3WU1B

Crystal structure of the ets1-runx1-dna ternary complex
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
105
structure length
105
Chain Sequence
b'GPIQLWQFLLELLTDKSCQSFISWTGDGWEFKLSDPDEVARRWGKRKNKPKMNYEKLSRGLRYYYDKNIIHKTAGKRYVYRFVCDLQSLLGYTPEELHAMLDVKP'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Runt-related transcription factor 1
publication title A novel allosteric mechanism on protein-DNA interactions underlying the phosphorylation-dependent regulation of Ets1 target gene expressions
pubmed doi rcsb
source organism Mus musculus
molecule tags Transcription/dna
total genus 35
structure length 105
sequence length 105
ec nomenclature
pdb deposition date 2014-04-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00178 Ets Ets-domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 3wu1B00
4G7ZF 3CO6C 1D8KA 4ZH4F 3L09A 4M9SA 1ZRFA 1FZPB 3WU1B 2QBYB 2L01A 4HDVA 4S04A 3KFWX 2K7LA 2KJCA 3SXYA 1MDMB 1J75A 1J59A 4L5JA 2NS0A 1OYYA 1B1BA 1Z7UA 2IVMA 2K4BA 3LFKA 4IXAA 5ICEA 1F5TA 2V1DA 3KCCA 5ED4A 2DPDA 1KU3A 3WTVC 5FD5A 5HDGA 3GZ5A 2WWYA 3DEUA 4LLNA 4UUVA 3KZYA 4A0YA 2NNYA 1ZG1A 2OAZA 4P9FA 1BI0A 2H27A 5CLSA 1PP8F 1TBXA 2DO7A 3ZQ7A 2EFNA 1T2KA 2IW5A 5D5WB 3E6BA 2K27A 3HOSA 4CYDA 1ON1A 5LHIA 1YLFA 2G7UA 5DYMA 3B73A 4G6QA 3F6VA 3KZZA 3GW2A 1O7FA 4PCQA 4LLLA 4RB3C 1AOYA 4L18B 3ZMVA 3CTAA 1IN6A 3HRUA 1FX7A 3MEXA 4CHUA 4GO1A 4HQEA 2GZWA 3KEQA 4I02A 1RIOH 1O3TA 2GXBA 3D5LA 2WTEA 3WTZA 2A3SA 3Q9SA 1FSHA 4Y17A 4IHSA 2DI3A 2HR3A 1V3FA 2ZO4A 2ISYA 4FX4A 4ENNA 2M5WA 2FQ3A 4AIJA 1U6GA 1ZGJA 2CFXA 1WRJA 3ZMZA 4KMFA 2PBIA 3RKYA 4KA4A 3WTYC 2NRAC 2J5PA 2AXLA 2HEOA 4I7HA 3SHFA 1ODDA 1FYLA 3TOBA 3TO9A 2JT1A 2QWWA 4EVIA 2ZMEB 4L0YB 4XLNF 3I71A 4CZZA 2R7DA 2FMLA 2YSRA 1Z9CA 2WC2A 4KIBA 2M8EA 3RPQA 2RQPA 2JZYA 3J80Z 3FZVA 3H3UA 5H6QA 4P5OA 5LGTA 3F8NA 2Y75A 2UXNA 3DKWA 1SFEA 1J9IA 5LLQA 1R23A 4GYIA 4Y13A 1I1GA 3ABTA 3I53A 1BI3A 3MWMA 4LD5A 2VT2A 4EJTA 2MD5A 4EJVA 1J5YA 3D0SA 3I0TA 5HS8A 1Z91A 2EA4A 3LQRA 4PGGA 4NHJA 1BOAA 1XCVA 2F5CA 1DPUA 1ZGAA 3KP6A 3EDPA 2P8TA 4Z2YA 3KE2A 2J5OA 4A6EA 3IRRA 4LK0F 1T0FA 3QPTA 1YG2A 3M8EA 2Z3YA 5FLXK 1IZ1A 1TNSA 2E7XA 5JR3A 4HF2A 3K9TA 1K6OA 1BIAA 2XKOA 3KP2A 3QU3A 4GGGA 3HTUA 1PDNC 4LMYA 3RKWA 2VBYA 4HX8A 1U5TC 1P4AA 1QPMA 2MA3A 3JW4A 2OZUA 2V9VA 1CF7A 2QENA 1LEBA 3G3ZA 3RTRA 2A6EF 1IXRC 1HBXG 1A04A 1SD5A 3E5QA 4L9JA 4R79A 4WF2A 4M74A 1XSDA 4EMSA 2GXGA 1Z1DA 1MD0A 2FU4A 2RNJA 2MH2A 4Q5SF 4L9TA 5LBQA 3GF2A 3LA7A 3KLOA 4IF4A 2XAGA 1FNNA 4A0XA 1FC3A 2QZ8A 2D1VA 3NEUA 4I2OA 3ECOA 4ENJA 4OU0A 5HS7A 2ESHA 2O6GE 2VONA 4N9IA 2QBYA 2CSOA 3AAFA 1MDMA 3ZMDA 3F21A 1ONVA 1JHFA 2BE5F 2MH9A 2EK5A 1ZARA 4EGZA 2Z99A 2ZXJA 2XVCA 5DCFA 5E8IA 4RGXA 4BHCA 2YU3A 3IL2A 4RS8A 1YIOA 1V4RA 2H6CA 2VT3A 4OIQF 1O3RA 2G9WA 2VOOA 4KFCA 1OKRA 5BQTA 2HQRA 3WGHA 4IVNA 3HSFA 2VC0A 3WTWC 2W24A 2BGCA 5J6XA 2PN6A 3JAMZ 2K02A 4G6DA 3BOQA 3GO5A 3V8LA 4NB5A 2Z33A 1YW7A 1HKTA 4JQFA 2E1CA 4IRHA 4CGZA 4QWQA 5DCMB 1S8NA 5CVRA 4FHTA 1UCRA 4G7HF 4IPAA 4JBAA 5TRDA 4L9VA 5LHHA 1JE8A 4ZYDA 2PG4A 1B59A 3HRMA 1XN7A 2PEXA 1HKQA 2GAUA 2X0LA 5LRRA 3JTHA 2KIUA 2L4MA 3SQNA 3WTXC 3CUOA 1QZZA 2R7FA 4ENKA 5HLGA 3ZN0A 5CVIA 2GQQA 4H0EA 4ZYHA 4A0ZA 2HWVA 2Y0MA 3FMRA 4KDPA 4ON0A 2FMYA 1YW9A 3QP6A 3DPLC 1IAWA 2BYVE 1HW1A 3QP5A 2PI0A 1JGSA 1OR7A 2CO5A 3P9CA 3RIRA 1FWZA 3TDZC 4L9NA 3RPUA 1VTNC 4BHPA 2A61A 4PZJA 1G3TA 5K5RA 2VE8A 4AIHA 5BS6A 3JTGA 1R00A 4YIFA 4UXNA 4YFNF 4FX0A 2P5KA 1LB2A 3P9IA 2VOPA 1C0WA 5HVQC 5L3BA 1XMKA 4UVCA 5LEKA 4AWXB 1J7KA 2H94A 2CYYA 1YYVA 3K1NA 2F5EA 4Q4ZF 1Z05A 1B9MA 3BJAA 4KNYA 5FO5A 5HDNA 3F8BA 3J80K 1R1VA 4O3MA 4UV8A 3VFZA 4EQQA 3E97A 3DV8A 3V8JA 4EJUA 4BXUA 3HYIA 2EV6A 5CVUA 1MJ9A 4HZFA 1HW2A 1LDKB 1BC7C 3N4MA 2DQRA 3JSOA 3HTSB 3COAC 2L54A 1S3JA 3FXRA 3T8RA 4OIRF 1DP7P 2TDXA 2BEOA 2L02A 4U88A 2B0LA 3QOPA 2ETHA 2IT0A 3BDDA 1XDSA 1KYZA 4RB0A 3GVAA 1L3LA 1SAXA 2ZKZA 2OQRA 1ZHFA 4HV6A 2XGXA 2DAOA 1TQIA 3QPHA 2XIGA 4YG2F 1PUEE 4WXDA 2P4WA 4HLYA 2R3SA 3NQOA 2IA0A 4GYGA 1FBUA 2O0YA 1YFHA 1ZRDA 3PQKA 3RDIA 3U2RA 2M87A 3SZTA 3V7CA 4ETSA 2PMHA 1RUOA 2RN7A 4CO8A 2EFWA 4HDUA 2LNBA 2Q0OA 1FOKA 5ILUA 3HSRA 2XAHA 3HHGA 3DF8A 1EH8A 1HKSA 1BC8C 2Y48A 4IRIA 3WE3A 2QYOA 1U5TA 4HF1A 2E1NA 4HF0A 3IWFA 3TQNA 4GCVA 2DK5A 1JXSA 1OPCA 2XASA 4I01A 2LF8A 1LDDA 4ZZLA 1W7PB 1MGTA 3S2WA 4GXOA 2HKOA 1YW8A 1WSUA 2IRFG 2XAJA 2BV6A 1EV7A 1DUXC 1IXCA 5D4SA 3HIFA 1S7OA 3F72A 3PFIA 1SFXA 1G3SA 2ZBKA 4LFUA 3FX3A 1OYIA 4KT5C 2JPCA 5FFZA 4XLPF 4OOIA 2FBKA 3MCZA 2F2EA 2V1XA 4HV5A 5E1ZB 4I98B 3JSPA 2DQLA 3LQQA 2C6YA 1RI7A 1F1ZA 4LGWA 1UB9A 2EV0A 5DD4A 1UHWA 3GFMA 4LB5A 3ULQB 1I27A 1S29A 2Z9OA 2Z5UA 2O8XA 5DCMA 2JSCA 1KU9A 2EFQA 4MEXF 3FM3A 5CVVA 1R7JA 4WXHA 3V7RA 3OOPA 3CUQB 2QUFA 2XRNA 1XSVA 1REPC 2O03A 3JAMK 5A2QK 3GEZA 2EFPA 3K2ZA 3F8FA 3R0AA 3LWFA 1D8JA 3RJPA 1IRGA 1OYWA 5ERIA 3FXQA 4YFKF 1IXSB 2LKPA 2F5DA 2FF4A 4WX9A 2HYGD 3WU0A 5ILSA 3EUHA 1JHHA 4HLXA 2HQNA 4PGHA 3IKTA 3CJNA 1BI1A 1K78A 2ZNZA 4HX7A 4RGSA 2D1HA 3F23A 4OMYA 2FRHA 4MHGA 2P5VA 3BY6A 4JK1X 4KICA 1T98A 4N0BA 2NNNA 2M45A 4EM0B 2GA2A 2HTSA 4LJZF 2O3FA 4F7ZA 3K1PA 2STWA 1ZAOA 5FFXA 3T0YA 1R1TA 1J2XA 1XMAA 2STTA 3J7AO 2X4HA 6PAXA 3PQJA 2A6HF 2OZ6A 1YO5C 2L3DA 3TO6A 2M30A 4U7DA 1FLIA 4XBFA 5D6EA 3TDUC 3LAPA 2DK8A 1KQ9A 4M72A 3E6CC 1XSXA 1LEAA 1IRFA 4HBLA 4UVAA 3IHUA 4RGUA 1ZYRF 2YX4A 1FYKA 3TO7A 3BPXA 3GXOA 2COMA 5D4RA 3F8CA 1F4KA 3L7WA 3ROUA 1K7AA 1EH7A 1L0OC 4EGYA 4KUMA 4UV9A 1RUNA 5HS9A 4MNUA 3WG9A 1P2FA 3ZMSA 3P9KA 4KIGA 2DU9A 2OQGA 3RKXA 1U78A 1ZRCA 3E3VA 1QZYA 3FHZA 3GZ6A 1J0RA 1T39A 1DPRA 1USSA 4EJOA 3M7GA 4FT8A 4WK8F 1QQIA 1LJ9A 4B8XA 1W5TA 3U9GA 4ZYGA 4UNOA 3LA2A 1FY7A 3KP5A 1USTA 1KA8A 3ZN1A 5A2QZ 4RGRA 3I59B 2G7HA 4KN7X 3V7SA 1TW2A 2MLKA 1KQ8A 4G94A 2XAFA 3BWGA 1TTYA 3MQ0A 4OIOF 2FXAA 1Q1HA 1R58A 2KIFA 3R0JA 3RYPA 2DW4A 1TW3A 1YS7A 3WTSC 2XV4S 1ZLJA 5L3FA 1SMTA 3F8MA 2RGVA 1GHCA 4BNCA 1QBJA 2ZJ2A 2RDPA 3E6MA 5CYVA 2HGCA 3BJOA 5JI6A 5EEHA 3HSEA 1XCBA 3R60A 3O3KA 3C1DA 2GWRA 3L2CA 3WE2A 2DLLA 2A5YB 2VODA 4DNCA 2OA4A 5LEJA 1LVAA 5HDKA 2PLYA 5J8CA 5F64A 1CGPA 5KVRA 5LRSA 3RYRA 2P7VB 5HLHA 2H09A 2PJPA 2K4JA 1XGOA 4ASNA 5K5QA 1ZLKA 1ON2A 4YIIA 4L0ZB 4MQVA 2PFBA 3GFLA 1KGSA 4KYWA 2ZMEA 5AONA 3ZP5A 3DXJF 4M9XA 1I6XA 3FXUA 3BP8A 4KN4X 1QNTA 2ZFWA 5DV5A 4BHBA 5FD6A 1O3QA 1WKMA 3M1EA 2XAQA 5TJJA 5K1YA 3V8KA 3OV8A 2VBWA 1FPQA 1B9NA 2DBBA 5JHUA 1F9NA 3FF5A 5D8LB 1IF1A 1FBQA 4UVBA 2W25A 3R4KA 1SFUA 2IA1A 1YQAA 1G3WA 3LAJA 3WTUC 1B6AA 1CF7B 3QRFF 4OIPF 4A5NA 1KU7A 1KQ0A 3EQLF 3Q5FA 5HLIA 1UHMA 1ZG3A 3B02A 3ISPA 4HAMA 4WWCA 3MFKA 2W85A 3K69A 4RB2C 1O3SA 4HYEA 1MKMA 1E17A 2NYXA 4Y15A 1XGNA 3H3ZA 3ZMUA 5E18F 5E17F 1W7PD 1Y0UA 3V4GA 1KU2A 1NHAA 4O6JA 2JPBA 4D0PA 2A68F 4EM1A 3DP7A 5JFRA 4ZYEA 1IN5A 2VBXA 3REOA 1G4DA 4BH9A 3F22A 4U0VA 4UHTA 3N97A 3DFGA 3I4PA 4K2EA 1B4AA 3Q9VA 3E5UA 1XB4A 4U0YA 4EM2A 3ZMTA 2QLZA 2Q8KA 2FEZA 1AWCA 4WXCA 1MZBA 5FB2A 4AIKA 4ESFA 3EETA 3TGNA 3WGGA 1TQMA 4XSZF 1SD4A 1GXPA 4DQ2A 1Z6RA 5DUKA 4AVPA 2HYFA 4MTEA 4LB6B 1I1SA 4ESJA 1G3YA 3QAHA 3KP7A 3GX4X 2D45A 4MQ9F 1H9TA 4IJAA 1DDNA 1HSTA 2XROA 2YPRA 1BBYA 3CDHA 4S05A 4ZZDA 5FGMA 3CO7C 4HOBA 3E5XA 5L3EA 2KJBA 2M1BA 1BJAA 1FSEA 3DPTA 2E7WA 2FOKA 2KKOA 5F6FA 5IT9Z 1R5HA 4BYYA 3SZPA 2UXXA 2EWNA 5JVTA 1IN8A 2V79A 3GWZA 5ICFA 1O57A 2FNAA 3KP4A 2MC3A 4LG0B 3TKYA 3W6JB 4RB1A 3M8FA 1FP2A 2RV8A 2OU2A 2EA2A 3RI4A 4M71A 2V6CA 4P55A 3CLOA 5L3GA 1T38A 3ZPLA 3T5XA 4HW0A 3CUQC 2CW0F 5CJ9A 1BIBA 2ACJA 3DQVC 3NRVA 4MTDA 3M9AA 3MZYA 3FMQA 1D5VA 5LGUA 2HZTA 2RVCA 3I59A 2IP2A 2ZNYA 3KLNA 3W6KB 2VN2A 4R8HA 2DPUA 1WI9A 2OD5A 2FE3A 2FBIA 3F3XA 2L4AA 1I5ZA 3ERED 2JRTA 2Q2EA 2DFIA 2W84A 4RAZA 5BMZA 4WCGA 3BJ6A 2FBHA 2PMUA 2P6TA 1OMIA 1SD7A 4O5VA 2RKHA 5D6FA 5D8KB 2VE9A 3TOAA 5EEGA 4ENMA 5F1RA 4G7OF 2MLGA 1EH6A 2D2WA 5HOOA 4QLCU 3HOTA 5DEQA 1ZREA 1W4MA 1PP7U 4I0AA 5E1WA 2W57A 1YTYA 2H6BA 2EV5A 1ULYA 4N9HA 3L9FA 2IJLA 3F6OA 1SMYF 4M9ZA 4R1HA 4XRFA 4EJWA 1HXDA 2ZCWA 2EB7A 3IWZA 2XKPA 4M6YA 4A2UA 1D3YA 1U3EM 2VC1A 2ISZA 1Z6TA 2QQBA 3BZ6A 3BPVA 4CXFA 3GFJA 3O6BB 5ICCA 3EYIA 4KIFA 1STZA 1GVJA 1WWXA 1T6SA 4OINF 2DTRA 3I5UA 4P96A 5DDGA 1K79A 1KYWA 5LGNA 1FBSA 1U8RA 2HOEA 3IC7A 1U2WA 4U0WA 3KEOA 4IRGA 3HUGA 4KMUX 3GFIA 3KP3A 5LHGA 4G9YA 2YX7A 3K0LA 3R61A 1LDJA 5L3DA 2A07F 3WTTC 2QM3A 2FSWA 3KETA 2DT5A 3GYHX 3H92A 3E6DA 4A12A 2YR2A 4B09A 2JTVA 5BPDA 1R36A 3R6SA 3U1DA 1HSJA 2F5FA 3VEPA 4IHTA 4G8XA 3BROA 1MJAA 3HRTA 1XGMA 3LSTA 3T8TA 2XHKA 1RZ4A 1XD7A 2CG4A 3GUDA 1TQPA 2XUBA 4BQAA 3J81K 2IPQX 2KRFA 3SFZA 1U5TB 1ZH5A 4TV7A 4CDGA 2ESNA 2KIMA 2QQ9A 4PDKA 1IN7A 3K1MA 3GLXA 2HS5A 4HA8A 3C3WA 3O2PE 5E8GA 4U7BA 4M6XA 3WGIA 2UZKA 2MBFA 2CQKA 1H9GA 2IA2A 1YS6A 4HQMA 5CVJA 2EFOA 1FT9A 2V1UA 3MZHA 4E70A 5BOXA 1BM9A 5K5OA 4NQWA 2CGPA 3G73A 2HKXA 5H6RA 3I54A 2LSOA 5BPIA 2HTJA 2HDCA 5E20A 1P4WA 3MAJA 2LDUA 5IT3A 4EV0A 3QU6A 4BAYA 3ABUA 1P4XA 5AIPA 4MEYF 5J8FA 3L00A 4LG0A 4I09A 1W7PA 4XSXF 2PQ8A 1HQCA 2VBZA 3ML6A 4L5IA 3VOEA 1IN4A 1IW7F 2AS5F 4Q47A 1ZN2A 2CWEA 5FLXZ 2QQAA 1S7AA 4CICA 5IT9K 4LLGF 5E1XA 2A69F 2LF7A 4M73A 1XDUA 4OMZA 3HHHA 2P5LC 1O7LA 1WQ2A 3WODF 3I58A 3I64A 3ECHA 4MGRA 1SD6A 3FMSA 2UWMA 4Q48A 5H20A 2RC4A 1LNWA 3T1BA 4YFXF 2FNPA 1K78B 1G6NA 5D5VB 1ZG5A 1RNLA 1BI2A 1FP1D 1R22A 1GXQA 1P6RA 2P6SA 3ELKA 2OBPA 5DD8A 5D5XB 3FM5A 5AIQA 1FYMA 1MJBA 1TLHB 1IUYA 5ILVA 1BN5A 4I0BA 1S6LA 2NAZA 3CUQA 4HX4A 2VXZA 1R5GA 3FWEA 1W5SA 4ESBA 5ICGA 3J81Z 2EJRA 5KK1A 2GA1A 3HRSA 3C18A 2QVOA 3VB2A 1UFMA 3IKVA 3VODA 2ELHA 3P7NA 3LA3A 2GIVA 1TNTA 5D5UB 1XGSA 1LQ1A 2O61A 4P9UA 1QGPA 2HFHA 1HW5A 2FA5A 2K86A 1E2XA 3C7JA 2P7CB 2BBYA 1QO0D 1X3UA 1H0MA 3EYYA 4LK1F 4A5MA 5L3CA 2WV0A 5DUIA 2ADUA 3IRQA 4RAYA 1R1UA 1P92A 4A6DA 4AD9A
chains in the Genus database with same CATH superfamily
4G7ZF 3CO6C 3J7AY 1RR7A 1D8KA 4ZH4F 5M3MJ 3L09A 3PNTA 4M9SA 1ZRFA 3K4CA 3RQIA 2LY9A 2JUCA 1FZPB 3WU1B 2QBYB 2L01A 4HDVA 4S04A 3KFWX 2K7LA 2KJCA 3SXYA 4BE2A 1ETYA 1MDMB 4CUGA 3I9V2 1J75A 3PNVA 1J59A 4L5JA 4IEJA 4FCYA 3NWTA 2NS0A 1U8BA 1OYYA 3OL3A 4L5EA 2XGEA 2ZXWH 2DYSH 3PUBA 1B1BA 3S3NA 1Z7UA 2IVMA 2K4BA 3LFKA 4IXAA 5ICEA 1F5TA 1TWHJ 2V1DA 1Z3XA 3OIPA 3KCCA 1FOYA 5ED4A 1VFCA 2DPDA 2RQQA 2IS4A 2VKHA 2R7RA 1KU3A 3QYEA 2CH0A 3WTVC 4HRIA 5FD5A 2EZIA 3OSFA 5HDGA 3H0DA 2WY8Q 3GZ5A 5EG0A 2WWYA 1APLC 3DEUA 4LLNA 4UUVA 3KZYA 2CU7A 2EH3A 4A0YA 3H5NA 1IDZA 4PSWA 2NNYA 1ZG1A 2OAZA 3BG7A 4XOTA 5FLVA 4P9FA 5DTDA 4XLCA 3L2UA 1BI0A 3OYBA 2H27A 4XMYA 1IC8A 5CLSA 4DYCA 1PP8F 1TBXA 3HXLA 4KISA 3RSNA 2R5YA 1Z67A 5HNHA 2DO7A 3ZQ7A 2EFNA 4IQ4A 3CF2A 2QCOA 1T2KA 2ECBA 2IW5A 5D5WB 4FETA 4DBRA 3E6BA 2K27A 3HOSA 4CYDA 1ON1A 2VKVA 5LHIA 1YLFA 2WAEA 3OS0A 2D5VA 3OY9A 2KLOA 2G7UA 5DYMA 4BU2A 3EPZA 3B73A 5TGTA 2LOOA 4G6QA 4MFDA 2IGNA 3F6VA 2VB6A 3KZZA 3G71I 3GW2A 1O7FA 1RC9A 4PCQA 4LLLA 4RB3C 1T33A 3RZOJ 2KRCA 3ERMA 1AOYA 3ZQGA 1G2HA 3HJEA 2KZGA 4L18B 2BVLA 4QPQA 3ZMVA 3ZQIA 4PJMA 3CTAA 4A3GJ 1OR7C 1IN6A 3DTKA 3HRUA 1FX7A 1Y56A 2K3PA 3MEXA 4CHUA 4GO1A 4KJZA 4HQEA 2GZWA 3KEQA 4I02A 2VJJA 1RIOH 1O3TA 1B8IB 3E1SA 2GXBA 2R92J 3D5LA 1X2NA 2WTEA 1P9QC 4GRIA 2VQGA 4CCMA 4M3BA 3WTZA 1IG7A 2A3SA 3IH2A 3Q9SA 1FSHA 4NC6A 2H1LA 2MGQA 4Y17A 4IHSA 1X3WB 2DI3A 4D7MA 1K4TA 2MC4A 2HR3A 5FRNA 1V3FA 2ZO4A 2ISYA 3FISA 4FX4A 4ENNA 9ANTA 2M5WA 2R7VA 2FQ3A 4AIJA 1U6GA 1ZGJA 2CFXA 2WBMA 2JA5J 1SVOA 1WRJA 3A0HC 3ZMZA 3J7YJ 4KMFA 2PBIA 3RKYA 4KA4A 3WTYC 2NRAC 1OQYA 2J5PA 2AXLA 1T8IA 2HEOA 2DT6A 4I7HA 1FIAA 3SHFA 1ODDA 1FYLA 2E2IJ 3TOBA 2R5ZB 3TO9A 2OPTA 2JT1A 2QWWA 4EVIA 2ZMEB 4L0YB 3HBLA 4XLNF 3TEDA 3I71A 4CZZA 2R7DA 3LSMA 2FMLA 2YSRA 4XKWA 5J1YA 1Z9CA 2WC2A 4KIBA 2M8EA 3RPQA 2RQPA 2JZYA 3J80Z 3I4MJ 3CCSI 1ZTRA 4OAYA 3FZVA 3H3UA 5H6QA 5B5EC 2A5WA 4P5OA 5LGTA 4HSTA 1WJDA 4M3GA 3F8NA 2Y75A 3G1OA 1VQLI 2HZDA 2UXNA 1OCTC 3DKWA 1SFEA 3B6CA 1J9IA 1A5JA 3DBHB 5LLQA 1R23A 4J00A 3K4MA 3WG7H 2LTPA 4GYIA 2HXOA 2VPRA 4Y13A 4JX4A 1TWCJ 3A01B 1I1GA 3MMYB 3ABTA 3I53A 1A35A 1BI3A 5IYDJ 3MWMA 1AKHA 1MBHA 3WU2C 3G2BA 3DPUA 4PFOA 2YS9A 4LD5A 4Y33A 1TP4A 2VT2A 4EJTA 2MD5A 4EJVA 1J5YA 3D0SA 3I0TA 2X1DA 5HS8A 1Z91A 2DMTA 2RAEA 5C3EJ 2EA4A 3CP2A 3LQRA 4PGGA 3VDXA 4NHJA 5J3LA 5M5XJ 1BOAA 1XCVA 2F5CA 1X1PA 1DPUA 3W2WA 1ZGAA 3KP6A 3EDPA 1XC5A 3UR3C 2P8TA 4Z2YA 3PIOF 3KE2A 5F0FA 2O5RA 1MNMC 2J5OA 4A6EA 5IOYA 3IRRA 2QSGX 1ITYA 4LK0F 4CZCA 3B6AA 1T0FA 3QPTA 1YG2A 2WA0A 2ZXHA 1MBJA 4CYCA 1AHDP 3U21A 1NH3A 3M8EA 2Z3YA 5FLXK 3GBGA 4XQFA 3LSIA 1MBKA 1IRZA 1IZ1A 1TNSA 2E7XA 2V9KA 3BR5A 3MZ8A 5IYBJ 4B4CA 3K9TA 5JR3A 4HF2A 3OS2A 1K6OA 1YIJI 1BIAA 3GTKJ 1XS9A 2X6WA 2XKOA 1T08B 3KP2A 3QU3A 4GGGA 3HTUA 3ESWB 1PDNC 4LMYA 3RKWA 2F48A 1F43A 2VBYA 4HX8A 2DDAA 4XICA 1U5TC 1P4AA 3ZQQA 2R0QC 1QPMA 5IPAA 3H35A 4XKBA 2MA3A 3JW4A 5GPAA 2OZUA 2EZLA 2V9VA 4QPOA 3PUFA 1CF7A 2QENA 3S15J 1LEBA 2CMPA 3G1MA 4UB8C 4BKXA 3LSGA 3GMEA 2XPVA 3DLLF 3G3ZA 3RTRA 2A6EF 4A3EJ 1IXRC 4E7IA 1HBXG 2JQ7A 4JOMA 1A04A 2Y0SA 1SD5A 3E5QA 2DJNA 4L9JA 3TP3A 5B66C 3TMOA 3CC7I 4R79A 4WF2A 4M74A 1XSDA 2DA7A 4EMSA 2GXGA 1Z1DA 2M9HA 1MD0A 2FU4A 3DCFA 1ETWA 2RNJA 5CQGA 5FKNA 2COBA 1YJ9I 1PJRA 1VQ5I 2MH2A 2F5VA 4Q5SF 2KZVA 4L9TA 5LBQA 1ETOA 3GF2A 3LA7A 1RRJA 3KLOA 2DMQA 3OYJA 4A3LJ 2DA5A 3HOUJ 3OYFA 4XLFA 3OL4A 4IF4A 5CPRB 3HOVJ 1WJAA 2XAGA 1FNNA 2FD5A 1Z21A 4G6TB 4A0XA 3W3CA 1VZ0A 2NVUB 4DBQA 1BJZA 1FC3A 2QZ8A 2D1VA 3NEUA 3H0GJ 4I2OA 3ECOA 4ENJA 4OU0A 1S9HA 5HS7A 2ESHA 2O6GE 2V6EA 4A3MJ 2VONA 4N9IA 2QBYA 2CSOA 2JA8J 4XLHA 3AAFA 2QA4I 3W2VA 3GZNB 1LKXA 1MDMA 1JUSA 3ZMDA 4BGDA 1FTTA 3F21A 2LREA 1ONVA 1JHFA 2BE5F 2E5ZA 2MH9A 2EK5A 3LMMA 1D0ZA 1ZARA 4EGZA 3BTLA 2Z99A 4LIVA 3K7AJ 2IAIA 2ZXJA 1TWGJ 2I10A 2XVCA 5DCFA 4A3JJ 3JRIA 1X2MA 5E8IA 2EINH 4RGXA 4HNVA 4BHCA 1VQPI 2YU3A 3IL2A 4DOZA 4RS8A 1YIOA 4C2TA 3S14J 3OWTA 3OYNA 2IXSA 1V4RA 2H6CA 3H9JA 2VT3A 3D5RC 1R4NB 4OIQF 1O3RA 2G9WA 3KZIC 1RETA 2VOOA 2DFEA 4KFCA 1OKRA 5BQTA 2HQRA 4P1WA 5E3LA 3WGHA 1B72B 4UUSA 4IVNA 3K10A 3HSFA 1W36D 1X1CA 2VC0A 1EA3A 3WTWC 1SVMA 2W24A 2BGCA 5J6XA 4NDLA 1V54H 3WHCA 1VI0A 2PN6A 3BG6A 1WCMJ 3VPRA 2ZC2A 3JAMZ 2K02A 3BZKA 5JLXA 4IHXA 4G6DA 3BOQA 2ZSHB 4JX5A 1TT5B 4D5CA 4YEJA 3GO5A 3V8LA 3J7ZI 4NB5A 2Z33A 3PL8A 1YW7A 2CQQA 2VKEA 1ZK8A 2WAFA 3BR6A 1HKTA 3M8JA 4EEFG 4JQFA 3RZDJ 3DKXA 1TZLA 3LOCA 1HC8A 2XAUA 4F55A 3QPSA 4U87A 2Q2EB 1BR2A 2E1CA 5EF6A 1J09A 4IRHA 1OCCH 2K85A 5FROA 4CGZA 2CUFA 1IRXA 1RPWA 4QWQA 5DCMB 1S8NA 2V4JC 1VF9A 5CVRA 2WB1N 4FHTA 1UCRA 4G7HF 4IPAA 4JBAA 5GAEJ 3JRBA 4A3KJ 2NVTJ 5TRDA 5KCMA 2OTJI 4L9VA 5LHHA 1N25A 4BACA 1JE8A 1R71A 4ZYDA 2Z16A 2PG4A 1B59A 3HRMA 4BE1A 2CQXA 1XN7A 3BT9A 2DA1A 2PEXA 1HKQA 3IP4B 1Y6IA 1W36C 2GAUA 2CFOA 2X0LA 5LRRA 1FTZA 2KPMA 4E7JA 3QOEA 3JTHA 2KIUA 2L4MA 1QHGA 3QYBA 4F52A 3SQNA 4HPQA 4ZJZA 4B3XA 4XK4A 2OCEA 3PIPF 3WTXC 1E3PA 1IUFA 2XB0X 3CUOA 1POGA 3CCRI 1JUPA 1B8IA 2HVRA 1BR1A 3VYTB 1QZZA 2E19A 2R7FA 4ENKA 5HLGA 3ZN0A 5CVIA 2GQQA 2W4SA 4H0EA 1N75A 4E7LA 4ZYHA 3RKQA 2DJIA 1TWAJ 4PSXA 4A0ZA 2MABA 3OMYA 2HWVA 2Y0MA 2JSPA 1ZELA 4II2A 3GTLJ 3FMRA 4DW6A 4KDPA 1WPKA 3OYHA 3PFYA 3WHBA 4A69C 4ON0A 3JRAA 2FMYA 1MMSA 2F4IA 1YW9A 1VQ8I 3QP6A 3M1CA 3DPLC 3JR9A 3CQZJ 1ETXA 1IAWA 2BYVE 2R5ZA 1HW1A 1UHSA 1X58A 3HOXJ 1I6HJ 3QP5A 2PI0A 3OYGA 1SFKA 3W6VA 2EIMH 1LFPA 2LKSA 2UUZA 3FKIJ 1JGSA 1ZKGA 1V5EA 2L9VA 4AU7A 1OR7A 3MKZA 3HEFA 2CO5A 3P9CA 3QWLA 3RIRA 3VSKA 1FWZA 1MMGA 2DOEA 3TDZC 2CV1A 4L9NA 3RPUA 1TT0A 1VTNC 2PJRB 3PO3J 4BHPA 2A61A 4PZJA 1G3TA 5K5RA 2VE8A 4AIHA 5BS6A 3JTGA 1R00A 3JRCA 2W1OA 5E79C 4XRMA 5J47A 3AL0B 4YIFA 4UXNA 4YFNF 1IV8A 4FX0A 3HUGB 2P5KA 1W0TA 4A3DJ 4B43A 1LB2A 5F0HA 4DYQA 2FUG2 2NVYJ 3P9IA 2VOPA 1C0WA 3LNQA 5HVQC 1VQOI 1RKWA 3SFIA 3MKWB 5L3BA 1XMKA 2R7SA 4UVCA 2WAQN 3A01A 4IX7A 2DA3A 5LEKA 1W0UA 1Y8QB 2MYSA 4AWXB 2BY0A 5TISC 1J7KA 1EKEA 4RDUA 2H94A 3BQYA 4ZDOA 2BVMA 2VKDA 2CYYA 1YYVA 1HDPA 2F5EA 3K1NA 3BR0A 2GLOA 4Q4ZF 2G0EA 1Z0XA 3M3YJ 4YRVA 1Z05A 1B9MA 3BJAA 2KFDA 4C3HJ 4KNYA 1R9TJ 5FO5A 4B47A 5HDNA 3F8BA 2Z2SB 3J80K 1R1VA 1NG7A 1H89C 4O3MA 4UV8A 4JP0A 3VFZA 1R6RA 4EQQA 3E97A 3DV8A 2LBFB 5FKOA 3V8JA 4EJUA 4XR6A 4BXUA 3DLAA 3HYIA 2DTZA 2EV6A 5CVUA 2OTLI 2KRHA 2CV2A 1MJ9A 4HZFA 1HW2A 3X2QH 1LDKB 1BC7C 3N4MA 2DQRA 3JSOA 3HTSB 1Z3YA 2ME0A 3COAC 1LFUP 2L54A 1KONA 5GAHJ 1S3JA 3FXRA 2F4OB 3T8RA 4OIRF 2NS8A 2CQNA 1DP7P 2TDXA 2BEOA 4B44A 4E7SA 2NXNB 2K3FA 1P7JA 2L02A 1T95A 1M1EB 4AYBN 3I56I 4BY1J 4U88A 1UZCA 2B0LA 2NVQJ 2M4GA 3QOPA 2ETHA 2IT0A 1ZQ3P 1DU6A 2GOMA 4FE4A 4BJ5C 4ABZA 3BDDA 1XDSA 1X1DA 3KYCB 3BC8A 1KYZA 4RB0A 3GVAA 1L3LA 1SAXA 2ZKZA 2OQRA 1JKPC 1VQ7I 2LG4A 3O8GA 1ZHFA 4HV6A 1O4XA 2XGXA 2DAOA 1TQIA 1X1AA 3QPHA 2XIGA 2CQ7A 3OYMA 1R4MB 4PK4A 1FOXA 1I50J 1X4OA 1OCZH 4YG2F 5JLWA 1MSEC 4AM3A 1ERDA 3KEYA 4WXDA 1PUEE 2DMNA 2P4WA 3CCJI 4HLYA 3HOZJ 2HPIA 2VASA 2R3SA 4AUXA 3GTQJ 4HNTA 3S1MJ 3NQOA 2IA0A 4GYGA 1LE8A 2VUMJ 1FBUA 4XONA 2O0YA 1YFHA 2LH9A 1ZRDA 2QSHX 3PQKA 1ENHA 2AXTC 3RDIA 3U2RA 2HQ5A 2DA6A 2M87A 3HGGA 3SZTA 3V7CA 3S2DJ 1DP3A 1XPXA 1ZR2A 4ETSA 2PMHA 2M8GX 1RUOA 2RN7A 4RLQA 4CO8A 2EFWA 1HLVA 4HDUA 4NQWB 2LNBA 2Q0OA 1K4SA 3RPUD 1FOKA 4BBSJ 5EEAA 1ETKA 5ILUA 3HSRA 1MNDA 2XAHA 3E7LA 2KIQA 3BCAA 4PFPA 3HHGA 3DF8A 1EH8A 1HKSA 1BC8C 2Y48A 4IRIA 3HGYA 1HDDC 2E1MB 1WZ2A 5F27A 2DMUA 3Q3SA 2QYOA 3HG9A 3WE3A 1U5TA 2H8WA 1GVDA 4HF1A 2E1NA 2QF7A 4HF0A 4C2UA 3IWFA 3H36A 3S93A 3TQNA 4GCVA 2DK5A 3DEEA 1JXSA 1OPCA 1X1BA 2XASA 1FMVA 4I01A 2R4GA 5IYCJ 2LF8A 4HEA2 3W2AA 3C2HA 1S72I 3LL7A 1LDDA 2ZMEC 4ZZLA 5KAIC 2F4MB 1W7PB 1MGTA 3S2WA 4CCNA 3ABKH 4C3IJ 4RA2A 1N77A 4GXOA 2HKOA 2RREA 1PUFB 2R7QA 3S16J 3DWLE 1YW8A 3LSKA 3GTOJ 1WSUA 2IRFG 2XAJA 2BV6A 1EV7A 2BOLA 1DUXC 1IXCA 5D4SA 5B1BH 3HIFA 1JKRC 1S7OA 2UV1A 3F72A 3PFIA 5B3SH 2IS1A 1SFXA 1G3SA 2ZBKA 4LFUA 4KITB 3QYFA 3FX3A 1OYIA 4KT5C 1UELB 2ME6A 2JPCA 5FFZA 4XLPF 3Q0VA 4OOIA 2XSJC 2FBKA 2R7WA 3MCZA 2F2EA 2V1XA 3H3VK 1QHHD 4FE7A 3CDLA 4UB6C 4HV5A 2BW3B 4Z6YA 5E1ZB 1X19A 2EZHA 4I98B 3JSPA 4ZTJA 2DQLA 3LQQA 2C6YA 1S5LC 1RI7A 3O8HA 2X1CA 1F1ZA 4LGWA 1UB9A 4RLFA 2EV0A 5DD4A 1UHWA 3GFMA 2DOAA 3SZGA 4LB5A 2W7NA 3ULQB 1I27A 2HDDA 1S29A 2Z9OA 2Z5UA 4IO9F 2O8XA 5DCMA 1WHUA 1KU9A 2JSCA 2EFQA 1TL8A 3DEWA 5E3OA 1JT0A 4MEXF 3FM3A 5CVVA 1R7JA 3A02A 1GDTA 4WXHA 3V7RA 3OOPA 2PX9A 3CUQB 2ZJPF 2FOWA 1MMAA 2QUFA 2VPLA 2XRNA 1U0JA 5EGOB 1XSVA 4AC0A 4Y7NJ 1QZEA 1REPC 2O03A 3HL2A 3JAMK 5A2QK 4A3BJ 3GEZA 2EFPA 2QKMB 3S1RJ 2BXYA 3K2ZA 2BHYA 4FQGA 2GOXB 3E0JB 3UKGA 3F8FA 2XF6A 3R0AA 3LWFA 1D8JA 1IO2A 3RJPA 3PNYA 1IRGA 3VYUB 4FTHA 1OYWA 5ERIA 3C2BA 4GFBA 3FXQA 3JRHA 1IXSB 1GLNA 2F5DA 2FF4A 2KL4A 2LKPA 2LYCA 3HZJA 4YFKF 4WX9A 2R7ZJ 2HYGD 1LUJB 1N78A 3WU0A 4V19K 3DTEA 1AA7A 5ILSA 3EUHA 1JHHA 3KIOA 4HLXA 1G59A 2HQNA 4PGHA 5KAFC 3IKTA 2FX0A 3CJNA 1BI1A 4BEHB 3JRFA 1K78A 4OAZA 2ZNZA 4HX7A 2KISA 4RGSA 2D1HA 2V9PA 3F23A 4OMYA 2DYRH 2FRHA 3K4BA 4MHGA 2P5VA 4CCJA 3CJQB 3BR3A 2OJED 3F9KA 5DM6F 3BY6A 3SDBA 2M34A 4JK1X 3FHNA 4KICA 1T98A 5C4JJ 1WI3A 2JVHA 4N0BA 2NNNA 3GTJJ 2M45A 2WB1A 4EM0B 2GA2A 2HTSA 3BTCA 4LJZF 2O3FA 3VWBA 3M07A 4F7ZA 1NTCA 3K1PA 2STWA 1OCRH 2O9LA 1HF0A 1ZAOA 2BHZA 5FFXA 1RESA 2MD0A 3L2RA 1SFOJ 3T0YA 1R1TA 1J2XA 1XMAA 2STTA 3PSFA 3J7AO 4PUSA 2X4HA 6PAXA 3DKYA 3ABMH 2A6HF 3PQJA 1WJBA 1ACIA 2OZ6A 3HKZN 4BXFA 4A3CJ 2ELKA 1YO5C 1GUUA 4E4HA 4CSWA 2X6OA 2EQRA 4DYRA 3H9GA 2L3DA 3CD6I 1XMXA 1TWFJ 3TO6A 4E6KG 3ZQFA 2M30A 4U7DA 1FLIA 4XBFA 2AO9A 1BA5A 2W82A 5D6EA 3TDUC 3LAPA 3OR1C 2DK8A 1KQ9A 4M72A 3E6CC 1GT0C 1XSXA 1LEAA 2VI6A 3KX2A 3H5RA 2EILH 1IRFA 4HBLA 3TW7A 4UVAA 3IHUA 4RGUA 1ZYRF 2YX4A 1FYKA 1Z7LA 3TO7A 2YUSA 3BPXA 3GCMA 2LBFA 4RBOA 3GXOA 4Y52J 2COMA 1A31A 5D4RA 3F8CA 1F4KA 3L7WA 5DS9A 3ROUA 5KNLA 1K7AA 1EH7A 1L0OC 1K6YA 4KUMA 4EGYA 3K2AA 4UV9A 3HPGA 2ZFUA 2CW7A 1RUNA 5HS9A 4MNUA 4MIMA 4ZDPA 3WG9A 4KT6A 3SDGA 2ZJQF 1P2FA 3S17J 4E7ZA 3ZMSA 3TBIA 1UAAA 5EYRA 4BL0B 2DMPA 2ID6A 3P9KA 4KIGA 2OF7A 4MLOA 3CLQA 2DU9A 2XF5A 2MSYA 2OQGA 3RKXA 2MFZA 1SVLA 2Q1ZB 3E3VA 1U78A 3CZ6A 1QZYA 1ZRCA 1DGRM 4IOAF 3FHZA 4ZTFA 1TC3C 1OISA 3GZ6A 5H2FC 1T56A 1XG1A 1XX5A 1J0RA 1T39A 3D5SC 2VIXA 5C44J 1DPRA 1USSA 2QQ8A 3FXKA 4EJOA 2WAQA 3M7GA 2Y9YA 4FT8A 4LG3A 4WK8F 2HU9A 3M4OJ 1QQIA 4D7NA 1LJ9A 4LOCA 4B8XA 1W5TA 3U9GA 4ZYGA 2E60A 4UNOA 3LA2A 2Y31A 4V2FA 4X6AJ 1FY7A 2K40A 5J4VA 2MW8A 1MBEA 3KP5A 1USTA 3FXMA 3BQZA 1KA8A 5CQEA 3ZN1A 1WH5A 2IEKA 4RGRA 3I59B 4DZJA 5A2QZ 2G7HA 4KN7X 3V7SA 1E0EA 4F92B 1TW2A 2MLKA 2TRTA 1KQ8A 4G94A 2XAFA 3BWGA 1YI2I 1TTYA 3MQ0A 4OIOF 3VYSB 4AVZA 2FXAA 2NOJB 1Q1HA 1R58A 2A05A 2KIFA 2OC6A 4IL6C 3R0JA 3RYPA 2DW4A 1TW3A 1VQKI 1YS7A 3WTSC 1VNDA 2M0MA 5C4XJ 1U9OA 1HOMA 1ORKA 2KHMA 2XV4S 1ZLJA 2JA6J 4IHYA 5L3FA 4UUTA 3AG2H 1OCPA 1SMTA 3EUHC 3F8MA 3IH4A 4A3FJ 2RGVA 4AYBA 1GHCA 4BNCA 2F6CA 3K70D 1BR4A 2K9NA 1QBJA 4IQJA 4BJTA 4LITA 2XC7A 2ZJ2A 2X51A 1HCRA 2RDPA 3OIOA 3E6MA 1U9NA 5CYVA 2HGCA 3BJOA 5JI6A 2DFFA 2B7EA 5EEHA 3HSEA 3LSRA 1XCBA 3R60A 3CCLI 3IH3A 3FXOA 3NWSA 3HOWJ 1R5ID 3O3KA 1QRYA 2X48A 2B9SA 3C1DA 2GWRA 1BOBA 2OUMA 2KDZA 3CCUI 3L2CA 1QVTA 1EF4A 1D1BA 3WE2A 4W1UA 1Y1WJ 1PUFA 2DLLA 5FRMA 2CUJA 2A5YB 3G4SI 4DNCA 2VODA 1ETQA 2OA4A 2VJ4A 3IAM2 5LEJA 1LVAA 5HDKA 2Y69H 2PLYA 3PM1A 5J8CA 5F64A 3CCQI 1X4PA 3C2GA 3GLLA 3QQAA 5E3MA 1CGPA 1EJ9A 3ZQCA 3CCEI 3AL0C 5KVRA 5LRSA 3RYRA 5M5YJ 5M5WJ 2P7VB 4CH7A 1IJWC 2DA4A 2RNGA 5GPCA 2EPFA 1ZGWA 1OLTA 5HLHA 2H09A 3HDDA 2PJPA 2K4JA 4XRSG 2HPMA 3FK6A 2DODA 1XGOA 3MN2A 1AKHB 4ASNA 3SJMA 5K5QA 3K70C 1ZLKA 3G6EI 1ON2A 2YU9J 4YIIA 3ONQA 4L0ZB 2BW3A 3CJTB 4MQVA 4F93B 2PFBA 1MSFC 2X1EA 4YIRX 5CKTA 3FKJA 5J1RA 3GFLA 1KGSA 3LSPA 4KYWA 3G1LA 3H5AA 3S8PA 2I8DA 2ZMEA 5AONA 3ZP5A 2VL8A 3DXJF 4M9XA 1WH7A 2VJ5A 2L7MP 1I6XA 3FXUA 3GTMJ 1YRNB 3BP8A 3CCYA 4KN4X 1QNTA 2ZFWA 5DV5A 4BHBA 2XGDA 5FD6A 1YJWI 2P0WA 1O3QA 2HVQA 2B63J 1WKMA 3M1EA 2XAQA 2ZB9A 4XORA 5TJJA 5K1YA 5FKMA 1FJLA 3V8KA 5EZHA 3OV8A 2VBWA 4CYCB 2NOGA 1FPQA 2LY1A 1B9NA 2DBBA 5JHUA 3OYDA 3KYLA 3FK7A 1Y1VJ 2EBIA 2ZSIB 5IOZA 2BY1A 1YE9A 1F9NA 3FF5A 5D8LB 1YHQI 1IF1A 1FBQA 2E35A 4UVBA 2W25A 2QGUA 3R4KA 1VQMI 2LFBA 1SFUA 1OFCX 2IA1A 1UG0A 1YQAA 3HPHA 2JJ7A 1G3WA 3LAJA 1SC7A 3WTUC 1B6AA 1X3ZB 1CF7B 2XGCA 3QRFF 4OIPF 1D0YA 2M2EA 3A0BC 2VJIA 4A5NA 3JRDA 3CMYA 1KU7A 2IBDA 1KQ0A 3EQLF 3Q5FA 2AQEA 5HLIA 3S2HJ 2R7TA 4LIUA 1UHMA 1ZG3A 1I39A 3B02A 3ISPA 4HAMA 4WWCA 3MFKA 2W85A 3K69A 4RB2C 1O3SA 1UJ8A 4DIQA 4HYEA 1KZHA 5GADJ 2EIKH 1MKMA 1E17A 2NYXA 1SANA 4Y15A 1XGNA 4CCOA 1MMDA 3H3ZA 3ZMUA 2GXAA 1V5GA 5E18F 5E17F 1W7PD 5K7HA 1Y0UA 3V4GA 1KU2A 1NHAA 3I55I 4O6JA 1A36A 2JK3A 3FBNB 4BQOA 2AQFA 2JPBA 4BE0A 4D0PA 2M7AA 2A68F 4EM1A 2HI3A 1I3AA 2X6YA 3DP7A 5JFRA 1JT6A 3VSLA 4ZYEA 1E3OC 1IN5A 2VBXA 4XN0A 3REOA 1G4DA 3BLYA 4BH9A 4XL9A 4AIDA 3F22A 1W1WE 4U0VA 4JYKA 4UHTA 3N97A 2Z1DA 3DFGA 3I4PA 4K2EA 3QPLA 4Y3OA 1B4AA 2BY3A 3Q9VA 2E1MC 1WFXA 3AG3H 4PJJA 4BS9A 1K61A 3FIWA 2AHQA 3E5UA 1UG2A 2CUZA 4BY7J 1XB4A 4U0YA 4EM2A 3CC4I 3DU5A 3ZMTA 2QLZA 2Q8KA 2M4KA 2FEZA 1AWCA 2CRGA 4WXCA 1IGNA 3Q0UA 2R7OA 1MZBA 1WJ5A 5FB2A 4PJNA 4AIKA 1MIJA 4ESFA 3EETA 3TGNA 3BG9A 3QODA 3WGGA 1TQMA 4XSZF 1SD4A 5F08A 3TL4X 4B1RA 4DQ2A 1Z6RA 1GXPA 1YITI 1AU7A 5DUKA 1XTAA 2K9MA 4AVPA 2LC2A 2PMZN 2HYFA 4MTEA 4J01A 2L2OA 4LB6B 1JI8A 4G12A 2JVGA 4XKCA 2E1OA 3VYRB 1I1SA 3OYEA 4JX6A 5IP6A 1G3YA 4ESJA 3QAHA 3KP7A 3GX4X 1WJEA 4MQ9F 3AKZA 2D45A 2XPUA 1ZR4A 1H9TA 2KP6A 4IJAA 3NAUA 1HSTA 3OR2C 1DDNA 2XROA 2YPRA 1BBYA 3CDHA 4S05A 4ZZDA 2L7FP 5FGMA 2K9QA 4UUSB 3CO7C 1FMWA 4BBRJ 1VQ4I 4HOBA 3TW6A 3E5XA 4BJ6C 5L3EA 2KJBA 2M1BA 1BJAA 4X0GA 1FSEA 3DPTA 2VQHA 2E7WA 2FOKA 3SYTA 1JKOC 2KKOA 5F6FA 2OV7A 1R5HA 5IT9Z 4BYYA 3JRGA 2DFHA 4RM3A 3SZPA 2A6TA 4IHWA 2UXXA 2EWNA 5JVTA 1IN8A 2V79A 1P7IA 3GWZA 5ICFA 1O57A 2IGKA 4PJLA 2FNAA 3KP4A 2MC3A 4LG0B 1VQ9I 2L7KA 3S3MA 3TKYA 5K7ZA 3KPHA 3W6JB 4RB1A 2KQRA 5KHDA 3M8FA 3HKZA 4M3EA 1UMQA 2IGMA 1MMNA 1FIPA 1FP2A 2XF7A 3CESA 2K9SA 2RV8A 2OU2A 3OYCA 3S3OA 2EA2A 1VQNI 4EATA 3RI4A 4M71A 2V6CA 4P55A 3CLOA 5JVGF 5L3GA 1T38A 5F1JA 3ZPLA 1BW5A 3T5XA 1Z77A 4HW0A 4BQQA 3CUQC 2CW0F 5CJ9A 5BNGA 1BIBA 3OSGA 2ACJA 2X85A 4HSRA 3DQVC 1E3HA 3FDYA 5HODA 4ANJA 3OYLA 1B72A 3NRVA 2BXZA 4MTDA 3EUAA 2GBYA 4E7HA 3M9AA 3MZYA 1LVKA 3FMQA 4XIDA 1JJ8C 1D5VA 5LGUA 2E2HJ 1OJLA 2OCCH 2HZTA 2XB5A 2RVCA 2I5UA 3ZRGA 2IS2A 3I59A 2IP2A 1WJCA 2ZNYA 3KLNA 3W6KB 3HOYJ 2ID3A 2VN2A 4R8HA 4RAFA 4OWRB 2DPUA 1WI9A 2OD5A 2FE3A 2FBIA 4CA0A 2X6XA 3F3XA 2L4AA 2V1NA 2R7XA 4XOPA 1I5ZA 3ERED 2JRTA 3ZGKA 2Q2EA 1DQUA 1MBGA 3OOUA 2DFIA 1NG6A 2W84A 2W48A 4F91B 3K6GA 4RAZA 3OS1A 4DZPA 5BMZA 4V2GA 4WCGA 3BJ6A 2FBHA 2PMUA 3FBIB 2P6TA 1OMIA 2V26A 1Y0NA 2L9SA 1SD7A 1CQTA 4MFEA 1Q1VA 4O5VA 3A2KA 2KT0A 3HC7A 2RKHA 2O8KA 5D6FA 5D8KB 3BG3A 2VE9A 5J40A 3TOAA 5EEGA 4ENMA 5F1RA 3HM5A 2L0KA 4QIWN 2MLGA 4G7OF 2QSFX 3BTIA 3MVPA 2HYJA 5EZGA 2JA7J 1EH6A 2D2WA 3S1QJ 2E34A 2TCTA 5HOOA 2CV0A 2FQ4A 5IP7J 5IY5H 2M0CA 4QLCU 4NC8A 4D1QA 3HOTA 3SEQA 5DEQA 1ZREA 3L2WA 1W4MA 2LMDA 1PP7U 5E3NA 2EIJH 4I0AA 5DM7F 5E1WA 3IAS2 1WJFA 2W57A 1YTYA 2H6BA 2EV5A 1ULYA 4N9HA 3L1PA 1A6QA 3BG5A 1F36A 2XDVA 1IV6A 3L9FA 3U1KA 2IJLA 2K5CA 3F6OA 3LSHA 4H4KC 1D1AA 1SMYF 2FJ1A 4M6VA 4M9ZA 4X1EA 4R1HA 4XRFA 4EJWA 1HXDA 3TP0A 4UY8I 2ZCWA 2EB7A 3IWZA 2XKPA 3OYIA 4M6YA 4A2UA 1QPIA 1D3YA 2CW8A 1U3EM 2HNHA 4C3JJ 4XKVA 2VC1A 4D5FA 5J1UA 5FLMJ 2ISZA 1PYVA 1Z6TA 2JUGA 4E7KA 1QU3A 2QQBA 3BZ6A 4XRSA 2VQCA 4A3IJ 4XN3A 2CS3A 3BPVA 1QA6A 2N8GA 1D5YA 4CXFA 3CMMA 2HOTA 2DN0A 3GFJA 3O6BB 4NNJA 5ICCA 2GM4A 3EYIA 2KDOA 4KIFA 1VQ6I 1YRNA 1STZA 1GVJA 2NS7A 3L2QA 1WWXA 3CCMI 1T6SA 4OINF 3P5JA 5HNFA 4IZZA 2DTRA 3I5UA 2PJRA 1JGGA 2LP0A 4P96A 5DDGA 1K79A 1KYWA 1W5CC 5LGNA 3BZCA 1FBSA 2MG4A 2R93J 5GTIC 1U8RA 2HOEA 3IC7A 1U2WA 4U0WA 4S0HB 3KEOA 4IRGA 4II3A 4ZC3A 5FJ8J 3HUGA 4FASD 4PJ0C 2IS6A 4KMUX 4A93J 3OIQA 3GFIA 3KP3A 2P81A 4C9YA 2Y30A 5LHGA 3CDIA 4G9YA 3FXLA 2YX7A 3K0LA 3R61A 1LDJA 5L3DA 5HLTA 2A07F 4F3QA 3WTTC 1FEXA 4C2MJ 3MKLA 4BXXJ 5GTHC 3S1NJ 2QM3A 2FSWA 3KETA 2DT5A 3GYHX 3H92A 4NUBA 3E6DA 3ZQLA 4A12A 2DXIA 2YR2A 4B09A 4IOCF 4NBQA 4RAGA 2JTVA 5BPDA 1R36A 3IUOA 3S32A 3DBLB 3R6SA 5EG0B 3PO2J 3U1DA 3DBRB 2HQAA 4IKFA 1LE8B 2HXIA 1HSJA 2F5FA 3VEPA 3ASOH 3BR1A 3A4CA 4G8XA 2XSDC 4IHTA 1V55H 2E5NA 4CCKA 2HOSA 3BROA 3SEZA 1MJAA 1YJNI 2QKLB 1IDYA 3ZCOA 3HRTA 1XGMA 5JHFA 3ASNH 3LSTA 1NK3P 3K4KA 3BTJA 1MH4A 3T8TA 2L9NA 2XHKA 1A6IA 1RZ4A 1XD7A 2R5YB 2CG4A 2VXDA 1JUMA 3GUDA 3RCOA 2K9LA 1TQPA 2XUBA 4BQAA 3J81K 2IPQX 4DJAA 2KRFA 2KMUA 2VQLA 3SFZA 3K4NA 1U5TB 1HA8A 4HG2A 4QSHA 1ZH5A 4XLAA 4XNFA 4TV7A 4CDGA 2ESNA 2H1KA 2KIMA 3ABLH 3K4JA 2W00A 3GTGJ 1MW7A 1LPQA 2QQ9A 4PDKA 1IN7A 3K1MA 2JMWA 3GLXA 1S7EA 2HS5A 5LD2C 2ECCA 4HA8A 3C3WA 3O2PE 5E8GA 4QTRA 4M6XA 4U7BA 5B1AH 3WGIA 2JA2A 4BDZA 2WY7Q 4MO7A 5FKLA 2UZKA 2MBFA 3F0CA 3BCBA 4I6ZA 2CQKA 4DGWB 1H9GA 2LY2A 4I99C 2IA2A 1YS6A 2L7ZA 2LVSA 4CCLA 4HQMA 5CVJA 2EFOA 3I4NJ 2E36A 2Y2ZA 1FT9A 1WVRA 1K83J 3AG1H 5EDNA 2V1UA 4M3DA 3MZHA 2BZTA 4E70A 5BOXA 4XLEA 4Y4RA 2L9RA 3ZR8X 1JJ6C 1BM9A 4B48A 5K5OA 4NQWA 2CGPA 2Y9ZA 1FOWA 3G73A 2HKXA 1Y8RB 3A1YA 2LR8A 2QEXI 3AFHA 5H6RA 1G8XA 1R49A 3I54A 1H88C 2LSOA 5BPIA 3H1CA 2HTJA 2HDCA 5E20A 2EZKA 3RQ4A 1P4WA 3JCUC 2XRLA 2XPWA 3MAJA 2LDUA 5IT3A 4EV0A 2DT7B 3QU6A 1I3QJ 4BAYA 5FKKA 3ABUA 2CJJA 1P4XA 3FXJA 5AIPA 5F04A 4MEYF 3EUKL 5J4YA 3CC2I 5J8FA 3L00A 1GV2A 2DCEA 4LG0A 2VLAA 3MD2A 4I09A 1W7PA 4XSXF 2PQ8A 3NARA 3UNGC 2CUEA 4W97A 5GP9A 1HQCA 5F0CA 2VBZA 2O7OA 4BDYA 1WGXA 3CCVI 1ETVA 3BR2A 2JWTA 2PMZA 3ML6A 1H8AC 1T0FC 4M3FA 1NK2P 4N4NB 4L5IA 3VOEA 1IN4A 1IW7F 4ZDLA 2AS5F 3DTIA 2LRDA 4Q47A 2DA2A 1D0XA 1ZN2A 2CWEA 4NC7A 5FLXZ 2QQAA 1JTXA 4FISA 3L2VA 1S7AA 1DU0A 4CICA 5IT9K 4LLGF 3CJRB 3ZQHA 1MH3A 2LK2A 4BUPA 5EJCA 3CMEI 2JN6A 5E1XA 2A69F 3N05A 2LF7A 4M73A 4ITVA 1XDUA 4GDFA 3LFUA 4OMZA 2Y0SN 2L5QA 3HHHA 2P5LC 1SEUA 4YELA 1O7LA 1WQ2A 2LLKA 3WODF 3I58A 4XM3A 3I64A 3ECHA 2NVXJ 4MGRA 4HNUA 2M3AA 1SD6A 3FMSA 5GAGJ 1SAUA 4IHVA 2UWMA 4Q48A 5H20A 3JREA 2RC4A 1LNWA 3T1BA 3OYAA 3AG4H 4YFXF 2FNPA 1K78B 1G6NA 5D5VB 1ZG5A 1RNLA 2ZJRF 1MBFA 1RR8C 1YX5A 3LSJA 1BI2A 2E2JJ 1FP1D 1R22A 1GXQA 1P6RA 2P6SA 3ELKA 3PJRA 2OBPA 5DD8A 2BY2A 5D5XB 3FM5A 5AIQA 2E71A 5IP9J 2LKXA 1FYMA 1MJBA 1TLHB 1IUYA 5ILVA 1BN5A 4I0BA 2DOFA 1DGWY 2NAZA 3CUQA 1S6LA 1Y39A 2GIZA 2ZXIA 2H8RA 1QVUA 3D1NI 4HX4A 2VXZA 5EGOA 1R5GA 1LFBA 3FWEA 3MKYB 4B3AA 1PVEA 1W5SA 4ESBA 3ZOBA 3CF5F 5ICGA 4BQNA 3J81Z 2LD5A 3CP8A 2R7UA 2EJRA 5KK1A 3PSIA 1GV5A 2GA1A 4J19A 2DDBA 1BL0A 3DU6A 3HRSA 2JRMA 2WV1A 1V5FA 3C18A 3V42A 5K7FA 3Q0WA 4I76A 2QVOA 1BW6A 1UFMA 3VB2A 1YOVB 3IKVA 2HVSA 4C30A 3VODA 2ELJA 2X9DA 1MNEA 2ELHA 3P7NA 3LA3A 2GIVA 2HOAA 3CMAI 3GTPJ 1TNTA 1YX3A 3HB9A 2M7BA 1JTYA 4RMNA 5D5UB 1XGSA 1LQ1A 2WADA 4RM2A 4P9UA 2O61A 3I3LA 3ZXSA 1QGPA 3K4LA 3OYKA 2HFHA 2V7FA 1HW5A 4BEHA 2FA5A 3A03A 2K86A 1E2XA 3C7JA 2P7CB 2IGOA 2BBYA 1QO0D 1X3UA 1H0MA 3EYYA 4LK1F 4A5MA 5L3CA 5LFAA 5M3FJ 3KYDB 1JKQC 2HDWA 3IV5A 2WV0A 4D9JA 5DUIA 1RKTA 2ADUA 4ZYAA 3IRQA 1D1CA 1OCOH 4RAYA 1R1UA 3H9QA 1P92A 4N4OB 2ICWG 4A6DA 4AD9A
chains in the Genus database with same CATH topology
4G7ZF 3CO6C 1D8KA 4ZH4F 3L09A 4M9SA 1ZRFA 1FZPB 3WU1B 2QBYB 2L01A 4HDVA 4S04A 3KFWX 2K7LA 2KJCA 3SXYA 1MDMB 1J75A 1J59A 4L5JA 2NS0A 1OYYA 1B1BA 1Z7UA 2IVMA 2K4BA 3LFKA 4IXAA 5ICEA 1F5TA 2V1DA 3KCCA 5ED4A 2DPDA 1KU3A 3WTVC 5FD5A 5HDGA 3GZ5A 2WWYA 3DEUA 4LLNA 4UUVA 3KZYA 4A0YA 2NNYA 1ZG1A 2OAZA 4P9FA 1BI0A 2H27A 5CLSA 1PP8F 1TBXA 2DO7A 3ZQ7A 2EFNA 1T2KA 2IW5A 5D5WB 3E6BA 2K27A 3HOSA 4CYDA 1ON1A 5LHIA 1YLFA 2G7UA 5DYMA 3B73A 4G6QA 3F6VA 3KZZA 3GW2A 1O7FA 4PCQA 4LLLA 4RB3C 1AOYA 4L18B 3ZMVA 3CTAA 1IN6A 3HRUA 1FX7A 3MEXA 4CHUA 4GO1A 4HQEA 2GZWA 3KEQA 4I02A 1RIOH 1O3TA 2GXBA 3D5LA 2WTEA 3WTZA 2A3SA 3Q9SA 1FSHA 4Y17A 4IHSA 2DI3A 2HR3A 1V3FA 2ZO4A 2ISYA 4FX4A 4ENNA 2M5WA 2FQ3A 4AIJA 1U6GA 1ZGJA 2CFXA 1WRJA 3ZMZA 4KMFA 2PBIA 3RKYA 4KA4A 3WTYC 2NRAC 2J5PA 2AXLA 2HEOA 4I7HA 3SHFA 1ODDA 1FYLA 3TOBA 3TO9A 2JT1A 2QWWA 4EVIA 2ZMEB 4L0YB 4XLNF 3I71A 4CZZA 2R7DA 2FMLA 2YSRA 1Z9CA 2WC2A 4KIBA 2M8EA 3RPQA 2RQPA 2JZYA 3J80Z 3FZVA 3H3UA 5H6QA 4P5OA 5LGTA 3F8NA 2Y75A 2UXNA 3DKWA 1SFEA 1J9IA 5LLQA 1R23A 4GYIA 4Y13A 1I1GA 3ABTA 3I53A 1BI3A 3MWMA 4LD5A 2VT2A 4EJTA 2MD5A 4EJVA 1J5YA 3D0SA 3I0TA 5HS8A 1Z91A 2EA4A 3LQRA 4PGGA 4NHJA 1BOAA 1XCVA 2F5CA 1DPUA 1ZGAA 3KP6A 3EDPA 2P8TA 4Z2YA 3KE2A 2J5OA 4A6EA 3IRRA 4LK0F 1T0FA 3QPTA 1YG2A 3M8EA 2Z3YA 5FLXK 1IZ1A 1TNSA 2E7XA 5JR3A 4HF2A 3K9TA 1K6OA 1BIAA 2XKOA 3KP2A 3QU3A 4GGGA 3HTUA 1PDNC 4LMYA 3RKWA 2VBYA 4HX8A 1U5TC 1P4AA 1QPMA 2MA3A 3JW4A 2OZUA 2V9VA 1CF7A 2QENA 1LEBA 3G3ZA 3RTRA 2A6EF 1IXRC 1HBXG 1A04A 1SD5A 3E5QA 4L9JA 4R79A 4WF2A 4M74A 1XSDA 4EMSA 2GXGA 1Z1DA 1MD0A 2FU4A 2RNJA 2MH2A 4Q5SF 4L9TA 5LBQA 3GF2A 3LA7A 3KLOA 4IF4A 2XAGA 1FNNA 4A0XA 1FC3A 2QZ8A 2D1VA 3NEUA 4I2OA 3ECOA 4ENJA 4OU0A 5HS7A 2ESHA 2O6GE 2VONA 4N9IA 2QBYA 2CSOA 3AAFA 1MDMA 3ZMDA 3F21A 1ONVA 1JHFA 2BE5F 2MH9A 2EK5A 1ZARA 4EGZA 2Z99A 2ZXJA 2XVCA 5DCFA 5E8IA 4RGXA 4BHCA 2YU3A 3IL2A 4RS8A 1YIOA 1V4RA 2H6CA 2VT3A 4OIQF 1O3RA 2G9WA 2VOOA 4KFCA 1OKRA 5BQTA 2HQRA 3WGHA 4IVNA 3HSFA 2VC0A 3WTWC 2W24A 2BGCA 5J6XA 2PN6A 3JAMZ 2K02A 4G6DA 3BOQA 3GO5A 3V8LA 4NB5A 2Z33A 1YW7A 1HKTA 4JQFA 2E1CA 4IRHA 4CGZA 4QWQA 5DCMB 1S8NA 5CVRA 4FHTA 1UCRA 4G7HF 4IPAA 4JBAA 5TRDA 4L9VA 5LHHA 1JE8A 4ZYDA 2PG4A 1B59A 3HRMA 1XN7A 2PEXA 1HKQA 2GAUA 2X0LA 5LRRA 3JTHA 2KIUA 2L4MA 3SQNA 3WTXC 3CUOA 1QZZA 2R7FA 4ENKA 5HLGA 3ZN0A 5CVIA 2GQQA 4H0EA 4ZYHA 4A0ZA 2HWVA 2Y0MA 3FMRA 4KDPA 4ON0A 2FMYA 1YW9A 3QP6A 3DPLC 1IAWA 2BYVE 1HW1A 3QP5A 2PI0A 1JGSA 1OR7A 2CO5A 3P9CA 3RIRA 1FWZA 3TDZC 4L9NA 3RPUA 1VTNC 4BHPA 2A61A 4PZJA 1G3TA 5K5RA 2VE8A 4AIHA 5BS6A 3JTGA 1R00A 4YIFA 4UXNA 4YFNF 4FX0A 2P5KA 1LB2A 3P9IA 2VOPA 1C0WA 5HVQC 5L3BA 1XMKA 4UVCA 5LEKA 4AWXB 1J7KA 2H94A 2CYYA 1YYVA 3K1NA 2F5EA 4Q4ZF 1Z05A 1B9MA 3BJAA 4KNYA 5FO5A 5HDNA 3F8BA 3J80K 1R1VA 4O3MA 4UV8A 3VFZA 4EQQA 3E97A 3DV8A 3V8JA 4EJUA 4BXUA 3HYIA 2EV6A 5CVUA 1MJ9A 4HZFA 1HW2A 1LDKB 1BC7C 3N4MA 2DQRA 3JSOA 3HTSB 3COAC 2L54A 1S3JA 3FXRA 3T8RA 4OIRF 1DP7P 2TDXA 2BEOA 2L02A 4U88A 2B0LA 3QOPA 2ETHA 2IT0A 3BDDA 1XDSA 1KYZA 4RB0A 3GVAA 1L3LA 1SAXA 2ZKZA 2OQRA 1ZHFA 4HV6A 2XGXA 2DAOA 1TQIA 3QPHA 2XIGA 4YG2F 1PUEE 4WXDA 2P4WA 4HLYA 2R3SA 3NQOA 2IA0A 4GYGA 1FBUA 2O0YA 1YFHA 1ZRDA 3PQKA 3RDIA 3U2RA 2M87A 3SZTA 3V7CA 4ETSA 2PMHA 1RUOA 2RN7A 4CO8A 2EFWA 4HDUA 2LNBA 2Q0OA 1FOKA 5ILUA 3HSRA 2XAHA 3HHGA 3DF8A 1EH8A 1HKSA 1BC8C 2Y48A 4IRIA 3WE3A 2QYOA 1U5TA 4HF1A 2E1NA 4HF0A 3IWFA 3TQNA 4GCVA 2DK5A 1JXSA 1OPCA 2XASA 4I01A 2LF8A 1LDDA 4ZZLA 1W7PB 1MGTA 3S2WA 4GXOA 2HKOA 1YW8A 1WSUA 2IRFG 2XAJA 2BV6A 1EV7A 1DUXC 1IXCA 5D4SA 3HIFA 1S7OA 3F72A 3PFIA 1SFXA 1G3SA 2ZBKA 4LFUA 3FX3A 1OYIA 4KT5C 2JPCA 5FFZA 4XLPF 4OOIA 2FBKA 3MCZA 2F2EA 2V1XA 4HV5A 5E1ZB 4I98B 3JSPA 2DQLA 3LQQA 2C6YA 1RI7A 1F1ZA 4LGWA 1UB9A 2EV0A 5DD4A 1UHWA 3GFMA 4LB5A 3ULQB 1I27A 1S29A 2Z9OA 2Z5UA 2O8XA 5DCMA 2JSCA 1KU9A 2EFQA 4MEXF 3FM3A 5CVVA 1R7JA 4WXHA 3V7RA 3OOPA 3CUQB 2QUFA 2XRNA 1XSVA 1REPC 2O03A 3JAMK 5A2QK 3GEZA 2EFPA 3K2ZA 3F8FA 3R0AA 3LWFA 1D8JA 3RJPA 1IRGA 1OYWA 5ERIA 3FXQA 4YFKF 1IXSB 2LKPA 2F5DA 2FF4A 4WX9A 2HYGD 3WU0A 5ILSA 3EUHA 1JHHA 4HLXA 2HQNA 4PGHA 3IKTA 3CJNA 1BI1A 1K78A 2ZNZA 4HX7A 4RGSA 2D1HA 3F23A 4OMYA 2FRHA 4MHGA 2P5VA 3BY6A 4JK1X 4KICA 1T98A 4N0BA 2NNNA 2M45A 4EM0B 2GA2A 2HTSA 4LJZF 2O3FA 4F7ZA 3K1PA 2STWA 1ZAOA 5FFXA 3T0YA 1R1TA 1J2XA 1XMAA 2STTA 3J7AO 2X4HA 6PAXA 3PQJA 2A6HF 2OZ6A 1YO5C 2L3DA 3TO6A 2M30A 4U7DA 1FLIA 4XBFA 5D6EA 3TDUC 3LAPA 2DK8A 1KQ9A 4M72A 3E6CC 1XSXA 1LEAA 1IRFA 4HBLA 4UVAA 3IHUA 4RGUA 1ZYRF 2YX4A 1FYKA 3TO7A 3BPXA 3GXOA 2COMA 5D4RA 3F8CA 1F4KA 3L7WA 3ROUA 1K7AA 1EH7A 1L0OC 4EGYA 4KUMA 4UV9A 1RUNA 5HS9A 4MNUA 3WG9A 1P2FA 3ZMSA 3P9KA 4KIGA 2DU9A 2OQGA 3RKXA 1U78A 1ZRCA 3E3VA 1QZYA 3FHZA 3GZ6A 1J0RA 1T39A 1DPRA 1USSA 4EJOA 3M7GA 4FT8A 4WK8F 1QQIA 1LJ9A 4B8XA 1W5TA 3U9GA 4ZYGA 4UNOA 3LA2A 1FY7A 3KP5A 1USTA 1KA8A 3ZN1A 5A2QZ 4RGRA 3I59B 2G7HA 4KN7X 3V7SA 1TW2A 2MLKA 1KQ8A 4G94A 2XAFA 3BWGA 1TTYA 3MQ0A 4OIOF 2FXAA 1Q1HA 1R58A 2KIFA 3R0JA 3RYPA 2DW4A 1TW3A 1YS7A 3WTSC 2XV4S 1ZLJA 5L3FA 1SMTA 3F8MA 2RGVA 1GHCA 4BNCA 1QBJA 2ZJ2A 2RDPA 3E6MA 5CYVA 2HGCA 3BJOA 5JI6A 5EEHA 3HSEA 1XCBA 3R60A 3O3KA 3C1DA 2GWRA 3L2CA 3WE2A 2DLLA 2A5YB 2VODA 4DNCA 2OA4A 5LEJA 1LVAA 5HDKA 2PLYA 5J8CA 5F64A 1CGPA 5KVRA 5LRSA 3RYRA 2P7VB 5HLHA 2H09A 2PJPA 2K4JA 1XGOA 4ASNA 5K5QA 1ZLKA 1ON2A 4YIIA 4L0ZB 4MQVA 2PFBA 3GFLA 1KGSA 4KYWA 2ZMEA 5AONA 3ZP5A 3DXJF 4M9XA 1I6XA 3FXUA 3BP8A 4KN4X 1QNTA 2ZFWA 5DV5A 4BHBA 5FD6A 1O3QA 1WKMA 3M1EA 2XAQA 5TJJA 5K1YA 3V8KA 3OV8A 2VBWA 1FPQA 1B9NA 2DBBA 5JHUA 1F9NA 3FF5A 5D8LB 1IF1A 1FBQA 4UVBA 2W25A 3R4KA 1SFUA 2IA1A 1YQAA 1G3WA 3LAJA 3WTUC 1B6AA 1CF7B 3QRFF 4OIPF 4A5NA 1KU7A 1KQ0A 3EQLF 3Q5FA 5HLIA 1UHMA 1ZG3A 3B02A 3ISPA 4HAMA 4WWCA 3MFKA 2W85A 3K69A 4RB2C 1O3SA 4HYEA 1MKMA 1E17A 2NYXA 4Y15A 1XGNA 3H3ZA 3ZMUA 5E18F 5E17F 1W7PD 1Y0UA 3V4GA 1KU2A 1NHAA 4O6JA 2JPBA 4D0PA 2A68F 4EM1A 3DP7A 5JFRA 4ZYEA 1IN5A 2VBXA 3REOA 1G4DA 4BH9A 3F22A 4U0VA 4UHTA 3N97A 3DFGA 3I4PA 4K2EA 1B4AA 3Q9VA 3E5UA 1XB4A 4U0YA 4EM2A 3ZMTA 2QLZA 2Q8KA 2FEZA 1AWCA 4WXCA 1MZBA 5FB2A 4AIKA 4ESFA 3EETA 3TGNA 3WGGA 1TQMA 4XSZF 1SD4A 1GXPA 4DQ2A 1Z6RA 5DUKA 4AVPA 2HYFA 4MTEA 4LB6B 1I1SA 4ESJA 1G3YA 3QAHA 3KP7A 3GX4X 2D45A 4MQ9F 1H9TA 4IJAA 1DDNA 1HSTA 2XROA 2YPRA 1BBYA 3CDHA 4S05A 4ZZDA 5FGMA 3CO7C 4HOBA 3E5XA 5L3EA 2KJBA 2M1BA 1BJAA 1FSEA 3DPTA 2E7WA 2FOKA 2KKOA 5F6FA 5IT9Z 1R5HA 4BYYA 3SZPA 2UXXA 2EWNA 5JVTA 1IN8A 2V79A 3GWZA 5ICFA 1O57A 2FNAA 3KP4A 2MC3A 4LG0B 3TKYA 3W6JB 4RB1A 3M8FA 1FP2A 2RV8A 2OU2A 2EA2A 3RI4A 4M71A 2V6CA 4P55A 3CLOA 5L3GA 1T38A 3ZPLA 3T5XA 4HW0A 3CUQC 2CW0F 5CJ9A 1BIBA 2ACJA 3DQVC 3NRVA 4MTDA 3M9AA 3MZYA 3FMQA 1D5VA 5LGUA 2HZTA 2RVCA 3I59A 2IP2A 2ZNYA 3KLNA 3W6KB 2VN2A 4R8HA 2DPUA 1WI9A 2OD5A 2FE3A 2FBIA 3F3XA 2L4AA 1I5ZA 3ERED 2JRTA 2Q2EA 2DFIA 2W84A 4RAZA 5BMZA 4WCGA 3BJ6A 2FBHA 2PMUA 2P6TA 1OMIA 1SD7A 4O5VA 2RKHA 5D6FA 5D8KB 2VE9A 3TOAA 5EEGA 4ENMA 5F1RA 4G7OF 2MLGA 1EH6A 2D2WA 5HOOA 4QLCU 3HOTA 5DEQA 1ZREA 1W4MA 1PP7U 4I0AA 5E1WA 2W57A 1YTYA 2H6BA 2EV5A 1ULYA 4N9HA 3L9FA 2IJLA 3F6OA 1SMYF 4M9ZA 4R1HA 4XRFA 4EJWA 1HXDA 2ZCWA 2EB7A 3IWZA 2XKPA 4M6YA 4A2UA 1D3YA 1U3EM 2VC1A 2ISZA 1Z6TA 2QQBA 3BZ6A 3BPVA 4CXFA 3GFJA 3O6BB 5ICCA 3EYIA 4KIFA 1STZA 1GVJA 1WWXA 1T6SA 4OINF 2DTRA 3I5UA 4P96A 5DDGA 1K79A 1KYWA 5LGNA 1FBSA 1U8RA 2HOEA 3IC7A 1U2WA 4U0WA 3KEOA 4IRGA 3HUGA 4KMUX 3GFIA 3KP3A 5LHGA 4G9YA 2YX7A 3K0LA 3R61A 1LDJA 5L3DA 2A07F 3WTTC 2QM3A 2FSWA 3KETA 2DT5A 3GYHX 3H92A 3E6DA 4A12A 2YR2A 4B09A 2JTVA 5BPDA 1R36A 3R6SA 3U1DA 1HSJA 2F5FA 3VEPA 4IHTA 4G8XA 3BROA 1MJAA 3HRTA 1XGMA 3LSTA 3T8TA 2XHKA 1RZ4A 1XD7A 2CG4A 3GUDA 1TQPA 2XUBA 4BQAA 3J81K 2IPQX 2KRFA 3SFZA 1U5TB 1ZH5A 4TV7A 4CDGA 2ESNA 2KIMA 2QQ9A 4PDKA 1IN7A 3K1MA 3GLXA 2HS5A 4HA8A 3C3WA 3O2PE 5E8GA 4U7BA 4M6XA 3WGIA 2UZKA 2MBFA 2CQKA 1H9GA 2IA2A 1YS6A 4HQMA 5CVJA 2EFOA 1FT9A 2V1UA 3MZHA 4E70A 5BOXA 1BM9A 5K5OA 4NQWA 2CGPA 3G73A 2HKXA 5H6RA 3I54A 2LSOA 5BPIA 2HTJA 2HDCA 5E20A 1P4WA 3MAJA 2LDUA 5IT3A 4EV0A 3QU6A 4BAYA 3ABUA 1P4XA 5AIPA 4MEYF 5J8FA 3L00A 4LG0A 4I09A 1W7PA 4XSXF 2PQ8A 1HQCA 2VBZA 3ML6A 4L5IA 3VOEA 1IN4A 1IW7F 2AS5F 4Q47A 1ZN2A 2CWEA 5FLXZ 2QQAA 1S7AA 4CICA 5IT9K 4LLGF 5E1XA 2A69F 2LF7A 4M73A 1XDUA 4OMZA 3HHHA 2P5LC 1O7LA 1WQ2A 3WODF 3I58A 3I64A 3ECHA 4MGRA 1SD6A 3FMSA 2UWMA 4Q48A 5H20A 2RC4A 1LNWA 3T1BA 4YFXF 2FNPA 1K78B 1G6NA 5D5VB 1ZG5A 1RNLA 1BI2A 1FP1D 1R22A 1GXQA 1P6RA 2P6SA 3ELKA 2OBPA 5DD8A 5D5XB 3FM5A 5AIQA 1FYMA 1MJBA 1TLHB 1IUYA 5ILVA 1BN5A 4I0BA 1S6LA 2NAZA 3CUQA 4HX4A 2VXZA 1R5GA 3FWEA 1W5SA 4ESBA 5ICGA 3J81Z 2EJRA 5KK1A 2GA1A 3HRSA 3C18A 2QVOA 3VB2A 1UFMA 3IKVA 3VODA 2ELHA 3P7NA 3LA3A 2GIVA 1TNTA 5D5UB 1XGSA 1LQ1A 2O61A 4P9UA 1QGPA 2HFHA 1HW5A 2FA5A 2K86A 1E2XA 3C7JA 2P7CB 2BBYA 1QO0D 1X3UA 1H0MA 3EYYA 4LK1F 4A5MA 5L3CA 2WV0A 5DUIA 2ADUA 3IRQA 4RAYA 1R1UA 1P92A 4A6DA 4AD9A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4G7Z F;  3CO6 C;  1D8K A;  4ZH4 F;  3L09 A;  4M9S A;  1ZRF A;  1FZP B;  3WU1 B;  2QBY B;  2L01 A;  4HDV A;  4S04 A;  3KFW X;  2K7L A;  2KJC A;  3SXY A;  1MDM B;  1J75 A;  1J59 A;  4L5J A;  2NS0 A;  1OYY A;  1B1B A;  1Z7U A;  2IVM A;  2K4B A;  3LFK A;  4IXA A;  5ICE A;  1F5T A;  2V1D A;  3KCC A;  5ED4 A;  2DPD A;  1KU3 A;  3WTV C;  5FD5 A;  5HDG A;  3GZ5 A;  2WWY A;  3DEU A;  4LLN A;  4UUV A;  3KZY A;  4A0Y A;  2NNY A;  1ZG1 A;  2OAZ A;  4P9F A;  1BI0 A;  2H27 A;  5CLS A;  1PP8 F;  1TBX A;  2DO7 A;  3ZQ7 A;  2EFN A;  1T2K A;  2IW5 A;  5D5W B;  3E6B A;  2K27 A;  3HOS A;  4CYD A;  1ON1 A;  5LHI A;  1YLF A;  2G7U A;  5DYM A;  3B73 A;  4G6Q A;  3F6V A;  3KZZ A;  3GW2 A;  1O7F A;  4PCQ A;  4LLL A;  4RB3 C;  1AOY A;  4L18 B;  3ZMV A;  3CTA A;  1IN6 A;  3HRU A;  1FX7 A;  3MEX A;  4CHU A;  4GO1 A;  4HQE A;  2GZW A;  3KEQ A;  4I02 A;  1RIO H;  1O3T A;  2GXB A;  3D5L A;  2WTE A;  3WTZ A;  2A3S A;  3Q9S A;  1FSH A;  4Y17 A;  4IHS A;  2DI3 A;  2HR3 A;  1V3F A;  2ZO4 A;  2ISY A;  4FX4 A;  4ENN A;  2M5W A;  2FQ3 A;  4AIJ A;  1U6G A;  1ZGJ A;  2CFX A;  1WRJ A;  3ZMZ A;  4KMF A;  2PBI A;  3RKY A;  4KA4 A;  3WTY C;  2NRA C;  2J5P A;  2AXL A;  2HEO A;  4I7H A;  3SHF A;  1ODD A;  1FYL A;  3TOB A;  3TO9 A;  2JT1 A;  2QWW A;  4EVI A;  2ZME B;  4L0Y B;  4XLN F;  3I71 A;  4CZZ A;  2R7D A;  2FML A;  2YSR A;  1Z9C A;  2WC2 A;  4KIB A;  2M8E A;  3RPQ A;  2RQP A;  2JZY A;  3J80 Z;  3FZV A;  3H3U A;  5H6Q A;  4P5O A;  5LGT A;  3F8N A;  2Y75 A;  2UXN A;  3DKW A;  1SFE A;  1J9I A;  5LLQ A;  1R23 A;  4GYI A;  4Y13 A;  1I1G A;  3ABT A;  3I53 A;  1BI3 A;  3MWM A;  4LD5 A;  2VT2 A;  4EJT A;  2MD5 A;  4EJV A;  1J5Y A;  3D0S A;  3I0T A;  5HS8 A;  1Z91 A;  2EA4 A;  3LQR A;  4PGG A;  4NHJ A;  1BOA A;  1XCV A;  2F5C A;  1DPU A;  1ZGA A;  3KP6 A;  3EDP A;  2P8T A;  4Z2Y A;  3KE2 A;  2J5O A;  4A6E A;  3IRR A;  4LK0 F;  1T0F A;  3QPT A;  1YG2 A;  3M8E A;  2Z3Y A;  5FLX K;  1IZ1 A;  1TNS A;  2E7X A;  5JR3 A;  4HF2 A;  3K9T A;  1K6O A;  1BIA A;  2XKO A;  3KP2 A;  3QU3 A;  4GGG A;  3HTU A;  1PDN C;  4LMY A;  3RKW A;  2VBY A;  4HX8 A;  1U5T C;  1P4A A;  1QPM A;  2MA3 A;  3JW4 A;  2OZU A;  2V9V A;  1CF7 A;  2QEN A;  1LEB A;  3G3Z A;  3RTR A;  2A6E F;  1IXR C;  1HBX G;  1A04 A;  1SD5 A;  3E5Q A;  4L9J A;  4R79 A;  4WF2 A;  4M74 A;  1XSD A;  4EMS A;  2GXG A;  1Z1D A;  1MD0 A;  2FU4 A;  2RNJ A;  2MH2 A;  4Q5S F;  4L9T A;  5LBQ A;  3GF2 A;  3LA7 A;  3KLO A;  4IF4 A;  2XAG A;  1FNN A;  4A0X A;  1FC3 A;  2QZ8 A;  2D1V A;  3NEU A;  4I2O A;  3ECO A;  4ENJ A;  4OU0 A;  5HS7 A;  2ESH A;  2O6G E;  2VON A;  4N9I A;  2QBY A;  2CSO A;  3AAF A;  1MDM A;  3ZMD A;  3F21 A;  1ONV A;  1JHF A;  2BE5 F;  2MH9 A;  2EK5 A;  1ZAR A;  4EGZ A;  2Z99 A;  2ZXJ A;  2XVC A;  5DCF A;  5E8I A;  4RGX A;  4BHC A;  2YU3 A;  3IL2 A;  4RS8 A;  1YIO A;  1V4R A;  2H6C A;  2VT3 A;  4OIQ F;  1O3R A;  2G9W A;  2VOO A;  4KFC A;  1OKR A;  5BQT A;  2HQR A;  3WGH A;  4IVN A;  3HSF A;  2VC0 A;  3WTW C;  2W24 A;  2BGC A;  5J6X A;  2PN6 A;  3JAM Z;  2K02 A;  4G6D A;  3BOQ A;  3GO5 A;  3V8L A;  4NB5 A;  2Z33 A;  1YW7 A;  1HKT A;  4JQF A;  2E1C A;  4IRH A;  4CGZ A;  4QWQ A;  5DCM B;  1S8N A;  5CVR A;  4FHT A;  1UCR A;  4G7H F;  4IPA A;  4JBA A;  5TRD A;  4L9V A;  5LHH A;  1JE8 A;  4ZYD A;  2PG4 A;  1B59 A;  3HRM A;  1XN7 A;  2PEX A;  1HKQ A;  2GAU A;  2X0L A;  5LRR A;  3JTH A;  2KIU A;  2L4M A;  3SQN A;  3WTX C;  3CUO A;  1QZZ A;  2R7F A;  4ENK A;  5HLG A;  3ZN0 A;  5CVI A;  2GQQ A;  4H0E A;  4ZYH A;  4A0Z A;  2HWV A;  2Y0M A;  3FMR A;  4KDP A;  4ON0 A;  2FMY A;  1YW9 A;  3QP6 A;  3DPL C;  1IAW A;  2BYV E;  1HW1 A;  3QP5 A;  2PI0 A;  1JGS A;  1OR7 A;  2CO5 A;  3P9C A;  3RIR A;  1FWZ A;  3TDZ C;  4L9N A;  3RPU A;  1VTN C;  4BHP A;  2A61 A;  4PZJ A;  1G3T A;  5K5R A;  2VE8 A;  4AIH A;  5BS6 A;  3JTG A;  1R00 A;  4YIF A;  4UXN A;  4YFN F;  4FX0 A;  2P5K A;  1LB2 A;  3P9I A;  2VOP A;  1C0W A;  5HVQ C;  5L3B A;  1XMK A;  4UVC A;  5LEK A;  4AWX B;  1J7K A;  2H94 A;  2CYY A;  1YYV A;  3K1N A;  2F5E A;  4Q4Z F;  1Z05 A;  1B9M A;  3BJA A;  4KNY A;  5FO5 A;  5HDN A;  3F8B A;  3J80 K;  1R1V A;  4O3M A;  4UV8 A;  3VFZ A;  4EQQ A;  3E97 A;  3DV8 A;  3V8J A;  4EJU A;  4BXU A;  3HYI A;  2EV6 A;  5CVU A;  1MJ9 A;  4HZF A;  1HW2 A;  1LDK B;  1BC7 C;  3N4M A;  2DQR A;  3JSO A;  3HTS B;  3COA C;  2L54 A;  1S3J A;  3FXR A;  3T8R A;  4OIR F;  1DP7 P;  2TDX A;  2BEO A;  2L02 A;  4U88 A;  2B0L A;  3QOP A;  2ETH A;  2IT0 A;  3BDD A;  1XDS A;  1KYZ A;  4RB0 A;  3GVA A;  1L3L A;  1SAX A;  2ZKZ A;  2OQR A;  1ZHF A;  4HV6 A;  2XGX A;  2DAO A;  1TQI A;  3QPH A;  2XIG A;  4YG2 F;  1PUE E;  4WXD A;  2P4W A;  4HLY A;  2R3S A;  3NQO A;  2IA0 A;  4GYG A;  1FBU A;  2O0Y A;  1YFH A;  1ZRD A;  3PQK A;  3RDI A;  3U2R A;  2M87 A;  3SZT A;  3V7C A;  4ETS A;  2PMH A;  1RUO A;  2RN7 A;  4CO8 A;  2EFW A;  4HDU A;  2LNB A;  2Q0O A;  1FOK A;  5ILU A;  3HSR A;  2XAH A;  3HHG A;  3DF8 A;  1EH8 A;  1HKS A;  1BC8 C;  2Y48 A;  4IRI A;  3WE3 A;  2QYO A;  1U5T A;  4HF1 A;  2E1N A;  4HF0 A;  3IWF A;  3TQN A;  4GCV A;  2DK5 A;  1JXS A;  1OPC A;  2XAS A;  4I01 A;  2LF8 A;  1LDD A;  4ZZL A;  1W7P B;  1MGT A;  3S2W A;  4GXO A;  2HKO A;  1YW8 A;  1WSU A;  2IRF G;  2XAJ A;  2BV6 A;  1EV7 A;  1DUX C;  1IXC A;  5D4S A;  3HIF A;  1S7O A;  3F72 A;  3PFI A;  1SFX A;  1G3S A;  2ZBK A;  4LFU A;  3FX3 A;  1OYI A;  4KT5 C;  2JPC A;  5FFZ A;  4XLP F;  4OOI A;  2FBK A;  3MCZ A;  2F2E A;  2V1X A;  4HV5 A;  5E1Z B;  4I98 B;  3JSP A;  2DQL A;  3LQQ A;  2C6Y A;  1RI7 A;  1F1Z A;  4LGW A;  1UB9 A;  2EV0 A;  5DD4 A;  1UHW A;  3GFM A;  4LB5 A;  3ULQ B;  1I27 A;  1S29 A;  2Z9O A;  2Z5U A;  2O8X A;  5DCM A;  2JSC A;  1KU9 A;  2EFQ A;  4MEX F;  3FM3 A;  5CVV A;  1R7J A;  4WXH A;  3V7R A;  3OOP A;  3CUQ B;  2QUF A;  2XRN A;  1XSV A;  1REP C;  2O03 A;  3JAM K;  5A2Q K;  3GEZ A;  2EFP A;  3K2Z A;  3F8F A;  3R0A A;  3LWF A;  1D8J A;  3RJP A;  1IRG A;  1OYW A;  5ERI A;  3FXQ A;  4YFK F;  1IXS B;  2LKP A;  2F5D A;  2FF4 A;  4WX9 A;  2HYG D;  3WU0 A;  5ILS A;  3EUH A;  1JHH A;  4HLX A;  2HQN A;  4PGH A;  3IKT A;  3CJN A;  1BI1 A;  1K78 A;  2ZNZ A;  4HX7 A;  4RGS A;  2D1H A;  3F23 A;  4OMY A;  2FRH A;  4MHG A;  2P5V A;  3BY6 A;  4JK1 X;  4KIC A;  1T98 A;  4N0B A;  2NNN A;  2M45 A;  4EM0 B;  2GA2 A;  2HTS A;  4LJZ F;  2O3F A;  4F7Z A;  3K1P A;  2STW A;  1ZAO A;  5FFX A;  3T0Y A;  1R1T A;  1J2X A;  1XMA A;  2STT A;  3J7A O;  2X4H A;  6PAX A;  3PQJ A;  2A6H F;  2OZ6 A;  1YO5 C;  2L3D A;  3TO6 A;  2M30 A;  4U7D A;  1FLI A;  4XBF A;  5D6E A;  3TDU C;  3LAP A;  2DK8 A;  1KQ9 A;  4M72 A;  3E6C C;  1XSX A;  1LEA A;  1IRF A;  4HBL A;  4UVA A;  3IHU A;  4RGU A;  1ZYR F;  2YX4 A;  1FYK A;  3TO7 A;  3BPX A;  3GXO A;  2COM A;  5D4R A;  3F8C A;  1F4K A;  3L7W A;  3ROU A;  1K7A A;  1EH7 A;  1L0O C;  4EGY A;  4KUM A;  4UV9 A;  1RUN A;  5HS9 A;  4MNU A;  3WG9 A;  1P2F A;  3ZMS A;  3P9K A;  4KIG A;  2DU9 A;  2OQG A;  3RKX A;  1U78 A;  1ZRC A;  3E3V A;  1QZY A;  3FHZ A;  3GZ6 A;  1J0R A;  1T39 A;  1DPR A;  1USS A;  4EJO A;  3M7G A;  4FT8 A;  4WK8 F;  1QQI A;  1LJ9 A;  4B8X A;  1W5T A;  3U9G A;  4ZYG A;  4UNO A;  3LA2 A;  1FY7 A;  3KP5 A;  1UST A;  1KA8 A;  3ZN1 A;  5A2Q Z;  4RGR A;  3I59 B;  2G7H A;  4KN7 X;  3V7S A;  1TW2 A;  2MLK A;  1KQ8 A;  4G94 A;  2XAF A;  3BWG A;  1TTY A;  3MQ0 A;  4OIO F;  2FXA A;  1Q1H A;  1R58 A;  2KIF A;  3R0J A;  3RYP A;  2DW4 A;  1TW3 A;  1YS7 A;  3WTS C;  2XV4 S;  1ZLJ A;  5L3F A;  1SMT A;  3F8M A;  2RGV A;  1GHC A;  4BNC A;  1QBJ A;  2ZJ2 A;  2RDP A;  3E6M A;  5CYV A;  2HGC A;  3BJO A;  5JI6 A;  5EEH A;  3HSE A;  1XCB A;  3R60 A;  3O3K A;  3C1D A;  2GWR A;  3L2C A;  3WE2 A;  2DLL A;  2A5Y B;  2VOD A;  4DNC A;  2OA4 A;  5LEJ A;  1LVA A;  5HDK A;  2PLY A;  5J8C A;  5F64 A;  1CGP A;  5KVR A;  5LRS A;  3RYR A;  2P7V B;  5HLH A;  2H09 A;  2PJP A;  2K4J A;  1XGO A;  4ASN A;  5K5Q A;  1ZLK A;  1ON2 A;  4YII A;  4L0Z B;  4MQV A;  2PFB A;  3GFL A;  1KGS A;  4KYW A;  2ZME A;  5AON A;  3ZP5 A;  3DXJ F;  4M9X A;  1I6X A;  3FXU A;  3BP8 A;  4KN4 X;  1QNT A;  2ZFW A;  5DV5 A;  4BHB A;  5FD6 A;  1O3Q A;  1WKM A;  3M1E A;  2XAQ A;  5TJJ A;  5K1Y A;  3V8K A;  3OV8 A;  2VBW A;  1FPQ A;  1B9N A;  2DBB A;  5JHU A;  1F9N A;  3FF5 A;  5D8L B;  1IF1 A;  1FBQ A;  4UVB A;  2W25 A;  3R4K A;  1SFU A;  2IA1 A;  1YQA A;  1G3W A;  3LAJ A;  3WTU C;  1B6A A;  1CF7 B;  3QRF F;  4OIP F;  4A5N A;  1KU7 A;  1KQ0 A;  3EQL F;  3Q5F A;  5HLI A;  1UHM A;  1ZG3 A;  3B02 A;  3ISP A;  4HAM A;  4WWC A;  3MFK A;  2W85 A;  3K69 A;  4RB2 C;  1O3S A;  4HYE A;  1MKM A;  1E17 A;  2NYX A;  4Y15 A;  1XGN A;  3H3Z A;  3ZMU A;  5E18 F;  5E17 F;  1W7P D;  1Y0U A;  3V4G A;  1KU2 A;  1NHA A;  4O6J A;  2JPB A;  4D0P A;  2A68 F;  4EM1 A;  3DP7 A;  5JFR A;  4ZYE A;  1IN5 A;  2VBX A;  3REO A;  1G4D A;  4BH9 A;  3F22 A;  4U0V A;  4UHT A;  3N97 A;  3DFG A;  3I4P A;  4K2E A;  1B4A A;  3Q9V A;  3E5U A;  1XB4 A;  4U0Y A;  4EM2 A;  3ZMT A;  2QLZ A;  2Q8K A;  2FEZ A;  1AWC A;  4WXC A;  1MZB A;  5FB2 A;  4AIK A;  4ESF A;  3EET A;  3TGN A;  3WGG A;  1TQM A;  4XSZ F;  1SD4 A;  1GXP A;  4DQ2 A;  1Z6R A;  5DUK A;  4AVP A;  2HYF A;  4MTE A;  4LB6 B;  1I1S A;  4ESJ A;  1G3Y A;  3QAH A;  3KP7 A;  3GX4 X;  2D45 A;  4MQ9 F;  1H9T A;  4IJA A;  1DDN A;  1HST A;  2XRO A;  2YPR A;  1BBY A;  3CDH A;  4S05 A;  4ZZD A;  5FGM A;  3CO7 C;  4HOB A;  3E5X A;  5L3E A;  2KJB A;  2M1B A;  1BJA A;  1FSE A;  3DPT A;  2E7W A;  2FOK A;  2KKO A;  5F6F A;  5IT9 Z;  1R5H A;  4BYY A;  3SZP A;  2UXX A;  2EWN A;  5JVT A;  1IN8 A;  2V79 A;  3GWZ A;  5ICF A;  1O57 A;  2FNA A;  3KP4 A;  2MC3 A;  4LG0 B;  3TKY A;  3W6J B;  4RB1 A;  3M8F A;  1FP2 A;  2RV8 A;  2OU2 A;  2EA2 A;  3RI4 A;  4M71 A;  2V6C A;  4P55 A;  3CLO A;  5L3G A;  1T38 A;  3ZPL A;  3T5X A;  4HW0 A;  3CUQ C;  2CW0 F;  5CJ9 A;  1BIB A;  2ACJ A;  3DQV C;  3NRV A;  4MTD A;  3M9A A;  3MZY A;  3FMQ A;  1D5V A;  5LGU A;  2HZT A;  2RVC A;  3I59 A;  2IP2 A;  2ZNY A;  3KLN A;  3W6K B;  2VN2 A;  4R8H A;  2DPU A;  1WI9 A;  2OD5 A;  2FE3 A;  2FBI A;  3F3X A;  2L4A A;  1I5Z A;  3ERE D;  2JRT A;  2Q2E A;  2DFI A;  2W84 A;  4RAZ A;  5BMZ A;  4WCG A;  3BJ6 A;  2FBH A;  2PMU A;  2P6T A;  1OMI A;  1SD7 A;  4O5V A;  2RKH A;  5D6F A;  5D8K B;  2VE9 A;  3TOA A;  5EEG A;  4ENM A;  5F1R A;  4G7O F;  2MLG A;  1EH6 A;  2D2W A;  5HOO A;  4QLC U;  3HOT A;  5DEQ A;  1ZRE A;  1W4M A;  1PP7 U;  4I0A A;  5E1W A;  2W57 A;  1YTY A;  2H6B A;  2EV5 A;  1ULY A;  4N9H A;  3L9F A;  2IJL A;  3F6O A;  1SMY F;  4M9Z A;  4R1H A;  4XRF A;  4EJW A;  1HXD A;  2ZCW A;  2EB7 A;  3IWZ A;  2XKP A;  4M6Y A;  4A2U A;  1D3Y A;  1U3E M;  2VC1 A;  2ISZ A;  1Z6T A;  2QQB A;  3BZ6 A;  3BPV A;  4CXF A;  3GFJ A;  3O6B B;  5ICC A;  3EYI A;  4KIF A;  1STZ A;  1GVJ A;  1WWX A;  1T6S A;  4OIN F;  2DTR A;  3I5U A;  4P96 A;  5DDG A;  1K79 A;  1KYW A;  5LGN A;  1FBS A;  1U8R A;  2HOE A;  3IC7 A;  1U2W A;  4U0W A;  3KEO A;  4IRG A;  3HUG A;  4KMU X;  3GFI A;  3KP3 A;  5LHG A;  4G9Y A;  2YX7 A;  3K0L A;  3R61 A;  1LDJ A;  5L3D A;  2A07 F;  3WTT C;  2QM3 A;  2FSW A;  3KET A;  2DT5 A;  3GYH X;  3H92 A;  3E6D A;  4A12 A;  2YR2 A;  4B09 A;  2JTV A;  5BPD A;  1R36 A;  3R6S A;  3U1D A;  1HSJ A;  2F5F A;  3VEP A;  4IHT A;  4G8X A;  3BRO A;  1MJA A;  3HRT A;  1XGM A;  3LST A;  3T8T A;  2XHK A;  1RZ4 A;  1XD7 A;  2CG4 A;  3GUD A;  1TQP A;  2XUB A;  4BQA A;  3J81 K;  2IPQ X;  2KRF A;  3SFZ A;  1U5T B;  1ZH5 A;  4TV7 A;  4CDG A;  2ESN A;  2KIM A;  2QQ9 A;  4PDK A;  1IN7 A;  3K1M A;  3GLX A;  2HS5 A;  4HA8 A;  3C3W A;  3O2P E;  5E8G A;  4U7B A;  4M6X A;  3WGI A;  2UZK A;  2MBF A;  2CQK A;  1H9G A;  2IA2 A;  1YS6 A;  4HQM A;  5CVJ A;  2EFO A;  1FT9 A;  2V1U A;  3MZH A;  4E70 A;  5BOX A;  1BM9 A;  5K5O A;  4NQW A;  2CGP A;  3G73 A;  2HKX A;  5H6R A;  3I54 A;  2LSO A;  5BPI A;  2HTJ A;  2HDC A;  5E20 A;  1P4W A;  3MAJ A;  2LDU A;  5IT3 A;  4EV0 A;  3QU6 A;  4BAY A;  3ABU A;  1P4X A;  5AIP A;  4MEY F;  5J8F A;  3L00 A;  4LG0 A;  4I09 A;  1W7P A;  4XSX F;  2PQ8 A;  1HQC A;  2VBZ A;  3ML6 A;  4L5I A;  3VOE A;  1IN4 A;  1IW7 F;  2AS5 F;  4Q47 A;  1ZN2 A;  2CWE A;  5FLX Z;  2QQA A;  1S7A A;  4CIC A;  5IT9 K;  4LLG F;  5E1X A;  2A69 F;  2LF7 A;  4M73 A;  1XDU A;  4OMZ A;  3HHH A;  2P5L C;  1O7L A;  1WQ2 A;  3WOD F;  3I58 A;  3I64 A;  3ECH A;  4MGR A;  1SD6 A;  3FMS A;  2UWM A;  4Q48 A;  5H20 A;  2RC4 A;  1LNW A;  3T1B A;  4YFX F;  2FNP A;  1K78 B;  1G6N A;  5D5V B;  1ZG5 A;  1RNL A;  1BI2 A;  1FP1 D;  1R22 A;  1GXQ A;  1P6R A;  2P6S A;  3ELK A;  2OBP A;  5DD8 A;  5D5X B;  3FM5 A;  5AIQ A;  1FYM A;  1MJB A;  1TLH B;  1IUY A;  5ILV A;  1BN5 A;  4I0B A;  1S6L A;  2NAZ A;  3CUQ A;  4HX4 A;  2VXZ A;  1R5G A;  3FWE A;  1W5S A;  4ESB A;  5ICG A;  3J81 Z;  2EJR A;  5KK1 A;  2GA1 A;  3HRS A;  3C18 A;  2QVO A;  3VB2 A;  1UFM A;  3IKV A;  3VOD A;  2ELH A;  3P7N A;  3LA3 A;  2GIV A;  1TNT A;  5D5U B;  1XGS A;  1LQ1 A;  2O61 A;  4P9U A;  1QGP A;  2HFH A;  1HW5 A;  2FA5 A;  2K86 A;  1E2X A;  3C7J A;  2P7C B;  2BBY A;  1QO0 D;  1X3U A;  1H0M A;  3EYY A;  4LK1 F;  4A5M A;  5L3C A;  2WV0 A;  5DUI A;  2ADU A;  3IRQ A;  4RAY A;  1R1U A;  1P92 A;  4A6D A;  4AD9 A; 
#chains in the Genus database with same CATH topology
 4G7Z F;  3CO6 C;  3J7A Y;  1RR7 A;  1D8K A;  4ZH4 F;  5M3M J;  3L09 A;  3PNT A;  4M9S A;  1ZRF A;  3K4C A;  3RQI A;  2LY9 A;  2JUC A;  1FZP B;  3WU1 B;  2QBY B;  2L01 A;  4HDV A;  4S04 A;  3KFW X;  2K7L A;  2KJC A;  3SXY A;  4BE2 A;  1ETY A;  1MDM B;  4CUG A;  3I9V 2;  1J75 A;  3PNV A;  1J59 A;  4L5J A;  4IEJ A;  4FCY A;  3NWT A;  2NS0 A;  1U8B A;  1OYY A;  3OL3 A;  4L5E A;  2XGE A;  2ZXW H;  2DYS H;  3PUB A;  1B1B A;  3S3N A;  1Z7U A;  2IVM A;  2K4B A;  3LFK A;  4IXA A;  5ICE A;  1F5T A;  1TWH J;  2V1D A;  1Z3X A;  3OIP A;  3KCC A;  1FOY A;  5ED4 A;  1VFC A;  2DPD A;  2RQQ A;  2IS4 A;  2VKH A;  2R7R A;  1KU3 A;  3QYE A;  2CH0 A;  3WTV C;  4HRI A;  5FD5 A;  2EZI A;  3OSF A;  5HDG A;  3H0D A;  2WY8 Q;  3GZ5 A;  5EG0 A;  2WWY A;  1APL C;  3DEU A;  4LLN A;  4UUV A;  3KZY A;  2CU7 A;  2EH3 A;  4A0Y A;  3H5N A;  1IDZ A;  4PSW A;  2NNY A;  1ZG1 A;  2OAZ A;  3BG7 A;  4XOT A;  5FLV A;  4P9F A;  5DTD A;  4XLC A;  3L2U A;  1BI0 A;  3OYB A;  2H27 A;  4XMY A;  1IC8 A;  5CLS A;  4DYC A;  1PP8 F;  1TBX A;  3HXL A;  4KIS A;  3RSN A;  2R5Y A;  1Z67 A;  5HNH A;  2DO7 A;  3ZQ7 A;  2EFN A;  4IQ4 A;  3CF2 A;  2QCO A;  1T2K A;  2ECB A;  2IW5 A;  5D5W B;  4FET A;  4DBR A;  3E6B A;  2K27 A;  3HOS A;  4CYD A;  1ON1 A;  2VKV A;  5LHI A;  1YLF A;  2WAE A;  3OS0 A;  2D5V A;  3OY9 A;  2KLO A;  2G7U A;  5DYM A;  4BU2 A;  3EPZ A;  3B73 A;  5TGT A;  2LOO A;  4G6Q A;  4MFD A;  2IGN A;  3F6V A;  2VB6 A;  3KZZ A;  3G71 I;  3GW2 A;  1O7F A;  1RC9 A;  4PCQ A;  4LLL A;  4RB3 C;  1T33 A;  3RZO J;  2KRC A;  3ERM A;  1AOY A;  3ZQG A;  1G2H A;  3HJE A;  2KZG A;  4L18 B;  2BVL A;  4QPQ A;  3ZMV A;  3ZQI A;  4PJM A;  3CTA A;  4A3G J;  1OR7 C;  1IN6 A;  3DTK A;  3HRU A;  1FX7 A;  1Y56 A;  2K3P A;  3MEX A;  4CHU A;  4GO1 A;  4KJZ A;  4HQE A;  2GZW A;  3KEQ A;  4I02 A;  2VJJ A;  1RIO H;  1O3T A;  1B8I B;  3E1S A;  2GXB A;  2R92 J;  3D5L A;  1X2N A;  2WTE A;  1P9Q C;  4GRI A;  2VQG A;  4CCM A;  4M3B A;  3WTZ A;  1IG7 A;  2A3S A;  3IH2 A;  3Q9S A;  1FSH A;  4NC6 A;  2H1L A;  2MGQ A;  4Y17 A;  4IHS A;  1X3W B;  2DI3 A;  4D7M A;  1K4T A;  2MC4 A;  2HR3 A;  5FRN A;  1V3F A;  2ZO4 A;  2ISY A;  3FIS A;  4FX4 A;  4ENN A;  9ANT A;  2M5W A;  2R7V A;  2FQ3 A;  4AIJ A;  1U6G A;  1ZGJ A;  2CFX A;  2WBM A;  2JA5 J;  1SVO A;  1WRJ A;  3A0H C;  3ZMZ A;  3J7Y J;  4KMF A;  2PBI A;  3RKY A;  4KA4 A;  3WTY C;  2NRA C;  1OQY A;  2J5P A;  2AXL A;  1T8I A;  2HEO A;  2DT6 A;  4I7H A;  1FIA A;  3SHF A;  1ODD A;  1FYL A;  2E2I J;  3TOB A;  2R5Z B;  3TO9 A;  2OPT A;  2JT1 A;  2QWW A;  4EVI A;  2ZME B;  4L0Y B;  3HBL A;  4XLN F;  3TED A;  3I71 A;  4CZZ A;  2R7D A;  3LSM A;  2FML A;  2YSR A;  4XKW A;  5J1Y A;  1Z9C A;  2WC2 A;  4KIB A;  2M8E A;  3RPQ A;  2RQP A;  2JZY A;  3J80 Z;  3I4M J;  3CCS I;  1ZTR A;  4OAY A;  3FZV A;  3H3U A;  5H6Q A;  5B5E C;  2A5W A;  4P5O A;  5LGT A;  4HST A;  1WJD A;  4M3G A;  3F8N A;  2Y75 A;  3G1O A;  1VQL I;  2HZD A;  2UXN A;  1OCT C;  3DKW A;  1SFE A;  3B6C A;  1J9I A;  1A5J A;  3DBH B;  5LLQ A;  1R23 A;  4J00 A;  3K4M A;  3WG7 H;  2LTP A;  4GYI A;  2HXO A;  2VPR A;  4Y13 A;  4JX4 A;  1TWC J;  3A01 B;  1I1G A;  3MMY B;  3ABT A;  3I53 A;  1A35 A;  1BI3 A;  5IYD J;  3MWM A;  1AKH A;  1MBH A;  3WU2 C;  3G2B A;  3DPU A;  4PFO A;  2YS9 A;  4LD5 A;  4Y33 A;  1TP4 A;  2VT2 A;  4EJT A;  2MD5 A;  4EJV A;  1J5Y A;  3D0S A;  3I0T A;  2X1D A;  5HS8 A;  1Z91 A;  2DMT A;  2RAE A;  5C3E J;  2EA4 A;  3CP2 A;  3LQR A;  4PGG A;  3VDX A;  4NHJ A;  5J3L A;  5M5X J;  1BOA A;  1XCV A;  2F5C A;  1X1P A;  1DPU A;  3W2W A;  1ZGA A;  3KP6 A;  3EDP A;  1XC5 A;  3UR3 C;  2P8T A;  4Z2Y A;  3PIO F;  3KE2 A;  5F0F A;  2O5R A;  1MNM C;  2J5O A;  4A6E A;  5IOY A;  3IRR A;  2QSG X;  1ITY A;  4LK0 F;  4CZC A;  3B6A A;  1T0F A;  3QPT A;  1YG2 A;  2WA0 A;  2ZXH A;  1MBJ A;  4CYC A;  1AHD P;  3U21 A;  1NH3 A;  3M8E A;  2Z3Y A;  5FLX K;  3GBG A;  4XQF A;  3LSI A;  1MBK A;  1IRZ A;  1IZ1 A;  1TNS A;  2E7X A;  2V9K A;  3BR5 A;  3MZ8 A;  5IYB J;  4B4C A;  3K9T A;  5JR3 A;  4HF2 A;  3OS2 A;  1K6O A;  1YIJ I;  1BIA A;  3GTK J;  1XS9 A;  2X6W A;  2XKO A;  1T08 B;  3KP2 A;  3QU3 A;  4GGG A;  3HTU A;  3ESW B;  1PDN C;  4LMY A;  3RKW A;  2F48 A;  1F43 A;  2VBY A;  4HX8 A;  2DDA A;  4XIC A;  1U5T C;  1P4A A;  3ZQQ A;  2R0Q C;  1QPM A;  5IPA A;  3H35 A;  4XKB A;  2MA3 A;  3JW4 A;  5GPA A;  2OZU A;  2EZL A;  2V9V A;  4QPO A;  3PUF A;  1CF7 A;  2QEN A;  3S15 J;  1LEB A;  2CMP A;  3G1M A;  4UB8 C;  4BKX A;  3LSG A;  3GME A;  2XPV A;  3DLL F;  3G3Z A;  3RTR A;  2A6E F;  4A3E J;  1IXR C;  4E7I A;  1HBX G;  2JQ7 A;  4JOM A;  1A04 A;  2Y0S A;  1SD5 A;  3E5Q A;  2DJN A;  4L9J A;  3TP3 A;  5B66 C;  3TMO A;  3CC7 I;  4R79 A;  4WF2 A;  4M74 A;  1XSD A;  2DA7 A;  4EMS A;  2GXG A;  1Z1D A;  2M9H A;  1MD0 A;  2FU4 A;  3DCF A;  1ETW A;  2RNJ A;  5CQG A;  5FKN A;  2COB A;  1YJ9 I;  1PJR A;  1VQ5 I;  2MH2 A;  2F5V A;  4Q5S F;  2KZV A;  4L9T A;  5LBQ A;  1ETO A;  3GF2 A;  3LA7 A;  1RRJ A;  3KLO A;  2DMQ A;  3OYJ A;  4A3L J;  2DA5 A;  3HOU J;  3OYF A;  4XLF A;  3OL4 A;  4IF4 A;  5CPR B;  3HOV J;  1WJA A;  2XAG A;  1FNN A;  2FD5 A;  1Z21 A;  4G6T B;  4A0X A;  3W3C A;  1VZ0 A;  2NVU B;  4DBQ A;  1BJZ A;  1FC3 A;  2QZ8 A;  2D1V A;  3NEU A;  3H0G J;  4I2O A;  3ECO A;  4ENJ A;  4OU0 A;  1S9H A;  5HS7 A;  2ESH A;  2O6G E;  2V6E A;  4A3M J;  2VON A;  4N9I A;  2QBY A;  2CSO A;  2JA8 J;  4XLH A;  3AAF A;  2QA4 I;  3W2V A;  3GZN B;  1LKX A;  1MDM A;  1JUS A;  3ZMD A;  4BGD A;  1FTT A;  3F21 A;  2LRE A;  1ONV A;  1JHF A;  2BE5 F;  2E5Z A;  2MH9 A;  2EK5 A;  3LMM A;  1D0Z A;  1ZAR A;  4EGZ A;  3BTL A;  2Z99 A;  4LIV A;  3K7A J;  2IAI A;  2ZXJ A;  1TWG J;  2I10 A;  2XVC A;  5DCF A;  4A3J J;  3JRI A;  1X2M A;  5E8I A;  2EIN H;  4RGX A;  4HNV A;  4BHC A;  1VQP I;  2YU3 A;  3IL2 A;  4DOZ A;  4RS8 A;  1YIO A;  4C2T A;  3S14 J;  3OWT A;  3OYN A;  2IXS A;  1V4R A;  2H6C A;  3H9J A;  2VT3 A;  3D5R C;  1R4N B;  4OIQ F;  1O3R A;  2G9W A;  3KZI C;  1RET A;  2VOO A;  2DFE A;  4KFC A;  1OKR A;  5BQT A;  2HQR A;  4P1W A;  5E3L A;  3WGH A;  1B72 B;  4UUS A;  4IVN A;  3K10 A;  3HSF A;  1W36 D;  1X1C A;  2VC0 A;  1EA3 A;  3WTW C;  1SVM A;  2W24 A;  2BGC A;  5J6X A;  4NDL A;  1V54 H;  3WHC A;  1VI0 A;  2PN6 A;  3BG6 A;  1WCM J;  3VPR A;  2ZC2 A;  3JAM Z;  2K02 A;  3BZK A;  5JLX A;  4IHX A;  4G6D A;  3BOQ A;  2ZSH B;  4JX5 A;  1TT5 B;  4D5C A;  4YEJ A;  3GO5 A;  3V8L A;  3J7Z I;  4NB5 A;  2Z33 A;  3PL8 A;  1YW7 A;  2CQQ A;  2VKE A;  1ZK8 A;  2WAF A;  3BR6 A;  1HKT A;  3M8J A;  4EEF G;  4JQF A;  3RZD J;  3DKX A;  1TZL A;  3LOC A;  1HC8 A;  2XAU A;  4F55 A;  3QPS A;  4U87 A;  2Q2E B;  1BR2 A;  2E1C A;  5EF6 A;  1J09 A;  4IRH A;  1OCC H;  2K85 A;  5FRO A;  4CGZ A;  2CUF A;  1IRX A;  1RPW A;  4QWQ A;  5DCM B;  1S8N A;  2V4J C;  1VF9 A;  5CVR A;  2WB1 N;  4FHT A;  1UCR A;  4G7H F;  4IPA A;  4JBA A;  5GAE J;  3JRB A;  4A3K J;  2NVT J;  5TRD A;  5KCM A;  2OTJ I;  4L9V A;  5LHH A;  1N25 A;  4BAC A;  1JE8 A;  1R71 A;  4ZYD A;  2Z16 A;  2PG4 A;  1B59 A;  3HRM A;  4BE1 A;  2CQX A;  1XN7 A;  3BT9 A;  2DA1 A;  2PEX A;  1HKQ A;  3IP4 B;  1Y6I A;  1W36 C;  2GAU A;  2CFO A;  2X0L A;  5LRR A;  1FTZ A;  2KPM A;  4E7J A;  3QOE A;  3JTH A;  2KIU A;  2L4M A;  1QHG A;  3QYB A;  4F52 A;  3SQN A;  4HPQ A;  4ZJZ A;  4B3X A;  4XK4 A;  2OCE A;  3PIP F;  3WTX C;  1E3P A;  1IUF A;  2XB0 X;  3CUO A;  1POG A;  3CCR I;  1JUP A;  1B8I A;  2HVR A;  1BR1 A;  3VYT B;  1QZZ A;  2E19 A;  2R7F A;  4ENK A;  5HLG A;  3ZN0 A;  5CVI A;  2GQQ A;  2W4S A;  4H0E A;  1N75 A;  4E7L A;  4ZYH A;  3RKQ A;  2DJI A;  1TWA J;  4PSX A;  4A0Z A;  2MAB A;  3OMY A;  2HWV A;  2Y0M A;  2JSP A;  1ZEL A;  4II2 A;  3GTL J;  3FMR A;  4DW6 A;  4KDP A;  1WPK A;  3OYH A;  3PFY A;  3WHB A;  4A69 C;  4ON0 A;  3JRA A;  2FMY A;  1MMS A;  2F4I A;  1YW9 A;  1VQ8 I;  3QP6 A;  3M1C A;  3DPL C;  3JR9 A;  3CQZ J;  1ETX A;  1IAW A;  2BYV E;  2R5Z A;  1HW1 A;  1UHS A;  1X58 A;  3HOX J;  1I6H J;  3QP5 A;  2PI0 A;  3OYG A;  1SFK A;  3W6V A;  2EIM H;  1LFP A;  2LKS A;  2UUZ A;  3FKI J;  1JGS A;  1ZKG A;  1V5E A;  2L9V A;  4AU7 A;  1OR7 A;  3MKZ A;  3HEF A;  2CO5 A;  3P9C A;  3QWL A;  3RIR A;  3VSK A;  1FWZ A;  1MMG A;  2DOE A;  3TDZ C;  2CV1 A;  4L9N A;  3RPU A;  1TT0 A;  1VTN C;  2PJR B;  3PO3 J;  4BHP A;  2A61 A;  4PZJ A;  1G3T A;  5K5R A;  2VE8 A;  4AIH A;  5BS6 A;  3JTG A;  1R00 A;  3JRC A;  2W1O A;  5E79 C;  4XRM A;  5J47 A;  3AL0 B;  4YIF A;  4UXN A;  4YFN F;  1IV8 A;  4FX0 A;  3HUG B;  2P5K A;  1W0T A;  4A3D J;  4B43 A;  1LB2 A;  5F0H A;  4DYQ A;  2FUG 2;  2NVY J;  3P9I A;  2VOP A;  1C0W A;  3LNQ A;  5HVQ C;  1VQO I;  1RKW A;  3SFI A;  3MKW B;  5L3B A;  1XMK A;  2R7S A;  4UVC A;  2WAQ N;  3A01 A;  4IX7 A;  2DA3 A;  5LEK A;  1W0U A;  1Y8Q B;  2MYS A;  4AWX B;  2BY0 A;  5TIS C;  1J7K A;  1EKE A;  4RDU A;  2H94 A;  3BQY A;  4ZDO A;  2BVM A;  2VKD A;  2CYY A;  1YYV A;  1HDP A;  2F5E A;  3K1N A;  3BR0 A;  2GLO A;  4Q4Z F;  2G0E A;  1Z0X A;  3M3Y J;  4YRV A;  1Z05 A;  1B9M A;  3BJA A;  2KFD A;  4C3H J;  4KNY A;  1R9T J;  5FO5 A;  4B47 A;  5HDN A;  3F8B A;  2Z2S B;  3J80 K;  1R1V A;  1NG7 A;  1H89 C;  4O3M A;  4UV8 A;  4JP0 A;  3VFZ A;  1R6R A;  4EQQ A;  3E97 A;  3DV8 A;  2LBF B;  5FKO A;  3V8J A;  4EJU A;  4XR6 A;  4BXU A;  3DLA A;  3HYI A;  2DTZ A;  2EV6 A;  5CVU A;  2OTL I;  2KRH A;  2CV2 A;  1MJ9 A;  4HZF A;  1HW2 A;  3X2Q H;  1LDK B;  1BC7 C;  3N4M A;  2DQR A;  3JSO A;  3HTS B;  1Z3Y A;  2ME0 A;  3COA C;  1LFU P;  2L54 A;  1KON A;  5GAH J;  1S3J A;  3FXR A;  2F4O B;  3T8R A;  4OIR F;  2NS8 A;  2CQN A;  1DP7 P;  2TDX A;  2BEO A;  4B44 A;  4E7S A;  2NXN B;  2K3F A;  1P7J A;  2L02 A;  1T95 A;  1M1E B;  4AYB N;  3I56 I;  4BY1 J;  4U88 A;  1UZC A;  2B0L A;  2NVQ J;  2M4G A;  3QOP A;  2ETH A;  2IT0 A;  1ZQ3 P;  1DU6 A;  2GOM A;  4FE4 A;  4BJ5 C;  4ABZ A;  3BDD A;  1XDS A;  1X1D A;  3KYC B;  3BC8 A;  1KYZ A;  4RB0 A;  3GVA A;  1L3L A;  1SAX A;  2ZKZ A;  2OQR A;  1JKP C;  1VQ7 I;  2LG4 A;  3O8G A;  1ZHF A;  4HV6 A;  1O4X A;  2XGX A;  2DAO A;  1TQI A;  1X1A A;  3QPH A;  2XIG A;  2CQ7 A;  3OYM A;  1R4M B;  4PK4 A;  1FOX A;  1I50 J;  1X4O A;  1OCZ H;  4YG2 F;  5JLW A;  1MSE C;  4AM3 A;  1ERD A;  3KEY A;  4WXD A;  1PUE E;  2DMN A;  2P4W A;  3CCJ I;  4HLY A;  3HOZ J;  2HPI A;  2VAS A;  2R3S A;  4AUX A;  3GTQ J;  4HNT A;  3S1M J;  3NQO A;  2IA0 A;  4GYG A;  1LE8 A;  2VUM J;  1FBU A;  4XON A;  2O0Y A;  1YFH A;  2LH9 A;  1ZRD A;  2QSH X;  3PQK A;  1ENH A;  2AXT C;  3RDI A;  3U2R A;  2HQ5 A;  2DA6 A;  2M87 A;  3HGG A;  3SZT A;  3V7C A;  3S2D J;  1DP3 A;  1XPX A;  1ZR2 A;  4ETS A;  2PMH A;  2M8G X;  1RUO A;  2RN7 A;  4RLQ A;  4CO8 A;  2EFW A;  1HLV A;  4HDU A;  4NQW B;  2LNB A;  2Q0O A;  1K4S A;  3RPU D;  1FOK A;  4BBS J;  5EEA A;  1ETK A;  5ILU A;  3HSR A;  1MND A;  2XAH A;  3E7L A;  2KIQ A;  3BCA A;  4PFP A;  3HHG A;  3DF8 A;  1EH8 A;  1HKS A;  1BC8 C;  2Y48 A;  4IRI A;  3HGY A;  1HDD C;  2E1M B;  1WZ2 A;  5F27 A;  2DMU A;  3Q3S A;  2QYO A;  3HG9 A;  3WE3 A;  1U5T A;  2H8W A;  1GVD A;  4HF1 A;  2E1N A;  2QF7 A;  4HF0 A;  4C2U A;  3IWF A;  3H36 A;  3S93 A;  3TQN A;  4GCV A;  2DK5 A;  3DEE A;  1JXS A;  1OPC A;  1X1B A;  2XAS A;  1FMV A;  4I01 A;  2R4G A;  5IYC J;  2LF8 A;  4HEA 2;  3W2A A;  3C2H A;  1S72 I;  3LL7 A;  1LDD A;  2ZME C;  4ZZL A;  5KAI C;  2F4M B;  1W7P B;  1MGT A;  3S2W A;  4CCN A;  3ABK H;  4C3I J;  4RA2 A;  1N77 A;  4GXO A;  2HKO A;  2RRE A;  1PUF B;  2R7Q A;  3S16 J;  3DWL E;  1YW8 A;  3LSK A;  3GTO J;  1WSU A;  2IRF G;  2XAJ A;  2BV6 A;  1EV7 A;  2BOL A;  1DUX C;  1IXC A;  5D4S A;  5B1B H;  3HIF A;  1JKR C;  1S7O A;  2UV1 A;  3F72 A;  3PFI A;  5B3S H;  2IS1 A;  1SFX A;  1G3S A;  2ZBK A;  4LFU A;  4KIT B;  3QYF A;  3FX3 A;  1OYI A;  4KT5 C;  1UEL B;  2ME6 A;  2JPC A;  5FFZ A;  4XLP F;  3Q0V A;  4OOI A;  2XSJ C;  2FBK A;  2R7W A;  3MCZ A;  2F2E A;  2V1X A;  3H3V K;  1QHH D;  4FE7 A;  3CDL A;  4UB6 C;  4HV5 A;  2BW3 B;  4Z6Y A;  5E1Z B;  1X19 A;  2EZH A;  4I98 B;  3JSP A;  4ZTJ A;  2DQL A;  3LQQ A;  2C6Y A;  1S5L C;  1RI7 A;  3O8H A;  2X1C A;  1F1Z A;  4LGW A;  1UB9 A;  4RLF A;  2EV0 A;  5DD4 A;  1UHW A;  3GFM A;  2DOA A;  3SZG A;  4LB5 A;  2W7N A;  3ULQ B;  1I27 A;  2HDD A;  1S29 A;  2Z9O A;  2Z5U A;  4IO9 F;  2O8X A;  5DCM A;  1WHU A;  1KU9 A;  2JSC A;  2EFQ A;  1TL8 A;  3DEW A;  5E3O A;  1JT0 A;  4MEX F;  3FM3 A;  5CVV A;  1R7J A;  3A02 A;  1GDT A;  4WXH A;  3V7R A;  3OOP A;  2PX9 A;  3CUQ B;  2ZJP F;  2FOW A;  1MMA A;  2QUF A;  2VPL A;  2XRN A;  1U0J A;  5EGO B;  1XSV A;  4AC0 A;  4Y7N J;  1QZE A;  1REP C;  2O03 A;  3HL2 A;  3JAM K;  5A2Q K;  4A3B J;  3GEZ A;  2EFP A;  2QKM B;  3S1R J;  2BXY A;  3K2Z A;  2BHY A;  4FQG A;  2GOX B;  3E0J B;  3UKG A;  3F8F A;  2XF6 A;  3R0A A;  3LWF A;  1D8J A;  1IO2 A;  3RJP A;  3PNY A;  1IRG A;  3VYU B;  4FTH A;  1OYW A;  5ERI A;  3C2B A;  4GFB A;  3FXQ A;  3JRH A;  1IXS B;  1GLN A;  2F5D A;  2FF4 A;  2KL4 A;  2LKP A;  2LYC A;  3HZJ A;  4YFK F;  4WX9 A;  2R7Z J;  2HYG D;  1LUJ B;  1N78 A;  3WU0 A;  4V19 K;  3DTE A;  1AA7 A;  5ILS A;  3EUH A;  1JHH A;  3KIO A;  4HLX A;  1G59 A;  2HQN A;  4PGH A;  5KAF C;  3IKT A;  2FX0 A;  3CJN A;  1BI1 A;  4BEH B;  3JRF A;  1K78 A;  4OAZ A;  2ZNZ A;  4HX7 A;  2KIS A;  4RGS A;  2D1H A;  2V9P A;  3F23 A;  4OMY A;  2DYR H;  2FRH A;  3K4B A;  4MHG A;  2P5V A;  4CCJ A;  3CJQ B;  3BR3 A;  2OJE D;  3F9K A;  5DM6 F;  3BY6 A;  3SDB A;  2M34 A;  4JK1 X;  3FHN A;  4KIC A;  1T98 A;  5C4J J;  1WI3 A;  2JVH A;  4N0B A;  2NNN A;  3GTJ J;  2M45 A;  2WB1 A;  4EM0 B;  2GA2 A;  2HTS A;  3BTC A;  4LJZ F;  2O3F A;  3VWB A;  3M07 A;  4F7Z A;  1NTC A;  3K1P A;  2STW A;  1OCR H;  2O9L A;  1HF0 A;  1ZAO A;  2BHZ A;  5FFX A;  1RES A;  2MD0 A;  3L2R A;  1SFO J;  3T0Y A;  1R1T A;  1J2X A;  1XMA A;  2STT A;  3PSF A;  3J7A O;  4PUS A;  2X4H A;  6PAX A;  3DKY A;  3ABM H;  2A6H F;  3PQJ A;  1WJB A;  1ACI A;  2OZ6 A;  3HKZ N;  4BXF A;  4A3C J;  2ELK A;  1YO5 C;  1GUU A;  4E4H A;  4CSW A;  2X6O A;  2EQR A;  4DYR A;  3H9G A;  2L3D A;  3CD6 I;  1XMX A;  1TWF J;  3TO6 A;  4E6K G;  3ZQF A;  2M30 A;  4U7D A;  1FLI A;  4XBF A;  2AO9 A;  1BA5 A;  2W82 A;  5D6E A;  3TDU C;  3LAP A;  3OR1 C;  2DK8 A;  1KQ9 A;  4M72 A;  3E6C C;  1GT0 C;  1XSX A;  1LEA A;  2VI6 A;  3KX2 A;  3H5R A;  2EIL H;  1IRF A;  4HBL A;  3TW7 A;  4UVA A;  3IHU A;  4RGU A;  1ZYR F;  2YX4 A;  1FYK A;  1Z7L A;  3TO7 A;  2YUS A;  3BPX A;  3GCM A;  2LBF A;  4RBO A;  3GXO A;  4Y52 J;  2COM A;  1A31 A;  5D4R A;  3F8C A;  1F4K A;  3L7W A;  5DS9 A;  3ROU A;  5KNL A;  1K7A A;  1EH7 A;  1L0O C;  1K6Y A;  4KUM A;  4EGY A;  3K2A A;  4UV9 A;  3HPG A;  2ZFU A;  2CW7 A;  1RUN A;  5HS9 A;  4MNU A;  4MIM A;  4ZDP A;  3WG9 A;  4KT6 A;  3SDG A;  2ZJQ F;  1P2F A;  3S17 J;  4E7Z A;  3ZMS A;  3TBI A;  1UAA A;  5EYR A;  4BL0 B;  2DMP A;  2ID6 A;  3P9K A;  4KIG A;  2OF7 A;  4MLO A;  3CLQ A;  2DU9 A;  2XF5 A;  2MSY A;  2OQG A;  3RKX A;  2MFZ A;  1SVL A;  2Q1Z B;  3E3V A;  1U78 A;  3CZ6 A;  1QZY A;  1ZRC A;  1DGR M;  4IOA F;  3FHZ A;  4ZTF A;  1TC3 C;  1OIS A;  3GZ6 A;  5H2F C;  1T56 A;  1XG1 A;  1XX5 A;  1J0R A;  1T39 A;  3D5S C;  2VIX A;  5C44 J;  1DPR A;  1USS A;  2QQ8 A;  3FXK A;  4EJO A;  2WAQ A;  3M7G A;  2Y9Y A;  4FT8 A;  4LG3 A;  4WK8 F;  2HU9 A;  3M4O J;  1QQI A;  4D7N A;  1LJ9 A;  4LOC A;  4B8X A;  1W5T A;  3U9G A;  4ZYG A;  2E60 A;  4UNO A;  3LA2 A;  2Y31 A;  4V2F A;  4X6A J;  1FY7 A;  2K40 A;  5J4V A;  2MW8 A;  1MBE A;  3KP5 A;  1UST A;  3FXM A;  3BQZ A;  1KA8 A;  5CQE A;  3ZN1 A;  1WH5 A;  2IEK A;  4RGR A;  3I59 B;  4DZJ A;  5A2Q Z;  2G7H A;  4KN7 X;  3V7S A;  1E0E A;  4F92 B;  1TW2 A;  2MLK A;  2TRT A;  1KQ8 A;  4G94 A;  2XAF A;  3BWG A;  1YI2 I;  1TTY A;  3MQ0 A;  4OIO F;  3VYS B;  4AVZ A;  2FXA A;  2NOJ B;  1Q1H A;  1R58 A;  2A05 A;  2KIF A;  2OC6 A;  4IL6 C;  3R0J A;  3RYP A;  2DW4 A;  1TW3 A;  1VQK I;  1YS7 A;  3WTS C;  1VND A;  2M0M A;  5C4X J;  1U9O A;  1HOM A;  1ORK A;  2KHM A;  2XV4 S;  1ZLJ A;  2JA6 J;  4IHY A;  5L3F A;  4UUT A;  3AG2 H;  1OCP A;  1SMT A;  3EUH C;  3F8M A;  3IH4 A;  4A3F J;  2RGV A;  4AYB A;  1GHC A;  4BNC A;  2F6C A;  3K70 D;  1BR4 A;  2K9N A;  1QBJ A;  4IQJ A;  4BJT A;  4LIT A;  2XC7 A;  2ZJ2 A;  2X51 A;  1HCR A;  2RDP A;  3OIO A;  3E6M A;  1U9N A;  5CYV A;  2HGC A;  3BJO A;  5JI6 A;  2DFF A;  2B7E A;  5EEH A;  3HSE A;  3LSR A;  1XCB A;  3R60 A;  3CCL I;  3IH3 A;  3FXO A;  3NWS A;  3HOW J;  1R5I D;  3O3K A;  1QRY A;  2X48 A;  2B9S A;  3C1D A;  2GWR A;  1BOB A;  2OUM A;  2KDZ A;  3CCU I;  3L2C A;  1QVT A;  1EF4 A;  1D1B A;  3WE2 A;  4W1U A;  1Y1W J;  1PUF A;  2DLL A;  5FRM A;  2CUJ A;  2A5Y B;  3G4S I;  4DNC A;  2VOD A;  1ETQ A;  2OA4 A;  2VJ4 A;  3IAM 2;  5LEJ A;  1LVA A;  5HDK A;  2Y69 H;  2PLY A;  3PM1 A;  5J8C A;  5F64 A;  3CCQ I;  1X4P A;  3C2G A;  3GLL A;  3QQA A;  5E3M A;  1CGP A;  1EJ9 A;  3ZQC A;  3CCE I;  3AL0 C;  5KVR A;  5LRS A;  3RYR A;  5M5Y J;  5M5W J;  2P7V B;  4CH7 A;  1IJW C;  2DA4 A;  2RNG A;  5GPC A;  2EPF A;  1ZGW A;  1OLT A;  5HLH A;  2H09 A;  3HDD A;  2PJP A;  2K4J A;  4XRS G;  2HPM A;  3FK6 A;  2DOD A;  1XGO A;  3MN2 A;  1AKH B;  4ASN A;  3SJM A;  5K5Q A;  3K70 C;  1ZLK A;  3G6E I;  1ON2 A;  2YU9 J;  4YII A;  3ONQ A;  4L0Z B;  2BW3 A;  3CJT B;  4MQV A;  4F93 B;  2PFB A;  1MSF C;  2X1E A;  4YIR X;  5CKT A;  3FKJ A;  5J1R A;  3GFL A;  1KGS A;  3LSP A;  4KYW A;  3G1L A;  3H5A A;  3S8P A;  2I8D A;  2ZME A;  5AON A;  3ZP5 A;  2VL8 A;  3DXJ F;  4M9X A;  1WH7 A;  2VJ5 A;  2L7M P;  1I6X A;  3FXU A;  3GTM J;  1YRN B;  3BP8 A;  3CCY A;  4KN4 X;  1QNT A;  2ZFW A;  5DV5 A;  4BHB A;  2XGD A;  5FD6 A;  1YJW I;  2P0W A;  1O3Q A;  2HVQ A;  2B63 J;  1WKM A;  3M1E A;  2XAQ A;  2ZB9 A;  4XOR A;  5TJJ A;  5K1Y A;  5FKM A;  1FJL A;  3V8K A;  5EZH A;  3OV8 A;  2VBW A;  4CYC B;  2NOG A;  1FPQ A;  2LY1 A;  1B9N A;  2DBB A;  5JHU A;  3OYD A;  3KYL A;  3FK7 A;  1Y1V J;  2EBI A;  2ZSI B;  5IOZ A;  2BY1 A;  1YE9 A;  1F9N A;  3FF5 A;  5D8L B;  1YHQ I;  1IF1 A;  1FBQ A;  2E35 A;  4UVB A;  2W25 A;  2QGU A;  3R4K A;  1VQM I;  2LFB A;  1SFU A;  1OFC X;  2IA1 A;  1UG0 A;  1YQA A;  3HPH A;  2JJ7 A;  1G3W A;  3LAJ A;  1SC7 A;  3WTU C;  1B6A A;  1X3Z B;  1CF7 B;  2XGC A;  3QRF F;  4OIP F;  1D0Y A;  2M2E A;  3A0B C;  2VJI A;  4A5N A;  3JRD A;  3CMY A;  1KU7 A;  2IBD A;  1KQ0 A;  3EQL F;  3Q5F A;  2AQE A;  5HLI A;  3S2H J;  2R7T A;  4LIU A;  1UHM A;  1ZG3 A;  1I39 A;  3B02 A;  3ISP A;  4HAM A;  4WWC A;  3MFK A;  2W85 A;  3K69 A;  4RB2 C;  1O3S A;  1UJ8 A;  4DIQ A;  4HYE A;  1KZH A;  5GAD J;  2EIK H;  1MKM A;  1E17 A;  2NYX A;  1SAN A;  4Y15 A;  1XGN A;  4CCO A;  1MMD A;  3H3Z A;  3ZMU A;  2GXA A;  1V5G A;  5E18 F;  5E17 F;  1W7P D;  5K7H A;  1Y0U A;  3V4G A;  1KU2 A;  1NHA A;  3I55 I;  4O6J A;  1A36 A;  2JK3 A;  3FBN B;  4BQO A;  2AQF A;  2JPB A;  4BE0 A;  4D0P A;  2M7A A;  2A68 F;  4EM1 A;  2HI3 A;  1I3A A;  2X6Y A;  3DP7 A;  5JFR A;  1JT6 A;  3VSL A;  4ZYE A;  1E3O C;  1IN5 A;  2VBX A;  4XN0 A;  3REO A;  1G4D A;  3BLY A;  4BH9 A;  4XL9 A;  4AID A;  3F22 A;  1W1W E;  4U0V A;  4JYK A;  4UHT A;  3N97 A;  2Z1D A;  3DFG A;  3I4P A;  4K2E A;  3QPL A;  4Y3O A;  1B4A A;  2BY3 A;  3Q9V A;  2E1M C;  1WFX A;  3AG3 H;  4PJJ A;  4BS9 A;  1K61 A;  3FIW A;  2AHQ A;  3E5U A;  1UG2 A;  2CUZ A;  4BY7 J;  1XB4 A;  4U0Y A;  4EM2 A;  3CC4 I;  3DU5 A;  3ZMT A;  2QLZ A;  2Q8K A;  2M4K A;  2FEZ A;  1AWC A;  2CRG A;  4WXC A;  1IGN A;  3Q0U A;  2R7O A;  1MZB A;  1WJ5 A;  5FB2 A;  4PJN A;  4AIK A;  1MIJ A;  4ESF A;  3EET A;  3TGN A;  3BG9 A;  3QOD A;  3WGG A;  1TQM A;  4XSZ F;  1SD4 A;  5F08 A;  3TL4 X;  4B1R A;  4DQ2 A;  1Z6R A;  1GXP A;  1YIT I;  1AU7 A;  5DUK A;  1XTA A;  2K9M A;  4AVP A;  2LC2 A;  2PMZ N;  2HYF A;  4MTE A;  4J01 A;  2L2O A;  4LB6 B;  1JI8 A;  4G12 A;  2JVG A;  4XKC A;  2E1O A;  3VYR B;  1I1S A;  3OYE A;  4JX6 A;  5IP6 A;  1G3Y A;  4ESJ A;  3QAH A;  3KP7 A;  3GX4 X;  1WJE A;  4MQ9 F;  3AKZ A;  2D45 A;  2XPU A;  1ZR4 A;  1H9T A;  2KP6 A;  4IJA A;  3NAU A;  1HST A;  3OR2 C;  1DDN A;  2XRO A;  2YPR A;  1BBY A;  3CDH A;  4S05 A;  4ZZD A;  2L7F P;  5FGM A;  2K9Q A;  4UUS B;  3CO7 C;  1FMW A;  4BBR J;  1VQ4 I;  4HOB A;  3TW6 A;  3E5X A;  4BJ6 C;  5L3E A;  2KJB A;  2M1B A;  1BJA A;  4X0G A;  1FSE A;  3DPT A;  2VQH A;  2E7W A;  2FOK A;  3SYT A;  1JKO C;  2KKO A;  5F6F A;  2OV7 A;  1R5H A;  5IT9 Z;  4BYY A;  3JRG A;  2DFH A;  4RM3 A;  3SZP A;  2A6T A;  4IHW A;  2UXX A;  2EWN A;  5JVT A;  1IN8 A;  2V79 A;  1P7I A;  3GWZ A;  5ICF A;  1O57 A;  2IGK A;  4PJL A;  2FNA A;  3KP4 A;  2MC3 A;  4LG0 B;  1VQ9 I;  2L7K A;  3S3M A;  3TKY A;  5K7Z A;  3KPH A;  3W6J B;  4RB1 A;  2KQR A;  5KHD A;  3M8F A;  3HKZ A;  4M3E A;  1UMQ A;  2IGM A;  1MMN A;  1FIP A;  1FP2 A;  2XF7 A;  3CES A;  2K9S A;  2RV8 A;  2OU2 A;  3OYC A;  3S3O A;  2EA2 A;  1VQN I;  4EAT A;  3RI4 A;  4M71 A;  2V6C A;  4P55 A;  3CLO A;  5JVG F;  5L3G A;  1T38 A;  5F1J A;  3ZPL A;  1BW5 A;  3T5X A;  1Z77 A;  4HW0 A;  4BQQ A;  3CUQ C;  2CW0 F;  5CJ9 A;  5BNG A;  1BIB A;  3OSG A;  2ACJ A;  2X85 A;  4HSR A;  3DQV C;  1E3H A;  3FDY A;  5HOD A;  4ANJ A;  3OYL A;  1B72 A;  3NRV A;  2BXZ A;  4MTD A;  3EUA A;  2GBY A;  4E7H A;  3M9A A;  3MZY A;  1LVK A;  3FMQ A;  4XID A;  1JJ8 C;  1D5V A;  5LGU A;  2E2H J;  1OJL A;  2OCC H;  2HZT A;  2XB5 A;  2RVC A;  2I5U A;  3ZRG A;  2IS2 A;  3I59 A;  2IP2 A;  1WJC A;  2ZNY A;  3KLN A;  3W6K B;  3HOY J;  2ID3 A;  2VN2 A;  4R8H A;  4RAF A;  4OWR B;  2DPU A;  1WI9 A;  2OD5 A;  2FE3 A;  2FBI A;  4CA0 A;  2X6X A;  3F3X A;  2L4A A;  2V1N A;  2R7X A;  4XOP A;  1I5Z A;  3ERE D;  2JRT A;  3ZGK A;  2Q2E A;  1DQU A;  1MBG A;  3OOU A;  2DFI A;  1NG6 A;  2W84 A;  2W48 A;  4F91 B;  3K6G A;  4RAZ A;  3OS1 A;  4DZP A;  5BMZ A;  4V2G A;  4WCG A;  3BJ6 A;  2FBH A;  2PMU A;  3FBI B;  2P6T A;  1OMI A;  2V26 A;  1Y0N A;  2L9S A;  1SD7 A;  1CQT A;  4MFE A;  1Q1V A;  4O5V A;  3A2K A;  2KT0 A;  3HC7 A;  2RKH A;  2O8K A;  5D6F A;  5D8K B;  3BG3 A;  2VE9 A;  5J40 A;  3TOA A;  5EEG A;  4ENM A;  5F1R A;  3HM5 A;  2L0K A;  4QIW N;  2MLG A;  4G7O F;  2QSF X;  3BTI A;  3MVP A;  2HYJ A;  5EZG A;  2JA7 J;  1EH6 A;  2D2W A;  3S1Q J;  2E34 A;  2TCT A;  5HOO A;  2CV0 A;  2FQ4 A;  5IP7 J;  5IY5 H;  2M0C A;  4QLC U;  4NC8 A;  4D1Q A;  3HOT A;  3SEQ A;  5DEQ A;  1ZRE A;  3L2W A;  1W4M A;  2LMD A;  1PP7 U;  5E3N A;  2EIJ H;  4I0A A;  5DM7 F;  5E1W A;  3IAS 2;  1WJF A;  2W57 A;  1YTY A;  2H6B A;  2EV5 A;  1ULY A;  4N9H A;  3L1P A;  1A6Q A;  3BG5 A;  1F36 A;  2XDV A;  1IV6 A;  3L9F A;  3U1K A;  2IJL A;  2K5C A;  3F6O A;  3LSH A;  4H4K C;  1D1A A;  1SMY F;  2FJ1 A;  4M6V A;  4M9Z A;  4X1E A;  4R1H A;  4XRF A;  4EJW A;  1HXD A;  3TP0 A;  4UY8 I;  2ZCW A;  2EB7 A;  3IWZ A;  2XKP A;  3OYI A;  4M6Y A;  4A2U A;  1QPI A;  1D3Y A;  2CW8 A;  1U3E M;  2HNH A;  4C3J J;  4XKV A;  2VC1 A;  4D5F A;  5J1U A;  5FLM J;  2ISZ A;  1PYV A;  1Z6T A;  2JUG A;  4E7K A;  1QU3 A;  2QQB A;  3BZ6 A;  4XRS A;  2VQC A;  4A3I J;  4XN3 A;  2CS3 A;  3BPV A;  1QA6 A;  2N8G A;  1D5Y A;  4CXF A;  3CMM A;  2HOT A;  2DN0 A;  3GFJ A;  3O6B B;  4NNJ A;  5ICC A;  2GM4 A;  3EYI A;  2KDO A;  4KIF A;  1VQ6 I;  1YRN A;  1STZ A;  1GVJ A;  2NS7 A;  3L2Q A;  1WWX A;  3CCM I;  1T6S A;  4OIN F;  3P5J A;  5HNF A;  4IZZ A;  2DTR A;  3I5U A;  2PJR A;  1JGG A;  2LP0 A;  4P96 A;  5DDG A;  1K79 A;  1KYW A;  1W5C C;  5LGN A;  3BZC A;  1FBS A;  2MG4 A;  2R93 J;  5GTI C;  1U8R A;  2HOE A;  3IC7 A;  1U2W A;  4U0W A;  4S0H B;  3KEO A;  4IRG A;  4II3 A;  4ZC3 A;  5FJ8 J;  3HUG A;  4FAS D;  4PJ0 C;  2IS6 A;  4KMU X;  4A93 J;  3OIQ A;  3GFI A;  3KP3 A;  2P81 A;  4C9Y A;  2Y30 A;  5LHG A;  3CDI A;  4G9Y A;  3FXL A;  2YX7 A;  3K0L A;  3R61 A;  1LDJ A;  5L3D A;  5HLT A;  2A07 F;  4F3Q A;  3WTT C;  1FEX A;  4C2M J;  3MKL A;  4BXX J;  5GTH C;  3S1N J;  2QM3 A;  2FSW A;  3KET A;  2DT5 A;  3GYH X;  3H92 A;  4NUB A;  3E6D A;  3ZQL A;  4A12 A;  2DXI A;  2YR2 A;  4B09 A;  4IOC F;  4NBQ A;  4RAG A;  2JTV A;  5BPD A;  1R36 A;  3IUO A;  3S32 A;  3DBL B;  3R6S A;  5EG0 B;  3PO2 J;  3U1D A;  3DBR B;  2HQA A;  4IKF A;  1LE8 B;  2HXI A;  1HSJ A;  2F5F A;  3VEP A;  3ASO H;  3BR1 A;  3A4C A;  4G8X A;  2XSD C;  4IHT A;  1V55 H;  2E5N A;  4CCK A;  2HOS A;  3BRO A;  3SEZ A;  1MJA A;  1YJN I;  2QKL B;  1IDY A;  3ZCO A;  3HRT A;  1XGM A;  5JHF A;  3ASN H;  3LST A;  1NK3 P;  3K4K A;  3BTJ A;  1MH4 A;  3T8T A;  2L9N A;  2XHK A;  1A6I A;  1RZ4 A;  1XD7 A;  2R5Y B;  2CG4 A;  2VXD A;  1JUM A;  3GUD A;  3RCO A;  2K9L A;  1TQP A;  2XUB A;  4BQA A;  3J81 K;  2IPQ X;  4DJA A;  2KRF A;  2KMU A;  2VQL A;  3SFZ A;  3K4N A;  1U5T B;  1HA8 A;  4HG2 A;  4QSH A;  1ZH5 A;  4XLA A;  4XNF A;  4TV7 A;  4CDG A;  2ESN A;  2H1K A;  2KIM A;  3ABL H;  3K4J A;  2W00 A;  3GTG J;  1MW7 A;  1LPQ A;  2QQ9 A;  4PDK A;  1IN7 A;  3K1M A;  2JMW A;  3GLX A;  1S7E A;  2HS5 A;  5LD2 C;  2ECC A;  4HA8 A;  3C3W A;  3O2P E;  5E8G A;  4QTR A;  4M6X A;  4U7B A;  5B1A H;  3WGI A;  2JA2 A;  4BDZ A;  2WY7 Q;  4MO7 A;  5FKL A;  2UZK A;  2MBF A;  3F0C A;  3BCB A;  4I6Z A;  2CQK A;  4DGW B;  1H9G A;  2LY2 A;  4I99 C;  2IA2 A;  1YS6 A;  2L7Z A;  2LVS A;  4CCL A;  4HQM A;  5CVJ A;  2EFO A;  3I4N J;  2E36 A;  2Y2Z A;  1FT9 A;  1WVR A;  1K83 J;  3AG1 H;  5EDN A;  2V1U A;  4M3D A;  3MZH A;  2BZT A;  4E70 A;  5BOX A;  4XLE A;  4Y4R A;  2L9R A;  3ZR8 X;  1JJ6 C;  1BM9 A;  4B48 A;  5K5O A;  4NQW A;  2CGP A;  2Y9Z A;  1FOW A;  3G73 A;  2HKX A;  1Y8R B;  3A1Y A;  2LR8 A;  2QEX I;  3AFH A;  5H6R A;  1G8X A;  1R49 A;  3I54 A;  1H88 C;  2LSO A;  5BPI A;  3H1C A;  2HTJ A;  2HDC A;  5E20 A;  2EZK A;  3RQ4 A;  1P4W A;  3JCU C;  2XRL A;  2XPW A;  3MAJ A;  2LDU A;  5IT3 A;  4EV0 A;  2DT7 B;  3QU6 A;  1I3Q J;  4BAY A;  5FKK A;  3ABU A;  2CJJ A;  1P4X A;  3FXJ A;  5AIP A;  5F04 A;  4MEY F;  3EUK L;  5J4Y A;  3CC2 I;  5J8F A;  3L00 A;  1GV2 A;  2DCE A;  4LG0 A;  2VLA A;  3MD2 A;  4I09 A;  1W7P A;  4XSX F;  2PQ8 A;  3NAR A;  3UNG C;  2CUE A;  4W97 A;  5GP9 A;  1HQC A;  5F0C A;  2VBZ A;  2O7O A;  4BDY A;  1WGX A;  3CCV I;  1ETV A;  3BR2 A;  2JWT A;  2PMZ A;  3ML6 A;  1H8A C;  1T0F C;  4M3F A;  1NK2 P;  4N4N B;  4L5I A;  3VOE A;  1IN4 A;  1IW7 F;  4ZDL A;  2AS5 F;  3DTI A;  2LRD A;  4Q47 A;  2DA2 A;  1D0X A;  1ZN2 A;  2CWE A;  4NC7 A;  5FLX Z;  2QQA A;  1JTX A;  4FIS A;  3L2V A;  1S7A A;  1DU0 A;  4CIC A;  5IT9 K;  4LLG F;  3CJR B;  3ZQH A;  1MH3 A;  2LK2 A;  4BUP A;  5EJC A;  3CME I;  2JN6 A;  5E1X A;  2A69 F;  3N05 A;  2LF7 A;  4M73 A;  4ITV A;  1XDU A;  4GDF A;  3LFU A;  4OMZ A;  2Y0S N;  2L5Q A;  3HHH A;  2P5L C;  1SEU A;  4YEL A;  1O7L A;  1WQ2 A;  2LLK A;  3WOD F;  3I58 A;  4XM3 A;  3I64 A;  3ECH A;  2NVX J;  4MGR A;  4HNU A;  2M3A A;  1SD6 A;  3FMS A;  5GAG J;  1SAU A;  4IHV A;  2UWM A;  4Q48 A;  5H20 A;  3JRE A;  2RC4 A;  1LNW A;  3T1B A;  3OYA A;  3AG4 H;  4YFX F;  2FNP A;  1K78 B;  1G6N A;  5D5V B;  1ZG5 A;  1RNL A;  2ZJR F;  1MBF A;  1RR8 C;  1YX5 A;  3LSJ A;  1BI2 A;  2E2J J;  1FP1 D;  1R22 A;  1GXQ A;  1P6R A;  2P6S A;  3ELK A;  3PJR A;  2OBP A;  5DD8 A;  2BY2 A;  5D5X B;  3FM5 A;  5AIQ A;  2E71 A;  5IP9 J;  2LKX A;  1FYM A;  1MJB A;  1TLH B;  1IUY A;  5ILV A;  1BN5 A;  4I0B A;  2DOF A;  1DGW Y;  2NAZ A;  3CUQ A;  1S6L A;  1Y39 A;  2GIZ A;  2ZXI A;  2H8R A;  1QVU A;  3D1N I;  4HX4 A;  2VXZ A;  5EGO A;  1R5G A;  1LFB A;  3FWE A;  3MKY B;  4B3A A;  1PVE A;  1W5S A;  4ESB A;  3ZOB A;  3CF5 F;  5ICG A;  4BQN A;  3J81 Z;  2LD5 A;  3CP8 A;  2R7U A;  2EJR A;  5KK1 A;  3PSI A;  1GV5 A;  2GA1 A;  4J19 A;  2DDB A;  1BL0 A;  3DU6 A;  3HRS A;  2JRM A;  2WV1 A;  1V5F A;  3C18 A;  3V42 A;  5K7F A;  3Q0W A;  4I76 A;  2QVO A;  1BW6 A;  1UFM A;  3VB2 A;  1YOV B;  3IKV A;  2HVS A;  4C30 A;  3VOD A;  2ELJ A;  2X9D A;  1MNE A;  2ELH A;  3P7N A;  3LA3 A;  2GIV A;  2HOA A;  3CMA I;  3GTP J;  1TNT A;  1YX3 A;  3HB9 A;  2M7B A;  1JTY A;  4RMN A;  5D5U B;  1XGS A;  1LQ1 A;  2WAD A;  4RM2 A;  4P9U A;  2O61 A;  3I3L A;  3ZXS A;  1QGP A;  3K4L A;  3OYK A;  2HFH A;  2V7F A;  1HW5 A;  4BEH A;  2FA5 A;  3A03 A;  2K86 A;  1E2X A;  3C7J A;  2P7C B;  2IGO A;  2BBY A;  1QO0 D;  1X3U A;  1H0M A;  3EYY A;  4LK1 F;  4A5M A;  5L3C A;  5LFA A;  5M3F J;  3KYD B;  1JKQ C;  2HDW A;  3IV5 A;  2WV0 A;  4D9J A;  5DUI A;  1RKT A;  2ADU A;  4ZYA A;  3IRQ A;  1D1C A;  1OCO H;  4RAY A;  1R1U A;  3H9Q A;  1P92 A;  4N4O B;  2ICW G;  4A6D A;  4AD9 A; 
#chains in the Genus database with same CATH homology
 4G7Z F;  3CO6 C;  1D8K A;  4ZH4 F;  3L09 A;  4M9S A;  1ZRF A;  1FZP B;  3WU1 B;  2QBY B;  2L01 A;  4HDV A;  4S04 A;  3KFW X;  2K7L A;  2KJC A;  3SXY A;  1MDM B;  1J75 A;  1J59 A;  4L5J A;  2NS0 A;  1OYY A;  1B1B A;  1Z7U A;  2IVM A;  2K4B A;  3LFK A;  4IXA A;  5ICE A;  1F5T A;  2V1D A;  3KCC A;  5ED4 A;  2DPD A;  1KU3 A;  3WTV C;  5FD5 A;  5HDG A;  3GZ5 A;  2WWY A;  3DEU A;  4LLN A;  4UUV A;  3KZY A;  4A0Y A;  2NNY A;  1ZG1 A;  2OAZ A;  4P9F A;  1BI0 A;  2H27 A;  5CLS A;  1PP8 F;  1TBX A;  2DO7 A;  3ZQ7 A;  2EFN A;  1T2K A;  2IW5 A;  5D5W B;  3E6B A;  2K27 A;  3HOS A;  4CYD A;  1ON1 A;  5LHI A;  1YLF A;  2G7U A;  5DYM A;  3B73 A;  4G6Q A;  3F6V A;  3KZZ A;  3GW2 A;  1O7F A;  4PCQ A;  4LLL A;  4RB3 C;  1AOY A;  4L18 B;  3ZMV A;  3CTA A;  1IN6 A;  3HRU A;  1FX7 A;  3MEX A;  4CHU A;  4GO1 A;  4HQE A;  2GZW A;  3KEQ A;  4I02 A;  1RIO H;  1O3T A;  2GXB A;  3D5L A;  2WTE A;  3WTZ A;  2A3S A;  3Q9S A;  1FSH A;  4Y17 A;  4IHS A;  2DI3 A;  2HR3 A;  1V3F A;  2ZO4 A;  2ISY A;  4FX4 A;  4ENN A;  2M5W A;  2FQ3 A;  4AIJ A;  1U6G A;  1ZGJ A;  2CFX A;  1WRJ A;  3ZMZ A;  4KMF A;  2PBI A;  3RKY A;  4KA4 A;  3WTY C;  2NRA C;  2J5P A;  2AXL A;  2HEO A;  4I7H A;  3SHF A;  1ODD A;  1FYL A;  3TOB A;  3TO9 A;  2JT1 A;  2QWW A;  4EVI A;  2ZME B;  4L0Y B;  4XLN F;  3I71 A;  4CZZ A;  2R7D A;  2FML A;  2YSR A;  1Z9C A;  2WC2 A;  4KIB A;  2M8E A;  3RPQ A;  2RQP A;  2JZY A;  3J80 Z;  3FZV A;  3H3U A;  5H6Q A;  4P5O A;  5LGT A;  3F8N A;  2Y75 A;  2UXN A;  3DKW A;  1SFE A;  1J9I A;  5LLQ A;  1R23 A;  4GYI A;  4Y13 A;  1I1G A;  3ABT A;  3I53 A;  1BI3 A;  3MWM A;  4LD5 A;  2VT2 A;  4EJT A;  2MD5 A;  4EJV A;  1J5Y A;  3D0S A;  3I0T A;  5HS8 A;  1Z91 A;  2EA4 A;  3LQR A;  4PGG A;  4NHJ A;  1BOA A;  1XCV A;  2F5C A;  1DPU A;  1ZGA A;  3KP6 A;  3EDP A;  2P8T A;  4Z2Y A;  3KE2 A;  2J5O A;  4A6E A;  3IRR A;  4LK0 F;  1T0F A;  3QPT A;  1YG2 A;  3M8E A;  2Z3Y A;  5FLX K;  1IZ1 A;  1TNS A;  2E7X A;  5JR3 A;  4HF2 A;  3K9T A;  1K6O A;  1BIA A;  2XKO A;  3KP2 A;  3QU3 A;  4GGG A;  3HTU A;  1PDN C;  4LMY A;  3RKW A;  2VBY A;  4HX8 A;  1U5T C;  1P4A A;  1QPM A;  2MA3 A;  3JW4 A;  2OZU A;  2V9V A;  1CF7 A;  2QEN A;  1LEB A;  3G3Z A;  3RTR A;  2A6E F;  1IXR C;  1HBX G;  1A04 A;  1SD5 A;  3E5Q A;  4L9J A;  4R79 A;  4WF2 A;  4M74 A;  1XSD A;  4EMS A;  2GXG A;  1Z1D A;  1MD0 A;  2FU4 A;  2RNJ A;  2MH2 A;  4Q5S F;  4L9T A;  5LBQ A;  3GF2 A;  3LA7 A;  3KLO A;  4IF4 A;  2XAG A;  1FNN A;  4A0X A;  1FC3 A;  2QZ8 A;  2D1V A;  3NEU A;  4I2O A;  3ECO A;  4ENJ A;  4OU0 A;  5HS7 A;  2ESH A;  2O6G E;  2VON A;  4N9I A;  2QBY A;  2CSO A;  3AAF A;  1MDM A;  3ZMD A;  3F21 A;  1ONV A;  1JHF A;  2BE5 F;  2MH9 A;  2EK5 A;  1ZAR A;  4EGZ A;  2Z99 A;  2ZXJ A;  2XVC A;  5DCF A;  5E8I A;  4RGX A;  4BHC A;  2YU3 A;  3IL2 A;  4RS8 A;  1YIO A;  1V4R A;  2H6C A;  2VT3 A;  4OIQ F;  1O3R A;  2G9W A;  2VOO A;  4KFC A;  1OKR A;  5BQT A;  2HQR A;  3WGH A;  4IVN A;  3HSF A;  2VC0 A;  3WTW C;  2W24 A;  2BGC A;  5J6X A;  2PN6 A;  3JAM Z;  2K02 A;  4G6D A;  3BOQ A;  3GO5 A;  3V8L A;  4NB5 A;  2Z33 A;  1YW7 A;  1HKT A;  4JQF A;  2E1C A;  4IRH A;  4CGZ A;  4QWQ A;  5DCM B;  1S8N A;  5CVR A;  4FHT A;  1UCR A;  4G7H F;  4IPA A;  4JBA A;  5TRD A;  4L9V A;  5LHH A;  1JE8 A;  4ZYD A;  2PG4 A;  1B59 A;  3HRM A;  1XN7 A;  2PEX A;  1HKQ A;  2GAU A;  2X0L A;  5LRR A;  3JTH A;  2KIU A;  2L4M A;  3SQN A;  3WTX C;  3CUO A;  1QZZ A;  2R7F A;  4ENK A;  5HLG A;  3ZN0 A;  5CVI A;  2GQQ A;  4H0E A;  4ZYH A;  4A0Z A;  2HWV A;  2Y0M A;  3FMR A;  4KDP A;  4ON0 A;  2FMY A;  1YW9 A;  3QP6 A;  3DPL C;  1IAW A;  2BYV E;  1HW1 A;  3QP5 A;  2PI0 A;  1JGS A;  1OR7 A;  2CO5 A;  3P9C A;  3RIR A;  1FWZ A;  3TDZ C;  4L9N A;  3RPU A;  1VTN C;  4BHP A;  2A61 A;  4PZJ A;  1G3T A;  5K5R A;  2VE8 A;  4AIH A;  5BS6 A;  3JTG A;  1R00 A;  4YIF A;  4UXN A;  4YFN F;  4FX0 A;  2P5K A;  1LB2 A;  3P9I A;  2VOP A;  1C0W A;  5HVQ C;  5L3B A;  1XMK A;  4UVC A;  5LEK A;  4AWX B;  1J7K A;  2H94 A;  2CYY A;  1YYV A;  3K1N A;  2F5E A;  4Q4Z F;  1Z05 A;  1B9M A;  3BJA A;  4KNY A;  5FO5 A;  5HDN A;  3F8B A;  3J80 K;  1R1V A;  4O3M A;  4UV8 A;  3VFZ A;  4EQQ A;  3E97 A;  3DV8 A;  3V8J A;  4EJU A;  4BXU A;  3HYI A;  2EV6 A;  5CVU A;  1MJ9 A;  4HZF A;  1HW2 A;  1LDK B;  1BC7 C;  3N4M A;  2DQR A;  3JSO A;  3HTS B;  3COA C;  2L54 A;  1S3J A;  3FXR A;  3T8R A;  4OIR F;  1DP7 P;  2TDX A;  2BEO A;  2L02 A;  4U88 A;  2B0L A;  3QOP A;  2ETH A;  2IT0 A;  3BDD A;  1XDS A;  1KYZ A;  4RB0 A;  3GVA A;  1L3L A;  1SAX A;  2ZKZ A;  2OQR A;  1ZHF A;  4HV6 A;  2XGX A;  2DAO A;  1TQI A;  3QPH A;  2XIG A;  4YG2 F;  1PUE E;  4WXD A;  2P4W A;  4HLY A;  2R3S A;  3NQO A;  2IA0 A;  4GYG A;  1FBU A;  2O0Y A;  1YFH A;  1ZRD A;  3PQK A;  3RDI A;  3U2R A;  2M87 A;  3SZT A;  3V7C A;  4ETS A;  2PMH A;  1RUO A;  2RN7 A;  4CO8 A;  2EFW A;  4HDU A;  2LNB A;  2Q0O A;  1FOK A;  5ILU A;  3HSR A;  2XAH A;  3HHG A;  3DF8 A;  1EH8 A;  1HKS A;  1BC8 C;  2Y48 A;  4IRI A;  3WE3 A;  2QYO A;  1U5T A;  4HF1 A;  2E1N A;  4HF0 A;  3IWF A;  3TQN A;  4GCV A;  2DK5 A;  1JXS A;  1OPC A;  2XAS A;  4I01 A;  2LF8 A;  1LDD A;  4ZZL A;  1W7P B;  1MGT A;  3S2W A;  4GXO A;  2HKO A;  1YW8 A;  1WSU A;  2IRF G;  2XAJ A;  2BV6 A;  1EV7 A;  1DUX C;  1IXC A;  5D4S A;  3HIF A;  1S7O A;  3F72 A;  3PFI A;  1SFX A;  1G3S A;  2ZBK A;  4LFU A;  3FX3 A;  1OYI A;  4KT5 C;  2JPC A;  5FFZ A;  4XLP F;  4OOI A;  2FBK A;  3MCZ A;  2F2E A;  2V1X A;  4HV5 A;  5E1Z B;  4I98 B;  3JSP A;  2DQL A;  3LQQ A;  2C6Y A;  1RI7 A;  1F1Z A;  4LGW A;  1UB9 A;  2EV0 A;  5DD4 A;  1UHW A;  3GFM A;  4LB5 A;  3ULQ B;  1I27 A;  1S29 A;  2Z9O A;  2Z5U A;  2O8X A;  5DCM A;  2JSC A;  1KU9 A;  2EFQ A;  4MEX F;  3FM3 A;  5CVV A;  1R7J A;  4WXH A;  3V7R A;  3OOP A;  3CUQ B;  2QUF A;  2XRN A;  1XSV A;  1REP C;  2O03 A;  3JAM K;  5A2Q K;  3GEZ A;  2EFP A;  3K2Z A;  3F8F A;  3R0A A;  3LWF A;  1D8J A;  3RJP A;  1IRG A;  1OYW A;  5ERI A;  3FXQ A;  4YFK F;  1IXS B;  2LKP A;  2F5D A;  2FF4 A;  4WX9 A;  2HYG D;  3WU0 A;  5ILS A;  3EUH A;  1JHH A;  4HLX A;  2HQN A;  4PGH A;  3IKT A;  3CJN A;  1BI1 A;  1K78 A;  2ZNZ A;  4HX7 A;  4RGS A;  2D1H A;  3F23 A;  4OMY A;  2FRH A;  4MHG A;  2P5V A;  3BY6 A;  4JK1 X;  4KIC A;  1T98 A;  4N0B A;  2NNN A;  2M45 A;  4EM0 B;  2GA2 A;  2HTS A;  4LJZ F;  2O3F A;  4F7Z A;  3K1P A;  2STW A;  1ZAO A;  5FFX A;  3T0Y A;  1R1T A;  1J2X A;  1XMA A;  2STT A;  3J7A O;  2X4H A;  6PAX A;  3PQJ A;  2A6H F;  2OZ6 A;  1YO5 C;  2L3D A;  3TO6 A;  2M30 A;  4U7D A;  1FLI A;  4XBF A;  5D6E A;  3TDU C;  3LAP A;  2DK8 A;  1KQ9 A;  4M72 A;  3E6C C;  1XSX A;  1LEA A;  1IRF A;  4HBL A;  4UVA A;  3IHU A;  4RGU A;  1ZYR F;  2YX4 A;  1FYK A;  3TO7 A;  3BPX A;  3GXO A;  2COM A;  5D4R A;  3F8C A;  1F4K A;  3L7W A;  3ROU A;  1K7A A;  1EH7 A;  1L0O C;  4EGY A;  4KUM A;  4UV9 A;  1RUN A;  5HS9 A;  4MNU A;  3WG9 A;  1P2F A;  3ZMS A;  3P9K A;  4KIG A;  2DU9 A;  2OQG A;  3RKX A;  1U78 A;  1ZRC A;  3E3V A;  1QZY A;  3FHZ A;  3GZ6 A;  1J0R A;  1T39 A;  1DPR A;  1USS A;  4EJO A;  3M7G A;  4FT8 A;  4WK8 F;  1QQI A;  1LJ9 A;  4B8X A;  1W5T A;  3U9G A;  4ZYG A;  4UNO A;  3LA2 A;  1FY7 A;  3KP5 A;  1UST A;  1KA8 A;  3ZN1 A;  5A2Q Z;  4RGR A;  3I59 B;  2G7H A;  4KN7 X;  3V7S A;  1TW2 A;  2MLK A;  1KQ8 A;  4G94 A;  2XAF A;  3BWG A;  1TTY A;  3MQ0 A;  4OIO F;  2FXA A;  1Q1H A;  1R58 A;  2KIF A;  3R0J A;  3RYP A;  2DW4 A;  1TW3 A;  1YS7 A;  3WTS C;  2XV4 S;  1ZLJ A;  5L3F A;  1SMT A;  3F8M A;  2RGV A;  1GHC A;  4BNC A;  1QBJ A;  2ZJ2 A;  2RDP A;  3E6M A;  5CYV A;  2HGC A;  3BJO A;  5JI6 A;  5EEH A;  3HSE A;  1XCB A;  3R60 A;  3O3K A;  3C1D A;  2GWR A;  3L2C A;  3WE2 A;  2DLL A;  2A5Y B;  2VOD A;  4DNC A;  2OA4 A;  5LEJ A;  1LVA A;  5HDK A;  2PLY A;  5J8C A;  5F64 A;  1CGP A;  5KVR A;  5LRS A;  3RYR A;  2P7V B;  5HLH A;  2H09 A;  2PJP A;  2K4J A;  1XGO A;  4ASN A;  5K5Q A;  1ZLK A;  1ON2 A;  4YII A;  4L0Z B;  4MQV A;  2PFB A;  3GFL A;  1KGS A;  4KYW A;  2ZME A;  5AON A;  3ZP5 A;  3DXJ F;  4M9X A;  1I6X A;  3FXU A;  3BP8 A;  4KN4 X;  1QNT A;  2ZFW A;  5DV5 A;  4BHB A;  5FD6 A;  1O3Q A;  1WKM A;  3M1E A;  2XAQ A;  5TJJ A;  5K1Y A;  3V8K A;  3OV8 A;  2VBW A;  1FPQ A;  1B9N A;  2DBB A;  5JHU A;  1F9N A;  3FF5 A;  5D8L B;  1IF1 A;  1FBQ A;  4UVB A;  2W25 A;  3R4K A;  1SFU A;  2IA1 A;  1YQA A;  1G3W A;  3LAJ A;  3WTU C;  1B6A A;  1CF7 B;  3QRF F;  4OIP F;  4A5N A;  1KU7 A;  1KQ0 A;  3EQL F;  3Q5F A;  5HLI A;  1UHM A;  1ZG3 A;  3B02 A;  3ISP A;  4HAM A;  4WWC A;  3MFK A;  2W85 A;  3K69 A;  4RB2 C;  1O3S A;  4HYE A;  1MKM A;  1E17 A;  2NYX A;  4Y15 A;  1XGN A;  3H3Z A;  3ZMU A;  5E18 F;  5E17 F;  1W7P D;  1Y0U A;  3V4G A;  1KU2 A;  1NHA A;  4O6J A;  2JPB A;  4D0P A;  2A68 F;  4EM1 A;  3DP7 A;  5JFR A;  4ZYE A;  1IN5 A;  2VBX A;  3REO A;  1G4D A;  4BH9 A;  3F22 A;  4U0V A;  4UHT A;  3N97 A;  3DFG A;  3I4P A;  4K2E A;  1B4A A;  3Q9V A;  3E5U A;  1XB4 A;  4U0Y A;  4EM2 A;  3ZMT A;  2QLZ A;  2Q8K A;  2FEZ A;  1AWC A;  4WXC A;  1MZB A;  5FB2 A;  4AIK A;  4ESF A;  3EET A;  3TGN A;  3WGG A;  1TQM A;  4XSZ F;  1SD4 A;  1GXP A;  4DQ2 A;  1Z6R A;  5DUK A;  4AVP A;  2HYF A;  4MTE A;  4LB6 B;  1I1S A;  4ESJ A;  1G3Y A;  3QAH A;  3KP7 A;  3GX4 X;  2D45 A;  4MQ9 F;  1H9T A;  4IJA A;  1DDN A;  1HST A;  2XRO A;  2YPR A;  1BBY A;  3CDH A;  4S05 A;  4ZZD A;  5FGM A;  3CO7 C;  4HOB A;  3E5X A;  5L3E A;  2KJB A;  2M1B A;  1BJA A;  1FSE A;  3DPT A;  2E7W A;  2FOK A;  2KKO A;  5F6F A;  5IT9 Z;  1R5H A;  4BYY A;  3SZP A;  2UXX A;  2EWN A;  5JVT A;  1IN8 A;  2V79 A;  3GWZ A;  5ICF A;  1O57 A;  2FNA A;  3KP4 A;  2MC3 A;  4LG0 B;  3TKY A;  3W6J B;  4RB1 A;  3M8F A;  1FP2 A;  2RV8 A;  2OU2 A;  2EA2 A;  3RI4 A;  4M71 A;  2V6C A;  4P55 A;  3CLO A;  5L3G A;  1T38 A;  3ZPL A;  3T5X A;  4HW0 A;  3CUQ C;  2CW0 F;  5CJ9 A;  1BIB A;  2ACJ A;  3DQV C;  3NRV A;  4MTD A;  3M9A A;  3MZY A;  3FMQ A;  1D5V A;  5LGU A;  2HZT A;  2RVC A;  3I59 A;  2IP2 A;  2ZNY A;  3KLN A;  3W6K B;  2VN2 A;  4R8H A;  2DPU A;  1WI9 A;  2OD5 A;  2FE3 A;  2FBI A;  3F3X A;  2L4A A;  1I5Z A;  3ERE D;  2JRT A;  2Q2E A;  2DFI A;  2W84 A;  4RAZ A;  5BMZ A;  4WCG A;  3BJ6 A;  2FBH A;  2PMU A;  2P6T A;  1OMI A;  1SD7 A;  4O5V A;  2RKH A;  5D6F A;  5D8K B;  2VE9 A;  3TOA A;  5EEG A;  4ENM A;  5F1R A;  4G7O F;  2MLG A;  1EH6 A;  2D2W A;  5HOO A;  4QLC U;  3HOT A;  5DEQ A;  1ZRE A;  1W4M A;  1PP7 U;  4I0A A;  5E1W A;  2W57 A;  1YTY A;  2H6B A;  2EV5 A;  1ULY A;  4N9H A;  3L9F A;  2IJL A;  3F6O A;  1SMY F;  4M9Z A;  4R1H A;  4XRF A;  4EJW A;  1HXD A;  2ZCW A;  2EB7 A;  3IWZ A;  2XKP A;  4M6Y A;  4A2U A;  1D3Y A;  1U3E M;  2VC1 A;  2ISZ A;  1Z6T A;  2QQB A;  3BZ6 A;  3BPV A;  4CXF A;  3GFJ A;  3O6B B;  5ICC A;  3EYI A;  4KIF A;  1STZ A;  1GVJ A;  1WWX A;  1T6S A;  4OIN F;  2DTR A;  3I5U A;  4P96 A;  5DDG A;  1K79 A;  1KYW A;  5LGN A;  1FBS A;  1U8R A;  2HOE A;  3IC7 A;  1U2W A;  4U0W A;  3KEO A;  4IRG A;  3HUG A;  4KMU X;  3GFI A;  3KP3 A;  5LHG A;  4G9Y A;  2YX7 A;  3K0L A;  3R61 A;  1LDJ A;  5L3D A;  2A07 F;  3WTT C;  2QM3 A;  2FSW A;  3KET A;  2DT5 A;  3GYH X;  3H92 A;  3E6D A;  4A12 A;  2YR2 A;  4B09 A;  2JTV A;  5BPD A;  1R36 A;  3R6S A;  3U1D A;  1HSJ A;  2F5F A;  3VEP A;  4IHT A;  4G8X A;  3BRO A;  1MJA A;  3HRT A;  1XGM A;  3LST A;  3T8T A;  2XHK A;  1RZ4 A;  1XD7 A;  2CG4 A;  3GUD A;  1TQP A;  2XUB A;  4BQA A;  3J81 K;  2IPQ X;  2KRF A;  3SFZ A;  1U5T B;  1ZH5 A;  4TV7 A;  4CDG A;  2ESN A;  2KIM A;  2QQ9 A;  4PDK A;  1IN7 A;  3K1M A;  3GLX A;  2HS5 A;  4HA8 A;  3C3W A;  3O2P E;  5E8G A;  4U7B A;  4M6X A;  3WGI A;  2UZK A;  2MBF A;  2CQK A;  1H9G A;  2IA2 A;  1YS6 A;  4HQM A;  5CVJ A;  2EFO A;  1FT9 A;  2V1U A;  3MZH A;  4E70 A;  5BOX A;  1BM9 A;  5K5O A;  4NQW A;  2CGP A;  3G73 A;  2HKX A;  5H6R A;  3I54 A;  2LSO A;  5BPI A;  2HTJ A;  2HDC A;  5E20 A;  1P4W A;  3MAJ A;  2LDU A;  5IT3 A;  4EV0 A;  3QU6 A;  4BAY A;  3ABU A;  1P4X A;  5AIP A;  4MEY F;  5J8F A;  3L00 A;  4LG0 A;  4I09 A;  1W7P A;  4XSX F;  2PQ8 A;  1HQC A;  2VBZ A;  3ML6 A;  4L5I A;  3VOE A;  1IN4 A;  1IW7 F;  2AS5 F;  4Q47 A;  1ZN2 A;  2CWE A;  5FLX Z;  2QQA A;  1S7A A;  4CIC A;  5IT9 K;  4LLG F;  5E1X A;  2A69 F;  2LF7 A;  4M73 A;  1XDU A;  4OMZ A;  3HHH A;  2P5L C;  1O7L A;  1WQ2 A;  3WOD F;  3I58 A;  3I64 A;  3ECH A;  4MGR A;  1SD6 A;  3FMS A;  2UWM A;  4Q48 A;  5H20 A;  2RC4 A;  1LNW A;  3T1B A;  4YFX F;  2FNP A;  1K78 B;  1G6N A;  5D5V B;  1ZG5 A;  1RNL A;  1BI2 A;  1FP1 D;  1R22 A;  1GXQ A;  1P6R A;  2P6S A;  3ELK A;  2OBP A;  5DD8 A;  5D5X B;  3FM5 A;  5AIQ A;  1FYM A;  1MJB A;  1TLH B;  1IUY A;  5ILV A;  1BN5 A;  4I0B A;  1S6L A;  2NAZ A;  3CUQ A;  4HX4 A;  2VXZ A;  1R5G A;  3FWE A;  1W5S A;  4ESB A;  5ICG A;  3J81 Z;  2EJR A;  5KK1 A;  2GA1 A;  3HRS A;  3C18 A;  2QVO A;  3VB2 A;  1UFM A;  3IKV A;  3VOD A;  2ELH A;  3P7N A;  3LA3 A;  2GIV A;  1TNT A;  5D5U B;  1XGS A;  1LQ1 A;  2O61 A;  4P9U A;  1QGP A;  2HFH A;  1HW5 A;  2FA5 A;  2K86 A;  1E2X A;  3C7J A;  2P7C B;  2BBY A;  1QO0 D;  1X3U A;  1H0M A;  3EYY A;  4LK1 F;  4A5M A;  5L3C A;  2WV0 A;  5DUI A;  2ADU A;  3IRQ A;  4RAY A;  1R1U A;  1P92 A;  4A6D A;  4AD9 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...