3HPHA

Closed tetramer of visna virus integrase (residues 1-219) in complex with ledgf ibd
Total Genus 64
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
64
sequence length
210
structure length
194
Chain Sequence
NIPLAEEEHNKWHQDAVSLHLEFGIPRTAAEDIVQQCDVCIDHWQVDYTHYEDKIILVWVETNSGLIYAERVKGETGQEFRVQTMKWYAMFAPKSLQSDNGPAFVAESTQLLMKYLGIEHTTGIPWNPQSQALVERTHQTLKNTLEKLIPMFNAFESALAGTLITLNIKRKGGLGTSPMDIFIFNKEQQRIQQQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords Integrase
publication title Structural basis for functional tetramerization of lentiviral integrase
pubmed doi rcsb
source organism Maedi visna virus
total genus 64
structure length 194
sequence length 210
chains with identical sequence B, C, D
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2009-06-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00665 rve Integrase core domain
A PF02022 Integrase_Zn Integrase Zinc binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.200 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Arc Repressor Mutant, subunit A 3hphA01
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 3hphA02
1HJRA 1REVA 2ETJA 2DFFA 4B8AB 3RRHA 3SUOA 3QINA 4FZZA 3HJFA 1TK0A 2HVIA 4N47A 4DTOA 1NOZA 3ZT2A 4Q0BA 1D9DA 4FJNA 4CEAA 3HP6A 1ZYQA 1LWCA 1Z25A 1VSEA 1S1WA 1RBRA 1RDDA 4IFYA 1EXQA 3BDPA 2XY5A 2X6SA 4IDKA 4QAGA 4CHOA 3AO4A 3UIQA 3LAKA 5FRNA 4ICLA 2XO7A 4DTNA 1TKDA 4J2AA 1T05A 3TR8A 3DLGA 1NK4A 3VQCA 4BWJA 3NHGA 4F2SA 2HHTA 4ID5A 1RT7A 4O4GA 1I3AA 1UA1A 4R5PA 3VQAA 4DFJA 4B3OA 3PO4A 4J2BA 2E6LA 5HBMA 3CM5A 5J2NA 4Y1DA 3ZCMA 4RW6A 1X9MA 4KI6A 3OVNA 3HPHA 3ISNC 4W5QA 4FM2A 1T03A 3F9KA 4DQRA 4OKKA 1XC9A 1C1BA 2E4LA 3LP2A 4BE2A 3EY1A 3NGIA 4I9LA 4E89A 3ZT0A 4HVJA 1XHZA 4NCBA 3SQ4A 2A1RA 4B9MA 4KREA 1IKYA 4Z4HA 4KB1A 2PYJA 4HUEA 1QSLA 3KTQA 4DSIA 5SZTA 4B08A 2XY7A 3TAGA 3LANA 1VK0A 1S9EA 4W5TA 3VQ9A 3CG7A 1RCHA 3HSTB 4UQGA 3NAEA 1IKVA 5J2PA 1L3UA 3TABA 3QEPA 3S9HA 1CZ9A 5HROA 5CYQA 1ITGA 3AA5X 2KZMA 5FROA 1SKSA 1QHTA 3OS1A 3QNOA 1KFSA 3LALA 1TAQA 2JLEA 3T19A 2D0BA 4G1QA 4E7HA 1TL3A 3AVHA 5D3GA 1MW7A 3B6PA 4BE1A 3NGZA 4YNQA 3H08A 3ULDA 1NK0A 2HMIA 3AO1A 4I2PA 3NBPA 2HHUA 3LDSA 1HNVA 1JLEA 2OPSA 3JYTA 2BDPA 4BDPA 2HHXA 3AVCA 4CEDA 3SUNA 1W0HA 3LAMA 3NH2A 4IG3A 3LP0A 3L2VA 3LPTA 4FJ8A 4DS5A 4CJEA 2YNFA 1U49A 1NK8A 3QETA 3K59A 3QLHA 1BI4B 4FXDA 4HUFA 4DTPA 1VRTA 2XHBA 4OKJA 4Z4GA 1WN7A 4AILC 3O3GA 3U6FA 3DLBA 4CK2A 3CM6A 3AVJA 3M8SA 3OYJA 1R0AA 3L3VA 2IGIA 3SV4A 1QTMA 2O4IA 4CJSA 3VN5A 3VA3A 1HYZA 3L2QA 1NKBA 4QCLA 3I8DA 3P5JA 2Z1JA 1VSFA 4M3TA 3THVA 3T1AA 3HYFA 1C1AA 4CIFA 4BDYA 4DTSA 4E0DA 5FRMA 3ZSRA 1WSEA 1C6VA 3HO1A 1RT5A 2YV0X 2VG7A 1SUQA 4GMJB 1G15A 3OJSA 4FLTA 1WSHA 3KD1E 2Z1IA 4CJLA 2Z1HA 4FCYA 3VQBA 4AHSA 5HRSA 1F21A 2LSNA 1RTHA 4DSFA 3DLRA 3SCXA 4FK0A 4HTUA 3A2FA 3SQ1A 1UWBA 3PV8A 3M8PA 5E41A 1RILA 4C8OA 2KW4A 4CGGA 1RTDA 4CJKA 3OYDA 1JL2A 1LW2A 2W42A 3OYIA 3QEVA 1X9SA 4E3SA 1FXXA 1RBTA 3MECA 1BQMA 4CECA 4DSEA 1ZBFA 5HLFA 3I0SA 3NE6A 3HPOA 1YT3A 3D45A 4JS4A 2FBVA 3NF7A 1SL2A 2KFZA 1J9AA 1TKXA 1Z26A 2DFHA 3HL8A 3KKRA 3WNHA 4CGJA 2Z1GA 5KRTA 3SJJA 4JLHA 2HHWA 1VRUA 1NJZA 4DTXA 1N6QA 4DQIA 5KTQA 3DRPA 3QNNA 2QKBA 2B6AA 4JRPA 2YNGA 4B9LA 1S9GA 2GBZA 4FJIA 4OLAA 4DU1A 2P5GA 5HRRA 2IS3A 4DTMA 4C8KA 2ZE2A 1GOCA 4MFBA 4E7LA 3LZIA 3TAEA 4HCBA 3AVKA 3ALYA 4CJVA 3OY9A 3ZT1A 1VSJA 2WONA 4CE9A 3TAPA 3S3MA 4CJ3A 4RW4A 5KI6A 1KONA 2HHVA 3AVGA 1C0MA 3F73A 2OPRA 4CHZA 3KJVA 1DTQA 1WAJA 4RW8A 1TKTA 1ASWA 1YVUA 3HP9A 4FLUA 3MXJA 1LWEA 1Y97A 1GOBA 4LH5A 4CEZA 3OYGA 1U4BA 1VSMA 3IG1A 1HYVA 4OVLA 2KFNA 4RG8A 1B9DA 1J5OA 2DTUA 1B92A 4C8NA 3RMAA 3OYFA 1JLCA 2HW3A 4CESA 3OYLA 1O1WA 4MQ3A 5JS2A 5KGXA 3OS2A 1NOYA 4TSXA 1SKWA 3CYMA 1NK9A 2OZMA 3TAQA 2HHQA 4OPKA 2HVHA 1LFPA 1HQEA 4IKFA 1YTUA 4CHNA 4CJUA 2OYQA 1JLGA 4HUGA 4E19A 1RNHA 4DF8A 2YNIA 1S1TA 2NUBA 3M8QA 2DFEA 4DSKA 1JL1A 5K14A 3IRXA 1GOAA 3TAMA 4N56A 3V9WA 3PX6A 2FBYA 1WJFA 1RT3A 5KRSA 3OYKA 5J2QA 2HB5A 4WE1A 1U45A 4DG1A 3IS9A 1NK5A 5FDLA 4KHWA 3NFAA 4H4OA 3VQ8A 4O55A 2XY6A 4FW2A 1RT4A 3VQ7A 3VQDA 4DFKA 5HRNA 3O3FA 4DLEA 1ZBLA 5C25A 4DWIA 2EHGA 3DRSA 1DTTA 1S1UA 1KSPA 3C6UA 4M3WA 1RTJA 1Q9YA 4CGFA 2B4JA 1TKZA 3VQQA 3NGYA 1A5WA 4F3QA 4CIEA 1TL1A 1WSIA 4FLXA 1HMVA 3K5OA 4RW7A 4DU4A 4LSNA 4CJWA 4DTRA 2G8HA 2KQ2A 4B9UA 4J2DA 1C0TA 4M3XA 1ZBIA 5SWMA 1BCMA 3JSMA 2KTQA 3CQ8A 3O4QA 4DMNA 4GVMA 4F3OA 1KLMA 1IG9A 2E6MA 5J2MA 3ZSOA 2GUIA 3KLHA 1BI4A 3TWHA 1RDAA 1N5YA 2AJQA 4KRFA 4LH4A 4KTWA 3SPYA 4CEEA 1TVRA 4CGDA 3K5MA 1DLOA 1TV6A 3ZSQA 2IC3A 3LP3A 4LD0A 3RMCA 3C94A 1HPZA 3LWLA 3TARA 4EP5A 3LZJA 1L3SA 3LPUA 3L3UA 3HVRA 1RBUA 1WLJA 3SZ2A 4CJQA 3AVIA 3MEDA 4CJPA 1J53A 1QSYA 4DSJA 1I39A 4KKOA 1D5AA 4FLVA 4OKEA 1RBSA 4OGEA 4PA1A 3AO2A 4B8CA 3QIOA 3OYAA 4KV8A 3OYHA 4Z4IA 4JS5A 4DF4A 5J1EA 1SL1A 4H4MA 4FK4A 4FK2A 3NH0A 4W5RA 3CFOA 1A5XA 4FJJA 1HQUA 3KLIA 4LY7A 3L8BA 2DY4A 2XY8A 4F2RA 2F8SA 2GV9A 4FLYA 5HRPA 3DLHA 2HNYA 3AA4A 2ATQA 4Q5VA 1JLQA 3DOKA 4ELVA 3AVLA 3SI6A 1U04A 4L8RB 1MU2A 2QXFA 1KVCA 3PY8A 3DRRA 2P1JA 3WNGA 3U3YA 4I9QA 4W5OA 3PO5A 4BE0A 4E7IA 1RT2A 2VWJA 4FJGA 2P5OA 4KB0A 4M41A 4K8ZA 4B9TA 1C1CA 3OYMA 2G8UA 3RMBA 4CFAA 4FJ7A 1FKPA 1BCOA 1LAWA 3BGRA 3AA2A 4CEQA 3ZSVA 4CFDA 1RDCA 1TGOA 3O4NA 1KVBA 3HM9A 3SV3A 3VA0A 4NCGA 4DQQA 1LWFA 3ZT3A 4O0IA 2RF2A 4GW6A 4CGHA 4CJTA 4KTQA 1HNIA 1B9FA 3E01A 1NJWA 3ZT4A 5CYMA 4FZXC 4CEBA 3RR8A 4FJXA 4CEOA 4OJRA 3ZSWA 3V1QA 5I3UA 1J54A 4DLGA 1TAUA 4N76A 3K2PA 3OYBA 4ZTJA 3U3GA 4CGIA 3NCIA 3SPZA 3QEXA 3MXIA 2BANA 3DM2A 1L5UA 1FK9A 2X78A 4F4KA 5JS1A 4Z0UA 3NF6A 1WJEA 3L2UA 1L3TA 1BQNA 2JGUA 4H8KA 2IOCA 4KHQA 1JLFA 4FVMA 1BHLA 4KFBA 3ZSXA 2D5RA 2RKIA 3KLGA 3V6DA 1W9HA 2XRIA 4KI4A 1BIUA 4O0JA 1S6PA 4CF2A 4J2EA 1WJAA 4W5NA 1JXBA 4RW9A 1QSSA 3CFRA 1KRPA 4NYFA 1S5JA 3AO5A 1X9WA 1WNSA 5DMRA 2HNZA 2VG5A 4CJRA 4CCHA 3NF8A 4FJLA 3PX0A 1T8EA 3RRGA 1RT1A 3DYAA 3AVBA 2A1SA 4CK1A 1EKEA 4CERA 3SUPA 2D0AA 1SKRA 4FYDA 1NKCA 3NF9A 3ZSYA 3HK2A 3VQ4A 2QKKA 4EP4A 5CZ1A 4PY5A 1WSJA 4FZYA 3TI0A 1IKXA 4XIUA 5KGWA 4KHYA 2IDOA 4CJ5A 4KO0A 3T3FA 5I42A 1ZBUA 2X6NA 3AVAA 2YKNA 1WSFA 4BACA 4M3YA 3VQEA 3C95A 1QE1A 3I0RA 1S1VA 4ZTFA 4LSLA 1U48A 4KHSA 3DI6A 3SUQA 1SL0A 3L2RA 2G8WA 3RR7A 4FJ5A 3SQ2A 2ZD1A 2WOMA 1JLAA 4FM0A 1RT6A 3SQ0A 1RTIA 4CEFA 1Q8IA 3QEIA 3EZ5A 1RBVA 1TK8A 3KLEA 1JKHA 5C42A 1NJYA 3NDKA 3MAQA 2FBTA 2YHBA 4ELTA 4KPYA 3KLFA 3EYZA 4IBNA 2YKMA 3WNFA 1S6QA 4B9NA 5DK5A 2ZQBA 2BGGA 3VQ6A 4N5SA 1KCFA 4DSLA 1JXEA 3KIOA 1NJXA 3QO9A 1ZBHA 1YTAA 4FJMA 4DU3A 1VSLA 4OLBA 4CHPA 4DFPA 1BGXT 2OZSA 4FJKA 4E1MA 3TANA 4ID1A 4M3UA 1SV5A 3AO3A 3QIPA 3M8RA 3CFPA 4C8LA 4HCCA 2EX3A 5EU7A 4M45A 2RPIA 1E0EA 3PX4A 1NK6A 4B9VA 3OYNA 4KAZA 4NCAA 3DLKA 3HVTA 4JRQA 2YNHA 1WJDA 3DMJA 1XHXA 1WSGA 2F8TA 3SYZA 3K58A 4Z4FA 3G0ZA 1K6YA 3AVFA 3C6TA 2VG6A 4Z4EA 4KHNA 3K57A 3S3NA 1EETA 4DTJA 1IKWA 3ASMA 3FFIA 3QEWA 5CZ2A 4CHQA 3OS0A 2Y1IA 3OJUA 1LW0A 4CFCA 3V9SA 3MEGA 5CY4A 2YHAA 4C8MA 3D0PA 1CXUA 3V9XA 3MXMA 1D8YA 2OA8A 4PWDA 2HNDA 3AA3A 4NYNA 1CZBA 3DLEA 4IFVA 4AHCA 2G8KA 4K8XA 4M42A 4CJFA 3OYEA 4FW1A 1VSHA 1EX4A 4DTUA 2I5JA 3AV9A 3VQPA 3RTVA 1KFDA 3P83D 2KZZA 4B9SA 3PUFA 4I7FA 3ITHA 1VSKA 1EP4A 4AH9A 4FLZA 1IH7A 1Q9XA 2QK9A 2FBXA 4IG0A 5HP1A 4CF9A 2OPPA 4AHRA 1WAFA 4ZHRA 3NH1A 2RN2A 3V1OA 3LWMA 4ELUA 4AHVA 3KD5E 2G8VA 2HHSA 4CHYA 4CK3A 4Z4CA 4E1NA 1S1XA 4BWMA 4DFMA 3HPGA 3K5NA 4E7JA 3KK1A 3DOLA 4F3TA 3G10A 1WJBA 1BIZA 3KKSA 4CFBA 4DQSA 3KK3A 1KTQA 5C24A 2PZSA 1UAXA 3V1RA 1NKEA 1L3VA 4KTZA 1HRHA 4DS4A 1XWLA 3RMDA 1T7PA 5T7BA 3HXMA 4EZ6A 4F8RA 4O44A 1CXQA 3WNEA 2G8FA 1IO2A 3MEEA 2PYLA 3O3HA 3TAFA 1ASVA 1X1PA 2F96A 3P1GA 2O4GA 4YFUA 1WJCA 4FLWA 1NK7A 4FJHA 1VSDA 3V9UA 3IAYA 4CF0A 4CIGA 1U47A 3V81A 2D0CA 4AHTA 4E7KA 1FKOA 2IAJA 3S3OA 4DQPA 4FM1A 1UA0A 4EZ9A 3RWUA 1KVAA 1BISA 1UOCA 3QERA 2P51A 1D9FA 4FJ9A 2B5JA 2X74A 1KLNA 4PQUA 4CF8A 3K5LA 3L2WA 4CJ4A 3SNNA 4QOZB 1C0UA 4Y1CA 1BL3A 2Y1JA 4N41A 1HYSA 2VWKA 1RDBA 4PUOA 3OYCA 2BE2A 4AHUA 1QQCA 2R7YA 4I2QA 3AVMA 1ASUA 4O5BA 4OGCA 2G8IA 2Q3SA 1A5VA 1JLBA 3ZSZA 2OPQA 1XI1A 4KHUA 3V9ZA 4BDZA 1CLQA 2FC0A 4M3ZA 4HHTA 4CF1A 3AVNA 1TK5A 1LV5A 3B6OA 1LAVA 1QS4A 4M3RA 3KK2A 3V4IA 3VQ5A 3QESA 3LP1A 2PY5A 2ITGA 1VSIA 3HT3A 4OPJA
chains in the Genus database with same CATH superfamily
1HJRA 2NRAC 3WTSC 1AWCA 2NOJB 4XEIA 4IXAA 4FJNA 1RIOH 3ZPLA 4IF4A 1QQMA 4Y3OA 2EFPA 3U9GA 3VTHA 4IDKA 4B1WB 2NZTA 3CCMI 1NGAA 1T05A 1J59A 2ZJPF 4R5PA 4MGRA 2UXDK 5IYBJ 2GTDA 3H3VK 4AIJA 3OVNA 4XORA 3Q0VA 3DTIA 4Z4HA 2O8CB 3IH3A 4D7MA 3HGGA 1USTA 4Y15A 4FT8A 3I54A 2PAVA 4B09A 4QPOA 5LEJA 1OH5A 1WRJA 2XAQA 3AL0C 1TAQA 2JLEA 1MWKA 4ZZLA 4IVNA 4A0XA 2CO5A 4RGRA 3NGZA 2M87A 3IAS2 1HNVA 3IMXA 4LK1F 3NH2A 4FJ8A 3L2VA 1W0UA 4HUFA 4FX4A 4AILC 4CK2A 1OH7A 5CPRB 1YW9A 2O4IA 4AIHA 4WCEL 3I8DA 4NQWA 3THVA 3CC7I 3MMYB 2VASA 2HBMA 3EE9A 1V5EA 4EIAA 1D3YA 1MD0A 3OIOA 3A2FA 2W41A 1WJ5A 3C2BA 5BRHA 4CJKA 3KEQA 5EVZA 4RAGA 3HPOA 4A3JJ 4YIRX 2Z1GA 2QQBA 1NJZA 4DQIA 3CESA 2BZTA 2E34A 4U0WA 2JA8J 4XR6A 2FF4A 2P5GA 3QFUA 5K7ZA 3TAPA 2L7KA 5FFXA 3AVGA 3TBIA 3R6MA 4G9ZA 3G71I 4FLUA 2WC2A 2KFNA 2DTUA 3OYFA 1JLCA 3TAQA 1VQPN 4CHNA 3CJ9A 3WTWC 3KYDB 5HLIA 4N9HA 5KRSA 3IS9A 3I8BA 4KFCA 2VQFK 1N33K 4A5MA 1Z1DA 3RPUA 4DJAA 1TL1A 3BJAA 2F5FA 4ZYHA 3CC2I 4A3MJ 4OIOF 2D4WA 4JI5K 4H4KC 2LBFB 1S7AA 2LG4A 3KWGA 3RKXA 2DQRA 2VE9A 4ZYGA 1LPQA 4BRPA 3NH0A 4CD1A 3CFOA 3UNGC 2GV9A 1CZAN 4IOCL 5D5XB 3VGMA 3PY8A 3VETA 1GLLO 3KP2A 4ZYAA 2QYOA 4B3XA 3CJBA 2YX7A 2Q0UA 1ZN2A 3I59A 5EEGA 1VQ5N 1MJBA 3BZCA 3GTKJ 1BR1A 3FXMA 4H0YB 3NCIA 3SPZA 1QBJA 3N05A 1XDSA 3J80O 4A5NA 2IBDA 1GXQA 4L0ZB 1IN8A 4FJLA 1T8EA 3EETA 2A1SA 4CK1A 1V4SA 2V26A 3NF9A 3R9PA 3ZSYA 1FJLA 2RE2A 2LNBA 2GA1A 4JKDA 1BIBA 1N78A 1DT9A 4N4OB 3C95A 4G94A 5AIQA 1SL0A 4EV0A 4FJ5A 3P38A 3CIPA 3S1MJ 2K40A 2MABA 3M4OJ 3O1BA 1FMWA 2LFBA 1NGHA 3C18A 4OLBA 2L5QA 3FKJA 3GL1A 3PX4A 4NCAA 3GBTA 1T98A 4RLFA 1MBGA 3BTLA 1VQOI 4YOWA 4CCLA 3ERMA 1AHDP 3M8FA 5F0FA 4GO1A 3RPQA 1S9HA 4K25A 2VJIA 2V79A 2X1CA 5DV5A 3NEUA 3J7ZO 3ZQ7A 2KIMA 1EWQA 4AH9A 1RR8C 3LA7A 1ESVA 1R5HA 2WBMA 2ISYA 4RWTA 4HLYA 4YOTA 2OU2A 4LB6B 3HPGA 5EOYA 3ABLH 4IJAA 3QP6A 1QO0D 2G8FA 1IO2A 1TNSA 2M0MA 1FKOA 2QM1A 1UOCA 4L9NA 4RB0A 3CCUN 2YX6A 3M9AA 4BGAA 1SFXA 4FASD 3K10A 4WK8F 1A5VA 4BRIA 2DMQA 4JK1X 4ILHA 2K9LA 1ZG3A 3J8AA 2HXIA 3HT3A 4CZIA 4L5JA 1TK0A 3PO3J 2IGNA 3OTOK 4M9XA 1VSEA 1S1WA 1RBRA 4D1QA 5GP9A 3CJ1A 4DTNA 2BXYA 1F5TA 2HHTA 2R5YB 3OL3A 2XAHA 3EE8A 4M6VA 2VONA 2E6LA 2XSDC 3EUAA 3ISNC 3F9KA 3FK6A 5ILSA 3JRBA 2WB1A 3D1NI 2OBPA 5LMNK 1R22A 1ITGA 5FROA 4X64K 3LALA 5H6RA 3L00A 2NNWA 4CEDA 1NK8A 3IDHA 5ELZA 3Q3SA 2OPTA 2UUCK 1SFEA 2NYXA 5ICCA 4QCLA 3THYA 4BDYA 1ZLJA 2V7ZA 3I55N 2WY8Q 3ECHA 2BYVE 2MC3A 4W97A 2A5XA 1RILA 2XAFA 3I0TA 3MMVA 4ISFA 4DSEA 2E1ZA 3NE6A 5GIPA 2FBVA 3CCQI 4CGJA 3SJJA 2WB1N 1S3XA 4BROA 1VRUA 3Q9SA 1N6QA 4YOYA 3IH2A 5D8LB 2DA3A 2F5CA 3DRPA 2X6WA 4B9LA 4RM3A 3GTQJ 4XKCA 4IRGA 3Q5FA 3LZIA 3SMPA 2N8GA 3ZT1A 1IG7A 2WONA 2LKSA 1FLIA 3EUHA 1WAJA 3H3ZA 4LH5A 1HNWK 1JCEA 4C8NA 2EILH 2DPDA 3RMAA 2PEXA 4CESA 3F22A 2CWEA 1LFPA 1WQ2A 5ERIA 3MN2A 4CJUA 1T0FA 2EQRA 1RZ4A 2DFEA 3IRXA 3P7NA 1RI7A 2XY6A 3F6VA 2V4JC 4UV9A 1UJ8A 4A3DJ 4RW7A 4CJWA 1ZBIA 2KTQA 3JAMZ 4DMNA 3WTXC 1OYYA 2E6MA 2JRTA 1BI4A 3JTHA 5KK1A 2IW5A 1H88C 3WU0A 3HTSB 2QWPA 4KKOA 2MSYA 4B8CA 2ISZA 2ZCWA 5K1YA 5JICA 3AVLA 4BQOA 3LNQA 4QLCU 1BL0A 1BJAA 3SXYA 1GLEG 2ZXHA 1CF7B 1BCOA 3AA2A 4FWOA 3ABMH 5C0YA 4KTQA 4LGWA 1FMVA 4FZXC 3B6CA 1MMSA 3S1RJ 4ZTJA 1WBBA 1JKOC 2X78A 1P9QC 2IOCA 2HTSA 4KFBA 2O8XA 3BG6A 4W5NA 4HG2A 1TT0A 1UHWA 1JE8A 4LF9K 3DLAA 3HC7A 2HTJA 2R4GA 4CZHA 4D0PA 5C4XJ 4CBWA 3HK2A 1GHCA 4EP4A 2GWJA 4QPQA 2DYSH 3TU5A 3R3LA 1VQ7I 4LSLA 3C2HA 2WWYA 3L2RA 5AQIA 4D5FA 4NLBA 5H2FC 3THXA 5FO5A 1YJ9I 5DDGA 3KLFA 3EYZA 4RAFA 3WNFA 2ZQBA 3E66A 1JXEA 3GTLJ 1NJXA 4FJMA 4X0GA 4DFPA 3BT9A 5FLXO 3TANA 4ID1A 1SV5A 4HCCA 2Q2RA 4AVZA 3OR2C 4JYKA 3E6DA 5GADJ 2KRCA 1K6YA 4O6JA 1B8IB 1SEUA 2FBIA 3QEWA 1YX5A 1JGSA 1H1VA 3MEGA 5IPAA 3ZETA 4A3KJ 5AFUH 1FBUA 4AHCA 3OYEA 3V8JA 3CERA 3RTVA 1IF1A 3FF5A 2KZZA 2NVTJ 3P4IA 3WE3A 5FJ8J 4B1ZA 4K41A 1WAFA 1FC3A 4DW6A 2G8VA 3WU2C 1ZGJA 2X6OA 3K0LA 4LB5A 1A04A 4KHPK 3VODA 3QPLA 2VYPA 3KKSA 4EM2A 4EJTA 2A69F 1UMQA 2ZJQF 4YFUA 3HOTA 3LAJA 2F96A 3EEQA 1ENHA 1XSXA 3N4QA 4XBFA 4CF0A 4DQPA 4FM1A 3QERA 4FJ9A 4MTDA 2BE2A 1QQCA 3SQNA 2UZKA 3SJMA 5JLHA 3JXUA 5AQRA 4RTFD 4XRMA 1LNWA 4K42A 2HVIA 3KZBA 4XQFA 2NNNA 3CCSN 4FL9A 4BAYA 1Z25A 2VT3A 1EXQA 2HQ5A 2X6SA 3AO4A 2KLOA 4JNEA 3LSHA 5B1BH 3ERED 1MMAA 4BC5A 5ICGA 2FUG2 4O5FA 1I3AA 1S22A 2UWMA 3LOCA 5GINA 1HPMA 3ZR8X 3HIFA 4ABZA 5KAFC 3HOUJ 2F4VK 2PJRA 3TO7A 2Y0SA 5GAHJ 1T39A 5E18F 3AA5X 1E3HA 3OS1A 3CHWA 2O8DB 3AVHA 2BW3A 2JUGA 1S5LC 3ID6A 1BBYA 1NGCA 2YNFA 4LD5A 4KMFA 4UY8I 4V2GA 3P5JA 3CMAN 4M3TA 2W82A 5J40A 4ON0A 5DTDA 4Y7NJ 5LHGA 4BNCA 4OINF 4DTSA 1RGIA 4Q48A 4JKGB 2YSRA 1G15A 5FD5A 2Z1HA 3VQBA 3ULQB 4XN3A 4A69C 3NAUA 1JCFA 3RKWA 4EGZA 4C8OA 2ZSIB 2EV6A 1HOMA 3NF7A 1SL2A 1EH7A 3J80K 4L9JA 1JHFA 3E1YA 1ETQA 2Y0SN 3D5SC 4HZFA 2GBZA 4FJIA 4BUPA 2EJRA 5HRRA 2NVQJ 4MNUA 1Q7YO 4CE9A 1LQ1A 3KP6A 2B9SA 5BRDA 4CHZA 1ZGWA 1Y97A 4CEZA 2Q0RA 1J5OA 3U2RA 1B92A 3PSIA 3OYLA 1O3QA 1XQSC 2HVHA 1HBXG 4BRQA 2RGVA 4FWLA 1S1TA 3GFJA 1W7PD 3DKXA 4DFKA 4DLEA 1U6GA 2OCEA 4M3WA 3RIRA 4AYBA 3GCMA 1I50J 2F5DA 1ACIA 2F5VA 5SWMA 5CR4A 4M6YA 3QBXA 3FXRA 3D5RC 3CETA 2P9UB 2DI3A 3BR1A 2GUIA 1YYVA 5C2DA 3RMCA 2GWRA 4XLEA 4AWXB 5HS9A 3FM5A 3JSOA 1ZGAA 2KMUA 1K61A 2JRMA 1TWFJ 3HSCA 1EO1A 4B4CA 2YX4A 3VWBA 5F2RA 1TTYA 1DU0A 2KJCA 4ELVA 4LF5K 3F21A 4UUSA 3DRRA 3PO5A 2VWJA 4MIMA 4B9TA 1K78B 4CFAA 1F36A 4DQQA 4NC8A 3G25A 4Y33A 4AYBN 3LSRA 2IGKA 1KAYA 3BZKA 4L18B 2XGXA 2A5YB 1OCCH 1OH8A 4CUGA 2W40A 3Q7CA 3CUQC 3Q0UA 3H3NO 3DEUA 4BQNA 3RSNA 2FSKA 3WEEA 3FK7A 1IDYA 4KHYA 3E9PA 2JN6A 3R1XA 1JJ6C 3ATUA 1S1VA 2W57A 1G4DA 1NG6A 1UZCA 3EKUA 5F0HA 5M1NA 4JK8A 3F23A 3R8EA 1KC8O 3BF3A 2J5OA 3E5XA 1DKGD 3VGKA 2OZSA 4HLXA 2MD0A 3AO3A 3K1MA 1Y1WJ 1NK6A 4B48A 4XM3A 4KAZA 3PUBA 4BRGA 1X4PA 3FZVA 1XHXA 4NXNK 4QS7A 3HBTA 3S3NA 3DWLA 2DMPA 3R6SA 2W84A 3KP3A 5CKTA 1T08B 4GV6A 1UHMA 5IP6A 3V8KA 2K3PA 3TP0A 4K2EA 3QYBA 4PGHA 3BY5A 3PUFA 1KZHA 1MH4A 5AQGA 3W6KB 2OQGA 3C7NB 2V1NA 3H45C 4AHVA 5E3LA 2HHSA 3CDLA 2HXOA 4ILJA 5LEKA 1YO5C 5C24A 5EEAA 5AQLA 2VIXA 4I7HA 1VQ8N 1WJCA 4DBQA 1B59A 1YUWA 5E3OA 3FGUA 4Z94A 4EZ9A 3T0YA 4PQUA 2MH2A 3CDHA 3CJNA 2RKHA 1XI1A 3KETA 1CLQA 2FC0A 4WQ5A 1LV5A 4ENMA 2PY5A 2XB5A 2PX9A 3OMYA 2H1KA 2WFBA 2GM4A 3F8FA 1TC3C 4B1VA 1RDDA 1HSTA 4Q4ZF 3UIQA 5FD6A 3TR8A 3VQAA 1DGRM 1V5GA 2QWRA 2E7XA 4CXFA 4BE2A 5M3MJ 1MSEC 4GYIA 4DSIA 4B08A 2XY7A 2ZGZA 3AG4H 4HNUA 4MO4A 1BU6O 1DPRA 2HF4A 4WQ4A 4K43A 1JJ8C 1FZPB 1QHTA 2GUPA 2O6GE 1U8RA 3A03A 3B6PA 3ULDA 2UUZA 1WFXA 5FKLA 4BDPA 4XMYA 3FM3A 2CU7A 5E8IA 3QLHA 3VEYA 4DTPA 3ABUA 4EGYA 2EZLA 1TQIA 5A2QK 4G7OF 1LDDA 1OCZH 4P55A 2FXUA 5M5XJ 2H94A 3KEOA 4IHXA 5FKOA 4II2A 2WTUA 2O8FB 5JLXA 4CZEA 1RDUA 2DAOA 2EFOA 2DTRA 3MVPA 2ZMEB 3M8PA 2BUPA 4FWSA 4WF2A 2L0KA 1HW2A 1GVJA 2L3DA 3HL8A 2F4IA 2FA5A 1VQNN 3CC4I 3LSIA 3VOEA 5F0XA 2XROA 2KDZA 3BJOA 4DU1A 1E3PA 3H1VX 1F9NA 1TWCJ 3CF5F 1KU2A 2O5RA 4E7LA 3ALYA 3FIWA 1MJ9A 5KI6A 2KIUA 4XOPA 3ZX0A 1X3ZB 3OYGA 1QPMA 1EV7A 1WHUA 2ASPA 1Y0NA 2Q2EA 1R49A 3B73A 2HW3A 1SKWA 2V1UA 4BXUA 5DEQA 4HUGA 1APLC 2OAZA 3BY6A 2O8CA 3V9WA 2M0CA 2OZ6A 5FLXK 3GZNB 3RCOA 1Z7UA 1QHAA 1Q9YA 1QQNA 4DYRA 4H5RA 4HSTA 1JUMA 3HBLA 1HMVA 2E60A 4KIFA 3O4QA 1KQ8A 4LK0F 3IKTA 1IG9A 2EFNA 4ZJZA 3GFMA 2EFQA 1N5YA 2H6BA 1TVRA 1NGGA 3C7JA 4CGDA 3K5MA 1MMNA 1ORKA 4ENNA 5F1XA 1L3SA 3BQYA 1BI1A 4IOAL 5D4SA 3GO5A 3AO2A 4BRMA 4Z4IA 3GF2A 4JS5A 4BR4A 4LJZF 2ZXIA 2F8SA 5J4VA 4RGSA 4IQJA 3KLNA 1ERDA 3O8HA 3HOYJ 4AIDA 2QEXN 4FTHA 2PG4A 5TRDA 1FKPA 3CJCA 3TL4X 4XNFA 5AR0A 1IV6A 1TQPA 2R3SA 1YI2I 3JAMO 2Y30A 1S72I 1ZRDA 1NGIA 2HBJA 1F4KA 4H8KA 5L3GA 4PSXA 4JK7A 2V7FA 3ZQLA 1STZA 2BHYA 2F6CA 2HEOA 3KP7A 3LSJA 1EKEA 4YDUA 1ATSA 1NTCA 1NGDA 3H92A 4TV7A 1WSJA 4XIUA 2IDOA 4M3DA 1ZR2A 4CJ5A 2DPUA 2DOAA 3RYRA 1K79A 3VQEA 1BR4A 1UFMA 2NXNB 2W6LA 1W7PB 3EZ5A 1RBVA 3ZQFA 3LSKA 3EUKL 2YKMA 4B9NA 2RVCA 4Y52J 3GTOJ 2LBFA 3CFPA 2EX3A 3UKGA 5E26A 3OYNA 3HVTA 1WSGA 3D2FB 2KKZA 2ECBA 3AVFA 2E1MB 2WADA 1YQAA 3K57A 2MC4A 1UB9A 3D0PA 2YJEA 3C6AA 1CZBA 1NGFA 4JP0A 1ZKGA 2EWNA 1WKMA 3TTCA 5K5RA 1NK3P 3K9KA 2QW9A 3ITHA 1WUAA 4FLZA 2QK9A 2FBXA 4IG0A 5TGTA 3MCAB 2O8KA 2FMLA 4M7XA 1NU0A 1AU7A 1MNMC 4DFMA 1JKPC 2W00A 4RB3C 5T7BA 4OPHA 3DQVC 4LF7K 2BEOA 1CXQA 2PYLA 1JKRC 1YJNN 3HXLA 2DDBA 4MFEA 2JPCA 3MK6A 2O0YA 1OCPA 4EM0B 4PKIA 4EVIA 1T6DA 1ZQ3P 4HHTA 2CGPA 3LM2A 2LH9A 1H8AC 4JHDB 1P7JA 1ZYQA 1OMIA 1X1CA 3OSGA 1X4OA 2GQQA 4IFYA 3BDPA 2XY5A 4PCQA 1M1EB 2XO7A 1NG7A 3H5NA 3J7AO 4IDHA 4WX9A 5D5WB 2BY1A 4RB1A 1C0WA 4FWRA 1VHXA 4DIQA 2P5KA 5LJWA 1XHZA 4DR6K 1FOXA 3LANA 3VQ9A 2EV5A 2M3AA 4IWVA 1GLBG 1K4SA 4BE1A 3H08A 4A5BA 3MAJA 3LDSA 3OHRA 4DUYK 5M1QA 2QA4N 3FHZA 3TP3A 1P4XA 2X1DA 3WUHA 3NVMA 1J09A 3LQQA 1YJWN 1WSEA 3A2KA 1RT5A 2BXZA 2CH5A 2UUBK 4O8UA 3CPEA 1RPWA 1XTAA 4F55A 4JI8K 5DD8A 2KHMA 2RV8A 3SCXA 5HOOA 1JL2A 1LOTB 2V6EA 3DAWA 1RBTA 3K9TA 4HW0A 1V55H 3HRTA 4JKAA 4M74A 2NLXA 2GXAA 3CC7N 2QKBA 2YNGA 3LL7A 1S7EA 1BN5A 3I56N 4FOIA 2VPLA 3M1CA 2WV1A 4HCBA 3DPLC 1FSEA 3FR0A 2R5YA 3LSTA 1TLHB 4OPKA 3K4MA 1HQEA 4GY2B 1SVOA 2VPRA 1CGPA 2QENA 1EH6A 2X4HA 2IAIA 5FDLA 1K8AO 3CCJI 4FW2A 3TSUA 1S1UA 4BRAA 3VQQA 1A5WA 3ZX2A 4DU4A 2HPMA 4LSNA 1BA0A 1RKWA 4GVMA 3HTUA 2JJ7A 3CJTB 3K4LA 5B66C 3CQZJ 4FOEA 2ZBKA 1KQSM 4ILGB 1WLJA 2Y69H 4EJOA 5AJ3K 1RETA 1SAXA 4KH5A 3DXJF 2CQQA 3FMSA 3CZ6A 4BE0A 4E7IA 2G8UA 1VNDA 3RMBA 2X6XA 5GAGP 3I4MJ 4AD9A 5J1UA 2DMUA 5I3UA 3MKZA 4DLGA 2LMDA 3ABKH 4OOIA 2ECCA 4O5VA 2BANA 3VGLA 1L5UA 1IV8A 3QICA 4KHQA 3ZMUA 1JLFA 1BHLA 4I02A 2NRRA 4P1WA 4CF2A 3HRUA 3M1FA 1JXBA 2WUSA 3WT0A 3KK7A 4HQMA 4CJRA 4BH9A 3K69A 3O4WA 1ON2A 5IWAK 4P9FA 4JKBA 3WTYC 2PQ8A 1QZEA 3FX3A 2V1XA 2VC0A 1ZBUA 1P8ZA 3F8NA 5FPMA 4A59A 1BOBA 2BY0A 2ZD1A 1HW1A 1JLAA 1D0YA 1RTIA 3WTVC 2GXBA 1IZ1A 2LY9A 1WPKA 1S6QA 4H0TB 4N5SA 3KIOA 5K5QA 1W5CC 2KQRA 3BR2A 2D1HA 1NMNA 4H5NA 4FPAA 2MD5A 1JT6A 3SZPA 3R61A 5IY5H 1WJDA 3CF5L 3SYZA 3RYPA 2WA0A 3T1BA 1ZXOA 5DCFA 1EETA 4HYEA 2FBKA 3BDDA 2QLZA 5B3SH 1WH7A 1CXUA 2DMNA 2A5WA 3EYIA 3GLLA 3CTAA 1CF7A 4UY8O 3VTIA 1Q1HA 2FOKA 1FOWA 5F04A 3IRQA 1VQON 3NH1A 2IS1A 3F9MA 4F7ZA 3TSPA 2P0WA 4A0ZA 4CHYA 4LF8K 3EPZA 3QBWA 3G2BA 4E1NA 4LLLA 3CDIA 2I5UA 4O3MA 3FBNB 3TO6A 1XGMA 1HC8A 3O3HA 2EV0A 4I2OA 3V9UA 1K7AA 4LFBK 1DGWY 1UA0A 4F9OA 3QP5A 2P7VB 4F52A 2R7YA 1SFOJ 3QFPA 2VL8A 1T8IA 1JCGA 4M3ZA 4H5WA 3B6OA 1P2FA 4RB2C 1R4NB 4CCKA 3CCRN 3BR0A 2M45A 1IBMK 4N47A 4CZGA 1RESA 3ISPA 1NOZA 4CCJA 4DCHA 4CEAA 3HP6A 1LWCA 3EZWA 2KZGA 2COMA 1LJ9A 2R7UA 2IVNA 3PIPF 2FNPA 2VJ4A 5HLTA 4BWJA 4DV1K 1B8IA 2P9IB 2DT7B 1YITN 2Y75A 1D1CA 2I7PA 3LP2A 3ECOA 2O61A 1N36K 4KREA 4XKBA 2OTJN 3VEXA 2O8EB 2QKLB 4X62K 3RPUD 3CJQB 3CD6N 3DTKA 3I5UA 2D1KA 4CZCA 1LVKA 4G1QA 3IAM2 4YNQA 2HSTA 2MA3A 3K4BA 3CMEN 3TDUC 1JTXA 2L02A 2FLOA 3H6EA 1W5SA 5AQQA 3M8SA 3OYJA 1QTMA 5BMZA 3H9JA 2HHHK 3WGHA 1VSFA 1HQCA 3E5QA 4Q5SF 1M90O 4HQEA 4ZZDA 4XKWA 2VG7A 2V7YA 3OJSA 5JFRA 2WY7Q 4DSFA 5J4YA 2OTLN 3JAMK 4U0YA 3OYDA 3AFHA 3G3ZA 1LW2A 3QEVA 3PNYA 2OC6A 2QWWA 3WXKA 3HHHA 2EA4A 1MBEA 2IS4A 3MX2A 2ZNYA 1SS6A 3WODF 4LG0B 3O6BB 1ATNA 2CUZA 2VOPA 2XB0X 2CG4A 1X2MA 3PQKA 3GTMJ 3WXLA 1V3FA 5K7HA 1Y8RB 1X1AA 2EFWA 4MDAA 1E2XA 1MJAA 2RQQA 1GOBA 4YOUA 4RG8A 3O1WA 1IC8A 1W1WE 5CVRA 5KGXA 2XUBA 3CJAA 2HHQA 3ZN1A 1BIAA 1TUUA 3E7LA 5K14A 1YTYA 1RT4A 3VQ7A 1KSPA 4CGFA 1TZLA 2O8DA 3OIQA 1WSIA 5GAEP 3J7YP 1SD6A 4LFCK 5AZJA 2ZXJA 2HBLA 5MLCQ 4LH4A 1U5TB 3LDNA 2DA5A 5M1KA 4BHCA 4DHYA 3KZZA 3LP3A 2XGDA 4JI0K 2LLKA 4DBRA 3COAC 2Z99A 4JKGA 2PFBA 4FK2A 3WQTA 4LMYA 4LY7A 2L9VA 4Q5VA 1Z3XA 5LGTA 2QXFA 3GVAA 5DD4A 4K8ZA 2PLYA 3OYMA 2NS8A 1JI8A 2BW3B 3BGRA 5HODA 1BI0A 3HM9A 4KISA 1LWFA 3FDYA 4GW6A 4CJTA 3VYSB 1FYMA 1VQPI 3BEXA 2K27A 4BG8A 4LITA 3NWTA 3BC8A 2D5RA 4JI2K 4PJNA 4RW9A 3IHUA 3AO5A 5M1OA 4HTLA 4BJ5C 4FHTA 2E1CA 2CFOA 3DYAA 3BZ6A 3I3LA 4BGDA 4CYCA 2CSOA 3ZYYX 3AL0B 1YOVB 1HKQA 3TI0A 4C9YA 3T1YK 3I64A 5KVRA 1P7IA 3W3CA 3SFIA 1MBFA 3DI6A 5AZIB 3F3XA 1N77A 1Q8IA 2KLAA 3KHYA 3KLEA 3HZ6A 4UVCA 4JI7K 2P9UA 1LEBA 4ELTA 2F4MB 1XX5A 4BR9A 4JKHA 4IOCF 4CHPA 5E1ZB 4E1MA 3FWEA 1IGNA 1BM9A 4N0BA 2VODA 3WGIA 1E0EA 3WQUA 2DJNA 1VQ7N 2JA5J 1QRYA 2QXLA 2X6YA 1IBKK 1R4MB 1YJ9N 2IP2A 3CMMA 2W24A 1H9TA 3BR5A 2YHAA 2OA8A 3A5OC 2RC4A 2COBA 5CVIA 1VQ5I 5BPIA 1VSHA 1XMAA 2A41A 1W2BM 4DTUA 1K78A 4JX6A 2GBYA 3CI5A 3LDQA 4M7YA 2HKXA 4A57A 1BO5O 5BN8A 4ZHRA 4G7HF 4OIQF 3BG3A 4E7JA 1XS9A 4C30A 3ASNH 1R36A 3KK3A 4A5AA 1ETYA 3MN9A 4EZ6A 4BRHA 3S1NJ 3TAFA 1IRFA 1X1PA 3IAYA 3S3OA 1KLNA 4JBAA 3DBHB 3H9QA 2VQEK 4I2QA 5DCMB 5CLSA 4IHWA 3VESA 2OCCH 1G2HA 3OBWA 2ETJA 3RRHA 2QKMB 4G7ZF 2P4WA 2V51B 4YOXA 3VSLA 2CQXA 1BOAA 1D9DA 2FRHA 4X1EA 2W48A 5LY3A 3M5RA 4FVUA 2OQRA 2WV0A 2A40A 4RW6A 3S2HJ 5ADXH 4DQRA 1HKGA 3CP2A 4CCNA 1IKYA 4KB1A 1O7FA 1JUSA 2P6SA 1J0RA 2P9SA 2M7BA 3CG7A 3J81O 3HSTB 2QI2A 2UXXA 4S05A 2XASA 1L3UA 3S9HA 3ZQCA 5HROA 2CUJA 2EIKH 2P9PA 3C7NA 2DCEA 4D9JA 1NK0A 3S41A 4DS5A 3QDKA 4FXDA 2LY1A 5KPTA 3K4CA 3P39A 1VRTA 3TOAA 2Z3YA 3L3VA 2IGIA 2P9LA 3BTIA 3PIOL 2B63J 2VBXA 5HDNA 1SC7A 4DZJA 2VN2A 5AQYA 1LFBA 2LSNA 5AQMA 3SYTA 5JVGF 3K4JA 1NG9A 1OCTC 4JS4A 2XGEA 3OWTA 3KKRA 5FLXZ 1U8BA 4AUXA 4JLHA 1ZBSA 3VEPA 1A6IA 2BGCA 1BW6A 5DUIA 2ZC2A 4MFBA 3TAEA 1Z67A 4YIIA 1I5ZA 2D0PA 4DGWB 5K5OA 4DR4K 3CLOA 4OVLA 1IBLK 2K02A 3O9RA 5JS2A 4I6MB 5KQDA 1NK9A 4IKFA 3PL8A 5LGUA 2ZWHA 4PKHA 1T2KA 4RLQA 4NDLA 3O3FA 2K85A 3G4SN 3Q7BA 5C25A 1WI3A 4HOBA 1BA5A 3ZEUB 3SEQA 4H0PA 4CCOA 4BC2A 1P92A 2H09A 4M3XA 1W7AA 3KLHA 2KPMA 4M3FA 3I55I 3L09A 4CYDA 5BPLA 2IC3A 3TARA 4PL7A 4CJQA 1EWRA 2AQFA 1MA9B 3QIOA 1VQ6N 2O8FA 1I1SA 2D1VA 1LVAA 2DY4A 1HX1A 4IFEA 2ZMEA 3PSFA 1ZRCA 4OMZA 3DKWA 2R0QC 5BR9A 2E2NA 4KUMA 3PJRA 1IXRC 1ZK8A 2Y9YA 1TGOA 1H0MA 1B9FA 2E8AA 2EINH 3DBRB 4CEOA 1MDUB 3HL2A 4XK4A 5KQ8A 3OYBA 1O4XA 3H46O 3U3GA 1FK9A 1WJEA 1L3TA 3M3YJ 2E88A 3MCPA 4H5VA 1BIUA 4J2EA 1IN4A 1QSSA 1S6LA 5J1YA 2LC2A 2HMPA 3VQ4A 1BJZA 3SAHA 4BY9C 2RHKA 4PUSA 2JA7J 2YKNA 2P7CB 3I53A 3JS6A 3CO7C 2QWQA 2PFUA 1KQ0A 3N4PA 3TTDA 3LDLA 4O8KA 3MWPA 4MO7A 4JI4K 5LBQA 4DU3A 4FJKA 2Q2EB 3FXJA 4FWPA 2YNHA 4WFAL 3K58A 1U3EM 3G0ZA 2JA2A 4DTJA 2IVMA 4CCMA 3ELKA 2M1BA 3W6JB 1NBWA 4HF0A 2VE8A 3GMEA 2VOOA 3HG9A 3AV9A 1QVFM 5IOYA 3ZXSA 3O5BA 3ID8A 1SAZA 4CF9A 1I27A 1HLUA 3A4CA 4CFBA 1T44A 2LRDA 2PZSA 1EA3A 3KE2A 4HV5A 3RMDA 2ESHA 4R79A 3MWTA 2CQ7A 3FLCO 2VXZA 2QWLA 3BTCA 3O80A 5B8HA 4G6DA 3RWUA 1KVAA 5BPDA 4CF8A 2Y1JA 1V4TA 4S0HB 5AQTA 3I9V2 2G8IA 3BUZB 1W7PA 4IO9L 5EG0B 5AONA 3ZT2A 2X51A 2LOOA 4KH4A 2FE3A 3AGRA 3PNTA 1TUYA 1A5JA 3O9QA 3CPWM 4QAGA 4CHOA 3DEEA 4BRNA 2W85A 3D2FA 3NHGA 2E2OA 5AQZA 4LIVA 4Y1DA 2L54A 3ULEB 1NNEA 5IYDJ 1C1BA 4CO8A 1J6ZA 4WXDA 1FBSA 2PYJA 1PUEE 3F5TA 1FP1D 1W5TA 5CVVA 3S32A 2R5ZB 5DM7L 4A3IJ 3WGGA 3G73A 1SAUA 1N32K 2AQEA 4B8XA 1J7KA 3ZX3A 1MW7A 4HF1A 1OR7A 3NBPA 3AVCA 3L4QA 2VKHA 4BJ6C 1JGGA 3RZDJ 1U49A 4M71A 2KZVA 2ACJA 3W6VA 1BW5A 1Z7LA 1H9GA 4CJSA 1NKBA 2HQNA 5JVTA 4E0DA 1TP4A 4LFAK 2YV0X 2ME0A 1A6QA 4CJLA 4OIRF 4AHSA 1FIPA 4BRKA 1KD1O 2PMHA 1KU3A 2W42A 3OYIA 2L7FP 3LSPA 3CCSI 2EZIA 1ZBFA 1DDNA 3T7ZA 3OBYA 2VQHA 3NWSA 4JHDA 4BVOA 4R1HA 3F0CA 4OLAA 4YFXF 3P9CA 1O3RA 4ZDOA 2ZE2A 5GPAA 4CJVA 3TTFA 3ATVA 3HTVA 2YHWA 1BG3A 1QA6A 2JWTA 2HU9A 5AIPA 2LD5A 1U0JA 2V9PA 1NOYA 3G1OA 3CYMA 1G3TA 3VEOA 2Z16A 2A6EF 4C2UA 4BKXA 3DFGA 1GV5A 2FX0A 3SDGA 2W1OA 3IL2A 4DWIA 1ZH5A 2H8WA 1NK2P 3GXOA 1U6ZA 2OZMA 1HKTA 1XSVA 1Y64A 2UYTA 3C94A 3VPRA 3K0SA 3L4IA 4PHTX 3LPUA 2NRXA 3AVIA 1J53A 4IHYA 2QWNA 3OYHA 2ZKZA 4FWKA 4DR2K 2JWKA 2YJFA 3AA4A 1LDJA 4C3IJ 2LP0A 3LFUA 3JRGA 4HEA2 3S93A 4I9QA 3JRHA 3BROA 1C1CA 4JAXA 2E1MC 3VA0A 4WCGA 4OAZA 3GW2A 5AQFA 4CGHA 4B44A 3A8YA 2W6KA 3VEWA 5KPZA 3MXIA 4LLGF 2OV7A 3DM2A 4L9VA 3WG7H 1GLFO 2VXDA 2HDCA 3SHFA 2VB6A 2XRIA 5C12A 2L4AA 4XIDA 2EIJH 3J7AP 4BQLA 3LSGA 3QOPA 4AVPA 2VG5A 2UXNA 3DLLL 2Z2SB 2QSGX 1YI2N 1S72N 1MGTA 3F8MA 4PZJA 4ZYEA 4ZTFA 5AQJA 1GLNA 3QYEA 5EEHA 1E4GT 5JVGL 3D0SA 1ETOA 1XMQK 2LR8A 5LHHA 1VQLN 1HYSA 1BGXT 1D8JA 1E3MA 1GLJO 4V2FA 2ME6A 3J81K 1XNQK 2R7RA 3KZIC 5FPDA 4KHNA 1F1ZA 2G7HA 5AQXA 2E2QA 3FZHA 1N34K 2V9VA 3FMRA 3MXMA 1VZ0A 3HOWJ 1YW8A 3MX5A 4FW1A 4CHUA 3OOUA 1EP4A 4Y4RA 2HYGD 2FF3B 2R92J 4GYGA 3LWMA 3H1CA 2HQAA 4BWMA 1WJBA 3E5UA 1HJOA 1KU7A 1R1VA 4BQZA 1TWHJ 4F8RA 3FXLA 1ASVA 3O3KA 4FJHA 4A2AA 1SFKA 2B5JA 1YHQN 2DQLA 4N41A 4A12A 1Q18A 3E1SA 3I4PA 2GAUA 3AVMA 3ZSZA 1E3OC 2P8TA 4DV5K 3VQ5A 4LF6K 3OOPA 4G8XA 1R23A 3BG7A 2JK3A 2DJIA 5IT9Z 4JI6K 5L3DA 3CCVN 2L01A 2A6AA 1FSHA 1N8RO 2WAEA 4H0OA 2ZGYA 4KYWA 3SBGA 2XRNA 2FNAA 3JRCA 2PBIA 3OW2M 4HBLA 3L0QA 2XDVA 4DFJA 5HNFA 3IKMA 1R1UA 5J2NA 3EQLF 4QS9A 2HOAA 2GZWA 1TYQB 1T03A 2E4LA 3NGIA 1I3QJ 4HVJA 3U9DA 1EJ9A 5FLMJ 4HUEA 5SZTA 4PJMA 1ZRFA 1R5GA 1S9EA 2HPIA 2KIQA 1RCHA 4UVBA 4IRHA 5JVHL 2TDXA 4E7HA 1TL3A 2GA2A 5HLHA 1SD4A 1OCRH 3AO1A 1JLEA 2M7AA 1UELB 3LP0A 3QETA 3KYLA 3CUQB 4J8FA 2GOMA 4U7BA 3EO3A 4WYBA 3U6FA 2JT1A 4FETA 4JI3K 1XDUA 3SV4A 1IXCA 3VA3A 3L2QA 4CZLA 4XKVA 3CCLN 4ZH4F 1C1AA 4NBQA 4JKEA 1MKMA 3P31A 5KHDA 4FLTA 4A2UA 3ASOH 1PUFB 1F21A 1UWBA 2KISA 3UE5A 5E20A 1IN6A 3MECA 5HLFA 2YHXA 1J9AA 3UKRB 3RKYA 1LDKB 1XPXA 4OX9K 4L0YB 1T33A 3CF2A 4MTEA 4JRPA 2FU4A 4NNJA 4FWMA 1JTYA 2FQ4A 2L9RA 1GOCA 3OY9A 3L6QA 4CJ3A 1T95A 2HQRA 1GV2A 1XD7A 2XGCA 3LDOA 3KJVA 1DTQA 3KP4A 2CH0A 5AQOA 1B9DA 1YIOA 2P9IA 3FZMA 1JLGA 3HOZJ 3GOIA 2M34A 3L2CA 3PX6A 2FBYA 2O8EA 2DT6A 4B3SK 2Q36A 2HWVA 2XV4S 1PYVA 4MO5A 4CIEA 5AQKA 4WFNL 2NRHA 3K2AA 4YFNF 1KLMA 4XSZF 3M8JA 3HOSA 2R7SA 4LD0A 5EGOB 2X48A 2BE5F 4CJPA 1IG8A 3BPXA 4OKEA 1RBSA 1C0GA 4DF4A 4HSRA 3QODA 2VGNA 3EUHC 2VI6A 3DOKA 3S16J 2VCPA 3C2GA 3WNGA 2MW8A 3QU6A 4JEPA 4LG0A 4RAYA 1T0FC 3CMYA 1Z3YA 2HZDA 4JD2B 4OJRA 4MLEA 3PNVA 5ADXA 2DYRH 4Z2YA 4XLNF 2R7OA 4UV8A 4A6DA 1OYIA 4JKCA 1WNSA 2A61A 1K73O 2HYFA 4AM7A 3IKVA 4LLNA 2Q1ZB 1ZR4A 1HNZK 4CERA 2QKKA 5F27A 2BVLA 4M3YA 1U48A 4F93B 4BQQA 1WI9A 2CGJA 4BRFA 3NVKA 4IOAF 3SQ0A 1TK8A 4ZC3A 4NO7A 2L4MA 3RZOJ 1U5TA 2Y0MA 2K5CA 1U2WA 2UV1A 2ADUA 3RJPA 3THWB 3FMQA 4G6QA 4B1RA 2Q8KA 5J47A 1O3SA 2NVXJ 5C2FA 3S2DJ 2TRTA 3C6TA 4Z4EA 1X3MA 2QEXI 1IKWA 3OS0A 1K4TA 4C1NI 1LW0A 1TW2A 5JMVA 4C8MA 1IJJA 2CFXA 1OLTA 1BWFO 1YX3A 1IRZA 3TOBA 3DLEA 4DYCA 4M42A 2A05A 2QM3A 4IQ4A 4DZPA 5AZJB 2GOXB 4M72A 4NXMK 4AHRA 2Q31A 3V1OA 2P5VA 1HR0K 3HB9A 2GX9A 4E7SA 2XAGA 4BRDA 1JUPA 1BIZA 3WXMB 2BHZA 4MEXF 1XG1A 1L3VA 4DS4A 4E7ZA 1HLVA 3RVCA 3OSFA 4YY3K 1HKBA 3G6EN 4L9TA 1D9FA 1XB4A 3SNNA 4ZYDA 4EATA 1C0UA 4Y1CA 4XN0A 2LK2A 1ZREA 1BUPA 4O5BA 2FBHA 5AZIA 2BBYA 1I94K 3A5LC 1D8KA 2RNJA 2MG4A 3C0BA 2BY2A 3S17J 3C6HA 1ZG1A 3GTGJ 2RN7A 4X6AJ 3PQJA 4ICLA 1TKDA 5TISC 3VQCA 1RT7A 1BOTO 4B3OA 2KRFA 3O8MA 4CYCB 1WGXA 2QGUA 3AAFA 4LF4K 3BG9A 2ZJRF 2KJBA 1JHHA 1PDNC 5EZHA 1IN7A 2QVOA 1J75A 1VQKN 3NAEA 2VGMA 3HHGA 2FEZA 2KZMA 4BQAA 4V19K 2XPWA 1FTTA 1LE8B 3V7SA 1HYZA 1VQMN 2MLKA 3HO1A 2BH1A 1ONVA 1QVGM 2EA2A 3VYUB 1OKJA 3H36A 3SQ1A 3FXKA 2IA0A 4E3SA 5DCMA 2FD5A 2OUMA 1Z26A 5EYRA 1HF0A 5DM6L 4KBOA 3MCZA 3ZOBA 4M9ZA 2A42A 4A2BA 5HVQC 1U9OA 4H03B 1XGNA 2ZO4A 5E84A 3EYYA 5H1SQ 1TKTA 1U4BA 3IG1A 1VTNC 3BJ6A 3EKSA 4MQ3A 2H6CA 2KDOA 2YNIA 2ASOA 4I6ZA 4QTRA 3M8EA 4WE1A 1E4FT 2XF7A 3NFAA 4O55A 3MD2A 2QA4I 4BU2A 4BL0B 2DK8A 2YU3A 3GUDA 4FPBA 3K5OA 4DTRA 3VEZA 2PJPA 3RQ4A 4HDUA 2K3FA 3BTJA 1YJWI 5EF6A 3ZSOA 2E5LK 4A3BJ 3BG5A 3KFWX 2M30A 4RGXA 5FFZA 2OZUA 3HVRA 1QU3A 1YIJI 2ZFUA 3GWZA 4RM2A 3NRVA 4P9UA 4CW7B 2L7ZA 2PN6A 2E2PA 2Z33A 1HQUA 4FLYA 3H5AA 2P9SB 3KZYA 1U04A 3I56I 2E1YA 2P9PB 4W5OA 1RT2A 4M41A 1FX7A 2DOFA 4CICA 5AQSA 1O13A 4O0IA 2RF2A 4BS9A 3LQRA 3ABTA 1HNIA 4PFOA 1P4AA 4WFBL 4PJJA 2HOTA 1W36D 4A93J 3K1PA 4N76A 2P9LB 5IOZA 3T69A 1NGEA 4FVMA 1YE9A 3MN5A 2Y2ZA 4U87A 1R1TA 5FPEA 2EWSA 1Y1VJ 4I6MA 1QHHD 2TCTA 3CFRA 2ICWG 5DMRA 2HNZA 3RRGA 2F4OB 4ESJA 3IP4B 2HOEA 2CUFA 1R5ID 5CZ1A 3T3FA 2D0OA 2K9NA 3HSFA 2EZHA 2QWMA 3ZEUA 1HDDC 4KHSA 5JHFA 5BN9A 1IUYA 3SQ2A 1FOYA 3AAPA 1X3UA 4BEHB 3NDKA 3SFZA 1ITYA 4IBNA 5DK5A 2OD5A 1B72B 1ZBHA 1VSLA 3A0IX 5EDNA 2XF6A 3M8RA 5EU7A 1H89C 2V9KA 1AKHB 4KICA 3F72A 1SD5A 3TO9A 3HOVJ 1NWKA 5ICEA 4PWDA 2HNDA 3AA3A 2AHQA 3D7EO 3VQPA 2LSOA 4RAZA 4WXCA 4XH4A 2NVYJ 3NARA 3VYRB 2RN2A 4QIWN 4CD3A 2P81A 2Y31A 3FKIJ 4GNIA 3O9TA 3FE1A 4KT5C 2O9LA 3W3DA 2CJJA 5AQUA 2P9KA 2QUFA 1UAXA 5B5EC 2WC9A 4HX7A 4HPQA 5FKKA 2E5NA 1R7JA 2DK5A 3HOXJ 3WTTC 2O4GA 3WE2A 4HA8A 3IUOA 2IAJA 5TJJA 2XKPA 4MEYF 5JR3A 3CQYA 2QZ8A 2E2JJ 3V9ZA 2EPFA 2BGGA 4CF1A 2MFZA 4M3RA 1MH3A 3HSRA 2D2WA 4FE4A 3SBTA 3SUOA 3ZRGA 2DA6A 3PLAA 1AA7A 3LAPA 1HNXK 4Q0BA 3D5LA 2HS5A 2E2IJ 1QPIA 2F5EA 3DLGA 1K8KA 3TGNA 1P90A 4RGUA 4Z6YA 2DFIA 4ANJA 1R71A 3HPHA 3BWGA 1QQIA 4J01A 2VQCA 4JK9A 3CCEN 2PMUA 3V7RA 2G0EA 5KNLA 3EY1A 3JSPA 4E89A 5LJVA 3SQ4A 1SMYF 4H0EA 2M8GX 5L3CA 1OCOH 1XMXA 3AKZA 3IC7A 1B1BA 3GLXA 1O57A 1CZ9A 5CYQA 1I1GA 1MBHA 1YLFA 3T19A 2D0BA 2HKOA 2J5PA 2HHUA 3JYTA 2HHXA 5D6EA 3K7AJ 5CQGA 1YXQA 4CJEA 3T8RA 3UB5A 4UNOA 2F48A 2CGKA 4WQ5C 5IT9O 1MZBA 2XHBA 4Z4GA 3TDZC 5AQPA 3VN5A 2EK5A 2L7MP 4CIFA 1ZYRF 4BJTA 4UUTA 1SUQA 2Z1IA 1WWXA 3QMLA 1RTHA 1FP2A 3CCRI 4YG2F 3CO6C 2FF6A 3GEZA 2E5ZA 1IRGA 3QQAA 1YT3A 3IFRA 1TKXA 3ESWB 2DFHA 3RDIA 3V8LA 4AM6A 5EG0A 2UXCK 1Y39A 3HUGA 1DUXC 4WQ4C 1YITI 3S3MA 1Y6IA 4BRLA 2IVPA 1LWEA 4IHSA 4H0VB 1YRNA 1Z9CA 2OTJI 3F8BA 4A3LJ 2KFDA 1O1WA 1PP7U 3ULEA 3CD6I 4MLHA 2X85A 4HWIA 2K9MA 1VQ9N 2ZJ2A 3BR6A 2QTDA 4CGZA 2R5ZA 4U7DA 2NVUB 4H4OA 3CMEI 2Q97A 1KYWA 5D5UB 1DTTA 1MIJA 2R7TA 2HVSA 2AXLA 4DKWA 5DUKA 4DR7K 4J2DA 5L3FA 3W2WA 4PK4A 3T5XA 4KTWA 4KN4X 3SPYA 1SFUA 2H1LA 2OTLI 1X19A 3DKYA 3LZJA 3UKUB 2P9NB 1BDGA 4OGEA 5GADP 1M1KO 3L7WA 1SL1A 2WAQA 1A5XA 1ODDA 1VQ4I 2E19A 4OIPF 3QRFF 4LIUA 5HRPA 3M7GA 5F6FA 1MU2A 1IAWA 2KKOA 2XIGA 2FXAA 2P1JA 3U3YA 2FMYA 5E3MA 2A3SA 5IYCJ 4CZKA 1RUNA 2ZJRL 3C3WA 4FJ7A 1SZ2A 3U8XA 3O4NA 3SV3A 2PMZA 3P9IA 4OAYA 3PFIA 2JTVA 1Z6TA 1NJWA 5GIOA 4XH5A 1I6XA 4ENKA 4FO0A 4WF9L 5LHIA 2DA4A 1W9HA 1ETXA 4O0JA 1S6PA 4LFUA 2Z9OA 3J81Z 1S5JA 3W2VA 4CZJA 4R8HA 3A5MC 2ELKA 4CBXA 3NF8A 2LVSA 5F1RA 1FOKA 2WAQN 2D0AA 3AGKA 3K1NA 1QVUA 1XCBA 4B1YB 4KO0A 1OVYA 3H35A 4BACA 4IZZA 3I0RA 1TT5B 4PKGA 3VF4A 1Z77A 4FM0A 2M8EA 1JKHA 1R58A 2WBNA 2PMZN 2FBTA 1BI3A 2I7NA 3VQ6A 2CGLA 4C3JJ 3K70C 4UVAA 2NAZA 2G9WA 2IXSA 4GKJK 4HNVA 1POGA 3QYFA 2Y1IA 4CFCA 5AQVA 1K83J 3CCMN 1D8YA 1R00A 3A0BC 4IFVA 1EX4A 1RR7A 3KLOA 2ZJPL 2ELHA 2ZM6K 4YDUC 5EZGA 5GAHP 2O8BB 5A2QO 4CK3A 4H0XB 5D6FA 5LL6Z 3KK1A 4C3HJ 2EB7A 1EQYA 1NKEA 4KTZA 4G6TB 4XONA 1FNNA 4JQFA 1FJGK 3DU5A 1VSDA 4MHGA 4PJ0C 3V81A 3K4KA 1V4RA 1B4AA 3IWFA 2VWKA 4A6EA 4BBSJ 1IJWC 4GFBA 2V1DA 3K9JA 4U67L 3RI4A 2YS9A 4FZZA 3QINA 1ILYA 3CUOA 4DTOA 2F7TA 2NNYA 3RTRA 5AFUA 2C6YA 4XL9A 4Y13A 3CP8A 1HW5A 3UR3C 4J2AA 3KPHA 1NK4A 3DEWA 2R7ZJ 3PO4A 4DV0K 2KP6A 3ZCMA 1X9MA 3WU1B 4KI6A 4FM2A 2R7WA 1XC9A 3SJHA 4I9LA 3ZT0A 1XSDA 3G71N 2BTFA 3M6GA 1WBDA 1OVQA 1W4MA 1VK0A 4W5TA 3MKLA 3HYIA 1IKVA 2Z5UA 4XSXF 1KFSA 3QNOA 5B1AH 2RAEA 4BREA 3SUNA 3E9LA 3S1QJ 4IZ9A 2ESNA 5CVUA 3CM6A 1X9JA 3VENA 2H8RA 3V4GA 3CC2N 5FRMA 1T3VA 3QB0A 3KD1E 3GFLA 5HRSA 1VI0A 4DOZA 3DLRA 2K86A 4FK0A 4HTUA 2YHYA 3SAGA 1DP3A 3I71A 3GYHX 4CECA 3D45A 1YAGA 5KRTA 3TW6A 5KTQA 2HVRA 3O2PE 2VQLA 5C10A 1N75A 2BV6A 2IS3A 2I8DA 3LSMA 2FSWA 4RS8A 3TQNA 2K7LA 2OPRA 4RW8A 1ASWA 3E6MA 2WTEA 4IEIA 3RSEB 1TYQA 4TSXA 4MDBA 1RNHA 4M3EA 3TMOA 2ITMA 4N56A 3VDXA 1WH5A 1XGSA 3E97A 1IV0A 5BS6A 3GBGA 3NGYA 3PIOF 4IXCA 3FZKA 3JSMA 2JPBA 3VEVA 3H3UA 3CUQA 4RDUA 3TWHA 1MDMA 1TBXA 2E71A 4II3A 4C23A 1FPQA 4EP5A 1HKCA 4C2MJ 4B3AA 1KAXA 3D2EB 4H4MA 1PUFA 3KLIA 1X58A 2XY8A 1JLQA 4BY7J 3MWMA 3K6GA 1MSFC 3VYTB 3UKRA 4FJGA 4ISEA 1X1DA 2F2EA 1QVTA 4UUVA 3A02A 4PJLA 2Y48A 1X2NA 2HOSA 3ZT4A 2BOLA 3QEXA 3VFZA 3NF6A 4YEJA 2ASMA 3VOVA 2XVCA 4KDPA 2O7OA 2R7VA 3HRGA 3G4SI 2XPVA 1KRPA 1RUOA 1WCMJ 2XF5A 1IW7F 4CCHA 3PX0A 4D7NA 2CQKA 1S29A 1SKRA 1NKCA 2D45A 1TWGJ 2OANA 5I42A 3SLCA 3HDDA 2VKVA 2Q1NA 2CQNA 4ENJA 3RR7A 2G8WA 2IA2A 4YELA 1U2VB 2ETHA 4CSWA 2H27A 2STWA 4KPYA 3DXMB 1VQ6I 4HAMA 1FT9A 1HXDA 4AIKA 2PI0A 4DSLA 3G1LA 1YF5L 1R59O 5EGOA 4M3UA 2B7EA 1VF9A 2JSPA 4EJWA 3LL3A 3R0AA 3P9KA 2D5VA 5D8KB 1UHSA 4NYNA 5IT9K 1ZC6A 5TKYA 3MEXA 3HRMA 1T6SA 5GAGJ 1J5YA 2IGOA 1DGKN 3P83D 1XUPO 4B9SA 1KXPA 4M9SA 1Q9XA 3KWIA 3ZMVA 1K9MO 4JD2A 4BY1J 3KD5E 1T56A 3N4MA 1S1XA 2JZYA 3OR1C 1K6OA 2VBZA 2E35A 2E20A 4F3TA 4P5OA 1DP7P 3T1HK 5CE3A 2E1OA 3MEEA 3P1GA 1GDTA 1B9NA 4C2TA 4CZZA 2VC1A 4CIGA 4AHTA 5ED4A 2OF7A 2X74A 5E1XA 1DQUA 1RDBA 4PUOA 3OYCA 4AHUA 2DODA 4KHUA 2OPQA 5M3FJ 4BDZA 1TK5A 3KK2A 1T6CA 3F6OA 4J19A 3OV8A 2DFFA 3M3ZA 3HJFA 2I10A 1D4XA 3GX4X 3CCQN 1G6NA 4KITB 4DR1K 3THWA 1G3YA 3D6RA 4EHUA 3LAKA 2HDWA 3HJEA 3MDQA 2GLOA 2KHOA 4B1XB 2JSCA 4ID5A 3KYCB 3LFKA 5HBMA 3CM5A 1W36C 1MMGA 1OPCA 4RMNA 1DEJA 4OMYA 3TAGA 4GV9A 3HGYA 1NHAA 4B3TK 3CJ7A 1SKSA 2MGQA 4XRSG 2JWLA 4I2PA 4M3GA 1FBQA 2RREA 3IWZA 4A3CJ 4IG3A 3LPTA 2BY3A 4B43A 3JREA 4EHTA 1WN7A 1QHGA 3O3GA 3DXKB 2IJLA 3ENBA 3AVJA 3H0DA 5HDGA 1MBKA 4IO9F 3HYFA 4MQ9F 3ZSRA 4DNCA 4FCYA 3A01B 1WSUA 1G99A 5FKNA 4AC0A 5LLQA 3M1EA 1NGBA 5ICFA 4CBUA 3MN7A 3WNHA 4DV4K 4XICA 4KJZA 3AG1H 1L3LA 4QSHA 3SZTA 1OISA 1QGPA 3O9SA 4FSVA 4IRIA 3FBIB 1UAAA 2DTZA 4RW4A 1LEAA 1KONA 3VF2A 4QWQA 2M4KA 5DM7F 1YVUA 3M07A 3MZYA 1OKRA 3OS2A 1TWAJ 5AQHA 4DF8A 3TAMA 2QBYB 3MN6A 1WJFA 1D0ZA 3FISA 1U45A 5E17F 3U1KA 3VQ8A 3VQDA 2DPNA 5ILVA 2J4RA 3C6UA 3U9ZA 2HYJA 5F0CA 4J00A 2R7DA 4EAHD 1X3NA 3CQ8A 4F3OA 1Q1VA 4AQYK 1Z0XA 2LF8A 1BC8C 1LE8A 4FISA 1RC9A 1TV6A 3ZSQA 2FJ1A 2E36A 4XLAA 1RBUA 3O08A 1QSYA 1D5AA 3RQIA 1R9TJ 3OYAA 5JHUA 3MQ0A 3DLHA 2HNHA 2R93J 3QAHA 4I98B 5J1RA 1KVCA 1W97L 2CW0F 2IS2A 5HLGA 5HS7A 1Q82O 1VFCA 1R6RA 1LAWA 2CS3A 4ASNA 5D5VB 4KH6A 4CVNE 2G7UA 3ZT3A 2XC7A 2CUEA 4DR5K 3U4LA 3ZSWA 1TAUA 2VKDA 3MZ8A 4NHJA 6PAXA 4Z0UA 3C65A 1PP8F 3KLGA 3H5RA 3LDPA 4DV3K 4B3MK 1WJAA 1CQTA 4BVPA 4ZDPA 1F43A 2WAFA 4WWCA 1YVNA 2HF3A 4FZYA 1IKXA 4LC9B 1V54H 4DUZK 3S2WA 5HL7L 5GAEJ 1XNRK 3J7YJ 2L2OA 2ZJQL 1D0XA 2DT5A 1YFHA 4CEFA 2A07F 1Z05A 5C42A 1NJYA 1NH3A 3A1YA 3QO9A 1QZZA 4UXNA 4JI1K 3QIPA 4FQGA 2RPIA 4B9VA 2JA6J 3DLKA 3TKYA 2YU9J 4Z4FA 4M63C 4KIBA 4UB6C 1O7LA 3BPVA 1GXPA 4DV2K 1ZARA 1U9NA 4AU7A 5BOXA 4E1JA 2VJJA 1A36A 2XAJA 1BA1A 2QSFX 2I5JA 1SVMA 2ID3A 3V7CA 2LKPA 4IPAA 3GZ5A 3PO2J 2KT0A 2Y9ZA 2W7NA 3S14J 2O03A 4JX4A 4S04A 3DLLF 2MH9A 4Z4CA 3CCUI 2DXIA 4Y17A 2DA7A 3V1RA 5CJ9A 5EX5A 3H9GA 1T7PA 5LGNA 4BYYA 5IT3A 4NQWB 4OPAA 1U47A 5EJCA 3KP5A 1BISA 3EDPA 2IS6A 2HI3A 4BXXJ 1FYKA 3K5LA 4I0BA 1Y56A 1VQLI 1IN5A 2Q3SA 1JLBA 2E1NA 1Q81O 3N97A 4BR2A 1LAVA 4BEHA 1VSIA 1REVA 5LMUK 3H0GJ 4F92B 3I4NJ 3DWLE 1S7OA 4KIGA 1LUJB 1B72A 4EJUA 3AAQA 1ATRA 5H6QA 3B02A 5CVJA 5FRNA 1AKHA 1UG0A 5M5WJ 5BPMA 4PSWA 5C3EJ 4IL6C 1UA1A 5H20A 2EH3A 1Y8QB 1ZTRA 3CCYA 4DR3K 3ZGKA 2YPRA 1GUUA 2IA1A 2FQ3A 4A3FJ 2HDDA 2JMWA 3WTZA 4C1NK 2A1RA 1PVEA 4NLCA 3TEDA 1QZ6A 4ESFA 3OIPA 2UU9K 1J9IA 3JRFA 3QEPA 2QQ8A 1A31A 2RQPA 5D3GA 4RCHA 3DPTA 2BDPA 1OYWA 4A0YA 3BCBA 4L5EA 1FYLA 1W0HA 5GTIC 5J8CA 1U78A 4OKJA 4W1UA 2NRVA 3TSQA 1YHQI 1KYZA 2AO9A 3AARA 4DQ2A 1ZELA 3B6AA 2QWOA 5M1PA 2DBBA 3PV8A 5E41A 3CCVI 3TPQA 5M1FA 1E17A 2XPUA 1SVLA 4ITVA 3HI0A 4DTXA 3LA3A 3DCFA 3ML6A 1MNDA 3I59B 1WVRA 4DTMA 3F8CA 4BG9A 1FIAA 1JKQC 2P9KB 3WHCA 4GDFA 4JKFA 4NB5A 2M4GA 2CRGA 3HP9A 3MXJA 3EN9A 1VSMA 4L5IA 2LYCA 3E6BA 3LM9A 3KEYA 2DDAA 2XKOA 2OYQA 3NQOA 2JVGA 3M8QA 2NUBA 1JL1A 4BR5A 4KHWA 2HB5A 1LKXA 1EH8A 1S8NA 2EHGA 1UCRA 3GTPJ 4CDGA 2YR2A 1D5YA 1XGOA 3E6CC 4F3QA 4FLXA 2AS5F 2R7QA 2O3FA 3CCLI 4EFHA 4HX8A 1RDAA 4KRFA 1DLOA 1K8KB 3KX2A 3PFYA 1Z21A 3LA2A 3L3UA 4XLFA 4LG3A 3MEDA 1TL8A 4DSJA 1I39A 1MNEA 4YOVA 4KV8A 2VKEA 5J1EA 4FK4A 3WXJA 4GV3A 4W5RA 4FJJA 5L3BA 2K4JA 4PDKA 3B8AX 2K9QA 5EXWA 3DU6A 4L8RB 3S8PA 4N9IA 1A35A 4XRSA 4G12A 2DN0A 2QQAA 4KB0A 2VWBA 1I6HJ 1YIJN 4CEQA 1NJIO 2ID6A 1RDCA 1SANA 1LFUP 2VBWA 5L3EA 3K4NA 3VSKA 3E01A 3ENHA 1Z6RA 4CGIA 2DMTA 5FKMA 3J7AY 4F4KA 5JS1A 2IVOA 2JGUA 2EIMH 4I09A 3OL4A 2GWKA 2FOWA 2M2EA 2VJ5A 3DV8A 1XC5A 3V42A 4CZFA 1X9WA 4IX7A 2HFHA 1RT1A 3SUPA 4ZDLA 2QF7A 2STTA 1WOQA 2HGCA 2L9NA 3SMSA 3ZQIA 1QE1A 2XAUA 1JT0A 1WB9A 2Z1DA 2LF7A 2ZMEC 4EEFG 3HUGB 3QEIA 4CA0A 3H3OB 3MAQA 2YHBA 3VERA 3SZGA 1KCFA 1YTAA 3S15J 3FZLA 1YRNB 4PL8A 4RA2A 3UKUA 4M45A 2P9NA 3ENOA 4JRQA 4OU0A 3HEFA 3ASMA 4CHQA 2CV0A 3V9XA 2VLAA 1HCRA 1IXSB 4MLOA 1IRXA 4NB4A 1GLAG 3X2QH 1UG2A 3QPHA 5CQEA 4I7FA 1IH7A 4GKKK 4V19S 3FZFA 1RDWX 2YCHA 1Z91A 3ZQQA 3BP8A 1BC7C 4DQSA 5FB2A 1HRHA 5IP9J 1FTZA 4AM3A 3WNEA 3THYB 5DYMA 1PJRA 4OO1J 3BOQA 4A61A 2XHKA 2IT0A 5FLVA 4GVEA 5J3LA 1ETKA 2P51A 1TQMA 4QOZB 3SAFA 1Q86O 4ETSA 4JYAK 3K2ZA 1QNTA 2HBKA 3A5NC 4I99C 1BI2A 2G8HA 4OPJA 4B8AB 4I01A 2QCOA 4BXFA 1P4WA 1HKSA 4Y0WA 2K9SA 1ON1A 3WXIA 4HNTA 1YG2A 3AG3H 3IRRA 3LWFA 3CC4N 2JVHA 1OQYA 2VUMJ 5EY4A 2M5WA 1ZAOA 1NGJA 3C1DA 1FW6A 4NCBA 3W0LA 3I33A 4B9MA 5E3NA 3KTQA 4IOXA 2DW4A 4D5CA 3CMAI 4L3QA 4BR7A 2O8BA 3R0JA 2NS0A 1J2XA 2BVMA 3SDBA 5BNGA 3LAMA 4M73A 3VPZA 3VMFB 1BI4B 3G6EI 3J7ZI 3DLBA 2X1EA 5D4RA 5JLWA 1XMOK 4OWRB 2Z1JA 1GLCG 1ULYA 3HRSA 2ZB9A 1C6VA 1XN7A 4GMJB 1D1AA 4GRIA 3L9FA 4PFPA 2KW4A 4JOMA 5BPNA 1KGSA 1FXXA 2FSNA 2XRLA 1NLVA 2ZF5O 3ZQHA 3I0SA 1X1BA 3ZQGA 4BBRJ 3I58A 5LD2C 3AY9A 2HHWA 1NMDA 1W0TA 5TKWA 3BR3A 1S9GA 2YI1A 3R60A 4C8KA 2VT2A 2VBYA 2HHVA 2LREA 1C0MA 1OR7C 1VQKI 1RKTA 3MFKA 2QQ9A 3JCUC 1KA8A 3ZMTA 4DSKA 5J2QA 4DG1A 2HR3A 5HRNA 1HUXA 4FWQA 3QU3A 3DRSA 2PBDA 1GVDA 2B4JA 3QPSA 2CMPA 3BCAA 4B9UA 1XMKA 1C0TA 4NUBA 2IRFG 1BCMA 5C4JJ 3THXB 5J2MA 1G8XA 1VQMI 1DPUA 5E79C 2AJQA 4CEEA 3J80Z 5CYVA 4HF2A 3LWLA 1RNLA 4N4NB 4DV7K 3SZ2A 4JV5K 4FLVA 4DYQA 4IHVA 4PA1A 3PM1A 2LKXA 5DM6F 4EM1A 1ETWA 4MQVA 1XC3A 4HRIA 3O8GA 3E0JB 3GG4A 2ATQA 3ZMDA 3BQZA 5BQTA 2K4BA 3ZETB 3E3VA 2CV1A 4ISGA 3ZMSA 3ZSVA 4CFDA 1KVBA 2LDUA 4CEBA 4FJXA 2P5LC 1VQ4N 3LMMA 3V1QA 1J54A 1JJ2M 4PGGA 1HA8A 3DBLB 2H3GX 4FWNA 3IH4A 3GZ6A 1G59A 4EQQA 3IV5A 3V6DA 2EBIA 5F1JA 4XH1A 2L9SA 4I76A 5JI6A 3RSEA 3JR9A 2JQ7A 2MYSA 3ZCOA 1QQOA 4A62A 3A0HC 4FYDA 1FY7A 4PY5A 3ZN0A 5KGWA 5F08A 4YFKF 2X6NA 3AVAA 4A3GJ 2RDPA 4XOTA 4IEEA 3FXOA 4H5TA 2DOEA 2CW7A 4YORA 3DJCA 4P96A 4M3BA 2KL4A 2NOGA 5J6XA 1BR2A 3BLYA 2NRZA 1KU9A 4X65K 1G3WA 2ELJA 4BC3A 3D2EA 2F8TA 2UXBK 5BREA 2YUSA 5E8GA 4WXHA 2VG6A 4NC7A 3FFIA 5CZ2A 4IJNA 3DTEA 3FXUA 4NC6A 4K8XA 2PJRB 1B9MA 4DV6K 3WG9A 3H1QA 1KFDA 1VQ8I 4G9YA 3R4KA 1MDMB 5HP1A 2NRWA 2OPPA 4ELUA 1JXSA 3FXQA 3L1PA 4I0AA 2CH6A 4GCVA 3K5NA 3G10A 2R7XA 3TW7A 1T38A 1KTQA 1EF4A 4E4HA 2KIFA 4DB3A 3HXMA 4IHTA 3MKYB 3JRAA 2D0CA 5IP7J 1WZ2A 2M9HA 5HS8A 3AG2H 3K70D 3JRIA 3W2AA 4A3EJ 1RFQA 3ZP5A 4BHPA 1ASUA 5JLFA 5FGMA 3AVNA 1U2VA 3V4IA 4EJVA 3LP1A 4GXOA 2AXTC 3DXMA 5FPNA 4YHHK 1D1BA 4HX4A 4AF1A 4EMSA 3JRDA 3WTUC 4F2SA 3SEZA 1G3SA 1ZLKA 4O4GA 1OH6A 1RRJA 4J2BA 2P6TA 1B6AA 4U0VA 2GELA 2XSJC 4W5QA 3JW4A 4OKKA 5C44J 1QSLA 1MMDA 3DPUA 4ESBA 3REOA 3CQXA 4UQGA 1LB2A 5J2PA 3TABA 9ANTA 1QZ5A 5DS9A 2HMIA 1LCUA 2OPSA 2HVQA 4RBOA 3CCJN 3K59A 5AQWA 2EZKA 1X3WB 1R0AA 4JN4A 1VQNI 4KN7X 2IEKA 3T1AA 3CJRB 2IIRA 5M5YJ 2QSHX 5J8FA 5ILUA 2Q0OA 2CW8A 1WSHA 1SMTA 3F2KA 4IEJA 5KCMA 3GDQA 4CGGA 1RTDA 1X9SA 2AA4A 2ZSHB 1HSJA 4BC4A 1BQMA 1O3TA 4UUSB 2KFZA 3DP7A 1KQ9A 4UHTA 1SQKA 2ZFWA 3QNNA 3ZMZA 2B6AA 5C15A 2A6TA 2X9DA 3CXCM 3AVKA 5CHIA 1TNTA 4B9QA 1VSJA 2NS7A 3CCEI 2A3ZA 4CH7A 3F73A 2B0LA 4FE7A 4CJ7A 1HYVA 2CYYA 2R7FA 1YS6A 3FHNA 2AP1A 2IGMA 3VB2A 2IPQX 1VAZA 5BRFA 1KAZA 1YTUA 3HSEA 2FSJA 1ZHFA 4E19A 3E9OA 4GGGA 1GOAA 2UUAK 3OYKA 1RT3A 5A2QZ 1FEXA 1NK5A 3GTJJ 3WEEB 5LRRA 1QZYA 1ZBLA 2GEMA 1GLDG 1RTJA 5I9EB 1TKZA 4B3RK 4KA4A 5KPRA 2KQ2A 2CV2A 1OFCX 2DA1A 4CZMA 2GIVA 3G1MA 2DA2A 3DXKA 1ZG5A 1HPZA 1DU6A 2A68F 4X66K 4XRFA 4E6KG 5K7FA 5HDKA 2ZNZA 3OA9A 2W25A 4MFDA 3JTGA 2MBFA 3Q9VA 3O9UA 1V5FA 3SK3A 3WHBA 3A01A 3GE1A 2LY2A 3L8BA 1YS7A 4F2RA 5HNHA 3KVGA 1OJLA 2HNYA 2JUCA 3SI6A 4IO8A 4XLCA 3ROUA 2DLLA 2HZTA 3GFIA 2X0LA 2P5OA 4NCGA 3HM8A 1C0FA 2A6HF 5LFAA 5CYMA 4M6XA 4BGBA 3RR8A 3NMUA 4KT6A 3K2PA 4KMUX 4K0KK 2W4SA 2MLGA 3L2UA 1BQNA 1VQ9I 3ZSXA 2RKIA 5GTHC 3QPTA 4KI4A 1HDPA 5KAIC 4NYFA 2F9TA 1USSA 4LOCA 4B1UB 3AVBA 2QBYA 3U1DA 4JX5A 1YW7A 3DF8A 1WSFA 2ZXWH 3KCCA 3SUQA 2WOMA 1MBJA 1RT6A 1P6RA 3HM5A 5AQNA 1ETVA 3EL2A 3ZLJA 5E1WA 3RKQA 4XLPF 3VF6A 2OJED 4C8LA 3HKZA 3Q0WA 4Q47A 1AOYA 3DMJA 2RNGA 4E70A 3MKWB 2E2HJ 1L0OC 1N25A 1FWZA 3IUCA 4BRCA 1Y0UA 4HDVA 5F64A 3ONQA 1REPC 4BHBA 1GT0C 3OJUA 1IUFA 3HZJA 3V9SA 5CY4A 3CLQA 1XCVA 4YIFA 2G8KA 4CJFA 3PIPL 2VQGA 4KNYA 1YJNI 2GIZA 4CI6A 1VSKA 3O6WA 2DO7A 2OA4A 2GXGA 2LTPA 2NRTA 5LRSA 3QWLA 1J5EK 3QOEA 2V52B 5GPCA 3U21A 4U88A 3DOLA 4QS8A 3BF1A 2KRHA 2E7WA 4FX0A 4B47A 4YRVA 1IDZA 4BR0A 2DU9A 4HV6A 4UB8C 5BR8K 1XWLA 1NM1A 4O44A 3T8TA 1U5TC 3HKZN 1S3JA 1NK7A 4FLWA 2V6CA 1SD7A 4XLHA 4E7KA 3FFKB 3L2WA 4CJ4A 1BL3A 3MZHA 4OGCA 2F9WA 1D5VA 1TW3A 1QS4A 4DQ8A 3QESA 1MWMA 4F91B 2ITGA
chains in the Genus database with same CATH topology
1HJRA 2DFFA 3HJFA 3BG7A 2DJIA 2NOJB 4FJNA 1ZYQA 4KITB 1X1CA 1X4OA 4Y3OA 4IFYA 2WAEA 3BDPA 2XY5A 4IDKA 3LAKA 2HDWA 2XO7A 1NG7A 1T05A 4ID5A 3H5NA 2XDVA 4R5PA 4DFJA 5HNFA 5HBMA 3CM5A 1W36C 5J2NA 3OVNA 4DIQA 1T03A 4XORA 2E4LA 1MMGA 3DTIA 3NGIA 1XHZA