3NQOA

Crystal structure of a marr family transcriptional regulator (cd1569) from clostridium difficile 630 at 2.20 a resolution
Total Genus 59
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
59
sequence length
187
structure length
182
Chain Sequence
b'DYSNELKELFLMNQTYATLFTLTNKIQIEGDKYFGILTSRQYMTILSILHLPEEETTLNNIARKMGTSKQNINRLVANLEKNGYVDVIPSPHDKRAINVKVTDLGKKVMVTCSRTGINFMADVFHEFTKDELETLWSLLKKMYRFNGEEQDGFEEDANEIDKIKSEALEEFAKRRNRVNKND'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords MarR-family transcriptional regulator
publication title Crystal structure of a MarR family transcriptional regulator (CD1569) from Clostridium difficile 630 at 2.20 A resolution
rcsb
source organism Clostridium difficile
molecule tags Transcription
total genus 59
structure length 182
sequence length 187
chains with identical sequence B
ec nomenclature
pdb deposition date 2010-06-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF12802 MarR_2 MarR family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 3nqoA00
5ILVA 4KNYA 1ZH5A 2COMA 5D5XB 1T38A 3FMRA 4WWCA 5D6EA 5LHIA 1O3TA 2G9WA 3GO5A 2LDUA 2QQAA 1HKSA 5E1WA 1HSJA 1SFEA 3ISPA 3K1PA 5K5RA 2YX4A 4EGZA 2LF8A 3RDIA 4L9TA 3ABTA 3K9TA 3DV8A 2CW0F 4IJAA 2P8TA 2XAGA 3ZPLA 3HRTA 4LLGF 1J0RA 5J8CA 3EETA 2ESHA 2NYXA 2VE8A 2UXNA 4BNCA 2OQGA 1W7PD 2F5DA 3F21A 3F23A 1RI7A 3V7RA 2K02A 3BDDA 4ENJA 4A2UA 1MDMA 3R6SA 1IF1A 2EFOA 5L3DA 3K2ZA 1TW2A 1JHFA 4PDKA 1L0OC 4A0XA 5FD5A 4FHTA 3TDUC 2HDCA 3RPUA 4LLLA 4HYEA 4R1HA 1D3YA 5HS9A 3HTSB 2ZO4A 2B0LA 2KJBA 1FBQA 2EV0A 2DQLA 4MTEA 4DQ2A 1LNWA 4MEYF 3WGHA 2QBYA 3K1MA 1DUXC 2ZBKA 3DQVC 4RB1A 1MD0A 2OZ6A 4EJWA 1FLIA 3FWEA 3WTVC 1CGPA 2F5FA 4KUMA 1J5YA 1NHAA 2KKOA 2LF7A 1KU9A 1KQ9A 1XGSA 1XDSA 4B09A 1OPCA 3KP7A 1U5TA 1H0MA 2JTVA 5AIPA 2XV4S 3E97A 4AIKA 3L09A 2QQBA 4CO8A 2FRHA 3HOSA 2MA3A 1IW7F 4WX9A 5IT3A 2IA0A 1BIBA 4EMSA 4O5VA 3E5QA 1B59A 3OV8A 4LFUA 2JPCA 1O3SA 2A68F 1Z91A 2CFXA 2IT0A 5HDKA 2ESNA 4CGZA 1JHHA 4BQAA 2MBFA 2EFQA 1SMTA 3MCZA 2ZMEB 1XSXA 2GAUA 3COAC 3CDHA 3WGIA 3P7NA 3DXJF 4YFXF 2DBBA 2XUBA 1S7AA 5FLXZ 3AAFA 3RYRA 1XD7A 2L3DA 5DD4A 1H9TA 1BJAA 4LD5A 1A04A 4R8HA 5HS7A 2X0LA 1FNNA 3BZ6A 4N0BA 4AIHA 3V4GA 1ULYA 4IRGA 3K1NA 4HV5A 3G73A 1FX7A 2HYFA 1SD5A 1PP7U 1RZ4A 3K69A 3WG9A 1D8KA 5FFXA 2O6GE 4KMFA 3P9IA 1B1BA 4OIRF 4EV0A 3DPTA 3E6MA 1Z05A 3DF8A 1XN7A 3ZMDA 1IN6A 2E1NA 1KYWA 4RGUA 3FHZA 2X4HA 2E1CA 5CVRA 2FSWA 4EVIA 2XKPA 3FX3A 1ON2A 2RN7A 3V7CA 2VBZA 4IXAA 5H20A 4ON0A 4M71A 2IA2A 3WE2A 2A69F 4L9NA 2NNYA 2CG4A 2VT2A 4IF4A 2R7DA 2FQ3A 4ASNA 5TJJA 2K86A 5DUIA 5HS8A 1HXDA 3ZMZA 4HX7A 5K5QA 5E18F 3KLNA 3JAMZ 2CQKA 1ZHFA 1G3WA 5CYVA 1PDNC 4M6YA 2RNJA 1IXRC 4O6JA 4ENMA 4U0WA 2Z3YA 5DDGA 4KICA 2XAQA 3T8RA 1LDKB 4KIGA 5F64A 1FYKA 2GWRA 5D8LB 4G6DA 1MJAA 3F72A 1GVJA 2OA4A 3LA3A 2XRNA 4BHCA 5HLHA 1P4AA 5DV5A 2M45A 4JBAA 3ERED 2W85A 2UXXA 2RC4A 1ZRDA 2M1BA 2O3FA 5FB2A 2WWYA 3L7WA 4UNOA 1EH7A 2PJPA 2GXBA 5HDGA 2E7XA 2FBHA 1BIAA 2FNPA 3SFZA 2VOOA 4L5JA 3E3VA 1E17A 4AIJA 2D2WA 2XGXA 3FM3A 1YS6A 3EYIA 1LQ1A 2DAOA 1TW3A 4IVNA 4UV8A 1WKMA 5DEQA 1H9GA 3FZVA 5L3FA 4HV6A 4N9HA 5JR3A 3J7AO 4WCGA 3J80K 2ISYA 3CLOA 2D1VA 2VE9A 4UXNA 4ZZLA 1FY7A 3N4MA 4LMYA 5J8FA 2PG4A 2VODA 3ZN1A 4Q47A 5JFRA 3HRUA 2EV5A 4MGRA 4U7BA 4EM0B 4G6QA 2XAJA 2JSCA 4GYIA 4UV9A 1RUNA 1YQAA 1HSTA 1LB2A 5F1RA 1S8NA 3BPVA 1FPQA 3O2PE 3DKWA 5L3BA 4EJOA 2XAFA 2IPQX 5ICCA 5LLQA 3Q5FA 1TQIA 3W6JB 1TNSA 2W24A 2VONA 1R00A 3IHUA 2VOPA 2MD5A 2IP2A 5E8IA 3QP6A 4P55A 4OIPF 3KEQA 2DLLA 3DP7A 3RYPA 3E6BA 3I59B 4MNUA 1AOYA 4Q48A 2M5WA 1C0WA 3ULQB 1ZAOA 1T6SA 3JSPA 2ACJA 4CXFA 1I5ZA 3MZHA 1O57A 3IKVA 1ZLKA 4L9JA 3L2CA 2M8EA 3GLXA 3CJNA 2YSRA 3U2RA 5D5VB 2H94A 4D0PA 2VBXA 2J5OA 1YFHA 3ML6A 4UUVA 1ZG1A 5D8KB 4L18B 2C6YA 4MQVA 3GFLA 3IL2A 1TLHB 1U8RA 2HKOA 2H6BA 3BP8A 1MJBA 2P6SA 2ETHA 1WWXA 3WTWC 1R5HA 2A61A 4GCVA 5L3EA 1FBUA 1XMKA 3RKWA 3SQNA 1P92A 4FX0A 4XLNF 2ZFWA 3WTSC 4ESBA 4P5OA 3QAHA 4FX4A 5BS6A 4ENNA 3GXOA 4BHBA 3IKTA 1O3QA 3JTGA 2R3SA 5ICFA 1V3FA 4G8XA 3TO9A 1YW9A 5D6FA 3VEPA 1R36A 5D5WB 2WTEA 2VT3A 5DUKA 1IAWA 1Z6TA 2CSOA 4ENKA 1P4XA 2EV6A 1HBXG 2QZ8A 4HA8A 2ELHA 2HTSA 3WTXC 3I58A 3PQJA 1I1GA 3M7GA 5E8GA 2K4JA 1DP7P 3SZPA 2P7VB 2DPDA 4BYYA 2GA1A 5H6QA 2Z33A 4HOBA 4LLNA 1ZG3A 2FMLA 5BOXA 5LHGA 2OU2A 2O61A 4YIIA 1QBJA 1B4AA 4K2EA 3KP5A 1SD6A 2QLZA 3I54A 4L0ZB 1W7PA 5ERIA 4Q5SF 2EA4A 3TDZC 1BI3A 4L9VA 1R1UA 1O7LA 1J2XA 3R0AA 4GO1A 2A6EF 2PMHA 1R5GA 1ZGJA 2EFPA 1RUOA 1OYIA 3KLOA 3D5LA 5LBQA 1SD7A 3KE2A 1DPUA 3EDPA 1YS7A 5BQTA 2BV6A 3GFJA 2FEZA 2DW4A 1U5TC 5FGMA 3ABUA 4OIOF 2PLYA 1KU3A 2ZMEA 2PN6A 4A5MA 3HSRA 1VTNC 4RAZA 3ECOA 4IHTA 3V8LA 4ESFA 2CO5A 3JSOA 2QUFA 3ZMUA 2HQNA 3T8TA 2QBYB 1CF7A 2PQ8A 2EB7A 2VXZA 4U7DA 1AWCA 5A2QZ 3OOPA 3V8JA 2H09A 4PGHA 1TBXA 3O3KA 3EQLF 4CICA 2D45A 2HS5A 3CUOA 2HWVA 5EEHA 3KP2A 3FF5A 3KP4A 2M87A 4M73A 3CUQA 1QZZA 5CLSA 1U5TB 1FWZA 5IT9Z 4A5NA 3CUQC 3P9KA 2NNNA 2NRAC 1FYLA 4G94A 6PAXA 2G7UA 1F4KA 4LB6B 3QOPA 4AWXB 5AONA 1K78B 5DD8A 2QVOA 4AD9A 2XKOA 4HX4A 4PCQA 2P6TA 3HOTA 2NAZA 3R4KA 4P96A 4M6XA 2IW5A 4HDUA 1Z1DA 1U2WA 2AS5F 1HKTA 4ZZDA 5KVRA 4HLYA 1S29A 1XDUA 1W5TA 4LG0B 4XSXF 5LHHA 1SFUA 4ESJA 4XLPF 2O0YA 4IRIA 2HR3A 1FP2A 2EFNA 1LVAA 2F2EA 3SHFA 1IXSB 4RGSA 5J6XA 2LKPA 1KQ0A 2DO7A 3M8EA 4HX8A 4HW0A 4QLCU 2IVMA 3BJ6A 1F5TA 3U9GA 4L0YB 1MKMA 3KP6A 1HQCA 3N97A 3R0JA 2ZCWA 1G3YA 3SZTA 1PP8F 2DI3A 3IC7A 1P2FA 1XSDA 3ELKA 1Y0UA 2TDXA 1I6XA 3KZYA 1ZG5A 1YIOA 4TV7A 3QU3A 2QM3A 2JZYA 2ZKZA 3G3ZA 2WC2A 1ZARA 5K1YA 4OMYA 3T0YA 5LGTA 5FD6A 3MQ0A 2XAHA 2OD5A 1UFMA 2FBKA 1I27A 1BM9A 3JTHA 4EM1A 1LEBA 4IHSA 3QP5A 4U88A 4I09A 1FOKA 2Y48A 3E6CC 3TOBA 5LGUA 3VFZA 4ZYDA 2F5EA 4KIFA 1JXSA 4I0BA 5DCFA 4KN4X 1WI9A 1GHCA 2RV8A 2LSOA 3LA2A 1RNLA 2DQRA 5FO5A 3EUHA 1XB4A 4M9ZA 4OIQF 1ON1A 1XSVA 1ZN2A 5ILUA 3WGGA 1F9NA 4EJTA 3TO6A 2RKHA 1SMYF 3IRRA 3TOAA 3D0SA 1QGPA 2Z5UA 2DT5A 1ONVA 2CGPA 1R58A 2AXLA 3FXRA 2PEXA 2E7WA 2FF4A 3QRFF 1LDJA 2VN2A 1REPC 3MEXA 3NEUA 4MQ9F 2FMYA 2BE5F 2EK5A 2V1DA 1Z9CA 1EH8A 3EYYA 1J75A 5LGNA 1IZ1A 4QWQA 2BEOA 1BOAA 5D4RA 1FC3A 2MC3A 3HUGA 1EV7A 3HHHA 5ICGA 2VBWA 4BXUA 1ZRFA 1O7FA 2YX7A 3VODA 2MH2A 2JRTA 5H6RA 1U3EM 3BOQA 1OR7A 4GYGA 5TRDA 4KT5C 2FXAA 3BY6A 1BN5A 2L02A 4HBLA 4YIFA 3REOA 2KIUA 3DPLC 3I59A 2DU9A 2ZNYA 2XASA 3I0TA 1SAXA 1ZREA 3ZP5A 4WXHA 3IWZA 2PBIA 5LEJA 3QU6A 4HAMA 2F5CA 2HOEA 1DDNA 1QPMA 3T1BA 2OZUA 3HIFA 4EQQA 4EJVA 5JVTA 2MH9A 2FOKA 3WE3A 2V79A 2DK5A 5FFZA 1YTYA 2Y75A 1T98A 2HKXA 3GW2A 2V6CA 3WTUC 1YLFA 1IN5A 3HSEA 2L01A 1IRGA 2IA1A 2BBYA 4E70A 2R7FA 1R1VA 2GXGA 5FLXK 3FMSA 4EGYA 3K0LA 4BHPA 3C7JA 3I4PA 2ADUA 1S7OA 4EJUA 1WSUA 2IRFG 4OU0A 3BPXA 4WXDA 2ZNZA 4YFNF 1HW2A 4HZFA 1IN8A 3TO7A 1BC7C 2JT1A 4PGGA 5DCMB 3RPQA 3WTZA 3V8KA 3DEUA 5CVUA 3B73A 4G9YA 4CDGA 4UVBA 1TNTA 5ICEA 2OQRA 1FYMA 5HLIA 3GX4X 2W57A 2HZTA 3GUDA 3WU1B 3KP3A 4RAYA 1J59A 2HEOA 3ROUA 3I71A 3RKXA 1B9MA 2O03A 1YO5C 1J7KA 3LSTA 4LGWA 1MGTA 2OBPA 4NHJA 1F1ZA 3KEOA 4O3MA 4S04A 2Q0OA 1YW7A 3F8MA 3GWZA 1G6NA 2HGCA 3MFKA 3NQOA 1FBSA 5HVQC 3GZ6A 1D5VA 2L4AA 1PUEE 2PMUA 3L00A 2DPUA 3LQQA 4UVAA 4LK0F 1B6AA 3BROA 4GXOA 3MWMA 3QPTA 4NQWA 1KQ8A 3ECHA 4OOIA 1W5SA 3KFWX 1BBYA 4WF2A 3JAMK 3KZZA 1KU2A 5CJ9A 3FXQA 3GZ5A 1OKRA 4UHTA 4HQMA 1TQPA 3KCCA 3MAJA 2Q8KA 2QYOA 3VOEA 1G3SA 4H0EA 4HF0A 2HYGD 5CVIA 4FT8A 4LB5A 1LJ9A 4GGGA 3SXYA 4A0YA 1R1TA 4M9XA 1OYYA 4ZH4F 4MHGA 4I98B 1JGSA 3S2WA 4UVCA 4WXCA 3F8CA 2XROA 2BGCA 2FNAA 3RIRA 3F22A 4IRHA 2RGVA 2QWWA 3R60A 3TQNA 1MDMB 2V1XA 3TGNA 1U78A 2W25A 3ZMVA 1ZLJA 2K4BA 3J80Z 3CTAA 3HYIA 1UHWA 1DPRA 4HF2A 2EFWA 2VC0A 4RB0A 1MJ9A 1W7PB 5D5UB 4KN7X 4CYDA 1TTYA 3BWGA 1OYWA 2YR2A 2J5PA 3RI4A 3GYHX 1HW1A 2JPBA 1YW8A 2Y0MA 2NS0A 5E17F 1JE8A 2RDPA 1D8JA 4KIBA 2LNBA 3V7SA 1BI0A 2STTA 1Z7UA 1P4WA 1Q1HA 1O3RA 3BJAA 1K78A 5LRSA 1V4RA 4A0ZA 4Y13A 1R7JA 3RTRA 2A07F 2D1HA 1QQIA 3LAJA 4I2OA 3MZYA 1T39A 1K7AA 5L3GA 2Z9OA 4LG0A 1BI1A 4YFKF 1BC8C 4OINF 1LEAA 3F8FA 1CF7B 1G4DA 1MZBA 5HDNA 2W84A 4KDPA 2VBYA 2WV0A 2P5KA 5LEKA 2UWMA 5KK1A 4HQEA 5CVJA 4KMUX 3PFIA 4LK1F 4N9IA 4MEXF 3Q9SA 3CUQB 3HRSA 5DYMA 4A6EA 3J81Z 1KU7A 1GXQA 2RQPA 3IWFA 1KYZA 5AIQA 1XGNA 2FA5A 2QENA 2XIGA 3R61A 2H6CA 3Q9VA 3E6DA 2GIVA 4DNCA 1IRFA 2CYYA 4ZYGA 1Z6RA 3F8BA 1USTA 3O6BB 1FSHA 2L4MA 3LFKA 4JQFA 4XRFA 4Q4ZF 3T5XA 1FSEA 2A5YB 3F6OA 1KGSA 2OAZA 3JW4A 4P9UA 2V1UA 3I53A 5K5OA 2ZXJA 3GVAA 2BYVE 3GF2A 4F7ZA 2PFBA 1QNTA 4M72A 2DTRA 1P6RA 3BJOA 2PI0A 2O8XA 3DFGA 5BPDA 3P9CA 4I02A 2ZJ2A 3LQRA 4CHUA 1STZA 1UCRA 1YYVA 2MLKA 4U0YA 4I7HA 1XGMA 4JK1X 5L3CA 3F3XA 4Z2YA 2FBIA 4Y17A 3E5UA 3QPHA 4OMZA 5JI6A 2GQQA 3C3WA 2M30A 2UZKA 2P5LC 3LAPA 1IUYA 4KFCA 1I1SA 1SD4A 1WQ2A 2K7LA 1J9IA 3LWFA 4NB5A 4BAYA 4I0AA 3C1DA 3W6KB 3U1DA 5ILSA 1QZYA 5LRRA 1SFXA 3I64A 3CO7C 2EWNA 1T2KA 2FE3A 5F6FA 4WK8F 5EEGA 2STWA 1QO0D 5E20A 3NRVA 3M1EA 1FP1D 4EM2A 1S3JA 5ED4A 3IRQA 1HKQA 3FMQA 3ZQ7A 3WODF 1ODDA 3HHGA 2H27A 4RS8A 4HLXA 1E2XA 1YG2A 1XCBA 2CWEA 3M8FA 3I5UA 1HW5A 2QQ9A 3TKYA 1G3TA 4G7ZF 1ZYRF 3GFIA 3RJPA 1S6LA 3KETA 3WTTC 2A6HF 1T0FA 1K79A 4KYWA 2YU3A 5BPIA 5E1XA 1R23A 4P9FA 3FXUA 1FT9A 4ZYEA 3F6VA 3GEZA 2XVCA 4A6DA 2IJLA 1EH6A 3H92A 1TQMA 3HRMA 4MTDA 2K27A 4S05A 3WTYC 1KA8A 4AVPA 4PZJA 2A3SA 1USSA 4RGXA 4HF1A 1WRJA 5HLGA 1IN7A 1FZPB 5E1ZB 2GZWA 2KRFA 1U6GA 4HDVA 3LA7A 1UB9A 2P7CB 4G7OF 2KIMA 4CZZA 2KJCA 3FM5A 4RGRA 2HQRA 2MLGA 5A2QK 2DK8A 4ZYHA 1BI2A 4BH9A 2EA2A 2FU4A 4Y15A 2KIFA 4ETSA 3VB2A 1B9NA 4R79A 1X3UA 1OMIA 3H3UA 2ISZA 5IT9K 3HTUA 5D4SA 4KA4A 5CVVA 3ZMSA 5JHUA 1IXCA 1XGOA 4XSZF 3E5XA 4L5IA 2VC1A 2XHKA 5DCMA 3F8NA 2G7HA 5BMZA 1XMAA 4LJZF 2HTJA 3ZMTA 2YPRA 2P5VA 5HOOA 2Z99A 4IPAA 2Q2EA 4M74A 4RB3C 3GFMA 3M9AA 4G7HF 1R22A 2HFHA 4A12A 2P4WA 3ZN0A 2L54A 4B8XA 4U0VA 1RIOH 1K6OA 2DFIA 3B02A 1ZGAA 3J81K 3CO6C 1GXPA 1W4MA 3RKYA 3WU0A 1IN4A 4XBFA 1XCVA 1LDDA 1L3LA 2V9VA 2GA2A 1UHMA 4M9SA 4YG2F 2RVCA 1ZRCA 3PQKA 3C18A 3L9FA 3HSFA 4I01A 2EJRA 3H3ZA 4RB2C
chains in the Genus database with same CATH superfamily
5ILVA 4YEJA 5EEAA 2F6CA 4KNYA 1ZH5A 2COMA 3W2AA 3GTQJ 1Y8QB 5D5XB 5H2FC 3FMRA 4XLEA 3IAS2 5D6EA 3TBIA 5LHIA 3A0BC 4WWCA 1T38A 2NVUB 4XKBA 1O3TA 2G9WA 4E7JA 3GO5A 3HGYA 3OYCA 2LDUA 4HNUA 4IO9F 2QQAA 1HKSA 2QKLB 5E1WA 1HSJA 3HZJA 4ZYAA 4C3JJ 1LE8A 1SFEA 3ISPA 1Y1VJ 2MGQA 3K1PA 1BA5A 5K5RA 2YX4A 3HGGA 4EGZA 2LF8A 3RDIA 3D5SC 4L9TA 3ABTA 3BR1A 4NNJA 1I3AA 4BBRJ 1WJAA 3K9TA 3BTLA 3DV8A 2CW0F 3M3YJ 2VJ4A 4IJAA 2P8TA 3FBIB 2XAGA 4RDUA 3ZPLA 3HRTA 2JA6J 4LLGF 1J0RA 1W36C 5J8CA 3EETA 1MBHA 2ESHA 2HPIA 4OAZA 2BY1A 4XN0A 2NYXA 2VE8A 2UXNA 3EUAA 4BNCA 2OQGA 1W7PD 3Q0UA 1V5GA 3OOUA 2F5DA 4D1QA 1VF9A 3F21A 2OPTA 4Y52J 4QPOA 3KYCB 3K4JA 4XONA 1JTXA 2JSPA 3F23A 2V6EA 1RI7A 2EZHA 3V7RA 1YJ9I 1A6QA 1MH3A 3CCUI 2K02A 3BDDA 2ME0A 4ENJA 2NS8A 4A2UA 1MDMA 1VQPI 3H5RA 4E7HA 3R6SA 2WB1N 3LMMA 2QSHX 4V2GA 2ZSHB 3RCOA 1IF1A 1P7JA 2EFOA 5L3DA 3BR2A 3K2ZA 1TW2A 3CCRI 4AM3A 2AQFA 1JHFA 4PDKA 1L0OC 1LVKA 4A0XA 3S15J 5FD5A 2H8WA 2EPFA 3TW6A 4FHTA 3LSKA 1YJNI 3TDUC 3S3NA 2HDCA 2KISA 3RPUA 2DODA 4LLLA 5J1RA 4M3FA 1FOXA 4HYEA 4R1HA 4B3AA 4RAFA 1D3YA 3L2QA 2COBA 4PJ0C 5HS9A 3HTSB 2VQHA 2L9SA 4PSXA 4KITB 3HOUJ 2ZO4A 4FASD 2B0LA 2KJBA 4H4KC 4C30A 1FBQA 2EV0A 2DQLA 2ICWG 4MTEA 3OIOA 4DQ2A 3CZ6A 1LNWA 4MEYF 3WGHA 2QBYA 3K1MA 3K4MA 1DUXC 2ZBKA 3DQVC 4RB1A 4KISA 1MD0A 2OZ6A 4EJWA 1V5FA 1WJFA 2ID6A 1FLIA 3FWEA 4XRMA 3WTVC 1JKQC 2F5FA 4KUMA 1CGPA 3SZGA 2Y30A 1J5YA 2N8GA 3CMAI 3JRCA 2RREA 1NHAA 2KKOA 1RRJA 5FLVA 2V9PA 2LF7A 2VQCA 1KU9A 2L0KA 4A3MJ 1KQ9A 1XGSA 3QYBA 1XDSA 2M2EA 4B09A 1OPCA 3KIOA 1EA3A 3KP7A 4PSWA 2DFHA 1S72I 2JJ7A 3LOCA 1U5TA 1H0MA 1X3WB 2JTVA 4P1WA 5CQGA 5AIPA 3OYMA 4C2MJ 2XV4S 3CCMI 3ZCOA 4EEFG 3E97A 1V55H 2ZFUA 4AIKA 2XDVA 4D7NA 1MW7A 1R71A 3L09A 3RZDJ 2QQBA 4CO8A 2FRHA 1E3PA 3HOSA 2MA3A 1IW7F 2K3FA 5CKTA 4WX9A 3JRBA 3OL3A 5IT3A 2IA0A 4ZC3A 1BIBA 4EMSA 3G6EI 4O5VA 2YU9J 3VSKA 2VJIA 1W0TA 3E5QA 1B59A 2R7UA 1FJLA 3OV8A 4LFUA 1WJ5A 2JPCA 1O3SA 2A68F 1Z91A 2CQQA 2CFXA 2DMPA 4I99C 2VB6A 2IT0A 5HDKA 2ESNA 4PUSA 4CGZA 4DW6A 1JHHA 3VYUB 2XSJC 4BQAA 2MBFA 1SFOJ 2HOAA 2EFQA 1SMTA 4CCJA 3MCZA 3PL8A 1APLC 2ZMEB 1XSXA 5GP9A 2XAUA 1K4SA 1MMNA 2GAUA 2WY7Q 1OCOH 2DA6A 3COAC 2A6TA 3HKZN 3NWTA 3CDHA 4E7IA 3WGIA 3H1CA 4D9JA 3K7AJ 3P7NA 3DXJF 4YFXF 2DBBA 5IP7J 2LY9A 2M4KA 2XUBA 2IBDA 1S7AA 5FLXZ 4NDLA 1VQMI 3AAFA 5EGOA 3HBLA 3LSMA 2QSFX 3RYRA 1XD7A 2VKEA 2L3DA 2VKDA 5M3MJ 5DD4A 1H9TA 2E1MB 1BJAA 2Q1ZB 4BEHA 4LD5A 2PJRA 3LSPA 1A04A 4R8HA 2QGUA 3BT9A 5K7HA 1VZ0A 1QZEA 5HS7A 2X0LA 2VPLA 1YITI 1FNNA 3BZ6A 4N0BA 4AIHA 3V4GA 1BR2A 1ULYA 4NC6A 4IRGA 3K1NA 4HV5A 3G73A 3DPUA 4B48A 3HOWJ 1FX7A 2CU7A 4IHVA 2HYFA 1SD5A 3L2WA 1PP7U 1RZ4A 1HOMA 1D1AA 2MABA 2KRCA 3K69A 3M1CA 2BZTA 3FKIJ 3WG9A 2CH0A 1D8KA 5FFXA 4LIUA 2O6GE 3A02A 2X85A 2I5UA 4KT6A 4KMFA 2AQEA 3P9IA 3ZQIA 2OTJI 1B1BA 4OIRF 4ZTJA 1WFXA 4EV0A 3I3LA 3DPTA 3E6MA 1Z05A 2R7VA 3DF8A 1XN7A 3ZMDA 1IN6A 2QCOA 2HI3A 2E1NA 1KYWA 5DM7F 4RGUA 3FHZA 2X4HA 1A36A 1IC8A 5CVRA 2E1CA 3PNYA 5EZGA 3BTCA 3SEQA 1P9QC 4MFEA 1WJEA 2FSWA 1Z67A 2HDWA 2IGKA 2M0CA 3KZIC 4EVIA 1SC7A 4A3DJ 2XKPA 3FX3A 2ZC2A 4NC7A 3CP2A 1ON2A 2KLOA 2RN7A 2Z2SB 1X1CA 3V7CA 2VBZA 4IXAA 4U87A 5H20A 2IS4A 3BCAA 1PVEA 4ON0A 1YE9A 2EILH 1LFUP 4M71A 2IA2A 3WE2A 3DWLE 2A69F 3DTKA 4L9NA 3A01A 4N4NB 2NNYA 2BOLA 1ACIA 4CYCB 3MKZA 2CG4A 2VT2A 4IF4A 3GCMA 3CLQA 2V9KA 3A03A 2K9QA 2R7DA 2FQ3A 4RA2A 4ASNA 5TJJA 2K86A 2H8RA 5DUIA 5HS8A 1HXDA 1X19A 2TRTA 2I8DA 4HX7A 3ZMZA 5K5QA 1IUFA 5E18F 3KLNA 4FISA 5K7ZA 3JAMZ 3JR9A 2CQKA 4F91B 3CJTB 1ZHFA 3FIWA 1WZ2A 2IAIA 1ETQA 4JX6A 2X6WA 5IPAA 2L9VA 3MKLA 1G3WA 1WJCA 5CYVA 1PDNC 5FKMA 4M6YA 2RNJA 4UUTA 1IXRC 3AL0C 1ETOA 1NG6A 4O6JA 1QVUA 4ENMA 3K4NA 2ZJRF 4U0WA 2Z3YA 5DDGA 4KICA 2GLOA 2XAQA 3OWTA 3CDLA 3T8RA 2BVLA 1FTZA 2L7ZA 1LDKB 2KIQA 2E60A 4KIGA 1VQLI 1AA7A 2K9NA 5F64A 3KYLA 1FYKA 3CMEI 5IYDJ 2GWRA 3ERMA 5EYRA 5D8LB 4MIMA 4G6DA 1MJAA 2MG4A 3F72A 1GVJA 4HPQA 4CSWA 2NVYJ 3PUBA 2OA4A 4DGWB 3S93A 4BY1J 3QWLA 2GBYA 3LA3A 2XRNA 3DU5A 5F1JA 3BTIA 2NVXJ 4BHCA 5HLHA 1P4AA 4JBAA 2M45A 5DV5A 3ERED 4ITVA 1DGRM 1VQKI 3CCQI 2W85A 4AIDA 1GT0C 2WADA 3HB9A 2UXXA 2RC4A 1ZRDA 2M1BA 2P0WA 4FQGA 2O3FA 4IL6C 3K4BA 1D5YA 5J3LA 5FB2A 2WWYA 4DYCA 1R4NB 3L7WA 3DLAA 1S9HA 4UNOA 2VJJA 1ZTRA 1EH7A 2HXIA 2XGEA 2GXBA 2PJPA 3S1NJ 4A3FJ 5HDGA 3ABLH 4LOCA 2E7XA 2FBHA 1BIAA 1UG0A 2DOEA 2FNPA 3SFZA 3K10A 1LPQA 1T0FC 2W7NA 3BQYA 2VOOA 1WH7A 2BXZA 4L5JA 3KPHA 3E3VA 3K70C 1E17A 3FKJA 4AIJA 2D2WA 2XGXA 3FM3A 4D5CA 1YS6A 4CCLA 3LSRA 3EYIA 1ETKA 3HPHA 1LQ1A 2DAOA 1TW3A 2M4GA 4IVNA 4UV8A 1WKMA 5DEQA 1H9GA 3FZVA 4D5FA 2Y9ZA 5L3FA 1OCZH 1BR1A 5GPCA 1JJ6C 4HV6A 3X2QH 5GADJ 2JVGA 4N9HA 5JR3A 3CCVI 3J7AO 1GV5A 4F55A 2EZKA 4WCGA 3J80K 3HDDA 2ISYA 3CLOA 2D1VA 1K4TA 2WY8Q 2VE9A 4UXNA 4ZZLA 3JCUC 3OYAA 1VQNI 2M34A 1FY7A 3N4MA 4BKXA 1MMSA 4LMYA 2CUJA 5J8FA 3OS2A 1JUSA 2PG4A 2VODA 3ZN1A 4Q47A 5GPAA 5JFRA 2DJNA 2EV5A 3HRUA 4MGRA 4U7BA 3GLLA 4XN3A 2FQ4A 4D7MA 4EM0B 4G6QA 3ZRGA 2G0EA 2XAJA 5M5WJ 2JSCA 2IS2A 3B6AA 3SEZA 4B47A 4GYIA 2JQ7A 2KDOA 4UV9A 1RUNA 4J00A 1YQAA 1HSTA 1LB2A 4UUSB 2R5YB 2VASA 2R7SA 5F1RA 1S8NA 2X1DA 3BPVA 5JLXA 3WG7H 3CCEI 1FPQA 3O2PE 5GAGJ 3DKWA 5L3BA 5J1YA 4EJOA 2XAFA 2IPQX 2BW3B 2KZGA 5ICCA 1MBEA 1AHDP 2HOSA 3SDGA 3HG9A 2CUEA 4A69C 5LLQA 4IOCF 1G2HA 3Q5FA 3HUGB 2LREA 2DA3A 1TQIA 3HL2A 1AKHA 3W6JB 1MSEC 1N77A 4I76A 2HQ5A 1TNSA 1B8IB 2DCEA 2W24A 3F0CA 4BQQA 4HNVA 4OWRB 5J1UA 1IV6A 2VONA 1R00A 2K5CA 4PJLA 3S3MA 3IHUA 2VOPA 2MD5A 3MZ8A 5IOYA 2IP2A 1GVDA 5B5EC 5E8IA 3OIQA 3QP6A 4P55A 5TISC 4DYRA 2BY3A 4OIPF 3KEQA 2DLLA 3DP7A 3RYPA 3E6BA 3FK7A 3I59B 4MNUA 1AOYA 1LUJB 3O8GA 4Q48A 2M5WA 1C0WA 3TMOA 3IH2A 3ULQB 3WHBA 3GTKJ 5J4VA 1ZAOA 4HG2A 1T6SA 4XNFA 3JSPA 2PMZA 3ZOBA 2JWTA 3QQAA 4CXFA 2ACJA 1I5ZA 3MZHA 1LFPA 1U9NA 4C3HJ 1O57A 3D5RC 3HM5A 3IKVA 1JJ8C 1ZLKA 4L9JA 4ANJA 3L2CA 3DU6A 2XRLA 2M8EA 3GLXA 4XRSG 2F4IA 4B3XA 2VLAA 1ETXA 1Z0XA 1RR7A 2XGCA 3CJNA 2YSRA 3U2RA 2F4OB 2H94A 3W2VA 5D5VB 4D0PA 1Z3YA 2DYRH 2VBXA 5JLWA 2J5OA 1YFHA 3ML6A 2QSGX 4UUVA 2MD0A 4RBOA 1ZG1A 2Y69H 5D8KB 4L18B 2CW8A 2C6YA 4MQVA 3GFLA 1QVTA 1UELB 3IL2A 1TLHB 1U8RA 2R7ZJ 3S2HJ 5F0FA 2X1CA 2HKOA 2H6BA 3BP8A 1YI2I 1MJBA 2P6SA 1BL0A 2ETHA 4A93J 1WWXA 3WTWC 1HLVA 5M5YJ 3CC7I 1R5HA 2A61A 2MC4A 4GCVA 2E34A 5KCMA 3HOVJ 5L3EA 1VQOI 1FBUA 1XMKA 2E19A 2F48A 3A4CA 3RKWA 1ENHA 1P92A 3SQNA 4FX0A 4XLNF 4XICA 2LKXA 4UB8C 2ZFWA 3WTSC 4ESBA 4A3KJ 4P5OA 3GZNB 3DKYA 4BDZA 5JHFA 1ERDA 3JRAA 5J40A 4A3JJ 1K83J 3QAHA 2F4MB 4FX4A 5TGTA 5BS6A 1W36D 4XLHA 1OJLA 4ENNA 3SJMA 3DBHB 4DJAA 3GXOA 4AC0A 4BHBA 3IKTA 1O3QA 2CV2A 3JTGA 3MD2A 2R3SA 5ICFA 2VL8A 1RPWA 2E5NA 4HEA2 2UV1A 4M3EA 1V3FA 4G8XA 1K6YA 3TO9A 1XTAA 3WU2C 1I50J 1UZCA 1YW9A 4XOPA 5D6FA 3VEPA 5LFAA 3BQZA 5K7FA 1GUUA 1R36A 5D5WB 2WTEA 3Q0WA 3BCBA 4DYQA 2VT3A 5DUKA 3G1MA 1IAWA 4FE7A 3OSFA 1Z6TA 2CSOA 2DOAA 4OAYA 4ENKA 2LKSA 3RKQA 1P4XA 3PM1A 2UUZA 4B43A 2EV6A 2W48A 1HBXG 5FRMA 2QZ8A 1T08B 4HA8A 1T8IA 2ELHA 2HTSA 1U0JA 2KZVA 5C4JJ 3GTLJ 3WTXC 4BJ6C 2E2HJ 3I58A 3PQJA 4XMYA 1I1GA 3M7GA 1BJZA 1X2NA 5E8GA 2QF7A 3BR6A 1SFKA 2K4JA 4IOAF 1PUFA 1DP7P 3SZPA 2HNHA 2LH9A 2P7VB 3DBLB 2BXYA 2DPDA 4BYYA 3J7ZI 2GA1A 5H6QA 2M8GX 3Q0VA 2CFOA 2KMUA 2Z33A 4HOBA 3OYKA 4A3BJ 1ZELA 4LLNA 4AU7A 1ZG3A 3OYHA 1WGXA 1Z77A 2FMLA 2JUCA 1DU0A 5BOXA 5LHGA 2OU2A 2O61A 4NQWB 2LVSA 2DFFA 4XR6A 4YIIA 1Q1VA 1ETWA 1QBJA 3FDYA 1B4AA 2DOFA 2HYJA 3DTIA 4FETA 4K2EA 3KP5A 1SD6A 4Z6YA 3OIPA 2QLZA 1Y0NA 3I54A 4L0ZB 2CMPA 3K4CA 2W00A 1W7PA 2TCTA 5ERIA 3PSIA 3VDXA 4Q5SF 2EA4A 4RM2A 3TDZC 2H1KA 1LFBA 1BI3A 4L9VA 1R1UA 1O7LA 1RESA 1J2XA 2YUSA 3FHNA 3R0AA 4GO1A 3F9KA 2A6EF 1MMGA 5DTDA 1IRZA 2PMHA 3U21A 1R5GA 3TEDA 5C44J 1ZGJA 3MKWB 1Z7LA 2EFPA 2X6OA 1RUOA 2VI6A 4PFOA 2ELKA 3V42A 1OYIA 3KLOA 4GFBA 3D5LA 3A1YA 3U1KA 5LBQA 2CS3A 2LC2A 1MNEA 1SD7A 3KE2A 2HDDA 3GTPJ 1DPUA 3EDPA 1JKRC 4ZDOA 1YS7A 4RM3A 2WBMA 3VYRB 5BQTA 2BV6A 3GFJA 2FEZA 2DW4A 5IYBJ 1U5TC 2DMTA 5FGMA 4XRSA 3ABUA 1UG2A 3TP0A 4PJMA 4OIOF 2OF7A 2PLYA 1KU3A 3H35A 2KDZA 3BZKA 2ZMEA 2PN6A 4A5MA 3ABMH 2EBIA 3HSRA 5BNGA 5M5XJ 4RAZA 3ECOA 4IX7A 4B4CA 1VTNC 4IHTA 2IXSA 3V8LA 4ESFA 1X1BA 2CO5A 1KZHA 3JSOA 2QUFA 3ZMUA 2HQNA 3T8TA 2QBYB 1CF7A 4JOMA 2LD5A 2PQ8A 2EB7A 2VXZA 3A0HC 4U7DA 1AWCA 1IDZA 2MYSA 5A2QZ 3OOPA 4II3A 3V8JA 3B6CA 2H09A 2NOJB 4PGHA 1TBXA 3O3KA 1NTCA 3EQLF 4CICA 2D45A 2DT6A 2HS5A 3CUOA 3K2AA 2HWVA 5EEHA 3BG9A 3KP2A 3FF5A 1MSFC 3KP4A 2M87A 1RR8C 2L9NA 4M73A 4E6KG 4EATA 4MLOA 3CUQA 1QZZA 5CLSA 1U5TB 2Z16A 1FWZA 3GTJJ 3G71I 5IT9Z 4A5NA 3CUQC 3OR1C 3ZR8X 3P9KA 2ZJQF 2MFZA 2NNNA 4BGDA 2NRAC 1FYLA 4G94A 4BXFA 6PAXA 4G12A 2Y0SA 2G7UA 1F4KA 4LB6B 3QOPA 3FXMA 4AWXB 4QSHA 4LIVA 5AONA 1Y8RB 2DJIA 3CC4I 3FXLA 1OFCX 1K78B 3ZQQA 2MW8A 5DD8A 3PO2J 2VQLA 3LSJA 2X6XA 1YX3A 2DDBA 1VQ4I 1PYVA 2QVOA 4BDYA 4AD9A 2XKOA 2W1OA 4HX4A 4PCQA 4PJNA 1JT6A 2JUGA 2P6TA 3HOTA 3BR0A 2NAZA 3R4KA 4P96A 4M6XA 3ZQLA 2DMNA 2DXIA 2IW5A 4HDUA 1Z1DA 1U2WA 2AS5F 1HKTA 4ZZDA 5KVRA 4HLYA 3E0JB 1S29A 1PJRA 2ZXWH 1XDUA 4A3EJ 1W5TA 2Y2ZA 3CCYA 2JA2A 4LG0B 4XSXF 4XM3A 5LHHA 3QODA 2HZDA 1SFUA 4ESJA 1EF4A 4B1RA 4XLPF 2O0YA 3S1QJ 4J01A 3C2HA 3K4LA 3ZQFA 4IRIA 4FTHA 2HR3A 1FP2A 2EFNA 1LVAA 4II2A 2CUZA 3ASOH 2F2EA 3SHFA 2XF6A 3S17J 1IXSB 4CYCA 4BE0A 4RGSA 2R7OA 4I6ZA 5J6XA 3PJRA 2PJRB 1RC9A 1G8XA 2LKPA 1KQ0A 3OYBA 2DO7A 2GOXB 3M8EA 4HX8A 4E7KA 4HW0A 4QLCU 3OYJA 2IVMA 2M3AA 5F04A 3RSNA 1T33A 2CQ7A 1HF0A 4DOZA 3BJ6A 1F5TA 3U9GA 4XKCA 4L0YB 1MKMA 3OY9A 3HOYJ 3KP6A 5E3LA 2CW7A 5CPRB 1HQCA 3N97A 3R0JA 1O4XA 2JVHA 2Y9YA 2ZCWA 5KAFC 1G3YA 1YJWI 2DA7A 3OL4A 3SZTA 2FOWA 4RLQA 3PNVA 2LBFB 3C2GA 2M9HA 3BG6A 1PP8F 1JKOC 2DI3A 3Q3SA 1OLTA 3VSLA 3IC7A 2V26A 2V7FA 1P2FA 3VWBA 1XSDA 2LP0A 3ELKA 5IYCJ 1Y0UA 2TDXA 1I6XA 2W4SA 3KZYA 1XX5A 1ZG5A 3GTMJ 2ZXHA 5M3FJ 1YIOA 4TV7A 3QU3A 4YIRX 2QM3A 2JZYA 2WAQA 2ZKZA 5GAHJ 3S3OA 3G3ZA 2WC2A 1ZARA 5K1YA 2XC7A 4OMYA 1OCTC 3T0YA 5LGTA 3OSGA 5FD6A 3I4MJ 2XGDA 3MQ0A 4W1UA 2XAHA 2OD5A 1I39A 1UFMA 2EIJH 2FBKA 4F93B 1W0UA 1I27A 1BM9A 3BR5A 3JTHA 4EM1A 4XIDA 2VXDA 1ORKA 4Y3OA 2JA7J 2YS9A 1LEBA 2EQRA 1HC8A 4RMNA 1A31A 4IHSA 3QP5A 4U88A 4DBRA 3BC8A 2Y0SN 4BUPA 3H9GA 5FLMJ 3RQ4A 4I09A 4HNTA 2Y48A 1FOKA 5FKLA 3E6CC 1ZR2A 3TOBA 1BR4A 5LGUA 3VFZA 1FIAA 4IHXA 1RETA 4ZYDA 2F5EA 3CC2I 2RAEA 2XF5A 4KIFA 2LYCA 2BY2A 2DMQA 1JXSA 4I0BA 3OS0A 1HDPA 1QRYA 2JMWA 2JN6A 5DCFA 4KN4X 1WI9A 3HEFA 1GHCA 2RV8A 2LSOA 3LA2A 1RNLA 2DQRA 3JRIA 4XORA 5FO5A 3EUHA 3UKGA 1D0XA 4X6AJ 1XB4A 3H0DA 2VQGA 4M9ZA 2EH3A 1JUMA 4OIQF 1MNMC 3PO3J 2OCEA 1ON1A 1XSVA 1ZN2A 2M7BA 1MIJA 5ILUA 1OCCH 3WGGA 1BW5A 2CQNA 1F9NA 4EJTA 3TO6A 2RKHA 1SMYF 3IRRA 3TOAA 4JX4A 5E3MA 3PSFA 3AL0B 3D0SA 3CCSI 2GM4A 5FKKA 2HVQA 4AVZA 1QGPA 2Z5UA 2DT5A 1ONVA 3JREA 1TL8A 2CGPA 4DZPA 1R58A 3TL4X 2I10A 2AXLA 3FXRA 2IS6A 2PEXA 2E7WA 2FF4A 1A5JA 3UR3C 2K85A 3QRFF 2FJ1A 3NARA 4W97A 3H5NA 1LDJA 2XPWA 2VN2A 1REPC 5LD2C 3MEXA 3NEUA 2FX0A 3OYNA 4MQ9F 2CV1A 2K9LA 2FMYA 5FKOA 1F43A 3D1NI 2BE5F 2ECBA 2OJED 2EK5A 2V1DA 1Z9CA 1EH8A 3EYYA 4S0HB 4UUSA 2OTLI 1J75A 3J7AY 2H1LA 5LGNA 2ID3A 2E35A 4AYBA 1IZ1A 4QWQA 2BEOA 3LFUA 2EIMH 1BOAA 1R5ID 5D4RA 4ZTFA 1GDTA 4IZZA 1FC3A 2B7EA 3KX2A 3H3VK 3ZXSA 1DGWY 2BW3A 4ZDPA 1ETYA 3H9JA 4PFPA 3CQZJ 3W6VA 2WAFA 3BG7A 2MC3A 3HUGA 3ZQGA 1EV7A 3HHHA 5ICGA 2VBWA 1NG7A 4BXUA 5C3EJ 4X0GA 2QQ8A 3MVPA 4PJJA 1ZRFA 1O7FA 2YX7A 4HSRA 3VODA 1B8IA 5B1AH 2MH2A 2JRTA 5B1BH 5GTHC 5H6RA 1U3EM 3BOQA 1OR7A 4GYGA 5TRDA 1H8AC 1FEXA 3W3CA 4KT5C 2FXAA 3BY6A 1DQUA 4XQFA 1BN5A 3AG4H 2L02A 4HBLA 4YIFA 5CQEA 3REOA 4NBQA 2KIUA 1VI0A 3DPLC 3I59A 2DU9A 1QHGA 2ZNYA 2XASA 3G1LA 3I0TA 1SAXA 2JA5J 1ZREA 3ZP5A 3M8JA 2JRMA 2HXOA 3FISA 2PBIA 1YX5A 3IWZA 4WXHA 1BW6A 4X1EA 1MMDA 5LEJA 3HPGA 3QU6A 4L5EA 2LTPA 2OUMA 4HAMA 1R9TJ 3IP4B 3FBNB 2F5CA 2HOEA 4QPQA 1DDNA 1QPMA 3T1BA 2OZUA 3HIFA 4JX5A 4B44A 4EQQA 1VQ5I 4EJVA 5JVTA 2MH9A 5KNLA 3L2VA 2FOKA 2IGOA 3WE3A 2V79A 4V19K 2DK5A 5FFZA 2O9LA 1FMVA 1YTYA 2Y75A 1T98A 3PIPF 1IG7A 2HKXA 3GW2A 2V6CA 3WTUC 2VIXA 1YLFA 1IN5A 3HSEA 2L01A 3CJRB 1IRGA 4IHYA 2IA1A 2BBYA 4E70A 5EG0B 4HSTA 2CUFA 3MN2A 2R7FA 2R5ZB 1R1VA 2V1NA 2GXGA 4M3DA 5FLXK 3FMSA 2IGNA 3SDBA 2JK3A 4YRVA 4EGYA 3K0LA 1B72B 4BHPA 3C7JA 3I4PA 2ADUA 1NK2P 3L2UA 4CCNA 1S7OA 1EJ9A 1AKHB 4EJUA 1WSUA 2LG4A 4OU0A 2IRFG 3J7YJ 3DBRB 3BPXA 4WXDA 1WPKA 1MBJA 3FXJA 1POGA 2IGMA 1DP3A 2FD5A 1P7IA 2DYSH 3OYGA 2F5VA 2ZNZA 4YFNF 1HW2A 4F92B 4HZFA 3PIOF 1S5LC 1IN8A 3CP8A 3TO7A 1BC7C 2JT1A 1H88C 4PGGA 1U9OA 5DCMB 3RPQA 3WTZA 3QPLA 4XKVA 3V8KA 3LSHA 3DEUA 5CVUA 3AFHA 5J47A 3B73A 4G9YA 1YRNB 4CDGA 1X1AA 1XC5A 4UVBA 3S32A 1Y1WJ 3C2BA 3HOXJ 1TNTA 3DEEA 2DN0A 3LNQA 4MFDA 5ICEA 2OQRA 1FYMA 4AYBN 5HLIA 1SAUA 3GX4X 2W57A 4BU2A 2Q2EB 2HZTA 3GUDA 4QTRA 3UNGC 3WU1B 2DDAA 3KP3A 4RAYA 1TWCJ 2PX9A 1J59A 1ZK8A 2HEOA 3G1OA 2K9SA 3ROUA 3I71A 3RKXA 1B9MA 2O03A 5IOZA 1YO5C 2K3PA 2DA4A 1J7KA 1TT5B 2HQAA 1D1BA 3LSTA 4LGWA 1MGTA 3HXLA 2OBPA 3FXOA 1F1ZA 3KEOA 4NHJA 4O3MA 4S04A 1Y6IA 2Q0OA 1YW7A 5KAIC 3F8MA 2DA2A 1MBGA 2A05A 3GWZA 1G6NA 3IUOA 4RAGA 3BG5A 2HGCA 1VQ9I 3MFKA 3NQOA 1FBSA 5HVQC 3GZ6A 1D5VA 2DT7B 2L4AA 1PUEE 1U8BA 2PMUA 3ZQHA 1OCRH 3L00A 2DPUA 1IO2A 1IV8A 3LQQA 4UVAA 4LK0F 1B6AA 1ZR4A 4BS9A 3BROA 4GXOA 3MWMA 2LOOA 3QPTA 4NQWA 1ZQ3P 1KQ8A 3ECHA 4C2UA 4OOIA 3RPUD 1W5SA 3KFWX 1BBYA 3BG3A 4WF2A 4IHWA 1T56A 3JAMK 2X9DA 3KZZA 3AG1H 1KU2A 5CJ9A 2DFEA 4IKFA 1WJDA 3FXQA 1WCMJ 2LY1A 3GZ5A 5GAEJ 3S16J 1LE8B 1OKRA 2CV0A 4BQOA 4UHTA 4HQMA 1TQPA 2R93J 2VKVA 3KCCA 3OS1A 2L5QA 3HKZA 3MAJA 1TZLA 2GXAA 5E79C 2GIZA 2Q8KA 1RKWA 1XMXA 3ESWB 2PMZN 3TP3A 2QYOA 3VOEA 1G3SA 3L1PA 4HF0A 2HYGD 2DA5A 5CVIA 4H0EA 2WAEA 4FT8A 4LB5A 4QIWN 3BR3A 1LJ9A 3KYDB 4GGGA 2KL4A 3SXYA 4A0YA 1K61A 1R1TA 2EZIA 1SVOA 4M9XA 1OYYA 3H5AA 3MMYB 4ZH4F 4MHGA 2X51A 4JP0A 3P5JA 4I98B 1JGSA 3S2WA 4YELA 4UVCA 4WXCA 3F8CA 2KHMA 2XROA 1Z21A 2BGCA 2FNAA 2O8KA 3RIRA 5FROA 5HODA 3F22A 3OYEA 2KFDA 4IRHA 2RGVA 1X4PA 2QWWA 1PUFB 3R60A 1D0YA 1OISA 3TQNA 1MDMB 1JUPA 2NVTJ 2V1XA 4XKWA 2FUG2 3TGNA 2LY2A 1U78A 2W25A 1MMAA 2L9RA 1VQ7I 2QA4I 2CRGA 3ZMVA 1QHHD 1ZLJA 4F52A 2R7TA 2K4BA 3PUFA 4JYKA 2P81A 5GTIC 4ABZA 2IS1A 5C4XJ 3G4SI 1UJ8A 3J80Z 4AUXA 5IY5H 1JTYA 5F08A 3CTAA 3HYIA 1JGGA 1UHWA 1DPRA 2AO9A 4HF2A 1S7EA 2EFWA 2X6YA 2VC0A 3PFYA 4RB0A 1MJ9A 1AU7A 1OQYA 2KT0A 1W7PB 5D5UB 4KN7X 4CYDA 1TTYA 1TP4A 3BWGA 2ZMEC 3JRHA 4A3GJ 2L7MP 1OYWA 2L2OA 2YR2A 4PK4A 1JT0A 2XPUA 1SANA 2J5PA 3RI4A 3GYHX 1HW1A 2JPBA 1YW8A 2Y0MA 2WA0A 4V2FA 1EKEA 2R4GA 2NS0A 5E17F 5FKNA 1JE8A 1R49A 2RDPA 1D8JA 2Z1DA 4KIBA 4LITA 3S1MJ 1CQTA 1WH5A 2LNBA 1ITYA 3V7SA 1BI0A 2E2JJ 2STTA 3CF2A 1Z7UA 2BVMA 1TWHJ 2E1OA 1X3ZB 2XB5A 1P4WA 2LLKA 1Q1HA 2M0MA 1SEUA 3VYTB 1O3RA 3H36A 1XPXA 1TWFJ 3BJAA 2E1MC 4IQ4A 1K78A 2KP6A 5LRSA 2M7AA 3NAUA 4Y7NJ 1VNDA 2BHYA 4BJ5C 4C2TA 3K4KA 2OV7A 3CMMA 1V4RA 4A0ZA 1IJWC 4Y13A 3QOEA 1R7JA 4G6TB 3RTRA 2A07F 4XLAA 2D1HA 1FOWA 3SYTA 1VQ8I 1E0EA 2VPRA 2VJ5A 3A2KA 3CD6I 1QQIA 4BQNA 1SVMA 5IP6A 4J19A 3LAJA 4I2OA 1NH3A 5HNHA 2DTZA 3MZYA 1KONA 3I55I 5EDNA 3CDIA 1VQ6I 2BHZA 1T39A 1K7AA 4NC8A 3LSGA 3QPSA 5L3GA 2Z9OA 4LG0A 1BI1A 2W82A 3ONQA 4YFKF 1BC8C 2AXTC 4OINF 3E7LA 1LEAA 3F8FA 1CF7B 1YIJI 1G4DA 1MZBA 5HDNA 2R7QA 2W84A 4KDPA 2VBYA 2WV0A 2P5KA 5LEKA 2UWMA 3DTEA 2LK2A 5B66C 1E3OC 5F27A 5KK1A 3M07A 4HQEA 1MNDA 5CVJA 4KMUX 3PFIA 3CCJI 2XPVA 4LK1F 4N9IA 4MEXF 2VKHA 5EJCA 3IH4A 1FIPA 3JRDA 5DS9A 3CJQB 4XL9A 3ASNH 3Q9SA 2QEXI 3CUQB 3HRSA 5DYMA 1V54H 4A6EA 3J81Z 1KU7A 1GXQA 2RQPA 3IWFA 4UY8I 1KYZA 3OYDA 2NOGA 5AIQA 1N25A 4XK4A 3JRGA 1XGNA 2FA5A 2QENA 2XIGA 2ME6A 1UMQA 3R61A 2H6CA 2ZSIB 3Q9VA 1D0ZA 3E6DA 2HVSA 3LL7A 2GIVA 1X4OA 2KRHA 1DU6A 1N75A 4DNCA 3DCFA 5EGOB 1JI8A 1IRFA 1R4MB 2CYYA 4ZYGA 1Z6RA 3F8BA 1USTA 4RLFA 1Y39A 4BEHB 3O6BB 2ELJA 4ZDLA 1FSHA 2LBFA 2L4MA 3LFKA 3E1SA 3GTGJ 4JQFA 4XRFA 4CA0A 3S8PA 4Q4ZF 3T5XA 4LG3A 1FSEA 4A3IJ 1HA8A 2A5YB 3F6OA 3HC7A 4Y4RA 2XF7A 1KGSA 3DLLF 2OAZA 2JA8J 1MBKA 1JKPC 3JW4A 4P9UA 3BTJA 5F0CA 1TWGJ 2V1UA 3I53A 5K5OA 1QU3A 2ZXJA 3NWSA 3GVAA 2BYVE 3L2RA 3GF2A 4F7ZA 2PFBA 3OYFA 1X1DA 1QNTA 2E36A 1BOBA 1P6RA 2DTRA 4M72A 3BJOA 1FTTA 2PI0A 2O8XA 5KHDA 2O7OA 4BXXJ 3DFGA 2R0QC 4E7SA 5BPDA 3P9CA 4I02A 3DEWA 2ZJ2A 3VPRA 3LQRA 1W5CC 4CHUA 1STZA 1UCRA 1YYVA 2MLKA 4U0YA 1X1PA 4I7HA 1XGMA 4JK1X 5L3CA 3F3XA 2XB0X 2ECCA 1VFCA 4Z2YA 2FBIA 4Y17A 3E5UA 4M3GA 3QPHA 4OMZA 2X1EA 5JI6A 2GQQA 3C3WA 3TW7A 2M30A 2VUMJ 3MKYB 1OCPA 2LMDA 2UZKA 5FJ8J 2P5LC 1FMWA 3LAPA 1IUYA 5HLTA 3M4OJ 4HRIA 4KFCA 1XG1A 4BE1A 2O5RA 3OR2C 4A3LJ 3A01B 5E3OA 2R7RA 1I1SA 2IEKA 4BJTA 5JVGF 2OC6A 1V5EA 1SD4A 1WQ2A 2K7LA 2R92J 1J9IA 3AKZA 3LWFA 4NB5A 4C9YA 1UAAA 3ZQCA 3BLYA 4BAYA 4MO7A 2QKMB 4E4HA 2LR8A 4BL0B 2E2IJ 4I0AA 3C1DA 3W6KB 3CESA 3U1DA 3O8HA 2B9SA 5ILSA 1WI3A 1HCRA 4BE2A 1TT0A 1QZYA 3CCLI 1SVLA 5LRRA 3K70D 1SFXA 3ABKH 3EUHC 3I64A 2EINH 3CO7C 2EWNA 2D5VA 1T2KA 1QA6A 2FE3A 4BY7J 5F6FA 4WK8F 5EEGA 2RQQA 2STWA 1QO0D 4XLCA 4XLFA 1GV2A 5E20A 3H0GJ 1G59A 4GRIA 3NRVA 3M1EA 3EUKL 2NVQJ 1FP1D 4DZJA 2HPMA 5B3SH 2EIKH 4EM2A 1A6IA 1S3JA 4XOTA 4CZCA 5ED4A 3IRQA 1HKQA 3FMQA 3ZQ7A 2BY0A 3WODF 1E3HA 2X48A 3RQIA 1ODDA 5HNFA 4BBSJ 2CJJA 3HHGA 3AG3H 4RS8A 2H27A 2R7XA 3OYLA 5FRNA 4M3BA 2ZXIA 4HLXA 1E2XA 1YG2A 2KQRA 1XCBA 2CWEA 3M8FA 2EZLA 1HW5A 3I5UA 4A3CJ 2QQ9A 3TKYA 1G3TA 3K6GA 1ZYRF 3GFIA 4G7ZF 4NUBA 3RJPA 1S6LA 3KETA 4CCMA 3WTTC 3QYFA 2A6HF 4UB6C 1T0FA 2E5ZA 1K79A 3PNTA 4KYWA 2YU3A 1D1CA 4DIQA 5BPIA 5E1XA 1R23A 3DKXA 1TWAJ 4P9FA 3FXUA 2V4JC 2R5YA 1FT9A 4ZYEA 3F6VA 3GEZA 2XVCA 4A6DA 3W2WA 2IJLA 1EH6A 1WVRA 3S14J 1MH4A 3H92A 1TQMA 3HRMA 4MTDA 2K27A 4F3QA 4S05A 4CUGA 5EF6A 2ZB9A 3WTYC 1KA8A 1ZKGA 4AVPA 4PZJA 1NK3P 2A3SA 1USSA 4RGXA 3H9QA 5EZHA 2WAQN 3G2BA 1WRJA 4HF1A 5HLGA 1OR7C 1IN7A 3I9V2 1FZPB 4ZJZA 4BACA 3QYEA 4GDFA 5E3NA 5E1ZB 2GZWA 1I3QJ 2B63J 2KRFA 1U6GA 3IV5A 3LA7A 4M6VA 2XSDC 4HDVA 1LKXA 2E71A 9ANTA 3JRFA 1UB9A 4FCYA 4FE4A 5EG0A 1HDDC 3EPZA 2P7CB 1T95A 4Y33A 5J4YA 4G7OF 1F36A 2KIMA 2KJCA 2WV1A 1WHUA 4CZZA 4C3IJ 1ZGWA 2R5ZA 3FM5A 4RGRA 5IP9J 3I4NJ 2HQRA 2MLGA 5A2QK 4E7ZA 1X2MA 4E7LA 1B72A 4CH7A 2DK8A 3VYSB 4ZYHA 1XS9A 4KJZA 1BI2A 4BH9A 2NXNB 3N05A 3BZCA 2EA2A 1MBFA 2FU4A 3OMYA 4Y15A 1I6HJ 2LRDA 2Y31A 2KIFA 4ETSA 3VB2A 1B9NA 3IAM2 3GBGA 3S2DJ 4R79A 1X3UA 1OMIA 3CF5F 1J09A 3S1RJ 3H3UA 3SFIA 2ISZA 5IT9K 3HTUA 5D4SA 4KA4A 5CVVA 3ZMSA 5JHUA 1IXCA 1XGOA 2CQXA 2WB1A 3WHCA 4XSZF 3E5XA 2AHQA 3CMYA 4L5IA 2VC1A 2XHKA 5DCMA 1QPIA 3F8NA 1N78A 1X58A 3FK6A 3ZGKA 3HJEA 2G7HA 3IH3A 5BMZA 1YRNA 1XMAA 4LJZF 2KPMA 2HTJA 2MSYA 2YPRA 3ZMTA 2A5WA 2P5VA 1YHQI 5HOOA 1W1WE 1IGNA 2GOMA 2DA1A 2Z99A 4IPAA 4N4OB 1WJBA 3LSIA 2Q2EA 4M74A 1Y56A 2HVRA 3RZOJ 2LFBA 4RB3C 3GFMA 1UHSA 2DMUA 3M9AA 2R7WA 4G7HF 1R22A 2HFHA 3GMEA 4A12A 2P4WA 3ZN0A 1A35A 1YOVB 2L7KA 2ZJPF 2K9MA 2L54A 3KEYA 4U0VA 4B8XA 4IEJA 1RIOH 1K6OA 2DFIA 1H89C 1IDYA 4DBQA 4CCOA 1ETVA 3B02A 1ZGAA 1TC3C 3HOZJ 1FOYA 3FXKA 3J81K 1IRXA 3CO6C 1GXPA 1W4MA 4CCKA 5DM6F 3RKYA 2RNGA 1Z3XA 3WU0A 3I56I 1GLNA 1IN4A 1R6RA 4XBFA 4IQJA 1XCVA 1LDDA 1L3LA 3OYIA 2K40A 2V9VA 2HOTA 2GA2A 2L7FP 2NS7A 1UHMA 3AG2H 4M9SA 4YG2F 2RVCA 1ZRCA 3PQKA 1M1EB 3C18A 3L9FA 3HSFA 4I01A 5F0HA 2OCCH 2EJRA 3GTOJ 1RKTA 2HU9A 3H3ZA 4RB2C
chains in the Genus database with same CATH topology
5ILVA 4KNYA 1ZH5A 2COMA 5D5XB 1T38A 3FMRA 4WWCA 5D6EA 5LHIA 1O3TA 2G9WA 3GO5A 2LDUA 2QQAA 1HKSA 5E1WA 1HSJA 1SFEA 3ISPA 3K1PA 5K5RA 2YX4A 4EGZA 2LF8A 3RDIA 4L9TA 3ABTA 3K9TA 3DV8A 2CW0F 4IJAA 2P8TA 2XAGA 3ZPLA 3HRTA 4LLGF 1J0RA 5J8CA 3EETA 2ESHA 2NYXA 2VE8A 2UXNA 4BNCA 2OQGA 1W7PD 2F5DA 3F21A 3F23A 1RI7A 3V7RA 2K02A 3BDDA 4ENJA 4A2UA 1MDMA 3R6SA 1IF1A 2EFOA 5L3DA 3K2ZA 1TW2A 1JHFA 4PDKA 1L0OC 4A0XA 5FD5A 4FHTA 3TDUC 2HDCA 3RPUA 4LLLA 4HYEA 4R1HA 1D3YA 5HS9A 3HTSB 2ZO4A 2B0LA 2KJBA 1FBQA 2EV0A 2DQLA 4MTEA 4DQ2A 1LNWA 4MEYF 3WGHA 2QBYA 3K1MA 1DUXC 2ZBKA 3DQVC 4RB1A 1MD0A 2OZ6A 4EJWA 1FLIA 3FWEA 3WTVC 1CGPA 2F5FA 4KUMA 1J5YA 1NHAA 2KKOA 2LF7A 1KU9A 1KQ9A 1XGSA 1XDSA 4B09A 1OPCA 3KP7A 1U5TA 1H0MA 2JTVA 5AIPA 2XV4S 3E97A 4AIKA 3L09A 2QQBA 4CO8A 2FRHA 3HOSA 2MA3A 1IW7F 4WX9A 5IT3A 2IA0A 1BIBA 4EMSA 4O5VA 3E5QA 1B59A 3OV8A 4LFUA 2JPCA 1O3SA 2A68F 1Z91A 2CFXA 2IT0A 5HDKA 2ESNA 4CGZA 1JHHA 4BQAA 2MBFA 2EFQA 1SMTA 3MCZA 2ZMEB 1XSXA 2GAUA 3COAC 3CDHA 3WGIA 3P7NA 3DXJF 4YFXF 2DBBA 2XUBA 1S7AA 5FLXZ 3AAFA 3RYRA 1XD7A 2L3DA 5DD4A 1H9TA 1BJAA 4LD5A 1A04A 4R8HA 5HS7A 2X0LA 1FNNA 3BZ6A 4N0BA 4AIHA 3V4GA 1ULYA 4IRGA 3K1NA 4HV5A 3G73A 1FX7A 2HYFA 1SD5A 1PP7U 1RZ4A 3K69A 3WG9A 1D8KA 5FFXA 2O6GE 4KMFA 3P9IA 1B1BA 4OIRF 4EV0A 3DPTA 3E6MA 1Z05A 3DF8A 1XN7A 3ZMDA 1IN6A 2E1NA 1KYWA 4RGUA 3FHZA 2X4HA 2E1CA 5CVRA 2FSWA 4EVIA 2XKPA 3FX3A 1ON2A 2RN7A 3V7CA 2VBZA 4IXAA 5H20A 4ON0A 4M71A 2IA2A 3WE2A 2A69F 4L9NA 2NNYA 2CG4A 2VT2A 4IF4A 2R7DA 2FQ3A 4ASNA 5TJJA 2K86A 5DUIA 5HS8A 1HXDA 3ZMZA 4HX7A 5K5QA 5E18F 3KLNA 3JAMZ 2CQKA 1ZHFA 1G3WA 5CYVA 1PDNC 4M6YA 2RNJA 1IXRC 4O6JA 4ENMA 4U0WA 2Z3YA 5DDGA 4KICA 2XAQA 3T8RA 1LDKB 4KIGA 5F64A 1FYKA 2GWRA 5D8LB 4G6DA 1MJAA 3F72A 1GVJA 2OA4A 3LA3A 2XRNA 4BHCA 5HLHA 1P4AA 5DV5A 2M45A 4JBAA 3ERED 2W85A 2UXXA 2RC4A 1ZRDA 2M1BA 2O3FA 5FB2A 2WWYA 3L7WA 4UNOA 1EH7A 2PJPA 2GXBA 5HDGA 2E7XA 2FBHA 1BIAA 2FNPA 3SFZA 2VOOA 4L5JA 3E3VA 1E17A 4AIJA 2D2WA 2XGXA 3FM3A 1YS6A 3EYIA 1LQ1A 2DAOA 1TW3A 4IVNA 4UV8A 1WKMA 5DEQA 1H9GA 3FZVA 5L3FA 4HV6A 4N9HA 5JR3A 3J7AO 4WCGA 3J80K 2ISYA 3CLOA 2D1VA 2VE9A 4UXNA 4ZZLA 1FY7A 3N4MA 4LMYA 5J8FA 2PG4A 2VODA 3ZN1A 4Q47A 5JFRA 3HRUA 2EV5A 4MGRA 4U7BA 4EM0B 4G6QA 2XAJA 2JSCA 4GYIA 4UV9A 1RUNA 1YQAA 1HSTA 1LB2A 5F1RA 1S8NA 3BPVA 1FPQA 3O2PE 3DKWA 5L3BA 4EJOA 2XAFA 2IPQX 5ICCA 5LLQA 3Q5FA 1TQIA 3W6JB 1TNSA 2W24A 2VONA 1R00A 3IHUA 2VOPA 2MD5A 2IP2A 5E8IA 3QP6A 4P55A 4OIPF 3KEQA 2DLLA 3DP7A 3RYPA 3E6BA 3I59B 4MNUA 1AOYA 4Q48A 2M5WA 1C0WA 3ULQB 1ZAOA 1T6SA 3JSPA 2ACJA 4CXFA 1I5ZA 3MZHA 1O57A 3IKVA 1ZLKA 4L9JA 3L2CA 2M8EA 3GLXA 3CJNA 2YSRA 3U2RA 5D5VB 2H94A 4D0PA 2VBXA 2J5OA 1YFHA 3ML6A 4UUVA 1ZG1A 5D8KB 4L18B 2C6YA 4MQVA 3GFLA 3IL2A 1TLHB 1U8RA 2HKOA 2H6BA 3BP8A 1MJBA 2P6SA 2ETHA 1WWXA 3WTWC 1R5HA 2A61A 4GCVA 5L3EA 1FBUA 1XMKA 3RKWA 3SQNA 1P92A 4FX0A 4XLNF 2ZFWA 3WTSC 4ESBA 4P5OA 3QAHA 4FX4A 5BS6A 4ENNA 3GXOA 4BHBA 3IKTA 1O3QA 3JTGA 2R3SA 5ICFA 1V3FA 4G8XA 3TO9A 1YW9A 5D6FA 3VEPA 1R36A 5D5WB 2WTEA 2VT3A 5DUKA 1IAWA 1Z6TA 2CSOA 4ENKA 1P4XA 2EV6A 1HBXG 2QZ8A 4HA8A 2ELHA 2HTSA 3WTXC 3I58A 3PQJA 1I1GA 3M7GA 5E8GA 2K4JA 1DP7P 3SZPA 2P7VB 2DPDA 4BYYA 2GA1A 5H6QA 2Z33A 4HOBA 4LLNA 1ZG3A 2FMLA 5BOXA 5LHGA 2OU2A 2O61A 4YIIA 1QBJA 1B4AA 4K2EA 3KP5A 1SD6A 2QLZA 3I54A 4L0ZB 1W7PA 5ERIA 4Q5SF 2EA4A 3TDZC 1BI3A 4L9VA 1R1UA 1O7LA 1J2XA 3R0AA 4GO1A 2A6EF 2PMHA 1R5GA 1ZGJA 2EFPA 1RUOA 1OYIA 3KLOA 3D5LA 5LBQA 1SD7A 3KE2A 1DPUA 3EDPA 1YS7A 5BQTA 2BV6A 3GFJA 2FEZA 2DW4A 1U5TC 5FGMA 3ABUA 4OIOF 2PLYA 1KU3A 2ZMEA 2PN6A 4A5MA 3HSRA 1VTNC 4RAZA 3ECOA 4IHTA 3V8LA 4ESFA 2CO5A 3JSOA 2QUFA 3ZMUA 2HQNA 3T8TA 2QBYB 1CF7A 2PQ8A 2EB7A 2VXZA 4U7DA 1AWCA 5A2QZ 3OOPA 3V8JA 2H09A 4PGHA 1TBXA 3O3KA 3EQLF 4CICA 2D45A 2HS5A 3CUOA 2HWVA 5EEHA 3KP2A 3FF5A 3KP4A 2M87A 4M73A 3CUQA 1QZZA 5CLSA 1U5TB 1FWZA 5IT9Z 4A5NA 3CUQC 3P9KA 2NNNA 2NRAC 1FYLA 4G94A 6PAXA 2G7UA 1F4KA 4LB6B 3QOPA 4AWXB 5AONA 1K78B 5DD8A 2QVOA 4AD9A 2XKOA 4HX4A 4PCQA 2P6TA 3HOTA 2NAZA 3R4KA 4P96A 4M6XA 2IW5A 4HDUA 1Z1DA 1U2WA 2AS5F 1HKTA 4ZZDA 5KVRA 4HLYA 1S29A 1XDUA 1W5TA 4LG0B 4XSXF 5LHHA 1SFUA 4ESJA 4XLPF 2O0YA 4IRIA 2HR3A 1FP2A 2EFNA 1LVAA 2F2EA 3SHFA 1IXSB 4RGSA 5J6XA 2LKPA 1KQ0A 2DO7A 3M8EA 4HX8A 4HW0A 4QLCU 2IVMA 3BJ6A 1F5TA 3U9GA 4L0YB 1MKMA 3KP6A 1HQCA 3N97A 3R0JA 2ZCWA 1G3YA 3SZTA 1PP8F 2DI3A 3IC7A 1P2FA 1XSDA 3ELKA 1Y0UA 2TDXA 1I6XA 3KZYA 1ZG5A 1YIOA 4TV7A 3QU3A 2QM3A 2JZYA 2ZKZA 3G3ZA 2WC2A 1ZARA 5K1YA 4OMYA 3T0YA 5LGTA 5FD6A 3MQ0A 2XAHA 2OD5A 1UFMA 2FBKA 1I27A 1BM9A 3JTHA 4EM1A 1LEBA 4IHSA 3QP5A 4U88A 4I09A 1FOKA 2Y48A 3E6CC 3TOBA 5LGUA 3VFZA 4ZYDA 2F5EA 4KIFA 1JXSA 4I0BA 5DCFA 4KN4X 1WI9A 1GHCA 2RV8A 2LSOA 3LA2A 1RNLA 2DQRA 5FO5A 3EUHA 1XB4A 4M9ZA 4OIQF 1ON1A 1XSVA 1ZN2A 5ILUA 3WGGA 1F9NA 4EJTA 3TO6A 2RKHA 1SMYF 3IRRA 3TOAA 3D0SA 1QGPA 2Z5UA 2DT5A 1ONVA 2CGPA 1R58A 2AXLA 3FXRA 2PEXA 2E7WA 2FF4A 3QRFF 1LDJA 2VN2A 1REPC 3MEXA 3NEUA 4MQ9F 2FMYA 2BE5F 2EK5A 2V1DA 1Z9CA 1EH8A 3EYYA 1J75A 5LGNA 1IZ1A 4QWQA 2BEOA 1BOAA 5D4RA 1FC3A 2MC3A 3HUGA 1EV7A 3HHHA 5ICGA 2VBWA 4BXUA 1ZRFA 1O7FA 2YX7A 3VODA 2MH2A 2JRTA 5H6RA 1U3EM 3BOQA 1OR7A 4GYGA 5TRDA 4KT5C 2FXAA 3BY6A 1BN5A 2L02A 4HBLA 4YIFA 3REOA 2KIUA 3DPLC 3I59A 2DU9A 2ZNYA 2XASA 3I0TA 1SAXA 1ZREA 3ZP5A 4WXHA 3IWZA 2PBIA 5LEJA 3QU6A 4HAMA 2F5CA 2HOEA 1DDNA 1QPMA 3T1BA 2OZUA 3HIFA 4EQQA 4EJVA 5JVTA 2MH9A 2FOKA 3WE3A 2V79A 2DK5A 5FFZA 1YTYA 2Y75A 1T98A 2HKXA 3GW2A 2V6CA 3WTUC 1YLFA 1IN5A 3HSEA 2L01A 1IRGA 2IA1A 2BBYA 4E70A 2R7FA 1R1VA 2GXGA 5FLXK 3FMSA 4EGYA 3K0LA 4BHPA 3C7JA 3I4PA 2ADUA 1S7OA 4EJUA 1WSUA 2IRFG 4OU0A 3BPXA 4WXDA 2ZNZA 4YFNF 1HW2A 4HZFA 1IN8A 3TO7A 1BC7C 2JT1A 4PGGA 5DCMB 3RPQA 3WTZA 3V8KA 3DEUA 5CVUA 3B73A 4G9YA 4CDGA 4UVBA 1TNTA 5ICEA 2OQRA 1FYMA 5HLIA 3GX4X 2W57A 2HZTA 3GUDA 3WU1B 3KP3A 4RAYA 1J59A 2HEOA 3ROUA 3I71A 3RKXA 1B9MA 2O03A 1YO5C 1J7KA 3LSTA 4LGWA 1MGTA 2OBPA 4NHJA 1F1ZA 3KEOA 4O3MA 4S04A 2Q0OA 1YW7A 3F8MA 3GWZA 1G6NA 2HGCA 3MFKA 3NQOA 1FBSA 5HVQC 3GZ6A 1D5VA 2L4AA 1PUEE 2PMUA 3L00A 2DPUA 3LQQA 4UVAA 4LK0F 1B6AA 3BROA 4GXOA 3MWMA 3QPTA 4NQWA 1KQ8A 3ECHA 4OOIA 1W5SA 3KFWX 1BBYA 4WF2A 3JAMK 3KZZA 1KU2A 5CJ9A 3FXQA 3GZ5A 1OKRA 4UHTA 4HQMA 1TQPA 3KCCA 3MAJA 2Q8KA 2QYOA 3VOEA 1G3SA 4H0EA 4HF0A 2HYGD 5CVIA 4FT8A 4LB5A 1LJ9A 4GGGA 3SXYA 4A0YA 1R1TA 4M9XA 1OYYA 4ZH4F 4MHGA 4I98B 1JGSA 3S2WA 4UVCA 4WXCA 3F8CA 2XROA 2BGCA 2FNAA 3RIRA 3F22A 4IRHA 2RGVA 2QWWA 3R60A 3TQNA 1MDMB 2V1XA 3TGNA 1U78A 2W25A 3ZMVA 1ZLJA 2K4BA 3J80Z 3CTAA 3HYIA 1UHWA 1DPRA 4HF2A 2EFWA 2VC0A 4RB0A 1MJ9A 1W7PB 5D5UB 4KN7X 4CYDA 1TTYA 3BWGA 1OYWA 2YR2A 2J5PA 3RI4A 3GYHX 1HW1A 2JPBA 1YW8A 2Y0MA 2NS0A 5E17F 1JE8A 2RDPA 1D8JA 4KIBA 2LNBA 3V7SA 1BI0A 2STTA 1Z7UA 1P4WA 1Q1HA 1O3RA 3BJAA 1K78A 5LRSA 1V4RA 4A0ZA 4Y13A 1R7JA 3RTRA 2A07F 2D1HA 1QQIA 3LAJA 4I2OA 3MZYA 1T39A 1K7AA 5L3GA 2Z9OA 4LG0A 1BI1A 4YFKF 1BC8C 4OINF 1LEAA 3F8FA 1CF7B 1G4DA 1MZBA 5HDNA 2W84A 4KDPA 2VBYA 2WV0A 2P5KA 5LEKA 2UWMA 5KK1A 4HQEA 5CVJA 4KMUX 3PFIA 4LK1F 4N9IA 4MEXF 3Q9SA 3CUQB 3HRSA 5DYMA 4A6EA 3J81Z 1KU7A 1GXQA 2RQPA 3IWFA 1KYZA 5AIQA 1XGNA 2FA5A 2QENA 2XIGA 3R61A 2H6CA 3Q9VA 3E6DA 2GIVA 4DNCA 1IRFA 2CYYA 4ZYGA 1Z6RA 3F8BA 1USTA 3O6BB 1FSHA 2L4MA 3LFKA 4JQFA 4XRFA 4Q4ZF 3T5XA 1FSEA 2A5YB 3F6OA 1KGSA 2OAZA 3JW4A 4P9UA 2V1UA 3I53A 5K5OA 2ZXJA 3GVAA 2BYVE 3GF2A 4F7ZA 2PFBA 1QNTA 4M72A 2DTRA 1P6RA 3BJOA 2PI0A 2O8XA 3DFGA 5BPDA 3P9CA 4I02A 2ZJ2A 3LQRA 4CHUA 1STZA 1UCRA 1YYVA 2MLKA 4U0YA 4I7HA 1XGMA 4JK1X 5L3CA 3F3XA 4Z2YA 2FBIA 4Y17A 3E5UA 3QPHA 4OMZA 5JI6A 2GQQA 3C3WA 2M30A 2UZKA 2P5LC 3LAPA 1IUYA 4KFCA 1I1SA 1SD4A 1WQ2A 2K7LA 1J9IA 3LWFA 4NB5A 4BAYA 4I0AA 3C1DA 3W6KB 3U1DA 5ILSA 1QZYA 5LRRA 1SFXA 3I64A 3CO7C 2EWNA 1T2KA 2FE3A 5F6FA 4WK8F 5EEGA 2STWA 1QO0D 5E20A 3NRVA 3M1EA 1FP1D 4EM2A 1S3JA 5ED4A 3IRQA 1HKQA 3FMQA 3ZQ7A 3WODF 1ODDA 3HHGA 2H27A 4RS8A 4HLXA 1E2XA 1YG2A 1XCBA 2CWEA 3M8FA 3I5UA 1HW5A 2QQ9A 3TKYA 1G3TA 4G7ZF 1ZYRF 3GFIA 3RJPA 1S6LA 3KETA 3WTTC 2A6HF 1T0FA 1K79A 4KYWA 2YU3A 5BPIA 5E1XA 1R23A 4P9FA 3FXUA 1FT9A 4ZYEA 3F6VA 3GEZA 2XVCA 4A6DA 2IJLA 1EH6A 3H92A 1TQMA 3HRMA 4MTDA 2K27A 4S05A 3WTYC 1KA8A 4AVPA 4PZJA 2A3SA 1USSA 4RGXA 4HF1A 1WRJA 5HLGA 1IN7A 1FZPB 5E1ZB 2GZWA 2KRFA 1U6GA 4HDVA 3LA7A 1UB9A 2P7CB 4G7OF 2KIMA 4CZZA 2KJCA 3FM5A 4RGRA 2HQRA 2MLGA 5A2QK 2DK8A 4ZYHA 1BI2A 4BH9A 2EA2A 2FU4A 4Y15A 2KIFA 4ETSA 3VB2A 1B9NA 4R79A 1X3UA 1OMIA 3H3UA 2ISZA 5IT9K 3HTUA 5D4SA 4KA4A 5CVVA 3ZMSA 5JHUA 1IXCA 1XGOA 4XSZF 3E5XA 4L5IA 2VC1A 2XHKA 5DCMA 3F8NA 2G7HA 5BMZA 1XMAA 4LJZF 2HTJA 3ZMTA 2YPRA 2P5VA 5HOOA 2Z99A 4IPAA 2Q2EA 4M74A 4RB3C 3GFMA 3M9AA 4G7HF 1R22A 2HFHA 4A12A 2P4WA 3ZN0A 2L54A 4B8XA 4U0VA 1RIOH 1K6OA 2DFIA 3B02A 1ZGAA 3J81K 3CO6C 1GXPA 1W4MA 3RKYA 3WU0A 1IN4A 4XBFA 1XCVA 1LDDA 1L3LA 2V9VA 2GA2A 1UHMA 4M9SA 4YG2F 2RVCA 1ZRCA 3PQKA 3C18A 3L9FA 3HSFA 4I01A 2EJRA 3H3ZA 4RB2C
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5ILV A;  4KNY A;  1ZH5 A;  2COM A;  5D5X B;  1T38 A;  3FMR A;  4WWC A;  5D6E A;  5LHI A;  1O3T A;  2G9W A;  3GO5 A;  2LDU A;  2QQA A;  1HKS A;  5E1W A;  1HSJ A;  1SFE A;  3ISP A;  3K1P A;  5K5R A;  2YX4 A;  4EGZ A;  2LF8 A;  3RDI A;  4L9T A;  3ABT A;  3K9T A;  3DV8 A;  2CW0 F;  4IJA A;  2P8T A;  2XAG A;  3ZPL A;  3HRT A;  4LLG F;  1J0R A;  5J8C A;  3EET A;  2ESH A;  2NYX A;  2VE8 A;  2UXN A;  4BNC A;  2OQG A;  1W7P D;  2F5D A;  3F21 A;  3F23 A;  1RI7 A;  3V7R A;  2K02 A;  3BDD A;  4ENJ A;  4A2U A;  1MDM A;  3R6S A;  1IF1 A;  2EFO A;  5L3D A;  3K2Z A;  1TW2 A;  1JHF A;  4PDK A;  1L0O C;  4A0X A;  5FD5 A;  4FHT A;  3TDU C;  2HDC A;  3RPU A;  4LLL A;  4HYE A;  4R1H A;  1D3Y A;  5HS9 A;  3HTS B;  2ZO4 A;  2B0L A;  2KJB A;  1FBQ A;  2EV0 A;  2DQL A;  4MTE A;  4DQ2 A;  1LNW A;  4MEY F;  3WGH A;  2QBY A;  3K1M A;  1DUX C;  2ZBK A;  3DQV C;  4RB1 A;  1MD0 A;  2OZ6 A;  4EJW A;  1FLI A;  3FWE A;  3WTV C;  1CGP A;  2F5F A;  4KUM A;  1J5Y A;  1NHA A;  2KKO A;  2LF7 A;  1KU9 A;  1KQ9 A;  1XGS A;  1XDS A;  4B09 A;  1OPC A;  3KP7 A;  1U5T A;  1H0M A;  2JTV A;  5AIP A;  2XV4 S;  3E97 A;  4AIK A;  3L09 A;  2QQB A;  4CO8 A;  2FRH A;  3HOS A;  2MA3 A;  1IW7 F;  4WX9 A;  5IT3 A;  2IA0 A;  1BIB A;  4EMS A;  4O5V A;  3E5Q A;  1B59 A;  3OV8 A;  4LFU A;  2JPC A;  1O3S A;  2A68 F;  1Z91 A;  2CFX A;  2IT0 A;  5HDK A;  2ESN A;  4CGZ A;  1JHH A;  4BQA A;  2MBF A;  2EFQ A;  1SMT A;  3MCZ A;  2ZME B;  1XSX A;  2GAU A;  3COA C;  3CDH A;  3WGI A;  3P7N A;  3DXJ F;  4YFX F;  2DBB A;  2XUB A;  1S7A A;  5FLX Z;  3AAF A;  3RYR A;  1XD7 A;  2L3D A;  5DD4 A;  1H9T A;  1BJA A;  4LD5 A;  1A04 A;  4R8H A;  5HS7 A;  2X0L A;  1FNN A;  3BZ6 A;  4N0B A;  4AIH A;  3V4G A;  1ULY A;  4IRG A;  3K1N A;  4HV5 A;  3G73 A;  1FX7 A;  2HYF A;  1SD5 A;  1PP7 U;  1RZ4 A;  3K69 A;  3WG9 A;  1D8K A;  5FFX A;  2O6G E;  4KMF A;  3P9I A;  1B1B A;  4OIR F;  4EV0 A;  3DPT A;  3E6M A;  1Z05 A;  3DF8 A;  1XN7 A;  3ZMD A;  1IN6 A;  2E1N A;  1KYW A;  4RGU A;  3FHZ A;  2X4H A;  2E1C A;  5CVR A;  2FSW A;  4EVI A;  2XKP A;  3FX3 A;  1ON2 A;  2RN7 A;  3V7C A;  2VBZ A;  4IXA A;  5H20 A;  4ON0 A;  4M71 A;  2IA2 A;  3WE2 A;  2A69 F;  4L9N A;  2NNY A;  2CG4 A;  2VT2 A;  4IF4 A;  2R7D A;  2FQ3 A;  4ASN A;  5TJJ A;  2K86 A;  5DUI A;  5HS8 A;  1HXD A;  3ZMZ A;  4HX7 A;  5K5Q A;  5E18 F;  3KLN A;  3JAM Z;  2CQK A;  1ZHF A;  1G3W A;  5CYV A;  1PDN C;  4M6Y A;  2RNJ A;  1IXR C;  4O6J A;  4ENM A;  4U0W A;  2Z3Y A;  5DDG A;  4KIC A;  2XAQ A;  3T8R A;  1LDK B;  4KIG A;  5F64 A;  1FYK A;  2GWR A;  5D8L B;  4G6D A;  1MJA A;  3F72 A;  1GVJ A;  2OA4 A;  3LA3 A;  2XRN A;  4BHC A;  5HLH A;  1P4A A;  5DV5 A;  2M45 A;  4JBA A;  3ERE D;  2W85 A;  2UXX A;  2RC4 A;  1ZRD A;  2M1B A;  2O3F A;  5FB2 A;  2WWY A;  3L7W A;  4UNO A;  1EH7 A;  2PJP A;  2GXB A;  5HDG A;  2E7X A;  2FBH A;  1BIA A;  2FNP A;  3SFZ A;  2VOO A;  4L5J A;  3E3V A;  1E17 A;  4AIJ A;  2D2W A;  2XGX A;  3FM3 A;  1YS6 A;  3EYI A;  1LQ1 A;  2DAO A;  1TW3 A;  4IVN A;  4UV8 A;  1WKM A;  5DEQ A;  1H9G A;  3FZV A;  5L3F A;  4HV6 A;  4N9H A;  5JR3 A;  3J7A O;  4WCG A;  3J80 K;  2ISY A;  3CLO A;  2D1V A;  2VE9 A;  4UXN A;  4ZZL A;  1FY7 A;  3N4M A;  4LMY A;  5J8F A;  2PG4 A;  2VOD A;  3ZN1 A;  4Q47 A;  5JFR A;  3HRU A;  2EV5 A;  4MGR A;  4U7B A;  4EM0 B;  4G6Q A;  2XAJ A;  2JSC A;  4GYI A;  4UV9 A;  1RUN A;  1YQA A;  1HST A;  1LB2 A;  5F1R A;  1S8N A;  3BPV A;  1FPQ A;  3O2P E;  3DKW A;  5L3B A;  4EJO A;  2XAF A;  2IPQ X;  5ICC A;  5LLQ A;  3Q5F A;  1TQI A;  3W6J B;  1TNS A;  2W24 A;  2VON A;  1R00 A;  3IHU A;  2VOP A;  2MD5 A;  2IP2 A;  5E8I A;  3QP6 A;  4P55 A;  4OIP F;  3KEQ A;  2DLL A;  3DP7 A;  3RYP A;  3E6B A;  3I59 B;  4MNU A;  1AOY A;  4Q48 A;  2M5W A;  1C0W A;  3ULQ B;  1ZAO A;  1T6S A;  3JSP A;  2ACJ A;  4CXF A;  1I5Z A;  3MZH A;  1O57 A;  3IKV A;  1ZLK A;  4L9J A;  3L2C A;  2M8E A;  3GLX A;  3CJN A;  2YSR A;  3U2R A;  5D5V B;  2H94 A;  4D0P A;  2VBX A;  2J5O A;  1YFH A;  3ML6 A;  4UUV A;  1ZG1 A;  5D8K B;  4L18 B;  2C6Y A;  4MQV A;  3GFL A;  3IL2 A;  1TLH B;  1U8R A;  2HKO A;  2H6B A;  3BP8 A;  1MJB A;  2P6S A;  2ETH A;  1WWX A;  3WTW C;  1R5H A;  2A61 A;  4GCV A;  5L3E A;  1FBU A;  1XMK A;  3RKW A;  3SQN A;  1P92 A;  4FX0 A;  4XLN F;  2ZFW A;  3WTS C;  4ESB A;  4P5O A;  3QAH A;  4FX4 A;  5BS6 A;  4ENN A;  3GXO A;  4BHB A;  3IKT A;  1O3Q A;  3JTG A;  2R3S A;  5ICF A;  1V3F A;  4G8X A;  3TO9 A;  1YW9 A;  5D6F A;  3VEP A;  1R36 A;  5D5W B;  2WTE A;  2VT3 A;  5DUK A;  1IAW A;  1Z6T A;  2CSO A;  4ENK A;  1P4X A;  2EV6 A;  1HBX G;  2QZ8 A;  4HA8 A;  2ELH A;  2HTS A;  3WTX C;  3I58 A;  3PQJ A;  1I1G A;  3M7G A;  5E8G A;  2K4J A;  1DP7 P;  3SZP A;  2P7V B;  2DPD A;  4BYY A;  2GA1 A;  5H6Q A;  2Z33 A;  4HOB A;  4LLN A;  1ZG3 A;  2FML A;  5BOX A;  5LHG A;  2OU2 A;  2O61 A;  4YII A;  1QBJ A;  1B4A A;  4K2E A;  3KP5 A;  1SD6 A;  2QLZ A;  3I54 A;  4L0Z B;  1W7P A;  5ERI A;  4Q5S F;  2EA4 A;  3TDZ C;  1BI3 A;  4L9V A;  1R1U A;  1O7L A;  1J2X A;  3R0A A;  4GO1 A;  2A6E F;  2PMH A;  1R5G A;  1ZGJ A;  2EFP A;  1RUO A;  1OYI A;  3KLO A;  3D5L A;  5LBQ A;  1SD7 A;  3KE2 A;  1DPU A;  3EDP A;  1YS7 A;  5BQT A;  2BV6 A;  3GFJ A;  2FEZ A;  2DW4 A;  1U5T C;  5FGM A;  3ABU A;  4OIO F;  2PLY A;  1KU3 A;  2ZME A;  2PN6 A;  4A5M A;  3HSR A;  1VTN C;  4RAZ A;  3ECO A;  4IHT A;  3V8L A;  4ESF A;  2CO5 A;  3JSO A;  2QUF A;  3ZMU A;  2HQN A;  3T8T A;  2QBY B;  1CF7 A;  2PQ8 A;  2EB7 A;  2VXZ A;  4U7D A;  1AWC A;  5A2Q Z;  3OOP A;  3V8J A;  2H09 A;  4PGH A;  1TBX A;  3O3K A;  3EQL F;  4CIC A;  2D45 A;  2HS5 A;  3CUO A;  2HWV A;  5EEH A;  3KP2 A;  3FF5 A;  3KP4 A;  2M87 A;  4M73 A;  3CUQ A;  1QZZ A;  5CLS A;  1U5T B;  1FWZ A;  5IT9 Z;  4A5N A;  3CUQ C;  3P9K A;  2NNN A;  2NRA C;  1FYL A;  4G94 A;  6PAX A;  2G7U A;  1F4K A;  4LB6 B;  3QOP A;  4AWX B;  5AON A;  1K78 B;  5DD8 A;  2QVO A;  4AD9 A;  2XKO A;  4HX4 A;  4PCQ A;  2P6T A;  3HOT A;  2NAZ A;  3R4K A;  4P96 A;  4M6X A;  2IW5 A;  4HDU A;  1Z1D A;  1U2W A;  2AS5 F;  1HKT A;  4ZZD A;  5KVR A;  4HLY A;  1S29 A;  1XDU A;  1W5T A;  4LG0 B;  4XSX F;  5LHH A;  1SFU A;  4ESJ A;  4XLP F;  2O0Y A;  4IRI A;  2HR3 A;  1FP2 A;  2EFN A;  1LVA A;  2F2E A;  3SHF A;  1IXS B;  4RGS A;  5J6X A;  2LKP A;  1KQ0 A;  2DO7 A;  3M8E A;  4HX8 A;  4HW0 A;  4QLC U;  2IVM A;  3BJ6 A;  1F5T A;  3U9G A;  4L0Y B;  1MKM A;  3KP6 A;  1HQC A;  3N97 A;  3R0J A;  2ZCW A;  1G3Y A;  3SZT A;  1PP8 F;  2DI3 A;  3IC7 A;  1P2F A;  1XSD A;  3ELK A;  1Y0U A;  2TDX A;  1I6X A;  3KZY A;  1ZG5 A;  1YIO A;  4TV7 A;  3QU3 A;  2QM3 A;  2JZY A;  2ZKZ A;  3G3Z A;  2WC2 A;  1ZAR A;  5K1Y A;  4OMY A;  3T0Y A;  5LGT A;  5FD6 A;  3MQ0 A;  2XAH A;  2OD5 A;  1UFM A;  2FBK A;  1I27 A;  1BM9 A;  3JTH A;  4EM1 A;  1LEB A;  4IHS A;  3QP5 A;  4U88 A;  4I09 A;  1FOK A;  2Y48 A;  3E6C C;  3TOB A;  5LGU A;  3VFZ A;  4ZYD A;  2F5E A;  4KIF A;  1JXS A;  4I0B A;  5DCF A;  4KN4 X;  1WI9 A;  1GHC A;  2RV8 A;  2LSO A;  3LA2 A;  1RNL A;  2DQR A;  5FO5 A;  3EUH A;  1XB4 A;  4M9Z A;  4OIQ F;  1ON1 A;  1XSV A;  1ZN2 A;  5ILU A;  3WGG A;  1F9N A;  4EJT A;  3TO6 A;  2RKH A;  1SMY F;  3IRR A;  3TOA A;  3D0S A;  1QGP A;  2Z5U A;  2DT5 A;  1ONV A;  2CGP A;  1R58 A;  2AXL A;  3FXR A;  2PEX A;  2E7W A;  2FF4 A;  3QRF F;  1LDJ A;  2VN2 A;  1REP C;  3MEX A;  3NEU A;  4MQ9 F;  2FMY A;  2BE5 F;  2EK5 A;  2V1D A;  1Z9C A;  1EH8 A;  3EYY A;  1J75 A;  5LGN A;  1IZ1 A;  4QWQ A;  2BEO A;  1BOA A;  5D4R A;  1FC3 A;  2MC3 A;  3HUG A;  1EV7 A;  3HHH A;  5ICG A;  2VBW A;  4BXU A;  1ZRF A;  1O7F A;  2YX7 A;  3VOD A;  2MH2 A;  2JRT A;  5H6R A;  1U3E M;  3BOQ A;  1OR7 A;  4GYG A;  5TRD A;  4KT5 C;  2FXA A;  3BY6 A;  1BN5 A;  2L02 A;  4HBL A;  4YIF A;  3REO A;  2KIU A;  3DPL C;  3I59 A;  2DU9 A;  2ZNY A;  2XAS A;  3I0T A;  1SAX A;  1ZRE A;  3ZP5 A;  4WXH A;  3IWZ A;  2PBI A;  5LEJ A;  3QU6 A;  4HAM A;  2F5C A;  2HOE A;  1DDN A;  1QPM A;  3T1B A;  2OZU A;  3HIF A;  4EQQ A;  4EJV A;  5JVT A;  2MH9 A;  2FOK A;  3WE3 A;  2V79 A;  2DK5 A;  5FFZ A;  1YTY A;  2Y75 A;  1T98 A;  2HKX A;  3GW2 A;  2V6C A;  3WTU C;  1YLF A;  1IN5 A;  3HSE A;  2L01 A;  1IRG A;  2IA1 A;  2BBY A;  4E70 A;  2R7F A;  1R1V A;  2GXG A;  5FLX K;  3FMS A;  4EGY A;  3K0L A;  4BHP A;  3C7J A;  3I4P A;  2ADU A;  1S7O A;  4EJU A;  1WSU A;  2IRF G;  4OU0 A;  3BPX A;  4WXD A;  2ZNZ A;  4YFN F;  1HW2 A;  4HZF A;  1IN8 A;  3TO7 A;  1BC7 C;  2JT1 A;  4PGG A;  5DCM B;  3RPQ A;  3WTZ A;  3V8K A;  3DEU A;  5CVU A;  3B73 A;  4G9Y A;  4CDG A;  4UVB A;  1TNT A;  5ICE A;  2OQR A;  1FYM A;  5HLI A;  3GX4 X;  2W57 A;  2HZT A;  3GUD A;  3WU1 B;  3KP3 A;  4RAY A;  1J59 A;  2HEO A;  3ROU A;  3I71 A;  3RKX A;  1B9M A;  2O03 A;  1YO5 C;  1J7K A;  3LST A;  4LGW A;  1MGT A;  2OBP A;  4NHJ A;  1F1Z A;  3KEO A;  4O3M A;  4S04 A;  2Q0O A;  1YW7 A;  3F8M A;  3GWZ A;  1G6N A;  2HGC A;  3MFK A;  3NQO A;  1FBS A;  5HVQ C;  3GZ6 A;  1D5V A;  2L4A A;  1PUE E;  2PMU A;  3L00 A;  2DPU A;  3LQQ A;  4UVA A;  4LK0 F;  1B6A A;  3BRO A;  4GXO A;  3MWM A;  3QPT A;  4NQW A;  1KQ8 A;  3ECH A;  4OOI A;  1W5S A;  3KFW X;  1BBY A;  4WF2 A;  3JAM K;  3KZZ A;  1KU2 A;  5CJ9 A;  3FXQ A;  3GZ5 A;  1OKR A;  4UHT A;  4HQM A;  1TQP A;  3KCC A;  3MAJ A;  2Q8K A;  2QYO A;  3VOE A;  1G3S A;  4H0E A;  4HF0 A;  2HYG D;  5CVI A;  4FT8 A;  4LB5 A;  1LJ9 A;  4GGG A;  3SXY A;  4A0Y A;  1R1T A;  4M9X A;  1OYY A;  4ZH4 F;  4MHG A;  4I98 B;  1JGS A;  3S2W A;  4UVC A;  4WXC A;  3F8C A;  2XRO A;  2BGC A;  2FNA A;  3RIR A;  3F22 A;  4IRH A;  2RGV A;  2QWW A;  3R60 A;  3TQN A;  1MDM B;  2V1X A;  3TGN A;  1U78 A;  2W25 A;  3ZMV A;  1ZLJ A;  2K4B A;  3J80 Z;  3CTA A;  3HYI A;  1UHW A;  1DPR A;  4HF2 A;  2EFW A;  2VC0 A;  4RB0 A;  1MJ9 A;  1W7P B;  5D5U B;  4KN7 X;  4CYD A;  1TTY A;  3BWG A;  1OYW A;  2YR2 A;  2J5P A;  3RI4 A;  3GYH X;  1HW1 A;  2JPB A;  1YW8 A;  2Y0M A;  2NS0 A;  5E17 F;  1JE8 A;  2RDP A;  1D8J A;  4KIB A;  2LNB A;  3V7S A;  1BI0 A;  2STT A;  1Z7U A;  1P4W A;  1Q1H A;  1O3R A;  3BJA A;  1K78 A;  5LRS A;  1V4R A;  4A0Z A;  4Y13 A;  1R7J A;  3RTR A;  2A07 F;  2D1H A;  1QQI A;  3LAJ A;  4I2O A;  3MZY A;  1T39 A;  1K7A A;  5L3G A;  2Z9O A;  4LG0 A;  1BI1 A;  4YFK F;  1BC8 C;  4OIN F;  1LEA A;  3F8F A;  1CF7 B;  1G4D A;  1MZB A;  5HDN A;  2W84 A;  4KDP A;  2VBY A;  2WV0 A;  2P5K A;  5LEK A;  2UWM A;  5KK1 A;  4HQE A;  5CVJ A;  4KMU X;  3PFI A;  4LK1 F;  4N9I A;  4MEX F;  3Q9S A;  3CUQ B;  3HRS A;  5DYM A;  4A6E A;  3J81 Z;  1KU7 A;  1GXQ A;  2RQP A;  3IWF A;  1KYZ A;  5AIQ A;  1XGN A;  2FA5 A;  2QEN A;  2XIG A;  3R61 A;  2H6C A;  3Q9V A;  3E6D A;  2GIV A;  4DNC A;  1IRF A;  2CYY A;  4ZYG A;  1Z6R A;  3F8B A;  1UST A;  3O6B B;  1FSH A;  2L4M A;  3LFK A;  4JQF A;  4XRF A;  4Q4Z F;  3T5X A;  1FSE A;  2A5Y B;  3F6O A;  1KGS A;  2OAZ A;  3JW4 A;  4P9U A;  2V1U A;  3I53 A;  5K5O A;  2ZXJ A;  3GVA A;  2BYV E;  3GF2 A;  4F7Z A;  2PFB A;  1QNT A;  4M72 A;  2DTR A;  1P6R A;  3BJO A;  2PI0 A;  2O8X A;  3DFG A;  5BPD A;  3P9C A;  4I02 A;  2ZJ2 A;  3LQR A;  4CHU A;  1STZ A;  1UCR A;  1YYV A;  2MLK A;  4U0Y A;  4I7H A;  1XGM A;  4JK1 X;  5L3C A;  3F3X A;  4Z2Y A;  2FBI A;  4Y17 A;  3E5U A;  3QPH A;  4OMZ A;  5JI6 A;  2GQQ A;  3C3W A;  2M30 A;  2UZK A;  2P5L C;  3LAP A;  1IUY A;  4KFC A;  1I1S A;  1SD4 A;  1WQ2 A;  2K7L A;  1J9I A;  3LWF A;  4NB5 A;  4BAY A;  4I0A A;  3C1D A;  3W6K B;  3U1D A;  5ILS A;  1QZY A;  5LRR A;  1SFX A;  3I64 A;  3CO7 C;  2EWN A;  1T2K A;  2FE3 A;  5F6F A;  4WK8 F;  5EEG A;  2STW A;  1QO0 D;  5E20 A;  3NRV A;  3M1E A;  1FP1 D;  4EM2 A;  1S3J A;  5ED4 A;  3IRQ A;  1HKQ A;  3FMQ A;  3ZQ7 A;  3WOD F;  1ODD A;  3HHG A;  2H27 A;  4RS8 A;  4HLX A;  1E2X A;  1YG2 A;  1XCB A;  2CWE A;  3M8F A;  3I5U A;  1HW5 A;  2QQ9 A;  3TKY A;  1G3T A;  4G7Z F;  1ZYR F;  3GFI A;  3RJP A;  1S6L A;  3KET A;  3WTT C;  2A6H F;  1T0F A;  1K79 A;  4KYW A;  2YU3 A;  5BPI A;  5E1X A;  1R23 A;  4P9F A;  3FXU A;  1FT9 A;  4ZYE A;  3F6V A;  3GEZ A;  2XVC A;  4A6D A;  2IJL A;  1EH6 A;  3H92 A;  1TQM A;  3HRM A;  4MTD A;  2K27 A;  4S05 A;  3WTY C;  1KA8 A;  4AVP A;  4PZJ A;  2A3S A;  1USS A;  4RGX A;  4HF1 A;  1WRJ A;  5HLG A;  1IN7 A;  1FZP B;  5E1Z B;  2GZW A;  2KRF A;  1U6G A;  4HDV A;  3LA7 A;  1UB9 A;  2P7C B;  4G7O F;  2KIM A;  4CZZ A;  2KJC A;  3FM5 A;  4RGR A;  2HQR A;  2MLG A;  5A2Q K;  2DK8 A;  4ZYH A;  1BI2 A;  4BH9 A;  2EA2 A;  2FU4 A;  4Y15 A;  2KIF A;  4ETS A;  3VB2 A;  1B9N A;  4R79 A;  1X3U A;  1OMI A;  3H3U A;  2ISZ A;  5IT9 K;  3HTU A;  5D4S A;  4KA4 A;  5CVV A;  3ZMS A;  5JHU A;  1IXC A;  1XGO A;  4XSZ F;  3E5X A;  4L5I A;  2VC1 A;  2XHK A;  5DCM A;  3F8N A;  2G7H A;  5BMZ A;  1XMA A;  4LJZ F;  2HTJ A;  3ZMT A;  2YPR A;  2P5V A;  5HOO A;  2Z99 A;  4IPA A;  2Q2E A;  4M74 A;  4RB3 C;  3GFM A;  3M9A A;  4G7H F;  1R22 A;  2HFH A;  4A12 A;  2P4W A;  3ZN0 A;  2L54 A;  4B8X A;  4U0V A;  1RIO H;  1K6O A;  2DFI A;  3B02 A;  1ZGA A;  3J81 K;  3CO6 C;  1GXP A;  1W4M A;  3RKY A;  3WU0 A;  1IN4 A;  4XBF A;  1XCV A;  1LDD A;  1L3L A;  2V9V A;  2GA2 A;  1UHM A;  4M9S A;  4YG2 F;  2RVC A;  1ZRC A;  3PQK A;  3C18 A;  3L9F A;  3HSF A;  4I01 A;  2EJR A;  3H3Z A;  4RB2 C; 
#chains in the Genus database with same CATH topology
 5ILV A;  4YEJ A;  5EEA A;  2F6C A;  4KNY A;  1ZH5 A;  2COM A;  3W2A A;  3GTQ J;  1Y8Q B;  5D5X B;  5H2F C;  3FMR A;  4XLE A;  3IAS 2;  5D6E A;  3TBI A;  5LHI A;  3A0B C;  4WWC A;  1T38 A;  2NVU B;  4XKB A;  1O3T A;  2G9W A;  4E7J A;  3GO5 A;  3HGY A;  3OYC A;  2LDU A;  4HNU A;  4IO9 F;  2QQA A;  1HKS A;  2QKL B;  5E1W A;  1HSJ A;  3HZJ A;  4ZYA A;  4C3J J;  1LE8 A;  1SFE A;  3ISP A;  1Y1V J;  2MGQ A;  3K1P A;  1BA5 A;  5K5R A;  2YX4 A;  3HGG A;  4EGZ A;  2LF8 A;  3RDI A;  3D5S C;  4L9T A;  3ABT A;  3BR1 A;  4NNJ A;  1I3A A;  4BBR J;  1WJA A;  3K9T A;  3BTL A;  3DV8 A;  2CW0 F;  3M3Y J;  2VJ4 A;  4IJA A;  2P8T A;  3FBI B;  2XAG A;  4RDU A;  3ZPL A;  3HRT A;  2JA6 J;  4LLG F;  1J0R A;  1W36 C;  5J8C A;  3EET A;  1MBH A;  2ESH A;  2HPI A;  4OAZ A;  2BY1 A;  4XN0 A;  2NYX A;  2VE8 A;  2UXN A;  3EUA A;  4BNC A;  2OQG A;  1W7P D;  3Q0U A;  1V5G A;  3OOU A;  2F5D A;  4D1Q A;  1VF9 A;  3F21 A;  2OPT A;  4Y52 J;  4QPO A;  3KYC B;  3K4J A;  4XON A;  1JTX A;  2JSP A;  3F23 A;  2V6E A;  1RI7 A;  2EZH A;  3V7R A;  1YJ9 I;  1A6Q A;  1MH3 A;  3CCU I;  2K02 A;  3BDD A;  2ME0 A;  4ENJ A;  2NS8 A;  4A2U A;  1MDM A;  1VQP I;  3H5R A;  4E7H A;  3R6S A;  2WB1 N;  3LMM A;  2QSH X;  4V2G A;  2ZSH B;  3RCO A;  1IF1 A;  1P7J A;  2EFO A;  5L3D A;  3BR2 A;  3K2Z A;  1TW2 A;  3CCR I;  4AM3 A;  2AQF A;  1JHF A;  4PDK A;  1L0O C;  1LVK A;  4A0X A;  3S15 J;  5FD5 A;  2H8W A;  2EPF A;  3TW6 A;  4FHT A;  3LSK A;  1YJN I;  3TDU C;  3S3N A;  2HDC A;  2KIS A;  3RPU A;  2DOD A;  4LLL A;  5J1R A;  4M3F A;  1FOX A;  4HYE A;  4R1H A;  4B3A A;  4RAF A;  1D3Y A;  3L2Q A;  2COB A;  4PJ0 C;  5HS9 A;  3HTS B;  2VQH A;  2L9S A;  4PSX A;  4KIT B;  3HOU J;  2ZO4 A;  4FAS D;  2B0L A;  2KJB A;  4H4K C;  4C30 A;  1FBQ A;  2EV0 A;  2DQL A;  2ICW G;  4MTE A;  3OIO A;  4DQ2 A;  3CZ6 A;  1LNW A;  4MEY F;  3WGH A;  2QBY A;  3K1M A;  3K4M A;  1DUX C;  2ZBK A;  3DQV C;  4RB1 A;  4KIS A;  1MD0 A;  2OZ6 A;  4EJW A;  1V5F A;  1WJF A;  2ID6 A;  1FLI A;  3FWE A;  4XRM A;  3WTV C;  1JKQ C;  2F5F A;  4KUM A;  1CGP A;  3SZG A;  2Y30 A;  1J5Y A;  2N8G A;  3CMA I;  3JRC A;  2RRE A;  1NHA A;  2KKO A;  1RRJ A;  5FLV A;  2V9P A;  2LF7 A;  2VQC A;  1KU9 A;  2L0K A;  4A3M J;  1KQ9 A;  1XGS A;  3QYB A;  1XDS A;  2M2E A;  4B09 A;  1OPC A;  3KIO A;  1EA3 A;  3KP7 A;  4PSW A;  2DFH A;  1S72 I;  2JJ7 A;  3LOC A;  1U5T A;  1H0M A;  1X3W B;  2JTV A;  4P1W A;  5CQG A;  5AIP A;  3OYM A;  4C2M J;  2XV4 S;  3CCM I;  3ZCO A;  4EEF G;  3E97 A;  1V55 H;  2ZFU A;  4AIK A;  2XDV A;  4D7N A;  1MW7 A;  1R71 A;  3L09 A;  3RZD J;  2QQB A;  4CO8 A;  2FRH A;  1E3P A;  3HOS A;  2MA3 A;  1IW7 F;  2K3F A;  5CKT A;  4WX9 A;  3JRB A;  3OL3 A;  5IT3 A;  2IA0 A;  4ZC3 A;  1BIB A;  4EMS A;  3G6E I;  4O5V A;  2YU9 J;  3VSK A;  2VJI A;  1W0T A;  3E5Q A;  1B59 A;  2R7U A;  1FJL A;  3OV8 A;  4LFU A;  1WJ5 A;  2JPC A;  1O3S A;  2A68 F;  1Z91 A;  2CQQ A;  2CFX A;  2DMP A;  4I99 C;  2VB6 A;  2IT0 A;  5HDK A;  2ESN A;  4PUS A;  4CGZ A;  4DW6 A;  1JHH A;  3VYU B;  2XSJ C;  4BQA A;  2MBF A;  1SFO J;  2HOA A;  2EFQ A;  1SMT A;  4CCJ A;  3MCZ A;  3PL8 A;  1APL C;  2ZME B;  1XSX A;  5GP9 A;  2XAU A;  1K4S A;  1MMN A;  2GAU A;  2WY7 Q;  1OCO H;  2DA6 A;  3COA C;  2A6T A;  3HKZ N;  3NWT A;  3CDH A;  4E7I A;  3WGI A;  3H1C A;  4D9J A;  3K7A J;  3P7N A;  3DXJ F;  4YFX F;  2DBB A;  5IP7 J;  2LY9 A;  2M4K A;  2XUB A;  2IBD A;  1S7A A;  5FLX Z;  4NDL A;  1VQM I;  3AAF A;  5EGO A;  3HBL A;  3LSM A;  2QSF X;  3RYR A;  1XD7 A;  2VKE A;  2L3D A;  2VKD A;  5M3M J;  5DD4 A;  1H9T A;  2E1M B;  1BJA A;  2Q1Z B;  4BEH A;  4LD5 A;  2PJR A;  3LSP A;  1A04 A;  4R8H A;  2QGU A;  3BT9 A;  5K7H A;  1VZ0 A;  1QZE A;  5HS7 A;  2X0L A;  2VPL A;  1YIT I;  1FNN A;  3BZ6 A;  4N0B A;  4AIH A;  3V4G A;  1BR2 A;  1ULY A;  4NC6 A;  4IRG A;  3K1N A;  4HV5 A;  3G73 A;  3DPU A;  4B48 A;  3HOW J;  1FX7 A;  2CU7 A;  4IHV A;  2HYF A;  1SD5 A;  3L2W A;  1PP7 U;  1RZ4 A;  1HOM A;  1D1A A;  2MAB A;  2KRC A;  3K69 A;  3M1C A;  2BZT A;  3FKI J;  3WG9 A;  2CH0 A;  1D8K A;  5FFX A;  4LIU A;  2O6G E;  3A02 A;  2X85 A;  2I5U A;  4KT6 A;  4KMF A;  2AQE A;  3P9I A;  3ZQI A;  2OTJ I;  1B1B A;  4OIR F;  4ZTJ A;  1WFX A;  4EV0 A;  3I3L A;  3DPT A;  3E6M A;  1Z05 A;  2R7V A;  3DF8 A;  1XN7 A;  3ZMD A;  1IN6 A;  2QCO A;  2HI3 A;  2E1N A;  1KYW A;  5DM7 F;  4RGU A;  3FHZ A;  2X4H A;  1A36 A;  1IC8 A;  5CVR A;  2E1C A;  3PNY A;  5EZG A;  3BTC A;  3SEQ A;  1P9Q C;  4MFE A;  1WJE A;  2FSW A;  1Z67 A;  2HDW A;  2IGK A;  2M0C A;  3KZI C;  4EVI A;  1SC7 A;  4A3D J;  2XKP A;  3FX3 A;  2ZC2 A;  4NC7 A;  3CP2 A;  1ON2 A;  2KLO A;  2RN7 A;  2Z2S B;  1X1C A;  3V7C A;  2VBZ A;  4IXA A;  4U87 A;  5H20 A;  2IS4 A;  3BCA A;  1PVE A;  4ON0 A;  1YE9 A;  2EIL H;  1LFU P;  4M71 A;  2IA2 A;  3WE2 A;  3DWL E;  2A69 F;  3DTK A;  4L9N A;  3A01 A;  4N4N B;  2NNY A;  2BOL A;  1ACI A;  4CYC B;  3MKZ A;  2CG4 A;  2VT2 A;  4IF4 A;  3GCM A;  3CLQ A;  2V9K A;  3A03 A;  2K9Q A;  2R7D A;  2FQ3 A;  4RA2 A;  4ASN A;  5TJJ A;  2K86 A;  2H8R A;  5DUI A;  5HS8 A;  1HXD A;  1X19 A;  2TRT A;  2I8D A;  4HX7 A;  3ZMZ A;  5K5Q A;  1IUF A;  5E18 F;  3KLN A;  4FIS A;  5K7Z A;  3JAM Z;  3JR9 A;  2CQK A;  4F91 B;  3CJT B;  1ZHF A;  3FIW A;  1WZ2 A;  2IAI A;  1ETQ A;  4JX6 A;  2X6W A;  5IPA A;  2L9V A;  3MKL A;  1G3W A;  1WJC A;  5CYV A;  1PDN C;  5FKM A;  4M6Y A;  2RNJ A;  4UUT A;  1IXR C;  3AL0 C;  1ETO A;  1NG6 A;  4O6J A;  1QVU A;  4ENM A;  3K4N A;  2ZJR F;  4U0W A;  2Z3Y A;  5DDG A;  4KIC A;  2GLO A;  2XAQ A;  3OWT A;  3CDL A;  3T8R A;  2BVL A;  1FTZ A;  2L7Z A;  1LDK B;  2KIQ A;  2E60 A;  4KIG A;  1VQL I;  1AA7 A;  2K9N A;  5F64 A;  3KYL A;  1FYK A;  3CME I;  5IYD J;  2GWR A;  3ERM A;  5EYR A;  5D8L B;  4MIM A;  4G6D A;  1MJA A;  2MG4 A;  3F72 A;  1GVJ A;  4HPQ A;  4CSW A;  2NVY J;  3PUB A;  2OA4 A;  4DGW B;  3S93 A;  4BY1 J;  3QWL A;  2GBY A;  3LA3 A;  2XRN A;  3DU5 A;  5F1J A;  3BTI A;  2NVX J;  4BHC A;  5HLH A;  1P4A A;  4JBA A;  2M45 A;  5DV5 A;  3ERE D;  4ITV A;  1DGR M;  1VQK I;  3CCQ I;  2W85 A;  4AID A;  1GT0 C;  2WAD A;  3HB9 A;  2UXX A;  2RC4 A;  1ZRD A;  2M1B A;  2P0W A;  4FQG A;  2O3F A;  4IL6 C;  3K4B A;  1D5Y A;  5J3L A;  5FB2 A;  2WWY A;  4DYC A;  1R4N B;  3L7W A;  3DLA A;  1S9H A;  4UNO A;  2VJJ A;  1ZTR A;  1EH7 A;  2HXI A;  2XGE A;  2GXB A;  2PJP A;  3S1N J;  4A3F J;  5HDG A;  3ABL H;  4LOC A;  2E7X A;  2FBH A;  1BIA A;  1UG0 A;  2DOE A;  2FNP A;  3SFZ A;  3K10 A;  1LPQ A;  1T0F C;  2W7N A;  3BQY A;  2VOO A;  1WH7 A;  2BXZ A;  4L5J A;  3KPH A;  3E3V A;  3K70 C;  1E17 A;  3FKJ A;  4AIJ A;  2D2W A;  2XGX A;  3FM3 A;  4D5C A;  1YS6 A;  4CCL A;  3LSR A;  3EYI A;  1ETK A;  3HPH A;  1LQ1 A;  2DAO A;  1TW3 A;  2M4G A;  4IVN A;  4UV8 A;  1WKM A;  5DEQ A;  1H9G A;  3FZV A;  4D5F A;  2Y9Z A;  5L3F A;  1OCZ H;  1BR1 A;  5GPC A;  1JJ6 C;  4HV6 A;  3X2Q H;  5GAD J;  2JVG A;  4N9H A;  5JR3 A;  3CCV I;  3J7A O;  1GV5 A;  4F55 A;  2EZK A;  4WCG A;  3J80 K;  3HDD A;  2ISY A;  3CLO A;  2D1V A;  1K4T A;  2WY8 Q;  2VE9 A;  4UXN A;  4ZZL A;  3JCU C;  3OYA A;  1VQN I;  2M34 A;  1FY7 A;  3N4M A;  4BKX A;  1MMS A;  4LMY A;  2CUJ A;  5J8F A;  3OS2 A;  1JUS A;  2PG4 A;  2VOD A;  3ZN1 A;  4Q47 A;  5GPA A;  5JFR A;  2DJN A;  2EV5 A;  3HRU A;  4MGR A;  4U7B A;  3GLL A;  4XN3 A;  2FQ4 A;  4D7M A;  4EM0 B;  4G6Q A;  3ZRG A;  2G0E A;  2XAJ A;  5M5W J;  2JSC A;  2IS2 A;  3B6A A;  3SEZ A;  4B47 A;  4GYI A;  2JQ7 A;  2KDO A;  4UV9 A;  1RUN A;  4J00 A;  1YQA A;  1HST A;  1LB2 A;  4UUS B;  2R5Y B;  2VAS A;  2R7S A;  5F1R A;  1S8N A;  2X1D A;  3BPV A;  5JLX A;  3WG7 H;  3CCE I;  1FPQ A;  3O2P E;  5GAG J;  3DKW A;  5L3B A;  5J1Y A;  4EJO A;  2XAF A;  2IPQ X;  2BW3 B;  2KZG A;  5ICC A;  1MBE A;  1AHD P;  2HOS A;  3SDG A;  3HG9 A;  2CUE A;  4A69 C;  5LLQ A;  4IOC F;  1G2H A;  3Q5F A;  3HUG B;  2LRE A;  2DA3 A;  1TQI A;  3HL2 A;  1AKH A;  3W6J B;  1MSE C;  1N77 A;  4I76 A;  2HQ5 A;  1TNS A;  1B8I B;  2DCE A;  2W24 A;  3F0C A;  4BQQ A;  4HNV A;  4OWR B;  5J1U A;  1IV6 A;  2VON A;  1R00 A;  2K5C A;  4PJL A;  3S3M A;  3IHU A;  2VOP A;  2MD5 A;  3MZ8 A;  5IOY A;  2IP2 A;  1GVD A;  5B5E C;  5E8I A;  3OIQ A;  3QP6 A;  4P55 A;  5TIS C;  4DYR A;  2BY3 A;  4OIP F;  3KEQ A;  2DLL A;  3DP7 A;  3RYP A;  3E6B A;  3FK7 A;  3I59 B;  4MNU A;  1AOY A;  1LUJ B;  3O8G A;  4Q48 A;  2M5W A;  1C0W A;  3TMO A;  3IH2 A;  3ULQ B;  3WHB A;  3GTK J;  5J4V A;  1ZAO A;  4HG2 A;  1T6S A;  4XNF A;  3JSP A;  2PMZ A;  3ZOB A;  2JWT A;  3QQA A;  4CXF A;  2ACJ A;  1I5Z A;  3MZH A;  1LFP A;  1U9N A;  4C3H J;  1O57 A;  3D5R C;  3HM5 A;  3IKV A;  1JJ8 C;  1ZLK A;  4L9J A;  4ANJ A;  3L2C A;  3DU6 A;  2XRL A;  2M8E A;  3GLX A;  4XRS G;  2F4I A;  4B3X A;  2VLA A;  1ETX A;  1Z0X A;  1RR7 A;  2XGC A;  3CJN A;  2YSR A;  3U2R A;  2F4O B;  2H94 A;  3W2V A;  5D5V B;  4D0P A;  1Z3Y A;  2DYR H;  2VBX A;  5JLW A;  2J5O A;  1YFH A;  3ML6 A;  2QSG X;  4UUV A;  2MD0 A;  4RBO A;  1ZG1 A;  2Y69 H;  5D8K B;  4L18 B;  2CW8 A;  2C6Y A;  4MQV A;  3GFL A;  1QVT A;  1UEL B;  3IL2 A;  1TLH B;  1U8R A;  2R7Z J;  3S2H J;  5F0F A;  2X1C A;  2HKO A;  2H6B A;  3BP8 A;  1YI2 I;  1MJB A;  2P6S A;  1BL0 A;  2ETH A;  4A93 J;  1WWX A;  3WTW C;  1HLV A;  5M5Y J;  3CC7 I;  1R5H A;  2A61 A;  2MC4 A;  4GCV A;  2E34 A;  5KCM A;  3HOV J;  5L3E A;  1VQO I;  1FBU A;  1XMK A;  2E19 A;  2F48 A;  3A4C A;  3RKW A;  1ENH A;  1P92 A;  3SQN A;  4FX0 A;  4XLN F;  4XIC A;  2LKX A;  4UB8 C;  2ZFW A;  3WTS C;  4ESB A;  4A3K J;  4P5O A;  3GZN B;  3DKY A;  4BDZ A;  5JHF A;  1ERD A;  3JRA A;  5J40 A;  4A3J J;  1K83 J;  3QAH A;  2F4M B;  4FX4 A;  5TGT A;  5BS6 A;  1W36 D;  4XLH A;  1OJL A;  4ENN A;  3SJM A;  3DBH B;  4DJA A;  3GXO A;  4AC0 A;  4BHB A;  3IKT A;  1O3Q A;  2CV2 A;  3JTG A;  3MD2 A;  2R3S A;  5ICF A;  2VL8 A;  1RPW A;  2E5N A;  4HEA 2;  2UV1 A;  4M3E A;  1V3F A;  4G8X A;  1K6Y A;  3TO9 A;  1XTA A;  3WU2 C;  1I50 J;  1UZC A;  1YW9 A;  4XOP A;  5D6F A;  3VEP A;  5LFA A;  3BQZ A;  5K7F A;  1GUU A;  1R36 A;  5D5W B;  2WTE A;  3Q0W A;  3BCB A;  4DYQ A;  2VT3 A;  5DUK A;  3G1M A;  1IAW A;  4FE7 A;  3OSF A;  1Z6T A;  2CSO A;  2DOA A;  4OAY A;  4ENK A;  2LKS A;  3RKQ A;  1P4X A;  3PM1 A;  2UUZ A;  4B43 A;  2EV6 A;  2W48 A;  1HBX G;  5FRM A;  2QZ8 A;  1T08 B;  4HA8 A;  1T8I A;  2ELH A;  2HTS A;  1U0J A;  2KZV A;  5C4J J;  3GTL J;  3WTX C;  4BJ6 C;  2E2H J;  3I58 A;  3PQJ A;  4XMY A;  1I1G A;  3M7G A;  1BJZ A;  1X2N A;  5E8G A;  2QF7 A;  3BR6 A;  1SFK A;  2K4J A;  4IOA F;  1PUF A;  1DP7 P;  3SZP A;  2HNH A;  2LH9 A;  2P7V B;  3DBL B;  2BXY A;  2DPD A;  4BYY A;  3J7Z I;  2GA1 A;  5H6Q A;  2M8G X;  3Q0V A;  2CFO A;  2KMU A;  2Z33 A;  4HOB A;  3OYK A;  4A3B J;  1ZEL A;  4LLN A;  4AU7 A;  1ZG3 A;  3OYH A;  1WGX A;  1Z77 A;  2FML A;  2JUC A;  1DU0 A;  5BOX A;  5LHG A;  2OU2 A;  2O61 A;  4NQW B;  2LVS A;  2DFF A;  4XR6 A;  4YII A;  1Q1V A;  1ETW A;  1QBJ A;  3FDY A;  1B4A A;  2DOF A;  2HYJ A;  3DTI A;  4FET A;  4K2E A;  3KP5 A;  1SD6 A;  4Z6Y A;  3OIP A;  2QLZ A;  1Y0N A;  3I54 A;  4L0Z B;  2CMP A;  3K4C A;  2W00 A;  1W7P A;  2TCT A;  5ERI A;  3PSI A;  3VDX A;  4Q5S F;  2EA4 A;  4RM2 A;  3TDZ C;  2H1K A;  1LFB A;  1BI3 A;  4L9V A;  1R1U A;  1O7L A;  1RES A;  1J2X A;  2YUS A;  3FHN A;  3R0A A;  4GO1 A;  3F9K A;  2A6E F;  1MMG A;  5DTD A;  1IRZ A;  2PMH A;  3U21 A;  1R5G A;  3TED A;  5C44 J;  1ZGJ A;  3MKW B;  1Z7L A;  2EFP A;  2X6O A;  1RUO A;  2VI6 A;  4PFO A;  2ELK A;  3V42 A;  1OYI A;  3KLO A;  4GFB A;  3D5L A;  3A1Y A;  3U1K A;  5LBQ A;  2CS3 A;  2LC2 A;  1MNE A;  1SD7 A;  3KE2 A;  2HDD A;  3GTP J;  1DPU A;  3EDP A;  1JKR C;  4ZDO A;  1YS7 A;  4RM3 A;  2WBM A;  3VYR B;  5BQT A;  2BV6 A;  3GFJ A;  2FEZ A;  2DW4 A;  5IYB J;  1U5T C;  2DMT A;  5FGM A;  4XRS A;  3ABU A;  1UG2 A;  3TP0 A;  4PJM A;  4OIO F;  2OF7 A;  2PLY A;  1KU3 A;  3H35 A;  2KDZ A;  3BZK A;  2ZME A;  2PN6 A;  4A5M A;  3ABM H;  2EBI A;  3HSR A;  5BNG A;  5M5X J;  4RAZ A;  3ECO A;  4IX7 A;  4B4C A;  1VTN C;  4IHT A;  2IXS A;  3V8L A;  4ESF A;  1X1B A;  2CO5 A;  1KZH A;  3JSO A;  2QUF A;  3ZMU A;  2HQN A;  3T8T A;  2QBY B;  1CF7 A;  4JOM A;  2LD5 A;  2PQ8 A;  2EB7 A;  2VXZ A;  3A0H C;  4U7D A;  1AWC A;  1IDZ A;  2MYS A;  5A2Q Z;  3OOP A;  4II3 A;  3V8J A;  3B6C A;  2H09 A;  2NOJ B;  4PGH A;  1TBX A;  3O3K A;  1NTC A;  3EQL F;  4CIC A;  2D45 A;  2DT6 A;  2HS5 A;  3CUO A;  3K2A A;  2HWV A;  5EEH A;  3BG9 A;  3KP2 A;  3FF5 A;  1MSF C;  3KP4 A;  2M87 A;  1RR8 C;  2L9N A;  4M73 A;  4E6K G;  4EAT A;  4MLO A;  3CUQ A;  1QZZ A;  5CLS A;  1U5T B;  2Z16 A;  1FWZ A;  3GTJ J;  3G71 I;  5IT9 Z;  4A5N A;  3CUQ C;  3OR1 C;  3ZR8 X;  3P9K A;  2ZJQ F;  2MFZ A;  2NNN A;  4BGD A;  2NRA C;  1FYL A;  4G94 A;  4BXF A;  6PAX A;  4G12 A;  2Y0S A;  2G7U A;  1F4K A;  4LB6 B;  3QOP A;  3FXM A;  4AWX B;  4QSH A;  4LIV A;  5AON A;  1Y8R B;  2DJI A;  3CC4 I;  3FXL A;  1OFC X;  1K78 B;  3ZQQ A;  2MW8 A;  5DD8 A;  3PO2 J;  2VQL A;  3LSJ A;  2X6X A;  1YX3 A;  2DDB A;  1VQ4 I;  1PYV A;  2QVO A;  4BDY A;  4AD9 A;  2XKO A;  2W1O A;  4HX4 A;  4PCQ A;  4PJN A;  1JT6 A;  2JUG A;  2P6T A;  3HOT A;  3BR0 A;  2NAZ A;  3R4K A;  4P96 A;  4M6X A;  3ZQL A;  2DMN A;  2DXI A;  2IW5 A;  4HDU A;  1Z1D A;  1U2W A;  2AS5 F;  1HKT A;  4ZZD A;  5KVR A;  4HLY A;  3E0J B;  1S29 A;  1PJR A;  2ZXW H;  1XDU A;  4A3E J;  1W5T A;  2Y2Z A;  3CCY A;  2JA2 A;  4LG0 B;  4XSX F;  4XM3 A;  5LHH A;  3QOD A;  2HZD A;  1SFU A;  4ESJ A;  1EF4 A;  4B1R A;  4XLP F;  2O0Y A;  3S1Q J;  4J01 A;  3C2H A;  3K4L A;  3ZQF A;  4IRI A;  4FTH A;  2HR3 A;  1FP2 A;  2EFN A;  1LVA A;  4II2 A;  2CUZ A;  3ASO H;  2F2E A;  3SHF A;  2XF6 A;  3S17 J;  1IXS B;  4CYC A;  4BE0 A;  4RGS A;  2R7O A;  4I6Z A;  5J6X A;  3PJR A;  2PJR B;  1RC9 A;  1G8X A;  2LKP A;  1KQ0 A;  3OYB A;  2DO7 A;  2GOX B;  3M8E A;  4HX8 A;  4E7K A;  4HW0 A;  4QLC U;  3OYJ A;  2IVM A;  2M3A A;  5F04 A;  3RSN A;  1T33 A;  2CQ7 A;  1HF0 A;  4DOZ A;  3BJ6 A;  1F5T A;  3U9G A;  4XKC A;  4L0Y B;  1MKM A;  3OY9 A;  3HOY J;  3KP6 A;  5E3L A;  2CW7 A;  5CPR B;  1HQC A;  3N97 A;  3R0J A;  1O4X A;  2JVH A;  2Y9Y A;  2ZCW A;  5KAF C;  1G3Y A;  1YJW I;  2DA7 A;  3OL4 A;  3SZT A;  2FOW A;  4RLQ A;  3PNV A;  2LBF B;  3C2G A;  2M9H A;  3BG6 A;  1PP8 F;  1JKO C;  2DI3 A;  3Q3S A;  1OLT A;  3VSL A;  3IC7 A;  2V26 A;  2V7F A;  1P2F A;  3VWB A;  1XSD A;  2LP0 A;  3ELK A;  5IYC J;  1Y0U A;  2TDX A;  1I6X A;  2W4S A;  3KZY A;  1XX5 A;  1ZG5 A;  3GTM J;  2ZXH A;  5M3F J;  1YIO A;  4TV7 A;  3QU3 A;  4YIR X;  2QM3 A;  2JZY A;  2WAQ A;  2ZKZ A;  5GAH J;  3S3O A;  3G3Z A;  2WC2 A;  1ZAR A;  5K1Y A;  2XC7 A;  4OMY A;  1OCT C;  3T0Y A;  5LGT A;  3OSG A;  5FD6 A;  3I4M J;  2XGD A;  3MQ0 A;  4W1U A;  2XAH A;  2OD5 A;  1I39 A;  1UFM A;  2EIJ H;  2FBK A;  4F93 B;  1W0U A;  1I27 A;  1BM9 A;  3BR5 A;  3JTH A;  4EM1 A;  4XID A;  2VXD A;  1ORK A;  4Y3O A;  2JA7 J;  2YS9 A;  1LEB A;  2EQR A;  1HC8 A;  4RMN A;  1A31 A;  4IHS A;  3QP5 A;  4U88 A;  4DBR A;  3BC8 A;  2Y0S N;  4BUP A;  3H9G A;  5FLM J;  3RQ4 A;  4I09 A;  4HNT A;  2Y48 A;  1FOK A;  5FKL A;  3E6C C;  1ZR2 A;  3TOB A;  1BR4 A;  5LGU A;  3VFZ A;  1FIA A;  4IHX A;  1RET A;  4ZYD A;  2F5E A;  3CC2 I;  2RAE A;  2XF5 A;  4KIF A;  2LYC A;  2BY2 A;  2DMQ A;  1JXS A;  4I0B A;  3OS0 A;  1HDP A;  1QRY A;  2JMW A;  2JN6 A;  5DCF A;  4KN4 X;  1WI9 A;  3HEF A;  1GHC A;  2RV8 A;  2LSO A;  3LA2 A;  1RNL A;  2DQR A;  3JRI A;  4XOR A;  5FO5 A;  3EUH A;  3UKG A;  1D0X A;  4X6A J;  1XB4 A;  3H0D A;  2VQG A;  4M9Z A;  2EH3 A;  1JUM A;  4OIQ F;  1MNM C;  3PO3 J;  2OCE A;  1ON1 A;  1XSV A;  1ZN2 A;  2M7B A;  1MIJ A;  5ILU A;  1OCC H;  3WGG A;  1BW5 A;  2CQN A;  1F9N A;  4EJT A;  3TO6 A;  2RKH A;  1SMY F;  3IRR A;  3TOA A;  4JX4 A;  5E3M A;  3PSF A;  3AL0 B;  3D0S A;  3CCS I;  2GM4 A;  5FKK A;  2HVQ A;  4AVZ A;  1QGP A;  2Z5U A;  2DT5 A;  1ONV A;  3JRE A;  1TL8 A;  2CGP A;  4DZP A;  1R58 A;  3TL4 X;  2I10 A;  2AXL A;  3FXR A;  2IS6 A;  2PEX A;  2E7W A;  2FF4 A;  1A5J A;  3UR3 C;  2K85 A;  3QRF F;  2FJ1 A;  3NAR A;  4W97 A;  3H5N A;  1LDJ A;  2XPW A;  2VN2 A;  1REP C;  5LD2 C;  3MEX A;  3NEU A;  2FX0 A;  3OYN A;  4MQ9 F;  2CV1 A;  2K9L A;  2FMY A;  5FKO A;  1F43 A;  3D1N I;  2BE5 F;  2ECB A;  2OJE D;  2EK5 A;  2V1D A;  1Z9C A;  1EH8 A;  3EYY A;  4S0H B;  4UUS A;  2OTL I;  1J75 A;  3J7A Y;  2H1L A;  5LGN A;  2ID3 A;  2E35 A;  4AYB A;  1IZ1 A;  4QWQ A;  2BEO A;  3LFU A;  2EIM H;  1BOA A;  1R5I D;  5D4R A;  4ZTF A;  1GDT A;  4IZZ A;  1FC3 A;  2B7E A;  3KX2 A;  3H3V K;  3ZXS A;  1DGW Y;  2BW3 A;  4ZDP A;  1ETY A;  3H9J A;  4PFP A;  3CQZ J;  3W6V A;  2WAF A;  3BG7 A;  2MC3 A;  3HUG A;  3ZQG A;  1EV7 A;  3HHH A;  5ICG A;  2VBW A;  1NG7 A;  4BXU A;  5C3E J;  4X0G A;  2QQ8 A;  3MVP A;  4PJJ A;  1ZRF A;  1O7F A;  2YX7 A;  4HSR A;  3VOD A;  1B8I A;  5B1A H;  2MH2 A;  2JRT A;  5B1B H;  5GTH C;  5H6R A;  1U3E M;  3BOQ A;  1OR7 A;  4GYG A;  5TRD A;  1H8A C;  1FEX A;  3W3C A;  4KT5 C;  2FXA A;  3BY6 A;  1DQU A;  4XQF A;  1BN5 A;  3AG4 H;  2L02 A;  4HBL A;  4YIF A;  5CQE A;  3REO A;  4NBQ A;  2KIU A;  1VI0 A;  3DPL C;  3I59 A;  2DU9 A;  1QHG A;  2ZNY A;  2XAS A;  3G1L A;  3I0T A;  1SAX A;  2JA5 J;  1ZRE A;  3ZP5 A;  3M8J A;  2JRM A;  2HXO A;  3FIS A;  2PBI A;  1YX5 A;  3IWZ A;  4WXH A;  1BW6 A;  4X1E A;  1MMD A;  5LEJ A;  3HPG A;  3QU6 A;  4L5E A;  2LTP A;  2OUM A;  4HAM A;  1R9T J;  3IP4 B;  3FBN B;  2F5C A;  2HOE A;  4QPQ A;  1DDN A;  1QPM A;  3T1B A;  2OZU A;  3HIF A;  4JX5 A;  4B44 A;  4EQQ A;  1VQ5 I;  4EJV A;  5JVT A;  2MH9 A;  5KNL A;  3L2V A;  2FOK A;  2IGO A;  3WE3 A;  2V79 A;  4V19 K;  2DK5 A;  5FFZ A;  2O9L A;  1FMV A;  1YTY A;  2Y75 A;  1T98 A;  3PIP F;  1IG7 A;  2HKX A;  3GW2 A;  2V6C A;  3WTU C;  2VIX A;  1YLF A;  1IN5 A;  3HSE A;  2L01 A;  3CJR B;  1IRG A;  4IHY A;  2IA1 A;  2BBY A;  4E70 A;  5EG0 B;  4HST A;  2CUF A;  3MN2 A;  2R7F A;  2R5Z B;  1R1V A;  2V1N A;  2GXG A;  4M3D A;  5FLX K;  3FMS A;  2IGN A;  3SDB A;  2JK3 A;  4YRV A;  4EGY A;  3K0L A;  1B72 B;  4BHP A;  3C7J A;  3I4P A;  2ADU A;  1NK2 P;  3L2U A;  4CCN A;  1S7O A;  1EJ9 A;  1AKH B;  4EJU A;  1WSU A;  2LG4 A;  4OU0 A;  2IRF G;  3J7Y J;  3DBR B;  3BPX A;  4WXD A;  1WPK A;  1MBJ A;  3FXJ A;  1POG A;  2IGM A;  1DP3 A;  2FD5 A;  1P7I A;  2DYS H;  3OYG A;  2F5V A;  2ZNZ A;  4YFN F;  1HW2 A;  4F92 B;  4HZF A;  3PIO F;  1S5L C;  1IN8 A;  3CP8 A;  3TO7 A;  1BC7 C;  2JT1 A;  1H88 C;  4PGG A;  1U9O A;  5DCM B;  3RPQ A;  3WTZ A;  3QPL A;  4XKV A;  3V8K A;  3LSH A;  3DEU A;  5CVU A;  3AFH A;  5J47 A;  3B73 A;  4G9Y A;  1YRN B;  4CDG A;  1X1A A;  1XC5 A;  4UVB A;  3S32 A;  1Y1W J;  3C2B A;  3HOX J;  1TNT A;  3DEE A;  2DN0 A;  3LNQ A;  4MFD A;  5ICE A;  2OQR A;  1FYM A;  4AYB N;  5HLI A;  1SAU A;  3GX4 X;  2W57 A;  4BU2 A;  2Q2E B;  2HZT A;  3GUD A;  4QTR A;  3UNG C;  3WU1 B;  2DDA A;  3KP3 A;  4RAY A;  1TWC J;  2PX9 A;  1J59 A;  1ZK8 A;  2HEO A;  3G1O A;  2K9S A;  3ROU A;  3I71 A;  3RKX A;  1B9M A;  2O03 A;  5IOZ A;  1YO5 C;  2K3P A;  2DA4 A;  1J7K A;  1TT5 B;  2HQA A;  1D1B A;  3LST A;  4LGW A;  1MGT A;  3HXL A;  2OBP A;  3FXO A;  1F1Z A;  3KEO A;  4NHJ A;  4O3M A;  4S04 A;  1Y6I A;  2Q0O A;  1YW7 A;  5KAI C;  3F8M A;  2DA2 A;  1MBG A;  2A05 A;  3GWZ A;  1G6N A;  3IUO A;  4RAG A;  3BG5 A;  2HGC A;  1VQ9 I;  3MFK A;  3NQO A;  1FBS A;  5HVQ C;  3GZ6 A;  1D5V A;  2DT7 B;  2L4A A;  1PUE E;  1U8B A;  2PMU A;  3ZQH A;  1OCR H;  3L00 A;  2DPU A;  1IO2 A;  1IV8 A;  3LQQ A;  4UVA A;  4LK0 F;  1B6A A;  1ZR4 A;  4BS9 A;  3BRO A;  4GXO A;  3MWM A;  2LOO A;  3QPT A;  4NQW A;  1ZQ3 P;  1KQ8 A;  3ECH A;  4C2U A;  4OOI A;  3RPU D;  1W5S A;  3KFW X;  1BBY A;  3BG3 A;  4WF2 A;  4IHW A;  1T56 A;  3JAM K;  2X9D A;  3KZZ A;  3AG1 H;  1KU2 A;  5CJ9 A;  2DFE A;  4IKF A;  1WJD A;  3FXQ A;  1WCM J;  2LY1 A;  3GZ5 A;  5GAE J;  3S16 J;  1LE8 B;  1OKR A;  2CV0 A;  4BQO A;  4UHT A;  4HQM A;  1TQP A;  2R93 J;  2VKV A;  3KCC A;  3OS1 A;  2L5Q A;  3HKZ A;  3MAJ A;  1TZL A;  2GXA A;  5E79 C;  2GIZ A;  2Q8K A;  1RKW A;  1XMX A;  3ESW B;  2PMZ N;  3TP3 A;  2QYO A;  3VOE A;  1G3S A;  3L1P A;  4HF0 A;  2HYG D;  2DA5 A;  5CVI A;  4H0E A;  2WAE A;  4FT8 A;  4LB5 A;  4QIW N;  3BR3 A;  1LJ9 A;  3KYD B;  4GGG A;  2KL4 A;  3SXY A;  4A0Y A;  1K61 A;  1R1T A;  2EZI A;  1SVO A;  4M9X A;  1OYY A;  3H5A A;  3MMY B;  4ZH4 F;  4MHG A;  2X51 A;  4JP0 A;  3P5J A;  4I98 B;  1JGS A;  3S2W A;  4YEL A;  4UVC A;  4WXC A;  3F8C A;  2KHM A;  2XRO A;  1Z21 A;  2BGC A;  2FNA A;  2O8K A;  3RIR A;  5FRO A;  5HOD A;  3F22 A;  3OYE A;  2KFD A;  4IRH A;  2RGV A;  1X4P A;  2QWW A;  1PUF B;  3R60 A;  1D0Y A;  1OIS A;  3TQN A;  1MDM B;  1JUP A;  2NVT J;  2V1X A;  4XKW A;  2FUG 2;  3TGN A;  2LY2 A;  1U78 A;  2W25 A;  1MMA A;  2L9R A;  1VQ7 I;  2QA4 I;  2CRG A;  3ZMV A;  1QHH D;  1ZLJ A;  4F52 A;  2R7T A;  2K4B A;  3PUF A;  4JYK A;  2P81 A;  5GTI C;  4ABZ A;  2IS1 A;  5C4X J;  3G4S I;  1UJ8 A;  3J80 Z;  4AUX A;  5IY5 H;  1JTY A;  5F08 A;  3CTA A;  3HYI A;  1JGG A;  1UHW A;  1DPR A;  2AO9 A;  4HF2 A;  1S7E A;  2EFW A;  2X6Y A;  2VC0 A;  3PFY A;  4RB0 A;  1MJ9 A;  1AU7 A;  1OQY A;  2KT0 A;  1W7P B;  5D5U B;  4KN7 X;  4CYD A;  1TTY A;  1TP4 A;  3BWG A;  2ZME C;  3JRH A;  4A3G J;  2L7M P;  1OYW A;  2L2O A;  2YR2 A;  4PK4 A;  1JT0 A;  2XPU A;  1SAN A;  2J5P A;  3RI4 A;  3GYH X;  1HW1 A;  2JPB A;  1YW8 A;  2Y0M A;  2WA0 A;  4V2F A;  1EKE A;  2R4G A;  2NS0 A;  5E17 F;  5FKN A;  1JE8 A;  1R49 A;  2RDP A;  1D8J A;  2Z1D A;  4KIB A;  4LIT A;  3S1M J;  1CQT A;  1WH5 A;  2LNB A;  1ITY A;  3V7S A;  1BI0 A;  2E2J J;  2STT A;  3CF2 A;  1Z7U A;  2BVM A;  1TWH J;  2E1O A;  1X3Z B;  2XB5 A;  1P4W A;  2LLK A;  1Q1H A;  2M0M A;  1SEU A;  3VYT B;  1O3R A;  3H36 A;  1XPX A;  1TWF J;  3BJA A;  2E1M C;  4IQ4 A;  1K78 A;  2KP6 A;  5LRS A;  2M7A A;  3NAU A;  4Y7N J;  1VND A;  2BHY A;  4BJ5 C;  4C2T A;  3K4K A;  2OV7 A;  3CMM A;  1V4R A;  4A0Z A;  1IJW C;  4Y13 A;  3QOE A;  1R7J A;  4G6T B;  3RTR A;  2A07 F;  4XLA A;  2D1H A;  1FOW A;  3SYT A;  1VQ8 I;  1E0E A;  2VPR A;  2VJ5 A;  3A2K A;  3CD6 I;  1QQI A;  4BQN A;  1SVM A;  5IP6 A;  4J19 A;  3LAJ A;  4I2O A;  1NH3 A;  5HNH A;  2DTZ A;  3MZY A;  1KON A;  3I55 I;  5EDN A;  3CDI A;  1VQ6 I;  2BHZ A;  1T39 A;  1K7A A;  4NC8 A;  3LSG A;  3QPS A;  5L3G A;  2Z9O A;  4LG0 A;  1BI1 A;  2W82 A;  3ONQ A;  4YFK F;  1BC8 C;  2AXT C;  4OIN F;  3E7L A;  1LEA A;  3F8F A;  1CF7 B;  1YIJ I;  1G4D A;  1MZB A;  5HDN A;  2R7Q A;  2W84 A;  4KDP A;  2VBY A;  2WV0 A;  2P5K A;  5LEK A;  2UWM A;  3DTE A;  2LK2 A;  5B66 C;  1E3O C;  5F27 A;  5KK1 A;  3M07 A;  4HQE A;  1MND A;  5CVJ A;  4KMU X;  3PFI A;  3CCJ I;  2XPV A;  4LK1 F;  4N9I A;  4MEX F;  2VKH A;  5EJC A;  3IH4 A;  1FIP A;  3JRD A;  5DS9 A;  3CJQ B;  4XL9 A;  3ASN H;  3Q9S A;  2QEX I;  3CUQ B;  3HRS A;  5DYM A;  1V54 H;  4A6E A;  3J81 Z;  1KU7 A;  1GXQ A;  2RQP A;  3IWF A;  4UY8 I;  1KYZ A;  3OYD A;  2NOG A;  5AIQ A;  1N25 A;  4XK4 A;  3JRG A;  1XGN A;  2FA5 A;  2QEN A;  2XIG A;  2ME6 A;  1UMQ A;  3R61 A;  2H6C A;  2ZSI B;  3Q9V A;  1D0Z A;  3E6D A;  2HVS A;  3LL7 A;  2GIV A;  1X4O A;  2KRH A;  1DU6 A;  1N75 A;  4DNC A;  3DCF A;  5EGO B;  1JI8 A;  1IRF A;  1R4M B;  2CYY A;  4ZYG A;  1Z6R A;  3F8B A;  1UST A;  4RLF A;  1Y39 A;  4BEH B;  3O6B B;  2ELJ A;  4ZDL A;  1FSH A;  2LBF A;  2L4M A;  3LFK A;  3E1S A;  3GTG J;  4JQF A;  4XRF A;  4CA0 A;  3S8P A;  4Q4Z F;  3T5X A;  4LG3 A;  1FSE A;  4A3I J;  1HA8 A;  2A5Y B;  3F6O A;  3HC7 A;  4Y4R A;  2XF7 A;  1KGS A;  3DLL F;  2OAZ A;  2JA8 J;  1MBK A;  1JKP C;  3JW4 A;  4P9U A;  3BTJ A;  5F0C A;  1TWG J;  2V1U A;  3I53 A;  5K5O A;  1QU3 A;  2ZXJ A;  3NWS A;  3GVA A;  2BYV E;  3L2R A;  3GF2 A;  4F7Z A;  2PFB A;  3OYF A;  1X1D A;  1QNT A;  2E36 A;  1BOB A;  1P6R A;  2DTR A;  4M72 A;  3BJO A;  1FTT A;  2PI0 A;  2O8X A;  5KHD A;  2O7O A;  4BXX J;  3DFG A;  2R0Q C;  4E7S A;  5BPD A;  3P9C A;  4I02 A;  3DEW A;  2ZJ2 A;  3VPR A;  3LQR A;  1W5C C;  4CHU A;  1STZ A;  1UCR A;  1YYV A;  2MLK A;  4U0Y A;  1X1P A;  4I7H A;  1XGM A;  4JK1 X;  5L3C A;  3F3X A;  2XB0 X;  2ECC A;  1VFC A;  4Z2Y A;  2FBI A;  4Y17 A;  3E5U A;  4M3G A;  3QPH A;  4OMZ A;  2X1E A;  5JI6 A;  2GQQ A;  3C3W A;  3TW7 A;  2M30 A;  2VUM J;  3MKY B;  1OCP A;  2LMD A;  2UZK A;  5FJ8 J;  2P5L C;  1FMW A;  3LAP A;  1IUY A;  5HLT A;  3M4O J;  4HRI A;  4KFC A;  1XG1 A;  4BE1 A;  2O5R A;  3OR2 C;  4A3L J;  3A01 B;  5E3O A;  2R7R A;  1I1S A;  2IEK A;  4BJT A;  5JVG F;  2OC6 A;  1V5E A;  1SD4 A;  1WQ2 A;  2K7L A;  2R92 J;  1J9I A;  3AKZ A;  3LWF A;  4NB5 A;  4C9Y A;  1UAA A;  3ZQC A;  3BLY A;  4BAY A;  4MO7 A;  2QKM B;  4E4H A;  2LR8 A;  4BL0 B;  2E2I J;  4I0A A;  3C1D A;  3W6K B;  3CES A;  3U1D A;  3O8H A;  2B9S A;  5ILS A;  1WI3 A;  1HCR A;  4BE2 A;  1TT0 A;  1QZY A;  3CCL I;  1SVL A;  5LRR A;  3K70 D;  1SFX A;  3ABK H;  3EUH C;  3I64 A;  2EIN H;  3CO7 C;  2EWN A;  2D5V A;  1T2K A;  1QA6 A;  2FE3 A;  4BY7 J;  5F6F A;  4WK8 F;  5EEG A;  2RQQ A;  2STW A;  1QO0 D;  4XLC A;  4XLF A;  1GV2 A;  5E20 A;  3H0G J;  1G59 A;  4GRI A;  3NRV A;  3M1E A;  3EUK L;  2NVQ J;  1FP1 D;  4DZJ A;  2HPM A;  5B3S H;  2EIK H;  4EM2 A;  1A6I A;  1S3J A;  4XOT A;  4CZC A;  5ED4 A;  3IRQ A;  1HKQ A;  3FMQ A;  3ZQ7 A;  2BY0 A;  3WOD F;  1E3H A;  2X48 A;  3RQI A;  1ODD A;  5HNF A;  4BBS J;  2CJJ A;  3HHG A;  3AG3 H;  4RS8 A;  2H27 A;  2R7X A;  3OYL A;  5FRN A;  4M3B A;  2ZXI A;  4HLX A;  1E2X A;  1YG2 A;  2KQR A;  1XCB A;  2CWE A;  3M8F A;  2EZL A;  1HW5 A;  3I5U A;  4A3C J;  2QQ9 A;  3TKY A;  1G3T A;  3K6G A;  1ZYR F;  3GFI A;  4G7Z F;  4NUB A;  3RJP A;  1S6L A;  3KET A;  4CCM A;  3WTT C;  3QYF A;  2A6H F;  4UB6 C;  1T0F A;  2E5Z A;  1K79 A;  3PNT A;  4KYW A;  2YU3 A;  1D1C A;  4DIQ A;  5BPI A;  5E1X A;  1R23 A;  3DKX A;  1TWA J;  4P9F A;  3FXU A;  2V4J C;  2R5Y A;  1FT9 A;  4ZYE A;  3F6V A;  3GEZ A;  2XVC A;  4A6D A;  3W2W A;  2IJL A;  1EH6 A;  1WVR A;  3S14 J;  1MH4 A;  3H92 A;  1TQM A;  3HRM A;  4MTD A;  2K27 A;  4F3Q A;  4S05 A;  4CUG A;  5EF6 A;  2ZB9 A;  3WTY C;  1KA8 A;  1ZKG A;  4AVP A;  4PZJ A;  1NK3 P;  2A3S A;  1USS A;  4RGX A;  3H9Q A;  5EZH A;  2WAQ N;  3G2B A;  1WRJ A;  4HF1 A;  5HLG A;  1OR7 C;  1IN7 A;  3I9V 2;  1FZP B;  4ZJZ A;  4BAC A;  3QYE A;  4GDF A;  5E3N A;  5E1Z B;  2GZW A;  1I3Q J;  2B63 J;  2KRF A;  1U6G A;  3IV5 A;  3LA7 A;  4M6V A;  2XSD C;  4HDV A;  1LKX A;  2E71 A;  9ANT A;  3JRF A;  1UB9 A;  4FCY A;  4FE4 A;  5EG0 A;  1HDD C;  3EPZ A;  2P7C B;  1T95 A;  4Y33 A;  5J4Y A;  4G7O F;  1F36 A;  2KIM A;  2KJC A;  2WV1 A;  1WHU A;  4CZZ A;  4C3I J;  1ZGW A;  2R5Z A;  3FM5 A;  4RGR A;  5IP9 J;  3I4N J;  2HQR A;  2MLG A;  5A2Q K;  4E7Z A;  1X2M A;  4E7L A;  1B72 A;  4CH7 A;  2DK8 A;  3VYS B;  4ZYH A;  1XS9 A;  4KJZ A;  1BI2 A;  4BH9 A;  2NXN B;  3N05 A;  3BZC A;  2EA2 A;  1MBF A;  2FU4 A;  3OMY A;  4Y15 A;  1I6H J;  2LRD A;  2Y31 A;  2KIF A;  4ETS A;  3VB2 A;  1B9N A;  3IAM 2;  3GBG A;  3S2D J;  4R79 A;  1X3U A;  1OMI A;  3CF5 F;  1J09 A;  3S1R J;  3H3U A;  3SFI A;  2ISZ A;  5IT9 K;  3HTU A;  5D4S A;  4KA4 A;  5CVV A;  3ZMS A;  5JHU A;  1IXC A;  1XGO A;  2CQX A;  2WB1 A;  3WHC A;  4XSZ F;  3E5X A;  2AHQ A;  3CMY A;  4L5I A;  2VC1 A;  2XHK A;  5DCM A;  1QPI A;  3F8N A;  1N78 A;  1X58 A;  3FK6 A;  3ZGK A;  3HJE A;  2G7H A;  3IH3 A;  5BMZ A;  1YRN A;  1XMA A;  4LJZ F;  2KPM A;  2HTJ A;  2MSY A;  2YPR A;  3ZMT A;  2A5W A;  2P5V A;  1YHQ I;  5HOO A;  1W1W E;  1IGN A;  2GOM A;  2DA1 A;  2Z99 A;  4IPA A;  4N4O B;  1WJB A;  3LSI A;  2Q2E A;  4M74 A;  1Y56 A;  2HVR A;  3RZO J;  2LFB A;  4RB3 C;  3GFM A;  1UHS A;  2DMU A;  3M9A A;  2R7W A;  4G7H F;  1R22 A;  2HFH A;  3GME A;  4A12 A;  2P4W A;  3ZN0 A;  1A35 A;  1YOV B;  2L7K A;  2ZJP F;  2K9M A;  2L54 A;  3KEY A;  4U0V A;  4B8X A;  4IEJ A;  1RIO H;  1K6O A;  2DFI A;  1H89 C;  1IDY A;  4DBQ A;  4CCO A;  1ETV A;  3B02 A;  1ZGA A;  1TC3 C;  3HOZ J;  1FOY A;  3FXK A;  3J81 K;  1IRX A;  3CO6 C;  1GXP A;  1W4M A;  4CCK A;  5DM6 F;  3RKY A;  2RNG A;  1Z3X A;  3WU0 A;  3I56 I;  1GLN A;  1IN4 A;  1R6R A;  4XBF A;  4IQJ A;  1XCV A;  1LDD A;  1L3L A;  3OYI A;  2K40 A;  2V9V A;  2HOT A;  2GA2 A;  2L7F P;  2NS7 A;  1UHM A;  3AG2 H;  4M9S A;  4YG2 F;  2RVC A;  1ZRC A;  3PQK A;  1M1E B;  3C18 A;  3L9F A;  3HSF A;  4I01 A;  5F0H A;  2OCC H;  2EJR A;  3GTO J;  1RKT A;  2HU9 A;  3H3Z A;  4RB2 C; 
#chains in the Genus database with same CATH homology
 5ILV A;  4KNY A;  1ZH5 A;  2COM A;  5D5X B;  1T38 A;  3FMR A;  4WWC A;  5D6E A;  5LHI A;  1O3T A;  2G9W A;  3GO5 A;  2LDU A;  2QQA A;  1HKS A;  5E1W A;  1HSJ A;  1SFE A;  3ISP A;  3K1P A;  5K5R A;  2YX4 A;  4EGZ A;  2LF8 A;  3RDI A;  4L9T A;  3ABT A;  3K9T A;  3DV8 A;  2CW0 F;  4IJA A;  2P8T A;  2XAG A;  3ZPL A;  3HRT A;  4LLG F;  1J0R A;  5J8C A;  3EET A;  2ESH A;  2NYX A;  2VE8 A;  2UXN A;  4BNC A;  2OQG A;  1W7P D;  2F5D A;  3F21 A;  3F23 A;  1RI7 A;  3V7R A;  2K02 A;  3BDD A;  4ENJ A;  4A2U A;  1MDM A;  3R6S A;  1IF1 A;  2EFO A;  5L3D A;  3K2Z A;  1TW2 A;  1JHF A;  4PDK A;  1L0O C;  4A0X A;  5FD5 A;  4FHT A;  3TDU C;  2HDC A;  3RPU A;  4LLL A;  4HYE A;  4R1H A;  1D3Y A;  5HS9 A;  3HTS B;  2ZO4 A;  2B0L A;  2KJB A;  1FBQ A;  2EV0 A;  2DQL A;  4MTE A;  4DQ2 A;  1LNW A;  4MEY F;  3WGH A;  2QBY A;  3K1M A;  1DUX C;  2ZBK A;  3DQV C;  4RB1 A;  1MD0 A;  2OZ6 A;  4EJW A;  1FLI A;  3FWE A;  3WTV C;  1CGP A;  2F5F A;  4KUM A;  1J5Y A;  1NHA A;  2KKO A;  2LF7 A;  1KU9 A;  1KQ9 A;  1XGS A;  1XDS A;  4B09 A;  1OPC A;  3KP7 A;  1U5T A;  1H0M A;  2JTV A;  5AIP A;  2XV4 S;  3E97 A;  4AIK A;  3L09 A;  2QQB A;  4CO8 A;  2FRH A;  3HOS A;  2MA3 A;  1IW7 F;  4WX9 A;  5IT3 A;  2IA0 A;  1BIB A;  4EMS A;  4O5V A;  3E5Q A;  1B59 A;  3OV8 A;  4LFU A;  2JPC A;  1O3S A;  2A68 F;  1Z91 A;  2CFX A;  2IT0 A;  5HDK A;  2ESN A;  4CGZ A;  1JHH A;  4BQA A;  2MBF A;  2EFQ A;  1SMT A;  3MCZ A;  2ZME B;  1XSX A;  2GAU A;  3COA C;  3CDH A;  3WGI A;  3P7N A;  3DXJ F;  4YFX F;  2DBB A;  2XUB A;  1S7A A;  5FLX Z;  3AAF A;  3RYR A;  1XD7 A;  2L3D A;  5DD4 A;  1H9T A;  1BJA A;  4LD5 A;  1A04 A;  4R8H A;  5HS7 A;  2X0L A;  1FNN A;  3BZ6 A;  4N0B A;  4AIH A;  3V4G A;  1ULY A;  4IRG A;  3K1N A;  4HV5 A;  3G73 A;  1FX7 A;  2HYF A;  1SD5 A;  1PP7 U;  1RZ4 A;  3K69 A;  3WG9 A;  1D8K A;  5FFX A;  2O6G E;  4KMF A;  3P9I A;  1B1B A;  4OIR F;  4EV0 A;  3DPT A;  3E6M A;  1Z05 A;  3DF8 A;  1XN7 A;  3ZMD A;  1IN6 A;  2E1N A;  1KYW A;  4RGU A;  3FHZ A;  2X4H A;  2E1C A;  5CVR A;  2FSW A;  4EVI A;  2XKP A;  3FX3 A;  1ON2 A;  2RN7 A;  3V7C A;  2VBZ A;  4IXA A;  5H20 A;  4ON0 A;  4M71 A;  2IA2 A;  3WE2 A;  2A69 F;  4L9N A;  2NNY A;  2CG4 A;  2VT2 A;  4IF4 A;  2R7D A;  2FQ3 A;  4ASN A;  5TJJ A;  2K86 A;  5DUI A;  5HS8 A;  1HXD A;  3ZMZ A;  4HX7 A;  5K5Q A;  5E18 F;  3KLN A;  3JAM Z;  2CQK A;  1ZHF A;  1G3W A;  5CYV A;  1PDN C;  4M6Y A;  2RNJ A;  1IXR C;  4O6J A;  4ENM A;  4U0W A;  2Z3Y A;  5DDG A;  4KIC A;  2XAQ A;  3T8R A;  1LDK B;  4KIG A;  5F64 A;  1FYK A;  2GWR A;  5D8L B;  4G6D A;  1MJA A;  3F72 A;  1GVJ A;  2OA4 A;  3LA3 A;  2XRN A;  4BHC A;  5HLH A;  1P4A A;  5DV5 A;  2M45 A;  4JBA A;  3ERE D;  2W85 A;  2UXX A;  2RC4 A;  1ZRD A;  2M1B A;  2O3F A;  5FB2 A;  2WWY A;  3L7W A;  4UNO A;  1EH7 A;  2PJP A;  2GXB A;  5HDG A;  2E7X A;  2FBH A;  1BIA A;  2FNP A;  3SFZ A;  2VOO A;  4L5J A;  3E3V A;  1E17 A;  4AIJ A;  2D2W A;  2XGX A;  3FM3 A;  1YS6 A;  3EYI A;  1LQ1 A;  2DAO A;  1TW3 A;  4IVN A;  4UV8 A;  1WKM A;  5DEQ A;  1H9G A;  3FZV A;  5L3F A;  4HV6 A;  4N9H A;  5JR3 A;  3J7A O;  4WCG A;  3J80 K;  2ISY A;  3CLO A;  2D1V A;  2VE9 A;  4UXN A;  4ZZL A;  1FY7 A;  3N4M A;  4LMY A;  5J8F A;  2PG4 A;  2VOD A;  3ZN1 A;  4Q47 A;  5JFR A;  3HRU A;  2EV5 A;  4MGR A;  4U7B A;  4EM0 B;  4G6Q A;  2XAJ A;  2JSC A;  4GYI A;  4UV9 A;  1RUN A;  1YQA A;  1HST A;  1LB2 A;  5F1R A;  1S8N A;  3BPV A;  1FPQ A;  3O2P E;  3DKW A;  5L3B A;  4EJO A;  2XAF A;  2IPQ X;  5ICC A;  5LLQ A;  3Q5F A;  1TQI A;  3W6J B;  1TNS A;  2W24 A;  2VON A;  1R00 A;  3IHU A;  2VOP A;  2MD5 A;  2IP2 A;  5E8I A;  3QP6 A;  4P55 A;  4OIP F;  3KEQ A;  2DLL A;  3DP7 A;  3RYP A;  3E6B A;  3I59 B;  4MNU A;  1AOY A;  4Q48 A;  2M5W A;  1C0W A;  3ULQ B;  1ZAO A;  1T6S A;  3JSP A;  2ACJ A;  4CXF A;  1I5Z A;  3MZH A;  1O57 A;  3IKV A;  1ZLK A;  4L9J A;  3L2C A;  2M8E A;  3GLX A;  3CJN A;  2YSR A;  3U2R A;  5D5V B;  2H94 A;  4D0P A;  2VBX A;  2J5O A;  1YFH A;  3ML6 A;  4UUV A;  1ZG1 A;  5D8K B;  4L18 B;  2C6Y A;  4MQV A;  3GFL A;  3IL2 A;  1TLH B;  1U8R A;  2HKO A;  2H6B A;  3BP8 A;  1MJB A;  2P6S A;  2ETH A;  1WWX A;  3WTW C;  1R5H A;  2A61 A;  4GCV A;  5L3E A;  1FBU A;  1XMK A;  3RKW A;  3SQN A;  1P92 A;  4FX0 A;  4XLN F;  2ZFW A;  3WTS C;  4ESB A;  4P5O A;  3QAH A;  4FX4 A;  5BS6 A;  4ENN A;  3GXO A;  4BHB A;  3IKT A;  1O3Q A;  3JTG A;  2R3S A;  5ICF A;  1V3F A;  4G8X A;  3TO9 A;  1YW9 A;  5D6F A;  3VEP A;  1R36 A;  5D5W B;  2WTE A;  2VT3 A;  5DUK A;  1IAW A;  1Z6T A;  2CSO A;  4ENK A;  1P4X A;  2EV6 A;  1HBX G;  2QZ8 A;  4HA8 A;  2ELH A;  2HTS A;  3WTX C;  3I58 A;  3PQJ A;  1I1G A;  3M7G A;  5E8G A;  2K4J A;  1DP7 P;  3SZP A;  2P7V B;  2DPD A;  4BYY A;  2GA1 A;  5H6Q A;  2Z33 A;  4HOB A;  4LLN A;  1ZG3 A;  2FML A;  5BOX A;  5LHG A;  2OU2 A;  2O61 A;  4YII A;  1QBJ A;  1B4A A;  4K2E A;  3KP5 A;  1SD6 A;  2QLZ A;  3I54 A;  4L0Z B;  1W7P A;  5ERI A;  4Q5S F;  2EA4 A;  3TDZ C;  1BI3 A;  4L9V A;  1R1U A;  1O7L A;  1J2X A;  3R0A A;  4GO1 A;  2A6E F;  2PMH A;  1R5G A;  1ZGJ A;  2EFP A;  1RUO A;  1OYI A;  3KLO A;  3D5L A;  5LBQ A;  1SD7 A;  3KE2 A;  1DPU A;  3EDP A;  1YS7 A;  5BQT A;  2BV6 A;  3GFJ A;  2FEZ A;  2DW4 A;  1U5T C;  5FGM A;  3ABU A;  4OIO F;  2PLY A;  1KU3 A;  2ZME A;  2PN6 A;  4A5M A;  3HSR A;  1VTN C;  4RAZ A;  3ECO A;  4IHT A;  3V8L A;  4ESF A;  2CO5 A;  3JSO A;  2QUF A;  3ZMU A;  2HQN A;  3T8T A;  2QBY B;  1CF7 A;  2PQ8 A;  2EB7 A;  2VXZ A;  4U7D A;  1AWC A;  5A2Q Z;  3OOP A;  3V8J A;  2H09 A;  4PGH A;  1TBX A;  3O3K A;  3EQL F;  4CIC A;  2D45 A;  2HS5 A;  3CUO A;  2HWV A;  5EEH A;  3KP2 A;  3FF5 A;  3KP4 A;  2M87 A;  4M73 A;  3CUQ A;  1QZZ A;  5CLS A;  1U5T B;  1FWZ A;  5IT9 Z;  4A5N A;  3CUQ C;  3P9K A;  2NNN A;  2NRA C;  1FYL A;  4G94 A;  6PAX A;  2G7U A;  1F4K A;  4LB6 B;  3QOP A;  4AWX B;  5AON A;  1K78 B;  5DD8 A;  2QVO A;  4AD9 A;  2XKO A;  4HX4 A;  4PCQ A;  2P6T A;  3HOT A;  2NAZ A;  3R4K A;  4P96 A;  4M6X A;  2IW5 A;  4HDU A;  1Z1D A;  1U2W A;  2AS5 F;  1HKT A;  4ZZD A;  5KVR A;  4HLY A;  1S29 A;  1XDU A;  1W5T A;  4LG0 B;  4XSX F;  5LHH A;  1SFU A;  4ESJ A;  4XLP F;  2O0Y A;  4IRI A;  2HR3 A;  1FP2 A;  2EFN A;  1LVA A;  2F2E A;  3SHF A;  1IXS B;  4RGS A;  5J6X A;  2LKP A;  1KQ0 A;  2DO7 A;  3M8E A;  4HX8 A;  4HW0 A;  4QLC U;  2IVM A;  3BJ6 A;  1F5T A;  3U9G A;  4L0Y B;  1MKM A;  3KP6 A;  1HQC A;  3N97 A;  3R0J A;  2ZCW A;  1G3Y A;  3SZT A;  1PP8 F;  2DI3 A;  3IC7 A;  1P2F A;  1XSD A;  3ELK A;  1Y0U A;  2TDX A;  1I6X A;  3KZY A;  1ZG5 A;  1YIO A;  4TV7 A;  3QU3 A;  2QM3 A;  2JZY A;  2ZKZ A;  3G3Z A;  2WC2 A;  1ZAR A;  5K1Y A;  4OMY A;  3T0Y A;  5LGT A;  5FD6 A;  3MQ0 A;  2XAH A;  2OD5 A;  1UFM A;  2FBK A;  1I27 A;  1BM9 A;  3JTH A;  4EM1 A;  1LEB A;  4IHS A;  3QP5 A;  4U88 A;  4I09 A;  1FOK A;  2Y48 A;  3E6C C;  3TOB A;  5LGU A;  3VFZ A;  4ZYD A;  2F5E A;  4KIF A;  1JXS A;  4I0B A;  5DCF A;  4KN4 X;  1WI9 A;  1GHC A;  2RV8 A;  2LSO A;  3LA2 A;  1RNL A;  2DQR A;  5FO5 A;  3EUH A;  1XB4 A;  4M9Z A;  4OIQ F;  1ON1 A;  1XSV A;  1ZN2 A;  5ILU A;  3WGG A;  1F9N A;  4EJT A;  3TO6 A;  2RKH A;  1SMY F;  3IRR A;  3TOA A;  3D0S A;  1QGP A;  2Z5U A;  2DT5 A;  1ONV A;  2CGP A;  1R58 A;  2AXL A;  3FXR A;  2PEX A;  2E7W A;  2FF4 A;  3QRF F;  1LDJ A;  2VN2 A;  1REP C;  3MEX A;  3NEU A;  4MQ9 F;  2FMY A;  2BE5 F;  2EK5 A;  2V1D A;  1Z9C A;  1EH8 A;  3EYY A;  1J75 A;  5LGN A;  1IZ1 A;  4QWQ A;  2BEO A;  1BOA A;  5D4R A;  1FC3 A;  2MC3 A;  3HUG A;  1EV7 A;  3HHH A;  5ICG A;  2VBW A;  4BXU A;  1ZRF A;  1O7F A;  2YX7 A;  3VOD A;  2MH2 A;  2JRT A;  5H6R A;  1U3E M;  3BOQ A;  1OR7 A;  4GYG A;  5TRD A;  4KT5 C;  2FXA A;  3BY6 A;  1BN5 A;  2L02 A;  4HBL A;  4YIF A;  3REO A;  2KIU A;  3DPL C;  3I59 A;  2DU9 A;  2ZNY A;  2XAS A;  3I0T A;  1SAX A;  1ZRE A;  3ZP5 A;  4WXH A;  3IWZ A;  2PBI A;  5LEJ A;  3QU6 A;  4HAM A;  2F5C A;  2HOE A;  1DDN A;  1QPM A;  3T1B A;  2OZU A;  3HIF A;  4EQQ A;  4EJV A;  5JVT A;  2MH9 A;  2FOK A;  3WE3 A;  2V79 A;  2DK5 A;  5FFZ A;  1YTY A;  2Y75 A;  1T98 A;  2HKX A;  3GW2 A;  2V6C A;  3WTU C;  1YLF A;  1IN5 A;  3HSE A;  2L01 A;  1IRG A;  2IA1 A;  2BBY A;  4E70 A;  2R7F A;  1R1V A;  2GXG A;  5FLX K;  3FMS A;  4EGY A;  3K0L A;  4BHP A;  3C7J A;  3I4P A;  2ADU A;  1S7O A;  4EJU A;  1WSU A;  2IRF G;  4OU0 A;  3BPX A;  4WXD A;  2ZNZ A;  4YFN F;  1HW2 A;  4HZF A;  1IN8 A;  3TO7 A;  1BC7 C;  2JT1 A;  4PGG A;  5DCM B;  3RPQ A;  3WTZ A;  3V8K A;  3DEU A;  5CVU A;  3B73 A;  4G9Y A;  4CDG A;  4UVB A;  1TNT A;  5ICE A;  2OQR A;  1FYM A;  5HLI A;  3GX4 X;  2W57 A;  2HZT A;  3GUD A;  3WU1 B;  3KP3 A;  4RAY A;  1J59 A;  2HEO A;  3ROU A;  3I71 A;  3RKX A;  1B9M A;  2O03 A;  1YO5 C;  1J7K A;  3LST A;  4LGW A;  1MGT A;  2OBP A;  4NHJ A;  1F1Z A;  3KEO A;  4O3M A;  4S04 A;  2Q0O A;  1YW7 A;  3F8M A;  3GWZ A;  1G6N A;  2HGC A;  3MFK A;  3NQO A;  1FBS A;  5HVQ C;  3GZ6 A;  1D5V A;  2L4A A;  1PUE E;  2PMU A;  3L00 A;  2DPU A;  3LQQ A;  4UVA A;  4LK0 F;  1B6A A;  3BRO A;  4GXO A;  3MWM A;  3QPT A;  4NQW A;  1KQ8 A;  3ECH A;  4OOI A;  1W5S A;  3KFW X;  1BBY A;  4WF2 A;  3JAM K;  3KZZ A;  1KU2 A;  5CJ9 A;  3FXQ A;  3GZ5 A;  1OKR A;  4UHT A;  4HQM A;  1TQP A;  3KCC A;  3MAJ A;  2Q8K A;  2QYO A;  3VOE A;  1G3S A;  4H0E A;  4HF0 A;  2HYG D;  5CVI A;  4FT8 A;  4LB5 A;  1LJ9 A;  4GGG A;  3SXY A;  4A0Y A;  1R1T A;  4M9X A;  1OYY A;  4ZH4 F;  4MHG A;  4I98 B;  1JGS A;  3S2W A;  4UVC A;  4WXC A;  3F8C A;  2XRO A;  2BGC A;  2FNA A;  3RIR A;  3F22 A;  4IRH A;  2RGV A;  2QWW A;  3R60 A;  3TQN A;  1MDM B;  2V1X A;  3TGN A;  1U78 A;  2W25 A;  3ZMV A;  1ZLJ A;  2K4B A;  3J80 Z;  3CTA A;  3HYI A;  1UHW A;  1DPR A;  4HF2 A;  2EFW A;  2VC0 A;  4RB0 A;  1MJ9 A;  1W7P B;  5D5U B;  4KN7 X;  4CYD A;  1TTY A;  3BWG A;  1OYW A;  2YR2 A;  2J5P A;  3RI4 A;  3GYH X;  1HW1 A;  2JPB A;  1YW8 A;  2Y0M A;  2NS0 A;  5E17 F;  1JE8 A;  2RDP A;  1D8J A;  4KIB A;  2LNB A;  3V7S A;  1BI0 A;  2STT A;  1Z7U A;  1P4W A;  1Q1H A;  1O3R A;  3BJA A;  1K78 A;  5LRS A;  1V4R A;  4A0Z A;  4Y13 A;  1R7J A;  3RTR A;  2A07 F;  2D1H A;  1QQI A;  3LAJ A;  4I2O A;  3MZY A;  1T39 A;  1K7A A;  5L3G A;  2Z9O A;  4LG0 A;  1BI1 A;  4YFK F;  1BC8 C;  4OIN F;  1LEA A;  3F8F A;  1CF7 B;  1G4D A;  1MZB A;  5HDN A;  2W84 A;  4KDP A;  2VBY A;  2WV0 A;  2P5K A;  5LEK A;  2UWM A;  5KK1 A;  4HQE A;  5CVJ A;  4KMU X;  3PFI A;  4LK1 F;  4N9I A;  4MEX F;  3Q9S A;  3CUQ B;  3HRS A;  5DYM A;  4A6E A;  3J81 Z;  1KU7 A;  1GXQ A;  2RQP A;  3IWF A;  1KYZ A;  5AIQ A;  1XGN A;  2FA5 A;  2QEN A;  2XIG A;  3R61 A;  2H6C A;  3Q9V A;  3E6D A;  2GIV A;  4DNC A;  1IRF A;  2CYY A;  4ZYG A;  1Z6R A;  3F8B A;  1UST A;  3O6B B;  1FSH A;  2L4M A;  3LFK A;  4JQF A;  4XRF A;  4Q4Z F;  3T5X A;  1FSE A;  2A5Y B;  3F6O A;  1KGS A;  2OAZ A;  3JW4 A;  4P9U A;  2V1U A;  3I53 A;  5K5O A;  2ZXJ A;  3GVA A;  2BYV E;  3GF2 A;  4F7Z A;  2PFB A;  1QNT A;  4M72 A;  2DTR A;  1P6R A;  3BJO A;  2PI0 A;  2O8X A;  3DFG A;  5BPD A;  3P9C A;  4I02 A;  2ZJ2 A;  3LQR A;  4CHU A;  1STZ A;  1UCR A;  1YYV A;  2MLK A;  4U0Y A;  4I7H A;  1XGM A;  4JK1 X;  5L3C A;  3F3X A;  4Z2Y A;  2FBI A;  4Y17 A;  3E5U A;  3QPH A;  4OMZ A;  5JI6 A;  2GQQ A;  3C3W A;  2M30 A;  2UZK A;  2P5L C;  3LAP A;  1IUY A;  4KFC A;  1I1S A;  1SD4 A;  1WQ2 A;  2K7L A;  1J9I A;  3LWF A;  4NB5 A;  4BAY A;  4I0A A;  3C1D A;  3W6K B;  3U1D A;  5ILS A;  1QZY A;  5LRR A;  1SFX A;  3I64 A;  3CO7 C;  2EWN A;  1T2K A;  2FE3 A;  5F6F A;  4WK8 F;  5EEG A;  2STW A;  1QO0 D;  5E20 A;  3NRV A;  3M1E A;  1FP1 D;  4EM2 A;  1S3J A;  5ED4 A;  3IRQ A;  1HKQ A;  3FMQ A;  3ZQ7 A;  3WOD F;  1ODD A;  3HHG A;  2H27 A;  4RS8 A;  4HLX A;  1E2X A;  1YG2 A;  1XCB A;  2CWE A;  3M8F A;  3I5U A;  1HW5 A;  2QQ9 A;  3TKY A;  1G3T A;  4G7Z F;  1ZYR F;  3GFI A;  3RJP A;  1S6L A;  3KET A;  3WTT C;  2A6H F;  1T0F A;  1K79 A;  4KYW A;  2YU3 A;  5BPI A;  5E1X A;  1R23 A;  4P9F A;  3FXU A;  1FT9 A;  4ZYE A;  3F6V A;  3GEZ A;  2XVC A;  4A6D A;  2IJL A;  1EH6 A;  3H92 A;  1TQM A;  3HRM A;  4MTD A;  2K27 A;  4S05 A;  3WTY C;  1KA8 A;  4AVP A;  4PZJ A;  2A3S A;  1USS A;  4RGX A;  4HF1 A;  1WRJ A;  5HLG A;  1IN7 A;  1FZP B;  5E1Z B;  2GZW A;  2KRF A;  1U6G A;  4HDV A;  3LA7 A;  1UB9 A;  2P7C B;  4G7O F;  2KIM A;  4CZZ A;  2KJC A;  3FM5 A;  4RGR A;  2HQR A;  2MLG A;  5A2Q K;  2DK8 A;  4ZYH A;  1BI2 A;  4BH9 A;  2EA2 A;  2FU4 A;  4Y15 A;  2KIF A;  4ETS A;  3VB2 A;  1B9N A;  4R79 A;  1X3U A;  1OMI A;  3H3U A;  2ISZ A;  5IT9 K;  3HTU A;  5D4S A;  4KA4 A;  5CVV A;  3ZMS A;  5JHU A;  1IXC A;  1XGO A;  4XSZ F;  3E5X A;  4L5I A;  2VC1 A;  2XHK A;  5DCM A;  3F8N A;  2G7H A;  5BMZ A;  1XMA A;  4LJZ F;  2HTJ A;  3ZMT A;  2YPR A;  2P5V A;  5HOO A;  2Z99 A;  4IPA A;  2Q2E A;  4M74 A;  4RB3 C;  3GFM A;  3M9A A;  4G7H F;  1R22 A;  2HFH A;  4A12 A;  2P4W A;  3ZN0 A;  2L54 A;  4B8X A;  4U0V A;  1RIO H;  1K6O A;  2DFI A;  3B02 A;  1ZGA A;  3J81 K;  3CO6 C;  1GXP A;  1W4M A;  3RKY A;  3WU0 A;  1IN4 A;  4XBF A;  1XCV A;  1LDD A;  1L3L A;  2V9V A;  2GA2 A;  1UHM A;  4M9S A;  4YG2 F;  2RVC A;  1ZRC A;  3PQK A;  3C18 A;  3L9F A;  3HSF A;  4I01 A;  2EJR A;  3H3Z A;  4RB2 C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...