1T0FC

Crystal structure of the tnsa/tnsc(504-555) complex
Total Genus 10
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
10
sequence length
49
structure length
49
Chain Sequence
IKVVKPSDWDSLPDTDLRYIYSQRQPEKTMHERLKGKGVIVDMASLFKQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Transposon Tn7 transposition protein tnsA
publication title The carboxy-terminal portion of TnsC activates the Tn7 transposase through a specific interaction with TnsA.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Dna binding protein
total genus 10
structure length 49
sequence length 49
chains with identical sequence D
ec nomenclature
pdb deposition date 2004-04-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF11426 Tn7_TnsC_Int Tn7 transposition regulator TnsC
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.960 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Arc Repressor Mutant, subunit A 1t0fC00
1T0FC
chains in the Genus database with same CATH superfamily
2TRTA 3BR1A 1DU6A 3WTWC 4I7HA 5HNFA 2EV5A 2HKXA 5D4SA 2H6CA 2V6EA 2E1OA 2JUCA 2CS3A 3FXRA 1PP8F 1LJ9A 5D6EA 5E1ZB 2ZJ2A 5DS9A 2STWA 5LHGA 5J6XA 1FP1D 1O57A 4PGHA 3VOEA 2DFHA 2DAOA 1WH5A 1YG2A 4GYGA 2LD5A 3J7YJ 2DBBA 3EQLF 2LLKA 3CUQC 5ILVA 3A01A 3TQNA 2ELJA 3FX3A 3BG3A 2HYGD 3I59A 2VOPA 3KZYA 3MKYB 5DCFA 4XOTA 1D8KA 2R7UA 1Z7LA 3NWTA 3RKYA 3CCLI 2WAQN 1YRNA 2A07F 1S5LC 2O7OA 3SFIA 1YX3A 4UUSB 2R7XA 2X51A 4HDUA 2IGNA 2DODA 2ZSIB 1S3JA 2DMTA 3AL0B 2HTJA 4NHJA 2IT0A 2L5QA 4XORA 2Z3YA 4YRVA 1YHQI 4I09A 2EILH 3R4KA 5HLIA 4XQFA 3GFJA 2HOTA 1IJWC 2DQLA 3OYFA 1BR4A 4BKXA 5K5OA 1JT0A 1F4KA 5HS9A 3CC4I 2E5ZA 1U3EM 4XLHA 5J1RA 3K2ZA 3JSOA 2LFBA 4IZZA 1FSHA 1X3ZB 4OOIA 3ISPA 2HOSA 3BZCA 2OD5A 4V2FA 2QBYA 2WAEA 3DXJF 3CC7I 3VYUB 5HLGA 3LWFA 4EGYA 1H89C 3QAHA 4E7ZA 2GIVA 2JA6J 2QWWA 1R5ID 2KP6A 1VQ5I 3TOAA 2R7FA 5LHHA 1VQ8I 5FD5A 5IP9J 2IS2A 2BVMA 3FKIJ 2MC4A 3PNVA 5E8GA 4AIJA 1JUPA 3K4LA 2L9RA 4FX0A 3RI4A 2F5VA 3CMYA 1HW1A 3CCEI 1ZR2A 3R6SA 5B1BH 4ESJA 2R3SA 3MN2A 1IN5A 2VODA 2IS4A 2AO9A 4GYIA 3GLXA 3V8LA 2AXLA 3CUOA 5FKKA 1ZR4A 2E1MC 3LFKA 2M9HA 4ITVA 5F0FA 2J5OA 2XGCA 3JSPA 1V4RA 1W5SA 1WRJA 1A6IA 2WB1N 1SD4A 2DA7A 2HFHA 5EEHA 1K4SA 3T8RA 2R7DA 4ZZLA 1PVEA 1XDSA 1OYWA 3DTKA 4KA4A 2IA1A 2NVYJ 1OCZH 3K69A 1P7IA 4CDGA 3KP7A 1UAAA 2V26A 2ETHA 4U0YA 3A0BC 3PO3J 1TBXA 4G94A 1ZH5A 5H20A 4EJVA 2E1NA 1RESA 2COMA 3QOPA 1BJZA 3CUQB 2HS5A 3DBLB 1R58A 2PMHA 5HLTA 2OTJI 1FYMA 1B1BA 2GZWA 4I0AA 3ULQB 3WU0A 3JAMK 2NOGA 3OL3A 1G3YA 4QSHA 3RIRA 4EATA 2VC0A 2V1DA 5LRSA 4M3DA 4V2GA 3CF5F 2E60A 2PJPA 4RMNA 3E6CC 1FX7A 2DDBA 2OQRA 4B47A 1EV7A 1ZLJA 2XASA 5IY5H 2ZO4A 5KHDA 1WJBA 2DI3A 2A68F 3LSRA 3OYKA 4IQ4A 5IT9Z 1ZARA 5JHUA 1WCMJ 2IGKA 5C3EJ 3G3ZA 3CC2I 1BW6A 1S8NA 2A6TA 4GCVA 2XHKA 3DKWA 5M3FJ 1UJ8A 4G6QA 1H9GA 3P5JA 1QPMA 2K3FA 2P81A 5J1UA 2HPMA 2ZB9A 1ETXA 2R7SA 1BI0A 4G6DA 2Y75A 3MCZA 4H4KC 2QSHX 2V1NA 2NVQJ 3SJMA 2JT1A 3RKWA 2NNNA 2K9LA 2OTLI 4U0VA 5E3LA 4Z6YA 4RM2A 4EM0B 1IRFA 5E1WA 4XKCA 4DBRA 4HNUA 4OIOF 1SVLA 2ACJA 1EJ9A 4E6KG 3KEOA 2FE3A 4RAZA 1ETQA 3H1CA 2K40A 4RLQA 1XD7A 2O5RA 5E3OA 3QPSA 2HXIA 3IKVA 2F5DA 4LB6B 3N97A 1RKTA 1WJDA 1WI9A 3LSMA 3L2VA 1WKMA 2JVHA 5IYCJ 4IRGA 3CCMI 3TP0A 2M1BA 4HF0A 1HF0A 1JGSA 3Q9SA 4AD9A 1LEAA 3F8CA 1MBKA 5F0CA 2DMNA 3HHHA 2DJNA 5D8KB 2D1HA 1X2MA 2Q2EA 1J5YA 2EK5A 3AG1H 2GIZA 4L0ZB 3QODA 1XDUA 2EQRA 3PSFA 3K1MA 4N0BA 1YW8A 3OOUA 1T6SA 3PL8A 3S1NJ 2ZCWA 3GW2A 4C2TA 4RDUA 1LVKA 5B1AH 3HL2A 2VOOA 2OBPA 2ZFUA 3FK7A 3BCAA 2CW7A 4AC0A 3HUGA 2FU4A 4ABZA 1ZG1A 4CUGA 3BG6A 4BACA 1LE8B 3ZOBA 3MKWB 4BE2A 4U88A 5B5EC 1B8IA 2FRHA 2RNJA 2OPTA 5M3MJ 4BU2A 4HX4A 3QYEA 2Y0SN 2KQRA 3NQOA 3GTQJ 1YE9A 3G1OA 2GBYA 2VT3A 5LLQA 1ZQ3P 4A12A 1SD7A 2BXYA 2DJIA 2LOOA 4AYBA 2KJBA 2N8GA 2CQQA 4OWRB 4D0PA 2W84A 4UVBA 4CCJA 4ESBA 5EG0B 2DA6A 5HS8A 3CDHA 4LIVA 2CFOA 1R9TJ 4I02A 2EV0A 4W1UA 5D6FA 3FXOA 1IDZA 2QGUA 4O5VA 4D7NA 1WH7A 4F3QA 3ZN1A 3I53A 4NQWB 2P5LC 3PO2J 5BNGA 1FEXA 3GEZA 3A02A 4XM3A 3TGNA 4IHTA 2A6EF 3WE2A 1N25A 3HTUA 3EUHC 2A5WA 5FJ8J 4JX5A 3ZR8X 2KT0A 3AFHA 5CPRB 3L2QA 1G6NA 2IEKA 1BOBA 2AXTC 3HKZA 1NHAA 3R0JA 3C2HA 1PP7U 1VQ6I 4CXFA 5E17F 2E34A 2Y30A 1G2HA 4ENKA 1SANA 4ZH4F 4XBFA 3V7RA 2PG4A 4C3IJ 5D5VB 3F23A 4NUBA 1IO2A 2IW5A 5TRDA 1W5CC 3RDIA 2A5YB 3BJOA 3OIOA 1BM9A 4FT8A 2IGMA 3IWZA 1BOAA 1ODDA 1W5TA 3K0LA 4A3CJ 3DEEA 2JMWA 5IT9K 3BPXA 4MHGA 5TJJA 1V5FA 5ILUA 3OIQA 4BY1J 5GADJ 1B59A 3NWSA 3H5NA 2XAQA 1OPCA 1U9OA 3SEQA 4AWXB 1AKHA 2XC7A 3OV8A 4A0YA 3CO7C 5BPDA 2L54A 3KLOA 4S05A 2EFPA 4ZDLA 3ZQLA 3ZP5A 1UHMA 2DFFA 4RAFA 4XMYA 2M4KA 5A2QZ 2Q8KA 1BL0A 4ZYGA 1KQ0A 1YLFA 2AQFA 3VODA 3DQVC 3WU1B 4H0EA 4BXUA 3E6DA 4L18B 2R7VA 2WV1A 2ZC2A 2O3FA 1OR7A 2I10A 2LF8A 2F4MB 4YG2F 3FMSA 3J7AY 2X4HA 1T0FC 1YQAA 1FOYA 1WJ5A 3M3YJ 5FD6A 3JRGA 2QENA 4ZZDA 1P6RA 3I5UA 2IJLA 3FXKA 2W1OA 2L01A 4HYEA 2YUSA 4A3DJ 4DOZA 4F93B 3HG9A 3D5LA 2W00A 3UR3C 4D5FA 4D5CA 1E2XA 1ENHA 4LLGF 2DA5A 3BG9A 3TDZC 5IOZA 3CESA 1MBJA 3K4MA 3PIOF 3G6EI 3LSPA 5EDNA 5HDNA 1XCVA 1T38A 1ON2A 3U2RA 3BTCA 5FLXZ 1ETYA 1W0TA 2HEOA 3CJRB 4BHCA 1YYVA 1MD0A 3ZMZA 3U1DA 2MGQA 4IEJA 4KNYA 1JJ6C 2HPIA 1USTA 1VNDA 5L3BA 1GLNA 3IH3A 4KT6A 3SZGA 3ONQA 2WTEA 3PUBA 4D7MA 2P7VB 5LHIA 5TISC 2VQHA 5JLWA 1HSTA 3S1MJ 5BS6A 1MMDA 2LRDA 3QQAA 4Y3OA 2STTA 1ZG3A 3OYHA 3TBIA 2DOFA 4C3HJ 5BQTA 3HGYA 1K78B 5CLSA 4LMYA 4CZCA 2BY2A 4RB3C 3H0DA 2F6CA 3ABTA 3OYDA 2M4GA 3N4MA 2VKEA 1UG2A 2KKOA 3OL4A 2OF7A 1TL8A 3EETA 1WGXA 3K1NA 2NOJB 2ICWG 1FIAA 4EM1A 1OISA 5J3LA 4B43A 5HLHA 3GBGA 3PSIA 5DCMA 3SEZA 5D5WB 6PAXA 4YIRX 3HOVJ 4OAYA 2V7FA 4I01A 4OINF 3W3CA 1GVDA 1RPWA 1UHSA 3C2BA 2NYXA 2KLOA 2HR3A 3L2CA 4MEYF 5LEKA 1RRJA 1R23A 4Q5SF 4UVAA 2V1UA 3GVAA 4LJZF 2ECBA 1IUFA 1A36A 2FQ4A 3JRHA 3HOTA 2CUFA 2Z1DA 4BAYA 4DJAA 2TDXA 3BG5A 1FTTA 1VQLI 3O3KA 3KEQA 5L3EA 1O7LA 4RS8A 1PUFA 3CMMA 3V8KA 2PBIA 3TDUC 1USSA 2L3DA 1ITYA 1I1GA 3DU5A 2EIMH 4UY8I 4P55A 1TP4A 3I64A 3HOXJ 3ERMA 2CW0F 1YIJI 2KIFA 4A6DA 3WU2C 1DDNA 3MKZA 2XDVA 1OCCH 2EJRA 2X6YA 1YIOA 2OJED 4RB2C 3HSEA 5F1JA 3P9KA 4A3FJ 1J75A 1DQUA 3HRSA 1S72I 3OYIA 5IYBJ 3V8JA 1LDKB 5GAEJ 2JUGA 4RGRA 5EEGA 2JRTA 1XPXA 4ASNA 5JVTA 4Y7NJ 4C2UA 5LGTA 1TWAJ 2DW4A 2L4AA 1PUFB 2KDZA 2HQRA 4DQ2A 2AQEA 2DMUA 2HZDA 5IP7J 2KRFA 2PJRB 1O3RA 3PUFA 3C18A 1FBSA 2EA4A 5GTIC 1QHHD 2Z33A 4CGZA 5A2QK 3ECHA 1SAUA 2R4GA 1S6LA 1X58A 4RGXA 3HBLA 3WTZA 1SVMA 3HIFA 1Z9CA 3S2DJ 1U8RA 3F22A 4XRSG 4L5EA 2LG4A 3E5XA 4A0ZA 1W4MA 4HBLA 3F0CA 3H0GJ 3WG9A 1ON1A 2B9SA 2HDCA 4CYCB 2X1EA 3QWLA 4PJMA 4A3MJ 3K4NA 4L9NA 2IBDA 3W6VA 3BT9A 1VQNI 1MH3A 2WWYA 2XGEA 1MNEA 2P0WA 4DNCA 1HKSA 3HRTA 3Q0UA 1ZGAA 5FKLA 2W24A 3SXYA 4DW6A 2D45A 2F2EA 1RIOH 1VQ9I 2EFNA 2L7ZA 2XAJA 2DN0A 3ERED 3M9AA 4NC7A 1K79A 1AU7A 3A4CA 2JA8J 3BTLA 3VPRA 3FMQA 1ZRFA 2UXXA 2F5EA 3DLAA 4XICA 2O03A 4CHUA 3E6MA 1ERDA 2JA2A 4IOCF 5FLXK 3E6BA 1D5VA 2L7MP 2A3SA 5FKMA 1B6AA 1LKXA 2HKOA 5DM6F 3E1SA 3GFLA 3RKQA 2M0CA 2FBIA 4EJUA 1X4OA 2DCEA 2LH9A 3K2AA 4HF2A 4WK8F 4CCLA 1HDDC 4A3EJ 3OS2A 2UUZA 1T98A 1MSFC 5C44J 4M6XA 5K1YA 3K9TA 4GFBA 3S16J 2LP0A 2DT7B 1EH7A 2MLKA 5E20A 2JPBA 1M1EB 2YX7A 3DP7A 1OCRH 2WBMA 2RQPA 3ZCOA 3CZ6A 3GWZA 4ENJA 1YJWI 4L9TA 4B3AA 2K85A 3MKLA 4M71A 2HTSA 3E5QA 3HJEA 1TT5B 1IXSB 3KZZA 1TWGJ 2DMPA 2Y9ZA 4IHYA 1R6RA 2BOLA 5GPCA 1NTCA 5FKOA 1YX5A 2ME6A 2RQQA 3L00A 3H5RA 1POGA 3KZIC 2DOEA 2DQRA 2MBFA 2RN7A 4LK0F 3ROUA 2LY9A 4BDYA 3H9JA 1F5TA 1HLVA 1MMAA 9ANTA 4IRIA 1Y8RB 3COAC 1X19A 3F8BA 2EZKA 3DV8A 4CCOA 2L2OA 2LBFB 3ASOH 3WTVC 1KQ9A 1UZCA 3LA7A 4BXFA 1RR8C 4UUSA 4WWCA 2GA2A 4ZDOA 2X1CA 5IPAA 4N9HA 2QA4I 1VI0A 2M5WA 1XTAA 1D1CA 3K4BA 3G73A 2FD5A 3KYLA 1W1WE 3KCCA 4PUSA 3RPQA 3CDLA 2HQNA 4M74A 4KDPA 2CGPA 4Y33A 1J9IA 4XN0A 1R1VA 3F6OA 2H1LA 5EZHA 3PNYA 1MBHA 3Q0WA 5CYVA 2IA0A 3ABUA 4WXHA 4XOPA 3TW7A 4XKVA 2FJ1A 4CCMA 5KAIC 4Y4RA 3IUOA 1WHUA 3BROA 2O61A 2HZTA 1Z91A 1SD6A 1P92A 2X48A 3ZQFA 1OCPA 1IV6A 1GXQA 3BWGA 4KYWA 5JLXA 1Y39A 2G7UA 4M6YA 1E3PA 4X6AJ 2IGOA 1ZK8A 1CF7A 3BCBA 3BC8A 3SQNA 1BR2A 1MBEA 3RCOA 3CD6I 1XC5A 3DBRB 4C2MJ 4OIRF 4EJWA 1UFMA 3K6GA 3WHCA 3CCQI 1ZRDA 3P9IA 2IRFG 3V42A 2AS5F 2CG4A 1T56A 1J09A 2H27A 3IV5A 3S15J 4XR6A 1LQ1A 4MIMA 1VQMI 2PFBA 2A69F 3K4KA 3CCUI 4PJ0C 1BW5A 1GDTA 3BR2A 2XGXA 4DYRA 4Y17A 4X1EA 5D5XB 2KIQA 1HCRA 4HW0A 5F0HA 1O3TA 2K7LA 1FLIA 4KIFA 2KIMA 1BIBA 4XRMA 2E7WA 5FLMJ 1CF7B 1X1PA 5K5RA 1YI2I 1G3WA 1F43A 1YOVB 4PGGA 1KU2A 2L7KA 2ZKZA 3C3WA 4XLPF 3E7LA 2VKHA 3ESWB 4NDLA 4M3BA 1V3FA 3LA3A 3K4CA 3AG3H 3QP5A 4D9JA 3CUQA 4FISA 5K7ZA 4IKFA 4PJLA 3NRVA 3JW4A 4RLFA 1VF9A 3GTOJ 5J8CA 3CCJI 1SMYF 3CJNA 3GTGJ 5J1YA 1N78A 3BTIA 4PK4A 2R7OA 4NB5A 4BQAA 1DPRA 2P7CB 1B9NA 1ETOA 3C7JA 1E3OC 3SYTA 2VL8A 4BQOA 2A05A 3WE3A 3H9GA 3DBHB 2KMUA 5DDGA 1GT0C 1RUOA 3EYIA 2GQQA 2ID3A 3HPHA 1J59A 4KMFA 4BH9A 1IG7A 2ZBKA 3KX2A 2FUG2 2R7ZJ 5EYRA 4R1HA 3OYMA 2KZVA 5J4VA 3CJTB 3HPGA 2KZGA 4O6JA 3F8MA 4PSXA 5FFXA 1OCTC 2K9QA 2PX9A 4DGWB 3WGIA 4BL0B 4RM3A 3CQZJ 3WTYC 4EMSA 1I3AA 2XGDA 4BYYA 4XNFA 2VE9A 4C3JJ 3GTMJ 4UB8C 4I99C 1IUYA 5GAGJ 2HU9A 3QYBA 4E4HA 4QLCU 2L02A 5IYDJ 2UV1A 5AIQA 1XGSA 1R7JA 1DP7P 2VB6A 1VQPI 5L3DA 4MO7A 1B4AA 3VYTB 2X6XA 4KICA 5F08A 5C4XJ 2ISYA 3S1RJ 2ZMEC 2EZHA 2BXZA 4XLCA 2VUMJ 1NK3P 1XS9A 5LBQA 3QU3A 1KGSA 2PN6A 1WWXA 3LA2A 1CGPA 1N75A 3I4NJ 2DA1A 3CLOA 5FKNA 4Y52J 2P6SA 3CCYA 1NK2P 2X85A 2VN2A 2NS0A 4BNCA 1KQ8A 2ESHA 4XIDA 2GOMA 3L09A 3LSKA 2JWTA 1D5YA 1D1BA 3MD2A 5BPIA 2W25A 1E17A 3K10A 2R7WA 2V9KA 3ZQIA 5CVRA 3VB2A 2XROA 1FWZA 1TT0A 4MEXF 1W7PB 1LDJA 3GTJJ 2CUJA 2L0KA 3DEWA 2XUBA 5K5QA 4WCGA 1Y0NA 2LR8A 1JHFA 2OA4A 2X6WA 4UNOA 3TL4X 1UHWA 3ZMDA 2BVLA 2WADA 2VC1A 2VPRA 3J81Z 3IC7A 2E1MB 1W36C 1LE8A 4A2UA 2LDUA 2OC6A 3QYFA 2H8WA 3S93A 5FROA 1S9HA 3WGGA 3BY6A 2KRCA 2EA2A 1XB4A 1Z7UA 5AONA 3T8TA 2GXBA 4LG3A 4EEFG 1V54H 2JTVA 3SDBA 4GXOA 3JRCA 4BS9A 4B1RA 4N4NB 1BBYA 4AVZA 4XSZF 4MFDA 3NARA 4BY7J 1HC8A 4AIKA 5EG0A 3U9GA 4M6VA 3PJRA 3OYGA 2VBYA 2K4BA 3BJ6A 2L9SA 2XB0X 3WTTC 3GX4X 4II2A 1U5TC 1FYKA 4NQWA 3HYIA 3GTPJ 4AYBN 5H6RA 3CDIA 4D1QA 2D2WA 4JK1X 1D0XA 4XKBA 4LB5A 3DPTA 1JJ8C 2XKPA 4XLAA 5L3GA 1MJAA 1DP3A 5FGMA 2R5YB 2FOWA 5HS7A 3G1MA 2ZXJA 2MD5A 1FOKA 2M30A 2F4OB 1ZKGA 2JZYA 3AAFA 2BYVE 2HVRA 3AG2H 1BI1A 3GZNB 1R36A 1MMNA 1DGWY 3MVPA 2ZMEB 2NVTJ 2VT2A 1P4XA 3GYHX 2Z99A 5ICFA 1LUJB 4RAYA 3UKGA 3L2WA 5DD8A 2DU9A 2Q0OA 4ESFA 2CMPA 3S2WA 3BTJA 1QA6A 4IX7A 3V7CA 1QVTA 1MW7A 4YIFA 4RB0A 4HPQA 2DOAA 4KMUX 2C6YA 1X3UA 4Q48A 2IPQX 1X1DA 3T1BA 2YU9J 3O2PE 5F1RA 4FASD 4I0BA 4QPQA 4HV6A 4G6TB 4DZJA 2OUMA 3ZGKA 2QQBA 1BI2A 1I39A 3I3LA 2MLGA 2WY8Q 3TO6A 2XAGA 2VASA 4F7ZA 1Q1VA 2QYOA 2I8DA 2MC3A 5KCMA 1OR7C 2XVCA 3JRDA 3O8GA 1KU7A 1ZG5A 1QNTA 3I71A 1WFXA 4RGSA 1X1AA 5HVQC 1IAWA 4HX7A 1U78A 1J0RA 3GO5A 1LPQA 2QM3A 2FXAA 2ZFWA 4A3JJ 1K4TA 3S3OA 1Z67A 2ECCA 3F3XA 3QOEA 4HF1A 4EQQA 3S17J 3TEDA 1IZ1A 5D4RA 2CWEA 1G3TA 2K02A 3RQ4A 5J40A 3DLLF 1ZN2A 1C0WA 1LFPA 1OFCX 1S29A 5FO5A 4LLLA 3WHBA 2EH3A 4ZYHA 3C2GA 2QSGX 2EV6A 4U7BA 2EFWA 2V1XA 3BDDA 1BA5A 2G7HA 1LNWA 4GO1A 4HLXA 4A3BJ 2FMLA 1TWHJ 2MFZA 2Q1ZB 3LL7A 5FRMA 1GUUA 2EWNA 4IHWA 1U5TB 1BC7C 4F91B 3V4GA 1RI7A 4L5JA 2LKSA 1UB9A 2CRGA 4UVCA 4L0YB 2VBXA 2XPWA 1WVRA 1FNNA 1HXDA 2LMDA 2EINH 3H36A 3H3ZA 4A5MA 3R60A 4V19K 2WV0A 3EUHA 4A5NA 1I6HJ 3EUAA 3HZJA 2H6BA 3GF2A 4RA2A 3J81K 5LGNA 4A3GJ 2RAEA 3HSFA 4E7SA 3REOA 4BJ5C 5KAFC 1BC8C 2L4MA 1MIJA 5ICGA 2XIGA 3TKYA 3U21A 4DIQA 3OYEA 2MG4A 1QO0D 4IPAA 4C9YA 1OLTA 2P4WA 1Z6RA 4Y15A 5EZGA 3AG4H 2EFQA 1UG0A 1K78A 2HXOA 4AM3A 4II3A 2LREA 3FXJA 1FPQA 2EZLA 2FX0A 3K7AJ 3ZQHA 3RYPA 4OMYA 3OMYA 3EPZA 2ZXIA 3LFUA 4HLYA 3S1QJ 3D0SA 3D1NI 3FK6A 4UV8A 1QU3A 4NBQA 2TCTA 3HGGA 4PFOA 1X4PA 1YTYA 4KISA 4U87A 4HX8A 2LY1A 3MEXA 2QVOA 2XF7A 3KP5A 1CQTA 2HVSA 3TW6A 2R5ZB 3QP6A 2YR2A 3FXUA 1T33A 2VKVA 2MABA 3I0TA 3HRMA 4A6EA 2R7QA 5EGOB 4CA0A 4YFKF 3LQQA 2WAFA 1FY7A 3W6KB 2JSCA 3ZMVA 1JXSA 1XX5A 1VQ4I 3FXQA 4JOMA 1T0FA 2K3PA 3LOCA 1WJFA 1HA8A 4AIHA 1I50J 2XAUA 5LEJA 1ZRCA 3JRFA 2PQ8A 2JA5J 4BGDA 4YFXF 3GFMA 1UELB 1D0YA 1AA7A 1S7AA 3BR6A 5M5WJ 1XN7A 4DBQA 4ZDPA 2Y2ZA 3JRAA 5FLVA 1QVUA 2CV0A 4MTEA 3FF5A 5CVJA 2LC2A 1V5EA 4PDKA 1JKRC 5DUKA 3U1KA 4I98B 3NAUA 5GTHC 2UXNA 3HB9A 4J01A 3QRFF 3RPUD 2YPRA 1KA8A 4JBAA 3Q5FA 3HOUJ 1FBUA 2PJRA 1Z6TA 1BN5A 2LF7A 4M72A 2VJ4A 1IN7A 3OYCA 2NS7A 4FE4A 4XLEA 2HYJA 1K7AA 2DFIA 3KETA 2VXZA 1EF4A 4FCYA 3B6AA 2NAZA 3HC7A 3HOZJ 2VIXA 3ABKH 5EF6A 3LAPA 5C4JJ 5J8FA 4F55A 3K70C 4HOBA 4E7LA 4ENMA 4NC6A 4WX9A 3M1EA 4U0WA 2RREA 4CYCA 3CCRI 3GTLJ 2EIJH 5TGTA 1XGMA 2HOAA 2P5KA 5J4YA 2OAZA 1T08B 1W7PD 2F4IA 1WJAA 3BG7A 4M3FA 2A61A 1U9NA 4ANJA 4CO8A 1TTYA 1O3SA 2DT5A 3HOSA 3FBNB 1D0ZA 4BHBA 1ZHFA 1HSJA 3HSRA 3ZMTA 2H8RA 3RZDJ 5B3SH 3TO7A 3RSNA 4MGRA 1YJNI 4YELA 4BXXJ 2E2JJ 2F5CA 1HKTA 1P2FA 2BY3A 2W57A 1WPKA 4G7HF 3FM3A 1O3QA 3A2KA 5F27A 1FBQA 2G0EA 1ZGWA 3MFKA 1ULYA 2I5UA 3E0JB 4G7ZF 1MSEC 2G9WA 4I6ZA 4IRHA 2K4JA 1RZ4A 4KIBA 3FXLA 2XSDC 1FSEA 2LKXA 1TQPA 4AVPA 4YFNF 1BIAA 1STZA 4FQGA 4HV5A 1XSVA 2ZNYA 1VQOI 1WI3A 5JVGF 3LNQA 2LK2A 2X6OA 1RUNA 3WTSC 1V55H 3F8NA 2KHMA 2ADUA 1QGPA 3BP8A 1Z05A 4LIUA 1P4WA 5M5XJ 1ETKA 4Y13A 4ZYAA 2QF7A 2DK5A 3OYNA 3I56I 3RYRA 1FMVA 2PLYA 3FHNA 2O8KA 3JTGA 1R5GA 1V5GA 4IF4A 4CH7A 2XF5A 2HQAA 4F92B 1Y56A 2XB5A 1OQYA 2LTPA 5CJ9A 5KVRA 1ETWA 2EIKH 5LFAA 4ENNA 2JVGA 4NNJA 3HHGA 2IAIA 2ELKA 2GA1A 1D1AA 4X0GA 4M73A 2BE5F 3BZ6A 4CICA 3ABLH 5IP6A 1H8AC 1ZELA 1RR7A 5E3NA 2RV8A 3BR5A 4E7JA 2B7EA 2K9SA 3ZQGA 1U2WA 3VWBA 3AL0C 2XPUA 4EVIA 1SFKA 2JPCA 1EH6A 2LBFA 3BZKA 1FIPA 1IV8A 2KDOA 2QKMB 1XSDA 1A6QA 4IL6C 4UXNA 1T2KA 3FMRA 1PYVA 2ID6A 2W82A 1P7JA 1IF1A 1I1SA 3DKXA 3F8FA 3IHUA 5EJCA 5EEAA 1G59A 3SHFA 3R61A 2DTZA 3BQZA 1JT6A 1ZGJA 4G7OF 3DKYA 1KYZA 4IHXA 2BHYA 3IKTA 2JQ7A 3JCUC 1A35A 4LOCA 4L9VA 2XSJC 3TOBA 1SFOJ 2CV2A 1ZTRA 2KFDA 4HAMA 2OZ6A 4FETA 4A0XA 3HEFA 5FFZA 2E2IJ 5HNHA 2F48A 2ZJQF 2M7AA 1W36D 2MYSA 4A3IJ 2VLAA 2DYSH 3QU6A 4PFPA 1Z21A 2O9LA 4LK1F 3BR0A 4N9IA 3ZQQA 2M2EA 2OZUA 1F1ZA 3I4PA 4IQJA 2CUEA 3WTXC 2VONA 1XCBA 2V6CA 4BUPA 1QQIA 3F21A 3EYYA 1JUSA 1A04A 2VQCA 4MQ9F 4RB1A 3J80Z 2JN6A 2PMZA 3V7SA 3VFZA 2ZNZA 4ZYDA 3TMOA 2R7RA 2KRHA 2L9VA 1I5ZA 1Q1HA 1K6YA 2BBYA 5F64A 3A0HC 3T5XA 3KYDB 1T95A 1H88C 2CU7A 2QCOA 2V9VA 3MWMA 2PI0A 3RQIA 4G9YA 4A69C 3H3VK 4JX4A 3OYBA 1YS6A 2MH9A 2JA7J 2OV7A 2KISA 1AHDP 3ABMH 2Z2SB 5H2FC 2M45A 2BW3A 2QEXI 5L3FA 3O6BB 1I6XA 2QQ9A 4LITA 4BBSJ 2FBKA 1R5HA 3IP4B 3T0YA 2IS1A 2RNGA 3M8FA 3TO9A 1QZYA 1R1TA 3Q9VA 3DF8A 1R4MB 2BV6A 1DGRM 2D1VA 1MJ9A 2FSWA 1WSUA 4B48A 2KPMA 3OSGA 3AKZA 2KJCA 5HODA 2DPUA 3TP3A 2WAQA 2HI3A 1U0JA 2DXIA 3CMEI 2GM4A 3KLNA 2CH0A 3CP8A 3IAS2 4L5IA 5CQEA 5AIPA 3VYRB 3A01B 3OYLA 2IS6A 2BW3B 1SFUA 2VJJA 1PUEE 2EPFA 3I59B 3DPUA 1OKRA 3HM5A 3IL2A 3HXLA 4BQNA 4BBRJ 2FEZA 3QPTA 4EJTA 3BOQA 1YRNB 2DK8A 4XSXF 1Y1VJ 4ZC3A 3H35A 5CVVA 5ERIA 1MH4A 3G1LA 1APLC 1B9MA 1LDDA 4HRIA 1SAXA 1PDNC 1BI3A 3BJAA 1TWFJ 2FOKA 3FBIB 1GHCA 1EH8A 3CMAI 1ETVA 3E3VA 2ELHA 4GGGA 1UMQA 1F9NA 2FA5A 4QIWN 4EV0A 4DYQA 2IP2A 2E1CA 3SZTA 1AOYA 1U6GA 3PQJA 4UHTA 5CVUA 1HBXG 1R22A 4B44A 2K9MA 1YW7A 4Q47A 1ZLKA 1TW3A 4KN7X 3RPUA 2E35A 4BJ6C 3D5SC 1RC9A 3OR1C 3LSGA 4A3LJ 2QBYB 4WXCA 1T8IA 2M3AA 2B0LA 1FOWA 3N05A 3FKJA 2VBZA 3A1YA 3Q3SA 3OSFA 1DUXC 3DFGA 2H94A 1LFUP 1IN8A 4HEA2 1MGTA 2RKHA 1REPC 1JE8A 5CVIA 3UNGC 1X2NA 4CYDA 2HGCA 1IC8A 4MFEA 2YX4A 4KITB 3OS1A 2WB1A 1LB2A 4HNVA 4HZFA 3W6JB 1DPUA 1A5JA 2E36A 1VQKI 3R0AA 1SD5A 3GUDA 3M1CA 5DV5A 2GLOA 4IJAA 1W7PA 3I54A 2CQXA 2UWMA 4LFUA 2OU2A 4HQMA 2VXDA 1R4NB 2Y69H 2K5CA 2W7NA 4EJOA 4CSWA 2XRNA 3OR2C 1JGGA 5JFRA 4M9ZA 2GAUA 1G8XA 1IRXA 3M07A 5IOYA 4JP0A 3HOWJ 2VQLA 3SZPA 3S32A 5HDGA 5JHFA 1QRYA 4GRIA 2QSFX 4KIGA 2E7XA 4IHSA 3EUKL 5GP9A 1G3SA 2LYCA 2P6TA 3L2UA 1ONVA 3ML6A 1IXCA 2BEOA 3IRQA 2ME0A 1TWCJ 3LSIA 2R93J 2CFXA 3J80K 1D8JA 1TC3C 1FYLA 4NC8A 4J00A 3EDPA 2E2HJ 4ZYEA 3OOPA 1MZBA 4OIPF 1A31A 3LSHA 2BGCA 3WGHA 1Z3XA 1Z3YA 1P9QC 2BHZA 3GMEA 2IVMA 2JJ7A 3M8JA 4M3EA 1XGNA 2Z16A 3WODF 2CQ7A 2KIUA 3LMMA 2H1KA 2R5YA 2XAFA 2X1DA 3P7NA 4IVNA 3W2VA 3CTAA 4PSWA 1WJCA 5KK1A 5H6QA 2R7TA 3VYSB 2Y9YA 4G8XA 4E7KA 1YW9A 2CYYA 2O8XA 2ESNA 5E3MA 1TW2A 1Y0UA 4ON0A 2L9NA 5JI6A 2XKOA 2ZMEA 3IWFA 2CV1A 5E18F 4QWQA 1FT9A 3ZMUA 2HOEA 1FMWA 5CKTA 3M4OJ 5GAHJ 3ECOA 4BQQA 3ZQCA 4ZTFA 3JRIA 5DM7F 3FISA 3M7GA 5HDKA 1FTZA 1P4AA 2B63J 1FZPB 2WA0A 3I9V2 2HVQA 2RGVA 1K83J 4ZTJA 1LEBA 1MMSA 5ICCA 5FB2A 5KNLA 3S14J 4BDZA 3DU6A 1AWCA 4P5OA 1SVOA 3G4SI 4OU0A 2NXNB 2GWRA 4XLNF 2OCCH 4M3GA 3H3UA 3DCFA 2FQ3A 2HWVA 3KPHA 4EM2A 4IXAA 3K70D 4XRFA 2Q2EB 1JI8A 1L3LA 4DYCA 1X1CA 2CJJA 3OYAA 1GXPA 5F6FA 3ZPLA 2ZJPF 4J19A 3LSTA 3GZ6A 2HQ5A 4M9SA 5LRRA 5E79C 2NRAC 2HYFA 2CO5A 3HKZN 3ZMSA 2Y0SA 2LKPA 2QUFA 1TQIA 3GXOA 2JRMA 3H92A 4UUTA 3DPLC 3HUGB 4JQFA 2DTRA 3LAJA 2FF4A 1Z1DA 1B8IB 2M0MA 1BJAA 3JR9A 1TNTA 1Y1WJ 3VSLA 1NH3A 2LNBA 1TNSA 4YEJA 3CO6C 3PIPF 4LLNA 1Y6IA 4GDFA 1SMTA 1MBGA 4HA8A 1RETA 1KU9A 5M5YJ 1VQ7I 1U5TA 3KP4A 1SEUA 3HDDA 3SDGA 1R1UA 2YU3A 3GZ5A 5CQGA 4BE0A 3BPVA 4CCNA 2M34A 1MBFA 4FTHA 2F5FA 4LGWA 3F72A 3GTKJ 1WJEA 2FBHA 2R0QC 1K6OA 2Y31A 1WQ2A 3H5AA 1OJLA 2XF6A 3FZVA 3LSJA 3C1DA 1X3WB 3HRUA 4JYKA 1SFEA 1YFHA 2GXAA 3HTSB 1KZHA 3LQRA 3KFWX 2XRLA 2XV4S 4KUMA 1I27A 2DMQA 3ASNH 4S04A 2DA3A 4E70A 1IN6A 3JRBA 1IW7F 3RJPA 1XSXA 3Q0VA 4WXDA 5E8IA 3DTIA 3F6VA 1OCOH 4E7IA 2RC4A 4W97A 1E0EA 3CCVI 2VKDA 4KT5C 4RGUA 2LVSA 2VBWA 4AUXA 3DEUA 3PM1A 3S3MA 2NVXJ 2DPDA 2JSPA 2QKLB 2DDAA 3I55I 2Y0MA 4FE7A 2DA2A 1RNLA 3WTUC 2R5ZA 4UB6C 2W4SA 1QBJA 2R92J 4XKWA 1G4DA 2CUZA 5EGOA 4XN3A 5FRNA 1AKHB 2YSRA 4RAGA 2KL4A 5DD4A 3JREA 2O6GE 3FXMA 1KYWA 4XLFA 4XK4A 4HSRA 2WY7Q 4MTDA 4TV7A 1SC7A 1J2XA 2MH2A 1WZ2A 1IRZA 3MQ0A 1D3YA 2ZXHA 3ELKA 5ILSA 3OY9A 2J5PA 5JR3A 1XMXA 1Z0XA 2NVUB 1FC3A 3J7AO 1JKPC 2FNAA 1XG1A 4Q4ZF 2WC2A 2QQ8A 5GPAA 4B09A 4I76A 3K4JA 3IAM2 2BY1A 1R49A 1VTNC 4KN4X 4P1WA 2DT6A 2OCEA 1OYYA 1ZAOA 4ZJZA 2D5VA 1YO5C 3FIWA 3E5UA 1ACIA 2P5VA 4K2EA 4XRSA 3G71I 2K9NA 3KE2A 1X1BA 3DTEA 3NEUA 3KP3A 4HNTA 4U7DA 4S0HB 3KP2A 3J7ZI 4HQEA 4P96A 2PEXA 3RZOJ 5LD2C 3L9FA 3BR3A 3GFIA 5D5UB 2P8TA 1PJRA 1YS7A 1JTXA 1NG7A 2BY0A 3OS0A 2BZTA 2DLLA 2MD0A 3B6CA 1R71A 2W85A 3FWEA 1JHHA 1U8BA 4IOAF 3F9KA 3L2RA 4A93J 1FP2A 5E1XA 1ORKA 1TQMA 3FDYA 5F04A 2HDDA 2L7FP 5DUIA 2RVCA 3ZN0A 2V79A 3H9QA 3BLYA 4PJJA 1NG6A 1MKMA 1YITI 2W48A 2Y48A 4XL9A 2VPLA 1FOXA 2V4JC 1T39A 2VE8A 2VQGA 3OIPA 2DA4A 2VI6A 3MMYB 3L1PA 1K61A 1F36A 4AU7A 5D8LB 5LGUA 1HOMA 4KFCA 3PFIA 3QPHA 3W2AA 1VZ0A 4I2OA 1MMGA 3GCMA 1I3QJ 3OWTA 5K7FA 2JK3A 4PCQA 4RBOA 2ZJRF 2E71A 1MNDA 4WF2A 3I4MJ 1UCRA 1EKEA 2YS9A 4AIDA 1GV5A 1MDMA 2NNYA 4OMZA 3CLQA 3IH4A 4JX6A 2CQKA 3FM5A 4LG0A 2GXGA 5K7HA 1IRGA 1QZZA 1YJ9I 2MA3A 1LVAA 4P9FA 2EBIA 2QLZA 4N4OB 1Z77A 3A03A 4BEHA 3I58A 5DCMB 5BOXA 1JKQC 2ZXWH 4L9JA 4MQVA 2M8GX 3KP6A 5IT3A 3P9CA 2K86A 2LY2A 2Z5UA 1E3HA 4B3XA 4CZZA 2E5NA 1QHGA 3D5RC 1XMKA 3OYJA 4UUVA 1IXRC 1QPIA 1JUMA 3CCSI 1TLHB 1XGOA 3DWLE 2Z9OA 4BHPA 4UV9A 2QQAA 3KIOA 3O8HA 1MDMB 2EB7A 2H09A 3MZ8A 3VSKA 3BQYA 3ZQ7A 1W0UA 3IH2A 4LG0B 4YIIA 3KYCB 3S2HJ 2OQGA 1HW5A 3MAJA 3SFZA 2LSOA 1ZREA 3HOYJ 2XAHA 4C30A 1MJBA 4Z2YA 4BEHB 2X0LA 3L7WA 4G12A 4O3MA 1O7FA 4QPOA 1HDPA 5DYMA 1N77A 1HW2A 5DTDA 2CSOA 5BMZA 4ETSA 3ZXSA 1DU0A 1B72A 5DEQA 3CF2A 1GVJA 2QZ8A 4IO9F 3B02A 3B73A 1VFCA 1EA3A 4R8HA 1OYIA 1IGNA 1RKWA 1XMAA 2IXSA 2DFEA 4FX4A 4MLOA 2CQNA 4OIQF 2EZIA 2X9DA 1ZYRF 2AHQA 3VEPA 2DYRH 4LD5A 1O4XA 3VDXA 4OAZA 4CCKA 2COBA 4QTRA 3W2WA 4FHTA 5J47A 3PFYA 2IA2A 2M87A 3RKXA 3K1PA 2VJIA 2A6HF 2E19A 2UZKA 1B72B 1QZEA 4B8XA 1KU3A 3PNTA 4DZPA 3S8PA 3CJQB 4BJTA 3E97A 3RTRA 3ZRGA 4KJZA 2M7BA 2NS8A 3G2BA 5HOOA 1H0MA 3KEYA 3MZYA 4E7HA 1JTYA 3GLLA 2VJ5A 5ED4A 2RDPA 3WG7H 3S3NA 2DO7A 3CP2A 2EFOA 1TZLA 2M8EA 4HDVA 2HNHA 1IDYA 3JTHA 1BR1A 4A3KJ 2K27A 3IRRA 1S7OA 4HG2A 4B4CA 4EGZA 1FJLA 2MW8A 2ISZA 4F52A 2XPVA 4PJNA 1MNMC 1R00A 1GV2A 3JAMZ 5B66C 4P9UA 1S7EA 3M8EA 4PZJA 1H9TA 2O0YA 2ZSHB 1SFXA 5ICEA 2MSYA 2GOXB 4M9XA 3MZHA 2FNPA 1HKQA 4MNUA 1J7KA 4R79A 1HQCA 1L0OC 2PMUA 4HSTA 1Y8QB 2V9PA 3X2QH 5L3CA 3FHZA 1JKOC 1LFBA 2CW8A 4BE1A 2FMYA 2HDWA 1KONA 2PMZN 4IHVA 3QPLA 4XONA 1OMIA 3PQKA 1IN4A
chains in the Genus database with same CATH topology
4CSWA 3OR2C 3DU5A 3S3OA 1G8XA 1IRXA 3QOEA 5HNFA 2VQLA 2V6EA 3S32A 3MKZA 2XDVA 3RQ4A 5JHFA 2CS3A 2X6YA 4GRIA 3EUKL 2LYCA 3L2UA 1DQUA 1LFPA 3OYIA 3LSIA 1LDKB 2JUGA 3C2GA 4U7BA 4NC8A 4J00A 4C2UA 2ELJA 2MFZA 3LSHA 2Q1ZB 3LL7A 5FRMA 2AQEA 2HZDA 1Z3XA 1Z3YA 3MKYB 4F91B 2PJRB 1P9QC 4XOTA 2R7UA 1Z7LA 3NWTA 1QHHD 1SAUA 3M8JA 2R4GA 1YX3A 2Z16A 2R7XA 2X51A 2IGNA 2LG4A 2ZSIB 3EUAA 3AL0B 3LMMA 2L5QA 4XORA 4YRVA 2X1DA 3W2VA 4PSWA 1WJCA 4XQFA 4E7SA 3OYFA 1BR4A 2R7TA 3VYSB 4BJ5C 2X1EA 4PJMA 4E7KA 3K4NA 2E5ZA 3U21A 4DIQA 4XLHA 3OYEA 2L9NA 4IZZA 1MNEA 2P0WA 4C9YA 1OLTA 1UG0A 4II3A 2LREA 2CV1A 4NC7A 2WAEA 3VYUB 3A4CA 3OMYA 3EPZA 1FMWA 2ZXIA 5CKTA 4E7ZA 3LFUA 4ZTFA 4BQQA 3DLAA 2KP6A 1QU3A 1ERDA 2JA2A 2WA0A 2IS2A 2BVMA 1X4PA 3I9V2 2HVQA 4PFOA 2MC4A 3PNVA 1LKXA 4ZTJA 4KISA 4U87A 2LY1A 3K4LA 2XF7A 5KNLA 2HVSA 2F5VA 3E1SA 1X4OA 2DCEA 2LH9A 4BDZA 3DU6A 4P5OA 4CCLA 2IS4A 2MABA 3OS2A 2UUZA 2R7QA 4CA0A 2WAFA 2E1MC 4ITVA 2DT7B 3K70D 2Q2EB 1JI8A 1X1CA 4JOMA 2K3PA 3OYAA 1WJFA 2WBMA 1HA8A 2XAUA 3ZCOA 3CZ6A 3DTKA 4BGDA 1UELB 1D0YA 1AA7A 1R6RA 2Y0SA 1UAAA 2BOLA 2V26A 1YX5A 4DBQA 4ZDPA 3DPLC 2RQQA 3HUGB 4JQFA 3H5RA 2CV0A 2LC2A 1V5EA 2M0MA 5HLTA 3VSLA 4BDYA 3H9JA 4YEJA 1MMAA 4J01A 3OL3A 3RPUD 1X19A 1Y6IA 4EATA 2E60A 4RMNA 2PJRA 4CCOA 2VJ4A 4B47A 5CQGA 2L2OA 2LBFB 5KHDA 4CCNA 3OYCA 1WJBA 4BE0A 4XLEA 2W7NA 1WJEA 3OYKA 2VXZA 4BXFA 4IQ4A 2IGKA 4ZDOA 2X1CA 3H5AA 3HC7A 2VIXA 2A6TA 2XF6A 4F55A 3K70C 4E7LA 1D1CA 3K4BA 3KYLA 2HPMA 2RREA 4PUSA 5TGTA 2R7SA 2F4IA 1WJAA 3BG7A 4Y33A 4H4KC 4ANJA 4XN0A 2V1NA 3PNYA 3HOSA 2K9LA 4XOPA 3FBNB 1D0ZA 4RM2A 4XKVA 4CCMA 4Y4RA 3IUOA 4DBRA 4XKCA 4HNUA 3DTIA 4E6KG 4E7IA 3RSNA 4YELA 1E0EA 4RLQA 2VKDA 3A2KA 2O5RA 3S3MA 2IGOA 3BCBA 1WJDA 2JSPA 3BC8A 3E0JB 2QKLB 3LSMA 3L2VA 1BR2A 3RCOA 2JVHA 2W4SA 3K6GA 4XKWA 3V42A 2CUZA 4XN3A 5FRNA 1J09A 2KL4A 4XR6A 4XLFA 4HSRA 2WY7Q 3K4KA 2KHMA 3QODA 2ZXHA 3PSFA 3OOUA 4LIUA 3OY9A 3PL8A 4ZYAA 3OYNA 4C2TA 1FMVA 1LVKA 3FHNA 1V5GA 4CH7A 3HL2A 2XF5A 2HQAA 4F92B 1Y56A 2ZFUA 2L7KA 3BCAA 5LFAA 2VKHA 2CW7A 3K4JA 3IAM2 4CUGA 2JVGA 4NNJA 3BG6A 3K4CA 4P1WA 2DT6A 4D9JA 4BACA 4ZJZA 4IKFA 4PJLA 1D1AA 4X0GA 3MKWB 4BE2A 4RLFA 4BU2A 1N78A 3QYEA 2R7OA 1X1BA 1ZELA 3DTEA 4PK4A 2KQRA 4HNTA 1YE9A 4E7JA 3VWBA 3AL0C 5LD2C 2DJIA 2LOOA 1SFKA 2LBFA 4AYBA 3SYTA 2VL8A 4BQOA 2KDOA 2QKMB 3H9GA 1PJRA 4OWRB 2KMUA 1NG7A 4CCJA 3OS0A 2MD0A 1PYVA 2CFOA 3HPHA 2W82A 4LIVA 3DKXA 3F9KA 1G59A 3L2RA 3KX2A 2FUG2 3FDYA 4F3QA 3DKYA 3OYMA 2KZVA 4NQWB 3HPGA 4PSXA 3H9QA 4DGWB 4BL0B 3BLYA 4PJJA 1NG6A 4RM3A 4XM3A 4XL9A 2VPLA 2V4JC 2XSJC 2VQGA 4XNFA 2CV2A 3OIPA 3EUHC 3MMYB 2A5WA 4FETA 3ZR8X 4AU7A 5HNHA 3AFHA 3W2AA 5CPRB 2M7AA 3L2QA 1VZ0A 1W36D 2MYSA 2VLAA 2HU9A 1BOBA 1MMGA 3OWTA 3QYBA 4E4HA 3HKZA 4PFPA 2UV1A 1Z21A 3C2HA 3ZQQA 1MNDA 2VB6A 3VYTB 2X6XA 4NUBA 4IQJA 4XLCA 2IGMA 4BUPA 3DEEA 4N4OB 1V5FA 4BEHA 1N75A 2VQCA 3OIQA 2PMZA 3NWSA 3H5NA 2X85A 3SEQA 3TMOA 2R7RA 2KRHA 2XC7A 2LY2A 4B3XA 2GOMA 1K6YA 3LSKA 1D1BA 3MD2A 2E5NA 1QHGA 3D5RC 4ZDLA 3OYJA 3K10A 2R7WA 2V9KA 1T95A 1TT0A 3DWLE 4XMYA 2M4KA 3OYBA 2CUJA 2OV7A 2AQFA 3VSKA 3DQVC 2Z2SB 2X6WA 2BW3A 3TL4X 2R7VA 2BVLA 2WADA 4C30A 4LITA 3J7AY 2E1MB 3IP4B 4BEHB 2IS1A 1T0FC 2RNGA 1W36C 1WJ5A 2OC6A 3QYFA 3S93A 1DGRM 4B48A 4QPOA 1S9HA 5FROA 2KPMA 2KRCA 2W1OA 3AKZA 1N77A 3ZXSA 4LG3A 4DOZA 4F93B 3HG9A 2WAQA 3D5LA 1U0JA 2W00A 3CF2A 3UR3C 2DXIA 3SDBA 2CH0A 3CP8A 3IAS2 4BS9A 3CESA 3K4MA 5CQEA 4N4NB 3VYRB 4AVZA 1EA3A 3OYLA 2IS6A 2BW3B 2IXSA 2VJJA 4MLOA 3DPUA 3PJRA 3OYGA 3HXLA 4BQNA 3CJRB 3VDXA 4OAZA 2L9SA 4CCKA 4II2A 4ZC3A 3H35A 3W2WA 4HRIA 3PFYA 2HPIA 3FBIB 4D1QA 1D0XA 4XKBA 3DPTA 1GLNA 4KT6A 4XLAA 3SZGA 2VJIA 1DP3A 3ONQA 3PUBA 3PNTA 3S8PA 3CJQB 4BJTA 3RTRA 3ZRGA 2VQHA 2HVRA 4KJZA 2M7BA 1MMDA 3G2BA 5HOOA 2LRDA 3KEYA 4Y3OA 4E7HA 1MMNA 1DGWY 4B44A 2VJ5A 2K9MA 3OYHA 3TBIA 3S3NA 4BJ6C 3D5SC 3OR1C 3L2WA 3LSGA 4CZCA 2CMPA 3H0DA 2M3AA 2F6CA 3CP2A 1TZLA 3OYDA 2M4GA 2HNHA 3N05A 3FKJA 1BR1A 4IX7A 3A1YA 1MW7A 3OL4A 4HG2A 4HPQA 2DOAA 2NOJB 4HEA2 4B43A 3GBGA 1X1DA 3PSIA 3SEZA 4F52A 4PJNA 4FASD 3UNGC 4OAYA 4QPQA 2V7FA 3W3CA 4G6TB 4KITB 3OS1A 2OUMA 2WB1A 3ZGKA 2KLOA 2ZSHB 2GOXB 3I3LA 4R79A 3M1CA 2WY8Q 2VASA 4HSTA 2I8DA 5KCMA 1OR7C 2CW8A 3HOTA 4BE1A 2Z1DA 4DJAA 2UWMA 2HDWA 1KONA 1WFXA 4XONA 5HVQC 1X1AA 2VXDA 3CMMA 2K5CA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1T0F C; 
#chains in the Genus database with same CATH topology
 2TRT A;  3BR1 A;  1DU6 A;  3WTW C;  4I7H A;  5HNF A;  2EV5 A;  2HKX A;  5D4S A;  2H6C A;  2V6E A;  2E1O A;  2JUC A;  2CS3 A;  3FXR A;  1PP8 F;  1LJ9 A;  5D6E A;  5E1Z B;  2ZJ2 A;  5DS9 A;  2STW A;  5LHG A;  5J6X A;  1FP1 D;  1O57 A;  4PGH A;  3VOE A;  2DFH A;  2DAO A;  1WH5 A;  1YG2 A;  4GYG A;  2LD5 A;  3J7Y J;  2DBB A;  3EQL F;  2LLK A;  3CUQ C;  5ILV A;  3A01 A;  3TQN A;  2ELJ A;  3FX3 A;  3BG3 A;  2HYG D;  3I59 A;  2VOP A;  3KZY A;  3MKY B;  5DCF A;  4XOT A;  1D8K A;  2R7U A;  1Z7L A;  3NWT A;  3RKY A;  3CCL I;  2WAQ N;  1YRN A;  2A07 F;  1S5L C;  2O7O A;  3SFI A;  1YX3 A;  4UUS B;  2R7X A;  2X51 A;  4HDU A;  2IGN A;  2DOD A;  2ZSI B;  1S3J A;  2DMT A;  3AL0 B;  2HTJ A;  4NHJ A;  2IT0 A;  2L5Q A;  4XOR A;  2Z3Y A;  4YRV A;  1YHQ I;  4I09 A;  2EIL H;  3R4K A;  5HLI A;  4XQF A;  3GFJ A;  2HOT A;  1IJW C;  2DQL A;  3OYF A;  1BR4 A;  4BKX A;  5K5O A;  1JT0 A;  1F4K A;  5HS9 A;  3CC4 I;  2E5Z A;  1U3E M;  4XLH A;  5J1R A;  3K2Z A;  3JSO A;  2LFB A;  4IZZ A;  1FSH A;  1X3Z B;  4OOI A;  3ISP A;  2HOS A;  3BZC A;  2OD5 A;  4V2F A;  2QBY A;  2WAE A;  3DXJ F;  3CC7 I;  3VYU B;  5HLG A;  3LWF A;  4EGY A;  1H89 C;  3QAH A;  4E7Z A;  2GIV A;  2JA6 J;  2QWW A;  1R5I D;  2KP6 A;  1VQ5 I;  3TOA A;  2R7F A;  5LHH A;  1VQ8 I;  5FD5 A;  5IP9 J;  2IS2 A;  2BVM A;  3FKI J;  2MC4 A;  3PNV A;  5E8G A;  4AIJ A;  1JUP A;  3K4L A;  2L9R A;  4FX0 A;  3RI4 A;  2F5V A;  3CMY A;  1HW1 A;  3CCE I;  1ZR2 A;  3R6S A;  5B1B H;  4ESJ A;  2R3S A;  3MN2 A;  1IN5 A;  2VOD A;  2IS4 A;  2AO9 A;  4GYI A;  3GLX A;  3V8L A;  2AXL A;  3CUO A;  5FKK A;  1ZR4 A;  2E1M C;  3LFK A;  2M9H A;  4ITV A;  5F0F A;  2J5O A;  2XGC A;  3JSP A;  1V4R A;  1W5S A;  1WRJ A;  1A6I A;  2WB1 N;  1SD4 A;  2DA7 A;  2HFH A;  5EEH A;  1K4S A;  3T8R A;  2R7D A;  4ZZL A;  1PVE A;  1XDS A;  1OYW A;  3DTK A;  4KA4 A;  2IA1 A;  2NVY J;  1OCZ H;  3K69 A;  1P7I A;  4CDG A;  3KP7 A;  1UAA A;  2V26 A;  2ETH A;  4U0Y A;  3A0B C;  3PO3 J;  1TBX A;  4G94 A;  1ZH5 A;  5H20 A;  4EJV A;  2E1N A;  1RES A;  2COM A;  3QOP A;  1BJZ A;  3CUQ B;  2HS5 A;  3DBL B;  1R58 A;  2PMH A;  5HLT A;  2OTJ I;  1FYM A;  1B1B A;  2GZW A;  4I0A A;  3ULQ B;  3WU0 A;  3JAM K;  2NOG A;  3OL3 A;  1G3Y A;  4QSH A;  3RIR A;  4EAT A;  2VC0 A;  2V1D A;  5LRS A;  4M3D A;  4V2G A;  3CF5 F;  2E60 A;  2PJP A;  4RMN A;  3E6C C;  1FX7 A;  2DDB A;  2OQR A;  4B47 A;  1EV7 A;  1ZLJ A;  2XAS A;  5IY5 H;  2ZO4 A;  5KHD A;  1WJB A;  2DI3 A;  2A68 F;  3LSR A;  3OYK A;  4IQ4 A;  5IT9 Z;  1ZAR A;  5JHU A;  1WCM J;  2IGK A;  5C3E J;  3G3Z A;  3CC2 I;  1BW6 A;  1S8N A;  2A6T A;  4GCV A;  2XHK A;  3DKW A;  5M3F J;  1UJ8 A;  4G6Q A;  1H9G A;  3P5J A;  1QPM A;  2K3F A;  2P81 A;  5J1U A;  2HPM A;  2ZB9 A;  1ETX A;  2R7S A;  1BI0 A;  4G6D A;  2Y75 A;  3MCZ A;  4H4K C;  2QSH X;  2V1N A;  2NVQ J;  3SJM A;  2JT1 A;  3RKW A;  2NNN A;  2K9L A;  2OTL I;  4U0V A;  5E3L A;  4Z6Y A;  4RM2 A;  4EM0 B;  1IRF A;  5E1W A;  4XKC A;  4DBR A;  4HNU A;  4OIO F;  1SVL A;  2ACJ A;  1EJ9 A;  4E6K G;  3KEO A;  2FE3 A;  4RAZ A;  1ETQ A;  3H1C A;  2K40 A;  4RLQ A;  1XD7 A;  2O5R A;  5E3O A;  3QPS A;  2HXI A;  3IKV A;  2F5D A;  4LB6 B;  3N97 A;  1RKT A;  1WJD A;  1WI9 A;  3LSM A;  3L2V A;  1WKM A;  2JVH A;  5IYC J;  4IRG A;  3CCM I;  3TP0 A;  2M1B A;  4HF0 A;  1HF0 A;  1JGS A;  3Q9S A;  4AD9 A;  1LEA A;  3F8C A;  1MBK A;  5F0C A;  2DMN A;  3HHH A;  2DJN A;  5D8K B;  2D1H A;  1X2M A;  2Q2E A;  1J5Y A;  2EK5 A;  3AG1 H;  2GIZ A;  4L0Z B;  3QOD A;  1XDU A;  2EQR A;  3PSF A;  3K1M A;  4N0B A;  1YW8 A;  3OOU A;  1T6S A;  3PL8 A;  3S1N J;  2ZCW A;  3GW2 A;  4C2T A;  4RDU A;  1LVK A;  5B1A H;  3HL2 A;  2VOO A;  2OBP A;  2ZFU A;  3FK7 A;  3BCA A;  2CW7 A;  4AC0 A;  3HUG A;  2FU4 A;  4ABZ A;  1ZG1 A;  4CUG A;  3BG6 A;  4BAC A;  1LE8 B;  3ZOB A;  3MKW B;  4BE2 A;  4U88 A;  5B5E C;  1B8I A;  2FRH A;  2RNJ A;  2OPT A;  5M3M J;  4BU2 A;  4HX4 A;  3QYE A;  2Y0S N;  2KQR A;  3NQO A;  3GTQ J;  1YE9 A;  3G1O A;  2GBY A;  2VT3 A;  5LLQ A;  1ZQ3 P;  4A12 A;  1SD7 A;  2BXY A;  2DJI A;  2LOO A;  4AYB A;  2KJB A;  2N8G A;  2CQQ A;  4OWR B;  4D0P A;  2W84 A;  4UVB A;  4CCJ A;  4ESB A;  5EG0 B;  2DA6 A;  5HS8 A;  3CDH A;  4LIV A;  2CFO A;  1R9T J;  4I02 A;  2EV0 A;  4W1U A;  5D6F A;  3FXO A;  1IDZ A;  2QGU A;  4O5V A;  4D7N A;  1WH7 A;  4F3Q A;  3ZN1 A;  3I53 A;  4NQW B;  2P5L C;  3PO2 J;  5BNG A;  1FEX A;  3GEZ A;  3A02 A;  4XM3 A;  3TGN A;  4IHT A;  2A6E F;  3WE2 A;  1N25 A;  3HTU A;  3EUH C;  2A5W A;  5FJ8 J;  4JX5 A;  3ZR8 X;  2KT0 A;  3AFH A;  5CPR B;  3L2Q A;  1G6N A;  2IEK A;  1BOB A;  2AXT C;  3HKZ A;  1NHA A;  3R0J A;  3C2H A;  1PP7 U;  1VQ6 I;  4CXF A;  5E17 F;  2E34 A;  2Y30 A;  1G2H A;  4ENK A;  1SAN A;  4ZH4 F;  4XBF A;  3V7R A;  2PG4 A;  4C3I J;  5D5V B;  3F23 A;  4NUB A;  1IO2 A;  2IW5 A;  5TRD A;  1W5C C;  3RDI A;  2A5Y B;  3BJO A;  3OIO A;  1BM9 A;  4FT8 A;  2IGM A;  3IWZ A;  1BOA A;  1ODD A;  1W5T A;  3K0L A;  4A3C J;  3DEE A;  2JMW A;  5IT9 K;  3BPX A;  4MHG A;  5TJJ A;  1V5F A;  5ILU A;  3OIQ A;  4BY1 J;  5GAD J;  1B59 A;  3NWS A;  3H5N A;  2XAQ A;  1OPC A;  1U9O A;  3SEQ A;  4AWX B;  1AKH A;  2XC7 A;  3OV8 A;  4A0Y A;  3CO7 C;  5BPD A;  2L54 A;  3KLO A;  4S05 A;  2EFP A;  4ZDL A;  3ZQL A;  3ZP5 A;  1UHM A;  2DFF A;  4RAF A;  4XMY A;  2M4K A;  5A2Q Z;  2Q8K A;  1BL0 A;  4ZYG A;  1KQ0 A;  1YLF A;  2AQF A;  3VOD A;  3DQV C;  3WU1 B;  4H0E A;  4BXU A;  3E6D A;  4L18 B;  2R7V A;  2WV1 A;  2ZC2 A;  2O3F A;  1OR7 A;  2I10 A;  2LF8 A;  2F4M B;  4YG2 F;  3FMS A;  3J7A Y;  2X4H A;  1T0F C;  1YQA A;  1FOY A;  1WJ5 A;  3M3Y J;  5FD6 A;  3JRG A;  2QEN A;  4ZZD A;  1P6R A;  3I5U A;  2IJL A;  3FXK A;  2W1O A;  2L01 A;  4HYE A;  2YUS A;  4A3D J;  4DOZ A;  4F93 B;  3HG9 A;  3D5L A;  2W00 A;  3UR3 C;  4D5F A;  4D5C A;  1E2X A;  1ENH A;  4LLG F;  2DA5 A;  3BG9 A;  3TDZ C;  5IOZ A;  3CES A;  1MBJ A;  3K4M A;  3PIO F;  3G6E I;  3LSP A;  5EDN A;  5HDN A;  1XCV A;  1T38 A;  1ON2 A;  3U2R A;  3BTC A;  5FLX Z;  1ETY A;  1W0T A;  2HEO A;  3CJR B;  4BHC A;  1YYV A;  1MD0 A;  3ZMZ A;  3U1D A;  2MGQ A;  4IEJ A;  4KNY A;  1JJ6 C;  2HPI A;  1UST A;  1VND A;  5L3B A;  1GLN A;  3IH3 A;  4KT6 A;  3SZG A;  3ONQ A;  2WTE A;  3PUB A;  4D7M A;  2P7V B;  5LHI A;  5TIS C;  2VQH A;  5JLW A;  1HST A;  3S1M J;  5BS6 A;  1MMD A;  2LRD A;  3QQA A;  4Y3O A;  2STT A;  1ZG3 A;  3OYH A;  3TBI A;  2DOF A;  4C3H J;  5BQT A;  3HGY A;  1K78 B;  5CLS A;  4LMY A;  4CZC A;  2BY2 A;  4RB3 C;  3H0D A;  2F6C A;  3ABT A;  3OYD A;  2M4G A;  3N4M A;  2VKE A;  1UG2 A;  2KKO A;  3OL4 A;  2OF7 A;  1TL8 A;  3EET A;  1WGX A;  3K1N A;  2NOJ B;  2ICW G;  1FIA A;  4EM1 A;  1OIS A;  5J3L A;  4B43 A;  5HLH A;  3GBG A;  3PSI A;  5DCM A;  3SEZ A;  5D5W B;  6PAX A;  4YIR X;  3HOV J;  4OAY A;  2V7F A;  4I01 A;  4OIN F;  3W3C A;  1GVD A;  1RPW A;  1UHS A;  3C2B A;  2NYX A;  2KLO A;  2HR3 A;  3L2C A;  4MEY F;  5LEK A;  1RRJ A;  1R23 A;  4Q5S F;  4UVA A;  2V1U A;  3GVA A;  4LJZ F;  2ECB A;  1IUF A;  1A36 A;  2FQ4 A;  3JRH A;  3HOT A;  2CUF A;  2Z1D A;  4BAY A;  4DJA A;  2TDX A;  3BG5 A;  1FTT A;  1VQL I;  3O3K A;  3KEQ A;  5L3E A;  1O7L A;  4RS8 A;  1PUF A;  3CMM A;  3V8K A;  2PBI A;  3TDU C;  1USS A;  2L3D A;  1ITY A;  1I1G A;  3DU5 A;  2EIM H;  4UY8 I;  4P55 A;  1TP4 A;  3I64 A;  3HOX J;  3ERM A;  2CW0 F;  1YIJ I;  2KIF A;  4A6D A;  3WU2 C;  1DDN A;  3MKZ A;  2XDV A;  1OCC H;  2EJR A;  2X6Y A;  1YIO A;  2OJE D;  4RB2 C;  3HSE A;  5F1J A;  3P9K A;  4A3F J;  1J75 A;  1DQU A;  3HRS A;  1S72 I;  3OYI A;  5IYB J;  3V8J A;  1LDK B;  5GAE J;  2JUG A;  4RGR A;  5EEG A;  2JRT A;  1XPX A;  4ASN A;  5JVT A;  4Y7N J;  4C2U A;  5LGT A;  1TWA J;  2DW4 A;  2L4A A;  1PUF B;  2KDZ A;  2HQR A;  4DQ2 A;  2AQE A;  2DMU A;  2HZD A;  5IP7 J;  2KRF A;  2PJR B;  1O3R A;  3PUF A;  3C18 A;  1FBS A;  2EA4 A;  5GTI C;  1QHH D;  2Z33 A;  4CGZ A;  5A2Q K;  3ECH A;  1SAU A;  2R4G A;  1S6L A;  1X58 A;  4RGX A;  3HBL A;  3WTZ A;  1SVM A;  3HIF A;  1Z9C A;  3S2D J;  1U8R A;  3F22 A;  4XRS G;  4L5E A;  2LG4 A;  3E5X A;  4A0Z A;  1W4M A;  4HBL A;  3F0C A;  3H0G J;  3WG9 A;  1ON1 A;  2B9S A;  2HDC A;  4CYC B;  2X1E A;  3QWL A;  4PJM A;  4A3M J;  3K4N A;  4L9N A;  2IBD A;  3W6V A;  3BT9 A;  1VQN I;  1MH3 A;  2WWY A;  2XGE A;  1MNE A;  2P0W A;  4DNC A;  1HKS A;  3HRT A;  3Q0U A;  1ZGA A;  5FKL A;  2W24 A;  3SXY A;  4DW6 A;  2D45 A;  2F2E A;  1RIO H;  1VQ9 I;  2EFN A;  2L7Z A;  2XAJ A;  2DN0 A;  3ERE D;  3M9A A;  4NC7 A;  1K79 A;  1AU7 A;  3A4C A;  2JA8 J;  3BTL A;  3VPR A;  3FMQ A;  1ZRF A;  2UXX A;  2F5E A;  3DLA A;  4XIC A;  2O03 A;  4CHU A;  3E6M A;  1ERD A;  2JA2 A;  4IOC F;  5FLX K;  3E6B A;  1D5V A;  2L7M P;  2A3S A;  5FKM A;  1B6A A;  1LKX A;  2HKO A;  5DM6 F;  3E1S A;  3GFL A;  3RKQ A;  2M0C A;  2FBI A;  4EJU A;  1X4O A;  2DCE A;  2LH9 A;  3K2A A;  4HF2 A;  4WK8 F;  4CCL A;  1HDD C;  4A3E J;  3OS2 A;  2UUZ A;  1T98 A;  1MSF C;  5C44 J;  4M6X A;  5K1Y A;  3K9T A;  4GFB A;  3S16 J;  2LP0 A;  2DT7 B;  1EH7 A;  2MLK A;  5E20 A;  2JPB A;  1M1E B;  2YX7 A;  3DP7 A;  1OCR H;  2WBM A;  2RQP A;  3ZCO A;  3CZ6 A;  3GWZ A;  4ENJ A;  1YJW I;  4L9T A;  4B3A A;  2K85 A;  3MKL A;  4M71 A;  2HTS A;  3E5Q A;  3HJE A;  1TT5 B;  1IXS B;  3KZZ A;  1TWG J;  2DMP A;  2Y9Z A;  4IHY A;  1R6R A;  2BOL A;  5GPC A;  1NTC A;  5FKO A;  1YX5 A;  2ME6 A;  2RQQ A;  3L00 A;  3H5R A;  1POG A;  3KZI C;  2DOE A;  2DQR A;  2MBF A;  2RN7 A;  4LK0 F;  3ROU A;  2LY9 A;  4BDY A;  3H9J A;  1F5T A;  1HLV A;  1MMA A;  9ANT A;  4IRI A;  1Y8R B;  3COA C;  1X19 A;  3F8B A;  2EZK A;  3DV8 A;  4CCO A;  2L2O A;  2LBF B;  3ASO H;  3WTV C;  1KQ9 A;  1UZC A;  3LA7 A;  4BXF A;  1RR8 C;  4UUS A;  4WWC A;  2GA2 A;  4ZDO A;  2X1C A;  5IPA A;  4N9H A;  2QA4 I;  1VI0 A;  2M5W A;  1XTA A;  1D1C A;  3K4B A;  3G73 A;  2FD5 A;  3KYL A;  1W1W E;  3KCC A;  4PUS A;  3RPQ A;  3CDL A;  2HQN A;  4M74 A;  4KDP A;  2CGP A;  4Y33 A;  1J9I A;  4XN0 A;  1R1V A;  3F6O A;  2H1L A;  5EZH A;  3PNY A;  1MBH A;  3Q0W A;  5CYV A;  2IA0 A;  3ABU A;  4WXH A;  4XOP A;  3TW7 A;  4XKV A;  2FJ1 A;  4CCM A;  5KAI C;  4Y4R A;  3IUO A;  1WHU A;  3BRO A;  2O61 A;  2HZT A;  1Z91 A;  1SD6 A;  1P92 A;  2X48 A;  3ZQF A;  1OCP A;  1IV6 A;  1GXQ A;  3BWG A;  4KYW A;  5JLX A;  1Y39 A;  2G7U A;  4M6Y A;  1E3P A;  4X6A J;  2IGO A;  1ZK8 A;  1CF7 A;  3BCB A;  3BC8 A;  3SQN A;  1BR2 A;  1MBE A;  3RCO A;  3CD6 I;  1XC5 A;  3DBR B;  4C2M J;  4OIR F;  4EJW A;  1UFM A;  3K6G A;  3WHC A;  3CCQ I;  1ZRD A;  3P9I A;  2IRF G;  3V42 A;  2AS5 F;  2CG4 A;  1T56 A;  1J09 A;  2H27 A;  3IV5 A;  3S15 J;  4XR6 A;  1LQ1 A;  4MIM A;  1VQM I;  2PFB A;  2A69 F;  3K4K A;  3CCU I;  4PJ0 C;  1BW5 A;  1GDT A;  3BR2 A;  2XGX A;  4DYR A;  4Y17 A;  4X1E A;  5D5X B;  2KIQ A;  1HCR A;  4HW0 A;  5F0H A;  1O3T A;  2K7L A;  1FLI A;  4KIF A;  2KIM A;  1BIB A;  4XRM A;  2E7W A;  5FLM J;  1CF7 B;  1X1P A;  5K5R A;  1YI2 I;  1G3W A;  1F43 A;  1YOV B;  4PGG A;  1KU2 A;  2L7K A;  2ZKZ A;  3C3W A;  4XLP F;  3E7L A;  2VKH A;  3ESW B;  4NDL A;  4M3B A;  1V3F A;  3LA3 A;  3K4C A;  3AG3 H;  3QP5 A;  4D9J A;  3CUQ A;  4FIS A;  5K7Z A;  4IKF A;  4PJL A;  3NRV A;  3JW4 A;  4RLF A;  1VF9 A;  3GTO J;  5J8C A;  3CCJ I;  1SMY F;  3CJN A;  3GTG J;  5J1Y A;  1N78 A;  3BTI A;  4PK4 A;  2R7O A;  4NB5 A;  4BQA A;  1DPR A;  2P7C B;  1B9N A;  1ETO A;  3C7J A;  1E3O C;  3SYT A;  2VL8 A;  4BQO A;  2A05 A;  3WE3 A;  3H9G A;  3DBH B;  2KMU A;  5DDG A;  1GT0 C;  1RUO A;  3EYI A;  2GQQ A;  2ID3 A;  3HPH A;  1J59 A;  4KMF A;  4BH9 A;  1IG7 A;  2ZBK A;  3KX2 A;  2FUG 2;  2R7Z J;  5EYR A;  4R1H A;  3OYM A;  2KZV A;  5J4V A;  3CJT B;  3HPG A;  2KZG A;  4O6J A;  3F8M A;  4PSX A;  5FFX A;  1OCT C;  2K9Q A;  2PX9 A;  4DGW B;  3WGI A;  4BL0 B;  4RM3 A;  3CQZ J;  3WTY C;  4EMS A;  1I3A A;  2XGD A;  4BYY A;  4XNF A;  2VE9 A;  4C3J J;  3GTM J;  4UB8 C;  4I99 C;  1IUY A;  5GAG J;  2HU9 A;  3QYB A;  4E4H A;  4QLC U;  2L02 A;  5IYD J;  2UV1 A;  5AIQ A;  1XGS A;  1R7J A;  1DP7 P;  2VB6 A;  1VQP I;  5L3D A;  4MO7 A;  1B4A A;  3VYT B;  2X6X A;  4KIC A;  5F08 A;  5C4X J;  2ISY A;  3S1R J;  2ZME C;  2EZH A;  2BXZ A;  4XLC A;  2VUM J;  1NK3 P;  1XS9 A;  5LBQ A;  3QU3 A;  1KGS A;  2PN6 A;  1WWX A;  3LA2 A;  1CGP A;  1N75 A;  3I4N J;  2DA1 A;  3CLO A;  5FKN A;  4Y52 J;  2P6S A;  3CCY A;  1NK2 P;  2X85 A;  2VN2 A;  2NS0 A;  4BNC A;  1KQ8 A;  2ESH A;  4XID A;  2GOM A;  3L09 A;  3LSK A;  2JWT A;  1D5Y A;  1D1B A;  3MD2 A;  5BPI A;  2W25 A;  1E17 A;  3K10 A;  2R7W A;  2V9K A;  3ZQI A;  5CVR A;  3VB2 A;  2XRO A;  1FWZ A;  1TT0 A;  4MEX F;  1W7P B;  1LDJ A;  3GTJ J;  2CUJ A;  2L0K A;  3DEW A;  2XUB A;  5K5Q A;  4WCG A;  1Y0N A;  2LR8 A;  1JHF A;  2OA4 A;  2X6W A;  4UNO A;  3TL4 X;  1UHW A;  3ZMD A;  2BVL A;  2WAD A;  2VC1 A;  2VPR A;  3J81 Z;  3IC7 A;  2E1M B;  1W36 C;  1LE8 A;  4A2U A;  2LDU A;  2OC6 A;  3QYF A;  2H8W A;  3S93 A;  5FRO A;  1S9H A;  3WGG A;  3BY6 A;  2KRC A;  2EA2 A;  1XB4 A;  1Z7U A;  5AON A;  3T8T A;  2GXB A;  4LG3 A;  4EEF G;  1V54 H;  2JTV A;  3SDB A;  4GXO A;  3JRC A;  4BS9 A;  4B1R A;  4N4N B;  1BBY A;  4AVZ A;  4XSZ F;  4MFD A;  3NAR A;  4BY7 J;  1HC8 A;  4AIK A;  5EG0 A;  3U9G A;  4M6V A;  3PJR A;  3OYG A;  2VBY A;  2K4B A;  3BJ6 A;  2L9S A;  2XB0 X;  3WTT C;  3GX4 X;  4II2 A;  1U5T C;  1FYK A;  4NQW A;  3HYI A;  3GTP J;  4AYB N;  5H6R A;  3CDI A;  4D1Q A;  2D2W A;  4JK1 X;  1D0X A;  4XKB A;  4LB5 A;  3DPT A;  1JJ8 C;  2XKP A;  4XLA A;  5L3G A;  1MJA A;  1DP3 A;  5FGM A;  2R5Y B;  2FOW A;  5HS7 A;  3G1M A;  2ZXJ A;  2MD5 A;  1FOK A;  2M30 A;  2F4O B;  1ZKG A;  2JZY A;  3AAF A;  2BYV E;  2HVR A;  3AG2 H;  1BI1 A;  3GZN B;  1R36 A;  1MMN A;  1DGW Y;  3MVP A;  2ZME B;  2NVT J;  2VT2 A;  1P4X A;  3GYH X;  2Z99 A;  5ICF A;  1LUJ B;  4RAY A;  3UKG A;  3L2W A;  5DD8 A;  2DU9 A;  2Q0O A;  4ESF A;  2CMP A;  3S2W A;  3BTJ A;  1QA6 A;  4IX7 A;  3V7C A;  1QVT A;  1MW7 A;  4YIF A;  4RB0 A;  4HPQ A;  2DOA A;  4KMU X;  2C6Y A;  1X3U A;  4Q48 A;  2IPQ X;  1X1D A;  3T1B A;  2YU9 J;  3O2P E;  5F1R A;  4FAS D;  4I0B A;  4QPQ A;  4HV6 A;  4G6T B;  4DZJ A;  2OUM A;  3ZGK A;  2QQB A;  1BI2 A;  1I39 A;  3I3L A;  2MLG A;  2WY8 Q;  3TO6 A;  2XAG A;  2VAS A;  4F7Z A;  1Q1V A;  2QYO A;  2I8D A;  2MC3 A;  5KCM A;  1OR7 C;  2XVC A;  3JRD A;  3O8G A;  1KU7 A;  1ZG5 A;  1QNT A;  3I71 A;  1WFX A;  4RGS A;  1X1A A;  5HVQ C;  1IAW A;  4HX7 A;  1U78 A;  1J0R A;  3GO5 A;  1LPQ A;  2QM3 A;  2FXA A;  2ZFW A;  4A3J J;  1K4T A;  3S3O A;  1Z67 A;  2ECC A;  3F3X A;  3QOE A;  4HF1 A;  4EQQ A;  3S17 J;  3TED A;  1IZ1 A;  5D4R A;  2CWE A;  1G3T A;  2K02 A;  3RQ4 A;  5J40 A;  3DLL F;  1ZN2 A;  1C0W A;  1LFP A;  1OFC X;  1S29 A;  5FO5 A;  4LLL A;  3WHB A;  2EH3 A;  4ZYH A;  3C2G A;  2QSG X;  2EV6 A;  4U7B A;  2EFW A;  2V1X A;  3BDD A;  1BA5 A;  2G7H A;  1LNW A;  4GO1 A;  4HLX A;  4A3B J;  2FML A;  1TWH J;  2MFZ A;  2Q1Z B;  3LL7 A;  5FRM A;  1GUU A;  2EWN A;  4IHW A;  1U5T B;  1BC7 C;  4F91 B;  3V4G A;  1RI7 A;  4L5J A;  2LKS A;  1UB9 A;  2CRG A;  4UVC A;  4L0Y B;  2VBX A;  2XPW A;  1WVR A;  1FNN A;  1HXD A;  2LMD A;  2EIN H;  3H36 A;  3H3Z A;  4A5M A;  3R60 A;  4V19 K;  2WV0 A;  3EUH A;  4A5N A;  1I6H J;  3EUA A;  3HZJ A;  2H6B A;  3GF2 A;  4RA2 A;  3J81 K;  5LGN A;  4A3G J;  2RAE A;  3HSF A;  4E7S A;  3REO A;  4BJ5 C;  5KAF C;  1BC8 C;  2L4M A;  1MIJ A;  5ICG A;  2XIG A;  3TKY A;  3U21 A;  4DIQ A;  3OYE A;  2MG4 A;  1QO0 D;  4IPA A;  4C9Y A;  1OLT A;  2P4W A;  1Z6R A;  4Y15 A;  5EZG A;  3AG4 H;  2EFQ A;  1UG0 A;  1K78 A;  2HXO A;  4AM3 A;  4II3 A;  2LRE A;  3FXJ A;  1FPQ A;  2EZL A;  2FX0 A;  3K7A J;  3ZQH A;  3RYP A;  4OMY A;  3OMY A;  3EPZ A;  2ZXI A;  3LFU A;  4HLY A;  3S1Q J;  3D0S A;  3D1N I;  3FK6 A;  4UV8 A;  1QU3 A;  4NBQ A;  2TCT A;  3HGG A;  4PFO A;  1X4P A;  1YTY A;  4KIS A;  4U87 A;  4HX8 A;  2LY1 A;  3MEX A;  2QVO A;  2XF7 A;  3KP5 A;  1CQT A;  2HVS A;  3TW6 A;  2R5Z B;  3QP6 A;  2YR2 A;  3FXU A;  1T33 A;  2VKV A;  2MAB A;  3I0T A;  3HRM A;  4A6E A;  2R7Q A;  5EGO B;  4CA0 A;  4YFK F;  3LQQ A;  2WAF A;  1FY7 A;  3W6K B;  2JSC A;  3ZMV A;  1JXS A;  1XX5 A;  1VQ4 I;  3FXQ A;  4JOM A;  1T0F A;  2K3P A;  3LOC A;  1WJF A;  1HA8 A;  4AIH A;  1I50 J;  2XAU A;  5LEJ A;  1ZRC A;  3JRF A;  2PQ8 A;  2JA5 J;  4BGD A;  4YFX F;  3GFM A;  1UEL B;  1D0Y A;  1AA7 A;  1S7A A;  3BR6 A;  5M5W J;  1XN7 A;  4DBQ A;  4ZDP A;  2Y2Z A;  3JRA A;  5FLV A;  1QVU A;  2CV0 A;  4MTE A;  3FF5 A;  5CVJ A;  2LC2 A;  1V5E A;  4PDK A;  1JKR C;  5DUK A;  3U1K A;  4I98 B;  3NAU A;  5GTH C;  2UXN A;  3HB9 A;  4J01 A;  3QRF F;  3RPU D;  2YPR A;  1KA8 A;  4JBA A;  3Q5F A;  3HOU J;  1FBU A;  2PJR A;  1Z6T A;  1BN5 A;  2LF7 A;  4M72 A;  2VJ4 A;  1IN7 A;  3OYC A;  2NS7 A;  4FE4 A;  4XLE A;  2HYJ A;  1K7A A;  2DFI A;  3KET A;  2VXZ A;  1EF4 A;  4FCY A;  3B6A A;  2NAZ A;  3HC7 A;  3HOZ J;  2VIX A;  3ABK H;  5EF6 A;  3LAP A;  5C4J J;  5J8F A;  4F55 A;  3K70 C;  4HOB A;  4E7L A;  4ENM A;  4NC6 A;  4WX9 A;  3M1E A;  4U0W A;  2RRE A;  4CYC A;  3CCR I;  3GTL J;  2EIJ H;  5TGT A;  1XGM A;  2HOA A;  2P5K A;  5J4Y A;  2OAZ A;  1T08 B;  1W7P D;  2F4I A;  1WJA A;  3BG7 A;  4M3F A;  2A61 A;  1U9N A;  4ANJ A;  4CO8 A;  1TTY A;  1O3S A;  2DT5 A;  3HOS A;  3FBN B;  1D0Z A;  4BHB A;  1ZHF A;  1HSJ A;  3HSR A;  3ZMT A;  2H8R A;  3RZD J;  5B3S H;  3TO7 A;  3RSN A;  4MGR A;  1YJN I;  4YEL A;  4BXX J;  2E2J J;  2F5C A;  1HKT A;  1P2F A;  2BY3 A;  2W57 A;  1WPK A;  4G7H F;  3FM3 A;  1O3Q A;  3A2K A;  5F27 A;  1FBQ A;  2G0E A;  1ZGW A;  3MFK A;  1ULY A;  2I5U A;  3E0J B;  4G7Z F;  1MSE C;  2G9W A;  4I6Z A;  4IRH A;  2K4J A;  1RZ4 A;  4KIB A;  3FXL A;  2XSD C;  1FSE A;  2LKX A;  1TQP A;  4AVP A;  4YFN F;  1BIA A;  1STZ A;  4FQG A;  4HV5 A;  1XSV A;  2ZNY A;  1VQO I;  1WI3 A;  5JVG F;  3LNQ A;  2LK2 A;  2X6O A;  1RUN A;  3WTS C;  1V55 H;  3F8N A;  2KHM A;  2ADU A;  1QGP A;  3BP8 A;  1Z05 A;  4LIU A;  1P4W A;  5M5X J;  1ETK A;  4Y13 A;  4ZYA A;  2QF7 A;  2DK5 A;  3OYN A;  3I56 I;  3RYR A;  1FMV A;  2PLY A;  3FHN A;  2O8K A;  3JTG A;  1R5G A;  1V5G A;  4IF4 A;  4CH7 A;  2XF5 A;  2HQA A;  4F92 B;  1Y56 A;  2XB5 A;  1OQY A;  2LTP A;  5CJ9 A;  5KVR A;  1ETW A;  2EIK H;  5LFA A;  4ENN A;  2JVG A;  4NNJ A;  3HHG A;  2IAI A;  2ELK A;  2GA1 A;  1D1A A;  4X0G A;  4M73 A;  2BE5 F;  3BZ6 A;  4CIC A;  3ABL H;  5IP6 A;  1H8A C;  1ZEL A;  1RR7 A;  5E3N A;  2RV8 A;  3BR5 A;  4E7J A;  2B7E A;  2K9S A;  3ZQG A;  1U2W A;  3VWB A;  3AL0 C;  2XPU A;  4EVI A;  1SFK A;  2JPC A;  1EH6 A;  2LBF A;  3BZK A;  1FIP A;  1IV8 A;  2KDO A;  2QKM B;  1XSD A;  1A6Q A;  4IL6 C;  4UXN A;  1T2K A;  3FMR A;  1PYV A;  2ID6 A;  2W82 A;  1P7J A;  1IF1 A;  1I1S A;  3DKX A;  3F8F A;  3IHU A;  5EJC A;  5EEA A;  1G59 A;  3SHF A;  3R61 A;  2DTZ A;  3BQZ A;  1JT6 A;  1ZGJ A;  4G7O F;  3DKY A;  1KYZ A;  4IHX A;  2BHY A;  3IKT A;  2JQ7 A;  3JCU C;  1A35 A;  4LOC A;  4L9V A;  2XSJ C;  3TOB A;  1SFO J;  2CV2 A;  1ZTR A;  2KFD A;  4HAM A;  2OZ6 A;  4FET A;  4A0X A;  3HEF A;  5FFZ A;  2E2I J;  5HNH A;  2F48 A;  2ZJQ F;  2M7A A;  1W36 D;  2MYS A;  4A3I J;  2VLA A;  2DYS H;  3QU6 A;  4PFP A;  1Z21 A;  2O9L A;  4LK1 F;  3BR0 A;  4N9I A;  3ZQQ A;  2M2E A;  2OZU A;  1F1Z A;  3I4P A;  4IQJ A;  2CUE A;  3WTX C;  2VON A;  1XCB A;  2V6C A;  4BUP A;  1QQI A;  3F21 A;  3EYY A;  1JUS A;  1A04 A;  2VQC A;  4MQ9 F;  4RB1 A;  3J80 Z;  2JN6 A;  2PMZ A;  3V7S A;  3VFZ A;  2ZNZ A;  4ZYD A;  3TMO A;  2R7R A;  2KRH A;  2L9V A;  1I5Z A;  1Q1H A;  1K6Y A;  2BBY A;  5F64 A;  3A0H C;  3T5X A;  3KYD B;  1T95 A;  1H88 C;  2CU7 A;  2QCO A;  2V9V A;  3MWM A;  2PI0 A;  3RQI A;  4G9Y A;  4A69 C;  3H3V K;  4JX4 A;  3OYB A;  1YS6 A;  2MH9 A;  2JA7 J;  2OV7 A;  2KIS A;  1AHD P;  3ABM H;  2Z2S B;  5H2F C;  2M45 A;  2BW3 A;  2QEX I;  5L3F A;  3O6B B;  1I6X A;  2QQ9 A;  4LIT A;  4BBS J;  2FBK A;  1R5H A;  3IP4 B;  3T0Y A;  2IS1 A;  2RNG A;  3M8F A;  3TO9 A;  1QZY A;  1R1T A;  3Q9V A;  3DF8 A;  1R4M B;  2BV6 A;  1DGR M;  2D1V A;  1MJ9 A;  2FSW A;  1WSU A;  4B48 A;  2KPM A;  3OSG A;  3AKZ A;  2KJC A;  5HOD A;  2DPU A;  3TP3 A;  2WAQ A;  2HI3 A;  1U0J A;  2DXI A;  3CME I;  2GM4 A;  3KLN A;  2CH0 A;  3CP8 A;  3IAS 2;  4L5I A;  5CQE A;  5AIP A;  3VYR B;  3A01 B;  3OYL A;  2IS6 A;  2BW3 B;  1SFU A;  2VJJ A;  1PUE E;  2EPF A;  3I59 B;  3DPU A;  1OKR A;  3HM5 A;  3IL2 A;  3HXL A;  4BQN A;  4BBR J;  2FEZ A;  3QPT A;  4EJT A;  3BOQ A;  1YRN B;  2DK8 A;  4XSX F;  1Y1V J;  4ZC3 A;  3H35 A;  5CVV A;  5ERI A;  1MH4 A;  3G1L A;  1APL C;  1B9M A;  1LDD A;  4HRI A;  1SAX A;  1PDN C;  1BI3 A;  3BJA A;  1TWF J;  2FOK A;  3FBI B;  1GHC A;  1EH8 A;  3CMA I;  1ETV A;  3E3V A;  2ELH A;  4GGG A;  1UMQ A;  1F9N A;  2FA5 A;  4QIW N;  4EV0 A;  4DYQ A;  2IP2 A;  2E1C A;  3SZT A;  1AOY A;  1U6G A;  3PQJ A;  4UHT A;  5CVU A;  1HBX G;  1R22 A;  4B44 A;  2K9M A;  1YW7 A;  4Q47 A;  1ZLK A;  1TW3 A;  4KN7 X;  3RPU A;  2E35 A;  4BJ6 C;  3D5S C;  1RC9 A;  3OR1 C;  3LSG A;  4A3L J;  2QBY B;  4WXC A;  1T8I A;  2M3A A;  2B0L A;  1FOW A;  3N05 A;  3FKJ A;  2VBZ A;  3A1Y A;  3Q3S A;  3OSF A;  1DUX C;  3DFG A;  2H94 A;  1LFU P;  1IN8 A;  4HEA 2;  1MGT A;  2RKH A;  1REP C;  1JE8 A;  5CVI A;  3UNG C;  1X2N A;  4CYD A;  2HGC A;  1IC8 A;  4MFE A;  2YX4 A;  4KIT B;  3OS1 A;  2WB1 A;  1LB2 A;  4HNV A;  4HZF A;  3W6J B;  1DPU A;  1A5J A;  2E36 A;  1VQK I;  3R0A A;  1SD5 A;  3GUD A;  3M1C A;  5DV5 A;  2GLO A;  4IJA A;  1W7P A;  3I54 A;  2CQX A;  2UWM A;  4LFU A;  2OU2 A;  4HQM A;  2VXD A;  1R4N B;  2Y69 H;  2K5C A;  2W7N A;  4EJO A;  4CSW A;  2XRN A;  3OR2 C;  1JGG A;  5JFR A;  4M9Z A;  2GAU A;  1G8X A;  1IRX A;  3M07 A;  5IOY A;  4JP0 A;  3HOW J;  2VQL A;  3SZP A;  3S32 A;  5HDG A;  5JHF A;  1QRY A;  4GRI A;  2QSF X;  4KIG A;  2E7X A;  4IHS A;  3EUK L;  5GP9 A;  1G3S A;  2LYC A;  2P6T A;  3L2U A;  1ONV A;  3ML6 A;  1IXC A;  2BEO A;  3IRQ A;  2ME0 A;  1TWC J;  3LSI A;  2R93 J;  2CFX A;  3J80 K;  1D8J A;  1TC3 C;  1FYL A;  4NC8 A;  4J00 A;  3EDP A;  2E2H J;  4ZYE A;  3OOP A;  1MZB A;  4OIP F;  1A31 A;  3LSH A;  2BGC A;  3WGH A;  1Z3X A;  1Z3Y A;  1P9Q C;  2BHZ A;  3GME A;  2IVM A;  2JJ7 A;  3M8J A;  4M3E A;  1XGN A;  2Z16 A;  3WOD F;  2CQ7 A;  2KIU A;  3LMM A;  2H1K A;  2R5Y A;  2XAF A;  2X1D A;  3P7N A;  4IVN A;  3W2V A;  3CTA A;  4PSW A;  1WJC A;  5KK1 A;  5H6Q A;  2R7T A;  3VYS B;  2Y9Y A;  4G8X A;  4E7K A;  1YW9 A;  2CYY A;  2O8X A;  2ESN A;  5E3M A;  1TW2 A;  1Y0U A;  4ON0 A;  2L9N A;  5JI6 A;  2XKO A;  2ZME A;  3IWF A;  2CV1 A;  5E18 F;  4QWQ A;  1FT9 A;  3ZMU A;  2HOE A;  1FMW A;  5CKT A;  3M4O J;  5GAH J;  3ECO A;  4BQQ A;  3ZQC A;  4ZTF A;  3JRI A;  5DM7 F;  3FIS A;  3M7G A;  5HDK A;  1FTZ A;  1P4A A;  2B63 J;  1FZP B;  2WA0 A;  3I9V 2;  2HVQ A;  2RGV A;  1K83 J;  4ZTJ A;  1LEB A;  1MMS A;  5ICC A;  5FB2 A;  5KNL A;  3S14 J;  4BDZ A;  3DU6 A;  1AWC A;  4P5O A;  1SVO A;  3G4S I;  4OU0 A;  2NXN B;  2GWR A;  4XLN F;  2OCC H;  4M3G A;  3H3U A;  3DCF A;  2FQ3 A;  2HWV A;  3KPH A;  4EM2 A;  4IXA A;  3K70 D;  4XRF A;  2Q2E B;  1JI8 A;  1L3L A;  4DYC A;  1X1C A;  2CJJ A;  3OYA A;  1GXP A;  5F6F A;  3ZPL A;  2ZJP F;  4J19 A;  3LST A;  3GZ6 A;  2HQ5 A;  4M9S A;  5LRR A;  5E79 C;  2NRA C;  2HYF A;  2CO5 A;  3HKZ N;  3ZMS A;  2Y0S A;  2LKP A;  2QUF A;  1TQI A;  3GXO A;  2JRM A;  3H92 A;  4UUT A;  3DPL C;  3HUG B;  4JQF A;  2DTR A;  3LAJ A;  2FF4 A;  1Z1D A;  1B8I B;  2M0M A;  1BJA A;  3JR9 A;  1TNT A;  1Y1W J;  3VSL A;  1NH3 A;  2LNB A;  1TNS A;  4YEJ A;  3CO6 C;  3PIP F;  4LLN A;  1Y6I A;  4GDF A;  1SMT A;  1MBG A;  4HA8 A;  1RET A;  1KU9 A;  5M5Y J;  1VQ7 I;  1U5T A;  3KP4 A;  1SEU A;  3HDD A;  3SDG A;  1R1U A;  2YU3 A;  3GZ5 A;  5CQG A;  4BE0 A;  3BPV A;  4CCN A;  2M34 A;  1MBF A;  4FTH A;  2F5F A;  4LGW A;  3F72 A;  3GTK J;  1WJE A;  2FBH A;  2R0Q C;  1K6O A;  2Y31 A;  1WQ2 A;  3H5A A;  1OJL A;  2XF6 A;  3FZV A;  3LSJ A;  3C1D A;  1X3W B;  3HRU A;  4JYK A;  1SFE A;  1YFH A;  2GXA A;  3HTS B;  1KZH A;  3LQR A;  3KFW X;  2XRL A;  2XV4 S;  4KUM A;  1I27 A;  2DMQ A;  3ASN H;  4S04 A;  2DA3 A;  4E70 A;  1IN6 A;  3JRB A;  1IW7 F;  3RJP A;  1XSX A;  3Q0V A;  4WXD A;  5E8I A;  3DTI A;  3F6V A;  1OCO H;  4E7I A;  2RC4 A;  4W97 A;  1E0E A;  3CCV I;  2VKD A;  4KT5 C;  4RGU A;  2LVS A;  2VBW A;  4AUX A;  3DEU A;  3PM1 A;  3S3M A;  2NVX J;  2DPD A;  2JSP A;  2QKL B;  2DDA A;  3I55 I;  2Y0M A;  4FE7 A;  2DA2 A;  1RNL A;  3WTU C;  2R5Z A;  4UB6 C;  2W4S A;  1QBJ A;  2R92 J;  4XKW A;  1G4D A;  2CUZ A;  5EGO A;  4XN3 A;  5FRN A;  1AKH B;  2YSR A;  4RAG A;  2KL4 A;  5DD4 A;  3JRE A;  2O6G E;  3FXM A;  1KYW A;  4XLF A;  4XK4 A;  4HSR A;  2WY7 Q;  4MTD A;  4TV7 A;  1SC7 A;  1J2X A;  2MH2 A;  1WZ2 A;  1IRZ A;  3MQ0 A;  1D3Y A;  2ZXH A;  3ELK A;  5ILS A;  3OY9 A;  2J5P A;  5JR3 A;  1XMX A;  1Z0X A;  2NVU B;  1FC3 A;  3J7A O;  1JKP C;  2FNA A;  1XG1 A;  4Q4Z F;  2WC2 A;  2QQ8 A;  5GPA A;  4B09 A;  4I76 A;  3K4J A;  3IAM 2;  2BY1 A;  1R49 A;  1VTN C;  4KN4 X;  4P1W A;  2DT6 A;  2OCE A;  1OYY A;  1ZAO A;  4ZJZ A;  2D5V A;  1YO5 C;  3FIW A;  3E5U A;  1ACI A;  2P5V A;  4K2E A;  4XRS A;  3G71 I;  2K9N A;  3KE2 A;  1X1B A;  3DTE A;  3NEU A;  3KP3 A;  4HNT A;  4U7D A;  4S0H B;  3KP2 A;  3J7Z I;  4HQE A;  4P96 A;  2PEX A;  3RZO J;  5LD2 C;  3L9F A;  3BR3 A;  3GFI A;  5D5U B;  2P8T A;  1PJR A;  1YS7 A;  1JTX A;  1NG7 A;  2BY0 A;  3OS0 A;  2BZT A;  2DLL A;  2MD0 A;  3B6C A;  1R71 A;  2W85 A;  3FWE A;  1JHH A;  1U8B A;  4IOA F;  3F9K A;  3L2R A;  4A93 J;  1FP2 A;  5E1X A;  1ORK A;  1TQM A;  3FDY A;  5F04 A;  2HDD A;  2L7F P;  5DUI A;  2RVC A;  3ZN0 A;  2V79 A;  3H9Q A;  3BLY A;  4PJJ A;  1NG6 A;  1MKM A;  1YIT I;  2W48 A;  2Y48 A;  4XL9 A;  2VPL A;  1FOX A;  2V4J C;  1T39 A;  2VE8 A;  2VQG A;  3OIP A;  2DA4 A;  2VI6 A;  3MMY B;  3L1P A;  1K61 A;  1F36 A;  4AU7 A;  5D8L B;  5LGU A;  1HOM A;  4KFC A;  3PFI A;  3QPH A;  3W2A A;  1VZ0 A;  4I2O A;  1MMG A;  3GCM A;  1I3Q J;  3OWT A;  5K7F A;  2JK3 A;  4PCQ A;  4RBO A;  2ZJR F;  2E71 A;  1MND A;  4WF2 A;  3I4M J;  1UCR A;  1EKE A;  2YS9 A;  4AID A;  1GV5 A;  1MDM A;  2NNY A;  4OMZ A;  3CLQ A;  3IH4 A;  4JX6 A;  2CQK A;  3FM5 A;  4LG0 A;  2GXG A;  5K7H A;  1IRG A;  1QZZ A;  1YJ9 I;  2MA3 A;  1LVA A;  4P9F A;  2EBI A;  2QLZ A;  4N4O B;  1Z77 A;  3A03 A;  4BEH A;  3I58 A;  5DCM B;  5BOX A;  1JKQ C;  2ZXW H;  4L9J A;  4MQV A;  2M8G X;  3KP6 A;  5IT3 A;  3P9C A;  2K86 A;  2LY2 A;  2Z5U A;  1E3H A;  4B3X A;  4CZZ A;  2E5N A;  1QHG A;  3D5R C;  1XMK A;  3OYJ A;  4UUV A;  1IXR C;  1QPI A;  1JUM A;  3CCS I;  1TLH B;  1XGO A;  3DWL E;  2Z9O A;  4BHP A;  4UV9 A;  2QQA A;  3KIO A;  3O8H A;  1MDM B;  2EB7 A;  2H09 A;  3MZ8 A;  3VSK A;  3BQY A;  3ZQ7 A;  1W0U A;  3IH2 A;  4LG0 B;  4YII A;  3KYC B;  3S2H J;  2OQG A;  1HW5 A;  3MAJ A;  3SFZ A;  2LSO A;  1ZRE A;  3HOY J;  2XAH A;  4C30 A;  1MJB A;  4Z2Y A;  4BEH B;  2X0L A;  3L7W A;  4G12 A;  4O3M A;  1O7F A;  4QPO A;  1HDP A;  5DYM A;  1N77 A;  1HW2 A;  5DTD A;  2CSO A;  5BMZ A;  4ETS A;  3ZXS A;  1DU0 A;  1B72 A;  5DEQ A;  3CF2 A;  1GVJ A;  2QZ8 A;  4IO9 F;  3B02 A;  3B73 A;  1VFC A;  1EA3 A;  4R8H A;  1OYI A;  1IGN A;  1RKW A;  1XMA A;  2IXS A;  2DFE A;  4FX4 A;  4MLO A;  2CQN A;  4OIQ F;  2EZI A;  2X9D A;  1ZYR F;  2AHQ A;  3VEP A;  2DYR H;  4LD5 A;  1O4X A;  3VDX A;  4OAZ A;  4CCK A;  2COB A;  4QTR A;  3W2W A;  4FHT A;  5J47 A;  3PFY A;  2IA2 A;  2M87 A;  3RKX A;  3K1P A;  2VJI A;  2A6H F;  2E19 A;  2UZK A;  1B72 B;  1QZE A;  4B8X A;  1KU3 A;  3PNT A;  4DZP A;  3S8P A;  3CJQ B;  4BJT A;  3E97 A;  3RTR A;  3ZRG A;  4KJZ A;  2M7B A;  2NS8 A;  3G2B A;  5HOO A;  1H0M A;  3KEY A;  3MZY A;  4E7H A;  1JTY A;  3GLL A;  2VJ5 A;  5ED4 A;  2RDP A;  3WG7 H;  3S3N A;  2DO7 A;  3CP2 A;  2EFO A;  1TZL A;  2M8E A;  4HDV A;  2HNH A;  1IDY A;  3JTH A;  1BR1 A;  4A3K J;  2K27 A;  3IRR A;  1S7O A;  4HG2 A;  4B4C A;  4EGZ A;  1FJL A;  2MW8 A;  2ISZ A;  4F52 A;  2XPV A;  4PJN A;  1MNM C;  1R00 A;  1GV2 A;  3JAM Z;  5B66 C;  4P9U A;  1S7E A;  3M8E A;  4PZJ A;  1H9T A;  2O0Y A;  2ZSH B;  1SFX A;  5ICE A;  2MSY A;  2GOX B;  4M9X A;  3MZH A;  2FNP A;  1HKQ A;  4MNU A;  1J7K A;  4R79 A;  1HQC A;  1L0O C;  2PMU A;  4HST A;  1Y8Q B;  2V9P A;  3X2Q H;  5L3C A;  3FHZ A;  1JKO C;  1LFB A;  2CW8 A;  4BE1 A;  2FMY A;  2HDW A;  1KON A;  2PMZ N;  4IHV A;  3QPL A;  4XON A;  1OMI A;  3PQK A;  1IN4 A; 
#chains in the Genus database with same CATH homology
 4CSW A;  3OR2 C;  3DU5 A;  3S3O A;  1G8X A;  1IRX A;  3QOE A;  5HNF A;  2VQL A;  2V6E A;  3S32 A;  3MKZ A;  2XDV A;  3RQ4 A;  5JHF A;  2CS3 A;  2X6Y A;  4GRI A;  3EUK L;  2LYC A;  3L2U A;  1DQU A;  1LFP A;  3OYI A;  3LSI A;  1LDK B;  2JUG A;  3C2G A;  4U7B A;  4NC8 A;  4J00 A;  4C2U A;  2ELJ A;  2MFZ A;  3LSH A;  2Q1Z B;  3LL7 A;  5FRM A;  2AQE A;  2HZD A;  1Z3X A;  1Z3Y A;  3MKY B;  4F91 B;  2PJR B;  1P9Q C;  4XOT A;  2R7U A;  1Z7L A;  3NWT A;  1QHH D;  1SAU A;  3M8J A;  2R4G A;  1YX3 A;  2Z16 A;  2R7X A;  2X51 A;  2IGN A;  2LG4 A;  2ZSI B;  3EUA A;  3AL0 B;  3LMM A;  2L5Q A;  4XOR A;  4YRV A;  2X1D A;  3W2V A;  4PSW A;  1WJC A;  4XQF A;  4E7S A;  3OYF A;  1BR4 A;  2R7T A;  3VYS B;  4BJ5 C;  2X1E A;  4PJM A;  4E7K A;  3K4N A;  2E5Z A;  3U21 A;  4DIQ A;  4XLH A;  3OYE A;  2L9N A;  4IZZ A;  1MNE A;  2P0W A;  4C9Y A;  1OLT A;  1UG0 A;  4II3 A;  2LRE A;  2CV1 A;  4NC7 A;  2WAE A;  3VYU B;  3A4C A;  3OMY A;  3EPZ A;  1FMW A;  2ZXI A;  5CKT A;  4E7Z A;  3LFU A;  4ZTF A;  4BQQ A;  3DLA A;  2KP6 A;  1QU3 A;  1ERD A;  2JA2 A;  2WA0 A;  2IS2 A;  2BVM A;  1X4P A;  3I9V 2;  2HVQ A;  4PFO A;  2MC4 A;  3PNV A;  1LKX A;  4ZTJ A;  4KIS A;  4U87 A;  2LY1 A;  3K4L A;  2XF7 A;  5KNL A;  2HVS A;  2F5V A;  3E1S A;  1X4O A;  2DCE A;  2LH9 A;  4BDZ A;  3DU6 A;  4P5O A;  4CCL A;  2IS4 A;  2MAB A;  3OS2 A;  2UUZ A;  2R7Q A;  4CA0 A;  2WAF A;  2E1M C;  4ITV A;  2DT7 B;  3K70 D;  2Q2E B;  1JI8 A;  1X1C A;  4JOM A;  2K3P A;  3OYA A;  1WJF A;  2WBM A;  1HA8 A;  2XAU A;  3ZCO A;  3CZ6 A;  3DTK A;  4BGD A;  1UEL B;  1D0Y A;  1AA7 A;  1R6R A;  2Y0S A;  1UAA A;  2BOL A;  2V26 A;  1YX5 A;  4DBQ A;  4ZDP A;  3DPL C;  2RQQ A;  3HUG B;  4JQF A;  3H5R A;  2CV0 A;  2LC2 A;  1V5E A;  2M0M A;  5HLT A;  3VSL A;  4BDY A;  3H9J A;  4YEJ A;  1MMA A;  4J01 A;  3OL3 A;  3RPU D;  1X19 A;  1Y6I A;  4EAT A;  2E60 A;  4RMN A;  2PJR A;  4CCO A;  2VJ4 A;  4B47 A;  5CQG A;  2L2O A;  2LBF B;  5KHD A;  4CCN A;  3OYC A;  1WJB A;  4BE0 A;  4XLE A;  2W7N A;  1WJE A;  3OYK A;  2VXZ A;  4BXF A;  4IQ4 A;  2IGK A;  4ZDO A;  2X1C A;  3H5A A;  3HC7 A;  2VIX A;  2A6T A;  2XF6 A;  4F55 A;  3K70 C;  4E7L A;  1D1C A;  3K4B A;  3KYL A;  2HPM A;  2RRE A;  4PUS A;  5TGT A;  2R7S A;  2F4I A;  1WJA A;  3BG7 A;  4Y33 A;  4H4K C;  4ANJ A;  4XN0 A;  2V1N A;  3PNY A;  3HOS A;  2K9L A;  4XOP A;  3FBN B;  1D0Z A;  4RM2 A;  4XKV A;  4CCM A;  4Y4R A;  3IUO A;  4DBR A;  4XKC A;  4HNU A;  3DTI A;  4E6K G;  4E7I A;  3RSN A;  4YEL A;  1E0E A;  4RLQ A;  2VKD A;  3A2K A;  2O5R A;  3S3M A;  2IGO A;  3BCB A;  1WJD A;  2JSP A;  3BC8 A;  3E0J B;  2QKL B;  3LSM A;  3L2V A;  1BR2 A;  3RCO A;  2JVH A;  2W4S A;  3K6G A;  4XKW A;  3V42 A;  2CUZ A;  4XN3 A;  5FRN A;  1J09 A;  2KL4 A;  4XR6 A;  4XLF A;  4HSR A;  2WY7 Q;  3K4K A;  2KHM A;  3QOD A;  2ZXH A;  3PSF A;  3OOU A;  4LIU A;  3OY9 A;  3PL8 A;  4ZYA A;  3OYN A;  4C2T A;  1FMV A;  1LVK A;  3FHN A;  1V5G A;  4CH7 A;  3HL2 A;  2XF5 A;  2HQA A;  4F92 B;  1Y56 A;  2ZFU A;  2L7K A;  3BCA A;  5LFA A;  2VKH A;  2CW7 A;  3K4J A;  3IAM 2;  4CUG A;  2JVG A;  4NNJ A;  3BG6 A;  3K4C A;  4P1W A;  2DT6 A;  4D9J A;  4BAC A;  4ZJZ A;  4IKF A;  4PJL A;  1D1A A;  4X0G A;  3MKW B;  4BE2 A;  4RLF A;  4BU2 A;  1N78 A;  3QYE A;  2R7O A;  1X1B A;  1ZEL A;  3DTE A;  4PK4 A;  2KQR A;  4HNT A;  1YE9 A;  4E7J A;  3VWB A;  3AL0 C;  5LD2 C;  2DJI A;  2LOO A;  1SFK A;  2LBF A;  4AYB A;  3SYT A;  2VL8 A;  4BQO A;  2KDO A;  2QKM B;  3H9G A;  1PJR A;  4OWR B;  2KMU A;  1NG7 A;  4CCJ A;  3OS0 A;  2MD0 A;  1PYV A;  2CFO A;  3HPH A;  2W82 A;  4LIV A;  3DKX A;  3F9K A;  1G59 A;  3L2R A;  3KX2 A;  2FUG 2;  3FDY A;  4F3Q A;  3DKY A;  3OYM A;  2KZV A;  4NQW B;  3HPG A;  4PSX A;  3H9Q A;  4DGW B;  4BL0 B;  3BLY A;  4PJJ A;  1NG6 A;  4RM3 A;  4XM3 A;  4XL9 A;  2VPL A;  2V4J C;  2XSJ C;  2VQG A;  4XNF A;  2CV2 A;  3OIP A;  3EUH C;  3MMY B;  2A5W A;  4FET A;  3ZR8 X;  4AU7 A;  5HNH A;  3AFH A;  3W2A A;  5CPR B;  2M7A A;  3L2Q A;  1VZ0 A;  1W36 D;  2MYS A;  2VLA A;  2HU9 A;  1BOB A;  1MMG A;  3OWT A;  3QYB A;  4E4H A;  3HKZ A;  4PFP A;  2UV1 A;  1Z21 A;  3C2H A;  3ZQQ A;  1MND A;  2VB6 A;  3VYT B;  2X6X A;  4NUB A;  4IQJ A;  4XLC A;  2IGM A;  4BUP A;  3DEE A;  4N4O B;  1V5F A;  4BEH A;  1N75 A;  2VQC A;  3OIQ A;  2PMZ A;  3NWS A;  3H5N A;  2X85 A;  3SEQ A;  3TMO A;  2R7R A;  2KRH A;  2XC7 A;  2LY2 A;  4B3X A;  2GOM A;  1K6Y A;  3LSK A;  1D1B A;  3MD2 A;  2E5N A;  1QHG A;  3D5R C;  4ZDL A;  3OYJ A;  3K10 A;  2R7W A;  2V9K A;  1T95 A;  1TT0 A;  3DWL E;  4XMY A;  2M4K A;  3OYB A;  2CUJ A;  2OV7 A;  2AQF A;  3VSK A;  3DQV C;  2Z2S B;  2X6W A;  2BW3 A;  3TL4 X;  2R7V A;  2BVL A;  2WAD A;  4C30 A;  4LIT A;  3J7A Y;  2E1M B;  3IP4 B;  4BEH B;  2IS1 A;  1T0F C;  2RNG A;  1W36 C;  1WJ5 A;  2OC6 A;  3QYF A;  3S93 A;  1DGR M;  4B48 A;  4QPO A;  1S9H A;  5FRO A;  2KPM A;  2KRC A;  2W1O A;  3AKZ A;  1N77 A;  3ZXS A;  4LG3 A;  4DOZ A;  4F93 B;  3HG9 A;  2WAQ A;  3D5L A;  1U0J A;  2W00 A;  3CF2 A;  3UR3 C;  2DXI A;  3SDB A;  2CH0 A;  3CP8 A;  3IAS 2;  4BS9 A;  3CES A;  3K4M A;  5CQE A;  4N4N B;  3VYR B;  4AVZ A;  1EA3 A;  3OYL A;  2IS6 A;  2BW3 B;  2IXS A;  2VJJ A;  4MLO A;  3DPU A;  3PJR A;  3OYG A;  3HXL A;  4BQN A;  3CJR B;  3VDX A;  4OAZ A;  2L9S A;  4CCK A;  4II2 A;  4ZC3 A;  3H35 A;  3W2W A;  4HRI A;  3PFY A;  2HPI A;  3FBI B;  4D1Q A;  1D0X A;  4XKB A;  3DPT A;  1GLN A;  4KT6 A;  4XLA A;  3SZG A;  2VJI A;  1DP3 A;  3ONQ A;  3PUB A;  3PNT A;  3S8P A;  3CJQ B;  4BJT A;  3RTR A;  3ZRG A;  2VQH A;  2HVR A;  4KJZ A;  2M7B A;  1MMD A;  3G2B A;  5HOO A;  2LRD A;  3KEY A;  4Y3O A;  4E7H A;  1MMN A;  1DGW Y;  4B44 A;  2VJ5 A;  2K9M A;  3OYH A;  3TBI A;  3S3N A;  4BJ6 C;  3D5S C;  3OR1 C;  3L2W A;  3LSG A;  4CZC A;  2CMP A;  3H0D A;  2M3A A;  2F6C A;  3CP2 A;  1TZL A;  3OYD A;  2M4G A;  2HNH A;  3N05 A;  3FKJ A;  1BR1 A;  4IX7 A;  3A1Y A;  1MW7 A;  3OL4 A;  4HG2 A;  4HPQ A;  2DOA A;  2NOJ B;  4HEA 2;  4B43 A;  3GBG A;  1X1D A;  3PSI A;  3SEZ A;  4F52 A;  4PJN A;  4FAS D;  3UNG C;  4OAY A;  4QPQ A;  2V7F A;  3W3C A;  4G6T B;  4KIT B;  3OS1 A;  2OUM A;  2WB1 A;  3ZGK A;  2KLO A;  2ZSH B;  2GOX B;  3I3L A;  4R79 A;  3M1C A;  2WY8 Q;  2VAS A;  4HST A;  2I8D A;  5KCM A;  1OR7 C;  2CW8 A;  3HOT A;  4BE1 A;  2Z1D A;  4DJA A;  2UWM A;  2HDW A;  1KON A;  1WFX A;  4XON A;  5HVQ C;  1X1A A;  2VXD A;  3CMM A;  2K5C A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...