3HPHA

Closed tetramer of visna virus integrase (residues 1-219) in complex with ledgf ibd
Total Genus 64
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
64
sequence length
210
structure length
194
Chain Sequence
b'NIPLAEEEHNKWHQDAVSLHLEFGIPRTAAEDIVQQCDVCIDHWQVDYTHYEDKIILVWVETNSGLIYAERVKGETGQEFRVQTMKWYAMFAPKSLQSDNGPAFVAESTQLLMKYLGIEHTTGIPWNPQSQALVERTHQTLKNTLEKLIPMFNAFESALAGTLITLNIKRKGGLGTSPMDIFIFNKEQQRIQQQ'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Integrase
publication title Structural basis for functional tetramerization of lentiviral integrase
pubmed doi rcsb
source organism Maedi visna virus
molecule tags Transferase
total genus 64
structure length 194
sequence length 210
chains with identical sequence B, C, D
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2009-06-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00665 rve Integrase core domain
A PF02022 Integrase_Zn Integrase Zinc binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.200 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Arc Repressor Mutant, subunit A 3hphA01
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 3hphA02
4OJRA 1ASVA 1WSGA 3NF7A 3AVHA 1KLMA 3AO3A 4I7FA 4CESA 4DSIA 1HJRA 3AVKA 3RMDA 4KAZA 4CEZA 1VRTA 1JLBA 1ITGA 1TKZA 3IS9A 3OS1A 1TK0A 2VG6A 4I2PA 3LANA 2FC0A 4CJKA 1CXQA 4BWMA 3SPZA 3SJJA 1T7PA 4FYDA 1IKYA 3SZ2A 1RT1A 3DRRA 4B9VA 3KK1A 4KHNA 1JKHA 5JS1A 1HPZA 3NBPA 3L2VA 4AHRA 3VA0A 3HL8A 4DSJA 3EY1A 3V9SA 4ELUA 4Z4IA 4PWDA 1FKOA 4KB0A 4FJHA 3HPHA 1ZBLA 3SUPA 1ZYQA 1KVCA 1TGOA 1S5JA 4FLZA 4CJRA 1RBSA 4M3RA 4CHYA 1DTQA 1JLAA 1IG9A 2G8FA 4FLTA 1U45A 3K2PA 4E1MA 3TAGA 4RG8A 4DS4A 3SQ2A 4KTZA 4Z4GA 3K59A 1WSFA 3M8RA 4CEEA 5JS2A 3CG7A 1BCOA 3T19A 4B3OA 2O4IA 4K8XA 4M41A 3V4IA 3NAEA 1NJZA 3ZSZA 3NGZA 3OYAA 1MU2A 3CM6A 4FK4A 1L3VA 3HPOA 1J53A 1BL3A 5J2QA 4AHUA 4C8NA 3QIPA 5CYMA 3QNNA 4EZ9A 3OYFA 4FM0A 2KFNA 4B9MA 1LW0A 3CFRA 3SPYA 2G8WA 1WJFA 4OGCA 5HRSA 3O4QA 2Z1GA 3CFPA 3S9HA 3AVBA 3KLGA 3C94A 2VG7A 1HMVA 3WNGA 1A5XA 3DM2A 4FZZA 3K5MA 2R7YA 4CJ3A 1CZ9A 4J2AA 3U3GA 2KZZA 1IH7A 1J5OA 3C6TA 4DQSA 4FK2A 4RW8A 3L2UA 3SUOA 3NH1A 3A2FA 3TABA 3AA5X 4B9UA 4FLYA 3IRXA 3L2QA 3P1GA 3O3HA 3QEIA 4DF8A 4EZ6A 3OYIA 3RRGA 3UIQA 4B9TA 4CJ5A 2IAJA 4KO0A 2OZSA 3IAYA 1KRPA 4I2QA 1HNVA 4RW7A 2G8VA 2DFEA 2QKBA 4KRFA 2Y1IA 3K5LA 3AA4A 3DRPA 3V9WA 1C0MA 2D0CA 2NUBA 1Q9XA 2AJQA 3DOLA 1VSIA 4OLAA 2HVHA 2OPRA 2Z1IA 3V9XA 3QEPA 4DTMA 5HLFA 4F4KA 4M3ZA 2EHGA 3KKRA 1NJWA 1QE1A 4MQ3A 4NCBA 1SL1A 4H4MA 3OY9A 3L2RA 4M3WA 1KCFA 4ZTJA 4Z4CA 1WNSA 3DOKA 1NK5A 4J2BA 1Q9YA 2A1SA 4FJJA 1C0TA 4FJMA 4FJNA 3VQ6A 2DTUA 1S1UA 4ID5A 4CHPA 2HHVA 1TAUA 1SKSA 3B6PA 1RBTA 3KIOA 3V6DA 2XY5A 1FK9A 1JL2A 3B6OA 2P5GA 4DFPA 4CGJA 1REVA 3ZT0A 4IG3A 4B9NA 3DMJA 3PO5A 5K14A 4ICLA 5FROA 4OLBA 4DTSA 3QESA 1T03A 3HO1A 4FJ9A 4ID1A 3DLHA 4CEAA 3QETA 5E41A 3QNOA 4BE0A 1NJXA 2RKIA 2B6AA 1Z25A 4JRQA 1SKRA 4F2SA 1HQUA 2W42A 3SYZA 3THVA 2D0AA 4FXDA 4E7JA 4LH5A 1BQNA 2BE2A 2ATQA 2GV9A 2OPPA 3HT3A 3PX6A 4W5OA 3TR8A 4CGDA 1S6PA 3FFIA 3OYLA 1F21A 3NDKA 1NK7A 1C0UA 4FJGA 2F8SA 1I3AA 4DSFA 3VA3A 4OKJA 1QS4A 3VQ5A 1NKEA 3LAKA 3I0RA 4IFYA 2G8HA 3KLIA 4ELVA 4Y1DA 4DTXA 3C95A 3C6UA 3DLGA 4N76A 2OA8A 2EX3A 1KLNA 4PY5A 2HW3A 3RRHA 3S3MA 1KFSA 3NCIA 4BDPA 3V81A 1DTTA 4RW6A 3F73A 2FBXA 2ZE2A 1KVAA 4DWIA 1WN7A 1S6QA 3SUQA 1A5VA 3S3OA 4KHYA 4MFBA 1ZBHA 2X6SA 1LWCA 3PX4A 2HVIA 3DLBA 4CFCA 3LAMA 1HYVA 3U3YA 1BHLA 2JLEA 3DLRA 4DS5A 1QSYA 3G10A 3LWLA 1RT2A 1W9HA 3AVGA 3ZT4A 2E4LA 4CFDA 4CIFA 3O3FA 4OKEA 4FJLA 1TL3A 5KTQA 4IG0A 2OPQA 3D0PA 4HUFA 1XHZA 1N5YA 2P51A 1EKEA 3VQQA 1A5WA 3VQAA 2P5OA 1LWEA 1TL1A 2XY8A 1LFPA 3AO5A 5CZ2A 4CJEA 1NOYA 4KI4A 1RT4A 1WAFA 3OYCA 1YVUA 1TKDA 1S1VA 3BDPA 3O3GA 1UA1A 4E1NA 1JLCA 4O5BA 2QKKA 4DFKA 4M3TA 4HUEA 4DU1A 1TK8A 4E19A 4F2RA 3RWUA 3K5NA 2RN2A 2Z1HA 1EP4A 3TAMA 4CF1A 4IKFA 5C24A 2ZQBA 1BISA 4C8OA 4DQPA 2XY7A 1JLFA 1VSDA 4CHNA 3CQ8A 4BDYA 4PQUA 1VSFA 4CJUA 1XHXA 3AO2A 1BI4A 2KTQA 2KW4A 5SZTA 1RDAA 2KFZA 1B92A 4BWJA 1S9GA 5HP1A 1NK6A 3SQ4A 2YV0X 2YHBA 4W5TA 3PX0A 3LPUA 3HSTB 5KRSA 3SV4A 4FM1A 1C6VA 4CFAA 1ZBFA 4M42A 4DTOA 4CF2A 1RT3A 4PA1A 4CJTA 4M3YA 3PV8A 2YKNA 3L2WA 3OJSA 3L3VA 1WAJA 3VQCA 1NOZA 2QXFA 3HM9A 3WNEA 1C1AA 3E01A 4OKKA 3SV3A 4GMJB 3V1OA 3MXMA 4B08A 1NK0A 4KB1A 4G1QA 4CK1A 3SQ0A 2OYQA 3KJVA 3OS2A 1TKTA 2F96A 4OGEA 4N5SA 4E0DA 2B4JA 2LSNA 3LWMA 1NJYA 4QOZB 3VQ9A 1EXQA 4OPKA 1KFDA 4FK0A 4FJXA 5J2PA 5FRMA 5I42A 4O0IA 1S9EA 3ASMA 4DF4A 3AVJA 3NGIA 3QINA 2Z1JA 2PY5A 4W5NA 4DTNA 2X78A 4NCGA 4DMNA 2HNDA 5EU7A 2HHUA 2XRIA 5D3GA 1IKXA 2HHTA 5C42A 3QERA 4CJPA 4DFMA 5J2NA 1N6QA 1RDCA 4GW6A 5FDLA 4KREA 1MW7A 4JS5A 1CZBA 5I3UA 4CHOA 3QEVA 4Q0BA 1IKVA 4CF8A 4HTUA 3RTVA 5HBMA 1HYSA 1SL0A 2F8TA 1BQMA 1WLJA 2YNGA 4RW4A 1NK8A 1SL2A 4CEDA 4FJ5A 3CFOA 5DMRA 4B8AB 4WE1A 3M8PA 4LY7A 3TANA 1WJAA 1VSJA 4O0JA 3OYBA 2B5JA 3NGYA 5CZ1A 3L8BA 3QLHA 4F3TA 1JLEA 3K58A 3OYGA 1B9DA 3AA3A 4JLHA 3NH0A 4HCBA 4BACA 1S1WA 3VQDA 1FKPA 2BDPA 4LD0A 4HVJA 3O4NA 1JL1A 4M45A 4EP5A 3KD1E 2YNIA 1GOCA 1R0AA 4ELTA 1JLQA 3HVRA 4E7HA 4CK2A 4FLVA 3NF9A 1RDDA 4DSEA 4CJWA 2PZSA 2QK9A 3ULDA 4KKOA 4E7IA 1RILA 1WSIA 4H4OA 4KHUA 3LALA 2HNYA 3BGRA 4DTPA 4OVLA 1NKBA 3K5OA 3AVAA 5HRNA 1U04A 1K6YA 2E6MA 4CGHA 1X9SA 1KONA 4K8ZA 4CERA 2G8IA 1L5UA 3HVTA 3DLKA 1NK9A 3OYJA 3MAQA 4PUOA 4XIUA 1IKWA 3NHGA 4N41A 2DFHA 5CY4A 4DTRA 3VN5A 2PYLA 3KD5E 3ISNC 1BIZA 4CHQA 4KTQA 2VWKA 4FZYA 2I5JA 4CJFA 1WJCA 4CEBA 3QEWA 3S3NA 4AHVA 4E89A 3IG1A 4O4GA 4F3OA 1VSHA 1QSSA 1RTJA 4AHCA 2D0BA 4NYNA 4FM2A 1HYZA 1TKXA 1VSMA 3LDSA 3OYMA 4JRPA 3U6FA 1YTUA 3MXJA 1BCMA 3LP1A 3ZT1A 4AHTA 4J2DA 3MECA 1UA0A 1U47A 3V1RA 2FBYA 4R5PA 4FJKA 2VG5A 4DQRA 4AH9A 4KPYA 4QCLA 1KVBA 3NE6A 4DQIA 4TSXA 3HYFA 3D45A 4DLEA 5HRRA 4HHTA 1C1BA 4N56A 4AILC 1RBVA 4KTWA 3TARA 3F9KA 3AVIA 2DFFA 3HXMA 2PYJA 2OZMA 5KGXA 1Q8IA 4CJLA 4CGFA 2HHQA 4DG1A 4DQQA 1U49A 3ZT3A 1T05A 4FJ8A 4KI6A 3AV9A 4KHQA 4FJIA 2X74A 3RR8A 4LSLA 5DK5A 1NK4A 4BE1A 3JYTA 4JS4A 4UQGA 3T3FA 1VSLA 4CF0A 3EYZA 2VWJA 4DFJA 1FXXA 1VSEA 4EP4A 1RT6A 1WJBA 3P5JA 5KRTA 3TAPA 2XHBA 1WJEA 1X9WA 4Q5VA 4C8KA 2YKMA 4E7LA 1BIUA 4I9LA 3ZSRA 3HK2A 4M3UA 2IDOA 3OVNA 4B9SA 2O4GA 4B9LA 4J2EA 1IO2A 3V9UA 2Y1JA 2X6NA 3HP9A 4DLGA 3LP2A 1ASWA 1B9FA 3KTQA 1JXBA 4CIGA 3I0SA 5T7BA 3AVNA 4CEFA 1L3TA 3AA2A 1XC9A 1O1WA 4FLXA 1GOBA 3DYAA 3TAFA 4O55A 2G8KA 1L3SA 1D9DA 5KI6A 3NF8A 3VQ8A 1VRUA 3ZSVA 2WOMA 1X9MA 3KK3A 3NFAA 1LV5A 1J54A 1LW2A 3VQ7A 5J1EA 4L8RB 3RMCA 2XY6A 4CHZA 1RCHA 2IS3A 4W5RA 5CYQA 3KLFA 5C25A 1BI4B 1TAQA 1G15A 1RBUA 1U48A 4O44A 1JXEA 1LAVA 2FBTA 3WNFA 1RTHA 1ZBIA 3RMAA 2DY4A 3KKSA 1E0EA 3EZ5A 4KV8A 3LZJA 4CJVA 4CFBA 2P1JA 2FBVA 3ZCMA 4E7KA 3VQPA 4YFUA 2YNFA 1BGXT 1ASUA 4ZTFA 1J9AA 1RDBA 1RT7A 3TWHA 3CYMA 3K57A 4FZXC 3M8QA 3MEGA 4H8KA 2HMIA 3NF6A 2KZMA 1YT3A 4YNQA 1D8YA 2HNZA 4AHSA 3RR7A 4M3XA 2IC3A 1HQEA 5J2MA 4FVMA 3SCXA 5FRNA 4CIEA 1D5AA 3PO4A 4F8RA 5HROA 4CF9A 3ZSXA 1Y97A 1DLOA 2BANA 1JLGA 2D5RA 3H08A 3QIOA 4CEQA 4BE2A 4FW1A 4DTUA 4LSNA 4DSKA 1TK5A 3M8SA 1X1PA 2HHSA 1HRHA 2JGUA 2OPSA 1WSHA 1TVRA 4KHSA 5SWMA 3SI6A 3OYKA 1YTAA 1GOAA 1TV6A 4CEOA 1VK0A 1SKWA 5HRPA 4DU3A 3ZSWA 3TAQA 4CGGA 3L3UA 4BDZA 1WSJA 2GBZA 2YNHA 4NYFA 3ZT2A 3HJFA 3WNHA 1SV5A 3HPGA 4CECA 1T8EA 4Z4FA 3NH2A 4CE9A 3OYDA 3QEXA 3LP0A 4Z4HA 2XO7A 1HNIA 1RTDA 3MEEA 4N47A 3ZSYA 1RT5A 4E3SA 3PUFA 2Q3SA 2RPIA 3OYEA 4CJ4A 1RBRA 1LWFA 1QQCA 3CM5A 1SUQA 4W5QA 4QAGA 4I9QA 4DU4A 3P83D 3SNNA 1KTQA 4LH4A 3LPTA 4IBNA 1WSEA 2HB5A 4FLUA 2YHAA 1XWLA 1CXUA 2RF2A 3AVFA 4GVMA 3KLHA 1QSLA 1EX4A 1I39A 1ZBUA 3AVLA 3DRSA 3KLEA 1EETA 4HCCA 2BGGA 3TI0A 4IFVA 2GUIA 2KQ2A 4CK3A 1XI1A 3VQEA 1W0HA 3T1AA 3LP3A 1UAXA 2HHXA 3RMBA 1QHTA 4HUGA 2WONA 3AVCA 1CLQA 2ETJA 2IOCA 1VSKA 3G0ZA 3PY8A 4CJSA 4FJ7A 2A1RA 1L3UA 4IDKA 2E6LA 1Z26A 3DI6A 4KHWA 4Y1CA 4FW2A 3MXIA 3HP6A 2HHWA 4B8CA 4C8MA 3MEDA 3VQBA 3V9ZA 2ZD1A 4C8LA 3JSMA 1D9FA 3AO1A 3V1QA 4Z4EA 4CGIA 4F3QA 3QO9A 3VQ4A 1RTIA 2IGIA 5KGWA 3OS0A 1WJDA 2ITGA 3AO4A 3ZSQA 3I8DA 4DTJA 3ITHA 3SUNA 3ZSOA 3OYHA 4KFBA 4Z0UA 4RW9A 3OYNA 1U4BA 1QTMA 4CCHA 4NCAA 1UOCA 1RNHA 1S1TA 3SQ1A 1C1CA 1LAWA 3DLEA 1NKCA 1KSPA 1S1XA 3ALYA 4DSLA 4FLWA 3KK2A 4ZHRA 4OPJA 4CJQA 3AVMA 3LZIA 3OJUA 3TAEA 4FCYA 2G8UA 1UWBA
chains in the Genus database with same CATH superfamily
1IJWC 3NF7A 2JSCA 4JKFA 2DYSH 3JAMK 1SAUA 2KIFA 1WQ2A 5FLXK 1G59A 2VONA 2F4VK 2V52B 1RUOA 1AA7A 3EY1A 4KITB 2VLAA 4ZYGA 2OJED 3HPHA 3TKYA 4CJRA 1RBSA 5CHIA 2HQ5A 1JLAA 2FD5A 2VGMA 3THWA 5H20A 2HYJA 5LMUK 1FYMA 3T19A 1C0FA 4D5FA 1L3VA 5DM7L 2CG4A 4GV9A 3QNNA 2OD5A 3KCCA 3G71N 3DM2A 3OOUA 2P9PB 2KZZA 3QPSA 3GZNB 3NH1A 4CH7A 1XCBA 3UKGA 4JX5A 3U1KA 1AWCA 4B9TA 2A3ZA 4RGRA 1C0MA 2FU4A 2AS5F 1DKGD 3FR0A 3KEYA 2P6TA 1ZREA 2WUSA 2VASA 1WNSA 1JE8A 3VQ6A 1ETQA 2XY5A 4LIUA 2OQGA 3CCRN 4CGJA 3HL2A 5FROA 1Y1WJ 1T6SA 3HO1A 4FJ9A 1WB9A 2L7FP 4CEAA 3FHNA 5ILSA 4BE0A 1HQUA 2W42A 4E7JA 1OPCA 1NK7A 2F8SA 2FUG2 1LCUA 3I59B 1MBFA 3KWGA 3K4JA 1S7OA 2EX3A 4PY5A 5M5XJ 3PIOL 2ISYA 1ZR2A 4DWIA 4MFBA 4BRHA 4CFCA 1BHLA 2UXDK 1RT2A 2XC7A 4JKBA 3SAHA 3D0PA 4IHSA 2R7SA 4U88A 1LWEA 1LFPA 1TL8A 1VQ6N 4KI4A 1U6GA 3OYCA 1SMYF 4A3KJ 1JLCA 1J5EK 4E19A 3RWUA 5C0YA 1IJJA 1YJNN 1KAXA 3G1LA 4RB0A 1P4AA 5L3CA 2YV0X 3IAS2 3L3VA 1GLCG 3C18A 3J7YJ 1ITYA 2AO9A 3SQ0A 3EUAA 5JLHA 3D5RC 3H1CA 2AXTC 2Z16A 4DBQA 2XRIA 5IYBJ 1RDCA 1QQIA 3I64A 2OCCH 3IDHA 1GHCA 2XSDC 3RTVA 1HYSA 1DEJA 1SL0A 1IUFA 2WAFA 5JI6A 2E2IJ 4OPHA 5AJ3K 3ATUA 4LG3A 2EZKA 3LSTA 3VOVA 4BQNA 1S1WA 1VQ7N 2ZFWA 4EP5A 5DS9A 4FLVA 3F22A 2F4IA 4EJOA 4YFXF 4XIUA 3HRTA 3HBLA 5LEKA 5AQVA 4AHVA 3IG1A 4O4GA 5FGMA 4S0HB 1HLUA 2KRCA 3H3OB 4YOVA 1HF0A 4FWLA 1IRXA 2E1OA 3J80K 2GAUA 3F9KA 1X9JA 2DFFA 1VQMI 1T05A 2M45A 3AV9A 2ZMEA 4MO5A 4G7HF 3CD6N 4DFJA 3O9SA 3WEEB 3EO3A 1WJBA 3DPTA 1X9WA 3KZIC 2CH5A 1ZG1A 4HG2A 2GX9A 2HHHK 1Z67A 1S7AA 1IBKK 2O6GE 2O4GA 5K7HA 4CBWA 2WY7Q 1JXBA 3LSHA 2PJRA 2XSJC 3NF8A 1VRUA 4B09A 5E84A 3KLFA 1TAQA 1G15A 1RBUA 2KHMA 3RMAA 4KJZA 3Q9SA 3EZ5A 3ZCMA 2FBVA 4II3A 1SFEA 3RSEB 4JQFA 5E1WA 3M8QA 1OH7A 2RHKA 1D5AA 1SFKA 4CF9A 4HDUA 2XAJA 3CF5F 1TK5A 2OPSA 2EIKH 1VK0A 5HOOA 2ICWG 4M9XA 3L3UA 1XNRK 3ZT2A 3ZMVA 3DF8A 2P5KA 3ZSYA 2DDBA 1RT5A 3TMOA 3BT9A 4QAGA 2OTJN 4JD2B 3MDQA 1BDGA 4YFNF 1BOTO 1WH7A 3K69A 3OR2C 3K9TA 2OPTA 2ZJQF 2P9UB 1U8RA 3EYIA 1DU6A 5D4SA 4A5BA 4EV0A 3RIRA 4IVNA 4ENJA 1H0MA 2P9LA 3V9ZA 3ZEUB 3SEQA 4CW7B 2LKPA 4LLGF 1I6HJ 4LFCK 5C44J 1MSEC 3OYNA 2A69F 1MDMA 1UOCA 2KPMA 3BJAA 3T69A 1OCPA 2BH1A 3FZMA 2YCHA 1GVDA 5IP6A 1OKRA 4DSIA 3SPZA 4AVZA 3WXIA 1RT1A 4KHNA 2W84A 1OKJA 1J75A 2VE8A 3G6EI 1IG9A 4C3IJ 4QLCU 1K9MO 4OIOF 1PYVA 2YSRA 3SQ2A 1Z0XA 2DA6A 3V4IA 4FK4A 1J53A 4Y4RA 3GZ6A 5CYMA 1Z6TA 4IOXA 5EZHA 3S9HA 3CPEA 2R7YA 1KAYA 3SUOA 1IN8A 3AA5X 1YJ9I 4DBRA 4CYCA 2Y0SA 1Q9XA 1KQ0A 1JKOC 3EE8A 5HLFA 1NJWA 3D2FB 3T1YK 3K7AJ 3VEOA 4WFBL 1XN7A 5EGOA 2RN7A 3CCLI 1JL2A 4PL8A 2O5RA 2IS2A 2DW4A 5K14A 4XLNF 2R7DA 2H94A 3VTHA 3E5QA 3LA3A 1VQPI 3D7EO 3H9QA 2NS7A 1I3AA 2YHYA 2QWMA 3QODA 1XQSC 1NKEA 2L4AA 1RUNA 3SAFA 3DLGA 5EYRA 1UHMA 1EV7A 3F73A 4ENMA 2VC0A 1WN7A 1N33K 4RAGA 2COBA 5KTQA 3H3VK 1HKBA 4KIBA 3ULEA 1TL1A 4F55A 5LHIA 2VQHA 1V54H 1S1VA 3M3YJ 3BDPA 1ATNA 4LC9B 2LOOA 4HLYA 3O80A 3K5NA 1YRNA 1X4PA 1WI9A 3FLCO 4RM3A 4FWOA 4CJUA 5C4XJ 3R0JA 3H3UA 3AAQA 5E8IA 4UXNA 3OJSA 4IJNA 2VKHA 3Q0WA 2VBZA 2YHXA 2LMDA 1TKTA 1ZGWA 2F96A 5FD6A 2B4JA 2L7ZA 4E7SA 3K9KA 4H5TA 5J2PA 3JRBA 1S9EA 4LB5A 2X78A 2HVQA 2E1MB 4C3HJ 1IKXA 3V7SA 2GWRA 4EJUA 5M1QA 5J2NA 1CZBA 3IL2A 4DR3K 2VIXA 1POGA 3O9QA 4NUBA 5IOZA 1FOYA 2K3PA 4A2UA 4QPQA 2DA3A 1SL2A 4CEDA 2HDDA 1W36C 4BC5A 2E2PA 3E9LA 3FK7A 3K6GA 3U9DA 4BRKA 2K86A 2HEOA 4V2GA 3GCMA 4IEIA 4M45A 3O9RA 4KMFA 1BJAA 4BS9A 1I50J 1FBSA 2LNBA 2R7TA 4YOYA 4G6DA 1RI7A 5K7ZA 4FZYA 2KKZA 2ASPA 3OA9A 4DV5K 1TKXA 4JRPA 1G8XA 3CCJI 4DQIA 5FFZA 1YUWA 3HKZA 2DQRA 3JREA 1RKTA 5EEGA 1YW7A 3HXMA 2HHQA 3LMMA 2HQNA 1TUUA 4B44A 4D7MA 2VQCA 3J81O 3ZETA 3P5JA 3BJ6A 3BY5A 1MKMA 5T7BA 4M71A 1L3TA 3D2EA 5KI6A 2DCEA 2FSWA 3V8JA 3VQ7A 1JTXA 3JSPA 4YOUA 2XY6A 4MEXF 5E79C 2R5ZB 1G99A 3VQPA 3L09A 3DXMB 2TDXA 3WXLA 1OYIA 1J9AA 2CH6A 5GADJ 3HUGB 4YOTA 4NO7A 3PNTA 2V4JC 4CEQA 1VQLI 4AUXA 1Y56A 1TVRA 1S3JA 3SI6A 2EFOA 4XM3A 1PVEA 2ZJRL 1SV5A 2IVPA 4Z4HA 2W25A 3OYEA 4DGWB 3HOVJ 1GV2A 4PDKA 2EIJH 3BR3A 2R5YA 5EEAA 3OBWA 4LG0B 3ZMTA 3T1AA 1Z05A 3VSLA 5BRDA 3RMBA 3CLOA 2A1RA 2E6LA 2YHWA 4KHWA 2XPVA 3MKYB 2ZF5O 2ZJ2A 5AQKA 1E17A 2R7WA 3ZSOA 5EEHA 1PUFB 4B43A 1BJZA 2DI3A 3E0JB 4I0AA 3TO6A 1IKYA 4KH4A 3CCMN 4ILGB 1TGOA 2CJJA 2O3FA 2QWRA 2HNHA 5HNHA 1YW8A 4B3OA 1NGHA 2KKOA 4WQ5A 3ZSZA 3NGZA 3CM6A 1ETWA 1SANA 3SDGA 4XH5A 5AQTA 3WNGA 1ETXA 3BP8A 2JRTA 3GX4X 1EJ9A 4NXMK 4IHVA 3RDIA 3QEIA 4XR6A 3E6CC 3AKZA 1MBJA 2OTLI 3Q7CA 3DRPA 3QEPA 4EJVA 4M3ZA 3KKRA 3CC4I 1SL1A 3BTLA 2BW3A 3QB0A 2ZJPL 4BG9A 4ZTJA 5M1NA 2JMWA 1WUAA 4FJJA 1SQKA 1N75A 3RCOA 3RKYA 2H1KA 1G6NA 3HZ6A 4Q48A 2F5VA 1WH5A 1REVA 1GLJO 2ZB9A 3CCEI 2RKIA 3A0IX 4F2SA 1TYQB 4EQQA 4ESJA 4CGDA 3ZQQA 4XIDA 5FD5A 4UV9A 1N78A 2M8GX 3DWLE 5AQUA 4U0YA 3LA2A 4IO9F 3LAMA 1AOYA 2HWVA 1OFCX 5BPNA 1XMXA 2F4MB 1A5WA 2XVCA 2E1MC 3W6KB 4BY1J 4WCEL 4FWNA 4GNIA 4IKFA 2ZQBA 1TTYA 3HHGA 4XOTA 1YHQI 3BCBA 2KW4A 3LDQA 5ICGA 5K1YA 2Y9ZA 3O9TA 4XQFA 2O8DB 4KH6A 3E01A 4M6VA 4G1QA 3T1HK 1VTNC 3J81Z 1D1BA 3J7AP 4QSHA 2WV1A 3S1MJ 4KUMA 3RKXA 2BZTA 4JKAA 3VSKA 1ZQ3P 4CJPA 1MD0A 1X58A 3HSEA 1K8KA 5JHUA 5JVGF 5BPIA 3IV5A 1BQMA 3ZQGA 5LLQA 1IN6A 1IDYA 1HKSA 4F3TA 4BC4A 4JI1K 1E2XA 1U8BA 2UUCK 1E4FT 4O5FA 1R0AA 4PJNA 5L3BA 3F8BA 3IWFA 4CSWA 3VGKA 1PP7U 1VF9A 3JRGA 3I56I 3WQUA 2DJIA 3HVTA 2PJPA 4L9JA 2HYFA 4CHQA 5KPRA 3GTQJ 1VSHA 5EG0A 5K5OA 1P7JA 4G8XA 5IY5H 1CZAN 3FM5A 1NU0A 1T39A 3NE6A 4BXXJ 2RQPA 4HHTA 2DT5A 3GTMJ 3E1YA 3TL4X 3P38A 3CUQB 2X74A 2VQLA 2CUZA 2KISA 5AQZA 1JJ2M 3HHHA 3ABTA 1W0TA 4EP4A 3P39A 3EUKL 5KAFC 2YKMA 1BIUA 3HK2A 3Q7BA 3PNYA 2QW9A 1A35A 1UAAA 3I33A 2RC4A 4DV2K 3AA2A 4B9QA 1BR4A 5J8CA 1X3ZB 2L9VA 3ZSVA 4II2A 5J1EA 4BRMA 1Y0NA 1FIPA 3R9PA 1SD7A 1ZR4A 1JXEA 4DV6K 2CV1A 5L3FA 5D5UB 1NGGA 4E7KA 2QBYB 1YXQA 4MO4A 5AFUA 3G3ZA 2FXAA 4JI4K 2K9NA 3NF6A 2WB1A 2IS4A 4FE7A 1QZEA 4A3MJ 3NVMA 1Y97A 4D7NA 2KDOA 4KDPA 5SWMA 1SKWA 5GP9A 5HRPA 2H8WA 4WXHA 1BC8C 3HPGA 4P96A 1I3QJ 4BRQA 3PUFA 4I2OA 4CJ4A 5GAHJ 2FNAA 4GV6A 1MSFC 1KTQA 4CHUA 2ZGYA 4F9OA 1BW6A 3E6MA 1I39A 1YI2I 5HL7L 2FSJA 2MD0A 1WBBA 4DYCA 1W0HA 1B72B 1X19A 2R7RA 5D5WB 4IWVA 4HUGA 2FXUA 1YVNA 4CZCA 4JKCA 4Z6YA 3CESA 2XGXA 2GLOA 4GRIA 3LM2A 3LSIA 4CCHA 2OUMA 2X6XA 3TDUC 2WA0A 5TJJA 2XF7A 3RZOJ 4FCYA 3R6MA 1KLMA 1P4WA 3HXLA 2J5OA 3A0BC 3OS1A 3A5OC 2QSGX 1ESVA 4MGRA 3SJJA 1T7PA 4OWRB 3DRRA 3SK3A 2LKXA 4NC7A 1Y0UA 4RGXA 1WFXA 5HLHA 1BM9A 2P9NA 1VZ0A 3JRFA 3E66A 3BCAA 5A2QO 4Z4GA 2KZVA 5J1RA 4M41A 3CCQI 5BMZA 2HDWA 1JJ6C 1K73O 4UVBA 1KD1O 3CFPA 3C94A 3FGUA 3WTYC 4K2EA 3K5MA 2DDAA 4J2AA 3CI5A 4DQSA 4E1JA 4KO0A 1BO5O 3GTGJ 2D0CA 1MDUB 2DYRH 5HNFA 1W7PD 2W24A 3H5RA 4XKBA 1BR2A 3K2AA 4M3WA 2Q1ZB 4FJNA 4FOIA 3NVKA 3S1QJ 2HHVA 1TAUA 4JKHA 1PP8F 2D1HA 2PMHA 3IUCA 2CW0F 1IV8A 4EMSA 1WCMJ 2UYTA 3H1QA 2LY1A 4FJGA 4D9JA 3LAKA 4IXAA 3DBRB 1WKMA 2OA8A 1FYLA 1XTAA 2XRLA 4FJLA 4CFDA 4IO8A 2W1OA 2E7WA 1YITI 1YVUA 4E6KG 3O3GA 3FFKB 4DFKA 3RPUD 3KYLA 4DU1A 4G7ZF 4HBLA 1W2BM 4PQUA 2GOXB 3CPWM 1JT0A 1K83J 4RCHA 4FM1A 2L4MA 2M7BA 4M3YA 3L2WA 2LF7A 1MBHA 3K2ZA 3SYTA 4ZDPA 3R4KA 2Q0UA 1ZXOA 5AQYA 4O0IA 3M8FA 3TOAA 3QINA 2PMZA 5FPMA 2VN2A 1KU3A 3MWPA 3QFPA 4DV0K 3KHYA 4F52A 2XGEA 4OAYA 4GW6A 1MW7A 3VETA 1J9IA 3E5UA 3LM9A 2PJRB 3P7NA 2NRXA 4FJ5A 1KC8O 3M1EA 4B8AB 5DYMA 3RQIA 1TNTA 4B1YB 3FKIJ 3DXKA 1UCRA 3ECHA 3WQTA 2X1CA 3O4NA 2YNIA 4X62K 4LFAK 3CF2A 2CGLA 5GTIC 4I6ZA 4KKOA 3IRQA 1EQYA 3CUQC 3O1WA 4DTPA 2RNJA 1KYZA 2E6MA 2ZGZA 2G8IA 5FLXZ 4L9NA 4DR6K 3OYJA 3MAQA 1W5TA 4NBQA 3OOPA 1AU7A 4LF7K 5CY4A 2LYCA 1OQYA 1RC9A 5FO5A 1RTJA 1VQKI 1Q81O 1VQMN 4Z2YA 3NWSA 4H0YB 3ONQA 2JVHA 4A3FJ 1OISA 4FWRA 2VG5A 5HODA 4XLAA 5CQEA 3FWEA 4ESFA 2JVGA 2CQXA 4DG1A 4DQQA 3OMYA 3RR8A 4CZKA 2BE5F 4PSWA 3ZSRA 4S04A 1IAWA 3E6DA 2A41A 1YX5A 3I9V2 4FLXA 3TAFA 1Y39A 3CC2I 2JJ7A 3ZN1A 3RMCA 5LEJA 5K7FA 3FXLA 4A0YA 3JRHA 3LZJA 2UXNA 2VQFK 4UUTA 1ASUA 3U21A 5CKTA 4BAYA 3C65A 3VDXA 1YT3A 1JUSA 2I5UA 3S14J 5A2QZ 4BE2A 2LK2A 4BGDA 1HRHA 4JYAK 2P9KB 2R7VA 4EVIA 2JUCA 3QAHA 3TW7A 1LE8A 3CTAA 1J59A 1T8EA 4N47A 4QS9A 4OAZA 3F8MA 4DU4A 1WSEA 1U9OA 2HB5A 3HB9A 3NMUA 1XWLA 4JI6K 4H0PA 3DXJF 4BU2A 5E8GA 4DUYK 1A6IA 3VQEA 3SAGA 1Z21A 5C3EJ 4JK1X 1LDDA 3AVCA 3G0ZA 4CJSA 5IP9J 3GF2A 1IF1A 1HW5A 1GV5A 4Y1CA 4H03B 3F6OA 4IDHA 3MEDA 3RKQA 2X48A 4DTJA 2TRTA 1ZLJA 2EV6A 4IZZA 3SQNA 4C23A 4KFBA 3HG9A 2IIRA 5EX5A 2LP0A 5B1BH 5EF6A 3A2KA 3TAEA 2Z33A 4CJ3A 4OJRA 2X85A 4CESA 1M1KO 2OZUA 3WHBA 3SMSA 2WV0A 3G2BA 1U2VA 5F1JA 3FDYA 1DDNA 3SZ2A 5JS1A 5GIPA 2ELKA 3NBPA 1IZ1A 1FKOA 1QPIA 2QKMB 4M3RA 4RB3C 5KQ8A 2P6SA 3ZRGA 3WTSC 3ULEB 4J19A 4OMZA 2F2EA 2W40A 1RKWA 4UB6C 1BN5A 4H0TB 1ZYRF 2H6BA 4AIDA 3QPTA 5J2QA 3GTKJ 4F7ZA 1LW0A 1YJ9N 4CD1A 4IHTA 4QIWN 3GBTA 5AQHA 5JLWA 2GEMA 5H6QA 2EFPA 5F0FA 4ITVA 1BA1A 3RRGA 2OZSA 1ENHA 4PKGA 2QKBA 2Y1IA 3CCLN 2O0YA 4PFPA 3VEPA 2Z1IA 4F4KA 3BR0A 2Z5UA 1UZCA 5F0XA 4BJ5C 2A1SA 3H5AA 3KX2A 1GLFO 1SKSA 4HV6A 2JWLA 1VQPN 1RBTA 4RS8A 4W1UA 4IG3A 2UUBK 1TWHJ 1R9TJ 1NJXA 1BU6O 2B6AA 2G7UA 2PAVA 3KK7A 2BE2A 1X1BA 1U78A 3FZKA 2VQEK 2ITMA 3VA3A 4OKJA 4LITA 2FE3A 2GA2A 4B3RK 4OIRF 3ASOH 1C0GA 3S3MA 1BBYA 2DA7A 1DTTA 4RW6A 2JN6A 2FBXA 3HSRA 1LDKB 4L0YB 3S3OA 1R4NB 3HRSA 3U3YA 2M30A 3B8AX 3QWLA 2KIQA 2P51A 2OV7A 2NNWA 4EHTA 2VL8A 2BBYA 1AKHB 3BG9A 1UA1A 3VEWA 3VYRB 3EETA 3QYBA 4M9SA 3CMYA 3H45C 4CF1A 3UKUA 4C8OA 3GXOA 3AO2A 5SZTA 1B92A 4WX9A 1NK6A 3LPUA 2VJ4A 4ZYAA 2IBDA 5AFUH 2DU9A 2ZXIA 3O4WA 2QXFA 3SV3A 2LBFA 1MJ9A 3RYRA 4O8KA 4CVNE 3ZETB 1KFDA 1LKXA 1OH5A 3NGIA 2CU7A 2V7ZA 2CV0A 2EPFA 2I8DA 3CLQA 3K1MA 3D2EB 1IKVA 4FO0A 2LY9A 4HTUA 2F8TA 5AQJA 2CYYA 3TBIA 2DA4A 5D6EA 3MQ0A 1FZPB 2FX0A 1VSJA 2A6TA 3D5LA 4AYBA 3FXOA 3VQDA 1BWFO 2B9SA 5C4JJ 2F9TA 4DW6A 2A42A 1QHAA 1BG3A 2IVOA 1ZRFA 2PFBA 5IT3A 1SAZA 3BZ6A 5E3MA 3AVAA 1U04A 1X9SA 4ZZDA 3I54A 3DLKA 4LGWA 3CCJN 1IKWA 1Y64A 2J4RA 3VN5A 3BPVA 3PIPL 4HTLA 3RTRA 1YO5C 2QWWA 3RPUA 2W6LA 2X1EA 4K41A 2PX9A 4BROA 3QRFF 3FMSA 3HYFA 3D45A 2NRVA 2NVYJ 1X3WB 1FTTA 5D5VB 1OR7A 4CZEA 4FJIA 2ELHA 2R4GA 2IA2A 2NNNA 4LSLA 2EA4A 3LSJA 4CF0A 2A3SA 1FXXA 2R7XA 4E7LA 1MNDA 2VQGA 1FWZA 4MNUA 3A0HC 2VJ5A 3LP2A 4DKWA 1PJRA 1I94K 2BY3A 4CEFA 2XB0X 3OWTA 3KP2A 1KZHA 5JLFA 3KK3A 3N4QA 1W1WE 4E7ZA 2B0LA 3V7CA 2Y2ZA 3WNFA 2BXYA 1MMGA 2NYXA 1JXSA 1VQLN 2KL4A 2Y30A 1ATRA 1O57A 1USTA 2E1NA 4GYGA 3VEXA 2WBNA 4FVMA 4N4OB 3ZQHA 1WOQA 3VTIA 1YJWI 4KHSA 4CEOA 5GADP 1D5YA 2YJEA 4CGGA 1FSEA 5AQIA 4BR9A 2HYGD 4KIGA 2DT7B 4Z4FA 3LP0A 3NQOA 1HW2A 1SUQA 2P9SA 4NQWB 2LDUA 4RA2A 2V51B 3HGGA 3M1FA 2Q2EA 2XPWA 3EKSA 3LP3A 4S05A 4IEJA 1Z6RA 1STZA 1UMQA 3SZTA 3DKWA 1VSKA 4FJ7A 1V5EA 4H0XB 2IGMA 3MXIA 4HLXA 5DUIA 2ITGA 3L1PA 3B73A 4Z0UA 4RW9A 3AGKA 1QTMA 2EWSA 4Y17A 1KSPA 1V4RA 1IXCA 4Z94A 4NC8A 1R1TA 3KK2A 1K78A 4ZHRA 2RE2A 1BI2A 3CUOA 1KYWA 2K4BA 3AO3A 3I5UA 1HNXK 1JLBA 2QWLA 4JV5K 1RZ4A 2AP1A 2HMPA 4KHPK 1P6RA 1R5HA 1JKHA 3LL3A 5BPLA 3NAUA 3CDIA 4JX6A 4KB0A 4FJHA 1J7KA 4A6EA 4MDAA 1DTQA 5CVVA 4YOWA 2G8FA 3GFLA 4YORA 2EINH 3HSCA 3NAEA 1NJZA 4HF0A 1S9HA 3DLLL 2QZ8A 2OTLN 4L9TA 1HMVA 1A5XA 2RREA 3U3GA 1FOWA 3CC4N 3TTDA 2CH0A 3P1GA 1AHDP 1DP7P 5BNGA 2AJQA 2R7ZJ 1A6QA 4MQ3A 3CCEN 4H4MA 1O3SA 1IV6A 2VBWA 2X6YA 5ILVA 1TBXA 2IA0A 1LEBA 4DFPA 1K8KB 4G9ZA 2FQ3A 2AQFA 5IT9K 4ICLA 3TSPA 2D0AA 2NVXJ 3W2VA 5IPAA 3CCUI 2FF4A 1IG7A 3VQ5A 1Z1DA 2CO5A 2G8HA 1YYVA 4ELVA 1NK2P 3ULQB 2XF5A 4Y15A 3D5SC 3IFRA 3VWBA 2DQLA 3DP7A 3TTCA 2EIMH 2GUPA 1LFBA 3VQQA 1YHQN 1SFOJ 3C2HA 2A6HF 4B3AA 1B59A 2CS3A 2V9KA 2D2WA 1DU0A 4H5RA 1P2FA 1BISA 4M3BA 2A5WA 1VSFA 1RDAA 4ZJZA 4BWJA 1S9GA 5HP1A 2HVRA 4P9UA 4BR4A 4M42A 4CFAA 1IC8A 4CF2A 1XUPO 5C2FA 4P5OA 3B6CA 4WYBA 2V9VA 2W85A 3H35A 4B3XA 4OGEA 1B1BA 3B6AA 4FK0A 1RPWA 1S8NA 4AQYK 4DF4A 2YX4A 4PUSA 1R4MB 4BQOA 3LDOA 3JCUC 4B3TK 1KGSA 2QI2A 3CMEI 4UUSB 2B5JA 4BG8A 1WZ2A 2BOLA 3PL8A 4RTFD 3W3CA 5EY4A 3I56N 4BACA 2OBPA 2HBMA 3HOYJ 4V2FA 1GOCA 2Z1DA 2VJJA 4CK2A 2WAQA 4MDBA 4JK7A 1HBXG 1APLC 1KU2A 3PSFA 2PQ8A 4BEHA 3LSRA 5HRNA 3LL7A 1KONA 5ADXA 2NRWA 3VESA 2EILH 3PQKA 3VYUB 3NHGA 3QOEA 2OF7A 1Z3YA 1U2WA 2JQ7A 4HNTA 2WAEA 4JOMA 3KLNA 2V1DA 1QSSA 2RQQA 4FM2A 1JHHA 4J8FA 1OCOH 2R7FA 1X2NA 4ISEA 4AH9A 1D8KA 3FZFA 2KZGA 1IN5A 4IRGA 4DR5K 1NK4A 4Y0WA 4C8KA 1T0FC 4IJAA 3C3WA 3I4MJ 3GDQA 2JZYA 2JK3A 1VQ8I 4DLGA 4BGAA 1T6DA 3AVNA 1XC9A 2ZJPF 3QU6A 4XRSG 2W4SA 3IC7A 3MAJA 4DR7K 5CYQA 1TWAJ 3G1OA 3S2HJ 2YX6A 5LJWA 3KKSA 4YFUA 1BGXT 2QSHX 4N0BA 5BRFA 3K0LA 1XMOK 2X4HA 2QWQA 2UV1A 4HNVA 4RM2A 4DSKA 1DP3A 1LB2A 2MH2A 5AQPA 2HHSA 2XKPA 4JBAA 3OYKA 2M1BA 2YUSA 2I10A 5LY3A 1YI2N 5B66C 4HW0A 3P9CA 3UKRA 2PN6A 3CM5A 4W5QA 3LPTA 1NMNA 1WSUA 4IRHA 3AVFA 1ZBUA 3DRSA 4ON0A 1ON1A 3MN9A 1W5SA 3BJOA 1O7FA 4I99C 2NVQJ 1SVOA 2L9RA 2IGNA 1X3NA 2KMUA 3J7AY 2GM4A 1G3YA 3RPQA 3AG1H 1ILYA 4WF9L 3SHFA 1WJDA 1JCGA 4B48A 3QICA 1SVMA 3F8FA 1S3XA 2FSKA 3LZIA 2Y75A 3H6EA 1HJRA 1ZRDA 2NRAC 4HDVA 1HOMA 4IZ9A 1YG2A 3FIWA 3LANA 2QQ9A 2E1YA 1F43A 3C0BA 2CQNA 3ASNH 3CCQN 1ZBLA 1ZYQA 3DEUA 3L4IA 3VENA 3CMAI 3CIPA 2LY2A 5JS2A 3T8TA 4DR2K 4K8XA 4KT6A 1BL3A 4NLBA 2CUEA 4B1UB 3CJAA 1MH4A 3ZQFA 2NVTJ 2VPLA 1FTZA 2MLKA 3BDDA 5C10A 2CW7A 3ZYYX 3O3HA 3IHUA 4KYWA 1TWCJ 4V19K 2D5VA 4BBRJ 3CJRB 3LFKA 1XC3A 4J00A 4MO7A 2JPBA 1OCTC 4CCOA 4CHPA 1WPKA 1W5CC 1MMDA 1IRZA 5LGTA 2M4KA 5TKYA 4CUGA 4OX9K 3CDHA 4DQ2A 1QZ5A 2F7TA 4ID1A 3KP7A 1PUEE 1NJIO 4GXOA 5E1ZB 5FPNA 5E41A 2GV9A 2ATQA 3HT3A 1FP2A 1QS4A 4JHDA 4IFYA 3RSNA 4IXCA 2ZM6K 2MD5A 1R59O 1YITN 3IKMA 2E2NA 2HVIA 1HC8A 4ILHA 2JA7J 1HYVA 3ID6A 1T33A 3QP5A 1FJLA 5AZIB 4CIFA 3CJBA 3KYDB 1B6AA 2JWKA 1TL3A 2VGNA 2O8EB 4B1WB 2P5OA 1VHXA 2GZWA 3AG3H 3BF1A 4HUEA 1TK8A 4F2RA 4M7YA 3BG5A 4XORA 1XHXA 1IUYA 2RKHA 5F27A 3OL4A 4IQ4A 3U1DA 4FX0A 3L4QA 4H4KC 1P9QC 3F21A 2VT3A 5CPRB 4BHCA 4PA1A 5AIQA 3MKWB 3M1CA 1TQIA 3JW4A 1J0RA 4IX7A 2BEOA 1WRJA 3NWTA 3JTHA 3FXUA 5DV5A 2HXIA 3ASMA 3E5XA 4M73A 4DMNA 2HHUA 4CBUA 2E71A 2Q0RA 5FDLA 3O6BB 2HKXA 1P4XA 2Q8KA 1Z7LA 2F5FA 2WBMA 2LLKA 5JVHL 1NGIA 3W2WA 1QHHD 3M8PA 1OJLA 1B8IA 3QDKA 5LRRA 1ON2A 4BBSJ 3QPHA 5AZJA 1RILA 1HDPA 3WE2A 5AONA 5AQXA 1VQKN 4OIPF 5TGTA 1L5UA 1NK9A 4DV7K 3THXB 2NRTA 3CF5L 3A02A 3KD5E 2KRHA 3S15J 2QF7A 4YFKF 3HSFA 4PKHA 4FSVA 3MN5A 4GY2B 4E89A 3CJTB 1JTYA 3WU1B 1HYZA 3LDSA 4MLHA 1U47A 3DV8A 2K9SA 3BTJA 4DLEA 2V6CA 1C1BA 5MLCQ 2NLXA 2Z99A 3CP2A 2E1ZA 3VEYA 4UNOA 2PG4A 3CJCA 5DK5A 4BE1A 3M8EA 3J7ZO 2NS0A 2XGDA 2ZJQL 1VSLA 5KRTA 4BQQA 2XB5A 3CC2N 2QWNA 4M3UA 2GXGA 2P9PA 3MMYB 3W3DA 3QYFA 3HP9A 1ASWA 3RQ4A 1EF4A 2B63J 3LAPA 1TQPA 4CCKA 1RCHA 3BUZB 1VAZA 3VPZA 2FMYA 1JJ8C 4C9YA 4X65K 1L3LA 4Y33A 4WK8F 1RDBA 2H09A 3A1YA 4EAHD 4CIEA 5CVJA 1DLOA 3F6VA 3GZ5A 3I59A 4CZIA 2JGUA 4IQJA 3O8GA 4BC3A 2FA5A 2I7PA 4A3CJ 3ZSWA 3Q9VA 3WNHA 5ILUA 3H0DA 4K0KK 4A5AA 3MEEA 3DBLB 4EM0B 3G73A 2RPIA 5CVIA 3K4CA 4ENKA 1XSDA 5M3MJ 3KVGA 5LFAA 3TTFA 4AU7A 2BGGA 2FMLA 3MZYA 5F2RA 3TSUA 4V19S 2FOWA 3MD2A 3GBGA 1XGNA 1L3UA 3DI6A 3ZX0A 1SFXA 4Q4ZF 3PSIA 5KGWA 4ZYHA 3I8DA 1P90A 3QP6A 1T56A 3A01B 4ISFA 4JYKA 2EJRA 1C1CA 1EA3A 4DSLA 2HBLA 4CJQA 2A68F 3RMDA 1HQCA 3QPLA 4X0GA 3TU5A 4GGGA 1OVYA 2FC0A 5FKMA 4B9VA 2EV0A 1IXRC 3IKTA 3OHRA 4EM1A 3V9SA 1OH8A 1YF5L 3LA7A 3SUPA 1S5JA 4CHYA 5E3OA 2STTA 1ETVA 4DS4A 4L5EA 3SXYA 4CEEA 3GEZA 2AXLA 1GT0C 2QQ8A 2KFNA 1M1EB 4PFOA 4UB8C 3O4QA 3UKUB 3ELKA 5M1PA 1HSJA 3TW6A 4EZ6A 3ERMA 1XS9A 2LBFB 4UUVA 4HYEA 4OLAA 3GTJJ 1W7PB 2Y0MA 5FLVA 5ADXH 3OY9A 1L0OC 4Z4CA 1LVAA 1C0TA 4ID5A 1E3PA 2FLOA 3B6OA 1JUMA 5LRSA 2GA1A 3F8CA 4I6MB 4DTSA 2GWKA 1P7IA 3K4KA 3QNOA 1SKRA 2XHKA 1Y1VJ 3L7WA 5D6FA 3WEEA 2X51A 3I0RA 3JSOA 3BWGA 4WF2A 1D1AA 4L18B 2ZE2A 4KHYA 1QGPA 3DLRA 1N25A 2W00A 3ZT4A 3LSGA 3IRRA 3O3FA 1EO1A 2K27A 2JSPA 4FETA 4JI2K 4LFUA 1TUYA 5CZ2A 4XOPA 4E1NA 4BGBA 3GYHX 4G6TB 4PJJA 4ZC3A 2YHBA 3MWTA 3HM9A 1W7AA 4C2TA 1NK0A 1HDDC 1GLLO 3KJVA 3OS2A 3C6HA 3FM3A 3GMEA 3AVJA 4A5NA 3MVPA 4JD2A 1BI3A 1HNWK 1D4XA 4FWQA 3W2AA 1V5FA 3NARA 2P9UA 1JHFA 3TANA 3L8BA 1PDNC 3ZEUA 3W0LA 1Z7UA 1YOVB 4DJAA 3V4GA 2HI3A 2PZSA 3V8KA 1WSIA 2ESHA 4LD5A 3ZQLA 4KISA 2KHOA 3MK6A 2X6OA 4N41A 1BIZA 3M4OJ 3N97A 1VQNI 1KU9A 4XN3A 2DMUA 3HJEA 3OYMA 1BCMA 3LP1A 3ZT1A 3HI0A 1ZRCA 2CQQA 5HRRA 1HKQA 4H0OA 3O2PE 5J8FA 1IN4A 4KI6A 4EEFG 2HQAA 1KQ9A 1UG2A 3T3FA 2CUJA 4JN4A 1RT6A 1OCZH 3HKZN 4B9LA 1BOAA 4J2EA 1ETKA 2Y1JA 2V6EA 3EE9A 4F91B 4OPAA 3VQ8A 5F6FA 1LV5A 3D2FA 1FOXA 3OSFA 4L9VA 3K4BA 1XMAA 2M9HA 2IAIA 1YJWN 4DV4K 2QTDA 1VQ9I 5L3EA 3PO4A 4A2BA 2BGCA 1I1SA 3HTUA 4DU3A 4WXCA 3O8MA 2FSNA 1J09A 1LNWA 5FFXA 2XO7A 4N9IA 3CERA 1NGAA 4E3SA 4BRGA 5DCFA 4I9QA 3EUHC 5AQSA 2E5NA 4CCNA 1EX4A 1A5JA 3JS6A 4JKGB 5ELZA 4LMYA 5JLXA 2ZNZA 3VF6A 1QHTA 1CLQA 2Q36A 2QXLA 1FNNA 4IDKA 1NGJA 4JK9A 2IGIA 3VERA 5B3SH 2FJ1A 1ACIA 5IYDJ 2EA2A 4JKDA 5AQWA 1LAWA 4XLFA 4FLWA 2CW8A 2JA2A 6PAXA 3TEDA 1WSGA 4FE4A 2OU2A 1XDUA 3MN2A 2XAUA 1TKZA 1P8ZA 1TK0A 5AQFA 4YRVA 1F36A 5E3LA 2CFXA 4FLZA 1K8AO 5DUKA 3ENOA 3ZLJA 4CO8A 4BRLA 2DT6A 3ZP5A 1BCOA 2MBFA 1QQMA 4ABZA 3CP8A 3TPQA 1GXPA 3HPOA 5C12A 4HX4A 4DR1K 2NS8A 3G1MA 3KLGA 3D0SA 4C3JJ 2VG7A 3E6BA 1S7EA 2IVMA 4L0ZB 1IH7A 4RLQA 3C6TA 4FK2A 2VWBA 4WQ4A 3A2FA 3L2QA 3PIPF 3UE5A 3HOZJ 4CJ5A 1KRPA 1S29A 3GFJA 3AA4A 2HVHA 3V9XA 1NNEA 4XKWA 4CI6A 5HS8A 4H0VB 1QZYA 1MIJA 1MMSA 4C2MJ 3T0YA 1NK5A 2F5DA 3J81K 1N32K 3KIOA 1FK9A 5DCMA 2VKDA 3CCUN 1LUJB 4PGGA 3PO5A 1T03A 2DOEA 1MMAA 3C7NB 4A3BJ 5JVGL 2NAZA 4JRQA 2X6WA 3CCSI 3KP5A 2QEXI 3H3ZA 3OYLA 5DEQA 1WHUA 4BR2A 2NXNB 1XMKA 3GLLA 1GLBG 3V81A 1CF7B 2CRGA 2DMNA 2X6SA 4CA0A 4WXDA 3LWLA 2OPQA 3DKYA 2Q1NA 3U4LA 4CCLA 3GUDA 4BRAA 2V7YA 3DXMA 2TCTA 2CUFA 3DCFA 1MBKA 2X9DA 3PX0A 3UNGC 2CQKA 1W4MA 5BPDA 4YEJA 4CJTA 5J1YA 4CZMA 3WNEA 3MXMA 1QVFM 2EH3A 4B08A 4I98B 4E0DA 4QOZB 4RAZA 2LR8A 3CMEN 3H3NO 4DFMA 4NB5A 1J2XA 4KMUX 4IFEA 4Q0BA 4KNYA 1WLJA 4A69C 3WTVC 4M72A 3DKXA 3F2KA 2JA8J 1FC3A 3SBGA 2BDPA 4HVJA 3HEFA 1JL1A 1XB4A 3HVRA 3K70D 2HQRA 1PUFA 3C1DA 5GAEP 4E7IA 5FKOA 4CD3A 4OVLA 4JI8K 4CBXA 4ZYDA 4I09A 1OMIA 1R1VA 2WWYA 1SFUA 3TDZC 2R7OA 4EATA 1U6ZA 4DTRA 4M6YA 3WGIA 1ZG3A 4CJFA 4AHCA 2D0BA 1NG6A 3UKRB 3QU3A 3V1RA 5CLSA 3KP3A 4FJKA 3BR6A 1KXPA 1BA5A 1RNLA 3IH2A 4I02A 3TARA 3AVIA 4CJLA 1XMQK 1VQ8N 2ZXHA 1U49A 5ED4A 3WTUC 2CGJA 4JS4A 1W0UA 1VSEA 1RDWX 4Y7NJ 3UR3C 3QFUA 2UZKA 4IF4A 1WWXA 1NM1A 1O1WA 1D9DA 3HOTA 4ETSA 4HPQA 4JEPA 2HOTA 1J54A 4FPBA 1QQOA 5F1XA 5FKKA 4OU0A 1RIOH 4YDUC 1KU7A 2OA4A 1LAVA 4FX4A 1E0EA 4CJVA 4PCQA 2YNFA 1LEAA 3THYB 5ICEA 3K57A 4CZGA 4H8KA 2HNZA 5FRNA 1TYQA 1G4DA 4FW1A 4LSNA 1QVGM 1WSHA 2K85A 2HVSA 2VXDA 1MZBA 1YTAA 1GOAA 2AHQA 3DEWA 3O5BA 2HR3A 2WB1N 3KE2A 3PLAA 4JI7K 4IPAA 2VPRA 2W6KA 4IBNA 3HOUJ 2A5XA 4L5JA 2CSOA 3KLEA 1VFCA 4U7DA 2ETJA 3HTSB 3DPUA 2NOGA 4C8MA 5DD8A 2QENA 3AO1A 3QO9A 2P0WA 2O8DA 2E60A 2JWTA 1X1AA 3SQ1A 1YE9A 1TP4A 3SJMA 1ZG5A 2DLLA 2NRZA 1JGGA 4RB2C 1VRTA 3WGHA 1LPQA 4I2PA 4PKIA 3CMAN 2OC6A 4MQ9F 5AR0A 4DSJA 4BRPA 4A3EJ 4MTDA 2QM1A 3VODA 2KIUA 4ENNA 1XG1A 3CC7I 4J01A 4FISA 3CG7A 2K9LA 5GPCA 3SZPA 1MU2A 2WC9A 2MW8A 4B9MA 2HOAA 1TWGJ 2M0CA 4MFEA 1Y8QB 4HF2A 2QA4I 1X2MA 1D8JA 5KPZA 3TABA 4KFCA 3OYIA 4MFDA 1J6ZA 4KRFA 1QVUA 2FF3B 3QBWA 2L7MP 3MCAB 2ZO4A 1Q9YA 2R92J 2K40A 3CJ1A 2G0EA 3S1NJ 4DYQA 2ZC2A 3CUQA 3BPXA 2F48A 3OR1C 4MTEA 2E2HJ 2PI0A 1S6PA 4MIMA 4DSFA 1Y6IA 3C6AA 3S32A 4X64K 5AZJB 3I53A 2M3AA 2ZSHB 3DLBA 1QA6A 1U3EM 1BC7C 2O8BB 3GFIA 1W9HA 3TO7A 3U2RA 4Q5SF 4HUFA 1S5LC 5BN8A 2MG4A 4A3GJ 1OCCH 4CJEA 4XRFA 4DUZK 1U5TB 5J6XA 1TQMA 2QBYA 4CCMA 4IOAL 1R7JA 1EP4A 2B7EA 2XY7A 1VSDA 3NRVA 4XLPF 2IXSA 1V4SA 3ZCOA 1WAJA 3VQCA 1G3TA 1Z77A 4GMJB 3JRIA 2OYQA 3I4PA 2HGCA 2DA1A 1DGRM 5J40A 5I42A 1KAZA 2E88A 3AGRA 3M6GA 5GPAA 5C42A 1GXQA 3QERA 2FRHA 5LGUA 4CHOA 2HKOA 5ICCA 4CF8A 3FXKA 1B72A 2YJFA 2YNGA 3PM1A 1BL0A 3LDPA 2CV2A 4RW4A 3G4SI 3THWB 2PMZN 3JAMO 4CXFA 5GAGP 4RGSA 5FLXO 1B9DA 1X1CA 2Q31A 3NH0A 2O8FA 1IV0A 2ME6A 4LD0A 3MKZA 3H46O 3ZPLA 4RDUA 3KD1E 2HOEA 1IN7A 5LHHA 4DIQA 5FKNA 5CJ9A 3K5OA 4CGHA 4K8ZA 1R36A 2ZCWA 4PUOA 3VFZA 4C30A 3EN9A 2PYLA 3TP3A 5A2QK 3QMLA 3C2BA 3ISNC 2VWKA 5HLIA 1B9MA 2D1VA 3ABMH 4EHUA 2FBYA 4KPYA 4GKJK 3ECOA 2IT0A 4AILC 1IRGA 4MHGA 1RBVA 4KTWA 3ZT3A 3HGYA 5TRDA 1O3QA 3GTPJ 2VWJA 4EJWA 1HKCA 2H3GX 3ZX3A 5LGNA 3KTQA 3I0SA 4O55A 2G8KA 4HZFA 2WOMA 4CHZA 5M1FA 1ZBIA 3KZBA 1V5GA 1TWFJ 4A2AA 1BIBA 3TWHA 4CGZA 2AA4A 2HMIA 4AHSA 2IC3A 2UU9K 5J2MA 1SVLA 2GBYA 2BANA 4UV8A 2D5RA 3V42A 3P9IA 4DZJA 4JK8A 4FTHA 1A31A 5DTDA 4BR0A 1VI0A 3VGMA 1FX7A 3QBXA 5TKWA 1RTDA 2E5LK 1E3HA 3L6QA 4LH4A 2DMQA 2YHAA 2GXBA 2E2OA 3TI0A 1OYWA 3CO7C 1UG0A 1HR0K 4CCJA 1SEUA 2XUBA 2WONA 4IRIA 1T6CA 4NB4A 4E4HA 3A03A 2MABA 2KJCA 2EV5A 4FW2A 1VQ5I 3VQBA 2ZD1A 3JSMA 1D9FA 4LF9K 3VQ4A 1RTIA 2VBXA 1MBEA 3ITHA 3U9ZA 1HXDA 1ETOA 3AG4H 1U0JA 2V7FA 2HF3A 3DLEA 3ALYA 4BR7A 4OPJA 3LQQA 4YIFA 5JFRA 2RAEA 3IS9A 4L5IA 4BRCA 1NH3A 1XSXA 2K4JA 4BVOA 4ELUA 2E7XA 1JT6A 1YQAA 2O8CA 1KVCA 3K9JA 4WCGA 1NMDA 3LSPA 2HBJA 4BC2A 4EGYA 3A8YA 1WSFA 3M7GA 4P1WA 2Y48A 2ZMEB 3BZCA 1U9NA 4AHUA 5F08A 1XC5A 3OYFA 4OIQF 4HF1A 2HOSA 2ZXWH 1TT0A 3AVBA 4FZZA 1MJBA 3J80O 3J7YP 4IOCL 3MKLA 2Y9YA 3ISPA 1RR8C 4XL9A 3IAYA 1TT5B 4RW7A 5AQQA 2DFEA 3N4MA 3H92A 3ABKH 4WWCA 3AY9A 9ANTA 4NCBA 2R3SA 3FXMA 4JKEA 3PUBA 1XPXA 4BXFA 4AIKA 1FIAA 3ZMUA 1FMVA 4HNUA 2P5GA 3I71A 4OLBA 2VCPA 2ASOA 3VEVA 3SMPA 1U5TC 3JAMZ 4AD9A 1ZTRA 5FPEA 3CJQB 3Q5FA 4DTXA 1KLNA 3VYTB 4C1NK 3AVGA 3MX5A 3HOSA 5DM7F 5F0CA 5LBQA 4JNEA 1RT4A 1TKDA 1UHSA 2EFWA 2QCOA 5JR3A 5FB2A 4M3TA 3H36A 1X1DA 5HDKA 5LJVA 2W82A 3BOQA 2STWA 2P9LB 2KFZA 2KTQA 1IBLK 3SQ4A 2XRNA 5IP7J 5CQGA 1ZBFA 3FBIB 1TLHB 4HWIA 2P9KA 1LDJA 2NRRA 2A5YB 3DWLA 1MDMB 3V1OA 4CZZA 2E5ZA 1LJ9A 4N5SA 1R22A 4BQAA 1E4GT 2HNDA 1H1VA 5EU7A 4XLCA 3DTIA 1X4OA 3ZR8X 5BS6A 1R00A 1TC3C 2N8GA 2V26A 3M8JA 1WJAA 3PIOF 4D1QA 3EYYA 1TW2A 1MWMA 4E7HA 1JLQA 2HFHA 2QM3A 4DSEA 4CJWA 2L0KA 2BUPA 1T95A 4KHUA 4IHYA 1VQNN 2UXCK 3G25A 1E3MA 2NNYA 4AYBN 2HDCA 2BV6A 3WTXC 2HF4A 4CYCB 1H9TA 2DPUA 1WJCA 4F3OA 2O61A 3U6FA 1YTUA 4IL6C 1V55H 4C2UA 5EGOB 2GQQA 1Q18A 2BHZA 4XSXF 2VOOA 3Q3SA 3CZ6A 2JA5J 4KHQA 3WXJA 4LLLA 3JYTA 5EVZA 4Q5VA 4GO1A 4CYDA 3G6EN 3IP4B 2LTPA 2X6NA 1BR1A 3DU6A 5K5RA 1GOBA 3O3KA 3BC8A 5CYVA 4L8RB 1VQ9N 1B9NA 3HC7A 4O44A 1RTHA 1F5TA 4CFBA 5FLMJ 5H2FC 2MGQA 3GTOJ 3L2CA 1YRNB 2KZMA 1ZARA 3RR7A 4M3XA 1WGXA 3SCXA 5AQMA 3QIOA 2Q2RA 4NXNK 1TV6A 4ASNA 1FY7A 5BR9A 1WSJA 4HSRA 2K9QA 4XLHA 4FWPA 3QEXA 2VOPA 2EZLA 1HW1A 3J80Z 4EIAA 1HPMA 1QQCA 1QPMA 4P55A 1AKHA 2KQ2A 4IFVA 4A59A 1UAXA 2DMTA 2GTDA 3FZHA 1Z26A 5BOXA 3AARA 3DU5A 5DCMB 3OS0A 3R61A 4CZJA 4HV5A 3ZQIA 3OYHA 2H27A 3CMMA 3FXJA 3LDNA 2X1DA 4I01A 1RNHA 2ZMEC 2YU9J 1FOKA 1QVTA 3JRAA 4N4NB 4I7FA 1MNMC 2RDPA 3ENHA 1YW9A 4EGZA 1SAXA 2IPQX 4BWMA 1EH6A 2VI6A 3LOCA 3F8NA 3FMRA 5KPTA 4GKKK 5H1SQ 2BXZA 4A0XA 1S6LA 4AM7A 3FKJA 4M3GA 4ZH4F 3CO6C 4KTZA 3KEQA 4B3SK 2ELJA 1DPRA 4OO1J 4QTRA 3QIPA 2EQRA 4FVUA 4KT5C 4H5WA 5BN9A 4FWKA 1R6RA 4FLYA 4M6XA 4G7OF 5FKLA 2IAJA 4BVPA 4I2QA 3WODF 5ICFA 2YU3A 4R79A 2M2EA 3WHCA 2KQRA 1QE1A 1LVKA 3L2RA 4J2BA 3CCSN 4UY8I 3DJCA 2QEXN 3ZT0A 3ESWB 5TISC 3CJ9A 1HSTA 3QETA 5KHDA 2CFOA 1VQ4I 3N05A 2OPPA 3MN6A 4FL9A 5JMVA 5DM6L 3V7RA 4I76A 5EXWA 2VUMJ 4JP0A 5HS7A 2QLZA 1KFSA 2IJLA 4M9ZA 2VKVA 1LWCA 1VNDA 4DS5A 3G10A 4IG0A 1FMWA 2R5YB 2CWEA 3DTKA 2P5VA 2XY8A 2MA3A 2K5CA 1WAFA 2L02A 2KFDA 4YY3K 4GFBA 4HX7A 5E1XA 1T0FA 5EDNA 5C24A 5D8KB 3IH3A 3GG4A 2VT2A 4W5TA 4H5VA 5FJ8J 1QZZA 1T08B 3PV8A 4F92B 4XKCA 4OKKA 3HM5A 3FZLA 4CK1A 4KA4A 1N36K 2M5WA 2Q0OA 3SLCA 5FRMA 2VBYA 4NQWA 1QO0D 2UXXA 3X2QH 3V8LA 1N6QA 2YI1A 4JS5A 2P9IA 4UVCA 3QEVA 1MH3A 5J4VA 1ZBSA 4IEEA 4PJ0C 3F3XA 3NGYA 5E26A 5CZ1A 4N9HA 4BRNA 4B4CA 4HCBA 1LOTB 1FKPA 3MFKA 3WXKA 3MWMA 2LSOA 4H4OA 2HNYA 5F04A 2F5CA 1ZK8A 2DK8A 3KZYA 3HOWJ 1JKPC 2R0QC 4BQZA 4K42A 3DAWA 4BNCA 4GCVA 2I5JA 2WAQN 4C1NI 4CEBA 4UVAA 2BW3B 1UA0A 5FPDA 3F72A 1XGOA 4DQRA 1KVBA 1Z3XA 2ZKZA 4N56A 4PJLA 2F6CA 2PYJA 5KVRA 1Q8IA 1V3FA 2A61A 2Y69H 3EDPA 1S72I 2XHBA 4B9SA 1IO2A 1B9FA 2XPUA 4ANJA 1FSHA 4A5MA 2LFBA 1L3SA 5BREA 3ATVA 1H9GA 1LW2A 3A5MC 1YFHA 2VJIA 5AQOA 4O6JA 1O7LA 2DO7A 2DY4A 3ERED 1ETYA 4KIFA 3I4NJ 2FQ4A 4WQ4C 1HLVA 3ROUA 3BROA 1ONVA 3WGGA 3OIPA 5GINA 4XNFA 2DTRA 5HROA 2ZFUA 5E3NA 1YS6A 2QQAA 1HNZK 1X1PA 3ZX2A 2VODA 3GOIA 1IBMK 2XAQA 3EQLF 1OYYA 2PMUA 1ZGAA 4GDFA 4BDZA 1ZELA 3HJFA 2MC3A 1D5VA 4CECA 3WG7H 4B1RA 3NH2A 5IWAK 2Z2SB 3GO5A 3DEEA 1RBRA 1LWFA 3P4IA 3P83D 2ASMA 4Y13A 2DPDA 3MN7A 3WTWC 3FZVA 3PFYA 1QSLA 4HCCA 3I55I 1ULYA 1XI1A 2BVLA 1P92A 4LJZF 2R7QA 3MEXA 2MYSA 1NBWA 4BL0B 2DPNA 4BY7J 1QU3A 4B8CA 4G12A 2QGUA 5AQNA 3Q0VA 3S41A 4HAMA 1VQOI 3BF3A 3R0AA 1YIOA 1S1XA 2MC4A 1ZHFA 3F0CA 3OJUA 2G8UA 2MH9A 1BI4A 1UWBA 3DQVC 1F1ZA 1D1CA 3AVKA 2FEZA 2QUFA 5DD4A 4GVEA 1FPQA 1ODDA 2BY1A 3CJNA 3CC7N 4XONA 4FYDA 1SZ2A 5EG0B 1IGNA 3HL8A 1XSVA 3O1BA 4ZYEA 2HTJA 2RVCA 1I1GA 3E9PA 4UUSA 1UB9A 2LRDA 4H0EA 4E1MA 2M87A 3VMFB 2QA4N 2UXBK 2ZJRF 1D3YA 1V4TA 4AM3A 4LFBK 4ISGA 3UB5A 5E17F 4A0ZA 3BLYA 2NRHA 3DLAA 4CZHA 4LIVA 2WTUA 3L2UA 3CXCM 3BG7A 3L00A 1HNVA 2CQ7A 2G8VA 2V1NA 3CETA 3K5LA 4JI3K 3V9WA 1ZH5A 4A3LJ 3I8BA 4FWMA 3HM8A 1JKQC 4XLEA 5KCMA 3E97A 2XKOA 2OZ6A 2AQEA 1RETA 1GLEG 3KP4A 3E7LA 2LG4A 1F9NA 1A04A 3WE3A 3QESA 3GL1A 3T7ZA 1NGFA 1K6OA 1Z25A 3PO2J 3SYZA 3FXQA 1BQNA 2VXZA 3S2DJ 3TR8A 3NDKA 1C0UA 3AAFA 5D4RA 2O8FB 2OCEA 3C95A 4N76A 1KVAA 4CZFA 2LF8A 4A57A 3BZKA 2E34A 2JLEA 1TNSA 3TO9A 4KB1A 5BRHA 5KQDA 1GUUA 3PQJA 4DZPA 3RZDJ 2DTZA 3RI4A 5CR4A 1R1UA 1XNQK 4O5BA 2BY2A 2RN2A 2E2QA 3CQ8A 1QNTA 5M5YJ 1XCVA 3KYCB 3LSMA 3VF2A 2Y31A 1JCEA 3SV4A 4FPAA 4FT8A 2PBIA 1YIJI 4XK4A 4WQ5C 4BRIA 3LWMA 2LSNA 1ORKA 4W5NA 2Z1JA 4RBOA 3A5LC 3E3VA 1N77A 3G4SN 3B02A 4NLCA 2E19A 2M4GA 4YELA 4LOCA 5I3UA 2DN0A 1BI1A 3CHWA 3OTOK 3BG3A 2KJBA 2HPMA 1NHAA 2OAZA 3QQAA 3TSQA 3CFOA 4ILJA 3WT0A 5DMRA 2P9NB 1UHWA 2G9WA 3QLHA 5M3FJ 4ZDLA 1HJOA 2DMPA 4WFNL 2ETHA 2ESNA 1YS7A 3I0TA 4LK1F 3J7AO 5J47A 2VYPA 2R7UA 4CERA 1BW5A 1H89C 4O3MA 3JXUA 3TQNA 4AM6A 1S22A 1FJGK 1W36D 2ZXJA 5CVRA 5GAHP 2D4WA 2KLAA 3CQYA 3WG9A 5EZGA 1KA8A 4IHWA 5M1OA 3BR5A 4PGHA 2FNPA 2WC2A 4PSXA 3KP6A 1SC7A 4YG2F 1WJEA 3WU2C 2V9PA 1I27A 1UELB 4UY8O 2F9WA 2HPIA 1JKRC 1DGWY 1DGKN 1JI8A 4HQMA 1I5ZA 4R8HA 3CCVI 1X9MA 3WU0A 2L7KA 2A6EF 4FOEA 5BR8K 3LQRA 4B1XB 2V1UA 4Y52J 1Q86O 5HS9A 1BI0A 1D8YA 2O8CB 5DDGA 2IGKA 2JT1A 3H08A 3WXMB 3M8SA 3AG2H 1KQSM 1HKGA 2NOJB 1Z9CA 3O08A 2OQRA 3T1BA 1G2HA 1W97L 1SD5A 4LF6K 4NYFA 2CMPA 4CE9A 1NWKA 4CZLA 1HNIA 3CCYA 4DV1K 3EL2A 5AZIA 2KP6A 3K1PA 1F4KA 3MX2A 1MWKA 4OINF 2O8EA 1H8AC 1NLVA 1VQ5N 3N4PA 2HBKA 4IOAF 3ZXSA 2GUIA 3C7JA 3VB2A 3K4MA 3E9OA 3O8HA 2ID3A 2IOCA 3EPZA 4BR5A 3L9FA 1K7AA 2O8XA 3HOXJ 4AVPA 2BY0A 2KIMA 3V1QA 5AQLA 3DXKB 4AF1A 3ZSQA 2DK5A 1FBUA 3HYIA 2QSFX 2W48A 3U8XA 4NCAA 2XAHA 1REPC 2A07F 3AVMA 3CQZJ 2V1XA 2WFBA 1NK3P 3R3LA 4KAZA 3LNQA 4CEZA 5E18F 2GWJA 2D0PA 3MMVA 3R60A 5E20A 2OANA 4CJKA 2QWPA 4OMYA 1HPZA 4M74A 3L2VA 1R5ID 3VA0A 3JR9A 1LQ1A 4Z4IA 3RVCA 3RYPA 3HTVA 4A3DJ 3DBHB 4BXUA 2Q97A 3OYAA 4C8NA 4RMNA 3VEZA 2G8WA 1WJFA 2Z1GA 1USSA 1MJAA 1CZ9A 4IHXA 4NC6A 3SFZA 1J5OA 4LF8K 4RW8A 3ML6A 4B9UA 3UIQA 3THXA 4MQVA 3O6WA 1G3SA 2NUBA 4AC0A 1VSIA 1QRYA 3VGLA 4DTMA 3G71I 3P31A 1SD4A 3F5TA 1KCFA 4DHYA 3ZMDA 2DTUA 1S1UA 1JUPA 1O4XA 2O03A 1NG9A 3CDLA 4W97A 1J5YA 2ID6A 1OCRH 1OLTA 3BEXA 2CGPA 3PX6A 4W5OA 3CCRI 3FFIA 2QKLB 1F21A 1TW3A 4XN0A 4DR4K 2KT0A 2LREA 4Y1DA 2HW3A 3C6UA 5J3LA 3RRHA 3BR1A 1BOBA 2EK5A 1LE8B 2JRMA 3SUQA 1A5VA 4QS8A 2FF6A 1MGTA 2IEKA 4OKEA 1XHZA 3ZGKA 2XV4S 3AL0B 1LFUP 3AO5A 3ZQCA 4FHTA 4K43A 5K5QA 2QKKA 4I7HA 3FBNB 1GDTA 3KLOA 3F9MA 1SMTA 4DQPA 4RLFA 1VQ6I 5B1AH 2GOMA 1C6VA 1RT3A 2YKNA 2M34A 1DT9A 3GFMA 2A05A 4CJ7A 1HUXA 2JPCA 3FX3A 1NOZA 1FP1D 2ADUA 1C1AA 5HDNA 2BTFA 2A6AA 1YJNI 3GTLJ 3PNVA 1MA9B 3T5XA 3VQ9A 1EXQA 3IKVA 3K70C 4JI0K 2PY5A 3GW2A 3WUHA 4LF4K 4BKXA 2A40A 2F5EA 1U2VB 4KREA 2L9NA 2QQBA 2E1CA 3ZMZA 1NK8A 2IGOA 1EWRA 3LFUA 4WE1A 3HZJA 4O0JA 1JGSA 1GLNA 2IP2A 4M63C 3OYGA 4JLHA 3OSGA 2DFIA 1Q1VA 4UHTA 2EZHA 4XRSA 3A01A 3NF9A 1RDDA 2QK9A 3ULDA 2LC2A 4DCHA 2JTVA 4A3IJ 1GVJA 3EUHA 5HLTA 1VQ7I 1ZC6A 4U7BA 4H5NA 4BJTA 2DFHA 2LVSA 1NG7A 4KTQA 2XAGA 4DNCA 3P9KA 4AHTA 1SS6A 3NEUA 3KETA 4BRFA 5KAIC 3ENBA 3M5RA 3SJHA 2RGVA 4JAXA 4XEIA 4RGUA 5KGXA 1MBGA 4CICA 3A5NC 3EYZA 2H1LA 4G94A 4I0BA 4MEYF 1G3WA 3TAPA 4IOCF 4LB6B 3OVNA 4JX4A 3REOA 4CIGA 3CD6I 2HSTA 3GE1A 4O5VA 3COAC 4X1EA 1IW7F 2ZWHA 3NFAA 1W7PA 4XICA 4QWQA 5H6RA 2FBTA 1XX5A 2HZDA 4KV8A 2DBBA 2VB6A 4I6MA 5CVUA 2UUZA 4FZXC 2BVMA 3S2WA 4HEA2 4HX8A 3KZZA 4GYIA 4F8RA 3BTCA 1OH6A 1JLGA 2WADA 3I3LA 3T8RA 2XASA 2YS9A 2GBZA 2YNHA 3OYDA 3OL3A 5LL6Z 2GIVA 2J5PA 4R1HA 4FQGA 2W41A 2L3DA 3S16J 3GWZA 2EFNA 4GVMA 2Y0SN 4YOXA 3TGNA 2IVNA 1EETA 5ERIA 3ABUA 4HQEA 1T8IA 3BY6A 3FE1A 2RV8A 2OTJI 2ME0A 3SDBA 2COMA 3CJ7A 4Z4EA 4F3QA 4P9FA 1MMNA 4AWXB 1UJ8A 1WJ5A 1FYKA 3OW2M 2IW5A 4L3QA 4JI5K 4RAFA 4D0PA 4MLEA 1Y8RB 2D0OA 1ASVA 4BUPA 1R58A 2W7NA 2WTEA 1ITGA 5LMNK 2PEXA 2LD5A 3RSEA 1IXSB 3EKUA 2RNGA 3KK1A 4AHRA 3IWZA 3VOEA 5GIOA 4AIJA 3OV8A 1EH8A 3FISA 4FLTA 1U45A 1YLFA 3K2PA 2XROA 3EEQA 4RG8A 3M8RA 1D0ZA 2O4IA 2EBIA 2P7CB 3SPYA 3ZMSA 5HRSA 1T38A 2O8KA 4X6AJ 5F1RA 3QOPA 2GIZA 3U9GA 3ID8A 4M7XA 2P5LC 2DODA 2DOAA 3BR2A 1NGBA 2HXOA 4E70A 2EHGA 3KWIA 3VF4A 1XGSA 3K4NA 1Q7YO 3OIQA 4EJTA 4FJMA 3R8EA 1VQ4N 3B6PA 2QVOA 2CGKA 1O3TA 2P9IB 3DMJA 3AL0C 1X3MA 5I9EB 1Z91A 2EZIA 3THVA 4FXDA 4LH5A 4NDLA 2UUAK 2KLOA 3IMXA 5F0HA 2K7LA 1GLAG 2HS5A 4BREA 1DPUA 3KLIA 3VYSB 2EWNA 3BQYA 3NCIA 3SFIA 2PFUA 3H0GJ 1S6QA 1ZBHA 2P8TA 3PX4A 1A36A 1UFMA 1QSYA 2K9MA 3DFGA 2E4LA 2P9SB 1IRFA 1N5YA 3R6SA 3VQAA 2Q2EB 5AIPA 2L2OA 1BA0A 1OVQA 2XIGA 4G6QA 3FK6A 1XD7A 4BDYA 3KPHA 4LLNA 4B1ZA 1ERDA 2PLYA 5B5EC 3HSTB 5KRSA 4ESBA 4DTOA 4BHPA 2XDVA 3K10A 5KNLA 1RR7A 4RAYA 4OPKA 1K78B 4FJXA 4YDUA 4LK0F 4NHJA 2Z9OA 4NCGA 2EB7A 2M8EA 5D3GA 3O9UA 4A3JJ 3EZWA 4HA8A 5JICA 1MNEA 4KN4X 4JKGA 5HBMA 3M3ZA 1TZLA 2ECCA 3J7ZI 3LAJA 1KQ8A 1YTYA 3OYBA 4PZJA 3ABLH 1JLEA 3K58A 3JRDA 3AA3A 2L9SA 4G9YA 5F64A 2NVUB 1WI3A 4PL7A 4ELTA 3HIFA 3HRGA 1CQTA 1CGPA 1IDZA 2D1KA 3LALA 3PFIA 3BGRA 2E20A 1HCRA 2Z3YA 1NKBA 3KEOA 2MLGA 4YHHK 4GV3A 5AQGA 3RJPA 5BQTA 5EJCA 3D6RA 3S3NA 4PJMA 4DQ8A 1R5GA 1VSMA 4F93B 4O8UA 4R5PA 3C2GA 1EWQA 4TSXA 4A12A 4K25A 1S72N 1HX1A 4CGFA 4FJ8A 4D5CA 3BG6A 4XMYA 1B4AA 4FASD 2DAOA 3ZQ7A 2HTSA 4I9LA 3CQXA 1O13A 2P81A 2O7OA 5AQRA 1R71A 5IT9O 4RB1A 4CDGA 3DTEA 5HDGA 4PHTX 3WTZA 1XGMA 2YX7A 4ZZLA 4IO9L 4RWTA 5C25A 2FBHA 1BI4B 1U48A 4B8XA 2NZTA 2P1JA 4DV3K 3GLXA 2FBIA 3MEGA 3C7NA 1XDSA 1ZGJA 2E35A 2KDZA 5DM6F 5GAEJ 1WBDA 4KICA 1HA8A 1FT9A 3MCPA 4WFAL 1JCFA 2MSYA 3TAQA 4HSTA 3DPLC 1CF7A 3R1XA 5HLGA 3I55N 5M1KA 4M3DA 1T98A 3K4LA 1QQNA 2D45A 2ZSIB 1ATSA 3K1NA 1RFQA 3SNNA 3MZHA 3KLHA 4U87A 3AVLA 2GXAA 2X0LA 3HRMA 4CK3A 1ZAOA 5EOYA 2G7HA 1VQON 3HP6A 3FHZA 2PBDA 4XH1A 4CGIA 3Q0UA 3AO4A 3E1SA 2HZTA 4A62A 4U0WA 1IG8A 5CE3A 4M3EA 4XSZF 1OR7C 1NKCA 4EFHA 2IS1A 4BEHB 3L0QA 4AIHA 2L01A 2ZBKA 4ZDOA 3AVHA 3H9GA 3PO3J 3TOBA 3S1RJ 1NGCA 2R5ZA 2VG6A 2VKEA 2IRFG 3SZGA 1CXQA 5C15A 4FWSA 1O3RA 3AAPA 1QHGA 3HUGA 4PWDA 2I7NA 4YIRX 3TAGA 3K59A 4BQLA 2XGCA 2YPRA 3CCMI 4A93J 1FLIA 1M90O 4EZ9A 1Q1HA 4FM0A 4PK4A 3CFRA 4KH5A 4OGCA 4QS7A 4M3FA 2DXIA 3LDLA 3QYEA 2F4OB 3FF5A 1RRJA 3IRXA 4DF8A 4B3MK 1T3VA 2UWMA 3HBTA 4LG0A 1K4SA 3DOLA 2OPRA 4B47A 5HVQC 3HDDA 4DOZA 4OOIA 4QPOA 3FXRA 2E2JJ 1E3OC 3DOKA 5M5WJ 2DJNA 3BQZA 1ZLKA 1H88C 3V6DA 4BY9C 4B9NA 3LSKA 3DLHA 2BHYA 1Q82O 1QBJA 1RDUA 2L5QA 2XF6A 3ZOBA 2VE9A 3S17J 2IA1A 1N34K 4BDPA 5J1UA 5J4YA 2O9LA 3JTGA 1DUXC 2P7VB 1EKEA 5KK1A 3M07A 1NOYA 2DA5A 3DLLF 5B8HA 2LH9A 3THYA 4B1VA 2H6CA 1YIJN 2Z1HA 2H8RA 1FW6A 3TAMA 2ECBA 1D0XA 1JLFA 4CHNA 2FBKA 1ZN2A 2JA6J 5D8LB 3MZ8A 3PJRA 5L3DA 2EFQA 2DA2A 3BTIA 4DYRA 1NJYA 3OIOA 3J8AA 3TP0A 1K4TA 1T2KA 4HRIA 3AFHA 4DTNA 2LKSA 3H9JA 5IT9Z 2HHTA 2ACJA 2QWOA 4X66K 4Y3OA 2M0MA 4DB3A 4KBOA 4LY7A 1QZ6A 4XKVA 4U0VA 3FMQA 1NGDA 3H1VX 2M7AA 2R93J 1YAGA 3I58A 1ZKGA 1N8RO 3K0SA 3W6JB 4MLOA 1NGEA 1K6YA 2ZNYA 3VPRA 4BH9A 5JVTA 1T44A 5D5XB 3F23A 4TV7A 2L54A 5C2DA 3QEWA 1DQUA 2VC1A 4NYNA 5L3GA 4A6DA 2FOKA 3MXJA 4EM2A 4J2DA 3MECA 1D0YA 4BJ6C 4BHBA 1NTCA 1BUPA 4QCLA 2HU9A 4NNJA 1FBQA 2OZMA 5LHGA 3S93A 2E8AA 3SBTA 3JRCA 2BYVE 4UQGA 2QYOA 3CCVN 2IDOA 4JHDB 2V79A 3IAM2 1YX3A 3V9UA 3M9AA 1RGIA 3DYAA 5IYCJ 3MCZA 4U67L 3S8PA 5LD2C 3A4CA 5BPMA 1R49A 2DOFA 2MFZA 2IS3A 4A61A 4W5RA 1GLDG 3IUOA 3WTTC 2P4WA 1FEXA 4HOBA 1I6XA 5GAGJ 1HKTA 1EH7A 2K02A 4KN7X 4ZTFA 1RT7A 3CYMA 5JHFA 4YNQA 1HQEA 4YIIA 4BYYA 1K61A 3ZSXA 4DTUA 1X3UA 4LF5K 3GVAA 3D1NI 2ISZA 2IS6A 3W6VA 3SEZA 2Q3SA 3H5NA 2O8BA 1WVRA 3KFWX 1K79A 4FLUA 1CXUA 1R23A 3HRUA 2RF2A 2W57A 3RKWA 2C6YA 1BIAA 3LWFA 2E36A 2JUGA 1U5TA 4BRDA 3IH4A 3ZN0A 2HHXA 2YR2A 2GELA 3PY8A 2HHWA 4XRMA 4Q47A 4XBFA 1B8IB 4C8LA 2KRFA 3OBYA 1RESA 3SUNA 2K3FA 2WY8Q 1U4BA 4XH4A 1S1TA 2XAFA 5IOYA 5GTHC 1SD6A 1C0WA
chains in the Genus database with same CATH topology
3DQVC 4OJRA 1WSGA 2X85A 3NF7A 1D1CA 4CESA 3AVKA 2XAUA 1TKZA 1SAUA 3G2BA 1TK0A 1G59A 4YRVA 4XONA 3FDYA 4FYDA 3SZ2A 5JS1A 3NBPA 3HL8A 1AA7A 3EY1A 4KITB 2VLAA 1FKOA 3HPHA 4FLZA 4CJRA 1RBSA 2QKMB 4M3RA 1JLAA 2LRDA 4E1MA 2DT6A 3ZRGA 1BCOA 3T19A 3CP8A