1T0FC

Crystal structure of the tnsa/tnsc(504-555) complex
Total Genus 10
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
10
sequence length
49
structure length
49
Chain Sequence
IKVVKPSDWDSLPDTDLRYIYSQRQPEKTMHERLKGKGVIVDMASLFKQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Dna binding protein
molecule keywords Transposon Tn7 transposition protein tnsA
publication title The carboxy-terminal portion of TnsC activates the Tn7 transposase through a specific interaction with TnsA.
pubmed doi rcsb
source organism Escherichia coli
total genus 10
structure length 49
sequence length 49
chains with identical sequence D
ec nomenclature
pdb deposition date 2004-04-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF11426 Tn7_TnsC_Int Tn7 transposition regulator TnsC
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.960 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Arc Repressor Mutant, subunit A 1t0fC00
1T0FC
chains in the Genus database with same CATH superfamily
3WTVC 2IJLA 4PUSA 4M6YA 1WJCA 1VQ4I 3I4MJ 1FEXA 1YOVB 2ZKZA 4CCMA 3SDBA 5J4YA 1BJZA 2DDBA 4XLNF 1TQPA 2A07F 3AL0B 2WB1A 2XUBA 2LKPA 3IAS2 1TWAJ 1U3EM 4HZFA 1OQYA 4OMYA 4M3EA 3CCEI 2JA5J 3OOUA 4JX4A 3TDUC 1QPIA 2P6TA 4BBSJ 4BAYA 4X1EA 2FRHA 4AIKA 3E7LA 5LHGA 1LB2A 3PNTA 4HDUA 1ZTRA 1V54H 1D0ZA 3LFKA 1K6OA 4RS8A 1NHAA 2NNNA 1Q1HA 2DAOA 2RQQA 4KMFA 3BJAA 4BL0B 2XKOA 3L2UA 1NH3A 2FNPA 2BVLA 1LVKA 4CZZA 5LEKA 4XLAA 4QLCU 2M8EA 3MD2A 3MCZA 5D6FA 5ILSA 2XAQA 2FSWA 5HDNA 1T8IA 5DYMA 1BI0A 1LFPA 4B8XA 4YFKF 3WU2C 2LD5A 1V3FA 2R5YA 3NEUA 3I71A 1P92A 6PAXA 4A3IJ 4XKWA 3CUQC 4P9FA 9ANTA 1TC3C 1ETVA 2FD5A 3EPZA 1TP4A 3H5NA 3HXLA 1HKSA 3FHNA 4RLFA 1MMDA 2V79A 3P9CA 1SMTA 2P5KA 2ZJRF 3WE2A 1OPCA 2XASA 3K1MA 2DFFA 2JA6J 5F04A 2F4MB 5F0CA 3F21A 1I6HJ 2R7VA 2DU9A 2LFBA 4B3AA 4DJAA 1BR2A 2IVMA 1SANA 3AG2H 2L3DA 4BDYA 3IAM2 5JFRA 4EEFG 4B09A 2EV5A 3GLLA 3DEUA 1H9TA 1ZLJA 1U9OA 4BQAA 2BHZA 3BOQA 1K61A 3C1DA 3SZPA 3A0HC 2EJRA 1SD7A 1MJAA 1JUMA 2KT0A 1GDTA 2QCOA 4F91B 3KPHA 2CW0F 3PM1A 4I0AA 1K4SA 4RGRA 2PJPA 3S2WA 3HEFA 3OV8A 3RYPA 3GLXA 1E3PA 1N25A 4DYQA 3VSKA 1R5ID 3DTIA 2E5ZA 1GXQA 1HSTA 5DS9A 2VKHA 5L3CA 2M3AA 4L9JA 4O6JA 5DTDA 1UAAA 1FC3A 1JTXA 3DPLC 1NK2P 1GXPA 2DOEA 5K7FA 1BOBA 2JPCA 1IUYA 5H2FC 4L9NA 4M71A 1IRGA 3HPHA 1S9HA 3HOZJ 3EQLF 3BR0A 3CO6C 2GOMA 4XICA 4XKCA 3BR5A 3OS1A 2CMPA 2AHQA 1ZR4A 1H9GA 3V4GA 2FNAA 2ZNYA 4KIFA 3GZNB 4LG3A 1AU7A 1B4AA 2A6TA 1VF9A 3JTGA 1R7JA 1DPRA 3EUHA 4PFOA 5E3NA 3A1YA 2MH9A 4JX6A 4M3BA 3LL7A 4QWQA 4HNVA 2XSDC 3E6CC 2DFHA 2OBPA 1R36A 3T5XA 1HBXG 3Q0VA 3OYGA 1IC8A 2ELJA 4Y3OA 1BN5A 3KX2A 5C4XJ 2OZ6A 2E71A 2BY2A 4MFEA 1K6YA 4Y4RA 3FKJA 3CCVI 1OYWA 2ADUA 2STTA 4A0YA 2E2JJ 2RKHA 5HLGA 2QLZA 1AWCA 2VKEA 3AAFA 3L1PA 1DP3A 3C2HA 3VODA 4BQNA 2OQRA 4IXAA 5JHFA 2X6OA 3L00A 2CS3A 2XPUA 1MZBA 1VQOI 4M9XA 2B9SA 2CGPA 3OYHA 3TQNA 3ABTA 3DLAA 1XN7A 2DFIA 2EQRA 2P7VB 5JVGF 5M3FJ 3V8LA 2DN0A 5C4JJ 4RDUA 3H9JA 2X1CA 3FXMA 3ZQGA 2PN6A 2CV1A 5FLVA 4B3XA 3K70C 4A3FJ 1D3YA 1T0FA 3WGIA 2L01A 4FE4A 1Z6TA 2O3FA 4E7KA 1H0MA 1IN8A 1RPWA 4GRIA 4CH7A 1SD4A 2FUG2 4HNUA 2GXBA 1D8JA 5CVRA 5J1RA 2FBHA 3B6AA 3LFUA 3DBLB 3BJ6A 1ON2A 2MLGA 4D5CA 1F43A 1X3ZB 5CQEA 2HOSA 3QPSA 1HSJA 3HUGA 5K5OA 1HF0A 4UXNA 4HSTA 4A3KJ 3LQQA 4NC8A 3CP2A 2EPFA 1YX3A 4HBLA 2EINH 2QQ8A 4YIRX 1SFXA 4E4HA 2ECBA 3E5UA 4K2EA 3S1MJ 3HOTA 1XB4A 1USSA 1VQ5I 4JK1X 5B1AH 4BACA 2A6EF 2EIMH 3DLLF 3FBIB 2JA8J 1RETA 1OMIA 2DLLA 2EILH 4UV8A 5F1JA 1FSHA 4I09A 1QNTA 2KLOA 1R23A 3ML6A 4IL6C 2HDDA 1JKOC 1IRXA 1S7AA 4KFCA 1FP2A 5A2QK 3DU6A 2H27A 4NUBA 4S04A 4BYYA 3OYBA 3CJTB 4MIMA 1Z6RA 2XHKA 1QVTA 2IXSA 1MSFC 1G3TA 1Z9CA 4BHCA 4MTDA 1BR1A 4Y17A 4Z6YA 1YQAA 2F5EA 4CSWA 2K7LA 4IRIA 2D45A 2B0LA 3COAC 2P5VA 2VI6A 2GLOA 5EEAA 3DP7A 2A68F 1IAWA 4IO9F 4HRIA 1GHCA 2XRNA 4U7DA 2BW3B 2ESHA 2P5LC 2KHMA 3L7WA 4A3DJ 1W4MA 2ELKA 3OMYA 2XF6A 3HC7A 3OS0A 2DA2A 2COBA 2JRTA 3BTLA 1B8IB 4HQMA 3IKVA 5E3LA 3JW4A 5A2QZ 3E3VA 3H36A 4IOCF 2MLKA 3L2CA 3HRTA 2V1UA 2NVXJ 2QUFA 1A6QA 3KZYA 4NQWB 3RKWA 2X6WA 2EV6A 2IGNA 2M0CA 2FU4A 5JVTA 3KFWX 4ZDOA 3D0SA 3A2KA 1IF1A 4U87A 3OSFA 3GZ5A 2UXNA 3CJRB 3HRUA 3RZDJ 2Z16A 1PP7U 1WI9A 2YU3A 3DKYA 1FTTA 3VSLA 3QWLA 1MMAA 2XAFA 3VYSB 4GDFA 2OA4A 5BPDA 2I10A 1SVMA 4PJLA 2E2HJ 5B1BH 3W6KB 3WGHA 3TO9A 4HDVA 4QTRA 3LSIA 2M7AA 4MQ9F 3S93A 1ETXA 1AKHB 2ZMEA 2FE3A 3V8KA 4AWXB 3QAHA 4ZH4F 4XR6A 4M73A 1T39A 3D5SC 1A31A 5FLXK 1D0XA 3R0AA 1UELB 2IP2A 2X0LA 4BE0A 4HW0A 2Z99A 3EYYA 4E7SA 2P0WA 4JP0A 2GXAA 1STZA 1PDNC 3R6SA 1D1AA 4IQJA 2VBXA 2Z1DA 2XGDA 1TBXA 1XTAA 2DOAA 3PFIA 3FK6A 3I4PA 2KIUA 2R3SA 2XAGA 1AA7A 3WG7H 2DYSH 3VYUB 5KAFC 3M07A 1BL0A 1DUXC 1FBQA 2VQHA 1OISA 1PYVA 2CUZA 2GBYA 4ZZDA 3JREA 4XOTA 1RR8C 5IP9J 3OR1C 4BH9A 3OYFA 1DQUA 4CZCA 5FLXZ 3BZCA 4XMYA 3IRRA 4HSRA 1K79A 2NRAC 1G6NA 5J3LA 3CCLI 3K4CA 2LYCA 2M1BA 5EDNA 3H5AA 5EF6A 2F5DA 2L7ZA 3TP0A 2HVRA 1ULYA 2DOFA 2FOWA 1NK3P 3U9GA 5ICGA 5EEHA 2OCCH 4KYWA 1ZG5A 5GADJ 1JHHA 4P55A 4EJTA 1RR7A 5D8KB 3GTGJ 2W48A 1MMSA 4DQ2A 2V9PA 4KIBA 1XDSA 5J8FA 2JTVA 3TBIA 4JYKA 2CQ7A 1IRFA 3SFIA 3HRMA 5J47A 3FXUA 3TW7A 2R7ZJ 3QOEA 3DU5A 3FISA 3F22A 3CCQI 3RKYA 4HF1A 5ILVA 5D6EA 5CQGA 3I64A 2WV0A 1SAXA 1SVLA 2C6YA 2BEOA 3R60A 3WHCA 5LHHA 3ABKH 5TISC 2HDCA 1JTYA 3M9AA 3GTOJ 3WODF 2LY2A 4HA8A 3CDHA 3FK7A 3BPXA 4E7HA 2DMNA 1UCRA 2LBFA 4Y15A 4QPOA 3B73A 4R79A 3SFZA 3VFZA 4AIDA 1ZR2A 1DGRM 2M5WA 1FOXA 3B02A 2OUMA 4XRSA 4KA4A 1WRJA 5LRRA 1SAUA 3JTHA 3M1EA 1OFCX 2DCEA 3RPQA 5EJCA 1A6IA 1TWHJ 1Z21A 4V2FA 4RB2C 2DA7A 2H8RA 3U2RA 1ERDA 1FOWA 1HW5A 2MSYA 4A3LJ 1HA8A 5ICEA 5BMZA 2KRCA 1VQKI 2EV0A 3ZP5A 2A5YB 4B43A 3QODA 2VOPA 4FCYA 3QQAA 4JBAA 2DT6A 5HS9A 2HU9A 2QSGX 4IHXA 4IQ4A 2CQNA 1TWCJ 5LBQA 2STWA 1MBJA 1X2NA 2EH3A 2HVQA 3T1BA 2X6YA 5M5XJ 1WVRA 3IWZA 3ZRGA 1Z0XA 4A3EJ 1SEUA 1GLNA 4DGWB 4M3GA 3KP7A 2MD0A 2O03A 1JGGA 1ACIA 2R7WA 3J7AO 1I1GA 1ONVA 3FMRA 4HV5A 2G7HA 1LDKB 1E0EA 2HNHA 2R7XA 4KJZA 4HG2A 3FM5A 3BG5A 4HAMA 2LR8A 2BY0A 1BC8C 2RDPA 5DCFA 1ZREA 4A5NA 1NTCA 5C44J 4E7LA 4V19K 3SDGA 1L3LA 4II2A 2E34A 2ISZA 1A5JA 2LC2A 2OD5A 3FXLA 3ZQLA 1H8AC 4ZYDA 2JMWA 3E5QA 3IRQA 3GUDA 2F5FA 2HZTA 5C3EJ 1IN6A 1IZ1A 2MYSA 2V9VA 4GYGA 1D8KA 2G7UA 4RAGA 4B47A 1JT0A 2F4OB 2HQAA 1ETOA 1YRNA 1J2XA 4D5FA 3JRCA 5KHDA 1P4AA 3WTXC 2E19A 1BW6A 4I01A 2HVSA 1E3HA 1Z3YA 1ZELA 2HYGD 3F3XA 2IW5A 1TTYA 2FJ1A 3UR3C 3BG3A 5DCMA 3UNGC 1JE8A 5B66C 2X51A 4JX5A 4BEHA 5GTIC 3LAJA 1ETQA 4OOIA 1M1EB 2OZUA 4UB6C 4CYDA 1WJEA 4JOMA 2VT3A 3F23A 1L0OC 1S3JA 3MKWB 3P9IA 2KZVA 4H4KC 1RC9A 4H0EA 1BC7C 4ZYAA 2PLYA 1HW2A 5HVQC 1W36C 2LVSA 2L02A 5GPAA 2VQGA 3J81K 4ESFA 5IYDJ 4HOBA 4AD9A 3HUGB 5E1XA 3GTQJ 2IGKA 2L7MP 4C3JJ 4C3IJ 1X19A 3ECOA 5E3MA 4I6ZA 4U0WA 2HYFA 1TWGJ 3L2RA 2Q0OA 2HYJA 3N97A 3ROUA 3LSHA 1YJ9I 4IHWA 1TW2A 3JRAA 4CA0A 2XV4S 1ZGAA 2XDVA 2HOTA 3BDDA 4PCQA 1JKPC 1QHHD 2G0EA 3DFGA 1B72A 3BZKA 2VN2A 3FM3A 4IHVA 5D5UB 3QYBA 3W6JB 1XD7A 2R92J 2CW8A 3P7NA 3NWTA 4M6VA 1XSDA 3Q0WA 3HOYJ 4HF2A 3C2BA 3J81Z 1FYLA 4FQGA 2KPMA 4QPQA 4C2UA 4CHUA 4UV9A 1SC7A 2YS9A 3WHBA 2OJED 3CZ6A 4LIUA 4IRHA 4CO8A 1TLHB 5GAGJ 1O3RA 1TQIA 2HOAA 4KT6A 3U1DA 4I02A 4A2UA 4E7JA 4W97A 1YHQI 3IWFA 3QP5A 3V42A 1X1BA 5F08A 1TL8A 3WU0A 4XKVA 1W1WE 3G73A 4CGZA 3E6DA 1KQ8A 2IBDA 2LREA 4MLOA 5E1ZB 5FKNA 1WGXA 1T2KA 4A93J 3GF2A 3K9TA 1D5VA 2HXIA 1U5TA 3EETA 3A03A 3S32A 4W1UA 3MQ0A 3A01A 2VC1A 3PSIA 4AYBN 1A04A 2HS5A 3HM5A 5J1UA 2EZLA 4RAYA 1B9NA 4CICA 2LF8A 3GO5A 1WSUA 2DDAA 4WXHA 5K5RA 2BGCA 3KLNA 1E2XA 2KRHA 1UZCA 2KIFA 4C3HJ 2M30A 5KCMA 4F3QA 5E3OA 3G3ZA 4AYBA 1XGNA 3I4NJ 4NHJA 1V5EA 4ON0A 5D4SA 2IS1A 1G8XA 3DXJF 1MJ9A 2LSOA 2DODA 3OOPA 1IV8A 5DM6F 2HWVA 4ITVA 1MNMC 1H88C 2A05A 2ETHA 1MNEA 1WPKA 3IH4A 3HB9A 2VJ4A 2RV8A 2ZMEB 3I54A 1LJ9A 4MGRA 4BGDA 2VKVA 5HLIA 3FXOA 1XG1A 3HSEA 1APLC 1QPMA 4U0VA 4A3MJ 1YW7A 2IPQX 2V1DA 3GYHX 3SZTA 5BNGA 3ZR8X 3MFKA 2AS5F 3CP8A 2VE9A 3ZMZA 4L0ZB 1TWFJ 3F8BA 3ISPA 4IF4A 3E0JB 1FIAA 1R4MB 1G3SA 1OR7C 1FP1D 2O61A 2COMA 3MMYB 4RLQA 3S8PA 4LK0F 1GUUA 4PFPA 1UMQA 3PQKA 3ASOH 1RIOH 4D7MA 3GXOA 1FOYA 4RB3C 2PI0A 2K9MA 5GAEJ 3RZOJ 1VI0A 4DZPA 4ENNA 2DA4A 2XB0X 5HNFA 1MGTA 2I5UA 3DTKA 3HKZN 5IOYA 2XROA 4CCLA 5LHIA 2NNYA 1FYKA 3P9KA 4HLXA 1R1UA 1JI8A 2ZSHB 2XB5A 2E1CA 3K2AA 1BM9A 2H1LA 3AL0C 2NVUB 1OLTA 4BY7J 3F8NA 4YG2F 1BIBA 1U8RA 3ZQFA 1AHDP 4LG0B 3HKZA 2YUSA 1OJLA 3DPTA 3M7GA 2LTPA 2W84A 3KP6A 4DW6A 2RAEA 5CVJA 2WC2A 2OTLI 2BBYA 2RREA 1KGSA 2PJRA 1B59A 3CCYA 3LMMA 3MZHA 1MDMA 2KQRA 1I1SA 1OYIA 3M3YJ 4A0ZA 3WTYC 1XPXA 3GZ6A 1VQNI 2R0QC 3K6GA 4RAZA 1BW5A 5E8IA 3PUFA 1NG6A 2XAHA 2L5QA 2BXYA 2LBFB 2GIZA 1T08B 3HOWJ 3LA3A 5J1YA 5JLXA 5D8LB 1SD5A 2MC3A 4L5EA 2FQ3A 1Z05A 4Q4ZF 1IRZA 3TL4X 4M72A 1SFEA 3S3MA 2EIJH 5IT9K 1B1BA 2MH2A 3PQJA 4XRFA 3IHUA 3GVAA 1LE8A 3OYCA 2D5VA 1GVDA 1O57A 1PUFA 1UHMA 3RKXA 2HPMA 3BWGA 2OC6A 2R5ZA 3S3OA 1V4RA 3BG9A 1XGMA 1GV2A 5M5WJ 2KISA 2QKMB 3E6BA 4PJMA 4LB5A 4KICA 1SFKA 1ZKGA 3OY9A 4U7BA 3CCSI 4GXOA 2XGEA 4KN4X 4IHTA 3GFLA 2R7SA 1QHGA 1V55H 1ODDA 2R7DA 5IT9Z 5DUKA 1YIOA 4ENMA 1HCRA 2NS7A 5KVRA 4UB8C 3F6VA 3BR2A 1QA6A 1UHWA 2RQPA 2E1NA 4XIDA 3F8MA 3M1CA 5FD6A 2V26A 3ESWB 1BJAA 4RMNA 1IGNA 4I0BA 4OAYA 2K85A 1TT5B 1AOYA 3HPGA 2BOLA 4A3CJ 3I5UA 1EJ9A 4EM1A 3MAJA 4F55A 1FNNA 4XNFA 3DKWA 2ME0A 1YFHA 3LSJA 1QGPA 2Z5UA 4FISA 5ICCA 2PMUA 2WAEA 3ULQB 2CFOA 1LUJB 2ESNA 3CLQA 3F0CA 2DXIA 2X85A 3ELKA 3PL8A 1HXDA 4QIWN 2HFHA 1MMNA 2X4HA 1BA5A 1U9NA 4YEJA 4AC0A 2YX4A 4EJWA 3H3VK 3CESA 2LY1A 4WK8F 1W5SA 1KU9A 3GFIA 4M3DA 3QPHA 4FX4A 1YRNB 3OYNA 3ZPLA 3FIWA 1PJRA 3BTCA 2F2EA 2L7FP 2EK5A 4YFXF 3ONQA 1WJFA 2DFEA 5E79C 1HQCA 2EA2A 3HGYA 1QRYA 4R1HA 2R7RA 4D7NA 2IGMA 1BBYA 2LDUA 3KZZA 3RPUD 3GX4X 4KN7X 1YJWI 5ERIA 1ITYA 3GEZA 4IX7A 5DCMB 2YU9J 3SEZA 4ZYHA 2K9LA 2K5CA 3FF5A 2OQGA 4BEHB 2VBZA 5GPCA 1DDNA 4MFDA 2PFBA 2DK5A 3BCBA 2LMDA 1JHFA 2QF7A 5DV5A 4ESBA 1K78A 1MBEA 3AG3H 3PIOF 4ZDLA 4XSZF 3WGGA 1B9MA 2KFDA 2R7FA 4Y7NJ 1IXSB 3QYEA 3WTZA 3I55I 3JRFA 2V6EA 4E70A 2DJIA 5HDGA 4LLLA 1HOMA 4FTHA 4F52A 4ANJA 3OYDA 5B5EC 2E35A 2DO7A 1MKMA 4J00A 3RKQA 3JRHA 1YW9A 3CUQA 1G59A 1LNWA 4CUGA 4I2OA 1J59A 3TKYA 2W57A 5IY5H 4YELA 2LY9A 5TGTA 4IKFA 1DPUA 1RESA 3CCMI 4BNCA 1EF4A 3BLYA 2NXNB 3KIOA 4AUXA 1JUPA 1WJ5A 2HTSA 5GTHC 3W2WA 5D5VB 2K4JA 4PJJA 2HEOA 3GFMA 3HOVJ 1DP7P 3ZMSA 4PZJA 3SEQA 1OCRH 1IUFA 2CQQA 1EA3A 1LKXA 2YR2A 1V5FA 3I59B 3RPUA 1F9NA 3BJOA 4OINF 1HW1A 2DQRA 4G7HF 4PSXA 2MABA 4YFNF 3CTAA 4BY1J 5M5YJ 1ETWA 5H20A 2CH0A 2F4IA 2WAQN 2IAIA 3TO7A 4BS9A 1RI7A 1TNTA 3M4OJ 2CFXA 2OAZA 5FRMA 1LDDA 4RGXA 2JWTA 2MG4A 4NC6A 2HZDA 4XK4A 3J7AY 3CMAI 1P4XA 2Z9OA 2DPUA 2WAQA 3SYTA 1S7EA 1KQ9A 4DYCA 1RUOA 2HR3A 3OWTA 4G6TB 5E17F 3WU1B 1LVAA 3S2HJ 2A6HF 2NS0A 2P4WA 2RVCA 2MW8A 4OAZA 1OCCH 2NS8A 4N9IA 5DUIA 1VQ8I 3BQZA 4G9YA 2QVOA 1P2FA 2MBFA 4Q48A 2Q8KA 2K3FA 3CMEI 4ZTJA 3DV8A 5FFZA 3ZMTA 2A5WA 5FB2A 1KYWA 1U5TB 1I6XA 2X1DA 1X1AA 2HGCA 2QYOA 2NVTJ 2O8KA 1FMWA 3A01B 4A5MA 2DTZA 4R8HA 2BVMA 3I58A 2EB7A 2PMZN 1N77A 3KEOA 2LRDA 1DU0A 2ECCA 2KJCA 1X1CA 2Y48A 3A4CA 2CSOA 2TDXA 1RKTA 5F1RA 2B7EA 3HOUJ 2DMPA 1ORKA 4XONA 2EFWA 3C18A 1SD6A 2M2EA 2PMZA 1I39A 1R22A 3REOA 3I56I 1RRJA 2W24A 2KP6A 4M74A 4ZC3A 2UUZA 1R1VA 1ZYRF 1XMXA 3MZ8A 3RJPA 2ZXHA 2WV1A 3FXRA 3ZMUA 4EM0B 2K02A 1WJBA 3FHZA 2ID6A 4FX0A 1F5TA 5FROA 2R5YB 2NVQJ 1A35A 2QEXI 3G1OA 5EGOA 4G12A 4EJVA 2ZB9A 4Y33A 2V1NA 2R7QA 2BY1A 4A0XA 2DT5A 1EKEA 3K4LA 4OWRB 4Q47A 1FPQA 3JRDA 3I0TA 2LLKA 5FKKA 3V7SA 2ZJPF 2VKDA 3SJMA 3C3WA 4G6DA 3SHFA 3CF2A 3FXKA 4F92B 1EV7A 2WA0A 3AFHA 4HNTA 1I27A 1BI2A 3LSKA 5JR3A 1JKQC 2PQ8A 3F8CA 2KIMA 4A3GJ 3ERMA 3E6MA 3JSPA 5FD5A 4BUPA 2R7TA 4I76A 1UHSA 3OYLA 2CYYA 4P5OA 2CRGA 4PJ0C 2QENA 3NARA 4MNUA 3LOCA 1I5ZA 2RN7A 1RUNA 4EQQA 4I99C 1ZHFA 3TP3A 2ZO4A 1ETKA 2K9QA 2PX9A 1TQMA 3OYMA 2K3PA 2F48A 2XF5A 5ILUA 4D9JA 1HDDC 5DD8A 1TZLA 2L4AA 1BOAA 2EZIA 4YRVA 2ISYA 5IYBJ 2V6CA 3Q0UA 5HOOA 4AIHA 2WTEA 4J01A 2L0KA 1P4WA 2D1VA 3EDPA 3O8GA 1MH4A 1QU3A 4RA2A 2WAFA 1K7AA 1IJWC 1KZHA 1T33A 2HDWA 2EZKA 3GMEA 3UKGA 1ETYA 5IP6A 3GTPJ 3FZVA 1W0UA 2J5OA 2AXTC 3DBRB 3LSTA 3GTKJ 2LKXA 1UJ8A 4NC7A 4BKXA 2FQ4A 4GYIA 1PVEA 3NWSA 2MC4A 3DTEA 3R61A 1IXRC 4M9SA 4XLFA 4MEXF 1Y1VJ 3FDYA 4WXDA 1HLVA 2LP0A 3CCUI 4OIPF 1K83J 2KL4A 4V2GA 4N0BA 1REPC 2OF7A 2L54A 3OSGA 2DI3A 5AONA 5F64A 1JUSA 3MKYB 5M3MJ 1NG7A 1T56A 1EH6A 2BYVE 1FJLA 5IYCJ 2HPIA 3Q5FA 5HNHA 2P8TA 2KZGA 4UVBA 3OIPA 4EV0A 2XRLA 1J5YA 3CF5F 1LE8B 2VXZA 3OYAA 3LNQA 4B4CA 3FX3A 2PMHA 3C7JA 2GXGA 2R5ZB 2X48A 2JN6A 2YSRA 2M4GA 4II3A 3DF8A 3WE3A 1VQ6I 3ZN0A 5FLMJ 5F27A 5FGMA 3HJEA 2FMLA 2JRMA 2Y69H 3OYKA 3HG9A 1FYMA 2W25A 1TNSA 3BQYA 4OIOF 3MVPA 2QWWA 3PO3J 4E7ZA 4BQOA 4A12A 3T8RA 1R5GA 2F6CA 2IA2A 4L5JA 1IG7A 1XMAA 3C2GA 4MQVA 1Q1VA 5BPIA 1A36A 2M7BA 3BC8A 3BTIA 3PUBA 3HYIA 4NDLA 5EG0A 1OCOH 2YX7A 2UWMA 3PIPF 1RKWA 3FXQA 3KP3A 3RYRA 3OR2C 4UHTA 4XN0A 4OU0A 2K40A 2Y9YA 2Z2SB 3J80K 3FMQA 4LLGF 5ICFA 3HOSA 4EGZA 1KYZA 3S1NJ 3ABMH 1YW8A 2W85A 5EYRA 3FWEA 1MBGA 2EBIA 3TGNA 5FJ8J 1X1PA 3HIFA 1J75A 3KP2A 2WBMA 1USTA 2OPTA 3O8HA 2JZYA 2LNBA 4EM2A 3KP5A 2WY8Q 4UUVA 3ZQHA 5JLWA 2FF4A 2JA2A 2V7FA 1W5CC 3KEYA 4DIQA 2M45A 1Y8QB 1Y56A 3FBNB 2R93J 3H9QA 2VJIA 4UUSA 2DPDA 3CD6I 2GA1A 2H6BA 3F6OA 2VBYA 4P96A 4LOCA 3KLOA 2BY3A 1T38A 5F0HA 3J80Z 3EUHC 2QQAA 3KP4A 2P7CB 4BHBA 5DD4A 2JK3A 2OCEA 3X2QH 1X3UA 1S8NA 4IRGA 2EZHA 3IV5A 1KU2A 1IDZA 1OCPA 2K9NA 3QPLA 4CYCA 1FBSA 1WH7A 1B8IA 1WKMA 3WTUC 4RB0A 5CYVA 4IHSA 3K4JA 1WQ2A 1T98A 4CXFA 1YTYA 2XKPA 3DKXA 3CLOA 5TRDA 2VJJA 3QOPA 5CKTA 3OYJA 2GZWA 1U6GA 4KMUX 2ZCWA 5FKMA 3MZYA 3DEEA 3HBLA 4NBQA 2BE5F 2RNGA 1BIAA 5KAIC 3CUQB 3BG7A 3MKZA 2JQ7A 3IUOA 3JSOA 2IRFG 1QZYA 2AQEA 3ZQ7A 5LRSA 2K4BA 2IS4A 2ZXJA 1SVOA 4WF2A 3MWMA 3IL2A 1MMGA 2VQLA 3HOXJ 3LWFA 4ZJZA 2VC0A 4X0GA 1YYVA 1QZEA 2EFPA 3AG1H 3BG6A 5CVUA 1FZPB 1E3OC 3CJQB 5H6QA 2YPRA 1T0FC 2DTRA 4ASNA 2DA3A 1FMVA 5TJJA 2R7UA 1BI1A 3CJNA 4IJAA 3G2BA 1JJ8C 2VPLA 4E6KG 3HRSA 4HQEA 1VTNC 2Y30A 4NNJA 2UZKA 1F36A 3S1RJ 3LA7A 4PGHA 4HX8A 4OIRF 3L2QA 2FOKA 1HC8A 2ZJQF 2Y75A 5D4RA 4MO7A 2VOOA 1LDJA 4HX7A 2EFQA 2MA3A 4HPQA 1X3WB 2W82A 3O3KA 1ZH5A 1ZG1A 4DBQA 5JHUA 2JSPA 1WZ2A 3ZN1A 1N75A 1KONA 4EMSA 4IPAA 4BE2A 1MBHA 2FX0A 1VQPI 3O6BB 5HS7A 4WX9A 2GIVA 3H0GJ 2MD5A 3S3NA 1WJAA 2FXAA 3LSMA 3S2DJ 1FIPA 1H89C 4HV6A 3KETA 2IA1A 3H1CA 5AIPA 1FT9A 3HGGA 3VYTB 2JUGA 2W7NA 4KT5C 2CQXA 1WJDA 4ZDPA 1HKTA 3PSFA 2XPWA 2L9NA 1VQLI 5E18F 2VT2A 5J8CA 5HDKA 1YI2I 1YS6A 3HSFA 3W6VA 2K27A 2V4JC 4XKBA 2L4MA 4FT8A 5LGTA 1R58A 4GGGA 4IEJA 1D0YA 2JSCA 1G3YA 3E97A 4XSXF 5HODA 4ENKA 5K7HA 1J9IA 2XIGA 2AQFA 5E1WA 2LK2A 4ABZA 2FBKA 1JJ6C 1ZQ3P 3VDXA 1U8BA 1UFMA 2DA6A 3QU3A 5K1YA 5LFAA 1W36D 1P9QC 1JKRC 2ZFWA 4RBOA 5LLQA 3I3LA 2CUEA 3JRGA 2EFNA 1ZRCA 2CW7A 2X6XA 3S15J 2BV6A 4FASD 2QQ9A 2A69F 4XLEA 2CV0A 2IS2A 3RDIA 4BE1A 1CF7A 5EEGA 2QA4I 3L2WA 2A61A 4Q5SF 2VIXA 1DU6A 3RSNA 3QU6A 2K9SA 2E1OA 3D5RC 3K4BA 3ZMVA 5GAHJ 5EGOB 2L9RA 5BOXA 1XMKA 1YG2A 2JT1A 3MEXA 3RIRA 1U78A 2O9LA 1W7PD 3LQRA 2DK8A 4QSHA 2OTJI 3FKIJ 2E7WA 3NRVA 4YIIA 4MHGA 1IN4A 4EJOA 2IEKA 3T0YA 1GV5A 2QBYA 3KYLA 3CC2I 2CU7A 2NYXA 5GP9A 1OCZH 4RGSA 2IA0A 5DM7F 2CWEA 3I53A 1OKRA 2Y0SN 1YLFA 2ZMEC 4XOPA 1W0TA 2V9KA 1MNDA 3U21A 2XAUA 1Z7LA 4N4NB 2P81A 2L9SA 1IO2A 3GTMJ 2DA5A 2DT7B 4LGWA 4KIGA 1X4PA 3S16J 3SZGA 2Q1ZB 2CO5A 2Y0SA 3MKLA 3TOBA 1MW7A 3LA2A 4UNOA 3K1PA 4KDPA 1O3TA 2ZNZA 4U0YA 3FXJA 1KU3A 1F4KA 5HLHA 2JVHA 2DJNA 3GCMA 1Y8RB 2E1MB 3H3ZA 3D1NI 3KE2A 4DYRA 2XAJA 2L7KA 5K7ZA 4DNCA 1QVUA 3D5LA 2MGQA 3V7RA 3W3CA 3VB2A 2HOEA 3VOEA 2P6SA 1I3AA 2Z3YA 5J6XA 1W7PA 1J0RA 1CGPA 3R0JA 1UB9A 1B6AA 4E7IA 1QQIA 4LLNA 1T6SA 2ID3A 1FWZA 3DPUA 2GQQA 4M3FA 3G1MA 3TOAA 2XGCA 3H92A 2HQRA 1WFXA 3CDIA 3Q9SA 2PEXA 2JUCA 3DQVC 1T95A 2LOOA 4G8XA 5L3DA 3ZQIA 3K4MA 1Y0NA 3J7YJ 3M8EA 2VL8A 2TRTA 3QPTA 3GTLJ 4ENJA 3U1KA 1SFUA 3EUKL 1XCBA 4KITB 1UG2A 1YE9A 2OV7A 2L2OA 3LSRA 1MBKA 3F9KA 3MN2A 4WCGA 3ZCOA 1LFUP 2WWYA 3ASNH 4L5IA 4P9UA 3IP4B 5IPAA 2KIQA 2ELHA 2W4SA 4Y52J 1G2HA 3CCJI 3CQZJ 4LB6B 1ZGWA 3VYRB 3NAUA 4ZTFA 2VONA 2DBBA 4CCJA 2M9HA 2CJJA 2H1KA 1O7LA 2B63J 3HDDA 2NVYJ 3QRFF 4CCOA 4C30A 1FY7A 3ABUA 4HF0A 3GBGA 3CMMA 2VODA 2GA2A 2TCTA 3Q9VA 1XCVA 4LD5A 3OIQA 4PGGA 1IV6A 1R71A 4BHPA 4M6XA 3ZGKA 3KYCB 2R4GA 1UG0A 1WHUA 1VNDA 1HDPA 3V7CA 2FA5A 3JAMK 5ED4A 5EG0B 4LJZF 4XM3A 2E1MC 1R5HA 2VQCA 3LSPA 4BXXJ 5FO5A 3CC7I 1ZRFA 1V5GA 2VPRA 3BP8A 4KISA 4XLCA 2VBWA 2O0YA 2LF7A 2LG4A 2X1EA 1POGA 3G4SI 1JXSA 2Q2EA 4A6DA 4EGYA 1XX5A 3OL4A 5JI6A 1IN7A 2IS6A 1FLIA 4C2TA 1S29A 2VE8A 3ECHA 3JAMZ 1QZZA 3LAPA 1OR7A 2GOXB 3DWLE 2GWRA 2NOJB 2ZJ2A 3F8FA 3K69A 5LGNA 4UUSB 3ERED 1YIJI 3SXYA 4A69C 2LH9A 1ZG3A 1QBJA 2E36A 5EZHA 1X58A 2VJ5A 2EWNA 2FMYA 3BR3A 4G7OF 2XC7A 4CDGA 5E20A 3M8FA 1J7KA 3LSGA 2OU2A 1B72B 5FKLA 1D1CA 3TW6A 5IP7J 1XGSA 4CYCB 3KEQA 2E7XA 5CPRB 4DOZA 1ZN2A 1SMYF 1X2MA 4YIFA 2G9WA 1O7FA 2JPBA 1ZK8A 3L2VA 3S1QJ 2Z33A 3QYFA 2KJBA 1EH7A 5K5QA 1Y39A 2I8DA 4BDZA 3OS2A 4L9VA 1IW7F 5F6FA 2W00A 2ZXWH 5J40A 1YX5A 3BCAA 1LFBA 1ZGJA 3K4KA 4L0YB 1ENHA 1QO0D 3H9GA 4DZJA 3IC7A 4FETA 3QP6A 2ZBKA 1XDUA 4F7ZA 1OCTC 1P7JA 2JJ7A 2VUMJ 4LK1F 4XRSG 4CCNA 4BU2A 4N9HA 1FOKA 3HZJA 1E17A 4PK4A 5L3FA 5D5WB 3WTTC 3JR9A 1IXCA 1P6RA 4HX4A 2VLAA 2BXZA 2QSFX 4A6EA 1LEAA 3CC4I 5DDGA 1KA8A 3E5XA 1EH8A 2CUJA 2DMTA 4BJ5C 4XBFA 3H3UA 3DCFA 3RQ4A 3K70D 1R1TA 2QKLB 1XGOA 3KZIC 4LFUA 2O6GE 1XSVA 3L09A 3PNYA 5KNLA 4LIVA 3BT9A 3H5RA 4XN3A 1C0WA 4XRMA 1X4OA 5HLTA 2CV2A 2ZXIA 3RTRA 4RB1A 4CCKA 2M34A 4IVNA 2HKXA 4XL9A 4L18B 3HHGA 1WWXA 2N8GA 2VXDA 3G1LA 4XLPF 3JRBA 1MIJA 1R49A 2A3SA 2FBIA 2BZTA 4BXFA 1MD0A 2WADA 1P7IA 2DMQA 3BROA 2AO9A 1D1BA 3Q3SA 3K4NA 1GVJA 1XC5A 3BTJA 1IN5A 2WY7Q 3BY6A 4TV7A 1K4TA 4XLHA 2UV1A 2XPVA 3BR1A 1W5TA 4GCVA 2PG4A 1VZ0A 4OMZA 3FMSA 4G6QA 2XSJC 5F0FA 2RC4A 2CUFA 3ABLH 3K2ZA 4LG0A 1MSEC 1ZRDA 1YS7A 4M9ZA 1WI3A 1Z3XA 3L9FA 1X1DA 2JA7J 2NAZA 3JRIA 2H6CA 4L9TA 5BS6A 1IDYA 5H6RA 1KQ0A 1Z77A 3CUOA 2NOGA 4D0PA 4O5VA 3ZQCA 4FE7A 4HYEA 4N4OB 3PO2J 3KYDB 3W2VA 3VEPA 3O2PE 4BJ6C 2ICWG 1GT0C 1Y1WJ 4UY8I 1U5TC 1YO5C 2GAUA 1FTZA 3N05A 3RCOA 3PNVA 3EYIA 3CCRI 1CF7B 4KUMA 1CQTA 4I98B 5D5XB 3W2AA 1I50J 2RNJA 4AM3A 3TEDA 2V1XA 1FX7A 1Z7UA 2KMUA 5IT3A 1J09A 4AU7A 1JT6A 5E8GA 2PJRB 2DMUA 4PJNA 5CLSA 1OYYA 1WH5A 1MDMB 2QBYB 5DEQA 3T8TA 3B6CA 4BQQA 3HSRA 1MBFA 2KKOA 1ZARA 1BR4A 4AVZA 2BHYA 2R7OA 4JQFA 4WXCA 4RAFA 1FSEA 4BXUA 1S7OA 1LPQA 4KNYA 4LMYA 2MFZA 3NQOA 5LEJA 2IGOA 5J4VA 2VASA 4ZYGA 4Y13A 3IH3A 3GFJA 1TW3A 5FKOA 3CMYA 2GM4A 1YITI 2XF7A 3VPRA 4F93B 1ZLKA 1VQ9I 1KU7A 2H09A 1SFOJ 4XQFA 3ZMDA 4I7HA 3HTSB 4A3BJ 4ESJA 4BJTA 3G6EI 5FFXA 3E1SA 1HKQA 3R4KA 2D2WA 1PP8F 3DEWA 2ZFUA 1Z91A 3TDZC 3BR6A 5EZGA 3K10A 1XS9A 1PUFB 4EJUA 1VQ7I 3TO6A 2D1HA 3RI4A 3G71I 4EVIA 1U0JA 4UVAA 1S6LA 3ZQQA 3I9V2 4U88A 1Y0UA 3K7AJ 4B44A 2QSHX 4IOAF 3ZOBA 1Z67A 2HI3A 2K86A 4OIQF 3M8JA 1W7PB 2VB6A 1Y6IA 2H94A 3KCCA 4XORA 2KDZA 3HHHA 2O8XA 5LGUA 1VFCA 3A02A 3N4MA 4RGUA 4A3JJ 1MH3A 2FEZA 4HEA2 2DA1A 1MJBA 1TT0A 4D1QA 4ZYEA 3GWZA 1G4DA 4BBRJ 1ZAOA 1F1ZA 2XGXA 4GFBA 5FRNA 4X6AJ 3OL3A 1PUEE 4FHTA 2DW4A 2HTJA 4LITA 1ON1A 2EIKH 2XVCA 4HLYA 1O3QA 1R00A 3SQNA 1FBUA 1XSXA 3JCUC 4G7ZF 3RQIA 3IKTA 2ME6A 4J19A 2HQNA 3WG9A 4PSWA 4B1RA 2EA4A 1I3QJ 4ZZLA 5L3BA 2ZSIB 3P5JA 2EFOA 2F5CA 4G94A 1U2WA 4C9YA 4S0HB 3OIOA 4B48A 5LD2C 1O3SA 1Z1DA 1D5YA 2M87A 4GO1A 2HXOA 3IH2A 2Y9ZA 2HKOA 3H35A 3WTSC 4UUTA 4MTEA 3S14J 4C2MJ 4O3MA 2E60A 5CJ9A 5BQTA 2Y0MA 3CO7C 1BI3A 2E5NA 1S5LC 2O5RA 3GW2A 4IHYA 3BZ6A 1WCMJ 3K1NA 2O7OA 2BW3A 2W1OA 2QM3A 1S72I 2QQBA 1R6RA 2Y31A 1YJNI 3H0DA 1LEBA 4NB5A 4MEYF 4AVPA 2M8GX 2JVGA 3VWBA 3A0BC 1RNLA 4IZZA 1JGSA 3OYIA 3HTUA 2E2IJ 3J7ZI 2IT0A 2J5PA 2M0MA 3S17J 1R9TJ 4NQWA 3PJRA 2M4KA 1K78B 3BPVA 5KK1A 1R4NB 2KRFA 2RGVA 5AIQA 3PFYA 1O4XA 2Q2EB 2X9DA 4RM3A 2QGUA 3GTJJ 1RZ4A 3F72A 1G3WA 2L9VA 3AKZA 2LKSA 3AG4H 3I59A 3TMOA 5L3GA 5CVVA 5HS8A 3DBHB 4AIJA 2AXLA 2Y2ZA 2CQKA 2ZC2A 4UVCA 3CDLA 4Z2YA 5B3SH 3HL2A 4P1WA 1LQ1A 1N78A 3V8JA 2ACJA 3WTWC 2QZ8A 2F5VA 3EUAA 2H8WA 4ETSA 4S05A 2DYRH 3OYEA 1AKHA 2HQ5A 4PDKA 4WWCA 2KDOA 4EATA 4RM2A 1VQMI 3ZXSA 3K0LA 5CVIA 5IOZA 1DGWY 2DQLA 5L3EA 2WB1N 2PBIA 2UXXA 4DBRA 2CG4A
chains in the Genus database with same CATH topology
4PUSA 5FRMA 1WJCA 1LDKB 4E7IA 1E0EA 2HZDA 4CCMA 3J7AY 3SDBA 2WAQA 2HNHA 3SYTA 2R7XA 3DPUA 4KJZA 4HG2A 3OWTA 4G6TB 3AL0B 2WB1A 3IAS2 1WFXA 4OAZA 4E7LA 3OOUA 4II2A 3DQVC 1T95A 2LC2A 2LOOA 4ZTJA 3K4MA 2A5WA 2VL8A 3PNTA 2X1DA 1X1AA 1FMWA 1D0ZA 3EUKL 2BVMA 4KITB 1YE9A 1N77A 2OV7A 2MYSA 2L2OA 2LRDA 2RQQA 3F9KA 3L2UA 4BL0B 3ZCOA 4B47A 2HQAA 2BVLA 1LVKA 4XLAA 1X1CA 3A4CA 3IP4B 3MD2A 2W4SA 5KHDA 4XONA 1LFPA 2PMZA 3VYRB 4ZTFA 4CCJA 2HVSA 1Z3YA 2KP6A 1ZELA 4CCOA 4C30A 4ZC3A 2UUZA 4XKWA 3GBGA 3CMMA 3UR3C 3UNGC 2ZXHA 3EPZA 3H5NA 3HXLA 3FHNA 2X51A 1WJBA 4RLFA 1MMDA 3OIQA 4BEHA 5FROA 3ZGKA 1WJEA 2R4GA 1UG0A 4JOMA 4Y33A 2V1NA 2R7QA 2R7VA 3K4LA 4OWRB 4DJAA 4XM3A 1BR2A 3MKWB 4BDYA 2E1MC 3IAM2 2VQCA 2KZVA 2VKDA 4H4KC 4ZYAA 3CF2A 4F92B 5HVQC 2WA0A 1W36C 3AFHA 4HNTA 1V5GA 2VQGA 3LSKA 4KISA 4XLCA 3HUGB 2LG4A 2X1EA 2IGKA 1X19A 4BUPA 4F91B 2R7TA 3L2RA 3OYLA 3OL4A 3LSHA 4P5OA 2IS6A 4CA0A 2XDVA 4C2TA 3VSKA 3DTIA 2E5ZA 1QHHD 3DWLE 2GOXB 2NOJB 2VKHA 3QYBA 2LH9A 2CW8A 2M3AA 3NWTA 1UAAA 3DPLC 3OYMA 2K3PA 2VJ5A 2XF5A 4D9JA 1TZLA 2XC7A 1BOBA 2KPMA 4YRVA 5HOOA 4J01A 4QPQA 3LSGA 2R7WA 4C2UA 1QU3A 1D1CA 2WAFA 3HPHA 1S9HA 2HDWA 5CPRB 4DOZA 3CZ6A 4LIUA 2GOMA 4XKCA 3OS1A 2CMPA 4KT6A 4E7JA 3L2VA 3QYFA 4LG3A 3V42A 1X1BA 4NC7A 2A6TA 2I8DA 3NWSA 2MC4A 4XKVA 4BDZA 3DTEA 3OS2A 2W00A 4XLFA 4PFOA 3FDYA 1YX5A 3A1YA 3BCAA 2LREA 4MLOA 3K4KA 3LL7A 3H9GA 2KL4A 4FETA 3OYGA 3MKYB 3S32A 2ELJA 1NG7A 4Y3OA 4CCNA 3PSIA 4BU2A 3KX2A 4PK4A 2HPIA 5HNHA 2VLAA 3OIPA 1K6YA 4Y4RA 3FKJA 2KRHA 2VXZA 3OYAA 5KCMA 4F3QA 1DP3A 3C2HA 4AYBA 4BQNA 1V5EA 2CUJA 2M4GA 4II3A 5JHFA 2IS1A 1G8XA 2CS3A 4BJ5C 3RQ4A 3K70D 2QKLB 4ITVA 3OYHA 3PNYA 5KNLA 4LIVA 3OYKA 3DLAA 3H5RA 3HG9A 1MNEA 4XN3A 2VJ4A 4BGDA 4E7ZA 4BQOA 1X4OA 5HLTA 2F6CA 2CV2A 3H9JA 2ZXIA 2X1CA 2CV1A 4B3XA 3C2GA 3K70C 3RTRA 4CCKA 3ZR8X 2M7BA 4XL9A 3BC8A 3CP8A 3PUBA 4E7KA 4GRIA 4CH7A 2VXDA 2FUG2 4HNUA 2UWMA 3E0JB 3OR2C 4BXFA 2WADA 4XN0A 3LFUA 1OR7C 4RLQA 3MMYB 1D1BA 3S8PA 2Z2SB 3K4NA 3HOSA 4PFPA 5CQEA 2WY7Q 4XLHA 2UV1A 4HSTA 2K9MA 4NC8A 3CP2A 2WBMA 1YX3A 2WY8Q 1VZ0A 4E4HA 3HOTA 2XSJC 2JA2A 2V7FA 5HNFA 3KEYA 4DIQA 3DTKA 4BACA 3FBNB 1Y56A 1Z3XA 4CCLA 1X1DA 2VJIA 3H9QA 3FBIB 1JI8A 2ZSHB 2KLOA 3AL0C 1IRXA 1OLTA 3EUHC 3DU6A 4NUBA 3HKZA 3OYBA 3DPTA 2IXSA 4N4OB 3W2VA 4BJ6C 1BR1A 4CSWA 3N05A 2RREA 3PNVA 3RCOA 3K4JA 2PJRA 4HRIA 3LMMA 3W2AA 2BW3B 3DKXA 2KQRA 2VJJA 5CKTA 3OYJA 2KHMA 3K6GA 3OMYA 3OS0A 2XF6A 3HC7A 1NG6A 2KMUA 2L5QA 1J09A 4AU7A 2LBFB 3DEEA 2PJRB 4PJNA 2RNGA 4BQQA 3BG7A 3MKZA 4NQWB 3IUOA 2AQEA 2X6WA 2IGNA 2IS4A 1BR4A 4AVZA 2R7OA 4JQFA 1MMGA 2VQLA 4ZDOA 3TL4X 3A2KA 3S3MA 4ZJZA 2MFZA 4X0GA 2IGOA 2VASA 4U87A 3BG6A 3CJRB 3OYCA 2Z16A 2XF7A 4F93B 3DKYA 3CJQB 2HPMA 3VSLA 2OC6A 1T0FC 4XQFA 3S3OA 1FMVA 1MMAA 3VYSB 4BJTA 2R7UA 2QKMB 4PJMA 3E1SA 3G2BA 2VPLA 4E6KG 4PJLA 2ZFUA 4NNJA 1SFKA 3OY9A 4U7BA 3K10A 3L2QA 3LSIA 2M7AA 3S93A 2R7SA 1QHGA 1U0JA 3ZQQA 3I9V2 4HPQA 4XR6A 2W82A 3D5SC 1D0XA 4DBQA 4B44A 2JSPA 1UELB 1N75A 1KONA 4BE0A 4BE2A 4E7SA 2P0WA 3M8JA 1D1AA 4IQJA 2VB6A 1Y6IA 3M1CA 2Z1DA 4XORA 2V26A 4RMNA 3S3NA 1WJAA 4OAYA 2DOAA 3LSMA 3HPGA 2BOLA 1AA7A 4HEA2 4F55A 3VYUB 4XNFA 3VYTB 2JUGA 2W7NA 1TT0A 4D1QA 4ZDPA 1WJDA 2VQHA 1PYVA 2CUZA 3PSFA 2WAEA 4XOTA 2CFOA 2L9NA 3OR1C 5FRNA 3OYFA 1DQUA 2X85A 3OL3A 4LITA 4CZCA 2DXIA 3PL8A 4XMYA 1MMNA 4HSRA 4YEJA 3K4CA 2LYCA 3CESA 3H5AA 2LY1A 2HVRA 2V4JC 4XKBA 3OYNA 4PSWA 1PJRA 1D0YA 2ZSIB 2AQFA 4C9YA 3VDXA 3ONQA 1WJFA 4B48A 5LD2C 3TBIA 5LFAA 1W36D 1P9QC 2R7RA 2IGMA 3H35A 3RPUD 3I3LA 2CW7A 2X6XA 3QOEA 4IX7A 2E60A 3DU5A 3SEZA 2K9LA 4FASD 2K5CA 2E5NA 4XLEA 2CV0A 2IS2A 5CQGA 4BEHB 2O5RA 4BE1A 3L2WA 2VIXA 3BCBA 3RSNA 3D5RC 3K4BA 2BW3A 2W1OA 1R6RA 4ZDLA 2LY2A 3H0DA 3QYEA 4E7HA 2JVGA 2V6EA 3VWBA 2DJIA 4IZZA 2LBFA 3OYIA 4F52A 4ANJA 3OYDA 4QPOA 4R79A 4J00A 2M0MA 3KYLA 3PJRA 1G59A 2M4KA 1DGRM 4CUGA 2OUMA 3PFYA 2Q2EB 1SAUA 4YELA 4RM3A 4XOPA 5TGTA 2DCEA 2V9KA 4IKFA 1MNDA 3U21A 2XAUA 3AKZA 1Z7LA 3BLYA 1Z21A 4N4NB 2L9SA 3TMOA 1WJ5A 3W2WA 2DT7B 1ERDA 4PJJA 1X4PA 3SZGA 2Q1ZB 1HA8A 2Y0SA 3HL2A 2KRCA 3SEQA 1MW7A 4P1WA 1N78A 4B43A 3QODA 2DT6A 1EA3A 1LKXA 2F5VA 1V5FA 2HU9A 3EUAA 2JVHA 4IQ4A 3OYEA 4PSXA 2E1MB 2MABA 2HVQA 2KDOA 4EATA 2X6YA 2L7KA 4RM2A 2CH0A 2F4IA 3ZRGA 3D5LA 3ZXSA 1DGWY 1GLNA 4BS9A 4DGWB 3W3CA 2MD0A 4DBRA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1T0F C; 
#chains in the Genus database with same CATH topology
 3WTV C;  2IJL A;  4PUS A;  4M6Y A;  1WJC A;  1VQ4 I;  3I4M J;  1FEX A;  1YOV B;  2ZKZ A;  4CCM A;  3SDB A;  5J4Y A;  1BJZ A;  2DDB A;  4XLN F;  1TQP A;  2A07 F;  3AL0 B;  2WB1 A;  2XUB A;  2LKP A;  3IAS 2;  1TWA J;  1U3E M;  4HZF A;  1OQY A;  4OMY A;  4M3E A;  3CCE I;  2JA5 J;  3OOU A;  4JX4 A;  3TDU C;  1QPI A;  2P6T A;  4BBS J;  4BAY A;  4X1E A;  2FRH A;  4AIK A;  3E7L A;  5LHG A;  1LB2 A;  3PNT A;  4HDU A;  1ZTR A;  1V54 H;  1D0Z A;  3LFK A;  1K6O A;  4RS8 A;  1NHA A;  2NNN A;  1Q1H A;  2DAO A;  2RQQ A;  4KMF A;  3BJA A;  4BL0 B;  2XKO A;  3L2U A;  1NH3 A;  2FNP A;  2BVL A;  1LVK A;  4CZZ A;  5LEK A;  4XLA A;  4QLC U;  2M8E A;  3MD2 A;  3MCZ A;  5D6F A;  5ILS A;  2XAQ A;  2FSW A;  5HDN A;  1T8I A;  5DYM A;  1BI0 A;  1LFP A;  4B8X A;  4YFK F;  3WU2 C;  2LD5 A;  1V3F A;  2R5Y A;  3NEU A;  3I71 A;  1P92 A;  6PAX A;  4A3I J;  4XKW A;  3CUQ C;  4P9F A;  9ANT A;  1TC3 C;  1ETV A;  2FD5 A;  3EPZ A;  1TP4 A;  3H5N A;  3HXL A;  1HKS A;  3FHN A;  4RLF A;  1MMD A;  2V79 A;  3P9C A;  1SMT A;  2P5K A;  2ZJR F;  3WE2 A;  1OPC A;  2XAS A;  3K1M A;  2DFF A;  2JA6 J;  5F04 A;  2F4M B;  5F0C A;  3F21 A;  1I6H J;  2R7V A;  2DU9 A;  2LFB A;  4B3A A;  4DJA A;  1BR2 A;  2IVM A;  1SAN A;  3AG2 H;  2L3D A;  4BDY A;  3IAM 2;  5JFR A;  4EEF G;  4B09 A;  2EV5 A;  3GLL A;  3DEU A;  1H9T A;  1ZLJ A;  1U9O A;  4BQA A;  2BHZ A;  3BOQ A;  1K61 A;  3C1D A;  3SZP A;  3A0H C;  2EJR A;  1SD7 A;  1MJA A;  1JUM A;  2KT0 A;  1GDT A;  2QCO A;  4F91 B;  3KPH A;  2CW0 F;  3PM1 A;  4I0A A;  1K4S A;  4RGR A;  2PJP A;  3S2W A;  3HEF A;  3OV8 A;  3RYP A;  3GLX A;  1E3P A;  1N25 A;  4DYQ A;  3VSK A;  1R5I D;  3DTI A;  2E5Z A;  1GXQ A;  1HST A;  5DS9 A;  2VKH A;  5L3C A;  2M3A A;  4L9J A;  4O6J A;  5DTD A;  1UAA A;  1FC3 A;  1JTX A;  3DPL C;  1NK2 P;  1GXP A;  2DOE A;  5K7F A;  1BOB A;  2JPC A;  1IUY A;  5H2F C;  4L9N A;  4M71 A;  1IRG A;  3HPH A;  1S9H A;  3HOZ J;  3EQL F;  3BR0 A;  3CO6 C;  2GOM A;  4XIC A;  4XKC A;  3BR5 A;  3OS1 A;  2CMP A;  2AHQ A;  1ZR4 A;  1H9G A;  3V4G A;  2FNA A;  2ZNY A;  4KIF A;  3GZN B;  4LG3 A;  1AU7 A;  1B4A A;  2A6T A;  1VF9 A;  3JTG A;  1R7J A;  1DPR A;  3EUH A;  4PFO A;  5E3N A;  3A1Y A;  2MH9 A;  4JX6 A;  4M3B A;  3LL7 A;  4QWQ A;  4HNV A;  2XSD C;  3E6C C;  2DFH A;  2OBP A;  1R36 A;  3T5X A;  1HBX G;  3Q0V A;  3OYG A;  1IC8 A;  2ELJ A;  4Y3O A;  1BN5 A;  3KX2 A;  5C4X J;  2OZ6 A;  2E71 A;  2BY2 A;  4MFE A;  1K6Y A;  4Y4R A;  3FKJ A;  3CCV I;  1OYW A;  2ADU A;  2STT A;  4A0Y A;  2E2J J;  2RKH A;  5HLG A;  2QLZ A;  1AWC A;  2VKE A;  3AAF A;  3L1P A;  1DP3 A;  3C2H A;  3VOD A;  4BQN A;  2OQR A;  4IXA A;  5JHF A;  2X6O A;  3L00 A;  2CS3 A;  2XPU A;  1MZB A;  1VQO I;  4M9X A;  2B9S A;  2CGP A;  3OYH A;  3TQN A;  3ABT A;  3DLA A;  1XN7 A;  2DFI A;  2EQR A;  2P7V B;  5JVG F;  5M3F J;  3V8L A;  2DN0 A;  5C4J J;  4RDU A;  3H9J A;  2X1C A;  3FXM A;  3ZQG A;  2PN6 A;  2CV1 A;  5FLV A;  4B3X A;  3K70 C;  4A3F J;  1D3Y A;  1T0F A;  3WGI A;  2L01 A;  4FE4 A;  1Z6T A;  2O3F A;  4E7K A;  1H0M A;  1IN8 A;  1RPW A;  4GRI A;  4CH7 A;  1SD4 A;  2FUG 2;  4HNU A;  2GXB A;  1D8J A;  5CVR A;  5J1R A;  2FBH A;  3B6A A;  3LFU A;  3DBL B;  3BJ6 A;  1ON2 A;  2MLG A;  4D5C A;  1F43 A;  1X3Z B;  5CQE A;  2HOS A;  3QPS A;  1HSJ A;  3HUG A;  5K5O A;  1HF0 A;  4UXN A;  4HST A;  4A3K J;  3LQQ A;  4NC8 A;  3CP2 A;  2EPF A;  1YX3 A;  4HBL A;  2EIN H;  2QQ8 A;  4YIR X;  1SFX A;  4E4H A;  2ECB A;  3E5U A;  4K2E A;  3S1M J;  3HOT A;  1XB4 A;  1USS A;  1VQ5 I;  4JK1 X;  5B1A H;  4BAC A;  2A6E F;  2EIM H;  3DLL F;  3FBI B;  2JA8 J;  1RET A;  1OMI A;  2DLL A;  2EIL H;  4UV8 A;  5F1J A;  1FSH A;  4I09 A;  1QNT A;  2KLO A;  1R23 A;  3ML6 A;  4IL6 C;  2HDD A;  1JKO C;  1IRX A;  1S7A A;  4KFC A;  1FP2 A;  5A2Q K;  3DU6 A;  2H27 A;  4NUB A;  4S04 A;  4BYY A;  3OYB A;  3CJT B;  4MIM A;  1Z6R A;  2XHK A;  1QVT A;  2IXS A;  1MSF C;  1G3T A;  1Z9C A;  4BHC A;  4MTD A;  1BR1 A;  4Y17 A;  4Z6Y A;  1YQA A;  2F5E A;  4CSW A;  2K7L A;  4IRI A;  2D45 A;  2B0L A;  3COA C;  2P5V A;  2VI6 A;  2GLO A;  5EEA A;  3DP7 A;  2A68 F;  1IAW A;  4IO9 F;  4HRI A;  1GHC A;  2XRN A;  4U7D A;  2BW3 B;  2ESH A;  2P5L C;  2KHM A;  3L7W A;  4A3D J;  1W4M A;  2ELK A;  3OMY A;  2XF6 A;  3HC7 A;  3OS0 A;  2DA2 A;  2COB A;  2JRT A;  3BTL A;  1B8I B;  4HQM A;  3IKV A;  5E3L A;  3JW4 A;  5A2Q Z;  3E3V A;  3H36 A;  4IOC F;  2MLK A;  3L2C A;  3HRT A;  2V1U A;  2NVX J;  2QUF A;  1A6Q A;  3KZY A;  4NQW B;  3RKW A;  2X6W A;  2EV6 A;  2IGN A;  2M0C A;  2FU4 A;  5JVT A;  3KFW X;  4ZDO A;  3D0S A;  3A2K A;  1IF1 A;  4U87 A;  3OSF A;  3GZ5 A;  2UXN A;  3CJR B;  3HRU A;  3RZD J;  2Z16 A;  1PP7 U;  1WI9 A;  2YU3 A;  3DKY A;  1FTT A;  3VSL A;  3QWL A;  1MMA A;  2XAF A;  3VYS B;  4GDF A;  2OA4 A;  5BPD A;  2I10 A;  1SVM A;  4PJL A;  2E2H J;  5B1B H;  3W6K B;  3WGH A;  3TO9 A;  4HDV A;  4QTR A;  3LSI A;  2M7A A;  4MQ9 F;  3S93 A;  1ETX A;  1AKH B;  2ZME A;  2FE3 A;  3V8K A;  4AWX B;  3QAH A;  4ZH4 F;  4XR6 A;  4M73 A;  1T39 A;  3D5S C;  1A31 A;  5FLX K;  1D0X A;  3R0A A;  1UEL B;  2IP2 A;  2X0L A;  4BE0 A;  4HW0 A;  2Z99 A;  3EYY A;  4E7S A;  2P0W A;  4JP0 A;  2GXA A;  1STZ A;  1PDN C;  3R6S A;  1D1A A;  4IQJ A;  2VBX A;  2Z1D A;  2XGD A;  1TBX A;  1XTA A;  2DOA A;  3PFI A;  3FK6 A;  3I4P A;  2KIU A;  2R3S A;  2XAG A;  1AA7 A;  3WG7 H;  2DYS H;  3VYU B;  5KAF C;  3M07 A;  1BL0 A;  1DUX C;  1FBQ A;  2VQH A;  1OIS A;  1PYV A;  2CUZ A;  2GBY A;  4ZZD A;  3JRE A;  4XOT A;  1RR8 C;  5IP9 J;  3OR1 C;  4BH9 A;  3OYF A;  1DQU A;  4CZC A;  5FLX Z;  3BZC A;  4XMY A;  3IRR A;  4HSR A;  1K79 A;  2NRA C;  1G6N A;  5J3L A;  3CCL I;  3K4C A;  2LYC A;  2M1B A;  5EDN A;  3H5A A;  5EF6 A;  2F5D A;  2L7Z A;  3TP0 A;  2HVR A;  1ULY A;  2DOF A;  2FOW A;  1NK3 P;  3U9G A;  5ICG A;  5EEH A;  2OCC H;  4KYW A;  1ZG5 A;  5GAD J;  1JHH A;  4P55 A;  4EJT A;  1RR7 A;  5D8K B;  3GTG J;  2W48 A;  1MMS A;  4DQ2 A;  2V9P A;  4KIB A;  1XDS A;  5J8F A;  2JTV A;  3TBI A;  4JYK A;  2CQ7 A;  1IRF A;  3SFI A;  3HRM A;  5J47 A;  3FXU A;  3TW7 A;  2R7Z J;  3QOE A;  3DU5 A;  3FIS A;  3F22 A;  3CCQ I;  3RKY A;  4HF1 A;  5ILV A;  5D6E A;  5CQG A;  3I64 A;  2WV0 A;  1SAX A;  1SVL A;  2C6Y A;  2BEO A;  3R60 A;  3WHC A;  5LHH A;  3ABK H;  5TIS C;  2HDC A;  1JTY A;  3M9A A;  3GTO J;  3WOD F;  2LY2 A;  4HA8 A;  3CDH A;  3FK7 A;  3BPX A;  4E7H A;  2DMN A;  1UCR A;  2LBF A;  4Y15 A;  4QPO A;  3B73 A;  4R79 A;  3SFZ A;  3VFZ A;  4AID A;  1ZR2 A;  1DGR M;  2M5W A;  1FOX A;  3B02 A;  2OUM A;  4XRS A;  4KA4 A;  1WRJ A;  5LRR A;  1SAU A;  3JTH A;  3M1E A;  1OFC X;  2DCE A;  3RPQ A;  5EJC A;  1A6I A;  1TWH J;  1Z21 A;  4V2F A;  4RB2 C;  2DA7 A;  2H8R A;  3U2R A;  1ERD A;  1FOW A;  1HW5 A;  2MSY A;  4A3L J;  1HA8 A;  5ICE A;  5BMZ A;  2KRC A;  1VQK I;  2EV0 A;  3ZP5 A;  2A5Y B;  4B43 A;  3QOD A;  2VOP A;  4FCY A;  3QQA A;  4JBA A;  2DT6 A;  5HS9 A;  2HU9 A;  2QSG X;  4IHX A;  4IQ4 A;  2CQN A;  1TWC J;  5LBQ A;  2STW A;  1MBJ A;  1X2N A;  2EH3 A;  2HVQ A;  3T1B A;  2X6Y A;  5M5X J;  1WVR A;  3IWZ A;  3ZRG A;  1Z0X A;  4A3E J;  1SEU A;  1GLN A;  4DGW B;  4M3G A;  3KP7 A;  2MD0 A;  2O03 A;  1JGG A;  1ACI A;  2R7W A;  3J7A O;  1I1G A;  1ONV A;  3FMR A;  4HV5 A;  2G7H A;  1LDK B;  1E0E A;  2HNH A;  2R7X A;  4KJZ A;  4HG2 A;  3FM5 A;  3BG5 A;  4HAM A;  2LR8 A;  2BY0 A;  1BC8 C;  2RDP A;  5DCF A;  1ZRE A;  4A5N A;  1NTC A;  5C44 J;  4E7L A;  4V19 K;  3SDG A;  1L3L A;  4II2 A;  2E34 A;  2ISZ A;  1A5J A;  2LC2 A;  2OD5 A;  3FXL A;  3ZQL A;  1H8A C;  4ZYD A;  2JMW A;  3E5Q A;  3IRQ A;  3GUD A;  2F5F A;  2HZT A;  5C3E J;  1IN6 A;  1IZ1 A;  2MYS A;  2V9V A;  4GYG A;  1D8K A;  2G7U A;  4RAG A;  4B47 A;  1JT0 A;  2F4O B;  2HQA A;  1ETO A;  1YRN A;  1J2X A;  4D5F A;  3JRC A;  5KHD A;  1P4A A;  3WTX C;  2E19 A;  1BW6 A;  4I01 A;  2HVS A;  1E3H A;  1Z3Y A;  1ZEL A;  2HYG D;  3F3X A;  2IW5 A;  1TTY A;  2FJ1 A;  3UR3 C;  3BG3 A;  5DCM A;  3UNG C;  1JE8 A;  5B66 C;  2X51 A;  4JX5 A;  4BEH A;  5GTI C;  3LAJ A;  1ETQ A;  4OOI A;  1M1E B;  2OZU A;  4UB6 C;  4CYD A;  1WJE A;  4JOM A;  2VT3 A;  3F23 A;  1L0O C;  1S3J A;  3MKW B;  3P9I A;  2KZV A;  4H4K C;  1RC9 A;  4H0E A;  1BC7 C;  4ZYA A;  2PLY A;  1HW2 A;  5HVQ C;  1W36 C;  2LVS A;  2L02 A;  5GPA A;  2VQG A;  3J81 K;  4ESF A;  5IYD J;  4HOB A;  4AD9 A;  3HUG B;  5E1X A;  3GTQ J;  2IGK A;  2L7M P;  4C3J J;  4C3I J;  1X19 A;  3ECO A;  5E3M A;  4I6Z A;  4U0W A;  2HYF A;  1TWG J;  3L2R A;  2Q0O A;  2HYJ A;  3N97 A;  3ROU A;  3LSH A;  1YJ9 I;  4IHW A;  1TW2 A;  3JRA A;  4CA0 A;  2XV4 S;  1ZGA A;  2XDV A;  2HOT A;  3BDD A;  4PCQ A;  1JKP C;  1QHH D;  2G0E A;  3DFG A;  1B72 A;  3BZK A;  2VN2 A;  3FM3 A;  4IHV A;  5D5U B;  3QYB A;  3W6J B;  1XD7 A;  2R92 J;  2CW8 A;  3P7N A;  3NWT A;  4M6V A;  1XSD A;  3Q0W A;  3HOY J;  4HF2 A;  3C2B A;  3J81 Z;  1FYL A;  4FQG A;  2KPM A;  4QPQ A;  4C2U A;  4CHU A;  4UV9 A;  1SC7 A;  2YS9 A;  3WHB A;  2OJE D;  3CZ6 A;  4LIU A;  4IRH A;  4CO8 A;  1TLH B;  5GAG J;  1O3R A;  1TQI A;  2HOA A;  4KT6 A;  3U1D A;  4I02 A;  4A2U A;  4E7J A;  4W97 A;  1YHQ I;  3IWF A;  3QP5 A;  3V42 A;  1X1B A;  5F08 A;  1TL8 A;  3WU0 A;  4XKV A;  1W1W E;  3G73 A;  4CGZ A;  3E6D A;  1KQ8 A;  2IBD A;  2LRE A;  4MLO A;  5E1Z B;  5FKN A;  1WGX A;  1T2K A;  4A93 J;  3GF2 A;  3K9T A;  1D5V A;  2HXI A;  1U5T A;  3EET A;  3A03 A;  3S32 A;  4W1U A;  3MQ0 A;  3A01 A;  2VC1 A;  3PSI A;  4AYB N;  1A04 A;  2HS5 A;  3HM5 A;  5J1U A;  2EZL A;  4RAY A;  1B9N A;  4CIC A;  2LF8 A;  3GO5 A;  1WSU A;  2DDA A;  4WXH A;  5K5R A;  2BGC A;  3KLN A;  1E2X A;  2KRH A;  1UZC A;  2KIF A;  4C3H J;  2M30 A;  5KCM A;  4F3Q A;  5E3O A;  3G3Z A;  4AYB A;  1XGN A;  3I4N J;  4NHJ A;  1V5E A;  4ON0 A;  5D4S A;  2IS1 A;  1G8X A;  3DXJ F;  1MJ9 A;  2LSO A;  2DOD A;  3OOP A;  1IV8 A;  5DM6 F;  2HWV A;  4ITV A;  1MNM C;  1H88 C;  2A05 A;  2ETH A;  1MNE A;  1WPK A;  3IH4 A;  3HB9 A;  2VJ4 A;  2RV8 A;  2ZME B;  3I54 A;  1LJ9 A;  4MGR A;  4BGD A;  2VKV A;  5HLI A;  3FXO A;  1XG1 A;  3HSE A;  1APL C;  1QPM A;  4U0V A;  4A3M J;  1YW7 A;  2IPQ X;  2V1D A;  3GYH X;  3SZT A;  5BNG A;  3ZR8 X;  3MFK A;  2AS5 F;  3CP8 A;  2VE9 A;  3ZMZ A;  4L0Z B;  1TWF J;  3F8B A;  3ISP A;  4IF4 A;  3E0J B;  1FIA A;  1R4M B;  1G3S A;  1OR7 C;  1FP1 D;  2O61 A;  2COM A;  3MMY B;  4RLQ A;  3S8P A;  4LK0 F;  1GUU A;  4PFP A;  1UMQ A;  3PQK A;  3ASO H;  1RIO H;  4D7M A;  3GXO A;  1FOY A;  4RB3 C;  2PI0 A;  2K9M A;  5GAE J;  3RZO J;  1VI0 A;  4DZP A;  4ENN A;  2DA4 A;  2XB0 X;  5HNF A;  1MGT A;  2I5U A;  3DTK A;  3HKZ N;  5IOY A;  2XRO A;  4CCL A;  5LHI A;  2NNY A;  1FYK A;  3P9K A;  4HLX A;  1R1U A;  1JI8 A;  2ZSH B;  2XB5 A;  2E1C A;  3K2A A;  1BM9 A;  2H1L A;  3AL0 C;  2NVU B;  1OLT A;  4BY7 J;  3F8N A;  4YG2 F;  1BIB A;  1U8R A;  3ZQF A;  1AHD P;  4LG0 B;  3HKZ A;  2YUS A;  1OJL A;  3DPT A;  3M7G A;  2LTP A;  2W84 A;  3KP6 A;  4DW6 A;  2RAE A;  5CVJ A;  2WC2 A;  2OTL I;  2BBY A;  2RRE A;  1KGS A;  2PJR A;  1B59 A;  3CCY A;  3LMM A;  3MZH A;  1MDM A;  2KQR A;  1I1S A;  1OYI A;  3M3Y J;  4A0Z A;  3WTY C;  1XPX A;  3GZ6 A;  1VQN I;  2R0Q C;  3K6G A;  4RAZ A;  1BW5 A;  5E8I A;  3PUF A;  1NG6 A;  2XAH A;  2L5Q A;  2BXY A;  2LBF B;  2GIZ A;  1T08 B;  3HOW J;  3LA3 A;  5J1Y A;  5JLX A;  5D8L B;  1SD5 A;  2MC3 A;  4L5E A;  2FQ3 A;  1Z05 A;  4Q4Z F;  1IRZ A;  3TL4 X;  4M72 A;  1SFE A;  3S3M A;  2EIJ H;  5IT9 K;  1B1B A;  2MH2 A;  3PQJ A;  4XRF A;  3IHU A;  3GVA A;  1LE8 A;  3OYC A;  2D5V A;  1GVD A;  1O57 A;  1PUF A;  1UHM A;  3RKX A;  2HPM A;  3BWG A;  2OC6 A;  2R5Z A;  3S3O A;  1V4R A;  3BG9 A;  1XGM A;  1GV2 A;  5M5W J;  2KIS A;  2QKM B;  3E6B A;  4PJM A;  4LB5 A;  4KIC A;  1SFK A;  1ZKG A;  3OY9 A;  4U7B A;  3CCS I;  4GXO A;  2XGE A;  4KN4 X;  4IHT A;  3GFL A;  2R7S A;  1QHG A;  1V55 H;  1ODD A;  2R7D A;  5IT9 Z;  5DUK A;  1YIO A;  4ENM A;  1HCR A;  2NS7 A;  5KVR A;  4UB8 C;  3F6V A;  3BR2 A;  1QA6 A;  1UHW A;  2RQP A;  2E1N A;  4XID A;  3F8M A;  3M1C A;  5FD6 A;  2V26 A;  3ESW B;  1BJA A;  4RMN A;  1IGN A;  4I0B A;  4OAY A;  2K85 A;  1TT5 B;  1AOY A;  3HPG A;  2BOL A;  4A3C J;  3I5U A;  1EJ9 A;  4EM1 A;  3MAJ A;  4F55 A;  1FNN A;  4XNF A;  3DKW A;  2ME0 A;  1YFH A;  3LSJ A;  1QGP A;  2Z5U A;  4FIS A;  5ICC A;  2PMU A;  2WAE A;  3ULQ B;  2CFO A;  1LUJ B;  2ESN A;  3CLQ A;  3F0C A;  2DXI A;  2X85 A;  3ELK A;  3PL8 A;  1HXD A;  4QIW N;  2HFH A;  1MMN A;  2X4H A;  1BA5 A;  1U9N A;  4YEJ A;  4AC0 A;  2YX4 A;  4EJW A;  3H3V K;  3CES A;  2LY1 A;  4WK8 F;  1W5S A;  1KU9 A;  3GFI A;  4M3D A;  3QPH A;  4FX4 A;  1YRN B;  3OYN A;  3ZPL A;  3FIW A;  1PJR A;  3BTC A;  2F2E A;  2L7F P;  2EK5 A;  4YFX F;  3ONQ A;  1WJF A;  2DFE A;  5E79 C;  1HQC A;  2EA2 A;  3HGY A;  1QRY A;  4R1H A;  2R7R A;  4D7N A;  2IGM A;  1BBY A;  2LDU A;  3KZZ A;  3RPU D;  3GX4 X;  4KN7 X;  1YJW I;  5ERI A;  1ITY A;  3GEZ A;  4IX7 A;  5DCM B;  2YU9 J;  3SEZ A;  4ZYH A;  2K9L A;  2K5C A;  3FF5 A;  2OQG A;  4BEH B;  2VBZ A;  5GPC A;  1DDN A;  4MFD A;  2PFB A;  2DK5 A;  3BCB A;  2LMD A;  1JHF A;  2QF7 A;  5DV5 A;  4ESB A;  1K78 A;  1MBE A;  3AG3 H;  3PIO F;  4ZDL A;  4XSZ F;  3WGG A;  1B9M A;  2KFD A;  2R7F A;  4Y7N J;  1IXS B;  3QYE A;  3WTZ A;  3I55 I;  3JRF A;  2V6E A;  4E70 A;  2DJI A;  5HDG A;  4LLL A;  1HOM A;  4FTH A;  4F52 A;  4ANJ A;  3OYD A;  5B5E C;  2E35 A;  2DO7 A;  1MKM A;  4J00 A;  3RKQ A;  3JRH A;  1YW9 A;  3CUQ A;  1G59 A;  1LNW A;  4CUG A;  4I2O A;  1J59 A;  3TKY A;  2W57 A;  5IY5 H;  4YEL A;  2LY9 A;  5TGT A;  4IKF A;  1DPU A;  1RES A;  3CCM I;  4BNC A;  1EF4 A;  3BLY A;  2NXN B;  3KIO A;  4AUX A;  1JUP A;  1WJ5 A;  2HTS A;  5GTH C;  3W2W A;  5D5V B;  2K4J A;  4PJJ A;  2HEO A;  3GFM A;  3HOV J;  1DP7 P;  3ZMS A;  4PZJ A;  3SEQ A;  1OCR H;  1IUF A;  2CQQ A;  1EA3 A;  1LKX A;  2YR2 A;  1V5F A;  3I59 B;  3RPU A;  1F9N A;  3BJO A;  4OIN F;  1HW1 A;  2DQR A;  4G7H F;  4PSX A;  2MAB A;  4YFN F;  3CTA A;  4BY1 J;  5M5Y J;  1ETW A;  5H20 A;  2CH0 A;  2F4I A;  2WAQ N;  2IAI A;  3TO7 A;  4BS9 A;  1RI7 A;  1TNT A;  3M4O J;  2CFX A;  2OAZ A;  5FRM A;  1LDD A;  4RGX A;  2JWT A;  2MG4 A;  4NC6 A;  2HZD A;  4XK4 A;  3J7A Y;  3CMA I;  1P4X A;  2Z9O A;  2DPU A;  2WAQ A;  3SYT A;  1S7E A;  1KQ9 A;  4DYC A;  1RUO A;  2HR3 A;  3OWT A;  4G6T B;  5E17 F;  3WU1 B;  1LVA A;  3S2H J;  2A6H F;  2NS0 A;  2P4W A;  2RVC A;  2MW8 A;  4OAZ A;  1OCC H;  2NS8 A;  4N9I A;  5DUI A;  1VQ8 I;  3BQZ A;  4G9Y A;  2QVO A;  1P2F A;  2MBF A;  4Q48 A;  2Q8K A;  2K3F A;  3CME I;  4ZTJ A;  3DV8 A;  5FFZ A;  3ZMT A;  2A5W A;  5FB2 A;  1KYW A;  1U5T B;  1I6X A;  2X1D A;  1X1A A;  2HGC A;  2QYO A;  2NVT J;  2O8K A;  1FMW A;  3A01 B;  4A5M A;  2DTZ A;  4R8H A;  2BVM A;  3I58 A;  2EB7 A;  2PMZ N;  1N77 A;  3KEO A;  2LRD A;  1DU0 A;  2ECC A;  2KJC A;  1X1C A;  2Y48 A;  3A4C A;  2CSO A;  2TDX A;  1RKT A;  5F1R A;  2B7E A;  3HOU J;  2DMP A;  1ORK A;  4XON A;  2EFW A;  3C18 A;  1SD6 A;  2M2E A;  2PMZ A;  1I39 A;  1R22 A;  3REO A;  3I56 I;  1RRJ A;  2W24 A;  2KP6 A;  4M74 A;  4ZC3 A;  2UUZ A;  1R1V A;  1ZYR F;  1XMX A;  3MZ8 A;  3RJP A;  2ZXH A;  2WV1 A;  3FXR A;  3ZMU A;  4EM0 B;  2K02 A;  1WJB A;  3FHZ A;  2ID6 A;  4FX0 A;  1F5T A;  5FRO A;  2R5Y B;  2NVQ J;  1A35 A;  2QEX I;  3G1O A;  5EGO A;  4G12 A;  4EJV A;  2ZB9 A;  4Y33 A;  2V1N A;  2R7Q A;  2BY1 A;  4A0X A;  2DT5 A;  1EKE A;  3K4L A;  4OWR B;  4Q47 A;  1FPQ A;  3JRD A;  3I0T A;  2LLK A;  5FKK A;  3V7S A;  2ZJP F;  2VKD A;  3SJM A;  3C3W A;  4G6D A;  3SHF A;  3CF2 A;  3FXK A;  4F92 B;  1EV7 A;  2WA0 A;  3AFH A;  4HNT A;  1I27 A;  1BI2 A;  3LSK A;  5JR3 A;  1JKQ C;  2PQ8 A;  3F8C A;  2KIM A;  4A3G J;  3ERM A;  3E6M A;  3JSP A;  5FD5 A;  4BUP A;  2R7T A;  4I76 A;  1UHS A;  3OYL A;  2CYY A;  4P5O A;  2CRG A;  4PJ0 C;  2QEN A;  3NAR A;  4MNU A;  3LOC A;  1I5Z A;  2RN7 A;  1RUN A;  4EQQ A;  4I99 C;  1ZHF A;  3TP3 A;  2ZO4 A;  1ETK A;  2K9Q A;  2PX9 A;  1TQM A;  3OYM A;  2K3P A;  2F48 A;  2XF5 A;  5ILU A;  4D9J A;  1HDD C;  5DD8 A;  1TZL A;  2L4A A;  1BOA A;  2EZI A;  4YRV A;  2ISY A;  5IYB J;  2V6C A;  3Q0U A;  5HOO A;  4AIH A;  2WTE A;  4J01 A;  2L0K A;  1P4W A;  2D1V A;  3EDP A;  3O8G A;  1MH4 A;  1QU3 A;  4RA2 A;  2WAF A;  1K7A A;  1IJW C;  1KZH A;  1T33 A;  2HDW A;  2EZK A;  3GME A;  3UKG A;  1ETY A;  5IP6 A;  3GTP J;  3FZV A;  1W0U A;  2J5O A;  2AXT C;  3DBR B;  3LST A;  3GTK J;  2LKX A;  1UJ8 A;  4NC7 A;  4BKX A;  2FQ4 A;  4GYI A;  1PVE A;  3NWS A;  2MC4 A;  3DTE A;  3R61 A;  1IXR C;  4M9S A;  4XLF A;  4MEX F;  1Y1V J;  3FDY A;  4WXD A;  1HLV A;  2LP0 A;  3CCU I;  4OIP F;  1K83 J;  2KL4 A;  4V2G A;  4N0B A;  1REP C;  2OF7 A;  2L54 A;  3OSG A;  2DI3 A;  5AON A;  5F64 A;  1JUS A;  3MKY B;  5M3M J;  1NG7 A;  1T56 A;  1EH6 A;  2BYV E;  1FJL A;  5IYC J;  2HPI A;  3Q5F A;  5HNH A;  2P8T A;  2KZG A;  4UVB A;  3OIP A;  4EV0 A;  2XRL A;  1J5Y A;  3CF5 F;  1LE8 B;  2VXZ A;  3OYA A;  3LNQ A;  4B4C A;  3FX3 A;  2PMH A;  3C7J A;  2GXG A;  2R5Z B;  2X48 A;  2JN6 A;  2YSR A;  2M4G A;  4II3 A;  3DF8 A;  3WE3 A;  1VQ6 I;  3ZN0 A;  5FLM J;  5F27 A;  5FGM A;  3HJE A;  2FML A;  2JRM A;  2Y69 H;  3OYK A;  3HG9 A;  1FYM A;  2W25 A;  1TNS A;  3BQY A;  4OIO F;  3MVP A;  2QWW A;  3PO3 J;  4E7Z A;  4BQO A;  4A12 A;  3T8R A;  1R5G A;  2F6C A;  2IA2 A;  4L5J A;  1IG7 A;  1XMA A;  3C2G A;  4MQV A;  1Q1V A;  5BPI A;  1A36 A;  2M7B A;  3BC8 A;  3BTI A;  3PUB A;  3HYI A;  4NDL A;  5EG0 A;  1OCO H;  2YX7 A;  2UWM A;  3PIP F;  1RKW A;  3FXQ A;  3KP3 A;  3RYR A;  3OR2 C;  4UHT A;  4XN0 A;  4OU0 A;  2K40 A;  2Y9Y A;  2Z2S B;  3J80 K;  3FMQ A;  4LLG F;  5ICF A;  3HOS A;  4EGZ A;  1KYZ A;  3S1N J;  3ABM H;  1YW8 A;  2W85 A;  5EYR A;  3FWE A;  1MBG A;  2EBI A;  3TGN A;  5FJ8 J;  1X1P A;  3HIF A;  1J75 A;  3KP2 A;  2WBM A;  1UST A;  2OPT A;  3O8H A;  2JZY A;  2LNB A;  4EM2 A;  3KP5 A;  2WY8 Q;  4UUV A;  3ZQH A;  5JLW A;  2FF4 A;  2JA2 A;  2V7F A;  1W5C C;  3KEY A;  4DIQ A;  2M45 A;  1Y8Q B;  1Y56 A;  3FBN B;  2R93 J;  3H9Q A;  2VJI A;  4UUS A;  2DPD A;  3CD6 I;  2GA1 A;  2H6B A;  3F6O A;  2VBY A;  4P96 A;  4LOC A;  3KLO A;  2BY3 A;  1T38 A;  5F0H A;  3J80 Z;  3EUH C;  2QQA A;  3KP4 A;  2P7C B;  4BHB A;  5DD4 A;  2JK3 A;  2OCE A;  3X2Q H;  1X3U A;  1S8N A;  4IRG A;  2EZH A;  3IV5 A;  1KU2 A;  1IDZ A;  1OCP A;  2K9N A;  3QPL A;  4CYC A;  1FBS A;  1WH7 A;  1B8I A;  1WKM A;  3WTU C;  4RB0 A;  5CYV A;  4IHS A;  3K4J A;  1WQ2 A;  1T98 A;  4CXF A;  1YTY A;  2XKP A;  3DKX A;  3CLO A;  5TRD A;  2VJJ A;  3QOP A;  5CKT A;  3OYJ A;  2GZW A;  1U6G A;  4KMU X;  2ZCW A;  5FKM A;  3MZY A;  3DEE A;  3HBL A;  4NBQ A;  2BE5 F;  2RNG A;  1BIA A;  5KAI C;  3CUQ B;  3BG7 A;  3MKZ A;  2JQ7 A;  3IUO A;  3JSO A;  2IRF G;  1QZY A;  2AQE A;  3ZQ7 A;  5LRS A;  2K4B A;  2IS4 A;  2ZXJ A;  1SVO A;  4WF2 A;  3MWM A;  3IL2 A;  1MMG A;  2VQL A;  3HOX J;  3LWF A;  4ZJZ A;  2VC0 A;  4X0G A;  1YYV A;  1QZE A;  2EFP A;  3AG1 H;  3BG6 A;  5CVU A;  1FZP B;  1E3O C;  3CJQ B;  5H6Q A;  2YPR A;  1T0F C;  2DTR A;  4ASN A;  2DA3 A;  1FMV A;  5TJJ A;  2R7U A;  1BI1 A;  3CJN A;  4IJA A;  3G2B A;  1JJ8 C;  2VPL A;  4E6K G;  3HRS A;  4HQE A;  1VTN C;  2Y30 A;  4NNJ A;  2UZK A;  1F36 A;  3S1R J;  3LA7 A;  4PGH A;  4HX8 A;  4OIR F;  3L2Q A;  2FOK A;  1HC8 A;  2ZJQ F;  2Y75 A;  5D4R A;  4MO7 A;  2VOO A;  1LDJ A;  4HX7 A;  2EFQ A;  2MA3 A;  4HPQ A;  1X3W B;  2W82 A;  3O3K A;  1ZH5 A;  1ZG1 A;  4DBQ A;  5JHU A;  2JSP A;  1WZ2 A;  3ZN1 A;  1N75 A;  1KON A;  4EMS A;  4IPA A;  4BE2 A;  1MBH A;  2FX0 A;  1VQP I;  3O6B B;  5HS7 A;  4WX9 A;  2GIV A;  3H0G J;  2MD5 A;  3S3N A;  1WJA A;  2FXA A;  3LSM A;  3S2D J;  1FIP A;  1H89 C;  4HV6 A;  3KET A;  2IA1 A;  3H1C A;  5AIP A;  1FT9 A;  3HGG A;  3VYT B;  2JUG A;  2W7N A;  4KT5 C;  2CQX A;  1WJD A;  4ZDP A;  1HKT A;  3PSF A;  2XPW A;  2L9N A;  1VQL I;  5E18 F;  2VT2 A;  5J8C A;  5HDK A;  1YI2 I;  1YS6 A;  3HSF A;  3W6V A;  2K27 A;  2V4J C;  4XKB A;  2L4M A;  4FT8 A;  5LGT A;  1R58 A;  4GGG A;  4IEJ A;  1D0Y A;  2JSC A;  1G3Y A;  3E97 A;  4XSX F;  5HOD A;  4ENK A;  5K7H A;  1J9I A;  2XIG A;  2AQF A;  5E1W A;  2LK2 A;  4ABZ A;  2FBK A;  1JJ6 C;  1ZQ3 P;  3VDX A;  1U8B A;  1UFM A;  2DA6 A;  3QU3 A;  5K1Y A;  5LFA A;  1W36 D;  1P9Q C;  1JKR C;  2ZFW A;  4RBO A;  5LLQ A;  3I3L A;  2CUE A;  3JRG A;  2EFN A;  1ZRC A;  2CW7 A;  2X6X A;  3S15 J;  2BV6 A;  4FAS D;  2QQ9 A;  2A69 F;  4XLE A;  2CV0 A;  2IS2 A;  3RDI A;  4BE1 A;  1CF7 A;  5EEG A;  2QA4 I;  3L2W A;  2A61 A;  4Q5S F;  2VIX A;  1DU6 A;  3RSN A;  3QU6 A;  2K9S A;  2E1O A;  3D5R C;  3K4B A;  3ZMV A;  5GAH J;  5EGO B;  2L9R A;  5BOX A;  1XMK A;  1YG2 A;  2JT1 A;  3MEX A;  3RIR A;  1U78 A;  2O9L A;  1W7P D;  3LQR A;  2DK8 A;  4QSH A;  2OTJ I;  3FKI J;  2E7W A;  3NRV A;  4YII A;  4MHG A;  1IN4 A;  4EJO A;  2IEK A;  3T0Y A;  1GV5 A;  2QBY A;  3KYL A;  3CC2 I;  2CU7 A;  2NYX A;  5GP9 A;  1OCZ H;  4RGS A;  2IA0 A;  5DM7 F;  2CWE A;  3I53 A;  1OKR A;  2Y0S N;  1YLF A;  2ZME C;  4XOP A;  1W0T A;  2V9K A;  1MND A;  3U21 A;  2XAU A;  1Z7L A;  4N4N B;  2P81 A;  2L9S A;  1IO2 A;  3GTM J;  2DA5 A;  2DT7 B;  4LGW A;  4KIG A;  1X4P A;  3S16 J;  3SZG A;  2Q1Z B;  2CO5 A;  2Y0S A;  3MKL A;  3TOB A;  1MW7 A;  3LA2 A;  4UNO A;  3K1P A;  4KDP A;  1O3T A;  2ZNZ A;  4U0Y A;  3FXJ A;  1KU3 A;  1F4K A;  5HLH A;  2JVH A;  2DJN A;  3GCM A;  1Y8R B;  2E1M B;  3H3Z A;  3D1N I;  3KE2 A;  4DYR A;  2XAJ A;  2L7K A;  5K7Z A;  4DNC A;  1QVU A;  3D5L A;  2MGQ A;  3V7R A;  3W3C A;  3VB2 A;  2HOE A;  3VOE A;  2P6S A;  1I3A A;  2Z3Y A;  5J6X A;  1W7P A;  1J0R A;  1CGP A;  3R0J A;  1UB9 A;  1B6A A;  4E7I A;  1QQI A;  4LLN A;  1T6S A;  2ID3 A;  1FWZ A;  3DPU A;  2GQQ A;  4M3F A;  3G1M A;  3TOA A;  2XGC A;  3H92 A;  2HQR A;  1WFX A;  3CDI A;  3Q9S A;  2PEX A;  2JUC A;  3DQV C;  1T95 A;  2LOO A;  4G8X A;  5L3D A;  3ZQI A;  3K4M A;  1Y0N A;  3J7Y J;  3M8E A;  2VL8 A;  2TRT A;  3QPT A;  3GTL J;  4ENJ A;  3U1K A;  1SFU A;  3EUK L;  1XCB A;  4KIT B;  1UG2 A;  1YE9 A;  2OV7 A;  2L2O A;  3LSR A;  1MBK A;  3F9K A;  3MN2 A;  4WCG A;  3ZCO A;  1LFU P;  2WWY A;  3ASN H;  4L5I A;  4P9U A;  3IP4 B;  5IPA A;  2KIQ A;  2ELH A;  2W4S A;  4Y52 J;  1G2H A;  3CCJ I;  3CQZ J;  4LB6 B;  1ZGW A;  3VYR B;  3NAU A;  4ZTF A;  2VON A;  2DBB A;  4CCJ A;  2M9H A;  2CJJ A;  2H1K A;  1O7L A;  2B63 J;  3HDD A;  2NVY J;  3QRF F;  4CCO A;  4C30 A;  1FY7 A;  3ABU A;  4HF0 A;  3GBG A;  3CMM A;  2VOD A;  2GA2 A;  2TCT A;  3Q9V A;  1XCV A;  4LD5 A;  3OIQ A;  4PGG A;  1IV6 A;  1R71 A;  4BHP A;  4M6X A;  3ZGK A;  3KYC B;  2R4G A;  1UG0 A;  1WHU A;  1VND A;  1HDP A;  3V7C A;  2FA5 A;  3JAM K;  5ED4 A;  5EG0 B;  4LJZ F;  4XM3 A;  2E1M C;  1R5H A;  2VQC A;  3LSP A;  4BXX J;  5FO5 A;  3CC7 I;  1ZRF A;  1V5G A;  2VPR A;  3BP8 A;  4KIS A;  4XLC A;  2VBW A;  2O0Y A;  2LF7 A;  2LG4 A;  2X1E A;  1POG A;  3G4S I;  1JXS A;  2Q2E A;  4A6D A;  4EGY A;  1XX5 A;  3OL4 A;  5JI6 A;  1IN7 A;  2IS6 A;  1FLI A;  4C2T A;  1S29 A;  2VE8 A;  3ECH A;  3JAM Z;  1QZZ A;  3LAP A;  1OR7 A;  2GOX B;  3DWL E;  2GWR A;  2NOJ B;  2ZJ2 A;  3F8F A;  3K69 A;  5LGN A;  4UUS B;  3ERE D;  1YIJ I;  3SXY A;  4A69 C;  2LH9 A;  1ZG3 A;  1QBJ A;  2E36 A;  5EZH A;  1X58 A;  2VJ5 A;  2EWN A;  2FMY A;  3BR3 A;  4G7O F;  2XC7 A;  4CDG A;  5E20 A;  3M8F A;  1J7K A;  3LSG A;  2OU2 A;  1B72 B;  5FKL A;  1D1C A;  3TW6 A;  5IP7 J;  1XGS A;  4CYC B;  3KEQ A;  2E7X A;  5CPR B;  4DOZ A;  1ZN2 A;  1SMY F;  1X2M A;  4YIF A;  2G9W A;  1O7F A;  2JPB A;  1ZK8 A;  3L2V A;  3S1Q J;  2Z33 A;  3QYF A;  2KJB A;  1EH7 A;  5K5Q A;  1Y39 A;  2I8D A;  4BDZ A;  3OS2 A;  4L9V A;  1IW7 F;  5F6F A;  2W00 A;  2ZXW H;  5J40 A;  1YX5 A;  3BCA A;  1LFB A;  1ZGJ A;  3K4K A;  4L0Y B;  1ENH A;  1QO0 D;  3H9G A;  4DZJ A;  3IC7 A;  4FET A;  3QP6 A;  2ZBK A;  1XDU A;  4F7Z A;  1OCT C;  1P7J A;  2JJ7 A;  2VUM J;  4LK1 F;  4XRS G;  4CCN A;  4BU2 A;  4N9H A;  1FOK A;  3HZJ A;  1E17 A;  4PK4 A;  5L3F A;  5D5W B;  3WTT C;  3JR9 A;  1IXC A;  1P6R A;  4HX4 A;  2VLA A;  2BXZ A;  2QSF X;  4A6E A;  1LEA A;  3CC4 I;  5DDG A;  1KA8 A;  3E5X A;  1EH8 A;  2CUJ A;  2DMT A;  4BJ5 C;  4XBF A;  3H3U A;  3DCF A;  3RQ4 A;  3K70 D;  1R1T A;  2QKL B;  1XGO A;  3KZI C;  4LFU A;  2O6G E;  1XSV A;  3L09 A;  3PNY A;  5KNL A;  4LIV A;  3BT9 A;  3H5R A;  4XN3 A;  1C0W A;  4XRM A;  1X4O A;  5HLT A;  2CV2 A;  2ZXI A;  3RTR A;  4RB1 A;  4CCK A;  2M34 A;  4IVN A;  2HKX A;  4XL9 A;  4L18 B;  3HHG A;  1WWX A;  2N8G A;  2VXD A;  3G1L A;  4XLP F;  3JRB A;  1MIJ A;  1R49 A;  2A3S A;  2FBI A;  2BZT A;  4BXF A;  1MD0 A;  2WAD A;  1P7I A;  2DMQ A;  3BRO A;  2AO9 A;  1D1B A;  3Q3S A;  3K4N A;  1GVJ A;  1XC5 A;  3BTJ A;  1IN5 A;  2WY7 Q;  3BY6 A;  4TV7 A;  1K4T A;  4XLH A;  2UV1 A;  2XPV A;  3BR1 A;  1W5T A;  4GCV A;  2PG4 A;  1VZ0 A;  4OMZ A;  3FMS A;  4G6Q A;  2XSJ C;  5F0F A;  2RC4 A;  2CUF A;  3ABL H;  3K2Z A;  4LG0 A;  1MSE C;  1ZRD A;  1YS7 A;  4M9Z A;  1WI3 A;  1Z3X A;  3L9F A;  1X1D A;  2JA7 J;  2NAZ A;  3JRI A;  2H6C A;  4L9T A;  5BS6 A;  1IDY A;  5H6R A;  1KQ0 A;  1Z77 A;  3CUO A;  2NOG A;  4D0P A;  4O5V A;  3ZQC A;  4FE7 A;  4HYE A;  4N4O B;  3PO2 J;  3KYD B;  3W2V A;  3VEP A;  3O2P E;  4BJ6 C;  2ICW G;  1GT0 C;  1Y1W J;  4UY8 I;  1U5T C;  1YO5 C;  2GAU A;  1FTZ A;  3N05 A;  3RCO A;  3PNV A;  3EYI A;  3CCR I;  1CF7 B;  4KUM A;  1CQT A;  4I98 B;  5D5X B;  3W2A A;  1I50 J;  2RNJ A;  4AM3 A;  3TED A;  2V1X A;  1FX7 A;  1Z7U A;  2KMU A;  5IT3 A;  1J09 A;  4AU7 A;  1JT6 A;  5E8G A;  2PJR B;  2DMU A;  4PJN A;  5CLS A;  1OYY A;  1WH5 A;  1MDM B;  2QBY B;  5DEQ A;  3T8T A;  3B6C A;  4BQQ A;  3HSR A;  1MBF A;  2KKO A;  1ZAR A;  1BR4 A;  4AVZ A;  2BHY A;  2R7O A;  4JQF A;  4WXC A;  4RAF A;  1FSE A;  4BXU A;  1S7O A;  1LPQ A;  4KNY A;  4LMY A;  2MFZ A;  3NQO A;  5LEJ A;  2IGO A;  5J4V A;  2VAS A;  4ZYG A;  4Y13 A;  3IH3 A;  3GFJ A;  1TW3 A;  5FKO A;  3CMY A;  2GM4 A;  1YIT I;  2XF7 A;  3VPR A;  4F93 B;  1ZLK A;  1VQ9 I;  1KU7 A;  2H09 A;  1SFO J;  4XQF A;  3ZMD A;  4I7H A;  3HTS B;  4A3B J;  4ESJ A;  4BJT A;  3G6E I;  5FFX A;  3E1S A;  1HKQ A;  3R4K A;  2D2W A;  1PP8 F;  3DEW A;  2ZFU A;  1Z91 A;  3TDZ C;  3BR6 A;  5EZG A;  3K10 A;  1XS9 A;  1PUF B;  4EJU A;  1VQ7 I;  3TO6 A;  2D1H A;  3RI4 A;  3G71 I;  4EVI A;  1U0J A;  4UVA A;  1S6L A;  3ZQQ A;  3I9V 2;  4U88 A;  1Y0U A;  3K7A J;  4B44 A;  2QSH X;  4IOA F;  3ZOB A;  1Z67 A;  2HI3 A;  2K86 A;  4OIQ F;  3M8J A;  1W7P B;  2VB6 A;  1Y6I A;  2H94 A;  3KCC A;  4XOR A;  2KDZ A;  3HHH A;  2O8X A;  5LGU A;  1VFC A;  3A02 A;  3N4M A;  4RGU A;  4A3J J;  1MH3 A;  2FEZ A;  4HEA 2;  2DA1 A;  1MJB A;  1TT0 A;  4D1Q A;  4ZYE A;  3GWZ A;  1G4D A;  4BBR J;  1ZAO A;  1F1Z A;  2XGX A;  4GFB A;  5FRN A;  4X6A J;  3OL3 A;  1PUE E;  4FHT A;  2DW4 A;  2HTJ A;  4LIT A;  1ON1 A;  2EIK H;  2XVC A;  4HLY A;  1O3Q A;  1R00 A;  3SQN A;  1FBU A;  1XSX A;  3JCU C;  4G7Z F;  3RQI A;  3IKT A;  2ME6 A;  4J19 A;  2HQN A;  3WG9 A;  4PSW A;  4B1R A;  2EA4 A;  1I3Q J;  4ZZL A;  5L3B A;  2ZSI B;  3P5J A;  2EFO A;  2F5C A;  4G94 A;  1U2W A;  4C9Y A;  4S0H B;  3OIO A;  4B48 A;  5LD2 C;  1O3S A;  1Z1D A;  1D5Y A;  2M87 A;  4GO1 A;  2HXO A;  3IH2 A;  2Y9Z A;  2HKO A;  3H35 A;  3WTS C;  4UUT A;  4MTE A;  3S14 J;  4C2M J;  4O3M A;  2E60 A;  5CJ9 A;  5BQT A;  2Y0M A;  3CO7 C;  1BI3 A;  2E5N A;  1S5L C;  2O5R A;  3GW2 A;  4IHY A;  3BZ6 A;  1WCM J;  3K1N A;  2O7O A;  2BW3 A;  2W1O A;  2QM3 A;  1S72 I;  2QQB A;  1R6R A;  2Y31 A;  1YJN I;  3H0D A;  1LEB A;  4NB5 A;  4MEY F;  4AVP A;  2M8G X;  2JVG A;  3VWB A;  3A0B C;  1RNL A;  4IZZ A;  1JGS A;  3OYI A;  3HTU A;  2E2I J;  3J7Z I;  2IT0 A;  2J5P A;  2M0M A;  3S17 J;  1R9T J;  4NQW A;  3PJR A;  2M4K A;  1K78 B;  3BPV A;  5KK1 A;  1R4N B;  2KRF A;  2RGV A;  5AIQ A;  3PFY A;  1O4X A;  2Q2E B;  2X9D A;  4RM3 A;  2QGU A;  3GTJ J;  1RZ4 A;  3F72 A;  1G3W A;  2L9V A;  3AKZ A;  2LKS A;  3AG4 H;  3I59 A;  3TMO A;  5L3G A;  5CVV A;  5HS8 A;  3DBH B;  4AIJ A;  2AXL A;  2Y2Z A;  2CQK A;  2ZC2 A;  4UVC A;  3CDL A;  4Z2Y A;  5B3S H;  3HL2 A;  4P1W A;  1LQ1 A;  1N78 A;  3V8J A;  2ACJ A;  3WTW C;  2QZ8 A;  2F5V A;  3EUA A;  2H8W A;  4ETS A;  4S05 A;  2DYR H;  3OYE A;  1AKH A;  2HQ5 A;  4PDK A;  4WWC A;  2KDO A;  4EAT A;  4RM2 A;  1VQM I;  3ZXS A;  3K0L A;  5CVI A;  5IOZ A;  1DGW Y;  2DQL A;  5L3E A;  2WB1 N;  2PBI A;  2UXX A;  4DBR A;  2CG4 A; 
#chains in the Genus database with same CATH homology
 4PUS A;  5FRM A;  1WJC A;  1LDK B;  4E7I A;  1E0E A;  2HZD A;  4CCM A;  3J7A Y;  3SDB A;  2WAQ A;  2HNH A;  3SYT A;  2R7X A;  3DPU A;  4KJZ A;  4HG2 A;  3OWT A;  4G6T B;  3AL0 B;  2WB1 A;  3IAS 2;  1WFX A;  4OAZ A;  4E7L A;  3OOU A;  4II2 A;  3DQV C;  1T95 A;  2LC2 A;  2LOO A;  4ZTJ A;  3K4M A;  2A5W A;  2VL8 A;  3PNT A;  2X1D A;  1X1A A;  1FMW A;  1D0Z A;  3EUK L;  2BVM A;  4KIT B;  1YE9 A;  1N77 A;  2OV7 A;  2MYS A;  2L2O A;  2LRD A;  2RQQ A;  3F9K A;  3L2U A;  4BL0 B;  3ZCO A;  4B47 A;  2HQA A;  2BVL A;  1LVK A;  4XLA A;  1X1C A;  3A4C A;  3IP4 B;  3MD2 A;  2W4S A;  5KHD A;  4XON A;  1LFP A;  2PMZ A;  3VYR B;  4ZTF A;  4CCJ A;  2HVS A;  1Z3Y A;  2KP6 A;  1ZEL A;  4CCO A;  4C30 A;  4ZC3 A;  2UUZ A;  4XKW A;  3GBG A;  3CMM A;  3UR3 C;  3UNG C;  2ZXH A;  3EPZ A;  3H5N A;  3HXL A;  3FHN A;  2X51 A;  1WJB A;  4RLF A;  1MMD A;  3OIQ A;  4BEH A;  5FRO A;  3ZGK A;  1WJE A;  2R4G A;  1UG0 A;  4JOM A;  4Y33 A;  2V1N A;  2R7Q A;  2R7V A;  3K4L A;  4OWR B;  4DJA A;  4XM3 A;  1BR2 A;  3MKW B;  4BDY A;  2E1M C;  3IAM 2;  2VQC A;  2KZV A;  2VKD A;  4H4K C;  4ZYA A;  3CF2 A;  4F92 B;  5HVQ C;  2WA0 A;  1W36 C;  3AFH A;  4HNT A;  1V5G A;  2VQG A;  3LSK A;  4KIS A;  4XLC A;  3HUG B;  2LG4 A;  2X1E A;  2IGK A;  1X19 A;  4BUP A;  4F91 B;  2R7T A;  3L2R A;  3OYL A;  3OL4 A;  3LSH A;  4P5O A;  2IS6 A;  4CA0 A;  2XDV A;  4C2T A;  3VSK A;  3DTI A;  2E5Z A;  1QHH D;  3DWL E;  2GOX B;  2NOJ B;  2VKH A;  3QYB A;  2LH9 A;  2CW8 A;  2M3A A;  3NWT A;  1UAA A;  3DPL C;  3OYM A;  2K3P A;  2VJ5 A;  2XF5 A;  4D9J A;  1TZL A;  2XC7 A;  1BOB A;  2KPM A;  4YRV A;  5HOO A;  4J01 A;  4QPQ A;  3LSG A;  2R7W A;  4C2U A;  1QU3 A;  1D1C A;  2WAF A;  3HPH A;  1S9H A;  2HDW A;  5CPR B;  4DOZ A;  3CZ6 A;  4LIU A;  2GOM A;  4XKC A;  3OS1 A;  2CMP A;  4KT6 A;  4E7J A;  3L2V A;  3QYF A;  4LG3 A;  3V42 A;  1X1B A;  4NC7 A;  2A6T A;  2I8D A;  3NWS A;  2MC4 A;  4XKV A;  4BDZ A;  3DTE A;  3OS2 A;  2W00 A;  4XLF A;  4PFO A;  3FDY A;  1YX5 A;  3A1Y A;  3BCA A;  2LRE A;  4MLO A;  3K4K A;  3LL7 A;  3H9G A;  2KL4 A;  4FET A;  3OYG A;  3MKY B;  3S32 A;  2ELJ A;  1NG7 A;  4Y3O A;  4CCN A;  3PSI A;  4BU2 A;  3KX2 A;  4PK4 A;  2HPI A;  5HNH A;  2VLA A;  3OIP A;  1K6Y A;  4Y4R A;  3FKJ A;  2KRH A;  2VXZ A;  3OYA A;  5KCM A;  4F3Q A;  1DP3 A;  3C2H A;  4AYB A;  4BQN A;  1V5E A;  2CUJ A;  2M4G A;  4II3 A;  5JHF A;  2IS1 A;  1G8X A;  2CS3 A;  4BJ5 C;  3RQ4 A;  3K70 D;  2QKL B;  4ITV A;  3OYH A;  3PNY A;  5KNL A;  4LIV A;  3OYK A;  3DLA A;  3H5R A;  3HG9 A;  1MNE A;  4XN3 A;  2VJ4 A;  4BGD A;  4E7Z A;  4BQO A;  1X4O A;  5HLT A;  2F6C A;  2CV2 A;  3H9J A;  2ZXI A;  2X1C A;  2CV1 A;  4B3X A;  3C2G A;  3K70 C;  3RTR A;  4CCK A;  3ZR8 X;  2M7B A;  4XL9 A;  3BC8 A;  3CP8 A;  3PUB A;  4E7K A;  4GRI A;  4CH7 A;  2VXD A;  2FUG 2;  4HNU A;  2UWM A;  3E0J B;  3OR2 C;  4BXF A;  2WAD A;  4XN0 A;  3LFU A;  1OR7 C;  4RLQ A;  3MMY B;  1D1B A;  3S8P A;  2Z2S B;  3K4N A;  3HOS A;  4PFP A;  5CQE A;  2WY7 Q;  4XLH A;  2UV1 A;  4HST A;  2K9M A;  4NC8 A;  3CP2 A;  2WBM A;  1YX3 A;  2WY8 Q;  1VZ0 A;  4E4H A;  3HOT A;  2XSJ C;  2JA2 A;  2V7F A;  5HNF A;  3KEY A;  4DIQ A;  3DTK A;  4BAC A;  3FBN B;  1Y56 A;  1Z3X A;  4CCL A;  1X1D A;  2VJI A;  3H9Q A;  3FBI B;  1JI8 A;  2ZSH B;  2KLO A;  3AL0 C;  1IRX A;  1OLT A;  3EUH C;  3DU6 A;  4NUB A;  3HKZ A;  3OYB A;  3DPT A;  2IXS A;  4N4O B;  3W2V A;  4BJ6 C;  1BR1 A;  4CSW A;  3N05 A;  2RRE A;  3PNV A;  3RCO A;  3K4J A;  2PJR A;  4HRI A;  3LMM A;  3W2A A;  2BW3 B;  3DKX A;  2KQR A;  2VJJ A;  5CKT A;  3OYJ A;  2KHM A;  3K6G A;  3OMY A;  3OS0 A;  2XF6 A;  3HC7 A;  1NG6 A;  2KMU A;  2L5Q A;  1J09 A;  4AU7 A;  2LBF B;  3DEE A;  2PJR B;  4PJN A;  2RNG A;  4BQQ A;  3BG7 A;  3MKZ A;  4NQW B;  3IUO A;  2AQE A;  2X6W A;  2IGN A;  2IS4 A;  1BR4 A;  4AVZ A;  2R7O A;  4JQF A;  1MMG A;  2VQL A;  4ZDO A;  3TL4 X;  3A2K A;  3S3M A;  4ZJZ A;  2MFZ A;  4X0G A;  2IGO A;  2VAS A;  4U87 A;  3BG6 A;  3CJR B;  3OYC A;  2Z16 A;  2XF7 A;  4F93 B;  3DKY A;  3CJQ B;  2HPM A;  3VSL A;  2OC6 A;  1T0F C;  4XQF A;  3S3O A;  1FMV A;  1MMA A;  3VYS B;  4BJT A;  2R7U A;  2QKM B;  4PJM A;  3E1S A;  3G2B A;  2VPL A;  4E6K G;  4PJL A;  2ZFU A;  4NNJ A;  1SFK A;  3OY9 A;  4U7B A;  3K10 A;  3L2Q A;  3LSI A;  2M7A A;  3S93 A;  2R7S A;  1QHG A;  1U0J A;  3ZQQ A;  3I9V 2;  4HPQ A;  4XR6 A;  2W82 A;  3D5S C;  1D0X A;  4DBQ A;  4B44 A;  2JSP A;  1UEL B;  1N75 A;  1KON A;  4BE0 A;  4BE2 A;  4E7S A;  2P0W A;  3M8J A;  1D1A A;  4IQJ A;  2VB6 A;  1Y6I A;  3M1C A;  2Z1D A;  4XOR A;  2V26 A;  4RMN A;  3S3N A;  1WJA A;  4OAY A;  2DOA A;  3LSM A;  3HPG A;  2BOL A;  1AA7 A;  4HEA 2;  4F55 A;  3VYU B;  4XNF A;  3VYT B;  2JUG A;  2W7N A;  1TT0 A;  4D1Q A;  4ZDP A;  1WJD A;  2VQH A;  1PYV A;  2CUZ A;  3PSF A;  2WAE A;  4XOT A;  2CFO A;  2L9N A;  3OR1 C;  5FRN A;  3OYF A;  1DQU A;  2X85 A;  3OL3 A;  4LIT A;  4CZC A;  2DXI A;  3PL8 A;  4XMY A;  1MMN A;  4HSR A;  4YEJ A;  3K4C A;  2LYC A;  3CES A;  3H5A A;  2LY1 A;  2HVR A;  2V4J C;  4XKB A;  3OYN A;  4PSW A;  1PJR A;  1D0Y A;  2ZSI B;  2AQF A;  4C9Y A;  3VDX A;  3ONQ A;  1WJF A;  4B48 A;  5LD2 C;  3TBI A;  5LFA A;  1W36 D;  1P9Q C;  2R7R A;  2IGM A;  3H35 A;  3RPU D;  3I3L A;  2CW7 A;  2X6X A;  3QOE A;  4IX7 A;  2E60 A;  3DU5 A;  3SEZ A;  2K9L A;  4FAS D;  2K5C A;  2E5N A;  4XLE A;  2CV0 A;  2IS2 A;  5CQG A;  4BEH B;  2O5R A;  4BE1 A;  3L2W A;  2VIX A;  3BCB A;  3RSN A;  3D5R C;  3K4B A;  2BW3 A;  2W1O A;  1R6R A;  4ZDL A;  2LY2 A;  3H0D A;  3QYE A;  4E7H A;  2JVG A;  2V6E A;  3VWB A;  2DJI A;  4IZZ A;  2LBF A;  3OYI A;  4F52 A;  4ANJ A;  3OYD A;  4QPO A;  4R79 A;  4J00 A;  2M0M A;  3KYL A;  3PJR A;  1G59 A;  2M4K A;  1DGR M;  4CUG A;  2OUM A;  3PFY A;  2Q2E B;  1SAU A;  4YEL A;  4RM3 A;  4XOP A;  5TGT A;  2DCE A;  2V9K A;  4IKF A;  1MND A;  3U21 A;  2XAU A;  3AKZ A;  1Z7L A;  3BLY A;  1Z21 A;  4N4N B;  2L9S A;  3TMO A;  1WJ5 A;  3W2W A;  2DT7 B;  1ERD A;  4PJJ A;  1X4P A;  3SZG A;  2Q1Z B;  1HA8 A;  2Y0S A;  3HL2 A;  2KRC A;  3SEQ A;  1MW7 A;  4P1W A;  1N78 A;  4B43 A;  3QOD A;  2DT6 A;  1EA3 A;  1LKX A;  2F5V A;  1V5F A;  2HU9 A;  3EUA A;  2JVH A;  4IQ4 A;  3OYE A;  4PSX A;  2E1M B;  2MAB A;  2HVQ A;  2KDO A;  4EAT A;  2X6Y A;  2L7K A;  4RM2 A;  2CH0 A;  2F4I A;  3ZRG A;  3D5L A;  3ZXS A;  1DGW Y;  1GLN A;  4BS9 A;  4DGW B;  3W3C A;  2MD0 A;  4DBR A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...