2R0QC

Crystal structure of a serine recombinase- dna regulatory complex
Total Genus 67
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
67
sequence length
200
structure length
193
Chain Sequence
MIIGYARVSSLDQNLERQLENLKTFGAEKIFTEKNRPILQKALNFVRMGDRFIVESIDRLGRNYNEVIHTVNYLKDKEVQLMITSLPMMNEVIGNPLLDKFMKDLIIQILAMVSEQERNESKRRQAQGIQVAKEKGVYKGRPLLYSPNAKDPQKRVIYHRVVEMLEEGQAISKIAKEVNITRQTVYRIKHDNG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Architecture of a serine recombinase-DNA regulatory complex.
pubmed doi rcsb
source organism Staphylococcus aureus
molecule tags Recombination/dna
molecule keywords 31-MER
total genus 67
structure length 193
sequence length 200
chains with identical sequence D, E, F
ec nomenclature
pdb deposition date 2007-08-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00239 Resolvase Resolvase, N terminal domain
C PF02796 HTH_7 Helix-turn-helix domain of resolvase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.60 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Homeodomain-like 2r0qC02
3.40.50.1390 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 2r0qC01
3LSRA 1IG7A 1ITYA 1MSFC 3ZQHA 1F43A 1IUFA 3H3VK 3SJMA 1FIAA 2VI6A 1TWFJ 3CCYA 1ETXA 1FTTA 1WPKA 2XPWA 2NVQJ 4C3JJ 1I3QJ 2ZB9A 3HGYA 2L7FP 4C3IJ 3WHCA 1ORKA 1MSEC 3RKQA 1AKHA 4AUXA 3S16J 4DYQA 4XICA 5J3LA 3TEDA 1HDPA 3GTOJ 3MN2A 1IDZA 4V2FA 2M9HA 2B63J 2HOTA 2EZIA 4AYBN 5F08A 3GTGJ 5C4XJ 4LOCA 1JT0A 2YU9J 2VKVA 5M5XJ 2AHQA 2CQQA 4RDUA 4B1RA 5C31A 2EBIA 4UUSA 5FKLA 3Q0WA 3MVPA 3HEFA 1BL0A 3BT9A 1OCPA 5BNGA 2I10A 2NOGA 1ZGWA 9ANTA 2JA7J 2EQRA 5IYDJ 3PO2J 2EH3A 1LFBA 3A02A 3MKLA 3PKZA 4X1EA 5EYRA 3H0GJ 2GM4A 2ECCA 2FX0A 4MFEA 3PM1A 3F0CA 2K9NA 4QTRA 2O7OA 4MO7A 5C4JJ 1W0TA 5M3FJ 3OSGA 4IEJA 1ZKGA 1P7JA 2X48A 4JP0A 3GUVA 2LP0A 2CJJA 2JWTA 3LHFA 2CU7A 2L9RA 4M6VA 3IV5A 1JUSA 1GHTA 1XG1A 3RZOJ 3BR3A 1ETYA 3ILXA 2VPRA 2O8KA 2X6OA 5E3LA 2GBYA 2OF7A 3BR0A 3BTJA 2E19A 5FKNA 3VPRA 3NAUA 4M3EA 3S15J 1FTZA 3S1MJ 1SANA 2WAQN 2FQ4A 3FIWA 3DEWA 3BVPA 3BR6A 3UJ3X 3B6CA 1ZR4A 3LNQA 2G0EA 1UHSA 5FJ8J 2GLOA 1HOMA 2R93J 3S2HJ 2HI3A 3JRBA 2LR8A 2XPUA 1RKWA 1TWGJ 3FK6A 3HOZJ 4L5EA 1K61A 3W6VA 3JRAA 1TWCJ 1Q1VA 3RZDJ 2XPVA 5EF6A 3LSJA 1X2MA 5HODA 4XIDA 1WGXA 1LE8B 3UKGA 2Y30A 2COBA 2HOAA 3HOYJ 2GM5A 2W48A 1H8AC 1WI3A 1IC8A 1YRNA 2R5YA 4W97A 1EF4A 5EZHA 4C2MJ 1TC3C 3JR9A 1JUPA 1AKHB 1JKRC 3JRCA 1WH5A 1JGGA 2E2IJ 5FKKA 2LD5A 5IYCJ 1NK2P 5J1UA 2HXIA 2L7MP 4A3EJ 2Y9ZA 1MBHA 5IYBJ 4A3IJ 2D5VA 3A03A 1I50J 2HQ5A 5IOYA 2JMWA 3IH4A 4D5CA 5IP7J 2XGCA 4QSHA 5E3NA 5EZGA 2JA5J 2TRTA 3GTKJ 3S1QJ 4BKXA 2DMQA 3GTMJ 1RKTA 2TCTA 1E3OC 2LVSA 4CYCA 4IHWA 3BQYA 2IEKA 1VF9A 1ETKA 1T56A 4FE7A 2XGDA 4MIMA 2MHCA 4IHXA 5E3OA 1QRYA 3IH2A 2KDZA 5IP9J 2MW8A 5F27A 2XB5A 4A3FJ 1RPWA 4RBOA 1MH3A 2IBDA 2K40A 3A01A 1HLVA 4W1UA 2VKEA 3S1NJ 3JREA 2HYJA 1TWHJ 1JTYA 1Y1VJ 2CUEA 1VFCA 1OJLA 5JLXA 5DTDA 5JLWA 1GV2A 3FKIJ 5C3EJ 5EG0B 4A3JJ 5F1JA 1B72B 1IRZA 2Y9YA 2N8GA 1GT0C 2KT0A 5IPAA 1H89C 1Y1WJ 1B8IA 1Z77A 1TWAJ 1R9TJ 4JX4A 4A3LJ 3L1PA 1D5YA 2DA5A 3G1LA 3IH3A 3I4MJ 4A69C 2XRLA 2YS9A 2ME0A 4B4CA 1A6IA 4FTHA 2R0QC 2K9SA 3QPLA 2AO9A 1MBJA 2DTZA 3GTJJ 1F36A 1LE8A 2NS7A 1Z0XA 1OCTC 2Y2ZA 2M0CA 1MNMC 2M34A 3HM5A 5C44J 1BJZA 2NVXJ 1A5JA 1K83J 1JKPC 3GTQJ 3A01B 4FISA 1PUFA 3ZQCA 1SFOJ 4BQQA 5M5WJ 3Q0UA 5FLMJ 4FCYA 1NK3P 1P7IA 4A3KJ 3GTPJ 3HOUJ 3S17J 5GPCA 3M3YJ 1X2NA 2DMPA 1ZR2A 1RR7A 1BA5A 3E7LA 3ZQGA 2R5ZB 4B3AA 5FKMA 2ID3A 3OSFA 4D7NA 2JJ7A 3ZQIA 5M3MJ 2O9LA 3CDLA 3GBGA 1UMQA 3HOVJ 3BR2A 2XGEA 3JRFA 3HB9A 1ZTRA 1FJLA 1I6HJ 2DA3A 1RETA 3K2AA 4EEFG 4DW6A 4XRSA 4A3CJ 2OPTA 1H88C 3K7AJ 5F0HA 4A3GJ 4M3FA 4I6ZA 5K7ZA 2LY9A 2NS8A 3BG9A 3DCFA 2DA4A 5EEAA 1ETVA 1GDTA 2MG4A 3BG5A 2QF7A 4J19A 3BR1A 5FKOA 2EZKA 4CYCB 1VNDA 2PMZN 1B72A 5K7HA 1MBEA 3TP3A 4BY7J 4QIWN 2Y0SN 3NARA 2RSLA 3I4NJ 5J1RA 4UUSB 2E2JJ 2CQXA 2LKXA 3O8HA 3BTIA 3G1OA 2E1OA 3FK7A 3TW7A 4IHYA 1IJWC 2HOSA 1MBGA 1U9NA 1HF0A 5EGOB 2JA6J 1JT6A 2FJ1A 1JJ6C 4JX5A 5EG0A 2ECBA 5DS9A 1WH7A 4IHVA 5F0FA 1FEXA 2JK3A 4DYRA 1B8IB 3G1MA 3OOUA 1U78A 1GUUA 2CUFA 4BY1J 3BG3A 3RQIA 1U9OA 1POGA 1HX7A 4D7MA 2JA8J 5IOZA 4DYCA 2ME6A 1W0UA 2X9DA 4M3BA 2CRGA 2R5ZA 1T33A 5C35A 2ELKA 3CMYA 1U8BA 3O8GA 2DA7A 4D5FA 4JX6A 2DMTA 1QVUA 2MSYA 3HBLA 4GFBA 4A3DJ 4DZPA 3HOWJ 1VI0A 1O4XA 2HXOA 3S14J 3TW6A 1XC5A 1OFCX 4G12A 1LFUP 1APLC 1MBKA 1AU7A 4FE4A 1ETOA 2JN6A 3JRIA 1AHDP 4MLOA 4MFDA 4AC0A 1BW6A 4NDLA 1JKQC 5C32A 3SFIA 5M5YJ 2R5YB 4M3GA 3CQZJ 1PUFB 1MH4A 1IGNA 3PO3J 1GVDA 2DMUA 5F0CA 4XK4A 1DU6A 1FIPA 3ZQFA 5IP6A 2E2HJ 1ZK8A 4C3HJ 4S0HB 4Y7NJ 2NVTJ 1NTCA 2H8RA 3GTLJ 2DA1A 3M4OJ 3SDGA 1CQTA 3QQAA 5FLVA 3QPSA 2R7ZJ 3Q3SA 1ETQA 2L7ZA 2LK2A 2LLKA 3TP0A 1JJ8C 1ETWA 4I76A 3G13A 2Y31A 4DZJA 2EZHA 3BQZA 4M3DA 2MGQA 5C34B 1JUMA 2RAEA 3S1RJ 3WHBA 1ZQ3P 2IAIA 1UG2A 1MBFA 1S7EA 4BBRJ 1GV5A 5E3MA 2H1KA 3ZQLA 2DA6A 5GP9A 1HDDC 2R92J 3HOXJ 5J1YA 2WB1N 4XRMA 2XB0X 4UUTA 3C2BA 4Y52J 5F04A 4HNVA 4ABZA 5K7FA 4BXXJ 4A3BJ 4A3MJ 1YRNB 3LSPA 4V2GA 3B6AA 1QPIA 2K9QA 5EGOA 3JRHA 1G2HA 1X58A 1HCRA 4BBSJ 1RESA 3FISA 2LTPA 1BW5A 2EZLA 3HDDA 3HKZN 2YUSA 3HGGA 1JTXA 2DJNA 2WV1A 2DA2A 2HDDA 3ZOBA 3S2DJ 1IDYA 4X6AJ 2P81A 3LHKA 2L0KA 1WCMJ 3BR5A 2ID6A 1QVTA 2QCOA 3JRGA 4A93J 5GPAA 1IV6A 1DU0A 3BTCA 3JRDA 2M2EA 1JKOC 1ENHA 3D1NI 2VUMJ 2FD5A 4JYKA 3LOCA 3Q0VA 2NVYJ 3OIOA 2XSDC 3BTLA 1XS9A 2DN0A 4XRSG 2M8GX 5EDNA 2LFBA 2DMNA 3LSGA
chains in the Genus database with same CATH superfamily
1IDOA 3ZCPA 4P4GA 2RH9B 1XI2A 3I6YA 4XQCA 5IJWA 2CLOB 1RFGE 1Z47A 3LQ1A 1HWYA 5LM3A 3SWWA 2P7IA 1NBME 1O96A 5CA0F 1PKEA 5IG2A 2GCNA 1SH7A 3NDJA 5J8FA 3BZUA 3M1AA 3NVDA 4IHJF 3L7BA 2GO1A 4HQMA 3DA8A 3GYGA 4ZRNA 4LE0A 2W2TA 4RY0A 4C4ZA 1Z7WA 1UMKA 2RK4A 5IVDA 2P7HA 3CGWA 5K1ZA 1GZVA 3FMOB 4QT0A 5T4FA 1XX5A 3NDBB 2C7BA 2B7CA 2BFEB 4A0YA 2V0CA 4I6EA 1A77A 3B82A 1QUEA 4HUJA 3G17A 2QV0A 1PD0A 2ASVA 2HTSA 4BO0A 5I45A 3OQOA 1G6HA 3OCJA 3WS7A 1ZSYA 1TC2A 7YASA 1UOQA 5EZYA 2X40A 2M9HA 3EQLF 1U1FA 2GDJA 3GFBA 4XJXA 5AXBA 4LXIA 1WV1A 2CQQA 3R60A 3R7FA 4CLEA 5KVCA 3WTSC 1DLIA 1OBVA 5ITZB 3WY9A 5LKRA 3LECA 5FWDA 3MVPA 3C3MA 2FFAA 4XM3A 2VP0A 3F21A 3X1JA 3QKWA 1T15A 1UBEA 4FHGA 1WPGA 4Q3EA 1JDUA 1N36B 1E5LA 3QLUA 5K6AA 1L7EA 1H93A 4K81B 1RCTE 2XBMA 1I6LA 1UBCA 4X3CA 3P71T 4TGLA 1L5OA 3VNVA 1GDDA 2J3IA 2SCUA 1UFQA 2HIHA 2LBFA 3PUKA 1RRMA 2D1YA 2PKYX 4ILKA 4WZZA 3TCNA 4MRVA 1W4BA 5C2JB 1VRCA 3OZAA 5E7JA 4TS4A 2E1MC 1G5HA 1D2MA 1XB2A 4DA9A 1KVTA 1OZHA 3KP2A 2RHCA 1FQOA 4NBSA 4AP9A 1EA5A 1OX5A 3PUVA 5IABA 1NVAA 3CTPA 4XOUA 4AIKA 2JG3A 1YJ8A 1J9GA 3HY3A 1NRXA 3RKXA 1LDKB 3I64A 3MKZA 1L4HA 1EXNA 2CNLA 2QYHA 3B9QA 2OFPA 2M8EA 4GHWA 3IV5A 2Z8YA 4S0XA 3SF0A 1IULA 1XG1A 3WGUA 1J8DA 4CQMD 4F1KA 1NIPA 2YBDA 3A1VA 5AIAA 1DOAA 1UFRA 1UZNA 4C4OA 2Q8PA 2KM1A 1IXKA 3OQBA 1NJ8A 1W2WB 3QXHA 3S81A 3AR5A 1AF4A 2JAUA 3DE0X 2SNIE 3L7KA 1FPMA 2F1IA 5BQOA 3TPZA 1EZZA 1JHUA 1Z0KA 4DWWA 1Y7IA 2Y2UA 2BI8A 2C5HA 2VBIA 4YIRX 2ZIXB 4IIYA 1SANA 3WLJA 4ER5A 1POXA 4MLDA 4YY3B 3QX8A 1B9NA 2W8BB 2ZTMA 5IC6A 2LRDA 2XAJA 3U1DA 1BEUB 1Z73A 2VG8A 1P4GA 3BVPA 1F6BA 1ODJA 3DTNA 3K0AB 4I55A 3UMVA 4UQLA 4TRNA 5CW2A 2ZBFA 5LUAA 2FDCA 2BE9A 1BVYF 3F47A 3C2QA 4KGVA 4L85A 5IAJA 4ZMSA 4LF9B 2EW1A 4U7TB 2EK5A 1T9HA 1LXCA 1T6BY 3EVCA 1A6QA 2LY1A 4GMXA 4J2TA 3WOVA 4CCSA 1RKWA 1F8XA 5LQNA 5E4FA 2AKEA 2PD4A 3T5PA 1VBFA 2HV8A 5IT9Z 2NZWA 2VC2B 3IODA 3KP1A 3KSAC 2QR2A 2D74A 4OJQA 2V9CA 3I1YA 3M6FA 5CT6A 3GJSA 1O9GA 1WDKA 2ODQA 5D2CA 1BHJA 3H0CA 3NIFB 1MCZA 4MA5A 5T41A 4MYRA 3AT1A 3RK4A 1N6NA 4I3FA 3TLGA 3ANLA 4MO9A 4LDZA 1PR1A 4MW9A 1BGXT 3ISVA 2RB4A 1M1YB 2C98A 2H52A 1KBOA 1MRZA 3G2OA 1P5JA 2AFIB 2HOAA 5K8VA 3UM9A 4LFCB 3CDHA 4YNBA 3F8MA 1Z0UA 1MGOA 3L7AA 4ZANA 1WI3A 2OHVA 2P6NA 1BMTA 5ILQA 5SV2A 4DYVA 5IDWA 3Q8KA 4MPRA 1OBCA 4EB6B 2R7TA 1W4RA 3I1IA 3JR9A 2IPXA 4OB7A 4WZAE 3GFGA 2YWBA 5KTOA 4UVAA 1H2ZA 4BQEA 4PPQA 2ZIVB 4G86A 1E99A 4XIYA 3SMVA 1J2TA 1P3Y1 1T9BA 4DIQA 4AG5A 1HBXG 3I34X 4K9KA 2HXIA 3DBLB 2BFDB 1ZXXA 4DCPA 3UJ8A 1KZ7B 4DLTA 3QVGA 4RXTA 3CX7A 3PPWA 1PJTA 2WD7B 3QHQA 1Z3IX 3GLHA 3B3FA 2YIMA 1I3NA 1EFLA 1K3TA 3O8RA 2JI6A 2V9VA 3RDPA 1CFJA 2JA5J 1WDLA 3MT8A 5JLJA 5E17F 4MVJG 1CSEE 4LKRA 3I2HA 1V8ZA 2IPMA 4A92A 5JPDA 4HEA2 1JVSA 2FY8A 2KBEA 3COPA 2UUOA 2V58A 4ONEA 4IZ6A 1GA6A 3QA3E 4KO1S 4G84A 2ZCJA 2VDRB 2VT6A 1T3GA 1E3OC 1JSZA 1PWXA 1DBWA 3D4IA 3EIWA 2Q46A 3FNHA 4GS5A 5KTYA 4XLPF 1V8OA 1XQWA 1I01A 4MV4A 1VHWA 3EIUA 3CH7A 1X2EA 2XUPA 4LX0A 3GARA 4FMCF 3GRZA 3QKUA 2PQ8A 4LJ8A 1EUDB 3K71B 2MHCA 3N28A 2P5YA 3E1KA 2JPBA 2FV8A 2WOJA 1AQLA 4HX5A 1X1DA 2F6CA 5HRCA 2LWIA 4RA9B 4UD6A 5ECGC 5JCXA 3B13B 5AKLA 1D8TA 1OQAA 1EM8B 1QE3A 2QRKA 3ETGA 3OZWA 1R88A 4OGWA 4XQ0A 4BXOA 1SHZA 1JIIA 4B6RA 4EHAA 3G5TA 1GGVA 1NNI1 3JRXA 3KJFA 3OQIB 3CE6A 4D96A 2H63A 2A88A 3X43A 1VFCA 4ZOCA 1P7VA 2K27A 1EA7A 2ETXA 2FFBA 2ZBEA 3HYCA 4OAYA 3NJRA 3ORYA 4O02B 4TMFA 3S0JA 3TWOA 3U7RA 1QVAA 2C4TA 2JEOA 1ISIA 3A37A 5C46F 1YZVA 3ILHA 1R18A 1DQNA 1PFKA 3UB3A 1SRQA 3DXXA 3D1LA 4V0MA 2IU0A 1Y7HA 5LYJB 1ZD9A 3QUBA 3QYEA 3T1QA 3VI3B 4I8DA 3ZV5A 5E3HA 1FF9A 5I8WA 3U16A 2DA5A 3G1LA 4GF5A 1SO8A 1GL7A 4A69C 2QRVB 2YNMA 3GRVA 3V4FA 3IQXA 5BN1A 1N6OA 1H2RS 3QPLA 4YP9A 2EBFX 4AMBA 4X0GA 1ECLA 3M1YA 4NQRA 2O0HA 3PK0A 2UZKA 5BT9A 4AJ2A 1MVOA 1IQRA 4R81A 1QC5A 3C3XA 1X6VA 1PJLA 3D8UA 4RENA 1T2EA 1DI0A 3A4LA 4B2PA 1DE0A 4Z9BA 4FBGA 2EX1A 4Z6KA 5KMGB 5LLTA 3E6MA 3TVTA 5L7TA 3TZCA 4L7QA 3KD2A 3NW9A 3P0IA 5JSYA 1U0EA 4YFNF 1MF7A 1OOEA 2YC4C 1XTPA 3N2YA 1FDTA 2FZEA 4FC7A 4TTPA 4U39A 3LLSA 3ENQA 4CEHB 4CE6A 2V7GA 4MMXB 4BQQA 3L0CA 4X6YA 1Y4SA 2J0UB 3CR3C 4XEHA 3T3MB 1R1UA 4CDMA 5K5RA 2CUNA 1HSTA 3GTPJ 2PBZA 2YSRA 1KSJA 2AD1A 5HFJA 4B1FA 1IN4A 2XIJA 2Y0MA 3C6YA 3S17J 1N2SA 4B3TB 3DFFA 3FPJA 2XZPA 1D1CA 3UOGA 1MDMB 1VE7A 2YWFA 3ZCXA 2DMPA 1G19A 1GQQA 2ZSKA 1U3WA 3FBTA 3EFOA 1G5PA 1P1RA 3MTGA 4QQ8A 2G9NA 3M4ZA 3U4DA 2C2BA 2J85A 5TMPA 4M9ZA 1CEYA 2KS6A 2V5UA 4B3AA 2Z9OA 3OPVA 1ZGCA 3MEQA 2QTNA 2YIDA 1C9KA 2MFZA 1QNLA 1EDBA 2HD4A 4ZYVA 4GNKA 5DI9A 3EULA 3PWZA 1W4AA 4PG5A 2G0TA 2G5GX 3LNTA 5GAJA 1KYWA 1N3IA 1NA5A 1NR7A 4FK8A 2QYOA 1ZOOA 2WT4A 3PRHA 1ZTRA 3G0BA 5B3AA 3W8RA 4AF7A 2ZFWA 1BA3A 2HS5A 1QRAA 3P0EA 5BNIA 4EEFG 1OCOH 2JAQA 2CE7A 1N5JA 2N3ZA 4KVGA 3WLLA 3PICA 3GFFA 1E6MA 2GYWA 2J6HA 1BCSB 1X7ZB 2V6JA 4M54A 2FUCA 3U9SA 4IKFA 2XMZA 2Z2XA 3EXFB 2OBLA 4QUKA 4C1BA 4YT4A 3K20A 4BGIA 1M5RA 3AEQB 1FP2A 1CQZA 3MRTA 3ANXA 4ENUA 3H92A 5EKSA 3FHJA 5EEAA 4D7AA 4EUKA 2VJKA 2YR2A 4G94A 1AT1A 1QH9A 1YDGA 3P9YA 4ZV7A 3RVOA 3EXEA 4MS1A 3JTGA 2EIJH 5CVRA 1HEIA 2RBGA 3IVCA 3KLMX 2GN8A 3NAGA 4K6MA 4PLTA 4WFJA 1QGDA 3WAKA 1AA7A 1P9NA 1YONA 4ETMA 4CYCB 2F1HA 1X7HA 4KI0A 1OI4A 4DLAA 4CNBA 4WWHA 1N5LA 4IDGA 2I2XB 3EB9A 4QIWN 1TM4E 4LZOA 4LOHA 2VSYA 3FCOA 5FTLA 1HNXB 5CLGA 2KRFA 4BUPA 1MTOA 1PFWA 1Y1PA 1Y8RB 1QIHA 3T1BA 2RSLA 4RHEA 3VSBA 1X3WB 2LG4A 2Q9AA 3HYNA 4G0YA 4GPZA 3O92A 4DGWB 1WM1A 2V8OA 1W4ZA 4OXQA 4XASA 4PBTA 5C8XA 3BGVA 1T3SA 3NOVA 1MN6A 3RFTA 1JHZA 2O2IA 2E85A 3UTCA 1E98A 4ZI7B 1NAHA 1N2BA 5GONA 4ZI2A 1EFCA 3VAYA 1C80A 3BTIA 3G1OA 3FK7A 4E7HA 1NN5A 3FI9A 4LSMA 2PZEA 5K0LA 2W7TA 4BMOB 2HOSA 5HXAA 4FEGA 1S3FA 1CJUC 1XLTA 4Q4CA 1A8QA 2YY5A 2EU8A 3TLXA 1JJVA 4HV5A 4G8BA 3F6CA 3F5MA 5DHFA 3GNQA 3EZNA 4G5YA 3E6AA 5A0FA 1EEXB 4NE9A 3IE0A 3Q8XB 2H6CA 3D4NA 4BOYA 5FA8A 1N75A 1RNLA 4O1HA 3OQIA 4MYDA 1B3RA 3FBNB 3WU1B 3BWVA 5EIAA 5KHAA 1J42A 1Z35A 4GQIA 5DM4A 3H2IA 4MPTA 3RYCA 1SFUA 3MZ0A 1CZRA 3FYUA 4D7MA 1U7ZA 3HA2A 1OC2A 1W52X 2I2WA 3M07A 2X9DA 1YQXA 3O8LA 4KH1A 3MWLA 2KW5A 4L76A 3G82C 1EB9A 5FHRA 2R5FA 1B74A 2WHXA 3GJYA 4AZTA 1L9KA 3JWIA 4BRWA 5KTKA 1P1IA 2RKHA 2VYND 2Y1WA 3NXSA 2UWMA 1P19A 1IK6A 4UU0A 4KKXB 1P4RA 5JDCA 2XKKA 1O87A 2R66A 3T99A 2MSYA 2E2WA 2NV2B 4DXDA 2WIDA 4KVAA 1GTSA 4HOYA 1OY1A 3SNKA 1NPTO 3CUQA 4IUDS 4F3YA 1KDZA 4F7ZA 1NXXA 3BH7A 3BS4A 3FVVA 3GF4A 3KO8A 3FCUB 4AQYB 1PHPA 4HB2A 3UWOA 1PYVA 4TV8F 1OCEA 4Q47A 4JEUA 3SEAA 4E1VA 2JAOA 1P4AA 1W34A 5JXGA 2H09A 1X92A 3SMQA 5KOIA 1A5ZA 1THTA 2A5JA 3JRIA 3ER6A 3CP8A 3F6PA 3ONDA 4OM8A 1AHDP 4QODA 5JH7B 3DDCA 1KIAA 1NOKA 1P4SA 4MLOA 4AC0A 4G0ZA 4KVFA 1NW3A 5CFQA 4KREA 3ZW8A 4QM7A 5EQJB 1FYWA 1ZQ1A 2LCFA 3A11A 4GICA 3LWDA 5AXAA 5L3SA 2OFOA 5KDOA 3KLPX 3NWPA 1GR0A 1KK3A 1QH1A 2NTJA 4U3JB 3ZQ6A 1DUIA 2WWHA 2ZRKA 4JVLA 2PKQP 3GVXA 4HDMB 1MDFA 4XKVA 2FH5B 3COSA 3WNQA 1Q1AA 1V7QA 4G6ZA 1TVEA 2NP7A 4A0SA 4JB3A 1RJGA 4JJGA 9LDTA 5KVAA 1ZNQO 4HNUA 1E8MA 1S6YA 3T5CA 3K5IA 3Q7TA 5KQSA 1DQSA 2W4SA 4NBQA 2BHLA 4V3CA 1M2KA 3BJ6A 1WHTB 2AG8A 3D6TB 2NVTJ 1T3ZA 2FTKE 2OZVA 5LJIA 1M1NA 3UMJA 1A8IA 3SDGA 3LX8A 4D4JA 3QE2A 3C7CB 5AJXA 1O7LA 2WK1A 1HSZA 4LJRA 3HTXA 3VVLA 1NG7A 1AMOA 4KVZA 2H9IA 2QTWB 4EKYA 4YV2A 2R7ZJ 1PVEA 3DTEA 1TRHA 4C21A 2XMSA 3VFZA 1ADGA 3ASYA 1SD5A 3H5WA 1RRPA 3MGGA 3H5RA 1M8PA 2VQEB 4ZCRA 2LBPA 4WXPA 2YQ4A 1USKA 1DOZA 3PSAA 3HIFA 2NSJA 3A0BC 3L04A 1GCOA 3UG6A 3WLSA 2XDWA 5DN9A 1DPUA 1L8XA 1IXRC 3BQZA 2GD1O 2OFXA 2ZLBA 4GI3A 3FKQA 4LBVA 2E5NA 4PLHA 3S2EA 4CQNA 4YUXA 1VQOI 4PN3A 4FZVA 3HU1A 2GLUA 3LKBA 5FD8A 5I48A 1YIJI 5CITA 1UOEA 2VPIA 4MS1B 1IG3A 5DYWA 3ZCVA 4HBGA 5M2QA 4FW8A 3FVWA 4D4HA 4LI0A 2VF4X 4QYMA 1ZG1A 3BG7A 5FLXK 2L17A 2VOJA 3K1TA 4L4YA 2VXDA 2PI0A 2C8LA 3DMTA 3NUGA 3PDHA 3VU3A 3PLNA 1U11A 1HKUA 2PEYA 3AF4A 3E15A 4MWBA 2QMYA 1NYTA 2X9VA 4B40A 4PNEA 5G0WA 7REQB 2P6MA 4DDWA 1QZTA 1QLJA 4QHYA 1G3MA 4QYXA 4DQ0A 1MX5A 4P8RA 1QKKA 1YJCA 4HY3A 4TLLB 1SFXA 2XB0X 3C2BA 3C3JA 4WJLA 5LL6P 2HYDA 2BGWA 3D4OA 3STWA 1JILA 4NK5A 3RSCA 2JGKA 2FZWA 5AJWA 3R75A 4FHEA 4F11A 1SVWA 3JD2A 5THXA 5EUBA 1D09A 3UH0A 4TKMA 3OUZA 3U1KA 2BEVB 2HF8A 1E9AA 2PWYA 3OIVA 4E08A 4HLDA 1NATA 4B0PA 2DDBA 3DMYA 3S7ZA 1WPRA 4BP1A 4R0NA 4RVCA 1M6YA 4RFVA 2UUBB 2CJPA 4KXXA 2QY6A 2F9FA 1JH8A 2ZBVA 4U87A 3D3EA 1P9RA 1L8OA 1XRSB 3GROA 2WV1A 1X19A 3AEUA 3K9HA 3U3OA 4YCSA 5BQ3A 3J80A 1RXIA 3ADBA 4KR2A 2CNOA 1A36A 4XKJA 3OG9A 5K3SA 3O75A 4M6XA 2CLFB 2IXDA 2DCEA 2PXHA 4YK7A 2CD7A 4ND5A 2G3YA 2ZUBA 1BXKA 4W8GA 3EGCA 4MARA 1M2HA 1TAGA 2A1IA 3FB1A 2EP7A 4MNTA 4YRCA 3TUZC 7ABPA 3OLYA 1QGYA 1M8GA 1IY2A 2W4IA 2CS3A 1FS5A 2ODBA 1ETHA 3AW8A 3C98A 3MFYA 2PQ6A 1A5TA 3AIIA 3MJRA 2DBRA 3BORA 4P35A 3HCAA 4NHEA 3ITKA 4YJHA 4L0MA 1YRYE 2VHQA 3KVRA 1RBMA 1O3RA 2LYCA 3V4LA 3DWEX 2XAUA 2PU5A 2YV2A 5GIOE 3CSSA 4BTVA 2QMUA 3I54A 1K4TA 3P7NA 1PTJC 1TLTA 2ZAGA 1DEAA 5DM60 2WD8A 2X1LA 3FZVA 4I1SA 4RPIA 1G9XA 4Y7DA 2J3KA 4OMCA 4HWGA 2FK8A 3CX6A 3QMMA 6Q21A 1AM4D 2PT5A 4Z1MD 1I32A 3LDAA 3SP1A 1PSDA 1IG7A 4AMVA 5F4BA 4BDTA 1U2DC 3C4QA 1C9YA 2WVJA 2ZQYA 4D56A 2CZQA 2Q3MA 3OZGA 4G0PA 3EXHB 4KZPA 5G53C 4LG3A 4Q1VA 2VDJA 3CCYA 5ETJA 3E70C 3WWYA 2ZUCA 1NLYA 4OO3A 1F12A 1ZMRA 2IHUA 4YCBA 5GJWC 3IO5A 1Q2XA 2K6GA 4KIGA 5A7GA 3TH5A 3A27A 4XE5A 3OR2C 2PBRA 4EFDA 1VI2A 4WHMA 5FP0A 2OAEA 4DR5B 5FUWA 2BBYA 1OLSA 2Y77A 4XGQA 2FBHA 2X4LA 4PYLA 2JI4A 4XICA 2G8LA 4Y2TA 2O54A 3CRZA 4PSKA 5HMMA 2QU8A 2JAPA 2FEKA 1MOSA 2D6FA 4L15A 2CVQA 5I9LA 3IV9A 4HP8A 5KS2A 3DOHA 1HEUA 5F5LA 3UHPA 2YYZA 3AVPA 1UFVA 3HFSA 4V2FA 1BE6A 4MR8A 4XYEA 1Z0ZA 4QAQA 1AGPA 3RFVA 2O8BB 1P0PA 5HIJA 3RHFA 1XJQA 4LBZA 4CIDA 1IJBA 4Y9TA 4B8YA 2D06A 2AHQA 1G16A 2DHDA 4KIWA 2J33A 5FKJA 4B1RA 3F6RA 3QJGA 3CLKA 4K3VA 2O2YA 1A8SA 5FKLA 3DD5A 1K8XB 2NYXA 1J06A 4HWTA 2P65A 3A6HA 3S1LA 1CF7A 1P0IA 3U2QA 2GAAA 2OD9A 4HWKA 3GV0A 2JB9A 4IRIA 2GPTA 4OPMA 3ZLTA 1RKUA 1C8BA 3G8CA 3LCJA 1S1CA 3NOXA 1DXYA 2YV5A 3A4TA 2MDTA 3ADOA 3HA7A 3CRW1 2JFUA 4UHCA 3UMCA 1THZA 4AY3A 1CLEA 3SDZA 4CQLA 3PKZA 3G68A 4DBLE 3WE7A 5EYRA 1TNDA 2GM4A 2H16A 5FD5A 1X7ZA 2P40A 3QJ5A 4BX8A 1RWXA 2JHFA 5EOVA 2E5ZA 3EEYA 5E2BA 5JEEA 5H70A 4AT1A 2JLAA 1GEEA 1BMFA 3Q3HA 1KY5A 2DPGA 1PFUA 4HYEA 1V45E 3H3UA 2WSYB 2QRLA 3K73O 1V8PA 3A9UA 3RODA 4EDHA 5BPFA 2WTXA 4LLGF 4L9AA 4JLNA 3ABZA 4I1YA 2HRRA 4UATA 5C37A 1II8A 2VAWA 3JQDA 4LHWA 3Q6IA 1E62A 4QDUA 4DG9A 5JD6A 1ZH2A 2GOXB 5L9AA 1L5VA 4A8JC 4CI9A 3LXRA 3BCUA 3O8OB 2CVOA 2A9RA 4ZT5A 3ERCA 3ZCRA 3D5SC 2V7VA 3GA0A 1C3EA 3D5TA 4LQLA 2NO7A 2IZ5A 2QSGX 4YP0A 3V2GA 3V7UA 3ASUA 3HCOA 1WL8A 1CF2O 3BTJA 4BECA 2XCRB 4Q19A 1BOBA 1P77A 4LOKA 4QXOA 3KDSE 1VKJA 4RZUA 3LLCA 4UCXA 1LWNA 2FZKA 4BO4A 1EE9A 2H0QA 1DUSA 5KOYA 1EWYA 1VMKA 3J81k 3HK2A 3THWB 3QPTA 4OSPA 3BR6A 4Y3OA 5IKMA 3WGOA 2CFTA 2XNDD 3AG4H 2CNDA 2YZ7A 3ANYB 4M22A 5D7NA 1NBAA 5C0OE 2W11A 4IQ4A 3TTSA 2LW7A 2ZI9A 3GMIA 1P6XA 4A10A 2FPIB 2VJBA 4WLNA 2IKQA 4E5SA 3EDCA 4XN0A 1VQ8I 3DBHB 3BCSA 4CZCA 2R93J 3L0BA 1BS9A 1T5OA 3JRBA 4KXVA 4LYYA 1RQ7A 1Z9CA 2O2EA 4GAEA 4OXNA 4YO7A 5DK6A 3GFPA 5EKXA 3RSGA 4XDZA 3TRHA 4DWOA 1A71A 1V6SA 4ZI7F 4YMHA 3IBGA 1B16A 1TWCJ 4QPQA 1J8VA 3HZHA 3LK6A 4Q00A 3LW7A 2QAJA 1PWEA 3RVRA 1P9LA 4D80A 3IDAA 3UJ6A 4ENRA 5J4HA 5K01A 1G1AA 2B4YA 5BSMA 2JH3A 3RFUA 4O29A 1JLSA 5HTKA 5KDLA 4U6SA 3Q2IA 4LRTB 3VR4H 3PUYA 1E6WA 3ABTA 1Z12A 2BE7A 4IUCS 1E3QA 2ZE5A 2MJLA 1EKXA 4ZCIA 3S2SA 4S35A 3W5BA 1X1PA 2ETHA 5E0KB 4CIYA 2A3SA 4MVJM 1HRDA 3F3YA 2KLBA 4PZPA 5LBIA 2Y0SA 5TJ9A 2Q62A 2EBHX 2R8YA 4PSAA 3T61A 1YC5A 2JFPA 4X63A 3RV4A 1TQIA 5I5GA 4J1TA 3T5AA 4G5XA 2E2IJ 4CEJB 2X22A 4U2DA 4DG5A 1Y4ZA 5G4LA 1BKSB 1VP3A 2MSDB 2WWTA 4LWOA 4DLZA 5C80A 5C8ZA 5CCXA 3MN1A 1UKBA 1BXRA 3RS8A 1KZGB 2LSOA 1DJLA 2J08A 2ZTUA 2X8WA 3BM5A 2MBFA 3HWX1 4JJ7A 2IDKA 3V8EA 4I5GA 3DCJA 2W6OA 1H8ED 1TAQA 3I9V6 3R5XA 4LHSA 3WWEA 1I50J 4BO9A 5SZJA 521PA 2JMWA 3AKEA 5C5IA 1Q1BA 5C7LO 1OH8A 221PA 1GZ3A 4RPKA 2WRZA 4PZUA 2ZYDA 2BGRA 4U0YA 1BBYA 3EIOA 3G5AA 5AVTA 4XJTA 2WNHA 4R54A 1DBIA 1Z83A 1SJ9A 2I3AA 3JV7A 4UZEA 2PZAA 4ZH4F 4PWYA 1A98A 1HETA 2QUHA 3BMXA 5DFAA 3A06A 4CTMA 1D0VA 5JO9A 4PLCA 2CCJA 1Q7CA 4ZOQI 5AT1A 1LLCA 2FQ3A 4LDJA 5DBEX 1ENZA 1TAUA 3K1MA 1CVLA 1A9YA 3CZMA 2KRHA 1WQ3A 3MWKA 3BDIA 3KEMA 1U90A 1T0JB 4GFDA 4JVMA 1T1EA 3FX2A 3A6ZA 4XKWA 2VBYA 3MXTA 4B6PA 5KNCA 1AGNA 1U7XA 1WMDA 1X42A 3HXKA 5BNWA 1RAAA 5TE9A 3TTXA 1WXHA 1I9CA 1J1IA 2H9AA 3EIXA 5K45A 1QRYA 5K6RA 3RO7A 3IH2A 2KDZA 2IELA 2FOLA 3UJNA 4KMRA 1FBTA 2HREA 2XB5A 1CB7A 1I1QB 2FQXA 2HU2A 2J30A 4WT7A 4URVR 1W0JD 1MH3A 3F74A 2WV7A 4I1RA 3WFIA 4YAIA 3S1NJ 1U5BA 2H1FA 3DQZA 2HYJA 3GQVA 3DAFA 4PZZA 3IURA 3DFGA 1XP8A 1ZA1A 2HRZA 3W05A 4Z7JA 1KU3A 3MBKA 1OJLA 1OD6A 3VR3A 1TQPA 4R1HA 1AQUA 5F5XA 4QIHA 4OHMA 2Q8QA 2DCUA 5JFRA 3AB7A 1DQPA 3OCUA 2L54A 3GLXA 4UZSA 5FBQB 4Z51A 5IRCD 3ZJ4A 2WYUA 3SE0A 1Q91A 4ARAA 3I3OA 1URPA 2PKQO 3KSZO 5I9IA 1L7DA 1QHXA 3DNFA 5H3LA 1O8BA 1XZPA 4BNLA 4U7PB 1F0PA 2X7HA 1XX6A 2IHNA 5BUZA 3TZQA 1B8VA 1WABA 3G7UA 2V45A 3PITA 1GQOA 1JQDA 1HDZA 2GD6A 3R6WA 4CHTA 3CESA 3IQDB 1RIFA 4PXYA 4WK2B 1TIBA 2WD9A 2PN1A 3F0TA 3EMBA 4O4HB 3G49A 4P80A 1CZOA 4E94A 5LZ2A 5C5CA 3DBIA 1T4BA 2DFTA 2XTZA 2GVZC 4KWHA 2WA0A 3WTVC 2M34A 4Q03A 3R20A 4BP3A 1S5PA 1HE3A 4YI3A 5B57C 1ZN7A 1A5JA 4U0JA 4X8HA 4B5KA 4FISA 4E7LA 3SZUA 1YQ9A 4KAJA 3F8BA 4A82A 1EYZA 4BQPA 1WKMA 4BZZA 1Z5ZA 1E7QA 4YRFA 5GONF 4A26A 3QKSA 2CZCA 4MVJP 2JLSA 2EL9A 3VC7A 3VJMA 4RJ2A 3B1KA 3X1WA 1UWCA 1G4UR 1VYVA 3ESBA 4FYPA 4HQFA 5SYNA 3H8WA 4CFSA 1YL7A 2QN1A 1I80A 3NBMA 5C1IA 4CUJA 3LL7A 1B1CA 3GDWA 1OWMA 3IAM2 1N0IA 1VHLA 3ESQA 4RZ3A 2FN3A 2GZWA 3M5WA 4W99A 5BMVF 3QE9Y 1OI3A 3DF9A 2HAEA 3JR3A 4BX2A 3L7MA 1GGJA 1UDAA 1PG0A 1Q5PA 4CIXA 4BE4A 3FMQA 3RYPA 1ZNWA 2OCIA 3PQDA 4IGEA 4ZICA 1DBPA 3M9WA 3ROMA 1JE8A 1WPXA 2FMTA 4X8MA 2YV4A 1OYVA 8GPBA 3KIPA 2RKWA 2YR0A 3ABOB 1SXJA 3X1MA 5EXPA 4DIKA 3UXHA 1E94E 1DG9A 3EGWA 2ZPTX 4EB0A 3KPHA 3T35A 3AUJB 3D2BA 1HKSA 4PC3A 3MOGA 2NS8A 3N2EA 3OOWA 1DB3A 5LQSA 5DI3B 4NB5A 1LRKA 4X1IA 3GHHA 3TKLA 2BELA 1ETVA 1ABBA 3BG5A 3JD3A 3ZVLA 3K4BA 1UBOS 2O5EA 1G18A 1R0SA 2JFBA 3K1JA 4N7BA 4KFCA 4R9VA 4HDRA 4URHA 4AZVA 4URXR 4EGJA 3DCNA 4NBTA 3TLZA 1NXTA 3UJ9A 4D4IA 4QFDA 1XDUA 1BDHA 1T8TA 3ZH2A 1D8AA 5LA6B 3STTA 4TVOA 3USES 2JW5A 2Q3JA 5TC4A 3GB9A 4GR5A 2QX7A 3NAQA 1Y82A 2LMDA 3NTQA 1ZNZA 2O8BA 2V6MA 4F4UA 2L9VA 4A8JB 3ZHYA 4FHFA 2NVUB 2VBZA 2PT9A 2B78A 1CY4A 1CV2A 3IEMA 2HMAA 3SM9A 3I61A 3FXOA 1P2UA 1Q7GA 5HS9A 2LKXA 2J3EA 1LLFA 3KOYA 1OAOC 4KYTA 5D3ZA 4UEQA 3TVDA 4O4IA 2VR1A 5ALKA 1Y0NA 5A6SB 1QHEA 4PLFA 4HN4B 2E1OA 4B17A 5KBYA 5DBFA 4XR6A 5A62A 2YC2C 3MMPA 1KZHA 4D02A 1CUWA 3ZMVA 5IZCA 5BVGB 3AHHA 1ADBA 4LCEA 1WQ2A 2AC7A 1JIQA 2FJPA 5IAEA 5DWVA 3WICA 4M21A 4BE9A 2VXCA 5LQMA 4RO0A 5CIWA 4YEDA 3RPUD 2K5UA 3QMPA 1J0EA 5GY7A 1SBTA 4I08A 5F0FA 2HB6A 3WRYA 4OXKA 5DI3A 5JUWA 3V7NA 3MJDA 3IVXA 3WKCA 4R71A 3OOYA 1FUIA 1W7PB 2GJAA 2W37A 4PG7A 4HJXA 2R7WA 2C97A 2QMEA 1ESCA 1XPXA 2AFHA 3GAMA 4KPUB 3ZD9A 3NM6B 4BP9A 1ZUNB 2NZ2A 3ZHVA 4XBFA 1AUPA 1ZH6A 3CWCA 4QWWA 2BM9A 5DVZA 2XJ9A 3VI4B 1N8KA 4CLOA 5HCUA 2QY9A 1FZTA 1T33A 4YRGA 1N25A 4FKBA 5AVVA 4G8CA 1V48A 2ELJA 1BD3A 1R5HA 1YDMA 3HSFA 3A2KA 1DFIA 2YWXA 3QF4B 3OEWA 4DXHA 3ZKAA 1JQ5A 2GVDC 4WCFC 3HOWJ 3SY8A 3QBEA 3H04A 5LR6A 2X13A 1P80A 4JYZA 1OCRH 3PQEA 3RSLA 4GWLA 5K1YA 2W85A 4ADSG 2PUBA 4LTDA 2OSVA 2VJYA 4BUCA 4E5MA 4M7RA 5ARBA 5GTDA 5JAUA 4NAUA 3CZ6A 3LPDA 1KNQA 4JYBA 2HMSA 2JGMA 2YYAA 1D0SA 4LFBB 1JMVA 2HQRA 3N7UA 4MFDA 3CLVA 1SM4A 4LVNA 1V3QE 3FPCA 4JLVA 1OKKD 4MB2A 2MABA 4WECA 4Y2HA 5GV7A 5K3FB 4M3GA 3CQZJ 3R1IA 1JT9A 4I1UA 2BMJA 3WGTA 4H3VA 1I3AA 3FM9A 2UV8A 3SJAA 2A07F 2MINA 4L5BA 3UMFA 1UOPA 4RL6A 2XWQA 2R60A 4J3FA 4Q01A 3DULA 1FQWA 1B6TA 4M72A 4WF2A 1K4MA 5EEHA 2VHWA 4YMLA 1Z22A 5FFZA 4P36A 3RF7A 3ZLJA 2A5GA 2QGUA 4POOA 2D5LA 1N9ZA 1QOQB 4IFTA 2GBPA 3I6BA 1S96A 1F1JA 1KEKA 2G36A 2DA1A 2B8TA 4N49A 2C5SA 3GGDA 1PVVA 4KOAA 4QYIA 5DNVA 1JG4A 2LXNA 4FFPA 4NJEB 2H1HA 1A9QA 5F2KA 2C57A 4LHYA 4XH9B 3U19A 2VDWA 4BMXA 5LOVF 1U3CA 3LA3A 4C9YA 1QG6A 4OI2A 3RC3A 4ZXPA 1ML3A 5AKZA 1Z74A 3GOHA 1QQ6A 4IIFA 3ZX5A 2CWEA 1TGYA 1ETWA 1ZW6A 2I4IA 2Y31A 4Y2YA 5I5EA 1I5OA 1DX4A 2OZPA 1T0UA 3BZBA 1BJAA 1CY0A 1W59A 2DBVO 1E3DA 5CVIA 4WBSA 2PH3A 2Y1CA 4QUHA 2R8PA 4ZYHA 1IUPA 4F71A 1DJMA 3F1LA 1V43A 2I4MA 3KQWA 2E34A 3WNBA 2FR8C 1DELA 2N1MA 3AKYA 1ZQ3P 4W5JA 3UH1A 1MABA 2FI1A 2ZBUA 1QYIA 1G3QA 1GPYA 2QRMA 2X1VA 2ZIXA 5LP6A 2CK3D 2BJHA 2Z5GA 3O91A 3PC2A 4X8LA 3UK7A 2EV5A 1KA8A 2I22A 2C29D 5DLPA 3NCHA 3K31A 3LC7O 3ZU3A 3H7IA 1U8AA 2RE8A 4RSGA 1I5EA 3GDGA 5LGUA 4BJ1A 2NAPA 2BE5F 2DKNA 1FBNA 2PLWA 1CQJB 4BCDA 4NC8A 4GOMD 1HDDC 3ESXA 5J1YA 1MV5A 1YZKA 3RS5A 3A0RB 3EDMA 2XV4S 5KAIC 1RIIA 2XMDA 2Q6TA 3FIJA 4WY2A 1S02A 1Y3CE 1U9ZA 2VXBA 1N0VC 1Z5WA 2FRDA 5J23A 3EPZA 3K4JA 2OU2A 1M10A 3L2CA 1KDYA 3MG9A 4A8PA 2WKQA 4M9QA 4DDTA 5K4GA 2CW8A 4PO9A 3NBYC 1X1TA 3H9BA 4XLTA 5B58C 3B6AA 4JLOA 5CFZA 2PSSA 4CEHA 2DFFA 1RE1A 4U2BA 4RADA 3D64A 2PL5A 3UJAA 1RJEA 2W8BA 4IIVA 1UAYA 3VYTB 1YHNA 3BTUA 2OXIA 3NKVA 2R7LA 3N0XA 5KYKA 1A4XA 1S1MA 3G2KA 4HGZA 4YLGA 2FZ5A 2XSZA 2IEZA 4ZEXA 3W6NA 2DJNA 1IDN1 1MXFA 3B2QA 3EISA 2JAXA 4RZQA 3RRZA 4CETA 1H2EA 1V16A 1X8LA 3STUA 4Z3OA 1VE9A 2Y1OA 2HVRA 4EYEA 5J2TA 4BCBA 5L7YA 3L7DA 1QG4A 4QPDA 2W6MA 4MRNA 2HPAA 2QD5A 4G5RA 1XQ1A 5JSZB 1AHNA 2Z30A 2WIJA 1QZZA 1AXGA 3MTAA 5CAEA 4E88A 4TZ0A 4I0WB 1NN3A 4WTOA 3ZHZA 4LHZA 3UHAA 4TTTS 2DFPA 3KDAA 1R0KA 2NVBA 5KC9A 3NLLA 2GWHA 1JG2A 3M3DA 1N5RA 3L9XA 1J4AA 2ZREA 2UU9B 2XTNA 5B5SA 1FIUA 1UBJS 3LLUA 3VJRA 1SAYA 1S8FA 4NENA 3AEQA 5CNKA 1RM4A 1GITA 3TPCA 3I3SR 3NDIA 3O4FA 3O8QB 5IBRA 1QR6A 1THMA 4HNAA 4EAQA 3B02A 3J7YJ 3JWGA 1GEGA 5ITWA 2W82A 1C9JA 2M1ZA 2XMGA 2FQWA 3VPAA 1IC6A 3H1EA 4RF3A 3GFRA 1L1EA 1IUFA 1LK5A 4MP6A 4F4HA 1KU9A 3P4YA 4BNFA 5A5EA 2QJFA 2WNIA 4RPCA 1J09A 3U1VA 4AS2A 1HA3A 5BR4A 2D5CA 2JVGA 2AQFA 2Q2WA 2A5DA 2UVQA 4P3PA 1SKBA 4B3JA 5DH9A 2O14A 2WBMA 2WI8A 5TQJA 4CCJA 2Y93A 4KPGA 3N7TA 1IWBB 2VLIA 1BXGB 1T5DX 4EW6A 1VXRA 4KITB 4AUXA 3Q3EA 1EVYA 3ORSA 2REOA 4BWFB 4DYQA 2PK3A 2IA1A 2BGCA 5AI8A 2HR1A 5AVJA 4M99A 5J3LA 3S3OA 3OLVA 5EHGA 2M4KA 3IA7A 3TFQA 4PQGA 5BSGA 3QKSB 4CL3A 1E6LA 1LFPA 2B63J 1NONA 5IK2D 4W9NA 1K7SN 5BN5B 2QN7A 4LCJA 2WVHA 2GHRA 3D5EA 3ZQ7A 2Q5FA 3A7DA 3HS3A 3ONEA 1XA3A 4GP9A 5J5VA 3VSEA 2VXZA 3FMIA 1ARZA 1DDOA 2BY4A 2CFSA 3GRKA 5HVQC 4I19A 1IY1A 1FSGA 4FFVA 3VH3A 4AJHA 4R9UC 4B3RB 1ZZEA 1FMWA 1T2NA 1XHLA 2OCLA 2VZ9A 3O3CA 2M6KA 4EPXA 4F56A 4F4FA 3K70B 1D04A 4KQ2A 1OV6A 3W3AH 5L3EA 3UFXB 1SG6A 2Q49A 4HB3A 1DBRA 1PX2A 2Q3BA 1IOLA 2XGSA 3OYIA 2O2ZA 4B8XA 2Q5EA 2A5YB 4K88A 1NFRA 4BNDB 2EH3A 2JFVA 1LFBA 2C04A 3ABIA 3FSGA 1SAXA 1WZUA 4FSXA 3ROKA 4EFLA 4P1ZA 3ZK7A 1DAHA 1XJCA 1EA3A 1HZJA 3JTEA 4YAJA 1Y9JA 3U44B 3O0DA 4FNAA 4FSHA 1ZHFA 2BT4A 2FLVA 4YQZA 1LZLA 2R6DA 3TIGA 4BVJA 5FUBA 4MK4A 4B6FA 3UYLA 3BH0A 4HDRB 2O8DA 5EIHA 2Z8XA 1U0JA 1HY3A 3FNEA 2JKZA 1SUEA 5GTIC 2CYYA 3DTVD 3PXBA 2ZJRF 1ESZA 1NVDA 2POCA 3PQJA 4EA7A 2AJTA 1CJTC 4PF1A 3QFHA 3JRNA 3PNYA 3GF2A 2X6QA 4A5MA 1ISFA 3D3QA 4R7TA 3RS2A 2W42A 4C7OA 1MC5A 3NCTA 3C2GA 4DNOA 4BEWA 3E9QA 3FF5A 3KZXA 2A9KA 4BQAA 2NP6A 3S15J 4B71A 2NV0A 3ZGYA 4Q1CA 3M8JA 5ALZA 3RSOA 4WDRA 1JZSA 1UEJA 2EYUA 3AXTA 3P94A 3AHCA 4M1KA 2EATA 1U9YA 2X58A 5IYZF 1HQCA 4NH4A 3GRAA 3T3PB 4AUKA 3NFRA 4X94A 4OHCA 3BWYA 4DMFA 4MHTA 4U02A 2AYYA 1OLUA 1ISGA 2JBAB 4FCWA 3EAFA 4RA2A 3RRFA 3CLQA 4YXFA 3WLNA 4JHXA 1GAEO 3S2HJ 4U88A 4UHKA 5DLDA 1FFDA 4G4IA 2JF0A 4OFZA 4ZXFA 2JJ2A 2X0FA 1R4MB 4MVJD 3OOPA 2D1RA 4GRAA 4FLFA 3W2FA 1Q1VA 1B0PA 2VBGA 3SDBA 3RZDJ 3LSIA 4P7GA 4RACA 1R8YA 3MT7A 1H9TA 1RPAA 5EF6A 4UQOA 4MUBA 1KKLA 1IBSA 1WVGA 2HL6A 4NESA 4RHXA 4D9EA 3DQPA 4CCOA 1QFXA 1UMCB 2XHZA 3D6UA 1Y1QA 2W2VA 1SB9A 1Y3IA 3H75A 5L3GA 4DNQA 3SXYA 4G23A 2P9QA 1EQAA 4N4AA 2HEGA 3T6KA 4MA0A 5EHXA 1E2LA 3THXA 3IR7A 4A2WA 1FUEA 1NVEA 3WIVA 2KPMA 1KH3A 1V4NA 2V7EA 1KI3A 1VLMA 2JFYA 3SVLA 4C4SA 2QKMB 1TC3C 2BHSA 2QXYA 2V4UA 2PMEA 3R74A 3DU5A 3LS2A 2V6GA 1QF6A 1QH0A 5ERXA 1TZMA 4MITA 4RGVA 1GTJ1 1G2IA 1QBKC 3QX7A 1MX3A 1XVVA 4X45A 3PSIA 2ETVA 4G1UC 4CLXA 5IU6A 3HKCB 4LF6B 2FSVC 4ZK6A 2Y9ZA 1PJ2A 2DY0A 3RIRA 4OHVA 3ZIAD 4NLLA 2D4HA 4RCZA 5E3JA 2XF7A 3F6EX 3TL2A 3L07A 1CT9A 4JGIA 2PQMA 1G3TA 2QN9A 4D5CA 1D2RA 1DXQA 1VE5A 2EG9A 2JL1A 2P69A 4PGGA 1I2DA 2D2WA 1GFWA 2CXTA 4DBLC 5DM1A 1UADA 1V2GA 4HKTA 1RXCA 2C2GA 2YN2A 4HVTA 3FXKA 3K9CA 4QU5A 2Q5LA 2XDQA 4X44A 2I8AA 5HKAA 1H0SA 4OQEA 1CY1A 1MJ5A 2ZRHA 1FFAA 3BG6A 2CLSA 3LDFA 3ADDA 3U9GA 1UBKS 3K7EA 4M36A 4M87A 2X0RA 1IQ0A 3JZDA 4LSZA 4M8IA 4W9NC 4BN4A 4DBZA 2YMQA 4ZWNA 1XAJA 2L9SA 4G1EB 1KC1A 3BZCA 4ZPXA 1Y8QA 4QYWA 2VN2A 4KPYA 4HF7A 3B73A 4KIUA 3I9KA 3HL4A 3NHMA 4A0RA 2ZYHA 2W6JA 3IP3A 1Q15A 3AM1A 5G41A 3V32A 3WAJA 4AJ9A 3RIYA 1ODSA 2P0YA 4FU0A 1SKYB 1HDRA 2JKVA 2PXXA 2PRIA 4FOSA 4KTVE 2C2ZA 4Q7JB 3R9KA 4E2WA 1KO4A 4Y1EA 5JAMA 4C4YA 5K0CA 3ZJUA 1OH6A 1NQVA 4OBBA 5K3EA 2IYOA 2K40A 2FJUA 4TKUA 5GQSA 3PX3A 3PXDA 2JIBA 5MFPA 2OT3B 4R79A 2BGTA 1JTYA 1IJEA 4AWAA 4BNMA 3ABLH 5FEMA 1II8B 3IPXA 1F38A 1KOJA 5IZ4A 2IH5A 1O1YA 2VZ0A 4N48A 3LBAA 5ILGA 5F1JA 2Q7DA 4ZDLA 1D2GA 3N86A 2CW7A 5JR3A 1XVTA 1PLJA 2GCGA 3AG6A 3LPLA 4FILA 1MDBA 1ZMTA 5E8GA 4IIDA 1YJNI 1D07A 4N7RA 3A1CA 4A3LJ 2JVHA 1BQEA 1CWUA 1DO8A 2CLHB 2YQZA 4H1UA 4MKGA 4MUYA 4Q16A 2H5IA 5D5XB 2PDAA 3G2PA 3ICVA 3OWHA 5FB3A 3GEGA 4B82A 4BNJA 3L4EA 1RS0A 2UDPA 2GN4A 5HA5A 2N9UA 1P62B 1LPNA 4WXDA 4AU7A 1O4WA 4KICA 4V02A 4II3A 4B43A 1OCTC 1GTZA 5DTIA 1HW5A 2AJDA 2O1SA 3GPCA 4MGIR 2VEDA 1FFGA 5EHIA 4GEGA 1PE0A 1V1MB 2M0CA 4EG3A 1KWGA 3H83A 2COKA 2RH4A 3C6XA 3P32A 5HUJA 2BD0A 3JQRA 5LOVB 5FFXA 2PLNA 2VXOA 4HDQB 4WOBA 1U3TA 2EZUA 1VQMI 1A9PA 3WYEA 4MQVA 2R87A 1ETUA 2PSJA 2OQ2A 3G2LA 2QHXA 1ECFA 3LYUA 2IZ0A 3ZU2A 3ZWWA 4YMTA 4OSEA 4TWAA 1VQ6I 4PCUA 4HLUA 4IXAA 1JNYA 4C4XA 3B38A 2V1XA 1EUZA 4R2XA 3SIRA 1ONVA 1LPPA 4XQ9A 4E22A 4JC8A 4NH0A 3KOUA 5AKHA 4QT4A 4UTPA 2G1KA 1AHIA 2H3EA 2WQZA 3KZCA 4V39A 3FCAA 4D8TA 5BQXA 2Q4EA 3FAKA 2IVMA 3OYGA 1GAWA 1ZVMA 4WFIA 2ZB4A 3L01A 2D00A 3ZKWB 4Y0AA 4N4OB 3HJUA 5LQKA 1P0CA 2PCJA 4KIJA 3PGKA 3TB4A 3TRFA 5GZ1A 5M3MJ 1F9EA 2DZDA 3DPUA 2NUAA 4J7AA 4WXRA 1HZZC 1RQNA 3W34A 1K8YB 3L7NA 5HOQA 1K7FB 2ZZKA 3BHNA 4HUQA 3WB0A 4DCNA 4DIBA 1V3TA 4DLWA 4NC6A 2W4MA 3JVDA 1L5QA 1OXMA 2WTBA 4IXNA 4XRSA 4U7JA 4DCMA 2PGXA 2PPVA 3VHRA 3D6MA 3EC1A 2C9BA 2QQGA 2G8NA 3PHBE 3EBLA 1IHDA 1UJBA 3AH8A 4GECA 1OYWA 1TIKA 1UKYA 3OKCA 4HNTA 3GJRA 3WK5A 4JHLA 5TS3A 2FSWA 1WUJS 4NOMA 4RGXA 3TDUC 3IGFA 4PYRA 4AWBA 3MBOA 4GI5A 4UBLA 2O48X 3OPXA 1SCNE 1E58A 1CS4C 2RI0A 2WMDA 3PVZA 5CR9A 2EV6A 5TVGA 4J19A 3DKPA 5D7BA 5ADUS 4HV4A 1ZEMA 2ZRDA 5EMNA 4DRYA 5B2EA 3ZTWA 1A9XA 4QXPA 3V2UA 1VNDA 3UO8B 4L4ZA 4DMHA 1EKEA 1ZISA 4XKCA 1NX6A 3C43A 1DQRA 3Q12A 4YAWA 1Z6XA 4BBPA 3WNDA 4HNSA 2GEBA 2R7FA 5FBHA 1WMEA 4H16A 2HZBA 2VHTA 4OQDA 2ZXJA 1MFPA 1L4YA 1E7SA 1QQ5A 1S8OA 4UUPA 5JHUA 2FSHA 2W1OA 2QT1A 2DC1A 1G8FA 3QKRA 4C2AA 3OWTA 1X9IA 2GHIA 3KQSA 4ZV9A 1JV2B 2G04A 2IY8A 4NY1A 1NVFA 5FX2A 5FAKA 3AZPA 3Q8MA 1ECJA 1IHPA 2DUNA 3N2IA 4TMZA 3WQBA 1NBMD 1FSFA 3O6VA 1M2EA 2NU9B 3OYLA 1RRVA 3AC0A 2XRFA 1JJ6C 2HJ9A 1JUDA 5AHXA 1RC8A 4DARA 2VK1A 2TMDA 2COMA 3T8RA 1FSPA 4J0KA 1ZICA 1D2AA 2SBTA 3IAUA 4EP1A 1I1GA 2BTEA 4BNKA 2R4UA 2H1CA 1FEXA 2IV2X 4QO8A 1P8JA 2DR2A 1WUYA 2JLQA 3AI3A 5CM2Z 2G5CA 2L7KA 4BEHB 2CUFA 2HDCA 2NXNA 3L0OA 4KXWA 3SSMA 4ZQIA 4TKVA 3IT0A 1ZRNA 4WEOA 3PNQA 4UNRA 2CNWA 4NFSA 3A04A 2HR3A 1FNCA 3K1AA 3BXEA 3LT5A 4C0XA 1M7GA 2JA8J 2JQ7A 1BC8C 5D8LB 4E7IA 1A3CA 1W0UA 1R12A 2E49A 4P2BA 3OS0A 3GQBA 1T6XA 2V7XA 5BWOA 1BWRA 4IDBA 4LDAA 2NN3C 4BYGA 2PX8A 3GEBA 2E4ZA 1ONBA 1LSJA 2FMIA 5FLXZ 1U8BA 1RHUA 3D0QA 1SY7A 4E5PA 1O0CA 1VQPI 2IPOA 5IVIA 1PG5A 4KCGA 1PZNA 4WOJA 2PG3A 5EERA 3W9UA 1SXQA 1ZD4A 3MJFA 1W85A 4FZJA 2RHOA 2AJCA 3CLHA 2JI7A 5TEWA 3R09A 1M54A 1ZQ9A 2RGVA 1XLWA 2L3DA 3M33A 2N47A 3L2UA 1FJ2A 1RYFA 2Q5HA 3D81A 4D8YA 2JLYA 2IXEA 1FZPB 2JVIA 3MFKA 4FOTA 1JE0A 4JU9A 3ADKA 4QQKA 2EZ9A 1KEVA 4BNTA 1KQ3A 5LOVA 3AERA 2JPDA 3WTUC 2H1RA 3ICQB 2QP9X 3L7CA 3PE6A 2A94A 4XOTA 4ZYAA 1NBWB 2R5YB 2P78A 2Q50A 2QRQA 3COVA 4MGRA 3BC1A 1D0ZA 3TO9A 4RD1A 3LO8A 1D3YA 2B1RA 2VJCA 4K8OA 3UJCA 2X1MA 2PMKA 4BXUA 1ZD3A 5A2GA 1J1UA 1SVOA 1TCAA 3J7TA 4LSWA 4BQOA 4BLPA 1GADO 3PVSA 1OMIA 2Q5IA 1PYGA 4ZT2A 1GUBA 1HLPA 4D6XA 1P2FA 4PZLA 3V7RA 5L3QA 3BSYA 3CW2A 3UMRA 4CMEA 4DZZA 2ACJA 5AIBA 5EJCA 2OEPA 2VQ6A 4X8OA 1XIVA 2RREA 4EUNA 2I4RA 2NQ2C 4P4UA 4H0CA 4BRUA 1GA4A 2ZNZA 3HJEA 4O33A 3UVEA 2VRCA 2CYCA 3CLUD 3PCXA 3PIRA 4D3YA 5AK0A 2GN0A 5KYWA 3OCCA 1NQTA 3OE7A 5T4BA 2XTJA 3E5XA 2VNAA 1D5WA 4DNPA 2Q1TA 4O2AB 4YRIA 1E4EB 1TW2A 3VODA 1KQPA 2AQIA 2HWWA 5SZHB 3ILYA 5CEJA 3W7BA 4Y2RA 5B7NA 2VJPA 1K7AA 2ZT6A 4GMGA 2AJLI 4LTMA 4REQB 3ZJVA 1J22A 4HQ0A 1PX0A 1JYSA 1L7RA 3KTOA 3EUFA 5F21A 4DQVA 1P91A 3QG5A 3FTNA 1PW7A 1KF0A 2HEOA 2XGGA 3KHKA 1JUMA 4QUBA 2DYSH 2QR5A 5MGBA 4YJFB 2UYHA 4OP2A 4P98A 5DF1A 1X3UA 5BMOA 1ELOA 4AKSA 1FUUA 2WQ6A 4NCHA 3VA7A 2Q1SA 4ND8B 3RIHA 4W5TA 4AY6A 2D1HA 3DV0B 1R1DA 4AJPA 4XYGA 2Q28A 1XSVA 1I6MA 1NJ1A 5ITVA 2VSOA 1Q17A 3LUFA 4HAUA 4U63A 3S8MA 4DHWA 4JSRA 3F6OA 1EZ1A 3IBSA 4NC9A 2H1IA 4H77A 4FP9A 1SEPA 1YVRA 4AY5A 1WX1A 3GFJA 5ITSA 2F1KA 3DB1A 3LUCA 5ALIA 5LHHA 1O7JA 2FZVA 2JIMA 4QGAA 1XYVA 2AQ8A 4P22A 3IQWA 4WCVA 3O8OA 4UNSA 3RYTC 3S32A 2AZTA 3GCXA 2DK8A 2ZB8A 3Q2KA 4MSUA 3ZY5A 4ABZA 2V1NA 4CEJA 1I3MA 4D41A 1LNWA 1T0BA 2QSZA 3GMTA 4M4SA 3W2TA 1WPQA 2Y1KA 3CZPA 3CRRA 2OD2A 2V96A 2B2CA 5G0VA 3KP5A 4ZDWA 3BAFA 2JCVA 3B5JA 1MMGA 3FNGA 1CVRA 3SGLA 3HOSA 2R25B 1WNFA 1G2HA 4Q3LA 1X1AA 2XOEA 1I4TD 1XLTC 1X58A 4KQWA 3IPAA 3KQVA 1FLIA 4RQBA 2A8YA 4DT1A 2Z6AA 3OURA 4LK1F 1P2BA 2XA2A 4D1YA 4IJUA 1TZKA 5AUOB 4RQUA 3G6KA 4XLLA 2W2KA 4ZALA 2LTPA 2EHDA 3GMSA 4RAOA 5DASA 1QJ4A 2YUSA 4C29A 2JIDA 3KJNA 3EAQA 1YUNA 3NV7A 2DQZA 3BCRA 4KDEA 4OHRA 4XM0A 3ZOBA 3CCSI 2PL1A 3S2DJ 2H2FA 3U48A 1C2YA 3B1VA 3PDCA 3ZNOA 3HLYA 1J0BA 4Y1RB 3JTMA 4IIXA 4GYWA 2OD7A 1RMYA 3R76A 4E6EA 2JJMA 3PYXA 2FXVA 2QVBA 4C3UA 4C78A 1MX9A 1O57A 1GGNA 1Q2UA 2YFHA 3IJEB 4YH1A 2Q8KA 1IHXA 2EJTA 2FETA 3VTFA 1HG0A 1B6SA 1R6BX 2LE0A 1RBZA 2J32A 2J4DA 2VUUA 2GLXA 4NATA 2ZBKA 4BP8A 1J2YA 2X3FA 2X8JB 2FD5A 3ABUA 1QPGA 3PHIA 4IDFA 4JVOA 3ETEA 5AM5A 2XB4A 4GZLA 4HGOA 2XSDC 4ER3A 5AJTA 3U4GA 2UZIR 3G0CA 4PZDA 3X2QH 1ZH5A 3AM4A 1RXEA 1YU9A 4XRSG 2BZGA 2EKBA 2P4HX 3DEJA 4JJKA 4YC7A 3RREA 4CG0A 2M8GX 1IAVA 1DCFA 1K6EA 2HZ7A 1XV5A 2PAFA 2R00C 3DTYA 4IXMA 2GTPA 4N01A 2WF6A 4QGBA 3ZQHA 3WBJA 1N32B 3KLBA 4XLNF 4DWVA 3HCPA 3LAJA 1YFZA 3OTHA 4HF2A 1KU6A 1OFIA 3OX3A 3RRMA 2JLXA 1AOYA 2PY6A 2RAPA 5KJCA 4FMPA 1ETXA 1GNTA 3LGSA 3UGKA 3KQUA 2STTA 3F5SA 3GXBA 1WPKA 2XPWA 1U6KA 4URZR 4CU2A 3QEBZ 4RXMA 1B42A 4Y8VA 3WHCA 4AXXA 3AUAA 1XHFA 4G2NA 2I6SA 5FROA 3Q5GA 4ZAGA 1NDHA 2H54A 4UTZA 1ORVA 1JAHA 2SHKA 3WZLA 1FXWF 2XNCA 5GJBA 2GA1A 2EF0A 4PC1A 4MJ7A 4UW9A 2RQQA 1HLFA 2MD0A 2A4KA 1GR1A 2PFSA 2R6GA 3H11B 1O6GA 2OCGA 3MOSA 3R41A 5IHXA 5JZOA 3VB2A 1XC7A 2YX7A 2ODTX 2P75A 4XQGA 6CHYA 1Q92A 5C51B 2X5XA 3M7GA 1NX9A 1P17A 3G0DA 5EWJA 1RHKA 1RRKA 2ALJA 4CYMA 5DBGA 5BV0A 3IRRA 2HCTA 2XWBF 4LZNA 1RUNA 3R3XA 3AU8A 4XVHA 5BV1A 3IEVA 3ZBUA 2GBGA 3W2AA 4Y18A 5I4CA 2AQEA 2HU9A 1C3JA 1MRNA 1NF3A 1OTHA 3AEZA 1U65A 3HJBA 3I9V1 4JUCA 5DHRA 3JQAA 5BSEA 2A58A 1JSLA 3JQBC 3BT9A 4HNQA 4GI1A 4PG4A 3LX5A 4DQLA 1E18A 4AQDA 3I42A 1W0CA 1BSVA 3WA7A 3ZHQA 2CLCX 3LT0A 1KYQA 3AXSA 3HJAA 5ESXA 5CA0A 3SHWA 4TTJA 4ESEA 3MM4A 2P91A 2X9QA 3EG9B 2YXNA 4JI6B 1WIWA 1JA0A 2QTVA 2AG6A 2C4KA 2HZTA 3F7MA 3WK9A 4DTIA 5DGHA 4QOJA 3ESWB 2ATIA 2ECCA 3O7WA 4P4SB 3T9FA 1KXJA 2XIQA 4JELA 4KN6A 4V19K 2JPCA 3K70C 1D6SA 3A58B 4ZDIA 3QUCA 4DM3A 1RYDA 4DLSA 3HRIA 2MINB 1CW2B 4FEEA 5JOQA 3M82A 3OPYI 3WTCA 1Q50A 3EW9A 2VUHB 1P7JA 3K05A 4I2OA 4W8HA 2X5JO 1JXQA 1ZK1A 1Q1NA 4KQCA 2XWSA 1E3EA 2IEYA 1TYEB 5LWHA 3DYIA 2IOHA 2Y0PA 4ACBA 4P4NA 2MMCA 2QL5A 3VR3D 5DNEA 5A5VA 4O2BF 1W581 3K10A 4WNIA 3UUEA 1JPUA 4NOJA 3GLFB 1NPYA 1RQGA 4TXNA 3BIWA 4W1QA 3UUWA 4GOXA 2V4JC 4BFSA 1NXQA 1K6MA 4BKQA 4Q05A 4WCDA 1CQXA 1BKYA 3NAUA 2ORIA 3JQGB 4OIFA 4Y67A 2CHVA 5IFKA 2F5DA 2MIIA 3QITA 2ZE7A 3E03A 5T67A 1KKMA 1I39A 4UV8A 1E3WA 2QROA 5TMBA 1SXPA 5KHLB 2O6LA 4R51A 4GVPA 1QIMA 2F1RA 2SECE 3DFKA 4MGEA 5EE3A 5HIMA 1WZNA 2ZBDA 3K6SB 4PFJA 2J9XB 1XCPA 4UVBA 3QPHA 3LBIA 3QU6A 3ONNA 4FJ2A 1SVNA 3PP8A 4YJ2A 1UXGA 3I04A 3W5IA 5JAPA 3VUEA 3UGJA 2ZULA 2LR8A 3CPSA 1KO8A 1TWGJ 2A78A 3HM2A 3QLEA 4LYJA 5EIFA 4ED9A 4WBNF 3L46A 3WRWA 3M70A 3JRAA 2PSEA 5KWJA 4QUJA 3CCEI 3UJ7A 3ZD7A 3U3KA 3ROFA 2JASA 2ZRCA 1EM6A 1Y6QA 1FNDA 4CYDA 1M34E 4J90A 5JCOA 1QO0A 5FBRB 1X2MA 4XIDA 4PIVA 2A6EF 2ZSUA 3P26A 1UFOA 5TVKA 1GV0A 1P4JA 4GSLA 1C1HA 3EWIA 3CF0A 1F8GA 3H3XA 4TN1A 4GUDA 4P7KA 4U6QA 2FDXA 2WA1A 5F78A 2D1FA 3MT0A 4AMGA 1XKQA 2YVLA 4TUYA 4KTTE 1A76A 3L92A 4PXSA 3RTAA 2G7ZA 2G71A 3AFOA 3OU7A 3RC7A 4CLRB 3AUXA 2QPTA 4UASA 2DB3A 5BMZA 1K79A 5AK3A 2P2YA 2Z5UA 1PJ4A 4D9IA 1L5HB 2AMFA 2AT1A 1XMPA 3Q6MA 3OCXA 4GQAA 4D9KA 1N2JA 5LXTB 2QTRA 2AA3A 4I3GA 2LD5A 5CDGA 4UFPA 2EKDA 3R3HA 4E5DA 4MRPA 4RKYA 5DNWA 1ST3A 3A03A 1WF6A 4NBKA 4JWTA 1EAMA 4XPZA 3DTKA 1P2GA 1GXSA 2VP9A 5KYNA 4ARZB 1N5OX 4J01A 5DUIA 3IQZA 4ARCA 3QGMA 1XKXA 2HBYA 1XZMA 1U9CA 1YVEI 3MGAA 4ASUA 4D8UA 2UUAB 1GCIA 3GTKJ 4MQ6A 2BUAA 4KR3A 4HQEA 2FZLA 3VJKA 3JQFC 1JPNA 4L95C 1Z6GA 3KT8A 1HE1C 4UE3S 3SQXA 3O2PE 3NHUA 3V1UA 2K85A 2HTJA 1LBTA 3IC5A 4TLDA 1OIXA 4YMWA 5FI1B 2E1PA 3K0CA 2XUGA 3OOEA 4IVPA 4J0IA 3K4PA 1SZJG 1D4AA 2J5QA 4JBXA 4QRIA 4DLXA 4GIBA 4QA9A 1M1ZA 2YW9A 3HWRA 5J6XA 1FSSA 2V26A 4RY8A 4YAKA 4ZHQB 4F8EA 3WRYC 4GGGA 2PBFA 3K30A 2QPOA 3ENNA 4FX5A 1S8NA 6REQB 4CMGA 3HYSA 2Z8YM 1NP7A 4HEA1 3JREA 2P11A 2XF2A 2XXAA 5JADA 2ECFA 1LBIA 3HDGA 1T2VA 4RHUA 1D3AA 5JLXA 4AO8A 5JLWA 2XEDA 1IZ0A 4G36A 4JQCA 5DP1A 2IS4A 2FN9A 1P61B 4PO8A 2H08A 2FQYA 4MS3A 5ES3A 2C7GA 4FGLA 2GJ8A 1C8VB 1M2WA 4YONB 3KTDA 1TJNA 2KT0A 5IPAA 1H89C 4XWYA 3G0GA 4D97A 2X5OA 3UAYA 4F8JA 3ZU6A 3TR0A 2C6YA 1QK3A 2W6CX 4RS4A 1LI5A 2R8EA 1TNSA 4ID9A 2FMHA 4FTHA 1LKZA 5F9MA 1XZCA 3KKZA 3LOPA 2NVWA 2EKLA 2B9EA 3NBFA 4K6HA 4O4LB 3E0QA 4F9EA 1GFIA 1MQSA 2FG6C 1Y8CA 1MU0A 4IDCA 4D1QA 4ZQEA 1GARA 1MNMC 1B8NA 3C4JA 1QGOA 4GH5A 4TS3A 1QDUA 5KYTA 4M88A 2E1CA 1E4YA 4A2UA 1L4BA 5H7XA 1DQUA 3HRKA 2ZQZA 5HDKA 1H2HA 4DC1A 5MF6A 1KPHA 4RKEA 2M6LA 4EVRA 2CMFA 5TF0A 1Q3TA 5LBUA 3V1LA 4B4KA 4XUEA 4NCJA 1UT5A 1NMXA 5I7UA 1ZITA 5FLMJ 4WK8F 3OY9A 4U6NA 2R7OA 2OYSA 2Y1LA 2DUJA 4JZKA 4PSXA 2PJRB 1YHYA 2AKAB 2PMDA 3H1FA 3PGVA 1GZUA 1B43A 3V1NA 5JYBA 2Q3LA 4KR6A 1O7FA 1BA5A 2HA6A 4GXRA 4UHBA 4ROTA 4DIOA 4ERXA 2WIGA 5ELMA 4L0CA 4IIHA 5ALWA 3ZY6A 1FNMA 4A6DA 4F96A 4Y6PA 2FEWB 3DMFA 2O4CA 2O9LA 4RWEA 1MKMA 4CDGA 2PKCA 2ZJ3A 4OJNA 5JY6A 2F3RA 4OUDB 2QM8A 2I2CA 4F4JA 2JEYA 3JRFA 1VFPA 2XD9A 3F6VA 3L0SA 3NEUA 1CJCA 1REQA 3DEFA 2DPYA 3UMBA 6LDHA 2E5LB 2ZXWH 4IHSA 1CLUA 2EL7A 3KP3A 4X7BA 5CCEA 2KISA 4UDYX 1CG6A 3HVHA 3NP7A 5FOXA 3LLMA 3SOZA 3UGTA 3STHA 4UHDA 5BSWA 3ZWMA 5ER9A 2ZKLA 1US8B 3BG9A 4TXHA 4Z1OA 5IDVA 2AMYA 1Z6QA 5DNYB 1DS6A 4KUHA 4D0LB 4EKIA 3IC7A 2XUFA 3CR8A 3WL7A 4FS8A 1GA1A 1ZW1A 3QENA 3EZ9A 4KE9A 3SS8A 4J4BA 1JF8A 3KV1A 1SD1A 2QAGC 2GRUA 2ZCVA 3FGNA 4WRRA 5DTMA 1BDMA 3WDLA 5I7RA 2P9TA 1N33B 1WD7A 1YJXA 4B3XA 3A1WA 3AF5A 5DN6A 3WGZA 4BYYA 2JRMA 2WOOA 4F72A 4ZYXA 5HRUA 2LBFB 2FEZA 4MVJE 2IYYA 3IT3A 2ZITA 1RZ4A 1KERA 2QN2A 5EKTA 5J1RA 3NYQA 4RA9A 3I9LA 1M74A 1GTRA 3PLAE 2VQHA 2OV2A 4DUGA 1DV2A 2J9ZB 4BVEA 3WGIA 2C58A 3BJEA 3EVFA 4TWBA 2A3RA 1K5PA 3PIDA 4RB0A 4KP7A 3U39A 3WL5A 1DKPA 5CLJA 4C7VA 4RTQA 1YZTA 2WR8A 2P0AA 4XARA 4BX3A 4L0QA 1AO0A 2I7CA 4J49A 4JX5A 4HZGA 4Q9HA 1AN0A 3TDKA 2GN6A 4BWVA 4V1CI 3O2SB 1MA3A 2ZUTA 4CV0A 4B7XA 1KMNA 1STOA 5BSHA 1PR4A 2QM3A 2GF2A 3TTVA 5DEOA 1G7SA 4MDYA 3GLUA 3AG2H 1YJ9I 1ATIA 2PMZA 3A3KA 1YRAA 2VRCD 4JWKA 4AB1A 1BR4A 5DMHA 2AWNA 5H1YA 3OJCA 1DQYA 2JFNA 2VHEA 3B5IA 3C18A 5KTMA 3ZN2A 3N0VA 1JN0A 1RE0A 3RLFA 3H3JA 2C5FA 3IUBA 4L16A 4X3PA 1WCYA 2WG0A 2YXEA 2QYTA 4EPWA 2Q1XA 3FWKA 3JYQA 3T3DA 1IRXA 3HYTA 1EFTA 4B33A 1KBQA 1VSVA 1ZO8A 3TO6A 4WKCA 1N77A 1B73A 2JANA 4HH0A 1QIGA 1FOWA 4A3DJ 3BA1A 1XD2A 1KARA 2UYOA 1K7CA 5HPYB 1VI0A 1USVA 2E7WA 2KMUA 1E2MA 4UUVA 3L02A 2VA8A 4FMDF 4WN9B 3WZ2A 2FMXA 3K2EA 4BBJA 2FUNB 4EF5A 4UB8C 3D6VA 4DV6B 3Q1LA 1SCKA 1E0JA 4HFJA 5DWQA 3O7MA 4F12A 1R74A 2DMRA 3IDQA 4ZDPA 3O3NB 3EGXB 3OTGA 4YJ3F 2J3JA 5LGTA 2GERA 5CDFA 2FSPA 4V0LA 1JEJA 1XHEA 2H4ZA 4XSZF 1NXOA 3DGEC 3JQCA 2W2XA 2WUFA 3KALA 3A1EA 4J1TC 4BC1A 4I81A 4BKMA 1KAMA 1SD6A 3INRA 2ZI7A 2L2OA 2R7UA 1JP7A 4HNGA 4ARUA 3OLQA 3PB3A 2OORC 4BHPA 5C7IO 4PZJA 1XMIA 3WJ2A 3GZ6A 1GGFA 4RZSA 4G5OA 3FUCA 4XGIA 3U4MA 4H3HB 3OZEA 4F7DA 1X0VA 3WNZA 1OASA 1W4MA 1UMBB 2BGUA 3F5DA 5L45A 4WCGA 3KXLA 2B99A 3ZIUA 2R2AA 2KP6A 5DNUA 1SN7A 5K5EA 5L51A 3SHTA 1G3YA 4K6CA 1BCSA 2R44A 4UEOA 3WL8A 1TVKB 3ZEAA 3RTEA 4KACA 2X2FA 4RKFA 3WQSB 4E30A 1SPXA 4O4JB 1Z05A 5LYJF 4P83A 4DMGA 2AEFA 3FDJA 1ZGJA 5ILUA 1OX4B 4DB2A 4JJIA 2AN3A 3E7PA 4YROA 3LC1O 5DBHX 2R8OA 2LK2A 2PX2A 1J5PA 3ELUA 4C87A 4F85A 4I76A 2AQHA 1A35A 4FUTA 3L5OA 1EX6A 1Z28A 3CPJB 1X1QA 3H19A 4RJTA 3GJ5A 2NGRA 1DC6A 1XRMA 3B70A 3FFBA 2YVKA 3RS7A 3VU1A 1ND5A 4BFTA 4EAAA 2PVCA 2XQIA 1FOEB 1LTHR 2XMBA 4M1OA 4AW9A 3A4NA 1KDTA 2QTCA 1HORA 2C0CA 3RFFA 5CDTA 2R7MA 3AR9A 2HDOA 2PD6A 5HNHA 1KVUA 3ENZA 4M1ZA 4UM5A 3CLTC 2G88A 3CZ4A 5ARDA 3S8PA 1EHCA 1FK8A 2CL7X 3GRYA 3LZCA 2IUSA 2PGOA 1EFRA 1NJGA 2OUKA 3HA5A 4N7JA 3F72A 1N7HA 3U44A 1KJNA 5HILA 3OESA 3U7HB 1C29B 1OI7A 4L3WA 1GV5A 2J3MA 2GEDA 3ZW9A 2GRJA 3A6LA 1DEOA 3GBSA 4IAOA 2EV9A 2IOQA 3UFBA 3ISPA 2OC9A 1TIPA 4HNRA 5F3RA 1FMTA 3DW3X 1EXMA 3EFHA 2OV3A 1L7NA 4FD3A 2IZOA 2QB5A 4CFYA 5INTA 2PX5A 3D6HA 3KZOA 5G0UA 1GUFA 2OAGA 3BTOA 3DHEA 3HHPA 3L05A 1DRWA 4R3WA 5SY4A 1DIHA 2XD4A 2HKOA 3HHEA 4XM2A 1VDZA 4DOMA 4MZXA 1OZ0A 1SG9A 3WC4A 3OOSA 2GIZA 2ZMEC 1I30A 4HDSA 1HOXA 5LLSA 1QPIA 5IJ9B 1E3TA 1JBKA 1XK7A 3ODGA 5E7MA 5CB0A 3VZSA 4ZVLA 5LZ4A 1AIPA 3DCYA 1W36D 1LC0A 4PLVA 1MEEA 4RTPA 1HCRA 4HQKA 4E0BA 2CDBA 4BLVA 3CSUA 1ZCAA 1JTVA 1W29A 4MMYB 2Y1GA 2HMUA 4NU8X 4O2RA 1L3CA 1T38A 1MJFA 5FO5A 2OHGA 3HGGA 4TX1A 4BWYA 2XCOA 1AZWA 2P2LA 2PWPA 2YOHA 5CCBA 4X7MA 4C2BA 3H5TA 3H2GA 2B98A 3SNHA 4TTVA 1YVPA 3NM5A 5HYVA 1USSA 4L3VA 1KP2A 1E4VA 3BF8A 3IPYA 3IOEA 3ME5A 2FPGA 3B6MA 2ID6A 2ZJ2A 3CUQB 1XZBA 3IB6A 4RAFA 2AXPA 3DVQX 2GF0A 2XUZA 3N58A 3OJOA 3DWIA 1VTKA 5K99A 1TUBA 1IZ7A 1I2CA 3HSRA 2NU6A 3F9RA 4AZ0A 1A1VA 2PLAA 1FOXA 1TCUA 4Q4LA 3T15A 2E5FA 3OETA 2VONA 5LLDA 4ZAVA 4DLPA 4HVCA 4DCGA 3QX3A 4UTOA 2FPUA 2W98A 5JH7A 4JLUA 1ZK3A 3PIIA 1GQYA 2HYFA 2F43A 3N8DA 4IGIA 5A5GA 3GAZA 2YBEA 1XN1A 1Q44A 1XEWX 2E4UA 2PUHA 1VQ4I 1TD9A 4FT8A 2BKLA 3QFCA 1ML4A 1NU8A 1PR6A 2EFPA 2QZZA 4LRQA 4OJYA 2P9BA 3SF8A 2EIHA 1YR2A 1PO7A 1YA8A 1S6LA 2ICWG 2II6A 1T24A 1AK2A 2AK3A 3CG4A 4YPVA 5HOEA 1PD1A 3TM5A 4NC7A 3SJMA 1L3IA 3AEKB 1Q7BA 1U2GC 2HQOA 3HMKA 4ZVTA 3O73A 3UXMA 3I0TA 2FSVA 2LVBA 1LNZA 2D3WA 1TWFJ 1M34A 2DSTA 2JIRA 3QE4A 4M89A 1K5DA 3V33A 1YQWA 1FTTA 5EG5A 1Z91A 1X4PA 3QUAA 5A4DA 3M1CA 2L7FP 1B41A 5ENDA 1QHIA 3D3WA 3BFKA 3NHWA 4KO4S 4OHKA 1ZGGA 4TMVA 1RBYA 1KK0A 4IQFA 3MAJA 1TA9A 4I0AA 4C30A 2B9VA 2G9UA 2Z6VA 4GYJA 4CN8A 2FSGA 1JIXA 1EJ9A 3ECCA 3DLTA 3ZY3A 3FMPB 4HS4A 5TXGA 1J9IA 2DU9A 4BQNA 4YJGA 3B9PA 1AKTA 5K0JA 3OLCX 3A6GA 1IDZA 2VJMA 4OY3A 1GY8A 2IEDA 5EZSA 3SR4A 1P1HA 3LGAA 4E15A 3JQBA 3WXMA 4OLAA 2R7RA 1IEVA 4JT8A 4K0RA 4UDNA 1R0BA 2I0FA 3HI4A 4YUZA 1D03A 4Q4JB 1TVKA 1XZHA 2YU9J 1VE6A 2V74B 5KWEA 5M5XJ 1W5BA 4OI1A 5AVSA 4DUZB 1PR5A 4HSTA 4JFAA 1N6KA 5MHTA 1II0A 4W1PA 1KMMA 5FBZA 2BFMA 5JZ9A 3C16C 3P9XA 1NSTA 4EZBA 5DD8A 4JB0A 2O50A 1XRLA 5BSKA 1QZEA 4OUKX 4IFEA 1W73A 3I58A 5GONB 3OF5A 3UWMA 1JZQA 1RYZA 1F5NA 2B35A 3G2JA 3LPAA 1RMTA 3HB1A 2OLKA 1MQ9A 3QWHA 4H7EA 4XYMA 5CJ2A 3BSWA 5AXCA 5ERGB 4GP6A 2VDNB 2J7KA 1IN1A