3WU1B

Crystal structure of the ets1-runx1-dna ternary complex
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
105
structure length
105
Chain Sequence
GPIQLWQFLLELLTDKSCQSFISWTGDGWEFKLSDPDEVARRWGKRKNKPKMNYEKLSRGLRYYYDKNIIHKTAGKRYVYRFVCDLQSLLGYTPEELHAMLDVKP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Runt-related transcription factor 1
publication title A novel allosteric mechanism on protein-DNA interactions underlying the phosphorylation-dependent regulation of Ets1 target gene expressions
pubmed doi rcsb
source organism Mus musculus
molecule tags Transcription/dna
total genus 35
structure length 105
sequence length 105
ec nomenclature
pdb deposition date 2014-04-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00178 Ets Ets-domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 3wu1B00
4KMUX 5ILUA 2OA4A 4N9HA 3WGGA 1HKQA 4I09A 4EM0B 2MA3A 4RGRA 2JZYA 5BPDA 2P7CB 5L3GA 1SMYF 5DUKA 3R6SA 3E5UA 5F6FA 5KVRA 4JQFA 2AXLA 3PQJA 2KIFA 3N4MA 1ZH5A 3BPVA 2M1BA 2PFBA 3LSTA 1USSA 2EFWA 3KP2A 1QPMA 5E20A 4AVPA 1FLIA 3WG9A 3FMSA 2OBPA 2LF8A 3G3ZA 3I5UA 4ASNA 3Q9SA 4KT5C 2OZUA 3RJPA 2A6EF 1MJAA 4LB5A 4BXUA 3P9CA 3ELKA 4TV7A 3RTRA 2X0LA 3V7SA 4HF2A 1XGMA 5LLQA 4XLPF 4UHTA 3WTWC 3FXRA 2UWMA 2QVOA 4YG2F 4KIGA 1RZ4A 2DLLA 1LNWA 1ZYRF 1NHAA 3ZMTA 1I27A 3BPXA 3ZMDA 3KFWX 1J2XA 2EA2A 1H9GA 1S7AA 1FZPB 1O7LA 1Q1HA 1H0MA 1FSHA 4MTDA 4ON0A 4EM1A 2CWEA 3S2WA 3U1DA 3E6CC 2FE3A 1B6AA 2ISYA 2W85A 2QQ9A 3EYYA 1S6LA 4L5JA 4OU0A 2HYFA 3D5LA 1T0FA 5EEHA 4M71A 2FF4A 1J5YA 3LQQA 4ZZDA 4FX4A 3TDZC 2P5KA 2VE9A 5ICGA 2D2WA 1ONVA 4RGXA 2O8XA 3REOA 2BE5F 3AAFA 2OD5A 4IRGA 1W5SA 4O6JA 2F5DA 1XGOA 4FHTA 5HDKA 1Z1DA 2XGXA 1A04A 3G73A 5BS6A 1BI0A 1UCRA 2EV0A 3F6OA 1I6XA 1K78A 5HS8A 1R23A 2WC2A 1MZBA 2E1CA 4HW0A 2L02A 3L00A 3VODA 1FBSA 4K2EA 4HDUA 1IN7A 2IA0A 1XCBA 5JR3A 2A69F 3PFIA 1FYLA 4NHJA 3L7WA 1GVJA 3J81Z 1KU9A 1U3EM 1SD6A 3HRUA 4HAMA 4U0YA 3F21A 2COMA 2L3DA 2W24A 2YU3A 1JHHA 4DQ2A 4OIQF 3PQKA 4RAYA 4LLLA 5J8FA 4L9NA 1FYMA 5E8GA 5DCFA 2K27A 2LNBA 1YYVA 4HOBA 5DD4A 3E6DA 3ZMSA 2RVCA 3GZ5A 1OYWA 3BWGA 3MWMA 4EJUA 3GWZA 5FLXZ 5D5WB 1SFUA 4YFNF 2O6GE 2DQRA 3SZPA 3GFLA 2Z5UA 1GXQA 3I4PA 1FOKA 2PI0A 1SD7A 2LF7A 3DV8A 3N97A 4M72A 1JGSA 1BI1A 3MAJA 4A6EA 3I64A 2TDXA 1BIAA 4A5NA 4ESJA 1YQAA 5D8LB 3K1PA 6PAXA 5ICFA 1YTYA 5AIQA 3KEOA 1AOYA 3IC7A 1QO0D 2JPCA 4CZZA 4GO1A 4I2OA 2D45A 1R1UA 3KP3A 2Z33A 4G8XA 1QGPA 4MQVA 3RIRA 1KU2A 1U5TC 4HX4A 1ZG3A 2FU4A 1FBUA 2KIMA 4L5IA 2GXGA 4ZYDA 4PDKA 1YS6A 3QP6A 2BV6A 3LA3A 4AD9A 1BM9A 3WU0A 2HGCA 4HQEA 1LQ1A 4IRHA 5LHHA 2A6HF 2VN2A 1XB4A 4KN7X 4AIHA 3I59A 1FC3A 3NEUA 1MDMA 3M9AA 4OIRF 4A5MA 3MZHA 4ENMA 5DCMB 5E18F 1Z91A 4UNOA 3F8MA 3WTZA 2HEOA 3TQNA 3F8CA 4UV8A 5L3BA 1IXRC 2ACJA 4OMZA 3FM3A 2YX7A 1T2KA 3BZ6A 2ZNZA 3EQLF 3F8FA 1G3WA 4RB1A 2KJCA 2IT0A 2G7HA 4ENKA 3IWFA 3NQOA 1R5GA 3KCCA 5BQTA 3ERED 3CUQC 1R5HA 1XMKA 3K9TA 3TO9A 1MJBA 2A3SA 5E17F 2HDCA 4LGWA 2MLKA 1TQIA 4RB2C 2IJLA 2P6SA 2EB7A 1F5TA 2HYGD 3CJNA 3KLNA 2XHKA 1TW2A 4XLNF 3F23A 4P55A 4YFKF 3P9KA 2LSOA 1HW2A 3FM5A 1D8JA 3WODF 5FGMA 1BC7C 1U5TA 3R0AA 2H6CA 1STZA 2JSCA 4EGZA 1IN8A 2FNAA 4HDVA 3DFGA 2A68F 5HOOA 2OZ6A 4PZJA 2CFXA 2FEZA 4AIJA 4KIBA 4LG0A 1IF1A 1ON1A 1G3YA 2P5LC 1QZYA 2JTVA 2GQQA 5JFRA 2HKXA 1UFMA 4RGUA 2QBYB 3HUGA 3EUHA 3TO7A 1XDUA 2O61A 5CVIA 5HLGA 5A2QZ 3FX3A 5K1YA 3I58A 4Y17A 1ON2A 1E2XA 3HTUA 5D8KB 3M8FA 4G9YA 5E1ZB 5LRRA 1USTA 3CUQB 3IWZA 3V4GA 5FD6A 3OOPA 3L09A 4U0VA 5D5VB 1XGNA 1O3QA 5J6XA 1TBXA 1O3RA 1J59A 3RI4A 1REPC 3KP4A 4UVCA 5LGNA 1QNTA 3ZPLA 3C3WA 4I0AA 5AIPA 1IW7F 3BJAA 3L9FA 5FO5A 5HLHA 3FMRA 5FB2A 1WKMA 4A12A 3QP5A 1FWZA 3ABTA 2QQAA 1UHWA 3I0TA 1WSUA 4HX8A 1B59A 1ZARA 1OYYA 2YX4A 1Z6TA 1J7KA 3D0SA 5CVRA 5CVUA 3SXYA 3RKYA 4WWCA 4LK0F 2RN7A 3DP7A 4I01A 4F7ZA 3FF5A 3H3ZA 2RV8A 4LK1F 5ICCA 1U8RA 3GLXA 2D1VA 4KYWA 2O03A 1FBQA 3KE2A 3F22A 3COAC 4KDPA 3Q5FA 4WXHA 3DPTA 3HSEA 2M87A 3SZTA 2QLZA 1R1TA 1O57A 5DYMA 3QU3A 3SFZA 4ZYEA 2J5OA 4M9XA 3GYHX 5EEGA 2ADUA 3T1BA 2UXNA 3HHGA 1C0WA 2NNNA 3FXQA 5ED4A 2XAHA 3FZVA 1DPUA 2H6BA 4EMSA 1IAWA 1WWXA 2Q0OA 5FD5A 5CVVA 1YW8A 1LEAA 4WXCA 2V79A 5ICEA 4NQWA 2DTRA 3DEUA 2HTSA 4Y13A 2DO7A 2W25A 2HQRA 3DF8A 1E17A 5LEKA 1SFEA 4KIFA 3JW4A 3R61A 4OIOF 3RPUA 3WTYC 4LFUA 2BBYA 2XAQA 3EETA 2MC3A 2RDPA 4EVIA 3FXUA 4I7HA 2D1HA 3ZP5A 4HV6A 3I54A 4U0WA 3WE2A 4R8HA 3GW2A 4I02A 3ZN0A 1HSJA 1AWCA 4H0EA 2O3FA 4Y15A 2LDUA 2R7DA 2NS0A 2Y0MA 4BH9A 4P9FA 3H92A 4FX0A 1BN5A 4CDGA 1TNSA 2KIUA 2ETHA 2K86A 5L3FA 1XSDA 3J80K 4BNCA 3K1MA 3TGNA 4G7OF 3BY6A 1FX7A 4OOIA 1RIOH 2FBKA 2H94A 3M1EA 1KQ9A 4IF4A 4QWQA 5JVTA 2XRNA 1W7PB 5E1XA 4KA4A 2G9WA 3BJ6A 1KA8A 2Y75A 5LHGA 1Z7UA 1G4DA 4AWXB 4B09A 4I98B 3GEZA 2EV5A 4RS8A 1HXDA 3RYRA 4ESBA 3P9IA 4ESFA 2QM3A 4CICA 1SFXA 1TLHB 1MGTA 3O6BB 4HLXA 3LA2A 4MNUA 3T8TA 4U7DA 3KP7A 3JSPA 1V3FA 2PQ8A 3MFKA 3C7JA 2HKOA 3GF2A 1IZ1A 4WXDA 2STTA 1XGSA 2G7UA 4XBFA 3MQ0A 2ZO4A 4ENJA 4UUVA 5D6EA 4IVNA 2QWWA 4M6XA 4A0YA 1TQPA 3L2CA 5IT9Z 3KP5A 2ELHA 3DPLC 3CTAA 3BJOA 3ROUA 3GUDA 4LLGF 4QLCU 1RNLA 4HQMA 4ZZLA 3V8KA 2M8EA 4M6YA 1GHCA 1KYWA 2DFIA 3FMQA 4U7BA 2F5EA 4NB5A 2IA1A 4UVBA 4EV0A 2VBZA 5H6RA 5H20A 1P2FA 4A2UA 4HBLA 1KGSA 1J0RA 4GGGA 4EGYA 4OIPF 5CVJA 4Q48A 2GAUA 4IXAA 2EJRA 3WTVC 2NNYA 3B73A 2XKOA 2F5CA 3ML6A 2VONA 5K5RA 3EYIA 3KP6A 5BPIA 2ZNYA 3JSOA 1GXPA 4PGHA 3VFZA 4EJVA 5FFXA 1S7OA 3V8JA 2ISZA 3CO6C 2IVMA 1BOAA 3IL2A 2FA5A 3LFKA 2YR2A 2CSOA 3GVAA 4HF0A 2DT5A 5CJ9A 2H27A 3ULQB 2DK5A 5D4SA 4XSXF 1F9NA 4CHUA 3I71A 2EA4A 1BI2A 1YLFA 1LB2A 4MEXF 3KZYA 2ZMEB 4RGSA 3HOTA 1XCVA 2FBIA 3E3VA 2ESNA 3T0YA 3KETA 5LHIA 3CO7C 4HZFA 4KNYA 1S8NA 3JAMZ 3OV8A 1O3SA 2EFPA 4IHSA 2ZCWA 4BHPA 2FNPA 3BOQA 2VOOA 1ZG1A 4A0ZA 2A07F 4GYGA 2XV4S 4WK8F 1SMTA 2DAOA 2V1UA 4LLNA 3NRVA 2VBXA 4CXFA 3CLOA 4WCGA 5BMZA 1IRGA 1BBYA 3FWEA 2W57A 3RPQA 2GZWA 5L3EA 2L54A 1EV7A 4EJWA 3J81K 2MD5A 1MJ9A 3VOEA 2CGPA 4O5VA 1EH6A 4YIFA 2VT3A 3TKYA 2STWA 2VT2A 4LB6B 5DCMA 2WTEA 2PBIA 3JTHA 5ILSA 3W6JB 4YFXF 1YG2A 3HRMA 5HDGA 1IN4A 3ZMUA 1IXCA 4Q47A 2IW5A 1HSTA 3VB2A 1KQ8A 2XKPA 2CG4A 3BDDA 3GFIA 2ZXJA 1WI9A 5FLXK 5HDNA 5E8IA 2L4MA 3MZYA 2L4AA 4M9ZA 4EJOA 1G3SA 1FYKA 2OU2A 2FOKA 1OMIA 3C18A 2YPRA 4BQAA 3ZMZA 3M7GA 3QU6A 1KU7A 1FSEA 2EFOA 1CF7B 1SAXA 1D5VA 3LQRA 3O2PE 2GWRA 1TNTA 3TO6A 1WQ2A 5TJJA 2EV6A 3KZZA 1I1SA 3IRQA 1FP2A 2A61A 1F1ZA 4UVAA 5DUIA 1MD0A 4IHTA 2P6TA 2VOPA 2V1XA 1HW1A 4P96A 3BP8A 1OYIA 3KLOA 1D8KA 4MTEA 5F64A 2FMYA 2RGVA 4L9VA 1UB9A 1G6NA 1BIBA 2HQNA 4MHGA 2NAZA 3RKXA 5LGTA 1QBJA 1ZHFA 1P92A 1YW7A 4B8XA 1I5ZA 1W7PD 4KFCA 3HSRA 4WX9A 1HQCA 3ECHA 2VODA 4PGGA 3R0JA 1EH8A 4RB3C 2PEXA 4HX7A 3RDIA 1J9IA 3E6MA 2QBYA 1W5TA 1KYZA 5DD8A 2QYOA 2XAJA 4S04A 2GA1A 2Z99A 1PUEE 2M30A 1IXSB 3F3XA 2IPQX 3K69A 4M9SA 2PJPA 5KK1A 3CUQA 2QENA 1K79A 1B9MA 2OQGA 5DEQA 5LBQA 4PCQA 2YSRA 1B4AA 2Y48A 2RKHA 3DQVC 4XSZF 2O0YA 1JXSA 4KMFA 1Z6RA 1YW9A 2HR3A 3GFJA 5LRSA 3CUOA 5HS9A 1IN6A 4CO8A 5HLIA 4JK1X 1FT9A 1YIOA 1K7AA 1P4XA 2F2EA 4IRIA 2VE8A 5D5XB 1BI3A 3Q9VA 2QZ8A 1W4MA 2PMHA 3ZQ7A 4U88A 5D6FA 1MKMA 4I0BA 2KJBA 4HV5A 2HFHA 3SQNA 4G6DA 4LD5A 2IRFG 1FNNA 1IUYA 4G94A 3WTUC 2ZKZA 3VEPA 1OR7A 3ZMVA 2MH9A 4GYIA 1ZGJA 5LGUA 1BC8C 2E7WA 2WWYA 2Z9OA 3U2RA 1Z9CA 1LDKB 4YIIA 4M73A 2RC4A 1JHFA 2GA2A 2GXBA 4MGRA 2WV0A 1LDDA 2XASA 4KICA 4O3MA 3GFMA 4L9JA 4IJAA 5A2QK 2FMLA 1YS7A 3LAJA 3K2ZA 1KQ0A 2E7XA 3I53A 3IKVA 3ZN1A 3DXJF 4HYEA 1ZN2A 1HBXG 3O3KA 1TQMA 2ESHA 3K1NA 5F1RA 2CW0F 3E6BA 3WTXC 3LAPA 4OINF 5ERIA 2FXAA 2V6CA 3KEQA 1YFHA 3IKTA 5K5OA 2DK8A 2PN6A 3WE3A 3E5QA 4HF1A 1ZRCA 3QPHA 1R58A 1QQIA 4G7HF 2OQRA 2W84A 3HRSA 2MH2A 5K5QA 2DBBA 1DUXC 3V7RA 4RB0A 2QUFA 3MEXA 2EFQA 2F5FA 1XD7A 1F4KA 3DKWA 2P7VB 2ZBKA 1PP8F 1K78B 1SD4A 5DV5A 2HZTA 4N0BA 3ECOA 3ABUA 4L9TA 2XVCA 3RKWA 5ILVA 2VBWA 1L0OC 1O3TA 2K4BA 4E70A 5HVQC 4S05A 2UZKA 4AIKA 4CGZA 1T6SA 3QAHA 1W7PA 3F8BA 4A6DA 5HS7A 2HOEA 2QQBA 1PP7U 2XAGA 2BEOA 3WTTC 1EH7A 2FBHA 3F8NA 4OMYA 1RUNA 2OAZA 4EQQA 2EWNA 1R00A 3T8RA 3P7NA 1ZRDA 3HYIA 1UHMA 3TDUC 1T98A 5J8CA 1R22A 3GXOA 5L3DA 4GCVA 4BHCA 1HKSA 1ODDA 2M5WA 4FT8A 1Z05A 3F6VA 5FFZA 1BJAA 2CQKA 2EFNA 4BHBA 4CYDA 4RAZA 5IT3A 2VBYA 3J7AO 3JTGA 4ZYGA 2AS5F 2A5YB 3W6KB 1P4WA 3M8EA 1RUOA 1QZZA 2Q2EA 2HWVA 5DDGA 4Q4ZF 4LMYA 2BYVE 4P5OA 2KRFA 3MCZA 1XSVA 2VC1A 1P4AA 2RNJA 2M45A 1IRFA 3IHUA 2BGCA 2VC0A 4DNCA 5BOXA 2IA2A 3QRFF 2DI3A 4XRFA 3HSFA 3GZ6A 4P9UA 1HW5A 4Q5SF 2UXXA 4L18B 2B0LA 4ZYHA 3I59B 2R7FA 4GXOA 2K4JA 1MDMB 3ISPA 2DW4A 1OPCA 3WU1B 3H3UA 1DPRA 4R1HA 3IRRA 2DU9A 4BAYA 1B1BA 5E1WA 2PLYA 3HHHA 2CO5A 4EJTA 1XSXA 2E1NA 1LEBA 1T39A 1S3JA 3WGIA 1R7JA 1SD5A 1H9TA 1HKTA 5CLSA 2EK5A 1ZLJA 3BROA 2PMUA 3TOAA 1X3UA 4G6QA 5H6QA 1K6OA 1XMAA 2ZMEA 1R36A 4MQ9F 2LKPA 5L3CA 2IP2A 2MLGA 1G3TA 2JT1A 1FY7A 1ZAOA 2DQLA 3K0LA 5AONA 2MBFA 1OKRA 1L3LA 5D5UB 4N9IA 2V9VA 4MEYF 2CYYA 1S29A 3QOPA 2P4WA 4G7ZF 2ZJ2A 2GIVA 1DDNA 3U9GA 3LWFA 1U78A 1DP7P 1XDSA 4KUMA 2KKOA 3HOSA 3E97A 5IT9K 3V7CA 3WGHA 3E5XA 5D4RA 2ZFWA 3CDHA 3V8LA 2DPDA 2RQPA 2FRHA 2Z3YA 2R3SA 1P6RA 2P5VA 2V1DA 2H09A 2Q8KA 2FQ3A 1U5TB 2XIGA 2X4HA 1LJ9A 1IN5A 3GX4X 2K7LA 4LG0B 4UXNA 1FP1D 4ETSA 3LA7A 1FPQA 2HTJA 3C1DA 1R1VA 1ZRFA 4LJZF 3HIFA 2C6YA 5CYVA 4A0XA 4HLYA 4JBAA 1U6GA 4Z2YA 1VTNC 1JE8A 4BYYA 3TOBA 1I1GA 2HS5A 3QPTA 2J5PA 5JI6A 3WTSC 2FSWA 1ULYA 3F72A 1Y0UA 1CF7A 2JRTA 1ZGAA 4IPAA 4EM2A 3B02A 5JHUA 3RYPA 1ZLKA 1XN7A 1O7FA 4HA8A 4UV9A 1ZG5A 3T5XA 1V4RA 4R79A 2DPUA 4L0ZB 3FHZA 3JAMK 3HRTA 2VXZA 1U2WA 4D0PA 2NYXA 2NRAC 1YO5C 4M74A 4ZH4F 2JPBA 2XAFA 1TW3A 3R4KA 3R60A 3SHFA 1J75A 1T38A 5LEJA 4L0YB 1KU3A 1ZREA 2L01A 2XUBA 3EDPA 1B9NA 2P8TA 1TTYA 2PG4A 4WF2A 1CGPA 2K02A 3J80Z 4KN4X 3HTSB 1WRJA 1PDNC 1D3YA 3GO5A 1RI7A 1LVAA 5TRDA 1LDJA 4ENNA 2XROA
chains in the Genus database with same CATH superfamily
4KMUX 5ILUA 1V5GA 2OA4A 4N9HA 3WGGA 1HKQA 2LFBA 3BR5A 4I09A 4EM0B 2MA3A 3M8JA 2CQ7A 4RGRA 5B1BH 2JZYA 2WAEA 5BPDA 2VLAA 4QPQA 2P7CB 3VYRB 5L3GA 1SMYF 5DUKA 4BXXJ 3R6SA 4PJNA 3U1KA 3E5UA 3LNQA 5F6FA 1YJWI 5KVRA 4BBRJ 4AUXA 4JQFA 1VI0A 5J4YA 5EZGA 2AXLA 3PQJA 2KIFA 4RDUA 3N4MA 4IKFA 3HOVJ 3LSMA 1ZH5A 3BPVA 2M1BA 2PFBA 4NQWB 1NG7A 4C30A 3LSTA 1G59A 2E60A 2VKEA 2EH3A 4QIWN 1USSA 2EFWA 3KP2A 3W3CA 1QPMA 5E20A 3H9JA 4AVPA 1FLIA 3WG9A 3FMSA 5GAHJ 2BY1A 2OBPA 2XPVA 5JHFA 2XSDC 4XORA 2R7XA 2LF8A 3G3ZA 3I5UA 4ASNA 3Q9SA 4D1QA 2QEXI 3BTCA 2OZUA 4KT5C 4HNTA 3RJPA 4AC0A 2A6EF 4N4OB 1MJAA 4LB5A 3UNGC 3G1OA 4BXUA 3P9CA 3ELKA 4TV7A 3RTRA 1D1AA 2X0LA 3V7SA 4HF2A 3Q0UA 5KAFC 4AIDA 3IAM2 2OJED 4PFPA 1XGMA 1BW5A 3CJTB 5LLQA 1EF4A 2XAUA 4XLPF 5B5EC 1H89C 5KNLA 3BR0A 4BUPA 1P7JA 4UHTA 3RQ4A 4FASD 3WTWC 3FXRA 2UWMA 2QVOA 4YG2F 5H2FC 4KIGA 1RZ4A 1X2MA 2DLLA 1LNWA 1ZYRF 1NHAA 2LY2A 4V2GA 1DU6A 3ZMTA 1IJWC 2R93J 1I27A 3BPXA 3ZMDA 3I56I 4QTRA 2ZJQF 3KFWX 3MMYB 3L2WA 1J2XA 2EA2A 2Y0SN 4M6VA 1H9GA 3CC2I 1S7AA 1FZPB 1BR2A 1O7LA 1Q1HA 3VSKA 1H0MA 2ZSIB 1W1WE 3M07A 1FSHA 3JRCA 2LBFB 4UUSA 4MTDA 2QA4I 3BLYA 4IQJA 3PSFA 2HVSA 4ON0A 4EM1A 2CWEA 2BY0A 3S2WA 3U1DA 4UUTA 3E6CC 2HU9A 2FE3A 3H5AA 1OCOH 3VPRA 1B6AA 2ISYA 3WHCA 1UELB 2W85A 2QQ9A 2B7EA 1I6HJ 3EYYA 3CMMA 1S6LA 2W00A 4L5JA 4OU0A 3MKZA 2HYFA 3D5LA 1S9HA 2A6TA 1FEXA 1NG6A 1T0FA 3OYGA 3HOXJ 5EEHA 4M71A 2FF4A 2W4SA 1E0EA 1J5YA 3LQQA 2RREA 4DBQA 4ZZDA 4FX4A 5IP9J 5GAGJ 5IY5H 3TDZC 2OCEA 2P5KA 3FXKA 2VE9A 5ICGA 1WZ2A 2D2WA 1FIPA 1Z77A 1ONVA 3HJEA 4RGXA 2O8XA 3REOA 2BE5F 1P9QC 3Q0VA 1OCPA 3AAFA 2OD5A 3IH3A 1MMNA 2VKHA 1W5SA 4IRGA 4D7MA 3QWLA 2E2HJ 4O6JA 2F5DA 2NVTJ 1XGOA 4FHTA 1SVOA 5HDKA 1I39A 1Z1DA 4ANJA 2XGXA 4A93J 1A04A 4NDLA 3G73A 3FHNA 2DT7B 5BS6A 4LIVA 4CYCB 2L9RA 2L7KA 3FKIJ 3OYDA 2H1KA 4XKCA 3I55I 2E36A 1BI0A 1UCRA 2DN0A 1P7IA 4V19K 2EV0A 3EUKL 3F6OA 1I6XA 1PUFA 1K78A 1Y8RB 1LFPA 2CQNA 5HS8A 1R23A 1MH4A 2WC2A 1VQPI 3TW6A 2KDOA 2BW3B 1RKWA 1MZBA 2QSHX 1HDDC 2E1CA 3OL4A 4HW0A 3GLLA 2L02A 3L00A 3VODA 1FBSA 4K2EA 4HDUA 2H8WA 1IN7A 4ZYAA 2IA0A 3A2KA 1XCBA 5JR3A 2A69F 4XKBA 3TBIA 3PFIA 1AHDP 1FYLA 4NHJA 3L7WA 2NXNB 1R49A 2EIKH 4FE4A 2W7NA 1GVJA 3J81Z 1KU9A 1U3EM 1SD6A 3HRUA 4HAMA 4D7NA 4U0YA 3F21A 3ZR8X 2COMA 4F3QA 2L3DA 4IL6C 1ETQA 2DFEA 2W24A 2YU3A 2MABA 2JQ7A 1JHHA 2EZLA 4DQ2A 2JRMA 1JI8A 4OIQF 3PQKA 4RAYA 3DCFA 4RLFA 3K7AJ 1IRXA 4LLLA 5J8FA 1QU3A 4L9NA 4DZJA 1FYMA 5E8GA 5DCFA 2K27A 5DM6F 2LNBA 1YYVA 4HOBA 3K10A 4DOZA 5DD4A 3IV5A 1KZHA 3E6DA 4FTHA 3ZMSA 2RVCA 3GZ5A 3A01B 3CD6I 2ME6A 1OYWA 3BWGA 5J40A 3MWMA 3CCUI 4IQ4A 4EJUA 3OSFA 3GWZA 5FLXZ 3A0HC 2VPRA 3CCYA 3K4JA 5D5WB 2EIMH 1SFUA 3C2HA 3GTQJ 4EEFG 2ZJRF 3S93A 4YFNF 2O6GE 5IP7J 2DQRA 3SZPA 2MSYA 2IS4A 4M3EA 3GFLA 2Z5UA 5C4XJ 1GXQA 2LY1A 3I4PA 1FOKA 2PI0A 3KEYA 1SD7A 1IV6A 2X6WA 2LF7A 3GTMJ 3HOWJ 4XONA 4HNUA 3AG1H 3DV8A 4Y7NJ 1XS9A 3N97A 3L2RA 4IZZA 4M72A 3S14J 1JGSA 1BI1A 2Y9YA 3MAJA 5E3OA 3S15J 1T08B 1IC8A 4A6EA 2AHQA 1OISA 4BE1A 3I64A 3VYTB 1K61A 2TDXA 1BIAA 4IHXA 4A5NA 3CCRI 4ESJA 2L9SA 1YQAA 5D8LB 3K1PA 6PAXA 5ICFA 5K7ZA 1YTYA 5AIQA 1TZLA 3KEOA 3PIPF 1AOYA 3IC7A 1QO0D 2JPCA 2E71A 2KRHA 4CZZA 4GO1A 4OWRB 5CKTA 4I2OA 2DCEA 2D45A 3CP2A 1R1UA 2L7ZA 3KP3A 3Q0WA 2Z33A 2EZHA 4G8XA 2HNHA 2PMZA 1QGPA 4MQVA 3RIRA 1KU2A 4CSWA 2LH9A 1U5TC 4HX4A 1ZG3A 2FU4A 3CCVI 1V54H 1FBUA 1WJ5A 2KIMA 3OYKA 4L5IA 3V42A 3L1PA 2GXGA 4ZYDA 3S3OA 5IYCJ 2FD5A 3PNTA 3ZQQA 5DM7F 2W1OA 1V5FA 2R5ZA 3LL7A 4PDKA 5IPAA 2ZFUA 1YS6A 3BG5A 3QP6A 4GFBA 2BV6A 4NUBA 3LA3A 4AD9A 1BM9A 2KFDA 3WU0A 2HGCA 3JRAA 3OS2A 4HQEA 4PJMA 4BACA 4M3BA 1LQ1A 4IRHA 5LHHA 4MFDA 4XIDA 2A6HF 2VN2A 3LMMA 2Y0SA 1XB4A 1DP3A 2V9KA 4KN7X 4AIHA 3JRBA 3I59A 1F43A 1FC3A 3NEUA 1SVLA 2XF5A 3M9AA 4OIRF 4A5MA 1MDMA 4I6ZA 2DA3A 3LSGA 3MZHA 2BHYA 4ENMA 2OUMA 1Z21A 2FQ4A 2LREA 1RKTA 1WJBA 3DU6A 5DCMB 1OCZH 5E18F 1Z91A 3H9GA 5IOYA 3M4OJ 4NNJA 4UNOA 3BG3A 3F8MA 5FKNA 3WTZA 2HEOA 4KJZA 3TQNA 3F8CA 4UV8A 2VJIA 2L9NA 3CDIA 5L3BA 2M9HA 3P5JA 1IXRC 2E19A 4B48A 2VPLA 2ACJA 4OMZA 3FM3A 4E7LA 2YX7A 3PJRA 4MO7A 1T2KA 3KIOA 1ITYA 3BZ6A 2ZNZA 3CESA 3EQLF 4IEJA 4RM3A 5DS9A 3F8FA 1AKHA 3K2AA 3LSJA 1IDZA 1B72B 4HG2A 1G3WA 4RB1A 2KJCA 3CCEI 1RR8C 2LVSA 3FK6A 2IT0A 4E4HA 4E7JA 1YRNB 4QPOA 2G7HA 4Y52J 3CLQA 4ENKA 3IWFA 3NQOA 1R5GA 3KCCA 5BQTA 1Z3YA 3ERED 3OS0A 3CUQC 1MBKA 1R5HA 5EG0B 3PUBA 5JVGF 1JKPC 1MMSA 1XMKA 3K9TA 3TO9A 1H8AC 1MJBA 4IHVA 4XM3A 4AYBN 1ZTRA 3SFIA 3H1CA 2A3SA 5E17F 1JT0A 2HDCA 3WG7H 4LGWA 5FLVA 1W0UA 1AA7A 2MLKA 1TQIA 4RB2C 3DTIA 2IJLA 2P6SA 4IHYA 2EB7A 1F5TA 5E79C 2HYGD 3CJNA 3KLNA 2EQRA 2BXYA 2XHKA 1TW2A 4XLNF 4RM2A 3F23A 4P55A 5FLMJ 1VQ6I 4YFKF 5FRNA 2E35A 3P9KA 2LSOA 2Z2SB 2X1CA 1HW2A 4ITVA 3JRHA 1A5JA 5E3NA 3FM5A 1D8JA 1W5CC 2NVYJ 3WODF 5FGMA 5FJ8J 1BC7C 5M5XJ 1U5TA 3R0AA 2H6CA 1STZA 2JSCA 1N75A 2K9MA 4EGZA 5B3SH 4BL0B 4BE2A 2IAIA 4YEJA 4N4NB 1IN8A 2FNAA 4HDVA 3DFGA 3OYBA 2A68F 1BJZA 5HOOA 2CW8A 2OZ6A 3NWTA 2CFXA 2FEZA 4PZJA 2GM4A 4AIJA 4KIBA 3DU5A 1SVMA 4LG0A 4RBOA 2HOAA 5BNGA 1ON1A 2EBIA 1IF1A 3K4NA 4DYQA 1MH3A 1G3YA 5EZHA 4CZCA 2P5LC 1QZYA 2JTVA 2Q1ZB 3S32A 3CJQB 2GQQA 5JFRA 3N05A 1YIJI 3HL2A 3DPUA 1ZKGA 2KQRA 3SYTA 2HKXA 1UFMA 4RGUA 2HQAA 1ZQ3P 1IG7A 2M0CA 2JA7J 2QBYB 3CCLI 1LUJB 3HUGA 3GTOJ 1OR7C 3EUHA 3TO7A 1XDUA 4I76A 2O61A 5CVIA 5HLGA 5A2QZ 3D5RC 3FX3A 4PK4A 4RAGA 5K1YA 3I58A 4Y17A 1ON2A 1ETOA 1J09A 3LOCA 1MBHA 1E2XA 4BBSJ 3HTUA 5D8KB 2DA4A 3CDLA 3M8FA 4G9YA 5E1ZB 5LRRA 1USTA 3CUQB 4XLHA 4BXFA 2M7BA 3IWZA 3V4GA 3ZQLA 5FD6A 1MIJA 3OOPA 3L09A 1ZR2A 4U0VA 5D5VB 2K3PA 2V9PA 1WJEA 1X1BA 4NC7A 4A3DJ 2QQ8A 3PNYA 1XGNA 2DMQA 5J6XA 1O3QA 3J7AY 3ABKH 3HB9A 5GPAA 2H8RA 2JA5J 1TBXA 1WH7A 3K4KA 2EILH 1LKXA 1O3RA 2XGEA 3CCQI 1T95A 1FTTA 1J59A 3RI4A 1UG0A 4Y4RA 1REPC 3BTLA 2ID6A 3KP4A 4UVCA 5LGNA 1QNTA 3AFHA 3ZPLA 5IP6A 3C3WA 1R71A 2CUJA 1APLC 2GXAA 1W36D 3G6EI 4I0AA 3OYLA 2ECCA 5AIPA 3BC8A 3CMAI 1IW7F 3BJAA 3LSRA 3L9FA 4IHWA 5FO5A 1BW6A 5HLHA 4BE0A 4JX6A 3FMRA 2XDVA 5FB2A 1WKMA 1NTCA 2XPUA 4A12A 4OAYA 1IUFA 1A6QA 1JUPA 3QP5A 1FWZA 3ABTA 2QQAA 1UHWA 3I0TA 3QQAA 4HEA2 4HX8A 5F0CA 1WSUA 2ZXIA 1B59A 1ZARA 3KZIC 5GADJ 1OYYA 2ZB9A 1UJ8A 1Z6TA 2YX4A 1J7KA 2BY2A 2CH0A 1N25A 3D0SA 1D0YA 3HGYA 5CVRA 5CVUA 2VJJA 3SXYA 4D5CA 4DJAA 3W2AA 3RKYA 4WWCA 5FKMA 3W2WA 4LK0F 2RN7A 2X6YA 2WB1A 2DYRH 2WV1A 2CRGA 3LSPA 4LG3A 3DP7A 4I01A 4F7ZA 3ZQFA 3FF5A 3H3ZA 1TWFJ 2RV8A 4LK1F 2RNGA 5ICCA 1U8RA 1JJ6C 3GLXA 3HC7A 2D1VA 2L7MP 4YIRX 4KYWA 5F1JA 1QRYA 2O03A 4P1WA 4FQGA 3BR6A 1FBQA 2VQGA 3KE2A 3F22A 1R9TJ 3RKQA 3OSGA 3COAC 4KDPA 5EGOA 3Q5FA 4WXHA 1ETVA 4UB6C 3DPTA 2KIQA 2Z16A 2DTZA 3PNVA 2E34A 3HSEA 4HSTA 2M87A 3SZTA 2QLZA 1R1TA 1O57A 1VNDA 1XPXA 5DYMA 2LK2A 3QU3A 4S0HB 3U21A 1JJ8C 3SFZA 1JKOC 2R7WA 4ZYEA 2QCOA 2R7TA 2J5OA 1Y8QB 2VUMJ 4MLOA 3F0CA 2F5VA 4M9XA 3GYHX 2R7UA 5EEGA 2P81A 2IGNA 4E6KG 2ADUA 3T1BA 2UXNA 2DT6A 3HHGA 1C0WA 2WY7Q 3MKLA 2NNNA 3FXQA 5ED4A 2XAHA 3FZVA 4GDFA 1DPUA 2KPMA 1YITI 1SANA 1WHUA 2H6BA 2R7OA 4EMSA 4F91B 2GOXB 1IAWA 1WWXA 2DA5A 3ZQHA 2Q0OA 4BQNA 5FD5A 5HLTA 2QSFX 5CVVA 1YW8A 1LEAA 2UUZA 4WXCA 2V79A 5ICEA 4NQWA 2DTRA 3SEQA 2V7FA 3DEUA 3HEFA 2HTSA 2LYCA 4Y13A 1N77A 4FISA 2DO7A 2W25A 2HQRA 3DF8A 4YELA 2XGDA 1E17A 5LEKA 1ETYA 1SFEA 1X1AA 3PIOF 3G1LA 4KIFA 1BOBA 3JW4A 3R61A 4OIOF 3J7YJ 4XRSA 3RPUA 3WTYC 4LFUA 3CC4I 1W36C 3MVPA 1K4TA 4HSRA 2BBYA 2XAQA 1K4SA 1TWHJ 3EETA 2AO9A 2MC3A 3M1CA 1ERDA 2LC2A 2RDPA 4EVIA 1MBFA 3FXUA 1GUUA 4I7HA 1U9OA 2D1HA 2M34A 1RPWA 4HV6A 3ZP5A 1X1DA 4RAFA 3I54A 4BEHB 4U0WA 3WE2A 4R8HA 3FBNB 3GW2A 3DBLB 4I02A 1X4PA 3B6CA 1HSJA 1YOVB 3ZN0A 1X3ZB 1AWCA 4H0EA 2O3FA 3OYFA 3FIWA 3PM1A 3VYUB 3ZOBA 4Y15A 3HKZA 2HPIA 2LDUA 2BVMA 1B8IB 2R7DA 2NS0A 2Y0MA 4IOAF 4BH9A 4P9FA 3H92A 1Y56A 4FX0A 3OOUA 1BN5A 4CDGA 2QKMB 4CA0A 1TNSA 4XQFA 5J1RA 1VQLI 1D1BA 2KIUA 3BZCA 2ETHA 2K86A 3DTKA 5L3FA 1T56A 2P0WA 3J80K 1XSDA 4BNCA 1S72I 3K1MA 3TGNA 4G7OF 1BA5A 2K9LA 3OR2C 2VXDA 1D0ZA 3TEDA 3BY6A 1FX7A 1WJCA 5FKLA 4OOIA 5IYBJ 1YX3A 2LBFA 1LVKA 2Y69H 1RIOH 2FBKA 2H94A 3M1EA 1KQ9A 2WAQA 3GTGJ 2TCTA 1JUSA 2WA0A 3H0DA 1HLVA 4IF4A 4QWQA 1FOYA 2OTJI 5JVTA 2RQQA 2XRNA 2X1DA 1W7PB 5E1XA 2MFZA 3CCJI 4KA4A 2G9WA 2K5CA 3BJ6A 4ZTJA 1KA8A 2Y75A 4BQQA 5LHGA 2LKXA 1Z7UA 2V1NA 1G4DA 3ASNH 2Z1DA 2QKLB 4AWXB 2KLOA 3HM5A 4B09A 4I98B 3GEZA 2EV5A 2CMPA 4RS8A 2A05A 1HXDA 3RYRA 2DA1A 3CMYA 2NS8A 3P9IA 4ESBA 3FXJA 5TISC 2COBA 4ESFA 1TC3C 2QM3A 3BG6A 4CICA 1SFXA 1TLHB 2KZGA 1GLNA 1MGTA 3NAUA 2DFHA 2DA2A 3O6BB 4HLXA 3LA2A 2IS2A 3IH2A 4B1RA 4E7HA 3G1MA 3UKGA 5LFAA 4MNUA 4XLCA 3T8TA 1ETXA 4U7DA 2NVUB 3OL3A 3KP7A 3JSPA 4CYCA 1V3FA 2PQ8A 3DLAA 2CQQA 3MFKA 1X1CA 3C7JA 2HKOA 3GF2A 1IZ1A 1WGXA 4WXDA 1ETWA 3FXMA 2STTA 1XGSA 2G7UA 4XRSG 2CS3A 4XBFA 1WCMJ 3DBRB 4X1EA 2E1MC 2WAFA 3MQ0A 2ZO4A 2BW3A 2OTLI 2I10A 5JLXA 4ENJA 1VQKI 4A3BJ 2IS1A 4UUVA 1WPKA 5D6EA 4IVNA 2QWWA 2JK3A 3JRDA 4M6XA 2Q2EB 1TQPA 4A0YA 2M7AA 1XMXA 1H88C 3HDDA 3L2CA 5IT9Z 3H3VK 3KP5A 1ENHA 2ELHA 3DPLC 4FE7A 3CTAA 1ETKA 3BJOA 3ROUA 2HDDA 3GUDA 4LLGF 4QLCU 1RNLA 4HQMA 2M8GX 5J3LA 3ESWB 4ZZLA 3V8KA 2R5YB 2M8EA 4M6YA 1GHCA 1KYWA 2DFIA 3FMQA 1Y6IA 4U7BA 1VF9A 2F5EA 2VKVA 2VL8A 4NB5A 4JOMA 1HC8A 4XLFA 2QGUA 2IA1A 2H1LA 4F92B 1A31A 3K4MA 4DIQA 3CC7I 1OJLA 4M3FA 2VBZA 2W82A 4UVBA 4EV0A 5H6RA 1Y1VJ 3HPHA 5H20A 3BCBA 2ID3A 5JLWA 1P2FA 4A2UA 2JVHA 4HBLA 1KGSA 1J0RA 4D5FA 2M3AA 1GV2A 2VI6A 2HOSA 4GGGA 4EGYA 3FISA 3S2DJ 4OIPF 4MIMA 5CVJA 3A01A 3PFYA 4Q48A 3IUOA 2GAUA 4IXAA 2OPTA 2EJRA 3PO3J 2L7FP 3WTVC 2NNYA 2LY9A 3B73A 2XKOA 4C2UA 2F5CA 3ML6A 3WHBA 4B3AA 2VONA 3D1NI 1LE8B 5K5RA 3EYIA 1DGRM 3KP6A 1GDTA 5BPIA 2ZNYA 1X19A 3JSOA 1UMQA 1GXPA 4PGHA 3VFZA 4EJVA 5FFXA 1S7OA 3AL0B 4NBQA 1MSFC 3V8JA 2JWTA 1FMWA 1SFOJ 2ISZA 1K6YA 3CO6C 2IVMA 1BOAA 3ABLH 3IL2A 1W0TA 2FA5A 2KL4A 3LFKA 2E1MB 2YR2A 2CSOA 3GVAA 4HF0A 2DT5A 5CJ9A 2H27A 3PL8A 3ULQB 1RC9A 2DK5A 5D4SA 3OYCA 4XSXF 1F9NA 1YJNI 4CHUA 3I71A 2EA4A 1BI2A 3FK7A 1YLFA 1LB2A 4FETA 4MEXF 1YHQI 2M0MA 5LD2C 3H5NA 3KZYA 2K9NA 2ZMEB 1XG1A 4RGSA 4PSXA 3HOTA 1XCVA 1S7EA 2FBIA 2JA2A 2RAEA 4LIUA 3BR1A 3E3VA 2ESNA 4W97A 3T0YA 5C4JJ 3KETA 1R4NB 5LHIA 3ABMH 3CO7C 4HZFA 2M4KA 3AKZA 4KNYA 2AQFA 1S8NA 3JAMZ 3OV8A 2Y30A 2EFPA 3CMEI 1O3SA 4IHSA 4NC8A 3GBGA 2ZCWA 4BHPA 2FNPA 2VQCA 3BOQA 4W1UA 4CCMA 2VOOA 1ZG1A 4A0ZA 2ZSHB 3MN2A 4OAZA 1OLTA 2CV0A 2A07F 4GYGA 2XV4S 4WK8F 1SMTA 2DAOA 2L2OA 3RCOA 2V1UA 3NRVA 4LLNA 1OCRH 2VBXA 4CXFA 2CW7A 3CLOA 1FMVA 4WCGA 5BMZA 1VQNI 4B4CA 2QSGX 3EUAA 5EYRA 1IRGA 1BBYA 3FWEA 2Y31A 4X6AJ 5GP9A 2W57A 3GMEA 1R4MB 2ICWG 3RPQA 2GZWA 3X2QH 5L3EA 2L54A 3RZDJ 5K7HA 3MKWB 1EKEA 1EV7A 4EJWA 3J81K 1WJFA 2MD5A 4XKWA 1MJ9A 1A6IA 3VOEA 2CGPA 4O5VA 3KX2A 2JJ7A 3DLLF 1X2NA 1EH6A 4YIFA 2VT3A 2WADA 3TKYA 2STWA 3JRGA 3E0JB 2ZJPF 1Z7LA 2AQEA 2VKDA 2VT2A 1WVRA 2B9SA 3VWBA 4LB6B 5HODA 5DCMA 2WTEA 2PBIA 5EEAA 3JTHA 5ILSA 3W6JB 4YFXF 1FIAA 1YG2A 2LRDA 2O7OA 2VIXA 3CZ6A 2V4JC 3HRMA 5HDGA 1IN4A 1BR1A 1IXCA 1Y0NA 4Q47A 3ZMUA 4AM3A 4C2TA 2IW5A 1HSTA 3E1SA 3L2VA 2DFFA 4E7KA 3VB2A 1KQ8A 2XKPA 2CG4A 2HDWA 4XNFA 1VZ0A 3BDDA 3GFIA 4G6TB 1MMDA 2ZXJA 1UZCA 1WI9A 3QPSA 2MYSA 3SDGA 5FLXK 5HDNA 5E8IA 1VFCA 2L4MA 2BHZA 3MZYA 2L4AA 4CCJA 4M9ZA 4EJOA 1G3SA 1FYKA 4DYRA 2OU2A 3DEWA 2FOKA 1B72A 1OMIA 1VQ5I 5M5WJ 3C18A 1OCTC 2YPRA 4BQAA 3ZMZA 2GBYA 1T33A 3M7GA 3C2GA 3QU6A 1KU7A 4A3MJ 1YRNA 1FSEA 2PJRB 3OY9A 2DJIA 2EFOA 2CFOA 4I99C 3W2VA 1CF7B 5EG0A 2F6CA 3DTEA 1SAXA 3LQRA 1QHHD 1D5VA 4F52A 3HZJA 3O2PE 1AU7A 2BY3A 2GWRA 1TNTA 2JVGA 3TO6A 4EATA 1BL0A 1MBJA 1WQ2A 2E1OA 5TJJA 1QA6A 4XLEA 2EV6A 3KZZA 1I1SA 3K6GA 2Y9ZA 1QHGA 4XKVA 3IRQA 1UHSA 4XN0A 2O8KA 4A3LJ 1FP2A 2A61A 1F1ZA 2CV1A 4UVAA 5DUIA 2IEKA 1MD0A 4IHTA 1XTAA 2P6TA 2VOPA 1MSEC 1OQYA 3CF2A 3FXLA 2CJJA 1D0XA 4BS9A 3K4CA 4B3XA 4BDYA 2V1XA 1HW1A 3CP8A 3BP8A 1OYIA 4P96A 4J19A 3O8GA 5E3MA 3KLOA 1D8KA 1POGA 4MTEA 1ZELA 3OYMA 2MG4A 5F64A 3C2BA 2FMYA 2RGVA 2CU7A 4L9VA 1TL8A 1UB9A 1G6NA 3QYBA 3G4SI 1BIBA 2HQNA 4MHGA 2G0EA 3TMOA 2E2IJ 1MBGA 2K9SA 2BXZA 2NAZA 3RKXA 2Y2ZA 5LGTA 1VQOI 1QBJA 1WFXA 1ZHFA 1P92A 1YW7A 2DDBA 4B8XA 1I5ZA 1LFUP 1W7PD 5GTHC 1ZK8A 1S5LC 5J1YA 4DW6A 2CV2A 3OYNA 3HSRA 3OYHA 4WX9A 1HQCA 3ECHA 2VODA 3L2QA 4PGGA 3R0JA 3PUFA 1EH8A 2E5NA 4RB3C 2PEXA 2R7SA 4HX7A 3RDIA 1J9IA 3E6MA 2QBYA 1W5TA 1KYZA 2KT0A 1NK2P 1FTZA 5DD8A 2QYOA 3QOEA 2XAJA 4A3EJ 4S04A 1Z3XA 5GAEJ 2GA1A 2Z99A 3HOUJ 1PUEE 2M30A 1QVUA 3S17J 2XB5A 1EA3A 1IXSB 1LPQA 3F3XA 2IPQX 1MNMC 3K69A 3FDYA 4F93B 4M9SA 1JT6A 2PJPA 3JREA 5KK1A 3CUQA 2QENA 3NARA 2X6OA 1V55H 1B9MA 1K79A 2OQGA 5DEQA 1WJAA 3BTJA 3S2HJ 1FOXA 1E3PA 5LBQA 4PCQA 4ZDLA 5GTIC 2DA6A 2YSRA 1B4AA 2Y48A 2X85A 1T8IA 1IRZA 2RKHA 3DQVC 2IGOA 4XSZF 2LG4A 5GPCA 2DYSH 2HI3A 1PYVA 2O0YA 4BKXA 1JXSA 4KMFA 1Z6RA 1YW9A 2EPFA 3FBIB 2EZKA 2HR3A 3GFJA 5LRSA 3CUOA 5HS9A 1IN6A 4CO8A 5HLIA 3ZGKA 2HVQA 4JK1X 4A3KJ 3LFUA 4QSHA 1FT9A 1E3HA 3DBHB 2ZXWH 4PSWA 1YIOA 3Q3SA 1K7AA 2HZDA 1P4XA 3HGGA 2F2EA 1QPIA 4IRIA 2VE8A 4BDZA 1VQMI 5D5XB 1BI3A 2KZVA 4II3A 1G8XA 2GIZA 3Q9VA 1JUMA 2QZ8A 1W4MA 5F04A 2PMHA 1HDPA 3ZQ7A 4U88A 5D6FA 2EIJH 3IP4B 1MKMA 4XOPA 4B43A 1ACIA 3I3LA 4LOCA 2M2EA 2YS9A 3QYFA 2UV1A 4I0BA 1ZGWA 2KJBA 4HV5A 2DOFA 2HFHA 3SQNA 1ZR4A 4G6DA 4LD5A 5F08A 2IRFG 1FNNA 4KISA 1IUYA 4G94A 3WTUC 3K4BA 2ZKZA 3JR9A 5F0FA 3VEPA 3ZXSA 4HRIA 3S16J 1X58A 1OR7A 3I9V2 3VYSB 2MH9A 4GYIA 3ZMVA 1ZGJA 4XMYA 5LGUA 1BC8C 2E7WA 2GOMA 4DZPA 3GTKJ 3MZ8A 2NOGA 5IYDJ 3S1NJ 2WWYA 1YI2I 2Z9OA 3ERMA 3U2RA 1LFBA 4ZDPA 5HNHA 1Z9CA 1LDKB 4BJ5C 1U0JA 3ZQCA 2DXIA 2XB0X 4YIIA 4C3IJ 4M73A 1X3WB 2RC4A 4IX7A 1JHFA 2GA2A 3H0GJ 2GXBA 4MGRA 1U9NA 2WV0A 1LDDA 2XASA 4KICA 4JX4A 3BCAA 4O3MA 2HXOA 3GFMA 4PJLA 1YE9A 4AYBA 4F55A 3OYJA 4L9JA 4IJAA 5A2QK 4ZDOA 2FMLA 1YS7A 3LAJA 3K2ZA 3K70D 5KAIC 1KQ0A 1CQTA 5J47A 3OIQA 3CQZJ 2PMZN 2E7XA 3I53A 4CCOA 2KMUA 3IKVA 2XSJC 3ZN1A 3DXJF 4UUSB 5FKOA 4HYEA 1ZN2A 1WI3A 4HPQA 1HBXG 2OC6A 5HNFA 3BQZA 3O3KA 1TQMA 3S3NA 2IGMA 2O9LA 4ZC3A 2DMNA 1TWAJ 4E7ZA 3HXLA 2MD0A 1F36A 2ESHA 5EJCA 3CF5F 3K1NA 3RZOJ 5F1RA 4CH7A 2CW0F 3HOYJ 3E6BA 3KYLA 3WTXC 3LAPA 4OINF 5ERIA 4X0GA 2FXAA 2YU9J 2HVRA 4RMNA 2V6CA 3KEQA 1YJ9I 3HPGA 5CQEA 3DKXA 1YFHA 4A3IJ 3IKTA 5K5OA 2HOTA 2DK8A 2DOEA 3J7ZI 3FXOA 2DMUA 2PN6A 2MGQA 1QVTA 4BY7J 3WE3A 3E5QA 3H36A 2DMTA 4HF1A 1ZRCA 3QPHA 1R58A 1QQIA 4G7HF 1NK3P 2OQRA 2W84A 3HRSA 2MH2A 4V2FA 5K5QA 2DBBA 2FJ1A 1DUXC 1I50J 5J1UA 3V7RA 4PJ0C 4RB0A 4XN3A 1BR4A 2QUFA 5FRMA 3MEXA 3IH4A 2W48A 4DYCA 2EFQA 5EDNA 2F5FA 4BEHA 1IO2A 1XD7A 3BTIA 1F4KA 3DKWA 5FKKA 3I4MJ 4PJJA 5CPRB 2P7VB 3TP3A 2ZBKA 1PP8F 1PUFB 1K78B 1SD4A 2R7VA 3HG9A 5DV5A 1UAAA 4PFOA 3OS1A 2HZTA 2YUSA 4N0BA 4RLQA 3I4NJ 3KYDB 3ASOH 3ECOA 1HOMA 2DMPA 1B8IA 1WH5A 4GRIA 3E7LA 3ABUA 4L9TA 3TP0A 2XVCA 1RRJA 3RKWA 3BG9A 4XLAA 4E7IA 5ILVA 4ZJZA 2R4GA 2VBWA 4Y33A 2JUGA 1L0OC 3GCMA 3OYEA 2KDZA 3JRFA 1O3TA 2MC4A 2K4BA 4G12A 2XRLA 4E70A 1I3QJ 2ZC2A 1YX5A 2FX0A 2CUFA 4C3HJ 5HVQC 4S05A 2UZKA 2WY8Q 4AIKA 4CGZA 1WJDA 1VQ4I 1T6SA 3QAHA 3A1YA 2CUZA 1D5YA 1W7PA 3F8BA 4A6DA 5HS7A 2LLKA 2HOEA 2QQBA 2JUCA 1PP7U 2XAGA 2D5VA 4MFEA 2BEOA 5TGTA 3WTTC 3AL0C 2XC7A 1MW7A 3GTJJ 2E2JJ 4BU2A 2KP6A 3OYIA 1EH7A 1RETA 2FBHA 3F8NA 4OMYA 2JSPA 1RUNA 3K70C 2OAZA 4EQQA 1HA8A 2JMWA 3A03A 2EWNA 1R00A 2WBMA 1XX5A 3T8RA 3P7NA 1ZRDA 3HYIA 1SEUA 1SFKA 2F4MB 1UHMA 4AU7A 3BG7A 3TDUC 3FKJA 1T98A 1PJRA 5J8CA 2EINH 2ZMEC 1M1EB 1R22A 2BVLA 3GXOA 1U8BA 1VQ7I 3OMYA 2LTPA 2IGKA 5L3DA 3AG4H 4GCVA 4BHCA 1HKSA 1ODDA 2M5WA 4FT8A 3SDBA 9ANTA 1Z05A 2R92J 3F6VA 5FFZA 4CCNA 1BJAA 2CQKA 2EFNA 1G2HA 3LSHA 4BHBA 1I3AA 5F27A 4CYDA 2DJNA 4ZTFA 4RAZA 5IT3A 4A69C 1DQUA 2VBYA 3J7AO 2LOOA 3JTGA 4CUGA 4ZYGA 2AS5F 2A5YB 5J4VA 3ZQGA 3W6KB 2LP0A 1P4WA 3B6AA 3D5SC 1JTXA 2HXIA 3M8EA 2XGCA 1RUOA 1QZZA 2Q2EA 2HWVA 4M3GA 5DDGA 4Q4ZF 3QODA 1OFCX 4LMYA 2BYVE 5EF6A 3PSIA 2VASA 2XF6A 4P5OA 3SZGA 2KRFA 4ABZA 3MCZA 1HCRA 1XSVA 2VC1A 4CCKA 1P4AA 2RNJA 1A36A 2QF7A 4BY1J 1Z0XA 2ZXHA 3BZKA 3MKYB 2ELKA 2M45A 1PVEA 1IRFA 1HF0A 3IHUA 2BGCA 2K85A 2R5YA 1NH3A 2VC0A 2JA8J 4DNCA 2R5ZB 1A35A 2N8GA 5BOXA 2IA2A 3QRFF 1IDYA 1TWGJ 2DI3A 2KISA 2XPWA 4XRFA 4BGDA 4BJ6C 3S3MA 3HSFA 3OWTA 3GZ6A 1RESA 2VQLA 3WU2C 4P9UA 5IOZA 1HW5A 4D9JA 2KHMA 3KYCB 2BZTA 4Q5SF 4UY8I 3O8HA 3HOZJ 2IXSA 2UXXA 4L18B 3HBLA 2B0LA 2ELJA 4ZYHA 3I59B 2R7FA 4GXOA 2K4JA 1MDMB 3GZNB 3ISPA 2DW4A 1OPCA 3WU1B 4XICA 5K7FA 3H3UA 1DPRA 3CJRB 4R1HA 3IRRA 2DU9A 4BAYA 3UR3C 1B1BA 5E1WA 1LE8A 2PLYA 1TT5B 3HHHA 2CO5A 1MNDA 4EJTA 1XSXA 2E1NA 5F0HA 1LEBA 1T39A 1S3JA 2X51A 1IGNA 1VQ9I 3WGIA 1R7JA 2X9DA 3AG3H 1SD5A 4AVZA 1H9TA 2WB1N 1HKTA 1TP4A 4A3CJ 3H5RA 2EK5A 5CLSA 1ZLJA 3BROA 1Q1VA 2PMUA 1MMGA 3TOAA 1X3UA 4G6QA 5H6QA 1AKHB 1K6OA 2LMDA 4CCLA 3EUHC 2DODA 3S1QJ 4JYKA 3H9QA 4IOCF 4A3GJ 1XMAA 2TRTA 2ZMEA 3A0BC 1R36A 4MQ9F 2LKPA 3OYAA 1XC5A 3GTPJ 5L3CA 2IP2A 2MLGA 2I8DA 1G3TA 2JT1A 5FROA 1FY7A 1ZAOA 2DQLA 4DGWB 3K0LA 5AONA 2MBFA 4IO9F 1OKRA 2L9VA 2L0KA 4A3JJ 3JCUC 1L3LA 5D5UB 4N9IA 2V9VA 2HYJA 2VQHA 3OIOA 4MEYF 2CYYA 1S29A 1X4OA 3QOPA 1GT0C 1MBEA 2P4WA 2R7QA 4G7ZF 2ZJ2A 2GIVA 4KITB 3U9GA 1DDNA 3LWFA 1U78A 5C44J 3PO2J 4C2MJ 3DKYA 1R5ID 3QYEA 1JKRC 1DP7P 1XDSA 3EPZA 4KUMA 3S1MJ 2A5WA 2KKOA 3HOSA 3KPHA 4C9YA 3E97A 3LSIA 5KCMA 5IT9K 3V7CA 3WGHA 3E5XA 3ONQA 4J00A 5B66C 3OR1C 5D4RA 2ZFWA 3CDHA 3V8LA 2NOJB 2DPDA 2RQPA 4H4KC 4KFCA 4HNVA 2PX9A 5C3EJ 2FRHA 4Y3OA 2Z3YA 2R3SA 2JA6J 1P6RA 2P5VA 3RPUD 4DBRA 3W6VA 2V1DA 2H09A 5DTDA 1R6RA 1UG2A 2Q8KA 2FQ3A 4XK4A 2X48A 1U5TB 2XIGA 2X4HA 2F4OB 3L2UA 1LJ9A 3RQIA 1Y1WJ 1IN5A 3S8PA 2EZIA 3BQYA 2CUEA 3GX4X 4UB8C 2KRCA 4II2A 2VJ4A 1IV8A 2K7LA 4LG0B 4UXNA 1FP1D 4ETSA 3JRIA 1EJ9A 2OF7A 3LA7A 4Z6YA 1FPQA 2HTJA 3C1DA 1JKQC 2I5UA 4B47A 2GLOA 4XR6A 3MD2A 1R1VA 4NC6A 1ZRFA 4LJZF 3HIFA 4B44A 2C6YA 5CYVA 4RA2A 2LD5A 4A0XA 4XRMA 4HLYA 2DDAA 3BR3A 4JBAA 2M4GA 2R7ZJ 3SEZA 2MW8A 1TWCJ 1U6GA 3HUGB 3TL4X 3BR2A 4Z2YA 1VTNC 2HPMA 5CQGA 1JE8A 4BYYA 5M5YJ 2XF7A 3LSKA 2V26A 3TOBA 1I1GA 2K9QA 4L5EA 2HS5A 1FOWA 3QPTA 2J5PA 5JI6A 2R0QC 1JGGA 3H35A 2IS6A 3WTSC 2FSWA 3TW7A 3ZRGA 1ULYA 4A3FJ 3F72A 4FCYA 2L5QA 2R7RA 3HKZN 1GV5A 1Y0UA 1ORKA 2PJRA 1CF7A 1Z67A 2JRTA 4PUSA 1ZGAA 4IPAA 4E7SA 4M3DA 2F48A 4EM2A 3B02A 1X1PA 1SC7A 5JHUA 3RYPA 4BQOA 2HQ5A 1ZLKA 4J01A 4LITA 2ECBA 1XN7A 4JP0A 1OCCH 1O7FA 3G71I 4HA8A 1TT0A 4UV9A 1ZG5A 3T5XA 1V4RA 4R79A 2DPUA 1QZEA 3NWSA 4L0ZB 1FJLA 2WAQN 2OV7A 2LR8A 2X1EA 3FHZA 3JAMK 1V5EA 3HRTA 2VXZA 1U2WA 2VB6A 4D0PA 2NYXA 2NRAC 2B63J 1YO5C 3BT9A 2NVXJ 1GVDA 3AG2H 1DGWY 2V6EA 1DU0A 3VDXA 4M74A 4ZH4F 3OIPA 1Y39A 1D1CA 2JPBA 3K4LA 5B1AH 4YRVA 4U87A 1RR7A 2XAFA 2E5ZA 2FUG2 2BOLA 2NVQJ 1TW3A 3R4KA 3RSNA 2AXTC 3M3YJ 2K3FA 2X6XA 3QPLA 3R60A 3SHFA 1MNEA 3S1RJ 1J75A 5KHDA 5LEJA 1T38A 4L0YB 5M3FJ 2ME0A 2K40A 1SAUA 1KU3A 3GTLJ 2F4IA 1ZREA 3ZCOA 5E3LA 4C3JJ 1N78A 2L01A 4XOTA 2NS7A 2XUBA 3A02A 3SJMA 3CCSI 3EDPA 1B9NA 2LKSA 1KONA 2P8TA 2CQXA 1JTYA 3F9KA 1TTYA 2IBDA 2PG4A 3G2BA 3ZQIA 4WF2A 1E3OC 2DA7A 1CGPA 1K83J 2K02A 3DWLE 3J80Z 4KN4X 3HTSB 1O4XA 1WRJA 2VJ5A 4KT6A 3DEEA 2DOAA 5EGOB 1PDNC 4BJTA 5M3MJ 1D3YA 3GO5A 1VQ8I 1RI7A 2JN6A 3VSLA 3A4CA 2FOWA 2OCCH 1MMAA 1LVAA 2O5RA 4JX5A 5TRDA 1LDJA 1T0FC 3IAS2 3CCMI 4XL9A 4ENNA 2XROA
chains in the Genus database with same CATH topology
4KMUX 5ILUA 2OA4A 4N9HA 3WGGA 1HKQA 4I09A 4EM0B 2MA3A 4RGRA 2JZYA 5BPDA 2P7CB 5L3GA 1SMYF 5DUKA 3R6SA 3E5UA 5F6FA 5KVRA 4JQFA 2AXLA 3PQJA 2KIFA 3N4MA 1ZH5A 3BPVA 2M1BA 2PFBA 3LSTA 1USSA 2EFWA 3KP2A 1QPMA 5E20A 4AVPA 1FLIA 3WG9A 3FMSA 2OBPA 2LF8A 3G3ZA 3I5UA 4ASNA 3Q9SA 4KT5C 2OZUA 3RJPA 2A6EF 1MJAA 4LB5A 4BXUA 3P9CA 3ELKA 4TV7A 3RTRA 2X0LA 3V7SA 4HF2A 1XGMA 5LLQA 4XLPF 4UHTA 3WTWC 3FXRA 2UWMA 2QVOA 4YG2F 4KIGA 1RZ4A 2DLLA 1LNWA 1ZYRF 1NHAA 3ZMTA 1I27A 3BPXA 3ZMDA 3KFWX 1J2XA 2EA2A 1H9GA 1S7AA 1FZPB 1O7LA 1Q1HA 1H0MA 1FSHA 4MTDA 4ON0A 4EM1A 2CWEA 3S2WA 3U1DA 3E6CC 2FE3A 1B6AA 2ISYA 2W85A 2QQ9A 3EYYA 1S6LA 4L5JA 4OU0A 2HYFA 3D5LA 1T0FA 5EEHA 4M71A 2FF4A 1J5YA 3LQQA 4ZZDA 4FX4A 3TDZC 2P5KA 2VE9A 5ICGA 2D2WA 1ONVA 4RGXA 2O8XA 3REOA 2BE5F 3AAFA 2OD5A 4IRGA 1W5SA 4O6JA 2F5DA 1XGOA 4FHTA 5HDKA 1Z1DA 2XGXA 1A04A 3G73A 5BS6A 1BI0A 1UCRA 2EV0A 3F6OA 1I6XA 1K78A 5HS8A 1R23A 2WC2A 1MZBA 2E1CA 4HW0A 2L02A 3L00A 3VODA 1FBSA 4K2EA 4HDUA 1IN7A 2IA0A 1XCBA 5JR3A 2A69F 3PFIA 1FYLA 4NHJA 3L7WA 1GVJA 3J81Z 1KU9A 1U3EM 1SD6A 3HRUA 4HAMA 4U0YA 3F21A 2COMA 2L3DA 2W24A 2YU3A 1JHHA 4DQ2A 4OIQF 3PQKA 4RAYA 4LLLA 5J8FA 4L9NA 1FYMA 5E8GA 5DCFA 2K27A 2LNBA 1YYVA 4HOBA 5DD4A 3E6DA 3ZMSA 2RVCA 3GZ5A 1OYWA 3BWGA 3MWMA 4EJUA 3GWZA 5FLXZ 5D5WB 1SFUA 4YFNF 2O6GE 2DQRA 3SZPA 3GFLA 2Z5UA 1GXQA 3I4PA 1FOKA 2PI0A 1SD7A 2LF7A 3DV8A 3N97A 4M72A 1JGSA 1BI1A 3MAJA 4A6EA 3I64A 2TDXA 1BIAA 4A5NA 4ESJA 1YQAA 5D8LB 3K1PA 6PAXA 5ICFA 1YTYA 5AIQA 3KEOA 1AOYA 3IC7A 1QO0D 2JPCA 4CZZA 4GO1A 4I2OA 2D45A 1R1UA 3KP3A 2Z33A 4G8XA 1QGPA 4MQVA 3RIRA 1KU2A 1U5TC 4HX4A 1ZG3A 2FU4A 1FBUA 2KIMA 4L5IA 2GXGA 4ZYDA 4PDKA 1YS6A 3QP6A 2BV6A 3LA3A 4AD9A 1BM9A 3WU0A 2HGCA 4HQEA 1LQ1A 4IRHA 5LHHA 2A6HF 2VN2A 1XB4A 4KN7X 4AIHA 3I59A 1FC3A 3NEUA 1MDMA 3M9AA 4OIRF 4A5MA 3MZHA 4ENMA 5DCMB 5E18F 1Z91A 4UNOA 3F8MA 3WTZA 2HEOA 3TQNA 3F8CA 4UV8A 5L3BA 1IXRC 2ACJA 4OMZA 3FM3A 2YX7A 1T2KA 3BZ6A 2ZNZA 3EQLF 3F8FA 1G3WA 4RB1A 2KJCA 2IT0A 2G7HA 4ENKA 3IWFA 3NQOA 1R5GA 3KCCA 5BQTA 3ERED 3CUQC 1R5HA 1XMKA 3K9TA 3TO9A 1MJBA 2A3SA 5E17F 2HDCA 4LGWA 2MLKA 1TQIA 4RB2C 2IJLA 2P6SA 2EB7A 1F5TA 2HYGD 3CJNA 3KLNA 2XHKA 1TW2A 4XLNF 3F23A 4P55A 4YFKF 3P9KA 2LSOA 1HW2A 3FM5A 1D8JA 3WODF 5FGMA 1BC7C 1U5TA 3R0AA 2H6CA 1STZA 2JSCA 4EGZA 1IN8A 2FNAA 4HDVA 3DFGA 2A68F 5HOOA 2OZ6A 4PZJA 2CFXA 2FEZA 4AIJA 4KIBA 4LG0A 1IF1A 1ON1A 1G3YA 2P5LC 1QZYA 2JTVA 2GQQA 5JFRA 2HKXA 1UFMA 4RGUA 2QBYB 3HUGA 3EUHA 3TO7A 1XDUA 2O61A 5CVIA 5HLGA 5A2QZ 3FX3A 5K1YA 3I58A 4Y17A 1ON2A 1E2XA 3HTUA 5D8KB 3M8FA 4G9YA 5E1ZB 5LRRA 1USTA 3CUQB 3IWZA 3V4GA 5FD6A 3OOPA 3L09A 4U0VA 5D5VB 1XGNA 1O3QA 5J6XA 1TBXA 1O3RA 1J59A 3RI4A 1REPC 3KP4A 4UVCA 5LGNA 1QNTA 3ZPLA 3C3WA 4I0AA 5AIPA 1IW7F 3BJAA 3L9FA 5FO5A 5HLHA 3FMRA 5FB2A 1WKMA 4A12A 3QP5A 1FWZA 3ABTA 2QQAA 1UHWA 3I0TA 1WSUA 4HX8A 1B59A 1ZARA 1OYYA 2YX4A 1Z6TA 1J7KA 3D0SA 5CVRA 5CVUA 3SXYA 3RKYA 4WWCA 4LK0F 2RN7A 3DP7A 4I01A 4F7ZA 3FF5A 3H3ZA 2RV8A 4LK1F 5ICCA 1U8RA 3GLXA 2D1VA 4KYWA 2O03A 1FBQA 3KE2A 3F22A 3COAC 4KDPA 3Q5FA 4WXHA 3DPTA 3HSEA 2M87A 3SZTA 2QLZA 1R1TA 1O57A 5DYMA 3QU3A 3SFZA 4ZYEA 2J5OA 4M9XA 3GYHX 5EEGA 2ADUA 3T1BA 2UXNA 3HHGA 1C0WA 2NNNA 3FXQA 5ED4A 2XAHA 3FZVA 1DPUA 2H6BA 4EMSA 1IAWA 1WWXA 2Q0OA 5FD5A 5CVVA 1YW8A 1LEAA 4WXCA 2V79A 5ICEA 4NQWA 2DTRA 3DEUA 2HTSA 4Y13A 2DO7A 2W25A 2HQRA 3DF8A 1E17A 5LEKA 1SFEA 4KIFA 3JW4A 3R61A 4OIOF 3RPUA 3WTYC 4LFUA 2BBYA 2XAQA 3EETA 2MC3A 2RDPA 4EVIA 3FXUA 4I7HA 2D1HA 3ZP5A 4HV6A 3I54A 4U0WA 3WE2A 4R8HA 3GW2A 4I02A 3ZN0A 1HSJA 1AWCA 4H0EA 2O3FA 4Y15A 2LDUA 2R7DA 2NS0A 2Y0MA 4BH9A 4P9FA 3H92A 4FX0A 1BN5A 4CDGA 1TNSA 2KIUA 2ETHA 2K86A 5L3FA 1XSDA 3J80K 4BNCA 3K1MA 3TGNA 4G7OF 3BY6A 1FX7A 4OOIA 1RIOH 2FBKA 2H94A 3M1EA 1KQ9A 4IF4A 4QWQA 5JVTA 2XRNA 1W7PB 5E1XA 4KA4A 2G9WA 3BJ6A 1KA8A 2Y75A 5LHGA 1Z7UA 1G4DA 4AWXB 4B09A 4I98B 3GEZA 2EV5A 4RS8A 1HXDA 3RYRA 4ESBA 3P9IA 4ESFA 2QM3A 4CICA 1SFXA 1TLHB 1MGTA 3O6BB 4HLXA 3LA2A 4MNUA 3T8TA 4U7DA 3KP7A 3JSPA 1V3FA 2PQ8A 3MFKA 3C7JA 2HKOA 3GF2A 1IZ1A 4WXDA 2STTA 1XGSA 2G7UA 4XBFA 3MQ0A 2ZO4A 4ENJA 4UUVA 5D6EA 4IVNA 2QWWA 4M6XA 4A0YA 1TQPA 3L2CA 5IT9Z 3KP5A 2ELHA 3DPLC 3CTAA 3BJOA 3ROUA 3GUDA 4LLGF 4QLCU 1RNLA 4HQMA 4ZZLA 3V8KA 2M8EA 4M6YA 1GHCA 1KYWA 2DFIA 3FMQA 4U7BA 2F5EA 4NB5A 2IA1A 4UVBA 4EV0A 2VBZA 5H6RA 5H20A 1P2FA 4A2UA 4HBLA 1KGSA 1J0RA 4GGGA 4EGYA 4OIPF 5CVJA 4Q48A 2GAUA 4IXAA 2EJRA 3WTVC 2NNYA 3B73A 2XKOA 2F5CA 3ML6A 2VONA 5K5RA 3EYIA 3KP6A 5BPIA 2ZNYA 3JSOA 1GXPA 4PGHA 3VFZA 4EJVA 5FFXA 1S7OA 3V8JA 2ISZA 3CO6C 2IVMA 1BOAA 3IL2A 2FA5A 3LFKA 2YR2A 2CSOA 3GVAA 4HF0A 2DT5A 5CJ9A 2H27A 3ULQB 2DK5A 5D4SA 4XSXF 1F9NA 4CHUA 3I71A 2EA4A 1BI2A 1YLFA 1LB2A 4MEXF 3KZYA 2ZMEB 4RGSA 3HOTA 1XCVA 2FBIA 3E3VA 2ESNA 3T0YA 3KETA 5LHIA 3CO7C 4HZFA 4KNYA 1S8NA 3JAMZ 3OV8A 1O3SA 2EFPA 4IHSA 2ZCWA 4BHPA 2FNPA 3BOQA 2VOOA 1ZG1A 4A0ZA 2A07F 4GYGA 2XV4S 4WK8F 1SMTA 2DAOA 2V1UA 4LLNA 3NRVA 2VBXA 4CXFA 3CLOA 4WCGA 5BMZA 1IRGA 1BBYA 3FWEA 2W57A 3RPQA 2GZWA 5L3EA 2L54A 1EV7A 4EJWA 3J81K 2MD5A 1MJ9A 3VOEA 2CGPA 4O5VA 1EH6A 4YIFA 2VT3A 3TKYA 2STWA 2VT2A 4LB6B 5DCMA 2WTEA 2PBIA 3JTHA 5ILSA 3W6JB 4YFXF 1YG2A 3HRMA 5HDGA 1IN4A 3ZMUA 1IXCA 4Q47A 2IW5A 1HSTA 3VB2A 1KQ8A 2XKPA 2CG4A 3BDDA 3GFIA 2ZXJA 1WI9A 5FLXK 5HDNA 5E8IA 2L4MA 3MZYA 2L4AA 4M9ZA 4EJOA 1G3SA 1FYKA 2OU2A 2FOKA 1OMIA 3C18A 2YPRA 4BQAA 3ZMZA 3M7GA 3QU6A 1KU7A 1FSEA 2EFOA 1CF7B 1SAXA 1D5VA 3LQRA 3O2PE 2GWRA 1TNTA 3TO6A 1WQ2A 5TJJA 2EV6A 3KZZA 1I1SA 3IRQA 1FP2A 2A61A 1F1ZA 4UVAA 5DUIA 1MD0A 4IHTA 2P6TA 2VOPA 2V1XA 1HW1A 4P96A 3BP8A 1OYIA 3KLOA 1D8KA 4MTEA 5F64A 2FMYA 2RGVA 4L9VA 1UB9A 1G6NA 1BIBA 2HQNA 4MHGA 2NAZA 3RKXA 5LGTA 1QBJA 1ZHFA 1P92A 1YW7A 4B8XA 1I5ZA 1W7PD 4KFCA 3HSRA 4WX9A 1HQCA 3ECHA 2VODA 4PGGA 3R0JA 1EH8A 4RB3C 2PEXA 4HX7A 3RDIA 1J9IA 3E6MA 2QBYA 1W5TA 1KYZA 5DD8A 2QYOA 2XAJA 4S04A 2GA1A 2Z99A 1PUEE 2M30A 1IXSB 3F3XA 2IPQX 3K69A 4M9SA 2PJPA 5KK1A 3CUQA 2QENA 1K79A 1B9MA 2OQGA 5DEQA 5LBQA 4PCQA 2YSRA 1B4AA 2Y48A 2RKHA 3DQVC 4XSZF 2O0YA 1JXSA 4KMFA 1Z6RA 1YW9A 2HR3A 3GFJA 5LRSA 3CUOA 5HS9A 1IN6A 4CO8A 5HLIA 4JK1X 1FT9A 1YIOA 1K7AA 1P4XA 2F2EA 4IRIA 2VE8A 5D5XB 1BI3A 3Q9VA 2QZ8A 1W4MA 2PMHA 3ZQ7A 4U88A 5D6FA 1MKMA 4I0BA 2KJBA 4HV5A 2HFHA 3SQNA 4G6DA 4LD5A 2IRFG 1FNNA 1IUYA 4G94A 3WTUC 2ZKZA 3VEPA 1OR7A 3ZMVA 2MH9A 4GYIA 1ZGJA 5LGUA 1BC8C 2E7WA 2WWYA 2Z9OA 3U2RA 1Z9CA 1LDKB 4YIIA 4M73A 2RC4A 1JHFA 2GA2A 2GXBA 4MGRA 2WV0A 1LDDA 2XASA 4KICA 4O3MA 3GFMA 4L9JA 4IJAA 5A2QK 2FMLA 1YS7A 3LAJA 3K2ZA 1KQ0A 2E7XA 3I53A 3IKVA 3ZN1A 3DXJF 4HYEA 1ZN2A 1HBXG 3O3KA 1TQMA 2ESHA 3K1NA 5F1RA 2CW0F 3E6BA 3WTXC 3LAPA 4OINF 5ERIA 2FXAA 2V6CA 3KEQA 1YFHA 3IKTA 5K5OA 2DK8A 2PN6A 3WE3A 3E5QA 4HF1A 1ZRCA 3QPHA 1R58A 1QQIA 4G7HF 2OQRA 2W84A 3HRSA 2MH2A 5K5QA 2DBBA 1DUXC 3V7RA 4RB0A 2QUFA 3MEXA 2EFQA 2F5FA 1XD7A 1F4KA 3DKWA 2P7VB 2ZBKA 1PP8F 1K78B 1SD4A 5DV5A 2HZTA 4N0BA 3ECOA 3ABUA 4L9TA 2XVCA 3RKWA 5ILVA 2VBWA 1L0OC 1O3TA 2K4BA 4E70A 5HVQC 4S05A 2UZKA 4AIKA 4CGZA 1T6SA 3QAHA 1W7PA 3F8BA 4A6DA 5HS7A 2HOEA 2QQBA 1PP7U 2XAGA 2BEOA 3WTTC 1EH7A 2FBHA 3F8NA 4OMYA 1RUNA 2OAZA 4EQQA 2EWNA 1R00A 3T8RA 3P7NA 1ZRDA 3HYIA 1UHMA 3TDUC 1T98A 5J8CA 1R22A 3GXOA 5L3DA 4GCVA 4BHCA 1HKSA 1ODDA 2M5WA 4FT8A 1Z05A 3F6VA 5FFZA 1BJAA 2CQKA 2EFNA 4BHBA 4CYDA 4RAZA 5IT3A 2VBYA 3J7AO 3JTGA 4ZYGA 2AS5F 2A5YB 3W6KB 1P4WA 3M8EA 1RUOA 1QZZA 2Q2EA 2HWVA 5DDGA 4Q4ZF 4LMYA 2BYVE 4P5OA 2KRFA 3MCZA 1XSVA 2VC1A 1P4AA 2RNJA 2M45A 1IRFA 3IHUA 2BGCA 2VC0A 4DNCA 5BOXA 2IA2A 3QRFF 2DI3A 4XRFA 3HSFA 3GZ6A 4P9UA 1HW5A 4Q5SF 2UXXA 4L18B 2B0LA 4ZYHA 3I59B 2R7FA 4GXOA 2K4JA 1MDMB 3ISPA 2DW4A 1OPCA 3WU1B 3H3UA 1DPRA 4R1HA 3IRRA 2DU9A 4BAYA 1B1BA 5E1WA 2PLYA 3HHHA 2CO5A 4EJTA 1XSXA 2E1NA 1LEBA 1T39A 1S3JA 3WGIA 1R7JA 1SD5A 1H9TA 1HKTA 5CLSA 2EK5A 1ZLJA 3BROA 2PMUA 3TOAA 1X3UA 4G6QA 5H6QA 1K6OA 1XMAA 2ZMEA 1R36A 4MQ9F 2LKPA 5L3CA 2IP2A 2MLGA 1G3TA 2JT1A 1FY7A 1ZAOA 2DQLA 3K0LA 5AONA 2MBFA 1OKRA 1L3LA 5D5UB 4N9IA 2V9VA 4MEYF 2CYYA 1S29A 3QOPA 2P4WA 4G7ZF 2ZJ2A 2GIVA 1DDNA 3U9GA 3LWFA 1U78A 1DP7P 1XDSA 4KUMA 2KKOA 3HOSA 3E97A 5IT9K 3V7CA 3WGHA 3E5XA 5D4RA 2ZFWA 3CDHA 3V8LA 2DPDA 2RQPA 2FRHA 2Z3YA 2R3SA 1P6RA 2P5VA 2V1DA 2H09A 2Q8KA 2FQ3A 1U5TB 2XIGA 2X4HA 1LJ9A 1IN5A 3GX4X 2K7LA 4LG0B 4UXNA 1FP1D 4ETSA 3LA7A 1FPQA 2HTJA 3C1DA 1R1VA 1ZRFA 4LJZF 3HIFA 2C6YA 5CYVA 4A0XA 4HLYA 4JBAA 1U6GA 4Z2YA 1VTNC 1JE8A 4BYYA 3TOBA 1I1GA 2HS5A 3QPTA 2J5PA 5JI6A 3WTSC 2FSWA 1ULYA 3F72A 1Y0UA 1CF7A 2JRTA 1ZGAA 4IPAA 4EM2A 3B02A 5JHUA 3RYPA 1ZLKA 1XN7A 1O7FA 4HA8A 4UV9A 1ZG5A 3T5XA 1V4RA 4R79A 2DPUA 4L0ZB 3FHZA 3JAMK 3HRTA 2VXZA 1U2WA 4D0PA 2NYXA 2NRAC 1YO5C 4M74A 4ZH4F 2JPBA 2XAFA 1TW3A 3R4KA 3R60A 3SHFA 1J75A 1T38A 5LEJA 4L0YB 1KU3A 1ZREA 2L01A 2XUBA 3EDPA 1B9NA 2P8TA 1TTYA 2PG4A 4WF2A 1CGPA 2K02A 3J80Z 4KN4X 3HTSB 1WRJA 1PDNC 1D3YA 3GO5A 1RI7A 1LVAA 5TRDA 1LDJA 4ENNA 2XROA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4KMU X;  5ILU A;  2OA4 A;  4N9H A;  3WGG A;  1HKQ A;  4I09 A;  4EM0 B;  2MA3 A;  4RGR A;  2JZY A;  5BPD A;  2P7C B;  5L3G A;  1SMY F;  5DUK A;  3R6S A;  3E5U A;  5F6F A;  5KVR A;  4JQF A;  2AXL A;  3PQJ A;  2KIF A;  3N4M A;  1ZH5 A;  3BPV A;  2M1B A;  2PFB A;  3LST A;  1USS A;  2EFW A;  3KP2 A;  1QPM A;  5E20 A;  4AVP A;  1FLI A;  3WG9 A;  3FMS A;  2OBP A;  2LF8 A;  3G3Z A;  3I5U A;  4ASN A;  3Q9S A;  4KT5 C;  2OZU A;  3RJP A;  2A6E F;  1MJA A;  4LB5 A;  4BXU A;  3P9C A;  3ELK A;  4TV7 A;  3RTR A;  2X0L A;  3V7S A;  4HF2 A;  1XGM A;  5LLQ A;  4XLP F;  4UHT A;  3WTW C;  3FXR A;  2UWM A;  2QVO A;  4YG2 F;  4KIG A;  1RZ4 A;  2DLL A;  1LNW A;  1ZYR F;  1NHA A;  3ZMT A;  1I27 A;  3BPX A;  3ZMD A;  3KFW X;  1J2X A;  2EA2 A;  1H9G A;  1S7A A;  1FZP B;  1O7L A;  1Q1H A;  1H0M A;  1FSH A;  4MTD A;  4ON0 A;  4EM1 A;  2CWE A;  3S2W A;  3U1D A;  3E6C C;  2FE3 A;  1B6A A;  2ISY A;  2W85 A;  2QQ9 A;  3EYY A;  1S6L A;  4L5J A;  4OU0 A;  2HYF A;  3D5L A;  1T0F A;  5EEH A;  4M71 A;  2FF4 A;  1J5Y A;  3LQQ A;  4ZZD A;  4FX4 A;  3TDZ C;  2P5K A;  2VE9 A;  5ICG A;  2D2W A;  1ONV A;  4RGX A;  2O8X A;  3REO A;  2BE5 F;  3AAF A;  2OD5 A;  4IRG A;  1W5S A;  4O6J A;  2F5D A;  1XGO A;  4FHT A;  5HDK A;  1Z1D A;  2XGX A;  1A04 A;  3G73 A;  5BS6 A;  1BI0 A;  1UCR A;  2EV0 A;  3F6O A;  1I6X A;  1K78 A;  5HS8 A;  1R23 A;  2WC2 A;  1MZB A;  2E1C A;  4HW0 A;  2L02 A;  3L00 A;  3VOD A;  1FBS A;  4K2E A;  4HDU A;  1IN7 A;  2IA0 A;  1XCB A;  5JR3 A;  2A69 F;  3PFI A;  1FYL A;  4NHJ A;  3L7W A;  1GVJ A;  3J81 Z;  1KU9 A;  1U3E M;  1SD6 A;  3HRU A;  4HAM A;  4U0Y A;  3F21 A;  2COM A;  2L3D A;  2W24 A;  2YU3 A;  1JHH A;  4DQ2 A;  4OIQ F;  3PQK A;  4RAY A;  4LLL A;  5J8F A;  4L9N A;  1FYM A;  5E8G A;  5DCF A;  2K27 A;  2LNB A;  1YYV A;  4HOB A;  5DD4 A;  3E6D A;  3ZMS A;  2RVC A;  3GZ5 A;  1OYW A;  3BWG A;  3MWM A;  4EJU A;  3GWZ A;  5FLX Z;  5D5W B;  1SFU A;  4YFN F;  2O6G E;  2DQR A;  3SZP A;  3GFL A;  2Z5U A;  1GXQ A;  3I4P A;  1FOK A;  2PI0 A;  1SD7 A;  2LF7 A;  3DV8 A;  3N97 A;  4M72 A;  1JGS A;  1BI1 A;  3MAJ A;  4A6E A;  3I64 A;  2TDX A;  1BIA A;  4A5N A;  4ESJ A;  1YQA A;  5D8L B;  3K1P A;  6PAX A;  5ICF A;  1YTY A;  5AIQ A;  3KEO A;  1AOY A;  3IC7 A;  1QO0 D;  2JPC A;  4CZZ A;  4GO1 A;  4I2O A;  2D45 A;  1R1U A;  3KP3 A;  2Z33 A;  4G8X A;  1QGP A;  4MQV A;  3RIR A;  1KU2 A;  1U5T C;  4HX4 A;  1ZG3 A;  2FU4 A;  1FBU A;  2KIM A;  4L5I A;  2GXG A;  4ZYD A;  4PDK A;  1YS6 A;  3QP6 A;  2BV6 A;  3LA3 A;  4AD9 A;  1BM9 A;  3WU0 A;  2HGC A;  4HQE A;  1LQ1 A;  4IRH A;  5LHH A;  2A6H F;  2VN2 A;  1XB4 A;  4KN7 X;  4AIH A;  3I59 A;  1FC3 A;  3NEU A;  1MDM A;  3M9A A;  4OIR F;  4A5M A;  3MZH A;  4ENM A;  5DCM B;  5E18 F;  1Z91 A;  4UNO A;  3F8M A;  3WTZ A;  2HEO A;  3TQN A;  3F8C A;  4UV8 A;  5L3B A;  1IXR C;  2ACJ A;  4OMZ A;  3FM3 A;  2YX7 A;  1T2K A;  3BZ6 A;  2ZNZ A;  3EQL F;  3F8F A;  1G3W A;  4RB1 A;  2KJC A;  2IT0 A;  2G7H A;  4ENK A;  3IWF A;  3NQO A;  1R5G A;  3KCC A;  5BQT A;  3ERE D;  3CUQ C;  1R5H A;  1XMK A;  3K9T A;  3TO9 A;  1MJB A;  2A3S A;  5E17 F;  2HDC A;  4LGW A;  2MLK A;  1TQI A;  4RB2 C;  2IJL A;  2P6S A;  2EB7 A;  1F5T A;  2HYG D;  3CJN A;  3KLN A;  2XHK A;  1TW2 A;  4XLN F;  3F23 A;  4P55 A;  4YFK F;  3P9K A;  2LSO A;  1HW2 A;  3FM5 A;  1D8J A;  3WOD F;  5FGM A;  1BC7 C;  1U5T A;  3R0A A;  2H6C A;  1STZ A;  2JSC A;  4EGZ A;  1IN8 A;  2FNA A;  4HDV A;  3DFG A;  2A68 F;  5HOO A;  2OZ6 A;  4PZJ A;  2CFX A;  2FEZ A;  4AIJ A;  4KIB A;  4LG0 A;  1IF1 A;  1ON1 A;  1G3Y A;  2P5L C;  1QZY A;  2JTV A;  2GQQ A;  5JFR A;  2HKX A;  1UFM A;  4RGU A;  2QBY B;  3HUG A;  3EUH A;  3TO7 A;  1XDU A;  2O61 A;  5CVI A;  5HLG A;  5A2Q Z;  3FX3 A;  5K1Y A;  3I58 A;  4Y17 A;  1ON2 A;  1E2X A;  3HTU A;  5D8K B;  3M8F A;  4G9Y A;  5E1Z B;  5LRR A;  1UST A;  3CUQ B;  3IWZ A;  3V4G A;  5FD6 A;  3OOP A;  3L09 A;  4U0V A;  5D5V B;  1XGN A;  1O3Q A;  5J6X A;  1TBX A;  1O3R A;  1J59 A;  3RI4 A;  1REP C;  3KP4 A;  4UVC A;  5LGN A;  1QNT A;  3ZPL A;  3C3W A;  4I0A A;  5AIP A;  1IW7 F;  3BJA A;  3L9F A;  5FO5 A;  5HLH A;  3FMR A;  5FB2 A;  1WKM A;  4A12 A;  3QP5 A;  1FWZ A;  3ABT A;  2QQA A;  1UHW A;  3I0T A;  1WSU A;  4HX8 A;  1B59 A;  1ZAR A;  1OYY A;  2YX4 A;  1Z6T A;  1J7K A;  3D0S A;  5CVR A;  5CVU A;  3SXY A;  3RKY A;  4WWC A;  4LK0 F;  2RN7 A;  3DP7 A;  4I01 A;  4F7Z A;  3FF5 A;  3H3Z A;  2RV8 A;  4LK1 F;  5ICC A;  1U8R A;  3GLX A;  2D1V A;  4KYW A;  2O03 A;  1FBQ A;  3KE2 A;  3F22 A;  3COA C;  4KDP A;  3Q5F A;  4WXH A;  3DPT A;  3HSE A;  2M87 A;  3SZT A;  2QLZ A;  1R1T A;  1O57 A;  5DYM A;  3QU3 A;  3SFZ A;  4ZYE A;  2J5O A;  4M9X A;  3GYH X;  5EEG A;  2ADU A;  3T1B A;  2UXN A;  3HHG A;  1C0W A;  2NNN A;  3FXQ A;  5ED4 A;  2XAH A;  3FZV A;  1DPU A;  2H6B A;  4EMS A;  1IAW A;  1WWX A;  2Q0O A;  5FD5 A;  5CVV A;  1YW8 A;  1LEA A;  4WXC A;  2V79 A;  5ICE A;  4NQW A;  2DTR A;  3DEU A;  2HTS A;  4Y13 A;  2DO7 A;  2W25 A;  2HQR A;  3DF8 A;  1E17 A;  5LEK A;  1SFE A;  4KIF A;  3JW4 A;  3R61 A;  4OIO F;  3RPU A;  3WTY C;  4LFU A;  2BBY A;  2XAQ A;  3EET A;  2MC3 A;  2RDP A;  4EVI A;  3FXU A;  4I7H A;  2D1H A;  3ZP5 A;  4HV6 A;  3I54 A;  4U0W A;  3WE2 A;  4R8H A;  3GW2 A;  4I02 A;  3ZN0 A;  1HSJ A;  1AWC A;  4H0E A;  2O3F A;  4Y15 A;  2LDU A;  2R7D A;  2NS0 A;  2Y0M A;  4BH9 A;  4P9F A;  3H92 A;  4FX0 A;  1BN5 A;  4CDG A;  1TNS A;  2KIU A;  2ETH A;  2K86 A;  5L3F A;  1XSD A;  3J80 K;  4BNC A;  3K1M A;  3TGN A;  4G7O F;  3BY6 A;  1FX7 A;  4OOI A;  1RIO H;  2FBK A;  2H94 A;  3M1E A;  1KQ9 A;  4IF4 A;  4QWQ A;  5JVT A;  2XRN A;  1W7P B;  5E1X A;  4KA4 A;  2G9W A;  3BJ6 A;  1KA8 A;  2Y75 A;  5LHG A;  1Z7U A;  1G4D A;  4AWX B;  4B09 A;  4I98 B;  3GEZ A;  2EV5 A;  4RS8 A;  1HXD A;  3RYR A;  4ESB A;  3P9I A;  4ESF A;  2QM3 A;  4CIC A;  1SFX A;  1TLH B;  1MGT A;  3O6B B;  4HLX A;  3LA2 A;  4MNU A;  3T8T A;  4U7D A;  3KP7 A;  3JSP A;  1V3F A;  2PQ8 A;  3MFK A;  3C7J A;  2HKO A;  3GF2 A;  1IZ1 A;  4WXD A;  2STT A;  1XGS A;  2G7U A;  4XBF A;  3MQ0 A;  2ZO4 A;  4ENJ A;  4UUV A;  5D6E A;  4IVN A;  2QWW A;  4M6X A;  4A0Y A;  1TQP A;  3L2C A;  5IT9 Z;  3KP5 A;  2ELH A;  3DPL C;  3CTA A;  3BJO A;  3ROU A;  3GUD A;  4LLG F;  4QLC U;  1RNL A;  4HQM A;  4ZZL A;  3V8K A;  2M8E A;  4M6Y A;  1GHC A;  1KYW A;  2DFI A;  3FMQ A;  4U7B A;  2F5E A;  4NB5 A;  2IA1 A;  4UVB A;  4EV0 A;  2VBZ A;  5H6R A;  5H20 A;  1P2F A;  4A2U A;  4HBL A;  1KGS A;  1J0R A;  4GGG A;  4EGY A;  4OIP F;  5CVJ A;  4Q48 A;  2GAU A;  4IXA A;  2EJR A;  3WTV C;  2NNY A;  3B73 A;  2XKO A;  2F5C A;  3ML6 A;  2VON A;  5K5R A;  3EYI A;  3KP6 A;  5BPI A;  2ZNY A;  3JSO A;  1GXP A;  4PGH A;  3VFZ A;  4EJV A;  5FFX A;  1S7O A;  3V8J A;  2ISZ A;  3CO6 C;  2IVM A;  1BOA A;  3IL2 A;  2FA5 A;  3LFK A;  2YR2 A;  2CSO A;  3GVA A;  4HF0 A;  2DT5 A;  5CJ9 A;  2H27 A;  3ULQ B;  2DK5 A;  5D4S A;  4XSX F;  1F9N A;  4CHU A;  3I71 A;  2EA4 A;  1BI2 A;  1YLF A;  1LB2 A;  4MEX F;  3KZY A;  2ZME B;  4RGS A;  3HOT A;  1XCV A;  2FBI A;  3E3V A;  2ESN A;  3T0Y A;  3KET A;  5LHI A;  3CO7 C;  4HZF A;  4KNY A;  1S8N A;  3JAM Z;  3OV8 A;  1O3S A;  2EFP A;  4IHS A;  2ZCW A;  4BHP A;  2FNP A;  3BOQ A;  2VOO A;  1ZG1 A;  4A0Z A;  2A07 F;  4GYG A;  2XV4 S;  4WK8 F;  1SMT A;  2DAO A;  2V1U A;  4LLN A;  3NRV A;  2VBX A;  4CXF A;  3CLO A;  4WCG A;  5BMZ A;  1IRG A;  1BBY A;  3FWE A;  2W57 A;  3RPQ A;  2GZW A;  5L3E A;  2L54 A;  1EV7 A;  4EJW A;  3J81 K;  2MD5 A;  1MJ9 A;  3VOE A;  2CGP A;  4O5V A;  1EH6 A;  4YIF A;  2VT3 A;  3TKY A;  2STW A;  2VT2 A;  4LB6 B;  5DCM A;  2WTE A;  2PBI A;  3JTH A;  5ILS A;  3W6J B;  4YFX F;  1YG2 A;  3HRM A;  5HDG A;  1IN4 A;  3ZMU A;  1IXC A;  4Q47 A;  2IW5 A;  1HST A;  3VB2 A;  1KQ8 A;  2XKP A;  2CG4 A;  3BDD A;  3GFI A;  2ZXJ A;  1WI9 A;  5FLX K;  5HDN A;  5E8I A;  2L4M A;  3MZY A;  2L4A A;  4M9Z A;  4EJO A;  1G3S A;  1FYK A;  2OU2 A;  2FOK A;  1OMI A;  3C18 A;  2YPR A;  4BQA A;  3ZMZ A;  3M7G A;  3QU6 A;  1KU7 A;  1FSE A;  2EFO A;  1CF7 B;  1SAX A;  1D5V A;  3LQR A;  3O2P E;  2GWR A;  1TNT A;  3TO6 A;  1WQ2 A;  5TJJ A;  2EV6 A;  3KZZ A;  1I1S A;  3IRQ A;  1FP2 A;  2A61 A;  1F1Z A;  4UVA A;  5DUI A;  1MD0 A;  4IHT A;  2P6T A;  2VOP A;  2V1X A;  1HW1 A;  4P96 A;  3BP8 A;  1OYI A;  3KLO A;  1D8K A;  4MTE A;  5F64 A;  2FMY A;  2RGV A;  4L9V A;  1UB9 A;  1G6N A;  1BIB A;  2HQN A;  4MHG A;  2NAZ A;  3RKX A;  5LGT A;  1QBJ A;  1ZHF A;  1P92 A;  1YW7 A;  4B8X A;  1I5Z A;  1W7P D;  4KFC A;  3HSR A;  4WX9 A;  1HQC A;  3ECH A;  2VOD A;  4PGG A;  3R0J A;  1EH8 A;  4RB3 C;  2PEX A;  4HX7 A;  3RDI A;  1J9I A;  3E6M A;  2QBY A;  1W5T A;  1KYZ A;  5DD8 A;  2QYO A;  2XAJ A;  4S04 A;  2GA1 A;  2Z99 A;  1PUE E;  2M30 A;  1IXS B;  3F3X A;  2IPQ X;  3K69 A;  4M9S A;  2PJP A;  5KK1 A;  3CUQ A;  2QEN A;  1K79 A;  1B9M A;  2OQG A;  5DEQ A;  5LBQ A;  4PCQ A;  2YSR A;  1B4A A;  2Y48 A;  2RKH A;  3DQV C;  4XSZ F;  2O0Y A;  1JXS A;  4KMF A;  1Z6R A;  1YW9 A;  2HR3 A;  3GFJ A;  5LRS A;  3CUO A;  5HS9 A;  1IN6 A;  4CO8 A;  5HLI A;  4JK1 X;  1FT9 A;  1YIO A;  1K7A A;  1P4X A;  2F2E A;  4IRI A;  2VE8 A;  5D5X B;  1BI3 A;  3Q9V A;  2QZ8 A;  1W4M A;  2PMH A;  3ZQ7 A;  4U88 A;  5D6F A;  1MKM A;  4I0B A;  2KJB A;  4HV5 A;  2HFH A;  3SQN A;  4G6D A;  4LD5 A;  2IRF G;  1FNN A;  1IUY A;  4G94 A;  3WTU C;  2ZKZ A;  3VEP A;  1OR7 A;  3ZMV A;  2MH9 A;  4GYI A;  1ZGJ A;  5LGU A;  1BC8 C;  2E7W A;  2WWY A;  2Z9O A;  3U2R A;  1Z9C A;  1LDK B;  4YII A;  4M73 A;  2RC4 A;  1JHF A;  2GA2 A;  2GXB A;  4MGR A;  2WV0 A;  1LDD A;  2XAS A;  4KIC A;  4O3M A;  3GFM A;  4L9J A;  4IJA A;  5A2Q K;  2FML A;  1YS7 A;  3LAJ A;  3K2Z A;  1KQ0 A;  2E7X A;  3I53 A;  3IKV A;  3ZN1 A;  3DXJ F;  4HYE A;  1ZN2 A;  1HBX G;  3O3K A;  1TQM A;  2ESH A;  3K1N A;  5F1R A;  2CW0 F;  3E6B A;  3WTX C;  3LAP A;  4OIN F;  5ERI A;  2FXA A;  2V6C A;  3KEQ A;  1YFH A;  3IKT A;  5K5O A;  2DK8 A;  2PN6 A;  3WE3 A;  3E5Q A;  4HF1 A;  1ZRC A;  3QPH A;  1R58 A;  1QQI A;  4G7H F;  2OQR A;  2W84 A;  3HRS A;  2MH2 A;  5K5Q A;  2DBB A;  1DUX C;  3V7R A;  4RB0 A;  2QUF A;  3MEX A;  2EFQ A;  2F5F A;  1XD7 A;  1F4K A;  3DKW A;  2P7V B;  2ZBK A;  1PP8 F;  1K78 B;  1SD4 A;  5DV5 A;  2HZT A;  4N0B A;  3ECO A;  3ABU A;  4L9T A;  2XVC A;  3RKW A;  5ILV A;  2VBW A;  1L0O C;  1O3T A;  2K4B A;  4E70 A;  5HVQ C;  4S05 A;  2UZK A;  4AIK A;  4CGZ A;  1T6S A;  3QAH A;  1W7P A;  3F8B A;  4A6D A;  5HS7 A;  2HOE A;  2QQB A;  1PP7 U;  2XAG A;  2BEO A;  3WTT C;  1EH7 A;  2FBH A;  3F8N A;  4OMY A;  1RUN A;  2OAZ A;  4EQQ A;  2EWN A;  1R00 A;  3T8R A;  3P7N A;  1ZRD A;  3HYI A;  1UHM A;  3TDU C;  1T98 A;  5J8C A;  1R22 A;  3GXO A;  5L3D A;  4GCV A;  4BHC A;  1HKS A;  1ODD A;  2M5W A;  4FT8 A;  1Z05 A;  3F6V A;  5FFZ A;  1BJA A;  2CQK A;  2EFN A;  4BHB A;  4CYD A;  4RAZ A;  5IT3 A;  2VBY A;  3J7A O;  3JTG A;  4ZYG A;  2AS5 F;  2A5Y B;  3W6K B;  1P4W A;  3M8E A;  1RUO A;  1QZZ A;  2Q2E A;  2HWV A;  5DDG A;  4Q4Z F;  4LMY A;  2BYV E;  4P5O A;  2KRF A;  3MCZ A;  1XSV A;  2VC1 A;  1P4A A;  2RNJ A;  2M45 A;  1IRF A;  3IHU A;  2BGC A;  2VC0 A;  4DNC A;  5BOX A;  2IA2 A;  3QRF F;  2DI3 A;  4XRF A;  3HSF A;  3GZ6 A;  4P9U A;  1HW5 A;  4Q5S F;  2UXX A;  4L18 B;  2B0L A;  4ZYH A;  3I59 B;  2R7F A;  4GXO A;  2K4J A;  1MDM B;  3ISP A;  2DW4 A;  1OPC A;  3WU1 B;  3H3U A;  1DPR A;  4R1H A;  3IRR A;  2DU9 A;  4BAY A;  1B1B A;  5E1W A;  2PLY A;  3HHH A;  2CO5 A;  4EJT A;  1XSX A;  2E1N A;  1LEB A;  1T39 A;  1S3J A;  3WGI A;  1R7J A;  1SD5 A;  1H9T A;  1HKT A;  5CLS A;  2EK5 A;  1ZLJ A;  3BRO A;  2PMU A;  3TOA A;  1X3U A;  4G6Q A;  5H6Q A;  1K6O A;  1XMA A;  2ZME A;  1R36 A;  4MQ9 F;  2LKP A;  5L3C A;  2IP2 A;  2MLG A;  1G3T A;  2JT1 A;  1FY7 A;  1ZAO A;  2DQL A;  3K0L A;  5AON A;  2MBF A;  1OKR A;  1L3L A;  5D5U B;  4N9I A;  2V9V A;  4MEY F;  2CYY A;  1S29 A;  3QOP A;  2P4W A;  4G7Z F;  2ZJ2 A;  2GIV A;  1DDN A;  3U9G A;  3LWF A;  1U78 A;  1DP7 P;  1XDS A;  4KUM A;  2KKO A;  3HOS A;  3E97 A;  5IT9 K;  3V7C A;  3WGH A;  3E5X A;  5D4R A;  2ZFW A;  3CDH A;  3V8L A;  2DPD A;  2RQP A;  2FRH A;  2Z3Y A;  2R3S A;  1P6R A;  2P5V A;  2V1D A;  2H09 A;  2Q8K A;  2FQ3 A;  1U5T B;  2XIG A;  2X4H A;  1LJ9 A;  1IN5 A;  3GX4 X;  2K7L A;  4LG0 B;  4UXN A;  1FP1 D;  4ETS A;  3LA7 A;  1FPQ A;  2HTJ A;  3C1D A;  1R1V A;  1ZRF A;  4LJZ F;  3HIF A;  2C6Y A;  5CYV A;  4A0X A;  4HLY A;  4JBA A;  1U6G A;  4Z2Y A;  1VTN C;  1JE8 A;  4BYY A;  3TOB A;  1I1G A;  2HS5 A;  3QPT A;  2J5P A;  5JI6 A;  3WTS C;  2FSW A;  1ULY A;  3F72 A;  1Y0U A;  1CF7 A;  2JRT A;  1ZGA A;  4IPA A;  4EM2 A;  3B02 A;  5JHU A;  3RYP A;  1ZLK A;  1XN7 A;  1O7F A;  4HA8 A;  4UV9 A;  1ZG5 A;  3T5X A;  1V4R A;  4R79 A;  2DPU A;  4L0Z B;  3FHZ A;  3JAM K;  3HRT A;  2VXZ A;  1U2W A;  4D0P A;  2NYX A;  2NRA C;  1YO5 C;  4M74 A;  4ZH4 F;  2JPB A;  2XAF A;  1TW3 A;  3R4K A;  3R60 A;  3SHF A;  1J75 A;  1T38 A;  5LEJ A;  4L0Y B;  1KU3 A;  1ZRE A;  2L01 A;  2XUB A;  3EDP A;  1B9N A;  2P8T A;  1TTY A;  2PG4 A;  4WF2 A;  1CGP A;  2K02 A;  3J80 Z;  4KN4 X;  3HTS B;  1WRJ A;  1PDN C;  1D3Y A;  3GO5 A;  1RI7 A;  1LVA A;  5TRD A;  1LDJ A;  4ENN A;  2XRO A; 
#chains in the Genus database with same CATH topology
 4KMU X;  5ILU A;  1V5G A;  2OA4 A;  4N9H A;  3WGG A;  1HKQ A;  2LFB A;  3BR5 A;  4I09 A;  4EM0 B;  2MA3 A;  3M8J A;  2CQ7 A;  4RGR A;  5B1B H;  2JZY A;  2WAE A;  5BPD A;  2VLA A;  4QPQ A;  2P7C B;  3VYR B;  5L3G A;  1SMY F;  5DUK A;  4BXX J;  3R6S A;  4PJN A;  3U1K A;  3E5U A;  3LNQ A;  5F6F A;  1YJW I;  5KVR A;  4BBR J;  4AUX A;  4JQF A;  1VI0 A;  5J4Y A;  5EZG A;  2AXL A;  3PQJ A;  2KIF A;  4RDU A;  3N4M A;  4IKF A;  3HOV J;  3LSM A;  1ZH5 A;  3BPV A;  2M1B A;  2PFB A;  4NQW B;  1NG7 A;  4C30 A;  3LST A;  1G59 A;  2E60 A;  2VKE A;  2EH3 A;  4QIW N;  1USS A;  2EFW A;  3KP2 A;  3W3C A;  1QPM A;  5E20 A;  3H9J A;  4AVP A;  1FLI A;  3WG9 A;  3FMS A;  5GAH J;  2BY1 A;  2OBP A;  2XPV A;  5JHF A;  2XSD C;  4XOR A;  2R7X A;  2LF8 A;  3G3Z A;  3I5U A;  4ASN A;  3Q9S A;  4D1Q A;  2QEX I;  3BTC A;  2OZU A;  4KT5 C;  4HNT A;  3RJP A;  4AC0 A;  2A6E F;  4N4O B;  1MJA A;  4LB5 A;  3UNG C;  3G1O A;  4BXU A;  3P9C A;  3ELK A;  4TV7 A;  3RTR A;  1D1A A;  2X0L A;  3V7S A;  4HF2 A;  3Q0U A;  5KAF C;  4AID A;  3IAM 2;  2OJE D;  4PFP A;  1XGM A;  1BW5 A;  3CJT B;  5LLQ A;  1EF4 A;  2XAU A;  4XLP F;  5B5E C;  1H89 C;  5KNL A;  3BR0 A;  4BUP A;  1P7J A;  4UHT A;  3RQ4 A;  4FAS D;  3WTW C;  3FXR A;  2UWM A;  2QVO A;  4YG2 F;  5H2F C;  4KIG A;  1RZ4 A;  1X2M A;  2DLL A;  1LNW A;  1ZYR F;  1NHA A;  2LY2 A;  4V2G A;  1DU6 A;  3ZMT A;  1IJW C;  2R93 J;  1I27 A;  3BPX A;  3ZMD A;  3I56 I;  4QTR A;  2ZJQ F;  3KFW X;  3MMY B;  3L2W A;  1J2X A;  2EA2 A;  2Y0S N;  4M6V A;  1H9G A;  3CC2 I;  1S7A A;  1FZP B;  1BR2 A;  1O7L A;  1Q1H A;  3VSK A;  1H0M A;  2ZSI B;  1W1W E;  3M07 A;  1FSH A;  3JRC A;  2LBF B;  4UUS A;  4MTD A;  2QA4 I;  3BLY A;  4IQJ A;  3PSF A;  2HVS A;  4ON0 A;  4EM1 A;  2CWE A;  2BY0 A;  3S2W A;  3U1D A;  4UUT A;  3E6C C;  2HU9 A;  2FE3 A;  3H5A A;  1OCO H;  3VPR A;  1B6A A;  2ISY A;  3WHC A;  1UEL B;  2W85 A;  2QQ9 A;  2B7E A;  1I6H J;  3EYY A;  3CMM A;  1S6L A;  2W00 A;  4L5J A;  4OU0 A;  3MKZ A;  2HYF A;  3D5L A;  1S9H A;  2A6T A;  1FEX A;  1NG6 A;  1T0F A;  3OYG A;  3HOX J;  5EEH A;  4M71 A;  2FF4 A;  2W4S A;  1E0E A;  1J5Y A;  3LQQ A;  2RRE A;  4DBQ A;  4ZZD A;  4FX4 A;  5IP9 J;  5GAG J;  5IY5 H;  3TDZ C;  2OCE A;  2P5K A;  3FXK A;  2VE9 A;  5ICG A;  1WZ2 A;  2D2W A;  1FIP A;  1Z77 A;  1ONV A;  3HJE A;  4RGX A;  2O8X A;  3REO A;  2BE5 F;  1P9Q C;  3Q0V A;  1OCP A;  3AAF A;  2OD5 A;  3IH3 A;  1MMN A;  2VKH A;  1W5S A;  4IRG A;  4D7M A;  3QWL A;  2E2H J;  4O6J A;  2F5D A;  2NVT J;  1XGO A;  4FHT A;  1SVO A;  5HDK A;  1I39 A;  1Z1D A;  4ANJ A;  2XGX A;  4A93 J;  1A04 A;  4NDL A;  3G73 A;  3FHN A;  2DT7 B;  5BS6 A;  4LIV A;  4CYC B;  2L9R A;  2L7K A;  3FKI J;  3OYD A;  2H1K A;  4XKC A;  3I55 I;  2E36 A;  1BI0 A;  1UCR A;  2DN0 A;  1P7I A;  4V19 K;  2EV0 A;  3EUK L;  3F6O A;  1I6X A;  1PUF A;  1K78 A;  1Y8R B;  1LFP A;  2CQN A;  5HS8 A;  1R23 A;  1MH4 A;  2WC2 A;  1VQP I;  3TW6 A;  2KDO A;  2BW3 B;  1RKW A;  1MZB A;  2QSH X;  1HDD C;  2E1C A;  3OL4 A;  4HW0 A;  3GLL A;  2L02 A;  3L00 A;  3VOD A;  1FBS A;  4K2E A;  4HDU A;  2H8W A;  1IN7 A;  4ZYA A;  2IA0 A;  3A2K A;  1XCB A;  5JR3 A;  2A69 F;  4XKB A;  3TBI A;  3PFI A;  1AHD P;  1FYL A;  4NHJ A;  3L7W A;  2NXN B;  1R49 A;  2EIK H;  4FE4 A;  2W7N A;  1GVJ A;  3J81 Z;  1KU9 A;  1U3E M;  1SD6 A;  3HRU A;  4HAM A;  4D7N A;  4U0Y A;  3F21 A;  3ZR8 X;  2COM A;  4F3Q A;  2L3D A;  4IL6 C;  1ETQ A;  2DFE A;  2W24 A;  2YU3 A;  2MAB A;  2JQ7 A;  1JHH A;  2EZL A;  4DQ2 A;  2JRM A;  1JI8 A;  4OIQ F;  3PQK A;  4RAY A;  3DCF A;  4RLF A;  3K7A J;  1IRX A;  4LLL A;  5J8F A;  1QU3 A;  4L9N A;  4DZJ A;  1FYM A;  5E8G A;  5DCF A;  2K27 A;  5DM6 F;  2LNB A;  1YYV A;  4HOB A;  3K10 A;  4DOZ A;  5DD4 A;  3IV5 A;  1KZH A;  3E6D A;  4FTH A;  3ZMS A;  2RVC A;  3GZ5 A;  3A01 B;  3CD6 I;  2ME6 A;  1OYW A;  3BWG A;  5J40 A;  3MWM A;  3CCU I;  4IQ4 A;  4EJU A;  3OSF A;  3GWZ A;  5FLX Z;  3A0H C;  2VPR A;  3CCY A;  3K4J A;  5D5W B;  2EIM H;  1SFU A;  3C2H A;  3GTQ J;  4EEF G;  2ZJR F;  3S93 A;  4YFN F;  2O6G E;  5IP7 J;  2DQR A;  3SZP A;  2MSY A;  2IS4 A;  4M3E A;  3GFL A;  2Z5U A;  5C4X J;  1GXQ A;  2LY1 A;  3I4P A;  1FOK A;  2PI0 A;  3KEY A;  1SD7 A;  1IV6 A;  2X6W A;  2LF7 A;  3GTM J;  3HOW J;  4XON A;  4HNU A;  3AG1 H;  3DV8 A;  4Y7N J;  1XS9 A;  3N97 A;  3L2R A;  4IZZ A;  4M72 A;  3S14 J;  1JGS A;  1BI1 A;  2Y9Y A;  3MAJ A;  5E3O A;  3S15 J;  1T08 B;  1IC8 A;  4A6E A;  2AHQ A;  1OIS A;  4BE1 A;  3I64 A;  3VYT B;  1K61 A;  2TDX A;  1BIA A;  4IHX A;  4A5N A;  3CCR I;  4ESJ A;  2L9S A;  1YQA A;  5D8L B;  3K1P A;  6PAX A;  5ICF A;  5K7Z A;  1YTY A;  5AIQ A;  1TZL A;  3KEO A;  3PIP F;  1AOY A;  3IC7 A;  1QO0 D;  2JPC A;  2E71 A;  2KRH A;  4CZZ A;  4GO1 A;  4OWR B;  5CKT A;  4I2O A;  2DCE A;  2D45 A;  3CP2 A;  1R1U A;  2L7Z A;  3KP3 A;  3Q0W A;  2Z33 A;  2EZH A;  4G8X A;  2HNH A;  2PMZ A;  1QGP A;  4MQV A;  3RIR A;  1KU2 A;  4CSW A;  2LH9 A;  1U5T C;  4HX4 A;  1ZG3 A;  2FU4 A;  3CCV I;  1V54 H;  1FBU A;  1WJ5 A;  2KIM A;  3OYK A;  4L5I A;  3V42 A;  3L1P A;  2GXG A;  4ZYD A;  3S3O A;  5IYC J;  2FD5 A;  3PNT A;  3ZQQ A;  5DM7 F;  2W1O A;  1V5F A;  2R5Z A;  3LL7 A;  4PDK A;  5IPA A;  2ZFU A;  1YS6 A;  3BG5 A;  3QP6 A;  4GFB A;  2BV6 A;  4NUB A;  3LA3 A;  4AD9 A;  1BM9 A;  2KFD A;  3WU0 A;  2HGC A;  3JRA A;  3OS2 A;  4HQE A;  4PJM A;  4BAC A;  4M3B A;  1LQ1 A;  4IRH A;  5LHH A;  4MFD A;  4XID A;  2A6H F;  2VN2 A;  3LMM A;  2Y0S A;  1XB4 A;  1DP3 A;  2V9K A;  4KN7 X;  4AIH A;  3JRB A;  3I59 A;  1F43 A;  1FC3 A;  3NEU A;  1SVL A;  2XF5 A;  3M9A A;  4OIR F;  4A5M A;  1MDM A;  4I6Z A;  2DA3 A;  3LSG A;  3MZH A;  2BHY A;  4ENM A;  2OUM A;  1Z21 A;  2FQ4 A;  2LRE A;  1RKT A;  1WJB A;  3DU6 A;  5DCM B;  1OCZ H;  5E18 F;  1Z91 A;  3H9G A;  5IOY A;  3M4O J;  4NNJ A;  4UNO A;  3BG3 A;  3F8M A;  5FKN A;  3WTZ A;  2HEO A;  4KJZ A;  3TQN A;  3F8C A;  4UV8 A;  2VJI A;  2L9N A;  3CDI A;  5L3B A;  2M9H A;  3P5J A;  1IXR C;  2E19 A;  4B48 A;  2VPL A;  2ACJ A;  4OMZ A;  3FM3 A;  4E7L A;  2YX7 A;  3PJR A;  4MO7 A;  1T2K A;  3KIO A;  1ITY A;  3BZ6 A;  2ZNZ A;  3CES A;  3EQL F;  4IEJ A;  4RM3 A;  5DS9 A;  3F8F A;  1AKH A;  3K2A A;  3LSJ A;  1IDZ A;  1B72 B;  4HG2 A;  1G3W A;  4RB1 A;  2KJC A;  3CCE I;  1RR8 C;  2LVS A;  3FK6 A;  2IT0 A;  4E4H A;  4E7J A;  1YRN B;  4QPO A;  2G7H A;  4Y52 J;  3CLQ A;  4ENK A;  3IWF A;  3NQO A;  1R5G A;  3KCC A;  5BQT A;  1Z3Y A;  3ERE D;  3OS0 A;  3CUQ C;  1MBK A;  1R5H A;  5EG0 B;  3PUB A;  5JVG F;  1JKP C;  1MMS A;  1XMK A;  3K9T A;  3TO9 A;  1H8A C;  1MJB A;  4IHV A;  4XM3 A;  4AYB N;  1ZTR A;  3SFI A;  3H1C A;  2A3S A;  5E17 F;  1JT0 A;  2HDC A;  3WG7 H;  4LGW A;  5FLV A;  1W0U A;  1AA7 A;  2MLK A;  1TQI A;  4RB2 C;  3DTI A;  2IJL A;  2P6S A;  4IHY A;  2EB7 A;  1F5T A;  5E79 C;  2HYG D;  3CJN A;  3KLN A;  2EQR A;  2BXY A;  2XHK A;  1TW2 A;  4XLN F;  4RM2 A;  3F23 A;  4P55 A;  5FLM J;  1VQ6 I;  4YFK F;  5FRN A;  2E35 A;  3P9K A;  2LSO A;  2Z2S B;  2X1C A;  1HW2 A;  4ITV A;  3JRH A;  1A5J A;  5E3N A;  3FM5 A;  1D8J A;  1W5C C;  2NVY J;  3WOD F;  5FGM A;  5FJ8 J;  1BC7 C;  5M5X J;  1U5T A;  3R0A A;  2H6C A;  1STZ A;  2JSC A;  1N75 A;  2K9M A;  4EGZ A;  5B3S H;  4BL0 B;  4BE2 A;  2IAI A;  4YEJ A;  4N4N B;  1IN8 A;  2FNA A;  4HDV A;  3DFG A;  3OYB A;  2A68 F;  1BJZ A;  5HOO A;  2CW8 A;  2OZ6 A;  3NWT A;  2CFX A;  2FEZ A;  4PZJ A;  2GM4 A;  4AIJ A;  4KIB A;  3DU5 A;  1SVM A;  4LG0 A;  4RBO A;  2HOA A;  5BNG A;  1ON1 A;  2EBI A;  1IF1 A;  3K4N A;  4DYQ A;  1MH3 A;  1G3Y A;  5EZH A;  4CZC A;  2P5L C;  1QZY A;  2JTV A;  2Q1Z B;  3S32 A;  3CJQ B;  2GQQ A;  5JFR A;  3N05 A;  1YIJ I;  3HL2 A;  3DPU A;  1ZKG A;  2KQR A;  3SYT A;  2HKX A;  1UFM A;  4RGU A;  2HQA A;  1ZQ3 P;  1IG7 A;  2M0C A;  2JA7 J;  2QBY B;  3CCL I;  1LUJ B;  3HUG A;  3GTO J;  1OR7 C;  3EUH A;  3TO7 A;  1XDU A;  4I76 A;  2O61 A;  5CVI A;  5HLG A;  5A2Q Z;  3D5R C;  3FX3 A;  4PK4 A;  4RAG A;  5K1Y A;  3I58 A;  4Y17 A;  1ON2 A;  1ETO A;  1J09 A;  3LOC A;  1MBH A;  1E2X A;  4BBS J;  3HTU A;  5D8K B;  2DA4 A;  3CDL A;  3M8F A;  4G9Y A;  5E1Z B;  5LRR A;  1UST A;  3CUQ B;  4XLH A;  4BXF A;  2M7B A;  3IWZ A;  3V4G A;  3ZQL A;  5FD6 A;  1MIJ A;  3OOP A;  3L09 A;  1ZR2 A;  4U0V A;  5D5V B;  2K3P A;  2V9P A;  1WJE A;  1X1B A;  4NC7 A;  4A3D J;  2QQ8 A;  3PNY A;  1XGN A;  2DMQ A;  5J6X A;  1O3Q A;  3J7A Y;  3ABK H;  3HB9 A;  5GPA A;  2H8R A;  2JA5 J;  1TBX A;  1WH7 A;  3K4K A;  2EIL H;  1LKX A;  1O3R A;  2XGE A;  3CCQ I;  1T95 A;  1FTT A;  1J59 A;  3RI4 A;  1UG0 A;  4Y4R A;  1REP C;  3BTL A;  2ID6 A;  3KP4 A;  4UVC A;  5LGN A;  1QNT A;  3AFH A;  3ZPL A;  5IP6 A;  3C3W A;  1R71 A;  2CUJ A;  1APL C;  2GXA A;  1W36 D;  3G6E I;  4I0A A;  3OYL A;  2ECC A;  5AIP A;  3BC8 A;  3CMA I;  1IW7 F;  3BJA A;  3LSR A;  3L9F A;  4IHW A;  5FO5 A;  1BW6 A;  5HLH A;  4BE0 A;  4JX6 A;  3FMR A;  2XDV A;  5FB2 A;  1WKM A;  1NTC A;  2XPU A;  4A12 A;  4OAY A;  1IUF A;  1A6Q A;  1JUP A;  3QP5 A;  1FWZ A;  3ABT A;  2QQA A;  1UHW A;  3I0T A;  3QQA A;  4HEA 2;  4HX8 A;  5F0C A;  1WSU A;  2ZXI A;  1B59 A;  1ZAR A;  3KZI C;  5GAD J;  1OYY A;  2ZB9 A;  1UJ8 A;  1Z6T A;  2YX4 A;  1J7K A;  2BY2 A;  2CH0 A;  1N25 A;  3D0S A;  1D0Y A;  3HGY A;  5CVR A;  5CVU A;  2VJJ A;  3SXY A;  4D5C A;  4DJA A;  3W2A A;  3RKY A;  4WWC A;  5FKM A;  3W2W A;  4LK0 F;  2RN7 A;  2X6Y A;  2WB1 A;  2DYR H;  2WV1 A;  2CRG A;  3LSP A;  4LG3 A;  3DP7 A;  4I01 A;  4F7Z A;  3ZQF A;  3FF5 A;  3H3Z A;  1TWF J;  2RV8 A;  4LK1 F;  2RNG A;  5ICC A;  1U8R A;  1JJ6 C;  3GLX A;  3HC7 A;  2D1V A;  2L7M P;  4YIR X;  4KYW A;  5F1J A;  1QRY A;  2O03 A;  4P1W A;  4FQG A;  3BR6 A;  1FBQ A;  2VQG A;  3KE2 A;  3F22 A;  1R9T J;  3RKQ A;  3OSG A;  3COA C;  4KDP A;  5EGO A;  3Q5F A;  4WXH A;  1ETV A;  4UB6 C;  3DPT A;  2KIQ A;  2Z16 A;  2DTZ A;  3PNV A;  2E34 A;  3HSE A;  4HST A;  2M87 A;  3SZT A;  2QLZ A;  1R1T A;  1O57 A;  1VND A;  1XPX A;  5DYM A;  2LK2 A;  3QU3 A;  4S0H B;  3U21 A;  1JJ8 C;  3SFZ A;  1JKO C;  2R7W A;  4ZYE A;  2QCO A;  2R7T A;  2J5O A;  1Y8Q B;  2VUM J;  4MLO A;  3F0C A;  2F5V A;  4M9X A;  3GYH X;  2R7U A;  5EEG A;  2P81 A;  2IGN A;  4E6K G;  2ADU A;  3T1B A;  2UXN A;  2DT6 A;  3HHG A;  1C0W A;  2WY7 Q;  3MKL A;  2NNN A;  3FXQ A;  5ED4 A;  2XAH A;  3FZV A;  4GDF A;  1DPU A;  2KPM A;  1YIT I;  1SAN A;  1WHU A;  2H6B A;  2R7O A;  4EMS A;  4F91 B;  2GOX B;  1IAW A;  1WWX A;  2DA5 A;  3ZQH A;  2Q0O A;  4BQN A;  5FD5 A;  5HLT A;  2QSF X;  5CVV A;  1YW8 A;  1LEA A;  2UUZ A;  4WXC A;  2V79 A;  5ICE A;  4NQW A;  2DTR A;  3SEQ A;  2V7F A;  3DEU A;  3HEF A;  2HTS A;  2LYC A;  4Y13 A;  1N77 A;  4FIS A;  2DO7 A;  2W25 A;  2HQR A;  3DF8 A;  4YEL A;  2XGD A;  1E17 A;  5LEK A;  1ETY A;  1SFE A;  1X1A A;  3PIO F;  3G1L A;  4KIF A;  1BOB A;  3JW4 A;  3R61 A;  4OIO F;  3J7Y J;  4XRS A;  3RPU A;  3WTY C;  4LFU A;  3CC4 I;  1W36 C;  3MVP A;  1K4T A;  4HSR A;  2BBY A;  2XAQ A;  1K4S A;  1TWH J;  3EET A;  2AO9 A;  2MC3 A;  3M1C A;  1ERD A;  2LC2 A;  2RDP A;  4EVI A;  1MBF A;  3FXU A;  1GUU A;  4I7H A;  1U9O A;  2D1H A;  2M34 A;  1RPW A;  4HV6 A;  3ZP5 A;  1X1D A;  4RAF A;  3I54 A;  4BEH B;  4U0W A;  3WE2 A;  4R8H A;  3FBN B;  3GW2 A;  3DBL B;  4I02 A;  1X4P A;  3B6C A;  1HSJ A;  1YOV B;  3ZN0 A;  1X3Z B;  1AWC A;  4H0E A;  2O3F A;  3OYF A;  3FIW A;  3PM1 A;  3VYU B;  3ZOB A;  4Y15 A;  3HKZ A;  2HPI A;  2LDU A;  2BVM A;  1B8I B;  2R7D A;  2NS0 A;  2Y0M A;  4IOA F;  4BH9 A;  4P9F A;  3H92 A;  1Y56 A;  4FX0 A;  3OOU A;  1BN5 A;  4CDG A;  2QKM B;  4CA0 A;  1TNS A;  4XQF A;  5J1R A;  1VQL I;  1D1B A;  2KIU A;  3BZC A;  2ETH A;  2K86 A;  3DTK A;  5L3F A;  1T56 A;  2P0W A;  3J80 K;  1XSD A;  4BNC A;  1S72 I;  3K1M A;  3TGN A;  4G7O F;  1BA5 A;  2K9L A;  3OR2 C;  2VXD A;  1D0Z A;  3TED A;  3BY6 A;  1FX7 A;  1WJC A;  5FKL A;  4OOI A;  5IYB J;  1YX3 A;  2LBF A;  1LVK A;  2Y69 H;  1RIO H;  2FBK A;  2H94 A;  3M1E A;  1KQ9 A;  2WAQ A;  3GTG J;  2TCT A;  1JUS A;  2WA0 A;  3H0D A;  1HLV A;  4IF4 A;  4QWQ A;  1FOY A;  2OTJ I;  5JVT A;  2RQQ A;  2XRN A;  2X1D A;  1W7P B;  5E1X A;  2MFZ A;  3CCJ I;  4KA4 A;  2G9W A;  2K5C A;  3BJ6 A;  4ZTJ A;  1KA8 A;  2Y75 A;  4BQQ A;  5LHG A;  2LKX A;  1Z7U A;  2V1N A;  1G4D A;  3ASN H;  2Z1D A;  2QKL B;  4AWX B;  2KLO A;  3HM5 A;  4B09 A;  4I98 B;  3GEZ A;  2EV5 A;  2CMP A;  4RS8 A;  2A05 A;  1HXD A;  3RYR A;  2DA1 A;  3CMY A;  2NS8 A;  3P9I A;  4ESB A;  3FXJ A;  5TIS C;  2COB A;  4ESF A;  1TC3 C;  2QM3 A;  3BG6 A;  4CIC A;  1SFX A;  1TLH B;  2KZG A;  1GLN A;  1MGT A;  3NAU A;  2DFH A;  2DA2 A;  3O6B B;  4HLX A;  3LA2 A;  2IS2 A;  3IH2 A;  4B1R A;  4E7H A;  3G1M A;  3UKG A;  5LFA A;  4MNU A;  4XLC A;  3T8T A;  1ETX A;  4U7D A;  2NVU B;  3OL3 A;  3KP7 A;  3JSP A;  4CYC A;  1V3F A;  2PQ8 A;  3DLA A;  2CQQ A;  3MFK A;  1X1C A;  3C7J A;  2HKO A;  3GF2 A;  1IZ1 A;  1WGX A;  4WXD A;  1ETW A;  3FXM A;  2STT A;  1XGS A;  2G7U A;  4XRS G;  2CS3 A;  4XBF A;  1WCM J;  3DBR B;  4X1E A;  2E1M C;  2WAF A;  3MQ0 A;  2ZO4 A;  2BW3 A;  2OTL I;  2I10 A;  5JLX A;  4ENJ A;  1VQK I;  4A3B J;  2IS1 A;  4UUV A;  1WPK A;  5D6E A;  4IVN A;  2QWW A;  2JK3 A;  3JRD A;  4M6X A;  2Q2E B;  1TQP A;  4A0Y A;  2M7A A;  1XMX A;  1H88 C;  3HDD A;  3L2C A;  5IT9 Z;  3H3V K;  3KP5 A;  1ENH A;  2ELH A;  3DPL C;  4FE7 A;  3CTA A;  1ETK A;  3BJO A;  3ROU A;  2HDD A;  3GUD A;  4LLG F;  4QLC U;  1RNL A;  4HQM A;  2M8G X;  5J3L A;  3ESW B;  4ZZL A;  3V8K A;  2R5Y B;  2M8E A;  4M6Y A;  1GHC A;  1KYW A;  2DFI A;  3FMQ A;  1Y6I A;  4U7B A;  1VF9 A;  2F5E A;  2VKV A;  2VL8 A;  4NB5 A;  4JOM A;  1HC8 A;  4XLF A;  2QGU A;  2IA1 A;  2H1L A;  4F92 B;  1A31 A;  3K4M A;  4DIQ A;  3CC7 I;  1OJL A;  4M3F A;  2VBZ A;  2W82 A;  4UVB A;  4EV0 A;  5H6R A;  1Y1V J;  3HPH A;  5H20 A;  3BCB A;  2ID3 A;  5JLW A;  1P2F A;  4A2U A;  2JVH A;  4HBL A;  1KGS A;  1J0R A;  4D5F A;  2M3A A;  1GV2 A;  2VI6 A;  2HOS A;  4GGG A;  4EGY A;  3FIS A;  3S2D J;  4OIP F;  4MIM A;  5CVJ A;  3A01 A;  3PFY A;  4Q48 A;  3IUO A;  2GAU A;  4IXA A;  2OPT A;  2EJR A;  3PO3 J;  2L7F P;  3WTV C;  2NNY A;  2LY9 A;  3B73 A;  2XKO A;  4C2U A;  2F5C A;  3ML6 A;  3WHB A;  4B3A A;  2VON A;  3D1N I;  1LE8 B;  5K5R A;  3EYI A;  1DGR M;  3KP6 A;  1GDT A;  5BPI A;  2ZNY A;  1X19 A;  3JSO A;  1UMQ A;  1GXP A;  4PGH A;  3VFZ A;  4EJV A;  5FFX A;  1S7O A;  3AL0 B;  4NBQ A;  1MSF C;  3V8J A;  2JWT A;  1FMW A;  1SFO J;  2ISZ A;  1K6Y A;  3CO6 C;  2IVM A;  1BOA A;  3ABL H;  3IL2 A;  1W0T A;  2FA5 A;  2KL4 A;  3LFK A;  2E1M B;  2YR2 A;  2CSO A;  3GVA A;  4HF0 A;  2DT5 A;  5CJ9 A;  2H27 A;  3PL8 A;  3ULQ B;  1RC9 A;  2DK5 A;  5D4S A;  3OYC A;  4XSX F;  1F9N A;  1YJN I;  4CHU A;  3I71 A;  2EA4 A;  1BI2 A;  3FK7 A;  1YLF A;  1LB2 A;  4FET A;  4MEX F;  1YHQ I;  2M0M A;  5LD2 C;  3H5N A;  3KZY A;  2K9N A;  2ZME B;  1XG1 A;  4RGS A;  4PSX A;  3HOT A;  1XCV A;  1S7E A;  2FBI A;  2JA2 A;  2RAE A;  4LIU A;  3BR1 A;  3E3V A;  2ESN A;  4W97 A;  3T0Y A;  5C4J J;  3KET A;  1R4N B;  5LHI A;  3ABM H;  3CO7 C;  4HZF A;  2M4K A;  3AKZ A;  4KNY A;  2AQF A;  1S8N A;  3JAM Z;  3OV8 A;  2Y30 A;  2EFP A;  3CME I;  1O3S A;  4IHS A;  4NC8 A;  3GBG A;  2ZCW A;  4BHP A;  2FNP A;  2VQC A;  3BOQ A;  4W1U A;  4CCM A;  2VOO A;  1ZG1 A;  4A0Z A;  2ZSH B;  3MN2 A;  4OAZ A;  1OLT A;  2CV0 A;  2A07 F;  4GYG A;  2XV4 S;  4WK8 F;  1SMT A;  2DAO A;  2L2O A;  3RCO A;  2V1U A;  3NRV A;  4LLN A;  1OCR H;  2VBX A;  4CXF A;  2CW7 A;  3CLO A;  1FMV A;  4WCG A;  5BMZ A;  1VQN I;  4B4C A;  2QSG X;  3EUA A;  5EYR A;  1IRG A;  1BBY A;  3FWE A;  2Y31 A;  4X6A J;  5GP9 A;  2W57 A;  3GME A;  1R4M B;  2ICW G;  3RPQ A;  2GZW A;  3X2Q H;  5L3E A;  2L54 A;  3RZD J;  5K7H A;  3MKW B;  1EKE A;  1EV7 A;  4EJW A;  3J81 K;  1WJF A;  2MD5 A;  4XKW A;  1MJ9 A;  1A6I A;  3VOE A;  2CGP A;  4O5V A;  3KX2 A;  2JJ7 A;  3DLL F;  1X2N A;  1EH6 A;  4YIF A;  2VT3 A;  2WAD A;  3TKY A;  2STW A;  3JRG A;  3E0J B;  2ZJP F;  1Z7L A;  2AQE A;  2VKD A;  2VT2 A;  1WVR A;  2B9S A;  3VWB A;  4LB6 B;  5HOD A;  5DCM A;  2WTE A;  2PBI A;  5EEA A;  3JTH A;  5ILS A;  3W6J B;  4YFX F;  1FIA A;  1YG2 A;  2LRD A;  2O7O A;  2VIX A;  3CZ6 A;  2V4J C;  3HRM A;  5HDG A;  1IN4 A;  1BR1 A;  1IXC A;  1Y0N A;  4Q47 A;  3ZMU A;  4AM3 A;  4C2T A;  2IW5 A;  1HST A;  3E1S A;  3L2V A;  2DFF A;  4E7K A;  3VB2 A;  1KQ8 A;  2XKP A;  2CG4 A;  2HDW A;  4XNF A;  1VZ0 A;  3BDD A;  3GFI A;  4G6T B;  1MMD A;  2ZXJ A;  1UZC A;  1WI9 A;  3QPS A;  2MYS A;  3SDG A;  5FLX K;  5HDN A;  5E8I A;  1VFC A;  2L4M A;  2BHZ A;  3MZY A;  2L4A A;  4CCJ A;  4M9Z A;  4EJO A;  1G3S A;  1FYK A;  4DYR A;  2OU2 A;  3DEW A;  2FOK A;  1B72 A;  1OMI A;  1VQ5 I;  5M5W J;  3C18 A;  1OCT C;  2YPR A;  4BQA A;  3ZMZ A;  2GBY A;  1T33 A;  3M7G A;  3C2G A;  3QU6 A;  1KU7 A;  4A3M J;  1YRN A;  1FSE A;  2PJR B;  3OY9 A;  2DJI A;  2EFO A;  2CFO A;  4I99 C;  3W2V A;  1CF7 B;  5EG0 A;  2F6C A;  3DTE A;  1SAX A;  3LQR A;  1QHH D;  1D5V A;  4F52 A;  3HZJ A;  3O2P E;  1AU7 A;  2BY3 A;  2GWR A;  1TNT A;  2JVG A;  3TO6 A;  4EAT A;  1BL0 A;  1MBJ A;  1WQ2 A;  2E1O A;  5TJJ A;  1QA6 A;  4XLE A;  2EV6 A;  3KZZ A;  1I1S A;  3K6G A;  2Y9Z A;  1QHG A;  4XKV A;  3IRQ A;  1UHS A;  4XN0 A;  2O8K A;  4A3L J;  1FP2 A;  2A61 A;  1F1Z A;  2CV1 A;  4UVA A;  5DUI A;  2IEK A;  1MD0 A;  4IHT A;  1XTA A;  2P6T A;  2VOP A;  1MSE C;  1OQY A;  3CF2 A;  3FXL A;  2CJJ A;  1D0X A;  4BS9 A;  3K4C A;  4B3X A;  4BDY A;  2V1X A;  1HW1 A;  3CP8 A;  3BP8 A;  1OYI A;  4P96 A;  4J19 A;  3O8G A;  5E3M A;  3KLO A;  1D8K A;  1POG A;  4MTE A;  1ZEL A;  3OYM A;  2MG4 A;  5F64 A;  3C2B A;  2FMY A;  2RGV A;  2CU7 A;  4L9V A;  1TL8 A;  1UB9 A;  1G6N A;  3QYB A;  3G4S I;  1BIB A;  2HQN A;  4MHG A;  2G0E A;  3TMO A;  2E2I J;  1MBG A;  2K9S A;  2BXZ A;  2NAZ A;  3RKX A;  2Y2Z A;  5LGT A;  1VQO I;  1QBJ A;  1WFX A;  1ZHF A;  1P92 A;  1YW7 A;  2DDB A;  4B8X A;  1I5Z A;  1LFU P;  1W7P D;  5GTH C;  1ZK8 A;  1S5L C;  5J1Y A;  4DW6 A;  2CV2 A;  3OYN A;  3HSR A;  3OYH A;  4WX9 A;  1HQC A;  3ECH A;  2VOD A;  3L2Q A;  4PGG A;  3R0J A;  3PUF A;  1EH8 A;  2E5N A;  4RB3 C;  2PEX A;  2R7S A;  4HX7 A;  3RDI A;  1J9I A;  3E6M A;  2QBY A;  1W5T A;  1KYZ A;  2KT0 A;  1NK2 P;  1FTZ A;  5DD8 A;  2QYO A;  3QOE A;  2XAJ A;  4A3E J;  4S04 A;  1Z3X A;  5GAE J;  2GA1 A;  2Z99 A;  3HOU J;  1PUE E;  2M30 A;  1QVU A;  3S17 J;  2XB5 A;  1EA3 A;  1IXS B;  1LPQ A;  3F3X A;  2IPQ X;  1MNM C;  3K69 A;  3FDY A;  4F93 B;  4M9S A;  1JT6 A;  2PJP A;  3JRE A;  5KK1 A;  3CUQ A;  2QEN A;  3NAR A;  2X6O A;  1V55 H;  1B9M A;  1K79 A;  2OQG A;  5DEQ A;  1WJA A;  3BTJ A;  3S2H J;  1FOX A;  1E3P A;  5LBQ A;  4PCQ A;  4ZDL A;  5GTI C;  2DA6 A;  2YSR A;  1B4A A;  2Y48 A;  2X85 A;  1T8I A;  1IRZ A;  2RKH A;  3DQV C;  2IGO A;  4XSZ F;  2LG4 A;  5GPC A;  2DYS H;  2HI3 A;  1PYV A;  2O0Y A;  4BKX A;  1JXS A;  4KMF A;  1Z6R A;  1YW9 A;  2EPF A;  3FBI B;  2EZK A;  2HR3 A;  3GFJ A;  5LRS A;  3CUO A;  5HS9 A;  1IN6 A;  4CO8 A;  5HLI A;  3ZGK A;  2HVQ A;  4JK1 X;  4A3K J;  3LFU A;  4QSH A;  1FT9 A;  1E3H A;  3DBH B;  2ZXW H;  4PSW A;  1YIO A;  3Q3S A;  1K7A A;  2HZD A;  1P4X A;  3HGG A;  2F2E A;  1QPI A;  4IRI A;  2VE8 A;  4BDZ A;  1VQM I;  5D5X B;  1BI3 A;  2KZV A;  4II3 A;  1G8X A;  2GIZ A;  3Q9V A;  1JUM A;  2QZ8 A;  1W4M A;  5F04 A;  2PMH A;  1HDP A;  3ZQ7 A;  4U88 A;  5D6F A;  2EIJ H;  3IP4 B;  1MKM A;  4XOP A;  4B43 A;  1ACI A;  3I3L A;  4LOC A;  2M2E A;  2YS9 A;  3QYF A;  2UV1 A;  4I0B A;  1ZGW A;  2KJB A;  4HV5 A;  2DOF A;  2HFH A;  3SQN A;  1ZR4 A;  4G6D A;  4LD5 A;  5F08 A;  2IRF G;  1FNN A;  4KIS A;  1IUY A;  4G94 A;  3WTU C;  3K4B A;  2ZKZ A;  3JR9 A;  5F0F A;  3VEP A;  3ZXS A;  4HRI A;  3S16 J;  1X58 A;  1OR7 A;  3I9V 2;  3VYS B;  2MH9 A;  4GYI A;  3ZMV A;  1ZGJ A;  4XMY A;  5LGU A;  1BC8 C;  2E7W A;  2GOM A;  4DZP A;  3GTK J;  3MZ8 A;  2NOG A;  5IYD J;  3S1N J;  2WWY A;  1YI2 I;  2Z9O A;  3ERM A;  3U2R A;  1LFB A;  4ZDP A;  5HNH A;  1Z9C A;  1LDK B;  4BJ5 C;  1U0J A;  3ZQC A;  2DXI A;  2XB0 X;  4YII A;  4C3I J;  4M73 A;  1X3W B;  2RC4 A;  4IX7 A;  1JHF A;  2GA2 A;  3H0G J;  2GXB A;  4MGR A;  1U9N A;  2WV0 A;  1LDD A;  2XAS A;  4KIC A;  4JX4 A;  3BCA A;  4O3M A;  2HXO A;  3GFM A;  4PJL A;  1YE9 A;  4AYB A;  4F55 A;  3OYJ A;  4L9J A;  4IJA A;  5A2Q K;  4ZDO A;  2FML A;  1YS7 A;  3LAJ A;  3K2Z A;  3K70 D;  5KAI C;  1KQ0 A;  1CQT A;  5J47 A;  3OIQ A;  3CQZ J;  2PMZ N;  2E7X A;  3I53 A;  4CCO A;  2KMU A;  3IKV A;  2XSJ C;  3ZN1 A;  3DXJ F;  4UUS B;  5FKO A;  4HYE A;  1ZN2 A;  1WI3 A;  4HPQ A;  1HBX G;  2OC6 A;  5HNF A;  3BQZ A;  3O3K A;  1TQM A;  3S3N A;  2IGM A;  2O9L A;  4ZC3 A;  2DMN A;  1TWA J;  4E7Z A;  3HXL A;  2MD0 A;  1F36 A;  2ESH A;  5EJC A;  3CF5 F;  3K1N A;  3RZO J;  5F1R A;  4CH7 A;  2CW0 F;  3HOY J;  3E6B A;  3KYL A;  3WTX C;  3LAP A;  4OIN F;  5ERI A;  4X0G A;  2FXA A;  2YU9 J;  2HVR A;  4RMN A;  2V6C A;  3KEQ A;  1YJ9 I;  3HPG A;  5CQE A;  3DKX A;  1YFH A;  4A3I J;  3IKT A;  5K5O A;  2HOT A;  2DK8 A;  2DOE A;  3J7Z I;  3FXO A;  2DMU A;  2PN6 A;  2MGQ A;  1QVT A;  4BY7 J;  3WE3 A;  3E5Q A;  3H36 A;  2DMT A;  4HF1 A;  1ZRC A;  3QPH A;  1R58 A;  1QQI A;  4G7H F;  1NK3 P;  2OQR A;  2W84 A;  3HRS A;  2MH2 A;  4V2F A;  5K5Q A;  2DBB A;  2FJ1 A;  1DUX C;  1I50 J;  5J1U A;  3V7R A;  4PJ0 C;  4RB0 A;  4XN3 A;  1BR4 A;  2QUF A;  5FRM A;  3MEX A;  3IH4 A;  2W48 A;  4DYC A;  2EFQ A;  5EDN A;  2F5F A;  4BEH A;  1IO2 A;  1XD7 A;  3BTI A;  1F4K A;  3DKW A;  5FKK A;  3I4M J;  4PJJ A;  5CPR B;  2P7V B;  3TP3 A;  2ZBK A;  1PP8 F;  1PUF B;  1K78 B;  1SD4 A;  2R7V A;  3HG9 A;  5DV5 A;  1UAA A;  4PFO A;  3OS1 A;  2HZT A;  2YUS A;  4N0B A;  4RLQ A;  3I4N J;  3KYD B;  3ASO H;  3ECO A;  1HOM A;  2DMP A;  1B8I A;  1WH5 A;  4GRI A;  3E7L A;  3ABU A;  4L9T A;  3TP0 A;  2XVC A;  1RRJ A;  3RKW A;  3BG9 A;  4XLA A;  4E7I A;  5ILV A;  4ZJZ A;  2R4G A;  2VBW A;  4Y33 A;  2JUG A;  1L0O C;  3GCM A;  3OYE A;  2KDZ A;  3JRF A;  1O3T A;  2MC4 A;  2K4B A;  4G12 A;  2XRL A;  4E70 A;  1I3Q J;  2ZC2 A;  1YX5 A;  2FX0 A;  2CUF A;  4C3H J;  5HVQ C;  4S05 A;  2UZK A;  2WY8 Q;  4AIK A;  4CGZ A;  1WJD A;  1VQ4 I;  1T6S A;  3QAH A;  3A1Y A;  2CUZ A;  1D5Y A;  1W7P A;  3F8B A;  4A6D A;  5HS7 A;  2LLK A;  2HOE A;  2QQB A;  2JUC A;  1PP7 U;  2XAG A;  2D5V A;  4MFE A;  2BEO A;  5TGT A;  3WTT C;  3AL0 C;  2XC7 A;  1MW7 A;  3GTJ J;  2E2J J;  4BU2 A;  2KP6 A;  3OYI A;  1EH7 A;  1RET A;  2FBH A;  3F8N A;  4OMY A;  2JSP A;  1RUN A;  3K70 C;  2OAZ A;  4EQQ A;  1HA8 A;  2JMW A;  3A03 A;  2EWN A;  1R00 A;  2WBM A;  1XX5 A;  3T8R A;  3P7N A;  1ZRD A;  3HYI A;  1SEU A;  1SFK A;  2F4M B;  1UHM A;  4AU7 A;  3BG7 A;  3TDU C;  3FKJ A;  1T98 A;  1PJR A;  5J8C A;  2EIN H;  2ZME C;  1M1E B;  1R22 A;  2BVL A;  3GXO A;  1U8B A;  1VQ7 I;  3OMY A;  2LTP A;  2IGK A;  5L3D A;  3AG4 H;  4GCV A;  4BHC A;  1HKS A;  1ODD A;  2M5W A;  4FT8 A;  3SDB A;  9ANT A;  1Z05 A;  2R92 J;  3F6V A;  5FFZ A;  4CCN A;  1BJA A;  2CQK A;  2EFN A;  1G2H A;  3LSH A;  4BHB A;  1I3A A;  5F27 A;  4CYD A;  2DJN A;  4ZTF A;  4RAZ A;  5IT3 A;  4A69 C;  1DQU A;  2VBY A;  3J7A O;  2LOO A;  3JTG A;  4CUG A;  4ZYG A;  2AS5 F;  2A5Y B;  5J4V A;  3ZQG A;  3W6K B;  2LP0 A;  1P4W A;  3B6A A;  3D5S C;  1JTX A;  2HXI A;  3M8E A;  2XGC A;  1RUO A;  1QZZ A;  2Q2E A;  2HWV A;  4M3G A;  5DDG A;  4Q4Z F;  3QOD A;  1OFC X;  4LMY A;  2BYV E;  5EF6 A;  3PSI A;  2VAS A;  2XF6 A;  4P5O A;  3SZG A;  2KRF A;  4ABZ A;  3MCZ A;  1HCR A;  1XSV A;  2VC1 A;  4CCK A;  1P4A A;  2RNJ A;  1A36 A;  2QF7 A;  4BY1 J;  1Z0X A;  2ZXH A;  3BZK A;  3MKY B;  2ELK A;  2M45 A;  1PVE A;  1IRF A;  1HF0 A;  3IHU A;  2BGC A;  2K85 A;  2R5Y A;  1NH3 A;  2VC0 A;  2JA8 J;  4DNC A;  2R5Z B;  1A35 A;  2N8G A;  5BOX A;  2IA2 A;  3QRF F;  1IDY A;  1TWG J;  2DI3 A;  2KIS A;  2XPW A;  4XRF A;  4BGD A;  4BJ6 C;  3S3M A;  3HSF A;  3OWT A;  3GZ6 A;  1RES A;  2VQL A;  3WU2 C;  4P9U A;  5IOZ A;  1HW5 A;  4D9J A;  2KHM A;  3KYC B;  2BZT A;  4Q5S F;  4UY8 I;  3O8H A;  3HOZ J;  2IXS A;  2UXX A;  4L18 B;  3HBL A;  2B0L A;  2ELJ A;  4ZYH A;  3I59 B;  2R7F A;  4GXO A;  2K4J A;  1MDM B;  3GZN B;  3ISP A;  2DW4 A;  1OPC A;  3WU1 B;  4XIC A;  5K7F A;  3H3U A;  1DPR A;  3CJR B;  4R1H A;  3IRR A;  2DU9 A;  4BAY A;  3UR3 C;  1B1B A;  5E1W A;  1LE8 A;  2PLY A;  1TT5 B;  3HHH A;  2CO5 A;  1MND A;  4EJT A;  1XSX A;  2E1N A;  5F0H A;  1LEB A;  1T39 A;  1S3J A;  2X51 A;  1IGN A;  1VQ9 I;  3WGI A;  1R7J A;  2X9D A;  3AG3 H;  1SD5 A;  4AVZ A;  1H9T A;  2WB1 N;  1HKT A;  1TP4 A;  4A3C J;  3H5R A;  2EK5 A;  5CLS A;  1ZLJ A;  3BRO A;  1Q1V A;  2PMU A;  1MMG A;  3TOA A;  1X3U A;  4G6Q A;  5H6Q A;  1AKH B;  1K6O A;  2LMD A;  4CCL A;  3EUH C;  2DOD A;  3S1Q J;  4JYK A;  3H9Q A;  4IOC F;  4A3G J;  1XMA A;  2TRT A;  2ZME A;  3A0B C;  1R36 A;  4MQ9 F;  2LKP A;  3OYA A;  1XC5 A;  3GTP J;  5L3C A;  2IP2 A;  2MLG A;  2I8D A;  1G3T A;  2JT1 A;  5FRO A;  1FY7 A;  1ZAO A;  2DQL A;  4DGW B;  3K0L A;  5AON A;  2MBF A;  4IO9 F;  1OKR A;  2L9V A;  2L0K A;  4A3J J;  3JCU C;  1L3L A;  5D5U B;  4N9I A;  2V9V A;  2HYJ A;  2VQH A;  3OIO A;  4MEY F;  2CYY A;  1S29 A;  1X4O A;  3QOP A;  1GT0 C;  1MBE A;  2P4W A;  2R7Q A;  4G7Z F;  2ZJ2 A;  2GIV A;  4KIT B;  3U9G A;  1DDN A;  3LWF A;  1U78 A;  5C44 J;  3PO2 J;  4C2M J;  3DKY A;  1R5I D;  3QYE A;  1JKR C;  1DP7 P;  1XDS A;  3EPZ A;  4KUM A;  3S1M J;  2A5W A;  2KKO A;  3HOS A;  3KPH A;  4C9Y A;  3E97 A;  3LSI A;  5KCM A;  5IT9 K;  3V7C A;  3WGH A;  3E5X A;  3ONQ A;  4J00 A;  5B66 C;  3OR1 C;  5D4R A;  2ZFW A;  3CDH A;  3V8L A;  2NOJ B;  2DPD A;  2RQP A;  4H4K C;  4KFC A;  4HNV A;  2PX9 A;  5C3E J;  2FRH A;  4Y3O A;  2Z3Y A;  2R3S A;  2JA6 J;  1P6R A;  2P5V A;  3RPU D;  4DBR A;  3W6V A;  2V1D A;  2H09 A;  5DTD A;  1R6R A;  1UG2 A;  2Q8K A;  2FQ3 A;  4XK4 A;  2X48 A;  1U5T B;  2XIG A;  2X4H A;  2F4O B;  3L2U A;  1LJ9 A;  3RQI A;  1Y1W J;  1IN5 A;  3S8P A;  2EZI A;  3BQY A;  2CUE A;  3GX4 X;  4UB8 C;  2KRC A;  4II2 A;  2VJ4 A;  1IV8 A;  2K7L A;  4LG0 B;  4UXN A;  1FP1 D;  4ETS A;  3JRI A;  1EJ9 A;  2OF7 A;  3LA7 A;  4Z6Y A;  1FPQ A;  2HTJ A;  3C1D A;  1JKQ C;  2I5U A;  4B47 A;  2GLO A;  4XR6 A;  3MD2 A;  1R1V A;  4NC6 A;  1ZRF A;  4LJZ F;  3HIF A;  4B44 A;  2C6Y A;  5CYV A;  4RA2 A;  2LD5 A;  4A0X A;  4XRM A;  4HLY A;  2DDA A;  3BR3 A;  4JBA A;  2M4G A;  2R7Z J;  3SEZ A;  2MW8 A;  1TWC J;  1U6G A;  3HUG B;  3TL4 X;  3BR2 A;  4Z2Y A;  1VTN C;  2HPM A;  5CQG A;  1JE8 A;  4BYY A;  5M5Y J;  2XF7 A;  3LSK A;  2V26 A;  3TOB A;  1I1G A;  2K9Q A;  4L5E A;  2HS5 A;  1FOW A;  3QPT A;  2J5P A;  5JI6 A;  2R0Q C;  1JGG A;  3H35 A;  2IS6 A;  3WTS C;  2FSW A;  3TW7 A;  3ZRG A;  1ULY A;  4A3F J;  3F72 A;  4FCY A;  2L5Q A;  2R7R A;  3HKZ N;  1GV5 A;  1Y0U A;  1ORK A;  2PJR A;  1CF7 A;  1Z67 A;  2JRT A;  4PUS A;  1ZGA A;  4IPA A;  4E7S A;  4M3D A;  2F48 A;  4EM2 A;  3B02 A;  1X1P A;  1SC7 A;  5JHU A;  3RYP A;  4BQO A;  2HQ5 A;  1ZLK A;  4J01 A;  4LIT A;  2ECB A;  1XN7 A;  4JP0 A;  1OCC H;  1O7F A;  3G71 I;  4HA8 A;  1TT0 A;  4UV9 A;  1ZG5 A;  3T5X A;  1V4R A;  4R79 A;  2DPU A;  1QZE A;  3NWS A;  4L0Z B;  1FJL A;  2WAQ N;  2OV7 A;  2LR8 A;  2X1E A;  3FHZ A;  3JAM K;  1V5E A;  3HRT A;  2VXZ A;  1U2W A;  2VB6 A;  4D0P A;  2NYX A;  2NRA C;  2B63 J;  1YO5 C;  3BT9 A;  2NVX J;  1GVD A;  3AG2 H;  1DGW Y;  2V6E A;  1DU0 A;  3VDX A;  4M74 A;  4ZH4 F;  3OIP A;  1Y39 A;  1D1C A;  2JPB A;  3K4L A;  5B1A H;  4YRV A;  4U87 A;  1RR7 A;  2XAF A;  2E5Z A;  2FUG 2;  2BOL A;  2NVQ J;  1TW3 A;  3R4K A;  3RSN A;  2AXT C;  3M3Y J;  2K3F A;  2X6X A;  3QPL A;  3R60 A;  3SHF A;  1MNE A;  3S1R J;  1J75 A;  5KHD A;  5LEJ A;  1T38 A;  4L0Y B;  5M3F J;  2ME0 A;  2K40 A;  1SAU A;  1KU3 A;  3GTL J;  2F4I A;  1ZRE A;  3ZCO A;  5E3L A;  4C3J J;  1N78 A;  2L01 A;  4XOT A;  2NS7 A;  2XUB A;  3A02 A;  3SJM A;  3CCS I;  3EDP A;  1B9N A;  2LKS A;  1KON A;  2P8T A;  2CQX A;  1JTY A;  3F9K A;  1TTY A;  2IBD A;  2PG4 A;  3G2B A;  3ZQI A;  4WF2 A;  1E3O C;  2DA7 A;  1CGP A;  1K83 J;  2K02 A;  3DWL E;  3J80 Z;  4KN4 X;  3HTS B;  1O4X A;  1WRJ A;  2VJ5 A;  4KT6 A;  3DEE A;  2DOA A;  5EGO B;  1PDN C;  4BJT A;  5M3M J;  1D3Y A;  3GO5 A;  1VQ8 I;  1RI7 A;  2JN6 A;  3VSL A;  3A4C A;  2FOW A;  2OCC H;  1MMA A;  1LVA A;  2O5R A;  4JX5 A;  5TRD A;  1LDJ A;  1T0F C;  3IAS 2;  3CCM I;  4XL9 A;  4ENN A;  2XRO A; 
#chains in the Genus database with same CATH homology
 4KMU X;  5ILU A;  2OA4 A;  4N9H A;  3WGG A;  1HKQ A;  4I09 A;  4EM0 B;  2MA3 A;  4RGR A;  2JZY A;  5BPD A;  2P7C B;  5L3G A;  1SMY F;  5DUK A;  3R6S A;  3E5U A;  5F6F A;  5KVR A;  4JQF A;  2AXL A;  3PQJ A;  2KIF A;  3N4M A;  1ZH5 A;  3BPV A;  2M1B A;  2PFB A;  3LST A;  1USS A;  2EFW A;  3KP2 A;  1QPM A;  5E20 A;  4AVP A;  1FLI A;  3WG9 A;  3FMS A;  2OBP A;  2LF8 A;  3G3Z A;  3I5U A;  4ASN A;  3Q9S A;  4KT5 C;  2OZU A;  3RJP A;  2A6E F;  1MJA A;  4LB5 A;  4BXU A;  3P9C A;  3ELK A;  4TV7 A;  3RTR A;  2X0L A;  3V7S A;  4HF2 A;  1XGM A;  5LLQ A;  4XLP F;  4UHT A;  3WTW C;  3FXR A;  2UWM A;  2QVO A;  4YG2 F;  4KIG A;  1RZ4 A;  2DLL A;  1LNW A;  1ZYR F;  1NHA A;  3ZMT A;  1I27 A;  3BPX A;  3ZMD A;  3KFW X;  1J2X A;  2EA2 A;  1H9G A;  1S7A A;  1FZP B;  1O7L A;  1Q1H A;  1H0M A;  1FSH A;  4MTD A;  4ON0 A;  4EM1 A;  2CWE A;  3S2W A;  3U1D A;  3E6C C;  2FE3 A;  1B6A A;  2ISY A;  2W85 A;  2QQ9 A;  3EYY A;  1S6L A;  4L5J A;  4OU0 A;  2HYF A;  3D5L A;  1T0F A;  5EEH A;  4M71 A;  2FF4 A;  1J5Y A;  3LQQ A;  4ZZD A;  4FX4 A;  3TDZ C;  2P5K A;  2VE9 A;  5ICG A;  2D2W A;  1ONV A;  4RGX A;  2O8X A;  3REO A;  2BE5 F;  3AAF A;  2OD5 A;  4IRG A;  1W5S A;  4O6J A;  2F5D A;  1XGO A;  4FHT A;  5HDK A;  1Z1D A;  2XGX A;  1A04 A;  3G73 A;  5BS6 A;  1BI0 A;  1UCR A;  2EV0 A;  3F6O A;  1I6X A;  1K78 A;  5HS8 A;  1R23 A;  2WC2 A;  1MZB A;  2E1C A;  4HW0 A;  2L02 A;  3L00 A;  3VOD A;  1FBS A;  4K2E A;  4HDU A;  1IN7 A;  2IA0 A;  1XCB A;  5JR3 A;  2A69 F;  3PFI A;  1FYL A;  4NHJ A;  3L7W A;  1GVJ A;  3J81 Z;  1KU9 A;  1U3E M;  1SD6 A;  3HRU A;  4HAM A;  4U0Y A;  3F21 A;  2COM A;  2L3D A;  2W24 A;  2YU3 A;  1JHH A;  4DQ2 A;  4OIQ F;  3PQK A;  4RAY A;  4LLL A;  5J8F A;  4L9N A;  1FYM A;  5E8G A;  5DCF A;  2K27 A;  2LNB A;  1YYV A;  4HOB A;  5DD4 A;  3E6D A;  3ZMS A;  2RVC A;  3GZ5 A;  1OYW A;  3BWG A;  3MWM A;  4EJU A;  3GWZ A;  5FLX Z;  5D5W B;  1SFU A;  4YFN F;  2O6G E;  2DQR A;  3SZP A;  3GFL A;  2Z5U A;  1GXQ A;  3I4P A;  1FOK A;  2PI0 A;  1SD7 A;  2LF7 A;  3DV8 A;  3N97 A;  4M72 A;  1JGS A;  1BI1 A;  3MAJ A;  4A6E A;  3I64 A;  2TDX A;  1BIA A;  4A5N A;  4ESJ A;  1YQA A;  5D8L B;  3K1P A;  6PAX A;  5ICF A;  1YTY A;  5AIQ A;  3KEO A;  1AOY A;  3IC7 A;  1QO0 D;  2JPC A;  4CZZ A;  4GO1 A;  4I2O A;  2D45 A;  1R1U A;  3KP3 A;  2Z33 A;  4G8X A;  1QGP A;  4MQV A;  3RIR A;  1KU2 A;  1U5T C;  4HX4 A;  1ZG3 A;  2FU4 A;  1FBU A;  2KIM A;  4L5I A;  2GXG A;  4ZYD A;  4PDK A;  1YS6 A;  3QP6 A;  2BV6 A;  3LA3 A;  4AD9 A;  1BM9 A;  3WU0 A;  2HGC A;  4HQE A;  1LQ1 A;  4IRH A;  5LHH A;  2A6H F;  2VN2 A;  1XB4 A;  4KN7 X;  4AIH A;  3I59 A;  1FC3 A;  3NEU A;  1MDM A;  3M9A A;  4OIR F;  4A5M A;  3MZH A;  4ENM A;  5DCM B;  5E18 F;  1Z91 A;  4UNO A;  3F8M A;  3WTZ A;  2HEO A;  3TQN A;  3F8C A;  4UV8 A;  5L3B A;  1IXR C;  2ACJ A;  4OMZ A;  3FM3 A;  2YX7 A;  1T2K A;  3BZ6 A;  2ZNZ A;  3EQL F;  3F8F A;  1G3W A;  4RB1 A;  2KJC A;  2IT0 A;  2G7H A;  4ENK A;  3IWF A;  3NQO A;  1R5G A;  3KCC A;  5BQT A;  3ERE D;  3CUQ C;  1R5H A;  1XMK A;  3K9T A;  3TO9 A;  1MJB A;  2A3S A;  5E17 F;  2HDC A;  4LGW A;  2MLK A;  1TQI A;  4RB2 C;  2IJL A;  2P6S A;  2EB7 A;  1F5T A;  2HYG D;  3CJN A;  3KLN A;  2XHK A;  1TW2 A;  4XLN F;  3F23 A;  4P55 A;  4YFK F;  3P9K A;  2LSO A;  1HW2 A;  3FM5 A;  1D8J A;  3WOD F;  5FGM A;  1BC7 C;  1U5T A;  3R0A A;  2H6C A;  1STZ A;  2JSC A;  4EGZ A;  1IN8 A;  2FNA A;  4HDV A;  3DFG A;  2A68 F;  5HOO A;  2OZ6 A;  4PZJ A;  2CFX A;  2FEZ A;  4AIJ A;  4KIB A;  4LG0 A;  1IF1 A;  1ON1 A;  1G3Y A;  2P5L C;  1QZY A;  2JTV A;  2GQQ A;  5JFR A;  2HKX A;  1UFM A;  4RGU A;  2QBY B;  3HUG A;  3EUH A;  3TO7 A;  1XDU A;  2O61 A;  5CVI A;  5HLG A;  5A2Q Z;  3FX3 A;  5K1Y A;  3I58 A;  4Y17 A;  1ON2 A;  1E2X A;  3HTU A;  5D8K B;  3M8F A;  4G9Y A;  5E1Z B;  5LRR A;  1UST A;  3CUQ B;  3IWZ A;  3V4G A;  5FD6 A;  3OOP A;  3L09 A;  4U0V A;  5D5V B;  1XGN A;  1O3Q A;  5J6X A;  1TBX A;  1O3R A;  1J59 A;  3RI4 A;  1REP C;  3KP4 A;  4UVC A;  5LGN A;  1QNT A;  3ZPL A;  3C3W A;  4I0A A;  5AIP A;  1IW7 F;  3BJA A;  3L9F A;  5FO5 A;  5HLH A;  3FMR A;  5FB2 A;  1WKM A;  4A12 A;  3QP5 A;  1FWZ A;  3ABT A;  2QQA A;  1UHW A;  3I0T A;  1WSU A;  4HX8 A;  1B59 A;  1ZAR A;  1OYY A;  2YX4 A;  1Z6T A;  1J7K A;  3D0S A;  5CVR A;  5CVU A;  3SXY A;  3RKY A;  4WWC A;  4LK0 F;  2RN7 A;  3DP7 A;  4I01 A;  4F7Z A;  3FF5 A;  3H3Z A;  2RV8 A;  4LK1 F;  5ICC A;  1U8R A;  3GLX A;  2D1V A;  4KYW A;  2O03 A;  1FBQ A;  3KE2 A;  3F22 A;  3COA C;  4KDP A;  3Q5F A;  4WXH A;  3DPT A;  3HSE A;  2M87 A;  3SZT A;  2QLZ A;  1R1T A;  1O57 A;  5DYM A;  3QU3 A;  3SFZ A;  4ZYE A;  2J5O A;  4M9X A;  3GYH X;  5EEG A;  2ADU A;  3T1B A;  2UXN A;  3HHG A;  1C0W A;  2NNN A;  3FXQ A;  5ED4 A;  2XAH A;  3FZV A;  1DPU A;  2H6B A;  4EMS A;  1IAW A;  1WWX A;  2Q0O A;  5FD5 A;  5CVV A;  1YW8 A;  1LEA A;  4WXC A;  2V79 A;  5ICE A;  4NQW A;  2DTR A;  3DEU A;  2HTS A;  4Y13 A;  2DO7 A;  2W25 A;  2HQR A;  3DF8 A;  1E17 A;  5LEK A;  1SFE A;  4KIF A;  3JW4 A;  3R61 A;  4OIO F;  3RPU A;  3WTY C;  4LFU A;  2BBY A;  2XAQ A;  3EET A;  2MC3 A;  2RDP A;  4EVI A;  3FXU A;  4I7H A;  2D1H A;  3ZP5 A;  4HV6 A;  3I54 A;  4U0W A;  3WE2 A;  4R8H A;  3GW2 A;  4I02 A;  3ZN0 A;  1HSJ A;  1AWC A;  4H0E A;  2O3F A;  4Y15 A;  2LDU A;  2R7D A;  2NS0 A;  2Y0M A;  4BH9 A;  4P9F A;  3H92 A;  4FX0 A;  1BN5 A;  4CDG A;  1TNS A;  2KIU A;  2ETH A;  2K86 A;  5L3F A;  1XSD A;  3J80 K;  4BNC A;  3K1M A;  3TGN A;  4G7O F;  3BY6 A;  1FX7 A;  4OOI A;  1RIO H;  2FBK A;  2H94 A;  3M1E A;  1KQ9 A;  4IF4 A;  4QWQ A;  5JVT A;  2XRN A;  1W7P B;  5E1X A;  4KA4 A;  2G9W A;  3BJ6 A;  1KA8 A;  2Y75 A;  5LHG A;  1Z7U A;  1G4D A;  4AWX B;  4B09 A;  4I98 B;  3GEZ A;  2EV5 A;  4RS8 A;  1HXD A;  3RYR A;  4ESB A;  3P9I A;  4ESF A;  2QM3 A;  4CIC A;  1SFX A;  1TLH B;  1MGT A;  3O6B B;  4HLX A;  3LA2 A;  4MNU A;  3T8T A;  4U7D A;  3KP7 A;  3JSP A;  1V3F A;  2PQ8 A;  3MFK A;  3C7J A;  2HKO A;  3GF2 A;  1IZ1 A;  4WXD A;  2STT A;  1XGS A;  2G7U A;  4XBF A;  3MQ0 A;  2ZO4 A;  4ENJ A;  4UUV A;  5D6E A;  4IVN A;  2QWW A;  4M6X A;  4A0Y A;  1TQP A;  3L2C A;  5IT9 Z;  3KP5 A;  2ELH A;  3DPL C;  3CTA A;  3BJO A;  3ROU A;  3GUD A;  4LLG F;  4QLC U;  1RNL A;  4HQM A;  4ZZL A;  3V8K A;  2M8E A;  4M6Y A;  1GHC A;  1KYW A;  2DFI A;  3FMQ A;  4U7B A;  2F5E A;  4NB5 A;  2IA1 A;  4UVB A;  4EV0 A;  2VBZ A;  5H6R A;  5H20 A;  1P2F A;  4A2U A;  4HBL A;  1KGS A;  1J0R A;  4GGG A;  4EGY A;  4OIP F;  5CVJ A;  4Q48 A;  2GAU A;  4IXA A;  2EJR A;  3WTV C;  2NNY A;  3B73 A;  2XKO A;  2F5C A;  3ML6 A;  2VON A;  5K5R A;  3EYI A;  3KP6 A;  5BPI A;  2ZNY A;  3JSO A;  1GXP A;  4PGH A;  3VFZ A;  4EJV A;  5FFX A;  1S7O A;  3V8J A;  2ISZ A;  3CO6 C;  2IVM A;  1BOA A;  3IL2 A;  2FA5 A;  3LFK A;  2YR2 A;  2CSO A;  3GVA A;  4HF0 A;  2DT5 A;  5CJ9 A;  2H27 A;  3ULQ B;  2DK5 A;  5D4S A;  4XSX F;  1F9N A;  4CHU A;  3I71 A;  2EA4 A;  1BI2 A;  1YLF A;  1LB2 A;  4MEX F;  3KZY A;  2ZME B;  4RGS A;  3HOT A;  1XCV A;  2FBI A;  3E3V A;  2ESN A;  3T0Y A;  3KET A;  5LHI A;  3CO7 C;  4HZF A;  4KNY A;  1S8N A;  3JAM Z;  3OV8 A;  1O3S A;  2EFP A;  4IHS A;  2ZCW A;  4BHP A;  2FNP A;  3BOQ A;  2VOO A;  1ZG1 A;  4A0Z A;  2A07 F;  4GYG A;  2XV4 S;  4WK8 F;  1SMT A;  2DAO A;  2V1U A;  4LLN A;  3NRV A;  2VBX A;  4CXF A;  3CLO A;  4WCG A;  5BMZ A;  1IRG A;  1BBY A;  3FWE A;  2W57 A;  3RPQ A;  2GZW A;  5L3E A;  2L54 A;  1EV7 A;  4EJW A;  3J81 K;  2MD5 A;  1MJ9 A;  3VOE A;  2CGP A;  4O5V A;  1EH6 A;  4YIF A;  2VT3 A;  3TKY A;  2STW A;  2VT2 A;  4LB6 B;  5DCM A;  2WTE A;  2PBI A;  3JTH A;  5ILS A;  3W6J B;  4YFX F;  1YG2 A;  3HRM A;  5HDG A;  1IN4 A;  3ZMU A;  1IXC A;  4Q47 A;  2IW5 A;  1HST A;  3VB2 A;  1KQ8 A;  2XKP A;  2CG4 A;  3BDD A;  3GFI A;  2ZXJ A;  1WI9 A;  5FLX K;  5HDN A;  5E8I A;  2L4M A;  3MZY A;  2L4A A;  4M9Z A;  4EJO A;  1G3S A;  1FYK A;  2OU2 A;  2FOK A;  1OMI A;  3C18 A;  2YPR A;  4BQA A;  3ZMZ A;  3M7G A;  3QU6 A;  1KU7 A;  1FSE A;  2EFO A;  1CF7 B;  1SAX A;  1D5V A;  3LQR A;  3O2P E;  2GWR A;  1TNT A;  3TO6 A;  1WQ2 A;  5TJJ A;  2EV6 A;  3KZZ A;  1I1S A;  3IRQ A;  1FP2 A;  2A61 A;  1F1Z A;  4UVA A;  5DUI A;  1MD0 A;  4IHT A;  2P6T A;  2VOP A;  2V1X A;  1HW1 A;  4P96 A;  3BP8 A;  1OYI A;  3KLO A;  1D8K A;  4MTE A;  5F64 A;  2FMY A;  2RGV A;  4L9V A;  1UB9 A;  1G6N A;  1BIB A;  2HQN A;  4MHG A;  2NAZ A;  3RKX A;  5LGT A;  1QBJ A;  1ZHF A;  1P92 A;  1YW7 A;  4B8X A;  1I5Z A;  1W7P D;  4KFC A;  3HSR A;  4WX9 A;  1HQC A;  3ECH A;  2VOD A;  4PGG A;  3R0J A;  1EH8 A;  4RB3 C;  2PEX A;  4HX7 A;  3RDI A;  1J9I A;  3E6M A;  2QBY A;  1W5T A;  1KYZ A;  5DD8 A;  2QYO A;  2XAJ A;  4S04 A;  2GA1 A;  2Z99 A;  1PUE E;  2M30 A;  1IXS B;  3F3X A;  2IPQ X;  3K69 A;  4M9S A;  2PJP A;  5KK1 A;  3CUQ A;  2QEN A;  1K79 A;  1B9M A;  2OQG A;  5DEQ A;  5LBQ A;  4PCQ A;  2YSR A;  1B4A A;  2Y48 A;  2RKH A;  3DQV C;  4XSZ F;  2O0Y A;  1JXS A;  4KMF A;  1Z6R A;  1YW9 A;  2HR3 A;  3GFJ A;  5LRS A;  3CUO A;  5HS9 A;  1IN6 A;  4CO8 A;  5HLI A;  4JK1 X;  1FT9 A;  1YIO A;  1K7A A;  1P4X A;  2F2E A;  4IRI A;  2VE8 A;  5D5X B;  1BI3 A;  3Q9V A;  2QZ8 A;  1W4M A;  2PMH A;  3ZQ7 A;  4U88 A;  5D6F A;  1MKM A;  4I0B A;  2KJB A;  4HV5 A;  2HFH A;  3SQN A;  4G6D A;  4LD5 A;  2IRF G;  1FNN A;  1IUY A;  4G94 A;  3WTU C;  2ZKZ A;  3VEP A;  1OR7 A;  3ZMV A;  2MH9 A;  4GYI A;  1ZGJ A;  5LGU A;  1BC8 C;  2E7W A;  2WWY A;  2Z9O A;  3U2R A;  1Z9C A;  1LDK B;  4YII A;  4M73 A;  2RC4 A;  1JHF A;  2GA2 A;  2GXB A;  4MGR A;  2WV0 A;  1LDD A;  2XAS A;  4KIC A;  4O3M A;  3GFM A;  4L9J A;  4IJA A;  5A2Q K;  2FML A;  1YS7 A;  3LAJ A;  3K2Z A;  1KQ0 A;  2E7X A;  3I53 A;  3IKV A;  3ZN1 A;  3DXJ F;  4HYE A;  1ZN2 A;  1HBX G;  3O3K A;  1TQM A;  2ESH A;  3K1N A;  5F1R A;  2CW0 F;  3E6B A;  3WTX C;  3LAP A;  4OIN F;  5ERI A;  2FXA A;  2V6C A;  3KEQ A;  1YFH A;  3IKT A;  5K5O A;  2DK8 A;  2PN6 A;  3WE3 A;  3E5Q A;  4HF1 A;  1ZRC A;  3QPH A;  1R58 A;  1QQI A;  4G7H F;  2OQR A;  2W84 A;  3HRS A;  2MH2 A;  5K5Q A;  2DBB A;  1DUX C;  3V7R A;  4RB0 A;  2QUF A;  3MEX A;  2EFQ A;  2F5F A;  1XD7 A;  1F4K A;  3DKW A;  2P7V B;  2ZBK A;  1PP8 F;  1K78 B;  1SD4 A;  5DV5 A;  2HZT A;  4N0B A;  3ECO A;  3ABU A;  4L9T A;  2XVC A;  3RKW A;  5ILV A;  2VBW A;  1L0O C;  1O3T A;  2K4B A;  4E70 A;  5HVQ C;  4S05 A;  2UZK A;  4AIK A;  4CGZ A;  1T6S A;  3QAH A;  1W7P A;  3F8B A;  4A6D A;  5HS7 A;  2HOE A;  2QQB A;  1PP7 U;  2XAG A;  2BEO A;  3WTT C;  1EH7 A;  2FBH A;  3F8N A;  4OMY A;  1RUN A;  2OAZ A;  4EQQ A;  2EWN A;  1R00 A;  3T8R A;  3P7N A;  1ZRD A;  3HYI A;  1UHM A;  3TDU C;  1T98 A;  5J8C A;  1R22 A;  3GXO A;  5L3D A;  4GCV A;  4BHC A;  1HKS A;  1ODD A;  2M5W A;  4FT8 A;  1Z05 A;  3F6V A;  5FFZ A;  1BJA A;  2CQK A;  2EFN A;  4BHB A;  4CYD A;  4RAZ A;  5IT3 A;  2VBY A;  3J7A O;  3JTG A;  4ZYG A;  2AS5 F;  2A5Y B;  3W6K B;  1P4W A;  3M8E A;  1RUO A;  1QZZ A;  2Q2E A;  2HWV A;  5DDG A;  4Q4Z F;  4LMY A;  2BYV E;  4P5O A;  2KRF A;  3MCZ A;  1XSV A;  2VC1 A;  1P4A A;  2RNJ A;  2M45 A;  1IRF A;  3IHU A;  2BGC A;  2VC0 A;  4DNC A;  5BOX A;  2IA2 A;  3QRF F;  2DI3 A;  4XRF A;  3HSF A;  3GZ6 A;  4P9U A;  1HW5 A;  4Q5S F;  2UXX A;  4L18 B;  2B0L A;  4ZYH A;  3I59 B;  2R7F A;  4GXO A;  2K4J A;  1MDM B;  3ISP A;  2DW4 A;  1OPC A;  3WU1 B;  3H3U A;  1DPR A;  4R1H A;  3IRR A;  2DU9 A;  4BAY A;  1B1B A;  5E1W A;  2PLY A;  3HHH A;  2CO5 A;  4EJT A;  1XSX A;  2E1N A;  1LEB A;  1T39 A;  1S3J A;  3WGI A;  1R7J A;  1SD5 A;  1H9T A;  1HKT A;  5CLS A;  2EK5 A;  1ZLJ A;  3BRO A;  2PMU A;  3TOA A;  1X3U A;  4G6Q A;  5H6Q A;  1K6O A;  1XMA A;  2ZME A;  1R36 A;  4MQ9 F;  2LKP A;  5L3C A;  2IP2 A;  2MLG A;  1G3T A;  2JT1 A;  1FY7 A;  1ZAO A;  2DQL A;  3K0L A;  5AON A;  2MBF A;  1OKR A;  1L3L A;  5D5U B;  4N9I A;  2V9V A;  4MEY F;  2CYY A;  1S29 A;  3QOP A;  2P4W A;  4G7Z F;  2ZJ2 A;  2GIV A;  1DDN A;  3U9G A;  3LWF A;  1U78 A;  1DP7 P;  1XDS A;  4KUM A;  2KKO A;  3HOS A;  3E97 A;  5IT9 K;  3V7C A;  3WGH A;  3E5X A;  5D4R A;  2ZFW A;  3CDH A;  3V8L A;  2DPD A;  2RQP A;  2FRH A;  2Z3Y A;  2R3S A;  1P6R A;  2P5V A;  2V1D A;  2H09 A;  2Q8K A;  2FQ3 A;  1U5T B;  2XIG A;  2X4H A;  1LJ9 A;  1IN5 A;  3GX4 X;  2K7L A;  4LG0 B;  4UXN A;  1FP1 D;  4ETS A;  3LA7 A;  1FPQ A;  2HTJ A;  3C1D A;  1R1V A;  1ZRF A;  4LJZ F;  3HIF A;  2C6Y A;  5CYV A;  4A0X A;  4HLY A;  4JBA A;  1U6G A;  4Z2Y A;  1VTN C;  1JE8 A;  4BYY A;  3TOB A;  1I1G A;  2HS5 A;  3QPT A;  2J5P A;  5JI6 A;  3WTS C;  2FSW A;  1ULY A;  3F72 A;  1Y0U A;  1CF7 A;  2JRT A;  1ZGA A;  4IPA A;  4EM2 A;  3B02 A;  5JHU A;  3RYP A;  1ZLK A;  1XN7 A;  1O7F A;  4HA8 A;  4UV9 A;  1ZG5 A;  3T5X A;  1V4R A;  4R79 A;  2DPU A;  4L0Z B;  3FHZ A;  3JAM K;  3HRT A;  2VXZ A;  1U2W A;  4D0P A;  2NYX A;  2NRA C;  1YO5 C;  4M74 A;  4ZH4 F;  2JPB A;  2XAF A;  1TW3 A;  3R4K A;  3R60 A;  3SHF A;  1J75 A;  1T38 A;  5LEJ A;  4L0Y B;  1KU3 A;  1ZRE A;  2L01 A;  2XUB A;  3EDP A;  1B9N A;  2P8T A;  1TTY A;  2PG4 A;  4WF2 A;  1CGP A;  2K02 A;  3J80 Z;  4KN4 X;  3HTS B;  1WRJ A;  1PDN C;  1D3Y A;  3GO5 A;  1RI7 A;  1LVA A;  5TRD A;  1LDJ A;  4ENN A;  2XRO A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...