1IG7A

Msx-1 homeodomain/dna complex structure
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
58
structure length
58
Chain Sequence
RKPRTPFTTAQLLALERKFRQKQYLSIAERAEFSSSLSLTETQVKIWFQNRRAKAKRL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords 5'-D(*CP*AP*CP*TP*AP*AP*TP*TP*GP*AP*AP*GP*G)-3'
publication title Crystal structure of the Msx-1 homeodomain/DNA complex
pubmed doi rcsb
source organism Mus musculus
molecule tags Transcription/dna
total genus 21
structure length 58
sequence length 58
ec nomenclature
pdb deposition date 2001-04-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00046 Homeodomain Homeodomain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.60 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Homeodomain-like 1ig7A00
1H88C 4AC0A 1H89C 2IEKA 3GBGA 3PO2J 3FKIJ 4IHYA 2LY9A 3QQAA 2EH3A 5J1YA 2JWTA 3JREA 1A6IA 1X2NA 4Y52J 2HYJA 2HOAA 1JTXA 3HBLA 2G0EA 2GBYA 4MFDA 3ZQLA 3JRCA 5EG0B 2Y9YA 3ZQGA 1ZK8A 5C4JJ 3ZQFA 2MW8A 2HOTA 1OJLA 2NVQJ 2DA5A 1WI3A 1HLVA 5IP6A 2R5ZB 4XRSA 3JRFA 1RR7A 3CDLA 3QPLA 2XGEA 1NK3P 2DTZA 3BG3A 1WPKA 1FIPA 3D1NI 4DZJA 1CQTA 4M3FA 4J19A 3OSFA 4B1RA 2DA3A 4MLOA 1Y1VJ 2ME0A 3C2BA 3HOWJ 1LE8B 5EDNA 1B8IB 2NOGA 2H1KA 1X2MA 5K7FA 2O7OA 3JRIA 5EZGA 3A01A 2LP0A 3B6CA 4MO7A 1BL0A 4BY1J 2Y0SN 4ABZA 9ANTA 3BQYA 2R92J 3DCFA 1S7EA 1JKPC 1P7JA 2ELKA 1OCPA 1FTZA 5J1RA 5M5XJ 2NVXJ 2YUSA 3GTGJ 2NVTJ 2COBA 2CJJA 3JRAA 3LSRA 4S0HB 1Z0XA 3WHBA 1JJ8C 1IG7A 1IGNA 3BTJA 1ETYA 3TP0A 4EEFG 1GVDA 5GPCA 3HGGA 4CYCA 2YU9J 1AHDP 1ETWA 1TWGJ 1ETXA 3HOXJ 1GDTA 1K83J 1R9TJ 1IV6A 1HF0A 3GTPJ 2L9RA 5F27A 2AO9A 5GPAA 1T33A 3S2DJ 1JTYA 2EZIA 1D5YA 2DMUA 4M3BA 4IHWA 1IDZA 2HXOA 2L7MP 2WV1A 1JUPA 2K9QA 3TP3A 1FIAA 1B72A 1U9OA 4W1UA 2EBIA 5J1UA 4UUTA 4I6ZA 4G12A 1HDDC 1P7IA 4DYCA 3MKLA 3LNQA 1A5JA 2E1OA 5K7ZA 3GTJJ 3IH2A 4XK4A 4DYQA 1WH7A 3NARA 5FLVA 3ZOBA 3JRDA 1I6HJ 1ORKA 5F0FA 1ETVA 2EZHA 5IYBJ 1YRNA 2TRTA 2ME6A 3O8GA 3Q0UA 1MBGA 3E7LA 3BR0A 4JP0A 1MBEA 1FTTA 3BTLA 3BT9A 5M3MJ 1MBFA 4A93J 4JX4A 3M3YJ 4D5CA 5FKMA 1Y1WJ 1FJLA 2HDDA 3BG9A 2YS9A 3O8HA 2ID6A 3JRGA 3H0GJ 5FKKA 3NAUA 4V2FA 1X58A 5IPAA 2K40A 2NS8A 3FK6A 2VI6A 5M5YJ 3GTQJ 3IH3A 3CMYA 1ZKGA 3A03A 2R5YB 1FEXA 4A3JJ 1QRYA 2VKEA 1PUFB 3HM5A 5EEAA 3OOUA 1MSEC 1JUSA 3QPSA 3BR3A 2XRLA 1SANA 5FJ8J 2R0QC 1HOMA 1AKHA 2KT0A 2LD5A 2DMQA 3CQZJ 3K7AJ 2O8KA 1XG1A 3JR9A 2LTPA 4XIDA 2LK2A 5F0CA 3SDGA 1Q1VA 2X9DA 4FTHA 2CUFA 3Q0VA 5IP7J 1F36A 2Y2ZA 3GTKJ 1ZTRA 2CQQA 3BR2A 1APLC 3G1OA 2LKXA 3I4NJ 2FQ4A 3HOZJ 2L7FP 1U8BA 2R93J 5IYCJ 3ZQCA 2JA8J 1QVUA 2OPTA 2FJ1A 2MGQA 4BBRJ 1JT0A 4B3AA 3HOYJ 1BW6A 2XGDA 1O4XA 1WH5A 2CUEA 1HDPA 1MH4A 2WB1N 2DMNA 3BQZA 3HOUJ 2M2EA 3HDDA 2HXIA 4L5EA 1JKQC 3WHCA 4QSHA 1GUUA 2DA2A 5FKLA 4Y7NJ 4HNVA 2JA7J 1MSFC 2M9HA 1JJ6C 3BR5A 1OFCX 5FKOA 2K9NA 2L0KA 5EG0A 2JJ7A 2M0CA 4XRSG 3OSGA 1B72B 3Q3SA 3S1NJ 1K61A 5EYRA 1QPIA 2LLKA 2DMPA 1POGA 4UUSB 2M34A 3LSPA 3IV5A 2O9LA 5FKNA 3FIWA 1XC5A 3H3VK 2FX0A 1GV2A 4RBOA 1MNMC 1TWFJ 3S15J 3GTLJ 4JYKA 4C3JJ 3BR1A 4BKXA 2DA7A 3HOVJ 3RZOJ 2N8GA 3TW6A 1LE8A 1VNDA 3PM1A 1T56A 1JGGA 3GTMJ 5IP9J 4MIMA 1TWCJ 3OIOA 3B6AA 2Y30A 2NVYJ 1JUMA 1ETKA 4XICA 2LVSA 2XPWA 1W0TA 5EZHA 5E3OA 1BW5A 5JLWA 1NK2P 4QTRA 4FE7A 2EZKA 2FD5A 3BG5A 2IAIA 1RKTA 1MBHA 3BTIA 3IH4A 2ECCA 2CRGA 5IOYA 1ETQA 2P81A 1RETA 1IUFA 2EQRA 3ZQIA 2E2HJ 2RAEA 2DJNA 2ID3A 2NS7A 1IC8A 3CCYA 1ZR4A 1GV5A 1OCTC 3FK7A 2Y9ZA 2MG4A 4A3EJ 1JT6A 4JX6A 5IOZA 1AKHB 4A3MJ 1ITYA 4LOCA 4IEJA 4A3CJ 3A02A 5EGOA 4FCYA 1QVTA 2CQXA 2W48A 5IYDJ 1F43A 4RDUA 3JRHA 2XB5A 3HEFA 4FE4A 1RPWA 3MVPA 2XPUA 5F08A 5K7HA 1I3QJ 3DEWA 1Z77A 1AU7A 2QF7A 4A3DJ 1BJZA 1GT0C 4A69C 1U78A 4X6AJ 2GLOA 4NDLA 2ZB9A 1ZQ3P 2VPRA 4V2GA 2XPVA 1NTCA 1MH3A 5EF6A 1SFOJ 2IBDA 1W0UA 5F0HA 3A01B 2DN0A 2E19A 4BBSJ 1U9NA 2LFBA 5E3MA 1IRZA 2JN6A 4MFEA 4A3BJ 2Y31A 2XGCA 3JRBA 4B4CA 2WAQN 2DA6A 4M3EA 1ZGWA 4C2MJ 3S1MJ 1I50J 3BTCA 5M3FJ 1ETOA 4A3FJ 4D5FA 2R7ZJ 5BNGA 2XB0X 3ZQHA 5E3NA 4CYCB 3TW7A 2PMZN 2VKVA 2B63J 5DS9A 2I10A 4C3IJ 2R5YA 3S14J 3Q0WA 4D7MA 1H8AC 3G1LA 1PUFA 1IDYA 1HCRA 3UKGA 1ENHA 2DA4A 3RZDJ 2CU7A 4BXXJ 1G2HA 2VUMJ 3K2AA 1UHSA 1TWHJ 5HODA 1VF9A 4FISA 3HKZN 4M3DA 2R5ZA 4M3GA 3SJMA 2JA6J 2QCOA 2DMTA 5C4XJ 1EF4A 5GP9A 2JA5J 2HI3A 1UMQA 1XS9A 4IHXA 4AUXA 3S1RJ 4AYBN 4GFBA 1RKWA 1YRNB 2M8GX 4X1EA 3M4OJ 3RKQA 3PO3J 2AHQA 1LFUP 1TC3C 2E2JJ 2LR8A 2K9SA 2JMWA 3L1PA 2L7ZA 1B8IA 2X6OA 4M6VA 5J3LA 1VFCA 3GTOJ 4QIWN 4D7NA 5DTDA 2H8RA 3FISA 4I76A 2ECBA 4W97A 2EZLA 1TWAJ 5C3EJ 4C3HJ 3W6VA 1DU6A 3LSJA 5EGOB 3BR6A 2HQ5A 1LFBA 2MSYA 1RESA 5F1JA 3S1QJ 1ZR2A 4DYRA 2GM4A 2KDZA 3SFIA 4UUSA 3G1MA 2XSDC 1BA5A 2OF7A 3MN2A 1JKRC 1VI0A 4DZPA 2DA1A 3LSGA 2JK3A 1MBKA 4A3IJ 2X48A 3F0CA 5C44J 4XRMA 1DU0A 2E2IJ 1UG2A 4JX5A 2HOSA 3RQIA 3HB9A 4BY7J 4DW6A 3VPRA 3S17J 2D5VA 1JKOC 5FLMJ 1MBJA 3TEDA 4A3GJ 1IJWC 1WCMJ 1WGXA 5JLXA 2TCTA 3HGYA 5F04A 3I4MJ 3S16J 4A3KJ 4IHVA 5M5WJ 4A3LJ 3S2HJ 1E3OC 3LOCA 5E3LA
chains in the Genus database with same CATH superfamily
1H88C 1A6QA 4AC0A 1H89C 2IEKA 3GBGA 3JAMK 4IHYA 4ENNA 1T0FC 2F5EA 4Y52J 4EJUA 1EJ9A 1JTXA 3AG3H 1HKTA 4E6KG 2M8EA 3ZQLA 4ZZDA 3FXQA 1B6AA 1FT9A 5DEQA 3JRCA 1SEUA 3JSPA 2DPDA 1SFKA 3CDIA 5C4JJ 5H6RA 3AG4H 2Y75A 1R23A 4YIRX 1D8KA 1WI3A 2DA5A 1J0RA 5IP6A 4K2EA 5IT3A 4XRSA 1J9IA 3CDLA 2OTLI 3QPLA 2XGEA 1G4DA 2LF7A 2YU3A 1G3YA 2MA3A 1JHHA 1SVLA 2DTZA 3ASOH 5LGUA 1NK3P 3C3WA 3S2WA 3UR3C 1OPCA 3F6OA 5E79C 4J19A 4M74A 3V4GA 2M4KA 3RI4A 3HUGB 3NRVA 3H5RA 4MLOA 1Y1VJ 2K3PA 3C2BA 1LE8B 2IJLA 2K9MA 4XKWA 1XTAA 1X2MA 3WU1B 5DCMB 3RSNA 3JTGA 1REPC 3E5UA 2I5UA 2LP0A 1ZGAA 1ZHFA 1BL0A 2W24A 3TOAA 4ABZA 1ON1A 1R1TA 2FXAA 2CUJA 2HPMA 1JKPC 3K10A 1FTZA 1D1AA 2M7AA 1D0YA 2YUSA 3GTGJ 4OAYA 3ECOA 1A36A 2COBA 3FMRA 1Y8RB 4S0HB 2DDAA 4KUMA 2HTJA 1ZLJA 4L5JA 3WHBA 1IGNA 2X1DA 1UZCA 1PVEA 4EJVA 3TP0A 4EEFG 3SHFA 2AQFA 3P5JA 1YJ9I 4P5OA 3J80Z 1YITI 3CC7I 4FHTA 4CYCA 2OTJI 1ETWA 3HIFA 4ZTFA 2B0LA 3PQKA 1K83J 4UB6C 3GVAA 3HOXJ 3SQNA 4PZJA 3BROA 4I0BA 5F27A 2CYYA 1YTYA 1HKSA 3GTPJ 2CUZA 5FRNA 1QA6A 1JTYA 4BEHA 4ESFA 1IV8A 2KRCA 5CKTA 5J4VA 3IAS2 5FO5A 2WAFA 4B8XA 3L2RA 1XPXA 2NRAC 2O61A 2HXOA 1JUPA 3KP4A 1FIAA 1K4SA 1VQ4I 4R8HA 1OCOH 3K4JA 3H92A 3QOEA 5HS9A 5LFAA 4G12A 3KLOA 2PG4A 1YYVA 3TBIA 4IZZA 3GX4X 1P7IA 2GOXB 3DKWA 5ERIA 4Z2YA 4DYCA 1A5JA 2Q2EA 4AWXB 5K7ZA 4BJ5C 5DUIA 4AIKA 2AQEA 1WH7A 4I99C 3OYKA 2VT2A 1DGWY 3JRDA 1ORKA 1RIOH 2JPBA 5D8LB 2EZHA 3FXOA 3K4LA 2ME6A 1BI3A 5D5UB 4NHJA 3FXLA 3BR0A 1R1VA 1OYIA 3B73A 3T1BA 3W6KB 2GQQA 4G6DA 1V5EA 5L3GA 2Z2SB 3DBRB 2R7FA 2HDDA 5CVJA 5FGMA 2DBBA 2ESHA 3BG9A 2XAFA 1ULYA 2VXZA 2VIXA 3SEQA 1SFXA 5H20A 4QPQA 1OYYA 2K4JA 4ZJZA 5HVQC 5JHFA 4YELA 1CF7A 2K40A 3D5RC 4Y3OA 5ICFA 3FK6A 1LVKA 1TQMA 2WY7Q 3GTQJ 4I02A 1QGPA 5FD5A 4H4KC 4RLFA 3U21A 4S04A 4A3JJ 3WTXC 3OYFA 4RM3A 1JI8A 3L09A 1IXRC 2EV5A 4HDUA 2PJPA 3QPSA 3A4CA 2R0QC 1HOMA 3MMYB 1AKHA 1XG1A 1O7LA 1Z3YA 2LTPA 4XLEA 3FBNB 2UV1A 1ZN2A 5F0CA 1TW3A 3SDGA 1RZ4A 4R1HA 2X9DA 3HHHA 2K3FA 3Q0VA 3RYRA 5IP7J 2A3SA 1P4XA 4HLXA 3DBHB 2DPUA 4XORA 1ZTRA 2KJBA 3RQ4A 3GLLA 3RPQA 1FLIA 2Y0MA 2E71A 3I4NJ 2CS3A 2X0LA 4YFNF 1TNSA 2L7FP 5IYCJ 5HNHA 2CFOA 3MKZA 3ISPA 4PJLA 3OYAA 2GA1A 2HVQA 2OZ6A 1BW6A 2IXSA 4XKBA 3I9V2 1M1EB 3CCLI 2G9WA 3P9KA 2EFWA 1GXPA 2VLAA 2LDUA 2WB1N 2E7WA 2DMNA 1ON2A 3RCOA 2KRFA 3WTVC 3CMEI 2RKHA 2HXIA 4L5EA 1JKQC 3C2HA 1LEBA 3UNGC 3PSFA 2IVMA 3M7GA 2X85A 2JA7J 4HPQA 2M9HA 1OFCX 3BR5A 5FKOA 2BY0A 2XF5A 5EG0A 2M0CA 3ABMH 2ZJPF 5E1ZB 3E5XA 3S1NJ 1Z7UA 4L5IA 3RKWA 1K61A 3RTRA 1KA8A 3IV5A 1Z6TA 3CDHA 2HDWA 4F52A 5E18F 1XC5A 2QSHX 4U7DA 2STTA 4KDPA 4RBOA 4LG0A 4KISA 2WC2A 3S15J 2DCEA 1YJWI 2OA4A 2QKLB 3F22A 2QQAA 1S3JA 2DQRA 1UG0A 4BKXA 3HC7A 3WE3A 1OLTA 2DI3A 3TW6A 1USTA 5KHDA 1KU9A 2QSFX 1T56A 2PEXA 4O3MA 2CQKA 3QWLA 1B4AA 5HDGA 3DTEA 3CJQB 4MIMA 1TWCJ 3B6AA 4BQQA 2LNBA 2NVYJ 3CLQA 4MTEA 4HW0A 3CCQI 2KZVA 2CW7A 2XPWA 1W0TA 3PJRA 1BN5A 2O6GE 2ADUA 2FQ3A 1YS6A 2Y69H 4QTRA 4FE7A 3H5NA 1LUJB 2EZKA 2FD5A 3W2AA 1UB9A 5FLXK 2FBHA 1HKQA 4ZH4F 1AOYA 1QZEA 2P81A 3NWSA 3ZQIA 1IUFA 2EQRA 2IGNA 1IW7F 2E2HJ 1V54H 2NS7A 2ID3A 3H5AA 4LFUA 4BHPA 5DUKA 2KRHA 3T5XA 3LWFA 4IEJA 5DV5A 4A3CJ 3ZGKA 3A02A 5EGOA 4FCYA 4HLYA 4E7JA 2LREA 1LNWA 4CYDA 2BXYA 1S9HA 3KE2A 5KK1A 3Q9SA 2CQXA 1F43A 2XB5A 5F08A 4FE4A 5FFXA 3MVPA 3SYTA 4Y13A 3N97A 2EFOA 3DEWA 4PSWA 3C2GA 4XNFA 3V42A 2A61A 4KN7X 4A3DJ 4HYEA 1BJZA 1GT0C 2JSCA 3ERED 2DOFA 2BVMA 4BXUA 5LEJA 3JW4A 1WJDA 3U9GA 2XPVA 2MH9A 5EF6A 1ZLKA 1X19A 4OIOF 5HLTA 1FOKA 2J5OA 3J7AO 4BE2A 2LY1A 1LB2A 3W2VA 2PQ8A 3F9KA 3L2VA 2JN6A 2HDCA 3RPUD 2W85A 3D5LA 1ZRFA 3S1MJ 3K4NA 2V1UA 4C2UA 5M3FJ 4D5FA 4RLQA 3F3XA 5BNGA 3E0JB 1XGNA 4DIQA 5BPDA 4CYCB 1V5FA 1RUNA 1XD7A 3ZRGA 3GMEA 1RC9A 1KQ9A 3CLOA 3IKVA 4C3IJ 2Z33A 4Y15A 4BYYA 4LD5A 1IDYA 5JFRA 4XOPA 3C18A 3WTYC 3GFMA 4GGGA 5LGTA 1LVAA 3H3ZA 4NBQA 4BEHB 3F72A 1KGSA 2L4MA 2DO7A 3I54A 2H8WA 4BXXJ 2VUMJ 2AS5F 3K2AA 1ZG5A 5HODA 3V7CA 3RPUA 1VQ7I 3EUHA 3IWFA 4Q47A 3BC8A 2BE5F 4QLCU 2Q2EB 3DF8A 4BJ6C 2HI3A 2PMHA 3TDUC 5ED4A 2F2EA 3ROUA 1ZGJA 2K85A 4AUXA 3QPTA 1SVOA 2VODA 3QPHA 4AYBN 4B43A 3ABLH 2KMUA 1RKWA 4AIJA 2FOWA 4X1EA 4ANJA 4WK8F 1N77A 2HFHA 3F8MA 4M6XA 3VEPA 3N05A 5E1WA 4EATA 2LR8A 2M30A 4DQ2A 2K9SA 4BS9A 2MD0A 1FX7A 4KMUX 4KICA 3GTOJ 5IT9K 2HVRA 1WQ2A 2H8RA 1ZH5A 1U5TA 2FF4A 1WI9A 2EWNA 2CFXA 4Y4RA 1TWAJ 4RAGA 3MCZA 3VSKA 4C3HJ 4OMYA 1XSDA 2E35A 2IGKA 1QPMA 3KYLA 1G8XA 1EH8A 2MSYA 5F1JA 3QRFF 4EJWA 1ZR2A 2ISYA 3K1MA 4MQVA 3L2WA 4I2OA 2EIKH 2JVHA 1I6XA 2AXTC 3M1EA 2M4GA 3GW2A 1BA5A 1I3AA 1U5TC 1X1AA 1JKRC 1VI0A 2F6CA 3LSGA 4BQNA 1P4AA 4NC6A 4WF2A 2M0MA 3F23A 3K70D 1SD4A 3FM5A 5C44J 4HRIA 4LIVA 4UVBA 3BPXA 2H6CA 5DD4A 1Q1HA 4RB3C 2E5ZA 2E2IJ 4PFPA 2W7NA 4L9JA 3PUFA 3VDXA 2PX9A 3RQIA 3WTTC 1YG2A 5IY5H 1ZRCA 3KP6A 2K7LA 2DAOA 2V9KA 2VC0A 5FLMJ 1MW7A 2VKDA 2UWMA 3AG2H 1Y0NA 1BM9A 1TLHB 1WGXA 5F1RA 4I01A 2TCTA 4XN3A 1FBQA 1FMVA 4MHGA 4HF2A 3S16J 5CVRA 1O7FA 2KP6A 2HKXA 1KU3A 3ESWB 3SZGA 1E17A 2IS6A 2M87A 1E3OC 3QAHA 5E3LA 1RI7A 3PO2J 3FKIJ 4R79A 2LY9A 4IQJA 3QQAA 2EH3A 5J1YA 1A6IA 1X2NA 1Y56A 3O3KA 2NNYA 1SC7A 2HOAA 2WY8Q 1KQ0A 2CW0F 4TV7A 3HBLA 5L3FA 1GVJA 1FMWA 1SAUA 4RB2C 4PK4A 1GHCA 3CESA 4AIDA 1HSTA 2E1MC 5EG0B 4WXCA 1FZPB 2W82A 3K70C 1SD7A 1IXCA 1OCRH 2EJRA 3I56I 2HZTA 4KMFA 3CD6I 3ZQFA 4GYGA 4I7HA 5L3BA 1HLVA 1F1ZA 5TJJA 4EM1A 3JRFA 5TGTA 1HW1A 1RR7A 3ONQA 1T2KA 1YLFA 4LG0B 4PUSA 3BG3A 1FSHA 1FIPA 1P92A 4ESBA 2GXBA 1CQTA 5D4RA 2GIZA 2JTVA 1HQCA 1WJ5A 3FXUA 4HX8A 4HQMA 4CCKA 2DLLA 3CUQC 3HOWJ 2QKMB 3GO5A 4FETA 3H36A 1KZHA 2HGCA 1MD0A 1TW2A 2LKPA 3JRIA 1FOXA 3ZXSA 2R7WA 1UHWA 2JT1A 2VQHA 3OIPA 2V6CA 2R7RA 2HOEA 4A0YA 5ICCA 1W7PD 3GYHX 2R92J 2O3FA 3ZCOA 3HPGA 2H1LA 4LK0F 1WJBA 3WGGA 4IRGA 2DT7B 5JVGF 2CJJA 3JRAA 3LSRA 2XF7A 4F91B 4DNCA 2VT3A 3GEZA 1IO2A 5LLQA 2HTSA 4G6QA 2OQRA 2PBIA 1RRJA 2E1CA 2DYSH 2YU9J 2VE9A 4CUGA 1AHDP 1W5TA 3EUKL 3V8KA 2PI0A 4FT8A 1VQPI 3CP2A 1R9TJ 1OISA 2L9RA 3S3OA 5GPAA 4KIBA 1VQKI 2G7HA 1D5YA 1W7PA 2DMUA 3FX3A 4IHWA 3OYEA 3CZ6A 3FZVA 1MMGA 3GLXA 1S8NA 1H9GA 1NHAA 3O6BB 1IN4A 1UCRA 3WGHA 4RAFA 3SFZA 1HDDC 3IP4B 4RGRA 1MGTA 5K1YA 2VKHA 4IXAA 2VASA 4C9YA 2EV6A 3T0YA 3A0BC 3NARA 3GFIA 2ZJRF 3ZOBA 1I6HJ 1ETVA 1H0MA 4LIUA 2P4WA 5IYBJ 1RUOA 1YRNA 1AA7A 2TRTA 1N78A 3Q0UA 3E7LA 4A0ZA 3R60A 4JP0A 1O3RA 1T08B 3LFKA 4UUVA 4FQGA 2WAEA 2P6SA 2XKPA 3BT9A 3TO7A 5M3MJ 3LAPA 1LJ9A 4A93J 4XSXF 1D0XA 2M5WA 3E1SA 3HSFA 4JX4A 4G7ZF 3M3YJ 5FKMA 2EIMH 1YFHA 2MLGA 2DOAA 1FJLA 2IGOA 2ZNZA 3AL0C 2CSOA 4IRHA 4M72A 3JRGA 1G59A 5LHHA 3P9CA 5ILVA 1VQ5I 5DCFA 1X58A 1N75A 3M9AA 4CXFA 2VOPA 1N25A 2NS8A 4UVCA 3ZQQA 3WTUC 1R5GA 3F21A 5M5YJ 2XVCA 3KP2A 4A6DA 2L4AA 2MC4A 1G3WA 4UB8C 2BBYA 1U6GA 3A03A 3PNVA 2QSGX 4LB6B 1X4PA 2VKEA 5EEAA 2F48A 4RA2A 3BR3A 2XRLA 1SANA 4PSXA 4UHTA 4A5MA 2LD5A 3GZ6A 4WX9A 1O3QA 2VBZA 4EM2A 4XIDA 3E5QA 2LK2A 2XF6A 4QWQA 5LEKA 1Q1VA 1QHGA 2QLZA 1YQAA 1LFPA 3DXJF 2E34A 4KA4A 3GTKJ 4KITB 2CQQA 2OU2A 3I64A 1MJ9A 2D2WA 1D8JA 2KFDA 4BHCA 4YFXF 4JQFA 3LSIA 2L3DA 1R71A 2JZYA 2FQ4A 4MTDA 2R93J 3DTIA 3FM3A 3ZQCA 1GLNA 1QVUA 2Z16A 3WG7H 1Z6RA 4FX0A 3W6JB 3LSHA 3HOYJ 2VJIA 2Q1ZB 1WH5A 2F4IA 3COAC 1HDPA 2BHZA 2FNAA 1OCZH 1WWXA 1RNLA 1X1DA 1X3ZB 2LKSA 2NYXA 4ASNA 1U5TB 3HDDA 3HRMA 3R6SA 2M7BA 3FHNA 3U2RA 1J7KA 1GUUA 2DA2A 4ZC3A 5KVRA 2OUMA 1FC3A 3KZIC 2Y48A 3EDPA 2V6EA 2L0KA 4XRSG 1NH3A 4CICA 1B72B 5L3EA 2V1DA 3IWZA 5LBQA 2V26A 2RVCA 2O9LA 5FKNA 2DYRH 2DFFA 3F6VA 1U2WA 1ZELA 1J59A 1BOAA 3PFYA 3TQNA 3DU5A 1MNMC 5ILSA 2VOOA 3BDDA 2R7QA 2HVSA 3J80K 4JYKA 3RYPA 3VFZA 3BR1A 4HF1A 2YX7A 5FB2A 3CCJI 3CCRI 2LOOA 2UXNA 5DDGA 2HQRA 1SMTA 5EJCA 2NVUB 2HKOA 5D6EA 2VJ4A 3GFLA 5D5XB 2WBMA 4ZZLA 3GTMJ 2IPQX 4G8XA 4UXNA 3KZZA 3CF5F 1ETKA 3BOQA 4XICA 4LITA 5EZHA 5E3OA 2IA2A 1BW5A 2E1MB 1NK2P 2ZXIA 3MWMA 3FXJA 1TT5B 3BG5A 2IAIA 1RKTA 5IOYA 3IH4A 2ECCA 2CRGA 2G7UA 1VZ0A 2O03A 2RNGA 2BOLA 2XDVA 2DJNA 1K6OA 3BCBA 4U88A 3CCYA 2VC1A 1GV5A 3JSOA 1OCTC 4HA8A 2OBPA 3S3MA 3I53A 2ZNYA 3J7ZI 5JVTA 1UFMA 2ZFUA 1JT6A 5IOZA 5CLSA 1HBXG 4I09A 1OCCH 3LA7A 4RAYA 2Q8KA 3CCMI 4EGZA 1ITYA 2VBWA 4LOCA 3CUQB 3CCSI 3GXOA 2YSRA 4AYBA 1TL8A 4A12A 2EFQA 2PFBA 5F64A 4G7HF 2H6BA 5GADJ 4RDUA 3HEFA 3VOEA 2L54A 1I3QJ 1Z77A 1TQPA 4NC8A 4CGZA 3WG9A 1K6YA 2ELJA 3CMMA 3EPZA 1PDNC 3Q5FA 1VQ6I 2L9VA 4E7SA 2ZSHB 4AIHA 4F7ZA 1QU3A 3BWGA 4Y33A 4NDLA 3J81Z 3OYNA 4YIFA 2JSPA 2RNJA 3CCEI 3HSRA 4V2GA 1FOYA 3LL7A 1NTCA 3CJNA 5FFZA 4M6YA 2IBDA 2DJIA 4U0VA 3VYRB 3J81K 2DN0A 3CO6C 3VODA 1T95A 4BBSJ 4EM0B 2X6XA 3OOPA 2IS1A 1SMYF 1SD5A 1XCBA 1O3SA 3HPHA 3KEQA 3KIOA 4A3BJ 3BLYA 3F8CA 3JRBA 5HOOA 2WAQN 2VBXA 5HLIA 5J40A 1JE8A 1VQ9I 2M3AA 4M3EA 4XL9A 4BE0A 2EIJH 3L2CA 5E3NA 1P4WA 3CTAA 3DEEA 1FWZA 2VKVA 3H1CA 1KU7A 1BR4A 5DD8A 2I10A 1H8AC 3KP3A 1PUFA 1HCRA 2MBFA 3H9QA 3PNYA 3EUAA 4RGUA 5BOXA 1W7PB 1ZRDA 3DPLC 4F93B 3QOPA 3HHGA 3RZDJ 2DK8A 4M71A 1BI1A 1TWHJ 1G3SA 1IN7A 1YOVB 2FA5A 1MNDA 1LDDA 4WCGA 4BE1A 3MZYA 4L0ZB 3HKZN 4M3GA 3SJMA 1IZ1A 2DMTA 2FMLA 1DDNA 5C4XJ 3FXMA 3P7NA 2JA5J 3AL0B 1XS9A 3M1CA 3CF2A 4XQFA 4YIIA 1Z9CA 2OZUA 2O0YA 1YRNB 2M8GX 1R6RA 5HS7A 1YHQI 5BQTA 2CO5A 4HV5A 3M4OJ 2FNPA 4WWCA 2AHQA 3GZ5A 1KQ8A 1KU2A 2YX4A 3KPHA 1QBJA 2JMWA 1K79A 2CV2A 2I8DA 4ZTJA 1FYKA 4LMYA 4M6VA 2A69F 3M8EA 2CQ7A 5GAHJ 2VQGA 5DTDA 4ZYHA 4I98B 2OC6A 2HQAA 2OJED 4I76A 2MLKA 4BAYA 2C6YA 2OAZA 3M07A 2OD5A 3F8FA 2E7XA 3KEOA 2DT6A 1QHHD 1LFBA 5B1AH 3E6CC 2EK5A 2H27A 1FP2A 2EPFA 4CZZA 2JRMA 2CV1A 1BI2A 2GM4A 2KDZA 3SFIA 3BJAA 1MZBA 1FPQA 1MNEA 1XMXA 1FOWA 4YEJA 4DZPA 4L18B 2DTRA 1W5CC 2R4GA 4ESJA 5K5OA 1MBKA 4A3IJ 3CUOA 2X48A 3F0CA 1DU0A 3NQOA 3EYIA 1E3HA 3NWTA 1TP4A 2ZSIB 1UG2A 3RKYA 3PFIA 4GXOA 3OMYA 2ICWG 1UELB 2LY2A 4PFOA 1IUYA 2KZGA 5LHIA 2D5VA 2V4JC 5HNFA 3TEDA 2VJ5A 1WCMJ 1XB4A 3MEXA 1YX5A 3VB2A 3I4MJ 5F04A 2KJCA 4OU0A 2P5LC 2Z3YA 3VYTB 4IHVA 2Z99A 4PJJA 4PCQA 2HR3A 3LOCA 3QP6A 5DM6F 3HXLA 1WHUA 1ZAOA 4RMNA 3OL3A 5J4YA 2ZXHA 3JREA 1XCVA 2DFHA 2XAHA 1L3LA 2HYJA 4YFKF 5GTHC 1W4MA 3AFHA 1WFXA 2G0EA 4MFDA 2MFZA 4OIQF 3FBIB 3R0JA 4E7IA 3E6DA 4M9SA 4RS8A 4BQOA 4DBQA 1AWCA 3LSKA 2MW8A 2Z9OA 3D0SA 1OJLA 2NVQJ 1YIOA 4GRIA 4YRVA 3KFWX 4IO9F 1G3TA 1QQIA 4L9NA 3D1NI 1ONVA 3I4PA 5LGNA 3KETA 2A05A 3CC4I 2EILH 3OSFA 4B1RA 4B3XA 2EA2A 2DA3A 1ZYRF 5D5VB 2ME0A 5EDNA 3WE2A 2NOGA 2H1KA 2V9PA 5K7FA 4GCVA 5EZGA 5HLHA 2QUFA 2FBKA 4BY1J 4CHUA 2VBYA 2Y0SN 2M1BA 3TGNA 9ANTA 3BQYA 3LQRA 3DCFA 5B5EC 4XLNF 2ELKA 2VJJA 5KAFC 2ISZA 3LA2A 1Y0UA 5J1RA 2NVXJ 2NVTJ 2K02A 5FRMA 1Z0XA 2NNNA 3LMMA 1IG7A 3BTJA 2Z1DA 4KT5C 2KQRA 5ILUA 1BR1A 2RN7A 3CMAI 1GVDA 2UXXA 3G2BA 5HDKA 5GPCA 2KPMA 4XLHA 1VQLI 2LSOA 1HF0A 5B66C 2AO9A 1T33A 3ZMSA 4NQWA 1VQNI 4AVPA 3FXKA 5K5QA 1OR7A 3K6GA 1IDZA 2QA4I 1B72A 2L7MP 3TP3A 3OYJA 3K69A 4G94A 3OYGA 2KIUA 2EBIA 2IT0A 4BJTA 3MKLA 4N4OB 4PGGA 2ZBKA 2XAGA 3GTJJ 2HEOA 3TDZC 4DYQA 5FLVA 4XBFA 4C30A 1EH7A 1OR7C 4II2A 2ZXJA 4EJOA 3V8LA 3O8GA 3DKYA 1MBGA 5JHUA 1LQ1A 1EKEA 1MBEA 3AAFA 5F6FA 2M45A 1FTTA 3BTLA 2FRHA 1S72I 4EJTA 3L9FA 1K7AA 3QU3A 2P7VB 2QQ9A 1FYMA 2VPLA 1T6SA 2KKOA 2RV8A 1A31A 2B7EA 4UVAA 2IW5A 3OL4A 1BR2A 2A6EF 3DFGA 2F5CA 2X4HA 5FKKA 4WXDA 4E7KA 2LRDA 5JR3A 3PUBA 3DBLB 4P96A 1G6NA 2QQ8A 3I58A 2B9SA 2STWA 1F4KA 2VI6A 2QWWA 2DODA 4O5VA 4A6EA 3SEZA 2DDBA 2R7VA 1P2FA 3I0TA 4OOIA 2TDXA 2CH0A 3ZQ7A 3OS2A 3CMYA 1ZKGA 2VB6A 3PQJA 5A2QZ 1FEXA 3G73A 1QRYA 2V7FA 2JQ7A 1PUFB 3GUDA 3HM5A 2HYFA 2HZDA 1TTYA 4XOTA 1MSEC 3DV8A 2P5VA 5FJ8J 2KT0A 1IN5A 2DMQA 2GXAA 3CQZJ 5TISC 3CUQA 2LBFA 2RC4A 3JR9A 4EGYA 4CH7A 2BY3A 4FTHA 4Q4ZF 4RB1A 2V1NA 3M8JA 1F36A 2DT5A 2A5YB 5H6QA 3TOBA 4J00A 3GWZA 3LAJA 1HW2A 3BR2A 1TNTA 2CW8A 4D0PA 1APLC 2WTEA 3AKZA 5HLGA 1E2XA 2V79A 4U0YA 2LKXA 3DLAA 2JA8J 1B9MA 2FJ1A 5LD2C 1D0ZA 1S29A 4BBRJ 3QU6A 3L2QA 1JT0A 4B3AA 1O4XA 2JUGA 3FHZA 3O2PE 1MH4A 1YW8A 1ZG1A 4II3A 3BQZA 3DPTA 2ETHA 2CV0A 2M2EA 5AIPA 2J5PA 3P9IA 2PJRA 2BXZA 3WHCA 4QSHA 4AU7A 4Y7NJ 5FKLA 1YE9A 3FWEA 3T8TA 1JJ6C 4E70A 3ABUA 3RJPA 2JJ7A 1I27A 2K27A 4IPAA 1W1WE 4IL6C 2DMPA 1MMNA 4XR6A 2M34A 1BOBA 2BEOA 4IX7A 4E7ZA 3H3VK 4N9IA 2L9SA 3OS0A 2DU9A 2FMYA 4N0BA 1GV2A 1Z91A 2FX0A 2DFIA 1TWFJ 2RDPA 2FU4A 5CQGA 3KYCB 2HS5A 5GAGJ 2DA7A 3RZOJ 3LFUA 2N8GA 4XM3A 1TBXA 2WAQA 4M9XA 4NNJA 4ZYAA 4YG2F 1F9NA 1S7AA 1JGGA 3K4MA 4A0XA 4IVNA 3E97A 4BL0B 3F8NA 2Q0OA 1ODDA 2XAUA 2Y30A 5TRDA 2CG4A 2LVSA 1GXQA 1MMAA 4B09A 3MZ8A 3ELKA 4ZDLA 1SD6A 5J47A 3LQQA 3ZR8X 5LRSA 3S8PA 2QM3A 1A04A 2F5VA 1A35A 3PIPF 3A2KA 2XSJC 1TZLA 2IS2A 4IHSA 2BZTA 2RAEA 4CCMA 2BHYA 3HKZA 4HX7A 5CPRB 3FK7A 2Y9ZA 4IJAA 2MG4A 4A3EJ 2P7CB 3WU0A 4IRIA 4G6TB 5GTIC 4JX6A 4ZDPA 4A3MJ 4JBAA 2WWYA 1Y8QB 3K9TA 1Z05A 2P0WA 3EETA 3L2UA 2VONA 1QNTA 2JVGA 2W48A 5IYDJ 1V55H 2XPUA 5K7HA 4CCLA 2A07F 2BY2A 4PJ0C 4FX4A 2WA0A 1AU7A 3C1DA 2DK5A 4A69C 1U78A 2GLOA 2LF8A 3JAMZ 3BY6A 1ZQ3P 2P6TA 4A2UA 3KYDB 5CVUA 4PGHA 2NXNB 1SFOJ 2EFNA 2R7DA 1I1SA 1I39A 2IP2A 1XSXA 1U9NA 3HTSB 2LFBA 5H2FC 5E3MA 4V19K 2RQQA 4OIRF 1X4OA 1Z1DA 3ASNH 4HNTA 3D5SC 4ENMA 4B4CA 3WTSC 1FYLA 4AM3A 4LK1F 4N9HA 3CC2I 2DA6A 4C2MJ 1I50J 3BTCA 1DPUA 2A6TA 5EEGA 1OMIA 2PLYA 2DOEA 3DKXA 2W1OA 4LG3A 4MGRA 2XIGA 2R5YA 3S14J 4UNOA 1S7OA 3KZYA 2VE8A 2RGVA 3UKGA 4NQWB 1K78B 2WV0A 2HPIA 2VL8A 3MFKA 1SFUA 1J2XA 2CU7A 3BG6A 4BDZA 3DU6A 2O5RA 4BUPA 4HSTA 5JI6A 3G71I 1TQIA 3GFJA 4M3DA 4Q5SF 2DFEA 2JA6J 3REOA 3H9GA 1VTNC 2XAQA 4ZYEA 3MZHA 3TMOA 4M9ZA 2HYGD 4GFBA 3MKYB 3ZPLA 3KCCA 4C2TA 2EV0A 2L2OA 1UHMA 4HG2A 3WODF 4E7LA 2X6WA 1LFUP 1R00A 4XLCA 1YO5C 4CCJA 3N4MA 2KL4A 3HL2A 4RM2A 4XLFA 1VFCA 1SAXA 1Y6IA 3U1KA 4BU2A 3KP7A 4HOBA 3IUOA 1HA8A 1J5YA 2XAJA 4NC7A 4P9FA 3FISA 4AVZA 4W97A 3TO9A 2EZLA 4P9UA 2A5WA 4BHBA 2XKOA 3DP7A 3H0DA 2UZKA 1DU6A 3LSJA 4B47A 5BS6A 3BR6A 3DPUA 2MH2A 3TL4X 4D1QA 5D6FA 4LLLA 2VQLA 1T98A 1U3EM 3I59B 1IN8A 3K1NA 4ENJA 2RQPA 1QO0D 2GOMA 4UUSA 1WSUA 1HC8A 3RIRA 2OF7A 2HNHA 3MN2A 4PDKA 3BP8A 1JHFA 2HU9A 4DOZA 2DA1A 1STZA 2Y0SA 2ZMEA 3WU2C 2IS4A 1B9NA 1VQ8I 4Y17A 3VWBA 3VYUB 3I3LA 4JX5A 3ERMA 2LBFB 4G9YA 4P55A 2H09A 4KJZA 2IA0A 3ECHA 3VPRA 4DW6A 2MYSA 4A5NA 3V7SA 3CCUI 4BGDA 3PL8A 2GWRA 1LEAA 1XN7A 4KIFA 5DYMA 5E8IA 2OCEA 3GZNB 1L0OC 2ZMEC 3A1YA 3DTKA 2LH9A 5K5RA 4E7HA 5B3SH 1XSVA 3IC7A 2K5CA 2XROA 3OIQA 1RR8C 2LG4A 2A68F 3SDBA 3LSMA 4XSZF 4IKFA 4GO1A 1HXDA 2LYCA 1DP3A 2JWTA 2BVLA 2PJRB 3HSEA 4D9JA 1ZARA 3L00A 3OYIA 4LB5A 1V4RA 2ZC2A 3WTZA 1XMKA 4BQAA 3K4CA 1PP8F 1YW9A 1R5ID 2GBYA 2XUBA 1MJAA 2CQNA 4HAMA 1JGSA 4GYIA 3OYLA 1T38A 2Y9YA 3ZQGA 1ZK8A 3KX2A 4FASD 3BJOA 2HOTA 2NAZA 2R7OA 1R49A 2A6HF 2R5ZB 5J8FA 3FKJA 2UUZA 3OYHA 3OS1A 2ZO4A 2R7XA 1IRFA 2MABA 1E0EA 1WPKA 2COMA 1B59A 1FBSA 3OR2C 1YX3A 4DZJA 2D1VA 5B1BH 4M3FA 4XKCA 1X1PA 3I55I 4RB0A 2NOJB 1PYVA 4BDYA 2QQBA 4XLAA 1T8IA 4XONA 3R4KA 2PN6A 1B8IB 2EB7A 3TO6A 2O7OA 1NG6A 2QBYB 3A01A 4MO7A 3B6CA 1Z67A 1IAWA 3BZKA 1I5ZA 4I0AA 1IN6A 1S7EA 4Q48A 1P7JA 1OCPA 1C0WA 3HG9A 3OYBA 5M5XJ 4PJMA 1ACIA 4GDFA 4HV6A 2GZWA 1BC8C 3S93A 5ICGA 3CO7C 2QENA 2QVOA 3HJEA 1WKMA 1JJ8C 3HYIA 1ETYA 1DPRA 1BC7C 3H3UA 1MKMA 3HGGA 3HRUA 5L3DA 1TWGJ 1ETXA 4IQ4A 1GDTA 3S3NA 1P9QC 1IV6A 3LA3A 3QP5A 3M8FA 1O3TA 3K4BA 2MD5A 3S2DJ 3RDIA 2EZIA 1B1BA 1J09A 1R4MB 4M3BA 2O8XA 2EA4A 2WV1A 2K9QA 1HW5A 1U9OA 4W1UA 2OCCH 4HDVA 3R61A 4ETSA 5J1UA 2F4MB 2LMDA 4UUTA 4I6ZA 4IOCF 1SFEA 3LNQA 3OYDA 2E1OA 3PSIA 2PMZA 2QGUA 3AG1H 1VQOI 5FLXZ 3EQLF 4ON0A 4LLNA 3IH2A 4XK4A 2AXLA 2K86A 2JUCA 3SXYA 1OKRA 5F0FA 4EVIA 3RKXA 3F8BA 5D4SA 2HWVA 4XRFA 1E3PA 2NS0A 2XC7A 1DUXC 1MBFA 4HX4A 3TKYA 3BPVA 4D5CA 2R7UA 1XGOA 1Y1WJ 3EYYA 2R7TA 2HQNA 4XN0A 4BNCA 2YS9A 3O8HA 2ID6A 1UJ8A 3H0GJ 5E20A 1LKXA 4HEA2 3NAUA 4V2FA 5DM7F 2H94A 2L01A 5IPAA 4HBLA 4H0EA 1T39A 4UY8I 3ABKH 1F5TA 1MDMA 4ZYDA 3ZMVA 4ITVA 4XKVA 4XMYA 4UV8A 3IH3A 1S5LC 3LSTA 3QYFA 3OV8A 2R5YB 4HQEA 4PJNA 3BCAA 3E3VA 3JCUC 3OOUA 1TT0A 1YI2I 1JUSA 4KT6A 1V5GA 4MEYF 4DGWB 2ACJA 1LDKB 1CGPA 3GCMA 4BXFA 2KLOA 4JOMA 3B02A 2BY1A 3K7AJ 1FP1D 2YPRA 1YJNI 3IRRA 2O8KA 1XX5A 4RAZA 2V9VA 3HZJA 2VN2A 4NB5A 3T8RA 3ZMUA 5HS8A 4EMSA 2CUFA 5GAEJ 2W00A 4KIGA 3G6EI 5CVIA 2D1HA 2Y2ZA 3FMSA 4KNYA 1MIJA 1USSA 2W25A 2FSWA 4QPOA 1ZREA 2FEZA 4EV0A 4CDGA 2D45A 3QYEA 3J7AY 4U7BA 3IKTA 3G1OA 1YIJI 2ZFWA 3HOZJ 1PUEE 4OWRB 1U8BA 2JPCA 2ELHA 4ZDOA 2MC3A 4CA0A 1BJAA 2OPTA 3X2QH 1R58A 1P6RA 2BW3A 2MGQA 4P1WA 1S6LA 2L02A 2XGDA 1HSJA 2K9LA 2CUEA 3HOSA 2DXIA 3PNTA 2F5DA 2XGXA 4CSWA 3KEYA 2XHKA 3HOUJ 1U0JA 2PMUA 2IA1A 1XGMA 1X1CA 3DLLF 4HNVA 4Z6YA 1MSFC 3SZTA 3Q9VA 4J01A 4MQ9F 1Z3XA 2K9NA 3OSGA 1YS7A 3Q3SA 5ICEA 3KLNA 5EYRA 2LLKA 1QPIA 2KIFA 1POGA 1R1UA 4UUSB 3LSPA 2WADA 2E1NA 1KYZA 3FIWA 4L9TA 1FNNA 4HZFA 2KHMA 2VXDA 5CVVA 2ZMEB 3GTLJ 2JA2A 4C3JJ 1O57A 2P8TA 4M73A 4RGXA 3PIOF 2FE3A 1K78A 4LLGF 3HOVJ 1WZ2A 3I5UA 5IT9Z 2KDOA 3HUGA 1BIAA 3BZCA 2W84A 1LE8A 4UV9A 1VNDA 3EUHC 3PM1A 1R36A 1EA3A 5DCMA 3ULQB 5IP9J 1IRGA 3OIOA 2VQCA 1JUMA 5FD6A 3W3CA 4AD9A 3OY9A 1I1GA 2OV7A 4CO8A 1KONA 1CF7B 5JLWA 5HDNA 3MQ0A 1FSEA 5E1XA 1MBHA 3BTIA 2EFPA 5D8KB 4EQQA 1ETQA 3OYCA 1RETA 1MMSA 2FBIA 2FUG2 4B44A 3IRQA 1WJAA 4JK1X 4CCOA 3CJRB 1IC8A 1ZR4A 1YW7A 4F92B 3IAM2 1X1BA 3BG7A 1Y39A 1AKHB 1OYWA 1UAAA 4RGSA 5E8GA 4ENKA 4KFCA 3CJTB 2EINH 4DBRA 1XGSA 4OIPF 3I59A 2GXGA 2CGPA 2JRTA 1QVTA 2ZKZA 3CP8A 3VYSB 2IRFG 3JRHA 1D5VA 1RPWA 2F5FA 3W2WA 5KCMA 2RREA 3ZN0A 2BV6A 3E6BA 5BPIA 2QF7A 1PJRA 4CZCA 1LPQA 3V7RA 3ABTA 1D1CA 4S05A 1QZZA 4X6AJ 1XMAA 2X1CA 2X1EA 1R5HA 2ZB9A 5A2QK 3E6MA 2VPRA 1Z21A 4B48A 2GA2A 4NUBA 1IF1A 2QZ8A 5LRRA 2E36A 1MH3A 3I71A 4IHTA 3OYMA 1W0UA 5F0HA 4KN4X 2XV4S 3A01B 3H35A 2DW4A 2CMPA 2E19A 3DEUA 2X51A 4XLPF 3G3ZA 3A0HC 4HF0A 2YR2A 1WJFA 2KIQA 1IRZA 4U0WA 2QEXI 2F4OB 5CJ9A 4MFEA 1J75A 1K4TA 2Y31A 2XGCA 3J7YJ 3DQVC 2ZJ2A 4HNUA 1PP7U 1VQMI 1D1BA 2E5NA 3CCVI 1ZGWA 2KISA 1ETOA 2L7KA 4WXHA 3ZN1A 4A3FJ 2R7ZJ 3K4KA 2XB0X 3ZQHA 3VSLA 1EV7A 1NG7A 4G7OF 1D3YA 5EEHA 2KIMA 5AIQA 3TW7A 2PMZN 2IGMA 2B63J 5DS9A 3KP5A 1WJEA 1ZG3A 2QYOA 3QYBA 2X6YA 1X3WB 3Q0WA 4D7MA 3G1LA 3R0AA 3IHUA 1R7JA 3C7JA 5D5WB 4E4HA 1ENHA 2P5KA 5CYVA 2DA4A 3OR1C 1G2HA 2Z5UA 1UHSA 1IRXA 4L9VA 1VF9A 4FISA 3ML6A 5FROA 1BBYA 1R22A 3OWTA 1JXSA 2R5ZA 1W36D 2QCOA 4IOAF 1EF4A 3K2ZA 1WVRA 3FF5A 5GP9A 1UMQA 2R7SA 3HOTA 5J6XA 4IHXA 3K0LA 3H9JA 1X3UA 3S1RJ 1XDSA 4OINF 2XRNA 5KAIC 3RKQA 2ZJQF 3PO3J 3FDYA 4L0YB 1WRJA 1TC3C 2E2JJ 5CQEA 2GIVA 3L1PA 3JTHA 2L7ZA 1B8IA 6PAXA 2X6OA 5J3LA 1H9TA 2LC2A 1KYWA 4F55A 4QIWN 4D7NA 3NEUA 1ERDA 2QBYA 1WJCA 3MAJA 5J8CA 2L5QA 4KYWA 3ZP5A 2K4BA 2ESNA 4U87A 3SZPA 3ZMTA 2ECBA 3IL2A 5C3EJ 4BH9A 3FMQA 4ZYGA 3W6VA 4HSRA 2GAUA 2DQLA 4OAZA 3G4SI 3WGIA 5EGOB 2HQ5A 1RESA 1MJBA 2W4SA 3MKWB 1MDMB 3S1QJ 4DYRA 4OMZA 4LGWA 3HTUA 3G1MA 2XSDC 4MNUA 1SVMA 3S32A 1MMDA 1FBUA 2XASA 1QZYA 2ZCWA 5LHGA 2WB1A 1U8RA 3MD2A 3V8JA 4O6JA 3ZMDA 2E60A 1W36C 2FOKA 4DJAA 1BI0A 2ZXWH 2JK3A 1EH6A 5AONA 4XRMA 4BACA 2V1XA 4LJZF 5KNLA 1DQUA 4IF4A 5L3CA 2HOSA 3WTWC 3BZ6A 1IXSB 3HB9A 4BY7J 1LDJA 3ZMZA 5E17F 1R4NB 3BJ6A 2OQGA 4X0GA 1V3FA 3S17J 1DGRM 3DWLE 1XDUA 3FXRA 2BGCA 4F3QA 1JKOC 1T0FA 2W57A 1MBJA 1BIBA 1OQYA 2CWEA 2R3SA 4CCNA 3HRTA 4A3GJ 4MEXF 3GF2A 3L7WA 3QODA 5BMZA 1IJWC 1FY7A 2BYVE 5JLXA 3HGYA 1DP7P 4A3KJ 3K1PA 3HRSA 5M5WJ 2L9NA 4A3LJ 2BW3B 3U1DA 3S2HJ 1W5SA 1Z7LA 4N4NB
chains in the Genus database with same CATH topology
1H88C 4AC0A 1H89C 2IEKA 3GBGA 3PO2J 3FKIJ 4IHYA 2LY9A 3QQAA 2EH3A 5J1YA 2JWTA 3JREA 1A6IA 1X2NA 4Y52J 2HYJA 2HOAA 1JTXA 3HBLA 2G0EA 2GBYA 4MFDA 3ZQLA 3JRCA 5EG0B 2Y9YA 3ZQGA 1ZK8A 5C4JJ 3ZQFA 2MW8A 2HOTA 1OJLA 2NVQJ 2DA5A 1WI3A 1HLVA 5IP6A 2R5ZB 4XRSA 3JRFA 1RR7A 3CDLA 3QPLA 2XGEA 1NK3P 2DTZA 3BG3A 1WPKA 1FIPA 3D1NI 4DZJA 1CQTA 4M3FA 4J19A 3OSFA 4B1RA 2DA3A 4MLOA 1Y1VJ 2ME0A 3C2BA 3HOWJ 1LE8B 5EDNA 1B8IB 2NOGA 2H1KA 1X2MA 5K7FA 2O7OA 3JRIA 5EZGA 3A01A 2LP0A 3B6CA 4MO7A 1BL0A 4BY1J 2Y0SN 4ABZA 9ANTA 3BQYA 2R92J 3DCFA 1S7EA 1JKPC 1P7JA 2ELKA 1OCPA 1FTZA 5J1RA 5M5XJ 2NVXJ 2YUSA 3GTGJ 2NVTJ 2COBA 2CJJA 3JRAA 3LSRA 4S0HB 1Z0XA 3WHBA 1JJ8C 1IG7A 1IGNA 3BTJA 1ETYA 3TP0A 4EEFG 1GVDA 5GPCA 3HGGA 4CYCA 2YU9J 1AHDP 1ETWA 1TWGJ 1ETXA 3HOXJ 1GDTA 1K83J 1R9TJ 1IV6A 1HF0A 3GTPJ 2L9RA 5F27A 2AO9A 5GPAA 1T33A 3S2DJ 1JTYA 2EZIA 1D5YA 2DMUA 4M3BA 4IHWA 1IDZA 2HXOA 2L7MP 2WV1A 1JUPA 2K9QA 3TP3A 1FIAA 1B72A 1U9OA 4W1UA 2EBIA 5J1UA 4UUTA 4I6ZA 4G12A 1HDDC 1P7IA 4DYCA 3MKLA 3LNQA 1A5JA 2E1OA 5K7ZA 3GTJJ 3IH2A 4XK4A 4DYQA 1WH7A 3NARA 5FLVA 3ZOBA 3JRDA 1I6HJ 1ORKA 5F0FA 1ETVA 2EZHA 5IYBJ 1YRNA 2TRTA 2ME6A 3O8GA 3Q0UA 1MBGA 3E7LA 3BR0A 4JP0A 1MBEA 1FTTA 3BTLA 3BT9A 5M3MJ 1MBFA 4A93J 4JX4A 3M3YJ 4D5CA 5FKMA 1Y1WJ 1FJLA 2HDDA 3BG9A 2YS9A 3O8HA 2ID6A 3JRGA 3H0GJ 5FKKA 3NAUA 4V2FA 1X58A 5IPAA 2K40A 2NS8A 3FK6A 2VI6A 5M5YJ 3GTQJ 3IH3A 3CMYA 1ZKGA 3A03A 2R5YB 1FEXA 4A3JJ 1QRYA 2VKEA 1PUFB 3HM5A 5EEAA 3OOUA 1MSEC 1JUSA 3QPSA 3BR3A 2XRLA 1SANA 5FJ8J 2R0QC 1HOMA 1AKHA 2KT0A 2LD5A 2DMQA 3CQZJ 3K7AJ 2O8KA 1XG1A 3JR9A 2LTPA 4XIDA 2LK2A 5F0CA 3SDGA 1Q1VA 2X9DA 4FTHA 2CUFA 3Q0VA 5IP7J 1F36A 2Y2ZA 3GTKJ 1ZTRA 2CQQA 3BR2A 1APLC 3G1OA 2LKXA 3I4NJ 2FQ4A 3HOZJ 2L7FP 1U8BA 2R93J 5IYCJ 3ZQCA 2JA8J 1QVUA 2OPTA 2FJ1A 2MGQA 4BBRJ 1JT0A 4B3AA 3HOYJ 1BW6A 2XGDA 1O4XA 1WH5A 2CUEA 1HDPA 1MH4A 2WB1N 2DMNA 3BQZA 3HOUJ 2M2EA 3HDDA 2HXIA 4L5EA 1JKQC 3WHCA 4QSHA 1GUUA 2DA2A 5FKLA 4Y7NJ 4HNVA 2JA7J 1MSFC 2M9HA 1JJ6C 3BR5A 1OFCX 5FKOA 2K9NA 2L0KA 5EG0A 2JJ7A 2M0CA 4XRSG 3OSGA 1B72B 3Q3SA 3S1NJ 1K61A 5EYRA 1QPIA 2LLKA 2DMPA 1POGA 4UUSB 2M34A 3LSPA 3IV5A 2O9LA 5FKNA 3FIWA 1XC5A 3H3VK 2FX0A 1GV2A 4RBOA 1MNMC 1TWFJ 3S15J 3GTLJ 4JYKA 4C3JJ 3BR1A 4BKXA 2DA7A 3HOVJ 3RZOJ 2N8GA 3TW6A 1LE8A 1VNDA 3PM1A 1T56A 1JGGA 3GTMJ 5IP9J 4MIMA 1TWCJ 3OIOA 3B6AA 2Y30A 2NVYJ 1JUMA 1ETKA 4XICA 2LVSA 2XPWA 1W0TA 5EZHA 5E3OA 1BW5A 5JLWA 1NK2P 4QTRA 4FE7A 2EZKA 2FD5A 3BG5A 2IAIA 1RKTA 1MBHA 3BTIA 3IH4A 2ECCA 2CRGA 5IOYA 1ETQA 2P81A 1RETA 1IUFA 2EQRA 3ZQIA 2E2HJ 2RAEA 2DJNA 2ID3A 2NS7A 1IC8A 3CCYA 1ZR4A 1GV5A 1OCTC 3FK7A 2Y9ZA 2MG4A 4A3EJ 1JT6A 4JX6A 5IOZA 1AKHB 4A3MJ 1ITYA 4LOCA 4IEJA 4A3CJ 3A02A 5EGOA 4FCYA 1QVTA 2CQXA 2W48A 5IYDJ 1F43A 4RDUA 3JRHA 2XB5A 3HEFA 4FE4A 1RPWA 3MVPA 2XPUA 5F08A 5K7HA 1I3QJ 3DEWA 1Z77A 1AU7A 2QF7A 4A3DJ 1BJZA 1GT0C 4A69C 1U78A 4X6AJ 2GLOA 4NDLA 2ZB9A 1ZQ3P 2VPRA 4V2GA 2XPVA 1NTCA 1MH3A 5EF6A 1SFOJ 2IBDA 1W0UA 5F0HA 3A01B 2DN0A 2E19A 4BBSJ 1U9NA 2LFBA 5E3MA 1IRZA 2JN6A 4MFEA 4A3BJ 2Y31A 2XGCA 3JRBA 4B4CA 2WAQN 2DA6A 4M3EA 1ZGWA 4C2MJ 3S1MJ 1I50J 3BTCA 5M3FJ 1ETOA 4A3FJ 4D5FA 2R7ZJ 5BNGA 2XB0X 3ZQHA 5E3NA 4CYCB 3TW7A 2PMZN 2VKVA 2B63J 5DS9A 2I10A 4C3IJ 2R5YA 3S14J 3Q0WA 4D7MA 1H8AC 3G1LA 1PUFA 1IDYA 1HCRA 3UKGA 1ENHA 2DA4A 3RZDJ 2CU7A 4BXXJ 1G2HA 2VUMJ 3K2AA 1UHSA 1TWHJ 5HODA 1VF9A 4FISA 3HKZN 4M3DA 2R5ZA 4M3GA 3SJMA 2JA6J 2QCOA 2DMTA 5C4XJ 1EF4A 5GP9A 2JA5J 2HI3A 1UMQA 1XS9A 4IHXA 4AUXA 3S1RJ 4AYBN 4GFBA 1RKWA 1YRNB 2M8GX 4X1EA 3M4OJ 3RKQA 3PO3J 2AHQA 1LFUP 1TC3C 2E2JJ 2LR8A 2K9SA 2JMWA 3L1PA 2L7ZA 1B8IA 2X6OA 4M6VA 5J3LA 1VFCA 3GTOJ 4QIWN 4D7NA 5DTDA 2H8RA 3FISA 4I76A 2ECBA 4W97A 2EZLA 1TWAJ 5C3EJ 4C3HJ 3W6VA 1DU6A 3LSJA 5EGOB 3BR6A 2HQ5A 1LFBA 2MSYA 1RESA 5F1JA 3S1QJ 1ZR2A 4DYRA 2GM4A 2KDZA 3SFIA 4UUSA 3G1MA 2XSDC 1BA5A 2OF7A 3MN2A 1JKRC 1VI0A 4DZPA 2DA1A 3LSGA 2JK3A 1MBKA 4A3IJ 2X48A 3F0CA 5C44J 4XRMA 1DU0A 2E2IJ 1UG2A 4JX5A 2HOSA 3RQIA 3HB9A 4BY7J 4DW6A 3VPRA 3S17J 2D5VA 1JKOC 5FLMJ 1MBJA 3TEDA 4A3GJ 1IJWC 1WCMJ 1WGXA 5JLXA 2TCTA 3HGYA 5F04A 3I4MJ 3S16J 4A3KJ 4IHVA 5M5WJ 4A3LJ 3S2HJ 1E3OC 3LOCA 5E3LA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1H88 C;  4AC0 A;  1H89 C;  2IEK A;  3GBG A;  3PO2 J;  3FKI J;  4IHY A;  2LY9 A;  3QQA A;  2EH3 A;  5J1Y A;  2JWT A;  3JRE A;  1A6I A;  1X2N A;  4Y52 J;  2HYJ A;  2HOA A;  1JTX A;  3HBL A;  2G0E A;  2GBY A;  4MFD A;  3ZQL A;  3JRC A;  5EG0 B;  2Y9Y A;  3ZQG A;  1ZK8 A;  5C4J J;  3ZQF A;  2MW8 A;  2HOT A;  1OJL A;  2NVQ J;  2DA5 A;  1WI3 A;  1HLV A;  5IP6 A;  2R5Z B;  4XRS A;  3JRF A;  1RR7 A;  3CDL A;  3QPL A;  2XGE A;  1NK3 P;  2DTZ A;  3BG3 A;  1WPK A;  1FIP A;  3D1N I;  4DZJ A;  1CQT A;  4M3F A;  4J19 A;  3OSF A;  4B1R A;  2DA3 A;  4MLO A;  1Y1V J;  2ME0 A;  3C2B A;  3HOW J;  1LE8 B;  5EDN A;  1B8I B;  2NOG A;  2H1K A;  1X2M A;  5K7F A;  2O7O A;  3JRI A;  5EZG A;  3A01 A;  2LP0 A;  3B6C A;  4MO7 A;  1BL0 A;  4BY1 J;  2Y0S N;  4ABZ A;  9ANT A;  3BQY A;  2R92 J;  3DCF A;  1S7E A;  1JKP C;  1P7J A;  2ELK A;  1OCP A;  1FTZ A;  5J1R A;  5M5X J;  2NVX J;  2YUS A;  3GTG J;  2NVT J;  2COB A;  2CJJ A;  3JRA A;  3LSR A;  4S0H B;  1Z0X A;  3WHB A;  1JJ8 C;  1IG7 A;  1IGN A;  3BTJ A;  1ETY A;  3TP0 A;  4EEF G;  1GVD A;  5GPC A;  3HGG A;  4CYC A;  2YU9 J;  1AHD P;  1ETW A;  1TWG J;  1ETX A;  3HOX J;  1GDT A;  1K83 J;  1R9T J;  1IV6 A;  1HF0 A;  3GTP J;  2L9R A;  5F27 A;  2AO9 A;  5GPA A;  1T33 A;  3S2D J;  1JTY A;  2EZI A;  1D5Y A;  2DMU A;  4M3B A;  4IHW A;  1IDZ A;  2HXO A;  2L7M P;  2WV1 A;  1JUP A;  2K9Q A;  3TP3 A;  1FIA A;  1B72 A;  1U9O A;  4W1U A;  2EBI A;  5J1U A;  4UUT A;  4I6Z A;  4G12 A;  1HDD C;  1P7I A;  4DYC A;  3MKL A;  3LNQ A;  1A5J A;  2E1O A;  5K7Z A;  3GTJ J;  3IH2 A;  4XK4 A;  4DYQ A;  1WH7 A;  3NAR A;  5FLV A;  3ZOB A;  3JRD A;  1I6H J;  1ORK A;  5F0F A;  1ETV A;  2EZH A;  5IYB J;  1YRN A;  2TRT A;  2ME6 A;  3O8G A;  3Q0U A;  1MBG A;  3E7L A;  3BR0 A;  4JP0 A;  1MBE A;  1FTT A;  3BTL A;  3BT9 A;  5M3M J;  1MBF A;  4A93 J;  4JX4 A;  3M3Y J;  4D5C A;  5FKM A;  1Y1W J;  1FJL A;  2HDD A;  3BG9 A;  2YS9 A;  3O8H A;  2ID6 A;  3JRG A;  3H0G J;  5FKK A;  3NAU A;  4V2F A;  1X58 A;  5IPA A;  2K40 A;  2NS8 A;  3FK6 A;  2VI6 A;  5M5Y J;  3GTQ J;  3IH3 A;  3CMY A;  1ZKG A;  3A03 A;  2R5Y B;  1FEX A;  4A3J J;  1QRY A;  2VKE A;  1PUF B;  3HM5 A;  5EEA A;  3OOU A;  1MSE C;  1JUS A;  3QPS A;  3BR3 A;  2XRL A;  1SAN A;  5FJ8 J;  2R0Q C;  1HOM A;  1AKH A;  2KT0 A;  2LD5 A;  2DMQ A;  3CQZ J;  3K7A J;  2O8K A;  1XG1 A;  3JR9 A;  2LTP A;  4XID A;  2LK2 A;  5F0C A;  3SDG A;  1Q1V A;  2X9D A;  4FTH A;  2CUF A;  3Q0V A;  5IP7 J;  1F36 A;  2Y2Z A;  3GTK J;  1ZTR A;  2CQQ A;  3BR2 A;  1APL C;  3G1O A;  2LKX A;  3I4N J;  2FQ4 A;  3HOZ J;  2L7F P;  1U8B A;  2R93 J;  5IYC J;  3ZQC A;  2JA8 J;  1QVU A;  2OPT A;  2FJ1 A;  2MGQ A;  4BBR J;  1JT0 A;  4B3A A;  3HOY J;  1BW6 A;  2XGD A;  1O4X A;  1WH5 A;  2CUE A;  1HDP A;  1MH4 A;  2WB1 N;  2DMN A;  3BQZ A;  3HOU J;  2M2E A;  3HDD A;  2HXI A;  4L5E A;  1JKQ C;  3WHC A;  4QSH A;  1GUU A;  2DA2 A;  5FKL A;  4Y7N J;  4HNV A;  2JA7 J;  1MSF C;  2M9H A;  1JJ6 C;  3BR5 A;  1OFC X;  5FKO A;  2K9N A;  2L0K A;  5EG0 A;  2JJ7 A;  2M0C A;  4XRS G;  3OSG A;  1B72 B;  3Q3S A;  3S1N J;  1K61 A;  5EYR A;  1QPI A;  2LLK A;  2DMP A;  1POG A;  4UUS B;  2M34 A;  3LSP A;  3IV5 A;  2O9L A;  5FKN A;  3FIW A;  1XC5 A;  3H3V K;  2FX0 A;  1GV2 A;  4RBO A;  1MNM C;  1TWF J;  3S15 J;  3GTL J;  4JYK A;  4C3J J;  3BR1 A;  4BKX A;  2DA7 A;  3HOV J;  3RZO J;  2N8G A;  3TW6 A;  1LE8 A;  1VND A;  3PM1 A;  1T56 A;  1JGG A;  3GTM J;  5IP9 J;  4MIM A;  1TWC J;  3OIO A;  3B6A A;  2Y30 A;  2NVY J;  1JUM A;  1ETK A;  4XIC A;  2LVS A;  2XPW A;  1W0T A;  5EZH A;  5E3O A;  1BW5 A;  5JLW A;  1NK2 P;  4QTR A;  4FE7 A;  2EZK A;  2FD5 A;  3BG5 A;  2IAI A;  1RKT A;  1MBH A;  3BTI A;  3IH4 A;  2ECC A;  2CRG A;  5IOY A;  1ETQ A;  2P81 A;  1RET A;  1IUF A;  2EQR A;  3ZQI A;  2E2H J;  2RAE A;  2DJN A;  2ID3 A;  2NS7 A;  1IC8 A;  3CCY A;  1ZR4 A;  1GV5 A;  1OCT C;  3FK7 A;  2Y9Z A;  2MG4 A;  4A3E J;  1JT6 A;  4JX6 A;  5IOZ A;  1AKH B;  4A3M J;  1ITY A;  4LOC A;  4IEJ A;  4A3C J;  3A02 A;  5EGO A;  4FCY A;  1QVT A;  2CQX A;  2W48 A;  5IYD J;  1F43 A;  4RDU A;  3JRH A;  2XB5 A;  3HEF A;  4FE4 A;  1RPW A;  3MVP A;  2XPU A;  5F08 A;  5K7H A;  1I3Q J;  3DEW A;  1Z77 A;  1AU7 A;  2QF7 A;  4A3D J;  1BJZ A;  1GT0 C;  4A69 C;  1U78 A;  4X6A J;  2GLO A;  4NDL A;  2ZB9 A;  1ZQ3 P;  2VPR A;  4V2G A;  2XPV A;  1NTC A;  1MH3 A;  5EF6 A;  1SFO J;  2IBD A;  1W0U A;  5F0H A;  3A01 B;  2DN0 A;  2E19 A;  4BBS J;  1U9N A;  2LFB A;  5E3M A;  1IRZ A;  2JN6 A;  4MFE A;  4A3B J;  2Y31 A;  2XGC A;  3JRB A;  4B4C A;  2WAQ N;  2DA6 A;  4M3E A;  1ZGW A;  4C2M J;  3S1M J;  1I50 J;  3BTC A;  5M3F J;  1ETO A;  4A3F J;  4D5F A;  2R7Z J;  5BNG A;  2XB0 X;  3ZQH A;  5E3N A;  4CYC B;  3TW7 A;  2PMZ N;  2VKV A;  2B63 J;  5DS9 A;  2I10 A;  4C3I J;  2R5Y A;  3S14 J;  3Q0W A;  4D7M A;  1H8A C;  3G1L A;  1PUF A;  1IDY A;  1HCR A;  3UKG A;  1ENH A;  2DA4 A;  3RZD J;  2CU7 A;  4BXX J;  1G2H A;  2VUM J;  3K2A A;  1UHS A;  1TWH J;  5HOD A;  1VF9 A;  4FIS A;  3HKZ N;  4M3D A;  2R5Z A;  4M3G A;  3SJM A;  2JA6 J;  2QCO A;  2DMT A;  5C4X J;  1EF4 A;  5GP9 A;  2JA5 J;  2HI3 A;  1UMQ A;  1XS9 A;  4IHX A;  4AUX A;  3S1R J;  4AYB N;  4GFB A;  1RKW A;  1YRN B;  2M8G X;  4X1E A;  3M4O J;  3RKQ A;  3PO3 J;  2AHQ A;  1LFU P;  1TC3 C;  2E2J J;  2LR8 A;  2K9S A;  2JMW A;  3L1P A;  2L7Z A;  1B8I A;  2X6O A;  4M6V A;  5J3L A;  1VFC A;  3GTO J;  4QIW N;  4D7N A;  5DTD A;  2H8R A;  3FIS A;  4I76 A;  2ECB A;  4W97 A;  2EZL A;  1TWA J;  5C3E J;  4C3H J;  3W6V A;  1DU6 A;  3LSJ A;  5EGO B;  3BR6 A;  2HQ5 A;  1LFB A;  2MSY A;  1RES A;  5F1J A;  3S1Q J;  1ZR2 A;  4DYR A;  2GM4 A;  2KDZ A;  3SFI A;  4UUS A;  3G1M A;  2XSD C;  1BA5 A;  2OF7 A;  3MN2 A;  1JKR C;  1VI0 A;  4DZP A;  2DA1 A;  3LSG A;  2JK3 A;  1MBK A;  4A3I J;  2X48 A;  3F0C A;  5C44 J;  4XRM A;  1DU0 A;  2E2I J;  1UG2 A;  4JX5 A;  2HOS A;  3RQI A;  3HB9 A;  4BY7 J;  4DW6 A;  3VPR A;  3S17 J;  2D5V A;  1JKO C;  5FLM J;  1MBJ A;  3TED A;  4A3G J;  1IJW C;  1WCM J;  1WGX A;  5JLX A;  2TCT A;  3HGY A;  5F04 A;  3I4M J;  3S16 J;  4A3K J;  4IHV A;  5M5W J;  4A3L J;  3S2H J;  1E3O C;  3LOC A;  5E3L A; 
#chains in the Genus database with same CATH topology
 1H88 C;  1A6Q A;  4AC0 A;  1H89 C;  2IEK A;  3GBG A;  3JAM K;  4IHY A;  4ENN A;  1T0F C;  2F5E A;  4Y52 J;  4EJU A;  1EJ9 A;  1JTX A;  3AG3 H;  1HKT A;  4E6K G;  2M8E A;  3ZQL A;  4ZZD A;  3FXQ A;  1B6A A;  1FT9 A;  5DEQ A;  3JRC A;  1SEU A;  3JSP A;  2DPD A;  1SFK A;  3CDI A;  5C4J J;  5H6R A;  3AG4 H;  2Y75 A;  1R23 A;  4YIR X;  1D8K A;  1WI3 A;  2DA5 A;  1J0R A;  5IP6 A;  4K2E A;  5IT3 A;  4XRS A;  1J9I A;  3CDL A;  2OTL I;  3QPL A;  2XGE A;  1G4D A;  2LF7 A;  2YU3 A;  1G3Y A;  2MA3 A;  1JHH A;  1SVL A;  2DTZ A;  3ASO H;  5LGU A;  1NK3 P;  3C3W A;  3S2W A;  3UR3 C;  1OPC A;  3F6O A;  5E79 C;  4J19 A;  4M74 A;  3V4G A;  2M4K A;  3RI4 A;  3HUG B;  3NRV A;  3H5R A;  4MLO A;  1Y1V J;  2K3P A;  3C2B A;  1LE8 B;  2IJL A;  2K9M A;  4XKW A;  1XTA A;  1X2M A;  3WU1 B;  5DCM B;  3RSN A;  3JTG A;  1REP C;  3E5U A;  2I5U A;  2LP0 A;  1ZGA A;  1ZHF A;  1BL0 A;  2W24 A;  3TOA A;  4ABZ A;  1ON1 A;  1R1T A;  2FXA A;  2CUJ A;  2HPM A;  1JKP C;  3K10 A;  1FTZ A;  1D1A A;  2M7A A;  1D0Y A;  2YUS A;  3GTG J;  4OAY A;  3ECO A;  1A36 A;  2COB A;  3FMR A;  1Y8R B;  4S0H B;  2DDA A;  4KUM A;  2HTJ A;  1ZLJ A;  4L5J A;  3WHB A;  1IGN A;  2X1D A;  1UZC A;  1PVE A;  4EJV A;  3TP0 A;  4EEF G;  3SHF A;  2AQF A;  3P5J A;  1YJ9 I;  4P5O A;  3J80 Z;  1YIT I;  3CC7 I;  4FHT A;  4CYC A;  2OTJ I;  1ETW A;  3HIF A;  4ZTF A;  2B0L A;  3PQK A;  1K83 J;  4UB6 C;  3GVA A;  3HOX J;  3SQN A;  4PZJ A;  3BRO A;  4I0B A;  5F27 A;  2CYY A;  1YTY A;  1HKS A;  3GTP J;  2CUZ A;  5FRN A;  1QA6 A;  1JTY A;  4BEH A;  4ESF A;  1IV8 A;  2KRC A;  5CKT A;  5J4V A;  3IAS 2;  5FO5 A;  2WAF A;  4B8X A;  3L2R A;  1XPX A;  2NRA C;  2O61 A;  2HXO A;  1JUP A;  3KP4 A;  1FIA A;  1K4S A;  1VQ4 I;  4R8H A;  1OCO H;  3K4J A;  3H92 A;  3QOE A;  5HS9 A;  5LFA A;  4G12 A;  3KLO A;  2PG4 A;  1YYV A;  3TBI A;  4IZZ A;  3GX4 X;  1P7I A;  2GOX B;  3DKW A;  5ERI A;  4Z2Y A;  4DYC A;  1A5J A;  2Q2E A;  4AWX B;  5K7Z A;  4BJ5 C;  5DUI A;  4AIK A;  2AQE A;  1WH7 A;  4I99 C;  3OYK A;  2VT2 A;  1DGW Y;  3JRD A;  1ORK A;  1RIO H;  2JPB A;  5D8L B;  2EZH A;  3FXO A;  3K4L A;  2ME6 A;  1BI3 A;  5D5U B;  4NHJ A;  3FXL A;  3BR0 A;  1R1V A;  1OYI A;  3B73 A;  3T1B A;  3W6K B;  2GQQ A;  4G6D A;  1V5E A;  5L3G A;  2Z2S B;  3DBR B;  2R7F A;  2HDD A;  5CVJ A;  5FGM A;  2DBB A;  2ESH A;  3BG9 A;  2XAF A;  1ULY A;  2VXZ A;  2VIX A;  3SEQ A;  1SFX A;  5H20 A;  4QPQ A;  1OYY A;  2K4J A;  4ZJZ A;  5HVQ C;  5JHF A;  4YEL A;  1CF7 A;  2K40 A;  3D5R C;  4Y3O A;  5ICF A;  3FK6 A;  1LVK A;  1TQM A;  2WY7 Q;  3GTQ J;  4I02 A;  1QGP A;  5FD5 A;  4H4K C;  4RLF A;  3U21 A;  4S04 A;  4A3J J;  3WTX C;  3OYF A;  4RM3 A;  1JI8 A;  3L09 A;  1IXR C;  2EV5 A;  4HDU A;  2PJP A;  3QPS A;  3A4C A;  2R0Q C;  1HOM A;  3MMY B;  1AKH A;  1XG1 A;  1O7L A;  1Z3Y A;  2LTP A;  4XLE A;  3FBN B;  2UV1 A;  1ZN2 A;  5F0C A;  1TW3 A;  3SDG A;  1RZ4 A;  4R1H A;  2X9D A;  3HHH A;  2K3F A;  3Q0V A;  3RYR A;  5IP7 J;  2A3S A;  1P4X A;  4HLX A;  3DBH B;  2DPU A;  4XOR A;  1ZTR A;  2KJB A;  3RQ4 A;  3GLL A;  3RPQ A;  1FLI A;  2Y0M A;  2E71 A;  3I4N J;  2CS3 A;  2X0L A;  4YFN F;  1TNS A;  2L7F P;  5IYC J;  5HNH A;  2CFO A;  3MKZ A;  3ISP A;  4PJL A;  3OYA A;  2GA1 A;  2HVQ A;  2OZ6 A;  1BW6 A;  2IXS A;  4XKB A;  3I9V 2;  1M1E B;  3CCL I;  2G9W A;  3P9K A;  2EFW A;  1GXP A;  2VLA A;  2LDU A;  2WB1 N;  2E7W A;  2DMN A;  1ON2 A;  3RCO A;  2KRF A;  3WTV C;  3CME I;  2RKH A;  2HXI A;  4L5E A;  1JKQ C;  3C2H A;  1LEB A;  3UNG C;  3PSF A;  2IVM A;  3M7G A;  2X85 A;  2JA7 J;  4HPQ A;  2M9H A;  1OFC X;  3BR5 A;  5FKO A;  2BY0 A;  2XF5 A;  5EG0 A;  2M0C A;  3ABM H;  2ZJP F;  5E1Z B;  3E5X A;  3S1N J;  1Z7U A;  4L5I A;  3RKW A;  1K61 A;  3RTR A;  1KA8 A;  3IV5 A;  1Z6T A;  3CDH A;  2HDW A;  4F52 A;  5E18 F;  1XC5 A;  2QSH X;  4U7D A;  2STT A;  4KDP A;  4RBO A;  4LG0 A;  4KIS A;  2WC2 A;  3S15 J;  2DCE A;  1YJW I;  2OA4 A;  2QKL B;  3F22 A;  2QQA A;  1S3J A;  2DQR A;  1UG0 A;  4BKX A;  3HC7 A;  3WE3 A;  1OLT A;  2DI3 A;  3TW6 A;  1UST A;  5KHD A;  1KU9 A;  2QSF X;  1T56 A;  2PEX A;  4O3M A;  2CQK A;  3QWL A;  1B4A A;  5HDG A;  3DTE A;  3CJQ B;  4MIM A;  1TWC J;  3B6A A;  4BQQ A;  2LNB A;  2NVY J;  3CLQ A;  4MTE A;  4HW0 A;  3CCQ I;  2KZV A;  2CW7 A;  2XPW A;  1W0T A;  3PJR A;  1BN5 A;  2O6G E;  2ADU A;  2FQ3 A;  1YS6 A;  2Y69 H;  4QTR A;  4FE7 A;  3H5N A;  1LUJ B;  2EZK A;  2FD5 A;  3W2A A;  1UB9 A;  5FLX K;  2FBH A;  1HKQ A;  4ZH4 F;  1AOY A;  1QZE A;  2P81 A;  3NWS A;  3ZQI A;  1IUF A;  2EQR A;  2IGN A;  1IW7 F;  2E2H J;  1V54 H;  2NS7 A;  2ID3 A;  3H5A A;  4LFU A;  4BHP A;  5DUK A;  2KRH A;  3T5X A;  3LWF A;  4IEJ A;  5DV5 A;  4A3C J;  3ZGK A;  3A02 A;  5EGO A;  4FCY A;  4HLY A;  4E7J A;  2LRE A;  1LNW A;  4CYD A;  2BXY A;  1S9H A;  3KE2 A;  5KK1 A;  3Q9S A;  2CQX A;  1F43 A;  2XB5 A;  5F08 A;  4FE4 A;  5FFX A;  3MVP A;  3SYT A;  4Y13 A;  3N97 A;  2EFO A;  3DEW A;  4PSW A;  3C2G A;  4XNF A;  3V42 A;  2A61 A;  4KN7 X;  4A3D J;  4HYE A;  1BJZ A;  1GT0 C;  2JSC A;  3ERE D;  2DOF A;  2BVM A;  4BXU A;  5LEJ A;  3JW4 A;  1WJD A;  3U9G A;  2XPV A;  2MH9 A;  5EF6 A;  1ZLK A;  1X19 A;  4OIO F;  5HLT A;  1FOK A;  2J5O A;  3J7A O;  4BE2 A;  2LY1 A;  1LB2 A;  3W2V A;  2PQ8 A;  3F9K A;  3L2V A;  2JN6 A;  2HDC A;  3RPU D;  2W85 A;  3D5L A;  1ZRF A;  3S1M J;  3K4N A;  2V1U A;  4C2U A;  5M3F J;  4D5F A;  4RLQ A;  3F3X A;  5BNG A;  3E0J B;  1XGN A;  4DIQ A;  5BPD A;  4CYC B;  1V5F A;  1RUN A;  1XD7 A;  3ZRG A;  3GME A;  1RC9 A;  1KQ9 A;  3CLO A;  3IKV A;  4C3I J;  2Z33 A;  4Y15 A;  4BYY A;  4LD5 A;  1IDY A;  5JFR A;  4XOP A;  3C18 A;  3WTY C;  3GFM A;  4GGG A;  5LGT A;  1LVA A;  3H3Z A;  4NBQ A;  4BEH B;  3F72 A;  1KGS A;  2L4M A;  2DO7 A;  3I54 A;  2H8W A;  4BXX J;  2VUM J;  2AS5 F;  3K2A A;  1ZG5 A;  5HOD A;  3V7C A;  3RPU A;  1VQ7 I;  3EUH A;  3IWF A;  4Q47 A;  3BC8 A;  2BE5 F;  4QLC U;  2Q2E B;  3DF8 A;  4BJ6 C;  2HI3 A;  2PMH A;  3TDU C;  5ED4 A;  2F2E A;  3ROU A;  1ZGJ A;  2K85 A;  4AUX A;  3QPT A;  1SVO A;  2VOD A;  3QPH A;  4AYB N;  4B43 A;  3ABL H;  2KMU A;  1RKW A;  4AIJ A;  2FOW A;  4X1E A;  4ANJ A;  4WK8 F;  1N77 A;  2HFH A;  3F8M A;  4M6X A;  3VEP A;  3N05 A;  5E1W A;  4EAT A;  2LR8 A;  2M30 A;  4DQ2 A;  2K9S A;  4BS9 A;  2MD0 A;  1FX7 A;  4KMU X;  4KIC A;  3GTO J;  5IT9 K;  2HVR A;  1WQ2 A;  2H8R A;  1ZH5 A;  1U5T A;  2FF4 A;  1WI9 A;  2EWN A;  2CFX A;  4Y4R A;  1TWA J;  4RAG A;  3MCZ A;  3VSK A;  4C3H J;  4OMY A;  1XSD A;  2E35 A;  2IGK A;  1QPM A;  3KYL A;  1G8X A;  1EH8 A;  2MSY A;  5F1J A;  3QRF F;  4EJW A;  1ZR2 A;  2ISY A;  3K1M A;  4MQV A;  3L2W A;  4I2O A;  2EIK H;  2JVH A;  1I6X A;  2AXT C;  3M1E A;  2M4G A;  3GW2 A;  1BA5 A;  1I3A A;  1U5T C;  1X1A A;  1JKR C;  1VI0 A;  2F6C A;  3LSG A;  4BQN A;  1P4A A;  4NC6 A;  4WF2 A;  2M0M A;  3F23 A;  3K70 D;  1SD4 A;  3FM5 A;  5C44 J;  4HRI A;  4LIV A;  4UVB A;  3BPX A;  2H6C A;  5DD4 A;  1Q1H A;  4RB3 C;  2E5Z A;  2E2I J;  4PFP A;  2W7N A;  4L9J A;  3PUF A;  3VDX A;  2PX9 A;  3RQI A;  3WTT C;  1YG2 A;  5IY5 H;  1ZRC A;  3KP6 A;  2K7L A;  2DAO A;  2V9K A;  2VC0 A;  5FLM J;  1MW7 A;  2VKD A;  2UWM A;  3AG2 H;  1Y0N A;  1BM9 A;  1TLH B;  1WGX A;  5F1R A;  4I01 A;  2TCT A;  4XN3 A;  1FBQ A;  1FMV A;  4MHG A;  4HF2 A;  3S16 J;  5CVR A;  1O7F A;  2KP6 A;  2HKX A;  1KU3 A;  3ESW B;  3SZG A;  1E17 A;  2IS6 A;  2M87 A;  1E3O C;  3QAH A;  5E3L A;  1RI7 A;  3PO2 J;  3FKI J;  4R79 A;  2LY9 A;  4IQJ A;  3QQA A;  2EH3 A;  5J1Y A;  1A6I A;  1X2N A;  1Y56 A;  3O3K A;  2NNY A;  1SC7 A;  2HOA A;  2WY8 Q;  1KQ0 A;  2CW0 F;  4TV7 A;  3HBL A;  5L3F A;  1GVJ A;  1FMW A;  1SAU A;  4RB2 C;  4PK4 A;  1GHC A;  3CES A;  4AID A;  1HST A;  2E1M C;  5EG0 B;  4WXC A;  1FZP B;  2W82 A;  3K70 C;  1SD7 A;  1IXC A;  1OCR H;  2EJR A;  3I56 I;  2HZT A;  4KMF A;  3CD6 I;  3ZQF A;  4GYG A;  4I7H A;  5L3B A;  1HLV A;  1F1Z A;  5TJJ A;  4EM1 A;  3JRF A;  5TGT A;  1HW1 A;  1RR7 A;  3ONQ A;  1T2K A;  1YLF A;  4LG0 B;  4PUS A;  3BG3 A;  1FSH A;  1FIP A;  1P92 A;  4ESB A;  2GXB A;  1CQT A;  5D4R A;  2GIZ A;  2JTV A;  1HQC A;  1WJ5 A;  3FXU A;  4HX8 A;  4HQM A;  4CCK A;  2DLL A;  3CUQ C;  3HOW J;  2QKM B;  3GO5 A;  4FET A;  3H36 A;  1KZH A;  2HGC A;  1MD0 A;  1TW2 A;  2LKP A;  3JRI A;  1FOX A;  3ZXS A;  2R7W A;  1UHW A;  2JT1 A;  2VQH A;  3OIP A;  2V6C A;  2R7R A;  2HOE A;  4A0Y A;  5ICC A;  1W7P D;  3GYH X;  2R92 J;  2O3F A;  3ZCO A;  3HPG A;  2H1L A;  4LK0 F;  1WJB A;  3WGG A;  4IRG A;  2DT7 B;  5JVG F;  2CJJ A;  3JRA A;  3LSR A;  2XF7 A;  4F91 B;  4DNC A;  2VT3 A;  3GEZ A;  1IO2 A;  5LLQ A;  2HTS A;  4G6Q A;  2OQR A;  2PBI A;  1RRJ A;  2E1C A;  2DYS H;  2YU9 J;  2VE9 A;  4CUG A;  1AHD P;  1W5T A;  3EUK L;  3V8K A;  2PI0 A;  4FT8 A;  1VQP I;  3CP2 A;  1R9T J;  1OIS A;  2L9R A;  3S3O A;  5GPA A;  4KIB A;  1VQK I;  2G7H A;  1D5Y A;  1W7P A;  2DMU A;  3FX3 A;  4IHW A;  3OYE A;  3CZ6 A;  3FZV A;  1MMG A;  3GLX A;  1S8N A;  1H9G A;  1NHA A;  3O6B B;  1IN4 A;  1UCR A;  3WGH A;  4RAF A;  3SFZ A;  1HDD C;  3IP4 B;  4RGR A;  1MGT A;  5K1Y A;  2VKH A;  4IXA A;  2VAS A;  4C9Y A;  2EV6 A;  3T0Y A;  3A0B C;  3NAR A;  3GFI A;  2ZJR F;  3ZOB A;  1I6H J;  1ETV A;  1H0M A;  4LIU A;  2P4W A;  5IYB J;  1RUO A;  1YRN A;  1AA7 A;  2TRT A;  1N78 A;  3Q0U A;  3E7L A;  4A0Z A;  3R60 A;  4JP0 A;  1O3R A;  1T08 B;  3LFK A;  4UUV A;  4FQG A;  2WAE A;  2P6S A;  2XKP A;  3BT9 A;  3TO7 A;  5M3M J;  3LAP A;  1LJ9 A;  4A93 J;  4XSX F;  1D0X A;  2M5W A;  3E1S A;  3HSF A;  4JX4 A;  4G7Z F;  3M3Y J;  5FKM A;  2EIM H;  1YFH A;  2MLG A;  2DOA A;  1FJL A;  2IGO A;  2ZNZ A;  3AL0 C;  2CSO A;  4IRH A;  4M72 A;  3JRG A;  1G59 A;  5LHH A;  3P9C A;  5ILV A;  1VQ5 I;  5DCF A;  1X58 A;  1N75 A;  3M9A A;  4CXF A;  2VOP A;  1N25 A;  2NS8 A;  4UVC A;  3ZQQ A;  3WTU C;  1R5G A;  3F21 A;  5M5Y J;  2XVC A;  3KP2 A;  4A6D A;  2L4A A;  2MC4 A;  1G3W A;  4UB8 C;  2BBY A;  1U6G A;  3A03 A;  3PNV A;  2QSG X;  4LB6 B;  1X4P A;  2VKE A;  5EEA A;  2F48 A;  4RA2 A;  3BR3 A;  2XRL A;  1SAN A;  4PSX A;  4UHT A;  4A5M A;  2LD5 A;  3GZ6 A;  4WX9 A;  1O3Q A;  2VBZ A;  4EM2 A;  4XID A;  3E5Q A;  2LK2 A;  2XF6 A;  4QWQ A;  5LEK A;  1Q1V A;  1QHG A;  2QLZ A;  1YQA A;  1LFP A;  3DXJ F;  2E34 A;  4KA4 A;  3GTK J;  4KIT B;  2CQQ A;  2OU2 A;  3I64 A;  1MJ9 A;  2D2W A;  1D8J A;  2KFD A;  4BHC A;  4YFX F;  4JQF A;  3LSI A;  2L3D A;  1R71 A;  2JZY A;  2FQ4 A;  4MTD A;  2R93 J;  3DTI A;  3FM3 A;  3ZQC A;  1GLN A;  1QVU A;  2Z16 A;  3WG7 H;  1Z6R A;  4FX0 A;  3W6J B;  3LSH A;  3HOY J;  2VJI A;  2Q1Z B;  1WH5 A;  2F4I A;  3COA C;  1HDP A;  2BHZ A;  2FNA A;  1OCZ H;  1WWX A;  1RNL A;  1X1D A;  1X3Z B;  2LKS A;  2NYX A;  4ASN A;  1U5T B;  3HDD A;  3HRM A;  3R6S A;  2M7B A;  3FHN A;  3U2R A;  1J7K A;  1GUU A;  2DA2 A;  4ZC3 A;  5KVR A;  2OUM A;  1FC3 A;  3KZI C;  2Y48 A;  3EDP A;  2V6E A;  2L0K A;  4XRS G;  1NH3 A;  4CIC A;  1B72 B;  5L3E A;  2V1D A;  3IWZ A;  5LBQ A;  2V26 A;  2RVC A;  2O9L A;  5FKN A;  2DYR H;  2DFF A;  3F6V A;  1U2W A;  1ZEL A;  1J59 A;  1BOA A;  3PFY A;  3TQN A;  3DU5 A;  1MNM C;  5ILS A;  2VOO A;  3BDD A;  2R7Q A;  2HVS A;  3J80 K;  4JYK A;  3RYP A;  3VFZ A;  3BR1 A;  4HF1 A;  2YX7 A;  5FB2 A;  3CCJ I;  3CCR I;  2LOO A;  2UXN A;  5DDG A;  2HQR A;  1SMT A;  5EJC A;  2NVU B;  2HKO A;  5D6E A;  2VJ4 A;  3GFL A;  5D5X B;  2WBM A;  4ZZL A;  3GTM J;  2IPQ X;  4G8X A;  4UXN A;  3KZZ A;  3CF5 F;  1ETK A;  3BOQ A;  4XIC A;  4LIT A;  5EZH A;  5E3O A;  2IA2 A;  1BW5 A;  2E1M B;  1NK2 P;  2ZXI A;  3MWM A;  3FXJ A;  1TT5 B;  3BG5 A;  2IAI A;  1RKT A;  5IOY A;  3IH4 A;  2ECC A;  2CRG A;  2G7U A;  1VZ0 A;  2O03 A;  2RNG A;  2BOL A;  2XDV A;  2DJN A;  1K6O A;  3BCB A;  4U88 A;  3CCY A;  2VC1 A;  1GV5 A;  3JSO A;  1OCT C;  4HA8 A;  2OBP A;  3S3M A;  3I53 A;  2ZNY A;  3J7Z I;  5JVT A;  1UFM A;  2ZFU A;  1JT6 A;  5IOZ A;  5CLS A;  1HBX G;  4I09 A;  1OCC H;  3LA7 A;  4RAY A;  2Q8K A;  3CCM I;  4EGZ A;  1ITY A;  2VBW A;  4LOC A;  3CUQ B;  3CCS I;  3GXO A;  2YSR A;  4AYB A;  1TL8 A;  4A12 A;  2EFQ A;  2PFB A;  5F64 A;  4G7H F;  2H6B A;  5GAD J;  4RDU A;  3HEF A;  3VOE A;  2L54 A;  1I3Q J;  1Z77 A;  1TQP A;  4NC8 A;  4CGZ A;  3WG9 A;  1K6Y A;  2ELJ A;  3CMM A;  3EPZ A;  1PDN C;  3Q5F A;  1VQ6 I;  2L9V A;  4E7S A;  2ZSH B;  4AIH A;  4F7Z A;  1QU3 A;  3BWG A;  4Y33 A;  4NDL A;  3J81 Z;  3OYN A;  4YIF A;  2JSP A;  2RNJ A;  3CCE I;  3HSR A;  4V2G A;  1FOY A;  3LL7 A;  1NTC A;  3CJN A;  5FFZ A;  4M6Y A;  2IBD A;  2DJI A;  4U0V A;  3VYR B;  3J81 K;  2DN0 A;  3CO6 C;  3VOD A;  1T95 A;  4BBS J;  4EM0 B;  2X6X A;  3OOP A;  2IS1 A;  1SMY F;  1SD5 A;  1XCB A;  1O3S A;  3HPH A;  3KEQ A;  3KIO A;  4A3B J;  3BLY A;  3F8C A;  3JRB A;  5HOO A;  2WAQ N;  2VBX A;  5HLI A;  5J40 A;  1JE8 A;  1VQ9 I;  2M3A A;  4M3E A;  4XL9 A;  4BE0 A;  2EIJ H;  3L2C A;  5E3N A;  1P4W A;  3CTA A;  3DEE A;  1FWZ A;  2VKV A;  3H1C A;  1KU7 A;  1BR4 A;  5DD8 A;  2I10 A;  1H8A C;  3KP3 A;  1PUF A;  1HCR A;  2MBF A;  3H9Q A;  3PNY A;  3EUA A;  4RGU A;  5BOX A;  1W7P B;  1ZRD A;  3DPL C;  4F93 B;  3QOP A;  3HHG A;  3RZD J;  2DK8 A;  4M71 A;  1BI1 A;  1TWH J;  1G3S A;  1IN7 A;  1YOV B;  2FA5 A;  1MND A;  1LDD A;  4WCG A;  4BE1 A;  3MZY A;  4L0Z B;  3HKZ N;  4M3G A;  3SJM A;  1IZ1 A;  2DMT A;  2FML A;  1DDN A;  5C4X J;  3FXM A;  3P7N A;  2JA5 J;  3AL0 B;  1XS9 A;  3M1C A;  3CF2 A;  4XQF A;  4YII A;  1Z9C A;  2OZU A;  2O0Y A;  1YRN B;  2M8G X;  1R6R A;  5HS7 A;  1YHQ I;  5BQT A;  2CO5 A;  4HV5 A;  3M4O J;  2FNP A;  4WWC A;  2AHQ A;  3GZ5 A;  1KQ8 A;  1KU2 A;  2YX4 A;  3KPH A;  1QBJ A;  2JMW A;  1K79 A;  2CV2 A;  2I8D A;  4ZTJ A;  1FYK A;  4LMY A;  4M6V A;  2A69 F;  3M8E A;  2CQ7 A;  5GAH J;  2VQG A;  5DTD A;  4ZYH A;  4I98 B;  2OC6 A;  2HQA A;  2OJE D;  4I76 A;  2MLK A;  4BAY A;  2C6Y A;  2OAZ A;  3M07 A;  2OD5 A;  3F8F A;  2E7X A;  3KEO A;  2DT6 A;  1QHH D;  1LFB A;  5B1A H;  3E6C C;  2EK5 A;  2H27 A;  1FP2 A;  2EPF A;  4CZZ A;  2JRM A;  2CV1 A;  1BI2 A;  2GM4 A;  2KDZ A;  3SFI A;  3BJA A;  1MZB A;  1FPQ A;  1MNE A;  1XMX A;  1FOW A;  4YEJ A;  4DZP A;  4L18 B;  2DTR A;  1W5C C;  2R4G A;  4ESJ A;  5K5O A;  1MBK A;  4A3I J;  3CUO A;  2X48 A;  3F0C A;  1DU0 A;  3NQO A;  3EYI A;  1E3H A;  3NWT A;  1TP4 A;  2ZSI B;  1UG2 A;  3RKY A;  3PFI A;  4GXO A;  3OMY A;  2ICW G;  1UEL B;  2LY2 A;  4PFO A;  1IUY A;  2KZG A;  5LHI A;  2D5V A;  2V4J C;  5HNF A;  3TED A;  2VJ5 A;  1WCM J;  1XB4 A;  3MEX A;  1YX5 A;  3VB2 A;  3I4M J;  5F04 A;  2KJC A;  4OU0 A;  2P5L C;  2Z3Y A;  3VYT B;  4IHV A;  2Z99 A;  4PJJ A;  4PCQ A;  2HR3 A;  3LOC A;  3QP6 A;  5DM6 F;  3HXL A;  1WHU A;  1ZAO A;  4RMN A;  3OL3 A;  5J4Y A;  2ZXH A;  3JRE A;  1XCV A;  2DFH A;  2XAH A;  1L3L A;  2HYJ A;  4YFK F;  5GTH C;  1W4M A;  3AFH A;  1WFX A;  2G0E A;  4MFD A;  2MFZ A;  4OIQ F;  3FBI B;  3R0J A;  4E7I A;  3E6D A;  4M9S A;  4RS8 A;  4BQO A;  4DBQ A;  1AWC A;  3LSK A;  2MW8 A;  2Z9O A;  3D0S A;  1OJL A;  2NVQ J;  1YIO A;  4GRI A;  4YRV A;  3KFW X;  4IO9 F;  1G3T A;  1QQI A;  4L9N A;  3D1N I;  1ONV A;  3I4P A;  5LGN A;  3KET A;  2A05 A;  3CC4 I;  2EIL H;  3OSF A;  4B1R A;  4B3X A;  2EA2 A;  2DA3 A;  1ZYR F;  5D5V B;  2ME0 A;  5EDN A;  3WE2 A;  2NOG A;  2H1K A;  2V9P A;  5K7F A;  4GCV A;  5EZG A;  5HLH A;  2QUF A;  2FBK A;  4BY1 J;  4CHU A;  2VBY A;  2Y0S N;  2M1B A;  3TGN A;  9ANT A;  3BQY A;  3LQR A;  3DCF A;  5B5E C;  4XLN F;  2ELK A;  2VJJ A;  5KAF C;  2ISZ A;  3LA2 A;  1Y0U A;  5J1R A;  2NVX J;  2NVT J;  2K02 A;  5FRM A;  1Z0X A;  2NNN A;  3LMM A;  1IG7 A;  3BTJ A;  2Z1D A;  4KT5 C;  2KQR A;  5ILU A;  1BR1 A;  2RN7 A;  3CMA I;  1GVD A;  2UXX A;  3G2B A;  5HDK A;  5GPC A;  2KPM A;  4XLH A;  1VQL I;  2LSO A;  1HF0 A;  5B66 C;  2AO9 A;  1T33 A;  3ZMS A;  4NQW A;  1VQN I;  4AVP A;  3FXK A;  5K5Q A;  1OR7 A;  3K6G A;  1IDZ A;  2QA4 I;  1B72 A;  2L7M P;  3TP3 A;  3OYJ A;  3K69 A;  4G94 A;  3OYG A;  2KIU A;  2EBI A;  2IT0 A;  4BJT A;  3MKL A;  4N4O B;  4PGG A;  2ZBK A;  2XAG A;  3GTJ J;  2HEO A;  3TDZ C;  4DYQ A;  5FLV A;  4XBF A;  4C30 A;  1EH7 A;  1OR7 C;  4II2 A;  2ZXJ A;  4EJO A;  3V8L A;  3O8G A;  3DKY A;  1MBG A;  5JHU A;  1LQ1 A;  1EKE A;  1MBE A;  3AAF A;  5F6F A;  2M45 A;  1FTT A;  3BTL A;  2FRH A;  1S72 I;  4EJT A;  3L9F A;  1K7A A;  3QU3 A;  2P7V B;  2QQ9 A;  1FYM A;  2VPL A;  1T6S A;  2KKO A;  2RV8 A;  1A31 A;  2B7E A;  4UVA A;  2IW5 A;  3OL4 A;  1BR2 A;  2A6E F;  3DFG A;  2F5C A;  2X4H A;  5FKK A;  4WXD A;  4E7K A;  2LRD A;  5JR3 A;  3PUB A;  3DBL B;  4P96 A;  1G6N A;  2QQ8 A;  3I58 A;  2B9S A;  2STW A;  1F4K A;  2VI6 A;  2QWW A;  2DOD A;  4O5V A;  4A6E A;  3SEZ A;  2DDB A;  2R7V A;  1P2F A;  3I0T A;  4OOI A;  2TDX A;  2CH0 A;  3ZQ7 A;  3OS2 A;  3CMY A;  1ZKG A;  2VB6 A;  3PQJ A;  5A2Q Z;  1FEX A;  3G73 A;  1QRY A;  2V7F A;  2JQ7 A;  1PUF B;  3GUD A;  3HM5 A;  2HYF A;  2HZD A;  1TTY A;  4XOT A;  1MSE C;  3DV8 A;  2P5V A;  5FJ8 J;  2KT0 A;  1IN5 A;  2DMQ A;  2GXA A;  3CQZ J;  5TIS C;  3CUQ A;  2LBF A;  2RC4 A;  3JR9 A;  4EGY A;  4CH7 A;  2BY3 A;  4FTH A;  4Q4Z F;  4RB1 A;  2V1N A;  3M8J A;  1F36 A;  2DT5 A;  2A5Y B;  5H6Q A;  3TOB A;  4J00 A;  3GWZ A;  3LAJ A;  1HW2 A;  3BR2 A;  1TNT A;  2CW8 A;  4D0P A;  1APL C;  2WTE A;  3AKZ A;  5HLG A;  1E2X A;  2V79 A;  4U0Y A;  2LKX A;  3DLA A;  2JA8 J;  1B9M A;  2FJ1 A;  5LD2 C;  1D0Z A;  1S29 A;  4BBR J;  3QU6 A;  3L2Q A;  1JT0 A;  4B3A A;  1O4X A;  2JUG A;  3FHZ A;  3O2P E;  1MH4 A;  1YW8 A;  1ZG1 A;  4II3 A;  3BQZ A;  3DPT A;  2ETH A;  2CV0 A;  2M2E A;  5AIP A;  2J5P A;  3P9I A;  2PJR A;  2BXZ A;  3WHC A;  4QSH A;  4AU7 A;  4Y7N J;  5FKL A;  1YE9 A;  3FWE A;  3T8T A;  1JJ6 C;  4E70 A;  3ABU A;  3RJP A;  2JJ7 A;  1I27 A;  2K27 A;  4IPA A;  1W1W E;  4IL6 C;  2DMP A;  1MMN A;  4XR6 A;  2M34 A;  1BOB A;  2BEO A;  4IX7 A;  4E7Z A;  3H3V K;  4N9I A;  2L9S A;  3OS0 A;  2DU9 A;  2FMY A;  4N0B A;  1GV2 A;  1Z91 A;  2FX0 A;  2DFI A;  1TWF J;  2RDP A;  2FU4 A;  5CQG A;  3KYC B;  2HS5 A;  5GAG J;  2DA7 A;  3RZO J;  3LFU A;  2N8G A;  4XM3 A;  1TBX A;  2WAQ A;  4M9X A;  4NNJ A;  4ZYA A;  4YG2 F;  1F9N A;  1S7A A;  1JGG A;  3K4M A;  4A0X A;  4IVN A;  3E97 A;  4BL0 B;  3F8N A;  2Q0O A;  1ODD A;  2XAU A;  2Y30 A;  5TRD A;  2CG4 A;  2LVS A;  1GXQ A;  1MMA A;  4B09 A;  3MZ8 A;  3ELK A;  4ZDL A;  1SD6 A;  5J47 A;  3LQQ A;  3ZR8 X;  5LRS A;  3S8P A;  2QM3 A;  1A04 A;  2F5V A;  1A35 A;  3PIP F;  3A2K A;  2XSJ C;  1TZL A;  2IS2 A;  4IHS A;  2BZT A;  2RAE A;  4CCM A;  2BHY A;  3HKZ A;  4HX7 A;  5CPR B;  3FK7 A;  2Y9Z A;  4IJA A;  2MG4 A;  4A3E J;  2P7C B;  3WU0 A;  4IRI A;  4G6T B;  5GTI C;  4JX6 A;  4ZDP A;  4A3M J;  4JBA A;  2WWY A;  1Y8Q B;  3K9T A;  1Z05 A;  2P0W A;  3EET A;  3L2U A;  2VON A;  1QNT A;  2JVG A;  2W48 A;  5IYD J;  1V55 H;  2XPU A;  5K7H A;  4CCL A;  2A07 F;  2BY2 A;  4PJ0 C;  4FX4 A;  2WA0 A;  1AU7 A;  3C1D A;  2DK5 A;  4A69 C;  1U78 A;  2GLO A;  2LF8 A;  3JAM Z;  3BY6 A;  1ZQ3 P;  2P6T A;  4A2U A;  3KYD B;  5CVU A;  4PGH A;  2NXN B;  1SFO J;  2EFN A;  2R7D A;  1I1S A;  1I39 A;  2IP2 A;  1XSX A;  1U9N A;  3HTS B;  2LFB A;  5H2F C;  5E3M A;  4V19 K;  2RQQ A;  4OIR F;  1X4O A;  1Z1D A;  3ASN H;  4HNT A;  3D5S C;  4ENM A;  4B4C A;  3WTS C;  1FYL A;  4AM3 A;  4LK1 F;  4N9H A;  3CC2 I;  2DA6 A;  4C2M J;  1I50 J;  3BTC A;  1DPU A;  2A6T A;  5EEG A;  1OMI A;  2PLY A;  2DOE A;  3DKX A;  2W1O A;  4LG3 A;  4MGR A;  2XIG A;  2R5Y A;  3S14 J;  4UNO A;  1S7O A;  3KZY A;  2VE8 A;  2RGV A;  3UKG A;  4NQW B;  1K78 B;  2WV0 A;  2HPI A;  2VL8 A;  3MFK A;  1SFU A;  1J2X A;  2CU7 A;  3BG6 A;  4BDZ A;  3DU6 A;  2O5R A;  4BUP A;  4HST A;  5JI6 A;  3G71 I;  1TQI A;  3GFJ A;  4M3D A;  4Q5S F;  2DFE A;  2JA6 J;  3REO A;  3H9G A;  1VTN C;  2XAQ A;  4ZYE A;  3MZH A;  3TMO A;  4M9Z A;  2HYG D;  4GFB A;  3MKY B;  3ZPL A;  3KCC A;  4C2T A;  2EV0 A;  2L2O A;  1UHM A;  4HG2 A;  3WOD F;  4E7L A;  2X6W A;  1LFU P;  1R00 A;  4XLC A;  1YO5 C;  4CCJ A;  3N4M A;  2KL4 A;  3HL2 A;  4RM2 A;  4XLF A;  1VFC A;  1SAX A;  1Y6I A;  3U1K A;  4BU2 A;  3KP7 A;  4HOB A;  3IUO A;  1HA8 A;  1J5Y A;  2XAJ A;  4NC7 A;  4P9F A;  3FIS A;  4AVZ A;  4W97 A;  3TO9 A;  2EZL A;  4P9U A;  2A5W A;  4BHB A;  2XKO A;  3DP7 A;  3H0D A;  2UZK A;  1DU6 A;  3LSJ A;  4B47 A;  5BS6 A;  3BR6 A;  3DPU A;  2MH2 A;  3TL4 X;  4D1Q A;  5D6F A;  4LLL A;  2VQL A;  1T98 A;  1U3E M;  3I59 B;  1IN8 A;  3K1N A;  4ENJ A;  2RQP A;  1QO0 D;  2GOM A;  4UUS A;  1WSU A;  1HC8 A;  3RIR A;  2OF7 A;  2HNH A;  3MN2 A;  4PDK A;  3BP8 A;  1JHF A;  2HU9 A;  4DOZ A;  2DA1 A;  1STZ A;  2Y0S A;  2ZME A;  3WU2 C;  2IS4 A;  1B9N A;  1VQ8 I;  4Y17 A;  3VWB A;  3VYU B;  3I3L A;  4JX5 A;  3ERM A;  2LBF B;  4G9Y A;  4P55 A;  2H09 A;  4KJZ A;  2IA0 A;  3ECH A;  3VPR A;  4DW6 A;  2MYS A;  4A5N A;  3V7S A;  3CCU I;  4BGD A;  3PL8 A;  2GWR A;  1LEA A;  1XN7 A;  4KIF A;  5DYM A;  5E8I A;  2OCE A;  3GZN B;  1L0O C;  2ZME C;  3A1Y A;  3DTK A;  2LH9 A;  5K5R A;  4E7H A;  5B3S H;  1XSV A;  3IC7 A;  2K5C A;  2XRO A;  3OIQ A;  1RR8 C;  2LG4 A;  2A68 F;  3SDB A;  3LSM A;  4XSZ F;  4IKF A;  4GO1 A;  1HXD A;  2LYC A;  1DP3 A;  2JWT A;  2BVL A;  2PJR B;  3HSE A;  4D9J A;  1ZAR A;  3L00 A;  3OYI A;  4LB5 A;  1V4R A;  2ZC2 A;  3WTZ A;  1XMK A;  4BQA A;  3K4C A;  1PP8 F;  1YW9 A;  1R5I D;  2GBY A;  2XUB A;  1MJA A;  2CQN A;  4HAM A;  1JGS A;  4GYI A;  3OYL A;  1T38 A;  2Y9Y A;  3ZQG A;  1ZK8 A;  3KX2 A;  4FAS D;  3BJO A;  2HOT A;  2NAZ A;  2R7O A;  1R49 A;  2A6H F;  2R5Z B;  5J8F A;  3FKJ A;  2UUZ A;  3OYH A;  3OS1 A;  2ZO4 A;  2R7X A;  1IRF A;  2MAB A;  1E0E A;  1WPK A;  2COM A;  1B59 A;  1FBS A;  3OR2 C;  1YX3 A;  4DZJ A;  2D1V A;  5B1B H;  4M3F A;  4XKC A;  1X1P A;  3I55 I;  4RB0 A;  2NOJ B;  1PYV A;  4BDY A;  2QQB A;  4XLA A;  1T8I A;  4XON A;  3R4K A;  2PN6 A;  1B8I B;  2EB7 A;  3TO6 A;  2O7O A;  1NG6 A;  2QBY B;  3A01 A;  4MO7 A;  3B6C A;  1Z67 A;  1IAW A;  3BZK A;  1I5Z A;  4I0A A;  1IN6 A;  1S7E A;  4Q48 A;  1P7J A;  1OCP A;  1C0W A;  3HG9 A;  3OYB A;  5M5X J;  4PJM A;  1ACI A;  4GDF A;  4HV6 A;  2GZW A;  1BC8 C;  3S93 A;  5ICG A;  3CO7 C;  2QEN A;  2QVO A;  3HJE A;  1WKM A;  1JJ8 C;  3HYI A;  1ETY A;  1DPR A;  1BC7 C;  3H3U A;  1MKM A;  3HGG A;  3HRU A;  5L3D A;  1TWG J;  1ETX A;  4IQ4 A;  1GDT A;  3S3N A;  1P9Q C;  1IV6 A;  3LA3 A;  3QP5 A;  3M8F A;  1O3T A;  3K4B A;  2MD5 A;  3S2D J;  3RDI A;  2EZI A;  1B1B A;  1J09 A;  1R4M B;  4M3B A;  2O8X A;  2EA4 A;  2WV1 A;  2K9Q A;  1HW5 A;  1U9O A;  4W1U A;  2OCC H;  4HDV A;  3R61 A;  4ETS A;  5J1U A;  2F4M B;  2LMD A;  4UUT A;  4I6Z A;  4IOC F;  1SFE A;  3LNQ A;  3OYD A;  2E1O A;  3PSI A;  2PMZ A;  2QGU A;  3AG1 H;  1VQO I;  5FLX Z;  3EQL F;  4ON0 A;  4LLN A;  3IH2 A;  4XK4 A;  2AXL A;  2K86 A;  2JUC A;  3SXY A;  1OKR A;  5F0F A;  4EVI A;  3RKX A;  3F8B A;  5D4S A;  2HWV A;  4XRF A;  1E3P A;  2NS0 A;  2XC7 A;  1DUX C;  1MBF A;  4HX4 A;  3TKY A;  3BPV A;  4D5C A;  2R7U A;  1XGO A;  1Y1W J;  3EYY A;  2R7T A;  2HQN A;  4XN0 A;  4BNC A;  2YS9 A;  3O8H A;  2ID6 A;  1UJ8 A;  3H0G J;  5E20 A;  1LKX A;  4HEA 2;  3NAU A;  4V2F A;  5DM7 F;  2H94 A;  2L01 A;  5IPA A;  4HBL A;  4H0E A;  1T39 A;  4UY8 I;  3ABK H;  1F5T A;  1MDM A;  4ZYD A;  3ZMV A;  4ITV A;  4XKV A;  4XMY A;  4UV8 A;  3IH3 A;  1S5L C;  3LST A;  3QYF A;  3OV8 A;  2R5Y B;  4HQE A;  4PJN A;  3BCA A;  3E3V A;  3JCU C;  3OOU A;  1TT0 A;  1YI2 I;  1JUS A;  4KT6 A;  1V5G A;  4MEY F;  4DGW B;  2ACJ A;  1LDK B;  1CGP A;  3GCM A;  4BXF A;  2KLO A;  4JOM A;  3B02 A;  2BY1 A;  3K7A J;  1FP1 D;  2YPR A;  1YJN I;  3IRR A;  2O8K A;  1XX5 A;  4RAZ A;  2V9V A;  3HZJ A;  2VN2 A;  4NB5 A;  3T8R A;  3ZMU A;  5HS8 A;  4EMS A;  2CUF A;  5GAE J;  2W00 A;  4KIG A;  3G6E I;  5CVI A;  2D1H A;  2Y2Z A;  3FMS A;  4KNY A;  1MIJ A;  1USS A;  2W25 A;  2FSW A;  4QPO A;  1ZRE A;  2FEZ A;  4EV0 A;  4CDG A;  2D45 A;  3QYE A;  3J7A Y;  4U7B A;  3IKT A;  3G1O A;  1YIJ I;  2ZFW A;  3HOZ J;  1PUE E;  4OWR B;  1U8B A;  2JPC A;  2ELH A;  4ZDO A;  2MC3 A;  4CA0 A;  1BJA A;  2OPT A;  3X2Q H;  1R58 A;  1P6R A;  2BW3 A;  2MGQ A;  4P1W A;  1S6L A;  2L02 A;  2XGD A;  1HSJ A;  2K9L A;  2CUE A;  3HOS A;  2DXI A;  3PNT A;  2F5D A;  2XGX A;  4CSW A;  3KEY A;  2XHK A;  3HOU J;  1U0J A;  2PMU A;  2IA1 A;  1XGM A;  1X1C A;  3DLL F;  4HNV A;  4Z6Y A;  1MSF C;  3SZT A;  3Q9V A;  4J01 A;  4MQ9 F;  1Z3X A;  2K9N A;  3OSG A;  1YS7 A;  3Q3S A;  5ICE A;  3KLN A;  5EYR A;  2LLK A;  1QPI A;  2KIF A;  1POG A;  1R1U A;  4UUS B;  3LSP A;  2WAD A;  2E1N A;  1KYZ A;  3FIW A;  4L9T A;  1FNN A;  4HZF A;  2KHM A;  2VXD A;  5CVV A;  2ZME B;  3GTL J;  2JA2 A;  4C3J J;  1O57 A;  2P8T A;  4M73 A;  4RGX A;  3PIO F;  2FE3 A;  1K78 A;  4LLG F;  3HOV J;  1WZ2 A;  3I5U A;  5IT9 Z;  2KDO A;  3HUG A;  1BIA A;  3BZC A;  2W84 A;  1LE8 A;  4UV9 A;  1VND A;  3EUH C;  3PM1 A;  1R36 A;  1EA3 A;  5DCM A;  3ULQ B;  5IP9 J;  1IRG A;  3OIO A;  2VQC A;  1JUM A;  5FD6 A;  3W3C A;  4AD9 A;  3OY9 A;  1I1G A;  2OV7 A;  4CO8 A;  1KON A;  1CF7 B;  5JLW A;  5HDN A;  3MQ0 A;  1FSE A;  5E1X A;  1MBH A;  3BTI A;  2EFP A;  5D8K B;  4EQQ A;  1ETQ A;  3OYC A;  1RET A;  1MMS A;  2FBI A;  2FUG 2;  4B44 A;  3IRQ A;  1WJA A;  4JK1 X;  4CCO A;  3CJR B;  1IC8 A;  1ZR4 A;  1YW7 A;  4F92 B;  3IAM 2;  1X1B A;  3BG7 A;  1Y39 A;  1AKH B;  1OYW A;  1UAA A;  4RGS A;  5E8G A;  4ENK A;  4KFC A;  3CJT B;  2EIN H;  4DBR A;  1XGS A;  4OIP F;  3I59 A;  2GXG A;  2CGP A;  2JRT A;  1QVT A;  2ZKZ A;  3CP8 A;  3VYS B;  2IRF G;  3JRH A;  1D5V A;  1RPW A;  2F5F A;  3W2W A;  5KCM A;  2RRE A;  3ZN0 A;  2BV6 A;  3E6B A;  5BPI A;  2QF7 A;  1PJR A;  4CZC A;  1LPQ A;  3V7R A;  3ABT A;  1D1C A;  4S05 A;  1QZZ A;  4X6A J;  1XMA A;  2X1C A;  2X1E A;  1R5H A;  2ZB9 A;  5A2Q K;  3E6M A;  2VPR A;  1Z21 A;  4B48 A;  2GA2 A;  4NUB A;  1IF1 A;  2QZ8 A;  5LRR A;  2E36 A;  1MH3 A;  3I71 A;  4IHT A;  3OYM A;  1W0U A;  5F0H A;  4KN4 X;  2XV4 S;  3A01 B;  3H35 A;  2DW4 A;  2CMP A;  2E19 A;  3DEU A;  2X51 A;  4XLP F;  3G3Z A;  3A0H C;  4HF0 A;  2YR2 A;  1WJF A;  2KIQ A;  1IRZ A;  4U0W A;  2QEX I;  2F4O B;  5CJ9 A;  4MFE A;  1J75 A;  1K4T A;  2Y31 A;  2XGC A;  3J7Y J;  3DQV C;  2ZJ2 A;  4HNU A;  1PP7 U;  1VQM I;  1D1B A;  2E5N A;  3CCV I;  1ZGW A;  2KIS A;  1ETO A;  2L7K A;  4WXH A;  3ZN1 A;  4A3F J;  2R7Z J;  3K4K A;  2XB0 X;  3ZQH A;  3VSL A;  1EV7 A;  1NG7 A;  4G7O F;  1D3Y A;  5EEH A;  2KIM A;  5AIQ A;  3TW7 A;  2PMZ N;  2IGM A;  2B63 J;  5DS9 A;  3KP5 A;  1WJE A;  1ZG3 A;  2QYO A;  3QYB A;  2X6Y A;  1X3W B;  3Q0W A;  4D7M A;  3G1L A;  3R0A A;  3IHU A;  1R7J A;  3C7J A;  5D5W B;  4E4H A;  1ENH A;  2P5K A;  5CYV A;  2DA4 A;  3OR1 C;  1G2H A;  2Z5U A;  1UHS A;  1IRX A;  4L9V A;  1VF9 A;  4FIS A;  3ML6 A;  5FRO A;  1BBY A;  1R22 A;  3OWT A;  1JXS A;  2R5Z A;  1W36 D;  2QCO A;  4IOA F;  1EF4 A;  3K2Z A;  1WVR A;  3FF5 A;  5GP9 A;  1UMQ A;  2R7S A;  3HOT A;  5J6X A;  4IHX A;  3K0L A;  3H9J A;  1X3U A;  3S1R J;  1XDS A;  4OIN F;  2XRN A;  5KAI C;  3RKQ A;  2ZJQ F;  3PO3 J;  3FDY A;  4L0Y B;  1WRJ A;  1TC3 C;  2E2J J;  5CQE A;  2GIV A;  3L1P A;  3JTH A;  2L7Z A;  1B8I A;  6PAX A;  2X6O A;  5J3L A;  1H9T A;  2LC2 A;  1KYW A;  4F55 A;  4QIW N;  4D7N A;  3NEU A;  1ERD A;  2QBY A;  1WJC A;  3MAJ A;  5J8C A;  2L5Q A;  4KYW A;  3ZP5 A;  2K4B A;  2ESN A;  4U87 A;  3SZP A;  3ZMT A;  2ECB A;  3IL2 A;  5C3E J;  4BH9 A;  3FMQ A;  4ZYG A;  3W6V A;  4HSR A;  2GAU A;  2DQL A;  4OAZ A;  3G4S I;  3WGI A;  5EGO B;  2HQ5 A;  1RES A;  1MJB A;  2W4S A;  3MKW B;  1MDM B;  3S1Q J;  4DYR A;  4OMZ A;  4LGW A;  3HTU A;  3G1M A;  2XSD C;  4MNU A;  1SVM A;  3S32 A;  1MMD A;  1FBU A;  2XAS A;  1QZY A;  2ZCW A;  5LHG A;  2WB1 A;  1U8R A;  3MD2 A;  3V8J A;  4O6J A;  3ZMD A;  2E60 A;  1W36 C;  2FOK A;  4DJA A;  1BI0 A;  2ZXW H;  2JK3 A;  1EH6 A;  5AON A;  4XRM A;  4BAC A;  2V1X A;  4LJZ F;  5KNL A;  1DQU A;  4IF4 A;  5L3C A;  2HOS A;  3WTW C;  3BZ6 A;  1IXS B;  3HB9 A;  4BY7 J;  1LDJ A;  3ZMZ A;  5E17 F;  1R4N B;  3BJ6 A;  2OQG A;  4X0G A;  1V3F A;  3S17 J;  1DGR M;  3DWL E;  1XDU A;  3FXR A;  2BGC A;  4F3Q A;  1JKO C;  1T0F A;  2W57 A;  1MBJ A;  1BIB A;  1OQY A;  2CWE A;  2R3S A;  4CCN A;  3HRT A;  4A3G J;  4MEX F;  3GF2 A;  3L7W A;  3QOD A;  5BMZ A;  1IJW C;  1FY7 A;  2BYV E;  5JLX A;  3HGY A;  1DP7 P;  4A3K J;  3K1P A;  3HRS A;  5M5W J;  2L9N A;  4A3L J;  2BW3 B;  3U1D A;  3S2H J;  1W5S A;  1Z7L A;  4N4N B; 
#chains in the Genus database with same CATH homology
 1H88 C;  4AC0 A;  1H89 C;  2IEK A;  3GBG A;  3PO2 J;  3FKI J;  4IHY A;  2LY9 A;  3QQA A;  2EH3 A;  5J1Y A;  2JWT A;  3JRE A;  1A6I A;  1X2N A;  4Y52 J;  2HYJ A;  2HOA A;  1JTX A;  3HBL A;  2G0E A;  2GBY A;  4MFD A;  3ZQL A;  3JRC A;  5EG0 B;  2Y9Y A;  3ZQG A;  1ZK8 A;  5C4J J;  3ZQF A;  2MW8 A;  2HOT A;  1OJL A;  2NVQ J;  2DA5 A;  1WI3 A;  1HLV A;  5IP6 A;  2R5Z B;  4XRS A;  3JRF A;  1RR7 A;  3CDL A;  3QPL A;  2XGE A;  1NK3 P;  2DTZ A;  3BG3 A;  1WPK A;  1FIP A;  3D1N I;  4DZJ A;  1CQT A;  4M3F A;  4J19 A;  3OSF A;  4B1R A;  2DA3 A;  4MLO A;  1Y1V J;  2ME0 A;  3C2B A;  3HOW J;  1LE8 B;  5EDN A;  1B8I B;  2NOG A;  2H1K A;  1X2M A;  5K7F A;  2O7O A;  3JRI A;  5EZG A;  3A01 A;  2LP0 A;  3B6C A;  4MO7 A;  1BL0 A;  4BY1 J;  2Y0S N;  4ABZ A;  9ANT A;  3BQY A;  2R92 J;  3DCF A;  1S7E A;  1JKP C;  1P7J A;  2ELK A;  1OCP A;  1FTZ A;  5J1R A;  5M5X J;  2NVX J;  2YUS A;  3GTG J;  2NVT J;  2COB A;  2CJJ A;  3JRA A;  3LSR A;  4S0H B;  1Z0X A;  3WHB A;  1JJ8 C;  1IG7 A;  1IGN A;  3BTJ A;  1ETY A;  3TP0 A;  4EEF G;  1GVD A;  5GPC A;  3HGG A;  4CYC A;  2YU9 J;  1AHD P;  1ETW A;  1TWG J;  1ETX A;  3HOX J;  1GDT A;  1K83 J;  1R9T J;  1IV6 A;  1HF0 A;  3GTP J;  2L9R A;  5F27 A;  2AO9 A;  5GPA A;  1T33 A;  3S2D J;  1JTY A;  2EZI A;  1D5Y A;  2DMU A;  4M3B A;  4IHW A;  1IDZ A;  2HXO A;  2L7M P;  2WV1 A;  1JUP A;  2K9Q A;  3TP3 A;  1FIA A;  1B72 A;  1U9O A;  4W1U A;  2EBI A;  5J1U A;  4UUT A;  4I6Z A;  4G12 A;  1HDD C;  1P7I A;  4DYC A;  3MKL A;  3LNQ A;  1A5J A;  2E1O A;  5K7Z A;  3GTJ J;  3IH2 A;  4XK4 A;  4DYQ A;  1WH7 A;  3NAR A;  5FLV A;  3ZOB A;  3JRD A;  1I6H J;  1ORK A;  5F0F A;  1ETV A;  2EZH A;  5IYB J;  1YRN A;  2TRT A;  2ME6 A;  3O8G A;  3Q0U A;  1MBG A;  3E7L A;  3BR0 A;  4JP0 A;  1MBE A;  1FTT A;  3BTL A;  3BT9 A;  5M3M J;  1MBF A;  4A93 J;  4JX4 A;  3M3Y J;  4D5C A;  5FKM A;  1Y1W J;  1FJL A;  2HDD A;  3BG9 A;  2YS9 A;  3O8H A;  2ID6 A;  3JRG A;  3H0G J;  5FKK A;  3NAU A;  4V2F A;  1X58 A;  5IPA A;  2K40 A;  2NS8 A;  3FK6 A;  2VI6 A;  5M5Y J;  3GTQ J;  3IH3 A;  3CMY A;  1ZKG A;  3A03 A;  2R5Y B;  1FEX A;  4A3J J;  1QRY A;  2VKE A;  1PUF B;  3HM5 A;  5EEA A;  3OOU A;  1MSE C;  1JUS A;  3QPS A;  3BR3 A;  2XRL A;  1SAN A;  5FJ8 J;  2R0Q C;  1HOM A;  1AKH A;  2KT0 A;  2LD5 A;  2DMQ A;  3CQZ J;  3K7A J;  2O8K A;  1XG1 A;  3JR9 A;  2LTP A;  4XID A;  2LK2 A;  5F0C A;  3SDG A;  1Q1V A;  2X9D A;  4FTH A;  2CUF A;  3Q0V A;  5IP7 J;  1F36 A;  2Y2Z A;  3GTK J;  1ZTR A;  2CQQ A;  3BR2 A;  1APL C;  3G1O A;  2LKX A;  3I4N J;  2FQ4 A;  3HOZ J;  2L7F P;  1U8B A;  2R93 J;  5IYC J;  3ZQC A;  2JA8 J;  1QVU A;  2OPT A;  2FJ1 A;  2MGQ A;  4BBR J;  1JT0 A;  4B3A A;  3HOY J;  1BW6 A;  2XGD A;  1O4X A;  1WH5 A;  2CUE A;  1HDP A;  1MH4 A;  2WB1 N;  2DMN A;  3BQZ A;  3HOU J;  2M2E A;  3HDD A;  2HXI A;  4L5E A;  1JKQ C;  3WHC A;  4QSH A;  1GUU A;  2DA2 A;  5FKL A;  4Y7N J;  4HNV A;  2JA7 J;  1MSF C;  2M9H A;  1JJ6 C;  3BR5 A;  1OFC X;  5FKO A;  2K9N A;  2L0K A;  5EG0 A;  2JJ7 A;  2M0C A;  4XRS G;  3OSG A;  1B72 B;  3Q3S A;  3S1N J;  1K61 A;  5EYR A;  1QPI A;  2LLK A;  2DMP A;  1POG A;  4UUS B;  2M34 A;  3LSP A;  3IV5 A;  2O9L A;  5FKN A;  3FIW A;  1XC5 A;  3H3V K;  2FX0 A;  1GV2 A;  4RBO A;  1MNM C;  1TWF J;  3S15 J;  3GTL J;  4JYK A;  4C3J J;  3BR1 A;  4BKX A;  2DA7 A;  3HOV J;  3RZO J;  2N8G A;  3TW6 A;  1LE8 A;  1VND A;  3PM1 A;  1T56 A;  1JGG A;  3GTM J;  5IP9 J;  4MIM A;  1TWC J;  3OIO A;  3B6A A;  2Y30 A;  2NVY J;  1JUM A;  1ETK A;  4XIC A;  2LVS A;  2XPW A;  1W0T A;  5EZH A;  5E3O A;  1BW5 A;  5JLW A;  1NK2 P;  4QTR A;  4FE7 A;  2EZK A;  2FD5 A;  3BG5 A;  2IAI A;  1RKT A;  1MBH A;  3BTI A;  3IH4 A;  2ECC A;  2CRG A;  5IOY A;  1ETQ A;  2P81 A;  1RET A;  1IUF A;  2EQR A;  3ZQI A;  2E2H J;  2RAE A;  2DJN A;  2ID3 A;  2NS7 A;  1IC8 A;  3CCY A;  1ZR4 A;  1GV5 A;  1OCT C;  3FK7 A;  2Y9Z A;  2MG4 A;  4A3E J;  1JT6 A;  4JX6 A;  5IOZ A;  1AKH B;  4A3M J;  1ITY A;  4LOC A;  4IEJ A;  4A3C J;  3A02 A;  5EGO A;  4FCY A;  1QVT A;  2CQX A;  2W48 A;  5IYD J;  1F43 A;  4RDU A;  3JRH A;  2XB5 A;  3HEF A;  4FE4 A;  1RPW A;  3MVP A;  2XPU A;  5F08 A;  5K7H A;  1I3Q J;  3DEW A;  1Z77 A;  1AU7 A;  2QF7 A;  4A3D J;  1BJZ A;  1GT0 C;  4A69 C;  1U78 A;  4X6A J;  2GLO A;  4NDL A;  2ZB9 A;  1ZQ3 P;  2VPR A;  4V2G A;  2XPV A;  1NTC A;  1MH3 A;  5EF6 A;  1SFO J;  2IBD A;  1W0U A;  5F0H A;  3A01 B;  2DN0 A;  2E19 A;  4BBS J;  1U9N A;  2LFB A;  5E3M A;  1IRZ A;  2JN6 A;  4MFE A;  4A3B J;  2Y31 A;  2XGC A;  3JRB A;  4B4C A;  2WAQ N;  2DA6 A;  4M3E A;  1ZGW A;  4C2M J;  3S1M J;  1I50 J;  3BTC A;  5M3F J;  1ETO A;  4A3F J;  4D5F A;  2R7Z J;  5BNG A;  2XB0 X;  3ZQH A;  5E3N A;  4CYC B;  3TW7 A;  2PMZ N;  2VKV A;  2B63 J;  5DS9 A;  2I10 A;  4C3I J;  2R5Y A;  3S14 J;  3Q0W A;  4D7M A;  1H8A C;  3G1L A;  1PUF A;  1IDY A;  1HCR A;  3UKG A;  1ENH A;  2DA4 A;  3RZD J;  2CU7 A;  4BXX J;  1G2H A;  2VUM J;  3K2A A;  1UHS A;  1TWH J;  5HOD A;  1VF9 A;  4FIS A;  3HKZ N;  4M3D A;  2R5Z A;  4M3G A;  3SJM A;  2JA6 J;  2QCO A;  2DMT A;  5C4X J;  1EF4 A;  5GP9 A;  2JA5 J;  2HI3 A;  1UMQ A;  1XS9 A;  4IHX A;  4AUX A;  3S1R J;  4AYB N;  4GFB A;  1RKW A;  1YRN B;  2M8G X;  4X1E A;  3M4O J;  3RKQ A;  3PO3 J;  2AHQ A;  1LFU P;  1TC3 C;  2E2J J;  2LR8 A;  2K9S A;  2JMW A;  3L1P A;  2L7Z A;  1B8I A;  2X6O A;  4M6V A;  5J3L A;  1VFC A;  3GTO J;  4QIW N;  4D7N A;  5DTD A;  2H8R A;  3FIS A;  4I76 A;  2ECB A;  4W97 A;  2EZL A;  1TWA J;  5C3E J;  4C3H J;  3W6V A;  1DU6 A;  3LSJ A;  5EGO B;  3BR6 A;  2HQ5 A;  1LFB A;  2MSY A;  1RES A;  5F1J A;  3S1Q J;  1ZR2 A;  4DYR A;  2GM4 A;  2KDZ A;  3SFI A;  4UUS A;  3G1M A;  2XSD C;  1BA5 A;  2OF7 A;  3MN2 A;  1JKR C;  1VI0 A;  4DZP A;  2DA1 A;  3LSG A;  2JK3 A;  1MBK A;  4A3I J;  2X48 A;  3F0C A;  5C44 J;  4XRM A;  1DU0 A;  2E2I J;  1UG2 A;  4JX5 A;  2HOS A;  3RQI A;  3HB9 A;  4BY7 J;  4DW6 A;  3VPR A;  3S17 J;  2D5V A;  1JKO C;  5FLM J;  1MBJ A;  3TED A;  4A3G J;  1IJW C;  1WCM J;  1WGX A;  5JLX A;  2TCT A;  3HGY A;  5F04 A;  3I4M J;  3S16 J;  4A3K J;  4IHV A;  5M5W J;  4A3L J;  3S2H J;  1E3O C;  3LOC A;  5E3L A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...