3NQOA

Crystal structure of a marr family transcriptional regulator (cd1569) from clostridium difficile 630 at 2.20 a resolution
Total Genus 59
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
59
sequence length
187
structure length
182
Chain Sequence
DYSNELKELFLMNQTYATLFTLTNKIQIEGDKYFGILTSRQYMTILSILHLPEEETTLNNIARKMGTSKQNINRLVANLEKNGYVDVIPSPHDKRAINVKVTDLGKKVMVTCSRTGINFMADVFHEFTKDELETLWSLLKKMYRFNGEEQDGFEEDANEIDKIKSEALEEFAKRRNRVNKND
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transcription
molecule keywords MarR-family transcriptional regulator
publication title Crystal structure of a MarR family transcriptional regulator (CD1569) from Clostridium difficile 630 at 2.20 A resolution
rcsb
source organism Clostridium difficile
total genus 59
structure length 182
sequence length 187
chains with identical sequence B
ec nomenclature
pdb deposition date 2010-06-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF12802 MarR_2 MarR family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 3nqoA00
4IHTA 5LRRA 4L9JA 3KLOA 3BZ6A 3CDHA 4D0PA 3QPHA 4OINF 3CO7C 1O7FA 3T1BA 2V1XA 2RN7A 3C1DA 3IL2A 4L9VA 2HGCA 3KZYA 1Q1HA 3VB2A 5BMZA 3OV8A 2QENA 2E7WA 1XCBA 5BS6A 2HZTA 4G6DA 1FSEA 3K1NA 5KVRA 4OMYA 1BI2A 1TQIA 4BQAA 1F9NA 3RPQA 5JI6A 2VOOA 4G7ZF 5ICCA 3Q5FA 3FMQA 4PDKA 5DUKA 3ZMUA 2HR3A 4HBLA 3DKWA 2DBBA 4P5OA 1Z1DA 2K7LA 5D8KB 4L0ZB 5FGMA 2OQRA 4EV0A 2A5YB 4AWXB 4ON0A 3P7NA 2RGVA 5L3EA 1LDDA 2LKPA 4HOBA 5TJJA 3KP5A 1BN5A 4EM2A 4RGXA 3T5XA 2GIVA 4A6DA 4RS8A 2VODA 1HKSA 1XMAA 3OOPA 5D8LB 3JAMK 3DFGA 1G3YA 1T0FA 3IC7A 3BJOA 3IKTA 3O3KA 1ODDA 1FP1D 3DPLC 2LDUA 3K9TA 1H9GA 1OMIA 2BYVE 1IN7A 4P9FA 3WTXC 2H09A 3CTAA 4ASNA 1USSA 4HDUA 2CW0F 1OPCA 1SMYF 1U5TB 1O3SA 4HW0A 2J5PA 4MTEA 3E3VA 5FFXA 2GXGA 1K78A 4A6EA 2QWWA 1Y0UA 2Z99A 2KKOA 4YFXF 2HTSA 3FX3A 3HSFA 1DUXC 3ECHA 3TO7A 2VXZA 4M9XA 2EA4A 4S05A 2MH9A 2WC2A 5F6FA 1LEBA 2MBFA 3RYPA 2ZXJA 2O6GE 1P4WA 2QQBA 2GAUA 3S2WA 1YS6A 1YIOA 2UXXA 4LGWA 1IXRC 5LRSA 1HKTA 1QGPA 1T38A 2LF7A 4ENMA 3R0JA 1TLHB 3LWFA 3SXYA 5CYVA 3KP2A 2CFXA 2DPUA 4YFKF 4ESBA 3WTVC 1HKQA 3HIFA 2BE5F 3HRMA 3M8EA 2M45A 1REPC 4K2EA 2JTVA 2VC0A 2F5DA 3L9FA 3LQRA 1XGOA 4HX7A 4M6YA 1R5GA 4WXDA 4KDPA 1TW2A 3DQVC 3E6DA 2MC3A 1YO5C 4JK1X 3FM3A 2O8XA 5L3DA 3IRQA 3PQKA 2XAGA 2BEOA 1JGSA 4Q4ZF 5IT9K 1GVJA 2V1UA 2IA2A 4ZYEA 2FE3A 2FBHA 2LSOA 1TBXA 2R7DA 4KN7X 2F5CA 2QZ8A 3IHUA 4RB3C 4OMZA 1S7OA 3G73A 2YSRA 4OIRF 1IRFA 2HFHA 3K1PA 1B6AA 4HF0A 4Y17A 5CVUA 2XKPA 4A0YA 2IT0A 2M1BA 3TDUC 4QLCU 4I09A 3O6BB 3RYRA 1GXPA 2Y0MA 4OIPF 1XGNA 3I59A 3MCZA 2QLZA 4HV5A 5L3FA 1J9IA 2VBZA 5LEJA 5LEKA 4LLGF 5FLXZ 2X4HA 1KU9A 5HS9A 2RC4A 3MFKA 2FBKA 3TQNA 4LMYA 3L2CA 2O61A 1IF1A 3F72A 3ZP5A 1XN7A 4PGGA 2JT1A 2ZMEB 5ED4A 3EYYA 3P9KA 3K69A 1LDKB 1UB9A 2EFNA 2DFIA 3JAMZ 4A5NA 2CQKA 3BROA 2XAFA 1L0OC 3RDIA 3F8NA 3E6CC 2NNYA 3ERED 4L5IA 1J7KA 2F2EA 5DYMA 1IAWA 1R7JA 4ZYDA 2OD5A 3QP5A 1BJAA 2QQ9A 2EK5A 1KU2A 2RQPA 5LLQA 2VONA 2W85A 3BWGA 4CO8A 3KETA 1BI1A 3CLOA 4OU0A 5K5RA 1QZYA 3WTSC 3GFMA 2FOKA 4MEYF 2GA2A 3J80Z 3ZMDA 1W7PB 2VT3A 2ZBKA 1JE8A 3CUQB 4CICA 5K1YA 4ENKA 3HRUA 2NAZA 4I98B 4M6XA 1U3EM 1WI9A 2WWYA 1ZG1A 2DK5A 1USTA 4BNCA 1P2FA 4RAYA 2RNJA 4NQWA 1R22A 1R36A 1ZARA 2XRNA 1XSDA 4G7OF 4EGYA 4M9SA 3QOPA 1EH8A 5HS8A 2YU3A 3TO6A 2TDXA 4KNYA 1MD0A 3SZTA 4G6QA 2W57A 1W4MA 5CVVA 1NHAA 3TOBA 2KJBA 4CZZA 1ZRFA 4S04A 4AVPA 3FXRA 4B8XA 2QBYB 4RB0A 4RAZA 1P4AA 3JW4A 1UCRA 3GF2A 1FWZA 3F8FA 1A04A 5DEQA 5LGUA 3MZHA 3H3UA 2D1HA 3WE2A 3ZQ7A 4XSZF 2L01A 5JFRA 4WX9A 1FYMA 3TGNA 1ZGAA 5EEHA 1DP7P 1LVAA 1RUOA 5IT9Z 4MHGA 4BAYA 2P8TA 1H0MA 3ML6A 4YG2F 2H6CA 2XAJA 2D45A 1ZLKA 4GXOA 3R0AA 1FOKA 3KLNA 5EEGA 5HLHA 1YW9A 3I58A 2O3FA 4EQQA 2V6CA 4BH9A 2YX4A 2M5WA 3QPTA 4MNUA 3BOQA 3K1MA 2L3DA 3HTSB 2MA3A 4P96A 1IZ1A 2FNPA 3CUQC 2DO7A 2GWRA 1LJ9A 5JHUA 3GO5A 3K2ZA 1OYYA 1WWXA 2A3SA 3RPUA 4DQ2A 1FBQA 2A07F 3KFWX 2A61A 3PFIA 3JTHA 2QYOA 4KN4X 1OYWA 3FWEA 2ZNZA 4GCVA 1UHMA 3IRRA 1TTYA 3KCCA 3LA3A 4G9YA 1SD4A 2XAQA 1S6LA 4R8HA 5AIQA 2AXLA 1WKMA 2FEZA 3DEUA 4BXUA 3KEQA 1I1SA 1CGPA 3BJAA 2IJLA 5CVRA 1U6GA 5LGTA 1MGTA 3J81Z 1SD5A 4R1HA 4BHBA 1ZG3A 1VTNC 4IRHA 3U9GA 4A12A 3WGGA 1O3RA 2PJPA 1F4KA 5H6RA 5FB2A 4L5JA 3F6VA 4HQMA 3DF8A 3K0LA 2PG4A 1R1VA 1MKMA 1SD7A 4EM0B 1K6OA 3V7CA 4L18B 2HYFA 3T8RA 1IN4A 4XSXF 1Z7UA 1HSJA 3RTRA 6PAXA 3WU1B 4LLNA 3RKXA 5D5VB 3N97A 2IA0A 3E6MA 4PZJA 2VBXA 3ISPA 4BHPA 2OZUA 1P92A 4XRFA 1E2XA 1FBSA 1FBUA 4KIGA 5FLXK 3F8BA 3TOAA 4I0AA 5FO5A 4U7BA 2ZCWA 4N9HA 4ESFA 3SFZA 3I54A 4QWQA 2JSCA 2P5LC 2ZJ2A 3AAFA 5D6EA 5ICEA 2BBYA 1P6RA 3WTWC 1Z91A 3RIRA 3ABTA 4FX0A 3HYIA 1ZH5A 2EB7A 1DDNA 1U2WA 1H9TA 1FPQA 1B59A 4HA8A 5IT3A 1DPRA 1T6SA 3BP8A 5HS7A 2RKHA 1YYVA 1UHWA 1JXSA 2HOEA 4IRGA 3J80K 2W24A 2EV5A 2Q8KA 3SHFA 1W7PA 2OU2A 3CUQA 2HTJA 3FMSA 1D5VA 2HQNA 1KU3A 5HVQC 1FSHA 4EJWA 5A2QK 1T98A 1HW5A 2RDPA 3VEPA 5D4RA 4UVAA 2DI3A 3LA2A 3VOEA 4OIQF 4O3MA 2ESNA 3KZZA 4P9UA 1EH6A 3LA7A 4MQVA 1ZRDA 3C7JA 3KP3A 2ETHA 3LSTA 5E1ZB 3R6SA 4ZH4F 1KA8A 4KIBA 3R61A 4A2UA 3ABUA 4ZZLA 3ELKA 4XBFA 5ERIA 2UZKA 3V7SA 4ETSA 2F5EA 2DAOA 4I2OA 2COMA 4HYEA 3IKVA 3KP7A 2QBYA 1BC8C 2CWEA 3LFKA 4MEXF 2X0LA 2DU9A 4LK0F 3V7RA 2PQ8A 4I02A 3IWZA 1O7LA 5BOXA 5JVTA 4AIHA 1R23A 1YLFA 5K5OA 2VBWA 4L9TA 5K5QA 4GYGA 4U0VA 1FP2A 3I4PA 4HV6A 5J6XA 4RGUA 1XGSA 1BIAA 3GWZA 3RJPA 2FXAA 5E8GA 2VOPA 4JBAA 3C18A 2Y48A 3GEZA 2NNNA 4LK1F 3TDZC 1ULYA 1QQIA 1U5TC 4XLPF 2XHKA 3HHHA 4N0BA 5DCMA 3PQJA 3WTUC 5AIPA 4NHJA 3EUHA 1QZZA 2QM3A 4CHUA 3O2PE 4HQEA 2K27A 3I53A 4HX8A 2R3SA 2PMHA 4ESJA 5DUIA 3RI4A 1K7AA 5KK1A 2H27A 5FD6A 5LBQA 3CUOA 2RV8A 1ON2A 1ZLJA 2EV0A 2DLLA 1Z6RA 1FZPB 2R7FA 3RKWA 5H6QA 3J7AO 3KEOA 3T0YA 4WXCA 2KIFA 2C6YA 3SQNA 4HLXA 2IVMA 1ZREA 4HZFA 1MJ9A 4UV8A 1OKRA 4KMUX 1I5ZA 3H3ZA 4IVNA 1JHFA 2BV6A 1PP7U 4RB2C 3J81K 3N4MA 4Q47A 1W5SA 1AWCA 2ELHA 4L9NA 4E70A 5F1RA 1BBYA 4GGGA 3I5UA 5A2QZ 1HXDA 2EFPA 3QU6A 3ZN0A 3GFIA 2FRHA 1K78B 5ICFA 3V8LA 2ISZA 4HAMA 5DV5A 3ZMVA 2K4JA 3WGHA 1IN6A 1LDJA 4HF2A 2A69F 3DXJF 2FA5A 1YS7A 5LHGA 1W7PD 5HOOA 3BPXA 2E1NA 4HF1A 3V4GA 1J5YA 5L3CA 2E1CA 2P5VA 4I01A 1RZ4A 3SZPA 2MLKA 2VE8A 2FF4A 3B02A 4KUMA 1IXCA 1IN8A 1BOAA 2P7VB 2XUBA 4IF4A 2V1DA 4CDGA 2Q0OA 3QRFF 2Z3YA 2Z5UA 3HUGA 4WXHA 1YW8A 2DW4A 5BPDA 4LG0B 4ZYHA 3GLXA 1JHHA 1LQ1A 2H6BA 2VE9A 3E5QA 1G3WA 3L00A 2Z33A 1T2KA 1O3QA 2Q2EA 3QP6A 4Y15A 3REOA 1RIOH 2GZWA 4AD9A 2W84A 1F5TA 2ZKZA 3RKYA 2P4WA 3W6JB 1KU7A 1U5TA 1XCVA 1YTYA 1Z9CA 3ZMSA 5BQTA 1QNTA 2MD5A 2OQGA 2KIMA 2ZNYA 3D5LA 4I7HA 2O03A 3E97A 1QPMA 2ACJA 4WF2A 4IJAA 1XB4A 3BDDA 4WWCA 4YIIA 2NRAC 1IW7F 4UNOA 1HBXG 2VBYA 1CF7B 1IUYA 2FU4A 2V79A 1TW3A 2E7XA 4UXNA 4H0EA 3I59B 3LQQA 4AIKA 1ON1A 4CXFA 4Z2YA 1RUNA 4U7DA 4OIOF 1C0WA 3VFZA 3KP4A 2Y75A 4Q48A 4HLYA 2EJRA 3KP6A 1XD7A 2XROA 4EJVA 2M8EA 5CJ9A 5E18F 2PI0A 2P6TA 3HTUA 4NB5A 2OAZA 2XAHA 1TQPA 4HDVA 1HW1A 3M1EA 3F8CA 1D8KA 3E5UA 5DD8A 1J59A 1SFEA 5FD5A 4FT8A 1MDMB 2G7HA 3H92A 4XLNF 3ZMTA 2STTA 4KIFA 4TV7A 1FLIA 3BJ6A 2A6HF 1BI0A 2XGXA 1HQCA 1ZHFA 1ZG5A 1S29A 4LD5A 4CYDA 4RGRA 3LAPA 1OYIA 2PLYA 2BGCA 2F5FA 3C3WA 1Z05A 4WK8F 1SD6A 1UFMA 2XVCA 4UVCA 3JSPA 2EFOA 4WCGA 2P6SA 3GW2A 1G4DA 5DCFA 3KE2A 3GXOA 1MJAA 1KYWA 5D4SA 3TKYA 3E5XA 3WTZA 3F6OA 5ICGA 3NRVA 2HQRA 1ZRCA 1S3JA 4ENJA 2HEOA 1QBJA 5CVIA 5ILUA 3G3ZA 1U8RA 3BPVA 4KMFA 2DQRA 5L3BA 2GXBA 1GXQA 1T39A 4EVIA 3F21A 1B9NA 4CGZA 2ZO4A 4M74A 3HHGA 4IHSA 5J8CA 1J0RA 2FMYA 4LB6B 4KFCA 3U2RA 5CLSA 3DP7A 3EYIA 4O6JA 2ZMEA 3B73A 2G9WA 3COAC 4U0WA 4IXAA 1I27A 2NS0A 1Z6TA 5JR3A 3GZ6A 2KJCA 4RGSA 3R4KA 2CGPA 1BC7C 2RVCA 2QQAA 2IPQX 1XGMA 5D5WB 1SAXA 4BHCA 2XASA 2YX7A 1XSXA 3W6KB 5FFZA 1PUEE 1W5TA 1RNLA 1B9MA 4LB5A 3WU0A 2JZYA 2A68F 1ONVA 3R60A 4FHTA 2K4BA 2VT2A 3M8FA 5HLIA 1FC3A 5HDNA 4GYIA 1B1BA 3M7GA 4AIJA 1KQ0A 2WV0A 2VN2A 5HLGA 1HSTA 2EV6A 5D6FA 4EGZA 2LNBA 2P5KA 1YQAA 2CSOA 4M73A 4EJTA 5E1XA 3V8JA 1R1UA 3FHZA 5BPIA 4YFNF 1R00A 4L0YB 2B0LA 2XKOA 3EQLF 4N9IA 2FMLA 4IRIA 3WODF 2L4MA 2K02A 2LF8A 3HRSA 1XDUA 1FYKA 5AONA 4EMSA 3LAJA 5HDGA 2HDCA 1WRJA 1DPUA 2OZ6A 4BYYA 3FZVA 3GZ5A 4YIFA 1XMKA 2YPRA 1MZBA 2EFQA 3V8KA 2JPCA 3GUDA 5D5UB 4LG0A 3GYHX 4Q5SF 2CG4A 1BM9A 4B09A 1ZGJA 4Y13A 3I71A 3DPTA 1QO0D 5DDGA 2K86A 1J75A 3F3XA 1TNSA 3F22A 1LB2A 4P55A 2VC1A 2WTEA 1SFUA 3WGIA 5TRDA 2EWNA 2QVOA 1S7AA 2ZFWA 2ADUA 2DTRA 2L4AA 2FBIA 1O3TA 1KQ9A 4A0XA 2CO5A 2HWVA 1V4RA 2EFWA 1B4AA 2PBIA 1U78A 3GFJA 1G3TA 3ZPLA 1G6NA 2J5OA 1TNTA 1XSVA 4PCQA 2JRTA 3WE3A 3FM5A 1CF7A 4OOIA 4R79A 2GQQA 1BIBA 3D0SA 4FX4A 2MLGA 4ENNA 3DV8A 1FYLA 3CO6C 2H94A 4U0YA 1D8JA 5HDKA 3JTGA 4EJOA 2UXNA 1YW7A 3I64A 2ESHA 3GVAA 4U88A 1BI3A 3HSEA 2HKOA 3GFLA 4G7HF 1FT9A 3MQ0A 1GHCA 4UVBA 2L02A 4KT5C 3MAJA 3L7WA 4G8XA 1WQ2A 1MDMA 2W25A 2OBPA 1XDSA 4M72A 1I1GA 2M87A 1LNWA 2KRFA 4EM1A 5E20A 3WTTC 5LGNA 4F7ZA 2G7UA 2A6EF 1KQ8A 2YR2A 1EH7A 3JSOA 5E1WA 4KA4A 1D3YA 3T8TA 2XV4S 4EJUA 1S8NA 1FY7A 2AS5F 3HOSA 3QU3A 1ZAOA 3EDPA 2DQLA 3HSRA 3ZN1A 2DPDA 2EA2A 1E17A 3WTYC 4M9ZA 1KGSA 1ZYRF 3FXQA 4RB1A 2FNAA 1J2XA 3TO9A 4ZZDA 1YFHA 2Z9OA 1SMTA 1G3SA 2GA1A 2PFBA 5LHHA 2FQ3A 3BY6A 5ILVA 2HS5A 3NQOA 3CJNA 2KIUA 3MZYA 4A5MA 1P4XA 2NYXA 4ZYGA 3GX4X 3MWMA 2IP2A 3P9CA 1OR7A 3F23A 4G94A 3L09A 1LEAA 3WG9A 2PEXA 2IRFG 4O5VA 3I0TA 2ISYA 3FF5A 1R5HA 4MTDA 1IN5A 2L54A 3FMRA 2V9VA 4DNCA 3Q9SA 1X3UA 1KYZA 5LHIA 1RI7A 3ECOA 3FXUA 4MQ9F 4LLLA 5L3GA 3NEUA 5E8IA 5CVJA 2OA4A 2PMUA 2DK8A 1ZN2A 4HX4A 1K79A 2D1VA 5D5XB 2STWA 3ROUA 4UV9A 2M30A 3ZMZA 4IPAA 3E6BA 3HOTA 5H20A 4PGHA 4KYWA 1EV7A 2D2WA 2IA1A 4LJZF 4LFUA 4JQFA 1O57A 5F64A 2QUFA 5E17F 1HW2A 2FSWA 5DCMB 4UHTA 2P7CB 1V3FA 2PN6A 1FX7A 2XIGA 3P9IA 1IRGA 2DT5A 3ULQB 4A0ZA 1L3LA 3VODA 2HYGD 3IWFA 3MEXA 1YG2A 1WSUA 4KICA 3U1DA 1MJBA 4GO1A 1TQMA 1I6XA 1R58A 3Q9VA 4I0BA 2HKXA 1STZA 4UUVA 3HRTA 3EETA 1AOYA 2CYYA 2IW5A 3M9AA 4M71A 2UWMA 1PDNC 3F8MA 2MH2A 1SFXA 1F1ZA 5J8FA 5ILSA 1FNNA 3QAHA 2O0YA 2JPBA 1IXSB 4MGRA 5DD4A 1PP8F 1R1TA
chains in the Genus database with same CATH superfamily
4IHTA 5LRRA 2LRDA 4NC8A 4L9JA 3KLOA 2DA3A 2LR8A 2X48A 1ETWA 2JSPA 3BZ6A 3CDHA 2LY2A 4D0PA 3S1RJ 3QPHA 4OINF 2ME6A 3G1LA 2K9QA 4LIVA 3CO7C 2R7XA 1O7FA 3T1BA 2BY2A 2V1XA 3W2VA 1V55H 3HOZJ 2RN7A 1JKQC 1EF4A 3C1DA 5KAIC 4L9VA 2HGCA 3KZYA 3IL2A 1Q1HA 2IGNA 3VB2A 2X6YA 5BMZA 3OV8A 4C3IJ 4J00A 1TWFJ 2QENA 1A35A 2E7WA 2OC6A 1Y6IA 1FOXA 4D5FA 3CQZJ 5FLVA 5TISC 1ZK8A 1XCBA 3A2KA 3SDBA 5BS6A 1DGWY 2DMUA 2IEKA 5F04A 2M4GA 3ABLH 3AG3H 2HZTA 4G6DA 4XN0A 1FSEA 3K1NA 2XF5A 5KVRA 3I4NJ 4OMYA 4PK4A 1BI2A 1MH3A 1TQIA 4BQAA 1F9NA 2QKLB 1BR1A 2JN6A 3DKYA 3RPQA 5JI6A 2XGCA 4B1RA 2R92J 1YJNI 2VOOA 1GDTA 1VF9A 4G7ZF 5ICCA 3Q5FA 3FMQA 1GVDA 1MMAA 4PDKA 5DUKA 3ZMUA 4B48A 3CJTB 2B9SA 2HR3A 4V2FA 4HBLA 2HU9A 2DBBA 2VQGA 3DKWA 4P5OA 1Y39A 2KISA 1Z1DA 5H2FC 4A3IJ 2K7LA 5D8KB 4L0ZB 1RKTA 5FGMA 2OQRA 4EV0A 2R7ZJ 2A5YB 4AWXB 2E34A 4PFOA 2VJJA 1X3ZB 2MFZA 1YIJI 3HG9A 3P7NA 4ON0A 2RGVA 5L3EA 1X58A 1LDDA 2LKPA 4HOBA 5TJJA 3IP4B 2CUFA 5J4VA 3KP5A 1BN5A 4EM2A 4RGXA 3T5XA 5F08A 2GIVA 4A6DA 2EZHA 3AFHA 4PJNA 4RS8A 2VODA 1HKSA 1X4PA 3A0HC 4BACA 1XMAA 2OPTA 3OOPA 5D8LB 4BJ5C 5IPAA 3IAM2 3JAMK 3DFGA 1PUFA 3AL0B 1AHDP 1G3YA 1T0FA 3IC7A 3BJOA 1Y0NA 3IKTA 3FISA 3PUBA 4AYBN 1F43A 3O3KA 2UUZA 1TL8A 1ODDA 1ITYA 1FP1D 3CMMA 3DPLC 2ZB9A 2LDUA 3K9TA 4QSHA 1H9GA 1OMIA 2BYVE 2DMNA 2DA1A 1IN7A 3LFUA 4XQFA 4P9FA 3WTXC 2H09A 3CTAA 2OJED 2MYSA 1GV2A 1USSA 3VDXA 4ASNA 4BEHA 1I50J 2CV0A 3HPGA 3PO3J 3VYSB 4HDUA 2EZIA 2CW0F 1OPCA 1WI3A 1OCZH 3OYAA 1SMYF 3BCBA 2F4OB 1U5TB 1SAUA 1O3SA 1CQTA 4HW0A 2E35A 2FX0A 1Z77A 2J5PA 4MTEA 3E3VA 3GBGA 4OAZA 2DFHA 2Z1DA 3FKIJ 2WY8Q 3MKZA 2EZKA 5FFXA 2GXGA 1K78A 4P1WA 2QWWA 1MMGA 4A6EA 1Y0UA 2Z99A 2KKOA 4BY7J 4YFXF 1J09A 2HTSA 2E5NA 2GBYA 3FX3A 3HSFA 4XICA 3H0GJ 2W00A 2CUJA 4RMNA 1JUPA 3BQZA 1DUXC 4J01A 3ECHA 3TO7A 1AKHB 2HZDA 1S7EA 2VXZA 4F93B 1ENHA 3FK7A 4M9XA 1DQUA 2EA4A 2KQRA 4YELA 3NARA 4S05A 2XF6A 3RQ4A 2V9KA 2MH9A 4II2A 2LOOA 2WC2A 5F6FA 3UR3C 1LEBA 1HOMA 3K7AJ 1D1AA 4AUXA 4XORA 2MBFA 5FKOA 2I8DA 3RYPA 4BQQA 2K3PA 4BDYA 2ZXJA 2O6GE 1P4WA 2CU7A 1XS9A 1LPQA 3TW6A 5GPCA 2QQBA 4XONA 3RZDJ 3KEYA 2GAUA 1RKWA 3S2WA 1YS6A 3W2AA 1YIOA 4GRIA 2UXXA 4LGWA 4XRSG 1IXRC 5LRSA 1TP4A 1HKTA 1QGPA 3G2BA 1T38A 2LF7A 4ENMA 3K70D 3R0JA 1TLHB 3LWFA 4G6TB 3SXYA 3OYJA 2HPIA 5CYVA 2ELJA 3KP2A 2CFXA 2DPUA 4YFKF 4ESBA 3WTVC 3A01B 4GFBA 1H8AC 1HKQA 3HIFA 2BE5F 3H36A 3HRMA 3M8EA 2M45A 1REPC 4K2EA 1KZHA 2JTVA 1Q1VA 1MBHA 4FISA 2VC0A 2CQNA 5M3FJ 2JVGA 3PSIA 2F5DA 3IH3A 3L9FA 3QPLA 3HGYA 5EEAA 3LQRA 1XGOA 1LFPA 2BZTA 4HX7A 4M6YA 3ZQIA 5HNHA 1G59A 2VKDA 2JA8J 1R5GA 4WXDA 4BE1A 4KDPA 4IHXA 1TW2A 3DQVC 2LVSA 3E6DA 1T8IA 4A3KJ 1TWHJ 2MC3A 3G1MA 3DTKA 3WHBA 3A1YA 5E3NA 1YO5C 2VKEA 1SVLA 1XC5A 1VQ4I 4JK1X 3FM3A 2O8XA 1WPKA 5GP9A 3DLLF 5L3DA 3IRQA 3PQKA 2R5YA 1QU3A 3CCJI 2XAGA 2BEOA 1JGSA 4Q4ZF 2VUMJ 4A93J 3DCFA 3HOWJ 5IT9K 4MIMA 4IZZA 3AL0C 1GVJA 3OS1A 2V1UA 1D1BA 2IA2A 4ZYEA 1FMWA 2FE3A 1WHUA 2QF7A 2FBHA 2LSOA 1TBXA 2R7DA 4KN7X 1I6HJ 4MFDA 2QZ8A 2F5CA 3IHUA 2NOJB 1FOWA 2M0MA 4RB3C 4OMZA 1QHHD 1S7OA 3G73A 3PUFA 2YSRA 1A31A 4N4OB 4OIRF 1JJ8C 3S2DJ 1IRFA 2HFHA 3K1PA 1B6AA 2K9LA 4HF0A 4Y17A 2CRGA 5CVUA 2XKPA 5EDNA 1N75A 4A0YA 2IT0A 2CS3A 4RDUA 2M1BA 3TDUC 4QLCU 2OV7A 2ZSHB 4I09A 3ZOBA 4BXXJ 2F4IA 3O6BB 3RYRA 3QPSA 1GXPA 2Y0MA 4OIPF 3DEWA 4BS9A 1XGNA 3I59A 3MCZA 2QLZA 4HG2A 3HGGA 4HV5A 4A3GJ 3OR2C 5L3FA 1J9IA 2EZLA 2VBZA 1I39A 5LEJA 2XSDC 1BR2A 2D5VA 5E3OA 5LEKA 4LLGF 5FLXZ 2X4HA 2L9SA 3VYTB 1KU9A 5HS9A 5GAGJ 2RC4A 3MFKA 1WH7A 2FBKA 3TQNA 4LMYA 3L2CA 2O61A 1IF1A 3F72A 3A03A 3IH2A 3ZP5A 1XN7A 1H88C 2DTZA 2KDZA 1UAAA 2O8KA 4PGGA 2JT1A 2ZMEB 5ED4A 3EYYA 3TBIA 4MLOA 4BXFA 3P9KA 3K69A 3OS0A 1LDKB 1UB9A 2EFNA 2DFIA 1BJZA 3CF2A 3MZ8A 3JAMZ 1R71A 3DTEA 1BOBA 4A5NA 1GLNA 2CQKA 3BROA 2XAFA 1L0OC 3RDIA 1LE8B 1YJ9I 2VL8A 5DS9A 3F8NA 3E6CC 2HDWA 2NNYA 3ERED 4L5IA 1J7KA 2F2EA 3L2WA 1OCCH 5DYMA 2VJIA 1IAWA 1R7JA 4ZYDA 2OD5A 1Z7LA 3QP5A 1BJAA 5LD2C 1KONA 2BVLA 4I76A 2WB1N 1MMSA 2QQ9A 2EK5A 1KU2A 2RQPA 1OISA 3L2RA 5LLQA 2VONA 2AQFA 2W85A 3CMYA 3BWGA 4CO8A 3KETA 1BI1A 3CJRB 3CLOA 4OU0A 2E60A 5K5RA 4CSWA 1QZYA 4XLEA 3GFMA 3WTSC 3OYDA 4C3JJ 2CUEA 1V54H 2FOKA 3L2QA 4MEYF 2GA2A 2VLAA 5EF6A 2CQ7A 4FE4A 3J80Z 4EEFG 2ZFUA 3ZMDA 1W7PB 2VT3A 2ZBKA 5IP7J 1JE8A 3CUQB 5BNGA 2KHMA 3V42A 4CICA 4ITVA 5K1YA 2KDOA 4ENKA 3HRUA 2NAZA 2R0QC 2WAEA 4I98B 4M6XA 3CLQA 1U3EM 5TGTA 1W1WE 3ZQCA 1WI9A 3CCYA 3HEFA 4DYRA 2WWYA 4A3FJ 4HRIA 1ZG1A 2DK5A 1USTA 3OWTA 1P2FA 4BNCA 4RAYA 1WJAA 2RNJA 1XG1A 4NQWA 1R22A 4DZJA 3BZKA 2H1KA 3W6VA 3HOXJ 1R36A 1ZARA 2XRNA 2X51A 1XPXA 2AO9A 1XSDA 1BL0A 4G7OF 2PMZA 4EGYA 4M9SA 3G6EI 2EH3A 3QOPA 1EH8A 4FTHA 5HS8A 2YU3A 3TO6A 2WAQN 4X0GA 2TDXA 4KNYA 1D0ZA 1MD0A 3SZTA 5GTIC 1Z3XA 2DOAA 2E2HJ 3GTOJ 4G6QA 3H3VK 2W57A 4Y52J 1W4MA 3QODA 1NHAA 5CVVA 3TOBA 2LC2A 2R4GA 2KJBA 1O4XA 4CZZA 1ZRFA 2QQ8A 4S04A 1GV5A 2DN0A 4HEA2 3ASNH 3DTIA 3H5RA 4CUGA 4AVPA 3FXRA 4B8XA 4E6KG 2QBYB 4RB0A 4RAZA 1P4AA 4HNVA 5GADJ 4IEJA 4UUSA 3HOYJ 3CJQB 3DPUA 3JW4A 2H1LA 3BG7A 2JJ7A 1UCRA 3GF2A 1FWZA 3F8FA 2NVQJ 1A04A 4A3LJ 2JUCA 5DEQA 5LGUA 2QA4I 3P5JA 4IO9F 3MZHA 3H3UA 2D1HA 5IY5H 3WE2A 1ETYA 3ZQ7A 3CCQI 1MBGA 2L01A 2ZXWH 4XSZF 5JFRA 3ABKH 4WX9A 1FYMA 3KYDB 3TGNA 1ZGAA 5EEHA 3RQIA 1DP7P 1LVAA 5HNFA 1RUOA 4E7LA 5IT9Z 3RCOA 3JRFA 3LSRA 4MHGA 3CCMI 3SEQA 1WZ2A 1MBEA 4BAYA 4BUPA 1K6YA 2P8TA 1H0MA 2L2OA 3ML6A 4YG2F 2H6CA 2F4MB 4MO7A 2XAJA 2D45A 2ELKA 1ZLKA 4GXOA 1G2HA 2JA6J 3R0AA 1FOKA 3KLNA 3AKZA 5EEGA 5HLHA 1YW9A 4BL0B 3I58A 2O3FA 4EQQA 1NK3P 2V6CA 1QZEA 2COBA 3GTKJ 4BH9A 2YX4A 3FDYA 2M5WA 3QPTA 4MNUA 4QPQA 3BOQA 5EJCA 2L7MP 1AKHA 3K1MA 2L3DA 2CV2A 3HTSB 2Q1ZB 3LSIA 5IYDJ 2MA3A 4D7MA 3LSPA 4DOZA 4P96A 4Y4RA 1IZ1A 2FNPA 3CUQC 4AYBA 2O9LA 2DO7A 2CJJA 2GWRA 1LJ9A 5JHUA 3GO5A 3K2ZA 1OYYA 1WWXA 2A3SA 1ZELA 3RPUA 4DQ2A 1IDYA 2E5ZA 2M0CA 1FBQA 2A07F 4M3EA 2L7ZA 2A61A 2VQLA 3KFWX 1LFBA 3PFIA 1OCRH 3JTHA 2QYOA 4XLAA 4KN4X 1I3QJ 4Y3OA 1X19A 1OYWA 3FWEA 5E79C 5IP6A 2ZNZA 1X1PA 1UHMA 4GCVA 1SEUA 2BY1A 2CV1A 1LVKA 3PJRA 1T08B 2R7VA 3IRRA 1TTYA 3KCCA 1VQPI 3LA3A 2F5VA 1MH4A 5K7HA 1OFCX 4G9YA 1SD4A 2XRLA 4CZCA 2XAQA 1ZR4A 2L9VA 4KT6A 1S6LA 3ABMH 1UHSA 3DU6A 5FKLA 5E3MA 4R8HA 3A01A 1V5FA 1E3PA 3OYBA 2ECBA 5AIQA 2AXLA 1WKMA 2FEZA 3DEUA 5EG0B 3CC7I 4BXUA 3KEQA 1IRXA 1I1SA 2IAIA 5JLXA 3BG5A 2L9RA 3OIPA 1X3WB 3SZGA 1P9QC 3HPHA 4J19A 1CGPA 2LY1A 3BJAA 5J47A 4IL6C 2HVQA 2IJLA 5CVRA 1MBFA 1U6GA 5LGTA 4CYCB 4AVZA 4XLCA 1MGTA 2QKMB 3J81Z 1SD5A 4R1HA 1ORKA 4BHBA 1TWAJ 1ZG3A 2XGEA 4M3FA 1VTNC 2RAEA 1FTZA 2NVYJ 4IRHA 3U9GA 3DBRB 4A12A 3WGGA 5FROA 1O3RA 2PJPA 3BT9A 1FJLA 1F4KA 1VNDA 2EQRA 5H6RA 5FB2A 4DW6A 4L5JA 3F6VA 4HQMA 1SANA 4YIRX 4YRVA 2RREA 4PSXA 3DF8A 3K0LA 5M5YJ 5J40A 2PG4A 4OWRB 1R1VA 1MKMA 3K4MA 4PJ0C 1SD7A 4EM0B 1K6OA 3Q3SA 3QQAA 3V7CA 1B8IB 2K3FA 3DKXA 4L18B 2M7BA 4ZDOA 2HYFA 4E7HA 2BHZA 2W48A 3L2VA 3T8RA 1IN4A 1Y56A 2X1CA 4XSXF 1Z7UA 1HSJA 3RTRA 4XOPA 6PAXA 4AIDA 3WU1B 4LLNA 1UG0A 3K2AA 3RKXA 3RKQA 1E3OC 5D5VB 3N97A 2TCTA 2IA0A 3E6MA 4PZJA 2M2EA 2M34A 2GM4A 2VBXA 2DMPA 3ISPA 4BHPA 2OZUA 4D5CA 1P92A 4U87A 3M1CA 3FHNA 4XRFA 1E2XA 3F9KA 1FBSA 3JREA 2X85A 4NC6A 1FBUA 1MNDA 1YX3A 4KIGA 3NWTA 3F8BA 5FLXK 1SVMA 3TOAA 2HNHA 2O7OA 4I0AA 3OYIA 5FO5A 4U7BA 3SJMA 2LBFA 2O5RA 2ZCWA 2B7EA 2XSJC 2R5ZA 2DMTA 3EUHC 4N9HA 4ESFA 3SFZA 2N8GA 4OAYA 1ETOA 3I54A 5IOYA 4QWQA 2JSCA 2P5LC 2IS1A 1FEXA 2ZJ2A 3HUGB 3AAFA 5D6EA 1OCPA 5ICEA 2BBYA 2BXZA 4CA0A 4B4CA 1P6RA 3D1NI 3WTWC 4FCYA 1Z91A 3PIPF 3RIRA 3HL2A 1HA8A 4JYKA 3BR2A 3ABTA 4XKBA 4BBRJ 3ZR8X 2Q2EB 1POGA 3OIOA 4CCNA 2DT7B 4FX0A 4CCKA 2YS9A 3HYIA 1ZH5A 1MIJA 2EB7A 1SFKA 2LFBA 1DDNA 2CQQA 3PM1A 1U2WA 1H9TA 1FPQA 1IRZA 1B59A 4HA8A 1GUUA 5IT3A 1DPRA 3BLYA 1T6SA 4E7ZA 4M6VA 3BQYA 3BP8A 1EJ9A 5HS7A 2RKHA 1YYVA 4ZC3A 1UHWA 5GPAA 3UNGC 5J1YA 1JXSA 2HOEA 2E2IJ 2I10A 2XPVA 4IRGA 3J80K 3RZOJ 2W24A 2Y69H 2EV5A 1B72A 2Q8KA 1VQ8I 5EZHA 3SHFA 1W7PA 2MW8A 3ASOH 2BW3A 2OU2A 3CUQA 3S3MA 4IX7A 3OL3A 2HTJA 3FMSA 2Y9ZA 1D5VA 2HQNA 1KU3A 5HVQC 5M5WJ 1FSHA 2LH9A 3Q0UA 4EJWA 5A2QK 1BW6A 1T98A 2DDBA 1HW5A 2NVXJ 1R6RA 2RDPA 1TZLA 1UG2A 3VEPA 5D4RA 4UVAA 2DI3A 3LA2A 3VOEA 4OIQF 2G0EA 4O3MA 2ESNA 3KZZA 2BHYA 4P9UA 1EH6A 2JA5J 3LA7A 2WB1A 2DMQA 1RETA 3OL4A 2EBIA 1MBJA 3KPHA 1T56A 4MQVA 2W7NA 4NNJA 2DOFA 4NUBA 3FK6A 1ETQA 3C7JA 3KP3A 3C2HA 1ZRDA 2ETHA 3D5RC 3LSTA 4XIDA 2QEXI 5E1ZB 3R6SA 2DYRH 3CZ6A 4ZH4F 2F48A 2MD0A 1KA8A 2I5UA 2V26A 4KIBA 3I4MJ 3LSJA 3R61A 1OCTC 2PX9A 3ABUA 4A2UA 4F52A 4ZZLA 1ZQ3P 3KIOA 1Z67A 3ELKA 4XBFA 5ERIA 1V5EA 2UZKA 1D0YA 3QYFA 2NVUB 3V7SA 3G71I 3S17J 1X4OA 3H1CA 4ETSA 2L7FP 1YJWI 2F5EA 2DAOA 1YI2I 2HVSA 1TT0A 4I2OA 2VI6A 2COMA 4LG3A 3S2HJ 2MABA 1FTTA 4HYEA 3IKVA 3KP7A 3GTGJ 2QBYA 1BC8C 3RPUD 2CWEA 3LFKA 2DFEA 4DBQA 4A3BJ 3NAUA 4MEXF 2M3AA 5IOZA 2BY3A 3ZXSA 3KYCB 4X6AJ 4BE0A 4A3EJ 2X0LA 1FIPA 2DU9A 1YITI 1IC8A 4LK0F 4II3A 3V7RA 1WVRA 3DBHB 2LLKA 2PQ8A 2EPFA 2KRHA 2NXNB 2CUZA 3IWZA 1O7LA 4I02A 3JRBA 1FOYA 5JVTA 5BOXA 2VB6A 4Z6YA 2QCOA 4AIHA 2CQXA 3MD2A 1R23A 1YLFA 3GMEA 4XMYA 5K5OA 2VQCA 4E7JA 1ZR2A 2VBWA 4L9TA 2WAQA 2XAUA 2YUSA 4G12A 2E71A 4IOAF 1JTYA 3TW7A 5K5QA 4GYGA 3A02A 3TP0A 4U0VA 2IGMA 2JUGA 1FP2A 1S72I 3I4PA 1ZKGA 4HV6A 4B43A 5J6XA 1WJEA 1UJ8A 4RGUA 3TP3A 1IUFA 1XGSA 2A6TA 1BIAA 3GWZA 1LFUP 3RJPA 1BR4A 2FXAA 5E8GA 3WG7H 2VOPA 4JBAA 3OSFA 1OQYA 3C18A 2V1NA 1VQ9I 2Y48A 3EPZA 3S14J 3GEZA 3FBNB 1V5GA 2NNNA 4LK1F 1W0UA 3TDZC 1TWCJ 2NOGA 1ULYA 4H4KC 1QQIA 1U5TC 1F36A 4BU2A 4XLPF 1MBKA 2XHKA 3HHHA 4KJZA 4N0BA 4BGDA 5DCMA 3PQJA 2L7KA 3WTUC 2H8WA 5AIPA 1TWGJ 2GIZA 3CDLA 4NHJA 3EUHA 2L5QA 1QZZA 2QM3A 5IP9J 4CHUA 1JGGA 3O2PE 4HQEA 2K27A 3KYLA 3I53A 2V4JC 4HSTA 5JHFA 4HX8A 3O8HA 2R3SA 3OY9A 4A69C 4BJ6C 5FLMJ 2PMHA 4ESJA 5DUIA 3RI4A 1K7AA 5KK1A 2IGOA 2VIXA 2H27A 1YRNB 4BBSJ 2VXDA 5FD6A 5LBQA 3CUOA 2RV8A 4C9YA 2DXIA 2ZJRF 5LFAA 1ON2A 1ZLJA 2DLLA 2EV0A 1Z6RA 1FZPB 1OLTA 2R7FA 2ME0A 3RKWA 5DTDA 3M3YJ 5H6QA 3J7AO 3KEOA 3JRDA 3T0YA 5HLTA 4ABZA 3L1PA 4WXCA 2KIFA 4W97A 4A3JJ 2C6YA 3SQNA 4HLXA 1PUFB 2IVMA 3QYBA 1ZREA 1DU6A 5B5EC 4HZFA 1MJ9A 4UV8A 1OKRA 2MSYA 4KMUX 1I5ZA 2TRTA 1VQOI 3C2BA 3EUAA 3H3ZA 4IVNA 4ZDLA 2WAFA 1JHFA 2BV6A 1PP7U 2LMDA 2ZXIA 4RB2C 3J81K 4F91B 3N4MA 1TT5B 4CYCA 4Q47A 3MKYB 1DGRM 1W5CC 1W5SA 2ELHA 1Y1VJ 2KIQA 1AWCA 3EUKL 4L9NA 4E70A 5F1RA 1BBYA 1R4NB 3ZCOA 4GGGA 4RLQA 2A5WA 3I5UA 3BTCA 4JOMA 4ZTJA 2K85A 2KPMA 5A2QZ 1HXDA 2EFPA 3QU6A 4XKVA 3ZN0A 3GFIA 2FRHA 3LNQA 4IQ4A 1K78B 5ICFA 2HOSA 3V8LA 2HQ5A 3QYEA 2ISZA 2GOMA 2WADA 3U1KA 2HOAA 4HAMA 5DV5A 2E1MB 1APLC 4Y33A 2FOWA 3ZMVA 2K4JA 1NK2P 1W36D 2DJIA 2E36A 3WGHA 1W0TA 1IN6A 4F55A 1N25A 1MMNA 5FRMA 2NVTJ 2R93J 1LDJA 2XGDA 4PFPA 4HF2A 2A69F 3DXJF 2FA5A 1YOVB 3HKZN 1YS7A 1ZGWA 5LHGA 2DFFA 2R7RA 3OYNA 1W7PD 1RR7A 1JJ6C 1X1AA 5HOOA 1IGNA 3BPXA 1E3HA 2E1NA 4HF1A 3CCEI 3DWLE 3KZIC 3V4GA 1J5YA 5L3CA 2E1CA 2P5VA 4I01A 4I99C 4M3GA 2X9DA 1RZ4A 3SZPA 1T33A 3JRHA 3M8JA 1DP3A 1VQLI 2MLKA 2EIMH 2VE8A 2FF4A 3K4BA 3J7YJ 4NDLA 3B02A 2KLOA 4KUMA 3S3OA 1IXCA 1IN8A 1BOAA 2P7VB 2XUBA 1X2MA 5EYRA 2K9NA 3K4JA 4IF4A 2FD5A 4RM3A 2V1DA 4CDGA 1LKXA 4B44A 1YX5A 2Q0OA 1K4SA 3ZGKA 3S1MJ 3QRFF 2CW8A 2Z3YA 2Z5UA 3HUGA 4WXHA 2KP6A 3H9JA 5B66C 2GOXB 1YW8A 2DW4A 3BCAA 5BPDA 3K4KA 2DA7A 3KX2A 4LG0B 4ZYHA 3GLXA 1JHHA 1LQ1A 2H6BA 2VE9A 1XTAA 3E5QA 3Q0WA 1G3WA 3L00A 2Z33A 1Y8RB 4PJJA 2ZMEC 3WU2C 1T2KA 1O3QA 3E7LA 3LSKA 2DDAA 4V19K 2Q2EA 3DEEA 3S1QJ 3QP6A 4Y15A 2KZGA 3L2UA 2M8GX 2NS8A 3S3NA 3REOA 1RIOH 2GZWA 2JMWA 4AD9A 2W84A 1F5TA 5IYCJ 2ZKZA 3RKYA 1UELB 3JRAA 2P4WA 3CDIA 3W6JB 2PJRB 3PL8A 4UB8C 4S0HB 1KU7A 1U5TA 1XCVA 3SFIA 4FETA 2XPUA 3PFYA 3VSLA 2V7FA 1VQ5I 1YTYA 1Z9CA 4PUSA 2EIJH 3ZMSA 5BQTA 1W36C 4B3AA 4QIWN 3GCMA 1QNTA 3S15J 2MD5A 2OQGA 2KIMA 2ZNYA 3D5LA 4I7HA 2O03A 3E97A 5B1AH 1IG7A 2ZJPF 1QPMA 3S1NJ 3G4SI 2X6OA 2ACJA 2P81A 4WF2A 2VJ4A 3D5SC 4IJAA 1XB4A 2KZVA 3LSGA 1RR8C 1VQNI 4RAFA 1S5LC 3BDDA 5EGOB 4WWCA 2RNGA 3H0DA 2QSFX 4YIIA 5B1BH 3MVPA 2NRAC 1IJWC 1IW7F 4AU7A 4UNOA 3B6CA 1HBXG 2VBYA 1CF7B 1ETVA 2FU4A 2X1EA 1IUYA 2V79A 4F92B 3HM5A 4A3CJ 2Y30A 1TW3A 3DU5A 2E7XA 3X2QH 1A5JA 1Z0XA 3FBIB 4UXNA 5KCMA 4H0EA 3I59B 2XF7A 3CMEI 3LQQA 4AIKA 1ON1A 2R7WA 3PO2J 1LUJB 4CXFA 4Z2YA 1RUNA 1JUMA 4U7DA 4OIOF 1C0WA 4LIUA 3VFZA 3KP4A 2K40A 2CW7A 2Y75A 4Q48A 4HLYA 4D9JA 2WA0A 2EJRA 3KP6A 5F0HA 1XD7A 3K4NA 2XROA 4EJVA 2M8EA 5CJ9A 5E18F 3GTQJ 4RBOA 3LOCA 2PI0A 2FJ1A 2P6TA 3HTUA 2OF7A 1WJ5A 2FQ4A 4NB5A 3IV5A 2OAZA 1X1BA 4PJMA 2E1OA 4C2TA 1IV6A 4V2GA 4DZPA 2LREA 2XAHA 1TQPA 4HDVA 1HW1A 3M1EA 2M4KA 3F8CA 2P0WA 4XRMA 2K9MA 1M1EB 3K6GA 1D8KA 3CP8A 3E5UA 5DD8A 4XM3A 1J59A 1SFEA 1R9TJ 1JT0A 1WH5A 2LTPA 4FT8A 5FD5A 2G7HA 2HXIA 1MDMB 3H92A 4XLNF 2QSGX 3ZMTA 2STTA 2DA2A 4KIFA 4TV7A 1JT6A 1FLIA 4RLFA 1HC8A 2Y0SN 2A6HF 1BI0A 2XGXA 3BJ6A 4HPQA 4GDFA 1HQCA 2HPMA 1ZHFA 4XNFA 3ONQA 3B6AA 4DIQA 1S9HA 3M07A 1ZG5A 4CH7A 2BVMA 3N05A 3Q0VA 2R7TA 1S29A 1U0JA 4CCJA 2HOTA 3F0CA 4LD5A 3UKGA 4CYDA 3BG6A 1K4TA 4AM3A 1WCMJ 1SC7A 1MMDA 4FQGA 4RGRA 3LAPA 2HDDA 1OYIA 2PLYA 2XC7A 2BGCA 5M5XJ 2F5FA 1I3AA 3C3WA 1G8XA 1Z05A 4IOCF 4WK8F 1SD6A 1UFMA 5CKTA 2XVCA 4UVCA 4WCGA 2EFOA 2K5CA 3JSPA 2P6SA 1VZ0A 3GW2A 1XMXA 1G4DA 1QA6A 5DCFA 5M3MJ 3KE2A 4B47A 1Y1WJ 3GXOA 1IV8A 1MJAA 1KYWA 5D4SA 5GTHC 3TEDA 3TKYA 2JA7J 5KHDA 4N4NB 3E5XA 4NQWB 4XLFA 3HOUJ 3WTZA 3F6OA 4JX4A 2KL4A 3NRVA 5ICGA 3PIOF 2HQRA 1VQ7I 1ZRCA 2ZXHA 5DM6F 2DCEA 2IBDA 1S3JA 4ENJA 3C2GA 2CH0A 2HEOA 1RPWA 5F1JA 1QBJA 5CVIA 2L9NA 5ILUA 3G3ZA 1VQ6I 1N78A 4XKCA 1U8RA 3BPVA 4KMFA 2DQRA 5L3BA 2GXBA 1GXQA 5FKMA 1T39A 4EVIA 4IHYA 3OMYA 3F21A 1B9NA 4CGZA 1QVTA 2ZO4A 5C44J 4M74A 3HHGA 4IHSA 1NG7A 5J8CA 3OYKA 2GXAA 1J0RA 2FMYA 4LB6B 4KFCA 3U2RA 5CLSA 3H5AA 4E7SA 3DP7A 4BQOA 3EYIA 4O6JA 5J4YA 1YRNA 2A05A 2XB0X 2ZMEA 3B73A 2G9WA 2MG4A 1RRJA 3COAC 4U0WA 4IXAA 4BJTA 1OJLA 1I27A 4XOTA 2NS0A 5DM7F 1VI0A 4UUSB 4BE2A 1Z6TA 3BR1A 5JR3A 1LE8A 2XPWA 4YEJA 1JI8A 3GZ6A 3RSNA 2KJCA 2IXSA 3K10A 4RGSA 3R4KA 3ZQQA 2CGPA 2VKVA 1BC7C 4XRSA 1HLVA 2RVCA 2QQAA 2IPQX 1XGMA 3HB9A 3ERMA 5D5WB 5C4JJ 1IDZA 1SAXA 4BHCA 4BDZA 1R5ID 1HDPA 2XASA 2YX7A 1XSXA 2WY7Q 2OCEA 2UV1A 1IO2A 1NG6A 2IGKA 5FFZA 3W6KB 3CCUI 4DYCA 2LKSA 3FXLA 3BZCA 4E7KA 1PUEE 1FMVA 1W5TA 1T95A 3VYRB 1RNLA 1B9MA 4LB5A 3WU0A 2JZYA 1ACIA 1H89C 2A68F 1ONVA 1UZCA 3R60A 4FHTA 2K4BA 2VT2A 1D1CA 3CF5F 3M8FA 5HLIA 1FC3A 5HDNA 4GYIA 3JR9A 3S16J 1JUSA 1B1BA 1RC9A 3M7GA 3PSFA 5KNLA 4AIJA 4IHWA 4LITA 3NWSA 2R7QA 2WV1A 3CC2I 1KQ0A 2WV0A 1YHQI 5FRNA 3DLAA 4DGWB 2VN2A 1AA7A 3J7ZI 3QOEA 3K4LA 5E3LA 4C2MJ 1P7JA 3FKJA 5HLGA 1HSTA 1MSFC 3BG9A 3FXJA 1P7IA 3HJEA 4KISA 2EV6A 5D6FA 4EGZA 2LNBA 2P5KA 3OYCA 1YQAA 2CSOA 4M73A 3A0BC 4HNUA 4EJTA 5E1XA 3V8JA 1R1UA 3FHZA 4D7NA 3JRIA 5BPIA 4UB6C 1Z21A 2EINH 4YFNF 1R00A 4L0YB 2B0LA 1QVUA 2XKOA 3EQLF 2VPLA 4N9IA 2FMLA 3OOUA 4CCOA 2XDVA 4IRIA 3WODF 3GZNB 3ZQFA 2L4MA 2K02A 2LF8A 4C30A 2LKXA 1JKOC 1VQKI 3HRSA 1XDUA 3BTIA 1FYKA 3FXOA 4XN3A 9ANTA 3OYLA 5AONA 4EMSA 3HDDA 2Y2ZA 3O8GA 3LAJA 4KITB 2DYSH 5HDGA 3WHCA 4NC7A 3HC7A 3I9V2 3BR0A 4L5EA 4DBRA 2HDCA 3HOVJ 1WRJA 1SFOJ 3GTLJ 1DPUA 4RAGA 3OYFA 2OZ6A 4BYYA 3FZVA 3GZ5A 3JRCA 4YIFA 1XMKA 2YPRA 1MZBA 3SYTA 2EFQA 4FASD 3V8KA 4I6ZA 2K9SA 2JPCA 3BR3A 2OTLI 1R4MB 1OR7C 3H9GA 3GUDA 2QGUA 5GAEJ 5D5UB 4LG0A 3GYHX 2Y31A 4ZJZA 4Q5SF 2CG4A 1HDDC 1BM9A 1PYVA 4B09A 2JA2A 3I3LA 3MN2A 1ZGJA 3HKZA 4Y13A 3A4CA 3I71A 3DPTA 4MFEA 1WJFA 1QO0D 2BXYA 3LSMA 5DDGA 3MMYB 2K86A 1J75A 3W3CA 1DU0A 4A3MJ 2IS6A 4QTRA 3F3XA 1FIAA 1TNSA 4HSRA 3F22A 1R49A 5CQEA 2GLOA 5J1RA 2PJRA 1LB2A 4P55A 4IHVA 2HXOA 2BY0A 2VC1A 1X1CA 2WTEA 1SFUA 2B63J 3WGIA 3CCRI 5TRDA 2EWNA 2QVOA 1S7AA 5FJ8J 1MSEC 1MNMC 2ZFWA 2VPRA 2ADUA 4X1EA 2DTRA 2L4AA 2FBIA 2OCCH 1O3TA 1PVEA 2EILH 2X6XA 1KQ9A 4A0XA 2CO5A 2W1OA 4ANJA 2DT6A 1QRYA 2R7SA 2ID3A 2HWVA 2E19A 3IAS2 2M9HA 1V4RA 1ZTRA 3CCLI 2EFWA 3GTMJ 1B4AA 2PBIA 3HZJA 1U78A 3GFJA 1G3TA 3ZPLA 4ZDPA 1G6NA 2J5OA 1TNTA 1XSVA 4PCQA 2JRTA 5EGOA 3M4OJ 3WE3A 3FM5A 2R7UA 3CP2A 1CF7A 4OOIA 4R79A 3FIWA 2GQQA 1BIBA 1SVOA 5C3EJ 3D0SA 4FX4A 2MLGA 4IKFA 3K70C 3BTJA 3IUOA 4XLHA 4ENNA 2LYCA 4PSWA 4CCLA 4XL9A 4DJAA 3DV8A 1FYLA 2EIKH 5F0CA 2LBFB 3CO6C 2H94A 4U0YA 2R5ZB 1D8JA 1AU7A 5C4XJ 3CC4I 4RA2A 5HDKA 4CCMA 2DA5A 3JTGA 4EJOA 2UXNA 1WJDA 1YW7A 3I64A 4XR6A 2ESHA 1RESA 3GVAA 2VJ5A 3FXKA 3PNTA 4U88A 1UMQA 2HQAA 1BI3A 3HSEA 1EKEA 2AQEA 4BQNA 2HKOA 4BY1J 2F6CA 2HI3A 4XKWA 3GFLA 4G7HF 1FT9A 2MC4A 3MQ0A 5EG0A 5IYBJ 4PJLA 1Z3YA 1GHCA 4UVBA 2W82A 3ESWB 2L02A 2ID6A 4KT5C 3MAJA 3U21A 3L7WA 4G8XA 1WQ2A 2HVRA 4BEHB 2W4SA 4ZTFA 4M3BA 1MDMA 2W25A 1HF0A 1BW5A 2OBPA 1WJCA 2VASA 1XDSA 5GAHJ 3OR1C 4LOCA 4M72A 1I1GA 2QSHX 2M87A 1LNWA 2KRFA 2MGQA 5J3LA 4EM1A 3HBLA 3I56I 5E20A 2Z2SB 5CQGA 1ETXA 3E0JB 1MNEA 3WTTC 5LGNA 4F7ZA 2G7UA 1B72B 2KFDA 2A6EF 3IH4A 1ERDA 1NH3A 3OYGA 3VSKA 3HXLA 2ZC2A 1WJBA 1QHGA 3AG1H 2BW3B 3JCUC 1KQ8A 2YR2A 1EH7A 3JSOA 5E1WA 4KA4A 1D3YA 4FE7A 3S8PA 3T8TA 2DODA 2XV4S 4EJUA 1MW7A 3GTJJ 5HODA 1S8NA 4C3HJ 5FKNA 1X2NA 1FY7A 1B8IA 2AS5F 3HOSA 3AG2H 1D0XA 3QU3A 1VQMI 1A6IA 1ZAOA 3EDPA 2HYJA 2DQLA 3HSRA 3ZN1A 2DPDA 2EA2A 1E17A 3WTYC 4M9ZA 1NTCA 5FKKA 4DYQA 4BKXA 1KGSA 1ZYRF 3FXQA 4RB1A 2FNAA 1J2XA 3TO9A 4ZZDA 1YFHA 2Z9OA 1SMTA 3CCVI 5JVGF 1G3SA 2GA1A 2VQHA 2LP0A 2PFBA 4F3QA 2Y0SA 2FQ3A 5LHHA 5EZGA 2E2JJ 5F0FA 3H35A 3BY6A 5ILVA 2DA6A 2HS5A 3NQOA 2BOLA 3CJNA 2KIUA 3G1OA 3MZYA 5CPRB 2Z16A 2KRCA 4C2UA 4A5MA 3LL7A 1P4XA 2DA4A 2NYXA 2V9PA 3BTLA 4ZYGA 3PNVA 2NS7A 4RM2A 3GX4X 3MWMA 2IP2A 3P9CA 3MKWB 4NBQA 3ZQGA 3OYEA 1N77A 1OR7A 3QWLA 5K7ZA 3F23A 4G94A 5JLWA 4E7IA 4M3DA 3L09A 1LEAA 3WG9A 2PEXA 2IRFG 4O5VA 2LK2A 3I0TA 2ISYA 3BR6A 4UY8I 3E1SA 2AXTC 3FF5A 4Y7NJ 1R5HA 3TMOA 4MTDA 1IN5A 4XK4A 2L54A 2ZSIB 4A3DJ 3FMRA 2JRMA 2XB5A 2V9VA 2VKHA 4DNCA 3PNYA 3CMAI 3Q9SA 2JQ7A 1X3UA 2V6EA 2L0KA 1KYZA 2JVHA 2IS2A 2DOEA 3MKLA 2CMPA 5LHIA 1RI7A 3ECOA 2CFOA 3FXUA 4MQ9F 4LLLA 1A36A 5L3GA 1A6QA 3NEUA 4ZYAA 5E8IA 1QPIA 5CVJA 3K4CA 2OA4A 2R5YB 3VPRA 2PMUA 1ZN2A 2DK8A 3SEZA 5J1UA 4HX4A 1K79A 3ZQHA 3JRGA 3AG4H 1T0FC 1HCRA 3FXMA 2D1VA 5D5XB 1ETKA 4JP0A 4E4HA 4B3XA 3OYHA 2STWA 3ROUA 4UV9A 1YE9A 2M30A 3ZMZA 4IPAA 4QPOA 3E6BA 1TC3C 3HOTA 2AHQA 5H20A 4PGHA 3H9QA 4JX5A 4KYWA 2YU9J 3CCSI 3CD6I 2LY9A 1EV7A 1U9OA 1WFXA 2D2WA 3S32A 2IA1A 3BR5A 4LJZF 3LSHA 4LFUA 2LG4A 4W1UA 3DBLB 3LMMA 2ICWG 4JQFA 1O57A 5F64A 2QUFA 5E17F 3BC8A 1HW2A 2DJNA 2Y9YA 5F27A 3W2WA 2FSWA 2H8RA 1D5YA 5DCMB 1E0EA 2OUMA 4UHTA 2P7CB 3VWBA 1V3FA 2PN6A 4EATA 1K61A 1FX7A 2XIGA 3P9IA 1U9NA 1IRGA 2DT5A 4JX6A 2M7AA 1X1DA 4UUTA 2X1DA 3ULQB 4A0ZA 1L3LA 3VODA 2LD5A 2HYGD 3J7AY 2JK3A 2KMUA 3IWFA 3GTPJ 3MEXA 1YG2A 1BA5A 1WSUA 4KICA 1EA3A 3BG3A 2E1MC 3U1DA 1PJRA 2WBMA 1MJBA 4GO1A 1XX5A 3OSGA 3H5NA 1U8BA 1TQMA 1OCOH 2FUG2 3CESA 1I6XA 2X6WA 1R58A 2ECCA 1JTXA 3Q9VA 4I0BA 5K7FA 2HKXA 1STZA 1Y8QB 4UUVA 1JKPC 3HRTA 4D1QA 2RQQA 3EETA 1AOYA 3ZRGA 4IQJA 1WGXA 2CYYA 2IW5A 4HNTA 3M9AA 3VYUB 4M71A 3OS2A 2UWMA 3ZQLA 3S93A 1PDNC 3F8MA 2IS4A 2MH2A 3TL4X 4AC0A 1GT0C 2R7OA 2KT0A 1K83J 1SFXA 2ZJQF 1F1ZA 3OIQA 5J8FA 5ILSA 1JKRC 3GLLA 1FNNA 3QAHA 3SDGA 3I55I 2O0YA 2JWTA 3OYMA 2JPBA 5KAFC 5B3SH 1VFCA 2OTJI 2PMZN 1IXSB 4MGRA 5DD4A 1PP8F 1R1TA
chains in the Genus database with same CATH topology
4IHTA 5LRRA 4L9JA 3KLOA 3BZ6A 3CDHA 4D0PA 3QPHA 4OINF 3CO7C 1O7FA 3T1BA 2V1XA 2RN7A 3C1DA 3IL2A 4L9VA 2HGCA 3KZYA 1Q1HA 3VB2A 5BMZA 3OV8A 2QENA 2E7WA 1XCBA 5BS6A 2HZTA 4G6DA 1FSEA 3K1NA 5KVRA 4OMYA 1BI2A 1TQIA 4BQAA 1F9NA 3RPQA 5JI6A 2VOOA 4G7ZF 5ICCA 3Q5FA 3FMQA 4PDKA 5DUKA 3ZMUA 2HR3A 4HBLA 3DKWA 2DBBA 4P5OA 1Z1DA 2K7LA 5D8KB 4L0ZB 5FGMA 2OQRA 4EV0A 2A5YB 4AWXB 4ON0A 3P7NA 2RGVA 5L3EA 1LDDA 2LKPA 4HOBA 5TJJA 3KP5A 1BN5A 4EM2A 4RGXA 3T5XA 2GIVA 4A6DA 4RS8A 2VODA 1HKSA 1XMAA 3OOPA 5D8LB 3JAMK 3DFGA 1G3YA 1T0FA 3IC7A 3BJOA 3IKTA 3O3KA 1ODDA 1FP1D 3DPLC 2LDUA 3K9TA 1H9GA 1OMIA 2BYVE 1IN7A 4P9FA 3WTXC 2H09A 3CTAA 4ASNA 1USSA 4HDUA 2CW0F 1OPCA 1SMYF 1U5TB 1O3SA 4HW0A 2J5PA 4MTEA 3E3VA 5FFXA 2GXGA 1K78A 4A6EA 2QWWA 1Y0UA 2Z99A 2KKOA 4YFXF 2HTSA 3FX3A 3HSFA 1DUXC 3ECHA 3TO7A 2VXZA 4M9XA 2EA4A 4S05A 2MH9A 2WC2A 5F6FA 1LEBA 2MBFA 3RYPA 2ZXJA 2O6GE 1P4WA 2QQBA 2GAUA 3S2WA 1YS6A 1YIOA 2UXXA 4LGWA 1IXRC 5LRSA 1HKTA 1QGPA 1T38A 2LF7A 4ENMA 3R0JA 1TLHB 3LWFA 3SXYA 5CYVA 3KP2A 2CFXA 2DPUA 4YFKF 4ESBA 3WTVC 1HKQA 3HIFA 2BE5F 3HRMA 3M8EA 2M45A 1REPC 4K2EA 2JTVA 2VC0A 2F5DA 3L9FA 3LQRA 1XGOA 4HX7A 4M6YA 1R5GA 4WXDA 4KDPA 1TW2A 3DQVC 3E6DA 2MC3A 1YO5C 4JK1X 3FM3A 2O8XA 5L3DA 3IRQA 3PQKA 2XAGA 2BEOA 1JGSA 4Q4ZF 5IT9K 1GVJA 2V1UA 2IA2A 4ZYEA 2FE3A 2FBHA 2LSOA 1TBXA 2R7DA 4KN7X 2F5CA 2QZ8A 3IHUA 4RB3C 4OMZA 1S7OA 3G73A 2YSRA 4OIRF 1IRFA 2HFHA 3K1PA 1B6AA 4HF0A 4Y17A 5CVUA 2XKPA 4A0YA 2IT0A 2M1BA 3TDUC 4QLCU 4I09A 3O6BB 3RYRA 1GXPA 2Y0MA 4OIPF 1XGNA 3I59A 3MCZA 2QLZA 4HV5A 5L3FA 1J9IA 2VBZA 5LEJA 5LEKA 4LLGF 5FLXZ 2X4HA 1KU9A 5HS9A 2RC4A 3MFKA 2FBKA 3TQNA 4LMYA 3L2CA 2O61A 1IF1A 3F72A 3ZP5A 1XN7A 4PGGA 2JT1A 2ZMEB 5ED4A 3EYYA 3P9KA 3K69A 1LDKB 1UB9A 2EFNA 2DFIA 3JAMZ 4A5NA 2CQKA 3BROA 2XAFA 1L0OC 3RDIA 3F8NA 3E6CC 2NNYA 3ERED 4L5IA 1J7KA 2F2EA 5DYMA 1IAWA 1R7JA 4ZYDA 2OD5A 3QP5A 1BJAA 2QQ9A 2EK5A 1KU2A 2RQPA 5LLQA 2VONA 2W85A 3BWGA 4CO8A 3KETA 1BI1A 3CLOA 4OU0A 5K5RA 1QZYA 3WTSC 3GFMA 2FOKA 4MEYF 2GA2A 3J80Z 3ZMDA 1W7PB 2VT3A 2ZBKA 1JE8A 3CUQB 4CICA 5K1YA 4ENKA 3HRUA 2NAZA 4I98B 4M6XA 1U3EM 1WI9A 2WWYA 1ZG1A 2DK5A 1USTA 4BNCA 1P2FA 4RAYA 2RNJA 4NQWA 1R22A 1R36A 1ZARA 2XRNA 1XSDA 4G7OF 4EGYA 4M9SA 3QOPA 1EH8A 5HS8A 2YU3A 3TO6A 2TDXA 4KNYA 1MD0A 3SZTA 4G6QA 2W57A 1W4MA 5CVVA 1NHAA 3TOBA 2KJBA 4CZZA 1ZRFA 4S04A 4AVPA 3FXRA 4B8XA 2QBYB 4RB0A 4RAZA 1P4AA 3JW4A 1UCRA 3GF2A 1FWZA 3F8FA 1A04A 5DEQA 5LGUA 3MZHA 3H3UA 2D1HA 3WE2A 3ZQ7A 4XSZF 2L01A 5JFRA 4WX9A 1FYMA 3TGNA 1ZGAA 5EEHA 1DP7P 1LVAA 1RUOA 5IT9Z 4MHGA 4BAYA 2P8TA 1H0MA 3ML6A 4YG2F 2H6CA 2XAJA 2D45A 1ZLKA 4GXOA 3R0AA 1FOKA 3KLNA 5EEGA 5HLHA 1YW9A 3I58A 2O3FA 4EQQA 2V6CA 4BH9A 2YX4A 2M5WA 3QPTA 4MNUA 3BOQA 3K1MA 2L3DA 3HTSB 2MA3A 4P96A 1IZ1A 2FNPA 3CUQC 2DO7A 2GWRA 1LJ9A 5JHUA 3GO5A 3K2ZA 1OYYA 1WWXA 2A3SA 3RPUA 4DQ2A 1FBQA 2A07F 3KFWX 2A61A 3PFIA 3JTHA 2QYOA 4KN4X 1OYWA 3FWEA 2ZNZA 4GCVA 1UHMA 3IRRA 1TTYA 3KCCA 3LA3A 4G9YA 1SD4A 2XAQA 1S6LA 4R8HA 5AIQA 2AXLA 1WKMA 2FEZA 3DEUA 4BXUA 3KEQA 1I1SA 1CGPA 3BJAA 2IJLA 5CVRA 1U6GA 5LGTA 1MGTA 3J81Z 1SD5A 4R1HA 4BHBA 1ZG3A 1VTNC 4IRHA 3U9GA 4A12A 3WGGA 1O3RA 2PJPA 1F4KA 5H6RA 5FB2A 4L5JA 3F6VA 4HQMA 3DF8A 3K0LA 2PG4A 1R1VA 1MKMA 1SD7A 4EM0B 1K6OA 3V7CA 4L18B 2HYFA 3T8RA 1IN4A 4XSXF 1Z7UA 1HSJA 3RTRA 6PAXA 3WU1B 4LLNA 3RKXA 5D5VB 3N97A 2IA0A 3E6MA 4PZJA 2VBXA 3ISPA 4BHPA 2OZUA 1P92A 4XRFA 1E2XA 1FBSA 1FBUA 4KIGA 5FLXK 3F8BA 3TOAA 4I0AA 5FO5A 4U7BA 2ZCWA 4N9HA 4ESFA 3SFZA 3I54A 4QWQA 2JSCA 2P5LC 2ZJ2A 3AAFA 5D6EA 5ICEA 2BBYA 1P6RA 3WTWC 1Z91A 3RIRA 3ABTA 4FX0A 3HYIA 1ZH5A 2EB7A 1DDNA 1U2WA 1H9TA 1FPQA 1B59A 4HA8A 5IT3A 1DPRA 1T6SA 3BP8A 5HS7A 2RKHA 1YYVA 1UHWA 1JXSA 2HOEA 4IRGA 3J80K 2W24A 2EV5A 2Q8KA 3SHFA 1W7PA 2OU2A 3CUQA 2HTJA 3FMSA 1D5VA 2HQNA 1KU3A 5HVQC 1FSHA 4EJWA 5A2QK 1T98A 1HW5A 2RDPA 3VEPA 5D4RA 4UVAA 2DI3A 3LA2A 3VOEA 4OIQF 4O3MA 2ESNA 3KZZA 4P9UA 1EH6A 3LA7A 4MQVA 1ZRDA 3C7JA 3KP3A 2ETHA 3LSTA 5E1ZB 3R6SA 4ZH4F 1KA8A 4KIBA 3R61A 4A2UA 3ABUA 4ZZLA 3ELKA 4XBFA 5ERIA 2UZKA 3V7SA 4ETSA 2F5EA 2DAOA 4I2OA 2COMA 4HYEA 3IKVA 3KP7A 2QBYA 1BC8C 2CWEA 3LFKA 4MEXF 2X0LA 2DU9A 4LK0F 3V7RA 2PQ8A 4I02A 3IWZA 1O7LA 5BOXA 5JVTA 4AIHA 1R23A 1YLFA 5K5OA 2VBWA 4L9TA 5K5QA 4GYGA 4U0VA 1FP2A 3I4PA 4HV6A 5J6XA 4RGUA 1XGSA 1BIAA 3GWZA 3RJPA 2FXAA 5E8GA 2VOPA 4JBAA 3C18A 2Y48A 3GEZA 2NNNA 4LK1F 3TDZC 1ULYA 1QQIA 1U5TC 4XLPF 2XHKA 3HHHA 4N0BA 5DCMA 3PQJA 3WTUC 5AIPA 4NHJA 3EUHA 1QZZA 2QM3A 4CHUA 3O2PE 4HQEA 2K27A 3I53A 4HX8A 2R3SA 2PMHA 4ESJA 5DUIA 3RI4A 1K7AA 5KK1A 2H27A 5FD6A 5LBQA 3CUOA 2RV8A 1ON2A 1ZLJA 2EV0A 2DLLA 1Z6RA 1FZPB 2R7FA 3RKWA 5H6QA 3J7AO 3KEOA 3T0YA 4WXCA 2KIFA 2C6YA 3SQNA 4HLXA 2IVMA 1ZREA 4HZFA 1MJ9A 4UV8A 1OKRA 4KMUX 1I5ZA 3H3ZA 4IVNA 1JHFA 2BV6A 1PP7U 4RB2C 3J81K 3N4MA 4Q47A 1W5SA 1AWCA 2ELHA 4L9NA 4E70A 5F1RA 1BBYA 4GGGA 3I5UA 5A2QZ 1HXDA 2EFPA 3QU6A 3ZN0A 3GFIA 2FRHA 1K78B 5ICFA 3V8LA 2ISZA 4HAMA 5DV5A 3ZMVA 2K4JA 3WGHA 1IN6A 1LDJA 4HF2A 2A69F 3DXJF 2FA5A 1YS7A 5LHGA 1W7PD 5HOOA 3BPXA 2E1NA 4HF1A 3V4GA 1J5YA 5L3CA 2E1CA 2P5VA 4I01A 1RZ4A 3SZPA 2MLKA 2VE8A 2FF4A 3B02A 4KUMA 1IXCA 1IN8A 1BOAA 2P7VB 2XUBA 4IF4A 2V1DA 4CDGA 2Q0OA 3QRFF 2Z3YA 2Z5UA 3HUGA 4WXHA 1YW8A 2DW4A 5BPDA 4LG0B 4ZYHA 3GLXA 1JHHA 1LQ1A 2H6BA 2VE9A 3E5QA 1G3WA 3L00A 2Z33A 1T2KA 1O3QA 2Q2EA 3QP6A 4Y15A 3REOA 1RIOH 2GZWA 4AD9A 2W84A 1F5TA 2ZKZA 3RKYA 2P4WA 3W6JB 1KU7A 1U5TA 1XCVA 1YTYA 1Z9CA 3ZMSA 5BQTA 1QNTA 2MD5A 2OQGA 2KIMA 2ZNYA 3D5LA 4I7HA 2O03A 3E97A 1QPMA 2ACJA 4WF2A 4IJAA 1XB4A 3BDDA 4WWCA 4YIIA 2NRAC 1IW7F 4UNOA 1HBXG 2VBYA 1CF7B 1IUYA 2FU4A 2V79A 1TW3A 2E7XA 4UXNA 4H0EA 3I59B 3LQQA 4AIKA 1ON1A 4CXFA 4Z2YA 1RUNA 4U7DA 4OIOF 1C0WA 3VFZA 3KP4A 2Y75A 4Q48A 4HLYA 2EJRA 3KP6A 1XD7A 2XROA 4EJVA 2M8EA 5CJ9A 5E18F 2PI0A 2P6TA 3HTUA 4NB5A 2OAZA 2XAHA 1TQPA 4HDVA 1HW1A 3M1EA 3F8CA 1D8KA 3E5UA 5DD8A 1J59A 1SFEA 5FD5A 4FT8A 1MDMB 2G7HA 3H92A 4XLNF 3ZMTA 2STTA 4KIFA 4TV7A 1FLIA 3BJ6A 2A6HF 1BI0A 2XGXA 1HQCA 1ZHFA 1ZG5A 1S29A 4LD5A 4CYDA 4RGRA 3LAPA 1OYIA 2PLYA 2BGCA 2F5FA 3C3WA 1Z05A 4WK8F 1SD6A 1UFMA 2XVCA 4UVCA 3JSPA 2EFOA 4WCGA 2P6SA 3GW2A 1G4DA 5DCFA 3KE2A 3GXOA 1MJAA 1KYWA 5D4SA 3TKYA 3E5XA 3WTZA 3F6OA 5ICGA 3NRVA 2HQRA 1ZRCA 1S3JA 4ENJA 2HEOA 1QBJA 5CVIA 5ILUA 3G3ZA 1U8RA 3BPVA 4KMFA 2DQRA 5L3BA 2GXBA 1GXQA 1T39A 4EVIA 3F21A 1B9NA 4CGZA 2ZO4A 4M74A 3HHGA 4IHSA 5J8CA 1J0RA 2FMYA 4LB6B 4KFCA 3U2RA 5CLSA 3DP7A 3EYIA 4O6JA 2ZMEA 3B73A 2G9WA 3COAC 4U0WA 4IXAA 1I27A 2NS0A 1Z6TA 5JR3A 3GZ6A 2KJCA 4RGSA 3R4KA 2CGPA 1BC7C 2RVCA 2QQAA 2IPQX 1XGMA 5D5WB 1SAXA 4BHCA 2XASA 2YX7A 1XSXA 3W6KB 5FFZA 1PUEE 1W5TA 1RNLA 1B9MA 4LB5A 3WU0A 2JZYA 2A68F 1ONVA 3R60A 4FHTA 2K4BA 2VT2A 3M8FA 5HLIA 1FC3A 5HDNA 4GYIA 1B1BA 3M7GA 4AIJA 1KQ0A 2WV0A 2VN2A 5HLGA 1HSTA 2EV6A 5D6FA 4EGZA 2LNBA 2P5KA 1YQAA 2CSOA 4M73A 4EJTA 5E1XA 3V8JA 1R1UA 3FHZA 5BPIA 4YFNF 1R00A 4L0YB 2B0LA 2XKOA 3EQLF 4N9IA 2FMLA 4IRIA 3WODF 2L4MA 2K02A 2LF8A 3HRSA 1XDUA 1FYKA 5AONA 4EMSA 3LAJA 5HDGA 2HDCA 1WRJA 1DPUA 2OZ6A 4BYYA 3FZVA 3GZ5A 4YIFA 1XMKA 2YPRA 1MZBA 2EFQA 3V8KA 2JPCA 3GUDA 5D5UB 4LG0A 3GYHX 4Q5SF 2CG4A 1BM9A 4B09A 1ZGJA 4Y13A 3I71A 3DPTA 1QO0D 5DDGA 2K86A 1J75A 3F3XA 1TNSA 3F22A 1LB2A 4P55A 2VC1A 2WTEA 1SFUA 3WGIA 5TRDA 2EWNA 2QVOA 1S7AA 2ZFWA 2ADUA 2DTRA 2L4AA 2FBIA 1O3TA 1KQ9A 4A0XA 2CO5A 2HWVA 1V4RA 2EFWA 1B4AA 2PBIA 1U78A 3GFJA 1G3TA 3ZPLA 1G6NA 2J5OA 1TNTA 1XSVA 4PCQA 2JRTA 3WE3A 3FM5A 1CF7A 4OOIA 4R79A 2GQQA 1BIBA 3D0SA 4FX4A 2MLGA 4ENNA 3DV8A 1FYLA 3CO6C 2H94A 4U0YA 1D8JA 5HDKA 3JTGA 4EJOA 2UXNA 1YW7A 3I64A 2ESHA 3GVAA 4U88A 1BI3A 3HSEA 2HKOA 3GFLA 4G7HF 1FT9A 3MQ0A 1GHCA 4UVBA 2L02A 4KT5C 3MAJA 3L7WA 4G8XA 1WQ2A 1MDMA 2W25A 2OBPA 1XDSA 4M72A 1I1GA 2M87A 1LNWA 2KRFA 4EM1A 5E20A 3WTTC 5LGNA 4F7ZA 2G7UA 2A6EF 1KQ8A 2YR2A 1EH7A 3JSOA 5E1WA 4KA4A 1D3YA 3T8TA 2XV4S 4EJUA 1S8NA 1FY7A 2AS5F 3HOSA 3QU3A 1ZAOA 3EDPA 2DQLA 3HSRA 3ZN1A 2DPDA 2EA2A 1E17A 3WTYC 4M9ZA 1KGSA 1ZYRF 3FXQA 4RB1A 2FNAA 1J2XA 3TO9A 4ZZDA 1YFHA 2Z9OA 1SMTA 1G3SA 2GA1A 2PFBA 5LHHA 2FQ3A 3BY6A 5ILVA 2HS5A 3NQOA 3CJNA 2KIUA 3MZYA 4A5MA 1P4XA 2NYXA 4ZYGA 3GX4X 3MWMA 2IP2A 3P9CA 1OR7A 3F23A 4G94A 3L09A 1LEAA 3WG9A 2PEXA 2IRFG 4O5VA 3I0TA 2ISYA 3FF5A 1R5HA 4MTDA 1IN5A 2L54A 3FMRA 2V9VA 4DNCA 3Q9SA 1X3UA 1KYZA 5LHIA 1RI7A 3ECOA 3FXUA 4MQ9F 4LLLA 5L3GA 3NEUA 5E8IA 5CVJA 2OA4A 2PMUA 2DK8A 1ZN2A 4HX4A 1K79A 2D1VA 5D5XB 2STWA 3ROUA 4UV9A 2M30A 3ZMZA 4IPAA 3E6BA 3HOTA 5H20A 4PGHA 4KYWA 1EV7A 2D2WA 2IA1A 4LJZF 4LFUA 4JQFA 1O57A 5F64A 2QUFA 5E17F 1HW2A 2FSWA 5DCMB 4UHTA 2P7CB 1V3FA 2PN6A 1FX7A 2XIGA 3P9IA 1IRGA 2DT5A 3ULQB 4A0ZA 1L3LA 3VODA 2HYGD 3IWFA 3MEXA 1YG2A 1WSUA 4KICA 3U1DA 1MJBA 4GO1A 1TQMA 1I6XA 1R58A 3Q9VA 4I0BA 2HKXA 1STZA 4UUVA 3HRTA 3EETA 1AOYA 2CYYA 2IW5A 3M9AA 4M71A 2UWMA 1PDNC 3F8MA 2MH2A 1SFXA 1F1ZA 5J8FA 5ILSA 1FNNA 3QAHA 2O0YA 2JPBA 1IXSB 4MGRA 5DD4A 1PP8F 1R1TA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4IHT A;  5LRR A;  4L9J A;  3KLO A;  3BZ6 A;  3CDH A;  4D0P A;  3QPH A;  4OIN F;  3CO7 C;  1O7F A;  3T1B A;  2V1X A;  2RN7 A;  3C1D A;  3IL2 A;  4L9V A;  2HGC A;  3KZY A;  1Q1H A;  3VB2 A;  5BMZ A;  3OV8 A;  2QEN A;  2E7W A;  1XCB A;  5BS6 A;  2HZT A;  4G6D A;  1FSE A;  3K1N A;  5KVR A;  4OMY A;  1BI2 A;  1TQI A;  4BQA A;  1F9N A;  3RPQ A;  5JI6 A;  2VOO A;  4G7Z F;  5ICC A;  3Q5F A;  3FMQ A;  4PDK A;  5DUK A;  3ZMU A;  2HR3 A;  4HBL A;  3DKW A;  2DBB A;  4P5O A;  1Z1D A;  2K7L A;  5D8K B;  4L0Z B;  5FGM A;  2OQR A;  4EV0 A;  2A5Y B;  4AWX B;  4ON0 A;  3P7N A;  2RGV A;  5L3E A;  1LDD A;  2LKP A;  4HOB A;  5TJJ A;  3KP5 A;  1BN5 A;  4EM2 A;  4RGX A;  3T5X A;  2GIV A;  4A6D A;  4RS8 A;  2VOD A;  1HKS A;  1XMA A;  3OOP A;  5D8L B;  3JAM K;  3DFG A;  1G3Y A;  1T0F A;  3IC7 A;  3BJO A;  3IKT A;  3O3K A;  1ODD A;  1FP1 D;  3DPL C;  2LDU A;  3K9T A;  1H9G A;  1OMI A;  2BYV E;  1IN7 A;  4P9F A;  3WTX C;  2H09 A;  3CTA A;  4ASN A;  1USS A;  4HDU A;  2CW0 F;  1OPC A;  1SMY F;  1U5T B;  1O3S A;  4HW0 A;  2J5P A;  4MTE A;  3E3V A;  5FFX A;  2GXG A;  1K78 A;  4A6E A;  2QWW A;  1Y0U A;  2Z99 A;  2KKO A;  4YFX F;  2HTS A;  3FX3 A;  3HSF A;  1DUX C;  3ECH A;  3TO7 A;  2VXZ A;  4M9X A;  2EA4 A;  4S05 A;  2MH9 A;  2WC2 A;  5F6F A;  1LEB A;  2MBF A;  3RYP A;  2ZXJ A;  2O6G E;  1P4W A;  2QQB A;  2GAU A;  3S2W A;  1YS6 A;  1YIO A;  2UXX A;  4LGW A;  1IXR C;  5LRS A;  1HKT A;  1QGP A;  1T38 A;  2LF7 A;  4ENM A;  3R0J A;  1TLH B;  3LWF A;  3SXY A;  5CYV A;  3KP2 A;  2CFX A;  2DPU A;  4YFK F;  4ESB A;  3WTV C;  1HKQ A;  3HIF A;  2BE5 F;  3HRM A;  3M8E A;  2M45 A;  1REP C;  4K2E A;  2JTV A;  2VC0 A;  2F5D A;  3L9F A;  3LQR A;  1XGO A;  4HX7 A;  4M6Y A;  1R5G A;  4WXD A;  4KDP A;  1TW2 A;  3DQV C;  3E6D A;  2MC3 A;  1YO5 C;  4JK1 X;  3FM3 A;  2O8X A;  5L3D A;  3IRQ A;  3PQK A;  2XAG A;  2BEO A;  1JGS A;  4Q4Z F;  5IT9 K;  1GVJ A;  2V1U A;  2IA2 A;  4ZYE A;  2FE3 A;  2FBH A;  2LSO A;  1TBX A;  2R7D A;  4KN7 X;  2F5C A;  2QZ8 A;  3IHU A;  4RB3 C;  4OMZ A;  1S7O A;  3G73 A;  2YSR A;  4OIR F;  1IRF A;  2HFH A;  3K1P A;  1B6A A;  4HF0 A;  4Y17 A;  5CVU A;  2XKP A;  4A0Y A;  2IT0 A;  2M1B A;  3TDU C;  4QLC U;  4I09 A;  3O6B B;  3RYR A;  1GXP A;  2Y0M A;  4OIP F;  1XGN A;  3I59 A;  3MCZ A;  2QLZ A;  4HV5 A;  5L3F A;  1J9I A;  2VBZ A;  5LEJ A;  5LEK A;  4LLG F;  5FLX Z;  2X4H A;  1KU9 A;  5HS9 A;  2RC4 A;  3MFK A;  2FBK A;  3TQN A;  4LMY A;  3L2C A;  2O61 A;  1IF1 A;  3F72 A;  3ZP5 A;  1XN7 A;  4PGG A;  2JT1 A;  2ZME B;  5ED4 A;  3EYY A;  3P9K A;  3K69 A;  1LDK B;  1UB9 A;  2EFN A;  2DFI A;  3JAM Z;  4A5N A;  2CQK A;  3BRO A;  2XAF A;  1L0O C;  3RDI A;  3F8N A;  3E6C C;  2NNY A;  3ERE D;  4L5I A;  1J7K A;  2F2E A;  5DYM A;  1IAW A;  1R7J A;  4ZYD A;  2OD5 A;  3QP5 A;  1BJA A;  2QQ9 A;  2EK5 A;  1KU2 A;  2RQP A;  5LLQ A;  2VON A;  2W85 A;  3BWG A;  4CO8 A;  3KET A;  1BI1 A;  3CLO A;  4OU0 A;  5K5R A;  1QZY A;  3WTS C;  3GFM A;  2FOK A;  4MEY F;  2GA2 A;  3J80 Z;  3ZMD A;  1W7P B;  2VT3 A;  2ZBK A;  1JE8 A;  3CUQ B;  4CIC A;  5K1Y A;  4ENK A;  3HRU A;  2NAZ A;  4I98 B;  4M6X A;  1U3E M;  1WI9 A;  2WWY A;  1ZG1 A;  2DK5 A;  1UST A;  4BNC A;  1P2F A;  4RAY A;  2RNJ A;  4NQW A;  1R22 A;  1R36 A;  1ZAR A;  2XRN A;  1XSD A;  4G7O F;  4EGY A;  4M9S A;  3QOP A;  1EH8 A;  5HS8 A;  2YU3 A;  3TO6 A;  2TDX A;  4KNY A;  1MD0 A;  3SZT A;  4G6Q A;  2W57 A;  1W4M A;  5CVV A;  1NHA A;  3TOB A;  2KJB A;  4CZZ A;  1ZRF A;  4S04 A;  4AVP A;  3FXR A;  4B8X A;  2QBY B;  4RB0 A;  4RAZ A;  1P4A A;  3JW4 A;  1UCR A;  3GF2 A;  1FWZ A;  3F8F A;  1A04 A;  5DEQ A;  5LGU A;  3MZH A;  3H3U A;  2D1H A;  3WE2 A;  3ZQ7 A;  4XSZ F;  2L01 A;  5JFR A;  4WX9 A;  1FYM A;  3TGN A;  1ZGA A;  5EEH A;  1DP7 P;  1LVA A;  1RUO A;  5IT9 Z;  4MHG A;  4BAY A;  2P8T A;  1H0M A;  3ML6 A;  4YG2 F;  2H6C A;  2XAJ A;  2D45 A;  1ZLK A;  4GXO A;  3R0A A;  1FOK A;  3KLN A;  5EEG A;  5HLH A;  1YW9 A;  3I58 A;  2O3F A;  4EQQ A;  2V6C A;  4BH9 A;  2YX4 A;  2M5W A;  3QPT A;  4MNU A;  3BOQ A;  3K1M A;  2L3D A;  3HTS B;  2MA3 A;  4P96 A;  1IZ1 A;  2FNP A;  3CUQ C;  2DO7 A;  2GWR A;  1LJ9 A;  5JHU A;  3GO5 A;  3K2Z A;  1OYY A;  1WWX A;  2A3S A;  3RPU A;  4DQ2 A;  1FBQ A;  2A07 F;  3KFW X;  2A61 A;  3PFI A;  3JTH A;  2QYO A;  4KN4 X;  1OYW A;  3FWE A;  2ZNZ A;  4GCV A;  1UHM A;  3IRR A;  1TTY A;  3KCC A;  3LA3 A;  4G9Y A;  1SD4 A;  2XAQ A;  1S6L A;  4R8H A;  5AIQ A;  2AXL A;  1WKM A;  2FEZ A;  3DEU A;  4BXU A;  3KEQ A;  1I1S A;  1CGP A;  3BJA A;  2IJL A;  5CVR A;  1U6G A;  5LGT A;  1MGT A;  3J81 Z;  1SD5 A;  4R1H A;  4BHB A;  1ZG3 A;  1VTN C;  4IRH A;  3U9G A;  4A12 A;  3WGG A;  1O3R A;  2PJP A;  1F4K A;  5H6R A;  5FB2 A;  4L5J A;  3F6V A;  4HQM A;  3DF8 A;  3K0L A;  2PG4 A;  1R1V A;  1MKM A;  1SD7 A;  4EM0 B;  1K6O A;  3V7C A;  4L18 B;  2HYF A;  3T8R A;  1IN4 A;  4XSX F;  1Z7U A;  1HSJ A;  3RTR A;  6PAX A;  3WU1 B;  4LLN A;  3RKX A;  5D5V B;  3N97 A;  2IA0 A;  3E6M A;  4PZJ A;  2VBX A;  3ISP A;  4BHP A;  2OZU A;  1P92 A;  4XRF A;  1E2X A;  1FBS A;  1FBU A;  4KIG A;  5FLX K;  3F8B A;  3TOA A;  4I0A A;  5FO5 A;  4U7B A;  2ZCW A;  4N9H A;  4ESF A;  3SFZ A;  3I54 A;  4QWQ A;  2JSC A;  2P5L C;  2ZJ2 A;  3AAF A;  5D6E A;  5ICE A;  2BBY A;  1P6R A;  3WTW C;  1Z91 A;  3RIR A;  3ABT A;  4FX0 A;  3HYI A;  1ZH5 A;  2EB7 A;  1DDN A;  1U2W A;  1H9T A;  1FPQ A;  1B59 A;  4HA8 A;  5IT3 A;  1DPR A;  1T6S A;  3BP8 A;  5HS7 A;  2RKH A;  1YYV A;  1UHW A;  1JXS A;  2HOE A;  4IRG A;  3J80 K;  2W24 A;  2EV5 A;  2Q8K A;  3SHF A;  1W7P A;  2OU2 A;  3CUQ A;  2HTJ A;  3FMS A;  1D5V A;  2HQN A;  1KU3 A;  5HVQ C;  1FSH A;  4EJW A;  5A2Q K;  1T98 A;  1HW5 A;  2RDP A;  3VEP A;  5D4R A;  4UVA A;  2DI3 A;  3LA2 A;  3VOE A;  4OIQ F;  4O3M A;  2ESN A;  3KZZ A;  4P9U A;  1EH6 A;  3LA7 A;  4MQV A;  1ZRD A;  3C7J A;  3KP3 A;  2ETH A;  3LST A;  5E1Z B;  3R6S A;  4ZH4 F;  1KA8 A;  4KIB A;  3R61 A;  4A2U A;  3ABU A;  4ZZL A;  3ELK A;  4XBF A;  5ERI A;  2UZK A;  3V7S A;  4ETS A;  2F5E A;  2DAO A;  4I2O A;  2COM A;  4HYE A;  3IKV A;  3KP7 A;  2QBY A;  1BC8 C;  2CWE A;  3LFK A;  4MEX F;  2X0L A;  2DU9 A;  4LK0 F;  3V7R A;  2PQ8 A;  4I02 A;  3IWZ A;  1O7L A;  5BOX A;  5JVT A;  4AIH A;  1R23 A;  1YLF A;  5K5O A;  2VBW A;  4L9T A;  5K5Q A;  4GYG A;  4U0V A;  1FP2 A;  3I4P A;  4HV6 A;  5J6X A;  4RGU A;  1XGS A;  1BIA A;  3GWZ A;  3RJP A;  2FXA A;  5E8G A;  2VOP A;  4JBA A;  3C18 A;  2Y48 A;  3GEZ A;  2NNN A;  4LK1 F;  3TDZ C;  1ULY A;  1QQI A;  1U5T C;  4XLP F;  2XHK A;  3HHH A;  4N0B A;  5DCM A;  3PQJ A;  3WTU C;  5AIP A;  4NHJ A;  3EUH A;  1QZZ A;  2QM3 A;  4CHU A;  3O2P E;  4HQE A;  2K27 A;  3I53 A;  4HX8 A;  2R3S A;  2PMH A;  4ESJ A;  5DUI A;  3RI4 A;  1K7A A;  5KK1 A;  2H27 A;  5FD6 A;  5LBQ A;  3CUO A;  2RV8 A;  1ON2 A;  1ZLJ A;  2EV0 A;  2DLL A;  1Z6R A;  1FZP B;  2R7F A;  3RKW A;  5H6Q A;  3J7A O;  3KEO A;  3T0Y A;  4WXC A;  2KIF A;  2C6Y A;  3SQN A;  4HLX A;  2IVM A;  1ZRE A;  4HZF A;  1MJ9 A;  4UV8 A;  1OKR A;  4KMU X;  1I5Z A;  3H3Z A;  4IVN A;  1JHF A;  2BV6 A;  1PP7 U;  4RB2 C;  3J81 K;  3N4M A;  4Q47 A;  1W5S A;  1AWC A;  2ELH A;  4L9N A;  4E70 A;  5F1R A;  1BBY A;  4GGG A;  3I5U A;  5A2Q Z;  1HXD A;  2EFP A;  3QU6 A;  3ZN0 A;  3GFI A;  2FRH A;  1K78 B;  5ICF A;  3V8L A;  2ISZ A;  4HAM A;  5DV5 A;  3ZMV A;  2K4J A;  3WGH A;  1IN6 A;  1LDJ A;  4HF2 A;  2A69 F;  3DXJ F;  2FA5 A;  1YS7 A;  5LHG A;  1W7P D;  5HOO A;  3BPX A;  2E1N A;  4HF1 A;  3V4G A;  1J5Y A;  5L3C A;  2E1C A;  2P5V A;  4I01 A;  1RZ4 A;  3SZP A;  2MLK A;  2VE8 A;  2FF4 A;  3B02 A;  4KUM A;  1IXC A;  1IN8 A;  1BOA A;  2P7V B;  2XUB A;  4IF4 A;  2V1D A;  4CDG A;  2Q0O A;  3QRF F;  2Z3Y A;  2Z5U A;  3HUG A;  4WXH A;  1YW8 A;  2DW4 A;  5BPD A;  4LG0 B;  4ZYH A;  3GLX A;  1JHH A;  1LQ1 A;  2H6B A;  2VE9 A;  3E5Q A;  1G3W A;  3L00 A;  2Z33 A;  1T2K A;  1O3Q A;  2Q2E A;  3QP6 A;  4Y15 A;  3REO A;  1RIO H;  2GZW A;  4AD9 A;  2W84 A;  1F5T A;  2ZKZ A;  3RKY A;  2P4W A;  3W6J B;  1KU7 A;  1U5T A;  1XCV A;  1YTY A;  1Z9C A;  3ZMS A;  5BQT A;  1QNT A;  2MD5 A;  2OQG A;  2KIM A;  2ZNY A;  3D5L A;  4I7H A;  2O03 A;  3E97 A;  1QPM A;  2ACJ A;  4WF2 A;  4IJA A;  1XB4 A;  3BDD A;  4WWC A;  4YII A;  2NRA C;  1IW7 F;  4UNO A;  1HBX G;  2VBY A;  1CF7 B;  1IUY A;  2FU4 A;  2V79 A;  1TW3 A;  2E7X A;  4UXN A;  4H0E A;  3I59 B;  3LQQ A;  4AIK A;  1ON1 A;  4CXF A;  4Z2Y A;  1RUN A;  4U7D A;  4OIO F;  1C0W A;  3VFZ A;  3KP4 A;  2Y75 A;  4Q48 A;  4HLY A;  2EJR A;  3KP6 A;  1XD7 A;  2XRO A;  4EJV A;  2M8E A;  5CJ9 A;  5E18 F;  2PI0 A;  2P6T A;  3HTU A;  4NB5 A;  2OAZ A;  2XAH A;  1TQP A;  4HDV A;  1HW1 A;  3M1E A;  3F8C A;  1D8K A;  3E5U A;  5DD8 A;  1J59 A;  1SFE A;  5FD5 A;  4FT8 A;  1MDM B;  2G7H A;  3H92 A;  4XLN F;  3ZMT A;  2STT A;  4KIF A;  4TV7 A;  1FLI A;  3BJ6 A;  2A6H F;  1BI0 A;  2XGX A;  1HQC A;  1ZHF A;  1ZG5 A;  1S29 A;  4LD5 A;  4CYD A;  4RGR A;  3LAP A;  1OYI A;  2PLY A;  2BGC A;  2F5F A;  3C3W A;  1Z05 A;  4WK8 F;  1SD6 A;  1UFM A;  2XVC A;  4UVC A;  3JSP A;  2EFO A;  4WCG A;  2P6S A;  3GW2 A;  1G4D A;  5DCF A;  3KE2 A;  3GXO A;  1MJA A;  1KYW A;  5D4S A;  3TKY A;  3E5X A;  3WTZ A;  3F6O A;  5ICG A;  3NRV A;  2HQR A;  1ZRC A;  1S3J A;  4ENJ A;  2HEO A;  1QBJ A;  5CVI A;  5ILU A;  3G3Z A;  1U8R A;  3BPV A;  4KMF A;  2DQR A;  5L3B A;  2GXB A;  1GXQ A;  1T39 A;  4EVI A;  3F21 A;  1B9N A;  4CGZ A;  2ZO4 A;  4M74 A;  3HHG A;  4IHS A;  5J8C A;  1J0R A;  2FMY A;  4LB6 B;  4KFC A;  3U2R A;  5CLS A;  3DP7 A;  3EYI A;  4O6J A;  2ZME A;  3B73 A;  2G9W A;  3COA C;  4U0W A;  4IXA A;  1I27 A;  2NS0 A;  1Z6T A;  5JR3 A;  3GZ6 A;  2KJC A;  4RGS A;  3R4K A;  2CGP A;  1BC7 C;  2RVC A;  2QQA A;  2IPQ X;  1XGM A;  5D5W B;  1SAX A;  4BHC A;  2XAS A;  2YX7 A;  1XSX A;  3W6K B;  5FFZ A;  1PUE E;  1W5T A;  1RNL A;  1B9M A;  4LB5 A;  3WU0 A;  2JZY A;  2A68 F;  1ONV A;  3R60 A;  4FHT A;  2K4B A;  2VT2 A;  3M8F A;  5HLI A;  1FC3 A;  5HDN A;  4GYI A;  1B1B A;  3M7G A;  4AIJ A;  1KQ0 A;  2WV0 A;  2VN2 A;  5HLG A;  1HST A;  2EV6 A;  5D6F A;  4EGZ A;  2LNB A;  2P5K A;  1YQA A;  2CSO A;  4M73 A;  4EJT A;  5E1X A;  3V8J A;  1R1U A;  3FHZ A;  5BPI A;  4YFN F;  1R00 A;  4L0Y B;  2B0L A;  2XKO A;  3EQL F;  4N9I A;  2FML A;  4IRI A;  3WOD F;  2L4M A;  2K02 A;  2LF8 A;  3HRS A;  1XDU A;  1FYK A;  5AON A;  4EMS A;  3LAJ A;  5HDG A;  2HDC A;  1WRJ A;  1DPU A;  2OZ6 A;  4BYY A;  3FZV A;  3GZ5 A;  4YIF A;  1XMK A;  2YPR A;  1MZB A;  2EFQ A;  3V8K A;  2JPC A;  3GUD A;  5D5U B;  4LG0 A;  3GYH X;  4Q5S F;  2CG4 A;  1BM9 A;  4B09 A;  1ZGJ A;  4Y13 A;  3I71 A;  3DPT A;  1QO0 D;  5DDG A;  2K86 A;  1J75 A;  3F3X A;  1TNS A;  3F22 A;  1LB2 A;  4P55 A;  2VC1 A;  2WTE A;  1SFU A;  3WGI A;  5TRD A;  2EWN A;  2QVO A;  1S7A A;  2ZFW A;  2ADU A;  2DTR A;  2L4A A;  2FBI A;  1O3T A;  1KQ9 A;  4A0X A;  2CO5 A;  2HWV A;  1V4R A;  2EFW A;  1B4A A;  2PBI A;  1U78 A;  3GFJ A;  1G3T A;  3ZPL A;  1G6N A;  2J5O A;  1TNT A;  1XSV A;  4PCQ A;  2JRT A;  3WE3 A;  3FM5 A;  1CF7 A;  4OOI A;  4R79 A;  2GQQ A;  1BIB A;  3D0S A;  4FX4 A;  2MLG A;  4ENN A;  3DV8 A;  1FYL A;  3CO6 C;  2H94 A;  4U0Y A;  1D8J A;  5HDK A;  3JTG A;  4EJO A;  2UXN A;  1YW7 A;  3I64 A;  2ESH A;  3GVA A;  4U88 A;  1BI3 A;  3HSE A;  2HKO A;  3GFL A;  4G7H F;  1FT9 A;  3MQ0 A;  1GHC A;  4UVB A;  2L02 A;  4KT5 C;  3MAJ A;  3L7W A;  4G8X A;  1WQ2 A;  1MDM A;  2W25 A;  2OBP A;  1XDS A;  4M72 A;  1I1G A;  2M87 A;  1LNW A;  2KRF A;  4EM1 A;  5E20 A;  3WTT C;  5LGN A;  4F7Z A;  2G7U A;  2A6E F;  1KQ8 A;  2YR2 A;  1EH7 A;  3JSO A;  5E1W A;  4KA4 A;  1D3Y A;  3T8T A;  2XV4 S;  4EJU A;  1S8N A;  1FY7 A;  2AS5 F;  3HOS A;  3QU3 A;  1ZAO A;  3EDP A;  2DQL A;  3HSR A;  3ZN1 A;  2DPD A;  2EA2 A;  1E17 A;  3WTY C;  4M9Z A;  1KGS A;  1ZYR F;  3FXQ A;  4RB1 A;  2FNA A;  1J2X A;  3TO9 A;  4ZZD A;  1YFH A;  2Z9O A;  1SMT A;  1G3S A;  2GA1 A;  2PFB A;  5LHH A;  2FQ3 A;  3BY6 A;  5ILV A;  2HS5 A;  3NQO A;  3CJN A;  2KIU A;  3MZY A;  4A5M A;  1P4X A;  2NYX A;  4ZYG A;  3GX4 X;  3MWM A;  2IP2 A;  3P9C A;  1OR7 A;  3F23 A;  4G94 A;  3L09 A;  1LEA A;  3WG9 A;  2PEX A;  2IRF G;  4O5V A;  3I0T A;  2ISY A;  3FF5 A;  1R5H A;  4MTD A;  1IN5 A;  2L54 A;  3FMR A;  2V9V A;  4DNC A;  3Q9S A;  1X3U A;  1KYZ A;  5LHI A;  1RI7 A;  3ECO A;  3FXU A;  4MQ9 F;  4LLL A;  5L3G A;  3NEU A;  5E8I A;  5CVJ A;  2OA4 A;  2PMU A;  2DK8 A;  1ZN2 A;  4HX4 A;  1K79 A;  2D1V A;  5D5X B;  2STW A;  3ROU A;  4UV9 A;  2M30 A;  3ZMZ A;  4IPA A;  3E6B A;  3HOT A;  5H20 A;  4PGH A;  4KYW A;  1EV7 A;  2D2W A;  2IA1 A;  4LJZ F;  4LFU A;  4JQF A;  1O57 A;  5F64 A;  2QUF A;  5E17 F;  1HW2 A;  2FSW A;  5DCM B;  4UHT A;  2P7C B;  1V3F A;  2PN6 A;  1FX7 A;  2XIG A;  3P9I A;  1IRG A;  2DT5 A;  3ULQ B;  4A0Z A;  1L3L A;  3VOD A;  2HYG D;  3IWF A;  3MEX A;  1YG2 A;  1WSU A;  4KIC A;  3U1D A;  1MJB A;  4GO1 A;  1TQM A;  1I6X A;  1R58 A;  3Q9V A;  4I0B A;  2HKX A;  1STZ A;  4UUV A;  3HRT A;  3EET A;  1AOY A;  2CYY A;  2IW5 A;  3M9A A;  4M71 A;  2UWM A;  1PDN C;  3F8M A;  2MH2 A;  1SFX A;  1F1Z A;  5J8F A;  5ILS A;  1FNN A;  3QAH A;  2O0Y A;  2JPB A;  1IXS B;  4MGR A;  5DD4 A;  1PP8 F;  1R1T A; 
#chains in the Genus database with same CATH topology
 4IHT A;  5LRR A;  2LRD A;  4NC8 A;  4L9J A;  3KLO A;  2DA3 A;  2LR8 A;  2X48 A;  1ETW A;  2JSP A;  3BZ6 A;  3CDH A;  2LY2 A;  4D0P A;  3S1R J;  3QPH A;  4OIN F;  2ME6 A;  3G1L A;  2K9Q A;  4LIV A;  3CO7 C;  2R7X A;  1O7F A;  3T1B A;  2BY2 A;  2V1X A;  3W2V A;  1V55 H;  3HOZ J;  2RN7 A;  1JKQ C;  1EF4 A;  3C1D A;  5KAI C;  4L9V A;  2HGC A;  3KZY A;  3IL2 A;  1Q1H A;  2IGN A;  3VB2 A;  2X6Y A;  5BMZ A;  3OV8 A;  4C3I J;  4J00 A;  1TWF J;  2QEN A;  1A35 A;  2E7W A;  2OC6 A;  1Y6I A;  1FOX A;  4D5F A;  3CQZ J;  5FLV A;  5TIS C;  1ZK8 A;  1XCB A;  3A2K A;  3SDB A;  5BS6 A;  1DGW Y;  2DMU A;  2IEK A;  5F04 A;  2M4G A;  3ABL H;  3AG3 H;  2HZT A;  4G6D A;  4XN0 A;  1FSE A;  3K1N A;  2XF5 A;  5KVR A;  3I4N J;  4OMY A;  4PK4 A;  1BI2 A;  1MH3 A;  1TQI A;  4BQA A;  1F9N A;  2QKL B;  1BR1 A;  2JN6 A;  3DKY A;  3RPQ A;  5JI6 A;  2XGC A;  4B1R A;  2R92 J;  1YJN I;  2VOO A;  1GDT A;  1VF9 A;  4G7Z F;  5ICC A;  3Q5F A;  3FMQ A;  1GVD A;  1MMA A;  4PDK A;  5DUK A;  3ZMU A;  4B48 A;  3CJT B;  2B9S A;  2HR3 A;  4V2F A;  4HBL A;  2HU9 A;  2DBB A;  2VQG A;  3DKW A;  4P5O A;  1Y39 A;  2KIS A;  1Z1D A;  5H2F C;  4A3I J;  2K7L A;  5D8K B;  4L0Z B;  1RKT A;  5FGM A;  2OQR A;  4EV0 A;  2R7Z J;  2A5Y B;  4AWX B;  2E34 A;  4PFO A;  2VJJ A;  1X3Z B;  2MFZ A;  1YIJ I;  3HG9 A;  3P7N A;  4ON0 A;  2RGV A;  5L3E A;  1X58 A;  1LDD A;  2LKP A;  4HOB A;  5TJJ A;  3IP4 B;  2CUF A;  5J4V A;  3KP5 A;  1BN5 A;  4EM2 A;  4RGX A;  3T5X A;  5F08 A;  2GIV A;  4A6D A;  2EZH A;  3AFH A;  4PJN A;  4RS8 A;  2VOD A;  1HKS A;  1X4P A;  3A0H C;  4BAC A;  1XMA A;  2OPT A;  3OOP A;  5D8L B;  4BJ5 C;  5IPA A;  3IAM 2;  3JAM K;  3DFG A;  1PUF A;  3AL0 B;  1AHD P;  1G3Y A;  1T0F A;  3IC7 A;  3BJO A;  1Y0N A;  3IKT A;  3FIS A;  3PUB A;  4AYB N;  1F43 A;  3O3K A;  2UUZ A;  1TL8 A;  1ODD A;  1ITY A;  1FP1 D;  3CMM A;  3DPL C;  2ZB9 A;  2LDU A;  3K9T A;  4QSH A;  1H9G A;  1OMI A;  2BYV E;  2DMN A;  2DA1 A;  1IN7 A;  3LFU A;  4XQF A;  4P9F A;  3WTX C;  2H09 A;  3CTA A;  2OJE D;  2MYS A;  1GV2 A;  1USS A;  3VDX A;  4ASN A;  4BEH A;  1I50 J;  2CV0 A;  3HPG A;  3PO3 J;  3VYS B;  4HDU A;  2EZI A;  2CW0 F;  1OPC A;  1WI3 A;  1OCZ H;  3OYA A;  1SMY F;  3BCB A;  2F4O B;  1U5T B;  1SAU A;  1O3S A;  1CQT A;  4HW0 A;  2E35 A;  2FX0 A;  1Z77 A;  2J5P A;  4MTE A;  3E3V A;  3GBG A;  4OAZ A;  2DFH A;  2Z1D A;  3FKI J;  2WY8 Q;  3MKZ A;  2EZK A;  5FFX A;  2GXG A;  1K78 A;  4P1W A;  2QWW A;  1MMG A;  4A6E A;  1Y0U A;  2Z99 A;  2KKO A;  4BY7 J;  4YFX F;  1J09 A;  2HTS A;  2E5N A;  2GBY A;  3FX3 A;  3HSF A;  4XIC A;  3H0G J;  2W00 A;  2CUJ A;  4RMN A;  1JUP A;  3BQZ A;  1DUX C;  4J01 A;  3ECH A;  3TO7 A;  1AKH B;  2HZD A;  1S7E A;  2VXZ A;  4F93 B;  1ENH A;  3FK7 A;  4M9X A;  1DQU A;  2EA4 A;  2KQR A;  4YEL A;  3NAR A;  4S05 A;  2XF6 A;  3RQ4 A;  2V9K A;  2MH9 A;  4II2 A;  2LOO A;  2WC2 A;  5F6F A;  3UR3 C;  1LEB A;  1HOM A;  3K7A J;  1D1A A;  4AUX A;  4XOR A;  2MBF A;  5FKO A;  2I8D A;  3RYP A;  4BQQ A;  2K3P A;  4BDY A;  2ZXJ A;  2O6G E;  1P4W A;  2CU7 A;  1XS9 A;  1LPQ A;  3TW6 A;  5GPC A;  2QQB A;  4XON A;  3RZD J;  3KEY A;  2GAU A;  1RKW A;  3S2W A;  1YS6 A;  3W2A A;  1YIO A;  4GRI A;  2UXX A;  4LGW A;  4XRS G;  1IXR C;  5LRS A;  1TP4 A;  1HKT A;  1QGP A;  3G2B A;  1T38 A;  2LF7 A;  4ENM A;  3K70 D;  3R0J A;  1TLH B;  3LWF A;  4G6T B;  3SXY A;  3OYJ A;  2HPI A;  5CYV A;  2ELJ A;  3KP2 A;  2CFX A;  2DPU A;  4YFK F;  4ESB A;  3WTV C;  3A01 B;  4GFB A;  1H8A C;  1HKQ A;  3HIF A;  2BE5 F;  3H36 A;  3HRM A;  3M8E A;  2M45 A;  1REP C;  4K2E A;  1KZH A;  2JTV A;  1Q1V A;  1MBH A;  4FIS A;  2VC0 A;  2CQN A;  5M3F J;  2JVG A;  3PSI A;  2F5D A;  3IH3 A;  3L9F A;  3QPL A;  3HGY A;  5EEA A;  3LQR A;  1XGO A;  1LFP A;  2BZT A;  4HX7 A;  4M6Y A;  3ZQI A;  5HNH A;  1G59 A;  2VKD A;  2JA8 J;  1R5G A;  4WXD A;  4BE1 A;  4KDP A;  4IHX A;  1TW2 A;  3DQV C;  2LVS A;  3E6D A;  1T8I A;  4A3K J;  1TWH J;  2MC3 A;  3G1M A;  3DTK A;  3WHB A;  3A1Y A;  5E3N A;  1YO5 C;  2VKE A;  1SVL A;  1XC5 A;  1VQ4 I;  4JK1 X;  3FM3 A;  2O8X A;  1WPK A;  5GP9 A;  3DLL F;  5L3D A;  3IRQ A;  3PQK A;  2R5Y A;  1QU3 A;  3CCJ I;  2XAG A;  2BEO A;  1JGS A;  4Q4Z F;  2VUM J;  4A93 J;  3DCF A;  3HOW J;  5IT9 K;  4MIM A;  4IZZ A;  3AL0 C;  1GVJ A;  3OS1 A;  2V1U A;  1D1B A;  2IA2 A;  4ZYE A;  1FMW A;  2FE3 A;  1WHU A;  2QF7 A;  2FBH A;  2LSO A;  1TBX A;  2R7D A;  4KN7 X;  1I6H J;  4MFD A;  2QZ8 A;  2F5C A;  3IHU A;  2NOJ B;  1FOW A;  2M0M A;  4RB3 C;  4OMZ A;  1QHH D;  1S7O A;  3G73 A;  3PUF A;  2YSR A;  1A31 A;  4N4O B;  4OIR F;  1JJ8 C;  3S2D J;  1IRF A;  2HFH A;  3K1P A;  1B6A A;  2K9L A;  4HF0 A;  4Y17 A;  2CRG A;  5CVU A;  2XKP A;  5EDN A;  1N75 A;  4A0Y A;  2IT0 A;  2CS3 A;  4RDU A;  2M1B A;  3TDU C;  4QLC U;  2OV7 A;  2ZSH B;  4I09 A;  3ZOB A;  4BXX J;  2F4I A;  3O6B B;  3RYR A;  3QPS A;  1GXP A;  2Y0M A;  4OIP F;  3DEW A;  4BS9 A;  1XGN A;  3I59 A;  3MCZ A;  2QLZ A;  4HG2 A;  3HGG A;  4HV5 A;  4A3G J;  3OR2 C;  5L3F A;  1J9I A;  2EZL A;  2VBZ A;  1I39 A;  5LEJ A;  2XSD C;  1BR2 A;  2D5V A;  5E3O A;  5LEK A;  4LLG F;  5FLX Z;  2X4H A;  2L9S A;  3VYT B;  1KU9 A;  5HS9 A;  5GAG J;  2RC4 A;  3MFK A;  1WH7 A;  2FBK A;  3TQN A;  4LMY A;  3L2C A;  2O61 A;  1IF1 A;  3F72 A;  3A03 A;  3IH2 A;  3ZP5 A;  1XN7 A;  1H88 C;  2DTZ A;  2KDZ A;  1UAA A;  2O8K A;  4PGG A;  2JT1 A;  2ZME B;  5ED4 A;  3EYY A;  3TBI A;  4MLO A;  4BXF A;  3P9K A;  3K69 A;  3OS0 A;  1LDK B;  1UB9 A;  2EFN A;  2DFI A;  1BJZ A;  3CF2 A;  3MZ8 A;  3JAM Z;  1R71 A;  3DTE A;  1BOB A;  4A5N A;  1GLN A;  2CQK A;  3BRO A;  2XAF A;  1L0O C;  3RDI A;  1LE8 B;  1YJ9 I;  2VL8 A;  5DS9 A;  3F8N A;  3E6C C;  2HDW A;  2NNY A;  3ERE D;  4L5I A;  1J7K A;  2F2E A;  3L2W A;  1OCC H;  5DYM A;  2VJI A;  1IAW A;  1R7J A;  4ZYD A;  2OD5 A;  1Z7L A;  3QP5 A;  1BJA A;  5LD2 C;  1KON A;  2BVL A;  4I76 A;  2WB1 N;  1MMS A;  2QQ9 A;  2EK5 A;  1KU2 A;  2RQP A;  1OIS A;  3L2R A;  5LLQ A;  2VON A;  2AQF A;  2W85 A;  3CMY A;  3BWG A;  4CO8 A;  3KET A;  1BI1 A;  3CJR B;  3CLO A;  4OU0 A;  2E60 A;  5K5R A;  4CSW A;  1QZY A;  4XLE A;  3GFM A;  3WTS C;  3OYD A;  4C3J J;  2CUE A;  1V54 H;  2FOK A;  3L2Q A;  4MEY F;  2GA2 A;  2VLA A;  5EF6 A;  2CQ7 A;  4FE4 A;  3J80 Z;  4EEF G;  2ZFU A;  3ZMD A;  1W7P B;  2VT3 A;  2ZBK A;  5IP7 J;  1JE8 A;  3CUQ B;  5BNG A;  2KHM A;  3V42 A;  4CIC A;  4ITV A;  5K1Y A;  2KDO A;  4ENK A;  3HRU A;  2NAZ A;  2R0Q C;  2WAE A;  4I98 B;  4M6X A;  3CLQ A;  1U3E M;  5TGT A;  1W1W E;  3ZQC A;  1WI9 A;  3CCY A;  3HEF A;  4DYR A;  2WWY A;  4A3F J;  4HRI A;  1ZG1 A;  2DK5 A;  1UST A;  3OWT A;  1P2F A;  4BNC A;  4RAY A;  1WJA A;  2RNJ A;  1XG1 A;  4NQW A;  1R22 A;  4DZJ A;  3BZK A;  2H1K A;  3W6V A;  3HOX J;  1R36 A;  1ZAR A;  2XRN A;  2X51 A;  1XPX A;  2AO9 A;  1XSD A;  1BL0 A;  4G7O F;  2PMZ A;  4EGY A;  4M9S A;  3G6E I;  2EH3 A;  3QOP A;  1EH8 A;  4FTH A;  5HS8 A;  2YU3 A;  3TO6 A;  2WAQ N;  4X0G A;  2TDX A;  4KNY A;  1D0Z A;  1MD0 A;  3SZT A;  5GTI C;  1Z3X A;  2DOA A;  2E2H J;  3GTO J;  4G6Q A;  3H3V K;  2W57 A;  4Y52 J;  1W4M A;  3QOD A;  1NHA A;  5CVV A;  3TOB A;  2LC2 A;  2R4G A;  2KJB A;  1O4X A;  4CZZ A;  1ZRF A;  2QQ8 A;  4S04 A;  1GV5 A;  2DN0 A;  4HEA 2;  3ASN H;  3DTI A;  3H5R A;  4CUG A;  4AVP A;  3FXR A;  4B8X A;  4E6K G;  2QBY B;  4RB0 A;  4RAZ A;  1P4A A;  4HNV A;  5GAD J;  4IEJ A;  4UUS A;  3HOY J;  3CJQ B;  3DPU A;  3JW4 A;  2H1L A;  3BG7 A;  2JJ7 A;  1UCR A;  3GF2 A;  1FWZ A;  3F8F A;  2NVQ J;  1A04 A;  4A3L J;  2JUC A;  5DEQ A;  5LGU A;  2QA4 I;  3P5J A;  4IO9 F;  3MZH A;  3H3U A;  2D1H A;  5IY5 H;  3WE2 A;  1ETY A;  3ZQ7 A;  3CCQ I;  1MBG A;  2L01 A;  2ZXW H;  4XSZ F;  5JFR A;  3ABK H;  4WX9 A;  1FYM A;  3KYD B;  3TGN A;  1ZGA A;  5EEH A;  3RQI A;  1DP7 P;  1LVA A;  5HNF A;  1RUO A;  4E7L A;  5IT9 Z;  3RCO A;  3JRF A;  3LSR A;  4MHG A;  3CCM I;  3SEQ A;  1WZ2 A;  1MBE A;  4BAY A;  4BUP A;  1K6Y A;  2P8T A;  1H0M A;  2L2O A;  3ML6 A;  4YG2 F;  2H6C A;  2F4M B;  4MO7 A;  2XAJ A;  2D45 A;  2ELK A;  1ZLK A;  4GXO A;  1G2H A;  2JA6 J;  3R0A A;  1FOK A;  3KLN A;  3AKZ A;  5EEG A;  5HLH A;  1YW9 A;  4BL0 B;  3I58 A;  2O3F A;  4EQQ A;  1NK3 P;  2V6C A;  1QZE A;  2COB A;  3GTK J;  4BH9 A;  2YX4 A;  3FDY A;  2M5W A;  3QPT A;  4MNU A;  4QPQ A;  3BOQ A;  5EJC A;  2L7M P;  1AKH A;  3K1M A;  2L3D A;  2CV2 A;  3HTS B;  2Q1Z B;  3LSI A;  5IYD J;  2MA3 A;  4D7M A;  3LSP A;  4DOZ A;  4P96 A;  4Y4R A;  1IZ1 A;  2FNP A;  3CUQ C;  4AYB A;  2O9L A;  2DO7 A;  2CJJ A;  2GWR A;  1LJ9 A;  5JHU A;  3GO5 A;  3K2Z A;  1OYY A;  1WWX A;  2A3S A;  1ZEL A;  3RPU A;  4DQ2 A;  1IDY A;  2E5Z A;  2M0C A;  1FBQ A;  2A07 F;  4M3E A;  2L7Z A;  2A61 A;  2VQL A;  3KFW X;  1LFB A;  3PFI A;  1OCR H;  3JTH A;  2QYO A;  4XLA A;  4KN4 X;  1I3Q J;  4Y3O A;  1X19 A;  1OYW A;  3FWE A;  5E79 C;  5IP6 A;  2ZNZ A;  1X1P A;  1UHM A;  4GCV A;  1SEU A;  2BY1 A;  2CV1 A;  1LVK A;  3PJR A;  1T08 B;  2R7V A;  3IRR A;  1TTY A;  3KCC A;  1VQP I;  3LA3 A;  2F5V A;  1MH4 A;  5K7H A;  1OFC X;  4G9Y A;  1SD4 A;  2XRL A;  4CZC A;  2XAQ A;  1ZR4 A;  2L9V A;  4KT6 A;  1S6L A;  3ABM H;  1UHS A;  3DU6 A;  5FKL A;  5E3M A;  4R8H A;  3A01 A;  1V5F A;  1E3P A;  3OYB A;  2ECB A;  5AIQ A;  2AXL A;  1WKM A;  2FEZ A;  3DEU A;  5EG0 B;  3CC7 I;  4BXU A;  3KEQ A;  1IRX A;  1I1S A;  2IAI A;  5JLX A;  3BG5 A;  2L9R A;  3OIP A;  1X3W B;  3SZG A;  1P9Q C;  3HPH A;  4J19 A;  1CGP A;  2LY1 A;  3BJA A;  5J47 A;  4IL6 C;  2HVQ A;  2IJL A;  5CVR A;  1MBF A;  1U6G A;  5LGT A;  4CYC B;  4AVZ A;  4XLC A;  1MGT A;  2QKM B;  3J81 Z;  1SD5 A;  4R1H A;  1ORK A;  4BHB A;  1TWA J;  1ZG3 A;  2XGE A;  4M3F A;  1VTN C;  2RAE A;  1FTZ A;  2NVY J;  4IRH A;  3U9G A;  3DBR B;  4A12 A;  3WGG A;  5FRO A;  1O3R A;  2PJP A;  3BT9 A;  1FJL A;  1F4K A;  1VND A;  2EQR A;  5H6R A;  5FB2 A;  4DW6 A;  4L5J A;  3F6V A;  4HQM A;  1SAN A;  4YIR X;  4YRV A;  2RRE A;  4PSX A;  3DF8 A;  3K0L A;  5M5Y J;  5J40 A;  2PG4 A;  4OWR B;  1R1V A;  1MKM A;  3K4M A;  4PJ0 C;  1SD7 A;  4EM0 B;  1K6O A;  3Q3S A;  3QQA A;  3V7C A;  1B8I B;  2K3F A;  3DKX A;  4L18 B;  2M7B A;  4ZDO A;  2HYF A;  4E7H A;  2BHZ A;  2W48 A;  3L2V A;  3T8R A;  1IN4 A;  1Y56 A;  2X1C A;  4XSX F;  1Z7U A;  1HSJ A;  3RTR A;  4XOP A;  6PAX A;  4AID A;  3WU1 B;  4LLN A;  1UG0 A;  3K2A A;  3RKX A;  3RKQ A;  1E3O C;  5D5V B;  3N97 A;  2TCT A;  2IA0 A;  3E6M A;  4PZJ A;  2M2E A;  2M34 A;  2GM4 A;  2VBX A;  2DMP A;  3ISP A;  4BHP A;  2OZU A;  4D5C A;  1P92 A;  4U87 A;  3M1C A;  3FHN A;  4XRF A;  1E2X A;  3F9K A;  1FBS A;  3JRE A;  2X85 A;  4NC6 A;  1FBU A;  1MND A;  1YX3 A;  4KIG A;  3NWT A;  3F8B A;  5FLX K;  1SVM A;  3TOA A;  2HNH A;  2O7O A;  4I0A A;  3OYI A;  5FO5 A;  4U7B A;  3SJM A;  2LBF A;  2O5R A;  2ZCW A;  2B7E A;  2XSJ C;  2R5Z A;  2DMT A;  3EUH C;  4N9H A;  4ESF A;  3SFZ A;  2N8G A;  4OAY A;  1ETO A;  3I54 A;  5IOY A;  4QWQ A;  2JSC A;  2P5L C;  2IS1 A;  1FEX A;  2ZJ2 A;  3HUG B;  3AAF A;  5D6E A;  1OCP A;  5ICE A;  2BBY A;  2BXZ A;  4CA0 A;  4B4C A;  1P6R A;  3D1N I;  3WTW C;  4FCY A;  1Z91 A;  3PIP F;  3RIR A;  3HL2 A;  1HA8 A;  4JYK A;  3BR2 A;  3ABT A;  4XKB A;  4BBR J;  3ZR8 X;  2Q2E B;  1POG A;  3OIO A;  4CCN A;  2DT7 B;  4FX0 A;  4CCK A;  2YS9 A;  3HYI A;  1ZH5 A;  1MIJ A;  2EB7 A;  1SFK A;  2LFB A;  1DDN A;  2CQQ A;  3PM1 A;  1U2W A;  1H9T A;  1FPQ A;  1IRZ A;  1B59 A;  4HA8 A;  1GUU A;  5IT3 A;  1DPR A;  3BLY A;  1T6S A;  4E7Z A;  4M6V A;  3BQY A;  3BP8 A;  1EJ9 A;  5HS7 A;  2RKH A;  1YYV A;  4ZC3 A;  1UHW A;  5GPA A;  3UNG C;  5J1Y A;  1JXS A;  2HOE A;  2E2I J;  2I10 A;  2XPV A;  4IRG A;  3J80 K;  3RZO J;  2W24 A;  2Y69 H;  2EV5 A;  1B72 A;  2Q8K A;  1VQ8 I;  5EZH A;  3SHF A;  1W7P A;  2MW8 A;  3ASO H;  2BW3 A;  2OU2 A;  3CUQ A;  3S3M A;  4IX7 A;  3OL3 A;  2HTJ A;  3FMS A;  2Y9Z A;  1D5V A;  2HQN A;  1KU3 A;  5HVQ C;  5M5W J;  1FSH A;  2LH9 A;  3Q0U A;  4EJW A;  5A2Q K;  1BW6 A;  1T98 A;  2DDB A;  1HW5 A;  2NVX J;  1R6R A;  2RDP A;  1TZL A;  1UG2 A;  3VEP A;  5D4R A;  4UVA A;  2DI3 A;  3LA2 A;  3VOE A;  4OIQ F;  2G0E A;  4O3M A;  2ESN A;  3KZZ A;  2BHY A;  4P9U A;  1EH6 A;  2JA5 J;  3LA7 A;  2WB1 A;  2DMQ A;  1RET A;  3OL4 A;  2EBI A;  1MBJ A;  3KPH A;  1T56 A;  4MQV A;  2W7N A;  4NNJ A;  2DOF A;  4NUB A;  3FK6 A;  1ETQ A;  3C7J A;  3KP3 A;  3C2H A;  1ZRD A;  2ETH A;  3D5R C;  3LST A;  4XID A;  2QEX I;  5E1Z B;  3R6S A;  2DYR H;  3CZ6 A;  4ZH4 F;  2F48 A;  2MD0 A;  1KA8 A;  2I5U A;  2V26 A;  4KIB A;  3I4M J;  3LSJ A;  3R61 A;  1OCT C;  2PX9 A;  3ABU A;  4A2U A;  4F52 A;  4ZZL A;  1ZQ3 P;  3KIO A;  1Z67 A;  3ELK A;  4XBF A;  5ERI A;  1V5E A;  2UZK A;  1D0Y A;  3QYF A;  2NVU B;  3V7S A;  3G71 I;  3S17 J;  1X4O A;  3H1C A;  4ETS A;  2L7F P;  1YJW I;  2F5E A;  2DAO A;  1YI2 I;  2HVS A;  1TT0 A;  4I2O A;  2VI6 A;  2COM A;  4LG3 A;  3S2H J;  2MAB A;  1FTT A;  4HYE A;  3IKV A;  3KP7 A;  3GTG J;  2QBY A;  1BC8 C;  3RPU D;  2CWE A;  3LFK A;  2DFE A;  4DBQ A;  4A3B J;  3NAU A;  4MEX F;  2M3A A;  5IOZ A;  2BY3 A;  3ZXS A;  3KYC B;  4X6A J;  4BE0 A;  4A3E J;  2X0L A;  1FIP A;  2DU9 A;  1YIT I;  1IC8 A;  4LK0 F;  4II3 A;  3V7R A;  1WVR A;  3DBH B;  2LLK A;  2PQ8 A;  2EPF A;  2KRH A;  2NXN B;  2CUZ A;  3IWZ A;  1O7L A;  4I02 A;  3JRB A;  1FOY A;  5JVT A;  5BOX A;  2VB6 A;  4Z6Y A;  2QCO A;  4AIH A;  2CQX A;  3MD2 A;  1R23 A;  1YLF A;  3GME A;  4XMY A;  5K5O A;  2VQC A;  4E7J A;  1ZR2 A;  2VBW A;  4L9T A;  2WAQ A;  2XAU A;  2YUS A;  4G12 A;  2E71 A;  4IOA F;  1JTY A;  3TW7 A;  5K5Q A;  4GYG A;  3A02 A;  3TP0 A;  4U0V A;  2IGM A;  2JUG A;  1FP2 A;  1S72 I;  3I4P A;  1ZKG A;  4HV6 A;  4B43 A;  5J6X A;  1WJE A;  1UJ8 A;  4RGU A;  3TP3 A;  1IUF A;  1XGS A;  2A6T A;  1BIA A;  3GWZ A;  1LFU P;  3RJP A;  1BR4 A;  2FXA A;  5E8G A;  3WG7 H;  2VOP A;  4JBA A;  3OSF A;  1OQY A;  3C18 A;  2V1N A;  1VQ9 I;  2Y48 A;  3EPZ A;  3S14 J;  3GEZ A;  3FBN B;  1V5G A;  2NNN A;  4LK1 F;  1W0U A;  3TDZ C;  1TWC J;  2NOG A;  1ULY A;  4H4K C;  1QQI A;  1U5T C;  1F36 A;  4BU2 A;  4XLP F;  1MBK A;  2XHK A;  3HHH A;  4KJZ A;  4N0B A;  4BGD A;  5DCM A;  3PQJ A;  2L7K A;  3WTU C;  2H8W A;  5AIP A;  1TWG J;  2GIZ A;  3CDL A;  4NHJ A;  3EUH A;  2L5Q A;  1QZZ A;  2QM3 A;  5IP9 J;  4CHU A;  1JGG A;  3O2P E;  4HQE A;  2K27 A;  3KYL A;  3I53 A;  2V4J C;  4HST A;  5JHF A;  4HX8 A;  3O8H A;  2R3S A;  3OY9 A;  4A69 C;  4BJ6 C;  5FLM J;  2PMH A;  4ESJ A;  5DUI A;  3RI4 A;  1K7A A;  5KK1 A;  2IGO A;  2VIX A;  2H27 A;  1YRN B;  4BBS J;  2VXD A;  5FD6 A;  5LBQ A;  3CUO A;  2RV8 A;  4C9Y A;  2DXI A;  2ZJR F;  5LFA A;  1ON2 A;  1ZLJ A;  2DLL A;  2EV0 A;  1Z6R A;  1FZP B;  1OLT A;  2R7F A;  2ME0 A;  3RKW A;  5DTD A;  3M3Y J;  5H6Q A;  3J7A O;  3KEO A;  3JRD A;  3T0Y A;  5HLT A;  4ABZ A;  3L1P A;  4WXC A;  2KIF A;  4W97 A;  4A3J J;  2C6Y A;  3SQN A;  4HLX A;  1PUF B;  2IVM A;  3QYB A;  1ZRE A;  1DU6 A;  5B5E C;  4HZF A;  1MJ9 A;  4UV8 A;  1OKR A;  2MSY A;  4KMU X;  1I5Z A;  2TRT A;  1VQO I;  3C2B A;  3EUA A;  3H3Z A;  4IVN A;  4ZDL A;  2WAF A;  1JHF A;  2BV6 A;  1PP7 U;  2LMD A;  2ZXI A;  4RB2 C;  3J81 K;  4F91 B;  3N4M A;  1TT5 B;  4CYC A;  4Q47 A;  3MKY B;  1DGR M;  1W5C C;  1W5S A;  2ELH A;  1Y1V J;  2KIQ A;  1AWC A;  3EUK L;  4L9N A;  4E70 A;  5F1R A;  1BBY A;  1R4N B;  3ZCO A;  4GGG A;  4RLQ A;  2A5W A;  3I5U A;  3BTC A;  4JOM A;  4ZTJ A;  2K85 A;  2KPM A;  5A2Q Z;  1HXD A;  2EFP A;  3QU6 A;  4XKV A;  3ZN0 A;  3GFI A;  2FRH A;  3LNQ A;  4IQ4 A;  1K78 B;  5ICF A;  2HOS A;  3V8L A;  2HQ5 A;  3QYE A;  2ISZ A;  2GOM A;  2WAD A;  3U1K A;  2HOA A;  4HAM A;  5DV5 A;  2E1M B;  1APL C;  4Y33 A;  2FOW A;  3ZMV A;  2K4J A;  1NK2 P;  1W36 D;  2DJI A;  2E36 A;  3WGH A;  1W0T A;  1IN6 A;  4F55 A;  1N25 A;  1MMN A;  5FRM A;  2NVT J;  2R93 J;  1LDJ A;  2XGD A;  4PFP A;  4HF2 A;  2A69 F;  3DXJ F;  2FA5 A;  1YOV B;  3HKZ N;  1YS7 A;  1ZGW A;  5LHG A;  2DFF A;  2R7R A;  3OYN A;  1W7P D;  1RR7 A;  1JJ6 C;  1X1A A;  5HOO A;  1IGN A;  3BPX A;  1E3H A;  2E1N A;  4HF1 A;  3CCE I;  3DWL E;  3KZI C;  3V4G A;  1J5Y A;  5L3C A;  2E1C A;  2P5V A;  4I01 A;  4I99 C;  4M3G A;  2X9D A;  1RZ4 A;  3SZP A;  1T33 A;  3JRH A;  3M8J A;  1DP3 A;  1VQL I;  2MLK A;  2EIM H;  2VE8 A;  2FF4 A;  3K4B A;  3J7Y J;  4NDL A;  3B02 A;  2KLO A;  4KUM A;  3S3O A;  1IXC A;  1IN8 A;  1BOA A;  2P7V B;  2XUB A;  1X2M A;  5EYR A;  2K9N A;  3K4J A;  4IF4 A;  2FD5 A;  4RM3 A;  2V1D A;  4CDG A;  1LKX A;  4B44 A;  1YX5 A;  2Q0O A;  1K4S A;  3ZGK A;  3S1M J;  3QRF F;  2CW8 A;  2Z3Y A;  2Z5U A;  3HUG A;  4WXH A;  2KP6 A;  3H9J A;  5B66 C;  2GOX B;  1YW8 A;  2DW4 A;  3BCA A;  5BPD A;  3K4K A;  2DA7 A;  3KX2 A;  4LG0 B;  4ZYH A;  3GLX A;  1JHH A;  1LQ1 A;  2H6B A;  2VE9 A;  1XTA A;  3E5Q A;  3Q0W A;  1G3W A;  3L00 A;  2Z33 A;  1Y8R B;  4PJJ A;  2ZME C;  3WU2 C;  1T2K A;  1O3Q A;  3E7L A;  3LSK A;  2DDA A;  4V19 K;  2Q2E A;  3DEE A;  3S1Q J;  3QP6 A;  4Y15 A;  2KZG A;  3L2U A;  2M8G X;  2NS8 A;  3S3N A;  3REO A;  1RIO H;  2GZW A;  2JMW A;  4AD9 A;  2W84 A;  1F5T A;  5IYC J;  2ZKZ A;  3RKY A;  1UEL B;  3JRA A;  2P4W A;  3CDI A;  3W6J B;  2PJR B;  3PL8 A;  4UB8 C;  4S0H B;  1KU7 A;  1U5T A;  1XCV A;  3SFI A;  4FET A;  2XPU A;  3PFY A;  3VSL A;  2V7F A;  1VQ5 I;  1YTY A;  1Z9C A;  4PUS A;  2EIJ H;  3ZMS A;  5BQT A;  1W36 C;  4B3A A;  4QIW N;  3GCM A;  1QNT A;  3S15 J;  2MD5 A;  2OQG A;  2KIM A;  2ZNY A;  3D5L A;  4I7H A;  2O03 A;  3E97 A;  5B1A H;  1IG7 A;  2ZJP F;  1QPM A;  3S1N J;  3G4S I;  2X6O A;  2ACJ A;  2P81 A;  4WF2 A;  2VJ4 A;  3D5S C;  4IJA A;  1XB4 A;  2KZV A;  3LSG A;  1RR8 C;  1VQN I;  4RAF A;  1S5L C;  3BDD A;  5EGO B;  4WWC A;  2RNG A;  3H0D A;  2QSF X;  4YII A;  5B1B H;  3MVP A;  2NRA C;  1IJW C;  1IW7 F;  4AU7 A;  4UNO A;  3B6C A;  1HBX G;  2VBY A;  1CF7 B;  1ETV A;  2FU4 A;  2X1E A;  1IUY A;  2V79 A;  4F92 B;  3HM5 A;  4A3C J;  2Y30 A;  1TW3 A;  3DU5 A;  2E7X A;  3X2Q H;  1A5J A;  1Z0X A;  3FBI B;  4UXN A;  5KCM A;  4H0E A;  3I59 B;  2XF7 A;  3CME I;  3LQQ A;  4AIK A;  1ON1 A;  2R7W A;  3PO2 J;  1LUJ B;  4CXF A;  4Z2Y A;  1RUN A;  1JUM A;  4U7D A;  4OIO F;  1C0W A;  4LIU A;  3VFZ A;  3KP4 A;  2K40 A;  2CW7 A;  2Y75 A;  4Q48 A;  4HLY A;  4D9J A;  2WA0 A;  2EJR A;  3KP6 A;  5F0H A;  1XD7 A;  3K4N A;  2XRO A;  4EJV A;  2M8E A;  5CJ9 A;  5E18 F;  3GTQ J;  4RBO A;  3LOC A;  2PI0 A;  2FJ1 A;  2P6T A;  3HTU A;  2OF7 A;  1WJ5 A;  2FQ4 A;  4NB5 A;  3IV5 A;  2OAZ A;  1X1B A;  4PJM A;  2E1O A;  4C2T A;  1IV6 A;  4V2G A;  4DZP A;  2LRE A;  2XAH A;  1TQP A;  4HDV A;  1HW1 A;  3M1E A;  2M4K A;  3F8C A;  2P0W A;  4XRM A;  2K9M A;  1M1E B;  3K6G A;  1D8K A;  3CP8 A;  3E5U A;  5DD8 A;  4XM3 A;  1J59 A;  1SFE A;  1R9T J;  1JT0 A;  1WH5 A;  2LTP A;  4FT8 A;  5FD5 A;  2G7H A;  2HXI A;  1MDM B;  3H92 A;  4XLN F;  2QSG X;  3ZMT A;  2STT A;  2DA2 A;  4KIF A;  4TV7 A;  1JT6 A;  1FLI A;  4RLF A;  1HC8 A;  2Y0S N;  2A6H F;  1BI0 A;  2XGX A;  3BJ6 A;  4HPQ A;  4GDF A;  1HQC A;  2HPM A;  1ZHF A;  4XNF A;  3ONQ A;  3B6A A;  4DIQ A;  1S9H A;  3M07 A;  1ZG5 A;  4CH7 A;  2BVM A;  3N05 A;  3Q0V A;  2R7T A;  1S29 A;  1U0J A;  4CCJ A;  2HOT A;  3F0C A;  4LD5 A;  3UKG A;  4CYD A;  3BG6 A;  1K4T A;  4AM3 A;  1WCM J;  1SC7 A;  1MMD A;  4FQG A;  4RGR A;  3LAP A;  2HDD A;  1OYI A;  2PLY A;  2XC7 A;  2BGC A;  5M5X J;  2F5F A;  1I3A A;  3C3W A;  1G8X A;  1Z05 A;  4IOC F;  4WK8 F;  1SD6 A;  1UFM A;  5CKT A;  2XVC A;  4UVC A;  4WCG A;  2EFO A;  2K5C A;  3JSP A;  2P6S A;  1VZ0 A;  3GW2 A;  1XMX A;  1G4D A;  1QA6 A;  5DCF A;  5M3M J;  3KE2 A;  4B47 A;  1Y1W J;  3GXO A;  1IV8 A;  1MJA A;  1KYW A;  5D4S A;  5GTH C;  3TED A;  3TKY A;  2JA7 J;  5KHD A;  4N4N B;  3E5X A;  4NQW B;  4XLF A;  3HOU J;  3WTZ A;  3F6O A;  4JX4 A;  2KL4 A;  3NRV A;  5ICG A;  3PIO F;  2HQR A;  1VQ7 I;  1ZRC A;  2ZXH A;  5DM6 F;  2DCE A;  2IBD A;  1S3J A;  4ENJ A;  3C2G A;  2CH0 A;  2HEO A;  1RPW A;  5F1J A;  1QBJ A;  5CVI A;  2L9N A;  5ILU A;  3G3Z A;  1VQ6 I;  1N78 A;  4XKC A;  1U8R A;  3BPV A;  4KMF A;  2DQR A;  5L3B A;  2GXB A;  1GXQ A;  5FKM A;  1T39 A;  4EVI A;  4IHY A;  3OMY A;  3F21 A;  1B9N A;  4CGZ A;  1QVT A;  2ZO4 A;  5C44 J;  4M74 A;  3HHG A;  4IHS A;  1NG7 A;  5J8C A;  3OYK A;  2GXA A;  1J0R A;  2FMY A;  4LB6 B;  4KFC A;  3U2R A;  5CLS A;  3H5A A;  4E7S A;  3DP7 A;  4BQO A;  3EYI A;  4O6J A;  5J4Y A;  1YRN A;  2A05 A;  2XB0 X;  2ZME A;  3B73 A;  2G9W A;  2MG4 A;  1RRJ A;  3COA C;  4U0W A;  4IXA A;  4BJT A;  1OJL A;  1I27 A;  4XOT A;  2NS0 A;  5DM7 F;  1VI0 A;  4UUS B;  4BE2 A;  1Z6T A;  3BR1 A;  5JR3 A;  1LE8 A;  2XPW A;  4YEJ A;  1JI8 A;  3GZ6 A;  3RSN A;  2KJC A;  2IXS A;  3K10 A;  4RGS A;  3R4K A;  3ZQQ A;  2CGP A;  2VKV A;  1BC7 C;  4XRS A;  1HLV A;  2RVC A;  2QQA A;  2IPQ X;  1XGM A;  3HB9 A;  3ERM A;  5D5W B;  5C4J J;  1IDZ A;  1SAX A;  4BHC A;  4BDZ A;  1R5I D;  1HDP A;  2XAS A;  2YX7 A;  1XSX A;  2WY7 Q;  2OCE A;  2UV1 A;  1IO2 A;  1NG6 A;  2IGK A;  5FFZ A;  3W6K B;  3CCU I;  4DYC A;  2LKS A;  3FXL A;  3BZC A;  4E7K A;  1PUE E;  1FMV A;  1W5T A;  1T95 A;  3VYR B;  1RNL A;  1B9M A;  4LB5 A;  3WU0 A;  2JZY A;  1ACI A;  1H89 C;  2A68 F;  1ONV A;  1UZC A;  3R60 A;  4FHT A;  2K4B A;  2VT2 A;  1D1C A;  3CF5 F;  3M8F A;  5HLI A;  1FC3 A;  5HDN A;  4GYI A;  3JR9 A;  3S16 J;  1JUS A;  1B1B A;  1RC9 A;  3M7G A;  3PSF A;  5KNL A;  4AIJ A;  4IHW A;  4LIT A;  3NWS A;  2R7Q A;  2WV1 A;  3CC2 I;  1KQ0 A;  2WV0 A;  1YHQ I;  5FRN A;  3DLA A;  4DGW B;  2VN2 A;  1AA7 A;  3J7Z I;  3QOE A;  3K4L A;  5E3L A;  4C2M J;  1P7J A;  3FKJ A;  5HLG A;  1HST A;  1MSF C;  3BG9 A;  3FXJ A;  1P7I A;  3HJE A;  4KIS A;  2EV6 A;  5D6F A;  4EGZ A;  2LNB A;  2P5K A;  3OYC A;  1YQA A;  2CSO A;  4M73 A;  3A0B C;  4HNU A;  4EJT A;  5E1X A;  3V8J A;  1R1U A;  3FHZ A;  4D7N A;  3JRI A;  5BPI A;  4UB6 C;  1Z21 A;  2EIN H;  4YFN F;  1R00 A;  4L0Y B;  2B0L A;  1QVU A;  2XKO A;  3EQL F;  2VPL A;  4N9I A;  2FML A;  3OOU A;  4CCO A;  2XDV A;  4IRI A;  3WOD F;  3GZN B;  3ZQF A;  2L4M A;  2K02 A;  2LF8 A;  4C30 A;  2LKX A;  1JKO C;  1VQK I;  3HRS A;  1XDU A;  3BTI A;  1FYK A;  3FXO A;  4XN3 A;  9ANT A;  3OYL A;  5AON A;  4EMS A;  3HDD A;  2Y2Z A;  3O8G A;  3LAJ A;  4KIT B;  2DYS H;  5HDG A;  3WHC A;  4NC7 A;  3HC7 A;  3I9V 2;  3BR0 A;  4L5E A;  4DBR A;  2HDC A;  3HOV J;  1WRJ A;  1SFO J;  3GTL J;  1DPU A;  4RAG A;  3OYF A;  2OZ6 A;  4BYY A;  3FZV A;  3GZ5 A;  3JRC A;  4YIF A;  1XMK A;  2YPR A;  1MZB A;  3SYT A;  2EFQ A;  4FAS D;  3V8K A;  4I6Z A;  2K9S A;  2JPC A;  3BR3 A;  2OTL I;  1R4M B;  1OR7 C;  3H9G A;  3GUD A;  2QGU A;  5GAE J;  5D5U B;  4LG0 A;  3GYH X;  2Y31 A;  4ZJZ A;  4Q5S F;  2CG4 A;  1HDD C;  1BM9 A;  1PYV A;  4B09 A;  2JA2 A;  3I3L A;  3MN2 A;  1ZGJ A;  3HKZ A;  4Y13 A;  3A4C A;  3I71 A;  3DPT A;  4MFE A;  1WJF A;  1QO0 D;  2BXY A;  3LSM A;  5DDG A;  3MMY B;  2K86 A;  1J75 A;  3W3C A;  1DU0 A;  4A3M J;  2IS6 A;  4QTR A;  3F3X A;  1FIA A;  1TNS A;  4HSR A;  3F22 A;  1R49 A;  5CQE A;  2GLO A;  5J1R A;  2PJR A;  1LB2 A;  4P55 A;  4IHV A;  2HXO A;  2BY0 A;  2VC1 A;  1X1C A;  2WTE A;  1SFU A;  2B63 J;  3WGI A;  3CCR I;  5TRD A;  2EWN A;  2QVO A;  1S7A A;  5FJ8 J;  1MSE C;  1MNM C;  2ZFW A;  2VPR A;  2ADU A;  4X1E A;  2DTR A;  2L4A A;  2FBI A;  2OCC H;  1O3T A;  1PVE A;  2EIL H;  2X6X A;  1KQ9 A;  4A0X A;  2CO5 A;  2W1O A;  4ANJ A;  2DT6 A;  1QRY A;  2R7S A;  2ID3 A;  2HWV A;  2E19 A;  3IAS 2;  2M9H A;  1V4R A;  1ZTR A;  3CCL I;  2EFW A;  3GTM J;  1B4A A;  2PBI A;  3HZJ A;  1U78 A;  3GFJ A;  1G3T A;  3ZPL A;  4ZDP A;  1G6N A;  2J5O A;  1TNT A;  1XSV A;  4PCQ A;  2JRT A;  5EGO A;  3M4O J;  3WE3 A;  3FM5 A;  2R7U A;  3CP2 A;  1CF7 A;  4OOI A;  4R79 A;  3FIW A;  2GQQ A;  1BIB A;  1SVO A;  5C3E J;  3D0S A;  4FX4 A;  2MLG A;  4IKF A;  3K70 C;  3BTJ A;  3IUO A;  4XLH A;  4ENN A;  2LYC A;  4PSW A;  4CCL A;  4XL9 A;  4DJA A;  3DV8 A;  1FYL A;  2EIK H;  5F0C A;  2LBF B;  3CO6 C;  2H94 A;  4U0Y A;  2R5Z B;  1D8J A;  1AU7 A;  5C4X J;  3CC4 I;  4RA2 A;  5HDK A;  4CCM A;  2DA5 A;  3JTG A;  4EJO A;  2UXN A;  1WJD A;  1YW7 A;  3I64 A;  4XR6 A;  2ESH A;  1RES A;  3GVA A;  2VJ5 A;  3FXK A;  3PNT A;  4U88 A;  1UMQ A;  2HQA A;  1BI3 A;  3HSE A;  1EKE A;  2AQE A;  4BQN A;  2HKO A;  4BY1 J;  2F6C A;  2HI3 A;  4XKW A;  3GFL A;  4G7H F;  1FT9 A;  2MC4 A;  3MQ0 A;  5EG0 A;  5IYB J;  4PJL A;  1Z3Y A;  1GHC A;  4UVB A;  2W82 A;  3ESW B;  2L02 A;  2ID6 A;  4KT5 C;  3MAJ A;  3U21 A;  3L7W A;  4G8X A;  1WQ2 A;  2HVR A;  4BEH B;  2W4S A;  4ZTF A;  4M3B A;  1MDM A;  2W25 A;  1HF0 A;  1BW5 A;  2OBP A;  1WJC A;  2VAS A;  1XDS A;  5GAH J;  3OR1 C;  4LOC A;  4M72 A;  1I1G A;  2QSH X;  2M87 A;  1LNW A;  2KRF A;  2MGQ A;  5J3L A;  4EM1 A;  3HBL A;  3I56 I;  5E20 A;  2Z2S B;  5CQG A;  1ETX A;  3E0J B;  1MNE A;  3WTT C;  5LGN A;  4F7Z A;  2G7U A;  1B72 B;  2KFD A;  2A6E F;  3IH4 A;  1ERD A;  1NH3 A;  3OYG A;  3VSK A;  3HXL A;  2ZC2 A;  1WJB A;  1QHG A;  3AG1 H;  2BW3 B;  3JCU C;  1KQ8 A;  2YR2 A;  1EH7 A;  3JSO A;  5E1W A;  4KA4 A;  1D3Y A;  4FE7 A;  3S8P A;  3T8T A;  2DOD A;  2XV4 S;  4EJU A;  1MW7 A;  3GTJ J;  5HOD A;  1S8N A;  4C3H J;  5FKN A;  1X2N A;  1FY7 A;  1B8I A;  2AS5 F;  3HOS A;  3AG2 H;  1D0X A;  3QU3 A;  1VQM I;  1A6I A;  1ZAO A;  3EDP A;  2HYJ A;  2DQL A;  3HSR A;  3ZN1 A;  2DPD A;  2EA2 A;  1E17 A;  3WTY C;  4M9Z A;  1NTC A;  5FKK A;  4DYQ A;  4BKX A;  1KGS A;  1ZYR F;  3FXQ A;  4RB1 A;  2FNA A;  1J2X A;  3TO9 A;  4ZZD A;  1YFH A;  2Z9O A;  1SMT A;  3CCV I;  5JVG F;  1G3S A;  2GA1 A;  2VQH A;  2LP0 A;  2PFB A;  4F3Q A;  2Y0S A;  2FQ3 A;  5LHH A;  5EZG A;  2E2J J;  5F0F A;  3H35 A;  3BY6 A;  5ILV A;  2DA6 A;  2HS5 A;  3NQO A;  2BOL A;  3CJN A;  2KIU A;  3G1O A;  3MZY A;  5CPR B;  2Z16 A;  2KRC A;  4C2U A;  4A5M A;  3LL7 A;  1P4X A;  2DA4 A;  2NYX A;  2V9P A;  3BTL A;  4ZYG A;  3PNV A;  2NS7 A;  4RM2 A;  3GX4 X;  3MWM A;  2IP2 A;  3P9C A;  3MKW B;  4NBQ A;  3ZQG A;  3OYE A;  1N77 A;  1OR7 A;  3QWL A;  5K7Z A;  3F23 A;  4G94 A;  5JLW A;  4E7I A;  4M3D A;  3L09 A;  1LEA A;  3WG9 A;  2PEX A;  2IRF G;  4O5V A;  2LK2 A;  3I0T A;  2ISY A;  3BR6 A;  4UY8 I;  3E1S A;  2AXT C;  3FF5 A;  4Y7N J;  1R5H A;  3TMO A;  4MTD A;  1IN5 A;  4XK4 A;  2L54 A;  2ZSI B;  4A3D J;  3FMR A;  2JRM A;  2XB5 A;  2V9V A;  2VKH A;  4DNC A;  3PNY A;  3CMA I;  3Q9S A;  2JQ7 A;  1X3U A;  2V6E A;  2L0K A;  1KYZ A;  2JVH A;  2IS2 A;  2DOE A;  3MKL A;  2CMP A;  5LHI A;  1RI7 A;  3ECO A;  2CFO A;  3FXU A;  4MQ9 F;  4LLL A;  1A36 A;  5L3G A;  1A6Q A;  3NEU A;  4ZYA A;  5E8I A;  1QPI A;  5CVJ A;  3K4C A;  2OA4 A;  2R5Y B;  3VPR A;  2PMU A;  1ZN2 A;  2DK8 A;  3SEZ A;  5J1U A;  4HX4 A;  1K79 A;  3ZQH A;  3JRG A;  3AG4 H;  1T0F C;  1HCR A;  3FXM A;  2D1V A;  5D5X B;  1ETK A;  4JP0 A;  4E4H A;  4B3X A;  3OYH A;  2STW A;  3ROU A;  4UV9 A;  1YE9 A;  2M30 A;  3ZMZ A;  4IPA A;  4QPO A;  3E6B A;  1TC3 C;  3HOT A;  2AHQ A;  5H20 A;  4PGH A;  3H9Q A;  4JX5 A;  4KYW A;  2YU9 J;  3CCS I;  3CD6 I;  2LY9 A;  1EV7 A;  1U9O A;  1WFX A;  2D2W A;  3S32 A;  2IA1 A;  3BR5 A;  4LJZ F;  3LSH A;  4LFU A;  2LG4 A;  4W1U A;  3DBL B;  3LMM A;  2ICW G;  4JQF A;  1O57 A;  5F64 A;  2QUF A;  5E17 F;  3BC8 A;  1HW2 A;  2DJN A;  2Y9Y A;  5F27 A;  3W2W A;  2FSW A;  2H8R A;  1D5Y A;  5DCM B;  1E0E A;  2OUM A;  4UHT A;  2P7C B;  3VWB A;  1V3F A;  2PN6 A;  4EAT A;  1K61 A;  1FX7 A;  2XIG A;  3P9I A;  1U9N A;  1IRG A;  2DT5 A;  4JX6 A;  2M7A A;  1X1D A;  4UUT A;  2X1D A;  3ULQ B;  4A0Z A;  1L3L A;  3VOD A;  2LD5 A;  2HYG D;  3J7A Y;  2JK3 A;  2KMU A;  3IWF A;  3GTP J;  3MEX A;  1YG2 A;  1BA5 A;  1WSU A;  4KIC A;  1EA3 A;  3BG3 A;  2E1M C;  3U1D A;  1PJR A;  2WBM A;  1MJB A;  4GO1 A;  1XX5 A;  3OSG A;  3H5N A;  1U8B A;  1TQM A;  1OCO H;  2FUG 2;  3CES A;  1I6X A;  2X6W A;  1R58 A;  2ECC A;  1JTX A;  3Q9V A;  4I0B A;  5K7F A;  2HKX A;  1STZ A;  1Y8Q B;  4UUV A;  1JKP C;  3HRT A;  4D1Q A;  2RQQ A;  3EET A;  1AOY A;  3ZRG A;  4IQJ A;  1WGX A;  2CYY A;  2IW5 A;  4HNT A;  3M9A A;  3VYU B;  4M71 A;  3OS2 A;  2UWM A;  3ZQL A;  3S93 A;  1PDN C;  3F8M A;  2IS4 A;  2MH2 A;  3TL4 X;  4AC0 A;  1GT0 C;  2R7O A;  2KT0 A;  1K83 J;  1SFX A;  2ZJQ F;  1F1Z A;  3OIQ A;  5J8F A;  5ILS A;  1JKR C;  3GLL A;  1FNN A;  3QAH A;  3SDG A;  3I55 I;  2O0Y A;  2JWT A;  3OYM A;  2JPB A;  5KAF C;  5B3S H;  1VFC A;  2OTJ I;  2PMZ N;  1IXS B;  4MGR A;  5DD4 A;  1PP8 F;  1R1T A; 
#chains in the Genus database with same CATH homology
 4IHT A;  5LRR A;  4L9J A;  3KLO A;  3BZ6 A;  3CDH A;  4D0P A;  3QPH A;  4OIN F;  3CO7 C;  1O7F A;  3T1B A;  2V1X A;  2RN7 A;  3C1D A;  3IL2 A;  4L9V A;  2HGC A;  3KZY A;  1Q1H A;  3VB2 A;  5BMZ A;  3OV8 A;  2QEN A;  2E7W A;  1XCB A;  5BS6 A;  2HZT A;  4G6D A;  1FSE A;  3K1N A;  5KVR A;  4OMY A;  1BI2 A;  1TQI A;  4BQA A;  1F9N A;  3RPQ A;  5JI6 A;  2VOO A;  4G7Z F;  5ICC A;  3Q5F A;  3FMQ A;  4PDK A;  5DUK A;  3ZMU A;  2HR3 A;  4HBL A;  3DKW A;  2DBB A;  4P5O A;  1Z1D A;  2K7L A;  5D8K B;  4L0Z B;  5FGM A;  2OQR A;  4EV0 A;  2A5Y B;  4AWX B;  4ON0 A;  3P7N A;  2RGV A;  5L3E A;  1LDD A;  2LKP A;  4HOB A;  5TJJ A;  3KP5 A;  1BN5 A;  4EM2 A;  4RGX A;  3T5X A;  2GIV A;  4A6D A;  4RS8 A;  2VOD A;  1HKS A;  1XMA A;  3OOP A;  5D8L B;  3JAM K;  3DFG A;  1G3Y A;  1T0F A;  3IC7 A;  3BJO A;  3IKT A;  3O3K A;  1ODD A;  1FP1 D;  3DPL C;  2LDU A;  3K9T A;  1H9G A;  1OMI A;  2BYV E;  1IN7 A;  4P9F A;  3WTX C;  2H09 A;  3CTA A;  4ASN A;  1USS A;  4HDU A;  2CW0 F;  1OPC A;  1SMY F;  1U5T B;  1O3S A;  4HW0 A;  2J5P A;  4MTE A;  3E3V A;  5FFX A;  2GXG A;  1K78 A;  4A6E A;  2QWW A;  1Y0U A;  2Z99 A;  2KKO A;  4YFX F;  2HTS A;  3FX3 A;  3HSF A;  1DUX C;  3ECH A;  3TO7 A;  2VXZ A;  4M9X A;  2EA4 A;  4S05 A;  2MH9 A;  2WC2 A;  5F6F A;  1LEB A;  2MBF A;  3RYP A;  2ZXJ A;  2O6G E;  1P4W A;  2QQB A;  2GAU A;  3S2W A;  1YS6 A;  1YIO A;  2UXX A;  4LGW A;  1IXR C;  5LRS A;  1HKT A;  1QGP A;  1T38 A;  2LF7 A;  4ENM A;  3R0J A;  1TLH B;  3LWF A;  3SXY A;  5CYV A;  3KP2 A;  2CFX A;  2DPU A;  4YFK F;  4ESB A;  3WTV C;  1HKQ A;  3HIF A;  2BE5 F;  3HRM A;  3M8E A;  2M45 A;  1REP C;  4K2E A;  2JTV A;  2VC0 A;  2F5D A;  3L9F A;  3LQR A;  1XGO A;  4HX7 A;  4M6Y A;  1R5G A;  4WXD A;  4KDP A;  1TW2 A;  3DQV C;  3E6D A;  2MC3 A;  1YO5 C;  4JK1 X;  3FM3 A;  2O8X A;  5L3D A;  3IRQ A;  3PQK A;  2XAG A;  2BEO A;  1JGS A;  4Q4Z F;  5IT9 K;  1GVJ A;  2V1U A;  2IA2 A;  4ZYE A;  2FE3 A;  2FBH A;  2LSO A;  1TBX A;  2R7D A;  4KN7 X;  2F5C A;  2QZ8 A;  3IHU A;  4RB3 C;  4OMZ A;  1S7O A;  3G73 A;  2YSR A;  4OIR F;  1IRF A;  2HFH A;  3K1P A;  1B6A A;  4HF0 A;  4Y17 A;  5CVU A;  2XKP A;  4A0Y A;  2IT0 A;  2M1B A;  3TDU C;  4QLC U;  4I09 A;  3O6B B;  3RYR A;  1GXP A;  2Y0M A;  4OIP F;  1XGN A;  3I59 A;  3MCZ A;  2QLZ A;  4HV5 A;  5L3F A;  1J9I A;  2VBZ A;  5LEJ A;  5LEK A;  4LLG F;  5FLX Z;  2X4H A;  1KU9 A;  5HS9 A;  2RC4 A;  3MFK A;  2FBK A;  3TQN A;  4LMY A;  3L2C A;  2O61 A;  1IF1 A;  3F72 A;  3ZP5 A;  1XN7 A;  4PGG A;  2JT1 A;  2ZME B;  5ED4 A;  3EYY A;  3P9K A;  3K69 A;  1LDK B;  1UB9 A;  2EFN A;  2DFI A;  3JAM Z;  4A5N A;  2CQK A;  3BRO A;  2XAF A;  1L0O C;  3RDI A;  3F8N A;  3E6C C;  2NNY A;  3ERE D;  4L5I A;  1J7K A;  2F2E A;  5DYM A;  1IAW A;  1R7J A;  4ZYD A;  2OD5 A;  3QP5 A;  1BJA A;  2QQ9 A;  2EK5 A;  1KU2 A;  2RQP A;  5LLQ A;  2VON A;  2W85 A;  3BWG A;  4CO8 A;  3KET A;  1BI1 A;  3CLO A;  4OU0 A;  5K5R A;  1QZY A;  3WTS C;  3GFM A;  2FOK A;  4MEY F;  2GA2 A;  3J80 Z;  3ZMD A;  1W7P B;  2VT3 A;  2ZBK A;  1JE8 A;  3CUQ B;  4CIC A;  5K1Y A;  4ENK A;  3HRU A;  2NAZ A;  4I98 B;  4M6X A;  1U3E M;  1WI9 A;  2WWY A;  1ZG1 A;  2DK5 A;  1UST A;  4BNC A;  1P2F A;  4RAY A;  2RNJ A;  4NQW A;  1R22 A;  1R36 A;  1ZAR A;  2XRN A;  1XSD A;  4G7O F;  4EGY A;  4M9S A;  3QOP A;  1EH8 A;  5HS8 A;  2YU3 A;  3TO6 A;  2TDX A;  4KNY A;  1MD0 A;  3SZT A;  4G6Q A;  2W57 A;  1W4M A;  5CVV A;  1NHA A;  3TOB A;  2KJB A;  4CZZ A;  1ZRF A;  4S04 A;  4AVP A;  3FXR A;  4B8X A;  2QBY B;  4RB0 A;  4RAZ A;  1P4A A;  3JW4 A;  1UCR A;  3GF2 A;  1FWZ A;  3F8F A;  1A04 A;  5DEQ A;  5LGU A;  3MZH A;  3H3U A;  2D1H A;  3WE2 A;  3ZQ7 A;  4XSZ F;  2L01 A;  5JFR A;  4WX9 A;  1FYM A;  3TGN A;  1ZGA A;  5EEH A;  1DP7 P;  1LVA A;  1RUO A;  5IT9 Z;  4MHG A;  4BAY A;  2P8T A;  1H0M A;  3ML6 A;  4YG2 F;  2H6C A;  2XAJ A;  2D45 A;  1ZLK A;  4GXO A;  3R0A A;  1FOK A;  3KLN A;  5EEG A;  5HLH A;  1YW9 A;  3I58 A;  2O3F A;  4EQQ A;  2V6C A;  4BH9 A;  2YX4 A;  2M5W A;  3QPT A;  4MNU A;  3BOQ A;  3K1M A;  2L3D A;  3HTS B;  2MA3 A;  4P96 A;  1IZ1 A;  2FNP A;  3CUQ C;  2DO7 A;  2GWR A;  1LJ9 A;  5JHU A;  3GO5 A;  3K2Z A;  1OYY A;  1WWX A;  2A3S A;  3RPU A;  4DQ2 A;  1FBQ A;  2A07 F;  3KFW X;  2A61 A;  3PFI A;  3JTH A;  2QYO A;  4KN4 X;  1OYW A;  3FWE A;  2ZNZ A;  4GCV A;  1UHM A;  3IRR A;  1TTY A;  3KCC A;  3LA3 A;  4G9Y A;  1SD4 A;  2XAQ A;  1S6L A;  4R8H A;  5AIQ A;  2AXL A;  1WKM A;  2FEZ A;  3DEU A;  4BXU A;  3KEQ A;  1I1S A;  1CGP A;  3BJA A;  2IJL A;  5CVR A;  1U6G A;  5LGT A;  1MGT A;  3J81 Z;  1SD5 A;  4R1H A;  4BHB A;  1ZG3 A;  1VTN C;  4IRH A;  3U9G A;  4A12 A;  3WGG A;  1O3R A;  2PJP A;  1F4K A;  5H6R A;  5FB2 A;  4L5J A;  3F6V A;  4HQM A;  3DF8 A;  3K0L A;  2PG4 A;  1R1V A;  1MKM A;  1SD7 A;  4EM0 B;  1K6O A;  3V7C A;  4L18 B;  2HYF A;  3T8R A;  1IN4 A;  4XSX F;  1Z7U A;  1HSJ A;  3RTR A;  6PAX A;  3WU1 B;  4LLN A;  3RKX A;  5D5V B;  3N97 A;  2IA0 A;  3E6M A;  4PZJ A;  2VBX A;  3ISP A;  4BHP A;  2OZU A;  1P92 A;  4XRF A;  1E2X A;  1FBS A;  1FBU A;  4KIG A;  5FLX K;  3F8B A;  3TOA A;  4I0A A;  5FO5 A;  4U7B A;  2ZCW A;  4N9H A;  4ESF A;  3SFZ A;  3I54 A;  4QWQ A;  2JSC A;  2P5L C;  2ZJ2 A;  3AAF A;  5D6E A;  5ICE A;  2BBY A;  1P6R A;  3WTW C;  1Z91 A;  3RIR A;  3ABT A;  4FX0 A;  3HYI A;  1ZH5 A;  2EB7 A;  1DDN A;  1U2W A;  1H9T A;  1FPQ A;  1B59 A;  4HA8 A;  5IT3 A;  1DPR A;  1T6S A;  3BP8 A;  5HS7 A;  2RKH A;  1YYV A;  1UHW A;  1JXS A;  2HOE A;  4IRG A;  3J80 K;  2W24 A;  2EV5 A;  2Q8K A;  3SHF A;  1W7P A;  2OU2 A;  3CUQ A;  2HTJ A;  3FMS A;  1D5V A;  2HQN A;  1KU3 A;  5HVQ C;  1FSH A;  4EJW A;  5A2Q K;  1T98 A;  1HW5 A;  2RDP A;  3VEP A;  5D4R A;  4UVA A;  2DI3 A;  3LA2 A;  3VOE A;  4OIQ F;  4O3M A;  2ESN A;  3KZZ A;  4P9U A;  1EH6 A;  3LA7 A;  4MQV A;  1ZRD A;  3C7J A;  3KP3 A;  2ETH A;  3LST A;  5E1Z B;  3R6S A;  4ZH4 F;  1KA8 A;  4KIB A;  3R61 A;  4A2U A;  3ABU A;  4ZZL A;  3ELK A;  4XBF A;  5ERI A;  2UZK A;  3V7S A;  4ETS A;  2F5E A;  2DAO A;  4I2O A;  2COM A;  4HYE A;  3IKV A;  3KP7 A;  2QBY A;  1BC8 C;  2CWE A;  3LFK A;  4MEX F;  2X0L A;  2DU9 A;  4LK0 F;  3V7R A;  2PQ8 A;  4I02 A;  3IWZ A;  1O7L A;  5BOX A;  5JVT A;  4AIH A;  1R23 A;  1YLF A;  5K5O A;  2VBW A;  4L9T A;  5K5Q A;  4GYG A;  4U0V A;  1FP2 A;  3I4P A;  4HV6 A;  5J6X A;  4RGU A;  1XGS A;  1BIA A;  3GWZ A;  3RJP A;  2FXA A;  5E8G A;  2VOP A;  4JBA A;  3C18 A;  2Y48 A;  3GEZ A;  2NNN A;  4LK1 F;  3TDZ C;  1ULY A;  1QQI A;  1U5T C;  4XLP F;  2XHK A;  3HHH A;  4N0B A;  5DCM A;  3PQJ A;  3WTU C;  5AIP A;  4NHJ A;  3EUH A;  1QZZ A;  2QM3 A;  4CHU A;  3O2P E;  4HQE A;  2K27 A;  3I53 A;  4HX8 A;  2R3S A;  2PMH A;  4ESJ A;  5DUI A;  3RI4 A;  1K7A A;  5KK1 A;  2H27 A;  5FD6 A;  5LBQ A;  3CUO A;  2RV8 A;  1ON2 A;  1ZLJ A;  2EV0 A;  2DLL A;  1Z6R A;  1FZP B;  2R7F A;  3RKW A;  5H6Q A;  3J7A O;  3KEO A;  3T0Y A;  4WXC A;  2KIF A;  2C6Y A;  3SQN A;  4HLX A;  2IVM A;  1ZRE A;  4HZF A;  1MJ9 A;  4UV8 A;  1OKR A;  4KMU X;  1I5Z A;  3H3Z A;  4IVN A;  1JHF A;  2BV6 A;  1PP7 U;  4RB2 C;  3J81 K;  3N4M A;  4Q47 A;  1W5S A;  1AWC A;  2ELH A;  4L9N A;  4E70 A;  5F1R A;  1BBY A;  4GGG A;  3I5U A;  5A2Q Z;  1HXD A;  2EFP A;  3QU6 A;  3ZN0 A;  3GFI A;  2FRH A;  1K78 B;  5ICF A;  3V8L A;  2ISZ A;  4HAM A;  5DV5 A;  3ZMV A;  2K4J A;  3WGH A;  1IN6 A;  1LDJ A;  4HF2 A;  2A69 F;  3DXJ F;  2FA5 A;  1YS7 A;  5LHG A;  1W7P D;  5HOO A;  3BPX A;  2E1N A;  4HF1 A;  3V4G A;  1J5Y A;  5L3C A;  2E1C A;  2P5V A;  4I01 A;  1RZ4 A;  3SZP A;  2MLK A;  2VE8 A;  2FF4 A;  3B02 A;  4KUM A;  1IXC A;  1IN8 A;  1BOA A;  2P7V B;  2XUB A;  4IF4 A;  2V1D A;  4CDG A;  2Q0O A;  3QRF F;  2Z3Y A;  2Z5U A;  3HUG A;  4WXH A;  1YW8 A;  2DW4 A;  5BPD A;  4LG0 B;  4ZYH A;  3GLX A;  1JHH A;  1LQ1 A;  2H6B A;  2VE9 A;  3E5Q A;  1G3W A;  3L00 A;  2Z33 A;  1T2K A;  1O3Q A;  2Q2E A;  3QP6 A;  4Y15 A;  3REO A;  1RIO H;  2GZW A;  4AD9 A;  2W84 A;  1F5T A;  2ZKZ A;  3RKY A;  2P4W A;  3W6J B;  1KU7 A;  1U5T A;  1XCV A;  1YTY A;  1Z9C A;  3ZMS A;  5BQT A;  1QNT A;  2MD5 A;  2OQG A;  2KIM A;  2ZNY A;  3D5L A;  4I7H A;  2O03 A;  3E97 A;  1QPM A;  2ACJ A;  4WF2 A;  4IJA A;  1XB4 A;  3BDD A;  4WWC A;  4YII A;  2NRA C;  1IW7 F;  4UNO A;  1HBX G;  2VBY A;  1CF7 B;  1IUY A;  2FU4 A;  2V79 A;  1TW3 A;  2E7X A;  4UXN A;  4H0E A;  3I59 B;  3LQQ A;  4AIK A;  1ON1 A;  4CXF A;  4Z2Y A;  1RUN A;  4U7D A;  4OIO F;  1C0W A;  3VFZ A;  3KP4 A;  2Y75 A;  4Q48 A;  4HLY A;  2EJR A;  3KP6 A;  1XD7 A;  2XRO A;  4EJV A;  2M8E A;  5CJ9 A;  5E18 F;  2PI0 A;  2P6T A;  3HTU A;  4NB5 A;  2OAZ A;  2XAH A;  1TQP A;  4HDV A;  1HW1 A;  3M1E A;  3F8C A;  1D8K A;  3E5U A;  5DD8 A;  1J59 A;  1SFE A;  5FD5 A;  4FT8 A;  1MDM B;  2G7H A;  3H92 A;  4XLN F;  3ZMT A;  2STT A;  4KIF A;  4TV7 A;  1FLI A;  3BJ6 A;  2A6H F;  1BI0 A;  2XGX A;  1HQC A;  1ZHF A;  1ZG5 A;  1S29 A;  4LD5 A;  4CYD A;  4RGR A;  3LAP A;  1OYI A;  2PLY A;  2BGC A;  2F5F A;  3C3W A;  1Z05 A;  4WK8 F;  1SD6 A;  1UFM A;  2XVC A;  4UVC A;  3JSP A;  2EFO A;  4WCG A;  2P6S A;  3GW2 A;  1G4D A;  5DCF A;  3KE2 A;  3GXO A;  1MJA A;  1KYW A;  5D4S A;  3TKY A;  3E5X A;  3WTZ A;  3F6O A;  5ICG A;  3NRV A;  2HQR A;  1ZRC A;  1S3J A;  4ENJ A;  2HEO A;  1QBJ A;  5CVI A;  5ILU A;  3G3Z A;  1U8R A;  3BPV A;  4KMF A;  2DQR A;  5L3B A;  2GXB A;  1GXQ A;  1T39 A;  4EVI A;  3F21 A;  1B9N A;  4CGZ A;  2ZO4 A;  4M74 A;  3HHG A;  4IHS A;  5J8C A;  1J0R A;  2FMY A;  4LB6 B;  4KFC A;  3U2R A;  5CLS A;  3DP7 A;  3EYI A;  4O6J A;  2ZME A;  3B73 A;  2G9W A;  3COA C;  4U0W A;  4IXA A;  1I27 A;  2NS0 A;  1Z6T A;  5JR3 A;  3GZ6 A;  2KJC A;  4RGS A;  3R4K A;  2CGP A;  1BC7 C;  2RVC A;  2QQA A;  2IPQ X;  1XGM A;  5D5W B;  1SAX A;  4BHC A;  2XAS A;  2YX7 A;  1XSX A;  3W6K B;  5FFZ A;  1PUE E;  1W5T A;  1RNL A;  1B9M A;  4LB5 A;  3WU0 A;  2JZY A;  2A68 F;  1ONV A;  3R60 A;  4FHT A;  2K4B A;  2VT2 A;  3M8F A;  5HLI A;  1FC3 A;  5HDN A;  4GYI A;  1B1B A;  3M7G A;  4AIJ A;  1KQ0 A;  2WV0 A;  2VN2 A;  5HLG A;  1HST A;  2EV6 A;  5D6F A;  4EGZ A;  2LNB A;  2P5K A;  1YQA A;  2CSO A;  4M73 A;  4EJT A;  5E1X A;  3V8J A;  1R1U A;  3FHZ A;  5BPI A;  4YFN F;  1R00 A;  4L0Y B;  2B0L A;  2XKO A;  3EQL F;  4N9I A;  2FML A;  4IRI A;  3WOD F;  2L4M A;  2K02 A;  2LF8 A;  3HRS A;  1XDU A;  1FYK A;  5AON A;  4EMS A;  3LAJ A;  5HDG A;  2HDC A;  1WRJ A;  1DPU A;  2OZ6 A;  4BYY A;  3FZV A;  3GZ5 A;  4YIF A;  1XMK A;  2YPR A;  1MZB A;  2EFQ A;  3V8K A;  2JPC A;  3GUD A;  5D5U B;  4LG0 A;  3GYH X;  4Q5S F;  2CG4 A;  1BM9 A;  4B09 A;  1ZGJ A;  4Y13 A;  3I71 A;  3DPT A;  1QO0 D;  5DDG A;  2K86 A;  1J75 A;  3F3X A;  1TNS A;  3F22 A;  1LB2 A;  4P55 A;  2VC1 A;  2WTE A;  1SFU A;  3WGI A;  5TRD A;  2EWN A;  2QVO A;  1S7A A;  2ZFW A;  2ADU A;  2DTR A;  2L4A A;  2FBI A;  1O3T A;  1KQ9 A;  4A0X A;  2CO5 A;  2HWV A;  1V4R A;  2EFW A;  1B4A A;  2PBI A;  1U78 A;  3GFJ A;  1G3T A;  3ZPL A;  1G6N A;  2J5O A;  1TNT A;  1XSV A;  4PCQ A;  2JRT A;  3WE3 A;  3FM5 A;  1CF7 A;  4OOI A;  4R79 A;  2GQQ A;  1BIB A;  3D0S A;  4FX4 A;  2MLG A;  4ENN A;  3DV8 A;  1FYL A;  3CO6 C;  2H94 A;  4U0Y A;  1D8J A;  5HDK A;  3JTG A;  4EJO A;  2UXN A;  1YW7 A;  3I64 A;  2ESH A;  3GVA A;  4U88 A;  1BI3 A;  3HSE A;  2HKO A;  3GFL A;  4G7H F;  1FT9 A;  3MQ0 A;  1GHC A;  4UVB A;  2L02 A;  4KT5 C;  3MAJ A;  3L7W A;  4G8X A;  1WQ2 A;  1MDM A;  2W25 A;  2OBP A;  1XDS A;  4M72 A;  1I1G A;  2M87 A;  1LNW A;  2KRF A;  4EM1 A;  5E20 A;  3WTT C;  5LGN A;  4F7Z A;  2G7U A;  2A6E F;  1KQ8 A;  2YR2 A;  1EH7 A;  3JSO A;  5E1W A;  4KA4 A;  1D3Y A;  3T8T A;  2XV4 S;  4EJU A;  1S8N A;  1FY7 A;  2AS5 F;  3HOS A;  3QU3 A;  1ZAO A;  3EDP A;  2DQL A;  3HSR A;  3ZN1 A;  2DPD A;  2EA2 A;  1E17 A;  3WTY C;  4M9Z A;  1KGS A;  1ZYR F;  3FXQ A;  4RB1 A;  2FNA A;  1J2X A;  3TO9 A;  4ZZD A;  1YFH A;  2Z9O A;  1SMT A;  1G3S A;  2GA1 A;  2PFB A;  5LHH A;  2FQ3 A;  3BY6 A;  5ILV A;  2HS5 A;  3NQO A;  3CJN A;  2KIU A;  3MZY A;  4A5M A;  1P4X A;  2NYX A;  4ZYG A;  3GX4 X;  3MWM A;  2IP2 A;  3P9C A;  1OR7 A;  3F23 A;  4G94 A;  3L09 A;  1LEA A;  3WG9 A;  2PEX A;  2IRF G;  4O5V A;  3I0T A;  2ISY A;  3FF5 A;  1R5H A;  4MTD A;  1IN5 A;  2L54 A;  3FMR A;  2V9V A;  4DNC A;  3Q9S A;  1X3U A;  1KYZ A;  5LHI A;  1RI7 A;  3ECO A;  3FXU A;  4MQ9 F;  4LLL A;  5L3G A;  3NEU A;  5E8I A;  5CVJ A;  2OA4 A;  2PMU A;  2DK8 A;  1ZN2 A;  4HX4 A;  1K79 A;  2D1V A;  5D5X B;  2STW A;  3ROU A;  4UV9 A;  2M30 A;  3ZMZ A;  4IPA A;  3E6B A;  3HOT A;  5H20 A;  4PGH A;  4KYW A;  1EV7 A;  2D2W A;  2IA1 A;  4LJZ F;  4LFU A;  4JQF A;  1O57 A;  5F64 A;  2QUF A;  5E17 F;  1HW2 A;  2FSW A;  5DCM B;  4UHT A;  2P7C B;  1V3F A;  2PN6 A;  1FX7 A;  2XIG A;  3P9I A;  1IRG A;  2DT5 A;  3ULQ B;  4A0Z A;  1L3L A;  3VOD A;  2HYG D;  3IWF A;  3MEX A;  1YG2 A;  1WSU A;  4KIC A;  3U1D A;  1MJB A;  4GO1 A;  1TQM A;  1I6X A;  1R58 A;  3Q9V A;  4I0B A;  2HKX A;  1STZ A;  4UUV A;  3HRT A;  3EET A;  1AOY A;  2CYY A;  2IW5 A;  3M9A A;  4M71 A;  2UWM A;  1PDN C;  3F8M A;  2MH2 A;  1SFX A;  1F1Z A;  5J8F A;  5ILS A;  1FNN A;  3QAH A;  2O0Y A;  2JPB A;  1IXS B;  4MGR A;  5DD4 A;  1PP8 F;  1R1T A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...