3NQOA

Crystal structure of a marr family transcriptional regulator (cd1569) from clostridium difficile 630 at 2.20 a resolution
Total Genus 59
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
59
sequence length
187
structure length
182
Chain Sequence
DYSNELKELFLMNQTYATLFTLTNKIQIEGDKYFGILTSRQYMTILSILHLPEEETTLNNIARKMGTSKQNINRLVANLEKNGYVDVIPSPHDKRAINVKVTDLGKKVMVTCSRTGINFMADVFHEFTKDELETLWSLLKKMYRFNGEEQDGFEEDANEIDKIKSEALEEFAKRRNRVNKND
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords MarR-family transcriptional regulator
publication title Crystal structure of a MarR family transcriptional regulator (CD1569) from Clostridium difficile 630 at 2.20 A resolution
rcsb
source organism Clostridium difficile
molecule tags Transcription
total genus 59
structure length 182
sequence length 187
chains with identical sequence B
ec nomenclature
pdb deposition date 2010-06-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF12802 MarR_2 MarR family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 3nqoA00
2A69F 2DU9A 5BPIA 1B1BA 4YFXF 3ZMVA 4O3MA 4KNYA 4WX9A 5HVQC 1SFUA 1BC7C 2X4HA 2PMHA 3HRSA 4ETSA 1WSUA 2RDPA 2ZO4A 2XAJA 3V4GA 1D8KA 2DQLA 4EJUA 2XASA 4CXFA 2FEZA 1MZBA 5DUKA 3ABTA 3CO6C 1ZHFA 1XDUA 5ILUA 3FM3A 2E7WA 5LEJA 3KCCA 3QU6A 3RKXA 1YW7A 2R7DA 4MEYF 2RC4A 3RPUA 5E8IA 5FFZA 4PDKA 2KJCA 4N0BA 1MKMA 3LA2A 1ZRFA 1BI0A 2VONA 1FY7A 5LGUA 4IHSA 3WE2A 2OA4A 3ZMUA 1T38A 4L5JA 2FXAA 3ERED 1W5TA 2O8XA 1PUEE 4MNUA 2FBIA 3FXUA 2W25A 3F72A 1OKRA 5DCFA 1REPC 4CGZA 4HW0A 2KJBA 1HKSA 1MDMB 1FBUA 3HHHA 1U8RA 2IW5A 3EETA 1B4AA 1I1GA 2DPDA 2W57A 1QGPA 3ZMTA 5HS7A 2EJRA 3Q9VA 4YFKF 5FD6A 3WTSC 2A5YB 4L0ZB 5HOOA 4R1HA 4RB2C 5HDNA 3ABUA 1U6GA 4BQAA 4MQVA 5D8LB 1G4DA 5KK1A 4CICA 1YYVA 2EFNA 4GXOA 2ZCWA 1QO0D 1D3YA 4AIKA 2HOEA 4MTDA 2P4WA 3DPLC 4LFUA 3DV8A 2ZNZA 1YTYA 1GXQA 2GA1A 3DPTA 4HV5A 1L3LA 1R5HA 4M71A 2YSRA 3U9GA 3G3ZA 3V7RA 3JAMK 4WXHA 5D6EA 5TRDA 3U2RA 1GXPA 4TV7A 1HW1A 2WV0A 3L9FA 5D8KB 2DW4A 1BC8C 2P5LC 3HSEA 4H0EA 1UFMA 1U78A 4LLNA 4L18B 1SMYF 2P7VB 2A3SA 4RGXA 3BPVA 2IA1A 4HBLA 1F4KA 1KQ8A 3HOTA 5K5RA 4BNCA 5A2QK 3W6JB 4WXDA 2XVCA 3WTWC 2M1BA 1XB4A 5LRRA 3C1DA 2G7HA 1G3TA 3ROUA 3FF5A 4GCVA 2OBPA 2FBHA 4KIFA 3WGHA 4PGGA 2XUBA 4NB5A 1ZARA 2PG4A 5E1WA 5J8CA 1DUXC 4G7ZF 1FYMA 2QWWA 1R1TA 3BP8A 1F5TA 1ODDA 3JW4A 3FX3A 4IJAA 1Z91A 1FSHA 1O3SA 3IRQA 3MZHA 1MJAA 1LDJA 4EJWA 2EB7A 3TDUC 2BGCA 1YFHA 2GXGA 3E5XA 3QAHA 2Z3YA 5L3CA 3HHGA 5L3BA 2Q8KA 2QBYB 5FLXK 5E18F 2Z33A 1ZGAA 4KMUX 4A0YA 3M8FA 4UXNA 1I1SA 4LK1F 2ETHA 3H92A 3U1DA 5ICGA 2P7CB 3KEOA 1LEAA 1O3RA 4U88A 2XAFA 5BPDA 1ZREA 3F23A 3ULQB 4ASNA 3WODF 4EM1A 4Y15A 2H09A 3O2PE 3P7NA 4A6DA 1XDSA 4HOBA 3ZQ7A 1QZYA 1IXCA 2D1HA 3WTXC 2H94A 3B02A 3CUQA 4CZZA 1SD4A 1P2FA 1HKTA 2DTRA 2O3FA 1H0MA 2K7LA 5FB2A 2HDCA 3OV8A 2PI0A 1TNSA 1G3YA 2LSOA 2HKOA 1ZH5A 2RNJA 4E70A 4F7ZA 2VT2A 3P9CA 1J59A 2FF4A 1ZG1A 2OU2A 2VBYA 3O6BB 3L2CA 2ZKZA 3T5XA 4HX7A 5HLHA 3LQRA 4XSXF 4XBFA 2OQGA 3I5UA 3EYIA 3H3ZA 3EYYA 2VOPA 2XAHA 2HYFA 4MHGA 2JZYA 1LQ1A 3QRFF 5FD5A 1IAWA 4UVCA 5DEQA 4GO1A 2VODA 3WG9A 3GWZA 2HR3A 1F9NA 3H3UA 4ZZLA 2XKOA 2VOOA 2CGPA 2PEXA 1S6LA 2AS5F 5LGTA 1QNTA 4HDUA 1R1VA 2C6YA 4LB5A 1R58A 1FZPB 1K7AA 1JGSA 3LAPA 2XROA 3PQKA 2D1VA 4GYIA 2F5CA 1YS7A 3QOPA 3IC7A 2J5PA 3LAJA 5AONA 1T0FA 3F8NA 5TJJA 2HYGD 1IN7A 5H20A 2FU4A 4A2UA 1BM9A 4BHCA 5E20A 3GFJA 2JSCA 1Z9CA 4AWXB 1TQMA 1FYKA 1L0OC 1ZGJA 1I5ZA 3EUHA 3C18A 1XCBA 1R00A 1XMAA 1FT9A 1IN4A 1FYLA 2HGCA 2QLZA 3KZYA 1OR7A 4I0BA 1FC3A 1HXDA 2JT1A 4M9SA 4OMYA 2STWA 4WXCA 5J8FA 5LGNA 1P4XA 5DD8A 2G9WA 4I2OA 3K69A 4QWQA 2QM3A 2H6CA 5CVVA 2DI3A 1KYZA 2P6TA 3C3WA 3IHUA 2LKPA 4CO8A 2Q0OA 1KU7A 4G9YA 1I27A 4GGGA 4KA4A 1LDDA 3KP6A 1PDNC 4PCQA 3GW2A 1LNWA 4LG0A 1RUOA 1DPRA 4P9UA 3NEUA 2EA2A 2JTVA 4AIHA 2FMLA 3RI4A 3FMQA 3CUOA 4WCGA 1SAXA 4ENMA 3F22A 2P5VA 2RQPA 4ZH4F 2QZ8A 2A68F 1BOAA 1KQ0A 4ESFA 1R7JA 3WGGA 2GQQA 3EQLF 4ENKA 2UXNA 4IRIA 4B09A 3TO7A 4ZYDA 2EFWA 3SFZA 3TQNA 1H9TA 3CDHA 5D4SA 1IN8A 3CO7C 4RB1A 3WTVC 4U0WA 1RZ4A 3SZTA 2XV4S 1E2XA 3WTTC 1ONVA 2PQ8A 4A0XA 1KGSA 4UNOA 1SFXA 4HDVA 1QPMA 3MWMA 2ZNYA 1IF1A 5L3DA 1KA8A 3BDDA 1R1UA 2A6EF 4EJVA 1W5SA 2CO5A 4LD5A 2ZJ2A 1J75A 5LHIA 6PAXA 3E97A 2MBFA 4EGZA 1DPUA 4BH9A 4I09A 2QUFA 1K6OA 2M8EA 4JBAA 2E1CA 2DQRA 3GZ6A 5BMZA 5K5QA 3O3KA 2GIVA 2DK8A 5AIQA 2K86A 1P4WA 3LQQA 4NHJA 2FA5A 3ELKA 4FX0A 1IXSB 1ZLJA 3GEZA 1Q1HA 3CUQB 1RUNA 2O0YA 2NYXA 5JHUA 3GF2A 4XSZF 2MA3A 1TW3A 4KYWA 1U3EM 3T8RA 2MLGA 3ZMDA 5ILVA 5DCMA 1J5YA 4R79A 2ZMEA 1J2XA 4ZYEA 1FP2A 4ENJA 2KIMA 2XGXA 2CW0F 3GYHX 3K2ZA 3E5UA 3HTUA 4EGYA 3ZP5A 2K4BA 5E1ZB 1QZZA 1SD7A 4HF2A 3E5QA 2STTA 1F1ZA 4UVAA 2P5KA 4G6DA 4OOIA 3VEPA 1DP7P 2KIUA 3BOQA 3SHFA 3D0SA 1T6SA 2O03A 2YPRA 2VBZA 5JI6A 4S04A 1XGOA 2IA2A 4WF2A 3COAC 2RKHA 1T98A 2W84A 3KP4A 3J81Z 5L3FA 4HLXA 2F5DA 3HUGA 4WK8F 3M9AA 3GO5A 3I53A 3T1BA 1YW9A 3FZVA 1YIOA 2Z9OA 4A5MA 4HZFA 3L09A 1UB9A 3HRMA 4OMZA 3BROA 1BJAA 3T0YA 1JXSA 5IT3A 4UV9A 3IRRA 4ZZDA 2EFPA 2KIFA 3VOEA 5D5VB 4L9NA 4DQ2A 1IXRC 1GHCA 2XAQA 3BY6A 4EQQA 4G94A 2V1UA 3WE3A 4HX8A 3MFKA 2KRFA 2O6GE 3I64A 5L3EA 3ZMSA 4N9IA 1VTNC 3HTSB 2BEOA 3OOPA 4OU0A 3MZYA 4CDGA 1XSVA 4EVIA 5FFXA 3J7AO 1LB2A 4IVNA 2GA2A 4BAYA 2UWMA 3GUDA 2QQBA 2FE3A 2J5OA 4Q4ZF 3I4PA 1USTA 3E6CC 1IRGA 5FO5A 1YS6A 4EM2A 4P9FA 5H6QA 3HSRA 3SQNA 1EH8A 4KFCA 3REOA 4M9XA 1PP8F 3HSFA 1YLFA 2FBKA 4ZYHA 3QP5A 1XN7A 4GYGA 4L5IA 4LG0B 1MJBA 2HQNA 2W85A 4ZYGA 3KETA 2D45A 2CFXA 4OIOF 5D5XB 2HTJA 3V8KA 4G7HF 5IT9Z 1LVAA 3E3VA 5HS8A 3I54A 3CLOA 2FQ3A 2AXLA 2FSWA 1LJ9A 4RB3C 3CJNA 1BIAA 3JSOA 1IUYA 3ZN0A 2XRNA 2PJPA 2HWVA 2FOKA 1Z7UA 4BHBA 4EJTA 2M5WA 2IPQX 1FP1D 1XMKA 2ISYA 2R3SA 2ZXJA 3J80Z 1HW5A 1U5TA 2ESHA 4HF0A 1CGPA 3FMRA 2Z5UA 2VXZA 5E8GA 1WWXA 3F8MA 3I0TA 3I58A 4BYYA 2KKOA 1QBJA 5HS9A 5H6RA 4I98B 3GVAA 2MLKA 2XHKA 1IN5A 1FNNA 4UHTA 1TLHB 4N9HA 2TDXA 1O3TA 3LA7A 5ICFA 2HQRA 1HSJA 2OQRA 2IVMA 1W7PD 4M9ZA 1EH7A 5DUIA 2H6BA 2EK5A 1BN5A 1NHAA 3N97A 1SMTA 4CHUA 4PZJA 3WTZA 3KLNA 1Y0UA 2H27A 4Q47A 2HEOA 1UCRA 5ICEA 2DAOA 1XGSA 1ON2A 1HKQA 2K02A 2V1XA 2HS5A 1ON1A 3HRTA 1ZRDA 4ENNA 5DCMB 2D2WA 2ZMEB 5CVUA 4HV6A 3DEUA 3PQJA 1HSTA 2NS0A 3K9TA 5AIPA 3WU1B 1S8NA 4B8XA 2V9VA 3ISPA 3RKWA 1FOKA 1YW8A 1FSEA 2VBXA 4EV0A 3GFMA 4XRFA 4HLYA 3M7GA 3F8BA 3LFKA 5EEHA 5CVJA 3V7CA 2PN6A 4I02A 2ZFWA 1XGNA 1B59A 1O57A 1HQCA 3DF8A 1AOYA 3R0AA 4NQWA 1RI7A 5LLQA 2X0LA 1O7FA 2QVOA 5JFRA 3IKTA 4G6QA 2F2EA 2EV0A 1XCVA 4KIBA 2XIGA 1IW7F 4KIGA 1S3JA 3F8CA 5D5UB 4OIPF 1DDNA 1J0RA 3TDZC 3R0JA 2LDUA 4YIIA 5KVRA 3D5LA 2DK5A 1K78A 2PMUA 1RIOH 4P55A 5LHHA 4S05A 4PGHA 3BWGA 1SD6A 4L9TA 2ESNA 1XD7A 3V7SA 3HRUA 5DDGA 3TO9A 3IL2A 2DLLA 5CLSA 2RV8A 3EDPA 3IWZA 1FBQA 4I0AA 3F21A 3DKWA 2NNYA 4ON0A 4A12A 1T2KA 3CUQC 3F6VA 2VBWA 1HBXG 4AIJA 2V1DA 5LRSA 2K27A 3FM5A 3RKYA 2E7XA 2IRFG 1S29A 4G7OF 1BBYA 3ML6A 4IXAA 4KN7X 3E6MA 1MJ9A 3JTHA 4HA8A 3R4KA 3NRVA 1BI1A 1TQIA 1TTYA 2PBIA 1ULYA 3T8TA 1W7PA 2CWEA 1BI2A 4KDPA 3WU0A 4Q5SF 1G3SA 4AD9A 4L9JA 4O5VA 1GVJA 3QU3A 4IHTA 2HFHA 4HX4A 2L54A 4HAMA 4U7BA 1D5VA 1RNLA 4L9VA 3BJOA 4P96A 4R8HA 1FBSA 5HLGA 4O6JA 4JQFA 3K1MA 3K1NA 4FHTA 3K1PA 2R7FA 4U0YA 4D0PA 1ZAOA 3RPQA 1KYWA 3Q9SA 3L7WA 3C7JA 1U5TB 1P6RA 5BOXA 3QP6A 5CYVA 5E17F 5D5WB 3F8FA 4XLNF 4HQEA 4LLLA 4A5NA 3KFWX 1R23A 5LHGA 2IP2A 4LMYA 1AWCA 4FX4A 5JVTA 1JHHA 3AAFA 1STZA 1MD0A 3BPXA 4Y13A 1EV7A 3Q5FA 3ECHA 3DFGA 1BI3A 2QYOA 2WWYA 3R60A 2EFOA 5LEKA 2HKXA 1O3QA 3N4MA 2EV6A 3FXQA 5K1YA 3E6BA 3WGIA 1R36A 4M73A 2VT3A 2ZBKA 2RVCA 3CTAA 1IN6A 3KP5A 5EEGA 1USSA 3I71A 1ZYRF 3MEXA 2YU3A 2M45A 2JPCA 2RN7A 2V6CA 2QENA 4KMFA 1OYIA 3LSTA 1KU9A 2Y75A 1V4RA 3SZPA 1OYWA 4IF4A 2M30A 4LB6B 1KU3A 4XLPF 2JPBA 2B0LA 3KE2A 2L3DA 3B73A 3I59A 2QQAA 1FPQA 4KICA 5F6FA 1WKMA 4K2EA 2M87A 5CJ9A 3J81K 3DP7A 1BIBA 4Q48A 3JAMZ 3IKVA 2PLYA 1T39A 4P5OA 4IPAA 5J6XA 3NQOA 5HDGA 3TGNA 1D8JA 3KZZA 1G6NA 1UHMA 2DBBA 1FX7A 1R5GA 2VC0A 4IRHA 4YFNF 1YG2A 1CF7B 4Z2YA 3R6SA 1U2WA 5HDKA 2DO7A 4IRGA 3RYPA 4ESBA 5A2QZ 3GXOA 3LA3A 1OMIA 2Z99A 1X3UA 1ZN2A 1S7OA 3GFIA 3S2WA 4DNCA 1WQ2A 3KLOA 1K78B 2OZ6A 2DT5A 3RTRA 2OD5A 4Y17A 4ESJA 1R22A 1J9IA 1B6AA 3V8JA 1PP7U 1UHWA 2Q2EA 2EWNA 5BQTA 1LEBA 4LJZF 2CG4A 4A6EA 5F1RA 3QPHA 3DXJF 1IZ1A 4U7DA 3GLXA 1TNTA 2L01A 2BE5F 2LF7A 5FLXZ 2ADUA 2O61A 2BBYA 3FHZA 5D4RA 3M8EA 2G7UA 4M74A 4RGUA 3V8LA 4HF1A 4UV8A 1E17A 5IT9K 4KN4X 2DPUA 2FMYA 4RGRA 1W4MA 3TKYA 1B9MA 3GZ5A 4LLGF 1OYYA 3GFLA 1JHFA 2CQKA 4JK1X 1W7PB 2VC1A 3GX4X 3TO6A 2FNAA 2OZUA 2WC2A 3E6DA 4LGWA 4AVPA 2COMA 1A04A 5L3GA 2MD5A 3J80K 3RYRA 2BYVE 1YQAA 3QPTA 4M72A 1Z6TA 1S7AA 2MH2A 3ECOA 4HQMA 5CVIA 2V79A 4UVBA 1QQIA 2CYYA 3BJ6A 4RGSA 1WI9A 5DYMA 1FWZA 2Y0MA 2E1NA 3LWFA 3PFIA 2P8TA 3VODA 3R61A 4M6XA 2MH9A 5HLIA 4LK0F 1MDMA 2K4JA 1K79A 3FMSA 3KP3A 3K0LA 4EM0B 2IA0A 1ZLKA 2EV5A 1Z1DA 3VFZA 3FWEA 1SD5A 2FNPA 2OAZA 4YG2F 3BZ6A 2NAZA 2UXXA 4I7HA 3DQVC 1ZRCA 4EJOA 2Y48A 4BXUA 2A61A 4OINF 4CYDA 1OPCA 1TW2A 2P6SA 1YO5C 5JR3A 3JTGA 3KEQA 3W6KB 2GWRA 2UZKA 5E1XA 1G3WA 4WWCA 2VN2A 3G73A 3P9IA 3HOSA 4MTEA 3BJAA 3TOBA 2DFIA 4RAYA 4OIQF 2F5EA 2XAGA 2HZTA 4RS8A 1P4AA 2A07F 2F5FA 3HYIA 3RIRA 3L00A 1J7KA 3ZPLA 4HYEA 2W24A 1Z05A 4OIRF 1CF7A 1KQ9A 2EFQA 4MQ9F 4RAZA 3I59B 4UUVA 2YX4A 2GXBA 4I01A 2FRHA 5ED4A 4KT5C 3KP2A 2ELHA 2HTSA 2WTEA 1JE8A 4FT8A 2JRTA 3JSPA 2ISZA 2IJLA 5DD4A 3MAJA 4BHPA 3KP7A 1SFEA 2CSOA 3HIFA 2L4AA 3ZMZA 1MGTA 1U5TC 4MEXF 1KU2A 3FXRA 3MQ0A 4G8XA 1TQPA 1H9GA 5FGMA 5F64A 1C0WA 3M1EA 4A0ZA 2VE8A 2RGVA 2BV6A 1LDKB 5BS6A 5ICCA 1XSDA 1Z6RA 2L02A 1ZG5A 3F3XA 5ERIA 1FLIA 5D6FA 3TOAA 4MGRA 4YIFA 1XSXA 2MC3A 2GAUA 4KUMA 4RB0A 1EH6A 2A6HF 3F6OA 1O7LA 4QLCU 2VE9A 2IT0A 5DV5A 1IRFA 5CVRA 1WRJA 1P92A 1ZG3A 4L0YB 3VB2A 2QBYA 2EA4A 3WTYC 3SXYA 2QQ9A 3RDIA 3RJPA 2NRAC 1B9NA 3IWFA 2GZWA 2L4MA 2YR2A 5ILSA 2ACJA 1I6XA 3WTUC 2NNNA 4M6YA 2PFBA 1TBXA 4U0VA 1HW2A 1V3FA 5K5OA 2LNBA 3P9KA 3ZN1A 5LBQA 2XKPA 2LF8A 2YX7A 4EMSA 3MCZA 1XGMA
chains in the Genus database with same CATH superfamily
3HPGA 1WJEA 2A69F 2OF7A 2DU9A 4KJZA 5BPIA 4F55A 1B1BA 4YFXF 3ZMVA 2UV1A 1SFOJ 1ERDA 4O3MA 4KNYA 4WX9A 2ECBA 2ZC2A 5HVQC 1SFUA 1BC7C 4E6KG 2X4HA 2PMHA 3HRSA 3RKQA 4ETSA 1WSUA 2RDPA 2ZO4A 2XAJA 2R7VA 2OCEA 2AQEA 5KAFC 3OYDA 2MD0A 4HSTA 3ONQA 3V4GA 1D8KA 2DQLA 4EJUA 5FLVA 2XASA 3CD6I 1MMSA 4CXFA 2FEZA 3CQZJ 2HNHA 2EBIA 1MZBA 4NUBA 5DUKA 1UJ8A 1JT0A 2B9SA 3ABTA 3CO6C 1ZHFA 4BGDA 1I3AA 1XDUA 4DZJA 5ILUA 1B72B 4BACA 3FM3A 5J1UA 2E7WA 5LEJA 1NG6A 3KCCA 1JKOC 2YUSA 3KZIC 1IJWC 3OYMA 2K9LA 2GOMA 3QU6A 3RKXA 1YW7A 2R7DA 5M3FJ 4MEYF 1VZ0A 2RC4A 1HDPA 1HDDC 3RPUA 5E8IA 5FFZA 2W1OA 2FQ4A 4PDKA 2KJCA 2YS9A 4N0BA 1MKMA 3LA2A 3S2DJ 3FXLA 1ZRFA 1BI0A 5J47A 1V5EA 1JI8A 2VONA 3DCFA 1FY7A 1X19A 5LGUA 4IHSA 3PUFA 3WE2A 2DFFA 2OA4A 3ZMUA 1JKQC 3MZ8A 1YITI 2WY7Q 1A6IA 4XLCA 4XRSA 1S7EA 1T38A 4P1WA 4L5JA 2FXAA 3ERED 1W5TA 3W2VA 2O8XA 1PUEE 4MNUA 4XN3A 2FBIA 4N4NB 4CYCA 3FXUA 2W25A 1SVLA 3H5NA 3F72A 1OKRA 1WZ2A 2DN0A 5DCFA 4OWRB 1QU3A 1REPC 4CGZA 2VUMJ 2KL4A 4HW0A 3VDXA 2RQQA 2KJBA 3CC7I 1HKSA 5FRMA 1MDMB 2QSGX 1FBUA 3HHHA 1U8RA 2IW5A 3MKWB 3GTOJ 1Y56A 3A0BC 3EETA 2VQHA 1B4AA 1I1GA 5EDNA 1JGGA 2DPDA 1FOWA 2R7TA 1I6HJ 2W57A 1QGPA 3ZMTA 5HS7A 2NOGA 2EJRA 2R5ZA 3H3VK 3Q9VA 5CKTA 4AU7A 3TBIA 5FKOA 5JLXA 4YFKF 5J1RA 3S2HJ 5FD6A 2VIXA 5GADJ 3WTSC 3HL2A 2A5YB 2LG4A 2X1CA 4L0ZB 1WJCA 5HOOA 4R1HA 2F48A 5HDNA 3ABUA 1U6GA 4RB2C 3CP8A 4U87A 4I6ZA 4BQAA 1RC9A 4MQVA 5D8LB 2OTJI 2BY2A 1YX5A 3CP2A 5EEAA 3CMYA 3BC8A 1G4DA 3C2BA 5KK1A 4CICA 2LH9A 2P0WA 1YYVA 2EFNA 1P7IA 4GXOA 2ZCWA 3IAM2 5M5WJ 1QO0D 5KHDA 1D3YA 2V7FA 4AIKA 1K6YA 2HOEA 2VI6A 3UKGA 4MTDA 4D9JA 2P4WA 3DPLC 2MW8A 2DTZA 4LFUA 3DV8A 2ZNZA 4BXFA 4IHYA 4A3LJ 2ZXHA 1YTYA 1GXQA 2I8DA 1SFKA 2FD5A 2GA1A 3DPTA 3IAS2 4HV5A 1L3LA 1TL8A 2JUGA 1R5HA 4M71A 3H9JA 2YSRA 3E0JB 3U9GA 1VNDA 4PFOA 1APLC 1WVRA 3G3ZA 3ZRGA 4S0HB 3GTLJ 5E3MA 3V7RA 1RR7A 3Q0VA 4FCYA 3JAMK 4WXHA 2HVRA 3OOUA 5D6EA 5TRDA 2HDWA 3U2RA 4D5FA 1GXPA 4TV7A 4QSHA 2MFZA 1BR4A 1HW1A 2DA3A 2WV0A 1U0JA 3L9FA 5D8KB 2DW4A 4EEFG 3OYBA 2P5LC 1BC8C 3H0DA 3HSEA 2CUFA 1UAAA 3EUAA 2CUJA 3B6CA 4H0EA 3QPLA 2VB6A 3MKZA 5FKKA 1FMWA 4DYCA 1UFMA 1U78A 4LLNA 4L18B 1W1WE 1SMYF 1JUSA 2ME0A 1MBGA 2P7VB 2A3SA 4RGXA 4B3XA 4RMNA 2NS8A 1X4OA 3BPVA 5K7ZA 3AKZA 4A3EJ 4BXXJ 4FTHA 2IA1A 2L7FP 4HBLA 1F4KA 2H8WA 1KQ8A 3HOTA 5K5RA 4BNCA 5A2QK 4M3FA 3OS1A 1E3OC 1IC8A 3W6JB 4WXDA 1POGA 2TRTA 2XVCA 3K4BA 4IL6C 3WTWC 5K7HA 2M1BA 2LBFA 2WADA 3LSPA 5F1JA 3BT9A 1XB4A 5LRRA 2EINH 3C1DA 2E5NA 1ETYA 2G7HA 1G3TA 4XK4A 1R6RA 3ROUA 2DJNA 3FF5A 1S9HA 4GCVA 3K4CA 2DXIA 2OBPA 2AO9A 2EZLA 2FBHA 4KIFA 4LIVA 4PGGA 3WGHA 1MSEC 2XUBA 4NB5A 4L5EA 1ZARA 2PG4A 5E1WA 2A5WA 2JMWA 5J8CA 1DUXC 2HVQA 2W00A 2JA2A 1T8IA 4G7ZF 1FYMA 2QWWA 1R1TA 3BP8A 1XMXA 3B6AA 4IX7A 1F5TA 1ODDA 3LSMA 2E36A 2X6XA 3QODA 3JW4A 3FX3A 1Z0XA 4IJAA 4OAZA 1R9TJ 1Z91A 5FKMA 1FSHA 1O3SA 3IRQA 3MZHA 1MJAA 1G59A 2DA1A 4RM3A 1LDJA 2Y0SA 1BW5A 1TWCJ 4EJWA 3LSIA 2EB7A 3TDUC 2BGCA 1YFHA 4QIWN 2GXGA 3RZDJ 3E5XA 2M9HA 3QAHA 2Z3YA 2DT6A 2ZMEC 5L3CA 3HHGA 1W0TA 5L3BA 2JWTA 2Q8KA 3BG3A 2QBYB 5FLXK 1YOVB 1N75A 5E18F 3GLLA 2Z33A 5M5XJ 1MMGA 1ZGAA 5C3EJ 4KMUX 4HNUA 1BW6A 4A0YA 3M8FA 3HKZA 2BXYA 4UXNA 4BS9A 1I1SA 2P81A 4LK1F 3LSRA 2ETHA 3H92A 3U1DA 5ICGA 2P7CB 4JYKA 3L2RA 3KEOA 1LEAA 1O3RA 4U88A 1FOXA 2XAFA 5BPDA 1Z3XA 1ZREA 3F23A 2QKMB 4DGWB 1K61A 2M7AA 3ULQB 4BEHB 3QQAA 3ZCOA 1AKHA 3MKYB 2ZFUA 4ASNA 1UELB 3ZQQA 4BBRJ 3WODF 1A36A 4EM1A 4Y15A 2H09A 2IGOA 3ZQFA 1R5ID 3O2PE 3P7NA 4A6DA 1DP3A 1SVMA 1XDSA 4HOBA 3ZQ7A 3JRCA 1H8AC 1QZYA 1IXCA 1RPWA 2D1HA 2FOWA 3BG6A 3WTXC 2H94A 3B02A 3CUQA 3OYJA 2M7BA 2Y31A 3CCRI 1E0EA 4CZZA 2KFDA 1EA3A 2K5CA 1SD4A 1NTCA 1P2FA 1RKTA 3FHNA 1HKTA 1AHDP 2DTRA 2O3FA 1H0MA 3LSGA 2K7LA 4XKCA 2E1OA 5FB2A 2HDCA 3OV8A 5LFAA 2PI0A 1TNSA 1G3YA 3ZGKA 2LSOA 2HKOA 2K9QA 1ZH5A 2RNJA 2R7QA 4E70A 3LOCA 4F7ZA 2VT2A 1FTTA 3OIPA 3P9CA 2K9NA 1J59A 2FF4A 1ZG1A 1P7JA 2OU2A 2VBYA 3O6BB 3L2CA 2ZKZA 3T5XA 4HX7A 5HLHA 3LQRA 4XSXF 2ZJRF 1VQNI 2BVLA 2IBDA 4XBFA 2OQGA 2ICWG 3I5UA 3I55I 3EYIA 3H3ZA 3EYYA 2VOPA 2XAHA 2HYFA 4MHGA 1ZGWA 4EATA 4XICA 2CFOA 3BZKA 2BXZA 2CV2A 2JZYA 3PUBA 4XKWA 1LQ1A 3QYBA 3KX2A 3ABLH 2M4GA 2VJ4A 3BR0A 5FD5A 3DU6A 2EZKA 4CSWA 3QRFF 1IAWA 4UVCA 4KITB 2DMPA 5DEQA 4GO1A 1IGNA 3WG9A 3GWZA 2VODA 1OFCX 2HR3A 1F9NA 3H3UA 2JA7J 4XLAA 4CCNA 4ZZLA 2XKOA 2XRLA 2VOOA 2CGPA 4FETA 2PEXA 1S6LA 2AS5F 5LGTA 4E7KA 1QNTA 2HVSA 4B1RA 3CMEI 1FTZA 4HDUA 1IG7A 4CYCB 1NK3P 4C30A 1WJAA 1R1VA 2C6YA 4LB5A 1R58A 3DLLF 1FZPB 1K7AA 1JGSA 2B7EA 3LAPA 4C2MJ 2XROA 3JRIA 3PQKA 2VJIA 3KYLA 2D1VA 4GYIA 2F5CA 1YS7A 3QOPA 2RREA 1BOBA 3IC7A 2J5PA 4QTRA 3LAJA 5AONA 2KDZA 5IYCJ 1T0FA 3F8NA 5TJJA 2B63J 2HYGD 1IN7A 2K85A 1HC8A 5H20A 2FU4A 3PO3J 4A2UA 4DJAA 1G2HA 1BM9A 2DCEA 2JSPA 3PNTA 4BHCA 5E20A 3KIOA 4Y4RA 1N25A 3GFJA 2JSCA 1Z9CA 1QVUA 4AWXB 2BZTA 4DOZA 1TQMA 2R4GA 3VYTB 1FYKA 1L0OC 1ZGJA 3TW6A 1I5ZA 3UR3C 3EUHA 1XTAA 3C18A 3I4MJ 4XL9A 3S17J 1XCBA 1EKEA 1IRZA 4BQOA 2HOAA 1R00A 1XMAA 1ZTRA 1FT9A 1IN4A 2CMPA 3KYDB 1FYLA 2HGCA 2QLZA 3KZYA 1OR7A 4I0BA 4A3KJ 1FC3A 1HXDA 2VKDA 3MD2A 2F6CA 2JT1A 3U1KA 4M9SA 4OMYA 3H35A 2STWA 1UHSA 1D1CA 1LPQA 4HSRA 3HOXJ 2O8KA 3IH3A 4WXCA 5J8FA 5LGNA 4XKBA 1P4XA 5DD8A 3PJRA 2G9WA 3H5RA 4I2OA 3K69A 4RDUA 3VYSB 4QWQA 2QM3A 2V26A 3BQZA 3PFYA 1K83J 2H6CA 5CVVA 2DI3A 1KYZA 4JX4A 2P6TA 3C3WA 3IHUA 2LKPA 4CO8A 2Q0OA 4E7IA 2F4IA 4XRSG 3W3CA 3BTCA 1KU7A 3M3YJ 4G9YA 1I27A 4GGGA 4KA4A 1LDDA 2HXOA 3KP6A 5CQEA 1D0ZA 5B3SH 4A3MJ 2RNGA 3O8GA 1PDNC 4PCQA 1T33A 2K3FA 3ZQLA 3DEEA 3M1CA 2X51A 4BDYA 2O7OA 2QCOA 3GW2A 3VSKA 1X3WB 1LNWA 3S1RJ 4LG0A 2NVUB 1RUOA 1DPRA 4P9UA 3NEUA 2EA2A 4RLFA 1ZQ3P 2JTVA 4AIHA 2FMLA 2JRMA 3RI4A 5K7FA 3JCUC 3FMQA 4ZTJA 3CF5F 3CUOA 5B66C 2BHYA 4WCGA 3G4SI 3OYHA 2X6YA 3KPHA 1SAXA 1Z77A 4ENMA 3F22A 5J4YA 2OPTA 2P5VA 2XPUA 2RQPA 1JTYA 1X1AA 4ZH4F 3A02A 2QZ8A 2A68F 2JVGA 3LSKA 1BOAA 1H89C 1KQ0A 1PJRA 4ESFA 2BHZA 3JRBA 3ZQGA 3AG3H 1R7JA 3WGGA 4LG3A 2GQQA 3EQLF 3ZQHA 4ENKA 3K4JA 1X1PA 2UXNA 1F43A 2IGMA 4IRIA 4B09A 1RR8C 4BDZA 3CCLI 3SYTA 2OV7A 3TO7A 1VQOI 1IDYA 4ZYDA 2EFWA 3SFZA 3TQNA 1H9TA 3CDHA 5D4SA 1IN8A 3CO7C 4C2TA 1TWAJ 4RB1A 3WTVC 1EJ9A 3CZ6A 1BL0A 4U0WA 1RZ4A 3SZTA 2XV4S 1E2XA 3WTTC 1ONVA 2PQ8A 4A0XA 1KGSA 4UNOA 1SFXA 1Y1VJ 4HDVA 1QPMA 3MWMA 2ZNYA 2YU9J 1KONA 2M0CA 1IF1A 3NAUA 5L3DA 1YIJI 3CCEI 1KA8A 1R4NB 3BDDA 5JHFA 4M3GA 1ZR4A 3A2KA 1R1UA 2A6EF 1MMNA 1ITYA 2DMNA 1GDTA 2JA6J 2EILH 4EJVA 1VQ7I 1W5SA 3W2WA 2CO5A 4LD5A 2ZJ2A 1J75A 3SFIA 5LHIA 1Z21A 3HXLA 6PAXA 3E97A 2DYSH 2KPMA 2MBFA 4EGZA 1WH7A 1DPUA 3TP0A 2ZSHB 4BH9A 1UZCA 4I09A 3VWBA 2QUFA 2HQAA 2M8EA 1K6OA 2F5VA 4JBAA 3BR3A 2E1CA 3MVPA 4E7LA 2DQRA 3GZ6A 4LIUA 5BMZA 5IYDJ 5K5QA 3O3KA 2Y2ZA 2GIVA 1OLTA 2DK8A 3MKLA 5AIQA 4ZDLA 2K86A 1P4WA 2IGNA 3LQQA 1AKHB 3PIOF 3G1OA 4NHJA 2R7WA 1BR1A 2FA5A 3ELKA 2CU7A 1YE9A 4E7JA 4IO9F 1EF4A 4FX0A 1IXSB 1ZLJA 3GEZA 1Q1HA 1SAUA 3CUQB 1RUNA 2KRCA 3DPUA 2RAEA 4BQNA 4ANJA 2O0YA 5EZGA 2NYXA 5JHUA 3GF2A 3L2VA 2L9SA 2LTPA 4XSZF 2MA3A 1TW3A 4KYWA 1U3EM 5FKNA 3T8RA 3Q3SA 3IUOA 4JX5A 5C4JJ 1HLVA 4JX6A 1JKPC 2MLGA 3ZMDA 4BKXA 5ILVA 5DCMA 1J5YA 4UUTA 4R79A 2W48A 1J2XA 2ZMEA 1FP2A 3CLQA 4ZYEA 1GVDA 1VI0A 4ENJA 2NS7A 3TL4X 5HLTA 2KIMA 3BLYA 4NBQA 2XGXA 2CW0F 3GYHX 1OCZH 3GTQJ 2TCTA 3S8PA 1X1CA 3K2ZA 3E5UA 3HTUA 4EGYA 3ZP5A 2K4BA 5E1ZB 1QZZA 1SD7A 5GPCA 1I50J 3D5RC 4HF2A 5C4XJ 3E5QA 2VLAA 3K4LA 1F1ZA 2STTA 2GM4A 3CMMA 5BNGA 4IKFA 2ZB9A 4UVAA 4B3AA 2QEXI 4C2UA 2P5KA 4G6DA 1FIPA 3CF2A 4OOIA 3VEPA 2N8GA 2IGKA 2DYRH 5GAHJ 1DP7P 2KIUA 3BOQA 3QYEA 2L7ZA 4A3IJ 5TGTA 3SHFA 3D0SA 4MFDA 3L1PA 1T6SA 2O03A 1VQLI 3HOZJ 4DYQA 2YPRA 2VBZA 5JI6A 4S04A 2XSJC 2R7RA 3PO2J 3GTGJ 1XGOA 2IA2A 3BG7A 3BR5A 4WF2A 2R7UA 4E7SA 3COAC 2RKHA 1T98A 1GUUA 2W4SA 3DLAA 2W84A 2O9LA 2K3PA 3KP4A 3J81Z 5L3FA 3G1MA 4HLXA 2F5DA 1XG1A 2QKLB 3HUGA 4WK8F 3M9AA 1O4XA 3GO5A 2HI3A 2XB0X 3I53A 3T1BA 2EZHA 2ELKA 1YW9A 3OL4A 4HEA2 3FZVA 2VQLA 1YIOA 2Z9OA 4A5MA 4UUSB 4HZFA 4B47A 5IP9J 2R92J 3L09A 1UB9A 3HRMA 3FXJA 2KQRA 2WAEA 4OMZA 4PSWA 3LNQA 2QF7A 1BJAA 3BROA 3T0YA 5IT3A 1JXSA 2VQCA 4UV9A 2X48A 4BY7J 2OJED 3IRRA 3C2HA 3BG9A 4ZZDA 2EFPA 1V55H 2KIFA 4F91B 3EPZA 3VOEA 1VQ8I 5D5VB 4L9NA 1JTXA 1ETXA 2VQGA 4DQ2A 4RBOA 1IXRC 1GHCA 2XAQA 3BY6A 4EQQA 1H88C 4G94A 3DWLE 4DZPA 2V1UA 3WE3A 4HX8A 3MFKA 5M5YJ 1WCMJ 3FXMA 2KRFA 2O6GE 3I64A 4IQ4A 5L3EA 3QPSA 1OISA 2COBA 2DT7B 4N9IA 3ZMSA 4CCMA 1VTNC 3HTSB 2BEOA 3OOPA 4OU0A 3MZYA 2JN6A 4CDGA 1WI3A 1XSVA 4N4OB 1Y8RB 4EVIA 5FFXA 4MIMA 3J7AO 4AC0A 1LB2A 2HPMA 4IVNA 2GA2A 1FMVA 5F27A 4D1QA 4BAYA 2UWMA 4NC6A 3GUDA 2QQBA 1XX5A 2FE3A 2J5OA 4Q4ZF 3I4PA 1USTA 1PUFB 3E6CC 1KZHA 1IRGA 5FO5A 4E7HA 2XC7A 1T56A 1YS6A 1RETA 2Y0SN 4EM2A 4P9FA 3NWTA 5H6QA 3HSRA 5EGOA 2Z16A 1M1EB 2I10A 3SQNA 1EH8A 4KFCA 5B1BH 3REOA 3G2BA 4M9XA 3I4NJ 1PP8F 1YJ9I 4FASD 3HSFA 1YLFA 1Z7LA 2FBKA 3IH4A 2IEKA 4XM3A 2CRGA 2XAUA 3QP5A 4LITA 4ZYHA 2DA2A 1XN7A 4GYGA 4L5IA 3SJMA 1NK2P 4LG0B 2CQ7A 1MJBA 4PSXA 2HQNA 2W85A 1V5GA 3GMEA 4ZYGA 3KETA 1MBFA 2D45A 1R4MB 2H1LA 2CFXA 4FE7A 4OIOF 3HOYJ 5D5XB 2HTJA 3HKZN 3V8KA 4BJTA 4RAGA 5J1YA 4AUXA 1MNMC 4G7HF 5IT9Z 1X4PA 2VKVA 1LVAA 2XGEA 3E3VA 5HS8A 3BR6A 2VJJA 3HGYA 4AVZA 3I54A 3CLOA 3DU5A 2FQ3A 2VASA 2AXLA 5DS9A 2GBYA 5CPRB 2FSWA 1LJ9A 4XOTA 1VQ5I 4HRIA 4RB3C 3CJNA 1BIAA 4C3JJ 3JSOA 1IUYA 1ZK8A 5KAIC 4A93J 3VSLA 3RCOA 3ZN0A 4GFBA 2XRNA 2PJPA 2HWVA 2FOKA 5J4VA 3Q0UA 1Z7UA 4BHBA 2VKEA 4EJTA 3LSHA 2M5WA 2CUZA 2R7ZJ 1MH3A 2IS1A 2IPQX 3OYEA 1FP1D 1XMKA 2ISYA 2R3SA 1RESA 2ZXJA 3J80Z 4KISA 1HW5A 2LC2A 1U5TA 2ESHA 2LREA 4HF0A 1CGPA 3AG4H 1MBEA 3FMRA 1ZKGA 2VXZA 2Z5UA 5E8GA 1WWXA 2CQNA 3F8MA 4C9YA 4XQFA 3I0TA 3I58A 3RQ4A 4BYYA 2KKOA 1QBJA 2R0QC 5HS9A 1MSFC 3OYCA 5H6RA 4I98B 3GVAA 2MLKA 2XHKA 2X9DA 2NOJB 4V19K 1IN5A 3BR1A 1FNNA 4UHTA 2D5VA 1D1BA 2HU9A 1K4TA 4F52A 1TLHB 1A5JA 4Z6YA 4N9HA 2TDXA 1DGWY 1O3TA 3LA7A 4YELA 5ICFA 2HQRA 3HC7A 1HF0A 2V4JC 3QOEA 1HSJA 1JJ8C 2WY8Q 1W5CC 2OQRA 3DKXA 5EYRA 2IVMA 1W7PD 4DIQA 2R5YA 2K9MA 1YRNA 4M9ZA 1EH7A 2QGUA 3PM1A 3ZOBA 5DUIA 3SZGA 2H6BA 2EK5A 4YEJA 1BN5A 2HZDA 2WV1A 1NHAA 3K4KA 3N97A 1SMTA 3A1YA 4CHUA 3HOVJ 4PZJA 2XPVA 3WTZA 3KLNA 1Y0UA 4QPQA 2H27A 2IS6A 2LY1A 2DOFA 3TP3A 3FK6A 3PIPF 2XF7A 4Q47A 1Y39A 4V2FA 2HEOA 3AG2H 2KLOA 4YIRX 1FEXA 1UCRA 5ICEA 4A3DJ 4XN0A 2DAOA 1XGSA 1ON2A 4D7NA 3LSJA 5GTHC 1HKQA 2K02A 2LFBA 4W1UA 1LE8A 5EG0A 2V1XA 2XSDC 2HS5A 3V42A 2JA8J 3UNGC 1ON1A 2E34A 3HRTA 3Q0WA 2KZGA 1ZRDA 4ENNA 5F0HA 5DCMB 3WG7H 3BG5A 3OWTA 2D2WA 4HPQA 2ZMEB 1F36A 4I99C 2F4MB 4M3DA 5CVUA 1Y1WJ 4HV6A 1JKRC 1ORKA 3DEUA 3ASNH 4AYBN 2ZJQF 3PQJA 2DOEA 4RAFA 1HSTA 3ABKH 2NS0A 3K9TA 5AIPA 4XNFA 3WU1B 1S8NA 4UUSA 3ASOH 4B8XA 3CCJI 2V9VA 3ISPA 3RKWA 4YRVA 3L2WA 1FOKA 3M07A 1YW8A 3BTIA 3DBRB 1FSEA 4Y7NJ 2VBXA 4EV0A 5B5EC 3GFMA 4XRFA 4CA0A 3MN2A 3OYAA 4HLYA 1DGRM 3M7GA 3F8BA 2Y9ZA 3LFKA 5EEHA 3RPUD 4BE0A 1OCRH 5CVJA 3V7CA 2ECCA 1I39A 2PN6A 4I02A 2ZFWA 4GRIA 4MO7A 1XGNA 2L9VA 1B59A 1O57A 4AYBA 1HQCA 4QPOA 1B8IA 1JUPA 3DF8A 1AOYA 2E60A 3R0AA 5H2FC 4NQWA 1RI7A 2VL8A 5LLQA 4I76A 2X0LA 3M4OJ 1ENHA 1O7FA 2QVOA 5JFRA 3HUGB 3IKTA 4G6QA 1U8BA 4BBSJ 1ZELA 3NARA 2F2EA 1YJNI 2EV0A 1XCVA 2G0EA 3WHCA 4J00A 4XLHA 1A35A 3AL0B 5IP6A 1OCTC 1TP4A 2LP0A 4KIBA 4H4KC 2XIGA 2EZIA 5DM6F 4AM3A 1OQYA 1IW7F 4KIGA 3JR9A 1VQPI 1S3JA 2L9RA 3SEQA 3F8CA 2Y69H 2PMZN 2LVSA 5D5UB 3AFHA 4BE1A 1DDNA 4OIPF 1J0RA 2Y30A 3TDZC 3R0JA 2ZXIA 5CQGA 2EIKH 2LDUA 4YIIA 1PUFA 2KDOA 5KVRA 3D5LA 2KHMA 3A01A 4UB8C 1VQ4I 2DK5A 1K78A 2PMUA 3CCSI 3I9V2 3WU2C 1RIOH 4P55A 5LHHA 2HXIA 3ESWB 4S05A 2EIJH 4PGHA 3BWGA 1SD6A 1Y0NA 4L9TA 2ESNA 3JRAA 1XD7A 3W2AA 1RRJA 3V7SA 3BR2A 4OAYA 3HRUA 2PMZA 5DDGA 1E3PA 3TO9A 3IL2A 2BY3A 3K2AA 5TISC 2DLLA 3ABMH 1VQ9I 5CLSA 2RV8A 3EDPA 4RM2A 4Y52J 1SVOA 3IWZA 1FBQA 4RA2A 2JK3A 3P5JA 4I0AA 2L2OA 5HNHA 2X1DA 3LMMA 3F21A 2XF6A 3DKWA 3A4CA 5IPAA 2NNYA 4ON0A 5J40A 4A12A 1W0UA 3F0CA 1T2KA 3CUQC 4ZYAA 3CJRB 1LUJB 3F6VA 2VBWA 1HBXG 4AIJA 2V1DA 5LRSA 3HGGA 1WGXA 2K27A 3C2GA 3FM5A 2LYCA 2QSFX 3RKYA 4G6TB 2E7XA 1W36C 2IRFG 1S29A 3CDIA 1D5YA 4G7OF 1BBYA 5EGOB 1LFBA 4RLQA 1UG2A 1U9OA 5IOYA 2Z2SB 3ML6A 2FJ1A 4IXAA 1I3QJ 4KN7X 3BCAA 3E6MA 1MJ9A 3JTHA 4HA8A 3ZQCA 3R4KA 1BI1A 3NRVA 1TQIA 4XLFA 1N78A 1TTYA 2PBIA 1GV5A 3OYGA 3DBLB 1ULYA 3T8TA 1TWFJ 1ETWA 4F3QA 4CCJA 1W7PA 2CWEA 2IXSA 2W82A 1LKXA 3S14J 1TWHJ 3I3LA 3FBNB 2CV0A 5C44J 1OJLA 1MMDA 2E2IJ 4IZZA 1ETOA 1BI2A 4KDPA 3RSNA 2IS4A 5EZHA 3WU0A 4Q5SF 1G3SA 4AD9A 4L9JA 4O5VA 1GVJA 3QU3A 4IHTA 2HFHA 2HQ5A 4HX4A 2CQXA 1BJZA 2CUEA 2L54A 4HAMA 4U7BA 5FROA 1D5VA 1MIJA 1RNLA 3S3NA 1DQUA 4L9VA 3BJOA 5F04A 4P96A 4R8HA 4CZCA 1FBSA 1BR2A 5HLGA 4O6JA 4JQFA 3QWLA 3IP4B 3K1MA 3CC4I 5JLWA 3K1NA 2OUMA 4FHTA 3LL7A 3K1PA 2R7FA 4U0YA 4D0PA 1UMQA 1ZAOA 3RPQA 4J19A 1KYWA 2M8GX 3A0HC 3Q9SA 3L7WA 3C7JA 2MSYA 1U5TB 1P6RA 2GXAA 3IH2A 3QP6A 5CYVA 5BOXA 2FX0A 5E17F 4NC7A 1Y8QB 3FXOA 5D5WB 3GTJJ 1T0FC 3F8FA 4C3IJ 4XLNF 2BOLA 4HQEA 4LLLA 2MC4A 2CS3A 2LRDA 3OS2A 4A5NA 2QQ8A 3KFWX 1R23A 5LHGA 1N77A 2X6OA 2IP2A 2VKHA 5J3LA 4LMYA 3AG1H 2BY0A 1AWCA 1LFPA 4HG2A 4FX4A 5JVTA 2OTLI 3KEYA 1JHHA 2KZVA 3AAFA 1STZA 4FISA 3E7LA 1JJ6C 5B1AH 2ME6A 1MD0A 3BPXA 4CH7A 4Y13A 3FIWA 4BJ5C 2JQ7A 1EV7A 3Q5FA 4XORA 3ECHA 4HNVA 3DFGA 2ZJPF 1YX3A 1BI3A 3OR2C 2QYOA 4BU2A 2E1MB 2WWYA 3GTMJ 3EUHC 3R60A 2MABA 2EFOA 3A03A 2ID3A 4XR6A 3HOUJ 4CCLA 5IOZA 1MBKA 5LEKA 4A69C 2M4KA 2HKXA 1O3QA 2R5YB 4XONA 1YRNB 1G8XA 3N4MA 2EV6A 3FXQA 5FKLA 2DA7A 5K1YA 1OR7C 3E6BA 3WGIA 1ETQA 1R36A 4M73A 2X1EA 3H1CA 2VT3A 3HG9A 2ZBKA 2RVCA 3BCBA 1X58A 2X6WA 3CESA 4PJMA 3CTAA 2MG4A 4DBRA 3K7AJ 1IN6A 3CCVI 4II3A 3S3OA 3ZQIA 1U9NA 3EUKL 3KP5A 5EEGA 1USSA 3I71A 1X3ZB 1ZYRF 3MEXA 2YU3A 2M45A 2JPCA 2RN7A 2V6CA 2QENA 4KMFA 2O5RA 1P9QC 5EJCA 1OYIA 1Z67A 2M34A 3LSTA 3HPHA 4UY8I 1KU9A 5GTIC 2Y75A 1V4RA 1LE8B 4PJLA 4F93B 2V1NA 5EG0B 3SZPA 2JJ7A 1AU7A 3H5AA 3OYFA 1OYWA 3VPRA 4C3HJ 4IF4A 2M30A 4AIDA 3OIQA 5FRNA 1QHGA 4LB6B 1KU3A 2PX9A 2Y9YA 4XLPF 2X85A 1W36D 2XB5A 2V9PA 2JPBA 2B0LA 3KE2A 3CJTB 2L3DA 4B44A 3B73A 2WBMA 3I59A 4E4HA 1MNDA 1NG7A 3BTLA 2QQAA 1FPQA 1TWGJ 4KICA 4B4CA 5F6FA 3HOWJ 1WJ5A 3RZOJ 3CCQI 1WKMA 3CMAI 4K2EA 3OS0A 2M87A 2DFEA 3OYNA 5CJ9A 1OCOH 3J81K 3CC2I 3DP7A 1R71A 1BIBA 4Q48A 3JAMZ 3IKVA 2PLYA 2VXDA 2R7OA 4W97A 1T39A 1UG0A 3FK7A 4BUPA 4P5OA 1PYVA 4IPAA 5J6XA 3NQOA 5HDGA 3JRFA 3TGNA 2ELJA 4D5CA 1D8JA 3KZZA 1B8IB 2DMUA 3CDLA 1G6NA 4NQWB 1Z3YA 2DFHA 2H8RA 1UHMA 1J09A 3CCUI 2DBBA 1FX7A 1R5GA 4XRMA 4M3BA 2VC0A 1T08B 4KT6A 3OSFA 4IRHA 1JT6A 4MFEA 4YFNF 1YG2A 2BW3A 2KT0A 3DEWA 4PJ0C 1V54H 4UB6C 1CF7B 2EH3A 3FKJA 1MH4A 4Z2YA 3DTIA 1X2NA 4BE2A 2BVMA 4DYRA 3R6SA 1U2WA 1WJDA 5HDKA 5F0FA 3GTKJ 2DO7A 4IRGA 3RYPA 4B48A 4ESBA 5A2QZ 3OY9A 3GXOA 9ANTA 1IRXA 5GP9A 2XGCA 3J7AY 2M3AA 3LA3A 4J01A 1OMIA 2Z99A 1X3UA 3HM5A 2DMTA 1ZN2A 5HODA 1S7OA 3OYKA 2DODA 3GFIA 3S2WA 4DNCA 1WQ2A 2HOSA 3A01B 3SDBA 3KLOA 3S1NJ 3FKIJ 1K78B 2OZ6A 2DDBA 1S5LC 3HBLA 2DT5A 2AQFA 1FJLA 1VF9A 2L5QA 3I56I 1YJWI 1VQMI 3RTRA 3S3MA 2OD5A 2VJ5A 4Y17A 1R22A 1WH5A 2LY9A 4ESJA 3F9KA 1FOYA 1J9IA 2VPRA 3L2UA 2CH0A 1B6AA 3G1LA 4IHXA 4PJJA 2WB1N 3V8JA 1WHUA 1PP7U 1UHWA 3DTKA 2Q2EA 2EWNA 4V2GA 5F0CA 2I5UA 5BQTA 1LEBA 4LJZF 5FJ8J 2CG4A 3G71I 4A6EA 5F1RA 1TZLA 3QPHA 2WAQN 3DXJF 2E35A 1IZ1A 3JRHA 4PK4A 2IAIA 4U7DA 1QRYA 2EPFA 1GV2A 1MBHA 3CCMI 5FLMJ 3K10A 1E3HA 3GLXA 1VQ6I 1PVEA 1RKWA 1TNTA 1TT0A 1OCCH 2BE5F 2L01A 4XLEA 1A31A 2LF7A 3ERMA 2E19A 5FLXZ 4FQGA 3CCYA 1BA5A 2ADUA 4B43A 3DTEA 2O61A 2WA0A 2BBYA 1IDZA 2JA5J 5EF6A 1YI2I 1ACIA 3FHZA 2LKXA 5D4RA 3M8EA 2G7UA 4M74A 4RGUA 3V8LA 2WB1A 3K6GA 3M8JA 4HF1A 1CQTA 4UV8A 1E17A 3NWSA 5IT9K 4ZC3A 1TC3C 4KN4X 2DPUA 2FMYA 4RGRA 1QPIA 1GLNA 2WAQA 1W4MA 3TKYA 1B9MA 2V9KA 2LK2A 3GZ5A 4LLGF 1OYYA 2NVXJ 3GFLA 1JHFA 3TEDA 1Q1VA 2CQKA 4JK1X 1TT5B 1W7PB 3N05A 4BL0B 2A05A 2K9SA 4GDFA 4IHVA 1QVTA 2VC1A 2XGDA 3W6VA 3GX4X 1HA8A 2XF5A 3FDYA 3TO6A 1SC7A 2FNAA 2OZUA 2WC2A 2LY2A 3D1NI 1S72I 2LD5A 3E6DA 2R7SA 4A3FJ 2EQRA 4LGWA 4NDLA 4AVPA 1SEUA 2COMA 4CUGA 1A04A 2LLKA 5GPAA 5L3GA 1B72A 2MD5A 1WPKA 3J80K 3RYRA 2BYVE 1MBJA 1MW7A 1XS9A 3OYIA 1DU0A 3S93A 1YQAA 4M3EA 3QPTA 1Y6IA 4M72A 2PJRB 2GOXB 1QZEA 1Z6TA 1V5FA 2FUG2 1S7AA 4A3GJ 4MLOA 1HCRA 2MH2A 3DKYA 3ECOA 3PSFA 4HQMA 3S1MJ 3GCMA 5CVIA 4ZTFA 2V79A 4UVBA 1QQIA 2CYYA 3BJ6A 4RGSA 2K40A 3AL0C 1WI9A 5E3OA 4ZDOA 5DYMA 1FWZA 3CJQB 4D7MA 2Y0MA 2E1NA 2E71A 3LWFA 3PFIA 2P8TA 5IY5H 5LD2C 2LR8A 2DA5A 4XOPA 3VODA 2V6EA 5E79C 3R61A 1FIAA 3OMYA 4M6XA 1ZR2A 2CV1A 2MH9A 3HDDA 3OIOA 2IS2A 2L9NA 5HLIA 4LK0F 1XPXA 3TW7A 3D5SC 3WHBA 4X0GA 3K70C 4II2A 1MNEA 1ETVA 1MDMA 2K4JA 1K79A 3FMSA 2AHQA 3K4MA 4CCKA 2KISA 3J7YJ 3KP3A 4BQQA 3K0LA 4EM0B 3GBGA 4BJ6C 5JVGF 2IA0A 1ZLKA 2EV5A 1Z1DA 2A6TA 3JRDA 2DJIA 3VFZA 1X1BA 1D0XA 2WAFA 1SD5A 3FWEA 2FNPA 2OAZA 4YG2F 3BZ6A 2NAZA 2Q1ZB 2NXNB 2UXXA 4I7HA 4IHWA 5KCMA 3DQVC 1ZRCA 4EJOA 2Y48A 4BXUA 2A61A 4FE4A 4DBQA 4PJNA 4OINF 4CYDA 2CJJA 1NH3A 1OPCA 1WJBA 3OSGA 4IOAF 1TW2A 4IQJA 2P6SA 2Z1DA 1YO5C 1D0YA 2GIZA 1K4SA 4Y3OA 3FBIB 5JR3A 3KEQA 3W6KB 2GWRA 3JTGA 2UZKA 5E1XA 1IO2A 1G3WA 2LKSA 4WWCA 2VN2A 3BTJA 4HNTA 3G73A 2DA6A 3P9IA 3HOSA 4MTEA 5IP7J 3BJAA 3TOBA 2L7KA 4ITVA 4JP0A 2DFIA 4RAYA 1LFUP 5E3NA 2NVQJ 1XC5A 4NNJA 4OIQF 2JUCA 5KNLA 2M2EA 3H36A 3G6EI 1SANA 1QHHD 2F5EA 4PUSA 2XAGA 2R93J 2BY1A 3SEZA 4G12A 2HZTA 4RS8A 1IV6A 2DMQA 3S1QJ 1P4AA 2A07F 3PNVA 2OC6A 2R5ZB 3K4NA 2F5FA 5GAGJ 3OL3A 2DA4A 3HYIA 3RIRA 5IYBJ 2LOOA 2XDVA 3L00A 4XMYA 4CCOA 4X6AJ 1J7KA 4XIDA 3ZPLA 3BZCA 4HYEA 3VYRB 2W24A 2L7MP 1IUFA 3TMOA 1Z05A 4NC8A 4OIRF 1CF7A 3HB9A 2R7XA 1KQ9A 3VYUB 2EFQA 2KIQA 4MQ9F 3O8HA 4RAZA 3I59B 2UUZA 4ZDPA 1X2MA 3MMYB 1X1DA 4PFPA 4UUVA 2YX4A 4ZJZA 1T95A 3PNYA 2GLOA 2GXBA 3JREA 4I01A 2FRHA 5ED4A 4KT5C 2EIMH 3QYFA 3KP2A 2ELHA 5F08A 3HJEA 2OCCH 3LFUA 2W7NA 2VPLA 2HTSA 2WTEA 1JE8A 4FT8A 1HOMA 2DDAA 2JVHA 3PSIA 2JRTA 3S15J 2CQQA 4E7ZA 4BY1J 3JSPA 2ISZA 2M0MA 1WJFA 2IJLA 5DD4A 3RQIA 3MAJA 3GZNB 4XKVA 4BHPA 3S32A 3KP7A 1SFEA 2CSOA 4X1EA 3HIFA 2L4AA 3X2QH 3ZMZA 2QA4I 1D1AA 1MGTA 4A3CJ 1GT0C 2ID6A 5M3MJ 1U5TC 3OR1C 4MEXF 1KU2A 3FXRA 3MQ0A 5DTDA 4G8XA 1TQPA 1H9GA 2BW3B 5FGMA 4F92B 2NVTJ 1IV8A 1ETKA 4JOMA 5F64A 2CW7A 1C0WA 2ZSIB 3M1EA 4A0ZA 2VE8A 3FISA 1VQKI 2RGVA 2HYJA 2BV6A 3SDGA 3H9QA 5HNFA 3GTPJ 1LDKB 5BS6A 2QSHX 3ZR8X 5ICCA 1AA7A 1XSDA 1Z6RA 2L02A 1ZG5A 2HDDA 3F3XA 5ERIA 4M6VA 3U21A 5D6FA 1FLIA 2H1KA 4IOCF 2HPIA 2CW8A 3TOAA 3JRGA 4MGRA 3IV5A 3E1SA 2L0KA 1XSXA 2MC3A 4YIFA 2GAUA 4KUMA 3J7ZI 3ZXSA 2E2JJ 2F4OB 1EH6A 4RB0A 2E1MC 2A6HF 3F6OA 3H0GJ 2HOTA 1O7LA 4QLCU 2VE9A 2KRHA 5DV5A 4DW6A 2IT0A 3FXKA 1IRFA 3BQYA 3HZJA 2DOAA 4IEJA 1VFCA 5CVRA 3DBHB 3K70D 1WRJA 5E3LA 1DU6A 1P92A 2LMDA 3L2QA 1WFXA 1ZG3A 4L0YB 3HEFA 2LBFB 3VB2A 2QBYA 3H9GA 2EA4A 3WTYC 3SXYA 2QQ9A 3RDIA 1QA6A 1A6QA 3RJPA 4ABZA 2NRAC 2Q2EB 1B9NA 1JUMA 3PL8A 1R49A 2MYSA 3IWFA 2GZWA 4Y33A 2ZXWH 2L4MA 2AXTC 2YR2A 5ILSA 2ACJA 2NVYJ 1I6XA 3WTUC 1YHQI 2MGQA 3OYLA 2KP6A 2NNNA 4M6YA 2PFBA 5DM7F 2E5ZA 1LVKA 4A3JJ 2E2HJ 1TBXA 4U0VA 4LOCA 1V3FA 1HW2A 3S16J 5K5OA 1MMAA 1OCPA 2LNBA 4BEHA 3KYCB 3P9KA 3ZN1A 5LBQA 2XKPA 2LF8A 2PJRA 2XPWA 2YX7A 4A3BJ 4EMSA 5GAEJ 3MCZA 1XGMA 2KMUA
chains in the Genus database with same CATH topology
2A69F 2DU9A 5BPIA 1B1BA 4YFXF 3ZMVA 4O3MA 4KNYA 4WX9A 5HVQC 1SFUA 1BC7C 2X4HA 2PMHA 3HRSA 4ETSA 1WSUA 2RDPA 2ZO4A 2XAJA 3V4GA 1D8KA 2DQLA 4EJUA 2XASA 4CXFA 2FEZA 1MZBA 5DUKA 3ABTA 3CO6C 1ZHFA 1XDUA 5ILUA 3FM3A 2E7WA 5LEJA 3KCCA 3QU6A 3RKXA 1YW7A 2R7DA 4MEYF 2RC4A 3RPUA 5E8IA 5FFZA 4PDKA 2KJCA 4N0BA 1MKMA 3LA2A 1ZRFA 1BI0A 2VONA 1FY7A 5LGUA 4IHSA 3WE2A 2OA4A 3ZMUA 1T38A 4L5JA 2FXAA 3ERED 1W5TA 2O8XA 1PUEE 4MNUA 2FBIA 3FXUA 2W25A 3F72A 1OKRA 5DCFA 1REPC 4CGZA 4HW0A 2KJBA 1HKSA 1MDMB 1FBUA 3HHHA 1U8RA 2IW5A 3EETA 1B4AA 1I1GA 2DPDA 2W57A 1QGPA 3ZMTA 5HS7A 2EJRA 3Q9VA 4YFKF 5FD6A 3WTSC 2A5YB 4L0ZB 5HOOA 4R1HA 4RB2C 5HDNA 3ABUA 1U6GA 4BQAA 4MQVA 5D8LB 1G4DA 5KK1A 4CICA 1YYVA 2EFNA 4GXOA 2ZCWA 1QO0D 1D3YA 4AIKA 2HOEA 4MTDA 2P4WA 3DPLC 4LFUA 3DV8A 2ZNZA 1YTYA 1GXQA 2GA1A 3DPTA 4HV5A 1L3LA 1R5HA 4M71A 2YSRA 3U9GA 3G3ZA 3V7RA 3JAMK 4WXHA 5D6EA 5TRDA 3U2RA 1GXPA 4TV7A 1HW1A 2WV0A 3L9FA 5D8KB 2DW4A 1BC8C 2P5LC 3HSEA 4H0EA 1UFMA 1U78A 4LLNA 4L18B 1SMYF 2P7VB 2A3SA 4RGXA 3BPVA 2IA1A 4HBLA 1F4KA 1KQ8A 3HOTA 5K5RA 4BNCA 5A2QK 3W6JB 4WXDA 2XVCA 3WTWC 2M1BA 1XB4A 5LRRA 3C1DA 2G7HA 1G3TA 3ROUA 3FF5A 4GCVA 2OBPA 2FBHA 4KIFA 3WGHA 4PGGA 2XUBA 4NB5A 1ZARA 2PG4A 5E1WA 5J8CA 1DUXC 4G7ZF 1FYMA 2QWWA 1R1TA 3BP8A 1F5TA 1ODDA 3JW4A 3FX3A 4IJAA 1Z91A 1FSHA 1O3SA 3IRQA 3MZHA 1MJAA 1LDJA 4EJWA 2EB7A 3TDUC 2BGCA 1YFHA 2GXGA 3E5XA 3QAHA 2Z3YA 5L3CA 3HHGA 5L3BA 2Q8KA 2QBYB 5FLXK 5E18F 2Z33A 1ZGAA 4KMUX 4A0YA 3M8FA 4UXNA 1I1SA 4LK1F 2ETHA 3H92A 3U1DA 5ICGA 2P7CB 3KEOA 1LEAA 1O3RA 4U88A 2XAFA 5BPDA 1ZREA 3F23A 3ULQB 4ASNA 3WODF 4EM1A 4Y15A 2H09A 3O2PE 3P7NA 4A6DA 1XDSA 4HOBA 3ZQ7A 1QZYA 1IXCA 2D1HA 3WTXC 2H94A 3B02A 3CUQA 4CZZA 1SD4A 1P2FA 1HKTA 2DTRA 2O3FA 1H0MA 2K7LA 5FB2A 2HDCA 3OV8A 2PI0A 1TNSA 1G3YA 2LSOA 2HKOA 1ZH5A 2RNJA 4E70A 4F7ZA 2VT2A 3P9CA 1J59A 2FF4A 1ZG1A 2OU2A 2VBYA 3O6BB 3L2CA 2ZKZA 3T5XA 4HX7A 5HLHA 3LQRA 4XSXF 4XBFA 2OQGA 3I5UA 3EYIA 3H3ZA 3EYYA 2VOPA 2XAHA 2HYFA 4MHGA 2JZYA 1LQ1A 3QRFF 5FD5A 1IAWA 4UVCA 5DEQA 4GO1A 2VODA 3WG9A 3GWZA 2HR3A 1F9NA 3H3UA 4ZZLA 2XKOA 2VOOA 2CGPA 2PEXA 1S6LA 2AS5F 5LGTA 1QNTA 4HDUA 1R1VA 2C6YA 4LB5A 1R58A 1FZPB 1K7AA 1JGSA 3LAPA 2XROA 3PQKA 2D1VA 4GYIA 2F5CA 1YS7A 3QOPA 3IC7A 2J5PA 3LAJA 5AONA 1T0FA 3F8NA 5TJJA 2HYGD 1IN7A 5H20A 2FU4A 4A2UA 1BM9A 4BHCA 5E20A 3GFJA 2JSCA 1Z9CA 4AWXB 1TQMA 1FYKA 1L0OC 1ZGJA 1I5ZA 3EUHA 3C18A 1XCBA 1R00A 1XMAA 1FT9A 1IN4A 1FYLA 2HGCA 2QLZA 3KZYA 1OR7A 4I0BA 1FC3A 1HXDA 2JT1A 4M9SA 4OMYA 2STWA 4WXCA 5J8FA 5LGNA 1P4XA 5DD8A 2G9WA 4I2OA 3K69A 4QWQA 2QM3A 2H6CA 5CVVA 2DI3A 1KYZA 2P6TA 3C3WA 3IHUA 2LKPA 4CO8A 2Q0OA 1KU7A 4G9YA 1I27A 4GGGA 4KA4A 1LDDA 3KP6A 1PDNC 4PCQA 3GW2A 1LNWA 4LG0A 1RUOA 1DPRA 4P9UA 3NEUA 2EA2A 2JTVA 4AIHA 2FMLA 3RI4A 3FMQA 3CUOA 4WCGA 1SAXA 4ENMA 3F22A 2P5VA 2RQPA 4ZH4F 2QZ8A 2A68F 1BOAA 1KQ0A 4ESFA 1R7JA 3WGGA 2GQQA 3EQLF 4ENKA 2UXNA 4IRIA 4B09A 3TO7A 4ZYDA 2EFWA 3SFZA 3TQNA 1H9TA 3CDHA 5D4SA 1IN8A 3CO7C 4RB1A 3WTVC 4U0WA 1RZ4A 3SZTA 2XV4S 1E2XA 3WTTC 1ONVA 2PQ8A 4A0XA 1KGSA 4UNOA 1SFXA 4HDVA 1QPMA 3MWMA 2ZNYA 1IF1A 5L3DA 1KA8A 3BDDA 1R1UA 2A6EF 4EJVA 1W5SA 2CO5A 4LD5A 2ZJ2A 1J75A 5LHIA 6PAXA 3E97A 2MBFA 4EGZA 1DPUA 4BH9A 4I09A 2QUFA 1K6OA 2M8EA 4JBAA 2E1CA 2DQRA 3GZ6A 5BMZA 5K5QA 3O3KA 2GIVA 2DK8A 5AIQA 2K86A 1P4WA 3LQQA 4NHJA 2FA5A 3ELKA 4FX0A 1IXSB 1ZLJA 3GEZA 1Q1HA 3CUQB 1RUNA 2O0YA 2NYXA 5JHUA 3GF2A 4XSZF 2MA3A 1TW3A 4KYWA 1U3EM 3T8RA 2MLGA 3ZMDA 5ILVA 5DCMA 1J5YA 4R79A 2ZMEA 1J2XA 4ZYEA 1FP2A 4ENJA 2KIMA 2XGXA 2CW0F 3GYHX 3K2ZA 3E5UA 3HTUA 4EGYA 3ZP5A 2K4BA 5E1ZB 1QZZA 1SD7A 4HF2A 3E5QA 2STTA 1F1ZA 4UVAA 2P5KA 4G6DA 4OOIA 3VEPA 1DP7P 2KIUA 3BOQA 3SHFA 3D0SA 1T6SA 2O03A 2YPRA 2VBZA 5JI6A 4S04A 1XGOA 2IA2A 4WF2A 3COAC 2RKHA 1T98A 2W84A 3KP4A 3J81Z 5L3FA 4HLXA 2F5DA 3HUGA 4WK8F 3M9AA 3GO5A 3I53A 3T1BA 1YW9A 3FZVA 1YIOA 2Z9OA 4A5MA 4HZFA 3L09A 1UB9A 3HRMA 4OMZA 3BROA 1BJAA 3T0YA 1JXSA 5IT3A 4UV9A 3IRRA 4ZZDA 2EFPA 2KIFA 3VOEA 5D5VB 4L9NA 4DQ2A 1IXRC 1GHCA 2XAQA 3BY6A 4EQQA 4G94A 2V1UA 3WE3A 4HX8A 3MFKA 2KRFA 2O6GE 3I64A 5L3EA 3ZMSA 4N9IA 1VTNC 3HTSB 2BEOA 3OOPA 4OU0A 3MZYA 4CDGA 1XSVA 4EVIA 5FFXA 3J7AO 1LB2A 4IVNA 2GA2A 4BAYA 2UWMA 3GUDA 2QQBA 2FE3A 2J5OA 4Q4ZF 3I4PA 1USTA 3E6CC 1IRGA 5FO5A 1YS6A 4EM2A 4P9FA 5H6QA 3HSRA 3SQNA 1EH8A 4KFCA 3REOA 4M9XA 1PP8F 3HSFA 1YLFA 2FBKA 4ZYHA 3QP5A 1XN7A 4GYGA 4L5IA 4LG0B 1MJBA 2HQNA 2W85A 4ZYGA 3KETA 2D45A 2CFXA 4OIOF 5D5XB 2HTJA 3V8KA 4G7HF 5IT9Z 1LVAA 3E3VA 5HS8A 3I54A 3CLOA 2FQ3A 2AXLA 2FSWA 1LJ9A 4RB3C 3CJNA 1BIAA 3JSOA 1IUYA 3ZN0A 2XRNA 2PJPA 2HWVA 2FOKA 1Z7UA 4BHBA 4EJTA 2M5WA 2IPQX 1FP1D 1XMKA 2ISYA 2R3SA 2ZXJA 3J80Z 1HW5A 1U5TA 2ESHA 4HF0A 1CGPA 3FMRA 2Z5UA 2VXZA 5E8GA 1WWXA 3F8MA 3I0TA 3I58A 4BYYA 2KKOA 1QBJA 5HS9A 5H6RA 4I98B 3GVAA 2MLKA 2XHKA 1IN5A 1FNNA 4UHTA 1TLHB 4N9HA 2TDXA 1O3TA 3LA7A 5ICFA 2HQRA 1HSJA 2OQRA 2IVMA 1W7PD 4M9ZA 1EH7A 5DUIA 2H6BA 2EK5A 1BN5A 1NHAA 3N97A 1SMTA 4CHUA 4PZJA 3WTZA 3KLNA 1Y0UA 2H27A 4Q47A 2HEOA 1UCRA 5ICEA 2DAOA 1XGSA 1ON2A 1HKQA 2K02A 2V1XA 2HS5A 1ON1A 3HRTA 1ZRDA 4ENNA 5DCMB 2D2WA 2ZMEB 5CVUA 4HV6A 3DEUA 3PQJA 1HSTA 2NS0A 3K9TA 5AIPA 3WU1B 1S8NA 4B8XA 2V9VA 3ISPA 3RKWA 1FOKA 1YW8A 1FSEA 2VBXA 4EV0A 3GFMA 4XRFA 4HLYA 3M7GA 3F8BA 3LFKA 5EEHA 5CVJA 3V7CA 2PN6A 4I02A 2ZFWA 1XGNA 1B59A 1O57A 1HQCA 3DF8A 1AOYA 3R0AA 4NQWA 1RI7A 5LLQA 2X0LA 1O7FA 2QVOA 5JFRA 3IKTA 4G6QA 2F2EA 2EV0A 1XCVA 4KIBA 2XIGA 1IW7F 4KIGA 1S3JA 3F8CA 5D5UB 4OIPF 1DDNA 1J0RA 3TDZC 3R0JA 2LDUA 4YIIA 5KVRA 3D5LA 2DK5A 1K78A 2PMUA 1RIOH 4P55A 5LHHA 4S05A 4PGHA 3BWGA 1SD6A 4L9TA 2ESNA 1XD7A 3V7SA 3HRUA 5DDGA 3TO9A 3IL2A 2DLLA 5CLSA 2RV8A 3EDPA 3IWZA 1FBQA 4I0AA 3F21A 3DKWA 2NNYA 4ON0A 4A12A 1T2KA 3CUQC 3F6VA 2VBWA 1HBXG 4AIJA 2V1DA 5LRSA 2K27A 3FM5A 3RKYA 2E7XA 2IRFG 1S29A 4G7OF 1BBYA 3ML6A 4IXAA 4KN7X 3E6MA 1MJ9A 3JTHA 4HA8A 3R4KA 3NRVA 1BI1A 1TQIA 1TTYA 2PBIA 1ULYA 3T8TA 1W7PA 2CWEA 1BI2A 4KDPA 3WU0A 4Q5SF 1G3SA 4AD9A 4L9JA 4O5VA 1GVJA 3QU3A 4IHTA 2HFHA 4HX4A 2L54A 4HAMA 4U7BA 1D5VA 1RNLA 4L9VA 3BJOA 4P96A 4R8HA 1FBSA 5HLGA 4O6JA 4JQFA 3K1MA 3K1NA 4FHTA 3K1PA 2R7FA 4U0YA 4D0PA 1ZAOA 3RPQA 1KYWA 3Q9SA 3L7WA 3C7JA 1U5TB 1P6RA 5BOXA 3QP6A 5CYVA 5E17F 5D5WB 3F8FA 4XLNF 4HQEA 4LLLA 4A5NA 3KFWX 1R23A 5LHGA 2IP2A 4LMYA 1AWCA 4FX4A 5JVTA 1JHHA 3AAFA 1STZA 1MD0A 3BPXA 4Y13A 1EV7A 3Q5FA 3ECHA 3DFGA 1BI3A 2QYOA 2WWYA 3R60A 2EFOA 5LEKA 2HKXA 1O3QA 3N4MA 2EV6A 3FXQA 5K1YA 3E6BA 3WGIA 1R36A 4M73A 2VT3A 2ZBKA 2RVCA 3CTAA 1IN6A 3KP5A 5EEGA 1USSA 3I71A 1ZYRF 3MEXA 2YU3A 2M45A 2JPCA 2RN7A 2V6CA 2QENA 4KMFA 1OYIA 3LSTA 1KU9A 2Y75A 1V4RA 3SZPA 1OYWA 4IF4A 2M30A 4LB6B 1KU3A 4XLPF 2JPBA 2B0LA 3KE2A 2L3DA 3B73A 3I59A 2QQAA 1FPQA 4KICA 5F6FA 1WKMA 4K2EA 2M87A 5CJ9A 3J81K 3DP7A 1BIBA 4Q48A 3JAMZ 3IKVA 2PLYA 1T39A 4P5OA 4IPAA 5J6XA 3NQOA 5HDGA 3TGNA 1D8JA 3KZZA 1G6NA 1UHMA 2DBBA 1FX7A 1R5GA 2VC0A 4IRHA 4YFNF 1YG2A 1CF7B 4Z2YA 3R6SA 1U2WA 5HDKA 2DO7A 4IRGA 3RYPA 4ESBA 5A2QZ 3GXOA 3LA3A 1OMIA 2Z99A 1X3UA 1ZN2A 1S7OA 3GFIA 3S2WA 4DNCA 1WQ2A 3KLOA 1K78B 2OZ6A 2DT5A 3RTRA 2OD5A 4Y17A 4ESJA 1R22A 1J9IA 1B6AA 3V8JA 1PP7U 1UHWA 2Q2EA 2EWNA 5BQTA 1LEBA 4LJZF 2CG4A 4A6EA 5F1RA 3QPHA 3DXJF 1IZ1A 4U7DA 3GLXA 1TNTA 2L01A 2BE5F 2LF7A 5FLXZ 2ADUA 2O61A 2BBYA 3FHZA 5D4RA 3M8EA 2G7UA 4M74A 4RGUA 3V8LA 4HF1A 4UV8A 1E17A 5IT9K 4KN4X 2DPUA 2FMYA 4RGRA 1W4MA 3TKYA 1B9MA 3GZ5A 4LLGF 1OYYA 3GFLA 1JHFA 2CQKA 4JK1X 1W7PB 2VC1A 3GX4X 3TO6A 2FNAA 2OZUA 2WC2A 3E6DA 4LGWA 4AVPA 2COMA 1A04A 5L3GA 2MD5A 3J80K 3RYRA 2BYVE 1YQAA 3QPTA 4M72A 1Z6TA 1S7AA 2MH2A 3ECOA 4HQMA 5CVIA 2V79A 4UVBA 1QQIA 2CYYA 3BJ6A 4RGSA 1WI9A 5DYMA 1FWZA 2Y0MA 2E1NA 3LWFA 3PFIA 2P8TA 3VODA 3R61A 4M6XA 2MH9A 5HLIA 4LK0F 1MDMA 2K4JA 1K79A 3FMSA 3KP3A 3K0LA 4EM0B 2IA0A 1ZLKA 2EV5A 1Z1DA 3VFZA 3FWEA 1SD5A 2FNPA 2OAZA 4YG2F 3BZ6A 2NAZA 2UXXA 4I7HA 3DQVC 1ZRCA 4EJOA 2Y48A 4BXUA 2A61A 4OINF 4CYDA 1OPCA 1TW2A 2P6SA 1YO5C 5JR3A 3JTGA 3KEQA 3W6KB 2GWRA 2UZKA 5E1XA 1G3WA 4WWCA 2VN2A 3G73A 3P9IA 3HOSA 4MTEA 3BJAA 3TOBA 2DFIA 4RAYA 4OIQF 2F5EA 2XAGA 2HZTA 4RS8A 1P4AA 2A07F 2F5FA 3HYIA 3RIRA 3L00A 1J7KA 3ZPLA 4HYEA 2W24A 1Z05A 4OIRF 1CF7A 1KQ9A 2EFQA 4MQ9F 4RAZA 3I59B 4UUVA 2YX4A 2GXBA 4I01A 2FRHA 5ED4A 4KT5C 3KP2A 2ELHA 2HTSA 2WTEA 1JE8A 4FT8A 2JRTA 3JSPA 2ISZA 2IJLA 5DD4A 3MAJA 4BHPA 3KP7A 1SFEA 2CSOA 3HIFA 2L4AA 3ZMZA 1MGTA 1U5TC 4MEXF 1KU2A 3FXRA 3MQ0A 4G8XA 1TQPA 1H9GA 5FGMA 5F64A 1C0WA 3M1EA 4A0ZA 2VE8A 2RGVA 2BV6A 1LDKB 5BS6A 5ICCA 1XSDA 1Z6RA 2L02A 1ZG5A 3F3XA 5ERIA 1FLIA 5D6FA 3TOAA 4MGRA 4YIFA 1XSXA 2MC3A 2GAUA 4KUMA 4RB0A 1EH6A 2A6HF 3F6OA 1O7LA 4QLCU 2VE9A 2IT0A 5DV5A 1IRFA 5CVRA 1WRJA 1P92A 1ZG3A 4L0YB 3VB2A 2QBYA 2EA4A 3WTYC 3SXYA 2QQ9A 3RDIA 3RJPA 2NRAC 1B9NA 3IWFA 2GZWA 2L4MA 2YR2A 5ILSA 2ACJA 1I6XA 3WTUC 2NNNA 4M6YA 2PFBA 1TBXA 4U0VA 1HW2A 1V3FA 5K5OA 2LNBA 3P9KA 3ZN1A 5LBQA 2XKPA 2LF8A 2YX7A 4EMSA 3MCZA 1XGMA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2A69 F;  2DU9 A;  5BPI A;  1B1B A;  4YFX F;  3ZMV A;  4O3M A;  4KNY A;  4WX9 A;  5HVQ C;  1SFU A;  1BC7 C;  2X4H A;  2PMH A;  3HRS A;  4ETS A;  1WSU A;  2RDP A;  2ZO4 A;  2XAJ A;  3V4G A;  1D8K A;  2DQL A;  4EJU A;  2XAS A;  4CXF A;  2FEZ A;  1MZB A;  5DUK A;  3ABT A;  3CO6 C;  1ZHF A;  1XDU A;  5ILU A;  3FM3 A;  2E7W A;  5LEJ A;  3KCC A;  3QU6 A;  3RKX A;  1YW7 A;  2R7D A;  4MEY F;  2RC4 A;  3RPU A;  5E8I A;  5FFZ A;  4PDK A;  2KJC A;  4N0B A;  1MKM A;  3LA2 A;  1ZRF A;  1BI0 A;  2VON A;  1FY7 A;  5LGU A;  4IHS A;  3WE2 A;  2OA4 A;  3ZMU A;  1T38 A;  4L5J A;  2FXA A;  3ERE D;  1W5T A;  2O8X A;  1PUE E;  4MNU A;  2FBI A;  3FXU A;  2W25 A;  3F72 A;  1OKR A;  5DCF A;  1REP C;  4CGZ A;  4HW0 A;  2KJB A;  1HKS A;  1MDM B;  1FBU A;  3HHH A;  1U8R A;  2IW5 A;  3EET A;  1B4A A;  1I1G A;  2DPD A;  2W57 A;  1QGP A;  3ZMT A;  5HS7 A;  2EJR A;  3Q9V A;  4YFK F;  5FD6 A;  3WTS C;  2A5Y B;  4L0Z B;  5HOO A;  4R1H A;  4RB2 C;  5HDN A;  3ABU A;  1U6G A;  4BQA A;  4MQV A;  5D8L B;  1G4D A;  5KK1 A;  4CIC A;  1YYV A;  2EFN A;  4GXO A;  2ZCW A;  1QO0 D;  1D3Y A;  4AIK A;  2HOE A;  4MTD A;  2P4W A;  3DPL C;  4LFU A;  3DV8 A;  2ZNZ A;  1YTY A;  1GXQ A;  2GA1 A;  3DPT A;  4HV5 A;  1L3L A;  1R5H A;  4M71 A;  2YSR A;  3U9G A;  3G3Z A;  3V7R A;  3JAM K;  4WXH A;  5D6E A;  5TRD A;  3U2R A;  1GXP A;  4TV7 A;  1HW1 A;  2WV0 A;  3L9F A;  5D8K B;  2DW4 A;  1BC8 C;  2P5L C;  3HSE A;  4H0E A;  1UFM A;  1U78 A;  4LLN A;  4L18 B;  1SMY F;  2P7V B;  2A3S A;  4RGX A;  3BPV A;  2IA1 A;  4HBL A;  1F4K A;  1KQ8 A;  3HOT A;  5K5R A;  4BNC A;  5A2Q K;  3W6J B;  4WXD A;  2XVC A;  3WTW C;  2M1B A;  1XB4 A;  5LRR A;  3C1D A;  2G7H A;  1G3T A;  3ROU A;  3FF5 A;  4GCV A;  2OBP A;  2FBH A;  4KIF A;  3WGH A;  4PGG A;  2XUB A;  4NB5 A;  1ZAR A;  2PG4 A;  5E1W A;  5J8C A;  1DUX C;  4G7Z F;  1FYM A;  2QWW A;  1R1T A;  3BP8 A;  1F5T A;  1ODD A;  3JW4 A;  3FX3 A;  4IJA A;  1Z91 A;  1FSH A;  1O3S A;  3IRQ A;  3MZH A;  1MJA A;  1LDJ A;  4EJW A;  2EB7 A;  3TDU C;  2BGC A;  1YFH A;  2GXG A;  3E5X A;  3QAH A;  2Z3Y A;  5L3C A;  3HHG A;  5L3B A;  2Q8K A;  2QBY B;  5FLX K;  5E18 F;  2Z33 A;  1ZGA A;  4KMU X;  4A0Y A;  3M8F A;  4UXN A;  1I1S A;  4LK1 F;  2ETH A;  3H92 A;  3U1D A;  5ICG A;  2P7C B;  3KEO A;  1LEA A;  1O3R A;  4U88 A;  2XAF A;  5BPD A;  1ZRE A;  3F23 A;  3ULQ B;  4ASN A;  3WOD F;  4EM1 A;  4Y15 A;  2H09 A;  3O2P E;  3P7N A;  4A6D A;  1XDS A;  4HOB A;  3ZQ7 A;  1QZY A;  1IXC A;  2D1H A;  3WTX C;  2H94 A;  3B02 A;  3CUQ A;  4CZZ A;  1SD4 A;  1P2F A;  1HKT A;  2DTR A;  2O3F A;  1H0M A;  2K7L A;  5FB2 A;  2HDC A;  3OV8 A;  2PI0 A;  1TNS A;  1G3Y A;  2LSO A;  2HKO A;  1ZH5 A;  2RNJ A;  4E70 A;  4F7Z A;  2VT2 A;  3P9C A;  1J59 A;  2FF4 A;  1ZG1 A;  2OU2 A;  2VBY A;  3O6B B;  3L2C A;  2ZKZ A;  3T5X A;  4HX7 A;  5HLH A;  3LQR A;  4XSX F;  4XBF A;  2OQG A;  3I5U A;  3EYI A;  3H3Z A;  3EYY A;  2VOP A;  2XAH A;  2HYF A;  4MHG A;  2JZY A;  1LQ1 A;  3QRF F;  5FD5 A;  1IAW A;  4UVC A;  5DEQ A;  4GO1 A;  2VOD A;  3WG9 A;  3GWZ A;  2HR3 A;  1F9N A;  3H3U A;  4ZZL A;  2XKO A;  2VOO A;  2CGP A;  2PEX A;  1S6L A;  2AS5 F;  5LGT A;  1QNT A;  4HDU A;  1R1V A;  2C6Y A;  4LB5 A;  1R58 A;  1FZP B;  1K7A A;  1JGS A;  3LAP A;  2XRO A;  3PQK A;  2D1V A;  4GYI A;  2F5C A;  1YS7 A;  3QOP A;  3IC7 A;  2J5P A;  3LAJ A;  5AON A;  1T0F A;  3F8N A;  5TJJ A;  2HYG D;  1IN7 A;  5H20 A;  2FU4 A;  4A2U A;  1BM9 A;  4BHC A;  5E20 A;  3GFJ A;  2JSC A;  1Z9C A;  4AWX B;  1TQM A;  1FYK A;  1L0O C;  1ZGJ A;  1I5Z A;  3EUH A;  3C18 A;  1XCB A;  1R00 A;  1XMA A;  1FT9 A;  1IN4 A;  1FYL A;  2HGC A;  2QLZ A;  3KZY A;  1OR7 A;  4I0B A;  1FC3 A;  1HXD A;  2JT1 A;  4M9S A;  4OMY A;  2STW A;  4WXC A;  5J8F A;  5LGN A;  1P4X A;  5DD8 A;  2G9W A;  4I2O A;  3K69 A;  4QWQ A;  2QM3 A;  2H6C A;  5CVV A;  2DI3 A;  1KYZ A;  2P6T A;  3C3W A;  3IHU A;  2LKP A;  4CO8 A;  2Q0O A;  1KU7 A;  4G9Y A;  1I27 A;  4GGG A;  4KA4 A;  1LDD A;  3KP6 A;  1PDN C;  4PCQ A;  3GW2 A;  1LNW A;  4LG0 A;  1RUO A;  1DPR A;  4P9U A;  3NEU A;  2EA2 A;  2JTV A;  4AIH A;  2FML A;  3RI4 A;  3FMQ A;  3CUO A;  4WCG A;  1SAX A;  4ENM A;  3F22 A;  2P5V A;  2RQP A;  4ZH4 F;  2QZ8 A;  2A68 F;  1BOA A;  1KQ0 A;  4ESF A;  1R7J A;  3WGG A;  2GQQ A;  3EQL F;  4ENK A;  2UXN A;  4IRI A;  4B09 A;  3TO7 A;  4ZYD A;  2EFW A;  3SFZ A;  3TQN A;  1H9T A;  3CDH A;  5D4S A;  1IN8 A;  3CO7 C;  4RB1 A;  3WTV C;  4U0W A;  1RZ4 A;  3SZT A;  2XV4 S;  1E2X A;  3WTT C;  1ONV A;  2PQ8 A;  4A0X A;  1KGS A;  4UNO A;  1SFX A;  4HDV A;  1QPM A;  3MWM A;  2ZNY A;  1IF1 A;  5L3D A;  1KA8 A;  3BDD A;  1R1U A;  2A6E F;  4EJV A;  1W5S A;  2CO5 A;  4LD5 A;  2ZJ2 A;  1J75 A;  5LHI A;  6PAX A;  3E97 A;  2MBF A;  4EGZ A;  1DPU A;  4BH9 A;  4I09 A;  2QUF A;  1K6O A;  2M8E A;  4JBA A;  2E1C A;  2DQR A;  3GZ6 A;  5BMZ A;  5K5Q A;  3O3K A;  2GIV A;  2DK8 A;  5AIQ A;  2K86 A;  1P4W A;  3LQQ A;  4NHJ A;  2FA5 A;  3ELK A;  4FX0 A;  1IXS B;  1ZLJ A;  3GEZ A;  1Q1H A;  3CUQ B;  1RUN A;  2O0Y A;  2NYX A;  5JHU A;  3GF2 A;  4XSZ F;  2MA3 A;  1TW3 A;  4KYW A;  1U3E M;  3T8R A;  2MLG A;  3ZMD A;  5ILV A;  5DCM A;  1J5Y A;  4R79 A;  2ZME A;  1J2X A;  4ZYE A;  1FP2 A;  4ENJ A;  2KIM A;  2XGX A;  2CW0 F;  3GYH X;  3K2Z A;  3E5U A;  3HTU A;  4EGY A;  3ZP5 A;  2K4B A;  5E1Z B;  1QZZ A;  1SD7 A;  4HF2 A;  3E5Q A;  2STT A;  1F1Z A;  4UVA A;  2P5K A;  4G6D A;  4OOI A;  3VEP A;  1DP7 P;  2KIU A;  3BOQ A;  3SHF A;  3D0S A;  1T6S A;  2O03 A;  2YPR A;  2VBZ A;  5JI6 A;  4S04 A;  1XGO A;  2IA2 A;  4WF2 A;  3COA C;  2RKH A;  1T98 A;  2W84 A;  3KP4 A;  3J81 Z;  5L3F A;  4HLX A;  2F5D A;  3HUG A;  4WK8 F;  3M9A A;  3GO5 A;  3I53 A;  3T1B A;  1YW9 A;  3FZV A;  1YIO A;  2Z9O A;  4A5M A;  4HZF A;  3L09 A;  1UB9 A;  3HRM A;  4OMZ A;  3BRO A;  1BJA A;  3T0Y A;  1JXS A;  5IT3 A;  4UV9 A;  3IRR A;  4ZZD A;  2EFP A;  2KIF A;  3VOE A;  5D5V B;  4L9N A;  4DQ2 A;  1IXR C;  1GHC A;  2XAQ A;  3BY6 A;  4EQQ A;  4G94 A;  2V1U A;  3WE3 A;  4HX8 A;  3MFK A;  2KRF A;  2O6G E;  3I64 A;  5L3E A;  3ZMS A;  4N9I A;  1VTN C;  3HTS B;  2BEO A;  3OOP A;  4OU0 A;  3MZY A;  4CDG A;  1XSV A;  4EVI A;  5FFX A;  3J7A O;  1LB2 A;  4IVN A;  2GA2 A;  4BAY A;  2UWM A;  3GUD A;  2QQB A;  2FE3 A;  2J5O A;  4Q4Z F;  3I4P A;  1UST A;  3E6C C;  1IRG A;  5FO5 A;  1YS6 A;  4EM2 A;  4P9F A;  5H6Q A;  3HSR A;  3SQN A;  1EH8 A;  4KFC A;  3REO A;  4M9X A;  1PP8 F;  3HSF A;  1YLF A;  2FBK A;  4ZYH A;  3QP5 A;  1XN7 A;  4GYG A;  4L5I A;  4LG0 B;  1MJB A;  2HQN A;  2W85 A;  4ZYG A;  3KET A;  2D45 A;  2CFX A;  4OIO F;  5D5X B;  2HTJ A;  3V8K A;  4G7H F;  5IT9 Z;  1LVA A;  3E3V A;  5HS8 A;  3I54 A;  3CLO A;  2FQ3 A;  2AXL A;  2FSW A;  1LJ9 A;  4RB3 C;  3CJN A;  1BIA A;  3JSO A;  1IUY A;  3ZN0 A;  2XRN A;  2PJP A;  2HWV A;  2FOK A;  1Z7U A;  4BHB A;  4EJT A;  2M5W A;  2IPQ X;  1FP1 D;  1XMK A;  2ISY A;  2R3S A;  2ZXJ A;  3J80 Z;  1HW5 A;  1U5T A;  2ESH A;  4HF0 A;  1CGP A;  3FMR A;  2Z5U A;  2VXZ A;  5E8G A;  1WWX A;  3F8M A;  3I0T A;  3I58 A;  4BYY A;  2KKO A;  1QBJ A;  5HS9 A;  5H6R A;  4I98 B;  3GVA A;  2MLK A;  2XHK A;  1IN5 A;  1FNN A;  4UHT A;  1TLH B;  4N9H A;  2TDX A;  1O3T A;  3LA7 A;  5ICF A;  2HQR A;  1HSJ A;  2OQR A;  2IVM A;  1W7P D;  4M9Z A;  1EH7 A;  5DUI A;  2H6B A;  2EK5 A;  1BN5 A;  1NHA A;  3N97 A;  1SMT A;  4CHU A;  4PZJ A;  3WTZ A;  3KLN A;  1Y0U A;  2H27 A;  4Q47 A;  2HEO A;  1UCR A;  5ICE A;  2DAO A;  1XGS A;  1ON2 A;  1HKQ A;  2K02 A;  2V1X A;  2HS5 A;  1ON1 A;  3HRT A;  1ZRD A;  4ENN A;  5DCM B;  2D2W A;  2ZME B;  5CVU A;  4HV6 A;  3DEU A;  3PQJ A;  1HST A;  2NS0 A;  3K9T A;  5AIP A;  3WU1 B;  1S8N A;  4B8X A;  2V9V A;  3ISP A;  3RKW A;  1FOK A;  1YW8 A;  1FSE A;  2VBX A;  4EV0 A;  3GFM A;  4XRF A;  4HLY A;  3M7G A;  3F8B A;  3LFK A;  5EEH A;  5CVJ A;  3V7C A;  2PN6 A;  4I02 A;  2ZFW A;  1XGN A;  1B59 A;  1O57 A;  1HQC A;  3DF8 A;  1AOY A;  3R0A A;  4NQW A;  1RI7 A;  5LLQ A;  2X0L A;  1O7F A;  2QVO A;  5JFR A;  3IKT A;  4G6Q A;  2F2E A;  2EV0 A;  1XCV A;  4KIB A;  2XIG A;  1IW7 F;  4KIG A;  1S3J A;  3F8C A;  5D5U B;  4OIP F;  1DDN A;  1J0R A;  3TDZ C;  3R0J A;  2LDU A;  4YII A;  5KVR A;  3D5L A;  2DK5 A;  1K78 A;  2PMU A;  1RIO H;  4P55 A;  5LHH A;  4S05 A;  4PGH A;  3BWG A;  1SD6 A;  4L9T A;  2ESN A;  1XD7 A;  3V7S A;  3HRU A;  5DDG A;  3TO9 A;  3IL2 A;  2DLL A;  5CLS A;  2RV8 A;  3EDP A;  3IWZ A;  1FBQ A;  4I0A A;  3F21 A;  3DKW A;  2NNY A;  4ON0 A;  4A12 A;  1T2K A;  3CUQ C;  3F6V A;  2VBW A;  1HBX G;  4AIJ A;  2V1D A;  5LRS A;  2K27 A;  3FM5 A;  3RKY A;  2E7X A;  2IRF G;  1S29 A;  4G7O F;  1BBY A;  3ML6 A;  4IXA A;  4KN7 X;  3E6M A;  1MJ9 A;  3JTH A;  4HA8 A;  3R4K A;  3NRV A;  1BI1 A;  1TQI A;  1TTY A;  2PBI A;  1ULY A;  3T8T A;  1W7P A;  2CWE A;  1BI2 A;  4KDP A;  3WU0 A;  4Q5S F;  1G3S A;  4AD9 A;  4L9J A;  4O5V A;  1GVJ A;  3QU3 A;  4IHT A;  2HFH A;  4HX4 A;  2L54 A;  4HAM A;  4U7B A;  1D5V A;  1RNL A;  4L9V A;  3BJO A;  4P96 A;  4R8H A;  1FBS A;  5HLG A;  4O6J A;  4JQF A;  3K1M A;  3K1N A;  4FHT A;  3K1P A;  2R7F A;  4U0Y A;  4D0P A;  1ZAO A;  3RPQ A;  1KYW A;  3Q9S A;  3L7W A;  3C7J A;  1U5T B;  1P6R A;  5BOX A;  3QP6 A;  5CYV A;  5E17 F;  5D5W B;  3F8F A;  4XLN F;  4HQE A;  4LLL A;  4A5N A;  3KFW X;  1R23 A;  5LHG A;  2IP2 A;  4LMY A;  1AWC A;  4FX4 A;  5JVT A;  1JHH A;  3AAF A;  1STZ A;  1MD0 A;  3BPX A;  4Y13 A;  1EV7 A;  3Q5F A;  3ECH A;  3DFG A;  1BI3 A;  2QYO A;  2WWY A;  3R60 A;  2EFO A;  5LEK A;  2HKX A;  1O3Q A;  3N4M A;  2EV6 A;  3FXQ A;  5K1Y A;  3E6B A;  3WGI A;  1R36 A;  4M73 A;  2VT3 A;  2ZBK A;  2RVC A;  3CTA A;  1IN6 A;  3KP5 A;  5EEG A;  1USS A;  3I71 A;  1ZYR F;  3MEX A;  2YU3 A;  2M45 A;  2JPC A;  2RN7 A;  2V6C A;  2QEN A;  4KMF A;  1OYI A;  3LST A;  1KU9 A;  2Y75 A;  1V4R A;  3SZP A;  1OYW A;  4IF4 A;  2M30 A;  4LB6 B;  1KU3 A;  4XLP F;  2JPB A;  2B0L A;  3KE2 A;  2L3D A;  3B73 A;  3I59 A;  2QQA A;  1FPQ A;  4KIC A;  5F6F A;  1WKM A;  4K2E A;  2M87 A;  5CJ9 A;  3J81 K;  3DP7 A;  1BIB A;  4Q48 A;  3JAM Z;  3IKV A;  2PLY A;  1T39 A;  4P5O A;  4IPA A;  5J6X A;  3NQO A;  5HDG A;  3TGN A;  1D8J A;  3KZZ A;  1G6N A;  1UHM A;  2DBB A;  1FX7 A;  1R5G A;  2VC0 A;  4IRH A;  4YFN F;  1YG2 A;  1CF7 B;  4Z2Y A;  3R6S A;  1U2W A;  5HDK A;  2DO7 A;  4IRG A;  3RYP A;  4ESB A;  5A2Q Z;  3GXO A;  3LA3 A;  1OMI A;  2Z99 A;  1X3U A;  1ZN2 A;  1S7O A;  3GFI A;  3S2W A;  4DNC A;  1WQ2 A;  3KLO A;  1K78 B;  2OZ6 A;  2DT5 A;  3RTR A;  2OD5 A;  4Y17 A;  4ESJ A;  1R22 A;  1J9I A;  1B6A A;  3V8J A;  1PP7 U;  1UHW A;  2Q2E A;  2EWN A;  5BQT A;  1LEB A;  4LJZ F;  2CG4 A;  4A6E A;  5F1R A;  3QPH A;  3DXJ F;  1IZ1 A;  4U7D A;  3GLX A;  1TNT A;  2L01 A;  2BE5 F;  2LF7 A;  5FLX Z;  2ADU A;  2O61 A;  2BBY A;  3FHZ A;  5D4R A;  3M8E A;  2G7U A;  4M74 A;  4RGU A;  3V8L A;  4HF1 A;  4UV8 A;  1E17 A;  5IT9 K;  4KN4 X;  2DPU A;  2FMY A;  4RGR A;  1W4M A;  3TKY A;  1B9M A;  3GZ5 A;  4LLG F;  1OYY A;  3GFL A;  1JHF A;  2CQK A;  4JK1 X;  1W7P B;  2VC1 A;  3GX4 X;  3TO6 A;  2FNA A;  2OZU A;  2WC2 A;  3E6D A;  4LGW A;  4AVP A;  2COM A;  1A04 A;  5L3G A;  2MD5 A;  3J80 K;  3RYR A;  2BYV E;  1YQA A;  3QPT A;  4M72 A;  1Z6T A;  1S7A A;  2MH2 A;  3ECO A;  4HQM A;  5CVI A;  2V79 A;  4UVB A;  1QQI A;  2CYY A;  3BJ6 A;  4RGS A;  1WI9 A;  5DYM A;  1FWZ A;  2Y0M A;  2E1N A;  3LWF A;  3PFI A;  2P8T A;  3VOD A;  3R61 A;  4M6X A;  2MH9 A;  5HLI A;  4LK0 F;  1MDM A;  2K4J A;  1K79 A;  3FMS A;  3KP3 A;  3K0L A;  4EM0 B;  2IA0 A;  1ZLK A;  2EV5 A;  1Z1D A;  3VFZ A;  3FWE A;  1SD5 A;  2FNP A;  2OAZ A;  4YG2 F;  3BZ6 A;  2NAZ A;  2UXX A;  4I7H A;  3DQV C;  1ZRC A;  4EJO A;  2Y48 A;  4BXU A;  2A61 A;  4OIN F;  4CYD A;  1OPC A;  1TW2 A;  2P6S A;  1YO5 C;  5JR3 A;  3JTG A;  3KEQ A;  3W6K B;  2GWR A;  2UZK A;  5E1X A;  1G3W A;  4WWC A;  2VN2 A;  3G73 A;  3P9I A;  3HOS A;  4MTE A;  3BJA A;  3TOB A;  2DFI A;  4RAY A;  4OIQ F;  2F5E A;  2XAG A;  2HZT A;  4RS8 A;  1P4A A;  2A07 F;  2F5F A;  3HYI A;  3RIR A;  3L00 A;  1J7K A;  3ZPL A;  4HYE A;  2W24 A;  1Z05 A;  4OIR F;  1CF7 A;  1KQ9 A;  2EFQ A;  4MQ9 F;  4RAZ A;  3I59 B;  4UUV A;  2YX4 A;  2GXB A;  4I01 A;  2FRH A;  5ED4 A;  4KT5 C;  3KP2 A;  2ELH A;  2HTS A;  2WTE A;  1JE8 A;  4FT8 A;  2JRT A;  3JSP A;  2ISZ A;  2IJL A;  5DD4 A;  3MAJ A;  4BHP A;  3KP7 A;  1SFE A;  2CSO A;  3HIF A;  2L4A A;  3ZMZ A;  1MGT A;  1U5T C;  4MEX F;  1KU2 A;  3FXR A;  3MQ0 A;  4G8X A;  1TQP A;  1H9G A;  5FGM A;  5F64 A;  1C0W A;  3M1E A;  4A0Z A;  2VE8 A;  2RGV A;  2BV6 A;  1LDK B;  5BS6 A;  5ICC A;  1XSD A;  1Z6R A;  2L02 A;  1ZG5 A;  3F3X A;  5ERI A;  1FLI A;  5D6F A;  3TOA A;  4MGR A;  4YIF A;  1XSX A;  2MC3 A;  2GAU A;  4KUM A;  4RB0 A;  1EH6 A;  2A6H F;  3F6O A;  1O7L A;  4QLC U;  2VE9 A;  2IT0 A;  5DV5 A;  1IRF A;  5CVR A;  1WRJ A;  1P92 A;  1ZG3 A;  4L0Y B;  3VB2 A;  2QBY A;  2EA4 A;  3WTY C;  3SXY A;  2QQ9 A;  3RDI A;  3RJP A;  2NRA C;  1B9N A;  3IWF A;  2GZW A;  2L4M A;  2YR2 A;  5ILS A;  2ACJ A;  1I6X A;  3WTU C;  2NNN A;  4M6Y A;  2PFB A;  1TBX A;  4U0V A;  1HW2 A;  1V3F A;  5K5O A;  2LNB A;  3P9K A;  3ZN1 A;  5LBQ A;  2XKP A;  2LF8 A;  2YX7 A;  4EMS A;  3MCZ A;  1XGM A; 
#chains in the Genus database with same CATH topology
 3HPG A;  1WJE A;  2A69 F;  2OF7 A;  2DU9 A;  4KJZ A;  5BPI A;  4F55 A;  1B1B A;  4YFX F;  3ZMV A;  2UV1 A;  1SFO J;  1ERD A;  4O3M A;  4KNY A;  4WX9 A;  2ECB A;  2ZC2 A;  5HVQ C;  1SFU A;  1BC7 C;  4E6K G;  2X4H A;  2PMH A;  3HRS A;  3RKQ A;  4ETS A;  1WSU A;  2RDP A;  2ZO4 A;  2XAJ A;  2R7V A;  2OCE A;  2AQE A;  5KAF C;  3OYD A;  2MD0 A;  4HST A;  3ONQ A;  3V4G A;  1D8K A;  2DQL A;  4EJU A;  5FLV A;  2XAS A;  3CD6 I;  1MMS A;  4CXF A;  2FEZ A;  3CQZ J;  2HNH A;  2EBI A;  1MZB A;  4NUB A;  5DUK A;  1UJ8 A;  1JT0 A;  2B9S A;  3ABT A;  3CO6 C;  1ZHF A;  4BGD A;  1I3A A;  1XDU A;  4DZJ A;  5ILU A;  1B72 B;  4BAC A;  3FM3 A;  5J1U A;  2E7W A;  5LEJ A;  1NG6 A;  3KCC A;  1JKO C;  2YUS A;  3KZI C;  1IJW C;  3OYM A;  2K9L A;  2GOM A;  3QU6 A;  3RKX A;  1YW7 A;  2R7D A;  5M3F J;  4MEY F;  1VZ0 A;  2RC4 A;  1HDP A;  1HDD C;  3RPU A;  5E8I A;  5FFZ A;  2W1O A;  2FQ4 A;  4PDK A;  2KJC A;  2YS9 A;  4N0B A;  1MKM A;  3LA2 A;  3S2D J;  3FXL A;  1ZRF A;  1BI0 A;  5J47 A;  1V5E A;  1JI8 A;  2VON A;  3DCF A;  1FY7 A;  1X19 A;  5LGU A;  4IHS A;  3PUF A;  3WE2 A;  2DFF A;  2OA4 A;  3ZMU A;  1JKQ C;  3MZ8 A;  1YIT I;  2WY7 Q;  1A6I A;  4XLC A;  4XRS A;  1S7E A;  1T38 A;  4P1W A;  4L5J A;  2FXA A;  3ERE D;  1W5T A;  3W2V A;  2O8X A;  1PUE E;  4MNU A;  4XN3 A;  2FBI A;  4N4N B;  4CYC A;  3FXU A;  2W25 A;  1SVL A;  3H5N A;  3F72 A;  1OKR A;  1WZ2 A;  2DN0 A;  5DCF A;  4OWR B;  1QU3 A;  1REP C;  4CGZ A;  2VUM J;  2KL4 A;  4HW0 A;  3VDX A;  2RQQ A;  2KJB A;  3CC7 I;  1HKS A;  5FRM A;  1MDM B;  2QSG X;  1FBU A;  3HHH A;  1U8R A;  2IW5 A;  3MKW B;  3GTO J;  1Y56 A;  3A0B C;  3EET A;  2VQH A;  1B4A A;  1I1G A;  5EDN A;  1JGG A;  2DPD A;  1FOW A;  2R7T A;  1I6H J;  2W57 A;  1QGP A;  3ZMT A;  5HS7 A;  2NOG A;  2EJR A;  2R5Z A;  3H3V K;  3Q9V A;  5CKT A;  4AU7 A;  3TBI A;  5FKO A;  5JLX A;  4YFK F;  5J1R A;  3S2H J;  5FD6 A;  2VIX A;  5GAD J;  3WTS C;  3HL2 A;  2A5Y B;  2LG4 A;  2X1C A;  4L0Z B;  1WJC A;  5HOO A;  4R1H A;  2F48 A;  5HDN A;  3ABU A;  1U6G A;  4RB2 C;  3CP8 A;  4U87 A;  4I6Z A;  4BQA A;  1RC9 A;  4MQV A;  5D8L B;  2OTJ I;  2BY2 A;  1YX5 A;  3CP2 A;  5EEA A;  3CMY A;  3BC8 A;  1G4D A;  3C2B A;  5KK1 A;  4CIC A;  2LH9 A;  2P0W A;  1YYV A;  2EFN A;  1P7I A;  4GXO A;  2ZCW A;  3IAM 2;  5M5W J;  1QO0 D;  5KHD A;  1D3Y A;  2V7F A;  4AIK A;  1K6Y A;  2HOE A;  2VI6 A;  3UKG A;  4MTD A;  4D9J A;  2P4W A;  3DPL C;  2MW8 A;  2DTZ A;  4LFU A;  3DV8 A;  2ZNZ A;  4BXF A;  4IHY A;  4A3L J;  2ZXH A;  1YTY A;  1GXQ A;  2I8D A;  1SFK A;  2FD5 A;  2GA1 A;  3DPT A;  3IAS 2;  4HV5 A;  1L3L A;  1TL8 A;  2JUG A;  1R5H A;  4M71 A;  3H9J A;  2YSR A;  3E0J B;  3U9G A;  1VND A;  4PFO A;  1APL C;  1WVR A;  3G3Z A;  3ZRG A;  4S0H B;  3GTL J;  5E3M A;  3V7R A;  1RR7 A;  3Q0V A;  4FCY A;  3JAM K;  4WXH A;  2HVR A;  3OOU A;  5D6E A;  5TRD A;  2HDW A;  3U2R A;  4D5F A;  1GXP A;  4TV7 A;  4QSH A;  2MFZ A;  1BR4 A;  1HW1 A;  2DA3 A;  2WV0 A;  1U0J A;  3L9F A;  5D8K B;  2DW4 A;  4EEF G;  3OYB A;  2P5L C;  1BC8 C;  3H0D A;  3HSE A;  2CUF A;  1UAA A;  3EUA A;  2CUJ A;  3B6C A;  4H0E A;  3QPL A;  2VB6 A;  3MKZ A;  5FKK A;  1FMW A;  4DYC A;  1UFM A;  1U78 A;  4LLN A;  4L18 B;  1W1W E;  1SMY F;  1JUS A;  2ME0 A;  1MBG A;  2P7V B;  2A3S A;  4RGX A;  4B3X A;  4RMN A;  2NS8 A;  1X4O A;  3BPV A;  5K7Z A;  3AKZ A;  4A3E J;  4BXX J;  4FTH A;  2IA1 A;  2L7F P;  4HBL A;  1F4K A;  2H8W A;  1KQ8 A;  3HOT A;  5K5R A;  4BNC A;  5A2Q K;  4M3F A;  3OS1 A;  1E3O C;  1IC8 A;  3W6J B;  4WXD A;  1POG A;  2TRT A;  2XVC A;  3K4B A;  4IL6 C;  3WTW C;  5K7H A;  2M1B A;  2LBF A;  2WAD A;  3LSP A;  5F1J A;  3BT9 A;  1XB4 A;  5LRR A;  2EIN H;  3C1D A;  2E5N A;  1ETY A;  2G7H A;  1G3T A;  4XK4 A;  1R6R A;  3ROU A;  2DJN A;  3FF5 A;  1S9H A;  4GCV A;  3K4C A;  2DXI A;  2OBP A;  2AO9 A;  2EZL A;  2FBH A;  4KIF A;  4LIV A;  4PGG A;  3WGH A;  1MSE C;  2XUB A;  4NB5 A;  4L5E A;  1ZAR A;  2PG4 A;  5E1W A;  2A5W A;  2JMW A;  5J8C A;  1DUX C;  2HVQ A;  2W00 A;  2JA2 A;  1T8I A;  4G7Z F;  1FYM A;  2QWW A;  1R1T A;  3BP8 A;  1XMX A;  3B6A A;  4IX7 A;  1F5T A;  1ODD A;  3LSM A;  2E36 A;  2X6X A;  3QOD A;  3JW4 A;  3FX3 A;  1Z0X A;  4IJA A;  4OAZ A;  1R9T J;  1Z91 A;  5FKM A;  1FSH A;  1O3S A;  3IRQ A;  3MZH A;  1MJA A;  1G59 A;  2DA1 A;  4RM3 A;  1LDJ A;  2Y0S A;  1BW5 A;  1TWC J;  4EJW A;  3LSI A;  2EB7 A;  3TDU C;  2BGC A;  1YFH A;  4QIW N;  2GXG A;  3RZD J;  3E5X A;  2M9H A;  3QAH A;  2Z3Y A;  2DT6 A;  2ZME C;  5L3C A;  3HHG A;  1W0T A;  5L3B A;  2JWT A;  2Q8K A;  3BG3 A;  2QBY B;  5FLX K;  1YOV B;  1N75 A;  5E18 F;  3GLL A;  2Z33 A;  5M5X J;  1MMG A;  1ZGA A;  5C3E J;  4KMU X;  4HNU A;  1BW6 A;  4A0Y A;  3M8F A;  3HKZ A;  2BXY A;  4UXN A;  4BS9 A;  1I1S A;  2P81 A;  4LK1 F;  3LSR A;  2ETH A;  3H92 A;  3U1D A;  5ICG A;  2P7C B;  4JYK A;  3L2R A;  3KEO A;  1LEA A;  1O3R A;  4U88 A;  1FOX A;  2XAF A;  5BPD A;  1Z3X A;  1ZRE A;  3F23 A;  2QKM B;  4DGW B;  1K61 A;  2M7A A;  3ULQ B;  4BEH B;  3QQA A;  3ZCO A;  1AKH A;  3MKY B;  2ZFU A;  4ASN A;  1UEL B;  3ZQQ A;  4BBR J;  3WOD F;  1A36 A;  4EM1 A;  4Y15 A;  2H09 A;  2IGO A;  3ZQF A;  1R5I D;  3O2P E;  3P7N A;  4A6D A;  1DP3 A;  1SVM A;  1XDS A;  4HOB A;  3ZQ7 A;  3JRC A;  1H8A C;  1QZY A;  1IXC A;  1RPW A;  2D1H A;  2FOW A;  3BG6 A;  3WTX C;  2H94 A;  3B02 A;  3CUQ A;  3OYJ A;  2M7B A;  2Y31 A;  3CCR I;  1E0E A;  4CZZ A;  2KFD A;  1EA3 A;  2K5C A;  1SD4 A;  1NTC A;  1P2F A;  1RKT A;  3FHN A;  1HKT A;  1AHD P;  2DTR A;  2O3F A;  1H0M A;  3LSG A;  2K7L A;  4XKC A;  2E1O A;  5FB2 A;  2HDC A;  3OV8 A;  5LFA A;  2PI0 A;  1TNS A;  1G3Y A;  3ZGK A;  2LSO A;  2HKO A;  2K9Q A;  1ZH5 A;  2RNJ A;  2R7Q A;  4E70 A;  3LOC A;  4F7Z A;  2VT2 A;  1FTT A;  3OIP A;  3P9C A;  2K9N A;  1J59 A;  2FF4 A;  1ZG1 A;  1P7J A;  2OU2 A;  2VBY A;  3O6B B;  3L2C A;  2ZKZ A;  3T5X A;  4HX7 A;  5HLH A;  3LQR A;  4XSX F;  2ZJR F;  1VQN I;  2BVL A;  2IBD A;  4XBF A;  2OQG A;  2ICW G;  3I5U A;  3I55 I;  3EYI A;  3H3Z A;  3EYY A;  2VOP A;  2XAH A;  2HYF A;  4MHG A;  1ZGW A;  4EAT A;  4XIC A;  2CFO A;  3BZK A;  2BXZ A;  2CV2 A;  2JZY A;  3PUB A;  4XKW A;  1LQ1 A;  3QYB A;  3KX2 A;  3ABL H;  2M4G A;  2VJ4 A;  3BR0 A;  5FD5 A;  3DU6 A;  2EZK A;  4CSW A;  3QRF F;  1IAW A;  4UVC A;  4KIT B;  2DMP A;  5DEQ A;  4GO1 A;  1IGN A;  3WG9 A;  3GWZ A;  2VOD A;  1OFC X;  2HR3 A;  1F9N A;  3H3U A;  2JA7 J;  4XLA A;  4CCN A;  4ZZL A;  2XKO A;  2XRL A;  2VOO A;  2CGP A;  4FET A;  2PEX A;  1S6L A;  2AS5 F;  5LGT A;  4E7K A;  1QNT A;  2HVS A;  4B1R A;  3CME I;  1FTZ A;  4HDU A;  1IG7 A;  4CYC B;  1NK3 P;  4C30 A;  1WJA A;  1R1V A;  2C6Y A;  4LB5 A;  1R58 A;  3DLL F;  1FZP B;  1K7A A;  1JGS A;  2B7E A;  3LAP A;  4C2M J;  2XRO A;  3JRI A;  3PQK A;  2VJI A;  3KYL A;  2D1V A;  4GYI A;  2F5C A;  1YS7 A;  3QOP A;  2RRE A;  1BOB A;  3IC7 A;  2J5P A;  4QTR A;  3LAJ A;  5AON A;  2KDZ A;  5IYC J;  1T0F A;  3F8N A;  5TJJ A;  2B63 J;  2HYG D;  1IN7 A;  2K85 A;  1HC8 A;  5H20 A;  2FU4 A;  3PO3 J;  4A2U A;  4DJA A;  1G2H A;  1BM9 A;  2DCE A;  2JSP A;  3PNT A;  4BHC A;  5E20 A;  3KIO A;  4Y4R A;  1N25 A;  3GFJ A;  2JSC A;  1Z9C A;  1QVU A;  4AWX B;  2BZT A;  4DOZ A;  1TQM A;  2R4G A;  3VYT B;  1FYK A;  1L0O C;  1ZGJ A;  3TW6 A;  1I5Z A;  3UR3 C;  3EUH A;  1XTA A;  3C18 A;  3I4M J;  4XL9 A;  3S17 J;  1XCB A;  1EKE A;  1IRZ A;  4BQO A;  2HOA A;  1R00 A;  1XMA A;  1ZTR A;  1FT9 A;  1IN4 A;  2CMP A;  3KYD B;  1FYL A;  2HGC A;  2QLZ A;  3KZY A;  1OR7 A;  4I0B A;  4A3K J;  1FC3 A;  1HXD A;  2VKD A;  3MD2 A;  2F6C A;  2JT1 A;  3U1K A;  4M9S A;  4OMY A;  3H35 A;  2STW A;  1UHS A;  1D1C A;  1LPQ A;  4HSR A;  3HOX J;  2O8K A;  3IH3 A;  4WXC A;  5J8F A;  5LGN A;  4XKB A;  1P4X A;  5DD8 A;  3PJR A;  2G9W A;  3H5R A;  4I2O A;  3K69 A;  4RDU A;  3VYS B;  4QWQ A;  2QM3 A;  2V26 A;  3BQZ A;  3PFY A;  1K83 J;  2H6C A;  5CVV A;  2DI3 A;  1KYZ A;  4JX4 A;  2P6T A;  3C3W A;  3IHU A;  2LKP A;  4CO8 A;  2Q0O A;  4E7I A;  2F4I A;  4XRS G;  3W3C A;  3BTC A;  1KU7 A;  3M3Y J;  4G9Y A;  1I27 A;  4GGG A;  4KA4 A;  1LDD A;  2HXO A;  3KP6 A;  5CQE A;  1D0Z A;  5B3S H;  4A3M J;  2RNG A;  3O8G A;  1PDN C;  4PCQ A;  1T33 A;  2K3F A;  3ZQL A;  3DEE A;  3M1C A;  2X51 A;  4BDY A;  2O7O A;  2QCO A;  3GW2 A;  3VSK A;  1X3W B;  1LNW A;  3S1R J;  4LG0 A;  2NVU B;  1RUO A;  1DPR A;  4P9U A;  3NEU A;  2EA2 A;  4RLF A;  1ZQ3 P;  2JTV A;  4AIH A;  2FML A;  2JRM A;  3RI4 A;  5K7F A;  3JCU C;  3FMQ A;  4ZTJ A;  3CF5 F;  3CUO A;  5B66 C;  2BHY A;  4WCG A;  3G4S I;  3OYH A;  2X6Y A;  3KPH A;  1SAX A;  1Z77 A;  4ENM A;  3F22 A;  5J4Y A;  2OPT A;  2P5V A;  2XPU A;  2RQP A;  1JTY A;  1X1A A;  4ZH4 F;  3A02 A;  2QZ8 A;  2A68 F;  2JVG A;  3LSK A;  1BOA A;  1H89 C;  1KQ0 A;  1PJR A;  4ESF A;  2BHZ A;  3JRB A;  3ZQG A;  3AG3 H;  1R7J A;  3WGG A;  4LG3 A;  2GQQ A;  3EQL F;  3ZQH A;  4ENK A;  3K4J A;  1X1P A;  2UXN A;  1F43 A;  2IGM A;  4IRI A;  4B09 A;  1RR8 C;  4BDZ A;  3CCL I;  3SYT A;  2OV7 A;  3TO7 A;  1VQO I;  1IDY A;  4ZYD A;  2EFW A;  3SFZ A;  3TQN A;  1H9T A;  3CDH A;  5D4S A;  1IN8 A;  3CO7 C;  4C2T A;  1TWA J;  4RB1 A;  3WTV C;  1EJ9 A;  3CZ6 A;  1BL0 A;  4U0W A;  1RZ4 A;  3SZT A;  2XV4 S;  1E2X A;  3WTT C;  1ONV A;  2PQ8 A;  4A0X A;  1KGS A;  4UNO A;  1SFX A;  1Y1V J;  4HDV A;  1QPM A;  3MWM A;  2ZNY A;  2YU9 J;  1KON A;  2M0C A;  1IF1 A;  3NAU A;  5L3D A;  1YIJ I;  3CCE I;  1KA8 A;  1R4N B;  3BDD A;  5JHF A;  4M3G A;  1ZR4 A;  3A2K A;  1R1U A;  2A6E F;  1MMN A;  1ITY A;  2DMN A;  1GDT A;  2JA6 J;  2EIL H;  4EJV A;  1VQ7 I;  1W5S A;  3W2W A;  2CO5 A;  4LD5 A;  2ZJ2 A;  1J75 A;  3SFI A;  5LHI A;  1Z21 A;  3HXL A;  6PAX A;  3E97 A;  2DYS H;  2KPM A;  2MBF A;  4EGZ A;  1WH7 A;  1DPU A;  3TP0 A;  2ZSH B;  4BH9 A;  1UZC A;  4I09 A;  3VWB A;  2QUF A;  2HQA A;  2M8E A;  1K6O A;  2F5V A;  4JBA A;  3BR3 A;  2E1C A;  3MVP A;  4E7L A;  2DQR A;  3GZ6 A;  4LIU A;  5BMZ A;  5IYD J;  5K5Q A;  3O3K A;  2Y2Z A;  2GIV A;  1OLT A;  2DK8 A;  3MKL A;  5AIQ A;  4ZDL A;  2K86 A;  1P4W A;  2IGN A;  3LQQ A;  1AKH B;  3PIO F;  3G1O A;  4NHJ A;  2R7W A;  1BR1 A;  2FA5 A;  3ELK A;  2CU7 A;  1YE9 A;  4E7J A;  4IO9 F;  1EF4 A;  4FX0 A;  1IXS B;  1ZLJ A;  3GEZ A;  1Q1H A;  1SAU A;  3CUQ B;  1RUN A;  2KRC A;  3DPU A;  2RAE A;  4BQN A;  4ANJ A;  2O0Y A;  5EZG A;  2NYX A;  5JHU A;  3GF2 A;  3L2V A;  2L9S A;  2LTP A;  4XSZ F;  2MA3 A;  1TW3 A;  4KYW A;  1U3E M;  5FKN A;  3T8R A;  3Q3S A;  3IUO A;  4JX5 A;  5C4J J;  1HLV A;  4JX6 A;  1JKP C;  2MLG A;  3ZMD A;  4BKX A;  5ILV A;  5DCM A;  1J5Y A;  4UUT A;  4R79 A;  2W48 A;  1J2X A;  2ZME A;  1FP2 A;  3CLQ A;  4ZYE A;  1GVD A;  1VI0 A;  4ENJ A;  2NS7 A;  3TL4 X;  5HLT A;  2KIM A;  3BLY A;  4NBQ A;  2XGX A;  2CW0 F;  3GYH X;  1OCZ H;  3GTQ J;  2TCT A;  3S8P A;  1X1C A;  3K2Z A;  3E5U A;  3HTU A;  4EGY A;  3ZP5 A;  2K4B A;  5E1Z B;  1QZZ A;  1SD7 A;  5GPC A;  1I50 J;  3D5R C;  4HF2 A;  5C4X J;  3E5Q A;  2VLA A;  3K4L A;  1F1Z A;  2STT A;  2GM4 A;  3CMM A;  5BNG A;  4IKF A;  2ZB9 A;  4UVA A;  4B3A A;  2QEX I;  4C2U A;  2P5K A;  4G6D A;  1FIP A;  3CF2 A;  4OOI A;  3VEP A;  2N8G A;  2IGK A;  2DYR H;  5GAH J;  1DP7 P;  2KIU A;  3BOQ A;  3QYE A;  2L7Z A;  4A3I J;  5TGT A;  3SHF A;  3D0S A;  4MFD A;  3L1P A;  1T6S A;  2O03 A;  1VQL I;  3HOZ J;  4DYQ A;  2YPR A;  2VBZ A;  5JI6 A;  4S04 A;  2XSJ C;  2R7R A;  3PO2 J;  3GTG J;  1XGO A;  2IA2 A;  3BG7 A;  3BR5 A;  4WF2 A;  2R7U A;  4E7S A;  3COA C;  2RKH A;  1T98 A;  1GUU A;  2W4S A;  3DLA A;  2W84 A;  2O9L A;  2K3P A;  3KP4 A;  3J81 Z;  5L3F A;  3G1M A;  4HLX A;  2F5D A;  1XG1 A;  2QKL B;  3HUG A;  4WK8 F;  3M9A A;  1O4X A;  3GO5 A;  2HI3 A;  2XB0 X;  3I53 A;  3T1B A;  2EZH A;  2ELK A;  1YW9 A;  3OL4 A;  4HEA 2;  3FZV A;  2VQL A;  1YIO A;  2Z9O A;  4A5M A;  4UUS B;  4HZF A;  4B47 A;  5IP9 J;  2R92 J;  3L09 A;  1UB9 A;  3HRM A;  3FXJ A;  2KQR A;  2WAE A;  4OMZ A;  4PSW A;  3LNQ A;  2QF7 A;  1BJA A;  3BRO A;  3T0Y A;  5IT3 A;  1JXS A;  2VQC A;  4UV9 A;  2X48 A;  4BY7 J;  2OJE D;  3IRR A;  3C2H A;  3BG9 A;  4ZZD A;  2EFP A;  1V55 H;  2KIF A;  4F91 B;  3EPZ A;  3VOE A;  1VQ8 I;  5D5V B;  4L9N A;  1JTX A;  1ETX A;  2VQG A;  4DQ2 A;  4RBO A;  1IXR C;  1GHC A;  2XAQ A;  3BY6 A;  4EQQ A;  1H88 C;  4G94 A;  3DWL E;  4DZP A;  2V1U A;  3WE3 A;  4HX8 A;  3MFK A;  5M5Y J;  1WCM J;  3FXM A;  2KRF A;  2O6G E;  3I64 A;  4IQ4 A;  5L3E A;  3QPS A;  1OIS A;  2COB A;  2DT7 B;  4N9I A;  3ZMS A;  4CCM A;  1VTN C;  3HTS B;  2BEO A;  3OOP A;  4OU0 A;  3MZY A;  2JN6 A;  4CDG A;  1WI3 A;  1XSV A;  4N4O B;  1Y8R B;  4EVI A;  5FFX A;  4MIM A;  3J7A O;  4AC0 A;  1LB2 A;  2HPM A;  4IVN A;  2GA2 A;  1FMV A;  5F27 A;  4D1Q A;  4BAY A;  2UWM A;  4NC6 A;  3GUD A;  2QQB A;  1XX5 A;  2FE3 A;  2J5O A;  4Q4Z F;  3I4P A;  1UST A;  1PUF B;  3E6C C;  1KZH A;  1IRG A;  5FO5 A;  4E7H A;  2XC7 A;  1T56 A;  1YS6 A;  1RET A;  2Y0S N;  4EM2 A;  4P9F A;  3NWT A;  5H6Q A;  3HSR A;  5EGO A;  2Z16 A;  1M1E B;  2I10 A;  3SQN A;  1EH8 A;  4KFC A;  5B1B H;  3REO A;  3G2B A;  4M9X A;  3I4N J;  1PP8 F;  1YJ9 I;  4FAS D;  3HSF A;  1YLF A;  1Z7L A;  2FBK A;  3IH4 A;  2IEK A;  4XM3 A;  2CRG A;  2XAU A;  3QP5 A;  4LIT A;  4ZYH A;  2DA2 A;  1XN7 A;  4GYG A;  4L5I A;  3SJM A;  1NK2 P;  4LG0 B;  2CQ7 A;  1MJB A;  4PSX A;  2HQN A;  2W85 A;  1V5G A;  3GME A;  4ZYG A;  3KET A;  1MBF A;  2D45 A;  1R4M B;  2H1L A;  2CFX A;  4FE7 A;  4OIO F;  3HOY J;  5D5X B;  2HTJ A;  3HKZ N;  3V8K A;  4BJT A;  4RAG A;  5J1Y A;  4AUX A;  1MNM C;  4G7H F;  5IT9 Z;  1X4P A;  2VKV A;  1LVA A;  2XGE A;  3E3V A;  5HS8 A;  3BR6 A;  2VJJ A;  3HGY A;  4AVZ A;  3I54 A;  3CLO A;  3DU5 A;  2FQ3 A;  2VAS A;  2AXL A;  5DS9 A;  2GBY A;  5CPR B;  2FSW A;  1LJ9 A;  4XOT A;  1VQ5 I;  4HRI A;  4RB3 C;  3CJN A;  1BIA A;  4C3J J;  3JSO A;  1IUY A;  1ZK8 A;  5KAI C;  4A93 J;  3VSL A;  3RCO A;  3ZN0 A;  4GFB A;  2XRN A;  2PJP A;  2HWV A;  2FOK A;  5J4V A;  3Q0U A;  1Z7U A;  4BHB A;  2VKE A;  4EJT A;  3LSH A;  2M5W A;  2CUZ A;  2R7Z J;  1MH3 A;  2IS1 A;  2IPQ X;  3OYE A;  1FP1 D;  1XMK A;  2ISY A;  2R3S A;  1RES A;  2ZXJ A;  3J80 Z;  4KIS A;  1HW5 A;  2LC2 A;  1U5T A;  2ESH A;  2LRE A;  4HF0 A;  1CGP A;  3AG4 H;  1MBE A;  3FMR A;  1ZKG A;  2VXZ A;  2Z5U A;  5E8G A;  1WWX A;  2CQN A;  3F8M A;  4C9Y A;  4XQF A;  3I0T A;  3I58 A;  3RQ4 A;  4BYY A;  2KKO A;  1QBJ A;  2R0Q C;  5HS9 A;  1MSF C;  3OYC A;  5H6R A;  4I98 B;  3GVA A;  2MLK A;  2XHK A;  2X9D A;  2NOJ B;  4V19 K;  1IN5 A;  3BR1 A;  1FNN A;  4UHT A;  2D5V A;  1D1B A;  2HU9 A;  1K4T A;  4F52 A;  1TLH B;  1A5J A;  4Z6Y A;  4N9H A;  2TDX A;  1DGW Y;  1O3T A;  3LA7 A;  4YEL A;  5ICF A;  2HQR A;  3HC7 A;  1HF0 A;  2V4J C;  3QOE A;  1HSJ A;  1JJ8 C;  2WY8 Q;  1W5C C;  2OQR A;  3DKX A;  5EYR A;  2IVM A;  1W7P D;  4DIQ A;  2R5Y A;  2K9M A;  1YRN A;  4M9Z A;  1EH7 A;  2QGU A;  3PM1 A;  3ZOB A;  5DUI A;  3SZG A;  2H6B A;  2EK5 A;  4YEJ A;  1BN5 A;  2HZD A;  2WV1 A;  1NHA A;  3K4K A;  3N97 A;  1SMT A;  3A1Y A;  4CHU A;  3HOV J;  4PZJ A;  2XPV A;  3WTZ A;  3KLN A;  1Y0U A;  4QPQ A;  2H27 A;  2IS6 A;  2LY1 A;  2DOF A;  3TP3 A;  3FK6 A;  3PIP F;  2XF7 A;  4Q47 A;  1Y39 A;  4V2F A;  2HEO A;  3AG2 H;  2KLO A;  4YIR X;  1FEX A;  1UCR A;  5ICE A;  4A3D J;  4XN0 A;  2DAO A;  1XGS A;  1ON2 A;  4D7N A;  3LSJ A;  5GTH C;  1HKQ A;  2K02 A;  2LFB A;  4W1U A;  1LE8 A;  5EG0 A;  2V1X A;  2XSD C;  2HS5 A;  3V42 A;  2JA8 J;  3UNG C;  1ON1 A;  2E34 A;  3HRT A;  3Q0W A;  2KZG A;  1ZRD A;  4ENN A;  5F0H A;  5DCM B;  3WG7 H;  3BG5 A;  3OWT A;  2D2W A;  4HPQ A;  2ZME B;  1F36 A;  4I99 C;  2F4M B;  4M3D A;  5CVU A;  1Y1W J;  4HV6 A;  1JKR C;  1ORK A;  3DEU A;  3ASN H;  4AYB N;  2ZJQ F;  3PQJ A;  2DOE A;  4RAF A;  1HST A;  3ABK H;  2NS0 A;  3K9T A;  5AIP A;  4XNF A;  3WU1 B;  1S8N A;  4UUS A;  3ASO H;  4B8X A;  3CCJ I;  2V9V A;  3ISP A;  3RKW A;  4YRV A;  3L2W A;  1FOK A;  3M07 A;  1YW8 A;  3BTI A;  3DBR B;  1FSE A;  4Y7N J;  2VBX A;  4EV0 A;  5B5E C;  3GFM A;  4XRF A;  4CA0 A;  3MN2 A;  3OYA A;  4HLY A;  1DGR M;  3M7G A;  3F8B A;  2Y9Z A;  3LFK A;  5EEH A;  3RPU D;  4BE0 A;  1OCR H;  5CVJ A;  3V7C A;  2ECC A;  1I39 A;  2PN6 A;  4I02 A;  2ZFW A;  4GRI A;  4MO7 A;  1XGN A;  2L9V A;  1B59 A;  1O57 A;  4AYB A;  1HQC A;  4QPO A;  1B8I A;  1JUP A;  3DF8 A;  1AOY A;  2E60 A;  3R0A A;  5H2F C;  4NQW A;  1RI7 A;  2VL8 A;  5LLQ A;  4I76 A;  2X0L A;  3M4O J;  1ENH A;  1O7F A;  2QVO A;  5JFR A;  3HUG B;  3IKT A;  4G6Q A;  1U8B A;  4BBS J;  1ZEL A;  3NAR A;  2F2E A;  1YJN I;  2EV0 A;  1XCV A;  2G0E A;  3WHC A;  4J00 A;  4XLH A;  1A35 A;  3AL0 B;  5IP6 A;  1OCT C;  1TP4 A;  2LP0 A;  4KIB A;  4H4K C;  2XIG A;  2EZI A;  5DM6 F;  4AM3 A;  1OQY A;  1IW7 F;  4KIG A;  3JR9 A;  1VQP I;  1S3J A;  2L9R A;  3SEQ A;  3F8C A;  2Y69 H;  2PMZ N;  2LVS A;  5D5U B;  3AFH A;  4BE1 A;  1DDN A;  4OIP F;  1J0R A;  2Y30 A;  3TDZ C;  3R0J A;  2ZXI A;  5CQG A;  2EIK H;  2LDU A;  4YII A;  1PUF A;  2KDO A;  5KVR A;  3D5L A;  2KHM A;  3A01 A;  4UB8 C;  1VQ4 I;  2DK5 A;  1K78 A;  2PMU A;  3CCS I;  3I9V 2;  3WU2 C;  1RIO H;  4P55 A;  5LHH A;  2HXI A;  3ESW B;  4S05 A;  2EIJ H;  4PGH A;  3BWG A;  1SD6 A;  1Y0N A;  4L9T A;  2ESN A;  3JRA A;  1XD7 A;  3W2A A;  1RRJ A;  3V7S A;  3BR2 A;  4OAY A;  3HRU A;  2PMZ A;  5DDG A;  1E3P A;  3TO9 A;  3IL2 A;  2BY3 A;  3K2A A;  5TIS C;  2DLL A;  3ABM H;  1VQ9 I;  5CLS A;  2RV8 A;  3EDP A;  4RM2 A;  4Y52 J;  1SVO A;  3IWZ A;  1FBQ A;  4RA2 A;  2JK3 A;  3P5J A;  4I0A A;  2L2O A;  5HNH A;  2X1D A;  3LMM A;  3F21 A;  2XF6 A;  3DKW A;  3A4C A;  5IPA A;  2NNY A;  4ON0 A;  5J40 A;  4A12 A;  1W0U A;  3F0C A;  1T2K A;  3CUQ C;  4ZYA A;  3CJR B;  1LUJ B;  3F6V A;  2VBW A;  1HBX G;  4AIJ A;  2V1D A;  5LRS A;  3HGG A;  1WGX A;  2K27 A;  3C2G A;  3FM5 A;  2LYC A;  2QSF X;  3RKY A;  4G6T B;  2E7X A;  1W36 C;  2IRF G;  1S29 A;  3CDI A;  1D5Y A;  4G7O F;  1BBY A;  5EGO B;  1LFB A;  4RLQ A;  1UG2 A;  1U9O A;  5IOY A;  2Z2S B;  3ML6 A;  2FJ1 A;  4IXA A;  1I3Q J;  4KN7 X;  3BCA A;  3E6M A;  1MJ9 A;  3JTH A;  4HA8 A;  3ZQC A;  3R4K A;  1BI1 A;  3NRV A;  1TQI A;  4XLF A;  1N78 A;  1TTY A;  2PBI A;  1GV5 A;  3OYG A;  3DBL B;  1ULY A;  3T8T A;  1TWF J;  1ETW A;  4F3Q A;  4CCJ A;  1W7P A;  2CWE A;  2IXS A;  2W82 A;  1LKX A;  3S14 J;  1TWH J;  3I3L A;  3FBN B;  2CV0 A;  5C44 J;  1OJL A;  1MMD A;  2E2I J;  4IZZ A;  1ETO A;  1BI2 A;  4KDP A;  3RSN A;  2IS4 A;  5EZH A;  3WU0 A;  4Q5S F;  1G3S A;  4AD9 A;  4L9J A;  4O5V A;  1GVJ A;  3QU3 A;  4IHT A;  2HFH A;  2HQ5 A;  4HX4 A;  2CQX A;  1BJZ A;  2CUE A;  2L54 A;  4HAM A;  4U7B A;  5FRO A;  1D5V A;  1MIJ A;  1RNL A;  3S3N A;  1DQU A;  4L9V A;  3BJO A;  5F04 A;  4P96 A;  4R8H A;  4CZC A;  1FBS A;  1BR2 A;  5HLG A;  4O6J A;  4JQF A;  3QWL A;  3IP4 B;  3K1M A;  3CC4 I;  5JLW A;  3K1N A;  2OUM A;  4FHT A;  3LL7 A;  3K1P A;  2R7F A;  4U0Y A;  4D0P A;  1UMQ A;  1ZAO A;  3RPQ A;  4J19 A;  1KYW A;  2M8G X;  3A0H C;  3Q9S A;  3L7W A;  3C7J A;  2MSY A;  1U5T B;  1P6R A;  2GXA A;  3IH2 A;  3QP6 A;  5CYV A;  5BOX A;  2FX0 A;  5E17 F;  4NC7 A;  1Y8Q B;  3FXO A;  5D5W B;  3GTJ J;  1T0F C;  3F8F A;  4C3I J;  4XLN F;  2BOL A;  4HQE A;  4LLL A;  2MC4 A;  2CS3 A;  2LRD A;  3OS2 A;  4A5N A;  2QQ8 A;  3KFW X;  1R23 A;  5LHG A;  1N77 A;  2X6O A;  2IP2 A;  2VKH A;  5J3L A;  4LMY A;  3AG1 H;  2BY0 A;  1AWC A;  1LFP A;  4HG2 A;  4FX4 A;  5JVT A;  2OTL I;  3KEY A;  1JHH A;  2KZV A;  3AAF A;  1STZ A;  4FIS A;  3E7L A;  1JJ6 C;  5B1A H;  2ME6 A;  1MD0 A;  3BPX A;  4CH7 A;  4Y13 A;  3FIW A;  4BJ5 C;  2JQ7 A;  1EV7 A;  3Q5F A;  4XOR A;  3ECH A;  4HNV A;  3DFG A;  2ZJP F;  1YX3 A;  1BI3 A;  3OR2 C;  2QYO A;  4BU2 A;  2E1M B;  2WWY A;  3GTM J;  3EUH C;  3R60 A;  2MAB A;  2EFO A;  3A03 A;  2ID3 A;  4XR6 A;  3HOU J;  4CCL A;  5IOZ A;  1MBK A;  5LEK A;  4A69 C;  2M4K A;  2HKX A;  1O3Q A;  2R5Y B;  4XON A;  1YRN B;  1G8X A;  3N4M A;  2EV6 A;  3FXQ A;  5FKL A;  2DA7 A;  5K1Y A;  1OR7 C;  3E6B A;  3WGI A;  1ETQ A;  1R36 A;  4M73 A;  2X1E A;  3H1C A;  2VT3 A;  3HG9 A;  2ZBK A;  2RVC A;  3BCB A;  1X58 A;  2X6W A;  3CES A;  4PJM A;  3CTA A;  2MG4 A;  4DBR A;  3K7A J;  1IN6 A;  3CCV I;  4II3 A;  3S3O A;  3ZQI A;  1U9N A;  3EUK L;  3KP5 A;  5EEG A;  1USS A;  3I71 A;  1X3Z B;  1ZYR F;  3MEX A;  2YU3 A;  2M45 A;  2JPC A;  2RN7 A;  2V6C A;  2QEN A;  4KMF A;  2O5R A;  1P9Q C;  5EJC A;  1OYI A;  1Z67 A;  2M34 A;  3LST A;  3HPH A;  4UY8 I;  1KU9 A;  5GTI C;  2Y75 A;  1V4R A;  1LE8 B;  4PJL A;  4F93 B;  2V1N A;  5EG0 B;  3SZP A;  2JJ7 A;  1AU7 A;  3H5A A;  3OYF A;  1OYW A;  3VPR A;  4C3H J;  4IF4 A;  2M30 A;  4AID A;  3OIQ A;  5FRN A;  1QHG A;  4LB6 B;  1KU3 A;  2PX9 A;  2Y9Y A;  4XLP F;  2X85 A;  1W36 D;  2XB5 A;  2V9P A;  2JPB A;  2B0L A;  3KE2 A;  3CJT B;  2L3D A;  4B44 A;  3B73 A;  2WBM A;  3I59 A;  4E4H A;  1MND A;  1NG7 A;  3BTL A;  2QQA A;  1FPQ A;  1TWG J;  4KIC A;  4B4C A;  5F6F A;  3HOW J;  1WJ5 A;  3RZO J;  3CCQ I;  1WKM A;  3CMA I;  4K2E A;  3OS0 A;  2M87 A;  2DFE A;  3OYN A;  5CJ9 A;  1OCO H;  3J81 K;  3CC2 I;  3DP7 A;  1R71 A;  1BIB A;  4Q48 A;  3JAM Z;  3IKV A;  2PLY A;  2VXD A;  2R7O A;  4W97 A;  1T39 A;  1UG0 A;  3FK7 A;  4BUP A;  4P5O A;  1PYV A;  4IPA A;  5J6X A;  3NQO A;  5HDG A;  3JRF A;  3TGN A;  2ELJ A;  4D5C A;  1D8J A;  3KZZ A;  1B8I B;  2DMU A;  3CDL A;  1G6N A;  4NQW B;  1Z3Y A;  2DFH A;  2H8R A;  1UHM A;  1J09 A;  3CCU I;  2DBB A;  1FX7 A;  1R5G A;  4XRM A;  4M3B A;  2VC0 A;  1T08 B;  4KT6 A;  3OSF A;  4IRH A;  1JT6 A;  4MFE A;  4YFN F;  1YG2 A;  2BW3 A;  2KT0 A;  3DEW A;  4PJ0 C;  1V54 H;  4UB6 C;  1CF7 B;  2EH3 A;  3FKJ A;  1MH4 A;  4Z2Y A;  3DTI A;  1X2N A;  4BE2 A;  2BVM A;  4DYR A;  3R6S A;  1U2W A;  1WJD A;  5HDK A;  5F0F A;  3GTK J;  2DO7 A;  4IRG A;  3RYP A;  4B48 A;  4ESB A;  5A2Q Z;  3OY9 A;  3GXO A;  9ANT A;  1IRX A;  5GP9 A;  2XGC A;  3J7A Y;  2M3A A;  3LA3 A;  4J01 A;  1OMI A;  2Z99 A;  1X3U A;  3HM5 A;  2DMT A;  1ZN2 A;  5HOD A;  1S7O A;  3OYK A;  2DOD A;  3GFI A;  3S2W A;  4DNC A;  1WQ2 A;  2HOS A;  3A01 B;  3SDB A;  3KLO A;  3S1N J;  3FKI J;  1K78 B;  2OZ6 A;  2DDB A;  1S5L C;  3HBL A;  2DT5 A;  2AQF A;  1FJL A;  1VF9 A;  2L5Q A;  3I56 I;  1YJW I;  1VQM I;  3RTR A;  3S3M A;  2OD5 A;  2VJ5 A;  4Y17 A;  1R22 A;  1WH5 A;  2LY9 A;  4ESJ A;  3F9K A;  1FOY A;  1J9I A;  2VPR A;  3L2U A;  2CH0 A;  1B6A A;  3G1L A;  4IHX A;  4PJJ A;  2WB1 N;  3V8J A;  1WHU A;  1PP7 U;  1UHW A;  3DTK A;  2Q2E A;  2EWN A;  4V2G A;  5F0C A;  2I5U A;  5BQT A;  1LEB A;  4LJZ F;  5FJ8 J;  2CG4 A;  3G71 I;  4A6E A;  5F1R A;  1TZL A;  3QPH A;  2WAQ N;  3DXJ F;  2E35 A;  1IZ1 A;  3JRH A;  4PK4 A;  2IAI A;  4U7D A;  1QRY A;  2EPF A;  1GV2 A;  1MBH A;  3CCM I;  5FLM J;  3K10 A;  1E3H A;  3GLX A;  1VQ6 I;  1PVE A;  1RKW A;  1TNT A;  1TT0 A;  1OCC H;  2BE5 F;  2L01 A;  4XLE A;  1A31 A;  2LF7 A;  3ERM A;  2E19 A;  5FLX Z;  4FQG A;  3CCY A;  1BA5 A;  2ADU A;  4B43 A;  3DTE A;  2O61 A;  2WA0 A;  2BBY A;  1IDZ A;  2JA5 J;  5EF6 A;  1YI2 I;  1ACI A;  3FHZ A;  2LKX A;  5D4R A;  3M8E A;  2G7U A;  4M74 A;  4RGU A;  3V8L A;  2WB1 A;  3K6G A;  3M8J A;  4HF1 A;  1CQT A;  4UV8 A;  1E17 A;  3NWS A;  5IT9 K;  4ZC3 A;  1TC3 C;  4KN4 X;  2DPU A;  2FMY A;  4RGR A;  1QPI A;  1GLN A;  2WAQ A;  1W4M A;  3TKY A;  1B9M A;  2V9K A;  2LK2 A;  3GZ5 A;  4LLG F;  1OYY A;  2NVX J;  3GFL A;  1JHF A;  3TED A;  1Q1V A;  2CQK A;  4JK1 X;  1TT5 B;  1W7P B;  3N05 A;  4BL0 B;  2A05 A;  2K9S A;  4GDF A;  4IHV A;  1QVT A;  2VC1 A;  2XGD A;  3W6V A;  3GX4 X;  1HA8 A;  2XF5 A;  3FDY A;  3TO6 A;  1SC7 A;  2FNA A;  2OZU A;  2WC2 A;  2LY2 A;  3D1N I;  1S72 I;  2LD5 A;  3E6D A;  2R7S A;  4A3F J;  2EQR A;  4LGW A;  4NDL A;  4AVP A;  1SEU A;  2COM A;  4CUG A;  1A04 A;  2LLK A;  5GPA A;  5L3G A;  1B72 A;  2MD5 A;  1WPK A;  3J80 K;  3RYR A;  2BYV E;  1MBJ A;  1MW7 A;  1XS9 A;  3OYI A;  1DU0 A;  3S93 A;  1YQA A;  4M3E A;  3QPT A;  1Y6I A;  4M72 A;  2PJR B;  2GOX B;  1QZE A;  1Z6T A;  1V5F A;  2FUG 2;  1S7A A;  4A3G J;  4MLO A;  1HCR A;  2MH2 A;  3DKY A;  3ECO A;  3PSF A;  4HQM A;  3S1M J;  3GCM A;  5CVI A;  4ZTF A;  2V79 A;  4UVB A;  1QQI A;  2CYY A;  3BJ6 A;  4RGS A;  2K40 A;  3AL0 C;  1WI9 A;  5E3O A;  4ZDO A;  5DYM A;  1FWZ A;  3CJQ B;  4D7M A;  2Y0M A;  2E1N A;  2E71 A;  3LWF A;  3PFI A;  2P8T A;  5IY5 H;  5LD2 C;  2LR8 A;  2DA5 A;  4XOP A;  3VOD A;  2V6E A;  5E79 C;  3R61 A;  1FIA A;  3OMY A;  4M6X A;  1ZR2 A;  2CV1 A;  2MH9 A;  3HDD A;  3OIO A;  2IS2 A;  2L9N A;  5HLI A;  4LK0 F;  1XPX A;  3TW7 A;  3D5S C;  3WHB A;  4X0G A;  3K70 C;  4II2 A;  1MNE A;  1ETV A;  1MDM A;  2K4J A;  1K79 A;  3FMS A;  2AHQ A;  3K4M A;  4CCK A;  2KIS A;  3J7Y J;  3KP3 A;  4BQQ A;  3K0L A;  4EM0 B;  3GBG A;  4BJ6 C;  5JVG F;  2IA0 A;  1ZLK A;  2EV5 A;  1Z1D A;  2A6T A;  3JRD A;  2DJI A;  3VFZ A;  1X1B A;  1D0X A;  2WAF A;  1SD5 A;  3FWE A;  2FNP A;  2OAZ A;  4YG2 F;  3BZ6 A;  2NAZ A;  2Q1Z B;  2NXN B;  2UXX A;  4I7H A;  4IHW A;  5KCM A;  3DQV C;  1ZRC A;  4EJO A;  2Y48 A;  4BXU A;  2A61 A;  4FE4 A;  4DBQ A;  4PJN A;  4OIN F;  4CYD A;  2CJJ A;  1NH3 A;  1OPC A;  1WJB A;  3OSG A;  4IOA F;  1TW2 A;  4IQJ A;  2P6S A;  2Z1D A;  1YO5 C;  1D0Y A;  2GIZ A;  1K4S A;  4Y3O A;  3FBI B;  5JR3 A;  3KEQ A;  3W6K B;  2GWR A;  3JTG A;  2UZK A;  5E1X A;  1IO2 A;  1G3W A;  2LKS A;  4WWC A;  2VN2 A;  3BTJ A;  4HNT A;  3G73 A;  2DA6 A;  3P9I A;  3HOS A;  4MTE A;  5IP7 J;  3BJA A;  3TOB A;  2L7K A;  4ITV A;  4JP0 A;  2DFI A;  4RAY A;  1LFU P;  5E3N A;  2NVQ J;  1XC5 A;  4NNJ A;  4OIQ F;  2JUC A;  5KNL A;  2M2E A;  3H36 A;  3G6E I;  1SAN A;  1QHH D;  2F5E A;  4PUS A;  2XAG A;  2R93 J;  2BY1 A;  3SEZ A;  4G12 A;  2HZT A;  4RS8 A;  1IV6 A;  2DMQ A;  3S1Q J;  1P4A A;  2A07 F;  3PNV A;  2OC6 A;  2R5Z B;  3K4N A;  2F5F A;  5GAG J;  3OL3 A;  2DA4 A;  3HYI A;  3RIR A;  5IYB J;  2LOO A;  2XDV A;  3L00 A;  4XMY A;  4CCO A;  4X6A J;  1J7K A;  4XID A;  3ZPL A;  3BZC A;  4HYE A;  3VYR B;  2W24 A;  2L7M P;  1IUF A;  3TMO A;  1Z05 A;  4NC8 A;  4OIR F;  1CF7 A;  3HB9 A;  2R7X A;  1KQ9 A;  3VYU B;  2EFQ A;  2KIQ A;  4MQ9 F;  3O8H A;  4RAZ A;  3I59 B;  2UUZ A;  4ZDP A;  1X2M A;  3MMY B;  1X1D A;  4PFP A;  4UUV A;  2YX4 A;  4ZJZ A;  1T95 A;  3PNY A;  2GLO A;  2GXB A;  3JRE A;  4I01 A;  2FRH A;  5ED4 A;  4KT5 C;  2EIM H;  3QYF A;  3KP2 A;  2ELH A;  5F08 A;  3HJE A;  2OCC H;  3LFU A;  2W7N A;  2VPL A;  2HTS A;  2WTE A;  1JE8 A;  4FT8 A;  1HOM A;  2DDA A;  2JVH A;  3PSI A;  2JRT A;  3S15 J;  2CQQ A;  4E7Z A;  4BY1 J;  3JSP A;  2ISZ A;  2M0M A;  1WJF A;  2IJL A;  5DD4 A;  3RQI A;  3MAJ A;  3GZN B;  4XKV A;  4BHP A;  3S32 A;  3KP7 A;  1SFE A;  2CSO A;  4X1E A;  3HIF A;  2L4A A;  3X2Q H;  3ZMZ A;  2QA4 I;  1D1A A;  1MGT A;  4A3C J;  1GT0 C;  2ID6 A;  5M3M J;  1U5T C;  3OR1 C;  4MEX F;  1KU2 A;  3FXR A;  3MQ0 A;  5DTD A;  4G8X A;  1TQP A;  1H9G A;  2BW3 B;  5FGM A;  4F92 B;  2NVT J;  1IV8 A;  1ETK A;  4JOM A;  5F64 A;  2CW7 A;  1C0W A;  2ZSI B;  3M1E A;  4A0Z A;  2VE8 A;  3FIS A;  1VQK I;  2RGV A;  2HYJ A;  2BV6 A;  3SDG A;  3H9Q A;  5HNF A;  3GTP J;  1LDK B;  5BS6 A;  2QSH X;  3ZR8 X;  5ICC A;  1AA7 A;  1XSD A;  1Z6R A;  2L02 A;  1ZG5 A;  2HDD A;  3F3X A;  5ERI A;  4M6V A;  3U21 A;  5D6F A;  1FLI A;  2H1K A;  4IOC F;  2HPI A;  2CW8 A;  3TOA A;  3JRG A;  4MGR A;  3IV5 A;  3E1S A;  2L0K A;  1XSX A;  2MC3 A;  4YIF A;  2GAU A;  4KUM A;  3J7Z I;  3ZXS A;  2E2J J;  2F4O B;  1EH6 A;  4RB0 A;  2E1M C;  2A6H F;  3F6O A;  3H0G J;  2HOT A;  1O7L A;  4QLC U;  2VE9 A;  2KRH A;  5DV5 A;  4DW6 A;  2IT0 A;  3FXK A;  1IRF A;  3BQY A;  3HZJ A;  2DOA A;  4IEJ A;  1VFC A;  5CVR A;  3DBH B;  3K70 D;  1WRJ A;  5E3L A;  1DU6 A;  1P92 A;  2LMD A;  3L2Q A;  1WFX A;  1ZG3 A;  4L0Y B;  3HEF A;  2LBF B;  3VB2 A;  2QBY A;  3H9G A;  2EA4 A;  3WTY C;  3SXY A;  2QQ9 A;  3RDI A;  1QA6 A;  1A6Q A;  3RJP A;  4ABZ A;  2NRA C;  2Q2E B;  1B9N A;  1JUM A;  3PL8 A;  1R49 A;  2MYS A;  3IWF A;  2GZW A;  4Y33 A;  2ZXW H;  2L4M A;  2AXT C;  2YR2 A;  5ILS A;  2ACJ A;  2NVY J;  1I6X A;  3WTU C;  1YHQ I;  2MGQ A;  3OYL A;  2KP6 A;  2NNN A;  4M6Y A;  2PFB A;  5DM7 F;  2E5Z A;  1LVK A;  4A3J J;  2E2H J;  1TBX A;  4U0V A;  4LOC A;  1V3F A;  1HW2 A;  3S16 J;  5K5O A;  1MMA A;  1OCP A;  2LNB A;  4BEH A;  3KYC B;  3P9K A;  3ZN1 A;  5LBQ A;  2XKP A;  2LF8 A;  2PJR A;  2XPW A;  2YX7 A;  4A3B J;  4EMS A;  5GAE J;  3MCZ A;  1XGM A;  2KMU A; 
#chains in the Genus database with same CATH homology
 2A69 F;  2DU9 A;  5BPI A;  1B1B A;  4YFX F;  3ZMV A;  4O3M A;  4KNY A;  4WX9 A;  5HVQ C;  1SFU A;  1BC7 C;  2X4H A;  2PMH A;  3HRS A;  4ETS A;  1WSU A;  2RDP A;  2ZO4 A;  2XAJ A;  3V4G A;  1D8K A;  2DQL A;  4EJU A;  2XAS A;  4CXF A;  2FEZ A;  1MZB A;  5DUK A;  3ABT A;  3CO6 C;  1ZHF A;  1XDU A;  5ILU A;  3FM3 A;  2E7W A;  5LEJ A;  3KCC A;  3QU6 A;  3RKX A;  1YW7 A;  2R7D A;  4MEY F;  2RC4 A;  3RPU A;  5E8I A;  5FFZ A;  4PDK A;  2KJC A;  4N0B A;  1MKM A;  3LA2 A;  1ZRF A;  1BI0 A;  2VON A;  1FY7 A;  5LGU A;  4IHS A;  3WE2 A;  2OA4 A;  3ZMU A;  1T38 A;  4L5J A;  2FXA A;  3ERE D;  1W5T A;  2O8X A;  1PUE E;  4MNU A;  2FBI A;  3FXU A;  2W25 A;  3F72 A;  1OKR A;  5DCF A;  1REP C;  4CGZ A;  4HW0 A;  2KJB A;  1HKS A;  1MDM B;  1FBU A;  3HHH A;  1U8R A;  2IW5 A;  3EET A;  1B4A A;  1I1G A;  2DPD A;  2W57 A;  1QGP A;  3ZMT A;  5HS7 A;  2EJR A;  3Q9V A;  4YFK F;  5FD6 A;  3WTS C;  2A5Y B;  4L0Z B;  5HOO A;  4R1H A;  4RB2 C;  5HDN A;  3ABU A;  1U6G A;  4BQA A;  4MQV A;  5D8L B;  1G4D A;  5KK1 A;  4CIC A;  1YYV A;  2EFN A;  4GXO A;  2ZCW A;  1QO0 D;  1D3Y A;  4AIK A;  2HOE A;  4MTD A;  2P4W A;  3DPL C;  4LFU A;  3DV8 A;  2ZNZ A;  1YTY A;  1GXQ A;  2GA1 A;  3DPT A;  4HV5 A;  1L3L A;  1R5H A;  4M71 A;  2YSR A;  3U9G A;  3G3Z A;  3V7R A;  3JAM K;  4WXH A;  5D6E A;  5TRD A;  3U2R A;  1GXP A;  4TV7 A;  1HW1 A;  2WV0 A;  3L9F A;  5D8K B;  2DW4 A;  1BC8 C;  2P5L C;  3HSE A;  4H0E A;  1UFM A;  1U78 A;  4LLN A;  4L18 B;  1SMY F;  2P7V B;  2A3S A;  4RGX A;  3BPV A;  2IA1 A;  4HBL A;  1F4K A;  1KQ8 A;  3HOT A;  5K5R A;  4BNC A;  5A2Q K;  3W6J B;  4WXD A;  2XVC A;  3WTW C;  2M1B A;  1XB4 A;  5LRR A;  3C1D A;  2G7H A;  1G3T A;  3ROU A;  3FF5 A;  4GCV A;  2OBP A;  2FBH A;  4KIF A;  3WGH A;  4PGG A;  2XUB A;  4NB5 A;  1ZAR A;  2PG4 A;  5E1W A;  5J8C A;  1DUX C;  4G7Z F;  1FYM A;  2QWW A;  1R1T A;  3BP8 A;  1F5T A;  1ODD A;  3JW4 A;  3FX3 A;  4IJA A;  1Z91 A;  1FSH A;  1O3S A;  3IRQ A;  3MZH A;  1MJA A;  1LDJ A;  4EJW A;  2EB7 A;  3TDU C;  2BGC A;  1YFH A;  2GXG A;  3E5X A;  3QAH A;  2Z3Y A;  5L3C A;  3HHG A;  5L3B A;  2Q8K A;  2QBY B;  5FLX K;  5E18 F;  2Z33 A;  1ZGA A;  4KMU X;  4A0Y A;  3M8F A;  4UXN A;  1I1S A;  4LK1 F;  2ETH A;  3H92 A;  3U1D A;  5ICG A;  2P7C B;  3KEO A;  1LEA A;  1O3R A;  4U88 A;  2XAF A;  5BPD A;  1ZRE A;  3F23 A;  3ULQ B;  4ASN A;  3WOD F;  4EM1 A;  4Y15 A;  2H09 A;  3O2P E;  3P7N A;  4A6D A;  1XDS A;  4HOB A;  3ZQ7 A;  1QZY A;  1IXC A;  2D1H A;  3WTX C;  2H94 A;  3B02 A;  3CUQ A;  4CZZ A;  1SD4 A;  1P2F A;  1HKT A;  2DTR A;  2O3F A;  1H0M A;  2K7L A;  5FB2 A;  2HDC A;  3OV8 A;  2PI0 A;  1TNS A;  1G3Y A;  2LSO A;  2HKO A;  1ZH5 A;  2RNJ A;  4E70 A;  4F7Z A;  2VT2 A;  3P9C A;  1J59 A;  2FF4 A;  1ZG1 A;  2OU2 A;  2VBY A;  3O6B B;  3L2C A;  2ZKZ A;  3T5X A;  4HX7 A;  5HLH A;  3LQR A;  4XSX F;  4XBF A;  2OQG A;  3I5U A;  3EYI A;  3H3Z A;  3EYY A;  2VOP A;  2XAH A;  2HYF A;  4MHG A;  2JZY A;  1LQ1 A;  3QRF F;  5FD5 A;  1IAW A;  4UVC A;  5DEQ A;  4GO1 A;  2VOD A;  3WG9 A;  3GWZ A;  2HR3 A;  1F9N A;  3H3U A;  4ZZL A;  2XKO A;  2VOO A;  2CGP A;  2PEX A;  1S6L A;  2AS5 F;  5LGT A;  1QNT A;  4HDU A;  1R1V A;  2C6Y A;  4LB5 A;  1R58 A;  1FZP B;  1K7A A;  1JGS A;  3LAP A;  2XRO A;  3PQK A;  2D1V A;  4GYI A;  2F5C A;  1YS7 A;  3QOP A;  3IC7 A;  2J5P A;  3LAJ A;  5AON A;  1T0F A;  3F8N A;  5TJJ A;  2HYG D;  1IN7 A;  5H20 A;  2FU4 A;  4A2U A;  1BM9 A;  4BHC A;  5E20 A;  3GFJ A;  2JSC A;  1Z9C A;  4AWX B;  1TQM A;  1FYK A;  1L0O C;  1ZGJ A;  1I5Z A;  3EUH A;  3C18 A;  1XCB A;  1R00 A;  1XMA A;  1FT9 A;  1IN4 A;  1FYL A;  2HGC A;  2QLZ A;  3KZY A;  1OR7 A;  4I0B A;  1FC3 A;  1HXD A;  2JT1 A;  4M9S A;  4OMY A;  2STW A;  4WXC A;  5J8F A;  5LGN A;  1P4X A;  5DD8 A;  2G9W A;  4I2O A;  3K69 A;  4QWQ A;  2QM3 A;  2H6C A;  5CVV A;  2DI3 A;  1KYZ A;  2P6T A;  3C3W A;  3IHU A;  2LKP A;  4CO8 A;  2Q0O A;  1KU7 A;  4G9Y A;  1I27 A;  4GGG A;  4KA4 A;  1LDD A;  3KP6 A;  1PDN C;  4PCQ A;  3GW2 A;  1LNW A;  4LG0 A;  1RUO A;  1DPR A;  4P9U A;  3NEU A;  2EA2 A;  2JTV A;  4AIH A;  2FML A;  3RI4 A;  3FMQ A;  3CUO A;  4WCG A;  1SAX A;  4ENM A;  3F22 A;  2P5V A;  2RQP A;  4ZH4 F;  2QZ8 A;  2A68 F;  1BOA A;  1KQ0 A;  4ESF A;  1R7J A;  3WGG A;  2GQQ A;  3EQL F;  4ENK A;  2UXN A;  4IRI A;  4B09 A;  3TO7 A;  4ZYD A;  2EFW A;  3SFZ A;  3TQN A;  1H9T A;  3CDH A;  5D4S A;  1IN8 A;  3CO7 C;  4RB1 A;  3WTV C;  4U0W A;  1RZ4 A;  3SZT A;  2XV4 S;  1E2X A;  3WTT C;  1ONV A;  2PQ8 A;  4A0X A;  1KGS A;  4UNO A;  1SFX A;  4HDV A;  1QPM A;  3MWM A;  2ZNY A;  1IF1 A;  5L3D A;  1KA8 A;  3BDD A;  1R1U A;  2A6E F;  4EJV A;  1W5S A;  2CO5 A;  4LD5 A;  2ZJ2 A;  1J75 A;  5LHI A;  6PAX A;  3E97 A;  2MBF A;  4EGZ A;  1DPU A;  4BH9 A;  4I09 A;  2QUF A;  1K6O A;  2M8E A;  4JBA A;  2E1C A;  2DQR A;  3GZ6 A;  5BMZ A;  5K5Q A;  3O3K A;  2GIV A;  2DK8 A;  5AIQ A;  2K86 A;  1P4W A;  3LQQ A;  4NHJ A;  2FA5 A;  3ELK A;  4FX0 A;  1IXS B;  1ZLJ A;  3GEZ A;  1Q1H A;  3CUQ B;  1RUN A;  2O0Y A;  2NYX A;  5JHU A;  3GF2 A;  4XSZ F;  2MA3 A;  1TW3 A;  4KYW A;  1U3E M;  3T8R A;  2MLG A;  3ZMD A;  5ILV A;  5DCM A;  1J5Y A;  4R79 A;  2ZME A;  1J2X A;  4ZYE A;  1FP2 A;  4ENJ A;  2KIM A;  2XGX A;  2CW0 F;  3GYH X;  3K2Z A;  3E5U A;  3HTU A;  4EGY A;  3ZP5 A;  2K4B A;  5E1Z B;  1QZZ A;  1SD7 A;  4HF2 A;  3E5Q A;  2STT A;  1F1Z A;  4UVA A;  2P5K A;  4G6D A;  4OOI A;  3VEP A;  1DP7 P;  2KIU A;  3BOQ A;  3SHF A;  3D0S A;  1T6S A;  2O03 A;  2YPR A;  2VBZ A;  5JI6 A;  4S04 A;  1XGO A;  2IA2 A;  4WF2 A;  3COA C;  2RKH A;  1T98 A;  2W84 A;  3KP4 A;  3J81 Z;  5L3F A;  4HLX A;  2F5D A;  3HUG A;  4WK8 F;  3M9A A;  3GO5 A;  3I53 A;  3T1B A;  1YW9 A;  3FZV A;  1YIO A;  2Z9O A;  4A5M A;  4HZF A;  3L09 A;  1UB9 A;  3HRM A;  4OMZ A;  3BRO A;  1BJA A;  3T0Y A;  1JXS A;  5IT3 A;  4UV9 A;  3IRR A;  4ZZD A;  2EFP A;  2KIF A;  3VOE A;  5D5V B;  4L9N A;  4DQ2 A;  1IXR C;  1GHC A;  2XAQ A;  3BY6 A;  4EQQ A;  4G94 A;  2V1U A;  3WE3 A;  4HX8 A;  3MFK A;  2KRF A;  2O6G E;  3I64 A;  5L3E A;  3ZMS A;  4N9I A;  1VTN C;  3HTS B;  2BEO A;  3OOP A;  4OU0 A;  3MZY A;  4CDG A;  1XSV A;  4EVI A;  5FFX A;  3J7A O;  1LB2 A;  4IVN A;  2GA2 A;  4BAY A;  2UWM A;  3GUD A;  2QQB A;  2FE3 A;  2J5O A;  4Q4Z F;  3I4P A;  1UST A;  3E6C C;  1IRG A;  5FO5 A;  1YS6 A;  4EM2 A;  4P9F A;  5H6Q A;  3HSR A;  3SQN A;  1EH8 A;  4KFC A;  3REO A;  4M9X A;  1PP8 F;  3HSF A;  1YLF A;  2FBK A;  4ZYH A;  3QP5 A;  1XN7 A;  4GYG A;  4L5I A;  4LG0 B;  1MJB A;  2HQN A;  2W85 A;  4ZYG A;  3KET A;  2D45 A;  2CFX A;  4OIO F;  5D5X B;  2HTJ A;  3V8K A;  4G7H F;  5IT9 Z;  1LVA A;  3E3V A;  5HS8 A;  3I54 A;  3CLO A;  2FQ3 A;  2AXL A;  2FSW A;  1LJ9 A;  4RB3 C;  3CJN A;  1BIA A;  3JSO A;  1IUY A;  3ZN0 A;  2XRN A;  2PJP A;  2HWV A;  2FOK A;  1Z7U A;  4BHB A;  4EJT A;  2M5W A;  2IPQ X;  1FP1 D;  1XMK A;  2ISY A;  2R3S A;  2ZXJ A;  3J80 Z;  1HW5 A;  1U5T A;  2ESH A;  4HF0 A;  1CGP A;  3FMR A;  2Z5U A;  2VXZ A;  5E8G A;  1WWX A;  3F8M A;  3I0T A;  3I58 A;  4BYY A;  2KKO A;  1QBJ A;  5HS9 A;  5H6R A;  4I98 B;  3GVA A;  2MLK A;  2XHK A;  1IN5 A;  1FNN A;  4UHT A;  1TLH B;  4N9H A;  2TDX A;  1O3T A;  3LA7 A;  5ICF A;  2HQR A;  1HSJ A;  2OQR A;  2IVM A;  1W7P D;  4M9Z A;  1EH7 A;  5DUI A;  2H6B A;  2EK5 A;  1BN5 A;  1NHA A;  3N97 A;  1SMT A;  4CHU A;  4PZJ A;  3WTZ A;  3KLN A;  1Y0U A;  2H27 A;  4Q47 A;  2HEO A;  1UCR A;  5ICE A;  2DAO A;  1XGS A;  1ON2 A;  1HKQ A;  2K02 A;  2V1X A;  2HS5 A;  1ON1 A;  3HRT A;  1ZRD A;  4ENN A;  5DCM B;  2D2W A;  2ZME B;  5CVU A;  4HV6 A;  3DEU A;  3PQJ A;  1HST A;  2NS0 A;  3K9T A;  5AIP A;  3WU1 B;  1S8N A;  4B8X A;  2V9V A;  3ISP A;  3RKW A;  1FOK A;  1YW8 A;  1FSE A;  2VBX A;  4EV0 A;  3GFM A;  4XRF A;  4HLY A;  3M7G A;  3F8B A;  3LFK A;  5EEH A;  5CVJ A;  3V7C A;  2PN6 A;  4I02 A;  2ZFW A;  1XGN A;  1B59 A;  1O57 A;  1HQC A;  3DF8 A;  1AOY A;  3R0A A;  4NQW A;  1RI7 A;  5LLQ A;  2X0L A;  1O7F A;  2QVO A;  5JFR A;  3IKT A;  4G6Q A;  2F2E A;  2EV0 A;  1XCV A;  4KIB A;  2XIG A;  1IW7 F;  4KIG A;  1S3J A;  3F8C A;  5D5U B;  4OIP F;  1DDN A;  1J0R A;  3TDZ C;  3R0J A;  2LDU A;  4YII A;  5KVR A;  3D5L A;  2DK5 A;  1K78 A;  2PMU A;  1RIO H;  4P55 A;  5LHH A;  4S05 A;  4PGH A;  3BWG A;  1SD6 A;  4L9T A;  2ESN A;  1XD7 A;  3V7S A;  3HRU A;  5DDG A;  3TO9 A;  3IL2 A;  2DLL A;  5CLS A;  2RV8 A;  3EDP A;  3IWZ A;  1FBQ A;  4I0A A;  3F21 A;  3DKW A;  2NNY A;  4ON0 A;  4A12 A;  1T2K A;  3CUQ C;  3F6V A;  2VBW A;  1HBX G;  4AIJ A;  2V1D A;  5LRS A;  2K27 A;  3FM5 A;  3RKY A;  2E7X A;  2IRF G;  1S29 A;  4G7O F;  1BBY A;  3ML6 A;  4IXA A;  4KN7 X;  3E6M A;  1MJ9 A;  3JTH A;  4HA8 A;  3R4K A;  3NRV A;  1BI1 A;  1TQI A;  1TTY A;  2PBI A;  1ULY A;  3T8T A;  1W7P A;  2CWE A;  1BI2 A;  4KDP A;  3WU0 A;  4Q5S F;  1G3S A;  4AD9 A;  4L9J A;  4O5V A;  1GVJ A;  3QU3 A;  4IHT A;  2HFH A;  4HX4 A;  2L54 A;  4HAM A;  4U7B A;  1D5V A;  1RNL A;  4L9V A;  3BJO A;  4P96 A;  4R8H A;  1FBS A;  5HLG A;  4O6J A;  4JQF A;  3K1M A;  3K1N A;  4FHT A;  3K1P A;  2R7F A;  4U0Y A;  4D0P A;  1ZAO A;  3RPQ A;  1KYW A;  3Q9S A;  3L7W A;  3C7J A;  1U5T B;  1P6R A;  5BOX A;  3QP6 A;  5CYV A;  5E17 F;  5D5W B;  3F8F A;  4XLN F;  4HQE A;  4LLL A;  4A5N A;  3KFW X;  1R23 A;  5LHG A;  2IP2 A;  4LMY A;  1AWC A;  4FX4 A;  5JVT A;  1JHH A;  3AAF A;  1STZ A;  1MD0 A;  3BPX A;  4Y13 A;  1EV7 A;  3Q5F A;  3ECH A;  3DFG A;  1BI3 A;  2QYO A;  2WWY A;  3R60 A;  2EFO A;  5LEK A;  2HKX A;  1O3Q A;  3N4M A;  2EV6 A;  3FXQ A;  5K1Y A;  3E6B A;  3WGI A;  1R36 A;  4M73 A;  2VT3 A;  2ZBK A;  2RVC A;  3CTA A;  1IN6 A;  3KP5 A;  5EEG A;  1USS A;  3I71 A;  1ZYR F;  3MEX A;  2YU3 A;  2M45 A;  2JPC A;  2RN7 A;  2V6C A;  2QEN A;  4KMF A;  1OYI A;  3LST A;  1KU9 A;  2Y75 A;  1V4R A;  3SZP A;  1OYW A;  4IF4 A;  2M30 A;  4LB6 B;  1KU3 A;  4XLP F;  2JPB A;  2B0L A;  3KE2 A;  2L3D A;  3B73 A;  3I59 A;  2QQA A;  1FPQ A;  4KIC A;  5F6F A;  1WKM A;  4K2E A;  2M87 A;  5CJ9 A;  3J81 K;  3DP7 A;  1BIB A;  4Q48 A;  3JAM Z;  3IKV A;  2PLY A;  1T39 A;  4P5O A;  4IPA A;  5J6X A;  3NQO A;  5HDG A;  3TGN A;  1D8J A;  3KZZ A;  1G6N A;  1UHM A;  2DBB A;  1FX7 A;  1R5G A;  2VC0 A;  4IRH A;  4YFN F;  1YG2 A;  1CF7 B;  4Z2Y A;  3R6S A;  1U2W A;  5HDK A;  2DO7 A;  4IRG A;  3RYP A;  4ESB A;  5A2Q Z;  3GXO A;  3LA3 A;  1OMI A;  2Z99 A;  1X3U A;  1ZN2 A;  1S7O A;  3GFI A;  3S2W A;  4DNC A;  1WQ2 A;  3KLO A;  1K78 B;  2OZ6 A;  2DT5 A;  3RTR A;  2OD5 A;  4Y17 A;  4ESJ A;  1R22 A;  1J9I A;  1B6A A;  3V8J A;  1PP7 U;  1UHW A;  2Q2E A;  2EWN A;  5BQT A;  1LEB A;  4LJZ F;  2CG4 A;  4A6E A;  5F1R A;  3QPH A;  3DXJ F;  1IZ1 A;  4U7D A;  3GLX A;  1TNT A;  2L01 A;  2BE5 F;  2LF7 A;  5FLX Z;  2ADU A;  2O61 A;  2BBY A;  3FHZ A;  5D4R A;  3M8E A;  2G7U A;  4M74 A;  4RGU A;  3V8L A;  4HF1 A;  4UV8 A;  1E17 A;  5IT9 K;  4KN4 X;  2DPU A;  2FMY A;  4RGR A;  1W4M A;  3TKY A;  1B9M A;  3GZ5 A;  4LLG F;  1OYY A;  3GFL A;  1JHF A;  2CQK A;  4JK1 X;  1W7P B;  2VC1 A;  3GX4 X;  3TO6 A;  2FNA A;  2OZU A;  2WC2 A;  3E6D A;  4LGW A;  4AVP A;  2COM A;  1A04 A;  5L3G A;  2MD5 A;  3J80 K;  3RYR A;  2BYV E;  1YQA A;  3QPT A;  4M72 A;  1Z6T A;  1S7A A;  2MH2 A;  3ECO A;  4HQM A;  5CVI A;  2V79 A;  4UVB A;  1QQI A;  2CYY A;  3BJ6 A;  4RGS A;  1WI9 A;  5DYM A;  1FWZ A;  2Y0M A;  2E1N A;  3LWF A;  3PFI A;  2P8T A;  3VOD A;  3R61 A;  4M6X A;  2MH9 A;  5HLI A;  4LK0 F;  1MDM A;  2K4J A;  1K79 A;  3FMS A;  3KP3 A;  3K0L A;  4EM0 B;  2IA0 A;  1ZLK A;  2EV5 A;  1Z1D A;  3VFZ A;  3FWE A;  1SD5 A;  2FNP A;  2OAZ A;  4YG2 F;  3BZ6 A;  2NAZ A;  2UXX A;  4I7H A;  3DQV C;  1ZRC A;  4EJO A;  2Y48 A;  4BXU A;  2A61 A;  4OIN F;  4CYD A;  1OPC A;  1TW2 A;  2P6S A;  1YO5 C;  5JR3 A;  3JTG A;  3KEQ A;  3W6K B;  2GWR A;  2UZK A;  5E1X A;  1G3W A;  4WWC A;  2VN2 A;  3G73 A;  3P9I A;  3HOS A;  4MTE A;  3BJA A;  3TOB A;  2DFI A;  4RAY A;  4OIQ F;  2F5E A;  2XAG A;  2HZT A;  4RS8 A;  1P4A A;  2A07 F;  2F5F A;  3HYI A;  3RIR A;  3L00 A;  1J7K A;  3ZPL A;  4HYE A;  2W24 A;  1Z05 A;  4OIR F;  1CF7 A;  1KQ9 A;  2EFQ A;  4MQ9 F;  4RAZ A;  3I59 B;  4UUV A;  2YX4 A;  2GXB A;  4I01 A;  2FRH A;  5ED4 A;  4KT5 C;  3KP2 A;  2ELH A;  2HTS A;  2WTE A;  1JE8 A;  4FT8 A;  2JRT A;  3JSP A;  2ISZ A;  2IJL A;  5DD4 A;  3MAJ A;  4BHP A;  3KP7 A;  1SFE A;  2CSO A;  3HIF A;  2L4A A;  3ZMZ A;  1MGT A;  1U5T C;  4MEX F;  1KU2 A;  3FXR A;  3MQ0 A;  4G8X A;  1TQP A;  1H9G A;  5FGM A;  5F64 A;  1C0W A;  3M1E A;  4A0Z A;  2VE8 A;  2RGV A;  2BV6 A;  1LDK B;  5BS6 A;  5ICC A;  1XSD A;  1Z6R A;  2L02 A;  1ZG5 A;  3F3X A;  5ERI A;  1FLI A;  5D6F A;  3TOA A;  4MGR A;  4YIF A;  1XSX A;  2MC3 A;  2GAU A;  4KUM A;  4RB0 A;  1EH6 A;  2A6H F;  3F6O A;  1O7L A;  4QLC U;  2VE9 A;  2IT0 A;  5DV5 A;  1IRF A;  5CVR A;  1WRJ A;  1P92 A;  1ZG3 A;  4L0Y B;  3VB2 A;  2QBY A;  2EA4 A;  3WTY C;  3SXY A;  2QQ9 A;  3RDI A;  3RJP A;  2NRA C;  1B9N A;  3IWF A;  2GZW A;  2L4M A;  2YR2 A;  5ILS A;  2ACJ A;  1I6X A;  3WTU C;  2NNN A;  4M6Y A;  2PFB A;  1TBX A;  4U0V A;  1HW2 A;  1V3F A;  5K5O A;  2LNB A;  3P9K A;  3ZN1 A;  5LBQ A;  2XKP A;  2LF8 A;  2YX7 A;  4EMS A;  3MCZ A;  1XGM A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...