3QRFF

Structure of a domain-swapped foxp3 dimer
Total Genus 16
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
16
sequence length
82
structure length
82
Chain Sequence
b'MRPPFTYATLIRWAILEAPEKQRTLNEIYHWFTRMFAFFRNHPATWKNAIRHNLSLHKCFVRVESEKGAVWTVDELEFRKKR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Nuclear factor of activated T-cells, cytoplasmic 2
publication title Structure of a Domain-Swapped FOXP3 Dimer on DNA and Its Function in Regulatory T Cells.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Dna binding protein/dna
total genus 16
structure length 82
sequence length 82
chains with identical sequence G, H, I
ec nomenclature
pdb deposition date 2011-02-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
F PF00250 Forkhead Forkhead domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 3qrfF00
3E6DA 5CVVA 5IT9K 2L3DA 3I59B 4R1HA 2H6CA 1F9NA 1T0FA 4F7ZA 4EJOA 5DCMA 4Y15A 4LG0A 1HKTA 5DCMB 1LDKB 1YIOA 2FMLA 3HTSB 2YR2A 3R6SA 2QUFA 2ISZA 1PP8F 1B6AA 2KIUA 1YG2A 3QAHA 2EFPA 4BQAA 3GX4X 3CTAA 3QOPA 3I71A 5L3CA 1B9NA 3RIRA 3HOTA 3I5UA 4HOBA 3QP6A 2PEXA 3GZ5A 3KEOA 2EA4A 1LEAA 2HYGD 3NQOA 4HLYA 1QGPA 3MAJA 1TNTA 4LLLA 3WE3A 1H9GA 4Q4ZF 4CGZA 5JVTA 3GYHX 1LQ1A 1ZG1A 2M45A 2DU9A 3HSRA 4RB0A 2A61A 2BYVE 5D8KB 3GZ6A 1H0MA 1FLIA 3WU0A 1TW3A 2CQKA 1KQ0A 3IRRA 1FC3A 5LGUA 1P92A 5E20A 3BOQA 3DXJF 5IT3A 2FMYA 4P96A 4QWQA 2MD5A 2BV6A 3T8RA 1O3SA 1Z1DA 3WTVC 3RPUA 2G9WA 1K79A 2NS0A 2VBYA 3DP7A 3V8LA 3G3ZA 5BOXA 5LGTA 2VXZA 5H6QA 4WK8F 2OAZA 1SAXA 3TO6A 3ABTA 1P6RA 1SD4A 3EYIA 4TV7A 3Q9SA 2DK8A 1TQPA 1WI9A 4G7ZF 5ICFA 2FNPA 3K2ZA 4GYGA 5FGMA 1QQIA 3IWFA 4R79A 1XDUA 3DKWA 1BI3A 4EM1A 2V6CA 4LMYA 3RI4A 1DPRA 1KU2A 5F6FA 1IUYA 1WQ2A 4MQVA 2E1NA 4A0ZA 1MKMA 2GA1A 2X0LA 3LAJA 2EWNA 1TQIA 4HX7A 1ZARA 2ACJA 3J81K 1BI0A 1IN8A 1U5TA 4DNCA 2Y75A 4BYYA 1U5TB 5DD8A 3ZMDA 1J0RA 4CZZA 1UFMA 1VTNC 1WSUA 4HV6A 3BY6A 4XRFA 3QU6A 1U78A 3KFWX 5CVRA 4S05A 4HF2A 3JTHA 1O3TA 2Z9OA 1H9TA 3REOA 2V1DA 2VODA 3SZTA 1YLFA 2Z33A 2Y0MA 2PN6A 3U1DA 1SFEA 3C7JA 4UV9A 1OPCA 3MQ0A 2QYOA 3BPVA 4A12A 3EDPA 2EB7A 3ZP5A 2XVCA 4MTEA 2XAHA 3U9GA 3BP8A 3G73A 4QLCU 3KP4A 2JT1A 1ZAOA 4FHTA 2P5VA 4A0YA 2F2EA 2DPUA 2R7DA 1QBJA 1MJAA 2QENA 1W7PD 3DPTA 1QO0D 3ZPLA 3CUQC 3KCCA 2CWEA 2IP2A 2F5FA 2MLGA 4P9FA 5LHHA 2A6EF 4M74A 3TOAA 4ZZLA 1BBYA 1OKRA 4LJZF 1ZLKA 5F64A 5HLGA 3NEUA 2PQ8A 3DEUA 1FSHA 5EEGA 3K69A 2HKXA 2HZTA 5FD6A 2OA4A 4MHGA 3TGNA 4U88A 2ZNYA 3R0AA 5D5XB 3L2CA 6PAXA 1Z9CA 1HW1A 1V3FA 2ZBKA 2K4JA 2FOKA 4LFUA 3GVAA 3WTTC 2L02A 1UCRA 3KZZA 2CO5A 3WU1B 2FU4A 2E7WA 3GFJA 4GCVA 4CICA 4WWCA 4WXDA 3LWFA 2IRFG 1QNTA 5ILSA 2UXNA 3HSFA 1UB9A 4CO8A 4GGGA 1FBSA 1MDMB 1WRJA 2STWA 1SFXA 2NYXA 2KJBA 3F23A 2HQNA 4ESJA 3U2RA 3P9KA 4EQQA 2IVMA 3GW2A 1BI1A 4L9NA 2HS5A 5ICGA 3KP7A 3OOPA 4LK0F 2HTJA 4RAZA 3GFIA 4RS8A 1F1ZA 1PDNC 4BH9A 5D4SA 1XMKA 2EFQA 2VT2A 1L0OC 1DPUA 4L9JA 1S8NA 3N97A 2P7VB 4KICA 5LHGA 1WWXA 2FF4A 1G3YA 1AWCA 3ERED 1FPQA 2FSWA 1K78A 2YSRA 3L9FA 1G3TA 5LHIA 2Q2EA 3K9TA 2JSCA 2P7CB 3HTUA 4O6JA 3ECOA 3KP2A 1G3SA 4OU0A 1J75A 3W6KB 4IJAA 2QQAA 2EJRA 5DCFA 3EETA 1OYIA 4HZFA 3WTZA 1HW2A 3E97A 3BWGA 3SZPA 4ZYGA 4AD9A 2IA2A 2Z5UA 4EJVA 4KIGA 1ZYRF 3IKVA 2WC2A 4XBFA 2WV0A 2RNJA 1LEBA 3CDHA 2W85A 3V8JA 4ON0A 4O3MA 1ULYA 5ED4A 2E7XA 3J80Z 2ESHA 4WXHA 3TKYA 3P7NA 3DFGA 4UVCA 2VE9A 1YS6A 4M9XA 4B8XA 1YW8A 3LA7A 1KU7A 2Q0OA 4IRHA 3MCZA 5CVIA 4R8HA 3CO6C 4ZH4F 1LNWA 4L5IA 2MC3A 3MWMA 2ADUA 1IRGA 5A2QK 2K7LA 4RB2C 1PUEE 1C0WA 2RC4A 4ENNA 1BC8C 3GLXA 1R00A 4YIIA 2RGVA 3HRSA 4U7BA 4O5VA 1GXQA 3K1MA 3ML6A 1D3YA 1TNSA 3H3UA 5FLXK 2H6BA 3KP6A 4GYIA 3CUOA 3PQKA 3IRQA 4ESBA 1KYWA 2VE8A 4A5MA 1T38A 2KIMA 4JQFA 4P55A 3KP3A 1EH6A 1EV7A 4HX8A 2F5CA 3LSTA 3FXRA 2O03A 2PMUA 2JPCA 3M7GA 3I59A 3LFKA 1YQAA 1W7PB 5CVUA 3V7SA 5DUKA 1FBQA 4UNOA 5HDKA 4UVBA 2HFHA 4G6DA 1HKQA 2FBHA 3ECHA 3F21A 1ZRDA 1Y0UA 1J2XA 4MGRA 2VT3A 3IC7A 1P4AA 2P5LC 2DAOA 3D0SA 1BI2A 1I1GA 1A04A 3GEZA 1DUXC 1XGOA 2BBYA 4PCQA 4OIOF 3ABUA 3AAFA 4RAYA 4XLNF 1YS7A 3K0LA 2LKPA 2P6SA 2M30A 1XB4A 1FZPB 4MNUA 1MD0A 3KLNA 4EV0A 5K5QA 2HDCA 3I54A 4U0WA 1JE8A 3RTRA 4I98B 5BS6A 4N9HA 4FX0A 1J7KA 4Q5SF 2Z99A 1RIOH 2L4MA 4HDVA 2GA2A 1I27A 4IXAA 2A6HF 1ON2A 2VBZA 3HRUA 3E6BA 3RKYA 3ZMUA 1Z7UA 3ROUA 2W84A 3WE2A 2AS5F 4UVAA 1KA8A 3MZHA 3T5XA 2JPBA 3KZYA 2FBIA 3E3VA 4UHTA 3FMRA 4RGRA 3M1EA 1GHCA 5FD5A 2XGXA 4ESFA 3T8TA 5HOOA 2OQRA 4XLPF 4BXUA 2IT0A 3TQNA 3WTWC 5E1ZB 1HQCA 3WTXC 3W6JB 5E1WA 4EJWA 4LB5A 4I09A 1G4DA 1LDDA 2IPQX 3SQNA 1ZRCA 4H0EA 2P4WA 2PJPA 4IHSA 5D6FA 4K2EA 3BPXA 3C1DA 3F22A 1RNLA 4LB6B 2BGCA 1U3EM 4G94A 1D8JA 4EM0B 2OBPA 1IXRC 1ZG3A 1I6XA 3BZ6A 1USTA 2L4AA 1IZ1A 5BPDA 1J9IA 2HYFA 1Z6TA 4IVNA 1OYWA 2XV4S 4Q48A 2CGPA 3JSPA 5DD4A 4RGXA 3ZMSA 4BHCA 2ZCWA 5HLIA 3V8KA 1HSJA 1ZGAA 2VN2A 4L5JA 5LEJA 1T6SA 3FZVA 1XCBA 3VOEA 4IHTA 3FF5A 2XIGA 2CW0F 4EM2A 4BHPA 3LQRA 5ICCA 2NRAC 2O0YA 2R7FA 2DI3A 1T2KA 2RQPA 2MBFA 1P2FA 2FRHA 3ZQ7A 3B02A 1B59A 5AIQA 3M9AA 2QBYB 2DO7A 4L0YB 1FP2A 3JAMZ 1WKMA 3SXYA 4HF1A 4YIFA 2X4HA 4ENKA 2NNYA 3PFIA 3CUQA 2H27A 3COAC 3CUQB 1FNNA 1B4AA 2D2WA 2IA1A 4MEYF 3Q9VA 1RUNA 4LK1F 4KIBA 2IJLA 5DUIA 3H92A 4MTDA 4BHBA 4CDGA 1RUOA 1KYZA 2L01A 3T0YA 1R1VA 3F8NA 4LD5A 1KU9A 1FP1D 3BROA 3L09A 5H20A 5ILVA 2VC0A 5J8FA 2WTEA 2XAQA 2RDPA 3T1BA 4M72A 4NQWA 2UWMA 4ZYEA 2V1UA 4G7OF 4EJTA 1B9MA 4UXNA 3HHHA 3R0JA 4GO1A 2RN7A 2EV0A 2ZNZA 4OIQF 1SD5A 1MDMA 3QRFF 2EFWA 3CLOA 3R4KA 2W57A 3WG9A 1HKSA 2PI0A 3LQQA 1JXSA 3LA2A 1K7AA 2ELHA 1BN5A 5JR3A 3DV8A 3I0TA 4OMZA 2O61A 3IHUA 5KK1A 3RPQA 3K1NA 3H3ZA 3R61A 4YG2F 1S7OA 1TBXA 1QPMA 1R5HA 5D5WB 3FXUA 3HIFA 1FYKA 3CO7C 5FFXA 1KQ8A 3ZN1A 1ZRFA 4IRGA 1EH7A 4PGGA 3HSEA 4N9IA 1EH8A 4LLGF 1XSXA 3HUGA 5HS7A 3E5XA 1STZA 2NAZA 3SFZA 3WTUC 1R1TA 2GQQA 2ZFWA 2HEOA 4G7HF 1XCVA 2W24A 4AIHA 2QQ9A 1IRFA 2Z3YA 2W25A 2MA3A 1JHHA 1K6OA 1JHFA 4RB1A 2GIVA 3GF2A 2LF7A 2HWVA 4ETSA 3HOSA 1TTYA 2J5PA 2IW5A 3RYPA 2PMHA 4KUMA 5E8GA 2UZKA 3MZYA 4RB3C 2DPDA 2R3SA 1IW7F 1TLHB 1XGMA 4HA8A 2XKOA 1XSVA 4HDUA 1X3UA 3TO7A 4EMSA 2B0LA 3Q5FA 3EUHA 2PFBA 4KN4X 4M6XA 4G6QA 3ULQB 5E8IA 4OIRF 2HOEA 3DF8A 4IPAA 2FNAA 2WWYA 3FWEA 2Y48A 3VODA 3I64A 4A0XA 2MLKA 4JBAA 5L3GA 4A5NA 5F1RA 2QVOA 1ZH5A 3K1PA 3F8FA 4OMYA 2CSOA 2DQLA 3F8BA 3J80K 2XROA 2F5DA 3O2PE 4L18B 2G7UA 2HR3A 1BC7C 1R58A 2XASA 2FXAA 1ZHFA 1YO5C 1MJBA 3GFLA 1IAWA 2QQBA 4HW0A 2J5OA 5BQTA 1ONVA 1BIAA 1E17A 2V79A 5HS9A 2VBWA 3FMSA 5LRRA 3HHGA 3EQLF 4BNCA 4NB5A 2NNNA 1IXSB 2K4BA 4HLXA 2DW4A 3F6OA 3TO9A 3IL2A 4A6EA 3KE2A 3P9CA 5IT9Z 5JFRA 5L3DA 3MEXA 1USSA 1KGSA 2VOOA 3GUDA 3F8MA 4MEXF 3J7AO 1W7PA 4A2UA 3OV8A 4I01A 4B09A 3I53A 1CF7B 3E5QA 1L3LA 2VOPA 3ELKA 1REPC 2ISYA 1FWZA 1I5ZA 3B73A 1U6GA 2H94A 1D5VA 2ZXJA 1ZREA 3L7WA 2FE3A 2O8XA 4KN7X 2QLZA 3JTGA 2A68F 3R60A 3WTSC 3RDIA 3WGHA 4LG0B 2M8EA 1YTYA 3M8EA 2LF8A 2VC1A 4M6YA 3O3KA 2ETHA 1FYMA 2GZWA 2D1VA 2EV6A 1NHAA 1BIBA 3F6VA 3TDZC 1IN7A 3C18A 1TW2A 3DQVC 3S2WA 2XAFA 4HQEA 5HDNA 4ZYDA 3V7RA 3WGIA 2FA5A 4I0BA 4KIFA 3JW4A 1BJAA 4KT5C 1ODDA 5CYVA 4XSZF 4AIJA 5J6XA 1MJ9A 2HGCA 1O3QA 3IWZA 3LAPA 1ON1A 2KIFA 5D4RA 5TRDA 3KEQA 1O3RA 3V7CA 1GXPA 3FM3A 1FOKA 3CJNA 1OR7A 2PBIA 5BMZA 3BDDA 2UXXA 2QWWA 3I58A 4D0PA 4WXCA 4YFXF 1UHMA 1IXCA 1R5GA 4NHJA 1SMYF 1RZ4A 3C3WA 2RV8A 2AXLA 5K5RA 3WTYC 1BOAA 3PQJA 2DQRA 2EFNA 5TJJA 1KU3A 4N0BA 1XN7A 1R7JA 2OZUA 3V4GA 2KKOA 1G3WA 1XMAA 4S04A 1XDSA 4AIKA 5HS8A 2ZO4A 2D45A 4U0VA 1HW5A 3VFZA 3EYYA 2DBBA 2XHKA 2KRFA 3J81Z 1W4MA 4U7DA 5ERIA 1FSEA 1SD7A 1FBUA 1T98A 3RKXA 2A07F 5D8LB 2K02A 1HSTA 2E1CA 3HRTA 1Z91A 2MH9A 2ZMEA 2ZMEB 5JHUA 5D5UB 2TDXA 4YFKF 2ESNA 1FX7A 2D1HA 1OYYA 4FX4A 2M87A 2BE5F 5D6EA 1U5TC 1B1BA 4PZJA 2XAJA 4OIPF 4Z2YA 2VBXA 1ZLJA 1BM9A 1YYVA 5CLSA 4CXFA 1D8KA 5L3BA 1IN4A 4M9ZA 2P5KA 5E17F 3L00A 2CFXA 2G7HA 4I2OA 4GXOA 2FEZA 2QBYA 3WODF 1DP7P 3F72A 1U2WA 4WX9A 1HXDA 1XD7A 3NRVA 4KNYA 3GXOA 4Y17A 2K27A 2FBKA 2OU2A 2JTVA 4AWXB 4DQ2A 3LA3A 2XAGA 1S7AA 3BJOA 1ZG5A 1QZYA 4IRIA 5D5VB 5L3FA 5FB2A 4EGYA 4XSXF 5AIPA 3JAMK 2LNBA 2XKPA 2LDUA 4KMFA 4ZZDA 4ASNA 2EV5A 4A6DA 4EGZA 3FXQA 1ZN2A 2V1XA 2P6TA 4HYEA 2H09A 1YFHA 5DEQA 3KLOA 4LGWA 2O3FA 2PLYA 3GO5A 5AONA 1HBXG 4EJUA 4M9SA 1FY7A 5K1YA 2F5EA 4YFNF 1O7FA 3TDUC 3P9IA 1IN6A 1XSDA 2OQGA 4HQMA 4L9VA 3FX3A 4PGHA 2DK5A 4HBLA 1W5TA 3ZMZA 1GVJA 5DYMA 2RKHA 3FMQA 2A5YB 1J59A 5LBQA 1YW9A 2M5WA 2HKOA 4G8XA 1IN5A 3BJ6A 5FFZA 3KETA 2YX7A 3M8FA 1O7LA 4P9UA 3E6CC 4HF0A 1XGNA 3ISPA 3O6BB 1MZBA 1PP7U 2DFIA 1G6NA 1T39A 5HVQC 5LEKA 4WF2A 4KA4A 2YX4A 1R22A 1LDJA 4KDPA 1JGSA 2EA2A 4I02A 2HQRA 2QZ8A 4P5OA 1S3JA 2ZJ2A 5E1XA 2CG4A 5BPIA 3HYIA 3MFKA 2IA0A 4FT8A 2V9VA 1MGTA 3F3XA 3VB2A 4ZYHA 4RGSA 3WGGA 4OINF 1S6LA 1Q1HA 2JZYA 3QP5A 2VONA 2HTSA 4G9YA 4E70A 1R1UA 4BAYA 5K5OA 1QZZA 3D5LA 5HDGA 5EEHA 2COMA 5CJ9A 1P4XA 4HX4A 5ILUA 5H6RA 1SMTA 1R23A 4CHUA 3DPLC 5L3EA 5KVRA 2GXBA 1LJ9A 3VEPA 2DT5A 3QPHA 3BJAA 1P4WA 2PG4A 4L9TA 4L0ZB 2EFOA 2KJCA 4IF4A 5DV5A 4KYWA 1SD6A 4I7HA 2XUBA 5CVJA 1XGSA 1K78B 1I1SA 2EK5A 3FM5A 1Z6RA 1RI7A 2Q8KA 4LLNA 5ICEA 1DDNA 5LGNA 1SFUA 4WCGA 2LSOA 3FHZA 2FQ3A 1LB2A 1F5TA 4JK1X 4CYDA 3TOBA 1S29A 3ZMTA 5JI6A 2M1BA 1F4KA 1UHWA 2QM3A 2MH2A 5HLHA 1AOYA 1R36A 4PDKA 3I4PA 2GXGA 2XRNA 1U8RA 2CYYA 2YPRA 5DDGA 3JSOA 3SHFA 4HAMA 4MQ9F 3ZN0A 3RJPA 2DLLA 5A2QZ 1E2XA 1OMIA 1V4RA 2O6GE 2OD5A 1LVAA 3N4MA 1ZGJA 4KMUX 3ZMVA 3E5UA 1FT9A 3RYRA 4RGUA 3HRMA 5FLXZ 1J5YA 5LLQA 2RVCA 1W5SA 2GAUA 2A69F 4ENJA 4UV8A 1TQMA 4Y13A 3RKWA 2BEOA 1IF1A 4U0YA 3QU3A 4KFCA 5E18F 1YW7A 2JRTA 5FO5A 4M73A 4Q47A 3QPTA 2A3SA 3GWZA 4AVPA 4ENMA 2YU3A 3GFMA 1Z05A 2OZ6A 1O57A 3IKTA 3E6MA 1CGPA 2L54A 3F8CA 4EVIA 4UUVA 2C6YA 4OOIA 2ZKZA 3KP5A 4HV5A 1CF7A 2STTA 2GWRA 2DTRA 1FYLA 1KQ9A 4M71A 5J8CA 2K86A 5LRSA 4I0AA 2P8TA
chains in the Genus database with same CATH superfamily
3E6DA 5CVVA 5IT9K 2L3DA 3S3NA 3LMMA 3TL4X 3AG2H 2Y9YA 3I59B 3HBLA 4R1HA 2H6CA 1F9NA 5C44J 1MIJA 1DP3A 1T0FA 3KYLA 4F7ZA 4EJOA 5DCMA 4Y15A 4LG0A 5IOYA 3PJRA 2NVTJ 3UKGA 1HKTA 5DCMB 3HG9A 3K4MA 1LDKB 1YIOA 3FXMA 2V4JC 2FMLA 3HTSB 2YR2A 4XKBA 3R6SA 4BGDA 2QUFA 4F52A 4YIRX 1PP8F 2ISZA 1B6AA 5FJ8J 2KIUA 1YG2A 3QAHA 2W4SA 1QA6A 2EFPA 4BQAA 3GX4X 2WBMA 3CZ6A 1D0YA 3CTAA 3QOPA 4BXFA 3I71A 5L3CA 1B9NA 2O5RA 3I3LA 4L5EA 3RIRA 3ZQIA 2XSJC 2DDAA 3HOTA 2KHMA 3I5UA 3LNQA 5F04A 4HOBA 3QP6A 1ZKGA 3A0BC 2PEXA 2ICWG 3GZ5A 2X1EA 1GDTA 1QVUA 4A3EJ 4PSWA 2JA2A 3KEOA 1TP4A 2EA4A 1LEAA 2HYGD 1YOVB 3L2UA 3L2QA 2OV7A 3NQOA 4HLYA 2GOMA 3ASNH 1QGPA 3MAJA 1TNTA 4XLEA 5FRNA 4LLLA 3IP4B 1GUUA 2L7ZA 1H9GA 3WE3A 5H2FC 4Q4ZF 4CGZA 1XX5A 3PIOF 3PNTA 1CQTA 4A3CJ 4IL6C 5JVTA 4C3IJ 3GYHX 1A5JA 2H1LA 1LQ1A 1MNEA 4XM3A 1ZG1A 2M45A 2DU9A 1Y8QB 3M8JA 3HSRA 4RB0A 2DDBA 2A61A 5C4JJ 1ETOA 2NS8A 2BYVE 5D8KB 1QHHD 2EZHA 2LC2A 2JMWA 3GZ6A 1H0MA 1FLIA 2WA0A 3WU0A 1TW3A 2CQKA 2DMPA 2HYJA 1KQ0A 3CC7I 2E35A 1FC3A 5LGUA 3IRRA 5IY5H 1P92A 5E20A 1YI2I 2V9PA 3OS1A 3BOQA 3DXJF 5IT3A 5C3EJ 2FMYA 1Z77A 3QYFA 1WVRA 1IRZA 4AYBN 4P96A 4XOPA 4QWQA 2NOGA 2MD5A 2BV6A 2EZLA 4E7IA 2HI3A 2Y30A 3T8RA 5JVGF 1ETYA 1O3SA 3CCRI 3TP3A 4II2A 1Z1DA 3WTVC 3RPUA 2G9WA 1K79A 2NS0A 2W00A 2LOOA 1X1CA 2VBYA 3LSKA 2CV2A 3TW7A 3GTMJ 3DP7A 2B7EA 4PJJA 3V8LA 3G3ZA 5BOXA 2H8WA 5LGTA 1LE8A 3PNVA 2VXZA 5H6QA 2R7WA 4M3EA 4WK8F 1LE8B 2OAZA 4XLHA 3C2HA 3JRFA 2NVUB 1SAXA 3TO6A 3ABTA 3RQIA 2DFFA 2Z16A 1P6RA 2IS4A 3HL2A 1SD4A 3EYIA 4TV7A 3Q9SA 1G2HA 3A01B 2DK8A 1Q1VA 2BY1A 1TQPA 3S16J 1WI9A 2JWTA 4G7ZF 5ICFA 2FNPA 1N77A 3K2ZA 4GYGA 5FGMA 2D5VA 4A69C 2DA7A 1QQIA 4C2UA 3IWFA 4R79A 1XDUA 3DKWA 1BI3A 3BQZA 4EM1A 3A03A 2V6CA 4LMYA 5J1RA 3RI4A 5CKTA 1DPRA 2CW7A 1KU2A 5F6FA 1IUYA 3OL4A 1WQ2A 1X58A 4XRMA 3H36A 2F48A 4BDYA 3DTIA 1VQ8I 5JHFA 4MQVA 2E1NA 3GTJJ 3S1MJ 4A0ZA 3A0HC 1MKMA 2OCEA 4DOZA 3G6EI 2X9DA 2GA1A 2X0LA 4BQNA 3BR6A 1WH5A 3LAJA 2EWNA 1TQIA 4HX7A 4YEJA 1ZARA 2ACJA 1N25A 2L9RA 4W97A 1S72I 2VJIA 2V6EA 3J81K 1BI0A 4RDUA 1IN8A 1U5TA 4DNCA 1H8AC 3K4KA 2Y75A 4ZYAA 4BYYA 1U5TB 5DD8A 3ZMDA 1J0RA 4CZZA 2W1OA 1UFMA 1VTNC 1WSUA 1TC3C 4HV6A 3BY6A 4XRFA 2WAFA 3QU6A 1U78A 3KFWX 3HOUJ 5CVRA 4S05A 4HF2A 4F93B 1B8IA 1Y0NA 5EZHA 2XF6A 4BKXA 3JTHA 2DOFA 3K2AA 1O3TA 2Z9OA 4XMYA 1H9TA 3REOA 2L5QA 2V1DA 3W2WA 2VODA 3SZTA 1YLFA 2Z33A 2Y0MA 2PN6A 1WCMJ 3U1DA 2COBA 1SFEA 3C7JA 4UV9A 1VQ4I 1OPCA 3WHBA 3MQ0A 1V55H 2QYOA 3BPVA 1RETA 2LP0A 4A12A 4MIMA 1HDDC 3W6VA 3FDYA 2E5ZA 5IP7J 3BT9A 3EDPA 2ZXWH 5HLTA 2EB7A 3DU6A 3LSJA 2ZXIA 3GTPJ 3MKYB 3G4SI 1D5YA 3ZP5A 2XVCA 3PSIA 5M3MJ 4MTEA 4HSTA 4QSHA 3K70C 4IHWA 2XAHA 3U9GA 3BP8A 1H88C 3AG4H 3G73A 4QLCU 1JUPA 3KP4A 2R92J 2JT1A 1ZAOA 4FHTA 1AU7A 1HF0A 2P5VA 4A0YA 4XKVA 2F2EA 2WAEA 2DPUA 2R7DA 1QBJA 1MJAA 1X3ZB 1WPKA 2QENA 2ID6A 3BTJA 1W7PD 3DPTA 1QO0D 3DCFA 2EIMH 3ZPLA 4HPQA 1PYVA 3EUAA 3CUQC 3GCMA 1DU6A 3KCCA 1SFOJ 4FCYA 1S9HA 2CWEA 2IP2A 3E1SA 1P7JA 2F5FA 2MLGA 3CMYA 4P9FA 4PJMA 5LHHA 5M5WJ 3OWTA 2A6EF 4M74A 3TOAA 4ZZLA 1BBYA 1OKRA 3QWLA 4LJZF 2LKSA 2O7OA 5J47A 1OLTA 1PVEA 1ZLKA 5F64A 5HLGA 2WY8Q 1BR4A 3NEUA 2E19A 1TWHJ 3G1MA 2PQ8A 3DEUA 4HEA2 1FSHA 3I9V2 4EEFG 3GLLA 5EEGA 3K69A 2HKXA 3S1QJ 2HZTA 2F4OB 1WJBA 5FD6A 2OA4A 2JA8J 4MHGA 4JX5A 1X19A 3TGNA 4ANJA 1UMQA 4U88A 2ZNYA 3R0AA 2ECCA 5D5XB 1MMDA 2P0WA 3L2CA 4Z6YA 5M3FJ 1JTYA 6PAXA 1Z9CA 1HW1A 1MBEA 1V3FA 2ZBKA 2K4JA 3J7AY 3DU5A 2FOKA 1NTCA 4LFUA 3GVAA 3WTTC 5EYRA 2HDDA 4NQWB 4DYCA 2XC7A 5K7FA 3OSFA 3A02A 3RSNA 2P81A 2L02A 1UCRA 3KZZA 2CO5A 4BU2A 3WU1B 2FU4A 2BY3A 4JP0A 4NC6A 2BVMA 2AO9A 2E7WA 3GFJA 4GCVA 4RMNA 4CICA 3DEWA 1WJCA 3DTEA 4OAZA 4CUGA 2OPTA 3K4LA 4BJ6C 3CCEI 3H0GJ 4WWCA 2LY2A 3LWFA 4WXDA 2IRFG 2CQNA 2R7UA 2R7RA 1QNTA 5ILSA 4J00A 2UXNA 2VPLA 3JR9A 4IOCF 3HSFA 2XAUA 2K9MA 1K6YA 1UB9A 4CO8A 4GGGA 1FBSA 1MDMB 3IV5A 1WRJA 3OY9A 4XOTA 2STWA 1SFXA 1R6RA 2JJ7A 1ZR4A 2NYXA 2VJJA 2HNHA 2KJBA 4PJNA 3F23A 2HQNA 4ESJA 2GOXB 4E7JA 3U2RA 2DOEA 4IKFA 3P9KA 4EQQA 2IVMA 1TT5B 3GW2A 4NNJA 3A2KA 1BI1A 4L9NA 3BR5A 1BR2A 4KITB 1EJ9A 2HS5A 3KP7A 3OOPA 4DGWB 1I39A 5ICGA 4LK0F 2HTJA 1XMXA 4RAZA 3GFIA 1BL0A 3HXLA 4RS8A 1FIPA 3RQ4A 1F1ZA 4A3BJ 1PDNC 2XGCA 4BH9A 5D4SA 2DA5A 1XMKA 2EFQA 2VT2A 1L0OC 1DPUA 4L9JA 1S8NA 1FJLA 3N97A 2MGQA 2P7VB 4KICA 5LHGA 2BY2A 1WWXA 2FF4A 1G3YA 1AWCA 3ERED 2VKHA 3LOCA 4MFEA 1FPQA 1FEXA 3BC8A 4QIWN 2FSWA 1LFBA 1ORKA 3HUGB 4JYKA 2R0QC 1K78A 3LL7A 2YSRA 3L9FA 3D5SC 4LG3A 4C2MJ 1G3TA 5LHIA 2Q2EA 3K9TA 2JSCA 1TWFJ 2P7CB 1QZEA 2DOAA 3HTUA 4O6JA 1ETXA 2HDWA 2VKDA 3ECOA 1AA7A 1MBFA 4XQFA 3KP2A 4HNVA 5DM7F 1X1BA 3HDDA 1BJZA 5FLMJ 1G3SA 1GV2A 2M2EA 3FKIJ 2JA5J 4OU0A 1J75A 3OYGA 3W6KB 4IJAA 4C2TA 3NAUA 2QQAA 3ZOBA 3QODA 2EJRA 5DCFA 2XGDA 3EETA 2Y2ZA 1V5FA 1OYIA 3QPLA 4J01A 2OJED 3JRBA 5CQEA 4HZFA 1G59A 5KAIC 2H8RA 2YU9J 2CW8A 3WTZA 4BQOA 4XIDA 3Q0WA 1W5CC 3OIPA 2LH9A 3HEFA 1HW2A 1D1AA 4BDZA 3E97A 3BWGA 3SZPA 4ZYGA 4AD9A 2IA2A 2Z5UA 3ZQHA 4EJVA 4KIGA 1ZYRF 3IKVA 2WC2A 3PNYA 2M7BA 4XBFA 2WV0A 1PJRA 2RNJA 2V1NA 1LEBA 4XORA 3CDHA 2W85A 3DKXA 3V8JA 4ON0A 3OR2C 4O3MA 1XS9A 1ZR2A 3K6GA 1ULYA 2DXIA 5ED4A 4D9JA 1IJWC 2E7XA 3J80Z 2ESHA 4WXHA 3TKYA 1HDPA 3M07A 3P7NA 4FASD 5IP6A 1IDZA 3CQZJ 3DFGA 3ZR8X 4UVCA 2E71A 2DCEA 2VE9A 1YS6A 4M9XA 4B8XA 1YW8A 3LA7A 3BCBA 3OYHA 1KU7A 2KISA 2Q0OA 4IRHA 3MCZA 4C9YA 3K70D 4RM3A 5CVIA 1YHQI 4R8HA 3CO6C 1BW6A 4ZH4F 2JA6J 1LNWA 4L5IA 2MC3A 3MWMA 1YRNB 2ADUA 4QPOA 1IRGA 2ME0A 1HA8A 5A2QK 2K7LA 4RB2C 3MKZA 4B4CA 1YE9A 1PUEE 4BUPA 1C0WA 2RC4A 1RR7A 2XPVA 4ENNA 1BC8C 3PSFA 1JUSA 1R00A 3GLXA 4HSRA 4NC7A 1JKOC 4YIIA 1XPXA 2RGVA 4UY8I 3HRSA 4U7BA 2YS9A 4O5VA 4D7MA 1GXQA 3K1MA 3ML6A 1D3YA 2I8DA 2RQQA 1I6HJ 3M1CA 3CCSI 1TNSA 3H3UA 4FETA 3BLYA 2H6BA 3KP6A 5FLXK 3AL0C 4GYIA 3IUOA 5J3LA 5C4XJ 1JI8A 2FX0A 1IV8A 3B6AA 3CUOA 3PQKA 3IRQA 1MBGA 5EEAA 2VLAA 4NUBA 4ESBA 1KYWA 4DZPA 2DN0A 2VE8A 2DA3A 5CPRB 4A5MA 1T38A 2UUZA 2KIMA 2TRTA 3OYMA 4JQFA 1YJNI 3W3CA 4P55A 5B66C 3KP3A 3WU2C 3UNGC 4KISA 1EH6A 3JRDA 1EV7A 4HX8A 3S17J 2A05A 2F5CA 3LSTA 1Z7LA 3HM5A 3FXRA 4XR6A 2R5ZB 1LFPA 2O03A 3OYFA 2PMUA 2JPCA 3NWTA 3L2WA 5KCMA 1E0EA 3OIOA 3DBLB 3I59A 3M7GA 1P9QC 3LFKA 1DGRM 1VZ0A 1YQAA 1W7PB 3E0JB 2CRGA 5CVUA 1T95A 2M9HA 1VNDA 5DUKA 2VXDA 3V7SA 1FBQA 4UNOA 3HPHA 4E7SA 2MG4A 2XSDC 5HDKA 2KIQA 4UVBA 2HFHA 4G6DA 1YIJI 1HKQA 2FBHA 2QA4I 2K9SA 1WJDA 3ECHA 3F21A 2NOJB 4JOMA 1Y0UA 2DODA 5K7ZA 1J2XA 4YRVA 1ZRDA 2LVSA 2M3AA 4MGRA 2HU9A 3ZQGA 2VT3A 3BR1A 5F27A 4CZCA 3IC7A 3H5NA 1P4AA 2P5LC 2LMDA 3D5RC 2DAOA 3D0SA 1BI2A 3L2RA 1VQMI 1I1GA 1A04A 3GEZA 4XONA 1DUXC 1XGOA 3CC4I 2BBYA 4PCQA 4OIOF 3ABUA 5DTDA 4A93J 3PM1A 4UUTA 3AAFA 4RAYA 1R49A 4XLNF 1YS7A 3K0LA 2LD5A 2K3PA 2LKPA 4XICA 4FISA 4AVZA 2P6SA 3LFUA 2M30A 3GTQJ 2VQCA 1XB4A 1FZPB 4MNUA 1MD0A 2GLOA 3KLNA 4AIDA 4HNUA 4RA2A 2AQFA 4EV0A 3HOWJ 5K5QA 2HDCA 1Z67A 2ME6A 3I54A 4U0WA 4CYCB 4B3XA 1JE8A 3Q3SA 2E1OA 3RTRA 4I98B 5BS6A 2CUJA 5HNHA 5J4YA 3K4CA 1ZK8A 4N9HA 5IPAA 3DLAA 3P5JA 4FX0A 4CCJA 3BG6A 1J7KA 3ABLH 3DLLF 4Q5SF 1PUFA 5GAEJ 2Z99A 1RIOH 1PUFB 2L4MA 4HDVA 2GA2A 1I27A 4MFDA 1OJLA 4IXAA 2A6HF 1ON2A 2VBZA 4A3LJ 3HRUA 1VQ6I 3E6BA 3TW6A 3OL3A 2ZB9A 3RKYA 1RESA 3ZMUA 1IC8A 3PL8A 2HVSA 3KPHA 1Z7UA 1VQOI 3ROUA 3MN2A 2JSPA 2EBIA 2PMZA 2W84A 3WE2A 2AS5F 2W48A 4UVAA 2DA2A 1KA8A 1TT0A 3MZHA 1FTZA 3T5XA 2JPBA 2K5CA 2AHQA 3KZYA 3OYEA 2FBIA 4D5FA 3E3VA 1VQ9I 3OS2A 4UHTA 3FMRA 2WAQA 3JRIA 4RGRA 3M1EA 1R9TJ 1OR7C 1GHCA 5FD5A 2XGXA 3CESA 4BY7J 2N8GA 1A35A 3FXJA 3ZQFA 4ESFA 1P7IA 2IGNA 3H1CA 3T8TA 5HOOA 4XN3A 2M7AA 1BA5A 3IH4A 3H5AA 2V7FA 2OQRA 3W2VA 4XLPF 4BXUA 1UG0A 2IT0A 4BBRJ 3TQNA 1KONA 3A01A 2CUFA 3WTWC 1OCCH 5E1ZB 2XGEA 1HQCA 3CD6I 3WTXC 3BG7A 2LTPA 3W6JB 2XPUA 2OUMA 5E1WA 2ZSIB 4EJWA 4BEHB 4LB5A 5M5YJ 4I09A 2NVQJ 2FUG2 1G4DA 5DS9A 2MYSA 1LDDA 2IPQX 1ENHA 3SQNA 1ZRCA 4H0EA 2P4WA 4B1RA 2PJPA 4IHSA 2R7QA 2BZTA 4YELA 2ZC2A 5D6FA 3LSHA 1A6QA 1T8IA 3RZDJ 5E3LA 4K2EA 3BPXA 3C1DA 3FK7A 5B1BH 3F22A 1RNLA 4I99C 3CMAI 2DMNA 3B6CA 4FE7A 1DQUA 3NWSA 1XTAA 4QTRA 2X6XA 4M3DA 1UHSA 4ZTJA 4W1UA 3HOVJ 4LB6B 3QQAA 1IUFA 2BOLA 3OYDA 1M1EB 2BGCA 2XB0X 2KMUA 4FTHA 1U3EM 4G94A 1SC7A 5EG0B 1D8JA 1ITYA 3OMYA 2E1MC 4EM0B 2OBPA 1IXRC 2DFEA 1ZG3A 1I6XA 3BZ6A 1USTA 4D5CA 2F4MB 4IOAF 4RM2A 2L4AA 2XPWA 3G2BA 2ZJQF 1O4XA 3IH3A 4I6ZA 1IZ1A 1NK2P 2VQGA 2NVYJ 5BPDA 1J9IA 3CCLI 4BACA 2HYFA 2NS7A 1Z6TA 4IVNA 3GBGA 1MBJA 3KYCB 1U8BA 1OYWA 2ZMEC 2XV4S 4Q48A 2CGPA 1MBKA 3JSPA 2LBFB 3PUBA 5DD4A 2L7FP 1WHUA 4RGXA 3ZMSA 4BHCA 1Y56A 1I50J 2KRHA 2ZCWA 2CUEA 2HOSA 5HLIA 3V8KA 1HSJA 3G71I 1ZGAA 2VN2A 4L5JA 5LEJA 1T6SA 3FZVA 1XCBA 3VOEA 1JKQC 2JQ7A 4IHTA 3FF5A 4B48A 2R7ZJ 2CV1A 2XIGA 3RCOA 4A3FJ 2LY1A 2CW0F 3MVPA 1I3AA 4RAGA 2IS1A 2HPIA 4EM2A 1HOMA 4BHPA 2R7XA 1X2MA 4QPQA 3LQRA 5ICCA 1FMWA 2NRAC 1APLC 4X1EA 3HZJA 1LVKA 2O0YA 2R7FA 4PFPA 3S93A 2DI3A 1T2KA 2RQPA 1WH7A 2K3FA 2MBFA 2KDOA 4IHXA 3CMEI 4A3JJ 1P2FA 2FRHA 4XNFA 3ZQ7A 3SYTA 3B02A 4N4NB 1B59A 5AIQA 3M9AA 2QBYB 2DO7A 5IYCJ 1FP2A 3JAMZ 4L0YB 1WKMA 3SXYA 4HF1A 4UB6C 4GRIA 4YIFA 2X4HA 1NK3P 3MZ8A 4ENKA 4A3IJ 1MNDA 2X6WA 3BTCA 3CCVI 1X4PA 1OQYA 2NNYA 4P1WA 3PFIA 5BNGA 3CUQA 4C3HJ 2H27A 3COAC 3CUQB 2BXYA 5F0FA 1FNNA 2HOTA 1B4AA 2D2WA 2IA1A 3SDBA 3BR2A 4MEYF 3Q9VA 1RUNA 1XC5A 4LK1F 2XF7A 3M3YJ 3LSGA 2B63J 1HC8A 4KIBA 2IJLA 1GVDA 5DUIA 2GM4A 3LSIA 3H92A 4BQQA 3U1KA 1VFCA 2M4KA 4OWRB 2CJJA 1EF4A 4MTDA 3FBNB 4BHBA 4CDGA 1RUOA 1KYZA 2LRDA 2MC4A 2L01A 3T0YA 1R1VA 2OC6A 3F8NA 1K4SA 2IBDA 4LD5A 3TMOA 2DMUA 1Z3YA 4FQGA 1KU9A 2DA1A 1FP1D 3BROA 3L09A 5H20A 5ILVA 2VC0A 1DU0A 5J8FA 2WTEA 2XAQA 2RDPA 2L7KA 2VL8A 1Y1VJ 3HB9A 2M4GA 1ACIA 2L9SA 3T1BA 3KZIC 4M72A 2O8KA 4NQWA 5B5EC 2UWMA 3G1OA 4Y52J 4ZYEA 2X85A 1Y39A 4IX7A 2LK2A 3FXKA 2I10A 1JJ8C 2V1UA 4G7OF 1MMSA 4LIVA 5LFAA 5IP9J 1VQNI 4PK4A 4XRSA 4CCOA 2KRCA 2O9LA 5GP9A 4EJTA 1ZELA 2BXZA 2IGKA 3OYCA 1B9MA 4UXNA 3HHHA 3R0JA 4GO1A 2CH0A 1BW5A 3E7LA 2RN7A 2EV0A 2ZNZA 4OIQF 1SD5A 2JRMA 1G8XA 3ZXSA 1MDMA 3QRFF 2EFWA 3CLOA 3R4KA 2K85A 3BG3A 2EZIA 2W57A 5F08A 4PJLA 3WG9A 1HKSA 4IEJA 2I5UA 2PI0A 3LQQA 1KZHA 2ID3A 1JXSA 3ONQA 3LA2A 1K7AA 2ELHA 2JVHA 1BN5A 5JR3A 3DV8A 3QYEA 3I0TA 4OMZA 4G6TB 2O61A 1ZQ3P 2LY9A 1YX3A 2IGMA 2MD0A 2K9NA 3IHUA 5KK1A 4F92B 2DT6A 3RPQA 5J1YA 3K1NA 3H3ZA 4KJZA 1V5GA 3R61A 1Y1WJ 4LOCA 4IHVA 3CLQA 4YG2F 4Y3OA 2WADA 2FQ4A 3F0CA 1S7OA 2G0EA 1OISA 1TBXA 1QPMA 1WFXA 1R5HA 5HNFA 3RPUD 5D5WB 3FXUA 3HIFA 1FYKA 2CQ7A 3CO7C 1VQKI 5FFXA 1KQ8A 3ZN1A 1V5EA 1ZRFA 4IRGA 1EH7A 2KFDA 4E7LA 4PGGA 1AHDP 3HSEA 2R93J 3VYRB 3OYNA 4N9IA 2CV0A 1EH8A 5HODA 4LLGF 1XSXA 3HUGA 3X2QH 2NVXJ 5HS7A 1FOYA 1OFCX 1IG7A 4UUSB 3E5XA 1STZA 2NAZA 3SFZA 1FMVA 2IS2A 1VQLI 3WTUC 1R1TA 2GQQA 1SVLA 2ZFWA 4E7ZA 2JK3A 2HEOA 4E4HA 3OSGA 3UR3C 1I3QJ 4G7HF 2XF5A 1SEUA 1XCVA 2W24A 1R71A 4AIHA 2QQ9A 1ZGWA 2R7VA 1IRFA 2Z3YA 2W25A 2MA3A 2E36A 1JHHA 1K6OA 1MBHA 2PMZN 2HVRA 1JHFA 4RB1A 2GIVA 3GF2A 2LF7A 1MNMC 2HWVA 2DJNA 4ETSA 3HOSA 1TTYA 2QF7A 2WAQN 1X2NA 2J5PA 3SFIA 2IW5A 4CCNA 3RYPA 2PMHA 4KUMA 5E8GA 1UJ8A 2CU7A 2UZKA 3MZYA 5IYDJ 4RB3C 4GDFA 2XB5A 1H89C 3S8PA 3HGGA 5GPAA 2QQ8A 5EJCA 2DPDA 2R3SA 3JRCA 4BXXJ 5B3SH 4CA0A 3M4OJ 2BHZA 1IW7F 1TLHB 1XGMA 4HA8A 2KP6A 2XKOA 1XSVA 2X1CA 3DTKA 1S5LC 1X3UA 3TO7A 4HDUA 4M3FA 4EMSA 2FJ1A 4X6AJ 1A36A 2B0LA 3Q5FA 3EUHA 4DZJA 2PFBA 4KN4X 3ASOH 4M6XA 3HOYJ 2ECBA 4G6QA 3ULQB 4OIRF 5E8IA 2HOEA 3DF8A 4IPAA 2HZDA 2FNAA 2WWYA 3FWEA 2TCTA 4RAFA 1J09A 2Y48A 3K4NA 3VODA 2CQXA 3VWBA 3I64A 3CDIA 2RAEA 1XG1A 2R7OA 4A0XA 1D1CA 2CFOA 3H3VK 5GAGJ 2MLKA 2VPRA 1IV6A 2L2OA 4JBAA 1YRNA 5L3GA 1ETVA 4A5NA 2L9VA 3H5RA 3JREA 5F1RA 2QVOA 1VF9A 1ZH5A 3K1PA 3F8FA 4MLOA 1ETQA 2IS6A 4OMYA 2CSOA 1B72A 2DQLA 3F8BA 4BJTA 2OF7A 2KT0A 3CDLA 3K10A 1B72B 3J80K 2XROA 2F5DA 3V42A 3O2PE 4L18B 2RREA 2G7UA 3VSKA 2HR3A 1BC7C 2DYSH 3WG7H 3CF5F 1IRXA 1R58A 2XASA 3ESWB 4LIUA 1FIAA 3JCUC 2FXAA 3I56I 1ZHFA 3PO2J 1YO5C 1MJBA 3GFLA 1IAWA 3AL0B 1UG2A 2QQBA 3OR1C 4HW0A 2Z2SB 5IOZA 1E3HA 4PUSA 1YJWI 2J5OA 5FKOA 5BQTA 1ONVA 2E60A 4Y7NJ 1BIAA 1NG7A 2KZGA 1E17A 2V79A 2DTZA 5HS9A 2VBWA 3BTIA 3FMSA 4DJAA 1RRJA 5LRRA 3HHGA 3EQLF 4BNCA 3GZNB 3H9JA 1BOBA 1ZTRA 4NB5A 2NNNA 5F1JA 9ANTA 1IXSB 4CCLA 2K4BA 5J1UA 4HLXA 4A3DJ 2DW4A 2E2IJ 3VPRA 2KDZA 3F6OA 4V2FA 3TO9A 3IL2A 4A6EA 3DEEA 3KE2A 3AFHA 2W82A 3P9CA 5IT9Z 5B1AH 2DYRH 5JFRA 5L3DA 5LD2C 3MEXA 2LFBA 2R5ZA 1USSA 1KGSA 4D1QA 2VOOA 3GUDA 4CH7A 3BR0A 4UB8C 4AU7A 4DYRA 5KHDA 3F8MA 4XLFA 1D0XA 4MEXF 3I55I 3J7AO 4G12A 4C3JJ 3ABKH 1W7PA 4A2UA 5FRMA 3HKZA 5KNLA 1E3PA 2DJIA 2Z1DA 1WJEA 3OV8A 4I01A 4B09A 2BHYA 1OCRH 3HOZJ 3SJMA 2E2HJ 3I53A 2MW8A 1CF7B 3E5QA 1L3LA 1TL8A 2VOPA 3ELKA 1SANA 1REPC 2EH3A 4H4KC 3NARA 3WHCA 1VI0A 3FXLA 1YX5A 3CC2I 2AXTC 4XLCA 4AUXA 3DBHB 2ISYA 1FWZA 1I5ZA 2JVGA 3AKZA 3B73A 3W2AA 1U6GA 3MMYB 2H94A 1W0TA 1D5VA 2ZXJA 1ZREA 1OCTC 3L7WA 3CJRB 2FE3A 2O8XA 4KN7X 1T33A 3I4MJ 2QLZA 3JTGA 2A68F 3HJEA 3R60A 3WTSC 3RDIA 3WGHA 4LG0B 1T0FC 2DA6A 2M8EA 3A1YA 1R4MB 3HOXJ 1YTYA 3M8EA 2LF8A 4M6VA 2VC1A 4M6YA 2X51A 3O3KA 3CP2A 3TEDA 2ETHA 1FYMA 1Z21A 2NXNB 2GZWA 2D1VA 5FROA 2EV6A 1FOXA 2DFHA 1HCRA 4CYCA 3CP8A 1NHAA 1BIBA 4BS9A 3F6VA 3TDZC 1IN7A 3C18A 1TW2A 3DQVC 3S2WA 3LSRA 2XAFA 5EZGA 4HQEA 5HDNA 4ZYDA 3V7RA 4NBQA 3WGIA 2FA5A 4I0BA 3CCQI 4KIFA 2EILH 3JW4A 3CCJI 5E3MA 1BJAA 1LFUP 1JKRC 2JA7J 4HNTA 2E34A 4KT5C 4II3A 3S1RJ 2M34A 3OYBA 1N78A 1ODDA 1F43A 2LYCA 3DPUA 5CYVA 5FKKA 4XKWA 3SDGA 3SZGA 4XSZF 4AIJA 2ELJA 2A6TA 5J6XA 1MJ9A 2HGCA 4J19A 3FKJA 3IWZA 3LAPA 1O3QA 2X1DA 4V19K 1ON1A 3PO3J 4XN0A 2KIFA 1QVTA 2E5NA 5D4RA 1RKTA 4ZDPA 3ZRGA 5TRDA 3KEQA 3FHNA 1O3RA 1A6IA 3GTOJ 2HOAA 2QGUA 1X3WB 1LPQA 1ERDA 2DMTA 4GFBA 3V7CA 3J7ZI 2OTJI 1GXPA 3FM3A 1FOKA 3CJNA 1OR7A 2PBIA 5BMZA 1UELB 1GT0C 5FKLA 1K4TA 3BDDA 2HQAA 2UXXA 3F9KA 2QWWA 3S15J 1X1AA 3I58A 3ZQLA 3H9QA 2AQEA 5GADJ 2BY0A 3CCMI 4D0PA 4WXCA 4YFXF 1UHMA 1IXCA 4D7NA 3FIWA 1R5GA 4NHJA 5CQGA 2WV1A 1WJ5A 2GIZA 1SMYF 1RZ4A 3C3WA 4HG2A 2YUSA 1AKHA 2EIJH 3FBIB 3L1PA 2QKLB 2RV8A 2AXLA 2Y0SA 3PFYA 5K5RA 3WTYC 1BOAA 1AKHB 3PQJA 2DQRA 3C2BA 5F0HA 4U87A 4PFOA 1K83J 2EFNA 5GAHJ 4BEHA 5TJJA 3S14J 2HXIA 4N4OB 1KU3A 4V2GA 3OOUA 4N0BA 2UV1A 2E2JJ 1XN7A 1R7JA 4I76A 4IQJA 2OZUA 2LR8A 5EF6A 3V4GA 3KYDB 2KKOA 4CCKA 2CMPA 2R7TA 2QEXI 1G3WA 4XKCA 2EZKA 3VYUB 1XMAA 2KPMA 3VYTB 2LG4A 4S04A 1XDSA 3TP0A 2EINH 3K4BA 4JX6A 4CCMA 2VASA 1IGNA 3N05A 4AIKA 5HS8A 2ZO4A 4ABZA 2D45A 2L7MP 1JT6A 4U0VA 3JRHA 1HW5A 3VFZA 3EYYA 2DBBA 2XHKA 5JLXA 1W1WE 2KRFA 3ZQCA 2IAIA 3J81Z 1W4MA 2EPFA 1VQPI 4U7DA 5ERIA 1FSEA 5EG0A 3U21A 1SD7A 1FBUA 2E1MB 3BZCA 1T98A 4BE1A 1MMNA 2GBYA 3IAM2 3RKXA 1OCOH 4EATA 2Y9ZA 2A07F 4A3MJ 3LSPA 5D8LB 4NC8A 2K02A 1HSTA 4XRSG 2JUCA 4OAYA 2XRLA 3OYLA 2E1CA 3HRTA 1Z91A 1OCPA 2MH9A 4DYQA 2ZMEA 1GLNA 1WGXA 3VYSB 3QYBA 5E3NA 2ZMEB 5JHUA 2LREA 5D5UB 3ABMH 2TDXA 1WJFA 2QKMB 5EDNA 3OYKA 2LBFA 1U9OA 4YFKF 5K7HA 3TBIA 1YJ9I 2ESNA 4IQ4A 1UAAA 1FX7A 5F0CA 2D1HA 1OYYA 4FX4A 2HVQA 2M87A 3FXOA 2BE5F 3DWLE 2VJ5A 5D6EA 1TZLA 1U5TC 4PSXA 5JLWA 1EA3A 1B1BA 4PZJA 2XAJA 3BQYA 4OIPF 4Z2YA 2VBXA 2Q1ZB 1ZLJA 1BM9A 1YYVA 5CLSA 4CXFA 4RLQA 3CMMA 1Y8RB 1D8KA 4XK4A 2CS3A 1X4OA 2IXSA 3CCYA 3ZQQA 2R5YA 5L3BA 4A3KJ 4KT6A 1IN4A 1B8IB 2QSHX 3SEZA 4M9ZA 2R5YB 3K4JA 2P5KA 5E17F 3L00A 4ZDOA 2CFXA 3S32A 1S7EA 2G7HA 2M0MA 4B3AA 4AM3A 4I2OA 3BZKA 4GXOA 4Y33A 3MKWB 2FEZA 2QBYA 3WODF 1DP7P 3F72A 4X0GA 3EUKL 4DIQA 1U2WA 4WX9A 1HXDA 2WB1A 2R4GA 1XD7A 3NRVA 3GMEA 3ERMA 4KNYA 2JUGA 3GXOA 4Y17A 2K27A 2ZFUA 2FBKA 2ELKA 2CUZA 2OU2A 5TISC 1WZ2A 1RC9A 2JTVA 4AWXB 4DQ2A 3LA3A 2XAGA 1S7AA 5EGOA 3BJOA 1ZG5A 1QZYA 3IH2A 5D5VB 4IRIA 3BG5A 2VB6A 5EGOB 2PJRA 4A3GJ 1LUJB 3Q0VA 5L3FA 5FB2A 4EGYA 4XSXF 5AIPA 3JAMK 2LNBA 2PJRB 3S2DJ 1QU3A 1Z0XA 5FKMA 2XKPA 3PIPF 2LDUA 3EPZA 4KMFA 4ZZDA 4ASNA 2EV5A 2DT7B 3H0DA 4A6DA 3JRGA 4EGZA 3ZCOA 3FXQA 4PJ0C 1ZN2A 2V1XA 2P6TA 1FTTA 4M3BA 3S3MA 3KEYA 1TWCJ 4HYEA 2H09A 3GTLJ 3H35A 1YFHA 5DEQA 2ZSHB 3KLOA 3KX2A 1Z3XA 4LGWA 1TWAJ 2O3FA 2VKEA 2PLYA 1F36A 3MKLA 1W36C 3GO5A 5AONA 1OCZH 3S3OA 3GTKJ 1HBXG 3HPGA 4EJUA 4M9SA 3RKQA 2GXAA 1R5ID 5FLVA 1SVOA 2KL4A 1QRYA 1FY7A 1MH4A 4C30A 5K1YA 2F5EA 4JX4A 4YFNF 1O7FA 3TDUC 1X1PA 2M0CA 1IO2A 3P9IA 1IN6A 4Y4RA 3AG3H 4F3QA 1XSDA 3LSMA 2OQGA 4BL0B 3KIOA 1MSEC 2MFZA 3S2HJ 2X6YA 4E6KG 5DM6F 4HQMA 4L9VA 3FX3A 3OYIA 1YITI 4PGHA 2DK5A 4HBLA 3HKZN 1W5TA 1Y6IA 2VJ4A 4NDLA 3QPSA 2VI6A 4RBOA 1QHGA 1MH3A 3ZMZA 1MMGA 2ZJRF 4DBQA 1GVJA 3PUFA 5DYMA 2RKHA 3FMQA 1EKEA 3CCUI 2A5YB 5KAFC 1J59A 5LBQA 1YW9A 2F6CA 2M5WA 1V54H 2OCCH 2HKOA 2QSFX 4G8XA 1IN5A 3BJ6A 1N75A 5FFZA 3CF2A 3CJQB 4AYBA 3KETA 1MMAA 1R4NB 3IAS2 1ETWA 2DMQA 2YX7A 3M8FA 1O7LA 5GPCA 2QSGX 1VQ7I 4P9UA 3E6CC 4HF0A 1XGNA 1D0ZA 4E7KA 3ISPA 4ZDLA 3O6BB 2FOWA 1MZBA 4BE0A 2KLOA 5GTHC 1PP7U 4S0HB 5J40A 2Y69H 2DFIA 1G6NA 1BR1A 2LLKA 1T39A 5HVQC 5LEKA 4WF2A 4KA4A 1TWGJ 2MSYA 2YX4A 2K40A 1R22A 3OYAA 1LDJA 2IGOA 2VKVA 4KDPA 3FISA 1JGSA 2EA2A 4I02A 2HQRA 2QZ8A 4P5OA 1S3JA 4E7HA 1WI3A 2ZJ2A 5E1XA 2CG4A 5BPIA 3HYIA 3MFKA 2IA0A 2VQHA 4FT8A 2V9VA 3GTGJ 2BVLA 1MGTA 3F3XA 3VB2A 2ZJPF 3DBRB 4BE2A 4ZYHA 4HRIA 3BR3A 4RGSA 3MD2A 3WGGA 3JRAA 4OINF 4BBSJ 1S6LA 4ZTFA 1Q1HA 4LITA 2OTLI 2JZYA 3D1NI 3QP5A 1A31A 2HTSA 2VONA 4IHYA 4G9YA 3HC7A 4E70A 1R1UA 4UUSA 4BAYA 5K5OA 1QZZA 3D5LA 5HDGA 5EEHA 2COMA 2RNGA 2LKXA 5CJ9A 3G1LA 1P4XA 4HX4A 5ILUA 5H6RA 1SMTA 1R23A 4CHUA 3DPLC 5L3EA 4DBRA 4B44A 5KVRA 1JJ6C 2GXBA 1LJ9A 4ZC3A 3OIQA 3VEPA 4DW6A 2DT5A 1VQ5I 3O8GA 3QPHA 3OYJA 1D1BA 1MSFC 1JKPC 3BJAA 3VDXA 1JUMA 1P4WA 2PG4A 2HPMA 4L9TA 4L0ZB 4AC0A 2EFOA 2KJCA 4IF4A 5DV5A 4KYWA 2X48A 1SD6A 4I7HA 2H1KA 4B47A 1ETKA 3BG9A 2XUBA 1XGSA 5CVJA 1K78B 1I1SA 1FOWA 2EK5A 3FM5A 1Z6RA 2Q2EB 1RI7A 2Q8KA 4LLNA 2FD5A 5J4VA 4FE4A 5ICEA 3BCAA 3K7AJ 1DDNA 5LGNA 1SFUA 3C2GA 4WCGA 2HXOA 1E3OC 2LSOA 2EQRA 2ZXHA 3FHZA 5E79C 3QOEA 2FQ3A 1LB2A 1F5TA 4JK1X 1QPIA 4CYDA 1HLVA 2Y0SN 3TOBA 1S29A 3ZMTA 5JI6A 1NG6A 2X6OA 2M1BA 2QCOA 2B9SA 1JTXA 4ITVA 1F4KA 1MW7A 1K61A 1UHWA 2QM3A 2MH2A 5HLHA 3OS0A 1AOYA 1R36A 4PDKA 3I4PA 2VUMJ 1T08B 2XRNA 2GXGA 3Q0UA 4IZZA 1U8RA 2W7NA 2V9KA 3DKYA 2CYYA 2YPRA 5DDGA 2L0KA 3JSOA 3O8HA 5FKNA 5IYBJ 2KZVA 3SHFA 4HAMA 4CSWA 4MQ9F 3ZN0A 3RJPA 2DLLA 5A2QZ 2BW3A 1E2XA 5TGTA 1OMIA 1V4RA 2BW3B 2O6GE 2OD5A 3VSLA 1LVAA 2IEKA 3SEQA 3N4MA 3EUHC 4M3GA 1SAUA 4BY1J 1ZGJA 4KMUX 1SFKA 2XDVA 1GV5A 1T56A 2VIXA 1RKWA 3A4CA 3RZOJ 3ZMVA 3E5UA 1JT0A 1FT9A 2F4IA 2JN6A 1W0UA 2PX9A 3RYRA 5E3OA 2KQRA 2A5WA 3H9GA 4RGUA 1RPWA 3HRMA 5FLXZ 1J5YA 4ZJZA 5LLQA 2RVCA 1W5SA 4F55A 2GAUA 2F5VA 2A69F 4ENJA 4BJ5C 2DA4A 3FK6A 4UV8A 3S1NJ 1TQMA 1U9NA 4Y13A 1UZCA 2K9QA 2L9NA 3RKWA 2HQ5A 1NH3A 2BEOA 1IF1A 4U0YA 3AG1H 1IDYA 1U0JA 4B43A 3QU3A 4KFCA 3CJTB 5E18F 1YW7A 1SVMA 2JRTA 5FO5A 4M73A 4Q47A 3QPTA 2A3SA 2Y31A 3GWZA 4AVPA 4ENMA 5GTIC 3I4NJ 1JGGA 2WY7Q 2YU3A 2MABA 3J7YJ 3GFMA 2K9LA 1Z05A 2OZ6A 2M8GX 1O57A 4RLFA 1W36D 2VQLA 3IKTA 3E6MA 1CGPA 1WJAA 1RR8C 2L54A 4IO9F 1X1DA 3F8CA 4XL9A 4EVIA 1LKXA 3L2VA 4UUVA 2C6YA 2R7SA 4OOIA 4F91B 2ZKZA 1DGWY 3KP5A 1POGA 4HV5A 2EIKH 1CF7A 5M5XJ 2GWRA 2V26A 2STTA 2DTRA 1FYLA 4XLAA 1KQ9A 2WB1N 4M71A 5J8CA 3BTLA 2K86A 3ZGKA 5LRSA 3HGYA 4I0AA 2P8TA 4MO7A 2CQQA
chains in the Genus database with same CATH topology
3E6DA 5CVVA 5IT9K 2L3DA 3I59B 4R1HA 2H6CA 1F9NA 1T0FA 4F7ZA 4EJOA 5DCMA 4Y15A 4LG0A 1HKTA 5DCMB 1LDKB 1YIOA 2FMLA 3HTSB 2YR2A 3R6SA 2QUFA 2ISZA 1PP8F 1B6AA 2KIUA 1YG2A 3QAHA 2EFPA 4BQAA 3GX4X 3CTAA 3QOPA 3I71A 5L3CA 1B9NA 3RIRA 3HOTA 3I5UA 4HOBA 3QP6A 2PEXA 3GZ5A 3KEOA 2EA4A 1LEAA 2HYGD 3NQOA 4HLYA 1QGPA 3MAJA 1TNTA 4LLLA 3WE3A 1H9GA 4Q4ZF 4CGZA 5JVTA 3GYHX 1LQ1A 1ZG1A 2M45A 2DU9A 3HSRA 4RB0A 2A61A 2BYVE 5D8KB 3GZ6A 1H0MA 1FLIA 3WU0A 1TW3A 2CQKA 1KQ0A 3IRRA 1FC3A 5LGUA 1P92A 5E20A 3BOQA 3DXJF 5IT3A 2FMYA 4P96A 4QWQA 2MD5A 2BV6A 3T8RA 1O3SA 1Z1DA 3WTVC 3RPUA 2G9WA 1K79A 2NS0A 2VBYA 3DP7A 3V8LA 3G3ZA 5BOXA 5LGTA 2VXZA 5H6QA 4WK8F 2OAZA 1SAXA 3TO6A 3ABTA 1P6RA 1SD4A 3EYIA 4TV7A 3Q9SA 2DK8A 1TQPA 1WI9A 4G7ZF 5ICFA 2FNPA 3K2ZA 4GYGA 5FGMA 1QQIA 3IWFA 4R79A 1XDUA 3DKWA 1BI3A 4EM1A 2V6CA 4LMYA 3RI4A 1DPRA 1KU2A 5F6FA 1IUYA 1WQ2A 4MQVA 2E1NA 4A0ZA 1MKMA 2GA1A 2X0LA 3LAJA 2EWNA 1TQIA 4HX7A 1ZARA 2ACJA 3J81K 1BI0A 1IN8A 1U5TA 4DNCA 2Y75A 4BYYA 1U5TB 5DD8A 3ZMDA 1J0RA 4CZZA 1UFMA 1VTNC 1WSUA 4HV6A 3BY6A 4XRFA 3QU6A 1U78A 3KFWX 5CVRA 4S05A 4HF2A 3JTHA 1O3TA 2Z9OA 1H9TA 3REOA 2V1DA 2VODA 3SZTA 1YLFA 2Z33A 2Y0MA 2PN6A 3U1DA 1SFEA 3C7JA 4UV9A 1OPCA 3MQ0A 2QYOA 3BPVA 4A12A 3EDPA 2EB7A 3ZP5A 2XVCA 4MTEA 2XAHA 3U9GA 3BP8A 3G73A 4QLCU 3KP4A 2JT1A 1ZAOA 4FHTA 2P5VA 4A0YA 2F2EA 2DPUA 2R7DA 1QBJA 1MJAA 2QENA 1W7PD 3DPTA 1QO0D 3ZPLA 3CUQC 3KCCA 2CWEA 2IP2A 2F5FA 2MLGA 4P9FA 5LHHA 2A6EF 4M74A 3TOAA 4ZZLA 1BBYA 1OKRA 4LJZF 1ZLKA 5F64A 5HLGA 3NEUA 2PQ8A 3DEUA 1FSHA 5EEGA 3K69A 2HKXA 2HZTA 5FD6A 2OA4A 4MHGA 3TGNA 4U88A 2ZNYA 3R0AA 5D5XB 3L2CA 6PAXA 1Z9CA 1HW1A 1V3FA 2ZBKA 2K4JA 2FOKA 4LFUA 3GVAA 3WTTC 2L02A 1UCRA 3KZZA 2CO5A 3WU1B 2FU4A 2E7WA 3GFJA 4GCVA 4CICA 4WWCA 4WXDA 3LWFA 2IRFG 1QNTA 5ILSA 2UXNA 3HSFA 1UB9A 4CO8A 4GGGA 1FBSA 1MDMB 1WRJA 2STWA 1SFXA 2NYXA 2KJBA 3F23A 2HQNA 4ESJA 3U2RA 3P9KA 4EQQA 2IVMA 3GW2A 1BI1A 4L9NA 2HS5A 5ICGA 3KP7A 3OOPA 4LK0F 2HTJA 4RAZA 3GFIA 4RS8A 1F1ZA 1PDNC 4BH9A 5D4SA 1XMKA 2EFQA 2VT2A 1L0OC 1DPUA 4L9JA 1S8NA 3N97A 2P7VB 4KICA 5LHGA 1WWXA 2FF4A 1G3YA 1AWCA 3ERED 1FPQA 2FSWA 1K78A 2YSRA 3L9FA 1G3TA 5LHIA 2Q2EA 3K9TA 2JSCA 2P7CB 3HTUA 4O6JA 3ECOA 3KP2A 1G3SA 4OU0A 1J75A 3W6KB 4IJAA 2QQAA 2EJRA 5DCFA 3EETA 1OYIA 4HZFA 3WTZA 1HW2A 3E97A 3BWGA 3SZPA 4ZYGA 4AD9A 2IA2A 2Z5UA 4EJVA 4KIGA 1ZYRF 3IKVA 2WC2A 4XBFA 2WV0A 2RNJA 1LEBA 3CDHA 2W85A 3V8JA 4ON0A 4O3MA 1ULYA 5ED4A 2E7XA 3J80Z 2ESHA 4WXHA 3TKYA 3P7NA 3DFGA 4UVCA 2VE9A 1YS6A 4M9XA 4B8XA 1YW8A 3LA7A 1KU7A 2Q0OA 4IRHA 3MCZA 5CVIA 4R8HA 3CO6C 4ZH4F 1LNWA 4L5IA 2MC3A 3MWMA 2ADUA 1IRGA 5A2QK 2K7LA 4RB2C 1PUEE 1C0WA 2RC4A 4ENNA 1BC8C 3GLXA 1R00A 4YIIA 2RGVA 3HRSA 4U7BA 4O5VA 1GXQA 3K1MA 3ML6A 1D3YA 1TNSA 3H3UA 5FLXK 2H6BA 3KP6A 4GYIA 3CUOA 3PQKA 3IRQA 4ESBA 1KYWA 2VE8A 4A5MA 1T38A 2KIMA 4JQFA 4P55A 3KP3A 1EH6A 1EV7A 4HX8A 2F5CA 3LSTA 3FXRA 2O03A 2PMUA 2JPCA 3M7GA 3I59A 3LFKA 1YQAA 1W7PB 5CVUA 3V7SA 5DUKA 1FBQA 4UNOA 5HDKA 4UVBA 2HFHA 4G6DA 1HKQA 2FBHA 3ECHA 3F21A 1ZRDA 1Y0UA 1J2XA 4MGRA 2VT3A 3IC7A 1P4AA 2P5LC 2DAOA 3D0SA 1BI2A 1I1GA 1A04A 3GEZA 1DUXC 1XGOA 2BBYA 4PCQA 4OIOF 3ABUA 3AAFA 4RAYA 4XLNF 1YS7A 3K0LA 2LKPA 2P6SA 2M30A 1XB4A 1FZPB 4MNUA 1MD0A 3KLNA 4EV0A 5K5QA 2HDCA 3I54A 4U0WA 1JE8A 3RTRA 4I98B 5BS6A 4N9HA 4FX0A 1J7KA 4Q5SF 2Z99A 1RIOH 2L4MA 4HDVA 2GA2A 1I27A 4IXAA 2A6HF 1ON2A 2VBZA 3HRUA 3E6BA 3RKYA 3ZMUA 1Z7UA 3ROUA 2W84A 3WE2A 2AS5F 4UVAA 1KA8A 3MZHA 3T5XA 2JPBA 3KZYA 2FBIA 3E3VA 4UHTA 3FMRA 4RGRA 3M1EA 1GHCA 5FD5A 2XGXA 4ESFA 3T8TA 5HOOA 2OQRA 4XLPF 4BXUA 2IT0A 3TQNA 3WTWC 5E1ZB 1HQCA 3WTXC 3W6JB 5E1WA 4EJWA 4LB5A 4I09A 1G4DA 1LDDA 2IPQX 3SQNA 1ZRCA 4H0EA 2P4WA 2PJPA 4IHSA 5D6FA 4K2EA 3BPXA 3C1DA 3F22A 1RNLA 4LB6B 2BGCA 1U3EM 4G94A 1D8JA 4EM0B 2OBPA 1IXRC 1ZG3A 1I6XA 3BZ6A 1USTA 2L4AA 1IZ1A 5BPDA 1J9IA 2HYFA 1Z6TA 4IVNA 1OYWA 2XV4S 4Q48A 2CGPA 3JSPA 5DD4A 4RGXA 3ZMSA 4BHCA 2ZCWA 5HLIA 3V8KA 1HSJA 1ZGAA 2VN2A 4L5JA 5LEJA 1T6SA 3FZVA 1XCBA 3VOEA 4IHTA 3FF5A 2XIGA 2CW0F 4EM2A 4BHPA 3LQRA 5ICCA 2NRAC 2O0YA 2R7FA 2DI3A 1T2KA 2RQPA 2MBFA 1P2FA 2FRHA 3ZQ7A 3B02A 1B59A 5AIQA 3M9AA 2QBYB 2DO7A 4L0YB 1FP2A 3JAMZ 1WKMA 3SXYA 4HF1A 4YIFA 2X4HA 4ENKA 2NNYA 3PFIA 3CUQA 2H27A 3COAC 3CUQB 1FNNA 1B4AA 2D2WA 2IA1A 4MEYF 3Q9VA 1RUNA 4LK1F 4KIBA 2IJLA 5DUIA 3H92A 4MTDA 4BHBA 4CDGA 1RUOA 1KYZA 2L01A 3T0YA 1R1VA 3F8NA 4LD5A 1KU9A 1FP1D 3BROA 3L09A 5H20A 5ILVA 2VC0A 5J8FA 2WTEA 2XAQA 2RDPA 3T1BA 4M72A 4NQWA 2UWMA 4ZYEA 2V1UA 4G7OF 4EJTA 1B9MA 4UXNA 3HHHA 3R0JA 4GO1A 2RN7A 2EV0A 2ZNZA 4OIQF 1SD5A 1MDMA 3QRFF 2EFWA 3CLOA 3R4KA 2W57A 3WG9A 1HKSA 2PI0A 3LQQA 1JXSA 3LA2A 1K7AA 2ELHA 1BN5A 5JR3A 3DV8A 3I0TA 4OMZA 2O61A 3IHUA 5KK1A 3RPQA 3K1NA 3H3ZA 3R61A 4YG2F 1S7OA 1TBXA 1QPMA 1R5HA 5D5WB 3FXUA 3HIFA 1FYKA 3CO7C 5FFXA 1KQ8A 3ZN1A 1ZRFA 4IRGA 1EH7A 4PGGA 3HSEA 4N9IA 1EH8A 4LLGF 1XSXA 3HUGA 5HS7A 3E5XA 1STZA 2NAZA 3SFZA 3WTUC 1R1TA 2GQQA 2ZFWA 2HEOA 4G7HF 1XCVA 2W24A 4AIHA 2QQ9A 1IRFA 2Z3YA 2W25A 2MA3A 1JHHA 1K6OA 1JHFA 4RB1A 2GIVA 3GF2A 2LF7A 2HWVA 4ETSA 3HOSA 1TTYA 2J5PA 2IW5A 3RYPA 2PMHA 4KUMA 5E8GA 2UZKA 3MZYA 4RB3C 2DPDA 2R3SA 1IW7F 1TLHB 1XGMA 4HA8A 2XKOA 1XSVA 4HDUA 1X3UA 3TO7A 4EMSA 2B0LA 3Q5FA 3EUHA 2PFBA 4KN4X 4M6XA 4G6QA 3ULQB 5E8IA 4OIRF 2HOEA 3DF8A 4IPAA 2FNAA 2WWYA 3FWEA 2Y48A 3VODA 3I64A 4A0XA 2MLKA 4JBAA 5L3GA 4A5NA 5F1RA 2QVOA 1ZH5A 3K1PA 3F8FA 4OMYA 2CSOA 2DQLA 3F8BA 3J80K 2XROA 2F5DA 3O2PE 4L18B 2G7UA 2HR3A 1BC7C 1R58A 2XASA 2FXAA 1ZHFA 1YO5C 1MJBA 3GFLA 1IAWA 2QQBA 4HW0A 2J5OA 5BQTA 1ONVA 1BIAA 1E17A 2V79A 5HS9A 2VBWA 3FMSA 5LRRA 3HHGA 3EQLF 4BNCA 4NB5A 2NNNA 1IXSB 2K4BA 4HLXA 2DW4A 3F6OA 3TO9A 3IL2A 4A6EA 3KE2A 3P9CA 5IT9Z 5JFRA 5L3DA 3MEXA 1USSA 1KGSA 2VOOA 3GUDA 3F8MA 4MEXF 3J7AO 1W7PA 4A2UA 3OV8A 4I01A 4B09A 3I53A 1CF7B 3E5QA 1L3LA 2VOPA 3ELKA 1REPC 2ISYA 1FWZA 1I5ZA 3B73A 1U6GA 2H94A 1D5VA 2ZXJA 1ZREA 3L7WA 2FE3A 2O8XA 4KN7X 2QLZA 3JTGA 2A68F 3R60A 3WTSC 3RDIA 3WGHA 4LG0B 2M8EA 1YTYA 3M8EA 2LF8A 2VC1A 4M6YA 3O3KA 2ETHA 1FYMA 2GZWA 2D1VA 2EV6A 1NHAA 1BIBA 3F6VA 3TDZC 1IN7A 3C18A 1TW2A 3DQVC 3S2WA 2XAFA 4HQEA 5HDNA 4ZYDA 3V7RA 3WGIA 2FA5A 4I0BA 4KIFA 3JW4A 1BJAA 4KT5C 1ODDA 5CYVA 4XSZF 4AIJA 5J6XA 1MJ9A 2HGCA 1O3QA 3IWZA 3LAPA 1ON1A 2KIFA 5D4RA 5TRDA 3KEQA 1O3RA 3V7CA 1GXPA 3FM3A 1FOKA 3CJNA 1OR7A 2PBIA 5BMZA 3BDDA 2UXXA 2QWWA 3I58A 4D0PA 4WXCA 4YFXF 1UHMA 1IXCA 1R5GA 4NHJA 1SMYF 1RZ4A 3C3WA 2RV8A 2AXLA 5K5RA 3WTYC 1BOAA 3PQJA 2DQRA 2EFNA 5TJJA 1KU3A 4N0BA 1XN7A 1R7JA 2OZUA 3V4GA 2KKOA 1G3WA 1XMAA 4S04A 1XDSA 4AIKA 5HS8A 2ZO4A 2D45A 4U0VA 1HW5A 3VFZA 3EYYA 2DBBA 2XHKA 2KRFA 3J81Z 1W4MA 4U7DA 5ERIA 1FSEA 1SD7A 1FBUA 1T98A 3RKXA 2A07F 5D8LB 2K02A 1HSTA 2E1CA 3HRTA 1Z91A 2MH9A 2ZMEA 2ZMEB 5JHUA 5D5UB 2TDXA 4YFKF 2ESNA 1FX7A 2D1HA 1OYYA 4FX4A 2M87A 2BE5F 5D6EA 1U5TC 1B1BA 4PZJA 2XAJA 4OIPF 4Z2YA 2VBXA 1ZLJA 1BM9A 1YYVA 5CLSA 4CXFA 1D8KA 5L3BA 1IN4A 4M9ZA 2P5KA 5E17F 3L00A 2CFXA 2G7HA 4I2OA 4GXOA 2FEZA 2QBYA 3WODF 1DP7P 3F72A 1U2WA 4WX9A 1HXDA 1XD7A 3NRVA 4KNYA 3GXOA 4Y17A 2K27A 2FBKA 2OU2A 2JTVA 4AWXB 4DQ2A 3LA3A 2XAGA 1S7AA 3BJOA 1ZG5A 1QZYA 4IRIA 5D5VB 5L3FA 5FB2A 4EGYA 4XSXF 5AIPA 3JAMK 2LNBA 2XKPA 2LDUA 4KMFA 4ZZDA 4ASNA 2EV5A 4A6DA 4EGZA 3FXQA 1ZN2A 2V1XA 2P6TA 4HYEA 2H09A 1YFHA 5DEQA 3KLOA 4LGWA 2O3FA 2PLYA 3GO5A 5AONA 1HBXG 4EJUA 4M9SA 1FY7A 5K1YA 2F5EA 4YFNF 1O7FA 3TDUC 3P9IA 1IN6A 1XSDA 2OQGA 4HQMA 4L9VA 3FX3A 4PGHA 2DK5A 4HBLA 1W5TA 3ZMZA 1GVJA 5DYMA 2RKHA 3FMQA 2A5YB 1J59A 5LBQA 1YW9A 2M5WA 2HKOA 4G8XA 1IN5A 3BJ6A 5FFZA 3KETA 2YX7A 3M8FA 1O7LA 4P9UA 3E6CC 4HF0A 1XGNA 3ISPA 3O6BB 1MZBA 1PP7U 2DFIA 1G6NA 1T39A 5HVQC 5LEKA 4WF2A 4KA4A 2YX4A 1R22A 1LDJA 4KDPA 1JGSA 2EA2A 4I02A 2HQRA 2QZ8A 4P5OA 1S3JA 2ZJ2A 5E1XA 2CG4A 5BPIA 3HYIA 3MFKA 2IA0A 4FT8A 2V9VA 1MGTA 3F3XA 3VB2A 4ZYHA 4RGSA 3WGGA 4OINF 1S6LA 1Q1HA 2JZYA 3QP5A 2VONA 2HTSA 4G9YA 4E70A 1R1UA 4BAYA 5K5OA 1QZZA 3D5LA 5HDGA 5EEHA 2COMA 5CJ9A 1P4XA 4HX4A 5ILUA 5H6RA 1SMTA 1R23A 4CHUA 3DPLC 5L3EA 5KVRA 2GXBA 1LJ9A 3VEPA 2DT5A 3QPHA 3BJAA 1P4WA 2PG4A 4L9TA 4L0ZB 2EFOA 2KJCA 4IF4A 5DV5A 4KYWA 1SD6A 4I7HA 2XUBA 5CVJA 1XGSA 1K78B 1I1SA 2EK5A 3FM5A 1Z6RA 1RI7A 2Q8KA 4LLNA 5ICEA 1DDNA 5LGNA 1SFUA 4WCGA 2LSOA 3FHZA 2FQ3A 1LB2A 1F5TA 4JK1X 4CYDA 3TOBA 1S29A 3ZMTA 5JI6A 2M1BA 1F4KA 1UHWA 2QM3A 2MH2A 5HLHA 1AOYA 1R36A 4PDKA 3I4PA 2GXGA 2XRNA 1U8RA 2CYYA 2YPRA 5DDGA 3JSOA 3SHFA 4HAMA 4MQ9F 3ZN0A 3RJPA 2DLLA 5A2QZ 1E2XA 1OMIA 1V4RA 2O6GE 2OD5A 1LVAA 3N4MA 1ZGJA 4KMUX 3ZMVA 3E5UA 1FT9A 3RYRA 4RGUA 3HRMA 5FLXZ 1J5YA 5LLQA 2RVCA 1W5SA 2GAUA 2A69F 4ENJA 4UV8A 1TQMA 4Y13A 3RKWA 2BEOA 1IF1A 4U0YA 3QU3A 4KFCA 5E18F 1YW7A 2JRTA 5FO5A 4M73A 4Q47A 3QPTA 2A3SA 3GWZA 4AVPA 4ENMA 2YU3A 3GFMA 1Z05A 2OZ6A 1O57A 3IKTA 3E6MA 1CGPA 2L54A 3F8CA 4EVIA 4UUVA 2C6YA 4OOIA 2ZKZA 3KP5A 4HV5A 1CF7A 2STTA 2GWRA 2DTRA 1FYLA 1KQ9A 4M71A 5J8CA 2K86A 5LRSA 4I0AA 2P8TA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3E6D A;  5CVV A;  5IT9 K;  2L3D A;  3I59 B;  4R1H A;  2H6C A;  1F9N A;  1T0F A;  4F7Z A;  4EJO A;  5DCM A;  4Y15 A;  4LG0 A;  1HKT A;  5DCM B;  1LDK B;  1YIO A;  2FML A;  3HTS B;  2YR2 A;  3R6S A;  2QUF A;  2ISZ A;  1PP8 F;  1B6A A;  2KIU A;  1YG2 A;  3QAH A;  2EFP A;  4BQA A;  3GX4 X;  3CTA A;  3QOP A;  3I71 A;  5L3C A;  1B9N A;  3RIR A;  3HOT A;  3I5U A;  4HOB A;  3QP6 A;  2PEX A;  3GZ5 A;  3KEO A;  2EA4 A;  1LEA A;  2HYG D;  3NQO A;  4HLY A;  1QGP A;  3MAJ A;  1TNT A;  4LLL A;  3WE3 A;  1H9G A;  4Q4Z F;  4CGZ A;  5JVT A;  3GYH X;  1LQ1 A;  1ZG1 A;  2M45 A;  2DU9 A;  3HSR A;  4RB0 A;  2A61 A;  2BYV E;  5D8K B;  3GZ6 A;  1H0M A;  1FLI A;  3WU0 A;  1TW3 A;  2CQK A;  1KQ0 A;  3IRR A;  1FC3 A;  5LGU A;  1P92 A;  5E20 A;  3BOQ A;  3DXJ F;  5IT3 A;  2FMY A;  4P96 A;  4QWQ A;  2MD5 A;  2BV6 A;  3T8R A;  1O3S A;  1Z1D A;  3WTV C;  3RPU A;  2G9W A;  1K79 A;  2NS0 A;  2VBY A;  3DP7 A;  3V8L A;  3G3Z A;  5BOX A;  5LGT A;  2VXZ A;  5H6Q A;  4WK8 F;  2OAZ A;  1SAX A;  3TO6 A;  3ABT A;  1P6R A;  1SD4 A;  3EYI A;  4TV7 A;  3Q9S A;  2DK8 A;  1TQP A;  1WI9 A;  4G7Z F;  5ICF A;  2FNP A;  3K2Z A;  4GYG A;  5FGM A;  1QQI A;  3IWF A;  4R79 A;  1XDU A;  3DKW A;  1BI3 A;  4EM1 A;  2V6C A;  4LMY A;  3RI4 A;  1DPR A;  1KU2 A;  5F6F A;  1IUY A;  1WQ2 A;  4MQV A;  2E1N A;  4A0Z A;  1MKM A;  2GA1 A;  2X0L A;  3LAJ A;  2EWN A;  1TQI A;  4HX7 A;  1ZAR A;  2ACJ A;  3J81 K;  1BI0 A;  1IN8 A;  1U5T A;  4DNC A;  2Y75 A;  4BYY A;  1U5T B;  5DD8 A;  3ZMD A;  1J0R A;  4CZZ A;  1UFM A;  1VTN C;  1WSU A;  4HV6 A;  3BY6 A;  4XRF A;  3QU6 A;  1U78 A;  3KFW X;  5CVR A;  4S05 A;  4HF2 A;  3JTH A;  1O3T A;  2Z9O A;  1H9T A;  3REO A;  2V1D A;  2VOD A;  3SZT A;  1YLF A;  2Z33 A;  2Y0M A;  2PN6 A;  3U1D A;  1SFE A;  3C7J A;  4UV9 A;  1OPC A;  3MQ0 A;  2QYO A;  3BPV A;  4A12 A;  3EDP A;  2EB7 A;  3ZP5 A;  2XVC A;  4MTE A;  2XAH A;  3U9G A;  3BP8 A;  3G73 A;  4QLC U;  3KP4 A;  2JT1 A;  1ZAO A;  4FHT A;  2P5V A;  4A0Y A;  2F2E A;  2DPU A;  2R7D A;  1QBJ A;  1MJA A;  2QEN A;  1W7P D;  3DPT A;  1QO0 D;  3ZPL A;  3CUQ C;  3KCC A;  2CWE A;  2IP2 A;  2F5F A;  2MLG A;  4P9F A;  5LHH A;  2A6E F;  4M74 A;  3TOA A;  4ZZL A;  1BBY A;  1OKR A;  4LJZ F;  1ZLK A;  5F64 A;  5HLG A;  3NEU A;  2PQ8 A;  3DEU A;  1FSH A;  5EEG A;  3K69 A;  2HKX A;  2HZT A;  5FD6 A;  2OA4 A;  4MHG A;  3TGN A;  4U88 A;  2ZNY A;  3R0A A;  5D5X B;  3L2C A;  6PAX A;  1Z9C A;  1HW1 A;  1V3F A;  2ZBK A;  2K4J A;  2FOK A;  4LFU A;  3GVA A;  3WTT C;  2L02 A;  1UCR A;  3KZZ A;  2CO5 A;  3WU1 B;  2FU4 A;  2E7W A;  3GFJ A;  4GCV A;  4CIC A;  4WWC A;  4WXD A;  3LWF A;  2IRF G;  1QNT A;  5ILS A;  2UXN A;  3HSF A;  1UB9 A;  4CO8 A;  4GGG A;  1FBS A;  1MDM B;  1WRJ A;  2STW A;  1SFX A;  2NYX A;  2KJB A;  3F23 A;  2HQN A;  4ESJ A;  3U2R A;  3P9K A;  4EQQ A;  2IVM A;  3GW2 A;  1BI1 A;  4L9N A;  2HS5 A;  5ICG A;  3KP7 A;  3OOP A;  4LK0 F;  2HTJ A;  4RAZ A;  3GFI A;  4RS8 A;  1F1Z A;  1PDN C;  4BH9 A;  5D4S A;  1XMK A;  2EFQ A;  2VT2 A;  1L0O C;  1DPU A;  4L9J A;  1S8N A;  3N97 A;  2P7V B;  4KIC A;  5LHG A;  1WWX A;  2FF4 A;  1G3Y A;  1AWC A;  3ERE D;  1FPQ A;  2FSW A;  1K78 A;  2YSR A;  3L9F A;  1G3T A;  5LHI A;  2Q2E A;  3K9T A;  2JSC A;  2P7C B;  3HTU A;  4O6J A;  3ECO A;  3KP2 A;  1G3S A;  4OU0 A;  1J75 A;  3W6K B;  4IJA A;  2QQA A;  2EJR A;  5DCF A;  3EET A;  1OYI A;  4HZF A;  3WTZ A;  1HW2 A;  3E97 A;  3BWG A;  3SZP A;  4ZYG A;  4AD9 A;  2IA2 A;  2Z5U A;  4EJV A;  4KIG A;  1ZYR F;  3IKV A;  2WC2 A;  4XBF A;  2WV0 A;  2RNJ A;  1LEB A;  3CDH A;  2W85 A;  3V8J A;  4ON0 A;  4O3M A;  1ULY A;  5ED4 A;  2E7X A;  3J80 Z;  2ESH A;  4WXH A;  3TKY A;  3P7N A;  3DFG A;  4UVC A;  2VE9 A;  1YS6 A;  4M9X A;  4B8X A;  1YW8 A;  3LA7 A;  1KU7 A;  2Q0O A;  4IRH A;  3MCZ A;  5CVI A;  4R8H A;  3CO6 C;  4ZH4 F;  1LNW A;  4L5I A;  2MC3 A;  3MWM A;  2ADU A;  1IRG A;  5A2Q K;  2K7L A;  4RB2 C;  1PUE E;  1C0W A;  2RC4 A;  4ENN A;  1BC8 C;  3GLX A;  1R00 A;  4YII A;  2RGV A;  3HRS A;  4U7B A;  4O5V A;  1GXQ A;  3K1M A;  3ML6 A;  1D3Y A;  1TNS A;  3H3U A;  5FLX K;  2H6B A;  3KP6 A;  4GYI A;  3CUO A;  3PQK A;  3IRQ A;  4ESB A;  1KYW A;  2VE8 A;  4A5M A;  1T38 A;  2KIM A;  4JQF A;  4P55 A;  3KP3 A;  1EH6 A;  1EV7 A;  4HX8 A;  2F5C A;  3LST A;  3FXR A;  2O03 A;  2PMU A;  2JPC A;  3M7G A;  3I59 A;  3LFK A;  1YQA A;  1W7P B;  5CVU A;  3V7S A;  5DUK A;  1FBQ A;  4UNO A;  5HDK A;  4UVB A;  2HFH A;  4G6D A;  1HKQ A;  2FBH A;  3ECH A;  3F21 A;  1ZRD A;  1Y0U A;  1J2X A;  4MGR A;  2VT3 A;  3IC7 A;  1P4A A;  2P5L C;  2DAO A;  3D0S A;  1BI2 A;  1I1G A;  1A04 A;  3GEZ A;  1DUX C;  1XGO A;  2BBY A;  4PCQ A;  4OIO F;  3ABU A;  3AAF A;  4RAY A;  4XLN F;  1YS7 A;  3K0L A;  2LKP A;  2P6S A;  2M30 A;  1XB4 A;  1FZP B;  4MNU A;  1MD0 A;  3KLN A;  4EV0 A;  5K5Q A;  2HDC A;  3I54 A;  4U0W A;  1JE8 A;  3RTR A;  4I98 B;  5BS6 A;  4N9H A;  4FX0 A;  1J7K A;  4Q5S F;  2Z99 A;  1RIO H;  2L4M A;  4HDV A;  2GA2 A;  1I27 A;  4IXA A;  2A6H F;  1ON2 A;  2VBZ A;  3HRU A;  3E6B A;  3RKY A;  3ZMU A;  1Z7U A;  3ROU A;  2W84 A;  3WE2 A;  2AS5 F;  4UVA A;  1KA8 A;  3MZH A;  3T5X A;  2JPB A;  3KZY A;  2FBI A;  3E3V A;  4UHT A;  3FMR A;  4RGR A;  3M1E A;  1GHC A;  5FD5 A;  2XGX A;  4ESF A;  3T8T A;  5HOO A;  2OQR A;  4XLP F;  4BXU A;  2IT0 A;  3TQN A;  3WTW C;  5E1Z B;  1HQC A;  3WTX C;  3W6J B;  5E1W A;  4EJW A;  4LB5 A;  4I09 A;  1G4D A;  1LDD A;  2IPQ X;  3SQN A;  1ZRC A;  4H0E A;  2P4W A;  2PJP A;  4IHS A;  5D6F A;  4K2E A;  3BPX A;  3C1D A;  3F22 A;  1RNL A;  4LB6 B;  2BGC A;  1U3E M;  4G94 A;  1D8J A;  4EM0 B;  2OBP A;  1IXR C;  1ZG3 A;  1I6X A;  3BZ6 A;  1UST A;  2L4A A;  1IZ1 A;  5BPD A;  1J9I A;  2HYF A;  1Z6T A;  4IVN A;  1OYW A;  2XV4 S;  4Q48 A;  2CGP A;  3JSP A;  5DD4 A;  4RGX A;  3ZMS A;  4BHC A;  2ZCW A;  5HLI A;  3V8K A;  1HSJ A;  1ZGA A;  2VN2 A;  4L5J A;  5LEJ A;  1T6S A;  3FZV A;  1XCB A;  3VOE A;  4IHT A;  3FF5 A;  2XIG A;  2CW0 F;  4EM2 A;  4BHP A;  3LQR A;  5ICC A;  2NRA C;  2O0Y A;  2R7F A;  2DI3 A;  1T2K A;  2RQP A;  2MBF A;  1P2F A;  2FRH A;  3ZQ7 A;  3B02 A;  1B59 A;  5AIQ A;  3M9A A;  2QBY B;  2DO7 A;  4L0Y B;  1FP2 A;  3JAM Z;  1WKM A;  3SXY A;  4HF1 A;  4YIF A;  2X4H A;  4ENK A;  2NNY A;  3PFI A;  3CUQ A;  2H27 A;  3COA C;  3CUQ B;  1FNN A;  1B4A A;  2D2W A;  2IA1 A;  4MEY F;  3Q9V A;  1RUN A;  4LK1 F;  4KIB A;  2IJL A;  5DUI A;  3H92 A;  4MTD A;  4BHB A;  4CDG A;  1RUO A;  1KYZ A;  2L01 A;  3T0Y A;  1R1V A;  3F8N A;  4LD5 A;  1KU9 A;  1FP1 D;  3BRO A;  3L09 A;  5H20 A;  5ILV A;  2VC0 A;  5J8F A;  2WTE A;  2XAQ A;  2RDP A;  3T1B A;  4M72 A;  4NQW A;  2UWM A;  4ZYE A;  2V1U A;  4G7O F;  4EJT A;  1B9M A;  4UXN A;  3HHH A;  3R0J A;  4GO1 A;  2RN7 A;  2EV0 A;  2ZNZ A;  4OIQ F;  1SD5 A;  1MDM A;  3QRF F;  2EFW A;  3CLO A;  3R4K A;  2W57 A;  3WG9 A;  1HKS A;  2PI0 A;  3LQQ A;  1JXS A;  3LA2 A;  1K7A A;  2ELH A;  1BN5 A;  5JR3 A;  3DV8 A;  3I0T A;  4OMZ A;  2O61 A;  3IHU A;  5KK1 A;  3RPQ A;  3K1N A;  3H3Z A;  3R61 A;  4YG2 F;  1S7O A;  1TBX A;  1QPM A;  1R5H A;  5D5W B;  3FXU A;  3HIF A;  1FYK A;  3CO7 C;  5FFX A;  1KQ8 A;  3ZN1 A;  1ZRF A;  4IRG A;  1EH7 A;  4PGG A;  3HSE A;  4N9I A;  1EH8 A;  4LLG F;  1XSX A;  3HUG A;  5HS7 A;  3E5X A;  1STZ A;  2NAZ A;  3SFZ A;  3WTU C;  1R1T A;  2GQQ A;  2ZFW A;  2HEO A;  4G7H F;  1XCV A;  2W24 A;  4AIH A;  2QQ9 A;  1IRF A;  2Z3Y A;  2W25 A;  2MA3 A;  1JHH A;  1K6O A;  1JHF A;  4RB1 A;  2GIV A;  3GF2 A;  2LF7 A;  2HWV A;  4ETS A;  3HOS A;  1TTY A;  2J5P A;  2IW5 A;  3RYP A;  2PMH A;  4KUM A;  5E8G A;  2UZK A;  3MZY A;  4RB3 C;  2DPD A;  2R3S A;  1IW7 F;  1TLH B;  1XGM A;  4HA8 A;  2XKO A;  1XSV A;  4HDU A;  1X3U A;  3TO7 A;  4EMS A;  2B0L A;  3Q5F A;  3EUH A;  2PFB A;  4KN4 X;  4M6X A;  4G6Q A;  3ULQ B;  5E8I A;  4OIR F;  2HOE A;  3DF8 A;  4IPA A;  2FNA A;  2WWY A;  3FWE A;  2Y48 A;  3VOD A;  3I64 A;  4A0X A;  2MLK A;  4JBA A;  5L3G A;  4A5N A;  5F1R A;  2QVO A;  1ZH5 A;  3K1P A;  3F8F A;  4OMY A;  2CSO A;  2DQL A;  3F8B A;  3J80 K;  2XRO A;  2F5D A;  3O2P E;  4L18 B;  2G7U A;  2HR3 A;  1BC7 C;  1R58 A;  2XAS A;  2FXA A;  1ZHF A;  1YO5 C;  1MJB A;  3GFL A;  1IAW A;  2QQB A;  4HW0 A;  2J5O A;  5BQT A;  1ONV A;  1BIA A;  1E17 A;  2V79 A;  5HS9 A;  2VBW A;  3FMS A;  5LRR A;  3HHG A;  3EQL F;  4BNC A;  4NB5 A;  2NNN A;  1IXS B;  2K4B A;  4HLX A;  2DW4 A;  3F6O A;  3TO9 A;  3IL2 A;  4A6E A;  3KE2 A;  3P9C A;  5IT9 Z;  5JFR A;  5L3D A;  3MEX A;  1USS A;  1KGS A;  2VOO A;  3GUD A;  3F8M A;  4MEX F;  3J7A O;  1W7P A;  4A2U A;  3OV8 A;  4I01 A;  4B09 A;  3I53 A;  1CF7 B;  3E5Q A;  1L3L A;  2VOP A;  3ELK A;  1REP C;  2ISY A;  1FWZ A;  1I5Z A;  3B73 A;  1U6G A;  2H94 A;  1D5V A;  2ZXJ A;  1ZRE A;  3L7W A;  2FE3 A;  2O8X A;  4KN7 X;  2QLZ A;  3JTG A;  2A68 F;  3R60 A;  3WTS C;  3RDI A;  3WGH A;  4LG0 B;  2M8E A;  1YTY A;  3M8E A;  2LF8 A;  2VC1 A;  4M6Y A;  3O3K A;  2ETH A;  1FYM A;  2GZW A;  2D1V A;  2EV6 A;  1NHA A;  1BIB A;  3F6V A;  3TDZ C;  1IN7 A;  3C18 A;  1TW2 A;  3DQV C;  3S2W A;  2XAF A;  4HQE A;  5HDN A;  4ZYD A;  3V7R A;  3WGI A;  2FA5 A;  4I0B A;  4KIF A;  3JW4 A;  1BJA A;  4KT5 C;  1ODD A;  5CYV A;  4XSZ F;  4AIJ A;  5J6X A;  1MJ9 A;  2HGC A;  1O3Q A;  3IWZ A;  3LAP A;  1ON1 A;  2KIF A;  5D4R A;  5TRD A;  3KEQ A;  1O3R A;  3V7C A;  1GXP A;  3FM3 A;  1FOK A;  3CJN A;  1OR7 A;  2PBI A;  5BMZ A;  3BDD A;  2UXX A;  2QWW A;  3I58 A;  4D0P A;  4WXC A;  4YFX F;  1UHM A;  1IXC A;  1R5G A;  4NHJ A;  1SMY F;  1RZ4 A;  3C3W A;  2RV8 A;  2AXL A;  5K5R A;  3WTY C;  1BOA A;  3PQJ A;  2DQR A;  2EFN A;  5TJJ A;  1KU3 A;  4N0B A;  1XN7 A;  1R7J A;  2OZU A;  3V4G A;  2KKO A;  1G3W A;  1XMA A;  4S04 A;  1XDS A;  4AIK A;  5HS8 A;  2ZO4 A;  2D45 A;  4U0V A;  1HW5 A;  3VFZ A;  3EYY A;  2DBB A;  2XHK A;  2KRF A;  3J81 Z;  1W4M A;  4U7D A;  5ERI A;  1FSE A;  1SD7 A;  1FBU A;  1T98 A;  3RKX A;  2A07 F;  5D8L B;  2K02 A;  1HST A;  2E1C A;  3HRT A;  1Z91 A;  2MH9 A;  2ZME A;  2ZME B;  5JHU A;  5D5U B;  2TDX A;  4YFK F;  2ESN A;  1FX7 A;  2D1H A;  1OYY A;  4FX4 A;  2M87 A;  2BE5 F;  5D6E A;  1U5T C;  1B1B A;  4PZJ A;  2XAJ A;  4OIP F;  4Z2Y A;  2VBX A;  1ZLJ A;  1BM9 A;  1YYV A;  5CLS A;  4CXF A;  1D8K A;  5L3B A;  1IN4 A;  4M9Z A;  2P5K A;  5E17 F;  3L00 A;  2CFX A;  2G7H A;  4I2O A;  4GXO A;  2FEZ A;  2QBY A;  3WOD F;  1DP7 P;  3F72 A;  1U2W A;  4WX9 A;  1HXD A;  1XD7 A;  3NRV A;  4KNY A;  3GXO A;  4Y17 A;  2K27 A;  2FBK A;  2OU2 A;  2JTV A;  4AWX B;  4DQ2 A;  3LA3 A;  2XAG A;  1S7A A;  3BJO A;  1ZG5 A;  1QZY A;  4IRI A;  5D5V B;  5L3F A;  5FB2 A;  4EGY A;  4XSX F;  5AIP A;  3JAM K;  2LNB A;  2XKP A;  2LDU A;  4KMF A;  4ZZD A;  4ASN A;  2EV5 A;  4A6D A;  4EGZ A;  3FXQ A;  1ZN2 A;  2V1X A;  2P6T A;  4HYE A;  2H09 A;  1YFH A;  5DEQ A;  3KLO A;  4LGW A;  2O3F A;  2PLY A;  3GO5 A;  5AON A;  1HBX G;  4EJU A;  4M9S A;  1FY7 A;  5K1Y A;  2F5E A;  4YFN F;  1O7F A;  3TDU C;  3P9I A;  1IN6 A;  1XSD A;  2OQG A;  4HQM A;  4L9V A;  3FX3 A;  4PGH A;  2DK5 A;  4HBL A;  1W5T A;  3ZMZ A;  1GVJ A;  5DYM A;  2RKH A;  3FMQ A;  2A5Y B;  1J59 A;  5LBQ A;  1YW9 A;  2M5W A;  2HKO A;  4G8X A;  1IN5 A;  3BJ6 A;  5FFZ A;  3KET A;  2YX7 A;  3M8F A;  1O7L A;  4P9U A;  3E6C C;  4HF0 A;  1XGN A;  3ISP A;  3O6B B;  1MZB A;  1PP7 U;  2DFI A;  1G6N A;  1T39 A;  5HVQ C;  5LEK A;  4WF2 A;  4KA4 A;  2YX4 A;  1R22 A;  1LDJ A;  4KDP A;  1JGS A;  2EA2 A;  4I02 A;  2HQR A;  2QZ8 A;  4P5O A;  1S3J A;  2ZJ2 A;  5E1X A;  2CG4 A;  5BPI A;  3HYI A;  3MFK A;  2IA0 A;  4FT8 A;  2V9V A;  1MGT A;  3F3X A;  3VB2 A;  4ZYH A;  4RGS A;  3WGG A;  4OIN F;  1S6L A;  1Q1H A;  2JZY A;  3QP5 A;  2VON A;  2HTS A;  4G9Y A;  4E70 A;  1R1U A;  4BAY A;  5K5O A;  1QZZ A;  3D5L A;  5HDG A;  5EEH A;  2COM A;  5CJ9 A;  1P4X A;  4HX4 A;  5ILU A;  5H6R A;  1SMT A;  1R23 A;  4CHU A;  3DPL C;  5L3E A;  5KVR A;  2GXB A;  1LJ9 A;  3VEP A;  2DT5 A;  3QPH A;  3BJA A;  1P4W A;  2PG4 A;  4L9T A;  4L0Z B;  2EFO A;  2KJC A;  4IF4 A;  5DV5 A;  4KYW A;  1SD6 A;  4I7H A;  2XUB A;  5CVJ A;  1XGS A;  1K78 B;  1I1S A;  2EK5 A;  3FM5 A;  1Z6R A;  1RI7 A;  2Q8K A;  4LLN A;  5ICE A;  1DDN A;  5LGN A;  1SFU A;  4WCG A;  2LSO A;  3FHZ A;  2FQ3 A;  1LB2 A;  1F5T A;  4JK1 X;  4CYD A;  3TOB A;  1S29 A;  3ZMT A;  5JI6 A;  2M1B A;  1F4K A;  1UHW A;  2QM3 A;  2MH2 A;  5HLH A;  1AOY A;  1R36 A;  4PDK A;  3I4P A;  2GXG A;  2XRN A;  1U8R A;  2CYY A;  2YPR A;  5DDG A;  3JSO A;  3SHF A;  4HAM A;  4MQ9 F;  3ZN0 A;  3RJP A;  2DLL A;  5A2Q Z;  1E2X A;  1OMI A;  1V4R A;  2O6G E;  2OD5 A;  1LVA A;  3N4M A;  1ZGJ A;  4KMU X;  3ZMV A;  3E5U A;  1FT9 A;  3RYR A;  4RGU A;  3HRM A;  5FLX Z;  1J5Y A;  5LLQ A;  2RVC A;  1W5S A;  2GAU A;  2A69 F;  4ENJ A;  4UV8 A;  1TQM A;  4Y13 A;  3RKW A;  2BEO A;  1IF1 A;  4U0Y A;  3QU3 A;  4KFC A;  5E18 F;  1YW7 A;  2JRT A;  5FO5 A;  4M73 A;  4Q47 A;  3QPT A;  2A3S A;  3GWZ A;  4AVP A;  4ENM A;  2YU3 A;  3GFM A;  1Z05 A;  2OZ6 A;  1O57 A;  3IKT A;  3E6M A;  1CGP A;  2L54 A;  3F8C A;  4EVI A;  4UUV A;  2C6Y A;  4OOI A;  2ZKZ A;  3KP5 A;  4HV5 A;  1CF7 A;  2STT A;  2GWR A;  2DTR A;  1FYL A;  1KQ9 A;  4M71 A;  5J8C A;  2K86 A;  5LRS A;  4I0A A;  2P8T A; 
#chains in the Genus database with same CATH topology
 3E6D A;  5CVV A;  5IT9 K;  2L3D A;  3S3N A;  3LMM A;  3TL4 X;  3AG2 H;  2Y9Y A;  3I59 B;  3HBL A;  4R1H A;  2H6C A;  1F9N A;  5C44 J;  1MIJ A;  1DP3 A;  1T0F A;  3KYL A;  4F7Z A;  4EJO A;  5DCM A;  4Y15 A;  4LG0 A;  5IOY A;  3PJR A;  2NVT J;  3UKG A;  1HKT A;  5DCM B;  3HG9 A;  3K4M A;  1LDK B;  1YIO A;  3FXM A;  2V4J C;  2FML A;  3HTS B;  2YR2 A;  4XKB A;  3R6S A;  4BGD A;  2QUF A;  4F52 A;  4YIR X;  1PP8 F;  2ISZ A;  1B6A A;  5FJ8 J;  2KIU A;  1YG2 A;  3QAH A;  2W4S A;  1QA6 A;  2EFP A;  4BQA A;  3GX4 X;  2WBM A;  3CZ6 A;  1D0Y A;  3CTA A;  3QOP A;  4BXF A;  3I71 A;  5L3C A;  1B9N A;  2O5R A;  3I3L A;  4L5E A;  3RIR A;  3ZQI A;  2XSJ C;  2DDA A;  3HOT A;  2KHM A;  3I5U A;  3LNQ A;  5F04 A;  4HOB A;  3QP6 A;  1ZKG A;  3A0B C;  2PEX A;  2ICW G;  3GZ5 A;  2X1E A;  1GDT A;  1QVU A;  4A3E J;  4PSW A;  2JA2 A;  3KEO A;  1TP4 A;  2EA4 A;  1LEA A;  2HYG D;  1YOV B;  3L2U A;  3L2Q A;  2OV7 A;  3NQO A;  4HLY A;  2GOM A;  3ASN H;  1QGP A;  3MAJ A;  1TNT A;  4XLE A;  5FRN A;  4LLL A;  3IP4 B;  1GUU A;  2L7Z A;  1H9G A;  3WE3 A;  5H2F C;  4Q4Z F;  4CGZ A;  1XX5 A;  3PIO F;  3PNT A;  1CQT A;  4A3C J;  4IL6 C;  5JVT A;  4C3I J;  3GYH X;  1A5J A;  2H1L A;  1LQ1 A;  1MNE A;  4XM3 A;  1ZG1 A;  2M45 A;  2DU9 A;  1Y8Q B;  3M8J A;  3HSR A;  4RB0 A;  2DDB A;  2A61 A;  5C4J J;  1ETO A;  2NS8 A;  2BYV E;  5D8K B;  1QHH D;  2EZH A;  2LC2 A;  2JMW A;  3GZ6 A;  1H0M A;  1FLI A;  2WA0 A;  3WU0 A;  1TW3 A;  2CQK A;  2DMP A;  2HYJ A;  1KQ0 A;  3CC7 I;  2E35 A;  1FC3 A;  5LGU A;  3IRR A;  5IY5 H;  1P92 A;  5E20 A;  1YI2 I;  2V9P A;  3OS1 A;  3BOQ A;  3DXJ F;  5IT3 A;  5C3E J;  2FMY A;  1Z77 A;  3QYF A;  1WVR A;  1IRZ A;  4AYB N;  4P96 A;  4XOP A;  4QWQ A;  2NOG A;  2MD5 A;  2BV6 A;  2EZL A;  4E7I A;  2HI3 A;  2Y30 A;  3T8R A;  5JVG F;  1ETY A;  1O3S A;  3CCR I;  3TP3 A;  4II2 A;  1Z1D A;  3WTV C;  3RPU A;  2G9W A;  1K79 A;  2NS0 A;  2W00 A;  2LOO A;  1X1C A;  2VBY A;  3LSK A;  2CV2 A;  3TW7 A;  3GTM J;  3DP7 A;  2B7E A;  4PJJ A;  3V8L A;  3G3Z A;  5BOX A;  2H8W A;  5LGT A;  1LE8 A;  3PNV A;  2VXZ A;  5H6Q A;  2R7W A;  4M3E A;  4WK8 F;  1LE8 B;  2OAZ A;  4XLH A;  3C2H A;  3JRF A;  2NVU B;  1SAX A;  3TO6 A;  3ABT A;  3RQI A;  2DFF A;  2Z16 A;  1P6R A;  2IS4 A;  3HL2 A;  1SD4 A;  3EYI A;  4TV7 A;  3Q9S A;  1G2H A;  3A01 B;  2DK8 A;  1Q1V A;  2BY1 A;  1TQP A;  3S16 J;  1WI9 A;  2JWT A;  4G7Z F;  5ICF A;  2FNP A;  1N77 A;  3K2Z A;  4GYG A;  5FGM A;  2D5V A;  4A69 C;  2DA7 A;  1QQI A;  4C2U A;  3IWF A;  4R79 A;  1XDU A;  3DKW A;  1BI3 A;  3BQZ A;  4EM1 A;  3A03 A;  2V6C A;  4LMY A;  5J1R A;  3RI4 A;  5CKT A;  1DPR A;  2CW7 A;  1KU2 A;  5F6F A;  1IUY A;  3OL4 A;  1WQ2 A;  1X58 A;  4XRM A;  3H36 A;  2F48 A;  4BDY A;  3DTI A;  1VQ8 I;  5JHF A;  4MQV A;  2E1N A;  3GTJ J;  3S1M J;  4A0Z A;  3A0H C;  1MKM A;  2OCE A;  4DOZ A;  3G6E I;  2X9D A;  2GA1 A;  2X0L A;  4BQN A;  3BR6 A;  1WH5 A;  3LAJ A;  2EWN A;  1TQI A;  4HX7 A;  4YEJ A;  1ZAR A;  2ACJ A;  1N25 A;  2L9R A;  4W97 A;  1S72 I;  2VJI A;  2V6E A;  3J81 K;  1BI0 A;  4RDU A;  1IN8 A;  1U5T A;  4DNC A;  1H8A C;  3K4K A;  2Y75 A;  4ZYA A;  4BYY A;  1U5T B;  5DD8 A;  3ZMD A;  1J0R A;  4CZZ A;  2W1O A;  1UFM A;  1VTN C;  1WSU A;  1TC3 C;  4HV6 A;  3BY6 A;  4XRF A;  2WAF A;  3QU6 A;  1U78 A;  3KFW X;  3HOU J;  5CVR A;  4S05 A;  4HF2 A;  4F93 B;  1B8I A;  1Y0N A;  5EZH A;  2XF6 A;  4BKX A;  3JTH A;  2DOF A;  3K2A A;  1O3T A;  2Z9O A;  4XMY A;  1H9T A;  3REO A;  2L5Q A;  2V1D A;  3W2W A;  2VOD A;  3SZT A;  1YLF A;  2Z33 A;  2Y0M A;  2PN6 A;  1WCM J;  3U1D A;  2COB A;  1SFE A;  3C7J A;  4UV9 A;  1VQ4 I;  1OPC A;  3WHB A;  3MQ0 A;  1V55 H;  2QYO A;  3BPV A;  1RET A;  2LP0 A;  4A12 A;  4MIM A;  1HDD C;  3W6V A;  3FDY A;  2E5Z A;  5IP7 J;  3BT9 A;  3EDP A;  2ZXW H;  5HLT A;  2EB7 A;  3DU6 A;  3LSJ A;  2ZXI A;  3GTP J;  3MKY B;  3G4S I;  1D5Y A;  3ZP5 A;  2XVC A;  3PSI A;  5M3M J;  4MTE A;  4HST A;  4QSH A;  3K70 C;  4IHW A;  2XAH A;  3U9G A;  3BP8 A;  1H88 C;  3AG4 H;  3G73 A;  4QLC U;  1JUP A;  3KP4 A;  2R92 J;  2JT1 A;  1ZAO A;  4FHT A;  1AU7 A;  1HF0 A;  2P5V A;  4A0Y A;  4XKV A;  2F2E A;  2WAE A;  2DPU A;  2R7D A;  1QBJ A;  1MJA A;  1X3Z B;  1WPK A;  2QEN A;  2ID6 A;  3BTJ A;  1W7P D;  3DPT A;  1QO0 D;  3DCF A;  2EIM H;  3ZPL A;  4HPQ A;  1PYV A;  3EUA A;  3CUQ C;  3GCM A;  1DU6 A;  3KCC A;  1SFO J;  4FCY A;  1S9H A;  2CWE A;  2IP2 A;  3E1S A;  1P7J A;  2F5F A;  2MLG A;  3CMY A;  4P9F A;  4PJM A;  5LHH A;  5M5W J;  3OWT A;  2A6E F;  4M74 A;  3TOA A;  4ZZL A;  1BBY A;  1OKR A;  3QWL A;  4LJZ F;  2LKS A;  2O7O A;  5J47 A;  1OLT A;  1PVE A;  1ZLK A;  5F64 A;  5HLG A;  2WY8 Q;  1BR4 A;  3NEU A;  2E19 A;  1TWH J;  3G1M A;  2PQ8 A;  3DEU A;  4HEA 2;  1FSH A;  3I9V 2;  4EEF G;  3GLL A;  5EEG A;  3K69 A;  2HKX A;  3S1Q J;  2HZT A;  2F4O B;  1WJB A;  5FD6 A;  2OA4 A;  2JA8 J;  4MHG A;  4JX5 A;  1X19 A;  3TGN A;  4ANJ A;  1UMQ A;  4U88 A;  2ZNY A;  3R0A A;  2ECC A;  5D5X B;  1MMD A;  2P0W A;  3L2C A;  4Z6Y A;  5M3F J;  1JTY A;  6PAX A;  1Z9C A;  1HW1 A;  1MBE A;  1V3F A;  2ZBK A;  2K4J A;  3J7A Y;  3DU5 A;  2FOK A;  1NTC A;  4LFU A;  3GVA A;  3WTT C;  5EYR A;  2HDD A;  4NQW B;  4DYC A;  2XC7 A;  5K7F A;  3OSF A;  3A02 A;  3RSN A;  2P81 A;  2L02 A;  1UCR A;  3KZZ A;  2CO5 A;  4BU2 A;  3WU1 B;  2FU4 A;  2BY3 A;  4JP0 A;  4NC6 A;  2BVM A;  2AO9 A;  2E7W A;  3GFJ A;  4GCV A;  4RMN A;  4CIC A;  3DEW A;  1WJC A;  3DTE A;  4OAZ A;  4CUG A;  2OPT A;  3K4L A;  4BJ6 C;  3CCE I;  3H0G J;  4WWC A;  2LY2 A;  3LWF A;  4WXD A;  2IRF G;  2CQN A;  2R7U A;  2R7R A;  1QNT A;  5ILS A;  4J00 A;  2UXN A;  2VPL A;  3JR9 A;  4IOC F;  3HSF A;  2XAU A;  2K9M A;  1K6Y A;  1UB9 A;  4CO8 A;  4GGG A;  1FBS A;  1MDM B;  3IV5 A;  1WRJ A;  3OY9 A;  4XOT A;  2STW A;  1SFX A;  1R6R A;  2JJ7 A;  1ZR4 A;  2NYX A;  2VJJ A;  2HNH A;  2KJB A;  4PJN A;  3F23 A;  2HQN A;  4ESJ A;  2GOX B;  4E7J A;  3U2R A;  2DOE A;  4IKF A;  3P9K A;  4EQQ A;  2IVM A;  1TT5 B;  3GW2 A;  4NNJ A;  3A2K A;  1BI1 A;  4L9N A;  3BR5 A;  1BR2 A;  4KIT B;  1EJ9 A;  2HS5 A;  3KP7 A;  3OOP A;  4DGW B;  1I39 A;  5ICG A;  4LK0 F;  2HTJ A;  1XMX A;  4RAZ A;  3GFI A;  1BL0 A;  3HXL A;  4RS8 A;  1FIP A;  3RQ4 A;  1F1Z A;  4A3B J;  1PDN C;  2XGC A;  4BH9 A;  5D4S A;  2DA5 A;  1XMK A;  2EFQ A;  2VT2 A;  1L0O C;  1DPU A;  4L9J A;  1S8N A;  1FJL A;  3N97 A;  2MGQ A;  2P7V B;  4KIC A;  5LHG A;  2BY2 A;  1WWX A;  2FF4 A;  1G3Y A;  1AWC A;  3ERE D;  2VKH A;  3LOC A;  4MFE A;  1FPQ A;  1FEX A;  3BC8 A;  4QIW N;  2FSW A;  1LFB A;  1ORK A;  3HUG B;  4JYK A;  2R0Q C;  1K78 A;  3LL7 A;  2YSR A;  3L9F A;  3D5S C;  4LG3 A;  4C2M J;  1G3T A;  5LHI A;  2Q2E A;  3K9T A;  2JSC A;  1TWF J;  2P7C B;  1QZE A;  2DOA A;  3HTU A;  4O6J A;  1ETX A;  2HDW A;  2VKD A;  3ECO A;  1AA7 A;  1MBF A;  4XQF A;  3KP2 A;  4HNV A;  5DM7 F;  1X1B A;  3HDD A;  1BJZ A;  5FLM J;  1G3S A;  1GV2 A;  2M2E A;  3FKI J;  2JA5 J;  4OU0 A;  1J75 A;  3OYG A;  3W6K B;  4IJA A;  4C2T A;  3NAU A;  2QQA A;  3ZOB A;  3QOD A;  2EJR A;  5DCF A;  2XGD A;  3EET A;  2Y2Z A;  1V5F A;  1OYI A;  3QPL A;  4J01 A;  2OJE D;  3JRB A;  5CQE A;  4HZF A;  1G59 A;  5KAI C;  2H8R A;  2YU9 J;  2CW8 A;  3WTZ A;  4BQO A;  4XID A;  3Q0W A;  1W5C C;  3OIP A;  2LH9 A;  3HEF A;  1HW2 A;  1D1A A;  4BDZ A;  3E97 A;  3BWG A;  3SZP A;  4ZYG A;  4AD9 A;  2IA2 A;  2Z5U A;  3ZQH A;  4EJV A;  4KIG A;  1ZYR F;  3IKV A;  2WC2 A;  3PNY A;  2M7B A;  4XBF A;  2WV0 A;  1PJR A;  2RNJ A;  2V1N A;  1LEB A;  4XOR A;  3CDH A;  2W85 A;  3DKX A;  3V8J A;  4ON0 A;  3OR2 C;  4O3M A;  1XS9 A;  1ZR2 A;  3K6G A;  1ULY A;  2DXI A;  5ED4 A;  4D9J A;  1IJW C;  2E7X A;  3J80 Z;  2ESH A;  4WXH A;  3TKY A;  1HDP A;  3M07 A;  3P7N A;  4FAS D;  5IP6 A;  1IDZ A;  3CQZ J;  3DFG A;  3ZR8 X;  4UVC A;  2E71 A;  2DCE A;  2VE9 A;  1YS6 A;  4M9X A;  4B8X A;  1YW8 A;  3LA7 A;  3BCB A;  3OYH A;  1KU7 A;  2KIS A;  2Q0O A;  4IRH A;  3MCZ A;  4C9Y A;  3K70 D;  4RM3 A;  5CVI A;  1YHQ I;  4R8H A;  3CO6 C;  1BW6 A;  4ZH4 F;  2JA6 J;  1LNW A;  4L5I A;  2MC3 A;  3MWM A;  1YRN B;  2ADU A;  4QPO A;  1IRG A;  2ME0 A;  1HA8 A;  5A2Q K;  2K7L A;  4RB2 C;  3MKZ A;  4B4C A;  1YE9 A;  1PUE E;  4BUP A;  1C0W A;  2RC4 A;  1RR7 A;  2XPV A;  4ENN A;  1BC8 C;  3PSF A;  1JUS A;  1R00 A;  3GLX A;  4HSR A;  4NC7 A;  1JKO C;  4YII A;  1XPX A;  2RGV A;  4UY8 I;  3HRS A;  4U7B A;  2YS9 A;  4O5V A;  4D7M A;  1GXQ A;  3K1M A;  3ML6 A;  1D3Y A;  2I8D A;  2RQQ A;  1I6H J;  3M1C A;  3CCS I;  1TNS A;  3H3U A;  4FET A;  3BLY A;  2H6B A;  3KP6 A;  5FLX K;  3AL0 C;  4GYI A;  3IUO A;  5J3L A;  5C4X J;  1JI8 A;  2FX0 A;  1IV8 A;  3B6A A;  3CUO A;  3PQK A;  3IRQ A;  1MBG A;  5EEA A;  2VLA A;  4NUB A;  4ESB A;  1KYW A;  4DZP A;  2DN0 A;  2VE8 A;  2DA3 A;  5CPR B;  4A5M A;  1T38 A;  2UUZ A;  2KIM A;  2TRT A;  3OYM A;  4JQF A;  1YJN I;  3W3C A;  4P55 A;  5B66 C;  3KP3 A;  3WU2 C;  3UNG C;  4KIS A;  1EH6 A;  3JRD A;  1EV7 A;  4HX8 A;  3S17 J;  2A05 A;  2F5C A;  3LST A;  1Z7L A;  3HM5 A;  3FXR A;  4XR6 A;  2R5Z B;  1LFP A;  2O03 A;  3OYF A;  2PMU A;  2JPC A;  3NWT A;  3L2W A;  5KCM A;  1E0E A;  3OIO A;  3DBL B;  3I59 A;  3M7G A;  1P9Q C;  3LFK A;  1DGR M;  1VZ0 A;  1YQA A;  1W7P B;  3E0J B;  2CRG A;  5CVU A;  1T95 A;  2M9H A;  1VND A;  5DUK A;  2VXD A;  3V7S A;  1FBQ A;  4UNO A;  3HPH A;  4E7S A;  2MG4 A;  2XSD C;  5HDK A;  2KIQ A;  4UVB A;  2HFH A;  4G6D A;  1YIJ I;  1HKQ A;  2FBH A;  2QA4 I;  2K9S A;  1WJD A;  3ECH A;  3F21 A;  2NOJ B;  4JOM A;  1Y0U A;  2DOD A;  5K7Z A;  1J2X A;  4YRV A;  1ZRD A;  2LVS A;  2M3A A;  4MGR A;  2HU9 A;  3ZQG A;  2VT3 A;  3BR1 A;  5F27 A;  4CZC A;  3IC7 A;  3H5N A;  1P4A A;  2P5L C;  2LMD A;  3D5R C;  2DAO A;  3D0S A;  1BI2 A;  3L2R A;  1VQM I;  1I1G A;  1A04 A;  3GEZ A;  4XON A;  1DUX C;  1XGO A;  3CC4 I;  2BBY A;  4PCQ A;  4OIO F;  3ABU A;  5DTD A;  4A93 J;  3PM1 A;  4UUT A;  3AAF A;  4RAY A;  1R49 A;  4XLN F;  1YS7 A;  3K0L A;  2LD5 A;  2K3P A;  2LKP A;  4XIC A;  4FIS A;  4AVZ A;  2P6S A;  3LFU A;  2M30 A;  3GTQ J;  2VQC A;  1XB4 A;  1FZP B;  4MNU A;  1MD0 A;  2GLO A;  3KLN A;  4AID A;  4HNU A;  4RA2 A;  2AQF A;  4EV0 A;  3HOW J;  5K5Q A;  2HDC A;  1Z67 A;  2ME6 A;  3I54 A;  4U0W A;  4CYC B;  4B3X A;  1JE8 A;  3Q3S A;  2E1O A;  3RTR A;  4I98 B;  5BS6 A;  2CUJ A;  5HNH A;  5J4Y A;  3K4C A;  1ZK8 A;  4N9H A;  5IPA A;  3DLA A;  3P5J A;  4FX0 A;  4CCJ A;  3BG6 A;  1J7K A;  3ABL H;  3DLL F;  4Q5S F;  1PUF A;  5GAE J;  2Z99 A;  1RIO H;  1PUF B;  2L4M A;  4HDV A;  2GA2 A;  1I27 A;  4MFD A;  1OJL A;  4IXA A;  2A6H F;  1ON2 A;  2VBZ A;  4A3L J;  3HRU A;  1VQ6 I;  3E6B A;  3TW6 A;  3OL3 A;  2ZB9 A;  3RKY A;  1RES A;  3ZMU A;  1IC8 A;  3PL8 A;  2HVS A;  3KPH A;  1Z7U A;  1VQO I;  3ROU A;  3MN2 A;  2JSP A;  2EBI A;  2PMZ A;  2W84 A;  3WE2 A;  2AS5 F;  2W48 A;  4UVA A;  2DA2 A;  1KA8 A;  1TT0 A;  3MZH A;  1FTZ A;  3T5X A;  2JPB A;  2K5C A;  2AHQ A;  3KZY A;  3OYE A;  2FBI A;  4D5F A;  3E3V A;  1VQ9 I;  3OS2 A;  4UHT A;  3FMR A;  2WAQ A;  3JRI A;  4RGR A;  3M1E A;  1R9T J;  1OR7 C;  1GHC A;  5FD5 A;  2XGX A;  3CES A;  4BY7 J;  2N8G A;  1A35 A;  3FXJ A;  3ZQF A;  4ESF A;  1P7I A;  2IGN A;  3H1C A;  3T8T A;  5HOO A;  4XN3 A;  2M7A A;  1BA5 A;  3IH4 A;  3H5A A;  2V7F A;  2OQR A;  3W2V A;  4XLP F;  4BXU A;  1UG0 A;  2IT0 A;  4BBR J;  3TQN A;  1KON A;  3A01 A;  2CUF A;  3WTW C;  1OCC H;  5E1Z B;  2XGE A;  1HQC A;  3CD6 I;  3WTX C;  3BG7 A;  2LTP A;  3W6J B;  2XPU A;  2OUM A;  5E1W A;  2ZSI B;  4EJW A;  4BEH B;  4LB5 A;  5M5Y J;  4I09 A;  2NVQ J;  2FUG 2;  1G4D A;  5DS9 A;  2MYS A;  1LDD A;  2IPQ X;  1ENH A;  3SQN A;  1ZRC A;  4H0E A;  2P4W A;  4B1R A;  2PJP A;  4IHS A;  2R7Q A;  2BZT A;  4YEL A;  2ZC2 A;  5D6F A;  3LSH A;  1A6Q A;  1T8I A;  3RZD J;  5E3L A;  4K2E A;  3BPX A;  3C1D A;  3FK7 A;  5B1B H;  3F22 A;  1RNL A;  4I99 C;  3CMA I;  2DMN A;  3B6C A;  4FE7 A;  1DQU A;  3NWS A;  1XTA A;  4QTR A;  2X6X A;  4M3D A;  1UHS A;  4ZTJ A;  4W1U A;  3HOV J;  4LB6 B;  3QQA A;  1IUF A;  2BOL A;  3OYD A;  1M1E B;  2BGC A;  2XB0 X;  2KMU A;  4FTH A;  1U3E M;  4G94 A;  1SC7 A;  5EG0 B;  1D8J A;  1ITY A;  3OMY A;  2E1M C;  4EM0 B;  2OBP A;  1IXR C;  2DFE A;  1ZG3 A;  1I6X A;  3BZ6 A;  1UST A;  4D5C A;  2F4M B;  4IOA F;  4RM2 A;  2L4A A;  2XPW A;  3G2B A;  2ZJQ F;  1O4X A;  3IH3 A;  4I6Z A;  1IZ1 A;  1NK2 P;  2VQG A;  2NVY J;  5BPD A;  1J9I A;  3CCL I;  4BAC A;  2HYF A;  2NS7 A;  1Z6T A;  4IVN A;  3GBG A;  1MBJ A;  3KYC B;  1U8B A;  1OYW A;  2ZME C;  2XV4 S;  4Q48 A;  2CGP A;  1MBK A;  3JSP A;  2LBF B;  3PUB A;  5DD4 A;  2L7F P;  1WHU A;  4RGX A;  3ZMS A;  4BHC A;  1Y56 A;  1I50 J;  2KRH A;  2ZCW A;  2CUE A;  2HOS A;  5HLI A;  3V8K A;  1HSJ A;  3G71 I;  1ZGA A;  2VN2 A;  4L5J A;  5LEJ A;  1T6S A;  3FZV A;  1XCB A;  3VOE A;  1JKQ C;  2JQ7 A;  4IHT A;  3FF5 A;  4B48 A;  2R7Z J;  2CV1 A;  2XIG A;  3RCO A;  4A3F J;  2LY1 A;  2CW0 F;  3MVP A;  1I3A A;  4RAG A;  2IS1 A;  2HPI A;  4EM2 A;  1HOM A;  4BHP A;  2R7X A;  1X2M A;  4QPQ A;  3LQR A;  5ICC A;  1FMW A;  2NRA C;  1APL C;  4X1E A;  3HZJ A;  1LVK A;  2O0Y A;  2R7F A;  4PFP A;  3S93 A;  2DI3 A;  1T2K A;  2RQP A;  1WH7 A;  2K3F A;  2MBF A;  2KDO A;  4IHX A;  3CME I;  4A3J J;  1P2F A;  2FRH A;  4XNF A;  3ZQ7 A;  3SYT A;  3B02 A;  4N4N B;  1B59 A;  5AIQ A;  3M9A A;  2QBY B;  2DO7 A;  5IYC J;  1FP2 A;  3JAM Z;  4L0Y B;  1WKM A;  3SXY A;  4HF1 A;  4UB6 C;  4GRI A;  4YIF A;  2X4H A;  1NK3 P;  3MZ8 A;  4ENK A;  4A3I J;  1MND A;  2X6W A;  3BTC A;  3CCV I;  1X4P A;  1OQY A;  2NNY A;  4P1W A;  3PFI A;  5BNG A;  3CUQ A;  4C3H J;  2H27 A;  3COA C;  3CUQ B;  2BXY A;  5F0F A;  1FNN A;  2HOT A;  1B4A A;  2D2W A;  2IA1 A;  3SDB A;  3BR2 A;  4MEY F;  3Q9V A;  1RUN A;  1XC5 A;  4LK1 F;  2XF7 A;  3M3Y J;  3LSG A;  2B63 J;  1HC8 A;  4KIB A;  2IJL A;  1GVD A;  5DUI A;  2GM4 A;  3LSI A;  3H92 A;  4BQQ A;  3U1K A;  1VFC A;  2M4K A;  4OWR B;  2CJJ A;  1EF4 A;  4MTD A;  3FBN B;  4BHB A;  4CDG A;  1RUO A;  1KYZ A;  2LRD A;  2MC4 A;  2L01 A;  3T0Y A;  1R1V A;  2OC6 A;  3F8N A;  1K4S A;  2IBD A;  4LD5 A;  3TMO A;  2DMU A;  1Z3Y A;  4FQG A;  1KU9 A;  2DA1 A;  1FP1 D;  3BRO A;  3L09 A;  5H20 A;  5ILV A;  2VC0 A;  1DU0 A;  5J8F A;  2WTE A;  2XAQ A;  2RDP A;  2L7K A;  2VL8 A;  1Y1V J;  3HB9 A;  2M4G A;  1ACI A;  2L9S A;  3T1B A;  3KZI C;  4M72 A;  2O8K A;  4NQW A;  5B5E C;  2UWM A;  3G1O A;  4Y52 J;  4ZYE A;  2X85 A;  1Y39 A;  4IX7 A;  2LK2 A;  3FXK A;  2I10 A;  1JJ8 C;  2V1U A;  4G7O F;  1MMS A;  4LIV A;  5LFA A;  5IP9 J;  1VQN I;  4PK4 A;  4XRS A;  4CCO A;  2KRC A;  2O9L A;  5GP9 A;  4EJT A;  1ZEL A;  2BXZ A;  2IGK A;  3OYC A;  1B9M A;  4UXN A;  3HHH A;  3R0J A;  4GO1 A;  2CH0 A;  1BW5 A;  3E7L A;  2RN7 A;  2EV0 A;  2ZNZ A;  4OIQ F;  1SD5 A;  2JRM A;  1G8X A;  3ZXS A;  1MDM A;  3QRF F;  2EFW A;  3CLO A;  3R4K A;  2K85 A;  3BG3 A;  2EZI A;  2W57 A;  5F08 A;  4PJL A;  3WG9 A;  1HKS A;  4IEJ A;  2I5U A;  2PI0 A;  3LQQ A;  1KZH A;  2ID3 A;  1JXS A;  3ONQ A;  3LA2 A;  1K7A A;  2ELH A;  2JVH A;  1BN5 A;  5JR3 A;  3DV8 A;  3QYE A;  3I0T A;  4OMZ A;  4G6T B;  2O61 A;  1ZQ3 P;  2LY9 A;  1YX3 A;  2IGM A;  2MD0 A;  2K9N A;  3IHU A;  5KK1 A;  4F92 B;  2DT6 A;  3RPQ A;  5J1Y A;  3K1N A;  3H3Z A;  4KJZ A;  1V5G A;  3R61 A;  1Y1W J;  4LOC A;  4IHV A;  3CLQ A;  4YG2 F;  4Y3O A;  2WAD A;  2FQ4 A;  3F0C A;  1S7O A;  2G0E A;  1OIS A;  1TBX A;  1QPM A;  1WFX A;  1R5H A;  5HNF A;  3RPU D;  5D5W B;  3FXU A;  3HIF A;  1FYK A;  2CQ7 A;  3CO7 C;  1VQK I;  5FFX A;  1KQ8 A;  3ZN1 A;  1V5E A;  1ZRF A;  4IRG A;  1EH7 A;  2KFD A;  4E7L A;  4PGG A;  1AHD P;  3HSE A;  2R93 J;  3VYR B;  3OYN A;  4N9I A;  2CV0 A;  1EH8 A;  5HOD A;  4LLG F;  1XSX A;  3HUG A;  3X2Q H;  2NVX J;  5HS7 A;  1FOY A;  1OFC X;  1IG7 A;  4UUS B;  3E5X A;  1STZ A;  2NAZ A;  3SFZ A;  1FMV A;  2IS2 A;  1VQL I;  3WTU C;  1R1T A;  2GQQ A;  1SVL A;  2ZFW A;  4E7Z A;  2JK3 A;  2HEO A;  4E4H A;  3OSG A;  3UR3 C;  1I3Q J;  4G7H F;  2XF5 A;  1SEU A;  1XCV A;  2W24 A;  1R71 A;  4AIH A;  2QQ9 A;  1ZGW A;  2R7V A;  1IRF A;  2Z3Y A;  2W25 A;  2MA3 A;  2E36 A;  1JHH A;  1K6O A;  1MBH A;  2PMZ N;  2HVR A;  1JHF A;  4RB1 A;  2GIV A;  3GF2 A;  2LF7 A;  1MNM C;  2HWV A;  2DJN A;  4ETS A;  3HOS A;  1TTY A;  2QF7 A;  2WAQ N;  1X2N A;  2J5P A;  3SFI A;  2IW5 A;  4CCN A;  3RYP A;  2PMH A;  4KUM A;  5E8G A;  1UJ8 A;  2CU7 A;  2UZK A;  3MZY A;  5IYD J;  4RB3 C;  4GDF A;  2XB5 A;  1H89 C;  3S8P A;  3HGG A;  5GPA A;  2QQ8 A;  5EJC A;  2DPD A;  2R3S A;  3JRC A;  4BXX J;  5B3S H;  4CA0 A;  3M4O J;  2BHZ A;  1IW7 F;  1TLH B;  1XGM A;  4HA8 A;  2KP6 A;  2XKO A;  1XSV A;  2X1C A;  3DTK A;  1S5L C;  1X3U A;  3TO7 A;  4HDU A;  4M3F A;  4EMS A;  2FJ1 A;  4X6A J;  1A36 A;  2B0L A;  3Q5F A;  3EUH A;  4DZJ A;  2PFB A;  4KN4 X;  3ASO H;  4M6X A;  3HOY J;  2ECB A;  4G6Q A;  3ULQ B;  4OIR F;  5E8I A;  2HOE A;  3DF8 A;  4IPA A;  2HZD A;  2FNA A;  2WWY A;  3FWE A;  2TCT A;  4RAF A;  1J09 A;  2Y48 A;  3K4N A;  3VOD A;  2CQX A;  3VWB A;  3I64 A;  3CDI A;  2RAE A;  1XG1 A;  2R7O A;  4A0X A;  1D1C A;  2CFO A;  3H3V K;  5GAG J;  2MLK A;  2VPR A;  1IV6 A;  2L2O A;  4JBA A;  1YRN A;  5L3G A;  1ETV A;  4A5N A;  2L9V A;  3H5R A;  3JRE A;  5F1R A;  2QVO A;  1VF9 A;  1ZH5 A;  3K1P A;  3F8F A;  4MLO A;  1ETQ A;  2IS6 A;  4OMY A;  2CSO A;  1B72 A;  2DQL A;  3F8B A;  4BJT A;  2OF7 A;  2KT0 A;  3CDL A;  3K10 A;  1B72 B;  3J80 K;  2XRO A;  2F5D A;  3V42 A;  3O2P E;  4L18 B;  2RRE A;  2G7U A;  3VSK A;  2HR3 A;  1BC7 C;  2DYS H;  3WG7 H;  3CF5 F;  1IRX A;  1R58 A;  2XAS A;  3ESW B;  4LIU A;  1FIA A;  3JCU C;  2FXA A;  3I56 I;  1ZHF A;  3PO2 J;  1YO5 C;  1MJB A;  3GFL A;  1IAW A;  3AL0 B;  1UG2 A;  2QQB A;  3OR1 C;  4HW0 A;  2Z2S B;  5IOZ A;  1E3H A;  4PUS A;  1YJW I;  2J5O A;  5FKO A;  5BQT A;  1ONV A;  2E60 A;  4Y7N J;  1BIA A;  1NG7 A;  2KZG A;  1E17 A;  2V79 A;  2DTZ A;  5HS9 A;  2VBW A;  3BTI A;  3FMS A;  4DJA A;  1RRJ A;  5LRR A;  3HHG A;  3EQL F;  4BNC A;  3GZN B;  3H9J A;  1BOB A;  1ZTR A;  4NB5 A;  2NNN A;  5F1J A;  9ANT A;  1IXS B;  4CCL A;  2K4B A;  5J1U A;  4HLX A;  4A3D J;  2DW4 A;  2E2I J;  3VPR A;  2KDZ A;  3F6O A;  4V2F A;  3TO9 A;  3IL2 A;  4A6E A;  3DEE A;  3KE2 A;  3AFH A;  2W82 A;  3P9C A;  5IT9 Z;  5B1A H;  2DYR H;  5JFR A;  5L3D A;  5LD2 C;  3MEX A;  2LFB A;  2R5Z A;  1USS A;  1KGS A;  4D1Q A;  2VOO A;  3GUD A;  4CH7 A;  3BR0 A;  4UB8 C;  4AU7 A;  4DYR A;  5KHD A;  3F8M A;  4XLF A;  1D0X A;  4MEX F;  3I55 I;  3J7A O;  4G12 A;  4C3J J;  3ABK H;  1W7P A;  4A2U A;  5FRM A;  3HKZ A;  5KNL A;  1E3P A;  2DJI A;  2Z1D A;  1WJE A;  3OV8 A;  4I01 A;  4B09 A;  2BHY A;  1OCR H;  3HOZ J;  3SJM A;  2E2H J;  3I53 A;  2MW8 A;  1CF7 B;  3E5Q A;  1L3L A;  1TL8 A;  2VOP A;  3ELK A;  1SAN A;  1REP C;  2EH3 A;  4H4K C;  3NAR A;  3WHC A;  1VI0 A;  3FXL A;  1YX5 A;  3CC2 I;  2AXT C;  4XLC A;  4AUX A;  3DBH B;  2ISY A;  1FWZ A;  1I5Z A;  2JVG A;  3AKZ A;  3B73 A;  3W2A A;  1U6G A;  3MMY B;  2H94 A;  1W0T A;  1D5V A;  2ZXJ A;  1ZRE A;  1OCT C;  3L7W A;  3CJR B;  2FE3 A;  2O8X A;  4KN7 X;  1T33 A;  3I4M J;  2QLZ A;  3JTG A;  2A68 F;  3HJE A;  3R60 A;  3WTS C;  3RDI A;  3WGH A;  4LG0 B;  1T0F C;  2DA6 A;  2M8E A;  3A1Y A;  1R4M B;  3HOX J;  1YTY A;  3M8E A;  2LF8 A;  4M6V A;  2VC1 A;  4M6Y A;  2X51 A;  3O3K A;  3CP2 A;  3TED A;  2ETH A;  1FYM A;  1Z21 A;  2NXN B;  2GZW A;  2D1V A;  5FRO A;  2EV6 A;  1FOX A;  2DFH A;  1HCR A;  4CYC A;  3CP8 A;  1NHA A;  1BIB A;  4BS9 A;  3F6V A;  3TDZ C;  1IN7 A;  3C18 A;  1TW2 A;  3DQV C;  3S2W A;  3LSR A;  2XAF A;  5EZG A;  4HQE A;  5HDN A;  4ZYD A;  3V7R A;  4NBQ A;  3WGI A;  2FA5 A;  4I0B A;  3CCQ I;  4KIF A;  2EIL H;  3JW4 A;  3CCJ I;  5E3M A;  1BJA A;  1LFU P;  1JKR C;  2JA7 J;  4HNT A;  2E34 A;  4KT5 C;  4II3 A;  3S1R J;  2M34 A;  3OYB A;  1N78 A;  1ODD A;  1F43 A;  2LYC A;  3DPU A;  5CYV A;  5FKK A;  4XKW A;  3SDG A;  3SZG A;  4XSZ F;  4AIJ A;  2ELJ A;  2A6T A;  5J6X A;  1MJ9 A;  2HGC A;  4J19 A;  3FKJ A;  3IWZ A;  3LAP A;  1O3Q A;  2X1D A;  4V19 K;  1ON1 A;  3PO3 J;  4XN0 A;  2KIF A;  1QVT A;  2E5N A;  5D4R A;  1RKT A;  4ZDP A;  3ZRG A;  5TRD A;  3KEQ A;  3FHN A;  1O3R A;  1A6I A;  3GTO J;  2HOA A;  2QGU A;  1X3W B;  1LPQ A;  1ERD A;  2DMT A;  4GFB A;  3V7C A;  3J7Z I;  2OTJ I;  1GXP A;  3FM3 A;  1FOK A;  3CJN A;  1OR7 A;  2PBI A;  5BMZ A;  1UEL B;  1GT0 C;  5FKL A;  1K4T A;  3BDD A;  2HQA A;  2UXX A;  3F9K A;  2QWW A;  3S15 J;  1X1A A;  3I58 A;  3ZQL A;  3H9Q A;  2AQE A;  5GAD J;  2BY0 A;  3CCM I;  4D0P A;  4WXC A;  4YFX F;  1UHM A;  1IXC A;  4D7N A;  3FIW A;  1R5G A;  4NHJ A;  5CQG A;  2WV1 A;  1WJ5 A;  2GIZ A;  1SMY F;  1RZ4 A;  3C3W A;  4HG2 A;  2YUS A;  1AKH A;  2EIJ H;  3FBI B;  3L1P A;  2QKL B;  2RV8 A;  2AXL A;  2Y0S A;  3PFY A;  5K5R A;  3WTY C;  1BOA A;  1AKH B;  3PQJ A;  2DQR A;  3C2B A;  5F0H A;  4U87 A;  4PFO A;  1K83 J;  2EFN A;  5GAH J;  4BEH A;  5TJJ A;  3S14 J;  2HXI A;  4N4O B;  1KU3 A;  4V2G A;  3OOU A;  4N0B A;  2UV1 A;  2E2J J;  1XN7 A;  1R7J A;  4I76 A;  4IQJ A;  2OZU A;  2LR8 A;  5EF6 A;  3V4G A;  3KYD B;  2KKO A;  4CCK A;  2CMP A;  2R7T A;  2QEX I;  1G3W A;  4XKC A;  2EZK A;  3VYU B;  1XMA A;  2KPM A;  3VYT B;  2LG4 A;  4S04 A;  1XDS A;  3TP0 A;  2EIN H;  3K4B A;  4JX6 A;  4CCM A;  2VAS A;  1IGN A;  3N05 A;  4AIK A;  5HS8 A;  2ZO4 A;  4ABZ A;  2D45 A;  2L7M P;  1JT6 A;  4U0V A;  3JRH A;  1HW5 A;  3VFZ A;  3EYY A;  2DBB A;  2XHK A;  5JLX A;  1W1W E;  2KRF A;  3ZQC A;  2IAI A;  3J81 Z;  1W4M A;  2EPF A;  1VQP I;  4U7D A;  5ERI A;  1FSE A;  5EG0 A;  3U21 A;  1SD7 A;  1FBU A;  2E1M B;  3BZC A;  1T98 A;  4BE1 A;  1MMN A;  2GBY A;  3IAM 2;  3RKX A;  1OCO H;  4EAT A;  2Y9Z A;  2A07 F;  4A3M J;  3LSP A;  5D8L B;  4NC8 A;  2K02 A;  1HST A;  4XRS G;  2JUC A;  4OAY A;  2XRL A;  3OYL A;  2E1C A;  3HRT A;  1Z91 A;  1OCP A;  2MH9 A;  4DYQ A;  2ZME A;  1GLN A;  1WGX A;  3VYS B;  3QYB A;  5E3N A;  2ZME B;  5JHU A;  2LRE A;  5D5U B;  3ABM H;  2TDX A;  1WJF A;  2QKM B;  5EDN A;  3OYK A;  2LBF A;  1U9O A;  4YFK F;  5K7H A;  3TBI A;  1YJ9 I;  2ESN A;  4IQ4 A;  1UAA A;  1FX7 A;  5F0C A;  2D1H A;  1OYY A;  4FX4 A;  2HVQ A;  2M87 A;  3FXO A;  2BE5 F;  3DWL E;  2VJ5 A;  5D6E A;  1TZL A;  1U5T C;  4PSX A;  5JLW A;  1EA3 A;  1B1B A;  4PZJ A;  2XAJ A;  3BQY A;  4OIP F;  4Z2Y A;  2VBX A;  2Q1Z B;  1ZLJ A;  1BM9 A;  1YYV A;  5CLS A;  4CXF A;  4RLQ A;  3CMM A;  1Y8R B;  1D8K A;  4XK4 A;  2CS3 A;  1X4O A;  2IXS A;  3CCY A;  3ZQQ A;  2R5Y A;  5L3B A;  4A3K J;  4KT6 A;  1IN4 A;  1B8I B;  2QSH X;  3SEZ A;  4M9Z A;  2R5Y B;  3K4J A;  2P5K A;  5E17 F;  3L00 A;  4ZDO A;  2CFX A;  3S32 A;  1S7E A;  2G7H A;  2M0M A;  4B3A A;  4AM3 A;  4I2O A;  3BZK A;  4GXO A;  4Y33 A;  3MKW B;  2FEZ A;  2QBY A;  3WOD F;  1DP7 P;  3F72 A;  4X0G A;  3EUK L;  4DIQ A;  1U2W A;  4WX9 A;  1HXD A;  2WB1 A;  2R4G A;  1XD7 A;  3NRV A;  3GME A;  3ERM A;  4KNY A;  2JUG A;  3GXO A;  4Y17 A;  2K27 A;  2ZFU A;  2FBK A;  2ELK A;  2CUZ A;  2OU2 A;  5TIS C;  1WZ2 A;  1RC9 A;  2JTV A;  4AWX B;  4DQ2 A;  3LA3 A;  2XAG A;  1S7A A;  5EGO A;  3BJO A;  1ZG5 A;  1QZY A;  3IH2 A;  5D5V B;  4IRI A;  3BG5 A;  2VB6 A;  5EGO B;  2PJR A;  4A3G J;  1LUJ B;  3Q0V A;  5L3F A;  5FB2 A;  4EGY A;  4XSX F;  5AIP A;  3JAM K;  2LNB A;  2PJR B;  3S2D J;  1QU3 A;  1Z0X A;  5FKM A;  2XKP A;  3PIP F;  2LDU A;  3EPZ A;  4KMF A;  4ZZD A;  4ASN A;  2EV5 A;  2DT7 B;  3H0D A;  4A6D A;  3JRG A;  4EGZ A;  3ZCO A;  3FXQ A;  4PJ0 C;  1ZN2 A;  2V1X A;  2P6T A;  1FTT A;  4M3B A;  3S3M A;  3KEY A;  1TWC J;  4HYE A;  2H09 A;  3GTL J;  3H35 A;  1YFH A;  5DEQ A;  2ZSH B;  3KLO A;  3KX2 A;  1Z3X A;  4LGW A;  1TWA J;  2O3F A;  2VKE A;  2PLY A;  1F36 A;  3MKL A;  1W36 C;  3GO5 A;  5AON A;  1OCZ H;  3S3O A;  3GTK J;  1HBX G;  3HPG A;  4EJU A;  4M9S A;  3RKQ A;  2GXA A;  1R5I D;  5FLV A;  1SVO A;  2KL4 A;  1QRY A;  1FY7 A;  1MH4 A;  4C30 A;  5K1Y A;  2F5E A;  4JX4 A;  4YFN F;  1O7F A;  3TDU C;  1X1P A;  2M0C A;  1IO2 A;  3P9I A;  1IN6 A;  4Y4R A;  3AG3 H;  4F3Q A;  1XSD A;  3LSM A;  2OQG A;  4BL0 B;  3KIO A;  1MSE C;  2MFZ A;  3S2H J;  2X6Y A;  4E6K G;  5DM6 F;  4HQM A;  4L9V A;  3FX3 A;  3OYI A;  1YIT I;  4PGH A;  2DK5 A;  4HBL A;  3HKZ N;  1W5T A;  1Y6I A;  2VJ4 A;  4NDL A;  3QPS A;  2VI6 A;  4RBO A;  1QHG A;  1MH3 A;  3ZMZ A;  1MMG A;  2ZJR F;  4DBQ A;  1GVJ A;  3PUF A;  5DYM A;  2RKH A;  3FMQ A;  1EKE A;  3CCU I;  2A5Y B;  5KAF C;  1J59 A;  5LBQ A;  1YW9 A;  2F6C A;  2M5W A;  1V54 H;  2OCC H;  2HKO A;  2QSF X;  4G8X A;  1IN5 A;  3BJ6 A;  1N75 A;  5FFZ A;  3CF2 A;  3CJQ B;  4AYB A;  3KET A;  1MMA A;  1R4N B;  3IAS 2;  1ETW A;  2DMQ A;  2YX7 A;  3M8F A;  1O7L A;  5GPC A;  2QSG X;  1VQ7 I;  4P9U A;  3E6C C;  4HF0 A;  1XGN A;  1D0Z A;  4E7K A;  3ISP A;  4ZDL A;  3O6B B;  2FOW A;  1MZB A;  4BE0 A;  2KLO A;  5GTH C;  1PP7 U;  4S0H B;  5J40 A;  2Y69 H;  2DFI A;  1G6N A;  1BR1 A;  2LLK A;  1T39 A;  5HVQ C;  5LEK A;  4WF2 A;  4KA4 A;  1TWG J;  2MSY A;  2YX4 A;  2K40 A;  1R22 A;  3OYA A;  1LDJ A;  2IGO A;  2VKV A;  4KDP A;  3FIS A;  1JGS A;  2EA2 A;  4I02 A;  2HQR A;  2QZ8 A;  4P5O A;  1S3J A;  4E7H A;  1WI3 A;  2ZJ2 A;  5E1X A;  2CG4 A;  5BPI A;  3HYI A;  3MFK A;  2IA0 A;  2VQH A;  4FT8 A;  2V9V A;  3GTG J;  2BVL A;  1MGT A;  3F3X A;  3VB2 A;  2ZJP F;  3DBR B;  4BE2 A;  4ZYH A;  4HRI A;  3BR3 A;  4RGS A;  3MD2 A;  3WGG A;  3JRA A;  4OIN F;  4BBS J;  1S6L A;  4ZTF A;  1Q1H A;  4LIT A;  2OTL I;  2JZY A;  3D1N I;  3QP5 A;  1A31 A;  2HTS A;  2VON A;  4IHY A;  4G9Y A;  3HC7 A;  4E70 A;  1R1U A;  4UUS A;  4BAY A;  5K5O A;  1QZZ A;  3D5L A;  5HDG A;  5EEH A;  2COM A;  2RNG A;  2LKX A;  5CJ9 A;  3G1L A;  1P4X A;  4HX4 A;  5ILU A;  5H6R A;  1SMT A;  1R23 A;  4CHU A;  3DPL C;  5L3E A;  4DBR A;  4B44 A;  5KVR A;  1JJ6 C;  2GXB A;  1LJ9 A;  4ZC3 A;  3OIQ A;  3VEP A;  4DW6 A;  2DT5 A;  1VQ5 I;  3O8G A;  3QPH A;  3OYJ A;  1D1B A;  1MSF C;  1JKP C;  3BJA A;  3VDX A;  1JUM A;  1P4W A;  2PG4 A;  2HPM A;  4L9T A;  4L0Z B;  4AC0 A;  2EFO A;  2KJC A;  4IF4 A;  5DV5 A;  4KYW A;  2X48 A;  1SD6 A;  4I7H A;  2H1K A;  4B47 A;  1ETK A;  3BG9 A;  2XUB A;  1XGS A;  5CVJ A;  1K78 B;  1I1S A;  1FOW A;  2EK5 A;  3FM5 A;  1Z6R A;  2Q2E B;  1RI7 A;  2Q8K A;  4LLN A;  2FD5 A;  5J4V A;  4FE4 A;  5ICE A;  3BCA A;  3K7A J;  1DDN A;  5LGN A;  1SFU A;  3C2G A;  4WCG A;  2HXO A;  1E3O C;  2LSO A;  2EQR A;  2ZXH A;  3FHZ A;  5E79 C;  3QOE A;  2FQ3 A;  1LB2 A;  1F5T A;  4JK1 X;  1QPI A;  4CYD A;  1HLV A;  2Y0S N;  3TOB A;  1S29 A;  3ZMT A;  5JI6 A;  1NG6 A;  2X6O A;  2M1B A;  2QCO A;  2B9S A;  1JTX A;  4ITV A;  1F4K A;  1MW7 A;  1K61 A;  1UHW A;  2QM3 A;  2MH2 A;  5HLH A;  3OS0 A;  1AOY A;  1R36 A;  4PDK A;  3I4P A;  2VUM J;  1T08 B;  2XRN A;  2GXG A;  3Q0U A;  4IZZ A;  1U8R A;  2W7N A;  2V9K A;  3DKY A;  2CYY A;  2YPR A;  5DDG A;  2L0K A;  3JSO A;  3O8H A;  5FKN A;  5IYB J;  2KZV A;  3SHF A;  4HAM A;  4CSW A;  4MQ9 F;  3ZN0 A;  3RJP A;  2DLL A;  5A2Q Z;  2BW3 A;  1E2X A;  5TGT A;  1OMI A;  1V4R A;  2BW3 B;  2O6G E;  2OD5 A;  3VSL A;  1LVA A;  2IEK A;  3SEQ A;  3N4M A;  3EUH C;  4M3G A;  1SAU A;  4BY1 J;  1ZGJ A;  4KMU X;  1SFK A;  2XDV A;  1GV5 A;  1T56 A;  2VIX A;  1RKW A;  3A4C A;  3RZO J;  3ZMV A;  3E5U A;  1JT0 A;  1FT9 A;  2F4I A;  2JN6 A;  1W0U A;  2PX9 A;  3RYR A;  5E3O A;  2KQR A;  2A5W A;  3H9G A;  4RGU A;  1RPW A;  3HRM A;  5FLX Z;  1J5Y A;  4ZJZ A;  5LLQ A;  2RVC A;  1W5S A;  4F55 A;  2GAU A;  2F5V A;  2A69 F;  4ENJ A;  4BJ5 C;  2DA4 A;  3FK6 A;  4UV8 A;  3S1N J;  1TQM A;  1U9N A;  4Y13 A;  1UZC A;  2K9Q A;  2L9N A;  3RKW A;  2HQ5 A;  1NH3 A;  2BEO A;  1IF1 A;  4U0Y A;  3AG1 H;  1IDY A;  1U0J A;  4B43 A;  3QU3 A;  4KFC A;  3CJT B;  5E18 F;  1YW7 A;  1SVM A;  2JRT A;  5FO5 A;  4M73 A;  4Q47 A;  3QPT A;  2A3S A;  2Y31 A;  3GWZ A;  4AVP A;  4ENM A;  5GTI C;  3I4N J;  1JGG A;  2WY7 Q;  2YU3 A;  2MAB A;  3J7Y J;  3GFM A;  2K9L A;  1Z05 A;  2OZ6 A;  2M8G X;  1O57 A;  4RLF A;  1W36 D;  2VQL A;  3IKT A;  3E6M A;  1CGP A;  1WJA A;  1RR8 C;  2L54 A;  4IO9 F;  1X1D A;  3F8C A;  4XL9 A;  4EVI A;  1LKX A;  3L2V A;  4UUV A;  2C6Y A;  2R7S A;  4OOI A;  4F91 B;  2ZKZ A;  1DGW Y;  3KP5 A;  1POG A;  4HV5 A;  2EIK H;  1CF7 A;  5M5X J;  2GWR A;  2V26 A;  2STT A;  2DTR A;  1FYL A;  4XLA A;  1KQ9 A;  2WB1 N;  4M71 A;  5J8C A;  3BTL A;  2K86 A;  3ZGK A;  5LRS A;  3HGY A;  4I0A A;  2P8T A;  4MO7 A;  2CQQ A; 
#chains in the Genus database with same CATH homology
 3E6D A;  5CVV A;  5IT9 K;  2L3D A;  3I59 B;  4R1H A;  2H6C A;  1F9N A;  1T0F A;  4F7Z A;  4EJO A;  5DCM A;  4Y15 A;  4LG0 A;  1HKT A;  5DCM B;  1LDK B;  1YIO A;  2FML A;  3HTS B;  2YR2 A;  3R6S A;  2QUF A;  2ISZ A;  1PP8 F;  1B6A A;  2KIU A;  1YG2 A;  3QAH A;  2EFP A;  4BQA A;  3GX4 X;  3CTA A;  3QOP A;  3I71 A;  5L3C A;  1B9N A;  3RIR A;  3HOT A;  3I5U A;  4HOB A;  3QP6 A;  2PEX A;  3GZ5 A;  3KEO A;  2EA4 A;  1LEA A;  2HYG D;  3NQO A;  4HLY A;  1QGP A;  3MAJ A;  1TNT A;  4LLL A;  3WE3 A;  1H9G A;  4Q4Z F;  4CGZ A;  5JVT A;  3GYH X;  1LQ1 A;  1ZG1 A;  2M45 A;  2DU9 A;  3HSR A;  4RB0 A;  2A61 A;  2BYV E;  5D8K B;  3GZ6 A;  1H0M A;  1FLI A;  3WU0 A;  1TW3 A;  2CQK A;  1KQ0 A;  3IRR A;  1FC3 A;  5LGU A;  1P92 A;  5E20 A;  3BOQ A;  3DXJ F;  5IT3 A;  2FMY A;  4P96 A;  4QWQ A;  2MD5 A;  2BV6 A;  3T8R A;  1O3S A;  1Z1D A;  3WTV C;  3RPU A;  2G9W A;  1K79 A;  2NS0 A;  2VBY A;  3DP7 A;  3V8L A;  3G3Z A;  5BOX A;  5LGT A;  2VXZ A;  5H6Q A;  4WK8 F;  2OAZ A;  1SAX A;  3TO6 A;  3ABT A;  1P6R A;  1SD4 A;  3EYI A;  4TV7 A;  3Q9S A;  2DK8 A;  1TQP A;  1WI9 A;  4G7Z F;  5ICF A;  2FNP A;  3K2Z A;  4GYG A;  5FGM A;  1QQI A;  3IWF A;  4R79 A;  1XDU A;  3DKW A;  1BI3 A;  4EM1 A;  2V6C A;  4LMY A;  3RI4 A;  1DPR A;  1KU2 A;  5F6F A;  1IUY A;  1WQ2 A;  4MQV A;  2E1N A;  4A0Z A;  1MKM A;  2GA1 A;  2X0L A;  3LAJ A;  2EWN A;  1TQI A;  4HX7 A;  1ZAR A;  2ACJ A;  3J81 K;  1BI0 A;  1IN8 A;  1U5T A;  4DNC A;  2Y75 A;  4BYY A;  1U5T B;  5DD8 A;  3ZMD A;  1J0R A;  4CZZ A;  1UFM A;  1VTN C;  1WSU A;  4HV6 A;  3BY6 A;  4XRF A;  3QU6 A;  1U78 A;  3KFW X;  5CVR A;  4S05 A;  4HF2 A;  3JTH A;  1O3T A;  2Z9O A;  1H9T A;  3REO A;  2V1D A;  2VOD A;  3SZT A;  1YLF A;  2Z33 A;  2Y0M A;  2PN6 A;  3U1D A;  1SFE A;  3C7J A;  4UV9 A;  1OPC A;  3MQ0 A;  2QYO A;  3BPV A;  4A12 A;  3EDP A;  2EB7 A;  3ZP5 A;  2XVC A;  4MTE A;  2XAH A;  3U9G A;  3BP8 A;  3G73 A;  4QLC U;  3KP4 A;  2JT1 A;  1ZAO A;  4FHT A;  2P5V A;  4A0Y A;  2F2E A;  2DPU A;  2R7D A;  1QBJ A;  1MJA A;  2QEN A;  1W7P D;  3DPT A;  1QO0 D;  3ZPL A;  3CUQ C;  3KCC A;  2CWE A;  2IP2 A;  2F5F A;  2MLG A;  4P9F A;  5LHH A;  2A6E F;  4M74 A;  3TOA A;  4ZZL A;  1BBY A;  1OKR A;  4LJZ F;  1ZLK A;  5F64 A;  5HLG A;  3NEU A;  2PQ8 A;  3DEU A;  1FSH A;  5EEG A;  3K69 A;  2HKX A;  2HZT A;  5FD6 A;  2OA4 A;  4MHG A;  3TGN A;  4U88 A;  2ZNY A;  3R0A A;  5D5X B;  3L2C A;  6PAX A;  1Z9C A;  1HW1 A;  1V3F A;  2ZBK A;  2K4J A;  2FOK A;  4LFU A;  3GVA A;  3WTT C;  2L02 A;  1UCR A;  3KZZ A;  2CO5 A;  3WU1 B;  2FU4 A;  2E7W A;  3GFJ A;  4GCV A;  4CIC A;  4WWC A;  4WXD A;  3LWF A;  2IRF G;  1QNT A;  5ILS A;  2UXN A;  3HSF A;  1UB9 A;  4CO8 A;  4GGG A;  1FBS A;  1MDM B;  1WRJ A;  2STW A;  1SFX A;  2NYX A;  2KJB A;  3F23 A;  2HQN A;  4ESJ A;  3U2R A;  3P9K A;  4EQQ A;  2IVM A;  3GW2 A;  1BI1 A;  4L9N A;  2HS5 A;  5ICG A;  3KP7 A;  3OOP A;  4LK0 F;  2HTJ A;  4RAZ A;  3GFI A;  4RS8 A;  1F1Z A;  1PDN C;  4BH9 A;  5D4S A;  1XMK A;  2EFQ A;  2VT2 A;  1L0O C;  1DPU A;  4L9J A;  1S8N A;  3N97 A;  2P7V B;  4KIC A;  5LHG A;  1WWX A;  2FF4 A;  1G3Y A;  1AWC A;  3ERE D;  1FPQ A;  2FSW A;  1K78 A;  2YSR A;  3L9F A;  1G3T A;  5LHI A;  2Q2E A;  3K9T A;  2JSC A;  2P7C B;  3HTU A;  4O6J A;  3ECO A;  3KP2 A;  1G3S A;  4OU0 A;  1J75 A;  3W6K B;  4IJA A;  2QQA A;  2EJR A;  5DCF A;  3EET A;  1OYI A;  4HZF A;  3WTZ A;  1HW2 A;  3E97 A;  3BWG A;  3SZP A;  4ZYG A;  4AD9 A;  2IA2 A;  2Z5U A;  4EJV A;  4KIG A;  1ZYR F;  3IKV A;  2WC2 A;  4XBF A;  2WV0 A;  2RNJ A;  1LEB A;  3CDH A;  2W85 A;  3V8J A;  4ON0 A;  4O3M A;  1ULY A;  5ED4 A;  2E7X A;  3J80 Z;  2ESH A;  4WXH A;  3TKY A;  3P7N A;  3DFG A;  4UVC A;  2VE9 A;  1YS6 A;  4M9X A;  4B8X A;  1YW8 A;  3LA7 A;  1KU7 A;  2Q0O A;  4IRH A;  3MCZ A;  5CVI A;  4R8H A;  3CO6 C;  4ZH4 F;  1LNW A;  4L5I A;  2MC3 A;  3MWM A;  2ADU A;  1IRG A;  5A2Q K;  2K7L A;  4RB2 C;  1PUE E;  1C0W A;  2RC4 A;  4ENN A;  1BC8 C;  3GLX A;  1R00 A;  4YII A;  2RGV A;  3HRS A;  4U7B A;  4O5V A;  1GXQ A;  3K1M A;  3ML6 A;  1D3Y A;  1TNS A;  3H3U A;  5FLX K;  2H6B A;  3KP6 A;  4GYI A;  3CUO A;  3PQK A;  3IRQ A;  4ESB A;  1KYW A;  2VE8 A;  4A5M A;  1T38 A;  2KIM A;  4JQF A;  4P55 A;  3KP3 A;  1EH6 A;  1EV7 A;  4HX8 A;  2F5C A;  3LST A;  3FXR A;  2O03 A;  2PMU A;  2JPC A;  3M7G A;  3I59 A;  3LFK A;  1YQA A;  1W7P B;  5CVU A;  3V7S A;  5DUK A;  1FBQ A;  4UNO A;  5HDK A;  4UVB A;  2HFH A;  4G6D A;  1HKQ A;  2FBH A;  3ECH A;  3F21 A;  1ZRD A;  1Y0U A;  1J2X A;  4MGR A;  2VT3 A;  3IC7 A;  1P4A A;  2P5L C;  2DAO A;  3D0S A;  1BI2 A;  1I1G A;  1A04 A;  3GEZ A;  1DUX C;  1XGO A;  2BBY A;  4PCQ A;  4OIO F;  3ABU A;  3AAF A;  4RAY A;  4XLN F;  1YS7 A;  3K0L A;  2LKP A;  2P6S A;  2M30 A;  1XB4 A;  1FZP B;  4MNU A;  1MD0 A;  3KLN A;  4EV0 A;  5K5Q A;  2HDC A;  3I54 A;  4U0W A;  1JE8 A;  3RTR A;  4I98 B;  5BS6 A;  4N9H A;  4FX0 A;  1J7K A;  4Q5S F;  2Z99 A;  1RIO H;  2L4M A;  4HDV A;  2GA2 A;  1I27 A;  4IXA A;  2A6H F;  1ON2 A;  2VBZ A;  3HRU A;  3E6B A;  3RKY A;  3ZMU A;  1Z7U A;  3ROU A;  2W84 A;  3WE2 A;  2AS5 F;  4UVA A;  1KA8 A;  3MZH A;  3T5X A;  2JPB A;  3KZY A;  2FBI A;  3E3V A;  4UHT A;  3FMR A;  4RGR A;  3M1E A;  1GHC A;  5FD5 A;  2XGX A;  4ESF A;  3T8T A;  5HOO A;  2OQR A;  4XLP F;  4BXU A;  2IT0 A;  3TQN A;  3WTW C;  5E1Z B;  1HQC A;  3WTX C;  3W6J B;  5E1W A;  4EJW A;  4LB5 A;  4I09 A;  1G4D A;  1LDD A;  2IPQ X;  3SQN A;  1ZRC A;  4H0E A;  2P4W A;  2PJP A;  4IHS A;  5D6F A;  4K2E A;  3BPX A;  3C1D A;  3F22 A;  1RNL A;  4LB6 B;  2BGC A;  1U3E M;  4G94 A;  1D8J A;  4EM0 B;  2OBP A;  1IXR C;  1ZG3 A;  1I6X A;  3BZ6 A;  1UST A;  2L4A A;  1IZ1 A;  5BPD A;  1J9I A;  2HYF A;  1Z6T A;  4IVN A;  1OYW A;  2XV4 S;  4Q48 A;  2CGP A;  3JSP A;  5DD4 A;  4RGX A;  3ZMS A;  4BHC A;  2ZCW A;  5HLI A;  3V8K A;  1HSJ A;  1ZGA A;  2VN2 A;  4L5J A;  5LEJ A;  1T6S A;  3FZV A;  1XCB A;  3VOE A;  4IHT A;  3FF5 A;  2XIG A;  2CW0 F;  4EM2 A;  4BHP A;  3LQR A;  5ICC A;  2NRA C;  2O0Y A;  2R7F A;  2DI3 A;  1T2K A;  2RQP A;  2MBF A;  1P2F A;  2FRH A;  3ZQ7 A;  3B02 A;  1B59 A;  5AIQ A;  3M9A A;  2QBY B;  2DO7 A;  4L0Y B;  1FP2 A;  3JAM Z;  1WKM A;  3SXY A;  4HF1 A;  4YIF A;  2X4H A;  4ENK A;  2NNY A;  3PFI A;  3CUQ A;  2H27 A;  3COA C;  3CUQ B;  1FNN A;  1B4A A;  2D2W A;  2IA1 A;  4MEY F;  3Q9V A;  1RUN A;  4LK1 F;  4KIB A;  2IJL A;  5DUI A;  3H92 A;  4MTD A;  4BHB A;  4CDG A;  1RUO A;  1KYZ A;  2L01 A;  3T0Y A;  1R1V A;  3F8N A;  4LD5 A;  1KU9 A;  1FP1 D;  3BRO A;  3L09 A;  5H20 A;  5ILV A;  2VC0 A;  5J8F A;  2WTE A;  2XAQ A;  2RDP A;  3T1B A;  4M72 A;  4NQW A;  2UWM A;  4ZYE A;  2V1U A;  4G7O F;  4EJT A;  1B9M A;  4UXN A;  3HHH A;  3R0J A;  4GO1 A;  2RN7 A;  2EV0 A;  2ZNZ A;  4OIQ F;  1SD5 A;  1MDM A;  3QRF F;  2EFW A;  3CLO A;  3R4K A;  2W57 A;  3WG9 A;  1HKS A;  2PI0 A;  3LQQ A;  1JXS A;  3LA2 A;  1K7A A;  2ELH A;  1BN5 A;  5JR3 A;  3DV8 A;  3I0T A;  4OMZ A;  2O61 A;  3IHU A;  5KK1 A;  3RPQ A;  3K1N A;  3H3Z A;  3R61 A;  4YG2 F;  1S7O A;  1TBX A;  1QPM A;  1R5H A;  5D5W B;  3FXU A;  3HIF A;  1FYK A;  3CO7 C;  5FFX A;  1KQ8 A;  3ZN1 A;  1ZRF A;  4IRG A;  1EH7 A;  4PGG A;  3HSE A;  4N9I A;  1EH8 A;  4LLG F;  1XSX A;  3HUG A;  5HS7 A;  3E5X A;  1STZ A;  2NAZ A;  3SFZ A;  3WTU C;  1R1T A;  2GQQ A;  2ZFW A;  2HEO A;  4G7H F;  1XCV A;  2W24 A;  4AIH A;  2QQ9 A;  1IRF A;  2Z3Y A;  2W25 A;  2MA3 A;  1JHH A;  1K6O A;  1JHF A;  4RB1 A;  2GIV A;  3GF2 A;  2LF7 A;  2HWV A;  4ETS A;  3HOS A;  1TTY A;  2J5P A;  2IW5 A;  3RYP A;  2PMH A;  4KUM A;  5E8G A;  2UZK A;  3MZY A;  4RB3 C;  2DPD A;  2R3S A;  1IW7 F;  1TLH B;  1XGM A;  4HA8 A;  2XKO A;  1XSV A;  4HDU A;  1X3U A;  3TO7 A;  4EMS A;  2B0L A;  3Q5F A;  3EUH A;  2PFB A;  4KN4 X;  4M6X A;  4G6Q A;  3ULQ B;  5E8I A;  4OIR F;  2HOE A;  3DF8 A;  4IPA A;  2FNA A;  2WWY A;  3FWE A;  2Y48 A;  3VOD A;  3I64 A;  4A0X A;  2MLK A;  4JBA A;  5L3G A;  4A5N A;  5F1R A;  2QVO A;  1ZH5 A;  3K1P A;  3F8F A;  4OMY A;  2CSO A;  2DQL A;  3F8B A;  3J80 K;  2XRO A;  2F5D A;  3O2P E;  4L18 B;  2G7U A;  2HR3 A;  1BC7 C;  1R58 A;  2XAS A;  2FXA A;  1ZHF A;  1YO5 C;  1MJB A;  3GFL A;  1IAW A;  2QQB A;  4HW0 A;  2J5O A;  5BQT A;  1ONV A;  1BIA A;  1E17 A;  2V79 A;  5HS9 A;  2VBW A;  3FMS A;  5LRR A;  3HHG A;  3EQL F;  4BNC A;  4NB5 A;  2NNN A;  1IXS B;  2K4B A;  4HLX A;  2DW4 A;  3F6O A;  3TO9 A;  3IL2 A;  4A6E A;  3KE2 A;  3P9C A;  5IT9 Z;  5JFR A;  5L3D A;  3MEX A;  1USS A;  1KGS A;  2VOO A;  3GUD A;  3F8M A;  4MEX F;  3J7A O;  1W7P A;  4A2U A;  3OV8 A;  4I01 A;  4B09 A;  3I53 A;  1CF7 B;  3E5Q A;  1L3L A;  2VOP A;  3ELK A;  1REP C;  2ISY A;  1FWZ A;  1I5Z A;  3B73 A;  1U6G A;  2H94 A;  1D5V A;  2ZXJ A;  1ZRE A;  3L7W A;  2FE3 A;  2O8X A;  4KN7 X;  2QLZ A;  3JTG A;  2A68 F;  3R60 A;  3WTS C;  3RDI A;  3WGH A;  4LG0 B;  2M8E A;  1YTY A;  3M8E A;  2LF8 A;  2VC1 A;  4M6Y A;  3O3K A;  2ETH A;  1FYM A;  2GZW A;  2D1V A;  2EV6 A;  1NHA A;  1BIB A;  3F6V A;  3TDZ C;  1IN7 A;  3C18 A;  1TW2 A;  3DQV C;  3S2W A;  2XAF A;  4HQE A;  5HDN A;  4ZYD A;  3V7R A;  3WGI A;  2FA5 A;  4I0B A;  4KIF A;  3JW4 A;  1BJA A;  4KT5 C;  1ODD A;  5CYV A;  4XSZ F;  4AIJ A;  5J6X A;  1MJ9 A;  2HGC A;  1O3Q A;  3IWZ A;  3LAP A;  1ON1 A;  2KIF A;  5D4R A;  5TRD A;  3KEQ A;  1O3R A;  3V7C A;  1GXP A;  3FM3 A;  1FOK A;  3CJN A;  1OR7 A;  2PBI A;  5BMZ A;  3BDD A;  2UXX A;  2QWW A;  3I58 A;  4D0P A;  4WXC A;  4YFX F;  1UHM A;  1IXC A;  1R5G A;  4NHJ A;  1SMY F;  1RZ4 A;  3C3W A;  2RV8 A;  2AXL A;  5K5R A;  3WTY C;  1BOA A;  3PQJ A;  2DQR A;  2EFN A;  5TJJ A;  1KU3 A;  4N0B A;  1XN7 A;  1R7J A;  2OZU A;  3V4G A;  2KKO A;  1G3W A;  1XMA A;  4S04 A;  1XDS A;  4AIK A;  5HS8 A;  2ZO4 A;  2D45 A;  4U0V A;  1HW5 A;  3VFZ A;  3EYY A;  2DBB A;  2XHK A;  2KRF A;  3J81 Z;  1W4M A;  4U7D A;  5ERI A;  1FSE A;  1SD7 A;  1FBU A;  1T98 A;  3RKX A;  2A07 F;  5D8L B;  2K02 A;  1HST A;  2E1C A;  3HRT A;  1Z91 A;  2MH9 A;  2ZME A;  2ZME B;  5JHU A;  5D5U B;  2TDX A;  4YFK F;  2ESN A;  1FX7 A;  2D1H A;  1OYY A;  4FX4 A;  2M87 A;  2BE5 F;  5D6E A;  1U5T C;  1B1B A;  4PZJ A;  2XAJ A;  4OIP F;  4Z2Y A;  2VBX A;  1ZLJ A;  1BM9 A;  1YYV A;  5CLS A;  4CXF A;  1D8K A;  5L3B A;  1IN4 A;  4M9Z A;  2P5K A;  5E17 F;  3L00 A;  2CFX A;  2G7H A;  4I2O A;  4GXO A;  2FEZ A;  2QBY A;  3WOD F;  1DP7 P;  3F72 A;  1U2W A;  4WX9 A;  1HXD A;  1XD7 A;  3NRV A;  4KNY A;  3GXO A;  4Y17 A;  2K27 A;  2FBK A;  2OU2 A;  2JTV A;  4AWX B;  4DQ2 A;  3LA3 A;  2XAG A;  1S7A A;  3BJO A;  1ZG5 A;  1QZY A;  4IRI A;  5D5V B;  5L3F A;  5FB2 A;  4EGY A;  4XSX F;  5AIP A;  3JAM K;  2LNB A;  2XKP A;  2LDU A;  4KMF A;  4ZZD A;  4ASN A;  2EV5 A;  4A6D A;  4EGZ A;  3FXQ A;  1ZN2 A;  2V1X A;  2P6T A;  4HYE A;  2H09 A;  1YFH A;  5DEQ A;  3KLO A;  4LGW A;  2O3F A;  2PLY A;  3GO5 A;  5AON A;  1HBX G;  4EJU A;  4M9S A;  1FY7 A;  5K1Y A;  2F5E A;  4YFN F;  1O7F A;  3TDU C;  3P9I A;  1IN6 A;  1XSD A;  2OQG A;  4HQM A;  4L9V A;  3FX3 A;  4PGH A;  2DK5 A;  4HBL A;  1W5T A;  3ZMZ A;  1GVJ A;  5DYM A;  2RKH A;  3FMQ A;  2A5Y B;  1J59 A;  5LBQ A;  1YW9 A;  2M5W A;  2HKO A;  4G8X A;  1IN5 A;  3BJ6 A;  5FFZ A;  3KET A;  2YX7 A;  3M8F A;  1O7L A;  4P9U A;  3E6C C;  4HF0 A;  1XGN A;  3ISP A;  3O6B B;  1MZB A;  1PP7 U;  2DFI A;  1G6N A;  1T39 A;  5HVQ C;  5LEK A;  4WF2 A;  4KA4 A;  2YX4 A;  1R22 A;  1LDJ A;  4KDP A;  1JGS A;  2EA2 A;  4I02 A;  2HQR A;  2QZ8 A;  4P5O A;  1S3J A;  2ZJ2 A;  5E1X A;  2CG4 A;  5BPI A;  3HYI A;  3MFK A;  2IA0 A;  4FT8 A;  2V9V A;  1MGT A;  3F3X A;  3VB2 A;  4ZYH A;  4RGS A;  3WGG A;  4OIN F;  1S6L A;  1Q1H A;  2JZY A;  3QP5 A;  2VON A;  2HTS A;  4G9Y A;  4E70 A;  1R1U A;  4BAY A;  5K5O A;  1QZZ A;  3D5L A;  5HDG A;  5EEH A;  2COM A;  5CJ9 A;  1P4X A;  4HX4 A;  5ILU A;  5H6R A;  1SMT A;  1R23 A;  4CHU A;  3DPL C;  5L3E A;  5KVR A;  2GXB A;  1LJ9 A;  3VEP A;  2DT5 A;  3QPH A;  3BJA A;  1P4W A;  2PG4 A;  4L9T A;  4L0Z B;  2EFO A;  2KJC A;  4IF4 A;  5DV5 A;  4KYW A;  1SD6 A;  4I7H A;  2XUB A;  5CVJ A;  1XGS A;  1K78 B;  1I1S A;  2EK5 A;  3FM5 A;  1Z6R A;  1RI7 A;  2Q8K A;  4LLN A;  5ICE A;  1DDN A;  5LGN A;  1SFU A;  4WCG A;  2LSO A;  3FHZ A;  2FQ3 A;  1LB2 A;  1F5T A;  4JK1 X;  4CYD A;  3TOB A;  1S29 A;  3ZMT A;  5JI6 A;  2M1B A;  1F4K A;  1UHW A;  2QM3 A;  2MH2 A;  5HLH A;  1AOY A;  1R36 A;  4PDK A;  3I4P A;  2GXG A;  2XRN A;  1U8R A;  2CYY A;  2YPR A;  5DDG A;  3JSO A;  3SHF A;  4HAM A;  4MQ9 F;  3ZN0 A;  3RJP A;  2DLL A;  5A2Q Z;  1E2X A;  1OMI A;  1V4R A;  2O6G E;  2OD5 A;  1LVA A;  3N4M A;  1ZGJ A;  4KMU X;  3ZMV A;  3E5U A;  1FT9 A;  3RYR A;  4RGU A;  3HRM A;  5FLX Z;  1J5Y A;  5LLQ A;  2RVC A;  1W5S A;  2GAU A;  2A69 F;  4ENJ A;  4UV8 A;  1TQM A;  4Y13 A;  3RKW A;  2BEO A;  1IF1 A;  4U0Y A;  3QU3 A;  4KFC A;  5E18 F;  1YW7 A;  2JRT A;  5FO5 A;  4M73 A;  4Q47 A;  3QPT A;  2A3S A;  3GWZ A;  4AVP A;  4ENM A;  2YU3 A;  3GFM A;  1Z05 A;  2OZ6 A;  1O57 A;  3IKT A;  3E6M A;  1CGP A;  2L54 A;  3F8C A;  4EVI A;  4UUV A;  2C6Y A;  4OOI A;  2ZKZ A;  3KP5 A;  4HV5 A;  1CF7 A;  2STT A;  2GWR A;  2DTR A;  1FYL A;  1KQ9 A;  4M71 A;  5J8C A;  2K86 A;  5LRS A;  4I0A A;  2P8T A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...