3HPHA

Closed tetramer of visna virus integrase (residues 1-219) in complex with ledgf ibd
Total Genus 64
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
64
sequence length
210
structure length
194
Chain Sequence
NIPLAEEEHNKWHQDAVSLHLEFGIPRTAAEDIVQQCDVCIDHWQVDYTHYEDKIILVWVETNSGLIYAERVKGETGQEFRVQTMKWYAMFAPKSLQSDNGPAFVAESTQLLMKYLGIEHTTGIPWNPQSQALVERTHQTLKNTLEKLIPMFNAFESALAGTLITLNIKRKGGLGTSPMDIFIFNKEQQRIQQQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural basis for functional tetramerization of lentiviral integrase
pubmed doi rcsb
source organism Maedi visna virus
molecule tags Transferase
molecule keywords Integrase
total genus 64
structure length 194
sequence length 210
chains with identical sequence B, C, D
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2009-06-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00665 rve Integrase core domain
A PF02022 Integrase_Zn Integrase Zinc binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.200 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Arc Repressor Mutant, subunit A 3hphA01
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 3hphA02
3K5OA 1HYVA 1ZBIA 1ZBHA 1VSDA 3DOKA 3VQ9A 3WNFA 4CGHA 4LSLA 1S1WA 4M3TA 1WJEA 2DFEA 3WNHA 3C95A 3OYAA 4LH4A 2BANA 3KLEA 3NBPA 3FFIA 4W5TA 1JL1A 3V9WA 1RDBA 4OLAA 4JS4A 4NYFA 2A1SA 3BGRA 3CFOA 1CZBA 4JRQA 4FZXC 3DOLA 3AVFA 3O4NA 3L2RA 4J2EA 2O4IA 2OPSA 3P1GA 3CM6A 3K59A 2HW3A 2WOMA 1WJDA 3AO4A 4I9LA 3KLGA 1RT7A 1S9EA 4CFDA 4CESA 2HMIA 4FJ8A 3OYCA 3MECA 3U3YA 3G10A 1RTJA 3T1AA 1ASWA 2HNYA 1QSLA 4F8RA 3S3MA 2D0AA 4AILC 3LDSA 1L5UA 5DK5A 4CIFA 3LZIA 4FYDA 4DS5A 1J9AA 1VSMA 2VG7A 2Z1HA 1EETA 4ID5A 4RW4A 2F96A 3QERA 3TAEA 2HHTA 2DFFA 5SZTA 1C1AA 1VSFA 4DFPA 4BDPA 1RT6A 4KHSA 2ITGA 1WSGA 4RW8A 5HRNA 3CFPA 3O3FA 3SUOA 1LAVA 4N47A 3PY8A 4PUOA 4Z4GA 4HVJA 1W9HA 1RT1A 5FDLA 1C0MA 1HQUA 4AHRA 4DU1A 1T03A 4FK4A 1Z25A 2IC3A 4CHQA 4AHCA 1JL2A 3OYLA 1NK8A 2KFZA 2HHXA 1JLAA 1C0TA 1A5WA 4Y1CA 4DTSA 1CLQA 2VG5A 2PZSA 4CFCA 4OGEA 1KTQA 1RBSA 1JLFA 1S6PA 1VSJA 3G0ZA 2XO7A 2KW4A 1D9DA 3MAQA 1BISA 4ICLA 4FJIA 1EX4A 1BGXT 4EZ6A 2DFHA 4M42A 1EXQA 1X9MA 1RTDA 3VQ7A 1O1WA 3VQBA 4CJ3A 1X1PA 4OJRA 3L8BA 3CM5A 4CJEA 3QEIA 1UAXA 2YHAA 3VQCA 3LALA 3O4QA 4CEDA 4DTJA 4DSLA 3HO1A 4OGCA 1U48A 3VN5A 2YNFA 3VA0A 4PWDA 4CGIA 3QEPA 1A5XA 4BE2A 2B6AA 4C8MA 1WSJA 1NK4A 2P5OA 4ELUA 4JLHA 3ITHA 4W5RA 4CJTA 3QEVA 4B9UA 4CF1A 4DTUA 4RW9A 3S9HA 4FJXA 4M3XA 4CJLA 4CF0A 3KK1A 4E7KA 4KO0A 2FBTA 2XY6A 2RKIA 4DTOA 4H4MA 4FLXA 1WNSA 4DF4A 4KB0A 4KB1A 4C8NA 1RILA 4KI6A 4NCGA 3OYEA 3V9ZA 4FJ9A 3TI0A 4HCBA 4H4OA 3ZSXA 1RDDA 3MEEA 3C6UA 3DRRA 4CGJA 4CF9A 1XC9A 3HVTA 3D0PA 1TL1A 3KIOA 3V81A 3OYKA 1KFDA 2G8UA 2I5JA 2Z1IA 2HNZA 4BWMA 5SWMA 4B9VA 4FJNA 4B08A 4E89A 1YTAA 1XWLA 3B6PA 1SKRA 1L3SA 1KFSA 2BGGA 3UIQA 3THVA 3KKSA 3TR8A 4CERA 5E41A 3HT3A 4Z4IA 1YVUA 4CGDA 3TARA 4E7IA 3HP9A 1KLMA 1JLBA 4R5PA 3NF8A 3SQ0A 1F21A 2BE2A 2P51A 1IH7A 1KSPA 4LSNA 1ASUA 4O5BA 1RTHA 3AA2A 3EZ5A 4DTXA 4IFYA 4CE9A 1SKSA 3VQ5A 4O44A 4OPKA 2G8HA 1NOYA 4LH5A 3TWHA 4Z4FA 4F4KA 4FM1A 4E7HA 1LFPA 5K14A 3L2VA 3L2QA 4FLUA 3IG1A 4FLYA 3HPGA 2WONA 1KONA 1C6VA 1KVAA 4NYNA 3OYDA 4CEOA 1NOZA 4H8KA 3QIOA 1HNIA 3RR8A 4DSEA 2D0CA 2E6MA 1Q8IA 1C1CA 4O55A 4UQGA 3HPHA 1TK0A 3ZT4A 4CCHA 1WSHA 4IDKA 1Q9YA 1HMVA 3VQDA 3ZT2A 1RT2A 2X74A 3OY9A 1BCOA 4CK2A 1S6QA 4WE1A 5C25A 3SQ1A 4CEZA 3QESA 1JXBA 5CZ2A 1QS4A 1DLOA 3NGZA 3RMCA 4NCAA 1QTMA 3LZJA 1BIUA 1ASVA 1EP4A 2XY8A 4J2BA 3V1RA 1LW2A 1S9GA 3O3GA 4FJ5A 3L2WA 1S1TA 4Z0UA 1VSLA 1WSEA 3NFAA 4JS5A 2FC0A 4DFMA 3HM9A 3K5LA 4Z4HA 4BE1A 4M3ZA 4TSXA 2YNGA 3QIPA 3KJVA 3U3GA 3QEXA 4CHOA 3L3VA 3ZCMA 3NGYA 3M8RA 1TKXA 4FM2A 4N56A 2OPQA 4KV8A 2RPIA 3K5MA 3SV3A 3V4IA 4DFKA 4DLGA 3QINA 3QO9A 4KTQA 4KHNA 3TABA 4PY5A 2QKKA 3DLHA 3NF7A 3CFRA 3SNNA 1GOAA 3SJJA 1RT3A 3ZSOA 4AHUA 3SPZA 4NCBA 2RN2A 1ZYQA 1RBRA 3OYNA 4CJVA 1BQMA 1FKOA 4FJJA 1QSSA 2HVIA 4KTWA 2VWKA 4DTMA 3DYAA 2YNIA 4CFBA 5T7BA 3E01A 4K8ZA 3NF9A 4DSFA 2QKBA 3WNGA 1RBUA 3I8DA 3NH0A 4DU4A 3HYFA 2OA8A 1CZ9A 3K58A 1S1UA 3V9UA 5DMRA 4AHSA 1SL2A 2X78A 3M8QA 4ID1A 4CIGA 4DMNA 4E19A 1VSIA 1T8EA 1J53A 4RG8A 2GV9A 2G8VA 4CHYA 2ZQBA 5KRSA 3PV8A 3CYMA 1U45A 5HRRA 3NH2A 3ZSQA 2FBYA 4XIUA 2E4LA 4B9LA 1VSKA 5HP1A 4ELTA 3HJFA 2IS3A 3ZSWA 5I3UA 4EZ9A 4F3OA 3LPUA 3PX4A 3SPYA 1NK9A 2G8FA 2JGUA 5J2MA 1IG9A 1DTQA 1LWEA 1VSHA 4J2DA 2IGIA 3LP3A 2G8KA 3NGIA 4DLEA 1GOBA 2OPRA 1TK5A 4E7JA 2KTQA 4IBNA 1RCHA 3NCIA 3SYZA 2ZD1A 3RR7A 4HHTA 3LP2A 4E1NA 3TAFA 1BIZA 1WAFA 4E7LA 5J2PA 2OYQA 3F73A 1T05A 3DMJA 2P1JA 3AA4A 3OVNA 3H08A 2Z1GA 4OKJA 3C6TA 3OS1A 3VQQA 2W42A 4DWIA 4FXDA 1DTTA 1RT4A 3OJUA 3RMAA 4OLBA 3VQEA 3OYFA 1TAUA 1NKCA 4CJ5A 3ALYA 3AA3A 1ZBUA 1Z26A 4CGFA 1NKEA 2HB5A 4IKFA 1TVRA 2YKMA 4CF2A 1JLCA 1I39A 4B8CA 3KLHA 5J2NA 1NK5A 2HHQA 5KGWA 1REVA 3KLIA 4DU3A 3O3HA 3I0RA 3LPTA 3SZ2A 3ZT1A 1NKBA 4DQIA 4FK0A 3VQ6A 4CF8A 3KKRA 4DF8A 4CHZA 1U4BA 4BWJA 3SQ2A 4K8XA 3HVRA 4J2AA 4M3UA 1BI4B 3DM2A 1WJBA 5KI6A 3QNOA 1VK0A 4FJLA 3MXMA 3DLBA 3HSTB 4CJ4A 1IKYA 1IKXA 1SL1A 1QSYA 4F3QA 4OKEA 5CY4A 3QEWA 4Z4CA 3KK3A 5FRMA 3AVNA 3PX6A 2AJQA 4DTNA 3ZSZA 4FVMA 1VRTA 4CJSA 3AVGA 4CEFA 2G8WA 3MXIA 1RTIA 3AVIA 2VG6A 4CK1A 3V9XA 1K6YA 1YT3A 5EU7A 2KFNA 3AV9A 3AVAA 3LP0A 2Y1IA 1NJYA 1WSIA 2QXFA 2BDPA 4DSKA 3D45A 5J1EA 4KPYA 3LANA 3NHGA 1UWBA 1TKDA 2FBXA 4KRFA 3L3UA 3SUNA 4KHQA 3SUQA 3SI6A 2OZMA 1YTUA 1RDAA 3K2PA 3NF6A 2YV0X 4EP5A 4FW2A 1WSFA 4FLTA 4CGGA 2D5RA 3ULDA 4FJGA 4E1MA 3P83D 4CEQA 3V1OA 3QETA 2HHWA 3PX0A 5KGXA 1FKPA 1FK9A 4CHPA 3ZSYA 4YNQA 1D9FA 3KTQA 4C8OA 1VRUA 1S1VA 3B6OA 2PYLA 1TAQA 4FLWA 1FXXA 1SL0A 1E0EA 1WAJA 4CEEA 2HHVA 4I2QA 2E6LA 3AVJA 4E0DA 2OZSA 2ETJA 4IFVA 4CEAA 4AHVA 4FLZA 3OYMA 1HYZA 4FW1A 2F8SA 3AVHA 4FJKA 3VQ4A 3AVKA 1SV5A 4CJWA 5KTQA 2B5JA 2LSNA 3P5JA 4FCYA 5FROA 3RTVA 4DQQA 1T7PA 3OYBA 2P5GA 3RWUA 3HXMA 4KHYA 2Y1JA 2KZMA 4W5QA 4O0JA 1ZBLA 4B9SA 4ELVA 1HQEA 3M8SA 4Y1DA 4AH9A 2EHGA 1XHXA 3PO5A 3V1QA 4O4GA 3EYZA 1WJAA 1LAWA 2IAJA 1ITGA 1GOCA 1JKHA 4B8AB 1KRPA 4FJHA 4RW6A 3KK2A 2O4GA 1SKWA 1G15A 2FBVA 3IS9A 3T19A 3L2UA 3TAGA 2A1RA 4DQPA 2KZZA 2IOCA 2R7YA 1JLEA 4CJRA 1LW0A 2XY7A 1IKWA 1U04A 3CG7A 2ZE2A 4FJMA 4KREA 1KVCA 2X6NA 4LY7A 4CJPA 4EP4A 1S1XA 1KLNA 5HROA 1CXUA 1QHTA 3AO5A 2PYJA 3DI6A 3RMDA 4N41A 4CJQA 2XRIA 4GW6A 3ZSVA 4E3SA 2G8IA 3TANA 1IO2A 2Q3SA 4I7FA 1IKVA 2HHSA 1BQNA 1LWCA 5D3GA 4JRPA 4AHTA 4KHWA 3OYJA 2YNHA 4ZHRA 1JXEA 1NJZA 4W5NA 3PO4A 3DLRA 1BL3A 3EY1A 3LP1A 3OJSA 3K57A 4GMJB 4FM0A 1TL3A 4I9QA 1HJRA 4O0IA 1JLGA 4HUGA 3QNNA 1RBVA 1MW7A 4FLVA 3ZT0A 1Q9XA 1B9DA 4CK3A 3MEGA 1UOCA 5CYMA 1B92A 1BCMA 3V9SA 3OYIA 1LV5A 1RT5A 3S3NA 3SUPA 3RMBA 4IG0A 1TGOA 4CHNA 2RF2A 4IG3A 4CJUA 3OS2A 4DQRA 3SCXA 2F8TA 1KCFA 3KD1E 1C1BA 2OPPA 1ZBFA 3ISNC 3LAMA 3ZT3A 4HUEA 1XHZA 1NJWA 3AVCA 3AVLA 5JS2A 4OPJA 1WLJA 3A2FA 1SUQA 3AVBA 3VA3A 3RRHA 1NK0A 3HPOA 4FK2A 4OKKA 2JLEA 1QE1A 1TKTA 2HNDA 1N6QA 4PA1A 3MEDA 1BI4A 3C94A 4DTPA 4BE0A 1NK7A 4M41A 1HNVA 3K5NA 4DTRA 3RRGA 4N76A 1QQCA 3LWLA 4FJ7A 5HRSA 2DTUA 1XI1A 4FZZA 3HP6A 4KI4A 4OVLA 1VSEA 5CZ1A 4HUFA 1L3VA 4CIEA 4F2RA 2GBZA 4B9TA 4B3OA 4HTUA 2GUIA 2HHUA 1TK8A 4B9NA 1L3TA 3QLHA 3AO2A 5J2QA 4L8RB 3DLEA 1CXQA 3DLGA 2QK9A 4Q0BA 3NAEA 4CJFA 5KRTA 3JYTA 2PY5A 4KAZA 4CJKA 2YHBA 3VQ8A 3OYHA 1UA0A 3HK2A 4CFAA 3HL8A 4QAGA 1U47A 2KQ2A 4FZYA 4M3RA 5HLFA 4DQSA 4DSJA 4M3YA 3KLFA 1BHLA 1HRHA 3DLKA 3ZSRA 1I3AA 1RNHA 2Z1JA 3AO1A 1U49A 4YFUA 4N5SA 3TAMA 3TAPA 4C8KA 1Y97A 3DRPA 4KKOA 4I2PA 1A5VA 3PUFA 4MFBA 5C24A 2XY5A 1TKZA 3KD5E 1W0HA 2HVHA 1D8YA 5JS1A 1N5YA 4RW7A 4Q5VA 1LWFA 3DRSA 4M45A 1HPZA 1RBTA 1JLQA 2VWJA 3NE6A 5HRPA 4QCLA 2B4JA 3T3FA 4KHUA 1HYSA 2XHBA 3V6DA 1WN7A 4G1QA 4KTZA 1KVBA 1C0UA 2YKNA 4GVMA 5HBMA 3LAKA 4DS4A 3SQ4A 1NK6A 4ZTJA 1MU2A 4DFJA 4PQUA 4M3WA 2IDOA 4W5OA 2DY4A 4BACA 3ASMA 3S3OA 3OYGA 2X6SA 3AO3A 3MXJA 5FRNA 3NH1A 4DSIA 3NDKA 4CECA 1RDCA 4HCCA 3VQAA 3JSMA 2NUBA 3AVMA 3OS0A 1X9SA 1J5OA 1L3UA 3VQPA 4CEBA 4BDYA 4F2SA 1S5JA 4MQ3A 5I42A 4KFBA 4B9MA 4C8LA 4F3TA 3IRXA 5C42A 1UA1A 4QOZB 4BDZA 3F9KA 1TV6A 3SV4A 1B9FA 4DG1A 3WNEA 1D5AA 3U6FA 3IAYA 1EKEA 1J54A 1WJCA 2D0BA 3BDPA 1WJFA 5CYQA 3CQ8A 3TAQA 3M8PA 1NJXA 3AA5X 1R0AA 3I0SA 3LWMA 2ATQA 4ZTFA 2EX3A 4LD0A 1X9WA 4Z4EA
chains in the Genus database with same CATH superfamily
3K5OA 2LD5A 4MLHA 2JWLA 3MEXA 1ZBHA 5E8IA 1QZYA 3WNFA 4M3TA 4FHTA 4LSLA 2QSFX 5CQGA 2W4SA 3AAFA 3C95A 3WNHA 4LMYA 1BI0A 3KLEA 5DM7L 2JUCA 3UKRB 4OLAA 4C2TA 1W4MA 1MH4A 2A1SA 3WHCA 3O4NA 4XLNF 3CMMA 3TSQA 2OPSA 3PIOL 3CM6A 3K59A 2HW3A 2HOSA 3J7ZI 3ZQCA 2M9HA 1S9EA 4CFDA 2VJ5A 4FJ8A 4RGRA 3DLAA 3OYCA 2JSCA 2L7MP 2ITMA 2R7WA 2EJRA 2HI3A 2HQRA 3VEYA 2HNHA 5AR0A 1N75A 2GIVA 3IP4B 4RLFA 4KBOA 2JK3A 1QSLA 4BS9A 1VQON 1JUMA 3KZZA 4RDUA 2PLYA 2OV7A 1BA0A 5CE3A 1STZA 4CIFA 1W7PA 2PN6A 5GIOA 1FYKA 1S7EA 2IVNA 5D6FA 1J9AA 4B1XB 4UUSA 2IGKA 1X58A 1DP3A 3DTKA 1HLVA 3J80Z 4LF7K 1VSFA 1TC3C 2XAFA 3KP5A 1RT6A 2ITGA 2VJIA 4RGUA 4UHTA 5HRNA 3O3FA 4A5NA 4IHTA 4A69C 3SUOA 4PUOA 4Z4GA 5JR3A 2BY3A 5CLSA 1RT1A 5FDLA 1T03A 1FOYA 2PMZN 3P7NA 3VSLA 4YOTA 4BRMA 2HYGD 4Y13A 1FYMA 1JLAA 3DCFA 3ZOBA 1XSVA 1VQOI 3L1PA 3V4GA 1A5WA 5AQYA 1WBBA 2VG5A 2W41A 2ZSIB 4CFCA 2MYSA 2A69F 1RBSA 4NQWB 3V7RA 4Y3OA 4NBQA 5H20A 1KU7A 1MMAA 2GEMA 2F9TA 1D9DA 3MAQA 3ENOA 5AQHA 4G12A 3ZEUB 3O9UA 2O9LA 4DR3K 1EXQA 4LF5K 1DQUA 1QU3A 3VQBA 1AKHA 4U7BA 1NWKA 3D2EB 3ID8A 3OBYA 5JLFA 4M3BA 2EK5A 4OJRA 2X6YA 4YOUA 1BN5A 3L8BA 1FBUA 3LSKA 3P39A 3CCUN 3QEIA 3FKIJ 1C0FA 2QEXI 3FXKA 4BR9A 3NQOA 4OGCA 2YNFA 3KETA 1A5XA 2LR8A 4ELUA 1XG1A 2B7EA 1ETWA 1CQTA 1NGFA 2GWRA 1Q18A 4JLHA 5AZJB 3EUHA 4CF1A 1O13A 4RW9A 2COBA 1TWAJ 3CP8A 3ZMZA 4BXFA 3CCLI 1TNTA 3H45C 4X0GA 4CJLA 4M3XA 4IOAL 2DT5A 2P7VB 3ZMDA 1B9MA 2WWYA 1SMYF 2XY6A 2OTLN 2XPVA 5GPAA 4XRFA 5H2FC 1NGIA 4BH9A 2ZFWA 2WUSA 3B6CA 5GTIC 1VI0A 2E1ZA 4BVOA 3R3LA 1XPXA 3OYEA 4NCGA 3V9ZA 2P5VA 2MH2A 3MKZA 4FJ9A 3M9AA 4EEFG 3W2AA 2PBDA 4L5IA 3DRRA 3LL7A 1XC9A 2HKOA 3F6OA 3QU3A 1I6XA 1Z1DA 3D0PA 2VLAA 1AHDP 2RNGA 1D3YA 3V81A 5SWMA 4B9VA 2E19A 1TQIA 1L3LA 2CV2A 4PK4A 4IXCA 1PP8F 2XDVA 3B6PA 4E89A 1SKRA 5M1QA 3THVA 3CF5F 1HDPA 2VOPA 4CERA 5J8CA 1YVUA 3JRDA 5EZHA 4EJOA 4FWQA 2VT2A 3E9LA 4GO1A 5E79C 3JREA 3NF8A 1N78A 1N32K 1ZG5A 4MLOA 1PUEE 1F21A 4DV3K 1KSPA 2ISZA 1ZGAA 3CF2A 1IBLK 1RTHA 2RDPA 2L7FP 4XONA 3KP4A 3WTUC 2I7NA 3HRMA 3SEQA 2DOEA 3GTKJ 4Q5SF 3HI0A 4IFYA 5AQGA 4DTXA 1XSXA 2X85A 4O44A 2VIXA 3MWPA 2Z5UA 4DQ2A 2KDOA 4DJAA 3FWEA 2L4AA 5HOOA 2DODA 2HBMA 1J5YA 4WFNL 3TWHA 3EDPA 2V9KA 3QBWA 1YW8A 3CQZJ 2RAEA 2DO7A 4QPOA 4A0ZA 3CDLA 1UG0A 2X1CA 2P5KA 3HUGA 4FETA 1IN4A 3HPGA 1QA6A 1KONA 2HGCA 2WC2A 1KVAA 2QWLA 4FLYA 2XRLA 4F55A 3G1MA 4KFCA 1MIJA 1HNIA 2D0CA 4YDUA 4CCHA 1JCFA 4FLUA 4JK7A 1FY7A 2Y30A 1G6NA 3G71N 5IOYA 4OMZA 1HMVA 3EN9A 1P4XA 4LGWA 4I99C 1LFUP 2R4GA 4CK2A 3TKYA 2DJNA 5AQJA 2Y2ZA 4CEZA 3QESA 3GW2A 3BJAA 3PNYA 1S5LC 3NGZA 5BOXA 3WT0A 3LMMA 2JA6J 3ULEA 4NCAA 1G3SA 5LHHA 3EYYA 3PNVA 3OW2M 4HSTA 4FJ5A 2X6WA 3P9KA 4B8XA 4E7SA 5JI6A 3D1NI 1S1TA 4Z0UA 4JS5A 1R59O 2FSNA 3GE1A 3WEEB 3CCJI 3AAQA 4H5WA 3WHBA 3GFLA 1BDGA 5M1KA 4WXCA 2CU7A 4F92B 1MMSA 3L3VA 3TOBA 2QQ9A 3BF3A 4CHOA 1QVGM 4Y4RA 1QQMA 1K4SA 2QM3A 4FM2A 4N56A 3BDDA 2OPQA 1HOMA 4KHNA 4DLGA 3QO9A 3K2ZA 4M6VA 2QKKA 4A3LJ 3H3NO 3DLHA 3ZGKA 2YUSA 1VQPI 1MJBA 3SNNA 5D5UB 2K85A 4IRIA 2QYOA 4P5OA 1RT3A 5C2FA 5BQTA 3SJJA 2OD5A 1GLBG 1ZYQA 4CYDA 1IG7A 4QPQA 2CQXA 1FKOA 1V5GA 4XR6A 5LRSA 4IFEA 1QSSA 2VODA 2QEXN 1IN8A 2UUZA 3RSNA 2STWA 3DYAA 3I58A 4OU0A 2YNIA 4CFBA 1N36K 2CUFA 5DV5A 1FIAA 3I53A 3CCRI 4H0EA 4C2UA 3LOCA 2P9KA 1JJ2M 2LKPA 3LSMA 2YHXA 3OR1C 1CZ9A 4FWNA 5CVJA 3MMVA 2CQNA 3WUHA 1S1UA 4CZMA 4AHSA 2X78A 4ID1A 3A02A 3HBLA 1VSIA 4BRFA 5EG0B 1J53A 5K14A 4WFAL 2ZQBA 1VQPN 5FO5A 2UWMA 4BRNA 5EEHA 1LE8B 4N4OB 1F5TA 3VPRA 1ZGJA 4XIUA 1MDMB 3LDQA 3L7WA 2WAQN 1O7FA 2Y75A 3CCLN 2HMPA 4EZ9A 3DEUA 3LPUA 2P9UB 1KQ8A 2LY2A 2JGUA 4IWVA 1R00A 3BCBA 5J2MA 2VXDA 1U9NA 3C2GA 1R1UA 4Q48A 1ZH5A 1LWEA 4RGSA 1QPMA 5BPDA 2IGIA 3LP3A 3LM9A 3SAHA 4BGDA 2G8KA 2P9NA 4DLEA 4CCNA 2KTQA 3TP3A 1RCHA 2ZD1A 4HHTA 3TAFA 1BIZA 3CJCA 4H5RA 1P7JA 1T05A 3DMJA 2XAHA 1A04A 4HV5A 2Q0RA 5IWAK 1TW3A 2BXZA 4NC7A 1T3VA 2GA2A 4KJZA 3IRQA 3VQEA 3QP5A 1LUJB 3OYFA 1IRZA 3E7LA 3LAPA 2DPNA 5AQXA 4CGFA 1Z26A 2MA3A 3E5UA 1TVRA 4IOCF 4JD2B 2Z99A 3IKTA 2VC0A 1RR8C 1LFBA 1LDKB 3HSRA 5IP9J 3ZQGA 1REVA 2BW3A 3CC7I 1XMXA 1IUFA 5C4XJ 1MNDA 1SQKA 4PKGA 3ZT1A 5B1AH 3S32A 4DQIA 3CD6N 2V79A 4DUZK 5EDNA 5AQVA 4EM0B 3OSGA 3KKRA 4M3UA 3BTIA 2NRHA 1XGOA 4JKCA 4XORA 4JI3K 5K7ZA 1MSEC 3SZGA 4YOYA 1VK0A 1P7IA 2L02A 3FISA 3ATVA 3DLBA 2O5RA 3DKWA 3R60A 4CJ4A 2JMWA 3QOPA 2YU9J 1K8AO 1IKXA 2QW9A 5CY4A 5AFUA 2AJQA 3KX2A 5GADJ 3UR3C 2Q2EB 4B3TK 1QO0D 1YO5C 1YRNA 3R0JA 2TRTA 4II2A 2VG6A 4CK1A 1YT3A 5EU7A 3M8EA 3RKWA 2ZM6K 3AV9A 1KQ9A 5C44J 3I56N 1HF0A 3NWTA 1JCGA 1WSIA 2QXFA 4JI6K 2ZFUA 2JWTA 4KPYA 2HXOA 4KICA 2Q36A 2CW0F 4BKXA 2O8KA 3NHGA 1IN7A 2FBXA 1OH5A 4KRFA 1YIJI 1AWCA 4FT8A 4Q4ZF 2K4BA 3SUNA 2IAIA 3TW6A 5EGOA 4OOIA 3E3VA 3RVCA 2NYXA 1RDAA 3F21A 3CF5L 2UU9K 4LF4K 2YV0X 4G6QA 3T1YK 1E4GT 1VQ8N 1R5HA 3H9GA 5HS8A 4I2OA 3I5UA 4FJGA 4E1MA 1OYIA 3G1LA 3WQTA 3QETA 3H0DA 4II3A 3AGRA 4N4NB 4JI4K 2PMHA 4CHPA 1D9FA 3RCOA 2FOKA 1A31A 3LM2A 5JVGL 1YW9A 3VENA 5HNHA 3GZ5A 3A4CA 4FISA 1TAQA 2RHKA 3IWFA 1FXXA 4FLWA 2PYLA 1E0EA 2HHVA 3JRIA 5BPLA 1SD5A 3F9MA 4AM7A 2ETJA 1FBSA 2NVTJ 4AHVA 5HLTA 2KFDA 4WWCA 3AVHA 2DMNA 3O6BB 2K3PA 3BZ6A 3AVKA 1A6IA 2O8FB 2ELKA 1IV6A 2P5GA 2BXYA 3P5JA 4YG2F 4FCYA 2E1CA 4H0XB 4QSHA 4LFUA 5KHDA 2QSHX 5DCMB 3MKWB 3BF1A 1Y6IA 3LSHA 1ZBLA 3W6JB 3QB0A 2LVSA 1XD7A 4CXFA 1OCTC 1D5YA 4AIJA 2XF5A 1NGJA 2EHGA 1D1AA 2H94A 5HVQC 3EKSA 2MABA 3DXKA 3L4IA 5TJJA 3ZN0A 3MWTA 4BGAA 1OR7A 4LK0F 3DBRB 2O4GA 1SKWA 2FBVA 1IW7F 3ISPA 3K0SA 1XC3A 2VT3A 4CUGA 2CGKA 5TKYA 3DLLF 2R7YA 4CJRA 3F23A 1U04A 1LDDA 2CH5A 1VQ9I 4QTRA 4HV6A 2G9WA 4B3SK 2D2WA 1T08B 1KVCA 5AQFA 1WQ2A 2I10A 1Z7UA 1OLTA 2P9PB 2EINH 5HODA 3THXB 4N41A 4GW6A 1K83J 3DTIA 3CUOA 3ZSVA 4YHHK 2XAJA 1YHQI 1VF9A 1IO2A 4Z2YA 3CCVN 2B63J 3SEZA 4X62K 3OIQA 2HHSA 1LWCA 4IVNA 1S7OA 1XNRK 2MBFA 3GTQJ 2BY1A 4JEPA 3CXCM 4JRPA 1OYWA 5EXWA 4KHWA 3F0CA 4JN4A 2YNHA 4GKJK 1OH6A 1S8NA 4XRSA 2DU9A 2IJLA 1C0WA 1E3OC 3CJBA 3BR3A 1TL3A 4FM0A 1XMOK 4O0IA 4I9QA 1Y39A 2DMQA 1MW7A 1QPIA 2CV0A 1ESVA 2K3FA 4MQ9F 3VODA 1NGEA 1JUPA 3OOUA 2HBLA 1UOCA 3THWA 1LV5A 3SFZA 1RT5A 4DBQA 3DXMA 3K10A 4ILJA 2QCOA 2VQEK 3RMBA 3U21A 2M1BA 1BIBA 2EZLA 3PQJA 3C3WA 4IG3A 3SCXA 3KEOA 4LLGF 1J5EK 3Q7CA 3GUDA 4LF6K 2VBXA 3OMYA 1AA7A 1Z77A 5D5VB 3JRGA 3H92A 2OPPA 2VGNA 4K41A 1NJWA 4L3QA 1GVDA 1OJLA 2NS0A 2G7UA 2WV1A 4LG0B 1X1CA 3G2BA 3FGUA 3HGYA 2HVRA 3I55N 1NK0A 3VYUB 2Q1ZB 5GTHC 4OKKA 1BI2A 2OAZA 1TKTA 3VOVA 2E2IJ 2HNDA 3VEWA 4AYBN 1D0XA 4BQNA 1N6QA 3C94A 1YS7A 2FOWA 2HFHA 4M41A 1NK7A 4JI7K 1QQCA 4FJ7A 1XCBA 9ANTA 1W5CC 3MCZA 4HRIA 2XAQA 1ZLKA 1ZC6A 2NRWA 4FZZA 4PFPA 3J7AY 3HP6A 3D2EA 2FD5A 1NKEA 2FA5A 3CCYA 1G4DA 4B9TA 2GUIA 1TQPA 3QPTA 4V2FA 2VOOA 4PL7A 1ZR4A 2NRZA 3J7YP 3J7ZO 4A3IJ 5J2QA 4FQGA 2M8EA 3HXLA 1CXQA 2KIMA 2FNPA 2CMPA 3ECOA 5KRTA 2FRHA 3JYTA 2PY5A 2YHBA 3QAHA 4IHWA 2ZJPF 3JS6A 2PQ8A 4EJWA 4FL9A 3VETA 1BHLA 3JCUC 1U9OA 3LQQA 1JE8A 2DXIA 1MZBA 4OWRB 4B48A 3WU0A 3I71A 3JRBA 1VQ5N 4G7HF 2D0OA 4JV5K 2HDDA 4M73A 2A6HF 4QLCU 4M9SA 4C8KA 3DRPA 4MFBA 4I2PA 1A5VA 3PUFA 3MAJA 5C24A 2EQRA 2HYFA 3ZQ7A 2O8BA 1D8YA 3IAS2 1FZPB 2K5CA 1N5YA 2QXLA 4RW7A 2P81A 3BR1A 3HTSB 1GLLO 1LB2A 1HPZA 3ABLH 1C0GA 1JLQA 3C7NB 3MCPA 4MEYF 4FOIA 2BZTA 1U2VA 4KHUA 1LE8A 1HYSA 3D7EO 4ZDLA 3PL8A 1ZGWA 2IVMA 2BEOA 2KRFA 1QZEA 2FQ3A 2JA2A 2Y0MA 1NG7A 2WV0A 4RM2A 4GVMA 4MDAA 5FPNA 3G1OA 1OPCA 3V8JA 4KIGA 4HX8A 5K5RA 5FLVA 2TCTA 1BM9A 1GLJO 1MU2A 3O9RA 4K25A 4M3WA 3HRSA 3VOEA 4BACA 3WTVC 3S3OA 1RDWX 4MO5A 3JTGA 3IH3A 4LIUA 1EF4A 4DSIA 4OIPF 1B6AA 3V42A 2R7OA 4IO9F 5J4YA 2ECCA 1FNNA 4NDLA 2DK8A 5FD5A 3HOWJ 2DMPA 3DXMB 1X9SA 2ZXWH 3AGKA 1ZKGA 1EA3A 4IOAF 4DR4K 1JT6A 2Q0UA 1QHGA 1TUUA 4NXMK 4B9MA 4C8LA 1BR4A 3IRXA 2H3GX 4JX4A 1CZAN 1YF5L 2DA5A 1KAXA 1EKEA 3D2FA 1J54A 4BHPA 1IXRC 1WJCA 1WJFA 3WGHA 1WHUA 4BL0B 4ZZLA 6PAXA 4H4KC 2X4HA 5J40A 4BJ5C 3M8PA 5EVZA 3CQ8A 3TDZC 1TW2A 3DF8A 1Q86O 3QOEA 3GF2A 1H88C 1ONVA 4F91B 1NGGA 3MCAB 3IKVA 2NVUB 5J47A 4HPQA 1P8ZA 4GYIA 3MVPA 3QDKA 2L2OA 4DW6A 2BANA 1VQMN 5BS6A 1NHAA 3NBPA 2R7RA 1JL1A 1RDBA 3M1EA 3BGRA 3GZNB 3I4MJ 5FLXO 4JRQA 5DUIA 3JSPA 3S2HJ 4IL6C 3CC7N 4H0PA 1WJDA 1RT7A 3S1MJ 2JZYA 1J9IA 2E2OA 3OL4A 3MECA 2WA0A 4HLYA 3FMQA 3CMEI 4LLNA 4F8RA 4RB2C 2RQQA 4UUVA 3AFHA 4ZYAA 4X65K 4MIMA 2R7TA 2DCEA 2AQFA 5K1YA 3QWLA 2A5YB 3LQRA 2CRGA 4XLPF 2E2JJ 5DK5A 2NZTA 1ETXA 1VQ7N 3DPTA 1YX3A 3MWMA 4E1JA 2DFIA 4BUPA 3BY5A 1T33A 4RW4A 5AQOA 1GHCA 5SZTA 4DFPA 4BDPA 1NK3P 2ZNZA 3Q3SA 1WSGA 3EUKL 2P4WA 3M7GA 3BUZB 3QFPA 4A61A 1W97L 4HVJA 3FZKA 1C0MA 4FK4A 4G6TB 3WTTC 2M87A 3OYLA 4KH4A 4AHCA 4PSWA 1SEUA 4V19S 2XKPA 1HKGA 4BY7J 4DTSA 1CLQA 3K69A 4ENMA 2FMYA 2PZSA 1KTQA 1DGWY 3O8HA 2ME6A 5DYMA 5FKNA 5B8HA 5K7FA 1VSJA 2OANA 2ZWHA 1MJ9A 2XO7A 3G25A 1VQ7I 4YIFA 2J5OA 1YS6A 1KC8O 1BISA 3ML6A 2LNBA 3K9TA 2LK2A 4M3EA 3W0LA 4EZ6A 4EJUA 3BQZA 2DFHA 4J00A 2Q2RA 2UYTA 4ZDOA 3JRAA 1X9MA 1HNXK 1OISA 3HZJA 2H1LA 3FKJA 1WH7A 4ITVA 3TDUC 1VQLN 1X1PA 3SMPA 2LG4A 3NWSA 4JAXA 4CJEA 3G4SN 1X3NA 1HA8A 5EY4A 1V5FA 2XV4S 3KFWX 3S2WA 4ABZA 1Z91A 2V1XA 1YRNB 1H9TA 4CEDA 1FW6A 1T0FC 2EZHA 1MMDA 4A2AA 3VN5A 4PWDA 3PO3J 3ZX2A 4BE2A 5ERIA 2B6AA 2K9SA 3GCMA 4NB5A 4DCHA 3ITHA 2ZCWA 2ZMEC 1R1VA 3JR9A 1XS9A 3HOVJ 4B47A 2ZGZA 1QHHD 3I59B 3GFMA 4W1UA 2LREA 3FK6A 2DJIA 5FFZA 4CYCB 4CF0A 5AZJA 1ZYRF 3K4BA 5KNLA 4DNCA 3KK1A 1I94K 4PDKA 2RKIA 4DTOA 2K4JA 4UV8A 5B1BH 5DD4A 5F0HA 2UXNA 3FXLA 3GMEA 4N9IA 1QBJA 4KB1A 3DKXA 2GZWA 1SVLA 2LYCA 3TI0A 1I1SA 1D1BA 1U8RA 3D5RC 5HS7A 1RDDA 1LJ9A 1J75A 3HVTA 1R22A 1I5ZA 4MFEA 2CQKA 1R23A 2NS7A 2V9VA 5E1ZB 4MHGA 3OYKA 2HNZA 3LDPA 4NQWA 3N4PA 1TWGJ 4B08A 2TDXA 2OTJI 3OA9A 4JYAK 5KVRA 1BOBA 2BGGA 1NGDA 4EQQA 3KKSA 3HT3A 1Y64A 2VQLA 3C1DA 5LGUA 3CCMI 1U6ZA 3O08A 3E97A 4CGDA 4PJMA 4HAMA 1GXQA 1O7LA 2CH0A 2IT0A 4NHJA 1ZG1A 1KQSM 4R5PA 3M1FA 3SQ0A 4PL8A 2Q31A 3HOSA 1IH7A 3P31A 2HYJA 5E1XA 4ZH4F 3KP7A 2IXSA 4FJXA 2EIJH 3OSFA 1ASUA 4O5BA 2DQRA 1WOQA 4H5TA 4M63C 4HDUA 4J01A 4Y52J 3SZPA 5HDKA 1W1WE 4OPKA 3ONQA 4E70A 2LLKA 3DV8A 4F4KA 5F1XA 4DR1K 3KCCA 3DTEA 1V55H 4BVPA 1X3UA 3FMSA 1FOXA 4G8XA 4FWKA 3OHRA 5DEQA 1K7AA 3CC4I 2BH1A 1RPWA 4H8KA 3RR8A 5K7HA 1Y8RB 4O55A 1MJAA 1Q8IA 3REOA 2F6CA 2ME0A 1TK0A 3BOQA 1WSHA 3U1KA 4IDKA 2V1DA 2VWBA 2CUZA 3ZT2A 2BHYA 2AXLA 2KMUA 1ZBSA 3OY9A 2VI6A 2X0LA 2X1DA 1VQ4I 5F1JA 5C25A 1ITYA 4HTLA 2ZSHB 3HB9A 1KXPA 5AFUH 5EJCA 1SAUA 2YI1A 2RVCA 3BG6A 1QS4A 3ECHA 4AF1A 1R7JA 5KAIC 1BIUA 1JT0A 2QZ8A 3KEYA 3LDLA 4O3MA 5L3FA 1LW2A 3V1RA 4J2BA 3RPQA 3WTZA 1VSLA 3UE5A 2HF3A 3NFAA 4DFMA 3HM9A 4ESJA 5KK1A 2W82A 3GBGA 3QEXA 3QIPA 4LJZF 1XN7A 3U3GA 3A5LC 3KJVA 2FMLA 3OR2C 2L3DA 4C3IJ 4BC3A 3S8PA 2R7SA 2RPIA 1SFXA 4K0KK 4XKBA 4KTQA 3TABA 2MLKA 3CESA 2P9PA 1QGPA 3T0YA 4CCJA 3TTCA 3NF7A 4ZJZA 2KQRA 2RGVA 4NCBA 1VQ6I 2AHQA 2RN2A 3HG9A 4GRIA 5AZIB 4A59A 1BQMA 3MQ0A 4XRMA 2IS1A 2HVIA 3VYSB 2L0KA 4JKEA 4DYCA 5BN8A 1GVJA 3E01A 4XL9A 1FOWA 1U0JA 4EV0A 3NF9A 2QKBA 1G2HA 4IOXA 3WNGA 4LIVA 3K58A 2QSGX 1RC9A 2JJ7A 3HHHA 1YIJN 5L3CA 3M8QA 3GEZA 2DN0A 1FT9A 4CIGA 5EF6A 4E19A 3MKLA 3HUGB 3ZLJA 3SHFA 2HQNA 4DZPA 1K6OA 2VUMJ 1NGHA 2FSKA 3VEOA 2E60A 2B0LA 3CMYA 1KU9A 2W40A 5KRSA 5GAHP 1X19A 2ZXJA 1POGA 5HRRA 3ZSQA 2O6GE 2VCPA 1I6HJ 1YI2I 2E4LA 4XLAA 4IZ9A 4FO0A 2QWMA 4ELTA 2M0MA 4XN3A 3AAPA 2IS3A 3ZN1A 3AY9A 5I3UA 3CCEI 1Z6TA 4JI8K 4D0PA 1HKTA 3F2KA 3SBTA 3CJAA 4HX7A 1VSHA 2LBFA 1NMDA 3NGIA 3ABMH 1S22A 3NAUA 2PJRA 3MZ8A 4E7JA 2W6KA 4IBNA 3WG7H 3SYZA 3O3KA 5FGMA 4CH7A 2R3SA 1RZ4A 4V2GA 5C3EJ 1K61A 4E1NA 4B3XA 2EBIA 2ZMEA 5J2PA 2KIFA 2P1JA 3GOIA 1SMTA 5A2QZ 4UVAA 2Z1GA 1LKXA 1KQ0A 5D4SA 1OVQA 3BQYA 3C6TA 3H08A 4O8UA 2P5LC 4XKCA 2FF3B 1VQ4N 1X3ZB 2HQAA 3DEWA 3OJUA 3ZMTA 3RMAA 4OLBA 4IHSA 3ASNH 5AONA 4J8FA 4CJ5A 2A6EF 4B1WB 4KNYA 4LFBK 4ETSA 3RSEB 1NH3A 3FXRA 4C1NI 5GINA 4YRVA 2HHQA 2W25A 4DBRA 5L3GA 3KLIA 2EA4A 4H0TB 4RTFD 1FLIA 1APLC 3I0RA 3LPTA 4XSXF 4BXXJ 3NARA 3MZYA 3PIPF 2QWNA 3EETA 3VQ6A 1WWXA 4CF8A 4CHZA 2M2EA 4PSXA 1FJLA 1HQCA 1UMQA 3LWFA 3SQ2A 2NNNA 3FZFA 2DDAA 4CZHA 1WJBA 3TMOA 5K5QA 3QNOA 3H0GJ 3M8FA 4L0YB 3K4KA 3HSTB 4XN0A 4JI0K 4ESBA 1W9HA 3CHWA 3QEWA 4MGRA 5LMUK 4IO8A 3AVNA 3PX6A 4I09A 3G6EN 2DTRA 1K8KA 3I4NJ 1XTAA 3ZSZA 3W2WA 3AVGA 2ADUA 3KZYA 2VBYA 5F04A 3BG5A 5J6XA 1SFUA 1UCRA 1XGSA 3HL2A 4GDFA 4BC5A 3Q7BA 2DBBA 2P9LB 2R5YB 3AVAA 2J5PA 1AKHB 3CDHA 1NJYA 4M3DA 3S1RJ 3CJ1A 5J1EA 4LFCK 2E5ZA 2XUBA 2JT1A 3FFKB 3DPUA 1GLCG 4PJ0C 2P6TA 2A07F 4WFBL 3L3UA 2IP2A 3FBNB 1JGSA 3DP7A 3L2CA 2E1OA 1BBYA 3T1BA 1VTNC 1LOTB 4A3BJ 3SUQA 3SI6A 2D0PA 2ZXHA 4EP5A 4X6AJ 1FEXA 4IDHA 4FLTA 1IXCA 5DD8A 5LEKA 4CEQA 1ZRCA 4HLXA 3K70D 2A40A 3PX0A 2HHWA 2GOXB 4A3DJ 1XUPO 1MMNA 2ESNA 2DOFA 3ZSYA 3LDNA 4YNQA 2ID3A 3ABUA 4A6DA 1VRUA 4QS9A 2QLZA 2LY1A 2QVOA 3B6OA 2ZO4A 2P9NB 2NOJB 1XMAA 2V9PA 3EQLF 3BPXA 2E6LA 4X64K 1ZQ3P 2EIMH 2OZSA 3M8JA 5FPEA 2I7PA 4IFVA 3IFRA 3OYMA 1HYZA 1W7PB 2E1MB 3KWIA 3VQ4A 3DQVC 5TISC 1ZAOA 5KCMA 1SV5A 2DMUA 2N8GA 1IV0A 4DQQA 4FOEA 4NO7A 3RWUA 3L00A 3EE8A 3MN7A 5GADP 1YX5A 3JRCA 3BY6A 1T98A 2R7FA 3ZMVA 3QODA 3H6EA 4O0JA 3BC8A 2JVHA 2KIQA 4HQEA 4UNOA 1HQEA 1QQOA 2V7YA 5DM6L 4B9SA 3HTVA 4G94A 3V1QA 4ZYDA 1WJAA 4HZFA 1LAWA 2JPBA 2JTVA 1JKHA 4B8AB 4FJHA 1FSHA 3KK2A 4B9NA 3T19A 4GV9A 2A1RA 1MBFA 1X4OA 3GWZA 2E8AA 1JLEA 2FE3A 4A12A 2YPRA 1LW0A 2XY7A 2Y69H 3BR6A 1YJWN 4FJMA 2ZE2A 4ILHA 4JKGA 1NGCA 4LY7A 3BG9A 3BR2A 4DB3A 1QHTA 4IO9L 4OIOF 2PYJA 3K4NA 4CJQA 1WPKA 2XRIA 4E3SA 4GXOA 1IRFA 3WGGA 5FLXZ 3IL2A 3TANA 3VGLA 4I7FA 3KP3A 4P9FA 5LHIA 3SFIA 2W7NA 1LEBA 3M5RA 2XAGA 3VF2A 4DR2K 1VZ0A 1VHXA 4AHTA 1O57A 2M4GA 2HQ5A 3BR5A 1D4XA 4XEIA 1I27A 3OYJA 5ED4A 1WSUA 2PI0A 3WEEA 4DKWA 2ZKZA 2ICWG 3PSFA 3DLRA 3U4LA 4AM3A 3PO4A 4W5NA 3OOPA 3P38A 3OJSA 1Z67A 3CI5A 3CP2A 3TEDA 2CJJA 3Q9SA 3CMAI 3UKUA 3Q0VA 1UJ8A 1VQ8I 2FXUA 5TRDA 2EILH 4FX0A 2WTEA 4IHYA 4FLVA 4I6MA 3ULEB 4ENNA 3ZT0A 1Q9XA 1B9DA 2OCEA 3S41A 1E3MA 2L9RA 2O7OA 3V9SA 2NNYA 5FPDA 1U6GA 1UZCA 4HQMA 2VE8A 4LITA 1TGOA 2HOEA 3WU1B 4FE4A 1IZ1A 5CPRB 4YFNF 2RF2A 4DQRA 2V4JC 1T38A 4BC4A 1KCFA 5JLHA 3GLXA 3KD1E 1ZBFA 3ZT3A 4HUEA 3AG1H 1M90O 5EZGA 5AIPA 2XB0X 5JS2A 3A2FA 3AVBA 2EV6A 2IS4A 1SUQA 3RRHA 1X2NA 3EKUA 3ULQB 4HF2A 4ZYGA 3G6EI 3IAM2 2JLEA 5C2DA 1DEJA 1R9TJ 5BR9A 3MEDA 1HKCA 3HRGA 5EX5A 5LMNK 2LY9A 3K5NA 3RRGA 2O0YA 3LWLA 2ZJ2A 5L3BA 3EEQA 1LCUA 1BC7C 4KMFA 5HRSA 2K27A 1HR0K 1ZG3A 1PP7U 2DTUA 1BC8C 3JXUA 1L3VA 5CZ1A 4HUFA 2GXGA 3O1WA 2H8RA 4F2RA 3CCVI 1QNTA 2K02A 3O80A 3PY8A 4O5FA 3N05A 3B73A 1U2WA 1Z0XA 4B1YB 3H1QA 4L8RB 3H3VK 3DLEA 1SD7A 1XDUA 2UV1A 4BJ6C 4PJLA 2R7DA 4G7ZF 4CZFA 2GXAA 4Q0BA 4CJFA 1Y0UA 3GYHX 1HKSA 4WF2A 3OYHA 1UA0A 1V4TA 5M5WJ 1YJNI 1VQ9N 3HK2A 2VJJA 3R6SA 4QAGA 1U47A 2KQ2A 3VYTB 4M3RA 5HLFA 4Y33A 2X6XA 4DQSA 2WBMA 2XPWA 2K40A 4ASNA 2FNAA 2XB5A 3V7CA 3UB5A 2R5ZA 3H5RA 4MO7A 1XMKA 1ZELA 4AYBA 3TAMA 4B09A 1IBKK 3TAPA 1GLEG 1PJRA 4S05A 2V52B 1MKMA 3J7AP 4MTDA 2CH6A 2M7AA 3KHYA 2XY5A 2BVLA 3CUQA 3M6GA 2CW8A 4L9NA 1T6DA 4IQJA 3KD5E 2HVHA 4M72A 1WFXA 1LWFA 2P9IA 3DRSA 4O5VA 2O03A 2R7ZJ 1Q81O 3RZOJ 1X1DA 4A2UA 2ZJRL 3CJ7A 2W48A 3T7ZA 4A3FJ 5ICCA 1JKQC 3CQXA 3HC7A 2WB1A 4CZKA 4AVZA 2XHBA 1WN7A 4G1QA 1TTYA 3PNTA 3KZBA 4BRGA 2AQEA 2YKNA 5HBMA 4JP0A 3E1YA 2XROA 4YIRX 2NRTA 2HPIA 3LAKA 4M7YA 2A3SA 1YIOA 2EPFA 2G0EA 2OQRA 4BRIA 4MDBA 4DFJA 4NC8A 1D5VA 2IDOA 3MX2A 1EJ9A 3O9QA 1S72N 4JKAA 4PJNA 3ASMA 1HW5A 3U2RA 4EFHA 1TWHJ 3MXJA 2D45A 1BJZA 4JKGB 2KHOA 3NH1A 3ZQHA 4WQ4C 3VTIA 1RDCA 2EZIA 5GP9A 4KISA 1DGKN 3JSMA 1DDNA 3AVMA 1FMWA 1J5OA 3AARA 1Y56A 3U9ZA 3VQPA 3K9JA 1RESA 2QWQA 3CERA 5I42A 1SFEA 1S7AA 4DR6K 2GWKA 3K4JA 3F9KA 2HDWA 1MMGA 3EYIA 4U87A 5CVRA 3LSTA 4LG3A 3IAYA 3TO7A 1OCOH 1XDSA 2P7CB 2DDBA 1LNWA 5JICA 4HNVA 5C12A 1KU2A 2D0BA 5CYQA 1NGAA 4FVUA 1U8BA 2VKDA 3TO9A 3AA5X 1R0AA 3ZRGA 3RIRA 1P4WA 3PFYA 4ZTFA 2E1MC 1X9WA 4EAHD 2JA5J 2EFWA 3S1QJ 1ZBIA 3K4LA 1RIOH 1VSDA 4MQ3A 3VQ9A 4CGHA 3AG4H 1S1WA 5BREA 1WJEA 4MFDA 4DHYA 1ILYA 3SDBA 4GNIA 2A3ZA 1HNWK 2PFBA 3BROA 2Y31A 4CZCA 2ASPA 5EOYA 2O8DB 3CFOA 1BW5A 1U5TA 1ON2A 2LP0A 3FXJA 4J2EA 1GLFO 2O4IA 3P1GA 1ETKA 1W5TA 4DV0K 2WOMA 3CC2N 3AO4A 4I9LA 2YS9A 2DW4A 3GVAA 4BQQA 3G71I 5IY5H 4GCVA 4BQAA 1FTTA 1RTJA 4J19A 1VQKI 2WY8Q 1ASWA 2HNYA 3T1AA 1NJIO 3H1VX 4OINF 4YEJA 4DV4K 1GDTA 2M7BA 4I6ZA 4CD1A 2E5NA 2MH9A 2NRAC 1XNQK 3VF6A 1E3PA 1L5UA 1YW7A 2OA4A 1YVNA 4EM1A 5IOZA 3LZIA 3P9IA 4DV5K 4HBLA 4FYDA 4DS5A 5LBQA 1VSMA 2VG7A 4ID5A 1EETA 2MC3A 2OJED 2F96A 4A2BA 1W36D 2DFFA 1OCCH 1X3WB 2XF7A 4PJJA 1OCRH 4MQVA 5H6RA 3HOYJ 5IYDJ 1MWMA 4JKBA 3WXKA 2X9DA 2Y48A 3IWZA 1LAVA 4N47A 5FKKA 2LTPA 1TYQA 3VB2A 5AQWA 2NVYJ 2KP6A 5IYCJ 5LFAA 3ZX3A 2W6LA 2HWVA 3MMYB 1S29A 3RPUA 1Z25A 4AHRA 4CHQA 5MLCQ 1JL2A 5JVGF 2HHXA 4XRSG 4KH6A 2DLLA 1C0TA 2O8CA 3GL1A 1YYVA 5A2QK 4XH5A 1ODDA 2GLOA 3K1PA 4IQ4A 1KAZA 5E3MA 3ZX0A 2KW4A 3WXLA 1FSEA 2IPQX 4CCKA 2YU3A 2P9IB 4M42A 2Q0OA 1IAWA 1EX4A 3O5BA 1GV2A 3E0JB 5FKLA 1S6LA 3CUQB 1O1WA 4ISEA 3RSEA 3MFKA 4EHTA 2HR3A 3TSUA 4UY8I 1ATRA 3CM5A 1N34K 4WQ5A 2CW7A 4KYWA 3VF4A 2L54A 1UAXA 4IZZA 5ELZA 1YJNN 4CBXA 3CCQI 4DTJA 4DSLA 3HTUA 4EM2A 1U48A 5E26A 2P8TA 1LDJA 1X9JA 1NK4A 4BREA 5BPMA 3WE2A 2HS5A 2M0CA 4XIDA 3WGIA 1GLNA 1PDNC 3HOUJ 1WSJA 4W5RA 3QEVA 4DTUA 2CFXA 3GTMJ 3FIWA 3HEFA 5HLIA 5ICGA 1SZ2A 3W2VA 3P9CA 4DGWB 1EQYA 3C18A 4KO0A 4M7XA 2H8WA 3IG1A 5ILUA 1RR7A 2QBYA 3VSKA 2F5CA 2XGEA 4H4MA 1WNSA 4B1ZA 4FLXA 4DF4A 1NK2P 4AC0A 2BVMA 2E7WA 4C8NA 2MSYA 1FBQA 1XC5A 1RILA 4P1WA 4KI6A 3IUOA 5BMZA 2RNJA 4NLBA 3LSIA 4HCBA 4HEA2 2QBYB 4HF0A 3MEEA 2DK5A 3C6UA 1HW1A 2FJ1A 5DTDA 1D8JA 4CF9A 3LSRA 3I55I 1JKPC 3VQCA 2Z1DA 1TL1A 4ZC3A 5GAGP 2G8UA 2F4VK 1UB9A 2I5JA 2Z1IA 4BWMA 1U78A 5F0CA 1DU6A 5M1FA 4RA2A 1XWLA 1YTAA 2DA1A 1KFSA 2WB1N 4CJTA 3O8GA 1HJOA 1KGSA 3TR8A 4PUSA 1BW6A 1I3QJ 1F1ZA 4JI1K 2XF6A 5FKMA 4BY1J 1SVOA 5JLXA 4C1NK 3TARA 4E7IA 3HP9A 2XIGA 4RCHA 2E34A 1JLBA 4D7MA 3OWTA 3HHGA 5EEGA 2BE2A 4IPAA 2P51A 3HKZN 4CZZA 3R1XA 3CMAN 4FWRA 2IBDA 4GGGA 1RUNA 4KIBA 2MGQA 2XHKA 3JW4A 5B5EC 5H6QA 1N77A 3AA2A 4CE9A 2K9MA 3R0AA 1SKSA 1KA8A 2Y0SN 3HIFA 4IXAA 2LF8A 4CZEA 2G8HA 5CVVA 4Z4FA 3QYEA 4H0VB 1H1VA 2A68F 1Z6RA 1LFPA 3L2VA 1FC3A 3L2QA 1LQ1A 2O8CB 3D2FB 2VQGA 4M74A 2WONA 3PIPL 4NYNA 3OYDA 3TTFA 4BY9C 4CEOA 1NOZA 4YELA 1A36A 1SFKA 3QIOA 2E6MA 4UQGA 3M3YJ 1C1CA 1BA1A 2ASOA 3H9QA 3HPHA 2EA2A 1REPC 2UXDK 3J80O 2R92J 2AP1A 2WFBA 3VTHA 3VERA 3VQDA 3BEXA 2FX0A 3A03A 2X74A 4RB0A 1S6QA 4WE1A 3T8RA 3SQ1A 1FIPA 1ETYA 5DDGA 3H1CA 4JK9A 3M1CA 4XK4A 4RB3C 1HKBA 1DLOA 5JHUA 2DT7B 1PYVA 3E5QA 4DOZA 3J7AO 3LDOA 1OCPA 1UG2A 1K4TA 1MNMC 3LZJA 1EP4A 2MG4A 3A5OC 4JX5A 3K70C 4U0VA 3BZKA 3H3UA 4Y15A 2O8XA 1S3XA 2FC0A 1FJGK 2JPCA 3KE2A 1E2XA 4BE1A 1JXSA 2IGOA 1WBDA 4RGXA 1HCRA 2YNGA 2Y0SA 5LEJA 2ECBA 4TSXA 4DR5K 1K73O 5IT9K 3GDQA 4JQFA 5CJ9A 4CCOA 2VQHA 3NGYA 3V7SA 3SYTA 3ZCMA 4KHQA 1U2VB 5C15A 3SV3A 4KV8A 4ESFA 4PY5A 1W7AA 4LB5A 3QINA 1SFOJ 4MO4A 4B1RA 5DM6F 3RZDJ 3E66A 3QP6A 3ZMSA 5BPIA 1FX7A 2M34A 3ELKA 3O2PE 3U1DA 1GOAA 2IVOA 4H03B 3ZSOA 4AHUA 2OCCH 4M6YA 3KP6A 3SJMA 3CCMN 3WTXC 4DV2K 3SPZA 2O8BB 2KKZA 1LVAA 4OAYA 2M8GX 4CJVA 2XRNA 3RTRA 4FJJA 1IN6A 4XMYA 2HSTA 1V4RA 4AWXB 4KTWA 2MFZA 1Z9CA 4DTMA 3BG3A 3SAFA 3SMSA 1AU7A 5FB2A 5F2RA 4WK8F 2MW8A 4BR5A 3KEQA 2QQAA 3HRTA 5DUKA 3OBWA 5BR8K 4DU1A 4K8ZA 1OKJA 4XBFA 1OH7A 5HDGA 3DKYA 1RBUA 4O8KA 2F5EA 4OIRF 3NH0A 2H6BA 3RI4A 3I8DA 1UHSA 3V9UA 2EFPA 5IP7J 4EJTA 2QM1A 3QFUA 5DMRA 4DMNA 1T8EA 1SL2A 5B3SH 1USSA 3T8TA 2A6TA 4CO8A 4CHYA 4MLEA 1VQNI 3BT9A 3TSPA 1RUOA 4O6JA 1BR2A 4PKIA 4IJNA 5IYBJ 2Z33A 1DU0A 3LAJA 3CYMA 3NH2A 4DUYK 5JVHL 2FBYA 2OTLI 3X2QH 3GXOA 1VSKA 3QYFA 5HP1A 3HJFA 4S04A 2GTDA 1BI1A 2F4OB 2FQ4A 4UXNA 3ZSWA 2Q1NA 3PO2J 2BBYA 3DWLE 4F52A 1NK9A 3OV8A 5DS9A 2K7LA 3K7AJ 4PKHA 1SS6A 4LK1F 3AL0B 1K8KB 1GLDG 3QRFF 2OPRA 4CYCA 5J4VA 3ERED 3G4SI 1BL0A 4CZJA 1QVUA 2L9NA 3I59A 1IV8A 2W24A 2HF4A 3DFGA 3FZLA 1WAFA 4E7LA 3FLCO 2OYQA 3H9JA 4FE7A 4M3GA 5FKOA 4P96A 3ESWB 2RN7A 3AA4A 3F73A 1TKDA 3OS1A 3L4QA 1M1KO 3VQQA 4IJAA 1RT4A 2WC9A 1U5TC 4U88A 5ILVA 1TAUA 1NKCA 3ALYA 2VPLA 3CMEN 2VKEA 3FM5A 4CCMA 2YHWA 3LL3A 1V3FA 2HB5A 4BRPA 4CBWA 4IOCL 1RNLA 4A62A 1JLCA 1I39A 4A3MJ 1ACIA 1HC8A 4B8CA 4BRHA 4XM3A 4KITB 2VL8A 1DGRM 3VGKA 5J2NA 3I3LA 3M07A 2ZJRF 4DU3A 3THYA 1NKBA 2D1KA 2Z16A 4CBUA 4XSZF 1MBJA 1KD1O 1NG9A 1U4BA 4BWJA 2I8DA 4N9HA 4BQZA 4YFXF 3FZVA 1BI4B 4LFAK 1P90A 2BE5F 4FXDA 3DM2A 1USTA 5KI6A 4E7ZA 5K5OA 3ZP5A 3R4KA 2ZMEB 4A5BA 1TUYA 5M1NA 3C65A 3CLQA 2Q97A 4OKEA 3HM8A 4Z4CA 5FRMA 2PJRB 1BU6O 2GQQA 5F0XA 1QQNA 2ELJA 4C3HJ 1VRTA 1SD4A 1NM1A 4CJSA 2G8WA 2L4MA 2W1OA 1T95A 2DTZA 1GV5A 2H6CA 3QU6A 1RTIA 4BNCA 5GAGJ 2DYSH 4HWIA 1Q7YO 3ASOH 3LP0A 3FXQA 5KQDA 5GIPA 2Y1IA 1T56A 2QA4N 2KZGA 2BDPA 4FX4A 3D45A 2QWWA 3CC2I 5M3FJ 3RPUD 3TOAA 2BY2A 1W0TA 3HJEA 2ZB9A 2OQGA 4Y17A 4JKHA 3SBGA 2RQPA 1EWRA 3T69A 3VESA 1P92A 3CCUI 2OZMA 3BCAA 2YJFA 3HSFA 2XPUA 4A3KJ 3K2PA 3NF6A 2ZXIA 3FDYA 5IP6A 2JUGA 3HDDA 2EH3A 3J80K 4FW2A 4CGGA 4YOXA 3ULDA 4I76A 5BRFA 5AQRA 3UKGA 3P83D 3HRUA 4HSRA 4WQ5C 2HEOA 5DM7F 2B9SA 5KGXA 1O3TA 1FK9A 3I9V2 3SAGA 1E3HA 2YX7A 4M9XA 2NRRA 2EIKH 3JSOA 2YJEA 3T1HK 3BLYA 2IEKA 3CJNA 2PEXA 3VMFB 1IBMK 1HUXA 1MBHA 3FK7A 3ZXSA 2XSJC 3BTCA 3EUHC 2HBJA 3U9DA 2M45A 4FLZA 2F8SA 3ID6A 1X1BA 4HNTA 4FJKA 4FPBA 5KTQA 4ENKA 3RTVA 5E3LA 2AXTC 2DAOA 3FHNA 5FROA 2B5JA 3MN6A 1T7PA 4XH4A 3Q0UA 5J1RA 3HXMA 3K6GA 3KVGA 4EVIA 5IT9O 2RV8A 2V1UA 4F93B 4BRQA 4W5QA 1B8IA 1OVYA 2JQ7A 2X6OA 2A05A 3MN5A 3M8SA 2LOOA 1BO5O 2DT6A 3JRHA 2GAUA 3PO5A 2XC7A 4IRHA 3EPZA 5D5WB 2IAJA 1KRPA 1ITGA 1GOCA 3B02A 5GPCA 4RW6A 1FP1D 1G15A 2KZZA 4DQPA 3L2UA 3BPVA 2XVCA 3FXMA 5AJ3K 3RKXA 3EL2A 5J3LA 4DR7K 5LD2C 3TPQA 4B9QA 3CG7A 4FWSA 3KYLA 4LLLA 1P2FA 1RKWA 1S1XA 3CETA 2Q2EA 2WAFA 3AO5A 3E6BA 4E4HA 3O8MA 2HZDA 1ETQA 1T0FA 5F64A 5EYRA 3ZQQA 5E18F 3DI6A 3RMDA 1YTUA 2D1VA 2CFOA 2IA1A 1P9QC 5C10A 2G8IA 2V7ZA 1R5GA 1YOVB 4I7HA 1IKVA 5AQQA 1N8RO 2BV6A 4NUBA 2HVQA 2FF6A 2GA1A 4B1VA 2YSRA 4CSWA 4Z94A 3JTHA 4YORA 4ZHRA 1WZ2A 1NJZA 1R1TA 1R6RA 2PJPA 3EY1A 4CI6A 3MX5A 4B3RK 5D8KB 3N97A 2BW3B 5M5XJ 3K0LA 2KJCA 5E1WA 3QNNA 4QWQA 5AQZA 1IRXA 4MTEA 2CGJA 4MEXF 2F4IA 4BXUA 3MEGA 1BCMA 4CK3A 1EWQA 3OYIA 4PHTX 4YDUC 2ELHA 2OPTA 3L09A 3S3NA 5M1PA 2IW5A 3SUPA 2DA7A 2JN6A 1YFHA 2VYPA 3Q9VA 4IG0A 2DQLA 1WB9A 1BOAA 2DA3A 1ZLJA 4CJUA 1Y1VJ 3I56I 1XQSC 2WTUA 2GX9A 1OQYA 2CQQA 2BTFA 3HYIA 4EATA 1C1BA 2JSPA 2WAEA 3LAMA 4F3OA 1VQ6N 4WXDA 4FPAA 2F5FA 2XSDC 1VQMI 3J81Z 1YAGA 2DA6A 3AVCA 4R8HA 3AVLA 1WLJA 4OPJA 3VA3A 4FK2A 2MD0A 3HPOA 5TKWA 3K1MA 1QE1A 4EGYA 3I4PA 2R7UA 2G7HA 3RJPA 4CCLA 4FWLA 3GLLA 1CF7A 5LJWA 2QGUA 1BI4A 2VKHA 2NNWA 4DTRA 4ZZDA 4BQLA 4N76A 4ANJA 3NEUA 5IT9Z 3MDQA 1KU3A 4KI4A 1MNEA 1P6RA 2L9SA 3SDGA 4BHBA 1WH5A 3N4MA 2JA8J 1VSEA 1X2MA 2QWPA 3FR0A 3A0HC 4KA4A 1MDMA 3A5MC 1OFCX 4HTUA 2LFBA 4RS8A 2HTSA 3NVMA 1L3TA 5E20A 3RYPA 3QLHA 2E2NA 5LLQA 3S15J 3SZ2A 3H46O 1X1AA 4I0BA 3S16J 2CGLA 5J1UA 3BJ6A 5LGNA 3VFZA 4RBOA 4KAZA 4EMSA 3TQNA 1J6ZA 3VQ8A 4CJKA 4JX6A 3H35A 4KT6A 2VQCA 5C4JJ 4LG0A 3HL8A 1B9NA 3CJRB 2A5WA 1AOYA 4M3YA 4LD0A 2E7XA 3RKQA 2P9KB 1HRHA 3DLKA 3D5LA 3ZSRA 1I3AA 1RNHA 4F7ZA 2Z1JA 3AO1A 5AQPA 3F3XA 2PAVA 1U49A 2Z2SB 4YFUA 5ICEA 1W5SA 1B72A 5CVIA 4GV6A 4EGZA 1QHAA 1Y97A 4JOMA 4JKFA 4KKOA 1RETA 2I5UA 1OCZH 1JJ8C 1TKZA 1BIAA 1W0HA 2A5XA 1X3MA 3C0BA 2NOGA 1PVEA 3MD2A 3FHZA 3DXJF 2DPUA 3S1NJ 4M45A 2HDCA 1ATSA 4IEEA 5HNFA 3G3ZA 2RREA 2R7QA 4BQOA 2HZTA 1O4XA 3ENHA 3FE1A 1MSFC 3WE3A 3NE6A 2A41A 4QCLA 1XGNA 1XX5A 1JGGA 3MK6A 5C0YA 3CO7C 3V6DA 3F8MA 1BG3A 3N4QA 1OKRA 3ZQFA 4NC6A 1KVBA 1C0UA 2ID6A 5KPRA 1DT9A 3PUBA 4U67L 1NK6A 3SQ4A 2DA4A 3O6WA 4BU2A 4QS8A 5HLHA 4B4CA 1JKRC 2O3FA 2VN2A 3E5XA 4CDGA 1NG6A 3SXYA 4WX9A 1GXPA 1YUWA 2YHYA 4DQ8A 3PJRA 3DJCA 3SQNA 2LBFB 3OYGA 2H27A 5CHIA 2DY4A 4C23A 3AO3A 5E3OA 4AM6A 3V8KA 4L5JA 3NDKA 2PBIA 3I0TA 5D6EA 2QWRA 2E5LK 3VQAA 5KPZA 1IXSB 2OU2A 2W85A 4DWIA 4CA0A 3QPHA 1L3UA 4BDYA 4CEBA 4JBAA 4BEHB 4F2SA 1S5JA 3KYDB 4HYEA 2ZGYA 2BGCA 2VB6A 3R61A 3K2AA 1JI8A 2RE2A 4BR2A 5C42A 1UA1A 4FWOA 4QOZB 2RC4A 1Q1HA 3WG9A 5GAEJ 2OTJN 3SV4A 2ZNYA 1O3SA 4RAGA 1B9FA 5AQUA 2QA4I 4DG1A 3WNEA 1WI3A 2QUFA 4G7OF 3U6FA 3TTDA 3BZCA 3ATUA 4W97A 4QIWN 1XGMA 2HTJA 4JYKA 1TQMA 3SZTA 3TAQA 3WODF 5D5XB 2D1HA 4KT5C 1OR7C 3TP0A 4V19K 3I0SA 3LWMA 2O8FA 2ATQA 3QMLA 4AU7A 2KJBA 4UB6C 4UUTA 3A2KA 5E84A 3CCJN 4PCQA 3TAEA 4Z4EA 4GY2B 5AIQA 1T6SA 3DU6A 4RLQA 1HYVA 4H5NA 3DOKA 2V51B 3EO3A 2STTA 2DFEA 3CIPA 4LF8K 2XAUA 3OYAA 1YJWI 1UAAA 4LH4A 5AQTA 3HZ6A 4C30A 3FFIA 4W5TA 3V9WA 4X1EA 4JS4A 2F4MB 5CYVA 5E8GA 4K42A 4NYFA 1YITN 1CZBA 2HHHK 3D0SA 4XNFA 3AVFA 3DOLA 3L2RA 2X1EA 3O4WA 4FZXC 4G9ZA 3CPEA 5E17F 4LOCA 3VWBA 5L3EA 2E35A 1M1EB 2ZJQF 3KLGA 4CESA 2GWJA 2HMIA 3S93A 1J0RA 4OMYA 3VEZA 4BR7A 4AQYK 2OUMA 3SJHA 3U3YA 2V6EA 1B8IB 3G10A 5B66C 4YY3K 2E88A 2NRVA 3S3MA 1H0MA 2D0AA 2E2PA 2YX6A 1FMVA 4XLHA 4A6EA 4AILC 4HDVA 1QZ5A 3LDSA 4H0OA 1BOTO 2ISYA 5HLGA 4Y7NJ 1O3QA 2Q8KA 4K2EA 3PX4A 1J09A 1S72I 4BBRJ 5IPAA 2Z1HA 4JKDA 3QERA 2HHTA 2VXZA 4E6KG 1C1AA 3COAC 3MZHA 2ZJQL 4I02A 2DPDA 4RW8A 5M1OA 3JAMK 3CFPA 1ORKA 4KHSA 1IUYA 2BOLA 2M3AA 2OBPA 3C7JA 1DPRA 1F4KA 3QQAA 1HQUA 1B4AA 2Z3YA 3GTGJ 2R0QC 3F6VA 1GT0C 2VONA 2IC3A 3E9PA 5HL7L 2KFZA 1NK8A 4FSVA 4BHCA 2VBZA 1Y0NA 3CZ6A 2VC1A 3LA3A 4Y1CA 2E71A 3F5TA 3L6QA 2O61A 3CPWM 2UUCK 4PGGA 4OGEA 1IJJA 4UVBA 3KWGA 1S9HA 1JLFA 1A6QA 1S6PA 3G0ZA 2E2QA 1IRGA 3E6CC 4UV9A 3C7NA 4XKVA 1TT5B 1IGNA 4ICLA 3F22A 4B1UB 1Z3XA 4FJIA 1BGXT 4H5VA 4NXNK 1YG2A 2H09A 2L7KA 1MDUB 4BEHA 3A8YA 1X4PA 3H5AA 1MBEA 3VQ7A 1RTDA 3HSEA 1RGIA 4CJ3A 1K9MO 4JK1X 2LH9A 1T8IA 1OYYA 4BROA 4LF9K 3OIPA 3D6RA 2HOAA 2PFUA 2EWSA 4C3JJ 4Y0WA 5JLWA 4LC9B 3IHUA 1HLUA 2K9NA 5CQEA 3VDXA 2YHAA 3LALA 3O4QA 3LSPA 1H8AC 2QF7A 2NVXJ 3K9KA 4WQ4A 3JAMZ 3VA0A 4CGIA 3QEPA 1Q1VA 2VKVA 4C8MA 3GO5A 4HF1A 2P5OA 1KZHA 4DYRA 4CHUA 1YITI 1TBXA 2NAZA 4UVCA 2KLAA 2E20A 3TU5A 2QKLB 1MA9B 4NB4A 3S9HA 1BJAA 1ZHFA 2KIUA 5LHGA 4E7KA 2EFOA 1G3WA 1R4MB 5F27A 2FBTA 3IDHA 3AL0C 5D8LB 3J7YJ 1R71A 2F9WA 4A5AA 4BRKA 3BG7A 4UY8O 4KB0A 4L5EA 3L9FA 1I50J 1Z05A 4P55A 5CKTA 2P9UA 4DV7K 4AIKA 2KZVA 2E2HJ 1UHWA 3RQ4A 2EWNA 3IMXA 3EZWA 3P4IA 1NGBA 3Q0WA 1YJ9N 4H4OA 3ZSXA 1XMQK 5KPTA 4ON0A 1FTZA 2KPMA 5AQLA 1SVMA 3LSJA 4CGJA 1B72B 1RFQA 2Y9ZA 3KIOA 3CCSN 1KFDA 2DMTA 4GYGA 3KK7A 2Y9YA 1D0YA 3IH2A 4FJNA 2KDZA 3HO1A 1L3SA 3S2DJ 2LSOA 4L9JA 2QQBA 2L01A 3UIQA 4XOPA 1JCEA 5E41A 2CQ7A 4HG2A 4BAYA 4Z4IA 3LA2A 1FYLA 1TWFJ 5KAFC 3FBIB 3IV5A 4H0YB 1KLMA 1TYQB 1JTYA 2BYVE 1JJ6C 5F6FA 4BR4A 3RQIA 2YX4A 4LSNA 1ZN2A 3IRRA 3THWB 3RDIA 2BUPA 2C6YA 5FFXA 3PM1A 2ACJA 5AQIA 5ILSA 4HNUA 3IH4A 3GZ6A 3BJOA 1FOKA 2JRTA 2PMZA 2F48A 4A3CJ 4XQFA 1ZREA 3EZ5A 4CZGA 2K9QA 3KLOA 3VQ5A 1IDYA 1OMIA 3M3ZA 2FBHA 4LH5A 3ZYYX 1NOYA 4M3FA 4A0YA 3WXJA 3ZR8X 1J59A 1Q82O 2FBKA 4E7HA 3IKMA 4FM1A 1CF7B 2F7TA 2A42A 2D5VA 1V4SA 3DBHB 3Q5FA 3H36A 1C6VA 1Z21A 4LD5A 3TBIA 2R93J 3CQYA 3SK3A 1BI3A 3E6MA 4C2MJ 1GLAG 4KN7X 3ZQIA 4XICA 4DSEA 4IX7A 3TO6A 4KHPK 3THXA 3GG4A 3ZT4A 1NLVA 2MC4A 1G59A 4IEIA 1ETOA 2M5WA 2XGXA 2NXNB 4HA8A 4IRGA 2XGDA 4XH1A 1RT2A 3A0IX 2F5DA 1ATNA 5FPMA 5LRRA 3U8XA 3E6DA 1BCOA 2IA2A 1DKGD 4R79A 4JHDA 5GAEP 4AUXA 2CV1A 2ZC2A 3E1SA 4RMNA 3ZPLA 1TP4A 1A5JA 1JXBA 3GBTA 4EIAA 1TNSA 4XLCA 5GAHJ 3O9TA 2M4KA 5CZ2A 3RMCA 1QTMA 3R6MA 1WUAA 4AVPA 1WKMA 2FXAA 2IS2A 1ASVA 1HSTA 2XY8A 1Y8QB 2F2EA 4TV7A 1WVRA 1S9GA 2ZF5O 3O3GA 3L2WA 3DXKB 1SD6A 1Y1WJ 1WSEA 3QBXA 2UUAK 1YJ9I 4M3ZA 3K5LA 2VPRA 3QICA 3KPHA 1JUSA 3HBTA 4Z4HA 3KLHA 5J1YA 1F9NA 4HX4A 2WADA 1I1GA 2EFNA 4G6DA 3DWLA 2P6SA 5DCMA 3M8RA 3NVKA 3MKYB 1TKXA 3GX4X 1QZ6A 3K5MA 4RAZA 3M4OJ 2VQFK 3V4IA 2X51A 4DFKA 1YI2N 2P9SB 2WAQA 4S0HB 4I0AA 1G99A 4GVEA 4U0YA 3CFRA 3CLOA 1W2BM 3SLCA 1EH8A 2X48A 3HOZJ 2V6CA 3FM3A 3W3DA 3G73A 4A57A 1RKTA 1RBRA 3OYNA 3JAMO 3NMUA 1YE9A 5M3MJ 2R5YA 2P9LA 2JWKA 2CS3A 4ZYHA 3GFJA 1TWCJ 3F8FA 5JVTA 2VWKA 4OPAA 1R49A 4BC2A 2GXBA 2CUJA 5I9EB 5T7BA 2FLOA 4D9JA 4EHUA 2FUG2 4DSFA 1MBGA 1HW2A 2FEZA 2OA8A 4DU4A 3J81O 3HYFA 2HOTA 3ABTA 1RI7A 3T5XA 1BA5A 3A01B 1ON1A 3DU5A 5M5YJ 4RG8A 4NLCA 4P9UA 5EGOB 2GV9A 2G8VA 2OC6A 4WF9L 1DPUA 2MD5A 3W3CA 3PV8A 4GV3A 1YLFA 4ZYEA 1MWKA 2J4RA 1V5EA 4Q47A 1U45A 1D8KA 4KUMA 1IF1A 4KN4X 4B9LA 3I54A 3EE9A 4CVNE 2HKXA 3C2HA 3AG2H 1K78A 1NBWA 1YXQA 3SPYA 4ISFA 2G8FA 2VE9A 1SANA 2L5QA 3O1BA 1J2XA 1IG9A 4M71A 1DTQA 1HX1A 4PFOA 3WXIA 2CO5A 1GOBA 2QENA 1JTXA 2L9VA 5LGTA 1TK5A 1VQLI 2AA4A 3ENBA 3NCIA 3RR7A 3PLAA 3DEEA 3B8AX 3LP2A 2CG4A 1ETVA 3ZCOA 1YTYA 3OVNA 1R5ID 4OKJA 4N0BA 3BWGA 4NNJA 4D7NA 3WQUA 3EUAA 3S17J 5F08A 2IIRA 1DTTA 1Q9YA 4L18B 2NLXA 1U3EM 4ISGA 1HSJA 3ZMUA 4D1QA 1TL8A 2IVPA 3AA3A 3HSCA 2ESHA 3R9PA 4DV6K 1ZBUA 3LSGA 2K9LA 4IKFA 3O9SA 1VQKN 4JI5K 2XGCA 2YKMA 3OL3A 1WJ5A 4CF2A 4JD2A 1NK5A 5KGWA 1DP7P 3CTAA 4UB8C 4AIDA 3AG3H 5AQSA 4BG8A 4BRLA 1CGPA 5TGTA 2KHMA 2GUPA 4Z6YA 4L9VA 3O3HA 3JRFA 4FK0A 2YR2A 3U9GA 4DF8A 5J8FA 4J2AA 3TW7A 2KRCA 3HVRA 1F36A 3ZETA 4K8XA 1ZTRA 2KKOA 3ERMA 5FLMJ 5AQMA 3WTSC 4ENJA 5BRHA 5AQKA 4FJLA 3MXMA 1LVKA 2HVSA 4B3AA 4CICA 1RRJA 1J7KA 1IKYA 2XASA 1QSYA 1SL1A 5LL6Z 4F3QA 1H9GA 4DIQA 4A93J 3KK3A 3ABKH 1FP2A 4DTNA 1W0UA 1XSDA 4FVMA 4F9OA 4WCGA 2MLGA 3FF5A 3CCEN 4CEFA 2LKSA 5A2QO 2O8EA 3MXIA 4CZLA 3AVIA 3V9XA 1EH7A 1FPQA 1K6YA 2GOMA 3K4CA 4CD3A 5JMVA 4BGBA 3THYB 2KFNA 3A0BC 3CUQC 1NMNA 2UZKA 5FLXK 1QQIA 1BWFO 5AZIA 1VQNN 4DSKA 2E1NA 1K79A 3DAWA 2A61A 3LANA 2A6AA 1TZLA 3CO6C 2EB7A 1F43A 1UWBA 4XKWA 3CJTB 3UKUB 2KT0A 3GTLJ 2HBKA 3BR0A 4AIHA 5JHFA 3ZQLA 1WSFA 1ERDA 3RYRA 1T6CA 2GBYA 2D5RA 1Z7LA 4CW7B 1QVFM 3V1OA 1KYZA 3BTJA 4HOBA 4XLFA 5JFRA 1FKPA 4BRDA 3KTQA 4L9TA 2EZKA 5DCFA 2QWOA 5BN9A 2LKXA 4C8OA 1S1VA 2EFQA 1T44A 2JRMA 3K4MA 2ZBKA 1E4FT 3WTYC 1SL0A 4CEEA 1WAJA 3PFIA 2M30A 4I2QA 3AVJA 4E0DA 4WXHA 1QRYA 4EJVA 4IEJA 4CEAA 2IS6A 3CD6I 4FW1A 3C2BA 3HOTA 1QZZA 3KZIC 4CJWA 1UFMA 2LSNA 3NRVA 4KHYA 2LC2A 2W57A 3OYBA 1G3YA 3HKZA 2E36A 3C6AA 1LEAA 3TL4X 5E3NA 1IG8A 1D1CA 1SAZA 3BP8A 5BPNA 2Y1JA 3B6AA 2KZMA 3CJQB 2HU9A 3LA7A 4A3EJ 4ELVA 1B1BA 2AO9A 1HXDA 3MN2A 4ILGB 1WI9A 4Y1DA 5F1RA 4B44A 1XHXA 2GELA 3VPZA 4AH9A 3BTLA 5EEAA 1IDZA 4O4GA 3EYZA 2IGNA 3FX3A 3I64A 1U5TB 3IUCA 2F5VA 2W42A 2O8DA 3IS9A 3TAGA 3A1YA 1O3RA 2QTDA 3VEVA 2IOCA 2NVQJ 4FTHA 4FWMA 3D5SC 3DBLB 3QYBA 1IKWA 2DYRH 2DOAA 4KREA 3TGNA 2WY7Q 2HPMA 3WXMB 2X6NA 4CJPA 1KLNA 4EP4A 3J81K 5HROA 2O8EB 5ICFA 4D5FA 1PUFA 1CXUA 2CWEA 3GFIA 3I8BA 3VYRB 3GTJJ 1NNEA 3H3OB 1JKOC 3L0QA 3VGMA 3DLLL 4HW0A 1HDDC 4YIIA 2Q3SA 3KYCB 4BBSJ 1BQNA 1G3TA 2KRHA 2OZUA 4QS7A 4YOWA 2LDUA 5D3GA 3ROUA 2KISA 2CGPA 4B9UA 1IC8A 4IHXA 3ZETB 1N33K 1IJWC 5CVUA 1JXEA 3LNQA 2RKHA 1BL3A 2LF7A 3LP1A 3K57A 5FJ8J 3VEXA 1ULYA 4GMJB 1IN5A 3PSIA 1HJRA 1JLGA 4HUGA 1RBVA 1G8XA 2CSOA 3HM5A 1BR1A 3AKZA 5KQ8A 3RKYA 5LY3A 5CYMA 4CGZA 4KIFA 1B92A 2DA2A 1GUUA 1KYWA 2CYYA 2JA7J 1UELB 2VGMA 1JHFA 1BUPA 5H1SQ 3E9OA 4CHNA 2KLOA 3OS2A 2DI3A 2F8TA 1HNZK 3ISNC 1XHZA 4GKKK 3W6VA 1R4NB 1R58A 2BY0A 2FBIA 3CCRN 3CCSI 2AS5F 1ZK8A 3MN9A 5L3DA 2P0WA 3FXOA 3OIOA 4RAFA 4BJTA 4JNEA 2V26A 3OTOK 2PG4A 4K43A 2D4WA 1VAZA 4FWPA 3FMRA 4I01A 1W36C 4PA1A 4BE0A 1W7PD 3F8CA 1XCVA 5HS9A 1R36A 1HNVA 4DTPA 2FF4A 4KDPA 2GIZA 4A5MA 3PIOF 2VJ4A 3CDIA 1XI1A 1MD0A 3H5NA 4KH5A 4U0WA 1ZARA 3PQKA 3A5NC 3I33A 1K78B 4OVLA 1UHMA 4CIEA 1YQAA 2IRFG 2R7VA 2GBZA 2YCHA 2COMA 3IC7A 2LMDA 4RB1A 2WBNA 4BR0A 1TK8A 2HHUA 2UXCK 3F8BA 2E1YA 2OF7A 4JI2K 1EV7A 3C6HA 2FSJA 3AO2A 1EO1A 3FXUA 2Z9OA 3QPLA 4RM3A 2EV5A 4YFKF 4LB6B 2R5ZB 1JHHA 3W6KB 3DLGA 2QK9A 3QPSA 3NAEA 4OX9K 4GFBA 2ZJPL 1WGXA 4PGHA 1MGTA 3A01A 1T2KA 4D5CA 4FASD 4CFAA 3CCQN 4RWTA 1EH6A 2JVGA 5ADXH 4FZYA 4YOVA 1HKQA 4DSJA 3KLFA 4M6XA 1LPQA 4C9YA 4X66K 2LRDA 3CC4N 3F8NA 1VQ5I 4N5SA 4CJ7A 4WCEL 2XKOA 5CR4A 1ZR2A 4KMUX 1A35A 4M9ZA 1ZXOA 5JS1A 1NTCA 4IHVA 4AD9A 4U7DA 4Q5VA 3ZEUA 4WYBA 4B43A 4BYYA 1YHQN 1RBTA 2VWJA 2P9SA 2FSWA 2NS8A 2HXIA 2H1KA 2QKMB 1L0OC 1P4AA 4BRCA 4J2DA 5HRPA 2B4JA 3T3FA 2K86A 4XLEA 1RDUA 2ASMA 4DV1K 1V54H 2BHZA 1SC7A 1KAYA 4KTZA 4B3MK 4OPHA 1SAXA 3K1NA 4A3GJ 3F72A 4G9YA 3WTWC 2UXBK 2PX9A 5F0FA 4PZJA 3HOXJ 4I98B 4RAYA 5FD6A 4ZTJA 4DS4A 4PQUA 2ETHA 1WRJA 4JK8A 5LJVA 3DPLC 4W5OA 3UNGC 5HDNA 1PUFB 2UUBK 1MBKA 4OO1J 2R7XA 2X6SA 3VEPA 3CJ9A 1S3JA 5FRNA 2IGMA 2W84A 3KLNA 4R1HA 1ZRFA 3J8AA 5ADXA 4DYQA 4UUSB 1E17A 4CECA 1VNDA 1NU0A 4HCCA 1MH3A 1WCMJ 4L0ZB 2NUBA 3V8LA 3WU2C 3OS0A 4MNUA 4JHDB 1DUXC 2EV0A 1HPMA 2QI2A 2VASA 2W00A 2GM4A 4I6MB 4KFBA 2NRXA 1FWZA 4IF4A 2FU4A 2L7ZA 1VFCA 3GTOJ 4F3TA 1HBXG 4BDZA 1TLHB 1Z3YA 3KP2A 3FZHA 5BNGA 5BRDA 1TV6A 1XB4A 3FZMA 2UXXA 3GTPJ 2V1NA 2VBWA 2QQ8A 1TT0A 3H3ZA 5D4RA 1ENHA 5EG0A 1OH8A 4CZIA 1D5AA 4BRAA 1T39A 1D0ZA 2PMUA 4OIQF 3LFUA 3LFKA 3R8EA 1H89C 3BDPA 1QVTA 3S14J 4ZDPA 3HGGA 4DZJA 2KL4A 5IT3A 2IA0A 4XOTA 4BG9A 1NJXA 4OAZA 1N25A 4A0XA 2CUEA 3UKRA 2V7FA 2EX3A 1B59A 5AQNA 2OZ6A 4A3JJ 4B3OA 1ZRDA
chains in the Genus database with same CATH topology
3K5OA 1ZBHA 3WNFA 4M3TA 4LSLA 5CQGA 2W4SA 3WNHA 3C95A 3KLEA 4OLAA 4C2TA 2A1SA 3O4NA 3CMMA 2OPSA 3K59A 3CM6A 2HW3A 4FJ8A 1S9EA 4CFDA 2VJ5A 3DLAA 3OYCA 2R7WA 2HNHA 1N75A 3IP4B 4RLFA 1QSLA 4BS9A 2OV7A 4CIFA 1J9AA 2IGKA 1DP3A 3DTKA 1VSFA 1RT6A 2ITGA