1T0FC

Crystal structure of the tnsa/tnsc(504-555) complex
Total Genus 10
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
10
sequence length
49
structure length
49
Chain Sequence
IKVVKPSDWDSLPDTDLRYIYSQRQPEKTMHERLKGKGVIVDMASLFKQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Transposon Tn7 transposition protein tnsA
publication title The carboxy-terminal portion of TnsC activates the Tn7 transposase through a specific interaction with TnsA.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Dna binding protein
total genus 10
structure length 49
sequence length 49
chains with identical sequence D
ec nomenclature
pdb deposition date 2004-04-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF11426 Tn7_TnsC_Int Tn7 transposition regulator TnsC
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.960 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Arc Repressor Mutant, subunit A 1t0fC00
1T0FC
chains in the Genus database with same CATH superfamily
1NK2P 2BY1A 1P92A 2E1NA 3CDLA 3L2VA 4D7NA 3T1BA 2HOAA 2EFNA 1Y1WJ 1IXCA 3HBLA 3KLNA 5J1YA 3K4BA 2EZIA 3E5XA 2GAUA 3RDIA 2Z33A 5ICCA 2CSOA 4FETA 1H0MA 1ZH5A 1STZA 2COBA 2FSWA 3RYRA 3L7WA 5K5OA 5JVGF 4XLHA 5F64A 3DKXA 3WHBA 3ERMA 4LITA 2CU7A 4DYRA 3LSPA 2ADUA 5FRMA 3AG3H 5CVIA 4PJLA 3RSNA 5M5XJ 1JUMA 3GTPJ 2ZKZA 2RQQA 2XPUA 3C2GA 2DA1A 1TQPA 1Z91A 2AO9A 3K2AA 4JBAA 1G4DA 2EFQA 2V1NA 3W2WA 5HLHA 3E6CC 4HPQA 4BACA 2M4KA 2EZKA 5DCMA 3U1KA 2PN6A 2X0LA 4KIBA 4HAMA 1Y39A 2QCOA 3ML6A 4M3FA 1ERDA 2DA6A 3VYTB 1VQLI 1ZRDA 4FCYA 3G2BA 4J19A 2GXBA 2DK8A 1S7AA 4BE2A 4B48A 4HF2A 3KLOA 1R1VA 2VONA 3CQZJ 2DLLA 3OOPA 2RNJA 3HHHA 1LB2A 3HKZN 1L0OC 3Q0UA 4HF1A 2EPFA 1DPRA 2ZFUA 2L9SA 2P5KA 1FBQA 4XSZF 3I9V2 3LFUA 3F8FA 3CCQI 2F5CA 2KISA 3HOSA 5EG0B 3P7NA 2FX0A 2FBHA 2K4BA 3JREA 3GZ5A 1OCPA 2IGKA 3CUQA 5JFRA 4M9XA 3Q9SA 2FJ1A 3O8HA 2M2EA 3WTWC 4XLPF 2BE5F 1TWHJ 5FKOA 2QBYA 2OV7A 2E2JJ 4CZCA 4KIGA 1WJ5A 2EZHA 2MLKA 1YW9A 2WADA 2OD5A 1TNSA 1N25A 4C3HJ 4Y15A 4QSHA 1XC5A 1K4SA 5JLWA 1P7IA 3B6AA 4YIFA 1D1BA 3F3XA 2N8GA 4FE7A 1DGWY 1O7LA 1B1BA 1OCCH 4KICA 2HQRA 2GIVA 1T98A 1VI0A 2ZO4A 1TP4A 4UV9A 2NVUB 4XKVA 1NHAA 5E3LA 5IT3A 1W0UA 1HBXG 1QQIA 1Z3XA 4GO1A 1SVOA 2LR8A 3I58A 4BJ5C 3HXLA 5L3FA 2V9VA 4DGWB 1G3WA 4XRSA 1FLIA 3BZKA 1WGXA 3ABLH 1MH4A 5ICFA 3I53A 1I50J 5EDNA 1OCZH 3K1MA 3I71A 3OMYA 1K4TA 1I39A 2BW3B 3KP2A 5EF6A 4YIRX 1FNNA 3IH3A 3AFHA 1WQ2A 1VQ6I 1WJFA 2HEOA 4RM2A 2K9NA 3ZOBA 3FXKA 2FA5A 2P81A 4O6JA 3OR1C 2KHMA 2DOEA 2R5ZA 5C44J 3GLXA 1GV2A 1ZG1A 4XOTA 1IXSB 4IL6C 4WF2A 2VL8A 2F5VA 3LA3A 1O3SA 2ISYA 3K4MA 2VQHA 1SEUA 1HCRA 3CCJI 3BP8A 2LH9A 2GZWA 4B47A 3HIFA 3S15J 2ZXIA 1TL8A 3BROA 1UJ8A 3W6JB 5LGNA 3WTYC 1HKQA 3T0YA 2O5RA 2Z1DA 1DDNA 2M0CA 2PJRA 4E7LA 5LFAA 1R5HA 1YX5A 4OMYA 2O0YA 2UZKA 1LQ1A 1CF7A 1R4NB 5K7ZA 1QHGA 3WU0A 3BTIA 4IHVA 3OS0A 2FMYA 1ZKGA 4KISA 3GTGJ 1XB4A 4DBRA 4EJVA 1UCRA 1ZGAA 3F21A 1POGA 1AKHA 3H9QA 3E97A 3ULQB 2MABA 5HLIA 2E5NA 4I99C 1MDMA 1A35A 3IKVA 2XAJA 2M7AA 4XIDA 3ECOA 2Q8KA 1ITYA 5HLGA 5KNLA 3S2DJ 5J3LA 5J6XA 1JKPC 3BG3A 1DP3A 2O03A 3CMEI 2VOPA 1PP7U 2R5YB 4G8XA 5TJJA 4BEHB 5CVVA 5H2FC 3K6GA 1ETQA 5HODA 5FJ8J 3CP8A 1HF0A 3G6EI 4LFUA 5BOXA 1O7FA 2M7BA 5J40A 2ID6A 4Y7NJ 4FISA 1I5ZA 4IJAA 4ZC3A 2XGCA 3O6BB 5AONA 5GAGJ 4AWXB 4RBOA 3ZQLA 4BDZA 1UG2A 4YELA 4Q4ZF 2XB0X 3LA2A 1FPQA 4M6YA 2KZGA 3PUFA 5DM6F 3LWFA 3WGGA 4S0HB 3TDZC 1U9NA 3OYNA 5FROA 3GYHX 1K6YA 3A2KA 3DLAA 5E20A 5KK1A 4II3A 1ZRCA 1UFMA 4MIMA 3ZCOA 4YFNF 5FB2A 3N4MA 1WJAA 4JYKA 3CMMA 5FKNA 3WE2A 1IJWC 1Z05A 1B72B 5ILUA 4E7JA 4A5NA 4ESFA 2JT1A 1VQOI 1R5ID 3CCSI 3OYDA 5HVQC 1TBXA 2PI0A 2ACJA 1JUPA 5AIPA 5L3GA 1JT0A 4RB2C 3C7JA 1CGPA 4HX7A 1T08B 3H35A 1MJBA 1G2HA 3TO6A 1E17A 1JHHA 2ZXJA 3HOWJ 2LYCA 2PFBA 1TWGJ 2QM3A 1ZK8A 1YS7A 2CQQA 3CCEI 1RR8C 4NUBA 4EATA 3DBRB 2V6CA 3CLOA 5J1UA 4ZYGA 2RDPA 2CFOA 2F4MB 2K27A 4GFBA 1VQNI 2Y69H 2HGCA 1B9MA 5E18F 3VYUB 3BOQA 5TRDA 1FJLA 5FKMA 3ZQCA 1LEBA 1ZTRA 1MMAA 3TDUC 3HKZA 1QVUA 2PMUA 3S14J 4RMNA 3ZMVA 1ZG3A 4DBQA 3FBNB 5C3EJ 5L3DA 2HQ5A 4LB5A 2BZTA 1HDPA 3KX2A 4WK8F 3Q0VA 2D1HA 3W3CA 4YIIA 5EZHA 2NS7A 3H3VK 2VBYA 1HSTA 2H6BA 1FOWA 3O2PE 4ZDPA 4B4CA 3G4SI 2AQFA 3ASOH 4MTDA 1MJAA 2R7QA 4HLYA 1J09A 3SQNA 2EV6A 3K7AJ 4OMZA 1E2XA 2HKOA 2YSRA 3L00A 4NB5A 4R8HA 3GXOA 4BE0A 3QODA 4JX5A 2R92J 3B73A 2W25A 2L5QA 5D6EA 3OYCA 4HQEA 3KZIC 3GO5A 5ILSA 2PQ8A 4I76A 3G1MA 4B8XA 2FUG2 5KAFC 1BM9A 2UXNA 4LGWA 4RGSA 4WX9A 5J8FA 4UUSB 3OYEA 4A6EA 1V5GA 3CCVI 1X3ZB 2XROA 3K2ZA 2A69F 2DTZA 3L2UA 4QTRA 3ZPLA 5EG0A 2DFIA 3NQOA 2F5EA 3DBLB 3FHZA 3BG9A 3GLLA 3S1RJ 1SMTA 2JQ7A 5KCMA 4BE1A 2MG4A 3TW7A 2MSYA 2L0KA 2KJCA 3OOUA 3EETA 2V7FA 4BU2A 2DQRA 3FZVA 4XN3A 1D0YA 3EUAA 3WG7H 1IUYA 2LY1A 3ELKA 1S7OA 3DU5A 1FSHA 3BQZA 4IHSA 3ABUA 3F72A 1WFXA 3TP0A 4M71A 1YIOA 3S1QJ 3LMMA 1X1CA 1IF1A 2Y75A 3K1NA 2X9DA 1XTAA 3CUOA 1IDYA 5TISC 4CA0A 3JRGA 1X1BA 1BI0A 5CYVA 4PDKA 3VYSB 4CCLA 4EGZA 1V55H 3WTSC 1O3RA 4PGHA 1WH7A 4XKCA 4BY1J 3D5SC 1U6GA 2A68F 4HSRA 4RAFA 1XGOA 4XNFA 4IRIA 1ODDA 2JRMA 2L9RA 2EIKH 2WTEA 2R7ZJ 2QQBA 2D5VA 2B7EA 2L7MP 3OIOA 4RM3A 4E7IA 3H3UA 4CCKA 4EQQA 4KDPA 1QU3A 1QO0D 1MMNA 1R7JA 1S6LA 3OYGA 4AVPA 3LOCA 2BW3A 4ZYEA 3JRBA 5LGTA 2OA4A 2X1CA 1W4MA 1ZG5A 1V4RA 4JP0A 1SAXA 4XONA 3QYBA 3LQQA 3EYIA 2EFOA 3CD6I 1WRJA 3OYHA 4KN4X 4ESJA 2E1MC 2OTLI 5FD5A 2OC6A 4U0WA 4AC0A 3JCUC 2JZYA 5GP9A 4IHTA 2DW4A 3TOBA 1ETXA 2RV8A 1GLNA 4RAGA 2HPIA 4C2MJ 2W57A 4PUSA 2I5UA 4HBLA 2O3FA 2V1XA 5FLMJ 3QPSA 4FX4A 2F4OB 3AG2H 1VTNC 4FQGA 1HC8A 3BC8A 2DU9A 2PMZN 1GV5A 2V9KA 3CZ6A 2KIMA 4CXFA 1QPMA 3JRAA 2K7LA 3QP6A 1SVMA 3FXUA 5IOZA 3OYLA 4LG0A 2Z99A 1UB9A 2GWRA 2CG4A 2HS5A 2M4GA 1MBGA 2DOFA 3RKYA 5FLXZ 1ZRFA 5F0FA 3I54A 2XPWA 1P4AA 1T0FC 3H0GJ 4A3DJ 5EEHA 3RJPA 3SEQA 2W00A 3L2CA 1D8JA 1ZQ3P 4QPQA 5TGTA 1FSEA 1YOVB 3G3ZA 4HA8A 1TTYA 2R5YA 2R7VA 3HB9A 2ZMEC 1WHUA 5D5VB 3C18A 3ERED 3PIPF 1K7AA 5EZGA 3GX4X 2Z5UA 4QWQA 2X48A 3K4CA 3QYEA 2HFHA 3PNVA 2DYRH 1X1DA 2XGXA 2R5ZB 1BJAA 1BL0A 3GEZA 3IWFA 2OU2A 3FDYA 4OIQF 1G3TA 3VWBA 3BLYA 3PO2J 1U0JA 2DA2A 2PEXA 5FD6A 4YEJA 2R3SA 3GUDA 4RS8A 4C2UA 1J5YA 4BDYA 2HVRA 4PFOA 2HYGD 2VOOA 3DF8A 3SZPA 3JTGA 3SFIA 3QRFF 3MEXA 2E1MB 3CC2I 3OSGA 3L2WA 2K4JA 5H6RA 1RR7A 2LDUA 3FXRA 2JA5J 1WWXA 4RGRA 3JRDA 3KP7A 3GMEA 4LJZF 3HM5A 3LSKA 3RZOJ 2QQ8A 1GDTA 1MBJA 2KKOA 4BGDA 1WCMJ 3BJAA 4ZTJA 5CKTA 2A3SA 2P5LC 4JQFA 2HVSA 4B3XA 2D45A 3TEDA 3ZMZA 4A2UA 4LLLA 3DTIA 2RGVA 3Q3SA 2Y9ZA 4TV7A 4XLNF 2ZBKA 5CVUA 3O3KA 2IXSA 4P55A 1Q1HA 2HOEA 5DD8A 1FP1D 1P4XA 3QAHA 2OUMA 4M72A 2H8RA 1BI1A 2BY3A 2EA4A 2VIXA 2VN2A 1ON1A 1VNDA 4A6DA 1EJ9A 3S1NJ 1Y0NA 5KVRA 2ELKA 1X4PA 3ZQIA 3EQLF 4JX6A 3F6VA 4CCOA 3FM3A 2M9HA 2JPBA 3BJOA 3FXQA 2WV1A 4HV6A 5L3EA 4PZJA 4HEA2 4YFKF 1P7JA 2CUJA 2K86A 3KYDB 4FASD 3JAMZ 4M6VA 3ASNH 1FEXA 2E5ZA 2L7FP 5E79C 2AXLA 4ON0A 2G0EA 4BUPA 4KUMA 2ETHA 1I1SA 2IJLA 2VKVA 2CQ7A 3BZCA 3MCZA 4L18B 1KA8A 3R61A 4LK0F 3VOEA 2DMUA 1NTCA 1Z77A 1KGSA 1RETA 4LG3A 4OINF 2M34A 3A0BC 3OWTA 4IHWA 2KPMA 2CW0F 4CSWA 3E6BA 2DXIA 2HQNA 2EIMH 3M8JA 2WY7Q 3S93A 4HSTA 3KFWX 1XG1A 4UUSA 1YG2A 2CUZA 3VEPA 1SD4A 3HTSB 1FTTA 1SFKA 1UHSA 1XDSA 3CC7I 4XKWA 1TC3C 2NOJB 2DPDA 2LC2A 2K9QA 1BR4A 1EV7A 4UHTA 3RIRA 3GVAA 5L3CA 4XKBA 3Q0WA 1XGSA 1ETYA 3PSIA 1FBSA 2VUMJ 1MD0A 5K7FA 1WVRA 4R79A 2WA0A 1F1ZA 2BEOA 3ESWB 3FM5A 2R4GA 1Y56A 4J00A 3ZMSA 4BYYA 4HG2A 3WG9A 3WTZA 1XS9A 2LY2A 1TWCJ 2PJPA 1BW6A 2CUFA 4XRMA 2VKEA 2RAEA 5FKKA 1JGSA 5HNFA 4MEYF 2K40A 3RTRA 1XX5A 1LVAA 3PQJA 4Q47A 5LHHA 3SXYA 1RKTA 2M8EA 3RPQA 1HLVA 4C30A 4CCJA 1YW8A 4ZJZA 1IV6A 4EJWA 2JVHA 2FF4A 4H4KC 4KT5C 5LD2C 2VQLA 2AHQA 2AXTC 2KP6A 4KFCA 3WTXC 4IHYA 2M8GX 3H36A 4I01A 5M3MJ 1SFUA 1RC9A 2VKDA 2DA5A 4UXNA 2CMPA 5B5EC 2IT0A 2HWVA 4A3MJ 2XIGA 5DD4A 3OSFA 1TQMA 2CRGA 2DDBA 1BOAA 3ZP5A 4J01A 1MBHA 2PMZA 1PUFB 2NVTJ 5A2QK 1JT6A 3HDDA 2YR2A 2ZJQF 2HPMA 4ABZA 4EEFG 3HG9A 5HS7A 2EV5A 4KMUX 2WAFA 2Q2EB 4XK4A 5BQTA 3OV8A 1IRXA 1KU2A 1SMYF 3MZHA 5E17F 3KPHA 3L9FA 5B1AH 1VQKI 2BVMA 3BQYA 2JTVA 3F0CA 3IWZA 4AIDA 2WBMA 3F22A 3MKYB 2HI3A 1X3UA 4AVZA 2QLZA 2R7XA 4O5VA 1D1AA 2J5PA 3LSIA 4A3JJ 2NAZA 3CTAA 2EK5A 4P1WA 2OQRA 2XKOA 4IEJA 2YUSA 5CVRA 4A5MA 2QA4I 1R49A 1IDZA 1OFCX 2DT6A 1S9HA 1R36A 3GFJA 1HW5A 3P9CA 3H5AA 3TKYA 3S2WA 2ZNYA 4G7HF 2P7VB 3FXJA 2XDVA 1OYIA 1PUEE 1XDUA 2OAZA 5D4SA 2HR3A 4BH9A 3HHGA 1WJBA 4PSXA 4PGGA 2R7RA 1GXQA 1BJZA 2ZJPF 4XSXF 5FLXK 4XLEA 1FX7A 1FIPA 1U5TC 2A6EF 2FNAA 3ABTA 4EVIA 1Z3YA 3V4GA 1Z7UA 5LGUA 4BHPA 2L9VA 2F6CA 3TW6A 3MKWB 4PJ0C 4CGZA 1KONA 2DTRA 3H0DA 2DA4A 3IAS2 4IQJA 2VXZA 2ZSHB 4L9VA 2HDWA 1XCVA 2OTJI 4KITB 3J7YJ 1B59A 2JPCA 2KDOA 3J7AY 2H09A 4D7MA 3BR3A 3EUHC 2IA2A 4AD9A 4MEXF 4BQOA 2I8DA 3U21A 3LQRA 2OCCH 2GA2A 3ABMH 3EDPA 1W7PB 3H5NA 5EJCA 1A6IA 1VF9A 3NAUA 1XCBA 2V6EA 1IV8A 1VQ8I 1U9OA 5JHUA 1YITI 2VQCA 2L4MA 3E6MA 2P6TA 3W2AA 1BR2A 2O9LA 1D0ZA 1VQ5I 5LBQA 4BAYA 1USSA 4AM3A 3PJRA 1QBJA 2E60A 3QPHA 3S3OA 2MYSA 4A69C 1JXSA 3PM1A 1U8BA 3AKZA 2O8KA 5DUIA 1RKWA 3KIOA 3LSGA 4V19K 3GTJJ 3DV8A 3ZQQA 4G12A 3HYIA 2NYXA 3I4NJ 2EFPA 2Q0OA 4F91B 1K83J 2FEZA 2PG4A 2TCTA 2RQPA 4BJ6C 9ANTA 1V3FA 2IP2A 4CUGA 1RUNA 4KMFA 4I6ZA 4ZDLA 1T95A 4LG0B 3EYYA 3N05A 2BYVE 2DI3A 1N77A 2COMA 4AUXA 3WU1B 1U2WA 1Y1VJ 3BCAA 3E5UA 4RGUA 3CJTB 3JRHA 1OMIA 2W85A 2A6TA 4I0AA 3R6SA 4A3KJ 1YO5C 1U5TB 3GBGA 2XSDC 4GGGA 3F23A 3MZYA 2X1DA 3V42A 4HOBA 4XLAA 1HXDA 3IRRA 1LFUP 1T0FA 1ENHA 3QU6A 3ROUA 4A3FJ 2G7HA 4M3DA 1R5GA 2Z9OA 2ZMEA 3SDBA 4XM3A 5DTDA 3G1LA 2DK5A 1EH7A 1XMXA 1JKQC 2B63J 5D4RA 1D5VA 1LUJB 4IHXA 3WODF 2NVQJ 2XGDA 1D5YA 3ZQHA 4OU0A 4C2TA 2NS8A 2PMHA 1IAWA 3BTLA 2E35A 4HDUA 1IN8A 3OYBA 3CF2A 2LSOA 4CICA 4MTEA 1BA5A 1O57A 5IT9K 2VXDA 1WH5A 3J81Z 2E1CA 5C4JJ 3J80Z 1G6NA 5EGOA 1KU9A 2O61A 2QUFA 2WAQN 1HOMA 1UG0A 3FXOA 1SFEA 3FKJA 3M9AA 5IOYA 2Q1ZB 3HTUA 3A4CA 4M74A 3KZZA 2LG4A 4EJOA 1V54H 3LAJA 1W5TA 1SFOJ 1X2NA 2LKXA 1WI3A 1E0EA 3SHFA 4HF0A 4MNUA 3ABKH 2F2EA 2K3PA 1RUOA 5E1ZB 3FXLA 3MQ0A 5L3BA 4M73A 1YJWI 2F5DA 3CJRB 1H89C 2Y2ZA 4ITVA 3TO9A 5J4VA 1Y8RB 4HRIA 4F52A 1APLC 4EMSA 3M3YJ 2ZXHA 4HNVA 1O3QA 3K0LA 2XUBA 1SVLA 2O7OA 4X0GA 2MD5A 3LSHA 2L7ZA 2NNNA 4U0YA 1FMVA 3GZNB 2IS2A 2QZ8A 2CW7A 2CO5A 3NWSA 3H92A 1RIOH 2QQAA 1RZ4A 1PYVA 4NC7A 2QSGX 3U1DA 4ASNA 2Z3YA 2VPRA 4FE4A 4YFXF 1T38A 2NOGA 3NRVA 2VT3A 2DMNA 3BG6A 2XC7A 3GCMA 2BY2A 3VB2A 1FIAA 5IP9J 3CCRI 3WGIA 2MC4A 1M1EB 2FQ4A 1XGMA 4ANJA 2LFBA 4I02A 1PUFA 2DFFA 3OL3A 4DIQA 2VJ5A 4X1EA 1KZHA 4IKFA 4A12A 2KRHA 1OCOH 3U2RA 1BI3A 2Q2EA 1A5JA 3I0TA 2DN0A 3KEYA 1C0WA 1WI9A 4AIKA 4EM2A 2LVSA 3KP6A 4ZZDA 2FNPA 2G7UA 2MGQA 2P6SA 4OIOF 3IH4A 2BXYA 1KYWA 2X6WA 3FMSA 4Y52J 3L09A 1Z67A 2C6YA 4BBRJ 1FMWA 4N9HA 3RCOA 2DAOA 1H8AC 1W7PD 3HRMA 1HSJA 1ETOA 4RLQA 2HDDA 3CUQC 1QZZA 1ZGJA 4N9IA 2JUGA 2XRLA 3MWMA 5B66C 2MD0A 5IYBJ 5J4YA 4A0YA 1DU0A 3V8LA 2BOLA 2Y9YA 4AYBN 2R7TA 1Z21A 4DJAA 3I56I 1Z6RA 1ORKA 4IPAA 2K9LA 3CO6C 4P9UA 1D3YA 2LF7A 1VQ9I 1FWZA 3GTKJ 1ULYA 5HNHA 4XMYA 2JVGA 2IA1A 2Y0MA 3K9TA 3LA7A 5M5YJ 3OS1A 5E8GA 1BW5A 1MNEA 1R4MB 3ZQGA 4IX7A 1ZELA 2ICWG 3DQVC 1TT5B 3TO7A 5EEGA 2E2IJ 3M1CA 2DBBA 5LHGA 4AIJA 3A1YA 2P0WA 2DA7A 4U7BA 2B0LA 2NRAC 3HJEA 4Y33A 5HDKA 2H1LA 1DUXC 3CO7C 3I59B 4A93J 2MFZA 3IC7A 2X6XA 2YX4A 5JHFA 3W6KB 1QA6A 5BPIA 3HSRA 1W7PA 1IC8A 5HLTA 1MSEC 3I55I 3BY6A 4R1HA 5E1WA 2D2WA 4L5EA 3I5UA 5FLVA 4NDLA 4C3IJ 3DXJF 4HNTA 3HZJA 2E34A 1F9NA 3M8FA 2WAEA 2XKPA 4W1UA 3TGNA 2CJJA 3F6OA 2PX9A 1LVKA 3MMYB 3QOPA 4BKXA 3IRQA 5B3SH 1JTXA 3E3VA 4CH7A 1FZPB 3WTTC 1R00A 2K02A 1HKSA 1ZYRF 1W36C 3G71I 5JLXA 3MAJA 1FYMA 2FOKA 4W97A 1DPUA 1FY7A 1VZ0A 1TW2A 3D0SA 4XRFA 2EH3A 2DDAA 4F92B 1JJ8C 2IA0A 1UELB 3DPUA 2PLYA 4D1QA 5LLQA 1H9GA 4A3IJ 2WY8Q 3KZYA 3A01B 1DP7P 4HZFA 4CHUA 4I98B 1LE8B 3S3MA 2JA7J 3GTOJ 3OYIA 1FOYA 1YJNI 2ZNZA 4ESBA 3S16J 2DT5A 2IEKA 3D5LA 3GFLA 1G3SA 3TOAA 3ZN0A 5E8IA 1ZGWA 3FMRA 2WV0A 4HW0A 2OF7A 1FYLA 1IG7A 2CYYA 1JE8A 2XAGA 2FOWA 1IZ1A 1U5TA 2LBFB 2M3AA 1SFXA 3RQ4A 1FOKA 2H27A 2KJBA 2JA8J 3E7LA 5ILVA 1J0RA 3KYLA 3P9IA 2AS5F 3FF5A 2STTA 3J7AO 3H9GA 3FISA 3OIQA 3OYAA 4E7KA 2WAQA 2XAHA 5GTIC 4KYWA 2B9SA 1UZCA 5CQEA 3OYFA 1KQ8A 1T39A 1EH6A 1WZ2A 3VSLA 2LD5A 3ISPA 2LF8A 1BN5A 2LOOA 4IQ4A 2IGNA 3GW2A 4LIVA 1Y0UA 3EUHA 3F8BA 1YS6A 1BI2A 4A3CJ 3OYJA 2ID3A 1BOBA 1I6XA 2FE3A 1OKRA 3V8JA 1I3AA 1T56A 1IN7A 3PO3J 2H6CA 1IRFA 3PFIA 3T8TA 2HTJA 4DZJA 1AHDP 1N78A 4IF4A 5K5QA 3J81K 2P7CB 1I3QJ 1UHWA 2M87A 3FWEA 1ETKA 2R7FA 2G9WA 2EINH 2FU4A 5J8CA 4EJTA 3FMQA 3QOEA 5FFXA 1J9IA 4BHCA 3I64A 3M7GA 1G3YA 5F0CA 3IL2A 1S72I 2WC2A 1YTYA 1MZBA 1HA8A 2JSCA 3CJNA 2HYJA 3FK7A 4CCNA 5E3OA 3VYRB 1REPC 2VQGA 2W24A 1XN7A 3KP4A 2DJIA 2EILH 1J7KA 4U0VA 5D5WB 2IVMA 1WKMA 2M5WA 1LJ9A 1E3PA 2MBFA 3QWLA 2ELJA 3V7RA 2L54A 2MC3A 3LFKA 4K2EA 2X6YA 3HPHA 5HDNA 2KRFA 4HDVA 2HVQA 4QLCU 4YG2F 2ME0A 3X2QH 3IKTA 1MGTA 4F3QA 4P96A 2R7WA 2QWWA 2A5YB 4Y17A 1MSFC 2X6OA 2FXAA 4NC8A 3K70C 3GFMA 2ZMEB 1B8IA 4B1RA 5M3FJ 2IPQX 3U9GA 2ME6A 5HOOA 3KETA 2DOAA 1TW3A 4PFPA 3PUBA 2CW8A 4S04A 1IGNA 5AIQA 3MKLA 5IYDJ 2KFDA 2KQRA 3JR9A 2DT7B 3OIPA 2MW8A 1XD7A 3RI4A 2HDCA 3UKGA 1AWCA 4LLGF 3FXMA 2X85A 2KT0A 2OJED 3FK6A 1UHMA 3HOYJ 1JUSA 2FRHA 3CMAI 3HOUJ 1MH3A 2IW5A 2OPTA 4AYBA 2L9NA 3BR2A 2M0MA 2W48A 3KYCB 2RREA 4XLFA 3RKQA 1EH8A 4L9JA 4MO7A 2QF7A 4Y13A 1XMKA 2V79A 4HX4A 1NH3A 3L1PA 4XOPA 2VASA 3P9KA 5FO5A 4A3GJ 5EGOB 1MMGA 2CQKA 4UB6C 1J59A 2R7SA 3R0JA 2P4WA 4N4OB 4X6AJ 1TWFJ 3BG5A 1K78B 2ZFWA 1BIBA 3PFYA 4IRHA 3FIWA 4B44A 1XSXA 3E0JB 4M9ZA 5JR3A 4PJMA 2A07F 2DA3A 4EV0A 3ECHA 3NARA 3CF5F 2RN7A 1U78A 3FHNA 3CP2A 2F4IA 2OQGA 4LOCA 2KRCA 3CDIA 5K5RA 4IRGA 3JRIA 3DU6A 5F27A 1R71A 2XV4S 4HLXA 1H9TA 4ZZLA 4ZYDA 2EFWA 1KU7A 3IH2A 2W1OA 4UY8I 4BQQA 1QHHD 1E3OC 5J1RA 2MA3A 1F36A 3VFZA 1Z1DA 3H3ZA 4L0YB 4PCQA 5DV5A 1JJ6C 2IS4A 2HKXA 2RNGA 2XRNA 3OL4A 4BY7J 2V26A 1PDNC 4RB0A 1GVJA 3AL0C 1WPKA 1Z6TA 3BWGA 5IPAA 2JSPA 1MMSA 2XAQA 2DMPA 3LAPA 2HXIA 2R7DA 1FOXA 2LP0A 2OCEA 2JMWA 3EPZA 1PVEA 1A6QA 2HOTA 2GLOA 2A5WA 3HOTA 1FBUA 4DYCA 3S2HJ 2LY9A 4RB1A 3BZ6A 3F8CA 2CV0A 2BGCA 4D5CA 5LEJA 1MBKA 3DCFA 2JA2A 5K7HA 3BDDA 1BC7C 2JA6J 3S1MJ 2VI6A 3I59A 2E7XA 1MNMC 5IYCJ 2EZLA 3N97A 1OPCA 2YPRA 3BR5A 1L3LA 4XL9A 1A36A 3DPTA 2NVYJ 3WTUC 3QQAA 2GA1A 5IP6A 3R4KA 3BR0A 4HYEA 1H88C 4D9JA 4RAZA 4EM1A 4KNYA 2XVCA 2CWEA 3GTMJ 2CFXA 3CCYA 2R7UA 1XMAA 5EYRA 5CLSA 3E5QA 1VQ4I 4BQNA 4ENJA 2VB6A 4L9NA 4BL0B 4ZTFA 3BR1A 1QZYA 2VBZA 5DS9A 2XF5A 3HGYA 2IGMA 2QKLB 3TQNA 1BIAA 1NG7A 3PSFA 2BHZA 2VKHA 2OZUA 2BY0A 1YIJI 3S3NA 2ZJ2A 1OJLA 1OYYA 3GTLJ 3ZN1A 1WSUA 1OCRH 3K1PA 4G94A 4OWRB 5LRSA 3A01A 1JKOC 1LE8A 1DGRM 1KU3A 3K4NA 2CQNA 5E1XA 3MKZA 1O4XA 4I09A 3I4MJ 4FHTA 3AL0B 3L2RA 1G59A 1ONVA 4U88A 1SD6A 4B43A 3FBIB 4P9FA 5HDGA 1R6RA 4MLOA 4WWCA 1YHQI 4MQVA 5BMZA 3RPUD 1AOYA 1W36D 3MD2A 1HW2A 3VDXA 1K79A 3PIOF 3ZXSA 2RVCA 3M8EA 1X58A 2LBFA 2HZTA 5GADJ 3BTCA 3Q9VA 1G8XA 1MNDA 5FKLA 1BR1A 3G1OA 4D5FA 4JX4A 3MZ8A 4IXAA 1BC8C 3KE2A 1KYZA 2VPLA 5FGMA 2IBDA 3FX3A 4KJZA 4LD5A 2ZCWA 3D1NI 3HEFA 4KIFA 1UMQA 2XASA 1U8RA 3CCUI 6PAXA 1KQ0A 3PNTA 2GM4A 5BPDA 4WXCA 4G6QA 4OIRF 1GUUA 2IRFG 2BXZA 2GQQA 4DOZA 1ZREA 2ZSIB 4NQWB 3ZQFA 2J5OA 2NXNB 3F9KA 3TP3A 1QPIA 1YW7A 1WJCA 4MQ9F 1T8IA 2K9SA 1PJRA 2VJIA 3GFIA 2FBIA 5D5UB 1UAAA 3REOA 2KLOA 2GIZA 3I4PA 1N75A 2OBPA 2ZXWH 1YE9A 4GRIA 5JI6A 4EM0B 3J7ZI 3VSKA 3CDHA 5M5WJ 2BBYA 4RAYA 1MIJA 5F6FA 3RPUA 2KMUA 3WGHA 2FMLA 3F8NA 2LNBA 4C3JJ 2TRTA 4ZYHA 4KA4A 4O3MA 3LSRA 5KAIC 3GZ6A 2LKSA 1S5LC 2WB1N 4DNCA 2EQRA 2R7OA 2A05A 2E19A 3K4KA 3OS2A 4LIUA 4OIPF 2UV1A 1OR7C 1P6RA 2NNYA 2E2HJ 2DFEA 1SD5A 2QSFX 4A0ZA 1RRJA 1AU7A 3ZRGA 5FRNA 1SAUA 3GWZA 1NK3P 2CV2A 2V9PA 1E3HA 2IGOA 5DYMA 4N4NB 4UV8A 3ZMTA 1I27A 3C3WA 1VQPI 2P5VA 1LDJA 4QPOA 3COAC 2W82A 5GPCA 1GVDA 2PBIA 2Y31A 4L9TA 3L2QA 2Y0SN 3VODA 1K6OA 1YRNB 4IO9F 5DEQA 3S17J 1XSVA 3JAMK 3E1SA 2BVLA 3HSFA 2DFHA 3EUKL 5CPRB 3DBHB 1GHCA 3C2BA 4BHBA 1FTZA 2IAIA 2K5CA 2OZ6A 4G6DA 4U87A 4G7ZF 3RKXA 5GTHC 2V1DA 2ELHA 2HQAA 4E7SA 3HSEA 2DPUA 3QYFA 1OCTC 1R23A 1IW7F 2NS0A 2WWYA 4UNOA 2HYFA 4CYCB 1LEAA 2MH2A 2DQLA 2GXGA 2UWMA 2V1UA 1YJ9I 3K70D 3HUGB 1LPQA 2Z2SB 1MBEA 3DKYA 5DUKA 3RKWA 1LKXA 4MFEA 2GOMA 2XPVA 3M07A 4XBFA 2EA2A 1ZHFA 1TLHB 4E4HA 1P4WA 4IOAF 1K78A 2ECBA 1W5SA 4Q5SF 4BJTA 1P2FA 1W1WE 4UVCA 5BNGA 3HPGA 3OR2C 5E3MA 2STWA 1EF4A 2QKMB 3TMOA 4XQFA 3KP3A 5GAEJ 5EEAA 3W2VA 2HXOA 2IS6A 4BXXJ 1AA7A 4GYIA 1TT0A 2L3DA 3H1CA 3QPTA 1HDDC 2HU9A 1EKEA 3WU2C 3DTKA 3MN2A 2KDZA 2QQ9A 4ENMA 1FP2A 4OAZA 4N0BA 3ZQ7A 4NNJA 2BHYA 1B8IB 4A3EJ 2H8WA 4NC6A 1VFCA 2H1KA 4PJJA 3BG7A 4LMYA 5CJ9A 4YRVA 4V2FA 1YQAA 1R1TA 1S3JA 5LHIA 1F43A 4XR6A 3E6DA 3MVPA 3JRFA 2EBIA 3HRUA 3K10A 4D0PA 4G6TB 3K4LA 2VJ4A 3QP5A 4U7DA 3JRCA 3SJMA 1IN6A 1ETWA 1JKRC 2HZDA 1Q1VA 2MH9A 2EJRA 4GDFA 1ETVA 3DWLE 3OYKA 3IP4B 1A04A 3HC7A 5F1RA 2VE9A 3T8RA 2EV0A 3H9JA 2E36A 3NEUA 4LLNA 1RNLA 1LNWA 2Z16A 5F04A 4XRSG 4B3AA 3H5RA 4OAYA 4AU7A 1SC7A 2M1BA 1F4KA 3SZGA 2KL4A 2XSJC 5IP7J 3JW4A 1KQ9A 4A3BJ 3UNGC 1QRYA 5ERIA 1S7EA 5HS9A 2CV1A 1GT0C 3B02A 5H20A 3BCBA 3ONQA 2ZC2A 1XGNA 5FFZA 4PJNA 2W84A 3BTJA 1ZLJA 2D1VA 3AAFA 3T5XA 2XAFA 1MKMA 2X51A 1MMDA 2E71A 1X1AA 2LTPA 1W5CC 2XF7A 1B6AA 5D5XB 4JK1X 1IXRC 4GCVA 2R0QC 3CCLI 2AQEA 1JI8A 1QGPA 1X4OA 3ZMUA 1D1CA 3S32A 2YU3A 4CZZA 1EA3A 2ESHA 3PL8A 1ON2A 1ZN2A 3SZTA 2KIQA 5K1YA 3LSTA 1ZAOA 4HQMA 3LL7A 5D6FA 3DEUA 1ZLKA 4QIWN 2X4HA 1IUFA 5CVJA 4ZH4F 2DMTA 2EIJH 4G9YA 1RESA 3HOXJ 2UXXA 3BR6A 1ZR2A 4FTHA 3DEEA 4MGRA 1SANA 3CCMI 1X3WB 4Y3OA 1HQCA 2XHKA 4XN0A 2CS3A 3HRSA 2LRDA 4Q48A 4E70A 1IN4A 1J75A 4UUTA 1K61A 4Z6YA 3B6CA 3DTEA 3QU3A 5ICGA 5DCFA 1OYWA 1FT9A 5KHDA 3CESA 4KN7X 2ESNA 2UUZA 1LDKB 4IZZA 2JRTA 3DLLF 5E3NA 3V7CA 3WE3A 2FD5A 3CLQA 3K4JA 5GAHJ 3HRTA 2LMDA 4E7HA 2W4SA 2EB7A 1ACIA 4ZYAA 1R58A 4ENKA 2LKPA 2K9MA 3DFGA 1DQUA 3KP5A 2VT2A 1R9TJ 3HOVJ 2ZJRF 2L7KA 3SEZA 1O3TA 2F48A 5DCMB 3S8PA 4M6XA 2ECCA 4DW6A 2HOSA 3IUOA 4KT6A 4BQAA 3RZDJ 5B1BH 2L4AA 2WB1A 4RA2A 4XICA 2DMQA 3A02A 3VPRA 1IRZA 3JSOA 2VJJA 3BJ6A 2RKHA 2XB5A 4Y4RA 4RGXA 2IS1A 4F55A 3AG4H 1MJ9A 4A3LJ 2VODA 4I0BA 1DU6A 4ETSA 2VBWA 2HTSA 1FYKA 1B9NA 2CUEA 5C4XJ 5A2QZ 2O6GE 4NQWA 2VBXA 1R22A 1IN5A 3AG1H 5F1JA 3V8KA 4V2GA 4H0EA 2O8XA 1X1PA 2L02A 1OISA 3BPXA 2X1EA 3JTHA 3OYMA 4HV5A 3HOZJ 3R60A 3CJQB 2Y0SA 3CUQB 1XSDA 4UB8C 5LRRA 5F0HA 1JGGA 1S8NA 1LFBA 2QBYB 4RDUA 2MLGA 1JHFA 3TBIA 3O8GA 2M45A 4F7ZA 3W6VA 3M1EA 4C9YA 4WXHA 2DJNA 2QGUA 5IY5H 2XGEA 4IVNA 2L2OA 4I2OA 4DQ2A 3ZMDA 1QVTA 3G73A 2Y48A 1Z9CA 4BS9A 2GXAA 3DKWA 4M9SA 3BT9A 4WXDA 1GXPA 3FKIJ 1RPWA 3R0AA 4OOIA 2YU9J 4L0ZB 4GXOA 2NVXJ 1U3EM 4NHJA 1VQ7I 4HX8A 1TQIA 3ZR8X 1HKTA 2GOXB 3MFKA 1ZARA 2W7NA 3WHCA 3ZGKA 4B09A 2ZB9A 1YRNA 2LREA 4AIHA 2JN6A 1QZEA 4ENNA 2JWTA 3LNQA 4FX0A 5ICEA 2K85A 4BEHA 1P9QC 4XORA 4PK4A 2M30A 5D8LB 2VLAA 2CQXA 1ZR4A 2CH0A 3GTQJ 2YX7A 4BXFA 5DM7F 3JSPA 2JK3A 2DCEA 4ZDOA 1USTA 4CCMA 3A03A 4P5OA 4HNUA 1B4AA 5CQGA 1IO2A 2R93J 5ED4A 3K69A 1SD7A 1Y6IA 3NWTA 3J80K 3CMYA 1D8KA 2FQ3A 4CYCA 1Y8QB 4G7OF 3F8MA 4PSWA 2QVOA 2I10A 5DDGA 4I7HA 5LEKA 1TNTA 2VC0A 3HUGA 3HGGA 4IOCF 4L5JA 4E7ZA 4M3GA 4CO8A 4BXUA 2HNHA 4A0XA 4WCGA 4S05A 1BBYA 3HL2A 1T33A 5HS8A 1W0TA 2RC4A 3Q5FA 2F5FA 3KEOA 3RQIA 3WTVC 1CQTA 2PJRB 3PQKA 1JTYA 1R1UA 1B72A 2DO7A 1VQMI 1CF7B 3LSMA 1IRGA 2BV6A 2VE8A 5H6QA 3KCCA 1A31A 4EJUA 1Z0XA 2V4JC 3OY9A 1YYVA 5J47A 2VC1A 1OQYA 4UVAA 2DYSH 1AKHB 2FBKA 1YLFA 3A0HC 1MDMB 3P5JA 4M3EA 1T6SA 2JJ7A 3DP7A 1NG6A 3C2HA 4XLCA 1J2XA 5GPAA 2TDXA 4UVBA 1I1GA 3PNYA 3RYPA 3SYTA 3SFZA 4DYQA 1OR7A 1HW1A 4LK1F 1D0XA 1WJDA 1RI7A 2CGPA 1X2MA 3IHUA 1LFPA 1YX3A 4DZPA 3CC4I 4M3BA 4MFDA 4RLFA 1MW7A 2DODA 4NBQA 2XAUA 5F08A 5BS6A 2QSHX 4RB3C 3M4OJ 1YFHA 5D8KB 4F93B 4E6KG 2YS9A 1S29A 4BBSJ 4FT8A 2QEXI 3KEQA 3DPLC 1XPXA 4MHGA 4L5IA 2A61A 2ISZA 4II2A 2A6HF 3IAM2 1YI2I 2KIUA 2QENA 3UR3C 1QNTA 1FC3A 2LLKA 3GF2A 3I3LA 4EGYA 2LK2A 4JOMA 1T2KA 1X19A 3V7SA 2Y30A 3DEWA 3BPVA 1TZLA 1V5EA 4Z2YA 2E1OA 2EWNA 3IV5A 4UUVA 4CDGA 4CYDA 1F5TA 1MBFA 1WJEA 2QYOA 1PP8F 4GYGA 1TWAJ 3C1DA 3TL4X 2XF6A 3SDGA 1Z7LA 5JVTA 2L01A 4BNCA 1OLTA 3LSJA 1LDDA 5IT9Z 2P8TA 2E7WA 2K3FA 3D5RC 2GBYA 4LB6B 3QPLA 1V5FA 1I6HJ 2KIFA 2H94A 2JUCA 2KZVA
chains in the Genus database with same CATH topology
2KLOA 3SEQA 2W00A 1N75A 4QPQA 3L2VA 2MC4A 5TGTA 4ANJA 2R7VA 1YE9A 3OL3A 4DIQA 2VJ5A 4GRIA 3VSKA 4IKFA 2KRHA 3K4CA 3QYEA 3K4BA 2KMUA 3PNVA 3KEYA 4FETA 1X1DA 3FDYA 4XLHA 3VWBA 3DKXA 2R7OA 3BLYA 1U0JA 3K4KA 4LITA 3OS2A 2X6WA 4YEJA 4LIUA 4C2UA 1FMWA 5FRMA 3RCOA 2UV1A 1OR7C 4BDYA 2HVRA 4PFOA 3RSNA 4PJLA 4RLQA 2RQQA 3C2GA 1SAUA 3ZRGA 5FRNA 2JUGA 2CV2A 2V1NA 2IGOA 3W2WA 2MD0A 4N4NB 2E1MB 4HPQA 4QPOA 2BOLA 4BACA 2M4KA 2W82A 3L2WA 2R7TA 3L2QA 1Z21A 4DJAA 1ERDA 2K9LA 3LSKA 3VYTB 3E1SA 3G2BA 2BVLA 5CPRB 4BGDA 3EUKL 5HNHA 4BE2A 4B48A 4XMYA 2JVGA 4ZTJA 5CKTA 3OS1A 4JQFA 2K5CA 1MNEA 4U87A 4B3XA 2HVSA 2ZFUA 4IX7A 2L9SA 1ZELA 3DTIA 2HQAA 3DQVC 4E7SA 3QYFA 3I9V2 3LFUA 3HOSA 3M1CA 3A1YA 2P0WA 2IGKA 4U7BA 2UWMA 3K70D 2IXSA 4Y33A 3HUGB 2Z2SB 3DKYA 1LKXA 2OV7A 2OUMA 2GOMA 4CZCA 2MFZA 2X6XA 2VIXA 5JHFA 4E4HA 1WJ5A 5HLTA 2WADA 4BJTA 1X4PA 3HPGA 3OR2C 1D1BA 2QKMB 4CCOA 3TMOA 4XQFA 1DGWY 4HNTA 3W2VA 2IS6A 1AA7A 2WAEA 4HEA2 1TT0A 4XKVA 2CUJA 4FASD 1LVKA 1Z3XA 3MMYB 2E5ZA 2HU9A 4BUPA 3DTKA 4CH7A 4BJ5C 3HXLA 4OAZA 4DGWB 1W36C 4NNJA 4LG3A 4PJJA 3BG7A 1VZ0A 4YRVA 3OWTA 2KPMA 4CSWA 4F92B 2DXIA 4XR6A 3OMYA 2BW3B 1UELB 3K10A 3AFHA 3DPUA 4G6TB 3M8JA 3S93A 2WY7Q 3K4LA 4HSTA 1WJFA 2VJ4A 2WY8Q 4D1QA 4RM2A 2HZDA 3S3MA 2CUZA 3OR1C 3OYIA 2KHMA 3DWLE 3OYKA 1SFKA 3IP4B 4XKWA 2NOJB 3HC7A 2LC2A 3D5LA 3H9JA 1BR4A 4XOTA 4XKBA 3PSIA 2VL8A 2F5VA 2Z16A 3K4MA 4R79A 2WA0A 3H5RA 2M3AA 2VQHA 2LBFB 4OAYA 3RQ4A 2R4GA 4AU7A 1Y56A 4J00A 2LH9A 4B47A 3KYLA 3SZGA 4HG2A 2ZXIA 3H9GA 2KL4A 3OIQA 3OYAA 2XSJC 4E7KA 2WAQA 3UNGC 2O5RA 2LY2A 2Z1DA 2PJRA 5CQEA 3OYFA 4E7LA 2CV1A 5LFAA 1YX5A 3VSLA 3BCBA 3ONQA 2LOOA 5HNFA 4IQ4A 3RTRA 4PJNA 2IGNA 4LIVA 1QHGA 3OS0A 2X51A 4KISA 4C30A 4CCJA 4DBRA 4ZJZA 3OYJA 1BOBA 1MMDA 2JVHA 1X1AA 3H9QA 4H4KC 2XF7A 2MABA 2VQLA 2E5NA 5LD2C 2KP6A 1N78A 2AQEA 1JI8A 2M7AA 1X4OA 1D1CA 2VKDA 3S32A 5KNLA 1EA3A 2CMPA 3PL8A 1DP3A 3QOEA 3LL7A 4J01A 4BEHB 2PMZA 3DEEA 2HPMA 3K6GA 3HG9A 1HA8A 2WAFA 2Q2EB 3CP8A 4Y3OA 4XN0A 1IRXA 2CS3A 2M7BA 2LRDA 4CCNA 3VYRB 2VQGA 4ZC3A 2DJIA 3DTEA 2BVMA 2WBMA 3CESA 5KHDA 2UUZA 1LDKB 4IZZA 3MKYB 4BDZA 4YELA 4AVZA 2ELJA 2R7XA 1D1AA 3LSIA 3K4JA 2X6YA 3HPHA 4P1WA 4E7HA 2W4SA 4ZYAA 2HVQA 3OYNA 5FROA 2K9MA 2DT6A 1DQUA 1S9HA 4F3QA 1K6YA 3A2KA 2L7KA 2R7WA 3DLAA 3H5AA 3SEZA 4II3A 3ZCOA 3S8PA 4NC8A 3K70C 2XDVA 1WJAA 3IUOA 3CMMA 4KT6A 2WB1A 2VJJA 5HOOA 2DOAA 4Y4RA 4E7JA 4PFPA 2IS1A 3PUBA 1WJBA 4PSXA 2CW8A 4F55A 2R7RA 3OYDA 5HVQC 2KQRA 2DT7B 3OIPA 4XLEA 1Z3YA 2X85A 3MKWB 3H35A 2F6CA 1KONA 3H0DA 3IAS2 4IQJA 2VXZA 2LYCA 2L9NA 2X1EA 2M0MA 2ZSHB 4AYBA 3OYMA 2HDWA 2RREA 3CJQB 2Y0SA 4XLFA 4KITB 4NUBA 4EATA 4XOPA 2KDOA 2VASA 3J7AY 1MMGA 2CFOA 2R7SA 3EUHC 4BQOA 2I8DA 3TBIA 3U21A 4N4OB 3VYUB 3H5NA 1MMAA 3HKZA 4C9YA 2V6EA 3PFYA 4B44A 3E0JB 4RMNA 2L2OA 2VQCA 3W2AA 1BR2A 4PJMA 1D0ZA 4BS9A 4DBQA 3FBNB 3KX2A 3FHNA 3PJRA 3CP2A 2E60A 3W3CA 2F4IA 2KRCA 4ZDPA 3DU6A 2MYSA 3S3OA 2AQFA 3AKZA 3ZR8X 3LSGA 2W1OA 4BQQA 1QHHD 2R7QA 1J09A 2GOXB 3ZQQA 2W7NA 3ZGKA 2IS4A 2RNGA 2LREA 4BE0A 3QODA 3OL4A 4F91B 2V26A 2L5QA 4BJ6C 3OYCA 3AL0C 2JSPA 4BEHA 4CUGA 1P9QC 2FUG2 4XORA 4PK4A 2VLAA 2CH0A 4BXFA 4ZDLA 1T95A 3N05A 2DCEA 4ZDOA 3OYEA 1N77A 3EPZA 4CCMA 4P5OA 4HNUA 1V5GA 5CQGA 3BCAA 2A5WA 3HOTA 3L2UA 1Y6IA 3NWTA 2CV0A 2A6TA 4PSWA 3GBGA 5KCMA 4BE1A 2JA2A 2X1DA 3V42A 4XLAA 3OOUA 4E7ZA 2HNHA 2V7FA 4BU2A 3HL2A 4XN3A 1D0YA 3EUAA 2LY1A 2PJRB 3DU5A 1WFXA 4XL9A 3DPTA 3SDBA 3LSMA 3LMMA 1X1CA 4XM3A 3OY9A 2V4JC 4D9JA 4CA0A 1X1BA 2R7UA 4CCLA 3VYSB 4XKCA 4C2TA 3D5SC 4BQNA 4ZTFA 2VB6A 4BL0B 1NG6A 4HSRA 4XNFA 3C2HA 3OYBA 2XF5A 4XLCA 3CF2A 3SYTA 3PNYA 2IGMA 2QKLB 1D0XA 2VXDA 1NG7A 1WJDA 4RM3A 4E7IA 4CCKA 3PSFA 2KZVA 1QU3A 1LFPA 1YX3A 2VKHA 1MMNA 4RLFA 1MW7A 3OYGA 3S3NA 2BW3A 2XAUA 1UG0A 4OWRB 2X1CA 3FKJA 1DGRM 3K4NA 3MKZA 2Q1ZB 3A4CA 4XONA 4F93B 2LG4A 3AL0B 3QYBA 4E6KG 3L2RA 1G59A 4B43A 3FBIB 3OYHA 3DPLC 2E1MC 1R6RA 4MLOA 1E0EA 3RPUD 4II2A 1W36D 2OC6A 3MD2A 3IAM2 2K3PA 3UR3C 3VDXA 3ZXSA 3I3LA 2LBFA 4JOMA 1GLNA 1G8XA 1MNDA 1X19A 1BR1A 2HPIA 3CJRB 4PUSA 4ITVA 1TZLA 1V5EA 4HRIA 2VPLA 4F52A 4KJZA 1WJEA 3BC8A 2ZXHA 3TL4X 2V9KA 2XF6A 3CZ6A 1Z7LA 4X0GA 3PNTA 3LSHA 1FMVA 1OLTA 2IS2A 2CW7A 3NWSA 3D5RC 1V5FA 1PYVA 3OYLA 4DOZA 4NC7A 2ZSIB 4NQWB 2M4GA 3F9KA 1WJCA 1PJRA 2VJIA 3BG6A 1UAAA 2XC7A 1T0FC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1T0F C; 
#chains in the Genus database with same CATH topology
 1NK2 P;  2BY1 A;  1P92 A;  2E1N A;  3CDL A;  3L2V A;  4D7N A;  3T1B A;  2HOA A;  2EFN A;  1Y1W J;  1IXC A;  3HBL A;  3KLN A;  5J1Y A;  3K4B A;  2EZI A;  3E5X A;  2GAU A;  3RDI A;  2Z33 A;  5ICC A;  2CSO A;  4FET A;  1H0M A;  1ZH5 A;  1STZ A;  2COB A;  2FSW A;  3RYR A;  3L7W A;  5K5O A;  5JVG F;  4XLH A;  5F64 A;  3DKX A;  3WHB A;  3ERM A;  4LIT A;  2CU7 A;  4DYR A;  3LSP A;  2ADU A;  5FRM A;  3AG3 H;  5CVI A;  4PJL A;  3RSN A;  5M5X J;  1JUM A;  3GTP J;  2ZKZ A;  2RQQ A;  2XPU A;  3C2G A;  2DA1 A;  1TQP A;  1Z91 A;  2AO9 A;  3K2A A;  4JBA A;  1G4D A;  2EFQ A;  2V1N A;  3W2W A;  5HLH A;  3E6C C;  4HPQ A;  4BAC A;  2M4K A;  2EZK A;  5DCM A;  3U1K A;  2PN6 A;  2X0L A;  4KIB A;  4HAM A;  1Y39 A;  2QCO A;  3ML6 A;  4M3F A;  1ERD A;  2DA6 A;  3VYT B;  1VQL I;  1ZRD A;  4FCY A;  3G2B A;  4J19 A;  2GXB A;  2DK8 A;  1S7A A;  4BE2 A;  4B48 A;  4HF2 A;  3KLO A;  1R1V A;  2VON A;  3CQZ J;  2DLL A;  3OOP A;  2RNJ A;  3HHH A;  1LB2 A;  3HKZ N;  1L0O C;  3Q0U A;  4HF1 A;  2EPF A;  1DPR A;  2ZFU A;  2L9S A;  2P5K A;  1FBQ A;  4XSZ F;  3I9V 2;  3LFU A;  3F8F A;  3CCQ I;  2F5C A;  2KIS A;  3HOS A;  5EG0 B;  3P7N A;  2FX0 A;  2FBH A;  2K4B A;  3JRE A;  3GZ5 A;  1OCP A;  2IGK A;  3CUQ A;  5JFR A;  4M9X A;  3Q9S A;  2FJ1 A;  3O8H A;  2M2E A;  3WTW C;  4XLP F;  2BE5 F;  1TWH J;  5FKO A;  2QBY A;  2OV7 A;  2E2J J;  4CZC A;  4KIG A;  1WJ5 A;  2EZH A;  2MLK A;  1YW9 A;  2WAD A;  2OD5 A;  1TNS A;  1N25 A;  4C3H J;  4Y15 A;  4QSH A;  1XC5 A;  1K4S A;  5JLW A;  1P7I A;  3B6A A;  4YIF A;  1D1B A;  3F3X A;  2N8G A;  4FE7 A;  1DGW Y;  1O7L A;  1B1B A;  1OCC H;  4KIC A;  2HQR A;  2GIV A;  1T98 A;  1VI0 A;  2ZO4 A;  1TP4 A;  4UV9 A;  2NVU B;  4XKV A;  1NHA A;  5E3L A;  5IT3 A;  1W0U A;  1HBX G;  1QQI A;  1Z3X A;  4GO1 A;  1SVO A;  2LR8 A;  3I58 A;  4BJ5 C;  3HXL A;  5L3F A;  2V9V A;  4DGW B;  1G3W A;  4XRS A;  1FLI A;  3BZK A;  1WGX A;  3ABL H;  1MH4 A;  5ICF A;  3I53 A;  1I50 J;  5EDN A;  1OCZ H;  3K1M A;  3I71 A;  3OMY A;  1K4T A;  1I39 A;  2BW3 B;  3KP2 A;  5EF6 A;  4YIR X;  1FNN A;  3IH3 A;  3AFH A;  1WQ2 A;  1VQ6 I;  1WJF A;  2HEO A;  4RM2 A;  2K9N A;  3ZOB A;  3FXK A;  2FA5 A;  2P81 A;  4O6J A;  3OR1 C;  2KHM A;  2DOE A;  2R5Z A;  5C44 J;  3GLX A;  1GV2 A;  1ZG1 A;  4XOT A;  1IXS B;  4IL6 C;  4WF2 A;  2VL8 A;  2F5V A;  3LA3 A;  1O3S A;  2ISY A;  3K4M A;  2VQH A;  1SEU A;  1HCR A;  3CCJ I;  3BP8 A;  2LH9 A;  2GZW A;  4B47 A;  3HIF A;  3S15 J;  2ZXI A;  1TL8 A;  3BRO A;  1UJ8 A;  3W6J B;  5LGN A;  3WTY C;  1HKQ A;  3T0Y A;  2O5R A;  2Z1D A;  1DDN A;  2M0C A;  2PJR A;  4E7L A;  5LFA A;  1R5H A;  1YX5 A;  4OMY A;  2O0Y A;  2UZK A;  1LQ1 A;  1CF7 A;  1R4N B;  5K7Z A;  1QHG A;  3WU0 A;  3BTI A;  4IHV A;  3OS0 A;  2FMY A;  1ZKG A;  4KIS A;  3GTG J;  1XB4 A;  4DBR A;  4EJV A;  1UCR A;  1ZGA A;  3F21 A;  1POG A;  1AKH A;  3H9Q A;  3E97 A;  3ULQ B;  2MAB A;  5HLI A;  2E5N A;  4I99 C;  1MDM A;  1A35 A;  3IKV A;  2XAJ A;  2M7A A;  4XID A;  3ECO A;  2Q8K A;  1ITY A;  5HLG A;  5KNL A;  3S2D J;  5J3L A;  5J6X A;  1JKP C;  3BG3 A;  1DP3 A;  2O03 A;  3CME I;  2VOP A;  1PP7 U;  2R5Y B;  4G8X A;  5TJJ A;  4BEH B;  5CVV A;  5H2F C;  3K6G A;  1ETQ A;  5HOD A;  5FJ8 J;  3CP8 A;  1HF0 A;  3G6E I;  4LFU A;  5BOX A;  1O7F A;  2M7B A;  5J40 A;  2ID6 A;  4Y7N J;  4FIS A;  1I5Z A;  4IJA A;  4ZC3 A;  2XGC A;  3O6B B;  5AON A;  5GAG J;  4AWX B;  4RBO A;  3ZQL A;  4BDZ A;  1UG2 A;  4YEL A;  4Q4Z F;  2XB0 X;  3LA2 A;  1FPQ A;  4M6Y A;  2KZG A;  3PUF A;  5DM6 F;  3LWF A;  3WGG A;  4S0H B;  3TDZ C;  1U9N A;  3OYN A;  5FRO A;  3GYH X;  1K6Y A;  3A2K A;  3DLA A;  5E20 A;  5KK1 A;  4II3 A;  1ZRC A;  1UFM A;  4MIM A;  3ZCO A;  4YFN F;  5FB2 A;  3N4M A;  1WJA A;  4JYK A;  3CMM A;  5FKN A;  3WE2 A;  1IJW C;  1Z05 A;  1B72 B;  5ILU A;  4E7J A;  4A5N A;  4ESF A;  2JT1 A;  1VQO I;  1R5I D;  3CCS I;  3OYD A;  5HVQ C;  1TBX A;  2PI0 A;  2ACJ A;  1JUP A;  5AIP A;  5L3G A;  1JT0 A;  4RB2 C;  3C7J A;  1CGP A;  4HX7 A;  1T08 B;  3H35 A;  1MJB A;  1G2H A;  3TO6 A;  1E17 A;  1JHH A;  2ZXJ A;  3HOW J;  2LYC A;  2PFB A;  1TWG J;  2QM3 A;  1ZK8 A;  1YS7 A;  2CQQ A;  3CCE I;  1RR8 C;  4NUB A;  4EAT A;  3DBR B;  2V6C A;  3CLO A;  5J1U A;  4ZYG A;  2RDP A;  2CFO A;  2F4M B;  2K27 A;  4GFB A;  1VQN I;  2Y69 H;  2HGC A;  1B9M A;  5E18 F;  3VYU B;  3BOQ A;  5TRD A;  1FJL A;  5FKM A;  3ZQC A;  1LEB A;  1ZTR A;  1MMA A;  3TDU C;  3HKZ A;  1QVU A;  2PMU A;  3S14 J;  4RMN A;  3ZMV A;  1ZG3 A;  4DBQ A;  3FBN B;  5C3E J;  5L3D A;  2HQ5 A;  4LB5 A;  2BZT A;  1HDP A;  3KX2 A;  4WK8 F;  3Q0V A;  2D1H A;  3W3C A;  4YII A;  5EZH A;  2NS7 A;  3H3V K;  2VBY A;  1HST A;  2H6B A;  1FOW A;  3O2P E;  4ZDP A;  4B4C A;  3G4S I;  2AQF A;  3ASO H;  4MTD A;  1MJA A;  2R7Q A;  4HLY A;  1J09 A;  3SQN A;  2EV6 A;  3K7A J;  4OMZ A;  1E2X A;  2HKO A;  2YSR A;  3L00 A;  4NB5 A;  4R8H A;  3GXO A;  4BE0 A;  3QOD A;  4JX5 A;  2R92 J;  3B73 A;  2W25 A;  2L5Q A;  5D6E A;  3OYC A;  4HQE A;  3KZI C;  3GO5 A;  5ILS A;  2PQ8 A;  4I76 A;  3G1M A;  4B8X A;  2FUG 2;  5KAF C;  1BM9 A;  2UXN A;  4LGW A;  4RGS A;  4WX9 A;  5J8F A;  4UUS B;  3OYE A;  4A6E A;  1V5G A;  3CCV I;  1X3Z B;  2XRO A;  3K2Z A;  2A69 F;  2DTZ A;  3L2U A;  4QTR A;  3ZPL A;  5EG0 A;  2DFI A;  3NQO A;  2F5E A;  3DBL B;  3FHZ A;  3BG9 A;  3GLL A;  3S1R J;  1SMT A;  2JQ7 A;  5KCM A;  4BE1 A;  2MG4 A;  3TW7 A;  2MSY A;  2L0K A;  2KJC A;  3OOU A;  3EET A;  2V7F A;  4BU2 A;  2DQR A;  3FZV A;  4XN3 A;  1D0Y A;  3EUA A;  3WG7 H;  1IUY A;  2LY1 A;  3ELK A;  1S7O A;  3DU5 A;  1FSH A;  3BQZ A;  4IHS A;  3ABU A;  3F72 A;  1WFX A;  3TP0 A;  4M71 A;  1YIO A;  3S1Q J;  3LMM A;  1X1C A;  1IF1 A;  2Y75 A;  3K1N A;  2X9D A;  1XTA A;  3CUO A;  1IDY A;  5TIS C;  4CA0 A;  3JRG A;  1X1B A;  1BI0 A;  5CYV A;  4PDK A;  3VYS B;  4CCL A;  4EGZ A;  1V55 H;  3WTS C;  1O3R A;  4PGH A;  1WH7 A;  4XKC A;  4BY1 J;  3D5S C;  1U6G A;  2A68 F;  4HSR A;  4RAF A;  1XGO A;  4XNF A;  4IRI A;  1ODD A;  2JRM A;  2L9R A;  2EIK H;  2WTE A;  2R7Z J;  2QQB A;  2D5V A;  2B7E A;  2L7M P;  3OIO A;  4RM3 A;  4E7I A;  3H3U A;  4CCK A;  4EQQ A;  4KDP A;  1QU3 A;  1QO0 D;  1MMN A;  1R7J A;  1S6L A;  3OYG A;  4AVP A;  3LOC A;  2BW3 A;  4ZYE A;  3JRB A;  5LGT A;  2OA4 A;  2X1C A;  1W4M A;  1ZG5 A;  1V4R A;  4JP0 A;  1SAX A;  4XON A;  3QYB A;  3LQQ A;  3EYI A;  2EFO A;  3CD6 I;  1WRJ A;  3OYH A;  4KN4 X;  4ESJ A;  2E1M C;  2OTL I;  5FD5 A;  2OC6 A;  4U0W A;  4AC0 A;  3JCU C;  2JZY A;  5GP9 A;  4IHT A;  2DW4 A;  3TOB A;  1ETX A;  2RV8 A;  1GLN A;  4RAG A;  2HPI A;  4C2M J;  2W57 A;  4PUS A;  2I5U A;  4HBL A;  2O3F A;  2V1X A;  5FLM J;  3QPS A;  4FX4 A;  2F4O B;  3AG2 H;  1VTN C;  4FQG A;  1HC8 A;  3BC8 A;  2DU9 A;  2PMZ N;  1GV5 A;  2V9K A;  3CZ6 A;  2KIM A;  4CXF A;  1QPM A;  3JRA A;  2K7L A;  3QP6 A;  1SVM A;  3FXU A;  5IOZ A;  3OYL A;  4LG0 A;  2Z99 A;  1UB9 A;  2GWR A;  2CG4 A;  2HS5 A;  2M4G A;  1MBG A;  2DOF A;  3RKY A;  5FLX Z;  1ZRF A;  5F0F A;  3I54 A;  2XPW A;  1P4A A;  1T0F C;  3H0G J;  4A3D J;  5EEH A;  3RJP A;  3SEQ A;  2W00 A;  3L2C A;  1D8J A;  1ZQ3 P;  4QPQ A;  5TGT A;  1FSE A;  1YOV B;  3G3Z A;  4HA8 A;  1TTY A;  2R5Y A;  2R7V A;  3HB9 A;  2ZME C;  1WHU A;  5D5V B;  3C18 A;  3ERE D;  3PIP F;  1K7A A;  5EZG A;  3GX4 X;  2Z5U A;  4QWQ A;  2X48 A;  3K4C A;  3QYE A;  2HFH A;  3PNV A;  2DYR H;  1X1D A;  2XGX A;  2R5Z B;  1BJA A;  1BL0 A;  3GEZ A;  3IWF A;  2OU2 A;  3FDY A;  4OIQ F;  1G3T A;  3VWB A;  3BLY A;  3PO2 J;  1U0J A;  2DA2 A;  2PEX A;  5FD6 A;  4YEJ A;  2R3S A;  3GUD A;  4RS8 A;  4C2U A;  1J5Y A;  4BDY A;  2HVR A;  4PFO A;  2HYG D;  2VOO A;  3DF8 A;  3SZP A;  3JTG A;  3SFI A;  3QRF F;  3MEX A;  2E1M B;  3CC2 I;  3OSG A;  3L2W A;  2K4J A;  5H6R A;  1RR7 A;  2LDU A;  3FXR A;  2JA5 J;  1WWX A;  4RGR A;  3JRD A;  3KP7 A;  3GME A;  4LJZ F;  3HM5 A;  3LSK A;  3RZO J;  2QQ8 A;  1GDT A;  1MBJ A;  2KKO A;  4BGD A;  1WCM J;  3BJA A;  4ZTJ A;  5CKT A;  2A3S A;  2P5L C;  4JQF A;  2HVS A;  4B3X A;  2D45 A;  3TED A;  3ZMZ A;  4A2U A;  4LLL A;  3DTI A;  2RGV A;  3Q3S A;  2Y9Z A;  4TV7 A;  4XLN F;  2ZBK A;  5CVU A;  3O3K A;  2IXS A;  4P55 A;  1Q1H A;  2HOE A;  5DD8 A;  1FP1 D;  1P4X A;  3QAH A;  2OUM A;  4M72 A;  2H8R A;  1BI1 A;  2BY3 A;  2EA4 A;  2VIX A;  2VN2 A;  1ON1 A;  1VND A;  4A6D A;  1EJ9 A;  3S1N J;  1Y0N A;  5KVR A;  2ELK A;  1X4P A;  3ZQI A;  3EQL F;  4JX6 A;  3F6V A;  4CCO A;  3FM3 A;  2M9H A;  2JPB A;  3BJO A;  3FXQ A;  2WV1 A;  4HV6 A;  5L3E A;  4PZJ A;  4HEA 2;  4YFK F;  1P7J A;  2CUJ A;  2K86 A;  3KYD B;  4FAS D;  3JAM Z;  4M6V A;  3ASN H;  1FEX A;  2E5Z A;  2L7F P;  5E79 C;  2AXL A;  4ON0 A;  2G0E A;  4BUP A;  4KUM A;  2ETH A;  1I1S A;  2IJL A;  2VKV A;  2CQ7 A;  3BZC A;  3MCZ A;  4L18 B;  1KA8 A;  3R61 A;  4LK0 F;  3VOE A;  2DMU A;  1NTC A;  1Z77 A;  1KGS A;  1RET A;  4LG3 A;  4OIN F;  2M34 A;  3A0B C;  3OWT A;  4IHW A;  2KPM A;  2CW0 F;  4CSW A;  3E6B A;  2DXI A;  2HQN A;  2EIM H;  3M8J A;  2WY7 Q;  3S93 A;  4HST A;  3KFW X;  1XG1 A;  4UUS A;  1YG2 A;  2CUZ A;  3VEP A;  1SD4 A;  3HTS B;  1FTT A;  1SFK A;  1UHS A;  1XDS A;  3CC7 I;  4XKW A;  1TC3 C;  2NOJ B;  2DPD A;  2LC2 A;  2K9Q A;  1BR4 A;  1EV7 A;  4UHT A;  3RIR A;  3GVA A;  5L3C A;  4XKB A;  3Q0W A;  1XGS A;  1ETY A;  3PSI A;  1FBS A;  2VUM J;  1MD0 A;  5K7F A;  1WVR A;  4R79 A;  2WA0 A;  1F1Z A;  2BEO A;  3ESW B;  3FM5 A;  2R4G A;  1Y56 A;  4J00 A;  3ZMS A;  4BYY A;  4HG2 A;  3WG9 A;  3WTZ A;  1XS9 A;  2LY2 A;  1TWC J;  2PJP A;  1BW6 A;  2CUF A;  4XRM A;  2VKE A;  2RAE A;  5FKK A;  1JGS A;  5HNF A;  4MEY F;  2K40 A;  3RTR A;  1XX5 A;  1LVA A;  3PQJ A;  4Q47 A;  5LHH A;  3SXY A;  1RKT A;  2M8E A;  3RPQ A;  1HLV A;  4C30 A;  4CCJ A;  1YW8 A;  4ZJZ A;  1IV6 A;  4EJW A;  2JVH A;  2FF4 A;  4H4K C;  4KT5 C;  5LD2 C;  2VQL A;  2AHQ A;  2AXT C;  2KP6 A;  4KFC A;  3WTX C;  4IHY A;  2M8G X;  3H36 A;  4I01 A;  5M3M J;  1SFU A;  1RC9 A;  2VKD A;  2DA5 A;  4UXN A;  2CMP A;  5B5E C;  2IT0 A;  2HWV A;  4A3M J;  2XIG A;  5DD4 A;  3OSF A;  1TQM A;  2CRG A;  2DDB A;  1BOA A;  3ZP5 A;  4J01 A;  1MBH A;  2PMZ A;  1PUF B;  2NVT J;  5A2Q K;  1JT6 A;  3HDD A;  2YR2 A;  2ZJQ F;  2HPM A;  4ABZ A;  4EEF G;  3HG9 A;  5HS7 A;  2EV5 A;  4KMU X;  2WAF A;  2Q2E B;  4XK4 A;  5BQT A;  3OV8 A;  1IRX A;  1KU2 A;  1SMY F;  3MZH A;  5E17 F;  3KPH A;  3L9F A;  5B1A H;  1VQK I;  2BVM A;  3BQY A;  2JTV A;  3F0C A;  3IWZ A;  4AID A;  2WBM A;  3F22 A;  3MKY B;  2HI3 A;  1X3U A;  4AVZ A;  2QLZ A;  2R7X A;  4O5V A;  1D1A A;  2J5P A;  3LSI A;  4A3J J;  2NAZ A;  3CTA A;  2EK5 A;  4P1W A;  2OQR A;  2XKO A;  4IEJ A;  2YUS A;  5CVR A;  4A5M A;  2QA4 I;  1R49 A;  1IDZ A;  1OFC X;  2DT6 A;  1S9H A;  1R36 A;  3GFJ A;  1HW5 A;  3P9C A;  3H5A A;  3TKY A;  3S2W A;  2ZNY A;  4G7H F;  2P7V B;  3FXJ A;  2XDV A;  1OYI A;  1PUE E;  1XDU A;  2OAZ A;  5D4S A;  2HR3 A;  4BH9 A;  3HHG A;  1WJB A;  4PSX A;  4PGG A;  2R7R A;  1GXQ A;  1BJZ A;  2ZJP F;  4XSX F;  5FLX K;  4XLE A;  1FX7 A;  1FIP A;  1U5T C;  2A6E F;  2FNA A;  3ABT A;  4EVI A;  1Z3Y A;  3V4G A;  1Z7U A;  5LGU A;  4BHP A;  2L9V A;  2F6C A;  3TW6 A;  3MKW B;  4PJ0 C;  4CGZ A;  1KON A;  2DTR A;  3H0D A;  2DA4 A;  3IAS 2;  4IQJ A;  2VXZ A;  2ZSH B;  4L9V A;  2HDW A;  1XCV A;  2OTJ I;  4KIT B;  3J7Y J;  1B59 A;  2JPC A;  2KDO A;  3J7A Y;  2H09 A;  4D7M A;  3BR3 A;  3EUH C;  2IA2 A;  4AD9 A;  4MEX F;  4BQO A;  2I8D A;  3U21 A;  3LQR A;  2OCC H;  2GA2 A;  3ABM H;  3EDP A;  1W7P B;  3H5N A;  5EJC A;  1A6I A;  1VF9 A;  3NAU A;  1XCB A;  2V6E A;  1IV8 A;  1VQ8 I;  1U9O A;  5JHU A;  1YIT I;  2VQC A;  2L4M A;  3E6M A;  2P6T A;  3W2A A;  1BR2 A;  2O9L A;  1D0Z A;  1VQ5 I;  5LBQ A;  4BAY A;  1USS A;  4AM3 A;  3PJR A;  1QBJ A;  2E60 A;  3QPH A;  3S3O A;  2MYS A;  4A69 C;  1JXS A;  3PM1 A;  1U8B A;  3AKZ A;  2O8K A;  5DUI A;  1RKW A;  3KIO A;  3LSG A;  4V19 K;  3GTJ J;  3DV8 A;  3ZQQ A;  4G12 A;  3HYI A;  2NYX A;  3I4N J;  2EFP A;  2Q0O A;  4F91 B;  1K83 J;  2FEZ A;  2PG4 A;  2TCT A;  2RQP A;  4BJ6 C;  9ANT A;  1V3F A;  2IP2 A;  4CUG A;  1RUN A;  4KMF A;  4I6Z A;  4ZDL A;  1T95 A;  4LG0 B;  3EYY A;  3N05 A;  2BYV E;  2DI3 A;  1N77 A;  2COM A;  4AUX A;  3WU1 B;  1U2W A;  1Y1V J;  3BCA A;  3E5U A;  4RGU A;  3CJT B;  3JRH A;  1OMI A;  2W85 A;  2A6T A;  4I0A A;  3R6S A;  4A3K J;  1YO5 C;  1U5T B;  3GBG A;  2XSD C;  4GGG A;  3F23 A;  3MZY A;  2X1D A;  3V42 A;  4HOB A;  4XLA A;  1HXD A;  3IRR A;  1LFU P;  1T0F A;  1ENH A;  3QU6 A;  3ROU A;  4A3F J;  2G7H A;  4M3D A;  1R5G A;  2Z9O A;  2ZME A;  3SDB A;  4XM3 A;  5DTD A;  3G1L A;  2DK5 A;  1EH7 A;  1XMX A;  1JKQ C;  2B63 J;  5D4R A;  1D5V A;  1LUJ B;  4IHX A;  3WOD F;  2NVQ J;  2XGD A;  1D5Y A;  3ZQH A;  4OU0 A;  4C2T A;  2NS8 A;  2PMH A;  1IAW A;  3BTL A;  2E35 A;  4HDU A;  1IN8 A;  3OYB A;  3CF2 A;  2LSO A;  4CIC A;  4MTE A;  1BA5 A;  1O57 A;  5IT9 K;  2VXD A;  1WH5 A;  3J81 Z;  2E1C A;  5C4J J;  3J80 Z;  1G6N A;  5EGO A;  1KU9 A;  2O61 A;  2QUF A;  2WAQ N;  1HOM A;  1UG0 A;  3FXO A;  1SFE A;  3FKJ A;  3M9A A;  5IOY A;  2Q1Z B;  3HTU A;  3A4C A;  4M74 A;  3KZZ A;  2LG4 A;  4EJO A;  1V54 H;  3LAJ A;  1W5T A;  1SFO J;  1X2N A;  2LKX A;  1WI3 A;  1E0E A;  3SHF A;  4HF0 A;  4MNU A;  3ABK H;  2F2E A;  2K3P A;  1RUO A;  5E1Z B;  3FXL A;  3MQ0 A;  5L3B A;  4M73 A;  1YJW I;  2F5D A;  3CJR B;  1H89 C;  2Y2Z A;  4ITV A;  3TO9 A;  5J4V A;  1Y8R B;  4HRI A;  4F52 A;  1APL C;  4EMS A;  3M3Y J;  2ZXH A;  4HNV A;  1O3Q A;  3K0L A;  2XUB A;  1SVL A;  2O7O A;  4X0G A;  2MD5 A;  3LSH A;  2L7Z A;  2NNN A;  4U0Y A;  1FMV A;  3GZN B;  2IS2 A;  2QZ8 A;  2CW7 A;  2CO5 A;  3NWS A;  3H92 A;  1RIO H;  2QQA A;  1RZ4 A;  1PYV A;  4NC7 A;  2QSG X;  3U1D A;  4ASN A;  2Z3Y A;  2VPR A;  4FE4 A;  4YFX F;  1T38 A;  2NOG A;  3NRV A;  2VT3 A;  2DMN A;  3BG6 A;  2XC7 A;  3GCM A;  2BY2 A;  3VB2 A;  1FIA A;  5IP9 J;  3CCR I;  3WGI A;  2MC4 A;  1M1E B;  2FQ4 A;  1XGM A;  4ANJ A;  2LFB A;  4I02 A;  1PUF A;  2DFF A;  3OL3 A;  4DIQ A;  2VJ5 A;  4X1E A;  1KZH A;  4IKF A;  4A12 A;  2KRH A;  1OCO H;  3U2R A;  1BI3 A;  2Q2E A;  1A5J A;  3I0T A;  2DN0 A;  3KEY A;  1C0W A;  1WI9 A;  4AIK A;  4EM2 A;  2LVS A;  3KP6 A;  4ZZD A;  2FNP A;  2G7U A;  2MGQ A;  2P6S A;  4OIO F;  3IH4 A;  2BXY A;  1KYW A;  2X6W A;  3FMS A;  4Y52 J;  3L09 A;  1Z67 A;  2C6Y A;  4BBR J;  1FMW A;  4N9H A;  3RCO A;  2DAO A;  1H8A C;  1W7P D;  3HRM A;  1HSJ A;  1ETO A;  4RLQ A;  2HDD A;  3CUQ C;  1QZZ A;  1ZGJ A;  4N9I A;  2JUG A;  2XRL A;  3MWM A;  5B66 C;  2MD0 A;  5IYB J;  5J4Y A;  4A0Y A;  1DU0 A;  3V8L A;  2BOL A;  2Y9Y A;  4AYB N;  2R7T A;  1Z21 A;  4DJA A;  3I56 I;  1Z6R A;  1ORK A;  4IPA A;  2K9L A;  3CO6 C;  4P9U A;  1D3Y A;  2LF7 A;  1VQ9 I;  1FWZ A;  3GTK J;  1ULY A;  5HNH A;  4XMY A;  2JVG A;  2IA1 A;  2Y0M A;  3K9T A;  3LA7 A;  5M5Y J;  3OS1 A;  5E8G A;  1BW5 A;  1MNE A;  1R4M B;  3ZQG A;  4IX7 A;  1ZEL A;  2ICW G;  3DQV C;  1TT5 B;  3TO7 A;  5EEG A;  2E2I J;  3M1C A;  2DBB A;  5LHG A;  4AIJ A;  3A1Y A;  2P0W A;  2DA7 A;  4U7B A;  2B0L A;  2NRA C;  3HJE A;  4Y33 A;  5HDK A;  2H1L A;  1DUX C;  3CO7 C;  3I59 B;  4A93 J;  2MFZ A;  3IC7 A;  2X6X A;  2YX4 A;  5JHF A;  3W6K B;  1QA6 A;  5BPI A;  3HSR A;  1W7P A;  1IC8 A;  5HLT A;  1MSE C;  3I55 I;  3BY6 A;  4R1H A;  5E1W A;  2D2W A;  4L5E A;  3I5U A;  5FLV A;  4NDL A;  4C3I J;  3DXJ F;  4HNT A;  3HZJ A;  2E34 A;  1F9N A;  3M8F A;  2WAE A;  2XKP A;  4W1U A;  3TGN A;  2CJJ A;  3F6O A;  2PX9 A;  1LVK A;  3MMY B;  3QOP A;  4BKX A;  3IRQ A;  5B3S H;  1JTX A;  3E3V A;  4CH7 A;  1FZP B;  3WTT C;  1R00 A;  2K02 A;  1HKS A;  1ZYR F;  1W36 C;  3G71 I;  5JLX A;  3MAJ A;  1FYM A;  2FOK A;  4W97 A;  1DPU A;  1FY7 A;  1VZ0 A;  1TW2 A;  3D0S A;  4XRF A;  2EH3 A;  2DDA A;  4F92 B;  1JJ8 C;  2IA0 A;  1UEL B;  3DPU A;  2PLY A;  4D1Q A;  5LLQ A;  1H9G A;  4A3I J;  2WY8 Q;  3KZY A;  3A01 B;  1DP7 P;  4HZF A;  4CHU A;  4I98 B;  1LE8 B;  3S3M A;  2JA7 J;  3GTO J;  3OYI A;  1FOY A;  1YJN I;  2ZNZ A;  4ESB A;  3S16 J;  2DT5 A;  2IEK A;  3D5L A;  3GFL A;  1G3S A;  3TOA A;  3ZN0 A;  5E8I A;  1ZGW A;  3FMR A;  2WV0 A;  4HW0 A;  2OF7 A;  1FYL A;  1IG7 A;  2CYY A;  1JE8 A;  2XAG A;  2FOW A;  1IZ1 A;  1U5T A;  2LBF B;  2M3A A;  1SFX A;  3RQ4 A;  1FOK A;  2H27 A;  2KJB A;  2JA8 J;  3E7L A;  5ILV A;  1J0R A;  3KYL A;  3P9I A;  2AS5 F;  3FF5 A;  2STT A;  3J7A O;  3H9G A;  3FIS A;  3OIQ A;  3OYA A;  4E7K A;  2WAQ A;  2XAH A;  5GTI C;  4KYW A;  2B9S A;  1UZC A;  5CQE A;  3OYF A;  1KQ8 A;  1T39 A;  1EH6 A;  1WZ2 A;  3VSL A;  2LD5 A;  3ISP A;  2LF8 A;  1BN5 A;  2LOO A;  4IQ4 A;  2IGN A;  3GW2 A;  4LIV A;  1Y0U A;  3EUH A;  3F8B A;  1YS6 A;  1BI2 A;  4A3C J;  3OYJ A;  2ID3 A;  1BOB A;  1I6X A;  2FE3 A;  1OKR A;  3V8J A;  1I3A A;  1T56 A;  1IN7 A;  3PO3 J;  2H6C A;  1IRF A;  3PFI A;  3T8T A;  2HTJ A;  4DZJ A;  1AHD P;  1N78 A;  4IF4 A;  5K5Q A;  3J81 K;  2P7C B;  1I3Q J;  1UHW A;  2M87 A;  3FWE A;  1ETK A;  2R7F A;  2G9W A;  2EIN H;  2FU4 A;  5J8C A;  4EJT A;  3FMQ A;  3QOE A;  5FFX A;  1J9I A;  4BHC A;  3I64 A;  3M7G A;  1G3Y A;  5F0C A;  3IL2 A;  1S72 I;  2WC2 A;  1YTY A;  1MZB A;  1HA8 A;  2JSC A;  3CJN A;  2HYJ A;  3FK7 A;  4CCN A;  5E3O A;  3VYR B;  1REP C;  2VQG A;  2W24 A;  1XN7 A;  3KP4 A;  2DJI A;  2EIL H;  1J7K A;  4U0V A;  5D5W B;  2IVM A;  1WKM A;  2M5W A;  1LJ9 A;  1E3P A;  2MBF A;  3QWL A;  2ELJ A;  3V7R A;  2L54 A;  2MC3 A;  3LFK A;  4K2E A;  2X6Y A;  3HPH A;  5HDN A;  2KRF A;  4HDV A;  2HVQ A;  4QLC U;  4YG2 F;  2ME0 A;  3X2Q H;  3IKT A;  1MGT A;  4F3Q A;  4P96 A;  2R7W A;  2QWW A;  2A5Y B;  4Y17 A;  1MSF C;  2X6O A;  2FXA A;  4NC8 A;  3K70 C;  3GFM A;  2ZME B;  1B8I A;  4B1R A;  5M3F J;  2IPQ X;  3U9G A;  2ME6 A;  5HOO A;  3KET A;  2DOA A;  1TW3 A;  4PFP A;  3PUB A;  2CW8 A;  4S04 A;  1IGN A;  5AIQ A;  3MKL A;  5IYD J;  2KFD A;  2KQR A;  3JR9 A;  2DT7 B;  3OIP A;  2MW8 A;  1XD7 A;  3RI4 A;  2HDC A;  3UKG A;  1AWC A;  4LLG F;  3FXM A;  2X85 A;  2KT0 A;  2OJE D;  3FK6 A;  1UHM A;  3HOY J;  1JUS A;  2FRH A;  3CMA I;  3HOU J;  1MH3 A;  2IW5 A;  2OPT A;  4AYB A;  2L9N A;  3BR2 A;  2M0M A;  2W48 A;  3KYC B;  2RRE A;  4XLF A;  3RKQ A;  1EH8 A;  4L9J A;  4MO7 A;  2QF7 A;  4Y13 A;  1XMK A;  2V79 A;  4HX4 A;  1NH3 A;  3L1P A;  4XOP A;  2VAS A;  3P9K A;  5FO5 A;  4A3G J;  5EGO B;  1MMG A;  2CQK A;  4UB6 C;  1J59 A;  2R7S A;  3R0J A;  2P4W A;  4N4O B;  4X6A J;  1TWF J;  3BG5 A;  1K78 B;  2ZFW A;  1BIB A;  3PFY A;  4IRH A;  3FIW A;  4B44 A;  1XSX A;  3E0J B;  4M9Z A;  5JR3 A;  4PJM A;  2A07 F;  2DA3 A;  4EV0 A;  3ECH A;  3NAR A;  3CF5 F;  2RN7 A;  1U78 A;  3FHN A;  3CP2 A;  2F4I A;  2OQG A;  4LOC A;  2KRC A;  3CDI A;  5K5R A;  4IRG A;  3JRI A;  3DU6 A;  5F27 A;  1R71 A;  2XV4 S;  4HLX A;  1H9T A;  4ZZL A;  4ZYD A;  2EFW A;  1KU7 A;  3IH2 A;  2W1O A;  4UY8 I;  4BQQ A;  1QHH D;  1E3O C;  5J1R A;  2MA3 A;  1F36 A;  3VFZ A;  1Z1D A;  3H3Z A;  4L0Y B;  4PCQ A;  5DV5 A;  1JJ6 C;  2IS4 A;  2HKX A;  2RNG A;  2XRN A;  3OL4 A;  4BY7 J;  2V26 A;  1PDN C;  4RB0 A;  1GVJ A;  3AL0 C;  1WPK A;  1Z6T A;  3BWG A;  5IPA A;  2JSP A;  1MMS A;  2XAQ A;  2DMP A;  3LAP A;  2HXI A;  2R7D A;  1FOX A;  2LP0 A;  2OCE A;  2JMW A;  3EPZ A;  1PVE A;  1A6Q A;  2HOT A;  2GLO A;  2A5W A;  3HOT A;  1FBU A;  4DYC A;  3S2H J;  2LY9 A;  4RB1 A;  3BZ6 A;  3F8C A;  2CV0 A;  2BGC A;  4D5C A;  5LEJ A;  1MBK A;  3DCF A;  2JA2 A;  5K7H A;  3BDD A;  1BC7 C;  2JA6 J;  3S1M J;  2VI6 A;  3I59 A;  2E7X A;  1MNM C;  5IYC J;  2EZL A;  3N97 A;  1OPC A;  2YPR A;  3BR5 A;  1L3L A;  4XL9 A;  1A36 A;  3DPT A;  2NVY J;  3WTU C;  3QQA A;  2GA1 A;  5IP6 A;  3R4K A;  3BR0 A;  4HYE A;  1H88 C;  4D9J A;  4RAZ A;  4EM1 A;  4KNY A;  2XVC A;  2CWE A;  3GTM J;  2CFX A;  3CCY A;  2R7U A;  1XMA A;  5EYR A;  5CLS A;  3E5Q A;  1VQ4 I;  4BQN A;  4ENJ A;  2VB6 A;  4L9N A;  4BL0 B;  4ZTF A;  3BR1 A;  1QZY A;  2VBZ A;  5DS9 A;  2XF5 A;  3HGY A;  2IGM A;  2QKL B;  3TQN A;  1BIA A;  1NG7 A;  3PSF A;  2BHZ A;  2VKH A;  2OZU A;  2BY0 A;  1YIJ I;  3S3N A;  2ZJ2 A;  1OJL A;  1OYY A;  3GTL J;  3ZN1 A;  1WSU A;  1OCR H;  3K1P A;  4G94 A;  4OWR B;  5LRS A;  3A01 A;  1JKO C;  1LE8 A;  1DGR M;  1KU3 A;  3K4N A;  2CQN A;  5E1X A;  3MKZ A;  1O4X A;  4I09 A;  3I4M J;  4FHT A;  3AL0 B;  3L2R A;  1G59 A;  1ONV A;  4U88 A;  1SD6 A;  4B43 A;  3FBI B;  4P9F A;  5HDG A;  1R6R A;  4MLO A;  4WWC A;  1YHQ I;  4MQV A;  5BMZ A;  3RPU D;  1AOY A;  1W36 D;  3MD2 A;  1HW2 A;  3VDX A;  1K79 A;  3PIO F;  3ZXS A;  2RVC A;  3M8E A;  1X58 A;  2LBF A;  2HZT A;  5GAD J;  3BTC A;  3Q9V A;  1G8X A;  1MND A;  5FKL A;  1BR1 A;  3G1O A;  4D5F A;  4JX4 A;  3MZ8 A;  4IXA A;  1BC8 C;  3KE2 A;  1KYZ A;  2VPL A;  5FGM A;  2IBD A;  3FX3 A;  4KJZ A;  4LD5 A;  2ZCW A;  3D1N I;  3HEF A;  4KIF A;  1UMQ A;  2XAS A;  1U8R A;  3CCU I;  6PAX A;  1KQ0 A;  3PNT A;  2GM4 A;  5BPD A;  4WXC A;  4G6Q A;  4OIR F;  1GUU A;  2IRF G;  2BXZ A;  2GQQ A;  4DOZ A;  1ZRE A;  2ZSI B;  4NQW B;  3ZQF A;  2J5O A;  2NXN B;  3F9K A;  3TP3 A;  1QPI A;  1YW7 A;  1WJC A;  4MQ9 F;  1T8I A;  2K9S A;  1PJR A;  2VJI A;  3GFI A;  2FBI A;  5D5U B;  1UAA A;  3REO A;  2KLO A;  2GIZ A;  3I4P A;  1N75 A;  2OBP A;  2ZXW H;  1YE9 A;  4GRI A;  5JI6 A;  4EM0 B;  3J7Z I;  3VSK A;  3CDH A;  5M5W J;  2BBY A;  4RAY A;  1MIJ A;  5F6F A;  3RPU A;  2KMU A;  3WGH A;  2FML A;  3F8N A;  2LNB A;  4C3J J;  2TRT A;  4ZYH A;  4KA4 A;  4O3M A;  3LSR A;  5KAI C;  3GZ6 A;  2LKS A;  1S5L C;  2WB1 N;  4DNC A;  2EQR A;  2R7O A;  2A05 A;  2E19 A;  3K4K A;  3OS2 A;  4LIU A;  4OIP F;  2UV1 A;  1OR7 C;  1P6R A;  2NNY A;  2E2H J;  2DFE A;  1SD5 A;  2QSF X;  4A0Z A;  1RRJ A;  1AU7 A;  3ZRG A;  5FRN A;  1SAU A;  3GWZ A;  1NK3 P;  2CV2 A;  2V9P A;  1E3H A;  2IGO A;  5DYM A;  4N4N B;  4UV8 A;  3ZMT A;  1I27 A;  3C3W A;  1VQP I;  2P5V A;  1LDJ A;  4QPO A;  3COA C;  2W82 A;  5GPC A;  1GVD A;  2PBI A;  2Y31 A;  4L9T A;  3L2Q A;  2Y0S N;  3VOD A;  1K6O A;  1YRN B;  4IO9 F;  5DEQ A;  3S17 J;  1XSV A;  3JAM K;  3E1S A;  2BVL A;  3HSF A;  2DFH A;  3EUK L;  5CPR B;  3DBH B;  1GHC A;  3C2B A;  4BHB A;  1FTZ A;  2IAI A;  2K5C A;  2OZ6 A;  4G6D A;  4U87 A;  4G7Z F;  3RKX A;  5GTH C;  2V1D A;  2ELH A;  2HQA A;  4E7S A;  3HSE A;  2DPU A;  3QYF A;  1OCT C;  1R23 A;  1IW7 F;  2NS0 A;  2WWY A;  4UNO A;  2HYF A;  4CYC B;  1LEA A;  2MH2 A;  2DQL A;  2GXG A;  2UWM A;  2V1U A;  1YJ9 I;  3K70 D;  3HUG B;  1LPQ A;  2Z2S B;  1MBE A;  3DKY A;  5DUK A;  3RKW A;  1LKX A;  4MFE A;  2GOM A;  2XPV A;  3M07 A;  4XBF A;  2EA2 A;  1ZHF A;  1TLH B;  4E4H A;  1P4W A;  4IOA F;  1K78 A;  2ECB A;  1W5S A;  4Q5S F;  4BJT A;  1P2F A;  1W1W E;  4UVC A;  5BNG A;  3HPG A;  3OR2 C;  5E3M A;  2STW A;  1EF4 A;  2QKM B;  3TMO A;  4XQF A;  3KP3 A;  5GAE J;  5EEA A;  3W2V A;  2HXO A;  2IS6 A;  4BXX J;  1AA7 A;  4GYI A;  1TT0 A;  2L3D A;  3H1C A;  3QPT A;  1HDD C;  2HU9 A;  1EKE A;  3WU2 C;  3DTK A;  3MN2 A;  2KDZ A;  2QQ9 A;  4ENM A;  1FP2 A;  4OAZ A;  4N0B A;  3ZQ7 A;  4NNJ A;  2BHY A;  1B8I B;  4A3E J;  2H8W A;  4NC6 A;  1VFC A;  2H1K A;  4PJJ A;  3BG7 A;  4LMY A;  5CJ9 A;  4YRV A;  4V2F A;  1YQA A;  1R1T A;  1S3J A;  5LHI A;  1F43 A;  4XR6 A;  3E6D A;  3MVP A;  3JRF A;  2EBI A;  3HRU A;  3K10 A;  4D0P A;  4G6T B;  3K4L A;  2VJ4 A;  3QP5 A;  4U7D A;  3JRC A;  3SJM A;  1IN6 A;  1ETW A;  1JKR C;  2HZD A;  1Q1V A;  2MH9 A;  2EJR A;  4GDF A;  1ETV A;  3DWL E;  3OYK A;  3IP4 B;  1A04 A;  3HC7 A;  5F1R A;  2VE9 A;  3T8R A;  2EV0 A;  3H9J A;  2E36 A;  3NEU A;  4LLN A;  1RNL A;  1LNW A;  2Z16 A;  5F04 A;  4XRS G;  4B3A A;  3H5R A;  4OAY A;  4AU7 A;  1SC7 A;  2M1B A;  1F4K A;  3SZG A;  2KL4 A;  2XSJ C;  5IP7 J;  3JW4 A;  1KQ9 A;  4A3B J;  3UNG C;  1QRY A;  5ERI A;  1S7E A;  5HS9 A;  2CV1 A;  1GT0 C;  3B02 A;  5H20 A;  3BCB A;  3ONQ A;  2ZC2 A;  1XGN A;  5FFZ A;  4PJN A;  2W84 A;  3BTJ A;  1ZLJ A;  2D1V A;  3AAF A;  3T5X A;  2XAF A;  1MKM A;  2X51 A;  1MMD A;  2E71 A;  1X1A A;  2LTP A;  1W5C C;  2XF7 A;  1B6A A;  5D5X B;  4JK1 X;  1IXR C;  4GCV A;  2R0Q C;  3CCL I;  2AQE A;  1JI8 A;  1QGP A;  1X4O A;  3ZMU A;  1D1C A;  3S32 A;  2YU3 A;  4CZZ A;  1EA3 A;  2ESH A;  3PL8 A;  1ON2 A;  1ZN2 A;  3SZT A;  2KIQ A;  5K1Y A;  3LST A;  1ZAO A;  4HQM A;  3LL7 A;  5D6F A;  3DEU A;  1ZLK A;  4QIW N;  2X4H A;  1IUF A;  5CVJ A;  4ZH4 F;  2DMT A;  2EIJ H;  4G9Y A;  1RES A;  3HOX J;  2UXX A;  3BR6 A;  1ZR2 A;  4FTH A;  3DEE A;  4MGR A;  1SAN A;  3CCM I;  1X3W B;  4Y3O A;  1HQC A;  2XHK A;  4XN0 A;  2CS3 A;  3HRS A;  2LRD A;  4Q48 A;  4E70 A;  1IN4 A;  1J75 A;  4UUT A;  1K61 A;  4Z6Y A;  3B6C A;  3DTE A;  3QU3 A;  5ICG A;  5DCF A;  1OYW A;  1FT9 A;  5KHD A;  3CES A;  4KN7 X;  2ESN A;  2UUZ A;  1LDK B;  4IZZ A;  2JRT A;  3DLL F;  5E3N A;  3V7C A;  3WE3 A;  2FD5 A;  3CLQ A;  3K4J A;  5GAH J;  3HRT A;  2LMD A;  4E7H A;  2W4S A;  2EB7 A;  1ACI A;  4ZYA A;  1R58 A;  4ENK A;  2LKP A;  2K9M A;  3DFG A;  1DQU A;  3KP5 A;  2VT2 A;  1R9T J;  3HOV J;  2ZJR F;  2L7K A;  3SEZ A;  1O3T A;  2F48 A;  5DCM B;  3S8P A;  4M6X A;  2ECC A;  4DW6 A;  2HOS A;  3IUO A;  4KT6 A;  4BQA A;  3RZD J;  5B1B H;  2L4A A;  2WB1 A;  4RA2 A;  4XIC A;  2DMQ A;  3A02 A;  3VPR A;  1IRZ A;  3JSO A;  2VJJ A;  3BJ6 A;  2RKH A;  2XB5 A;  4Y4R A;  4RGX A;  2IS1 A;  4F55 A;  3AG4 H;  1MJ9 A;  4A3L J;  2VOD A;  4I0B A;  1DU6 A;  4ETS A;  2VBW A;  2HTS A;  1FYK A;  1B9N A;  2CUE A;  5C4X J;  5A2Q Z;  2O6G E;  4NQW A;  2VBX A;  1R22 A;  1IN5 A;  3AG1 H;  5F1J A;  3V8K A;  4V2G A;  4H0E A;  2O8X A;  1X1P A;  2L02 A;  1OIS A;  3BPX A;  2X1E A;  3JTH A;  3OYM A;  4HV5 A;  3HOZ J;  3R60 A;  3CJQ B;  2Y0S A;  3CUQ B;  1XSD A;  4UB8 C;  5LRR A;  5F0H A;  1JGG A;  1S8N A;  1LFB A;  2QBY B;  4RDU A;  2MLG A;  1JHF A;  3TBI A;  3O8G A;  2M45 A;  4F7Z A;  3W6V A;  3M1E A;  4C9Y A;  4WXH A;  2DJN A;  2QGU A;  5IY5 H;  2XGE A;  4IVN A;  2L2O A;  4I2O A;  4DQ2 A;  3ZMD A;  1QVT A;  3G73 A;  2Y48 A;  1Z9C A;  4BS9 A;  2GXA A;  3DKW A;  4M9S A;  3BT9 A;  4WXD A;  1GXP A;  3FKI J;  1RPW A;  3R0A A;  4OOI A;  2YU9 J;  4L0Z B;  4GXO A;  2NVX J;  1U3E M;  4NHJ A;  1VQ7 I;  4HX8 A;  1TQI A;  3ZR8 X;  1HKT A;  2GOX B;  3MFK A;  1ZAR A;  2W7N A;  3WHC A;  3ZGK A;  4B09 A;  2ZB9 A;  1YRN A;  2LRE A;  4AIH A;  2JN6 A;  1QZE A;  4ENN A;  2JWT A;  3LNQ A;  4FX0 A;  5ICE A;  2K85 A;  4BEH A;  1P9Q C;  4XOR A;  4PK4 A;  2M30 A;  5D8L B;  2VLA A;  2CQX A;  1ZR4 A;  2CH0 A;  3GTQ J;  2YX7 A;  4BXF A;  5DM7 F;  3JSP A;  2JK3 A;  2DCE A;  4ZDO A;  1UST A;  4CCM A;  3A03 A;  4P5O A;  4HNU A;  1B4A A;  5CQG A;  1IO2 A;  2R93 J;  5ED4 A;  3K69 A;  1SD7 A;  1Y6I A;  3NWT A;  3J80 K;  3CMY A;  1D8K A;  2FQ3 A;  4CYC A;  1Y8Q B;  4G7O F;  3F8M A;  4PSW A;  2QVO A;  2I10 A;  5DDG A;  4I7H A;  5LEK A;  1TNT A;  2VC0 A;  3HUG A;  3HGG A;  4IOC F;  4L5J A;  4E7Z A;  4M3G A;  4CO8 A;  4BXU A;  2HNH A;  4A0X A;  4WCG A;  4S05 A;  1BBY A;  3HL2 A;  1T33 A;  5HS8 A;  1W0T A;  2RC4 A;  3Q5F A;  2F5F A;  3KEO A;  3RQI A;  3WTV C;  1CQT A;  2PJR B;  3PQK A;  1JTY A;  1R1U A;  1B72 A;  2DO7 A;  1VQM I;  1CF7 B;  3LSM A;  1IRG A;  2BV6 A;  2VE8 A;  5H6Q A;  3KCC A;  1A31 A;  4EJU A;  1Z0X A;  2V4J C;  3OY9 A;  1YYV A;  5J47 A;  2VC1 A;  1OQY A;  4UVA A;  2DYS H;  1AKH B;  2FBK A;  1YLF A;  3A0H C;  1MDM B;  3P5J A;  4M3E A;  1T6S A;  2JJ7 A;  3DP7 A;  1NG6 A;  3C2H A;  4XLC A;  1J2X A;  5GPA A;  2TDX A;  4UVB A;  1I1G A;  3PNY A;  3RYP A;  3SYT A;  3SFZ A;  4DYQ A;  1OR7 A;  1HW1 A;  4LK1 F;  1D0X A;  1WJD A;  1RI7 A;  2CGP A;  1X2M A;  3IHU A;  1LFP A;  1YX3 A;  4DZP A;  3CC4 I;  4M3B A;  4MFD A;  4RLF A;  1MW7 A;  2DOD A;  4NBQ A;  2XAU A;  5F08 A;  5BS6 A;  2QSH X;  4RB3 C;  3M4O J;  1YFH A;  5D8K B;  4F93 B;  4E6K G;  2YS9 A;  1S29 A;  4BBS J;  4FT8 A;  2QEX I;  3KEQ A;  3DPL C;  1XPX A;  4MHG A;  4L5I A;  2A61 A;  2ISZ A;  4II2 A;  2A6H F;  3IAM 2;  1YI2 I;  2KIU A;  2QEN A;  3UR3 C;  1QNT A;  1FC3 A;  2LLK A;  3GF2 A;  3I3L A;  4EGY A;  2LK2 A;  4JOM A;  1T2K A;  1X19 A;  3V7S A;  2Y30 A;  3DEW A;  3BPV A;  1TZL A;  1V5E A;  4Z2Y A;  2E1O A;  2EWN A;  3IV5 A;  4UUV A;  4CDG A;  4CYD A;  1F5T A;  1MBF A;  1WJE A;  2QYO A;  1PP8 F;  4GYG A;  1TWA J;  3C1D A;  3TL4 X;  2XF6 A;  3SDG A;  1Z7L A;  5JVT A;  2L01 A;  4BNC A;  1OLT A;  3LSJ A;  1LDD A;  5IT9 Z;  2P8T A;  2E7W A;  2K3F A;  3D5R C;  2GBY A;  4LB6 B;  3QPL A;  1V5F A;  1I6H J;  2KIF A;  2H94 A;  2JUC A;  2KZV A; 
#chains in the Genus database with same CATH homology
 2KLO A;  3SEQ A;  2W00 A;  1N75 A;  4QPQ A;  3L2V A;  2MC4 A;  5TGT A;  4ANJ A;  2R7V A;  1YE9 A;  3OL3 A;  4DIQ A;  2VJ5 A;  4GRI A;  3VSK A;  4IKF A;  2KRH A;  3K4C A;  3QYE A;  3K4B A;  2KMU A;  3PNV A;  3KEY A;  4FET A;  1X1D A;  3FDY A;  4XLH A;  3VWB A;  3DKX A;  2R7O A;  3BLY A;  1U0J A;  3K4K A;  4LIT A;  3OS2 A;  2X6W A;  4YEJ A;  4LIU A;  4C2U A;  1FMW A;  5FRM A;  3RCO A;  2UV1 A;  1OR7 C;  4BDY A;  2HVR A;  4PFO A;  3RSN A;  4PJL A;  4RLQ A;  2RQQ A;  3C2G A;  1SAU A;  3ZRG A;  5FRN A;  2JUG A;  2CV2 A;  2V1N A;  2IGO A;  3W2W A;  2MD0 A;  4N4N B;  2E1M B;  4HPQ A;  4QPO A;  2BOL A;  4BAC A;  2M4K A;  2W82 A;  3L2W A;  2R7T A;  3L2Q A;  1Z21 A;  4DJA A;  1ERD A;  2K9L A;  3LSK A;  3VYT B;  3E1S A;  3G2B A;  2BVL A;  5CPR B;  4BGD A;  3EUK L;  5HNH A;  4BE2 A;  4B48 A;  4XMY A;  2JVG A;  4ZTJ A;  5CKT A;  3OS1 A;  4JQF A;  2K5C A;  1MNE A;  4U87 A;  4B3X A;  2HVS A;  2ZFU A;  4IX7 A;  2L9S A;  1ZEL A;  3DTI A;  2HQA A;  3DQV C;  4E7S A;  3QYF A;  3I9V 2;  3LFU A;  3HOS A;  3M1C A;  3A1Y A;  2P0W A;  2IGK A;  4U7B A;  2UWM A;  3K70 D;  2IXS A;  4Y33 A;  3HUG B;  2Z2S B;  3DKY A;  1LKX A;  2OV7 A;  2OUM A;  2GOM A;  4CZC A;  2MFZ A;  2X6X A;  2VIX A;  5JHF A;  4E4H A;  1WJ5 A;  5HLT A;  2WAD A;  4BJT A;  1X4P A;  3HPG A;  3OR2 C;  1D1B A;  2QKM B;  4CCO A;  3TMO A;  4XQF A;  1DGW Y;  4HNT A;  3W2V A;  2IS6 A;  1AA7 A;  2WAE A;  4HEA 2;  1TT0 A;  4XKV A;  2CUJ A;  4FAS D;  1LVK A;  1Z3X A;  3MMY B;  2E5Z A;  2HU9 A;  4BUP A;  3DTK A;  4CH7 A;  4BJ5 C;  3HXL A;  4OAZ A;  4DGW B;  1W36 C;  4NNJ A;  4LG3 A;  4PJJ A;  3BG7 A;  1VZ0 A;  4YRV A;  3OWT A;  2KPM A;  4CSW A;  4F92 B;  2DXI A;  4XR6 A;  3OMY A;  2BW3 B;  1UEL B;  3K10 A;  3AFH A;  3DPU A;  4G6T B;  3M8J A;  3S93 A;  2WY7 Q;  3K4L A;  4HST A;  1WJF A;  2VJ4 A;  2WY8 Q;  4D1Q A;  4RM2 A;  2HZD A;  3S3M A;  2CUZ A;  3OR1 C;  3OYI A;  2KHM A;  3DWL E;  3OYK A;  1SFK A;  3IP4 B;  4XKW A;  2NOJ B;  3HC7 A;  2LC2 A;  3D5L A;  3H9J A;  1BR4 A;  4XOT A;  4XKB A;  3PSI A;  2VL8 A;  2F5V A;  2Z16 A;  3K4M A;  4R79 A;  2WA0 A;  3H5R A;  2M3A A;  2VQH A;  2LBF B;  4OAY A;  3RQ4 A;  2R4G A;  4AU7 A;  1Y56 A;  4J00 A;  2LH9 A;  4B47 A;  3KYL A;  3SZG A;  4HG2 A;  2ZXI A;  3H9G A;  2KL4 A;  3OIQ A;  3OYA A;  2XSJ C;  4E7K A;  2WAQ A;  3UNG C;  2O5R A;  2LY2 A;  2Z1D A;  2PJR A;  5CQE A;  3OYF A;  4E7L A;  2CV1 A;  5LFA A;  1YX5 A;  3VSL A;  3BCB A;  3ONQ A;  2LOO A;  5HNF A;  4IQ4 A;  3RTR A;  4PJN A;  2IGN A;  4LIV A;  1QHG A;  3OS0 A;  2X51 A;  4KIS A;  4C30 A;  4CCJ A;  4DBR A;  4ZJZ A;  3OYJ A;  1BOB A;  1MMD A;  2JVH A;  1X1A A;  3H9Q A;  4H4K C;  2XF7 A;  2MAB A;  2VQL A;  2E5N A;  5LD2 C;  2KP6 A;  1N78 A;  2AQE A;  1JI8 A;  2M7A A;  1X4O A;  1D1C A;  2VKD A;  3S32 A;  5KNL A;  1EA3 A;  2CMP A;  3PL8 A;  1DP3 A;  3QOE A;  3LL7 A;  4J01 A;  4BEH B;  2PMZ A;  3DEE A;  2HPM A;  3K6G A;  3HG9 A;  1HA8 A;  2WAF A;  2Q2E B;  3CP8 A;  4Y3O A;  4XN0 A;  1IRX A;  2CS3 A;  2M7B A;  2LRD A;  4CCN A;  3VYR B;  2VQG A;  4ZC3 A;  2DJI A;  3DTE A;  2BVM A;  2WBM A;  3CES A;  5KHD A;  2UUZ A;  1LDK B;  4IZZ A;  3MKY B;  4BDZ A;  4YEL A;  4AVZ A;  2ELJ A;  2R7X A;  1D1A A;  3LSI A;  3K4J A;  2X6Y A;  3HPH A;  4P1W A;  4E7H A;  2W4S A;  4ZYA A;  2HVQ A;  3OYN A;  5FRO A;  2K9M A;  2DT6 A;  1DQU A;  1S9H A;  4F3Q A;  1K6Y A;  3A2K A;  2L7K A;  2R7W A;  3DLA A;  3H5A A;  3SEZ A;  4II3 A;  3ZCO A;  3S8P A;  4NC8 A;  3K70 C;  2XDV A;  1WJA A;  3IUO A;  3CMM A;  4KT6 A;  2WB1 A;  2VJJ A;  5HOO A;  2DOA A;  4Y4R A;  4E7J A;  4PFP A;  2IS1 A;  3PUB A;  1WJB A;  4PSX A;  2CW8 A;  4F55 A;  2R7R A;  3OYD A;  5HVQ C;  2KQR A;  2DT7 B;  3OIP A;  4XLE A;  1Z3Y A;  2X85 A;  3MKW B;  3H35 A;  2F6C A;  1KON A;  3H0D A;  3IAS 2;  4IQJ A;  2VXZ A;  2LYC A;  2L9N A;  2X1E A;  2M0M A;  2ZSH B;  4AYB A;  3OYM A;  2HDW A;  2RRE A;  3CJQ B;  2Y0S A;  4XLF A;  4KIT B;  4NUB A;  4EAT A;  4XOP A;  2KDO A;  2VAS A;  3J7A Y;  1MMG A;  2CFO A;  2R7S A;  3EUH C;  4BQO A;  2I8D A;  3TBI A;  3U21 A;  4N4O B;  3VYU B;  3H5N A;  1MMA A;  3HKZ A;  4C9Y A;  2V6E A;  3PFY A;  4B44 A;  3E0J B;  4RMN A;  2L2O A;  2VQC A;  3W2A A;  1BR2 A;  4PJM A;  1D0Z A;  4BS9 A;  4DBQ A;  3FBN B;  3KX2 A;  3FHN A;  3PJR A;  3CP2 A;  2E60 A;  3W3C A;  2F4I A;  2KRC A;  4ZDP A;  3DU6 A;  2MYS A;  3S3O A;  2AQF A;  3AKZ A;  3ZR8 X;  3LSG A;  2W1O A;  4BQQ A;  1QHH D;  2R7Q A;  1J09 A;  2GOX B;  3ZQQ A;  2W7N A;  3ZGK A;  2IS4 A;  2RNG A;  2LRE A;  4BE0 A;  3QOD A;  3OL4 A;  4F91 B;  2V26 A;  2L5Q A;  4BJ6 C;  3OYC A;  3AL0 C;  2JSP A;  4BEH A;  4CUG A;  1P9Q C;  2FUG 2;  4XOR A;  4PK4 A;  2VLA A;  2CH0 A;  4BXF A;  4ZDL A;  1T95 A;  3N05 A;  2DCE A;  4ZDO A;  3OYE A;  1N77 A;  3EPZ A;  4CCM A;  4P5O A;  4HNU A;  1V5G A;  5CQG A;  3BCA A;  2A5W A;  3HOT A;  3L2U A;  1Y6I A;  3NWT A;  2CV0 A;  2A6T A;  4PSW A;  3GBG A;  5KCM A;  4BE1 A;  2JA2 A;  2X1D A;  3V42 A;  4XLA A;  3OOU A;  4E7Z A;  2HNH A;  2V7F A;  4BU2 A;  3HL2 A;  4XN3 A;  1D0Y A;  3EUA A;  2LY1 A;  2PJR B;  3DU5 A;  1WFX A;  4XL9 A;  3DPT A;  3SDB A;  3LSM A;  3LMM A;  1X1C A;  4XM3 A;  3OY9 A;  2V4J C;  4D9J A;  4CA0 A;  1X1B A;  2R7U A;  4CCL A;  3VYS B;  4XKC A;  4C2T A;  3D5S C;  4BQN A;  4ZTF A;  2VB6 A;  4BL0 B;  1NG6 A;  4HSR A;  4XNF A;  3C2H A;  3OYB A;  2XF5 A;  4XLC A;  3CF2 A;  3SYT A;  3PNY A;  2IGM A;  2QKL B;  1D0X A;  2VXD A;  1NG7 A;  1WJD A;  4RM3 A;  4E7I A;  4CCK A;  3PSF A;  2KZV A;  1QU3 A;  1LFP A;  1YX3 A;  2VKH A;  1MMN A;  4RLF A;  1MW7 A;  3OYG A;  3S3N A;  2BW3 A;  2XAU A;  1UG0 A;  4OWR B;  2X1C A;  3FKJ A;  1DGR M;  3K4N A;  3MKZ A;  2Q1Z B;  3A4C A;  4XON A;  4F93 B;  2LG4 A;  3AL0 B;  3QYB A;  4E6K G;  3L2R A;  1G59 A;  4B43 A;  3FBI B;  3OYH A;  3DPL C;  2E1M C;  1R6R A;  4MLO A;  1E0E A;  3RPU D;  4II2 A;  1W36 D;  2OC6 A;  3MD2 A;  3IAM 2;  2K3P A;  3UR3 C;  3VDX A;  3ZXS A;  3I3L A;  2LBF A;  4JOM A;  1GLN A;  1G8X A;  1MND A;  1X19 A;  1BR1 A;  2HPI A;  3CJR B;  4PUS A;  4ITV A;  1TZL A;  1V5E A;  4HRI A;  2VPL A;  4F52 A;  4KJZ A;  1WJE A;  3BC8 A;  2ZXH A;  3TL4 X;  2V9K A;  2XF6 A;  3CZ6 A;  1Z7L A;  4X0G A;  3PNT A;  3LSH A;  1FMV A;  1OLT A;  2IS2 A;  2CW7 A;  3NWS A;  3D5R C;  1V5F A;  1PYV A;  3OYL A;  4DOZ A;  4NC7 A;  2ZSI B;  4NQW B;  2M4G A;  3F9K A;  1WJC A;  1PJR A;  2VJI A;  3BG6 A;  1UAA A;  2XC7 A;  1T0F C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...