3HPHA

Closed tetramer of visna virus integrase (residues 1-219) in complex with ledgf ibd
Total Genus 64
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
64
sequence length
210
structure length
194
Chain Sequence
NIPLAEEEHNKWHQDAVSLHLEFGIPRTAAEDIVQQCDVCIDHWQVDYTHYEDKIILVWVETNSGLIYAERVKGETGQEFRVQTMKWYAMFAPKSLQSDNGPAFVAESTQLLMKYLGIEHTTGIPWNPQSQALVERTHQTLKNTLEKLIPMFNAFESALAGTLITLNIKRKGGLGTSPMDIFIFNKEQQRIQQQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural basis for functional tetramerization of lentiviral integrase
pubmed doi rcsb
source organism Maedi visna virus
molecule tags Transferase
molecule keywords Integrase
total genus 64
structure length 194
sequence length 210
chains with identical sequence B, C, D
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2009-06-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00665 rve Integrase core domain
A PF02022 Integrase_Zn Integrase Zinc binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.200 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Arc Repressor Mutant, subunit A 3hphA01
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 3hphA02
1B92A 3SQ2A 4FZZA 3LWMA 3SV3A 4DTJA 2OZMA 3AA2A 3LAMA 1MU2A 1QQCA 1C0UA 2WONA 4CJTA 3NDKA 1SL1A 2G8WA 2HHWA 3WNFA 1RBTA 2G8HA 4W5NA 4E7LA 4BWMA 4KTQA 1JL2A 1ASVA 1WAFA 1YTAA 2OPRA 3KLEA 3M8SA 4E7KA 3RWUA 4J2BA 4OPJA 5FROA 4KB0A 4ZTFA 4KPYA 4I9LA 4TSXA 1JLCA 2P51A 3BGRA 4CJFA 1ZBUA 1JLAA 4KTZA 4EP4A 5I3UA 3VQQA 3WNHA 4CJ5A 1HJRA 5EU7A 3OYCA 1QSSA 4OKEA 1X9MA 2HHVA 1NK6A 3C6TA 3L3VA 1VRTA 5FDLA 5SWMA 3TABA 2HHXA 1UWBA 1RT1A 5DMRA 3DLHA 3MXJA 4CF0A 4E7JA 1IO2A 3SQ0A 1GOAA 4Q5VA 2QKKA 2HHUA 3ZT1A 4DF8A 4CJWA 3V9SA 3SQ1A 4EZ9A 5KI6A 4DTOA 3S3NA 1HPZA 4FLZA 4KRFA 3MXMA 1BL3A 2F96A 3HP9A 4N5SA 3RTVA 2ETJA 4M3WA 1XWLA 4CJPA 1CXQA 2X6NA 1VK0A 3OVNA 1L3SA 1EETA 3KLHA 1D8YA 4NYFA 4CEQA 1KVCA 5CYMA 4CJRA 4Z0UA 2FC0A 4HUGA 2KZZA 3DRSA 2DY4A 1RTHA 1KFDA 4CESA 4KFBA 5K14A 1BI4B 3QNOA 1HQEA 4DQSA 3C6UA 4Z4GA 4BWJA 4O0JA 1WSGA 3SUPA 2D5RA 1UAXA 1ZBHA 4CEBA 1VSLA 3VQ9A 1ZBIA 4KREA 1RT2A 2FBTA 3NAEA 4BE1A 3AVJA 3ZSYA 4DTPA 3SNNA 4O44A 4M41A 4CEFA 1LW0A 3K5OA 4AHTA 3B6PA 3EYZA 3JYTA 1E0EA 1UA0A 1L3VA 2KTQA 4DLEA 3RR8A 3EY1A 5J2QA 3QESA 1RCHA 1VSDA 2VG5A 3AO4A 3TARA 5HP1A 3DRPA 4JRPA 1R0AA 1S1TA 5HBMA 1QSLA 3CFPA 2JLEA 4GW6A 4EZ6A 1TGOA 3MEDA 4H8KA 3SYZA 2D0CA 3TAMA 4I7FA 3U3GA 3QEIA 4KB1A 2BANA 3L2UA 4OGCA 1CLQA 3O3FA 2DFEA 4CE9A 3CFOA 3BDPA 3IAYA 4E7IA 3PX4A 3WNGA 5J1EA 4O0IA 3CG7A 1C0TA 4AHCA 1BQMA 4AHVA 3C94A 4CGHA 3NGIA 1TK5A 4C8LA 4N76A 4DS4A 3U3YA 3QINA 3D0PA 4B9SA 1TKXA 1WSFA 1LAVA 1RILA 2KFNA 3HPGA 4O55A 1CXUA 4YFUA 4QAGA 3U6FA 3DRRA 3LDSA 2FBVA 2Q3SA 3VQEA 1X1PA 3QETA 3MEGA 1RDAA 4F2RA 2FBXA 3KK3A 4J2DA 3K59A 1ZBFA 1XHXA 3VA3A 4CJUA 5CZ1A 3OS1A 3PY8A 1TV6A 5KGWA 1GOCA 4UQGA 4CJSA 2Z1GA 4CEZA 4FJ8A 4F3QA 1Q9YA 1TVRA 1TK0A 1EP4A 4LH5A 3V1OA 3VQ8A 2XY7A 1D9FA 1YTUA 1JKHA 4KI6A 4H4OA 1NK0A 1W9HA 3NF7A 4CIGA 3HVTA 2DTUA 4PWDA 1T7PA 4KAZA 1IKXA 2JGUA 1DLOA 3TAFA 4FJXA 4FJKA 1MW7A 4PA1A 3V9XA 1U04A 4N41A 4KI4A 1Q8IA 4FLYA 2LSNA 4B9TA 1SKRA 1NK7A 1C1BA 2HHQA 4FXDA 2HNYA 3P83D 5CZ2A 4M3ZA 4Q0BA 4KTWA 3NCIA 1NJWA 3QIOA 3QLHA 4ICLA 1RTDA 4KHWA 2GUIA 1TKDA 1N5YA 3ZT3A 3CYMA 4M3RA 4J2EA 1T05A 4HTUA 3ZT0A 3SUNA 1WJAA 3RRGA 1KFSA 1RBSA 1EKEA 1WJBA 1WN7A 3OYIA 3SZ2A 4FJJA 4DTXA 4DQQA 2RPIA 3SPYA 3K5LA 4I2QA 4FK2A 1VSMA 1NKEA 4LY7A 3LP3A 1HRHA 4B3OA 3AA4A 3TWHA 3RMAA 4DWIA 4CJKA 5HRNA 4F2SA 1F21A 1S9EA 4N47A 3ZSQA 1LFPA 2VG6A 4CJ4A 1BQNA 3L2VA 4FJ9A 1TAQA 3CM6A 3OS2A 1KCFA 4FZXC 1JLFA 1D5AA 2YHBA 3V9WA 1WAJA 1J53A 1RDCA 3QEWA 4BDZA 1T8EA 1VSKA 3NF8A 4E7HA 3AV9A 1KVBA 2XRIA 4GMJB 1KLMA 3ZSVA 2W42A 3ALYA 1SV5A 4OPKA 4LSNA 3DOLA 2HNZA 3ZT2A 3NHGA 1A5XA 1RT5A 2A1SA 3DLRA 3QEVA 3OS0A 3AVMA 5E41A 2Z1HA 4F4KA 3ZSRA 4B9MA 1A5VA 1REVA 2Z1JA 4CCHA 3EZ5A 3OYGA 3LP1A 3KJVA 4DQPA 4CHZA 1QTMA 2PYJA 4CK1A 4E1MA 4FM2A 2KFZA 4I2PA 2ZQBA 3RMCA 2B4JA 4M42A 4M3UA 3KD5E 3SCXA 3VA0A 2G8KA 3QIPA 1L5UA 4CFBA 3VQAA 3K2PA 4FLTA 1SL0A 2ZD1A 3KKSA 3O3HA 3PX6A 2GV9A 3B6OA 3NGZA 3HPOA 4ELVA 1CZ9A 4KHQA 1WNSA 2YNHA 3HVRA 4OKKA 1S5JA 3HM9A 4DSJA 3HJFA 1RBVA 3L2RA 1ASUA 4L8RB 5D3GA 3HK2A 4B08A 2BE2A 1TKTA 5JS2A 5J2NA 1J5OA 1S1WA 2IC3A 4DTSA 3DLEA 4FK0A 3AVAA 3OYKA 2Z1IA 4Y1CA 3LP0A 4CF1A 1QSYA 2IOCA 2O4GA 3K5MA 3VQBA 3PX0A 4BDYA 2QKBA 3G10A 3AVGA 1QE1A 4CJEA 3DLBA 2BGGA 4FLXA 3M8PA 3AO5A 4NCGA 4CGIA 1TKZA 4CHYA 4E3SA 1W0HA 4IFVA 3RR7A 4BDPA 4E19A 2OPPA 4QCLA 3ULDA 1K6YA 3AO3A 4WE1A 4BE0A 2HMIA 4B9NA 3OYMA 3AVLA 1YVUA 2OPSA 4DS5A 2A1RA 5J2PA 3THVA 2I5JA 3HSTB 3QO9A 3OYEA 1NK5A 1NK4A 4DU4A 3DLGA 4AHUA 3MEEA 1BHLA 1JLQA 2KZMA 3D45A 2PYLA 1FKPA 2EX3A 2OPQA 3OYLA 2RF2A 3V1QA 4CECA 3LZJA 3I0RA 1RT7A 4FLVA 1CZBA 1DTTA 4IDKA 3NF6A 3OY9A 1BIZA 3CFRA 4DTUA 4RW6A 4CGFA 3QEPA 1HNVA 1SUQA 1J54A 3K57A 4CEDA 3K5NA 2E6LA 2D0BA 3NH2A 1BCMA 4CFDA 5KRTA 3NBPA 1NKBA 1WLJA 2EHGA 1VSIA 3AVKA 3G0ZA 1NK9A 3KLGA 1ITGA 3V1RA 4CEOA 5FRMA 2RKIA 5C42A 1TAUA 1XHZA 3VQ5A 4CIEA 4C8MA 1UA1A 4ELTA 3RMBA 2DFFA 3HO1A 3KD1E 2VG7A 1Q9XA 3AO1A 1J9AA 4EP5A 1WJCA 1C1CA 2KW4A 1I39A 3VQ4A 1RT6A 4O5BA 3LWLA 3F73A 1KONA 3TANA 5JS1A 4E0DA 1WJDA 3OJSA 1X9SA 1WSEA 1RTIA 1WSJA 4BE2A 4OKJA 4B8AB 4DSEA 3ZSZA 2G8IA 5T7BA 1TL1A 3HYFA 4CF8A 5KTQA 3AA3A 3L2WA 1KTQA 1TL3A 1RT3A 5HRSA 2QK9A 1HYSA 2AJQA 1C6VA 1LV5A 4RG8A 4PUOA 4O4GA 3IRXA 4Z4IA 1LWCA 4FLWA 4JRQA 2HNDA 4CGDA 2HHTA 2HHSA 3T19A 4M3TA 4N56A 3T3FA 2F8SA 4MFBA 1RBRA 2IGIA 1Z25A 5CY4A 3L8BA 4FM0A 1RNHA 4IBNA 1NK8A 4CGGA 4OLAA 1ZBLA 3TAQA 2YHAA 4AHSA 2DFHA 2YKMA 1L3UA 4FYDA 3SUOA 3OYNA 4HVJA 4CK3A 3O3GA 1ASWA 4DSKA 4NCBA 3HPHA 4IG3A 2R7YA 3OYHA 4FCYA 1B9FA 3MXIA 2PY5A 4ID5A 2VWJA 2O4IA 1BGXT 1IKWA 1RTJA 2ITGA 3VQ6A 1I3AA 3E01A 4DQIA 2X6SA 1NJYA 1S1UA 4CHNA 4DQRA 2XY6A 1SKWA 3NGYA 1LAWA 4OJRA 2XY5A 3HXMA 1KSPA 1KRPA 4Z4EA 4B9LA 2QXFA 1EX4A 3ASMA 3VQPA 3NH0A 1U49A 3KTQA 3IG1A 2FBYA 1B9DA 3QEXA 3SQ4A 4DFMA 3SPZA 4F3TA 4PY5A 3DMJA 3HT3A 5DK5A 3AVFA 4CF9A 4CJQA 3VQCA 3P5JA 4C8NA 2Y1IA 3VQDA 1DTQA 4FW1A 4Z4HA 4R5PA 3NH1A 3OYJA 3S9HA 3S3MA 4ZTJA 4KHSA 4RW4A 3LALA 3LZIA 2G8FA 1IKVA 1IG9A 4E1NA 3DI6A 3HP6A 2HVIA 2X78A 4DF4A 3SJJA 1YT3A 3T1AA 4HUEA 1GOBA 4FJHA 4DSFA 3ITHA 4RW8A 1NOYA 1WSIA 4FJ5A 4FM1A 4FJNA 4PQUA 4CJ3A 3RMDA 4DLGA 3FFIA 2HVHA 3OYAA 3QERA 4Z4FA 3UIQA 1FXXA 1G15A 1QHTA 5HRRA 2YV0X 3MAQA 1NJZA 3I0SA 4KHYA 3NF9A 2D0AA 2G8UA 3KIOA 5C25A 4CF2A 1XC9A 3LANA 3WNEA 3KK2A 3TAPA 1HMVA 1U45A 1NJXA 4DG1A 4ELUA 4MQ3A 4FJ7A 5SZTA 3JSMA 3TI0A 1O1WA 3KLIA 1S1XA 3KK1A 4I9QA 3AVNA 4DTRA 1IKYA 2RN2A 4LD0A 2P5GA 2WOMA 3DM2A 3H08A 2HB5A 4NYNA 3ZT4A 4FLUA 1HQUA 4K8ZA 1KVAA 4M3XA 3V6DA 1S1VA 2XO7A 4DU1A 5J2MA 4CIFA 2KQ2A 1RDDA 4FJLA 4DSIA 4DU3A 2BDPA 2YNFA 4FVMA 1VSJA 3LPTA 4Z4CA 3CQ8A 1D9DA 4CEAA 4DTMA 4KHNA 1NOZA 4RW9A 2YKNA 2G8VA 4FW2A 2P1JA 4AH9A 2B5JA 3LAKA 1Z26A 3KLFA 3I8DA 3LP2A 4KKOA 4KV8A 4CFCA 3OYBA 3PO4A 4KHUA 2VWKA 3AVBA 4BACA 3ZSOA 4DSLA 5KRSA 1HYZA 3ZSXA 1BI4A 3OYDA 4ID1A 1JLGA 4NCAA 3V9UA 3QNNA 2IS3A 2OZSA 1FK9A 3K58A 5FRNA 1JXEA 3SUQA 2XHBA 1S6QA 1TK8A 4C8OA 4G1QA 4FJMA 2ZE2A 3F9KA 3AVIA 4CEEA 3PV8A 4IG0A 1JLBA 4E89A 3PO5A 4KO0A 4DMNA 4CJVA 1VSHA 3SI6A 2X74A 4B9VA 3SV4A 3M8QA 4RW7A 2OA8A 5HROA 1FKOA 2OYQA 5C24A 4F8RA 4IFYA 1U4BA 3PUFA 1BIUA 1HYVA 4K8XA 1JXBA 4FZYA 4IKFA 2P5OA 1C0MA 3MECA 3L2QA 4CHPA 5KGXA 4HHTA 3AVCA 2IDOA 4J2AA 3V9ZA 5HLFA 4ZHRA 3P1GA 1ZYQA 1WJEA 1RT4A 5CYQA 2YNIA 3A2FA 3TAGA 4B9UA 1LWFA 2F8TA 3ZCMA 4OLBA 2NUBA 1RBUA 4JS4A 1Y97A 4HUFA 1U48A 1X9WA 1L3TA 4B8CA 1SL2A 1KLNA 1WSHA 3VN5A 4W5OA 1IH7A 3AA5X 3L3UA 3VQ7A 2Y1JA 2E4LA 3O4QA 3LPUA 4CGJA 4QOZB 1VRUA 4CK2A 3C95A 4DFKA 4FJGA 4HCBA 2B6AA 4OGEA 4JLHA 1T03A 4DFPA 1XI1A 3DLKA 4CHOA 4GVMA 4AHRA 3AO2A 4YNQA 4HCCA 3OYFA 3KKRA 4CFAA 4F3OA 3M8RA 5I42A 4DTNA 1S9GA 3S3OA 1A5WA 3NFAA 3HL8A 3CM5A 3O4NA 1WJFA 1SKSA 4FK4A 2ATQA 2GBZA 1UOCA 2IAJA 1VSEA 2PZSA 4W5TA 3TR8A 3IS9A 2E6MA 4H4MA 3V4IA 3ISNC 3DYAA 4LSLA 4FJIA 1BISA 3ZSWA 1VSFA 3DOKA 4CERA 1HNIA 1LW2A 3AVHA 1NKCA 1JLEA 5HRPA 4OVLA 3NE6A 4M3YA 1C1AA 3RRHA 4W5QA 4XIUA 1RDBA 3OJUA 4CHQA 4JS5A 2XY8A 1S6PA 1U47A 4DFJA 4AILC 2YNGA 1JL1A 1EXQA 2HW3A 4LH4A 4CJLA 3TAEA 1BCOA 1QS4A 3V81A 4Y1DA 4C8KA 1LWEA 4W5RA 4M45A 1N6QA
chains in the Genus database with same CATH superfamily
3DBLB 3Q9SA 3UB5A 1M90O 3LWMA 9ANTA 1X3NA 3SV3A 3FMRA 5CVIA 1UB9A 2G8WA 4PL8A 5FPMA 2HHWA 3I64A 3WNFA 1PDNC 3RJPA 4Z94A 3ZMUA 1VQ9I 2BE5F 4B48A 2G8FA 2QTDA 1JL2A 2OPRA 1WAFA 3JAMO 3IRQA 4J2BA 3DEWA 1D0YA 2OCCH 2VKDA 5DM6L 4KPYA 3F2KA 3DTIA 3ASOH 5M5WJ 2COBA 1YJ9I 2OANA 4CZCA 2P5LC 2E35A 4JI2K 2ZNYA 3PSIA 5I3UA 3OYCA 4CJ5A 3CCQI 1HJRA 4ENMA 3KP6A 3ABTA 3HOTA 2HHVA 4L5JA 1L3LA 2FX0A 3J7AY 3E6MA 4N4NB 4BRKA 4UVCA 2X4HA 3DLAA 5LMNK 2R4GA 2AA4A 4JKBA 3MXJA 3C2HA 1GOAA 3K9JA 3ULEB 2DMUA 1XS9A 2NVXJ 1YJWN 3O9RA 4DF8A 3WODF 5GADJ 4EZ9A 5J8FA 3GCMA 5E84A 5J3LA 4ILHA 1TZLA 1BL3A 3MXMA 4S0HB 3WTUC 4N5SA 4CJPA 1CXQA 3OVNA 4BBRJ 3CPEA 4JKGA 3KLHA 4NYFA 3HRMA 4CEQA 3O80A 4HA8A 4EATA 3DRSA 2ISZA 4X66K 3LSKA 3FHZA 1NGFA 3TKYA 4BJ5C 2RGVA 3J8AA 3VYTB 1UAAA 2JPBA 5JMVA 1ZBIA 4AVZA 4MTDA 3CCLN 4KREA 2RNGA 4RM2A 3G71I 3LL7A 3CQZJ 4QIWN 3TDZC 1V4SA 4BE1A 3I33A 1VQNN 2QQBA 3DBHB 3ZSYA 3DLLF 4DTPA 2O03A 3SNNA 4XIDA 3HHHA 5C3EJ 3K5OA 3THYA 2NAZA 3WG7H 1IRFA 4OIOF 3EYZA 3JYTA 5FD5A 1E0EA 1JKRC 2KTQA 1CQTA 2JN6A 1LQ1A 3IKVA 3KX2A 1DGKN 1U2VA 5HP1A 3ECHA 1R0AA 2JWTA 2WAFA 1ZRFA 2JLEA 4EZ6A 1FWZA 4H8KA 3SYZA 3KZZA 5D4SA 3KP5A 3C65A 4JN4A 4Y15A 3QEIA 1ZTRA 3ENHA 2O8EA 3CZ6A 3JRFA 3K6GA 3IFRA 2KQRA 4Y17A 2NVYJ 2XSJC 2Q0RA 4GYIA 4CE9A 1ULYA 2A05A 4OIPF 2MD5A 1SANA 2ZXWH 2UXXA 5HLIA 4CXFA 5EVZA 4O0IA 3OR1C 3GXOA 1C0TA 1BQMA 3CG7A 1TK5A 4JI5K 2OBPA 2NRHA 2NRXA 4GDFA 2JUGA 3QINA 4EV0A 4A59A 4BRMA 4B9SA 1TT0A 1K6OA 3CCVI 3WXJA 2Q2EA 1MBGA 1LAVA 1TKXA 1Z91A 3MN7A 3HPGA 3PIPL 1R6RA 3HOVJ 3D5LA 1IRZA 4IO9L 3SMPA 3CC2N 2A5YB 1FMWA 3PJRA 2MABA 2F4OB 2HDWA 3VQEA 3LDSA 1M1KO 2H1LA 2BVMA 1RDAA 1MMDA 4TV7A 2FBXA 4DQ8A 4F2RA 4FX4A 3MFKA 1N34K 3HUGA 3ZQLA 3CJTB 1GLBG 2MLKA 4IHXA 2TCTA 1NHAA 1GOCA 5EEGA 4AIDA 1TV6A 2Z1GA 3BTCA 4ISGA 4F3QA 2W1OA 3H3VK 3VESA 5D8KB 4CEZA 3FMQA 4FJ8A 5AZJA 1TK0A 1N77A 4MLOA 1D9FA 3E1SA 3EUHA 4Y4RA 5D8LB 4B8XA 4H4OA 1ETKA 3KP3A 4YOVA 2L4AA 4KMUX 2NS8A 3BCBA 4KAZA 1IKXA 2VXDA 1U8BA 1GLJO 5GINA 1CF7A 2UZKA 3WNEA 2G7HA 1MW7A 4FJXA 1U04A 2O8CB 3T0YA 3BC8A 1ETVA 2LSNA 1T6SA 2VXZA 1GLEG 1AOYA 4A61A 2MH9A 2QSFX 3C1DA 3DQVC 3HKZA 3K4BA 4XR6A 4DV6K 4Q0BA 2ASMA 3FXQA 3QIOA 4UUTA 4BXUA 4EMSA 4P9UA 2W7NA 4AF1A 4CCLA 1Z3XA 2IT0A 1TKDA 1LEBA 2FBIA 4A3IJ 4M3RA 3H0DA 3G73A 1W0TA 3DJCA 3QP5A 3L4IA 1FSEA 2W48A 2O3FA 2D0OA 3IKMA 3WQUA 3J80Z 4I6MB 4IO8A 3CP8A 3A0BC 3SZ2A 4DTXA 3CCSI 3CCQN 4UB8C 3Q7BA 1FSHA 2D1HA 2P9UA 1VSMA 2NVQJ 4B3OA 2YSRA 4ABZA 1OCZH 2IJLA 5HL7L 3TWHA 4JKHA 3QODA 5FLMJ 5AQRA 1ON1A 3JAMZ 1BDGA 4N47A 4WFAL 3DKYA 1WH5A 2QF7A 3IRRA 3ID6A 3ZSQA 4V2GA 4HX7A 2CW8A 2R7WA 3OS2A 2PI0A 1QGPA 1TAQA 4WXCA 1K79A 4KITB 3FE1A 2ME0A 2STWA 2MBFA 3R4KA 1JLFA 3IDHA 4E1JA 2HYJA 4B4CA 1CF7B 3QEWA 3FXKA 3E97A 3S2DJ 3CUQB 5DCMA 1SAXA 1LB2A 3VTIA 1XNRK 4A12A 4E7HA 4JAXA 1KVBA 2XRIA 1DT9A 3FZLA 5ELZA 2IGNA 5J4VA 1J9IA 2W42A 5M5YJ 3GFIA 2DCEA 2VI6A 1TWFJ 1TP4A 3RKWA 2A1SA 1J5YA 2G0EA 2DXIA 2D2WA 4CICA 3OS0A 3BG9A 5AQGA 2PG4A 5KCMA 1REVA 2Z1JA 4ZYGA 3C6AA 3EZ5A 3DU6A 3ZMDA 5K5QA 2LFBA 1J0RA 3E9LA 5B3SH 2FNPA 5HS9A 4FM2A 3RMCA 4D5CA 4J01A 4U87A 1QNTA 2ISYA 1BC7C 2XF6A 3KD5E 3LM2A 3J81Z 1JTYA 2H09A 2ZNZA 1RRJA 2P9KB 2WTUA 2E2HJ 4LJZF 3BROA 4BEHB 2B63J 2WUSA 2LLKA 1N78A 1UJ8A 2MFZA 2HBJA 3EYIA 2OQRA 4FT8A 4KA4A 3OL4A 3PO2J 1E4FT 3CCMN 2ELKA 4KHQA 3WXKA 5AZJB 3H1CA 1S5JA 3RDIA 2IW5A 4OKKA 3L2RA 2F5FA 3A5NC 5JS2A 2HHHK 2ICWG 4CBXA 1VAZA 2E1NA 4FK0A 2CUFA 1GXPA 4IEEA 3D5SC 2ASPA 1DP7P 2E1YA 1O4XA 3MZ8A 3KYCB 1ETYA 4I2OA 4Y1CA 4UV8A 1QQIA 3GE1A 3I56N 3HM5A 3KEYA 2O4GA 2JA2A 1ITYA 4BDYA 3GWZA 4CJEA 2A40A 3K70D 5HOOA 5ERIA 3RZDJ 1H8AC 3I59A 5KAFC 2F9TA 4CGIA 4NXMK 2UUAK 2DOAA 4IOCF 1FOYA 4E3SA 4PUSA 3CETA 1MH3A 4DV3K 3RR7A 1UHSA 2OPPA 3ULDA 1K6YA 2XAJA 4BE0A 4WE1A 1OCTC 4B9NA 5BS6A 1U8RA 2L7FP 2P9KA 4C2UA 5JLHA 2BH1A 2PMUA 3MKZA 1XPXA 1KQSM 3ABUA 5J2PA 4EEFG 3GBTA 3HSTB 3THVA 3DLGA 3MN5A 2K86A 2KZMA 1BHLA 3R9PA 4M9SA 3VPRA 2V52B 1TWAJ 5HDGA 5IY5H 1EA3A 1PP8F 2OPQA 2P9IB 3ZETB 3LZJA 4FLVA 5C15A 3H36A 1G3TA 2K3PA 4LIUA 3PIPF 2FSNA 1UMQA 4RW6A 4CGFA 3CFRA 2JQ7A 3FBNB 2QXLA 3M3ZA 1J54A 5GTHC 2O7OA 4BEHA 4BAYA 3I4MJ 2OF7A 4JI6K 4GRIA 4DV4K 2VGMA 3LSJA 2D0BA 2ESNA 2DK5A 5C2DA 5M1NA 3EEQA 4WXHA 2BBYA 3BCAA 3BR6A 3I56I 1XMAA 3BWGA 4FASD 3U1KA 5KRTA 4QWQA 1WLJA 1NKBA 4WK8F 2Y9ZA 5FLXK 3O9UA 2DW4A 3C2BA 2K9LA 1YF5L 4NB4A 4ZZLA 3ZMTA 5FRMA 5DEQA 2RKIA 2GXAA 2M8GX 1TAUA 3KETA 4CIEA 4D0PA 4NO7A 5JICA 3RMBA 2ZGYA 3IWZA 1Z0XA 4MLEA 2CUZA 2L9VA 3E5UA 4HBLA 3A0HC 1WBDA 1Q9XA 3KD1E 2IS2A 5BRFA 2R7FA 4EP5A 2HDDA 4AQYK 1C1CA 1I39A 2LC2A 1RT6A 2WB1N 4MEYF 2OC6A 1KONA 4RS8A 3TL4X 1DUXC 5AQQA 3F73A 4F55A 3OJSA 1X9SA 1NWKA 1XC9A 2IGKA 4LG0A 4OX9K 5LEJA 2YU9J 1WSJA 4OKJA 3TSQA 4B8AB 3ZSZA 2VKVA 2E36A 3FXMA 2PMZA 1RPWA 5HS7A 3T8RA 1A35A 4S04A 2Q2RA 3HYFA 4CF8A 2W57A 3AAQA 3DLLL 1YJ9N 1RT3A 2AJQA 3PUBA 4JP0A 1C6VA 1SFXA 4QLCU 2ECCA 4LB6B 2K5CA 2QVOA 3D0SA 3F8NA 4MO7A 1R71A 4Z4IA 3TDUC 1B8IA 3O08A 4F93B 2W84A 1VQLI 1LWCA 3E5QA 3DTEA 2E1ZA 1GLNA 3H3OB 1QRYA 4CGDA 3M8JA 5FLVA 5FB2A 3T3FA 4MFBA 3UKUA 2W6KA 1SAUA 3H45C 4A2AA 5KAIC 2BY0A 1QBJA 1NGIA 3OIOA 3CJ9A 3CJAA 5IWAK 1QO0D 2XAFA 1ESVA 3DXKB 2CH6A 3HSFA 3SXYA 1Y56A 3GVAA 4AHSA 2DA7A 1RIOH 3H9QA 3MVPA 3OYNA 3CJ7A 4HVJA 1W1WE 4DR3K 1U78A 3Q9VA 2R7OA 4LLLA 1ASWA 4ASNA 4DSKA 2KLOA 3K4NA 3OYHA 4FCYA 1B9FA 3LSHA 1POGA 3E66A 4L18B 2V4JC 2XAHA 4L5IA 2MH2A 5F27A 1I3AA 3W6JB 1JKPC 1IKWA 1BGXT 4JKGB 3T7ZA 3PM1A 2DOFA 2FE3A 5FKKA 4DQRA 5AZIB 2X6WA 2XUBA 3HXMA 1KRPA 5D6EA 2A5XA 4ESJA 4FL9A 1MJAA 5EJCA 5LFAA 2P9SB 3IG1A 4A57A 2X0LA 3SDGA 3DMJA 2KRFA 3A03A 3TSPA 3HT3A 3AVFA 2RQQA 4CF9A 2R7DA 3BG7A 2KKZA 5DS9A 5L3EA 2LBFB 3QYEA 4AD9A 3OYJA 3O4WA 4B3RK 4R5PA 3J7AO 1DEJA 4FWOA 3OW2M 1T6DA 2V51B 3CIPA 3VSKA 3LALA 2AQEA 3GZ5A 4C30A 3MDQA 2VT2A 5EOYA 2RV8A 1DP3A 1YT3A 3T1AA 1TBXA 2P6TA 5CQEA 1JUMA 5LMUK 3I54A 1XCBA 1WSIA 5E3NA 1NOYA 3H46O 3F22A 3IH2A 4F52A 1IJWC 1IDYA 5KPZA 5TJJA 3VGMA 1QHTA 2YV0X 4A0XA 1IN6A 2K02A 3DXKA 3G4SN 1UG2A 1OCPA 2RVCA 5F04A 3FR0A 4LF6K 3QP6A 2JZYA 1LCUA 1C0WA 3AL0C 2DA3A 1TUYA 1HBXG 5B66C 2CGJA 1U0JA 1WVRA 3VB2A 4RB2C 2DPUA 2QENA 2HBLA 1NGCA 3VGLA 4DG1A 3JSMA 1O1WA 3D2EA 3GBGA 2Y2ZA 1R49A 2DT7B 2Z16A 2RN2A 1B72A 2P5GA 2DODA 2WOMA 3DM2A 1TW2A 2IS1A 1HQUA 3KZYA 2LY2A 4I0BA 2Y69H 2BZTA 2M1BA 3EE9A 4K8ZA 4M3XA 3KP2A 1PUFA 2DU9A 1BA5A 1IRXA 3UKRA 2Z2SB 2ZMEB 3G4SI 2KQ2A 2OZUA 2P0WA 4DSIA 2P5KA 2YNFA 1VSJA 3I9V2 4Z4CA 3CQ8A 5H1SQ 1D9DA 2JJ7A 5D6FA 4CEAA 3DPUA 4K0KK 4RW9A 3HDDA 2JT1A 2YKNA 4FW2A 2P1JA 4AH9A 2B5JA 3LAKA 1Z26A 3GZNB 3KLFA 2DBBA 3PO4A 3BG5A 3OYBA 2UV1A 5KVRA 2ZXJA 2QBYB 3AVBA 1GDTA 4H5WA 1S8NA 1W4MA 3O5BA 5KRSA 3OYDA 3S8PA 5HODA 5F6FA 2BY1A 3QNNA 3CTAA 3CCRI 2IS3A 2ITMA 2OZSA 3QOPA 3TOBA 3COAC 4YORA 3WEEB 2XHBA 3JRIA 1I94K 5IT9K 3GTJJ 1YOVB 4MDBA 1OJLA 1NJIO 2OAZA 2ELHA 1K4TA 4FJMA 2ZE2A 3PV8A 3CC7I 4FETA 2FA5A 2GOXB 4PKGA 5AQHA 2M34A 3MCPA 2CW0F 4A3LJ 4DMNA 2X1CA 4BRGA 1Z77A 1OPCA 1YX3A 3BR5A 4ON0A 2QM1A 4JQFA 1FYMA 4Y0WA 4RW7A 4NQWA 1FKOA 4GCVA 4B47A 1K8KA 5AQZA 2OYQA 3V8KA 3PUFA 3B6AA 3CCLI 2HVQA 1Y64A 1N32K 3LSMA 1JXBA 5ICFA 4PL7A 1K9MO 2IRFG 2P5OA 4H0OA 3ECOA 3LDPA 3TO7A 4IWVA 4MLHA 4PJMA 2CFOA 3V9ZA 1RC9A 2E1MC 4B44A 2EZKA 1RT4A 4G9YA 3ULEA 1HQCA 3TAGA 3ASNH 1IC8A 1KU7A 2HYFA 4I99C 4KNYA 1U48A 2V7YA 3DFGA 3SBTA 5I9EB 3I0TA 1U3EM 5ICCA 3VN5A 1KLNA 2UXCK 1Q1VA 2R5ZA 5FKOA 3HIFA 3VEWA 3LPUA 4UUSA 4CGJA 2Z5UA 3AGRA 4CK2A 4FWKA 2DI3A 1R59O 4II2A 1IV6A 1H9GA 1Z3YA 4JLHA 1YI2I 4DFPA 3K1MA 3ZOBA 5GAHJ 2YHYA 4IRGA 3C2GA 4CHOA 3R60A 3WGGA 1O13A 1K61A 4YNQA 4I0AA 2M4KA 3IUOA 3OYFA 3KKRA 3M8RA 2FMLA 5I42A 1YITN 4F3OA 1A5WA 3IUCA 2VONA 1S7AA 2DDBA 1FP2A 1WZ2A 4BY7J 4UY8I 5AFUA 1R9TJ 1FBSA 2E6MA 4O5FA 3V4IA 1RETA 2W4SA 3K1NA 4PFPA 5CLSA 2RNJA 1E3PA 3RPUD 5EEAA 2ZBKA 4D1QA 3CCMI 1E3HA 1BISA 3DOKA 4ISFA 1BIAA 2XDVA 3FXLA 1JLEA 2P9PA 1O7FA 2P5VA 1YIOA 2XGEA 4RAFA 2CGPA 1U6ZA 4OVLA 4XIUA 2PFBA 3K9TA 2A3ZA 3OJUA 4JI3K 1XC5A 3DV8A 3FMSA 3MAJA 3IH4A 2CV2A 2XKPA 2IS6A 3ZX2A 4FOEA 3ZP5A 1FBQA 1R7JA 2GZWA 5AR0A 3CDHA 1XGMA 4M9ZA 1ZGWA 3L9FA 1EXQA 1JL1A 1XGNA 4EJVA 4BS9A 4J8FA 4B43A 4WX9A 3RQIA 1BCOA 3V81A 4M6XA 1ETXA 4G6DA 1HUXA 4Y1DA 4HF1A 2ZJPF 1F36A 3VOEA 5GPAA 1B92A 1OYWA 4FZZA 4PDKA 4MHGA 1DPRA 5L3DA 4XLHA 2WADA 3I5UA 3FM3A 4BH9A 4DYCA 4ENJA 4QPOA 1MU2A 3NDKA 4DTJA 1XN7A 1RBTA 2P7VB 4C1NK 5J47A 2DPDA 1KAZA 3M8SA 4BNCA 3FM5A 1ASVA 5DCFA 5GAGP 3KLEA 2HMPA 4OPJA 5FROA 1T56A 2RREA 3H3ZA 2H8WA 4TSXA 2P51A 3NVMA 1HDDC 4EJTA 4CJFA 3KK7A 1JLAA 3OV8A 4EP4A 3GYHX 3BLYA 1MGTA 5BPLA 1QSSA 2KJCA 1XG1A 1NMDA 2VJ4A 2F48A 4XK4A 3KEQA 2AO9A 1XTAA 1HCRA 2FXAA 1B59A 1VRTA 2Z99A 5FDLA 3TABA 2A69F 2JRTA 5DMRA 4A62A 4GVEA 4E7JA 1W7PB 1IO2A 1N25A 4CF0A 3SQ0A 1D1BA 2HHUA 4DOZA 2GQQA 2CJJA 4Q47A 2GAUA 4BR9A 3CCSN 3A4CA 4CJWA 1NNEA 3SQ1A 4IZZA 3QPHA 4M3DA 2HEOA 2V7FA 5HNFA 3RTVA 2NS7A 4IPAA 2ETJA 4M3WA 4DB3A 3ZN0A 4JX5A 3VDXA 1VK0A 1EETA 4CVNE 3AG3H 3CMEI 4GGGA 4XLEA 4G7ZF 5CYMA 4I01A 2AXLA 1LDDA 1T38A 1IRGA 3LAJA 2HI3A 4M3GA 2OTLI 1XMQK 4DR6K 2R92J 2DY4A 5AQVA 4KFBA 1M1EB 2HSTA 1KGSA 1HQEA 2GA1A 4XICA 2IVMA 4A93J 3C6UA 3ZX3A 4EHTA 4DV2K 4O0JA 1HNZK 2YI1A 4FHTA 1H88C 2D5RA 2UUZA 2V1NA 2P9UB 2ZKZA 2ZXIA 5EX5A 1ZBHA 1O3TA 2E88A 3VQ9A 4G7OF 2QWMA 4CA0A 3BQZA 1ZK8A 3NAEA 2HQNA 2BYVE 2X48A 3GTPJ 2A07F 3Q7CA 1CZAN 3AVJA 2DYSH 3AAFA 5GAEJ 1VQ6I 5CVUA 3V8LA 3JRDA 4AUXA 1QZ6A 1Y1VJ 3LQRA 1W36C 3C7NB 4M41A 4CEFA 1X3WB 2XGXA 3CJRB 4OIQF 2QUFA 4LK0F 1UA0A 1L3VA 4HLYA 3RR8A 4MO5A 3QESA 3GTQJ 2ECBA 1RCHA 2MC3A 4RA2A 3TARA 4ISEA 4UB6C 2VQHA 2O8KA 4H03B 1QSLA 1FOXA 5LJVA 2Q36A 4HSTA 3VERA 1EH8A 4M72A 3TAMA 2K9MA 5F0CA 3FHNA 4XRSG 4I76A 1YO5C 4CHUA 4OGCA 3U3GA 1WUAA 1T6CA 4BJ6C 2J5OA 3H5RA 1CLQA 5IP9J 2DFEA 1IN4A 2R5ZB 2E2IJ 1JTXA 3K70C 2GTDA 2EWSA 3CQXA 1YG2A 1HKBA 3CFOA 5GIPA 3BDPA 4U0WA 4E7IA 5KQDA 4XRFA 3KVGA 5AQJA 2FF3B 3B8AX 4FOIA 2DMNA 2QZ8A 3WNGA 3P9KA 1LDKB 3P38A 4AHCA 5J1EA 4N76A 2BY2A 3WU0A 1NKCA 2PBIA 1I5ZA 2EILH 3R0AA 2VC0A 1ZG3A 1YW9A 4MQVA 3J81K 3SFZA 5C4XJ 3ZEUB 2KFNA 4IOXA 4OU0A 3FIWA 3QBWA 1D5YA 2DA6A 4AM3A 3S1MJ 2E1CA 5M1FA 5C4JJ 4YFUA 3REOA 1WRJA 1C0FA 2FBVA 1X1PA 1XX5A 3FWEA 3MEGA 5BRHA 4YFKF 3QETA 5LLQA 3RSNA 2OA4A 2ZFUA 4PKHA 3K9KA 1XHXA 2A6TA 4CJUA 3PY8A 5E1WA 3QWLA 4CJSA 4LIVA 4GXOA 2YHXA 2GUPA 2PQ8A 2HYGD 1EP4A 3V1OA 1VHXA 1KZHA 3OBWA 4ILJA 1YTUA 4KI6A 4FTHA 1W9HA 1USSA 5BRDA 3NF7A 3SEZA 3S1NJ 4L5EA 1YS6A 3TU5A 2CQ7A 2O8EB 2LREA 2L9RA 4PFOA 4X0GA 4CZKA 5AQOA 3A0IX 2UUBK 1V4TA 5LRSA 3GW2A 2KLAA 2KJBA 2XVCA 1K73O 1QVTA 1MMSA 3WTWC 1F9NA 4WXDA 5ED4A 4FXDA 3U9GA 5CZ2A 4M3ZA 4IOAF 3HB9A 3C6HA 1LE8A 5JFRA 3QLHA 5DYMA 3CJBA 5HDKA 5DD8A 2GUIA 3J7YP 1N5YA 3ZT3A 1GLFO 2EA2A 2EV0A 6PAXA 4HTUA 1WJAA 3EQLF 1SFUA 1WJBA 3HRGA 3ZXSA 3R1XA 2LKSA 1WKMA 1ZYRF 4P9FA 3HOYJ 5BMZA 3ZMSA 4DQQA 5AONA 2R7TA 1SVOA 5BN9A 3K5LA 1NKEA 4XKBA 4LY7A 3S2HJ 1NGBA 2FBHA 3SMSA 4MFEA 2OJED 2P9NB 3GG4A 4WF2A 2HBMA 1F21A 2YHWA 5F08A 3QDKA 2P9IA 4Y52J 1PUFB 4M3YA 3X2QH 3CM6A 3UKUB 1T39A 1NJYA 1S29A 4BR2A 3DKWA 5A2QK 1OCCH 1Q82O 4A6EA 2BY3A 1WAJA 2M5WA 1I3QJ 3BY6A 2PEXA 3L1PA 1U9NA 3FZFA 1E3MA 2E2JJ 3THXA 2XSDC 1VSKA 3BZ6A 3NF8A 2A5WA 2WFBA 3ZQGA 3DP7A 3ABKH 2XPUA 1IXSB 1IG7A 2VPLA 2QWQA 4O8KA 2FLOA 4JYAK 2DLLA 2BHYA 5M5XJ 1JCGA 1V5GA 1FEXA 3NHGA 4JI8K 2L7ZA 4MIMA 4V19K 1ZG5A 3AVMA 1VQ7N 1FOWA 4CCHA 2VT3A 1ZLJA 2L5QA 3ZQ7A 3OYGA 4XH5A 3KJVA 2EBIA 2GIVA 1O7LA 3RKYA 5DUIA 2LD5A 1RNLA 3JW4A 1SC7A 4CK1A 4WFNL 2DQRA 3DPLC 4A0ZA 1WB9A 3HSEA 2B4JA 3VENA 3MWPA 4M3UA 2O8FB 1BJAA 3ONQA 4L9VA 4IOCL 4DV5K 2IS4A 3VA0A 2Q2EB 3LDNA 4CFBA 3THWA 3VQAA 2V26A 4GKJK 1SL0A 4AWXB 3KKSA 3O3HA 1A31A 2CWEA 1YTYA 3MMYB 3PX6A 2FEZA 1APLC 3W6VA 4P5OA 4FWPA 2HPMA 3U9ZA 1WNSA 5J1RA 2W6LA 4DSJA 1YE9A 1RBVA 1ASUA 3J7AP 3JS6A 2BXZA 2HOTA 1J6ZA 3M5RA 1D3YA 1S1WA 2IC3A 4CZJA 3AY9A 5DM7F 4HNVA 5D5VB 4X64K 2QWOA 2Z1IA 4OMZA 4KN7X 4ZZDA 4RB1A 4FSVA 1KA8A 4N0BA 3EL2A 2VBXA 2EIJH 5JLFA 1VQMI 3U9DA 4B3MK 4RDUA 4B1XB 2IOCA 3VQBA 5J1YA 3PX0A 5CVVA 4IHVA 4KH4A 1QE1A 2UYTA 2BGGA 3WU1B 3IHUA 5E18F 4ZDOA 1IJJA 1OVYA 3AO5A 2RQPA 3PNTA 3RSEA 1TWGJ 3P4IA 2EK5A 1W0HA 2VKHA 2J4RA 4KBOA 4E19A 3FDYA 1BL0A 1XSXA 4A3MJ 2JA7J 3AO3A 3BTJA 3I59B 5EY4A 3VOVA 1IBMK 2LOOA 5BNGA 1YVUA 2OPSA 1LOTB 4DS5A 3GTGJ 3CJCA 2A1RA 4D7MA 1LVAA 1X3UA 1BOAA 3OYEA 2I5JA 3QO9A 1NK4A 4I09A 3SQNA 2VCPA 4J19A 1BI1A 2O8DB 3ZEUA 2PYLA 4IJAA 5ADXA 2MSYA 3OYLA 1PUEE 2RF2A 4CECA 4X65K 1CZBA 3LA2A 4IDKA 3KZBA 5CR4A 1BIZA 4DTUA 1RESA 4BXXJ 4DBQA 3QEPA 2DYRH 3GTKJ 2RKHA 1G2HA 1LJ9A 1SUQA 2A6AA 1AA7A 3CO7C 4CEDA 3F8BA 2E6LA 4OIRF 2VKEA 4EJOA 1T95A 1VQ5I 2ZWHA 4WQ5A 4CFDA 1FX7A 1BUPA 3A01A 2CV1A 2X6YA 2JSCA 4U7BA 5LL6Z 2EHGA 1VSIA 4G6TB 2VIXA 3KLGA 4CYDA 3V1RA 2KHMA 4JKAA 3GO5A 3VQ5A 5DD4A 4ELTA 2LR8A 3NWSA 1I1GA 3JCUC 4M3FA 4OPHA 5AFUH 5C2FA 3HO1A 2Q31A 4X62K 3AO1A 4L9NA 2LVSA 1J9AA 1Q18A 3Q0VA 1NM1A 2QWPA 3VWBA 2KW4A 1OFCX 1SVMA 2DK8A 1P9QC 5FFXA 5IOYA 3EN9A 3LWLA 5JS1A 1WJDA 3BZCA 2E5LK 2QWRA 1WSEA 4HX4A 3KHYA 1MNMC 4BE2A 3KE2A 1ZGJA 2E2PA 5T7BA 1CGPA 4I6MA 2L9NA 1MD0A 2BVLA 1FOKA 3AA3A 3QB0A 3TTFA 1TL3A 3VEPA 2EFNA 4XLCA 2WY8Q 1FTTA 1DQUA 4CCOA 1TWHJ 3LOCA 3VYSB 1WJ5A 1P90A 2HHTA 5M3FJ 2X1DA 2AHQA 2D1KA 2XGDA 3CPWM 3C7JA 1R4NB 2IGIA 3VEYA 4BL0B 2E7XA 5AQXA 5IT9Z 2ZJPL 1TT5B 3UNGC 4BVOA 5GPCA 1I1SA 1QZ5A 2QQ9A 3CUQC 4RBOA 2DFHA 3DCFA 5BQTA 4DBRA 2YKMA 5JHUA 4BRFA 3FZVA 4DIQA 5JVHL 3PQJA 3MWTA 2ZJQL 2PY5A 4ID5A 3CMMA 3CMEN 4NB5A 2O4IA 2M8EA 1XC3A 4OOIA 1LPQA 2ITGA 2W25A 5J6XA 5C44J 3E01A 2UXDK 2YX4A 4CHNA 4B1WB 2GA2A 1T08B 2R5YA 1EQYA 1LAWA 3NGYA 4N9IA 4OJRA 3DAWA 4Z4EA 4C3HJ 1MBHA 2VPRA 3LAPA 3ASMA 1U49A 2GWRA 3SQ4A 1B9DA 3QEXA 3EYYA 1ON2A 4BHPA 5DK5A 2CG4A 1GVJA 2EPFA 2K3FA 3P5JA 1VQNI 2IGOA 3HSCA 2Y1IA 3NAUA 2R7RA 3VQDA 4FW1A 4Z4HA 3ZQQA 3OWTA 2PJRB 3P9CA 3VF4A 2WAEA 3O6WA 2J5PA 3I53A 4EJUA 5KHDA 3WTXC 1P2FA 1V3FA 3MN6A 2N8GA 4C3IJ 5A2QZ 3DI6A 3LZIA 2HVIA 1ORKA 4NLCA 2IEKA 2F6CA 2LY9A 2O8XA 4HUEA 1GOBA 3VEZA 3ITHA 2VQCA 2QBYA 2Y0SN 5D5XB 5E17F 2ZGZA 3A5MC 4FJNA 4PQUA 2Q0UA 4G94A 3P39A 3O8HA 3D6RA 4CD1A 4RB3C 1NGGA 3O9SA 4K41A 5TKWA 1JKOC 3S16J 1SKRA 4ZDPA 3QERA 4MEXF 2A3SA 5KPRA 4KHYA 4H0EA 3I0SA 5LGTA 3NF9A 3K7AJ 4IHWA 4CGZA 3BJ6A 3F23A 3SLCA 2B0LA 5C25A 4IZ9A 1S9HA 1BBYA 4JX4A 4Z2YA 4IX7A 1ETOA 4MQ9F 3LANA 2QA4I 2BW3A 1B72B 4MO4A 4FJ7A 3U21A 2FU4A 1Y39A 5SZTA 3HSRA 4FWSA 3EUKL 1S1XA 1J2XA 1QZEA 5F0FA 1HC8A 2NZTA 3AVNA 2V6EA 3G25A 1X2MA 2GBYA 3BR1A 3F72A 3W6KB 3CCJI 2P9SA 3SAHA 1RDWX 1I50J 1R23A 2KMUA 4B09A 2X85A 4FLUA 1I6HJ 1KVAA 3VEXA 4UVBA 4IQJA 1P4AA 2MA3A 1TQPA 1D5VA 5J2MA 3C7NA 1GHCA 1MBEA 2OTJN 5AQLA 2XAQA 4RGXA 1LNWA 4FVMA 3D2FB 1OH6A 2VQLA 4DHYA 5FPNA 4DTMA 4RMNA 4KHNA 2K9NA 5CKTA 5LGNA 2WBMA 1LEAA 4Y3OA 3JRGA 1BI2A 3KCCA 3WHCA 1FLIA 3I8DA 2YJEA 3GFLA 3LP2A 2ETHA 4KHUA 1FP1D 3A01B 4BACA 1X3MA 1J59A 4K25A 1ZQ3P 2LP0A 4DSLA 2V1DA 1HYZA 1YUWA 2CH0A 1BI4A 3ZSXA 1JLGA 4M71A 3CUQA 5DCMB 3RI4A 3NEUA 4NC8A 4AYBA 5B5EC 4BRAA 3J80O 1ZKGA 3G1OA 3K58A 5FRNA 3FZHA 2EQRA 3ZPLA 2Y0SA 1S6QA 2I8DA 3VGKA 4X1EA 1W5TA 3SEQA 1A04A 4UNOA 3VMFB 3ZRGA 2ZJQF 4XN0A 4CEEA 4IG0A 1JLBA 5HLTA 5FPDA 3PSFA 3HJEA 4KO0A 2D45A 5H6QA 2XKOA 3H0GJ 2YX7A 3G1MA 4NXNK 3QFUA 1X2NA 5BPMA 3L2CA 3OOUA 3M7GA 2OA8A 3OSGA 3SJHA 4BVPA 2P9NA 4F8RA 4IFYA 1YRNB 3H1QA 1OVQA 2KP6A 4EM1A 3HL2A 4NDLA 1EJ9A 4BC5A 4BG9A 2OD5A 2K4JA 4C23A 5EXWA 4IKFA 4FZYA 4K8XA 3LFUA 1C0MA 4GYGA 4BRQA 5KQ8A 4HHTA 4PJJA 2F7TA 3AVCA 4P1WA 3CF5L 4DUZK 4J2AA 3DEEA 5CHIA 4WFBL 4ZHRA 1MNEA 3P1GA 1WJEA 5HLFA 3THXB 1JCFA 4LFAK 3SK3A 2KIQA 5CYQA 3M8FA 2VOPA 2GWKA 2Q1NA 2YNIA 3A2FA 3PIOL 1T2KA 2O8CA 2NUBA 1RBUA 1E2XA 4JS4A 5AQMA 1S7EA 1AKHB 2R7UA 4NNJA 3WG9A 1SL2A 3H5AA 2GEMA 4W5OA 1GV2A 4CZZA 2K7LA 3VQ7A 2EWNA 3R6SA 2QYOA 2DMTA 2E4LA 4YHHK 1XGOA 4A3FJ 1EF4A 3OHRA 1QHAA 2QQ8A 1XSDA 4HG2A 4QS8A 4PKIA 1P6RA 2G9WA 3BJOA 4HCBA 1OLTA 4HEA2 4UV9A 1P7IA 5GAGJ 4OGEA 2Q0OA 1RUNA 1WPKA 1XI1A 2B7EA 4YDUC 1IW7F 3AO2A 5J8CA 1IXRC 4BU2A 2DQLA 2R93J 3CCUI 4H0VB 5LRRA 3BQYA 1E4GT 1DPUA 3NFAA 1Z1DA 3G1LA 1SKSA 4ESFA 1K83J 4FK4A 2BUPA 1UOCA 3VYRB 4ZYEA 2MLGA 1KAYA 5TISC 2GM4A 4XSXF 4ZDLA 1X1CA 2H27A 1MSFC 5EGOB 4R1HA 4BQNA 5IT3A 5BN8A 4CERA 1HNIA 4A5BA 4H4KC 3I4NJ 2FOKA 2E2OA 5HRPA 4W5QA 2XF7A 1DU0A 4XKWA 5K5RA 2KIUA 2CGKA 1S6PA 2P6SA 1JHHA 5EG0B 2YNGA 5JVGL 3MN9A 5GAHP 4XH4A 1ETQA 4DFJA 1STZA 1VTNC 4CJLA 2PBDA 1XMOK 3TAEA 2DDAA 1DGRM 3WXMB 5LHHA 3R0JA 2CGLA 3G3ZA 4P96A 3A8YA 4C8KA 2BHZA 1N75A 3ZMVA 1A5JA 1R5GA 3IP4B 1KAXA 3SQ2A 1Y8RB 2COMA 2HFHA 3JR9A 1W36D 4A2BA 5LEKA 3ERMA 1NGEA 2RDPA 3AA2A 2Q8KA 1C0UA 3LAMA 4CJTA 4DV0K 3QPLA 2JA5J 2R7VA 4R79A 4E7LA 2G8HA 2KT0A 4W5NA 2LSOA 1Y1WJ 4FE4A 1YTAA 1PVEA 4KTQA 2LG4A 3PL8A 3TO9A 4KB0A 2LMDA 2NOJB 3N4PA 4LOCA 4I9LA 2AXTC 3M8EA 4HYEA 3RQ4A 3BGRA 3FKJA 1ZBUA 2XPWA 2VQGA 2H94A 3BPVA 5JVTA 2O6GE 2NNWA 1HSJA 4LB5A 1SAZA 3WTTC 2YX6A 5L3CA 1U6GA 3I4PA 4B3AA 3WTYC 1ZRCA 2WBNA 3C6TA 3DXMB 4YOUA 3NMUA 3AG2H 4JX6A 2HHXA 4A5AA 4OWRB 2ZMEA 2LDUA 3W2VA 1W5SA 1K8KB 1UWBA 1HF0A 2BTFA 1EV7A 1T33A 1U5TC 2K9SA 3AKZA 3A5LC 5E26A 5LY3A 4YOYA 1YITI 2QKKA 2VJ5A 4G6QA 1VQOI 1BW5A 3GOIA 2Q97A 3V9SA 4DTOA 2M87A 3F21A 5BPNA 1G3WA 3QYBA 1HPZA 2VQEK 4DUYK 4MNUA 4V2FA 3GLXA 2F96A 2PJPA 2LH9A 3HP9A 1VQ5N 2X6OA 1W2BM 5KK1A 2CUJA 3QYFA 4I7HA 1BWFO 1XWLA 4M3BA 2X6NA 1L3SA 3R6MA 4IHSA 2P9LB 2HXOA 1TNTA 4X6AJ 1H1VA 4BG8A 3M1FA 2VL8A 1RTHA 2HQRA 1YW8A 1KFDA 4CESA 1LUJB 3JSPA 1BI4B 4JHDA 1GLAG 4DR1K 1GXQA 3BP8A 3TW6A 5K1YA 2LY1A 3MKYB 1BU6O 1X1DA 2ZXHA 1WSGA 4BWJA 1OH8A 1ENHA 2VN2A 1UAXA 3ZQIA 3LDLA 1VSLA 4H0XB 4BR7A 5D5UB 1KYWA 1NK2P 2FBTA 3CLQA 3N97A 4F7ZA 5K7ZA 2D0PA 5B1AH 1SS6A 4NQWB 4HLXA 3U8XA 2WC9A 1I6XA 4RWTA 2EZIA 3KZIC 2IVOA 3B6PA 2V9KA 4XORA 4EVIA 3W3CA 1YJWI 1NU0A 2PFUA 4DLEA 1JJ6C 2KL4A 1ZXOA 3BG3A 4XBFA 3B6CA 3O3KA 3WU2C 5TRDA 1VSDA 3AO4A 3DRPA 4YDUA 2O5RA 3VEVA 1IN7A 3DXMA 4YRVA 3CFPA 2LK2A 3SZTA 1T8IA 5F1JA 5JI6A 3A5OC 1TGOA 5FKNA 3MEDA 4GW6A 3WUHA 2CH5A 4BRLA 1Q7YO 5M1KA 4BKXA 2E5NA 3L2UA 1H9TA 2BANA 4H0TB 2ZO4A 5BPIA 1A36A 4B1ZA 3O3FA 1ZC6A 1DU6A 4AU7A 1DKGD 3ESWB 1SD6A 3IAYA 1IG8A 3ZN1A 4HTLA 4BY1J 2DFIA 3CUOA 5DUKA 1WFXA 4L0ZB 3C94A 3F9MA 1PP7U 4AHVA 1YW7A 2LRDA 4BRDA 4CGHA 3NGIA 1RKWA 1T0FA 3U3YA 3B02A 3D0PA 1EWRA 4BGDA 1O57A 2DTRA 2GOMA 4OAZA 1WSFA 1WBBA 4O55A 2W24A 4U0VA 2QW9A 1CXUA 3S15J 1VQKN 3ZQHA 4HX8A 2KHOA 3U6FA 4IEIA 2Q3SA 3CJ1A 4M9XA 1TLHB 2CQQA 3A02A 3K59A 2Q1ZB 5CZ1A 2Y31A 4UQGA 1JGSA 1G3SA 3CDIA 3EETA 2ZF5O 2DMPA 2GX9A 3EO3A 1T98A 1P4XA 3MEXA 3BDDA 3HI0A 1HLVA 3D5RC 1JHFA 4JKCA 4FLWA 3RMAA 1RI7A 1G3YA 1R58A 1RR7A 4JI4K 3GEZA 3GDQA 1WWXA 1XGSA 3JREA 3J80K 4CIGA 4PWDA 1T7PA 2VJJA 3TAFA 1V5FA 4B1RA 4GFBA 1HW2A 4RW4A 3V9XA 2TRTA 3D1NI 4N41A 3RKXA 1I27A 4B9TA 1JE8A 3ZR8X 3RVCA 4QPQA 5EG0A 3WXIA 2HHQA 2NRZA 1IZ1A 1YQAA 3TOAA 4ESBA 4YFNF 2HNYA 1NMNA 3NCIA 1NJWA 1LVKA 3CO6C 2YCHA 1YI2N 3FLCO 5E1ZB 1RTDA 2K85A 3F6OA 5E3MA 2EFWA 1TYQA 2QWLA 3CYMA 3CESA 3EUHC 3HZJA 1MJ9A 3HOWJ 2E8AA 1T05A 4J2EA 3SUNA 3ZT0A 3RRGA 2IP2A 3IV5A 1KFSA 3AAPA 2XF5A 1EKEA 4FVUA 1W0UA 1WN7A 1D0ZA 3ATUA 2RPIA 4CZIA 3SPYA 4I2QA 4FK2A 5LHGA 3AA4A 3EE8A 1XDUA 1YIJN 4PJ0C 5LBQA 4CJKA 1NJXA 4M63C 1HX1A 3S14J 1LFPA 3VF2A 1TQIA 2NRWA 1BQNA 4CJ4A 3O1BA 2O8BB 2QGUA 2JUCA 5AQYA 3FFKB 1J75A 2ESHA 2UUCK 4IFEA 3V9WA 1ATNA 3RKQA 2STTA 1BOBA 3ABLH 1BG3A 4LF8K 5J2NA 1K4SA 5EZGA 2WC2A 3AGKA 3AV9A 4QTRA 1WSUA 3FZKA 1KLMA 2K40A 3T1HK 4II3A 4UXNA 2P9LA 3ALYA 4R8HA 3H6EA 4LSNA 3I58A 5EZHA 2KRHA 3JRAA 1ZBSA 2HNZA 3DOLA 3ZT2A 3RPUA 1BI0A 1BO5O 1OH7A 3LSRA 3DLRA 2F4VK 4YFXF 4YELA 4RLFA 2WB1A 1T44A 3CERA 4RAGA 1ACIA 5E41A 1GLCG 4F4KA 2HS5A 3CC7N 1HKTA 4DQPA 1ZGAA 2HTSA 2NOGA 4C9YA 1H0MA 1YAGA 4E1MA 2UU9K 3E9PA 2VE9A 1MKMA 3A1YA 4I2PA 2ZQBA 4M42A 4HZFA 4NUBA 4E70A 1FNNA 2LYCA 4HSRA 2G8KA 4Z6YA 3SHFA 4DJAA 1L5UA 1X19A 1XMKA 2EFQA 3SZGA 4ITVA 1ZARA 3D2EB 4RLQA 3K2PA 1R1TA 5AQKA 1BIBA 4A3CJ 3FX3A 1KD1O 1YYVA 5IT9O 5F2RA 4KN4X 4H0PA 3B6OA 2QWNA 3HPOA 1T0FC 1FJLA 1X4PA 1TC3C 2YNHA 4FISA 1QVGM 1N36K 5D3GA 4B08A 2DA5A 2BE2A 4U67L 1AKHA 4AVPA 2CQNA 3V7CA 5J4YA 2UWMA 5KNLA 2EZHA 2JWLA 1ZLKA 4QS9A 3DLEA 4DV1K 4XLAA 1X1BA 2OU2A 3OYKA 3AVAA 4KJZA 3W2AA 3GZ6A 3NRVA 2QWWA 3E1YA 2A6EF 4CZEA 2W40A 2F4IA 2QM3A 4GV3A 4A69C 1YJNI 3LP0A 1QSYA 4AM6A 4WQ4A 3K5MA 4JV5K 2QEXN 1S5LC 5E1XA 2QKBA 1UCRA 3AVGA 3DLBA 2LTPA 1REPC 4DGWB 3S17J 4BR4A 4FLXA 3M8PA 3HKZN 1TKZA 4WYBA 3TTCA 5F1RA 2Z1DA 2ID3A 3ID8A 4IFVA 4BDPA 2CMPA 2DA4A 4GNIA 4LFCK 2CU7A 5HDNA 1SFOJ 4LLNA 2HMIA 4XOPA 1XUPO 3P7NA 1NK3P 3O8MA 1NK5A 4A6DA 3J7ZO 4AHUA 3HOUJ 3CC4N 2IIRA 2EX3A 2YPRA 5JR3A 2MGQA 1RT7A 5F0XA 2LF7A 3J7ZI 3OY9A 1HNXK 5M1PA 1OISA 3QU6A 1HLUA 2M30A 3OIPA 4MFDA 3QMLA 2O8BA 3P31A 5BR8K 3NWTA 2HXIA 1SEUA 5AQFA 3H35A 2MYSA 5IYCJ 1BCMA 2A61A 4CD3A 4UY8O 1D1CA 1Q1HA 4I6ZA 2E34A 3ZQCA 3NBPA 2FJ1A 4BUPA 2HGCA 3AVKA 3KYDB 4UUSB 2I7NA 2XROA 1NK9A 1OH5A 3U4LA 2Y30A 4CEOA 1VQKI 1WH7A 3S2WA 5E3LA 1UA1A 5K7HA 1OMIA 4N4OB 3T1BA 3MKWB 4PY5A 2VG7A 3IAM2 4M6YA 5DDGA 3MQ0A 1JXSA 2E71A 2BOLA 4HV5A 1WJCA 4DQIA 5F1XA 1JT6A 1R22A 3VQ4A 2L54A 1G4DA 3TANA 4E0DA 1TW3A 3HOZJ 3CDLA 1MMGA 4BQOA 4E6KG 5FFZA 4A3BJ 4DSEA 3THWB 2G8IA 2VBYA 1TL1A 2NRRA 2JA6J 5FJ8J 5FLXZ 2KKOA 2WA0A 2K4BA 2IXSA 3IL2A 5HRSA 4F9OA 3DWLE 3CMYA 3KP4A 4M7YA 4B3SK 2R0QC 1R4MB 1HJOA 4XONA 4RG8A 4LF9K 4PUOA 3FGUA 2WY7Q 2A68F 2LF8A 4HAMA 3IRXA 1P7JA 4BRNA 1TWCJ 4PHTX 1SMTA 2WV0A 3ELKA 3L00A 2WV1A 2QA4N 5IP7J 3AG4H 3KWIA 3T19A 3ZLJA 4M3TA 2EINH 3E6CC 5CY4A 2F8SA 2LKPA 3T1YK 4FM0A 1RNHA 2EIMH 5AQTA 2GWJA 4CUGA 1QHHD 3LSIA 3UKGA 1KXPA 3VSLA 4DYQA 4HDVA 2YHAA 1ZBLA 2PMZN 3SDBA 3VODA 4FYDA 4GKKK 1JT0A 4JKDA 3O3GA 2L2OA 3F0CA 4UVAA 4NCBA 3HPHA 5J1UA 4IG3A 4NC7A 5JLWA 2L4MA 3I3LA 1Y6IA 4GY2B 3MXIA 1LE8B 2VWJA 5LGUA 3LA7A 4XLFA 5BR9A 1P4WA 3BR0A 4RGUA 4FE7A 2GLOA 2VUMJ 2JA8J 1B9MA 1XCVA 2X6SA 3FF5A 1S1UA 1B4AA 2HQ5A 1R1UA 1Z9CA 1VQPN 3K2ZA 1KC8O 1SKWA 3BY5A 4PCQA 1KSPA 2CUEA 2XY5A 1K78B 3QPTA 1NGAA 3M6GA 1IN8A 1X3ZB 1BW6A 1TYQB 2BGCA 1U5TA 3NH0A 5HNHA 5M1OA 4F3TA 3S93A 4GO1A 3V4GA 2K9QA 4XRMA 4RTFD 3QU3A 5C12A 3BG6A 4DFMA 3E6BA 3GF2A 1HOMA 1RUOA 2QI2A 5FKLA 4EQQA 2R7XA 4CJQA 4C8NA 2HKXA 1XB4A 4IRHA 3TBIA 4LG0B 2VWBA 4KYWA 1FJGK 4KHSA 5DM6F 2Y0MA 3S3MA 4H5RA 4L3QA 2ZFWA 1FIPA 3RTRA 2NLXA 2NVUB 1RFQA 1IG9A 1MJBA 1IN5A 2E19A 2R7ZJ 1KU3A 2PJRA 2JPCA 3C3WA 3H3NO 4DF4A 3BZKA 5CPRB 2W00A 3HRTA 4B1UB 4RW8A 2VE8A 1MBKA 2HOEA 4FWRA 1ZAOA 4CJ3A 2OPTA 1QVFM 4DLGA 3TP3A 1VQ8I 4A3EJ 2P81A 3FFIA 3MX2A 2DJIA 2QQAA 4JD2A 1G6NA 4CZMA 4CYCB 1NGJA 4KIGA 1FXXA 1NJZA 1TNSA 4PSXA 5HRRA 3MAQA 3UIQA 2JTVA 2OTJI 1WGXA 4IDHA 3PIOF 4BQLA 5EEHA 4I02A 5JVGF 1UELB 3KPHA 2G8UA 3KIOA 4DR2K 4KIBA 4CF2A 2L3DA 4H5NA 1QPMA 1OCRH 3DBRB 3WGIA 3CF5F 1FPQA 4MQ3A 2VODA 3U1DA 1F5TA 4LFBK 1J09A 3KK1A 2IPQX 2F9WA 1MBFA 5ILSA 1IKYA 4J00A 2XPVA 1UFMA 5GTIC 4NYNA 3O8GA 3H08A 4CJ7A 1GV5A 1D0XA 2KISA 2KFDA 4MTEA 4FPBA 3ZT4A 1K78A 3VEOA 1T3VA 2UXNA 2NVTJ 4XEIA 2XO7A 4DU1A 3V6DA 4OO1J 1W97L 2KRCA 3THYB 1FT9A 1RDDA 1R1VA 4FJLA 1FTZA 2BDPA 1ZR2A 3SAFA 3CHWA 1A6QA 3NQOA 1O3SA 5C10A 1F1ZA 1HW1A 1MH4A 4C2TA 3ENBA 4IXCA 2MD0A 1VQ8N 3F6VA 3SZPA 4IXAA 4CH7A 1Q81O 2CFXA 2G8VA 1SD7A 3DKXA 4KV8A 4CFCA 2EZLA 2MW8A 1O3QA 4XL9A 4BC3A 5E8IA 4B9QA 2BXYA 2VYPA 1R00A 4K2EA 4ID1A 2ACJA 4E4HA 4M73A 4NCAA 4LG3A 2ZCWA 3OIQA 2FSKA 2CW7A 4BRIA 1FK9A 3GFJA 1JXEA 3SUQA 1TQMA 1Z21A 5H2FC 1SMYF 3L6QA 1TK8A 4G1QA 3AVIA 2ASOA 2FOWA 1YX5A 2D1VA 3HC7A 3FK6A 2HPIA 3FXRA 3M07A 4MGRA 4AIKA 4E89A 2Y48A 4WF9L 3TPQA 5AJ3K 5ADXH 5IOZA 2Y1JA 1Y0NA 4H5TA 2X74A 3K4JA 3RYPA 3SV4A 2R7SA 4RCHA 1KQ8A 1U2WA 2BV6A 2HR3A 1QPIA 1UG0A 3EKSA 4KFCA 5C24A 1U4BA 4DNCA 4ZYDA 3AFHA 4CDGA 1HYVA 1FY7A 5CVRA 3CI5A 5KGXA 2PN6A 3V42A 1YRNA 2ZB9A 1ILYA 3TW7A 4ENNA 4YY3K 2IDOA 4BQAA 2CQXA 5H6RA 5ICGA 1KU9A 2KDZA 3GTLJ 4BRPA 5C0YA 1S6LA 1X4OA 1S22A 4NLBA 4HW0A 2HBKA 2ZJ2A 1LWFA 3ZCMA 4OLBA 4PZJA 1L3TA 3WTSC 1Y97A 1MNDA 4BHBA 3BEXA 4B8CA 4C2MJ 5CQGA 1WSHA 5AQSA 1Z7UA 4H5VA 3L3UA 2M7BA 3GX4X 3ROUA 1QHGA 1SVLA 2O9LA 1JGGA 1YFHA 4QS7A 2L02A 3LM9A 4QOZB 3BR3A 3C95A 1IBKK 5CJ9A 3S1QJ 3HM8A 1IBLK 4FJGA 2DA2A 1HPMA 2B6AA 3W2WA 2RN7A 3O9TA 1Y0UA 2AQFA 4XMYA 3SUOA 1T03A 4PGGA 1FC3A 4LD5A 1O3RA 2V79A 3I55N 4CFAA 3LSPA 4FWQA 3RSEB 3CMAI 1WQ2A 4DTNA 1SD4A 4XLPF 3CM5A 3O4NA 3CCYA 2ATQA 2D4WA 2GBZA 2IAJA 3W3DA 4IRIA 3CQYA 4W5TA 2HNHA 3IS9A 2BEOA 3E5XA 4H4MA 3TQNA 3DYAA 3ISNC 3M4OJ 5IYBJ 4LSLA 2JVHA 3RZOJ 2V9PA 4KH6A 3DPTA 3UKRB 3ZSWA 4HV6A 1LW2A 1MZBA 2L0KA 2OZ6A 5GADP 2OUMA 3RRHA 1AHDP 1RDBA 4CHQA 4BGAA 1B8IB 2LBFA 4EJWA 5HLHA 4JS5A 2XY8A 1U47A 3BR2A 5GAEP 3JSOA 1Q9YA 1XD7A 3GMEA 4LH4A 2KDOA 5ILUA 1SZ2A 4A5NA 1EO1A 3BF3A 3MCZA 1E3OC 3EPZA 4FWNA 4CBUA 3V8JA 4A3JJ 3CCJN 1LWEA 4W5RA 4KT6A 2XHKA 4W97A 3KYLA 3O6BB 4DKWA 5AZIA 3S41A 3G71N 2HOSA 1HR0K 3ABMH 4ZYHA 1SL1A 2IAIA 1QQCA 4B9UA 2H6CA 4O3MA 2WONA 2OZMA 2KFZA 1MMAA 3G6EI 4YOTA 2R5YB 4BWMA 3HRUA 4E7KA 4BR0A 3RWUA 4EIAA 3KEOA 4ZTFA 3I8BA 3LL3A 3K4KA 3HRSA 5MLCQ 3H3UA 1JLCA 2JMWA 3CXCM 1ODDA 2CRGA 3DEUA 3DF8A 4XN3A 4KTZA 3G6EN 3VQQA 4PJLA 3WNHA 5EU7A 1NTCA 3DTKA 3K69A 4OKEA 4BROA 5B8HA 1X9MA 3VPZA 1NK6A 3L3VA 5EGOA 5AQNA 5SWMA 3QPSA 1SFKA 1RT1A 1W7AA 5IP6A 3DLHA 3PO3J 5LD2C 3OBYA 3CLOA 2IGMA 3HGYA 5DTDA 4JK9A 4Q5VA 3AG1H 2X9DA 3ZT1A 2A41A 2EJRA 3PQKA 3S3NA 1EH6A 3VYUB 5KI6A 1IUFA 4FLZA 1YXQA 4KRFA 2FD5A 4CCMA 3JXUA 1GT0C 2DT6A 4CCKA 2M0MA 1D8YA 4WQ5C 5A2QO 1KVCA 1B9NA 2IA2A 3LNQA 2B9SA 2FC0A 4Z0UA 4CJRA 4HUGA 4JI7K 2E1MB 2KZZA 3IH3A 2P4WA 5H20A 5K14A 1XQSC 3QNOA 4DQSA 2L7KA 3E7LA 4WCEL 4G8XA 2DA1A 2BW3B 4Z4GA 3SUPA 3CF2A 5DV5A 2ID6A 2LNBA 4CEBA 1BR4A 2MC4A 2PYJA 2VB6A 3M3YJ 1RT2A 2VQFK 1HKCA 3V7SA 4RAYA 3V9UA 3QOEA 1MMNA 3L7WA 3TP0A 5JHFA 2CO5A 4LGWA 1MDMB 4O44A 2F5DA 1LW0A 3B73A 1GLDG 3MX5A 2R3SA 4JKEA 3ENOA 3VETA 4AHTA 1XDSA 1W7PA 3LWFA 2HDCA 3CC2I 3ERED 3HTVA 3D2FA 4JNEA 3EY1A 5J2QA 1VFCA 2Y9YA 2VG5A 4F92B 2PAVA 5J40A 4JRPA 2FF6A 1S1TA 4HNTA 3GTMJ 2QLZA 2KIMA 5HBMA 1BR1A 2VJIA 4XM3A 1BC8C 5D4RA 2D0CA 4I7FA 4KB1A 2X1EA 1JCEA 4GV6A 1OR7A 2QCOA 3KLNA 2W41A 2OV7A 2XV4S 3MK6A 3QRFF 2VGNA 4JK1X 3DU5A 3GLLA 4JRQA 4FWMA 1FMVA 1WHUA 5DM7L 4EHUA 3SJMA 3PX4A 1RZ4A 5E8GA 2FNAA 1VZ0A 4NBQA 3CD6I 1UHMA 3E3VA 5ICEA 1GVDA 1ZR4A 4KICA 1AU7A 2FXUA 5FLXO 5BREA 4EFHA 4O8UA 2DMQA 4DS4A 4JI1K 4PK4A 1N33K 4YIRX 2NNYA 2IBDA 2ZMEC 3HTUA 1WI9A 3VFZA 3OSFA 4A3DJ 1RILA 2ZJRL 3R8EA 1V4RA 4L0YB 2XRNA 3GTOJ 4QAGA 3DRRA 3MZHA 2TDXA 4ZH4F 4BXFA 1KQ0A 3KK3A 2ME6A 4J2DA 1IAWA 4L9TA 1IUYA 1ZBFA 3FISA 4XRSA 4HF0A 3RPQA 3OS1A 1D8JA 5KGWA 5LJWA 3VA3A 2ELJA 4HOBA 5B1BH 3WHBA 1VQ4I 1ERDA 4DR7K 1TVRA 5IYDJ 3F8FA 4KIFA 3AL0B 4LH5A 3NE6A 3VQ8A 1V55H 3BUZB 2XY7A 1JKHA 2VC1A 3I71A 3IAS2 1NK0A 4BYYA 1ETWA 1RKTA 1K7AA 3HVTA 2DTUA 5GIOA 4CI6A 2HF4A 2JGUA 1DLOA 3F8CA 4YG2F 2QSHX 4DCHA 4FJKA 3FZMA 1S72I 1XSVA 4PA1A 3W0LA 3SAGA 2X51A 4ANJA 1Q8IA 4YOXA 1GUUA 1MWKA 3CMAN 1BR2A 3T5XA 4FLYA 4KI4A 3O1WA 4DR5K 3I55I 1R5HA 4JBAA 2I7PA 1C1BA 2JRMA 1NK7A 3VF6A 3P83D 5K7FA 2HVSA 2DPNA 4KTWA 2DO7A 1SQKA 3P9IA 4ICLA 4XH1A 1YJNN 2P8TA 4WWCA 2DOEA 3DWLA 4KHWA 1EWQA 1DGWY 1X1AA 1DDNA 1QA6A 4UHTA 4ZYAA 5F0HA 5CE3A 1ATRA 4DV7K 1NG9A 4ETSA 2EFPA 4U0YA 1RBSA 5M3MJ 3OYIA 4LF4K 3JRHA 2JK3A 4FJJA 3G2BA 2HQAA 2V9VA 2WAQA 4BRCA 3MD2A 3LP3A 1ZREA 1HRHA 3BTIA 5HRNA 4F2SA 1B1BA 4D9JA 1S9EA 3OR2C 1H89C 1QQMA 2VG6A 3L2VA 3MMVA 4FJ9A 2DAOA 4RGSA 3N4MA 2XC7A 1KCFA 5FKMA 1NH3A 1S72N 3C18A 1D5AA 4FZXC 4M7XA 2YHBA 4JYKA 4IOAL 2H1KA 2E7WA 1ZN2A 2V1XA 2YUSA 4AIJA 4BDZA 1MSEC 1QU3A 1J53A 1RDCA 4BQZA 1T8EA 1XNQK 2YJFA 4GMJB 4BGBA 1BA0A 2FRHA 2VASA 3HHGA 3K4MA 3M1CA 3BJAA 4HQMA 1SV5A 3HZ6A 3ZSVA 4BQQA 4AM7A 4OPKA 4KHPK 2XAGA 1JI8A 1MDUB 1J5OA 4V19S 1OR7C 3FXOA 5FGMA 1A5XA 1G99A 3PFIA 1RT5A 3QEVA 2Z33A 4JK7A 4W1UA 2QKLB 2Z1HA 3ZSRA 3Q0WA 1A5VA 4B9MA 1FYLA 2PLYA 1ZRDA 5JLXA 2EFOA 2XASA 1YHQI 4C3JJ 4CO8A 4Y13A 3LP1A 4CHZA 4JOMA 1QTMA 3N05A 3EKUA 1WOQA 4Q4ZF 2O8DA 1PJRA 1VI0A 2H3GX 3E6DA 3H1VX 2HTJA 4LK1F 5IPAA 5AQIA 3H5NA 3QIPA 3SCXA 3F5TA 1UZCA 4BREA 1HSTA 4P55A 4FLTA 3ZETA 1Y8QB 4CCNA 2ZD1A 3ZCOA 3WQTA 4XKCA 2OQGA 2GV9A 3AARA 2VBWA 3ULQB 3OOPA 4XQFA 4BBSJ 1D4XA 3NGZA 4ELVA 3TTDA 3CD6N 1CZ9A 4LLGF 3HVRA 4PSWA 1YHQN 5AQPA 3HM9A 3HJFA 3LDOA 3HK2A 1KYZA 4L8RB 3JAMK 2WAQN 4ZC3A 4OMYA 2VOOA 1TKTA 1PYVA 2FQ3A 3GL1A 2DT5A 3F3XA 4DTSA 3OMYA 1C0GA 3O9QA 1JJ8C 2KPMA 3WTVC 3H92A 3T69A 4KH5A 1VQ7I 2MG4A 1U9OA 3HBTA 4CF1A 1E17A 1YS7A 4FO0A 3G10A 3ZX0A 1AWCA 1K8AO 2E2NA 4KISA 3LA3A 2RAEA 4NCGA 4BC2A 5BPDA 3R61A 4CHYA 1X9JA 4JEPA 3K4LA 1SFEA 3KFWX 4XSZF 3HUGB 3ML6A 4QCLA 2UXBK 4A2UA 1P92A 3EZWA 3OYMA 3AVLA 3TO6A 5EF6A 1KU2A 3Q3SA 2DJNA 2FSWA 2M0CA 3JTHA 3WE3A 4HDUA 1YIJI 2V1UA 1RGIA 4DW6A 4DU4A 3GUDA 2XIGA 3HG9A 4LFUA 4HQEA 4BJTA 1JLQA 3MEEA 3D45A 4A0YA 1B6AA 3PFYA 1JUPA 1ONVA 4XOTA 3LMMA 3TMOA 3TEDA 1FKPA 3V1QA 3BT9A 3I0RA 3JRCA 1DTTA 3ZQFA 3NF6A 3SBGA 1ZHFA 1U2VB 2KZVA 2ZJRF 5TKYA 1HNVA 1VNDA 3K57A 3CJQB 2FF4A 1Z67A 4PJNA 3H9GA 4MDAA 3K5NA 3NH2A 4H0YB 1MBJA 2GIZA 3QBXA 4BRHA 3K0LA 5LHIA 3SYTA 1J5EK 1VQMN 1BI3A 1BN5A 3SFIA 3LSTA 3O2PE 1R5ID 4RGRA 2RE2A 2PX9A 2ZC2A 1ATSA 3G0ZA 5KPTA 4I98B 1QQNA 1ITGA 3ATVA 1TL8A 2VBZA 5C42A 1N8RO 2DN0A 3GFMA 1XHZA 4D5FA 4C8MA 4YOWA 4NC6A 2DFFA 4JI0K 3JTGA 3CCVN 2EIKH 4CCJA 1R36A 1D8KA 5BOXA 2M9HA 3K10A 5AQWA 2HKOA 4M6VA 3BOQA 4CSWA 1P8ZA 4O5BA 3WEEA 4CZHA 1IV0A 3WTZA 4JHDB 5AIQA 3D7EO 3WXLA 4Z4FA 4NHJA 1RTIA 3UR3C 5F64A 4OLAA 4XKVA 5KTQA 4F91B 3L2WA 1LDJA 3HXLA 1KTQA 1LFUP 2QK9A 1Z6TA 1HYSA 4B3TK 3JRBA 4FWLA 2RC4A 5E3OA 2QEXI 3N4QA 1RDUA 1LV5A 4G7HF 4O4GA 2KIFA 3MN2A 4EAHD 1HW5A 1NGDA 3IMXA 2HNDA 3J81O 2HHSA 1HKQA 4N56A 3HTSB 3VTHA 5CVJA 1RBRA 1Z25A 1UHWA 4G12A 3L8BA 4IF4A 4IBNA 5FPEA 1NK8A 4AYBN 2M7AA 3S1RJ 4CGGA 3CCEI 1A6IA 5AQUA 2NNNA 3TAQA 4C1NI 2RHKA 2JSPA 4S05A 4CYCA 3CC4I 1BM9A 1D1AA 2CV0A 4CK3A 3UE5A 3K0SA 1IV8A 4XNFA 2ADUA 1QQOA 2R7YA 2OCEA 2EV6A 4A3KJ 3K1PA 3HOXJ 1W7PD 2NRVA 4E7ZA 1RTJA 3CJNA 4DZJA 2ZSHB 2E20A 4KUMA 4WCGA 1HKGA 1NLVA 5M1QA 3VQ6A 3IC7A 1FYKA 2A6HF 4EM0B 2XY6A 4G9ZA 3KLOA 4IVNA 4IO9F 3BF1A 2L7MP 2Z9OA 4B9LA 2QXFA 1EX4A 3VQPA 2EH3A 3KTQA 2HOAA 2FBYA 3SPZA 3OTOK 3QICA 2K27A 1BJZA 4CZGA 2R7QA 1HXDA 3TSUA 1VQLN 1HDPA 4BR5A 4CBWA 4ENKA 3VQCA 3CP2A 4CZLA 2ZM6K 4N9HA 4DQ2A 1DTQA 4ZTJA 2IVNA 1FIAA 3WE2A 3NH1A 2EB7A 1NBWA 3S9HA 3E9OA 2X6XA 4EGZA 1L3UA 1YLFA 4DZPA 1IKVA 4E1NA 3HP6A 2FUG2 3K2AA 2E2QA 3R3LA 1FBUA 2X78A 1VQ6N 4Q48A 3SJJA 2HVRA 4FJHA 4O6JA 4JD2B 3OA9A 4IEJA 4DSFA 2XGCA 4FJ5A 4OPAA 4FM1A 1IXCA 1Z7LA 3FXJA 3T8TA 2P9PB 2YR2A 3RYRA 3HYIA 4HF2A 3RMDA 2HVHA 3OYAA 4UUVA 1QVUA 1G59A 2PMHA 1NGHA 4LF5K 3WT0A 1VQPI 4AIHA 5ILVA 5GP9A 1G15A 4FQGA 3DXJF 4HPQA 2XRLA 3L09A 3Q0UA 1HKSA 3F8MA 3IKTA 2D0AA 4L9JA 3NVKA 4B3XA 1WI3A 2NS0A 4A5MA 4ILGB 4OAYA 4ZJZA 1KQ9A 3QAHA 2NYXA 1JKQC 2HZTA 1S7OA 1ZG1A 1HMVA 3KK2A 4DFKA 5E20A 3TAPA 1U45A 1OYIA 2IA1A 2L9SA 4ELUA 4DR4K 3TI0A 4I9QA 2Z3YA 3KLIA 4LF7K 3LQQA 2WWYA 3OL3A 2VLAA 2CSOA 4DTRA 4O5VA 4Y33A 4LD0A 3MZYA 2F5VA 2HB5A 2V7ZA 2HU9A 3HEFA 2GXBA 3CCRN 4RM3A 3QFPA 2V6CA 5HVQC 5EYRA 2CYYA 4QSHA 1S1VA 2O61A 4CIFA 3RIRA 1F4KA 1HA8A 3U2RA 2M2EA 2AS5F 1WCMJ 4DU3A 2G7UA 2M4GA 4RB0A 4AC0A 1SD5A 1Z05A 2FMYA 3PNVA 5L3BA 5K5OA 3LPTA 3MKLA 2YS9A 1NOZA 2F5CA 3S32A 1VF9A 3CCUN 4KKOA 2VWKA 2XAUA 1NG6A 2GXGA 2I10A 3ZSOA 2Y75A 1Q86O 5E79C 5D5WB 1F43A 2H6BA 1FW6A 3BPXA 4GV9A 3QQAA 1BOTO 4M3EA 1L0OC 1Z6RA 3L4QA 4WQ4C 1QZZA 2I5UA 2O0YA 4RAZA 1ZELA 4U88A 2AP1A 2IVPA 2DTZA 1V54H 4B1VA 4YIIA 5L3FA 2HZDA 4C8OA 1XMXA 1BA1A 3F9KA 2M45A 2HF3A 1X58A 2H8RA 1MWMA 4DYRA 1J7KA 1MA9B 3FK7A 3PO5A 5FO5A 4LMYA 4CJVA 1VSHA 4IHTA 3SI6A 3E0JB 4B9VA 3MWMA 4B1YB 3ZYYX 3M8QA 3Q5FA 2D5VA 4IHYA 2XB5A 3RCOA 3MCAB 1MDMA 4CZFA 5HROA 2QSGX 3PLAA 3M1EA 1IF1A 4DWIA 4FPAA 1LKXA 1W5CC 4KMFA 1BIUA 3LSGA 2WTEA 3WGHA 3ZGKA 3FBIB 3L2QA 3MECA 3ISPA 4LC9B 2EV5A 4CHPA 3FXUA 3TGNA 4M74A 4EM2A 4HWIA 2F5EA 1ZYQA 2P7CB 2KZGA 5EDNA 2W82A 2CQKA 4E7SA 4Q5SF 3C0BA 4BY9C 1EH7A 2CS3A 3J7YJ 2NRTA 1LFBA 2F8TA 1V5EA 4HUFA 3M9AA 1X9WA 3IWFA 3KP7A 2HWVA 1GLLO 2E60A 4CW7B 1JJ2M 3H9JA 1TTYA 2F2EA 2JVGA 2NRAC 1IH7A 3AA5X 1IGNA 3KWGA 4K43A 5HS8A 3O4QA 2XB0X 2C6YA 2LKXA 4HRIA 4C8LA 1VRUA 3BTLA 4PGHA 1U5TB 4IL6C 4IQ4A 5AIPA 1S3XA 1USTA 2FSJA 4LITA 3LDQA 1MIJA 1NG7A 3LFKA 5TGTA 2M3AA 1OCOH 5CYVA 4YIFA 4KT5C 3FKIJ 1OKRA 2L01A 3DLKA 4GVMA 4AHRA 4YEJA 4HCCA 1G8XA 3S3OA 1S9GA 1OQYA 4IJNA 4JKFA 4BC4A 1OYYA 2ZSIB 5HLGA 3HL8A 1VQ9N 1WJFA 2IA0A 4A3GJ 5L3GA 2PZSA 2EA4A 1VSEA 2A42A 3TR8A 1JUSA 3EUAA 1OKJA 4FJIA 4Y7NJ 1HNWK 2NXNB 3HGGA 2O8FA 1VSFA 1ZH5A 2GELA 2OTLN 2FQ4A 3A2KA 1QZYA 3EDPA 3AVHA 4K42A 4FX0A 4XLNF 3K4CA 1YVNA 3NARA 2E1OA 4HNUA 1C1AA 1TUUA 4JK8A 1FZPB 3HBLA 3L0QA 4OINF 4BHCA 4D7NA 2W85A 1VQ4N 3CCEN 3PNYA 2JWKA 3ZMZA 3V7RA 4AILC 4KDPA 2QKMB 2YU3A 2FBKA 5FD6A 2HW3A 2E5ZA 3HOSA 1IDZA 1VQON 4EGYA 1RR8C 1QS4A 4U7DA 2F4MB 1S3JA 4M45A 1N6QA
chains in the Genus database with same CATH topology
3LWMA 3SV3A 2G8WA 2HHWA 3WNFA 4B48A 1JL2A 2OPRA 1WAFA 4J2BA 1D0YA 2VKDA 4KPYA 3DTIA 4CZCA 5I3UA 3PSIA 3OYCA 4CJ5A 1HJRA 2HHVA 3HOTA 3J7AY 4N4NB 3DLAA 2R4GA 3MXJA 3C2HA 1GOAA 4DF8A 4EZ9A 1TZLA 1BL3A 3MXMA 4N5SA 4CJPA 1CXQA 3OVNA 3KLHA 4NYFA 4CEQA