3HPHA

Closed tetramer of visna virus integrase (residues 1-219) in complex with ledgf ibd
Total Genus 64
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
64
sequence length
210
structure length
194
Chain Sequence
NIPLAEEEHNKWHQDAVSLHLEFGIPRTAAEDIVQQCDVCIDHWQVDYTHYEDKIILVWVETNSGLIYAERVKGETGQEFRVQTMKWYAMFAPKSLQSDNGPAFVAESTQLLMKYLGIEHTTGIPWNPQSQALVERTHQTLKNTLEKLIPMFNAFESALAGTLITLNIKRKGGLGTSPMDIFIFNKEQQRIQQQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Integrase
publication title Structural basis for functional tetramerization of lentiviral integrase
pubmed doi rcsb
source organism Maedi visna virus
molecule tags Transferase
total genus 64
structure length 194
sequence length 210
chains with identical sequence B, C, D
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2009-06-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00665 rve Integrase core domain
A PF02022 Integrase_Zn Integrase Zinc binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.200 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Arc Repressor Mutant, subunit A 3hphA01
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 3hphA02
2O4IA 1CXUA 4Z4GA 3LANA 3BGRA 4CFCA 1TKTA 3DLHA 3QEVA 3DLKA 3ZSYA 1NJYA 3D45A 4L8RB 4Z4CA 3RWUA 2DFEA 1KVAA 3T19A 1Q9XA 1RBSA 4DS5A 1BIZA 1WAJA 5CYMA 4ID1A 3ZSQA 3OYAA 5HRSA 4FZZA 1KVCA 3NFAA 4N41A 3NDKA 1XHZA 4AHCA 1S9GA 4NYNA 4JRPA 4I9LA 3VQBA 3AVHA 1EETA 1TL3A 2RPIA 4CJ4A 1DLOA 3ZT1A 3NCIA 4B9NA 5FRMA 4M3XA 3LP0A 2D0BA 1Z25A 2PYLA 3JYTA 3NF7A 4FJNA 3SQ4A 4DU4A 1IKVA 1TK0A 1YTAA 1C6VA 2P1JA 2QKKA 3SUOA 2P5OA 3L3UA 4DSIA 3AVBA 1XC9A 1BGXT 4JS5A 2O4GA 3L2RA 3CQ8A 2DFFA 1BI4A 3KKRA 1XHXA 4LH5A 1HQUA 3NF9A 4CEOA 3VQ7A 4FM1A 4EP4A 3I8DA 3DM2A 3QLHA 1HYVA 4ID5A 1U47A 1NJZA 4NYFA 3OJSA 3LP3A 1KCFA 3SYZA 4RW8A 1DTTA 5CYQA 3OS2A 1A5XA 4CEEA 1WJDA 1C0TA 3HP6A 1REVA 3I0SA 3CM5A 3K5LA 1RILA 1RTJA 4DSLA 4KHSA 3OYKA 2G8VA 3L8BA 1RT6A 3OS0A 2YKMA 4WE1A 4CHYA 4DFMA 3SJJA 4Z4IA 3TABA 4CERA 5KRSA 1TAQA 4OKEA 4KHNA 4CHNA 3AV9A 3THVA 4CGHA 4JRQA 1L3UA 2HW3A 2XO7A 2BANA 4CHQA 3O3FA 2LSNA 3SNNA 1WSIA 4W5TA 4UQGA 4J2EA 2KFZA 4FXDA 2YKNA 1NK6A 1J9AA 4OJRA 1SKRA 3ZCMA 1T03A 2X74A 4OLAA 4NCBA 3V9ZA 4CJ3A 3QEIA 1BI4B 1KLMA 4KB1A 3S3MA 4FJ8A 1TKXA 4FJXA 3OYBA 1WSEA 4CIFA 2I5JA 3ZT3A 3VA0A 3OYLA 3PUFA 3PX6A 4QOZB 4OVLA 4Q0BA 3DRRA 5EU7A 4FK4A 1WJEA 4OGCA 3HVTA 4CK2A 4FLYA 3WNHA 3WNGA 3V4IA 3V6DA 1S1UA 3WNFA 1UA1A 2PYJA 4C8KA 1RT1A 4M3TA 4I9QA 2KQ2A 4B9MA 4E89A 3SUNA 4O4GA 4CJLA 4FLTA 1NK5A 3PO4A 1WJBA 1JKHA 4KTQA 1S6QA 4CF0A 4CFDA 1WSGA 3KD5E 3VQCA 3PV8A 3CM6A 1J5OA 4E1NA 4PY5A 1W0HA 4JLHA 4DFPA 4B3OA 3L3VA 3ZSZA 3IAYA 4FJJA 3ULDA 3LWMA 3TWHA 1WNSA 4CEDA 4ZTFA 3HPHA 3P5JA 2EHGA 4CEBA 2F96A 3F73A 4FM2A 1RDCA 4RG8A 4CECA 2D5RA 1QQCA 3TANA 1Q8IA 4GMJB 1TKZA 1KFSA 1BL3A 2F8TA 3C6UA 3F9KA 5HRRA 4DG1A 2FBYA 4FJMA 2OPRA 3KJVA 3ZSVA 1RDDA 2Q3SA 3AVKA 4CEZA 4B9LA 3ZT0A 3CFRA 4EP5A 3NH2A 4CJQA 3ASMA 3O3GA 3SPZA 4DLGA 2HHUA 3OYIA 1ITGA 1A5WA 1HMVA 4ZTJA 4W5OA 4AH9A 5C24A 3TR8A 3OYDA 3QETA 2QXFA 1BCMA 1VSIA 4BE0A 4LSNA 3QESA 3KD1E 3VQEA 4FJ9A 1RDAA 1S6PA 3AVCA 3TAPA 2OZMA 1QTMA 1KLNA 3S3OA 4IG3A 2HNYA 1C0UA 2FBVA 4CF1A 3SV3A 1GOCA 3SI6A 3L2UA 4NCGA 3AVMA 4AHVA 1JXEA 1X1PA 5JS2A 2IOCA 3AVIA 3LPTA 2P5GA 2G8UA 4ELTA 3AVJA 4DTNA 5CY4A 4W5NA 3PX0A 1I3AA 4DS4A 3QIOA 2G8HA 4QCLA 3CFOA 3RR7A 3NGIA 1VSFA 1S1WA 3KLIA 1JL2A 1U48A 1LV5A 3KLEA 3VQ5A 1QE1A 2VWKA 2R7YA 2FBTA 4W5QA 2OPPA 2G8WA 1T7PA 3HVRA 4O0IA 4EZ9A 3B6PA 1UOCA 4ELVA 3ZSRA 1JLBA 4N47A 3U3GA 4KRFA 2OA8A 4CESA 1HQEA 3TAFA 4E7LA 3PX4A 4B9SA 1G15A 4BWJA 4CF2A 3P1GA 1C1BA 1HJRA 3T1AA 1NK9A 1VSLA 4DQIA 4NCAA 3AO3A 4BE1A 3C95A 1JL1A 4CJRA 4F3TA 3VN5A 1BQMA 2YNFA 1QSSA 1HYSA 1U49A 1BQNA 1NK8A 4B8AB 2Y1JA 1JLQA 2Z1IA 3K5MA 3V1OA 4PQUA 4E7HA 4DFJA 4CJFA 2DTUA 1J53A 4KREA 3OVNA 4CJ5A 1KRPA 1CZBA 2IAJA 1MW7A 4FLXA 4C8LA 3ZSWA 4KHUA 1EKEA 3LAMA 4FLUA 3QERA 4Z4EA 3EZ5A 4AHTA 4ELUA 2IDOA 1IKYA 1Q9YA 3ZSOA 1RBTA 3C94A 1HRHA 3RRHA 1HPZA 4F3OA 1TAUA 3AO4A 5C42A 3S3NA 2KZZA 4FK0A 4DU3A 2PZSA 3KTQA 3CFPA 4DQRA 3TAMA 1RDBA 3M8PA 1HNVA 2DFHA 1C1CA 3DYAA 4FZXC 2QK9A 2X6SA 4LY7A 3KK3A 4CEAA 2D0AA 1MU2A 3I0RA 3ITHA 3AVNA 1LWCA 1S9EA 1TK8A 1RBVA 3SQ0A 2G8KA 3HO1A 4AHSA 4ZHRA 3S9HA 3SQ1A 4CIGA 4KV8A 4C8NA 4PWDA 2EX3A 2IGIA 4Y1CA 3SUPA 4IG0A 4KTZA 1D9FA 2BDPA 1IH7A 3H08A 4B9UA 3MEEA 4DU1A 1NK4A 3TI0A 3PO5A 4Z4HA 3DMJA 4G1QA 3KK1A 2WOMA 2VG7A 4DWIA 4E7IA 4EZ6A 3RMCA 4QAGA 3K5NA 3SCXA 1Y97A 4BWMA 3DLEA 1HNIA 3V1QA 1FK9A 1L3VA 2HHSA 3QNNA 2YHBA 1ASVA 3HYFA 3AO1A 4N5SA 3DLBA 3OYNA 2YNIA 4OPJA 1NK7A 4FJ5A 3AA5X 4FVMA 1TK5A 3M8RA 2YV0X 4M41A 3DOKA 3MXMA 2RF2A 3K5OA 5CZ2A 3KLGA 3MAQA 3LZJA 4J2DA 4M3ZA 3QO9A 4CF9A 3VQAA 1RT5A 3T3FA 4FJHA 4DTPA 4CGGA 3SV4A 3VQQA 4DFKA 3MXJA 1JLFA 1WJFA 3K2PA 1GOAA 4KO0A 5KGXA 3L2WA 1NOYA 4ICLA 4B9TA 1LAWA 1B9FA 4CK3A 1F21A 2YHAA 2HNDA 4OKKA 2AJQA 4FJIA 4FJLA 2D0CA 1NOZA 3U6FA 1SKWA 2XY7A 1YTUA 1ZBFA 4CJVA 3UIQA 2BGGA 4CE9A 4BDYA 3VQPA 3HK2A 2KTQA 1N6QA 1NKCA 1SL0A 1NKEA 3QIPA 4OGEA 2FBXA 4OKJA 4W5RA 4E7JA 3AO5A 4H4MA 3OYFA 4PUOA 1RT7A 3B6OA 1KVBA 2E4LA 2KW4A 2E6MA 1JXBA 2BE2A 4HVJA 4CJKA 3K58A 1U04A 4I7FA 3V81A 4FCYA 1ZBLA 1RTIA 1VSKA 2VG5A 3CYMA 4H8KA 1UWBA 4O44A 5J2NA 4KHWA 3VQ6A 1ZYQA 4J2AA 4IFVA 1KONA 1JLAA 3NF8A 5KGWA 5KTQA 3IG1A 3CG7A 2VWJA 4F8RA 2OPSA 2KFNA 2DY4A 3KLHA 4DTSA 5K14A 3HT3A 1T8EA 3G10A 3G0ZA 4CEFA 4FW1A 4HUFA 1LWEA 4E19A 3LZIA 1IKWA 3DRSA 4DQQA 4H4OA 4AILC 4CJPA 5FRNA 2HB5A 4GW6A 4FJKA 1LAVA 3ALYA 4FLZA 3OYGA 1SKSA 1HYZA 1RCHA 2XRIA 4CFBA 1WSJA 2B6AA 2P51A 4CIEA 4FK2A 1WJCA 2ITGA 4BDPA 4C8OA 2B5JA 4FJ7A 3RRGA 1TVRA 2WONA 3V9WA 3DLRA 3HP9A 3O4NA 2XHBA 4IDKA 2OPQA 4HUGA 4I2PA 3AO2A 4IFYA 1O1WA 1WSFA 4Q5VA 2Z1HA 4KKOA 4Y1DA 4RW4A 4M3WA 1L3TA 4BE2A 4DSEA 1UA0A 3K57A 3O4QA 2QKBA 3NGZA 1BHLA 1VSEA 4E7KA 4O0JA 2XY5A 4RW6A 3OYHA 2HHWA 2NUBA 4FLWA 4CEQA 5KRTA 1BISA 3KKSA 3VQ4A 5J2QA 1NK0A 2YNGA 1RTDA 3RR8A 1FKPA 1D5AA 5HRPA 3OS1A 1ZBUA 3AVGA 1WAFA 5HP1A 1KFDA 3FFIA 3HM9A 3V9SA 1JLCA 3KIOA 2JGUA 4OLBA 3NH0A 1YT3A 5E41A 1SUQA 3OYJA 4BDZA 2XY6A 4F4KA 2JLEA 3V9XA 1UAXA 1WLJA 3OYMA 4HTUA 4DTXA 1ZBHA 2RKIA 3IRXA 5J2PA 3TAEA 3HXMA 2FC0A 2ZE2A 3SZ2A 3KK2A 4M3UA 2HVIA 5HLFA 1CLQA 4CJTA 4FM0A 1BIUA 4LD0A 4Z4FA 4CJEA 4KTWA 1TL1A 3MEDA 1RNHA 4TSXA 3LP2A 4M3YA 1A5VA 1RBUA 2ZD1A 4Z0UA 4N76A 3AA2A 1B92A 3MEGA 3VQ9A 4KAZA 3WNEA 4IBNA 3QEXA 1TV6A 4KPYA 4FZYA 4DTMA 2HHQA 1LW0A 3ZSXA 4DQPA 1RT3A 5I42A 3RTVA 1TKDA 4KHQA 3TARA 5D3GA 2RN2A 3LP1A 1EXQA 5HBMA 4DTRA 1D9DA 4CCHA 5FROA 3OYCA 1K6YA 3EY1A 3NF6A 1LW2A 3QINA 4O5BA 3NHGA 2HHVA 4GVMA 1QHTA 4B08A 3NE6A 1VSJA 2W42A 3TAQA 1EX4A 3AA3A 4M45A 4DSFA 3QNOA 3PY8A 1N5YA 3LDSA 4KFBA 2X6NA 2IS3A 5HRNA 4OPKA 1KTQA 4R5PA 4F2SA 1QS4A 4N56A 2A1SA 2ATQA 3K59A 5DMRA 4LSLA 1L5UA 1I39A 4HCCA 1EP4A 4CJUA 1RBRA 3MECA 2OYQA 1VRUA 1NJXA 4RW9A 2G8IA 4CGJA 3V1RA 4CGDA 4K8XA 4CGIA 3DLGA 1S1XA 2HHXA 4CFAA 1ASWA 5J1EA 2B4JA 5T7BA 2Z1GA 2VG6A 4F2RA 2IC3A 4FJGA 4CHOA 3ZT4A 1ZBIA 2XY8A 1WJAA 4KHYA 4K8ZA 3C6TA 1ASUA 3D0PA 4DSJA 3JSMA 3NH1A 5HROA 4KI6A 1QSLA 5SZTA 1XWLA 3AA4A 1BCOA 1WSHA 5FDLA 3P83D 1C1AA 1CZ9A 2GUIA 3AVLA 3NGYA 3VA3A 1S1VA 4E1MA 2F8SA 3HPGA 3E01A 2Z1JA 3DI6A 4C8MA 4AHRA 1XI1A 1T05A 2ETJA 1U45A 2HNZA 4CK1A 4DLEA 4YNQA 5JS1A 1NKBA 1IKXA 4E3SA 1VSMA 2YNHA 4DTUA 1U4BA 3OY9A 2GBZA 3IS9A 5J2MA 4DMNA 3M8SA 3SUQA 1X9WA 1NJWA 4PA1A 5CZ1A 4M3RA 3LAKA 4KB0A 3ZT2A 4DF4A 3TAGA 1IG9A 1TGOA 3QEWA 1SL1A 2PY5A 4HHTA 4DQSA 1IO2A 1SL2A 2HVHA 3DOLA 5SWMA 3AVFA 3L2QA 2X78A 4O55A 3VQDA 4F3QA 1D8YA 3BDPA 4CJWA 1VSHA 3OJUA 1GOBA 3NAEA 3QEPA 4M42A 3ISNC 4IKFA 4AHUA 1Z26A 1E0EA 3RMAA 3HSTB 4CGFA 4HCBA 3SQ2A 4E0DA 3DRPA 3EYZA 3RMBA 3MXIA 1KSPA 4B9VA 4FYDA 1YVUA 4J2BA 4JS4A 2E6LA 2A1RA 1X9MA 1LFPA 1J54A 1VSDA 2GV9A 5KI6A 4CHPA 4FLVA 4FW2A 4RW7A 4DTJA 1S1TA 3OYEA 1FKOA 4CHZA 3HJFA 1CXQA 3HL8A 4B8CA 2HHTA 1VK0A 3KLFA 1VRTA 1FXXA 1L3SA 4I2QA 1JLGA 1RT4A 4MFBA 3U3YA 2ZQBA 1LWFA 3VQ8A 1C0MA 5C25A 3NBPA 4HUEA 2G8FA 2Y1IA 1JLEA 4CF8A 3SPYA 4DSKA 4CJSA 3A2FA 4BACA 4DTOA 2HMIA 1S5JA 2KZMA 1DTQA 1X9SA 1W9HA 1R0AA 4XIUA 1SV5A 3O3HA 3HPOA 1QSYA 3RMDA 4LH4A 4YFUA 3L2VA 3V9UA 3M8QA 3LPUA 5I3UA 3LWLA 1WN7A 4DF8A 1B9DA 3AVAA 1RTHA 5DK5A 3LALA 4MQ3A 2OZSA 4KI4A 1RT2A
chains in the Genus database with same CATH superfamily
5D4RA 4Y15A 4OPHA 3S93A 1RBSA 4HW0A 1MNDA 1B9NA 3CMMA 3CCLN 1QVTA 1Z25A 2D0BA 4BQLA 1XX5A 1XSDA 5CJ9A 3SQ4A 2KHOA 4WXDA 3CD6N 1AOYA 4BRLA 3SJMA 1X9WA 5M1NA 3AG2H 3K5LA 4OX9K 1RILA 3K1NA 2YKMA 1NH3A 3ZR8X 5EX5A 3THVA 2BANA 1WSIA 1NK6A 4OJRA 2VJ4A 4W97A 4DZPA 1JKPC 3DQVC 4AU7A 1BA0A 4CIFA 2AQFA 3PUFA 4A2UA 3PFYA 4C8KA 5JLWA 4Y7NJ 1NM1A 2KQ2A 2DAOA 1KAXA 1SQKA 1J5OA 3KLNA 3H46O 1HF0A 3L3VA 4IEIA 3D5LA 2J5OA 2FF6A 3BWGA 4AWXB 3HRTA 3PSIA 5H2FC 3QODA 4FISA 5D6FA 4RG8A 2JK3A 2MGQA 3MKYB 2DMTA 3GW2A 4YFNF 2IT0A 2OPRA 4M6VA 1O3SA 1S3XA 3OYIA 4AH9A 4PJJA 4G6TB 4ZYGA 3TAPA 1KLNA 4UB8C 2F7TA 3GFMA 5CR4A 1GVJA 1BM9A 2FBTA 3HVRA 3FM5A 1XCVA 2F5EA 4EM0B 5AQVA 3HM5A 3H1VX 2VOOA 5ICEA 1E3HA 3LM2A 3PO2J 4FWKA 4KNYA 3GWZA 1XPXA 1DGKN 3Q9SA 4ELUA 1G59A 2LD5A 4BS9A 3C94A 4F3OA 1G3SA 4D5CA 2ASMA 1LQ1A 1C1CA 2R93J 1NK4A 3MCAB 4XBFA 4Z4HA 3E5XA 1A35A 2GOXB 4K2EA 4EZ6A 3R3LA 1Y97A 3RSNA 3DLEA 4B3SK 5LMNK 3K5OA 4JK8A 4CF9A 3CF5L 4RA2A 2I10A 1EH7A 3CMAI 3THXB 3S17J 1XSXA 2VN2A 1J2XA 2BGGA 2XB5A 1RT7A 3BEXA 3OBYA 3TMOA 1VSKA 3NQOA 4M71A 1YW8A 5AZIB 4F8RA 2P9KA 4NC7A 1QNTA 5K14A 1T8EA 1BR4A 4CEFA 1HBXG 2AQEA 2WAQA 1OMIA 4K0KK 5KPRA 4CCJA 1ZRFA 5GIPA 4NUBA 1H1VA 1HSTA 3AO2A 5JFRA 2NNWA 1VQ4N 3HKZN 1VQON 4KBOA 2E2QA 2HYJA 2MSYA 5L3DA 4QSHA 1U78A 4IOXA 4GV6A 4M9XA 5ILSA 2PMUA 5FO5A 1XS9A 3PNTA 2XAHA 1MH4A 3WUHA 3IP4B 2E34A 4OLBA 4C2TA 3KE2A 5E41A 4JP0A 3WGIA 2JTVA 3IRXA 4CJTA 1TL1A 1KGSA 2VUMJ 4DKWA 1RBUA 4AQYK 4LB6B 3THYB 3C65A 1LW0A 4IEJA 5I42A 1MWKA 1FWZA 2RN2A 5HBMA 3AFHA 2VE8A 4RGXA 4CCHA 3NF6A 4UUSA 3QINA 3O9TA 4IHVA 2W42A 2W25A 1D1AA 3SYTA 4CICA 1QS4A 2HHXA 3G25A 3HSEA 2OV7A 5LRRA 4FJGA 4CHOA 1USTA 4KHYA 2KLAA 3D0PA 4KYWA 2BY0A 3LQQA 1DUXC 5HL7L 3AA4A 1BCOA 3AVLA 4U7DA 2FNAA 1K4SA 3HPGA 3DI6A 2O8BA 4C8MA 1LFUP 1J75A 4C1NI 4EJVA 2P7CB 1M1EB 3U4LA 1BOTO 2PLYA 2EZKA 3QEWA 1ESVA 1JKOC 4YOUA 2TCTA 3VODA 2QW9A 2O8KA 2XF5A 3SQ2A 2DI3A 3EYZA 3MXIA 1TT5B 4E7ZA 4CHPA 5GPAA 3OL3A 1OJLA 1WVRA 2FA5A 3WXKA 1BJAA 3S32A 2GAUA 3Q9VA 3R8EA 5I3UA 3LWLA 1JUMA 2YI1A 3HOVJ 2W24A 4EJTA 4KI4A 1BDGA 4Z4GA 4CFCA 3BGRA 3DLKA 3WTZA 3D45A 5FKLA 3E9OA 4BR9A 4JRPA 5BN9A 1TL3A 1WKMA 2VPRA 4LK1F 5J40A 4JI6K 1XGOA 3VPRA 5F27A 3SUOA 2JJ7A 2V4JC 1PYVA 2JSPA 3I8DA 3VMFB 3FXUA 4DGWB 1XMAA 2Q1ZB 2ZSHB 3QDKA 4KHSA 1XB4A 1E3PA 5KRSA 2YX4A 1R4NB 2FXUA 4ZYEA 3ID8A 2O8DA 1BI0A 4B47A 3V9ZA 4DV6K 1TUUA 3ZT3A 3HOWJ 4OVLA 2QENA 3HVTA 3E97A 4O4GA 1S6QA 1YS7A 1FIAA 2W48A 5CVVA 1N25A 2PX9A 3ENOA 3ZSZA 3U8XA 4HSTA 3P5JA 2KKOA 4BAYA 1SD4A 2VXDA 3BG7A 3ZEUB 3ASMA 2DA5A 4W5OA 2OZ6A 1QQNA 3H9QA 4WWCA 5AQQA 4FJ9A 2DMQA 3KP5A 3I55N 4CF1A 5LBQA 1R22A 5KQ8A 5JS2A 4ELTA 2RN7A 3QIOA 3CC2N 3CFOA 3JAMO 2XKOA 3I3LA 4DYRA 2L9RA 1QSSA 2P4WA 2V26A 2Y1JA 4PGGA 2Z1IA 4PQUA 2X6WA 3CCSN 3I56I 1GLNA 3WQUA 4DV7K 1JXSA 1GLEG 4JD2A 1P6RA 1XMQK 2V9KA 2VB6A 4FK0A 4JX6A 2VKEA 3AGKA 3KK3A 4ON0A 2G8KA 4ZHRA 2NLXA 1SS6A 4JKGB 2HR3A 4M7XA 3K5NA 3KP4A 4FE4A 1Y1WJ 1KYWA 1LDJA 4C9YA 3ZQIA 1X58A 1HW2A 5AJ3K 2XRLA 1XNRK 1ONVA 3IH4A 3AL0B 3HBLA 4B9TA 4LG3A 4A2BA 2QBYA 1RUNA 2HNDA 1RC9A 2XV4S 4FETA 3M07A 1YTUA 2JMWA 2WAEA 3OBWA 2XY7A 2AO9A 1NKCA 3P7NA 1U9NA 1GLFO 2FJ1A 2DT7B 4A93J 2E6MA 1U04A 5HLGA 1RTIA 5E84A 3ZMVA 5KAFC 2MYSA 4DQQA 4LMYA 1S7AA 1LAVA 3ABTA 5JHFA 2A6EF 3HKZA 4Y52J 1MMGA 3OTOK 3TDUC 1VQ5I 4RBOA 5ADXH 2WC9A 3DFGA 3PO3J 1FOKA 1VSEA 2PMZN 4HBLA 4RW6A 2HHWA 1K78A 1BISA 3VQ4A 3FMQA 2OA4A 3LSMA 2R92J 3TEDA 1IG8A 3TDZC 4HLXA 2A5YB 5L3BA 4XH4A 4HTUA 4DTXA 2D0OA 2RHKA 2FC0A 2ITMA 1NGEA 4F9OA 3MEDA 1M90O 2VT2A 1GT0C 1BA1A 3ZN1A 3WNEA 3GX4X 3MCZA 1D9DA 2JPBA 2E1YA 1HA8A 2HXIA 3CLQA 3BROA 4ZZDA 3NE6A 4ISFA 3SAGA 1N5YA 2LC2A 5DMRA 1L5UA 1I39A 2LRDA 3GTOJ 4KDPA 1P4WA 3IC7A 4AC0A 3A01A 4KT5C 2XGCA 4NQWB 1WJAA 4FX4A 4I6MB 4G94A 4YOWA 3LSIA 1S72I 2V7ZA 1O3RA 1CZ9A 3SK3A 1KC8O 3CUQC 3NAUA 1VQ9I 2XSJC 1IKXA 5J2MA 3CJRB 5CZ1A 3F3XA 3U2RA 2FRHA 2KPMA 3G73A 5TRDA 5CLSA 3NAEA 5AQUA 2WFBA 1F43A 3B6CA 4DQ8A 1LFPA 3EEQA 4IHSA 3H92A 1OYIA 2XIGA 1AA7A 3F23A 1JLGA 2OUMA 1FBUA 4FHTA 3EYYA 1TZLA 1HKTA 1X1BA 3RQ4A 5JVHL 5LHGA 5C2FA 3OIOA 2H09A 1ERDA 2Y0SN 4YELA 4OU0A 2X85A 4RM2A 5KPTA 4MFEA 4C1NK 5FRMA 2K40A 2X1DA 1IV0A 5GIOA 3EPZA 4KUMA 1Q86O 2PBIA 4Q5SF 1X1AA 1FNNA 3OS2A 3HP6A 2BEOA 1O3QA 2PJRA 2D1KA 3N4PA 4GNIA 2RGVA 2J4RA 1QO0D 3I4MJ 4CHNA 2M2EA 2Q8KA 2DMNA 4U0YA 1Z77A 5GTHC 4XONA 4CJ3A 4KB1A 3K7AJ 3WTUC 2RNJA 3OYLA 3C7JA 2I8DA 2M1BA 1S1UA 4KJZA 3UB5A 4E89A 4IO9F 2HYGD 2V7FA 3H6EA 4I02A 3ESWB 3IV5A 4PY5A 3QU3A 1MDMA 2MLKA 2F96A 2WADA 1BL3A 2F8TA 1YRNB 2OBPA 4AF1A 1MNMC 2K02A 3TSQA 4L3QA 2XASA 4A3GJ 4MNUA 2ME6A 1BCMA 1JHFA 4BJ6C 1RDAA 2I7NA 3E9PA 2O0YA 3S3OA 4FWNA 4LGWA 4NCGA 1S1WA 1U48A 5IT3A 1ZHFA 2X1EA 2MC4A 4EZ9A 1LOTB 3WHCA 2CJJA 4KRFA 3VOVA 3CMEI 3U1DA 2Q2RA 4JHDA 4MEYF 2LKXA 3BLYA 4GDFA 4PHTX 1OCOH 2LTPA 1WRJA 1QHAA 1U8BA 1XD7A 1YHQN 4JI7K 3HIFA 3AG3H 1D0XA 4ENJA 2EFPA 1G3YA 1FX7A 1P4AA 5E18F 5E3OA 1QQOA 3S3NA 1KU2A 1Z6RA 4BRGA 3M8PA 2DFHA 3GEZA 3DYAA 3CLOA 5BOXA 2GWKA 3SQ0A 4MLEA 1YJ9N 4Y1CA 2L7ZA 4CZJA 2P9SB 3G1LA 5K5RA 2DA7A 2ZFUA 3DWLE 2VBWA 4N5SA 4JEPA 2YNIA 4FJ5A 4M41A 2DXIA 3VQAA 3T3FA 2XAFA 4G6DA 2QWOA 2Z5UA 4FOIA 3MXJA 3K2PA 1GOAA 1X3NA 3M5RA 2RDPA 2NVYJ 3LOCA 3CP2A 4FSVA 2R5ZB 3U6FA 5BR9A 1ZBFA 4CE9A 2E71A 1ZGAA 3HSCA 1FZPB 4P1WA 3FZMA 1HR0K 4UVAA 2ZMEC 4IFVA 3CG7A 4FW1A 3IKTA 5GAEJ 4FJKA 2QA4N 2XRIA 5J1UA 1YAGA 2PMZA 4JI8K 2KFDA 2HI3A 3JAMZ 3CTAA 2OYQA 4ZC3A 1IBLK 1D5AA 2E20A 1ZBUA 4HF2A 3KPHA 5CVIA 2X9DA 3O8HA 4YIFA 1YTYA 2JGUA 5LEJA 2XY6A 3S2HJ 3V9XA 2Y48A 3CCUN 3QRFF 4LFCK 4MGRA 4I98B 3RYRA 3RSEB 1MA9B 3H5RA 1B72B 3A5OC 2FOKA 2R7OA 3BJAA 5F1XA 2DOFA 4N76A 4WK8F 5TGTA 3K4KA 3T1HK 2A40A 3VEPA 2FMYA 3LP1A 4LLGF 1G8XA 2HZTA 3EUAA 3GOIA 5HDKA 1RRJA 2LMDA 4DSFA 4XRSG 3N4QA 3C6AA 2CFXA 4XL9A 5LEKA 3QYBA 4QS8A 4IOAF 3OSFA 4N9HA 2JVHA 1QVGM 3VB2A 1ZR4A 4RB0A 4XOTA 5E26A 1ILYA 2LF7A 1XWLA 3NGYA 4M7YA 3VA3A 3HGGA 3MD2A 2RNGA 1T05A 1HSJA 2KZVA 4DLEA 1XCBA 2LREA 3ABKH 4MDBA 1R7JA 1XMKA 4LFBK 4IHXA 2K27A 5CHIA 3WU2C 5F04A 2STTA 1P4XA 2IPQX 2B9SA 1G3TA 2ASOA 1IG9A 3J7ZO 2P9IB 1OFCX 3OJUA 3QEPA 4Q4ZF 3TL4X 2W00A 3O1WA 3R9PA 4RB2C 2Q36A 3S8PA 4KIGA 1C0MA 3NBPA 1TNTA 2HMIA 4L5JA 4BRFA 2VQCA 4M3GA 3KVGA 1TQPA 1WN7A 1J9IA 1JGSA 1RTHA 1VAZA 1T6SA 4FZXC 3CCMN 1ETVA 2ZM6K 2DFEA 1GXPA 3ZSQA 3NFAA 2R7XA 3VQBA 3CC4N 1IBMK 2L7MP 2EILH 3ATVA 2BVLA 2FF3B 1C6VA 2QKKA 4GVEA 4PZJA 3TOAA 5M3MJ 5DTDA 3L1PA 3D6RA 1XTAA 1HYVA 2HQ5A 1IF1A 4D7NA 4I09A 4CERA 1DGRM 4N9IA 1JT0A 1IXSB 3Q0UA 1YI2N 5FD5A 2LBFB 2CYYA 3OYBA 4CK2A 3WNHA 3ENBA 3MWTA 3BCBA 4JX5A 1Z67A 2L4AA 4BNCA 2L9SA 4DFPA 4ENKA 3ABLH 2HQRA 1WNSA 2D5RA 3ONQA 2D5VA 2CW7A 4N4OB 4UB6C 5DEQA 2BY2A 2LFBA 2HHUA 1HW1A 3TR8A 3DV8A 3HDDA 2QWQA 3ERED 4EM2A 4AHVA 2PFUA 3M7GA 3AVJA 5CY4A 4LIUA 3GUDA 4QCLA 3KLIA 2JRMA 3JSPA 2M4KA 1UOCA 1K6OA 4N47A 2QLZA 4M73A 1RI7A 4FOEA 1S5LC 3C95A 5LJVA 1W2BM 1QRYA 1EF4A 4BHBA 3CP8A 3FZFA 3E6CC 4ZYDA 4I0BA 3V7SA 4AVPA 3ZLJA 3ZSWA 3LAMA 1RBTA 3RRHA 1HPZA 1I6XA 3H0GJ 2QI2A 3A0IX 5JLFA 4HNVA 5IP7J 1GLAG 1HNVA 3VYRB 1HKBA 3FXKA 3HO1A 2YU9J 3CHWA 4WFNL 4A69C 4V2FA 1R5HA 3D2FA 3VTHA 3KK1A 4DWIA 3FK7A 2PMHA 4O5VA 2VQLA 3AO1A 2CMPA 5EXWA 1IZ1A 4DUZK 3LA7A 5C0YA 5KGXA 4B1ZA 4N0BA 1TL8A 3MMYB 2FSJA 5CYVA 1VQMI 3SZGA 4IRIA 1BWFO 2IS4A 2V79A 3Q7BA 1X9JA 1W4MA 5BRFA 5C15A 3ABUA 2KKZA 4O44A 3H1CA 5DD8A 4QTRA 1NGDA 3ZRGA 3CJ7A 3VEWA 4O3MA 4DR2K 1D5YA 3AAQA 4S04A 1A04A 3VEXA 1SKSA 3DXJF 2DJIA 3K2ZA 4BDPA 4B8XA 1R36A 4B3MK 1TVRA 3O4NA 4O8KA 4HUGA 1WSFA 3NWSA 5FFXA 2HFHA 1XMXA 1ZH5A 3C7NB 3KLOA 3NARA 4E7KA 3LDOA 5J2QA 4M9SA 1I6HJ 2VASA 4X64K 4DR7K 2KMUA 4EJWA 5H6QA 2M45A 1X3MA 1V5EA 5JR3A 2XUBA 3G6EI 1WWXA 4LITA 3CI5A 2DFIA 3BJ6A 2QSFX 1F5TA 3BTIA 4IX7A 4KAZA 5E79C 4BU2A 3JS6A 5FROA 3UNGC 5FPNA 3BG6A 1K6YA 4WQ5A 4O5BA 2WAFA 2HHVA 1BI3A 1SFXA 3K70D 2HF3A 4BRNA 2ME0A 2O61A 4R5PA 3T8RA 4HCCA 1RBRA 1R1VA 3S1MJ 2MW8A 4IXAA 3L0QA 3R0AA 2CGKA 5AQOA 1WSHA 4GGGA 3ZP5A 2CGLA 1N32K 3CUQB 4E3SA 4DTUA 3RPQA 2RC4A 2L7FP 4PA1A 4BRAA 4JI3K 4DF4A 5JVTA 3NEUA 1TQIA 4H0VB 4MHGA 5C4XJ 1UHSA 3BR6A 2K4JA 2GIVA 5D5VB 4M42A 1U5TA 3A02A 4JBAA 4XLAA 1J54A 1VSDA 1U3EM 3E6MA 4ZDOA 1VK0A 1KD1O 4BQZA 4BY7J 3RIRA 3SDBA 1JLEA 5GAHP 2A3ZA 1DTQA 2ZKZA 2XHKA 2HEOA 1UFMA 4QPOA 2BV6A 3ZMSA 2IGNA 3T8TA 3VEVA 1LPQA 2CW0F 3RWUA 2M7AA 4CGZA 3ZQQA 3PQJA 3QOPA 1JTYA 4XLFA 3C6HA 2O4GA 4C23A 3D5SC 2LNBA 2KP6A 1MMNA 3C2BA 2CO5A 1TAQA 3EZWA 4CGHA 3IDHA 3WU0A 3G4SN 3AG1H 3MN6A 1XDSA 3GE1A 2FSNA 4OLAA 3QAHA 4BRQA 5LHIA 2HPIA 1IRZA 3CO6C 3QMLA 3AG4H 1FYKA 5C3EJ 2X51A 1KQ8A 4FLTA 1JUSA 2ID6A 4OO1J 3DP7A 3ZX3A 4E1NA 4FE7A 4JLHA 4Z94A 1IW7F 2EHGA 3P9IA 2KJBA 3C6UA 2FBYA 2UXCK 3I5UA 1KU7A 1I1GA 1T6CA 4GCVA 1G6NA 1A5WA 3IWZA 5C24A 2HOEA 4LLLA 3VSLA 3K1MA 3MN9A 1E4FT 3KHYA 2P8TA 4YOXA 2NOJB 4E1JA 2G8WA 4LF9K 2QM3A 1SAUA 2FSWA 1HJRA 4O6JA 3DEWA 2O8CB 1BQMA 4B8AB 1IUFA 1J53A 1UHWA 4NO7A 5F6FA 1MW7A 4G6QA 4ZJZA 2ZWHA 4AHTA 2CQ7A 1QZZA 2KIQA 4DU3A 4DQRA 4GYGA 3ULQB 2DODA 3GTJJ 2UU9K 4CEAA 5D4SA 1I50J 2A6TA 2R7TA 5M3FJ 3S9HA 1XNQK 2EX3A 4GYIA 1BR1A 3ASNH 3PM1A 3JR9A 1HDPA 3QNNA 2ZJRF 1ZKGA 3OYNA 3RJPA 3MXMA 2RF2A 4H5VA 5AZIA 4DTPA 1L3LA 1CZAN 1YYVA 3JSOA 4F92B 4EFHA 3MDQA 4G7ZF 4FJLA 2M7BA 4CJVA 1JT6A 2V1XA 2A5XA 3C3WA 5CQEA 3B6OA 3WTSC 2V9PA 1BU6O 4FCYA 2TDXA 1UZCA 4DR1K 5K7FA 1NWKA 1MMAA 2KFNA 2ZMEB 2NOGA 3MVPA 1I27A 4AILC 4BY9C 2P6TA 4FLZA 1WI3A 4IPAA 2P51A 4WX9A 3V9WA 3DLRA 4M3WA 4CW7B 1UA0A 2YX6A 2V1UA 4PL7A 5KRTA 4FLWA 4PFPA 1EH8A 2HZDA 4B1VA 1ZG5A 2PG4A 1K8KB 4IOCF 4BVPA 1WAFA 2OTJN 1KFDA 5AFUH 3CMYA 1Z7LA 4A0YA 1SUQA 4F4KA 1VQKN 1HNWK 2ZCWA 2ELKA 4DIQA 1HLUA 3SZ2A 3I9V2 2NRTA 2F6CA 3LP2A 1OKRA 4A3FJ 3WTVC 4FZYA 2IP2A 4ANJA 1T56A 2P0WA 4H0EA 4B08A 3HXLA 4M45A 5AQLA 2QQBA 1P2FA 2X6NA 2GX9A 3BTCA 2RVCA 2JA6J 1VQLI 4RW9A 4CGDA 3EL2A 5MLCQ 1ASWA 2MABA 2JVGA 3VF2A 4F2RA 5EEHA 2MFZA 4UHTA 3RDIA 1ZBIA 1X3UA 3T69A 4K8ZA 1XUPO 3C6TA 1A5JA 4AUXA 1WCMJ 2VL8A 2JWKA 1RR8C 3IH2A 2PFBA 4BRHA 1O13A 5ILUA 2K4BA 3LAPA 2HNZA 1PUEE 4CK1A 5JS1A 1YS6A 3R0JA 1U4BA 1RGIA 2IS2A 5F0XA 4FWSA 1NJWA 3LAKA 2K9QA 2CH0A 3S1QJ 5FD6A 1BN5A 2IGMA 4IKFA 4PKIA 5J3LA 3QICA 3GBGA 3HSRA 3VYSB 3BPVA 3ZN0A 1S1TA 1JTXA 1XN7A 2W6LA 4CHZA 4V19K 1VRTA 3U3YA 3CCJN 3RKYA 4H0YB 2Y0MA 4DSKA 1J09A 4BKXA 4I01A 4MO4A 2KZMA 3VF6A 4ENNA 3LDLA 4J00A 4MEXF 2UUBK 3LANA 2EZIA 2UYTA 4U7BA 3HUGA 2F9WA 4IHYA 1FBQA 3NDKA 3K10A 4CJ4A 3E5QA 4EM1A 1DP7P 4H03B 2HDDA 2VODA 1QBJA 3CJBA 5BPIA 1G3WA 1HPMA 4II3A 2M4GA 1WJDA 1RTJA 4PUSA 1FIPA 2R3SA 1RT6A 4CHYA 3CUOA 2VLAA 5FPEA 2CQKA 2ZXHA 1L3UA 4FL9A 4V19S 2KFZA 2HS5A 2F5VA 1T95A 5BQTA 1U9OA 1KLMA 4XICA 1TKXA 1WSEA 4K41A 1YIOA 1YXQA 3DRRA 3ZEUA 3WNGA 4X1EA 4I9QA 1GV2A 2L02A 3PV8A 3VQCA 3CM6A 1RDWX 1VQ8N 3KP2A 2GZWA 1Z21A 2VPLA 1TP4A 1RDCA 5E8GA 3KJVA 2F2EA 3W6JB 3RZDJ 4DQ2A 3ZSVA 4B9LA 2F4OB 3NH2A 1MBFA 4DLGA 1W5TA 3CCQI 2HOSA 3LNQA 4WCGA 1HUXA 3VEYA 3HRMA 2K3PA 2HOAA 1I3AA 2H8WA 3QB0A 3C2HA 3B6PA 3EO3A 1ZARA 2EA4A 4B9SA 2Y2ZA 2UUAK 1C1BA 1NK9A 1Y64A 2KDZA 5HS8A 5E17F 1OKJA 2O7OA 4E7HA 3KEOA 4JKGA 5IT9Z 3CESA 4FLXA 4C8LA 2PAVA 2J5PA 1Q9YA 3GZ5A 3ZOBA 3ZXSA 3TSUA 3ABMH 3V42A 4IHWA 2R7DA 1WZ2A 1RIOH 3KEYA 4AHSA 2NRVA 5IT9K 3QFUA 1IRGA 1ETQA 1OLTA 4G1QA 1FEXA 2ZXWH 2DMUA 3BG5A 4CZLA 3A4CA 2JA5J 1UCRA 2L54A 2NRWA 3M8FA 3VERA 1NOYA 3LSHA 1T2KA 3LQRA 2DA6A 3GTQJ 2ZJ2A 3KK7A 3OYFA 1B1BA 4A3MJ 2NS8A 3K9KA 1HX1A 3QBXA 4H8KA 2VKVA 3BP8A 5DM7F 3HT3A 3F21A 1IKWA 3N97A 2Z9OA 1Y0UA 3ALYA 1N33K 3E1SA 4X0GA 2VT3A 4XM3A 2WONA 3QYFA 3JREA 4R8HA 3CC7I 2OPQA 2QTDA 5LL6Z 1O1WA 1E2XA 4GO1A 3LMMA 5C44J 2WTEA 4BRPA 2VWBA 4A5NA 2XGDA 1IV6A 3QPHA 4BC2A 5AZJB 2IIRA 2A6HF 4CYDA 5M5WJ 2VXZA 4BDZA 2CQNA 1VQ7I 3MMVA 5J2PA 1SD6A 1FC3A 2K9NA 2HVIA 2IXSA 2E19A 1WJ5A 5AQTA 4Z0UA 3W3CA 2K9MA 4IBNA 3ZQ7A 1T08B 4BVOA 1VFCA 2B0LA 2BOLA 4I6MA 1DDNA 2MBFA 4JK1X 4BXFA 3TO6A 2HF4A 5EG0B 1ON1A 1USSA 4YRVA 4F2SA 2FBKA 3K9TA 1R23A 1YITI 2DTRA 1EP4A 4CGJA 2B4JA 1X1CA 1DQUA 2P5KA 2YSRA 3JSMA 2BVMA 2EIJH 5IOYA 3H35A 5GPCA 4RAYA 1PUFB 3SFZA 4BBSJ 2TRTA 1O4XA 3SUQA 2R7FA 3NVMA 3A5LC 1TGOA 2DK5A 1IO2A 3VYTB 4W1UA 3DLLL 3WXMB 1T44A 1MWMA 3ISNC 4UXNA 1NGBA 1Z26A 3HSTB 1YVUA 2M0MA 2HU9A 3EKSA 2N8GA 2EQRA 1EJ9A 2P9KB 4JI0K 2LOOA 4CCMA 1FMVA 4GY2B 3ISPA 3ID6A 5KCMA 5HNFA 2L4MA 3U9GA 4CF8A 4CJSA 4BACA 4V2GA 1W9HA 1T3VA 4YHHK 4XIUA 3RMDA 3DKXA 4Y17A 3LPUA 2COMA 4XKBA 5ERIA 2DBBA 5AQXA 2UXXA 2OZSA 1CXUA 3DLHA 1NJYA 5HRSA 1HC8A 2IA0A 3LM9A 4I9LA 1VQNN 1ZXOA 5E3LA 2ZB9A 2DFFA 1HQUA 1U47A 2XPUA 3FLCO 5L3FA 3CCVN 3SEQA 3JW4A 3E5UA 4CHQA 2KZGA 5HDNA 5M5YJ 3QEIA 3THWA 4EJUA 4OINF 4FJ8A 1YRNA 1EWQA 2LK2A 4LB5A 5EGOA 4JI1K 3SBTA 2PYJA 3WNFA 5DM6L 2Y75A 2V52B 1X3WB 5JLHA 1FJLA 2DQLA 1OCZH 5C4JJ 1TWCJ 3ZT0A 3CFRA 4CJQA 4E70A 5IWAK 1ZG3A 4DZJA 4AM6A 4BE0A 2JQ7A 3WG9A 2IJLA 3KP6A 1NMDA 2XRNA 4HYEA 2G8UA 4W5NA 3HOXJ 3NGIA 1HKCA 4J8FA 4OMYA 4HDUA 1G15A 1TQMA 5EEAA 4Y0WA 1KAZA 5HDGA 3K5MA 1YUWA 3J7AP 3CCYA 2A41A 3HC7A 4DFJA 3E6DA 4G9ZA 3CJAA 1T6DA 1X2MA 3RI4A 5M1FA 4FLUA 1T39A 1JE8A 3W2AA 2DW4A 1H9GA 3F8CA 1N34K 5KHDA 5F2RA 2X6SA 2VC0A 1MU2A 3AVNA 2X48A 5TJJA 4C8NA 4YOVA 3BDDA 4XN3A 2HVRA 5IYDJ 1K79A 5BPDA 2EFWA 4DYCA 3WXIA 2HTJA 3M8JA 1O7LA 4CSWA 1QHGA 1MBEA 2GXGA 3H5AA 2E2JJ 3ZGKA 5D5UB 3VF4A 3AGRA 2WV0A 4J2DA 3BG3A 3LZJA 3VSKA 2VYPA 3CQYA 3SV4A 1J5EK 3L2WA 2KRHA 2GWRA 4A3JJ 5DD4A 3E0JB 1QPMA 3IFRA 4XH5A 2FBXA 3AO5A 4H4MA 1YJWN 3I4NJ 2NZTA 2CUEA 2XGEA 1JXBA 3K58A 5LHHA 4A3KJ 1GDTA 4J2AA 3R61A 5GP9A 1D0YA 4DTSA 4HUFA 1LWEA 4CCOA 4D7MA 3SZTA 5FRNA 4JOMA 3S14J 3OYGA 3EYIA 3TTDA 2HBJA 2B5JA 3L7WA 4QS7A 2M87A 4IDKA 3A03A 4KKOA 1TWAJ 5KVRA 4DYQA 4F55A 3RSEA 3BY5A 3GMEA 2ACJA 1FKPA 2F5DA 2FE3A 5M5XJ 2E2IJ 1YX3A 3HM9A 4D5FA 3MFKA 4BR0A 3HTUA 2HDWA 1W36C 4JK7A 1ZBHA 1XG1A 1CLQA 1IG7A 3KFWX 1Y8QB 4JX4A 2QGUA 2L01A 2K85A 1B92A 3VESA 4DQPA 4IL6C 3KZIC 4DUYK 4OAYA 4DTRA 1VQPN 1K61A 4XN0A 2ZNZA 4JD2B 2CWEA 2GA1A 4NB5A 2HKOA 5J4VA 4N56A 3F6VA 1UB9A 3SLCA 1REPC 2FEZA 5AQHA 2G8IA 1OVQA 4K8XA 4ZZLA 2KRCA 1KQ9A 1GXQA 3AAFA 3KWGA 4M74A 4RWTA 1QSLA 2GBYA 1OQYA 3HRGA 5D5XB 3P83D 1JKRC 2Z16A 4DV4K 1D8KA 5IP6A 1Y6IA 4I2OA 3ENHA 4EAHD 2ETJA 4MQ9F 1RUOA 4DOZA 3SQNA 2GBZA 3IS9A 3CJQB 3IHUA 3QWLA 1UAAA 4B48A 4KB0A 3I53A 2HVHA 4MLOA 4AIDA 2V9VA 4AHUA 4FWOA 1NGHA 3GXOA 1YW9A 3MN2A 1BI1A 4A61A 5DCFA 2W4SA 4RW7A 3IAM2 4HQEA 1CXQA 4QPQA 1WOQA 4DR4K 1KU3A 3RQIA 2JWLA 1DT9A 3CPEA 3HPOA 3TBIA 4AYBN 1HQCA 3LSKA 2XDVA 2NXNB 2LY1A 4KISA 1TKTA 2RAEA 2UXNA 4FWQA 2IS6A 4ID1A 1QZYA 4MFDA 3CCRI 4UV8A 2PZSA 3TO9A 2RPIA 1OCPA 3NCIA 1T33A 1B4AA 5J8CA 3K4CA 3JRAA 1X1DA 2P5OA 2OCEA 1XC9A 2LBFA 3HTVA 3L2RA 2CSOA 1S22A 3CXCM 4BC3A 2Z3YA 4CEEA 5DCMB 2ZNYA 5FKKA 3S16J 4DFMA 1XC3A 3BUZB 4Z6YA 3MN7A 4OKEA 3FBIB 2UXBK 2HW3A 4WQ5C 3O3FA 2VQFK 4W5TA 2VQGA 1NNEA 4OIPF 4CVNE 5AIQA 2YKNA 1SKRA 3ZCMA 2X74A 4NCBA 3L2CA 4M3DA 1C0WA 4LF6K 1QQMA 3PX6A 5ICCA 4QOZB 5EU7A 4FK4A 1OCTC 2Q0RA 1Y1VJ 2G9WA 1RT1A 3SUNA 5L3GA 1WJBA 1QVUA 4IO8A 2NVUB 2IW5A 1ATSA 3T1YK 4I0AA 5GAHJ 5GAGJ 1HMVA 2X0LA 1IXCA 4C3HJ 1H0MA 2AXTC 3KD1E 2OZUA 4XIDA 1S9HA 1QZ5A 4IG3A 3K4JA 4KT6A 5J1RA 5FLXO 1U5TC 2LP0A 1Q82O 2BBYA 1JL2A 2ZGYA 3KLEA 3E66A 3KEQA 1W1WE 3PL8A 1TWGJ 3U3GA 3T1AA 3G3ZA 1JL1A 2P81A 1HLVA 4KA4A 1ORKA 4CCLA 2LR8A 2EA2A 2X6XA 3F72A 4XKCA 3W2WA 1MD0A 2DLLA 1R00A 1HRHA 6PAXA 1J5YA 1IGNA 4PGHA 3KTQA 2EWNA 2G0EA 1TK8A 2A61A 1PJRA 2NS7A 3FX3A 1BO5O 1OCCH 3PO5A 2P5VA 4BBRJ 3GLLA 4I76A 5CPRB 5ADXA 1FK9A 2HHSA 1D3YA 3O8GA 5DUIA 1ASVA 4CZHA 2ECCA 3AA5X 4M3ZA 5E1WA 3G71I 2PJRB 3IKMA 5EY4A 1IDYA 3V7RA 2YHAA 3FHZA 5HS7A 4R79A 1N6QA 4BRIA 4OGEA 2GXBA 4W5RA 2E1OA 2CH5A 3R6SA 5J2NA 2PI0A 1KONA 4QWQA 5KGWA 4H0PA 3C7NA 3G0ZA 1MSFC 1D0ZA 2XAJA 4YOYA 3CMAN 2NRZA 1WSJA 1N8RO 3VTIA 4M6YA 4C8OA 4DB3A 4IFYA 4Y1DA 1L3TA 5E8IA 5FLVA 2UZKA 2Z1DA 4RGUA 3OYHA 1NK0A 1E3MA 1B9MA 1ZAOA 3NWTA 1SAZA 2CGJA 4NHJA 2YJFA 3NH0A 1FP1D 3OYMA 2PJPA 4EIAA 3WEEB 3PNYA 5AQWA 4Z4FA 4O5FA 4KITB 3AA2A 2LY9A 3VQ9A 2YR2A 5AQIA 1SAXA 3GL1A 1ITYA 1VQ6I 2ZXIA 1O7FA 3BR2A 4BGAA 2E1MC 1IN7A 4OPKA 2IS3A 3G1OA 2LLKA 4X6AJ 2AS5F 2VGNA 1NJXA 2HPMA 1CF7A 2Q2EA 1S1XA 2H6CA 5KPZA 2H1LA 2VG6A 2E88A 4L0YB 2XY8A 3ULEB 4BH9A 2V7YA 1XI1A 1N78A 1HNXK 5LMUK 3ZT2A 5FB2A 5SWMA 4O55A 1X3ZB 3ZMDA 3BDPA 2CG4A 3G1MA 5AQRA 4NB4A 4JS4A 1F9NA 3KZYA 1K83J 2IA1A 2JA7J 1FKOA 5EZHA 3LFUA 1CQTA 1RKWA 4HUEA 5C25A 1S5JA 1HNZK 4BQAA 3RVCA 5E3NA 4B1UB 4LLNA 3D1NI 4CUGA 2OTLI 3LDQA 4Z4CA 3REOA 1Q9XA 3VYUB 1WAJA 4H5NA 3CIPA 3AVHA 4CD3A 5LLQA 2DMPA 2QXLA 2ZJPF 4LH5A 3VQ7A 1T03A 1NJZA 2FXAA 3FZVA 2FLOA 5CYQA 3KD5E 4G7OF 1YJNI 3O08A 4BRKA 1P8ZA 3U1KA 1VF9A 4PJ0C 4U67L 3S1NJ 1JCFA 4UNOA 3CF2A 3TKYA 2W40A 1BI4B 1QGPA 4AIHA 4GFBA 4MO7A 3J80K 3EE8A 3I59A 5C2DA 4XORA 3F2KA 4CJLA 5LJWA 1NK5A 1ATNA 4KTQA 4P9FA 5AONA 2IRFG 3HL2A 3IAYA 3GFJA 1JHHA 2BY1A 2HGCA 1XDUA 4YFXF 2VOPA 1YW7A 1YIJI 4ZTJA 2QXFA 2IAIA 2A5WA 2CRGA 4C2UA 4DV3K 2O8CA 2HNYA 1Q81O 1YO5C 3WE3A 2DPDA 3AVIA 4DTNA 4DS4A 2HMPA 1VSFA 2P6SA 4IZZA 1FOYA 1LB2A 2OPPA 2OAZA 4BWJA 3P1GA 4DQIA 3M8EA 3QPSA 3N4MA 4NXNK 2YCHA 3KCCA 1MBKA 3F9MA 2W84A 4B3RK 4JKAA 2EFNA 3FHNA 4CJFA 3GTPJ 4H5TA 2M5WA 3O6BB 1EKEA 3WQTA 3BOQA 2ZSIB 1SFKA 2K3FA 3TAMA 4OIOF 3FMSA 4A3CJ 4G12A 3ZQCA 4A5BA 4PL8A 5AQSA 1AKHB 2P9UB 5IY5H 4M3FA 3I56N 2DT6A 3CJNA 4OPJA 3I0TA 4RB1A 3MZYA 3UKRA 1IN6A 3HEFA 1WI9A 2YS9A 1Z7UA 2WBMA 1JLFA 4FWPA 1AHDP 1OVYA 2ELJA 1STZA 3SZPA 4OKKA 4PK4A 2QEXI 1X2NA 2QZ8A 2R5YB 4OKJA 5ILVA 3IH3A 3QP6A 4B4CA 4PUOA 1SVMA 1TWFJ 4BL0B 2F48A 5KTQA 3RKWA 4WYBA 2A69F 4R1HA 2QKLB 3FGUA 4U0VA 3G10A 4F52A 3LZIA 4GW6A 1K8KA 4CFBA 2B6AA 1WJCA 4H5RA 4B1YB 4DR5K 3LSTA 4A59A 3HOUJ 3DBHB 5FLXZ 3K57A 2EK5A 1S3JA 1SEUA 1R4MB 1RTDA 1BW6A 3LA2A 3AAPA 1W5CC 4MTDA 1TT0A 1WBBA 4CI6A 5FLXK 3S15J 1FY7A 3RYPA 2BTFA 2XKPA 4L9VA 2E5LK 1FSEA 4NDLA 1UAXA 3UR3C 3TAEA 1VQ5N 3HXMA 3BZCA 4FASD 4CJEA 2MA3A 4TSXA 4M3YA 4IJNA 5AQZA 5D8KB 3KETA 3FZHA 3QQAA 2KRFA 3QEXA 2PBDA 2PN6A 3HG9A 3U21A 1V3FA 2YUSA 1LW2A 3WODF 2EV6A 3TAQA 3MZ8A 1EX4A 2ETHA 3QNOA 4WFBL 4KFBA 5HRNA 3K59A 4HDVA 3AL0C 3CCEI 4F93B 3M4OJ 2HYFA 2VKHA 3A1YA 2HSTA 4NNJA 3D2FB 5HOOA 3GTMJ 1ASUA 2CW8A 1JJ2M 3VGKA 1TTYA 5K5OA 4E1MA 2DA4A 2QWRA 1MBGA 2Z1JA 1LDDA 4CBWA 1QA6A 3DEEA 1PDNC 3O9UA 1W7PD 4M3RA 2OPTA 1A31A 2VBYA 4D0PA 1I3QJ 2LY2A 1SL1A 3FXOA 2WAQN 1ZQ3P 4F3QA 2IBDA 4CJWA 1VSHA 1S72N 1E0EA 3Q0VA 3RMAA 4OAZA 1R9TJ 3RMBA 4A0ZA 3O9QA 2E6LA 3W0LA 2A1RA 3I64A 1WSUA 4BR7A 1VQ9N 3H36A 4EVIA 4XKVA 3CJ1A 2NRAC 1DGWY 2E2PA 2VQHA 1IUYA 3CCLI 2FF4A 4HX7A 4DR3K 4ETSA 1X4OA 4A0XA 1HW5A 3CD6I 4PCQA 2ZO4A 1IRFA 2X6YA 1BL0A 3R60A 2QWPA 3QEVA 2HBLA 1NK3P 3J81K 4L8RB 5J8FA 1E4GT 1XC5A 5CYMA 1AWCA 4FZZA 1MIJA 3MAJA 3ECOA 3ZT1A 4YG2F 2EIKH 3FE1A 3KYDB 4FJNA 4DSIA 1ON2A 1S8NA 3CQ8A 2ESNA 4XK4A 1XHXA 2AHQA 3DM2A 4NYFA 3OJSA 3LP3A 1T8IA 1KCFA 2R7SA 3JCUC 3S2DJ 3I0SA 4YIIA 2OANA 2FOWA 4BQQA 3GBTA 3KYCB 1Z9CA 5LY3A 2KLOA 2GTDA 1OR7A 1FYLA 4UQGA 2BUPA 4FXDA 1J9AA 3MX5A 1I5ZA 3TU5A 4EJOA 1WGXA 4H4KC 2IGKA 4MTEA 2Z33A 1B8IA 4L18B 3K1PA 3V6DA 1QHHD 4B9MA 3PO4A 4CF0A 1WSGA 4KICA 4RGRA 4HV6A 4C2MJ 2O03A 1Y39A 3QP5A 4PKHA 1Q1HA 3BTJA 4HOBA 2CU7A 4JKCA 4XSZF 4L5IA 1SZ2A 1NTCA 1D4XA 2Q3SA 1EWRA 4FO0A 2XC7A 3O3GA 1ITGA 3AY9A 2OZMA 3I33A 3PNVA 3AVMA 3EDPA 2IOCA 5FPDA 3HRSA 3PX0A 3WG7H 1YE9A 4OPAA 2D0PA 3OOPA 4JI2K 4O0IA 3ZSRA 2LDUA 3TAFA 2DN0A 5KQDA 2EIMH 1ZGJA 4BE1A 1YX5A 1MJBA 3F8FA 3FZKA 3BR5A 4ZYAA 3CETA 4WQ4A 4RTFD 2LF8A 5GTIC 3H5NA 5C42A 4S0HB 3BPXA 3CMEN 2D1VA 1RDBA 1JKQC 4D9JA 2E8AA 1LWCA 3P38A 3WHBA 2XAGA 3SQ1A 4FPAA 1SC7A 2BDPA 4B9UA 1IH7A 2WOMA 1LKXA 1H88C 1QZ6A 4QAGA 3DPTA 1P92A 2CS3A 3TP3A 2DOAA 2QWNA 2KQRA 4FVMA 1M1KO 2YV0X 3KLGA 3IMXA 4FJHA 3O2PE 4KO0A 3RPUD 3H9GA 2B7EA 1D8JA 3ZPLA 1WBDA 1NOZA 2VQEK 3BF3A 4Z2YA 3I4PA 5HS9A 4HAMA 5BNGA 2E4LA 1VQ4I 1VQOI 2DY4A 3C18A 3KLHA 1RNLA 3NVKA 1OYYA 5CVJA 5E3MA 4HA8A 5AZJA 4IQ4A 3OL4A 4CIEA 2ITGA 2GOMA 4LD5A 4CZGA 3P9CA 3EUKL 3E7LA 4BE2A 3ZETB 1SMTA 2QYOA 2UV1A 3A5NC 3AKZA 4K43A 4K25A 1ETXA 4FTHA 4A57A 3AVGA 4DCHA 5HP1A 3K6GA 2OF7A 4CYCB 1FTTA 3K0SA 2Y0SA 1G99A 2XPVA 4AM3A 5EG0A 5HNHA 2GIZA 3W6KB 1A5VA 3MEGA 1MBHA 3J7AO 4WXCA 1XGSA 1HKSA 1UELB 3EY1A 3D2EA 3NHGA 3JRCA 2IS1A 1VSJA 2RQQA 1U6ZA 3LDSA 4JKEA 3BZKA 2A1SA 4JYAK 3R6MA 1DU6A 2E1MB 1PUFA 4U87A 4HZFA 1VRUA 2YHWA 4YOTA 3DLGA 4I99C 1FSHA 3DPLC 4RCHA 1OCRH 1DU0A 3NH1A 5HROA 4M63C 4B3AA 1XSVA 1Q7YO 2P9PB 1BC8C 2D45A 4NC6A 1S1VA 2NVTJ 1U45A 3SAFA 2FQ3A 3L6QA 3UE5A 1PP7U 5CQGA 2YNHA 1LUJB 5AQGA 3ASOH 2CV1A 2WBNA 3D7EO 4B1XB 4L9NA 3PFIA 3L2QA 3NRVA 4XR6A 3VEZA 3WU1B 3MKWB 5K1YA 3FZLA 2KISA 4KFCA 1Q1VA 4J01A 1KYZA 2HVQA 4IZ9A 2HQNA 1Z91A 4FLVA 1F4KA 2OC6A 4IQJA 3T5XA 2Y1IA 3SPYA 4CH7A 3KZZA 3H3ZA 1X9SA 1SV5A 1MNEA 3COAC 4PDKA 2Y9YA 4Y33A 3ML6A 1NGCA 4IDHA 3OYAA 5A2QO 1XHZA 4IO9L 1MZBA 4P9UA 3K9JA 2UWMA 4JKDA 1IKVA 2XB0X 1BGXT 1UG0A 3LSRA 2YPRA 3HM8A 4Y13A 2CV0A 2VBZA 2E60A 5M1PA 3IUCA 3V8JA 1R49A 5H1SQ 5F0FA 2KIUA 4JRQA 2O8EB 3V4GA 2LKPA 1OH8A 4J2EA 3PUBA 1TLHB 3BJOA 1GLDG 4RGSA 2I5JA 3VA0A 4Q0BA 4LJZF 3FKIJ 4RAFA 4M3TA 3I55I 3BY6A 4P5OA 3TWHA 2MD0A 4ZTFA 4CEBA 3CC2I 3F73A 3H1QA 3UKGA 1R6RA 4DG1A 2IVPA 4FJMA 1PP8F 4HEA2 3AVKA 4BJTA 3K2AA 3E3VA 3OYDA 4BXUA 3DXMA 2WWYA 3IRRA 4BQOA 4FWLA 4H0OA 2A6AA 3CCSI 2WV1A 2C6YA 3LPTA 2P9NA 2G8HA 4HX4A 1LV5A 5ELZA 3EUHA 3LL3A 4XQFA 4ELVA 4PSXA 4AVZA 4CESA 2EBIA 4IRGA 3O5BA 2XSDC 1HYSA 1FJGK 4JYKA 1JLQA 4UY8O 5BPLA 4Z4EA 3ZSOA 4UUTA 4JK9A 1JJ8C 4CJ7A 3HGYA 3HUGB 4L9JA 3I0RA 3X2QH 5IYBJ 4KV8A 1QVFM 4KTZA 1R58A 3MEEA 4XLCA 2H3GX 3IL2A 3DMJA 2VG7A 1ODDA 1HNIA 3V1QA 4RLQA 2R7RA 2M3AA 3OOUA 4HG2A 4OIRF 3T7ZA 3MAQA 2DPNA 4HQMA 2DJNA 2L0KA 4E4HA 4H5WA 1WJFA 3CPWM 2A3SA 3IRQA 5AFUA 4CK3A 5FKNA 1F21A 1Z05A 3OMYA 2AJQA 2O8FB 2R0QC 3UIQA 5FKOA 3HK2A 3VQPA 1JI8A 4HPQA 4E7JA 1NGGA 2O9LA 5EZGA 2BE2A 4I7FA 4KHWA 2LH9A 4XRFA 1LDKB 1ZBSA 4E19A 5LFAA 2A42A 4FK2A 3TTCA 1VQMN 4UY8I 5KK1A 2FU4A 2QWWA 3EETA 2JUCA 2R7UA 2M8GX 4CEQA 1TYQB 5AQJA 1TW3A 4ZDLA 5B1AH 1OPCA 4IOAL 5GAGP 2W82A 3KIOA 3HOYJ 2ECBA 1K8AO 3OYJA 4D1QA 4BR4A 4B3TK 5IT9O 1NHAA 4M3UA 3KK2A 4FM0A 4LD0A 1W7PB 4CBXA 3GF2A 1IC8A 3K0LA 4IJAA 2CV2A 4C3JJ 4XLEA 3H3VK 4KPYA 4DTMA 1EH6A 1IJJA 4KHQA 3TARA 2XGXA 3OYCA 3I54A 3LSJA 4GVMA 1QHTA 1WH5A 3G6EN 4CZMA 4A6DA 3I8BA 2ATQA 1P7JA 2AP1A 3P39A 5FGMA 1UMQA 3KZBA 2QVOA 2W85A 2DA3A 2IC3A 1VNDA 1W7AA 4EMSA 1T38A 4I7HA 5LGNA 3Q0WA 2EWSA 2DOEA 1APLC 2CUFA 3WE2A 5FDLA 1C1AA 2MC3A 1ENHA 3E01A 1IBKK 4A2AA 4KIFA 5C12A 4ABZA 3OY9A 4DMNA 2XROA 3HHGA 2X78A 3VEOA 1GOBA 3DAWA 5BRHA 3DRPA 3HOZJ 4B9VA 4J2BA 4CZEA 4HWIA 1FYMA 5KI6A 2M0CA 4XRMA 3HJFA 1SVLA 4A3LJ 5H20A 1P7IA 5JICA 4DV1K 2DT5A 4Y4RA 3L2VA 4YFUA 5J47A 4JKHA 5DK5A 1WFXA 5E1ZB 1TWHJ 1RT2A 4FWRA 2DCEA 3ZSYA 2KT0A 4B43A 5BRDA 5DCMA 2NNNA 1KQ0A 4M3EA 2KJCA 1EETA 1VTNC 3F8BA 1O3TA 3CDIA 3TP0A 4M3XA 3SDGA 3FF5A 2BZTA 1TK0A 2GXAA 2P1JA 2IVNA 2V6CA 2X6OA 3NF9A 4CEOA 3DTKA 3QLHA 3EN9A 3O3KA 5AQFA 3MQ0A 1IN8A 3LDPA 3ERMA 4X65K 4B9QA 1D1BA 4E7SA 4P55A 4P96A 1DP3A 3AV9A 4MDAA 3THXA 1FOWA 1YG2A 2LSNA 4UVBA 5DDGA 3BF1A 4NLCA 3H3UA 3PIOF 4LF4K 3FIWA 4YY3K 2EV0A 4FLYA 1HXDA 1VZ0A 4WF9L 1JKHA 3SAHA 4CXFA 4FJJA 4CEDA 3ECHA 4FVUA 1TW2A 3TANA 1Q8IA 4GMJB 2GELA 2LSOA 5EF6A 2DDBA 1W97L 4EP5A 3F0CA 4BEHB 4JKFA 5H6RA 4XLPF 2DPUA 1VSIA 3VQEA 3AVCA 2NAZA 2HTSA 4A3IJ 5BPNA 1YHQI 3C0BA 2ID3A 2NS0A 4WF2A 4BQNA 3MKLA 3K4LA 4G9YA 3OR2C 2CFOA 2QKMB 1QE1A 4W5QA 3SJHA 3CQZJ 1JLBA 3BCAA 4NCAA 2DTZA 5J6XA 1YJ9I 2E1CA 3THYA 1R1UA 2KIMA 1HJOA 1T0FA 3OVNA 2FNPA 3B6AA 2DA1A 3EZ5A 3W6VA 5A2QZ 2BXYA 2QK9A 5I9EB 3ITHA 2E7WA 3DXKB 2EB7A 5BREA 4YFKF 2XPWA 3WTTC 1D9FA 5A2QK 2WY8Q 3LSPA 1I1SA 3MEXA 1L3VA 2L5QA 4RS8A 2VI6A 1TK5A 3M9AA 5CZ2A 1LE8B 5EJCA 4RB3C 3HTSB 2ESHA 1NBWA 3CO7C 3A8YA 2XF7A 2QA4I 4FJIA 1Y56A 3FDYA 2ISYA 4BDYA 1EA3A 3QIPA 1ETKA 3THWB 2ZJQF 3H9JA 2D2WA 4QS9A 3CYMA 5EGOB 2UUCK 3GO5A 3VQ6A 2BXZA 1KQSM 1SVOA 3NF8A 2RREA 3BR0A 2OPSA 3H45C 4HNTA 2W57A 3VETA 3W3DA 1MKMA 2HB5A 3BQYA 3I71A 4LG0B 1S6LA 4FJ7A 4BRDA 5HLIA 2XAQA 3CCUI 2P9LB 4J19A 4ILJA 2JZYA 3WEEA 2QKBA 3O4QA 1IAWA 3UKUB 4O0JA 4BXXJ 2XY5A 2HWVA 4BR2A 3KKSA 2YNGA 3OS1A 3C1DA 1U2VB 3V9SA 3VWBA 4ESFA 5LD2C 2JLEA 3OV8A 5E1XA 1R1TA 5HVQC 4KTWA 3ZMTA 2ZD1A 2VONA 1TV6A 2K5CA 3ZSXA 1EXQA 1YFHA 4C30A 4IFEA 3HBTA 4LF7K 3TGNA 4PSWA 3ULEA 3VPZA 1KTQA 3Q3SA 4LSLA 3AARA 2MH9A 2IGOA 1SFUA 5ED4A 1KXPA 3M1EA 4CGIA 2KHMA 3E1YA 4U0WA 3J7YP 2HKXA 4OIQF 5IYCJ 2JA2A 1V5FA 4BJ5C 4KN4X 5J1YA 2HQAA 4EEFG 1VQLN 3PJRA 2QQAA 4RAGA 3M8SA 2COBA 4ZH4F 4WXHA 2YX7A 1V4TA 2WB1N 4BG8A 4E0DA 3V8LA 1UJ8A 3CCMI 3FM3A 3O9SA 4FW2A 4LF8K 2HHTA 1RT4A 3CC4I 3JTHA 2KIFA 2HBKA 2X1CA 2R4GA 1H9TA 1HKQA 3M8QA 1B9DA 4QLCU 3GDQA 2BW3B 1Y0NA 3JAMK 3O9RA 5GADJ 5BPMA 3EE9A 1IRXA 4IRHA 1BIZA 5JMVA 1BW5A 2EFQA 4BC5A 2WA0A 4YDUA 4BGDA 4NYNA 4B9NA 5AQPA 1YI2I 3JYTA 3NF7A 3ZQHA 1YTAA 1W0TA 5F1RA 1NLVA 2H94A 2W41A 1BI4A 3KKRA 3ZMUA 4A3EJ 3U9DA 4EP4A 4RW8A 2QCOA 3KP3A 1C0TA 2G8VA 2OU2A 4Z4IA 3SJJA 1EQYA 2MLGA 3CJ9A 4KHNA 4M72A 5LGUA 1B59A 3SNNA 2QSHX 1OH6A 4GV3A 2YJEA 4LK0F 1NMNA 1WUAA 5ICFA 3WGHA 3TSPA 3DKYA 4MIMA 4BGBA 1BJZA 1R59O 5FPMA 2GWJA 4CECA 3OIQA 3CJCA 1LCUA 4CZCA 2V1DA 3PIPF 1TUYA 4II2A 1MJAA 4JN4A 3HYIA 5FJ8J 2EZLA 2G7HA 3NMUA 4ASNA 2P5GA 3R4KA 2K9SA 3VQ5A 1WPKA 2R7YA 2RKHA 1T7PA 2DQRA 2F4IA 3D0SA 1HQEA 4E7LA 2ZJRL 3CCQN 3PIOL 3ELKA 2YU3A 4AIKA 3S41A 1U49A 5HODA 3DTEA 3V1OA 1AKHA 5C10A 1LNWA 4KREA 2P9UA 4CJ5A 1KRPA 3OIPA 4CZZA 3RTRA 1FOXA 4ZYHA 2VJJA 1ETWA 3HOSA 2KZZA 2IA2A 5IOZA 1ZELA 2VJIA 2D0AA 4IHTA 2H6BA 3SUPA 3VFZA 4IG0A 1PVEA 4NQWA 4PKGA 2O6GE 1HDDC 4BWMA 1J7KA 2R5YA 2YHBA 3QOEA 2V6EA 3J7ZI 3HYFA 1DPUA 4CO8A 4OWRB 2EPFA 5CVUA 3DU6A 4DBQA 2HDCA 4ITVA 2CQXA 4TV7A 3VQQA 3I58A 2O8XA 1E3OC 4ICLA 1OR7C 1RR7A 2DO7A 3L00A 4ESJA 2D0CA 4IOCL 4HX8A 2UXDK 3TW7A 5B66C 1KVBA 2Q97A 2EINH 5AQYA 1ZBLA 4XRSA 1UWBA 5AQKA 2W1OA 2HVSA 1MBJA 2FUG2 3V8KA 2FD5A 3P9KA 3DRSA 1J6ZA 4H4OA 2M34A 4JAXA 1ZGWA 2OCCH 3JRBA 4CA0A 4YIRX 2JUGA 1Z1DA 2VJ5A 1NG7A 2VC1A 4A12A 1BUPA 3EKUA 1ZK8A 3NGZA 3RR8A 5HRPA 1D1CA 4A6EA 3H3NO 2A05A 3HI0A 3FFIA 1EV7A 2HNHA 2GQQA 3CC7N 4S05A 1UHMA 1IDZA 2ZE2A 4QIWN 3FXLA 4IXCA 1RNHA 4FPBA 2ZJQL 5TKWA 4FQGA 4CCKA 2HHQA 3FKJA 3BR3A 1TKDA 2FBHA 2CUZA 4WQ4C 1BIAA 1GLCG 5E20A 1Q18A 1VQ7N 5FFZA 3GG4A 5TKYA 1IN4A 4OOIA 3GTGJ 1D5VA 4WFAL 2F9TA 5CKTA 2Y31A 4GV9A 1FMWA 4UUSB 1N36K 4DSJA 4KI6A 4OMZA 4HSRA 3HHHA 5D6EA 3VDXA 5F64A 5BMZA 1YITN 1NKBA 1RETA 2Y69H 2DU9A 3K70C 4L0ZB 4HV5A 4YORA 3TAGA 3KX2A 2WB1A 5KAIC 4HCBA 1I94K 5F1JA 3J7AY 2R7VA 1KSPA 3DWLA 4FYDA 2O8BB 3CZ6A 2Z99A 3HL8A 1L3SA 5JHUA 4Q47A 3B02A 3VQ8A 2CQQA 3A2FA 4DTOA 2GEMA 5HLTA 1CGPA 3P31A 1IN5A 4JV5K 4MQ3A 3A5MC 1E17A 3M3YJ 3M3ZA 3LDNA 2L9VA 3QPLA 3H0DA 2OD5A 5AIPA 1KVAA 3GYHX 4UUVA 4DS5A 2VBXA 3DPUA 1ZC6A 1KVCA 1S9GA 4AIJA 3JRDA 3G4SI 3CQXA 1DLOA 3OR1C 2RE2A 2EFOA 2P9SA 4PJNA 1R71A 4KHPK 4JS5A 2HXOA 1FBSA 3M1FA 2FQ4A 1DTTA 2JPCA 1A5XA 2E5ZA 4DSLA 2EZHA 4WE1A 4DV0K 2D4WA 2XO7A 3DLAA 1MH3A 3GLXA 3WTXC 3JRIA 2R5ZA 4KH4A 2ISZA 1WJEA 2F5FA 1UG2A 3V4IA 1UA1A 2NYXA 2ADUA 4GRIA 5EOYA 1CF7B 2Q2EB 4EV0A 4CFDA 4CBUA 4G7HF 2BHZA 3LSGA 4ILGB 4LC9B 4B3OA 1IV8A 2A68F 3T1BA 2O8DB 5JVGF 1S29A 1Y8RB 1QQCA 3LA3A 2LYCA 2QF7A 1RDDA 4JNEA 3FR0A 1XGNA 4RAZA 1LFBA 4LSNA 3QESA 3LL7A 4M9ZA 3L2UA 2QUFA 1X1PA 3F22A 4NXMK 2FBIA 3W2VA 2V51B 4M6XA 5FLMJ 2WY7Q 4A3BJ 4CF2A 1B72A 1ZN2A 4CJRA 4XKWA 1QPIA 1NG9A 3VN5A 2YNFA 2XF6A 5EYRA 4AD9A 2B63J 3EQLF 3MCPA 2GA2A 2BGCA 3O6WA 3VGMA 1ETOA 1MMSA 1CZBA 4F91B 4KHUA 1IKYA 1TAUA 3E9LA 1FW6A 1NGJA 5EEGA 3ATUA 3PIPL 4PWDA 1XQSC 1Z6TA 4LOCA 5ICGA 5DM7L 4DU1A 4DW6A 2VIXA 2VCPA 1GLBG 1S7EA 4FX0A 3GZNB 3J80O 3DBRB 3LAJA 4BUPA 5BS6A 4M3BA 3N05A 3DLBA 5JLXA 4EGZA 1NK7A 4BREA 1K9MO 2NRXA 1RT5A 2L2OA 3ZQGA 1H8AC 1LAWA 5BR8K 2ZBKA 3ZQLA 4B09A 5CVRA 2KTQA 3WXLA 1SL0A 2P9IA 1NKEA 2E2OA 1V55H 2JSCA 2GM4A 4HVJA 4CJKA 2VG5A 3I59B 1RZ4A 4RLFA 3ZETA 1FPQA 1JLAA 3IG1A 1B6AA 4L9TA 1KZHA 2K7LA 1W36D 2QBYB 2O3FA 4CJPA 5B8HA 3DU5A 2OTJI 2FX0A 3OHRA 3HZJA 3MK6A 5D5WB 4HF0A 4HF1A 4UVCA 3V7CA 4CYCA 1BOAA 1SD5A 1IXRC 1VQKI 1YVNA 4I2PA 4Q5VA 2E2NA 2AXLA 1SANA 1BHLA 2NUBA 4KH5A 5F08A 2STWA 3BQZA 5F0HA 1G2HA 1FLIA 3MX2A 4BC4A 3EUHC 3KP7A 5K5QA 1NG6A 2F5CA 4AM7A 2RKIA 3IWFA 2ELHA 3BR1A 5HLFA 2QWLA 4X66K 1YQAA 2OQRA 1K78B 1J59A 4K42A 3H3OB 2PQ8A 4CZKA 1RT3A 3RTVA 3O4WA 1J0RA 4FT8A 3PY8A 2A07F 4RMNA 5M1KA 1F36A 3QYEA 2P9PA 4H0XB 5BN8A 2LVSA 3MWPA 4CJUA 4U88A 3MECA 3GTLJ 4CFAA 3VGLA 5J1EA 1BBYA 4EGYA 2R7ZJ 4MO5A 2BYVE 1BIBA 1Z3XA 1GVDA 3JRGA 3QU6A 5SZTA 4IEEA 3TW6A 4CHUA 2F8SA 2R7QA 1SMYF 4GKJK 3UKRB 1YOVB 4ZDPA 4YNQA 2VGMA 3GZ6A 3RZOJ 1ZLKA 4A5MA 3A01B 3CCJI 2QM1A 3DKWA 1LEBA 3TO7A 1U0JA 2DA2A 4DQSA 1D8YA 2RV8A 3AVFA 5D8LB 5L3CA 2BHYA 4CD1A 1Z0XA 2WUSA 4KH6A 3M1CA 3ZQFA 2GV9A 2NVXJ 2Q0UA 2OJED 3OYEA 1JCGA 2H1KA 3RCOA 2L7KA 4E6KG 2P7VB 4BHCA 2G8FA 2BY3A 2FMLA 3BZ6A 2VE9A 4EHUA 1R0AA 1QSYA 2JN6A 4LH4A 1C0GA 2XVCA 4ESBA 3AVAA 4Y3OA 2L3DA 3FBNB 2O4IA 1JGGA 3JRFA 3T19A 1R5ID 2CGPA 3OW2M 4N41A 4AHCA 3L4IA 4DBRA 5K7HA 3DLLF 1GV5A 1TBXA 1A36A 3MWMA 2V1NA 2O8EA 3FISA 2M30A 4DU4A 4H0TB 1T98A 3TOBA 3L3UA 2GLOA 2M8EA 3F5TA 3QBWA 4ILHA 3U9ZA 5HLHA 1YF5L 3CM5A 2MG4A 3L8BA 3WGGA 3CCRN 2JT1A 1VQ8I 1MMDA 1NGAA 1LVAA 1GLLO 1IJWC 3SFIA 2DYRH 4NLBA 1SFOJ 2Z2SB 3SMSA 4XOPA 4FJXA 4UV9A 4F7ZA 3L9FA 2VKDA 5DYMA 4JI5K 5DV5A 1P9QC 4KIBA 4OGCA 1P90A 3O1BA 1FP2A 2OQGA 3E6BA 1W0HA 5M1QA 1WHUA 2MD5A 1V4RA 3HPHA 3S1RJ 4FM2A 1TKZA 1HOMA 5LGTA 1TNSA 5J4YA 4CEZA 3Q5FA 3SPZA 4A62A 3IAS2 4EQQA 1U2WA 1BI2A 1C0UA 3SV3A 4BRMA 2FBVA 1GOCA 3SI6A 1MDMB 3BTLA 4CCNA 4IWVA 3R1XA 3RR7A 3J81O 4GXOA 3C2GA 2W7NA 5B3SH 2CUJA 1L0OC 2NRRA 2G7UA 4HLYA 4MQVA 2FSKA 5DM6F 2OA8A 3TQNA 4JQFA 3DTIA 1MDUB 1VSLA 3AO3A 2ZGZA 9ANTA 1RFQA 3K4BA 3RKXA 1BQNA 1WH7A 3TTFA 5LRSA 5AQNA 1WQ2A 2IAJA 4ISEA 1RPWA 2IDOA 5JVGL 3MN5A 3AO4A 1JCEA 4O8UA 2CH6A 4JHDB 2F4MB 2Y9ZA 4LY7A 1RBVA 2K9LA 3OA9A 4CIGA 2IGIA 4LFAK 5AQMA 3OWTA 3FXJA 3TI0A 2O8FA 4E7IA 3RMCA 3DCFA 3DOKA 3SMPA 4CGGA 3CUQA 1U6GA 2K86A 4XLNF 1X4PA 3PSFA 1SKWA 1A6QA 4HRIA 1XGMA 2RQPA 3G2BA 3A0HC 3V81A 1W5SA 1KA8A 3IKVA 5JI6A 1B8IB 1ZYQA 3BG9A 3CDLA 2VWJA 3G71N 1C0FA 2BH1A 1OYWA 2EJRA 3BC8A 1TYQA 4A3DJ 2DTUA 3S2WA 1HYZA 1RCHA 3HJEA 1RKTA 4XMYA 4X62K 4I6ZA 3RRGA 3F8MA 3HP9A 4DHYA 3F6OA 5TISC 4RM3A 3CDHA 2Z1HA 2QSGX 1MSEC 3WXJA 2QQ8A 3Q7CA 3B8AX 2DYSH 1W7PA 4XEIA 3DF8A 2ZC2A 2EV5A 4GKKK 4AYBA 1RESA 4PFOA 1JLCA 1FTZA 1QU3A 1N75A 1K4TA 4XNFA 1BIUA 4XSXF 4WCEL 1ZTRA 1GHCA 2ZF5O 1T0FC 4C3IJ 2E1ZA 5D3GA 1ULYA 1KAYA 1QQIA 3AA3A 3F8NA 3K4MA 2IVMA 2Q1NA 3GCMA 3FK6A 3SBGA 3J80Z 1MJ9A 1GUUA 1VI0A 2L9NA 2YHXA 5T7BA 2Z1GA 4FWMA 3ZT4A 3L09A 3JXUA 2HHHK 3P4IA 1ZRDA 1VQ6N 3GVAA 1Z3YA 2GUIA 3A0BC 5KNLA 1LEAA 4Q48A 4HNUA 1POGA 4DNCA 4HHTA 4NC8A 3K4NA 3VQDA 5GINA 3FXMA 2QQ9A 4N4NB 5F0CA 4DV2K 2NVQJ 1LJ9A 3WT0A 1ZYRF 4B8CA 3KLFA 1FXXA 4I2QA 1LWFA 1U8RA 4ISGA 1VQNI 1G4DA 4IF4A 3QPTA 4DF8A 1TC3C 3LFKA 1VHXA 2E5NA 1ETYA 4YEJA 3CCVI 1FT9A 5L3EA 2XAUA 3CJTB 1AU7A 2ASPA 4BR5A 4B1RA 3LP0A 2PYLA 5CE3A 4BRCA 2ZXJA 3PLAA 3MZHA 2E35A 3AVBA 3J7YJ 4PJLA 4FM1A 4ID5A 1O57A 1XMOK 4XLHA 3SYZA 4DR6K 2OTLN 1REVA 1NK2P 3OYKA 3OS0A 3TABA 4MLHA 2I5UA 5K7ZA 4IVNA 4BG9A 3D2EB 3GTKJ 2GUPA 3S3MA 3IUOA 2UUZA 4BY1J 2IVOA 2JA8J 4RDUA 4BEHA 4CDGA 3B73A 3ZX2A 4KMUX 2LKSA 2ZMEA 1NGIA 1YJNN 1S7OA 2ICWG 1WB9A 3ULDA 3LWMA 1BG3A 3PQKA 2NRHA 3SHFA 1RDUA 3GFLA 1KFSA 1EO1A 5HRRA 3F9KA 5AR0A 4DV5K 2ZFWA 2F4VK 3FMRA 3FXQA 1NGFA 3WTWC 3RPUA 3QETA 4KMFA 5M1OA 3DBLB 1S6PA 3HSFA 1QTMA 1BOBA 4DJAA 3K69A 1ZREA 2P5LC 1JXEA 2QWMA 2E1NA 1HKGA 1OH7A 3OSGA 5B1BH 2H8RA 2VWKA 3M6GA 3FFKB 3CF5F 2M9HA 1YIJN 3PX4A 1R5GA 2X4HA 1BC7C 3RKQA 5GAEP 4JKBA 4F3TA 4B3XA 3DXKA 1NK8A 2O5RA 3CERA 2E7XA 1ZR2A 3HRUA 3L4QA 3O80A 3QERA 5DUKA 1SFEA 2HOTA 4BHPA 3CFPA 1V54H 4YDUC 4PJMA 2KDOA 1LE8A 1ZLJA 1S9EA 2DDAA 3H08A 1YLFA 1MGTA 1DKGD 5GADP 1H89C 3SCXA 3KYLA 1YJWI 2WC2A 3GFIA 5IPAA 3M8RA 5FKMA 3QO9A 3D5RC 1NU0A 4DFKA 2HBMA 1B9FA 1ZG1A 1K73O 2IEKA 1W0UA 4BYYA 4LG0A 2NNYA 3MKZA 4HTLA 3VENA 2KW4A 3ZYYX 4CZIA 2P9LA 1KU9A 2H27A 4LF5K 3UKUA 1V4SA 3ZCOA 1ATRA 2Q0OA 3DEUA 4G8XA 5EVZA 2BE5F 1HCRA 1U2VA 3O8MA 2QEXN 1BA5A 2XHBA 2JRTA 3A2KA 3VOEA 4XH1A 3SEZA 2Y30A 4LFUA 4RW4A 1QZEA 4DSEA 4B44A 1X19A 4EATA 4LIVA 4NBQA 4KN7X 3DXMB 3J81Z 4BROA 1VQPI 2P9NB 1YT3A 2PEXA 2KL4A 1JUPA 1WLJA 3LWFA 3SXYA 3HZ6A 3TPQA 3FXRA 3ZMZA 1V5GA 3HB9A 3BT9A 1OISA 2MH2A 2R7WA 1GLJO 1F1ZA 3DJCA 3KWIA 4ENMA 3FWEA 5DS9A 3T0YA 3ROUA 3HOTA 4EHTA 2DK8A 3JTGA 1ZRCA 4JI4K 2AA4A 2EH3A 3V1RA 1BR2A 1K7AA 3ZX0A 4B1WB 4A5AA 3JRHA 4AHRA 1LVKA 1VSMA 2I7PA 3CCEN 1DPRA 5IP9J 2JWTA 4CZFA 1A6IA 1SD7A 2E2HJ 2WTUA 2YHYA 2PY5A 1SL2A 2W6KA 3DOLA 1N77A 3J8AA 1NJIO 2Q31A 4CGFA 2D1HA 2LG4A 3QFPA 2BW3A 1X9MA 2ZJPL 4DTJA 4L5EA 5EDNA 1DEJA 4MFBA 2ZQBA 1JJ6C 3WTYC 5B5EC 1U5TB 3O3HA 2E36A 3V9UA 1ACIA 3LALA 1OH5A
chains in the Genus database with same CATH topology
4CUGA 4QPOA 2IGNA 4Z4CA 3RWUA 1IRXA 1Q9XA 3S93A 1RBSA 1BIZA 3VYUB 2M7AA 1WAJA 1MNDA 2WA0A 4BGDA 4NYNA 3AVHA 4B9NA 3CMMA 3ZQQA 2D0BA 1Z25A 4XLFA 3JYTA 3NF7A 3SQ4A 1YTAA 2O4GA 1BI4A 3KKRA 3D5SC 4LH5A 1X9WA 3VQ7A 1T03A 4EP4A 1NJZA 4RW8A 5CYQA 3KD5E