3WU1B

Crystal structure of the ets1-runx1-dna ternary complex
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
105
structure length
105
Chain Sequence
GPIQLWQFLLELLTDKSCQSFISWTGDGWEFKLSDPDEVARRWGKRKNKPKMNYEKLSRGLRYYYDKNIIHKTAGKRYVYRFVCDLQSLLGYTPEELHAMLDVKP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Runt-related transcription factor 1
publication title A novel allosteric mechanism on protein-DNA interactions underlying the phosphorylation-dependent regulation of Ets1 target gene expressions
pubmed doi rcsb
source organism Mus musculus
molecule tags Transcription/dna
total genus 35
structure length 105
sequence length 105
ec nomenclature
pdb deposition date 2014-04-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00178 Ets Ets-domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 3wu1B00
2UZKA 2H94A 1G4DA 2ZCWA 2WV0A 1WQ2A 3FM5A 2O61A 4L9JA 1ZN2A 1XDSA 2WWYA 1XSVA 2VT3A 3TO6A 2EV5A 2GQQA 3RKXA 1ZLKA 1FOKA 3V7RA 2WC2A 3LA3A 4EJOA 2JZYA 4HV5A 1ONVA 1G3SA 2ZO4A 1KYWA 3HIFA 3I0TA 2IA1A 1H9TA 3ZMSA 1YW7A 5EEHA 3KFWX 2PLYA 4LK0F 1W7PB 4MEYF 1WSUA 2HKOA 4EM2A 3JW4A 1QZYA 2K27A 4I0AA 4U88A 1YYVA 4M9ZA 1RUOA 3RTRA 1YS7A 4D0PA 4LGWA 3BROA 4EGYA 3MAJA 3W6KB 3GO5A 2ZMEB 5DD4A 4ESBA 2JRTA 1HKSA 2K7LA 1I1SA 4JBAA 1IRFA 3WTUC 1HW2A 5JVTA 2M45A 1XSXA 1W4MA 1X3UA 1STZA 5HS7A 5BOXA 3P9KA 4Q5SF 2ZFWA 4MEXF 5DCFA 1S3JA 5F1RA 3I59A 5DUKA 2XV4S 4EM1A 3I5UA 4YFNF 3T8TA 1FPQA 2BYVE 1OYIA 5LHGA 2ISYA 1J2XA 5F64A 1U5TB 2GWRA 5ICCA 1I6XA 3JTHA 1ZH5A 4EVIA 2VBZA 2QWWA 3WTYC 2IVMA 1B9NA 4HA8A 1UHMA 3IKVA 2CSOA 2STWA 2IP2A 2QENA 1IXRC 4YFKF 2LF8A 1K6OA 4KN7X 5LEKA 1O3SA 5JFRA 3I59B 1B6AA 2R7DA 4HDUA 4LJZF 4AVPA 1D8JA 4KMUX 4MHGA 1LDDA 2ZNYA 1W5SA 2K86A 4KMFA 1P2FA 1R1TA 1RUNA 3N4MA 1I27A 2P4WA 1IUYA 4HAMA 3MQ0A 1E17A 4ZYHA 2NRAC 1T2KA 2D1VA 3C7JA 5EEGA 5FFZA 3T5XA 5L3FA 1BJAA 4TV7A 1RI7A 2DW4A 2QBYB 5A2QZ 2J5PA 4XSZF 1S7OA 3LQRA 3TQNA 3U9GA 3GZ5A 1QPMA 3ULQB 4HW0A 1AWCA 3J81K 2QQ9A 2DAOA 2ZNZA 3EYIA 2JSCA 2L54A 2UXXA 3ECOA 4M9XA 1OYWA 3ZMUA 2G9WA 5FD6A 3KETA 3V7SA 1G3YA 2GIVA 2VBXA 1I5ZA 2PJPA 3K1MA 1LNWA 1IXCA 2R3SA 1EH7A 4G6QA 2VOOA 2YX4A 4HQEA 3ZMTA 5IT3A 5LEJA 2GAUA 3GW2A 5D8KB 3JSOA 4GCVA 1FZPB 5ILSA 1SD7A 2C6YA 5FFXA 4Q47A 1BM9A 2VBWA 1HW1A 2DK5A 4M9SA 2OBPA 2IW5A 4OIQF 2D2WA 2MBFA 1SD5A 3KP4A 1KU3A 4L0ZB 1XGSA 1QGPA 4R79A 2YPRA 1IW7F 4CGZA 3E3VA 1O3RA 5FD5A 3V8KA 1BC7C 1WI9A 2DLLA 3SHFA 2CGPA 3MWMA 4O5VA 1GVJA 2HS5A 4GYIA 4ESJA 1SD6A 4S04A 1O3QA 2BE5F 4OMZA 3F8CA 3WU1B 1KYZA 4M6YA 1MGTA 2XKOA 3L7WA 1R1VA 1D3YA 5HLIA 4IJAA 2M1BA 2V1XA 2FXAA 3MEXA 3GYHX 3F6OA 2TDXA 2L3DA 4KIFA 1FSEA 3CO6C 3W6JB 2E7XA 1Z1DA 3DKWA 5D4SA 2FE3A 4LFUA 3LQQA 2DU9A 2KIMA 2FQ3A 3WTVC 1IN6A 4LB5A 3SXYA 3HHHA 4AIKA 1PUEE 4RAZA 1BBYA 1P92A 2FEZA 4M71A 4ENKA 4BHBA 3FXQA 4IRHA 5CLSA 2NAZA 1ZG5A 3PQKA 1XDUA 2JTVA 4NB5A 5KK1A 3HTUA 1HXDA 3FX3A 3V8LA 3LFKA 3F8BA 2KIUA 1S8NA 2MLGA 2KIFA 4Z2YA 5DDGA 1F9NA 3TO9A 2LDUA 1HSJA 3K1PA 1TW3A 3QU6A 5H20A 2MC3A 4ENJA 2HDCA 3WTTC 1YW8A 3L2CA 1G3TA 2M5WA 4ON0A 2Y0MA 1DP7P 1V3FA 4L5IA 3ML6A 2IRFG 3IWFA 2BEOA 3I54A 2DK8A 3HOTA 3WTSC 2IT0A 5HDKA 3OV8A 3ZMDA 5L3EA 2OAZA 5LGUA 3RPUA 1B1BA 4ETSA 1IF1A 4O3MA 3DFGA 3BJ6A 2FA5A 1FY7A 2EA2A 2XAGA 4PDKA 2JPCA 1D5VA 1T6SA 3VEPA 4WCGA 1Q1HA 3KP2A 3KP3A 3RPQA 1R58A 3P7NA 5D8LB 1UHWA 4OMYA 2QQBA 1U5TC 3PQJA 3I4PA 2IA2A 2H6CA 5ICFA 1XSDA 1OMIA 1BI0A 1FBUA 1LDKB 1SMYF 3KZZA 2DPUA 1QNTA 4PGHA 1KA8A 5BPDA 4G7OF 3LAPA 1ZREA 2DT5A 4MGRA 1LDJA 3MZHA 2P5VA 4KIBA 2KKOA 1T39A 4MQ9F 1W7PA 5L3GA 2H6BA 3IHUA 1DPUA 3U1DA 2XVCA 1O3TA 2VE9A 1IAWA 4UVAA 1KQ8A 5BQTA 2Q8KA 1IN5A 4I02A 4WWCA 2OZUA 2M87A 4M72A 4R8HA 5K5RA 4UV9A 5D6EA 2ZMEA 5D5VB 3F22A 3RDIA 1KU2A 3EUHA 4CYDA 2HTSA 2XGXA 1REPC 3CLOA 3LA2A 2NYXA 1WWXA 2X0LA 3E97A 5FO5A 2EJRA 1HSTA 2XHKA 3H3ZA 3I53A 1XMAA 4HZFA 1GXQA 4I01A 3QPHA 2VE8A 3J81Z 3L9FA 1Z05A 2RN7A 3ZMZA 3WTZA 4ZZDA 2E1CA 3CO7C 1PDNC 3I58A 2A3SA 1U5TA 2NNYA 5LHHA 2RQPA 4RB0A 4N0BA 3TDUC 4L9TA 2W84A 1A04A 4RS8A 1YFHA 4YFXF 3KE2A 2GXGA 2RKHA 3I64A 3B73A 5L3BA 3CUQB 2EV6A 1LEAA 3HHGA 1BI2A 4KFCA 5J6XA 1HBXG 1TQPA 3FZVA 4ESFA 3ZP5A 2NS0A 5ERIA 4OIOF 2E1NA 4DNCA 1Z9CA 4HLXA 3QP5A 2NNNA 1FX7A 1WKMA 2PG4A 1B4AA 3E6MA 4F7ZA 2GA1A 5CJ9A 4N9IA 1ZRDA 2HWVA 5HVQC 2HYFA 4KIGA 4JK1X 2K4JA 4IHSA 1XD7A 4K2EA 4BXUA 2AXLA 2A69F 2FMYA 1FYLA 2QBYA 4ZYGA 4HF2A 2Y75A 4RB2C 3HRTA 5LRSA 1TBXA 2D1HA 4S05A 3REOA 2ZXJA 1R36A 3QRFF 1EH6A 3R6SA 1J7KA 2VOPA 3FXRA 2H27A 3KP7A 2XIGA 2IPQX 1ODDA 3J7AO 5IT9K 5JHUA 5E8GA 2G7HA 4G6DA 5CVVA 4M74A 2V1DA 2P5LC 1MDMB 1F5TA 4UV8A 5HDGA 2HQNA 1FNNA 3MFKA 3R60A 4DQ2A 4LK1F 2FNAA 3JTGA 3SZTA 5E18F 5CYVA 5DYMA 2HZTA 5DCMA 1UCRA 3ROUA 2FRHA 2LKPA 5D5UB 2XAQA 4EJWA 1C0WA 3FMQA 2VC1A 2Z33A 5TRDA 4P5OA 4A0XA 3GEZA 4YG2F 3E5UA 2ELHA 4BQAA 1IN4A 3COAC 2EK5A 1K78A 2P6SA 4CICA 3EDPA 4U0WA 4OIPF 3BDDA 3GFLA 4OU0A 2XROA 1BOAA 1XN7A 1YQAA 1UFMA 2VXZA 3WGGA 2RC4A 4QLCU 1S6LA 5D6FA 4I0BA 3B02A 4EGZA 1YTYA 2A6HF 5CVUA 2FNPA 4LLGF 3HSRA 3SFZA 4LB6B 3L00A 4HBLA 1Z6RA 3GVAA 1GXPA 4WF2A 3KP5A 5DCMB 1JHHA 4B09A 3RI4A 4EJTA 5E17F 2HKXA 4ASNA 3M7GA 5ILUA 1J75A 2XUBA 3RYPA 5HOOA 5LRRA 4GYGA 1JGSA 1K78B 5KVRA 3SZPA 1VTNC 2FSWA 2PMUA 5CVJA 3IRQA 2A61A 2O0YA 3S2WA 3CUOA 3T0YA 1USTA 2L01A 2PMHA 3VODA 5FLXK 2CFXA 3FM3A 1O7FA 1D8KA 4IHTA 4MTDA 2W85A 4HYEA 4I2OA 3ZQ7A 3FMRA 5FGMA 1IRGA 4JQFA 5DEQA 2HGCA 4RGXA 3F72A 2OQRA 1LVAA 2XAFA 1HKTA 4H0EA 5ILVA 3TDZC 2EFOA 4LD5A 1S7AA 1L0OC 2B0LA 4BHPA 2ZJ2A 3CJNA 4P9UA 1RZ4A 3IL2A 2OU2A 1U3EM 4PGGA 2FMLA 3C3WA 5AIQA 1W5TA 3IC7A 2PQ8A 5D5XB 3FXUA 3ZN1A 4XLPF 4IRGA 4LG0B 2HEOA 1OR7A 4G7HF 3J80K 3N97A 3I71A 5DUIA 4HDVA 5ICEA 1SFEA 5HLHA 4A0ZA 1F4KA 4GGGA 1OKRA 4ZZLA 4GXOA 2JT1A 2F5DA 5E1WA 2P7VB 1T0FA 3DF8A 5J8CA 1MZBA 4UVBA 2KJBA 3QAHA 2P6TA 2P8TA 1HW5A 1O7LA 3BP8A 4EQQA 1J9IA 2F5EA 3F6VA 4GO1A 1TLHB 3RKWA 4A2UA 1YO5C 3F3XA 4N9HA 3EQLF 4U0VA 3R0AA 1E2XA 5L3CA 1V4RA 3WE3A 4I09A 2VT2A 3ZN0A 4A6EA 3K9TA 1ZRCA 5LBQA 2DPDA 5HS9A 2HR3A 2M30A 2EFQA 2F5FA 1FBQA 4OIRF 1ZHFA 1S29A 4IVNA 1R23A 2LNBA 3ZMVA 2FF4A 1KU9A 3RJPA 4RGSA 3K0LA 2IJLA 4Q4ZF 4B8XA 1TNSA 3CUQC 3JAMK 1MJBA 1YS6A 2MLKA 4ZYEA 2PBIA 2VODA 2DQRA 4P55A 2QM3A 3KLNA 1FC3A 1FT9A 2YSRA 3BY6A 2V79A 3G3ZA 1XCVA 4UXNA 2ESNA 3GXOA 4XLNF 1ZARA 4L5JA 1R1UA 2W57A 2G7UA 4XBFA 3FWEA 1K79A 5JI6A 2UXNA 1R22A 1LQ1A 2J5OA 2YX7A 3EYYA 5ICGA 1LEBA 1SD4A 4G94A 4FHTA 1K7AA 4YIIA 3R0JA 3R61A 2XRNA 2EB7A 4BNCA 3O6BB 2IA0A 3GFIA 3ISPA 4MTEA 2QZ8A 2ISZA 1B9MA 3WTXC 1TQMA 1NHAA 1U8RA 1FWZA 5IT9Z 4P96A 3KEQA 1B59A 4EJVA 1P6RA 1U2WA 2QLZA 3HOSA 3M8EA 5E1ZB 2Z9OA 5BS6A 3G73A 4U7BA 3DPLC 5HS8A 2M8EA 3DV8A 1XMKA 3E6DA 3GFJA 2RDPA 4KA4A 2ACJA 1I1GA 3CUQA 4ZYDA 1BIBA 3L09A 4LLNA 4G9YA 1CGPA 3D0SA 1EH8A 1GHCA 1ZAOA 2KJCA 5K5OA 4NHJA 5AONA 3K1NA 4RGUA 2W24A 4HOBA 2A6EF 2UWMA 3QPTA 3PFIA 3E5QA 2KRFA 1TW2A 3GF2A 4AIHA 1OPCA 3SQNA 5CVRA 1R5GA 4EMSA 2CG4A 3F8FA 3E5XA 1TNTA 4KICA 5DD8A 3P9CA 1T38A 1LB2A 1TTYA 2HYGD 2MH2A 3CTAA 4AIJA 4KT5C 2K02A 3NQOA 3KCCA 1P4WA 3QOPA 4CDGA 2COMA 3DP7A 1ULYA 1YIOA 2V9VA 1XGNA 5HDNA 3TOAA 4FX0A 4BAYA 1J0RA 5LGTA 3M1EA 2BBYA 3BPXA 1ZG1A 4LLLA 1R00A 3MCZA 1J5YA 3ELKA 4OINF 2Z3YA 4U7DA 2L02A 1WRJA 4RAYA 1OYYA 4MQVA 6PAXA 2OD5A 4A5NA 4IXAA 2BGCA 3RIRA 3QU3A 5LGNA 1MDMA 1XGMA 5FLXZ 5LLQA 1YW9A 1ZYRF 2DFIA 1AOYA 2LSOA 2OQGA 4PCQA 4HQMA 1USSA 4A12A 2JPBA 3V8JA 4M73A 3K2ZA 4KYWA 1JHFA 3ECHA 5E1XA 5CVIA 2F5CA 3WTWC 3AAFA 4L0YB 3M8FA 1O57A 3WE2A 2P5KA 2OZ6A 1ZGJA 4A5MA 1QZZA 3F8MA 4UUVA 3O3KA 2X4HA 4XRFA 4EV0A 4L9VA 2CW0F 2F2EA 2GZWA 2BV6A 4L9NA 1RNLA 3H92A 4BHCA 4ENMA 4KDPA 2GXBA 3QP6A 4RGRA 2A68F 3KZYA 2E7WA 3K69A 5D5WB 3IRRA 4OOIA 3KLOA 3HSFA 3J80Z 4ZH4F 3C1DA 3LAJA 2O6GE 5D4RA 2FBKA 3HYIA 1MKMA 3BWGA 3Q9SA 3R4KA 4A6DA 1ON2A 3BZ6A 2R7FA 2P7CB 1KGSA 2HFHA 4IPAA 3T8RA 4KN4X 3WU0A 3IKTA 1MD0A 2VC0A 3ABUA 3RKYA 1MJ9A 2QVOA 3RYRA 3TKYA 3F8NA 1LJ9A 1FLIA 2O3FA 1QBJA 4RB1A 4G8XA 2PEXA 2VN2A 1P4XA 5F6FA 2V6CA 3LA7A 2XKPA 3HUGA 2RV8A 2RGVA 2D45A 1Z7UA 4A0YA 1HQCA 4L18B 3MZYA 4IRIA 4Y17A 4KUMA 3HTSB 4R1HA 4PZJA 4M6XA 3JAMZ 1J59A 1UB9A 3WG9A 5J8FA 2W25A 4HX4A 4AD9A 3FHZA 2OA4A 2DI3A 1U6GA 3V7CA 4U0YA 2HTJA 2YU3A 5DV5A 1CF7A 3WGIA 4AWXB 1FBSA 3F21A 1IZ1A 1P4AA 1HKQA 1SFXA 3D5LA 2DO7A 4LG0A 1YLFA 2RVCA 3TOBA 1ZRFA 2WTEA 2MH9A 3CDHA 4WXCA 1DDNA 1ZG3A 3NRVA 1KQ0A 1YG2A 2RNJA 4RB3C 4FX4A 1Z6TA 4WXDA 3EETA 1T98A 3ABTA 2Q2EA 4Y15A 3OOPA 1TQIA 1G3WA 2Y48A 3BJAA 3DQVC 3WGHA 2EA4A 3GFMA 1CF7B 4WX9A 4Q48A 2MD5A 4I7HA 2EWNA 3LSTA 3VOEA 5E8IA 1IXSB 1KQ9A 3GX4X 5FB2A 4BH9A 5K1YA 3ERED 3JSPA 2V1UA 1G6NA 2AS5F 3E6CC 1IN7A 1ON1A 3M9AA 1W7PD 2XASA 2VBYA 3C18A 3TGNA 1PP7U 4E70A 4FT8A 2FU4A 1MJAA 3HRSA 3VFZA 1FP2A 3Q9VA 4NQWA 1BI3A 2Q0OA 3U2RA 2ADUA 4UVCA 2XAJA 1DUXC 5A2QK 2DQLA 1FYKA 4HF1A 2EV0A 1ZLJA 2FOKA 1XCBA 2CO5A 2CWEA 2ESHA 3DEUA 4WK8F 4BYYA 2PN6A 4CHUA 1FSHA 5E20A 5TJJA 5H6QA 1QQIA 5JR3A 2EFPA 1BN5A 2CQKA 2GA2A 2VONA 5H6RA 4CO8A 4UHTA 2LF7A 2A5YB 2XAHA 1JE8A 4P9FA 3E6BA 2L4MA 3ZPLA 1RIOH 4KNYA 2QQAA 4HLYA 1H9GA 5BPIA 2K4BA 4HX8A 3DPTA 4QWQA 2A07F 5ED4A 2MA3A 2Z5UA 3KEOA 5L3DA 1FP1D 4EJUA 3BJOA 4LMYA 1FYMA 4MNUA 1DPRA 4WXHA 1BIAA 5HLGA 5K5QA 3DXJF 5BMZA 2PI0A 3GUDA 1KU7A 2FBIA 3NEUA 1Z91A 2EFWA 2STTA 3BOQA 3KP6A 1QO0D 4ENNA 3HRMA 4YIFA 1Y0UA 2QYOA 2DTRA 2YR2A 1JXSA 3F23A 1H0MA 3GZ6A 3GWZA 2FBHA 3P9IA 4IF4A 2EFNA 5AIPA 1SMTA 4UNOA 4EM0B 2CYYA 2PFBA 1U78A 3FF5A 3O2PE 3TO7A 4HV6A 1XGOA 1L3LA 3V4GA 1XB4A 3GLXA 3T1BA 5LHIA 1SAXA 2DBBA 4CZZA 1IN8A 2ZBKA 4HX7A 3VB2A 4G7ZF 2HOEA 3HRUA 2ZKZA 1BI1A 1PP8F 2HQRA 3BPVA 2Z99A 1R7JA 2QUFA 3HSEA 1BC8C 4I98B 3FMSA 3IWZA 1ZGAA 4XSXF 1EV7A 2O8XA 3H3UA 2H09A 2L4AA 3WODF 1SFUA 4O6JA 4Y13A 2ETHA 2O03A 3Q5FA 4CXFA 1R5HA 1F1ZA 4HF0A 3LWFA
chains in the Genus database with same CATH superfamily
3S1RJ 2UZKA 5EGOA 2H8RA 2H94A 1G4DA 2DJIA 2ZCWA 4I99C 2WV0A 1BL0A 2IS2A 1WQ2A 3Q0UA 3FM5A 2O61A 4L9JA 3A01B 1ZN2A 1P7IA 1XDSA 2PJRA 2WWYA 5HODA 1JKPC 1XSVA 3S8PA 2VT3A 3TO6A 2EV5A 3GTOJ 2VJJA 2O8KA 3VYUB 2GQQA 3RKXA 3DBLB 1ZLKA 5EG0A 1SVLA 1FOKA 4MO7A 5J1RA 3V7RA 2MC4A 4DOZA 1TWHJ 4DIQA 2XPUA 4CYCB 3ZQLA 1UZCA 1IGNA 2WC2A 1ETQA 3LA3A 1YJWI 1TL8A 5DM6F 4EJOA 2JZYA 4HV5A 1MSEC 1QU3A 1ONVA 1G3SA 1G2HA 2ZO4A 1KYWA 1AKHA 3HIFA 3I0TA 5LD2C 2IA1A 1H9TA 3ZMSA 1YW7A 1B8IA 5EEHA 1HC8A 3KFWX 2PLYA 3BTJA 4LK0F 1W7PB 4MEYF 3OSGA 1WSUA 4XRSG 2HKOA 4EM2A 3JW4A 1QZYA 3QPLA 2K27A 5GTHC 5EGOB 2BXYA 2JA2A 4I0AA 2BXZA 4U88A 1YYVA 2ID6A 4M9ZA 1RUOA 2AO9A 3RTRA 2R7SA 1EA3A 1YS7A 3KYLA 2LLKA 4D0PA 4LGWA 3H9JA 3BROA 2LKSA 3PNYA 2D5VA 4EGYA 5FJ8J 3MAJA 2DJNA 3W6KB 1N78A 1CQTA 5EG0B 3GO5A 2ZMEB 5DD4A 4ESBA 4RLFA 2JRTA 1HKSA 3JRIA 2K7LA 2O9LA 1I1SA 4JBAA 2L9SA 1IRFA 2L9VA 3FXLA 3WTUC 1HW2A 2VJIA 5JVTA 2M45A 2AXTC 1GT0C 1SAUA 1XSXA 1W4MA 1X3UA 1STZA 5HS7A 4GRIA 5BOXA 3L2VA 3P9KA 2NOGA 4Q5SF 2M3AA 2ZFWA 5LFAA 5DCFA 4MEXF 1S3JA 5F1RA 3I59A 1U9OA 2BVMA 2XV4S 4NC8A 5DUKA 2OTLI 9ANTA 4EM1A 3OYEA 2ME0A 3I5UA 4BXXJ 1A6IA 1EKEA 3W6VA 1GDTA 3IAM2 3PUBA 2GIZA 3T8TA 4YFNF 1FPQA 2BYVE 1OYIA 5LHGA 2ISYA 1J2XA 2JVGA 4A3EJ 5F64A 1U5TB 2GWRA 4IL6C 2QSGX 2UV1A 4BBRJ 5ICCA 5IPAA 1I6XA 3JRCA 2CJJA 3OS0A 4ZDOA 1DGRM 5J3LA 3JTHA 1ZH5A 4EVIA 3OYIA 2VBZA 3BTLA 2XGCA 2QWWA 4V19K 3MMYB 2ZJQF 4OWRB 2IGMA 4E4HA 4EATA 3WTYC 3WU2C 5F0HA 3A0HC 2IEKA 2IVMA 1B9NA 2E35A 2EBIA 4HA8A 3S32A 4MLOA 1UHMA 1JKOC 3IKVA 2DOFA 3M1CA 2V9PA 2F6CA 3FISA 3OR2C 1ZTRA 2CSOA 1HCRA 2IP2A 2STWA 2QENA 1TWGJ 1IXRC 4YFKF 3S14J 2VKHA 4JX5A 2LF8A 1K6OA 2ZXHA 2HNHA 4KN7X 5LEKA 1O3SA 2NVXJ 3GTPJ 5JFRA 3I59B 1B6AA 3BR0A 1F36A 2R7DA 2DA7A 4HDUA 4LJZF 4AVPA 1IG7A 2WB1N 1W0TA 3CJRB 4AYBN 1D8JA 2HDDA 4KMUX 3FXJA 2E1MC 4MHGA 1LDDA 4U87A 2ZNYA 1W5SA 1TWAJ 2K86A 1OCPA 3FXKA 3DLLF 4KMFA 2M4KA 1P2FA 2Y9ZA 1R1TA 4C3IJ 2GOMA 2L0KA 3ERMA 1RUNA 3N4MA 4LIUA 1I27A 3K4MA 2P4WA 1IUYA 3S17J 4HAMA 3MQ0A 1E17A 4ZYHA 1VQPI 1NG7A 2NRAC 3GMEA 1LFBA 1T2KA 3M8JA 2D1VA 2LY1A 4PFOA 3C7JA 5EEGA 5FFZA 3T5XA 5L3FA 1BJAA 2Y69H 4TV7A 2QKMB 4DBQA 1RI7A 2K3PA 1FEXA 3OYNA 2FUG2 4DW6A 2DW4A 2Y2ZA 4C9YA 2QBYB 1JKRC 1LVKA 2L7MP 1X2NA 4RAFA 5A2QZ 4XRSA 2J5PA 1GV2A 2N8GA 1SVMA 4XSZF 1QA6A 1JUPA 2ZJPF 1S7OA 3LQRA 3ABLH 3TQNA 3U9GA 1Z67A 4NUBA 3GZ5A 1JUSA 1QPMA 3ULQB 4HW0A 1H89C 1AWCA 1QPIA 4E7HA 4XLFA 3J81K 2YU9J 2XPVA 2QQ9A 2DAOA 2ZNZA 2GM4A 3EYIA 4Z6YA 5KNLA 1Y39A 2JSCA 1G8XA 2L54A 2UXXA 3ECOA 4M9XA 4XORA 1OYWA 3TP0A 2Y31A 4UB6C 2KFDA 1WH5A 3ZMUA 3HOWJ 3O8GA 2G9WA 4MIMA 5FD6A 3FHNA 2CQ7A 3KETA 4ANJA 1PYVA 3V7SA 2L2OA 1G3YA 1ZR2A 1VZ0A 3OYHA 3KIOA 1YIJI 2GIVA 2V26A 2VBXA 2OV7A 1I5ZA 2BY0A 5M3MJ 1ZELA 4A3KJ 4XONA 2R7RA 4B4CA 2PJPA 3K1MA 1LNWA 1KONA 3TW6A 1IXCA 2R3SA 1EH7A 4G6QA 3GZNB 2VOOA 3GTKJ 2YX4A 4HQEA 2ZFUA 3ZMTA 1MBHA 5IT3A 5LEJA 2GAUA 3GW2A 5FRMA 2WAQN 5D8KB 3PJRA 3JSOA 2HXOA 2MFZA 4GCVA 4CCNA 1FZPB 5ILSA 1SD7A 2C6YA 5FFXA 4Q47A 4C2MJ 4MFEA 3ZQFA 5B3SH 1DU6A 4BDYA 4XM3A 5GPAA 5B66C 3D1NI 1BM9A 2VBWA 1HW1A 2OCCH 1W1WE 1X19A 3S1MJ 2DK5A 2R7TA 1LFPA 5KAIC 4M9SA 2OBPA 2IW5A 4H4KC 4OIQF 4FQGA 3HJEA 4HEA2 4C3HJ 2D2WA 3IH2A 2MBFA 2JN6A 1SD5A 2CUFA 2E5ZA 3KP4A 1KU3A 4L0ZB 1XGSA 2ZSIB 3ZQIA 1QGPA 2E2JJ 4R79A 2YPRA 2H1LA 1IW7F 5IYBJ 1BR1A 4CGZA 4X6AJ 4BY7J 3HDDA 1YHQI 2DTZA 3DWLE 2O5RA 3K2AA 5DTDA 1RETA 3E3VA 4BJ6C 5EYRA 4RMNA 1O3RA 2HXIA 5FD5A 3V8KA 2X6XA 1LKXA 1BC7C 4CSWA 1WI9A 4EEFG 1BR4A 1FIPA 1VNDA 2DLLA 3SHFA 2CGPA 1RESA 4G6TB 3MWMA 4O5VA 2BZTA 1GVJA 2HS5A 1OLTA 4GYIA 2R7WA 4M3GA 3I3LA 4ESJA 1IDYA 1SD6A 3SFIA 4S04A 1O3QA 2BE5F 2R0QC 4OMZA 3F8CA 3WU1B 4B43A 1KYZA 4M6YA 1MGTA 1ZKGA 2XKOA 2XSDC 3BG3A 5GPCA 3RQ4A 3I4MJ 4BJTA 4CA0A 4BS9A 3NAUA 2JUCA 3C2HA 3OYKA 1D0ZA 3TMOA 3J7AY 2KISA 2LBFB 3L7WA 1OCZH 1R1VA 3KPHA 4ITVA 4AUXA 1D3YA 5HLIA 1A35A 4IJAA 2M1BA 4NC7A 3DBHB 4BGDA 3DKYA 3LSIA 2R92J 2WBMA 3HGYA 2V1XA 2FXAA 3MEXA 3GYHX 1FJLA 3CDIA 3OYDA 1NG6A 5M3FJ 3F6OA 2E34A 2TDXA 2L3DA 4KIFA 1FSEA 4RAGA 4XL9A 2E71A 3CO6C 1FMVA 2LREA 1R4NB 3DCFA 1HOMA 1M1EB 2IXSA 4ZDPA 1QVTA 3W6JB 5EEAA 2E7XA 3B6CA 3CCUI 1Z1DA 1F43A 3DKWA 5GAGJ 5D4SA 3OYBA 2M0CA 5HLTA 1K83J 2FE3A 4LFUA 2M7BA 3LQQA 2DU9A 1U0JA 4QIWN 2KIMA 2FQ3A 3WTVC 4QSHA 1WVRA 1IN6A 1PUFB 4LB5A 3BCAA 4A3IJ 3SXYA 3MKLA 3HHHA 5DM7F 3LSHA 4AIKA 1PUEE 2K85A 4RAZA 3K7AJ 3L2QA 1BBYA 1P92A 2FEZA 4M71A 4ENKA 2DT7B 2K9SA 4BHBA 2KRCA 3FXQA 4IRHA 5CLSA 3MKYB 2NAZA 1ZG5A 3CMAI 2ID3A 4RLQA 1SEUA 3PQKA 2W1OA 1W36C 3DEWA 3HZJA 2R7QA 1XDUA 3H36A 2JTVA 1R4MB 4NB5A 5KK1A 3HTUA 1HXDA 3FX3A 3V8LA 3LFKA 3F8BA 2KIUA 1Y0NA 1S8NA 2MLGA 3FK6A 2KIFA 2IBDA 1LE8A 4Z2YA 5DDGA 3LSRA 1F9NA 3TO9A 4BDZA 2LDUA 1HSJA 1R6RA 3K1PA 1T33A 1TW3A 3QU6A 4BACA 5H20A 2MC3A 4ENJA 3A2KA 2HDCA 4LOCA 2JA8J 3WTTC 3BG5A 1MH4A 3GTLJ 4DJAA 1YW8A 2DA2A 3L2CA 1WJ5A 2KT0A 3CLQA 3HGGA 1UMQA 4B47A 1SFOJ 1G3TA 3S3MA 2OTJI 2M5WA 4ON0A 2QSHX 1T8IA 5K7HA 2KMUA 2Y0MA 2QGUA 2LYCA 1V3FA 4F55A 1DP7P 2DDAA 4L5IA 3ML6A 4YRVA 2IRFG 3IWFA 3K10A 4BL0B 3HEFA 1IRZA 2BEOA 3I54A 5IOYA 2DK8A 3HOTA 3WTSC 1Z7LA 1D1BA 4PK4A 4IQJA 2IT0A 2ELKA 5HDKA 3OV8A 3ZMDA 1A5JA 2R4GA 2VJ5A 2ZMEC 5L3EA 4CH7A 2OAZA 2V4JC 5LGUA 3IUOA 3DEEA 2M8GX 3RPUA 1B1BA 4ETSA 2DA1A 1IF1A 1TT0A 4O3MA 1UELB 3BJ6A 2FA5A 3DFGA 1FY7A 1G59A 1SANA 2EA2A 2XAGA 3AL0B 4PDKA 3F9KA 2JPCA 1HA8A 1RKTA 1R71A 1D5VA 5B5EC 3ZXSA 1T6SA 3HOVJ 5F1JA 3ABMH 4PJNA 1X1BA 1LE8B 3VEPA 4WCGA 3OYLA 4M3EA 1Q1HA 3KP2A 1MBFA 2B9SA 2PX9A 1VF9A 2MYSA 5EZGA 3KP3A 2BHZA 3RPQA 1R58A 3P7NA 5FRNA 1WJDA 5D8LB 3WG7H 5FLVA 2Q1ZB 3H9QA 1UHWA 3JRFA 4OMYA 4FE4A 3EUKL 2HQ5A 1QRYA 2VQHA 2NVUB 5E3OA 2QQBA 2VUMJ 1U5TC 3PQJA 2FOWA 3I4PA 2IA2A 2MW8A 5FLMJ 3KEYA 2H6CA 3PO3J 5ICFA 4E7JA 1XSDA 1OMIA 1BI0A 4DBRA 1MBGA 3HM5A 1FBUA 3CCSI 1LDKB 1DQUA 3UNGC 1T95A 3IP4B 1SMYF 1WH7A 1UG2A 3KZZA 2DPUA 1PJRA 5FROA 1QNTA 1ETYA 2BW3B 4PGHA 1WPKA 1KA8A 2ME6A 4CYCA 5BPDA 4A3LJ 2B7EA 4G7OF 3LL7A 2A5WA 1D0YA 4LIVA 3VSKA 3LAPA 2DFFA 3BG6A 1U9NA 3TW7A 1ZREA 4D5FA 2DT5A 4MGRA 1LDJA 3QYFA 1OCRH 1T56A 2CU7A 5E79C 3ZQHA 5JLWA 3MZHA 4ZTJA 2P5VA 3P5JA 1ZQ3P 4RA2A 4KIBA 1ERDA 2KKOA 2WV1A 2HVSA 1T39A 4MQ9F 4B3XA 1W7PA 1BA5A 1RC9A 2XDVA 4XNFA 5L3GA 2H6BA 2Y0SA 3IHUA 3FIWA 1DPUA 3U1DA 4JYKA 2WAEA 1FMWA 4W1UA 2XVCA 3WHBA 1O3TA 3GTMJ 2KPMA 1DU0A 1X3WB 2VE9A 1IAWA 2EIKH 4F91B 4YELA 3NWSA 1JT6A 4UVAA 1KQ8A 5BQTA 2Q8KA 2E1OA 4E7LA 3QQAA 3JRDA 1AA7A 3HOXJ 2FX0A 1IN5A 4D5CA 4I02A 3Q0VA 2CQQA 4WWCA 1VQNI 2OZUA 2M87A 2Z16A 4A3CJ 2LKXA 2EIJH 4M72A 3VYRB 5M5YJ 4C2TA 4R8HA 1MNEA 5K5RA 4UV9A 5D6EA 2ZMEA 3G1MA 5D5VB 3IV5A 3F22A 3RDIA 1KU2A 2A6TA 1P7JA 3EUHA 4CYDA 2CV1A 2HTSA 2XGXA 2K9QA 1REPC 3CLOA 3LA2A 1FOXA 2NYXA 5IYCJ 1WWXA 2DA5A 3JRAA 2X0LA 1LFUP 3CCJI 3E97A 1MIJA 3MZ8A 5FO5A 2H8WA 2EJRA 1MMGA 2EZKA 1HSTA 2XHKA 3H3ZA 1K4TA 3I53A 1XMAA 4HZFA 1GXQA 4I01A 2QF7A 1RR8C 3QPHA 2MG4A 2VE8A 2MD0A 3J81Z 3L9FA 1Z05A 2RN7A 2QCOA 3ZMZA 4BQOA 3JRBA 3WTZA 4ZZDA 4IZZA 2E1CA 2VQGA 5KHDA 2JA6J 2DFEA 3MKZA 3I58A 3CO7C 1PDNC 2KIQA 2NVTJ 2M34A 1IO2A 2A3SA 1U5TA 2NNYA 4A3MJ 5LHHA 3KYDB 4GDFA 2VI6A 2RQPA 2XB5A 1MMSA 4RB0A 1N77A 3BG7A 4N0BA 3TDUC 3CP8A 4L9TA 2NOJB 2W84A 1BW6A 3VYSB 2GLOA 1A04A 4RS8A 1YFHA 4YFXF 3KE2A 1W0UA 1RR7A 2GXGA 4BEHA 2EILH 2RKHA 3I64A 3B73A 4M3FA 2QSFX 2Y9YA 3CUQB 5L3BA 3PIOF 2XB0X 4KJZA 1YI2I 3CCQI 2EV6A 1LEAA 1YJNI 2HVRA 3HHGA 1BI2A 4BJ5C 4KFCA 5J6XA 1HBXG 3HB9A 1TQPA 2JK3A 3FZVA 1Y8RB 5GAEJ 4ESFA 1Y8QB 3ZP5A 2NS0A 5ERIA 3BCBA 4OIOF 2E1NA 4DNCA 1X1DA 1Z9CA 3GBGA 2R7VA 3PO2J 4HLXA 3QP5A 2NNNA 1ACIA 1FX7A 1SFKA 2QQ8A 3HKZA 1WKMA 2PG4A 1B4AA 3E6MA 1HDDC 4XQFA 4F7ZA 2ZXWH 5FKOA 1TP4A 4KITB 3VPRA 2LR8A 2GA1A 1ZK8A 4BKXA 3OYFA 4C30A 5CJ9A 4N9IA 2CUZA 2L5QA 1IV8A 2E60A 3NWTA 4B48A 1BR2A 2R7ZJ 4BEHB 1ZRDA 5CQGA 3JREA 3PFYA 2HWVA 1HF0A 3AFHA 4C2UA 5M5WJ 5HVQC 2DA4A 4HSRA 3BZCA 3WHCA 2HYFA 4KIGA 4JK1X 3CC4I 3L2WA 3CJQB 2K4JA 4IHSA 1XD7A 4K2EA 2R5YA 4BXUA 3A0BC 2AXLA 4QPOA 2A69F 2FMYA 3A1YA 1FYLA 3G4SI 2QBYA 4ZYGA 1YX5A 4HF2A 2Y75A 2V1NA 4RB2C 1MNDA 2LMDA 2BOLA 2MABA 3HRTA 4N4OB 2L9RA 2RQQA 4XLHA 5LRSA 1TBXA 2D1HA 2X48A 2AQFA 4S05A 2HOTA 3REOA 5JVGF 2QEXI 4DYRA 1ENHA 2ZXJA 4A3GJ 1ZGWA 1R36A 4V2FA 2ZXIA 1WJAA 3QRFF 1EH6A 2TCTA 1A6QA 2KDZA 4XLCA 3R6SA 1YE9A 3JCUC 3L2RA 1J7KA 1VQ6I 2EINH 2VOPA 3FXRA 2CW8A 2H27A 3LSKA 3KP7A 2XIGA 3C2GA 1BOBA 3H5AA 2IPQX 1ODDA 3J7AO 5F0FA 5IT9K 2K9NA 5JHUA 5E8GA 3SEQA 4IEJA 2G7HA 2KLOA 4G6DA 5CVVA 4M74A 1DGWY 2V1DA 3MKWB 2P5LC 1IDZA 2F4OB 4PJMA 1VQ8I 3OS1A 3MVPA 4J19A 1MDMB 3HL2A 1F5TA 2VKEA 2VASA 4UV8A 5HDGA 2BY2A 2HQNA 2M2EA 1S9HA 5E3NA 1FNNA 2DDBA 2W4SA 2R5YB 2HDWA 1JTXA 3MFKA 5FKLA 3R60A 4HPQA 4DQ2A 3OYMA 4LK1F 3BLYA 2FNAA 4OAZA 4II2A 1VQLI 3V42A 3JTGA 3SZTA 5E18F 5CYVA 5DYMA 3ZQQA 2HZTA 5DCMA 3FKIJ 1UCRA 2M0MA 3ROUA 1FTTA 2FRHA 3UKGA 2LKPA 1K6YA 5D5UB 2XAQA 4EJWA 2R7UA 4XIDA 1C0WA 2X6WA 1GLNA 4A93J 2UUZA 3BQYA 3FMQA 3VWBA 2VC1A 2Z33A 5TRDA 4P5OA 4A0XA 2W7NA 3GEZA 2IS1A 3ASOH 4YG2F 3E5UA 2ELHA 4BQAA 1QVUA 2OJED 1IN4A 4ZYAA 5K7ZA 3COAC 2EK5A 2V7FA 1K78A 4XICA 2P6SA 2AHQA 4CICA 3OR1C 3EDPA 1VQMI 4U0WA 1YOVB 4OIPF 4BQNA 3BDDA 3GFLA 1O4XA 2JA7J 4OU0A 2ECBA 2NS7A 2XROA 3OIPA 2W48A 1BOAA 1XN7A 1YQAA 1UFMA 2VXZA 2WY7Q 3WGGA 4AM3A 2RC4A 4QLCU 1S6LA 3HPHA 5D6FA 4I0BA 3B02A 4EGZA 3SYTA 1YTYA 4I6ZA 2A6HF 4N4NB 2WY8Q 5CVUA 2FNPA 3AKZA 4LLGF 3H5NA 3HSRA 4XK4A 3SFZA 3OS2A 4LB6B 3LOCA 1RPWA 3L00A 2AQEA 1Z6RA 2VB6A 4HBLA 1OCTC 3ASNH 3BR6A 3HPGA 4LITA 4RBOA 3LSPA 3GVAA 5C3EJ 2X1DA 1GXPA 1ETOA 4XN0A 2E2IJ 3HC7A 4WF2A 3KP5A 2EPFA 5DCMB 4OAYA 1JHHA 4B09A 3RI4A 2GOXB 4EJTA 1MSFC 5E17F 3F0CA 2HOSA 2HKXA 3M7GA 4ASNA 2X1EA 2DXIA 5ILUA 1X58A 2LBFA 1UHSA 2XUBA 2OPTA 3RYPA 5GADJ 5HOOA 3CCLI 1J75A 3TBIA 5LRRA 4GYGA 1XMXA 1JGSA 1K78B 2BHYA 5KVRA 3SZPA 1Z3YA 1VTNC 3AL0C 2FSWA 2PMZN 2PMUA 5CVJA 2KZVA 1YRNA 2WA0A 3IRQA 2A61A 2O0YA 3S2WA 3CUOA 3W3CA 4ZTFA 2DYSH 2L7ZA 4E7ZA 3T0YA 1WZ2A 1USTA 4FASD 2L01A 2PMHA 2OF7A 3VODA 4Y52J 5FLXK 2CFXA 1Y6IA 3FM3A 1O7FA 3A03A 4XLEA 2KZGA 1D8KA 4IHTA 4MTDA 2W85A 4I76A 1E3OC 4HYEA 1TC3C 4I2OA 3ZQ7A 1A36A 3QPSA 3FMRA 3L2UA 5FGMA 5B1BH 4E7KA 4RM2A 1IRGA 4JQFA 4XLAA 5DEQA 3RZOJ 3BR1A 3FBIB 2HGCA 2VPRA 4RGXA 3F72A 5H2FC 2OQRA 1PUFA 1LVAA 2XAFA 3QYEA 1HKTA 4H0EA 3H3VK 4FE7A 5ILVA 2XAUA 2CUEA 3TDZC 4PJJA 4GFBA 2X51A 1T08B 5HNHA 2EFOA 4LD5A 1S7AA 2HOAA 1L0OC 2B0LA 4BHPA 1WJBA 4IHXA 2ZJ2A 3CJNA 3ONQA 4P9UA 1N25A 1RZ4A 3RQIA 2WB1A 3IL2A 3CMEI 2OU2A 1U3EM 1YRNB 4PGGA 4B44A 3QWLA 2FMLA 3C3WA 2CW7A 5AIQA 1W5TA 3PSIA 3IC7A 1B72A 1YX3A 2PQ8A 2KDOA 5D5XB 1W36D 5IP9J 2RREA 3FXUA 3ZN1A 4XLPF 4IRGA 4IKFA 2KP6A 4XKCA 4LG0B 4YEJA 3ZQCA 1R9TJ 2HEOA 1OR7A 2COBA 2Y0SN 4G7HF 3J80K 3N97A 5GAHJ 3I71A 3FDYA 1MMAA 5DUIA 4HDVA 5GP9A 3K70D 4E7IA 5ICEA 1SFEA 2XSJC 1I50J 5HLHA 2JWTA 2B63J 4A0ZA 2IGKA 1F4KA 2RNGA 4GGGA 4E7SA 2TRTA 1OKRA 4ZZLA 4GXOA 1D5YA 1MBKA 3DBRB 2JT1A 1APLC 2CQXA 2NXNB 2R5ZB 4DZPA 1JJ6C 2F5DA 3LSGA 2FJ1A 4IX7A 5E1WA 2P7VB 1X4PA 3CP2A 1T0FA 3DF8A 5J8CA 1WJCA 1MZBA 3BQZA 4IOCF 2BY1A 4UVBA 2EH3A 2KJBA 2XPWA 2P6TA 3PM1A 1QHGA 2P8TA 3QAHA 2I8DA 2HU9A 1D1AA 1HW5A 3B6AA 1O7LA 3BP8A 3VDXA 4EQQA 5IP7J 1J9IA 2Y30A 2F5EA 3F6VA 4GO1A 1TLHB 3RKWA 1B72B 1D1CA 3K4KA 4A2UA 2L7FP 4XKWA 1YO5C 3F3XA 4J00A 2P0WA 4N9HA 3S93A 2DT6A 1PVEA 3EQLF 3KX2A 4U0VA 3N05A 3R0AA 1E2XA 5L3CA 1V4RA 3WE3A 4I09A 2VT2A 3ZN0A 4A6EA 1VQ4I 3C2BA 3K9TA 1ZRCA 4A3FJ 4HNTA 2DMTA 2CRGA 4A69C 1Z3XA 3CCYA 5LBQA 2XC7A 1JUMA 2DPDA 4XRMA 5HS9A 2HR3A 2M30A 2JUGA 2CUJA 3EPZA 5J47A 1WGXA 3BR2A 1LPQA 3PNTA 4DYQA 2EFQA 2F5FA 1FBQA 4OIRF 1ZHFA 1S29A 1X1CA 4IVNA 1Z21A 5FKMA 1R23A 2LNBA 3HOUJ 3ZMVA 2FF4A 1KU9A 4AU7A 4D9JA 5F0CA 4RDUA 2GBYA 3RJPA 3RSNA 2JRMA 3EUHC 4RGSA 3K0LA 2IJLA 4Q4ZF 2BW3A 4B8XA 1TNSA 2DA3A 3CUQC 3JAMK 2M4GA 1MJBA 2LY9A 3JRGA 1NK2P 1VFCA 1YS6A 2KRHA 4X1EA 2I10A 2LRDA 1JKQC 2MLKA 2RAEA 4ZYEA 2BY3A 2PBIA 3DLAA 2VODA 2DQRA 3JR9A 2X6YA 4P55A 2QM3A 4HRIA 1K4SA 1WHUA 3H1CA 3OY9A 3KLNA 1AHDP 1NH3A 4A3DJ 1FC3A 1FT9A 2YSRA 2HZDA 3TP3A 3BY6A 2XGDA 2V79A 2M7AA 4AVZA 5IY5H 3CCVI 3H35A 2ZB9A 3G3ZA 3HKZN 3SJMA 1IC8A 1XCVA 2MGQA 4UXNA 1BJZA 2ESNA 1YJ9I 4AC0A 3GXOA 4XLNF 1ZARA 1POGA 1JGGA 4L5JA 2FQ4A 5IP6A 1R1UA 2W57A 2G7UA 4XBFA 5IYDJ 3BTCA 3FWEA 1K79A 3BR3A 4JOMA 5JI6A 5GTIC 2UXNA 2JMWA 1R22A 1WJFA 4PJ0C 1LQ1A 2J5OA 2YX7A 4XKVA 3EYYA 5ICGA 1LEBA 1SD4A 4G94A 4II3A 4FHTA 2VKVA 1K7AA 2K5CA 4YIIA 1TT5B 3CZ6A 3GLLA 3R0JA 1Y56A 3R61A 4UUTA 2XRNA 1H88C 2EB7A 4BNCA 3O6BB 2IA0A 1HDPA 3GFIA 3ISPA 1S72I 4MTEA 1RKWA 2QZ8A 2ISZA 4CCMA 1B9MA 3WTXC 4BE0A 1TQMA 1JI8A 4M3DA 1NHAA 3CC2I 3FXMA 1U8RA 3FK7A 1FWZA 3DU6A 1U8BA 3GTQJ 2GXAA 5JHFA 2VLAA 5IT9Z 4P96A 3KEQA 1B59A 4EJVA 5IOZA 1P6RA 1U2WA 2DMNA 2QLZA 3HOSA 1XTAA 3M8EA 3CCMI 5E1ZB 4CUGA 2Z9OA 4NC6A 1QZEA 5BS6A 3G73A 3G71I 4J01A 2W82A 2HPIA 4U7BA 5C4JJ 2H1KA 4PSWA 3DPLC 4CCLA 5HS8A 2OCEA 1TWFJ 2M8EA 3DV8A 1XMKA 4CCJA 3G1OA 3E6DA 3I55I 3AG4H 4C3JJ 3GFJA 2RDPA 4Y3OA 3SEZA 4KA4A 2ACJA 4XN3A 4DGWB 1I1GA 3BT9A 3CUQA 2V9KA 3K4LA 4ZYDA 1BIBA 5JLXA 3U21A 4HNUA 3L09A 3K4BA 4LLNA 4G9YA 3M07A 1CGPA 2YUSA 3D0SA 1EH8A 1GHCA 1X2MA 1ZAOA 2KJCA 1WJEA 5K5OA 4NHJA 3S1NJ 1WFXA 5AONA 4HSTA 4BE2A 3OL3A 3E7LA 3K1NA 4BE1A 4RGUA 2KQRA 4F3QA 1VQ5I 1V5FA 2W24A 2E36A 4HOBA 2A6EF 4BUPA 2UWMA 3QPTA 4M6VA 3PFIA 3E5QA 2CV2A 2KRFA 5C4XJ 1TW2A 3G1LA 3GF2A 4AIHA 1VQ9I 4UUSB 4XMYA 4FCYA 1OPCA 1ETVA 3ZGKA 3BG9A 2Z1DA 3SQNA 5FKKA 5CVRA 1R5GA 3ZQGA 3CMYA 2DMUA 3IH4A 1OISA 4EMSA 2CG4A 3F8FA 3E5XA 2JSPA 1TNTA 2CMPA 1K61A 2HYJA 4KICA 5DD8A 3P9CA 1T38A 1LB2A 1TTYA 3FXOA 2LG4A 2HYGD 2IS4A 3K4CA 2MH2A 3CTAA 4AIJA 2LOOA 2K02A 3NQOA 4KT5C 3S15J 1V5EA 3KCCA 3H9GA 1P4WA 4RM3A 3QOPA 4CDGA 1X1PA 2COMA 4E6KG 2PJRB 1DP3A 2YS9A 3DP7A 1ULYA 1YIOA 2V9VA 3LWFA 1XGNA 3ZR8X 3K6GA 3TEDA 2IGNA 5EZHA 1UG0A 5HDNA 2XF6A 3TOAA 2KHMA 4FX0A 5KCMA 4BAYA 1LUJB 1R5ID 2XF5A 1J0RA 5LGTA 3M1EA 2BBYA 3BPXA 1ZG1A 4LLLA 2QKLB 1R00A 3OSFA 3CF2A 4BU2A 4D7MA 3MCZA 1J5YA 3ESWB 1AKHB 4HG2A 3KZIC 3ELKA 4OINF 3OWTA 2Z3YA 1B8IB 4U7DA 2L02A 5CQEA 5TGTA 1WRJA 3LMMA 3S1QJ 5F04A 4RAYA 4CZCA 1MBEA 1OYYA 4MQVA 6PAXA 2OD5A 5TISC 1JT0A 2LTPA 4A5NA 1N75A 4F92B 4IXAA 1Q1VA 2LH9A 2BGCA 3RIRA 3QU3A 2EIMH 2QA4I 5LGNA 1MDMA 2ICWG 1XGMA 3UR3C 5FLXZ 5LLQA 1YITI 1YW9A 1ZYRF 2E19A 3K4NA 2DFIA 3VSLA 1AOYA 2LSOA 1I3AA 2KL4A 4W97A 5EJCA 3VYTB 2OQGA 4PCQA 4HQMA 4XR6A 1USSA 2LY2A 5C44J 3A02A 2JPBA 3EUAA 4M73A 3K2ZA 3V8JA 1P9QC 1JHFA 4A12A 4KYWA 2XRLA 3ECHA 5E1XA 5CVIA 1R49A 2F5CA 4A3JJ 3WTWC 3AAFA 4L0YB 1D0XA 3M8FA 3MN2A 1O57A 3WE2A 2K40A 2P5KA 1E3HA 2OZ6A 1ZGJA 2R7OA 1E3PA 2K9LA 1OCOH 1QZZA 3F8MA 4A5MA 4UUVA 4B1RA 2A05A 1H8AC 2VPLA 1BW5A 3O3KA 2X4HA 3K4JA 4XRFA 4EV0A 4QTRA 4L9VA 2CW0F 2F2EA 5J1YA 2L9NA 2GZWA 2BV6A 4L9NA 1WCMJ 1RNLA 3H92A 4BHCA 3QYBA 4ENMA 4KDPA 1RRJA 1VI0A 3DU5A 2DMPA 2GXBA 3QP6A 4RGRA 2VL8A 2JJ7A 2A68F 1ETWA 3KZYA 3FKJA 3KYCB 2E7WA 4KISA 3PIPF 1ITYA 3K69A 4IQ4A 2IS6A 3NARA 5D5WB 3IRRA 2OC6A 4OOIA 2JQ7A 3J7ZI 2CQNA 3KLOA 3HSFA 3J80Z 3GTGJ 4ZH4F 4JX4A 3C1DA 3LAJA 3S3NA 2O6GE 5D4RA 1MH3A 2FBKA 4BY1J 3S16J 4AIDA 3HYIA 3PL8A 1MKMA 4L5EA 4B3AA 3BWGA 3Q9SA 3OYCA 3RCOA 5M5XJ 1IV6A 3R4KA 4A6DA 1ON2A 3BZ6A 2DFHA 5B1AH 2R7FA 1W5CC 2P7CB 1KGSA 3FBNB 3A4CA 5DS9A 2HFHA 2P81A 2E5NA 4IPAA 2LFBA 3T8RA 3O8HA 2ELJA 4Y33A 4X0GA 4KN4X 3WU0A 3S2DJ 1V55H 1OFCX 1Y1VJ 3IKTA 1X1AA 1OJLA 1MD0A 2VC0A 3ABUA 3RKYA 1MJ9A 2QVOA 3RYRA 3TKYA 3F8NA 1OQYA 1A31A 2VKDA 1LJ9A 1FLIA 2O3FA 3LNQA 1QBJA 3ZRGA 2W00A 3BZKA 1OR7C 4RB1A 2DOAA 4G8XA 2JA5J 2PEXA 2VN2A 1P4XA 3OYGA 4F93B 5F6FA 4IHYA 2V6CA 5K7FA 3CD6I 3LA7A 1HLVA 2XKPA 1MW7A 3QOEA 4NBQA 3HUGA 2RV8A 1I6HJ 2RGVA 2CS3A 3HBLA 2D45A 1Z7UA 4A0YA 1HQCA 3OIQA 1VQOI 4L18B 3MZYA 2VQCA 2DYRH 2MSYA 1XPXA 4IRIA 4XOTA 4Y17A 4KUMA 1T0FC 3HTSB 2X1CA 3SDGA 4R1HA 2CFOA 1ZR4A 4PZJA 1GUUA 4M6XA 3JAMZ 1J59A 2EZLA 4IHWA 2WAFA 1MBJA 1UB9A 3WG9A 3OL4A 5J8FA 2W25A 4HX4A 4AD9A 3FHZA 5CKTA 2OA4A 1FTZA 2FD5A 3RPUD 2DI3A 1U6GA 2LVSA 4PUSA 3V7CA 4U0YA 2HTJA 3CQZJ 2YU3A 4KT6A 5DV5A 2LP0A 1CF7A 2ZSHB 3WGIA 4AWXB 4NDLA 1FBSA 3F21A 4D1QA 1IZ1A 3ZOBA 1P4AA 2F5VA 1HKQA 2K3FA 2VQLA 5F27A 1SFXA 4BQQA 2LC2A 3D5LA 5J4VA 4XOPA 2DO7A 4LG3A 4LG0A 1XS9A 3DKXA 1YLFA 2RVCA 2R93J 3SZGA 2G0EA 3X2QH 4S0HB 4UY8I 3CJTB 3TOBA 1ZRFA 3HUGB 2WTEA 1XG1A 3AG2H 2JVHA 1X3ZB 3RKQA 4JX6A 2E2HJ 2MH9A 1I3QJ 5E3LA 2L7KA 5FKNA 3CDHA 4WXCA 2X85A 2NVQJ 1X4OA 2ZJRF 1DDNA 4XKBA 4FISA 1ZG3A 3NRVA 1KZHA 1KQ0A 3LSJA 1YG2A 2RNJA 4RB3C 4FX4A 2R5ZA 3BTIA 4G12A 2ZC2A 1Z6TA 4WXDA 5BNGA 2LK2A 3EETA 3OOUA 4M3BA 1T98A 5J1UA 3ABTA 2Q2EA 4AYBA 1VQ7I 1MMNA 4Y15A 3OOPA 1TQIA 1G3WA 2Y48A 2E1MB 3BJAA 3DQVC 3AG3H 3HXLA 3WGHA 2EA4A 3S2HJ 4PFPA 3GFMA 3D5RC 5J4YA 4WX9A 1JJ8C 1XC5A 4Q48A 5E3MA 1CF7B 2MD5A 3AG1H 4I7HA 2EWNA 2OUMA 3LSTA 2F4IA 3H5RA 2I5UA 3VOEA 5E8IA 4Y7NJ 1IXSB 1KQ9A 3GX4X 5FB2A 4BH9A 5K1YA 3ERED 3JSPA 2V1UA 3RZDJ 1NK3P 2ECCA 2EZIA 1G6NA 3DPUA 2AS5F 3E6CC 1IN7A 1ON1A 3M9AA 1W7PD 2XASA 2VBYA 3C18A 4QPQA 3TGNA 1PP7U 3IH3A 4E70A 4FT8A 4ABZA 3CMMA 2WADA 2FU4A 2X6OA 1MJAA 3HRSA 3OIOA 3TL4X 3PSFA 3VFZA 1FP2A 3Q9VA 1E0EA 4FETA 4NQWA 1V54H 3CCRI 1BI3A 2Q0OA 3I9V2 1ETKA 2ADUA 3U2RA 4UVCA 2XAJA 1MNMC 2R7XA 2VJ4A 3CDLA 5EDNA 1FIAA 1DUXC 5A2QK 2DQLA 3W2WA 1FYKA 4HF1A 1IUFA 2XGEA 2EV0A 1ZLJA 2Q2EB 2FOKA 2X9DA 5J40A 3E1SA 1XCBA 2VXDA 4P1WA 2CO5A 2CWEA 2ESHA 2DOEA 3DEUA 1XX5A 4WK8F 1ETXA 2EZHA 4PSXA 2HPMA 3CC7I 4BYYA 2NS8A 2PN6A 4CHUA 1FSHA 5E20A 5HNFA 1AU7A 2Z2SB 5TJJA 5H6QA 1QQIA 1FOYA 5JR3A 2EFPA 3I56I 4IO9F 1BN5A 3GTJJ 1I39A 2CQKA 2GA2A 1VQKI 2HI3A 3IAS2 3BR5A 2VONA 5H6RA 4CO8A 4UHTA 4F52A 2DA6A 2LF7A 2A5YB 2O7OA 2XAHA 1JE8A 5KAFC 1S7EA 3E6BA 2L4MA 4P9FA 1UAAA 3ZPLA 1RIOH 4KNYA 1IJWC 5F08A 3HOYJ 1ORKA 2QQAA 4IHVA 1V5GA 4HLYA 1H9GA 5BPIA 3LFUA 2K4BA 3CESA 3DPTA 4HX8A 4QWQA 2A07F 3G2BA 5ED4A 4Y4RA 3K70C 4NQWB 4FTHA 3DTKA 2MA3A 2Z5UA 3KEOA 1TWCJ 2WAQA 1FP1D 5L3DA 3U1KA 4EJUA 4ZJZA 3H0GJ 2IAIA 3BJOA 4LMYA 1FYMA 4MNUA 1WI3A 1DPRA 1TZLA 1J09A 4WXHA 1QHHD 4DZJA 2CV0A 1BIAA 5HLGA 3HOZJ 4DYCA 5K5QA 1OCCH 1UJ8A 3DXJF 3LSMA 1SVOA 1NTCA 1JTYA 2F48A 5BMZA 2VIXA 3W2AA 2PI0A 2HQAA 3GUDA 3L1PA 1KU7A 2BVLA 4CCOA 2FBIA 4CCKA 3NEUA 5CPRB 3Q3SA 1Z91A 2EFWA 3MD2A 2IGOA 3GCMA 2STTA 3BOQA 1Z77A 2V6EA 1EJ9A 3KP6A 1QO0D 4ENNA 3HRMA 3DTIA 1GVDA 3Q0WA 3PNVA 4YIFA 1Y0UA 2PMZA 2QYOA 2DTRA 3DTEA 3JRHA 2YR2A 4ZC3A 1JXSA 2M9HA 2XF7A 3F23A 1H0MA 2HVQA 4BXFA 3GZ6A 1MMDA 1Y1WJ 3OMYA 3GWZA 2CH0A 2FBHA 3P9IA 4IF4A 4HNVA 2EFNA 5AIPA 3CCEI 3S3OA 1SMTA 4UNOA 3H0DA 4EM0B 3OYAA 1EF4A 2CYYA 2PFBA 1U78A 3FF5A 2DN0A 3O2PE 3TO7A 3ABKH 4HV6A 1XGOA 4PJLA 3QODA 3BC8A 1L3LA 3V4GA 4V2GA 4D7NA 1XB4A 3SDBA 3GLXA 3T1BA 5LHIA 3A01A 1FOWA 3J7YJ 3OYJA 1SAXA 2LD5A 2DBBA 4ZDLA 3ZCOA 4CZZA 3M3YJ 4IOAF 3I4NJ 2DMQA 4JP0A 1IN8A 2K9MA 2ZBKA 3CF5F 4HX7A 3VB2A 4G7ZF 2HOEA 3HRUA 4BBSJ 2ZKZA 1BI1A 1PP8F 2F4MB 2HQRA 3BPVA 2Z99A 1R7JA 2QUFA 3HSEA 3W2VA 1BC8C 4YIRX 4I98B 3FMSA 3IWZA 1Z0XA 4UB8C 1ZGAA 1IRXA 4XSXF 3HG9A 1EV7A 2DCEA 2O8XA 3H3UA 2H09A 2L4AA 3D5SC 3WODF 2DODA 4UUSA 1SFUA 4O6JA 2EQRA 3E0JB 4Y13A 4A3BJ 5EF6A 2ETHA 2O03A 3Q5FA 4MFDA 4CXFA 3PUFA 1GV5A 1R5HA 1F1ZA 1SC7A 2NVYJ 4HF0A 3G6EI 1S5LC 3M4OJ 4NNJA
chains in the Genus database with same CATH topology
2UZKA 2H94A 1G4DA 2ZCWA 2WV0A 1WQ2A 3FM5A 2O61A 4L9JA 1ZN2A 1XDSA 2WWYA 1XSVA 2VT3A 3TO6A 2EV5A 2GQQA 3RKXA 1ZLKA 1FOKA 3V7RA 2WC2A 3LA3A 4EJOA 2JZYA 4HV5A 1ONVA 1G3SA 2ZO4A 1KYWA 3HIFA 3I0TA 2IA1A 1H9TA 3ZMSA 1YW7A 5EEHA 3KFWX 2PLYA 4LK0F 1W7PB 4MEYF 1WSUA 2HKOA 4EM2A 3JW4A 1QZYA 2K27A 4I0AA 4U88A 1YYVA 4M9ZA 1RUOA 3RTRA 1YS7A 4D0PA 4LGWA 3BROA 4EGYA 3MAJA 3W6KB 3GO5A 2ZMEB 5DD4A 4ESBA 2JRTA 1HKSA 2K7LA 1I1SA 4JBAA 1IRFA 3WTUC 1HW2A 5JVTA 2M45A 1XSXA 1W4MA 1X3UA 1STZA 5HS7A 5BOXA 3P9KA 4Q5SF 2ZFWA 4MEXF 5DCFA 1S3JA 5F1RA 3I59A 5DUKA 2XV4S 4EM1A 3I5UA 4YFNF 3T8TA 1FPQA 2BYVE 1OYIA 5LHGA 2ISYA 1J2XA 5F64A 1U5TB 2GWRA 5ICCA 1I6XA 3JTHA 1ZH5A 4EVIA 2VBZA 2QWWA 3WTYC 2IVMA 1B9NA 4HA8A 1UHMA 3IKVA 2CSOA 2STWA 2IP2A 2QENA 1IXRC 4YFKF 2LF8A 1K6OA 4KN7X 5LEKA 1O3SA 5JFRA 3I59B 1B6AA 2R7DA 4HDUA 4LJZF 4AVPA 1D8JA 4KMUX 4MHGA 1LDDA 2ZNYA 1W5SA 2K86A 4KMFA 1P2FA 1R1TA 1RUNA 3N4MA 1I27A 2P4WA 1IUYA 4HAMA 3MQ0A 1E17A 4ZYHA 2NRAC 1T2KA 2D1VA 3C7JA 5EEGA 5FFZA 3T5XA 5L3FA 1BJAA 4TV7A 1RI7A 2DW4A 2QBYB 5A2QZ 2J5PA 4XSZF 1S7OA 3LQRA 3TQNA 3U9GA 3GZ5A 1QPMA 3ULQB 4HW0A 1AWCA 3J81K 2QQ9A 2DAOA 2ZNZA 3EYIA 2JSCA 2L54A 2UXXA 3ECOA 4M9XA 1OYWA 3ZMUA 2G9WA 5FD6A 3KETA 3V7SA 1G3YA 2GIVA 2VBXA 1I5ZA 2PJPA 3K1MA 1LNWA 1IXCA 2R3SA 1EH7A 4G6QA 2VOOA 2YX4A 4HQEA 3ZMTA 5IT3A 5LEJA 2GAUA 3GW2A 5D8KB 3JSOA 4GCVA 1FZPB 5ILSA 1SD7A 2C6YA 5FFXA 4Q47A 1BM9A 2VBWA 1HW1A 2DK5A 4M9SA 2OBPA 2IW5A 4OIQF 2D2WA 2MBFA 1SD5A 3KP4A 1KU3A 4L0ZB 1XGSA 1QGPA 4R79A 2YPRA 1IW7F 4CGZA 3E3VA 1O3RA 5FD5A 3V8KA 1BC7C 1WI9A 2DLLA 3SHFA 2CGPA 3MWMA 4O5VA 1GVJA 2HS5A 4GYIA 4ESJA 1SD6A 4S04A 1O3QA 2BE5F 4OMZA 3F8CA 3WU1B 1KYZA 4M6YA 1MGTA 2XKOA 3L7WA 1R1VA 1D3YA 5HLIA 4IJAA 2M1BA 2V1XA 2FXAA 3MEXA 3GYHX 3F6OA 2TDXA 2L3DA 4KIFA 1FSEA 3CO6C 3W6JB 2E7XA 1Z1DA 3DKWA 5D4SA 2FE3A 4LFUA 3LQQA 2DU9A 2KIMA 2FQ3A 3WTVC 1IN6A 4LB5A 3SXYA 3HHHA 4AIKA 1PUEE 4RAZA 1BBYA 1P92A 2FEZA 4M71A 4ENKA 4BHBA 3FXQA 4IRHA 5CLSA 2NAZA 1ZG5A 3PQKA 1XDUA 2JTVA 4NB5A 5KK1A 3HTUA 1HXDA 3FX3A 3V8LA 3LFKA 3F8BA 2KIUA 1S8NA 2MLGA 2KIFA 4Z2YA 5DDGA 1F9NA 3TO9A 2LDUA 1HSJA 3K1PA 1TW3A 3QU6A 5H20A 2MC3A 4ENJA 2HDCA 3WTTC 1YW8A 3L2CA 1G3TA 2M5WA 4ON0A 2Y0MA 1DP7P 1V3FA 4L5IA 3ML6A 2IRFG 3IWFA 2BEOA 3I54A 2DK8A 3HOTA 3WTSC 2IT0A 5HDKA 3OV8A 3ZMDA 5L3EA 2OAZA 5LGUA 3RPUA 1B1BA 4ETSA 1IF1A 4O3MA 3DFGA 3BJ6A 2FA5A 1FY7A 2EA2A 2XAGA 4PDKA 2JPCA 1D5VA 1T6SA 3VEPA 4WCGA 1Q1HA 3KP2A 3KP3A 3RPQA 1R58A 3P7NA 5D8LB 1UHWA 4OMYA 2QQBA 1U5TC 3PQJA 3I4PA 2IA2A 2H6CA 5ICFA 1XSDA 1OMIA 1BI0A 1FBUA 1LDKB 1SMYF 3KZZA 2DPUA 1QNTA 4PGHA 1KA8A 5BPDA 4G7OF 3LAPA 1ZREA 2DT5A 4MGRA 1LDJA 3MZHA 2P5VA 4KIBA 2KKOA 1T39A 4MQ9F 1W7PA 5L3GA 2H6BA 3IHUA 1DPUA 3U1DA 2XVCA 1O3TA 2VE9A 1IAWA 4UVAA 1KQ8A 5BQTA 2Q8KA 1IN5A 4I02A 4WWCA 2OZUA 2M87A 4M72A 4R8HA 5K5RA 4UV9A 5D6EA 2ZMEA 5D5VB 3F22A 3RDIA 1KU2A 3EUHA 4CYDA 2HTSA 2XGXA 1REPC 3CLOA 3LA2A 2NYXA 1WWXA 2X0LA 3E97A 5FO5A 2EJRA 1HSTA 2XHKA 3H3ZA 3I53A 1XMAA 4HZFA 1GXQA 4I01A 3QPHA 2VE8A 3J81Z 3L9FA 1Z05A 2RN7A 3ZMZA 3WTZA 4ZZDA 2E1CA 3CO7C 1PDNC 3I58A 2A3SA 1U5TA 2NNYA 5LHHA 2RQPA 4RB0A 4N0BA 3TDUC 4L9TA 2W84A 1A04A 4RS8A 1YFHA 4YFXF 3KE2A 2GXGA 2RKHA 3I64A 3B73A 5L3BA 3CUQB 2EV6A 1LEAA 3HHGA 1BI2A 4KFCA 5J6XA 1HBXG 1TQPA 3FZVA 4ESFA 3ZP5A 2NS0A 5ERIA 4OIOF 2E1NA 4DNCA 1Z9CA 4HLXA 3QP5A 2NNNA 1FX7A 1WKMA 2PG4A 1B4AA 3E6MA 4F7ZA 2GA1A 5CJ9A 4N9IA 1ZRDA 2HWVA 5HVQC 2HYFA 4KIGA 4JK1X 2K4JA 4IHSA 1XD7A 4K2EA 4BXUA 2AXLA 2A69F 2FMYA 1FYLA 2QBYA 4ZYGA 4HF2A 2Y75A 4RB2C 3HRTA 5LRSA 1TBXA 2D1HA 4S05A 3REOA 2ZXJA 1R36A 3QRFF 1EH6A 3R6SA 1J7KA 2VOPA 3FXRA 2H27A 3KP7A 2XIGA 2IPQX 1ODDA 3J7AO 5IT9K 5JHUA 5E8GA 2G7HA 4G6DA 5CVVA 4M74A 2V1DA 2P5LC 1MDMB 1F5TA 4UV8A 5HDGA 2HQNA 1FNNA 3MFKA 3R60A 4DQ2A 4LK1F 2FNAA 3JTGA 3SZTA 5E18F 5CYVA 5DYMA 2HZTA 5DCMA 1UCRA 3ROUA 2FRHA 2LKPA 5D5UB 2XAQA 4EJWA 1C0WA 3FMQA 2VC1A 2Z33A 5TRDA 4P5OA 4A0XA 3GEZA 4YG2F 3E5UA 2ELHA 4BQAA 1IN4A 3COAC 2EK5A 1K78A 2P6SA 4CICA 3EDPA 4U0WA 4OIPF 3BDDA 3GFLA 4OU0A 2XROA 1BOAA 1XN7A 1YQAA 1UFMA 2VXZA 3WGGA 2RC4A 4QLCU 1S6LA 5D6FA 4I0BA 3B02A 4EGZA 1YTYA 2A6HF 5CVUA 2FNPA 4LLGF 3HSRA 3SFZA 4LB6B 3L00A 4HBLA 1Z6RA 3GVAA 1GXPA 4WF2A 3KP5A 5DCMB 1JHHA 4B09A 3RI4A 4EJTA 5E17F 2HKXA 4ASNA 3M7GA 5ILUA 1J75A 2XUBA 3RYPA 5HOOA 5LRRA 4GYGA 1JGSA 1K78B 5KVRA 3SZPA 1VTNC 2FSWA 2PMUA 5CVJA 3IRQA 2A61A 2O0YA 3S2WA 3CUOA 3T0YA 1USTA 2L01A 2PMHA 3VODA 5FLXK 2CFXA 3FM3A 1O7FA 1D8KA 4IHTA 4MTDA 2W85A 4HYEA 4I2OA 3ZQ7A 3FMRA 5FGMA 1IRGA 4JQFA 5DEQA 2HGCA 4RGXA 3F72A 2OQRA 1LVAA 2XAFA 1HKTA 4H0EA 5ILVA 3TDZC 2EFOA 4LD5A 1S7AA 1L0OC 2B0LA 4BHPA 2ZJ2A 3CJNA 4P9UA 1RZ4A 3IL2A 2OU2A 1U3EM 4PGGA 2FMLA 3C3WA 5AIQA 1W5TA 3IC7A 2PQ8A 5D5XB 3FXUA 3ZN1A 4XLPF 4IRGA 4LG0B 2HEOA 1OR7A 4G7HF 3J80K 3N97A 3I71A 5DUIA 4HDVA 5ICEA 1SFEA 5HLHA 4A0ZA 1F4KA 4GGGA 1OKRA 4ZZLA 4GXOA 2JT1A 2F5DA 5E1WA 2P7VB 1T0FA 3DF8A 5J8CA 1MZBA 4UVBA 2KJBA 3QAHA 2P6TA 2P8TA 1HW5A 1O7LA 3BP8A 4EQQA 1J9IA 2F5EA 3F6VA 4GO1A 1TLHB 3RKWA 4A2UA 1YO5C 3F3XA 4N9HA 3EQLF 4U0VA 3R0AA 1E2XA 5L3CA 1V4RA 3WE3A 4I09A 2VT2A 3ZN0A 4A6EA 3K9TA 1ZRCA 5LBQA 2DPDA 5HS9A 2HR3A 2M30A 2EFQA 2F5FA 1FBQA 4OIRF 1ZHFA 1S29A 4IVNA 1R23A 2LNBA 3ZMVA 2FF4A 1KU9A 3RJPA 4RGSA 3K0LA 2IJLA 4Q4ZF 4B8XA 1TNSA 3CUQC 3JAMK 1MJBA 1YS6A 2MLKA 4ZYEA 2PBIA 2VODA 2DQRA 4P55A 2QM3A 3KLNA 1FC3A 1FT9A 2YSRA 3BY6A 2V79A 3G3ZA 1XCVA 4UXNA 2ESNA 3GXOA 4XLNF 1ZARA 4L5JA 1R1UA 2W57A 2G7UA 4XBFA 3FWEA 1K79A 5JI6A 2UXNA 1R22A 1LQ1A 2J5OA 2YX7A 3EYYA 5ICGA 1LEBA 1SD4A 4G94A 4FHTA 1K7AA 4YIIA 3R0JA 3R61A 2XRNA 2EB7A 4BNCA 3O6BB 2IA0A 3GFIA 3ISPA 4MTEA 2QZ8A 2ISZA 1B9MA 3WTXC 1TQMA 1NHAA 1U8RA 1FWZA 5IT9Z 4P96A 3KEQA 1B59A 4EJVA 1P6RA 1U2WA 2QLZA 3HOSA 3M8EA 5E1ZB 2Z9OA 5BS6A 3G73A 4U7BA 3DPLC 5HS8A 2M8EA 3DV8A 1XMKA 3E6DA 3GFJA 2RDPA 4KA4A 2ACJA 1I1GA 3CUQA 4ZYDA 1BIBA 3L09A 4LLNA 4G9YA 1CGPA 3D0SA 1EH8A 1GHCA 1ZAOA 2KJCA 5K5OA 4NHJA 5AONA 3K1NA 4RGUA 2W24A 4HOBA 2A6EF 2UWMA 3QPTA 3PFIA 3E5QA 2KRFA 1TW2A 3GF2A 4AIHA 1OPCA 3SQNA 5CVRA 1R5GA 4EMSA 2CG4A 3F8FA 3E5XA 1TNTA 4KICA 5DD8A 3P9CA 1T38A 1LB2A 1TTYA 2HYGD 2MH2A 3CTAA 4AIJA 4KT5C 2K02A 3NQOA 3KCCA 1P4WA 3QOPA 4CDGA 2COMA 3DP7A 1ULYA 1YIOA 2V9VA 1XGNA 5HDNA 3TOAA 4FX0A 4BAYA 1J0RA 5LGTA 3M1EA 2BBYA 3BPXA 1ZG1A 4LLLA 1R00A 3MCZA 1J5YA 3ELKA 4OINF 2Z3YA 4U7DA 2L02A 1WRJA 4RAYA 1OYYA 4MQVA 6PAXA 2OD5A 4A5NA 4IXAA 2BGCA 3RIRA 3QU3A 5LGNA 1MDMA 1XGMA 5FLXZ 5LLQA 1YW9A 1ZYRF 2DFIA 1AOYA 2LSOA 2OQGA 4PCQA 4HQMA 1USSA 4A12A 2JPBA 3V8JA 4M73A 3K2ZA 4KYWA 1JHFA 3ECHA 5E1XA 5CVIA 2F5CA 3WTWC 3AAFA 4L0YB 3M8FA 1O57A 3WE2A 2P5KA 2OZ6A 1ZGJA 4A5MA 1QZZA 3F8MA 4UUVA 3O3KA 2X4HA 4XRFA 4EV0A 4L9VA 2CW0F 2F2EA 2GZWA 2BV6A 4L9NA 1RNLA 3H92A 4BHCA 4ENMA 4KDPA 2GXBA 3QP6A 4RGRA 2A68F 3KZYA 2E7WA 3K69A 5D5WB 3IRRA 4OOIA 3KLOA 3HSFA 3J80Z 4ZH4F 3C1DA 3LAJA 2O6GE 5D4RA 2FBKA 3HYIA 1MKMA 3BWGA 3Q9SA 3R4KA 4A6DA 1ON2A 3BZ6A 2R7FA 2P7CB 1KGSA 2HFHA 4IPAA 3T8RA 4KN4X 3WU0A 3IKTA 1MD0A 2VC0A 3ABUA 3RKYA 1MJ9A 2QVOA 3RYRA 3TKYA 3F8NA 1LJ9A 1FLIA 2O3FA 1QBJA 4RB1A 4G8XA 2PEXA 2VN2A 1P4XA 5F6FA 2V6CA 3LA7A 2XKPA 3HUGA 2RV8A 2RGVA 2D45A 1Z7UA 4A0YA 1HQCA 4L18B 3MZYA 4IRIA 4Y17A 4KUMA 3HTSB 4R1HA 4PZJA 4M6XA 3JAMZ 1J59A 1UB9A 3WG9A 5J8FA 2W25A 4HX4A 4AD9A 3FHZA 2OA4A 2DI3A 1U6GA 3V7CA 4U0YA 2HTJA 2YU3A 5DV5A 1CF7A 3WGIA 4AWXB 1FBSA 3F21A 1IZ1A 1P4AA 1HKQA 1SFXA 3D5LA 2DO7A 4LG0A 1YLFA 2RVCA 3TOBA 1ZRFA 2WTEA 2MH9A 3CDHA 4WXCA 1DDNA 1ZG3A 3NRVA 1KQ0A 1YG2A 2RNJA 4RB3C 4FX4A 1Z6TA 4WXDA 3EETA 1T98A 3ABTA 2Q2EA 4Y15A 3OOPA 1TQIA 1G3WA 2Y48A 3BJAA 3DQVC 3WGHA 2EA4A 3GFMA 1CF7B 4WX9A 4Q48A 2MD5A 4I7HA 2EWNA 3LSTA 3VOEA 5E8IA 1IXSB 1KQ9A 3GX4X 5FB2A 4BH9A 5K1YA 3ERED 3JSPA 2V1UA 1G6NA 2AS5F 3E6CC 1IN7A 1ON1A 3M9AA 1W7PD 2XASA 2VBYA 3C18A 3TGNA 1PP7U 4E70A 4FT8A 2FU4A 1MJAA 3HRSA 3VFZA 1FP2A 3Q9VA 4NQWA 1BI3A 2Q0OA 3U2RA 2ADUA 4UVCA 2XAJA 1DUXC 5A2QK 2DQLA 1FYKA 4HF1A 2EV0A 1ZLJA 2FOKA 1XCBA 2CO5A 2CWEA 2ESHA 3DEUA 4WK8F 4BYYA 2PN6A 4CHUA 1FSHA 5E20A 5TJJA 5H6QA 1QQIA 5JR3A 2EFPA 1BN5A 2CQKA 2GA2A 2VONA 5H6RA 4CO8A 4UHTA 2LF7A 2A5YB 2XAHA 1JE8A 4P9FA 3E6BA 2L4MA 3ZPLA 1RIOH 4KNYA 2QQAA 4HLYA 1H9GA 5BPIA 2K4BA 4HX8A 3DPTA 4QWQA 2A07F 5ED4A 2MA3A 2Z5UA 3KEOA 5L3DA 1FP1D 4EJUA 3BJOA 4LMYA 1FYMA 4MNUA 1DPRA 4WXHA 1BIAA 5HLGA 5K5QA 3DXJF 5BMZA 2PI0A 3GUDA 1KU7A 2FBIA 3NEUA 1Z91A 2EFWA 2STTA 3BOQA 3KP6A 1QO0D 4ENNA 3HRMA 4YIFA 1Y0UA 2QYOA 2DTRA 2YR2A 1JXSA 3F23A 1H0MA 3GZ6A 3GWZA 2FBHA 3P9IA 4IF4A 2EFNA 5AIPA 1SMTA 4UNOA 4EM0B 2CYYA 2PFBA 1U78A 3FF5A 3O2PE 3TO7A 4HV6A 1XGOA 1L3LA 3V4GA 1XB4A 3GLXA 3T1BA 5LHIA 1SAXA 2DBBA 4CZZA 1IN8A 2ZBKA 4HX7A 3VB2A 4G7ZF 2HOEA 3HRUA 2ZKZA 1BI1A 1PP8F 2HQRA 3BPVA 2Z99A 1R7JA 2QUFA 3HSEA 1BC8C 4I98B 3FMSA 3IWZA 1ZGAA 4XSXF 1EV7A 2O8XA 3H3UA 2H09A 2L4AA 3WODF 1SFUA 4O6JA 4Y13A 2ETHA 2O03A 3Q5FA 4CXFA 1R5HA 1F1ZA 4HF0A 3LWFA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2UZK A;  2H94 A;  1G4D A;  2ZCW A;  2WV0 A;  1WQ2 A;  3FM5 A;  2O61 A;  4L9J A;  1ZN2 A;  1XDS A;  2WWY A;  1XSV A;  2VT3 A;  3TO6 A;  2EV5 A;  2GQQ A;  3RKX A;  1ZLK A;  1FOK A;  3V7R A;  2WC2 A;  3LA3 A;  4EJO A;  2JZY A;  4HV5 A;  1ONV A;  1G3S A;  2ZO4 A;  1KYW A;  3HIF A;  3I0T A;  2IA1 A;  1H9T A;  3ZMS A;  1YW7 A;  5EEH A;  3KFW X;  2PLY A;  4LK0 F;  1W7P B;  4MEY F;  1WSU A;  2HKO A;  4EM2 A;  3JW4 A;  1QZY A;  2K27 A;  4I0A A;  4U88 A;  1YYV A;  4M9Z A;  1RUO A;  3RTR A;  1YS7 A;  4D0P A;  4LGW A;  3BRO A;  4EGY A;  3MAJ A;  3W6K B;  3GO5 A;  2ZME B;  5DD4 A;  4ESB A;  2JRT A;  1HKS A;  2K7L A;  1I1S A;  4JBA A;  1IRF A;  3WTU C;  1HW2 A;  5JVT A;  2M45 A;  1XSX A;  1W4M A;  1X3U A;  1STZ A;  5HS7 A;  5BOX A;  3P9K A;  4Q5S F;  2ZFW A;  4MEX F;  5DCF A;  1S3J A;  5F1R A;  3I59 A;  5DUK A;  2XV4 S;  4EM1 A;  3I5U A;  4YFN F;  3T8T A;  1FPQ A;  2BYV E;  1OYI A;  5LHG A;  2ISY A;  1J2X A;  5F64 A;  1U5T B;  2GWR A;  5ICC A;  1I6X A;  3JTH A;  1ZH5 A;  4EVI A;  2VBZ A;  2QWW A;  3WTY C;  2IVM A;  1B9N A;  4HA8 A;  1UHM A;  3IKV A;  2CSO A;  2STW A;  2IP2 A;  2QEN A;  1IXR C;  4YFK F;  2LF8 A;  1K6O A;  4KN7 X;  5LEK A;  1O3S A;  5JFR A;  3I59 B;  1B6A A;  2R7D A;  4HDU A;  4LJZ F;  4AVP A;  1D8J A;  4KMU X;  4MHG A;  1LDD A;  2ZNY A;  1W5S A;  2K86 A;  4KMF A;  1P2F A;  1R1T A;  1RUN A;  3N4M A;  1I27 A;  2P4W A;  1IUY A;  4HAM A;  3MQ0 A;  1E17 A;  4ZYH A;  2NRA C;  1T2K A;  2D1V A;  3C7J A;  5EEG A;  5FFZ A;  3T5X A;  5L3F A;  1BJA A;  4TV7 A;  1RI7 A;  2DW4 A;  2QBY B;  5A2Q Z;  2J5P A;  4XSZ F;  1S7O A;  3LQR A;  3TQN A;  3U9G A;  3GZ5 A;  1QPM A;  3ULQ B;  4HW0 A;  1AWC A;  3J81 K;  2QQ9 A;  2DAO A;  2ZNZ A;  3EYI A;  2JSC A;  2L54 A;  2UXX A;  3ECO A;  4M9X A;  1OYW A;  3ZMU A;  2G9W A;  5FD6 A;  3KET A;  3V7S A;  1G3Y A;  2GIV A;  2VBX A;  1I5Z A;  2PJP A;  3K1M A;  1LNW A;  1IXC A;  2R3S A;  1EH7 A;  4G6Q A;  2VOO A;  2YX4 A;  4HQE A;  3ZMT A;  5IT3 A;  5LEJ A;  2GAU A;  3GW2 A;  5D8K B;  3JSO A;  4GCV A;  1FZP B;  5ILS A;  1SD7 A;  2C6Y A;  5FFX A;  4Q47 A;  1BM9 A;  2VBW A;  1HW1 A;  2DK5 A;  4M9S A;  2OBP A;  2IW5 A;  4OIQ F;  2D2W A;  2MBF A;  1SD5 A;  3KP4 A;  1KU3 A;  4L0Z B;  1XGS A;  1QGP A;  4R79 A;  2YPR A;  1IW7 F;  4CGZ A;  3E3V A;  1O3R A;  5FD5 A;  3V8K A;  1BC7 C;  1WI9 A;  2DLL A;  3SHF A;  2CGP A;  3MWM A;  4O5V A;  1GVJ A;  2HS5 A;  4GYI A;  4ESJ A;  1SD6 A;  4S04 A;  1O3Q A;  2BE5 F;  4OMZ A;  3F8C A;  3WU1 B;  1KYZ A;  4M6Y A;  1MGT A;  2XKO A;  3L7W A;  1R1V A;  1D3Y A;  5HLI A;  4IJA A;  2M1B A;  2V1X A;  2FXA A;  3MEX A;  3GYH X;  3F6O A;  2TDX A;  2L3D A;  4KIF A;  1FSE A;  3CO6 C;  3W6J B;  2E7X A;  1Z1D A;  3DKW A;  5D4S A;  2FE3 A;  4LFU A;  3LQQ A;  2DU9 A;  2KIM A;  2FQ3 A;  3WTV C;  1IN6 A;  4LB5 A;  3SXY A;  3HHH A;  4AIK A;  1PUE E;  4RAZ A;  1BBY A;  1P92 A;  2FEZ A;  4M71 A;  4ENK A;  4BHB A;  3FXQ A;  4IRH A;  5CLS A;  2NAZ A;  1ZG5 A;  3PQK A;  1XDU A;  2JTV A;  4NB5 A;  5KK1 A;  3HTU A;  1HXD A;  3FX3 A;  3V8L A;  3LFK A;  3F8B A;  2KIU A;  1S8N A;  2MLG A;  2KIF A;  4Z2Y A;  5DDG A;  1F9N A;  3TO9 A;  2LDU A;  1HSJ A;  3K1P A;  1TW3 A;  3QU6 A;  5H20 A;  2MC3 A;  4ENJ A;  2HDC A;  3WTT C;  1YW8 A;  3L2C A;  1G3T A;  2M5W A;  4ON0 A;  2Y0M A;  1DP7 P;  1V3F A;  4L5I A;  3ML6 A;  2IRF G;  3IWF A;  2BEO A;  3I54 A;  2DK8 A;  3HOT A;  3WTS C;  2IT0 A;  5HDK A;  3OV8 A;  3ZMD A;  5L3E A;  2OAZ A;  5LGU A;  3RPU A;  1B1B A;  4ETS A;  1IF1 A;  4O3M A;  3DFG A;  3BJ6 A;  2FA5 A;  1FY7 A;  2EA2 A;  2XAG A;  4PDK A;  2JPC A;  1D5V A;  1T6S A;  3VEP A;  4WCG A;  1Q1H A;  3KP2 A;  3KP3 A;  3RPQ A;  1R58 A;  3P7N A;  5D8L B;  1UHW A;  4OMY A;  2QQB A;  1U5T C;  3PQJ A;  3I4P A;  2IA2 A;  2H6C A;  5ICF A;  1XSD A;  1OMI A;  1BI0 A;  1FBU A;  1LDK B;  1SMY F;  3KZZ A;  2DPU A;  1QNT A;  4PGH A;  1KA8 A;  5BPD A;  4G7O F;  3LAP A;  1ZRE A;  2DT5 A;  4MGR A;  1LDJ A;  3MZH A;  2P5V A;  4KIB A;  2KKO A;  1T39 A;  4MQ9 F;  1W7P A;  5L3G A;  2H6B A;  3IHU A;  1DPU A;  3U1D A;  2XVC A;  1O3T A;  2VE9 A;  1IAW A;  4UVA A;  1KQ8 A;  5BQT A;  2Q8K A;  1IN5 A;  4I02 A;  4WWC A;  2OZU A;  2M87 A;  4M72 A;  4R8H A;  5K5R A;  4UV9 A;  5D6E A;  2ZME A;  5D5V B;  3F22 A;  3RDI A;  1KU2 A;  3EUH A;  4CYD A;  2HTS A;  2XGX A;  1REP C;  3CLO A;  3LA2 A;  2NYX A;  1WWX A;  2X0L A;  3E97 A;  5FO5 A;  2EJR A;  1HST A;  2XHK A;  3H3Z A;  3I53 A;  1XMA A;  4HZF A;  1GXQ A;  4I01 A;  3QPH A;  2VE8 A;  3J81 Z;  3L9F A;  1Z05 A;  2RN7 A;  3ZMZ A;  3WTZ A;  4ZZD A;  2E1C A;  3CO7 C;  1PDN C;  3I58 A;  2A3S A;  1U5T A;  2NNY A;  5LHH A;  2RQP A;  4RB0 A;  4N0B A;  3TDU C;  4L9T A;  2W84 A;  1A04 A;  4RS8 A;  1YFH A;  4YFX F;  3KE2 A;  2GXG A;  2RKH A;  3I64 A;  3B73 A;  5L3B A;  3CUQ B;  2EV6 A;  1LEA A;  3HHG A;  1BI2 A;  4KFC A;  5J6X A;  1HBX G;  1TQP A;  3FZV A;  4ESF A;  3ZP5 A;  2NS0 A;  5ERI A;  4OIO F;  2E1N A;  4DNC A;  1Z9C A;  4HLX A;  3QP5 A;  2NNN A;  1FX7 A;  1WKM A;  2PG4 A;  1B4A A;  3E6M A;  4F7Z A;  2GA1 A;  5CJ9 A;  4N9I A;  1ZRD A;  2HWV A;  5HVQ C;  2HYF A;  4KIG A;  4JK1 X;  2K4J A;  4IHS A;  1XD7 A;  4K2E A;  4BXU A;  2AXL A;  2A69 F;  2FMY A;  1FYL A;  2QBY A;  4ZYG A;  4HF2 A;  2Y75 A;  4RB2 C;  3HRT A;  5LRS A;  1TBX A;  2D1H A;  4S05 A;  3REO A;  2ZXJ A;  1R36 A;  3QRF F;  1EH6 A;  3R6S A;  1J7K A;  2VOP A;  3FXR A;  2H27 A;  3KP7 A;  2XIG A;  2IPQ X;  1ODD A;  3J7A O;  5IT9 K;  5JHU A;  5E8G A;  2G7H A;  4G6D A;  5CVV A;  4M74 A;  2V1D A;  2P5L C;  1MDM B;  1F5T A;  4UV8 A;  5HDG A;  2HQN A;  1FNN A;  3MFK A;  3R60 A;  4DQ2 A;  4LK1 F;  2FNA A;  3JTG A;  3SZT A;  5E18 F;  5CYV A;  5DYM A;  2HZT A;  5DCM A;  1UCR A;  3ROU A;  2FRH A;  2LKP A;  5D5U B;  2XAQ A;  4EJW A;  1C0W A;  3FMQ A;  2VC1 A;  2Z33 A;  5TRD A;  4P5O A;  4A0X A;  3GEZ A;  4YG2 F;  3E5U A;  2ELH A;  4BQA A;  1IN4 A;  3COA C;  2EK5 A;  1K78 A;  2P6S A;  4CIC A;  3EDP A;  4U0W A;  4OIP F;  3BDD A;  3GFL A;  4OU0 A;  2XRO A;  1BOA A;  1XN7 A;  1YQA A;  1UFM A;  2VXZ A;  3WGG A;  2RC4 A;  4QLC U;  1S6L A;  5D6F A;  4I0B A;  3B02 A;  4EGZ A;  1YTY A;  2A6H F;  5CVU A;  2FNP A;  4LLG F;  3HSR A;  3SFZ A;  4LB6 B;  3L00 A;  4HBL A;  1Z6R A;  3GVA A;  1GXP A;  4WF2 A;  3KP5 A;  5DCM B;  1JHH A;  4B09 A;  3RI4 A;  4EJT A;  5E17 F;  2HKX A;  4ASN A;  3M7G A;  5ILU A;  1J75 A;  2XUB A;  3RYP A;  5HOO A;  5LRR A;  4GYG A;  1JGS A;  1K78 B;  5KVR A;  3SZP A;  1VTN C;  2FSW A;  2PMU A;  5CVJ A;  3IRQ A;  2A61 A;  2O0Y A;  3S2W A;  3CUO A;  3T0Y A;  1UST A;  2L01 A;  2PMH A;  3VOD A;  5FLX K;  2CFX A;  3FM3 A;  1O7F A;  1D8K A;  4IHT A;  4MTD A;  2W85 A;  4HYE A;  4I2O A;  3ZQ7 A;  3FMR A;  5FGM A;  1IRG A;  4JQF A;  5DEQ A;  2HGC A;  4RGX A;  3F72 A;  2OQR A;  1LVA A;  2XAF A;  1HKT A;  4H0E A;  5ILV A;  3TDZ C;  2EFO A;  4LD5 A;  1S7A A;  1L0O C;  2B0L A;  4BHP A;  2ZJ2 A;  3CJN A;  4P9U A;  1RZ4 A;  3IL2 A;  2OU2 A;  1U3E M;  4PGG A;  2FML A;  3C3W A;  5AIQ A;  1W5T A;  3IC7 A;  2PQ8 A;  5D5X B;  3FXU A;  3ZN1 A;  4XLP F;  4IRG A;  4LG0 B;  2HEO A;  1OR7 A;  4G7H F;  3J80 K;  3N97 A;  3I71 A;  5DUI A;  4HDV A;  5ICE A;  1SFE A;  5HLH A;  4A0Z A;  1F4K A;  4GGG A;  1OKR A;  4ZZL A;  4GXO A;  2JT1 A;  2F5D A;  5E1W A;  2P7V B;  1T0F A;  3DF8 A;  5J8C A;  1MZB A;  4UVB A;  2KJB A;  3QAH A;  2P6T A;  2P8T A;  1HW5 A;  1O7L A;  3BP8 A;  4EQQ A;  1J9I A;  2F5E A;  3F6V A;  4GO1 A;  1TLH B;  3RKW A;  4A2U A;  1YO5 C;  3F3X A;  4N9H A;  3EQL F;  4U0V A;  3R0A A;  1E2X A;  5L3C A;  1V4R A;  3WE3 A;  4I09 A;  2VT2 A;  3ZN0 A;  4A6E A;  3K9T A;  1ZRC A;  5LBQ A;  2DPD A;  5HS9 A;  2HR3 A;  2M30 A;  2EFQ A;  2F5F A;  1FBQ A;  4OIR F;  1ZHF A;  1S29 A;  4IVN A;  1R23 A;  2LNB A;  3ZMV A;  2FF4 A;  1KU9 A;  3RJP A;  4RGS A;  3K0L A;  2IJL A;  4Q4Z F;  4B8X A;  1TNS A;  3CUQ C;  3JAM K;  1MJB A;  1YS6 A;  2MLK A;  4ZYE A;  2PBI A;  2VOD A;  2DQR A;  4P55 A;  2QM3 A;  3KLN A;  1FC3 A;  1FT9 A;  2YSR A;  3BY6 A;  2V79 A;  3G3Z A;  1XCV A;  4UXN A;  2ESN A;  3GXO A;  4XLN F;  1ZAR A;  4L5J A;  1R1U A;  2W57 A;  2G7U A;  4XBF A;  3FWE A;  1K79 A;  5JI6 A;  2UXN A;  1R22 A;  1LQ1 A;  2J5O A;  2YX7 A;  3EYY A;  5ICG A;  1LEB A;  1SD4 A;  4G94 A;  4FHT A;  1K7A A;  4YII A;  3R0J A;  3R61 A;  2XRN A;  2EB7 A;  4BNC A;  3O6B B;  2IA0 A;  3GFI A;  3ISP A;  4MTE A;  2QZ8 A;  2ISZ A;  1B9M A;  3WTX C;  1TQM A;  1NHA A;  1U8R A;  1FWZ A;  5IT9 Z;  4P96 A;  3KEQ A;  1B59 A;  4EJV A;  1P6R A;  1U2W A;  2QLZ A;  3HOS A;  3M8E A;  5E1Z B;  2Z9O A;  5BS6 A;  3G73 A;  4U7B A;  3DPL C;  5HS8 A;  2M8E A;  3DV8 A;  1XMK A;  3E6D A;  3GFJ A;  2RDP A;  4KA4 A;  2ACJ A;  1I1G A;  3CUQ A;  4ZYD A;  1BIB A;  3L09 A;  4LLN A;  4G9Y A;  1CGP A;  3D0S A;  1EH8 A;  1GHC A;  1ZAO A;  2KJC A;  5K5O A;  4NHJ A;  5AON A;  3K1N A;  4RGU A;  2W24 A;  4HOB A;  2A6E F;  2UWM A;  3QPT A;  3PFI A;  3E5Q A;  2KRF A;  1TW2 A;  3GF2 A;  4AIH A;  1OPC A;  3SQN A;  5CVR A;  1R5G A;  4EMS A;  2CG4 A;  3F8F A;  3E5X A;  1TNT A;  4KIC A;  5DD8 A;  3P9C A;  1T38 A;  1LB2 A;  1TTY A;  2HYG D;  2MH2 A;  3CTA A;  4AIJ A;  4KT5 C;  2K02 A;  3NQO A;  3KCC A;  1P4W A;  3QOP A;  4CDG A;  2COM A;  3DP7 A;  1ULY A;  1YIO A;  2V9V A;  1XGN A;  5HDN A;  3TOA A;  4FX0 A;  4BAY A;  1J0R A;  5LGT A;  3M1E A;  2BBY A;  3BPX A;  1ZG1 A;  4LLL A;  1R00 A;  3MCZ A;  1J5Y A;  3ELK A;  4OIN F;  2Z3Y A;  4U7D A;  2L02 A;  1WRJ A;  4RAY A;  1OYY A;  4MQV A;  6PAX A;  2OD5 A;  4A5N A;  4IXA A;  2BGC A;  3RIR A;  3QU3 A;  5LGN A;  1MDM A;  1XGM A;  5FLX Z;  5LLQ A;  1YW9 A;  1ZYR F;  2DFI A;  1AOY A;  2LSO A;  2OQG A;  4PCQ A;  4HQM A;  1USS A;  4A12 A;  2JPB A;  3V8J A;  4M73 A;  3K2Z A;  4KYW A;  1JHF A;  3ECH A;  5E1X A;  5CVI A;  2F5C A;  3WTW C;  3AAF A;  4L0Y B;  3M8F A;  1O57 A;  3WE2 A;  2P5K A;  2OZ6 A;  1ZGJ A;  4A5M A;  1QZZ A;  3F8M A;  4UUV A;  3O3K A;  2X4H A;  4XRF A;  4EV0 A;  4L9V A;  2CW0 F;  2F2E A;  2GZW A;  2BV6 A;  4L9N A;  1RNL A;  3H92 A;  4BHC A;  4ENM A;  4KDP A;  2GXB A;  3QP6 A;  4RGR A;  2A68 F;  3KZY A;  2E7W A;  3K69 A;  5D5W B;  3IRR A;  4OOI A;  3KLO A;  3HSF A;  3J80 Z;  4ZH4 F;  3C1D A;  3LAJ A;  2O6G E;  5D4R A;  2FBK A;  3HYI A;  1MKM A;  3BWG A;  3Q9S A;  3R4K A;  4A6D A;  1ON2 A;  3BZ6 A;  2R7F A;  2P7C B;  1KGS A;  2HFH A;  4IPA A;  3T8R A;  4KN4 X;  3WU0 A;  3IKT A;  1MD0 A;  2VC0 A;  3ABU A;  3RKY A;  1MJ9 A;  2QVO A;  3RYR A;  3TKY A;  3F8N A;  1LJ9 A;  1FLI A;  2O3F A;  1QBJ A;  4RB1 A;  4G8X A;  2PEX A;  2VN2 A;  1P4X A;  5F6F A;  2V6C A;  3LA7 A;  2XKP A;  3HUG A;  2RV8 A;  2RGV A;  2D45 A;  1Z7U A;  4A0Y A;  1HQC A;  4L18 B;  3MZY A;  4IRI A;  4Y17 A;  4KUM A;  3HTS B;  4R1H A;  4PZJ A;  4M6X A;  3JAM Z;  1J59 A;  1UB9 A;  3WG9 A;  5J8F A;  2W25 A;  4HX4 A;  4AD9 A;  3FHZ A;  2OA4 A;  2DI3 A;  1U6G A;  3V7C A;  4U0Y A;  2HTJ A;  2YU3 A;  5DV5 A;  1CF7 A;  3WGI A;  4AWX B;  1FBS A;  3F21 A;  1IZ1 A;  1P4A A;  1HKQ A;  1SFX A;  3D5L A;  2DO7 A;  4LG0 A;  1YLF A;  2RVC A;  3TOB A;  1ZRF A;  2WTE A;  2MH9 A;  3CDH A;  4WXC A;  1DDN A;  1ZG3 A;  3NRV A;  1KQ0 A;  1YG2 A;  2RNJ A;  4RB3 C;  4FX4 A;  1Z6T A;  4WXD A;  3EET A;  1T98 A;  3ABT A;  2Q2E A;  4Y15 A;  3OOP A;  1TQI A;  1G3W A;  2Y48 A;  3BJA A;  3DQV C;  3WGH A;  2EA4 A;  3GFM A;  1CF7 B;  4WX9 A;  4Q48 A;  2MD5 A;  4I7H A;  2EWN A;  3LST A;  3VOE A;  5E8I A;  1IXS B;  1KQ9 A;  3GX4 X;  5FB2 A;  4BH9 A;  5K1Y A;  3ERE D;  3JSP A;  2V1U A;  1G6N A;  2AS5 F;  3E6C C;  1IN7 A;  1ON1 A;  3M9A A;  1W7P D;  2XAS A;  2VBY A;  3C18 A;  3TGN A;  1PP7 U;  4E70 A;  4FT8 A;  2FU4 A;  1MJA A;  3HRS A;  3VFZ A;  1FP2 A;  3Q9V A;  4NQW A;  1BI3 A;  2Q0O A;  3U2R A;  2ADU A;  4UVC A;  2XAJ A;  1DUX C;  5A2Q K;  2DQL A;  1FYK A;  4HF1 A;  2EV0 A;  1ZLJ A;  2FOK A;  1XCB A;  2CO5 A;  2CWE A;  2ESH A;  3DEU A;  4WK8 F;  4BYY A;  2PN6 A;  4CHU A;  1FSH A;  5E20 A;  5TJJ A;  5H6Q A;  1QQI A;  5JR3 A;  2EFP A;  1BN5 A;  2CQK A;  2GA2 A;  2VON A;  5H6R A;  4CO8 A;  4UHT A;  2LF7 A;  2A5Y B;  2XAH A;  1JE8 A;  4P9F A;  3E6B A;  2L4M A;  3ZPL A;  1RIO H;  4KNY A;  2QQA A;  4HLY A;  1H9G A;  5BPI A;  2K4B A;  4HX8 A;  3DPT A;  4QWQ A;  2A07 F;  5ED4 A;  2MA3 A;  2Z5U A;  3KEO A;  5L3D A;  1FP1 D;  4EJU A;  3BJO A;  4LMY A;  1FYM A;  4MNU A;  1DPR A;  4WXH A;  1BIA A;  5HLG A;  5K5Q A;  3DXJ F;  5BMZ A;  2PI0 A;  3GUD A;  1KU7 A;  2FBI A;  3NEU A;  1Z91 A;  2EFW A;  2STT A;  3BOQ A;  3KP6 A;  1QO0 D;  4ENN A;  3HRM A;  4YIF A;  1Y0U A;  2QYO A;  2DTR A;  2YR2 A;  1JXS A;  3F23 A;  1H0M A;  3GZ6 A;  3GWZ A;  2FBH A;  3P9I A;  4IF4 A;  2EFN A;  5AIP A;  1SMT A;  4UNO A;  4EM0 B;  2CYY A;  2PFB A;  1U78 A;  3FF5 A;  3O2P E;  3TO7 A;  4HV6 A;  1XGO A;  1L3L A;  3V4G A;  1XB4 A;  3GLX A;  3T1B A;  5LHI A;  1SAX A;  2DBB A;  4CZZ A;  1IN8 A;  2ZBK A;  4HX7 A;  3VB2 A;  4G7Z F;  2HOE A;  3HRU A;  2ZKZ A;  1BI1 A;  1PP8 F;  2HQR A;  3BPV A;  2Z99 A;  1R7J A;  2QUF A;  3HSE A;  1BC8 C;  4I98 B;  3FMS A;  3IWZ A;  1ZGA A;  4XSX F;  1EV7 A;  2O8X A;  3H3U A;  2H09 A;  2L4A A;  3WOD F;  1SFU A;  4O6J A;  4Y13 A;  2ETH A;  2O03 A;  3Q5F A;  4CXF A;  1R5H A;  1F1Z A;  4HF0 A;  3LWF A; 
#chains in the Genus database with same CATH topology
 3S1R J;  2UZK A;  5EGO A;  2H8R A;  2H94 A;  1G4D A;  2DJI A;  2ZCW A;  4I99 C;  2WV0 A;  1BL0 A;  2IS2 A;  1WQ2 A;  3Q0U A;  3FM5 A;  2O61 A;  4L9J A;  3A01 B;  1ZN2 A;  1P7I A;  1XDS A;  2PJR A;  2WWY A;  5HOD A;  1JKP C;  1XSV A;  3S8P A;  2VT3 A;  3TO6 A;  2EV5 A;  3GTO J;  2VJJ A;  2O8K A;  3VYU B;  2GQQ A;  3RKX A;  3DBL B;  1ZLK A;  5EG0 A;  1SVL A;  1FOK A;  4MO7 A;  5J1R A;  3V7R A;  2MC4 A;  4DOZ A;  1TWH J;  4DIQ A;  2XPU A;  4CYC B;  3ZQL A;  1UZC A;  1IGN A;  2WC2 A;  1ETQ A;  3LA3 A;  1YJW I;  1TL8 A;  5DM6 F;  4EJO A;  2JZY A;  4HV5 A;  1MSE C;  1QU3 A;  1ONV A;  1G3S A;  1G2H A;  2ZO4 A;  1KYW A;  1AKH A;  3HIF A;  3I0T A;  5LD2 C;  2IA1 A;  1H9T A;  3ZMS A;  1YW7 A;  1B8I A;  5EEH A;  1HC8 A;  3KFW X;  2PLY A;  3BTJ A;  4LK0 F;  1W7P B;  4MEY F;  3OSG A;  1WSU A;  4XRS G;  2HKO A;  4EM2 A;  3JW4 A;  1QZY A;  3QPL A;  2K27 A;  5GTH C;  5EGO B;  2BXY A;  2JA2 A;  4I0A A;  2BXZ A;  4U88 A;  1YYV A;  2ID6 A;  4M9Z A;  1RUO A;  2AO9 A;  3RTR A;  2R7S A;  1EA3 A;  1YS7 A;  3KYL A;  2LLK A;  4D0P A;  4LGW A;  3H9J A;  3BRO A;  2LKS A;  3PNY A;  2D5V A;  4EGY A;  5FJ8 J;  3MAJ A;  2DJN A;  3W6K B;  1N78 A;  1CQT A;  5EG0 B;  3GO5 A;  2ZME B;  5DD4 A;  4ESB A;  4RLF A;  2JRT A;  1HKS A;  3JRI A;  2K7L A;  2O9L A;  1I1S A;  4JBA A;  2L9S A;  1IRF A;  2L9V A;  3FXL A;  3WTU C;  1HW2 A;  2VJI A;  5JVT A;  2M45 A;  2AXT C;  1GT0 C;  1SAU A;  1XSX A;  1W4M A;  1X3U A;  1STZ A;  5HS7 A;  4GRI A;  5BOX A;  3L2V A;  3P9K A;  2NOG A;  4Q5S F;  2M3A A;  2ZFW A;  5LFA A;  5DCF A;  4MEX F;  1S3J A;  5F1R A;  3I59 A;  1U9O A;  2BVM A;  2XV4 S;  4NC8 A;  5DUK A;  2OTL I;  9ANT A;  4EM1 A;  3OYE A;  2ME0 A;  3I5U A;  4BXX J;  1A6I A;  1EKE A;  3W6V A;  1GDT A;  3IAM 2;  3PUB A;  2GIZ A;  3T8T A;  4YFN F;  1FPQ A;  2BYV E;  1OYI A;  5LHG A;  2ISY A;  1J2X A;  2JVG A;  4A3E J;  5F64 A;  1U5T B;  2GWR A;  4IL6 C;  2QSG X;  2UV1 A;  4BBR J;  5ICC A;  5IPA A;  1I6X A;  3JRC A;  2CJJ A;  3OS0 A;  4ZDO A;  1DGR M;  5J3L A;  3JTH A;  1ZH5 A;  4EVI A;  3OYI A;  2VBZ A;  3BTL A;  2XGC A;  2QWW A;  4V19 K;  3MMY B;  2ZJQ F;  4OWR B;  2IGM A;  4E4H A;  4EAT A;  3WTY C;  3WU2 C;  5F0H A;  3A0H C;  2IEK A;  2IVM A;  1B9N A;  2E35 A;  2EBI A;  4HA8 A;  3S32 A;  4MLO A;  1UHM A;  1JKO C;  3IKV A;  2DOF A;  3M1C A;  2V9P A;  2F6C A;  3FIS A;  3OR2 C;  1ZTR A;  2CSO A;  1HCR A;  2IP2 A;  2STW A;  2QEN A;  1TWG J;  1IXR C;  4YFK F;  3S14 J;  2VKH A;  4JX5 A;  2LF8 A;  1K6O A;  2ZXH A;  2HNH A;  4KN7 X;  5LEK A;  1O3S A;  2NVX J;  3GTP J;  5JFR A;  3I59 B;  1B6A A;  3BR0 A;  1F36 A;  2R7D A;  2DA7 A;  4HDU A;  4LJZ F;  4AVP A;  1IG7 A;  2WB1 N;  1W0T A;  3CJR B;  4AYB N;  1D8J A;  2HDD A;  4KMU X;  3FXJ A;  2E1M C;  4MHG A;  1LDD A;  4U87 A;  2ZNY A;  1W5S A;  1TWA J;  2K86 A;  1OCP A;  3FXK A;  3DLL F;  4KMF A;  2M4K A;  1P2F A;  2Y9Z A;  1R1T A;  4C3I J;  2GOM A;  2L0K A;  3ERM A;  1RUN A;  3N4M A;  4LIU A;  1I27 A;  3K4M A;  2P4W A;  1IUY A;  3S17 J;  4HAM A;  3MQ0 A;  1E17 A;  4ZYH A;  1VQP I;  1NG7 A;  2NRA C;  3GME A;  1LFB A;  1T2K A;  3M8J A;  2D1V A;  2LY1 A;  4PFO A;  3C7J A;  5EEG A;  5FFZ A;  3T5X A;  5L3F A;  1BJA A;  2Y69 H;  4TV7 A;  2QKM B;  4DBQ A;  1RI7 A;  2K3P A;  1FEX A;  3OYN A;  2FUG 2;  4DW6 A;  2DW4 A;  2Y2Z A;  4C9Y A;  2QBY B;  1JKR C;  1LVK A;  2L7M P;  1X2N A;  4RAF A;  5A2Q Z;  4XRS A;  2J5P A;  1GV2 A;  2N8G A;  1SVM A;  4XSZ F;  1QA6 A;  1JUP A;  2ZJP F;  1S7O A;  3LQR A;  3ABL H;  3TQN A;  3U9G A;  1Z67 A;  4NUB A;  3GZ5 A;  1JUS A;  1QPM A;  3ULQ B;  4HW0 A;  1H89 C;  1AWC A;  1QPI A;  4E7H A;  4XLF A;  3J81 K;  2YU9 J;  2XPV A;  2QQ9 A;  2DAO A;  2ZNZ A;  2GM4 A;  3EYI A;  4Z6Y A;  5KNL A;  1Y39 A;  2JSC A;  1G8X A;  2L54 A;  2UXX A;  3ECO A;  4M9X A;  4XOR A;  1OYW A;  3TP0 A;  2Y31 A;  4UB6 C;  2KFD A;  1WH5 A;  3ZMU A;  3HOW J;  3O8G A;  2G9W A;  4MIM A;  5FD6 A;  3FHN A;  2CQ7 A;  3KET A;  4ANJ A;  1PYV A;  3V7S A;  2L2O A;  1G3Y A;  1ZR2 A;  1VZ0 A;  3OYH A;  3KIO A;  1YIJ I;  2GIV A;  2V26 A;  2VBX A;  2OV7 A;  1I5Z A;  2BY0 A;  5M3M J;  1ZEL A;  4A3K J;  4XON A;  2R7R A;  4B4C A;  2PJP A;  3K1M A;  1LNW A;  1KON A;  3TW6 A;  1IXC A;  2R3S A;  1EH7 A;  4G6Q A;  3GZN B;  2VOO A;  3GTK J;  2YX4 A;  4HQE A;  2ZFU A;  3ZMT A;  1MBH A;  5IT3 A;  5LEJ A;  2GAU A;  3GW2 A;  5FRM A;  2WAQ N;  5D8K B;  3PJR A;  3JSO A;  2HXO A;  2MFZ A;  4GCV A;  4CCN A;  1FZP B;  5ILS A;  1SD7 A;  2C6Y A;  5FFX A;  4Q47 A;  4C2M J;  4MFE A;  3ZQF A;  5B3S H;  1DU6 A;  4BDY A;  4XM3 A;  5GPA A;  5B66 C;  3D1N I;  1BM9 A;  2VBW A;  1HW1 A;  2OCC H;  1W1W E;  1X19 A;  3S1M J;  2DK5 A;  2R7T A;  1LFP A;  5KAI C;  4M9S A;  2OBP A;  2IW5 A;  4H4K C;  4OIQ F;  4FQG A;  3HJE A;  4HEA 2;  4C3H J;  2D2W A;  3IH2 A;  2MBF A;  2JN6 A;  1SD5 A;  2CUF A;  2E5Z A;  3KP4 A;  1KU3 A;  4L0Z B;  1XGS A;  2ZSI B;  3ZQI A;  1QGP A;  2E2J J;  4R79 A;  2YPR A;  2H1L A;  1IW7 F;  5IYB J;  1BR1 A;  4CGZ A;  4X6A J;  4BY7 J;  3HDD A;  1YHQ I;  2DTZ A;  3DWL E;  2O5R A;  3K2A A;  5DTD A;  1RET A;  3E3V A;  4BJ6 C;  5EYR A;  4RMN A;  1O3R A;  2HXI A;  5FD5 A;  3V8K A;  2X6X A;  1LKX A;  1BC7 C;  4CSW A;  1WI9 A;  4EEF G;  1BR4 A;  1FIP A;  1VND A;  2DLL A;  3SHF A;  2CGP A;  1RES A;  4G6T B;  3MWM A;  4O5V A;  2BZT A;  1GVJ A;  2HS5 A;  1OLT A;  4GYI A;  2R7W A;  4M3G A;  3I3L A;  4ESJ A;  1IDY A;  1SD6 A;  3SFI A;  4S04 A;  1O3Q A;  2BE5 F;  2R0Q C;  4OMZ A;  3F8C A;  3WU1 B;  4B43 A;  1KYZ A;  4M6Y A;  1MGT A;  1ZKG A;  2XKO A;  2XSD C;  3BG3 A;  5GPC A;  3RQ4 A;  3I4M J;  4BJT A;  4CA0 A;  4BS9 A;  3NAU A;  2JUC A;  3C2H A;  3OYK A;  1D0Z A;  3TMO A;  3J7A Y;  2KIS A;  2LBF B;  3L7W A;  1OCZ H;  1R1V A;  3KPH A;  4ITV A;  4AUX A;  1D3Y A;  5HLI A;  1A35 A;  4IJA A;  2M1B A;  4NC7 A;  3DBH B;  4BGD A;  3DKY A;  3LSI A;  2R92 J;  2WBM A;  3HGY A;  2V1X A;  2FXA A;  3MEX A;  3GYH X;  1FJL A;  3CDI A;  3OYD A;  1NG6 A;  5M3F J;  3F6O A;  2E34 A;  2TDX A;  2L3D A;  4KIF A;  1FSE A;  4RAG A;  4XL9 A;  2E71 A;  3CO6 C;  1FMV A;  2LRE A;  1R4N B;  3DCF A;  1HOM A;  1M1E B;  2IXS A;  4ZDP A;  1QVT A;  3W6J B;  5EEA A;  2E7X A;  3B6C A;  3CCU I;  1Z1D A;  1F43 A;  3DKW A;  5GAG J;  5D4S A;  3OYB A;  2M0C A;  5HLT A;  1K83 J;  2FE3 A;  4LFU A;  2M7B A;  3LQQ A;  2DU9 A;  1U0J A;  4QIW N;  2KIM A;  2FQ3 A;  3WTV C;  4QSH A;  1WVR A;  1IN6 A;  1PUF B;  4LB5 A;  3BCA A;  4A3I J;  3SXY A;  3MKL A;  3HHH A;  5DM7 F;  3LSH A;  4AIK A;  1PUE E;  2K85 A;  4RAZ A;  3K7A J;  3L2Q A;  1BBY A;  1P92 A;  2FEZ A;  4M71 A;  4ENK A;  2DT7 B;  2K9S A;  4BHB A;  2KRC A;  3FXQ A;  4IRH A;  5CLS A;  3MKY B;  2NAZ A;  1ZG5 A;  3CMA I;  2ID3 A;  4RLQ A;  1SEU A;  3PQK A;  2W1O A;  1W36 C;  3DEW A;  3HZJ A;  2R7Q A;  1XDU A;  3H36 A;  2JTV A;  1R4M B;  4NB5 A;  5KK1 A;  3HTU A;  1HXD A;  3FX3 A;  3V8L A;  3LFK A;  3F8B A;  2KIU A;  1Y0N A;  1S8N A;  2MLG A;  3FK6 A;  2KIF A;  2IBD A;  1LE8 A;  4Z2Y A;  5DDG A;  3LSR A;  1F9N A;  3TO9 A;  4BDZ A;  2LDU A;  1HSJ A;  1R6R A;  3K1P A;  1T33 A;  1TW3 A;  3QU6 A;  4BAC A;  5H20 A;  2MC3 A;  4ENJ A;  3A2K A;  2HDC A;  4LOC A;  2JA8 J;  3WTT C;  3BG5 A;  1MH4 A;  3GTL J;  4DJA A;  1YW8 A;  2DA2 A;  3L2C A;  1WJ5 A;  2KT0 A;  3CLQ A;  3HGG A;  1UMQ A;  4B47 A;  1SFO J;  1G3T A;  3S3M A;  2OTJ I;  2M5W A;  4ON0 A;  2QSH X;  1T8I A;  5K7H A;  2KMU A;  2Y0M A;  2QGU A;  2LYC A;  1V3F A;  4F55 A;  1DP7 P;  2DDA A;  4L5I A;  3ML6 A;  4YRV A;  2IRF G;  3IWF A;  3K10 A;  4BL0 B;  3HEF A;  1IRZ A;  2BEO A;  3I54 A;  5IOY A;  2DK8 A;  3HOT A;  3WTS C;  1Z7L A;  1D1B A;  4PK4 A;  4IQJ A;  2IT0 A;  2ELK A;  5HDK A;  3OV8 A;  3ZMD A;  1A5J A;  2R4G A;  2VJ5 A;  2ZME C;  5L3E A;  4CH7 A;  2OAZ A;  2V4J C;  5LGU A;  3IUO A;  3DEE A;  2M8G X;  3RPU A;  1B1B A;  4ETS A;  2DA1 A;  1IF1 A;  1TT0 A;  4O3M A;  1UEL B;  3BJ6 A;  2FA5 A;  3DFG A;  1FY7 A;  1G59 A;  1SAN A;  2EA2 A;  2XAG A;  3AL0 B;  4PDK A;  3F9K A;  2JPC A;  1HA8 A;  1RKT A;  1R71 A;  1D5V A;  5B5E C;  3ZXS A;  1T6S A;  3HOV J;  5F1J A;  3ABM H;  4PJN A;  1X1B A;  1LE8 B;  3VEP A;  4WCG A;  3OYL A;  4M3E A;  1Q1H A;  3KP2 A;  1MBF A;  2B9S A;  2PX9 A;  1VF9 A;  2MYS A;  5EZG A;  3KP3 A;  2BHZ A;  3RPQ A;  1R58 A;  3P7N A;  5FRN A;  1WJD A;  5D8L B;  3WG7 H;  5FLV A;  2Q1Z B;  3H9Q A;  1UHW A;  3JRF A;  4OMY A;  4FE4 A;  3EUK L;  2HQ5 A;  1QRY A;  2VQH A;  2NVU B;  5E3O A;  2QQB A;  2VUM J;  1U5T C;  3PQJ A;  2FOW A;  3I4P A;  2IA2 A;  2MW8 A;  5FLM J;  3KEY A;  2H6C A;  3PO3 J;  5ICF A;  4E7J A;  1XSD A;  1OMI A;  1BI0 A;  4DBR A;  1MBG A;  3HM5 A;  1FBU A;  3CCS I;  1LDK B;  1DQU A;  3UNG C;  1T95 A;  3IP4 B;  1SMY F;  1WH7 A;  1UG2 A;  3KZZ A;  2DPU A;  1PJR A;  5FRO A;  1QNT A;  1ETY A;  2BW3 B;  4PGH A;  1WPK A;  1KA8 A;  2ME6 A;  4CYC A;  5BPD A;  4A3L J;  2B7E A;  4G7O F;  3LL7 A;  2A5W A;  1D0Y A;  4LIV A;  3VSK A;  3LAP A;  2DFF A;  3BG6 A;  1U9N A;  3TW7 A;  1ZRE A;  4D5F A;  2DT5 A;  4MGR A;  1LDJ A;  3QYF A;  1OCR H;  1T56 A;  2CU7 A;  5E79 C;  3ZQH A;  5JLW A;  3MZH A;  4ZTJ A;  2P5V A;  3P5J A;  1ZQ3 P;  4RA2 A;  4KIB A;  1ERD A;  2KKO A;  2WV1 A;  2HVS A;  1T39 A;  4MQ9 F;  4B3X A;  1W7P A;  1BA5 A;  1RC9 A;  2XDV A;  4XNF A;  5L3G A;  2H6B A;  2Y0S A;  3IHU A;  3FIW A;  1DPU A;  3U1D A;  4JYK A;  2WAE A;  1FMW A;  4W1U A;  2XVC A;  3WHB A;  1O3T A;  3GTM J;  2KPM A;  1DU0 A;  1X3W B;  2VE9 A;  1IAW A;  2EIK H;  4F91 B;  4YEL A;  3NWS A;  1JT6 A;  4UVA A;  1KQ8 A;  5BQT A;  2Q8K A;  2E1O A;  4E7L A;  3QQA A;  3JRD A;  1AA7 A;  3HOX J;  2FX0 A;  1IN5 A;  4D5C A;  4I02 A;  3Q0V A;  2CQQ A;  4WWC A;  1VQN I;  2OZU A;  2M87 A;  2Z16 A;  4A3C J;  2LKX A;  2EIJ H;  4M72 A;  3VYR B;  5M5Y J;  4C2T A;  4R8H A;  1MNE A;  5K5R A;  4UV9 A;  5D6E A;  2ZME A;  3G1M A;  5D5V B;  3IV5 A;  3F22 A;  3RDI A;  1KU2 A;  2A6T A;  1P7J A;  3EUH A;  4CYD A;  2CV1 A;  2HTS A;  2XGX A;  2K9Q A;  1REP C;  3CLO A;  3LA2 A;  1FOX A;  2NYX A;  5IYC J;  1WWX A;  2DA5 A;  3JRA A;  2X0L A;  1LFU P;  3CCJ I;  3E97 A;  1MIJ A;  3MZ8 A;  5FO5 A;  2H8W A;  2EJR A;  1MMG A;  2EZK A;  1HST A;  2XHK A;  3H3Z A;  1K4T A;  3I53 A;  1XMA A;  4HZF A;  1GXQ A;  4I01 A;  2QF7 A;  1RR8 C;  3QPH A;  2MG4 A;  2VE8 A;  2MD0 A;  3J81 Z;  3L9F A;  1Z05 A;  2RN7 A;  2QCO A;  3ZMZ A;  4BQO A;  3JRB A;  3WTZ A;  4ZZD A;  4IZZ A;  2E1C A;  2VQG A;  5KHD A;  2JA6 J;  2DFE A;  3MKZ A;  3I58 A;  3CO7 C;  1PDN C;  2KIQ A;  2NVT J;  2M34 A;  1IO2 A;  2A3S A;  1U5T A;  2NNY A;  4A3M J;  5LHH A;  3KYD B;  4GDF A;  2VI6 A;  2RQP A;  2XB5 A;  1MMS A;  4RB0 A;  1N77 A;  3BG7 A;  4N0B A;  3TDU C;  3CP8 A;  4L9T A;  2NOJ B;  2W84 A;  1BW6 A;  3VYS B;  2GLO A;  1A04 A;  4RS8 A;  1YFH A;  4YFX F;  3KE2 A;  1W0U A;  1RR7 A;  2GXG A;  4BEH A;  2EIL H;  2RKH A;  3I64 A;  3B73 A;  4M3F A;  2QSF X;  2Y9Y A;  3CUQ B;  5L3B A;  3PIO F;  2XB0 X;  4KJZ A;  1YI2 I;  3CCQ I;  2EV6 A;  1LEA A;  1YJN I;  2HVR A;  3HHG A;  1BI2 A;  4BJ5 C;  4KFC A;  5J6X A;  1HBX G;  3HB9 A;  1TQP A;  2JK3 A;  3FZV A;  1Y8R B;  5GAE J;  4ESF A;  1Y8Q B;  3ZP5 A;  2NS0 A;  5ERI A;  3BCB A;  4OIO F;  2E1N A;  4DNC A;  1X1D A;  1Z9C A;  3GBG A;  2R7V A;  3PO2 J;  4HLX A;  3QP5 A;  2NNN A;  1ACI A;  1FX7 A;  1SFK A;  2QQ8 A;  3HKZ A;  1WKM A;  2PG4 A;  1B4A A;  3E6M A;  1HDD C;  4XQF A;  4F7Z A;  2ZXW H;  5FKO A;  1TP4 A;  4KIT B;  3VPR A;  2LR8 A;  2GA1 A;  1ZK8 A;  4BKX A;  3OYF A;  4C30 A;  5CJ9 A;  4N9I A;  2CUZ A;  2L5Q A;  1IV8 A;  2E60 A;  3NWT A;  4B48 A;  1BR2 A;  2R7Z J;  4BEH B;  1ZRD A;  5CQG A;  3JRE A;  3PFY A;  2HWV A;  1HF0 A;  3AFH A;  4C2U A;  5M5W J;  5HVQ C;  2DA4 A;  4HSR A;  3BZC A;  3WHC A;  2HYF A;  4KIG A;  4JK1 X;  3CC4 I;  3L2W A;  3CJQ B;  2K4J A;  4IHS A;  1XD7 A;  4K2E A;  2R5Y A;  4BXU A;  3A0B C;  2AXL A;  4QPO A;  2A69 F;  2FMY A;  3A1Y A;  1FYL A;  3G4S I;  2QBY A;  4ZYG A;  1YX5 A;  4HF2 A;  2Y75 A;  2V1N A;  4RB2 C;  1MND A;  2LMD A;  2BOL A;  2MAB A;  3HRT A;  4N4O B;  2L9R A;  2RQQ A;  4XLH A;  5LRS A;  1TBX A;  2D1H A;  2X48 A;  2AQF A;  4S05 A;  2HOT A;  3REO A;  5JVG F;  2QEX I;  4DYR A;  1ENH A;  2ZXJ A;  4A3G J;  1ZGW A;  1R36 A;  4V2F A;  2ZXI A;  1WJA A;  3QRF F;  1EH6 A;  2TCT A;  1A6Q A;  2KDZ A;  4XLC A;  3R6S A;  1YE9 A;  3JCU C;  3L2R A;  1J7K A;  1VQ6 I;  2EIN H;  2VOP A;  3FXR A;  2CW8 A;  2H27 A;  3LSK A;  3KP7 A;  2XIG A;  3C2G A;  1BOB A;  3H5A A;  2IPQ X;  1ODD A;  3J7A O;  5F0F A;  5IT9 K;  2K9N A;  5JHU A;  5E8G A;  3SEQ A;  4IEJ A;  2G7H A;  2KLO A;  4G6D A;  5CVV A;  4M74 A;  1DGW Y;  2V1D A;  3MKW B;  2P5L C;  1IDZ A;  2F4O B;  4PJM A;  1VQ8 I;  3OS1 A;  3MVP A;  4J19 A;  1MDM B;  3HL2 A;  1F5T A;  2VKE A;  2VAS A;  4UV8 A;  5HDG A;  2BY2 A;  2HQN A;  2M2E A;  1S9H A;  5E3N A;  1FNN A;  2DDB A;  2W4S A;  2R5Y B;  2HDW A;  1JTX A;  3MFK A;  5FKL A;  3R60 A;  4HPQ A;  4DQ2 A;  3OYM A;  4LK1 F;  3BLY A;  2FNA A;  4OAZ A;  4II2 A;  1VQL I;  3V42 A;  3JTG A;  3SZT A;  5E18 F;  5CYV A;  5DYM A;  3ZQQ A;  2HZT A;  5DCM A;  3FKI J;  1UCR A;  2M0M A;  3ROU A;  1FTT A;  2FRH A;  3UKG A;  2LKP A;  1K6Y A;  5D5U B;  2XAQ A;  4EJW A;  2R7U A;  4XID A;  1C0W A;  2X6W A;  1GLN A;  4A93 J;  2UUZ A;  3BQY A;  3FMQ A;  3VWB A;  2VC1 A;  2Z33 A;  5TRD A;  4P5O A;  4A0X A;  2W7N A;  3GEZ A;  2IS1 A;  3ASO H;  4YG2 F;  3E5U A;  2ELH A;  4BQA A;  1QVU A;  2OJE D;  1IN4 A;  4ZYA A;  5K7Z A;  3COA C;  2EK5 A;  2V7F A;  1K78 A;  4XIC A;  2P6S A;  2AHQ A;  4CIC A;  3OR1 C;  3EDP A;  1VQM I;  4U0W A;  1YOV B;  4OIP F;  4BQN A;  3BDD A;  3GFL A;  1O4X A;  2JA7 J;  4OU0 A;  2ECB A;  2NS7 A;  2XRO A;  3OIP A;  2W48 A;  1BOA A;  1XN7 A;  1YQA A;  1UFM A;  2VXZ A;  2WY7 Q;  3WGG A;  4AM3 A;  2RC4 A;  4QLC U;  1S6L A;  3HPH A;  5D6F A;  4I0B A;  3B02 A;  4EGZ A;  3SYT A;  1YTY A;  4I6Z A;  2A6H F;  4N4N B;  2WY8 Q;  5CVU A;  2FNP A;  3AKZ A;  4LLG F;  3H5N A;  3HSR A;  4XK4 A;  3SFZ A;  3OS2 A;  4LB6 B;  3LOC A;  1RPW A;  3L00 A;  2AQE A;  1Z6R A;  2VB6 A;  4HBL A;  1OCT C;  3ASN H;  3BR6 A;  3HPG A;  4LIT A;  4RBO A;  3LSP A;  3GVA A;  5C3E J;  2X1D A;  1GXP A;  1ETO A;  4XN0 A;  2E2I J;  3HC7 A;  4WF2 A;  3KP5 A;  2EPF A;  5DCM B;  4OAY A;  1JHH A;  4B09 A;  3RI4 A;  2GOX B;  4EJT A;  1MSF C;  5E17 F;  3F0C A;  2HOS A;  2HKX A;  3M7G A;  4ASN A;  2X1E A;  2DXI A;  5ILU A;  1X58 A;  2LBF A;  1UHS A;  2XUB A;  2OPT A;  3RYP A;  5GAD J;  5HOO A;  3CCL I;  1J75 A;  3TBI A;  5LRR A;  4GYG A;  1XMX A;  1JGS A;  1K78 B;  2BHY A;  5KVR A;  3SZP A;  1Z3Y A;  1VTN C;  3AL0 C;  2FSW A;  2PMZ N;  2PMU A;  5CVJ A;  2KZV A;  1YRN A;  2WA0 A;  3IRQ A;  2A61 A;  2O0Y A;  3S2W A;  3CUO A;  3W3C A;  4ZTF A;  2DYS H;  2L7Z A;  4E7Z A;  3T0Y A;  1WZ2 A;  1UST A;  4FAS D;  2L01 A;  2PMH A;  2OF7 A;  3VOD A;  4Y52 J;  5FLX K;  2CFX A;  1Y6I A;  3FM3 A;  1O7F A;  3A03 A;  4XLE A;  2KZG A;  1D8K A;  4IHT A;  4MTD A;  2W85 A;  4I76 A;  1E3O C;  4HYE A;  1TC3 C;  4I2O A;  3ZQ7 A;  1A36 A;  3QPS A;  3FMR A;  3L2U A;  5FGM A;  5B1B H;  4E7K A;  4RM2 A;  1IRG A;  4JQF A;  4XLA A;  5DEQ A;  3RZO J;  3BR1 A;  3FBI B;  2HGC A;  2VPR A;  4RGX A;  3F72 A;  5H2F C;  2OQR A;  1PUF A;  1LVA A;  2XAF A;  3QYE A;  1HKT A;  4H0E A;  3H3V K;  4FE7 A;  5ILV A;  2XAU A;  2CUE A;  3TDZ C;  4PJJ A;  4GFB A;  2X51 A;  1T08 B;  5HNH A;  2EFO A;  4LD5 A;  1S7A A;  2HOA A;  1L0O C;  2B0L A;  4BHP A;  1WJB A;  4IHX A;  2ZJ2 A;  3CJN A;  3ONQ A;  4P9U A;  1N25 A;  1RZ4 A;  3RQI A;  2WB1 A;  3IL2 A;  3CME I;  2OU2 A;  1U3E M;  1YRN B;  4PGG A;  4B44 A;  3QWL A;  2FML A;  3C3W A;  2CW7 A;  5AIQ A;  1W5T A;  3PSI A;  3IC7 A;  1B72 A;  1YX3 A;  2PQ8 A;  2KDO A;  5D5X B;  1W36 D;  5IP9 J;  2RRE A;  3FXU A;  3ZN1 A;  4XLP F;  4IRG A;  4IKF A;  2KP6 A;  4XKC A;  4LG0 B;  4YEJ A;  3ZQC A;  1R9T J;  2HEO A;  1OR7 A;  2COB A;  2Y0S N;  4G7H F;  3J80 K;  3N97 A;  5GAH J;  3I71 A;  3FDY A;  1MMA A;  5DUI A;  4HDV A;  5GP9 A;  3K70 D;  4E7I A;  5ICE A;  1SFE A;  2XSJ C;  1I50 J;  5HLH A;  2JWT A;  2B63 J;  4A0Z A;  2IGK A;  1F4K A;  2RNG A;  4GGG A;  4E7S A;  2TRT A;  1OKR A;  4ZZL A;  4GXO A;  1D5Y A;  1MBK A;  3DBR B;  2JT1 A;  1APL C;  2CQX A;  2NXN B;  2R5Z B;  4DZP A;  1JJ6 C;  2F5D A;  3LSG A;  2FJ1 A;  4IX7 A;  5E1W A;  2P7V B;  1X4P A;  3CP2 A;  1T0F A;  3DF8 A;  5J8C A;  1WJC A;  1MZB A;  3BQZ A;  4IOC F;  2BY1 A;  4UVB A;  2EH3 A;  2KJB A;  2XPW A;  2P6T A;  3PM1 A;  1QHG A;  2P8T A;  3QAH A;  2I8D A;  2HU9 A;  1D1A A;  1HW5 A;  3B6A A;  1O7L A;  3BP8 A;  3VDX A;  4EQQ A;  5IP7 J;  1J9I A;  2Y30 A;  2F5E A;  3F6V A;  4GO1 A;  1TLH B;  3RKW A;  1B72 B;  1D1C A;  3K4K A;  4A2U A;  2L7F P;  4XKW A;  1YO5 C;  3F3X A;  4J00 A;  2P0W A;  4N9H A;  3S93 A;  2DT6 A;  1PVE A;  3EQL F;  3KX2 A;  4U0V A;  3N05 A;  3R0A A;  1E2X A;  5L3C A;  1V4R A;  3WE3 A;  4I09 A;  2VT2 A;  3ZN0 A;  4A6E A;  1VQ4 I;  3C2B A;  3K9T A;  1ZRC A;  4A3F J;  4HNT A;  2DMT A;  2CRG A;  4A69 C;  1Z3X A;  3CCY A;  5LBQ A;  2XC7 A;  1JUM A;  2DPD A;  4XRM A;  5HS9 A;  2HR3 A;  2M30 A;  2JUG A;  2CUJ A;  3EPZ A;  5J47 A;  1WGX A;  3BR2 A;  1LPQ A;  3PNT A;  4DYQ A;  2EFQ A;  2F5F A;  1FBQ A;  4OIR F;  1ZHF A;  1S29 A;  1X1C A;  4IVN A;  1Z21 A;  5FKM A;  1R23 A;  2LNB A;  3HOU J;  3ZMV A;  2FF4 A;  1KU9 A;  4AU7 A;  4D9J A;  5F0C A;  4RDU A;  2GBY A;  3RJP A;  3RSN A;  2JRM A;  3EUH C;  4RGS A;  3K0L A;  2IJL A;  4Q4Z F;  2BW3 A;  4B8X A;  1TNS A;  2DA3 A;  3CUQ C;  3JAM K;  2M4G A;  1MJB A;  2LY9 A;  3JRG A;  1NK2 P;  1VFC A;  1YS6 A;  2KRH A;  4X1E A;  2I10 A;  2LRD A;  1JKQ C;  2MLK A;  2RAE A;  4ZYE A;  2BY3 A;  2PBI A;  3DLA A;  2VOD A;  2DQR A;  3JR9 A;  2X6Y A;  4P55 A;  2QM3 A;  4HRI A;  1K4S A;  1WHU A;  3H1C A;  3OY9 A;  3KLN A;  1AHD P;  1NH3 A;  4A3D J;  1FC3 A;  1FT9 A;  2YSR A;  2HZD A;  3TP3 A;  3BY6 A;  2XGD A;  2V79 A;  2M7A A;  4AVZ A;  5IY5 H;  3CCV I;  3H35 A;  2ZB9 A;  3G3Z A;  3HKZ N;  3SJM A;  1IC8 A;  1XCV A;  2MGQ A;  4UXN A;  1BJZ A;  2ESN A;  1YJ9 I;  4AC0 A;  3GXO A;  4XLN F;  1ZAR A;  1POG A;  1JGG A;  4L5J A;  2FQ4 A;  5IP6 A;  1R1U A;  2W57 A;  2G7U A;  4XBF A;  5IYD J;  3BTC A;  3FWE A;  1K79 A;  3BR3 A;  4JOM A;  5JI6 A;  5GTI C;  2UXN A;  2JMW A;  1R22 A;  1WJF A;  4PJ0 C;  1LQ1 A;  2J5O A;  2YX7 A;  4XKV A;  3EYY A;  5ICG A;  1LEB A;  1SD4 A;  4G94 A;  4II3 A;  4FHT A;  2VKV A;  1K7A A;  2K5C A;  4YII A;  1TT5 B;  3CZ6 A;  3GLL A;  3R0J A;  1Y56 A;  3R61 A;  4UUT A;  2XRN A;  1H88 C;  2EB7 A;  4BNC A;  3O6B B;  2IA0 A;  1HDP A;  3GFI A;  3ISP A;  1S72 I;  4MTE A;  1RKW A;  2QZ8 A;  2ISZ A;  4CCM A;  1B9M A;  3WTX C;  4BE0 A;  1TQM A;  1JI8 A;  4M3D A;  1NHA A;  3CC2 I;  3FXM A;  1U8R A;  3FK7 A;  1FWZ A;  3DU6 A;  1U8B A;  3GTQ J;  2GXA A;  5JHF A;  2VLA A;  5IT9 Z;  4P96 A;  3KEQ A;  1B59 A;  4EJV A;  5IOZ A;  1P6R A;  1U2W A;  2DMN A;  2QLZ A;  3HOS A;  1XTA A;  3M8E A;  3CCM I;  5E1Z B;  4CUG A;  2Z9O A;  4NC6 A;  1QZE A;  5BS6 A;  3G73 A;  3G71 I;  4J01 A;  2W82 A;  2HPI A;  4U7B A;  5C4J J;  2H1K A;  4PSW A;  3DPL C;  4CCL A;  5HS8 A;  2OCE A;  1TWF J;  2M8E A;  3DV8 A;  1XMK A;  4CCJ A;  3G1O A;  3E6D A;  3I55 I;  3AG4 H;  4C3J J;  3GFJ A;  2RDP A;  4Y3O A;  3SEZ A;  4KA4 A;  2ACJ A;  4XN3 A;  4DGW B;  1I1G A;  3BT9 A;  3CUQ A;  2V9K A;  3K4L A;  4ZYD A;  1BIB A;  5JLX A;  3U21 A;  4HNU A;  3L09 A;  3K4B A;  4LLN A;  4G9Y A;  3M07 A;  1CGP A;  2YUS A;  3D0S A;  1EH8 A;  1GHC A;  1X2M A;  1ZAO A;  2KJC A;  1WJE A;  5K5O A;  4NHJ A;  3S1N J;  1WFX A;  5AON A;  4HST A;  4BE2 A;  3OL3 A;  3E7L A;  3K1N A;  4BE1 A;  4RGU A;  2KQR A;  4F3Q A;  1VQ5 I;  1V5F A;  2W24 A;  2E36 A;  4HOB A;  2A6E F;  4BUP A;  2UWM A;  3QPT A;  4M6V A;  3PFI A;  3E5Q A;  2CV2 A;  2KRF A;  5C4X J;  1TW2 A;  3G1L A;  3GF2 A;  4AIH A;  1VQ9 I;  4UUS B;  4XMY A;  4FCY A;  1OPC A;  1ETV A;  3ZGK A;  3BG9 A;  2Z1D A;  3SQN A;  5FKK A;  5CVR A;  1R5G A;  3ZQG A;  3CMY A;  2DMU A;  3IH4 A;  1OIS A;  4EMS A;  2CG4 A;  3F8F A;  3E5X A;  2JSP A;  1TNT A;  2CMP A;  1K61 A;  2HYJ A;  4KIC A;  5DD8 A;  3P9C A;  1T38 A;  1LB2 A;  1TTY A;  3FXO A;  2LG4 A;  2HYG D;  2IS4 A;  3K4C A;  2MH2 A;  3CTA A;  4AIJ A;  2LOO A;  2K02 A;  3NQO A;  4KT5 C;  3S15 J;  1V5E A;  3KCC A;  3H9G A;  1P4W A;  4RM3 A;  3QOP A;  4CDG A;  1X1P A;  2COM A;  4E6K G;  2PJR B;  1DP3 A;  2YS9 A;  3DP7 A;  1ULY A;  1YIO A;  2V9V A;  3LWF A;  1XGN A;  3ZR8 X;  3K6G A;  3TED A;  2IGN A;  5EZH A;  1UG0 A;  5HDN A;  2XF6 A;  3TOA A;  2KHM A;  4FX0 A;  5KCM A;  4BAY A;  1LUJ B;  1R5I D;  2XF5 A;  1J0R A;  5LGT A;  3M1E A;  2BBY A;  3BPX A;  1ZG1 A;  4LLL A;  2QKL B;  1R00 A;  3OSF A;  3CF2 A;  4BU2 A;  4D7M A;  3MCZ A;  1J5Y A;  3ESW B;  1AKH B;  4HG2 A;  3KZI C;  3ELK A;  4OIN F;  3OWT A;  2Z3Y A;  1B8I B;  4U7D A;  2L02 A;  5CQE A;  5TGT A;  1WRJ A;  3LMM A;  3S1Q J;  5F04 A;  4RAY A;  4CZC A;  1MBE A;  1OYY A;  4MQV A;  6PAX A;  2OD5 A;  5TIS C;  1JT0 A;  2LTP A;  4A5N A;  1N75 A;  4F92 B;  4IXA A;  1Q1V A;  2LH9 A;  2BGC A;  3RIR A;  3QU3 A;  2EIM H;  2QA4 I;  5LGN A;  1MDM A;  2ICW G;  1XGM A;  3UR3 C;  5FLX Z;  5LLQ A;  1YIT I;  1YW9 A;  1ZYR F;  2E19 A;  3K4N A;  2DFI A;  3VSL A;  1AOY A;  2LSO A;  1I3A A;  2KL4 A;  4W97 A;  5EJC A;  3VYT B;  2OQG A;  4PCQ A;  4HQM A;  4XR6 A;  1USS A;  2LY2 A;  5C44 J;  3A02 A;  2JPB A;  3EUA A;  4M73 A;  3K2Z A;  3V8J A;  1P9Q C;  1JHF A;  4A12 A;  4KYW A;  2XRL A;  3ECH A;  5E1X A;  5CVI A;  1R49 A;  2F5C A;  4A3J J;  3WTW C;  3AAF A;  4L0Y B;  1D0X A;  3M8F A;  3MN2 A;  1O57 A;  3WE2 A;  2K40 A;  2P5K A;  1E3H A;  2OZ6 A;  1ZGJ A;  2R7O A;  1E3P A;  2K9L A;  1OCO H;  1QZZ A;  3F8M A;  4A5M A;  4UUV A;  4B1R A;  2A05 A;  1H8A C;  2VPL A;  1BW5 A;  3O3K A;  2X4H A;  3K4J A;  4XRF A;  4EV0 A;  4QTR A;  4L9V A;  2CW0 F;  2F2E A;  5J1Y A;  2L9N A;  2GZW A;  2BV6 A;  4L9N A;  1WCM J;  1RNL A;  3H92 A;  4BHC A;  3QYB A;  4ENM A;  4KDP A;  1RRJ A;  1VI0 A;  3DU5 A;  2DMP A;  2GXB A;  3QP6 A;  4RGR A;  2VL8 A;  2JJ7 A;  2A68 F;  1ETW A;  3KZY A;  3FKJ A;  3KYC B;  2E7W A;  4KIS A;  3PIP F;  1ITY A;  3K69 A;  4IQ4 A;  2IS6 A;  3NAR A;  5D5W B;  3IRR A;  2OC6 A;  4OOI A;  2JQ7 A;  3J7Z I;  2CQN A;  3KLO A;  3HSF A;  3J80 Z;  3GTG J;  4ZH4 F;  4JX4 A;  3C1D A;  3LAJ A;  3S3N A;  2O6G E;  5D4R A;  1MH3 A;  2FBK A;  4BY1 J;  3S16 J;  4AID A;  3HYI A;  3PL8 A;  1MKM A;  4L5E A;  4B3A A;  3BWG A;  3Q9S A;  3OYC A;  3RCO A;  5M5X J;  1IV6 A;  3R4K A;  4A6D A;  1ON2 A;  3BZ6 A;  2DFH A;  5B1A H;  2R7F A;  1W5C C;  2P7C B;  1KGS A;  3FBN B;  3A4C A;  5DS9 A;  2HFH A;  2P81 A;  2E5N A;  4IPA A;  2LFB A;  3T8R A;  3O8H A;  2ELJ A;  4Y33 A;  4X0G A;  4KN4 X;  3WU0 A;  3S2D J;  1V55 H;  1OFC X;  1Y1V J;  3IKT A;  1X1A A;  1OJL A;  1MD0 A;  2VC0 A;  3ABU A;  3RKY A;  1MJ9 A;  2QVO A;  3RYR A;  3TKY A;  3F8N A;  1OQY A;  1A31 A;  2VKD A;  1LJ9 A;  1FLI A;  2O3F A;  3LNQ A;  1QBJ A;  3ZRG A;  2W00 A;  3BZK A;  1OR7 C;  4RB1 A;  2DOA A;  4G8X A;  2JA5 J;  2PEX A;  2VN2 A;  1P4X A;  3OYG A;  4F93 B;  5F6F A;  4IHY A;  2V6C A;  5K7F A;  3CD6 I;  3LA7 A;  1HLV A;  2XKP A;  1MW7 A;  3QOE A;  4NBQ A;  3HUG A;  2RV8 A;  1I6H J;  2RGV A;  2CS3 A;  3HBL A;  2D45 A;  1Z7U A;  4A0Y A;  1HQC A;  3OIQ A;  1VQO I;  4L18 B;  3MZY A;  2VQC A;  2DYR H;  2MSY A;  1XPX A;  4IRI A;  4XOT A;  4Y17 A;  4KUM A;  1T0F C;  3HTS B;  2X1C A;  3SDG A;  4R1H A;  2CFO A;  1ZR4 A;  4PZJ A;  1GUU A;  4M6X A;  3JAM Z;  1J59 A;  2EZL A;  4IHW A;  2WAF A;  1MBJ A;  1UB9 A;  3WG9 A;  3OL4 A;  5J8F A;  2W25 A;  4HX4 A;  4AD9 A;  3FHZ A;  5CKT A;  2OA4 A;  1FTZ A;  2FD5 A;  3RPU D;  2DI3 A;  1U6G A;  2LVS A;  4PUS A;  3V7C A;  4U0Y A;  2HTJ A;  3CQZ J;  2YU3 A;  4KT6 A;  5DV5 A;  2LP0 A;  1CF7 A;  2ZSH B;  3WGI A;  4AWX B;  4NDL A;  1FBS A;  3F21 A;  4D1Q A;  1IZ1 A;  3ZOB A;  1P4A A;  2F5V A;  1HKQ A;  2K3F A;  2VQL A;  5F27 A;  1SFX A;  4BQQ A;  2LC2 A;  3D5L A;  5J4V A;  4XOP A;  2DO7 A;  4LG3 A;  4LG0 A;  1XS9 A;  3DKX A;  1YLF A;  2RVC A;  2R93 J;  3SZG A;  2G0E A;  3X2Q H;  4S0H B;  4UY8 I;  3CJT B;  3TOB A;  1ZRF A;  3HUG B;  2WTE A;  1XG1 A;  3AG2 H;  2JVH A;  1X3Z B;  3RKQ A;  4JX6 A;  2E2H J;  2MH9 A;  1I3Q J;  5E3L A;  2L7K A;  5FKN A;  3CDH A;  4WXC A;  2X85 A;  2NVQ J;  1X4O A;  2ZJR F;  1DDN A;  4XKB A;  4FIS A;  1ZG3 A;  3NRV A;  1KZH A;  1KQ0 A;  3LSJ A;  1YG2 A;  2RNJ A;  4RB3 C;  4FX4 A;  2R5Z A;  3BTI A;  4G12 A;  2ZC2 A;  1Z6T A;  4WXD A;  5BNG A;  2LK2 A;  3EET A;  3OOU A;  4M3B A;  1T98 A;  5J1U A;  3ABT A;  2Q2E A;  4AYB A;  1VQ7 I;  1MMN A;  4Y15 A;  3OOP A;  1TQI A;  1G3W A;  2Y48 A;  2E1M B;  3BJA A;  3DQV C;  3AG3 H;  3HXL A;  3WGH A;  2EA4 A;  3S2H J;  4PFP A;  3GFM A;  3D5R C;  5J4Y A;  4WX9 A;  1JJ8 C;  1XC5 A;  4Q48 A;  5E3M A;  1CF7 B;  2MD5 A;  3AG1 H;  4I7H A;  2EWN A;  2OUM A;  3LST A;  2F4I A;  3H5R A;  2I5U A;  3VOE A;  5E8I A;  4Y7N J;  1IXS B;  1KQ9 A;  3GX4 X;  5FB2 A;  4BH9 A;  5K1Y A;  3ERE D;  3JSP A;  2V1U A;  3RZD J;  1NK3 P;  2ECC A;  2EZI A;  1G6N A;  3DPU A;  2AS5 F;  3E6C C;  1IN7 A;  1ON1 A;  3M9A A;  1W7P D;  2XAS A;  2VBY A;  3C18 A;  4QPQ A;  3TGN A;  1PP7 U;  3IH3 A;  4E70 A;  4FT8 A;  4ABZ A;  3CMM A;  2WAD A;  2FU4 A;  2X6O A;  1MJA A;  3HRS A;  3OIO A;  3TL4 X;  3PSF A;  3VFZ A;  1FP2 A;  3Q9V A;  1E0E A;  4FET A;  4NQW A;  1V54 H;  3CCR I;  1BI3 A;  2Q0O A;  3I9V 2;  1ETK A;  2ADU A;  3U2R A;  4UVC A;  2XAJ A;  1MNM C;  2R7X A;  2VJ4 A;  3CDL A;  5EDN A;  1FIA A;  1DUX C;  5A2Q K;  2DQL A;  3W2W A;  1FYK A;  4HF1 A;  1IUF A;  2XGE A;  2EV0 A;  1ZLJ A;  2Q2E B;  2FOK A;  2X9D A;  5J40 A;  3E1S A;  1XCB A;  2VXD A;  4P1W A;  2CO5 A;  2CWE A;  2ESH A;  2DOE A;  3DEU A;  1XX5 A;  4WK8 F;  1ETX A;  2EZH A;  4PSX A;  2HPM A;  3CC7 I;  4BYY A;  2NS8 A;  2PN6 A;  4CHU A;  1FSH A;  5E20 A;  5HNF A;  1AU7 A;  2Z2S B;  5TJJ A;  5H6Q A;  1QQI A;  1FOY A;  5JR3 A;  2EFP A;  3I56 I;  4IO9 F;  1BN5 A;  3GTJ J;  1I39 A;  2CQK A;  2GA2 A;  1VQK I;  2HI3 A;  3IAS 2;  3BR5 A;  2VON A;  5H6R A;  4CO8 A;  4UHT A;  4F52 A;  2DA6 A;  2LF7 A;  2A5Y B;  2O7O A;  2XAH A;  1JE8 A;  5KAF C;  1S7E A;  3E6B A;  2L4M A;  4P9F A;  1UAA A;  3ZPL A;  1RIO H;  4KNY A;  1IJW C;  5F08 A;  3HOY J;  1ORK A;  2QQA A;  4IHV A;  1V5G A;  4HLY A;  1H9G A;  5BPI A;  3LFU A;  2K4B A;  3CES A;  3DPT A;  4HX8 A;  4QWQ A;  2A07 F;  3G2B A;  5ED4 A;  4Y4R A;  3K70 C;  4NQW B;  4FTH A;  3DTK A;  2MA3 A;  2Z5U A;  3KEO A;  1TWC J;  2WAQ A;  1FP1 D;  5L3D A;  3U1K A;  4EJU A;  4ZJZ A;  3H0G J;  2IAI A;  3BJO A;  4LMY A;  1FYM A;  4MNU A;  1WI3 A;  1DPR A;  1TZL A;  1J09 A;  4WXH A;  1QHH D;  4DZJ A;  2CV0 A;  1BIA A;  5HLG A;  3HOZ J;  4DYC A;  5K5Q A;  1OCC H;  1UJ8 A;  3DXJ F;  3LSM A;  1SVO A;  1NTC A;  1JTY A;  2F48 A;  5BMZ A;  2VIX A;  3W2A A;  2PI0 A;  2HQA A;  3GUD A;  3L1P A;  1KU7 A;  2BVL A;  4CCO A;  2FBI A;  4CCK A;  3NEU A;  5CPR B;  3Q3S A;  1Z91 A;  2EFW A;  3MD2 A;  2IGO A;  3GCM A;  2STT A;  3BOQ A;  1Z77 A;  2V6E A;  1EJ9 A;  3KP6 A;  1QO0 D;  4ENN A;  3HRM A;  3DTI A;  1GVD A;  3Q0W A;  3PNV A;  4YIF A;  1Y0U A;  2PMZ A;  2QYO A;  2DTR A;  3DTE A;  3JRH A;  2YR2 A;  4ZC3 A;  1JXS A;  2M9H A;  2XF7 A;  3F23 A;  1H0M A;  2HVQ A;  4BXF A;  3GZ6 A;  1MMD A;  1Y1W J;  3OMY A;  3GWZ A;  2CH0 A;  2FBH A;  3P9I A;  4IF4 A;  4HNV A;  2EFN A;  5AIP A;  3CCE I;  3S3O A;  1SMT A;  4UNO A;  3H0D A;  4EM0 B;  3OYA A;  1EF4 A;  2CYY A;  2PFB A;  1U78 A;  3FF5 A;  2DN0 A;  3O2P E;  3TO7 A;  3ABK H;  4HV6 A;  1XGO A;  4PJL A;  3QOD A;  3BC8 A;  1L3L A;  3V4G A;  4V2G A;  4D7N A;  1XB4 A;  3SDB A;  3GLX A;  3T1B A;  5LHI A;  3A01 A;  1FOW A;  3J7Y J;  3OYJ A;  1SAX A;  2LD5 A;  2DBB A;  4ZDL A;  3ZCO A;  4CZZ A;  3M3Y J;  4IOA F;  3I4N J;  2DMQ A;  4JP0 A;  1IN8 A;  2K9M A;  2ZBK A;  3CF5 F;  4HX7 A;  3VB2 A;  4G7Z F;  2HOE A;  3HRU A;  4BBS J;  2ZKZ A;  1BI1 A;  1PP8 F;  2F4M B;  2HQR A;  3BPV A;  2Z99 A;  1R7J A;  2QUF A;  3HSE A;  3W2V A;  1BC8 C;  4YIR X;  4I98 B;  3FMS A;  3IWZ A;  1Z0X A;  4UB8 C;  1ZGA A;  1IRX A;  4XSX F;  3HG9 A;  1EV7 A;  2DCE A;  2O8X A;  3H3U A;  2H09 A;  2L4A A;  3D5S C;  3WOD F;  2DOD A;  4UUS A;  1SFU A;  4O6J A;  2EQR A;  3E0J B;  4Y13 A;  4A3B J;  5EF6 A;  2ETH A;  2O03 A;  3Q5F A;  4MFD A;  4CXF A;  3PUF A;  1GV5 A;  1R5H A;  1F1Z A;  1SC7 A;  2NVY J;  4HF0 A;  3G6E I;  1S5L C;  3M4O J;  4NNJ A; 
#chains in the Genus database with same CATH homology
 2UZK A;  2H94 A;  1G4D A;  2ZCW A;  2WV0 A;  1WQ2 A;  3FM5 A;  2O61 A;  4L9J A;  1ZN2 A;  1XDS A;  2WWY A;  1XSV A;  2VT3 A;  3TO6 A;  2EV5 A;  2GQQ A;  3RKX A;  1ZLK A;  1FOK A;  3V7R A;  2WC2 A;  3LA3 A;  4EJO A;  2JZY A;  4HV5 A;  1ONV A;  1G3S A;  2ZO4 A;  1KYW A;  3HIF A;  3I0T A;  2IA1 A;  1H9T A;  3ZMS A;  1YW7 A;  5EEH A;  3KFW X;  2PLY A;  4LK0 F;  1W7P B;  4MEY F;  1WSU A;  2HKO A;  4EM2 A;  3JW4 A;  1QZY A;  2K27 A;  4I0A A;  4U88 A;  1YYV A;  4M9Z A;  1RUO A;  3RTR A;  1YS7 A;  4D0P A;  4LGW A;  3BRO A;  4EGY A;  3MAJ A;  3W6K B;  3GO5 A;  2ZME B;  5DD4 A;  4ESB A;  2JRT A;  1HKS A;  2K7L A;  1I1S A;  4JBA A;  1IRF A;  3WTU C;  1HW2 A;  5JVT A;  2M45 A;  1XSX A;  1W4M A;  1X3U A;  1STZ A;  5HS7 A;  5BOX A;  3P9K A;  4Q5S F;  2ZFW A;  4MEX F;  5DCF A;  1S3J A;  5F1R A;  3I59 A;  5DUK A;  2XV4 S;  4EM1 A;  3I5U A;  4YFN F;  3T8T A;  1FPQ A;  2BYV E;  1OYI A;  5LHG A;  2ISY A;  1J2X A;  5F64 A;  1U5T B;  2GWR A;  5ICC A;  1I6X A;  3JTH A;  1ZH5 A;  4EVI A;  2VBZ A;  2QWW A;  3WTY C;  2IVM A;  1B9N A;  4HA8 A;  1UHM A;  3IKV A;  2CSO A;  2STW A;  2IP2 A;  2QEN A;  1IXR C;  4YFK F;  2LF8 A;  1K6O A;  4KN7 X;  5LEK A;  1O3S A;  5JFR A;  3I59 B;  1B6A A;  2R7D A;  4HDU A;  4LJZ F;  4AVP A;  1D8J A;  4KMU X;  4MHG A;  1LDD A;  2ZNY A;  1W5S A;  2K86 A;  4KMF A;  1P2F A;  1R1T A;  1RUN A;  3N4M A;  1I27 A;  2P4W A;  1IUY A;  4HAM A;  3MQ0 A;  1E17 A;  4ZYH A;  2NRA C;  1T2K A;  2D1V A;  3C7J A;  5EEG A;  5FFZ A;  3T5X A;  5L3F A;  1BJA A;  4TV7 A;  1RI7 A;  2DW4 A;  2QBY B;  5A2Q Z;  2J5P A;  4XSZ F;  1S7O A;  3LQR A;  3TQN A;  3U9G A;  3GZ5 A;  1QPM A;  3ULQ B;  4HW0 A;  1AWC A;  3J81 K;  2QQ9 A;  2DAO A;  2ZNZ A;  3EYI A;  2JSC A;  2L54 A;  2UXX A;  3ECO A;  4M9X A;  1OYW A;  3ZMU A;  2G9W A;  5FD6 A;  3KET A;  3V7S A;  1G3Y A;  2GIV A;  2VBX A;  1I5Z A;  2PJP A;  3K1M A;  1LNW A;  1IXC A;  2R3S A;  1EH7 A;  4G6Q A;  2VOO A;  2YX4 A;  4HQE A;  3ZMT A;  5IT3 A;  5LEJ A;  2GAU A;  3GW2 A;  5D8K B;  3JSO A;  4GCV A;  1FZP B;  5ILS A;  1SD7 A;  2C6Y A;  5FFX A;  4Q47 A;  1BM9 A;  2VBW A;  1HW1 A;  2DK5 A;  4M9S A;  2OBP A;  2IW5 A;  4OIQ F;  2D2W A;  2MBF A;  1SD5 A;  3KP4 A;  1KU3 A;  4L0Z B;  1XGS A;  1QGP A;  4R79 A;  2YPR A;  1IW7 F;  4CGZ A;  3E3V A;  1O3R A;  5FD5 A;  3V8K A;  1BC7 C;  1WI9 A;  2DLL A;  3SHF A;  2CGP A;  3MWM A;  4O5V A;  1GVJ A;  2HS5 A;  4GYI A;  4ESJ A;  1SD6 A;  4S04 A;  1O3Q A;  2BE5 F;  4OMZ A;  3F8C A;  3WU1 B;  1KYZ A;  4M6Y A;  1MGT A;  2XKO A;  3L7W A;  1R1V A;  1D3Y A;  5HLI A;  4IJA A;  2M1B A;  2V1X A;  2FXA A;  3MEX A;  3GYH X;  3F6O A;  2TDX A;  2L3D A;  4KIF A;  1FSE A;  3CO6 C;  3W6J B;  2E7X A;  1Z1D A;  3DKW A;  5D4S A;  2FE3 A;  4LFU A;  3LQQ A;  2DU9 A;  2KIM A;  2FQ3 A;  3WTV C;  1IN6 A;  4LB5 A;  3SXY A;  3HHH A;  4AIK A;  1PUE E;  4RAZ A;  1BBY A;  1P92 A;  2FEZ A;  4M71 A;  4ENK A;  4BHB A;  3FXQ A;  4IRH A;  5CLS A;  2NAZ A;  1ZG5 A;  3PQK A;  1XDU A;  2JTV A;  4NB5 A;  5KK1 A;  3HTU A;  1HXD A;  3FX3 A;  3V8L A;  3LFK A;  3F8B A;  2KIU A;  1S8N A;  2MLG A;  2KIF A;  4Z2Y A;  5DDG A;  1F9N A;  3TO9 A;  2LDU A;  1HSJ A;  3K1P A;  1TW3 A;  3QU6 A;  5H20 A;  2MC3 A;  4ENJ A;  2HDC A;  3WTT C;  1YW8 A;  3L2C A;  1G3T A;  2M5W A;  4ON0 A;  2Y0M A;  1DP7 P;  1V3F A;  4L5I A;  3ML6 A;  2IRF G;  3IWF A;  2BEO A;  3I54 A;  2DK8 A;  3HOT A;  3WTS C;  2IT0 A;  5HDK A;  3OV8 A;  3ZMD A;  5L3E A;  2OAZ A;  5LGU A;  3RPU A;  1B1B A;  4ETS A;  1IF1 A;  4O3M A;  3DFG A;  3BJ6 A;  2FA5 A;  1FY7 A;  2EA2 A;  2XAG A;  4PDK A;  2JPC A;  1D5V A;  1T6S A;  3VEP A;  4WCG A;  1Q1H A;  3KP2 A;  3KP3 A;  3RPQ A;  1R58 A;  3P7N A;  5D8L B;  1UHW A;  4OMY A;  2QQB A;  1U5T C;  3PQJ A;  3I4P A;  2IA2 A;  2H6C A;  5ICF A;  1XSD A;  1OMI A;  1BI0 A;  1FBU A;  1LDK B;  1SMY F;  3KZZ A;  2DPU A;  1QNT A;  4PGH A;  1KA8 A;  5BPD A;  4G7O F;  3LAP A;  1ZRE A;  2DT5 A;  4MGR A;  1LDJ A;  3MZH A;  2P5V A;  4KIB A;  2KKO A;  1T39 A;  4MQ9 F;  1W7P A;  5L3G A;  2H6B A;  3IHU A;  1DPU A;  3U1D A;  2XVC A;  1O3T A;  2VE9 A;  1IAW A;  4UVA A;  1KQ8 A;  5BQT A;  2Q8K A;  1IN5 A;  4I02 A;  4WWC A;  2OZU A;  2M87 A;  4M72 A;  4R8H A;  5K5R A;  4UV9 A;  5D6E A;  2ZME A;  5D5V B;  3F22 A;  3RDI A;  1KU2 A;  3EUH A;  4CYD A;  2HTS A;  2XGX A;  1REP C;  3CLO A;  3LA2 A;  2NYX A;  1WWX A;  2X0L A;  3E97 A;  5FO5 A;  2EJR A;  1HST A;  2XHK A;  3H3Z A;  3I53 A;  1XMA A;  4HZF A;  1GXQ A;  4I01 A;  3QPH A;  2VE8 A;  3J81 Z;  3L9F A;  1Z05 A;  2RN7 A;  3ZMZ A;  3WTZ A;  4ZZD A;  2E1C A;  3CO7 C;  1PDN C;  3I58 A;  2A3S A;  1U5T A;  2NNY A;  5LHH A;  2RQP A;  4RB0 A;  4N0B A;  3TDU C;  4L9T A;  2W84 A;  1A04 A;  4RS8 A;  1YFH A;  4YFX F;  3KE2 A;  2GXG A;  2RKH A;  3I64 A;  3B73 A;  5L3B A;  3CUQ B;  2EV6 A;  1LEA A;  3HHG A;  1BI2 A;  4KFC A;  5J6X A;  1HBX G;  1TQP A;  3FZV A;  4ESF A;  3ZP5 A;  2NS0 A;  5ERI A;  4OIO F;  2E1N A;  4DNC A;  1Z9C A;  4HLX A;  3QP5 A;  2NNN A;  1FX7 A;  1WKM A;  2PG4 A;  1B4A A;  3E6M A;  4F7Z A;  2GA1 A;  5CJ9 A;  4N9I A;  1ZRD A;  2HWV A;  5HVQ C;  2HYF A;  4KIG A;  4JK1 X;  2K4J A;  4IHS A;  1XD7 A;  4K2E A;  4BXU A;  2AXL A;  2A69 F;  2FMY A;  1FYL A;  2QBY A;  4ZYG A;  4HF2 A;  2Y75 A;  4RB2 C;  3HRT A;  5LRS A;  1TBX A;  2D1H A;  4S05 A;  3REO A;  2ZXJ A;  1R36 A;  3QRF F;  1EH6 A;  3R6S A;  1J7K A;  2VOP A;  3FXR A;  2H27 A;  3KP7 A;  2XIG A;  2IPQ X;  1ODD A;  3J7A O;  5IT9 K;  5JHU A;  5E8G A;  2G7H A;  4G6D A;  5CVV A;  4M74 A;  2V1D A;  2P5L C;  1MDM B;  1F5T A;  4UV8 A;  5HDG A;  2HQN A;  1FNN A;  3MFK A;  3R60 A;  4DQ2 A;  4LK1 F;  2FNA A;  3JTG A;  3SZT A;  5E18 F;  5CYV A;  5DYM A;  2HZT A;  5DCM A;  1UCR A;  3ROU A;  2FRH A;  2LKP A;  5D5U B;  2XAQ A;  4EJW A;  1C0W A;  3FMQ A;  2VC1 A;  2Z33 A;  5TRD A;  4P5O A;  4A0X A;  3GEZ A;  4YG2 F;  3E5U A;  2ELH A;  4BQA A;  1IN4 A;  3COA C;  2EK5 A;  1K78 A;  2P6S A;  4CIC A;  3EDP A;  4U0W A;  4OIP F;  3BDD A;  3GFL A;  4OU0 A;  2XRO A;  1BOA A;  1XN7 A;  1YQA A;  1UFM A;  2VXZ A;  3WGG A;  2RC4 A;  4QLC U;  1S6L A;  5D6F A;  4I0B A;  3B02 A;  4EGZ A;  1YTY A;  2A6H F;  5CVU A;  2FNP A;  4LLG F;  3HSR A;  3SFZ A;  4LB6 B;  3L00 A;  4HBL A;  1Z6R A;  3GVA A;  1GXP A;  4WF2 A;  3KP5 A;  5DCM B;  1JHH A;  4B09 A;  3RI4 A;  4EJT A;  5E17 F;  2HKX A;  4ASN A;  3M7G A;  5ILU A;  1J75 A;  2XUB A;  3RYP A;  5HOO A;  5LRR A;  4GYG A;  1JGS A;  1K78 B;  5KVR A;  3SZP A;  1VTN C;  2FSW A;  2PMU A;  5CVJ A;  3IRQ A;  2A61 A;  2O0Y A;  3S2W A;  3CUO A;  3T0Y A;  1UST A;  2L01 A;  2PMH A;  3VOD A;  5FLX K;  2CFX A;  3FM3 A;  1O7F A;  1D8K A;  4IHT A;  4MTD A;  2W85 A;  4HYE A;  4I2O A;  3ZQ7 A;  3FMR A;  5FGM A;  1IRG A;  4JQF A;  5DEQ A;  2HGC A;  4RGX A;  3F72 A;  2OQR A;  1LVA A;  2XAF A;  1HKT A;  4H0E A;  5ILV A;  3TDZ C;  2EFO A;  4LD5 A;  1S7A A;  1L0O C;  2B0L A;  4BHP A;  2ZJ2 A;  3CJN A;  4P9U A;  1RZ4 A;  3IL2 A;  2OU2 A;  1U3E M;  4PGG A;  2FML A;  3C3W A;  5AIQ A;  1W5T A;  3IC7 A;  2PQ8 A;  5D5X B;  3FXU A;  3ZN1 A;  4XLP F;  4IRG A;  4LG0 B;  2HEO A;  1OR7 A;  4G7H F;  3J80 K;  3N97 A;  3I71 A;  5DUI A;  4HDV A;  5ICE A;  1SFE A;  5HLH A;  4A0Z A;  1F4K A;  4GGG A;  1OKR A;  4ZZL A;  4GXO A;  2JT1 A;  2F5D A;  5E1W A;  2P7V B;  1T0F A;  3DF8 A;  5J8C A;  1MZB A;  4UVB A;  2KJB A;  3QAH A;  2P6T A;  2P8T A;  1HW5 A;  1O7L A;  3BP8 A;  4EQQ A;  1J9I A;  2F5E A;  3F6V A;  4GO1 A;  1TLH B;  3RKW A;  4A2U A;  1YO5 C;  3F3X A;  4N9H A;  3EQL F;  4U0V A;  3R0A A;  1E2X A;  5L3C A;  1V4R A;  3WE3 A;  4I09 A;  2VT2 A;  3ZN0 A;  4A6E A;  3K9T A;  1ZRC A;  5LBQ A;  2DPD A;  5HS9 A;  2HR3 A;  2M30 A;  2EFQ A;  2F5F A;  1FBQ A;  4OIR F;  1ZHF A;  1S29 A;  4IVN A;  1R23 A;  2LNB A;  3ZMV A;  2FF4 A;  1KU9 A;  3RJP A;  4RGS A;  3K0L A;  2IJL A;  4Q4Z F;  4B8X A;  1TNS A;  3CUQ C;  3JAM K;  1MJB A;  1YS6 A;  2MLK A;  4ZYE A;  2PBI A;  2VOD A;  2DQR A;  4P55 A;  2QM3 A;  3KLN A;  1FC3 A;  1FT9 A;  2YSR A;  3BY6 A;  2V79 A;  3G3Z A;  1XCV A;  4UXN A;  2ESN A;  3GXO A;  4XLN F;  1ZAR A;  4L5J A;  1R1U A;  2W57 A;  2G7U A;  4XBF A;  3FWE A;  1K79 A;  5JI6 A;  2UXN A;  1R22 A;  1LQ1 A;  2J5O A;  2YX7 A;  3EYY A;  5ICG A;  1LEB A;  1SD4 A;  4G94 A;  4FHT A;  1K7A A;  4YII A;  3R0J A;  3R61 A;  2XRN A;  2EB7 A;  4BNC A;  3O6B B;  2IA0 A;  3GFI A;  3ISP A;  4MTE A;  2QZ8 A;  2ISZ A;  1B9M A;  3WTX C;  1TQM A;  1NHA A;  1U8R A;  1FWZ A;  5IT9 Z;  4P96 A;  3KEQ A;  1B59 A;  4EJV A;  1P6R A;  1U2W A;  2QLZ A;  3HOS A;  3M8E A;  5E1Z B;  2Z9O A;  5BS6 A;  3G73 A;  4U7B A;  3DPL C;  5HS8 A;  2M8E A;  3DV8 A;  1XMK A;  3E6D A;  3GFJ A;  2RDP A;  4KA4 A;  2ACJ A;  1I1G A;  3CUQ A;  4ZYD A;  1BIB A;  3L09 A;  4LLN A;  4G9Y A;  1CGP A;  3D0S A;  1EH8 A;  1GHC A;  1ZAO A;  2KJC A;  5K5O A;  4NHJ A;  5AON A;  3K1N A;  4RGU A;  2W24 A;  4HOB A;  2A6E F;  2UWM A;  3QPT A;  3PFI A;  3E5Q A;  2KRF A;  1TW2 A;  3GF2 A;  4AIH A;  1OPC A;  3SQN A;  5CVR A;  1R5G A;  4EMS A;  2CG4 A;  3F8F A;  3E5X A;  1TNT A;  4KIC A;  5DD8 A;  3P9C A;  1T38 A;  1LB2 A;  1TTY A;  2HYG D;  2MH2 A;  3CTA A;  4AIJ A;  4KT5 C;  2K02 A;  3NQO A;  3KCC A;  1P4W A;  3QOP A;  4CDG A;  2COM A;  3DP7 A;  1ULY A;  1YIO A;  2V9V A;  1XGN A;  5HDN A;  3TOA A;  4FX0 A;  4BAY A;  1J0R A;  5LGT A;  3M1E A;  2BBY A;  3BPX A;  1ZG1 A;  4LLL A;  1R00 A;  3MCZ A;  1J5Y A;  3ELK A;  4OIN F;  2Z3Y A;  4U7D A;  2L02 A;  1WRJ A;  4RAY A;  1OYY A;  4MQV A;  6PAX A;  2OD5 A;  4A5N A;  4IXA A;  2BGC A;  3RIR A;  3QU3 A;  5LGN A;  1MDM A;  1XGM A;  5FLX Z;  5LLQ A;  1YW9 A;  1ZYR F;  2DFI A;  1AOY A;  2LSO A;  2OQG A;  4PCQ A;  4HQM A;  1USS A;  4A12 A;  2JPB A;  3V8J A;  4M73 A;  3K2Z A;  4KYW A;  1JHF A;  3ECH A;  5E1X A;  5CVI A;  2F5C A;  3WTW C;  3AAF A;  4L0Y B;  3M8F A;  1O57 A;  3WE2 A;  2P5K A;  2OZ6 A;  1ZGJ A;  4A5M A;  1QZZ A;  3F8M A;  4UUV A;  3O3K A;  2X4H A;  4XRF A;  4EV0 A;  4L9V A;  2CW0 F;  2F2E A;  2GZW A;  2BV6 A;  4L9N A;  1RNL A;  3H92 A;  4BHC A;  4ENM A;  4KDP A;  2GXB A;  3QP6 A;  4RGR A;  2A68 F;  3KZY A;  2E7W A;  3K69 A;  5D5W B;  3IRR A;  4OOI A;  3KLO A;  3HSF A;  3J80 Z;  4ZH4 F;  3C1D A;  3LAJ A;  2O6G E;  5D4R A;  2FBK A;  3HYI A;  1MKM A;  3BWG A;  3Q9S A;  3R4K A;  4A6D A;  1ON2 A;  3BZ6 A;  2R7F A;  2P7C B;  1KGS A;  2HFH A;  4IPA A;  3T8R A;  4KN4 X;  3WU0 A;  3IKT A;  1MD0 A;  2VC0 A;  3ABU A;  3RKY A;  1MJ9 A;  2QVO A;  3RYR A;  3TKY A;  3F8N A;  1LJ9 A;  1FLI A;  2O3F A;  1QBJ A;  4RB1 A;  4G8X A;  2PEX A;  2VN2 A;  1P4X A;  5F6F A;  2V6C A;  3LA7 A;  2XKP A;  3HUG A;  2RV8 A;  2RGV A;  2D45 A;  1Z7U A;  4A0Y A;  1HQC A;  4L18 B;  3MZY A;  4IRI A;  4Y17 A;  4KUM A;  3HTS B;  4R1H A;  4PZJ A;  4M6X A;  3JAM Z;  1J59 A;  1UB9 A;  3WG9 A;  5J8F A;  2W25 A;  4HX4 A;  4AD9 A;  3FHZ A;  2OA4 A;  2DI3 A;  1U6G A;  3V7C A;  4U0Y A;  2HTJ A;  2YU3 A;  5DV5 A;  1CF7 A;  3WGI A;  4AWX B;  1FBS A;  3F21 A;  1IZ1 A;  1P4A A;  1HKQ A;  1SFX A;  3D5L A;  2DO7 A;  4LG0 A;  1YLF A;  2RVC A;  3TOB A;  1ZRF A;  2WTE A;  2MH9 A;  3CDH A;  4WXC A;  1DDN A;  1ZG3 A;  3NRV A;  1KQ0 A;  1YG2 A;  2RNJ A;  4RB3 C;  4FX4 A;  1Z6T A;  4WXD A;  3EET A;  1T98 A;  3ABT A;  2Q2E A;  4Y15 A;  3OOP A;  1TQI A;  1G3W A;  2Y48 A;  3BJA A;  3DQV C;  3WGH A;  2EA4 A;  3GFM A;  1CF7 B;  4WX9 A;  4Q48 A;  2MD5 A;  4I7H A;  2EWN A;  3LST A;  3VOE A;  5E8I A;  1IXS B;  1KQ9 A;  3GX4 X;  5FB2 A;  4BH9 A;  5K1Y A;  3ERE D;  3JSP A;  2V1U A;  1G6N A;  2AS5 F;  3E6C C;  1IN7 A;  1ON1 A;  3M9A A;  1W7P D;  2XAS A;  2VBY A;  3C18 A;  3TGN A;  1PP7 U;  4E70 A;  4FT8 A;  2FU4 A;  1MJA A;  3HRS A;  3VFZ A;  1FP2 A;  3Q9V A;  4NQW A;  1BI3 A;  2Q0O A;  3U2R A;  2ADU A;  4UVC A;  2XAJ A;  1DUX C;  5A2Q K;  2DQL A;  1FYK A;  4HF1 A;  2EV0 A;  1ZLJ A;  2FOK A;  1XCB A;  2CO5 A;  2CWE A;  2ESH A;  3DEU A;  4WK8 F;  4BYY A;  2PN6 A;  4CHU A;  1FSH A;  5E20 A;  5TJJ A;  5H6Q A;  1QQI A;  5JR3 A;  2EFP A;  1BN5 A;  2CQK A;  2GA2 A;  2VON A;  5H6R A;  4CO8 A;  4UHT A;  2LF7 A;  2A5Y B;  2XAH A;  1JE8 A;  4P9F A;  3E6B A;  2L4M A;  3ZPL A;  1RIO H;  4KNY A;  2QQA A;  4HLY A;  1H9G A;  5BPI A;  2K4B A;  4HX8 A;  3DPT A;  4QWQ A;  2A07 F;  5ED4 A;  2MA3 A;  2Z5U A;  3KEO A;  5L3D A;  1FP1 D;  4EJU A;  3BJO A;  4LMY A;  1FYM A;  4MNU A;  1DPR A;  4WXH A;  1BIA A;  5HLG A;  5K5Q A;  3DXJ F;  5BMZ A;  2PI0 A;  3GUD A;  1KU7 A;  2FBI A;  3NEU A;  1Z91 A;  2EFW A;  2STT A;  3BOQ A;  3KP6 A;  1QO0 D;  4ENN A;  3HRM A;  4YIF A;  1Y0U A;  2QYO A;  2DTR A;  2YR2 A;  1JXS A;  3F23 A;  1H0M A;  3GZ6 A;  3GWZ A;  2FBH A;  3P9I A;  4IF4 A;  2EFN A;  5AIP A;  1SMT A;  4UNO A;  4EM0 B;  2CYY A;  2PFB A;  1U78 A;  3FF5 A;  3O2P E;  3TO7 A;  4HV6 A;  1XGO A;  1L3L A;  3V4G A;  1XB4 A;  3GLX A;  3T1B A;  5LHI A;  1SAX A;  2DBB A;  4CZZ A;  1IN8 A;  2ZBK A;  4HX7 A;  3VB2 A;  4G7Z F;  2HOE A;  3HRU A;  2ZKZ A;  1BI1 A;  1PP8 F;  2HQR A;  3BPV A;  2Z99 A;  1R7J A;  2QUF A;  3HSE A;  1BC8 C;  4I98 B;  3FMS A;  3IWZ A;  1ZGA A;  4XSX F;  1EV7 A;  2O8X A;  3H3U A;  2H09 A;  2L4A A;  3WOD F;  1SFU A;  4O6J A;  4Y13 A;  2ETH A;  2O03 A;  3Q5F A;  4CXF A;  1R5H A;  1F1Z A;  4HF0 A;  3LWF A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...