3HPHA

Closed tetramer of visna virus integrase (residues 1-219) in complex with ledgf ibd
Total Genus 64
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
64
sequence length
210
structure length
194
Chain Sequence
NIPLAEEEHNKWHQDAVSLHLEFGIPRTAAEDIVQQCDVCIDHWQVDYTHYEDKIILVWVETNSGLIYAERVKGETGQEFRVQTMKWYAMFAPKSLQSDNGPAFVAESTQLLMKYLGIEHTTGIPWNPQSQALVERTHQTLKNTLEKLIPMFNAFESALAGTLITLNIKRKGGLGTSPMDIFIFNKEQQRIQQQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural basis for functional tetramerization of lentiviral integrase
pubmed doi rcsb
source organism Maedi visna virus
molecule tags Transferase
molecule keywords Integrase
total genus 64
structure length 194
sequence length 210
chains with identical sequence B, C, D
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2009-06-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00665 rve Integrase core domain
A PF02022 Integrase_Zn Integrase Zinc binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.200 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Arc Repressor Mutant, subunit A 3hphA01
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 3hphA02
3D0PA 2KTQA 3ZT2A 4LH4A 2GBZA 4OLAA 1MU2A 1IKXA 3SUOA 3P83D 4DU3A 1U49A 1SKSA 4K8ZA 3V9ZA 3O4NA 4HUGA 3OVNA 3S9HA 1QTMA 1NKBA 2VG5A 3K57A 4DSIA 3MECA 3RMCA 4DFJA 4ZTFA 3C94A 5HRNA 4NCAA 4JRQA 3WNHA 3ZT0A 3KD1E 3TR8A 5EU7A 4J2DA 4E1NA 1WSIA 4B08A 4CERA 5HLFA 1CZ9A 3QIOA 4DFMA 3SYZA 4PQUA 4JLHA 2EHGA 5E41A 3VQAA 1JLBA 2LSNA 3RR8A 3RWUA 4DG1A 4FM2A 1KONA 1DLOA 3NDKA 1NK9A 1D9FA 4DSJA 2P1JA 4CF9A 3U3GA 1FXXA 1KVBA 1ZBFA 4CJ3A 1WJCA 3QEPA 3CYMA 3HP9A 4FJJA 1RNHA 2YKMA 4CJVA 1S5JA 1WAFA 3SCXA 1BL3A 4CEEA 4N5SA 1VSDA 1TAUA 2VG6A 1RILA 4G1QA 3G0ZA 3LP2A 3L2QA 3AVAA 4HVJA 3DLHA 4DTRA 1S1TA 3IRXA 3AVBA 3NE6A 2W42A 2FBXA 4O44A 5KI6A 3NFAA 4B9TA 4OPKA 1JKHA 1MW7A 3SNNA 4B9UA 3CM6A 4IFVA 4CK1A 2IOCA 5D3GA 4Z4FA 2IGIA 1ASWA 2OZMA 1J9AA 4OKKA 4M3YA 2G8HA 4KHSA 1S6QA 2PYJA 3MEEA 1LAWA 1RT7A 3PX4A 2ZQBA 3DRRA 4UQGA 3CFOA 3KD5E 4F8RA 4FZYA 2KZZA 2HVHA 3OYGA 3O3HA 4KTQA 4DS5A 2Q3SA 2WOMA 1TKXA 3AVKA 3ZSZA 4FLZA 3V1OA 2JGUA 1WJDA 3LP0A 1X1PA 2RF2A 3C95A 3M8PA 3NGZA 3V9XA 4IG3A 2G8VA 4Z4GA 3OYNA 3CFPA 3T3FA 1KLNA 3AA2A 4FLVA 4QOZB 4FK0A 4QCLA 3AVJA 4OLBA 2G8FA 4DWIA 5J2NA 3LPUA 4PUOA 4CESA 4DQPA 4C8LA 3KJVA 3LAMA 1TL1A 2G8UA 4PY5A 2HMIA 3HL8A 1BISA 4KHWA 5I3UA 2X78A 3HM9A 1DTTA 4FJGA 4BE2A 1LFPA 3VQ6A 3S3NA 1RTDA 1GOCA 2B4JA 3LALA 4KO0A 4KTZA 3EY1A 3HXMA 3ZT1A 1XHXA 3VN5A 1LV5A 3VQ7A 2VWKA 5CY4A 3VQQA 3AA5X 4E19A 1ITGA 4DLEA 1REVA 4XIUA 2YHBA 5KGWA 3K2PA 5FDLA 4DTUA 2PY5A 3DLGA 1F21A 4HHTA 2DFFA 3NH0A 4FW1A 4DLGA 4NYFA 2G8KA 4ELUA 2RPIA 4KI4A 3DOLA 1KTQA 1LAVA 4PWDA 1SV5A 1C0UA 1UWBA 2Z1IA 4HUFA 4CJPA 1CXQA 1VRUA 3OJSA 3F9KA 1TL3A 4B9VA 4GVMA 1TGOA 4DTJA 2KW4A 1D5AA 5KRTA 3TAMA 4CJEA 5SWMA 4DTSA 1GOBA 2ZE2A 4K8XA 3LDSA 1TKZA 4GW6A 4CE9A 3O3FA 4FM1A 3OYEA 4H4MA 3AO2A 1T05A 1C1CA 1NOYA 4FK4A 4CJ5A 3HYFA 1WSHA 5K14A 3OYIA 3BGRA 3V9WA 1L3TA 3SV4A 2X6SA 1B9DA 4LY7A 3JYTA 3TWHA 4CECA 3UIQA 1BGXT 4CF2A 3RMAA 3OYDA 3QESA 1SL2A 4B3OA 1LWEA 3NF7A 2BDPA 4W5RA 2I5JA 4B9MA 3V6DA 4Y1CA 1Q9XA 2E6MA 3HPOA 4AHRA 4CFAA 3I8DA 3AVHA 3KIOA 3KK3A 4M3RA 1I39A 1EP4A 1Q9YA 4Y1DA 4RW9A 4ELVA 3LWMA 1TK5A 2F8TA 3V1QA 1RT3A 5CYMA 1KFDA 4KREA 3L2WA 1WAJA 4OPJA 1X9WA 3NGIA 3PO5A 3OYMA 1IKWA 5JS1A 1IO2A 4BE1A 3AVMA 3OYFA 3VQBA 3C6TA 1Q8IA 5CZ2A 1XHZA 4CJ4A 3OS2A 2NUBA 2A1SA 3NF9A 1ASVA 4FJKA 1QHTA 4Z0UA 1NJXA 4QAGA 4HCCA 4FZXC 2B6AA 4RW7A 3AVIA 4KHQA 3VQ4A 3QEXA 2Z1JA 3KTQA 2YHAA 4AH9A 1JLGA 1RBRA 3QNNA 1TK8A 4CHZA 1L3VA 1L3UA 4LH5A 3LWLA 4AHUA 1EX4A 3NCIA 3K5NA 3SV3A 2DY4A 4DTNA 4FJLA 1ZBLA 2YNGA 2D0AA 2HB5A 3IG1A 4YNQA 3LP1A 4DF4A 3PX6A 4CJLA 1NJZA 3RRGA 1CLQA 4FLWA 5JS2A 3ALYA 3CM5A 3SQ0A 3P1GA 5J1EA 1C1AA 4EZ9A 4CK3A 4DFKA 4B9NA 1S1XA 4FJXA 3K5MA 2A1RA 4C8KA 4W5OA 2ITGA 3U6FA 3L3UA 1YTUA 3AA3A 4B8CA 3SQ4A 4KAZA 4CGJA 3I0RA 2E4LA 4CEFA 1S1VA 3LZIA 3SUNA 4ELTA 4CJWA 4C8NA 2BGGA 1ZBHA 3KK1A 2HHWA 3L2UA 1CXUA 3LAKA 4C8MA 1YTAA 1HYZA 1UAXA 3D45A 1VSHA 3ZSRA 1TK0A 1N6QA 3O3GA 3OYHA 4CJFA 4N47A 4DTOA 1S9EA 1RT5A 3NH2A 1TAQA 2OYQA 4N41A 2ZD1A 3B6PA 4I2QA 1BHLA 4FJ8A 1BCOA 1KCFA 1QE1A 4CEOA 3SPZA 1BI4B 3DYAA 3KLGA 4JS5A 4FLYA 1NK0A 4I7FA 2G8IA 1BIZA 4C8OA 3WNEA 1JXBA 2XY7A 2O4IA 1C6VA 2XY8A 3ZSQA 3SPYA 4CJTA 4E3SA 4EP4A 2G8WA 2IC3A 1KVCA 4ICLA 4JS4A 3VA0A 2Y1JA 5I42A 2R7YA 4Q5VA 4DU1A 1KLMA 1BQMA 1HYSA 5HRRA 1NK5A 4FK2A 1QSLA 1LW2A 4KTWA 4CFDA 1ZBIA 5HRPA 1U4BA 2KQ2A 4DSKA 4KI6A 4CHPA 3VQ8A 4B9SA 2HNZA 2OPRA 2YV0X 4H4OA 3DOKA 3DLRA 4CF1A 2Y1IA 2X6NA 4FJNA 1NK8A 5C25A 3OYBA 3ZSWA 1IKYA 1GOAA 4DMNA 1ZBUA 3SQ2A 1FK9A 1O1WA 4M42A 2HHQA 3LP3A 1HNVA 1R0AA 4CEQA 3WNFA 5KGXA 1C0MA 3RTVA 4FJ5A 4O0IA 3OY9A 1HRHA 4M3ZA 4DQRA 4DTMA 4CEBA 1RCHA 2QKBA 1SUQA 2DFHA 5HRSA 4FLXA 2F8SA 1LWCA 1Z26A 4DS4A 3G10A 2IAJA 1YT3A 4E7HA 4GMJB 3IS9A 1NKEA 4BWJA 4CIEA 1QSSA 3BDPA 1EKEA 1WLJA 3PV8A 1X9MA 3RMBA 1HNIA 1WSEA 3ASMA 3K5OA 4FM0A 1TV6A 3CG7A 3M8RA 4FLUA 2P51A 3QO9A 3ZCMA 3RRHA 5HP1A 1C0TA 2FBTA 5FRMA 2AJQA 4LD0A 3PUFA 1DTQA 2BANA 3QEWA 3PX0A 1EXQA 3KKRA 2O4GA 4BACA 1NK4A 4NYNA 2KZMA 4ID5A 2VWJA 4DSFA 4KHNA 4FYDA 4BWMA 4RG8A 3NF8A 5J2MA 3OS0A 1U48A 1RTIA 1RT1A 2IS3A 2P5GA 4CFBA 3TI0A 1NK7A 2IDOA 3HVRA 4CJQA 1RDBA 1TVRA 4OKEA 3OYLA 4KV8A 2XRIA 4L8RB 4FXDA 4RW4A 4Z4HA 1WN7A 1FKPA 3OJUA 3KK2A 3E01A 3V1RA 3S3MA 4E7LA 4BE0A 4HCBA 3QERA 3MAQA 1RDAA 1NJYA 4DQIA 4R5PA 4BDYA 3HPHA 1L5UA 3HT3A 4DTXA 5DK5A 4ZTJA 4O4GA 4OKJA 4F2SA 2HHTA 3K59A 4W5NA 4Z4CA 4DFPA 3SUQA 3L2RA 4IFYA 4M3UA 2EX3A 4OVLA 3TAGA 3AV9A 4CJRA 1BQNA 3ISNC 4FVMA 3V81A 2GV9A 1Z25A 3KLHA 4AHTA 2HHSA 3KLEA 4PA1A 1IH7A 1D9DA 4IKFA 2GUIA 4O5BA 1TKDA 2HHUA 3KKSA 2DTUA 3MEDA 1W9HA 1HQUA 1VSKA 2DFEA 3L2VA 3SUPA 5HROA 4E7IA 2OZSA 1FKOA 2HHVA 4KFBA 4CJKA 4W5TA 3TARA 3DLBA 4IDKA 2PYLA 1K6YA 4YFUA 4NCBA 1CZBA 1LWFA 1VSJA 1SL1A 4E7JA 3ZSYA 4OGCA 2QKKA 1UA0A 1NKCA 1BIUA 1SKRA 4CFCA 1RT2A 1TKTA 4Q0BA 3PY8A 3KLIA 4CHOA 1EETA 4WE1A 4DSEA 1ZYQA 4IG0A 1SL0A 3AO5A 4OJRA 4O0JA 1YVUA 1VSFA 2WONA 1WJEA 2F96A 4CHNA 1UA1A 3SZ2A 1HPZA 1S1WA 3AA4A 4TSXA 3WNGA 3VQCA 5KTQA 2QXFA 4CCHA 4O55A 4HUEA 1RT4A 1VSEA 1VSIA 2HNDA 2OPSA 3ITHA 5FRNA 1B9FA 1RDDA 3VQEA 4ZHRA 2QK9A 4CEDA 3AVGA 2HNYA 4NCGA 4E1MA 4E89A 3RR7A 1JXEA 1RDCA 2RN2A 4DQSA 3TAPA 3F73A 3TANA 1T8EA 4FJIA 1VSMA 4F3QA 4B8AB 1HQEA 3O4QA 4LSNA 3V4IA 1SKWA 1UOCA 2PZSA 4I9QA 1A5XA 2KFNA 3NBPA 4MFBA 3CFRA 3AO4A 1D8YA 5SZTA 3DRSA 2JLEA 5HBMA 4CF0A 1W0HA 3U3YA 3SI6A 3NHGA 2P5OA 1WSJA 1HJRA 4EZ6A 4I2PA 2D0BA 3S3OA 2X74A 3NH1A 4F4KA 2E6LA 1S6PA 3JSMA 2XO7A 3T1AA 1X9SA 3OYJA 1NK6A 1VRTA 1JL2A 4AHVA 3VQDA 3OYCA 5C42A 3MXIA 1KRPA 2BE2A 2OPQA 1JLFA 4CIFA 1L3SA 4HTUA 4LSLA 4DSLA 2YKNA 4AILC 3ZSXA 1T7PA 4FJMA 2D5RA 1HYVA 4FCYA 3SJJA 5KRSA 3A2FA 3EZ5A 4BDPA 2YNHA 4RW8A 1BI4A 1QSYA 4CGDA 4CGIA 4B9LA 3TAQA 1E0EA 1ASUA 4H8KA 4M3TA 4KHYA 3DRPA 3HPGA 2D0CA 2RKIA 3IAYA 3HO1A 1RBSA 4OGEA 3VQ5A 2HW3A 3AO3A 4I9LA 3KLFA 4N56A 4AHCA 1KVAA 1J5OA 4CIGA 4FJ7A 3HP6A 3MEGA 1QS4A 3QINA 2ATQA 1KSPA 3M8QA 4CF8A 4KHUA 4FW2A 1RBTA 2Z1GA 3B6OA 5T7BA 2XHBA 3AVLA 4DTPA 3QEVA 1XC9A 1N5YA 1NOZA 4J2AA 4CHYA 1VK0A 2XY6A 3QIPA 4Z4EA 1WNSA 3DMJA 3AVFA 4FJHA 1JLAA 3K58A 3DM2A 1JLQA 3I0SA 3MXMA 2HHXA 1VSLA 1BCMA 2OA8A 3TAEA 3SQ1A 4FZZA 4CGFA 1XI1A 2YNIA 1I3AA 3P5JA 5CZ1A 4AHSA 4F3TA 5C24A 1IKVA 3TAFA 1KFSA 1WJFA 3ZSVA 1WJAA 1LW0A 4DF8A 4F2RA 3C6UA 4M41A 4CJUA 4CGGA 4CK2A 1G15A 4M45A 3LZJA 1B92A 1NJWA 3L3VA 3HVTA 3NF6A 3ZSOA 3QNOA 5FROA 1RT6A 3DLKA 1U45A 4F3OA 4FJ9A 1RTJA 4KB0A 3ZT3A 3M8SA 3DLEA 4ID1A 1A5WA 2Z1HA 5CYQA 2XY5A 1WJBA 4CJSA 2FBYA 4MQ3A 2ETJA 4Z4IA 3QETA 4W5QA 3RMDA 1C1BA 4CGHA 3HK2A 3OYKA 1U47A 4N76A 1JLEA 1T03A 1S9GA 3K5LA 2FBVA 3L8BA 2FC0A 1S1UA 2VG7A 1U04A 1RBUA 3OS1A 3QLHA 3HSTB 4KB1A 3LANA 1WSGA 3AO1A 3ULDA 2YNFA 3FFIA 4M3XA 4J2EA 1RBVA 2B5JA 3CQ8A 3MXJA 5J2PA 3HJFA 3AVNA 3THVA 4KPYA 1JLCA 1XWLA 3PO4A 4E7KA 5J2QA 4KRFA 3VQPA 4CHQA 1RTHA 3DI6A 4M3WA 3TABA 3VA3A 1IG9A 1A5VA 1J53A 3AVCA 3EYZA 4E0DA 4J2BA 4CEZA 1J54A 3OYAA 2KFZA 5DMRA 3V9SA 4RW6A 3LPTA 4FLTA 4DU4A 1Y97A 3V9UA 2OPPA 4DQQA 2HVIA 3H08A 4IBNA 3VQ9A 3T19A 3NGYA 4KKOA 4CEAA 4JRPA 3QEIA 4BDZA 3ZT4A 1QQCA 4EP5A 3NAEA 1JL1A 1WSFA 1HMVA
chains in the Genus database with same CATH superfamily
4UV9A 5JLXA 3ABMH 3ZT2A 2GBZA 4IZZA 4RM3A 4HQMA 3RSEA 2MC3A 2H27A 1R59O 2Y75A 2UXCK 2XPWA 5EY4A 3GTOJ 4G9YA 2D0PA 3IFRA 4BJ6C 1RUNA 3SEZA 1HPMA 2Q2EB 3OVNA 2F4OB 4OMYA 2IS2A 3KPHA 3IUOA 2VG5A 3T1HK 5GAEJ 3M1FA 3E5QA 1G8XA 2EA2A 3O8HA 2A41A 4ZTFA 4L0YB 3C94A 1WHUA 2F5DA 5LHIA 3HL2A 1Q18A 1K78B 1P6RA 1U8BA 2DPDA 4RLQA 3RYRA 4B08A 4MIMA 4ON0A 3K7AJ 1VQ8I 4K41A 1A04A 1IJWC 4BEHB 1TNTA 3GBGA 5IOZA 4AIKA 2ECBA 2X4HA 3IHUA 1IRZA 3BEXA 3VQAA 3RR8A 3RWUA 4CD1A 4FM2A 1KONA 3QU3A 2BXYA 1JXSA 3NDKA 1NK9A 4DSJA 4DGWB 1Z05A 2VPLA 3ZGKA 3U3GA 9ANTA 2UXNA 3D7EO 2PMHA 3PL8A 1RNHA 2RE2A 1KQ9A 1X3ZB 4MNUA 1LFUP 2EV6A 2R7SA 1TUYA 4CEEA 3G6EI 4HOBA 5EG0A 3DLAA 3JTHA 5AR0A 1MMNA 3AVAA 4HVJA 3DLHA 1RESA 4JI4K 2UUZA 5K7HA 3HB9A 2W42A 2FBXA 3DPLC 1ZLKA 4QS7A 3NFAA 4B9TA 2FF3B 4HF2A 2A6HF 2JUGA 1MW7A 1A6QA 3ZQIA 1VQPI 3VEVA 2W85A 2K3FA 2LR8A 4DTRA 2O8DB 1PJRA 2ZMEA 2IOCA 1IXRC 4EM0B 2IGIA 2W41A 4FWQA 1SC7A 2DA5A 3P4IA 4Y0WA 4M3YA 4ZDPA 1T0FC 1HKTA 3MEEA 4XIDA 4Y4RA 3DRRA 3KD5E 1ETVA 3BTCA 3S16J 2P7VB 2ZBKA 2Y9YA 5ILSA 3C7NA 1K8AO 3OYGA 3FXKA 1UZCA 2K40A 3MN7A 1BA5A 2HVHA 2LBFA 2GXGA 3KEYA 2Q3SA 1ZELA 2WOMA 3ZSZA 1G59A 4OPAA 3V1OA 3CC7N 5C44J 3LP0A 5CKTA 1X1PA 4BRLA 4RGXA 3CQZJ 2OAZA 4IG3A 3E1SA 3CFPA 4HSRA 4GYIA 3L00A 4PCQA 3UKRA 4FLVA 4QCLA 4Y33A 4N9HA 4BAYA 2V9KA 3HSCA 4H5WA 2M3AA 2XSJC 3F8NA 1QZ6A 3LPUA 4EM2A 1R71A 1K8KB 3CD6I 4GFBA 3LAMA 2JJ7A 3SFIA 5A2QK 3V8JA 1W0TA 3H3OB 4BC5A 3G6EN 2G8UA 3HL8A 3VSKA 1BISA 1F9NA 2X78A 2FBHA 3EO3A 2W40A 3PQJA 4JK8A 4Z94A 4BE2A 1LFPA 2IW5A 4BBSJ 4WF2A 3LALA 3EY1A 1Z91A 2V51B 3HI0A 1XHXA 3DTEA 2OA4A 2X6OA 2XV4S 5J3LA 2VWKA 3LSKA 1NM1A 4XIUA 2KIQA 5GP9A 2OCCH 3K2PA 3SAFA 1ON2A 4DTUA 2PY5A 1W5CC 5ILUA 1XS9A 1LE8B 1S9HA 4KT6A 2NNYA 3TQNA 4ELUA 3M7GA 1KTQA 1MBEA 1SV5A 1I6XA 2LBFB 4K25A 3WGIA 4HUFA 3CD6N 2Y2ZA 4JK1X 3C65A 1ZGAA 1APLC 4BC4A 3F9KA 1R58A 2E1MB 3JW4A 3QMLA 4GVMA 1POGA 2CFXA 3R4KA 2JZYA 1ETYA 3HTSB 5KRTA 5SWMA 4CJEA 3HGYA 1GOBA 2ZE2A 5E8GA 4PJJA 1E2XA 4HQEA 1QPIA 4H4MA 3AO2A 4FK4A 2MYSA 2YHXA 2OC6A 1K8KA 4CJ5A 2VQHA 2X0LA 1WSHA 3BG7A 3V9WA 1L3TA 4Y17A 3TWHA 5ICFA 3GX4X 2HFHA 3JYTA 3A03A 3IV5A 2UXXA 1BGXT 3K9JA 2F9WA 3W6JB 3RMAA 4OPHA 3QESA 3NF7A 2EH3A 1YXQA 1Z3YA 3V6DA 2WAFA 3A0HC 5J4YA 3TTFA 3HPOA 2CGLA 2IVNA 3ABKH 1Q9XA 5FJ8J 3GTJJ 4CZMA 3KIOA 2M7BA 3HGGA 3ECOA 3KK3A 2VQCA 3FXOA 1MKMA 5D4RA 4HA8A 4AVZA 4ILHA 1T38A 3LAPA 1YIJI 3V1QA 3BR1A 3MKZA 4KREA 1KFDA 3L2WA 4U67L 3FGUA 3NGIA 2LMDA 5CHIA 1IKWA 5M1KA 3THYB 3MWPA 5JS1A 1IO2A 1F1ZA 3E3VA 3GZNB 1OCPA 3R60A 4HZFA 4YIIA 4XICA 3OYFA 1R4NB 5DV5A 3D2FA 3JRCA 1XHZA 1ZARA 2HBMA 4CJ4A 2FF6A 2Z1IA 1XC3A 1D3YA 1N25A 1ASVA 2L7ZA 2JRMA 2J5OA 1T2KA 4KUMA 1NJXA 2VQEK 2F5EA 2C6YA 4FZXC 2B6AA 2EZLA 3SXYA 1A5JA 3AY9A 5D4SA 3QQAA 1D5VA 4IHYA 2MGQA 3ZYYX 3RTVA 3E5UA 4YFNF 1L3UA 2P4WA 2IGKA 5K7FA 2I5UA 1VAZA 5GAEP 4XRSA 3K5NA 1BG3A 1TT0A 5F0XA 2FBKA 3A5MC 4IEJA 1VQLN 1XMAA 1FEXA 3CCVN 3FMQA 2YNGA 5KAFC 2Z99A 2HPMA 4YNQA 4CJLA 1CLQA 2F2EA 3RRGA 3QU6A 4JEPA 4GV9A 2DODA 3CM5A 4EZ9A 2KT0A 3S17J 2CFOA 3P1GA 4B1YB 1J09A 2DU9A 4TV7A 5L3BA 4P55A 5FB2A 1S1XA 4JKGB 4CBXA 3K5MA 3KEOA 2Z1DA 2O8BA 1A6IA 4HRIA 5FLVA 4A2AA 1D8JA 4B8XA 4KAZA 2LOOA 2VB6A 3OV8A 2I7NA 3I0RA 2E4LA 1R22A 2BEOA 4FETA 4B43A 3SUNA 3PSFA 4ELTA 4C8NA 2ME6A 1A35A 2YJEA 4QWQA 3GBTA 1FPQA 1XB4A 2DMUA 3L2UA 2OTJI 3ZQCA 2HOAA 2XAGA 1YTAA 4C8MA 4BRCA 1BM9A 1VQMI 1ACIA 1VSHA 1N6QA 3OYHA 2V7ZA 4GW6A 4JI7K 4BQNA 5JVGF 4F55A 2Y31A 5AQVA 4EVIA 2CMPA 4LF5K 4OAZA 2VT3A 3BR6A 3B6PA 3KETA 1GUUA 1BCOA 3JXUA 4FJ8A 4NC8A 4CEOA 4LFBK 2DOFA 3OIQA 3ZCOA 4KISA 3NWSA 2FU4A 1MSFC 1BIZA 4I7FA 4ILJA 3GTMJ 3CMYA 3IUCA 4LITA 3ZSQA 2XAHA 3I4MJ 4CJTA 4E3SA 4ZJZA 2GA2A 1NLVA 4WCEL 3VA0A 4EJUA 1D1CA 2E60A 3TMOA 4PJNA 2HF4A 3KP5A 4U88A 1KLMA 4KDPA 3ONQA 2NZTA 1QHGA 2VKHA 1MBJA 1SD4A 4JKAA 4DKWA 4EQQA 4ZDOA 5K5RA 4KI6A 1FW6A 4X1EA 2A61A 2H09A 4XK4A 5E17F 1TQPA 2P0WA 4LMYA 2BVLA 4Y3OA 5AQQA 3HSRA 2W7NA 3CJ1A 4D5FA 3ENBA 3FFKB 3I8BA 3CJQB 4MDBA 4DV1K 1M1KO 1T44A 2DT6A 1PUFB 2FQ3A 1NTCA 3FMRA 4BRAA 3CF5F 5TGTA 2FNAA 4M42A 2HHQA 1R0AA 3VEZA 1S7EA 4IQJA 1RDWX 1C0MA 3SYTA 2BUPA 3WNFA 1HRHA 3M6GA 5F0CA 3PLAA 5KNLA 3E9LA 3SBTA 3J80O 1I1SA 1JHHA 2H94A 1F43A 4CVNE 1H9TA 1B72A 3VTIA 2KFZA 3Q3SA 1E3HA 4BNCA 4NBQA 1P90A 2KKZA 4FLXA 2DT7B 4X62K 3CCUN 2F8SA 2DPNA 3BF3A 1YT3A 3IWZA 3HKZA 4BWJA 1BDGA 1YF5L 1EKEA 3UNGC 3RMBA 3M5RA 2PMZN 5J40A 5EZGA 1TV6A 3CG7A 1WUAA 2P51A 3QO9A 3ZCMA 3WODF 3M8RA 2EQRA 1OLTA 5ILVA 1HX1A 3G3ZA 1DTQA 5FLMJ 5K1YA 2IXSA 3QPLA 2ZJQL 3QEWA 1WKMA 2O4GA 4K43A 1BIBA 2CS3A 1LDKB 2ISZA 2F9TA 4M3EA 2ID3A 4DSFA 1XSXA 1FSHA 1LUJB 3OS0A 2STTA 3VB2A 4BRQA 1Q7YO 2P5GA 1K61A 1EO1A 3AARA 3L1PA 2DN0A 3K2AA 1E3MA 3L4IA 4AWXB 3HVRA 1UG2A 1RDBA 1TVRA 3WQUA 3K4JA 1R5ID 1OPCA 2ZNZA 3OJUA 4AQYK 3HKZN 2VKDA 4HCBA 3QERA 2EFWA 3HDDA 1RDAA 2IRFG 4DQIA 2WWYA 5GPCA 2UU9K 2QZ8A 1XC5A 3HT3A 2EFOA 3W6VA 5DK5A 2KISA 3DXMA 4F2SA 2NOGA 2KKOA 3C6HA 2PFBA 4Z4CA 1VQ9I 1E3OC 1IZ1A 5AQKA 4XORA 5GTIC 2IIRA 5ICGA 5FPDA 2QEXN 3ID8A 4OVLA 2FJ1A 3DTKA 1RETA 3FXQA 4BRFA 1XX5A 3FM3A 4EIAA 4C2MJ 1J6ZA 4O8UA 2A6AA 5BREA 4AIJA 2ZB9A 5LD2C 3EUAA 4XONA 4IOXA 5AQXA 3V81A 2CJJA 3O9SA 3CJRB 1EJ9A 4KH5A 3KLHA 2QKMB 4ZYDA 1P4AA 1Y56A 3LDNA 3KLEA 4CYCB 4XM3A 1SAXA 3FKJA 2PAVA 2OZSA 5B5EC 4CW7B 5E3NA 3SUPA 2OBPA 1QVGM 3CJAA 1XGNA 2X1DA 3RCOA 2HHHK 3TP3A 1FOXA 3IWFA 3MWTA 4WQ4C 4IOCL 1S5LC 3KYDB 3DEEA 2KZGA 1K6YA 3AG2H 1WH5A 5IY5H 3HOWJ 4NCBA 4L9VA 1KAXA 3ULEB 3VF4A 1VSJA 3KE2A 4Z2YA 1XGOA 2MBFA 2Y0SA 2QKKA 1MWKA 2E2NA 4B3TK 1ULYA 2OJED 4CD3A 2A3ZA 4Q0BA 3PY8A 3JTGA 1JUMA 1XMKA 1LJ9A 2CUEA 1SAUA 1ZYQA 4IG0A 4DV0K 2W6LA 3BT9A 3AO5A 1VZ0A 2VBZA 3DEUA 1AWCA 1W97L 5LL6Z 1WJEA 2JVGA 1IUFA 1BI2A 2W00A 3VPZA 1S1WA 2FEZA 3AA4A 3VQCA 3E9PA 4GKJK 2XAUA 4H0EA 4MTEA 1D5YA 3WG7H 1XCVA 2M2EA 3I9V2 4G6TB 2JWLA 3CCEN 3BC8A 1RT4A 2HNDA 1B9FA 2Q31A 4ZHRA 4M6YA 2Y48A 3PSIA 5EOYA 2VBXA 2HNYA 4AU7A 2WUSA 4E89A 4PJMA 4RCHA 4KHSA 1NGJA 4KA4A 1T8EA 4FJIA 4B3XA 4UHTA 1D1AA 2O8EA 1SKWA 2ZC2A 4CFDA 4MDAA 1UOCA 1D8YA 1KQ0A 5H1SQ 5J8CA 5AIPA 1KC8O 2JLEA 4H0VB 3CCSN 3SI6A 1FYLA 1KYZA 2DMPA 1HJRA 4I2PA 5BQTA 3S3OA 2D0BA 2P9NA 3J8AA 3ULEA 4WQ4A 4DV2K 3ABLH 2E6LA 1U6GA 4I6MB 1K79A 4HTLA 2G9WA 1HXDA 1OMIA 3JRGA 4P96A 2XO7A 1GV2A 3ATUA 1JL2A 4AHVA 3MXIA 3I55N 3VEPA 3ZQHA 3S1RJ 4ZYHA 3P9IA 1L3SA 5GTHC 1HCRA 4UUSA 3G71I 1R1TA 3FK6A 2BGCA 3AL0B 1T7PA 2OTLN 4FJMA 2XDVA 3LA3A 1K4TA 1R9TJ 4ESFA 4ISEA 4RDUA 2ZJRL 4LOCA 4FWMA 3BJAA 2E5LK 2Z3YA 3DCFA 3SDBA 1OH5A 2E2PA 4P5OA 2Q0OA 2KIFA 1FIAA 4RLFA 2NVUB 1ZQ3P 1E0EA 4GVEA 4CGIA 1ZREA 3TAQA 1ZHFA 3AG4H 2D0CA 2H6BA 2RKIA 1BI0A 4CZIA 1RBSA 4XQFA 2PJPA 2VE9A 4FPAA 3K9TA 5AQWA 4OGEA 4LLNA 1IBKK 3OL4A 1J5OA 4AHCA 1BUPA 1KVAA 4XEIA 2O8EB 5AFUA 1VQKI 1QS4A 1Y1WJ 1RUOA 3QINA 2XHKA 1MBHA 5EGOB 1U8RA 2HKOA 4HBLA 2YJFA 5FGMA 3BG6A 3ZQQA 3M8QA 4H0YB 2Z1GA 1YJWI 1HKSA 3LDQA 4A61A 3AVLA 4DTPA 2EWNA 4A3KJ 1XC9A 3H0GJ 4O8KA 4CHYA 5FKLA 3ASNH 3A01B 1VK0A 1MMGA 1HDDC 3QIPA 1UJ8A 2O8BB 3HUGA 3QPSA 1UG0A 1PYVA 2HKXA 2L7KA 2KIUA 3BDDA 3CJTB 3I0SA 3CMMA 6PAXA 1WI3A 2HHXA 1VQPN 1BCMA 4IHVA 2IS6A 4FZZA 1MMAA 1FLIA 1ZRDA 2YNIA 4F3TA 3LSHA 1KZHA 2PJRA 1IDZA 2D5VA 2O03A 5ERIA 3MZHA 4A5MA 1XSDA 4RAYA 4DF8A 1U78A 2CQKA 3GVAA 4XMYA 1HJOA 4IWVA 1G15A 2LK2A 3U1KA 2W25A 3HOUJ 2KIMA 2COMA 3GTPJ 3M3YJ 3MN5A 1ZG5A 2LRDA 3R9PA 3SAHA 1R1VA 3KCCA 4XKWA 2DFIA 1IV6A 3HVTA 1YLFA 5FROA 5D5UB 1RT6A 4F3OA 3IP4B 1H89C 3WXIA 4PJLA 4BG9A 3B6CA 1WGXA 2DOEA 3K10A 3O08A 3K70D 3HRTA 1Y0NA 3T7ZA 3ZMVA 2OZ6A 4D9JA 5GAHJ 3EYYA 1WJBA 2L7MP 3E1YA 4JD2B 4M3DA 4Q4ZF 3Q0WA 5C0YA 4L9TA 3WG9A 4MQ9F 3CO6C 3W3DA 3GOIA 1N34K 2E19A 5LFAA 2E2HJ 3RYPA 4ENKA 1VQ7I 1JLEA 3K4NA 1S9GA 4H5VA 3H3UA 2VOOA 5ICEA 1RBUA 2BZTA 3I33A 3HSTB 3G25A 2A69F 3WT0A 3LANA 1X1BA 2ZJPL 1J5EK 1WSGA 3AO1A 3ULDA 3MCZA 1UAAA 2R93J 2ZMEB 3HTVA 2M34A 2UXDK 1RBVA 4I09A 5ADXA 3AVNA 2RNJA 2HXOA 1VHXA 1SVOA 2DOAA 4PDKA 5LJVA 2VL8A 3LL7A 1J59A 1RDUA 4DV3K 5DCMB 4CHQA 4M3WA 2VXZA 3DI6A 4F93B 3W6KB 3HZJA 3BJ6A 3ZR8X 3EYZA 3F8MA 3OYAA 1J54A 2A5XA 1RZ4A 2EIJH 4IRHA 4OWRB 3W3CA 2D45A 2ZWHA 4RW6A 5TKYA 1QHHD 4DU4A 3I58A 3ENHA 1Y97A 3DXKA 2CQXA 2VE8A 4DQQA 5DD4A 3WXKA 3VQ9A 4JRPA 2KHMA 3RPUA 4BDZA 4EP5A 1EH7A 1MDMB 4BY1J 1HLUA 1HKGA 3P83D 4H0XB 1FYMA 4KFCA 4LH4A 3OHRA 3S2WA 1IKXA 5L3EA 3SUOA 1VNDA 3AG3H 3IKMA 2RDPA 4FT8A 3RVCA 4S04A 3O4NA 5BPMA 1FY7A 3K0SA 5TJJA 1K7AA 5A2QZ 3K57A 1Y1VJ 4DSIA 4BQOA 2IP2A 4DFJA 4IX7A 2L5QA 3BOQA 3I54A 4II3A 4QSHA 3WNHA 2M30A 3VGKA 1PP8F 3ZT0A 2E88A 1WBDA 5LGUA 1WSIA 4IHWA 3S41A 2IGNA 2YCHA 4BYYA 1CZ9A 3VOEA 3QIOA 2VLAA 3SYZA 4DFMA 4JLHA 5E41A 4I76A 4NB4A 3T1BA 5LRRA 2ZGZA 3RKQA 4BBRJ 4DG1A 1JGGA 2E1CA 3CQXA 3RJPA 2ITMA 1O13A 5E1WA 1ZBFA 1WJCA 3SJHA 3CYMA 3HP9A 3F0CA 2FXAA 2WY7Q 2YKMA 3THXB 4LF7K 2NRZA 3SCXA 3ECHA 2W6KA 4PL8A 2UUCK 1B6AA 1RILA 3LP2A 3F21A 2JA2A 4OINF 5FKKA 5CVRA 3LSJA 4CSWA 2UZKA 1MZBA 4ZC3A 2GEMA 3AVBA 4HPQA 3FISA 1RPWA 2F4IA 4RM2A 3CCSI 3K69A 4DHYA 2IVMA 5GPAA 2Z2SB 4CK1A 5D5VB 1TYQB 3CCQN 2OCEA 4Z4FA 3EEQA 4YG2F 1ASWA 2BW3B 2OZMA 3V8KA 1ERDA 2YUSA 5C12A 3JAMZ 2ZCWA 5H20A 1ODDA 3GZ5A 1SFXA 3BJOA 4OAYA 4ZYAA 3ZRGA 1NMDA 4XR6A 4EGZA 2A07F 1C0WA 4EJTA 4LG0B 2ZQBA 3AAQA 3CFOA 4E7SA 3ZEUB 4FZYA 4JI2K 1N75A 5BPIA 3EE9A 4DS5A 4GO1A 1WH7A 2VQGA 3AVKA 1X4PA 4LF6K 4XH4A 1S72N 2JGUA 3CHWA 1X2MA 2HQNA 2HTJA 2HVSA 3C95A 2XRNA 3NGZA 3HSEA 2G8VA 5HLHA 3LQQA 4MLEA 1KLNA 2NS0A 1JTYA 1YTYA 4QOZB 2F4VK 4CZZA 4PGGA 3CCJI 3KHYA 4BC3A 3LDPA 5LY3A 5BPNA 1IRFA 1D0XA 4BRIA 1RR7A 4PUOA 1BR2A 4ESBA 3THXA 2VWBA 5AQPA 4C8LA 5FKMA 2LF7A 2EPFA 2RGVA 3FK7A 4YOTA 3N4PA 5I3UA 2XB0X 4NUBA 3HM9A 3VODA 1DTTA 4FJGA 2YU9J 3S3NA 2CGKA 1EF4A 2B4JA 4KO0A 2ELKA 3KZYA 4UB6C 2W4SA 3S2DJ 1TYQA 4YFXF 3ZQFA 1DGWY 4DR2K 5CY4A 3F6VA 2IGMA 2ZKZA 5HODA 3AA5X 1OVYA 2G7HA 1IF1A 2P9SB 4NXNK 2FOWA 2CQNA 3E6DA 3F8CA 4CCOA 1SFOJ 4N4NB 1YHQI 4CHUA 3CJ7A 5FDLA 4HHTA 1GLFO 4BROA 4MO5A 3WU2C 3MCAB 4WCGA 3CCJN 4AM3A 2OF7A 4ILGB 3C18A 1XSVA 1DUXC 2HBJA 1TWHJ 4B3SK 4P9UA 3CLQA 1CXQA 2JSPA 5J1RA 2FSKA 3AKZA 3H1QA 2JSCA 4AM6A 3O2PE 3DBHB 1O3TA 3LWFA 2KP6A 4PJ0C 1P2FA 4LG3A 3BCAA 2PN6A 1D1BA 1QQIA 4DTSA 4K8XA 3H0DA 2WBMA 4WXDA 1IG7A 1TKZA 2FE3A 1LDDA 3GFJA 2RV8A 1C1CA 4XKVA 2E1YA 3K6GA 5KPTA 5K14A 4L9NA 4FWKA 4JKFA 3SV4A 1B9DA 3DEWA 3DJCA 3OBWA 2L54A 5ED4A 3I59A 1GLBG 2OQGA 1YW8A 2X1EA 3OYDA 1CF7B 4B3OA 2V1NA 1QQNA 4W5RA 4B9MA 2PMZA 2GZWA 5C4JJ 1K78A 4CFAA 3F22A 4HLYA 5BOXA 2X85A 4IEIA 3SJMA 2RVCA 3RSNA 3VF2A 2BE5F 1VQ6I 1TK5A 1B59A 2ZGYA 2W1OA 3BR5A 3D6RA 5CYMA 4NO7A 2F8TA 3E5XA 2B63J 4DR7K 2VCPA 4UVBA 3VPRA 1E17A 3PO5A 5H6RA 3JAMK 4ENNA 1ZXOA 3IH4A 3VQBA 2HZTA 3CXCM 4MEXF 2NUBA 4BGDA 3Q7BA 1I27A 4JAXA 3KP6A 4A2BA 4H4KC 4XH1A 4QAGA 3NARA 5F2RA 4G6DA 2KHOA 1G3YA 2LD5A 1GXQA 4RW7A 2A6EF 4MTDA 2VYPA 1VQON 1MBKA 3V8LA 1QA6A 5J4VA 3GUDA 2STWA 3ESWB 1RR8C 2UYTA 1L3VA 4WX9A 4RB1A 4LH5A 2ZJPF 1KA8A 2QVOA 1EX4A 3D2EA 3KWIA 4AHUA 3WTTC 2BY3A 3SV3A 4KIBA 3BROA 2DY4A 4FJLA 2VOPA 4K0KK 1UHMA 5D6FA 1R6RA 4DJAA 1G99A 4DF4A 1NJZA 4O6JA 4UXNA 4IHSA 5JS2A 4HF0A 4FLWA 3H1CA 1EH8A 1IXCA 1C1AA 5J1EA 4CK3A 2W84A 3SQ0A 3M9AA 5C3EJ 4DFKA 4B9NA 2VJIA 4FJXA 2R0QC 1XGSA 2IJLA 1S6LA 3CUQA 2R7WA 3MK6A 3H3ZA 1YIOA 2V1XA 4W5OA 1BR1A 3BY5A 2ZFWA 4JX5A 4LFUA 4RAFA 1W2BM 3FWEA 4CEFA 1S1VA 1X9JA 3OIOA 1W0UA 4B3RK 2BGGA 3RKWA 1GVDA 2E1ZA 3KX2A 5E1XA 3KK1A 2VASA 5EZHA 5F1RA 1Z1DA 2QA4N 3DU5A 1UAXA 1EA3A 2K7LA 5L3FA 3ZSRA 3O3GA 4DYCA 5GIPA 3H5RA 2E34A 1RT5A 5IT9O 3VF6A 5KPRA 4N41A 1K4SA 2BH1A 3JAMO 1X3MA 1OCOH 3NVMA 1X2NA 3SQNA 1BI4B 5IYCJ 1SEUA 2EZKA 2G8IA 2XGCA 5F64A 2QXLA 3WNEA 3MEXA 2XY7A 2E1NA 5AZJB 4DCHA 5HDGA 3SPYA 5M5XJ 3R0JA 2G8WA 2IC3A 5DM6F 4JS4A 5IP7J 3K4MA 2E71A 3WTXC 2O61A 3QBXA 2R7YA 4DU1A 1S7OA 5LHGA 4LLLA 4B1RA 1ZBIA 2NS7A 4DR6K 1LNWA 3VYUB 1HW1A 3VQ8A 4A5BA 2H8WA 2HNZA 2BTFA 2YV0X 4A12A 4CHPA 1TWGJ 2NRRA 3DOKA 3U9DA 2Y1IA 1OH7A 4IPAA 2Y30A 3ZLJA 4FJNA 5C25A 3O9TA 3OYBA 3H9GA 1IKYA 1EQYA 4B9SA 1FK9A 3K1PA 1W7PA 3MD2A 1XGMA 3ZMTA 4ZYEA 4LJZF 3R6SA 3LP3A 3SLCA 4CEQA 4PL7A 5KGXA 5JVGL 2PFUA 4O0IA 1B8IB 5BPLA 3BZKA 2JN6A 3BTIA 4NLBA 4U0VA 2F5VA 1SUQA 2CYYA 2WY8Q 3C2HA 1Z26A 3CCYA 2NRXA 3A5LC 3G10A 5DTDA 1P92A 2E5ZA 2DTZA 1HUXA 4DUZK 3BDPA 2XGDA 1Y6IA 1BI3A 4W97A 1AKHA 1QZZA 3PNVA 2XSDC 1X9MA 1HNIA 4FM0A 1KAYA 2IS4A 3RRHA 1UCRA 2CSOA 2LKSA 2LY2A 1QVTA 4A5NA 4CZFA 3CMAN 5HP1A 5LLQA 1I3QJ 4CCNA 4D7MA 4J00A 2UWMA 4NLCA 5TKWA 3HG9A 3PX0A 4KJZA 2NYXA 4A3GJ 1EXQA 4L9JA 4CZHA 3HOVJ 3M3ZA 2KZMA 1ZK8A 2YS9A 2HMPA 2DLLA 2VWJA 4YY3K 1EWQA 3ML6A 2XF7A 5J2MA 2A05A 3NF8A 1GVJA 1U48A 1OKRA 5DCFA 3U9GA 4CFBA 1GLDG 1TTYA 2IDOA 3KP7A 1YFHA 1NK2P 3OYLA 4CJQA 4NNJA 1TC3C 2XRIA 4KV8A 3BR0A 1GXPA 2BVMA 1BU6O 2P5LC 3E01A 5CQEA 3V1RA 3HHGA 5F27A 4OMZA 2XC7A 1MBGA 3C2BA 4H5NA 2P9IB 4LG0A 3ZEUA 1YS7A 3VGMA 4RAZA 2O8XA 5CLSA 5E3OA 4HF1A 4ZTJA 2GAUA 3DKXA 2DK8A 3K4BA 5B66C 4LFCK 3HOSA 1HKBA 2QSFX 4OKJA 2OQRA 4W5NA 3ZMSA 1YX5A 1IUYA 4YOVA 4DFPA 2OUMA 4IFYA 4K2EA 3B02A 4WXCA 3RQ4A 1QBJA 3LOCA 3TAGA 1AKHB 1BBYA 3FXUA 3MAJA 3E6BA 2RNGA 2DA6A 3CZ6A 3QP5A 1BQNA 1NMNA 3GFLA 2R7TA 1BIAA 1Z25A 4AHTA 3RSEB 1NKBA 2ELJA 4IKFA 1D9DA 1TKDA 1KYWA 2DTUA 3FXJA 3NEUA 1YVNA 3MEDA 1W9HA 1VSKA 4AIDA 5HROA 1ZRCA 2QYOA 3MMYB 5AIQA 3G4SI 1FKOA 5AQRA 5GINA 4ITVA 2KDZA 3CMEN 4JYAK 2HHVA 4NDLA 4KFBA 4JBAA 2QI2A 1N8RO 4A3DJ 5JHUA 3A5NC 1V5FA 4OX9K 4RBOA 3H1VX 3VEOA 2D2WA 4YFUA 1CZBA 1U2VA 4XLEA 3VMFB 1SL1A 4FE7A 4HLXA 2N8GA 3NMUA 1TL8A 1JKPC 2HOTA 3LFKA 4WK8F 2NVQJ 1JUSA 1MNEA 3KLIA 4CHOA 1EETA 2OTLI 4DSEA 4GV3A 2HOSA 4FWOA 4HNTA 2EZIA 2DYSH 3GE1A 4BL0B 3CCMN 3IL2A 1XUPO 1IW7F 4IJAA 3DKYA 4CHNA 1FMWA 1NHAA 3WNGA 5KTQA 3B73A 4UNOA 3MVPA 1YG2A 4QPOA 2DCEA 2IS1A 1UB9A 1A31A 4IF4A 2QXFA 1T3VA 3FDYA 3THWB 4CCHA 4O55A 1GDTA 2FF4A 3EETA 3CJ9A 3ITHA 1YITI 5C2FA 3G1OA 5FRNA 1N32K 3LMMA 2VONA 2QK9A 1LVKA 2DXIA 4CEDA 3HOZJ 2LY1A 3TW7A 2LC2A 3PUBA 2PLYA 3AVGA 4CZJA 1NGGA 2FA5A 2H1LA 5J47A 3TANA 3F73A 1BW6A 1UHSA 2DO7A 3M8JA 3BCBA 3KFWX 4ZYGA 1VSMA 1HQEA 1VF9A 2E1OA 2Z5UA 4KH4A 5JLFA 2KFNA 5FLXK 2CU7A 3OMYA 5KVRA 1I50J 3I64A 4QLCU 4M3FA 1JKOC 4MFBA 5HBMA 1LEBA 4CF0A 3CC2N 2JPBA 3J7YJ 1D0ZA 3SEQA 4EZ6A 2K27A 2HXIA 4YORA 1O4XA 1OR7A 5HS9A 1NGDA 3S14J 5D5WB 2JWKA 3T1AA 1ZGJA 4CDGA 1VRTA 3OYCA 3RZOJ 1GLEG 2ASMA 2OZUA 4GRIA 2V1UA 1KRPA 4C1NI 2FXUA 3VYSB 1TWAJ 3FKIJ 4GCVA 3WGHA 4B3MK 2VXDA 2XAFA 4DSLA 2YKNA 4OOIA 4JKEA 4AILC 4HNVA 2GXAA 2QWWA 4CYDA 3CP2A 2P9UB 1EH6A 3N4QA 3VENA 2E5NA 3SDGA 4FCYA 3E6CC 2GLOA 2K02A 2JA5J 1U5TB 2XASA 2QWOA 3A2FA 3WEEA 5KRSA 2D1KA 2YNHA 1IJJA 1DU6A 4HV6A 4CGDA 1V54H 3EPZA 4G6QA 1Y39A 1ASUA 4H8KA 4M3TA 4KHYA 1BA0A 1Q1HA 3HPGA 1LFBA 4AC0A 2R5YA 1V5GA 4RTFD 3IAYA 3HO1A 2VIXA 3CDHA 3VEXA 5J8FA 4KBOA 1FTTA 1FOKA 4E1JA 3AGKA 4I9LA 2HHTA 3J7AO 2DBBA 4N56A 3HIFA 2HTSA 1YS6A 5GIOA 3I4PA 4UVCA 1CQTA 1X58A 3HZ6A 3CC4I 1XNQK 2KLOA 2R5ZB 2EJRA 4KHUA 1USTA 4GY2B 4Y7NJ 1XMOK 2NRAC 2XHBA 4HAMA 1NOZA 4J2AA 4Z4EA 4A2UA 2L3DA 2A5WA 4MO7A 3ZMZA 2H3GX 5F1XA 4B9VA 4FJHA 1JLAA 3MZ8A 1O3SA 2X6XA 4CCLA 3GTKJ 3MXMA 3TDUC 1TWCJ 5LEKA 5M3FJ 1VSLA 2K5CA 3H35A 2XROA 3SQ1A 2L9NA 2OA8A 1XI1A 3RKXA 3I3LA 3ZETB 5CZ1A 3VERA 4EFHA 1TNSA 3F2KA 3N97A 4BR4A 2JMWA 2QBYB 1WJFA 1AHDP 2XB5A 1Y8RB 2WB1A 4PKHA 2PMUA 4QPQA 1X3UA 4F2RA 2BHYA 4M73A 4CJUA 1RNLA 3A2KA 5HLIA 2AP1A 2AQFA 3FXRA 4M45A 2DDBA 1B92A 1FBQA 1OISA 1LPQA 2MA3A 4C23A 5IWAK 1F36A 4NXMK 4I0BA 5HLTA 1FC3A 1U9OA 5B3SH 3BZ6A 1U45A 3CP8A 5DD8A 4DV5K 1I1GA 1OCZH 3D5RC 3JRHA 3PFIA 4FJ9A 1RTJA 2Q97A 2PI0A 1P8ZA 2A40A 2KRHA 5LHHA 3FZKA 5C4XJ 2V79A 1MWMA 5FKOA 1GLAG 2E2QA 2HNHA 3FBIB 3F9MA 4MQ3A 2LKXA 1IBLK 4Z4IA 3QETA 2R5ZA 4XN3A 1AOYA 2F7TA 1C1BA 1IDYA 4ABZA 3S1NJ 3TTCA 1ZH5A 1NGAA 1T03A 2DA7A 1ZR4A 3CUQC 5E3MA 3K5LA 3S93A 1ENHA 1S1UA 3U2RA 4LLGF 3WTVC 1RKWA 2VG7A 4O5VA 2PX9A 1JCGA 4AVPA 2DT5A 3EN9A 2Z33A 2QM3A 4L5EA 5CVUA 1TUUA 1YIJN 2HWVA 1BOBA 2VGMA 3C1DA 3QRFF 4UVAA 2YNFA 5AQGA 4X0GA 3CQ8A 4XRFA 1FOYA 3J80Z 5LGNA 3O9RA 5J2PA 2QBYA 3HJFA 4IO9L 4KIGA 2AXTC 4G8XA 1Z9CA 2HDCA 2P6SA 1JLCA 3VESA 1NGHA 1R00A 3PO4A 5J2QA 5IT9Z 3VQPA 2DA1A 3FHNA 4I6MA 1RTHA 1LB2A 4H0TB 2V6CA 4ANJA 4M3BA 1SD6A 1SFKA 4FTHA 3UKGA 1VQNI 1J53A 3TABA 4CEZA 1IG9A 5AQZA 3H9JA 3V9SA 4M9ZA 3R3LA 4QIWN 4L3QA 1JJ8C 3KLNA 1PVEA 1ZKGA 5EEGA 2QWRA 1GHCA 4FLTA 4QS8A 2GXBA 3LNQA 2HVIA 2QLZA 3OOPA 4IBNA 3MX2A 4W1UA 3NGYA 1KGSA 1IN6A 4FX0A 1I6HJ 4CEAA 3QEIA 2HQRA 2HF3A 5CVJA 3LSMA 4C30A 3OA9A 3KYCB 2JT1A 5AJ3K 1IAWA 1JL1A 1ATRA 1WSFA 2Q1NA 1Z3XA 2QEXI 2KTQA 2GBYA 2P5KA 4YIFA 1HNXK 3U4LA 4OLAA 1OVQA 4JX4A 5M1OA 5HL7L 2NVYJ 4EHUA 4DU3A 1SKSA 2EIKH 5KQDA 2B0LA 4DOZA 2BY1A 4HUGA 2FMYA 4S05A 5AQUA 3DFGA 4KMFA 4F7ZA 1PDNC 1BC8C 3MECA 1UHWA 2L9RA 2DYRH 3P9KA 3H3NO 5E84A 4NCAA 3ELKA 4GXOA 1DT9A 3QOEA 3C3WA 4DQ2A 1SQKA 4CE9A 5FLXZ 4JRQA 3TR8A 4BR0A 2W57A 3WE3A 4BQQA 3BTLA 4HNUA 4E1NA 1YJNN 1VQMN 3RTRA 5HLFA 1YQAA 3FR0A 4DR1K 4KITB 4A93J 2EHGA 1B1BA 1JLBA 1LV5A 4UY8O 4HWIA 4A3JJ 2LY9A 2P1JA 3ZX0A 2DK5A 4ASNA 1DPUA 1FXXA 2LVSA 1AA7A 4CJ3A 5E1ZB 3HXLA 2ID6A 3H3VK 1U5TC 1FJLA 2VJ5A 1S5JA 1WAFA 2X6YA 3CCLI 4IZ9A 5ADXH 1NWKA 4M71A 4RA2A 1TZLA 1VSDA 5KPZA 4G1QA 4N5SA 1HKQA 4RGRA 3I0TA 3EQLF 5F6FA 3FXLA 3JSOA 2JQ7A 1S1TA 3T0YA 2GX9A 4BR9A 5A2QO 4U87A 5KI6A 4JKBA 4OPKA 2O8KA 3CLOA 1JKHA 2J4RA 3CM6A 3GW2A 3H9QA 4IO9F 2A5YB 4XBFA 1H9GA 4YOYA 4OKKA 1OFCX 2V9PA 2P6TA 4P9FA 4GV6A 2ELHA 1S6QA 2RQQA 1O7LA 1HW5A 3PM1A 5E26A 1WWXA 1HQCA 4IRIA 1KAZA 1MH4A 1OH6A 1JGSA 3R0AA 1Z67A 1SD7A 2MD0A 2HOEA 3GDQA 2JUCA 2EFNA 3MMVA 1YRNA 1B72B 2DW4A 1TKXA 3AFHA 4I98B 1R7JA 3HRGA 1ZBSA 5LMUK 4G94A 3UKRB 4DBRA 3V9XA 3F8BA 3GL1A 3OYNA 1P4XA 2ZO4A 4XOTA 2D0OA 3T3FA 4FOEA 4A69C 1OKJA 5GAHP 4V19S 2MC4A 2EWSA 2BBYA 3AVJA 3BF1A 3OSGA 2G8FA 4OLBA 4DWIA 1KU9A 4A0YA 2QSHX 4D0PA 4H03B 4DQPA 3M1EA 2Q0RA 4WWCA 1B9MA 5JFRA 1MMSA 3KJVA 3J81K 2CGPA 4PY5A 1FP2A 3ABUA 2FX0A 5KK1A 3CCLN 3K1NA 1L3LA 2HSTA 2XPUA 3ZX2A 3P9CA 2WC2A 1ETQA 3QBWA 4IJNA 5E18F 1J0RA 5AQOA 3W0LA 4X65K 1GOCA 4M3GA 3HXMA 2V26A 2UUAK 3ZT1A 4H5RA 4WFAL 1SMYF 3VQ7A 3IH2A 1O3RA 5LMNK 4LD5A 2NRHA 4E19A 1ITGA 1IGNA 2ZMEC 4N4OB 1D4XA 5KGWA 1LCUA 4EM1A 4DZPA 3CPWM 2MD5A 4JQFA 4H0PA 1F21A 3CJBA 3NH0A 5DYMA 3I55I 2ZM6K 1MNDA 4JHDA 3CF2A 3DOLA 4EV0A 1Y64A 2GTDA 4KI4A 5DDGA 3KWGA 3HTUA 4PWDA 3FZMA 1I5ZA 3DTIA 1LE8A 1HC8A 2EV5A 1VRUA 2HDDA 5K5QA 1GLNA 1RC9A 1U9NA 2MH2A 3CCRI 4M74A 1FTZA 1TL3A 2YX6A 4WQ5C 3LA2A 4EATA 2CV0A 1QZEA 2KW4A 1MDMA 4DIQA 2P9UA 3DP7A 4J8FA 1T56A 2E2OA 3LSTA 1ZAOA 3I71A 5F0HA 1MH3A 3F72A 1JT0A 1E4GT 2PBDA 4IQ4A 1TT5B 3CI5A 5BR9A 4ENMA 3J7ZO 1NOYA 4IOCF 3TW6A 3HYFA 3OYIA 5LJWA 3FX3A 3BGRA 3LSIA 3KD1E 5IT3A 5E8IA 4LY7A 3HEFA 4CECA 3UIQA 4YELA 2Z9OA 3EE8A 3ZX3A 1QHAA 1ZN2A 3COAC 1SL2A 4JI3K 1I94K 5AZJA 2I5JA 3CIPA 1Z21A 3BR3A 4RS8A 5FKNA 1VQ5I 4YDUA 1YJWN 2E36A 4AHRA 4BKXA 1Q81O 4EEFG 1S3XA 3OR2C 5EF6A 1C0GA 2YHYA 3HM5A 1YX3A 2O7OA 1U0JA 1I39A 4FVUA 1EP4A 1Q9YA 4ELVA 2P81A 4RW9A 2DA2A 3DWLE 1HF0A 4U0WA 4C2UA 1QU3A 3THYA 1YYVA 1YHQN 3NRVA 1SVLA 3D2FB 4YDUC 2DMTA 5KHDA 2ZXHA 3OSFA 1YI2I 4PKIA 2O3FA 1HSTA 2DA3A 2DTRA 5CZ2A 1Z6RA 1FOWA 3PNYA 4NC6A 2KPMA 2Q1ZB 2A1SA 3HRUA 5IP9J 4N9IA 2NOJB 1QHTA 4Z0UA 4B48A 1VQ5N 3DPUA 4HCCA 5K7ZA 4HDUA 3AL0C 4BRMA 3TEDA 4KHQA 5JMVA 4HV5A 3GMEA 4B4CA 1R4MB 4PZJA 2ASOA 3WTZA 4KIFA 2EILH 2YHAA 2R7QA 3A5OC 2QCOA 2GWRA 1ZG1A 4AH9A 4CHZA 3LWLA 3T8TA 4M9XA 3NCIA 3WHCA 1DEJA 2QM1A 4OIQF 1IN4A 2P9NB 2DDAA 1VTNC 4LB6B 4E7ZA 3HBTA 5AQHA 4DZJA 2HB5A 3K4KA 3VETA 3OTOK 1NJIO 1HOMA 3PX6A 2CUJA 3PO2J 5AQNA 4IL6C 1BOTO 1Y0UA 2FNPA 1U3EM 2ECCA 3NQOA 2L02A 2XF6A 5BNGA 3O8MA 4ISFA 3H45C 4BRGA 4DV6K 2A1RA 4C8KA 3GF2A 5DS9A 4Q5SF 3PFYA 3L3UA 5D8LB 2HYFA 3O1BA 4B8CA 4L5JA 2I7PA 3SQ4A 4CGJA 4LF8K 3LZIA 2KZZA 1R49A 4CJWA 1K83J 5H2FC 3MKWB 2WADA 1EV7A 3DBRB 3P7NA 1ZBHA 3LA7A 3FHZA 3P38A 2HHWA 4A3FJ 1DDNA 1F5TA 1JCFA 1A36A 1GLCG 2E1MC 1HYZA 3GCMA 3D45A 5JLHA 4XNFA 1TK0A 1HNZK 4IOAL 3J7YP 1S9EA 1WI9A 1F4KA 2ZD1A 3H5NA 4I2QA 3WXMB 1W36D 1W7AA 2FUG2 2LREA 3GFMA 1KCFA 3MN6A 3SPZA 4FLYA 3DYAA 3KLGA 4JS5A 4FWLA 1DGRM 4MGRA 1DU0A 1FX7A 3EUHA 5BS6A 4C8OA 2K9NA 2P8TA 3VYRB 3CMAI 1JXBA 4ISGA 2O4IA 4BEHA 1C6VA 2R3SA 1YAGA 2XY8A 2HGCA 3O8GA 3TP0A 5JR3A 1P7IA 2QSGX 3ZQLA 1NU0A 3O5BA 2Y1JA 4XLAA 5I42A 2MLGA 5BR8K 1KXPA 3VDXA 3FZVA 4CH7A 2JA6J 1GV5A 4JOMA 4M7YA 5JVHL 4DR5K 1M90O 1VQ4N 3CETA 3BG3A 1S22A 5HRRA 2VPRA 1QSLA 4FK2A 1LW2A 2ZSIB 3HUGB 1G3TA 3QODA 2M9HA 4KTWA 4WYBA 2EV0A 3RZDJ 2KQ2A 5HRPA 1U4BA 1WB9A 2OPRA 1X1DA 4H4OA 3K4LA 3DLRA 3FM5A 2X6NA 1NK8A 1FIPA 4G7HF 1BN5A 2XVCA 2Y0MA 1GOAA 4RB3C 2P9KA 3L09A 5IPAA 1Y8QB 5M3MJ 1OCRH 1BL0A 1OCTC 1ZBUA 2Q0UA 3SQ2A 1O1WA 4HEA2 3VEWA 1OYWA 3AAFA 4FQGA 1WJ5A 1HNVA 2RREA 4FJ5A 3KZZA 2OD5A 1S3JA 3BP8A 3M1CA 1EWRA 1NGBA 2NNWA 4EGYA 1HLVA 3C7NB 4FWPA 3MWMA 4M3ZA 3FLCO 2HBKA 3MQ0A 2AQEA 4LIUA 3HOTA 1HBXG 1RCHA 4MLHA 2DFHA 3C0BA 1T6SA 4JKDA 5HRSA 2QKBA 1IN7A 1D0YA 3QWLA 3GWZA 1LWCA 1V4TA 2M7AA 2V7FA 3Q9VA 4E7HA 4GMJB 1NKEA 2I10A 5JLWA 1QSSA 1JHFA 5E3LA 3CPEA 3TGNA 1WLJA 3R6MA 1WSEA 2V1DA 3JCUC 3L4QA 3MN2A 5GADP 3AGRA 2AJQA 1W4MA 1T6CA 2FBTA 1W1WE 1U2WA 3K9KA 5ELZA 4LD0A 3PUFA 5M5WJ 2BANA 3MKYB 3O3FA 2UUBK 3GXOA 4DUYK 3EKUA 1FBSA 3KKRA 3VYTB 4BQAA 1NK4A 1K73O 3WHBA 3MCPA 2R7FA 4ID5A 3TOBA 4C3JJ 2Z16A 1KU2A 4LK1F 4R1HA 1Z7UA 4Q48A 2VUMJ 5FPNA 4CBUA 1W5TA 1FWZA 2Y9ZA 1RTIA 1RT1A 2IS3A 2RC4A 3TI0A 2QENA 5M1NA 1NK7A 2AXLA 4CUGA 4BG8A 4HW0A 3UB5A 4OKEA 2BY2A 4AD9A 2BOLA 3ATVA 2KQRA 4O5FA 4MEYF 4RW4A 4Z4HA 1WN7A 4AM7A 4L8RB 1QO0D 3F5TA 3S3MA 5AZIB 3CF5L 2B7EA 2DJIA 5AONA 4BE0A 1MJ9A 4V2GA 3MAQA 1LKXA 4GNIA 4EAHD 1TP4A 1L5UA 3AAPA 1IN8A 4DTXA 3FIWA 4KT5C 4O4GA 3WUHA 4EJWA 3K59A 3BR2A 2P9PB 1ZGWA 2P9LA 3WU1B 3SUQA 3L2RA 2ZXIA 4CZEA 1UFMA 2MABA 4OO1J 2GM4A 5IOYA 5DM6L 2NXNB 5DUKA 4ZDLA 3ERMA 2MW8A 2RQPA 3ISNC 3L6QA 2CUZA 5AQMA 5EXWA 2GV9A 1FNNA 3BTJA 3PQKA 4DW6A 2TCTA 2DI3A 4FSVA 1N36K 1YTUA 2HHSA 4B44A 2XAJA 4PA1A 2G0EA 4CCJA 4WFBL 2WAEA 4O5BA 3KKSA 2UXBK 4G7OF 1LEAA 2DFEA 3LFUA 3E7LA 2VQFK 4E7IA 2JK3A 3RDIA 2KFDA 2E8AA 5CVVA 3BZCA 2QQ9A 1U6ZA 3CTAA 2IBDA 3WXJA 4CJKA 3TARA 4XRMA 1Z77A 2PYLA 1N33K 4U7DA 4FO0A 3E6MA 1RGIA 1ZG3A 2E7XA 3A1YA 1LWFA 2F4MB 4EHTA 2QWQA 5AZIA 5CE3A 4YHHK 2G8HA 3ZN1A 4FX4A 4E7JA 1MMDA 3ZSYA 2F6CA 2CV2A 1OQYA 4CGZA 2MG4A 3OOUA 4BXUA 1BIUA 3E9OA 4OGCA 3R8EA 2I8DA 2LH9A 4O3MA 2GELA 3QPTA 1J7KA 5BPDA 2O6GE 1SL0A 1RKTA 2DMNA 3M8EA 1QQOA 2ESNA 1VQ8N 3I5UA 2WONA 1TLHB 2F96A 4D1QA 1T08B 3HJEA 3SZ2A 1HPZA 3JRFA 1NG6A 3CJNA 1MD0A 2E2JJ 4HUEA 1R5HA 4NQWB 2R7ZJ 2M87A 2VT2A 1VSEA 4PFOA 5M5YJ 3A8YA 3NVKA 5L3GA 2QWMA 2JA7J 1IC8A 2V6EA 1SS6A 4NCGA 4E1MA 3RR7A 1JXEA 2RN2A 3CJCA 4DQSA 1W7PB 4F3QA 4B8AB 4LSNA 3V4IA 3RPUD 4LIVA 1A5XA 3BG5A 1XMQK 4BJ5C 3BPXA 2Q8KA 4CI6A 1TQMA 4W5TA 3NHGA 1WSJA 2MLKA 1S72I 4NC7A 1IRGA 1T98A 3O6BB 4RMNA 2X74A 3NH1A 4G12A 1D8KA 3A0BC 3TO9A 4F4KA 3QYFA 3MN9A 3BQZA 3JSMA 2X48A 5JI6A 4CICA 1X9SA 3OYJA 4BRDA 1OCCH 3VOVA 3SK3A 3VQDA 4BRHA 5C42A 2CUFA 2FBIA 1NK3P 2EINH 1JLFA 1OYYA 4FOIA 5F04A 4XRSG 5HDKA 2HQ5A 4A3EJ 3O1WA 4IFEA 3CMEI 3K1MA 1B4AA 3BLYA 2BY0A 3PIOF 2E2IJ 4UUSB 2Q2EA 1W5SA 5KCMA 3OWTA 3X2QH 2MH9A 2VKVA 3EZ5A 3ZN0A 2DMQA 2M8GX 4KHPK 3FE1A 1QSYA 2IAIA 4BXFA 5CPRB 2WC9A 1Q82O 4FL9A 1ZC6A 3W2WA 2X6WA 4B9QA 3CCEI 3LDOA 2ETHA 3A02A 5HVQC 4CJ7A 2HW3A 3AO3A 3KLFA 1OH8A 1QNTA 3DF8A 1C0FA 2J5PA 3HP6A 1S7AA 1K9MO 3D1NI 4E70A 4YRVA 4CF8A 3DLLF 2R7DA 4OU0A 2ESHA 2M5WA 4UUTA 3V7RA 1RBTA 2QW9A 3G1LA 4CZCA 4BGBA 4BR7A 3TO7A 1JUPA 1SFEA 3MDQA 4Q47A 4IRGA 2XY6A 2XUBA 2K4BA 2HVRA 1PUFA 2E20A 2WFBA 3DMJA 3Q7CA 1V3FA 1M1EB 2L2OA 1JLQA 4Z6YA 3G4SN 2XGEA 2QA4I 3O9UA 3ASOH 4A3CJ 4B3AA 4B1ZA 4CGFA 5J1UA 3P5JA 4AHSA 5C24A 3TSUA 1KFSA 2NRWA 1WFXA 3ZSVA 2FMLA 4FWNA 2HYJA 5AQSA 1XG1A 4HSTA 3C6UA 2VJJA 5CYVA 1ORKA 4M41A 4JNEA 4CK2A 5BRFA 1QVUA 4DR4K 2CQ7A 1TBXA 3Q0UA 3LZJA 1NJWA 3CESA 3I59B 4IVNA 4F52A 3L3VA 1X3WB 1VQNN 3E66A 2LLKA 4JI8K 4P1WA 2HQAA 4KNYA 1JCEA 4KB0A 2LDUA 3ZT3A 2W48A 4WFNL 3DLEA 5HDNA 4A62A 3FF5A 2IT0A 4MFEA 1BOAA 4BHBA 1RIOH 1A5WA 2Z1HA 2WTUA 1NNEA 1SVMA 4RWTA 1VQKN 1TWFJ 4I0AA 4CJSA 1R23A 3LAJA 3DQVC 1YW7A 2HVQA 1YI2N 1USSA 1JJ2M 4JKCA 1HKCA 3RMDA 3O3KA 4D7NA 3HK2A 1ETXA 3OL3A 1FT9A 1U47A 2AO9A 1R36A 3TU5A 3S15J 1DPRA 2FC0A 3Q5FA 3RPQA 1N77A 1U04A 1V4RA 3OS1A 2L01A 1JE8A 3ZPLA 2P9KB 3L2CA 3K2ZA 2JWTA 5M1PA 3IRQA 4GDFA 2ZSHB 4M3XA 4J2EA 3IH3A 1FYKA 1SZ2A 2XAQA 5E20A 3O9QA 3M8FA 2XIGA 2VC1A 3HSFA 3THVA 1X19A 5AQFA 2LTPA 1XWLA 2JVHA 5M1QA 4BY9C 4E7KA 5IT9K 2FSNA 3TSQA 3VA3A 4B1XB 1J9IA 3AVCA 4CA0A 4J2BA 3CQYA 1V5EA 2JPCA 5TISC 2MSYA 4WF9L 1GT0C 2WAQA 3SBGA 4DB3A 4CCKA 3ULQB 3K70C 4FISA 3H08A 1SD5A 3F23A 4DV7K 4M9SA 3TDZC 2Y69H 4NB5A 4PSWA 1VQLI 3ZT4A 1HR0K 3VSLA 2HI3A 4C2TA 4DYQA 1HMVA 3H36A 1V55H 1B9NA 4PSXA 4XKBA 5EEAA 5IYDJ 5KAIC 3DWLA 4CO8A 3D0PA 4B1VA 1G3WA 1MU2A 2YU3A 5AQTA 3CCQI 3SZTA 3LM2A 3A0IX 1U49A 4K8ZA 3DXJF 1QGPA 1BO5O 1NGFA 4BR2A 3V9ZA 4C3IJ 1JJ6C 3S9HA 5GAGP 3DBLB 1QTMA 2FOKA 2R7VA 1BJAA 3RMCA 1ONVA 1WSUA 3T1YK 5HRNA 5BN9A 2UV1A 3O6WA 1QPMA 4XLCA 1H88C 4J2DA 5EU7A 3LL3A 1WZ2A 1KQSM 4CERA 1MJBA 5E79C 3CCMI 2KDOA 3KK7A 1E4FT 3FZFA 3IDHA 5C10A 5F0FA 4PQUA 3G2BA 4AIHA 2P7CB 4KYWA 2LSNA 1LDJA 4A5AA 4PHTX 2HS5A 2OPTA 2QWNA 4DQ8A 1DLOA 1D9FA 1X1AA 2CV1A 1T33A 2BYVE 3F8FA 4I2OA 1O57A 4FWRA 4YOUA 3QAHA 2VBYA 4GYGA 4PFPA 3JS6A 1KVBA 4CBWA 5FD5A 4H0OA 2LFBA 3VTHA 4CF9A 2QKLB 3QEPA 1ZYRF 4FJJA 4CJVA 5HOOA 3T69A 1YE9A 3I56I 1BL3A 2AHQA 4K42A 1TAUA 2VG6A 4BQZA 3G0ZA 2YI1A 3L2QA 4A57A 4XLNF 1NGEA 2PBIA 2CH0A 3IRXA 3NE6A 4O44A 1XDSA 2CW8A 2KRCA 4J19A 1LOTB 4MFDA 3RQIA 4B9UA 4MHGA 2BW3A 1YOVB 1YJNI 3SNNA 4IFVA 2D1HA 4LF9K 1KU7A 1KD1O 3GLLA 5D3GA 2IA0A 3HC7A 1B8IA 1J9AA 3B6AA 2EB7A 5F08A 2BV6A 3PO3J 1WVRA 1LAWA 1QQMA 1RT7A 5BRHA 3PX4A 1ATSA 4UQGA 4F8RA 2O8FB 1ITYA 3DXMB 2P5VA 2Q36A 3F6OA 4CZLA 2K9SA 5LBQA 3PIOL 4AF1A 1BC7C 2DAOA 3O3HA 2L9VA 1P4WA 1VQOI 2K3PA 5EVZA 5DM7L 4KTQA 4FLZA 5EEHA 1G3SA 2EFPA 2F48A 1R1UA 3BY6A 1WJDA 2VKEA 4V2FA 2WV1A 2RF2A 3H6EA 3M8PA 4Z4GA 2IVPA 1ATNA 2R7OA 4A0XA 2IA2A 2PQ8A 3CUOA 3AA2A 3JRIA 2E7WA 4Y15A 4FK0A 1YITN 5J2NA 1K6OA 3MZYA 4CESA 2ZJ2A 1IV8A 2IEKA 2A6TA 2HDWA 1X4OA 2LG4A 1ETKA 5LGTA 2CGJA 2Q2RA 2HBLA 5KQ8A 4YOWA 1TL1A 4H5TA 3QYBA 2R7RA 2HMIA 2FD5A 1T6DA 4KHWA 1XN7A 3FMSA 2R4GA 2M0CA 4A0ZA 3QB0A 3VGLA 2JTVA 3M07A 3NAUA 4XKCA 2ADUA 4E6KG 3VQ6A 2OV7A 5FD6A 3Q0VA 2AS5F 3U8XA 1RTDA 4KTZA 4PKGA 5EGOA 3FXMA 2VODA 2YPRA 1FZPB 3I4NJ 1G2HA 1J5YA 3J7ZI 1JI8A 3P31A 3VN5A 3VQQA 1YUWA 1WBBA 2ACJA 4DLEA 1REVA 1STZA 2YHBA 2IPQX 1FP1D 4J01A 2EZHA 3GTLJ 3DLGA 4DLGA 2MFZA 2DFFA 5HLGA 4A3LJ 2P9SA 4FW1A 1IN5A 1NBWA 4NYFA 4CZKA 2G8KA 2GA1A 2RPIA 1VI0A 4N0BA 5EYRA 3IRRA 5IYBJ 4LGWA 5IP6A 1LAVA 2GIZA 1C0UA 2L4AA 1UWBA 3VWBA 5D8KB 3S1MJ 2GIVA 3VFZA 1WQ2A 3BQYA 1KU3A 2V52B 3WTSC 4CJPA 2O8CB 4DBQA 4OIOF 3OJSA 2O9LA 1LQ1A 1TGOA 5J6XA 3WTUC 4DTJA 1O3QA 1D5AA 3TAMA 1WOQA 2R7UA 4BC2A 3LDSA 4BHCA 5EG0B 4FM1A 3OYEA 1T05A 2O8DA 4L5IA 3OW2M 1MIJA 4S0HB 5LEJA 3S2HJ 4C9YA 2X6SA 3EKSA 2M4KA 3IC7A 1CF7A 1S29A 4CF2A 1WPKA 2H6CA 2NRVA 1LWEA 3G1MA 2ZJRF 4F9OA 2BDPA 3SHFA 3TKYA 4Y1CA 4A3IJ 4KN4X 2E6MA 3HRMA 3P39A 4IXAA 4BS9A 3I8DA 2CW7A 3AVHA 4DR3K 1H8AC 1BWFO 4M3RA 3I56N 2EA4A 1U2VB 4Y1DA 4HX7A 3SZPA 3LWMA 2FSWA 1RT3A 2KJCA 4BJTA 4D5CA 1WAJA 4OPJA 4KMUX 4FASD 1X9WA 4RB2C 3MX5A 2WBNA 3OYMA 4WXHA 4KICA 4RB0A 5JICA 5HS7A 4BE1A 2XRLA 4XOPA 4FHTA 3UR3C 3AVMA 1XPXA 4CZGA 3C6TA 1Q8IA 3OS2A 4LK0F 5GAGJ 3NF9A 1XD7A 4FJKA 4A3BJ 2VQLA 1DQUA 3R61A 4JP0A 1XCBA 4I02A 3JRBA 3AVIA 4II2A 3VQ4A 2RHKA 3QEXA 4R8HA 3ZMUA 2Z1JA 1RFQA 3KTQA 3QNNA 1JLGA 1RBRA 3CC7I 2YHWA 3DXKB 3QDKA 3VEYA 3V42A 1TK8A 2GWKA 4UV8A 3WTWC 1ZR2A 2QUFA 4DTNA 1ESVA 1ZBLA 4UUVA 1IG8A 2FLOA 3D2EB 1ETOA 1Z6TA 1FBUA 2CW0F 4HG2A 3FBNB 2D0AA 3IG1A 1OYIA 4UY8I 3LP1A 5H6QA 3U6FA 1ILYA 5FFXA 2L7FP 4B47A 3ALYA 1YRNB 3QFUA 2HU9A 5HNFA 3F3XA 2BXZA 4BR5A 4HX4A 1XQSC 2O0YA 2ITGA 2ICWG 5L3DA 3AA3A 2NLXA 1JT6A 3SZGA 3U1DA 3BG9A 1CZAN 3MKLA 4HX8A 3ZXSA 1Q86O 1BI1A 3TL4X 2NRTA 5AQJA 1CXUA 3LAKA 4Y52J 2GUPA 5BRDA 5BMZA 3HBLA 3KZIC 4CJFA 1AU7A 4XSXF 4N47A 2LNBA 2RN7A 3S8PA 2L0KA 3OIPA 2CH6A 3NH2A 4DTOA 1TAQA 3ZQ7A 5ICCA 4CYCA 1U5TA 3WEEB 2EK5A 3LSGA 4BRPA 1BHLA 2OYQA 2IVOA 2L9SA 1QE1A 1JKRC 5B8HA 1NK0A 1FJGK 1N5YA 4JHDB 4EJOA 4IHTA 3HOYJ 1WRJA 4BY7J 1MJAA 2ZFUA 1TW3A 4XN0A 2R5YB 1YJ9I 2K9MA 4I01A 1WCMJ 2X9DA 4JYKA 1XNRK 4NHJA 3M4OJ 2HR3A 4EP4A 5B1BH 2CG4A 1KVCA 4ICLA 3L9FA 2NVTJ 1W7PD 2GOMA 1MBFA 4HYEA 4Q5VA 1ON1A 3O4WA 1BQMA 1HYSA 2OU2A 1NK5A 4I99C 2OTJN 2PG4A 2X1CA 2V9VA 3GO5A 1XMXA 4DSKA 3EDPA 2DQRA 4CF1A 4BREA 1VQ7N 3JSPA 3ID6A 1T0FA 1SMTA 3ZETA 3ZSWA 4DMNA 3J81Z 2X51A 3KP4A 2GOXB 2CH5A 3FZHA 3N05A 1T39A 1MA9B 2PEXA 3ROUA 5C2DA 4XLPF 5AFUH 3OY9A 4JK9A 2KL4A 3U21A 4DQRA 2QWLA 4DTMA 2W24A 1X3NA 1BR4A 2M4GA 3DPTA 1HW2A 3GTQJ 3L0QA 4CEBA 4X64K 3KYLA 4M6XA 4JV5K 4DS4A 2XPVA 5DUIA 2IAJA 4C3HJ 3IS9A 1SFUA 4CIEA 4IEEA 2BHZA 5CR4A 3H5AA 2ZJQF 3TSPA 3PV8A 1HSJA 3ASMA 3K5OA 4WQ5A 3Q9SA 3BWGA 2V4JC 4FLUA 2QGUA 2H1KA 4BH9A 5FRMA 1S8NA 1C0TA 1IBMK 3EZWA 4BVPA 2FQ4A 1R5GA 2XF5A 3C7JA 1JKQC 2WA0A 2HEOA 2CRGA 1J2XA 4BACA 1VQ4I 3J7AY 1HDPA 1FSEA 2K86A 2M45A 1BA1A 4NYNA 2K4JA 5DEQA 2LP0A 3BUZB 4KHNA 4FYDA 4BWMA 4RG8A 5D5XB 3L7WA 2GWJA 3QICA 3LDLA 2WB1N 3IKTA 1G4DA 3GTGJ 3EL2A 1XDUA 1PUEE 3DKWA 4LB5A 4FXDA 3KK2A 1FKPA 1TW2A 2K9LA 1HA8A 3HHHA 4E7LA 3CERA 2K85A 3KP2A 2LYCA 3GEZA 2NVXJ 3LM9A 1NJYA 4R5PA 4BDYA 3HPHA 4DV4K 1NGIA 4E0DA 3DU6A 3QYEA 3C6AA 1X1CA 3EUKL 4IXCA 3QOPA 2ZNYA 1DP7P 1KQ8A 3CDIA 3A01A 2VI6A 5EX5A 4ZZDA 3B8AX 4Y13A 1NG9A 4MQVA 3WE2A 4M3UA 5M1FA 2XGXA 3D5LA 1MSEC 3WU0A 2EX3A 1HNWK 3V7SA 3AV9A 3EUHC 4CJRA 2EBIA 2XKOA 4HDVA 3DLLL 3D0SA 3ERED 3GG4A 4FVMA 4YOXA 3PJRA 3UKUA 4JN4A 1W36C 1N78A 1NG7A 4A3MJ 3BPVA 5FFZA 2CO5A 4B1UB 1IH7A 3CCRN 2ISYA 3AG1H 3E0JB 2E35A 4I7HA 1DKGD 2GUIA 3KZBA 4LC9B 2HHUA 4JK7A 3LSRA 1HQUA 3L2VA 4PK4A 1Q1VA 3ENOA 3CC2I 3JREA 3RIRA 4C1NK 4JKHA 2PJRB 4IO8A 3SMSA 1OR7C 2CQQA 4OIRF 3JR9A 4BU2A 3ZP5A 5K5OA 1VFCA 2HZDA 2B9SA 4IDKA 1RRJA 1O7FA 5FLXO 1VQ9N 3DLBA 2YX4A 1ZRFA 4BRKA 2F5FA 5BN8A 5GADJ 1FMVA 2NAZA 3RKYA 3G73A 1MDUB 4M63C 1CGPA 4R79A 3PIPL 1UA0A 1NKCA 1SKRA 4BUPA 2O5RA 4CFCA 1RT2A 1TKTA 2V7YA 2WAQN 1LVAA 4ENJA 5B1AH 2KZVA 4OIPF 4WE1A 3UE5A 4X6AJ 4OJRA 4F91B 3JRDA 4O0JA 2O8CA 1YVUA 1QZYA 4YFKF 1VSFA 1UA1A 4FWSA 2HPIA 4AUXA 3D5SC 3HM8A 3THWA 4TSXA 3S32A 5F1JA 5J1YA 3DAWA 1OJLA 4JD2A 4ETSA 3J80K 3HOXJ 4ESJA 4YEJA 4IHXA 2ZXWH 3KEQA 2TRTA 1T8IA 3MFKA 4RGSA 4G9ZA 3REOA 5CVIA 4EMSA 2VJ4A 4RGUA 4A6DA 1VSIA 2VC0A 2OPSA 3UKUB 3TOAA 3K4CA 4G7ZF 1RDDA 4L18B 3VQEA 1NH3A 3J81O 4JI1K 4AYBN 5EDNA 3WQTA 1RDCA 3TAPA 2WV0A 2VBWA 4ZH4F 5MLCQ 3O4QA 4I9QA 2PZSA 2EFQA 3NBPA 4BQLA 3CFRA 3AO4A 3WGGA 3JRAA 5SZTA 3DRSA 3QPHA 5C15A 3U3YA 1MNMC 1W0HA 2P5OA 3SFZA 4FE4A 4EJVA 4BRNA 2DJNA 3CUQB 4KH6A 3EYIA 1GLLO 1S6PA 5DCMA 3QFPA 3R1XA 2L4MA 1XTAA 3ZQGA 4I6ZA 1ETWA 3GZ6A 3CCVI 3S1QJ 1NK6A 2O8FA 2QQ8A 1DP3A 2BE2A 4YIRX 2OPQA 3W2AA 1UMQA 3H92A 5DM7F 4LSLA 2CWEA 4CIFA 4HTUA 1IXSB 4JI5K 4GKKK 1TQIA 1QZ5A 3U9ZA 3ZSXA 2QQAA 2D5RA 4RAGA 3PIPF 1HYVA 3GLXA 3SJJA 2WTEA 3TBIA 4DNCA 4XH5A 4PUSA 4BDPA 2F5CA 4RW8A 1BI4A 2D4WA 4M7XA 3J7AP 2R7XA 4B9LA 5JVTA 1YO5C 4U7BA 3DRPA 2YR2A 3OR1C 2RKHA 5L3CA 1GLJO 2OANA 5LRSA 4PGHA 4B1WB 4XSZF 3KVGA 5TRDA 3A4CA 3CCUI 3VQ5A 3T8RA 2P9LB 4CIGA 1T95A 3TTDA 4JI0K 4FJ7A 1J75A 3IAS2 3KLOA 2DQLA 3SAGA 3N4MA 3MEGA 4M72A 2ATQA 3H46O 1KSPA 1QVFM 4FW2A 1BJZA 2M1BA 4QS9A 2KLAA 3RI4A 3B6OA 3TPQA 2TDXA 5T7BA 3QEVA 1YJ9N 2RAEA 1IRXA 2P9PA 5AQYA 2W82A 2XKPA 3KP3A 1H0MA 1WNSA 3AVFA 1YW9A 1REPC 2KJBA 1SAZA 3K58A 2EIMH 3DM2A 4M6VA 4GGGA 4A6EA 2G7UA 2ZXJA 3TAEA 4DYRA 2PYJA 1I3AA 3GFIA 4BVOA 3G71N 3ISPA 1Z7LA 2YSRA 1IKVA 3TAFA 1JTXA 1WJAA 1LW0A 2R92J 3V7CA 5HNHA 4L0ZB 4AYBA 2ASPA 2ZF5O 4CGGA 3W2VA 3TO6A 4UB8C 3WTYC 5I9EB 4IOAF 3LSPA 5AQIA 3C2GA 3O80A 3CC4N 3NF6A 4FPBA 3IKVA 3ZSOA 3QNOA 2QQBA 4CCMA 3DLKA 4MLOA 1RI7A 5D6EA 5FPEA 4XLHA 3IMXA 5AQLA 1QRYA 1G6NA 2YX7A 3HRSA 3K0LA 1UELB 5CQGA 3M8SA 2KMUA 4ID1A 4IDHA 5HS8A 1ZLJA 5EJCA 5CYQA 3LQRA 3GYHX 3CO7C 1Z0XA 3OBYA 2XY5A 3WXLA 4LF4K 2FBYA 3DV8A 1E3PA 3CDLA 2Y0SN 2ETJA 2VGNA 3T5XA 2GQQA 4QTRA 3ZOBA 4ZZLA 4W5QA 4JKGA 2QWPA 2IGOA 2LSOA 4CGHA 2LKPA 3OYKA 4NQWA 4BGAA 5CJ9A 4N76A 2ME0A 1L0OC 2FBVA 3L8BA 4U0YA 2D1VA 3PNTA 3NWTA 2H8RA 4V19K 1MGTA 3V4GA 3QLHA 5FPMA 2QF7A 1BW5A 1VQ6N 4MO4A 4KB1A 1SANA 5JHFA 1P7JA 4E4HA 2LF8A 3FFIA 1NGCA 2JRTA 2M0MA 2JA8J 2B5JA 2P9IA 2FRHA 3MXJA 2QTDA 3E97A 2HYGD 3SMPA 4A59A 2M8EA 4KPYA 2NNNA 4JX6A 1V4SA 4LFAK 2IA1A 4KRFA 4CXFA 3I53A 4JI6K 3QP6A 3ZMDA 2DPUA 1A5VA 1DGKN 2A68F 4B09A 2K9QA 1P9QC 2NS8A 4XL9A 4F92B 1H1VA 2FSJA 5DMRA 4X66K 3HYIA 3ABTA 2VN2A 2KRFA 1PP7U 2A42A 2AA4A 3LPTA 3IAM2 1IV0A 4KN7X 3V9UA 2OPPA 5FO5A 4BHPA 2COBA 3T19A 4KKOA 1QQCA 3NAEA 2A3SA 2DA4A 3FZLA 4BXXJ 1ZTRA 4XLFA
chains in the Genus database with same CATH topology
3ZT2A 2GBZA 4IZZA 4RM3A 4BJ6C 3SEZA 3OVNA 2Q2EB 2IS2A 1NKBA 3IUOA 2VG5A 1G8XA 4ZTFA 3C94A 3HL2A 4RLQA 4B08A 4BEHB 3GBGA 3VQAA 3RR8A 3RWUA 4FM2A 1KONA 3NDKA 1NK9A 4DSJA 4DGWB 2VPLA 3ZGKA 3U3GA 3PL8A 1RNHA 2R7SA 4CEEA 3DLAA 1MMNA 3AVAA 4HVJA 3DLHA