 4X61A 4NMMA 2ENUA 4AN4A 5AI5A 2IU0A 2JRTA 4BV9A 1Z0IA 1W75A 3SJUA 4KYWA 2A3RA 1XLVA 5HKAA 2BGKA 5ALVA 4ZT4A 2J0UA 5B37A 5HM6A 4M6YA 4A8HA 3A6HA 5A0TA 5I4BA 3CP2A 4R9UC 4DIEA 3L7YA 4I4TF 1SCBA 1O89A 3GT3A 1CRQA 3K0FA 3N86A 3AM1A 1NRWA 2JJ2A 1H69A 3N6XA 5IDYA 1DCFA 4X41A 2PJDA 5D5VB 4RS8A 4TS1A 3PUIA 3S28A 3UH0A 4HLQB 1B3BA 2IYTA 5FTNA 4Y7CA 3KZOA 2IH4A 1CZHA 1NRIA 2AG6A 3W2EA 3SF8B 2CV1A 5J40A 4YRAA 1K86A 2XZTA 3E3AA 3N70A 3QOWA 3UZUA 5EIBC 4OJTA 2JBHA 1T8YA 1EFUA 2XZOA 5CGQB 4B8ZA 1H4QA 2O5CA 1EB9A 4OXYA 2GMWA 1Q1EA 3TAHA 1ZW1A 4HUQB 1IUOA 2AC2A 4EY3A 4Z2YA 1A27A 4FGZA 4HY3A 1GEEA 1F48A 1P0CA 4QHTA 3PTAA 2WQ7A 3KEMA 4M9SA 3OIWA 1P9LA 2QQ9A 1DQPA 2BM0A 2VZLA 1VPEA 4KNWA 1I14A 1WW8A 1N7HA 2HNAA 4AY4A 3OQVA 1QJCA 4H4KC 3I76A 2J1LA 4HLYA 2BV6A 1RXUA 3FISA 1G98A 1N6HA 3INNA 2RGWA 2OBMA 3H87A 2P5YA 3PCTA 3CLKA 3WAKA 3R0IA 2WTXA 2OGUA 5H0IA 3BCRA 1Y42X 4QTRA 4NMWA 4AWBA 2IE8A 4AYBN 5BW8A 4A16A 1SIUA 3BHNA 2QTLA 1RPZA 2ORYA 1T6XA 4FYYA 3QAHA 2X1DA 3WWEA 3V4LA 3NALA 3ICEA 3TTVA 1LDBA 4A73A 3KP2A 3PD0A 4TQUS 4Q9JA 3OQ1A 2HMWA 4FW8A 2ZSKA 3TYXA 4DJAA 5F7JA 2STWA 3ER9A 2P2NA 4XGNA 2QMEA 5DD8A 2A9QA 3FPGA 2QJRA 2LY2A 4LOHA 4AJPA 2B94A 3T34A 2JTVA 2A3SA 4NU6A 2E7WA 1IZ9A 4PXAA 2AUTA 4XFDA 1GNSA 3NBAA 2AN9A 3H8JA 3COPA 4MKZA 1AXEA 1GPUA 1A9TA 3E58A 4N5LA 3BDVA 3MLEA 3SBEA 1WMBA 4WD3A 3EVEA 3AILA 1JJ6C 5U9CA 3QA3E 4XVQA 4Y33A 4IIJA 1E58A 1VMIA 3BSSA 3GLIB 4RZSA 3RGGA 1A6IA 3TXAA 3WTZA 5ENDA 3T7CA 2D8MA 3LUFA 5KQLA 4UOEA 1N8NA 3USES 2JHAA 3LUGA 4IZOA 1HE5A 2YVQA 4I9GA 4Q9KA 2VA8A 2EIKH 2VH2A 4MZDA 2D54A 2J3KA 3VH3A 1VRVA 2D2VA 4U2KA 4QPOA 3NVAA 1KFBB 3LK6A 4JP3A 5B1SA 2BW0A 3BZ6A 3K2IA 1ATZA 3MWEB 1EFCA 3W2VA 2QPOA 5IM4A 3DEIA 5H7XA 3IURA 2OXCA 1KPGA 2HGSA 2AXQA 3E5NA 1QP8A 2PJRA 1J5PA 2O3FA 3QODA 4J3JA 4P5OA 5BVHA 4QREA 1GNRA 1NC3A 4EPWA 5KDDA 2H5LA 1UZCA 1PDOA 2LE0A 2C96A 4B43A 3CUQA 5B36A 5DNDA 5GWXA 2EDAA 1EWTA 1GL3A 1TKAA 3MCVA 4KMSA 2K4BA 3TZEA 3GTMJ 2JCSA 4DMUB 1OGJA 4ZA2A 3QFSA 1HKHA 1FRZA 3AFHA 4V0NA 3U3ZA 2HSDA 2L9NA 3QI7A 2GAJA 1JA9A 3GLHB 2BM9A 2PUGA 4BO5A 3E97A 1IVYA 2IWHA 1ZOPA 3NH6A 4I4CA 4BQNA 3ITEA 2ELKA 2Q2NA 4AP6A 3ZWNA 3MVEA 2EFDB 4TM7A 2BHNA 1KEUA 2KI5A 2KRHA 4DLWA 4N5HX 4KO4S 3WYGA 3CNBA 4FEEA 1YJ9I 4FDTA 1Y1SA 4BFWA 1MAWA 1CS0A 4HS4A 3PI7A 4HVAA 3R44A 2DA4A 3HXOA 1T9GR 2XQKA 1VPLA 5JCOA 1UJMA 4LGCA 4GH5A 3K4KA 1VI6A 2XRLA 4YDQA 3NFRA 1R2QA 5K4AA 3MMSA 3AU8A 4V0LA 1LNSA 3AONB 3F78A 1PFVA 5BSTA 1RYDA 2IIVA 3AJ9A 4U7PB 4XR4A 4MS3B 1E7RA 3DVAA 4XRSG 3KJZA 4MR7A 3BMQA 2J5RA 4DCJA 2BFNA 2XWSA 3U3DA 3BGSA 5G0TA 1GN8A 3V7YA 4X3CA 4MR9B 4GOOD 1BW5A 2HKXA 1P7WA 3IOBA 3SSAA 3SGLA 1CZLA 2CNBA 4F4HA 1UB9A 2FMXA 3ROXA 2XQVA 1RM0A 3BQYA 4KX3A 4ZYXA 2JT1A 1Z0FA 3PQ3A 1E1MA 3BTUA 3DDSA 3Q7PA 5ITWA 2ODWA 4CT5A 4FE4A 3Q7RA 1P1KA 1GUAA 2AFRA 1JXOA 2RK3A 2X5XA 1N2JA 4N0BA 4DLNA 4AKGA 4CLOA 1MNAA 5A2QZ 2F4IA 1IH8A 3EXAA 1KMHA 3EAGA 2YUSA 2P2SA 2D4AA 4KIUA 4AJ9A 2PZMA 5ESDA 1H4TA 4RBOA 2C82A 3T8RA 4J1TC 4IKPA 1GVDA 2PUDA 2V6FA 4HN2A 3PUYA 4EUFA 4I08A 1J70A 3T8TA 1MORA 3S99A 1B0PA 2KIMA 1G8KA 1K6XA 1PBNA 3IODA 4PSDA 5EJCA 2HA5A 2Y6VA 3KL2A 2D59A 1RP1A 2F1HA 3EQZA 3SZ3A 4X84A 1D8KA 3CMMA 2GM4A 3OD5A 1BOOA 2BMWA 2JZCA 5HKOA 4GPTA 3OEYA 4Q18A 1MG0A 4YRTA 1EGVB 4BMPB 1D0IA 4LN1A 5ALUA 5EKUA 3G7UA 2O8FB 2Y76A 3M4JA 1ORKA 3BJIC 5AI6A 4YCMA 5LYJA 1QG2A 1NUSA 2XUBA 4UVBA 2D4HA 2GAUA 4YAEA 4PFOA 3PYLA 4G6ZA 3E22B 3ETJA 5CXQA 1USVA 2BGLA 3SE0A 1KI1A 1PUFB 8ADHA 3S8MA 3F9KA 2QZ8A 4L50A 3KDSE 2QLLA 4DYCA 1RR7A 3DZIA 3KJNA 2VJBA 2P41A 3KQWA 3T0YA 4R1MA 4C0BA 1S8OA 1UZMA 4TKVA 1RKTA 4K7JA 4JC5A 4DNXA 4E7PA 3TP0A 1ZLXA 3TLMA 3AHGA 3AEXA 1M66A 1NTRA 2PQ8A 2KB0A 2YZKA 1VGQA 2JGNA 3OX1A 3TI9A 3BTIA 3I04A 3SYNA 3QLVC 2WB1A 5E3JA 4BXOA 4BHPA 4J01A 2GCOA 3FWEA 1KZ4A 1Z5GA 3H5IA 4PZAA 4LECA 2DK8A 4XICA 4HNGA 1KZGB 4MIOA 1UWCA 2LZ0A 3SX0A 4F4JA 3GP3A 1M2GA 2OV4A 1JJ8C 4CF6A 5I9IA 4HB0A 5F2NA 1DFHA 2A2ZA 4U0WA 4Y8VA 3N8HA 4I4IA 2EINH 3VU9A 2MSDB 3WGIA 1BDBA 1K1EA 1VI2A 3O1IC 4LOIA 1BVUA 2I8LA 2H5EA 2G5CA 3MMZA 3BC1A 1G5TA 2QQBA 4HO1X 1G66A 2CLLB 5DP2A 3HB5X 1TM5E 5CDGA 4KQXA 4OJQA 1XMQB 1PGOA 4TLAA 3RLFA 3BULA 4WDQA 2FZGA 1B76A 3F90A 3GGGA 3EOZA 1PE0A 4PLCA 2WC1A 4G4IA 4LTNA 2JIRA 2VDWA 2JIPA 2QP4A 4EARA 1A9RA 2A7XA 3AIKA 3N0RA 4YROA 4BQOA 1YL5A 4XEHA 4A0GA 3U5TA 2R11A 1OI7A 2XB4A 3K4CA 2VRNA 1YZKA 2BL4A 2PTGA 4G63A 1ID1A 2D0OB 2QYSA 4E5VA 5K99A 3H4IA 3IDAA 4DLZA 1DS6A 3P2MA 2AOUA 5K0BA 2QM7A 1MDBA 3FYTA 4ND8B 4XSGA 1M10A 5FNVA 2VP2A 4FMDF 2ZTUA 4QHYA 1WXHA 2AC4A 2VZ8A 3KZYA 1XF1A 2IQIA 3WYNA 1X4OA 2B8EA 5IXJA 3K94A 3HGQA 3H9UA 3DM9B 2WWVD 4M72A 1KJ9A 3OWHA 2X1MA 1THGA 2IU3A 3T41A 3W77A 4N6GA 2O8NA 1T4CB 3I9V1 1CXZA 2P11A 3MWDA 4TWIA 3N6VA 4NZMA 2DHCA 3FWKA 3ZGNA 1OD6A 1QIMA 5FT9A 2PE5A 2XYQA 2XGOA 5JJCA 4MZXA 3EMKA 4I0WB 4B3TB 2W57A 1Z6XA 1OLXA 3AI7A 2QBYB 3N6RA 1UMCA 4G0XA 3WTSC 1IHOA 4WV3A 1MQ9A 4EMSA 2E2JJ 2OCEA 4WCFC 4AUNA 2IPXA 1QBJA 4BNKA 4UEKA 1S7CA 4ZYAA 4NLLA 1C30A 4Q3OA 4BDYA 2VN2A 3PJFA 3G2QA 1GG8A 3M89A 5FA5A 1WUHS 5T5QA 1IN6A 4IO0A 3LTNC 3NTVA 1EQ2A 2Q2OA 4D7MA 4AJ1A 2XV4S 2QU8A 1BJAA 2R8ZA 4YAJA 1FS6A 3WDMA 3CVOA 3JW4A 4Q1EA 3ZWCA 2PWZA 2V7QD 3BT7A 4P54A 2I7XA 1KAMA 1VLMA 2BFBB 4BNTA 8ABPA 2BFAA 4YRDA 3QG5A 1E1NA 1KK2A 1JNYA 4L15A 2ZBRA 2VOPA 4OBBA 1RUNA 3ESQA 3MD9A 4EB0A 3DO5A 2J32A 1SXQA 2H48A 4NYMQ 4R83A 3WP1B 1AHPA 2YFYA 1G4AE 2BY3A 5AONA 2RBKA 3KCCA 3OZEA 1NG9A 1Y34E 1EG7A 3R41A 3OS0A 2NU7A 3BWMA 4ZV7A 5EWMB 1ZCBA 2Z9BA 4Q1CA 4ZVMA 3VSBA 2NYVA 2ZW9A 3DE0X 3K6JA 3LP8A 5HQ3B 5TJJA 3QKUA 4E31A 4E7LA 1I4TD 4S2UA 4KR3A 3EPLA 4JT2A 2IITA 1XPOA 4PRLA 1Z7YA 1IN4A 5IZCC 2VRCD 3A31A 3CLQA 4MPDA 3I58A 3AOEC 4G8DA 1LZKA 1GAEO 5C4IA 4G0UA 2VP5A 2JI4A 1UOPA 1KJWA 3GJ8A 3H42B 4BNXA 3EIWA 1W6UA 1QCYA 1FTYA 2Z6QA 2HHLA 4P08A 4S1PA 2HHAA 2ZI4A 4B87A 4LRUA 2YY7A 2VJCA 3QOYA 4I6GA 3A10A 2YS6A 5P8WA 4M46A 1YCDA 1ORVA 1ZN9A 4ZZ0A 3KPJA 4FVTA 4LVCA 1JILA 2LBFB 4OHYA 1MBGA 5CRIA 4EDHA 3RRBA 1U80A 3E27A 3JASA 1TM3E 1LNWA 5REQB 1E3TA 2O2ZA 5LOVB 2CXOA 5CW1A 4XLHA 2C29D 2JHCA 1HE2A 3H97A 4G9YA 4GDMA 4TTAA 4A5NA 5FNZA 3CO5A 1E5VA 1FTQA 5HRUA 5EKDA 3DMRA 4E5KA 3EPHA 4PSKA 1IJBA 4LF7B 1VHTA 1K75A 3G8AA 5FTMA 1BI2A 3BRQA 2VT3A 3D7KA 4CVNA 4RAFA 4RXTA 5FLXA 2HWXA 5FFFA 1O95D 3EW9A 5JE8A 1TWCJ 3RK4A 1KQOA 4UV9A 1R4ZA 3RWBA 3AF5A 1FZTA 5DFAA 2W1OA 5E9WA 3ZIAD 2FP3A 1S3SA 2DHQA 2OCAA 3FRIA 2IYOA 4QU9A 4OA5A 5CLGA 3GLGA 4YR9A 3ONDA 5T41A 2A67A 4DOZA 1B1AA 3R77A 1PP7U 3KJXA 4RKRA 4C2MJ 2PZGA 5B1YA 4B85A 2O2CA 5C8DA 1DIBA 2NUPA 2PT7A 2A5YB 4HBGA 4BVJA 3KOOA 1UBLS 3PITA 3V7CA 5WRFA 4BB0A 1X1SA 1JQEA 4RVFA 1L4BA 2LKSA 2HEOA 1EF4A 3AWDA 5J4KA 1IEWA 3KEFA 3GOQA 1VIAA 3PE3A 5JSKA 4ETSA 3PVCA 1IL0A 3QG1A 1HNXB 2VAMA 1UL1X 1K27A 1KAQA 2WKPA 3TZCA 3CZQA 2BBOA 1TFUA 4EAAA 3NT2A 1DQUA 1SVKA 2MHCA 4G94A 3HRUA 2DWUA 1JDPA 3BWBA 3SR4A 3R3HA 4MV8A 3RHSA 4AUMA 2NZYA 2WV7A 4LKOA 2Y0SN 2PD3A 1CE8B 3D2LA 2WB4A 2ID6A 1Q1HA 1IQ0A 4CIBA 4KQCA 1JEOA 2VOJA 5ILUA 3TE7A 1ZIXA 2DAPA 4A2QA 2PMFA 3REGA 1UAGA 2G80A 1KI3A 4OYHA 3PQKA 2VP3A 2ZCVA 2FETA 2IYSA 5IAJA 3TNLA 4WBNA 4NPCA 2GN6A 4MVXA 2BEVB 4DCPA 4R69A 2WHXA 2AG1A 3LSIA 3L6OO 4LZPA 5FLXK 2PSEA 1TL7C 4L9WA 1FS5A 3OX3A 3DTIA 1GPH1 1YCHA 3FDJA 4WOKA 2CF5A 4LWOA 1ZREA 3M7GA 4C4TA 3UR3C 4ZOLB 4NOJA 1J33A 1R8SA 3L0PA 1VG9B 3BWXA 3IQFA 3OX2A 5LPNA 3FJ1A 1CX9B 1D03A 1WXXA 3A0BC 1IG3A 4HEJA 4ZAWA 5JS6A 1D5WA 4TTIA 1KHHA 1X7WA 4U8GA 2JLSA 3QPBA 4AM3A 1MJGM 3A1VA 2QIOA 3IKMB 1FYFA 5B7PA 2AJLI 1J25A 3ETNA 3M9XA 5IH3A 4P3KA 3OZSA 3K1NA 2OCYC 2O06A 4TLLB 3X1YA 4YHBA 3PDJA 2E85A 5L95A 2ID3A 3TOZA 5CA1B 4G8BA 1M34A 3FIJA 4PONA 5JS7A 5IN4A 3U60B 2QMOA 2HFKA 4U0VA 1X2BA 2IHTA 5E79C 2VSFA 1F51E 4NNOA 4HGYA 3ZQUA 3KQUA 1LC3A 3V1TC 2IY9A 5HFNA 2FEOA 4GM1A 3AP1A 2FDCA 1JFTA 4KL8S 5IY5H 1T6SA 4IH4A 5A5DA 1SMKA 2F7SA 5DM1A 1QYCA 2CJYA 2HK6A 5SZJA 5I4IA 1O6FA 1QJ4A 3R20A 5KAPA 3MILA 3KVNA 4R0MA 3MKWB 3K0BA 1JJIA 1G0OA 1RRMA 3LD9A 3AT1A 1M6VB 2ONYA 3U7HB 3T7RA 2FWNA 5I9SA 4UTXA 1WMAA 1ZGZA 4DMMA 2HLNA 1V3UA 1U78A 4QTXA 4WT7A 1RQLA 3VO2A 1SIBE 1NZDA 1PJ8A 1CUUA 5KDLA 3IV9A 3L77A 5FPKA 4XA8A 4AJKA 4JNKA 3QUBA 1UP7A 4MKRA 1N5OX 3C7CB 1VMKA 3EQ2A 1GGJA 3CHYA 4JC4A 3H04A 1R37A 4AMBA 1CERA 5DCYA 1CR2A 1H2BA 3N4MA 2DWCA 3SAJA 3K5HA 1QGPA 1IZ0A 2I8AA 1B72B 3DKKA 5H9VA 3O0DA 1CF2O 4N18A 2VLAA 1HFJA 1L8AA 1CG6A 5J63A 1KS9A 2YRWA 3MYYA 2CL0X 3FOAA 2CQNA 5T8KA 5JPCA 3PC2A 1UOOA 3AJDA 1OGIA 4BFUA 3G3ZA 2BJWA 4Y7NJ 1SQGA 3HJAA 3R40A 3UWPA 4IO9F 5CCEA 1KEKA 1U5TC 1SAYA 1K6MA 4RPJA 4X63A 1F6DA 4C4SA 1RWOA 3CTAA 1PT7A 4COOA 2FUNB 3L1KA 2BP7B 3QBDA 4NC6A 4O4IB 3FBGA 1AKUA 1LV7A 1OVGA 3UHJA 2V7QA 3A9WA 3IIMA 4MUBA 2D8AA 3SFIA 2CUNA 3AB8A 4TWRA 3QUAA 2GBLC 2YFHA 4MQEA 5I7EA 3G89A 4JI4B 4FKMA 3RKQA 2BEJA 4MGZR 4OQPA 1QGZA 1Z15A 1KMMA 2RHTA 5AKLA 1A5AB 3PSAA 2C2HA 2FW1A 3KJIA 4WXEA 2APJA 1YS7A 4GMFA 4DTCA 3OBIA 4TRRA 1GG9A 4O2BB 1QZUA 4UU8A 4MQ5A 1X7YA 4QBGB 3THRA 4A3SA 5IUKC 2FOWA 1ZELA 3FHNA 5K5OA 2IZ7A 1HDIA 5B6JA 2CUTA 1EBBA 2XDQB 5FQNA 2VRCA 2GKGA 4W9RA 3HFSA 1LJUA 1FJXA 2QTVA 2YZMA 1AHNA 1G291 4WKGA 1N5RA 3IALA 2C98A 4FHCA 1MN6A 2QLZA 1MDMA 1T5TA 4FHZA 5DNWA 4N3BA 3GEDA 3CV3A 2CE2X 4ZYWA 1VHJA 1TJYA 3F1KA 4EGFA 1UBRS 2VQFB 4EHIA 5BWNA 2YIVX 1GFZA 4XRFA 4OKSA 4BNZA 3D3QA 1ST2A 4YEJA 2Q21A 3INGA 3NHAA 4CR6A 4YJ3A 3QJYA 1IBKB 3DDWA 5E1DA 2DHEA 4E30A 4WUVA 1EQUA 1Y3IA 3EIOA 1MW9X 5LQCA 3ESAA 2R7FA 1DWOA 2PMBA 4PF1A 1P2BA 4G1UC 1RMQA 2L18A 3T7JA 2GDJA 1YULA 2ODTX 3TKYA 3WK6A 4TYMA 3WJ2A 4MIKA 3EVCA 2QIPA 3PR3A 1PCXA 1QX4A 4WNAA 1NQTA 1HBJA 4JA2A 1FUEA 1DIAA 1QDUA 1G9TA 2O48X 2FJUA 1TNTA 1YE5A 1T9DA 1O95A 1YBHA 2A0KA 1F3OA 2BI7A 4ENSA 3L0BA 3QVTA 1OZGA 3OL4A 5BXYA 2JFOA 4BLQA 4L73A 2B21A 3TBKA 1NVUQ 4P82A 3K31A 2KLHA 3E48A 5IKXA 1WB9A 4BKOA 3H8SA 3ABSB 1HDCA 4NOKA 2OGWA 4BQFA 2P9TA 3U1DA 2G9UA 2BUAA 4R81A 3ES9A 3UPUA 1BFUA 5FD6A 2IV2X 3VKGA 2BIFA 2XVXA 3WLRA 5EJEA 1QHIA 3G0OA 2QUBA 2QT9A 3LXMA 3MFKA 1K9VF 2J5XA 1SXJB 1LD3A 4N9QA 3SJCA 2IYLD 1SOUA 2C3MA 4INPA 3LWDA 2QUHA 2RB5A 5JNVA 2ZFUA 2GXAA 1DGWY 2IP2A 4I7HA 2AFIA 3I4MJ 4MCJA 5LP6B 1JAYA 4GLLA 1X86B 3MUEA 2W58A