1IG7A

Msx-1 homeodomain/dna complex structure
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
58
structure length
58
Chain Sequence
RKPRTPFTTAQLLALERKFRQKQYLSIAERAEFSSSLSLTETQVKIWFQNRRAKAKRL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Crystal structure of the Msx-1 homeodomain/DNA complex
pubmed doi rcsb
source organism Mus musculus
molecule tags Transcription/dna
molecule keywords 5'-D(*CP*AP*CP*TP*AP*AP*TP*TP*GP*AP*AP*GP*G)-3'
total genus 21
structure length 58
sequence length 58
ec nomenclature
pdb deposition date 2001-04-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00046 Homeodomain Homeodomain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.60 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Homeodomain-like 1ig7A00
4B3AA 1W0UA 1A5JA 2ID3A 2L7MP 2E1OA 2YUSA 1POGA 1UHSA 1IJWC 1X2NA 5HODA 1U9NA 1FTZA 2B63J 3GBGA 1ETOA 3JRAA 3MKLA 1U9OA 1VF9A 2R5YA 1IDYA 3GTGJ 3JRIA 2IEKA 3CCYA 3LNQA 4ABZA 2XSDC 2VUMJ 2DA1A 1I6HJ 1RR7A 2N8GA 3GTKJ 2WAQN 3F0CA 2E2JJ 2DA2A 3B6CA 1RKWA 4GFBA 3HOUJ 3BQYA 1S7EA 2EZKA 2XB5A 5FLMJ 4M3GA 5EG0A 5E3OA 3M4OJ 1U8BA 1JKQC 3ZQGA 4XRSG 4Y52J 1P7IA 3BG5A 4UUTA 1WGXA 2DTZA 2EH3A 3G1MA 5IYCJ 1MSFC 1ITYA 2DMTA 1K83J 1GUUA 1MBJA 1OJLA 1EF4A 2RAEA 1JKPC 1QVTA 1WH5A 4X6AJ 4QSHA 2EBIA 4M3DA 4MFEA 1ORKA 3GTOJ 2XGDA 5EG0B 2EZHA 2PMZN 4FE7A 5M5XJ 5BNGA 4W97A 3S1MJ 1RKTA 1X2MA 3HOYJ 5EYRA 1Y1WJ 1ZKGA 1E3OC 1AKHB 3GTPJ 2XB0X 3JRGA 1JJ8C 1FTTA 1FIPA 2HOAA 2XGCA 4HNVA 1AHDP 2JN6A 3A01A 1T33A 2HQ5A 2CRGA 1OCPA 5GPAA 4IHVA 2HOSA 2FJ1A 2CJJA 1OCTC 1APLC 2W48A 1RPWA 1ETVA 2CQXA 1RESA 2R7ZJ 1TWHJ 3BTLA 3A02A 2ELKA 1MSEC 1JKRC 5EGOB 4FTHA 4DYQA 1SFOJ 2HOTA 3S2DJ 5F27A 3LSRA 5F1JA 2M2EA 2HI3A 2DMPA 2JMWA 2JA7J 1Y1VJ 5E3LA 5IP6A 1VI0A 3BR1A 1FJLA 2R92J 2P81A 1NK2P 1ZK8A 5E3NA 2MSYA 4A93J 2XPVA 1TWGJ 4B1RA 4D5FA 2CUEA 3HBLA 1BW5A 2LR8A 3BG3A 1IGNA 1YRNB 3SFIA 5M5YJ 3OSFA 3RQIA 2ID6A 3JRHA 3TW7A 5C4XJ 4V2GA 1GV2A 4RBOA 3HEFA 4C2MJ 3WHBA 2WB1N 1XC5A 2NS7A 3BTJA 2R5ZB 4BBRJ 2O7OA 3JR9A 1IG7A 4W1UA 3I4NJ 2NVXJ 4A3LJ 2WV1A 4A3EJ 2H1KA 1ETWA 1UMQA 1IRZA 3Q0UA 4MIMA 3D1NI 3BR3A 2DA3A 2FQ4A 1ZR4A 3A01B 1JT0A 2DA5A 3W6VA 3S1NJ 5FKLA 3FK6A 4S0HB 2R5ZA 2JK3A 3BR6A 3VPRA 2GM4A 3PM1A 5IPAA 3HB9A 3Q3SA 1T56A 1MBEA 3S17J 3ZQFA 4DZPA 3JRCA 2NVTJ 2EZIA 4AUXA 3TW6A 2NOGA 1GVDA 4A3JJ 5J1YA 5EDNA 3BTCA 3BR0A 3DEWA 5FKMA 1MBGA 3JRBA 1MBHA 3QPSA 3LSJA 1JUSA 1TWCJ 5M5WJ 1CQTA 2X48A 3ZQIA 2G0EA 4IHYA 3QPLA 3NARA 1JUPA 2TCTA 2JA6J 1LFUP 4JX5A 2KT0A 2LD5A 3MN2A 4RDUA 1HLVA 2K9SA 2XRLA 3G1LA 4X1EA 2MW8A 2LTPA 3C2BA 3S15J 1DU6A 2CU7A 4BY7J 1GT0C 1TWAJ 1IC8A 2Y31A 1W0TA 1BA5A 4CYCA 2FX0A 4A3FJ 2I10A 4BXXJ 2EZLA 2M34A 3JRFA 1LE8A 3NAUA 3BR2A 1ETYA 2R5YB 1ZQ3P 3HGYA 3S14J 4AYBN 2ME6A 4C3HJ 5K7HA 2DJNA 1LE8B 1H8AC 2JJ7A 1I50J 2Y30A 1JGGA 5IYDJ 4M6VA 3H3VK 1B72B 3O8HA 4JX4A 3JREA 1SANA 3SJMA 5F08A 5K7FA 1B8IA 3OOUA 3H0GJ 3JRDA 3LSPA 3BTIA 1XG1A 1ETQA 1ZTRA 2OPTA 1Z77A 2NS8A 4G12A 3FIWA 4DYCA 1QVUA 3HDDA 4IHXA 4QTRA 2HYJA 3LOCA 1G2HA 4I6ZA 1ETXA 2JA8J 4A3KJ 4Y7NJ 2XPUA 1HOMA 1LFBA 3CQZJ 1F36A 5J1UA 3A03A 2LP0A 1QPIA 2NVYJ 1FIAA 3L1PA 4DW6A 3S16J 2GBYA 2LVSA 1H88C 3ZQHA 1IV6A 2Y0SN 1Q1VA 3BG9A 5DTDA 2QF7A 2FD5A 5FLVA 1I3QJ 2ZB9A 4A3DJ 1IDZA 4DZJA 1JTXA 4C3JJ 3IH2A 5FKKA 5K7ZA 3S1RJ 2D5VA 1MH4A 2LY9A 1PUFA 1QRYA 5C44J 1YRNA 3B6AA 9ANTA 3G1OA 5F0HA 5EEAA 4XIDA 1GDTA 3HOVJ 2ECBA 3Q0VA 3ZQLA 2ME0A 4DYRA 2X6OA 5JLXA 4JYKA 2XGEA 1BW6A 3RZDJ 3K7AJ 5IYBJ 4B4CA 1BL0A 5F04A 4EEFG 1JTYA 3CDLA 4FISA 2TRTA 5IP7J 5FJ8J 1U78A 3GTMJ 5JLWA 2M0CA 3HM5A 1HDDC 1MBKA 1WCMJ 1B72A 3HGGA 2IAIA 1OFCX 1MH3A 3ZOBA 2VKVA 4C3IJ 4D5CA 4BKXA 4QIWN 4A3BJ 3RKQA 2VKEA 2O8KA 5IOYA 3HOXJ 2MGQA 1JUMA 5IOZA 1RETA 1NTCA 2H8RA 3O8GA 4XRSA 2JA5J 3MVPA 4MLOA 2M8GX 2DN0A 5J3LA 4NDLA 2DMQA 2LFBA 1P7JA 2AHQA 4M3EA 3FKIJ 5EZHA 2HDDA 1VNDA 4XK4A 2M9HA 2DMNA 3M3YJ 4FCYA 3BR5A 3LSGA 3HOWJ 2IBDA 3OIOA 1AU7A 2X9DA 2K9NA 3DCFA 2LLKA 4D7MA 5DS9A 1F43A 1VFCA 4MFDA 3RZOJ 5EZGA 4IHWA 4AC0A 1AKHA 4I76A 2EQRA 5F0FA 3SDGA 4A3CJ 3IH4A 4XRMA 4UUSA 1BJZA 2COBA 3HOZJ 1UG2A 4MO7A 1ZR2A 1B8IB 2DMUA 2AO9A 2CUFA 1R9TJ 3GTLJ 1FEXA 3E7LA 2R93J 5FKNA 3GTJJ 3S1QJ 1K61A 5EGOA 2HXIA 4CYCB 4A3IJ 1O4XA 5E3MA 3TEDA 2VPRA 2DA6A 3BQZA 4D7NA 4J19A 2YU9J 2E2IJ 2VI6A 1TC3C 2MG4A 4JX6A 2L7FP 1JJ6C 2Y2ZA 3IH3A 4JP0A 1MBFA 4UUSB 3OSGA 2Y9ZA 2OF7A 3QQAA 2CQQA 1DU0A 3WHCA 1HF0A 4A3MJ 2E19A 5J1RA 2ECCA 4BY1J 1MNMC 2Y9YA 1TWFJ 5F0CA 3K2AA 5C3EJ 5M3MJ 5M3FJ 4L5EA 3GTQJ 4LOCA 5IP9J 4FE4A 3Q0WA 4M3FA 1JKOC 1HCRA 1WH7A 2L9RA 4V2FA 4BBSJ 3ZQCA 2DA4A 1WI3A 2LKXA 1XS9A 2E2HJ 2L0KA 1JT6A 1D5YA 3FK7A 1HDPA 3IV5A 1PUFB 2KDZA 5C4JJ 5EF6A 3CMYA 3PO2J 5GP9A 3HKZN 3TP0A 4IEJA 4M3BA 2NVQJ 2JWTA 3FISA 3TP3A 1ETKA 2YS9A 2R0QC 1NK3P 3I4MJ 5GPCA 3PO3J 1Z0XA 2L7ZA 1H89C 4A69C 1GV5A 1A6IA 3UKGA 3BT9A 2O9LA 2XPWA 1IUFA 2QCOA 2DA7A 4A3GJ 2K40A 5FKOA 4XICA 3S2HJ 1WPKA 2HXOA 2LK2A 1X58A 1ZGWA 2GLOA 2K9QA 1ENHA
chains in the Genus database with same CATH superfamily
1YS6A 3GFIA 3RYRA 3CCEI 2L7MP 1ACIA 2HNHA 1FSHA 1T95A 2K02A 4LFUA 3ELKA 1BIBA 3K10A 2COMA 1Y39A 3CO7C 1X19A 2QEXI 1WKMA 1ETOA 5E8GA 4RGUA 2CV1A 3RKYA 2PJPA 1HKSA 2KJCA 4HV5A 5LHIA 3MD2A 3VSKA 1VF9A 3K70D 1IDYA 4M73A 3GTGJ 4LG0B 2IEKA 2CFXA 3LNQA 2UXNA 4ZC3A 3CF5F 4I09A 4RB1A 2HYFA 4ZYHA 1S5LC 2E2JJ 3W2WA 4ENMA 3HOUJ 1EV7A 2EFPA 1RI7A 4O6JA 1S8NA 3ZRGA 1A6QA 3CMMA 4XRSG 3R60A 2E1MC 4I0AA 3IAS2 1MSFC 2DMTA 1K83J 3KEQA 4WX9A 4XLHA 2VBZA 1LFPA 1EF4A 2ZO4A 1QVTA 3M8EA 4X6AJ 4QSHA 5HDGA 2EBIA 3BZ6A 1I6XA 4M3DA 4MFEA 5D4RA 2DPUA 4M9ZA 1P4WA 3UNGC 5EG0B 2EZHA 2PMZN 4FE7A 1L3LA 4LD5A 4W97A 4DNCA 2ZJQF 4HG2A 3ASOH 3N97A 2PMHA 2HZDA 1RKTA 1T0FC 3CP2A 5CVUA 1AKHB 5A2QK 5HNFA 3HG9A 2ELHA 3PQJA 1V5GA 2HOAA 2ZMEC 1DPRA 3A01A 3TO9A 3PFYA 3QYBA 4PJJA 2VE8A 1T33A 4XNFA 2CRGA 2E1NA 2Y75A 2FRHA 4IHVA 4BAYA 3FZVA 3T0YA 2FJ1A 2H94A 2VL8A 1NG6A 4RM3A 3H36A 3SEQA 1T98A 1FBSA 1EJ9A 3QRFF 4R1HA 4AIDA 3HRUA 3OYFA 3A02A 4XLPF 4HSTA 5B66C 4BH9A 1QU3A 4HF2A 2A6TA 1JKRC 3OYBA 4E7KA 3JCUC 1SFOJ 1YI2I 4AIHA 5F27A 3PSIA 1IRGA 4FQGA 2E1CA 4MEXF 3K4JA 2HI3A 2JMWA 1Y1VJ 4I2OA 5E3LA 2OJED 4EJWA 4I98B 2V26A 2ZXHA 2IS6A 5E3NA 1IXRC 1XX5A 3HPHA 4B1RA 4NB5A 2PBIA 2LR8A 2XF5A 3ERMA 2E71A 1Z05A 1YRNB 1YW7A 3QYEA 3DLLF 2F5FA 2JRMA 3SHFA 3MEXA 2F5CA 3JRHA 1MMSA 4ENKA 5FB2A 5HOOA 2OV7A 2G7HA 4C2MJ 2WB1N 3ABMH 1XC5A 1HQCA 2V9PA 4W1UA 2G7UA 2WV1A 3FXRA 2HTSA 3DKXA 3V8KA 2H1KA 1UMQA 4M74A 3KETA 2DOEA 3FMSA 3QAHA 2WC2A 3Q0UA 2M87A 3I64A 4MIMA 3JSPA 2TDXA 3GFMA 4IO9F 2DA3A 1ZR4A 3A01B 3KFWX 2V79A 1UHWA 1DGWY 2X85A 2CYYA 4S0HB 3VPRA 3U2RA 4AD9A 3HB9A 3Q3SA 3S17J 3MAJA 5FROA 3ZQFA 4CSWA 2ZXJA 2NOGA 1F9NA 3KP5A 1YTYA 4OIQF 3D0SA 3DEWA 1MBGA 4N4NB 2HVRA 1Z91A 2F5EA 5HS7A 3V8JA 3ZQ7A 3E5QA 2W82A 2X1EA 5IT9K 5DYMA 2AS5F 2PJRA 3JAMZ 2R7UA 2P6SA 2VBWA 4PGHA 4IHYA 4MQVA 1SD6A 2CG4A 3NARA 5BPIA 3A4CA 3KYCB 2KT0A 3NRVA 2OD5A 5ILVA 3K69A 5E17F 1P92A 1MJ9A 1JHFA 4B8XA 5KHDA 4HX7A 1X4OA 1TTYA 1J5YA 4HLYA 3S15J 1M1EB 1DU6A 3RCOA 1FP2A 1RNLA 1SD4A 2M7BA 4XOTA 3GLXA 4ZYGA 3HPGA 4CYDA 4D0PA 2I10A 3C7JA 4BXXJ 4A12A 2M34A 2CV0A 3I58A 1H9TA 2KLOA 3BR2A 5EEHA 1S7AA 1R6RA 1Z21A 2JRTA 4HPQA 3QOEA 4NC6A 1K6YA 2FMYA 4MHGA 1IW7F 3H3UA 1TT5B 1RC9A 2DJNA 3CUQB 1RZ4A 4IVNA 5HLTA 3G4SI 4EGYA 2JJ7A 5IYDJ 4HF1A 4UY8I 4WF2A 2UWMA 3H35A 2VLAA 3GEZA 2ZJRF 4N0BA 4WXDA 3REOA 3RKWA 1JI8A 1SFEA 1SANA 3SJMA 3J7YJ 2V6EA 2HDCA 3HL2A 3OOUA 3JRDA 3CCQI 4GO1A 2W7NA 1XG1A 1GHCA 4G12A 3L2UA 1G2HA 1QVUA 1OYYA 4L0YB 1ZG1A 3VODA 3WGHA 5GTIC 3IC7A 3Q9VA 1ZG3A 2FXAA 4OAZA 2QSHX 3Q5FA 2LP0A 2DI3A 2FNAA 5HDKA 1J0RA 2QA4I 3FHZA 4KMFA 3E1SA 4ZTFA 2GBYA 2LKPA 1H88C 3ZQHA 3Q9SA 2Y0SN 1IRXA 4IZZA 1CF7A 5E1WA 2ISYA 2HYGD 2DQLA 2MH2A 3HXLA 3DU5A 3W3CA 5FLVA 1TQPA 4IX7A 4BQOA 4WK8F 2DO7A 2NRAC 2ZB9A 1E0EA 3F8NA 3SDBA 3CDHA 2E5ZA 3J7AO 3LA2A 2R7VA 1IN4A 3IH2A 5FKKA 2OQRA 1HKQA 3FM3A 4O3MA 2AQFA 1YRNA 4YG2F 3OIPA 3QODA 1SVMA 2A69F 4AVPA 5F0HA 3OYDA 2VJIA 1TW3A 3MCZA 1GDTA 3HOVJ 3Q0VA 2J5PA 2ISZA 4M71A 2FUG2 2Q1ZB 2X6OA 3J81K 4NUBA 5H20A 2C6YA 2V7FA 5ERIA 3F8FA 3HSRA 4KITB 4EEFG 1FWZA 1UZCA 2HKXA 2IW5A 3I4PA 5IP7J 4KDPA 4D9JA 1VQOI 1XCBA 1PDNC 1UG0A 5FJ8J 5LEJA 1QGPA 2KIUA 4XR6A 1QO0D 1B72A 4LJZF 2K27A 3K0LA 2E60A 4BQAA 4BKXA 2Z5UA 4QIWN 2R7SA 1WWXA 1Y8RB 2JSPA 2CWEA 2P8TA 3ML6A 4ZYEA 5IOYA 5IY5H 1JUMA 3J7ZI 1KQ0A 3VYSB 5D5VB 2EV5A 3F21A 4ITVA 1E17A 3CLQA 2M8GX 1SC7A 2XAJA 4G94A 2DMQA 2WTEA 1J2XA 2LFBA 2BVMA 1W5SA 3ZR8X 5A2QZ 2JTVA 5EZHA 4DJAA 4XK4A 2VBYA 4YFKF 2M9HA 2RQPA 2DMNA 1Y0UA 3C3WA 2LSOA 3BR5A 5E1ZB 3ERED 1F1ZA 2W84A 1RRJA 2W4SA 3OIOA 4P96A 2VJ5A 1ULYA 2XC7A 4U0VA 2X9DA 3OS0A 4RAFA 1UB9A 2ELJA 1YJWI 1W4MA 5DS9A 1AOYA 4JOMA 2ZJPF 1VQ8I 1F43A 4ENJA 1UJ8A 5AIQA 1VFCA 2HU9A 2HTJA 3J80Z 1P4XA 4MFDA 3SZPA 2CS3A 2RV8A 4DBRA 4PSWA 3NQOA 2ZJ2A 2VQLA 1D1AA 2EQRA 4QPOA 4QWQA 5F0FA 1P9QC 3IH4A 1N25A 3HOZJ 4XSXF 2DMUA 2Q8KA 2CUFA 1GVJA 4WXCA 3DKYA 2UZKA 5KK1A 1FEXA 2BY2A 5FKNA 3V8LA 5TJJA 1X1CA 2KKOA 1W5CC 1XGOA 5EGOA 2EA4A 2VQHA 2F2EA 1DGRM 4Y17A 2VPRA 3TEDA 5ILUA 1FMWA 3DXJF 4KIFA 1Y6IA 2O03A 2IS2A 4BJ6C 3OL4A 1MKMA 2OUMA 2IGKA 2VBXA 2OF7A 3HSEA 4EGZA 2LDUA 2VT3A 2KIQA 4XOPA 2CQNA 2DYRH 2E19A 2W57A 1LVKA 3AL0C 1MDMA 1P4AA 5TRDA 3WGIA 1FOKA 1TWFJ 1F5TA 2IGOA 2VT2A 3K2AA 2HQAA 4HNTA 1KYWA 1LDDA 1A04A 3V4GA 3DTEA 5M3MJ 1HBXG 4DQ2A 4L5EA 3GTQJ 4LOCA 3Q0WA 1JKOC 2PMZA 2JSCA 1U2WA 3GWZA 3PIOF 1XS9A 1OLTA 3CF2A 2LF7A 3CUOA 4ZYAA 3QPHA 1MJBA 1PUFB 1XGNA 3FXJA 2LRDA 1RIOH 3CMYA 3VYRB 2ZXIA 3WU2C 3H3ZA 3FX3A 3HKZA 3L2CA 1VQNI 2WA0A 2EPFA 3HOTA 2NVQJ 4HZFA 2JWTA 1YG2A 3GFLA 5DD4A 1YYVA 3H1CA 5GPCA 4CCJA 3CCLI 2A5YB 2L7ZA 4PK4A 1H89C 5IT9Z 3HHGA 3BROA 4PDKA 1K4TA 1WJBA 3OYIA 1I27A 2AXTC 4D1QA 3ROUA 1X1BA 3S2HJ 1K6OA 3WTTC 2DFEA 2DFIA 4PJ0C 2H27A 4PFPA 4IQJA 2KRFA 2GLOA 2K9QA 1BI3A 2A68F 1W0UA 3MFKA 2CGPA 1IN6A 2E1OA 2YUSA 4YFXF 1HW2A 3H5NA 2W24A 1U6GA 2K9LA 3DPUA 5HDNA 5ILSA 4IOCF 3K4NA 1X3WB 3JRAA 1IZ1A 2VN2A 4U7BA 2JA2A 1G6NA 2OAZA 4L9TA 1ONVA 2F6CA 3CJQB 4HX8A 1A31A 4BHCA 1ERDA 2JZYA 2DA1A 1I6HJ 1S29A 2N8GA 3ZN1A 4LLNA 3F0CA 5CVIA 2EFWA 1BJAA 1EH8A 4GFBA 1S7EA 2M4GA 2XB5A 5FLMJ 2DJIA 2O3FA 5E3OA 1LJ9A 1OQYA 3M4OJ 4BHPA 1BR4A 2NS0A 1FX7A 3ZQGA 3BG5A 4UUTA 2OTJI 5IYCJ 3CMEI 3BJOA 4A5MA 3BDDA 5B1AH 4GCVA 3S3NA 3S2WA 1GUUA 5FRMA 1MBJA 2KMUA 1OJLA 2RAEA 2FBKA 3LSHA 1K78B 2M3AA 2GXGA 5LRSA 2EK5A 3CC7I 2RDPA 4H0EA 3OYEA 3ZP5A 4WWCA 3GTOJ 2K3PA 4XONA 3FMQA 1R4MB 5M5XJ 2Y0MA 3S1MJ 3FM5A 4RB0A 5EYRA 1ZKGA 1E3OC 4FHTA 1E3HA 4U0WA 2K85A 1XGMA 2EIJH 2XB0X 3OYMA 4UUVA 3CJRB 1FIPA 2E34A 2L5QA 2Z99A 3ABUA 2V1XA 4LLGF 3A1YA 3TOBA 1LB2A 5DUIA 2XGCA 1Y56A 2ZSIB 1SAUA 2JN6A 4Q4ZF 2DFFA 5HLIA 4AIKA 2HQ5A 5GPAA 1OCPA 3MQ0A 1T38A 4KT6A 4I0BA 4HEA2 2CJJA 5AIPA 1WSUA 4BS9A 1YO5C 1FY7A 3FBNB 4J01A 4NC8A 3IUOA 3M9AA 2P6TA 4KYWA 1YHQI 2DFHA 2EWNA 2R7ZJ 1TWHJ 1Z3YA 3BTLA 4NQWB 2VXZA 1YE9A 2D2WA 2QQBA 2GWRA 5EGOB 1XB4A 5KNLA 5TISC 4FTHA 5DCFA 3HYIA 4DYQA 2QQAA 4RM2A 3QP6A 2L2OA 1NH3A 2IVMA 4KN7X 1Y8QB 2DT7B 3OIQA 2DMPA 4AYBA 1DDNA 3K4LA 2KFDA 4LGWA 4OIPF 1FJLA 2R92J 2MFZA 2QSFX 2OCCH 4A93J 1KQ9A 3DTKA 2XPVA 1J7KA 1D0XA 2CUEA 5K5RA 3HBLA 2QQ8A 1YLFA 1MMAA 2J5OA 4E7LA 1EA3A 2NXNB 3SFIA 4A6DA 5M5YJ 1D8KA 2HWVA 2O8XA 1B1BA 3BP8A 3F9KA 3BPXA 3V7CA 4V2GA 4E70A 4RBOA 2XV4S 2VONA 3BCAA 4YIIA 1T2KA 3BTJA 1D1BA 3OMYA 1X1DA 1V55H 3O3KA 2F5DA 1ETWA 2LH9A 1UELB 1IRZA 4NHJA 2VKHA 4G7ZF 2DPDA 3BR3A 2YSRA 1EH7A 1W1WE 2E5NA 1WHUA 3FXOA 3BR6A 2WY7Q 3PM1A 5IPAA 1MBEA 2VOOA 1K7AA 1HXDA 2DODA 5H6RA 1ZREA 1BC8C 2E1MB 3LSMA 3H92A 4AUXA 3CLOA 2F5VA 5J1YA 5EDNA 2HPIA 2FMLA 3BR0A 1XDSA 4XKCA 4EQQA 3CCJI 3OS2A 3QPSA 2CQKA 1Z1DA 3I59A 4XLCA 2X6XA 2L01A 4KUMA 5GAHJ 1HSTA 1UFMA 2XF7A 2G0EA 1IN8A 3QOPA 4FX4A 3QPLA 2UUZA 1KQ8A 1JUPA 3KP6A 4XORA 1LFUP 3V7SA 1MD0A 4XRFA 3ISPA 3K1PA 4ZJZA 2K9SA 5EEGA 3T1BA 4EM1A 2X6WA 3HTUA 3AAFA 1LQ1A 4OINF 2CUZA 1WQ2A 3ECHA 4LIVA 1Z6TA 2R7DA 4E7IA 4UNOA 2CU7A 4CCKA 1GT0C 4ZDPA 2BW3B 4ESJA 2RC4A 2IGNA 2DU9A 4CYCA 2FX0A 1LEBA 1KGSA 3DPLC 3JRFA 1LE8A 4BDZA 1YJNI 5D6FA 3NAUA 1QZEA 1IRFA 2BHYA 3W6KB 5JHFA 2XASA 2Z1DA 2R5YB 2P0WA 5LHHA 2QM3A 5EJCA 4AYBN 3KP4A 3SFZA 4C3HJ 1H8AC 1I50J 3TQNA 1JGGA 2YR2A 4GDFA 2K4JA 4M6VA 2QBYB 3O8HA 4JX4A 5K5QA 2HPMA 5F08A 5K7FA 1DUXC 3LSPA 3BTIA 1G4DA 2H8WA 2JVGA 3P5JA 1Z77A 4DYCA 3HDDA 5CVJA 2B9SA 2IGMA 4AIJA 3SZTA 1U8RA 2P7CB 1QHHD 3WG7H 1D0YA 4Y7NJ 4XMYA 1R5ID 2XPUA 1LFBA 1HOMA 2G9WA 4XLFA 2ZSHB 1MW7A 5E1XA 1FP1D 1HKTA 2M8EA 1WJFA 3BY6A 3L1PA 3VB2A 4HF0A 5BPDA 1DP3A 4RAGA 1QPMA 4IRIA 4LG3A 1Q1VA 5DTDA 3U9GA 1XSDA 2R7WA 1XPXA 4L5JA 2H09A 3IAM2 2KIMA 1I3QJ 1IDZA 3L2VA 3BG7A 1R5GA 2MABA 2PQ8A 3S1RJ 2D5VA 2E7WA 4MTDA 4L0ZB 1R49A 4HSRA 1VTNC 3VWBA 2MBFA 1ON1A 2VPLA 2IS4A 1ZGAA 4HV6A 2PEXA 4IRGA 2ECBA 3LA7A 4DYRA 2WWYA 3LAPA 2BBYA 2RN7A 2XGEA 3A0HC 2M0MA 1BL0A 1SFKA 3DBHB 2DYSH 4UXNA 2ZNYA 4FISA 5HVQC 3V42A 1U78A 3E0JB 3F8MA 3J7AY 4ZDOA 5F6FA 1ON2A 4KMUX 4EM0B 3TDZC 1MBKA 4KN4X 2M4KA 1SD5A 4LK1F 1R5HA 3F8CA 2QSGX 4KA4A 1VQMI 3FKJA 4A3BJ 4BQQA 3S93A 2VIXA 2VKEA 1XTAA 4RGSA 1FMVA 2STTA 4ZDLA 4ENNA 1S7OA 5D6EA 1MJAA 5IOZA 4XKBA 1RETA 3BJ6A 3H5RA 2H8RA 2QKLB 5DCMB 1LDJA 1QA6A 1W36D 1FYMA 3M8JA 2LY1A 4NDLA 2A07F 3DLAA 1Q1HA 4M3EA 3JAMK 1YIJI 1FT9A 3WU1B 1R7JA 3F3XA 2HDDA 1PYVA 3KZZA 1O3SA 2MD5A 3M3YJ 2BE5F 3CUQC 3EUKL 3KP3A 3FXKA 4OU0A 5E8IA 4FCYA 3KYDB 1LDKB 5FFZA 2Q0OA 4P9UA 3H0DA 1X3ZB 2FNPA 4M72A 2LKSA 4BEHA 2F4MB 1IN7A 4F55A 1B59A 3GCMA 5JVTA 3DBRB 4AC0A 5L3FA 2LF8A 2QENA 4I76A 1XGSA 4UUSA 1YIOA 2COBA 4Y33A 3KLOA 1YITI 4Z6YA 3EQLF 2MLKA 4BNCA 4HRIA 3GTLJ 4XLNF 2Z16A 3E7LA 1ZLKA 3GTJJ 2R93J 4I02A 5B5EC 5FLXK 2HXIA 4CYCB 2NNYA 3QU3A 1BIAA 1G59A 1XSVA 4L9VA 5LLQA 4E7JA 3BQZA 1FC3A 4J19A 2PG4A 1YQAA 1W36C 3PUBA 2VI6A 1HA8A 1OCOH 2L7FP 3OSGA 1D3YA 1MBFA 4ZYDA 2Y9ZA 1C0WA 3QQAA 4EJTA 3D5SC 3DKWA 3EUAA 2WY8Q 3WHCA 2KQRA 3CMAI 1ZG5A 4BY1J 1Z7UA 1MNMC 2R7FA 3BOQA 2L4MA 3EETA 1SFXA 3I5UA 2AQEA 3KIOA 2BYVE 3HHHA 4HX4A 4N9HA 4CICA 3MWMA 5H2FC 2GAUA 4V2FA 1I3AA 3MKWB 2MYSA 1KYZA 3HC7A 2L0KA 1JT6A 1BI2A 2ZBKA 1D5YA 4F3QA 1VQLI 5KVRA 2LYCA 4DBQA 3IKVA 2EFNA 3KP7A 1MMGA 1U5TA 2KDZA 5C4JJ 3C2GA 4KT5C 5J4VA 4P5OA 3CTAA 3L7WA 3JTHA 2BVLA 4M3BA 4M6XA 3WE3A 5HNHA 1IXCA 3TP3A 2P5LC 1D8JA 2YS9A 4HQMA 2R0QC 4CZCA 3I4MJ 1Z0XA 2IA1A 3DEUA 1OISA 1A6IA 1GV5A 2I5UA 3UKGA 2M5WA 3H9JA 4P1WA 1B9MA 2O9LA 4IJAA 2IPQX 3GXOA 5CLSA 2FQ3A 2QCOA 4C2UA 5FKOA 4XICA 1WPKA 3OY9A 3GZ6A 3D5LA 3H9QA 2LK2A 1X58A 1ZGWA 2KZGA 3CCMI 3QPTA 2K7LA 3K1MA 4LG0A 1ZGJA 2DQRA 2ID3A 3S32A 1POGA 4FT8A 2PN6A 1RUNA 1IJWC 4BU2A 1X2NA 3K9TA 2M30A 2B63J 2DXIA 3GBGA 3ESWB 2IXSA 4G8XA 4B43A 3RPUA 4G6TB 2W25A 3MKLA 3E3VA 1HW5A 2XRNA 4OAYA 4CA0A 2D1VA 2L9SA 1R71A 4HYEA 3JRIA 4BYYA 4HOBA 2VUMJ 4ABZA 2LBFA 4CXFA 5K1YA 3QWLA 1RR7A 4XKWA 3U1DA 3GTKJ 2A6EF 4HW0A 2LOOA 3BQYA 2NVUB 1YJ9I 2W1OA 2MH9A 1U8BA 1JKQC 2RNJA 3RDIA 4IQ4A 3MKYB 5HLHA 1IUYA 3RIRA 4MQ9F 4Y52J 1P7IA 1N78A 1KU9A 3OL3A 4EJUA 2EH3A 3G1MA 1ITYA 4PJLA 3F8BA 1G3TA 3BLYA 3FXQA 3KPHA 4BUPA 1WH5A 1PUEE 5L3CA 2IT0A 1H9GA 2DK5A 2PLYA 1T0FA 3PL8A 3AL0B 1ORKA 5DV5A 2ZXWH 5ICEA 2XGDA 2EFOA 4U87A 5BNGA 3VYTB 3HOYJ 1X2MA 3RPUD 1TQIA 1I39A 2RGVA 1Y1WJ 2P7VB 2H1LA 2X6YA 1FOWA 4IF4A 3WTSC 3JRGA 5L3BA 1FTTA 3FXLA 1QZZA 2NOJB 4G6QA 2V1DA 2QBYA 3UR3C 1AHDP 3PNTA 2DLLA 3DBLB 4RGXA 3RTRA 2R7OA 4M6YA 3PQKA 4GYIA 1OCTC 1APLC 4S04A 3CC2I 1TT0A 3P9KA 1FOXA 3SZGA 2NNNA 3DPTA 4U88A 2W48A 2O5RA 1ETVA 2A5WA 2VJJA 5JFRA 1J09A 5F64A 1RESA 3E97A 3ONQA 1ZRFA 1IF1A 2P5KA 1MSEC 3QP5A 1R22A 5E79C 3S3MA 3VYUB 5D8KB 5CVVA 4ETSA 2KISA 2HOTA 3S2DJ 2FF4A 3LSRA 3G71I 2L02A 3CJTB 5F1JA 3G6EI 1H0MA 2XAUA 4PUSA 3RQ4A 4Q5SF 2JA7J 5F1RA 5IP6A 2OA4A 3LA3A 3RYPA 4A0ZA 2P81A 3ZGKA 1NK2P 5B1BH 1ZK8A 1OCRH 1S9HA 2ESNA 3EYYA 3LFKA 4B47A 1WRJA 4RLFA 2BW3A 4D5FA 3I56I 3OYAA 1BW5A 1FLIA 3BG3A 3D5RC 2HEOA 4ZZLA 4HLXA 4LLLA 4EATA 1HC8A 3RQIA 2ID6A 4XBFA 2E7XA 3KX2A 3TW7A 5TGTA 2DDAA 1X4PA 4EVIA 2ZMEB 1O3QA 5FGMA 3F22A 2KDOA 1MIJA 2FOWA 3H9GA 2ACJA 3JR9A 4JBAA 5FRNA 1TL8A 3I4NJ 1YW9A 4A3EJ 1YOVB 5IT3A 2V6CA 4XL9A 1O3RA 2CH0A 4UV8A 3F6OA 3D1NI 2FQ4A 3W6VA 3S1NJ 2DA5A 1SD7A 5FKLA 4BDYA 4R79A 2GM4A 1PVEA 1B9NA 2R5ZA 4EJOA 3J81Z 1T56A 2BY3A 3TDUC 2XKOA 3CJNA 4XQFA 2I8DA 4Q48A 3JRCA 5E18F 1QQIA 2QUFA 2BEOA 3GMEA 1ZARA 3L9FA 3ZMSA 1BR1A 4AM3A 2CW8A 5ED4A 1K79A 3ZMDA 1LPQA 5J40A 3LSJA 3GO5A 1SFUA 4BE0A 2VQCA 3WGGA 5M5WJ 1I5ZA 4RS8A 1CQTA 3ZQIA 5BMZA 1K4SA 3LFUA 1S3JA 2KJBA 3MKZA 1A36A 2IA2A 2V1NA 4Y3OA 1NHAA 3HRMA 5L3GA 2LD5A 5FLXZ 4RDUA 5DD8A 2XRLA 2GA2A 3G1LA 4X1EA 2ZCWA 5FFXA 5GTHC 3LSIA 2E36A 3WTXC 3HRSA 3BJAA 2XKPA 2HDWA 1OYWA 4BY7J 2X1CA 1TWAJ 2FSWA 1IC8A 2Y31A 2VODA 2D45A 2R7XA 4AWXB 3S8PA 3TGNA 4A3FJ 1SVOA 1Y0NA 5D5UB 3V7RA 3LSTA 1ETYA 3DTIA 4BQNA 1STZA 3CP8A 2VC0A 1R4NB 2ME6A 1S6LA 5K7HA 4LB5A 1R00A 4HNUA 1VQ5I 2Y30A 4I99C 1YX3A 2DK8A 3KZYA 3B73A 1XMXA 1ZLJA 3PIPF 3OYHA 4LB6B 3JREA 2OQGA 3G73A 3K6GA 4UHTA 2JUGA 3WTZA 1LNWA 5JVGF 1ETQA 1W7PA 1ZTRA 3M8FA 4BE1A 3FIWA 1VQ7I 3M07A 4QTRA 3LOCA 4DGWB 2VE9A 2GXBA 1FBQA 3E6MA 3H5AA 3MZHA 2JA8J 3MMYB 2VOPA 2X0LA 4CZZA 3CUQA 4JQFA 5KAIC 1F36A 3SEZA 3SYTA 4MTEA 5E20A 1WI9A 4YFNF 2NVYJ 1FIAA 4Y13A 2GIVA 2KP6A 1OCZH 1HW1A 3BG9A 2QLZA 2L4AA 1E2XA 3EUHA 5DDGA 3AKZA 2VXDA 3ZMVA 4BL0B 2PFBA 5CQEA 5L3EA 2OBPA 3M1EA 3TO7A 1FZPB 1JTXA 4RGRA 4C3JJ 2NAZA 3FXUA 5C44J 1R36A 9ANTA 1I1SA 3G1OA 2RNGA 5L3DA 2K4BA 4XIDA 1OR7C 3R6SA 4V19K 3ZQLA 2ME0A 2DOFA 4BXUA 4IKFA 4NNJA 1TBXA 2HS5A 1BW6A 3RZDJ 4B4CA 5JI6A 3ZCOA 1JTYA 4YIRX 2A61A 2YPRA 3CDLA 1LUJB 2B7EA 4L18B 4LMYA 3F23A 2DCEA 3GTMJ 2IRFG 2M0CA 3HM5A 4IPAA 1IO2A 4RLQA 3FXMA 2ADUA 4PJMA 3GYHX 2IAIA 3HGGA 1OFCX 4C3IJ 4D5CA 3KYLA 1PP7U 3W6JB 4RMNA 3RKQA 3S3OA 3HUGA 4II2A 4MNUA 4ESFA 3GUDA 3QYFA 1NTCA 3SQNA 4XRSA 2HQRA 2EILH 3R0AA 3MVPA 4M9XA 4G7OF 1VQ4I 4EJVA 3WTVC 3L00A 1G3SA 1P7JA 2AHQA 3FKIJ 1W5TA 2WAFA 2XIGA 3I0TA 4AU7A 2CFOA 2IBDA 3TO6A 2UXXA 3A2KA 3ABLH 1DPUA 5H6QA 3OV8A 2IJLA 2QVOA 2QYOA 1JXSA 3IKTA 4B3XA 4KJZA 4F93B 1X3UA 2XDVA 3ZMTA 4CCNA 4B48A 2EINH 5BOXA 4XLEA 2HKOA 3DQVC 5EZGA 4IHWA 2O6GE 3C2HA 1AKHA 1IXSB 2FU4A 2EJRA 3LAJA 1YW8A 2KHMA 1ZRDA 5LHGA 3SDGA 4A3CJ 1MZBA 4JK1X 1VZ0A 3ZQQA 1UG2A 3CESA 3L09A 4MO7A 1OYIA 4ANJA 3HTSB 1R9TJ 3LQQA 5ICCA 2L7KA 4F92B 1R1TA 1V54H 3CD6I 4GGGA 3S1QJ 1K61A 2DW4A 3IHUA 1TQMA 4A3IJ 1O4XA 1O7FA 2KRCA 5CQGA 2MA3A 2DA6A 5J8FA 3ZMUA 3PJRA 2YU9J 4KIBA 1R1VA 2E2IJ 2MG4A 2EIMH 2HVSA 3IH3A 4JP0A 1SEUA 2LMDA 4I01A 3OOPA 2GA1A 2LNBA 2OTLI 1HF0A 4NC7A 4IL6C 4HDUA 2XROA 2IA0A 5ICFA 2ECCA 2O61A 2Y0SA 2Y9YA 4E7HA 3R61A 3R0JA 5D5WB 1NG7A 3HRTA 5C3EJ 2LREA 3G3ZA 2VASA 5M3FJ 4OIRF 4FE4A 4M3FA 1HCRA 3GX4X 1VQKI 1G3YA 4QLCU 4B09A 1KZHA 2DA4A 1WI3A 2QQ9A 4CCMA 5D4SA 1W7PD 3CDIA 4AVZA 2A3SA 1E3PA 3TBIA 1RR8C 2MC4A 2HZTA 3BZCA 2R7QA 1KA8A 2XGXA 3PO2J 3AG1H 2W00A 3HKZN 4IEJA 1PJRA 4KICA 2V9KA 5D8LB 3FISA 3GZNB 1NK3P 3PO3J 1WFXA 3K2ZA 3OR2C 4XM3A 2IP2A 4LITA 1T6SA 5LEKA 3BT9A 3OYGA 3L2RA 3QU6A 4H4KC 4CO8A 4ZH4F 1P6RA 2XHKA 1FYLA 3GLLA 3PFIA 4A3GJ 2K40A 2O0YA 2WADA 2KIFA 3BC8A 4WCGA 3K70C 2OU2A 1SAXA 1QBJA 3MZYA 1U5TB 4UVBA 3N4MA 4TV7A 1X1AA 1Z3XA 4B3AA 1A5JA 1J9IA 4O5VA 1GLNA 4PSXA 1UHSA 2L9VA 2HOEA 5D5XB 1BI1A 1GXPA 3T5XA 4BJ5C 3IP4B 1U9NA 2RVCA 5HODA 1FYKA 1FTZA 2YX7A 1OKRA 3PNVA 2FBIA 1U9OA 2R5YA 1TLHB 4BE2A 4UV9A 2EIKH 1JE8A 3K1NA 1B6AA 4F91B 3LWFA 2R4GA 3CCYA 1DP7P 3RPQA 2XSDC 1J59A 1IN5A 1AA7A 2YU3A 3IWZA 4IHTA 2WAQN 1IV8A 1XMKA 4CHUA 2DA2A 3B6CA 1RKWA 4F7ZA 2BXZA 4G9YA 2EZKA 3HJEA 4M3GA 5EG0A 5LGTA 4XLAA 1VQPI 2FBHA 4PZJA 3E5XA 4PGGA 2VJ4A 3SXYA 1O57A 1YFHA 1WGXA 2DTZA 1USTA 1SVLA 3GF2A 2QZ8A 2HVQA 4XN3A 1V5FA 1MNDA 3ZN0A 1JKPC 3BZKA 4MGRA 5LRRA 1WJ5A 3T8RA 1WJEA 4BACA 1D5VA 3FBIB 3BCBA 5DCMA 4S05A 3EYIA 4IXAA 2WBMA 5GADJ 4PJNA 1Z67A 5LFAA 2DT5A 3ZMZA 3CZ6A 2FE3A 4L5IA 2V9VA 3GTPJ 2EV0A 1QZYA 5GAEJ 2K9MA 1JJ8C 3CCVI 3PNYA 4HNVA 1I1GA 2JUCA 2X1DA 2XAFA 4Z2YA 2CMPA 1XCVA 4L9JA 4N4OB 1J75A 1G8XA 2HOSA 2RKHA 4RAYA 4E6KG 3HSFA 2B0LA 1KONA 1WJDA 1RPWA 2EB7A 2KRHA 2CQXA 3LSKA 4OMYA 2BY0A 2ELKA 3M7GA 3MZ8A 4GRIA 4HBLA 4CH7A 4CDGA 4HAMA 1LEAA 5DM7F 4CUGA 2XAHA 5LBQA 3BG6A 3WTYC 2M2EA 3DWLE 1BOBA 2EFQA 4EV0A 3P7NA 1RUOA 4HQEA 1VI0A 3BR1A 5GAGJ 4K2EA 3KEYA 2JVHA 4HDVA 2MSYA 3DF8A 5LD2C 3IRQA 2Q2EA 1TWGJ 3I9V2 2DAOA 1Z9CA 1R23A 2DT6A 2YX4A 3F6VA 4YEJA 3EUHC 2QGUA 1IGNA 1ZRCA 1BC7C 3OSFA 1ZYRF 3OYKA 2CV2A 5C4XJ 4MEYF 3ULQB 2WV0A 3FF5A 1GV2A 1D0ZA 3HEFA 2XSJC 2Z33A 1V5EA 3WHBA 4G7HF 3FWEA 2NS7A 1XDUA 2R5ZB 2PJRB 4BBRJ 2O7OA 4A5NA 4DOZA 5KAFC 1IG7A 2L3DA 3ECOA 2OZ6A 2NVXJ 4A3LJ 2FEZA 3JW4A 2X51A 2EA2A 2GZWA 4YIFA 1FBUA 2OCEA 2ZKZA 3EDPA 1ZELA 1JT0A 2VB6A 2KPMA 3GZ5A 2JT1A 2XF6A 4NQWA 5FD6A 3HOSA 4WXHA 1F4KA 3FK6A 2JK3A 2V4JC 5CKTA 2DBBA 3OYLA 2QWWA 5FD5A 4L9NA 1YS7A 4DZPA 2NVTJ 1Z6RA 4M9SA 2EZIA 4Q47A 3TW6A 2A6HF 4RB2C 1GVDA 1FSEA 3AG3H 5DUKA 3TOAA 4A3JJ 1JGSA 3IRRA 3BTCA 5HS9A 4ASNA 5FKMA 5KCMA 3JRBA 1MBHA 2Z2SB 5FO5A 1LKXA 1JUSA 1TWCJ 3VDXA 1OMIA 2ZNZA 4R8HA 2CUJA 4DIQA 4F52A 3CCRI 2X48A 5DEQA 5JHUA 2ESHA 4IHSA 4II3A 3OYCA 4EMSA 3HZJA 3E5UA 3TL4X 2TCTA 2JA6J 3LQRA 1HSJA 4JX5A 3BWGA 3MN2A 4KFCA 2PI0A 1HLVA 3E6DA 2UV1A 3E6BA 3RSNA 5HS8A 3G2BA 3GW2A 3I59B 3O6BB 5DM6F 2MW8A 2LTPA 3C2BA 4FX0A 2DTRA 2AXLA 2P5VA 2P4WA 2M1BA 4BEHB 1MMDA 2L54A 1W0TA 2ICWG 2R3SA 1BA5A 4BJTA 1LVAA 4C2TA 2LY2A 5J6XA 2EZLA 1U0JA 5BS6A 2GXAA 2Z9OA 2DDBA 1OR7A 1N75A 1WVRA 5J8CA 3T8TA 4A0YA 1ZQ3P 3HGYA 3E6CC 3S14J 1W7PB 3HUGB 1EKEA 1BR2A 2BOLA 2E35A 2HR3A 1LE8B 1SMYF 3N05A 2XUBA 1UAAA 3B02A 2JPBA 1WJAA 4IRHA 1KU2A 3VSLA 2HQNA 3H3VK 2WAEA 1B72B 2IS1A 4RB3C 4QPQA 3JTGA 2HGCA 1PP8F 1B8IA 3AFHA 3ASNH 3H0GJ 4HA8A 3LL7A 5J4YA 1MNEA 2OPTA 2NS8A 4IHXA 4OWRB 2HYJA 3IL2A 2GIZA 1ETXA 1P2FA 4I6ZA 3M1CA 1O3TA 4ZZDA 4A3KJ 2BGCA 5AONA 4EM2A 2BXYA 3R4KA 5ICGA 1D1CA 3CQZJ 2ETHA 2EV6A 5J1UA 2GQQA 3DP7A 3A03A 1QPIA 1REPC 3WG9A 2STWA 4OOIA 4B44A 2VC1A 4PFOA 4DW6A 2LVSA 3S16J 1GXQA 4YRVA 1U3EM 1IV6A 2MC3A 2PMUA 3NWTA 2QF7A 2ZC2A 3L2QA 2ZFUA 3K4CA 2BZTA 5CJ9A 4ON0A 1S72I 2VQGA 2FD5A 1O7LA 1TW2A 1WJCA 4BXFA 4A3DJ 2FOKA 2VKDA 3PUFA 4DZJA 1MMNA 4UVCA 1ZAOA 1R1UA 4RAZA 5K7ZA 1MH4A 4U7DA 2LG4A 2LY9A 1PUFA 1QRYA 4NBQA 1BOAA 1YX5A 3B6AA 4X0GA 1FPQA 1DQUA 1ZHFA 1FNNA 5EEAA 1USSA 4YELA 3VOEA 1FOYA 3VEPA 1X1PA 2XAQA 3CO6C 2KL4A 2KZVA 3C1DA 3ABKH 4JYKA 5JLXA 1T39A 4IOAF 3DU6A 4N9IA 2K3FA 3K7AJ 5IYBJ 3HIFA 1B4AA 1OPCA 5F04A 3I54A 4GXOA 4U0YA 1CGPA 2FA5A 4P9FA 2TRTA 4FETA 1ZN2A 4CGZA 4E4HA 2JQ7A 4GYGA 5JLWA 1MGTA 2MD0A 1HDDC 2A05A 1WCMJ 3I71A 4E7SA 1UHMA 3X2QH 3WU0A 1MH3A 3ZOBA 2VKVA 4J00A 3OYNA 1TNTA 3GVAA 1IAWA 2O8KA 4UB6C 2ZMEA 3I53A 3OR1C 4C30A 4C9YA 2GOXB 4ESBA 1XD7A 2ZFWA 3HOXJ 2MGQA 2BHZA 2F48A 3P9CA 3O8GA 3PSFA 4UB8C 2JA5J 2WB1A 4MLOA 4OMZA 3DEEA 2DN0A 4BHBA 5J3LA 2H6BA 5LGUA 3VFZA 3WTUC 1XMAA 3K4BA 1V3FA 2MLGA 1TP4A 2F4OB 5CVRA 5HLGA 4OIOF 1WZ2A 1VNDA 5LGNA 3BPVA 4XKVA 3ABTA 3DFGA 6PAXA 3LSGA 5CYVA 3FHNA 3W2AA 3HOWJ 4XN0A 2Q2EB 4I7HA 2K5CA 3K4KA 3FDYA 1AU7A 3K4MA 4E7ZA 1OCCH 2CQ7A 2K9NA 3DCFA 3KZIC 5J47A 1SMTA 2LLKA 4D7MA 1VQ9I 3GFJA 3RKXA 2OC6A 3IWFA 4KIGA 1G3WA 1JHHA 3NWSA 2M7AA 1BM9A 5CPRB 3TMOA 3RZOJ 2LC2A 3O2PE 2DOAA 3OYJA 2R7TA 1QHGA 1UCRA 1XSXA 3J80K 4XRMA 1BJZA 1ZR2A 3ZXSA 4Y4RA 1B8IB 4BGDA 1N77A 2AO9A 2BV6A 2CSOA 1K78A 2F4IA 3KEOA 2Z3YA 1QNTA 3W2VA 3RI4A 1ODDA 2HFHA 2RREA 2CW0F 4Y15A 3ZPLA 5E3MA 3OS1A 2WAQA 1ZH5A 3LMMA 1BI0A 4D7NA 3I55I 2PX9A 1KU7A 1TC3C 4JX6A 3U21A 1L0OC 2Y2ZA 3A0BC 4G6DA 4UUSB 1JJ6C 5B3SH 4LIUA 2CO5A 4XSZF 3DV8A 3KE2A 2CQQA 2W85A 1BN5A 4A0XA 1DU0A 5BQTA 1CF7B 1EH6A 4A3MJ 5J1RA 1KU3A 3COAC 5JR3A 3EPZA 5F0CA 3F72A 3I3LA 4CCOA 5K5OA 4A6EA 1Z7LA 2D1HA 2M45A 5IP9J 2GOMA 2BY1A 1AWCA 1T8IA 2K86A 4ZTJA 3TKYA 1WH7A 3RJPA 2L9RA 2RQQA 1XN7A 3P9IA 2R7RA 3CC4I 1TZLA 3ZQCA 2H6CA 2LKXA 4BBSJ 2E2HJ 4KNYA 3KP2A 3KLNA 1T08B 4KISA 3NEUA 1A35A 3FK7A 4P55A 4PCQA 1VQ6I 1HDPA 3JSOA 3IV5A 2XVCA 3U1KA 4UVAA 1MDMB 2JPCA 1TNSA 2CW7A 2Y48A 3AG4H 4A2UA 2V1UA 5EF6A 3AG2H 3OWTA 3WODF 3WTWC 5GP9A 3CCSI 3TP0A 2QKMB 3L2WA 3CCUI 1ETKA 4FASD 1V4RA 2OZUA 3FMRA 4RA2A 2NYXA 2L9NA 4A69C 2XPWA 1IUFA 3KCCA 3C18A 2DA7A 3WE2A 2Y69H 2XAGA 2HXOA 4CCLA 1R58A 4LK0F 1BBYA 2LBFB 2X4HA 1ENHA 1U5TC
chains in the Genus database with same CATH topology
4B3AA 1W0UA 1A5JA 2ID3A 2L7MP 2E1OA 2YUSA 1POGA 1UHSA 1IJWC 1X2NA 5HODA 1U9NA 1FTZA 2B63J 3GBGA 1ETOA 3JRAA 3MKLA 1U9OA 1VF9A 2R5YA 1IDYA 3GTGJ 3JRIA 2IEKA 3CCYA 3LNQA 4ABZA 2XSDC 2VUMJ 2DA1A 1I6HJ 1RR7A 2N8GA 3GTKJ 2WAQN 3F0CA 2E2JJ 2DA2A 3B6CA 1RKWA 4GFBA 3HOUJ 3BQYA 1S7EA 2EZKA 2XB5A 5FLMJ 4M3GA 5EG0A 5E3OA 3M4OJ 1U8BA 1JKQC 3ZQGA 4XRSG 4Y52J 1P7IA 3BG5A 4UUTA 1WGXA 2DTZA 2EH3A 3G1MA 5IYCJ 1MSFC 1ITYA 2DMTA 1K83J 1GUUA 1MBJA 1OJLA 1EF4A 2RAEA 1JKPC 1QVTA 1WH5A 4X6AJ 4QSHA 2EBIA 4M3DA 4MFEA 1ORKA 3GTOJ 2XGDA 5EG0B 2EZHA 2PMZN 4FE7A 5M5XJ 5BNGA 4W97A 3S1MJ 1RKTA 1X2MA 3HOYJ 5EYRA 1Y1WJ 1ZKGA 1E3OC 1AKHB 3GTPJ 2XB0X 3JRGA 1JJ8C 1FTTA 1FIPA 2HOAA 2XGCA 4HNVA 1AHDP 2JN6A 3A01A 1T33A 2HQ5A 2CRGA 1OCPA 5GPAA 4IHVA 2HOSA 2FJ1A 2CJJA 1OCTC 1APLC 2W48A 1RPWA 1ETVA 2CQXA 1RESA 2R7ZJ 1TWHJ 3BTLA 3A02A 2ELKA 1MSEC 1JKRC 5EGOB 4FTHA 4DYQA 1SFOJ 2HOTA 3S2DJ 5F27A 3LSRA 5F1JA 2M2EA 2HI3A 2DMPA 2JMWA 2JA7J 1Y1VJ 5E3LA 5IP6A 1VI0A 3BR1A 1FJLA 2R92J 2P81A 1NK2P 1ZK8A 5E3NA 2MSYA 4A93J 2XPVA 1TWGJ 4B1RA 4D5FA 2CUEA 3HBLA 1BW5A 2LR8A 3BG3A 1IGNA 1YRNB 3SFIA 5M5YJ 3OSFA 3RQIA 2ID6A 3JRHA 3TW7A 5C4XJ 4V2GA 1GV2A 4RBOA 3HEFA 4C2MJ 3WHBA 2WB1N 1XC5A 2NS7A 3BTJA 2R5ZB 4BBRJ 2O7OA 3JR9A 1IG7A 4W1UA 3I4NJ 2NVXJ 4A3LJ 2WV1A 4A3EJ 2H1KA 1ETWA 1UMQA 1IRZA 3Q0UA 4MIMA 3D1NI 3BR3A 2DA3A 2FQ4A 1ZR4A 3A01B 1JT0A 2DA5A 3W6VA 3S1NJ 5FKLA 3FK6A 4S0HB 2R5ZA 2JK3A 3BR6A 3VPRA 2GM4A 3PM1A 5IPAA 3HB9A 3Q3SA 1T56A 1MBEA 3S17J 3ZQFA 4DZPA 3JRCA 2NVTJ 2EZIA 4AUXA 3TW6A 2NOGA 1GVDA 4A3JJ 5J1YA 5EDNA 3BTCA 3BR0A 3DEWA 5FKMA 1MBGA 3JRBA 1MBHA 3QPSA 3LSJA 1JUSA 1TWCJ 5M5WJ 1CQTA 2X48A 3ZQIA 2G0EA 4IHYA 3QPLA 3NARA 1JUPA 2TCTA 2JA6J 1LFUP 4JX5A 2KT0A 2LD5A 3MN2A 4RDUA 1HLVA 2K9SA 2XRLA 3G1LA 4X1EA 2MW8A 2LTPA 3C2BA 3S15J 1DU6A 2CU7A 4BY7J 1GT0C 1TWAJ 1IC8A 2Y31A 1W0TA 1BA5A 4CYCA 2FX0A 4A3FJ 2I10A 4BXXJ 2EZLA 2M34A 3JRFA 1LE8A 3NAUA 3BR2A 1ETYA 2R5YB 1ZQ3P 3HGYA 3S14J 4AYBN 2ME6A 4C3HJ 5K7HA 2DJNA 1LE8B 1H8AC 2JJ7A 1I50J 2Y30A 1JGGA 5IYDJ 4M6VA 3H3VK 1B72B 3O8HA 4JX4A 3JREA 1SANA 3SJMA 5F08A 5K7FA 1B8IA 3OOUA 3H0GJ 3JRDA 3LSPA 3BTIA 1XG1A 1ETQA 1ZTRA 2OPTA 1Z77A 2NS8A 4G12A 3FIWA 4DYCA 1QVUA 3HDDA 4IHXA 4QTRA 2HYJA 3LOCA 1G2HA 4I6ZA 1ETXA 2JA8J 4A3KJ 4Y7NJ 2XPUA 1HOMA 1LFBA 3CQZJ 1F36A 5J1UA 3A03A 2LP0A 1QPIA 2NVYJ 1FIAA 3L1PA 4DW6A 3S16J 2GBYA 2LVSA 1H88C 3ZQHA 1IV6A 2Y0SN 1Q1VA 3BG9A 5DTDA 2QF7A 2FD5A 5FLVA 1I3QJ 2ZB9A 4A3DJ 1IDZA 4DZJA 1JTXA 4C3JJ 3IH2A 5FKKA 5K7ZA 3S1RJ 2D5VA 1MH4A 2LY9A 1PUFA 1QRYA 5C44J 1YRNA 3B6AA 9ANTA 3G1OA 5F0HA 5EEAA 4XIDA 1GDTA 3HOVJ 2ECBA 3Q0VA 3ZQLA 2ME0A 4DYRA 2X6OA 5JLXA 4JYKA 2XGEA 1BW6A 3RZDJ 3K7AJ 5IYBJ 4B4CA 1BL0A 5F04A 4EEFG 1JTYA 3CDLA 4FISA 2TRTA 5IP7J 5FJ8J 1U78A 3GTMJ 5JLWA 2M0CA 3HM5A 1HDDC 1MBKA 1WCMJ 1B72A 3HGGA 2IAIA 1OFCX 1MH3A 3ZOBA 2VKVA 4C3IJ 4D5CA 4BKXA 4QIWN 4A3BJ 3RKQA 2VKEA 2O8KA 5IOYA 3HOXJ 2MGQA 1JUMA 5IOZA 1RETA 1NTCA 2H8RA 3O8GA 4XRSA 2JA5J 3MVPA 4MLOA 2M8GX 2DN0A 5J3LA 4NDLA 2DMQA 2LFBA 1P7JA 2AHQA 4M3EA 3FKIJ 5EZHA 2HDDA 1VNDA 4XK4A 2M9HA 2DMNA 3M3YJ 4FCYA 3BR5A 3LSGA 3HOWJ 2IBDA 3OIOA 1AU7A 2X9DA 2K9NA 3DCFA 2LLKA 4D7MA 5DS9A 1F43A 1VFCA 4MFDA 3RZOJ 5EZGA 4IHWA 4AC0A 1AKHA 4I76A 2EQRA 5F0FA 3SDGA 4A3CJ 3IH4A 4XRMA 4UUSA 1BJZA 2COBA 3HOZJ 1UG2A 4MO7A 1ZR2A 1B8IB 2DMUA 2AO9A 2CUFA 1R9TJ 3GTLJ 1FEXA 3E7LA 2R93J 5FKNA 3GTJJ 3S1QJ 1K61A 5EGOA 2HXIA 4CYCB 4A3IJ 1O4XA 5E3MA 3TEDA 2VPRA 2DA6A 3BQZA 4D7NA 4J19A 2YU9J 2E2IJ 2VI6A 1TC3C 2MG4A 4JX6A 2L7FP 1JJ6C 2Y2ZA 3IH3A 4JP0A 1MBFA 4UUSB 3OSGA 2Y9ZA 2OF7A 3QQAA 2CQQA 1DU0A 3WHCA 1HF0A 4A3MJ 2E19A 5J1RA 2ECCA 4BY1J 1MNMC 2Y9YA 1TWFJ 5F0CA 3K2AA 5C3EJ 5M3MJ 5M3FJ 4L5EA 3GTQJ 4LOCA 5IP9J 4FE4A 3Q0WA 4M3FA 1JKOC 1HCRA 1WH7A 2L9RA 4V2FA 4BBSJ 3ZQCA 2DA4A 1WI3A 2LKXA 1XS9A 2E2HJ 2L0KA 1JT6A 1D5YA 3FK7A 1HDPA 3IV5A 1PUFB 2KDZA 5C4JJ 5EF6A 3CMYA 3PO2J 5GP9A 3HKZN 3TP0A 4IEJA 4M3BA 2NVQJ 2JWTA 3FISA 3TP3A 1ETKA 2YS9A 2R0QC 1NK3P 3I4MJ 5GPCA 3PO3J 1Z0XA 2L7ZA 1H89C 4A69C 1GV5A 1A6IA 3UKGA 3BT9A 2O9LA 2XPWA 1IUFA 2QCOA 2DA7A 4A3GJ 2K40A 5FKOA 4XICA 3S2HJ 1WPKA 2HXOA 2LK2A 1X58A 1ZGWA 2GLOA 2K9QA 1ENHA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4B3A A;  1W0U A;  1A5J A;  2ID3 A;  2L7M P;  2E1O A;  2YUS A;  1POG A;  1UHS A;  1IJW C;  1X2N A;  5HOD A;  1U9N A;  1FTZ A;  2B63 J;  3GBG A;  1ETO A;  3JRA A;  3MKL A;  1U9O A;  1VF9 A;  2R5Y A;  1IDY A;  3GTG J;  3JRI A;  2IEK A;  3CCY A;  3LNQ A;  4ABZ A;  2XSD C;  2VUM J;  2DA1 A;  1I6H J;  1RR7 A;  2N8G A;  3GTK J;  2WAQ N;  3F0C A;  2E2J J;  2DA2 A;  3B6C A;  1RKW A;  4GFB A;  3HOU J;  3BQY A;  1S7E A;  2EZK A;  2XB5 A;  5FLM J;  4M3G A;  5EG0 A;  5E3O A;  3M4O J;  1U8B A;  1JKQ C;  3ZQG A;  4XRS G;  4Y52 J;  1P7I A;  3BG5 A;  4UUT A;  1WGX A;  2DTZ A;  2EH3 A;  3G1M A;  5IYC J;  1MSF C;  1ITY A;  2DMT A;  1K83 J;  1GUU A;  1MBJ A;  1OJL A;  1EF4 A;  2RAE A;  1JKP C;  1QVT A;  1WH5 A;  4X6A J;  4QSH A;  2EBI A;  4M3D A;  4MFE A;  1ORK A;  3GTO J;  2XGD A;  5EG0 B;  2EZH A;  2PMZ N;  4FE7 A;  5M5X J;  5BNG A;  4W97 A;  3S1M J;  1RKT A;  1X2M A;  3HOY J;  5EYR A;  1Y1W J;  1ZKG A;  1E3O C;  1AKH B;  3GTP J;  2XB0 X;  3JRG A;  1JJ8 C;  1FTT A;  1FIP A;  2HOA A;  2XGC A;  4HNV A;  1AHD P;  2JN6 A;  3A01 A;  1T33 A;  2HQ5 A;  2CRG A;  1OCP A;  5GPA A;  4IHV A;  2HOS A;  2FJ1 A;  2CJJ A;  1OCT C;  1APL C;  2W48 A;  1RPW A;  1ETV A;  2CQX A;  1RES A;  2R7Z J;  1TWH J;  3BTL A;  3A02 A;  2ELK A;  1MSE C;  1JKR C;  5EGO B;  4FTH A;  4DYQ A;  1SFO J;  2HOT A;  3S2D J;  5F27 A;  3LSR A;  5F1J A;  2M2E A;  2HI3 A;  2DMP A;  2JMW A;  2JA7 J;  1Y1V J;  5E3L A;  5IP6 A;  1VI0 A;  3BR1 A;  1FJL A;  2R92 J;  2P81 A;  1NK2 P;  1ZK8 A;  5E3N A;  2MSY A;  4A93 J;  2XPV A;  1TWG J;  4B1R A;  4D5F A;  2CUE A;  3HBL A;  1BW5 A;  2LR8 A;  3BG3 A;  1IGN A;  1YRN B;  3SFI A;  5M5Y J;  3OSF A;  3RQI A;  2ID6 A;  3JRH A;  3TW7 A;  5C4X J;  4V2G A;  1GV2 A;  4RBO A;  3HEF A;  4C2M J;  3WHB A;  2WB1 N;  1XC5 A;  2NS7 A;  3BTJ A;  2R5Z B;  4BBR J;  2O7O A;  3JR9 A;  1IG7 A;  4W1U A;  3I4N J;  2NVX J;  4A3L J;  2WV1 A;  4A3E J;  2H1K A;  1ETW A;  1UMQ A;  1IRZ A;  3Q0U A;  4MIM A;  3D1N I;  3BR3 A;  2DA3 A;  2FQ4 A;  1ZR4 A;  3A01 B;  1JT0 A;  2DA5 A;  3W6V A;  3S1N J;  5FKL A;  3FK6 A;  4S0H B;  2R5Z A;  2JK3 A;  3BR6 A;  3VPR A;  2GM4 A;  3PM1 A;  5IPA A;  3HB9 A;  3Q3S A;  1T56 A;  1MBE A;  3S17 J;  3ZQF A;  4DZP A;  3JRC A;  2NVT J;  2EZI A;  4AUX A;  3TW6 A;  2NOG A;  1GVD A;  4A3J J;  5J1Y A;  5EDN A;  3BTC A;  3BR0 A;  3DEW A;  5FKM A;  1MBG A;  3JRB A;  1MBH A;  3QPS A;  3LSJ A;  1JUS A;  1TWC J;  5M5W J;  1CQT A;  2X48 A;  3ZQI A;  2G0E A;  4IHY A;  3QPL A;  3NAR A;  1JUP A;  2TCT A;  2JA6 J;  1LFU P;  4JX5 A;  2KT0 A;  2LD5 A;  3MN2 A;  4RDU A;  1HLV A;  2K9S A;  2XRL A;  3G1L A;  4X1E A;  2MW8 A;  2LTP A;  3C2B A;  3S15 J;  1DU6 A;  2CU7 A;  4BY7 J;  1GT0 C;  1TWA J;  1IC8 A;  2Y31 A;  1W0T A;  1BA5 A;  4CYC A;  2FX0 A;  4A3F J;  2I10 A;  4BXX J;  2EZL A;  2M34 A;  3JRF A;  1LE8 A;  3NAU A;  3BR2 A;  1ETY A;  2R5Y B;  1ZQ3 P;  3HGY A;  3S14 J;  4AYB N;  2ME6 A;  4C3H J;  5K7H A;  2DJN A;  1LE8 B;  1H8A C;  2JJ7 A;  1I50 J;  2Y30 A;  1JGG A;  5IYD J;  4M6V A;  3H3V K;  1B72 B;  3O8H A;  4JX4 A;  3JRE A;  1SAN A;  3SJM A;  5F08 A;  5K7F A;  1B8I A;  3OOU A;  3H0G J;  3JRD A;  3LSP A;  3BTI A;  1XG1 A;  1ETQ A;  1ZTR A;  2OPT A;  1Z77 A;  2NS8 A;  4G12 A;  3FIW A;  4DYC A;  1QVU A;  3HDD A;  4IHX A;  4QTR A;  2HYJ A;  3LOC A;  1G2H A;  4I6Z A;  1ETX A;  2JA8 J;  4A3K J;  4Y7N J;  2XPU A;  1HOM A;  1LFB A;  3CQZ J;  1F36 A;  5J1U A;  3A03 A;  2LP0 A;  1QPI A;  2NVY J;  1FIA A;  3L1P A;  4DW6 A;  3S16 J;  2GBY A;  2LVS A;  1H88 C;  3ZQH A;  1IV6 A;  2Y0S N;  1Q1V A;  3BG9 A;  5DTD A;  2QF7 A;  2FD5 A;  5FLV A;  1I3Q J;  2ZB9 A;  4A3D J;  1IDZ A;  4DZJ A;  1JTX A;  4C3J J;  3IH2 A;  5FKK A;  5K7Z A;  3S1R J;  2D5V A;  1MH4 A;  2LY9 A;  1PUF A;  1QRY A;  5C44 J;  1YRN A;  3B6A A;  9ANT A;  3G1O A;  5F0H A;  5EEA A;  4XID A;  1GDT A;  3HOV J;  2ECB A;  3Q0V A;  3ZQL A;  2ME0 A;  4DYR A;  2X6O A;  5JLX A;  4JYK A;  2XGE A;  1BW6 A;  3RZD J;  3K7A J;  5IYB J;  4B4C A;  1BL0 A;  5F04 A;  4EEF G;  1JTY A;  3CDL A;  4FIS A;  2TRT A;  5IP7 J;  5FJ8 J;  1U78 A;  3GTM J;  5JLW A;  2M0C A;  3HM5 A;  1HDD C;  1MBK A;  1WCM J;  1B72 A;  3HGG A;  2IAI A;  1OFC X;  1MH3 A;  3ZOB A;  2VKV A;  4C3I J;  4D5C A;  4BKX A;  4QIW N;  4A3B J;  3RKQ A;  2VKE A;  2O8K A;  5IOY A;  3HOX J;  2MGQ A;  1JUM A;  5IOZ A;  1RET A;  1NTC A;  2H8R A;  3O8G A;  4XRS A;  2JA5 J;  3MVP A;  4MLO A;  2M8G X;  2DN0 A;  5J3L A;  4NDL A;  2DMQ A;  2LFB A;  1P7J A;  2AHQ A;  4M3E A;  3FKI J;  5EZH A;  2HDD A;  1VND A;  4XK4 A;  2M9H A;  2DMN A;  3M3Y J;  4FCY A;  3BR5 A;  3LSG A;  3HOW J;  2IBD A;  3OIO A;  1AU7 A;  2X9D A;  2K9N A;  3DCF A;  2LLK A;  4D7M A;  5DS9 A;  1F43 A;  1VFC A;  4MFD A;  3RZO J;  5EZG A;  4IHW A;  4AC0 A;  1AKH A;  4I76 A;  2EQR A;  5F0F A;  3SDG A;  4A3C J;  3IH4 A;  4XRM A;  4UUS A;  1BJZ A;  2COB A;  3HOZ J;  1UG2 A;  4MO7 A;  1ZR2 A;  1B8I B;  2DMU A;  2AO9 A;  2CUF A;  1R9T J;  3GTL J;  1FEX A;  3E7L A;  2R93 J;  5FKN A;  3GTJ J;  3S1Q J;  1K61 A;  5EGO A;  2HXI A;  4CYC B;  4A3I J;  1O4X A;  5E3M A;  3TED A;  2VPR A;  2DA6 A;  3BQZ A;  4D7N A;  4J19 A;  2YU9 J;  2E2I J;  2VI6 A;  1TC3 C;  2MG4 A;  4JX6 A;  2L7F P;  1JJ6 C;  2Y2Z A;  3IH3 A;  4JP0 A;  1MBF A;  4UUS B;  3OSG A;  2Y9Z A;  2OF7 A;  3QQA A;  2CQQ A;  1DU0 A;  3WHC A;  1HF0 A;  4A3M J;  2E19 A;  5J1R A;  2ECC A;  4BY1 J;  1MNM C;  2Y9Y A;  1TWF J;  5F0C A;  3K2A A;  5C3E J;  5M3M J;  5M3F J;  4L5E A;  3GTQ J;  4LOC A;  5IP9 J;  4FE4 A;  3Q0W A;  4M3F A;  1JKO C;  1HCR A;  1WH7 A;  2L9R A;  4V2F A;  4BBS J;  3ZQC A;  2DA4 A;  1WI3 A;  2LKX A;  1XS9 A;  2E2H J;  2L0K A;  1JT6 A;  1D5Y A;  3FK7 A;  1HDP A;  3IV5 A;  1PUF B;  2KDZ A;  5C4J J;  5EF6 A;  3CMY A;  3PO2 J;  5GP9 A;  3HKZ N;  3TP0 A;  4IEJ A;  4M3B A;  2NVQ J;  2JWT A;  3FIS A;  3TP3 A;  1ETK A;  2YS9 A;  2R0Q C;  1NK3 P;  3I4M J;  5GPC A;  3PO3 J;  1Z0X A;  2L7Z A;  1H89 C;  4A69 C;  1GV5 A;  1A6I A;  3UKG A;  3BT9 A;  2O9L A;  2XPW A;  1IUF A;  2QCO A;  2DA7 A;  4A3G J;  2K40 A;  5FKO A;  4XIC A;  3S2H J;  1WPK A;  2HXO A;  2LK2 A;  1X58 A;  1ZGW A;  2GLO A;  2K9Q A;  1ENH A; 
#chains in the Genus database with same CATH topology
 1YS6 A;  3GFI A;  3RYR A;  3CCE I;  2L7M P;  1ACI A;  2HNH A;  1FSH A;  1T95 A;  2K02 A;  4LFU A;  3ELK A;  1BIB A;  3K10 A;  2COM A;  1Y39 A;  3CO7 C;  1X19 A;  2QEX I;  1WKM A;  1ETO A;  5E8G A;  4RGU A;  2CV1 A;  3RKY A;  2PJP A;  1HKS A;  2KJC A;  4HV5 A;  5LHI A;  3MD2 A;  3VSK A;  1VF9 A;  3K70 D;  1IDY A;  4M73 A;  3GTG J;  4LG0 B;  2IEK A;  2CFX A;  3LNQ A;  2UXN A;  4ZC3 A;  3CF5 F;  4I09 A;  4RB1 A;  2HYF A;  4ZYH A;  1S5L C;  2E2J J;  3W2W A;  4ENM A;  3HOU J;  1EV7 A;  2EFP A;  1RI7 A;  4O6J A;  1S8N A;  3ZRG A;  1A6Q A;  3CMM A;  4XRS G;  3R60 A;  2E1M C;  4I0A A;  3IAS 2;  1MSF C;  2DMT A;  1K83 J;  3KEQ A;  4WX9 A;  4XLH A;  2VBZ A;  1LFP A;  1EF4 A;  2ZO4 A;  1QVT A;  3M8E A;  4X6A J;  4QSH A;  5HDG A;  2EBI A;  3BZ6 A;  1I6X A;  4M3D A;  4MFE A;  5D4R A;  2DPU A;  4M9Z A;  1P4W A;  3UNG C;  5EG0 B;  2EZH A;  2PMZ N;  4FE7 A;  1L3L A;  4LD5 A;  4W97 A;  4DNC A;  2ZJQ F;  4HG2 A;  3ASO H;  3N97 A;  2PMH A;  2HZD A;  1RKT A;  1T0F C;  3CP2 A;  5CVU A;  1AKH B;  5A2Q K;  5HNF A;  3HG9 A;  2ELH A;  3PQJ A;  1V5G A;  2HOA A;  2ZME C;  1DPR A;  3A01 A;  3TO9 A;  3PFY A;  3QYB A;  4PJJ A;  2VE8 A;  1T33 A;  4XNF A;  2CRG A;  2E1N A;  2Y75 A;  2FRH A;  4IHV A;  4BAY A;  3FZV A;  3T0Y A;  2FJ1 A;  2H94 A;  2VL8 A;  1NG6 A;  4RM3 A;  3H36 A;  3SEQ A;  1T98 A;  1FBS A;  1EJ9 A;  3QRF F;  4R1H A;  4AID A;  3HRU A;  3OYF A;  3A02 A;  4XLP F;  4HST A;  5B66 C;  4BH9 A;  1QU3 A;  4HF2 A;  2A6T A;  1JKR C;  3OYB A;  4E7K A;  3JCU C;  1SFO J;  1YI2 I;  4AIH A;  5F27 A;  3PSI A;  1IRG A;  4FQG A;  2E1C A;  4MEX F;  3K4J A;  2HI3 A;  2JMW A;  1Y1V J;  4I2O A;  5E3L A;  2OJE D;  4EJW A;  4I98 B;  2V26 A;  2ZXH A;  2IS6 A;  5E3N A;  1IXR C;  1XX5 A;  3HPH A;  4B1R A;  4NB5 A;  2PBI A;  2LR8 A;  2XF5 A;  3ERM A;  2E71 A;  1Z05 A;  1YRN B;  1YW7 A;  3QYE A;  3DLL F;  2F5F A;  2JRM A;  3SHF A;  3MEX A;  2F5C A;  3JRH A;  1MMS A;  4ENK A;  5FB2 A;  5HOO A;  2OV7 A;  2G7H A;  4C2M J;  2WB1 N;  3ABM H;  1XC5 A;  1HQC A;  2V9P A;  4W1U A;  2G7U A;  2WV1 A;  3FXR A;  2HTS A;  3DKX A;  3V8K A;  2H1K A;  1UMQ A;  4M74 A;  3KET A;  2DOE A;  3FMS A;  3QAH A;  2WC2 A;  3Q0U A;  2M87 A;  3I64 A;  4MIM A;  3JSP A;  2TDX A;  3GFM A;  4IO9 F;  2DA3 A;  1ZR4 A;  3A01 B;  3KFW X;  2V79 A;  1UHW A;  1DGW Y;  2X85 A;  2CYY A;  4S0H B;  3VPR A;  3U2R A;  4AD9 A;  3HB9 A;  3Q3S A;  3S17 J;  3MAJ A;  5FRO A;  3ZQF A;  4CSW A;  2ZXJ A;  2NOG A;  1F9N A;  3KP5 A;  1YTY A;  4OIQ F;  3D0S A;  3DEW A;  1MBG A;  4N4N B;  2HVR A;  1Z91 A;  2F5E A;  5HS7 A;  3V8J A;  3ZQ7 A;  3E5Q A;  2W82 A;  2X1E A;  5IT9 K;  5DYM A;  2AS5 F;  2PJR A;  3JAM Z;  2R7U A;  2P6S A;  2VBW A;  4PGH A;  4IHY A;  4MQV A;  1SD6 A;  2CG4 A;  3NAR A;  5BPI A;  3A4C A;  3KYC B;  2KT0 A;  3NRV A;  2OD5 A;  5ILV A;  3K69 A;  5E17 F;  1P92 A;  1MJ9 A;  1JHF A;  4B8X A;  5KHD A;  4HX7 A;  1X4O A;  1TTY A;  1J5Y A;  4HLY A;  3S15 J;  1M1E B;  1DU6 A;  3RCO A;  1FP2 A;  1RNL A;  1SD4 A;  2M7B A;  4XOT A;  3GLX A;  4ZYG A;  3HPG A;  4CYD A;  4D0P A;  2I10 A;  3C7J A;  4BXX J;  4A12 A;  2M34 A;  2CV0 A;  3I58 A;  1H9T A;  2KLO A;  3BR2 A;  5EEH A;  1S7A A;  1R6R A;  1Z21 A;  2JRT A;  4HPQ A;  3QOE A;  4NC6 A;  1K6Y A;  2FMY A;  4MHG A;  1IW7 F;  3H3U A;  1TT5 B;  1RC9 A;  2DJN A;  3CUQ B;  1RZ4 A;  4IVN A;  5HLT A;  3G4S I;  4EGY A;  2JJ7 A;  5IYD J;  4HF1 A;  4UY8 I;  4WF2 A;  2UWM A;  3H35 A;  2VLA A;  3GEZ A;  2ZJR F;  4N0B A;  4WXD A;  3REO A;  3RKW A;  1JI8 A;  1SFE A;  1SAN A;  3SJM A;  3J7Y J;  2V6E A;  2HDC A;  3HL2 A;  3OOU A;  3JRD A;  3CCQ I;  4GO1 A;  2W7N A;  1XG1 A;  1GHC A;  4G12 A;  3L2U A;  1G2H A;  1QVU A;  1OYY A;  4L0Y B;  1ZG1 A;  3VOD A;  3WGH A;  5GTI C;  3IC7 A;  3Q9V A;  1ZG3 A;  2FXA A;  4OAZ A;  2QSH X;  3Q5F A;  2LP0 A;  2DI3 A;  2FNA A;  5HDK A;  1J0R A;  2QA4 I;  3FHZ A;  4KMF A;  3E1S A;  4ZTF A;  2GBY A;  2LKP A;  1H88 C;  3ZQH A;  3Q9S A;  2Y0S N;  1IRX A;  4IZZ A;  1CF7 A;  5E1W A;  2ISY A;  2HYG D;  2DQL A;  2MH2 A;  3HXL A;  3DU5 A;  3W3C A;  5FLV A;  1TQP A;  4IX7 A;  4BQO A;  4WK8 F;  2DO7 A;  2NRA C;  2ZB9 A;  1E0E A;  3F8N A;  3SDB A;  3CDH A;  2E5Z A;  3J7A O;  3LA2 A;  2R7V A;  1IN4 A;  3IH2 A;  5FKK A;  2OQR A;  1HKQ A;  3FM3 A;  4O3M A;  2AQF A;  1YRN A;  4YG2 F;  3OIP A;  3QOD A;  1SVM A;  2A69 F;  4AVP A;  5F0H A;  3OYD A;  2VJI A;  1TW3 A;  3MCZ A;  1GDT A;  3HOV J;  3Q0V A;  2J5P A;  2ISZ A;  4M71 A;  2FUG 2;  2Q1Z B;  2X6O A;  3J81 K;  4NUB A;  5H20 A;  2C6Y A;  2V7F A;  5ERI A;  3F8F A;  3HSR A;  4KIT B;  4EEF G;  1FWZ A;  1UZC A;  2HKX A;  2IW5 A;  3I4P A;  5IP7 J;  4KDP A;  4D9J A;  1VQO I;  1XCB A;  1PDN C;  1UG0 A;  5FJ8 J;  5LEJ A;  1QGP A;  2KIU A;  4XR6 A;  1QO0 D;  1B72 A;  4LJZ F;  2K27 A;  3K0L A;  2E60 A;  4BQA A;  4BKX A;  2Z5U A;  4QIW N;  2R7S A;  1WWX A;  1Y8R B;  2JSP A;  2CWE A;  2P8T A;  3ML6 A;  4ZYE A;  5IOY A;  5IY5 H;  1JUM A;  3J7Z I;  1KQ0 A;  3VYS B;  5D5V B;  2EV5 A;  3F21 A;  4ITV A;  1E17 A;  3CLQ A;  2M8G X;  1SC7 A;  2XAJ A;  4G94 A;  2DMQ A;  2WTE A;  1J2X A;  2LFB A;  2BVM A;  1W5S A;  3ZR8 X;  5A2Q Z;  2JTV A;  5EZH A;  4DJA A;  4XK4 A;  2VBY A;  4YFK F;  2M9H A;  2RQP A;  2DMN A;  1Y0U A;  3C3W A;  2LSO A;  3BR5 A;  5E1Z B;  3ERE D;  1F1Z A;  2W84 A;  1RRJ A;  2W4S A;  3OIO A;  4P96 A;  2VJ5 A;  1ULY A;  2XC7 A;  4U0V A;  2X9D A;  3OS0 A;  4RAF A;  1UB9 A;  2ELJ A;  1YJW I;  1W4M A;  5DS9 A;  1AOY A;  4JOM A;  2ZJP F;  1VQ8 I;  1F43 A;  4ENJ A;  1UJ8 A;  5AIQ A;  1VFC A;  2HU9 A;  2HTJ A;  3J80 Z;  1P4X A;  4MFD A;  3SZP A;  2CS3 A;  2RV8 A;  4DBR A;  4PSW A;  3NQO A;  2ZJ2 A;  2VQL A;  1D1A A;  2EQR A;  4QPO A;  4QWQ A;  5F0F A;  1P9Q C;  3IH4 A;  1N25 A;  3HOZ J;  4XSX F;  2DMU A;  2Q8K A;  2CUF A;  1GVJ A;  4WXC A;  3DKY A;  2UZK A;  5KK1 A;  1FEX A;  2BY2 A;  5FKN A;  3V8L A;  5TJJ A;  1X1C A;  2KKO A;  1W5C C;  1XGO A;  5EGO A;  2EA4 A;  2VQH A;  2F2E A;  1DGR M;  4Y17 A;  2VPR A;  3TED A;  5ILU A;  1FMW A;  3DXJ F;  4KIF A;  1Y6I A;  2O03 A;  2IS2 A;  4BJ6 C;  3OL4 A;  1MKM A;  2OUM A;  2IGK A;  2VBX A;  2OF7 A;  3HSE A;  4EGZ A;  2LDU A;  2VT3 A;  2KIQ A;  4XOP A;  2CQN A;  2DYR H;  2E19 A;  2W57 A;  1LVK A;  3AL0 C;  1MDM A;  1P4A A;  5TRD A;  3WGI A;  1FOK A;  1TWF J;  1F5T A;  2IGO A;  2VT2 A;  3K2A A;  2HQA A;  4HNT A;  1KYW A;  1LDD A;  1A04 A;  3V4G A;  3DTE A;  5M3M J;  1HBX G;  4DQ2 A;  4L5E A;  3GTQ J;  4LOC A;  3Q0W A;  1JKO C;  2PMZ A;  2JSC A;  1U2W A;  3GWZ A;  3PIO F;  1XS9 A;  1OLT A;  3CF2 A;  2LF7 A;  3CUO A;  4ZYA A;  3QPH A;  1MJB A;  1PUF B;  1XGN A;  3FXJ A;  2LRD A;  1RIO H;  3CMY A;  3VYR B;  2ZXI A;  3WU2 C;  3H3Z A;  3FX3 A;  3HKZ A;  3L2C A;  1VQN I;  2WA0 A;  2EPF A;  3HOT A;  2NVQ J;  4HZF A;  2JWT A;  1YG2 A;  3GFL A;  5DD4 A;  1YYV A;  3H1C A;  5GPC A;  4CCJ A;  3CCL I;  2A5Y B;  2L7Z A;  4PK4 A;  1H89 C;  5IT9 Z;  3HHG A;  3BRO A;  4PDK A;  1K4T A;  1WJB A;  3OYI A;  1I27 A;  2AXT C;  4D1Q A;  3ROU A;  1X1B A;  3S2H J;  1K6O A;  3WTT C;  2DFE A;  2DFI A;  4PJ0 C;  2H27 A;  4PFP A;  4IQJ A;  2KRF A;  2GLO A;  2K9Q A;  1BI3 A;  2A68 F;  1W0U A;  3MFK A;  2CGP A;  1IN6 A;  2E1O A;  2YUS A;  4YFX F;  1HW2 A;  3H5N A;  2W24 A;  1U6G A;  2K9L A;  3DPU A;  5HDN A;  5ILS A;  4IOC F;  3K4N A;  1X3W B;  3JRA A;  1IZ1 A;  2VN2 A;  4U7B A;  2JA2 A;  1G6N A;  2OAZ A;  4L9T A;  1ONV A;  2F6C A;  3CJQ B;  4HX8 A;  1A31 A;  4BHC A;  1ERD A;  2JZY A;  2DA1 A;  1I6H J;  1S29 A;  2N8G A;  3ZN1 A;  4LLN A;  3F0C A;  5CVI A;  2EFW A;  1BJA A;  1EH8 A;  4GFB A;  1S7E A;  2M4G A;  2XB5 A;  5FLM J;  2DJI A;  2O3F A;  5E3O A;  1LJ9 A;  1OQY A;  3M4O J;  4BHP A;  1BR4 A;  2NS0 A;  1FX7 A;  3ZQG A;  3BG5 A;  4UUT A;  2OTJ I;  5IYC J;  3CME I;  3BJO A;  4A5M A;  3BDD A;  5B1A H;  4GCV A;  3S3N A;  3S2W A;  1GUU A;  5FRM A;  1MBJ A;  2KMU A;  1OJL A;  2RAE A;  2FBK A;  3LSH A;  1K78 B;  2M3A A;  2GXG A;  5LRS A;  2EK5 A;  3CC7 I;  2RDP A;  4H0E A;  3OYE A;  3ZP5 A;  4WWC A;  3GTO J;  2K3P A;  4XON A;  3FMQ A;  1R4M B;  5M5X J;  2Y0M A;  3S1M J;  3FM5 A;  4RB0 A;  5EYR A;  1ZKG A;  1E3O C;  4FHT A;  1E3H A;  4U0W A;  2K85 A;  1XGM A;  2EIJ H;  2XB0 X;  3OYM A;  4UUV A;  3CJR B;  1FIP A;  2E34 A;  2L5Q A;  2Z99 A;  3ABU A;  2V1X A;  4LLG F;  3A1Y A;  3TOB A;  1LB2 A;  5DUI A;  2XGC A;  1Y56 A;  2ZSI B;  1SAU A;  2JN6 A;  4Q4Z F;  2DFF A;  5HLI A;  4AIK A;  2HQ5 A;  5GPA A;  1OCP A;  3MQ0 A;  1T38 A;  4KT6 A;  4I0B A;  4HEA 2;  2CJJ A;  5AIP A;  1WSU A;  4BS9 A;  1YO5 C;  1FY7 A;  3FBN B;  4J01 A;  4NC8 A;  3IUO A;  3M9A A;  2P6T A;  4KYW A;  1YHQ I;  2DFH A;  2EWN A;  2R7Z J;  1TWH J;  1Z3Y A;  3BTL A;  4NQW B;  2VXZ A;  1YE9 A;  2D2W A;  2QQB A;  2GWR A;  5EGO B;  1XB4 A;  5KNL A;  5TIS C;  4FTH A;  5DCF A;  3HYI A;  4DYQ A;  2QQA A;  4RM2 A;  3QP6 A;  2L2O A;  1NH3 A;  2IVM A;  4KN7 X;  1Y8Q B;  2DT7 B;  3OIQ A;  2DMP A;  4AYB A;  1DDN A;  3K4L A;  2KFD A;  4LGW A;  4OIP F;  1FJL A;  2R92 J;  2MFZ A;  2QSF X;  2OCC H;  4A93 J;  1KQ9 A;  3DTK A;  2XPV A;  1J7K A;  1D0X A;  2CUE A;  5K5R A;  3HBL A;  2QQ8 A;  1YLF A;  1MMA A;  2J5O A;  4E7L A;  1EA3 A;  2NXN B;  3SFI A;  4A6D A;  5M5Y J;  1D8K A;  2HWV A;  2O8X A;  1B1B A;  3BP8 A;  3F9K A;  3BPX A;  3V7C A;  4V2G A;  4E70 A;  4RBO A;  2XV4 S;  2VON A;  3BCA A;  4YII A;  1T2K A;  3BTJ A;  1D1B A;  3OMY A;  1X1D A;  1V55 H;  3O3K A;  2F5D A;  1ETW A;  2LH9 A;  1UEL B;  1IRZ A;  4NHJ A;  2VKH A;  4G7Z F;  2DPD A;  3BR3 A;  2YSR A;  1EH7 A;  1W1W E;  2E5N A;  1WHU A;  3FXO A;  3BR6 A;  2WY7 Q;  3PM1 A;  5IPA A;  1MBE A;  2VOO A;  1K7A A;  1HXD A;  2DOD A;  5H6R A;  1ZRE A;  1BC8 C;  2E1M B;  3LSM A;  3H92 A;  4AUX A;  3CLO A;  2F5V A;  5J1Y A;  5EDN A;  2HPI A;  2FML A;  3BR0 A;  1XDS A;  4XKC A;  4EQQ A;  3CCJ I;  3OS2 A;  3QPS A;  2CQK A;  1Z1D A;  3I59 A;  4XLC A;  2X6X A;  2L01 A;  4KUM A;  5GAH J;  1HST A;  1UFM A;  2XF7 A;  2G0E A;  1IN8 A;  3QOP A;  4FX4 A;  3QPL A;  2UUZ A;  1KQ8 A;  1JUP A;  3KP6 A;  4XOR A;  1LFU P;  3V7S A;  1MD0 A;  4XRF A;  3ISP A;  3K1P A;  4ZJZ A;  2K9S A;  5EEG A;  3T1B A;  4EM1 A;  2X6W A;  3HTU A;  3AAF A;  1LQ1 A;  4OIN F;  2CUZ A;  1WQ2 A;  3ECH A;  4LIV A;  1Z6T A;  2R7D A;  4E7I A;  4UNO A;  2CU7 A;  4CCK A;  1GT0 C;  4ZDP A;  2BW3 B;  4ESJ A;  2RC4 A;  2IGN A;  2DU9 A;  4CYC A;  2FX0 A;  1LEB A;  1KGS A;  3DPL C;  3JRF A;  1LE8 A;  4BDZ A;  1YJN I;  5D6F A;  3NAU A;  1QZE A;  1IRF A;  2BHY A;  3W6K B;  5JHF A;  2XAS A;  2Z1D A;  2R5Y B;  2P0W A;  5LHH A;  2QM3 A;  5EJC A;  4AYB N;  3KP4 A;  3SFZ A;  4C3H J;  1H8A C;  1I50 J;  3TQN A;  1JGG A;  2YR2 A;  4GDF A;  2K4J A;  4M6V A;  2QBY B;  3O8H A;  4JX4 A;  5K5Q A;  2HPM A;  5F08 A;  5K7F A;  1DUX C;  3LSP A;  3BTI A;  1G4D A;  2H8W A;  2JVG A;  3P5J A;  1Z77 A;  4DYC A;  3HDD A;  5CVJ A;  2B9S A;  2IGM A;  4AIJ A;  3SZT A;  1U8R A;  2P7C B;  1QHH D;  3WG7 H;  1D0Y A;  4Y7N J;  4XMY A;  1R5I D;  2XPU A;  1LFB A;  1HOM A;  2G9W A;  4XLF A;  2ZSH B;  1MW7 A;  5E1X A;  1FP1 D;  1HKT A;  2M8E A;  1WJF A;  3BY6 A;  3L1P A;  3VB2 A;  4HF0 A;  5BPD A;  1DP3 A;  4RAG A;  1QPM A;  4IRI A;  4LG3 A;  1Q1V A;  5DTD A;  3U9G A;  1XSD A;  2R7W A;  1XPX A;  4L5J A;  2H09 A;  3IAM 2;  2KIM A;  1I3Q J;  1IDZ A;  3L2V A;  3BG7 A;  1R5G A;  2MAB A;  2PQ8 A;  3S1R J;  2D5V A;  2E7W A;  4MTD A;  4L0Z B;  1R49 A;  4HSR A;  1VTN C;  3VWB A;  2MBF A;  1ON1 A;  2VPL A;  2IS4 A;  1ZGA A;  4HV6 A;  2PEX A;  4IRG A;  2ECB A;  3LA7 A;  4DYR A;  2WWY A;  3LAP A;  2BBY A;  2RN7 A;  2XGE A;  3A0H C;  2M0M A;  1BL0 A;  1SFK A;  3DBH B;  2DYS H;  4UXN A;  2ZNY A;  4FIS A;  5HVQ C;  3V42 A;  1U78 A;  3E0J B;  3F8M A;  3J7A Y;  4ZDO A;  5F6F A;  1ON2 A;  4KMU X;  4EM0 B;  3TDZ C;  1MBK A;  4KN4 X;  2M4K A;  1SD5 A;  4LK1 F;  1R5H A;  3F8C A;  2QSG X;  4KA4 A;  1VQM I;  3FKJ A;  4A3B J;  4BQQ A;  3S93 A;  2VIX A;  2VKE A;  1XTA A;  4RGS A;  1FMV A;  2STT A;  4ZDL A;  4ENN A;  1S7O A;  5D6E A;  1MJA A;  5IOZ A;  4XKB A;  1RET A;  3BJ6 A;  3H5R A;  2H8R A;  2QKL B;  5DCM B;  1LDJ A;  1QA6 A;  1W36 D;  1FYM A;  3M8J A;  2LY1 A;  4NDL A;  2A07 F;  3DLA A;  1Q1H A;  4M3E A;  3JAM K;  1YIJ I;  1FT9 A;  3WU1 B;  1R7J A;  3F3X A;  2HDD A;  1PYV A;  3KZZ A;  1O3S A;  2MD5 A;  3M3Y J;  2BE5 F;  3CUQ C;  3EUK L;  3KP3 A;  3FXK A;  4OU0 A;  5E8I A;  4FCY A;  3KYD B;  1LDK B;  5FFZ A;  2Q0O A;  4P9U A;  3H0D A;  1X3Z B;  2FNP A;  4M72 A;  2LKS A;  4BEH A;  2F4M B;  1IN7 A;  4F55 A;  1B59 A;  3GCM A;  5JVT A;  3DBR B;  4AC0 A;  5L3F A;  2LF8 A;  2QEN A;  4I76 A;  1XGS A;  4UUS A;  1YIO A;  2COB A;  4Y33 A;  3KLO A;  1YIT I;  4Z6Y A;  3EQL F;  2MLK A;  4BNC A;  4HRI A;  3GTL J;  4XLN F;  2Z16 A;  3E7L A;  1ZLK A;  3GTJ J;  2R93 J;  4I02 A;  5B5E C;  5FLX K;  2HXI A;  4CYC B;  2NNY A;  3QU3 A;  1BIA A;  1G59 A;  1XSV A;  4L9V A;  5LLQ A;  4E7J A;  3BQZ A;  1FC3 A;  4J19 A;  2PG4 A;  1YQA A;  1W36 C;  3PUB A;  2VI6 A;  1HA8 A;  1OCO H;  2L7F P;  3OSG A;  1D3Y A;  1MBF A;  4ZYD A;  2Y9Z A;  1C0W A;  3QQA A;  4EJT A;  3D5S C;  3DKW A;  3EUA A;  2WY8 Q;  3WHC A;  2KQR A;  3CMA I;  1ZG5 A;  4BY1 J;  1Z7U A;  1MNM C;  2R7F A;  3BOQ A;  2L4M A;  3EET A;  1SFX A;  3I5U A;  2AQE A;  3KIO A;  2BYV E;  3HHH A;  4HX4 A;  4N9H A;  4CIC A;  3MWM A;  5H2F C;  2GAU A;  4V2F A;  1I3A A;  3MKW B;  2MYS A;  1KYZ A;  3HC7 A;  2L0K A;  1JT6 A;  1BI2 A;  2ZBK A;  1D5Y A;  4F3Q A;  1VQL I;  5KVR A;  2LYC A;  4DBQ A;  3IKV A;  2EFN A;  3KP7 A;  1MMG A;  1U5T A;  2KDZ A;  5C4J J;  3C2G A;  4KT5 C;  5J4V A;  4P5O A;  3CTA A;  3L7W A;  3JTH A;  2BVL A;  4M3B A;  4M6X A;  3WE3 A;  5HNH A;  1IXC A;  3TP3 A;  2P5L C;  1D8J A;  2YS9 A;  4HQM A;  2R0Q C;  4CZC A;  3I4M J;  1Z0X A;  2IA1 A;  3DEU A;  1OIS A;  1A6I A;  1GV5 A;  2I5U A;  3UKG A;  2M5W A;  3H9J A;  4P1W A;  1B9M A;  2O9L A;  4IJA A;  2IPQ X;  3GXO A;  5CLS A;  2FQ3 A;  2QCO A;  4C2U A;  5FKO A;  4XIC A;  1WPK A;  3OY9 A;  3GZ6 A;  3D5L A;  3H9Q A;  2LK2 A;  1X58 A;  1ZGW A;  2KZG A;  3CCM I;  3QPT A;  2K7L A;  3K1M A;  4LG0 A;  1ZGJ A;  2DQR A;  2ID3 A;  3S32 A;  1POG A;  4FT8 A;  2PN6 A;  1RUN A;  1IJW C;  4BU2 A;  1X2N A;  3K9T A;  2M30 A;  2B63 J;  2DXI A;  3GBG A;  3ESW B;  2IXS A;  4G8X A;  4B43 A;  3RPU A;  4G6T B;  2W25 A;  3MKL A;  3E3V A;  1HW5 A;  2XRN A;  4OAY A;  4CA0 A;  2D1V A;  2L9S A;  1R71 A;  4HYE A;  3JRI A;  4BYY A;  4HOB A;  2VUM J;  4ABZ A;  2LBF A;  4CXF A;  5K1Y A;  3QWL A;  1RR7 A;  4XKW A;  3U1D A;  3GTK J;  2A6E F;  4HW0 A;  2LOO A;  3BQY A;  2NVU B;  1YJ9 I;  2W1O A;  2MH9 A;  1U8B A;  1JKQ C;  2RNJ A;  3RDI A;  4IQ4 A;  3MKY B;  5HLH A;  1IUY A;  3RIR A;  4MQ9 F;  4Y52 J;  1P7I A;  1N78 A;  1KU9 A;  3OL3 A;  4EJU A;  2EH3 A;  3G1M A;  1ITY A;  4PJL A;  3F8B A;  1G3T A;  3BLY A;  3FXQ A;  3KPH A;  4BUP A;  1WH5 A;  1PUE E;  5L3C A;  2IT0 A;  1H9G A;  2DK5 A;  2PLY A;  1T0F A;  3PL8 A;  3AL0 B;  1ORK A;  5DV5 A;  2ZXW H;  5ICE A;  2XGD A;  2EFO A;  4U87 A;  5BNG A;  3VYT B;  3HOY J;  1X2M A;  3RPU D;  1TQI A;  1I39 A;  2RGV A;  1Y1W J;  2P7V B;  2H1L A;  2X6Y A;  1FOW A;  4IF4 A;  3WTS C;  3JRG A;  5L3B A;  1FTT A;  3FXL A;  1QZZ A;  2NOJ B;  4G6Q A;  2V1D A;  2QBY A;  3UR3 C;  1AHD P;  3PNT A;  2DLL A;  3DBL B;  4RGX A;  3RTR A;  2R7O A;  4M6Y A;  3PQK A;  4GYI A;  1OCT C;  1APL C;  4S04 A;  3CC2 I;  1TT0 A;  3P9K A;  1FOX A;  3SZG A;  2NNN A;  3DPT A;  4U88 A;  2W48 A;  2O5R A;  1ETV A;  2A5W A;  2VJJ A;  5JFR A;  1J09 A;  5F64 A;  1RES A;  3E97 A;  3ONQ A;  1ZRF A;  1IF1 A;  2P5K A;  1MSE C;  3QP5 A;  1R22 A;  5E79 C;  3S3M A;  3VYU B;  5D8K B;  5CVV A;  4ETS A;  2KIS A;  2HOT A;  3S2D J;  2FF4 A;  3LSR A;  3G71 I;  2L02 A;  3CJT B;  5F1J A;  3G6E I;  1H0M A;  2XAU A;  4PUS A;  3RQ4 A;  4Q5S F;  2JA7 J;  5F1R A;  5IP6 A;  2OA4 A;  3LA3 A;  3RYP A;  4A0Z A;  2P81 A;  3ZGK A;  1NK2 P;  5B1B H;  1ZK8 A;  1OCR H;  1S9H A;  2ESN A;  3EYY A;  3LFK A;  4B47 A;  1WRJ A;  4RLF A;  2BW3 A;  4D5F A;  3I56 I;  3OYA A;  1BW5 A;  1FLI A;  3BG3 A;  3D5R C;  2HEO A;  4ZZL A;  4HLX A;  4LLL A;  4EAT A;  1HC8 A;  3RQI A;  2ID6 A;  4XBF A;  2E7X A;  3KX2 A;  3TW7 A;  5TGT A;  2DDA A;  1X4P A;  4EVI A;  2ZME B;  1O3Q A;  5FGM A;  3F22 A;  2KDO A;  1MIJ A;  2FOW A;  3H9G A;  2ACJ A;  3JR9 A;  4JBA A;  5FRN A;  1TL8 A;  3I4N J;  1YW9 A;  4A3E J;  1YOV B;  5IT3 A;  2V6C A;  4XL9 A;  1O3R A;  2CH0 A;  4UV8 A;  3F6O A;  3D1N I;  2FQ4 A;  3W6V A;  3S1N J;  2DA5 A;  1SD7 A;  5FKL A;  4BDY A;  4R79 A;  2GM4 A;  1PVE A;  1B9N A;  2R5Z A;  4EJO A;  3J81 Z;  1T56 A;  2BY3 A;  3TDU C;  2XKO A;  3CJN A;  4XQF A;  2I8D A;  4Q48 A;  3JRC A;  5E18 F;  1QQI A;  2QUF A;  2BEO A;  3GME A;  1ZAR A;  3L9F A;  3ZMS A;  1BR1 A;  4AM3 A;  2CW8 A;  5ED4 A;  1K79 A;  3ZMD A;  1LPQ A;  5J40 A;  3LSJ A;  3GO5 A;  1SFU A;  4BE0 A;  2VQC A;  3WGG A;  5M5W J;  1I5Z A;  4RS8 A;  1CQT A;  3ZQI A;  5BMZ A;  1K4S A;  3LFU A;  1S3J A;  2KJB A;  3MKZ A;  1A36 A;  2IA2 A;  2V1N A;  4Y3O A;  1NHA A;  3HRM A;  5L3G A;  2LD5 A;  5FLX Z;  4RDU A;  5DD8 A;  2XRL A;  2GA2 A;  3G1L A;  4X1E A;  2ZCW A;  5FFX A;  5GTH C;  3LSI A;  2E36 A;  3WTX C;  3HRS A;  3BJA A;  2XKP A;  2HDW A;  1OYW A;  4BY7 J;  2X1C A;  1TWA J;  2FSW A;  1IC8 A;  2Y31 A;  2VOD A;  2D45 A;  2R7X A;  4AWX B;  3S8P A;  3TGN A;  4A3F J;  1SVO A;  1Y0N A;  5D5U B;  3V7R A;  3LST A;  1ETY A;  3DTI A;  4BQN A;  1STZ A;  3CP8 A;  2VC0 A;  1R4N B;  2ME6 A;  1S6L A;  5K7H A;  4LB5 A;  1R00 A;  4HNU A;  1VQ5 I;  2Y30 A;  4I99 C;  1YX3 A;  2DK8 A;  3KZY A;  3B73 A;  1XMX A;  1ZLJ A;  3PIP F;  3OYH A;  4LB6 B;  3JRE A;  2OQG A;  3G73 A;  3K6G A;  4UHT A;  2JUG A;  3WTZ A;  1LNW A;  5JVG F;  1ETQ A;  1W7P A;  1ZTR A;  3M8F A;  4BE1 A;  3FIW A;  1VQ7 I;  3M07 A;  4QTR A;  3LOC A;  4DGW B;  2VE9 A;  2GXB A;  1FBQ A;  3E6M A;  3H5A A;  3MZH A;  2JA8 J;  3MMY B;  2VOP A;  2X0L A;  4CZZ A;  3CUQ A;  4JQF A;  5KAI C;  1F36 A;  3SEZ A;  3SYT A;  4MTE A;  5E20 A;  1WI9 A;  4YFN F;  2NVY J;  1FIA A;  4Y13 A;  2GIV A;  2KP6 A;  1OCZ H;  1HW1 A;  3BG9 A;  2QLZ A;  2L4A A;  1E2X A;  3EUH A;  5DDG A;  3AKZ A;  2VXD A;  3ZMV A;  4BL0 B;  2PFB A;  5CQE A;  5L3E A;  2OBP A;  3M1E A;  3TO7 A;  1FZP B;  1JTX A;  4RGR A;  4C3J J;  2NAZ A;  3FXU A;  5C44 J;  1R36 A;  9ANT A;  1I1S A;  3G1O A;  2RNG A;  5L3D A;  2K4B A;  4XID A;  1OR7 C;  3R6S A;  4V19 K;  3ZQL A;  2ME0 A;  2DOF A;  4BXU A;  4IKF A;  4NNJ A;  1TBX A;  2HS5 A;  1BW6 A;  3RZD J;  4B4C A;  5JI6 A;  3ZCO A;  1JTY A;  4YIR X;  2A61 A;  2YPR A;  3CDL A;  1LUJ B;  2B7E A;  4L18 B;  4LMY A;  3F23 A;  2DCE A;  3GTM J;  2IRF G;  2M0C A;  3HM5 A;  4IPA A;  1IO2 A;  4RLQ A;  3FXM A;  2ADU A;  4PJM A;  3GYH X;  2IAI A;  3HGG A;  1OFC X;  4C3I J;  4D5C A;  3KYL A;  1PP7 U;  3W6J B;  4RMN A;  3RKQ A;  3S3O A;  3HUG A;  4II2 A;  4MNU A;  4ESF A;  3GUD A;  3QYF A;  1NTC A;  3SQN A;  4XRS A;  2HQR A;  2EIL H;  3R0A A;  3MVP A;  4M9X A;  4G7O F;  1VQ4 I;  4EJV A;  3WTV C;  3L00 A;  1G3S A;  1P7J A;  2AHQ A;  3FKI J;  1W5T A;  2WAF A;  2XIG A;  3I0T A;  4AU7 A;  2CFO A;  2IBD A;  3TO6 A;  2UXX A;  3A2K A;  3ABL H;  1DPU A;  5H6Q A;  3OV8 A;  2IJL A;  2QVO A;  2QYO A;  1JXS A;  3IKT A;  4B3X A;  4KJZ A;  4F93 B;  1X3U A;  2XDV A;  3ZMT A;  4CCN A;  4B48 A;  2EIN H;  5BOX A;  4XLE A;  2HKO A;  3DQV C;  5EZG A;  4IHW A;  2O6G E;  3C2H A;  1AKH A;  1IXS B;  2FU4 A;  2EJR A;  3LAJ A;  1YW8 A;  2KHM A;  1ZRD A;  5LHG A;  3SDG A;  4A3C J;  1MZB A;  4JK1 X;  1VZ0 A;  3ZQQ A;  1UG2 A;  3CES A;  3L09 A;  4MO7 A;  1OYI A;  4ANJ A;  3HTS B;  1R9T J;  3LQQ A;  5ICC A;  2L7K A;  4F92 B;  1R1T A;  1V54 H;  3CD6 I;  4GGG A;  3S1Q J;  1K61 A;  2DW4 A;  3IHU A;  1TQM A;  4A3I J;  1O4X A;  1O7F A;  2KRC A;  5CQG A;  2MA3 A;  2DA6 A;  5J8F A;  3ZMU A;  3PJR A;  2YU9 J;  4KIB A;  1R1V A;  2E2I J;  2MG4 A;  2EIM H;  2HVS A;  3IH3 A;  4JP0 A;  1SEU A;  2LMD A;  4I01 A;  3OOP A;  2GA1 A;  2LNB A;  2OTL I;  1HF0 A;  4NC7 A;  4IL6 C;  4HDU A;  2XRO A;  2IA0 A;  5ICF A;  2ECC A;  2O61 A;  2Y0S A;  2Y9Y A;  4E7H A;  3R61 A;  3R0J A;  5D5W B;  1NG7 A;  3HRT A;  5C3E J;  2LRE A;  3G3Z A;  2VAS A;  5M3F J;  4OIR F;  4FE4 A;  4M3F A;  1HCR A;  3GX4 X;  1VQK I;  1G3Y A;  4QLC U;  4B09 A;  1KZH A;  2DA4 A;  1WI3 A;  2QQ9 A;  4CCM A;  5D4S A;  1W7P D;  3CDI A;  4AVZ A;  2A3S A;  1E3P A;  3TBI A;  1RR8 C;  2MC4 A;  2HZT A;  3BZC A;  2R7Q A;  1KA8 A;  2XGX A;  3PO2 J;  3AG1 H;  2W00 A;  3HKZ N;  4IEJ A;  1PJR A;  4KIC A;  2V9K A;  5D8L B;  3FIS A;  3GZN B;  1NK3 P;  3PO3 J;  1WFX A;  3K2Z A;  3OR2 C;  4XM3 A;  2IP2 A;  4LIT A;  1T6S A;  5LEK A;  3BT9 A;  3OYG A;  3L2R A;  3QU6 A;  4H4K C;  4CO8 A;  4ZH4 F;  1P6R A;  2XHK A;  1FYL A;  3GLL A;  3PFI A;  4A3G J;  2K40 A;  2O0Y A;  2WAD A;  2KIF A;  3BC8 A;  4WCG A;  3K70 C;  2OU2 A;  1SAX A;  1QBJ A;  3MZY A;  1U5T B;  4UVB A;  3N4M A;  4TV7 A;  1X1A A;  1Z3X A;  4B3A A;  1A5J A;  1J9I A;  4O5V A;  1GLN A;  4PSX A;  1UHS A;  2L9V A;  2HOE A;  5D5X B;  1BI1 A;  1GXP A;  3T5X A;  4BJ5 C;  3IP4 B;  1U9N A;  2RVC A;  5HOD A;  1FYK A;  1FTZ A;  2YX7 A;  1OKR A;  3PNV A;  2FBI A;  1U9O A;  2R5Y A;  1TLH B;  4BE2 A;  4UV9 A;  2EIK H;  1JE8 A;  3K1N A;  1B6A A;  4F91 B;  3LWF A;  2R4G A;  3CCY A;  1DP7 P;  3RPQ A;  2XSD C;  1J59 A;  1IN5 A;  1AA7 A;  2YU3 A;  3IWZ A;  4IHT A;  2WAQ N;  1IV8 A;  1XMK A;  4CHU A;  2DA2 A;  3B6C A;  1RKW A;  4F7Z A;  2BXZ A;  4G9Y A;  2EZK A;  3HJE A;  4M3G A;  5EG0 A;  5LGT A;  4XLA A;  1VQP I;  2FBH A;  4PZJ A;  3E5X A;  4PGG A;  2VJ4 A;  3SXY A;  1O57 A;  1YFH A;  1WGX A;  2DTZ A;  1UST A;  1SVL A;  3GF2 A;  2QZ8 A;  2HVQ A;  4XN3 A;  1V5F A;  1MND A;  3ZN0 A;  1JKP C;  3BZK A;  4MGR A;  5LRR A;  1WJ5 A;  3T8R A;  1WJE A;  4BAC A;  1D5V A;  3FBI B;  3BCB A;  5DCM A;  4S05 A;  3EYI A;  4IXA A;  2WBM A;  5GAD J;  4PJN A;  1Z67 A;  5LFA A;  2DT5 A;  3ZMZ A;  3CZ6 A;  2FE3 A;  4L5I A;  2V9V A;  3GTP J;  2EV0 A;  1QZY A;  5GAE J;  2K9M A;  1JJ8 C;  3CCV I;  3PNY A;  4HNV A;  1I1G A;  2JUC A;  2X1D A;  2XAF A;  4Z2Y A;  2CMP A;  1XCV A;  4L9J A;  4N4O B;  1J75 A;  1G8X A;  2HOS A;  2RKH A;  4RAY A;  4E6K G;  3HSF A;  2B0L A;  1KON A;  1WJD A;  1RPW A;  2EB7 A;  2KRH A;  2CQX A;  3LSK A;  4OMY A;  2BY0 A;  2ELK A;  3M7G A;  3MZ8 A;  4GRI A;  4HBL A;  4CH7 A;  4CDG A;  4HAM A;  1LEA A;  5DM7 F;  4CUG A;  2XAH A;  5LBQ A;  3BG6 A;  3WTY C;  2M2E A;  3DWL E;  1BOB A;  2EFQ A;  4EV0 A;  3P7N A;  1RUO A;  4HQE A;  1VI0 A;  3BR1 A;  5GAG J;  4K2E A;  3KEY A;  2JVH A;  4HDV A;  2MSY A;  3DF8 A;  5LD2 C;  3IRQ A;  2Q2E A;  1TWG J;  3I9V 2;  2DAO A;  1Z9C A;  1R23 A;  2DT6 A;  2YX4 A;  3F6V A;  4YEJ A;  3EUH C;  2QGU A;  1IGN A;  1ZRC A;  1BC7 C;  3OSF A;  1ZYR F;  3OYK A;  2CV2 A;  5C4X J;  4MEY F;  3ULQ B;  2WV0 A;  3FF5 A;  1GV2 A;  1D0Z A;  3HEF A;  2XSJ C;  2Z33 A;  1V5E A;  3WHB A;  4G7H F;  3FWE A;  2NS7 A;  1XDU A;  2R5Z B;  2PJR B;  4BBR J;  2O7O A;  4A5N A;  4DOZ A;  5KAF C;  1IG7 A;  2L3D A;  3ECO A;  2OZ6 A;  2NVX J;  4A3L J;  2FEZ A;  3JW4 A;  2X51 A;  2EA2 A;  2GZW A;  4YIF A;  1FBU A;  2OCE A;  2ZKZ A;  3EDP A;  1ZEL A;  1JT0 A;  2VB6 A;  2KPM A;  3GZ5 A;  2JT1 A;  2XF6 A;  4NQW A;  5FD6 A;  3HOS A;  4WXH A;  1F4K A;  3FK6 A;  2JK3 A;  2V4J C;  5CKT A;  2DBB A;  3OYL A;  2QWW A;  5FD5 A;  4L9N A;  1YS7 A;  4DZP A;  2NVT J;  1Z6R A;  4M9S A;  2EZI A;  4Q47 A;  3TW6 A;  2A6H F;  4RB2 C;  1GVD A;  1FSE A;  3AG3 H;  5DUK A;  3TOA A;  4A3J J;  1JGS A;  3IRR A;  3BTC A;  5HS9 A;  4ASN A;  5FKM A;  5KCM A;  3JRB A;  1MBH A;  2Z2S B;  5FO5 A;  1LKX A;  1JUS A;  1TWC J;  3VDX A;  1OMI A;  2ZNZ A;  4R8H A;  2CUJ A;  4DIQ A;  4F52 A;  3CCR I;  2X48 A;  5DEQ A;  5JHU A;  2ESH A;  4IHS A;  4II3 A;  3OYC A;  4EMS A;  3HZJ A;  3E5U A;  3TL4 X;  2TCT A;  2JA6 J;  3LQR A;  1HSJ A;  4JX5 A;  3BWG A;  3MN2 A;  4KFC A;  2PI0 A;  1HLV A;  3E6D A;  2UV1 A;  3E6B A;  3RSN A;  5HS8 A;  3G2B A;  3GW2 A;  3I59 B;  3O6B B;  5DM6 F;  2MW8 A;  2LTP A;  3C2B A;  4FX0 A;  2DTR A;  2AXL A;  2P5V A;  2P4W A;  2M1B A;  4BEH B;  1MMD A;  2L54 A;  1W0T A;  2ICW G;  2R3S A;  1BA5 A;  4BJT A;  1LVA A;  4C2T A;  2LY2 A;  5J6X A;  2EZL A;  1U0J A;  5BS6 A;  2GXA A;  2Z9O A;  2DDB A;  1OR7 A;  1N75 A;  1WVR A;  5J8C A;  3T8T A;  4A0Y A;  1ZQ3 P;  3HGY A;  3E6C C;  3S14 J;  1W7P B;  3HUG B;  1EKE A;  1BR2 A;  2BOL A;  2E35 A;  2HR3 A;  1LE8 B;  1SMY F;  3N05 A;  2XUB A;  1UAA A;  3B02 A;  2JPB A;  1WJA A;  4IRH A;  1KU2 A;  3VSL A;  2HQN A;  3H3V K;  2WAE A;  1B72 B;  2IS1 A;  4RB3 C;  4QPQ A;  3JTG A;  2HGC A;  1PP8 F;  1B8I A;  3AFH A;  3ASN H;  3H0G J;  4HA8 A;  3LL7 A;  5J4Y A;  1MNE A;  2OPT A;  2NS8 A;  4IHX A;  4OWR B;  2HYJ A;  3IL2 A;  2GIZ A;  1ETX A;  1P2F A;  4I6Z A;  3M1C A;  1O3T A;  4ZZD A;  4A3K J;  2BGC A;  5AON A;  4EM2 A;  2BXY A;  3R4K A;  5ICG A;  1D1C A;  3CQZ J;  2ETH A;  2EV6 A;  5J1U A;  2GQQ A;  3DP7 A;  3A03 A;  1QPI A;  1REP C;  3WG9 A;  2STW A;  4OOI A;  4B44 A;  2VC1 A;  4PFO A;  4DW6 A;  2LVS A;  3S16 J;  1GXQ A;  4YRV A;  1U3E M;  1IV6 A;  2MC3 A;  2PMU A;  3NWT A;  2QF7 A;  2ZC2 A;  3L2Q A;  2ZFU A;  3K4C A;  2BZT A;  5CJ9 A;  4ON0 A;  1S72 I;  2VQG A;  2FD5 A;  1O7L A;  1TW2 A;  1WJC A;  4BXF A;  4A3D J;  2FOK A;  2VKD A;  3PUF A;  4DZJ A;  1MMN A;  4UVC A;  1ZAO A;  1R1U A;  4RAZ A;  5K7Z A;  1MH4 A;  4U7D A;  2LG4 A;  2LY9 A;  1PUF A;  1QRY A;  4NBQ A;  1BOA A;  1YX5 A;  3B6A A;  4X0G A;  1FPQ A;  1DQU A;  1ZHF A;  1FNN A;  5EEA A;  1USS A;  4YEL A;  3VOE A;  1FOY A;  3VEP A;  1X1P A;  2XAQ A;  3CO6 C;  2KL4 A;  2KZV A;  3C1D A;  3ABK H;  4JYK A;  5JLX A;  1T39 A;  4IOA F;  3DU6 A;  4N9I A;  2K3F A;  3K7A J;  5IYB J;  3HIF A;  1B4A A;  1OPC A;  5F04 A;  3I54 A;  4GXO A;  4U0Y A;  1CGP A;  2FA5 A;  4P9F A;  2TRT A;  4FET A;  1ZN2 A;  4CGZ A;  4E4H A;  2JQ7 A;  4GYG A;  5JLW A;  1MGT A;  2MD0 A;  1HDD C;  2A05 A;  1WCM J;  3I71 A;  4E7S A;  1UHM A;  3X2Q H;  3WU0 A;  1MH3 A;  3ZOB A;  2VKV A;  4J00 A;  3OYN A;  1TNT A;  3GVA A;  1IAW A;  2O8K A;  4UB6 C;  2ZME A;  3I53 A;  3OR1 C;  4C30 A;  4C9Y A;  2GOX B;  4ESB A;  1XD7 A;  2ZFW A;  3HOX J;  2MGQ A;  2BHZ A;  2F48 A;  3P9C A;  3O8G A;  3PSF A;  4UB8 C;  2JA5 J;  2WB1 A;  4MLO A;  4OMZ A;  3DEE A;  2DN0 A;  4BHB A;  5J3L A;  2H6B A;  5LGU A;  3VFZ A;  3WTU C;  1XMA A;  3K4B A;  1V3F A;  2MLG A;  1TP4 A;  2F4O B;  5CVR A;  5HLG A;  4OIO F;  1WZ2 A;  1VND A;  5LGN A;  3BPV A;  4XKV A;  3ABT A;  3DFG A;  6PAX A;  3LSG A;  5CYV A;  3FHN A;  3W2A A;  3HOW J;  4XN0 A;  2Q2E B;  4I7H A;  2K5C A;  3K4K A;  3FDY A;  1AU7 A;  3K4M A;  4E7Z A;  1OCC H;  2CQ7 A;  2K9N A;  3DCF A;  3KZI C;  5J47 A;  1SMT A;  2LLK A;  4D7M A;  1VQ9 I;  3GFJ A;  3RKX A;  2OC6 A;  3IWF A;  4KIG A;  1G3W A;  1JHH A;  3NWS A;  2M7A A;  1BM9 A;  5CPR B;  3TMO A;  3RZO J;  2LC2 A;  3O2P E;  2DOA A;  3OYJ A;  2R7T A;  1QHG A;  1UCR A;  1XSX A;  3J80 K;  4XRM A;  1BJZ A;  1ZR2 A;  3ZXS A;  4Y4R A;  1B8I B;  4BGD A;  1N77 A;  2AO9 A;  2BV6 A;  2CSO A;  1K78 A;  2F4I A;  3KEO A;  2Z3Y A;  1QNT A;  3W2V A;  3RI4 A;  1ODD A;  2HFH A;  2RRE A;  2CW0 F;  4Y15 A;  3ZPL A;  5E3M A;  3OS1 A;  2WAQ A;  1ZH5 A;  3LMM A;  1BI0 A;  4D7N A;  3I55 I;  2PX9 A;  1KU7 A;  1TC3 C;  4JX6 A;  3U21 A;  1L0O C;  2Y2Z A;  3A0B C;  4G6D A;  4UUS B;  1JJ6 C;  5B3S H;  4LIU A;  2CO5 A;  4XSZ F;  3DV8 A;  3KE2 A;  2CQQ A;  2W85 A;  1BN5 A;  4A0X A;  1DU0 A;  5BQT A;  1CF7 B;  1EH6 A;  4A3M J;  5J1R A;  1KU3 A;  3COA C;  5JR3 A;  3EPZ A;  5F0C A;  3F72 A;  3I3L A;  4CCO A;  5K5O A;  4A6E A;  1Z7L A;  2D1H A;  2M45 A;  5IP9 J;  2GOM A;  2BY1 A;  1AWC A;  1T8I A;  2K86 A;  4ZTJ A;  3TKY A;  1WH7 A;  3RJP A;  2L9R A;  2RQQ A;  1XN7 A;  3P9I A;  2R7R A;  3CC4 I;  1TZL A;  3ZQC A;  2H6C A;  2LKX A;  4BBS J;  2E2H J;  4KNY A;  3KP2 A;  3KLN A;  1T08 B;  4KIS A;  3NEU A;  1A35 A;  3FK7 A;  4P55 A;  4PCQ A;  1VQ6 I;  1HDP A;  3JSO A;  3IV5 A;  2XVC A;  3U1K A;  4UVA A;  1MDM B;  2JPC A;  1TNS A;  2CW7 A;  2Y48 A;  3AG4 H;  4A2U A;  2V1U A;  5EF6 A;  3AG2 H;  3OWT A;  3WOD F;  3WTW C;  5GP9 A;  3CCS I;  3TP0 A;  2QKM B;  3L2W A;  3CCU I;  1ETK A;  4FAS D;  1V4R A;  2OZU A;  3FMR A;  4RA2 A;  2NYX A;  2L9N A;  4A69 C;  2XPW A;  1IUF A;  3KCC A;  3C18 A;  2DA7 A;  3WE2 A;  2Y69 H;  2XAG A;  2HXO A;  4CCL A;  1R58 A;  4LK0 F;  1BBY A;  2LBF B;  2X4H A;  1ENH A;  1U5T C; 
#chains in the Genus database with same CATH homology
 4B3A A;  1W0U A;  1A5J A;  2ID3 A;  2L7M P;  2E1O A;  2YUS A;  1POG A;  1UHS A;  1IJW C;  1X2N A;  5HOD A;  1U9N A;  1FTZ A;  2B63 J;  3GBG A;  1ETO A;  3JRA A;  3MKL A;  1U9O A;  1VF9 A;  2R5Y A;  1IDY A;  3GTG J;  3JRI A;  2IEK A;  3CCY A;  3LNQ A;  4ABZ A;  2XSD C;  2VUM J;  2DA1 A;  1I6H J;  1RR7 A;  2N8G A;  3GTK J;  2WAQ N;  3F0C A;  2E2J J;  2DA2 A;  3B6C A;  1RKW A;  4GFB A;  3HOU J;  3BQY A;  1S7E A;  2EZK A;  2XB5 A;  5FLM J;  4M3G A;  5EG0 A;  5E3O A;  3M4O J;  1U8B A;  1JKQ C;  3ZQG A;  4XRS G;  4Y52 J;  1P7I A;  3BG5 A;  4UUT A;  1WGX A;  2DTZ A;  2EH3 A;  3G1M A;  5IYC J;  1MSF C;  1ITY A;  2DMT A;  1K83 J;  1GUU A;  1MBJ A;  1OJL A;  1EF4 A;  2RAE A;  1JKP C;  1QVT A;  1WH5 A;  4X6A J;  4QSH A;  2EBI A;  4M3D A;  4MFE A;  1ORK A;  3GTO J;  2XGD A;  5EG0 B;  2EZH A;  2PMZ N;  4FE7 A;  5M5X J;  5BNG A;  4W97 A;  3S1M J;  1RKT A;  1X2M A;  3HOY J;  5EYR A;  1Y1W J;  1ZKG A;  1E3O C;  1AKH B;  3GTP J;  2XB0 X;  3JRG A;  1JJ8 C;  1FTT A;  1FIP A;  2HOA A;  2XGC A;  4HNV A;  1AHD P;  2JN6 A;  3A01 A;  1T33 A;  2HQ5 A;  2CRG A;  1OCP A;  5GPA A;  4IHV A;  2HOS A;  2FJ1 A;  2CJJ A;  1OCT C;  1APL C;  2W48 A;  1RPW A;  1ETV A;  2CQX A;  1RES A;  2R7Z J;  1TWH J;  3BTL A;  3A02 A;  2ELK A;  1MSE C;  1JKR C;  5EGO B;  4FTH A;  4DYQ A;  1SFO J;  2HOT A;  3S2D J;  5F27 A;  3LSR A;  5F1J A;  2M2E A;  2HI3 A;  2DMP A;  2JMW A;  2JA7 J;  1Y1V J;  5E3L A;  5IP6 A;  1VI0 A;  3BR1 A;  1FJL A;  2R92 J;  2P81 A;  1NK2 P;  1ZK8 A;  5E3N A;  2MSY A;  4A93 J;  2XPV A;  1TWG J;  4B1R A;  4D5F A;  2CUE A;  3HBL A;  1BW5 A;  2LR8 A;  3BG3 A;  1IGN A;  1YRN B;  3SFI A;  5M5Y J;  3OSF A;  3RQI A;  2ID6 A;  3JRH A;  3TW7 A;  5C4X J;  4V2G A;  1GV2 A;  4RBO A;  3HEF A;  4C2M J;  3WHB A;  2WB1 N;  1XC5 A;  2NS7 A;  3BTJ A;  2R5Z B;  4BBR J;  2O7O A;  3JR9 A;  1IG7 A;  4W1U A;  3I4N J;  2NVX J;  4A3L J;  2WV1 A;  4A3E J;  2H1K A;  1ETW A;  1UMQ A;  1IRZ A;  3Q0U A;  4MIM A;  3D1N I;  3BR3 A;  2DA3 A;  2FQ4 A;  1ZR4 A;  3A01 B;  1JT0 A;  2DA5 A;  3W6V A;  3S1N J;  5FKL A;  3FK6 A;  4S0H B;  2R5Z A;  2JK3 A;  3BR6 A;  3VPR A;  2GM4 A;  3PM1 A;  5IPA A;  3HB9 A;  3Q3S A;  1T56 A;  1MBE A;  3S17 J;  3ZQF A;  4DZP A;  3JRC A;  2NVT J;  2EZI A;  4AUX A;  3TW6 A;  2NOG A;  1GVD A;  4A3J J;  5J1Y A;  5EDN A;  3BTC A;  3BR0 A;  3DEW A;  5FKM A;  1MBG A;  3JRB A;  1MBH A;  3QPS A;  3LSJ A;  1JUS A;  1TWC J;  5M5W J;  1CQT A;  2X48 A;  3ZQI A;  2G0E A;  4IHY A;  3QPL A;  3NAR A;  1JUP A;  2TCT A;  2JA6 J;  1LFU P;  4JX5 A;  2KT0 A;  2LD5 A;  3MN2 A;  4RDU A;  1HLV A;  2K9S A;  2XRL A;  3G1L A;  4X1E A;  2MW8 A;  2LTP A;  3C2B A;  3S15 J;  1DU6 A;  2CU7 A;  4BY7 J;  1GT0 C;  1TWA J;  1IC8 A;  2Y31 A;  1W0T A;  1BA5 A;  4CYC A;  2FX0 A;  4A3F J;  2I10 A;  4BXX J;  2EZL A;  2M34 A;  3JRF A;  1LE8 A;  3NAU A;  3BR2 A;  1ETY A;  2R5Y B;  1ZQ3 P;  3HGY A;  3S14 J;  4AYB N;  2ME6 A;  4C3H J;  5K7H A;  2DJN A;  1LE8 B;  1H8A C;  2JJ7 A;  1I50 J;  2Y30 A;  1JGG A;  5IYD J;  4M6V A;  3H3V K;  1B72 B;  3O8H A;  4JX4 A;  3JRE A;  1SAN A;  3SJM A;  5F08 A;  5K7F A;  1B8I A;  3OOU A;  3H0G J;  3JRD A;  3LSP A;  3BTI A;  1XG1 A;  1ETQ A;  1ZTR A;  2OPT A;  1Z77 A;  2NS8 A;  4G12 A;  3FIW A;  4DYC A;  1QVU A;  3HDD A;  4IHX A;  4QTR A;  2HYJ A;  3LOC A;  1G2H A;  4I6Z A;  1ETX A;  2JA8 J;  4A3K J;  4Y7N J;  2XPU A;  1HOM A;  1LFB A;  3CQZ J;  1F36 A;  5J1U A;  3A03 A;  2LP0 A;  1QPI A;  2NVY J;  1FIA A;  3L1P A;  4DW6 A;  3S16 J;  2GBY A;  2LVS A;  1H88 C;  3ZQH A;  1IV6 A;  2Y0S N;  1Q1V A;  3BG9 A;  5DTD A;  2QF7 A;  2FD5 A;  5FLV A;  1I3Q J;  2ZB9 A;  4A3D J;  1IDZ A;  4DZJ A;  1JTX A;  4C3J J;  3IH2 A;  5FKK A;  5K7Z A;  3S1R J;  2D5V A;  1MH4 A;  2LY9 A;  1PUF A;  1QRY A;  5C44 J;  1YRN A;  3B6A A;  9ANT A;  3G1O A;  5F0H A;  5EEA A;  4XID A;  1GDT A;  3HOV J;  2ECB A;  3Q0V A;  3ZQL A;  2ME0 A;  4DYR A;  2X6O A;  5JLX A;  4JYK A;  2XGE A;  1BW6 A;  3RZD J;  3K7A J;  5IYB J;  4B4C A;  1BL0 A;  5F04 A;  4EEF G;  1JTY A;  3CDL A;  4FIS A;  2TRT A;  5IP7 J;  5FJ8 J;  1U78 A;  3GTM J;  5JLW A;  2M0C A;  3HM5 A;  1HDD C;  1MBK A;  1WCM J;  1B72 A;  3HGG A;  2IAI A;  1OFC X;  1MH3 A;  3ZOB A;  2VKV A;  4C3I J;  4D5C A;  4BKX A;  4QIW N;  4A3B J;  3RKQ A;  2VKE A;  2O8K A;  5IOY A;  3HOX J;  2MGQ A;  1JUM A;  5IOZ A;  1RET A;  1NTC A;  2H8R A;  3O8G A;  4XRS A;  2JA5 J;  3MVP A;  4MLO A;  2M8G X;  2DN0 A;  5J3L A;  4NDL A;  2DMQ A;  2LFB A;  1P7J A;  2AHQ A;  4M3E A;  3FKI J;  5EZH A;  2HDD A;  1VND A;  4XK4 A;  2M9H A;  2DMN A;  3M3Y J;  4FCY A;  3BR5 A;  3LSG A;  3HOW J;  2IBD A;  3OIO A;  1AU7 A;  2X9D A;  2K9N A;  3DCF A;  2LLK A;  4D7M A;  5DS9 A;  1F43 A;  1VFC A;  4MFD A;  3RZO J;  5EZG A;  4IHW A;  4AC0 A;  1AKH A;  4I76 A;  2EQR A;  5F0F A;  3SDG A;  4A3C J;  3IH4 A;  4XRM A;  4UUS A;  1BJZ A;  2COB A;  3HOZ J;  1UG2 A;  4MO7 A;  1ZR2 A;  1B8I B;  2DMU A;  2AO9 A;  2CUF A;  1R9T J;  3GTL J;  1FEX A;  3E7L A;  2R93 J;  5FKN A;  3GTJ J;  3S1Q J;  1K61 A;  5EGO A;  2HXI A;  4CYC B;  4A3I J;  1O4X A;  5E3M A;  3TED A;  2VPR A;  2DA6 A;  3BQZ A;  4D7N A;  4J19 A;  2YU9 J;  2E2I J;  2VI6 A;  1TC3 C;  2MG4 A;  4JX6 A;  2L7F P;  1JJ6 C;  2Y2Z A;  3IH3 A;  4JP0 A;  1MBF A;  4UUS B;  3OSG A;  2Y9Z A;  2OF7 A;  3QQA A;  2CQQ A;  1DU0 A;  3WHC A;  1HF0 A;  4A3M J;  2E19 A;  5J1R A;  2ECC A;  4BY1 J;  1MNM C;  2Y9Y A;  1TWF J;  5F0C A;  3K2A A;  5C3E J;  5M3M J;  5M3F J;  4L5E A;  3GTQ J;  4LOC A;  5IP9 J;  4FE4 A;  3Q0W A;  4M3F A;  1JKO C;  1HCR A;  1WH7 A;  2L9R A;  4V2F A;  4BBS J;  3ZQC A;  2DA4 A;  1WI3 A;  2LKX A;  1XS9 A;  2E2H J;  2L0K A;  1JT6 A;  1D5Y A;  3FK7 A;  1HDP A;  3IV5 A;  1PUF B;  2KDZ A;  5C4J J;  5EF6 A;  3CMY A;  3PO2 J;  5GP9 A;  3HKZ N;  3TP0 A;  4IEJ A;  4M3B A;  2NVQ J;  2JWT A;  3FIS A;  3TP3 A;  1ETK A;  2YS9 A;  2R0Q C;  1NK3 P;  3I4M J;  5GPC A;  3PO3 J;  1Z0X A;  2L7Z A;  1H89 C;  4A69 C;  1GV5 A;  1A6I A;  3UKG A;  3BT9 A;  2O9L A;  2XPW A;  1IUF A;  2QCO A;  2DA7 A;  4A3G J;  2K40 A;  5FKO A;  4XIC A;  3S2H J;  1WPK A;  2HXO A;  2LK2 A;  1X58 A;  1ZGW A;  2GLO A;  2K9Q A;  1ENH A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...