3WU1B

Crystal structure of the ets1-runx1-dna ternary complex
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
105
structure length
105
Chain Sequence
GPIQLWQFLLELLTDKSCQSFISWTGDGWEFKLSDPDEVARRWGKRKNKPKMNYEKLSRGLRYYYDKNIIHKTAGKRYVYRFVCDLQSLLGYTPEELHAMLDVKP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Transcription/dna
molecule keywords Runt-related transcription factor 1
publication title A novel allosteric mechanism on protein-DNA interactions underlying the phosphorylation-dependent regulation of Ets1 target gene expressions
pubmed doi rcsb
source organism Mus musculus
total genus 35
structure length 105
sequence length 105
ec nomenclature
pdb deposition date 2014-04-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00178 Ets Ets-domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 3wu1B00
1ZYRF 2VBZA 2DAOA 4LFUA 5AIQA 2PFBA 4LLNA 3IHUA 4XLNF 4A0ZA 2K7LA 3K2ZA 1XGSA 3FM5A 3BPVA 1XGMA 2BEOA 2OA4A 1J2XA 1YS6A 3WTYC 4G8XA 3RTRA 4KUMA 1RI7A 3KLNA 4CHUA 1L0OC 2M30A 2W25A 5DEQA 2GA1A 4L0ZB 2CO5A 1LDDA 1JHFA 4OIOF 4G94A 1KGSA 3U2RA 4ENNA 2PJPA 5AONA 2NNNA 1ZAOA 4FT8A 5D4RA 2XROA 2VC0A 2GXBA 4I7HA 3TOBA 4KNYA 2M1BA 4KIGA 4RGSA 1YG2A 2FE3A 4HZFA 4QLCU 1S7AA 1I1GA 2XKOA 5E8IA 4KIBA 1TW3A 2LSOA 4FX0A 3L9FA 4NHJA 5ICEA 3OV8A 1HKQA 1QPMA 4EM0B 5ICGA 2RV8A 3V8JA 3S2WA 5FLXK 2UXXA 4RB1A 4GO1A 1KU3A 2FSWA 1BIBA 1U5TB 2ZFWA 1ZH5A 1T0FA 2Z9OA 3BJ6A 2NNYA 4DNCA 5K5OA 5D5XB 1MGTA 1O57A 1O7LA 1PP7U 3Q9VA 3EYIA 4IRGA 2K86A 1FYLA 1ZGJA 2F2EA 5D8KB 2DPUA 4L9NA 5CVUA 2RQPA 3RKYA 5ICCA 3WGIA 2FEZA 2D45A 1IN6A 1D8KA 1QZYA 3R4KA 4I09A 2XIGA 3E6MA 3KP4A 2OZ6A 4U0YA 3LA3A 2E1CA 3D0SA 1EH8A 4L9VA 4HF2A 1IW7F 4KFCA 2KRFA 3QPHA 4HX8A 1AOYA 3ERED 2XAHA 3CUQA 1B1BA 3C7JA 4RS8A 4G9YA 4LG0A 3E6BA 4HLYA 4AIHA 4AD9A 5LEKA 3F22A 4PZJA 1RUOA 3TOAA 1OYWA 4HBLA 3OOPA 1B6AA 5FB2A 5A2QZ 3FZVA 3JSOA 1HQCA 3JW4A 2QYOA 3JAMZ 1LDJA 3J81Z 1TNTA 1BOAA 1ON2A 1KA8A 3J7AO 4H0EA 4LK0F 1R23A 3DPTA 1FT9A 1Z9CA 2E1NA 3DXJF 2O0YA 4EVIA 3MAJA 4Y13A 2JSCA 2EB7A 3K1PA 3K1NA 3KP6A 4WWCA 2GWRA 3R60A 1ULYA 1G6NA 1USSA 1HXDA 2W24A 4E70A 1U3EM 3TO7A 4Q4ZF 2QZ8A 1U78A 1W7PD 3KP3A 1QGPA 4RAYA 4KICA 3DF8A 3RKWA 3P9KA 1OR7A 2ACJA 3WTXC 5FD6A 4CZZA 1P4WA 4L9JA 4OIRF 4YFXF 2KIFA 3J80Z 2EA4A 2KIUA 2ISYA 3HIFA 1IN4A 1O3QA 2ZO4A 3GFJA 4MGRA 2MLGA 3SQNA 4M9SA 1R5HA 3T8TA 2HKOA 3WTTC 2PLYA 3H3ZA 1K78B 4PGGA 3DKWA 5DUKA 3IKVA 1FYMA 2O3FA 2QM3A 3J80K 1OYIA 2ESHA 4G7OF 1D5VA 4S05A 4A5NA 3E97A 3LQRA 5E1WA 2IA1A 2MH2A 1TQIA 1B4AA 3O2PE 1XMKA 4P9FA 1FZPB 4YFNF 5LEJA 5LHHA 4LLGF 1REPC 2V1UA 1P4AA 2HS5A 4O3MA 1J5YA 1P4XA 2GZWA 2HTJA 5IT9K 5BMZA 2STTA 2OZUA 2GAUA 2P7CB 3FWEA 5L3FA 1QNTA 2MBFA 4M74A 3HYIA 1IRFA 3RDIA 2ZMEA 2EK5A 2V6CA 2O6GE 5DCMA 2XV4S 2F5DA 4EMSA 2XVCA 4EGZA 2HTSA 3GW2A 4GYGA 1MDMB 2EA2A 3FMRA 2RVCA 4HF0A 3IWZA 4M73A 1D3YA 2Y75A 3I54A 3WGHA 1W7PB 5L3GA 3GYHX 4IJAA 2Z3YA 2OQRA 2XHKA 5KK1A 2D1VA 3EUHA 1XCBA 4AVPA 3H92A 5JHUA 2M5WA 2CWEA 1FX7A 5IT3A 2QLZA 3T0YA 3WTUC 4HQMA 1O3RA 2MH9A 3ZP5A 5J6XA 3ZQ7A 3KETA 1Z6TA 3HRTA 2A68F 3RPQA 4XRFA 1DPRA 3LSTA 3M7GA 3ECOA 1ZN2A 2ADUA 1RZ4A 2FMLA 1OMIA 3KCCA 2QQBA 2JPCA 1KU7A 4XSXF 1JHHA 2CYYA 2V79A 4KYWA 2XAJA 2EWNA 4P9UA 1BIAA 2CQKA 2YU3A 5HS8A 1TTYA 3KP5A 5FGMA 3BY6A 2VT2A 4ZYHA 1W5SA 1KYWA 1YW9A 2H6CA 1H9TA 1K79A 5ED4A 3HRSA 5HS7A 2Y0MA 1ZARA 3QAHA 4EV0A 5E8GA 3F23A 3ROUA 1MZBA 3G73A 2YSRA 2VBWA 4WXDA 1F9NA 2V1XA 1BC8C 1TLHB 2KJBA 2VBYA 1FYKA 2RC4A 1B9MA 1P2FA 1IN7A 3TO6A 4EJOA 2HDCA 2G9WA 4G7HF 4BYYA 5CJ9A 2EFQA 2K4JA 2DLLA 4UXNA 3CUOA 4OMZA 2HWVA 4XSZF 2RDPA 5HLGA 3MFKA 1FWZA 1MD0A 3N97A 4TV7A 2ZBKA 4BNCA 5DV5A 1USTA 2VOPA 4M9XA 2YX7A 2NYXA 3T5XA 4GXOA 1J75A 2BYVE 2G7UA 2O03A 1CF7A 4A0YA 1SAXA 4EJTA 3K1MA 1G3YA 3CO7C 4RB3C 1FY7A 1P6RA 2EJRA 4AIJA 4NQWA 3AAFA 4BXUA 3I58A 1XN7A 3V7RA 2DI3A 5BPIA 2L02A 3KEQA 2RNJA 3K9TA 1Z6RA 3R6SA 4EGYA 2MLKA 1T98A 2GA2A 2K27A 2K02A 3IL2A 3F3XA 5D4SA 2YR2A 5E1ZB 2VT3A 4A6DA 4KDPA 3VB2A 2RKHA 3BJOA 1DP7P 4LB5A 2DK8A 3Q5FA 4OINF 2R7FA 2L01A 1SMTA 3BPXA 5LGNA 1TNSA 2LF7A 5FO5A 3GZ6A 4OU0A 3JTGA 1UHWA 5FFXA 1XGNA 4BHCA 1SD5A 3WTZA 4MEXF 1YLFA 2H09A 2JPBA 4I0AA 2VE9A 3G3ZA 3QOPA 4IHSA 4A0XA 2QWWA 2M45A 1F4KA 1C0WA 3L7WA 4UNOA 5K5QA 2UWMA 1TW2A 4Y15A 4ESJA 1ODDA 2IA2A 4UUVA 4AIKA 2A6HF 2A6EF 1I6XA 3BP8A 1XSXA 1S3JA 3ELKA 5ERIA 2H6BA 4ZYDA 1BI3A 3FMQA 3KZZA 3RJPA 2OD5A 3FHZA 3E6CC 4MQVA 1T2KA 3IWFA 3LAJA 3WTWC 2CFXA 4N9IA 1DDNA 1IRGA 5DD8A 1O3TA 3PQJA 2DU9A 2VBXA 3I4PA 1FBQA 2FRHA 1UHMA 1Q1HA 5HDNA 3HUGA 5EEGA 1WSUA 3CLOA 3TDUC 2OAZA 3TDZC 3REOA 1FOKA 5LBQA 1E17A 1IF1A 5J8FA 1J59A 2QVOA 4YFKF 1BI2A 4Q5SF 1J9IA 4U7BA 3DEUA 1YIOA 1G3TA 3JTHA 1MJAA 4EJVA 2EV6A 3GO5A 3P9IA 2EFNA 3BJAA 3DPLC 2RGVA 4Z2YA 3IRQA 1U5TA 3WTVC 3I5UA 1PUEE 3GF2A 1LJ9A 3ZMSA 2FA5A 1FP1D 3GX4X 1R1UA 1BJAA 3KP2A 3FXUA 5D8LB 5A2QK 4HX4A 4PGHA 1ONVA 1XDUA 1UB9A 3HOTA 2JTVA 2ISZA 3JAMK 3IC7A 1JGSA 1ZRFA 3GVAA 1A04A 2PG4A 2VONA 2AXLA 3J81K 4XBFA 3T8RA 3CDHA 2LNBA 3N4MA 5BOXA 1E2XA 3DFGA 3ZMVA 1FNNA 5E17F 3E3VA 1WWXA 4S04A 3CO6C 3F8NA 2BBYA 5D6EA 5H6QA 1ZREA 1IXRC 1D8JA 2PBIA 4JQFA 1DUXC 4ENKA 2WC2A 3C18A 2GQQA 1ZLJA 1XSDA 2F5CA 4CICA 1FLIA 4HAMA 4BQAA 3SHFA 4L18B 3TO9A 1ZGAA 2K4BA 3ZMZA 2P4WA 4U7DA 1T6SA 3EYYA 2PI0A 1MJ9A 2QQAA 3E5XA 1UCRA 2E7XA 4YIIA 5E18F 4L0YB 4BH9A 3ISPA 5JFRA 1IZ1A 1KQ8A 3I0TA 4WCGA 1I1SA 3SZPA 2QBYB 1BC7C 1YW8A 2Q8KA 2D2WA 5E20A 2IA0A 4WXCA 2F5EA 2QENA 1LB2A 5F64A 1K6OA 2VODA 3GLXA 4GYIA 1ZLKA 4HX7A 1TQPA 3F8MA 1RUNA 1YYVA 4LJZF 4OMYA 2P6TA 1B9NA 1P92A 3MWMA 4CGZA 3M8FA 3PFIA 2WV0A 2Y48A 1FSEA 4LMYA 4KMUX 3VOEA 4CO8A 3RI4A 4MQ9F 4WXHA 1SD7A 2ZKZA 4KN4X 2D1HA 3R0JA 1NHAA 5JI6A 2HKXA 4ESFA 1HW2A 4RGRA 1LDKB 1IN5A 1ZHFA 2KKOA 1U2WA 4RGXA 4DQ2A 3HSRA 3GFIA 1R5GA 1YTYA 2HYGD 2ZXJA 1QZZA 5LHIA 1AWCA 2EV5A 2EFPA 4NB5A 2CW0F 3JSPA 1S29A 2X4HA 2AS5F 5CVVA 4RAZA 4U0VA 3F8CA 4I98B 2NS0A 1JXSA 1J7KA 2DQLA 1HSTA 5LLQA 2UZKA 5F6FA 2NAZA 1YS7A 4ZYGA 4BAYA 3WU0A 2ESNA 2WWYA 4HW0A 3HTUA 1BM9A 2UXNA 3DQVC 3CTAA 1SD6A 3P9CA 3TGNA 4CYDA 1JE8A 5K1YA 4ENMA 3EDPA 4PCQA 2FF4A 5H20A 1MDMA 2FOKA 5EEHA 4B09A 3LA7A 2PMUA 1EH6A 3WG9A 1S7OA 5CVIA 3TQNA 1XB4A 5HDGA 4O5VA 1I5ZA 3L2CA 2ZJ2A 2Z99A 3F8BA 3RYPA 1W7PA 1EV7A 1XMAA 2M87A 1U6GA 2P7VB 3RYRA 4M6YA 2OBPA 4EJUA 5ILVA 3CUQC 3RPUA 3EETA 4Y17A 3BWGA 5BS6A 3T1BA 1EH7A 3B02A 2KJCA 3ABTA 2COMA 2KIMA 2A3SA 3GWZA 1SMYF 3V8LA 3I59B 2WTEA 4HOBA 1U5TC 2HEOA 3VFZA 3GXOA 2OU2A 1H0MA 4KIFA 1W4MA 3FMSA 2IRFG 5LHGA 2HQRA 2MD5A 2JRTA 3ECHA 1OKRA 5D5VB 1XSVA 2FQ3A 4WX9A 4LD5A 4R1HA 3D5LA 3QPTA 2L3DA 4RB0A 5CVRA 3COAC 2OQGA 1R58A 2CG4A 1Z7UA 2ZNZA 5TJJA 3GEZA 4MNUA 3QU3A 2BGCA 5HLIA 2IPQX 4EM2A 4UVBA 1V3FA 5L3CA 2BV6A 5H6RA 2J5PA 3FF5A 4ETSA 4M71A 1WQ2A 1UFMA 3FM3A 1CGPA 4HV6A 2Q0OA 3ZPLA 1L3LA 2XUBA 4A12A 3HSEA 1IN8A 5HS9A 4CXFA 4L5JA 2DW4A 2J5OA 3C1DA 3MZHA 1HW1A 3F8FA 4UHTA 4LB6B 3QP5A 2HZTA 4HA8A 3U1DA 4R79A 2DBBA 2IT0A 1OYYA 5LGUA 3O6BB 4PDKA 1YFHA 1MKMA 2IVMA 1FC3A 1O3SA 4IXAA 3SFZA 1BI0A 1FP2A 4I01A 1XCVA 5HOOA 4IPAA 1Z91A 3WU1B 5BPDA 5E1XA 1QQIA 3HHHA 2XKPA 4M6XA 3BZ6A 3BOQA 2NRAC 2VN2A 1O7FA 4ZYEA 1IXSB 4U88A 3L00A 4HDVA 1LQ1A 5JVTA 1GXQA 5FLXZ 3HRMA 2V9VA 2O61A 3KE2A 2P5KA 5L3EA 1X3UA 2W57A 3IRRA 3CUQB 2P8TA 5BQTA 3WTSC 1BI1A 2H94A 4LG0B 4CDGA 4KT5C 1GHCA 3ZN1A 3QU6A 5CYVA 2VOOA 1I27A 4G6QA 4IRIA 3MZYA 5L3BA 4YIFA 2X0LA 4B8XA 3K0LA 2R3SA 2CSOA 3BROA 3M9AA 1W5TA 1IXCA 4Q47A 2EFOA 4MEYF 2ETHA 4HDUA 5DDGA 1QO0D 2LDUA 2A5YB 4UV8A 5ILUA 2YPRA 1WI9A 1Z05A 2HFHA 1STZA 1KU2A 2DT5A 4GCVA 4P5OA 5FD5A 2IJLA 1HKSA 2XRNA 3WGGA 2W85A 1FBUA 3I64A 4N9HA 5DCFA 2PEXA 1KU9A 1OPCA 1F1ZA 4RB2C 1J0RA 4MTEA 2BE5F 4JK1X 1Z1DA 3MEXA 2YX4A 2EFWA 1VTNC 1ZG1A 1LEBA 1IAWA 2FNPA 2A69F 1WRJA 2Z33A 3L09A 1LVAA 4I02A 2M8EA 4ESBA 3TKYA 2CGPA 5HDKA 1ZG3A 1B59A 4LLLA 5ICFA 4IVNA 4XLPF 3CJNA 3MQ0A 4G7ZF 3RIRA 2MC3A 4BHBA 1R7JA 3BDDA 3DV8A 3V8KA 3IKTA 3LWFA 3C3WA 3KZYA 2FXAA 4N0BA 2E7WA 3ZN0A 1U8RA 2DTRA 5FFZA 5KVRA 3LFKA 4HF1A 2HOEA 3E5QA 3GFLA 4L5IA 2DQRA 4A5MA 2ZMEB 2DO7A 3GFMA 3WE3A 3U9GA 2ZCWA 1KQ0A 4HLXA 5DCMB 1T38A 4ZZDA 3E5UA 2FMYA 4WF2A 4A6EA 3H3UA 3ZMTA 3HSFA 1RNLA 4UVAA 1R36A 1K7AA 1R1TA 1H9GA 5J8CA 1Y0UA 2JZYA 5IT9Z 1ZRDA 3Q9SA 3HHGA 2DFIA 3K69A 4P55A 2C6YA 2B0LA 3ZMDA 1HW5A 2STWA 1FBSA 2FBIA 2IW5A 3KP7A 3W6JB 4JBAA 4ENJA 2H27A 4HYEA 4U0WA 1R00A 4KMFA 4AWXB 4F7ZA 1RIOH 3NRVA 1K78A 5ILSA 1XGOA 3LQQA 2XGXA 3QP6A 3HRUA 2ZNYA 4BHPA 1S6LA 3PQKA 3B73A 3WODF 3R61A 4M9ZA 2VE8A 5JR3A 3EQLF 3HTSB 2QQ9A 3RKXA 5D5WB 1ZRCA 2QBYA 2P5VA 2A61A 1FSHA 3F6VA 5LRSA 2P5LC 3F6OA 2Z5UA 4ASNA 4ZZLA 5DUIA 3E6DA 2XAFA 2GXGA 3FXRA 3KEOA 1BBYA 3I71A 3ZMUA 3V7SA 2HQNA 4RGUA 4A2UA 3NEUA 4IHTA 1BN5A 4L9TA 5AIPA 4R8HA 3FX3A 2ELHA 1MJBA 2QUFA 1PP8F 5TRDA 1PDNC 4I0BA 3M1EA 3LAPA 2R7DA 2V1DA 1LEAA 1QBJA 2HGCA 2LF8A 3ML6A 3R0AA 4Q48A 3M8EA 4LGWA 1XD7A 2MA3A 2EV0A 1HKTA 2P6SA 3FXQA 1GVJA 1SFXA 1G4DA 3KFWX 3DP7A 2DPDA 4OIQF 2LKPA 2FBKA 3O3KA 5F1RA 4MHGA 4ZH4F 4HV5A 1CF7B 1V4RA 3VODA 2FU4A 4D0PA 2TDXA 3GZ5A 3MCZA 3KLOA 4OIPF 2IP2A 2JT1A 5LGTA 3HOSA 4HQEA 1T39A 3P7NA 4KA4A 1G3WA 1TQMA 5HLHA 4EQQA 5D5UB 4MTDA 4QWQA 5DD4A 2VXZA 4M72A 1DPUA 3V4GA 2PQ8A 4IRHA 1FPQA 3LA2A 3VEPA 1LNWA 1ON1A 1WKMA 3QRFF 1IUYA 4G6DA 4UVCA 3F72A 4FHTA 3NQOA 2L54A 2VC1A 5CVJA 3W6KB 2XASA 5K5RA 1ZG5A 2PN6A 4IF4A 2L4AA 2W84A 4LK1F 5D6FA 1HBXG 1R1VA 4O6JA 3I53A 2HR3A 1SFEA 2FBHA 4KN7X 2O8XA 1SD4A 4GGGA 5LRRA 4ON0A 2A07F 6PAXA 3ABUA 2Q2EA 1XDSA 1TBXA 4UV9A 4K2EA 1KQ9A 1F5TA 5CLSA 2HYFA 2L4MA 2F5FA 3SXYA 2G7HA 2DK5A 1S8NA 4EJWA 3ULQB 1GXPA 5L3DA 5DYMA 4EM1A 3WE2A 4I2OA 2GIVA 2XAQA 3SZTA 1SFUA 2PMHA 4WK8F 1KYZA 1R22A 4FX4A 3F21A 1G3SA 4YG2F 3V7CA 4P96A 3GUDA 1YW7A 2FNAA 5HVQC 4OOIA 2RN7A 1YO5C 1YQAA 3I59A 2XAGA 1HSJA
chains in the Genus database with same CATH superfamily
1ZYRF 2ZSHB 2VBZA 2BHYA 1U9NA 4BQNA 5DM6F 2DAOA 4LFUA 5AIQA 2PFBA 3G6EI 4LLNA 1ETYA 3IHUA 4XLNF 2ZC2A 3HBLA 4A0ZA 2AHQA 2K7LA 3K2ZA 1XGSA 3FM5A 3BPVA 2ID6A 3KYCB 3AL0B 3FXKA 1XGMA 2BEOA 2OA4A 1QRYA 2Y9YA 1RETA 3LSGA 1J2XA 1YS6A 1Z3YA 3WTYC 2E2IJ 1JT6A 4G8XA 1N78A 3CMAI 2LR8A 4C3JJ 3JRHA 3RTRA 4KUMA 1RI7A 4FISA 3RKQA 1CQTA 4HG2A 3KLNA 4CHUA 1L0OC 2ID3A 1WH7A 2M30A 2W25A 5DEQA 2GA1A 4L0ZB 2DFFA 1ZR2A 1Y56A 2CO5A 1LDDA 1JHFA 4OIOF 4U87A 4G94A 1KGSA 3U2RA 3G1OA 4ENNA 3HOYJ 2PJPA 2HU9A 5IP6A 2JQ7A 4ANJA 1OFCX 3OYAA 5AONA 2NNNA 1ZAOA 1OISA 4FT8A 5D4RA 2VC0A 2XROA 3CLQA 2HI3A 2XPWA 5IYDJ 2E36A 2ECCA 4BDZA 2GXBA 4I7HA 3TOBA 4KNYA 1J09A 5GPAA 1Y8RB 1VQ9I 2M1BA 2GXAA 3HUGB 2XF6A 3RSNA 4KIGA 4RGSA 1YG2A 2FE3A 2KPMA 1WH5A 4HZFA 4QLCU 1S7AA 1BJZA 5J1UA 1K4TA 5E3OA 4AU7A 5E3NA 1Z3XA 1MH3A 1I1GA 2XKOA 1Y1VJ 3JRDA 1MBKA 5E8IA 4KIBA 2VKDA 1TW3A 2LSOA 2DMPA 4FX0A 3L9FA 4NHJA 5GADJ 1JUMA 5ICEA 3S14J 3OV8A 1HKQA 1QPMA 3IH4A 3JR9A 4BE2A 3GTMJ 4CA0A 1X19A 4EM0B 5ICGA 2RV8A 3V8JA 3S2WA 2YUSA 2FQ4A 4E7JA 1JUPA 2H8RA 5FLXK 2UXXA 3EUKL 4RB1A 1ITYA 1WJEA 2WAEA 4XOTA 3CD6I 4HRIA 4GO1A 2XF7A 1KU3A 3TP3A 2FSWA 1BIBA 5HNHA 2K9QA 1U5TB 2ZFWA 3WHCA 4B4CA 1ZH5A 1T0FA 3AFHA 3MKZA 5K7HA 2Y31A 4M3GA 2Z9OA 3BJ6A 2NNYA 4DNCA 1E3HA 5DTDA 1NTCA 5K5OA 5D5XB 2M7AA 1MGTA 1O57A 1O7LA 2HDWA 1PP7U 1MSFC 4D7MA 3Q9VA 3KEYA 3EYIA 1SVOA 3H5NA 3FXLA 4IRGA 3PSFA 2K86A 4X6AJ 5LFAA 2WV1A 3OR1C 1ZGJA 2X1EA 2F2EA 5D8KB 2FOWA 4L9NA 5CVUA 1FYLA 1H8AC 2DPUA 2RQPA 3RKYA 5ICCA 3WGIA 2FEZA 2D45A 1SFOJ 1IN6A 1D8KA 1QZYA 1MW7A 3QWLA 3R4KA 4I09A 3OYIA 2XIGA 3E6MA 3KP4A 2OZ6A 4JOMA 3LA3A 4U0YA 2IS4A 2E1CA 3D0SA 1EH8A 1VNDA 3GMEA 2L0KA 2QA4I 4L9VA 4Y33A 2K9LA 2LBFA 2XGCA 4HF2A 5EG0B 1VZ0A 1W0TA 1IW7F 2WAQN 1AKHB 4KFCA 4IZZA 2KRFA 3QPHA 4HX8A 1AOYA 2CFOA 1BA5A 3BR5A 3SFIA 3ERED 1HCRA 2XAHA 2DDAA 2Z16A 3CUQA 1B1BA 2CQ7A 5FRMA 3OYEA 4BE0A 3C7JA 4PSXA 4RS8A 1ZGWA 1B72A 4G9YA 5IY5H 4LG0A 3E6BA 1OLTA 4N4NB 2OCCH 2PX9A 2MG4A 5E79C 4AIHA 4HLYA 3HJEA 4AD9A 5BNGA 5LEKA 3F22A 4PZJA 1RUOA 3TOAA 1OYWA 4HBLA 3OOPA 3QQAA 3BQZA 1B6AA 1SEUA 4C3HJ 4BGDA 1IDYA 5FB2A 3C2BA 1H89C 2DA4A 5A2QZ 3FZVA 3JSOA 1HQCA 2IEKA 3JW4A 1R71A 3OYHA 2W7NA 2QYOA 1D1BA 3W2WA 3JAMZ 3FKJA 1MMSA 1X1PA 1LDJA 3J81Z 1TNTA 1BOAA 1ON2A 4IX7A 1KA8A 4HSRA 3J7AO 2K3PA 4H0EA 2EZLA 4LK0F 1R23A 4CCOA 3DPTA 5C44J 2EZHA 4Z6YA 3HOXJ 1FT9A 1Z9CA 2QGUA 2UUZA 3NWSA 1FIAA 2E1NA 3S1MJ 1FOXA 2DYRH 5FKMA 1LE8B 3DXJF 4EATA 2O0YA 2QF7A 1HF0A 2QCOA 4EVIA 3MAJA 2VPRA 4Y13A 1T95A 2JSCA 3TMOA 5J4VA 1VQOI 2EB7A 1YRNB 3BTJA 3K1PA 1T56A 4NC7A 3K1NA 5C4XJ 5HLTA 3KP6A 3MZ8A 4WWCA 1X2NA 2GWRA 3DEEA 3HGYA 3R60A 2V1NA 1ULYA 1G6NA 1USSA 1G2HA 4XONA 1HXDA 2W24A 3FISA 4E70A 3H35A 1TC3C 3PJRA 1U3EM 1D5YA 4CYCB 1MH4A 3TO7A 4Q4ZF 2QZ8A 1U78A 3G4SI 4I76A 1W7PD 4QIWN 3IP4B 1EA3A 1M1EB 4ZTJA 3KP3A 1QGPA 3G1MA 4KICA 4RAYA 3DF8A 3RKWA 4IHXA 3P9KA 3DKXA 2VXDA 1OR7A 3RCOA 2ACJA 3WTXC 5FD6A 4CZZA 1P4WA 5EGOB 4L9JA 3OR2C 4OIRF 4YFXF 2KIFA 3J80Z 3CJRB 2GOMA 2EA4A 3RPUD 2KIUA 2ISYA 3HIFA 1IN4A 3J7YJ 3D1NI 1O3QA 2ZO4A 3GFJA 4MGRA 3K4LA 2MLGA 3SQNA 5EJCA 4M9SA 1R5HA 3T8TA 5H2FC 1SC7A 1AHDP 3SEQA 2JVGA 2HKOA 3WTTC 2CQXA 2PLYA 3H3ZA 3CP8A 1K78B 4PGGA 4QSHA 1OCZH 3LNQA 3MMYB 3DKWA 5DUKA 3IKVA 1FYMA 5F27A 1YX5A 5J1YA 4J00A 2LVSA 3L2VA 1E3PA 2I5UA 2O3FA 2QM3A 5EDNA 3J80K 2R7VA 3LSKA 3WU2C 1OYIA 4BXFA 3AG2H 3H0GJ 2NXNB 3FXJA 2ESHA 1WI3A 4G7OF 1OCPA 1D5VA 4S05A 4A5NA 4BACA 2F6CA 3E97A 1FTTA 3LQRA 3OS1A 5E1WA 2IA1A 2MH2A 1TQIA 2BXZA 4RLFA 1B4AA 3O2PE 5FRNA 2VASA 4PK4A 1XMKA 4KJZA 4P9FA 4YRVA 3H0DA 1FZPB 1T8IA 4YFNF 2VLAA 5LEJA 5LHHA 2LY9A 2AQFA 3F9KA 2LY1A 4LLGF 2DOFA 1REPC 3VSLA 4RBOA 2V1UA 1P4AA 2HS5A 2E35A 4IHVA 2L7ZA 1ZR4A 3CCEI 2OPTA 4O3MA 1J5YA 1P4XA 2GZWA 2HTJA 5IT9K 2LY2A 5BMZA 2STTA 2OZUA 2GAUA 2P7CB 2AXTC 5EZHA 3FWEA 3B6CA 5L3FA 4BKXA 1IDZA 1QNTA 2WAFA 2MBFA 5FKNA 4M74A 3HYIA 1IRFA 2HOSA 3RDIA 3H5RA 2ZMEA 3VSKA 2EK5A 1GV5A 2M34A 5B66C 2V6CA 3BR3A 1MBGA 2O6GE 5DCMA 2XV4S 2F5DA 4EMSA 3K4KA 4IHYA 2XVCA 2Y0SA 4EGZA 3DKYA 2HTSA 3GW2A 4GYGA 4GRIA 2R7WA 4F92B 1MDMB 2EA2A 4LITA 2KQRA 3FMRA 3S15J 3HEFA 2RVCA 4HF0A 3IWZA 2HZDA 5B5EC 4M73A 1D3YA 2Y75A 2XB0X 2KZVA 3CC4I 2PJRA 4M3EA 1ZTRA 3AG4H 3I54A 3WGHA 4CUGA 3QODA 1W7PB 5L3GA 4IHWA 3DBHB 2ELJA 3GYHX 3U21A 3JRGA 4IJAA 2Z3YA 2WBMA 2OQRA 3DWLE 2XHKA 2DOEA 3OIOA 5KK1A 2D1VA 4DOZA 1HC8A 2KT0A 3EUHA 9ANTA 1XCBA 4AVPA 3H92A 1PJRA 5JHUA 2G0EA 2M5WA 2CWEA 3UR3C 4BXXJ 4UY8I 3FDYA 1FX7A 5IT3A 1ZQ3P 2QLZA 1LPQA 3E1SA 1JJ6C 3T0YA 3A2KA 3HL2A 3WTUC 4HQMA 4V2FA 2L9NA 1O3RA 2MH9A 3B6AA 5J6XA 3ZQ7A 1ZKGA 3KETA 3ZP5A 3OYFA 3I4MJ 3N05A 1LKXA 1YITI 1DU0A 1S5LC 1Z6TA 3HRTA 2A68F 2EIMH 3RPQA 3A1YA 4XRFA 1DPRA 3LSTA 3M7GA 2VPLA 1PVEA 3ECOA 1ZN2A 4XKWA 3QOEA 2ADUA 1RC9A 5JLXA 1RZ4A 1X1BA 3BR1A 2FMLA 1OMIA 3KCCA 1T0FC 2QQBA 2JPCA 1VFCA 4XSXF 1KU7A 4V2GA 1JHHA 1IUFA 2M2EA 4FE7A 2CYYA 2V79A 1TWFJ 4C9YA 2EZIA 4KYWA 2XAJA 2EWNA 1VQLI 4P9UA 1TWGJ 4IQ4A 1MMAA 2KHMA 1HDDC 1BIAA 2CQKA 1X1DA 5DM7F 3ZQLA 2YU3A 5HS8A 2Z1DA 2BY1A 1MNMC 1TTYA 4HNVA 3KP5A 5FGMA 2XSJC 3BY6A 1K4SA 2VT2A 2EPFA 2QKMB 3J7AY 4ZYHA 1W5SA 4BDYA 1KYWA 1YW9A 2H6CA 3JRAA 2R5ZA 1H9TA 2Y9ZA 1K79A 5ED4A 1B8IA 1HDPA 1TP4A 3HRSA 5HS7A 2E5NA 2EILH 2Y0MA 1R5ID 1ZARA 4I6ZA 2X6YA 3QAHA 4EV0A 2DXIA 5E8GA 3F23A 3ROUA 2CW7A 2OF7A 3A4CA 1MZBA 3CJQB 3P5JA 3G73A 4AC0A 2YSRA 2VBWA 3H5AA 4WXDA 1F9NA 2V1XA 2BHZA 4S0HB 1BC8C 2WB1N 5IOZA 2M8GX 3CZ6A 2R7TA 4IQJA 3CMYA 4XORA 1TLHB 3DEWA 2KJBA 2VBYA 1FYKA 3PIOF 2RC4A 5J1RA 1XS9A 1QHHD 1B9MA 1P2FA 3D5SC 3MD2A 4C2UA 3PL8A 3VDXA 1IN7A 3TO6A 4EJOA 5E3MA 2HDCA 2KL4A 3NWTA 2G9WA 3PIPF 4G7HF 3CC2I 1FIPA 4RAGA 4BYYA 5CJ9A 2EFQA 2K4JA 2HYJA 2DLLA 3W6VA 3FKIJ 4UXNA 4XRMA 3CUOA 4OMZA 1X3ZB 2HWVA 2ICWG 3MVPA 4XSZF 3IH2A 2E1MC 2RDPA 3GCMA 5HLGA 3OYKA 5GTIC 2RAEA 1WVRA 3ZQQA 1WJCA 3MFKA 2R7OA 1FWZA 3ZQCA 1MD0A 3N97A 4TV7A 2ZBKA 4BNCA 3W2AA 5DV5A 1USTA 2VOPA 3CESA 2YX7A 4M9XA 2NYXA 1E3OC 3T5XA 5IYBJ 1JKQC 4GXOA 3F0CA 3K4NA 2LLKA 1J75A 2LG4A 2BYVE 2G7UA 2O03A 1KZHA 3S2DJ 1R6RA 2CS3A 1CF7A 4A0YA 1SAXA 2LOOA 2VB6A 4EJTA 3PNVA 3K1MA 1G3YA 3CO7C 4RB3C 2LRDA 1FY7A 1P6RA 2EJRA 4AYBN 4FCYA 2X6XA 1NH3A 4AIJA 3ABKH 4NQWA 2TCTA 4E4HA 3H3VK 3AAFA 4BXUA 3I58A 4XLHA 3L2UA 1XN7A 3V7RA 2DI3A 4BQOA 1R49A 5BPIA 4P1WA 2L02A 3Q0UA 5GPCA 1QVTA 3KEQA 2RNJA 3K9TA 2E2JJ 4HNUA 1Z6RA 3R6SA 3HB9A 3SEZA 3FBIB 3PFYA 4EGYA 2MLKA 1T98A 2MD0A 1JUSA 1OR7C 1IG7A 3HGGA 2GA2A 2K27A 2K02A 4CCJA 3IL2A 4DZJA 3F3XA 5D4SA 2YR2A 5E1ZB 2VT3A 2LH9A 4A6DA 1SVMA 4KDPA 2ELKA 3VB2A 2RKHA 5FLVA 2M4GA 1ETQA 3K70C 3S17J 2JA2A 5IP7J 2OTJI 3I9V2 2IBDA 1JT0A 3PUBA 3BJOA 1DP7P 4LB5A 5CKTA 2DK8A 3Q5FA 2CQNA 4IKFA 4OINF 2R7FA 1RKTA 2CU7A 5HODA 2L01A 1OJLA 1SMTA 3BPXA 2VUMJ 5LGNA 4XQFA 4L5EA 1TNSA 2QQ8A 2LF7A 4C30A 3OMYA 4F91B 2QSFX 5FO5A 3GZ6A 4OU0A 1PUFB 1VQ4I 1Q1VA 4PJMA 4B47A 1RR8C 4NNJA 2X9DA 1LUJB 1QU3A 3JTGA 2XGEA 4FE4A 4DJAA 1UHWA 3LSPA 4XR6A 5FFXA 3OS2A 3EPZA 1X4PA 2M4KA 4DW6A 1XGNA 1HLVA 4CCNA 3HPGA 3M07A 2M0MA 2BW3B 5B1BH 5EZGA 2DDBA 3JRIA 2PMZN 1D0YA 4BHCA 1SD5A 3WTZA 4MEXF 2W1OA 2BXYA 1YLFA 2XSDC 2UV1A 3GBGA 2H09A 2JPBA 4I0AA 4QPOA 3GTPJ 2VE9A 4ABZA 5CPRB 3G3ZA 1MMGA 3QOPA 1DGWY 4IHSA 1X3WB 1MNDA 1A5JA 5LD2C 2X85A 4BEHB 4A0XA 2QWWA 5EF6A 1S72I 2DJIA 1YHQI 2M45A 4A69C 3MKYB 1TWHJ 1F4KA 3FXOA 1C0WA 2VI6A 1HA8A 3Q0VA 3L7WA 2LBFB 1VQ7I 4UNOA 5K5QA 2ZFUA 2OC6A 1TW2A 3G1LA 4Y15A 4ESJA 2UWMA 1ODDA 2IA2A 3FIWA 4UUVA 4AIKA 2A6HF 4M3DA 2A6EF 1I6XA 2H1KA 3K4MA 3BP8A 4FQGA 1IV6A 1BW5A 1XSXA 3I4NJ 1YJNI 1S3JA 3ELKA 5ERIA 2H6BA 4ZYDA 2KMUA 3KYDB 1BI3A 3FMQA 1T33A 4YIRX 4C2TA 3KZZA 4XKCA 3JREA 2O8KA 1YIJI 3HPHA 3RJPA 2Y0SN 3J7ZI 2OD5A 3QYBA 3FHZA 4RMNA 2KIQA 2CV0A 1S9HA 3E6CC 4LG3A 4MQVA 1T2KA 3IWFA 1D1CA 3LAJA 4QPQA 3WTWC 3JRCA 2CFXA 4N9IA 2X6OA 2B7EA 1DDNA 1IRGA 1PYVA 2W48A 5DD8A 1O3TA 3PQJA 2DU9A 2CV2A 4DZPA 4J01A 4BBRJ 2VBXA 3ASOH 3I4PA 2ZJPF 4E7IA 1FBQA 2FRHA 1UHMA 1K61A 3W3CA 1Q1HA 5HDNA 3HUGA 5EEGA 4C3IJ 1WSUA 3CLOA 3TDUC 2OAZA 1ETOA 1WJDA 3A0HC 3TDZC 3OL4A 3REOA 1FOKA 4UB6C 1FOYA 1XC5A 2WB1A 2JJ7A 5F04A 1UG0A 5LBQA 1E17A 1IF1A 5KNLA 3UKGA 5J8FA 1J59A 1FMVA 2QVOA 1XG1A 4YFKF 2HVQA 2KDOA 3LSHA 4IOCF 1BI2A 2W82A 4Q5SF 1J9IA 4U7BA 3DEUA 1YIOA 1G3TA 4A3KJ 3JTHA 3S16J 1MJAA 2Y30A 3CF2A 4EJVA 2EV6A 1FEXA 1TWAJ 3GO5A 3P9IA 2EFNA 3BJAA 3Q3SA 5CQEA 2A05A 1TT0A 3DPLC 3M3YJ 2RGVA 3LSIA 1Z21A 2KFDA 3FBNB 4Z2YA 3IRQA 1U5TA 3WTVC 3VYTB 1BL0A 3I5UA 1PUEE 3GF2A 1BW6A 1FMWA 2MGQA 1LJ9A 3ZMSA 2HPMA 2FA5A 4A3BJ 2ME6A 1FP1D 2O9LA 3GX4X 2LP0A 1R1UA 4F93B 1BJAA 1OQYA 3KP2A 3FXUA 3ESWB 1RESA 5D8LB 5A2QK 4HX4A 4PGHA 1ONVA 1XDUA 1UB9A 4MLOA 4XLCA 3HOTA 2MC4A 2JTVA 2ISZA 2XPUA 3TBIA 3JAMK 3CCLI 3IC7A 1JGSA 1ZRFA 1TWCJ 5IPAA 3GVAA 1A04A 2PG4A 3A03A 2VONA 4AYBA 2AXLA 3J81K 4XBFA 3SDGA 3WG7H 3T8RA 3K7AJ 3BC8A 3CDHA 4A3JJ 4ZTFA 2JMWA 2LNBA 1MBJA 1MMNA 2Y2ZA 3N4MA 5BOXA 2Q1ZB 1A36A 2I10A 2HXIA 1K6YA 1E2XA 1GUUA 1AA7A 4PJJA 1A31A 3GTKJ 5EG0A 3DFGA 1AKHA 2HPIA 3NARA 3ZMVA 2IAIA 1FNNA 5E17F 3IAM2 1ZK8A 1W5CC 3E3VA 1WWXA 1UG2A 4S04A 3CO6C 1FJLA 2X51A 2VKHA 3F8NA 2L9RA 5J3LA 2BBYA 4M3FA 4DIQA 5D6EA 3CQZJ 3RZOJ 5H6QA 1VQNI 1ZREA 1E0EA 1ERDA 1IXRC 1D8JA 2PBIA 1MIJA 3BTIA 4JQFA 4XNFA 1DUXC 1NG6A 4ENKA 4IL6C 2WC2A 3C18A 2GQQA 3GTLJ 1ZLJA 1XSDA 2K9SA 2JWTA 2F5CA 4CICA 5E3LA 3CCRI 1FLIA 4HAMA 1VQMI 3HM5A 4BQAA 3SHFA 4BJ5C 4L18B 4ZDPA 3TO9A 1ZGAA 2K4BA 3QYFA 3ZMZA 2B63J 2P4WA 4U7DA 1T6SA 3EYYA 2PI0A 1MJ9A 2DFHA 2QQAA 3E5XA 1UCRA 1H88C 5F1JA 4KITB 3HC7A 2E7XA 3GLLA 4YIIA 2R7XA 5E18F 2ME0A 3DCFA 2KDZA 2W00A 4L0YB 4IOAF 1DU6A 1YJWI 4BH9A 3IH3A 3DLLF 2KISA 3ISPA 1QA6A 1IJWC 5JFRA 2DA3A 1IZ1A 4W1UA 4AVZA 1V5EA 1LE8A 1KQ8A 3I0TA 4WCGA 1JKOC 1I1SA 2VQLA 2O5RA 3KX2A 3SZPA 2QBYB 3M8JA 4DYQA 1BC7C 2R93J 1YW8A 3K4JA 2Q8KA 2ZXWH 2D2WA 4G12A 2R7QA 5E20A 1T08B 1YRNA 2PMZA 2IA0A 4KT6A 4WXCA 2F5EA 2QENA 1LB2A 5F64A 4B48A 1K6OA 2VODA 1OCRH 3GLXA 1NG7A 5IP9J 4GYIA 1ZLKA 2VJIA 4E7KA 1QZEA 3KIOA 4HX7A 1Z77A 3CP2A 3IUOA 4CYCA 3ZGKA 1TQPA 4BE1A 2BVMA 3F8MA 1RUNA 1YYVA 4CH7A 2IGMA 4LJZF 4UUSB 4OMYA 1I50J 1JJ8C 2P6TA 4OWRB 3DU5A 1B9NA 1EKEA 1P92A 1V55H 3ABLH 3MWMA 1V54H 2MW8A 5EGOA 3BCBA 2CH0A 4CGZA 3M8FA 2XF5A 3PFIA 2E19A 2IS2A 1WGXA 2WV0A 2Y48A 2M3AA 4A3IJ 3AG3H 1FSEA 4LMYA 4X1EA 4KMUX 3VOEA 4OAYA 4CO8A 3BCAA 4E7SA 2W4SA 3OYMA 3RI4A 4MQ9F 4WXHA 1SD7A 2ZKZA 4DBRA 2AO9A 4KN4X 2D1HA 4PJNA 3R0JA 4XOPA 1DGRM 1VI0A 1NHAA 5JI6A 1ACIA 2LYCA 4BU2A 2HKXA 3DTIA 4ESFA 3DTKA 1HW2A 3QPSA 4RGRA 4PJLA 1LDKB 3HKZA 3GTQJ 3H9QA 2DA2A 1IN5A 1ZHFA 4GDFA 3CCVI 2DCEA 3DLAA 2KKOA 1U2WA 4RGXA 4DQ2A 3HSRA 3GFIA 2ZSIB 2VQCA 1R5GA 2DMNA 1I3AA 1YTYA 2HYGD 3LL7A 3HG9A 1Z7LA 4A3FJ 2FD5A 4XRSG 4EEFG 3LOCA 5GAGJ 2VL8A 2ZXJA 2YU9J 1VQ6I 1QZZA 5LHIA 1AWCA 5KAFC 2EV5A 2EFPA 3ABMH 4NB5A 3L2QA 1BOBA 2CW0F 3JSPA 1S29A 2X4HA 3AL0C 2LREA 4NUBA 2AS5F 3CCQI 5F0FA 5CVVA 4RAZA 4U0VA 1Y1WJ 3F8CA 4I98B 3OSGA 2NS0A 1JXSA 1J7KA 2DQLA 1HSTA 5J47A 5LLQA 1N75A 2UZKA 5F6FA 1LFBA 2NAZA 4PFPA 1YS7A 2DMUA 4CSWA 4ZYGA 4BAYA 5IOYA 2HXOA 2H1LA 1VF9A 3WU0A 2R7SA 2ESNA 5DS9A 2E71A 2HVRA 2WWYA 4HW0A 2ZXIA 3HTUA 1BM9A 2MYSA 2UXNA 3DQVC 3CTAA 1DQUA 2X1CA 3CF5F 3KPHA 1SD6A 4UUTA 4XKBA 3P9CA 3DBRB 3TGNA 1WJ5A 4ZDLA 4CYDA 1JE8A 5K1YA 3BR6A 4RAFA 3EDPA 4ENMA 4PCQA 2FF4A 5H20A 1Z67A 1MDMA 2FOKA 5EEHA 4B09A 3RQ4A 3LA7A 2PMUA 1EH6A 2YS9A 4Y52J 3PNYA 3WG9A 1S7OA 5CVIA 4BUPA 3TQNA 5K7FA 1X1CA 1XB4A 5TGTA 2KZGA 3G71I 2JRMA 5HDGA 2F4IA 4O5VA 3HOWJ 1I5ZA 2QKLB 3L2CA 2ZJ2A 2Z99A 3F8BA 3RYPA 1W7PA 1X2MA 1EV7A 4RM2A 2Q2EB 3BZKA 1XMAA 1S7EA 2M87A 5TISC 3LSRA 1U6GA 3ZXSA 1BR4A 2L9VA 1BR2A 5GTHC 2P7VB 5FROA 3M1CA 3RYRA 3OIQA 3OL3A 4M6YA 2OBPA 2DMTA 4EJUA 2IS6A 5ILVA 3CUQC 1IRXA 2R5YA 3LFUA 3RPUA 1N25A 3CDLA 2VQGA 3EETA 5GAHJ 4Y17A 3CCMI 3BWGA 3FHNA 2EQRA 1U8BA 1NK3P 5BS6A 3T1BA 1IV8A 5FJ8J 1W36C 1EH7A 3B02A 3PSIA 2JA7J 4XM3A 4NQWB 2KJCA 3ABTA 2CUEA 2COMA 1VQKI 3S2HJ 2KIMA 4RA2A 4Y4RA 3U1KA 2A3SA 3A01B 3GWZA 5M5YJ 1SMYF 3V8LA 3K10A 4JX6A 3I59B 1SAUA 2WTEA 4HOBA 1U5TC 2HEOA 1IGNA 3IAS2 3VFZA 3GXOA 3GTJJ 2OU2A 1H0MA 2FJ1A 4KIFA 1LFUP 1W4MA 3FMSA 1I6HJ 2IRFG 4IEJA 5LHGA 3A02A 2HVSA 1XMXA 4J19A 2HQRA 2MD5A 2NVXJ 1G59A 2JSPA 2JRTA 3ECHA 5F0CA 1OKRA 5D5VB 1XSVA 3SZGA 2FQ3A 4WX9A 3CCYA 1YJ9I 2ZJRF 2LC2A 1JTXA 4LD5A 4R1HA 1A6QA 2RQQA 3D5LA 1QPIA 1GV2A 3QPTA 2F5VA 4XLAA 2L3DA 4RB0A 5CVRA 2ZB9A 3COAC 3ZCOA 5M5XJ 2EINH 4ZYAA 3I56I 2OQGA 1R58A 2CG4A 1Z7UA 3S93A 2ZNZA 5TJJA 3GEZA 2V6EA 4MNUA 4A3GJ 3QU3A 5FKOA 5F0HA 2BGCA 5HLIA 2IPQX 4EM2A 4B1RA 4GFBA 4UVBA 4YELA 2VJJA 4KISA 2V26A 2HOTA 1V3FA 5L3CA 2NS8A 2BV6A 5H6RA 3BZCA 2J5PA 3FF5A 1JTYA 3BG7A 4ETSA 2AQEA 4XICA 1G8XA 4M71A 1WQ2A 1UFMA 3H9GA 1JKRC 3FM3A 3OYNA 1CGPA 1ETVA 4HV6A 2MSYA 2Q0OA 4M3BA 3OYDA 3ZPLA 1L3LA 4AIDA 2XUBA 4A12A 5F08A 3HSEA 4XKVA 1IN8A 5HS9A 4CXFA 1SANA 2JA5J 2EZKA 4L5JA 2DW4A 2MABA 4LIUA 2EIJH 4CCMA 3BTLA 1A6IA 2J5OA 3C1DA 3MZHA 1X1AA 1HW1A 4E7ZA 3F8FA 4QTRA 4UHTA 4CZCA 4LB6B 3OWTA 4Y3OA 3QP5A 2HZTA 1ETXA 1IO2A 3TW7A 4HA8A 1OCTC 3U1DA 4R79A 2DBBA 4FETA 2IT0A 3JCUC 1OYYA 3WHBA 5LGUA 1POGA 2FUG2 3HXLA 3O6BB 4PDKA 4D9JA 4JX4A 5FKLA 4F3QA 3OYJA 4MFEA 1YFHA 1MKMA 2IVMA 3HOZJ 3BR0A 3SJMA 2L2OA 1FC3A 1O3SA 4IXAA 3SFZA 3BQYA 1BI0A 1N77A 3BG9A 1FP2A 4I01A 3PO2J 2K9MA 1XCVA 2V7FA 3V42A 2B9SA 2WADA 5HOOA 2OV7A 4IPAA 3OYCA 1Z91A 2VQHA 4NC6A 5JLWA 2CQQA 4XMYA 3WU1B 5BPDA 1MNEA 1NK2P 2GBYA 5E1XA 1QQIA 3HHHA 2XKPA 4M6XA 3BZ6A 2ECBA 3VPRA 3BOQA 2I8DA 2VN2A 3S3MA 2NRAC 1O7FA 1ETKA 4ZYEA 3K70D 1AU7A 1IXSB 3ERMA 4G6TB 1K83J 2K85A 2ZMEC 3HOUJ 4U88A 3L00A 5C4JJ 3OYBA 4HDVA 4PJ0C 3CC7I 3VYSB 1LQ1A 1JGGA 5JVTA 1GXQA 4XN3A 5FLXZ 3HRMA 2V9VA 2DOAA 2O61A 3KE2A 2P5KA 5L3EA 1X3UA 2JUCA 2W57A 1RKWA 3IRRA 3CUQB 2P8TA 5BQTA 2E5ZA 3WTSC 1B72B 1BI1A 2H94A 3ZQHA 4LG0B 2TRTA 5J4YA 2CJJA 4B3AA 4CDGA 4KT5C 1GHCA 4JX5A 3ZN1A 3QU6A 4BY7J 1BR1A 5GP9A 2BZTA 5CYVA 1PUFA 1QVUA 3K4BA 2VOOA 1I27A 3S32A 4B44A 4G6QA 4XRSA 3MZYA 5L3BA 4IRIA 3PM1A 1P9QC 3EUAA 4YIFA 3KYLA 2X0LA 4JYKA 1F36A 3HKZN 4B8XA 3EUHC 2R3SA 3K0LA 2CSOA 3BROA 3M9AA 3S3OA 2E1MB 1W5TA 2FX0A 2IGKA 3D5RC 4BBSJ 2HOAA 2R4GA 1WJFA 2BW3A 1IXCA 2NVUB 4Q47A 2EFOA 4MEYF 2ETHA 3CCUI 2L5QA 4HDUA 3OOUA 5DDGA 1QO0D 2LDUA 4LOCA 2NVYJ 3DBLB 4DYCA 2A5YB 2NOGA 4A93J 4UV8A 3C2HA 3ZR8X 5ILUA 2YPRA 1WI9A 1Z05A 2HFHA 1STZA 1KU2A 1ZELA 3TP0A 2DT5A 2WY8Q 2CUZA 2F4MB 2K5CA 2VJ4A 4GCVA 4BEHA 1D0ZA 2XC7A 4E6KG 4FTHA 4P5OA 5FD5A 3CMEI 1WJAA 3O8GA 3CJTB 2IJLA 4BJTA 2XDVA 1HKSA 2XRNA 1KONA 3WGGA 2W85A 1FBUA 2KRCA 3I64A 1U9OA 4HEA2 3LSJA 4N9HA 5DCFA 2DMQA 2XPVA 2PEXA 1KU9A 3DTEA 2D5VA 1OPCA 1F1ZA 2X1DA 5KCMA 3M4OJ 4RB2C 3DU6A 1J0RA 2NS7A 4MTEA 2BE5F 4NBQA 2HQAA 3K4CA 1TZLA 4JK1X 2E2HJ 1OCCH 4F55A 2NVQJ 1Z1DA 1YX3A 1VQPI 1MBEA 3JRBA 4D1QA 3MEXA 2L9SA 1XTAA 2YX4A 3AKZA 4BY1J 2EFWA 1VTNC 5M3MJ 3ZRGA 1ZG1A 1LEBA 1IAWA 3I3LA 2FNPA 2VKEA 2A69F 3LMMA 2BY2A 3ONQA 1WRJA 5KHDA 1SVLA 3GZNB 3K6GA 3L09A 2Z33A 2IXSA 4A3EJ 1LVAA 4I02A 2M8EA 4ESBA 3TKYA 4YEJA 2DJNA 4HNTA 1GDTA 2A6TA 1Y6IA 1XPXA 2CGPA 2VIXA 2L7KA 4II3A 2JA8J 5HDKA 1ZG3A 3C2GA 1B59A 2M9HA 4LIVA 4AM3A 4F52A 1RPWA 4LLLA 2Y69H 5ICFA 2BOLA 5EEAA 2KP6A 3W2VA 2V9KA 4IVNA 4XLPF 3CJNA 3MQ0A 4OAZA 3O8HA 4G7ZF 3RIRA 2DA6A 3OIPA 3IV5A 2MC3A 4BHBA 1Y0NA 2E60A 1R7JA 2DA5A 3ZQGA 3S8PA 3BDDA 3DV8A 3V8KA 3IKTA 2RREA 5FKKA 1TL8A 1WFXA 3LWFA 3C3WA 3KZYA 4H4KC 1JKPC 2FXAA 4N0BA 3S3NA 2CUJA 2E7WA 3ZN0A 1U8RA 2DTRA 4XLEA 1IRZA 3FK6A 2IGOA 5FFZA 3FK7A 5KVRA 2RNGA 3LFKA 3OSFA 3CMMA 4HF1A 2HOEA 3S1QJ 3CCJI 4A3CJ 3E5QA 3BLYA 2LKSA 3GFLA 4L5IA 2DQRA 4A5MA 2QSGX 1V5FA 2ZMEB 2DO7A 3BT9A 3ZQIA 3GFMA 3E7LA 1EJ9A 3WE3A 3U9GA 2ZCWA 1YE9A 1KQ0A 2L7FP 3MN2A 4HLXA 5DCMB 3SYTA 1T38A 4ZZDA 3E5UA 3BR2A 2XGDA 4JP0A 2FMYA 1TT5B 3NAUA 4WF2A 4A6EA 2DTZA 3H3UA 4Y7NJ 5JVGF 2OCEA 3ZMTA 3HSFA 1RNLA 4UVAA 1GT0C 1LVKA 4XLFA 2L7MP 2R0QC 2V4JC 4CCKA 2PJRB 1R36A 1R4MB 4FASD 2VKVA 3Q0WA 1K7AA 1R1TA 1H9GA 5J8CA 2QEXI 4ZDOA 3L2RA 1Y0UA 1R4NB 2OJED 3LSMA 2JZYA 1MBFA 1Z0XA 2DODA 2QSHX 3TW6A 5IT9Z 1ZRDA 3Q9SA 3HHGA 3TL4X 1WJBA 5EYRA 2DFIA 3K69A 4P55A 3HOVJ 2C6YA 2JA6J 2B0LA 2CRGA 2P0WA 3ZMDA 1HW5A 4PSWA 3S1RJ 5JHFA 2STWA 2GOXB 2WY7Q 2NVTJ 2KLOA 2ZXHA 1FBSA 1QHGA 2FBIA 2IW5A 2GIZA 2M7BA 3KP7A 1ORKA 3HDDA 4MO7A 3W6JB 2XAUA 1IC8A 4JBAA 2HQ5A 4ENJA 2H27A 4HYEA 4U0WA 1WZ2A 2GM4A 1R00A 2F48A 2JK3A 1UMQA 1GVDA 4KMFA 4IO9F 1UHSA 1A35A 2V9PA 1ETWA 4AWXB 4F7ZA 2JVHA 2HNHA 4A3DJ 1RIOH 3BTCA 3NRVA 3TEDA 3GTGJ 1K78A 5ILSA 1XGOA 4RM3A 3LQQA 1UJ8A 1U0JA 5M5WJ 4XN0A 2JUGA 2XGXA 2P81A 3BG3A 3A0BC 3QP6A 3UNGC 3HRUA 3E0JB 2OTLI 2ZJQF 2R92J 1LFPA 2ZNYA 4BHPA 4E7LA 1S6LA 3PQKA 1RRJA 5K7ZA 2IGNA 3B73A 3WODF 3R61A 4M9ZA 1APLC 3OYLA 2R7ZJ 2EBIA 5KAIC 2VE8A 5JR3A 3K2AA 3I55I 3EQLF 1YOVB 3HTSB 2QQ9A 3RKXA 5D5WB 1W1WE 1ZRCA 2QBYA 3HZJA 2X6WA 2P5VA 2Z2SB 3CCSI 2A61A 4X0GA 1FSHA 3F6VA 5LRSA 1X4OA 2P5LC 1D0XA 1UAAA 3F6OA 2Z5UA 4ASNA 5J40A 4ZZLA 4M6VA 5DUIA 3E6DA 1W0UA 2XAFA 2CUFA 1JI8A 2R5ZB 1B8IB 2GXGA 3FXRA 3MKLA 3KEOA 1BBYA 3SDBA 3I71A 4NDLA 3QPLA 3OY9A 2LMDA 2CW8A 3ZMUA 3V7SA 2DT6A 2HQNA 4RGUA 5FLMJ 4A2UA 1D1AA 3RZDJ 2H8WA 4MFDA 1VQ8I 2LTPA 3NEUA 2R7RA 4IHTA 1BN5A 4CCLA 4UUSA 4A3LJ 4C2MJ 2BY0A 2DA1A 3AG1H 4L9TA 5AIPA 2R5YB 4R8HA 3BG5A 2WAQA 3FX3A 2M0CA 4PUSA 1MJBA 2ELHA 3ASNH 2QUFA 1YI2I 3VWBA 2CMPA 4MIMA 3X2QH 3PUFA 4D5CA 2COBA 1P7JA 4NC8A 1PP8F 5TRDA 5GAEJ 1PDNC 4I0BA 3M1EA 3LAPA 2R7DA 2V1DA 2A5WA 1LEAA 4A3MJ 1QBJA 2HGCA 2LF8A 3ML6A 4B43A 3KZIC 3R0AA 4Q48A 2KRHA 3M8EA 4LGWA 3JRFA 4BL0B 1XD7A 2MA3A 1EF4A 2EV0A 2DA7A 4AUXA 3H9JA 1HKTA 2DYSH 1RR7A 3MKWB 4HSTA 2P6SA 2JN6A 3FXQA 1GVJA 1SFXA 1G4DA 4UB8C 2X48A 4XK4A 3KFWX 2LD5A 3DP7A 1SFKA 2K3FA 2DPDA 4XL9A 3GTOJ 4OIQF 2LKPA 2VJ5A 2FBKA 3O3KA 5F1RA 1UELB 5C3EJ 4BQQA 5HNFA 1MBHA 4MHGA 2LFBA 2HDDA 4ZH4F 4HV5A 1CF7B 1V4RA 3VODA 4ZC3A 2FU4A 3H36A 2N8GA 4D0PA 5IYCJ 2TDXA 3GZ5A 3H1CA 3MCZA 3KLOA 4OIPF 1X58A 3DPUA 2IP2A 4RLQA 4RDUA 2JT1A 1WHUA 4XIDA 5LGTA 3HOSA 4HQEA 1T39A 3P7NA 3S1NJ 4KA4A 3PNTA 1G3WA 1MSEC 1TQMA 1Y8QB 4EQQA 5HLHA 5D5UB 1R9TJ 4MTDA 4I99C 4QWQA 2WA0A 5DD4A 4ITVA 3ZOBA 2VXZA 4M72A 1DPUA 2OUMA 3V4GA 2XB5A 2PQ8A 4IRHA 1FPQA 3LA2A 3VEPA 2E1OA 4W97A 1LNWA 3OYGA 1ON1A 4B3XA 3VYRB 4DGWB 3ZQFA 2F4OB 1XX5A 2MFZA 1WKMA 1HOMA 3QRFF 1IUYA 2O7OA 4D5FA 4G6DA 4UVCA 3PO3J 2R7UA 3F72A 2CV1A 3BG6A 4FHTA 1Y39A 1DP3A 1FTZA 1P7IA 3NQOA 1WPKA 2L54A 2VC1A 5CVJA 1V5GA 3W6KB 2XASA 4D7NA 5K5RA 4BS9A 4DYRA 1ZG5A 1OCOH 2PN6A 4IF4A 2L4AA 4E7HA 2W84A 4HPQA 4LK1F 2LK2A 3CDIA 5D6FA 1HBXG 1I39A 3FXMA 1R1VA 4O6JA 3I53A 1VQ5I 2HR3A 1SFEA 1UZCA 2FBHA 4KN7X 2O8XA 2IS1A 5B3SH 1SD4A 4GGGA 5LRRA 2DFEA 2DN0A 2E34A 4ON0A 2A07F 2EH3A 6PAXA 3RQIA 2K40A 3ABUA 2Q2EA 1XDSA 1TBXA 4UV9A 4K2EA 1KQ9A 1F5TA 5CLSA 2HYFA 1MMDA 5B1AH 2L4MA 4V19K 1W36D 1FOWA 2F5FA 2GLOA 2LKXA 2NOJB 3SXYA 1GLNA 2G7HA 2DK5A 1S8NA 4EJWA 3ULQB 1WCMJ 1GXPA 5L3DA 5DYMA 5M3FJ 1ENHA 2BVLA 2BY3A 4EM1A 3OS0A 3VYUB 3G2BA 3WE2A 4I2OA 2GIVA 2XAQA 3L2WA 2DT7B 3SZTA 4BJ6C 5CQGA 1SFUA 2PMHA 4WK8F 1KYZA 4PFOA 2K9NA 1R22A 1I3QJ 4II2A 4ZJZA 1G3SA 3L1PA 4YG2F 3V7CA 3F21A 4P96A 4FX4A 3GUDA 2XRLA 1YW7A 2FNAA 4DBQA 2EIKH 4OOIA 5HVQC 1F43A 2RN7A 1O4XA 1YO5C 1YQAA 4N4OB 3A01A 3I59A 2XAGA 1HSJA 3QYEA
chains in the Genus database with same CATH topology
1ZYRF 2VBZA 2DAOA 4LFUA 5AIQA 2PFBA 4LLNA 3IHUA 4XLNF 4A0ZA 2K7LA 3K2ZA 1XGSA 3FM5A 3BPVA 1XGMA 2BEOA 2OA4A 1J2XA 1YS6A 3WTYC 4G8XA 3RTRA 4KUMA 1RI7A 3KLNA 4CHUA 1L0OC 2M30A 2W25A 5DEQA 2GA1A 4L0ZB 2CO5A 1LDDA 1JHFA 4OIOF 4G94A 1KGSA 3U2RA 4ENNA 2PJPA 5AONA 2NNNA 1ZAOA 4FT8A 5D4RA 2XROA 2VC0A 2GXBA 4I7HA 3TOBA 4KNYA 2M1BA 4KIGA 4RGSA 1YG2A 2FE3A 4HZFA 4QLCU 1S7AA 1I1GA 2XKOA 5E8IA 4KIBA 1TW3A 2LSOA 4FX0A 3L9FA 4NHJA 5ICEA 3OV8A 1HKQA 1QPMA 4EM0B 5ICGA 2RV8A 3V8JA 3S2WA 5FLXK 2UXXA 4RB1A 4GO1A 1KU3A 2FSWA 1BIBA 1U5TB 2ZFWA 1ZH5A 1T0FA 2Z9OA 3BJ6A 2NNYA 4DNCA 5K5OA 5D5XB 1MGTA 1O57A 1O7LA 1PP7U 3Q9VA 3EYIA 4IRGA 2K86A 1FYLA 1ZGJA 2F2EA 5D8KB 2DPUA 4L9NA 5CVUA 2RQPA 3RKYA 5ICCA 3WGIA 2FEZA 2D45A 1IN6A 1D8KA 1QZYA 3R4KA 4I09A 2XIGA 3E6MA 3KP4A 2OZ6A 4U0YA 3LA3A 2E1CA 3D0SA 1EH8A 4L9VA 4HF2A 1IW7F 4KFCA 2KRFA 3QPHA 4HX8A 1AOYA 3ERED 2XAHA 3CUQA 1B1BA 3C7JA 4RS8A 4G9YA 4LG0A 3E6BA 4HLYA 4AIHA 4AD9A 5LEKA 3F22A 4PZJA 1RUOA 3TOAA 1OYWA 4HBLA 3OOPA 1B6AA 5FB2A 5A2QZ 3FZVA 3JSOA 1HQCA 3JW4A 2QYOA 3JAMZ 1LDJA 3J81Z 1TNTA 1BOAA 1ON2A 1KA8A 3J7AO 4H0EA 4LK0F 1R23A 3DPTA 1FT9A 1Z9CA 2E1NA 3DXJF 2O0YA 4EVIA 3MAJA 4Y13A 2JSCA 2EB7A 3K1PA 3K1NA 3KP6A 4WWCA 2GWRA 3R60A 1ULYA 1G6NA 1USSA 1HXDA 2W24A 4E70A 1U3EM 3TO7A 4Q4ZF 2QZ8A 1U78A 1W7PD 3KP3A 1QGPA 4RAYA 4KICA 3DF8A 3RKWA 3P9KA 1OR7A 2ACJA 3WTXC 5FD6A 4CZZA 1P4WA 4L9JA 4OIRF 4YFXF 2KIFA 3J80Z 2EA4A 2KIUA 2ISYA 3HIFA 1IN4A 1O3QA 2ZO4A 3GFJA 4MGRA 2MLGA 3SQNA 4M9SA 1R5HA 3T8TA 2HKOA 3WTTC 2PLYA 3H3ZA 1K78B 4PGGA 3DKWA 5DUKA 3IKVA 1FYMA 2O3FA 2QM3A 3J80K 1OYIA 2ESHA 4G7OF 1D5VA 4S05A 4A5NA 3E97A 3LQRA 5E1WA 2IA1A 2MH2A 1TQIA 1B4AA 3O2PE 1XMKA 4P9FA 1FZPB 4YFNF 5LEJA 5LHHA 4LLGF 1REPC 2V1UA 1P4AA 2HS5A 4O3MA 1J5YA 1P4XA 2GZWA 2HTJA 5IT9K 5BMZA 2STTA 2OZUA 2GAUA 2P7CB 3FWEA 5L3FA 1QNTA 2MBFA 4M74A 3HYIA 1IRFA 3RDIA 2ZMEA 2EK5A 2V6CA 2O6GE 5DCMA 2XV4S 2F5DA 4EMSA 2XVCA 4EGZA 2HTSA 3GW2A 4GYGA 1MDMB 2EA2A 3FMRA 2RVCA 4HF0A 3IWZA 4M73A 1D3YA 2Y75A 3I54A 3WGHA 1W7PB 5L3GA 3GYHX 4IJAA 2Z3YA 2OQRA 2XHKA 5KK1A 2D1VA 3EUHA 1XCBA 4AVPA 3H92A 5JHUA 2M5WA 2CWEA 1FX7A 5IT3A 2QLZA 3T0YA 3WTUC 4HQMA 1O3RA 2MH9A 3ZP5A 5J6XA 3ZQ7A 3KETA 1Z6TA 3HRTA 2A68F 3RPQA 4XRFA 1DPRA 3LSTA 3M7GA 3ECOA 1ZN2A 2ADUA 1RZ4A 2FMLA 1OMIA 3KCCA 2QQBA 2JPCA 1KU7A 4XSXF 1JHHA 2CYYA 2V79A 4KYWA 2XAJA 2EWNA 4P9UA 1BIAA 2CQKA 2YU3A 5HS8A 1TTYA 3KP5A 5FGMA 3BY6A 2VT2A 4ZYHA 1W5SA 1KYWA 1YW9A 2H6CA 1H9TA 1K79A 5ED4A 3HRSA 5HS7A 2Y0MA 1ZARA 3QAHA 4EV0A 5E8GA 3F23A 3ROUA 1MZBA 3G73A 2YSRA 2VBWA 4WXDA 1F9NA 2V1XA 1BC8C 1TLHB 2KJBA 2VBYA 1FYKA 2RC4A 1B9MA 1P2FA 1IN7A 3TO6A 4EJOA 2HDCA 2G9WA 4G7HF 4BYYA 5CJ9A 2EFQA 2K4JA 2DLLA 4UXNA 3CUOA 4OMZA 2HWVA 4XSZF 2RDPA 5HLGA 3MFKA 1FWZA 1MD0A 3N97A 4TV7A 2ZBKA 4BNCA 5DV5A 1USTA 2VOPA 4M9XA 2YX7A 2NYXA 3T5XA 4GXOA 1J75A 2BYVE 2G7UA 2O03A 1CF7A 4A0YA 1SAXA 4EJTA 3K1MA 1G3YA 3CO7C 4RB3C 1FY7A 1P6RA 2EJRA 4AIJA 4NQWA 3AAFA 4BXUA 3I58A 1XN7A 3V7RA 2DI3A 5BPIA 2L02A 3KEQA 2RNJA 3K9TA 1Z6RA 3R6SA 4EGYA 2MLKA 1T98A 2GA2A 2K27A 2K02A 3IL2A 3F3XA 5D4SA 2YR2A 5E1ZB 2VT3A 4A6DA 4KDPA 3VB2A 2RKHA 3BJOA 1DP7P 4LB5A 2DK8A 3Q5FA 4OINF 2R7FA 2L01A 1SMTA 3BPXA 5LGNA 1TNSA 2LF7A 5FO5A 3GZ6A 4OU0A 3JTGA 1UHWA 5FFXA 1XGNA 4BHCA 1SD5A 3WTZA 4MEXF 1YLFA 2H09A 2JPBA 4I0AA 2VE9A 3G3ZA 3QOPA 4IHSA 4A0XA 2QWWA 2M45A 1F4KA 1C0WA 3L7WA 4UNOA 5K5QA 2UWMA 1TW2A 4Y15A 4ESJA 1ODDA 2IA2A 4UUVA 4AIKA 2A6HF 2A6EF 1I6XA 3BP8A 1XSXA 1S3JA 3ELKA 5ERIA 2H6BA 4ZYDA 1BI3A 3FMQA 3KZZA 3RJPA 2OD5A 3FHZA 3E6CC 4MQVA 1T2KA 3IWFA 3LAJA 3WTWC 2CFXA 4N9IA 1DDNA 1IRGA 5DD8A 1O3TA 3PQJA 2DU9A 2VBXA 3I4PA 1FBQA 2FRHA 1UHMA 1Q1HA 5HDNA 3HUGA 5EEGA 1WSUA 3CLOA 3TDUC 2OAZA 3TDZC 3REOA 1FOKA 5LBQA 1E17A 1IF1A 5J8FA 1J59A 2QVOA 4YFKF 1BI2A 4Q5SF 1J9IA 4U7BA 3DEUA 1YIOA 1G3TA 3JTHA 1MJAA 4EJVA 2EV6A 3GO5A 3P9IA 2EFNA 3BJAA 3DPLC 2RGVA 4Z2YA 3IRQA 1U5TA 3WTVC 3I5UA 1PUEE 3GF2A 1LJ9A 3ZMSA 2FA5A 1FP1D 3GX4X 1R1UA 1BJAA 3KP2A 3FXUA 5D8LB 5A2QK 4HX4A 4PGHA 1ONVA 1XDUA 1UB9A 3HOTA 2JTVA 2ISZA 3JAMK 3IC7A 1JGSA 1ZRFA 3GVAA 1A04A 2PG4A 2VONA 2AXLA 3J81K 4XBFA 3T8RA 3CDHA 2LNBA 3N4MA 5BOXA 1E2XA 3DFGA 3ZMVA 1FNNA 5E17F 3E3VA 1WWXA 4S04A 3CO6C 3F8NA 2BBYA 5D6EA 5H6QA 1ZREA 1IXRC 1D8JA 2PBIA 4JQFA 1DUXC 4ENKA 2WC2A 3C18A 2GQQA 1ZLJA 1XSDA 2F5CA 4CICA 1FLIA 4HAMA 4BQAA 3SHFA 4L18B 3TO9A 1ZGAA 2K4BA 3ZMZA 2P4WA 4U7DA 1T6SA 3EYYA 2PI0A 1MJ9A 2QQAA 3E5XA 1UCRA 2E7XA 4YIIA 5E18F 4L0YB 4BH9A 3ISPA 5JFRA 1IZ1A 1KQ8A 3I0TA 4WCGA 1I1SA 3SZPA 2QBYB 1BC7C 1YW8A 2Q8KA 2D2WA 5E20A 2IA0A 4WXCA 2F5EA 2QENA 1LB2A 5F64A 1K6OA 2VODA 3GLXA 4GYIA 1ZLKA 4HX7A 1TQPA 3F8MA 1RUNA 1YYVA 4LJZF 4OMYA 2P6TA 1B9NA 1P92A 3MWMA 4CGZA 3M8FA 3PFIA 2WV0A 2Y48A 1FSEA 4LMYA 4KMUX 3VOEA 4CO8A 3RI4A 4MQ9F 4WXHA 1SD7A 2ZKZA 4KN4X 2D1HA 3R0JA 1NHAA 5JI6A 2HKXA 4ESFA 1HW2A 4RGRA 1LDKB 1IN5A 1ZHFA 2KKOA 1U2WA 4RGXA 4DQ2A 3HSRA 3GFIA 1R5GA 1YTYA 2HYGD 2ZXJA 1QZZA 5LHIA 1AWCA 2EV5A 2EFPA 4NB5A 2CW0F 3JSPA 1S29A 2X4HA 2AS5F 5CVVA 4RAZA 4U0VA 3F8CA 4I98B 2NS0A 1JXSA 1J7KA 2DQLA 1HSTA 5LLQA 2UZKA 5F6FA 2NAZA 1YS7A 4ZYGA 4BAYA 3WU0A 2ESNA 2WWYA 4HW0A 3HTUA 1BM9A 2UXNA 3DQVC 3CTAA 1SD6A 3P9CA 3TGNA 4CYDA 1JE8A 5K1YA 4ENMA 3EDPA 4PCQA 2FF4A 5H20A 1MDMA 2FOKA 5EEHA 4B09A 3LA7A 2PMUA 1EH6A 3WG9A 1S7OA 5CVIA 3TQNA 1XB4A 5HDGA 4O5VA 1I5ZA 3L2CA 2ZJ2A 2Z99A 3F8BA 3RYPA 1W7PA 1EV7A 1XMAA 2M87A 1U6GA 2P7VB 3RYRA 4M6YA 2OBPA 4EJUA 5ILVA 3CUQC 3RPUA 3EETA 4Y17A 3BWGA 5BS6A 3T1BA 1EH7A 3B02A 2KJCA 3ABTA 2COMA 2KIMA 2A3SA 3GWZA 1SMYF 3V8LA 3I59B 2WTEA 4HOBA 1U5TC 2HEOA 3VFZA 3GXOA 2OU2A 1H0MA 4KIFA 1W4MA 3FMSA 2IRFG 5LHGA 2HQRA 2MD5A 2JRTA 3ECHA 1OKRA 5D5VB 1XSVA 2FQ3A 4WX9A 4LD5A 4R1HA 3D5LA 3QPTA 2L3DA 4RB0A 5CVRA 3COAC 2OQGA 1R58A 2CG4A 1Z7UA 2ZNZA 5TJJA 3GEZA 4MNUA 3QU3A 2BGCA 5HLIA 2IPQX 4EM2A 4UVBA 1V3FA 5L3CA 2BV6A 5H6RA 2J5PA 3FF5A 4ETSA 4M71A 1WQ2A 1UFMA 3FM3A 1CGPA 4HV6A 2Q0OA 3ZPLA 1L3LA 2XUBA 4A12A 3HSEA 1IN8A 5HS9A 4CXFA 4L5JA 2DW4A 2J5OA 3C1DA 3MZHA 1HW1A 3F8FA 4UHTA 4LB6B 3QP5A 2HZTA 4HA8A 3U1DA 4R79A 2DBBA 2IT0A 1OYYA 5LGUA 3O6BB 4PDKA 1YFHA 1MKMA 2IVMA 1FC3A 1O3SA 4IXAA 3SFZA 1BI0A 1FP2A 4I01A 1XCVA 5HOOA 4IPAA 1Z91A 3WU1B 5BPDA 5E1XA 1QQIA 3HHHA 2XKPA 4M6XA 3BZ6A 3BOQA 2NRAC 2VN2A 1O7FA 4ZYEA 1IXSB 4U88A 3L00A 4HDVA 1LQ1A 5JVTA 1GXQA 5FLXZ 3HRMA 2V9VA 2O61A 3KE2A 2P5KA 5L3EA 1X3UA 2W57A 3IRRA 3CUQB 2P8TA 5BQTA 3WTSC 1BI1A 2H94A 4LG0B 4CDGA 4KT5C 1GHCA 3ZN1A 3QU6A 5CYVA 2VOOA 1I27A 4G6QA 4IRIA 3MZYA 5L3BA 4YIFA 2X0LA 4B8XA 3K0LA 2R3SA 2CSOA 3BROA 3M9AA 1W5TA 1IXCA 4Q47A 2EFOA 4MEYF 2ETHA 4HDUA 5DDGA 1QO0D 2LDUA 2A5YB 4UV8A 5ILUA 2YPRA 1WI9A 1Z05A 2HFHA 1STZA 1KU2A 2DT5A 4GCVA 4P5OA 5FD5A 2IJLA 1HKSA 2XRNA 3WGGA 2W85A 1FBUA 3I64A 4N9HA 5DCFA 2PEXA 1KU9A 1OPCA 1F1ZA 4RB2C 1J0RA 4MTEA 2BE5F 4JK1X 1Z1DA 3MEXA 2YX4A 2EFWA 1VTNC 1ZG1A 1LEBA 1IAWA 2FNPA 2A69F 1WRJA 2Z33A 3L09A 1LVAA 4I02A 2M8EA 4ESBA 3TKYA 2CGPA 5HDKA 1ZG3A 1B59A 4LLLA 5ICFA 4IVNA 4XLPF 3CJNA 3MQ0A 4G7ZF 3RIRA 2MC3A 4BHBA 1R7JA 3BDDA 3DV8A 3V8KA 3IKTA 3LWFA 3C3WA 3KZYA 2FXAA 4N0BA 2E7WA 3ZN0A 1U8RA 2DTRA 5FFZA 5KVRA 3LFKA 4HF1A 2HOEA 3E5QA 3GFLA 4L5IA 2DQRA 4A5MA 2ZMEB 2DO7A 3GFMA 3WE3A 3U9GA 2ZCWA 1KQ0A 4HLXA 5DCMB 1T38A 4ZZDA 3E5UA 2FMYA 4WF2A 4A6EA 3H3UA 3ZMTA 3HSFA 1RNLA 4UVAA 1R36A 1K7AA 1R1TA 1H9GA 5J8CA 1Y0UA 2JZYA 5IT9Z 1ZRDA 3Q9SA 3HHGA 2DFIA 3K69A 4P55A 2C6YA 2B0LA 3ZMDA 1HW5A 2STWA 1FBSA 2FBIA 2IW5A 3KP7A 3W6JB 4JBAA 4ENJA 2H27A 4HYEA 4U0WA 1R00A 4KMFA 4AWXB 4F7ZA 1RIOH 3NRVA 1K78A 5ILSA 1XGOA 3LQQA 2XGXA 3QP6A 3HRUA 2ZNYA 4BHPA 1S6LA 3PQKA 3B73A 3WODF 3R61A 4M9ZA 2VE8A 5JR3A 3EQLF 3HTSB 2QQ9A 3RKXA 5D5WB 1ZRCA 2QBYA 2P5VA 2A61A 1FSHA 3F6VA 5LRSA 2P5LC 3F6OA 2Z5UA 4ASNA 4ZZLA 5DUIA 3E6DA 2XAFA 2GXGA 3FXRA 3KEOA 1BBYA 3I71A 3ZMUA 3V7SA 2HQNA 4RGUA 4A2UA 3NEUA 4IHTA 1BN5A 4L9TA 5AIPA 4R8HA 3FX3A 2ELHA 1MJBA 2QUFA 1PP8F 5TRDA 1PDNC 4I0BA 3M1EA 3LAPA 2R7DA 2V1DA 1LEAA 1QBJA 2HGCA 2LF8A 3ML6A 3R0AA 4Q48A 3M8EA 4LGWA 1XD7A 2MA3A 2EV0A 1HKTA 2P6SA 3FXQA 1GVJA 1SFXA 1G4DA 3KFWX 3DP7A 2DPDA 4OIQF 2LKPA 2FBKA 3O3KA 5F1RA 4MHGA 4ZH4F 4HV5A 1CF7B 1V4RA 3VODA 2FU4A 4D0PA 2TDXA 3GZ5A 3MCZA 3KLOA 4OIPF 2IP2A 2JT1A 5LGTA 3HOSA 4HQEA 1T39A 3P7NA 4KA4A 1G3WA 1TQMA 5HLHA 4EQQA 5D5UB 4MTDA 4QWQA 5DD4A 2VXZA 4M72A 1DPUA 3V4GA 2PQ8A 4IRHA 1FPQA 3LA2A 3VEPA 1LNWA 1ON1A 1WKMA 3QRFF 1IUYA 4G6DA 4UVCA 3F72A 4FHTA 3NQOA 2L54A 2VC1A 5CVJA 3W6KB 2XASA 5K5RA 1ZG5A 2PN6A 4IF4A 2L4AA 2W84A 4LK1F 5D6FA 1HBXG 1R1VA 4O6JA 3I53A 2HR3A 1SFEA 2FBHA 4KN7X 2O8XA 1SD4A 4GGGA 5LRRA 4ON0A 2A07F 6PAXA 3ABUA 2Q2EA 1XDSA 1TBXA 4UV9A 4K2EA 1KQ9A 1F5TA 5CLSA 2HYFA 2L4MA 2F5FA 3SXYA 2G7HA 2DK5A 1S8NA 4EJWA 3ULQB 1GXPA 5L3DA 5DYMA 4EM1A 3WE2A 4I2OA 2GIVA 2XAQA 3SZTA 1SFUA 2PMHA 4WK8F 1KYZA 1R22A 4FX4A 3F21A 1G3SA 4YG2F 3V7CA 4P96A 3GUDA 1YW7A 2FNAA 5HVQC 4OOIA 2RN7A 1YO5C 1YQAA 3I59A 2XAGA 1HSJA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1ZYR F;  2VBZ A;  2DAO A;  4LFU A;  5AIQ A;  2PFB A;  4LLN A;  3IHU A;  4XLN F;  4A0Z A;  2K7L A;  3K2Z A;  1XGS A;  3FM5 A;  3BPV A;  1XGM A;  2BEO A;  2OA4 A;  1J2X A;  1YS6 A;  3WTY C;  4G8X A;  3RTR A;  4KUM A;  1RI7 A;  3KLN A;  4CHU A;  1L0O C;  2M30 A;  2W25 A;  5DEQ A;  2GA1 A;  4L0Z B;  2CO5 A;  1LDD A;  1JHF A;  4OIO F;  4G94 A;  1KGS A;  3U2R A;  4ENN A;  2PJP A;  5AON A;  2NNN A;  1ZAO A;  4FT8 A;  5D4R A;  2XRO A;  2VC0 A;  2GXB A;  4I7H A;  3TOB A;  4KNY A;  2M1B A;  4KIG A;  4RGS A;  1YG2 A;  2FE3 A;  4HZF A;  4QLC U;  1S7A A;  1I1G A;  2XKO A;  5E8I A;  4KIB A;  1TW3 A;  2LSO A;  4FX0 A;  3L9F A;  4NHJ A;  5ICE A;  3OV8 A;  1HKQ A;  1QPM A;  4EM0 B;  5ICG A;  2RV8 A;  3V8J A;  3S2W A;  5FLX K;  2UXX A;  4RB1 A;  4GO1 A;  1KU3 A;  2FSW A;  1BIB A;  1U5T B;  2ZFW A;  1ZH5 A;  1T0F A;  2Z9O A;  3BJ6 A;  2NNY A;  4DNC A;  5K5O A;  5D5X B;  1MGT A;  1O57 A;  1O7L A;  1PP7 U;  3Q9V A;  3EYI A;  4IRG A;  2K86 A;  1FYL A;  1ZGJ A;  2F2E A;  5D8K B;  2DPU A;  4L9N A;  5CVU A;  2RQP A;  3RKY A;  5ICC A;  3WGI A;  2FEZ A;  2D45 A;  1IN6 A;  1D8K A;  1QZY A;  3R4K A;  4I09 A;  2XIG A;  3E6M A;  3KP4 A;  2OZ6 A;  4U0Y A;  3LA3 A;  2E1C A;  3D0S A;  1EH8 A;  4L9V A;  4HF2 A;  1IW7 F;  4KFC A;  2KRF A;  3QPH A;  4HX8 A;  1AOY A;  3ERE D;  2XAH A;  3CUQ A;  1B1B A;  3C7J A;  4RS8 A;  4G9Y A;  4LG0 A;  3E6B A;  4HLY A;  4AIH A;  4AD9 A;  5LEK A;  3F22 A;  4PZJ A;  1RUO A;  3TOA A;  1OYW A;  4HBL A;  3OOP A;  1B6A A;  5FB2 A;  5A2Q Z;  3FZV A;  3JSO A;  1HQC A;  3JW4 A;  2QYO A;  3JAM Z;  1LDJ A;  3J81 Z;  1TNT A;  1BOA A;  1ON2 A;  1KA8 A;  3J7A O;  4H0E A;  4LK0 F;  1R23 A;  3DPT A;  1FT9 A;  1Z9C A;  2E1N A;  3DXJ F;  2O0Y A;  4EVI A;  3MAJ A;  4Y13 A;  2JSC A;  2EB7 A;  3K1P A;  3K1N A;  3KP6 A;  4WWC A;  2GWR A;  3R60 A;  1ULY A;  1G6N A;  1USS A;  1HXD A;  2W24 A;  4E70 A;  1U3E M;  3TO7 A;  4Q4Z F;  2QZ8 A;  1U78 A;  1W7P D;  3KP3 A;  1QGP A;  4RAY A;  4KIC A;  3DF8 A;  3RKW A;  3P9K A;  1OR7 A;  2ACJ A;  3WTX C;  5FD6 A;  4CZZ A;  1P4W A;  4L9J A;  4OIR F;  4YFX F;  2KIF A;  3J80 Z;  2EA4 A;  2KIU A;  2ISY A;  3HIF A;  1IN4 A;  1O3Q A;  2ZO4 A;  3GFJ A;  4MGR A;  2MLG A;  3SQN A;  4M9S A;  1R5H A;  3T8T A;  2HKO A;  3WTT C;  2PLY A;  3H3Z A;  1K78 B;  4PGG A;  3DKW A;  5DUK A;  3IKV A;  1FYM A;  2O3F A;  2QM3 A;  3J80 K;  1OYI A;  2ESH A;  4G7O F;  1D5V A;  4S05 A;  4A5N A;  3E97 A;  3LQR A;  5E1W A;  2IA1 A;  2MH2 A;  1TQI A;  1B4A A;  3O2P E;  1XMK A;  4P9F A;  1FZP B;  4YFN F;  5LEJ A;  5LHH A;  4LLG F;  1REP C;  2V1U A;  1P4A A;  2HS5 A;  4O3M A;  1J5Y A;  1P4X A;  2GZW A;  2HTJ A;  5IT9 K;  5BMZ A;  2STT A;  2OZU A;  2GAU A;  2P7C B;  3FWE A;  5L3F A;  1QNT A;  2MBF A;  4M74 A;  3HYI A;  1IRF A;  3RDI A;  2ZME A;  2EK5 A;  2V6C A;  2O6G E;  5DCM A;  2XV4 S;  2F5D A;  4EMS A;  2XVC A;  4EGZ A;  2HTS A;  3GW2 A;  4GYG A;  1MDM B;  2EA2 A;  3FMR A;  2RVC A;  4HF0 A;  3IWZ A;  4M73 A;  1D3Y A;  2Y75 A;  3I54 A;  3WGH A;  1W7P B;  5L3G A;  3GYH X;  4IJA A;  2Z3Y A;  2OQR A;  2XHK A;  5KK1 A;  2D1V A;  3EUH A;  1XCB A;  4AVP A;  3H92 A;  5JHU A;  2M5W A;  2CWE A;  1FX7 A;  5IT3 A;  2QLZ A;  3T0Y A;  3WTU C;  4HQM A;  1O3R A;  2MH9 A;  3ZP5 A;  5J6X A;  3ZQ7 A;  3KET A;  1Z6T A;  3HRT A;  2A68 F;  3RPQ A;  4XRF A;  1DPR A;  3LST A;  3M7G A;  3ECO A;  1ZN2 A;  2ADU A;  1RZ4 A;  2FML A;  1OMI A;  3KCC A;  2QQB A;  2JPC A;  1KU7 A;  4XSX F;  1JHH A;  2CYY A;  2V79 A;  4KYW A;  2XAJ A;  2EWN A;  4P9U A;  1BIA A;  2CQK A;  2YU3 A;  5HS8 A;  1TTY A;  3KP5 A;  5FGM A;  3BY6 A;  2VT2 A;  4ZYH A;  1W5S A;  1KYW A;  1YW9 A;  2H6C A;  1H9T A;  1K79 A;  5ED4 A;  3HRS A;  5HS7 A;  2Y0M A;  1ZAR A;  3QAH A;  4EV0 A;  5E8G A;  3F23 A;  3ROU A;  1MZB A;  3G73 A;  2YSR A;  2VBW A;  4WXD A;  1F9N A;  2V1X A;  1BC8 C;  1TLH B;  2KJB A;  2VBY A;  1FYK A;  2RC4 A;  1B9M A;  1P2F A;  1IN7 A;  3TO6 A;  4EJO A;  2HDC A;  2G9W A;  4G7H F;  4BYY A;  5CJ9 A;  2EFQ A;  2K4J A;  2DLL A;  4UXN A;  3CUO A;  4OMZ A;  2HWV A;  4XSZ F;  2RDP A;  5HLG A;  3MFK A;  1FWZ A;  1MD0 A;  3N97 A;  4TV7 A;  2ZBK A;  4BNC A;  5DV5 A;  1UST A;  2VOP A;  4M9X A;  2YX7 A;  2NYX A;  3T5X A;  4GXO A;  1J75 A;  2BYV E;  2G7U A;  2O03 A;  1CF7 A;  4A0Y A;  1SAX A;  4EJT A;  3K1M A;  1G3Y A;  3CO7 C;  4RB3 C;  1FY7 A;  1P6R A;  2EJR A;  4AIJ A;  4NQW A;  3AAF A;  4BXU A;  3I58 A;  1XN7 A;  3V7R A;  2DI3 A;  5BPI A;  2L02 A;  3KEQ A;  2RNJ A;  3K9T A;  1Z6R A;  3R6S A;  4EGY A;  2MLK A;  1T98 A;  2GA2 A;  2K27 A;  2K02 A;  3IL2 A;  3F3X A;  5D4S A;  2YR2 A;  5E1Z B;  2VT3 A;  4A6D A;  4KDP A;  3VB2 A;  2RKH A;  3BJO A;  1DP7 P;  4LB5 A;  2DK8 A;  3Q5F A;  4OIN F;  2R7F A;  2L01 A;  1SMT A;  3BPX A;  5LGN A;  1TNS A;  2LF7 A;  5FO5 A;  3GZ6 A;  4OU0 A;  3JTG A;  1UHW A;  5FFX A;  1XGN A;  4BHC A;  1SD5 A;  3WTZ A;  4MEX F;  1YLF A;  2H09 A;  2JPB A;  4I0A A;  2VE9 A;  3G3Z A;  3QOP A;  4IHS A;  4A0X A;  2QWW A;  2M45 A;  1F4K A;  1C0W A;  3L7W A;  4UNO A;  5K5Q A;  2UWM A;  1TW2 A;  4Y15 A;  4ESJ A;  1ODD A;  2IA2 A;  4UUV A;  4AIK A;  2A6H F;  2A6E F;  1I6X A;  3BP8 A;  1XSX A;  1S3J A;  3ELK A;  5ERI A;  2H6B A;  4ZYD A;  1BI3 A;  3FMQ A;  3KZZ A;  3RJP A;  2OD5 A;  3FHZ A;  3E6C C;  4MQV A;  1T2K A;  3IWF A;  3LAJ A;  3WTW C;  2CFX A;  4N9I A;  1DDN A;  1IRG A;  5DD8 A;  1O3T A;  3PQJ A;  2DU9 A;  2VBX A;  3I4P A;  1FBQ A;  2FRH A;  1UHM A;  1Q1H A;  5HDN A;  3HUG A;  5EEG A;  1WSU A;  3CLO A;  3TDU C;  2OAZ A;  3TDZ C;  3REO A;  1FOK A;  5LBQ A;  1E17 A;  1IF1 A;  5J8F A;  1J59 A;  2QVO A;  4YFK F;  1BI2 A;  4Q5S F;  1J9I A;  4U7B A;  3DEU A;  1YIO A;  1G3T A;  3JTH A;  1MJA A;  4EJV A;  2EV6 A;  3GO5 A;  3P9I A;  2EFN A;  3BJA A;  3DPL C;  2RGV A;  4Z2Y A;  3IRQ A;  1U5T A;  3WTV C;  3I5U A;  1PUE E;  3GF2 A;  1LJ9 A;  3ZMS A;  2FA5 A;  1FP1 D;  3GX4 X;  1R1U A;  1BJA A;  3KP2 A;  3FXU A;  5D8L B;  5A2Q K;  4HX4 A;  4PGH A;  1ONV A;  1XDU A;  1UB9 A;  3HOT A;  2JTV A;  2ISZ A;  3JAM K;  3IC7 A;  1JGS A;  1ZRF A;  3GVA A;  1A04 A;  2PG4 A;  2VON A;  2AXL A;  3J81 K;  4XBF A;  3T8R A;  3CDH A;  2LNB A;  3N4M A;  5BOX A;  1E2X A;  3DFG A;  3ZMV A;  1FNN A;  5E17 F;  3E3V A;  1WWX A;  4S04 A;  3CO6 C;  3F8N A;  2BBY A;  5D6E A;  5H6Q A;  1ZRE A;  1IXR C;  1D8J A;  2PBI A;  4JQF A;  1DUX C;  4ENK A;  2WC2 A;  3C18 A;  2GQQ A;  1ZLJ A;  1XSD A;  2F5C A;  4CIC A;  1FLI A;  4HAM A;  4BQA A;  3SHF A;  4L18 B;  3TO9 A;  1ZGA A;  2K4B A;  3ZMZ A;  2P4W A;  4U7D A;  1T6S A;  3EYY A;  2PI0 A;  1MJ9 A;  2QQA A;  3E5X A;  1UCR A;  2E7X A;  4YII A;  5E18 F;  4L0Y B;  4BH9 A;  3ISP A;  5JFR A;  1IZ1 A;  1KQ8 A;  3I0T A;  4WCG A;  1I1S A;  3SZP A;  2QBY B;  1BC7 C;  1YW8 A;  2Q8K A;  2D2W A;  5E20 A;  2IA0 A;  4WXC A;  2F5E A;  2QEN A;  1LB2 A;  5F64 A;  1K6O A;  2VOD A;  3GLX A;  4GYI A;  1ZLK A;  4HX7 A;  1TQP A;  3F8M A;  1RUN A;  1YYV A;  4LJZ F;  4OMY A;  2P6T A;  1B9N A;  1P92 A;  3MWM A;  4CGZ A;  3M8F A;  3PFI A;  2WV0 A;  2Y48 A;  1FSE A;  4LMY A;  4KMU X;  3VOE A;  4CO8 A;  3RI4 A;  4MQ9 F;  4WXH A;  1SD7 A;  2ZKZ A;  4KN4 X;  2D1H A;  3R0J A;  1NHA A;  5JI6 A;  2HKX A;  4ESF A;  1HW2 A;  4RGR A;  1LDK B;  1IN5 A;  1ZHF A;  2KKO A;  1U2W A;  4RGX A;  4DQ2 A;  3HSR A;  3GFI A;  1R5G A;  1YTY A;  2HYG D;  2ZXJ A;  1QZZ A;  5LHI A;  1AWC A;  2EV5 A;  2EFP A;  4NB5 A;  2CW0 F;  3JSP A;  1S29 A;  2X4H A;  2AS5 F;  5CVV A;  4RAZ A;  4U0V A;  3F8C A;  4I98 B;  2NS0 A;  1JXS A;  1J7K A;  2DQL A;  1HST A;  5LLQ A;  2UZK A;  5F6F A;  2NAZ A;  1YS7 A;  4ZYG A;  4BAY A;  3WU0 A;  2ESN A;  2WWY A;  4HW0 A;  3HTU A;  1BM9 A;  2UXN A;  3DQV C;  3CTA A;  1SD6 A;  3P9C A;  3TGN A;  4CYD A;  1JE8 A;  5K1Y A;  4ENM A;  3EDP A;  4PCQ A;  2FF4 A;  5H20 A;  1MDM A;  2FOK A;  5EEH A;  4B09 A;  3LA7 A;  2PMU A;  1EH6 A;  3WG9 A;  1S7O A;  5CVI A;  3TQN A;  1XB4 A;  5HDG A;  4O5V A;  1I5Z A;  3L2C A;  2ZJ2 A;  2Z99 A;  3F8B A;  3RYP A;  1W7P A;  1EV7 A;  1XMA A;  2M87 A;  1U6G A;  2P7V B;  3RYR A;  4M6Y A;  2OBP A;  4EJU A;  5ILV A;  3CUQ C;  3RPU A;  3EET A;  4Y17 A;  3BWG A;  5BS6 A;  3T1B A;  1EH7 A;  3B02 A;  2KJC A;  3ABT A;  2COM A;  2KIM A;  2A3S A;  3GWZ A;  1SMY F;  3V8L A;  3I59 B;  2WTE A;  4HOB A;  1U5T C;  2HEO A;  3VFZ A;  3GXO A;  2OU2 A;  1H0M A;  4KIF A;  1W4M A;  3FMS A;  2IRF G;  5LHG A;  2HQR A;  2MD5 A;  2JRT A;  3ECH A;  1OKR A;  5D5V B;  1XSV A;  2FQ3 A;  4WX9 A;  4LD5 A;  4R1H A;  3D5L A;  3QPT A;  2L3D A;  4RB0 A;  5CVR A;  3COA C;  2OQG A;  1R58 A;  2CG4 A;  1Z7U A;  2ZNZ A;  5TJJ A;  3GEZ A;  4MNU A;  3QU3 A;  2BGC A;  5HLI A;  2IPQ X;  4EM2 A;  4UVB A;  1V3F A;  5L3C A;  2BV6 A;  5H6R A;  2J5P A;  3FF5 A;  4ETS A;  4M71 A;  1WQ2 A;  1UFM A;  3FM3 A;  1CGP A;  4HV6 A;  2Q0O A;  3ZPL A;  1L3L A;  2XUB A;  4A12 A;  3HSE A;  1IN8 A;  5HS9 A;  4CXF A;  4L5J A;  2DW4 A;  2J5O A;  3C1D A;  3MZH A;  1HW1 A;  3F8F A;  4UHT A;  4LB6 B;  3QP5 A;  2HZT A;  4HA8 A;  3U1D A;  4R79 A;  2DBB A;  2IT0 A;  1OYY A;  5LGU A;  3O6B B;  4PDK A;  1YFH A;  1MKM A;  2IVM A;  1FC3 A;  1O3S A;  4IXA A;  3SFZ A;  1BI0 A;  1FP2 A;  4I01 A;  1XCV A;  5HOO A;  4IPA A;  1Z91 A;  3WU1 B;  5BPD A;  5E1X A;  1QQI A;  3HHH A;  2XKP A;  4M6X A;  3BZ6 A;  3BOQ A;  2NRA C;  2VN2 A;  1O7F A;  4ZYE A;  1IXS B;  4U88 A;  3L00 A;  4HDV A;  1LQ1 A;  5JVT A;  1GXQ A;  5FLX Z;  3HRM A;  2V9V A;  2O61 A;  3KE2 A;  2P5K A;  5L3E A;  1X3U A;  2W57 A;  3IRR A;  3CUQ B;  2P8T A;  5BQT A;  3WTS C;  1BI1 A;  2H94 A;  4LG0 B;  4CDG A;  4KT5 C;  1GHC A;  3ZN1 A;  3QU6 A;  5CYV A;  2VOO A;  1I27 A;  4G6Q A;  4IRI A;  3MZY A;  5L3B A;  4YIF A;  2X0L A;  4B8X A;  3K0L A;  2R3S A;  2CSO A;  3BRO A;  3M9A A;  1W5T A;  1IXC A;  4Q47 A;  2EFO A;  4MEY F;  2ETH A;  4HDU A;  5DDG A;  1QO0 D;  2LDU A;  2A5Y B;  4UV8 A;  5ILU A;  2YPR A;  1WI9 A;  1Z05 A;  2HFH A;  1STZ A;  1KU2 A;  2DT5 A;  4GCV A;  4P5O A;  5FD5 A;  2IJL A;  1HKS A;  2XRN A;  3WGG A;  2W85 A;  1FBU A;  3I64 A;  4N9H A;  5DCF A;  2PEX A;  1KU9 A;  1OPC A;  1F1Z A;  4RB2 C;  1J0R A;  4MTE A;  2BE5 F;  4JK1 X;  1Z1D A;  3MEX A;  2YX4 A;  2EFW A;  1VTN C;  1ZG1 A;  1LEB A;  1IAW A;  2FNP A;  2A69 F;  1WRJ A;  2Z33 A;  3L09 A;  1LVA A;  4I02 A;  2M8E A;  4ESB A;  3TKY A;  2CGP A;  5HDK A;  1ZG3 A;  1B59 A;  4LLL A;  5ICF A;  4IVN A;  4XLP F;  3CJN A;  3MQ0 A;  4G7Z F;  3RIR A;  2MC3 A;  4BHB A;  1R7J A;  3BDD A;  3DV8 A;  3V8K A;  3IKT A;  3LWF A;  3C3W A;  3KZY A;  2FXA A;  4N0B A;  2E7W A;  3ZN0 A;  1U8R A;  2DTR A;  5FFZ A;  5KVR A;  3LFK A;  4HF1 A;  2HOE A;  3E5Q A;  3GFL A;  4L5I A;  2DQR A;  4A5M A;  2ZME B;  2DO7 A;  3GFM A;  3WE3 A;  3U9G A;  2ZCW A;  1KQ0 A;  4HLX A;  5DCM B;  1T38 A;  4ZZD A;  3E5U A;  2FMY A;  4WF2 A;  4A6E A;  3H3U A;  3ZMT A;  3HSF A;  1RNL A;  4UVA A;  1R36 A;  1K7A A;  1R1T A;  1H9G A;  5J8C A;  1Y0U A;  2JZY A;  5IT9 Z;  1ZRD A;  3Q9S A;  3HHG A;  2DFI A;  3K69 A;  4P55 A;  2C6Y A;  2B0L A;  3ZMD A;  1HW5 A;  2STW A;  1FBS A;  2FBI A;  2IW5 A;  3KP7 A;  3W6J B;  4JBA A;  4ENJ A;  2H27 A;  4HYE A;  4U0W A;  1R00 A;  4KMF A;  4AWX B;  4F7Z A;  1RIO H;  3NRV A;  1K78 A;  5ILS A;  1XGO A;  3LQQ A;  2XGX A;  3QP6 A;  3HRU A;  2ZNY A;  4BHP A;  1S6L A;  3PQK A;  3B73 A;  3WOD F;  3R61 A;  4M9Z A;  2VE8 A;  5JR3 A;  3EQL F;  3HTS B;  2QQ9 A;  3RKX A;  5D5W B;  1ZRC A;  2QBY A;  2P5V A;  2A61 A;  1FSH A;  3F6V A;  5LRS A;  2P5L C;  3F6O A;  2Z5U A;  4ASN A;  4ZZL A;  5DUI A;  3E6D A;  2XAF A;  2GXG A;  3FXR A;  3KEO A;  1BBY A;  3I71 A;  3ZMU A;  3V7S A;  2HQN A;  4RGU A;  4A2U A;  3NEU A;  4IHT A;  1BN5 A;  4L9T A;  5AIP A;  4R8H A;  3FX3 A;  2ELH A;  1MJB A;  2QUF A;  1PP8 F;  5TRD A;  1PDN C;  4I0B A;  3M1E A;  3LAP A;  2R7D A;  2V1D A;  1LEA A;  1QBJ A;  2HGC A;  2LF8 A;  3ML6 A;  3R0A A;  4Q48 A;  3M8E A;  4LGW A;  1XD7 A;  2MA3 A;  2EV0 A;  1HKT A;  2P6S A;  3FXQ A;  1GVJ A;  1SFX A;  1G4D A;  3KFW X;  3DP7 A;  2DPD A;  4OIQ F;  2LKP A;  2FBK A;  3O3K A;  5F1R A;  4MHG A;  4ZH4 F;  4HV5 A;  1CF7 B;  1V4R A;  3VOD A;  2FU4 A;  4D0P A;  2TDX A;  3GZ5 A;  3MCZ A;  3KLO A;  4OIP F;  2IP2 A;  2JT1 A;  5LGT A;  3HOS A;  4HQE A;  1T39 A;  3P7N A;  4KA4 A;  1G3W A;  1TQM A;  5HLH A;  4EQQ A;  5D5U B;  4MTD A;  4QWQ A;  5DD4 A;  2VXZ A;  4M72 A;  1DPU A;  3V4G A;  2PQ8 A;  4IRH A;  1FPQ A;  3LA2 A;  3VEP A;  1LNW A;  1ON1 A;  1WKM A;  3QRF F;  1IUY A;  4G6D A;  4UVC A;  3F72 A;  4FHT A;  3NQO A;  2L54 A;  2VC1 A;  5CVJ A;  3W6K B;  2XAS A;  5K5R A;  1ZG5 A;  2PN6 A;  4IF4 A;  2L4A A;  2W84 A;  4LK1 F;  5D6F A;  1HBX G;  1R1V A;  4O6J A;  3I53 A;  2HR3 A;  1SFE A;  2FBH A;  4KN7 X;  2O8X A;  1SD4 A;  4GGG A;  5LRR A;  4ON0 A;  2A07 F;  6PAX A;  3ABU A;  2Q2E A;  1XDS A;  1TBX A;  4UV9 A;  4K2E A;  1KQ9 A;  1F5T A;  5CLS A;  2HYF A;  2L4M A;  2F5F A;  3SXY A;  2G7H A;  2DK5 A;  1S8N A;  4EJW A;  3ULQ B;  1GXP A;  5L3D A;  5DYM A;  4EM1 A;  3WE2 A;  4I2O A;  2GIV A;  2XAQ A;  3SZT A;  1SFU A;  2PMH A;  4WK8 F;  1KYZ A;  1R22 A;  4FX4 A;  3F21 A;  1G3S A;  4YG2 F;  3V7C A;  4P96 A;  3GUD A;  1YW7 A;  2FNA A;  5HVQ C;  4OOI A;  2RN7 A;  1YO5 C;  1YQA A;  3I59 A;  2XAG A;  1HSJ A; 
#chains in the Genus database with same CATH topology
 1ZYR F;  2ZSH B;  2VBZ A;  2BHY A;  1U9N A;  4BQN A;  5DM6 F;  2DAO A;  4LFU A;  5AIQ A;  2PFB A;  3G6E I;  4LLN A;  1ETY A;  3IHU A;  4XLN F;  2ZC2 A;  3HBL A;  4A0Z A;  2AHQ A;  2K7L A;  3K2Z A;  1XGS A;  3FM5 A;  3BPV A;  2ID6 A;  3KYC B;  3AL0 B;  3FXK A;  1XGM A;  2BEO A;  2OA4 A;  1QRY A;  2Y9Y A;  1RET A;  3LSG A;  1J2X A;  1YS6 A;  1Z3Y A;  3WTY C;  2E2I J;  1JT6 A;  4G8X A;  1N78 A;  3CMA I;  2LR8 A;  4C3J J;  3JRH A;  3RTR A;  4KUM A;  1RI7 A;  4FIS A;  3RKQ A;  1CQT A;  4HG2 A;  3KLN A;  4CHU A;  1L0O C;  2ID3 A;  1WH7 A;  2M30 A;  2W25 A;  5DEQ A;  2GA1 A;  4L0Z B;  2DFF A;  1ZR2 A;  1Y56 A;  2CO5 A;  1LDD A;  1JHF A;  4OIO F;  4U87 A;  4G94 A;  1KGS A;  3U2R A;  3G1O A;  4ENN A;  3HOY J;  2PJP A;  2HU9 A;  5IP6 A;  2JQ7 A;  4ANJ A;  1OFC X;  3OYA A;  5AON A;  2NNN A;  1ZAO A;  1OIS A;  4FT8 A;  5D4R A;  2VC0 A;  2XRO A;  3CLQ A;  2HI3 A;  2XPW A;  5IYD J;  2E36 A;  2ECC A;  4BDZ A;  2GXB A;  4I7H A;  3TOB A;  4KNY A;  1J09 A;  5GPA A;  1Y8R B;  1VQ9 I;  2M1B A;  2GXA A;  3HUG B;  2XF6 A;  3RSN A;  4KIG A;  4RGS A;  1YG2 A;  2FE3 A;  2KPM A;  1WH5 A;  4HZF A;  4QLC U;  1S7A A;  1BJZ A;  5J1U A;  1K4T A;  5E3O A;  4AU7 A;  5E3N A;  1Z3X A;  1MH3 A;  1I1G A;  2XKO A;  1Y1V J;  3JRD A;  1MBK A;  5E8I A;  4KIB A;  2VKD A;  1TW3 A;  2LSO A;  2DMP A;  4FX0 A;  3L9F A;  4NHJ A;  5GAD J;  1JUM A;  5ICE A;  3S14 J;  3OV8 A;  1HKQ A;  1QPM A;  3IH4 A;  3JR9 A;  4BE2 A;  3GTM J;  4CA0 A;  1X19 A;  4EM0 B;  5ICG A;  2RV8 A;  3V8J A;  3S2W A;  2YUS A;  2FQ4 A;  4E7J A;  1JUP A;  2H8R A;  5FLX K;  2UXX A;  3EUK L;  4RB1 A;  1ITY A;  1WJE A;  2WAE A;  4XOT A;  3CD6 I;  4HRI A;  4GO1 A;  2XF7 A;  1KU3 A;  3TP3 A;  2FSW A;  1BIB A;  5HNH A;  2K9Q A;  1U5T B;  2ZFW A;  3WHC A;  4B4C A;  1ZH5 A;  1T0F A;  3AFH A;  3MKZ A;  5K7H A;  2Y31 A;  4M3G A;  2Z9O A;  3BJ6 A;  2NNY A;  4DNC A;  1E3H A;  5DTD A;  1NTC A;  5K5O A;  5D5X B;  2M7A A;  1MGT A;  1O57 A;  1O7L A;  2HDW A;  1PP7 U;  1MSF C;  4D7M A;  3Q9V A;  3KEY A;  3EYI A;  1SVO A;  3H5N A;  3FXL A;  4IRG A;  3PSF A;  2K86 A;  4X6A J;  5LFA A;  2WV1 A;  3OR1 C;  1ZGJ A;  2X1E A;  2F2E A;  5D8K B;  2FOW A;  4L9N A;  5CVU A;  1FYL A;  1H8A C;  2DPU A;  2RQP A;  3RKY A;  5ICC A;  3WGI A;  2FEZ A;  2D45 A;  1SFO J;  1IN6 A;  1D8K A;  1QZY A;  1MW7 A;  3QWL A;  3R4K A;  4I09 A;  3OYI A;  2XIG A;  3E6M A;  3KP4 A;  2OZ6 A;  4JOM A;  3LA3 A;  4U0Y A;  2IS4 A;  2E1C A;  3D0S A;  1EH8 A;  1VND A;  3GME A;  2L0K A;  2QA4 I;  4L9V A;  4Y33 A;  2K9L A;  2LBF A;  2XGC A;  4HF2 A;  5EG0 B;  1VZ0 A;  1W0T A;  1IW7 F;  2WAQ N;  1AKH B;  4KFC A;  4IZZ A;  2KRF A;  3QPH A;  4HX8 A;  1AOY A;  2CFO A;  1BA5 A;  3BR5 A;  3SFI A;  3ERE D;  1HCR A;  2XAH A;  2DDA A;  2Z16 A;  3CUQ A;  1B1B A;  2CQ7 A;  5FRM A;  3OYE A;  4BE0 A;  3C7J A;  4PSX A;  4RS8 A;  1ZGW A;  1B72 A;  4G9Y A;  5IY5 H;  4LG0 A;  3E6B A;  1OLT A;  4N4N B;  2OCC H;  2PX9 A;  2MG4 A;  5E79 C;  4AIH A;  4HLY A;  3HJE A;  4AD9 A;  5BNG A;  5LEK A;  3F22 A;  4PZJ A;  1RUO A;  3TOA A;  1OYW A;  4HBL A;  3OOP A;  3QQA A;  3BQZ A;  1B6A A;  1SEU A;  4C3H J;  4BGD A;  1IDY A;  5FB2 A;  3C2B A;  1H89 C;  2DA4 A;  5A2Q Z;  3FZV A;  3JSO A;  1HQC A;  2IEK A;  3JW4 A;  1R71 A;  3OYH A;  2W7N A;  2QYO A;  1D1B A;  3W2W A;  3JAM Z;  3FKJ A;  1MMS A;  1X1P A;  1LDJ A;  3J81 Z;  1TNT A;  1BOA A;  1ON2 A;  4IX7 A;  1KA8 A;  4HSR A;  3J7A O;  2K3P A;  4H0E A;  2EZL A;  4LK0 F;  1R23 A;  4CCO A;  3DPT A;  5C44 J;  2EZH A;  4Z6Y A;  3HOX J;  1FT9 A;  1Z9C A;  2QGU A;  2UUZ A;  3NWS A;  1FIA A;  2E1N A;  3S1M J;  1FOX A;  2DYR H;  5FKM A;  1LE8 B;  3DXJ F;  4EAT A;  2O0Y A;  2QF7 A;  1HF0 A;  2QCO A;  4EVI A;  3MAJ A;  2VPR A;  4Y13 A;  1T95 A;  2JSC A;  3TMO A;  5J4V A;  1VQO I;  2EB7 A;  1YRN B;  3BTJ A;  3K1P A;  1T56 A;  4NC7 A;  3K1N A;  5C4X J;  5HLT A;  3KP6 A;  3MZ8 A;  4WWC A;  1X2N A;  2GWR A;  3DEE A;  3HGY A;  3R60 A;  2V1N A;  1ULY A;  1G6N A;  1USS A;  1G2H A;  4XON A;  1HXD A;  2W24 A;  3FIS A;  4E70 A;  3H35 A;  1TC3 C;  3PJR A;  1U3E M;  1D5Y A;  4CYC B;  1MH4 A;  3TO7 A;  4Q4Z F;  2QZ8 A;  1U78 A;  3G4S I;  4I76 A;  1W7P D;  4QIW N;  3IP4 B;  1EA3 A;  1M1E B;  4ZTJ A;  3KP3 A;  1QGP A;  3G1M A;  4KIC A;  4RAY A;  3DF8 A;  3RKW A;  4IHX A;  3P9K A;  3DKX A;  2VXD A;  1OR7 A;  3RCO A;  2ACJ A;  3WTX C;  5FD6 A;  4CZZ A;  1P4W A;  5EGO B;  4L9J A;  3OR2 C;  4OIR F;  4YFX F;  2KIF A;  3J80 Z;  3CJR B;  2GOM A;  2EA4 A;  3RPU D;  2KIU A;  2ISY A;  3HIF A;  1IN4 A;  3J7Y J;  3D1N I;  1O3Q A;  2ZO4 A;  3GFJ A;  4MGR A;  3K4L A;  2MLG A;  3SQN A;  5EJC A;  4M9S A;  1R5H A;  3T8T A;  5H2F C;  1SC7 A;  1AHD P;  3SEQ A;  2JVG A;  2HKO A;  3WTT C;  2CQX A;  2PLY A;  3H3Z A;  3CP8 A;  1K78 B;  4PGG A;  4QSH A;  1OCZ H;  3LNQ A;  3MMY B;  3DKW A;  5DUK A;  3IKV A;  1FYM A;  5F27 A;  1YX5 A;  5J1Y A;  4J00 A;  2LVS A;  3L2V A;  1E3P A;  2I5U A;  2O3F A;  2QM3 A;  5EDN A;  3J80 K;  2R7V A;  3LSK A;  3WU2 C;  1OYI A;  4BXF A;  3AG2 H;  3H0G J;  2NXN B;  3FXJ A;  2ESH A;  1WI3 A;  4G7O F;  1OCP A;  1D5V A;  4S05 A;  4A5N A;  4BAC A;  2F6C A;  3E97 A;  1FTT A;  3LQR A;  3OS1 A;  5E1W A;  2IA1 A;  2MH2 A;  1TQI A;  2BXZ A;  4RLF A;  1B4A A;  3O2P E;  5FRN A;  2VAS A;  4PK4 A;  1XMK A;  4KJZ A;  4P9F A;  4YRV A;  3H0D A;  1FZP B;  1T8I A;  4YFN F;  2VLA A;  5LEJ A;  5LHH A;  2LY9 A;  2AQF A;  3F9K A;  2LY1 A;  4LLG F;  2DOF A;  1REP C;  3VSL A;  4RBO A;  2V1U A;  1P4A A;  2HS5 A;  2E35 A;  4IHV A;  2L7Z A;  1ZR4 A;  3CCE I;  2OPT A;  4O3M A;  1J5Y A;  1P4X A;  2GZW A;  2HTJ A;  5IT9 K;  2LY2 A;  5BMZ A;  2STT A;  2OZU A;  2GAU A;  2P7C B;  2AXT C;  5EZH A;  3FWE A;  3B6C A;  5L3F A;  4BKX A;  1IDZ A;  1QNT A;  2WAF A;  2MBF A;  5FKN A;  4M74 A;  3HYI A;  1IRF A;  2HOS A;  3RDI A;  3H5R A;  2ZME A;  3VSK A;  2EK5 A;  1GV5 A;  2M34 A;  5B66 C;  2V6C A;  3BR3 A;  1MBG A;  2O6G E;  5DCM A;  2XV4 S;  2F5D A;  4EMS A;  3K4K A;  4IHY A;  2XVC A;  2Y0S A;  4EGZ A;  3DKY A;  2HTS A;  3GW2 A;  4GYG A;  4GRI A;  2R7W A;  4F92 B;  1MDM B;  2EA2 A;  4LIT A;  2KQR A;  3FMR A;  3S15 J;  3HEF A;  2RVC A;  4HF0 A;  3IWZ A;  2HZD A;  5B5E C;  4M73 A;  1D3Y A;  2Y75 A;  2XB0 X;  2KZV A;  3CC4 I;  2PJR A;  4M3E A;  1ZTR A;  3AG4 H;  3I54 A;  3WGH A;  4CUG A;  3QOD A;  1W7P B;  5L3G A;  4IHW A;  3DBH B;  2ELJ A;  3GYH X;  3U21 A;  3JRG A;  4IJA A;  2Z3Y A;  2WBM A;  2OQR A;  3DWL E;  2XHK A;  2DOE A;  3OIO A;  5KK1 A;  2D1V A;  4DOZ A;  1HC8 A;  2KT0 A;  3EUH A;  9ANT A;  1XCB A;  4AVP A;  3H92 A;  1PJR A;  5JHU A;  2G0E A;  2M5W A;  2CWE A;  3UR3 C;  4BXX J;  4UY8 I;  3FDY A;  1FX7 A;  5IT3 A;  1ZQ3 P;  2QLZ A;  1LPQ A;  3E1S A;  1JJ6 C;  3T0Y A;  3A2K A;  3HL2 A;  3WTU C;  4HQM A;  4V2F A;  2L9N A;  1O3R A;  2MH9 A;  3B6A A;  5J6X A;  3ZQ7 A;  1ZKG A;  3KET A;  3ZP5 A;  3OYF A;  3I4M J;  3N05 A;  1LKX A;  1YIT I;  1DU0 A;  1S5L C;  1Z6T A;  3HRT A;  2A68 F;  2EIM H;  3RPQ A;  3A1Y A;  4XRF A;  1DPR A;  3LST A;  3M7G A;  2VPL A;  1PVE A;  3ECO A;  1ZN2 A;  4XKW A;  3QOE A;  2ADU A;  1RC9 A;  5JLX A;  1RZ4 A;  1X1B A;  3BR1 A;  2FML A;  1OMI A;  3KCC A;  1T0F C;  2QQB A;  2JPC A;  1VFC A;  4XSX F;  1KU7 A;  4V2G A;  1JHH A;  1IUF A;  2M2E A;  4FE7 A;  2CYY A;  2V79 A;  1TWF J;  4C9Y A;  2EZI A;  4KYW A;  2XAJ A;  2EWN A;  1VQL I;  4P9U A;  1TWG J;  4IQ4 A;  1MMA A;  2KHM A;  1HDD C;  1BIA A;  2CQK A;  1X1D A;  5DM7 F;  3ZQL A;  2YU3 A;  5HS8 A;  2Z1D A;  2BY1 A;  1MNM C;  1TTY A;  4HNV A;  3KP5 A;  5FGM A;  2XSJ C;  3BY6 A;  1K4S A;  2VT2 A;  2EPF A;  2QKM B;  3J7A Y;  4ZYH A;  1W5S A;  4BDY A;  1KYW A;  1YW9 A;  2H6C A;  3JRA A;  2R5Z A;  1H9T A;  2Y9Z A;  1K79 A;  5ED4 A;  1B8I A;  1HDP A;  1TP4 A;  3HRS A;  5HS7 A;  2E5N A;  2EIL H;  2Y0M A;  1R5I D;  1ZAR A;  4I6Z A;  2X6Y A;  3QAH A;  4EV0 A;  2DXI A;  5E8G A;  3F23 A;  3ROU A;  2CW7 A;  2OF7 A;  3A4C A;  1MZB A;  3CJQ B;  3P5J A;  3G73 A;  4AC0 A;  2YSR A;  2VBW A;  3H5A A;  4WXD A;  1F9N A;  2V1X A;  2BHZ A;  4S0H B;  1BC8 C;  2WB1 N;  5IOZ A;  2M8G X;  3CZ6 A;  2R7T A;  4IQJ A;  3CMY A;  4XOR A;  1TLH B;  3DEW A;  2KJB A;  2VBY A;  1FYK A;  3PIO F;  2RC4 A;  5J1R A;  1XS9 A;  1QHH D;  1B9M A;  1P2F A;  3D5S C;  3MD2 A;  4C2U A;  3PL8 A;  3VDX A;  1IN7 A;  3TO6 A;  4EJO A;  5E3M A;  2HDC A;  2KL4 A;  3NWT A;  2G9W A;  3PIP F;  4G7H F;  3CC2 I;  1FIP A;  4RAG A;  4BYY A;  5CJ9 A;  2EFQ A;  2K4J A;  2HYJ A;  2DLL A;  3W6V A;  3FKI J;  4UXN A;  4XRM A;  3CUO A;  4OMZ A;  1X3Z B;  2HWV A;  2ICW G;  3MVP A;  4XSZ F;  3IH2 A;  2E1M C;  2RDP A;  3GCM A;  5HLG A;  3OYK A;  5GTI C;  2RAE A;  1WVR A;  3ZQQ A;  1WJC A;  3MFK A;  2R7O A;  1FWZ A;  3ZQC A;  1MD0 A;  3N97 A;  4TV7 A;  2ZBK A;  4BNC A;  3W2A A;  5DV5 A;  1UST A;  2VOP A;  3CES A;  2YX7 A;  4M9X A;  2NYX A;  1E3O C;  3T5X A;  5IYB J;  1JKQ C;  4GXO A;  3F0C A;  3K4N A;  2LLK A;  1J75 A;  2LG4 A;  2BYV E;  2G7U A;  2O03 A;  1KZH A;  3S2D J;  1R6R A;  2CS3 A;  1CF7 A;  4A0Y A;  1SAX A;  2LOO A;  2VB6 A;  4EJT A;  3PNV A;  3K1M A;  1G3Y A;  3CO7 C;  4RB3 C;  2LRD A;  1FY7 A;  1P6R A;  2EJR A;  4AYB N;  4FCY A;  2X6X A;  1NH3 A;  4AIJ A;  3ABK H;  4NQW A;  2TCT A;  4E4H A;  3H3V K;  3AAF A;  4BXU A;  3I58 A;  4XLH A;  3L2U A;  1XN7 A;  3V7R A;  2DI3 A;  4BQO A;  1R49 A;  5BPI A;  4P1W A;  2L02 A;  3Q0U A;  5GPC A;  1QVT A;  3KEQ A;  2RNJ A;  3K9T A;  2E2J J;  4HNU A;  1Z6R A;  3R6S A;  3HB9 A;  3SEZ A;  3FBI B;  3PFY A;  4EGY A;  2MLK A;  1T98 A;  2MD0 A;  1JUS A;  1OR7 C;  1IG7 A;  3HGG A;  2GA2 A;  2K27 A;  2K02 A;  4CCJ A;  3IL2 A;  4DZJ A;  3F3X A;  5D4S A;  2YR2 A;  5E1Z B;  2VT3 A;  2LH9 A;  4A6D A;  1SVM A;  4KDP A;  2ELK A;  3VB2 A;  2RKH A;  5FLV A;  2M4G A;  1ETQ A;  3K70 C;  3S17 J;  2JA2 A;  5IP7 J;  2OTJ I;  3I9V 2;  2IBD A;  1JT0 A;  3PUB A;  3BJO A;  1DP7 P;  4LB5 A;  5CKT A;  2DK8 A;  3Q5F A;  2CQN A;  4IKF A;  4OIN F;  2R7F A;  1RKT A;  2CU7 A;  5HOD A;  2L01 A;  1OJL A;  1SMT A;  3BPX A;  2VUM J;  5LGN A;  4XQF A;  4L5E A;  1TNS A;  2QQ8 A;  2LF7 A;  4C30 A;  3OMY A;  4F91 B;  2QSF X;  5FO5 A;  3GZ6 A;  4OU0 A;  1PUF B;  1VQ4 I;  1Q1V A;  4PJM A;  4B47 A;  1RR8 C;  4NNJ A;  2X9D A;  1LUJ B;  1QU3 A;  3JTG A;  2XGE A;  4FE4 A;  4DJA A;  1UHW A;  3LSP A;  4XR6 A;  5FFX A;  3OS2 A;  3EPZ A;  1X4P A;  2M4K A;  4DW6 A;  1XGN A;  1HLV A;  4CCN A;  3HPG A;  3M07 A;  2M0M A;  2BW3 B;  5B1B H;  5EZG A;  2DDB A;  3JRI A;  2PMZ N;  1D0Y A;  4BHC A;  1SD5 A;  3WTZ A;  4MEX F;  2W1O A;  2BXY A;  1YLF A;  2XSD C;  2UV1 A;  3GBG A;  2H09 A;  2JPB A;  4I0A A;  4QPO A;  3GTP J;  2VE9 A;  4ABZ A;  5CPR B;  3G3Z A;  1MMG A;  3QOP A;  1DGW Y;  4IHS A;  1X3W B;  1MND A;  1A5J A;  5LD2 C;  2X85 A;  4BEH B;  4A0X A;  2QWW A;  5EF6 A;  1S72 I;  2DJI A;  1YHQ I;  2M45 A;  4A69 C;  3MKY B;  1TWH J;  1F4K A;  3FXO A;  1C0W A;  2VI6 A;  1HA8 A;  3Q0V A;  3L7W A;  2LBF B;  1VQ7 I;  4UNO A;  5K5Q A;  2ZFU A;  2OC6 A;  1TW2 A;  3G1L A;  4Y15 A;  4ESJ A;  2UWM A;  1ODD A;  2IA2 A;  3FIW A;  4UUV A;  4AIK A;  2A6H F;  4M3D A;  2A6E F;  1I6X A;  2H1K A;  3K4M A;  3BP8 A;  4FQG A;  1IV6 A;  1BW5 A;  1XSX A;  3I4N J;  1YJN I;  1S3J A;  3ELK A;  5ERI A;  2H6B A;  4ZYD A;  2KMU A;  3KYD B;  1BI3 A;  3FMQ A;  1T33 A;  4YIR X;  4C2T A;  3KZZ A;  4XKC A;  3JRE A;  2O8K A;  1YIJ I;  3HPH A;  3RJP A;  2Y0S N;  3J7Z I;  2OD5 A;  3QYB A;  3FHZ A;  4RMN A;  2KIQ A;  2CV0 A;  1S9H A;  3E6C C;  4LG3 A;  4MQV A;  1T2K A;  3IWF A;  1D1C A;  3LAJ A;  4QPQ A;  3WTW C;  3JRC A;  2CFX A;  4N9I A;  2X6O A;  2B7E A;  1DDN A;  1IRG A;  1PYV A;  2W48 A;  5DD8 A;  1O3T A;  3PQJ A;  2DU9 A;  2CV2 A;  4DZP A;  4J01 A;  4BBR J;  2VBX A;  3ASO H;  3I4P A;  2ZJP F;  4E7I A;  1FBQ A;  2FRH A;  1UHM A;  1K61 A;  3W3C A;  1Q1H A;  5HDN A;  3HUG A;  5EEG A;  4C3I J;  1WSU A;  3CLO A;  3TDU C;  2OAZ A;  1ETO A;  1WJD A;  3A0H C;  3TDZ C;  3OL4 A;  3REO A;  1FOK A;  4UB6 C;  1FOY A;  1XC5 A;  2WB1 A;  2JJ7 A;  5F04 A;  1UG0 A;  5LBQ A;  1E17 A;  1IF1 A;  5KNL A;  3UKG A;  5J8F A;  1J59 A;  1FMV A;  2QVO A;  1XG1 A;  4YFK F;  2HVQ A;  2KDO A;  3LSH A;  4IOC F;  1BI2 A;  2W82 A;  4Q5S F;  1J9I A;  4U7B A;  3DEU A;  1YIO A;  1G3T A;  4A3K J;  3JTH A;  3S16 J;  1MJA A;  2Y30 A;  3CF2 A;  4EJV A;  2EV6 A;  1FEX A;  1TWA J;  3GO5 A;  3P9I A;  2EFN A;  3BJA A;  3Q3S A;  5CQE A;  2A05 A;  1TT0 A;  3DPL C;  3M3Y J;  2RGV A;  3LSI A;  1Z21 A;  2KFD A;  3FBN B;  4Z2Y A;  3IRQ A;  1U5T A;  3WTV C;  3VYT B;  1BL0 A;  3I5U A;  1PUE E;  3GF2 A;  1BW6 A;  1FMW A;  2MGQ A;  1LJ9 A;  3ZMS A;  2HPM A;  2FA5 A;  4A3B J;  2ME6 A;  1FP1 D;  2O9L A;  3GX4 X;  2LP0 A;  1R1U A;  4F93 B;  1BJA A;  1OQY A;  3KP2 A;  3FXU A;  3ESW B;  1RES A;  5D8L B;  5A2Q K;  4HX4 A;  4PGH A;  1ONV A;  1XDU A;  1UB9 A;  4MLO A;  4XLC A;  3HOT A;  2MC4 A;  2JTV A;  2ISZ A;  2XPU A;  3TBI A;  3JAM K;  3CCL I;  3IC7 A;  1JGS A;  1ZRF A;  1TWC J;  5IPA A;  3GVA A;  1A04 A;  2PG4 A;  3A03 A;  2VON A;  4AYB A;  2AXL A;  3J81 K;  4XBF A;  3SDG A;  3WG7 H;  3T8R A;  3K7A J;  3BC8 A;  3CDH A;  4A3J J;  4ZTF A;  2JMW A;  2LNB A;  1MBJ A;  1MMN A;  2Y2Z A;  3N4M A;  5BOX A;  2Q1Z B;  1A36 A;  2I10 A;  2HXI A;  1K6Y A;  1E2X A;  1GUU A;  1AA7 A;  4PJJ A;  1A31 A;  3GTK J;  5EG0 A;  3DFG A;  1AKH A;  2HPI A;  3NAR A;  3ZMV A;  2IAI A;  1FNN A;  5E17 F;  3IAM 2;  1ZK8 A;  1W5C C;  3E3V A;  1WWX A;  1UG2 A;  4S04 A;  3CO6 C;  1FJL A;  2X51 A;  2VKH A;  3F8N A;  2L9R A;  5J3L A;  2BBY A;  4M3F A;  4DIQ A;  5D6E A;  3CQZ J;  3RZO J;  5H6Q A;  1VQN I;  1ZRE A;  1E0E A;  1ERD A;  1IXR C;  1D8J A;  2PBI A;  1MIJ A;  3BTI A;  4JQF A;  4XNF A;  1DUX C;  1NG6 A;  4ENK A;  4IL6 C;  2WC2 A;  3C18 A;  2GQQ A;  3GTL J;  1ZLJ A;  1XSD A;  2K9S A;  2JWT A;  2F5C A;  4CIC A;  5E3L A;  3CCR I;  1FLI A;  4HAM A;  1VQM I;  3HM5 A;  4BQA A;  3SHF A;  4BJ5 C;  4L18 B;  4ZDP A;  3TO9 A;  1ZGA A;  2K4B A;  3QYF A;  3ZMZ A;  2B63 J;  2P4W A;  4U7D A;  1T6S A;  3EYY A;  2PI0 A;  1MJ9 A;  2DFH A;  2QQA A;  3E5X A;  1UCR A;  1H88 C;  5F1J A;  4KIT B;  3HC7 A;  2E7X A;  3GLL A;  4YII A;  2R7X A;  5E18 F;  2ME0 A;  3DCF A;  2KDZ A;  2W00 A;  4L0Y B;  4IOA F;  1DU6 A;  1YJW I;  4BH9 A;  3IH3 A;  3DLL F;  2KIS A;  3ISP A;  1QA6 A;  1IJW C;  5JFR A;  2DA3 A;  1IZ1 A;  4W1U A;  4AVZ A;  1V5E A;  1LE8 A;  1KQ8 A;  3I0T A;  4WCG A;  1JKO C;  1I1S A;  2VQL A;  2O5R A;  3KX2 A;  3SZP A;  2QBY B;  3M8J A;  4DYQ A;  1BC7 C;  2R93 J;  1YW8 A;  3K4J A;  2Q8K A;  2ZXW H;  2D2W A;  4G12 A;  2R7Q A;  5E20 A;  1T08 B;  1YRN A;  2PMZ A;  2IA0 A;  4KT6 A;  4WXC A;  2F5E A;  2QEN A;  1LB2 A;  5F64 A;  4B48 A;  1K6O A;  2VOD A;  1OCR H;  3GLX A;  1NG7 A;  5IP9 J;  4GYI A;  1ZLK A;  2VJI A;  4E7K A;  1QZE A;  3KIO A;  4HX7 A;  1Z77 A;  3CP2 A;  3IUO A;  4CYC A;  3ZGK A;  1TQP A;  4BE1 A;  2BVM A;  3F8M A;  1RUN A;  1YYV A;  4CH7 A;  2IGM A;  4LJZ F;  4UUS B;  4OMY A;  1I50 J;  1JJ8 C;  2P6T A;  4OWR B;  3DU5 A;  1B9N A;  1EKE A;  1P92 A;  1V55 H;  3ABL H;  3MWM A;  1V54 H;  2MW8 A;  5EGO A;  3BCB A;  2CH0 A;  4CGZ A;  3M8F A;  2XF5 A;  3PFI A;  2E19 A;  2IS2 A;  1WGX A;  2WV0 A;  2Y48 A;  2M3A A;  4A3I J;  3AG3 H;  1FSE A;  4LMY A;  4X1E A;  4KMU X;  3VOE A;  4OAY A;  4CO8 A;  3BCA A;  4E7S A;  2W4S A;  3OYM A;  3RI4 A;  4MQ9 F;  4WXH A;  1SD7 A;  2ZKZ A;  4DBR A;  2AO9 A;  4KN4 X;  2D1H A;  4PJN A;  3R0J A;  4XOP A;  1DGR M;  1VI0 A;  1NHA A;  5JI6 A;  1ACI A;  2LYC A;  4BU2 A;  2HKX A;  3DTI A;  4ESF A;  3DTK A;  1HW2 A;  3QPS A;  4RGR A;  4PJL A;  1LDK B;  3HKZ A;  3GTQ J;  3H9Q A;  2DA2 A;  1IN5 A;  1ZHF A;  4GDF A;  3CCV I;  2DCE A;  3DLA A;  2KKO A;  1U2W A;  4RGX A;  4DQ2 A;  3HSR A;  3GFI A;  2ZSI B;  2VQC A;  1R5G A;  2DMN A;  1I3A A;  1YTY A;  2HYG D;  3LL7 A;  3HG9 A;  1Z7L A;  4A3F J;  2FD5 A;  4XRS G;  4EEF G;  3LOC A;  5GAG J;  2VL8 A;  2ZXJ A;  2YU9 J;  1VQ6 I;  1QZZ A;  5LHI A;  1AWC A;  5KAF C;  2EV5 A;  2EFP A;  3ABM H;  4NB5 A;  3L2Q A;  1BOB A;  2CW0 F;  3JSP A;  1S29 A;  2X4H A;  3AL0 C;  2LRE A;  4NUB A;  2AS5 F;  3CCQ I;  5F0F A;  5CVV A;  4RAZ A;  4U0V A;  1Y1W J;  3F8C A;  4I98 B;  3OSG A;  2NS0 A;  1JXS A;  1J7K A;  2DQL A;  1HST A;  5J47 A;  5LLQ A;  1N75 A;  2UZK A;  5F6F A;  1LFB A;  2NAZ A;  4PFP A;  1YS7 A;  2DMU A;  4CSW A;  4ZYG A;  4BAY A;  5IOY A;  2HXO A;  2H1L A;  1VF9 A;  3WU0 A;  2R7S A;  2ESN A;  5DS9 A;  2E71 A;  2HVR A;  2WWY A;  4HW0 A;  2ZXI A;  3HTU A;  1BM9 A;  2MYS A;  2UXN A;  3DQV C;  3CTA A;  1DQU A;  2X1C A;  3CF5 F;  3KPH A;  1SD6 A;  4UUT A;  4XKB A;  3P9C A;  3DBR B;  3TGN A;  1WJ5 A;  4ZDL A;  4CYD A;  1JE8 A;  5K1Y A;  3BR6 A;  4RAF A;  3EDP A;  4ENM A;  4PCQ A;  2FF4 A;  5H20 A;  1Z67 A;  1MDM A;  2FOK A;  5EEH A;  4B09 A;  3RQ4 A;  3LA7 A;  2PMU A;  1EH6 A;  2YS9 A;  4Y52 J;  3PNY A;  3WG9 A;  1S7O A;  5CVI A;  4BUP A;  3TQN A;  5K7F A;  1X1C A;  1XB4 A;  5TGT A;  2KZG A;  3G71 I;  2JRM A;  5HDG A;  2F4I A;  4O5V A;  3HOW J;  1I5Z A;  2QKL B;  3L2C A;  2ZJ2 A;  2Z99 A;  3F8B A;  3RYP A;  1W7P A;  1X2M A;  1EV7 A;  4RM2 A;  2Q2E B;  3BZK A;  1XMA A;  1S7E A;  2M87 A;  5TIS C;  3LSR A;  1U6G A;  3ZXS A;  1BR4 A;  2L9V A;  1BR2 A;  5GTH C;  2P7V B;  5FRO A;  3M1C A;  3RYR A;  3OIQ A;  3OL3 A;  4M6Y A;  2OBP A;  2DMT A;  4EJU A;  2IS6 A;  5ILV A;  3CUQ C;  1IRX A;  2R5Y A;  3LFU A;  3RPU A;  1N25 A;  3CDL A;  2VQG A;  3EET A;  5GAH J;  4Y17 A;  3CCM I;  3BWG A;  3FHN A;  2EQR A;  1U8B A;  1NK3 P;  5BS6 A;  3T1B A;  1IV8 A;  5FJ8 J;  1W36 C;  1EH7 A;  3B02 A;  3PSI A;  2JA7 J;  4XM3 A;  4NQW B;  2KJC A;  3ABT A;  2CUE A;  2COM A;  1VQK I;  3S2H J;  2KIM A;  4RA2 A;  4Y4R A;  3U1K A;  2A3S A;  3A01 B;  3GWZ A;  5M5Y J;  1SMY F;  3V8L A;  3K10 A;  4JX6 A;  3I59 B;  1SAU A;  2WTE A;  4HOB A;  1U5T C;  2HEO A;  1IGN A;  3IAS 2;  3VFZ A;  3GXO A;  3GTJ J;  2OU2 A;  1H0M A;  2FJ1 A;  4KIF A;  1LFU P;  1W4M A;  3FMS A;  1I6H J;  2IRF G;  4IEJ A;  5LHG A;  3A02 A;  2HVS A;  1XMX A;  4J19 A;  2HQR A;  2MD5 A;  2NVX J;  1G59 A;  2JSP A;  2JRT A;  3ECH A;  5F0C A;  1OKR A;  5D5V B;  1XSV A;  3SZG A;  2FQ3 A;  4WX9 A;  3CCY A;  1YJ9 I;  2ZJR F;  2LC2 A;  1JTX A;  4LD5 A;  4R1H A;  1A6Q A;  2RQQ A;  3D5L A;  1QPI A;  1GV2 A;  3QPT A;  2F5V A;  4XLA A;  2L3D A;  4RB0 A;  5CVR A;  2ZB9 A;  3COA C;  3ZCO A;  5M5X J;  2EIN H;  4ZYA A;  3I56 I;  2OQG A;  1R58 A;  2CG4 A;  1Z7U A;  3S93 A;  2ZNZ A;  5TJJ A;  3GEZ A;  2V6E A;  4MNU A;  4A3G J;  3QU3 A;  5FKO A;  5F0H A;  2BGC A;  5HLI A;  2IPQ X;  4EM2 A;  4B1R A;  4GFB A;  4UVB A;  4YEL A;  2VJJ A;  4KIS A;  2V26 A;  2HOT A;  1V3F A;  5L3C A;  2NS8 A;  2BV6 A;  5H6R A;  3BZC A;  2J5P A;  3FF5 A;  1JTY A;  3BG7 A;  4ETS A;  2AQE A;  4XIC A;  1G8X A;  4M71 A;  1WQ2 A;  1UFM A;  3H9G A;  1JKR C;  3FM3 A;  3OYN A;  1CGP A;  1ETV A;  4HV6 A;  2MSY A;  2Q0O A;  4M3B A;  3OYD A;  3ZPL A;  1L3L A;  4AID A;  2XUB A;  4A12 A;  5F08 A;  3HSE A;  4XKV A;  1IN8 A;  5HS9 A;  4CXF A;  1SAN A;  2JA5 J;  2EZK A;  4L5J A;  2DW4 A;  2MAB A;  4LIU A;  2EIJ H;  4CCM A;  3BTL A;  1A6I A;  2J5O A;  3C1D A;  3MZH A;  1X1A A;  1HW1 A;  4E7Z A;  3F8F A;  4QTR A;  4UHT A;  4CZC A;  4LB6 B;  3OWT A;  4Y3O A;  3QP5 A;  2HZT A;  1ETX A;  1IO2 A;  3TW7 A;  4HA8 A;  1OCT C;  3U1D A;  4R79 A;  2DBB A;  4FET A;  2IT0 A;  3JCU C;  1OYY A;  3WHB A;  5LGU A;  1POG A;  2FUG 2;  3HXL A;  3O6B B;  4PDK A;  4D9J A;  4JX4 A;  5FKL A;  4F3Q A;  3OYJ A;  4MFE A;  1YFH A;  1MKM A;  2IVM A;  3HOZ J;  3BR0 A;  3SJM A;  2L2O A;  1FC3 A;  1O3S A;  4IXA A;  3SFZ A;  3BQY A;  1BI0 A;  1N77 A;  3BG9 A;  1FP2 A;  4I01 A;  3PO2 J;  2K9M A;  1XCV A;  2V7F A;  3V42 A;  2B9S A;  2WAD A;  5HOO A;  2OV7 A;  4IPA A;  3OYC A;  1Z91 A;  2VQH A;  4NC6 A;  5JLW A;  2CQQ A;  4XMY A;  3WU1 B;  5BPD A;  1MNE A;  1NK2 P;  2GBY A;  5E1X A;  1QQI A;  3HHH A;  2XKP A;  4M6X A;  3BZ6 A;  2ECB A;  3VPR A;  3BOQ A;  2I8D A;  2VN2 A;  3S3M A;  2NRA C;  1O7F A;  1ETK A;  4ZYE A;  3K70 D;  1AU7 A;  1IXS B;  3ERM A;  4G6T B;  1K83 J;  2K85 A;  2ZME C;  3HOU J;  4U88 A;  3L00 A;  5C4J J;  3OYB A;  4HDV A;  4PJ0 C;  3CC7 I;  3VYS B;  1LQ1 A;  1JGG A;  5JVT A;  1GXQ A;  4XN3 A;  5FLX Z;  3HRM A;  2V9V A;  2DOA A;  2O61 A;  3KE2 A;  2P5K A;  5L3E A;  1X3U A;  2JUC A;  2W57 A;  1RKW A;  3IRR A;  3CUQ B;  2P8T A;  5BQT A;  2E5Z A;  3WTS C;  1B72 B;  1BI1 A;  2H94 A;  3ZQH A;  4LG0 B;  2TRT A;  5J4Y A;  2CJJ A;  4B3A A;  4CDG A;  4KT5 C;  1GHC A;  4JX5 A;  3ZN1 A;  3QU6 A;  4BY7 J;  1BR1 A;  5GP9 A;  2BZT A;  5CYV A;  1PUF A;  1QVU A;  3K4B A;  2VOO A;  1I27 A;  3S32 A;  4B44 A;  4G6Q A;  4XRS A;  3MZY A;  5L3B A;  4IRI A;  3PM1 A;  1P9Q C;  3EUA A;  4YIF A;  3KYL A;  2X0L A;  4JYK A;  1F36 A;  3HKZ N;  4B8X A;  3EUH C;  2R3S A;  3K0L A;  2CSO A;  3BRO A;  3M9A A;  3S3O A;  2E1M B;  1W5T A;  2FX0 A;  2IGK A;  3D5R C;  4BBS J;  2HOA A;  2R4G A;  1WJF A;  2BW3 A;  1IXC A;  2NVU B;  4Q47 A;  2EFO A;  4MEY F;  2ETH A;  3CCU I;  2L5Q A;  4HDU A;  3OOU A;  5DDG A;  1QO0 D;  2LDU A;  4LOC A;  2NVY J;  3DBL B;  4DYC A;  2A5Y B;  2NOG A;  4A93 J;  4UV8 A;  3C2H A;  3ZR8 X;  5ILU A;  2YPR A;  1WI9 A;  1Z05 A;  2HFH A;  1STZ A;  1KU2 A;  1ZEL A;  3TP0 A;  2DT5 A;  2WY8 Q;  2CUZ A;  2F4M B;  2K5C A;  2VJ4 A;  4GCV A;  4BEH A;  1D0Z A;  2XC7 A;  4E6K G;  4FTH A;  4P5O A;  5FD5 A;  3CME I;  1WJA A;  3O8G A;  3CJT B;  2IJL A;  4BJT A;  2XDV A;  1HKS A;  2XRN A;  1KON A;  3WGG A;  2W85 A;  1FBU A;  2KRC A;  3I64 A;  1U9O A;  4HEA 2;  3LSJ A;  4N9H A;  5DCF A;  2DMQ A;  2XPV A;  2PEX A;  1KU9 A;  3DTE A;  2D5V A;  1OPC A;  1F1Z A;  2X1D A;  5KCM A;  3M4O J;  4RB2 C;  3DU6 A;  1J0R A;  2NS7 A;  4MTE A;  2BE5 F;  4NBQ A;  2HQA A;  3K4C A;  1TZL A;  4JK1 X;  2E2H J;  1OCC H;  4F55 A;  2NVQ J;  1Z1D A;  1YX3 A;  1VQP I;  1MBE A;  3JRB A;  4D1Q A;  3MEX A;  2L9S A;  1XTA A;  2YX4 A;  3AKZ A;  4BY1 J;  2EFW A;  1VTN C;  5M3M J;  3ZRG A;  1ZG1 A;  1LEB A;  1IAW A;  3I3L A;  2FNP A;  2VKE A;  2A69 F;  3LMM A;  2BY2 A;  3ONQ A;  1WRJ A;  5KHD A;  1SVL A;  3GZN B;  3K6G A;  3L09 A;  2Z33 A;  2IXS A;  4A3E J;  1LVA A;  4I02 A;  2M8E A;  4ESB A;  3TKY A;  4YEJ A;  2DJN A;  4HNT A;  1GDT A;  2A6T A;  1Y6I A;  1XPX A;  2CGP A;  2VIX A;  2L7K A;  4II3 A;  2JA8 J;  5HDK A;  1ZG3 A;  3C2G A;  1B59 A;  2M9H A;  4LIV A;  4AM3 A;  4F52 A;  1RPW A;  4LLL A;  2Y69 H;  5ICF A;  2BOL A;  5EEA A;  2KP6 A;  3W2V A;  2V9K A;  4IVN A;  4XLP F;  3CJN A;  3MQ0 A;  4OAZ A;  3O8H A;  4G7Z F;  3RIR A;  2DA6 A;  3OIP A;  3IV5 A;  2MC3 A;  4BHB A;  1Y0N A;  2E60 A;  1R7J A;  2DA5 A;  3ZQG A;  3S8P A;  3BDD A;  3DV8 A;  3V8K A;  3IKT A;  2RRE A;  5FKK A;  1TL8 A;  1WFX A;  3LWF A;  3C3W A;  3KZY A;  4H4K C;  1JKP C;  2FXA A;  4N0B A;  3S3N A;  2CUJ A;  2E7W A;  3ZN0 A;  1U8R A;  2DTR A;  4XLE A;  1IRZ A;  3FK6 A;  2IGO A;  5FFZ A;  3FK7 A;  5KVR A;  2RNG A;  3LFK A;  3OSF A;  3CMM A;  4HF1 A;  2HOE A;  3S1Q J;  3CCJ I;  4A3C J;  3E5Q A;  3BLY A;  2LKS A;  3GFL A;  4L5I A;  2DQR A;  4A5M A;  2QSG X;  1V5F A;  2ZME B;  2DO7 A;  3BT9 A;  3ZQI A;  3GFM A;  3E7L A;  1EJ9 A;  3WE3 A;  3U9G A;  2ZCW A;  1YE9 A;  1KQ0 A;  2L7F P;  3MN2 A;  4HLX A;  5DCM B;  3SYT A;  1T38 A;  4ZZD A;  3E5U A;  3BR2 A;  2XGD A;  4JP0 A;  2FMY A;  1TT5 B;  3NAU A;  4WF2 A;  4A6E A;  2DTZ A;  3H3U A;  4Y7N J;  5JVG F;  2OCE A;  3ZMT A;  3HSF A;  1RNL A;  4UVA A;  1GT0 C;  1LVK A;  4XLF A;  2L7M P;  2R0Q C;  2V4J C;  4CCK A;  2PJR B;  1R36 A;  1R4M B;  4FAS D;  2VKV A;  3Q0W A;  1K7A A;  1R1T A;  1H9G A;  5J8C A;  2QEX I;  4ZDO A;  3L2R A;  1Y0U A;  1R4N B;  2OJE D;  3LSM A;  2JZY A;  1MBF A;  1Z0X A;  2DOD A;  2QSH X;  3TW6 A;  5IT9 Z;  1ZRD A;  3Q9S A;  3HHG A;  3TL4 X;  1WJB A;  5EYR A;  2DFI A;  3K69 A;  4P55 A;  3HOV J;  2C6Y A;  2JA6 J;  2B0L A;  2CRG A;  2P0W A;  3ZMD A;  1HW5 A;  4PSW A;  3S1R J;  5JHF A;  2STW A;  2GOX B;  2WY7 Q;  2NVT J;  2KLO A;  2ZXH A;  1FBS A;  1QHG A;  2FBI A;  2IW5 A;  2GIZ A;  2M7B A;  3KP7 A;  1ORK A;  3HDD A;  4MO7 A;  3W6J B;  2XAU A;  1IC8 A;  4JBA A;  2HQ5 A;  4ENJ A;  2H27 A;  4HYE A;  4U0W A;  1WZ2 A;  2GM4 A;  1R00 A;  2F48 A;  2JK3 A;  1UMQ A;  1GVD A;  4KMF A;  4IO9 F;  1UHS A;  1A35 A;  2V9P A;  1ETW A;  4AWX B;  4F7Z A;  2JVH A;  2HNH A;  4A3D J;  1RIO H;  3BTC A;  3NRV A;  3TED A;  3GTG J;  1K78 A;  5ILS A;  1XGO A;  4RM3 A;  3LQQ A;  1UJ8 A;  1U0J A;  5M5W J;  4XN0 A;  2JUG A;  2XGX A;  2P81 A;  3BG3 A;  3A0B C;  3QP6 A;  3UNG C;  3HRU A;  3E0J B;  2OTL I;  2ZJQ F;  2R92 J;  1LFP A;  2ZNY A;  4BHP A;  4E7L A;  1S6L A;  3PQK A;  1RRJ A;  5K7Z A;  2IGN A;  3B73 A;  3WOD F;  3R61 A;  4M9Z A;  1APL C;  3OYL A;  2R7Z J;  2EBI A;  5KAI C;  2VE8 A;  5JR3 A;  3K2A A;  3I55 I;  3EQL F;  1YOV B;  3HTS B;  2QQ9 A;  3RKX A;  5D5W B;  1W1W E;  1ZRC A;  2QBY A;  3HZJ A;  2X6W A;  2P5V A;  2Z2S B;  3CCS I;  2A61 A;  4X0G A;  1FSH A;  3F6V A;  5LRS A;  1X4O A;  2P5L C;  1D0X A;  1UAA A;  3F6O A;  2Z5U A;  4ASN A;  5J40 A;  4ZZL A;  4M6V A;  5DUI A;  3E6D A;  1W0U A;  2XAF A;  2CUF A;  1JI8 A;  2R5Z B;  1B8I B;  2GXG A;  3FXR A;  3MKL A;  3KEO A;  1BBY A;  3SDB A;  3I71 A;  4NDL A;  3QPL A;  3OY9 A;  2LMD A;  2CW8 A;  3ZMU A;  3V7S A;  2DT6 A;  2HQN A;  4RGU A;  5FLM J;  4A2U A;  1D1A A;  3RZD J;  2H8W A;  4MFD A;  1VQ8 I;  2LTP A;  3NEU A;  2R7R A;  4IHT A;  1BN5 A;  4CCL A;  4UUS A;  4A3L J;  4C2M J;  2BY0 A;  2DA1 A;  3AG1 H;  4L9T A;  5AIP A;  2R5Y B;  4R8H A;  3BG5 A;  2WAQ A;  3FX3 A;  2M0C A;  4PUS A;  1MJB A;  2ELH A;  3ASN H;  2QUF A;  1YI2 I;  3VWB A;  2CMP A;  4MIM A;  3X2Q H;  3PUF A;  4D5C A;  2COB A;  1P7J A;  4NC8 A;  1PP8 F;  5TRD A;  5GAE J;  1PDN C;  4I0B A;  3M1E A;  3LAP A;  2R7D A;  2V1D A;  2A5W A;  1LEA A;  4A3M J;  1QBJ A;  2HGC A;  2LF8 A;  3ML6 A;  4B43 A;  3KZI C;  3R0A A;  4Q48 A;  2KRH A;  3M8E A;  4LGW A;  3JRF A;  4BL0 B;  1XD7 A;  2MA3 A;  1EF4 A;  2EV0 A;  2DA7 A;  4AUX A;  3H9J A;  1HKT A;  2DYS H;  1RR7 A;  3MKW B;  4HST A;  2P6S A;  2JN6 A;  3FXQ A;  1GVJ A;  1SFX A;  1G4D A;  4UB8 C;  2X48 A;  4XK4 A;  3KFW X;  2LD5 A;  3DP7 A;  1SFK A;  2K3F A;  2DPD A;  4XL9 A;  3GTO J;  4OIQ F;  2LKP A;  2VJ5 A;  2FBK A;  3O3K A;  5F1R A;  1UEL B;  5C3E J;  4BQQ A;  5HNF A;  1MBH A;  4MHG A;  2LFB A;  2HDD A;  4ZH4 F;  4HV5 A;  1CF7 B;  1V4R A;  3VOD A;  4ZC3 A;  2FU4 A;  3H36 A;  2N8G A;  4D0P A;  5IYC J;  2TDX A;  3GZ5 A;  3H1C A;  3MCZ A;  3KLO A;  4OIP F;  1X58 A;  3DPU A;  2IP2 A;  4RLQ A;  4RDU A;  2JT1 A;  1WHU A;  4XID A;  5LGT A;  3HOS A;  4HQE A;  1T39 A;  3P7N A;  3S1N J;  4KA4 A;  3PNT A;  1G3W A;  1MSE C;  1TQM A;  1Y8Q B;  4EQQ A;  5HLH A;  5D5U B;  1R9T J;  4MTD A;  4I99 C;  4QWQ A;  2WA0 A;  5DD4 A;  4ITV A;  3ZOB A;  2VXZ A;  4M72 A;  1DPU A;  2OUM A;  3V4G A;  2XB5 A;  2PQ8 A;  4IRH A;  1FPQ A;  3LA2 A;  3VEP A;  2E1O A;  4W97 A;  1LNW A;  3OYG A;  1ON1 A;  4B3X A;  3VYR B;  4DGW B;  3ZQF A;  2F4O B;  1XX5 A;  2MFZ A;  1WKM A;  1HOM A;  3QRF F;  1IUY A;  2O7O A;  4D5F A;  4G6D A;  4UVC A;  3PO3 J;  2R7U A;  3F72 A;  2CV1 A;  3BG6 A;  4FHT A;  1Y39 A;  1DP3 A;  1FTZ A;  1P7I A;  3NQO A;  1WPK A;  2L54 A;  2VC1 A;  5CVJ A;  1V5G A;  3W6K B;  2XAS A;  4D7N A;  5K5R A;  4BS9 A;  4DYR A;  1ZG5 A;  1OCO H;  2PN6 A;  4IF4 A;  2L4A A;  4E7H A;  2W84 A;  4HPQ A;  4LK1 F;  2LK2 A;  3CDI A;  5D6F A;  1HBX G;  1I39 A;  3FXM A;  1R1V A;  4O6J A;  3I53 A;  1VQ5 I;  2HR3 A;  1SFE A;  1UZC A;  2FBH A;  4KN7 X;  2O8X A;  2IS1 A;  5B3S H;  1SD4 A;  4GGG A;  5LRR A;  2DFE A;  2DN0 A;  2E34 A;  4ON0 A;  2A07 F;  2EH3 A;  6PAX A;  3RQI A;  2K40 A;  3ABU A;  2Q2E A;  1XDS A;  1TBX A;  4UV9 A;  4K2E A;  1KQ9 A;  1F5T A;  5CLS A;  2HYF A;  1MMD A;  5B1A H;  2L4M A;  4V19 K;  1W36 D;  1FOW A;  2F5F A;  2GLO A;  2LKX A;  2NOJ B;  3SXY A;  1GLN A;  2G7H A;  2DK5 A;  1S8N A;  4EJW A;  3ULQ B;  1WCM J;  1GXP A;  5L3D A;  5DYM A;  5M3F J;  1ENH A;  2BVL A;  2BY3 A;  4EM1 A;  3OS0 A;  3VYU B;  3G2B A;  3WE2 A;  4I2O A;  2GIV A;  2XAQ A;  3L2W A;  2DT7 B;  3SZT A;  4BJ6 C;  5CQG A;  1SFU A;  2PMH A;  4WK8 F;  1KYZ A;  4PFO A;  2K9N A;  1R22 A;  1I3Q J;  4II2 A;  4ZJZ A;  1G3S A;  3L1P A;  4YG2 F;  3V7C A;  3F21 A;  4P96 A;  4FX4 A;  3GUD A;  2XRL A;  1YW7 A;  2FNA A;  4DBQ A;  2EIK H;  4OOI A;  5HVQ C;  1F43 A;  2RN7 A;  1O4X A;  1YO5 C;  1YQA A;  4N4O B;  3A01 A;  3I59 A;  2XAG A;  1HSJ A;  3QYE A; 
#chains in the Genus database with same CATH homology
 1ZYR F;  2VBZ A;  2DAO A;  4LFU A;  5AIQ A;  2PFB A;  4LLN A;  3IHU A;  4XLN F;  4A0Z A;  2K7L A;  3K2Z A;  1XGS A;  3FM5 A;  3BPV A;  1XGM A;  2BEO A;  2OA4 A;  1J2X A;  1YS6 A;  3WTY C;  4G8X A;  3RTR A;  4KUM A;  1RI7 A;  3KLN A;  4CHU A;  1L0O C;  2M30 A;  2W25 A;  5DEQ A;  2GA1 A;  4L0Z B;  2CO5 A;  1LDD A;  1JHF A;  4OIO F;  4G94 A;  1KGS A;  3U2R A;  4ENN A;  2PJP A;  5AON A;  2NNN A;  1ZAO A;  4FT8 A;  5D4R A;  2XRO A;  2VC0 A;  2GXB A;  4I7H A;  3TOB A;  4KNY A;  2M1B A;  4KIG A;  4RGS A;  1YG2 A;  2FE3 A;  4HZF A;  4QLC U;  1S7A A;  1I1G A;  2XKO A;  5E8I A;  4KIB A;  1TW3 A;  2LSO A;  4FX0 A;  3L9F A;  4NHJ A;  5ICE A;  3OV8 A;  1HKQ A;  1QPM A;  4EM0 B;  5ICG A;  2RV8 A;  3V8J A;  3S2W A;  5FLX K;  2UXX A;  4RB1 A;  4GO1 A;  1KU3 A;  2FSW A;  1BIB A;  1U5T B;  2ZFW A;  1ZH5 A;  1T0F A;  2Z9O A;  3BJ6 A;  2NNY A;  4DNC A;  5K5O A;  5D5X B;  1MGT A;  1O57 A;  1O7L A;  1PP7 U;  3Q9V A;  3EYI A;  4IRG A;  2K86 A;  1FYL A;  1ZGJ A;  2F2E A;  5D8K B;  2DPU A;  4L9N A;  5CVU A;  2RQP A;  3RKY A;  5ICC A;  3WGI A;  2FEZ A;  2D45 A;  1IN6 A;  1D8K A;  1QZY A;  3R4K A;  4I09 A;  2XIG A;  3E6M A;  3KP4 A;  2OZ6 A;  4U0Y A;  3LA3 A;  2E1C A;  3D0S A;  1EH8 A;  4L9V A;  4HF2 A;  1IW7 F;  4KFC A;  2KRF A;  3QPH A;  4HX8 A;  1AOY A;  3ERE D;  2XAH A;  3CUQ A;  1B1B A;  3C7J A;  4RS8 A;  4G9Y A;  4LG0 A;  3E6B A;  4HLY A;  4AIH A;  4AD9 A;  5LEK A;  3F22 A;  4PZJ A;  1RUO A;  3TOA A;  1OYW A;  4HBL A;  3OOP A;  1B6A A;  5FB2 A;  5A2Q Z;  3FZV A;  3JSO A;  1HQC A;  3JW4 A;  2QYO A;  3JAM Z;  1LDJ A;  3J81 Z;  1TNT A;  1BOA A;  1ON2 A;  1KA8 A;  3J7A O;  4H0E A;  4LK0 F;  1R23 A;  3DPT A;  1FT9 A;  1Z9C A;  2E1N A;  3DXJ F;  2O0Y A;  4EVI A;  3MAJ A;  4Y13 A;  2JSC A;  2EB7 A;  3K1P A;  3K1N A;  3KP6 A;  4WWC A;  2GWR A;  3R60 A;  1ULY A;  1G6N A;  1USS A;  1HXD A;  2W24 A;  4E70 A;  1U3E M;  3TO7 A;  4Q4Z F;  2QZ8 A;  1U78 A;  1W7P D;  3KP3 A;  1QGP A;  4RAY A;  4KIC A;  3DF8 A;  3RKW A;  3P9K A;  1OR7 A;  2ACJ A;  3WTX C;  5FD6 A;  4CZZ A;  1P4W A;  4L9J A;  4OIR F;  4YFX F;  2KIF A;  3J80 Z;  2EA4 A;  2KIU A;  2ISY A;  3HIF A;  1IN4 A;  1O3Q A;  2ZO4 A;  3GFJ A;  4MGR A;  2MLG A;  3SQN A;  4M9S A;  1R5H A;  3T8T A;  2HKO A;  3WTT C;  2PLY A;  3H3Z A;  1K78 B;  4PGG A;  3DKW A;  5DUK A;  3IKV A;  1FYM A;  2O3F A;  2QM3 A;  3J80 K;  1OYI A;  2ESH A;  4G7O F;  1D5V A;  4S05 A;  4A5N A;  3E97 A;  3LQR A;  5E1W A;  2IA1 A;  2MH2 A;  1TQI A;  1B4A A;  3O2P E;  1XMK A;  4P9F A;  1FZP B;  4YFN F;  5LEJ A;  5LHH A;  4LLG F;  1REP C;  2V1U A;  1P4A A;  2HS5 A;  4O3M A;  1J5Y A;  1P4X A;  2GZW A;  2HTJ A;  5IT9 K;  5BMZ A;  2STT A;  2OZU A;  2GAU A;  2P7C B;  3FWE A;  5L3F A;  1QNT A;  2MBF A;  4M74 A;  3HYI A;  1IRF A;  3RDI A;  2ZME A;  2EK5 A;  2V6C A;  2O6G E;  5DCM A;  2XV4 S;  2F5D A;  4EMS A;  2XVC A;  4EGZ A;  2HTS A;  3GW2 A;  4GYG A;  1MDM B;  2EA2 A;  3FMR A;  2RVC A;  4HF0 A;  3IWZ A;  4M73 A;  1D3Y A;  2Y75 A;  3I54 A;  3WGH A;  1W7P B;  5L3G A;  3GYH X;  4IJA A;  2Z3Y A;  2OQR A;  2XHK A;  5KK1 A;  2D1V A;  3EUH A;  1XCB A;  4AVP A;  3H92 A;  5JHU A;  2M5W A;  2CWE A;  1FX7 A;  5IT3 A;  2QLZ A;  3T0Y A;  3WTU C;  4HQM A;  1O3R A;  2MH9 A;  3ZP5 A;  5J6X A;  3ZQ7 A;  3KET A;  1Z6T A;  3HRT A;  2A68 F;  3RPQ A;  4XRF A;  1DPR A;  3LST A;  3M7G A;  3ECO A;  1ZN2 A;  2ADU A;  1RZ4 A;  2FML A;  1OMI A;  3KCC A;  2QQB A;  2JPC A;  1KU7 A;  4XSX F;  1JHH A;  2CYY A;  2V79 A;  4KYW A;  2XAJ A;  2EWN A;  4P9U A;  1BIA A;  2CQK A;  2YU3 A;  5HS8 A;  1TTY A;  3KP5 A;  5FGM A;  3BY6 A;  2VT2 A;  4ZYH A;  1W5S A;  1KYW A;  1YW9 A;  2H6C A;  1H9T A;  1K79 A;  5ED4 A;  3HRS A;  5HS7 A;  2Y0M A;  1ZAR A;  3QAH A;  4EV0 A;  5E8G A;  3F23 A;  3ROU A;  1MZB A;  3G73 A;  2YSR A;  2VBW A;  4WXD A;  1F9N A;  2V1X A;  1BC8 C;  1TLH B;  2KJB A;  2VBY A;  1FYK A;  2RC4 A;  1B9M A;  1P2F A;  1IN7 A;  3TO6 A;  4EJO A;  2HDC A;  2G9W A;  4G7H F;  4BYY A;  5CJ9 A;  2EFQ A;  2K4J A;  2DLL A;  4UXN A;  3CUO A;  4OMZ A;  2HWV A;  4XSZ F;  2RDP A;  5HLG A;  3MFK A;  1FWZ A;  1MD0 A;  3N97 A;  4TV7 A;  2ZBK A;  4BNC A;  5DV5 A;  1UST A;  2VOP A;  4M9X A;  2YX7 A;  2NYX A;  3T5X A;  4GXO A;  1J75 A;  2BYV E;  2G7U A;  2O03 A;  1CF7 A;  4A0Y A;  1SAX A;  4EJT A;  3K1M A;  1G3Y A;  3CO7 C;  4RB3 C;  1FY7 A;  1P6R A;  2EJR A;  4AIJ A;  4NQW A;  3AAF A;  4BXU A;  3I58 A;  1XN7 A;  3V7R A;  2DI3 A;  5BPI A;  2L02 A;  3KEQ A;  2RNJ A;  3K9T A;  1Z6R A;  3R6S A;  4EGY A;  2MLK A;  1T98 A;  2GA2 A;  2K27 A;  2K02 A;  3IL2 A;  3F3X A;  5D4S A;  2YR2 A;  5E1Z B;  2VT3 A;  4A6D A;  4KDP A;  3VB2 A;  2RKH A;  3BJO A;  1DP7 P;  4LB5 A;  2DK8 A;  3Q5F A;  4OIN F;  2R7F A;  2L01 A;  1SMT A;  3BPX A;  5LGN A;  1TNS A;  2LF7 A;  5FO5 A;  3GZ6 A;  4OU0 A;  3JTG A;  1UHW A;  5FFX A;  1XGN A;  4BHC A;  1SD5 A;  3WTZ A;  4MEX F;  1YLF A;  2H09 A;  2JPB A;  4I0A A;  2VE9 A;  3G3Z A;  3QOP A;  4IHS A;  4A0X A;  2QWW A;  2M45 A;  1F4K A;  1C0W A;  3L7W A;  4UNO A;  5K5Q A;  2UWM A;  1TW2 A;  4Y15 A;  4ESJ A;  1ODD A;  2IA2 A;  4UUV A;  4AIK A;  2A6H F;  2A6E F;  1I6X A;  3BP8 A;  1XSX A;  1S3J A;  3ELK A;  5ERI A;  2H6B A;  4ZYD A;  1BI3 A;  3FMQ A;  3KZZ A;  3RJP A;  2OD5 A;  3FHZ A;  3E6C C;  4MQV A;  1T2K A;  3IWF A;  3LAJ A;  3WTW C;  2CFX A;  4N9I A;  1DDN A;  1IRG A;  5DD8 A;  1O3T A;  3PQJ A;  2DU9 A;  2VBX A;  3I4P A;  1FBQ A;  2FRH A;  1UHM A;  1Q1H A;  5HDN A;  3HUG A;  5EEG A;  1WSU A;  3CLO A;  3TDU C;  2OAZ A;  3TDZ C;  3REO A;  1FOK A;  5LBQ A;  1E17 A;  1IF1 A;  5J8F A;  1J59 A;  2QVO A;  4YFK F;  1BI2 A;  4Q5S F;  1J9I A;  4U7B A;  3DEU A;  1YIO A;  1G3T A;  3JTH A;  1MJA A;  4EJV A;  2EV6 A;  3GO5 A;  3P9I A;  2EFN A;  3BJA A;  3DPL C;  2RGV A;  4Z2Y A;  3IRQ A;  1U5T A;  3WTV C;  3I5U A;  1PUE E;  3GF2 A;  1LJ9 A;  3ZMS A;  2FA5 A;  1FP1 D;  3GX4 X;  1R1U A;  1BJA A;  3KP2 A;  3FXU A;  5D8L B;  5A2Q K;  4HX4 A;  4PGH A;  1ONV A;  1XDU A;  1UB9 A;  3HOT A;  2JTV A;  2ISZ A;  3JAM K;  3IC7 A;  1JGS A;  1ZRF A;  3GVA A;  1A04 A;  2PG4 A;  2VON A;  2AXL A;  3J81 K;  4XBF A;  3T8R A;  3CDH A;  2LNB A;  3N4M A;  5BOX A;  1E2X A;  3DFG A;  3ZMV A;  1FNN A;  5E17 F;  3E3V A;  1WWX A;  4S04 A;  3CO6 C;  3F8N A;  2BBY A;  5D6E A;  5H6Q A;  1ZRE A;  1IXR C;  1D8J A;  2PBI A;  4JQF A;  1DUX C;  4ENK A;  2WC2 A;  3C18 A;  2GQQ A;  1ZLJ A;  1XSD A;  2F5C A;  4CIC A;  1FLI A;  4HAM A;  4BQA A;  3SHF A;  4L18 B;  3TO9 A;  1ZGA A;  2K4B A;  3ZMZ A;  2P4W A;  4U7D A;  1T6S A;  3EYY A;  2PI0 A;  1MJ9 A;  2QQA A;  3E5X A;  1UCR A;  2E7X A;  4YII A;  5E18 F;  4L0Y B;  4BH9 A;  3ISP A;  5JFR A;  1IZ1 A;  1KQ8 A;  3I0T A;  4WCG A;  1I1S A;  3SZP A;  2QBY B;  1BC7 C;  1YW8 A;  2Q8K A;  2D2W A;  5E20 A;  2IA0 A;  4WXC A;  2F5E A;  2QEN A;  1LB2 A;  5F64 A;  1K6O A;  2VOD A;  3GLX A;  4GYI A;  1ZLK A;  4HX7 A;  1TQP A;  3F8M A;  1RUN A;  1YYV A;  4LJZ F;  4OMY A;  2P6T A;  1B9N A;  1P92 A;  3MWM A;  4CGZ A;  3M8F A;  3PFI A;  2WV0 A;  2Y48 A;  1FSE A;  4LMY A;  4KMU X;  3VOE A;  4CO8 A;  3RI4 A;  4MQ9 F;  4WXH A;  1SD7 A;  2ZKZ A;  4KN4 X;  2D1H A;  3R0J A;  1NHA A;  5JI6 A;  2HKX A;  4ESF A;  1HW2 A;  4RGR A;  1LDK B;  1IN5 A;  1ZHF A;  2KKO A;  1U2W A;  4RGX A;  4DQ2 A;  3HSR A;  3GFI A;  1R5G A;  1YTY A;  2HYG D;  2ZXJ A;  1QZZ A;  5LHI A;  1AWC A;  2EV5 A;  2EFP A;  4NB5 A;  2CW0 F;  3JSP A;  1S29 A;  2X4H A;  2AS5 F;  5CVV A;  4RAZ A;  4U0V A;  3F8C A;  4I98 B;  2NS0 A;  1JXS A;  1J7K A;  2DQL A;  1HST A;  5LLQ A;  2UZK A;  5F6F A;  2NAZ A;  1YS7 A;  4ZYG A;  4BAY A;  3WU0 A;  2ESN A;  2WWY A;  4HW0 A;  3HTU A;  1BM9 A;  2UXN A;  3DQV C;  3CTA A;  1SD6 A;  3P9C A;  3TGN A;  4CYD A;  1JE8 A;  5K1Y A;  4ENM A;  3EDP A;  4PCQ A;  2FF4 A;  5H20 A;  1MDM A;  2FOK A;  5EEH A;  4B09 A;  3LA7 A;  2PMU A;  1EH6 A;  3WG9 A;  1S7O A;  5CVI A;  3TQN A;  1XB4 A;  5HDG A;  4O5V A;  1I5Z A;  3L2C A;  2ZJ2 A;  2Z99 A;  3F8B A;  3RYP A;  1W7P A;  1EV7 A;  1XMA A;  2M87 A;  1U6G A;  2P7V B;  3RYR A;  4M6Y A;  2OBP A;  4EJU A;  5ILV A;  3CUQ C;  3RPU A;  3EET A;  4Y17 A;  3BWG A;  5BS6 A;  3T1B A;  1EH7 A;  3B02 A;  2KJC A;  3ABT A;  2COM A;  2KIM A;  2A3S A;  3GWZ A;  1SMY F;  3V8L A;  3I59 B;  2WTE A;  4HOB A;  1U5T C;  2HEO A;  3VFZ A;  3GXO A;  2OU2 A;  1H0M A;  4KIF A;  1W4M A;  3FMS A;  2IRF G;  5LHG A;  2HQR A;  2MD5 A;  2JRT A;  3ECH A;  1OKR A;  5D5V B;  1XSV A;  2FQ3 A;  4WX9 A;  4LD5 A;  4R1H A;  3D5L A;  3QPT A;  2L3D A;  4RB0 A;  5CVR A;  3COA C;  2OQG A;  1R58 A;  2CG4 A;  1Z7U A;  2ZNZ A;  5TJJ A;  3GEZ A;  4MNU A;  3QU3 A;  2BGC A;  5HLI A;  2IPQ X;  4EM2 A;  4UVB A;  1V3F A;  5L3C A;  2BV6 A;  5H6R A;  2J5P A;  3FF5 A;  4ETS A;  4M71 A;  1WQ2 A;  1UFM A;  3FM3 A;  1CGP A;  4HV6 A;  2Q0O A;  3ZPL A;  1L3L A;  2XUB A;  4A12 A;  3HSE A;  1IN8 A;  5HS9 A;  4CXF A;  4L5J A;  2DW4 A;  2J5O A;  3C1D A;  3MZH A;  1HW1 A;  3F8F A;  4UHT A;  4LB6 B;  3QP5 A;  2HZT A;  4HA8 A;  3U1D A;  4R79 A;  2DBB A;  2IT0 A;  1OYY A;  5LGU A;  3O6B B;  4PDK A;  1YFH A;  1MKM A;  2IVM A;  1FC3 A;  1O3S A;  4IXA A;  3SFZ A;  1BI0 A;  1FP2 A;  4I01 A;  1XCV A;  5HOO A;  4IPA A;  1Z91 A;  3WU1 B;  5BPD A;  5E1X A;  1QQI A;  3HHH A;  2XKP A;  4M6X A;  3BZ6 A;  3BOQ A;  2NRA C;  2VN2 A;  1O7F A;  4ZYE A;  1IXS B;  4U88 A;  3L00 A;  4HDV A;  1LQ1 A;  5JVT A;  1GXQ A;  5FLX Z;  3HRM A;  2V9V A;  2O61 A;  3KE2 A;  2P5K A;  5L3E A;  1X3U A;  2W57 A;  3IRR A;  3CUQ B;  2P8T A;  5BQT A;  3WTS C;  1BI1 A;  2H94 A;  4LG0 B;  4CDG A;  4KT5 C;  1GHC A;  3ZN1 A;  3QU6 A;  5CYV A;  2VOO A;  1I27 A;  4G6Q A;  4IRI A;  3MZY A;  5L3B A;  4YIF A;  2X0L A;  4B8X A;  3K0L A;  2R3S A;  2CSO A;  3BRO A;  3M9A A;  1W5T A;  1IXC A;  4Q47 A;  2EFO A;  4MEY F;  2ETH A;  4HDU A;  5DDG A;  1QO0 D;  2LDU A;  2A5Y B;  4UV8 A;  5ILU A;  2YPR A;  1WI9 A;  1Z05 A;  2HFH A;  1STZ A;  1KU2 A;  2DT5 A;  4GCV A;  4P5O A;  5FD5 A;  2IJL A;  1HKS A;  2XRN A;  3WGG A;  2W85 A;  1FBU A;  3I64 A;  4N9H A;  5DCF A;  2PEX A;  1KU9 A;  1OPC A;  1F1Z A;  4RB2 C;  1J0R A;  4MTE A;  2BE5 F;  4JK1 X;  1Z1D A;  3MEX A;  2YX4 A;  2EFW A;  1VTN C;  1ZG1 A;  1LEB A;  1IAW A;  2FNP A;  2A69 F;  1WRJ A;  2Z33 A;  3L09 A;  1LVA A;  4I02 A;  2M8E A;  4ESB A;  3TKY A;  2CGP A;  5HDK A;  1ZG3 A;  1B59 A;  4LLL A;  5ICF A;  4IVN A;  4XLP F;  3CJN A;  3MQ0 A;  4G7Z F;  3RIR A;  2MC3 A;  4BHB A;  1R7J A;  3BDD A;  3DV8 A;  3V8K A;  3IKT A;  3LWF A;  3C3W A;  3KZY A;  2FXA A;  4N0B A;  2E7W A;  3ZN0 A;  1U8R A;  2DTR A;  5FFZ A;  5KVR A;  3LFK A;  4HF1 A;  2HOE A;  3E5Q A;  3GFL A;  4L5I A;  2DQR A;  4A5M A;  2ZME B;  2DO7 A;  3GFM A;  3WE3 A;  3U9G A;  2ZCW A;  1KQ0 A;  4HLX A;  5DCM B;  1T38 A;  4ZZD A;  3E5U A;  2FMY A;  4WF2 A;  4A6E A;  3H3U A;  3ZMT A;  3HSF A;  1RNL A;  4UVA A;  1R36 A;  1K7A A;  1R1T A;  1H9G A;  5J8C A;  1Y0U A;  2JZY A;  5IT9 Z;  1ZRD A;  3Q9S A;  3HHG A;  2DFI A;  3K69 A;  4P55 A;  2C6Y A;  2B0L A;  3ZMD A;  1HW5 A;  2STW A;  1FBS A;  2FBI A;  2IW5 A;  3KP7 A;  3W6J B;  4JBA A;  4ENJ A;  2H27 A;  4HYE A;  4U0W A;  1R00 A;  4KMF A;  4AWX B;  4F7Z A;  1RIO H;  3NRV A;  1K78 A;  5ILS A;  1XGO A;  3LQQ A;  2XGX A;  3QP6 A;  3HRU A;  2ZNY A;  4BHP A;  1S6L A;  3PQK A;  3B73 A;  3WOD F;  3R61 A;  4M9Z A;  2VE8 A;  5JR3 A;  3EQL F;  3HTS B;  2QQ9 A;  3RKX A;  5D5W B;  1ZRC A;  2QBY A;  2P5V A;  2A61 A;  1FSH A;  3F6V A;  5LRS A;  2P5L C;  3F6O A;  2Z5U A;  4ASN A;  4ZZL A;  5DUI A;  3E6D A;  2XAF A;  2GXG A;  3FXR A;  3KEO A;  1BBY A;  3I71 A;  3ZMU A;  3V7S A;  2HQN A;  4RGU A;  4A2U A;  3NEU A;  4IHT A;  1BN5 A;  4L9T A;  5AIP A;  4R8H A;  3FX3 A;  2ELH A;  1MJB A;  2QUF A;  1PP8 F;  5TRD A;  1PDN C;  4I0B A;  3M1E A;  3LAP A;  2R7D A;  2V1D A;  1LEA A;  1QBJ A;  2HGC A;  2LF8 A;  3ML6 A;  3R0A A;  4Q48 A;  3M8E A;  4LGW A;  1XD7 A;  2MA3 A;  2EV0 A;  1HKT A;  2P6S A;  3FXQ A;  1GVJ A;  1SFX A;  1G4D A;  3KFW X;  3DP7 A;  2DPD A;  4OIQ F;  2LKP A;  2FBK A;  3O3K A;  5F1R A;  4MHG A;  4ZH4 F;  4HV5 A;  1CF7 B;  1V4R A;  3VOD A;  2FU4 A;  4D0P A;  2TDX A;  3GZ5 A;  3MCZ A;  3KLO A;  4OIP F;  2IP2 A;  2JT1 A;  5LGT A;  3HOS A;  4HQE A;  1T39 A;  3P7N A;  4KA4 A;  1G3W A;  1TQM A;  5HLH A;  4EQQ A;  5D5U B;  4MTD A;  4QWQ A;  5DD4 A;  2VXZ A;  4M72 A;  1DPU A;  3V4G A;  2PQ8 A;  4IRH A;  1FPQ A;  3LA2 A;  3VEP A;  1LNW A;  1ON1 A;  1WKM A;  3QRF F;  1IUY A;  4G6D A;  4UVC A;  3F72 A;  4FHT A;  3NQO A;  2L54 A;  2VC1 A;  5CVJ A;  3W6K B;  2XAS A;  5K5R A;  1ZG5 A;  2PN6 A;  4IF4 A;  2L4A A;  2W84 A;  4LK1 F;  5D6F A;  1HBX G;  1R1V A;  4O6J A;  3I53 A;  2HR3 A;  1SFE A;  2FBH A;  4KN7 X;  2O8X A;  1SD4 A;  4GGG A;  5LRR A;  4ON0 A;  2A07 F;  6PAX A;  3ABU A;  2Q2E A;  1XDS A;  1TBX A;  4UV9 A;  4K2E A;  1KQ9 A;  1F5T A;  5CLS A;  2HYF A;  2L4M A;  2F5F A;  3SXY A;  2G7H A;  2DK5 A;  1S8N A;  4EJW A;  3ULQ B;  1GXP A;  5L3D A;  5DYM A;  4EM1 A;  3WE2 A;  4I2O A;  2GIV A;  2XAQ A;  3SZT A;  1SFU A;  2PMH A;  4WK8 F;  1KYZ A;  1R22 A;  4FX4 A;  3F21 A;  1G3S A;  4YG2 F;  3V7C A;  4P96 A;  3GUD A;  1YW7 A;  2FNA A;  5HVQ C;  4OOI A;  2RN7 A;  1YO5 C;  1YQA A;  3I59 A;  2XAG A;  1HSJ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...