1IG7A

Msx-1 homeodomain/dna complex structure
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
58
structure length
58
Chain Sequence
RKPRTPFTTAQLLALERKFRQKQYLSIAERAEFSSSLSLTETQVKIWFQNRRAKAKRL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Crystal structure of the Msx-1 homeodomain/DNA complex
pubmed doi rcsb
source organism Mus musculus
molecule tags Transcription/dna
molecule keywords 5'-D(*CP*AP*CP*TP*AP*AP*TP*TP*GP*AP*AP*GP*G)-3'
total genus 21
structure length 58
sequence length 58
ec nomenclature
pdb deposition date 2001-04-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00046 Homeodomain Homeodomain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.60 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Homeodomain-like 1ig7A00
1FIAA 1IGNA 2EBIA 4A3DJ 1JKPC 3S16J 4IHWA 3BTIA 4A93J 1B72A 2AO9A 2G0EA 2CQQA 4FISA 1ETQA 1GVDA 5J1UA 2L9RA 1RETA 3GBGA 1DU0A 1ZK8A 2IBDA 5E3MA 2NS7A 2R7ZJ 2VPRA 3JRGA 1JT6A 5M5XJ 1P7IA 4A3LJ 3ZQHA 1MH3A 1LFBA 3WHCA 1LE8B 1MSEC 1PUFA 4BXXJ 5DTDA 2MSYA 3LSPA 4DYRA 2QF7A 1MNMC 3BG5A 2IAIA 4NDLA 5FLMJ 2E2JJ 1I6HJ 5FJ8J 3RZOJ 1FJLA 4C3HJ 3HKZN 3SFIA 2X9DA 3TW7A 4DYQA 3TP3A 3GTKJ 5JLXA 2YUSA 2N8GA 1HLVA 2DMTA 3HGYA 2X48A 1B72B 1U9OA 3M4OJ 3LNQA 1ETVA 3MVPA 1XS9A 4IHVA 5J3LA 3ZQCA 5EDNA 2E1OA 3BR3A 3RKQA 3I4NJ 2Y9YA 4W97A 5M5YJ 3C2BA 2FX0A 2LLKA 1RR7A 3QQAA 3ZQGA 4JX4A 2HI3A 4XK4A 2W48A 1U78A 4MLOA 2QCOA 4QIWN 2EH3A 2HOAA 1JJ8C 2EZHA 2K9NA 1LE8A 2K40A 2M2EA 2L7MP 4CYCA 4XICA 4MFDA 2JJ7A 3QPSA 1GUUA 1MBJA 4B3AA 3S1RJ 5E3NA 5IYCJ 5C3EJ 2WAQN 3QPLA 4A69C 1QPIA 1NTCA 2NVTJ 1GV2A 3GTLJ 3GTJJ 3OOUA 5IYBJ 4UUSB 2DTZA 2L7ZA 4A3FJ 3BT9A 4JX6A 5K7FA 3H0GJ 4D7NA 2MGQA 1JKRC 5F27A 3BR0A 3ZQIA 2LR8A 5F0FA 4BY1J 2CUFA 1WI3A 3A01A 5DS9A 1B8IA 4RDUA 5EG0B 1XG1A 2YU9J 4FE7A 5GPCA 5IPAA 4CYCB 3O8HA 1TC3C 2OF7A 2NVQJ 1A5JA 3BR1A 3G1MA 1IDZA 3IV5A 2CRGA 3BTJA 3GTGJ 2DA7A 1ZKGA 1UMQA 1BJZA 4HNVA 4J19A 2M0CA 5K7HA 2JA6J 2ID6A 4JYKA 1YRNA 1JUSA 2L7FP 4V2FA 1GT0C 2AHQA 2HQ5A 2R5YA 3JR9A 1IV6A 4XRSG 3S1NJ 4Y52J 4GFBA 2XPUA 3HDDA 3JRIA 3JREA 1RPWA 1MBFA 1MBHA 2DN0A 2HDDA 2VKVA 2ZB9A 1UG2A 4FTHA 2DA1A 3BQZA 3HB9A 1H89C 2JA7J 3O8GA 5JLWA 4BBRJ 2M8GX 3B6AA 1YRNB 1TWAJ 1Z77A 1EF4A 4LOCA 3RQIA 2KDZA 5F0CA 1ZR4A 2K9QA 3S17J 1XC5A 2X6OA 4XRMA 2EZKA 1FTZA 4S0HB 1WGXA 1X2MA 3CMYA 1JKQC 2HOTA 2CU7A 2O8KA 2L0KA 2WB1N 1PUFB 2E19A 3MKLA 2DA5A 5J1RA 4FCYA 2GLOA 2O9LA 5C4XJ 1SFOJ 1RKWA 1D5YA 3K2AA 1VNDA 4BBSJ 1IDYA 3DCFA 5FKLA 4A3GJ 3NAUA 5M3FJ 2DA3A 5F08A 2XSDC 1VF9A 1GV5A 1JT0A 4M3FA 1TWFJ 4MO7A 4M3BA 2FJ1A 2R93J 1WCMJ 1SANA 2DA6A 1FTTA 3VPRA 2CQXA 5EEAA 5FKKA 5E3LA 5K7ZA 1G2HA 3BTLA 4A3KJ 3E7LA 2YS9A 1JUPA 2EZLA 2FD5A 3S1MJ 1ZGWA 2PMZN 2CUEA 2HYJA 3S2DJ 5FKNA 2R5ZA 1IC8A 2B63J 3LSGA 1H88C 2Y9ZA 1BW5A 1MSFC 3CDLA 1BW6A 3FK7A 1W0TA 3JRBA 1F43A 1OCTC 1NK2P 4A3CJ 3DEWA 2NVXJ 1APLC 4M6VA 2TCTA 2LD5A 2LFBA 5BNGA 4FE4A 2LTPA 1Q1VA 2CJJA 3ZQFA 2DMUA 3Q3SA 3S1QJ 1I3QJ 3CQZJ 3HOXJ 5EZGA 2XGDA 5EGOA 3CCYA 1QVTA 3PM1A 5C4JJ 1ETOA 4BY7J 3SJMA 2WV1A 3FISA 3FIWA 3A02A 1WH7A 2Y2ZA 2VUMJ 4DZPA 1JJ6C 4X6AJ 1HCRA 3OSGA 3W6VA 3JRCA 5FLVA 2M9HA 4AYBN 1HDPA 2MW8A 5GP9A 5F0HA 1OJLA 1BL0A 3L1PA 1ETXA 2NVYJ 4MFEA 2JWTA 3HOWJ 4A3EJ 3Q0VA 3D1NI 4M3GA 1AKHB 1ZQ3P 4DW6A 1O4XA 1POGA 4MIMA 1Y1VJ 3HM5A 4UUTA 2ECCA 1FIPA 2M34A 5EF6A 4XIDA 1Z0XA 3TP0A 3NARA 3TEDA 1MBEA 1Y1WJ 4JP0A 3HOYJ 4C3JJ 3PO2J 2LKXA 3Q0WA 1U8BA 1ETKA 3HEFA 2E2IJ 3HOZJ 1IUFA 1JGGA 1DU6A 5J1YA 3ZQLA 1MBGA 1WPKA 4QSHA 1WH5A 3BR6A 4C3IJ 1K61A 2COBA 1S7EA 4D5FA 4A3BJ 4BKXA 2XB5A 3MN2A 4I76A 3A03A 3WHBA 3RZDJ 3JRFA 5HODA 1FEXA 2LY9A 2LP0A 4IEJA 4A3IJ 2XB0X 1RKTA 3LSJA 1JTXA 2KT0A 2E2HJ 2EQRA 3M3YJ 5EZHA 2FQ4A 3K7AJ 5IP6A 2R5ZB 1T56A 2LVSA 5FKOA 2GM4A 3A01B 2RAEA 3FK6A 2R92J 2ID3A 3PO3J 2GBYA 4I6ZA 3JRHA 4ABZA 1TWCJ 1OFCX 4XRSA 1ZTRA 2P81A 3OIOA 1HOMA 1QRYA 1I50J 2VI6A 1W0UA 3TW6A 3BR5A 2TRTA 2JK3A 2JMWA 1P7JA 4V2GA 4A3MJ 4UUSA 1AKHA 3BG3A 1MBKA 4M3EA 3HOUJ 2ELKA 1VFCA 1BA5A 1U9NA 1AU7A 3H3VK 3IH3A 2R5YB 1JUMA 2XPWA 2NOGA 3S15J 4AC0A 4QTRA 1JTYA 1TWGJ 2LK2A 9ANTA 2ME0A 2DJNA 1E3OC 2VKEA 3OSFA 2O7OA 3JRAA 1IJWC 1ORKA 3SDGA 3S14J 1LFUP 5EG0A 3BR2A 3LOCA 4RBOA 3GTQJ 5EGOB 3HOVJ 5IP9J 5F04A 2I10A 2H1KA 2ECBA 2JN6A 4X1EA 1X2NA 1H8AC 3GTPJ 1K83J 2EZIA 2XGEA 1T33A 3F0CA 5FKMA 3UKGA 2DMPA 3HBLA 2DA2A 1ETWA 1CQTA 3JRDA 1MH4A 2IEKA 2Y31A 5IOZA 2DMQA 5M3MJ 2H8RA 1IRZA 4B1RA 3G1LA 2OPTA 2MG4A 4L5EA 4A3JJ 2K9SA 1HDDC 2XRLA 5IP7J 1ENHA 4IHYA 1QVUA 3G1OA 1IG7A 2D5VA 3B6CA 1UHSA 3FKIJ 3IH2A 3BG9A 2Y30A 4AUXA 3BQYA 4D5CA 5IOYA 4Y7NJ 4D7MA 4IHXA 1X58A 2XPVA 5GPAA 5IYDJ 3GTOJ 3BTCA 3Q0UA 2HXIA 5F1JA 1TWHJ 1HF0A 1JKOC 1A6IA 5EYRA 4M3DA 4JX5A 1AHDP 1OCPA 2XGCA 1ZR2A 4C2MJ 4DYCA 4B4CA 2DMNA 2Y0SN 3IH4A 1GDTA 2JA5J 1ETYA 4DZJA 2HXOA 3HGGA 1NK3P 5M5WJ 2JA8J 2ME6A 3ZOBA 1R9TJ 5C44J 1RESA 5E3OA 2HOSA 1VI0A 4EEFG 3LSRA 1F36A 4W1UA 1B8IB 2DA4A 1ITYA 3GTMJ 3I4MJ 3S2HJ 4G12A 2NS8A 2R0QC
chains in the Genus database with same CATH superfamily
5JHUA 1FX7A 2EBIA 4A3DJ 1TT5B 3S16J 2OZ6A 2DW4A 1J75A 1B72A 4CHUA 4A93J 2XASA 1E2XA 2HVQA 4WX9A 2G0EA 3BZ6A 4FISA 1XTAA 5LGNA 3PNTA 1ETQA 2HPMA 2DTRA 3K4NA 3DTEA 5DUIA 5FRMA 2KZGA 3GBGA 4KITB 2BY1A 1ZRCA 5E3MA 2A6TA 2R7ZJ 3EDPA 3JRGA 5M5XJ 3G73A 1H0MA 4F93B 1P4WA 5GAGJ 3CCRI 4E7IA 1PUFA 4BXXJ 4PJJA 3FWEA 1CF7B 2MSYA 5IT9K 1VQMI 4F7ZA 3IP4B 2E2JJ 2BY0A 1DUXC 3FMRA 4BNCA 3IC7A 3TOAA 3TO9A 1MDMB 3J80Z 1T2KA 2DT6A 3GTKJ 5JLXA 1FSEA 1W36C 3HGYA 5J8FA 1YX3A 2X48A 3ASNH 2ZMEA 1B72B 4EJWA 3M4OJ 2X1DA 2KRFA 2ZMEB 3HPHA 4CH7A 4BHPA 5J3LA 2BOLA 2MC3A 2E1OA 1O7LA 3C7JA 3KP5A 2DT5A 1QO0D 2FX0A 2LLKA 3T0YA 1ZG1A 2L9NA 2H8WA 1B9MA 4ITVA 3ZQGA 4AIDA 2ZJRF 2OAZA 1FYLA 4MLOA 2E34A 5B1BH 4QIWN 4H4KC 4HF0A 5J47A 1X19A 1JJ8C 3H3ZA 3QU6A 2L54A 2QKMB 3ABMH 4G8XA 2K40A 1UB9A 3L9FA 4A6EA 2A61A 4XLAA 2PLYA 2VE9A 3QPSA 2P7CB 2LKSA 3CTAA 1GUUA 5D6EA 1MBJA 4LLLA 2FMYA 2ZBKA 4OWRB 3S1RJ 1HSTA 5HDGA 2JSCA 3R0AA 5IYCJ 5C3EJ 2V9PA 4WXHA 4A69C 4FX0A 2NVTJ 3GTLJ 3PFYA 3GTJJ 1DGRM 3OOUA 1D1AA 4IF4A 4RGUA 2F4MB 2A05A 2ELJA 3BT9A 4ZYDA 4D7NA 2MGQA 3ZQIA 1U5TC 3DBLB 4PK4A 2CUFA 2X1EA 4NUBA 3Q9SA 3JTGA 1BI2A 2ACJA 4HEA2 5JI6A 1U8RA 1BIAA 1T98A 3FDYA 3D5RC 3PIOF 1B4AA 5EG0B 5GPCA 5IPAA 2ZO4A 1XPXA 1MKMA 4ENJA 1A5JA 3CZ6A 2MLGA 3CO7C 3H5NA 1T0FA 1I6XA 3GTGJ 1OKRA 2DOEA 4LB6B 2WB1A 2DA7A 1UMQA 2CW7A 2M0CA 4I98B 2L5QA 2ID6A 2R7DA 2Z16A 3JTHA 1SFUA 1YRNA 4KNYA 4AYBA 2L7FP 2AHQA 3W2VA 3DFGA 4BDZA 2F5VA 1J09A 4Y52J 2A5YB 4DGWB 5HLIA 4BUPA 5KAIC 2MFZA 5E79C 3R61A 2CQ7A 3DEEA 1S7OA 3KEOA 3JREA 4XONA 4Y15A 1FNNA 1MBHA 3TDUC 2HDDA 2ESHA 3LWFA 5ILVA 4CCOA 4L5IA 3ONQA 2KQRA 2JA7J 3W2WA 5JLWA 3F8CA 3KEQA 1A35A 1KU7A 3CF2A 3LQRA 4UB8C 1MD0A 1QZYA 5DCMA 4ZZLA 1Z91A 3B6AA 1IO2A 2DK5A 4LGWA 2P5KA 4LOCA 1ZR4A 3IRRA 2JZYA 3DPTA 2EZKA 4PJ0C 5FROA 4XRMA 1K79A 1FTZA 1WGXA 3CMYA 2HOTA 1BR4A 2CU7A 1FY7A 2WB1N 1PUFB 4A6DA 2EIJH 2E19A 1XGOA 2GLOA 2RQPA 1O3SA 2GA1A 3KYDB 3MD2A 4C2UA 3SYTA 3AG1H 3DCFA 3GCMA 4A3GJ 2YSRA 3H36A 3QOEA 2WWYA 2XSDC 1VF9A 1PJRA 3EUKL 1TQPA 1ON1A 3CLQA 3KLOA 1S8NA 5FD6A 5CPRB 3ELKA 1V5GA 1WCMJ 1S72I 4AVPA 1SANA 3GXOA 2EFQA 4LFUA 3HOTA 4HPQA 5EEAA 5FKKA 4EJTA 2IS6A 2K86A 4UY8I 2IGMA 1G3WA 1IRFA 4Q4ZF 2LBFA 3OYHA 2PMZN 2HYJA 3ESWB 3KIOA 3S2DJ 3WGIA 1QGPA 2B63J 3LSIA 2JVGA 1MSFC 4OMZA 3CDLA 4M6YA 3VEPA 4AIKA 1W0TA 3JRBA 2G7HA 1F43A 3P9KA 5J4VA 2D2WA 3AAFA 2CFOA 3DQVC 3HRMA 3IAM2 1IXRC 1WJDA 1X1AA 4L9JA 2GIZA 4LG3A 2M4GA 2TCTA 2LFBA 4MGRA 4FE4A 2PX9A 1Q1VA 1RZ4A 2DCEA 3L2CA 1UAAA 1D8JA 2DMUA 1R58A 5D5XB 2QZ8A 1S5LC 4B43A 1I3QJ 3MZHA 3HOXJ 2HTSA 4AIJA 4PZJA 2DAOA 2RGVA 3CC4I 2EA2A 4LITA 3CCYA 4ESBA 1QVTA 3DBRB 3PM1A 4CCKA 4EJOA 1P6RA 3SJMA 2WV1A 2PJRA 3FIWA 1STZA 2KISA 1X1CA 3I5UA 4PDKA 3CESA 3HXLA 4DZPA 5FLVA 2L3DA 4EVIA 4UVBA 4AYBN 4YFXF 5GP9A 5L3FA 2PMZA 5F0HA 2V79A 3HIFA 3RKXA 4CO8A 3F8MA 2NOJB 3GX4X 1RUNA 2H1LA 1D5VA 5DM6F 2IGKA 1N75A 1ZHFA 4EJUA 1YW8A 1NG7A 2ZC2A 3HOWJ 1UG0A 3AL0C 1ZG3A 1T0FC 1AKHB 4ENMA 4GXOA 3FXMA 5J6XA 4MIMA 1Y1VJ 3HM5A 3CP2A 2EJRA 1FIPA 2M34A 3FKJA 4XSXF 2FA5A 2DQRA 4P9UA 4IRIA 1T39A 4JP0A 3CJNA 4FT8A 4C3JJ 1EH8A 4BYYA 2XF5A 2Z1DA 3PO2J 3KYCB 2LKXA 1U8BA 4XNFA 3DPUA 3N4MA 2E7XA 1EV7A 4Q5SF 4QSHA 3P5JA 1WHUA 2COBA 4II2A 4D5FA 2XB5A 2EFNA 5DD4A 1BI0A 3FZVA 1X3ZB 3KYLA 2FOWA 3L00A 5ERIA 3OIQA 5HODA 3RZDJ 4HSTA 2DK8A 4ESFA 1FEXA 2LP0A 4IEJA 4FASD 4A3IJ 3WG7H 4G6TB 3Q5FA 3LSJA 1JTXA 4B47A 2KT0A 1WRJA 4M6XA 3ZMZA 2IPQX 2E2HJ 4EGYA 2IS4A 2FNPA 1Z05A 1X4OA 3M3YJ 2VONA 2Y0SA 3ZMTA 3K7AJ 4HRIA 1T56A 1F4KA 2R7VA 5IT3A 1XMXA 4BQQA 2GM4A 5HNFA 2R92J 3LQQA 2V6EA 2MC4A 1Q1HA 2BZTA 3BJOA 2VL8A 2R7OA 1I50J 2HU9A 4E6KG 5DDGA 4HF1A 1P4XA 3FXOA 2B7EA 4EGZA 3BR5A 1P7JA 2IGNA 3OS1A 4HX4A 3F6OA 2DPUA 2RNGA 4M3EA 3HOUJ 5AIQA 5EJCA 1Y56A 3H3VK 2HGCA 1DGWY 3PL8A 2ME0A 2CMPA 1Y6IA 2RVCA 3G3ZA 2QSHX 2LH9A 1Z3YA 2KIQA 4BEHB 2FMLA 1YS7A 1XGNA 4KISA 3PFIA 2O7OA 3JRAA 2LF8A 3SDGA 3S14J 2WY7Q 1T95A 1XSVA 3NQOA 2V1NA 2HVSA 2KPMA 4XKBA 3GTQJ 2M45A 3HOVJ 2UUZA 3LA3A 2LYCA 2H1KA 4ZYEA 3K4KA 3GEZA 1VQ7I 1T08B 3GTPJ 2VBZA 2OC6A 1T33A 3GZ6A 1EKEA 2VOOA 1G4DA 2O0YA 3DBHB 4YG2F 2KDOA 3IUOA 1MH4A 2UXNA 3RQ4A 4BACA 2L9VA 2DMQA 5K5QA 2H8RA 1I3AA 2D1VA 3DPLC 2OPTA 3KLNA 3S93A 4BGDA 4KT6A 2JA2A 5IY5H 3F8FA 5ICGA 3K9TA 3OYKA 1TT0A 3AG3H 2XRLA 3E6MA 5IP7J 2P6SA 3L7WA 2JSPA 2R7FA 3G1OA 1IG7A 2STTA 4UB6C 2D5VA 2RV8A 1D0YA 3K1PA 4GO1A 3RTRA 3WODF 5HDNA 1UHSA 3FKIJ 3RI4A 2HQNA 1A04A 3IHUA 2Y30A 1WKMA 2IVMA 3ZQ7A 4JK1X 1E3PA 2XPVA 4I99C 5GTHC 4S04A 2IRFG 4IHSA 3GTOJ 1SMYF 2ZXWH 2V1UA 1IN4A 2CUJA 3S32A 1MDMA 4HYEA 1JKOC 3LSTA 2XAHA 3E5XA 3FHNA 1G3TA 3DKWA 1WVRA 4M3DA 2XGCA 1OYIA 1W7PB 2Q0OA 2E71A 2LDUA 3IH4A 3Q9VA 2VBWA 1GDTA 4EQQA 1W7PA 3RJPA 1ZG5A 3CCSI 1ETYA 4AM3A 2R7QA 2HXOA 3OL3A 2VLAA 1VQ9I 3ZMSA 1T38A 2W84A 3CCLI 5M5WJ 3D5LA 1KONA 4V19K 4D0PA 2GIVA 3L2VA 2HOSA 1VI0A 4W1UA 4XKVA 1VQPI 2DA4A 3OYMA 2QBYA 3GTMJ 1LFPA 2CV0A 2P6TA 3I4MJ 3HL2A 2R0QC 4JOMA 1JI8A 1YYVA 3LAPA 3OYBA 1F5TA 2AO9A 2AXLA 2CQQA 5E17F 3B73A 4E4HA 4N4OB 1YIOA 2L9RA 5J1UA 1BJAA 1IW7F 3I54A 1ZK8A 3PQJA 2OQRA 4FHTA 1KZHA 4BXUA 2B0LA 2E1MB 1I27A 3IAS2 3FMQA 2NS7A 3JAMZ 4XL9A 4HX8A 4ENKA 1P7IA 1R23A 4ETSA 4UVCA 1U0JA 5CVRA 3PNVA 1MSEC 2EFWA 3U1KA 3LSPA 1ZGAA 2ZFUA 3L2QA 1ZELA 2DFIA 2HFHA 3BG5A 5FLMJ 1MNMC 1I6HJ 2BEOA 2MH9A 1G59A 1FJLA 3BCAA 1OLTA 2X9DA 3GWZA 4DYQA 5J4YA 2CG4A 1J59A 3CJTB 1HLVA 1D1CA 3WU1B 2OBPA 4L5JA 2B9SA 4NB5A 4ZYAA 2BHZA 5LD2C 4OU0A 3KZIC 1XS9A 1SC7A 2OA4A 2XUBA 4IXAA 4KIGA 5D6FA 4HBLA 4S05A 5EDNA 3BR3A 2HEOA 5M5YJ 4W97A 3C2BA 1U2WA 3A2KA 3QQAA 2KRCA 3QWLA 4RLFA 2BW3B 4JX4A 1UZCA 3M1CA 4XK4A 3SXYA 2V26A 2HOAA 2EZHA 3MQ0A 3KZYA 4NC7A 2M2EA 2WA0A 3M07A 5TGTA 2L7MP 4XICA 2V9VA 2ZJQF 4MFDA 2JJ7A 3RKWA 5FB2A 4CDGA 4BU2A 2Q2EA 1OCRH 2FSWA 3J80K 2YX4A 2AXTC 1NTCA 3J7AY 4QWQA 2CS3A 5IYBJ 2F48A 1PVEA 1AA7A 5BPDA 4A3FJ 1XX5A 1BC7C 4JX6A 5K7FA 2MA3A 3QRFF 1FPQA 5IT9Z 1SD5A 1GLNA 1JKRC 5F27A 1FBSA 2PBIA 2OD5A 4BY1J 1WI3A 2UZKA 4HLYA 2EK5A 4B48A 3S3MA 1FMVA 1RNLA 1DPRA 2UWMA 4RDUA 1XG1A 1VQOI 2FOKA 1Y8QB 3GYHX 4CYCB 1TC3C 3TMOA 3OYJA 1IDZA 4HNUA 4GGGA 2QQ9A 3OS2A 3GF2A 1XMKA 2JTVA 2XF7A 4RAGA 5LBQA 3G71I 1SFKA 5CVUA 2XAUA 4HNVA 5L3EA 1CGPA 1FYKA 2O03A 5DUKA 3WU0A 2KIFA 5HS7A 1HKQA 4A0ZA 2G7UA 1JUSA 1UJ8A 2R5YA 1XGSA 3JR9A 1ULYA 3C2HA 5KK1A 4A2UA 5F1RA 2DJIA 3HUGA 4XRSG 3I53A 4EM1A 1P4AA 2K9MA 3F3XA 1TLHB 3BROA 4GFBA 3DF8A 3F21A 2P7VB 5FGMA 3HDDA 1R4MB 3L2RA 1MZBA 3CP8A 1XDUA 2VQGA 2KJBA 2A5WA 3UNGC 2MD5A 1X4PA 2VKVA 4D9JA 2DA1A 2LF7A 5LHIA 1HKSA 1E0EA 3SZPA 4BH9A 3BDDA 1IN7A 2H6CA 2PMUA 4YIIA 2M8GX 4Y17A 3CF5F 3L2UA 2MBFA 1TWAJ 2Q2EB 1EF4A 1MMGA 3HSEA 3RQIA 3SFZA 2D1HA 2KZVA 2K9QA 4UV9A 4DBRA 2FF4A 2E35A 4S0HB 4CZZA 5HLHA 1X2MA 3V4GA 2O8KA 1REPC 1I5ZA 3IL2A 4LIUA 2DA5A 3BY6A 3BWGA 3J7AO 4HX7A 3ZQQA 1D5YA 1VNDA 1PUEE 3KP2A 4NQWA 3NAUA 2DA3A 5F08A 1WJBA 1O3TA 1H9GA 1QZZA 1JT0A 1HW5A 1Y0UA 4M3FA 1TWFJ 2DYSH 5HOOA 2FJ1A 2LKPA 2L2OA 2RC4A 2ISYA 2BVLA 5ICFA 2BXZA 4CCJA 4UV8A 1FTTA 2M4KA 2CQXA 4BL0B 4P96A 4OINF 5K7ZA 1G2HA 3E7LA 3AKZA 2AQEA 1HBXG 2FD5A 4O6JA 1IN8A 1RUOA 2R5ZA 1IC8A 4IRHA 1S7AA 2OZUA 1UFMA 3KPHA 5TISC 1BW5A 1BBYA 4OIOF 4XSZF 1R00A 1ZLJA 2EV0A 3NWTA 2JUCA 1NK2P 2WY8Q 3HHHA 2K7LA 2GOMA 5DCMB 1YO5C 1FOXA 2NVXJ 2V1XA 2K5CA 4QPQA 1ZN2A 3OMYA 2A68F 2LTPA 1W4MA 1FBUA 1V54H 3U9GA 2Z33A 1K6OA 1XDSA 3PNYA 3S1QJ 3K6GA 3CQZJ 3MZYA 3CUQB 2VODA 5CYVA 3LSHA 3AG2H 2WADA 5F6FA 1YJNI 1TP4A 5EGOA 2DT7B 2ZXHA 1ETOA 4CYDA 2M3AA 2HNHA 3FISA 3R60A 3A02A 1WH7A 1K78B 2W24A 2A07F 4OAZA 4PUSA 2QBYB 2KL4A 3E5UA 1O3RA 1HCRA 1O7FA 2VT3A 2DPDA 2KFDA 1HDPA 5DCFA 2BBYA 2QQAA 3HSRA 5KVRA 3UR3C 4E7ZA 2E1MC 1BL0A 3L1PA 2YX7A 1VQ4I 2JVHA 3LFUA 3CDIA 4MFEA 5H6RA 3Q0VA 1XGMA 1K4TA 1EH7A 1OR7A 2M8EA 3JCUC 3PIPF 5J8CA 1ZQ3P 3LA2A 2XSJC 3RPUA 4RAYA 5EF6A 6PAXA 1HXDA 4XIDA 5EEGA 1Z0XA 3TP0A 3CCQI 1HSJA 1MBEA 2HVRA 1Y1WJ 1BIBA 2QSFX 2QWWA 5L3CA 2E2IJ 1IUFA 4ZDOA 1GHCA 2HZDA 1MJ9A 4CICA 5J1YA 3ISPA 1Z7LA 3WGHA 3S8PA 3ZQLA 2LRDA 3OYDA 3BR6A 4C3IJ 4A3BJ 1MGTA 2XKPA 1Z6TA 4ASNA 1F9NA 4G7OF 4BEHA 4RMNA 3H0DA 3WHBA 3JRFA 1KQ0A 3FBNB 1BOAA 4IOAF 1I1GA 2CGPA 2RDPA 5CVVA 3DKXA 1ZREA 1KA8A 5EZHA 1TNTA 4KDPA 3V8JA 3I64A 1K78A 5DV5A 1D0XA 1Z67A 3A01B 3IWZA 3PO3J 1I1SA 2GBYA 2ESNA 4EM0B 1PYVA 2CW0F 3FMSA 5CVIA 1B59A 4AVZA 1RIOH 1OFCX 4XRSA 1ZTRA 2JT1A 3IKVA 4MTDA 1HOMA 4KMUX 2VI6A 1W0UA 2CWEA 3TW6A 4HG2A 2I5UA 3P9CA 4XLCA 4KN4X 2M7BA 2NRAC 2PN6A 4V2GA 2CW8A 1AOYA 4Q47A 3M8JA 5ICCA 1PP8F 2ELKA 1U9NA 3GFLA 5TJJA 3IH3A 1A36A 4ANJA 1FLIA 2YU3A 1UCRA 3S15J 1R71A 2WC2A 1JTYA 3S2WA 1E3HA 2ZFWA 3KEYA 1Y8RB 4JBAA 1LDDA 2LY1A 3S3OA 3DTKA 3OSFA 1USTA 3AFHA 2ADUA 1EH6A 5EG0A 2ZXJA 3HRUA 3H5AA 3LOCA 2A6EF 3RKYA 5EGOB 4F91B 2I10A 1AWCA 5HS9A 3GFMA 3VYSB 5D5VB 2VQHA 1KQ8A 4AWXB 3EUHA 1R1VA 4HOBA 4U88A 1R5ID 1VZ0A 4XKCA 2LNBA 2M30A 3OYEA 2EPFA 1KQ9A 2ZNZA 4LB5A 4A5MA 2YR2A 2FBIA 4Y13A 4IHTA 3FXRA 3V8LA 1FP2A 1TZLA 4K2EA 5D8KB 1ETWA 1TNSA 4DNCA 3OYGA 3WTTC 1LVKA 2PI0A 5B5EC 1F1ZA 3W6KB 4E7KA 3VDXA 4ZJZA 1V3FA 1U6GA 4A3JJ 4CCMA 2OCCH 1WJCA 2R3SA 3QP6A 3M7GA 1HDDC 4ZDLA 2WV0A 4IQ4A 2Y69H 2LREA 4EV0A 4IHYA 1QVUA 3F72A 2OTJI 4HNTA 3GMEA 4ENNA 2BV6A 3BG9A 1YFHA 4KMFA 3J81Z 1YW7A 2HDWA 3KETA 2EFOA 3TBIA 3DLLF 4IHXA 3BG6A 5GPAA 3BTCA 3BJAA 3Q0UA 4XOPA 5F1JA 5AIPA 1HF0A 2COMA 1A6IA 1ZAOA 3ROUA 2GOXB 3K1MA 2R7WA 3FXQA 4JX5A 4ZTFA 5D4SA 2X0LA 1BR1A 4MQ9F 4C2MJ 4OIRF 4DYCA 5HNHA 2M7AA 4IQJA 1ZRDA 2HYFA 4M72A 3JSPA 2DFFA 4XLNF 3P7NA 3HGGA 2DOFA 3H5RA 1LNWA 5JVTA 2ME6A 2DFEA 1J7KA 2VQCA 1U5TA 4MNUA 5E3OA 4KJZA 3EUAA 1F36A 4LG0A 1LJ9A 1M1EB 2X85A 1VQLI 2DXIA 3S2HJ 2NS8A 3WG9A 1FIAA 4U0VA 2PJRB 1JKPC 1Z7UA 4XORA 5K5OA 3M8FA 1H9TA 2GWRA 3WTVC 2NXNB 1X1DA 3A1YA 4L0ZB 4F52A 1RETA 1WI9A 2VJ4A 3EQLF 4FX4A 4PJMA 2OJED 2XKOA 1JT6A 3J7ZI 5LRRA 2EIKH 3RYPA 4EJVA 1LQ1A 4RGXA 4RM3A 4RB1A 4A3LJ 1CF7A 3ZQHA 3QYBA 2J5OA 3R4KA 3VSLA 4NBQA 5LHHA 1LE8B 5DTDA 5KHDA 3J81K 3COAC 1SFEA 1B6AA 2C6YA 2STWA 2O5RA 5FLXK 2ISZA 2XDVA 1UELB 1G3SA 2IAIA 2P8TA 4NDLA 5L3DA 3RZOJ 2RREA 4IOCF 3X2QH 3PSIA 4M9SA 4UXNA 2VKDA 2CQKA 3SFIA 5HLTA 2XAJA 3TW7A 2Z9OA 3H9QA 4LK1F 2KIUA 2DMTA 3E6CC 3GO5A 1U9OA 2JPBA 2UXXA 4B44A 2EINH 1R5HA 3MVPA 1USSA 3K69A 4F55A 1X3UA 4IHVA 4I2OA 2DYRH 3HUGB 4JQFA 3REOA 3V7RA 2XV4S 3EETA 2OTLI 3RKQA 3I4NJ 2VC1A 2Y9YA 4MEYF 3DEUA 4PFOA 2IJLA 3B02A 1RR7A 2LMDA 3JAMK 3CCEI 4L0YB 4N4NB 4IVNA 3HZJA 1HQCA 3ABKH 1KU3A 2E1NA 2HI3A 4IPAA 3PSFA 1U78A 1XSDA 2K9NA 1LE8A 4PJNA 4WXCA 4CYCA 4IX7A 1QA6A 3ERED 4KN7X 3FBIB 2MYSA 3DU5A 1KGSA 3T8TA 4B3AA 4EM2A 2RNJA 5GAEJ 5E3NA 1Y0NA 1V4RA 1R36A 5LGTA 2VXZA 2X6YA 4RAZA 3GW2A 1MIJA 2IA1A 4UUSB 2L7ZA 2FUG2 2QYOA 1WQ2A 3HTUA 2NNYA 3BR0A 2M5WA 2HZTA 2LR8A 5F0FA 3ULQB 1W5SA 1VTNC 5E18F 4G9YA 1LDJA 4I01A 5ED4A 1WFXA 1QQIA 1WJ5A 3C1DA 5HDKA 1B8IA 1LVAA 2K9LA 2Z2SB 2MLKA 3OYLA 4A0XA 4B3XA 4FE7A 1I39A 3NRVA 4WCGA 4FQGA 3G1MA 2JRMA 5E8GA 2Q8KA 4EATA 2QA4I 1QHGA 2L9SA 2KJCA 2LG4A 4I7HA 1ZKGA 3FM3A 2M1BA 3I71A 4J19A 3LSMA 5J40A 2R4GA 2JA6J 5E8IA 2IP2A 1X1PA 2ZSIB 1RC9A 4JYKA 1K4SA 1ZH5A 2KLOA 1YOVB 4V2FA 2IA0A 3OS0A 2HQ5A 5ILUA 2OCEA 3BZCA 4Y33A 3FXJA 3ECOA 3S3NA 3FHZA 4MTEA 2BE5F 1TQIA 4RS8A 2XC7A 3JRIA 3PQKA 3TO7A 2QKLB 4XRFA 4XLEA 1RPWA 1NH3A 1MBFA 1OISA 1O57A 2KIMA 1SEUA 5FRNA 1ODDA 2ZB9A 3K4JA 2HPIA 3K70C 2Z3YA 1H89C 4M73A 2GXGA 2HKOA 3OYFA 4BBRJ 2KRHA 5F64A 3H9JA 4P5OA 3V7CA 2BYVE 1K6YA 2WTEA 3W6JB 1TBXA 3IKTA 3SEQA 1YRNB 2KDZA 5F0CA 3FX3A 3HRTA 4U0YA 1A31A 1XC5A 2GQQA 2X6OA 3S17J 2EA4A 3I58A 3TKYA 1JKQC 1JGSA 2L0KA 2G9WA 4XMYA 1KU2A 2LBFB 5J1RA 4FCYA 4PGHA 3GUDA 5C4XJ 1SFOJ 1RKWA 4BBSJ 5FKLA 1KYWA 2XAGA 3HC7A 1XCBA 1GVJA 4HA8A 5H20A 4HDVA 1GV5A 3FXLA 2E60A 1B9NA 4M3BA 1T8IA 2L4AA 4U7BA 5LFAA 2R93J 4LIVA 2BGCA 2DA6A 4BJTA 1YQAA 2X51A 3K10A 1DQUA 3VPRA 5E3LA 4WK8F 3WTXC 2KHMA 3M1EA 4M9ZA 3BTLA 3SHFA 2UV1A 3E6DA 1OQYA 2YS9A 1LEAA 3TO6A 4BS9A 5BMZA 2EZLA 3S1MJ 1PDNC 4E7LA 1ZGWA 1N25A 4O5VA 3F8BA 4RLQA 3LSGA 1LPQA 1ZGJA 4DOZA 1LDKB 3FK7A 1BW6A 3IWFA 2W4SA 2K4JA 1T6SA 4G94A 4G7ZF 3MFKA 3GVAA 1IXCA 2LOOA 4KIFA 1J0RA 4A3CJ 4UVAA 3MKZA 5KCMA 1APLC 4M6VA 1X1BA 3KP3A 5BNGA 5JFRA 3I9V2 2K3FA 3OYCA 3TGNA 5FO5A 3ZQFA 1Z9CA 2NS0A 2L02A 2CH0A 5EZGA 1GXPA 2XGDA 4BQAA 1ERDA 3ZRGA 3OYIA 1MJAA 3F6VA 1MMAA 3A0BC 3QODA 4I0BA 3H35A 2MABA 2VUMJ 2BHYA 1JJ6C 4GYGA 3OSGA 3JRCA 4R79A 2O6GE 2OV7A 2MW8A 1XB4A 3I4PA 3RDIA 3SQNA 1YTYA 2CV2A 1OPCA 3CCMI 3BP8A 2VKHA 4UHTA 5KAFC 1IAWA 4HAMA 1ETXA 2NVYJ 1R5GA 4IJAA 4DJAA 4OIQF 1GXQA 2DBBA 5HVQC 1SD6A 3D1NI 3LSKA 1POGA 1FBQA 4UUTA 1BOBA 2ECCA 2QENA 1LB2A 3QPHA 3O3KA 3TEDA 2OUMA 3SEZA 4RAFA 3WE2A 4H0EA 2DDAA 3SZTA 4BHBA 3F8NA 3CJQB 3Q0WA 5GTIC 1ETKA 3HEFA 1L3LA 2DFHA 1ACIA 2BY3A 3HOZJ 1JGGA 1FWZA 2P4WA 1DU6A 4BE0A 3RPQA 2X6XA 1WPKA 4A5NA 4KFCA 1K61A 1S7EA 4A12A 1BM9A 1WJAA 3F23A 2Y75A 3MN2A 4KUMA 4I0AA 3LA7A 3LL7A 1S3JA 3ZPLA 5E20A 4BE1A 2LY9A 4ON0A 1BR2A 2XB0X 4CSWA 4N9HA 3V8KA 2NNNA 5BOXA 2IS1A 1J9IA 2EQRA 4PGGA 5FD5A 3H92A 2ZSHB 3R6SA 5JVGF 5IP6A 2PFBA 2YPRA 4Y4RA 2GZWA 2LVSA 3FM5A 2RAEA 3FK6A 1D3YA 2LY2A 5BS6A 2ID3A 4MEXF 1SD7A 4I6ZA 4ABZA 2HS5A 4HF2A 1B1BA 2M87A 4L9NA 2P81A 2GAUA 2A69F 1QRYA 3HG9A 4L9VA 4GCVA 5K5RA 3EYIA 4CA0A 4Z6YA 4HV6A 5A2QZ 4J00A 1HC8A 2TRTA 2VXDA 3ERMA 1W5CC 2DLLA 2HR3A 1MBKA 1U5TB 3I0TA 1VFCA 2V4JC 1BA5A 1TL8A 1OMIA 2Q1ZB 2ETHA 5L3GA 1HA8A 1JUMA 4RGRA 3ABUA 3BZKA 2NOGA 2O8XA 4Y3OA 2JQ7A 1FSHA 4M74A 2VBYA 2LK2A 2OQGA 3NWSA 1JXSA 1V5EA 2GXAA 2W82A 2DJNA 5B1AH 1E3OC 2QSGX 4NC8A 3OYAA 2VKEA 1R49A 1MNDA 4KICA 3HPGA 5H2FC 2P0WA 2MH2A 2VBXA 3CJRB 1IJWC 1ORKA 1JHFA 1OCCH 3T1BA 3RCOA 1LFUP 3ZMVA 4NNJA 3G2BA 3ABTA 3CUQC 4RBOA 2R7SA 4YFKF 5K1YA 5IP9J 5F04A 3WTZA 2QGUA 4B8XA 4X0GA 1IF1A 3QOPA 2VJJA 2ECBA 5DM7F 3CCJI 4X1EA 1X2NA 3KCCA 4G6DA 4YFNF 4IRGA 1K83J 3HSFA 2F5CA 4ZYGA 5DYMA 2EZIA 2QM3A 2E1CA 3VWBA 5B3SH 4L9TA 4C30A 3KP7A 2Z5UA 5FKMA 3H9GA 2DMPA 2EIMH 3HBLA 2DA2A 1FOKA 3MWMA 2IEKA 1MNEA 2ZJPF 2CFXA 2Y31A 2R7UA 3WE3A 5M3MJ 5D5UB 4B1RA 4YIFA 4YRVA 1JHHA 4CGZA 3G1LA 2QQBA 4RB0A 5LEKA 1BN5A 2PEXA 4L5EA 4RB3C 4HV5A 2K9SA 4J01A 1QU3A 3N05A 2CYYA 1IXSB 2W00A 1S29A 3TDZC 1ENHA 5D8LB 2DI3A 4OOIA 4BXFA 3B6CA 1J5YA 5D4RA 4L18B 3CMMA 2WBMA 1HW2A 1Z1DA 2V7FA 3IH2A 2FE3A 3CC7I 3DKYA 3T5XA 5E1WA 2HTJA 3K4BA 2V1DA 4D7MA 1X58A 2W85A 3C3WA 5TRDA 5IYDJ 3PUBA 1EJ9A 3M9AA 4EMSA 2HXIA 3BPXA 2XAFA 2DU9A 3G6EI 2EFPA 5EYRA 1AHDP 2HOEA 2ZKZA 1PP7U 2DMNA 2VQLA 1QZEA 1EA3A 3V42A 4DZJA 3WTSC 2H27A 3ZN1A 1NK3P 2EILH 4LJZF 3ZOBA 4IZZA 3N97A 2JA8J 3PUFA 1R9TJ 1XSXA 4PFPA 2L7KA 3DWLE 4TV7A 5LEJA 3WGGA 2IA2A 1B8IB 1QPMA 2ZJ2A 1ITYA 3MMYB 3TOBA 3M8EA 2D45A 4G12A 2QLZA 3BJ6A 1YJ9I 1U3EM 1IGNA 4YELA 4IHWA 2J5PA 3VODA 3BTIA 3ZXSA 4KA4A 1Z21A 2IXSA 4ZYHA 1G6NA 1D8KA 2IS2A 1YLFA 1SVMA 1GVDA 4MHGA 3HYIA 4WF2A 1DU0A 4D1QA 4UNOA 1LEBA 3KX2A 3CC2I 2IBDA 1SD4A 3A0HC 3GFJA 4ZZDA 2DQLA 2VPRA 4XLPF 2QUFA 3LAJA 1VQNI 2VJIA 3I59B 1MJBA 3GZ5A 1MH3A 1LFBA 3WHCA 1DPUA 4NC6A 3KP6A 4DYRA 2TDXA 4CZCA 2QF7A 1HKTA 1A6QA 3MAJA 1KYZA 2BW3A 2M0MA 1MMNA 3CMEI 4HZFA 5FJ8J 2F5DA 2H6BA 1ZRFA 4C3HJ 3HKZN 2ZNYA 3J7YJ 3K70D 3TP3A 1IUYA 2YUSA 2FBKA 2N8GA 2F6CA 4DIQA 4C2TA 1IV8A 3LNQA 1ETVA 4OIPF 1UHMA 1P9QC 3ZQCA 2X4HA 3CUQA 3VYUB 4N9IA 5JR3A 4QLCU 5HLGA 1R4NB 3TQNA 3ZP5A 3QYFA 3OR1C 3F22A 3IRQA 5LRSA 2DO7A 2W48A 1YG2A 2QCOA 5CLSA 4LLGF 2EH3A 1JE8A 1IN6A 3C18A 3VFZA 4BDYA 1IRXA 1OCOH 1YHQI 1TQMA 2R7RA 2A6HF 3VOEA 3MCZA 4LK0F 2W7NA 5BPIA 3GLXA 4PSWA 2XRNA 1NG6A 1VQ8I 1YX5A 1MMSA 2WAQN 3QPLA 1QPIA 2ZCWA 1GV2A 4C9YA 4GDFA 4LD5A 1WZ2A 2JPCA 3HKZA 2DTZA 2R7XA 4E7JA 3L2WA 3H0GJ 2Z99A 1P92A 5FLXZ 2DOAA 1XN7A 1VQKI 3A01A 4HSRA 1FOYA 5DS9A 5CKTA 2JUGA 4HDUA 4KT5C 4F3QA 2YU9J 4B09A 3O8HA 4MQVA 2PMHA 2OF7A 2NVQJ 3BR1A 4P1WA 2CRGA 3IV5A 3BTJA 2PJPA 2KMUA 4O3MA 3BOQA 3CDHA 1BJZA 4CCNA 3LMMA 4U7DA 5K7HA 4CXFA 4ZC3A 4M9XA 1YW9A 4I09A 3F9KA 3GFIA 4YEJA 1GT0C 2I8DA 1IV6A 1FC3A 2AQFA 3H3UA 3S1NJ 2RN7A 5D5WB 1V5FA 2XPUA 2VASA 1SVLA 2XIGA 4G6QA 4P55A 5JHFA 1MMDA 3QPTA 3DU6A 1X3WB 2E5NA 3E97A 3WTWC 2DN0A 2RQQA 4E70A 1YITI 1UG2A 2QQ8A 4NQWB 4FTHA 2VJ5A 3BQZA 3HB9A 3U1DA 3O8GA 1S6LA 1QNTA 4XOTA 4XR6A 2FXAA 3OYNA 5EEHA 4HQMA 4ZTJA 4P9FA 4E7SA 1Z77A 2XHKA 3OWTA 4RB2C 4LMYA 3ECHA 3E5QA 4M71A 5E1XA 2VT2A 3U2RA 5ICEA 4E7HA 3CMAI 4XKWA 1K7AA 2HYGD 1FMWA 3K4MA 3MKLA 3HHGA 3SZGA 4ZH4F 3ASOH 4YIRX 2O9LA 1RRJA 2GA2A 3I56I 4NHJA 3K2AA 3VYTB 1IDYA 2FU4A 2EWNA 3FXUA 1VQ6I 3CD6I 1Z3XA 1P2FA 1V55H 2HKXA 5M3FJ 3K2ZA 1R1TA 4KIBA 3ABLH 4MO7A 4RA2A 3D0SA 1LKXA 1FOWA 1SFXA 2WAEA 2HQRA 2LSOA 4FETA 2W57A 1W1WE 1UHWA 3OV8A 3E6BA 3MZ8A 3T8RA 4A3KJ 2CV1A 1JUPA 3ML6A 3KZZA 4R8HA 2QVOA 4IL6C 3ZCOA 2CUEA 5FKNA 1H88C 2Y9ZA 3VYRB 3R0JA 2VIXA 3P9IA 4BJ5C 1YJWI 4HLXA 4A0YA 1N77A 1OCTC 4UUVA 3AL0B 5DEQA 1FT9A 2FNAA 1SAXA 3DEWA 3H1CA 3WTYC 3CCUI 5CJ9A 2LD5A 3RYRA 2DDBA 2VN2A 3FF5A 2CJJA 3Q3SA 3EYYA 2K4BA 5KNLA 3DP7A 2ZXIA 2VB6A 1W36D 1HW1A 4XLFA 2WAFA 3BG7A 4BHCA 4BAYA 5C4JJ 3JSOA 4BY7J 2FRHA 3HRSA 2Y2ZA 4X6AJ 3QAHA 3W6VA 1R7JA 2K85A 4AIHA 2M9HA 4G7HF 2NAZA 3DV8A 1LUJB 3DLAA 5CVJA 1OJLA 2RKHA 5LLQA 3W2AA 3K4CA 3RIRA 3OY9A 2K02A 1BI3A 3NEUA 1NHAA 1O3QA 3EPZA 4QPOA 2PQ8A 1DP3A 2JWTA 2F4OB 4A3EJ 2VC0A 4M3GA 2HWVA 5FFXA 4DW6A 1O4XA 5B66C 5AONA 3W3CA 2XAQA 3L09A 3NARA 2XVCA 4BQOA 4HQEA 2AS5F 3HOYJ 2BY2A 2O3FA 1C0WA 2E36A 2CSOA 5L3BA 1YE9A 1YI2I 2H94A 1TW2A 3I55I 1IRGA 3HJEA 3HTSB 1MBGA 1WH5A 4IO9F 3LFKA 3KP4A 2IW5A 3CLOA 2K27A 4BKXA 3MKYB 1SAUA 4I76A 2X1CA 3CCVI 2XF6A 3A03A 3V7SA 1VQ5I 2W25A 2L01A 3E3VA 4WWCA 3ZMUA 3JW4A 4GRIA 2QEXI 4BE2A 2F5FA 1G3YA 2BXYA 4R1HA 1RKTA 2Y48A 2EV6A 5GAHJ 3BCBA 1QBJA 5E1ZB 3K4LA 2OU2A 3QP5A 2CUZA 2FQ4A 4DBQA 2R5ZB 3GZNB 5DD8A 3VB2A 1ZLKA 1DDNA 5FKOA 1XMAA 2V6CA 2P5LC 4PSXA 2L4MA 2K3PA 1QHHD 1YS6A 3JRHA 1XD7A 5ILSA 3E0JB 3CO6C 1TWCJ 3C2GA 4DQ2A 3DXJF 3A4CA 3OIOA 3G4SI 3AG4H 4XN0A 4U87A 1Z6RA 1WJFA 1OYYA 1RR8C 2JK3A 2JMWA 4BQNA 5GADJ 2KP6A 2V9KA 1S9HA 4A3MJ 4HW0A 4F92B 5HS8A 2DODA 2H09A 4UUSA 1AKHA 3BG3A 2PG4A 2W1OA 2HDCA 3I3LA 1FZPB 4GYIA 1BI1A 2R5YB 5H6QA 2XPWA 1E17A 1FYMA 2R7TA 1IN5A 4AC0A 1OCZH 1TWGJ 5FFZA 5LHGA 3D5SC 4QTRA 2NYXA 3I59A 4XN3A 9ANTA 2XROA 1DP7P 1ON2A 1G8XA 2CQNA 1YIJI 1Y39A 5BQTA 3K1NA 2ZMEC 4II3A 2F5EA 3ZN0A 3EUHC 5CQGA 2IGOA 4PCQA 3BR2A 4ESJA 3DTIA 4Q48A 3KE2A 3OR2C 4Z2YA 1SVOA 4KYWA 1OR7C 2JN6A 3TL4X 5A2QK 1ZARA 1H8AC 1TW3A 2BVMA 1WJEA 3PJRA 3OIPA 2E5ZA 2XGEA 1W7PD 2CO5A 3F0CA 4RGSA 4WXDA 2FEZA 2VPLA 4XBFA 3BLYA 4RM2A 1ONVA 3UKGA 2ELHA 4XQFA 3WU2C 2FBHA 1CQTA 3JRDA 5IOZA 3CUOA 1R1UA 1IRZA 1BC8C 1FP1D 1R6RA 3O2PE 2EV5A 4CUGA 2VE8A 4PJLA 4U0WA 5CQEA 2XGXA 2MG4A 2EB7A 1N78A 3HOSA 1WSUA 3MKWB 1ZYRF 4XM3A 3ZMDA 5LGUA 2O61A 4AU7A 3K0LA 1WWXA 1IZ1A 2KKOA 2GXBA 4OMYA 1TTYA 4CCLA 2WAQA 4IKFA 3RPUD 1D1BA 1SMTA 4AUXA 3BQYA 1OYWA 3RSNA 4D5CA 3FXKA 5IOYA 3WTUC 4Y7NJ 4LG0B 2F4IA 2E7WA 2JRTA 4XLHA 1D0ZA 1TWHJ 2FQ3A 4I02A 2X6WA 2VOPA 2LC2A 1OCPA 3ZR8X 2IT0A 2P5VA 2F2EA 1ZR2A 4OAYA 4B4CA 3QYEA 2Y0SN 3BPVA 3SDBA 3BC8A 2JA5J 4N0BA 1XCVA 4BJ6C 3KFWX 1KU9A 3E1SA 1L0OC 3QU3A 3U21A 4LLNA 1J2XA 2ICWG 2HQAA 2A3SA 2Y0MA 3OL4A 3OOPA 5C44J 1RESA 3GLLA 3ZGKA 4AD9A 4EEFG 1W5TA 2MD0A 2NVUB 3O6BB 1MW7A 1RI7A 1R22A 3MEXA 3VSKA 3LSRA 4ZDPA 1AU7A
chains in the Genus database with same CATH topology
1FIAA 1IGNA 2EBIA 4A3DJ 1JKPC 3S16J 4IHWA 3BTIA 4A93J 1B72A 2AO9A 2G0EA 2CQQA 4FISA 1ETQA 1GVDA 5J1UA 2L9RA 1RETA 3GBGA 1DU0A 1ZK8A 2IBDA 5E3MA 2NS7A 2R7ZJ 2VPRA 3JRGA 1JT6A 5M5XJ 1P7IA 4A3LJ 3ZQHA 1MH3A 1LFBA 3WHCA 1LE8B 1MSEC 1PUFA 4BXXJ 5DTDA 2MSYA 3LSPA 4DYRA 2QF7A 1MNMC 3BG5A 2IAIA 4NDLA 5FLMJ 2E2JJ 1I6HJ 5FJ8J 3RZOJ 1FJLA 4C3HJ 3HKZN 3SFIA 2X9DA 3TW7A 4DYQA 3TP3A 3GTKJ 5JLXA 2YUSA 2N8GA 1HLVA 2DMTA 3HGYA 2X48A 1B72B 1U9OA 3M4OJ 3LNQA 1ETVA 3MVPA 1XS9A 4IHVA 5J3LA 3ZQCA 5EDNA 2E1OA 3BR3A 3RKQA 3I4NJ 2Y9YA 4W97A 5M5YJ 3C2BA 2FX0A 2LLKA 1RR7A 3QQAA 3ZQGA 4JX4A 2HI3A 4XK4A 2W48A 1U78A 4MLOA 2QCOA 4QIWN 2EH3A 2HOAA 1JJ8C 2EZHA 2K9NA 1LE8A 2K40A 2M2EA 2L7MP 4CYCA 4XICA 4MFDA 2JJ7A 3QPSA 1GUUA 1MBJA 4B3AA 3S1RJ 5E3NA 5IYCJ 5C3EJ 2WAQN 3QPLA 4A69C 1QPIA 1NTCA 2NVTJ 1GV2A 3GTLJ 3GTJJ 3OOUA 5IYBJ 4UUSB 2DTZA 2L7ZA 4A3FJ 3BT9A 4JX6A 5K7FA 3H0GJ 4D7NA 2MGQA 1JKRC 5F27A 3BR0A 3ZQIA 2LR8A 5F0FA 4BY1J 2CUFA 1WI3A 3A01A 5DS9A 1B8IA 4RDUA 5EG0B 1XG1A 2YU9J 4FE7A 5GPCA 5IPAA 4CYCB 3O8HA 1TC3C 2OF7A 2NVQJ 1A5JA 3BR1A 3G1MA 1IDZA 3IV5A 2CRGA 3BTJA 3GTGJ 2DA7A 1ZKGA 1UMQA 1BJZA 4HNVA 4J19A 2M0CA 5K7HA 2JA6J 2ID6A 4JYKA 1YRNA 1JUSA 2L7FP 4V2FA 1GT0C 2AHQA 2HQ5A 2R5YA 3JR9A 1IV6A 4XRSG 3S1NJ 4Y52J 4GFBA 2XPUA 3HDDA 3JRIA 3JREA 1RPWA 1MBFA 1MBHA 2DN0A 2HDDA 2VKVA 2ZB9A 1UG2A 4FTHA 2DA1A 3BQZA 3HB9A 1H89C 2JA7J 3O8GA 5JLWA 4BBRJ 2M8GX 3B6AA 1YRNB 1TWAJ 1Z77A 1EF4A 4LOCA 3RQIA 2KDZA 5F0CA 1ZR4A 2K9QA 3S17J 1XC5A 2X6OA 4XRMA 2EZKA 1FTZA 4S0HB 1WGXA 1X2MA 3CMYA 1JKQC 2HOTA 2CU7A 2O8KA 2L0KA 2WB1N 1PUFB 2E19A 3MKLA 2DA5A 5J1RA 4FCYA 2GLOA 2O9LA 5C4XJ 1SFOJ 1RKWA 1D5YA 3K2AA 1VNDA 4BBSJ 1IDYA 3DCFA 5FKLA 4A3GJ 3NAUA 5M3FJ 2DA3A 5F08A 2XSDC 1VF9A 1GV5A 1JT0A 4M3FA 1TWFJ 4MO7A 4M3BA 2FJ1A 2R93J 1WCMJ 1SANA 2DA6A 1FTTA 3VPRA 2CQXA 5EEAA 5FKKA 5E3LA 5K7ZA 1G2HA 3BTLA 4A3KJ 3E7LA 2YS9A 1JUPA 2EZLA 2FD5A 3S1MJ 1ZGWA 2PMZN 2CUEA 2HYJA 3S2DJ 5FKNA 2R5ZA 1IC8A 2B63J 3LSGA 1H88C 2Y9ZA 1BW5A 1MSFC 3CDLA 1BW6A 3FK7A 1W0TA 3JRBA 1F43A 1OCTC 1NK2P 4A3CJ 3DEWA 2NVXJ 1APLC 4M6VA 2TCTA 2LD5A 2LFBA 5BNGA 4FE4A 2LTPA 1Q1VA 2CJJA 3ZQFA 2DMUA 3Q3SA 3S1QJ 1I3QJ 3CQZJ 3HOXJ 5EZGA 2XGDA 5EGOA 3CCYA 1QVTA 3PM1A 5C4JJ 1ETOA 4BY7J 3SJMA 2WV1A 3FISA 3FIWA 3A02A 1WH7A 2Y2ZA 2VUMJ 4DZPA 1JJ6C 4X6AJ 1HCRA 3OSGA 3W6VA 3JRCA 5FLVA 2M9HA 4AYBN 1HDPA 2MW8A 5GP9A 5F0HA 1OJLA 1BL0A 3L1PA 1ETXA 2NVYJ 4MFEA 2JWTA 3HOWJ 4A3EJ 3Q0VA 3D1NI 4M3GA 1AKHB 1ZQ3P 4DW6A 1O4XA 1POGA 4MIMA 1Y1VJ 3HM5A 4UUTA 2ECCA 1FIPA 2M34A 5EF6A 4XIDA 1Z0XA 3TP0A 3NARA 3TEDA 1MBEA 1Y1WJ 4JP0A 3HOYJ 4C3JJ 3PO2J 2LKXA 3Q0WA 1U8BA 1ETKA 3HEFA 2E2IJ 3HOZJ 1IUFA 1JGGA 1DU6A 5J1YA 3ZQLA 1MBGA 1WPKA 4QSHA 1WH5A 3BR6A 4C3IJ 1K61A 2COBA 1S7EA 4D5FA 4A3BJ 4BKXA 2XB5A 3MN2A 4I76A 3A03A 3WHBA 3RZDJ 3JRFA 5HODA 1FEXA 2LY9A 2LP0A 4IEJA 4A3IJ 2XB0X 1RKTA 3LSJA 1JTXA 2KT0A 2E2HJ 2EQRA 3M3YJ 5EZHA 2FQ4A 3K7AJ 5IP6A 2R5ZB 1T56A 2LVSA 5FKOA 2GM4A 3A01B 2RAEA 3FK6A 2R92J 2ID3A 3PO3J 2GBYA 4I6ZA 3JRHA 4ABZA 1TWCJ 1OFCX 4XRSA 1ZTRA 2P81A 3OIOA 1HOMA 1QRYA 1I50J 2VI6A 1W0UA 3TW6A 3BR5A 2TRTA 2JK3A 2JMWA 1P7JA 4V2GA 4A3MJ 4UUSA 1AKHA 3BG3A 1MBKA 4M3EA 3HOUJ 2ELKA 1VFCA 1BA5A 1U9NA 1AU7A 3H3VK 3IH3A 2R5YB 1JUMA 2XPWA 2NOGA 3S15J 4AC0A 4QTRA 1JTYA 1TWGJ 2LK2A 9ANTA 2ME0A 2DJNA 1E3OC 2VKEA 3OSFA 2O7OA 3JRAA 1IJWC 1ORKA 3SDGA 3S14J 1LFUP 5EG0A 3BR2A 3LOCA 4RBOA 3GTQJ 5EGOB 3HOVJ 5IP9J 5F04A 2I10A 2H1KA 2ECBA 2JN6A 4X1EA 1X2NA 1H8AC 3GTPJ 1K83J 2EZIA 2XGEA 1T33A 3F0CA 5FKMA 3UKGA 2DMPA 3HBLA 2DA2A 1ETWA 1CQTA 3JRDA 1MH4A 2IEKA 2Y31A 5IOZA 2DMQA 5M3MJ 2H8RA 1IRZA 4B1RA 3G1LA 2OPTA 2MG4A 4L5EA 4A3JJ 2K9SA 1HDDC 2XRLA 5IP7J 1ENHA 4IHYA 1QVUA 3G1OA 1IG7A 2D5VA 3B6CA 1UHSA 3FKIJ 3IH2A 3BG9A 2Y30A 4AUXA 3BQYA 4D5CA 5IOYA 4Y7NJ 4D7MA 4IHXA 1X58A 2XPVA 5GPAA 5IYDJ 3GTOJ 3BTCA 3Q0UA 2HXIA 5F1JA 1TWHJ 1HF0A 1JKOC 1A6IA 5EYRA 4M3DA 4JX5A 1AHDP 1OCPA 2XGCA 1ZR2A 4C2MJ 4DYCA 4B4CA 2DMNA 2Y0SN 3IH4A 1GDTA 2JA5J 1ETYA 4DZJA 2HXOA 3HGGA 1NK3P 5M5WJ 2JA8J 2ME6A 3ZOBA 1R9TJ 5C44J 1RESA 5E3OA 2HOSA 1VI0A 4EEFG 3LSRA 1F36A 4W1UA 1B8IB 2DA4A 1ITYA 3GTMJ 3I4MJ 3S2HJ 4G12A 2NS8A 2R0QC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1FIA A;  1IGN A;  2EBI A;  4A3D J;  1JKP C;  3S16 J;  4IHW A;  3BTI A;  4A93 J;  1B72 A;  2AO9 A;  2G0E A;  2CQQ A;  4FIS A;  1ETQ A;  1GVD A;  5J1U A;  2L9R A;  1RET A;  3GBG A;  1DU0 A;  1ZK8 A;  2IBD A;  5E3M A;  2NS7 A;  2R7Z J;  2VPR A;  3JRG A;  1JT6 A;  5M5X J;  1P7I A;  4A3L J;  3ZQH A;  1MH3 A;  1LFB A;  3WHC A;  1LE8 B;  1MSE C;  1PUF A;  4BXX J;  5DTD A;  2MSY A;  3LSP A;  4DYR A;  2QF7 A;  1MNM C;  3BG5 A;  2IAI A;  4NDL A;  5FLM J;  2E2J J;  1I6H J;  5FJ8 J;  3RZO J;  1FJL A;  4C3H J;  3HKZ N;  3SFI A;  2X9D A;  3TW7 A;  4DYQ A;  3TP3 A;  3GTK J;  5JLX A;  2YUS A;  2N8G A;  1HLV A;  2DMT A;  3HGY A;  2X48 A;  1B72 B;  1U9O A;  3M4O J;  3LNQ A;  1ETV A;  3MVP A;  1XS9 A;  4IHV A;  5J3L A;  3ZQC A;  5EDN A;  2E1O A;  3BR3 A;  3RKQ A;  3I4N J;  2Y9Y A;  4W97 A;  5M5Y J;  3C2B A;  2FX0 A;  2LLK A;  1RR7 A;  3QQA A;  3ZQG A;  4JX4 A;  2HI3 A;  4XK4 A;  2W48 A;  1U78 A;  4MLO A;  2QCO A;  4QIW N;  2EH3 A;  2HOA A;  1JJ8 C;  2EZH A;  2K9N A;  1LE8 A;  2K40 A;  2M2E A;  2L7M P;  4CYC A;  4XIC A;  4MFD A;  2JJ7 A;  3QPS A;  1GUU A;  1MBJ A;  4B3A A;  3S1R J;  5E3N A;  5IYC J;  5C3E J;  2WAQ N;  3QPL A;  4A69 C;  1QPI A;  1NTC A;  2NVT J;  1GV2 A;  3GTL J;  3GTJ J;  3OOU A;  5IYB J;  4UUS B;  2DTZ A;  2L7Z A;  4A3F J;  3BT9 A;  4JX6 A;  5K7F A;  3H0G J;  4D7N A;  2MGQ A;  1JKR C;  5F27 A;  3BR0 A;  3ZQI A;  2LR8 A;  5F0F A;  4BY1 J;  2CUF A;  1WI3 A;  3A01 A;  5DS9 A;  1B8I A;  4RDU A;  5EG0 B;  1XG1 A;  2YU9 J;  4FE7 A;  5GPC A;  5IPA A;  4CYC B;  3O8H A;  1TC3 C;  2OF7 A;  2NVQ J;  1A5J A;  3BR1 A;  3G1M A;  1IDZ A;  3IV5 A;  2CRG A;  3BTJ A;  3GTG J;  2DA7 A;  1ZKG A;  1UMQ A;  1BJZ A;  4HNV A;  4J19 A;  2M0C A;  5K7H A;  2JA6 J;  2ID6 A;  4JYK A;  1YRN A;  1JUS A;  2L7F P;  4V2F A;  1GT0 C;  2AHQ A;  2HQ5 A;  2R5Y A;  3JR9 A;  1IV6 A;  4XRS G;  3S1N J;  4Y52 J;  4GFB A;  2XPU A;  3HDD A;  3JRI A;  3JRE A;  1RPW A;  1MBF A;  1MBH A;  2DN0 A;  2HDD A;  2VKV A;  2ZB9 A;  1UG2 A;  4FTH A;  2DA1 A;  3BQZ A;  3HB9 A;  1H89 C;  2JA7 J;  3O8G A;  5JLW A;  4BBR J;  2M8G X;  3B6A A;  1YRN B;  1TWA J;  1Z77 A;  1EF4 A;  4LOC A;  3RQI A;  2KDZ A;  5F0C A;  1ZR4 A;  2K9Q A;  3S17 J;  1XC5 A;  2X6O A;  4XRM A;  2EZK A;  1FTZ A;  4S0H B;  1WGX A;  1X2M A;  3CMY A;  1JKQ C;  2HOT A;  2CU7 A;  2O8K A;  2L0K A;  2WB1 N;  1PUF B;  2E19 A;  3MKL A;  2DA5 A;  5J1R A;  4FCY A;  2GLO A;  2O9L A;  5C4X J;  1SFO J;  1RKW A;  1D5Y A;  3K2A A;  1VND A;  4BBS J;  1IDY A;  3DCF A;  5FKL A;  4A3G J;  3NAU A;  5M3F J;  2DA3 A;  5F08 A;  2XSD C;  1VF9 A;  1GV5 A;  1JT0 A;  4M3F A;  1TWF J;  4MO7 A;  4M3B A;  2FJ1 A;  2R93 J;  1WCM J;  1SAN A;  2DA6 A;  1FTT A;  3VPR A;  2CQX A;  5EEA A;  5FKK A;  5E3L A;  5K7Z A;  1G2H A;  3BTL A;  4A3K J;  3E7L A;  2YS9 A;  1JUP A;  2EZL A;  2FD5 A;  3S1M J;  1ZGW A;  2PMZ N;  2CUE A;  2HYJ A;  3S2D J;  5FKN A;  2R5Z A;  1IC8 A;  2B63 J;  3LSG A;  1H88 C;  2Y9Z A;  1BW5 A;  1MSF C;  3CDL A;  1BW6 A;  3FK7 A;  1W0T A;  3JRB A;  1F43 A;  1OCT C;  1NK2 P;  4A3C J;  3DEW A;  2NVX J;  1APL C;  4M6V A;  2TCT A;  2LD5 A;  2LFB A;  5BNG A;  4FE4 A;  2LTP A;  1Q1V A;  2CJJ A;  3ZQF A;  2DMU A;  3Q3S A;  3S1Q J;  1I3Q J;  3CQZ J;  3HOX J;  5EZG A;  2XGD A;  5EGO A;  3CCY A;  1QVT A;  3PM1 A;  5C4J J;  1ETO A;  4BY7 J;  3SJM A;  2WV1 A;  3FIS A;  3FIW A;  3A02 A;  1WH7 A;  2Y2Z A;  2VUM J;  4DZP A;  1JJ6 C;  4X6A J;  1HCR A;  3OSG A;  3W6V A;  3JRC A;  5FLV A;  2M9H A;  4AYB N;  1HDP A;  2MW8 A;  5GP9 A;  5F0H A;  1OJL A;  1BL0 A;  3L1P A;  1ETX A;  2NVY J;  4MFE A;  2JWT A;  3HOW J;  4A3E J;  3Q0V A;  3D1N I;  4M3G A;  1AKH B;  1ZQ3 P;  4DW6 A;  1O4X A;  1POG A;  4MIM A;  1Y1V J;  3HM5 A;  4UUT A;  2ECC A;  1FIP A;  2M34 A;  5EF6 A;  4XID A;  1Z0X A;  3TP0 A;  3NAR A;  3TED A;  1MBE A;  1Y1W J;  4JP0 A;  3HOY J;  4C3J J;  3PO2 J;  2LKX A;  3Q0W A;  1U8B A;  1ETK A;  3HEF A;  2E2I J;  3HOZ J;  1IUF A;  1JGG A;  1DU6 A;  5J1Y A;  3ZQL A;  1MBG A;  1WPK A;  4QSH A;  1WH5 A;  3BR6 A;  4C3I J;  1K61 A;  2COB A;  1S7E A;  4D5F A;  4A3B J;  4BKX A;  2XB5 A;  3MN2 A;  4I76 A;  3A03 A;  3WHB A;  3RZD J;  3JRF A;  5HOD A;  1FEX A;  2LY9 A;  2LP0 A;  4IEJ A;  4A3I J;  2XB0 X;  1RKT A;  3LSJ A;  1JTX A;  2KT0 A;  2E2H J;  2EQR A;  3M3Y J;  5EZH A;  2FQ4 A;  3K7A J;  5IP6 A;  2R5Z B;  1T56 A;  2LVS A;  5FKO A;  2GM4 A;  3A01 B;  2RAE A;  3FK6 A;  2R92 J;  2ID3 A;  3PO3 J;  2GBY A;  4I6Z A;  3JRH A;  4ABZ A;  1TWC J;  1OFC X;  4XRS A;  1ZTR A;  2P81 A;  3OIO A;  1HOM A;  1QRY A;  1I50 J;  2VI6 A;  1W0U A;  3TW6 A;  3BR5 A;  2TRT A;  2JK3 A;  2JMW A;  1P7J A;  4V2G A;  4A3M J;  4UUS A;  1AKH A;  3BG3 A;  1MBK A;  4M3E A;  3HOU J;  2ELK A;  1VFC A;  1BA5 A;  1U9N A;  1AU7 A;  3H3V K;  3IH3 A;  2R5Y B;  1JUM A;  2XPW A;  2NOG A;  3S15 J;  4AC0 A;  4QTR A;  1JTY A;  1TWG J;  2LK2 A;  9ANT A;  2ME0 A;  2DJN A;  1E3O C;  2VKE A;  3OSF A;  2O7O A;  3JRA A;  1IJW C;  1ORK A;  3SDG A;  3S14 J;  1LFU P;  5EG0 A;  3BR2 A;  3LOC A;  4RBO A;  3GTQ J;  5EGO B;  3HOV J;  5IP9 J;  5F04 A;  2I10 A;  2H1K A;  2ECB A;  2JN6 A;  4X1E A;  1X2N A;  1H8A C;  3GTP J;  1K83 J;  2EZI A;  2XGE A;  1T33 A;  3F0C A;  5FKM A;  3UKG A;  2DMP A;  3HBL A;  2DA2 A;  1ETW A;  1CQT A;  3JRD A;  1MH4 A;  2IEK A;  2Y31 A;  5IOZ A;  2DMQ A;  5M3M J;  2H8R A;  1IRZ A;  4B1R A;  3G1L A;  2OPT A;  2MG4 A;  4L5E A;  4A3J J;  2K9S A;  1HDD C;  2XRL A;  5IP7 J;  1ENH A;  4IHY A;  1QVU A;  3G1O A;  1IG7 A;  2D5V A;  3B6C A;  1UHS A;  3FKI J;  3IH2 A;  3BG9 A;  2Y30 A;  4AUX A;  3BQY A;  4D5C A;  5IOY A;  4Y7N J;  4D7M A;  4IHX A;  1X58 A;  2XPV A;  5GPA A;  5IYD J;  3GTO J;  3BTC A;  3Q0U A;  2HXI A;  5F1J A;  1TWH J;  1HF0 A;  1JKO C;  1A6I A;  5EYR A;  4M3D A;  4JX5 A;  1AHD P;  1OCP A;  2XGC A;  1ZR2 A;  4C2M J;  4DYC A;  4B4C A;  2DMN A;  2Y0S N;  3IH4 A;  1GDT A;  2JA5 J;  1ETY A;  4DZJ A;  2HXO A;  3HGG A;  1NK3 P;  5M5W J;  2JA8 J;  2ME6 A;  3ZOB A;  1R9T J;  5C44 J;  1RES A;  5E3O A;  2HOS A;  1VI0 A;  4EEF G;  3LSR A;  1F36 A;  4W1U A;  1B8I B;  2DA4 A;  1ITY A;  3GTM J;  3I4M J;  3S2H J;  4G12 A;  2NS8 A;  2R0Q C; 
#chains in the Genus database with same CATH topology
 5JHU A;  1FX7 A;  2EBI A;  4A3D J;  1TT5 B;  3S16 J;  2OZ6 A;  2DW4 A;  1J75 A;  1B72 A;  4CHU A;  4A93 J;  2XAS A;  1E2X A;  2HVQ A;  4WX9 A;  2G0E A;  3BZ6 A;  4FIS A;  1XTA A;  5LGN A;  3PNT A;  1ETQ A;  2HPM A;  2DTR A;  3K4N A;  3DTE A;  5DUI A;  5FRM A;  2KZG A;  3GBG A;  4KIT B;  2BY1 A;  1ZRC A;  5E3M A;  2A6T A;  2R7Z J;  3EDP A;  3JRG A;  5M5X J;  3G73 A;  1H0M A;  4F93 B;  1P4W A;  5GAG J;  3CCR I;  4E7I A;  1PUF A;  4BXX J;  4PJJ A;  3FWE A;  1CF7 B;  2MSY A;  5IT9 K;  1VQM I;  4F7Z A;  3IP4 B;  2E2J J;  2BY0 A;  1DUX C;  3FMR A;  4BNC A;  3IC7 A;  3TOA A;  3TO9 A;  1MDM B;  3J80 Z;  1T2K A;  2DT6 A;  3GTK J;  5JLX A;  1FSE A;  1W36 C;  3HGY A;  5J8F A;  1YX3 A;  2X48 A;  3ASN H;  2ZME A;  1B72 B;  4EJW A;  3M4O J;  2X1D A;  2KRF A;  2ZME B;  3HPH A;  4CH7 A;  4BHP A;  5J3L A;  2BOL A;  2MC3 A;  2E1O A;  1O7L A;  3C7J A;  3KP5 A;  2DT5 A;  1QO0 D;  2FX0 A;  2LLK A;  3T0Y A;  1ZG1 A;  2L9N A;  2H8W A;  1B9M A;  4ITV A;  3ZQG A;  4AID A;  2ZJR F;  2OAZ A;  1FYL A;  4MLO A;  2E34 A;  5B1B H;  4QIW N;  4H4K C;  4HF0 A;  5J47 A;  1X19 A;  1JJ8 C;  3H3Z A;  3QU6 A;  2L54 A;  2QKM B;  3ABM H;  4G8X A;  2K40 A;  1UB9 A;  3L9F A;  4A6E A;  2A61 A;  4XLA A;  2PLY A;  2VE9 A;  3QPS A;  2P7C B;  2LKS A;  3CTA A;  1GUU A;  5D6E A;  1MBJ A;  4LLL A;  2FMY A;  2ZBK A;  4OWR B;  3S1R J;  1HST A;  5HDG A;  2JSC A;  3R0A A;  5IYC J;  5C3E J;  2V9P A;  4WXH A;  4A69 C;  4FX0 A;  2NVT J;  3GTL J;  3PFY A;  3GTJ J;  1DGR M;  3OOU A;  1D1A A;  4IF4 A;  4RGU A;  2F4M B;  2A05 A;  2ELJ A;  3BT9 A;  4ZYD A;  4D7N A;  2MGQ A;  3ZQI A;  1U5T C;  3DBL B;  4PK4 A;  2CUF A;  2X1E A;  4NUB A;  3Q9S A;  3JTG A;  1BI2 A;  2ACJ A;  4HEA 2;  5JI6 A;  1U8R A;  1BIA A;  1T98 A;  3FDY A;  3D5R C;  3PIO F;  1B4A A;  5EG0 B;  5GPC A;  5IPA A;  2ZO4 A;  1XPX A;  1MKM A;  4ENJ A;  1A5J A;  3CZ6 A;  2MLG A;  3CO7 C;  3H5N A;  1T0F A;  1I6X A;  3GTG J;  1OKR A;  2DOE A;  4LB6 B;  2WB1 A;  2DA7 A;  1UMQ A;  2CW7 A;  2M0C A;  4I98 B;  2L5Q A;  2ID6 A;  2R7D A;  2Z16 A;  3JTH A;  1SFU A;  1YRN A;  4KNY A;  4AYB A;  2L7F P;  2AHQ A;  3W2V A;  3DFG A;  4BDZ A;  2F5V A;  1J09 A;  4Y52 J;  2A5Y B;  4DGW B;  5HLI A;  4BUP A;  5KAI C;  2MFZ A;  5E79 C;  3R61 A;  2CQ7 A;  3DEE A;  1S7O A;  3KEO A;  3JRE A;  4XON A;  4Y15 A;  1FNN A;  1MBH A;  3TDU C;  2HDD A;  2ESH A;  3LWF A;  5ILV A;  4CCO A;  4L5I A;  3ONQ A;  2KQR A;  2JA7 J;  3W2W A;  5JLW A;  3F8C A;  3KEQ A;  1A35 A;  1KU7 A;  3CF2 A;  3LQR A;  4UB8 C;  1MD0 A;  1QZY A;  5DCM A;  4ZZL A;  1Z91 A;  3B6A A;  1IO2 A;  2DK5 A;  4LGW A;  2P5K A;  4LOC A;  1ZR4 A;  3IRR A;  2JZY A;  3DPT A;  2EZK A;  4PJ0 C;  5FRO A;  4XRM A;  1K79 A;  1FTZ A;  1WGX A;  3CMY A;  2HOT A;  1BR4 A;  2CU7 A;  1FY7 A;  2WB1 N;  1PUF B;  4A6D A;  2EIJ H;  2E19 A;  1XGO A;  2GLO A;  2RQP A;  1O3S A;  2GA1 A;  3KYD B;  3MD2 A;  4C2U A;  3SYT A;  3AG1 H;  3DCF A;  3GCM A;  4A3G J;  2YSR A;  3H36 A;  3QOE A;  2WWY A;  2XSD C;  1VF9 A;  1PJR A;  3EUK L;  1TQP A;  1ON1 A;  3CLQ A;  3KLO A;  1S8N A;  5FD6 A;  5CPR B;  3ELK A;  1V5G A;  1WCM J;  1S72 I;  4AVP A;  1SAN A;  3GXO A;  2EFQ A;  4LFU A;  3HOT A;  4HPQ A;  5EEA A;  5FKK A;  4EJT A;  2IS6 A;  2K86 A;  4UY8 I;  2IGM A;  1G3W A;  1IRF A;  4Q4Z F;  2LBF A;  3OYH A;  2PMZ N;  2HYJ A;  3ESW B;  3KIO A;  3S2D J;  3WGI A;  1QGP A;  2B63 J;  3LSI A;  2JVG A;  1MSF C;  4OMZ A;  3CDL A;  4M6Y A;  3VEP A;  4AIK A;  1W0T A;  3JRB A;  2G7H A;  1F43 A;  3P9K A;  5J4V A;  2D2W A;  3AAF A;  2CFO A;  3DQV C;  3HRM A;  3IAM 2;  1IXR C;  1WJD A;  1X1A A;  4L9J A;  2GIZ A;  4LG3 A;  2M4G A;  2TCT A;  2LFB A;  4MGR A;  4FE4 A;  2PX9 A;  1Q1V A;  1RZ4 A;  2DCE A;  3L2C A;  1UAA A;  1D8J A;  2DMU A;  1R58 A;  5D5X B;  2QZ8 A;  1S5L C;  4B43 A;  1I3Q J;  3MZH A;  3HOX J;  2HTS A;  4AIJ A;  4PZJ A;  2DAO A;  2RGV A;  3CC4 I;  2EA2 A;  4LIT A;  3CCY A;  4ESB A;  1QVT A;  3DBR B;  3PM1 A;  4CCK A;  4EJO A;  1P6R A;  3SJM A;  2WV1 A;  2PJR A;  3FIW A;  1STZ A;  2KIS A;  1X1C A;  3I5U A;  4PDK A;  3CES A;  3HXL A;  4DZP A;  5FLV A;  2L3D A;  4EVI A;  4UVB A;  4AYB N;  4YFX F;  5GP9 A;  5L3F A;  2PMZ A;  5F0H A;  2V79 A;  3HIF A;  3RKX A;  4CO8 A;  3F8M A;  2NOJ B;  3GX4 X;  1RUN A;  2H1L A;  1D5V A;  5DM6 F;  2IGK A;  1N75 A;  1ZHF A;  4EJU A;  1YW8 A;  1NG7 A;  2ZC2 A;  3HOW J;  1UG0 A;  3AL0 C;  1ZG3 A;  1T0F C;  1AKH B;  4ENM A;  4GXO A;  3FXM A;  5J6X A;  4MIM A;  1Y1V J;  3HM5 A;  3CP2 A;  2EJR A;  1FIP A;  2M34 A;  3FKJ A;  4XSX F;  2FA5 A;  2DQR A;  4P9U A;  4IRI A;  1T39 A;  4JP0 A;  3CJN A;  4FT8 A;  4C3J J;  1EH8 A;  4BYY A;  2XF5 A;  2Z1D A;  3PO2 J;  3KYC B;  2LKX A;  1U8B A;  4XNF A;  3DPU A;  3N4M A;  2E7X A;  1EV7 A;  4Q5S F;  4QSH A;  3P5J A;  1WHU A;  2COB A;  4II2 A;  4D5F A;  2XB5 A;  2EFN A;  5DD4 A;  1BI0 A;  3FZV A;  1X3Z B;  3KYL A;  2FOW A;  3L00 A;  5ERI A;  3OIQ A;  5HOD A;  3RZD J;  4HST A;  2DK8 A;  4ESF A;  1FEX A;  2LP0 A;  4IEJ A;  4FAS D;  4A3I J;  3WG7 H;  4G6T B;  3Q5F A;  3LSJ A;  1JTX A;  4B47 A;  2KT0 A;  1WRJ A;  4M6X A;  3ZMZ A;  2IPQ X;  2E2H J;  4EGY A;  2IS4 A;  2FNP A;  1Z05 A;  1X4O A;  3M3Y J;  2VON A;  2Y0S A;  3ZMT A;  3K7A J;  4HRI A;  1T56 A;  1F4K A;  2R7V A;  5IT3 A;  1XMX A;  4BQQ A;  2GM4 A;  5HNF A;  2R92 J;  3LQQ A;  2V6E A;  2MC4 A;  1Q1H A;  2BZT A;  3BJO A;  2VL8 A;  2R7O A;  1I50 J;  2HU9 A;  4E6K G;  5DDG A;  4HF1 A;  1P4X A;  3FXO A;  2B7E A;  4EGZ A;  3BR5 A;  1P7J A;  2IGN A;  3OS1 A;  4HX4 A;  3F6O A;  2DPU A;  2RNG A;  4M3E A;  3HOU J;  5AIQ A;  5EJC A;  1Y56 A;  3H3V K;  2HGC A;  1DGW Y;  3PL8 A;  2ME0 A;  2CMP A;  1Y6I A;  2RVC A;  3G3Z A;  2QSH X;  2LH9 A;  1Z3Y A;  2KIQ A;  4BEH B;  2FML A;  1YS7 A;  1XGN A;  4KIS A;  3PFI A;  2O7O A;  3JRA A;  2LF8 A;  3SDG A;  3S14 J;  2WY7 Q;  1T95 A;  1XSV A;  3NQO A;  2V1N A;  2HVS A;  2KPM A;  4XKB A;  3GTQ J;  2M45 A;  3HOV J;  2UUZ A;  3LA3 A;  2LYC A;  2H1K A;  4ZYE A;  3K4K A;  3GEZ A;  1VQ7 I;  1T08 B;  3GTP J;  2VBZ A;  2OC6 A;  1T33 A;  3GZ6 A;  1EKE A;  2VOO A;  1G4D A;  2O0Y A;  3DBH B;  4YG2 F;  2KDO A;  3IUO A;  1MH4 A;  2UXN A;  3RQ4 A;  4BAC A;  2L9V A;  2DMQ A;  5K5Q A;  2H8R A;  1I3A A;  2D1V A;  3DPL C;  2OPT A;  3KLN A;  3S93 A;  4BGD A;  4KT6 A;  2JA2 A;  5IY5 H;  3F8F A;  5ICG A;  3K9T A;  3OYK A;  1TT0 A;  3AG3 H;  2XRL A;  3E6M A;  5IP7 J;  2P6S A;  3L7W A;  2JSP A;  2R7F A;  3G1O A;  1IG7 A;  2STT A;  4UB6 C;  2D5V A;  2RV8 A;  1D0Y A;  3K1P A;  4GO1 A;  3RTR A;  3WOD F;  5HDN A;  1UHS A;  3FKI J;  3RI4 A;  2HQN A;  1A04 A;  3IHU A;  2Y30 A;  1WKM A;  2IVM A;  3ZQ7 A;  4JK1 X;  1E3P A;  2XPV A;  4I99 C;  5GTH C;  4S04 A;  2IRF G;  4IHS A;  3GTO J;  1SMY F;  2ZXW H;  2V1U A;  1IN4 A;  2CUJ A;  3S32 A;  1MDM A;  4HYE A;  1JKO C;  3LST A;  2XAH A;  3E5X A;  3FHN A;  1G3T A;  3DKW A;  1WVR A;  4M3D A;  2XGC A;  1OYI A;  1W7P B;  2Q0O A;  2E71 A;  2LDU A;  3IH4 A;  3Q9V A;  2VBW A;  1GDT A;  4EQQ A;  1W7P A;  3RJP A;  1ZG5 A;  3CCS I;  1ETY A;  4AM3 A;  2R7Q A;  2HXO A;  3OL3 A;  2VLA A;  1VQ9 I;  3ZMS A;  1T38 A;  2W84 A;  3CCL I;  5M5W J;  3D5L A;  1KON A;  4V19 K;  4D0P A;  2GIV A;  3L2V A;  2HOS A;  1VI0 A;  4W1U A;  4XKV A;  1VQP I;  2DA4 A;  3OYM A;  2QBY A;  3GTM J;  1LFP A;  2CV0 A;  2P6T A;  3I4M J;  3HL2 A;  2R0Q C;  4JOM A;  1JI8 A;  1YYV A;  3LAP A;  3OYB A;  1F5T A;  2AO9 A;  2AXL A;  2CQQ A;  5E17 F;  3B73 A;  4E4H A;  4N4O B;  1YIO A;  2L9R A;  5J1U A;  1BJA A;  1IW7 F;  3I54 A;  1ZK8 A;  3PQJ A;  2OQR A;  4FHT A;  1KZH A;  4BXU A;  2B0L A;  2E1M B;  1I27 A;  3IAS 2;  3FMQ A;  2NS7 A;  3JAM Z;  4XL9 A;  4HX8 A;  4ENK A;  1P7I A;  1R23 A;  4ETS A;  4UVC A;  1U0J A;  5CVR A;  3PNV A;  1MSE C;  2EFW A;  3U1K A;  3LSP A;  1ZGA A;  2ZFU A;  3L2Q A;  1ZEL A;  2DFI A;  2HFH A;  3BG5 A;  5FLM J;  1MNM C;  1I6H J;  2BEO A;  2MH9 A;  1G59 A;  1FJL A;  3BCA A;  1OLT A;  2X9D A;  3GWZ A;  4DYQ A;  5J4Y A;  2CG4 A;  1J59 A;  3CJT B;  1HLV A;  1D1C A;  3WU1 B;  2OBP A;  4L5J A;  2B9S A;  4NB5 A;  4ZYA A;  2BHZ A;  5LD2 C;  4OU0 A;  3KZI C;  1XS9 A;  1SC7 A;  2OA4 A;  2XUB A;  4IXA A;  4KIG A;  5D6F A;  4HBL A;  4S05 A;  5EDN A;  3BR3 A;  2HEO A;  5M5Y J;  4W97 A;  3C2B A;  1U2W A;  3A2K A;  3QQA A;  2KRC A;  3QWL A;  4RLF A;  2BW3 B;  4JX4 A;  1UZC A;  3M1C A;  4XK4 A;  3SXY A;  2V26 A;  2HOA A;  2EZH A;  3MQ0 A;  3KZY A;  4NC7 A;  2M2E A;  2WA0 A;  3M07 A;  5TGT A;  2L7M P;  4XIC A;  2V9V A;  2ZJQ F;  4MFD A;  2JJ7 A;  3RKW A;  5FB2 A;  4CDG A;  4BU2 A;  2Q2E A;  1OCR H;  2FSW A;  3J80 K;  2YX4 A;  2AXT C;  1NTC A;  3J7A Y;  4QWQ A;  2CS3 A;  5IYB J;  2F48 A;  1PVE A;  1AA7 A;  5BPD A;  4A3F J;  1XX5 A;  1BC7 C;  4JX6 A;  5K7F A;  2MA3 A;  3QRF F;  1FPQ A;  5IT9 Z;  1SD5 A;  1GLN A;  1JKR C;  5F27 A;  1FBS A;  2PBI A;  2OD5 A;  4BY1 J;  1WI3 A;  2UZK A;  4HLY A;  2EK5 A;  4B48 A;  3S3M A;  1FMV A;  1RNL A;  1DPR A;  2UWM A;  4RDU A;  1XG1 A;  1VQO I;  2FOK A;  1Y8Q B;  3GYH X;  4CYC B;  1TC3 C;  3TMO A;  3OYJ A;  1IDZ A;  4HNU A;  4GGG A;  2QQ9 A;  3OS2 A;  3GF2 A;  1XMK A;  2JTV A;  2XF7 A;  4RAG A;  5LBQ A;  3G71 I;  1SFK A;  5CVU A;  2XAU A;  4HNV A;  5L3E A;  1CGP A;  1FYK A;  2O03 A;  5DUK A;  3WU0 A;  2KIF A;  5HS7 A;  1HKQ A;  4A0Z A;  2G7U A;  1JUS A;  1UJ8 A;  2R5Y A;  1XGS A;  3JR9 A;  1ULY A;  3C2H A;  5KK1 A;  4A2U A;  5F1R A;  2DJI A;  3HUG A;  4XRS G;  3I53 A;  4EM1 A;  1P4A A;  2K9M A;  3F3X A;  1TLH B;  3BRO A;  4GFB A;  3DF8 A;  3F21 A;  2P7V B;  5FGM A;  3HDD A;  1R4M B;  3L2R A;  1MZB A;  3CP8 A;  1XDU A;  2VQG A;  2KJB A;  2A5W A;  3UNG C;  2MD5 A;  1X4P A;  2VKV A;  4D9J A;  2DA1 A;  2LF7 A;  5LHI A;  1HKS A;  1E0E A;  3SZP A;  4BH9 A;  3BDD A;  1IN7 A;  2H6C A;  2PMU A;  4YII A;  2M8G X;  4Y17 A;  3CF5 F;  3L2U A;  2MBF A;  1TWA J;  2Q2E B;  1EF4 A;  1MMG A;  3HSE A;  3RQI A;  3SFZ A;  2D1H A;  2KZV A;  2K9Q A;  4UV9 A;  4DBR A;  2FF4 A;  2E35 A;  4S0H B;  4CZZ A;  5HLH A;  1X2M A;  3V4G A;  2O8K A;  1REP C;  1I5Z A;  3IL2 A;  4LIU A;  2DA5 A;  3BY6 A;  3BWG A;  3J7A O;  4HX7 A;  3ZQQ A;  1D5Y A;  1VND A;  1PUE E;  3KP2 A;  4NQW A;  3NAU A;  2DA3 A;  5F08 A;  1WJB A;  1O3T A;  1H9G A;  1QZZ A;  1JT0 A;  1HW5 A;  1Y0U A;  4M3F A;  1TWF J;  2DYS H;  5HOO A;  2FJ1 A;  2LKP A;  2L2O A;  2RC4 A;  2ISY A;  2BVL A;  5ICF A;  2BXZ A;  4CCJ A;  4UV8 A;  1FTT A;  2M4K A;  2CQX A;  4BL0 B;  4P96 A;  4OIN F;  5K7Z A;  1G2H A;  3E7L A;  3AKZ A;  2AQE A;  1HBX G;  2FD5 A;  4O6J A;  1IN8 A;  1RUO A;  2R5Z A;  1IC8 A;  4IRH A;  1S7A A;  2OZU A;  1UFM A;  3KPH A;  5TIS C;  1BW5 A;  1BBY A;  4OIO F;  4XSZ F;  1R00 A;  1ZLJ A;  2EV0 A;  3NWT A;  2JUC A;  1NK2 P;  2WY8 Q;  3HHH A;  2K7L A;  2GOM A;  5DCM B;  1YO5 C;  1FOX A;  2NVX J;  2V1X A;  2K5C A;  4QPQ A;  1ZN2 A;  3OMY A;  2A68 F;  2LTP A;  1W4M A;  1FBU A;  1V54 H;  3U9G A;  2Z33 A;  1K6O A;  1XDS A;  3PNY A;  3S1Q J;  3K6G A;  3CQZ J;  3MZY A;  3CUQ B;  2VOD A;  5CYV A;  3LSH A;  3AG2 H;  2WAD A;  5F6F A;  1YJN I;  1TP4 A;  5EGO A;  2DT7 B;  2ZXH A;  1ETO A;  4CYD A;  2M3A A;  2HNH A;  3FIS A;  3R60 A;  3A02 A;  1WH7 A;  1K78 B;  2W24 A;  2A07 F;  4OAZ A;  4PUS A;  2QBY B;  2KL4 A;  3E5U A;  1O3R A;  1HCR A;  1O7F A;  2VT3 A;  2DPD A;  2KFD A;  1HDP A;  5DCF A;  2BBY A;  2QQA A;  3HSR A;  5KVR A;  3UR3 C;  4E7Z A;  2E1M C;  1BL0 A;  3L1P A;  2YX7 A;  1VQ4 I;  2JVH A;  3LFU A;  3CDI A;  4MFE A;  5H6R A;  3Q0V A;  1XGM A;  1K4T A;  1EH7 A;  1OR7 A;  2M8E A;  3JCU C;  3PIP F;  5J8C A;  1ZQ3 P;  3LA2 A;  2XSJ C;  3RPU A;  4RAY A;  5EF6 A;  6PAX A;  1HXD A;  4XID A;  5EEG A;  1Z0X A;  3TP0 A;  3CCQ I;  1HSJ A;  1MBE A;  2HVR A;  1Y1W J;  1BIB A;  2QSF X;  2QWW A;  5L3C A;  2E2I J;  1IUF A;  4ZDO A;  1GHC A;  2HZD A;  1MJ9 A;  4CIC A;  5J1Y A;  3ISP A;  1Z7L A;  3WGH A;  3S8P A;  3ZQL A;  2LRD A;  3OYD A;  3BR6 A;  4C3I J;  4A3B J;  1MGT A;  2XKP A;  1Z6T A;  4ASN A;  1F9N A;  4G7O F;  4BEH A;  4RMN A;  3H0D A;  3WHB A;  3JRF A;  1KQ0 A;  3FBN B;  1BOA A;  4IOA F;  1I1G A;  2CGP A;  2RDP A;  5CVV A;  3DKX A;  1ZRE A;  1KA8 A;  5EZH A;  1TNT A;  4KDP A;  3V8J A;  3I64 A;  1K78 A;  5DV5 A;  1D0X A;  1Z67 A;  3A01 B;  3IWZ A;  3PO3 J;  1I1S A;  2GBY A;  2ESN A;  4EM0 B;  1PYV A;  2CW0 F;  3FMS A;  5CVI A;  1B59 A;  4AVZ A;  1RIO H;  1OFC X;  4XRS A;  1ZTR A;  2JT1 A;  3IKV A;  4MTD A;  1HOM A;  4KMU X;  2VI6 A;  1W0U A;  2CWE A;  3TW6 A;  4HG2 A;  2I5U A;  3P9C A;  4XLC A;  4KN4 X;  2M7B A;  2NRA C;  2PN6 A;  4V2G A;  2CW8 A;  1AOY A;  4Q47 A;  3M8J A;  5ICC A;  1PP8 F;  2ELK A;  1U9N A;  3GFL A;  5TJJ A;  3IH3 A;  1A36 A;  4ANJ A;  1FLI A;  2YU3 A;  1UCR A;  3S15 J;  1R71 A;  2WC2 A;  1JTY A;  3S2W A;  1E3H A;  2ZFW A;  3KEY A;  1Y8R B;  4JBA A;  1LDD A;  2LY1 A;  3S3O A;  3DTK A;  3OSF A;  1UST A;  3AFH A;  2ADU A;  1EH6 A;  5EG0 A;  2ZXJ A;  3HRU A;  3H5A A;  3LOC A;  2A6E F;  3RKY A;  5EGO B;  4F91 B;  2I10 A;  1AWC A;  5HS9 A;  3GFM A;  3VYS B;  5D5V B;  2VQH A;  1KQ8 A;  4AWX B;  3EUH A;  1R1V A;  4HOB A;  4U88 A;  1R5I D;  1VZ0 A;  4XKC A;  2LNB A;  2M30 A;  3OYE A;  2EPF A;  1KQ9 A;  2ZNZ A;  4LB5 A;  4A5M A;  2YR2 A;  2FBI A;  4Y13 A;  4IHT A;  3FXR A;  3V8L A;  1FP2 A;  1TZL A;  4K2E A;  5D8K B;  1ETW A;  1TNS A;  4DNC A;  3OYG A;  3WTT C;  1LVK A;  2PI0 A;  5B5E C;  1F1Z A;  3W6K B;  4E7K A;  3VDX A;  4ZJZ A;  1V3F A;  1U6G A;  4A3J J;  4CCM A;  2OCC H;  1WJC A;  2R3S A;  3QP6 A;  3M7G A;  1HDD C;  4ZDL A;  2WV0 A;  4IQ4 A;  2Y69 H;  2LRE A;  4EV0 A;  4IHY A;  1QVU A;  3F72 A;  2OTJ I;  4HNT A;  3GME A;  4ENN A;  2BV6 A;  3BG9 A;  1YFH A;  4KMF A;  3J81 Z;  1YW7 A;  2HDW A;  3KET A;  2EFO A;  3TBI A;  3DLL F;  4IHX A;  3BG6 A;  5GPA A;  3BTC A;  3BJA A;  3Q0U A;  4XOP A;  5F1J A;  5AIP A;  1HF0 A;  2COM A;  1A6I A;  1ZAO A;  3ROU A;  2GOX B;  3K1M A;  2R7W A;  3FXQ A;  4JX5 A;  4ZTF A;  5D4S A;  2X0L A;  1BR1 A;  4MQ9 F;  4C2M J;  4OIR F;  4DYC A;  5HNH A;  2M7A A;  4IQJ A;  1ZRD A;  2HYF A;  4M72 A;  3JSP A;  2DFF A;  4XLN F;  3P7N A;  3HGG A;  2DOF A;  3H5R A;  1LNW A;  5JVT A;  2ME6 A;  2DFE A;  1J7K A;  2VQC A;  1U5T A;  4MNU A;  5E3O A;  4KJZ A;  3EUA A;  1F36 A;  4LG0 A;  1LJ9 A;  1M1E B;  2X85 A;  1VQL I;  2DXI A;  3S2H J;  2NS8 A;  3WG9 A;  1FIA A;  4U0V A;  2PJR B;  1JKP C;  1Z7U A;  4XOR A;  5K5O A;  3M8F A;  1H9T A;  2GWR A;  3WTV C;  2NXN B;  1X1D A;  3A1Y A;  4L0Z B;  4F52 A;  1RET A;  1WI9 A;  2VJ4 A;  3EQL F;  4FX4 A;  4PJM A;  2OJE D;  2XKO A;  1JT6 A;  3J7Z I;  5LRR A;  2EIK H;  3RYP A;  4EJV A;  1LQ1 A;  4RGX A;  4RM3 A;  4RB1 A;  4A3L J;  1CF7 A;  3ZQH A;  3QYB A;  2J5O A;  3R4K A;  3VSL A;  4NBQ A;  5LHH A;  1LE8 B;  5DTD A;  5KHD A;  3J81 K;  3COA C;  1SFE A;  1B6A A;  2C6Y A;  2STW A;  2O5R A;  5FLX K;  2ISZ A;  2XDV A;  1UEL B;  1G3S A;  2IAI A;  2P8T A;  4NDL A;  5L3D A;  3RZO J;  2RRE A;  4IOC F;  3X2Q H;  3PSI A;  4M9S A;  4UXN A;  2VKD A;  2CQK A;  3SFI A;  5HLT A;  2XAJ A;  3TW7 A;  2Z9O A;  3H9Q A;  4LK1 F;  2KIU A;  2DMT A;  3E6C C;  3GO5 A;  1U9O A;  2JPB A;  2UXX A;  4B44 A;  2EIN H;  1R5H A;  3MVP A;  1USS A;  3K69 A;  4F55 A;  1X3U A;  4IHV A;  4I2O A;  2DYR H;  3HUG B;  4JQF A;  3REO A;  3V7R A;  2XV4 S;  3EET A;  2OTL I;  3RKQ A;  3I4N J;  2VC1 A;  2Y9Y A;  4MEY F;  3DEU A;  4PFO A;  2IJL A;  3B02 A;  1RR7 A;  2LMD A;  3JAM K;  3CCE I;  4L0Y B;  4N4N B;  4IVN A;  3HZJ A;  1HQC A;  3ABK H;  1KU3 A;  2E1N A;  2HI3 A;  4IPA A;  3PSF A;  1U78 A;  1XSD A;  2K9N A;  1LE8 A;  4PJN A;  4WXC A;  4CYC A;  4IX7 A;  1QA6 A;  3ERE D;  4KN7 X;  3FBI B;  2MYS A;  3DU5 A;  1KGS A;  3T8T A;  4B3A A;  4EM2 A;  2RNJ A;  5GAE J;  5E3N A;  1Y0N A;  1V4R A;  1R36 A;  5LGT A;  2VXZ A;  2X6Y A;  4RAZ A;  3GW2 A;  1MIJ A;  2IA1 A;  4UUS B;  2L7Z A;  2FUG 2;  2QYO A;  1WQ2 A;  3HTU A;  2NNY A;  3BR0 A;  2M5W A;  2HZT A;  2LR8 A;  5F0F A;  3ULQ B;  1W5S A;  1VTN C;  5E18 F;  4G9Y A;  1LDJ A;  4I01 A;  5ED4 A;  1WFX A;  1QQI A;  1WJ5 A;  3C1D A;  5HDK A;  1B8I A;  1LVA A;  2K9L A;  2Z2S B;  2MLK A;  3OYL A;  4A0X A;  4B3X A;  4FE7 A;  1I39 A;  3NRV A;  4WCG A;  4FQG A;  3G1M A;  2JRM A;  5E8G A;  2Q8K A;  4EAT A;  2QA4 I;  1QHG A;  2L9S A;  2KJC A;  2LG4 A;  4I7H A;  1ZKG A;  3FM3 A;  2M1B A;  3I71 A;  4J19 A;  3LSM A;  5J40 A;  2R4G A;  2JA6 J;  5E8I A;  2IP2 A;  1X1P A;  2ZSI B;  1RC9 A;  4JYK A;  1K4S A;  1ZH5 A;  2KLO A;  1YOV B;  4V2F A;  2IA0 A;  3OS0 A;  2HQ5 A;  5ILU A;  2OCE A;  3BZC A;  4Y33 A;  3FXJ A;  3ECO A;  3S3N A;  3FHZ A;  4MTE A;  2BE5 F;  1TQI A;  4RS8 A;  2XC7 A;  3JRI A;  3PQK A;  3TO7 A;  2QKL B;  4XRF A;  4XLE A;  1RPW A;  1NH3 A;  1MBF A;  1OIS A;  1O57 A;  2KIM A;  1SEU A;  5FRN A;  1ODD A;  2ZB9 A;  3K4J A;  2HPI A;  3K70 C;  2Z3Y A;  1H89 C;  4M73 A;  2GXG A;  2HKO A;  3OYF A;  4BBR J;  2KRH A;  5F64 A;  3H9J A;  4P5O A;  3V7C A;  2BYV E;  1K6Y A;  2WTE A;  3W6J B;  1TBX A;  3IKT A;  3SEQ A;  1YRN B;  2KDZ A;  5F0C A;  3FX3 A;  3HRT A;  4U0Y A;  1A31 A;  1XC5 A;  2GQQ A;  2X6O A;  3S17 J;  2EA4 A;  3I58 A;  3TKY A;  1JKQ C;  1JGS A;  2L0K A;  2G9W A;  4XMY A;  1KU2 A;  2LBF B;  5J1R A;  4FCY A;  4PGH A;  3GUD A;  5C4X J;  1SFO J;  1RKW A;  4BBS J;  5FKL A;  1KYW A;  2XAG A;  3HC7 A;  1XCB A;  1GVJ A;  4HA8 A;  5H20 A;  4HDV A;  1GV5 A;  3FXL A;  2E60 A;  1B9N A;  4M3B A;  1T8I A;  2L4A A;  4U7B A;  5LFA A;  2R93 J;  4LIV A;  2BGC A;  2DA6 A;  4BJT A;  1YQA A;  2X51 A;  3K10 A;  1DQU A;  3VPR A;  5E3L A;  4WK8 F;  3WTX C;  2KHM A;  3M1E A;  4M9Z A;  3BTL A;  3SHF A;  2UV1 A;  3E6D A;  1OQY A;  2YS9 A;  1LEA A;  3TO6 A;  4BS9 A;  5BMZ A;  2EZL A;  3S1M J;  1PDN C;  4E7L A;  1ZGW A;  1N25 A;  4O5V A;  3F8B A;  4RLQ A;  3LSG A;  1LPQ A;  1ZGJ A;  4DOZ A;  1LDK B;  3FK7 A;  1BW6 A;  3IWF A;  2W4S A;  2K4J A;  1T6S A;  4G94 A;  4G7Z F;  3MFK A;  3GVA A;  1IXC A;  2LOO A;  4KIF A;  1J0R A;  4A3C J;  4UVA A;  3MKZ A;  5KCM A;  1APL C;  4M6V A;  1X1B A;  3KP3 A;  5BNG A;  5JFR A;  3I9V 2;  2K3F A;  3OYC A;  3TGN A;  5FO5 A;  3ZQF A;  1Z9C A;  2NS0 A;  2L02 A;  2CH0 A;  5EZG A;  1GXP A;  2XGD A;  4BQA A;  1ERD A;  3ZRG A;  3OYI A;  1MJA A;  3F6V A;  1MMA A;  3A0B C;  3QOD A;  4I0B A;  3H35 A;  2MAB A;  2VUM J;  2BHY A;  1JJ6 C;  4GYG A;  3OSG A;  3JRC A;  4R79 A;  2O6G E;  2OV7 A;  2MW8 A;  1XB4 A;  3I4P A;  3RDI A;  3SQN A;  1YTY A;  2CV2 A;  1OPC A;  3CCM I;  3BP8 A;  2VKH A;  4UHT A;  5KAF C;  1IAW A;  4HAM A;  1ETX A;  2NVY J;  1R5G A;  4IJA A;  4DJA A;  4OIQ F;  1GXQ A;  2DBB A;  5HVQ C;  1SD6 A;  3D1N I;  3LSK A;  1POG A;  1FBQ A;  4UUT A;  1BOB A;  2ECC A;  2QEN A;  1LB2 A;  3QPH A;  3O3K A;  3TED A;  2OUM A;  3SEZ A;  4RAF A;  3WE2 A;  4H0E A;  2DDA A;  3SZT A;  4BHB A;  3F8N A;  3CJQ B;  3Q0W A;  5GTI C;  1ETK A;  3HEF A;  1L3L A;  2DFH A;  1ACI A;  2BY3 A;  3HOZ J;  1JGG A;  1FWZ A;  2P4W A;  1DU6 A;  4BE0 A;  3RPQ A;  2X6X A;  1WPK A;  4A5N A;  4KFC A;  1K61 A;  1S7E A;  4A12 A;  1BM9 A;  1WJA A;  3F23 A;  2Y75 A;  3MN2 A;  4KUM A;  4I0A A;  3LA7 A;  3LL7 A;  1S3J A;  3ZPL A;  5E20 A;  4BE1 A;  2LY9 A;  4ON0 A;  1BR2 A;  2XB0 X;  4CSW A;  4N9H A;  3V8K A;  2NNN A;  5BOX A;  2IS1 A;  1J9I A;  2EQR A;  4PGG A;  5FD5 A;  3H92 A;  2ZSH B;  3R6S A;  5JVG F;  5IP6 A;  2PFB A;  2YPR A;  4Y4R A;  2GZW A;  2LVS A;  3FM5 A;  2RAE A;  3FK6 A;  1D3Y A;  2LY2 A;  5BS6 A;  2ID3 A;  4MEX F;  1SD7 A;  4I6Z A;  4ABZ A;  2HS5 A;  4HF2 A;  1B1B A;  2M87 A;  4L9N A;  2P81 A;  2GAU A;  2A69 F;  1QRY A;  3HG9 A;  4L9V A;  4GCV A;  5K5R A;  3EYI A;  4CA0 A;  4Z6Y A;  4HV6 A;  5A2Q Z;  4J00 A;  1HC8 A;  2TRT A;  2VXD A;  3ERM A;  1W5C C;  2DLL A;  2HR3 A;  1MBK A;  1U5T B;  3I0T A;  1VFC A;  2V4J C;  1BA5 A;  1TL8 A;  1OMI A;  2Q1Z B;  2ETH A;  5L3G A;  1HA8 A;  1JUM A;  4RGR A;  3ABU A;  3BZK A;  2NOG A;  2O8X A;  4Y3O A;  2JQ7 A;  1FSH A;  4M74 A;  2VBY A;  2LK2 A;  2OQG A;  3NWS A;  1JXS A;  1V5E A;  2GXA A;  2W82 A;  2DJN A;  5B1A H;  1E3O C;  2QSG X;  4NC8 A;  3OYA A;  2VKE A;  1R49 A;  1MND A;  4KIC A;  3HPG A;  5H2F C;  2P0W A;  2MH2 A;  2VBX A;  3CJR B;  1IJW C;  1ORK A;  1JHF A;  1OCC H;  3T1B A;  3RCO A;  1LFU P;  3ZMV A;  4NNJ A;  3G2B A;  3ABT A;  3CUQ C;  4RBO A;  2R7S A;  4YFK F;  5K1Y A;  5IP9 J;  5F04 A;  3WTZ A;  2QGU A;  4B8X A;  4X0G A;  1IF1 A;  3QOP A;  2VJJ A;  2ECB A;  5DM7 F;  3CCJ I;  4X1E A;  1X2N A;  3KCC A;  4G6D A;  4YFN F;  4IRG A;  1K83 J;  3HSF A;  2F5C A;  4ZYG A;  5DYM A;  2EZI A;  2QM3 A;  2E1C A;  3VWB A;  5B3S H;  4L9T A;  4C30 A;  3KP7 A;  2Z5U A;  5FKM A;  3H9G A;  2DMP A;  2EIM H;  3HBL A;  2DA2 A;  1FOK A;  3MWM A;  2IEK A;  1MNE A;  2ZJP F;  2CFX A;  2Y31 A;  2R7U A;  3WE3 A;  5M3M J;  5D5U B;  4B1R A;  4YIF A;  4YRV A;  1JHH A;  4CGZ A;  3G1L A;  2QQB A;  4RB0 A;  5LEK A;  1BN5 A;  2PEX A;  4L5E A;  4RB3 C;  4HV5 A;  2K9S A;  4J01 A;  1QU3 A;  3N05 A;  2CYY A;  1IXS B;  2W00 A;  1S29 A;  3TDZ C;  1ENH A;  5D8L B;  2DI3 A;  4OOI A;  4BXF A;  3B6C A;  1J5Y A;  5D4R A;  4L18 B;  3CMM A;  2WBM A;  1HW2 A;  1Z1D A;  2V7F A;  3IH2 A;  2FE3 A;  3CC7 I;  3DKY A;  3T5X A;  5E1W A;  2HTJ A;  3K4B A;  2V1D A;  4D7M A;  1X58 A;  2W85 A;  3C3W A;  5TRD A;  5IYD J;  3PUB A;  1EJ9 A;  3M9A A;  4EMS A;  2HXI A;  3BPX A;  2XAF A;  2DU9 A;  3G6E I;  2EFP A;  5EYR A;  1AHD P;  2HOE A;  2ZKZ A;  1PP7 U;  2DMN A;  2VQL A;  1QZE A;  1EA3 A;  3V42 A;  4DZJ A;  3WTS C;  2H27 A;  3ZN1 A;  1NK3 P;  2EIL H;  4LJZ F;  3ZOB A;  4IZZ A;  3N97 A;  2JA8 J;  3PUF A;  1R9T J;  1XSX A;  4PFP A;  2L7K A;  3DWL E;  4TV7 A;  5LEJ A;  3WGG A;  2IA2 A;  1B8I B;  1QPM A;  2ZJ2 A;  1ITY A;  3MMY B;  3TOB A;  3M8E A;  2D45 A;  4G12 A;  2QLZ A;  3BJ6 A;  1YJ9 I;  1U3E M;  1IGN A;  4YEL A;  4IHW A;  2J5P A;  3VOD A;  3BTI A;  3ZXS A;  4KA4 A;  1Z21 A;  2IXS A;  4ZYH A;  1G6N A;  1D8K A;  2IS2 A;  1YLF A;  1SVM A;  1GVD A;  4MHG A;  3HYI A;  4WF2 A;  1DU0 A;  4D1Q A;  4UNO A;  1LEB A;  3KX2 A;  3CC2 I;  2IBD A;  1SD4 A;  3A0H C;  3GFJ A;  4ZZD A;  2DQL A;  2VPR A;  4XLP F;  2QUF A;  3LAJ A;  1VQN I;  2VJI A;  3I59 B;  1MJB A;  3GZ5 A;  1MH3 A;  1LFB A;  3WHC A;  1DPU A;  4NC6 A;  3KP6 A;  4DYR A;  2TDX A;  4CZC A;  2QF7 A;  1HKT A;  1A6Q A;  3MAJ A;  1KYZ A;  2BW3 A;  2M0M A;  1MMN A;  3CME I;  4HZF A;  5FJ8 J;  2F5D A;  2H6B A;  1ZRF A;  4C3H J;  3HKZ N;  2ZNY A;  3J7Y J;  3K70 D;  3TP3 A;  1IUY A;  2YUS A;  2FBK A;  2N8G A;  2F6C A;  4DIQ A;  4C2T A;  1IV8 A;  3LNQ A;  1ETV A;  4OIP F;  1UHM A;  1P9Q C;  3ZQC A;  2X4H A;  3CUQ A;  3VYU B;  4N9I A;  5JR3 A;  4QLC U;  5HLG A;  1R4N B;  3TQN A;  3ZP5 A;  3QYF A;  3OR1 C;  3F22 A;  3IRQ A;  5LRS A;  2DO7 A;  2W48 A;  1YG2 A;  2QCO A;  5CLS A;  4LLG F;  2EH3 A;  1JE8 A;  1IN6 A;  3C18 A;  3VFZ A;  4BDY A;  1IRX A;  1OCO H;  1YHQ I;  1TQM A;  2R7R A;  2A6H F;  3VOE A;  3MCZ A;  4LK0 F;  2W7N A;  5BPI A;  3GLX A;  4PSW A;  2XRN A;  1NG6 A;  1VQ8 I;  1YX5 A;  1MMS A;  2WAQ N;  3QPL A;  1QPI A;  2ZCW A;  1GV2 A;  4C9Y A;  4GDF A;  4LD5 A;  1WZ2 A;  2JPC A;  3HKZ A;  2DTZ A;  2R7X A;  4E7J A;  3L2W A;  3H0G J;  2Z99 A;  1P92 A;  5FLX Z;  2DOA A;  1XN7 A;  1VQK I;  3A01 A;  4HSR A;  1FOY A;  5DS9 A;  5CKT A;  2JUG A;  4HDU A;  4KT5 C;  4F3Q A;  2YU9 J;  4B09 A;  3O8H A;  4MQV A;  2PMH A;  2OF7 A;  2NVQ J;  3BR1 A;  4P1W A;  2CRG A;  3IV5 A;  3BTJ A;  2PJP A;  2KMU A;  4O3M A;  3BOQ A;  3CDH A;  1BJZ A;  4CCN A;  3LMM A;  4U7D A;  5K7H A;  4CXF A;  4ZC3 A;  4M9X A;  1YW9 A;  4I09 A;  3F9K A;  3GFI A;  4YEJ A;  1GT0 C;  2I8D A;  1IV6 A;  1FC3 A;  2AQF A;  3H3U A;  3S1N J;  2RN7 A;  5D5W B;  1V5F A;  2XPU A;  2VAS A;  1SVL A;  2XIG A;  4G6Q A;  4P55 A;  5JHF A;  1MMD A;  3QPT A;  3DU6 A;  1X3W B;  2E5N A;  3E97 A;  3WTW C;  2DN0 A;  2RQQ A;  4E70 A;  1YIT I;  1UG2 A;  2QQ8 A;  4NQW B;  4FTH A;  2VJ5 A;  3BQZ A;  3HB9 A;  3U1D A;  3O8G A;  1S6L A;  1QNT A;  4XOT A;  4XR6 A;  2FXA A;  3OYN A;  5EEH A;  4HQM A;  4ZTJ A;  4P9F A;  4E7S A;  1Z77 A;  2XHK A;  3OWT A;  4RB2 C;  4LMY A;  3ECH A;  3E5Q A;  4M71 A;  5E1X A;  2VT2 A;  3U2R A;  5ICE A;  4E7H A;  3CMA I;  4XKW A;  1K7A A;  2HYG D;  1FMW A;  3K4M A;  3MKL A;  3HHG A;  3SZG A;  4ZH4 F;  3ASO H;  4YIR X;  2O9L A;  1RRJ A;  2GA2 A;  3I56 I;  4NHJ A;  3K2A A;  3VYT B;  1IDY A;  2FU4 A;  2EWN A;  3FXU A;  1VQ6 I;  3CD6 I;  1Z3X A;  1P2F A;  1V55 H;  2HKX A;  5M3F J;  3K2Z A;  1R1T A;  4KIB A;  3ABL H;  4MO7 A;  4RA2 A;  3D0S A;  1LKX A;  1FOW A;  1SFX A;  2WAE A;  2HQR A;  2LSO A;  4FET A;  2W57 A;  1W1W E;  1UHW A;  3OV8 A;  3E6B A;  3MZ8 A;  3T8R A;  4A3K J;  2CV1 A;  1JUP A;  3ML6 A;  3KZZ A;  4R8H A;  2QVO A;  4IL6 C;  3ZCO A;  2CUE A;  5FKN A;  1H88 C;  2Y9Z A;  3VYR B;  3R0J A;  2VIX A;  3P9I A;  4BJ5 C;  1YJW I;  4HLX A;  4A0Y A;  1N77 A;  1OCT C;  4UUV A;  3AL0 B;  5DEQ A;  1FT9 A;  2FNA A;  1SAX A;  3DEW A;  3H1C A;  3WTY C;  3CCU I;  5CJ9 A;  2LD5 A;  3RYR A;  2DDB A;  2VN2 A;  3FF5 A;  2CJJ A;  3Q3S A;  3EYY A;  2K4B A;  5KNL A;  3DP7 A;  2ZXI A;  2VB6 A;  1W36 D;  1HW1 A;  4XLF A;  2WAF A;  3BG7 A;  4BHC A;  4BAY A;  5C4J J;  3JSO A;  4BY7 J;  2FRH A;  3HRS A;  2Y2Z A;  4X6A J;  3QAH A;  3W6V A;  1R7J A;  2K85 A;  4AIH A;  2M9H A;  4G7H F;  2NAZ A;  3DV8 A;  1LUJ B;  3DLA A;  5CVJ A;  1OJL A;  2RKH A;  5LLQ A;  3W2A A;  3K4C A;  3RIR A;  3OY9 A;  2K02 A;  1BI3 A;  3NEU A;  1NHA A;  1O3Q A;  3EPZ A;  4QPO A;  2PQ8 A;  1DP3 A;  2JWT A;  2F4O B;  4A3E J;  2VC0 A;  4M3G A;  2HWV A;  5FFX A;  4DW6 A;  1O4X A;  5B66 C;  5AON A;  3W3C A;  2XAQ A;  3L09 A;  3NAR A;  2XVC A;  4BQO A;  4HQE A;  2AS5 F;  3HOY J;  2BY2 A;  2O3F A;  1C0W A;  2E36 A;  2CSO A;  5L3B A;  1YE9 A;  1YI2 I;  2H94 A;  1TW2 A;  3I55 I;  1IRG A;  3HJE A;  3HTS B;  1MBG A;  1WH5 A;  4IO9 F;  3LFK A;  3KP4 A;  2IW5 A;  3CLO A;  2K27 A;  4BKX A;  3MKY B;  1SAU A;  4I76 A;  2X1C A;  3CCV I;  2XF6 A;  3A03 A;  3V7S A;  1VQ5 I;  2W25 A;  2L01 A;  3E3V A;  4WWC A;  3ZMU A;  3JW4 A;  4GRI A;  2QEX I;  4BE2 A;  2F5F A;  1G3Y A;  2BXY A;  4R1H A;  1RKT A;  2Y48 A;  2EV6 A;  5GAH J;  3BCB A;  1QBJ A;  5E1Z B;  3K4L A;  2OU2 A;  3QP5 A;  2CUZ A;  2FQ4 A;  4DBQ A;  2R5Z B;  3GZN B;  5DD8 A;  3VB2 A;  1ZLK A;  1DDN A;  5FKO A;  1XMA A;  2V6C A;  2P5L C;  4PSX A;  2L4M A;  2K3P A;  1QHH D;  1YS6 A;  3JRH A;  1XD7 A;  5ILS A;  3E0J B;  3CO6 C;  1TWC J;  3C2G A;  4DQ2 A;  3DXJ F;  3A4C A;  3OIO A;  3G4S I;  3AG4 H;  4XN0 A;  4U87 A;  1Z6R A;  1WJF A;  1OYY A;  1RR8 C;  2JK3 A;  2JMW A;  4BQN A;  5GAD J;  2KP6 A;  2V9K A;  1S9H A;  4A3M J;  4HW0 A;  4F92 B;  5HS8 A;  2DOD A;  2H09 A;  4UUS A;  1AKH A;  3BG3 A;  2PG4 A;  2W1O A;  2HDC A;  3I3L A;  1FZP B;  4GYI A;  1BI1 A;  2R5Y B;  5H6Q A;  2XPW A;  1E17 A;  1FYM A;  2R7T A;  1IN5 A;  4AC0 A;  1OCZ H;  1TWG J;  5FFZ A;  5LHG A;  3D5S C;  4QTR A;  2NYX A;  3I59 A;  4XN3 A;  9ANT A;  2XRO A;  1DP7 P;  1ON2 A;  1G8X A;  2CQN A;  1YIJ I;  1Y39 A;  5BQT A;  3K1N A;  2ZME C;  4II3 A;  2F5E A;  3ZN0 A;  3EUH C;  5CQG A;  2IGO A;  4PCQ A;  3BR2 A;  4ESJ A;  3DTI A;  4Q48 A;  3KE2 A;  3OR2 C;  4Z2Y A;  1SVO A;  4KYW A;  1OR7 C;  2JN6 A;  3TL4 X;  5A2Q K;  1ZAR A;  1H8A C;  1TW3 A;  2BVM A;  1WJE A;  3PJR A;  3OIP A;  2E5Z A;  2XGE A;  1W7P D;  2CO5 A;  3F0C A;  4RGS A;  4WXD A;  2FEZ A;  2VPL A;  4XBF A;  3BLY A;  4RM2 A;  1ONV A;  3UKG A;  2ELH A;  4XQF A;  3WU2 C;  2FBH A;  1CQT A;  3JRD A;  5IOZ A;  3CUO A;  1R1U A;  1IRZ A;  1BC8 C;  1FP1 D;  1R6R A;  3O2P E;  2EV5 A;  4CUG A;  2VE8 A;  4PJL A;  4U0W A;  5CQE A;  2XGX A;  2MG4 A;  2EB7 A;  1N78 A;  3HOS A;  1WSU A;  3MKW B;  1ZYR F;  4XM3 A;  3ZMD A;  5LGU A;  2O61 A;  4AU7 A;  3K0L A;  1WWX A;  1IZ1 A;  2KKO A;  2GXB A;  4OMY A;  1TTY A;  4CCL A;  2WAQ A;  4IKF A;  3RPU D;  1D1B A;  1SMT A;  4AUX A;  3BQY A;  1OYW A;  3RSN A;  4D5C A;  3FXK A;  5IOY A;  3WTU C;  4Y7N J;  4LG0 B;  2F4I A;  2E7W A;  2JRT A;  4XLH A;  1D0Z A;  1TWH J;  2FQ3 A;  4I02 A;  2X6W A;  2VOP A;  2LC2 A;  1OCP A;  3ZR8 X;  2IT0 A;  2P5V A;  2F2E A;  1ZR2 A;  4OAY A;  4B4C A;  3QYE A;  2Y0S N;  3BPV A;  3SDB A;  3BC8 A;  2JA5 J;  4N0B A;  1XCV A;  4BJ6 C;  3KFW X;  1KU9 A;  3E1S A;  1L0O C;  3QU3 A;  3U21 A;  4LLN A;  1J2X A;  2ICW G;  2HQA A;  2A3S A;  2Y0M A;  3OL4 A;  3OOP A;  5C44 J;  1RES A;  3GLL A;  3ZGK A;  4AD9 A;  4EEF G;  1W5T A;  2MD0 A;  2NVU B;  3O6B B;  1MW7 A;  1RI7 A;  1R22 A;  3MEX A;  3VSK A;  3LSR A;  4ZDP A;  1AU7 A; 
#chains in the Genus database with same CATH homology
 1FIA A;  1IGN A;  2EBI A;  4A3D J;  1JKP C;  3S16 J;  4IHW A;  3BTI A;  4A93 J;  1B72 A;  2AO9 A;  2G0E A;  2CQQ A;  4FIS A;  1ETQ A;  1GVD A;  5J1U A;  2L9R A;  1RET A;  3GBG A;  1DU0 A;  1ZK8 A;  2IBD A;  5E3M A;  2NS7 A;  2R7Z J;  2VPR A;  3JRG A;  1JT6 A;  5M5X J;  1P7I A;  4A3L J;  3ZQH A;  1MH3 A;  1LFB A;  3WHC A;  1LE8 B;  1MSE C;  1PUF A;  4BXX J;  5DTD A;  2MSY A;  3LSP A;  4DYR A;  2QF7 A;  1MNM C;  3BG5 A;  2IAI A;  4NDL A;  5FLM J;  2E2J J;  1I6H J;  5FJ8 J;  3RZO J;  1FJL A;  4C3H J;  3HKZ N;  3SFI A;  2X9D A;  3TW7 A;  4DYQ A;  3TP3 A;  3GTK J;  5JLX A;  2YUS A;  2N8G A;  1HLV A;  2DMT A;  3HGY A;  2X48 A;  1B72 B;  1U9O A;  3M4O J;  3LNQ A;  1ETV A;  3MVP A;  1XS9 A;  4IHV A;  5J3L A;  3ZQC A;  5EDN A;  2E1O A;  3BR3 A;  3RKQ A;  3I4N J;  2Y9Y A;  4W97 A;  5M5Y J;  3C2B A;  2FX0 A;  2LLK A;  1RR7 A;  3QQA A;  3ZQG A;  4JX4 A;  2HI3 A;  4XK4 A;  2W48 A;  1U78 A;  4MLO A;  2QCO A;  4QIW N;  2EH3 A;  2HOA A;  1JJ8 C;  2EZH A;  2K9N A;  1LE8 A;  2K40 A;  2M2E A;  2L7M P;  4CYC A;  4XIC A;  4MFD A;  2JJ7 A;  3QPS A;  1GUU A;  1MBJ A;  4B3A A;  3S1R J;  5E3N A;  5IYC J;  5C3E J;  2WAQ N;  3QPL A;  4A69 C;  1QPI A;  1NTC A;  2NVT J;  1GV2 A;  3GTL J;  3GTJ J;  3OOU A;  5IYB J;  4UUS B;  2DTZ A;  2L7Z A;  4A3F J;  3BT9 A;  4JX6 A;  5K7F A;  3H0G J;  4D7N A;  2MGQ A;  1JKR C;  5F27 A;  3BR0 A;  3ZQI A;  2LR8 A;  5F0F A;  4BY1 J;  2CUF A;  1WI3 A;  3A01 A;  5DS9 A;  1B8I A;  4RDU A;  5EG0 B;  1XG1 A;  2YU9 J;  4FE7 A;  5GPC A;  5IPA A;  4CYC B;  3O8H A;  1TC3 C;  2OF7 A;  2NVQ J;  1A5J A;  3BR1 A;  3G1M A;  1IDZ A;  3IV5 A;  2CRG A;  3BTJ A;  3GTG J;  2DA7 A;  1ZKG A;  1UMQ A;  1BJZ A;  4HNV A;  4J19 A;  2M0C A;  5K7H A;  2JA6 J;  2ID6 A;  4JYK A;  1YRN A;  1JUS A;  2L7F P;  4V2F A;  1GT0 C;  2AHQ A;  2HQ5 A;  2R5Y A;  3JR9 A;  1IV6 A;  4XRS G;  3S1N J;  4Y52 J;  4GFB A;  2XPU A;  3HDD A;  3JRI A;  3JRE A;  1RPW A;  1MBF A;  1MBH A;  2DN0 A;  2HDD A;  2VKV A;  2ZB9 A;  1UG2 A;  4FTH A;  2DA1 A;  3BQZ A;  3HB9 A;  1H89 C;  2JA7 J;  3O8G A;  5JLW A;  4BBR J;  2M8G X;  3B6A A;  1YRN B;  1TWA J;  1Z77 A;  1EF4 A;  4LOC A;  3RQI A;  2KDZ A;  5F0C A;  1ZR4 A;  2K9Q A;  3S17 J;  1XC5 A;  2X6O A;  4XRM A;  2EZK A;  1FTZ A;  4S0H B;  1WGX A;  1X2M A;  3CMY A;  1JKQ C;  2HOT A;  2CU7 A;  2O8K A;  2L0K A;  2WB1 N;  1PUF B;  2E19 A;  3MKL A;  2DA5 A;  5J1R A;  4FCY A;  2GLO A;  2O9L A;  5C4X J;  1SFO J;  1RKW A;  1D5Y A;  3K2A A;  1VND A;  4BBS J;  1IDY A;  3DCF A;  5FKL A;  4A3G J;  3NAU A;  5M3F J;  2DA3 A;  5F08 A;  2XSD C;  1VF9 A;  1GV5 A;  1JT0 A;  4M3F A;  1TWF J;  4MO7 A;  4M3B A;  2FJ1 A;  2R93 J;  1WCM J;  1SAN A;  2DA6 A;  1FTT A;  3VPR A;  2CQX A;  5EEA A;  5FKK A;  5E3L A;  5K7Z A;  1G2H A;  3BTL A;  4A3K J;  3E7L A;  2YS9 A;  1JUP A;  2EZL A;  2FD5 A;  3S1M J;  1ZGW A;  2PMZ N;  2CUE A;  2HYJ A;  3S2D J;  5FKN A;  2R5Z A;  1IC8 A;  2B63 J;  3LSG A;  1H88 C;  2Y9Z A;  1BW5 A;  1MSF C;  3CDL A;  1BW6 A;  3FK7 A;  1W0T A;  3JRB A;  1F43 A;  1OCT C;  1NK2 P;  4A3C J;  3DEW A;  2NVX J;  1APL C;  4M6V A;  2TCT A;  2LD5 A;  2LFB A;  5BNG A;  4FE4 A;  2LTP A;  1Q1V A;  2CJJ A;  3ZQF A;  2DMU A;  3Q3S A;  3S1Q J;  1I3Q J;  3CQZ J;  3HOX J;  5EZG A;  2XGD A;  5EGO A;  3CCY A;  1QVT A;  3PM1 A;  5C4J J;  1ETO A;  4BY7 J;  3SJM A;  2WV1 A;  3FIS A;  3FIW A;  3A02 A;  1WH7 A;  2Y2Z A;  2VUM J;  4DZP A;  1JJ6 C;  4X6A J;  1HCR A;  3OSG A;  3W6V A;  3JRC A;  5FLV A;  2M9H A;  4AYB N;  1HDP A;  2MW8 A;  5GP9 A;  5F0H A;  1OJL A;  1BL0 A;  3L1P A;  1ETX A;  2NVY J;  4MFE A;  2JWT A;  3HOW J;  4A3E J;  3Q0V A;  3D1N I;  4M3G A;  1AKH B;  1ZQ3 P;  4DW6 A;  1O4X A;  1POG A;  4MIM A;  1Y1V J;  3HM5 A;  4UUT A;  2ECC A;  1FIP A;  2M34 A;  5EF6 A;  4XID A;  1Z0X A;  3TP0 A;  3NAR A;  3TED A;  1MBE A;  1Y1W J;  4JP0 A;  3HOY J;  4C3J J;  3PO2 J;  2LKX A;  3Q0W A;  1U8B A;  1ETK A;  3HEF A;  2E2I J;  3HOZ J;  1IUF A;  1JGG A;  1DU6 A;  5J1Y A;  3ZQL A;  1MBG A;  1WPK A;  4QSH A;  1WH5 A;  3BR6 A;  4C3I J;  1K61 A;  2COB A;  1S7E A;  4D5F A;  4A3B J;  4BKX A;  2XB5 A;  3MN2 A;  4I76 A;  3A03 A;  3WHB A;  3RZD J;  3JRF A;  5HOD A;  1FEX A;  2LY9 A;  2LP0 A;  4IEJ A;  4A3I J;  2XB0 X;  1RKT A;  3LSJ A;  1JTX A;  2KT0 A;  2E2H J;  2EQR A;  3M3Y J;  5EZH A;  2FQ4 A;  3K7A J;  5IP6 A;  2R5Z B;  1T56 A;  2LVS A;  5FKO A;  2GM4 A;  3A01 B;  2RAE A;  3FK6 A;  2R92 J;  2ID3 A;  3PO3 J;  2GBY A;  4I6Z A;  3JRH A;  4ABZ A;  1TWC J;  1OFC X;  4XRS A;  1ZTR A;  2P81 A;  3OIO A;  1HOM A;  1QRY A;  1I50 J;  2VI6 A;  1W0U A;  3TW6 A;  3BR5 A;  2TRT A;  2JK3 A;  2JMW A;  1P7J A;  4V2G A;  4A3M J;  4UUS A;  1AKH A;  3BG3 A;  1MBK A;  4M3E A;  3HOU J;  2ELK A;  1VFC A;  1BA5 A;  1U9N A;  1AU7 A;  3H3V K;  3IH3 A;  2R5Y B;  1JUM A;  2XPW A;  2NOG A;  3S15 J;  4AC0 A;  4QTR A;  1JTY A;  1TWG J;  2LK2 A;  9ANT A;  2ME0 A;  2DJN A;  1E3O C;  2VKE A;  3OSF A;  2O7O A;  3JRA A;  1IJW C;  1ORK A;  3SDG A;  3S14 J;  1LFU P;  5EG0 A;  3BR2 A;  3LOC A;  4RBO A;  3GTQ J;  5EGO B;  3HOV J;  5IP9 J;  5F04 A;  2I10 A;  2H1K A;  2ECB A;  2JN6 A;  4X1E A;  1X2N A;  1H8A C;  3GTP J;  1K83 J;  2EZI A;  2XGE A;  1T33 A;  3F0C A;  5FKM A;  3UKG A;  2DMP A;  3HBL A;  2DA2 A;  1ETW A;  1CQT A;  3JRD A;  1MH4 A;  2IEK A;  2Y31 A;  5IOZ A;  2DMQ A;  5M3M J;  2H8R A;  1IRZ A;  4B1R A;  3G1L A;  2OPT A;  2MG4 A;  4L5E A;  4A3J J;  2K9S A;  1HDD C;  2XRL A;  5IP7 J;  1ENH A;  4IHY A;  1QVU A;  3G1O A;  1IG7 A;  2D5V A;  3B6C A;  1UHS A;  3FKI J;  3IH2 A;  3BG9 A;  2Y30 A;  4AUX A;  3BQY A;  4D5C A;  5IOY A;  4Y7N J;  4D7M A;  4IHX A;  1X58 A;  2XPV A;  5GPA A;  5IYD J;  3GTO J;  3BTC A;  3Q0U A;  2HXI A;  5F1J A;  1TWH J;  1HF0 A;  1JKO C;  1A6I A;  5EYR A;  4M3D A;  4JX5 A;  1AHD P;  1OCP A;  2XGC A;  1ZR2 A;  4C2M J;  4DYC A;  4B4C A;  2DMN A;  2Y0S N;  3IH4 A;  1GDT A;  2JA5 J;  1ETY A;  4DZJ A;  2HXO A;  3HGG A;  1NK3 P;  5M5W J;  2JA8 J;  2ME6 A;  3ZOB A;  1R9T J;  5C44 J;  1RES A;  5E3O A;  2HOS A;  1VI0 A;  4EEF G;  3LSR A;  1F36 A;  4W1U A;  1B8I B;  2DA4 A;  1ITY A;  3GTM J;  3I4M J;  3S2H J;  4G12 A;  2NS8 A;  2R0Q C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...