2H27A

Crystal structure of escherichia coli sigmae region 4 bound to its-35 element dna
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
71
structure length
71
Chain Sequence
SHMLSEELRQIVFRTIESLPEDLRMAITLRELDGLSYEEIAAIMDCPVGTVRSRIFRAREAIDNKVQPLIR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Transferase/dna
molecule keywords 5'-D(*CP*CP*CP*GP*GP*AP*AP*CP*TP*TP*CP*G)-3'
publication title The structural basis for promoter -35 element recognition by the group IV sigma factors.
pubmed doi rcsb
source organism Escherichia coli k12
total genus 28
structure length 71
sequence length 71
chains with identical sequence D
ec nomenclature
pdb deposition date 2006-05-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08281 Sigma70_r4_2 Sigma-70, region 4
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 2h27A00
1S8NA 3U9GA 3WE2A 3KP2A 2QBYB 3BY6A 1MDMA 1I27A 3CDHA 3P7NA 3ZMZA 1FBSA 4UVBA 3KEQA 4IRHA 4CYDA 3C1DA 5FGMA 1BC7C 3COAC 4EGZA 3TDUC 3ECHA 3FM3A 3M8EA 1F1ZA 1K79A 1RUNA 3CLOA 3ECOA 1XMKA 3N4MA 3EUHA 2OA4A 5K5OA 1K6OA 4WXCA 3T5XA 1ZG3A 3Q9VA 4KN7X 1HW1A 2FA5A 3ZMSA 3WTSC 1USSA 3J81K 1Z1DA 4R1HA 1BI0A 5LEJA 3V7RA 3TGNA 2FBIA 2HYFA 5D4SA 1I1SA 2Z99A 3HUGA 1YW7A 3ABTA 1TNSA 2FEZA 2ZMEA 3HHHA 4KICA 3DEUA 1XD7A 5DYMA 5K1YA 1MGTA 3MZYA 2W24A 3ZMDA 3HSEA 5HLIA 1SFUA 2ETHA 1P4XA 2IVMA 3KFWX 1P92A 3TOAA 4U88A 5ILUA 1IRFA 3WGIA 3G3ZA 1W4MA 3ML6A 5DCFA 2EV0A 3KLOA 1FY7A 3O3KA 2EFNA 4HDUA 5CVUA 5LHGA 2F2EA 3J7AO 3EQLF 1ZG1A 2H27A 2EB7A 1DPUA 1ON1A 2KJBA 3QPTA 5LHHA 1L0OC 2VT3A 4BH9A 3WTXC 4WXHA 2J5PA 4U0WA 2WTEA 1SD5A 3V7CA 2OAZA 3P9KA 1J9IA 2IJLA 4WXDA 3HRUA 1ZGAA 2DU9A 4L18B 2DI3A 4MHGA 1IN4A 4ZZLA 5LBQA 5CVIA 2FOKA 4UNOA 2O03A 1P6RA 4HF2A 4GO1A 4GYGA 4IJAA 1R36A 2A61A 2EWNA 4U7BA 2HR3A 4M71A 3JSOA 4FX4A 1B6AA 1YS7A 2D45A 1F4KA 4A12A 3TO7A 3RJPA 2ZNYA 4OIRF 3G73A 5D8KB 2OZUA 4BXUA 3CUQC 5DCMA 5HS8A 3CTAA 3HIFA 1PP8F 2QBYA 3FF5A 3E3VA 2ADUA 4LFUA 2V1DA 2AS5F 5CLSA 2HEOA 3GYHX 4KNYA 1XSXA 1ZLKA 1T0FA 2FE3A 3GZ6A 2K86A 2EFOA 2HDCA 1FYLA 1IRGA 1W7PB 3FZVA 1XSVA 4CXFA 1U5TA 3KE2A 2L01A 4HBLA 4HAMA 3QRFF 1S6LA 5BQTA 2O6GE 4XSZF 2E7WA 5E1WA 5FD6A 1I1GA 4P55A 3MAJA 1KYZA 1UHWA 4JQFA 4XSXF 2DLLA 4GYIA 3WTTC 2DO7A 3TQNA 3DXJF 4B8XA 1STZA 3DPTA 1U3EM 3U1DA 1XCVA 1XMAA 2ZO4A 1R1UA 2GWRA 3O6BB 2DQLA 3LQRA 1QZZA 3KETA 1USTA 1J5YA 1B4AA 3F6OA 4ZH4F 3KP6A 1FX7A 1KU2A 4HA8A 1SD6A 4U0VA 2F5FA 1F5TA 5JI6A 4KUMA 4WX9A 1YO5C 2BV6A 4OIQF 1XGMA 4RAZA 3HRTA 3ZMTA 4G7HF 1IW7F 2V9VA 2G9WA 1BI1A 5D6EA 4M72A 1DDNA 3KCCA 3BJAA 3JW4A 3CUOA 4HOBA 4I09A 2VBWA 5LGUA 1FLIA 2QUFA 1ZYRF 3BPVA 3V8JA 1NHAA 2Y0MA 2QM3A 1HW5A 4MTDA 2QLZA 4UV8A 4I98B 2W25A 1RUOA 3F22A 2K7LA 2DK5A 1QPMA 1YW8A 1TW3A 4HYEA 3HHGA 2V1UA 3E6MA 5HLGA 4LK1F 3R60A 3I58A 4EM0B 3GUDA 3BROA 1QQIA 2CO5A 2F5EA 4IRGA 4LB5A 4UXNA 4IF4A 4S04A 1AWCA 2EV5A 5LGNA 5DV5A 4GCVA 3LAJA 4EJTA 5D5WB 3K0LA 3I5UA 4RB0A 1ZG5A 2ZCWA 3L7WA 2VOPA 1WKMA 2IA2A 3BPXA 3TDZC 4TV7A 5A2QZ 2ESHA 3IRRA 1SAXA 3WG9A 3E97A 1OR7A 1E2XA 4OOIA 1W7PA 2DW4A 5DD8A 4NHJA 2ZJ2A 2M45A 4OU0A 1TQIA 2IPQX 3QP5A 1B9MA 2NAZA 3WTWC 2WC2A 2LF8A 3QU3A 5L3EA 2RN7A 4PDKA 2D1VA 5LHIA 3FXQA 1UCRA 1R00A 3SFZA 2VBYA 2KIUA 2HZTA 3H92A 2NRAC 3R6SA 1U2WA 2STWA 5HOOA 2GQQA 3R4KA 2H6BA 1SFEA 3CJNA 4MTEA 4UHTA 3KP5A 3CO7C 1JHHA 2BYVE 4EM1A 2P4WA 3MWMA 4OINF 5K5QA 2V6CA 3BOQA 5K5RA 2BE5F 1XSDA 2P6TA 4LG0B 4RGXA 2L4MA 2IP2A 1JXSA 1FSHA 2A07F 2VN2A 5E17F 1KYWA 1UFMA 4H0EA 5E1ZB 4HX8A 1O3RA 1V3FA 3KZYA 2F5CA 4P9FA 3MCZA 2WWYA 1ZLJA 1XDSA 2A5YB 2EFQA 5FD5A 1SD4A 3E6BA 4AIKA 1IXSB 5E1XA 5LRSA 2VOOA 4S05A 3IRQA 1ZH5A 2NNNA 2KKOA 2HQNA 1DP7P 1QNTA 2MLGA 2W57A 4XLPF 2JSCA 4I2OA 2IA0A 1WWXA 4KT5C 2K4BA 4MEXF 1R1TA 2FNPA 2RGVA 1TNTA 3KZZA 4L9TA 2Z5UA 1ULYA 2L3DA 2LDUA 2MC3A 4WF2A 2QYOA 2DPDA 2ISZA 4E70A 4EJUA 5ICCA 4A5MA 5KK1A 1LEAA 4HDVA 2YX4A 1DUXC 3RKWA 1I5ZA 1TLHB 1XGOA 3BDDA 1ONVA 1IXCA 2VONA 1G3TA 2W84A 1G3WA 1QGPA 2GAUA 2ZXJA 2OQGA 3CUQB 2R7FA 2R7DA 3B02A 5H6RA 1LVAA 4LGWA 2FXAA 3V7SA 1H9GA 2P7VB 3ZQ7A 2Q2EA 1IZ1A 1ZRFA 3I64A 2Y48A 4AIJA 2HQRA 2RC4A 3ULQB 2PG4A 2LNBA 3E5XA 2D2WA 3VODA 1KU7A 2PMHA 3SZPA 4XRFA 5LRRA 5FFXA 4I01A 2V79A 5JR3A 2XIGA 4EGYA 1IN8A 3JTGA 1J59A 4F7ZA 1CGPA 4Q5SF 2BBYA 2EJRA 5E8IA 3QAHA 2LF7A 3GFLA 2XAQA 1SD7A 4EV0A 1PUEE 4RB3C 1FYMA 2KIMA 2D1HA 1V4RA 4FX0A 4AD9A 1SMTA 2VE8A 1X3UA 2XGXA 1REPC 3FHZA 1ZARA 4CDGA 5H6QA 4L5IA 1H0MA 4KMFA 1BBYA 1G3SA 1YLFA 1FWZA 3LSTA 4LG0A 1HKQA 4ETSA 3V8LA 2XV4S 3RKYA 4RB2C 4ASNA 4XLNF 5CVVA 5D4RA 3C3WA 3AAFA 2NNYA 2NS0A 3FMSA 4M9ZA 2CQKA 5LGTA 2FNAA 3JAMZ 1Z7UA 1Z9CA 3HSFA 4FHTA 2UWMA 1T6SA 2GXBA 2A68F 4ENMA 3KP3A 2DTRA 1RI7A 1R23A 1YFHA 2ACJA 4KYWA 1LEBA 5F6FA 2P7CB 1C0WA 2HKXA 1SFXA 3R0AA 4NQWA 2XUBA 1KQ0A 1CF7B 2ZKZA 3F21A 2XAFA 3WU1B 3F8NA 4KN4X 1FZPB 5F1RA 1IN6A 2YPRA 3TKYA 1O3TA 4M74A 5L3CA 1HKTA 4HV6A 4LLGF 2L4AA 1KU9A 3K69A 2PI0A 3B73A 1FYKA 3HTSB 3RDIA 3CUQA 1OYWA 1BI2A 1QO0D 5CVRA 4RAYA 4ZZDA 3K1MA 4CHUA 4LK0F 5J8FA 2O8XA 5AIQA 1LDJA 2XAHA 3RPQA 2VBXA 4JK1X 2JPBA 2DAOA 3GEZA 2K02A 3HRSA 4YIFA 3JAMK 4L9NA 3L09A 1WQ2A 4Q47A 1UHMA 5HDGA 1FP2A 4L9VA 3DKWA 5LEKA 1IF1A 1FNNA 3L2CA 1BC8C 4LJZF 4HQEA 2RVCA 5E20A 1MJBA 1RZ4A 3RKXA 3SHFA 4AVPA 4ENJA 1YG2A 1XCBA 2C6YA 2GA2A 3GZ5A 1YTYA 1R5GA 1HSJA 2RKHA 2STTA 1QBJA 1S3JA 3W6KB 1P4WA 4RS8A 1Y0UA 1GHCA 3CO6C 2DFIA 4EMSA 4CZZA 3OV8A 1XN7A 5DEQA 2MLKA 2VC0A 5D5XB 3REOA 1Z05A 3J80Z 2QWWA 3F72A 2QENA 1ZRCA 3GW2A 2QZ8A 2X4HA 2YX7A 2XAJA 2P5KA 3K2ZA 2OD5A 1RNLA 2JZYA 1MJAA 3P9IA 2FSWA 3DFGA 3M9AA 3NEUA 2OQRA 1P2FA 1Z6RA 4G9YA 1ODDA 4HLXA 1R1VA 1ZREA 1PP7U 2P6SA 5CJ9A 1Z6TA 2K4JA 2IA1A 2AXLA 5FB2A 3JTHA 2XAGA 2L54A 1DPRA 4N9HA 4HX7A 2HOEA 1EH6A 2E7XA 4DQ2A 4ENKA 1XGSA 1O57A 1I6XA 2ZFWA 3L00A 1CF7A 1IN7A 2KIFA 1BIBA 1IXRC 2KRFA 1J75A 3K1NA 4UUVA 2O3FA 3DQVC 5ED4A 5ICEA 4HLYA 1HKSA 3K1PA 2UXNA 5HS9A 3HTUA 3F23A 4DNCA 1B9NA 2XKPA 2IW5A 2HKOA 3BWGA 2K27A 1BIAA 4IVNA 3D5LA 2CYYA 2YR2A 4MEYF 3J80K 4HQMA 2JPCA 2PN6A 2CFXA 3QU6A 3FWEA 1IAWA 1D8KA 3VOEA 4AWXB 3GXOA 2OU2A 2JTVA 5ICGA 4RGUA 2E1CA 3ZN1A 1E17A 1YIOA 2H6CA 3HOSA 4K2EA 1YW9A 1ZN2A 2Z3YA 5D8LB 4LB6B 1G3YA 1S7AA 2RNJA 4G6QA 3V4GA 4RB1A 4Y13A 4A2UA 3MFKA 5ICFA 1QZYA 1KGSA 1HXDA 4G7ZF 2XKOA 3DV8A 1JE8A 1TTYA 1XGNA 3V8KA 4G94A 3TOBA 1KU3A 2EA4A 4D0PA 1KA8A 3IKTA 1LB2A 2M5WA 2PQ8A 3VFZA 2HYGD 4I02A 3IL2A 4M73A 3RYPA 3RYRA 1BM9A 5EEHA 3I53A 5D6FA 1LDKB 3MZHA 4IXAA 3DF8A 1O7LA 4Z2YA 4AIHA 1R22A 5BMZA 3QOPA 1MKMA 2L02A 2NYXA 4ZYDA 2M8EA 5HVQC 2IRFG 3FMRA 1O7FA 2HS5A 2UZKA 4KMUX 5KVRA 2MBFA 2FQ3A 4M6YA 1W7PD 5HDNA 1ZRDA 1JGSA 1BN5A 4R79A 1JHFA 4HF0A 5BS6A 2Y75A 3IC7A 3BJOA 4M9XA 4OMZA 2Q8KA 3GFMA 3E6DA 5AONA 2KJCA 2VBZA 2ELHA 3WODF 4QWQA 3D0SA 1ON2A 4ESJA 3ZMUA 4MNUA 3HRMA 4GXOA 3TO6A 4CICA 4IHSA 2HTSA 1R7JA 3WTVC 1HW2A 3ERED 1MZBA 4KDPA 1SMYF 3WE3A 2A6EF 5JVTA 2O61A 4MQVA 4PGHA 4BAYA 4YFKF 1T98A 3TO9A 1G6NA 4IRIA 2CW0F 3RIRA 2GA1A 4A6DA 2XHKA 4BHCA 3QP6A 2FBKA 2A6HF 2QVOA 3I54A 2HGCA 3ELKA 3C18A 3HOTA 3WGGA 1EV7A 4RGRA 4ZYHA 3LAPA 3M7GA 3I59B 1FC3A 1WI9A 2GIVA 4HX4A 4LD5A 4BNCA 1GXPA 4PCQA 1U5TB 1R5HA 1TQMA 3I71A 4P96A 2FMLA 4HZFA 2TDXA 6PAXA 1U78A 4CGZA 2RV8A 1XDUA 3P9CA 1UB9A 2R3SA 5HDKA 2G7UA 2MA3A 2XVCA 4WK8F 3U2RA 5CVJA 1IN5A 2A3SA 3SQNA 5JHUA 2MH2A 2PLYA 4L5JA 2DBBA 4KA4A 1Z91A 4EJOA 4YFNF 3EYYA 3LA2A 5ILVA 3BP8A 2V1XA 1YQAA 4HF1A 4I0BA 2XRNA 5D5VB 4EQQA 4IPAA 3IHUA 4HV5A 3S2WA 5J6XA 4ENNA 2GXGA 4G8XA 4LLLA 3DPLC 4UVAA 2M30A 3R61A 1G4DA 3WTUC 5E18F 2PEXA 1WSUA 3GWZA 1FT9A 2MH9A 2MD5A 2ESNA 3IWFA 2XASA 4A6EA 1F9NA 3WGHA 2VXZA 3ISPA 1K7AA 3KEOA 3IWZA 2IT0A 4BHPA 2OBPA 4I7HA 4O3MA 2QQBA 4KFCA 3I4PA 3O2PE 2H94A 5J8CA 2QQAA 4ZYEA 2YSRA 2ZBKA 1ZAOA 5AIPA 3F6VA 3H3ZA 3E5QA 3T8TA 1LNWA 4A0ZA 2CWEA 3DP7A 3PFIA 2EK5A 1W5SA 2H09A 3HSRA 4ZYGA 3PQKA 2FF4A 3ABUA 3VB2A 2QQ9A 1S29A 3Q5FA 4G7OF 2DT5A 4EJVA 2VE9A 3MEXA 1KQ9A 2FMYA 3GX4X 1VTNC 5TJJA 4EVIA 4EJWA 1K78B 2ZNZA 4ESFA 2VC1A 1U5TC 3Q9SA 1LJ9A 4R8HA 3LFKA 2PFBA 4U0YA 3IKVA 2XROA 3EYIA 4UV9A 4KIBA 4N9IA 3QPHA 2GZWA 5HLHA 4P9UA 1YYVA 4O5VA 5D5UB 3BZ6A 5F64A 3I59A 3LA7A 3E5UA 5TRDA 4PZJA 4EM2A 2B0LA 5EEGA 3K9TA 5ERIA 1U8RA 2PBIA 3T1BA 2JRTA 3L9FA 3LA3A 3PQJA 4BQAA 2PJPA 1OKRA 1MD0A 3BJ6A 3KP4A 5DUKA 4L0YB 3SXYA 5DDGA 2G7HA 4MQ9F 2YU3A 4YG2F 2Q0OA 1T39A 4O6JA 5BPIA 2UXXA 1HBXG 3W6JB 1FSEA 3WTYC 3EDPA 1MJ9A 2BEOA 3GFJA 3F3XA 5L3BA 1OPCA 2PMUA 1GVJA 5IT3A 3NRVA 4CO8A 2X0LA 1D5VA 1S7OA 3FM5A 1TW2A 1KQ8A 3GF2A 2DPUA 4N0BA 2CG4A 3GFIA 4OIPF 2O0YA 2FBHA 2FRHA 4HW0A 3E6CC 1J7KA 5H20A 3KP7A 2COMA 1BI3A 1L3LA 1B59A 4JBAA 5L3FA 3ZP5A 3T8RA 3ROUA 2P5VA 2EFPA 4ON0A 1AOYA 4BHBA 2FU4A 1GXQA 3R0JA 3JSPA 3N97A 4L0ZB 4A0XA 1B1BA 1OYIA 3F8CA 1O3SA 1FP1D 4BYYA 4P5OA 1MDMB 4KIGA 3WTZA 1D3YA 2DQRA 4YFXF 5FLXZ 2M87A 4XBFA 4M6XA 3EETA 2M1BA 2HTJA 1XB4A 1PDNC 3FXRA 5DUIA 3NQOA 4A0YA 4WCGA 2Z9OA 1OMIA 2VT2A 1R58A 1K78A 3RI4A 4YIIA 2CGPA 2DK8A 2J5OA 4QLCU 3M1EA 1P4AA 2HWVA 2P8TA 1O3QA 4OMYA 2F5DA 3GLXA 2HFHA 2WV0A 1W5TA 5HS7A 3FXUA 5JFRA 2A69F 3GVAA 4WWCA 1FOKA 2ZMEB 4Q48A 5IT9Z 1FBUA 1IUYA 1OYYA 3RPUA 1ZGJA 1EH8A 4PGGA 4Q4ZF 1YS6A 3F8MA 1ZHFA 3ZPLA 1WRJA 4LMYA 2W85A 1H9TA 3VEPA 3M8FA 2LSOA 1BOAA 5E8GA 3ZN0A 2LKPA 3C7JA 2RQPA 2OZ6A 1RIOH 4MGRA 1HQCA 1D8JA 4ESBA 5L3DA 2ISYA 2Z33A 1T38A 4KIFA 5FLXK 5DD4A 3HYIA 1FBQA 4G6DA 3F8BA 4U7DA 1FPQA 1LQ1A 4NB5A 5BPDA 2P5LC 4B09A 1BJAA 3RTRA 1J2XA 4FT8A 4UVCA 2EFWA 4IHTA 4OIOF 3OOPA 4I0AA 2E1NA 3SZTA 4LLNA 5FFZA 2CSOA 3J81Z 1EH7A 4GGGA 3FMQA 3LWFA 4Y17A 5LLQA 1U6GA 3H3UA 3WU0A 4L9JA 1J0RA 3KLNA 5A2QK 4M9SA 2BGCA 1LDDA 2EV6A 4Y15A 5CYVA 1A04A 1HSTA 2JT1A 1Q1HA 2VODA 1T2KA 2RDPA 3GO5A 5FO5A 5IT9K 3ZMVA 3F8FA 1TBXA 5ILSA 4RGSA 1TQPA 3MQ0A 4A5NA 3FX3A 5BOXA 2EA2A 3LQQA 3T0YA 5L3GA 3I0TA 5DCMB
chains in the Genus database with same CATH superfamily
1S8NA 3U9GA 3H9QA 3WE2A 3IV5A 3KP2A 4PSXA 3KEYA 2QBYB 3H9JA 3BY6A 1MDMA 4A3GJ 1I27A 3CDHA 1FTTA 3P7NA 2HQAA 3ZMZA 1FBSA 3K4JA 3JRIA 4XOPA 3DTKA 2ZFUA 2WADA 3ZGKA 2L2OA 4UVBA 3KEQA 4HPQA 5DTDA 1ERDA 4IRHA 4CYDA 4Y7NJ 3GTGJ 2H8WA 2EH3A 3C1DA 5FGMA 1BC7C 2ELKA 3JR9A 3COAC 4EGZA 3TDUC 3WU2C 2H1LA 3OYEA 3ECHA 3FM3A 3M8EA 1F1ZA 1K79A 3CP8A 1RUNA 3CLOA 3ECOA 1SFOJ 1XMKA 3N4MA 2ZMEC 1F36A 1V54H 3EUHA 3MMYB 2OA4A 3K4NA 4BQOA 5K5OA 3AL0B 1K6OA 3Q3SA 4II2A 4ZJZA 1U9NA 4YIRX 3JRDA 1YRNB 4WXCA 3BLYA 4GRIA 3T5XA 2E71A 1NG7A 2JVHA 3I4NJ 1VQMI 1ZG3A 2KIQA 3Q9VA 1HW1A 4KN7X 2FA5A 5EG0B 3ZMSA 1YI2I 2JA5J 3WTSC 1LE8B 1USSA 2X1DA 2OV7A 1UJ8A 1Z1DA 3J81K 2Y69H 1UMQA 4R1HA 1BI0A 5LEJA 1X2NA 3V7RA 3TGNA 2FBIA 1WGXA 2HYFA 4PJ0C 5TISC 3LSHA 1KZHA 5D4SA 2Z99A 1UAAA 1I1SA 3HUGA 1VQ9I 1YW7A 5K7FA 1VI0A 2CUZA 2DA5A 3ABTA 1TNSA 2DFEA 2FEZA 2ZMEA 3HHHA 4KICA 3DEUA 1XD7A 5DYMA 5K1YA 1MGTA 3MZYA 2W24A 3ZMDA 3HSEA 1ETXA 2A5WA 3DEEA 4E7IA 3CMAI 1ACIA 3HG9A 1MBHA 5HLIA 3LSKA 1SFUA 4IHYA 2ETHA 1P4XA 1QPIA 2IVMA 4E7KA 3KFWX 3PM1A 4L5EA 1P92A 5E79C 3TOAA 4U88A 5ILUA 1IRFA 2KT0A 3WGIA 2R5ZB 5F1JA 2CQNA 3G3ZA 4LIVA 1W4MA 2CV0A 3ML6A 4X1EA 4JX5A 5DCFA 2NVQJ 2EV0A 3KLOA 1FY7A 3ZQFA 3O3KA 2EFNA 3FK6A 4HDUA 5CVUA 4CCMA 2L0KA 2F2EA 5LHGA 3EQLF 3J7AO 4ANJA 1ZG1A 2H27A 4CCKA 3CCUI 2EB7A 3DLLF 4XICA 1DPUA 1ON1A 3M1CA 5J47A 4BGDA 4F93B 2LVSA 1A6QA 2KJBA 2KRHA 3QPTA 4XONA 3OYKA 3DTIA 2DMPA 5LHHA 2L7FP 2M34A 2R5YA 1L0OC 2VT3A 3LMMA 4BH9A 3WTXC 1TP4A 4WXHA 2J5PA 3PFYA 2LBFA 4U0WA 2W48A 1D0XA 2L7ZA 2WTEA 4ZDLA 1SD5A 1IGNA 3V7CA 2OAZA 3DKYA 4XLFA 3TEDA 2CW8A 3P9KA 1J9IA 1JJ6C 2RNGA 4XRSG 2IJLA 2HVRA 4EEFG 1NG6A 4WXDA 4D5CA 3HRUA 1ZGAA 2HZDA 2DU9A 4L18B 2NS7A 2AQFA 1XMXA 2DI3A 3JRAA 4MHGA 1IN4A 2DJNA 1K4TA 4DW6A 4IKFA 2V7FA 3GTMJ 1QU3A 2LKSA 4ZZLA 5LBQA 5CVIA 3C2GA 2FOKA 4UNOA 3ONQA 2O03A 3OYNA 3BTLA 1P6RA 1GDTA 4HF2A 2KPMA 4GO1A 4GYGA 4IJAA 4PJLA 3OYDA 1R36A 4CSWA 2A61A 4DIQA 2DXIA 1MSEC 5CQEA 2EWNA 4U7BA 2HR3A 2EPFA 4M71A 3JSOA 4FX4A 1T0FC 1B6AA 3PJRA 4PFOA 1YS7A 2D45A 2F6CA 4JX6A 1F4KA 1I3AA 4A12A 3TO7A 3RJPA 2ZNYA 2MYSA 4OIRF 3G73A 5D8KB 2IAIA 2OZUA 2M8GX 2VB6A 2BXZA 4BXUA 1TT5B 3CUQC 2PX9A 5DCMA 3AL0C 5HS8A 4E7JA 3CTAA 4X6AJ 3HIFA 1PP8F 1V5GA 2QBYA 3FF5A 2X1CA 2ADUA 3E3VA 4LFUA 2V1DA 2AS5F 5CLSA 2ME0A 2HEOA 3GYHX 1WJAA 4KNYA 1PYVA 2M3AA 1XSXA 1ZLKA 1T0FA 2FE3A 3CP2A 1YJWI 4JX4A 3GZ6A 2K86A 2EFOA 2VJ5A 3G6EI 3OYHA 1OCCH 2CS3A 2HDCA 1FYLA 4XLEA 1IDZA 1HA8A 3BT9A 3UKGA 3CCMI 1W7PB 1OCZH 1IRGA 3FZVA 5EGOA 1XSVA 4N4OB 2K9QA 4IHVA 1GV2A 5FKOA 4CXFA 1U5TA 1Y8QB 2DMQA 3KE2A 3L2QA 2L01A 2LMDA 4HBLA 3LL7A 2PMZA 1YRNA 4AUXA 2KLOA 4HAMA 3QRFF 1H89C 2HVQA 1S6LA 4XLAA 5BQTA 1N25A 2O6GE 1N78A 4B43A 2V6EA 4XSZF 2E7WA 5E1WA 3OS1A 5FD6A 1I1GA 4P55A 1JJ8C 4BDZA 2CV2A 3MAJA 1I50J 2DOEA 3OS2A 1KYZA 1UHWA 4JQFA 4XSXF 2DLLA 5IP7J 1NTCA 2JSPA 4GYIA 4UUSB 1NK3P 2LOOA 4BUPA 3WTTC 3PIPF 2DO7A 3TQNA 3DXJF 3FXJA 4B8XA 5IP9J 1STZA 1E3HA 2A05A 4V2FA 4A3CJ 3DPTA 2WAEA 1U3EM 3U1DA 1XCVA 3BR0A 1QA6A 1XMAA 2ZO4A 4RLFA 1R1UA 2IEKA 2V9KA 1OFCX 3EPZA 3CCEI 1WHUA 2GWRA 3K10A 2E36A 4FETA 3O6BB 1Z3YA 2DQLA 3LQRA 2BHYA 2OTJI 1QZZA 3H5AA 3KETA 3CF5F 1USTA 3W2WA 1J5YA 2XAUA 5FROA 2R5ZA 1G2HA 1B4AA 1T33A 1XX5A 3F6OA 4ZH4F 3KP6A 1FOXA 3A02A 5FJ8J 4BDYA 2EIJH 1FX7A 1KU2A 1H8AC 4FASD 4HA8A 5DS9A 1LPQA 1SD6A 4U0VA 2F5FA 1FTZA 1F5TA 4XORA 5JI6A 1S5LC 1T8IA 3HOXJ 3CC7I 4A3DJ 4KUMA 4WX9A 3OYGA 1YO5C 3IH3A 3S3OA 2BV6A 4OIQF 4AC0A 1XGMA 1RKWA 2JN6A 4RAZA 2NVTJ 3VYRB 3HRTA 3ZMTA 1MBGA 4G7HF 1IW7F 2NOJB 1IV8A 2V9VA 2G9WA 4RM3A 1A31A 1BI1A 5D6EA 3I9V2 4M72A 5K7HA 1DDNA 3A01B 2K40A 3KCCA 4E7LA 1BW5A 1JUPA 3BJAA 3JW4A 4QSHA 3CUOA 1R49A 4HOBA 4I09A 2VBWA 5LGUA 2W4SA 1FLIA 4FE4A 4BJ5C 2QUFA 3QPSA 3O8GA 1U8BA 2M7BA 3HOUJ 1ZYRF 1LFBA 3BPVA 3V8JA 1NHAA 2Y0MA 2QM3A 1YIJI 1HW5A 2V26A 1HOMA 3SEZA 2KP6A 1HLVA 4MTDA 2QLZA 1JT6A 1VQPI 4UV8A 1F43A 4I98B 2M4KA 2W25A 1BR2A 4CCNA 1RUOA 3F22A 4Y3OA 1X4PA 1HC8A 5GPAA 2K7LA 4DJAA 2DK5A 4E7HA 3BTIA 2X6YA 4B44A 1QPMA 1YW8A 1TW3A 4HYEA 3HHGA 2V1UA 3VDXA 3E6MA 5HLGA 4LK1F 3PNYA 3OIPA 2BXYA 3R60A 3QQAA 3S17J 3I58A 2NS8A 3DBHB 4EM0B 3GUDA 2HDWA 3BROA 1QQIA 2CO5A 2F5EA 2BVMA 4IRGA 3OYJA 4LB5A 4UXNA 1D1AA 3HPHA 4IF4A 3AKZA 1X3ZB 2DYSH 3OL3A 4S04A 3I4MJ 1AWCA 2EV5A 4NC7A 1BR1A 3RZOJ 1OR7C 3BG5A 3K70C 4D1QA 5LGNA 5DV5A 4FCYA 4GCVA 2HQ5A 3ZQIA 3CD6I 4B3AA 4NNJA 3LAJA 1GLNA 5KHDA 1LFUP 4H4KC 1UELB 4EJTA 5D5WB 3K0LA 4XKCA 3LSMA 3FIWA 2GLOA 4W97A 3K4CA 3D5RC 2Q2EB 1OCOH 3DKXA 2CW7A 3I5UA 3LSIA 4RB0A 1ZG5A 2ZCWA 2NVUB 3L7WA 2Y0SA 2VOPA 1WKMA 3JRGA 3L2UA 1ETOA 2IA2A 4QTRA 4JOMA 3BPXA 3TDZC 4TV7A 5A2QZ 2ESHA 3IRRA 3CMYA 3KYCB 1SAXA 3K4MA 3WG9A 3E97A 1OR7A 1E2XA 4OOIA 1W7PA 2DW4A 4FISA 5DD8A 4LG3A 3HBLA 3G2BA 2HI3A 4NHJA 2JA8J 2M0CA 4BJTA 3QYBA 2ZJ2A 4CCLA 2M45A 4OU0A 1TQIA 2IPQX 3QP5A 2PMZN 1UG0A 1B9MA 2KDOA 5KNLA 2NAZA 1IG7A 2G0EA 3FXOA 4XRSA 3WTWC 4LOCA 3U1KA 1B72A 2WC2A 2LF8A 3MN2A 2E35A 3QU3A 5L3EA 2RN7A 1E3OC 2XF7A 4PDKA 2D1VA 4E7SA 3FXQA 4XL9A 5LHIA 3VYSB 2M0MA 1UCRA 2MGQA 4ZTJA 1R00A 5GTHC 4A3IJ 3SFZA 2VBYA 2KIUA 1AA7A 1X2MA 2HZTA 4B1RA 3H92A 2NRAC 3R6SA 4UUSA 1U2WA 2STWA 3H1CA 5HOOA 2GQQA 3R4KA 2M7AA 1TC3C 2H6BA 3C2HA 2E5ZA 1SFEA 1QHHD 3CJNA 3GTPJ 4MTEA 2DMUA 4UHTA 3KP5A 3CO7C 1JHHA 2BYVE 4EM1A 1LKXA 1ORKA 2UV1A 2P4WA 3L1PA 2R7QA 3MWMA 4OINF 5K5QA 4RLQA 4AYBA 2V6CA 3HPGA 2CH0A 3BOQA 1QVTA 2BE5F 4B48A 5HNFA 5K5RA 3JREA 1XSDA 2VPLA 2P6TA 4CH7A 4DBRA 5F08A 1JKOC 4LG0B 4RGXA 4A3KJ 2NOGA 2I10A 3DLAA 1WFXA 2L4MA 1AU7A 2KISA 2IP2A 1JXSA 1FSHA 2CUEA 3ESWB 2A07F 2VN2A 2N8GA 5E17F 4BXXJ 1HF0A 3HKZA 1KYWA 3ZOBA 3BZCA 1UFMA 2RREA 2R7RA 4H0EA 4IQJA 5E1ZB 2JWTA 2XGEA 4HX8A 3FXMA 4I99C 1O3RA 3ABLH 1V3FA 1U0JA 1SVMA 3KZYA 3WHBA 2F5CA 4P9FA 3MCZA 2WWYA 1ZLJA 1XDSA 3IUOA 1S72I 2A5YB 3HDDA 2EFQA 5FD5A 1SD4A 4A3BJ 2B7EA 3E6BA 4YEJA 4AIKA 1IXSB 5E1XA 5J4VA 1FOWA 3RPUD 5LRSA 2VOOA 3LSPA 4S05A 3IRQA 2KMUA 1ZH5A 2DA6A 2NNNA 2CU7A 1D1BA 2KKOA 2HQNA 4XN0A 1DP7P 2IS2A 1QNTA 2VJ4A 2MLGA 1WVRA 2L5QA 2W82A 2CQ7A 2W57A 4N4NB 4XLPF 1VZ0A 1CQTA 2JSCA 3FKIJ 3N05A 3J7AY 4I2OA 4CCOA 2IA0A 1WWXA 4KT5C 2K4BA 2XPVA 4MEXF 1R1TA 3WG7H 4DYCA 2FNPA 5FRNA 2RGVA 4PJMA 1TNTA 1WCMJ 3U21A 1JUMA 4C3IJ 3KZZA 4L9TA 2Z5UA 1ULYA 2P81A 2L3DA 3MVPA 2LDUA 2MC3A 2KZGA 1MIJA 1V55H 4WF2A 4DOZA 4MO7A 3TBIA 4D9JA 2QYOA 4XLCA 4IZZA 4OAZA 2M9HA 2DPDA 3FISA 2ISZA 4E70A 4EJUA 5ICCA 4A5MA 5KK1A 2VXDA 5GAGJ 2HPMA 2LG4A 1LEAA 4HDVA 2ZJRF 2YX4A 1DUXC 3RKWA 4BE0A 1I5ZA 1TLHB 1UG2A 1XGOA 3BDDA 1ONVA 1IXCA 2VONA 1T95A 1G3TA 4U87A 3TW7A 2W84A 4HNUA 1G3WA 1MNEA 1QGPA 2JK3A 2GAUA 4PFPA 2ZXJA 2OQGA 3CUQB 2R7FA 2R7DA 3FBNB 2DYRH 2Y9YA 2BZTA 3B02A 5H6RA 2V4JC 1LVAA 4LGWA 5E3MA 2FXAA 3V7SA 3G4SI 1VQ4I 1H9GA 2HPIA 2P7VB 1SVLA 3ZQ7A 4DYQA 2X6XA 4XLHA 1I3QJ 2MC4A 2Q2EA 2K3FA 1IZ1A 1ZRFA 2O5RA 2LC2A 2K9NA 1M1EB 3I64A 2VIXA 3JRBA 2Y48A 4AIJA 1X1BA 2Y0SN 2HQRA 2RC4A 1FOYA 3ULQB 1GV5A 4ABZA 2PG4A 2LNBA 3E5XA 4E6KG 1BW6A 2D2WA 1ZK8A 3VODA 2PMHA 4CZCA 4J19A 1ZR2A 5EZGA 1KU7A 5LD2C 2OCCH 1E3PA 3SZPA 1IRZA 4UB6C 1SAUA 2FX0A 1TWFJ 2TCTA 1BJZA 4XRFA 5LRRA 4IO9F 5FLVA 3GTQJ 1X1PA 3OIOA 5FFXA 4I01A 2V79A 3FBIB 4M3BA 2E5NA 5B1BH 5JR3A 2XIGA 2QKLB 4EGYA 1IN8A 3JTGA 1O4XA 1J59A 4F7ZA 1CGPA 2L9SA 4ZDPA 4Q5SF 2BBYA 1ZR4A 3S1NJ 2EJRA 2EQRA 5E8IA 2H8RA 3QAHA 1XTAA 2VLAA 2LF7A 3GFLA 2XAQA 2EZHA 1SD7A 4F91B 4EV0A 4BBSJ 3A03A 1PUEE 1FIAA 1LFPA 1PUFB 1ETWA 3BZKA 4QPQA 4RB3C 5B66C 3MD2A 2F4MB 1FYMA 3S1QJ 2KIMA 2D1HA 1V4RA 4FX0A 4AD9A 1ZELA 4NUBA 4GDFA 2VPRA 2IS1A 1SMTA 3S15J 3BCAA 1JI8A 3PSIA 4D7MA 4DYRA 2VE8A 1X3UA 1OQYA 2XGXA 1MBFA 1REPC 5FKLA 3FHZA 1ZARA 1IC8A 4CDGA 5H6QA 2YUSA 2X9DA 4L5IA 1H0MA 2GOMA 4AYBN 5M5YJ 4KMFA 1BBYA 1G3SA 2LLKA 5IYDJ 1YLFA 5DM6F 1FWZA 3LSTA 4LG0A 1HKQA 4ETSA 3FXLA 3V8LA 2JA2A 3CJTB 1R4NB 4Y52J 3ZRGA 2XV4S 1TT0A 3RKYA 3Q0VA 4QIWN 2DOFA 4RB2C 4ASNA 4XLNF 1YX5A 3J7YJ 5CVVA 5D4RA 3D5SC 3C3WA 3AAFA 5CQGA 2KQRA 2NNYA 2NS0A 3HGYA 3FMSA 4M9ZA 5M5XJ 3SDGA 1EKEA 2CQKA 2RAEA 3PIOF 3OYFA 5LGTA 3M4OJ 3SYTA 2FNAA 4V2GA 1K4SA 3JAMZ 1Z7UA 1Z9CA 3HSFA 5FRMA 3GTJJ 4FHTA 2RQQA 2UWMA 1IRXA 3C2BA 3CCYA 1T6SA 2GXBA 3HB9A 1R4MB 2A68F 5IOZA 4ENMA 1HDDC 3KP3A 2DTRA 3HOVJ 1RI7A 2IGMA 1R23A 1IV6A 1YFHA 1Z0XA 2ACJA 2HOSA 3HXLA 1U9OA 4KYWA 1LEBA 5F6FA 1V5EA 2P7CB 3PO3J 4BBRJ 1C0WA 2HKXA 2BOLA 2MG4A 1SFXA 3R0AA 4NQWA 4F55A 4BY1J 4FQGA 2XUBA 2EZLA 3OY9A 1KQ0A 1CF7B 2ZKZA 3F21A 2HVSA 2XAFA 5C3EJ 3WU1B 1I6HJ 1D1CA 1MH4A 3F8NA 2VUMJ 2F5VA 3L2RA 5FLMJ 4KN4X 4F52A 1FZPB 5F1RA 1IN6A 3DCFA 2YPRA 2O7OA 3LFUA 3TKYA 1O3TA 4ZDOA 4A3FJ 1A6IA 2EBIA 4M74A 5L3CA 2ZXHA 3SDBA 2BY3A 4V19K 1HKTA 4HV6A 5JLXA 2Y2ZA 4M3GA 4RAFA 4LLGF 3M3YJ 2L4AA 2BY1A 2YU9J 4BU2A 2JRMA 1W1WE 1KU9A 3K69A 1RR7A 1S9HA 3GBGA 4HEA2 3MKYB 3CCRI 1AHDP 2PI0A 3B73A 3RSNA 3S16J 1Y56A 2ME6A 2FJ1A 4M6VA 2BY2A 1VNDA 5F0CA 1FYKA 1X4OA 5E3NA 3RDIA 3HTSB 3CUQA 4NDLA 1YJNI 1OYWA 3H36A 3LOCA 1BI2A 1VQ7I 1QO0D 5CVRA 2VKDA 2EZIA 4RAYA 3CLQA 4FE7A 4ZZDA 5EG0A 3K1MA 2V9PA 1QRYA 4CHUA 3TP0A 1MBKA 1LE8A 4BJ6C 4LK0F 2F48A 5J8FA 5B5EC 5GTIC 2BHZA 2O8XA 5AIQA 1LDJA 2XAHA 4G6TB 3RPQA 2VBXA 4JK1X 4ZYAA 5F27A 1SEUA 2JPBA 2VI6A 2DAOA 2JMWA 4LIUA 4MLOA 3GEZA 2K02A 1VQNI 3HRSA 4YIFA 2VQGA 3QWLA 4L9NA 3JAMK 3L09A 1WQ2A 4Q47A 1UHMA 5HDGA 3CQZJ 1MNDA 3OYMA 4MFEA 1FP2A 3KZIC 4L9VA 3DKWA 5LEKA 1A5JA 2CQQA 4G12A 3CDIA 1IF1A 1Z3XA 2LY9A 1FNNA 3L2CA 1BC8C 2GXAA 4LJZF 4HQEA 1WJCA 2RVCA 2LP0A 5E20A 1MJBA 1RZ4A 2XF6A 3RKXA 3SHFA 2VQLA 4AVPA 2VL8A 3FKJA 4ENJA 2QKMB 1YG2A 4BY7J 1XCBA 2C6YA 2GA2A 3GZ5A 2IBDA 1YTYA 1FMVA 1R5GA 1HSJA 2RKHA 2STTA 5LFAA 2CFOA 1QBJA 1VQOI 1S3JA 4B47A 3W6KB 4BKXA 3ZCOA 3HL2A 1P4WA 1PUFA 5EF6A 4IEJA 4RS8A 3P5JA 1Y0UA 1GHCA 3CO6C 3ERMA 2NXNB 2DFIA 4EMSA 4CZZA 3OV8A 3HM5A 3S93A 1Y6IA 5B1AH 4PK4A 1T56A 2LY1A 3ZR8X 3ZQCA 3CESA 1XN7A 5DEQA 2R7ZJ 2MLKA 1DU0A 2VC0A 5GAEJ 5D5XB 3REOA 3HOYJ 3H35A 1Z05A 1EF4A 3GTLJ 3J80Z 2QWWA 3F72A 2QENA 1VQ8I 1ZRCA 3BTJA 2DMNA 1QZEA 3GW2A 3S2DJ 3UR3C 2QZ8A 2X4HA 2YX7A 2XAJA 1MBJA 2P5KA 2AXTC 1MMNA 3K2ZA 2OD5A 3AG3H 1RNLA 1W0UA 2JZYA 1XG1A 1DQUA 1MJAA 3P9IA 5EZHA 4I6ZA 2FSWA 3DFGA 3M9AA 3RCOA 3NEUA 1JTXA 3Q0WA 2OQRA 1P2FA 1Z6RA 3E1SA 1XC5A 4G9YA 3GTKJ 1ODDA 4HLXA 1R1VA 1ZREA 3CMEI 1PP7U 3WHCA 2P6SA 1ITYA 5CJ9A 3OYAA 3OSGA 1Z6TA 2K4JA 2IA1A 3EUKL 3VYTB 2AXLA 5IP6A 2QSFX 5IPAA 5FB2A 3JTHA 1RESA 2XAGA 2L54A 2VKHA 1DPRA 3QYEA 2KRCA 4N9HA 3LNQA 4HX7A 1A35A 2HOEA 4A69C 1EH6A 2E7XA 4DQ2A 5KAIC 4ENKA 3ABMH 3JRHA 3ZQHA 1XGSA 2DA7A 4BACA 1O57A 1I6XA 1ZTRA 2DDAA 3W6VA 3DPUA 2ZFWA 3L00A 1RPWA 3DU6A 1CF7A 1IN7A 3HEFA 5JHFA 2LKXA 1Y1VJ 5HNHA 2PJRB 5EJCA 2X6OA 2KIFA 3MKLA 1BIBA 4C3HJ 1IXRC 2KRFA 1J75A 4GFBA 5CKTA 3K1NA 5GADJ 2O3FA 1P9QC 4UUVA 1G59A 2GOXB 3DQVC 2IGOA 5ED4A 4F3QA 5ICEA 3PUFA 3BR6A 4HLYA 2OC6A 1HKSA 3K1PA 1TZLA 1WH7A 2UXNA 5EDNA 5HS9A 3HTUA 4UUTA 3D1NI 3F23A 2OF7A 4HRIA 4DNCA 1B9NA 2XKPA 2IW5A 3ZXSA 2HKOA 3VSLA 3BWGA 2K27A 1VF9A 2DA3A 3F0CA 1BIAA 2E1OA 4IVNA 3D5LA 2CYYA 5J4YA 5C44J 2YR2A 4MEYF 3J80K 4HQMA 2OJED 2JPCA 2PN6A 3JRFA 3GCMA 2CFXA 3QU6A 3FWEA 2AO9A 1IAWA 1D8KA 3K7AJ 3VOEA 3GXOA 4AWXB 2OU2A 3S32A 4NC6A 2JTVA 1UHSA 2DDBA 2VKVA 2W1OA 5ICGA 1YHQI 4RGUA 2E1CA 2HXIA 3BR2A 3BG9A 2R7WA 2L9VA 3ZN1A 1E17A 1YIOA 2H6CA 3HOSA 4K2EA 1YW9A 3BCBA 3QYFA 5DM7F 1ZN2A 2DTZA 2Z3YA 1YOVB 3E0JB 5D8LB 2DA4A 4LB6B 1G3YA 1S7AA 1GT0C 2RNJA 3KX2A 1YJ9I 4G6QA 3V4GA 4RB1A 1TWGJ 4Y13A 4A2UA 3MFKA 5ICFA 1QZYA 2X48A 2O8KA 3A1YA 1KGSA 1HXDA 3J7ZI 4G7ZF 2UUZA 2XKOA 2M4GA 3BG7A 3DV8A 1JE8A 1TTYA 4YELA 5KCMA 1XGNA 3V8KA 5IOYA 4G94A 3TOBA 1KU3A 2EA4A 3S14J 4D0PA 1RR8C 2MABA 2JA6J 1KA8A 1W0TA 4XIDA 1FJLA 3IKTA 2Z2SB 1LB2A 2M5WA 2PQ8A 3VFZA 3VWBA 1NH3A 2HYGD 2ZJPF 4RMNA 4I02A 3IL2A 2MD0A 3LSGA 5CPRB 1E0EA 4M73A 3RYPA 3H0GJ 1DP3A 3RYRA 1BM9A 1SVOA 4KT6A 2EZKA 5EEHA 1P7JA 4DZPA 2QF7A 3I53A 4PJNA 3W3CA 4ITVA 5D6FA 1S7EA 3KYDB 1LDKB 3MZHA 2GM4A 4IXAA 3DF8A 1O7LA 3HZJA 4Z2YA 4AIHA 1R22A 5F04A 3K2AA 1Z7LA 3GTOJ 5BMZA 3QOPA 3SJMA 2W7NA 1ETVA 3G71I 1MKMA 2L02A 2NYXA 2WAQA 4ZYDA 2M8EA 5HVQC 2IRFG 3FMRA 2OTLI 1O7FA 1OCTC 2HS5A 2UZKA 4KMUX 5KVRA 2DFHA 2MBFA 2QEXI 1UZCA 3ZQGA 3K70D 2FQ3A 3MKWB 2Q1ZB 4M6YA 1W7PD 5HDNA 1OJLA 1JGSA 1ZRDA 1FMWA 3A01A 1BN5A 4R79A 1JHFA 4HF0A 5BS6A 2Y75A 3IC7A 3BJOA 4M9XA 3A4CA 4OMZA 2Q8KA 3GFMA 1BOBA 2XSDC 4P1WA 1D0YA 4ZC3A 2JJ7A 3E6DA 3KIOA 3PO2J 2R7SA 5AONA 2KJCA 2VBZA 2ELHA 2ZXWH 2ID3A 4X0GA 3WODF 2F4IA 3D0SA 4QWQA 1ON2A 4ESJA 1DU6A 3ZMUA 2QQ8A 3K4BA 1WH5A 2XF5A 4MNUA 2CQXA 1ENHA 3HRMA 4GXOA 3TO6A 4CICA 1TWAJ 2XDVA 4IHSA 2HTSA 1PJRA 1R7JA 5F0FA 3WTVC 2HOAA 1HW2A 1Z77A 2DOAA 2F4OB 3ERED 2ECCA 1ETQA 3CC4I 2XB5A 1MZBA 3HOZJ 4KDPA 4II3A 1SMYF 4XN3A 2EIKH 3WE3A 2A6EF 5JVTA 2O61A 4D5FA 2XB0X 4M3EA 4MQVA 1MW7A 4PGHA 4BAYA 1HDPA 4XQFA 4YFKF 1T98A 3K4KA 3TO9A 3NWSA 1G6NA 3G1LA 4LITA 1SANA 4IRIA 2CW0F 3RIRA 1GUUA 4IHWA 2GA1A 4A6DA 1W36D 3EUHC 4CUGA 2XHKA 4XM3A 4B4CA 2HNHA 4BHCA 3QP6A 1IJWC 2FBKA 3DBRB 4M3DA 2A6HF 2QVOA 3BQYA 3I54A 2HGCA 3ELKA 2OPTA 3C18A 3HOTA 2P0WA 3WGGA 2PJRA 5J1UA 1EV7A 4RGRA 2XRLA 4ZYHA 2VQCA 3LAPA 2VJIA 2LFBA 3M7GA 3I59B 1MBEA 1FIPA 4A3MJ 1FC3A 1WZ2A 1WI9A 2CJJA 2GIVA 2I8DA 2MFZA 1BA5A 1MMGA 5E3LA 2EIMH 4HX4A 4LD5A 2VQHA 4BNCA 1QHGA 5EGOB 1GXPA 2I5UA 5BNGA 4PCQA 1U5TB 3W2VA 1R5HA 4IL6C 1TQMA 4HSRA 3I71A 1JKPC 2Z1DA 2E60A 2R7XA 4P96A 2E2HJ 2K5CA 2FMLA 1N75A 5M5WJ 3IH2A 3IAM2 3CCQI 2R0QC 4XNFA 4HZFA 2TDXA 2ZSHB 4IHXA 6PAXA 1IO2A 1U78A 4CGZA 2Z16A 2RV8A 1XDUA 3P9CA 1UB9A 2R3SA 5HDKA 3UNGC 1B8IB 2G7UA 2MA3A 2XVCA 2ECBA 3U2RA 4WK8F 4BE1A 3BG6A 3DEWA 5CVJA 5FKKA 2E2JJ 1IN5A 3OIQA 2BW3B 2A3SA 3SQNA 4BEHB 4HNVA 5JHUA 1PVEA 1R5ID 1OISA 2MH2A 4L5JA 2DBBA 2PLYA 4KA4A 4HNTA 1D0ZA 1Z91A 4EJOA 4XKBA 4YFNF 3EYYA 3LA2A 5ILVA 2DFFA 3ZQLA 1R9TJ 3BP8A 2V1XA 1YQAA 4M3FA 1RRJA 2BVLA 4HF1A 5GPCA 4I0BA 3B6CA 3JRCA 2XRNA 3AG1H 4EQQA 5D5VB 4C30A 4IPAA 2DA1A 4MIMA 3IHUA 4HV5A 3S2WA 5J6XA 4BE2A 5F0HA 4ENNA 2GXGA 4G8XA 4LLLA 3DPLC 4UVAA 4AIDA 3NARA 2M30A 3R61A 3ZQQA 3S2HJ 1G4DA 3WTUC 4F92B 1MMDA 5E18F 2HU9A 2PEXA 1WSUA 4I76A 2FOWA 1FT9A 2MH9A 3GWZA 2MD5A 1Y0NA 4UB8C 2VJJA 2ESNA 3CCLI 3IWFA 4BQQA 2XASA 1JUSA 2CMPA 4A6EA 1F9NA 5EEAA 2ZSIB 3QPLA 3MKZA 3WGHA 3CCJI 2VXZA 1Y8RB 3ISPA 1K7AA 1YITI 3ASOH 3KEOA 3RQIA 2K3PA 3IWZA 2IT0A 4IX7A 4BHPA 2OBPA 2X1EA 2ZC2A 3HKZN 4I7HA 3H5NA 3I56I 4O3MA 2QQBA 5H2FC 4KFCA 2WAQN 3OSFA 3I4PA 2WV1A 2AQEA 3O2PE 2H94A 2JUCA 5J8CA 1X1AA 2K9MA 3CJRB 2QQAA 4ZYEA 2YSRA 2JVGA 2EINH 2L9NA 4IQ4A 2NVYJ 3AG4H 2ZBKA 1ZAOA 5AIPA 2L9RA 3F6VA 3H3ZA 1JT0A 2MW8A 2X6WA 1AKHB 2LD5A 3E5QA 3T8TA 1LNWA 4A0ZA 2HXOA 2CWEA 3DP7A 3PFIA 2EK5A 1W5SA 5B3SH 2XC7A 2H09A 3PSFA 2JQ7A 4RBOA 2O9LA 2E1MB 3BR3A 1X1DA 5C4JJ 3HSRA 4ZYGA 2R92J 1KONA 3PQKA 2FF4A 3ABUA 1MMSA 5K7ZA 3VB2A 2R93J 2XGDA 3VYUB 5M3MJ 3OYCA 3CC2I 2QQ9A 1OCPA 4A3JJ 1TWHJ 5J1YA 4DBQA 1NK2P 2KHMA 2M2EA 1S29A 3Q5FA 4G7OF 9ANTA 4XKWA 2DT5A 3MZ8A 1G8XA 4EJVA 2VE9A 2EILH 3MEXA 3S3NA 1KQ9A 3V42A 4ZTFA 5FKMA 1ZKGA 2FMYA 1IUFA 3K4LA 3GX4X 1VTNC 4HSTA 5TJJA 4EVIA 3PNTA 4QPOA 4EJWA 3S1RJ 1K78B 2DODA 1A36A 2ZNZA 3VSKA 4ESFA 2Y30A 2LRDA 1U5TC 2LREA 2VC1A 4JP0A 3CCSI 3Q9SA 1K6YA 1LJ9A 4R8HA 3BG3A 2ZJQF 4XMYA 5KAFC 3LFKA 2PFBA 4UY8I 3CF2A 2LYCA 3IKVA 4U0YA 2XROA 4CYCB 3EYIA 4UV9A 4KIBA 4N9IA 3QPHA 3OMYA 2GZWA 5HLHA 3TMOA 4P9UA 1YYVA 2QCOA 3GZNB 4O5VA 3L2WA 5D5UB 3BZ6A 3OR2C 1WPKA 5F64A 4A3LJ 3I59A 3LA7A 3OYIA 1Y39A 3E5UA 4D7NA 1K61A 5TRDA 4PZJA 4EM2A 2B0LA 5EEGA 1JKRC 3K9TA 5ERIA 2V1NA 2NVXJ 3NAUA 2CUFA 1U8RA 3SFIA 2PBIA 3T1BA 2OUMA 2JRTA 3L9FA 2COBA 3LA3A 3KYLA 1Q1VA 3PQJA 4BQAA 5M3FJ 2PJPA 1OKRA 1MD0A 3SZGA 1B72B 3BJ6A 2IXSA 5C4XJ 3KP4A 3L2VA 1H88C 1JTYA 3F9KA 3TW6A 5DUKA 4XK4A 4L0YB 3SXYA 4OAYA 5DDGA 3A0BC 1B8IA 3RQ4A 2G7HA 4MQ9F 2XGCA 1N77A 2YU3A 1WI3A 2CRGA 2Q0OA 4YG2F 3PL8A 4S0HB 1T39A 4O6JA 1MH3A 2BW3A 4AU7A 4BEHA 5BPIA 2UXXA 1SC7A 1HBXG 5EYRA 3W6JB 1FSEA 3WTYC 2IGNA 3EDPA 3HC7A 1MJ9A 1P7IA 2BEOA 1R71A 3GFJA 3KPHA 3OWTA 3PNVA 3F3XA 5L3BA 1OPCA 1POGA 2PMUA 1GVJA 2X51A 2GBYA 4PUSA 4NC8A 2E2IJ 5IT3A 3IH4A 4CCJA 2JUGA 2K85A 2LY2A 3NRVA 4CO8A 1QVUA 2X0LA 1D5VA 1S7OA 3H5RA 3FM5A 3GLLA 1TW2A 1KQ8A 2VASA 1JGGA 1EJ9A 1I39A 1X19A 1YX3A 3GF2A 2DPUA 2LH9A 3I55I 4N0BA 3E7LA 1WJFA 2CG4A 4EATA 3GFIA 4C2UA 4KISA 1V5FA 4OIPF 4C9YA 3IAS2 3X2QH 5GP9A 3CDLA 2LK2A 4KITB 1VFCA 2O0YA 2FBHA 2FRHA 4HW0A 3CMMA 2WB1A 3E6CC 2DJIA 1J7KA 5H20A 2E1MC 2IGKA 3KP7A 2DN0A 1YE9A 2DT7B 2COMA 1BI3A 1RKTA 2X85A 4PJJA 1MSFC 3SEQA 3RKQA 1L3LA 1B59A 4J01A 4IOCF 4JBAA 2DA2A 3BC8A 5FKNA 4CA0A 2L7MP 5L3FA 1ZGWA 3ZP5A 1HCRA 3T8RA 4KJZA 3ROUA 2P5VA 3H3VK 1AKHA 2EFPA 4ON0A 2R7OA 4RM2A 2FD5A 3DBLB 1X3WB 3BTCA 1AOYA 4BHBA 2QSHX 2GIZA 3W2AA 2FU4A 1GXQA 1BR4A 3R0JA 2R7UA 3JSPA 3N97A 4L0ZB 2R4GA 5TGTA 2QSGX 4A0XA 3HGGA 1B1BA 1OYIA 2DMTA 3F8CA 1VQLI 1O3SA 1FP1D 2L7KA 4BYYA 2A6TA 3M07A 3TP3A 3CCVI 2ICWG 4P5OA 2E34A 2FQ4A 1MDMB 4A3EJ 4KIGA 3WTZA 2CUJA 2LR8A 3Q0UA 1D3YA 2XSJC 4AM3A 2DQRA 4YFXF 1WJBA 2R7VA 5FLXZ 2M87A 4XBFA 4M6XA 2QA4I 3EETA 1WJEA 3DU5A 2M1BA 2D5VA 2HTJA 1XB4A 3FDYA 3O8HA 1D5YA 1PDNC 3FXRA 4DGWB 5DUIA 2IS6A 3NQOA 1RC9A 4A0YA 4PSWA 4WCGA 2BY0A 4E4HA 2WY8Q 2Z9OA 4C3JJ 1OMIA 2VT2A 1R58A 1K78A 3RI4A 2XPWA 3VPRA 4YIIA 4C2MJ 5IY5H 1Y1WJ 2CGPA 3H9GA 2DK8A 3GMEA 3A2KA 4XR6A 1W5CC 3QODA 2J5OA 3H0DA 1DGRM 2KFDA 4QLCU 3M1EA 3RZDJ 1P4AA 2HWVA 3S1MJ 4XKVA 2P8TA 4CYCA 1O3QA 1ZQ3P 3LSRA 3OS0A 2ZB9A 2H1KA 5HLTA 1LUJB 4OMYA 2F5DA 3GLXA 2W00A 2HFHA 5JLWA 2WV0A 2K9LA 3BR5A 1W5TA 4J00A 5HS7A 3FXUA 5JFRA 2A69F 3I3LA 3HUGB 3GVAA 4A93J 4WWCA 3BR1A 2WAFA 2KDZA 1FOKA 3M8JA 2ZMEB 4Q48A 5IT9Z 1FBUA 4IOAF 1IUYA 4BS9A 1OYYA 1RETA 3RPUA 3OYLA 4FTHA 1ZGJA 3HOWJ 1EH8A 2TRTA 3ABKH 1MMAA 4PGGA 1FEXA 5IYCJ 2B63J 2E19A 4Q4ZF 1YS6A 3F8MA 4Y4RA 3TL4X 5J3LA 1ZHFA 3AFHA 3ZPLA 1WRJA 4LMYA 3OYBA 2W85A 2WA0A 4AVZA 1Z67A 1W36C 1BL0A 2YS9A 1H9TA 1X1CA 3VEPA 3IP4B 2ZXIA 1APLC 1Z21A 3M8FA 5J40A 2LSOA 1BOAA 5E8GA 3ZN0A 4YRVA 1WJ5A 2LKPA 3C7JA 2RQPA 2OZ6A 1RIOH 4MGRA 2ID6A 2Y9ZA 1HQCA 2KL4A 3B6AA 2KZVA 1D8JA 2K9SA 2QGUA 4ESBA 5L3DA 3OR1C 3OL4A 3G1MA 2VKEA 1GVDA 2ISYA 3QOEA 2Z33A 1T38A 4KIFA 1VQKI 2ELJA 5FLXK 5DD4A 4B3XA 3HYIA 4OWRB 3FXKA 3JCUC 3FHNA 3ASNH 1FBQA 4G6DA 1WJDA 3F8BA 4U7DA 1LVKA 2OCEA 5J1RA 1FPQA 3FK7A 1LQ1A 1K83J 1OCRH 3G1OA 4NB5A 4E7ZA 1IDYA 3K6GA 5HODA 2P5LC 5BPDA 4B09A 1XPXA 2B9SA 4C2TA 1T08B 5IYBJ 2R5YB 4W1UA 1BJAA 2LTPA 3S3MA 3RTRA 2IS4A 4Y33A 3DTEA 2LBFB 3AG2H 1J2XA 1SFKA 2DCEA 4FT8A 1TWCJ 4RAGA 1J09A 4UVCA 2EFWA 4IHTA 4OIOF 1TL8A 3OOPA 4I0AA 2E1NA 3SZTA 4LLNA 5FFZA 2DT6A 2CSOA 2FUG2 3DWLE 1EH7A 3J81Z 2HYJA 4GGGA 3FMQA 4NBQA 3LWFA 4Y17A 5LLQA 1U6GA 3H3UA 3WU0A 2CV1A 3S8PA 4BQNA 1VQ6I 2JA7J 3NWTA 5GAHJ 2WB1N 4L9JA 2XPUA 1J0RA 4HG2A 4Z6YA 1MNMC 3KLNA 1EA3A 3A0HC 4RDUA 2WY7Q 2Y31A 1ETYA 5A2QK 4M9SA 4DZJA 2BGCA 1LDDA 2EV6A 4Y15A 5CYVA 3CZ6A 1A04A 2MSYA 1HSTA 2JT1A 1X58A 4BXFA 1Q1HA 2VODA 1T2KA 4XOTA 2RDPA 3GO5A 5FO5A 5IT9K 3ZMVA 3HJEA 3BQZA 3F8FA 4JYKA 4XRMA 1TBXA 5ILSA 4RGSA 2WBMA 3CJQB 4MFDA 1TQPA 3MQ0A 4A5NA 2HDDA 5JVGF 1OLTA 3EUAA 3FX3A 4NQWB 2AHQA 3OOUA 5BOXA 3PUBA 2EA2A 4RA2A 3LQQA 1ETKA 2R7TA 1DGWY 4BL0B 3LSJA 3T0YA 2HOTA 5L3GA 1VQ5I 1XS9A 3I0TA 1R6RA 1JKQC 5DCMB 5E3OA
chains in the Genus database with same CATH topology
1S8NA 3U9GA 3WE2A 3KP2A 2QBYB 3BY6A 1MDMA 1I27A 3CDHA 3P7NA 3ZMZA 1FBSA 4UVBA 3KEQA 4IRHA 4CYDA 3C1DA 5FGMA 1BC7C 3COAC 4EGZA 3TDUC 3ECHA 3FM3A 3M8EA 1F1ZA 1K79A 1RUNA 3CLOA 3ECOA 1XMKA 3N4MA 3EUHA 2OA4A 5K5OA 1K6OA 4WXCA 3T5XA 1ZG3A 3Q9VA 4KN7X 1HW1A 2FA5A 3ZMSA 3WTSC 1USSA 3J81K 1Z1DA 4R1HA 1BI0A 5LEJA 3V7RA 3TGNA 2FBIA 2HYFA 5D4SA 1I1SA 2Z99A 3HUGA 1YW7A 3ABTA 1TNSA 2FEZA 2ZMEA 3HHHA 4KICA 3DEUA 1XD7A 5DYMA 5K1YA 1MGTA 3MZYA 2W24A 3ZMDA 3HSEA 5HLIA 1SFUA 2ETHA 1P4XA 2IVMA 3KFWX 1P92A 3TOAA 4U88A 5ILUA 1IRFA 3WGIA 3G3ZA 1W4MA 3ML6A 5DCFA 2EV0A 3KLOA 1FY7A 3O3KA 2EFNA 4HDUA 5CVUA 5LHGA 2F2EA 3J7AO 3EQLF 1ZG1A 2H27A 2EB7A 1DPUA 1ON1A 2KJBA 3QPTA 5LHHA 1L0OC 2VT3A 4BH9A 3WTXC 4WXHA 2J5PA 4U0WA 2WTEA 1SD5A 3V7CA 2OAZA 3P9KA 1J9IA 2IJLA 4WXDA 3HRUA 1ZGAA 2DU9A 4L18B 2DI3A 4MHGA 1IN4A 4ZZLA 5LBQA 5CVIA 2FOKA 4UNOA 2O03A 1P6RA 4HF2A 4GO1A 4GYGA 4IJAA 1R36A 2A61A 2EWNA 4U7BA 2HR3A 4M71A 3JSOA 4FX4A 1B6AA 1YS7A 2D45A 1F4KA 4A12A 3TO7A 3RJPA 2ZNYA 4OIRF 3G73A 5D8KB 2OZUA 4BXUA 3CUQC 5DCMA 5HS8A 3CTAA 3HIFA 1PP8F 2QBYA 3FF5A 3E3VA 2ADUA 4LFUA 2V1DA 2AS5F 5CLSA 2HEOA 3GYHX 4KNYA 1XSXA 1ZLKA 1T0FA 2FE3A 3GZ6A 2K86A 2EFOA 2HDCA 1FYLA 1IRGA 1W7PB 3FZVA 1XSVA 4CXFA 1U5TA 3KE2A 2L01A 4HBLA 4HAMA 3QRFF 1S6LA 5BQTA 2O6GE 4XSZF 2E7WA 5E1WA 5FD6A 1I1GA 4P55A 3MAJA 1KYZA 1UHWA 4JQFA 4XSXF 2DLLA 4GYIA 3WTTC 2DO7A 3TQNA 3DXJF 4B8XA 1STZA 3DPTA 1U3EM 3U1DA 1XCVA 1XMAA 2ZO4A 1R1UA 2GWRA 3O6BB 2DQLA 3LQRA 1QZZA 3KETA 1USTA 1J5YA 1B4AA 3F6OA 4ZH4F 3KP6A 1FX7A 1KU2A 4HA8A 1SD6A 4U0VA 2F5FA 1F5TA 5JI6A 4KUMA 4WX9A 1YO5C 2BV6A 4OIQF 1XGMA 4RAZA 3HRTA 3ZMTA 4G7HF 1IW7F 2V9VA 2G9WA 1BI1A 5D6EA 4M72A 1DDNA 3KCCA 3BJAA 3JW4A 3CUOA 4HOBA 4I09A 2VBWA 5LGUA 1FLIA 2QUFA 1ZYRF 3BPVA 3V8JA 1NHAA 2Y0MA 2QM3A 1HW5A 4MTDA 2QLZA 4UV8A 4I98B 2W25A 1RUOA 3F22A 2K7LA 2DK5A 1QPMA 1YW8A 1TW3A 4HYEA 3HHGA 2V1UA 3E6MA 5HLGA 4LK1F 3R60A 3I58A 4EM0B 3GUDA 3BROA 1QQIA 2CO5A 2F5EA 4IRGA 4LB5A 4UXNA 4IF4A 4S04A 1AWCA 2EV5A 5LGNA 5DV5A 4GCVA 3LAJA 4EJTA 5D5WB 3K0LA 3I5UA 4RB0A 1ZG5A 2ZCWA 3L7WA 2VOPA 1WKMA 2IA2A 3BPXA 3TDZC 4TV7A 5A2QZ 2ESHA 3IRRA 1SAXA 3WG9A 3E97A 1OR7A 1E2XA 4OOIA 1W7PA 2DW4A 5DD8A 4NHJA 2ZJ2A 2M45A 4OU0A 1TQIA 2IPQX 3QP5A 1B9MA 2NAZA 3WTWC 2WC2A 2LF8A 3QU3A 5L3EA 2RN7A 4PDKA 2D1VA 5LHIA 3FXQA 1UCRA 1R00A 3SFZA 2VBYA 2KIUA 2HZTA 3H92A 2NRAC 3R6SA 1U2WA 2STWA 5HOOA 2GQQA 3R4KA 2H6BA 1SFEA 3CJNA 4MTEA 4UHTA 3KP5A 3CO7C 1JHHA 2BYVE 4EM1A 2P4WA 3MWMA 4OINF 5K5QA 2V6CA 3BOQA 5K5RA 2BE5F 1XSDA 2P6TA 4LG0B 4RGXA 2L4MA 2IP2A 1JXSA 1FSHA 2A07F 2VN2A 5E17F 1KYWA 1UFMA 4H0EA 5E1ZB 4HX8A 1O3RA 1V3FA 3KZYA 2F5CA 4P9FA 3MCZA 2WWYA 1ZLJA 1XDSA 2A5YB 2EFQA 5FD5A 1SD4A 3E6BA 4AIKA 1IXSB 5E1XA 5LRSA 2VOOA 4S05A 3IRQA 1ZH5A 2NNNA 2KKOA 2HQNA 1DP7P 1QNTA 2MLGA 2W57A 4XLPF 2JSCA 4I2OA 2IA0A 1WWXA 4KT5C 2K4BA 4MEXF 1R1TA 2FNPA 2RGVA 1TNTA 3KZZA 4L9TA 2Z5UA 1ULYA 2L3DA 2LDUA 2MC3A 4WF2A 2QYOA 2DPDA 2ISZA 4E70A 4EJUA 5ICCA 4A5MA 5KK1A 1LEAA 4HDVA 2YX4A 1DUXC 3RKWA 1I5ZA 1TLHB 1XGOA 3BDDA 1ONVA 1IXCA 2VONA 1G3TA 2W84A 1G3WA 1QGPA 2GAUA 2ZXJA 2OQGA 3CUQB 2R7FA 2R7DA 3B02A 5H6RA 1LVAA 4LGWA 2FXAA 3V7SA 1H9GA 2P7VB 3ZQ7A 2Q2EA 1IZ1A 1ZRFA 3I64A 2Y48A 4AIJA 2HQRA 2RC4A 3ULQB 2PG4A 2LNBA 3E5XA 2D2WA 3VODA 1KU7A 2PMHA 3SZPA 4XRFA 5LRRA 5FFXA 4I01A 2V79A 5JR3A 2XIGA 4EGYA 1IN8A 3JTGA 1J59A 4F7ZA 1CGPA 4Q5SF 2BBYA 2EJRA 5E8IA 3QAHA 2LF7A 3GFLA 2XAQA 1SD7A 4EV0A 1PUEE 4RB3C 1FYMA 2KIMA 2D1HA 1V4RA 4FX0A 4AD9A 1SMTA 2VE8A 1X3UA 2XGXA 1REPC 3FHZA 1ZARA 4CDGA 5H6QA 4L5IA 1H0MA 4KMFA 1BBYA 1G3SA 1YLFA 1FWZA 3LSTA 4LG0A 1HKQA 4ETSA 3V8LA 2XV4S 3RKYA 4RB2C 4ASNA 4XLNF 5CVVA 5D4RA 3C3WA 3AAFA 2NNYA 2NS0A 3FMSA 4M9ZA 2CQKA 5LGTA 2FNAA 3JAMZ 1Z7UA 1Z9CA 3HSFA 4FHTA 2UWMA 1T6SA 2GXBA 2A68F 4ENMA 3KP3A 2DTRA 1RI7A 1R23A 1YFHA 2ACJA 4KYWA 1LEBA 5F6FA 2P7CB 1C0WA 2HKXA 1SFXA 3R0AA 4NQWA 2XUBA 1KQ0A 1CF7B 2ZKZA 3F21A 2XAFA 3WU1B 3F8NA 4KN4X 1FZPB 5F1RA 1IN6A 2YPRA 3TKYA 1O3TA 4M74A 5L3CA 1HKTA 4HV6A 4LLGF 2L4AA 1KU9A 3K69A 2PI0A 3B73A 1FYKA 3HTSB 3RDIA 3CUQA 1OYWA 1BI2A 1QO0D 5CVRA 4RAYA 4ZZDA 3K1MA 4CHUA 4LK0F 5J8FA 2O8XA 5AIQA 1LDJA 2XAHA 3RPQA 2VBXA 4JK1X 2JPBA 2DAOA 3GEZA 2K02A 3HRSA 4YIFA 3JAMK 4L9NA 3L09A 1WQ2A 4Q47A 1UHMA 5HDGA 1FP2A 4L9VA 3DKWA 5LEKA 1IF1A 1FNNA 3L2CA 1BC8C 4LJZF 4HQEA 2RVCA 5E20A 1MJBA 1RZ4A 3RKXA 3SHFA 4AVPA 4ENJA 1YG2A 1XCBA 2C6YA 2GA2A 3GZ5A 1YTYA 1R5GA 1HSJA 2RKHA 2STTA 1QBJA 1S3JA 3W6KB 1P4WA 4RS8A 1Y0UA 1GHCA 3CO6C 2DFIA 4EMSA 4CZZA 3OV8A 1XN7A 5DEQA 2MLKA 2VC0A 5D5XB 3REOA 1Z05A 3J80Z 2QWWA 3F72A 2QENA 1ZRCA 3GW2A 2QZ8A 2X4HA 2YX7A 2XAJA 2P5KA 3K2ZA 2OD5A 1RNLA 2JZYA 1MJAA 3P9IA 2FSWA 3DFGA 3M9AA 3NEUA 2OQRA 1P2FA 1Z6RA 4G9YA 1ODDA 4HLXA 1R1VA 1ZREA 1PP7U 2P6SA 5CJ9A 1Z6TA 2K4JA 2IA1A 2AXLA 5FB2A 3JTHA 2XAGA 2L54A 1DPRA 4N9HA 4HX7A 2HOEA 1EH6A 2E7XA 4DQ2A 4ENKA 1XGSA 1O57A 1I6XA 2ZFWA 3L00A 1CF7A 1IN7A 2KIFA 1BIBA 1IXRC 2KRFA 1J75A 3K1NA 4UUVA 2O3FA 3DQVC 5ED4A 5ICEA 4HLYA 1HKSA 3K1PA 2UXNA 5HS9A 3HTUA 3F23A 4DNCA 1B9NA 2XKPA 2IW5A 2HKOA 3BWGA 2K27A 1BIAA 4IVNA 3D5LA 2CYYA 2YR2A 4MEYF 3J80K 4HQMA 2JPCA 2PN6A 2CFXA 3QU6A 3FWEA 1IAWA 1D8KA 3VOEA 4AWXB 3GXOA 2OU2A 2JTVA 5ICGA 4RGUA 2E1CA 3ZN1A 1E17A 1YIOA 2H6CA 3HOSA 4K2EA 1YW9A 1ZN2A 2Z3YA 5D8LB 4LB6B 1G3YA 1S7AA 2RNJA 4G6QA 3V4GA 4RB1A 4Y13A 4A2UA 3MFKA 5ICFA 1QZYA 1KGSA 1HXDA 4G7ZF 2XKOA 3DV8A 1JE8A 1TTYA 1XGNA 3V8KA 4G94A 3TOBA 1KU3A 2EA4A 4D0PA 1KA8A 3IKTA 1LB2A 2M5WA 2PQ8A 3VFZA 2HYGD 4I02A 3IL2A 4M73A 3RYPA 3RYRA 1BM9A 5EEHA 3I53A 5D6FA 1LDKB 3MZHA 4IXAA 3DF8A 1O7LA 4Z2YA 4AIHA 1R22A 5BMZA 3QOPA 1MKMA 2L02A 2NYXA 4ZYDA 2M8EA 5HVQC 2IRFG 3FMRA 1O7FA 2HS5A 2UZKA 4KMUX 5KVRA 2MBFA 2FQ3A 4M6YA 1W7PD 5HDNA 1ZRDA 1JGSA 1BN5A 4R79A 1JHFA 4HF0A 5BS6A 2Y75A 3IC7A 3BJOA 4M9XA 4OMZA 2Q8KA 3GFMA 3E6DA 5AONA 2KJCA 2VBZA 2ELHA 3WODF 4QWQA 3D0SA 1ON2A 4ESJA 3ZMUA 4MNUA 3HRMA 4GXOA 3TO6A 4CICA 4IHSA 2HTSA 1R7JA 3WTVC 1HW2A 3ERED 1MZBA 4KDPA 1SMYF 3WE3A 2A6EF 5JVTA 2O61A 4MQVA 4PGHA 4BAYA 4YFKF 1T98A 3TO9A 1G6NA 4IRIA 2CW0F 3RIRA 2GA1A 4A6DA 2XHKA 4BHCA 3QP6A 2FBKA 2A6HF 2QVOA 3I54A 2HGCA 3ELKA 3C18A 3HOTA 3WGGA 1EV7A 4RGRA 4ZYHA 3LAPA 3M7GA 3I59B 1FC3A 1WI9A 2GIVA 4HX4A 4LD5A 4BNCA 1GXPA 4PCQA 1U5TB 1R5HA 1TQMA 3I71A 4P96A 2FMLA 4HZFA 2TDXA 6PAXA 1U78A 4CGZA 2RV8A 1XDUA 3P9CA 1UB9A 2R3SA 5HDKA 2G7UA 2MA3A 2XVCA 4WK8F 3U2RA 5CVJA 1IN5A 2A3SA 3SQNA 5JHUA 2MH2A 2PLYA 4L5JA 2DBBA 4KA4A 1Z91A 4EJOA 4YFNF 3EYYA 3LA2A 5ILVA 3BP8A 2V1XA 1YQAA 4HF1A 4I0BA 2XRNA 5D5VB 4EQQA 4IPAA 3IHUA 4HV5A 3S2WA 5J6XA 4ENNA 2GXGA 4G8XA 4LLLA 3DPLC 4UVAA 2M30A 3R61A 1G4DA 3WTUC 5E18F 2PEXA 1WSUA 3GWZA 1FT9A 2MH9A 2MD5A 2ESNA 3IWFA 2XASA 4A6EA 1F9NA 3WGHA 2VXZA 3ISPA 1K7AA 3KEOA 3IWZA 2IT0A 4BHPA 2OBPA 4I7HA 4O3MA 2QQBA 4KFCA 3I4PA 3O2PE 2H94A 5J8CA 2QQAA 4ZYEA 2YSRA 2ZBKA 1ZAOA 5AIPA 3F6VA 3H3ZA 3E5QA 3T8TA 1LNWA 4A0ZA 2CWEA 3DP7A 3PFIA 2EK5A 1W5SA 2H09A 3HSRA 4ZYGA 3PQKA 2FF4A 3ABUA 3VB2A 2QQ9A 1S29A 3Q5FA 4G7OF 2DT5A 4EJVA 2VE9A 3MEXA 1KQ9A 2FMYA 3GX4X 1VTNC 5TJJA 4EVIA 4EJWA 1K78B 2ZNZA 4ESFA 2VC1A 1U5TC 3Q9SA 1LJ9A 4R8HA 3LFKA 2PFBA 4U0YA 3IKVA 2XROA 3EYIA 4UV9A 4KIBA 4N9IA 3QPHA 2GZWA 5HLHA 4P9UA 1YYVA 4O5VA 5D5UB 3BZ6A 5F64A 3I59A 3LA7A 3E5UA 5TRDA 4PZJA 4EM2A 2B0LA 5EEGA 3K9TA 5ERIA 1U8RA 2PBIA 3T1BA 2JRTA 3L9FA 3LA3A 3PQJA 4BQAA 2PJPA 1OKRA 1MD0A 3BJ6A 3KP4A 5DUKA 4L0YB 3SXYA 5DDGA 2G7HA 4MQ9F 2YU3A 4YG2F 2Q0OA 1T39A 4O6JA 5BPIA 2UXXA 1HBXG 3W6JB 1FSEA 3WTYC 3EDPA 1MJ9A 2BEOA 3GFJA 3F3XA 5L3BA 1OPCA 2PMUA 1GVJA 5IT3A 3NRVA 4CO8A 2X0LA 1D5VA 1S7OA 3FM5A 1TW2A 1KQ8A 3GF2A 2DPUA 4N0BA 2CG4A 3GFIA 4OIPF 2O0YA 2FBHA 2FRHA 4HW0A 3E6CC 1J7KA 5H20A 3KP7A 2COMA 1BI3A 1L3LA 1B59A 4JBAA 5L3FA 3ZP5A 3T8RA 3ROUA 2P5VA 2EFPA 4ON0A 1AOYA 4BHBA 2FU4A 1GXQA 3R0JA 3JSPA 3N97A 4L0ZB 4A0XA 1B1BA 1OYIA 3F8CA 1O3SA 1FP1D 4BYYA 4P5OA 1MDMB 4KIGA 3WTZA 1D3YA 2DQRA 4YFXF 5FLXZ 2M87A 4XBFA 4M6XA 3EETA 2M1BA 2HTJA 1XB4A 1PDNC 3FXRA 5DUIA 3NQOA 4A0YA 4WCGA 2Z9OA 1OMIA 2VT2A 1R58A 1K78A 3RI4A 4YIIA 2CGPA 2DK8A 2J5OA 4QLCU 3M1EA 1P4AA 2HWVA 2P8TA 1O3QA 4OMYA 2F5DA 3GLXA 2HFHA 2WV0A 1W5TA 5HS7A 3FXUA 5JFRA 2A69F 3GVAA 4WWCA 1FOKA 2ZMEB 4Q48A 5IT9Z 1FBUA 1IUYA 1OYYA 3RPUA 1ZGJA 1EH8A 4PGGA 4Q4ZF 1YS6A 3F8MA 1ZHFA 3ZPLA 1WRJA 4LMYA 2W85A 1H9TA 3VEPA 3M8FA 2LSOA 1BOAA 5E8GA 3ZN0A 2LKPA 3C7JA 2RQPA 2OZ6A 1RIOH 4MGRA 1HQCA 1D8JA 4ESBA 5L3DA 2ISYA 2Z33A 1T38A 4KIFA 5FLXK 5DD4A 3HYIA 1FBQA 4G6DA 3F8BA 4U7DA 1FPQA 1LQ1A 4NB5A 5BPDA 2P5LC 4B09A 1BJAA 3RTRA 1J2XA 4FT8A 4UVCA 2EFWA 4IHTA 4OIOF 3OOPA 4I0AA 2E1NA 3SZTA 4LLNA 5FFZA 2CSOA 3J81Z 1EH7A 4GGGA 3FMQA 3LWFA 4Y17A 5LLQA 1U6GA 3H3UA 3WU0A 4L9JA 1J0RA 3KLNA 5A2QK 4M9SA 2BGCA 1LDDA 2EV6A 4Y15A 5CYVA 1A04A 1HSTA 2JT1A 1Q1HA 2VODA 1T2KA 2RDPA 3GO5A 5FO5A 5IT9K 3ZMVA 3F8FA 1TBXA 5ILSA 4RGSA 1TQPA 3MQ0A 4A5NA 3FX3A 5BOXA 2EA2A 3LQQA 3T0YA 5L3GA 3I0TA 5DCMB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1S8N A;  3U9G A;  3WE2 A;  3KP2 A;  2QBY B;  3BY6 A;  1MDM A;  1I27 A;  3CDH A;  3P7N A;  3ZMZ A;  1FBS A;  4UVB A;  3KEQ A;  4IRH A;  4CYD A;  3C1D A;  5FGM A;  1BC7 C;  3COA C;  4EGZ A;  3TDU C;  3ECH A;  3FM3 A;  3M8E A;  1F1Z A;  1K79 A;  1RUN A;  3CLO A;  3ECO A;  1XMK A;  3N4M A;  3EUH A;  2OA4 A;  5K5O A;  1K6O A;  4WXC A;  3T5X A;  1ZG3 A;  3Q9V A;  4KN7 X;  1HW1 A;  2FA5 A;  3ZMS A;  3WTS C;  1USS A;  3J81 K;  1Z1D A;  4R1H A;  1BI0 A;  5LEJ A;  3V7R A;  3TGN A;  2FBI A;  2HYF A;  5D4S A;  1I1S A;  2Z99 A;  3HUG A;  1YW7 A;  3ABT A;  1TNS A;  2FEZ A;  2ZME A;  3HHH A;  4KIC A;  3DEU A;  1XD7 A;  5DYM A;  5K1Y A;  1MGT A;  3MZY A;  2W24 A;  3ZMD A;  3HSE A;  5HLI A;  1SFU A;  2ETH A;  1P4X A;  2IVM A;  3KFW X;  1P92 A;  3TOA A;  4U88 A;  5ILU A;  1IRF A;  3WGI A;  3G3Z A;  1W4M A;  3ML6 A;  5DCF A;  2EV0 A;  3KLO A;  1FY7 A;  3O3K A;  2EFN A;  4HDU A;  5CVU A;  5LHG A;  2F2E A;  3J7A O;  3EQL F;  1ZG1 A;  2H27 A;  2EB7 A;  1DPU A;  1ON1 A;  2KJB A;  3QPT A;  5LHH A;  1L0O C;  2VT3 A;  4BH9 A;  3WTX C;  4WXH A;  2J5P A;  4U0W A;  2WTE A;  1SD5 A;  3V7C A;  2OAZ A;  3P9K A;  1J9I A;  2IJL A;  4WXD A;  3HRU A;  1ZGA A;  2DU9 A;  4L18 B;  2DI3 A;  4MHG A;  1IN4 A;  4ZZL A;  5LBQ A;  5CVI A;  2FOK A;  4UNO A;  2O03 A;  1P6R A;  4HF2 A;  4GO1 A;  4GYG A;  4IJA A;  1R36 A;  2A61 A;  2EWN A;  4U7B A;  2HR3 A;  4M71 A;  3JSO A;  4FX4 A;  1B6A A;  1YS7 A;  2D45 A;  1F4K A;  4A12 A;  3TO7 A;  3RJP A;  2ZNY A;  4OIR F;  3G73 A;  5D8K B;  2OZU A;  4BXU A;  3CUQ C;  5DCM A;  5HS8 A;  3CTA A;  3HIF A;  1PP8 F;  2QBY A;  3FF5 A;  3E3V A;  2ADU A;  4LFU A;  2V1D A;  2AS5 F;  5CLS A;  2HEO A;  3GYH X;  4KNY A;  1XSX A;  1ZLK A;  1T0F A;  2FE3 A;  3GZ6 A;  2K86 A;  2EFO A;  2HDC A;  1FYL A;  1IRG A;  1W7P B;  3FZV A;  1XSV A;  4CXF A;  1U5T A;  3KE2 A;  2L01 A;  4HBL A;  4HAM A;  3QRF F;  1S6L A;  5BQT A;  2O6G E;  4XSZ F;  2E7W A;  5E1W A;  5FD6 A;  1I1G A;  4P55 A;  3MAJ A;  1KYZ A;  1UHW A;  4JQF A;  4XSX F;  2DLL A;  4GYI A;  3WTT C;  2DO7 A;  3TQN A;  3DXJ F;  4B8X A;  1STZ A;  3DPT A;  1U3E M;  3U1D A;  1XCV A;  1XMA A;  2ZO4 A;  1R1U A;  2GWR A;  3O6B B;  2DQL A;  3LQR A;  1QZZ A;  3KET A;  1UST A;  1J5Y A;  1B4A A;  3F6O A;  4ZH4 F;  3KP6 A;  1FX7 A;  1KU2 A;  4HA8 A;  1SD6 A;  4U0V A;  2F5F A;  1F5T A;  5JI6 A;  4KUM A;  4WX9 A;  1YO5 C;  2BV6 A;  4OIQ F;  1XGM A;  4RAZ A;  3HRT A;  3ZMT A;  4G7H F;  1IW7 F;  2V9V A;  2G9W A;  1BI1 A;  5D6E A;  4M72 A;  1DDN A;  3KCC A;  3BJA A;  3JW4 A;  3CUO A;  4HOB A;  4I09 A;  2VBW A;  5LGU A;  1FLI A;  2QUF A;  1ZYR F;  3BPV A;  3V8J A;  1NHA A;  2Y0M A;  2QM3 A;  1HW5 A;  4MTD A;  2QLZ A;  4UV8 A;  4I98 B;  2W25 A;  1RUO A;  3F22 A;  2K7L A;  2DK5 A;  1QPM A;  1YW8 A;  1TW3 A;  4HYE A;  3HHG A;  2V1U A;  3E6M A;  5HLG A;  4LK1 F;  3R60 A;  3I58 A;  4EM0 B;  3GUD A;  3BRO A;  1QQI A;  2CO5 A;  2F5E A;  4IRG A;  4LB5 A;  4UXN A;  4IF4 A;  4S04 A;  1AWC A;  2EV5 A;  5LGN A;  5DV5 A;  4GCV A;  3LAJ A;  4EJT A;  5D5W B;  3K0L A;  3I5U A;  4RB0 A;  1ZG5 A;  2ZCW A;  3L7W A;  2VOP A;  1WKM A;  2IA2 A;  3BPX A;  3TDZ C;  4TV7 A;  5A2Q Z;  2ESH A;  3IRR A;  1SAX A;  3WG9 A;  3E97 A;  1OR7 A;  1E2X A;  4OOI A;  1W7P A;  2DW4 A;  5DD8 A;  4NHJ A;  2ZJ2 A;  2M45 A;  4OU0 A;  1TQI A;  2IPQ X;  3QP5 A;  1B9M A;  2NAZ A;  3WTW C;  2WC2 A;  2LF8 A;  3QU3 A;  5L3E A;  2RN7 A;  4PDK A;  2D1V A;  5LHI A;  3FXQ A;  1UCR A;  1R00 A;  3SFZ A;  2VBY A;  2KIU A;  2HZT A;  3H92 A;  2NRA C;  3R6S A;  1U2W A;  2STW A;  5HOO A;  2GQQ A;  3R4K A;  2H6B A;  1SFE A;  3CJN A;  4MTE A;  4UHT A;  3KP5 A;  3CO7 C;  1JHH A;  2BYV E;  4EM1 A;  2P4W A;  3MWM A;  4OIN F;  5K5Q A;  2V6C A;  3BOQ A;  5K5R A;  2BE5 F;  1XSD A;  2P6T A;  4LG0 B;  4RGX A;  2L4M A;  2IP2 A;  1JXS A;  1FSH A;  2A07 F;  2VN2 A;  5E17 F;  1KYW A;  1UFM A;  4H0E A;  5E1Z B;  4HX8 A;  1O3R A;  1V3F A;  3KZY A;  2F5C A;  4P9F A;  3MCZ A;  2WWY A;  1ZLJ A;  1XDS A;  2A5Y B;  2EFQ A;  5FD5 A;  1SD4 A;  3E6B A;  4AIK A;  1IXS B;  5E1X A;  5LRS A;  2VOO A;  4S05 A;  3IRQ A;  1ZH5 A;  2NNN A;  2KKO A;  2HQN A;  1DP7 P;  1QNT A;  2MLG A;  2W57 A;  4XLP F;  2JSC A;  4I2O A;  2IA0 A;  1WWX A;  4KT5 C;  2K4B A;  4MEX F;  1R1T A;  2FNP A;  2RGV A;  1TNT A;  3KZZ A;  4L9T A;  2Z5U A;  1ULY A;  2L3D A;  2LDU A;  2MC3 A;  4WF2 A;  2QYO A;  2DPD A;  2ISZ A;  4E70 A;  4EJU A;  5ICC A;  4A5M A;  5KK1 A;  1LEA A;  4HDV A;  2YX4 A;  1DUX C;  3RKW A;  1I5Z A;  1TLH B;  1XGO A;  3BDD A;  1ONV A;  1IXC A;  2VON A;  1G3T A;  2W84 A;  1G3W A;  1QGP A;  2GAU A;  2ZXJ A;  2OQG A;  3CUQ B;  2R7F A;  2R7D A;  3B02 A;  5H6R A;  1LVA A;  4LGW A;  2FXA A;  3V7S A;  1H9G A;  2P7V B;  3ZQ7 A;  2Q2E A;  1IZ1 A;  1ZRF A;  3I64 A;  2Y48 A;  4AIJ A;  2HQR A;  2RC4 A;  3ULQ B;  2PG4 A;  2LNB A;  3E5X A;  2D2W A;  3VOD A;  1KU7 A;  2PMH A;  3SZP A;  4XRF A;  5LRR A;  5FFX A;  4I01 A;  2V79 A;  5JR3 A;  2XIG A;  4EGY A;  1IN8 A;  3JTG A;  1J59 A;  4F7Z A;  1CGP A;  4Q5S F;  2BBY A;  2EJR A;  5E8I A;  3QAH A;  2LF7 A;  3GFL A;  2XAQ A;  1SD7 A;  4EV0 A;  1PUE E;  4RB3 C;  1FYM A;  2KIM A;  2D1H A;  1V4R A;  4FX0 A;  4AD9 A;  1SMT A;  2VE8 A;  1X3U A;  2XGX A;  1REP C;  3FHZ A;  1ZAR A;  4CDG A;  5H6Q A;  4L5I A;  1H0M A;  4KMF A;  1BBY A;  1G3S A;  1YLF A;  1FWZ A;  3LST A;  4LG0 A;  1HKQ A;  4ETS A;  3V8L A;  2XV4 S;  3RKY A;  4RB2 C;  4ASN A;  4XLN F;  5CVV A;  5D4R A;  3C3W A;  3AAF A;  2NNY A;  2NS0 A;  3FMS A;  4M9Z A;  2CQK A;  5LGT A;  2FNA A;  3JAM Z;  1Z7U A;  1Z9C A;  3HSF A;  4FHT A;  2UWM A;  1T6S A;  2GXB A;  2A68 F;  4ENM A;  3KP3 A;  2DTR A;  1RI7 A;  1R23 A;  1YFH A;  2ACJ A;  4KYW A;  1LEB A;  5F6F A;  2P7C B;  1C0W A;  2HKX A;  1SFX A;  3R0A A;  4NQW A;  2XUB A;  1KQ0 A;  1CF7 B;  2ZKZ A;  3F21 A;  2XAF A;  3WU1 B;  3F8N A;  4KN4 X;  1FZP B;  5F1R A;  1IN6 A;  2YPR A;  3TKY A;  1O3T A;  4M74 A;  5L3C A;  1HKT A;  4HV6 A;  4LLG F;  2L4A A;  1KU9 A;  3K69 A;  2PI0 A;  3B73 A;  1FYK A;  3HTS B;  3RDI A;  3CUQ A;  1OYW A;  1BI2 A;  1QO0 D;  5CVR A;  4RAY A;  4ZZD A;  3K1M A;  4CHU A;  4LK0 F;  5J8F A;  2O8X A;  5AIQ A;  1LDJ A;  2XAH A;  3RPQ A;  2VBX A;  4JK1 X;  2JPB A;  2DAO A;  3GEZ A;  2K02 A;  3HRS A;  4YIF A;  3JAM K;  4L9N A;  3L09 A;  1WQ2 A;  4Q47 A;  1UHM A;  5HDG A;  1FP2 A;  4L9V A;  3DKW A;  5LEK A;  1IF1 A;  1FNN A;  3L2C A;  1BC8 C;  4LJZ F;  4HQE A;  2RVC A;  5E20 A;  1MJB A;  1RZ4 A;  3RKX A;  3SHF A;  4AVP A;  4ENJ A;  1YG2 A;  1XCB A;  2C6Y A;  2GA2 A;  3GZ5 A;  1YTY A;  1R5G A;  1HSJ A;  2RKH A;  2STT A;  1QBJ A;  1S3J A;  3W6K B;  1P4W A;  4RS8 A;  1Y0U A;  1GHC A;  3CO6 C;  2DFI A;  4EMS A;  4CZZ A;  3OV8 A;  1XN7 A;  5DEQ A;  2MLK A;  2VC0 A;  5D5X B;  3REO A;  1Z05 A;  3J80 Z;  2QWW A;  3F72 A;  2QEN A;  1ZRC A;  3GW2 A;  2QZ8 A;  2X4H A;  2YX7 A;  2XAJ A;  2P5K A;  3K2Z A;  2OD5 A;  1RNL A;  2JZY A;  1MJA A;  3P9I A;  2FSW A;  3DFG A;  3M9A A;  3NEU A;  2OQR A;  1P2F A;  1Z6R A;  4G9Y A;  1ODD A;  4HLX A;  1R1V A;  1ZRE A;  1PP7 U;  2P6S A;  5CJ9 A;  1Z6T A;  2K4J A;  2IA1 A;  2AXL A;  5FB2 A;  3JTH A;  2XAG A;  2L54 A;  1DPR A;  4N9H A;  4HX7 A;  2HOE A;  1EH6 A;  2E7X A;  4DQ2 A;  4ENK A;  1XGS A;  1O57 A;  1I6X A;  2ZFW A;  3L00 A;  1CF7 A;  1IN7 A;  2KIF A;  1BIB A;  1IXR C;  2KRF A;  1J75 A;  3K1N A;  4UUV A;  2O3F A;  3DQV C;  5ED4 A;  5ICE A;  4HLY A;  1HKS A;  3K1P A;  2UXN A;  5HS9 A;  3HTU A;  3F23 A;  4DNC A;  1B9N A;  2XKP A;  2IW5 A;  2HKO A;  3BWG A;  2K27 A;  1BIA A;  4IVN A;  3D5L A;  2CYY A;  2YR2 A;  4MEY F;  3J80 K;  4HQM A;  2JPC A;  2PN6 A;  2CFX A;  3QU6 A;  3FWE A;  1IAW A;  1D8K A;  3VOE A;  4AWX B;  3GXO A;  2OU2 A;  2JTV A;  5ICG A;  4RGU A;  2E1C A;  3ZN1 A;  1E17 A;  1YIO A;  2H6C A;  3HOS A;  4K2E A;  1YW9 A;  1ZN2 A;  2Z3Y A;  5D8L B;  4LB6 B;  1G3Y A;  1S7A A;  2RNJ A;  4G6Q A;  3V4G A;  4RB1 A;  4Y13 A;  4A2U A;  3MFK A;  5ICF A;  1QZY A;  1KGS A;  1HXD A;  4G7Z F;  2XKO A;  3DV8 A;  1JE8 A;  1TTY A;  1XGN A;  3V8K A;  4G94 A;  3TOB A;  1KU3 A;  2EA4 A;  4D0P A;  1KA8 A;  3IKT A;  1LB2 A;  2M5W A;  2PQ8 A;  3VFZ A;  2HYG D;  4I02 A;  3IL2 A;  4M73 A;  3RYP A;  3RYR A;  1BM9 A;  5EEH A;  3I53 A;  5D6F A;  1LDK B;  3MZH A;  4IXA A;  3DF8 A;  1O7L A;  4Z2Y A;  4AIH A;  1R22 A;  5BMZ A;  3QOP A;  1MKM A;  2L02 A;  2NYX A;  4ZYD A;  2M8E A;  5HVQ C;  2IRF G;  3FMR A;  1O7F A;  2HS5 A;  2UZK A;  4KMU X;  5KVR A;  2MBF A;  2FQ3 A;  4M6Y A;  1W7P D;  5HDN A;  1ZRD A;  1JGS A;  1BN5 A;  4R79 A;  1JHF A;  4HF0 A;  5BS6 A;  2Y75 A;  3IC7 A;  3BJO A;  4M9X A;  4OMZ A;  2Q8K A;  3GFM A;  3E6D A;  5AON A;  2KJC A;  2VBZ A;  2ELH A;  3WOD F;  4QWQ A;  3D0S A;  1ON2 A;  4ESJ A;  3ZMU A;  4MNU A;  3HRM A;  4GXO A;  3TO6 A;  4CIC A;  4IHS A;  2HTS A;  1R7J A;  3WTV C;  1HW2 A;  3ERE D;  1MZB A;  4KDP A;  1SMY F;  3WE3 A;  2A6E F;  5JVT A;  2O61 A;  4MQV A;  4PGH A;  4BAY A;  4YFK F;  1T98 A;  3TO9 A;  1G6N A;  4IRI A;  2CW0 F;  3RIR A;  2GA1 A;  4A6D A;  2XHK A;  4BHC A;  3QP6 A;  2FBK A;  2A6H F;  2QVO A;  3I54 A;  2HGC A;  3ELK A;  3C18 A;  3HOT A;  3WGG A;  1EV7 A;  4RGR A;  4ZYH A;  3LAP A;  3M7G A;  3I59 B;  1FC3 A;  1WI9 A;  2GIV A;  4HX4 A;  4LD5 A;  4BNC A;  1GXP A;  4PCQ A;  1U5T B;  1R5H A;  1TQM A;  3I71 A;  4P96 A;  2FML A;  4HZF A;  2TDX A;  6PAX A;  1U78 A;  4CGZ A;  2RV8 A;  1XDU A;  3P9C A;  1UB9 A;  2R3S A;  5HDK A;  2G7U A;  2MA3 A;  2XVC A;  4WK8 F;  3U2R A;  5CVJ A;  1IN5 A;  2A3S A;  3SQN A;  5JHU A;  2MH2 A;  2PLY A;  4L5J A;  2DBB A;  4KA4 A;  1Z91 A;  4EJO A;  4YFN F;  3EYY A;  3LA2 A;  5ILV A;  3BP8 A;  2V1X A;  1YQA A;  4HF1 A;  4I0B A;  2XRN A;  5D5V B;  4EQQ A;  4IPA A;  3IHU A;  4HV5 A;  3S2W A;  5J6X A;  4ENN A;  2GXG A;  4G8X A;  4LLL A;  3DPL C;  4UVA A;  2M30 A;  3R61 A;  1G4D A;  3WTU C;  5E18 F;  2PEX A;  1WSU A;  3GWZ A;  1FT9 A;  2MH9 A;  2MD5 A;  2ESN A;  3IWF A;  2XAS A;  4A6E A;  1F9N A;  3WGH A;  2VXZ A;  3ISP A;  1K7A A;  3KEO A;  3IWZ A;  2IT0 A;  4BHP A;  2OBP A;  4I7H A;  4O3M A;  2QQB A;  4KFC A;  3I4P A;  3O2P E;  2H94 A;  5J8C A;  2QQA A;  4ZYE A;  2YSR A;  2ZBK A;  1ZAO A;  5AIP A;  3F6V A;  3H3Z A;  3E5Q A;  3T8T A;  1LNW A;  4A0Z A;  2CWE A;  3DP7 A;  3PFI A;  2EK5 A;  1W5S A;  2H09 A;  3HSR A;  4ZYG A;  3PQK A;  2FF4 A;  3ABU A;  3VB2 A;  2QQ9 A;  1S29 A;  3Q5F A;  4G7O F;  2DT5 A;  4EJV A;  2VE9 A;  3MEX A;  1KQ9 A;  2FMY A;  3GX4 X;  1VTN C;  5TJJ A;  4EVI A;  4EJW A;  1K78 B;  2ZNZ A;  4ESF A;  2VC1 A;  1U5T C;  3Q9S A;  1LJ9 A;  4R8H A;  3LFK A;  2PFB A;  4U0Y A;  3IKV A;  2XRO A;  3EYI A;  4UV9 A;  4KIB A;  4N9I A;  3QPH A;  2GZW A;  5HLH A;  4P9U A;  1YYV A;  4O5V A;  5D5U B;  3BZ6 A;  5F64 A;  3I59 A;  3LA7 A;  3E5U A;  5TRD A;  4PZJ A;  4EM2 A;  2B0L A;  5EEG A;  3K9T A;  5ERI A;  1U8R A;  2PBI A;  3T1B A;  2JRT A;  3L9F A;  3LA3 A;  3PQJ A;  4BQA A;  2PJP A;  1OKR A;  1MD0 A;  3BJ6 A;  3KP4 A;  5DUK A;  4L0Y B;  3SXY A;  5DDG A;  2G7H A;  4MQ9 F;  2YU3 A;  4YG2 F;  2Q0O A;  1T39 A;  4O6J A;  5BPI A;  2UXX A;  1HBX G;  3W6J B;  1FSE A;  3WTY C;  3EDP A;  1MJ9 A;  2BEO A;  3GFJ A;  3F3X A;  5L3B A;  1OPC A;  2PMU A;  1GVJ A;  5IT3 A;  3NRV A;  4CO8 A;  2X0L A;  1D5V A;  1S7O A;  3FM5 A;  1TW2 A;  1KQ8 A;  3GF2 A;  2DPU A;  4N0B A;  2CG4 A;  3GFI A;  4OIP F;  2O0Y A;  2FBH A;  2FRH A;  4HW0 A;  3E6C C;  1J7K A;  5H20 A;  3KP7 A;  2COM A;  1BI3 A;  1L3L A;  1B59 A;  4JBA A;  5L3F A;  3ZP5 A;  3T8R A;  3ROU A;  2P5V A;  2EFP A;  4ON0 A;  1AOY A;  4BHB A;  2FU4 A;  1GXQ A;  3R0J A;  3JSP A;  3N97 A;  4L0Z B;  4A0X A;  1B1B A;  1OYI A;  3F8C A;  1O3S A;  1FP1 D;  4BYY A;  4P5O A;  1MDM B;  4KIG A;  3WTZ A;  1D3Y A;  2DQR A;  4YFX F;  5FLX Z;  2M87 A;  4XBF A;  4M6X A;  3EET A;  2M1B A;  2HTJ A;  1XB4 A;  1PDN C;  3FXR A;  5DUI A;  3NQO A;  4A0Y A;  4WCG A;  2Z9O A;  1OMI A;  2VT2 A;  1R58 A;  1K78 A;  3RI4 A;  4YII A;  2CGP A;  2DK8 A;  2J5O A;  4QLC U;  3M1E A;  1P4A A;  2HWV A;  2P8T A;  1O3Q A;  4OMY A;  2F5D A;  3GLX A;  2HFH A;  2WV0 A;  1W5T A;  5HS7 A;  3FXU A;  5JFR A;  2A69 F;  3GVA A;  4WWC A;  1FOK A;  2ZME B;  4Q48 A;  5IT9 Z;  1FBU A;  1IUY A;  1OYY A;  3RPU A;  1ZGJ A;  1EH8 A;  4PGG A;  4Q4Z F;  1YS6 A;  3F8M A;  1ZHF A;  3ZPL A;  1WRJ A;  4LMY A;  2W85 A;  1H9T A;  3VEP A;  3M8F A;  2LSO A;  1BOA A;  5E8G A;  3ZN0 A;  2LKP A;  3C7J A;  2RQP A;  2OZ6 A;  1RIO H;  4MGR A;  1HQC A;  1D8J A;  4ESB A;  5L3D A;  2ISY A;  2Z33 A;  1T38 A;  4KIF A;  5FLX K;  5DD4 A;  3HYI A;  1FBQ A;  4G6D A;  3F8B A;  4U7D A;  1FPQ A;  1LQ1 A;  4NB5 A;  5BPD A;  2P5L C;  4B09 A;  1BJA A;  3RTR A;  1J2X A;  4FT8 A;  4UVC A;  2EFW A;  4IHT A;  4OIO F;  3OOP A;  4I0A A;  2E1N A;  3SZT A;  4LLN A;  5FFZ A;  2CSO A;  3J81 Z;  1EH7 A;  4GGG A;  3FMQ A;  3LWF A;  4Y17 A;  5LLQ A;  1U6G A;  3H3U A;  3WU0 A;  4L9J A;  1J0R A;  3KLN A;  5A2Q K;  4M9S A;  2BGC A;  1LDD A;  2EV6 A;  4Y15 A;  5CYV A;  1A04 A;  1HST A;  2JT1 A;  1Q1H A;  2VOD A;  1T2K A;  2RDP A;  3GO5 A;  5FO5 A;  5IT9 K;  3ZMV A;  3F8F A;  1TBX A;  5ILS A;  4RGS A;  1TQP A;  3MQ0 A;  4A5N A;  3FX3 A;  5BOX A;  2EA2 A;  3LQQ A;  3T0Y A;  5L3G A;  3I0T A;  5DCM B; 
#chains in the Genus database with same CATH topology
 1S8N A;  3U9G A;  3H9Q A;  3WE2 A;  3IV5 A;  3KP2 A;  4PSX A;  3KEY A;  2QBY B;  3H9J A;  3BY6 A;  1MDM A;  4A3G J;  1I27 A;  3CDH A;  1FTT A;  3P7N A;  2HQA A;  3ZMZ A;  1FBS A;  3K4J A;  3JRI A;  4XOP A;  3DTK A;  2ZFU A;  2WAD A;  3ZGK A;  2L2O A;  4UVB A;  3KEQ A;  4HPQ A;  5DTD A;  1ERD A;  4IRH A;  4CYD A;  4Y7N J;  3GTG J;  2H8W A;  2EH3 A;  3C1D A;  5FGM A;  1BC7 C;  2ELK A;  3JR9 A;  3COA C;  4EGZ A;  3TDU C;  3WU2 C;  2H1L A;  3OYE A;  3ECH A;  3FM3 A;  3M8E A;  1F1Z A;  1K79 A;  3CP8 A;  1RUN A;  3CLO A;  3ECO A;  1SFO J;  1XMK A;  3N4M A;  2ZME C;  1F36 A;  1V54 H;  3EUH A;  3MMY B;  2OA4 A;  3K4N A;  4BQO A;  5K5O A;  3AL0 B;  1K6O A;  3Q3S A;  4II2 A;  4ZJZ A;  1U9N A;  4YIR X;  3JRD A;  1YRN B;  4WXC A;  3BLY A;  4GRI A;  3T5X A;  2E71 A;  1NG7 A;  2JVH A;  3I4N J;  1VQM I;  1ZG3 A;  2KIQ A;  3Q9V A;  1HW1 A;  4KN7 X;  2FA5 A;  5EG0 B;  3ZMS A;  1YI2 I;  2JA5 J;  3WTS C;  1LE8 B;  1USS A;  2X1D A;  2OV7 A;  1UJ8 A;  1Z1D A;  3J81 K;  2Y69 H;  1UMQ A;  4R1H A;  1BI0 A;  5LEJ A;  1X2N A;  3V7R A;  3TGN A;  2FBI A;  1WGX A;  2HYF A;  4PJ0 C;  5TIS C;  3LSH A;  1KZH A;  5D4S A;  2Z99 A;  1UAA A;  1I1S A;  3HUG A;  1VQ9 I;  1YW7 A;  5K7F A;  1VI0 A;  2CUZ A;  2DA5 A;  3ABT A;  1TNS A;  2DFE A;  2FEZ A;  2ZME A;  3HHH A;  4KIC A;  3DEU A;  1XD7 A;  5DYM A;  5K1Y A;  1MGT A;  3MZY A;  2W24 A;  3ZMD A;  3HSE A;  1ETX A;  2A5W A;  3DEE A;  4E7I A;  3CMA I;  1ACI A;  3HG9 A;  1MBH A;  5HLI A;  3LSK A;  1SFU A;  4IHY A;  2ETH A;  1P4X A;  1QPI A;  2IVM A;  4E7K A;  3KFW X;  3PM1 A;  4L5E A;  1P92 A;  5E79 C;  3TOA A;  4U88 A;  5ILU A;  1IRF A;  2KT0 A;  3WGI A;  2R5Z B;  5F1J A;  2CQN A;  3G3Z A;  4LIV A;  1W4M A;  2CV0 A;  3ML6 A;  4X1E A;  4JX5 A;  5DCF A;  2NVQ J;  2EV0 A;  3KLO A;  1FY7 A;  3ZQF A;  3O3K A;  2EFN A;  3FK6 A;  4HDU A;  5CVU A;  4CCM A;  2L0K A;  2F2E A;  5LHG A;  3EQL F;  3J7A O;  4ANJ A;  1ZG1 A;  2H27 A;  4CCK A;  3CCU I;  2EB7 A;  3DLL F;  4XIC A;  1DPU A;  1ON1 A;  3M1C A;  5J47 A;  4BGD A;  4F93 B;  2LVS A;  1A6Q A;  2KJB A;  2KRH A;  3QPT A;  4XON A;  3OYK A;  3DTI A;  2DMP A;  5LHH A;  2L7F P;  2M34 A;  2R5Y A;  1L0O C;  2VT3 A;  3LMM A;  4BH9 A;  3WTX C;  1TP4 A;  4WXH A;  2J5P A;  3PFY A;  2LBF A;  4U0W A;  2W48 A;  1D0X A;  2L7Z A;  2WTE A;  4ZDL A;  1SD5 A;  1IGN A;  3V7C A;  2OAZ A;  3DKY A;  4XLF A;  3TED A;  2CW8 A;  3P9K A;  1J9I A;  1JJ6 C;  2RNG A;  4XRS G;  2IJL A;  2HVR A;  4EEF G;  1NG6 A;  4WXD A;  4D5C A;  3HRU A;  1ZGA A;  2HZD A;  2DU9 A;  4L18 B;  2NS7 A;  2AQF A;  1XMX A;  2DI3 A;  3JRA A;  4MHG A;  1IN4 A;  2DJN A;  1K4T A;  4DW6 A;  4IKF A;  2V7F A;  3GTM J;  1QU3 A;  2LKS A;  4ZZL A;  5LBQ A;  5CVI A;  3C2G A;  2FOK A;  4UNO A;  3ONQ A;  2O03 A;  3OYN A;  3BTL A;  1P6R A;  1GDT A;  4HF2 A;  2KPM A;  4GO1 A;  4GYG A;  4IJA A;  4PJL A;  3OYD A;  1R36 A;  4CSW A;  2A61 A;  4DIQ A;  2DXI A;  1MSE C;  5CQE A;  2EWN A;  4U7B A;  2HR3 A;  2EPF A;  4M71 A;  3JSO A;  4FX4 A;  1T0F C;  1B6A A;  3PJR A;  4PFO A;  1YS7 A;  2D45 A;  2F6C A;  4JX6 A;  1F4K A;  1I3A A;  4A12 A;  3TO7 A;  3RJP A;  2ZNY A;  2MYS A;  4OIR F;  3G73 A;  5D8K B;  2IAI A;  2OZU A;  2M8G X;  2VB6 A;  2BXZ A;  4BXU A;  1TT5 B;  3CUQ C;  2PX9 A;  5DCM A;  3AL0 C;  5HS8 A;  4E7J A;  3CTA A;  4X6A J;  3HIF A;  1PP8 F;  1V5G A;  2QBY A;  3FF5 A;  2X1C A;  2ADU A;  3E3V A;  4LFU A;  2V1D A;  2AS5 F;  5CLS A;  2ME0 A;  2HEO A;  3GYH X;  1WJA A;  4KNY A;  1PYV A;  2M3A A;  1XSX A;  1ZLK A;  1T0F A;  2FE3 A;  3CP2 A;  1YJW I;  4JX4 A;  3GZ6 A;  2K86 A;  2EFO A;  2VJ5 A;  3G6E I;  3OYH A;  1OCC H;  2CS3 A;  2HDC A;  1FYL A;  4XLE A;  1IDZ A;  1HA8 A;  3BT9 A;  3UKG A;  3CCM I;  1W7P B;  1OCZ H;  1IRG A;  3FZV A;  5EGO A;  1XSV A;  4N4O B;  2K9Q A;  4IHV A;  1GV2 A;  5FKO A;  4CXF A;  1U5T A;  1Y8Q B;  2DMQ A;  3KE2 A;  3L2Q A;  2L01 A;  2LMD A;  4HBL A;  3LL7 A;  2PMZ A;  1YRN A;  4AUX A;  2KLO A;  4HAM A;  3QRF F;  1H89 C;  2HVQ A;  1S6L A;  4XLA A;  5BQT A;  1N25 A;  2O6G E;  1N78 A;  4B43 A;  2V6E A;  4XSZ F;  2E7W A;  5E1W A;  3OS1 A;  5FD6 A;  1I1G A;  4P55 A;  1JJ8 C;  4BDZ A;  2CV2 A;  3MAJ A;  1I50 J;  2DOE A;  3OS2 A;  1KYZ A;  1UHW A;  4JQF A;  4XSX F;  2DLL A;  5IP7 J;  1NTC A;  2JSP A;  4GYI A;  4UUS B;  1NK3 P;  2LOO A;  4BUP A;  3WTT C;  3PIP F;  2DO7 A;  3TQN A;  3DXJ F;  3FXJ A;  4B8X A;  5IP9 J;  1STZ A;  1E3H A;  2A05 A;  4V2F A;  4A3C J;  3DPT A;  2WAE A;  1U3E M;  3U1D A;  1XCV A;  3BR0 A;  1QA6 A;  1XMA A;  2ZO4 A;  4RLF A;  1R1U A;  2IEK A;  2V9K A;  1OFC X;  3EPZ A;  3CCE I;  1WHU A;  2GWR A;  3K10 A;  2E36 A;  4FET A;  3O6B B;  1Z3Y A;  2DQL A;  3LQR A;  2BHY A;  2OTJ I;  1QZZ A;  3H5A A;  3KET A;  3CF5 F;  1UST A;  3W2W A;  1J5Y A;  2XAU A;  5FRO A;  2R5Z A;  1G2H A;  1B4A A;  1T33 A;  1XX5 A;  3F6O A;  4ZH4 F;  3KP6 A;  1FOX A;  3A02 A;  5FJ8 J;  4BDY A;  2EIJ H;  1FX7 A;  1KU2 A;  1H8A C;  4FAS D;  4HA8 A;  5DS9 A;  1LPQ A;  1SD6 A;  4U0V A;  2F5F A;  1FTZ A;  1F5T A;  4XOR A;  5JI6 A;  1S5L C;  1T8I A;  3HOX J;  3CC7 I;  4A3D J;  4KUM A;  4WX9 A;  3OYG A;  1YO5 C;  3IH3 A;  3S3O A;  2BV6 A;  4OIQ F;  4AC0 A;  1XGM A;  1RKW A;  2JN6 A;  4RAZ A;  2NVT J;  3VYR B;  3HRT A;  3ZMT A;  1MBG A;  4G7H F;  1IW7 F;  2NOJ B;  1IV8 A;  2V9V A;  2G9W A;  4RM3 A;  1A31 A;  1BI1 A;  5D6E A;  3I9V 2;  4M72 A;  5K7H A;  1DDN A;  3A01 B;  2K40 A;  3KCC A;  4E7L A;  1BW5 A;  1JUP A;  3BJA A;  3JW4 A;  4QSH A;  3CUO A;  1R49 A;  4HOB A;  4I09 A;  2VBW A;  5LGU A;  2W4S A;  1FLI A;  4FE4 A;  4BJ5 C;  2QUF A;  3QPS A;  3O8G A;  1U8B A;  2M7B A;  3HOU J;  1ZYR F;  1LFB A;  3BPV A;  3V8J A;  1NHA A;  2Y0M A;  2QM3 A;  1YIJ I;  1HW5 A;  2V26 A;  1HOM A;  3SEZ A;  2KP6 A;  1HLV A;  4MTD A;  2QLZ A;  1JT6 A;  1VQP I;  4UV8 A;  1F43 A;  4I98 B;  2M4K A;  2W25 A;  1BR2 A;  4CCN A;  1RUO A;  3F22 A;  4Y3O A;  1X4P A;  1HC8 A;  5GPA A;  2K7L A;  4DJA A;  2DK5 A;  4E7H A;  3BTI A;  2X6Y A;  4B44 A;  1QPM A;  1YW8 A;  1TW3 A;  4HYE A;  3HHG A;  2V1U A;  3VDX A;  3E6M A;  5HLG A;  4LK1 F;  3PNY A;  3OIP A;  2BXY A;  3R60 A;  3QQA A;  3S17 J;  3I58 A;  2NS8 A;  3DBH B;  4EM0 B;  3GUD A;  2HDW A;  3BRO A;  1QQI A;  2CO5 A;  2F5E A;  2BVM A;  4IRG A;  3OYJ A;  4LB5 A;  4UXN A;  1D1A A;  3HPH A;  4IF4 A;  3AKZ A;  1X3Z B;  2DYS H;  3OL3 A;  4S04 A;  3I4M J;  1AWC A;  2EV5 A;  4NC7 A;  1BR1 A;  3RZO J;  1OR7 C;  3BG5 A;  3K70 C;  4D1Q A;  5LGN A;  5DV5 A;  4FCY A;  4GCV A;  2HQ5 A;  3ZQI A;  3CD6 I;  4B3A A;  4NNJ A;  3LAJ A;  1GLN A;  5KHD A;  1LFU P;  4H4K C;  1UEL B;  4EJT A;  5D5W B;  3K0L A;  4XKC A;  3LSM A;  3FIW A;  2GLO A;  4W97 A;  3K4C A;  3D5R C;  2Q2E B;  1OCO H;  3DKX A;  2CW7 A;  3I5U A;  3LSI A;  4RB0 A;  1ZG5 A;  2ZCW A;  2NVU B;  3L7W A;  2Y0S A;  2VOP A;  1WKM A;  3JRG A;  3L2U A;  1ETO A;  2IA2 A;  4QTR A;  4JOM A;  3BPX A;  3TDZ C;  4TV7 A;  5A2Q Z;  2ESH A;  3IRR A;  3CMY A;  3KYC B;  1SAX A;  3K4M A;  3WG9 A;  3E97 A;  1OR7 A;  1E2X A;  4OOI A;  1W7P A;  2DW4 A;  4FIS A;  5DD8 A;  4LG3 A;  3HBL A;  3G2B A;  2HI3 A;  4NHJ A;  2JA8 J;  2M0C A;  4BJT A;  3QYB A;  2ZJ2 A;  4CCL A;  2M45 A;  4OU0 A;  1TQI A;  2IPQ X;  3QP5 A;  2PMZ N;  1UG0 A;  1B9M A;  2KDO A;  5KNL A;  2NAZ A;  1IG7 A;  2G0E A;  3FXO A;  4XRS A;  3WTW C;  4LOC A;  3U1K A;  1B72 A;  2WC2 A;  2LF8 A;  3MN2 A;  2E35 A;  3QU3 A;  5L3E A;  2RN7 A;  1E3O C;  2XF7 A;  4PDK A;  2D1V A;  4E7S A;  3FXQ A;  4XL9 A;  5LHI A;  3VYS B;  2M0M A;  1UCR A;  2MGQ A;  4ZTJ A;  1R00 A;  5GTH C;  4A3I J;  3SFZ A;  2VBY A;  2KIU A;  1AA7 A;  1X2M A;  2HZT A;  4B1R A;  3H92 A;  2NRA C;  3R6S A;  4UUS A;  1U2W A;  2STW A;  3H1C A;  5HOO A;  2GQQ A;  3R4K A;  2M7A A;  1TC3 C;  2H6B A;  3C2H A;  2E5Z A;  1SFE A;  1QHH D;  3CJN A;  3GTP J;  4MTE A;  2DMU A;  4UHT A;  3KP5 A;  3CO7 C;  1JHH A;  2BYV E;  4EM1 A;  1LKX A;  1ORK A;  2UV1 A;  2P4W A;  3L1P A;  2R7Q A;  3MWM A;  4OIN F;  5K5Q A;  4RLQ A;  4AYB A;  2V6C A;  3HPG A;  2CH0 A;  3BOQ A;  1QVT A;  2BE5 F;  4B48 A;  5HNF A;  5K5R A;  3JRE A;  1XSD A;  2VPL A;  2P6T A;  4CH7 A;  4DBR A;  5F08 A;  1JKO C;  4LG0 B;  4RGX A;  4A3K J;  2NOG A;  2I10 A;  3DLA A;  1WFX A;  2L4M A;  1AU7 A;  2KIS A;  2IP2 A;  1JXS A;  1FSH A;  2CUE A;  3ESW B;  2A07 F;  2VN2 A;  2N8G A;  5E17 F;  4BXX J;  1HF0 A;  3HKZ A;  1KYW A;  3ZOB A;  3BZC A;  1UFM A;  2RRE A;  2R7R A;  4H0E A;  4IQJ A;  5E1Z B;  2JWT A;  2XGE A;  4HX8 A;  3FXM A;  4I99 C;  1O3R A;  3ABL H;  1V3F A;  1U0J A;  1SVM A;  3KZY A;  3WHB A;  2F5C A;  4P9F A;  3MCZ A;  2WWY A;  1ZLJ A;  1XDS A;  3IUO A;  1S72 I;  2A5Y B;  3HDD A;  2EFQ A;  5FD5 A;  1SD4 A;  4A3B J;  2B7E A;  3E6B A;  4YEJ A;  4AIK A;  1IXS B;  5E1X A;  5J4V A;  1FOW A;  3RPU D;  5LRS A;  2VOO A;  3LSP A;  4S05 A;  3IRQ A;  2KMU A;  1ZH5 A;  2DA6 A;  2NNN A;  2CU7 A;  1D1B A;  2KKO A;  2HQN A;  4XN0 A;  1DP7 P;  2IS2 A;  1QNT A;  2VJ4 A;  2MLG A;  1WVR A;  2L5Q A;  2W82 A;  2CQ7 A;  2W57 A;  4N4N B;  4XLP F;  1VZ0 A;  1CQT A;  2JSC A;  3FKI J;  3N05 A;  3J7A Y;  4I2O A;  4CCO A;  2IA0 A;  1WWX A;  4KT5 C;  2K4B A;  2XPV A;  4MEX F;  1R1T A;  3WG7 H;  4DYC A;  2FNP A;  5FRN A;  2RGV A;  4PJM A;  1TNT A;  1WCM J;  3U21 A;  1JUM A;  4C3I J;  3KZZ A;  4L9T A;  2Z5U A;  1ULY A;  2P81 A;  2L3D A;  3MVP A;  2LDU A;  2MC3 A;  2KZG A;  1MIJ A;  1V55 H;  4WF2 A;  4DOZ A;  4MO7 A;  3TBI A;  4D9J A;  2QYO A;  4XLC A;  4IZZ A;  4OAZ A;  2M9H A;  2DPD A;  3FIS A;  2ISZ A;  4E70 A;  4EJU A;  5ICC A;  4A5M A;  5KK1 A;  2VXD A;  5GAG J;  2HPM A;  2LG4 A;  1LEA A;  4HDV A;  2ZJR F;  2YX4 A;  1DUX C;  3RKW A;  4BE0 A;  1I5Z A;  1TLH B;  1UG2 A;  1XGO A;  3BDD A;  1ONV A;  1IXC A;  2VON A;  1T95 A;  1G3T A;  4U87 A;  3TW7 A;  2W84 A;  4HNU A;  1G3W A;  1MNE A;  1QGP A;  2JK3 A;  2GAU A;  4PFP A;  2ZXJ A;  2OQG A;  3CUQ B;  2R7F A;  2R7D A;  3FBN B;  2DYR H;  2Y9Y A;  2BZT A;  3B02 A;  5H6R A;  2V4J C;  1LVA A;  4LGW A;  5E3M A;  2FXA A;  3V7S A;  3G4S I;  1VQ4 I;  1H9G A;  2HPI A;  2P7V B;  1SVL A;  3ZQ7 A;  4DYQ A;  2X6X A;  4XLH A;  1I3Q J;  2MC4 A;  2Q2E A;  2K3F A;  1IZ1 A;  1ZRF A;  2O5R A;  2LC2 A;  2K9N A;  1M1E B;  3I64 A;  2VIX A;  3JRB A;  2Y48 A;  4AIJ A;  1X1B A;  2Y0S N;  2HQR A;  2RC4 A;  1FOY A;  3ULQ B;  1GV5 A;  4ABZ A;  2PG4 A;  2LNB A;  3E5X A;  4E6K G;  1BW6 A;  2D2W A;  1ZK8 A;  3VOD A;  2PMH A;  4CZC A;  4J19 A;  1ZR2 A;  5EZG A;  1KU7 A;  5LD2 C;  2OCC H;  1E3P A;  3SZP A;  1IRZ A;  4UB6 C;  1SAU A;  2FX0 A;  1TWF J;  2TCT A;  1BJZ A;  4XRF A;  5LRR A;  4IO9 F;  5FLV A;  3GTQ J;  1X1P A;  3OIO A;  5FFX A;  4I01 A;  2V79 A;  3FBI B;  4M3B A;  2E5N A;  5B1B H;  5JR3 A;  2XIG A;  2QKL B;  4EGY A;  1IN8 A;  3JTG A;  1O4X A;  1J59 A;  4F7Z A;  1CGP A;  2L9S A;  4ZDP A;  4Q5S F;  2BBY A;  1ZR4 A;  3S1N J;  2EJR A;  2EQR A;  5E8I A;  2H8R A;  3QAH A;  1XTA A;  2VLA A;  2LF7 A;  3GFL A;  2XAQ A;  2EZH A;  1SD7 A;  4F91 B;  4EV0 A;  4BBS J;  3A03 A;  1PUE E;  1FIA A;  1LFP A;  1PUF B;  1ETW A;  3BZK A;  4QPQ A;  4RB3 C;  5B66 C;  3MD2 A;  2F4M B;  1FYM A;  3S1Q J;  2KIM A;  2D1H A;  1V4R A;  4FX0 A;  4AD9 A;  1ZEL A;  4NUB A;  4GDF A;  2VPR A;  2IS1 A;  1SMT A;  3S15 J;  3BCA A;  1JI8 A;  3PSI A;  4D7M A;  4DYR A;  2VE8 A;  1X3U A;  1OQY A;  2XGX A;  1MBF A;  1REP C;  5FKL A;  3FHZ A;  1ZAR A;  1IC8 A;  4CDG A;  5H6Q A;  2YUS A;  2X9D A;  4L5I A;  1H0M A;  2GOM A;  4AYB N;  5M5Y J;  4KMF A;  1BBY A;  1G3S A;  2LLK A;  5IYD J;  1YLF A;  5DM6 F;  1FWZ A;  3LST A;  4LG0 A;  1HKQ A;  4ETS A;  3FXL A;  3V8L A;  2JA2 A;  3CJT B;  1R4N B;  4Y52 J;  3ZRG A;  2XV4 S;  1TT0 A;  3RKY A;  3Q0V A;  4QIW N;  2DOF A;  4RB2 C;  4ASN A;  4XLN F;  1YX5 A;  3J7Y J;  5CVV A;  5D4R A;  3D5S C;  3C3W A;  3AAF A;  5CQG A;  2KQR A;  2NNY A;  2NS0 A;  3HGY A;  3FMS A;  4M9Z A;  5M5X J;  3SDG A;  1EKE A;  2CQK A;  2RAE A;  3PIO F;  3OYF A;  5LGT A;  3M4O J;  3SYT A;  2FNA A;  4V2G A;  1K4S A;  3JAM Z;  1Z7U A;  1Z9C A;  3HSF A;  5FRM A;  3GTJ J;  4FHT A;  2RQQ A;  2UWM A;  1IRX A;  3C2B A;  3CCY A;  1T6S A;  2GXB A;  3HB9 A;  1R4M B;  2A68 F;  5IOZ A;  4ENM A;  1HDD C;  3KP3 A;  2DTR A;  3HOV J;  1RI7 A;  2IGM A;  1R23 A;  1IV6 A;  1YFH A;  1Z0X A;  2ACJ A;  2HOS A;  3HXL A;  1U9O A;  4KYW A;  1LEB A;  5F6F A;  1V5E A;  2P7C B;  3PO3 J;  4BBR J;  1C0W A;  2HKX A;  2BOL A;  2MG4 A;  1SFX A;  3R0A A;  4NQW A;  4F55 A;  4BY1 J;  4FQG A;  2XUB A;  2EZL A;  3OY9 A;  1KQ0 A;  1CF7 B;  2ZKZ A;  3F21 A;  2HVS A;  2XAF A;  5C3E J;  3WU1 B;  1I6H J;  1D1C A;  1MH4 A;  3F8N A;  2VUM J;  2F5V A;  3L2R A;  5FLM J;  4KN4 X;  4F52 A;  1FZP B;  5F1R A;  1IN6 A;  3DCF A;  2YPR A;  2O7O A;  3LFU A;  3TKY A;  1O3T A;  4ZDO A;  4A3F J;  1A6I A;  2EBI A;  4M74 A;  5L3C A;  2ZXH A;  3SDB A;  2BY3 A;  4V19 K;  1HKT A;  4HV6 A;  5JLX A;  2Y2Z A;  4M3G A;  4RAF A;  4LLG F;  3M3Y J;  2L4A A;  2BY1 A;  2YU9 J;  4BU2 A;  2JRM A;  1W1W E;  1KU9 A;  3K69 A;  1RR7 A;  1S9H A;  3GBG A;  4HEA 2;  3MKY B;  3CCR I;  1AHD P;  2PI0 A;  3B73 A;  3RSN A;  3S16 J;  1Y56 A;  2ME6 A;  2FJ1 A;  4M6V A;  2BY2 A;  1VND A;  5F0C A;  1FYK A;  1X4O A;  5E3N A;  3RDI A;  3HTS B;  3CUQ A;  4NDL A;  1YJN I;  1OYW A;  3H36 A;  3LOC A;  1BI2 A;  1VQ7 I;  1QO0 D;  5CVR A;  2VKD A;  2EZI A;  4RAY A;  3CLQ A;  4FE7 A;  4ZZD A;  5EG0 A;  3K1M A;  2V9P A;  1QRY A;  4CHU A;  3TP0 A;  1MBK A;  1LE8 A;  4BJ6 C;  4LK0 F;  2F48 A;  5J8F A;  5B5E C;  5GTI C;  2BHZ A;  2O8X A;  5AIQ A;  1LDJ A;  2XAH A;  4G6T B;  3RPQ A;  2VBX A;  4JK1 X;  4ZYA A;  5F27 A;  1SEU A;  2JPB A;  2VI6 A;  2DAO A;  2JMW A;  4LIU A;  4MLO A;  3GEZ A;  2K02 A;  1VQN I;  3HRS A;  4YIF A;  2VQG A;  3QWL A;  4L9N A;  3JAM K;  3L09 A;  1WQ2 A;  4Q47 A;  1UHM A;  5HDG A;  3CQZ J;  1MND A;  3OYM A;  4MFE A;  1FP2 A;  3KZI C;  4L9V A;  3DKW A;  5LEK A;  1A5J A;  2CQQ A;  4G12 A;  3CDI A;  1IF1 A;  1Z3X A;  2LY9 A;  1FNN A;  3L2C A;  1BC8 C;  2GXA A;  4LJZ F;  4HQE A;  1WJC A;  2RVC A;  2LP0 A;  5E20 A;  1MJB A;  1RZ4 A;  2XF6 A;  3RKX A;  3SHF A;  2VQL A;  4AVP A;  2VL8 A;  3FKJ A;  4ENJ A;  2QKM B;  1YG2 A;  4BY7 J;  1XCB A;  2C6Y A;  2GA2 A;  3GZ5 A;  2IBD A;  1YTY A;  1FMV A;  1R5G A;  1HSJ A;  2RKH A;  2STT A;  5LFA A;  2CFO A;  1QBJ A;  1VQO I;  1S3J A;  4B47 A;  3W6K B;  4BKX A;  3ZCO A;  3HL2 A;  1P4W A;  1PUF A;  5EF6 A;  4IEJ A;  4RS8 A;  3P5J A;  1Y0U A;  1GHC A;  3CO6 C;  3ERM A;  2NXN B;  2DFI A;  4EMS A;  4CZZ A;  3OV8 A;  3HM5 A;  3S93 A;  1Y6I A;  5B1A H;  4PK4 A;  1T56 A;  2LY1 A;  3ZR8 X;  3ZQC A;  3CES A;  1XN7 A;  5DEQ A;  2R7Z J;  2MLK A;  1DU0 A;  2VC0 A;  5GAE J;  5D5X B;  3REO A;  3HOY J;  3H35 A;  1Z05 A;  1EF4 A;  3GTL J;  3J80 Z;  2QWW A;  3F72 A;  2QEN A;  1VQ8 I;  1ZRC A;  3BTJ A;  2DMN A;  1QZE A;  3GW2 A;  3S2D J;  3UR3 C;  2QZ8 A;  2X4H A;  2YX7 A;  2XAJ A;  1MBJ A;  2P5K A;  2AXT C;  1MMN A;  3K2Z A;  2OD5 A;  3AG3 H;  1RNL A;  1W0U A;  2JZY A;  1XG1 A;  1DQU A;  1MJA A;  3P9I A;  5EZH A;  4I6Z A;  2FSW A;  3DFG A;  3M9A A;  3RCO A;  3NEU A;  1JTX A;  3Q0W A;  2OQR A;  1P2F A;  1Z6R A;  3E1S A;  1XC5 A;  4G9Y A;  3GTK J;  1ODD A;  4HLX A;  1R1V A;  1ZRE A;  3CME I;  1PP7 U;  3WHC A;  2P6S A;  1ITY A;  5CJ9 A;  3OYA A;  3OSG A;  1Z6T A;  2K4J A;  2IA1 A;  3EUK L;  3VYT B;  2AXL A;  5IP6 A;  2QSF X;  5IPA A;  5FB2 A;  3JTH A;  1RES A;  2XAG A;  2L54 A;  2VKH A;  1DPR A;  3QYE A;  2KRC A;  4N9H A;  3LNQ A;  4HX7 A;  1A35 A;  2HOE A;  4A69 C;  1EH6 A;  2E7X A;  4DQ2 A;  5KAI C;  4ENK A;  3ABM H;  3JRH A;  3ZQH A;  1XGS A;  2DA7 A;  4BAC A;  1O57 A;  1I6X A;  1ZTR A;  2DDA A;  3W6V A;  3DPU A;  2ZFW A;  3L00 A;  1RPW A;  3DU6 A;  1CF7 A;  1IN7 A;  3HEF A;  5JHF A;  2LKX A;  1Y1V J;  5HNH A;  2PJR B;  5EJC A;  2X6O A;  2KIF A;  3MKL A;  1BIB A;  4C3H J;  1IXR C;  2KRF A;  1J75 A;  4GFB A;  5CKT A;  3K1N A;  5GAD J;  2O3F A;  1P9Q C;  4UUV A;  1G59 A;  2GOX B;  3DQV C;  2IGO A;  5ED4 A;  4F3Q A;  5ICE A;  3PUF A;  3BR6 A;  4HLY A;  2OC6 A;  1HKS A;  3K1P A;  1TZL A;  1WH7 A;  2UXN A;  5EDN A;  5HS9 A;  3HTU A;  4UUT A;  3D1N I;  3F23 A;  2OF7 A;  4HRI A;  4DNC A;  1B9N A;  2XKP A;  2IW5 A;  3ZXS A;  2HKO A;  3VSL A;  3BWG A;  2K27 A;  1VF9 A;  2DA3 A;  3F0C A;  1BIA A;  2E1O A;  4IVN A;  3D5L A;  2CYY A;  5J4Y A;  5C44 J;  2YR2 A;  4MEY F;  3J80 K;  4HQM A;  2OJE D;  2JPC A;  2PN6 A;  3JRF A;  3GCM A;  2CFX A;  3QU6 A;  3FWE A;  2AO9 A;  1IAW A;  1D8K A;  3K7A J;  3VOE A;  3GXO A;  4AWX B;  2OU2 A;  3S32 A;  4NC6 A;  2JTV A;  1UHS A;  2DDB A;  2VKV A;  2W1O A;  5ICG A;  1YHQ I;  4RGU A;  2E1C A;  2HXI A;  3BR2 A;  3BG9 A;  2R7W A;  2L9V A;  3ZN1 A;  1E17 A;  1YIO A;  2H6C A;  3HOS A;  4K2E A;  1YW9 A;  3BCB A;  3QYF A;  5DM7 F;  1ZN2 A;  2DTZ A;  2Z3Y A;  1YOV B;  3E0J B;  5D8L B;  2DA4 A;  4LB6 B;  1G3Y A;  1S7A A;  1GT0 C;  2RNJ A;  3KX2 A;  1YJ9 I;  4G6Q A;  3V4G A;  4RB1 A;  1TWG J;  4Y13 A;  4A2U A;  3MFK A;  5ICF A;  1QZY A;  2X48 A;  2O8K A;  3A1Y A;  1KGS A;  1HXD A;  3J7Z I;  4G7Z F;  2UUZ A;  2XKO A;  2M4G A;  3BG7 A;  3DV8 A;  1JE8 A;  1TTY A;  4YEL A;  5KCM A;  1XGN A;  3V8K A;  5IOY A;  4G94 A;  3TOB A;  1KU3 A;  2EA4 A;  3S14 J;  4D0P A;  1RR8 C;  2MAB A;  2JA6 J;  1KA8 A;  1W0T A;  4XID A;  1FJL A;  3IKT A;  2Z2S B;  1LB2 A;  2M5W A;  2PQ8 A;  3VFZ A;  3VWB A;  1NH3 A;  2HYG D;  2ZJP F;  4RMN A;  4I02 A;  3IL2 A;  2MD0 A;  3LSG A;  5CPR B;  1E0E A;  4M73 A;  3RYP A;  3H0G J;  1DP3 A;  3RYR A;  1BM9 A;  1SVO A;  4KT6 A;  2EZK A;  5EEH A;  1P7J A;  4DZP A;  2QF7 A;  3I53 A;  4PJN A;  3W3C A;  4ITV A;  5D6F A;  1S7E A;  3KYD B;  1LDK B;  3MZH A;  2GM4 A;  4IXA A;  3DF8 A;  1O7L A;  3HZJ A;  4Z2Y A;  4AIH A;  1R22 A;  5F04 A;  3K2A A;  1Z7L A;  3GTO J;  5BMZ A;  3QOP A;  3SJM A;  2W7N A;  1ETV A;  3G71 I;  1MKM A;  2L02 A;  2NYX A;  2WAQ A;  4ZYD A;  2M8E A;  5HVQ C;  2IRF G;  3FMR A;  2OTL I;  1O7F A;  1OCT C;  2HS5 A;  2UZK A;  4KMU X;  5KVR A;  2DFH A;  2MBF A;  2QEX I;  1UZC A;  3ZQG A;  3K70 D;  2FQ3 A;  3MKW B;  2Q1Z B;  4M6Y A;  1W7P D;  5HDN A;  1OJL A;  1JGS A;  1ZRD A;  1FMW A;  3A01 A;  1BN5 A;  4R79 A;  1JHF A;  4HF0 A;  5BS6 A;  2Y75 A;  3IC7 A;  3BJO A;  4M9X A;  3A4C A;  4OMZ A;  2Q8K A;  3GFM A;  1BOB A;  2XSD C;  4P1W A;  1D0Y A;  4ZC3 A;  2JJ7 A;  3E6D A;  3KIO A;  3PO2 J;  2R7S A;  5AON A;  2KJC A;  2VBZ A;  2ELH A;  2ZXW H;  2ID3 A;  4X0G A;  3WOD F;  2F4I A;  3D0S A;  4QWQ A;  1ON2 A;  4ESJ A;  1DU6 A;  3ZMU A;  2QQ8 A;  3K4B A;  1WH5 A;  2XF5 A;  4MNU A;  2CQX A;  1ENH A;  3HRM A;  4GXO A;  3TO6 A;  4CIC A;  1TWA J;  2XDV A;  4IHS A;  2HTS A;  1PJR A;  1R7J A;  5F0F A;  3WTV C;  2HOA A;  1HW2 A;  1Z77 A;  2DOA A;  2F4O B;  3ERE D;  2ECC A;  1ETQ A;  3CC4 I;  2XB5 A;  1MZB A;  3HOZ J;  4KDP A;  4II3 A;  1SMY F;  4XN3 A;  2EIK H;  3WE3 A;  2A6E F;  5JVT A;  2O61 A;  4D5F A;  2XB0 X;  4M3E A;  4MQV A;  1MW7 A;  4PGH A;  4BAY A;  1HDP A;  4XQF A;  4YFK F;  1T98 A;  3K4K A;  3TO9 A;  3NWS A;  1G6N A;  3G1L A;  4LIT A;  1SAN A;  4IRI A;  2CW0 F;  3RIR A;  1GUU A;  4IHW A;  2GA1 A;  4A6D A;  1W36 D;  3EUH C;  4CUG A;  2XHK A;  4XM3 A;  4B4C A;  2HNH A;  4BHC A;  3QP6 A;  1IJW C;  2FBK A;  3DBR B;  4M3D A;  2A6H F;  2QVO A;  3BQY A;  3I54 A;  2HGC A;  3ELK A;  2OPT A;  3C18 A;  3HOT A;  2P0W A;  3WGG A;  2PJR A;  5J1U A;  1EV7 A;  4RGR A;  2XRL A;  4ZYH A;  2VQC A;  3LAP A;  2VJI A;  2LFB A;  3M7G A;  3I59 B;  1MBE A;  1FIP A;  4A3M J;  1FC3 A;  1WZ2 A;  1WI9 A;  2CJJ A;  2GIV A;  2I8D A;  2MFZ A;  1BA5 A;  1MMG A;  5E3L A;  2EIM H;  4HX4 A;  4LD5 A;  2VQH A;  4BNC A;  1QHG A;  5EGO B;  1GXP A;  2I5U A;  5BNG A;  4PCQ A;  1U5T B;  3W2V A;  1R5H A;  4IL6 C;  1TQM A;  4HSR A;  3I71 A;  1JKP C;  2Z1D A;  2E60 A;  2R7X A;  4P96 A;  2E2H J;  2K5C A;  2FML A;  1N75 A;  5M5W J;  3IH2 A;  3IAM 2;  3CCQ I;  2R0Q C;  4XNF A;  4HZF A;  2TDX A;  2ZSH B;  4IHX A;  6PAX A;  1IO2 A;  1U78 A;  4CGZ A;  2Z16 A;  2RV8 A;  1XDU A;  3P9C A;  1UB9 A;  2R3S A;  5HDK A;  3UNG C;  1B8I B;  2G7U A;  2MA3 A;  2XVC A;  2ECB A;  3U2R A;  4WK8 F;  4BE1 A;  3BG6 A;  3DEW A;  5CVJ A;  5FKK A;  2E2J J;  1IN5 A;  3OIQ A;  2BW3 B;  2A3S A;  3SQN A;  4BEH B;  4HNV A;  5JHU A;  1PVE A;  1R5I D;  1OIS A;  2MH2 A;  4L5J A;  2DBB A;  2PLY A;  4KA4 A;  4HNT A;  1D0Z A;  1Z91 A;  4EJO A;  4XKB A;  4YFN F;  3EYY A;  3LA2 A;  5ILV A;  2DFF A;  3ZQL A;  1R9T J;  3BP8 A;  2V1X A;  1YQA A;  4M3F A;  1RRJ A;  2BVL A;  4HF1 A;  5GPC A;  4I0B A;  3B6C A;  3JRC A;  2XRN A;  3AG1 H;  4EQQ A;  5D5V B;  4C30 A;  4IPA A;  2DA1 A;  4MIM A;  3IHU A;  4HV5 A;  3S2W A;  5J6X A;  4BE2 A;  5F0H A;  4ENN A;  2GXG A;  4G8X A;  4LLL A;  3DPL C;  4UVA A;  4AID A;  3NAR A;  2M30 A;  3R61 A;  3ZQQ A;  3S2H J;  1G4D A;  3WTU C;  4F92 B;  1MMD A;  5E18 F;  2HU9 A;  2PEX A;  1WSU A;  4I76 A;  2FOW A;  1FT9 A;  2MH9 A;  3GWZ A;  2MD5 A;  1Y0N A;  4UB8 C;  2VJJ A;  2ESN A;  3CCL I;  3IWF A;  4BQQ A;  2XAS A;  1JUS A;  2CMP A;  4A6E A;  1F9N A;  5EEA A;  2ZSI B;  3QPL A;  3MKZ A;  3WGH A;  3CCJ I;  2VXZ A;  1Y8R B;  3ISP A;  1K7A A;  1YIT I;  3ASO H;  3KEO A;  3RQI A;  2K3P A;  3IWZ A;  2IT0 A;  4IX7 A;  4BHP A;  2OBP A;  2X1E A;  2ZC2 A;  3HKZ N;  4I7H A;  3H5N A;  3I56 I;  4O3M A;  2QQB A;  5H2F C;  4KFC A;  2WAQ N;  3OSF A;  3I4P A;  2WV1 A;  2AQE A;  3O2P E;  2H94 A;  2JUC A;  5J8C A;  1X1A A;  2K9M A;  3CJR B;  2QQA A;  4ZYE A;  2YSR A;  2JVG A;  2EIN H;  2L9N A;  4IQ4 A;  2NVY J;  3AG4 H;  2ZBK A;  1ZAO A;  5AIP A;  2L9R A;  3F6V A;  3H3Z A;  1JT0 A;  2MW8 A;  2X6W A;  1AKH B;  2LD5 A;  3E5Q A;  3T8T A;  1LNW A;  4A0Z A;  2HXO A;  2CWE A;  3DP7 A;  3PFI A;  2EK5 A;  1W5S A;  5B3S H;  2XC7 A;  2H09 A;  3PSF A;  2JQ7 A;  4RBO A;  2O9L A;  2E1M B;  3BR3 A;  1X1D A;  5C4J J;  3HSR A;  4ZYG A;  2R92 J;  1KON A;  3PQK A;  2FF4 A;  3ABU A;  1MMS A;  5K7Z A;  3VB2 A;  2R93 J;  2XGD A;  3VYU B;  5M3M J;  3OYC A;  3CC2 I;  2QQ9 A;  1OCP A;  4A3J J;  1TWH J;  5J1Y A;  4DBQ A;  1NK2 P;  2KHM A;  2M2E A;  1S29 A;  3Q5F A;  4G7O F;  9ANT A;  4XKW A;  2DT5 A;  3MZ8 A;  1G8X A;  4EJV A;  2VE9 A;  2EIL H;  3MEX A;  3S3N A;  1KQ9 A;  3V42 A;  4ZTF A;  5FKM A;  1ZKG A;  2FMY A;  1IUF A;  3K4L A;  3GX4 X;  1VTN C;  4HST A;  5TJJ A;  4EVI A;  3PNT A;  4QPO A;  4EJW A;  3S1R J;  1K78 B;  2DOD A;  1A36 A;  2ZNZ A;  3VSK A;  4ESF A;  2Y30 A;  2LRD A;  1U5T C;  2LRE A;  2VC1 A;  4JP0 A;  3CCS I;  3Q9S A;  1K6Y A;  1LJ9 A;  4R8H A;  3BG3 A;  2ZJQ F;  4XMY A;  5KAF C;  3LFK A;  2PFB A;  4UY8 I;  3CF2 A;  2LYC A;  3IKV A;  4U0Y A;  2XRO A;  4CYC B;  3EYI A;  4UV9 A;  4KIB A;  4N9I A;  3QPH A;  3OMY A;  2GZW A;  5HLH A;  3TMO A;  4P9U A;  1YYV A;  2QCO A;  3GZN B;  4O5V A;  3L2W A;  5D5U B;  3BZ6 A;  3OR2 C;  1WPK A;  5F64 A;  4A3L J;  3I59 A;  3LA7 A;  3OYI A;  1Y39 A;  3E5U A;  4D7N A;  1K61 A;  5TRD A;  4PZJ A;  4EM2 A;  2B0L A;  5EEG A;  1JKR C;  3K9T A;  5ERI A;  2V1N A;  2NVX J;  3NAU A;  2CUF A;  1U8R A;  3SFI A;  2PBI A;  3T1B A;  2OUM A;  2JRT A;  3L9F A;  2COB A;  3LA3 A;  3KYL A;  1Q1V A;  3PQJ A;  4BQA A;  5M3F J;  2PJP A;  1OKR A;  1MD0 A;  3SZG A;  1B72 B;  3BJ6 A;  2IXS A;  5C4X J;  3KP4 A;  3L2V A;  1H88 C;  1JTY A;  3F9K A;  3TW6 A;  5DUK A;  4XK4 A;  4L0Y B;  3SXY A;  4OAY A;  5DDG A;  3A0B C;  1B8I A;  3RQ4 A;  2G7H A;  4MQ9 F;  2XGC A;  1N77 A;  2YU3 A;  1WI3 A;  2CRG A;  2Q0O A;  4YG2 F;  3PL8 A;  4S0H B;  1T39 A;  4O6J A;  1MH3 A;  2BW3 A;  4AU7 A;  4BEH A;  5BPI A;  2UXX A;  1SC7 A;  1HBX G;  5EYR A;  3W6J B;  1FSE A;  3WTY C;  2IGN A;  3EDP A;  3HC7 A;  1MJ9 A;  1P7I A;  2BEO A;  1R71 A;  3GFJ A;  3KPH A;  3OWT A;  3PNV A;  3F3X A;  5L3B A;  1OPC A;  1POG A;  2PMU A;  1GVJ A;  2X51 A;  2GBY A;  4PUS A;  4NC8 A;  2E2I J;  5IT3 A;  3IH4 A;  4CCJ A;  2JUG A;  2K85 A;  2LY2 A;  3NRV A;  4CO8 A;  1QVU A;  2X0L A;  1D5V A;  1S7O A;  3H5R A;  3FM5 A;  3GLL A;  1TW2 A;  1KQ8 A;  2VAS A;  1JGG A;  1EJ9 A;  1I39 A;  1X19 A;  1YX3 A;  3GF2 A;  2DPU A;  2LH9 A;  3I55 I;  4N0B A;  3E7L A;  1WJF A;  2CG4 A;  4EAT A;  3GFI A;  4C2U A;  4KIS A;  1V5F A;  4OIP F;  4C9Y A;  3IAS 2;  3X2Q H;  5GP9 A;  3CDL A;  2LK2 A;  4KIT B;  1VFC A;  2O0Y A;  2FBH A;  2FRH A;  4HW0 A;  3CMM A;  2WB1 A;  3E6C C;  2DJI A;  1J7K A;  5H20 A;  2E1M C;  2IGK A;  3KP7 A;  2DN0 A;  1YE9 A;  2DT7 B;  2COM A;  1BI3 A;  1RKT A;  2X85 A;  4PJJ A;  1MSF C;  3SEQ A;  3RKQ A;  1L3L A;  1B59 A;  4J01 A;  4IOC F;  4JBA A;  2DA2 A;  3BC8 A;  5FKN A;  4CA0 A;  2L7M P;  5L3F A;  1ZGW A;  3ZP5 A;  1HCR A;  3T8R A;  4KJZ A;  3ROU A;  2P5V A;  3H3V K;  1AKH A;  2EFP A;  4ON0 A;  2R7O A;  4RM2 A;  2FD5 A;  3DBL B;  1X3W B;  3BTC A;  1AOY A;  4BHB A;  2QSH X;  2GIZ A;  3W2A A;  2FU4 A;  1GXQ A;  1BR4 A;  3R0J A;  2R7U A;  3JSP A;  3N97 A;  4L0Z B;  2R4G A;  5TGT A;  2QSG X;  4A0X A;  3HGG A;  1B1B A;  1OYI A;  2DMT A;  3F8C A;  1VQL I;  1O3S A;  1FP1 D;  2L7K A;  4BYY A;  2A6T A;  3M07 A;  3TP3 A;  3CCV I;  2ICW G;  4P5O A;  2E34 A;  2FQ4 A;  1MDM B;  4A3E J;  4KIG A;  3WTZ A;  2CUJ A;  2LR8 A;  3Q0U A;  1D3Y A;  2XSJ C;  4AM3 A;  2DQR A;  4YFX F;  1WJB A;  2R7V A;  5FLX Z;  2M87 A;  4XBF A;  4M6X A;  2QA4 I;  3EET A;  1WJE A;  3DU5 A;  2M1B A;  2D5V A;  2HTJ A;  1XB4 A;  3FDY A;  3O8H A;  1D5Y A;  1PDN C;  3FXR A;  4DGW B;  5DUI A;  2IS6 A;  3NQO A;  1RC9 A;  4A0Y A;  4PSW A;  4WCG A;  2BY0 A;  4E4H A;  2WY8 Q;  2Z9O A;  4C3J J;  1OMI A;  2VT2 A;  1R58 A;  1K78 A;  3RI4 A;  2XPW A;  3VPR A;  4YII A;  4C2M J;  5IY5 H;  1Y1W J;  2CGP A;  3H9G A;  2DK8 A;  3GME A;  3A2K A;  4XR6 A;  1W5C C;  3QOD A;  2J5O A;  3H0D A;  1DGR M;  2KFD A;  4QLC U;  3M1E A;  3RZD J;  1P4A A;  2HWV A;  3S1M J;  4XKV A;  2P8T A;  4CYC A;  1O3Q A;  1ZQ3 P;  3LSR A;  3OS0 A;  2ZB9 A;  2H1K A;  5HLT A;  1LUJ B;  4OMY A;  2F5D A;  3GLX A;  2W00 A;  2HFH A;  5JLW A;  2WV0 A;  2K9L A;  3BR5 A;  1W5T A;  4J00 A;  5HS7 A;  3FXU A;  5JFR A;  2A69 F;  3I3L A;  3HUG B;  3GVA A;  4A93 J;  4WWC A;  3BR1 A;  2WAF A;  2KDZ A;  1FOK A;  3M8J A;  2ZME B;  4Q48 A;  5IT9 Z;  1FBU A;  4IOA F;  1IUY A;  4BS9 A;  1OYY A;  1RET A;  3RPU A;  3OYL A;  4FTH A;  1ZGJ A;  3HOW J;  1EH8 A;  2TRT A;  3ABK H;  1MMA A;  4PGG A;  1FEX A;  5IYC J;  2B63 J;  2E19 A;  4Q4Z F;  1YS6 A;  3F8M A;  4Y4R A;  3TL4 X;  5J3L A;  1ZHF A;  3AFH A;  3ZPL A;  1WRJ A;  4LMY A;  3OYB A;  2W85 A;  2WA0 A;  4AVZ A;  1Z67 A;  1W36 C;  1BL0 A;  2YS9 A;  1H9T A;  1X1C A;  3VEP A;  3IP4 B;  2ZXI A;  1APL C;  1Z21 A;  3M8F A;  5J40 A;  2LSO A;  1BOA A;  5E8G A;  3ZN0 A;  4YRV A;  1WJ5 A;  2LKP A;  3C7J A;  2RQP A;  2OZ6 A;  1RIO H;  4MGR A;  2ID6 A;  2Y9Z A;  1HQC A;  2KL4 A;  3B6A A;  2KZV A;  1D8J A;  2K9S A;  2QGU A;  4ESB A;  5L3D A;  3OR1 C;  3OL4 A;  3G1M A;  2VKE A;  1GVD A;  2ISY A;  3QOE A;  2Z33 A;  1T38 A;  4KIF A;  1VQK I;  2ELJ A;  5FLX K;  5DD4 A;  4B3X A;  3HYI A;  4OWR B;  3FXK A;  3JCU C;  3FHN A;  3ASN H;  1FBQ A;  4G6D A;  1WJD A;  3F8B A;  4U7D A;  1LVK A;  2OCE A;  5J1R A;  1FPQ A;  3FK7 A;  1LQ1 A;  1K83 J;  1OCR H;  3G1O A;  4NB5 A;  4E7Z A;  1IDY A;  3K6G A;  5HOD A;  2P5L C;  5BPD A;  4B09 A;  1XPX A;  2B9S A;  4C2T A;  1T08 B;  5IYB J;  2R5Y B;  4W1U A;  1BJA A;  2LTP A;  3S3M A;  3RTR A;  2IS4 A;  4Y33 A;  3DTE A;  2LBF B;  3AG2 H;  1J2X A;  1SFK A;  2DCE A;  4FT8 A;  1TWC J;  4RAG A;  1J09 A;  4UVC A;  2EFW A;  4IHT A;  4OIO F;  1TL8 A;  3OOP A;  4I0A A;  2E1N A;  3SZT A;  4LLN A;  5FFZ A;  2DT6 A;  2CSO A;  2FUG 2;  3DWL E;  1EH7 A;  3J81 Z;  2HYJ A;  4GGG A;  3FMQ A;  4NBQ A;  3LWF A;  4Y17 A;  5LLQ A;  1U6G A;  3H3U A;  3WU0 A;  2CV1 A;  3S8P A;  4BQN A;  1VQ6 I;  2JA7 J;  3NWT A;  5GAH J;  2WB1 N;  4L9J A;  2XPU A;  1J0R A;  4HG2 A;  4Z6Y A;  1MNM C;  3KLN A;  1EA3 A;  3A0H C;  4RDU A;  2WY7 Q;  2Y31 A;  1ETY A;  5A2Q K;  4M9S A;  4DZJ A;  2BGC A;  1LDD A;  2EV6 A;  4Y15 A;  5CYV A;  3CZ6 A;  1A04 A;  2MSY A;  1HST A;  2JT1 A;  1X58 A;  4BXF A;  1Q1H A;  2VOD A;  1T2K A;  4XOT A;  2RDP A;  3GO5 A;  5FO5 A;  5IT9 K;  3ZMV A;  3HJE A;  3BQZ A;  3F8F A;  4JYK A;  4XRM A;  1TBX A;  5ILS A;  4RGS A;  2WBM A;  3CJQ B;  4MFD A;  1TQP A;  3MQ0 A;  4A5N A;  2HDD A;  5JVG F;  1OLT A;  3EUA A;  3FX3 A;  4NQW B;  2AHQ A;  3OOU A;  5BOX A;  3PUB A;  2EA2 A;  4RA2 A;  3LQQ A;  1ETK A;  2R7T A;  1DGW Y;  4BL0 B;  3LSJ A;  3T0Y A;  2HOT A;  5L3G A;  1VQ5 I;  1XS9 A;  3I0T A;  1R6R A;  1JKQ C;  5DCM B;  5E3O A; 
#chains in the Genus database with same CATH homology
 1S8N A;  3U9G A;  3WE2 A;  3KP2 A;  2QBY B;  3BY6 A;  1MDM A;  1I27 A;  3CDH A;  3P7N A;  3ZMZ A;  1FBS A;  4UVB A;  3KEQ A;  4IRH A;  4CYD A;  3C1D A;  5FGM A;  1BC7 C;  3COA C;  4EGZ A;  3TDU C;  3ECH A;  3FM3 A;  3M8E A;  1F1Z A;  1K79 A;  1RUN A;  3CLO A;  3ECO A;  1XMK A;  3N4M A;  3EUH A;  2OA4 A;  5K5O A;  1K6O A;  4WXC A;  3T5X A;  1ZG3 A;  3Q9V A;  4KN7 X;  1HW1 A;  2FA5 A;  3ZMS A;  3WTS C;  1USS A;  3J81 K;  1Z1D A;  4R1H A;  1BI0 A;  5LEJ A;  3V7R A;  3TGN A;  2FBI A;  2HYF A;  5D4S A;  1I1S A;  2Z99 A;  3HUG A;  1YW7 A;  3ABT A;  1TNS A;  2FEZ A;  2ZME A;  3HHH A;  4KIC A;  3DEU A;  1XD7 A;  5DYM A;  5K1Y A;  1MGT A;  3MZY A;  2W24 A;  3ZMD A;  3HSE A;  5HLI A;  1SFU A;  2ETH A;  1P4X A;  2IVM A;  3KFW X;  1P92 A;  3TOA A;  4U88 A;  5ILU A;  1IRF A;  3WGI A;  3G3Z A;  1W4M A;  3ML6 A;  5DCF A;  2EV0 A;  3KLO A;  1FY7 A;  3O3K A;  2EFN A;  4HDU A;  5CVU A;  5LHG A;  2F2E A;  3J7A O;  3EQL F;  1ZG1 A;  2H27 A;  2EB7 A;  1DPU A;  1ON1 A;  2KJB A;  3QPT A;  5LHH A;  1L0O C;  2VT3 A;  4BH9 A;  3WTX C;  4WXH A;  2J5P A;  4U0W A;  2WTE A;  1SD5 A;  3V7C A;  2OAZ A;  3P9K A;  1J9I A;  2IJL A;  4WXD A;  3HRU A;  1ZGA A;  2DU9 A;  4L18 B;  2DI3 A;  4MHG A;  1IN4 A;  4ZZL A;  5LBQ A;  5CVI A;  2FOK A;  4UNO A;  2O03 A;  1P6R A;  4HF2 A;  4GO1 A;  4GYG A;  4IJA A;  1R36 A;  2A61 A;  2EWN A;  4U7B A;  2HR3 A;  4M71 A;  3JSO A;  4FX4 A;  1B6A A;  1YS7 A;  2D45 A;  1F4K A;  4A12 A;  3TO7 A;  3RJP A;  2ZNY A;  4OIR F;  3G73 A;  5D8K B;  2OZU A;  4BXU A;  3CUQ C;  5DCM A;  5HS8 A;  3CTA A;  3HIF A;  1PP8 F;  2QBY A;  3FF5 A;  3E3V A;  2ADU A;  4LFU A;  2V1D A;  2AS5 F;  5CLS A;  2HEO A;  3GYH X;  4KNY A;  1XSX A;  1ZLK A;  1T0F A;  2FE3 A;  3GZ6 A;  2K86 A;  2EFO A;  2HDC A;  1FYL A;  1IRG A;  1W7P B;  3FZV A;  1XSV A;  4CXF A;  1U5T A;  3KE2 A;  2L01 A;  4HBL A;  4HAM A;  3QRF F;  1S6L A;  5BQT A;  2O6G E;  4XSZ F;  2E7W A;  5E1W A;  5FD6 A;  1I1G A;  4P55 A;  3MAJ A;  1KYZ A;  1UHW A;  4JQF A;  4XSX F;  2DLL A;  4GYI A;  3WTT C;  2DO7 A;  3TQN A;  3DXJ F;  4B8X A;  1STZ A;  3DPT A;  1U3E M;  3U1D A;  1XCV A;  1XMA A;  2ZO4 A;  1R1U A;  2GWR A;  3O6B B;  2DQL A;  3LQR A;  1QZZ A;  3KET A;  1UST A;  1J5Y A;  1B4A A;  3F6O A;  4ZH4 F;  3KP6 A;  1FX7 A;  1KU2 A;  4HA8 A;  1SD6 A;  4U0V A;  2F5F A;  1F5T A;  5JI6 A;  4KUM A;  4WX9 A;  1YO5 C;  2BV6 A;  4OIQ F;  1XGM A;  4RAZ A;  3HRT A;  3ZMT A;  4G7H F;  1IW7 F;  2V9V A;  2G9W A;  1BI1 A;  5D6E A;  4M72 A;  1DDN A;  3KCC A;  3BJA A;  3JW4 A;  3CUO A;  4HOB A;  4I09 A;  2VBW A;  5LGU A;  1FLI A;  2QUF A;  1ZYR F;  3BPV A;  3V8J A;  1NHA A;  2Y0M A;  2QM3 A;  1HW5 A;  4MTD A;  2QLZ A;  4UV8 A;  4I98 B;  2W25 A;  1RUO A;  3F22 A;  2K7L A;  2DK5 A;  1QPM A;  1YW8 A;  1TW3 A;  4HYE A;  3HHG A;  2V1U A;  3E6M A;  5HLG A;  4LK1 F;  3R60 A;  3I58 A;  4EM0 B;  3GUD A;  3BRO A;  1QQI A;  2CO5 A;  2F5E A;  4IRG A;  4LB5 A;  4UXN A;  4IF4 A;  4S04 A;  1AWC A;  2EV5 A;  5LGN A;  5DV5 A;  4GCV A;  3LAJ A;  4EJT A;  5D5W B;  3K0L A;  3I5U A;  4RB0 A;  1ZG5 A;  2ZCW A;  3L7W A;  2VOP A;  1WKM A;  2IA2 A;  3BPX A;  3TDZ C;  4TV7 A;  5A2Q Z;  2ESH A;  3IRR A;  1SAX A;  3WG9 A;  3E97 A;  1OR7 A;  1E2X A;  4OOI A;  1W7P A;  2DW4 A;  5DD8 A;  4NHJ A;  2ZJ2 A;  2M45 A;  4OU0 A;  1TQI A;  2IPQ X;  3QP5 A;  1B9M A;  2NAZ A;  3WTW C;  2WC2 A;  2LF8 A;  3QU3 A;  5L3E A;  2RN7 A;  4PDK A;  2D1V A;  5LHI A;  3FXQ A;  1UCR A;  1R00 A;  3SFZ A;  2VBY A;  2KIU A;  2HZT A;  3H92 A;  2NRA C;  3R6S A;  1U2W A;  2STW A;  5HOO A;  2GQQ A;  3R4K A;  2H6B A;  1SFE A;  3CJN A;  4MTE A;  4UHT A;  3KP5 A;  3CO7 C;  1JHH A;  2BYV E;  4EM1 A;  2P4W A;  3MWM A;  4OIN F;  5K5Q A;  2V6C A;  3BOQ A;  5K5R A;  2BE5 F;  1XSD A;  2P6T A;  4LG0 B;  4RGX A;  2L4M A;  2IP2 A;  1JXS A;  1FSH A;  2A07 F;  2VN2 A;  5E17 F;  1KYW A;  1UFM A;  4H0E A;  5E1Z B;  4HX8 A;  1O3R A;  1V3F A;  3KZY A;  2F5C A;  4P9F A;  3MCZ A;  2WWY A;  1ZLJ A;  1XDS A;  2A5Y B;  2EFQ A;  5FD5 A;  1SD4 A;  3E6B A;  4AIK A;  1IXS B;  5E1X A;  5LRS A;  2VOO A;  4S05 A;  3IRQ A;  1ZH5 A;  2NNN A;  2KKO A;  2HQN A;  1DP7 P;  1QNT A;  2MLG A;  2W57 A;  4XLP F;  2JSC A;  4I2O A;  2IA0 A;  1WWX A;  4KT5 C;  2K4B A;  4MEX F;  1R1T A;  2FNP A;  2RGV A;  1TNT A;  3KZZ A;  4L9T A;  2Z5U A;  1ULY A;  2L3D A;  2LDU A;  2MC3 A;  4WF2 A;  2QYO A;  2DPD A;  2ISZ A;  4E70 A;  4EJU A;  5ICC A;  4A5M A;  5KK1 A;  1LEA A;  4HDV A;  2YX4 A;  1DUX C;  3RKW A;  1I5Z A;  1TLH B;  1XGO A;  3BDD A;  1ONV A;  1IXC A;  2VON A;  1G3T A;  2W84 A;  1G3W A;  1QGP A;  2GAU A;  2ZXJ A;  2OQG A;  3CUQ B;  2R7F A;  2R7D A;  3B02 A;  5H6R A;  1LVA A;  4LGW A;  2FXA A;  3V7S A;  1H9G A;  2P7V B;  3ZQ7 A;  2Q2E A;  1IZ1 A;  1ZRF A;  3I64 A;  2Y48 A;  4AIJ A;  2HQR A;  2RC4 A;  3ULQ B;  2PG4 A;  2LNB A;  3E5X A;  2D2W A;  3VOD A;  1KU7 A;  2PMH A;  3SZP A;  4XRF A;  5LRR A;  5FFX A;  4I01 A;  2V79 A;  5JR3 A;  2XIG A;  4EGY A;  1IN8 A;  3JTG A;  1J59 A;  4F7Z A;  1CGP A;  4Q5S F;  2BBY A;  2EJR A;  5E8I A;  3QAH A;  2LF7 A;  3GFL A;  2XAQ A;  1SD7 A;  4EV0 A;  1PUE E;  4RB3 C;  1FYM A;  2KIM A;  2D1H A;  1V4R A;  4FX0 A;  4AD9 A;  1SMT A;  2VE8 A;  1X3U A;  2XGX A;  1REP C;  3FHZ A;  1ZAR A;  4CDG A;  5H6Q A;  4L5I A;  1H0M A;  4KMF A;  1BBY A;  1G3S A;  1YLF A;  1FWZ A;  3LST A;  4LG0 A;  1HKQ A;  4ETS A;  3V8L A;  2XV4 S;  3RKY A;  4RB2 C;  4ASN A;  4XLN F;  5CVV A;  5D4R A;  3C3W A;  3AAF A;  2NNY A;  2NS0 A;  3FMS A;  4M9Z A;  2CQK A;  5LGT A;  2FNA A;  3JAM Z;  1Z7U A;  1Z9C A;  3HSF A;  4FHT A;  2UWM A;  1T6S A;  2GXB A;  2A68 F;  4ENM A;  3KP3 A;  2DTR A;  1RI7 A;  1R23 A;  1YFH A;  2ACJ A;  4KYW A;  1LEB A;  5F6F A;  2P7C B;  1C0W A;  2HKX A;  1SFX A;  3R0A A;  4NQW A;  2XUB A;  1KQ0 A;  1CF7 B;  2ZKZ A;  3F21 A;  2XAF A;  3WU1 B;  3F8N A;  4KN4 X;  1FZP B;  5F1R A;  1IN6 A;  2YPR A;  3TKY A;  1O3T A;  4M74 A;  5L3C A;  1HKT A;  4HV6 A;  4LLG F;  2L4A A;  1KU9 A;  3K69 A;  2PI0 A;  3B73 A;  1FYK A;  3HTS B;  3RDI A;  3CUQ A;  1OYW A;  1BI2 A;  1QO0 D;  5CVR A;  4RAY A;  4ZZD A;  3K1M A;  4CHU A;  4LK0 F;  5J8F A;  2O8X A;  5AIQ A;  1LDJ A;  2XAH A;  3RPQ A;  2VBX A;  4JK1 X;  2JPB A;  2DAO A;  3GEZ A;  2K02 A;  3HRS A;  4YIF A;  3JAM K;  4L9N A;  3L09 A;  1WQ2 A;  4Q47 A;  1UHM A;  5HDG A;  1FP2 A;  4L9V A;  3DKW A;  5LEK A;  1IF1 A;  1FNN A;  3L2C A;  1BC8 C;  4LJZ F;  4HQE A;  2RVC A;  5E20 A;  1MJB A;  1RZ4 A;  3RKX A;  3SHF A;  4AVP A;  4ENJ A;  1YG2 A;  1XCB A;  2C6Y A;  2GA2 A;  3GZ5 A;  1YTY A;  1R5G A;  1HSJ A;  2RKH A;  2STT A;  1QBJ A;  1S3J A;  3W6K B;  1P4W A;  4RS8 A;  1Y0U A;  1GHC A;  3CO6 C;  2DFI A;  4EMS A;  4CZZ A;  3OV8 A;  1XN7 A;  5DEQ A;  2MLK A;  2VC0 A;  5D5X B;  3REO A;  1Z05 A;  3J80 Z;  2QWW A;  3F72 A;  2QEN A;  1ZRC A;  3GW2 A;  2QZ8 A;  2X4H A;  2YX7 A;  2XAJ A;  2P5K A;  3K2Z A;  2OD5 A;  1RNL A;  2JZY A;  1MJA A;  3P9I A;  2FSW A;  3DFG A;  3M9A A;  3NEU A;  2OQR A;  1P2F A;  1Z6R A;  4G9Y A;  1ODD A;  4HLX A;  1R1V A;  1ZRE A;  1PP7 U;  2P6S A;  5CJ9 A;  1Z6T A;  2K4J A;  2IA1 A;  2AXL A;  5FB2 A;  3JTH A;  2XAG A;  2L54 A;  1DPR A;  4N9H A;  4HX7 A;  2HOE A;  1EH6 A;  2E7X A;  4DQ2 A;  4ENK A;  1XGS A;  1O57 A;  1I6X A;  2ZFW A;  3L00 A;  1CF7 A;  1IN7 A;  2KIF A;  1BIB A;  1IXR C;  2KRF A;  1J75 A;  3K1N A;  4UUV A;  2O3F A;  3DQV C;  5ED4 A;  5ICE A;  4HLY A;  1HKS A;  3K1P A;  2UXN A;  5HS9 A;  3HTU A;  3F23 A;  4DNC A;  1B9N A;  2XKP A;  2IW5 A;  2HKO A;  3BWG A;  2K27 A;  1BIA A;  4IVN A;  3D5L A;  2CYY A;  2YR2 A;  4MEY F;  3J80 K;  4HQM A;  2JPC A;  2PN6 A;  2CFX A;  3QU6 A;  3FWE A;  1IAW A;  1D8K A;  3VOE A;  4AWX B;  3GXO A;  2OU2 A;  2JTV A;  5ICG A;  4RGU A;  2E1C A;  3ZN1 A;  1E17 A;  1YIO A;  2H6C A;  3HOS A;  4K2E A;  1YW9 A;  1ZN2 A;  2Z3Y A;  5D8L B;  4LB6 B;  1G3Y A;  1S7A A;  2RNJ A;  4G6Q A;  3V4G A;  4RB1 A;  4Y13 A;  4A2U A;  3MFK A;  5ICF A;  1QZY A;  1KGS A;  1HXD A;  4G7Z F;  2XKO A;  3DV8 A;  1JE8 A;  1TTY A;  1XGN A;  3V8K A;  4G94 A;  3TOB A;  1KU3 A;  2EA4 A;  4D0P A;  1KA8 A;  3IKT A;  1LB2 A;  2M5W A;  2PQ8 A;  3VFZ A;  2HYG D;  4I02 A;  3IL2 A;  4M73 A;  3RYP A;  3RYR A;  1BM9 A;  5EEH A;  3I53 A;  5D6F A;  1LDK B;  3MZH A;  4IXA A;  3DF8 A;  1O7L A;  4Z2Y A;  4AIH A;  1R22 A;  5BMZ A;  3QOP A;  1MKM A;  2L02 A;  2NYX A;  4ZYD A;  2M8E A;  5HVQ C;  2IRF G;  3FMR A;  1O7F A;  2HS5 A;  2UZK A;  4KMU X;  5KVR A;  2MBF A;  2FQ3 A;  4M6Y A;  1W7P D;  5HDN A;  1ZRD A;  1JGS A;  1BN5 A;  4R79 A;  1JHF A;  4HF0 A;  5BS6 A;  2Y75 A;  3IC7 A;  3BJO A;  4M9X A;  4OMZ A;  2Q8K A;  3GFM A;  3E6D A;  5AON A;  2KJC A;  2VBZ A;  2ELH A;  3WOD F;  4QWQ A;  3D0S A;  1ON2 A;  4ESJ A;  3ZMU A;  4MNU A;  3HRM A;  4GXO A;  3TO6 A;  4CIC A;  4IHS A;  2HTS A;  1R7J A;  3WTV C;  1HW2 A;  3ERE D;  1MZB A;  4KDP A;  1SMY F;  3WE3 A;  2A6E F;  5JVT A;  2O61 A;  4MQV A;  4PGH A;  4BAY A;  4YFK F;  1T98 A;  3TO9 A;  1G6N A;  4IRI A;  2CW0 F;  3RIR A;  2GA1 A;  4A6D A;  2XHK A;  4BHC A;  3QP6 A;  2FBK A;  2A6H F;  2QVO A;  3I54 A;  2HGC A;  3ELK A;  3C18 A;  3HOT A;  3WGG A;  1EV7 A;  4RGR A;  4ZYH A;  3LAP A;  3M7G A;  3I59 B;  1FC3 A;  1WI9 A;  2GIV A;  4HX4 A;  4LD5 A;  4BNC A;  1GXP A;  4PCQ A;  1U5T B;  1R5H A;  1TQM A;  3I71 A;  4P96 A;  2FML A;  4HZF A;  2TDX A;  6PAX A;  1U78 A;  4CGZ A;  2RV8 A;  1XDU A;  3P9C A;  1UB9 A;  2R3S A;  5HDK A;  2G7U A;  2MA3 A;  2XVC A;  4WK8 F;  3U2R A;  5CVJ A;  1IN5 A;  2A3S A;  3SQN A;  5JHU A;  2MH2 A;  2PLY A;  4L5J A;  2DBB A;  4KA4 A;  1Z91 A;  4EJO A;  4YFN F;  3EYY A;  3LA2 A;  5ILV A;  3BP8 A;  2V1X A;  1YQA A;  4HF1 A;  4I0B A;  2XRN A;  5D5V B;  4EQQ A;  4IPA A;  3IHU A;  4HV5 A;  3S2W A;  5J6X A;  4ENN A;  2GXG A;  4G8X A;  4LLL A;  3DPL C;  4UVA A;  2M30 A;  3R61 A;  1G4D A;  3WTU C;  5E18 F;  2PEX A;  1WSU A;  3GWZ A;  1FT9 A;  2MH9 A;  2MD5 A;  2ESN A;  3IWF A;  2XAS A;  4A6E A;  1F9N A;  3WGH A;  2VXZ A;  3ISP A;  1K7A A;  3KEO A;  3IWZ A;  2IT0 A;  4BHP A;  2OBP A;  4I7H A;  4O3M A;  2QQB A;  4KFC A;  3I4P A;  3O2P E;  2H94 A;  5J8C A;  2QQA A;  4ZYE A;  2YSR A;  2ZBK A;  1ZAO A;  5AIP A;  3F6V A;  3H3Z A;  3E5Q A;  3T8T A;  1LNW A;  4A0Z A;  2CWE A;  3DP7 A;  3PFI A;  2EK5 A;  1W5S A;  2H09 A;  3HSR A;  4ZYG A;  3PQK A;  2FF4 A;  3ABU A;  3VB2 A;  2QQ9 A;  1S29 A;  3Q5F A;  4G7O F;  2DT5 A;  4EJV A;  2VE9 A;  3MEX A;  1KQ9 A;  2FMY A;  3GX4 X;  1VTN C;  5TJJ A;  4EVI A;  4EJW A;  1K78 B;  2ZNZ A;  4ESF A;  2VC1 A;  1U5T C;  3Q9S A;  1LJ9 A;  4R8H A;  3LFK A;  2PFB A;  4U0Y A;  3IKV A;  2XRO A;  3EYI A;  4UV9 A;  4KIB A;  4N9I A;  3QPH A;  2GZW A;  5HLH A;  4P9U A;  1YYV A;  4O5V A;  5D5U B;  3BZ6 A;  5F64 A;  3I59 A;  3LA7 A;  3E5U A;  5TRD A;  4PZJ A;  4EM2 A;  2B0L A;  5EEG A;  3K9T A;  5ERI A;  1U8R A;  2PBI A;  3T1B A;  2JRT A;  3L9F A;  3LA3 A;  3PQJ A;  4BQA A;  2PJP A;  1OKR A;  1MD0 A;  3BJ6 A;  3KP4 A;  5DUK A;  4L0Y B;  3SXY A;  5DDG A;  2G7H A;  4MQ9 F;  2YU3 A;  4YG2 F;  2Q0O A;  1T39 A;  4O6J A;  5BPI A;  2UXX A;  1HBX G;  3W6J B;  1FSE A;  3WTY C;  3EDP A;  1MJ9 A;  2BEO A;  3GFJ A;  3F3X A;  5L3B A;  1OPC A;  2PMU A;  1GVJ A;  5IT3 A;  3NRV A;  4CO8 A;  2X0L A;  1D5V A;  1S7O A;  3FM5 A;  1TW2 A;  1KQ8 A;  3GF2 A;  2DPU A;  4N0B A;  2CG4 A;  3GFI A;  4OIP F;  2O0Y A;  2FBH A;  2FRH A;  4HW0 A;  3E6C C;  1J7K A;  5H20 A;  3KP7 A;  2COM A;  1BI3 A;  1L3L A;  1B59 A;  4JBA A;  5L3F A;  3ZP5 A;  3T8R A;  3ROU A;  2P5V A;  2EFP A;  4ON0 A;  1AOY A;  4BHB A;  2FU4 A;  1GXQ A;  3R0J A;  3JSP A;  3N97 A;  4L0Z B;  4A0X A;  1B1B A;  1OYI A;  3F8C A;  1O3S A;  1FP1 D;  4BYY A;  4P5O A;  1MDM B;  4KIG A;  3WTZ A;  1D3Y A;  2DQR A;  4YFX F;  5FLX Z;  2M87 A;  4XBF A;  4M6X A;  3EET A;  2M1B A;  2HTJ A;  1XB4 A;  1PDN C;  3FXR A;  5DUI A;  3NQO A;  4A0Y A;  4WCG A;  2Z9O A;  1OMI A;  2VT2 A;  1R58 A;  1K78 A;  3RI4 A;  4YII A;  2CGP A;  2DK8 A;  2J5O A;  4QLC U;  3M1E A;  1P4A A;  2HWV A;  2P8T A;  1O3Q A;  4OMY A;  2F5D A;  3GLX A;  2HFH A;  2WV0 A;  1W5T A;  5HS7 A;  3FXU A;  5JFR A;  2A69 F;  3GVA A;  4WWC A;  1FOK A;  2ZME B;  4Q48 A;  5IT9 Z;  1FBU A;  1IUY A;  1OYY A;  3RPU A;  1ZGJ A;  1EH8 A;  4PGG A;  4Q4Z F;  1YS6 A;  3F8M A;  1ZHF A;  3ZPL A;  1WRJ A;  4LMY A;  2W85 A;  1H9T A;  3VEP A;  3M8F A;  2LSO A;  1BOA A;  5E8G A;  3ZN0 A;  2LKP A;  3C7J A;  2RQP A;  2OZ6 A;  1RIO H;  4MGR A;  1HQC A;  1D8J A;  4ESB A;  5L3D A;  2ISY A;  2Z33 A;  1T38 A;  4KIF A;  5FLX K;  5DD4 A;  3HYI A;  1FBQ A;  4G6D A;  3F8B A;  4U7D A;  1FPQ A;  1LQ1 A;  4NB5 A;  5BPD A;  2P5L C;  4B09 A;  1BJA A;  3RTR A;  1J2X A;  4FT8 A;  4UVC A;  2EFW A;  4IHT A;  4OIO F;  3OOP A;  4I0A A;  2E1N A;  3SZT A;  4LLN A;  5FFZ A;  2CSO A;  3J81 Z;  1EH7 A;  4GGG A;  3FMQ A;  3LWF A;  4Y17 A;  5LLQ A;  1U6G A;  3H3U A;  3WU0 A;  4L9J A;  1J0R A;  3KLN A;  5A2Q K;  4M9S A;  2BGC A;  1LDD A;  2EV6 A;  4Y15 A;  5CYV A;  1A04 A;  1HST A;  2JT1 A;  1Q1H A;  2VOD A;  1T2K A;  2RDP A;  3GO5 A;  5FO5 A;  5IT9 K;  3ZMV A;  3F8F A;  1TBX A;  5ILS A;  4RGS A;  1TQP A;  3MQ0 A;  4A5N A;  3FX3 A;  5BOX A;  2EA2 A;  3LQQ A;  3T0Y A;  5L3G A;  3I0T A;  5DCM B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...