3QRFF

Structure of a domain-swapped foxp3 dimer
Total Genus 16
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
16
sequence length
82
structure length
82
Chain Sequence
MRPPFTYATLIRWAILEAPEKQRTLNEIYHWFTRMFAFFRNHPATWKNAIRHNLSLHKCFVRVESEKGAVWTVDELEFRKKR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Dna binding protein/dna
molecule keywords Nuclear factor of activated T-cells, cytoplasmic 2
publication title Structure of a Domain-Swapped FOXP3 Dimer on DNA and Its Function in Regulatory T Cells.
pubmed doi rcsb
source organism Homo sapiens
total genus 16
structure length 82
sequence length 82
chains with identical sequence G, H, I
ec nomenclature
pdb deposition date 2011-02-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
F PF00250 Forkhead Forkhead domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 3qrfF00
4ZYHA 3FMRA 5DYMA 1U3EM 2BYVE 5IT9Z 4KIFA 1LQ1A 3BPXA 5IT9K 3IRQA 2JTVA 1EH6A 4WCGA 1S29A 4P5OA 2J5PA 4CYDA 4A6EA 5LRSA 1D8KA 3KP5A 3ABTA 3RJPA 3BJAA 1KYZA 1USSA 4ENMA 4IHSA 2B0LA 4CZZA 1MJAA 5BQTA 1FNNA 1H0MA 4Y13A 1R1TA 1W7PB 4UVAA 5LGTA 4MHGA 1QZYA 1B9NA 4FX4A 2KJBA 3ABUA 2L4AA 4QLCU 3FXRA 3U9GA 5HLHA 1YO5C 3GEZA 2O0YA 4LGWA 5FLXZ 3O6BB 5DUKA 1DP7P 5HS8A 5LHGA 1LEBA 5FLXK 2FSWA 1B9MA 4D0PA 1R1UA 2IRFG 1K78A 2OZ6A 4YIIA 1BI0A 4L9JA 1T2KA 2XUBA 4LLNA 3CUQA 1YIOA 4JQFA 1EH7A 4HQMA 3KP4A 1MDMB 2XAHA 2CO5A 4Z2YA 2M1BA 1QGPA 3DFGA 5BOXA 3K1MA 4EM0B 2HQNA 4ENJA 1ZG1A 4IF4A 2Z33A 4A5NA 2F5CA 3F21A 3M8FA 4WXHA 1R1VA 4EJOA 3ECOA 3P9KA 5JVTA 1CGPA 4ETSA 4L0ZB 2F5DA 3ZN1A 3KEOA 3FXQA 4KMFA 4G7ZF 2V9VA 3LAPA 2HZTA 2ETHA 3HOSA 1U5TC 4ZYDA 2FBIA 2K27A 1J75A 4M74A 1U78A 4G9YA 3R60A 1ZRFA 3BROA 4BAYA 3I0TA 5HLIA 3ECHA 2WC2A 2H6CA 2JPCA 3TKYA 3RPUA 2HKXA 1KQ9A 1QO0D 3OOPA 2K02A 1K6OA 4M9SA 1IN7A 2FBKA 1ZGAA 4MTEA 1P4XA 3MZYA 3Q5FA 3QU3A 1ZGJA 4IHTA 3E6CC 2GIVA 5J6XA 2P8TA 2ACJA 2P5LC 1KU7A 1O3TA 2MLKA 4L9NA 3ZQ7A 1SD4A 4U7DA 2DAOA 2GA2A 2QYOA 1ONVA 3JTGA 1XSVA 2KIMA 4RB0A 3DPTA 4FT8A 1ZRDA 1JGSA 1FOKA 1STZA 1OR7A 1G4DA 1HW2A 2ZNZA 3IWZA 2VOOA 2K86A 4M72A 2IJLA 4YG2F 3EDPA 1IUYA 2K4BA 1P6RA 2P7VB 3JTHA 4A5MA 4RB1A 1TW2A 2ZNYA 2D1VA 3C7JA 1P92A 3CUQB 1FLIA 2WTEA 3GWZA 5LGUA 4OIOF 5DV5A 2FOKA 4I2OA 4L0YB 1TBXA 5DCMA 3P9IA 1MJBA 3KLNA 2OA4A 4P55A 2ESNA 2GA1A 1IAWA 1JHHA 3FZVA 3C3WA 1IW7F 1TQIA 1XGMA 5FFZA 5LBQA 2TDXA 2KRFA 4EJVA 3MQ0A 3I64A 2L54A 1HQCA 1O3SA 2GXGA 2IPQX 3JSOA 4HF1A 3ZP5A 4PGHA 5HS9A 4LB5A 5DUIA 2Z9OA 1BC7C 4UUVA 1DPRA 3BY6A 5D8LB 3QP6A 1XDSA 2GZWA 2IVMA 2JSCA 4RGUA 4OINF 4HV5A 2O3FA 2NRAC 4CO8A 5HDNA 3GX4X 2MA3A 2EV0A 1YS6A 2W57A 2DK8A 3NEUA 2O03A 2FF4A 1UHMA 1QZZA 3CJNA 3U2RA 3V7SA 1FYMA 2FNAA 2MD5A 2FXAA 1RZ4A 2ZFWA 5F1RA 2YX7A 2DFIA 4AIKA 3F8MA 3R0AA 2HDCA 4CGZA 3DPLC 1O7LA 5HS7A 2ZJ2A 2OU2A 1G3YA 2FRHA 4KIBA 1PDNC 2NYXA 5AONA 1XCVA 3WODF 3IKTA 4XRFA 1FC3A 4MNUA 5HDGA 2V79A 2BEOA 3K2ZA 4GYGA 2R7FA 1ZLJA 1KYWA 4ESBA 4A0XA 1YG2A 3R0JA 2GXBA 2V1XA 2YU3A 3GFJA 1BI3A 1O3RA 4TV7A 3F23A 3WU1B 1TQMA 1QQIA 4XSZF 1W5TA 5D6FA 2M5WA 3FMQA 1VTNC 3C1DA 3M8EA 4MEXF 4LK0F 3RKYA 2WWYA 1FX7A 4I09A 3DQVC 1B1BA 3REOA 3FM5A 1HW5A 4EV0A 2W85A 2LF7A 5FD5A 1U8RA 1ZG5A 1OMIA 1HBXG 1UFMA 1JXSA 3RDIA 2VBWA 1YW7A 3G3ZA 4R8HA 2STWA 3N97A 3KETA 3IL2A 1I5ZA 4KMUX 4L5JA 5TJJA 1BIBA 4HOBA 1SFEA 4B09A 2KIUA 1D3YA 2QENA 4RGRA 1ON2A 2LNBA 2L3DA 2HFHA 2DTRA 5KK1A 2F5FA 2XRNA 3E5QA 1T38A 2COMA 1R58A 3H3ZA 2HTSA 5CYVA 2Y0MA 1FYLA 4MGRA 4GYIA 3L2CA 3VEPA 3CO6C 1RUOA 4EM2A 5CJ9A 3QPTA 3F8NA 2QZ8A 1HXDA 1OKRA 2HOEA 1C0WA 1ZH5A 4EJTA 2X4HA 3ZPLA 1IN4A 1QPMA 2VXZA 1SMTA 4KA4A 4Q47A 1MKMA 1UB9A 3KP2A 1W7PD 3SQNA 3CDHA 4M71A 2XAJA 5LRRA 1YFHA 2EFNA 1B4AA 4M73A 3HUGA 3RPQA 1LVAA 1KGSA 1G3TA 3WU0A 3G73A 1UCRA 3E3VA 2VONA 3GF2A 3GFIA 1FBQA 4GXOA 4QWQA 3F8FA 5DD8A 2PLYA 3I59A 4IJAA 4EGYA 4LFUA 2FA5A 3MCZA 3HRTA 3T5XA 2HS5A 1DDNA 4L18B 1CF7A 2A6EF 3KP7A 3J7AO 2AS5F 2DBBA 2VC0A 2MH2A 5H6RA 4AWXB 5DCFA 1WRJA 2DW4A 1MGTA 1FP2A 4HA8A 1REPC 3KZZA 2A61A 5ILUA 3OV8A 4GCVA 4HW0A 3K69A 5D5VB 3GXOA 2L01A 1KU2A 3HSEA 4UV9A 4BQAA 4WXCA 1E17A 1WSUA 1BI1A 2V1DA 1B6AA 4LG0A 2KIFA 2VE8A 5LEJA 2P7CB 3KLOA 2VT2A 3ZN0A 1R00A 4PCQA 5EEHA 2XKPA 1D5VA 4RGSA 2YX4A 2IA0A 5F64A 2HYFA 1ZN2A 3V4GA 3CO7C 1KU3A 4M6YA 3IHUA 4IPAA 1WWXA 1LDJA 4KYWA 2RNJA 5D8KB 4Y17A 1I1GA 2QVOA 2L4MA 1BN5A 1SD5A 1EH8A 2PQ8A 3GYHX 2MH9A 5CLSA 3HOTA 3E5XA 4RAYA 2FE3A 5KVRA 2L02A 3V8LA 3D0SA 5ILSA 3KFWX 2MC3A 3WG9A 3HHGA 5JI6A 4KNYA 2PN6A 2KKOA 3SFZA 2PEXA 4U0WA 4EQQA 1BI2A 1YLFA 4RGXA 1AOYA 4U7BA 2V6CA 2E1CA 3RI4A 4ESFA 4MTDA 3MAJA 2KJCA 3PQJA 1O3QA 1FT9A 2H6BA 3KP6A 3EYYA 1ULYA 4ZZDA 5H20A 4ENKA 3ZMTA 1G3SA 2JRTA 3C18A 1RUNA 2MLGA 1W5SA 3GFMA 4OIPF 5ICEA 2OZUA 5IT3A 1DUXC 2EA4A 1J2XA 4UV8A 3BJ6A 3BP8A 2LF8A 4A2UA 2PI0A 1R23A 3VFZA 4LK1F 3SXYA 3B73A 5HOOA 4UVBA 1J0RA 1SFUA 5L3FA 3DF8A 1OPCA 3TOAA 3K0LA 4HZFA 3I58A 1GVJA 4LLGF 1S3JA 4A0ZA 4R1HA 3HSRA 1H9GA 2EB7A 2HWVA 1TNSA 3I5UA 1GXPA 5BPDA 3WTZA 3KP3A 2XKOA 1K78B 2XASA 1PP8F 2A6HF 4P96A 5FGMA 4F7ZA 3KZYA 2GQQA 2XV4S 3TO6A 1F9NA 3BPVA 3NRVA 2FBHA 2QWWA 5AIQA 2DO7A 4LLLA 4BHPA 5E1XA 5BS6A 3F6OA 3TDUC 5E1WA 1IRGA 4EGZA 3QRFF 2EJRA 1YW8A 2O61A 4OMZA 1J59A 4ZYEA 3TQNA 4P9UA 2DLLA 2NAZA 1I27A 4K2EA 4L9TA 5ILVA 1LB2A 1Z91A 2CFXA 2VC1A 3LA2A 4RB2C 3WE2A 2UWMA 1H9TA 1USTA 2UXXA 4R79A 2YSRA 1V3FA 4EJWA 2HYGD 2R3SA 5E1ZB 3BOQA 3TGNA 4MQ9F 5LEKA 2LDUA 2QQAA 5J8CA 2H09A 2Q2EA 1QBJA 3M9AA 1HSTA 3WTSC 4O6JA 4PGGA 2DPDA 4XBFA 1O7FA 1G6NA 5D5WB 3WTYC 3CUQC 4XLNF 1NHAA 4DQ2A 2HTJA 2RC4A 2G9WA 2IA1A 1K79A 4CHUA 2RGVA 5DD4A 3EQLF 4FX0A 3WTXC 1IN5A 4ESJA 2FMLA 5TRDA 5LGNA 2M30A 3V7CA 4XSXF 4KFCA 3J80Z 1QNTA 5L3DA 4HDVA 3F72A 5L3GA 1FBSA 4BYYA 1MZBA 3J80K 3T8RA 4BHCA 1XGNA 1KQ8A 1X3UA 2DQLA 4AVPA 2QBYA 3IWFA 2VE9A 2O8XA 1MJ9A 4G8XA 2RQPA 1XGSA 3FXUA 3MWMA 3LA7A 2XIGA 1TTYA 3TO9A 2JPBA 3R4KA 4CICA 3E6BA 2A3SA 4OU0A 4I7HA 5FB2A 3O3KA 2XAGA 1RIOH 2FU4A 2VN2A 4GGGA 2IW5A 3F8CA 5LHHA 4A12A 2FEZA 4UXNA 2V1UA 2P5VA 4O3MA 1S6LA 1Q1HA 1Z9CA 1TLHB 1BBYA 3VOEA 1AWCA 5DCMB 1S7OA 1Z05A 3E97A 1KQ0A 2YPRA 3GO5A 2HKOA 1WKMA 1TW3A 4HQEA 4G6DA 4IRIA 4WXDA 5CVRA 3QP5A 3JSPA 2Q8KA 4LB6B 3K1PA 3DKWA 2OD5A 1IXCA 1IF1A 1FWZA 2EFQA 5F6FA 1I1SA 2BGCA 5FO5A 1KU9A 2D2WA 2ZXJA 4U0YA 1ZLKA 5LLQA 5L3CA 3RYPA 3N4MA 5CVJA 5E20A 3L9FA 2EFWA 1IN8A 3KE2A 3I4PA 1YQAA 2M87A 3Q9VA 2QQBA 1U5TA 1S7AA 4LD5A 4N9IA 3RKWA 3CUOA 5FD6A 3HTUA 4ASNA 5JR3A 4EMSA 2F2EA 1P4AA 1GHCA 3TO7A 1BC8C 2IP2A 3LAJA 2P5KA 4IXAA 2P6SA 3DP7A 4UNOA 4HF0A 4E70A 2IA2A 2O6GE 2DT5A 4A0YA 3LQQA 4KN7X 1YW9A 4O5VA 1B59A 4Q48A 3FX3A 4RS8A 3E6MA 2PFBA 2D45A 1F1ZA 4EJUA 4B8XA 3T1BA 3PQKA 1HKQA 1ZHFA 1LJ9A 2ZO4A 4P9FA 2BE5F 5BPIA 2ZBKA 4NHJA 4ZZLA 3HRSA 4HX4A 3U1DA 3GZ6A 4Q4ZF 4OMYA 2HQRA 1MD0A 1F5TA 3EYIA 2PJPA 1U2WA 3IKVA 1FSEA 3DV8A 2CGPA 3RTRA 2OAZA 3IC7A 4N0BA 3DEUA 1XGOA 1J7KA 5HLGA 3HHHA 2JZYA 2RDPA 4KN4X 1XDUA 3S2WA 3RIRA 5AIPA 1S8NA 1R22A 5D5UB 4CDGA 4BHBA 3CTAA 4N9HA 2DU9A 4KUMA 3O2PE 3ZMSA 4PDKA 1FZPB 3W6KB 2P4WA 2AXLA 2ADUA 2LSOA 3F6VA 1Z1DA 3T8TA 3ZMZA 1DPUA 3PFIA 1IRFA 1BOAA 5A2QZ 2ZCWA 1LNWA 5A2QK 1LDDA 5E8GA 1U5TB 1IXSB 2RVCA 2G7HA 3D5LA 3E6DA 1J9IA 1XD7A 2XVCA 2YR2A 4LJZF 3VB2A 2EFOA 3QAHA 2PG4A 5ED4A 5JHUA 2ZMEA 4HDUA 2QM3A 5ICFA 1ZYRF 1ZREA 1ODDA 3WTVC 1Z7UA 2OQRA 3HTSB 1P2FA 2CW0F 3ERED 1G3WA 2BV6A 2OBPA 1SD7A 1OYWA 3QOPA 4G7OF 3MZHA 1L3LA 3WE3A 4G6QA 3GFLA 4YFXF 3I71A 1LEAA 3GW2A 5E17F 2OQGA 5DEQA 4WWCA 4BH9A 5E8IA 3VODA 3GLXA 3ROUA 4JBAA 2DI3A 4U88A 1ON1A 3P7NA 4HYEA 3EUHA 1Z6RA 4BXUA 1ZG3A 6PAXA 3H3UA 1IN6A 5BMZA 4ZH4F 2WV0A 1L0OC 2EWNA 2XAFA 1T6SA 4HF2A 1I6XA 1RNLA 3I54A 4EM1A 1WI9A 1BM9A 3GUDA 3HYIA 1BJAA 1FSHA 3ISPA 4YIFA 5CVIA 2ELHA 4YFNF 2J5OA 4HLYA 3I59B 4H0EA 5K5QA 3ZMVA 2XROA 2UXNA 5L3EA 5JFRA 1CF7B 3V7RA 3ZMDA 2X0LA 4HX7A 4RAZA 2A07F 1SAXA 1FPQA 3AAFA 2C6YA 2A69F 3TDZC 2R7DA 1Y0UA 3Q9SA 5HVQC 2LKPA 3JAMZ 4KT5C 3L00A 4M9XA 1XSDA 3JAMK 4MQVA 3J81Z 1PP7U 1Z6TA 4ON0A 2DK5A 3ZMUA 3J81K 2FQ3A 1R5GA 4LG0B 3HSFA 3WTTC 5D4RA 1FP1D 2STTA 4I02A 1IXRC 5LHIA 5D5XB 2CSOA 1XSXA 3H92A 2H27A 1RI7A 2CG4A 4HAMA 2E1NA 2VT3A 4I0BA 1HW1A 2W25A 4KICA 1F4KA 2G7UA 2FMYA 2DQRA 2H94A 2ISZA 2Q0OA 2EFPA 3I53A 2Z5UA 2F5EA 5J8FA 3FHZA 3F8BA 5DDGA 3WGGA 3LQRA 2ZMEB 3E5UA 3P9CA 3MFKA 1XN7A 1LDKB 2M45A 2HGCA 1OYIA 2EV5A 3CLOA 3GZ5A 1V4RA 3COAC 2CQKA 3IRRA 3B02A 4WF2A 3F3XA 5D6EA 4CXFA 3FF5A 2W84A 1ZAOA 2ZKZA 3NQOA 1SFXA 3L7WA 4HV6A 2A68F 4UHTA 2EK5A 4L5IA 5CVUA 2ISYA 3FMSA 1IZ1A 1J5YA 3BWGA 1R36A 2PMUA 3F22A 3SZTA 1YYVA 1W4MA 2VBYA 5H6QA 3T0YA 3R61A 4I98B 1FYKA 2RV8A 3V8KA 1XMAA 4IRHA 4U0VA 4G94A 2BBYA 1FBUA 2VBZA 2NNYA 3MEXA 4KDPA 2RKHA 1UHWA 2GWRA 3V8JA 1E2XA 1T0FA 4HBLA 1SMYF 1HKSA 5ICCA 2NNNA 2K7LA 1R7JA 3EETA 2M8EA 1A04A 4WX9A 2Z99A 5FFXA 5ICGA 2D1HA 2A5YB 1GXQA 3KEQA 5CVVA 2GAUA 2HEOA 2MBFA 2Y75A 4I01A 1P4WA 1PUEE 3QU6A 4HX8A 3BZ6A 3K9TA 5K5RA 2K4JA 1EV7A 2E7XA 4M9ZA 4HLXA 4AD9A 1HSJA 4RB3C 2P6TA 2VOPA 1JHFA 1XB4A 4XLPF 4A6DA 5E18F 1BIAA 4YFKF 2E7WA 3L09A 1D8JA 1SD6A 2DPUA 3K1NA 1O57A 3WTWC 2XHKA 4OIRF 1K7AA 3RYRA 3JW4A 2ESHA 3WGIA 3WTUC 1TNTA 5L3BA 3FWEA 1FY7A 2RN7A 3LSTA 2UZKA 3TOBA 2Y48A 4L9VA 1W7PA 3RKXA 2NS0A 5K1YA 5D4SA 1YTYA 2QQ9A 3HRUA 4G7HF 4ENNA 1OYYA 1XCBA 4IVNA 4EVIA 5HDKA 4OIQF 2QLZA 4NB5A 4FHTA 4NQWA 5ERIA 2VBXA 4IRGA 4KIGA 2IT0A 1HKTA 2Z3YA 3BJOA 3ML6A 3DXJF 3W6JB 2CWEA 2EA2A 1R5HA 4LMYA 2W24A 3FM3A 4DNCA 3ULQB 3GVAA 4S05A 1T98A 2PMHA 3QPHA 3HIFA 3SZPA 3BDDA 3KCCA 4Q5SF 4ZYGA 4PZJA 2HR3A 4MEYF 2FNPA 1YS7A 4BNCA 3SHFA 3ELKA 1MDMA 2QBYB 5K5OA 1U6GA 4WK8F 2JT1A 3M7GA 2XAQA 3WGHA 2XGXA 4OOIA 3LA3A 4M6XA 4UVCA 3R6SA 3LWFA 2PBIA 1XMKA 1ZARA 1TQPA 2QUFA 4I0AA 4S04A 4Y15A 4AIJA 1ZRCA 4AIHA 2CYYA 3LFKA 4JK1X 5EEGA 4GO1A 1WQ2A 2VODA 1T39A 3HRMA 1JE8A 3M1EA 1KA8A 2EV6A
chains in the Genus database with same CATH superfamily
4ZYHA 1GDTA 1D1AA 3FMRA 3ONQA 5DYMA 3I55I 1U3EM 3GTOJ 1FTZA 2BYVE 4E6KG 4HNVA 3HBLA 4X1EA 4CYCA 5IT9Z 4KIFA 1LQ1A 1G2HA 3BPXA 1LE8A 1ENHA 3IRQA 4P1WA 5IT9K 4FE7A 2JTVA 4ZC3A 3H5AA 1EH6A 2OJED 2RAEA 4IHWA 2KHMA 1S29A 4P5OA 4WCGA 2J5PA 4CYDA 3J7AY 4E7HA 1Z77A 1GVDA 4UUTA 4A6EA 1WFXA 5LRSA 1HA8A 1YJWI 1D8KA 2LH9A 3KP5A 3ABTA 3RJPA 3O8GA 3A4CA 3BJAA 1KYZA 1V5FA 1ZELA 1USSA 4ENMA 4IHSA 2B0LA 4CZZA 4BDZA 1MJAA 2XPUA 4ZDLA 2L9RA 5BQTA 1FNNA 2JUGA 2M7AA 1H0MA 3A01A 4Y13A 1R1TA 1W7PB 1VQ4I 2AQFA 4UVAA 1X1AA 5LGTA 4MHGA 4A3MJ 1QZYA 3S1NJ 3U1KA 1B9NA 4FX4A 1RR7A 2DTZA 2KJBA 3ABUA 4KJZA 3GTPJ 2L4AA 2W00A 4QLCU 3WU2C 4XORA 1X1DA 3HOZJ 2XB0X 3FXRA 5FKMA 1E3PA 3U9GA 5HLHA 1VQ8I 1YO5C 4IQ4A 1MNEA 4NQWB 3GEZA 4X0GA 2BHZA 2O0YA 4LGWA 5FLXZ 3S14J 2LG4A 3CJRB 1WPKA 2ZSIB 3O6BB 5DUKA 2HNHA 1RRJA 3VPRA 4M3BA 1DP7P 5HS8A 3KPHA 5LHGA 1LEBA 2KQRA 5FLXK 4C3IJ 1RKWA 2FSWA 1B9MA 5EGOB 4D0PA 2FX0A 1R1UA 2IRFG 5HNFA 1K78A 2OZ6A 3S1QJ 4PFOA 2GLOA 4YIIA 4W97A 1Z67A 1BI0A 3OR1C 4L9JA 1S7EA 1VQ6I 1T2KA 2X9DA 2XUBA 4LLNA 3C2HA 2VXDA 3CUQA 3FKIJ 1YIOA 3EPZA 1K83J 2BHYA 4JQFA 4DW6A 2GOMA 1EH7A 4HQMA 3M4OJ 3KP4A 2EZKA 1MDMB 2XAHA 2CO5A 1N75A 3NAUA 2NOJB 2LTPA 2GOXB 2M1BA 4Z2YA 4BJ5C 3OL4A 1QGPA 2XDVA 3DFGA 5BOXA 1YITI 3K1MA 2E36A 4ITVA 2EZHA 2CS3A 4IL6C 4GDFA 4EM0B 2AQEA 2HQNA 4ENJA 1DGRM 1ZG1A 4IF4A 2Z33A 1B8IB 2NVYJ 4A5NA 2E34A 2F5CA 1AKHB 2MD0A 1WH5A 3F21A 2K3FA 3ASOH 3M8FA 4A3KJ 3MKLA 5M5YJ 3ZQIA 4WXHA 1R1VA 3HPGA 3J7YJ 4EJOA 1X58A 2LY2A 3ECOA 3P9KA 5JVTA 1CGPA 3K4KA 4ETSA 1DQUA 4L0ZB 3AG1H 5B3SH 5KNLA 1SAUA 2F5DA 3ZN1A 3BG3A 2R93J 3KEOA 3ZCOA 4C2TA 1VF9A 3FXOA 3FXQA 2VLAA 4KMFA 4G7ZF 2V9VA 2WY7Q 1UHSA 3LAPA 1SFOJ 2HZTA 2KL4A 3H9QA 2ETHA 2XF6A 1IUFA 3HOSA 2HI3A 1U5TC 3FHNA 4CYCB 4ZYDA 1RESA 2FBIA 2K27A 1J75A 2R0QC 4M74A 1U78A 2RREA 3H35A 4G9YA 3MVPA 3R60A 4E7LA 1LE8B 1ZRFA 3AFHA 2DFFA 3BROA 4BAYA 3I0TA 4IHYA 2NVXJ 1OFCX 5HLIA 2HOSA 1IO2A 3ECHA 2WC2A 2N8GA 1YX3A 2OTJI 2H6CA 2JPCA 3TKYA 3RPUA 2HKXA 3CCSI 1KQ9A 3DLAA 4AU7A 1QO0D 3ZQCA 2YU9J 3OOPA 2K02A 1K6OA 4M9SA 1IN7A 3DTKA 2FBKA 3HOXJ 1ZGAA 4MTEA 3OYLA 1Z21A 1P4XA 3MZYA 3Q5FA 2L7MP 3QU3A 3L1PA 1ZGJA 4DZJA 3KX2A 4IHTA 3E6CC 2GIVA 5J6XA 3A02A 1JUSA 2P8TA 4BS9A 2KP6A 1WJ5A 2ACJA 1ACIA 2CW8A 2P5LC 1ZR4A 3GTMJ 1E3HA 1KU7A 1ERDA 2PJRA 1O3TA 2MLKA 2XGEA 1NG6A 4FCYA 3L2QA 3OYIA 2LK2A 4L9NA 3H3VK 3BQZA 3ZQ7A 4M3GA 1SD4A 3W3CA 1DP3A 4U7DA 4C2UA 4RBOA 3LFUA 2DAOA 3S1RJ 3HJEA 2GA2A 2QYOA 4N4OB 4JOMA 4A3FJ 1ONVA 3OYNA 4HNUA 3JTGA 1XSVA 2CUZA 2KIMA 2UV1A 4RB0A 3FIWA 4XLFA 3DPTA 4FT8A 1ZRDA 1JGSA 1FOKA 1OCTC 1STZA 1OR7A 1G4DA 1HW2A 1YRNA 2ZNZA 3IWZA 2VOOA 2KRCA 2QCOA 3S1MJ 2K86A 2R7RA 3BG5A 4M72A 3EUAA 3JRFA 2IJLA 4YG2F 4XONA 3EDPA 2LREA 3VYSB 2OC6A 1ETKA 2WB1A 1IUYA 2K4BA 1P6RA 1TWFJ 3S2HJ 3AL0B 3BG7A 2P7VB 1I3AA 3JTHA 3CC4I 1X1PA 1VI0A 4A5MA 4RB1A 1TW2A 2WB1N 3K10A 2ZNYA 2ZXHA 1R71A 2D1VA 3C7JA 1P92A 3CUQB 2DOFA 3PM1A 5GP9A 1E0EA 1FLIA 5FLMJ 1VQPI 4E7SA 2IAIA 2XB5A 3PSIA 2DXIA 2WTEA 3GWZA 1W36D 2LP0A 3JRDA 5LGUA 4OIOF 3KIOA 5DV5A 3HM5A 2FOKA 2V6EA 4I2OA 1FOXA 4L0YB 4NC6A 1TBXA 5DCMA 3BZCA 3P9IA 3HDDA 1UJ8A 1MJBA 3KLNA 2OA4A 4P55A 4U87A 3TW6A 4F93B 1K61A 1BW6A 1WVRA 2ESNA 1MBJA 3CDLA 2GA1A 1IAWA 1JHHA 2DA6A 3RQ4A 3FZVA 3C3WA 1IW7F 2CUJA 4ZTJA 5F0FA 1TQIA 1XGMA 5FFZA 3LSRA 5LBQA 2TDXA 2KRFA 4EJVA 3MQ0A 3I64A 2L54A 1HQCA 2W7NA 1O3SA 2GXGA 2IPQX 3JSOA 4HF1A 3OR2C 2Z1DA 4HNTA 4IKFA 3ZP5A 4PGHA 3BR1A 5HS9A 3HOUJ 3QOEA 4LB5A 1NK2P 5DUIA 2H8WA 2Z9OA 1BC7C 4UUVA 1MNDA 2CW7A 1DPRA 2EQRA 3BY6A 3DKXA 3QP6A 5D8LB 3RSNA 1K4SA 1N25A 1R4NB 2MG4A 3MKZA 1XDSA 2GZWA 5DTDA 4BBRJ 3BLYA 2BY0A 2IVMA 2JSCA 2KISA 4RGUA 4XN0A 4OINF 4BGDA 3RZDJ 1JUPA 4FQGA 2LBFA 4HV5A 2O3FA 2NRAC 3A03A 4CO8A 3GTQJ 2M8GX 3CF5F 4NC8A 5GAHJ 5HDNA 3GX4X 2BZTA 2MA3A 2LRDA 2EV0A 1YS6A 2W57A 2DK8A 3FBIB 5IP9J 3NEUA 3UR3C 2O03A 2FF4A 1D0XA 4IO9F 1UHMA 1QZZA 3DEWA 3I3LA 2ZMEC 3CJNA 3U2RA 3V7SA 1BOBA 1FYMA 2FNAA 5EYRA 2MD5A 2FXAA 1RZ4A 1MBFA 2ZFWA 5F1RA 2CV2A 2JA8J 2YX7A 1R5ID 3UKGA 1LVKA 1X2MA 2DFIA 4AIKA 3C2BA 3F8MA 2BVLA 3R0AA 2HDCA 4CGZA 3CCVI 3DPLC 2PJRB 1O7LA 1VQKI 5HS7A 5GPCA 2E2HJ 1WJBA 2ZJ2A 2OU2A 3PJRA 1G3YA 2O8KA 4UY8I 3CD6I 2FRHA 4KIBA 5B66C 4H4KC 1PDNC 3FXKA 5KAFC 1A36A 5EJCA 2NYXA 5AONA 4UUSA 1B72B 1Y8RB 2R7VA 1XCVA 2L9VA 2X1EA 1ETXA 3WODF 1Y6IA 4BBSJ 3IKTA 4XRFA 2VPLA 5FKNA 1FC3A 1U8BA 4OAZA 4MNUA 2LLKA 5HDGA 2DFEA 2V79A 1WZ2A 2JJ7A 1IRXA 2BEOA 3K2ZA 4GYGA 2D5VA 2KIQA 3DU5A 2R7FA 1ZLJA 4B3XA 1X2NA 5B1BH 2BY3A 1KYWA 4ESBA 4A0XA 3G2BA 1YG2A 3R0JA 1QU3A 2GXBA 2V1XA 1HDPA 2YU3A 3GFJA 1BI3A 4E7IA 1O3RA 4TV7A 3F23A 3WU1B 1TQMA 1Y39A 1JTXA 1T56A 1QQIA 4M3DA 4XSZF 1W5TA 5D6FA 4A3LJ 2M5WA 3SYTA 3FMQA 4BE2A 1VTNC 2KMUA 3DWLE 3C1DA 3M8EA 4MEXF 2MC4A 4LK0F 1TL8A 3RKYA 2WWYA 3M1CA 1FX7A 2XAUA 1OCOH 4I09A 3FBNB 3H5RA 3DQVC 1B1BA 4CCOA 3CCQI 1P7IA 3K7AJ 4ANJA 1X4PA 3KYLA 3REOA 3CMYA 2LMDA 3OYHA 3FM5A 2VIXA 4C9YA 4AM3A 2F4IA 3TMOA 1HW5A 4ZTFA 2LOOA 4EV0A 2W85A 1ETYA 5K7FA 4YELA 1I50J 2M4GA 1EJ9A 1ZK8A 2WAFA 1MBHA 1YOVB 2LF7A 5FD5A 3KYCB 1ZR2A 4RDUA 1U8RA 1ZG5A 1OMIA 3SEQA 1HBXG 2PX9A 3GTJJ 1UFMA 2DT6A 3ASNH 1JXSA 3RDIA 4PSWA 2VBWA 1FMWA 4HPQA 4BEHA 1YW7A 3G3ZA 4R8HA 2WA0A 2HPMA 2STWA 2VB6A 3FK7A 1FJLA 4B4CA 3N97A 2KLOA 2KDOA 2LBFB 4ZYAA 2RQQA 1HDDC 5HODA 4C30A 2Y31A 3KETA 1RC9A 1WJDA 5C3EJ 3IL2A 1PYVA 1I5ZA 4KMUX 1MBEA 4L5JA 5TJJA 3NWSA 3OYCA 1BIBA 4CCNA 1J09A 4QIWN 4HOBA 1K6YA 3E1SA 1SFEA 4F55A 3K4JA 4B09A 1G59A 2KIUA 4M3FA 5J4YA 1D3YA 2QENA 3DBRB 1ON2A 4RGRA 3Q0WA 2LNBA 5EEAA 1WGXA 2H1KA 3S17J 2L3DA 5HLTA 2HFHA 2DTRA 3CCLI 1JKOC 3I4NJ 2DCEA 5KK1A 2F5FA 2XRNA 3E5QA 5B5EC 1T38A 2W4SA 3ZRGA 2COMA 2XSJC 1R58A 3H3ZA 2HTSA 3GZNB 4Y52J 5CYVA 2Y0MA 1FYLA 1AU7A 3BTJA 4MFEA 4MGRA 4II2A 4GYIA 3L2CA 2WBMA 1OCZH 2GXAA 3VEPA 2XF5A 1S5LC 3CO6C 2XSDC 3BR6A 1RUOA 3G1LA 2EPFA 3LSMA 4EM2A 4M3EA 2JN6A 5CJ9A 2KRHA 1BR4A 3QPTA 2M2EA 3F8NA 3FISA 1M1EB 1UAAA 2QZ8A 2LD5A 5FLVA 1HXDA 1OKRA 2HOEA 2DDBA 4BXFA 3LSGA 5CQGA 1C0WA 1ZH5A 1A31A 4EJTA 1XTAA 4RA2A 2X4HA 3ZPLA 1IN4A 1QPMA 3MMYB 1DU6A 3DKYA 1SANA 1SMTA 2VXZA 3TP3A 4KA4A 4Q47A 1MKMA 1UB9A 3KP2A 1W7PD 3SQNA 2DJIA 3CDHA 4M71A 4NC7A 2XAJA 5IPAA 5LRRA 1YFHA 2EFNA 5IYBJ 1BJZA 3ABKH 5E3OA 2CUEA 1B4AA 4M73A 3HUGA 4DYRA 3RPQA 1LVAA 1TZLA 4B48A 1KGSA 1G3TA 3WU0A 3G73A 1V5GA 3S3OA 4PSXA 3SDGA 1UCRA 2A05A 5M3MJ 1AA7A 3CCYA 1OJLA 3E3VA 1QHGA 2VONA 3GF2A 3GFIA 1TT5B 1FBQA 1N78A 4GXOA 3OOUA 4QWQA 3F8FA 4PJ0C 2AXTC 2E1OA 5J3LA 2MSYA 5DD8A 2PLYA 3I59A 4IJAA 4EGYA 4LFUA 2FA5A 1NH3A 2CFOA 3MCZA 3HRTA 3T5XA 2HS5A 4XRSG 1DDNA 4L18B 1CF7A 1JT6A 2A6EF 1WI3A 3KP7A 4F52A 3G4SI 5GAGJ 3HKZA 3J7AO 1H88C 2AS5F 4Y3OA 2DBBA 5E3NA 2VC0A 4BUPA 5DM6F 2MH2A 4ZDPA 2NVQJ 2EH3A 4G6TB 5H6RA 4AWXB 3JR9A 1YHQI 3HKZN 5DCFA 1WRJA 3GCMA 1MGTA 2DW4A 1FP2A 4HA8A 5TGTA 3V42A 4CCKA 2W1OA 1REPC 3E0JB 3ZQLA 4DGWB 1H89C 3KZZA 4A93J 2X6YA 2A61A 5ILUA 3OV8A 4GCVA 2MW8A 4DBQA 4HW0A 3OIQA 3K69A 5D5VB 3GXOA 2L01A 1MMSA 1KU2A 2DOEA 1ETQA 3HSEA 4CZCA 2R5YA 3L2UA 1RPWA 3LSJA 3MD2A 4UV9A 4WXCA 3K4BA 1D5YA 4BQAA 1AHDP 1E17A 2FD5A 1WSUA 5FKKA 1BI1A 2WAEA 1VFCA 2V1DA 1B6AA 4LG0A 2KIFA 4DJAA 2VE8A 5LEJA 2P7CB 3KLOA 1ITYA 4XKBA 2VT2A 3LMMA 3ZN0A 3I9V2 1R00A 1YX5A 4PCQA 1S72I 2R5ZA 2LFBA 5EEHA 2XKPA 1D5VA 1RKTA 1JI8A 4UB8C 4CH7A 2NVUB 4RGSA 2YX4A 1TC3C 3JRCA 2IA0A 5F64A 2HYFA 1PJRA 3HXLA 3I4MJ 1ZN2A 2WADA 3V4GA 3LSPA 3CO7C 2FJ1A 2XPVA 1KU3A 4M6YA 1Z3YA 1NTCA 2VL8A 3IHUA 4IPAA 1TWCJ 1UG2A 1WWXA 2QKLB 1LDJA 4KYWA 2RNJA 4GFBA 5D8KB 4KISA 4Y17A 1I1GA 5LFAA 2QVOA 2L4MA 3HL2A 1BN5A 1SD5A 1EH8A 2PQ8A 3GYHX 4A3CJ 2MH9A 2ME0A 5CLSA 4BE0A 3HOTA 3E5XA 3F0CA 2VQCA 2CU7A 2DT7B 2JRMA 3BR2A 1OLTA 1JTYA 4RAYA 3PFYA 2FE3A 2COBA 5KVRA 1DU0A 2Z16A 2L02A 2ZJPF 3BTIA 3V8LA 3CDIA 1MMAA 3D0SA 5ILSA 3KFWX 1BR1A 2MC3A 5KHDA 4IQJA 3WG9A 3HHGA 5JI6A 1X1CA 2KFDA 3G6EI 2DMTA 4KNYA 3OYGA 2PN6A 1BA5A 2ZSHB 2KKOA 3SFZA 2LY1A 2PEXA 4QPOA 4U0WA 4EQQA 1BI2A 1TWHJ 1YLFA 3FK6A 4RGXA 2CV0A 1AOYA 4U7BA 3LSHA 2V6CA 5J1RA 4RM3A 2E1CA 3RCOA 3M07A 3RI4A 4ESFA 4MTDA 2NS8A 4J19A 4LIVA 3C2GA 3MAJA 1Y0NA 3HB9A 2KJCA 3PQJA 1O3QA 1D0ZA 4AIDA 1QRYA 1FT9A 2H6BA 2O5RA 3EYYA 3KP6A 4FETA 2XGCA 5C4XJ 3PIPF 1ULYA 4ZZDA 5H20A 4ENKA 3S16J 3ZMTA 1G3SA 2JRTA 4IOAF 1IJWC 3C18A 1YI2I 1Y1VJ 2F4OB 1RUNA 2F4MB 2DN0A 2EIJH 2MLGA 4M6VA 1W5SA 2L7FP 3GFMA 3MN2A 1PUFA 4OIPF 5ICEA 1XMXA 2K85A 3BT9A 2OZUA 5IT3A 1DUXC 2DMNA 4C3HJ 2YUSA 3IAS2 2EA4A 3RKQA 1J2XA 1V55H 1IC8A 2B63J 2X1CA 3PO3J 4DYQA 4UV8A 1MNMC 2E5NA 4MO7A 3BJ6A 3BP8A 3OIOA 2LF8A 3IH2A 4A2UA 2DYRH 2PI0A 1R23A 5F0CA 2QA4I 3VFZA 2L5QA 4LK1F 4PJLA 3A01B 1PVEA 3SXYA 2A6TA 4XLCA 1ZQ3P 3CJTB 3B73A 5HOOA 5F04A 2P81A 1K4TA 1Y1WJ 4CA0A 4UVBA 3TP0A 5GPAA 1J0RA 2Q1ZB 5GADJ 1SFUA 2DJNA 1FTTA 4BKXA 3O8HA 2LR8A 1Z0XA 5L3FA 3DF8A 1OPCA 3TOAA 4B3AA 2LKXA 3K0LA 4JX5A 1MH3A 1JKRC 1JJ8C 3JRAA 4HZFA 1ETWA 3I58A 4C3JJ 1GVJA 1A6QA 4PJJA 4LLGF 4XNFA 1I39A 2M3AA 1S3JA 4A0ZA 2X6WA 1WHUA 4R1HA 4BXXJ 2X85A 4D7MA 4V2FA 3HSRA 1H9GA 3TBIA 1IGNA 1DGWY 2EB7A 3VDXA 2EIMH 2HWVA 1TNSA 3I5UA 1GXPA 5BPDA 3WTZA 3KP3A 2XKOA 1K78B 2CMPA 2XASA 2QSFX 1PP8F 1MMNA 2A6HF 3HZJA 4P96A 2GM4A 2VUMJ 1R9TJ 5FGMA 4F7ZA 5LD2C 3KZYA 2GQQA 1FIPA 2XV4S 5F27A 3TO6A 2L7KA 1F9NA 3BPVA 3NRVA 2FBHA 2X51A 3PL8A 4A3IJ 1R49A 2QWWA 3FXJA 2HXIA 3DBHB 1POGA 5AIQA 2DO7A 4LLLA 2QKMB 4BHPA 1VQNI 3ZGKA 2DDAA 3RPUD 5E1XA 3CMEI 3DTIA 5BS6A 3F6OA 2Y9ZA 3TDUC 5E1WA 3JRIA 1IRGA 4EGZA 2ID3A 3QRFF 2EJRA 3ZQQA 2IGNA 1JJ6C 1YW8A 2O61A 1JT0A 2XRLA 4OMZA 4D5FA 4LITA 1J59A 5EF6A 4JX4A 2R92J 4ZYEA 4W1UA 3TQNA 3OL3A 5M3FJ 4N4NB 4HG2A 4P9UA 4X6AJ 2DLLA 2NAZA 4MFDA 1I27A 4K2EA 4L9TA 5ILVA 3JRHA 1LB2A 3H0GJ 1Z91A 2CFXA 1LKXA 2VC1A 3LA2A 4L5EA 1RETA 1MH4A 4RB2C 3WE2A 2BW3A 2UWMA 5TISC 1GV2A 1H9TA 1USTA 2UXXA 2K9LA 5CQEA 3A1YA 4G12A 2Y2ZA 4R79A 3BC8A 4A3DJ 2YSRA 3ESWB 2BOLA 3CZ6A 3OIPA 4Y4RA 1V3FA 4EJWA 3OMYA 1BR2A 2HYGD 2R3SA 3FDYA 5E1ZB 3DLLF 3SJMA 1WJAA 3BOQA 4D5CA 2NOGA 3TGNA 5KAIC 3MKWB 1XC5A 3M3YJ 4MQ9F 5LEKA 2LDUA 2QQAA 2DMQA 5J8CA 2H09A 2Q2EA 1QBJA 3WHBA 2HYJA 3AL0C 4XKCA 3M9AA 1HSTA 3WTSC 2ZC2A 1SVLA 2YS9A 4O6JA 4PGGA 4ABZA 2DPDA 2CUFA 3HGGA 1FIAA 4XBFA 1O7FA 1G6NA 5D5WB 1PUFB 3WTYC 5CPRB 3CUQC 4JP0A 2I8DA 4XLNF 1NHAA 4DQ2A 2H8RA 3OYAA 2BXZA 2HTJA 2RC4A 2G9WA 2QGUA 2IA1A 1K79A 4CHUA 2RGVA 4LG3A 3TEDA 5DD4A 2W82A 3EQLF 4FX0A 3WTXC 1IN5A 4ESJA 2FMLA 2DOAA 2JVHA 2XC7A 5TRDA 3VYRB 5LGNA 2M30A 4D1QA 3V7CA 3OYKA 1FMVA 2VKHA 1A5JA 4XSXF 4KFCA 3J80Z 1QNTA 2V1NA 5L3DA 4HDVA 4OWRB 3F72A 5L3GA 1FBSA 4BYYA 1IG7A 1MZBA 1VNDA 3J80K 3T8RA 4BHCA 2E1MB 3LSKA 1XGNA 1KQ8A 1X3UA 2XF7A 4EEFG 3OSGA 3KEYA 1R4MB 2DQLA 4AVPA 2QBYA 2CQ7A 2JA7J 3EUHC 3IWFA 2H1LA 2VE9A 2O8XA 1MJ9A 4G8XA 2RQPA 4NNJA 1GT0C 2P0WA 2ICWG 1XGSA 2M7BA 3FXUA 3MWMA 3LA7A 1I3QJ 2XIGA 1QA6A 1TTYA 2I10A 1YRNB 3TO9A 1D1BA 2JPBA 2OCCH 4CCJA 3R4KA 4CICA 1SC7A 3E6BA 2A3SA 1OCCH 4OU0A 3QPSA 4I7HA 4D9JA 5FRNA 2VJ4A 2DA1A 5FB2A 3BR3A 1OISA 3O3KA 3CCEI 2XAGA 1RIOH 2KDZA 1D0YA 2FU4A 4I6ZA 2VN2A 4GGGA 2ECCA 2CH0A 3G1MA 2IW5A 3F8CA 5LHHA 4A12A 3EUKL 2FEZA 3QWLA 1W36C 3IP4B 2MABA 1E3OC 4UXNA 5E79C 3QYBA 1Y8QB 2V1UA 4DZPA 2P5VA 2W48A 4E7KA 4O3MA 3VSLA 1S6LA 1Q1HA 1Z9CA 1GUUA 5J47A 4RMNA 1TLHB 3Q3SA 1BBYA 3VOEA 1KONA 4A3EJ 1HOMA 2OCEA 1AWCA 5DCMB 1F43A 1S7OA 4PJNA 1Z05A 2K40A 2F5VA 4XL9A 3E97A 3J7ZI 1KQ0A 2YPRA 3GO5A 2FQ4A 9ANTA 2HKOA 1WKMA 2BXYA 2ZJRF 1TW3A 1QHHD 2LY9A 4HQEA 5FKLA 4G6DA 4IRIA 4WXDA 5CVRA 2DMPA 3QP5A 3JSPA 2B9SA 2Q8KA 4LB6B 4XRSA 2IGMA 3K1PA 4AUXA 3DKWA 4A3BJ 2OD5A 4A3GJ 2JWTA 2M0MA 4FTHA 1IXCA 2A5WA 1IF1A 1FWZA 2CQNA 2EFQA 3AG3H 1X3WB 5F6FA 1I1SA 2VJJA 4BQOA 2IXSA 4AYBA 2BGCA 2HOAA 5FO5A 1KU9A 2D2WA 1P7JA 2ZXJA 3PNVA 2HQ5A 4XN3A 4U0YA 1ZLKA 4J01A 1MIJA 3OYMA 4AYBN 3GMEA 3CCUI 5LLQA 4ZDOA 5JLXA 5L3CA 3VWBA 3BR0A 3RYPA 4F91B 4XICA 2R7XA 3N4MA 4AVZA 5CVJA 5E20A 5IYCJ 2HOTA 5EDNA 1Q1VA 3L9FA 4HEA2 2EFWA 4BJTA 1T33A 1IN8A 3KE2A 3I4PA 4B43A 1YQAA 2M87A 3Q9VA 2QQBA 3S32A 1U5TA 3QYEA 4CCMA 1S7AA 3N05A 4LD5A 4N9IA 3FXMA 2MFZA 3ZQHA 4B47A 1QVUA 3RKWA 3CUOA 5FD6A 3S3NA 2VJ5A 5FROA 3HTUA 3OWTA 4ASNA 4LOCA 4KITB 5JR3A 3S8PA 4EMSA 2DFHA 2F2EA 2CQXA 5BNGA 1P4AA 2DYSH 2F6CA 2K9QA 4FASD 3S3MA 1GHCA 3SEZA 3TO7A 1BC8C 3RZOJ 2IP2A 3LAJA 1QVTA 2P5KA 4IXAA 2P6SA 1EKEA 3DP7A 1XX5A 4UNOA 4HF0A 4E70A 2TCTA 2IA2A 2O6GE 1EA3A 2DT5A 3G71I 1MSEC 4A0YA 1FOWA 3LQQA 4KN7X 3MZ8A 1YW9A 4UUSB 4O5VA 3BG9A 1B59A 4Q48A 4RAFA 3X2QH 1A6IA 3FX3A 4RS8A 3E6MA 1VQ7I 3QQAA 2K5CA 2PFBA 2DA2A 3F9KA 4IEJA 4NBQA 2D45A 1F1ZA 1XG1A 4EJUA 4FISA 4B8XA 1AKHA 1QZEA 3T1BA 2OV7A 3K70D 2BY2A 3QYFA 3PQKA 1HKQA 1ZHFA 3TW7A 1IDZA 2KZVA 1LJ9A 3LL7A 5GAEJ 3JCUC 2EINH 2ZO4A 2JMWA 3A0BC 4P9FA 2BE5F 5BPIA 2ZBKA 4XOTA 4NHJA 1HCRA 4ZZLA 3HRSA 4HX4A 3ZQGA 3U1DA 3GZ6A 3S93A 1Y56A 1MMGA 5C4JJ 4Q4ZF 4OMYA 1P9QC 5M5WJ 3BCBA 2HQRA 1MD0A 1F5TA 3EYIA 2KZGA 2PJPA 1U2WA 1UZCA 2LVSA 5FJ8J 3IKVA 1FSEA 3DV8A 2CGPA 1T0FC 3HC7A 3RTRA 2NXNB 3LSIA 2OAZA 3IC7A 2EBIA 2LYCA 5JLWA 4N0BA 3K4NA 3DEUA 1WJFA 1XGOA 2VJIA 3JREA 2ZFUA 1J7KA 1S9HA 5HLGA 3HHHA 3E7LA 2JZYA 2RDPA 4KN4X 1XDUA 2V9KA 5F08A 1X19A 3SFIA 2UUZA 3S2WA 3RIRA 1MMDA 1ZKGA 3CP8A 5AIPA 1WCMJ 1LUJB 5DM7F 1LFBA 2F48A 1S8NA 3IAM2 3CC2I 1R22A 4BE1A 1OQYA 2VI6A 2IGKA 3ZR8X 4BY1J 2IEKA 2MYSA 5D5UB 4CDGA 1W0TA 5K7HA 4BHBA 1VZ0A 3CTAA 4AC0A 4N9HA 3VYUB 3OYFA 2DU9A 3CMMA 2LC2A 3S2DJ 2KT0A 2G0EA 5C44J 4KUMA 3O2PE 1MBGA 4BU2A 3ZMSA 4PDKA 4XLHA 4QTRA 1FZPB 5KCMA 1MW7A 3U21A 3W6KB 2P4WA 4CCLA 4BEHB 2AXLA 2ADUA 2M4KA 2LSOA 3F6VA 1I6HJ 1Z1DA 3T8TA 3ZMZA 2Y30A 1DPUA 3PFIA 2L9NA 3CF2A 3A2KA 2DA3A 1IRFA 4CSWA 1TP4A 2Y0SA 2HQAA 1BOAA 4PK4A 1T08B 1HF0A 2QSHX 5A2QZ 1TWAJ 2ZCWA 2BY1A 2JVGA 2MGQA 1LNWA 5A2QK 1LDDA 1LPQA 2Y0SN 3UNGC 3BTLA 2EZIA 5E8GA 4YIRX 1U5TB 3Q0UA 1IXSB 4V19K 2RVCA 2G7HA 3D5LA 2DMUA 3E6DA 2OPTA 2VKDA 3OS2A 1J9IA 2HVQA 4D7NA 1XD7A 2XVCA 2YR2A 1IRZA 4LJZF 5E3LA 3VB2A 2HDWA 5IP7J 2IS4A 1BW5A 2EFOA 3ABMH 3QAHA 3D1NI 2VQGA 2PG4A 5ED4A 3LOCA 2GBYA 5JHUA 2ZMEA 4HDUA 2QM3A 4QPQA 4DYCA 4KT6A 5ICFA 3NWTA 3HG9A 1ZYRF 1ZREA 1ODDA 4E4HA 3WTVC 1Z7UA 2OQRA 3HTSB 1P2FA 4XOPA 3CCRI 2CW0F 3ERED 2TRTA 1G3WA 2X6XA 2BV6A 2ID6A 2OBPA 1SD7A 1OYWA 3QOPA 2V9PA 4G7OF 1TWGJ 1X3ZB 3MZHA 2VKEA 3DPUA 1L3LA 4IOCF 3WE3A 3NARA 2QF7A 4G6QA 2ZB9A 3GFLA 4XRMA 3K70C 4YFXF 3I71A 3DTEA 1LEAA 1T95A 3GW2A 5EZGA 5E17F 2OQGA 5DEQA 3DEEA 3FKJA 4WWCA 3OSFA 4BH9A 5E8IA 3VODA 2R7OA 3DBLB 4JYKA 3GLXA 5E3MA 3ROUA 4RLFA 4A3JJ 2NVTJ 3HUGB 2IBDA 2L0KA 1U9OA 4JBAA 1G8XA 2DI3A 2KPMA 4U88A 5IY5H 4RLQA 2HVSA 1ON1A 3P7NA 4HYEA 4A69C 2CV1A 3EUHA 1Z6RA 4BXUA 1ZG3A 2ZXIA 6PAXA 1YE9A 1Z3XA 3H3UA 5JVGF 1F36A 1IN6A 5BMZA 3GTGJ 4ZH4F 1NK3P 4XIDA 2WV0A 3OS1A 1WJCA 1L0OC 1W5CC 2EWNA 2XAFA 5DS9A 1T6SA 1TT0A 3OYBA 1JGGA 1I6XA 1RNLA 3I54A 4EM1A 4HF2A 1WI9A 5JHFA 1BM9A 3GUDA 3HYIA 1BJAA 1FSHA 3ISPA 2E2IJ 4YIFA 5CVIA 2ELHA 1IV6A 3PO2J 4YFNF 2J5OA 3ZXSA 4HLYA 3I59B 1H8AC 4H0EA 5K5QA 3ZMVA 5J4VA 4DOZA 2XROA 2UXNA 5L3EA 5JFRA 5FRMA 1CF7B 4E7ZA 4GRIA 3V7RA 1EF4A 3ZMDA 1YJ9I 3OYEA 2X0LA 1A35A 4HX7A 3ZQFA 2ZXWH 4RAZA 2A07F 3PUFA 4XM3A 1SAXA 3IUOA 1FPQA 3AAFA 3HOVJ 2C6YA 2A69F 4C2MJ 4EATA 3TDZC 2R7DA 1Y0UA 3Q9SA 5HVQC 2R7ZJ 2LKPA 3JAMZ 1JKPC 4KT5C 2E2JJ 3L00A 2Y9YA 3IH3A 4M9XA 5J40A 4ZJZA 1XSDA 3JAMK 4MQVA 2R5YB 3J81Z 1PP7U 1Z6TA 4ON0A 2DK5A 3ZMUA 3TL4X 4Y7NJ 3J81K 3AG4H 2FQ3A 1R5GA 4LG0B 1MBKA 5IOZA 2DA7A 2LKSA 4YEJA 3HGYA 3HSFA 3WTTC 5D4RA 4XLEA 2VKVA 2L9SA 1FP1D 2Y69H 3K2AA 2STTA 4I02A 1IXRC 5LHIA 5D5XB 4NUBA 1BL0A 4I99C 1V5EA 2R5ZB 1B72A 2R4GA 2CSOA 3BZKA 1XSXA 3H92A 3MKYB 2H27A 3K6GA 1RI7A 3K4MA 1T8IA 1FEXA 2CG4A 4HAMA 2E1NA 3BG6A 2VT3A 4I0BA 2V7FA 1HW1A 2W25A 2CRGA 4NDLA 4KICA 3SDBA 2ELKA 1F4KA 4XMYA 3GTKJ 2JUCA 2G7UA 3PNYA 2FMYA 2DQRA 2H94A 2ISZA 2Q0OA 2EFPA 3FXLA 3I53A 2Z5UA 3LNQA 2F5EA 1R6RA 2O7OA 5J8FA 3FHZA 3W6VA 3HPHA 4Y33A 2HPIA 3F8BA 3H36A 5DDGA 1WH7A 3WGGA 3A0HC 2K9MA 3LQRA 2ZMEB 3KZIC 2ZJQF 1XS9A 4B44A 3E5UA 3P9CA 3MFKA 1X1BA 1XN7A 1LDKB 2M45A 2HGCA 1ZTRA 1OYIA 2AHQA 2EV5A 2ELJA 3CLOA 3GZ5A 5FKOA 1V4RA 3COAC 2CQKA 3B6AA 3GTLJ 4OAYA 1FOYA 3IRRA 1VQ9I 1OCRH 2NS7A 3B02A 1W1WE 2B7EA 2L7ZA 4WF2A 3F3XA 5D6EA 4CXFA 3FF5A 1NG7A 1OCPA 2W84A 3WG7H 4B1RA 1APLC 5F1JA 1ZAOA 2ZKZA 1LFUP 5J1UA 4FE4A 3NQOA 3CESA 1SFXA 3L7WA 4HV6A 2A68F 4UHTA 2EK5A 3IV5A 2E19A 2FOWA 4L5IA 1V54H 4E7JA 1UELB 2OF7A 2V4JC 4HRIA 2M34A 4BACA 4V2GA 5CVUA 2ISYA 3FMSA 1IZ1A 1J5YA 3BWGA 3RQIA 3WHCA 1R36A 2I5UA 3L2RA 2X48A 2L2OA 3L2VA 2PMUA 4BQQA 3F22A 3SZTA 3W2AA 1YYVA 2JA2A 1N77A 2EILH 4F3QA 1W4MA 2VBYA 2EZLA 5CKTA 5H6QA 3T0YA 1WJEA 3R61A 5IOYA 1XPXA 1HC8A 4HSTA 1HLVA 4I98B 5H2FC 1FYKA 3S15J 2RV8A 3CCJI 2VPRA 3V8KA 4S0HB 1XMAA 4BJ6C 2V26A 1YIJI 4IRHA 4U0VA 2JSPA 2O9LA 4G94A 1YJNI 2WV1A 2BBYA 2CQQA 3VSKA 1VQMI 1FBUA 2IS6A 2VBZA 2DODA 3MEXA 2NNYA 4KDPA 1VQ5I 2RKHA 3DCFA 4YRVA 1UHWA 4PFPA 2GWRA 2R7WA 3V8JA 3I56I 4IX7A 1E2XA 1T0FA 4HBLA 3CJQB 1SMYF 1SVMA 2RNGA 1HKSA 5ICCA 2NNNA 2R7TA 3ZOBA 2K7LA 4BDYA 2QSGX 1R7JA 5EG0A 2OTLI 3EETA 2XGDA 2M8EA 3OYJA 2HXOA 1A04A 2R7UA 4WX9A 2Z99A 5FFXA 3P5JA 2FUG2 4LIUA 5ICGA 2D1HA 4BY7J 2A5YB 4XLAA 1U9NA 5K7ZA 3L2WA 4RM2A 3W2WA 1GXQA 5F0HA 3KEQA 4IZZA 3Q0VA 5CVVA 2GAUA 2VQHA 3IH4A 2HEOA 1ORKA 2ECBA 2MBFA 5M5XJ 2Y75A 4IHVA 4I01A 2QQ8A 1P4WA 4UB6C 1PUEE 5IYDJ 3QU6A 2IS2A 4XR6A 4BQNA 4HX8A 2ME6A 2X1DA 4XKVA 3BZ6A 1GV5A 4XKWA 3K9TA 5K5RA 2R7SA 2K4JA 3SZGA 3H9JA 3HOYJ 1IDYA 1EV7A 2PMZA 2E7XA 4M9ZA 4HLXA 2X6OA 4AD9A 1HSJA 3BTCA 2WAQA 4RB3C 2P6TA 3B6CA 2VOPA 4IHXA 2PMZN 1JHFA 1XB4A 4XLPF 4A6DA 5HNHA 2WAQN 3H1CA 2R7QA 2JQ7A 5E18F 1BIAA 2E7WA 4I76A 4JX6A 4YFKF 5IP6A 3L09A 1D8JA 1SD6A 4MLOA 3ABLH 2EIKH 2DPUA 3K1NA 3GLLA 3BCAA 3DU6A 2K3PA 1O57A 5J1YA 3WTWC 2XHKA 4OIRF 4II3A 1VQLI 1K7AA 2DA5A 3RYRA 3QPLA 3JRBA 2E1MC 3JW4A 2ESHA 4RAGA 3PIOF 2CJJA 3WGIA 3WTUC 5GTHC 3GBGA 1TNTA 1JUMA 3PNTA 2BW3B 5L3BA 3OY9A 4PUSA 2HVRA 2GIZA 1O4XA 3FWEA 1FY7A 3CMAI 1X4OA 2RN7A 3H9GA 3LSTA 4MIMA 4F92B 3D5SC 2UZKA 3TOBA 2Y48A 3M8JA 1OR7C 4L9VA 2WY8Q 1RR8C 3D5RC 1W7PA 1MSFC 3RKXA 2E71A 2NS0A 5K1YA 5D4SA 2K9SA 1YTYA 2Q2EB 2HZDA 2QQ9A 2E5ZA 3HRUA 4G7HF 4ENNA 1OYYA 1SFKA 1XCBA 4IVNA 2E35A 4EVIA 4Z6YA 3CCMI 2HU9A 5HDKA 3VYTB 2Z2SB 3BQYA 4OIQF 3G1OA 2QLZA 2JA6J 4NB5A 4FHTA 4NQWA 5ERIA 2VBXA 3ERMA 3PUBA 4IRGA 4KIGA 3AG2H 3K4CA 2IT0A 1HKTA 2Z3YA 3BJOA 3BR5A 3ML6A 3JRGA 1D1CA 2K9NA 3DXJF 3W6JB 2CWEA 2QEXI 2EA2A 1ZGWA 1R5HA 1SEUA 4QSHA 4LMYA 5EGOA 2VASA 2W24A 3CLQA 3FM3A 4DNCA 4CUGA 3ULQB 3GVAA 4S05A 3OYDA 2E60A 1T98A 3H5NA 2PMHA 3CP2A 2JA5J 4J00A 3QPHA 3HIFA 4XK4A 3W2VA 3SZPA 1CQTA 3BDDA 3KCCA 2OUMA 4Q5SF 2DA4A 4DBRA 4ZYGA 2AO9A 3PSFA 4HSRA 4PZJA 2HR3A 2BVMA 4MEYF 2VQLA 2FNPA 1YS7A 5GTIC 2JK3A 4BNCA 3HOWJ 1KZHA 5EG0B 3SHFA 3ELKA 1MDMA 3QODA 2QBYB 1IV8A 1U6GA 5K5OA 1ETVA 4WK8F 1U0JA 2JT1A 2M0CA 3M7GA 2HDDA 3H0DA 5B1AH 2XAQA 3WGHA 2XGXA 4OOIA 3LA3A 1QPIA 3AKZA 4M6XA 4UVCA 3R6SA 4PJMA 3LWFA 2PBIA 1XMKA 1ZARA 1B8IA 1JKQC 1TQPA 3KYDB 1VQOI 1GLNA 2QUFA 4I0AA 4S04A 2IS1A 4Y15A 4BL0B 4AIJA 1ZRCA 3CQZJ 4AIHA 3HEFA 2CYYA 4XQFA 3K4LA 3CC7I 3LFKA 4JK1X 5EEGA 4DIQA 2M9HA 2IGOA 1W0UA 1SVOA 4GO1A 3OS0A 1WQ2A 2VODA 1T39A 3HRMA 1JE8A 2XPWA 1ETOA 3M1EA 1UMQA 1Z7LA 1KA8A 1UG0A 5EZHA 1LFPA 2EV6A
chains in the Genus database with same CATH topology
4ZYHA 3FMRA 5DYMA 1U3EM 2BYVE 5IT9Z 4KIFA 1LQ1A 3BPXA 5IT9K 3IRQA 2JTVA 1EH6A 4WCGA 1S29A 4P5OA 2J5PA 4CYDA 4A6EA 5LRSA 1D8KA 3KP5A 3ABTA 3RJPA 3BJAA 1KYZA 1USSA 4ENMA 4IHSA 2B0LA 4CZZA 1MJAA 5BQTA 1FNNA 1H0MA 4Y13A 1R1TA 1W7PB 4UVAA 5LGTA 4MHGA 1QZYA 1B9NA 4FX4A 2KJBA 3ABUA 2L4AA 4QLCU 3FXRA 3U9GA 5HLHA 1YO5C 3GEZA 2O0YA 4LGWA 5FLXZ 3O6BB 5DUKA 1DP7P 5HS8A 5LHGA 1LEBA 5FLXK 2FSWA 1B9MA 4D0PA 1R1UA 2IRFG 1K78A 2OZ6A 4YIIA 1BI0A 4L9JA 1T2KA 2XUBA 4LLNA 3CUQA 1YIOA 4JQFA 1EH7A 4HQMA 3KP4A 1MDMB 2XAHA 2CO5A 4Z2YA 2M1BA 1QGPA 3DFGA 5BOXA 3K1MA 4EM0B 2HQNA 4ENJA 1ZG1A 4IF4A 2Z33A 4A5NA 2F5CA 3F21A 3M8FA 4WXHA 1R1VA 4EJOA 3ECOA 3P9KA 5JVTA 1CGPA 4ETSA 4L0ZB 2F5DA 3ZN1A 3KEOA 3FXQA 4KMFA 4G7ZF 2V9VA 3LAPA 2HZTA 2ETHA 3HOSA 1U5TC 4ZYDA 2FBIA 2K27A 1J75A 4M74A 1U78A 4G9YA 3R60A 1ZRFA 3BROA 4BAYA 3I0TA 5HLIA 3ECHA 2WC2A 2H6CA 2JPCA 3TKYA 3RPUA 2HKXA 1KQ9A 1QO0D 3OOPA 2K02A 1K6OA 4M9SA 1IN7A 2FBKA 1ZGAA 4MTEA 1P4XA 3MZYA 3Q5FA 3QU3A 1ZGJA 4IHTA 3E6CC 2GIVA 5J6XA 2P8TA 2ACJA 2P5LC 1KU7A 1O3TA 2MLKA 4L9NA 3ZQ7A 1SD4A 4U7DA 2DAOA 2GA2A 2QYOA 1ONVA 3JTGA 1XSVA 2KIMA 4RB0A 3DPTA 4FT8A 1ZRDA 1JGSA 1FOKA 1STZA 1OR7A 1G4DA 1HW2A 2ZNZA 3IWZA 2VOOA 2K86A 4M72A 2IJLA 4YG2F 3EDPA 1IUYA 2K4BA 1P6RA 2P7VB 3JTHA 4A5MA 4RB1A 1TW2A 2ZNYA 2D1VA 3C7JA 1P92A 3CUQB 1FLIA 2WTEA 3GWZA 5LGUA 4OIOF 5DV5A 2FOKA 4I2OA 4L0YB 1TBXA 5DCMA 3P9IA 1MJBA 3KLNA 2OA4A 4P55A 2ESNA 2GA1A 1IAWA 1JHHA 3FZVA 3C3WA 1IW7F 1TQIA 1XGMA 5FFZA 5LBQA 2TDXA 2KRFA 4EJVA 3MQ0A 3I64A 2L54A 1HQCA 1O3SA 2GXGA 2IPQX 3JSOA 4HF1A 3ZP5A 4PGHA 5HS9A 4LB5A 5DUIA 2Z9OA 1BC7C 4UUVA 1DPRA 3BY6A 5D8LB 3QP6A 1XDSA 2GZWA 2IVMA 2JSCA 4RGUA 4OINF 4HV5A 2O3FA 2NRAC 4CO8A 5HDNA 3GX4X 2MA3A 2EV0A 1YS6A 2W57A 2DK8A 3NEUA 2O03A 2FF4A 1UHMA 1QZZA 3CJNA 3U2RA 3V7SA 1FYMA 2FNAA 2MD5A 2FXAA 1RZ4A 2ZFWA 5F1RA 2YX7A 2DFIA 4AIKA 3F8MA 3R0AA 2HDCA 4CGZA 3DPLC 1O7LA 5HS7A 2ZJ2A 2OU2A 1G3YA 2FRHA 4KIBA 1PDNC 2NYXA 5AONA 1XCVA 3WODF 3IKTA 4XRFA 1FC3A 4MNUA 5HDGA 2V79A 2BEOA 3K2ZA 4GYGA 2R7FA 1ZLJA 1KYWA 4ESBA 4A0XA 1YG2A 3R0JA 2GXBA 2V1XA 2YU3A 3GFJA 1BI3A 1O3RA 4TV7A 3F23A 3WU1B 1TQMA 1QQIA 4XSZF 1W5TA 5D6FA 2M5WA 3FMQA 1VTNC 3C1DA 3M8EA 4MEXF 4LK0F 3RKYA 2WWYA 1FX7A 4I09A 3DQVC 1B1BA 3REOA 3FM5A 1HW5A 4EV0A 2W85A 2LF7A 5FD5A 1U8RA 1ZG5A 1OMIA 1HBXG 1UFMA 1JXSA 3RDIA 2VBWA 1YW7A 3G3ZA 4R8HA 2STWA 3N97A 3KETA 3IL2A 1I5ZA 4KMUX 4L5JA 5TJJA 1BIBA 4HOBA 1SFEA 4B09A 2KIUA 1D3YA 2QENA 4RGRA 1ON2A 2LNBA 2L3DA 2HFHA 2DTRA 5KK1A 2F5FA 2XRNA 3E5QA 1T38A 2COMA 1R58A 3H3ZA 2HTSA 5CYVA 2Y0MA 1FYLA 4MGRA 4GYIA 3L2CA 3VEPA 3CO6C 1RUOA 4EM2A 5CJ9A 3QPTA 3F8NA 2QZ8A 1HXDA 1OKRA 2HOEA 1C0WA 1ZH5A 4EJTA 2X4HA 3ZPLA 1IN4A 1QPMA 2VXZA 1SMTA 4KA4A 4Q47A 1MKMA 1UB9A 3KP2A 1W7PD 3SQNA 3CDHA 4M71A 2XAJA 5LRRA 1YFHA 2EFNA 1B4AA 4M73A 3HUGA 3RPQA 1LVAA 1KGSA 1G3TA 3WU0A 3G73A 1UCRA 3E3VA 2VONA 3GF2A 3GFIA 1FBQA 4GXOA 4QWQA 3F8FA 5DD8A 2PLYA 3I59A 4IJAA 4EGYA 4LFUA 2FA5A 3MCZA 3HRTA 3T5XA 2HS5A 1DDNA 4L18B 1CF7A 2A6EF 3KP7A 3J7AO 2AS5F 2DBBA 2VC0A 2MH2A 5H6RA 4AWXB 5DCFA 1WRJA 2DW4A 1MGTA 1FP2A 4HA8A 1REPC 3KZZA 2A61A 5ILUA 3OV8A 4GCVA 4HW0A 3K69A 5D5VB 3GXOA 2L01A 1KU2A 3HSEA 4UV9A 4BQAA 4WXCA 1E17A 1WSUA 1BI1A 2V1DA 1B6AA 4LG0A 2KIFA 2VE8A 5LEJA 2P7CB 3KLOA 2VT2A 3ZN0A 1R00A 4PCQA 5EEHA 2XKPA 1D5VA 4RGSA 2YX4A 2IA0A 5F64A 2HYFA 1ZN2A 3V4GA 3CO7C 1KU3A 4M6YA 3IHUA 4IPAA 1WWXA 1LDJA 4KYWA 2RNJA 5D8KB 4Y17A 1I1GA 2QVOA 2L4MA 1BN5A 1SD5A 1EH8A 2PQ8A 3GYHX 2MH9A 5CLSA 3HOTA 3E5XA 4RAYA 2FE3A 5KVRA 2L02A 3V8LA 3D0SA 5ILSA 3KFWX 2MC3A 3WG9A 3HHGA 5JI6A 4KNYA 2PN6A 2KKOA 3SFZA 2PEXA 4U0WA 4EQQA 1BI2A 1YLFA 4RGXA 1AOYA 4U7BA 2V6CA 2E1CA 3RI4A 4ESFA 4MTDA 3MAJA 2KJCA 3PQJA 1O3QA 1FT9A 2H6BA 3KP6A 3EYYA 1ULYA 4ZZDA 5H20A 4ENKA 3ZMTA 1G3SA 2JRTA 3C18A 1RUNA 2MLGA 1W5SA 3GFMA 4OIPF 5ICEA 2OZUA 5IT3A 1DUXC 2EA4A 1J2XA 4UV8A 3BJ6A 3BP8A 2LF8A 4A2UA 2PI0A 1R23A 3VFZA 4LK1F 3SXYA 3B73A 5HOOA 4UVBA 1J0RA 1SFUA 5L3FA 3DF8A 1OPCA 3TOAA 3K0LA 4HZFA 3I58A 1GVJA 4LLGF 1S3JA 4A0ZA 4R1HA 3HSRA 1H9GA 2EB7A 2HWVA 1TNSA 3I5UA 1GXPA 5BPDA 3WTZA 3KP3A 2XKOA 1K78B 2XASA 1PP8F 2A6HF 4P96A 5FGMA 4F7ZA 3KZYA 2GQQA 2XV4S 3TO6A 1F9NA 3BPVA 3NRVA 2FBHA 2QWWA 5AIQA 2DO7A 4LLLA 4BHPA 5E1XA 5BS6A 3F6OA 3TDUC 5E1WA 1IRGA 4EGZA 3QRFF 2EJRA 1YW8A 2O61A 4OMZA 1J59A 4ZYEA 3TQNA 4P9UA 2DLLA 2NAZA 1I27A 4K2EA 4L9TA 5ILVA 1LB2A 1Z91A 2CFXA 2VC1A 3LA2A 4RB2C 3WE2A 2UWMA 1H9TA 1USTA 2UXXA 4R79A 2YSRA 1V3FA 4EJWA 2HYGD 2R3SA 5E1ZB 3BOQA 3TGNA 4MQ9F 5LEKA 2LDUA 2QQAA 5J8CA 2H09A 2Q2EA 1QBJA 3M9AA 1HSTA 3WTSC 4O6JA 4PGGA 2DPDA 4XBFA 1O7FA 1G6NA 5D5WB 3WTYC 3CUQC 4XLNF 1NHAA 4DQ2A 2HTJA 2RC4A 2G9WA 2IA1A 1K79A 4CHUA 2RGVA 5DD4A 3EQLF 4FX0A 3WTXC 1IN5A 4ESJA 2FMLA 5TRDA 5LGNA 2M30A 3V7CA 4XSXF 4KFCA 3J80Z 1QNTA 5L3DA 4HDVA 3F72A 5L3GA 1FBSA 4BYYA 1MZBA 3J80K 3T8RA 4BHCA 1XGNA 1KQ8A 1X3UA 2DQLA 4AVPA 2QBYA 3IWFA 2VE9A 2O8XA 1MJ9A 4G8XA 2RQPA 1XGSA 3FXUA 3MWMA 3LA7A 2XIGA 1TTYA 3TO9A 2JPBA 3R4KA 4CICA 3E6BA 2A3SA 4OU0A 4I7HA 5FB2A 3O3KA 2XAGA 1RIOH 2FU4A 2VN2A 4GGGA 2IW5A 3F8CA 5LHHA 4A12A 2FEZA 4UXNA 2V1UA 2P5VA 4O3MA 1S6LA 1Q1HA 1Z9CA 1TLHB 1BBYA 3VOEA 1AWCA 5DCMB 1S7OA 1Z05A 3E97A 1KQ0A 2YPRA 3GO5A 2HKOA 1WKMA 1TW3A 4HQEA 4G6DA 4IRIA 4WXDA 5CVRA 3QP5A 3JSPA 2Q8KA 4LB6B 3K1PA 3DKWA 2OD5A 1IXCA 1IF1A 1FWZA 2EFQA 5F6FA 1I1SA 2BGCA 5FO5A 1KU9A 2D2WA 2ZXJA 4U0YA 1ZLKA 5LLQA 5L3CA 3RYPA 3N4MA 5CVJA 5E20A 3L9FA 2EFWA 1IN8A 3KE2A 3I4PA 1YQAA 2M87A 3Q9VA 2QQBA 1U5TA 1S7AA 4LD5A 4N9IA 3RKWA 3CUOA 5FD6A 3HTUA 4ASNA 5JR3A 4EMSA 2F2EA 1P4AA 1GHCA 3TO7A 1BC8C 2IP2A 3LAJA 2P5KA 4IXAA 2P6SA 3DP7A 4UNOA 4HF0A 4E70A 2IA2A 2O6GE 2DT5A 4A0YA 3LQQA 4KN7X 1YW9A 4O5VA 1B59A 4Q48A 3FX3A 4RS8A 3E6MA 2PFBA 2D45A 1F1ZA 4EJUA 4B8XA 3T1BA 3PQKA 1HKQA 1ZHFA 1LJ9A 2ZO4A 4P9FA 2BE5F 5BPIA 2ZBKA 4NHJA 4ZZLA 3HRSA 4HX4A 3U1DA 3GZ6A 4Q4ZF 4OMYA 2HQRA 1MD0A 1F5TA 3EYIA 2PJPA 1U2WA 3IKVA 1FSEA 3DV8A 2CGPA 3RTRA 2OAZA 3IC7A 4N0BA 3DEUA 1XGOA 1J7KA 5HLGA 3HHHA 2JZYA 2RDPA 4KN4X 1XDUA 3S2WA 3RIRA 5AIPA 1S8NA 1R22A 5D5UB 4CDGA 4BHBA 3CTAA 4N9HA 2DU9A 4KUMA 3O2PE 3ZMSA 4PDKA 1FZPB 3W6KB 2P4WA 2AXLA 2ADUA 2LSOA 3F6VA 1Z1DA 3T8TA 3ZMZA 1DPUA 3PFIA 1IRFA 1BOAA 5A2QZ 2ZCWA 1LNWA 5A2QK 1LDDA 5E8GA 1U5TB 1IXSB 2RVCA 2G7HA 3D5LA 3E6DA 1J9IA 1XD7A 2XVCA 2YR2A 4LJZF 3VB2A 2EFOA 3QAHA 2PG4A 5ED4A 5JHUA 2ZMEA 4HDUA 2QM3A 5ICFA 1ZYRF 1ZREA 1ODDA 3WTVC 1Z7UA 2OQRA 3HTSB 1P2FA 2CW0F 3ERED 1G3WA 2BV6A 2OBPA 1SD7A 1OYWA 3QOPA 4G7OF 3MZHA 1L3LA 3WE3A 4G6QA 3GFLA 4YFXF 3I71A 1LEAA 3GW2A 5E17F 2OQGA 5DEQA 4WWCA 4BH9A 5E8IA 3VODA 3GLXA 3ROUA 4JBAA 2DI3A 4U88A 1ON1A 3P7NA 4HYEA 3EUHA 1Z6RA 4BXUA 1ZG3A 6PAXA 3H3UA 1IN6A 5BMZA 4ZH4F 2WV0A 1L0OC 2EWNA 2XAFA 1T6SA 4HF2A 1I6XA 1RNLA 3I54A 4EM1A 1WI9A 1BM9A 3GUDA 3HYIA 1BJAA 1FSHA 3ISPA 4YIFA 5CVIA 2ELHA 4YFNF 2J5OA 4HLYA 3I59B 4H0EA 5K5QA 3ZMVA 2XROA 2UXNA 5L3EA 5JFRA 1CF7B 3V7RA 3ZMDA 2X0LA 4HX7A 4RAZA 2A07F 1SAXA 1FPQA 3AAFA 2C6YA 2A69F 3TDZC 2R7DA 1Y0UA 3Q9SA 5HVQC 2LKPA 3JAMZ 4KT5C 3L00A 4M9XA 1XSDA 3JAMK 4MQVA 3J81Z 1PP7U 1Z6TA 4ON0A 2DK5A 3ZMUA 3J81K 2FQ3A 1R5GA 4LG0B 3HSFA 3WTTC 5D4RA 1FP1D 2STTA 4I02A 1IXRC 5LHIA 5D5XB 2CSOA 1XSXA 3H92A 2H27A 1RI7A 2CG4A 4HAMA 2E1NA 2VT3A 4I0BA 1HW1A 2W25A 4KICA 1F4KA 2G7UA 2FMYA 2DQRA 2H94A 2ISZA 2Q0OA 2EFPA 3I53A 2Z5UA 2F5EA 5J8FA 3FHZA 3F8BA 5DDGA 3WGGA 3LQRA 2ZMEB 3E5UA 3P9CA 3MFKA 1XN7A 1LDKB 2M45A 2HGCA 1OYIA 2EV5A 3CLOA 3GZ5A 1V4RA 3COAC 2CQKA 3IRRA 3B02A 4WF2A 3F3XA 5D6EA 4CXFA 3FF5A 2W84A 1ZAOA 2ZKZA 3NQOA 1SFXA 3L7WA 4HV6A 2A68F 4UHTA 2EK5A 4L5IA 5CVUA 2ISYA 3FMSA 1IZ1A 1J5YA 3BWGA 1R36A 2PMUA 3F22A 3SZTA 1YYVA 1W4MA 2VBYA 5H6QA 3T0YA 3R61A 4I98B 1FYKA 2RV8A 3V8KA 1XMAA 4IRHA 4U0VA 4G94A 2BBYA 1FBUA 2VBZA 2NNYA 3MEXA 4KDPA 2RKHA 1UHWA 2GWRA 3V8JA 1E2XA 1T0FA 4HBLA 1SMYF 1HKSA 5ICCA 2NNNA 2K7LA 1R7JA 3EETA 2M8EA 1A04A 4WX9A 2Z99A 5FFXA 5ICGA 2D1HA 2A5YB 1GXQA 3KEQA 5CVVA 2GAUA 2HEOA 2MBFA 2Y75A 4I01A 1P4WA 1PUEE 3QU6A 4HX8A 3BZ6A 3K9TA 5K5RA 2K4JA 1EV7A 2E7XA 4M9ZA 4HLXA 4AD9A 1HSJA 4RB3C 2P6TA 2VOPA 1JHFA 1XB4A 4XLPF 4A6DA 5E18F 1BIAA 4YFKF 2E7WA 3L09A 1D8JA 1SD6A 2DPUA 3K1NA 1O57A 3WTWC 2XHKA 4OIRF 1K7AA 3RYRA 3JW4A 2ESHA 3WGIA 3WTUC 1TNTA 5L3BA 3FWEA 1FY7A 2RN7A 3LSTA 2UZKA 3TOBA 2Y48A 4L9VA 1W7PA 3RKXA 2NS0A 5K1YA 5D4SA 1YTYA 2QQ9A 3HRUA 4G7HF 4ENNA 1OYYA 1XCBA 4IVNA 4EVIA 5HDKA 4OIQF 2QLZA 4NB5A 4FHTA 4NQWA 5ERIA 2VBXA 4IRGA 4KIGA 2IT0A 1HKTA 2Z3YA 3BJOA 3ML6A 3DXJF 3W6JB 2CWEA 2EA2A 1R5HA 4LMYA 2W24A 3FM3A 4DNCA 3ULQB 3GVAA 4S05A 1T98A 2PMHA 3QPHA 3HIFA 3SZPA 3BDDA 3KCCA 4Q5SF 4ZYGA 4PZJA 2HR3A 4MEYF 2FNPA 1YS7A 4BNCA 3SHFA 3ELKA 1MDMA 2QBYB 5K5OA 1U6GA 4WK8F 2JT1A 3M7GA 2XAQA 3WGHA 2XGXA 4OOIA 3LA3A 4M6XA 4UVCA 3R6SA 3LWFA 2PBIA 1XMKA 1ZARA 1TQPA 2QUFA 4I0AA 4S04A 4Y15A 4AIJA 1ZRCA 4AIHA 2CYYA 3LFKA 4JK1X 5EEGA 4GO1A 1WQ2A 2VODA 1T39A 3HRMA 1JE8A 3M1EA 1KA8A 2EV6A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4ZYH A;  3FMR A;  5DYM A;  1U3E M;  2BYV E;  5IT9 Z;  4KIF A;  1LQ1 A;  3BPX A;  5IT9 K;  3IRQ A;  2JTV A;  1EH6 A;  4WCG A;  1S29 A;  4P5O A;  2J5P A;  4CYD A;  4A6E A;  5LRS A;  1D8K A;  3KP5 A;  3ABT A;  3RJP A;  3BJA A;  1KYZ A;  1USS A;  4ENM A;  4IHS A;  2B0L A;  4CZZ A;  1MJA A;  5BQT A;  1FNN A;  1H0M A;  4Y13 A;  1R1T A;  1W7P B;  4UVA A;  5LGT A;  4MHG A;  1QZY A;  1B9N A;  4FX4 A;  2KJB A;  3ABU A;  2L4A A;  4QLC U;  3FXR A;  3U9G A;  5HLH A;  1YO5 C;  3GEZ A;  2O0Y A;  4LGW A;  5FLX Z;  3O6B B;  5DUK A;  1DP7 P;  5HS8 A;  5LHG A;  1LEB A;  5FLX K;  2FSW A;  1B9M A;  4D0P A;  1R1U A;  2IRF G;  1K78 A;  2OZ6 A;  4YII A;  1BI0 A;  4L9J A;  1T2K A;  2XUB A;  4LLN A;  3CUQ A;  1YIO A;  4JQF A;  1EH7 A;  4HQM A;  3KP4 A;  1MDM B;  2XAH A;  2CO5 A;  4Z2Y A;  2M1B A;  1QGP A;  3DFG A;  5BOX A;  3K1M A;  4EM0 B;  2HQN A;  4ENJ A;  1ZG1 A;  4IF4 A;  2Z33 A;  4A5N A;  2F5C A;  3F21 A;  3M8F A;  4WXH A;  1R1V A;  4EJO A;  3ECO A;  3P9K A;  5JVT A;  1CGP A;  4ETS A;  4L0Z B;  2F5D A;  3ZN1 A;  3KEO A;  3FXQ A;  4KMF A;  4G7Z F;  2V9V A;  3LAP A;  2HZT A;  2ETH A;  3HOS A;  1U5T C;  4ZYD A;  2FBI A;  2K27 A;  1J75 A;  4M74 A;  1U78 A;  4G9Y A;  3R60 A;  1ZRF A;  3BRO A;  4BAY A;  3I0T A;  5HLI A;  3ECH A;  2WC2 A;  2H6C A;  2JPC A;  3TKY A;  3RPU A;  2HKX A;  1KQ9 A;  1QO0 D;  3OOP A;  2K02 A;  1K6O A;  4M9S A;  1IN7 A;  2FBK A;  1ZGA A;  4MTE A;  1P4X A;  3MZY A;  3Q5F A;  3QU3 A;  1ZGJ A;  4IHT A;  3E6C C;  2GIV A;  5J6X A;  2P8T A;  2ACJ A;  2P5L C;  1KU7 A;  1O3T A;  2MLK A;  4L9N A;  3ZQ7 A;  1SD4 A;  4U7D A;  2DAO A;  2GA2 A;  2QYO A;  1ONV A;  3JTG A;  1XSV A;  2KIM A;  4RB0 A;  3DPT A;  4FT8 A;  1ZRD A;  1JGS A;  1FOK A;  1STZ A;  1OR7 A;  1G4D A;  1HW2 A;  2ZNZ A;  3IWZ A;  2VOO A;  2K86 A;  4M72 A;  2IJL A;  4YG2 F;  3EDP A;  1IUY A;  2K4B A;  1P6R A;  2P7V B;  3JTH A;  4A5M A;  4RB1 A;  1TW2 A;  2ZNY A;  2D1V A;  3C7J A;  1P92 A;  3CUQ B;  1FLI A;  2WTE A;  3GWZ A;  5LGU A;  4OIO F;  5DV5 A;  2FOK A;  4I2O A;  4L0Y B;  1TBX A;  5DCM A;  3P9I A;  1MJB A;  3KLN A;  2OA4 A;  4P55 A;  2ESN A;  2GA1 A;  1IAW A;  1JHH A;  3FZV A;  3C3W A;  1IW7 F;  1TQI A;  1XGM A;  5FFZ A;  5LBQ A;  2TDX A;  2KRF A;  4EJV A;  3MQ0 A;  3I64 A;  2L54 A;  1HQC A;  1O3S A;  2GXG A;  2IPQ X;  3JSO A;  4HF1 A;  3ZP5 A;  4PGH A;  5HS9 A;  4LB5 A;  5DUI A;  2Z9O A;  1BC7 C;  4UUV A;  1DPR A;  3BY6 A;  5D8L B;  3QP6 A;  1XDS A;  2GZW A;  2IVM A;  2JSC A;  4RGU A;  4OIN F;  4HV5 A;  2O3F A;  2NRA C;  4CO8 A;  5HDN A;  3GX4 X;  2MA3 A;  2EV0 A;  1YS6 A;  2W57 A;  2DK8 A;  3NEU A;  2O03 A;  2FF4 A;  1UHM A;  1QZZ A;  3CJN A;  3U2R A;  3V7S A;  1FYM A;  2FNA A;  2MD5 A;  2FXA A;  1RZ4 A;  2ZFW A;  5F1R A;  2YX7 A;  2DFI A;  4AIK A;  3F8M A;  3R0A A;  2HDC A;  4CGZ A;  3DPL C;  1O7L A;  5HS7 A;  2ZJ2 A;  2OU2 A;  1G3Y A;  2FRH A;  4KIB A;  1PDN C;  2NYX A;  5AON A;  1XCV A;  3WOD F;  3IKT A;  4XRF A;  1FC3 A;  4MNU A;  5HDG A;  2V79 A;  2BEO A;  3K2Z A;  4GYG A;  2R7F A;  1ZLJ A;  1KYW A;  4ESB A;  4A0X A;  1YG2 A;  3R0J A;  2GXB A;  2V1X A;  2YU3 A;  3GFJ A;  1BI3 A;  1O3R A;  4TV7 A;  3F23 A;  3WU1 B;  1TQM A;  1QQI A;  4XSZ F;  1W5T A;  5D6F A;  2M5W A;  3FMQ A;  1VTN C;  3C1D A;  3M8E A;  4MEX F;  4LK0 F;  3RKY A;  2WWY A;  1FX7 A;  4I09 A;  3DQV C;  1B1B A;  3REO A;  3FM5 A;  1HW5 A;  4EV0 A;  2W85 A;  2LF7 A;  5FD5 A;  1U8R A;  1ZG5 A;  1OMI A;  1HBX G;  1UFM A;  1JXS A;  3RDI A;  2VBW A;  1YW7 A;  3G3Z A;  4R8H A;  2STW A;  3N97 A;  3KET A;  3IL2 A;  1I5Z A;  4KMU X;  4L5J A;  5TJJ A;  1BIB A;  4HOB A;  1SFE A;  4B09 A;  2KIU A;  1D3Y A;  2QEN A;  4RGR A;  1ON2 A;  2LNB A;  2L3D A;  2HFH A;  2DTR A;  5KK1 A;  2F5F A;  2XRN A;  3E5Q A;  1T38 A;  2COM A;  1R58 A;  3H3Z A;  2HTS A;  5CYV A;  2Y0M A;  1FYL A;  4MGR A;  4GYI A;  3L2C A;  3VEP A;  3CO6 C;  1RUO A;  4EM2 A;  5CJ9 A;  3QPT A;  3F8N A;  2QZ8 A;  1HXD A;  1OKR A;  2HOE A;  1C0W A;  1ZH5 A;  4EJT A;  2X4H A;  3ZPL A;  1IN4 A;  1QPM A;  2VXZ A;  1SMT A;  4KA4 A;  4Q47 A;  1MKM A;  1UB9 A;  3KP2 A;  1W7P D;  3SQN A;  3CDH A;  4M71 A;  2XAJ A;  5LRR A;  1YFH A;  2EFN A;  1B4A A;  4M73 A;  3HUG A;  3RPQ A;  1LVA A;  1KGS A;  1G3T A;  3WU0 A;  3G73 A;  1UCR A;  3E3V A;  2VON A;  3GF2 A;  3GFI A;  1FBQ A;  4GXO A;  4QWQ A;  3F8F A;  5DD8 A;  2PLY A;  3I59 A;  4IJA A;  4EGY A;  4LFU A;  2FA5 A;  3MCZ A;  3HRT A;  3T5X A;  2HS5 A;  1DDN A;  4L18 B;  1CF7 A;  2A6E F;  3KP7 A;  3J7A O;  2AS5 F;  2DBB A;  2VC0 A;  2MH2 A;  5H6R A;  4AWX B;  5DCF A;  1WRJ A;  2DW4 A;  1MGT A;  1FP2 A;  4HA8 A;  1REP C;  3KZZ A;  2A61 A;  5ILU A;  3OV8 A;  4GCV A;  4HW0 A;  3K69 A;  5D5V B;  3GXO A;  2L01 A;  1KU2 A;  3HSE A;  4UV9 A;  4BQA A;  4WXC A;  1E17 A;  1WSU A;  1BI1 A;  2V1D A;  1B6A A;  4LG0 A;  2KIF A;  2VE8 A;  5LEJ A;  2P7C B;  3KLO A;  2VT2 A;  3ZN0 A;  1R00 A;  4PCQ A;  5EEH A;  2XKP A;  1D5V A;  4RGS A;  2YX4 A;  2IA0 A;  5F64 A;  2HYF A;  1ZN2 A;  3V4G A;  3CO7 C;  1KU3 A;  4M6Y A;  3IHU A;  4IPA A;  1WWX A;  1LDJ A;  4KYW A;  2RNJ A;  5D8K B;  4Y17 A;  1I1G A;  2QVO A;  2L4M A;  1BN5 A;  1SD5 A;  1EH8 A;  2PQ8 A;  3GYH X;  2MH9 A;  5CLS A;  3HOT A;  3E5X A;  4RAY A;  2FE3 A;  5KVR A;  2L02 A;  3V8L A;  3D0S A;  5ILS A;  3KFW X;  2MC3 A;  3WG9 A;  3HHG A;  5JI6 A;  4KNY A;  2PN6 A;  2KKO A;  3SFZ A;  2PEX A;  4U0W A;  4EQQ A;  1BI2 A;  1YLF A;  4RGX A;  1AOY A;  4U7B A;  2V6C A;  2E1C A;  3RI4 A;  4ESF A;  4MTD A;  3MAJ A;  2KJC A;  3PQJ A;  1O3Q A;  1FT9 A;  2H6B A;  3KP6 A;  3EYY A;  1ULY A;  4ZZD A;  5H20 A;  4ENK A;  3ZMT A;  1G3S A;  2JRT A;  3C18 A;  1RUN A;  2MLG A;  1W5S A;  3GFM A;  4OIP F;  5ICE A;  2OZU A;  5IT3 A;  1DUX C;  2EA4 A;  1J2X A;  4UV8 A;  3BJ6 A;  3BP8 A;  2LF8 A;  4A2U A;  2PI0 A;  1R23 A;  3VFZ A;  4LK1 F;  3SXY A;  3B73 A;  5HOO A;  4UVB A;  1J0R A;  1SFU A;  5L3F A;  3DF8 A;  1OPC A;  3TOA A;  3K0L A;  4HZF A;  3I58 A;  1GVJ A;  4LLG F;  1S3J A;  4A0Z A;  4R1H A;  3HSR A;  1H9G A;  2EB7 A;  2HWV A;  1TNS A;  3I5U A;  1GXP A;  5BPD A;  3WTZ A;  3KP3 A;  2XKO A;  1K78 B;  2XAS A;  1PP8 F;  2A6H F;  4P96 A;  5FGM A;  4F7Z A;  3KZY A;  2GQQ A;  2XV4 S;  3TO6 A;  1F9N A;  3BPV A;  3NRV A;  2FBH A;  2QWW A;  5AIQ A;  2DO7 A;  4LLL A;  4BHP A;  5E1X A;  5BS6 A;  3F6O A;  3TDU C;  5E1W A;  1IRG A;  4EGZ A;  3QRF F;  2EJR A;  1YW8 A;  2O61 A;  4OMZ A;  1J59 A;  4ZYE A;  3TQN A;  4P9U A;  2DLL A;  2NAZ A;  1I27 A;  4K2E A;  4L9T A;  5ILV A;  1LB2 A;  1Z91 A;  2CFX A;  2VC1 A;  3LA2 A;  4RB2 C;  3WE2 A;  2UWM A;  1H9T A;  1UST A;  2UXX A;  4R79 A;  2YSR A;  1V3F A;  4EJW A;  2HYG D;  2R3S A;  5E1Z B;  3BOQ A;  3TGN A;  4MQ9 F;  5LEK A;  2LDU A;  2QQA A;  5J8C A;  2H09 A;  2Q2E A;  1QBJ A;  3M9A A;  1HST A;  3WTS C;  4O6J A;  4PGG A;  2DPD A;  4XBF A;  1O7F A;  1G6N A;  5D5W B;  3WTY C;  3CUQ C;  4XLN F;  1NHA A;  4DQ2 A;  2HTJ A;  2RC4 A;  2G9W A;  2IA1 A;  1K79 A;  4CHU A;  2RGV A;  5DD4 A;  3EQL F;  4FX0 A;  3WTX C;  1IN5 A;  4ESJ A;  2FML A;  5TRD A;  5LGN A;  2M30 A;  3V7C A;  4XSX F;  4KFC A;  3J80 Z;  1QNT A;  5L3D A;  4HDV A;  3F72 A;  5L3G A;  1FBS A;  4BYY A;  1MZB A;  3J80 K;  3T8R A;  4BHC A;  1XGN A;  1KQ8 A;  1X3U A;  2DQL A;  4AVP A;  2QBY A;  3IWF A;  2VE9 A;  2O8X A;  1MJ9 A;  4G8X A;  2RQP A;  1XGS A;  3FXU A;  3MWM A;  3LA7 A;  2XIG A;  1TTY A;  3TO9 A;  2JPB A;  3R4K A;  4CIC A;  3E6B A;  2A3S A;  4OU0 A;  4I7H A;  5FB2 A;  3O3K A;  2XAG A;  1RIO H;  2FU4 A;  2VN2 A;  4GGG A;  2IW5 A;  3F8C A;  5LHH A;  4A12 A;  2FEZ A;  4UXN A;  2V1U A;  2P5V A;  4O3M A;  1S6L A;  1Q1H A;  1Z9C A;  1TLH B;  1BBY A;  3VOE A;  1AWC A;  5DCM B;  1S7O A;  1Z05 A;  3E97 A;  1KQ0 A;  2YPR A;  3GO5 A;  2HKO A;  1WKM A;  1TW3 A;  4HQE A;  4G6D A;  4IRI A;  4WXD A;  5CVR A;  3QP5 A;  3JSP A;  2Q8K A;  4LB6 B;  3K1P A;  3DKW A;  2OD5 A;  1IXC A;  1IF1 A;  1FWZ A;  2EFQ A;  5F6F A;  1I1S A;  2BGC A;  5FO5 A;  1KU9 A;  2D2W A;  2ZXJ A;  4U0Y A;  1ZLK A;  5LLQ A;  5L3C A;  3RYP A;  3N4M A;  5CVJ A;  5E20 A;  3L9F A;  2EFW A;  1IN8 A;  3KE2 A;  3I4P A;  1YQA A;  2M87 A;  3Q9V A;  2QQB A;  1U5T A;  1S7A A;  4LD5 A;  4N9I A;  3RKW A;  3CUO A;  5FD6 A;  3HTU A;  4ASN A;  5JR3 A;  4EMS A;  2F2E A;  1P4A A;  1GHC A;  3TO7 A;  1BC8 C;  2IP2 A;  3LAJ A;  2P5K A;  4IXA A;  2P6S A;  3DP7 A;  4UNO A;  4HF0 A;  4E70 A;  2IA2 A;  2O6G E;  2DT5 A;  4A0Y A;  3LQQ A;  4KN7 X;  1YW9 A;  4O5V A;  1B59 A;  4Q48 A;  3FX3 A;  4RS8 A;  3E6M A;  2PFB A;  2D45 A;  1F1Z A;  4EJU A;  4B8X A;  3T1B A;  3PQK A;  1HKQ A;  1ZHF A;  1LJ9 A;  2ZO4 A;  4P9F A;  2BE5 F;  5BPI A;  2ZBK A;  4NHJ A;  4ZZL A;  3HRS A;  4HX4 A;  3U1D A;  3GZ6 A;  4Q4Z F;  4OMY A;  2HQR A;  1MD0 A;  1F5T A;  3EYI A;  2PJP A;  1U2W A;  3IKV A;  1FSE A;  3DV8 A;  2CGP A;  3RTR A;  2OAZ A;  3IC7 A;  4N0B A;  3DEU A;  1XGO A;  1J7K A;  5HLG A;  3HHH A;  2JZY A;  2RDP A;  4KN4 X;  1XDU A;  3S2W A;  3RIR A;  5AIP A;  1S8N A;  1R22 A;  5D5U B;  4CDG A;  4BHB A;  3CTA A;  4N9H A;  2DU9 A;  4KUM A;  3O2P E;  3ZMS A;  4PDK A;  1FZP B;  3W6K B;  2P4W A;  2AXL A;  2ADU A;  2LSO A;  3F6V A;  1Z1D A;  3T8T A;  3ZMZ A;  1DPU A;  3PFI A;  1IRF A;  1BOA A;  5A2Q Z;  2ZCW A;  1LNW A;  5A2Q K;  1LDD A;  5E8G A;  1U5T B;  1IXS B;  2RVC A;  2G7H A;  3D5L A;  3E6D A;  1J9I A;  1XD7 A;  2XVC A;  2YR2 A;  4LJZ F;  3VB2 A;  2EFO A;  3QAH A;  2PG4 A;  5ED4 A;  5JHU A;  2ZME A;  4HDU A;  2QM3 A;  5ICF A;  1ZYR F;  1ZRE A;  1ODD A;  3WTV C;  1Z7U A;  2OQR A;  3HTS B;  1P2F A;  2CW0 F;  3ERE D;  1G3W A;  2BV6 A;  2OBP A;  1SD7 A;  1OYW A;  3QOP A;  4G7O F;  3MZH A;  1L3L A;  3WE3 A;  4G6Q A;  3GFL A;  4YFX F;  3I71 A;  1LEA A;  3GW2 A;  5E17 F;  2OQG A;  5DEQ A;  4WWC A;  4BH9 A;  5E8I A;  3VOD A;  3GLX A;  3ROU A;  4JBA A;  2DI3 A;  4U88 A;  1ON1 A;  3P7N A;  4HYE A;  3EUH A;  1Z6R A;  4BXU A;  1ZG3 A;  6PAX A;  3H3U A;  1IN6 A;  5BMZ A;  4ZH4 F;  2WV0 A;  1L0O C;  2EWN A;  2XAF A;  1T6S A;  4HF2 A;  1I6X A;  1RNL A;  3I54 A;  4EM1 A;  1WI9 A;  1BM9 A;  3GUD A;  3HYI A;  1BJA A;  1FSH A;  3ISP A;  4YIF A;  5CVI A;  2ELH A;  4YFN F;  2J5O A;  4HLY A;  3I59 B;  4H0E A;  5K5Q A;  3ZMV A;  2XRO A;  2UXN A;  5L3E A;  5JFR A;  1CF7 B;  3V7R A;  3ZMD A;  2X0L A;  4HX7 A;  4RAZ A;  2A07 F;  1SAX A;  1FPQ A;  3AAF A;  2C6Y A;  2A69 F;  3TDZ C;  2R7D A;  1Y0U A;  3Q9S A;  5HVQ C;  2LKP A;  3JAM Z;  4KT5 C;  3L00 A;  4M9X A;  1XSD A;  3JAM K;  4MQV A;  3J81 Z;  1PP7 U;  1Z6T A;  4ON0 A;  2DK5 A;  3ZMU A;  3J81 K;  2FQ3 A;  1R5G A;  4LG0 B;  3HSF A;  3WTT C;  5D4R A;  1FP1 D;  2STT A;  4I02 A;  1IXR C;  5LHI A;  5D5X B;  2CSO A;  1XSX A;  3H92 A;  2H27 A;  1RI7 A;  2CG4 A;  4HAM A;  2E1N A;  2VT3 A;  4I0B A;  1HW1 A;  2W25 A;  4KIC A;  1F4K A;  2G7U A;  2FMY A;  2DQR A;  2H94 A;  2ISZ A;  2Q0O A;  2EFP A;  3I53 A;  2Z5U A;  2F5E A;  5J8F A;  3FHZ A;  3F8B A;  5DDG A;  3WGG A;  3LQR A;  2ZME B;  3E5U A;  3P9C A;  3MFK A;  1XN7 A;  1LDK B;  2M45 A;  2HGC A;  1OYI A;  2EV5 A;  3CLO A;  3GZ5 A;  1V4R A;  3COA C;  2CQK A;  3IRR A;  3B02 A;  4WF2 A;  3F3X A;  5D6E A;  4CXF A;  3FF5 A;  2W84 A;  1ZAO A;  2ZKZ A;  3NQO A;  1SFX A;  3L7W A;  4HV6 A;  2A68 F;  4UHT A;  2EK5 A;  4L5I A;  5CVU A;  2ISY A;  3FMS A;  1IZ1 A;  1J5Y A;  3BWG A;  1R36 A;  2PMU A;  3F22 A;  3SZT A;  1YYV A;  1W4M A;  2VBY A;  5H6Q A;  3T0Y A;  3R61 A;  4I98 B;  1FYK A;  2RV8 A;  3V8K A;  1XMA A;  4IRH A;  4U0V A;  4G94 A;  2BBY A;  1FBU A;  2VBZ A;  2NNY A;  3MEX A;  4KDP A;  2RKH A;  1UHW A;  2GWR A;  3V8J A;  1E2X A;  1T0F A;  4HBL A;  1SMY F;  1HKS A;  5ICC A;  2NNN A;  2K7L A;  1R7J A;  3EET A;  2M8E A;  1A04 A;  4WX9 A;  2Z99 A;  5FFX A;  5ICG A;  2D1H A;  2A5Y B;  1GXQ A;  3KEQ A;  5CVV A;  2GAU A;  2HEO A;  2MBF A;  2Y75 A;  4I01 A;  1P4W A;  1PUE E;  3QU6 A;  4HX8 A;  3BZ6 A;  3K9T A;  5K5R A;  2K4J A;  1EV7 A;  2E7X A;  4M9Z A;  4HLX A;  4AD9 A;  1HSJ A;  4RB3 C;  2P6T A;  2VOP A;  1JHF A;  1XB4 A;  4XLP F;  4A6D A;  5E18 F;  1BIA A;  4YFK F;  2E7W A;  3L09 A;  1D8J A;  1SD6 A;  2DPU A;  3K1N A;  1O57 A;  3WTW C;  2XHK A;  4OIR F;  1K7A A;  3RYR A;  3JW4 A;  2ESH A;  3WGI A;  3WTU C;  1TNT A;  5L3B A;  3FWE A;  1FY7 A;  2RN7 A;  3LST A;  2UZK A;  3TOB A;  2Y48 A;  4L9V A;  1W7P A;  3RKX A;  2NS0 A;  5K1Y A;  5D4S A;  1YTY A;  2QQ9 A;  3HRU A;  4G7H F;  4ENN A;  1OYY A;  1XCB A;  4IVN A;  4EVI A;  5HDK A;  4OIQ F;  2QLZ A;  4NB5 A;  4FHT A;  4NQW A;  5ERI A;  2VBX A;  4IRG A;  4KIG A;  2IT0 A;  1HKT A;  2Z3Y A;  3BJO A;  3ML6 A;  3DXJ F;  3W6J B;  2CWE A;  2EA2 A;  1R5H A;  4LMY A;  2W24 A;  3FM3 A;  4DNC A;  3ULQ B;  3GVA A;  4S05 A;  1T98 A;  2PMH A;  3QPH A;  3HIF A;  3SZP A;  3BDD A;  3KCC A;  4Q5S F;  4ZYG A;  4PZJ A;  2HR3 A;  4MEY F;  2FNP A;  1YS7 A;  4BNC A;  3SHF A;  3ELK A;  1MDM A;  2QBY B;  5K5O A;  1U6G A;  4WK8 F;  2JT1 A;  3M7G A;  2XAQ A;  3WGH A;  2XGX A;  4OOI A;  3LA3 A;  4M6X A;  4UVC A;  3R6S A;  3LWF A;  2PBI A;  1XMK A;  1ZAR A;  1TQP A;  2QUF A;  4I0A A;  4S04 A;  4Y15 A;  4AIJ A;  1ZRC A;  4AIH A;  2CYY A;  3LFK A;  4JK1 X;  5EEG A;  4GO1 A;  1WQ2 A;  2VOD A;  1T39 A;  3HRM A;  1JE8 A;  3M1E A;  1KA8 A;  2EV6 A; 
#chains in the Genus database with same CATH topology
 4ZYH A;  1GDT A;  1D1A A;  3FMR A;  3ONQ A;  5DYM A;  3I55 I;  1U3E M;  3GTO J;  1FTZ A;  2BYV E;  4E6K G;  4HNV A;  3HBL A;  4X1E A;  4CYC A;  5IT9 Z;  4KIF A;  1LQ1 A;  1G2H A;  3BPX A;  1LE8 A;  1ENH A;  3IRQ A;  4P1W A;  5IT9 K;  4FE7 A;  2JTV A;  4ZC3 A;  3H5A A;  1EH6 A;  2OJE D;  2RAE A;  4IHW A;  2KHM A;  1S29 A;  4P5O A;  4WCG A;  2J5P A;  4CYD A;  3J7A Y;  4E7H A;  1Z77 A;  1GVD A;  4UUT A;  4A6E A;  1WFX A;  5LRS A;  1HA8 A;  1YJW I;  1D8K A;  2LH9 A;  3KP5 A;  3ABT A;  3RJP A;  3O8G A;  3A4C A;  3BJA A;  1KYZ A;  1V5F A;  1ZEL A;  1USS A;  4ENM A;  4IHS A;  2B0L A;  4CZZ A;  4BDZ A;  1MJA A;  2XPU A;  4ZDL A;  2L9R A;  5BQT A;  1FNN A;  2JUG A;  2M7A A;  1H0M A;  3A01 A;  4Y13 A;  1R1T A;  1W7P B;  1VQ4 I;  2AQF A;  4UVA A;  1X1A A;  5LGT A;  4MHG A;  4A3M J;  1QZY A;  3S1N J;  3U1K A;  1B9N A;  4FX4 A;  1RR7 A;  2DTZ A;  2KJB A;  3ABU A;  4KJZ A;  3GTP J;  2L4A A;  2W00 A;  4QLC U;  3WU2 C;  4XOR A;  1X1D A;  3HOZ J;  2XB0 X;  3FXR A;  5FKM A;  1E3P A;  3U9G A;  5HLH A;  1VQ8 I;  1YO5 C;  4IQ4 A;  1MNE A;  4NQW B;  3GEZ A;  4X0G A;  2BHZ A;  2O0Y A;  4LGW A;  5FLX Z;  3S14 J;  2LG4 A;  3CJR B;  1WPK A;  2ZSI B;  3O6B B;  5DUK A;  2HNH A;  1RRJ A;  3VPR A;  4M3B A;  1DP7 P;  5HS8 A;  3KPH A;  5LHG A;  1LEB A;  2KQR A;  5FLX K;  4C3I J;  1RKW A;  2FSW A;  1B9M A;  5EGO B;  4D0P A;  2FX0 A;  1R1U A;  2IRF G;  5HNF A;  1K78 A;  2OZ6 A;  3S1Q J;  4PFO A;  2GLO A;  4YII A;  4W97 A;  1Z67 A;  1BI0 A;  3OR1 C;  4L9J A;  1S7E A;  1VQ6 I;  1T2K A;  2X9D A;  2XUB A;  4LLN A;  3C2H A;  2VXD A;  3CUQ A;  3FKI J;  1YIO A;  3EPZ A;  1K83 J;  2BHY A;  4JQF A;  4DW6 A;  2GOM A;  1EH7 A;  4HQM A;  3M4O J;  3KP4 A;  2EZK A;  1MDM B;  2XAH A;  2CO5 A;  1N75 A;  3NAU A;  2NOJ B;  2LTP A;  2GOX B;  2M1B A;  4Z2Y A;  4BJ5 C;  3OL4 A;  1QGP A;  2XDV A;  3DFG A;  5BOX A;  1YIT I;  3K1M A;  2E36 A;  4ITV A;  2EZH A;  2CS3 A;  4IL6 C;  4GDF A;  4EM0 B;  2AQE A;  2HQN A;  4ENJ A;  1DGR M;  1ZG1 A;  4IF4 A;  2Z33 A;  1B8I B;  2NVY J;  4A5N A;  2E34 A;  2F5C A;  1AKH B;  2MD0 A;  1WH5 A;  3F21 A;  2K3F A;  3ASO H;  3M8F A;  4A3K J;  3MKL A;  5M5Y J;  3ZQI A;  4WXH A;  1R1V A;  3HPG A;  3J7Y J;  4EJO A;  1X58 A;  2LY2 A;  3ECO A;  3P9K A;  5JVT A;  1CGP A;  3K4K A;  4ETS A;  1DQU A;  4L0Z B;  3AG1 H;  5B3S H;  5KNL A;  1SAU A;  2F5D A;  3ZN1 A;  3BG3 A;  2R93 J;  3KEO A;  3ZCO A;  4C2T A;  1VF9 A;  3FXO A;  3FXQ A;  2VLA A;  4KMF A;  4G7Z F;  2V9V A;  2WY7 Q;  1UHS A;  3LAP A;  1SFO J;  2HZT A;  2KL4 A;  3H9Q A;  2ETH A;  2XF6 A;  1IUF A;  3HOS A;  2HI3 A;  1U5T C;  3FHN A;  4CYC B;  4ZYD A;  1RES A;  2FBI A;  2K27 A;  1J75 A;  2R0Q C;  4M74 A;  1U78 A;  2RRE A;  3H35 A;  4G9Y A;  3MVP A;  3R60 A;  4E7L A;  1LE8 B;  1ZRF A;  3AFH A;  2DFF A;  3BRO A;  4BAY A;  3I0T A;  4IHY A;  2NVX J;  1OFC X;  5HLI A;  2HOS A;  1IO2 A;  3ECH A;  2WC2 A;  2N8G A;  1YX3 A;  2OTJ I;  2H6C A;  2JPC A;  3TKY A;  3RPU A;  2HKX A;  3CCS I;  1KQ9 A;  3DLA A;  4AU7 A;  1QO0 D;  3ZQC A;  2YU9 J;  3OOP A;  2K02 A;  1K6O A;  4M9S A;  1IN7 A;  3DTK A;  2FBK A;  3HOX J;  1ZGA A;  4MTE A;  3OYL A;  1Z21 A;  1P4X A;  3MZY A;  3Q5F A;  2L7M P;  3QU3 A;  3L1P A;  1ZGJ A;  4DZJ A;  3KX2 A;  4IHT A;  3E6C C;  2GIV A;  5J6X A;  3A02 A;  1JUS A;  2P8T A;  4BS9 A;  2KP6 A;  1WJ5 A;  2ACJ A;  1ACI A;  2CW8 A;  2P5L C;  1ZR4 A;  3GTM J;  1E3H A;  1KU7 A;  1ERD A;  2PJR A;  1O3T A;  2MLK A;  2XGE A;  1NG6 A;  4FCY A;  3L2Q A;  3OYI A;  2LK2 A;  4L9N A;  3H3V K;  3BQZ A;  3ZQ7 A;  4M3G A;  1SD4 A;  3W3C A;  1DP3 A;  4U7D A;  4C2U A;  4RBO A;  3LFU A;  2DAO A;  3S1R J;  3HJE A;  2GA2 A;  2QYO A;  4N4O B;  4JOM A;  4A3F J;  1ONV A;  3OYN A;  4HNU A;  3JTG A;  1XSV A;  2CUZ A;  2KIM A;  2UV1 A;  4RB0 A;  3FIW A;  4XLF A;  3DPT A;  4FT8 A;  1ZRD A;  1JGS A;  1FOK A;  1OCT C;  1STZ A;  1OR7 A;  1G4D A;  1HW2 A;  1YRN A;  2ZNZ A;  3IWZ A;  2VOO A;  2KRC A;  2QCO A;  3S1M J;  2K86 A;  2R7R A;  3BG5 A;  4M72 A;  3EUA A;  3JRF A;  2IJL A;  4YG2 F;  4XON A;  3EDP A;  2LRE A;  3VYS B;  2OC6 A;  1ETK A;  2WB1 A;  1IUY A;  2K4B A;  1P6R A;  1TWF J;  3S2H J;  3AL0 B;  3BG7 A;  2P7V B;  1I3A A;  3JTH A;  3CC4 I;  1X1P A;  1VI0 A;  4A5M A;  4RB1 A;  1TW2 A;  2WB1 N;  3K10 A;  2ZNY A;  2ZXH A;  1R71 A;  2D1V A;  3C7J A;  1P92 A;  3CUQ B;  2DOF A;  3PM1 A;  5GP9 A;  1E0E A;  1FLI A;  5FLM J;  1VQP I;  4E7S A;  2IAI A;  2XB5 A;  3PSI A;  2DXI A;  2WTE A;  3GWZ A;  1W36 D;  2LP0 A;  3JRD A;  5LGU A;  4OIO F;  3KIO A;  5DV5 A;  3HM5 A;  2FOK A;  2V6E A;  4I2O A;  1FOX A;  4L0Y B;  4NC6 A;  1TBX A;  5DCM A;  3BZC A;  3P9I A;  3HDD A;  1UJ8 A;  1MJB A;  3KLN A;  2OA4 A;  4P55 A;  4U87 A;  3TW6 A;  4F93 B;  1K61 A;  1BW6 A;  1WVR A;  2ESN A;  1MBJ A;  3CDL A;  2GA1 A;  1IAW A;  1JHH A;  2DA6 A;  3RQ4 A;  3FZV A;  3C3W A;  1IW7 F;  2CUJ A;  4ZTJ A;  5F0F A;  1TQI A;  1XGM A;  5FFZ A;  3LSR A;  5LBQ A;  2TDX A;  2KRF A;  4EJV A;  3MQ0 A;  3I64 A;  2L54 A;  1HQC A;  2W7N A;  1O3S A;  2GXG A;  2IPQ X;  3JSO A;  4HF1 A;  3OR2 C;  2Z1D A;  4HNT A;  4IKF A;  3ZP5 A;  4PGH A;  3BR1 A;  5HS9 A;  3HOU J;  3QOE A;  4LB5 A;  1NK2 P;  5DUI A;  2H8W A;  2Z9O A;  1BC7 C;  4UUV A;  1MND A;  2CW7 A;  1DPR A;  2EQR A;  3BY6 A;  3DKX A;  3QP6 A;  5D8L B;  3RSN A;  1K4S A;  1N25 A;  1R4N B;  2MG4 A;  3MKZ A;  1XDS A;  2GZW A;  5DTD A;  4BBR J;  3BLY A;  2BY0 A;  2IVM A;  2JSC A;  2KIS A;  4RGU A;  4XN0 A;  4OIN F;  4BGD A;  3RZD J;  1JUP A;  4FQG A;  2LBF A;  4HV5 A;  2O3F A;  2NRA C;  3A03 A;  4CO8 A;  3GTQ J;  2M8G X;  3CF5 F;  4NC8 A;  5GAH J;  5HDN A;  3GX4 X;  2BZT A;  2MA3 A;  2LRD A;  2EV0 A;  1YS6 A;  2W57 A;  2DK8 A;  3FBI B;  5IP9 J;  3NEU A;  3UR3 C;  2O03 A;  2FF4 A;  1D0X A;  4IO9 F;  1UHM A;  1QZZ A;  3DEW A;  3I3L A;  2ZME C;  3CJN A;  3U2R A;  3V7S A;  1BOB A;  1FYM A;  2FNA A;  5EYR A;  2MD5 A;  2FXA A;  1RZ4 A;  1MBF A;  2ZFW A;  5F1R A;  2CV2 A;  2JA8 J;  2YX7 A;  1R5I D;  3UKG A;  1LVK A;  1X2M A;  2DFI A;  4AIK A;  3C2B A;  3F8M A;  2BVL A;  3R0A A;  2HDC A;  4CGZ A;  3CCV I;  3DPL C;  2PJR B;  1O7L A;  1VQK I;  5HS7 A;  5GPC A;  2E2H J;  1WJB A;  2ZJ2 A;  2OU2 A;  3PJR A;  1G3Y A;  2O8K A;  4UY8 I;  3CD6 I;  2FRH A;  4KIB A;  5B66 C;  4H4K C;  1PDN C;  3FXK A;  5KAF C;  1A36 A;  5EJC A;  2NYX A;  5AON A;  4UUS A;  1B72 B;  1Y8R B;  2R7V A;  1XCV A;  2L9V A;  2X1E A;  1ETX A;  3WOD F;  1Y6I A;  4BBS J;  3IKT A;  4XRF A;  2VPL A;  5FKN A;  1FC3 A;  1U8B A;  4OAZ A;  4MNU A;  2LLK A;  5HDG A;  2DFE A;  2V79 A;  1WZ2 A;  2JJ7 A;  1IRX A;  2BEO A;  3K2Z A;  4GYG A;  2D5V A;  2KIQ A;  3DU5 A;  2R7F A;  1ZLJ A;  4B3X A;  1X2N A;  5B1B H;  2BY3 A;  1KYW A;  4ESB A;  4A0X A;  3G2B A;  1YG2 A;  3R0J A;  1QU3 A;  2GXB A;  2V1X A;  1HDP A;  2YU3 A;  3GFJ A;  1BI3 A;  4E7I A;  1O3R A;  4TV7 A;  3F23 A;  3WU1 B;  1TQM A;  1Y39 A;  1JTX A;  1T56 A;  1QQI A;  4M3D A;  4XSZ F;  1W5T A;  5D6F A;  4A3L J;  2M5W A;  3SYT A;  3FMQ A;  4BE2 A;  1VTN C;  2KMU A;  3DWL E;  3C1D A;  3M8E A;  4MEX F;  2MC4 A;  4LK0 F;  1TL8 A;  3RKY A;  2WWY A;  3M1C A;  1FX7 A;  2XAU A;  1OCO H;  4I09 A;  3FBN B;  3H5R A;  3DQV C;  1B1B A;  4CCO A;  3CCQ I;  1P7I A;  3K7A J;  4ANJ A;  1X4P A;  3KYL A;  3REO A;  3CMY A;  2LMD A;  3OYH A;  3FM5 A;  2VIX A;  4C9Y A;  4AM3 A;  2F4I A;  3TMO A;  1HW5 A;  4ZTF A;  2LOO A;  4EV0 A;  2W85 A;  1ETY A;  5K7F A;  4YEL A;  1I50 J;  2M4G A;  1EJ9 A;  1ZK8 A;  2WAF A;  1MBH A;  1YOV B;  2LF7 A;  5FD5 A;  3KYC B;  1ZR2 A;  4RDU A;  1U8R A;  1ZG5 A;  1OMI A;  3SEQ A;  1HBX G;  2PX9 A;  3GTJ J;  1UFM A;  2DT6 A;  3ASN H;  1JXS A;  3RDI A;  4PSW A;  2VBW A;  1FMW A;  4HPQ A;  4BEH A;  1YW7 A;  3G3Z A;  4R8H A;  2WA0 A;  2HPM A;  2STW A;  2VB6 A;  3FK7 A;  1FJL A;  4B4C A;  3N97 A;  2KLO A;  2KDO A;  2LBF B;  4ZYA A;  2RQQ A;  1HDD C;  5HOD A;  4C30 A;  2Y31 A;  3KET A;  1RC9 A;  1WJD A;  5C3E J;  3IL2 A;  1PYV A;  1I5Z A;  4KMU X;  1MBE A;  4L5J A;  5TJJ A;  3NWS A;  3OYC A;  1BIB A;  4CCN A;  1J09 A;  4QIW N;  4HOB A;  1K6Y A;  3E1S A;  1SFE A;  4F55 A;  3K4J A;  4B09 A;  1G59 A;  2KIU A;  4M3F A;  5J4Y A;  1D3Y A;  2QEN A;  3DBR B;  1ON2 A;  4RGR A;  3Q0W A;  2LNB A;  5EEA A;  1WGX A;  2H1K A;  3S17 J;  2L3D A;  5HLT A;  2HFH A;  2DTR A;  3CCL I;  1JKO C;  3I4N J;  2DCE A;  5KK1 A;  2F5F A;  2XRN A;  3E5Q A;  5B5E C;  1T38 A;  2W4S A;  3ZRG A;  2COM A;  2XSJ C;  1R58 A;  3H3Z A;  2HTS A;  3GZN B;  4Y52 J;  5CYV A;  2Y0M A;  1FYL A;  1AU7 A;  3BTJ A;  4MFE A;  4MGR A;  4II2 A;  4GYI A;  3L2C A;  2WBM A;  1OCZ H;  2GXA A;  3VEP A;  2XF5 A;  1S5L C;  3CO6 C;  2XSD C;  3BR6 A;  1RUO A;  3G1L A;  2EPF A;  3LSM A;  4EM2 A;  4M3E A;  2JN6 A;  5CJ9 A;  2KRH A;  1BR4 A;  3QPT A;  2M2E A;  3F8N A;  3FIS A;  1M1E B;  1UAA A;  2QZ8 A;  2LD5 A;  5FLV A;  1HXD A;  1OKR A;  2HOE A;  2DDB A;  4BXF A;  3LSG A;  5CQG A;  1C0W A;  1ZH5 A;  1A31 A;  4EJT A;  1XTA A;  4RA2 A;  2X4H A;  3ZPL A;  1IN4 A;  1QPM A;  3MMY B;  1DU6 A;  3DKY A;  1SAN A;  1SMT A;  2VXZ A;  3TP3 A;  4KA4 A;  4Q47 A;  1MKM A;  1UB9 A;  3KP2 A;  1W7P D;  3SQN A;  2DJI A;  3CDH A;  4M71 A;  4NC7 A;  2XAJ A;  5IPA A;  5LRR A;  1YFH A;  2EFN A;  5IYB J;  1BJZ A;  3ABK H;  5E3O A;  2CUE A;  1B4A A;  4M73 A;  3HUG A;  4DYR A;  3RPQ A;  1LVA A;  1TZL A;  4B48 A;  1KGS A;  1G3T A;  3WU0 A;  3G73 A;  1V5G A;  3S3O A;  4PSX A;  3SDG A;  1UCR A;  2A05 A;  5M3M J;  1AA7 A;  3CCY A;  1OJL A;  3E3V A;  1QHG A;  2VON A;  3GF2 A;  3GFI A;  1TT5 B;  1FBQ A;  1N78 A;  4GXO A;  3OOU A;  4QWQ A;  3F8F A;  4PJ0 C;  2AXT C;  2E1O A;  5J3L A;  2MSY A;  5DD8 A;  2PLY A;  3I59 A;  4IJA A;  4EGY A;  4LFU A;  2FA5 A;  1NH3 A;  2CFO A;  3MCZ A;  3HRT A;  3T5X A;  2HS5 A;  4XRS G;  1DDN A;  4L18 B;  1CF7 A;  1JT6 A;  2A6E F;  1WI3 A;  3KP7 A;  4F52 A;  3G4S I;  5GAG J;  3HKZ A;  3J7A O;  1H88 C;  2AS5 F;  4Y3O A;  2DBB A;  5E3N A;  2VC0 A;  4BUP A;  5DM6 F;  2MH2 A;  4ZDP A;  2NVQ J;  2EH3 A;  4G6T B;  5H6R A;  4AWX B;  3JR9 A;  1YHQ I;  3HKZ N;  5DCF A;  1WRJ A;  3GCM A;  1MGT A;  2DW4 A;  1FP2 A;  4HA8 A;  5TGT A;  3V42 A;  4CCK A;  2W1O A;  1REP C;  3E0J B;  3ZQL A;  4DGW B;  1H89 C;  3KZZ A;  4A93 J;  2X6Y A;  2A61 A;  5ILU A;  3OV8 A;  4GCV A;  2MW8 A;  4DBQ A;  4HW0 A;  3OIQ A;  3K69 A;  5D5V B;  3GXO A;  2L01 A;  1MMS A;  1KU2 A;  2DOE A;  1ETQ A;  3HSE A;  4CZC A;  2R5Y A;  3L2U A;  1RPW A;  3LSJ A;  3MD2 A;  4UV9 A;  4WXC A;  3K4B A;  1D5Y A;  4BQA A;  1AHD P;  1E17 A;  2FD5 A;  1WSU A;  5FKK A;  1BI1 A;  2WAE A;  1VFC A;  2V1D A;  1B6A A;  4LG0 A;  2KIF A;  4DJA A;  2VE8 A;  5LEJ A;  2P7C B;  3KLO A;  1ITY A;  4XKB A;  2VT2 A;  3LMM A;  3ZN0 A;  3I9V 2;  1R00 A;  1YX5 A;  4PCQ A;  1S72 I;  2R5Z A;  2LFB A;  5EEH A;  2XKP A;  1D5V A;  1RKT A;  1JI8 A;  4UB8 C;  4CH7 A;  2NVU B;  4RGS A;  2YX4 A;  1TC3 C;  3JRC A;  2IA0 A;  5F64 A;  2HYF A;  1PJR A;  3HXL A;  3I4M J;  1ZN2 A;  2WAD A;  3V4G A;  3LSP A;  3CO7 C;  2FJ1 A;  2XPV A;  1KU3 A;  4M6Y A;  1Z3Y A;  1NTC A;  2VL8 A;  3IHU A;  4IPA A;  1TWC J;  1UG2 A;  1WWX A;  2QKL B;  1LDJ A;  4KYW A;  2RNJ A;  4GFB A;  5D8K B;  4KIS A;  4Y17 A;  1I1G A;  5LFA A;  2QVO A;  2L4M A;  3HL2 A;  1BN5 A;  1SD5 A;  1EH8 A;  2PQ8 A;  3GYH X;  4A3C J;  2MH9 A;  2ME0 A;  5CLS A;  4BE0 A;  3HOT A;  3E5X A;  3F0C A;  2VQC A;  2CU7 A;  2DT7 B;  2JRM A;  3BR2 A;  1OLT A;  1JTY A;  4RAY A;  3PFY A;  2FE3 A;  2COB A;  5KVR A;  1DU0 A;  2Z16 A;  2L02 A;  2ZJP F;  3BTI A;  3V8L A;  3CDI A;  1MMA A;  3D0S A;  5ILS A;  3KFW X;  1BR1 A;  2MC3 A;  5KHD A;  4IQJ A;  3WG9 A;  3HHG A;  5JI6 A;  1X1C A;  2KFD A;  3G6E I;  2DMT A;  4KNY A;  3OYG A;  2PN6 A;  1BA5 A;  2ZSH B;  2KKO A;  3SFZ A;  2LY1 A;  2PEX A;  4QPO A;  4U0W A;  4EQQ A;  1BI2 A;  1TWH J;  1YLF A;  3FK6 A;  4RGX A;  2CV0 A;  1AOY A;  4U7B A;  3LSH A;  2V6C A;  5J1R A;  4RM3 A;  2E1C A;  3RCO A;  3M07 A;  3RI4 A;  4ESF A;  4MTD A;  2NS8 A;  4J19 A;  4LIV A;  3C2G A;  3MAJ A;  1Y0N A;  3HB9 A;  2KJC A;  3PQJ A;  1O3Q A;  1D0Z A;  4AID A;  1QRY A;  1FT9 A;  2H6B A;  2O5R A;  3EYY A;  3KP6 A;  4FET A;  2XGC A;  5C4X J;  3PIP F;  1ULY A;  4ZZD A;  5H20 A;  4ENK A;  3S16 J;  3ZMT A;  1G3S A;  2JRT A;  4IOA F;  1IJW C;  3C18 A;  1YI2 I;  1Y1V J;  2F4O B;  1RUN A;  2F4M B;  2DN0 A;  2EIJ H;  2MLG A;  4M6V A;  1W5S A;  2L7F P;  3GFM A;  3MN2 A;  1PUF A;  4OIP F;  5ICE A;  1XMX A;  2K85 A;  3BT9 A;  2OZU A;  5IT3 A;  1DUX C;  2DMN A;  4C3H J;  2YUS A;  3IAS 2;  2EA4 A;  3RKQ A;  1J2X A;  1V55 H;  1IC8 A;  2B63 J;  2X1C A;  3PO3 J;  4DYQ A;  4UV8 A;  1MNM C;  2E5N A;  4MO7 A;  3BJ6 A;  3BP8 A;  3OIO A;  2LF8 A;  3IH2 A;  4A2U A;  2DYR H;  2PI0 A;  1R23 A;  5F0C A;  2QA4 I;  3VFZ A;  2L5Q A;  4LK1 F;  4PJL A;  3A01 B;  1PVE A;  3SXY A;  2A6T A;  4XLC A;  1ZQ3 P;  3CJT B;  3B73 A;  5HOO A;  5F04 A;  2P81 A;  1K4T A;  1Y1W J;  4CA0 A;  4UVB A;  3TP0 A;  5GPA A;  1J0R A;  2Q1Z B;  5GAD J;  1SFU A;  2DJN A;  1FTT A;  4BKX A;  3O8H A;  2LR8 A;  1Z0X A;  5L3F A;  3DF8 A;  1OPC A;  3TOA A;  4B3A A;  2LKX A;  3K0L A;  4JX5 A;  1MH3 A;  1JKR C;  1JJ8 C;  3JRA A;  4HZF A;  1ETW A;  3I58 A;  4C3J J;  1GVJ A;  1A6Q A;  4PJJ A;  4LLG F;  4XNF A;  1I39 A;  2M3A A;  1S3J A;  4A0Z A;  2X6W A;  1WHU A;  4R1H A;  4BXX J;  2X85 A;  4D7M A;  4V2F A;  3HSR A;  1H9G A;  3TBI A;  1IGN A;  1DGW Y;  2EB7 A;  3VDX A;  2EIM H;  2HWV A;  1TNS A;  3I5U A;  1GXP A;  5BPD A;  3WTZ A;  3KP3 A;  2XKO A;  1K78 B;  2CMP A;  2XAS A;  2QSF X;  1PP8 F;  1MMN A;  2A6H F;  3HZJ A;  4P96 A;  2GM4 A;  2VUM J;  1R9T J;  5FGM A;  4F7Z A;  5LD2 C;  3KZY A;  2GQQ A;  1FIP A;  2XV4 S;  5F27 A;  3TO6 A;  2L7K A;  1F9N A;  3BPV A;  3NRV A;  2FBH A;  2X51 A;  3PL8 A;  4A3I J;  1R49 A;  2QWW A;  3FXJ A;  2HXI A;  3DBH B;  1POG A;  5AIQ A;  2DO7 A;  4LLL A;  2QKM B;  4BHP A;  1VQN I;  3ZGK A;  2DDA A;  3RPU D;  5E1X A;  3CME I;  3DTI A;  5BS6 A;  3F6O A;  2Y9Z A;  3TDU C;  5E1W A;  3JRI A;  1IRG A;  4EGZ A;  2ID3 A;  3QRF F;  2EJR A;  3ZQQ A;  2IGN A;  1JJ6 C;  1YW8 A;  2O61 A;  1JT0 A;  2XRL A;  4OMZ A;  4D5F A;  4LIT A;  1J59 A;  5EF6 A;  4JX4 A;  2R92 J;  4ZYE A;  4W1U A;  3TQN A;  3OL3 A;  5M3F J;  4N4N B;  4HG2 A;  4P9U A;  4X6A J;  2DLL A;  2NAZ A;  4MFD A;  1I27 A;  4K2E A;  4L9T A;  5ILV A;  3JRH A;  1LB2 A;  3H0G J;  1Z91 A;  2CFX A;  1LKX A;  2VC1 A;  3LA2 A;  4L5E A;  1RET A;  1MH4 A;  4RB2 C;  3WE2 A;  2BW3 A;  2UWM A;  5TIS C;  1GV2 A;  1H9T A;  1UST A;  2UXX A;  2K9L A;  5CQE A;  3A1Y A;  4G12 A;  2Y2Z A;  4R79 A;  3BC8 A;  4A3D J;  2YSR A;  3ESW B;  2BOL A;  3CZ6 A;  3OIP A;  4Y4R A;  1V3F A;  4EJW A;  3OMY A;  1BR2 A;  2HYG D;  2R3S A;  3FDY A;  5E1Z B;  3DLL F;  3SJM A;  1WJA A;  3BOQ A;  4D5C A;  2NOG A;  3TGN A;  5KAI C;  3MKW B;  1XC5 A;  3M3Y J;  4MQ9 F;  5LEK A;  2LDU A;  2QQA A;  2DMQ A;  5J8C A;  2H09 A;  2Q2E A;  1QBJ A;  3WHB A;  2HYJ A;  3AL0 C;  4XKC A;  3M9A A;  1HST A;  3WTS C;  2ZC2 A;  1SVL A;  2YS9 A;  4O6J A;  4PGG A;  4ABZ A;  2DPD A;  2CUF A;  3HGG A;  1FIA A;  4XBF A;  1O7F A;  1G6N A;  5D5W B;  1PUF B;  3WTY C;  5CPR B;  3CUQ C;  4JP0 A;  2I8D A;  4XLN F;  1NHA A;  4DQ2 A;  2H8R A;  3OYA A;  2BXZ A;  2HTJ A;  2RC4 A;  2G9W A;  2QGU A;  2IA1 A;  1K79 A;  4CHU A;  2RGV A;  4LG3 A;  3TED A;  5DD4 A;  2W82 A;  3EQL F;  4FX0 A;  3WTX C;  1IN5 A;  4ESJ A;  2FML A;  2DOA A;  2JVH A;  2XC7 A;  5TRD A;  3VYR B;  5LGN A;  2M30 A;  4D1Q A;  3V7C A;  3OYK A;  1FMV A;  2VKH A;  1A5J A;  4XSX F;  4KFC A;  3J80 Z;  1QNT A;  2V1N A;  5L3D A;  4HDV A;  4OWR B;  3F72 A;  5L3G A;  1FBS A;  4BYY A;  1IG7 A;  1MZB A;  1VND A;  3J80 K;  3T8R A;  4BHC A;  2E1M B;  3LSK A;  1XGN A;  1KQ8 A;  1X3U A;  2XF7 A;  4EEF G;  3OSG A;  3KEY A;  1R4M B;  2DQL A;  4AVP A;  2QBY A;  2CQ7 A;  2JA7 J;  3EUH C;  3IWF A;  2H1L A;  2VE9 A;  2O8X A;  1MJ9 A;  4G8X A;  2RQP A;  4NNJ A;  1GT0 C;  2P0W A;  2ICW G;  1XGS A;  2M7B A;  3FXU A;  3MWM A;  3LA7 A;  1I3Q J;  2XIG A;  1QA6 A;  1TTY A;  2I10 A;  1YRN B;  3TO9 A;  1D1B A;  2JPB A;  2OCC H;  4CCJ A;  3R4K A;  4CIC A;  1SC7 A;  3E6B A;  2A3S A;  1OCC H;  4OU0 A;  3QPS A;  4I7H A;  4D9J A;  5FRN A;  2VJ4 A;  2DA1 A;  5FB2 A;  3BR3 A;  1OIS A;  3O3K A;  3CCE I;  2XAG A;  1RIO H;  2KDZ A;  1D0Y A;  2FU4 A;  4I6Z A;  2VN2 A;  4GGG A;  2ECC A;  2CH0 A;  3G1M A;  2IW5 A;  3F8C A;  5LHH A;  4A12 A;  3EUK L;  2FEZ A;  3QWL A;  1W36 C;  3IP4 B;  2MAB A;  1E3O C;  4UXN A;  5E79 C;  3QYB A;  1Y8Q B;  2V1U A;  4DZP A;  2P5V A;  2W48 A;  4E7K A;  4O3M A;  3VSL A;  1S6L A;  1Q1H A;  1Z9C A;  1GUU A;  5J47 A;  4RMN A;  1TLH B;  3Q3S A;  1BBY A;  3VOE A;  1KON A;  4A3E J;  1HOM A;  2OCE A;  1AWC A;  5DCM B;  1F43 A;  1S7O A;  4PJN A;  1Z05 A;  2K40 A;  2F5V A;  4XL9 A;  3E97 A;  3J7Z I;  1KQ0 A;  2YPR A;  3GO5 A;  2FQ4 A;  9ANT A;  2HKO A;  1WKM A;  2BXY A;  2ZJR F;  1TW3 A;  1QHH D;  2LY9 A;  4HQE A;  5FKL A;  4G6D A;  4IRI A;  4WXD A;  5CVR A;  2DMP A;  3QP5 A;  3JSP A;  2B9S A;  2Q8K A;  4LB6 B;  4XRS A;  2IGM A;  3K1P A;  4AUX A;  3DKW A;  4A3B J;  2OD5 A;  4A3G J;  2JWT A;  2M0M A;  4FTH A;  1IXC A;  2A5W A;  1IF1 A;  1FWZ A;  2CQN A;  2EFQ A;  3AG3 H;  1X3W B;  5F6F A;  1I1S A;  2VJJ A;  4BQO A;  2IXS A;  4AYB A;  2BGC A;  2HOA A;  5FO5 A;  1KU9 A;  2D2W A;  1P7J A;  2ZXJ A;  3PNV A;  2HQ5 A;  4XN3 A;  4U0Y A;  1ZLK A;  4J01 A;  1MIJ A;  3OYM A;  4AYB N;  3GME A;  3CCU I;  5LLQ A;  4ZDO A;  5JLX A;  5L3C A;  3VWB A;  3BR0 A;  3RYP A;  4F91 B;  4XIC A;  2R7X A;  3N4M A;  4AVZ A;  5CVJ A;  5E20 A;  5IYC J;  2HOT A;  5EDN A;  1Q1V A;  3L9F A;  4HEA 2;  2EFW A;  4BJT A;  1T33 A;  1IN8 A;  3KE2 A;  3I4P A;  4B43 A;  1YQA A;  2M87 A;  3Q9V A;  2QQB A;  3S32 A;  1U5T A;  3QYE A;  4CCM A;  1S7A A;  3N05 A;  4LD5 A;  4N9I A;  3FXM A;  2MFZ A;  3ZQH A;  4B47 A;  1QVU A;  3RKW A;  3CUO A;  5FD6 A;  3S3N A;  2VJ5 A;  5FRO A;  3HTU A;  3OWT A;  4ASN A;  4LOC A;  4KIT B;  5JR3 A;  3S8P A;  4EMS A;  2DFH A;  2F2E A;  2CQX A;  5BNG A;  1P4A A;  2DYS H;  2F6C A;  2K9Q A;  4FAS D;  3S3M A;  1GHC A;  3SEZ A;  3TO7 A;  1BC8 C;  3RZO J;  2IP2 A;  3LAJ A;  1QVT A;  2P5K A;  4IXA A;  2P6S A;  1EKE A;  3DP7 A;  1XX5 A;  4UNO A;  4HF0 A;  4E70 A;  2TCT A;  2IA2 A;  2O6G E;  1EA3 A;  2DT5 A;  3G71 I;  1MSE C;  4A0Y A;  1FOW A;  3LQQ A;  4KN7 X;  3MZ8 A;  1YW9 A;  4UUS B;  4O5V A;  3BG9 A;  1B59 A;  4Q48 A;  4RAF A;  3X2Q H;  1A6I A;  3FX3 A;  4RS8 A;  3E6M A;  1VQ7 I;  3QQA A;  2K5C A;  2PFB A;  2DA2 A;  3F9K A;  4IEJ A;  4NBQ A;  2D45 A;  1F1Z A;  1XG1 A;  4EJU A;  4FIS A;  4B8X A;  1AKH A;  1QZE A;  3T1B A;  2OV7 A;  3K70 D;  2BY2 A;  3QYF A;  3PQK A;  1HKQ A;  1ZHF A;  3TW7 A;  1IDZ A;  2KZV A;  1LJ9 A;  3LL7 A;  5GAE J;  3JCU C;  2EIN H;  2ZO4 A;  2JMW A;  3A0B C;  4P9F A;  2BE5 F;  5BPI A;  2ZBK A;  4XOT A;  4NHJ A;  1HCR A;  4ZZL A;  3HRS A;  4HX4 A;  3ZQG A;  3U1D A;  3GZ6 A;  3S93 A;  1Y56 A;  1MMG A;  5C4J J;  4Q4Z F;  4OMY A;  1P9Q C;  5M5W J;  3BCB A;  2HQR A;  1MD0 A;  1F5T A;  3EYI A;  2KZG A;  2PJP A;  1U2W A;  1UZC A;  2LVS A;  5FJ8 J;  3IKV A;  1FSE A;  3DV8 A;  2CGP A;  1T0F C;  3HC7 A;  3RTR A;  2NXN B;  3LSI A;  2OAZ A;  3IC7 A;  2EBI A;  2LYC A;  5JLW A;  4N0B A;  3K4N A;  3DEU A;  1WJF A;  1XGO A;  2VJI A;  3JRE A;  2ZFU A;  1J7K A;  1S9H A;  5HLG A;  3HHH A;  3E7L A;  2JZY A;  2RDP A;  4KN4 X;  1XDU A;  2V9K A;  5F08 A;  1X19 A;  3SFI A;  2UUZ A;  3S2W A;  3RIR A;  1MMD A;  1ZKG A;  3CP8 A;  5AIP A;  1WCM J;  1LUJ B;  5DM7 F;  1LFB A;  2F48 A;  1S8N A;  3IAM 2;  3CC2 I;  1R22 A;  4BE1 A;  1OQY A;  2VI6 A;  2IGK A;  3ZR8 X;  4BY1 J;  2IEK A;  2MYS A;  5D5U B;  4CDG A;  1W0T A;  5K7H A;  4BHB A;  1VZ0 A;  3CTA A;  4AC0 A;  4N9H A;  3VYU B;  3OYF A;  2DU9 A;  3CMM A;  2LC2 A;  3S2D J;  2KT0 A;  2G0E A;  5C44 J;  4KUM A;  3O2P E;  1MBG A;  4BU2 A;  3ZMS A;  4PDK A;  4XLH A;  4QTR A;  1FZP B;  5KCM A;  1MW7 A;  3U21 A;  3W6K B;  2P4W A;  4CCL A;  4BEH B;  2AXL A;  2ADU A;  2M4K A;  2LSO A;  3F6V A;  1I6H J;  1Z1D A;  3T8T A;  3ZMZ A;  2Y30 A;  1DPU A;  3PFI A;  2L9N A;  3CF2 A;  3A2K A;  2DA3 A;  1IRF A;  4CSW A;  1TP4 A;  2Y0S A;  2HQA A;  1BOA A;  4PK4 A;  1T08 B;  1HF0 A;  2QSH X;  5A2Q Z;  1TWA J;  2ZCW A;  2BY1 A;  2JVG A;  2MGQ A;  1LNW A;  5A2Q K;  1LDD A;  1LPQ A;  2Y0S N;  3UNG C;  3BTL A;  2EZI A;  5E8G A;  4YIR X;  1U5T B;  3Q0U A;  1IXS B;  4V19 K;  2RVC A;  2G7H A;  3D5L A;  2DMU A;  3E6D A;  2OPT A;  2VKD A;  3OS2 A;  1J9I A;  2HVQ A;  4D7N A;  1XD7 A;  2XVC A;  2YR2 A;  1IRZ A;  4LJZ F;  5E3L A;  3VB2 A;  2HDW A;  5IP7 J;  2IS4 A;  1BW5 A;  2EFO A;  3ABM H;  3QAH A;  3D1N I;  2VQG A;  2PG4 A;  5ED4 A;  3LOC A;  2GBY A;  5JHU A;  2ZME A;  4HDU A;  2QM3 A;  4QPQ A;  4DYC A;  4KT6 A;  5ICF A;  3NWT A;  3HG9 A;  1ZYR F;  1ZRE A;  1ODD A;  4E4H A;  3WTV C;  1Z7U A;  2OQR A;  3HTS B;  1P2F A;  4XOP A;  3CCR I;  2CW0 F;  3ERE D;  2TRT A;  1G3W A;  2X6X A;  2BV6 A;  2ID6 A;  2OBP A;  1SD7 A;  1OYW A;  3QOP A;  2V9P A;  4G7O F;  1TWG J;  1X3Z B;  3MZH A;  2VKE A;  3DPU A;  1L3L A;  4IOC F;  3WE3 A;  3NAR A;  2QF7 A;  4G6Q A;  2ZB9 A;  3GFL A;  4XRM A;  3K70 C;  4YFX F;  3I71 A;  3DTE A;  1LEA A;  1T95 A;  3GW2 A;  5EZG A;  5E17 F;  2OQG A;  5DEQ A;  3DEE A;  3FKJ A;  4WWC A;  3OSF A;  4BH9 A;  5E8I A;  3VOD A;  2R7O A;  3DBL B;  4JYK A;  3GLX A;  5E3M A;  3ROU A;  4RLF A;  4A3J J;  2NVT J;  3HUG B;  2IBD A;  2L0K A;  1U9O A;  4JBA A;  1G8X A;  2DI3 A;  2KPM A;  4U88 A;  5IY5 H;  4RLQ A;  2HVS A;  1ON1 A;  3P7N A;  4HYE A;  4A69 C;  2CV1 A;  3EUH A;  1Z6R A;  4BXU A;  1ZG3 A;  2ZXI A;  6PAX A;  1YE9 A;  1Z3X A;  3H3U A;  5JVG F;  1F36 A;  1IN6 A;  5BMZ A;  3GTG J;  4ZH4 F;  1NK3 P;  4XID A;  2WV0 A;  3OS1 A;  1WJC A;  1L0O C;  1W5C C;  2EWN A;  2XAF A;  5DS9 A;  1T6S A;  1TT0 A;  3OYB A;  1JGG A;  1I6X A;  1RNL A;  3I54 A;  4EM1 A;  4HF2 A;  1WI9 A;  5JHF A;  1BM9 A;  3GUD A;  3HYI A;  1BJA A;  1FSH A;  3ISP A;  2E2I J;  4YIF A;  5CVI A;  2ELH A;  1IV6 A;  3PO2 J;  4YFN F;  2J5O A;  3ZXS A;  4HLY A;  3I59 B;  1H8A C;  4H0E A;  5K5Q A;  3ZMV A;  5J4V A;  4DOZ A;  2XRO A;  2UXN A;  5L3E A;  5JFR A;  5FRM A;  1CF7 B;  4E7Z A;  4GRI A;  3V7R A;  1EF4 A;  3ZMD A;  1YJ9 I;  3OYE A;  2X0L A;  1A35 A;  4HX7 A;  3ZQF A;  2ZXW H;  4RAZ A;  2A07 F;  3PUF A;  4XM3 A;  1SAX A;  3IUO A;  1FPQ A;  3AAF A;  3HOV J;  2C6Y A;  2A69 F;  4C2M J;  4EAT A;  3TDZ C;  2R7D A;  1Y0U A;  3Q9S A;  5HVQ C;  2R7Z J;  2LKP A;  3JAM Z;  1JKP C;  4KT5 C;  2E2J J;  3L00 A;  2Y9Y A;  3IH3 A;  4M9X A;  5J40 A;  4ZJZ A;  1XSD A;  3JAM K;  4MQV A;  2R5Y B;  3J81 Z;  1PP7 U;  1Z6T A;  4ON0 A;  2DK5 A;  3ZMU A;  3TL4 X;  4Y7N J;  3J81 K;  3AG4 H;  2FQ3 A;  1R5G A;  4LG0 B;  1MBK A;  5IOZ A;  2DA7 A;  2LKS A;  4YEJ A;  3HGY A;  3HSF A;  3WTT C;  5D4R A;  4XLE A;  2VKV A;  2L9S A;  1FP1 D;  2Y69 H;  3K2A A;  2STT A;  4I02 A;  1IXR C;  5LHI A;  5D5X B;  4NUB A;  1BL0 A;  4I99 C;  1V5E A;  2R5Z B;  1B72 A;  2R4G A;  2CSO A;  3BZK A;  1XSX A;  3H92 A;  3MKY B;  2H27 A;  3K6G A;  1RI7 A;  3K4M A;  1T8I A;  1FEX A;  2CG4 A;  4HAM A;  2E1N A;  3BG6 A;  2VT3 A;  4I0B A;  2V7F A;  1HW1 A;  2W25 A;  2CRG A;  4NDL A;  4KIC A;  3SDB A;  2ELK A;  1F4K A;  4XMY A;  3GTK J;  2JUC A;  2G7U A;  3PNY A;  2FMY A;  2DQR A;  2H94 A;  2ISZ A;  2Q0O A;  2EFP A;  3FXL A;  3I53 A;  2Z5U A;  3LNQ A;  2F5E A;  1R6R A;  2O7O A;  5J8F A;  3FHZ A;  3W6V A;  3HPH A;  4Y33 A;  2HPI A;  3F8B A;  3H36 A;  5DDG A;  1WH7 A;  3WGG A;  3A0H C;  2K9M A;  3LQR A;  2ZME B;  3KZI C;  2ZJQ F;  1XS9 A;  4B44 A;  3E5U A;  3P9C A;  3MFK A;  1X1B A;  1XN7 A;  1LDK B;  2M45 A;  2HGC A;  1ZTR A;  1OYI A;  2AHQ A;  2EV5 A;  2ELJ A;  3CLO A;  3GZ5 A;  5FKO A;  1V4R A;  3COA C;  2CQK A;  3B6A A;  3GTL J;  4OAY A;  1FOY A;  3IRR A;  1VQ9 I;  1OCR H;  2NS7 A;  3B02 A;  1W1W E;  2B7E A;  2L7Z A;  4WF2 A;  3F3X A;  5D6E A;  4CXF A;  3FF5 A;  1NG7 A;  1OCP A;  2W84 A;  3WG7 H;  4B1R A;  1APL C;  5F1J A;  1ZAO A;  2ZKZ A;  1LFU P;  5J1U A;  4FE4 A;  3NQO A;  3CES A;  1SFX A;  3L7W A;  4HV6 A;  2A68 F;  4UHT A;  2EK5 A;  3IV5 A;  2E19 A;  2FOW A;  4L5I A;  1V54 H;  4E7J A;  1UEL B;  2OF7 A;  2V4J C;  4HRI A;  2M34 A;  4BAC A;  4V2G A;  5CVU A;  2ISY A;  3FMS A;  1IZ1 A;  1J5Y A;  3BWG A;  3RQI A;  3WHC A;  1R36 A;  2I5U A;  3L2R A;  2X48 A;  2L2O A;  3L2V A;  2PMU A;  4BQQ A;  3F22 A;  3SZT A;  3W2A A;  1YYV A;  2JA2 A;  1N77 A;  2EIL H;  4F3Q A;  1W4M A;  2VBY A;  2EZL A;  5CKT A;  5H6Q A;  3T0Y A;  1WJE A;  3R61 A;  5IOY A;  1XPX A;  1HC8 A;  4HST A;  1HLV A;  4I98 B;  5H2F C;  1FYK A;  3S15 J;  2RV8 A;  3CCJ I;  2VPR A;  3V8K A;  4S0H B;  1XMA A;  4BJ6 C;  2V26 A;  1YIJ I;  4IRH A;  4U0V A;  2JSP A;  2O9L A;  4G94 A;  1YJN I;  2WV1 A;  2BBY A;  2CQQ A;  3VSK A;  1VQM I;  1FBU A;  2IS6 A;  2VBZ A;  2DOD A;  3MEX A;  2NNY A;  4KDP A;  1VQ5 I;  2RKH A;  3DCF A;  4YRV A;  1UHW A;  4PFP A;  2GWR A;  2R7W A;  3V8J A;  3I56 I;  4IX7 A;  1E2X A;  1T0F A;  4HBL A;  3CJQ B;  1SMY F;  1SVM A;  2RNG A;  1HKS A;  5ICC A;  2NNN A;  2R7T A;  3ZOB A;  2K7L A;  4BDY A;  2QSG X;  1R7J A;  5EG0 A;  2OTL I;  3EET A;  2XGD A;  2M8E A;  3OYJ A;  2HXO A;  1A04 A;  2R7U A;  4WX9 A;  2Z99 A;  5FFX A;  3P5J A;  2FUG 2;  4LIU A;  5ICG A;  2D1H A;  4BY7 J;  2A5Y B;  4XLA A;  1U9N A;  5K7Z A;  3L2W A;  4RM2 A;  3W2W A;  1GXQ A;  5F0H A;  3KEQ A;  4IZZ A;  3Q0V A;  5CVV A;  2GAU A;  2VQH A;  3IH4 A;  2HEO A;  1ORK A;  2ECB A;  2MBF A;  5M5X J;  2Y75 A;  4IHV A;  4I01 A;  2QQ8 A;  1P4W A;  4UB6 C;  1PUE E;  5IYD J;  3QU6 A;  2IS2 A;  4XR6 A;  4BQN A;  4HX8 A;  2ME6 A;  2X1D A;  4XKV A;  3BZ6 A;  1GV5 A;  4XKW A;  3K9T A;  5K5R A;  2R7S A;  2K4J A;  3SZG A;  3H9J A;  3HOY J;  1IDY A;  1EV7 A;  2PMZ A;  2E7X A;  4M9Z A;  4HLX A;  2X6O A;  4AD9 A;  1HSJ A;  3BTC A;  2WAQ A;  4RB3 C;  2P6T A;  3B6C A;  2VOP A;  4IHX A;  2PMZ N;  1JHF A;  1XB4 A;  4XLP F;  4A6D A;  5HNH A;  2WAQ N;  3H1C A;  2R7Q A;  2JQ7 A;  5E18 F;  1BIA A;  2E7W A;  4I76 A;  4JX6 A;  4YFK F;  5IP6 A;  3L09 A;  1D8J A;  1SD6 A;  4MLO A;  3ABL H;  2EIK H;  2DPU A;  3K1N A;  3GLL A;  3BCA A;  3DU6 A;  2K3P A;  1O57 A;  5J1Y A;  3WTW C;  2XHK A;  4OIR F;  4II3 A;  1VQL I;  1K7A A;  2DA5 A;  3RYR A;  3QPL A;  3JRB A;  2E1M C;  3JW4 A;  2ESH A;  4RAG A;  3PIO F;  2CJJ A;  3WGI A;  3WTU C;  5GTH C;  3GBG A;  1TNT A;  1JUM A;  3PNT A;  2BW3 B;  5L3B A;  3OY9 A;  4PUS A;  2HVR A;  2GIZ A;  1O4X A;  3FWE A;  1FY7 A;  3CMA I;  1X4O A;  2RN7 A;  3H9G A;  3LST A;  4MIM A;  4F92 B;  3D5S C;  2UZK A;  3TOB A;  2Y48 A;  3M8J A;  1OR7 C;  4L9V A;  2WY8 Q;  1RR8 C;  3D5R C;  1W7P A;  1MSF C;  3RKX A;  2E71 A;  2NS0 A;  5K1Y A;  5D4S A;  2K9S A;  1YTY A;  2Q2E B;  2HZD A;  2QQ9 A;  2E5Z A;  3HRU A;  4G7H F;  4ENN A;  1OYY A;  1SFK A;  1XCB A;  4IVN A;  2E35 A;  4EVI A;  4Z6Y A;  3CCM I;  2HU9 A;  5HDK A;  3VYT B;  2Z2S B;  3BQY A;  4OIQ F;  3G1O A;  2QLZ A;  2JA6 J;  4NB5 A;  4FHT A;  4NQW A;  5ERI A;  2VBX A;  3ERM A;  3PUB A;  4IRG A;  4KIG A;  3AG2 H;  3K4C A;  2IT0 A;  1HKT A;  2Z3Y A;  3BJO A;  3BR5 A;  3ML6 A;  3JRG A;  1D1C A;  2K9N A;  3DXJ F;  3W6J B;  2CWE A;  2QEX I;  2EA2 A;  1ZGW A;  1R5H A;  1SEU A;  4QSH A;  4LMY A;  5EGO A;  2VAS A;  2W24 A;  3CLQ A;  3FM3 A;  4DNC A;  4CUG A;  3ULQ B;  3GVA A;  4S05 A;  3OYD A;  2E60 A;  1T98 A;  3H5N A;  2PMH A;  3CP2 A;  2JA5 J;  4J00 A;  3QPH A;  3HIF A;  4XK4 A;  3W2V A;  3SZP A;  1CQT A;  3BDD A;  3KCC A;  2OUM A;  4Q5S F;  2DA4 A;  4DBR A;  4ZYG A;  2AO9 A;  3PSF A;  4HSR A;  4PZJ A;  2HR3 A;  2BVM A;  4MEY F;  2VQL A;  2FNP A;  1YS7 A;  5GTI C;  2JK3 A;  4BNC A;  3HOW J;  1KZH A;  5EG0 B;  3SHF A;  3ELK A;  1MDM A;  3QOD A;  2QBY B;  1IV8 A;  1U6G A;  5K5O A;  1ETV A;  4WK8 F;  1U0J A;  2JT1 A;  2M0C A;  3M7G A;  2HDD A;  3H0D A;  5B1A H;  2XAQ A;  3WGH A;  2XGX A;  4OOI A;  3LA3 A;  1QPI A;  3AKZ A;  4M6X A;  4UVC A;  3R6S A;  4PJM A;  3LWF A;  2PBI A;  1XMK A;  1ZAR A;  1B8I A;  1JKQ C;  1TQP A;  3KYD B;  1VQO I;  1GLN A;  2QUF A;  4I0A A;  4S04 A;  2IS1 A;  4Y15 A;  4BL0 B;  4AIJ A;  1ZRC A;  3CQZ J;  4AIH A;  3HEF A;  2CYY A;  4XQF A;  3K4L A;  3CC7 I;  3LFK A;  4JK1 X;  5EEG A;  4DIQ A;  2M9H A;  2IGO A;  1W0U A;  1SVO A;  4GO1 A;  3OS0 A;  1WQ2 A;  2VOD A;  1T39 A;  3HRM A;  1JE8 A;  2XPW A;  1ETO A;  3M1E A;  1UMQ A;  1Z7L A;  1KA8 A;  1UG0 A;  5EZH A;  1LFP A;  2EV6 A; 
#chains in the Genus database with same CATH homology
 4ZYH A;  3FMR A;  5DYM A;  1U3E M;  2BYV E;  5IT9 Z;  4KIF A;  1LQ1 A;  3BPX A;  5IT9 K;  3IRQ A;  2JTV A;  1EH6 A;  4WCG A;  1S29 A;  4P5O A;  2J5P A;  4CYD A;  4A6E A;  5LRS A;  1D8K A;  3KP5 A;  3ABT A;  3RJP A;  3BJA A;  1KYZ A;  1USS A;  4ENM A;  4IHS A;  2B0L A;  4CZZ A;  1MJA A;  5BQT A;  1FNN A;  1H0M A;  4Y13 A;  1R1T A;  1W7P B;  4UVA A;  5LGT A;  4MHG A;  1QZY A;  1B9N A;  4FX4 A;  2KJB A;  3ABU A;  2L4A A;  4QLC U;  3FXR A;  3U9G A;  5HLH A;  1YO5 C;  3GEZ A;  2O0Y A;  4LGW A;  5FLX Z;  3O6B B;  5DUK A;  1DP7 P;  5HS8 A;  5LHG A;  1LEB A;  5FLX K;  2FSW A;  1B9M A;  4D0P A;  1R1U A;  2IRF G;  1K78 A;  2OZ6 A;  4YII A;  1BI0 A;  4L9J A;  1T2K A;  2XUB A;  4LLN A;  3CUQ A;  1YIO A;  4JQF A;  1EH7 A;  4HQM A;  3KP4 A;  1MDM B;  2XAH A;  2CO5 A;  4Z2Y A;  2M1B A;  1QGP A;  3DFG A;  5BOX A;  3K1M A;  4EM0 B;  2HQN A;  4ENJ A;  1ZG1 A;  4IF4 A;  2Z33 A;  4A5N A;  2F5C A;  3F21 A;  3M8F A;  4WXH A;  1R1V A;  4EJO A;  3ECO A;  3P9K A;  5JVT A;  1CGP A;  4ETS A;  4L0Z B;  2F5D A;  3ZN1 A;  3KEO A;  3FXQ A;  4KMF A;  4G7Z F;  2V9V A;  3LAP A;  2HZT A;  2ETH A;  3HOS A;  1U5T C;  4ZYD A;  2FBI A;  2K27 A;  1J75 A;  4M74 A;  1U78 A;  4G9Y A;  3R60 A;  1ZRF A;  3BRO A;  4BAY A;  3I0T A;  5HLI A;  3ECH A;  2WC2 A;  2H6C A;  2JPC A;  3TKY A;  3RPU A;  2HKX A;  1KQ9 A;  1QO0 D;  3OOP A;  2K02 A;  1K6O A;  4M9S A;  1IN7 A;  2FBK A;  1ZGA A;  4MTE A;  1P4X A;  3MZY A;  3Q5F A;  3QU3 A;  1ZGJ A;  4IHT A;  3E6C C;  2GIV A;  5J6X A;  2P8T A;  2ACJ A;  2P5L C;  1KU7 A;  1O3T A;  2MLK A;  4L9N A;  3ZQ7 A;  1SD4 A;  4U7D A;  2DAO A;  2GA2 A;  2QYO A;  1ONV A;  3JTG A;  1XSV A;  2KIM A;  4RB0 A;  3DPT A;  4FT8 A;  1ZRD A;  1JGS A;  1FOK A;  1STZ A;  1OR7 A;  1G4D A;  1HW2 A;  2ZNZ A;  3IWZ A;  2VOO A;  2K86 A;  4M72 A;  2IJL A;  4YG2 F;  3EDP A;  1IUY A;  2K4B A;  1P6R A;  2P7V B;  3JTH A;  4A5M A;  4RB1 A;  1TW2 A;  2ZNY A;  2D1V A;  3C7J A;  1P92 A;  3CUQ B;  1FLI A;  2WTE A;  3GWZ A;  5LGU A;  4OIO F;  5DV5 A;  2FOK A;  4I2O A;  4L0Y B;  1TBX A;  5DCM A;  3P9I A;  1MJB A;  3KLN A;  2OA4 A;  4P55 A;  2ESN A;  2GA1 A;  1IAW A;  1JHH A;  3FZV A;  3C3W A;  1IW7 F;  1TQI A;  1XGM A;  5FFZ A;  5LBQ A;  2TDX A;  2KRF A;  4EJV A;  3MQ0 A;  3I64 A;  2L54 A;  1HQC A;  1O3S A;  2GXG A;  2IPQ X;  3JSO A;  4HF1 A;  3ZP5 A;  4PGH A;  5HS9 A;  4LB5 A;  5DUI A;  2Z9O A;  1BC7 C;  4UUV A;  1DPR A;  3BY6 A;  5D8L B;  3QP6 A;  1XDS A;  2GZW A;  2IVM A;  2JSC A;  4RGU A;  4OIN F;  4HV5 A;  2O3F A;  2NRA C;  4CO8 A;  5HDN A;  3GX4 X;  2MA3 A;  2EV0 A;  1YS6 A;  2W57 A;  2DK8 A;  3NEU A;  2O03 A;  2FF4 A;  1UHM A;  1QZZ A;  3CJN A;  3U2R A;  3V7S A;  1FYM A;  2FNA A;  2MD5 A;  2FXA A;  1RZ4 A;  2ZFW A;  5F1R A;  2YX7 A;  2DFI A;  4AIK A;  3F8M A;  3R0A A;  2HDC A;  4CGZ A;  3DPL C;  1O7L A;  5HS7 A;  2ZJ2 A;  2OU2 A;  1G3Y A;  2FRH A;  4KIB A;  1PDN C;  2NYX A;  5AON A;  1XCV A;  3WOD F;  3IKT A;  4XRF A;  1FC3 A;  4MNU A;  5HDG A;  2V79 A;  2BEO A;  3K2Z A;  4GYG A;  2R7F A;  1ZLJ A;  1KYW A;  4ESB A;  4A0X A;  1YG2 A;  3R0J A;  2GXB A;  2V1X A;  2YU3 A;  3GFJ A;  1BI3 A;  1O3R A;  4TV7 A;  3F23 A;  3WU1 B;  1TQM A;  1QQI A;  4XSZ F;  1W5T A;  5D6F A;  2M5W A;  3FMQ A;  1VTN C;  3C1D A;  3M8E A;  4MEX F;  4LK0 F;  3RKY A;  2WWY A;  1FX7 A;  4I09 A;  3DQV C;  1B1B A;  3REO A;  3FM5 A;  1HW5 A;  4EV0 A;  2W85 A;  2LF7 A;  5FD5 A;  1U8R A;  1ZG5 A;  1OMI A;  1HBX G;  1UFM A;  1JXS A;  3RDI A;  2VBW A;  1YW7 A;  3G3Z A;  4R8H A;  2STW A;  3N97 A;  3KET A;  3IL2 A;  1I5Z A;  4KMU X;  4L5J A;  5TJJ A;  1BIB A;  4HOB A;  1SFE A;  4B09 A;  2KIU A;  1D3Y A;  2QEN A;  4RGR A;  1ON2 A;  2LNB A;  2L3D A;  2HFH A;  2DTR A;  5KK1 A;  2F5F A;  2XRN A;  3E5Q A;  1T38 A;  2COM A;  1R58 A;  3H3Z A;  2HTS A;  5CYV A;  2Y0M A;  1FYL A;  4MGR A;  4GYI A;  3L2C A;  3VEP A;  3CO6 C;  1RUO A;  4EM2 A;  5CJ9 A;  3QPT A;  3F8N A;  2QZ8 A;  1HXD A;  1OKR A;  2HOE A;  1C0W A;  1ZH5 A;  4EJT A;  2X4H A;  3ZPL A;  1IN4 A;  1QPM A;  2VXZ A;  1SMT A;  4KA4 A;  4Q47 A;  1MKM A;  1UB9 A;  3KP2 A;  1W7P D;  3SQN A;  3CDH A;  4M71 A;  2XAJ A;  5LRR A;  1YFH A;  2EFN A;  1B4A A;  4M73 A;  3HUG A;  3RPQ A;  1LVA A;  1KGS A;  1G3T A;  3WU0 A;  3G73 A;  1UCR A;  3E3V A;  2VON A;  3GF2 A;  3GFI A;  1FBQ A;  4GXO A;  4QWQ A;  3F8F A;  5DD8 A;  2PLY A;  3I59 A;  4IJA A;  4EGY A;  4LFU A;  2FA5 A;  3MCZ A;  3HRT A;  3T5X A;  2HS5 A;  1DDN A;  4L18 B;  1CF7 A;  2A6E F;  3KP7 A;  3J7A O;  2AS5 F;  2DBB A;  2VC0 A;  2MH2 A;  5H6R A;  4AWX B;  5DCF A;  1WRJ A;  2DW4 A;  1MGT A;  1FP2 A;  4HA8 A;  1REP C;  3KZZ A;  2A61 A;  5ILU A;  3OV8 A;  4GCV A;  4HW0 A;  3K69 A;  5D5V B;  3GXO A;  2L01 A;  1KU2 A;  3HSE A;  4UV9 A;  4BQA A;  4WXC A;  1E17 A;  1WSU A;  1BI1 A;  2V1D A;  1B6A A;  4LG0 A;  2KIF A;  2VE8 A;  5LEJ A;  2P7C B;  3KLO A;  2VT2 A;  3ZN0 A;  1R00 A;  4PCQ A;  5EEH A;  2XKP A;  1D5V A;  4RGS A;  2YX4 A;  2IA0 A;  5F64 A;  2HYF A;  1ZN2 A;  3V4G A;  3CO7 C;  1KU3 A;  4M6Y A;  3IHU A;  4IPA A;  1WWX A;  1LDJ A;  4KYW A;  2RNJ A;  5D8K B;  4Y17 A;  1I1G A;  2QVO A;  2L4M A;  1BN5 A;  1SD5 A;  1EH8 A;  2PQ8 A;  3GYH X;  2MH9 A;  5CLS A;  3HOT A;  3E5X A;  4RAY A;  2FE3 A;  5KVR A;  2L02 A;  3V8L A;  3D0S A;  5ILS A;  3KFW X;  2MC3 A;  3WG9 A;  3HHG A;  5JI6 A;  4KNY A;  2PN6 A;  2KKO A;  3SFZ A;  2PEX A;  4U0W A;  4EQQ A;  1BI2 A;  1YLF A;  4RGX A;  1AOY A;  4U7B A;  2V6C A;  2E1C A;  3RI4 A;  4ESF A;  4MTD A;  3MAJ A;  2KJC A;  3PQJ A;  1O3Q A;  1FT9 A;  2H6B A;  3KP6 A;  3EYY A;  1ULY A;  4ZZD A;  5H20 A;  4ENK A;  3ZMT A;  1G3S A;  2JRT A;  3C18 A;  1RUN A;  2MLG A;  1W5S A;  3GFM A;  4OIP F;  5ICE A;  2OZU A;  5IT3 A;  1DUX C;  2EA4 A;  1J2X A;  4UV8 A;  3BJ6 A;  3BP8 A;  2LF8 A;  4A2U A;  2PI0 A;  1R23 A;  3VFZ A;  4LK1 F;  3SXY A;  3B73 A;  5HOO A;  4UVB A;  1J0R A;  1SFU A;  5L3F A;  3DF8 A;  1OPC A;  3TOA A;  3K0L A;  4HZF A;  3I58 A;  1GVJ A;  4LLG F;  1S3J A;  4A0Z A;  4R1H A;  3HSR A;  1H9G A;  2EB7 A;  2HWV A;  1TNS A;  3I5U A;  1GXP A;  5BPD A;  3WTZ A;  3KP3 A;  2XKO A;  1K78 B;  2XAS A;  1PP8 F;  2A6H F;  4P96 A;  5FGM A;  4F7Z A;  3KZY A;  2GQQ A;  2XV4 S;  3TO6 A;  1F9N A;  3BPV A;  3NRV A;  2FBH A;  2QWW A;  5AIQ A;  2DO7 A;  4LLL A;  4BHP A;  5E1X A;  5BS6 A;  3F6O A;  3TDU C;  5E1W A;  1IRG A;  4EGZ A;  3QRF F;  2EJR A;  1YW8 A;  2O61 A;  4OMZ A;  1J59 A;  4ZYE A;  3TQN A;  4P9U A;  2DLL A;  2NAZ A;  1I27 A;  4K2E A;  4L9T A;  5ILV A;  1LB2 A;  1Z91 A;  2CFX A;  2VC1 A;  3LA2 A;  4RB2 C;  3WE2 A;  2UWM A;  1H9T A;  1UST A;  2UXX A;  4R79 A;  2YSR A;  1V3F A;  4EJW A;  2HYG D;  2R3S A;  5E1Z B;  3BOQ A;  3TGN A;  4MQ9 F;  5LEK A;  2LDU A;  2QQA A;  5J8C A;  2H09 A;  2Q2E A;  1QBJ A;  3M9A A;  1HST A;  3WTS C;  4O6J A;  4PGG A;  2DPD A;  4XBF A;  1O7F A;  1G6N A;  5D5W B;  3WTY C;  3CUQ C;  4XLN F;  1NHA A;  4DQ2 A;  2HTJ A;  2RC4 A;  2G9W A;  2IA1 A;  1K79 A;  4CHU A;  2RGV A;  5DD4 A;  3EQL F;  4FX0 A;  3WTX C;  1IN5 A;  4ESJ A;  2FML A;  5TRD A;  5LGN A;  2M30 A;  3V7C A;  4XSX F;  4KFC A;  3J80 Z;  1QNT A;  5L3D A;  4HDV A;  3F72 A;  5L3G A;  1FBS A;  4BYY A;  1MZB A;  3J80 K;  3T8R A;  4BHC A;  1XGN A;  1KQ8 A;  1X3U A;  2DQL A;  4AVP A;  2QBY A;  3IWF A;  2VE9 A;  2O8X A;  1MJ9 A;  4G8X A;  2RQP A;  1XGS A;  3FXU A;  3MWM A;  3LA7 A;  2XIG A;  1TTY A;  3TO9 A;  2JPB A;  3R4K A;  4CIC A;  3E6B A;  2A3S A;  4OU0 A;  4I7H A;  5FB2 A;  3O3K A;  2XAG A;  1RIO H;  2FU4 A;  2VN2 A;  4GGG A;  2IW5 A;  3F8C A;  5LHH A;  4A12 A;  2FEZ A;  4UXN A;  2V1U A;  2P5V A;  4O3M A;  1S6L A;  1Q1H A;  1Z9C A;  1TLH B;  1BBY A;  3VOE A;  1AWC A;  5DCM B;  1S7O A;  1Z05 A;  3E97 A;  1KQ0 A;  2YPR A;  3GO5 A;  2HKO A;  1WKM A;  1TW3 A;  4HQE A;  4G6D A;  4IRI A;  4WXD A;  5CVR A;  3QP5 A;  3JSP A;  2Q8K A;  4LB6 B;  3K1P A;  3DKW A;  2OD5 A;  1IXC A;  1IF1 A;  1FWZ A;  2EFQ A;  5F6F A;  1I1S A;  2BGC A;  5FO5 A;  1KU9 A;  2D2W A;  2ZXJ A;  4U0Y A;  1ZLK A;  5LLQ A;  5L3C A;  3RYP A;  3N4M A;  5CVJ A;  5E20 A;  3L9F A;  2EFW A;  1IN8 A;  3KE2 A;  3I4P A;  1YQA A;  2M87 A;  3Q9V A;  2QQB A;  1U5T A;  1S7A A;  4LD5 A;  4N9I A;  3RKW A;  3CUO A;  5FD6 A;  3HTU A;  4ASN A;  5JR3 A;  4EMS A;  2F2E A;  1P4A A;  1GHC A;  3TO7 A;  1BC8 C;  2IP2 A;  3LAJ A;  2P5K A;  4IXA A;  2P6S A;  3DP7 A;  4UNO A;  4HF0 A;  4E70 A;  2IA2 A;  2O6G E;  2DT5 A;  4A0Y A;  3LQQ A;  4KN7 X;  1YW9 A;  4O5V A;  1B59 A;  4Q48 A;  3FX3 A;  4RS8 A;  3E6M A;  2PFB A;  2D45 A;  1F1Z A;  4EJU A;  4B8X A;  3T1B A;  3PQK A;  1HKQ A;  1ZHF A;  1LJ9 A;  2ZO4 A;  4P9F A;  2BE5 F;  5BPI A;  2ZBK A;  4NHJ A;  4ZZL A;  3HRS A;  4HX4 A;  3U1D A;  3GZ6 A;  4Q4Z F;  4OMY A;  2HQR A;  1MD0 A;  1F5T A;  3EYI A;  2PJP A;  1U2W A;  3IKV A;  1FSE A;  3DV8 A;  2CGP A;  3RTR A;  2OAZ A;  3IC7 A;  4N0B A;  3DEU A;  1XGO A;  1J7K A;  5HLG A;  3HHH A;  2JZY A;  2RDP A;  4KN4 X;  1XDU A;  3S2W A;  3RIR A;  5AIP A;  1S8N A;  1R22 A;  5D5U B;  4CDG A;  4BHB A;  3CTA A;  4N9H A;  2DU9 A;  4KUM A;  3O2P E;  3ZMS A;  4PDK A;  1FZP B;  3W6K B;  2P4W A;  2AXL A;  2ADU A;  2LSO A;  3F6V A;  1Z1D A;  3T8T A;  3ZMZ A;  1DPU A;  3PFI A;  1IRF A;  1BOA A;  5A2Q Z;  2ZCW A;  1LNW A;  5A2Q K;  1LDD A;  5E8G A;  1U5T B;  1IXS B;  2RVC A;  2G7H A;  3D5L A;  3E6D A;  1J9I A;  1XD7 A;  2XVC A;  2YR2 A;  4LJZ F;  3VB2 A;  2EFO A;  3QAH A;  2PG4 A;  5ED4 A;  5JHU A;  2ZME A;  4HDU A;  2QM3 A;  5ICF A;  1ZYR F;  1ZRE A;  1ODD A;  3WTV C;  1Z7U A;  2OQR A;  3HTS B;  1P2F A;  2CW0 F;  3ERE D;  1G3W A;  2BV6 A;  2OBP A;  1SD7 A;  1OYW A;  3QOP A;  4G7O F;  3MZH A;  1L3L A;  3WE3 A;  4G6Q A;  3GFL A;  4YFX F;  3I71 A;  1LEA A;  3GW2 A;  5E17 F;  2OQG A;  5DEQ A;  4WWC A;  4BH9 A;  5E8I A;  3VOD A;  3GLX A;  3ROU A;  4JBA A;  2DI3 A;  4U88 A;  1ON1 A;  3P7N A;  4HYE A;  3EUH A;  1Z6R A;  4BXU A;  1ZG3 A;  6PAX A;  3H3U A;  1IN6 A;  5BMZ A;  4ZH4 F;  2WV0 A;  1L0O C;  2EWN A;  2XAF A;  1T6S A;  4HF2 A;  1I6X A;  1RNL A;  3I54 A;  4EM1 A;  1WI9 A;  1BM9 A;  3GUD A;  3HYI A;  1BJA A;  1FSH A;  3ISP A;  4YIF A;  5CVI A;  2ELH A;  4YFN F;  2J5O A;  4HLY A;  3I59 B;  4H0E A;  5K5Q A;  3ZMV A;  2XRO A;  2UXN A;  5L3E A;  5JFR A;  1CF7 B;  3V7R A;  3ZMD A;  2X0L A;  4HX7 A;  4RAZ A;  2A07 F;  1SAX A;  1FPQ A;  3AAF A;  2C6Y A;  2A69 F;  3TDZ C;  2R7D A;  1Y0U A;  3Q9S A;  5HVQ C;  2LKP A;  3JAM Z;  4KT5 C;  3L00 A;  4M9X A;  1XSD A;  3JAM K;  4MQV A;  3J81 Z;  1PP7 U;  1Z6T A;  4ON0 A;  2DK5 A;  3ZMU A;  3J81 K;  2FQ3 A;  1R5G A;  4LG0 B;  3HSF A;  3WTT C;  5D4R A;  1FP1 D;  2STT A;  4I02 A;  1IXR C;  5LHI A;  5D5X B;  2CSO A;  1XSX A;  3H92 A;  2H27 A;  1RI7 A;  2CG4 A;  4HAM A;  2E1N A;  2VT3 A;  4I0B A;  1HW1 A;  2W25 A;  4KIC A;  1F4K A;  2G7U A;  2FMY A;  2DQR A;  2H94 A;  2ISZ A;  2Q0O A;  2EFP A;  3I53 A;  2Z5U A;  2F5E A;  5J8F A;  3FHZ A;  3F8B A;  5DDG A;  3WGG A;  3LQR A;  2ZME B;  3E5U A;  3P9C A;  3MFK A;  1XN7 A;  1LDK B;  2M45 A;  2HGC A;  1OYI A;  2EV5 A;  3CLO A;  3GZ5 A;  1V4R A;  3COA C;  2CQK A;  3IRR A;  3B02 A;  4WF2 A;  3F3X A;  5D6E A;  4CXF A;  3FF5 A;  2W84 A;  1ZAO A;  2ZKZ A;  3NQO A;  1SFX A;  3L7W A;  4HV6 A;  2A68 F;  4UHT A;  2EK5 A;  4L5I A;  5CVU A;  2ISY A;  3FMS A;  1IZ1 A;  1J5Y A;  3BWG A;  1R36 A;  2PMU A;  3F22 A;  3SZT A;  1YYV A;  1W4M A;  2VBY A;  5H6Q A;  3T0Y A;  3R61 A;  4I98 B;  1FYK A;  2RV8 A;  3V8K A;  1XMA A;  4IRH A;  4U0V A;  4G94 A;  2BBY A;  1FBU A;  2VBZ A;  2NNY A;  3MEX A;  4KDP A;  2RKH A;  1UHW A;  2GWR A;  3V8J A;  1E2X A;  1T0F A;  4HBL A;  1SMY F;  1HKS A;  5ICC A;  2NNN A;  2K7L A;  1R7J A;  3EET A;  2M8E A;  1A04 A;  4WX9 A;  2Z99 A;  5FFX A;  5ICG A;  2D1H A;  2A5Y B;  1GXQ A;  3KEQ A;  5CVV A;  2GAU A;  2HEO A;  2MBF A;  2Y75 A;  4I01 A;  1P4W A;  1PUE E;  3QU6 A;  4HX8 A;  3BZ6 A;  3K9T A;  5K5R A;  2K4J A;  1EV7 A;  2E7X A;  4M9Z A;  4HLX A;  4AD9 A;  1HSJ A;  4RB3 C;  2P6T A;  2VOP A;  1JHF A;  1XB4 A;  4XLP F;  4A6D A;  5E18 F;  1BIA A;  4YFK F;  2E7W A;  3L09 A;  1D8J A;  1SD6 A;  2DPU A;  3K1N A;  1O57 A;  3WTW C;  2XHK A;  4OIR F;  1K7A A;  3RYR A;  3JW4 A;  2ESH A;  3WGI A;  3WTU C;  1TNT A;  5L3B A;  3FWE A;  1FY7 A;  2RN7 A;  3LST A;  2UZK A;  3TOB A;  2Y48 A;  4L9V A;  1W7P A;  3RKX A;  2NS0 A;  5K1Y A;  5D4S A;  1YTY A;  2QQ9 A;  3HRU A;  4G7H F;  4ENN A;  1OYY A;  1XCB A;  4IVN A;  4EVI A;  5HDK A;  4OIQ F;  2QLZ A;  4NB5 A;  4FHT A;  4NQW A;  5ERI A;  2VBX A;  4IRG A;  4KIG A;  2IT0 A;  1HKT A;  2Z3Y A;  3BJO A;  3ML6 A;  3DXJ F;  3W6J B;  2CWE A;  2EA2 A;  1R5H A;  4LMY A;  2W24 A;  3FM3 A;  4DNC A;  3ULQ B;  3GVA A;  4S05 A;  1T98 A;  2PMH A;  3QPH A;  3HIF A;  3SZP A;  3BDD A;  3KCC A;  4Q5S F;  4ZYG A;  4PZJ A;  2HR3 A;  4MEY F;  2FNP A;  1YS7 A;  4BNC A;  3SHF A;  3ELK A;  1MDM A;  2QBY B;  5K5O A;  1U6G A;  4WK8 F;  2JT1 A;  3M7G A;  2XAQ A;  3WGH A;  2XGX A;  4OOI A;  3LA3 A;  4M6X A;  4UVC A;  3R6S A;  3LWF A;  2PBI A;  1XMK A;  1ZAR A;  1TQP A;  2QUF A;  4I0A A;  4S04 A;  4Y15 A;  4AIJ A;  1ZRC A;  4AIH A;  2CYY A;  3LFK A;  4JK1 X;  5EEG A;  4GO1 A;  1WQ2 A;  2VOD A;  1T39 A;  3HRM A;  1JE8 A;  3M1E A;  1KA8 A;  2EV6 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...