3HPHA

Closed tetramer of visna virus integrase (residues 1-219) in complex with ledgf ibd
Total Genus 64
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
64
sequence length
210
structure length
194
Chain Sequence
NIPLAEEEHNKWHQDAVSLHLEFGIPRTAAEDIVQQCDVCIDHWQVDYTHYEDKIILVWVETNSGLIYAERVKGETGQEFRVQTMKWYAMFAPKSLQSDNGPAFVAESTQLLMKYLGIEHTTGIPWNPQSQALVERTHQTLKNTLEKLIPMFNAFESALAGTLITLNIKRKGGLGTSPMDIFIFNKEQQRIQQQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Integrase
publication title Structural basis for functional tetramerization of lentiviral integrase
pubmed doi rcsb
source organism Maedi visna virus
molecule tags Transferase
total genus 64
structure length 194
sequence length 210
chains with identical sequence B, C, D
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2009-06-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00665 rve Integrase core domain
A PF02022 Integrase_Zn Integrase Zinc binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.200 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Arc Repressor Mutant, subunit A 3hphA01
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 3hphA02
2KW4A 1C0UA 1UAXA 1ASWA 1TKZA 1C1CA 1RTJA 3SV4A 1NOZA 1BI4B 3ISNC 4DSIA 4Z4CA 3V6DA 3ZSWA 1RBTA 1JLCA 4KFBA 4DTUA 1L3UA 4IG3A 2Z1GA 2XY8A 2JGUA 4F8RA 1FKOA 4F3TA 1TV6A 3K2PA 4HUEA 3SCXA 2HHQA 4Z0UA 4E7KA 4B9TA 2D0CA 1RBSA 3DOKA 4BE2A 3K5OA 4CJ4A 4CGHA 1QTMA 4Y1CA 1LV5A 3NF9A 3LAMA 4CF2A 2KFNA 1DLOA 3AO1A 4KTQA 4CIFA 3L8BA 4M41A 4CGFA 3C94A 4RW6A 4RG8A 3RMDA 3O4QA 4J2AA 3VQ8A 3DRPA 2HNZA 3CG7A 3S3OA 2Z1IA 3QEXA 3SYZA 3SNNA 1F21A 3KD1E 4BWJA 4JLHA 3S3NA 4AHCA 4I7FA 3L2WA 3NGYA 4YNQA 4CF9A 4RW4A 5HP1A 3WNHA 3K5MA 2Q3SA 5DK5A 3QEVA 1JL1A 4CJ3A 3O3HA 3CYMA 3DLKA 4RW9A 4I2PA 3ZCMA 1TK5A 2LSNA 4B9SA 3UIQA 1A5XA 4KPYA 2KZMA 3ZSOA 2ETJA 1I39A 3CFOA 2XO7A 3U6FA 4AH9A 3CM6A 4M3ZA 1J53A 2R7YA 3DLGA 1G15A 3KLHA 3LZJA 4XIUA 2F8TA 4R5PA 3M8SA 4W5OA 1JLBA 4CEAA 3ASMA 3LWMA 4JS4A 2XY6A 3D0PA 4HCBA 3LP1A 2GBZA 1Q8IA 1HQUA 4F2SA 4DS5A 4CEBA 3KKSA 1NK4A 4M3TA 2HW3A 2DFHA 1TK0A 3SQ2A 3F73A 3VQ6A 2G8HA 4E0DA 4F3OA 2OPSA 4CJQA 1XHXA 1B92A 1S6PA 2VG7A 4G1QA 4OLAA 4FJGA 3QLHA 1MU2A 4FJ5A 4ELUA 2X78A 4ID5A 2DTUA 3ZSQA 4LSLA 4CK3A 3ZSRA 4CIGA 3SJJA 5KRTA 4KHWA 3DLBA 3ZSXA 4CHYA 1VSLA 1ASUA 1L3SA 4KI6A 3PUFA 3RMCA 2ZQBA 3D45A 3O4NA 5J1EA 3OYIA 1JXEA 1NK8A 4FJ7A 1VSMA 4CJRA 3TAPA 3KK1A 1QSSA 1LW0A 1NK0A 3AVFA 4I2QA 1WNSA 4DTSA 3LZIA 1WSIA 1DTTA 3NBPA 4M3RA 4N5SA 1LWEA 4O4GA 4FJNA 2OA8A 3NH0A 1JLQA 5HRPA 1EKEA 5I42A 1WSJA 1QE1A 4DQSA 1JKHA 1YVUA 4CJKA 4BE1A 1JLEA 1BIZA 2Y1JA 2XY7A 3HYFA 3TARA 1W9HA 3AVAA 4GMJB 4E7JA 2Y1IA 3MXJA 2YNFA 3V1RA 1VSKA 1HNIA 4IG0A 3ZT1A 2YKNA 4DSFA 3ZSYA 4FZXC 4GW6A 1CXUA 4FLXA 3MEGA 2NUBA 4CHZA 4TSXA 1X9MA 3QETA 4FK0A 1S1XA 4CK1A 3AVJA 4Q0BA 1L5UA 1DTQA 5T7BA 1T03A 2KFZA 1KCFA 3M8RA 2QKBA 4IFYA 2OPQA 3OJUA 1UA1A 1B9DA 2HHTA 3IG1A 4CHNA 3HO1A 2GUIA 5C42A 4OKEA 3OYEA 4DF4A 1SL0A 1U47A 1JL2A 1LAWA 4Z4IA 1VRUA 4CF8A 3IAYA 2JLEA 1J9AA 3VQ7A 1GOAA 1TKTA 3HL8A 3A2FA 3LPTA 1CXQA 3ZT4A 3HM9A 2Z1JA 1SKSA 3KTQA 2GV9A 4KHUA 3LALA 3NF6A 3OVNA 4C8LA 4KO0A 1WJCA 1RT1A 4BDYA 4M42A 1RDDA 1YT3A 1Q9XA 1TKDA 4LSNA 3OYCA 2IOCA 4LD0A 3TANA 3HP9A 3C95A 3AA2A 3MECA 1RDBA 1QS4A 3ITHA 4CFAA 3AVHA 3ZSZA 1REVA 3LWLA 4DQPA 1VK0A 4M3WA 4KREA 4W5NA 1WN7A 1TVRA 3NHGA 1NJYA 5FRNA 3DYAA 4WE1A 2WONA 4CEEA 1NK7A 4B9NA 4CJ5A 4BDZA 4N47A 3VQ4A 2VWJA 3VQQA 3H08A 4BDPA 1ZBHA 4M45A 1EETA 3WNFA 3L2RA 4KHYA 1HYSA 1WJDA 1D9DA 3PO5A 2FBVA 4CEOA 1TKXA 4E89A 1K6YA 1NJWA 4F2RA 1RT5A 4N41A 1ZBFA 2G8FA 4B9LA 1S1VA 1VSDA 2A1SA 1SKWA 3VQDA 3RTVA 4DS4A 1IKXA 4MFBA 4DWIA 4FW2A 4LH4A 3AO5A 5SWMA 4K8ZA 4J2BA 4B3OA 3OYJA 1N6QA 1KFDA 3NFAA 4CFCA 2G8WA 2DFEA 1JLFA 2VG5A 3LAKA 3SV3A 2HHXA 3OYBA 3V81A 3O3GA 1KFSA 4DLEA 4DSJA 4DG1A 1EXQA 2RN2A 4ID1A 4FJLA 3QNOA 1BQMA 4DLGA 2O4GA 2HHUA 3AVCA 4DF8A 4OLBA 1CZBA 3QEIA 3HVTA 4CESA 4FXDA 5CZ1A 2HVHA 4W5RA 4BWMA 1E0EA 3VQEA 3SUNA 3T3FA 3ZSVA 4K8XA 1VSIA 3RRHA 5J2QA 4FJXA 3CM5A 2KQ2A 5KGXA 3NH2A 4ICLA 2D5RA 1U04A 5HRSA 1RT2A 4Y1DA 1BIUA 4AILC 4CF1A 5J2NA 3HPHA 1T05A 1NK5A 2KZZA 1WJAA 1HJRA 3DMJA 1XI1A 1BCOA 2P1JA 1KVAA 4ELVA 2HHVA 4DSKA 3JSMA 1WJBA 4Z4GA 3SUOA 4Z4FA 1KRPA 2X6NA 3L3VA 4OVLA 5HRRA 1KVCA 1J5OA 2YHAA 3QINA 4PWDA 4M3UA 5CY4A 4N56A 3OS1A 2XRIA 1TAQA 3JYTA 4UQGA 4B8AB 2HMIA 3DRRA 4OPKA 3RR8A 4NCBA 3SQ1A 4KAZA 2RPIA 3AA3A 4KTWA 1S9EA 4MQ3A 3TAMA 5HRNA 1R0AA 4DTPA 3TR8A 3S3MA 1VSHA 2F8SA 3WNGA 5HLFA 1KSPA 3SUPA 3FFIA 1GOBA 4DFMA 4B9UA 1ZBIA 3AVIA 2BDPA 1WAJA 4C8OA 1J54A 2YNGA 5DMRA 4KHNA 3SQ0A 2QK9A 4C8KA 1KLNA 4ELTA 3V9ZA 4QAGA 3KKRA 1WJFA 2B5JA 2B6AA 3HT3A 3KJVA 2P51A 1I3AA 1RILA 3HVRA 4CEZA 3QEPA 2ZD1A 4EZ9A 4KHSA 2HNDA 3VQCA 3U3GA 2QKKA 5J2PA 4BACA 1YTAA 3HP6A 1Z26A 3PO4A 3NF7A 3VQ9A 3NAEA 1WSEA 3CQ8A 1B9FA 4DQQA 4E7HA 3ZT3A 3HSTB 4CF0A 1FKPA 2FBYA 3L2QA 3EYZA 1BCMA 3DLHA 2DY4A 4KTZA 4B8CA 1QSYA 2WOMA 2E6LA 4O0IA 1YTUA 3AV9A 4HVJA 5I3UA 1RT4A 3OYNA 1RBRA 2Z1HA 3V9WA 1BGXT 4C8MA 4CJEA 4FM2A 4FZZA 1GOCA 1EP4A 3AA5X 4QOZB 4E7IA 4FYDA 1W0HA 3K59A 4FW1A 1Y97A 4IBNA 1X9SA 4IFVA 3LP2A 4OKKA 5E41A 5KTQA 1JLGA 3OYDA 4HTUA 3DI6A 4DSEA 3V4IA 3OY9A 1LWFA 3RWUA 3AVGA 4NYFA 5CYMA 1CZ9A 3DM2A 3VQAA 4E7LA 2IAJA 2RKIA 1NKEA 1RTDA 4O0JA 1N5YA 2KTQA 2YV0X 4CGDA 4Z4HA 1RTHA 1NOYA 2G8IA 1X9WA 1JXBA 4DTXA 4B9VA 3KLFA 4B9MA 2ATQA 3ALYA 1IG9A 4IDKA 3NGZA 1RT3A 4I9QA 3HPGA 3PX6A 3DLEA 3TABA 4O5BA 1KONA 1FK9A 5KRSA 1NKCA 1ZYQA 3PY8A 3I0SA 1RT6A 4FVMA 3T19A 4CJSA 1L3TA 3PX0A 3I0RA 3SQ4A 1D5AA 4HHTA 4E1NA 4LH5A 4AHUA 3NH1A 2YNHA 3TWHA 3RMBA 4CIEA 3HK2A 2YKMA 4CERA 4JRQA 2PYLA 4FJ8A 1VSEA 4Z4EA 3KK2A 1A5WA 4NCGA 4ZHRA 1S5JA 1WSFA 4KB1A 3G0ZA 3HPOA 3NCIA 1Z25A 3MAQA 2VG6A 3QNNA 5FDLA 3VQBA 3OYHA 3CFRA 4DTRA 1HMVA 4PUOA 4M3YA 2P5GA 2X74A 3M8PA 1HRHA 1CLQA 5HROA 4NYNA 1BHLA 1NK6A 1HQEA 3NGIA 4O55A 1ITGA 3OYLA 3HJFA 1ASVA 3E01A 1XC9A 1ZBUA 1S1UA 1TL1A 1SL2A 1BISA 3T1AA 1VSFA 4CJLA 1EX4A 2YNIA 1IH7A 1NJZA 4J2EA 1LFPA 3BGRA 4CJWA 4N76A 1WJEA 3LDSA 1C1BA 3AO2A 4Q5VA 1SL1A 1KLMA 3P1GA 4FJKA 1S6QA 2G8UA 3OJSA 3RR7A 1LWCA 4E19A 1NK9A 2QXFA 1RTIA 2BANA 4FCYA 5J2MA 1KVBA 3LP3A 3MXIA 3P5JA 3NE6A 4OKJA 2XHBA 2I5JA 3QERA 4QCLA 4CECA 1UA0A 2OPPA 2G8KA 3IS9A 5KI6A 2OYQA 1JLAA 3ZT0A 3LP0A 2A1RA 2RF2A 3LPUA 4PA1A 1SV5A 3C6UA 4O44A 4CGGA 1VRTA 2BE2A 3AVMA 3KLIA 1S1TA 4RW8A 4YFUA 3KLEA 3EZ5A 4DTJA 2ZE2A 4M3XA 4DMNA 5D3GA 1UOCA 4AHTA 3V9XA 4CHQA 1RBUA 3KLGA 1LW2A 4OPJA 3AVNA 1WSHA 2HHSA 3DLRA 3QEWA 4CJFA 1S9GA 4CHOA 1SKRA 1A5VA 5KGWA 4CE9A 2DFFA 4ZTJA 4LY7A 3BDPA 4DU3A 2W42A 1FXXA 4CK2A 2P5OA 1HNVA 4IKFA 1QQCA 3QESA 4PQUA 3AO3A 3CFPA 4DTNA 3NDKA 4FLVA 2EX3A 3V1QA 4DQRA 4AHSA 3MXMA 4ZTFA 5FRMA 2BGGA 1TGOA 1IKVA 2VWKA 3KK3A 1C6VA 4FLZA 3V9UA 3PX4A 4GVMA 3SI6A 1NKBA 4CHPA 4FLTA 4B08A 4KRFA 3F9KA 3VN5A 3SZ2A 4OGEA 3AO4A 3HXMA 3WNEA 4AHRA 1HYZA 3AA4A 3OYKA 3OYAA 3ULDA 4BE0A 4L8RB 5JS1A 3SUQA 1Q9YA 5SZTA 1T8EA 4F4KA 1RNHA 1U48A 4H4OA 1WSGA 4CFDA 3RRGA 4PY5A 3S9HA 1L3VA 3KD5E 3I8DA 1WLJA 2AJQA 4FLWA 3OS2A 3DOLA 4DQIA 2B4JA 1HYVA 3TI0A 2PZSA 4JS5A 3B6PA 4CEDA 3TAQA 4FK2A 3K58A 2OPRA 4C8NA 1TK8A 4HUFA 1RCHA 4OGCA 3TAEA 3TAFA 1QHTA 1U4BA 4CGIA 2HNYA 4CCHA 4HCCA 2D0BA 1KTQA 1C1AA 2FBXA 2IDOA 3MEDA 4H8KA 2OZSA 4DSLA 3L3UA 3P83D 2XY5A 1HPZA 1SUQA 3K5NA 4CJUA 3QIPA 4DU4A 4FJHA 2X6SA 3K5LA 1LAVA 1ZBLA 4CJTA 4CJVA 2O4IA 1BI4A 3AVLA 2HB5A 4FLYA 4DTOA 3L2VA 2FC0A 4NCAA 1XWLA 1RDCA 2E4LA 3G10A 3OYGA 5K14A 2D0AA 4RW7A 2PY5A 4J2DA 3SPYA 3PV8A 3IRXA 3MEEA 4HUGA 1TL3A 2OZMA 3K57A 4AHVA 1RT7A 4CJPA 2ITGA 5HBMA 3AVKA 3U3YA 1RDAA 1D9FA 1IKWA 1C0TA 4FK4A 4FM1A 1BL3A 2F96A 4F3QA 3M8QA 1S1WA 4KKOA 4DFPA 4OJRA 4DFJA 1WAFA 4EZ6A 4FJIA 1IO2A 4CEQA 1U49A 5EU7A 1IKYA 4E1MA 2IGIA 5C25A 2E6MA 4EP5A 3VQPA 3SPZA 2IC3A 4KI4A 3B6OA 1BQNA 3KIOA 4DFKA 4CFBA 2EHGA 3THVA 3EY1A 3OYFA 3OS0A 1MW7A 4EP4A 3DRSA 4JRPA 2IS3A 3VQ5A 4FM0A 4CEFA 4I9LA 1UWBA 4H4MA 4FLUA 4E3SA 3TAGA 4FJJA 4FJ9A 4KB0A 5CYQA 1NJXA 2FBTA 3NF8A 3AVBA 3VA0A 3ZT2A 5FROA 3LANA 4W5QA 3OYMA 4DU1A 5JS2A 1XHZA 3QO9A 3L2UA 1O1WA 1X1PA 5C24A 1VSJA 2HHWA 4FZYA 4CGJA 3VA3A 1TAUA 3O3FA 3RMAA 4DTMA 4KV8A 4KHQA 1C0MA 2PYJA 2YHBA 3V9SA 1QSLA 1D8YA 1T7PA 2HVIA 3C6TA 3V1OA 2G8VA 4W5TA 1U45A 4FJMA 3QIOA 1RBVA 5CZ2A
chains in the Genus database with same CATH superfamily
4I6ZA 2VC1A 2GIZA 3SV4A 1BI4B 2HOAA 2E2HJ 3V6DA 4KN4X 1BI1A 4BRCA 1NJIO 4B3RK 2O8KA 3AL0C 4F3TA 5JVGF 4UV8A 3C1DA 1UELB 3QDKA 2NZTA 2KFNA 1T8IA 2EWSA 2K9NA 3FXJA 4CIFA 1FC3A 3VODA 3KWGA 1IBLK 3K5MA 2Q3SA 1ZLJA 4RW9A 2KZMA 4LG0B 2K5CA 4A12A 5KQ8A 2WAQA 3MN2A 1WBBA 2NS8A 1R23A 3W0LA 3ISPA 2XGDA 4G1QA 4HNUA 4ID5A 3TPQA 3LA3A 3E0JB 4A5AA 1R9TJ 4O4GA 1IRFA 5HRPA 3RQ4A 1JKHA 4CJKA 3GTOJ 5KHDA 1N36K 2F5EA 1PUFA 4JI7K 2OJED 2HKOA 4CZFA 4DQ8A 3QPHA 2E8AA 4CK1A 4Q0BA 3O2PE 1DTQA 3CCVN 3WTXC 3VDXA 2P5VA 1YITN 3A8YA 3BY5A 2JLEA 1X1CA 2DK5A 4KO0A 5ELZA 2H6CA 4HG2A 4LD0A 3MECA 2E1MC 1RDBA 3RKWA 4M6VA 3KYLA 3ZQCA 4BDZA 4M3GA 1N34K 3L2RA 4LLNA 2QA4N 4JHDA 4C30A 1UAAA 2UYTA 4IF4A 4OLBA 3D2EB 4DHYA 2BY0A 3HPHA 4YORA 3DMJA 2L7ZA 4Z4GA 2FBIA 4CW7B 4RAFA 3MFKA 1JXSA 3L3VA 3VEVA 4FWMA 1JGSA 1OQYA 3OL3A 2BH1A 3RR8A 2QM3A 3TAMA 1VSHA 3OMYA 4KJZA 2BDPA 3AG4H 3SQ0A 1MDMA 4IHSA 4DR4K 5E3NA 3HT3A 5KAFC 1XQSC 1K79A 3TTFA 1EH6A 3K6GA 1X9JA 2JSPA 5EF6A 3IV5A 4O0IA 1YTUA 5LEKA 1T2KA 4FM2A 4D0PA 3AA5X 4E7IA 2RVCA 4IDHA 1Y97A 1ZBSA 4OKKA 2K4JA 5CYMA 4FVUA 4CGDA 3FXRA 4ISEA 3KLFA 4B9MA 5J40A 3NGZA 5HVQC 5KRSA 3E6DA 3P39A 1ZG1A 3C2BA 3IHUA 3KX2A 3LWFA 3WTUC 3HHHA 1RDWX 2R93J 3ZXSA 5FDLA 4M3YA 3GTQJ 4H03B 4CZEA 1U3EM 1YAGA 5BPLA 1IDZA 1IN8A 1WZ2A 3CCJN 4G94A 3A5MC 4UXNA 2BANA 3P7NA 2BHYA 2OPPA 3GE1A 3U21A 1VRTA 3S1MJ 1UOCA 5AQJA 3IRRA 2X1CA 3MCPA 2MH2A 2HDWA 1S9GA 1TQMA 2GXBA 2YX6A 3H0DA 3VGKA 4FLVA 1LDDA 2PMUA 3GUDA 1LJ9A 5TJJA 1CGPA 2ZXHA 3SZ2A 3AO4A 1ZGAA 3M3ZA 3BTIA 2UXDK 5C4JJ 4BVOA 5E3LA 5AQGA 2LY1A 3CCMN 5B5EC 2RQQA 3HGYA 2MYSA 4M7YA 2E5NA 1OKRA 1OLTA 1BOAA 2VXDA 4RAYA 3TTCA 1KTQA 2NOJB 4UNOA 2PMHA 4A3EJ 1U2VA 3CC4I 2ZM6K 2O4IA 1LKXA 5KVRA 2ASPA 4ISGA 2GBYA 3KYCB 3N97A 1K4TA 3SJHA 4WCEL 2JA8J 1BL3A 2F96A 3M8QA 4CZLA 5J3LA 4DV0K 4EP5A 3H3UA 2JJ7A 3DXKB 4JRPA 1BC8C 3VERA 2DA3A 3ZQLA 4BRHA 2FBTA 4HX7A 3ZT2A 2P7CB 2X0LA 3FGUA 5JS2A 3BCBA 3QPLA 4I2OA 3RMAA 2HVIA 5EGOA 4ZDPA 2KW4A 1HJOA 1FBQA 4AYBA 4XBFA 4YHHK 1BI2A 2X6WA 2JVGA 1FJLA 4A0ZA 3OIOA 2DI3A 4CBWA 3D5RC 4A2AA 3H5RA 4FETA 5DK5A 2P9KB 4IFEA 2VBXA 2XB5A 3CJ1A 3QU3A 3KZYA 3TO6A 4AH9A 1R4MB 5DEQA 3CF5L 4JI1K 3P31A 3VEOA 2EA4A 3HDDA 4HX8A 2QWWA 2BW3A 3A4CA 5BREA 1FTZA 5AQHA 2X78A 2JPBA 3GF2A 1L3SA 3OYIA 1VSMA 3KK1A 1QSSA 2CH0A 3NBPA 5J1RA 4BQNA 3DKXA 3G73A 4DQSA 3O3KA 4I6MB 5AONA 2FX0A 3CIPA 1K73O 3EL2A 4FZXC 2CFOA 2LTPA 1BW6A 4M3FA 1NK3P 2F4IA 1USSA 2JRMA 1E3MA 1VQ4I 1TWCJ 3FZMA 4M7XA 3IG1A 4CHNA 3AGKA 2JUCA 3CTAA 4KHUA 1MGTA 2OU2A 1RT1A 3SXYA 2QYOA 1QS4A 1REVA 3K9KA 3T1BA 1SC7A 4RAGA 1S9HA 1SFUA 4KN7X 3H08A 3WODF 3WNFA 1HYSA 2DU9A 1XGOA 5E17F 2HQ5A 1VQ9I 3F5TA 2WAQN 3VQDA 2F2EA 4J2BA 4DSJA 4ID1A 4BROA 3ZSVA 1W7AA 3THWB 1TT5B 5J2NA 3ZQQA 4DSKA 1ZAOA 3EPZA 2X1DA 1IN7A 2VI6A 2FF4A 3S3MA 1T08B 2UUZA 3CUQC 4G6TB 2CO5A 5DMRA 2KPMA 4PKIA 3FDYA 4A3DJ 3HVRA 1MMSA 2G0EA 1I3QJ 3QFUA 1NNEA 4D1QA 1ERDA 1RR8C 3H1VX 2PG4A 1RBRA 2UXBK 3HSCA 1GOCA 5FO5A 5BMZA 2HKXA 4IBNA 5E8GA 3RWUA 2HYFA 2OBPA 2LRDA 4CBXA 2KTQA 4KITB 4NB4A 2VBZA 4JK7A 3R0AA 3CJ7A 1YIJI 2E1NA 1PUEE 2ZWHA 3I0SA 1A04A 3GL1A 3BTJA 1RPWA 3VMFB 2QSFX 1FYLA 2YKMA 3U1DA 4GO1A 3KK2A 3FIWA 4MO4A 4IX7A 1BA1A 4A3MJ 4OWRB 2VPLA 1JI8A 5M3FJ 3M8PA 1HRHA 2GOMA 2QVOA 5J8CA 5M1QA 4JK8A 3GWZA 4CCJA 4ZC3A 4CJLA 3BGRA 2KRHA 2DYSH 3H3ZA 3BWGA 4DZPA 4F91B 4YFUA 1S1TA 1ZRCA 1VQLI 3PQKA 5F64A 4AHTA 4CHQA 3QU6A 3H0GJ 3RZOJ 4M73A 3VPZA 4W1UA 3BPVA 1VQPN 3KK3A 4EHTA 2ZGZA 2LF8A 2Q0RA 1K83J 3ULDA 3OYAA 4GV9A 2HTSA 2GAUA 4CFDA 3E5XA 3KD5E 4Q4ZF 4JS5A 3EUHA 3JRBA 4X0GA 3RSNA 2LG4A 4CXFA 1W0TA 4U67L 1UHSA 3MKLA 3VGLA 5K14A 3S93A 3FMRA 4AHVA 1NGBA 5BRDA 3VWBA 1IKWA 1HX1A 4FJIA 5EU7A 4PL8A 3OYFA 3VQ5A 4L8RB 4H4MA 1Y64A 5KQDA 3VA0A 2DW4A 3O3FA 4PFPA 3F8NA 4BJTA 4HLYA 1ZQ3P 1C0UA 1ASWA 5E1WA 2F6CA 3B73A 3ISNC 1P90A 3VTIA 3ZSWA 1L3UA 2DTZA 4CBUA 5JR3A 2JGUA 4O6JA 3GXOA 2DMTA 3IKTA 2J5PA 3DOKA 5AQOA 1QTMA 4Z6YA 4B3XA 1FY7A 1JCFA 3L2CA 5E18F 3QEXA 2MBFA 1Z1DA 2I7NA 1LVKA 2UUAK 4B43A 1H9GA 3DXMB 5DM7L 4B9SA 1A5XA 4G6QA 2RC4A 1N78A 2OZUA 3ZMSA 4MLHA 5BN8A 2R7YA 3K70D 2MLGA 4CZIA 2W48A 2RN7A 1NK4A 1IDYA 4RB1A 4X66K 3WHCA 5A2QZ 3KCCA 3QLHA 4WFNL 2EIJH 4HYEA 1G2HA 4LF4K 2DPDA 1GLLO 4FJ7A 4UUSA 4B3TK 3Q5FA 5I42A 4UV9A 2Q1ZB 2YR2A 4WYBA 2HBKA 1AKHA 4XRFA 3MEGA 2ME0A 3QETA 1S1XA 5T7BA 4E4HA 1Y6IA 1Z05A 5GTHC 4AYBN 4G7OF 3QAHA 4QSHA 4V2GA 2BUPA 3LPTA 3ZT4A 2CYYA 4RM2A 3Q0UA 4C8LA 3OYCA 3P4IA 3JCUC 4FSVA 5J47A 2M7AA 3IMXA 4NQWA 3G71I 4JV5K 3ZMTA 4IEJA 1EETA 1DU6A 1PUFB 5AR0A 4PCQA 1K6YA 3CQXA 2PMZA 3BR0A 2P9LA 3CCRI 4XIDA 1OYYA 2IVPA 1K8KA 2F5FA 2VODA 4FHTA 5AQSA 2PFBA 3OYBA 2E36A 4I0AA 3AVCA 4UUTA 1BDGA 3QEIA 5ED4A 4DBQA 4IRIA 1EH7A 2P1JA 5F08A 3LSJA 1KRPA 4HX4A 1KVCA 4PWDA 4UY8O 4MDAA 2HVRA 5TGTA 4BXUA 3DRRA 1W5TA 3RIRA 1LPQA 1TTYA 4XOPA 2RPIA 1CF7A 2F8SA 4AWXB 1ZBIA 1AWCA 1VQMN 2DQRA 2GUPA 3I4PA 4G12A 1U8BA 2R7XA 3I54A 3KKRA 2JA6J 2YUSA 2GM4A 2GWKA 4FE7A 4EZ9A 2HNHA 4IO9F 4B47A 1XMQK 5M1NA 3HP6A 2VE8A 1XGNA 4JK9A 4CF0A 1XCBA 2A5YB 4LK1F 3WXJA 4DOZA 1B4AA 4CGZA 3FMSA 5JVGL 5HLGA 5LMUK 3F21A 1VQNN 3DEUA 3M6GA 3N4QA 1FYKA 4L3QA 4A6EA 2HOSA 2P9NA 3ALYA 3HOSA 3R8EA 3WXIA 1DQUA 4OLAA 1ZYQA 4FVMA 5FKLA 1MDMB 3I0RA 2CQ7A 4LH5A 2YNHA 3D2FA 4Y17A 3HK2A 2ZSIB 1NHAA 4ANJA 1KAXA 3NCIA 4QPQA 1Z0XA 3BTCA 4O55A 4ENMA 2M87A 3RVCA 4HSRA 2STTA 1SL2A 1X2NA 4I09A 4N76A 4WFAL 3FXMA 3NVMA 5IP6A 4Q5VA 2JVHA 4EJWA 3OWTA 4FCYA 3P5JA 1H88C 4QCLA 1BU6O 4BY7J 1QZYA 3ZT0A 2XSDC 2OF7A 3EQLF 1P9QC 4M3XA 3FZHA 4KHPK 2ZBKA 3OR1C 2D2WA 2HOEA 4JNEA 2CFXA 4FWLA 2EX3A 4ZZDA 5AQNA 1BG3A 1YLFA 2XF7A 4RB2C 4OGEA 5A2QK 5MLCQ 1A6IA 4BE0A 3DV8A 5JS1A 2P9IA 1U6GA 1U78A 3SUQA 3S9HA 5IY5H 4LF5K 1HKGA 2FU4A 4JN4A 3ROUA 1IBMK 4A3GJ 4ZYEA 2X6SA 4CJVA 2P9UA 3CC7N 3DTIA 1O3TA 5EJCA 1QPMA 4C3HJ 5KPRA 1IO2A 4CEQA 2CGKA 3SHFA 1YF5L 2ZNZA 2F9TA 1MA9B 2OTJN 4CGJA 3H3VK 3VF2A 2XAHA 2D1KA 1C0MA 3KEOA 3PM1A 4FJMA 2OQGA 1U2VB 4LIVA 2DO7A 3O5BA 4KFBA 2Z33A 4B3AA 2Q2RA 4EMSA 5F0CA 4IO8A 4BG9A 3C3WA 3MMYB 2DT6A 1LV5A 3NF9A 1U2WA 1FOYA 3G6EI 3V4GA 3DPTA 3HRUA 1ATSA 2QTDA 1J09A 1E4GT 4BNCA 1S29A 1HPMA 4OPAA 4HLXA 3GTMJ 3HRGA 3EUAA 5A2QO 1RETA 5EGOB 2GA1A 4XH1A 3H3OB 3O1WA 1NGFA 4C3JJ 1TK0A 3UR3C 3RDIA 1Q82O 3RCOA 1MWMA 2NOGA 3CJCA 3SJJA 3ZRGA 1ASUA 3E9OA 2FJ1A 4XORA 2IJLA 4NHJA 3JRDA 2XGEA 1WNSA 1Z91A 4J01A 4M3RA 3QICA 3NH0A 1RNLA 4MQ9F 3F22A 2EZKA 3GBTA 1HNIA 2VGNA 3CJNA 1XN7A 1ATRA 5AFUH 1QVFM 2KFZA 3J7AP 2BW3B 4HQEA 1IN4A 4Y13A 4KH6A 1ETQA 5AZIB 2R5ZB 3T8RA 4U7DA 3ABKH 1F1ZA 3DCFA 4KFCA 3JTHA 4JD2A 3J7YJ 1D0YA 2K85A 3MVPA 4F52A 1Q1VA 3TDUC 4ZDLA 1VK0A 2ZGYA 3G1OA 1WVRA 4CEOA 1VSDA 4DV3K 5SWMA 1KGSA 3BROA 4YELA 2G8WA 1TWGJ 4EIAA 4FX0A 4Y4RA 4ENJA 4FXDA 2FMYA 2HVHA 4ESBA 2VQFK 4DUYK 4HBLA 2E34A 4UB8C 4JK1X 2EINH 3K0SA 1HJRA 4YIIA 3LSGA 3LSKA 2YSRA 1JTXA 1UMQA 3GFIA 4IQ4A 2K9QA 4UQGA 4KAZA 1KZHA 1NGCA 3FFIA 3CMEN 4RGXA 3JSOA 4ELTA 3KP4A 1EQYA 1KXPA 3G1MA 3CQZJ 3COAC 5J8FA 3ZMUA 1NGHA 1G8XA 2WV1A 4FWOA 1W36D 3OW2M 2HPIA 4E7HA 2VYPA 2FBYA 1IUFA 3DLHA 2D1HA 2MG4A 2KLOA 1UG0A 2Z1HA 5IWAK 3WXLA 2BBYA 1R1TA 1OFCX 2EIMH 2LKSA 1RZ4A 4O0JA 2YV0X 3KVGA 3EZWA 1RT6A 1X3MA 1LVAA 1FIPA 3N05A 1IXSB 4FJ8A 1BWFO 2H09A 4B9QA 1X19A 5ILVA 5E1XA 2MLKA 4JI0K 2GTDA 3E01A 1ZBUA 4GY2B 3DFGA 2KZGA 3T1AA 4XKCA 2QM1A 2EFWA 1J5YA 1WJEA 2HVSA 4OIOF 5H2FC 3RR7A 5D8LB 3CDHA 2E1OA 2L02A 2M34A 2Q36A 4IEIA 1JLAA 1HW5A 4L5IA 1E2XA 4K25A 1IC8A 1QZ6A 2EZLA 3RI4A 1ONVA 3I71A 3AVNA 4U0VA 3A5LC 3V1QA 1SAXA 3A03A 4NC8A 2D0OA 4KH5A 4A59A 3AA4A 1DEJA 3EDPA 4KISA 1T8EA 4F4KA 1OCOH 4PKGA 1U48A 3CETA 3D5LA 3Q9VA 2BY2A 1Q7YO 3WHBA 3NRVA 3CCSN 5K7FA 4CGIA 2OZSA 1CZAN 4HEA2 2I5UA 4AQYK 3MMVA 2FC0A 1RDCA 2D0AA 2V79A 3EE8A 2WAFA 5BPDA 4RBOA 1HF0A 4BBSJ 1BQNA 1VZ0A 4EP4A 4FLUA 4CEFA 4KB0A 3QP5A 5FROA 2CWEA 3WEEA 3QOPA 4DTMA 2PYJA 1MJAA 5GPAA 3CMAN 1FOWA 3QB0A 3R61A 1C1CA 3ZMVA 3I55N 1JJ2M 3B6CA 2IA2A 4H5WA 2ASOA 2RAEA 4RGRA 4BHPA 4CGFA 3TMOA 4B1YB 4A3JJ 4C23A 4CF9A 3TL4X 4EJUA 2CJJA 3O3HA 3PSIA 1SEUA 3DLKA 5AQYA 2TDXA 3ZCMA 1NMDA 1HKCA 2WC2A 1Q8IA 4F2SA 4ON0A 1SD5A 5BR9A 4CYDA 2FLOA 4A62A 4ILHA 3DLBA 4GYIA 3RMCA 5HLTA 3VFZA 3EYIA 1U5TB 1SFEA 1XS9A 4M9SA 4N5SA 3KP7A 4NLCA 2HYGD 1W9HA 4JX6A 3MXJA 4EATA 3ZSYA 3JAMZ 2E2NA 1RDUA 3CDLA 2LH9A 2XC7A 2P9SA 3ABTA 1KCFA 3F6VA 5CJ9A 1ACIA 3K1PA 4F93B 4DV7K 4GNIA 2NRAC 4A57A 2V52B 1SKSA 1FMWA 2KT0A 2WADA 1H9TA 4UUSB 3H9JA 3IC7A 3CERA 3JRGA 3ZPLA 2Y0SA 3AVHA 4L5JA 3Q7BA 2COMA 1CQTA 1SMTA 3VQ4A 4DR3K 1P6RA 4JI5K 3NVKA 1AKHB 4YOVA 1Z6TA 3CJRB 3JSPA 4DWIA 2KDOA 1SD6A 3AO5A 3O9TA 3LAKA 2Z99A 2DYRH 2HHUA 2M4GA 3HVTA 2UXCK 3JRAA 2CGLA 3RRHA 4FJXA 2H27A 2KQ2A 5KGXA 3TSUA 4IHXA 4AM6A 1BIUA 2KZZA 1NK5A 3FR0A 3X2QH 2M8EA 3KP6A 4A93J 4NQWB 3S1RJ 3LDPA 4CCKA 1FNNA 4PJLA 3VENA 2P9LB 2HYJA 5BPIA 1JT0A 5H20A 3RZDJ 2FE3A 3R0JA 3QEPA 1HKQA 4XSZF 5GTIC 4V19K 1S3XA 5HDNA 2Q2EA 1RKWA 2PBDA 3AV9A 5DCMB 4DYCA 4BQLA 1N75A 4ZYAA 2QCOA 2O8BA 1SMYF 3H6EA 4YOWA 2Y31A 2FF3B 1ATNA 1NOYA 4CZHA 4A0YA 1DP7P 5GIPA 1HKBA 2ZJ2A 2JRTA 2LNBA 2VQCA 3EKUA 3SZTA 1L3TA 1ESVA 3SEZA 1RESA 1HNZK 4KB1A 2GOXB 2X74A 1X4OA 1IJJA 2W40A 5E26A 1J9IA 1WI9A 4IZ9A 4C3IJ 2GWJA 3LSHA 3LDSA 3THYB 3L00A 4BR0A 4RA2A 2G8UA 1LWCA 4E19A 2QXFA 2P9NB 1LNWA 2CSOA 3BZKA 2VIXA 3KLEA 5LHGA 1NMNA 2ZE2A 3DBHB 3D2FB 1M1KO 1U0JA 3Q7CA 1W5CC 3QMLA 4CHOA 3DLLF 2XF6A 1W2BM 2A6AA 2NLXA 4CK2A 1HNVA 2ZMEA 2L4MA 3GFJA 3MXMA 3G1LA 1TGOA 2VOOA 2EJRA 3V9UA 5IYDJ 1I1GA 4UVAA 2DAOA 4WXCA 4DKWA 4IQJA 5CKTA 1YO5C 1RNHA 1R4NB 3HEFA 3I8DA 2ASMA 2B4JA 1HYVA 4MEXF 2KKZA 3F8MA 4OGCA 4GV3A 1LOTB 3MEDA 3P83D 4JKAA 5C4XJ 3OBYA 2ZJQL 2OA4A 4BHBA 4RTFD 4FWKA 3L2VA 1XWLA 3JAMK 3QODA 1ZR4A 2OZMA 1S1WA 2O0YA 2ELKA 4A2UA 2FSJA 2P9IB 1RC9A 1VNDA 1IW7F 1MBJA 3TW6A 3L2UA 2LC2A 1HOMA 3I64A 2VKDA 4XSXF 4Z2YA 3VGMA 4CH7A 4W5TA 4XKWA 2W85A 1VQ7I 2BGCA 1RTJA 1FSHA 2P9UB 4IG3A 1ON1A 1YG2A 4OOIA 5LRRA 3PNVA 3AO1A 1S72I 2D4WA 1D5YA 3VQ8A 4FO0A 4BWJA 2FA5A 4IO9L 4YIFA 3I8BA 3NGYA 4YOTA 3CCEN 3MKZA 4F9OA 4Y15A 4NB5A 2E71A 1STZA 3PIOF 2LSNA 1N25A 2DPNA 2LLKA 2OD5A 2KRCA 2Z16A 5JHUA 1PJRA 4W5OA 2HBLA 2FEZA 2QEXI 1WSUA 4HV5A 2HW3A 4DS5A 4CEBA 3VQ6A 1N8RO 3U9DA 1R7JA 3ZCOA 4Y0WA 4ELUA 1NBWA 4CK3A 1QVTA 3SMPA 3DKYA 3VEPA 1HW1A 1PP7U 1JXEA 4PJMA 3JAMO 3IFRA 1FPQA 1VQ5I 3IH2A 1EKEA 1MH3A 2DTRA 1T0FC 2FSKA 5F0FA 1VSKA 1V4SA 1POGA 2QWOA 1WH5A 2OPQA 3RSEA 1G59A 3ULEB 3EN9A 4F92B 4XLAA 4WQ5C 3BZCA 4LF8K 1J0RA 1W36C 1TKTA 2Z1JA 3HOTA 1W0UA 3SQNA 4JI8K 1FLIA 5B8HA 1MJBA 4CFAA 3M8EA 1YJ9N 1YJNN 2VWJA 1ZBHA 3CCLN 4CVNE 4JX4A 4JBAA 1TKXA 1U6ZA 4F2RA 2NVUB 4OINF 2WTEA 1WBDA 4A3CJ 1XGMA 2E60A 2A6EF 4CFCA 4MQVA 2VG5A 2W4SA 4CCLA 3ZEUA 4PL7A 4YRVA 4RAZA 5CZ1A 5ICFA 1E0EA 4HRIA 2HBMA 5F0HA 4JD2B 4RWTA 4AILC 4XONA 2K9MA 4OAZA 3M1EA 1FIAA 4H0EA 4JEPA 2XAFA 3ABUA 1QGPA 2LF7A 4OVLA 2VCPA 3VETA 3HOZJ 4N56A 1TAQA 5EZHA 3KWIA 1X2MA 2IT0A 2F5CA 2CH5A 2BVMA 5L3FA 4C8KA 2UWMA 2P51A 3GOIA 3FKJA 2QKKA 3VEWA 2W84A 2XSJC 3WTTC 4XH4A 2V6CA 1HDPA 1IG7A 4FW1A 5BR8K 3V4IA 1JLGA 3F9MA 2UUBK 3FMQA 1Q1HA 5HDKA 4E7SA 3DM2A 2V1NA 3MCZA 3T69A 1N5YA 4Z4HA 2K9LA 2JSCA 4B3MK 1OYWA 4LK0F 4I7HA 3L1PA 3HPGA 2L4AA 3TGNA 1NGIA 1ZLKA 4FQGA 2JT1A 2QWLA 3RMBA 4HPQA 3SBTA 4D5FA 5F1RA 4Y7NJ 3MAQA 2P5GA 4HWIA 5FB2A 3TTDA 2KMUA 3HUGB 5GINA 2V1UA 1IV8A 4S0HB 3I59A 2KHOA 3KEYA 4HZFA 4FJKA 3CC2N 1K6OA 3MXIA 9ANTA 1MD0A 1YVNA 4NXNK 2XAQA 5D3GA 4BEHB 1BA0A 4B1UB 3GTLJ 3WXKA 1HR0K 2DFIA 2P5LC 1FXXA 4LFBK 3E9LA 1B59A 1PP8F 3I0TA 2BGGA 4UY8I 1C6VA 3PX4A 3R4KA 3VN5A 4WXDA 5C0YA 1X1AA 4K41A 2LK2A 2MC4A 4H4OA 3CCVI 3OIPA 5AQUA 1YITI 2CW0F 2DN0A 2RQPA 3LA2A 2CQQA 2LSOA 3ZQFA 2IDOA 3K4BA 3D7EO 1SUQA 3S2DJ 4BG8A 4A5NA 2VB6A 2HB5A 2MD5A 3GCMA 4XMYA 4FWNA 1GUUA 3IWZA 3GFLA 1I94K 1QZEA 3BR2A 4DFPA 4J19A 2E2JJ 3CP2A 3HSRA 3DRSA 4FM0A 2Y69H 4FJ9A 2ISZA 3ZYYX 3OYMA 4U0WA 5CVVA 2V9PA 3VA3A 1TAUA 4H0TB 2A41A 3D0SA 4IOAF 2PFUA 5CZ2A 3FLCO 1UAXA 3MAJA 4Z4CA 4P9UA 1VFCA 1JLCA 4XR6A 1YE9A 1NG7A 4B09A 2D0CA 1GLEG 3PL8A 4I02A 3MN6A 1KQSM 4KTQA 2Y30A 4BRAA 4M41A 1Z77A 3SYZA 2ICWG 3UKUA 1U5TC 4AHCA 2FD5A 5EX5A 4DV1K 3MX2A 5M1OA 1JL1A 3WEEB 1RR7A 1IRGA 2H6BA 2H1LA 4Q47A 2FNAA 2VQLA 2DMNA 2XY6A 3LP1A 2WB1A 1R5HA 2YX7A 3L0QA 4CJQA 3DPLC 4EM0B 3VYRB 1S6PA 3F2KA 3ZSRA 2J4RA 4KHWA 1RIOH 3TDZC 1FX7A 1NGEA 1YJWN 4I76A 3IH4A 3HYIA 1EWQA 4I2QA 2BV6A 4AIKA 1I6XA 5DS9A 1NH3A 1H0MA 1QE1A 3RYPA 1JLEA 3DPUA 1HA8A 3AVAA 3U4LA 1V5GA 2YHYA 5ADXH 2YCHA 1E3HA 4TSXA 3LQRA 5M1PA 4MFDA 2BY3A 2FSNA 5GAHP 2XHKA 1F5TA 4BKXA 4H0XB 5M5YJ 2MD0A 1UFMA 1G3SA 2LREA 1BN5A 1UA1A 1F43A 5LHHA 5GPCA 1U47A 1GXQA 1QHHD 5AFUA 3CCJI 2ME6A 1GLNA 1OCTC 5I9EB 1XMOK 2DA6A 4BDYA 5FKMA 5HS7A 3HSFA 4IVNA 1MBGA 5DD4A 1OCPA 1NG6A 1HDDC 4PJJA 1GLCG 3DWLA 3TEDA 5CVUA 4CEEA 4CJ5A 3VQQA 3U9GA 4BDPA 1Q81O 3HOYJ 2FXAA 1D9DA 5FLXZ 4E89A 3CDIA 1X3ZB 5AQLA 3NQOA 4B9LA 2P9SB 1A31A 1YOVB 3MKWB 5IYCJ 1OVYA 1N6QA 1S5LC 1KFSA 4HF1A 2NNYA 1XTAA 1QZZA 4FX4A 4NC6A 3CCMI 3E97A 1XI1A 2IEKA 5HRRA 4X62K 1OH6A 1K78A 2V7FA 4OPKA 5K7HA 2K3FA 1D0XA 1F36A 3OHRA 4O5FA 1GOBA 2CQNA 5C10A 4MTEA 2GXGA 1QHGA 3KJVA 1I3AA 4G6DA 1IV6A 4OPHA 1N33K 4BACA 4BRNA 3CQ8A 1B9FA 3HSTB 1QSYA 1H8AC 4CA0A 3VESA 4PGGA 2FOWA 4GDFA 1XC5A 3VF6A 4CD1A 1OCZH 4DIQA 4YOYA 3ULQB 4DTXA 3NEUA 1FK9A 3KZZA 4CJSA 4M74A 3PX0A 4DR1K 3HM8A 2PYLA 4DYRA 1A5WA 3FFKB 4PKHA 1QZ5A 3HJFA 1S1UA 4OU0A 3O6BB 4FOIA 1JHHA 2DT7B 3LSPA 1NJZA 1LFPA 5F27A 4LFAK 2O8BB 1JKRC 1JT6A 2CV2A 2D0PA 1SAUA 1TL8A 4QWQA 3C0BA 4BHCA 4CECA 2HDDA 1UA0A 4HA8A 4OMZA 2R7TA 4DMNA 1EF4A 2MW8A 1K8AO 1W7PA 3MCAB 1E3OC 1LDJA 2P5OA 2I7PA 2OPTA 3AO3A 4DTNA 3CUQA 3WTWC 2KP6A 5JVTA 2ZJRF 4KYWA 3WNEA 1LUJB 3OA9A 3VEYA 3RRGA 1G4DA 1XCVA 3RQIA 3LM2A 2OTLN 4FK2A 4RDUA 4HUFA 3CCQN 1U4BA 3HTSB 3Q0WA 4H8KA 2V1DA 4FJHA 1TLHB 3WTVC 3AVLA 2NRZA 1QBJA 3SAFA 3LAJA 2DT5A 2ZMEB 3BT9A 1D3YA 2Z2SB 4PSWA 3R60A 2W6LA 3VQPA 3QBWA 1O3RA 4ISFA 1NGAA 2HHWA 1PDNC 3TAGA 3W6VA 5AIQA 4WQ4C 5L3EA 1YXQA 2Q31A 4R79A 1Z3XA 4B8XA 3BR1A 1TKZA 5FKOA 2HMPA 3JREA 2EILH 5FLXK 1JTYA 3GEZA 2MA3A 3T5XA 3E5QA 1D1CA 2O8EA 2YJEA 2HNZA 2EPFA 3SNNA 4NO7A 4JLHA 2KDZA 5BNGA 3ELKA 4B1ZA 3J7YP 4Q5SF 2M9HA 3ENHA 3ZSOA 2ETJA 3M4OJ 1R58A 2LDUA 4AUXA 1G15A 1S6LA 2X48A 2RHKA 3O08A 2VBWA 2ZXJA 3H5NA 4QS8A 1JJ8C 3LFUA 3FBIB 3M9AA 2PJPA 4JKGA 4HW0A 1SQKA 3BG5A 1USTA 3BDDA 3FXQA 1HCRA 3H3NO 4EM1A 2YJFA 4B1VA 1LWEA 4BE1A 2Y2ZA 5LBQA 5EEGA 2Y1IA 1P2FA 2E2IJ 1PYVA 2YKNA 4GW6A 3CCUN 5IOYA 4A69C 4IZZA 3CI5A 5GADP 2Y9ZA 1P7JA 3K4LA 1LAWA 2CUZA 5EVZA 3RYRA 3VYSB 4RLFA 2HF4A 1JE8A 3OVNA 2O61A 2EBIA 2DMUA 2JTVA 1PVEA 3C95A 3DLLL 1IN5A 2V9KA 3QBXA 3S1NJ 1T39A 5BQTA 4HNVA 4LB6B 4L9VA 2VJ5A 3AGRA 2LBFA 2G8FA 4X6AJ 2TCTA 2JWLA 2GIVA 1MJ9A 3G3ZA 4XOTA 3CLQA 1VQPI 2WB1N 3NFAA 4EQQA 5D5UB 5M5XJ 1MNMC 1CZBA 1L0OC 5D5XB 4CESA 1X1BA 2NRWA 3VQEA 1YS7A 3R6SA 1ZR2A 5HRSA 1VQ6N 2PAVA 3AL0B 1WJBA 1SVMA 3SUOA 2X6NA 2PJRB 4XM3A 3TSPA 2CG4A 3TR8A 3SUPA 2O8FA 3JW4A 5HLIA 2UXNA 4X1EA 3PIPF 1ETWA 3IAM2 1WJFA 4DCHA 2HNDA 2DQLA 1P4WA 1YTAA 3NF7A 4M63C 4XICA 1GV5A 3QRFF 2E6LA 3QYFA 1BO5O 4EHUA 2XROA 3F0CA 3LL7A 3OYDA 5E79C 4XNFA 3PX6A 1X3NA 3SQ4A 1D5AA 2FRHA 3TWHA 4F7ZA 3V7SA 2FF6A 4ZHRA 1O7FA 1G99A 3GTPJ 4E70A 3PIOL 1HMVA 3W2WA 1CLQA 2M8GX 1NK6A 3IKVA 2M7BA 1ITGA 3FISA 3C18A 2DMPA 5BS6A 2GQQA 2GLOA 1KU2A 3HSEA 2W41A 3S41A 3IS9A 3THXB 5FLVA 1HSTA 2UUCK 2CGJA 3OS0A 1V54H 3SJMA 2E1MB 2PI0A 1YRNB 3ENOA 2IGNA 2MGQA 1WJ5A 4AC0A 2KFDA 4BVPA 3QEWA 3BDPA 4XL9A 3QP6A 3QESA 1IUYA 3CFPA 2KIUA 2XRLA 1E4FT 2VWKA 4B08A 3V8LA 3I59B 3CZ6A 3K4CA 5EDNA 4WK8F 3DKWA 2DA5A 3ZQHA 1BW5A 3OS2A 1NTCA 3WQUA 1C1AA 4CZCA 3BOQA 4AIJA 2M4KA 3ID6A 3MD2A 2CRGA 3U2RA 4P9FA 2DA7A 4HUGA 2R4GA 3CPWM 1BUPA 3HG9A 2N8GA 4KKOA 4F3QA 1R71A 4BXFA 1T44A 4IHVA 4E1MA 2IGIA 2ZB9A 3ENBA 3KIOA 2EHGA 3THVA 1GVDA 2JWKA 2IS3A 2R7RA 3FE1A 3LAPA 2EFOA 2IGMA 3S8PA 2ESNA 1O3QA 4AD9A 4A5BA 4WXHA 4BJ5C 4KHQA 4NC7A 2DBBA 1MMDA 1MSFC 5CQEA 2YI1A 4F8RA 5DCFA 3H1QA 2ZFUA 1J59A 2Y0MA 3BG7A 5FFZA 3S15J 5M1FA 3A0HC 1YX5A 2UXXA 4L5EA 4UVCA 4U0YA 4RW6A 3DRPA 2FMLA 3V7CA 2ZJPF 1F21A 3O6WA 3O8HA 1VQMI 2IA0A 3RPQA 4E1JA 3QEVA 1K61A 2LY2A 4XLPF 5JLHA 1IJWC 3CFOA 3U6FA 2YHXA 1UHWA 1WGXA 3PSFA 5KK1A 4ZH4F 4BRLA 3I33A 3G25A 4DR2K 4HCBA 5GIOA 4M3BA 2GBZA 1HQUA 2L3DA 4A3BJ 4M3TA 3GLXA 4XLHA 1IXCA 1KU9A 1VQNI 5KRTA 2JN6A 3ZQGA 3HGGA 3K9JA 5LEJA 3O4NA 2IVNA 3U1KA 2RKHA 1JJ6C 4IG0A 2L2OA 1L5UA 2IXSA 4NBQA 1TZLA 3OYEA 4ITVA 1JL2A 3KETA 1CXQA 4V19S 4CYCB 1T3VA 3E1YA 4M42A 3BG3A 2OV7A 2FBKA 3AA2A 3H92A 5ICCA 5AQIA 5BRFA 3QWLA 2NNWA 3I5UA 1BM9A 2HZTA 4ETSA 2AO9A 3P9KA 3MQ0A 5LGNA 5JI6A 1ZHFA 1VQ8N 2A1SA 1SD4A 5LHIA 1SKWA 3K9TA 4MFBA 2VC0A 2VT3A 3BG6A 3L6QA 3W2AA 4BRKA 5AQFA 4PJ0C 1Z7LA 2XF5A 5LJWA 3QNOA 3FWEA 4L0ZB 2NVTJ 4DF8A 1S7OA 3T1HK 4B4CA 3T3FA 3BR3A 4XRSG 3S14J 2QBYA 4IL6C 1ZXOA 2XPUA 5LD2C 4H4KC 2HHVA 3EKSA 2HEOA 5HNHA 3E6MA 4J00A 1Z6RA 5KPZA 1WFXA 1WI3A 3AA3A 1S9EA 4MQ3A 5HRNA 1SS6A 4RGSA 3CC7I 4XN0A 1LE8B 3CHWA 5C3EJ 4HV6A 4JYAK 2B6AA 2ESHA 1RILA 3VEXA 2M5WA 1GDTA 1GLBG 3ONQA 2K86A 5E3OA 2I8DA 4K0KK 3ZT3A 2R92J 4IOAL 5CVJA 4HVJA 1ETKA 1D0ZA 1YHQN 2OTJI 3MKYB 1X9SA 4IFVA 4KUMA 3GTGJ 3EEQA 1RTDA 1K78B 3HRTA 4A2BA 1RT3A 3SDGA 2AJQA 2BTFA 2G9WA 4NLBA 3SAGA 2VQEK 3HOWJ 4NCGA 1WQ2A 3E5UA 4DTRA 3VQBA 3HC7A 5HROA 4P96A 4NYNA 2LKXA 3J7AY 4KT5C 1AU7A 1TC3C 2VKEA 3WTYC 2HZDA 1OR7C 4CJWA 2E35A 2LR8A 2QWNA 3ATUA 1SL1A 2QQ9A 2LMDA 1NK9A 5J2MA 3ASOH 2K7LA 2VWBA 3NE6A 2XAGA 3FXUA 2OYQA 2WBNA 4A6DA 2VOPA 2RF2A 3LPUA 5JLXA 4CGGA 2AS5F 1IF1A 3JS6A 1MMNA 2B0LA 3OV8A 1T6CA 3HRMA 4MFEA 2BEOA 3J80Z 3S32A 3TO7A 1APLC 4BL0B 1ZGJA 4ZTFA 1XSXA 3T0YA 3SI6A 3AAPA 1G3TA 2ACJA 4CHPA 4KRFA 5H1SQ 3HXMA 3BQZA 4OIQF 5SZTA 2HWVA 4LJZF 1VQKN 1L3VA 1KQ0A 1EO1A 3V7RA 1B9NA 3U8XA 1KAZA 3K58A 3E1SA 2PN6A 1QHTA 4CDGA 4HCCA 2FBXA 2NXNB 3K1MA 1N77A 2XY5A 4DU4A 4E6KG 1MBEA 4CJTA 1ZBLA 1W7PB 4KBOA 4BR4A 2H1KA 4J2DA 3PV8A 4AM3A 1LFUP 3CUQB 3HBTA 1D1AA 1U49A 4PDKA 4JI3K 5K5RA 2P9PA 2K9SA 4KI4A 2O8DA 3H46O 4CFBA 2Y48A 4E3SA 3F6OA 5CYQA 3KYDB 3LL3A 3BLYA 2WA0A 1Z21A 2JA2A 3FHNA 2X4HA 3V9SA 3C6TA 5ERIA 1U45A 2F5VA 2HHTA 1YTYA 4K2EA 5FPMA 3M1CA 3C7NA 2ZJQF 3I58A 1RBTA 2XDVA 1LDKB 4H0YB 2XY8A 1BI3A 5DD8A 4UB6C 1XB4A 3GBGA 3CCYA 5FJ8J 2C6YA 3C94A 3G4SN 3O4QA 2XPWA 4L0YB 1GXPA 3CMEI 5DUKA 1ZH5A 2CH6A 4CICA 3L9FA 3FF5A 1OJLA 1E17A 4CI6A 3DLGA 3LZJA 1VAZA 1Z3YA 1TUYA 1BJAA 4Y3OA 1TP4A 4DBRA 3ID8A 4E0DA 1FWZA 5F04A 1R1UA 4JAXA 2DTUA 3ZSQA 2R0QC 4XLCA 4DGWB 5EEHA 3ZSXA 4RB0A 3KK7A 5H6QA 5HOOA 4JHDB 5J1EA 4CJRA 3SK3A 5B3SH 2IRFG 1I27A 1WRJA 2VBYA 1WSIA 1FT9A 2MH9A 2W57A 4BRQA 3RKQA 1XMXA 4GMJB 5FD5A 1RI7A 4D7MA 2NS0A 4DSFA 3W3DA 1LB2A 2NUBA 4CHZA 1FJGK 3HZJA 1T03A 2VJ4A 4XK4A 2QKBA 3HO1A 5ADXA 4DR7K 3FXKA 5J1YA 3IAYA 5F1JA 1U9NA 3KTQA 4JKGB 3HIFA 3DXMA 3CD6N 3H36A 4PK4A 4YOUA 1TWHJ 1YT3A 1Q9XA 1HKSA 1TKDA 4LSNA 3HTUA 2W82A 3S2WA 3SZGA 1YFHA 3ZSZA 3LWLA 1C0WA 4W97A 1YW7A 4H0PA 4A3LJ 4M9ZA 3E6BA 1QVGM 3KPHA 1XDSA 5C2DA 2VKVA 2ZJRL 4DV6K 3Q3SA 4HSTA 4LD5A 3RTVA 4JKBA 1YYVA 5LL6Z 4BC2A 5AQMA 3DWLE 2IS1A 4W5RA 3VF4A 3TQNA 4K43A 5EZGA 4NUBA 3J80K 3CCSI 1BCOA 3K0LA 5FFXA 1ETOA 3DJCA 1V4TA 5AQKA 3QPTA 5HS8A 4JKDA 2LBFB 2DDBA 1ZYRF 1EWRA 3KLNA 4R8HA 3O9QA 2KISA 3AVIA 1G3WA 4QTRA 4GYGA 1O3SA 1G6NA 3SYTA 4KHSA 5L3BA 4H5RA 3U3GA 3PO4A 3WGIA 3CJTB 3FX3A 1JCGA 4B8CA 3I56N 4YDUC 1OPCA 2V7ZA 2HPMA 3ZX0A 2O6GE 3HJEA 5BOXA 1W0HA 1B6AA 1IZ1A 2ITMA 4NYFA 1BA5A 3CMAI 1WKMA 4E7LA 5M3MJ 1P8ZA 1VF9A 2EFNA 1IAWA 4IDKA 2O8FB 2EZHA 3I55I 4I9QA 2M1BA 2NYXA 4E1NA 3F72A 5HDGA 4JRQA 3CMYA 4MIMA 4Z4EA 3G0ZA 2VG6A 3CXCM 3OYLA 4EVIA 3W6JB 3TOAA 3OSGA 2YNIA 2DK8A 2TRTA 3AO2A 3MWTA 3HOXJ 2JA5J 3BQYA 3LP3A 5GAGP 2EK5A 2MFZA 3J80O 3E3VA 4ILGB 3J7ZO 4PA1A 2HVQA 5JHFA 1XNQK 3AVMA 1O57A 3V9XA 3VOEA 3LMMA 4FASD 4OPJA 4CJFA 2HXIA 2A61A 1P92A 4LY7A 2MC3A 3ZETA 4DU3A 5JVHL 2JPCA 1VI0A 4JKHA 1IKVA 4FLZA 5E20A 2BY1A 3QOEA 3F9KA 1DKGD 3L7WA 1SZ2A 2O5RA 2OZ6A 2V1XA 2OAZA 4XRSA 3TAQA 1RGIA 3E9PA 4L18B 3LDQA 3K5NA 5EXWA 1XMKA 2HOTA 4NCAA 2HXOA 3AG1H 4OO1J 5JICA 4P55A 4DR5K 4FM1A 2NRHA 2QWPA 1WAFA 3VPRA 5C25A 2HQNA 2KJCA 3EY1A 3QFPA 3LDNA 3DTKA 3K4MA 4W5QA 3PNYA 1SANA 1NWKA 1X1PA 4KMUX 1T7PA 2OANA 2JZYA 1K7AA 4IEEA 3QIOA 2BXYA 2W1OA 2UZKA 2KIMA 4UVBA 4QIWN 2RNGA 2K27A 1IV0A 3K2PA 4PSXA 4HUEA 1VQON 4Z0UA 4E7KA 4JI2K 2VT2A 4Y1CA 4A3KJ 4BY1J 3PIPL 5L3DA 1FW6A 2YU9J 1SAZA 3TSQA 2W24A 4BGAA 3A5OC 2CV1A 2ZF5O 4I7FA 4RW4A 5IOZA 3SZPA 4L9JA 3UIQA 1YI2N 3PFYA 2XO7A 2QSGX 1J53A 4ILJA 4A61A 1QQMA 4WX9A 5KPTA 1MNEA 3KKSA 2HBJA 4Q48A 2HSTA 1XHXA 2VG7A 4LC9B 4XN3A 2EH3A 3MWPA 5CLSA 4XQFA 1KD1O 3GZNB 1S8NA 1NK8A 4PHTX 4GRIA 4E7ZA 4S05A 2GELA 1NGGA 4BR5A 3HZ6A 1YVUA 2HI3A 1Y0UA 1BC7C 4BBRJ 3ZT1A 3AARA 3VTHA 5B1AH 4MO5A 2R7UA 3CO7C 2VONA 3D1NI 3L4QA 3AG2H 1B9DA 2GX9A 4RLQA 4G7HF 4DF4A 5K5QA 1J9AA 2PMZN 3WG7H 2DCEA 3IUCA 2I10A 1Q18A 3HP9A 2F4MB 3ITHA 3WTSC 3MZ8A 4W5NA 1TVRA 3PFIA 4KIGA 1WHUA 4WE1A 4L9TA 2D1VA 2PX9A 4M45A 1WJDA 1TWAJ 4C2MJ 2AQEA 1ZGWA 1IKXA 2RGVA 2VASA 4DB3A 1KFDA 2DFEA 3V81A 3VSLA 3U9ZA 1G3YA 1ZARA 4CUGA 5E8IA 1ODDA 4CF1A 4I0BA 4X65K 3MK6A 3BTLA 3UKRA 4HAMA 1J5OA 2CUFA 4DJAA 3OS1A 2XRIA 2D5VA 4BGDA 3WUHA 3CF2A 2KQRA 5AZIA 2R5ZA 3TO9A 5M5WJ 4B9UA 2DA4A 4KHNA 1GLDG 1P7IA 3MN5A 4M6YA 4QAGA 2L9RA 2B5JA 1T6SA 1ZREA 2DODA 3JRHA 5J2PA 1T0FA 3NAEA 3TW7A 3O8GA 2WOMA 1E3PA 3OYNA 4AF1A 1BGXT 4C8MA 2YPRA 4CJEA 2IAIA 2QBYB 1MDUB 3A0IX 4HTUA 5KTQA 3KE2A 1A6QA 3OY9A 2HGCA 4WQ5A 4RM3A 4WWCA 2AHQA 4XEIA 5GAEJ 1M1EB 2RREA 1IG9A 1JCEA 3UE5A 4XLFA 3TABA 1FOKA 2ZJPL 1R5GA 4IXAA 1TYQA 1J6ZA 3SEQA 4CERA 3IH3A 1UG2A 2ZFWA 4YFKF 1ITYA 3CCEI 2R3SA 1IRXA 3P9CA 1XG1A 3DP7A 2JMWA 3DEWA 1C1BA 3OJSA 2QQBA 2L54A 4LLGF 2G8KA 3DEEA 2ZNYA 3BF3A 3LP0A 3O80A 1QHAA 2XGCA 2NRXA 1RBUA 3WU1B 3VYTB 3ZX2A 1NGDA 3DLRA 1SKRA 4AIDA 2IP2A 3OIQA 1ENHA 1F9NA 2RNJA 4S04A 4FISA 3LFKA 1R1VA 3NDKA 4AU7A 4AHSA 1A35A 2VJIA 3ASNH 2JUGA 2B9SA 1I6HJ 1D4XA 3WU2C 4CEDA 3HOVJ 1TK8A 2O8CA 3F8CA 1ZRDA 2Y9YA 3DF8A 4AVPA 2K02A 4FLYA 4DTOA 4CCOA 1Y8QB 2E4LA 3G10A 1LEAA 5BRHA 1SD7A 1TL3A 3S17J 1RT7A 1C0GA 1YJ9I 1C0TA 2K3PA 1YJNI 2IS2A 1XPXA 1HBXG 1BOBA 3CCLI 1GHCA 4JI4K 4OIRF 4DFKA 3F8BA 4CZGA 1BOTO 1DPUA 3AVBA 1JKPC 4DU1A 2L7FP 2FSWA 1QO0D 1YQAA 1ZK8A 4KV8A 2CQKA 1OCCH 3V1OA 1RBVA 1OYIA 4YG2F 2R7FA 1RKTA 2E5ZA 4BR9A 5K5OA 4G9ZA 2VLAA 4BJ6C 1TV6A 2A5XA 4IRHA 3WGGA 3LAMA 4QS9A 1DLOA 3L8BA 4BR2A 2P9PB 3ZMZA 2O8DB 1DGKN 1T98A 3KD1E 4CCMA 4YY3K 3OR2C 1Y1VJ 2V7YA 4I2PA 1TK5A 1SFKA 1QQNA 2G7UA 4EJOA 2P4WA 3PO3J 3K4JA 4FTHA 4R5PA 3M8SA 3BCAA 3C7NB 5C2FA 1H89C 4CEAA 3ASMA 3VB2A 5AIPA 5ICGA 3FZVA 4IOCF 2DLLA 2OPSA 2HHHK 3Q0VA 1MU2A 1MSEC 4GCVA 4LSLA 4M72A 2H94A 3A02A 1K8KB 3TAPA 1NLVA 3MDQA 4FOEA 2OA8A 1RUNA 1JLQA 1WSJA 3NARA 1ETXA 4E7JA 4B44A 3V1RA 2O9LA 3JRFA 3KZIC 1IG8A 2W6KA 1ZTRA 4XKVA 4IFYA 3OJUA 3LA7A 1KU3A 1ETYA 3DBLB 2B7EA 1CF7B 2M0MA 4D5CA 3A2FA 2OQRA 2L5QA 3CC4N 1P4XA 2P6SA 3CC2I 4ZYDA 3C7JA 5FKNA 2IOCA 3ABLH 4YOXA 3BY6A 1NJYA 3S2HJ 2LVSA 5DYMA 4N47A 5AQVA 4KHYA 1RT5A 4N41A 4EAHD 2RE2A 5KAIC 4FT8A 4FW2A 1U5TA 4GFBA 3SV3A 3WE3A 2HHXA 3O3GA 2AA4A 1EXQA 4DG1A 2O4GA 4X64K 2IIRA 3ERED 3T1YK 4EEFG 2XKOA 3ZX3A 3SUNA 5J2QA 2DA2A 1RUOA 1XGSA 3WE2A 4ICLA 3PLAA 5E84A 4G8XA 1KQ8A 3LDLA 1MH4A 1R49A 1C0FA 4BC4A 2HS5A 2ELJA 5CY4A 3JYTA 4EV0A 2HMIA 3SQ1A 3SAHA 5HLFA 4HOBA 1TNSA 2KRFA 3SDBA 2DOEA 4O3MA 4N0BA 3VQCA 2K4BA 5EY4A 1BBYA 2D45A 1DPRA 5AQRA 2E2QA 4PZJA 2BVLA 2F7TA 3R9PA 3NWTA 1MWKA 5M1KA 5E41A 3DI6A 3LSRA 3WGHA 1FBUA 2IAJA 2RKIA 5J1UA 3HKZA 5E1ZB 3BG9A 1X9WA 3LSMA 4CD3A 5FLMJ 2MSYA 1LCUA 3Q9SA 2ZO4A 5EYRA 3T19A 3UKGA 1HNXK 2WY8Q 2EIKH 2BYVE 2ETHA 4BY9C 5EEAA 5EG0A 5DTDA 1Y39A 2QUFA 2XPVA 3ECOA 3FM3A 1Z25A 1VQ4N 1BHLA 3J8AA 3LNQA 3LDOA 4II3A 3MN7A 1D8JA 1VSFA 3AKZA 4UHTA 4J2EA 2A3SA 3IAS2 3P1GA 3CESA 1K9MO 2I5JA 4HTLA 2UV1A 5KI6A 4MO7A 2BXZA 2R5YA 1J75A 2A1RA 3C6UA 1IGNA 3EZ5A 4IRGA 2R7WA 5DCMA 3KLGA 3DTEA 1SFOJ 4R1HA 1OISA 1YJWI 5KGWA 4CE9A 1VQ9N 3O1BA 1HXDA 3BJ6A 2Q1NA 2A07F 1QQCA 5GAHJ 3NAUA 5KCMA 2FQ4A 3FHZA 3MN9A 2VN2A 2XKPA 1NKBA 5K1YA 4V2FA 1WWXA 2R7DA 4OX9K 3C65A 1WSGA 1T6DA 3R3LA 1WLJA 3TI0A 3FK7A 4HDUA 1RCHA 1FMVA 2D0BA 4BQQA 3OL4A 4DSLA 3ZQ7A 1UJ8A 1HPZA 4OIPF 3WT0A 4CJUA 4G7ZF 2DOFA 1S22A 3ZETB 3THYA 4RW7A 4LITA 2XUBA 3O9RA 4FK4A 1QRYA 2NVXJ 3OSFA 1IKYA 2M45A 1FOXA 3B6OA 3J7AO 1Z67A 2NVYJ 4FJJA 4BYYA 4FPAA 1QU3A 5EOYA 1NJXA 1NM1A 3WG9A 3O8MA 5C24A 2WC9A 3CUOA 3LM9A 3E6CC 2NAZA 4BRDA 4KH4A 1QSLA 1D8YA 3KLOA 2X6XA 4PJNA 3VEZA 4DTUA 1YIJN 1B72A 2Z1GA 2OCCH 3BJOA 4BRMA 2EA2A 1RBSA 2QGUA 2A3ZA 2L0KA 3KP5A 4J2AA 3I9V2 1Y1WJ 5LMNK 4A3IJ 3MX5A 2QW9A 1QVUA 3K2ZA 5HP1A 3WNHA 4CJ3A 3CPEA 3CYMA 1IRZA 2ELHA 3FKIJ 4HF0A 2WWYA 3M3YJ 2VKHA 3F23A 2NRRA 3GVAA 4XIUA 1FSEA 3CJ9A 1JLBA 4JS4A 3D0PA 1ZN2A 2DFHA 2G8HA 3C2GA 1WUAA 1HSJA 4M71A 3AAFA 4LG3A 1VQLN 5C44J 1BR4A 4CHYA 4XH5A 4KI6A 1NK0A 3AVFA 4DTSA 3LZIA 3ZQIA 2Q97A 3CMMA 1ULYA 1BIZA 5DM6F 2Y1JA 3T7ZA 3ML6A 5C15A 5LJVA 3R1XA 1MBKA 1X9MA 1CXUA 2Y0SN 1MKMA 1WCMJ 1JGGA 1DDNA 1Y8RB 3M8RA 1BL0A 3W2VA 5IT9Z 4WQ4A 4H0VB 2ID3A 3B6AA 4MLEA 3GTJJ 2K40A 4FL9A 5CPRB 1RDDA 2W25A 4WCGA 3S16J 1S7EA 2F9WA 1GT0C 1GLJO 5H6RA 1YUWA 1X3WB 2XB0X 2L7MP 5FRNA 3G2BA 4C1NK 2ID6A 5D4RA 3UB5A 3NMUA 1V5FA 3H45C 2FBVA 1XDUA 1NJWA 3M8JA 2DA1A 3EO3A 4B3OA 2L01A 4IPAA 2O7OA 5FKKA 1R36A 2V4JC 1EA3A 2PEXA 3EETA 4BWMA 1DGWY 1B8IA 4K8XA 3CM5A 3M07A 1S7AA 1U04A 2OTLI 3W6KB 3PQJA 3CCQI 4ELVA 2CU7A 3DU6A 2KHMA 3JSMA 1OH8A 2EFQA 2Q0OA 3ULEA 4B8AB 5K7ZA 1I5ZA 1ORKA 4IHTA 4KTWA 1R0AA 3C2HA 5CR4A 1HUXA 2VUMJ 1J54A 2YNGA 2ZXIA 3OBWA 1HC8A 1KLNA 3V9ZA 1AA7A 2ZXWH 2E2OA 4JYKA 4CEZA 3HL2A 2A6HF 1R59O 4ENKA 1Z26A 3VQ9A 1WSEA 2EV0A 2NVQJ 3EYZA 4KTZA 3EUHC 2QKLB 1BI0A 4FYDA 3UKRB 1LWFA 4HNTA 4M9XA 2FXUA 2ATQA 4U7BA 3S1QJ 1RRJA 3DLEA 3PY8A 4O5BA 5HS9A 1QA6A 3KHYA 3N4PA 1OMIA 1T95A 3GFMA 1S5JA 2EB7A 3CFRA 4PUOA 1KYZA 1K4SA 5AQZA 1TQIA 1ASVA 3J81Z 1TL1A 1ZKGA 4XRMA 4FWPA 5DDGA 5HL7L 2M0CA 3E66A 3REOA 5TISC 1TYQB 4O8KA 4RW8A 1JUSA 4DR6K 4DTJA 4WFBL 3G71N 1Z9CA 1LW2A 1XSVA 1IXRC 2HHSA 5B1BH 2X85A 4ZTJA 3CCRN 4MDBA 1V55H 1MBHA 2WBMA 4DQRA 4IJAA 3IUOA 3IRQA 3JTGA 4EJTA 4U87A 1MMGA 5GADJ 1T33A 4AHRA 3DXJF 1Q9YA 3ZGKA 3CCUI 5TKYA 3HKZN 4XLEA 3DOLA 4DW6A 4DQIA 3RTRA 3B6PA 1WPKA 4UUVA 2V6EA 4C8NA 3TAFA 3L3UA 5FPNA 3QIPA 2IA1A 3HUGA 2Z9OA 4I01A 1TT0A 4CO8A 1BR1A 4IXCA 1N32K 3SPYA 3EE9A 5IT9K 4EZ6A 4DFJA 2E6MA 3SPZA 2IC3A 3M5RA 4BEHA 4I98B 1Y56A 3K1NA 3NF8A 2AP1A 3BP8A 2KZVA 3QO9A 4FZYA 4FE4A 2O8CB 2NRTA 1U8RA 5J6XA 2CW8A 4N4NB 1KA8A 2A40A 1NOZA 3PNTA 2KIFA 4DSIA 3A01A 4CCNA 3SCXA 1VQ6I 4B9TA 3MEXA 4JKFA 4BE2A 1A5JA 4CGHA 2R7VA 3VOVA 2HF3A 4C2UA 1KAYA 3RMDA 4RG8A 2DPUA 3CG7A 1D8KA 2PBIA 2A69F 4GV6A 3J7ZI 3IDHA 4JP0A 1FTTA 1D1BA 1KQ9A 1BJZA 3EUKL 3SBGA 2E88A 1YIOA 1TW2A 4Y52J 3CM6A 4M3ZA 2F8TA 3DU5A 4JOMA 3LOCA 1FEXA 2X6OA 5LGTA 4OMYA 4BGBA 4TV7A 4LF9K 1B92A 3WQTA 4FJ5A 1DUXC 5AQWA 4CIGA 1VSLA 5D6EA 4H5NA 2VQGA 1Q86O 1LW0A 2LY9A 1UHMA 2JQ7A 5AZJA 1TBXA 3K70C 2ECCA 3GDQA 2EFPA 5IT9O 2XY7A 4KIFA 3HYFA 1V4RA 1XC3A 2YNFA 4FLXA 1TWFJ 4FK0A 4LF7K 3AVJA 4A0XA 2Y75A 2E7XA 3IWFA 1XMAA 2HR3A 1JUMA 2X6YA 1SL0A 5FD6A 3TP0A 1VRUA 4CF8A 5B66C 3HL8A 3HM9A 2YHWA 1WH7A 2R7SA 3LALA 3TU5A 3LSIA 3CP8A 1WJCA 3W3CA 3QPSA 3DLAA 1QPIA 1NGJA 3ZN1A 3KEQA 3FXLA 4DQPA 2CUJA 4KREA 2HFHA 3DYAA 4NDLA 1VHXA 2Q2EB 1NK7A 3J81K 3I4MJ 2HQRA 4D9JA 4ZJZA 1S1VA 3AFHA 5AJ3K 3H5AA 3BUZB 2F4VK 1OVQA 4KA4A 2RN2A 3PO2J 1BQMA 3TP3A 2WY7Q 4ABZA 2P6TA 2FOKA 1Z7UA 2WFBA 2HTJA 2BE5F 4G9YA 3FZLA 1T05A 4GXOA 1W1WE 5F2RA 4BS9A 2CQXA 4BUPA 2VPRA 3I53A 4M3UA 2IS4A 3G6EN 1MMAA 3GMEA 3CJAA 4DTPA 4BRPA 3H35A 2NS7A 3O9UA 4DFMA 4PFOA 2LOOA 2QQAA 2ZD1A 5FPEA 3SFZA 1W5SA 2A05A 3L2QA 1FKPA 2ADUA 2MABA 1HLUA 2G7HA 5I3UA 3QYEA 2IS6A 1REPC 4FZZA 4IHYA 2P81A 4ZZLA 3WTZA 4YIRX 2IVMA 4DSEA 2YX4A 4LFCK 1NKEA 1JHFA 1HW2A 1JUPA 3RJPA 1JXBA 1BIBA 2NNNA 4DQ2A 1KONA 4EGYA 4HHTA 2QI2A 2CUEA 2QZ8A 3J81O 1VSEA 4AVZA 3HPOA 3QNNA 1A36A 3RKYA 3V8JA 2IVOA 1SVLA 2R7OA 1X4PA 2EWNA 4FWRA 5AQQA 4FWSA 1EX4A 2QENA 4MHGA 1TUUA 1EH8A 4IOCL 1M90O 3TOBA 1S6QA 1S3JA 3SFIA 3GO5A 3QYBA 1KVBA 2O3FA 1J7KA 4N9IA 5CYVA 2DJIA 1SV5A 2BE2A 3KLIA 2VJJA 2QLZA 3RPUD 4BXXJ 2XAUA 4YEJA 5AQPA 1UB9A 5EG0B 1FZPB 1WSHA 4RCHA 1YX3A 2W42A 2ZCWA 4PQUA 1FBSA 2XASA 2Z1DA 4MGRA 2KKOA 1XX5A 4LOCA 2FUG2 2Z5UA 4IWVA 3VYUB 4FLWA 5LFAA 3DQVC 3F3XA 1WOQA 2R5YB 1OH5A 1ZG3A 1UCRA 3TAEA 2RV8A 2HNYA 1RFQA 3BZ6A 2F4OB 3K5LA 4XLNF 1BI4A 2VQHA 4MLOA 2VGMA 3BC8A 3MEEA 5HBMA 3WXMB 3U3YA 3AAQA 1Y0NA 3L4IA 2GEMA 2AXLA 5GP9A 5LY3A 4JKEA 5L3GA 2Z3YA 1MW7A 1DT9A 1R5ID 1AOYA 2X9DA 1VQ8I 1AHDP 2DOAA 1R00A 5CQGA 1O1WA 3M8FA 3OOUA 4ENNA 1TNTA 2H8RA 4LG0A 2G8VA 5FLXO 1OR7A 4M3EA 2QWQA 2XGXA 1L3LA 4K42A 3N4MA 4GVEA 1FKOA 2HHQA 1LEBA 2O03A 3ESWB 4KMFA 3K69A 4CJ4A 3IP4B 4LB5A 2ZSHB 3I4NJ 1ZRFA 1IN6A 3RSEB 4N4OB 3V8KA 3L2WA 5BPNA 3LSTA 2GWRA 2H8WA 2EQRA 3NWSA 1I39A 1ZELA 1FYMA 3KP3A 4NNJA 5TRDA 3RPUA 3KLHA 1FP1D 3LWMA 2IBDA 2PQ8A 1B72B 1YHQI 4F3OA 1B1BA 5D5WB 1JKQC 5TKWA 4FWQA 3PUFA 1MZBA 1NU0A 3IL2A 2VE9A 3PUBA 2P0WA 1O4XA 3ZP5A 4KIBA 4FJNA 3ZEUB 2HU9A 3RKXA 2LP0A 3T8TA 5HLHA 3GTKJ 3TARA 4BQZA 1D5VA 1J5EK 2A5WA 4KT6A 3O9SA 2GUIA 5C42A 3BPXA 3VQ7A 1GOAA 3D2EA 1KC8O 1YW8A 2GV9A 3I3LA 1YS6A 2IGKA 3TANA 1DU0A 2R7ZJ 3BF1A 5AQXA 4M3WA 4N9HA 3DBRB 2OCEA 4A3FJ 4B9NA 2JA7J 2ZC2A 1I50J 1F4KA 4B1WB 5J4VA 2WTUA 3PO5A 5IPAA 2COBA 1ZBFA 4QLCU 2UU9K 5GAEP 4CZJA 4LH4A 4K8ZA 2F48A 1JLFA 3C6AA 3JRIA 1R6RA 4KICA 3VSKA 4DLGA 3LQQA 2W00A 4O5VA 1VQKI 1VSIA 5JLWA 2WV0A 4BR7A 1V3FA 5DUIA 4U88A 4H5TA 2NRVA 2M30A 1KVAA 3K2AA 3EYYA 4NCBA 5F1XA 4M3DA 3HI0A 4CJ7A 1WAJA 2CMPA 3HRSA 6PAXA 1HLVA 2E20A 4D7NA 3K4KA 3D6RA 2P5KA 3KFWX 2DY4A 1B8IB 1NG9A 4KDPA 1XNRK 2LKPA 5J4YA 1EP4A 4QOZB 3L09A 3A1YA 3WU0A 3CF5F 3AVGA 2HDCA 4MEYF 3VQAA 4Y33A 1DGRM 1JKOC 2QWRA 2OUMA 4H0OA 1T38A 5F0XA 1OCRH 3MZYA 3G4SI 1BR2A 1SFXA 2PJRA 2KJBA 3FBNB 4BRFA 2CV0A 2Q0UA 1TQPA 1HQEA 4MTDA 1XC9A 1NK2P 5D5VB 1MNDA 1BISA 4ASNA 4DV4K 3HB9A 1KLMA 4XKBA 1RTIA 3QERA 2XHBA 2XIGA 4Z94A 3HXLA 1YW9A 5CVRA 4FJGA 2XV4S 3CJBA 4B1RA 5E3MA 4LLLA 3QQAA 3GYHX 3K4NA 2YU3A 5BPMA 5DM6L 2H3GX 4ESJA 4IKFA 4GKKK 1KYWA 5FRMA 2JWTA 2LYCA 4FLTA 2A42A 2L7KA 3JR9A 4AM7A 4J8FA 3OYKA 4BAYA 3DXKA 3ZOBA 2FNPA 2P7VB 3FXOA 1EV7A 2F5DA 4II2A 4CZZA 4QPOA 2PZSA 3ECHA 4YDUA 4B1XB 1VTNC 3UKUB 4HDVA 3CD6I 1LAVA 4LGWA 2LFBA 2ZKZA 2E5LK 2KL4A 2PY5A 1XD7A 3IRXA 4CJPA 2DJNA 2ITGA 1RDAA 2IW5A 3MWMA 2BOLA 3CQYA 4OJRA 5HNFA 3THXA 1QQIA 3DAWA 4DV5K 2CW7A 1YRNA 4P5OA 1X1DA 4I9LA 4IOXA 4BQOA 2P9KA 1XHZA 1VSJA 5C12A 4B48A 3GZ6A 3E7LA 2KLAA 2QKMB 4HF2A 1GLFO 2YHBA 5IP7J 3FZKA 2V51B 2WUSA 3ZR8X 5LGUA 4H5VA 4C2TA 4EGZA 3CLOA 2JK3A 3K5OA 1MBFA 3IKMA 1ETVA 3H9GA 4OAYA 3GG4A 1HKTA 3A5NC 5DV5A 4CF2A 5CHIA 5JMVA 3UNGC 3K10A 3GW2A 3S3OA 2Z1IA 4DZJA 1P4AA 1W4MA 3S3NA 4YNQA 4WF9L 4EJVA 5BN9A 2E7WA 4EM2A 2VL8A 3GLLA 1LFBA 2CS3A 2E1CA 4I6MA 3AY9A 4KPYA 4BC5A 4RS8A 1HNWK 4JKCA 2WAEA 1XUPO 3I56I 5D6FA 4EFHA 3ZLJA 4JI6K 3A01B 1O7LA 3OOPA 4FPBA 3SQ2A 3HBLA 1MIJA 4F55A 3F73A 5LLQA 4ESFA 5IP9J 5F6FA 1R22A 4DUZK 3A0BC 3FK6A 2ZQBA 3D45A 4LMYA 2X51A 2EV5A 2AXTC 4A5MA 1DTTA 3BR6A 3MZHA 2IGOA 4ZYHA 3BJAA 3M1FA 1U9OA 5D8KB 3F8FA 3TBIA 2M3AA 3V42A 4BREA 1ZC6A 2R7QA 3B8AX 4LF6K 5GAGJ 1J2XA 2V26A 2B63J 4OKEA 1B9MA 2IPQX 2QA4I 4Z4IA 4IJNA 3ATVA 1ON2A 4AIHA 3NF6A 1FP2A 4CZKA 3THWA 3M7GA 5AZJB 4JQFA 5CE3A 1WN7A 3NHGA 4PUSA 2L9VA 2WONA 4BQAA 1GLAG 2OC6A 3R6MA 2DXIA 3ERMA 3HOUJ 1O13A 2ECBA 3HM5A 1SVOA 1KU7A 1QNTA 1GVJA 2EV6A 2ISYA 2EZIA 3HTVA 4DS4A 4I99C 3TKYA 5FPDA 1H1VA 3OYJA 2E19A 2STWA 4DYQA 4DLEA 4WF2A 4FJLA 2J5OA 2FQ3A 1VQ7N 1DP3A 5HODA 3NH2A 2D5RA 1RT2A 4Y1DA 1T56A 1WJAA 2LD5A 2GXAA 4Z4FA 1W97L 1X58A 2YHAA 5IT3A 3QINA 1S72N 4ZYGA 2ZMEC 3H1CA 2X1EA 3CO6C 3WNGA 3ABMH 1KSPA 4RB3C 4C8OA 4CYCA 1GV2A 3JXUA 4P1WA 2QK9A 5ICEA 3P38A 4PGHA 3OTOK 1XSDA 4B3SK 4DQQA 2AQFA 1BCMA 4YFXF 2QEXN 2DDAA 4RGUA 5DM7F 1RT4A 3V9WA 2PLYA 1UZCA 4RMNA 4KNYA 3K59A 2CGPA 3GZ5A 3LP2A 3SMSA 4DV2K 1ILYA 3H9QA 2O8XA 3FM5A 1CZ9A 1X3UA 2HQAA 5IYBJ 2W7NA 1RTHA 1BIAA 2G8IA 3PJRA 2L9NA 4LFUA 3AG3H 4B9VA 4L9NA 1VQ5N 5ILSA 1NKCA 1VQOI 2E1YA 3C6HA 1TW3A 4AHUA 3NH1A 4CIEA 1WB9A 3JRCA 1IBKK 3BR5A 1WSFA 2A68F 4MNUA 3OYHA 2QQ8A 2BZTA 4IHWA 2GZWA 2E1ZA 4ZDOA 3D5SC 4BU2A 3NGIA 2V9VA 2QF7A 1YI2I 1LE8A 5JLFA 1OKJA 1IH7A 4DNCA 1W7PD 4GKJK 5CVIA 2Q8KA 4BH9A 4NXMK 4OKJA 4BC3A 4C9YA 4O44A 4CZMA 3ZN0A 4CSWA 2DMQA 2QWMA 2FBHA 4HQMA 4JX5A 1A5VA 2DFFA 5LRSA 2QSHX 2XAJA 4LIUA 4GVMA 2XRNA 1QQOA 1HYZA 1HQCA 2YS9A 4QS7A 4PY5A 2QXLA 3P9IA 2BHZA 1OH7A 2M2EA 5KNLA 3O4WA 3KZBA 1LQ1A 2OPRA 3BEXA 2O8EB 4BRGA 4CCHA 3HHGA 3GX4X 1EJ9A 3A2KA 4O8UA 5JFRA 2RDPA 2KIQA 4GGGA 2A6TA 3OYGA 5D4SA 3K7AJ 4YFNF 1V5EA 3K57A 3SLCA 3AVKA 3CJQB 5L3CA 4BRIA 2VXZA 5FGMA 5AQTA 1D9FA 4CHUA 3FZFA 3ZMDA 1ZG5A 1UWBA 4M6XA 3KP2A 3LANA 2XVCA 1I1SA 4C1NI 2L9SA 5ILUA 2P8TA 2GA2A 2E2PA 3B02A
chains in the Genus database with same CATH topology
2X6XA 4PJNA 1C1CA 3SV4A 1BI4B 3V6DA 4DTUA 2Z1GA 3AL0C 4F8RA 4F3TA 2ZFUA 1RBSA 1UELB 3BG7A 2KFNA 4CIFA 1YX5A 4CGFA 4RW6A 3TMOA 4J2AA 3I9V2 3DRPA 1F21A 4CF9A 3TL4X 5HP1A 3WNHA 3K5MA 2Q3SA 3QEVA 4CJ3A 3O3HA 2LY2A 3PSIA 3CYMA 3DLKA 4RW9A 3ZCMA 2KZMA