3IWFA

The crystal structure of the n-terminal domain of a rpir transcriptional regulator from staphylococcus epidermidis to 1.4a
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
102
structure length
89
Chain Sequence
b'MPNILYKIDNQYPYFTKNEKKIAQFILNYPHKVVNMTSQEIANQLETSSTSIIRLSKKVTPGGFNELKTRLSKFLPKEVTQYNNKLHSR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Transcription regulator RpiR family
publication title The Crystal Structure of the N-terminal domain of a RpiR Transcriptional Regulator from Staphylococcus epidermidis to 1.4A
rcsb
source organism Staphylococcus epidermidis
molecule tags Transcription regulator
total genus 32
structure length 89
sequence length 102
chains with identical sequence B
ec nomenclature
pdb deposition date 2009-09-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01418 HTH_6 Helix-turn-helix domain, rpiR family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 3iwfA00
4Y15A 1U6GA 4OMYA 3TDZC 1S29A 3QRFF 3ZMTA 2Z5UA 2D1VA 3EUHA 4A0ZA 2GA1A 5A2QK 1GXQA 1JGSA 1FT9A 3JSPA 4HF2A 3U9GA 3KE2A 5DD8A 2C6YA 2XKPA 2FNPA 3N97A 2HOEA 2EV6A 5HS8A 2J5OA 3JTHA 2IJLA 3KLOA 1U5TC 5CJ9A 2W57A 4MHGA 4XRFA 2Z33A 3LA7A 3V7RA 2ISYA 1A04A 5HDGA 1DP7P 2VC1A 1ZRCA 3HRTA 2IA2A 5HLGA 3HRUA 3T5XA 4G8XA 3E6CC 2F5DA 2L4AA 2QWWA 3CLOA 3D5LA 4Z2YA 5FLXZ 4YFNF 3NEUA 5FB2A 3IC7A 3ULQB 2STTA 2IA1A 2NAZA 2Z99A 4R79A 1EH7A 5D6FA 2ZNZA 3HHGA 1W5TA 4BAYA 4ASNA 1I1SA 3SHFA 4A6DA 4GXOA 1FSHA 3R4KA 2A6HF 2V79A 3WE3A 1P4AA 2EFOA 1MKMA 3Q9VA 2ZMEA 3HOTA 2MH9A 1IRFA 4UVCA 4AD9A 3K1MA 4QLCU 3VB2A 2QBYB 1K6OA 3E6MA 2ZBKA 3F8BA 1YS7A 2E1CA 1S8NA 2WTEA 1SFUA 2BBYA 2O3FA 3KZZA 4G7HF 3C1DA 1UCRA 3WG9A 3C7JA 1OPCA 3VODA 4N0BA 1IXCA 4M6XA 4I98B 2FXAA 2VE8A 1JXSA 2DAOA 1XCBA 3J80Z 5FD6A 1BBYA 1TNSA 1CF7B 2XAFA 2W24A 1ZRDA 2A3SA 1B9NA 1MZBA 4RB0A 1P92A 1XSDA 1TBXA 2XIGA 3E6DA 4GO1A 3WTZA 3LAPA 4A2UA 5FO5A 1BI1A 4IHSA 2HGCA 1KU7A 2A07F 2XASA 5L3CA 1RZ4A 2XGXA 3HUGA 2XHKA 1T6SA 2IVMA 1D8JA 5J8CA 1TTYA 5LGUA 3FZVA 3GLXA 3HHHA 2G9WA 2W84A 1ZLJA 3DEUA 4LK1F 3GFMA 4IRIA 1R23A 5LHIA 1GVJA 1DUXC 3DKWA 3TO9A 2VXZA 3ELKA 3OV8A 5HLHA 5CVUA 3DF8A 1I27A 3F22A 1OR7A 4I0AA 4OIOF 3F8MA 2HKOA 4U7DA 1YQAA 1Z6RA 3K9TA 2FSWA 3GFLA 3IRQA 2BEOA 1XDSA 3WTTC 2P6TA 1TLHB 3EQLF 1REPC 1IAWA 4KMFA 3TO7A 2O6GE 4HQMA 3IWZA 4RB1A 4N9IA 4WCGA 1L3LA 3E3VA 4ESFA 4RB3C 1RIOH 1R1TA 4M6YA 4Q47A 3GZ5A 1ZGJA 3FXUA 2UXNA 1Z1DA 4KYWA 3CUOA 1YIOA 1Z91A 2YU3A 4F7ZA 4Q4ZF 5DUKA 3K1PA 1ON2A 3MWMA 4ENJA 5DCFA 3WGIA 5ICGA 2K86A 3C18A 4MQ9F 2W85A 3GYHX 2QQBA 5LLQA 1UB9A 3NQOA 1XCVA 2EK5A 3I59B 3RDIA 1KU3A 2RQPA 3SXYA 3T0YA 2MD5A 1P6RA 1S6LA 2P4WA 1TW2A 1K78B 2VBXA 1BI0A 1J7KA 2FBIA 4AIHA 3Q5FA 5LHHA 4HDUA 4BHBA 3MZHA 3QOPA 1ZREA 4KICA 5D5WB 2FU4A 3F8CA 4S04A 3ML6A 2XRNA 3EYIA 3WU1B 4P5OA 5BMZA 5LBQA 3KLNA 1FP1D 3LAJA 1K78A 3TQNA 5LRSA 3RKWA 4CGZA 5D4RA 1Z05A 4ZYDA 1LEBA 3ISPA 4K2EA 2DPUA 1YYVA 3PQJA 3DV8A 1NHAA 4DNCA 5D8LB 1L0OC 4M9XA 5K5RA 1U2WA 2R3SA 2RGVA 4KIFA 1U8RA 4S05A 3RPUA 3JAMZ 4KN7X 5ERIA 4L9JA 3GXOA 1PDNC 4QWQA 4CZZA 3D0SA 2Q8KA 3E5QA 3R0AA 4WWCA 1R58A 3AAFA 4LD5A 1HW5A 1MJAA 4IVNA 3HTSB 4EVIA 4HW0A 4UVBA 2A5YB 1BIBA 1BM9A 4U88A 1YG2A 2X4HA 3ZMDA 2RDPA 1FNNA 2RN7A 3MCZA 4KT5C 1P4XA 5D6EA 2KKOA 4KDPA 4OIQF 1YO5C 1R5HA 5D5VB 4LLNA 2OA4A 1IXSB 3P9KA 4EM2A 1Q1HA 1FBQA 3HRSA 1S3JA 3ABTA 3BJOA 4HF1A 3BZ6A 3DFGA 2EFWA 1R36A 1SD5A 2H94A 2QUFA 1KGSA 1EV7A 5H6RA 3L00A 2PI0A 3ZN0A 3I54A 2M87A 2YSRA 1O7FA 4HQEA 2MC3A 4XLPF 1FZPB 2FF4A 1TNTA 3BROA 3I71A 1U3EM 4Q48A 2R7DA 1O57A 5H6QA 5BPDA 1S7OA 2ISZA 4Q5SF 2YR2A 4CYDA 3Q9SA 3SFZA 5LEJA 2IA0A 2VOPA 3EETA 2YPRA 1FX7A 3R6SA 1DPRA 3REOA 2ZKZA 3C3WA 1ZH5A 2H09A 4JBAA 5L3BA 3S2WA 3FXQA 1G3SA 2CYYA 2DI3A 2PQ8A 1RUOA 2P7VB 2HTSA 3DPTA 3KEQA 2O03A 4DQ2A 4G7ZF 2P5LC 4ESBA 5CLSA 2K7LA 2GAUA 1R5GA 2CGPA 1FOKA 5FFZA 4FX4A 1ULYA 5JR3A 3BDDA 2KJBA 1PP8F 3BJAA 3R61A 5F6FA 3TOAA 1XSVA 2L01A 1J5YA 2RNJA 2JPBA 2LDUA 3DP7A 4M72A 1FC3A 1XGOA 5ICFA 2L54A 5F1RA 4L18B 2DK5A 2FNAA 2QYOA 1ONVA 2HQRA 3LQQA 3COAC 2BGCA 1OYWA 5JFRA 3K0LA 4P55A 3ZMVA 3P9CA 4PCQA 1W7PB 2DPDA 5D5XB 2XAQA 3VOEA 2MLKA 3RIRA 1ZN2A 2E1NA 3FM3A 1IXRC 1B1BA 2FMYA 3IKTA 2MLGA 2XUBA 5AONA 4BHCA 2RV8A 3RJPA 3GF2A 1FY7A 2KRFA 3T8TA 4ZZDA 2NYXA 1W7PA 3V7CA 1HSJA 2KIFA 3TDUC 1WI9A 3F72A 2PBIA 4M74A 2VOOA 1I6XA 5K1YA 4ZZLA 4LLGF 3MQ0A 3WGHA 2ZMEB 1ZGAA 1I5ZA 4RGXA 1IRGA 1WKMA 4ENMA 1YW8A 1B4AA 2XROA 2WV0A 1E17A 2KJCA 2K4JA 1GHCA 4HAMA 2J5PA 5HDKA 2PFBA 3O2PE 3MEXA 4UHTA 1D3YA 4HF0A 1BJAA 3FX3A 1FLIA 3LFKA 3FXRA 3WE2A 1KYWA 3GFJA 5F64A 1H9TA 4KN4X 2JSCA 1LQ1A 3EDPA 2STWA 3K69A 4NQWA 3F23A 4RGSA 1JHFA 1IF1A 2PEXA 4G94A 5E1WA 3QU6A 3WTXC 2DU9A 1RNLA 5JVTA 4CDGA 1PUEE 4OIPF 2DO7A 2HR3A 4LG0B 4ON0A 4EV0A 2VT3A 1BI2A 2O8XA 2GIVA 3QPTA 1ZRFA 3W6KB 2P7CB 4MGRA 3HTUA 1MJ9A 1PP7U 4ZYEA 3MAJA 2VC0A 4BH9A 2FEZA 4G6DA 3G73A 4ETSA 3DQVC 3GEZA 2WC2A 1B59A 1R1VA 2ZCWA 1U78A 1MJBA 4M9ZA 5IT3A 1QPMA 3KP7A 2V9VA 2ZO4A 2ZJ2A 2LNBA 2P5KA 4LG0A 5K5OA 2VBZA 3GO5A 3G3ZA 3WODF 2CFXA 2GXBA 3KCCA 1OMIA 4UV9A 5KK1A 2XAGA 3WGGA 1BC8C 4XSXF 2OAZA 2MA3A 3F3XA 4FX0A 3ERED 2KIUA 4HOBA 3M7GA 3ZN1A 1J75A 2QVOA 3F6OA 4PZJA 5A2QZ 1YW9A 1KQ9A 2HEOA 1F1ZA 3BPVA 3KP3A 1J59A 3IWFA 2ESHA 2ZNYA 4PGGA 1IN8A 3MZYA 1G3YA 2PG4A 2LKPA 4UUVA 3CDHA 2A6EF 5AIPA 1G3WA 4HX8A 2EA2A 3I5UA 2IPQX 1K79A 3WTWC 5BOXA 1HSTA 1VTNC 2VODA 3HYIA 1QZZA 4YFXF 2V1DA 1E2XA 3L2CA 1R1UA 1WQ2A 1OYIA 3SZTA 1XMAA 3K1NA 2EFQA 3R60A 2G7HA 5DD4A 1O3TA 3M8EA 1TQMA 1MDMA 3WTSC 1F5TA 4RAYA 4WXCA 1C0WA 4I2OA 2LF8A 1X3UA 3NRVA 1O3QA 4RGRA 2QLZA 4HBLA 4UVAA 4NB5A 1ZG5A 1G3TA 4LB6B 4IF4A 4TV7A 1FYLA 1XDUA 2GZWA 2NRAC 2FOKA 2H27A 4HV5A 1QNTA 2HKXA 2K4BA 1LDDA 2QQAA 2IP2A 4LJZF 3KP2A 5HLIA 1R00A 4WXHA 4A5NA 1LEAA 1HQCA 4A0YA 1AWCA 4HX7A 2VONA 3SQNA 3JTGA 4CXFA 3BPXA 4HV6A 2FRHA 2OQGA 5D4SA 2PMHA 1HKTA 1V4RA 4HDVA 4ESJA 1SAXA 3P9IA 1ZLKA 4BQAA 5J8FA 2W25A 5JHUA 3RKXA 4HA8A 4CO8A 5LEKA 4KNYA 3FWEA 1O7LA 3HIFA 2IT0A 4MEYF 2O61A 3J81K 4Y17A 4UV8A 2OZ6A 1SD6A 1G4DA 4HLXA 2RKHA 2H6BA 3KZYA 2FMLA 3QU3A 2K02A 3GX4X 3DPLC 4O5VA 4AWXB 5DEQA 5ED4A 2V1XA 3M1EA 2P8TA 3WTVC 3RPQA 4OIRF 2F2EA 2F5CA 2CO5A 1ZAOA 2EWNA 4ENNA 2DLLA 3L7WA 4BYYA 2P6SA 3V7SA 1TW3A 4XSZF 2HYFA 5KVRA 1U5TA 2EFNA 4HYEA 3QP5A 5HVQC 4G7OF 1GXPA 2D2WA 4ZYHA 1BOAA 2EFPA 2E7WA 3VEPA 3TKYA 2NNYA 3BWGA 1EH8A 4D0PA 2FBHA 3RTRA 4OMZA 4PDKA 1B6AA 1JE8A 2QQ9A 1OKRA 2EV0A 4L9TA 2COMA 4AIJA 5BQTA 3P7NA 2D1HA 4FT8A 2PN6A 3GUDA 1HBXG 3ABUA 1QO0D 4EMSA 4MQVA 4AVPA 4KUMA 3V8KA 4G6QA 2RVCA 1JHHA 1HKQA 1Y0UA 3R0JA 3LA3A 4U7BA 3LQRA 2IRFG 2F5FA 1YW7A 1YFHA 1UFMA 2FBKA 2L4MA 1IN4A 1WSUA 2QM3A 5D8KB 1W5SA 3I4PA 4O3MA 3RKYA 1ZYRF 2DBBA 3F21A 4IRGA 2JRTA 2WWYA 1KQ0A 3CTAA 4YG2F 1SFEA 1TQIA 2ZFWA 1D5VA 3LSTA 4I7HA 3J80K 2ESNA 6PAXA 2A68F 4KIBA 3FMQA 1Z7UA 2HS5A 2P5VA 4GGGA 1KU2A 3E5UA 2MBFA 4KMUX 4UXNA 3IL2A 3ZMZA 4RGUA 4WXDA 1XN7A 1IN6A 5FGMA 3SZPA 3TGNA 2GWRA 1T2KA 4U0WA 1ZHFA 1P4WA 1LNWA 1YLFA 2D45A 2EJRA 3I58A 4BXUA 2HQNA 4CICA 1USTA 2KIMA 3CUQB 4YIIA 2DW4A 4E70A 4AIKA 1W4MA 2GQQA 1KU9A 2AXLA 1XGNA 4OU0A 3KP4A 1QQIA 2Q2EA 4CHUA 4ENKA 2OU2A 2VBYA 1FYKA 3L9FA 2K27A 2Y0MA 3H92A 1XGMA 2M45A 1SMTA 2CG4A 2GA2A 5DYMA 3CUQA 1LJ9A 2L02A 1T98A 4R8HA 1T0FA 4FHTA 1KYZA 4A6EA 5E17F 3RYRA 3HRMA 2M30A 3TOBA 1K7AA 2XV4S 1BC7C 1O3SA 3GWZA 5LRRA 4IRHA 3GZ6A 3K2ZA 1I1GA 5H20A 4R1HA 4GCVA 1IN5A 2G7UA 2YX4A 4P9UA 5E1ZB 4LLLA 4L5IA 1FP2A 1S7AA 2A61A 5L3DA 5LGNA 3ECHA 4L0YB 4LGWA 3CO7C 1HXDA 2HWVA 4WF2A 4EM0B 4H0EA 2F5EA 3U1DA 1IZ1A 4KFCA 2XAJA 3B02A 1EH6A 1QBJA 2HZTA 1ODDA 2PJPA 1T38A 3GFIA 1UHMA 3WU0A 4UNOA 1FWZA 2XAHA 3ZMSA 3EYYA 1SMYF 4NHJA 4OINF 4IPAA 2OBPA 2VT2A 2EB7A 4L9VA 2QENA 1B9MA 4YIFA 2EV5A 1XB4A 3RI4A 5DCMB 2IW5A 5L3EA 1O3RA 2JTVA 1Z9CA 2QZ8A 3BJ6A 1XMKA 4WX9A 2PLYA 2OD5A 3HSRA 2QBYA 4O6JA 3IHUA 2NNNA 2GXGA 1AOYA 5BS6A 3BP8A 3KP5A 1D8KA 2Y75A 1MGTA 4U0YA 2CQKA 5DUIA 4EJOA 5DCMA 3TO6A 1HW1A 3H3UA 3JAMK 2Z3YA 5HDNA 2HFHA 1W7PD 3QPHA 1R7JA 1CF7A 4JQFA 2BE5F 3B73A 3U2RA 3W6JB 2UZKA 2DTRA 5DV5A 3T8RA 3H3ZA 1ZARA 1KA8A 3I64A 3ZMUA 3KEOA 3ROUA 2Q0OA 2XVCA 1MD0A 2E7XA 4LMYA 1WWXA 3MFKA 3KP6A 3I0TA 4B09A 3HSFA 4KA4A 2HDCA 3V8JA 2A69F 1LDKB 1DPUA 3T1BA 2TDXA 1SD4A 4L9NA 3CUQC 3PQKA 2JPCA 5TRDA 2V1UA 1FSEA 1HKSA 3JSOA 3BOQA 2RC4A 3F6VA 1MDMB 4RB2C 1CGPA 2UXXA 3WTUC 5CVIA 5DDGA 5FD5A 2LF7A 4EJVA 2OZUA 2FQ3A 3VFZA 4EGZA 4EGYA 5ICEA 1TQPA 4EM1A 5AIQA 2VE9A 3ZQ7A 5TJJA 2H6CA 5ILVA 2HYGD 5E18F 3FMSA 1H9GA 5IT9K 3I53A 3WTYC 1R22A 1USSA 3M8FA 2CWEA 4L5JA 4MTEA 3QP6A 3J7AO 3E6BA 2VN2A 3O6BB 3IRRA 4GYIA 1RUNA 2BYVE 3F8NA 4KIGA 2XKOA 5CVJA 1YTYA 4WK8F 3DXJF 3FM5A 1QGPA 1BI3A 1YS6A 4MNUA 5JI6A 1T39A 3E97A 2JT1A 3M9AA 4M9SA 2BV6A 3FF5A 5ILSA 5L3FA 3CO6C 5BPIA 4YFKF 3QAHA 5K5QA 1F9NA 1IUYA 2FA5A 2DFIA 5LGTA 3KETA 2Z9OA 1UHWA 3I59A 5CVVA 4ZH4F 2FE3A 5CVRA 5LHGA 4IHTA 5E20A 5ILUA 3IKVA 2CSOA 5L3GA 1P2FA 3LWFA 1XSXA 4I01A 4A0XA 1SD7A 4LFUA 3FHZA 2M1BA 1IW7F 5E1XA 1F4KA 3RYPA 2HTJA 3OOPA 5HS7A 4A5MA 4EQQA 1FBSA 1U5TB 4MTDA 3V8LA 1FYMA 2L3DA 2AS5F 4HX4A 3HSEA 2B0LA 1KQ8A 3GVAA 4BHPA 2DT5A 2EA4A 1IN7A 2UWMA 4N9HA 1STZA 1J0RA 4LK0F 5D5UB 4IXAA 4PGHA 3JW4A 2DQLA 1WRJA 4RS8A 1J2XA 2O0YA 3HOSA 4JK1X 5FLXK 5HS9A 1OYYA 5EEGA 1RI7A 3ZP5A 1BN5A 1LB2A 1Z6TA 3KFWX 1ZG3A 4EJUA 3PFIA 3ZPLA 4EJWA 4RAZA 4G9YA 2M5WA 2LSOA 1H0MA 1XGSA 2M8EA 2V6CA 5HOOA 2ADUA 4I02A 2YX7A 4HLYA 2CW0F 4LB5A 2ZXJA 2R7FA 2Y48A 4XBFA 1BIAA 4I09A 4MEXF 5IT9Z 3FMRA 2JZYA 5CYVA 4U0VA 1FBUA 1LDJA 1ZG1A 2VBWA 4EJTA 3O3KA 5FFXA 4BNCA 4OOIA 3F8FA 3ECOA 5J6XA 2ETHA 2X0LA 2DQRA 3L09A 4M71A 4L0ZB 4A12A 4XLNF 1V3FA 4M73A 2PMUA 1LVAA 4I0BA 5E8GA 1QZYA 4P9FA 3BY6A 1ON1A 3N4MA 2OQRA 4HZFA 2DK8A 1FPQA 1J9IA 3E5XA 3LA2A 5EEHA 2MH2A 1DDNA 5E8IA 4ZYGA 2NS0A 5ICCA 1SFXA 4IJAA 1G6NA 4GYGA 4P96A 1HW2A 2ELHA 3J81Z 4B8XA 3GW2A 2ACJA 1XD7A 4Y13A 3CJNA 3V4GA
chains in the Genus database with same CATH superfamily
2R7XA 3LOCA 4Y15A 1T56A 1U6GA 4BE1A 4OMYA 3OR1C 2HPMA 3EUAA 3OSFA 3TDZC 1S29A 3QRFF 2Z1DA 2WBMA 3H35A 3ZMTA 2Z5UA 2D1VA 2NOGA 1V5EA 2DOEA 2X1EA 2R7WA 3EUHA 4H4KC 4A0ZA 2GA1A 5A2QK 4A69C 1GXQA 5F0FA 1JGSA 1JTXA 1I3AA 3NAUA 4I99C 3TW6A 3ZCOA 2DA6A 3PNVA 1FT9A 2RQQA 3JSPA 4HF2A 1GUUA 3KE2A 3TL4X 3DLAA 5DD8A 3SEQA 2HQ5A 3U9GA 2C6YA 2XKPA 2FNPA 1N25A 3N97A 2HOEA 2EV6A 4Y4RA 5HS8A 1JT6A 3SDBA 2K5CA 2XB5A 4W1UA 2BZTA 1QVUA 2J5OA 3JTHA 1MH3A 5J3LA 2IJLA 2K9NA 5HNFA 3KLOA 1I6HJ 1U5TC 5CJ9A 4XICA 2W57A 4MHGA 2F48A 3ZXSA 4XRFA 4QPQA 1GDTA 1SVLA 2Z33A 4XLCA 4UUSB 4AU7A 1KZHA 3LA7A 3V7RA 2ISYA 4KISA 4F91B 1A04A 3E0JB 5HODA 5HDGA 4C3HJ 4CA0A 1DP7P 2VC1A 1ZRCA 2DMUA 2PMZN 2IA2A 3HRTA 5HLGA 3HRUA 4C2UA 2R7TA 4BXFA 3T5XA 2L7MP 4RAGA 4G8XA 3I56I 3E6CC 5JLWA 2F5DA 2L4AA 2W1OA 2QWWA 3CLOA 1WI3A 2DMNA 3D5LA 2Q1ZB 4Z2YA 5FLXZ 3S17J 4YFNF 1IV6A 4Y52J 3NEUA 5FB2A 3IC7A 3ULQB 2WA0A 1R6RA 2FD5A 2H8WA 2STTA 4XN0A 5BNGA 1B72B 2IA1A 2NAZA 3V42A 5M3FJ 2Z99A 4R79A 4UUSA 1H89C 4RA2A 2V7FA 1EH7A 2MFZA 5D6FA 1TWFJ 2F4OB 2WAQN 2ZNZA 3HHGA 3WG7H 1W5TA 4IQ4A 3G1OA 4BAYA 4CCLA 1WH5A 2CUZA 2LYCA 4ASNA 3FBIB 3U1KA 3PFYA 3D5SC 1I1SA 3SHFA 3BR5A 3ZR8X 3BCBA 4A6DA 4GXOA 1FSHA 1IC8A 1VQ5I 4XNFA 1Z3YA 3G2BA 3R4KA 3G4SI 4PFOA 2A6HF 2V79A 3WE3A 4DBRA 1P4AA 2P0WA 3QOEA 2EFOA 2K3FA 2OJED 1MKMA 3Q9VA 3HOZJ 2ZMEA 1B72A 3HOTA 4LG3A 2MH9A 1IRFA 4UVCA 4AD9A 3W2WA 3K1MA 4QLCU 2CW8A 3UR3C 3D5RC 1MBJA 3VB2A 1X2MA 2CMPA 2X6WA 2QBYB 1K6OA 3E6MA 1HDDC 2ZBKA 3F8BA 1YS7A 4XKWA 2E1CA 1S8NA 2WTEA 1SFUA 2BBYA 3SJMA 2O3FA 2EIMH 3KZZA 2VJIA 3CDLA 4G7HF 1XC5A 2O5RA 2KFDA 3G1MA 3VYSB 1A6IA 3C1DA 1UCRA 3WG9A 4DZJA 1WJBA 3C7JA 3CQZJ 1OPCA 3KX2A 3VODA 4N0BA 1K83J 4PUSA 2GLOA 1JJ6C 1IXCA 2P81A 4M6XA 5FJ8J 2ME6A 2VJJA 4I98B 2FXAA 4XKCA 5JVGF 2LD5A 5E3NA 2VE8A 3KPHA 1A6QA 1JXSA 2DAOA 3H0DA 2EZLA 1XCBA 4HSTA 3J80Z 3ZGKA 5FD6A 1BBYA 2RREA 2R7VA 1R49A 1TNSA 3VWBA 1CF7B 2XAFA 2W24A 1ZRDA 5FKNA 2BHYA 2JA7J 2A3SA 4HNVA 1JKRC 2M0CA 3FXOA 1B9NA 1MZBA 4RB0A 4PK4A 1P92A 2WB1N 2XSJC 2EINH 2Y2ZA 1XSDA 4GFBA 2OTJI 1TBXA 2XIGA 2IS6A 3E6DA 1LE8B 1LVKA 3ASOH 4GO1A 3PNYA 3WTZA 4A2UA 5FO5A 1BI1A 3K4LA 5EEAA 3LAPA 3S3MA 3MZ8A 3GLLA 1PJRA 3W3CA 2HGCA 1KU7A 2A07F 2XASA 3H1CA 5L3CA 1RZ4A 2XGXA 3NWTA 1WVRA 3HUGA 2XHKA 1T6SA 2IVMA 4CCJA 3DTKA 1WCMJ 1D8JA 5GAEJ 1AA7A 3CCUI 2E34A 5J8CA 1TTYA 3JRAA 5LGUA 1BW6A 4M3FA 3SEZA 3FZVA 3GLXA 3HG9A 3HHHA 5TGTA 4FTHA 2R92J 3EUHC 1Z77A 2G9WA 2IGKA 1LE8A 3CCQI 2W84A 1ZLJA 3DEUA 1S5LC 1Z21A 4LK1F 3GFMA 4A3KJ 4IRIA 1R23A 5LHIA 1GVJA 1DUXC 3DKWA 4ZYAA 3TO9A 2VXZA 3ELKA 3H5AA 4DW6A 3DTIA 3CMEI 3OV8A 2HDWA 4EEFG 5HLHA 4IOCF 2FOWA 5CVUA 3DF8A 1I27A 2B7EA 3F22A 1OR7A 2M9HA 4I0AA 4OIOF 1YJWI 3F8MA 3M07A 2HKOA 3EUKL 2DMTA 4P1WA 4U7DA 1YQAA 3OIPA 4E7SA 3L2UA 1A35A 1Z6RA 3K9TA 2FSWA 4IX7A 2O8KA 3GFLA 3IRQA 2BEOA 1XDSA 3WTTC 2P6TA 4F3QA 1TLHB 1MNMC 3EQLF 1REPC 1IAWA 4KMFA 3VDXA 4BJTA 3TO7A 1UELB 2E5ZA 4ZTJA 2O6GE 4HQMA 3IWZA 4RB1A 1VQNI 4N9IA 4WCGA 1L3LA 3E3VA 1XX5A 4ESFA 4RB3C 1ETWA 1RIOH 1R1TA 2E19A 3GTMJ 4M6YA 3OYIA 4Q47A 3PIPF 2FQ4A 3GZ5A 3JCUC 2K3PA 1ZGJA 3FXUA 2UXNA 4HSRA 1Z1DA 4XOTA 4KYWA 2R7OA 4JP0A 3CUOA 1YIOA 2GM4A 3TMOA 3HZJA 3OY9A 4E4HA 1Z91A 2YU3A 4F7ZA 4Q4ZF 5DUKA 3K1PA 1YI2I 1ON2A 1XMXA 3MWMA 1FEXA 1MNDA 1TZLA 4ENJA 3M1CA 5DCFA 4E7HA 3S16J 2EZHA 3O8HA 2KQRA 1D1AA 3WGIA 5ICGA 3UNGC 2K86A 3C18A 4A3FJ 1P9QC 4MQ9F 3Q0WA 3AG1H 3GCMA 2LMDA 4E7ZA 4B43A 3K70D 2W85A 3GYHX 1OFCX 1X3WB 4JOMA 3ONQA 2JRMA 2QQBA 1FIPA 2EIJH 5LLQA 4C2MJ 1UB9A 3CJTB 3NQOA 1SEUA 1XCVA 2EK5A 3CP2A 2R5ZB 3I59B 3RDIA 2DDAA 2CV1A 1KU3A 2RQPA 2VASA 1YRNB 1U9NA 2W48A 3SXYA 1SC7A 4XONA 4IOAF 3T0YA 2MD5A 5IYCJ 1P6RA 2KP6A 2HDDA 2IXSA 1S6LA 2P4WA 1TW2A 1K78B 4Y33A 2VBXA 1PUFA 4S0HB 1BI0A 1J7KA 2FBIA 3FISA 4AIHA 3Q5FA 2VQLA 5LHHA 2DN0A 5E3LA 2OCCH 4BHBA 4HDUA 3MZHA 3QOPA 2HOSA 1IV8A 1ZREA 1UMQA 2HXIA 2LKSA 2H1LA 4PJLA 4KICA 4RM2A 2FU4A 5D5WB 4D1QA 3F8CA 4S04A 2R5ZA 3ML6A 2M7BA 2XRNA 5CPRB 2CQXA 3EYIA 3WU1B 3BCAA 1YRNA 4P5OA 5BMZA 5LBQA 3KLNA 4B44A 4HPQA 1HA8A 4V19K 1FP1D 4D5FA 4A3BJ 3LAJA 4LOCA 4HNUA 4BDYA 1K78A 3TQNA 5LRSA 2V4JC 2K9MA 2NXNB 3RKWA 3M8JA 4CGZA 2IGMA 5D4RA 4KJZA 1Z05A 4ZYDA 1LEBA 3ISPA 5M5YJ 1MBEA 3HKZA 5H2FC 4K2EA 2DPUA 1YYVA 3PQJA 3DV8A 3TBIA 1NHAA 4UUTA 4DNCA 5D8LB 1L0OC 3OYHA 1YJ9I 4M9XA 3G6EI 5K5RA 1I39A 1U2WA 2R3SA 2RGVA 4KIFA 1U8RA 2LY9A 2K85A 4MFDA 1AU7A 2XSDC 1QHGA 4S05A 3RPUA 3JAMZ 2JA8J 1WHUA 2XF7A 2RAEA 3AG2H 4KN7X 1ETOA 5ERIA 4L9JA 3L1PA 3GXOA 2L9SA 4QWQA 1PDNC 2LK2A 2VLAA 4CZZA 3D0SA 3PNTA 1GT0C 2Q8KA 3E5QA 1E0EA 3R0AA 1BR1A 4WWCA 3MKYB 1RKWA 2AQFA 1R58A 3AAFA 4LD5A 4CYCB 2BOLA 2K9SA 1HW5A 1MJAA 2ZSIB 2HU9A 4IVNA 4EVIA 3HTSB 1TWCJ 2HNHA 4YRVA 4HW0A 3LFUA 4UVBA 3DWLE 2A5YB 3CCEI 1BIBA 1BM9A 4U88A 1W0UA 2X4HA 1RKTA 1YG2A 2X1CA 3ZMDA 2R93J 2RDPA 1FNNA 2RN7A 3MCZA 1OR7C 4KT5C 1OCCH 2E1OA 1P4XA 2JJ7A 5D6EA 4J19A 3IH3A 4XRSG 3CCLI 2K9LA 2KKOA 4IHXA 4KDPA 4BQOA 5J4VA 4OIQF 1YO5C 2VQCA 1R5HA 2R4GA 4M3BA 5D5VB 4LLNA 3HJEA 2OA4A 1IXSB 2GIZA 3P9KA 4EM2A 1Q1HA 5E79C 1SFOJ 3ZQCA 1T8IA 1FBQA 3HRSA 2ME0A 1JUSA 2LP0A 3OYMA 3OYKA 1S3JA 3ABTA 3BJOA 4HF1A 3BZ6A 3DFGA 2EFWA 2VL8A 1R36A 1SD5A 1K4SA 2H94A 3DU6A 2QUFA 1ACIA 1KGSA 1EV7A 4UB8C 1X3ZB 5H6RA 1OCRH 3L00A 2PI0A 4XL9A 3ZN0A 2VI6A 3I54A 3I55I 5J1UA 2YUSA 1ZGWA 4YELA 5IP7J 2M87A 2YSRA 1O7FA 1V5FA 1RRJA 4HQEA 1ETKA 4E6KG 1X1BA 5F0CA 4CZCA 2E2IJ 3CC2I 3H5RA 3OOUA 2KISA 2MC3A 3OYNA 1XG1A 4XLPF 3QYEA 2LY1A 3J7YJ 1FZPB 2FF4A 1TNTA 5FLMJ 3VYTB 2NS8A 3K6GA 3BROA 3I71A 1U3EM 4Q48A 2R7DA 2HPIA 1O57A 5H6QA 3FBNB 3WU2C 5BPDA 1S7OA 3QYBA 5JLXA 4QTRA 2ISZA 1U8BA 4Q5SF 4ZDPA 2YR2A 2KDOA 5GPCA 3HBLA 4CCNA 4CYDA 2E60A 3Q9SA 1DU0A 1IRXA 4IHYA 3SFZA 5LEJA 2IA0A 2VOPA 3EETA 4ZTFA 2YPRA 1IUFA 1FX7A 3R6SA 1JUPA 4C30A 3K4CA 2GXAA 1DPRA 1WPKA 3REOA 2ZKZA 3C3WA 4B1RA 3KYDB 2DA4A 1ZH5A 1ERDA 5B3SH 3IV5A 2CQQA 2H09A 3DU5A 4BJ5C 1MW7A 2BY0A 4XKVA 4DYCA 4JBAA 5L3BA 3S2WA 4V2FA 3OYCA 3FXQA 1G3SA 2CYYA 1HLVA 3D1NI 2DI3A 2M34A 2PQ8A 4B3AA 1RUOA 2P7VB 2LTPA 2HTSA 3DPTA 1RR8C 3ZQFA 4KITB 2LRDA 3KEQA 2M2EA 4ZC3A 1N75A 2O03A 3AG3H 4RBOA 4DQ2A 2XGCA 3OL3A 4G7ZF 2P5LC 4ESBA 5CLSA 2K7LA 2GAUA 1R5GA 2CGPA 1FOKA 5FFZA 4FX4A 1ULYA 2M8GX 3MD2A 2KZGA 4Y7NJ 5JR3A 3BDDA 2KJBA 5DTDA 1TP4A 3HM5A 1PP8F 4GDFA 3BJAA 3R61A 5F6FA 3TOAA 4JX5A 3SZGA 1XSVA 1MH4A 3H5NA 2L01A 1RETA 2AO9A 1Y39A 3FDYA 3CCRI 1N77A 2L7ZA 1J5YA 2RNJA 1K61A 2JPBA 2LDUA 2L2OA 3DP7A 4M72A 4BQQA 1FC3A 1XGOA 5ICFA 1H88C 3BTIA 2ICWG 2L54A 5F1RA 5GTIC 4L18B 2DK5A 2FNAA 3A1YA 1T95A 3C2GA 3WHBA 2QYOA 3BR2A 1LFUP 2DYSH 1ONVA 2HQRA 1JKOC 3BTJA 3LQQA 3COAC 3ABMH 2BGCA 3J7AY 2BY2A 4AM3A 1EKEA 1OYWA 2CS3A 2LC2A 5JFRA 3W2AA 2DMQA 3K0LA 4P55A 3ZMVA 2EZKA 3P9CA 1MBKA 2V26A 4PCQA 1W7PB 2CQNA 2DPDA 5D5XB 2XAQA 3VOEA 3WHCA 3C2BA 4BE2A 2JUCA 2MLKA 4FQGA 3PUFA 3HDDA 3RKQA 3E7LA 2R5YB 3RIRA 2PJRB 1OJLA 1ZN2A 4MLOA 2E1NA 3FM3A 1IXRC 3GTLJ 2OC6A 3QQAA 1B1BA 2FMYA 3IKTA 3HOXJ 2MLGA 2XUBA 2LBFB 4OAYA 2G0EA 1JJ8C 5AONA 4F92B 2WY8Q 4BHCA 2RV8A 3RJPA 3GF2A 1S9HA 1FY7A 3FXKA 2KRFA 3BQYA 3T8TA 3VYUB 4XK4A 4ZZDA 3CD6I 2I8DA 2NYXA 1W7PA 3V7CA 1HSJA 1Z7LA 2KIFA 9ANTA 3TDUC 3VSLA 4D7MA 1WI9A 4M6VA 2CUEA 2B63J 3F72A 2R7SA 4B4CA 2PBIA 4M74A 2R5YA 2VOOA 1I6XA 2KL4A 5K1YA 2PJRA 3ABKH 3F0CA 4ZZLA 3BG7A 2X85A 4LLGF 4X1EA 3RSNA 3MQ0A 3WGHA 2R7ZJ 2ZMEB 3OSGA 1ZGAA 1I5ZA 4RGXA 3BZCA 2MD0A 1IRGA 1WKMA 2FUG2 4B3XA 1YW8A 4ENMA 3IH2A 1D5YA 2E1MB 2LBFA 3OL4A 2KPMA 4Z6YA 1B4AA 3K4MA 2XROA 2WV0A 1E17A 2BXYA 3CF5F 2KJCA 3TEDA 2K4JA 3H36A 1WJDA 2VXDA 3BG9A 2NVUB 4NQWB 1GHCA 4HAMA 2J5PA 5HDKA 2PFBA 3PJRA 2NS7A 3LSGA 1V5GA 3O2PE 3MEXA 4V2GA 4UHTA 4LIVA 2QCOA 1D3YA 4HF0A 1BJAA 3Q0UA 3OYAA 3FX3A 1YITI 1FLIA 3K2AA 3LFKA 4AYBA 3FXRA 2L5QA 3S1QJ 1UZCA 3WE2A 4RLQA 3HL2A 1KYWA 3GFJA 5F64A 1H9TA 3FK6A 4ABZA 4KN4X 2JSCA 1FOYA 2HYJA 1LQ1A 3BG6A 3MKWB 4MIMA 4RDUA 3EDPA 2STWA 1RC9A 3K69A 4NQWA 3F23A 4RGSA 1JHFA 3PSIA 4CUGA 1IF1A 4A93J 2DJNA 3HEFA 4L5EA 2PEXA 4RM3A 4G94A 5E1WA 1X4OA 3ABLH 3QU6A 5KNLA 2QKLB 3WTXC 3DTEA 2XRLA 3BT9A 2DU9A 1RNLA 5JVTA 4CDGA 3BTLA 2CH0A 3GZNB 2JUGA 3FKJA 4DOZA 2DTZA 1PUEE 4RAFA 1IRZA 2OTLI 5EGOB 4Y3OA 1V55H 4BUPA 1VQLI 2K40A 3HUGB 4OIPF 2DO7A 2HR3A 4LG0B 3HPHA 4ON0A 4EV0A 3FXJA 1Y8RB 5FKMA 2VKDA 2VT3A 3CJRB 1BI2A 2BVLA 5C44J 2O8XA 2GIVA 4E7JA 2TRTA 3QPTA 1ZRFA 2AHQA 3K4JA 3W6KB 2FX0A 3AFHA 4QSHA 4UY8I 4CCOA 2P7CB 2ELJA 3BR6A 4B47A 4MGRA 3HTUA 1MJ9A 2HI3A 1PP7U 4ZYEA 2EPFA 3MAJA 2VC0A 4BH9A 3OYEA 2FEZA 4G6DA 3G73A 1VQ7I 3SDGA 4BS9A 3DQVC 4ETSA 3GEZA 3OYJA 2WC2A 1B59A 4DIQA 1R1VA 2ZCWA 3OIOA 1U78A 1MJBA 3K7AJ 4M9ZA 5IT3A 3LSIA 1QPMA 3KP7A 2V9VA 5EGOA 2Z16A 2ZO4A 2JA2A 2IGOA 2ZJ2A 5GADJ 2LNBA 2ECCA 2P5KA 4LG0A 2EH3A 5K5OA 2VBZA 3GO5A 2IBDA 5F08A 1YIJI 3G3ZA 1WJEA 3WODF 2CFXA 2GXBA 3DBRB 3ESWB 3KCCA 1OMIA 1X1DA 4UV9A 5KK1A 2XAGA 1JUMA 1IG7A 2K9QA 1DGWY 1DQUA 2XPVA 5F04A 3WGGA 4C9YA 1BC8C 4XSXF 3Q0VA 2OAZA 2KLOA 1HC8A 2R0QC 1O4XA 2MA3A 2IEKA 4FISA 2DXIA 3F3XA 1V54H 5B1AH 4I6ZA 1R5ID 4FX0A 3ERED 1I50J 3I9V2 1QRYA 5CQGA 2KIUA 5J47A 4XQFA 4HOBA 3M7GA 3GTGJ 3ZN1A 1J75A 2QVOA 2OCEA 3F6OA 3DCFA 4PZJA 5A2QZ 3BR0A 5FRMA 1YW9A 1KQ9A 2HEOA 4NC8A 1F1ZA 3BPVA 3QWLA 3KP3A 1J59A 3IWFA 2ESHA 2ZNYA 4PGGA 4OAZA 3JR9A 2JWTA 2X6XA 1IN8A 3CZ6A 3PIOF 1A31A 3H3VK 2L9VA 4W97A 2XDVA 4A3EJ 1WGXA 2DT6A 3MZYA 1G3YA 2NOJB 4F93B 2HVRA 2PG4A 2LKPA 4UUVA 3S1NJ 3CDHA 1WZ2A 2A6EF 3HB9A 4XLHA 1OCPA 5AIPA 2ZJRF 1D1BA 3HKZN 3CMYA 3LSPA 1XTAA 2L7KA 1GLNA 1G3WA 4HX8A 2A6TA 2MABA 4BY7J 2DA5A 4ZJZA 2EA2A 1TL8A 3I5UA 2IPQX 1K79A 3WTWC 5BOXA 5E3MA 1HSTA 1VTNC 2VODA 3HYIA 1QZZA 3FKIJ 1SANA 2DCEA 4YFXF 3HOUJ 4ZDOA 2V1DA 3S2HJ 1E2XA 1F36A 3L2CA 4BBSJ 3MVPA 3B6AA 3CMAI 2W00A 5IP6A 3BR3A 4FETA 1R1UA 2V9KA 1A36A 1ETVA 1WQ2A 2CW7A 1X1CA 2DFFA 1WJAA 2ZXHA 1OYIA 3SZTA 2LFBA 1FOWA 1VQ8I 4PJJA 1XMAA 2GOXB 3GBGA 1PUFB 3K1NA 1VZ0A 4KT6A 1LPQA 2EFQA 3R60A 4IQJA 2VKHA 2G7HA 5DD4A 1O3TA 1PYVA 3SFIA 3M8EA 1NK2P 1TQMA 1MDMA 3AL0B 2L9RA 1J09A 2KHMA 2WV1A 3WTSC 2ZMEC 1MMGA 1F5TA 3CC4I 1P7JA 4RAYA 2X1DA 1UG2A 3LSMA 4A3CJ 1JT0A 1WJ5A 4WXCA 1MNEA 3BC8A 1K6YA 2W82A 2E1MC 4XLFA 4BDZA 1C0WA 2O9LA 2LF8A 4I2OA 1X3UA 4CCKA 5K7HA 3NRVA 1O3QA 2E2HJ 4RGRA 2QLZA 3HXLA 5IOYA 1MSFC 4HBLA 2DJIA 3S8PA 4UVAA 4LIUA 4NB5A 1ZG5A 1G3TA 4LB6B 5KHDA 2DOAA 4IF4A 4EATA 2FJ1A 2HVQA 4TV7A 5EJCA 3G1LA 1QHHD 4A3GJ 5IPAA 1FYLA 1XDUA 2GZWA 2NRAC 3S1MJ 2FOKA 2H27A 4BJ6C 4HV5A 1WH7A 3OS0A 1YOVB 1QNTA 2Y0SA 2HKXA 2K4BA 1IJWC 1LDDA 4BY1J 1GV5A 2IP2A 2QQAA 3CCMI 2JMWA 1VQ6I 1SVMA 4DYRA 4LJZF 3KP2A 5GAGJ 5HLIA 1R00A 4WXHA 5HLTA 4A5NA 1LEAA 1HQCA 4A0YA 3JRBA 1AWCA 4HX7A 2VONA 3SQNA 3JTGA 3VYRB 4CXFA 3BPXA 4HV6A 2FRHA 2OQGA 1MMAA 2X6YA 4XKBA 2PMHA 5D4SA 3KYLA 1HKTA 2BHZA 1V4RA 4HDVA 4ESJA 2ZJPF 1U0JA 1GVDA 1ZKGA 3P9IA 1SAXA 1ZLKA 2UV1A 3LMMA 3OIQA 4BQAA 1ZQ3P 5J8FA 2W25A 5JHUA 1MMSA 3RKXA 4J00A 4HA8A 4DJAA 1MSEC 4CO8A 5LEKA 4KNYA 3ZOBA 1OISA 3FWEA 1O7LA 3HIFA 3OWTA 2IT0A 2DFHA 3GTJJ 4MEYF 1FJLA 3I3LA 4D7NA 2O61A 1RR7A 1MBGA 3J81K 3CCJI 2MG4A 5JHFA 4Y17A 1ETQA 2IS2A 1TT5B 2L0KA 4BU2A 3JRCA 1VQ4I 4UV8A 2D5VA 2OZ6A 2MYSA 1SD6A 1G4DA 4HLXA 2RKHA 2H6BA 3KZYA 2FMLA 3QU3A 1W36C 5IOZA 2K02A 3GX4X 3DPLC 3IP4B 3GTOJ 2L7FP 4O5VA 1DGRM 5J1RA 2XGDA 4FCYA 4AWXB 1D1CA 1ETXA 5DEQA 1W0TA 2DA2A 2O7OA 1KONA 5IP9J 5HNHA 5ED4A 2CU7A 2DOFA 3CDIA 4IEJA 2V1XA 3M1EA 3L2WA 3GTPJ 2P8TA 2BXZA 5F1JA 1YX3A 1LFBA 1QVTA 3WTVC 4PSXA 3I4NJ 3RPQA 2DA3A 4OIRF 2F2EA 2F5CA 2CO5A 5EF6A 3I4MJ 2Y69H 1ZAOA 5B5EC 1S72I 4AVZA 2EWNA 3FK7A 4ENNA 2DLLA 3HGGA 2JVGA 4BKXA 2XPUA 1HCRA 2W7NA 4M3EA 2IGNA 3L7WA 4PSWA 2XF6A 2P6SA 3V7SA 4BYYA 1TW3A 4XSZF 2HYFA 4IHVA 5KVRA 1U5TA 2EFNA 1VQ9I 3CCYA 4C2TA 3A4CA 4HYEA 1JKQC 3QP5A 5HVQC 2VPRA 5TISC 4G7OF 1WFXA 1GXPA 1BR4A 2DFEA 2D2WA 3J7ZI 4A3IJ 4ZYHA 2WY7Q 1W1WE 1BOAA 1AKHB 2EFPA 3HOVJ 1YE9A 2E7WA 3VEPA 1W5CC 3NARA 3QPLA 3S1RJ 3TKYA 3BWGA 2NNYA 1EH8A 4D0PA 1R4MB 2FBHA 3RTRA 2IAIA 3K4NA 4OMZA 1Z3XA 3P5JA 4PDKA 3BLYA 1B6AA 3BG5A 1VFCA 3S14J 5FKKA 1H8AC 1JE8A 4XRSA 2QQ9A 3ZQHA 3JRFA 4X6AJ 3ZQGA 1R9TJ 3RCOA 1OKRA 2EV0A 2F5VA 3PL8A 4NC6A 4YEJA 2V9PA 1RPWA 2COMA 2X6OA 4L9TA 4MFEA 3ZRGA 4AIJA 5BQTA 3K4KA 4FASD 3S3OA 2R7RA 1BA5A 4IHWA 3P7NA 2N8GA 2D1HA 2VQGA 1A5JA 4FT8A 2PN6A 3GUDA 1AKHA 2DYRH 3KZIC 1HBXG 3ABUA 4XR6A 1QO0D 4EMSA 4MQVA 4AVPA 4KUMA 3V8KA 3GMEA 1D0YA 4G6QA 2OPTA 1ORKA 1JHHA 2RVCA 2HXOA 3ZQIA 1HKQA 1Y0UA 2M7AA 3R0JA 3LA3A 1X2NA 2XPWA 4XMYA 4U7BA 3LQRA 1G59A 2IRFG 2F5FA 1LFPA 1YW7A 1YFHA 1UFMA 2FBKA 2L4MA 3A03A 4JX4A 1IN4A 1WSUA 3BQZA 1D0ZA 3JRIA 1S7EA 3LSRA 3AL0C 2VKVA 2QM3A 5D8KB 1W5SA 2XGEA 3I4PA 4O3MA 3RKYA 1SVOA 1ZYRF 2DBBA 2F6CA 4AC0A 4AUXA 4N4OB 1EA3A 3DBHB 2MC4A 5DS9A 2XAUA 1Z67A 3F21A 4IRGA 2M4KA 2JRTA 3H0GJ 2WWYA 2XF5A 1KQ0A 3CTAA 4YG2F 4BACA 1SFEA 1TQIA 2ZFWA 2QQ8A 2V1NA 3VPRA 1D5VA 3LSTA 3MMYB 4I7HA 1X1AA 2ESNA 3J80K 1XPXA 2A68F 4KIBA 1HF0A 6PAXA 3FMQA 2LY2A 1NG7A 3E1SA 4HG2A 2A05A 1Z7UA 3IH4A 1UJ8A 3PO3J 5J4YA 2HS5A 3UKGA 2P5VA 4GGGA 1G8XA 1OCTC 1FTTA 1KU2A 2I10A 3E5UA 3L2RA 2MBFA 4IO9F 4KMUX 2VJ4A 4UXNA 3IL2A 2EILH 5EDNA 3RQIA 4AYBN 1Z0XA 3NWSA 3ZMZA 4RGUA 4WXDA 1XN7A 1IN6A 5FGMA 4IKFA 1DP3A 3SZPA 2Q2EB 3TGNA 1JTYA 1QZEA 3K10A 3GTQJ 2GWRA 3OYFA 3IAS2 1T2KA 4U0WA 1ZHFA 2H8RA 1P4WA 1LNWA 1YLFA 4U87A 1TT0A 1ZTRA 2F4MB 2D45A 3S32A 3FHNA 2EJRA 2QSFX 2VB6A 3I58A 4GRIA 4BXUA 2HQNA 4CICA 1X1PA 1USTA 2KIMA 4HNTA 3CUQB 4JYKA 2KIQA 2DW4A 2DA1A 4YIIA 4E70A 4AIKA 1FMVA 1GV2A 1YX5A 1W4MA 2GQQA 5IYBJ 1KU9A 1YHQI 4ITVA 3W6VA 2AXLA 1XGNA 2EZIA 1DU6A 2NVYJ 4OU0A 3KP4A 3EPZA 3CCVI 1QQIA 2Q2EA 1MBHA 2IS1A 4CHUA 4ENKA 4BEHB 3RZOJ 1LKXA 2OU2A 2VBYA 1FYKA 3PUBA 1B8IB 3LSKA 2GBYA 2LKXA 3L9FA 2K27A 2Y0MA 2LH9A 2YS9A 3MKZA 3MN2A 1G2HA 4XLAA 3H92A 3IAM2 1XGMA 2M45A 5GAHJ 1SMTA 5CQEA 2KT0A 5DM6F 2CG4A 2GA2A 5DYMA 3ZQQA 1TWHJ 3CUQA 1LJ9A 2L02A 1T98A 4R8HA 3C2HA 1T0FA 4FHTA 1KYZA 2WAEA 4A6EA 3A0HC 1N78A 1JKPC 5E17F 3RYRA 3HRMA 2M30A 4BEHA 2EIKH 4QPOA 1OLTA 1B8IA 3TOBA 1K7AA 2XV4S 2KZVA 4NBQA 5B66C 1BC7C 1O3SA 3GWZA 5LRRA 4IRHA 2W4SA 5EZGA 3GZ6A 2HQAA 2AQEA 3K2ZA 2EQRA 1I1GA 2E5NA 2ID3A 3BTCA 5C3EJ 5H20A 4R1HA 4GCVA 5C4JJ 1IN5A 2G7UA 2YX4A 4P9UA 2DA7A 3DBLB 5E1ZB 2E36A 4LLLA 1ITYA 2Y9YA 3QODA 1FP2A 1S7AA 2A61A 4L5IA 5L3DA 5LGNA 3ECHA 4L0YB 2BW3B 4LGWA 3HC7A 3DKXA 3RQ4A 2CQ7A 3CO7C 4F52A 1HXDA 2HWVA 4WF2A 4EM0B 1Q1VA 4H0EA 1X19A 2F5EA 3U1DA 2QA4I 1IZ1A 4KFCA 5J1YA 2VUMJ 4QIWN 2KRCA 2XAJA 3S93A 3B02A 2X48A 1X58A 1EH6A 1QBJA 2HZTA 4G6TB 1OCZH 1ODDA 4NC7A 2ZC2A 2PJPA 2ZB9A 2COBA 1T38A 3GFIA 2HVSA 4A3DJ 4MO7A 1UHMA 3WU0A 4UNOA 3KEYA 1P7IA 1FWZA 1FMWA 2BW3A 3JREA 2ID6A 2XAHA 3ZMSA 3EYYA 1SMYF 4NHJA 4XOPA 2YU9J 4OINF 4IPAA 2OBPA 3BZKA 3HGYA 4ANJA 3A01B 2XB0X 2VT2A 2BVMA 2EB7A 4L9VA 2QENA 1B9MA 4YIFA 4DZPA 1BW5A 4NDLA 2EV5A 3Q3SA 1XB4A 4A3JJ 3IUOA 3RI4A 5DCMB 2IW5A 4DGWB 5L3EA 1O3RA 2JTVA 4LITA 1ZELA 1T33A 1Z9CA 1MBFA 2QZ8A 3QPSA 3VSKA 1NK3P 3BJ6A 1XMKA 4CSWA 4WX9A 4A3LJ 1EF4A 3M4OJ 4II2A 1UG0A 2OV7A 2OD5A 2PLYA 3HSRA 2QBYA 2CUJA 1WJCA 4O6JA 3LNQA 2DMPA 2ZFUA 2VPLA 3IHUA 2NNNA 2GXGA 4BGDA 4IHSA 1AOYA 2BY3A 5BS6A 3BP8A 3KP5A 1D8KA 2Y75A 1MGTA 5GPAA 4U0YA 3CESA 4II3A 5F0HA 2CQKA 3S15J 3TP3A 3A01A 2PMZA 3HOWJ 3H9GA 3OS2A 4DYQA 3OYGA 4DBQA 1T08B 2R7QA 4NUBA 5DUIA 4EJOA 5DCMA 3TO6A 3OYDA 1HW1A 3H3UA 1M1EB 2Z3YA 3JAMK 4J01A 3A0BC 4I76A 5HDNA 5EYRA 1BL0A 2HFHA 1W7PD 3QPHA 1R7JA 1MMDA 1CF7A 4JQFA 4M3GA 2JN6A 2Y0SN 3BG3A 2BE5F 2ZSHB 3B73A 2WAQA 5KAFC 3LSHA 3U2RA 3W6JB 2UZKA 2DTRA 5DV5A 3T8RA 3H3ZA 1ZARA 1KA8A 1FTZA 3I64A 3ZMUA 1ZR2A 3KEOA 3ROUA 2Q0OA 2XVCA 2JVHA 1MD0A 2E7XA 2GOMA 1I3QJ 4LMYA 2QSGX 1WWXA 3MFKA 3KP6A 3I0TA 4B09A 2QSHX 3HSFA 2JSPA 2MGQA 1VF9A 4KA4A 2HDCA 4PJ0C 3G71I 4CCMA 5C4XJ 3V8JA 4RMNA 3N05A 5FRNA 2A69F 2HOAA 3DLLF 1LDKB 1DPUA 3T1BA 5M5WJ 2TDXA 1SD4A 4L9NA 2X9DA 3CUQC 3PQKA 2JPCA 3O8GA 3CCSI 2ZXIA 5TRDA 2V1UA 1T0FC 1FSEA 1HKSA 3OMYA 4BL0B 3JSOA 3BOQA 2RC4A 3F6VA 3FXMA 1MDMB 4X0GA 4CH7A 4RB2C 4N4NB 2E2JJ 1POGA 2LG4A 2CFOA 5EZHA 1CGPA 2UXXA 5KCMA 2LVSA 3WTUC 3FIWA 5CVIA 5DDGA 1NG6A 5FD5A 2LF7A 3JRGA 4EJVA 2OZUA 2ZXWH 2FQ3A 3VFZA 3QYFA 4E7LA 2NVTJ 2VJ5A 4EGZA 3JRDA 4EGYA 2LR8A 1Y0NA 2TCTA 5ICEA 2B9SA 1TQPA 1XS9A 1VI0A 4EM1A 1ENHA 2CV0A 5AIQA 5J40A 2VE9A 3ZQ7A 2DODA 5TJJA 2H6CA 5ILVA 2H1KA 2UUZA 1IO2A 2HYGD 3M3YJ 2ELKA 5E18F 2OF7A 3FMSA 2JQ7A 4FE4A 1H9GA 5F27A 5IT9K 3I53A 1Y6IA 2LOOA 1VQKI 3WTYC 2WB1A 2QEXI 1R22A 1USSA 3M8FA 4HEA2 2CWEA 4BBRJ 3S2DJ 1NH3A 4L5JA 2MSYA 4XLEA 3QP6A 1U9OA 4MTEA 3J7AO 1ETYA 3E6BA 2VN2A 3O6BB 3W2VA 3IRRA 1FOXA 4GYIA 2MW8A 1RUNA 4HRIA 1BOBA 2BYVE 3X2QH 2KDZA 3F8NA 2RNGA 4KIGA 2XKOA 1D0XA 1K4TA 5CVJA 1YTYA 2JA5J 3CP8A 4WK8F 3DXJF 3PO2J 5GTHC 3FM5A 1QGPA 3H9QA 1BI3A 1YS6A 4MNUA 5JI6A 1T39A 5EG0B 2QGUA 5B1BH 3CC7I 1SFKA 2LREA 2JT1A 3E97A 3M9AA 2CRGA 2Y30A 4M9SA 2BV6A 3FF5A 5ILSA 5L3FA 3CO6C 5BPIA 1NTCA 2XC7A 2M0MA 1F43A 4YFKF 4M3DA 2E71A 2L9NA 3QAHA 5K5QA 1JGGA 1WJFA 3K70C 1F9NA 1IUYA 1YJNI 3ERMA 1W36D 2FA5A 2VQHA 2DFIA 5LGTA 1UHSA 3KETA 1ZR4A 2Z9OA 1UHWA 1OCOH 5DM7F 3I59A 4OWRB 5CVVA 3FXLA 2IS4A 3TW7A 2X51A 4ZH4F 2FE3A 3AG4H 5CVRA 5LHGA 4IHTA 5E20A 5ILUA 3IKVA 5EG0A 1LUJB 3U21A 2CSOA 5L3GA 2HOTA 1P2FA 3LWFA 1MMNA 1XSXA 4C3JJ 4A3MJ 4I01A 2VIXA 4A0XA 5FLVA 2JA6J 1SD7A 4LFUA 5CKTA 3FHZA 5FKLA 2M1BA 3OYBA 1Y1VJ 4PJMA 1IW7F 5E1XA 1F4KA 3RYPA 3JRHA 2LLKA 2HTJA 3OOPA 5HS7A 2R7UA 4A5MA 3OYLA 4EQQA 5IYDJ 1FBSA 1U5TB 4MTDA 2HZDA 2ECBA 3V8LA 1FYMA 1ZK8A 2L3DA 2NVXJ 1QU3A 1HOMA 2M3AA 2AS5F 4HX4A 2M4GA 3HSEA 5K7FA 2B0LA 2Y9ZA 1KQ8A 2BY1A 4UB6C 2QKMB 3GVAA 4BHPA 1BJZA 2DT5A 2EA4A 2JK3A 1IN7A 3HOYJ 5LD2C 2DDBA 2UWMA 3KYCB 4N9HA 4D5CA 1STZA 1J0RA 4LK0F 5D5UB 5FROA 1VQOI 4FE7A 4IXAA 4PFPA 2KRHA 1QPIA 2CV2A 4PGHA 3JW4A 2DQLA 3ZQLA 4YIRX 1WRJA 4RS8A 1J2XA 2O0YA 3HOSA 2V6EA 2NVQJ 3DPUA 4JK1X 3ASNH 5FLXK 4XM3A 1OQYA 5HS9A 3HPGA 4CYCA 5K7ZA 1OYYA 3AKZA 4XRMA 5EEGA 1RI7A 3ZP5A 5IY5H 1BN5A 1JI8A 3GTKJ 3LSJA 1LB2A 1APLC 1Z6TA 1TC3C 2F4IA 3CMMA 3OR2C 4C3IJ 3K4BA 3BR1A 2WADA 3KFWX 3A2KA 3SYTA 1FIAA 1ZG3A 4EJUA 2EBIA 3PFIA 3ZPLA 1Y1WJ 4EJWA 4RAZA 3PSFA 4G9YA 2A5WA 3MKLA 1X4PA 2M5WA 4PJNA 1EJ9A 4E7IA 4BXXJ 2LSOA 4BQNA 1H0MA 1XGSA 2M8EA 2V6CA 5HOOA 3DKYA 2ADUA 1AHDP 4I02A 2YX7A 4HLYA 1E3PA 1TWAJ 2CW0F 4LB5A 2ZXJA 2R7FA 2Y48A 1VQPI 4XBFA 1BIAA 1BR2A 4D9JA 1UAAA 4G12A 4I09A 1CQTA 2AXTC 4MEXF 2PX9A 3OS1A 3FMRA 5IT9Z 2WAFA 1PVEA 2JZYA 3PM1A 5CYVA 4U0VA 4BE0A 1SAUA 1FBUA 3KIOA 1R71A 4E7KA 1LDJA 1ZG1A 1QA6A 2VBWA 4EJTA 3O3KA 1RESA 5FFXA 4XN3A 2DT7B 2CJJA 5E3OA 2QF7A 2ZJQF 5LFAA 4BNCA 4OOIA 5M3MJ 3F8FA 2CUFA 3ECOA 5J6XA 5M5XJ 1E3HA 2Z2SB 3H9JA 1HDPA 2KMUA 2ETHA 2X0LA 2DQRA 3F9KA 3L09A 4M71A 3B6CA 3DEEA 1Y8QB 4RLFA 4L0ZB 4IZZA 3A02A 4A12A 5FKOA 3TP0A 3RPUD 4XLNF 1Y56A 1V3FA 1TWGJ 4M73A 2PMUA 1LVAA 4XORA 4I0BA 5E8GA 4JX6A 1QZYA 4P9FA 3CJQB 1IDYA 1R4NB 3BY6A 3LL7A 3CLQA 2OUMA 1ON1A 2E35A 3N4MA 3L2VA 1MIJA 4IL6C 2VKEA 2OQRA 4HZFA 2DK8A 1FPQA 1J9IA 3RZDJ 3E5XA 4NNJA 1E3OC 4F55A 3LA2A 1IGNA 5EEHA 2MH2A 4AIDA 5E8IA 1DDNA 3S3NA 4B48A 4ZYGA 2NS0A 5ICCA 1SFXA 2I5UA 4IJAA 4ZDLA 1G6NA 4GYGA 4P96A 1VNDA 5KAIC 3DEWA 1HW2A 3L2QA 2ELHA 3J81Z 3CF2A 1VQMI 4B8XA 4XIDA 2Y31A 3GW2A 2ACJA 5GP9A 1XD7A 1IDZA 4Y13A 3CJNA 3V4GA
chains in the Genus database with same CATH topology
4Y15A 1U6GA 4OMYA 3TDZC 1S29A 3QRFF 3ZMTA 2Z5UA 2D1VA 3EUHA 4A0ZA 2GA1A 5A2QK 1GXQA 1JGSA 1FT9A 3JSPA 4HF2A 3U9GA 3KE2A 5DD8A 2C6YA 2XKPA 2FNPA 3N97A 2HOEA 2EV6A 5HS8A 2J5OA 3JTHA 2IJLA 3KLOA 1U5TC 5CJ9A 2W57A 4MHGA 4XRFA 2Z33A 3LA7A 3V7RA 2ISYA 1A04A 5HDGA 1DP7P 2VC1A 1ZRCA 3HRTA 2IA2A 5HLGA 3HRUA 3T5XA 4G8XA 3E6CC 2F5DA 2L4AA 2QWWA 3CLOA 3D5LA 4Z2YA 5FLXZ 4YFNF 3NEUA 5FB2A 3IC7A 3ULQB 2STTA 2IA1A 2NAZA 2Z99A 4R79A 1EH7A 5D6FA 2ZNZA 3HHGA 1W5TA 4BAYA 4ASNA 1I1SA 3SHFA 4A6DA 4GXOA 1FSHA 3R4KA 2A6HF 2V79A 3WE3A 1P4AA 2EFOA 1MKMA 3Q9VA 2ZMEA 3HOTA 2MH9A 1IRFA 4UVCA 4AD9A 3K1MA 4QLCU 3VB2A 2QBYB 1K6OA 3E6MA 2ZBKA 3F8BA 1YS7A 2E1CA 1S8NA 2WTEA 1SFUA 2BBYA 2O3FA 3KZZA 4G7HF 3C1DA 1UCRA 3WG9A 3C7JA 1OPCA 3VODA 4N0BA 1IXCA 4M6XA 4I98B 2FXAA 2VE8A 1JXSA 2DAOA 1XCBA 3J80Z 5FD6A 1BBYA 1TNSA 1CF7B 2XAFA 2W24A 1ZRDA 2A3SA 1B9NA 1MZBA 4RB0A 1P92A 1XSDA 1TBXA 2XIGA 3E6DA 4GO1A 3WTZA 3LAPA 4A2UA 5FO5A 1BI1A 4IHSA 2HGCA 1KU7A 2A07F 2XASA 5L3CA 1RZ4A 2XGXA 3HUGA 2XHKA 1T6SA 2IVMA 1D8JA 5J8CA 1TTYA 5LGUA 3FZVA 3GLXA 3HHHA 2G9WA 2W84A 1ZLJA 3DEUA 4LK1F 3GFMA 4IRIA 1R23A 5LHIA 1GVJA 1DUXC 3DKWA 3TO9A 2VXZA 3ELKA 3OV8A 5HLHA 5CVUA 3DF8A 1I27A 3F22A 1OR7A 4I0AA 4OIOF 3F8MA 2HKOA 4U7DA 1YQAA 1Z6RA 3K9TA 2FSWA 3GFLA 3IRQA 2BEOA 1XDSA 3WTTC 2P6TA 1TLHB 3EQLF 1REPC 1IAWA 4KMFA 3TO7A 2O6GE 4HQMA 3IWZA 4RB1A 4N9IA 4WCGA 1L3LA 3E3VA 4ESFA 4RB3C 1RIOH 1R1TA 4M6YA 4Q47A 3GZ5A 1ZGJA 3FXUA 2UXNA 1Z1DA 4KYWA 3CUOA 1YIOA 1Z91A 2YU3A 4F7ZA 4Q4ZF 5DUKA 3K1PA 1ON2A 3MWMA 4ENJA 5DCFA 3WGIA 5ICGA 2K86A 3C18A 4MQ9F 2W85A 3GYHX 2QQBA 5LLQA 1UB9A 3NQOA 1XCVA 2EK5A 3I59B 3RDIA 1KU3A 2RQPA 3SXYA 3T0YA 2MD5A 1P6RA 1S6LA 2P4WA 1TW2A 1K78B 2VBXA 1BI0A 1J7KA 2FBIA 4AIHA 3Q5FA 5LHHA 4HDUA 4BHBA 3MZHA 3QOPA 1ZREA 4KICA 5D5WB 2FU4A 3F8CA 4S04A 3ML6A 2XRNA 3EYIA 3WU1B 4P5OA 5BMZA 5LBQA 3KLNA 1FP1D 3LAJA 1K78A 3TQNA 5LRSA 3RKWA 4CGZA 5D4RA 1Z05A 4ZYDA 1LEBA 3ISPA 4K2EA 2DPUA 1YYVA 3PQJA 3DV8A 1NHAA 4DNCA 5D8LB 1L0OC 4M9XA 5K5RA 1U2WA 2R3SA 2RGVA 4KIFA 1U8RA 4S05A 3RPUA 3JAMZ 4KN7X 5ERIA 4L9JA 3GXOA 1PDNC 4QWQA 4CZZA 3D0SA 2Q8KA 3E5QA 3R0AA 4WWCA 1R58A 3AAFA 4LD5A 1HW5A 1MJAA 4IVNA 3HTSB 4EVIA 4HW0A 4UVBA 2A5YB 1BIBA 1BM9A 4U88A 1YG2A 2X4HA 3ZMDA 2RDPA 1FNNA 2RN7A 3MCZA 4KT5C 1P4XA 5D6EA 2KKOA 4KDPA 4OIQF 1YO5C 1R5HA 5D5VB 4LLNA 2OA4A 1IXSB 3P9KA 4EM2A 1Q1HA 1FBQA 3HRSA 1S3JA 3ABTA 3BJOA 4HF1A 3BZ6A 3DFGA 2EFWA 1R36A 1SD5A 2H94A 2QUFA 1KGSA 1EV7A 5H6RA 3L00A 2PI0A 3ZN0A 3I54A 2M87A 2YSRA 1O7FA 4HQEA 2MC3A 4XLPF 1FZPB 2FF4A 1TNTA 3BROA 3I71A 1U3EM 4Q48A 2R7DA 1O57A 5H6QA 5BPDA 1S7OA 2ISZA 4Q5SF 2YR2A 4CYDA 3Q9SA 3SFZA 5LEJA 2IA0A 2VOPA 3EETA 2YPRA 1FX7A 3R6SA 1DPRA 3REOA 2ZKZA 3C3WA 1ZH5A 2H09A 4JBAA 5L3BA 3S2WA 3FXQA 1G3SA 2CYYA 2DI3A 2PQ8A 1RUOA 2P7VB 2HTSA 3DPTA 3KEQA 2O03A 4DQ2A 4G7ZF 2P5LC 4ESBA 5CLSA 2K7LA 2GAUA 1R5GA 2CGPA 1FOKA 5FFZA 4FX4A 1ULYA 5JR3A 3BDDA 2KJBA 1PP8F 3BJAA 3R61A 5F6FA 3TOAA 1XSVA 2L01A 1J5YA 2RNJA 2JPBA 2LDUA 3DP7A 4M72A 1FC3A 1XGOA 5ICFA 2L54A 5F1RA 4L18B 2DK5A 2FNAA 2QYOA 1ONVA 2HQRA 3LQQA 3COAC 2BGCA 1OYWA 5JFRA 3K0LA 4P55A 3ZMVA 3P9CA 4PCQA 1W7PB 2DPDA 5D5XB 2XAQA 3VOEA 2MLKA 3RIRA 1ZN2A 2E1NA 3FM3A 1IXRC 1B1BA 2FMYA 3IKTA 2MLGA 2XUBA 5AONA 4BHCA 2RV8A 3RJPA 3GF2A 1FY7A 2KRFA 3T8TA 4ZZDA 2NYXA 1W7PA 3V7CA 1HSJA 2KIFA 3TDUC 1WI9A 3F72A 2PBIA 4M74A 2VOOA 1I6XA 5K1YA 4ZZLA 4LLGF 3MQ0A 3WGHA 2ZMEB 1ZGAA 1I5ZA 4RGXA 1IRGA 1WKMA 4ENMA 1YW8A 1B4AA 2XROA 2WV0A 1E17A 2KJCA 2K4JA 1GHCA 4HAMA 2J5PA 5HDKA 2PFBA 3O2PE 3MEXA 4UHTA 1D3YA 4HF0A 1BJAA 3FX3A 1FLIA 3LFKA 3FXRA 3WE2A 1KYWA 3GFJA 5F64A 1H9TA 4KN4X 2JSCA 1LQ1A 3EDPA 2STWA 3K69A 4NQWA 3F23A 4RGSA 1JHFA 1IF1A 2PEXA 4G94A 5E1WA 3QU6A 3WTXC 2DU9A 1RNLA 5JVTA 4CDGA 1PUEE 4OIPF 2DO7A 2HR3A 4LG0B 4ON0A 4EV0A 2VT3A 1BI2A 2O8XA 2GIVA 3QPTA 1ZRFA 3W6KB 2P7CB 4MGRA 3HTUA 1MJ9A 1PP7U 4ZYEA 3MAJA 2VC0A 4BH9A 2FEZA 4G6DA 3G73A 4ETSA 3DQVC 3GEZA 2WC2A 1B59A 1R1VA 2ZCWA 1U78A 1MJBA 4M9ZA 5IT3A 1QPMA 3KP7A 2V9VA 2ZO4A 2ZJ2A 2LNBA 2P5KA 4LG0A 5K5OA 2VBZA 3GO5A 3G3ZA 3WODF 2CFXA 2GXBA 3KCCA 1OMIA 4UV9A 5KK1A 2XAGA 3WGGA 1BC8C 4XSXF 2OAZA 2MA3A 3F3XA 4FX0A 3ERED 2KIUA 4HOBA 3M7GA 3ZN1A 1J75A 2QVOA 3F6OA 4PZJA 5A2QZ 1YW9A 1KQ9A 2HEOA 1F1ZA 3BPVA 3KP3A 1J59A 3IWFA 2ESHA 2ZNYA 4PGGA 1IN8A 3MZYA 1G3YA 2PG4A 2LKPA 4UUVA 3CDHA 2A6EF 5AIPA 1G3WA 4HX8A 2EA2A 3I5UA 2IPQX 1K79A 3WTWC 5BOXA 1HSTA 1VTNC 2VODA 3HYIA 1QZZA 4YFXF 2V1DA 1E2XA 3L2CA 1R1UA 1WQ2A 1OYIA 3SZTA 1XMAA 3K1NA 2EFQA 3R60A 2G7HA 5DD4A 1O3TA 3M8EA 1TQMA 1MDMA 3WTSC 1F5TA 4RAYA 4WXCA 1C0WA 4I2OA 2LF8A 1X3UA 3NRVA 1O3QA 4RGRA 2QLZA 4HBLA 4UVAA 4NB5A 1ZG5A 1G3TA 4LB6B 4IF4A 4TV7A 1FYLA 1XDUA 2GZWA 2NRAC 2FOKA 2H27A 4HV5A 1QNTA 2HKXA 2K4BA 1LDDA 2QQAA 2IP2A 4LJZF 3KP2A 5HLIA 1R00A 4WXHA 4A5NA 1LEAA 1HQCA 4A0YA 1AWCA 4HX7A 2VONA 3SQNA 3JTGA 4CXFA 3BPXA 4HV6A 2FRHA 2OQGA 5D4SA 2PMHA 1HKTA 1V4RA 4HDVA 4ESJA 1SAXA 3P9IA 1ZLKA 4BQAA 5J8FA 2W25A 5JHUA 3RKXA 4HA8A 4CO8A 5LEKA 4KNYA 3FWEA 1O7LA 3HIFA 2IT0A 4MEYF 2O61A 3J81K 4Y17A 4UV8A 2OZ6A 1SD6A 1G4DA 4HLXA 2RKHA 2H6BA 3KZYA 2FMLA 3QU3A 2K02A 3GX4X 3DPLC 4O5VA 4AWXB 5DEQA 5ED4A 2V1XA 3M1EA 2P8TA 3WTVC 3RPQA 4OIRF 2F2EA 2F5CA 2CO5A 1ZAOA 2EWNA 4ENNA 2DLLA 3L7WA 4BYYA 2P6SA 3V7SA 1TW3A 4XSZF 2HYFA 5KVRA 1U5TA 2EFNA 4HYEA 3QP5A 5HVQC 4G7OF 1GXPA 2D2WA 4ZYHA 1BOAA 2EFPA 2E7WA 3VEPA 3TKYA 2NNYA 3BWGA 1EH8A 4D0PA 2FBHA 3RTRA 4OMZA 4PDKA 1B6AA 1JE8A 2QQ9A 1OKRA 2EV0A 4L9TA 2COMA 4AIJA 5BQTA 3P7NA 2D1HA 4FT8A 2PN6A 3GUDA 1HBXG 3ABUA 1QO0D 4EMSA 4MQVA 4AVPA 4KUMA 3V8KA 4G6QA 2RVCA 1JHHA 1HKQA 1Y0UA 3R0JA 3LA3A 4U7BA 3LQRA 2IRFG 2F5FA 1YW7A 1YFHA 1UFMA 2FBKA 2L4MA 1IN4A 1WSUA 2QM3A 5D8KB 1W5SA 3I4PA 4O3MA 3RKYA 1ZYRF 2DBBA 3F21A 4IRGA 2JRTA 2WWYA 1KQ0A 3CTAA 4YG2F 1SFEA 1TQIA 2ZFWA 1D5VA 3LSTA 4I7HA 3J80K 2ESNA 6PAXA 2A68F 4KIBA 3FMQA 1Z7UA 2HS5A 2P5VA 4GGGA 1KU2A 3E5UA 2MBFA 4KMUX 4UXNA 3IL2A 3ZMZA 4RGUA 4WXDA 1XN7A 1IN6A 5FGMA 3SZPA 3TGNA 2GWRA 1T2KA 4U0WA 1ZHFA 1P4WA 1LNWA 1YLFA 2D45A 2EJRA 3I58A 4BXUA 2HQNA 4CICA 1USTA 2KIMA 3CUQB 4YIIA 2DW4A 4E70A 4AIKA 1W4MA 2GQQA 1KU9A 2AXLA 1XGNA 4OU0A 3KP4A 1QQIA 2Q2EA 4CHUA 4ENKA 2OU2A 2VBYA 1FYKA 3L9FA 2K27A 2Y0MA 3H92A 1XGMA 2M45A 1SMTA 2CG4A 2GA2A 5DYMA 3CUQA 1LJ9A 2L02A 1T98A 4R8HA 1T0FA 4FHTA 1KYZA 4A6EA 5E17F 3RYRA 3HRMA 2M30A 3TOBA 1K7AA 2XV4S 1BC7C 1O3SA 3GWZA 5LRRA 4IRHA 3GZ6A 3K2ZA 1I1GA 5H20A 4R1HA 4GCVA 1IN5A 2G7UA 2YX4A 4P9UA 5E1ZB 4LLLA 4L5IA 1FP2A 1S7AA 2A61A 5L3DA 5LGNA 3ECHA 4L0YB 4LGWA 3CO7C 1HXDA 2HWVA 4WF2A 4EM0B 4H0EA 2F5EA 3U1DA 1IZ1A 4KFCA 2XAJA 3B02A 1EH6A 1QBJA 2HZTA 1ODDA 2PJPA 1T38A 3GFIA 1UHMA 3WU0A 4UNOA 1FWZA 2XAHA 3ZMSA 3EYYA 1SMYF 4NHJA 4OINF 4IPAA 2OBPA 2VT2A 2EB7A 4L9VA 2QENA 1B9MA 4YIFA 2EV5A 1XB4A 3RI4A 5DCMB 2IW5A 5L3EA 1O3RA 2JTVA 1Z9CA 2QZ8A 3BJ6A 1XMKA 4WX9A 2PLYA 2OD5A 3HSRA 2QBYA 4O6JA 3IHUA 2NNNA 2GXGA 1AOYA 5BS6A 3BP8A 3KP5A 1D8KA 2Y75A 1MGTA 4U0YA 2CQKA 5DUIA 4EJOA 5DCMA 3TO6A 1HW1A 3H3UA 3JAMK 2Z3YA 5HDNA 2HFHA 1W7PD 3QPHA 1R7JA 1CF7A 4JQFA 2BE5F 3B73A 3U2RA 3W6JB 2UZKA 2DTRA 5DV5A 3T8RA 3H3ZA 1ZARA 1KA8A 3I64A 3ZMUA 3KEOA 3ROUA 2Q0OA 2XVCA 1MD0A 2E7XA 4LMYA 1WWXA 3MFKA 3KP6A 3I0TA 4B09A 3HSFA 4KA4A 2HDCA 3V8JA 2A69F 1LDKB 1DPUA 3T1BA 2TDXA 1SD4A 4L9NA 3CUQC 3PQKA 2JPCA 5TRDA 2V1UA 1FSEA 1HKSA 3JSOA 3BOQA 2RC4A 3F6VA 1MDMB 4RB2C 1CGPA 2UXXA 3WTUC 5CVIA 5DDGA 5FD5A 2LF7A 4EJVA 2OZUA 2FQ3A 3VFZA 4EGZA 4EGYA 5ICEA 1TQPA 4EM1A 5AIQA 2VE9A 3ZQ7A 5TJJA 2H6CA 5ILVA 2HYGD 5E18F 3FMSA 1H9GA 5IT9K 3I53A 3WTYC 1R22A 1USSA 3M8FA 2CWEA 4L5JA 4MTEA 3QP6A 3J7AO 3E6BA 2VN2A 3O6BB 3IRRA 4GYIA 1RUNA 2BYVE 3F8NA 4KIGA 2XKOA 5CVJA 1YTYA 4WK8F 3DXJF 3FM5A 1QGPA 1BI3A 1YS6A 4MNUA 5JI6A 1T39A 3E97A 2JT1A 3M9AA 4M9SA 2BV6A 3FF5A 5ILSA 5L3FA 3CO6C 5BPIA 4YFKF 3QAHA 5K5QA 1F9NA 1IUYA 2FA5A 2DFIA 5LGTA 3KETA 2Z9OA 1UHWA 3I59A 5CVVA 4ZH4F 2FE3A 5CVRA 5LHGA 4IHTA 5E20A 5ILUA 3IKVA 2CSOA 5L3GA 1P2FA 3LWFA 1XSXA 4I01A 4A0XA 1SD7A 4LFUA 3FHZA 2M1BA 1IW7F 5E1XA 1F4KA 3RYPA 2HTJA 3OOPA 5HS7A 4A5MA 4EQQA 1FBSA 1U5TB 4MTDA 3V8LA 1FYMA 2L3DA 2AS5F 4HX4A 3HSEA 2B0LA 1KQ8A 3GVAA 4BHPA 2DT5A 2EA4A 1IN7A 2UWMA 4N9HA 1STZA 1J0RA 4LK0F 5D5UB 4IXAA 4PGHA 3JW4A 2DQLA 1WRJA 4RS8A 1J2XA 2O0YA 3HOSA 4JK1X 5FLXK 5HS9A 1OYYA 5EEGA 1RI7A 3ZP5A 1BN5A 1LB2A 1Z6TA 3KFWX 1ZG3A 4EJUA 3PFIA 3ZPLA 4EJWA 4RAZA 4G9YA 2M5WA 2LSOA 1H0MA 1XGSA 2M8EA 2V6CA 5HOOA 2ADUA 4I02A 2YX7A 4HLYA 2CW0F 4LB5A 2ZXJA 2R7FA 2Y48A 4XBFA 1BIAA 4I09A 4MEXF 5IT9Z 3FMRA 2JZYA 5CYVA 4U0VA 1FBUA 1LDJA 1ZG1A 2VBWA 4EJTA 3O3KA 5FFXA 4BNCA 4OOIA 3F8FA 3ECOA 5J6XA 2ETHA 2X0LA 2DQRA 3L09A 4M71A 4L0ZB 4A12A 4XLNF 1V3FA 4M73A 2PMUA 1LVAA 4I0BA 5E8GA 1QZYA 4P9FA 3BY6A 1ON1A 3N4MA 2OQRA 4HZFA 2DK8A 1FPQA 1J9IA 3E5XA 3LA2A 5EEHA 2MH2A 1DDNA 5E8IA 4ZYGA 2NS0A 5ICCA 1SFXA 4IJAA 1G6NA 4GYGA 4P96A 1HW2A 2ELHA 3J81Z 4B8XA 3GW2A 2ACJA 1XD7A 4Y13A 3CJNA 3V4GA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4Y15 A;  1U6G A;  4OMY A;  3TDZ C;  1S29 A;  3QRF F;  3ZMT A;  2Z5U A;  2D1V A;  3EUH A;  4A0Z A;  2GA1 A;  5A2Q K;  1GXQ A;  1JGS A;  1FT9 A;  3JSP A;  4HF2 A;  3U9G A;  3KE2 A;  5DD8 A;  2C6Y A;  2XKP A;  2FNP A;  3N97 A;  2HOE A;  2EV6 A;  5HS8 A;  2J5O A;  3JTH A;  2IJL A;  3KLO A;  1U5T C;  5CJ9 A;  2W57 A;  4MHG A;  4XRF A;  2Z33 A;  3LA7 A;  3V7R A;  2ISY A;  1A04 A;  5HDG A;  1DP7 P;  2VC1 A;  1ZRC A;  3HRT A;  2IA2 A;  5HLG A;  3HRU A;  3T5X A;  4G8X A;  3E6C C;  2F5D A;  2L4A A;  2QWW A;  3CLO A;  3D5L A;  4Z2Y A;  5FLX Z;  4YFN F;  3NEU A;  5FB2 A;  3IC7 A;  3ULQ B;  2STT A;  2IA1 A;  2NAZ A;  2Z99 A;  4R79 A;  1EH7 A;  5D6F A;  2ZNZ A;  3HHG A;  1W5T A;  4BAY A;  4ASN A;  1I1S A;  3SHF A;  4A6D A;  4GXO A;  1FSH A;  3R4K A;  2A6H F;  2V79 A;  3WE3 A;  1P4A A;  2EFO A;  1MKM A;  3Q9V A;  2ZME A;  3HOT A;  2MH9 A;  1IRF A;  4UVC A;  4AD9 A;  3K1M A;  4QLC U;  3VB2 A;  2QBY B;  1K6O A;  3E6M A;  2ZBK A;  3F8B A;  1YS7 A;  2E1C A;  1S8N A;  2WTE A;  1SFU A;  2BBY A;  2O3F A;  3KZZ A;  4G7H F;  3C1D A;  1UCR A;  3WG9 A;  3C7J A;  1OPC A;  3VOD A;  4N0B A;  1IXC A;  4M6X A;  4I98 B;  2FXA A;  2VE8 A;  1JXS A;  2DAO A;  1XCB A;  3J80 Z;  5FD6 A;  1BBY A;  1TNS A;  1CF7 B;  2XAF A;  2W24 A;  1ZRD A;  2A3S A;  1B9N A;  1MZB A;  4RB0 A;  1P92 A;  1XSD A;  1TBX A;  2XIG A;  3E6D A;  4GO1 A;  3WTZ A;  3LAP A;  4A2U A;  5FO5 A;  1BI1 A;  4IHS A;  2HGC A;  1KU7 A;  2A07 F;  2XAS A;  5L3C A;  1RZ4 A;  2XGX A;  3HUG A;  2XHK A;  1T6S A;  2IVM A;  1D8J A;  5J8C A;  1TTY A;  5LGU A;  3FZV A;  3GLX A;  3HHH A;  2G9W A;  2W84 A;  1ZLJ A;  3DEU A;  4LK1 F;  3GFM A;  4IRI A;  1R23 A;  5LHI A;  1GVJ A;  1DUX C;  3DKW A;  3TO9 A;  2VXZ A;  3ELK A;  3OV8 A;  5HLH A;  5CVU A;  3DF8 A;  1I27 A;  3F22 A;  1OR7 A;  4I0A A;  4OIO F;  3F8M A;  2HKO A;  4U7D A;  1YQA A;  1Z6R A;  3K9T A;  2FSW A;  3GFL A;  3IRQ A;  2BEO A;  1XDS A;  3WTT C;  2P6T A;  1TLH B;  3EQL F;  1REP C;  1IAW A;  4KMF A;  3TO7 A;  2O6G E;  4HQM A;  3IWZ A;  4RB1 A;  4N9I A;  4WCG A;  1L3L A;  3E3V A;  4ESF A;  4RB3 C;  1RIO H;  1R1T A;  4M6Y A;  4Q47 A;  3GZ5 A;  1ZGJ A;  3FXU A;  2UXN A;  1Z1D A;  4KYW A;  3CUO A;  1YIO A;  1Z91 A;  2YU3 A;  4F7Z A;  4Q4Z F;  5DUK A;  3K1P A;  1ON2 A;  3MWM A;  4ENJ A;  5DCF A;  3WGI A;  5ICG A;  2K86 A;  3C18 A;  4MQ9 F;  2W85 A;  3GYH X;  2QQB A;  5LLQ A;  1UB9 A;  3NQO A;  1XCV A;  2EK5 A;  3I59 B;  3RDI A;  1KU3 A;  2RQP A;  3SXY A;  3T0Y A;  2MD5 A;  1P6R A;  1S6L A;  2P4W A;  1TW2 A;  1K78 B;  2VBX A;  1BI0 A;  1J7K A;  2FBI A;  4AIH A;  3Q5F A;  5LHH A;  4HDU A;  4BHB A;  3MZH A;  3QOP A;  1ZRE A;  4KIC A;  5D5W B;  2FU4 A;  3F8C A;  4S04 A;  3ML6 A;  2XRN A;  3EYI A;  3WU1 B;  4P5O A;  5BMZ A;  5LBQ A;  3KLN A;  1FP1 D;  3LAJ A;  1K78 A;  3TQN A;  5LRS A;  3RKW A;  4CGZ A;  5D4R A;  1Z05 A;  4ZYD A;  1LEB A;  3ISP A;  4K2E A;  2DPU A;  1YYV A;  3PQJ A;  3DV8 A;  1NHA A;  4DNC A;  5D8L B;  1L0O C;  4M9X A;  5K5R A;  1U2W A;  2R3S A;  2RGV A;  4KIF A;  1U8R A;  4S05 A;  3RPU A;  3JAM Z;  4KN7 X;  5ERI A;  4L9J A;  3GXO A;  1PDN C;  4QWQ A;  4CZZ A;  3D0S A;  2Q8K A;  3E5Q A;  3R0A A;  4WWC A;  1R58 A;  3AAF A;  4LD5 A;  1HW5 A;  1MJA A;  4IVN A;  3HTS B;  4EVI A;  4HW0 A;  4UVB A;  2A5Y B;  1BIB A;  1BM9 A;  4U88 A;  1YG2 A;  2X4H A;  3ZMD A;  2RDP A;  1FNN A;  2RN7 A;  3MCZ A;  4KT5 C;  1P4X A;  5D6E A;  2KKO A;  4KDP A;  4OIQ F;  1YO5 C;  1R5H A;  5D5V B;  4LLN A;  2OA4 A;  1IXS B;  3P9K A;  4EM2 A;  1Q1H A;  1FBQ A;  3HRS A;  1S3J A;  3ABT A;  3BJO A;  4HF1 A;  3BZ6 A;  3DFG A;  2EFW A;  1R36 A;  1SD5 A;  2H94 A;  2QUF A;  1KGS A;  1EV7 A;  5H6R A;  3L00 A;  2PI0 A;  3ZN0 A;  3I54 A;  2M87 A;  2YSR A;  1O7F A;  4HQE A;  2MC3 A;  4XLP F;  1FZP B;  2FF4 A;  1TNT A;  3BRO A;  3I71 A;  1U3E M;  4Q48 A;  2R7D A;  1O57 A;  5H6Q A;  5BPD A;  1S7O A;  2ISZ A;  4Q5S F;  2YR2 A;  4CYD A;  3Q9S A;  3SFZ A;  5LEJ A;  2IA0 A;  2VOP A;  3EET A;  2YPR A;  1FX7 A;  3R6S A;  1DPR A;  3REO A;  2ZKZ A;  3C3W A;  1ZH5 A;  2H09 A;  4JBA A;  5L3B A;  3S2W A;  3FXQ A;  1G3S A;  2CYY A;  2DI3 A;  2PQ8 A;  1RUO A;  2P7V B;  2HTS A;  3DPT A;  3KEQ A;  2O03 A;  4DQ2 A;  4G7Z F;  2P5L C;  4ESB A;  5CLS A;  2K7L A;  2GAU A;  1R5G A;  2CGP A;  1FOK A;  5FFZ A;  4FX4 A;  1ULY A;  5JR3 A;  3BDD A;  2KJB A;  1PP8 F;  3BJA A;  3R61 A;  5F6F A;  3TOA A;  1XSV A;  2L01 A;  1J5Y A;  2RNJ A;  2JPB A;  2LDU A;  3DP7 A;  4M72 A;  1FC3 A;  1XGO A;  5ICF A;  2L54 A;  5F1R A;  4L18 B;  2DK5 A;  2FNA A;  2QYO A;  1ONV A;  2HQR A;  3LQQ A;  3COA C;  2BGC A;  1OYW A;  5JFR A;  3K0L A;  4P55 A;  3ZMV A;  3P9C A;  4PCQ A;  1W7P B;  2DPD A;  5D5X B;  2XAQ A;  3VOE A;  2MLK A;  3RIR A;  1ZN2 A;  2E1N A;  3FM3 A;  1IXR C;  1B1B A;  2FMY A;  3IKT A;  2MLG A;  2XUB A;  5AON A;  4BHC A;  2RV8 A;  3RJP A;  3GF2 A;  1FY7 A;  2KRF A;  3T8T A;  4ZZD A;  2NYX A;  1W7P A;  3V7C A;  1HSJ A;  2KIF A;  3TDU C;  1WI9 A;  3F72 A;  2PBI A;  4M74 A;  2VOO A;  1I6X A;  5K1Y A;  4ZZL A;  4LLG F;  3MQ0 A;  3WGH A;  2ZME B;  1ZGA A;  1I5Z A;  4RGX A;  1IRG A;  1WKM A;  4ENM A;  1YW8 A;  1B4A A;  2XRO A;  2WV0 A;  1E17 A;  2KJC A;  2K4J A;  1GHC A;  4HAM A;  2J5P A;  5HDK A;  2PFB A;  3O2P E;  3MEX A;  4UHT A;  1D3Y A;  4HF0 A;  1BJA A;  3FX3 A;  1FLI A;  3LFK A;  3FXR A;  3WE2 A;  1KYW A;  3GFJ A;  5F64 A;  1H9T A;  4KN4 X;  2JSC A;  1LQ1 A;  3EDP A;  2STW A;  3K69 A;  4NQW A;  3F23 A;  4RGS A;  1JHF A;  1IF1 A;  2PEX A;  4G94 A;  5E1W A;  3QU6 A;  3WTX C;  2DU9 A;  1RNL A;  5JVT A;  4CDG A;  1PUE E;  4OIP F;  2DO7 A;  2HR3 A;  4LG0 B;  4ON0 A;  4EV0 A;  2VT3 A;  1BI2 A;  2O8X A;  2GIV A;  3QPT A;  1ZRF A;  3W6K B;  2P7C B;  4MGR A;  3HTU A;  1MJ9 A;  1PP7 U;  4ZYE A;  3MAJ A;  2VC0 A;  4BH9 A;  2FEZ A;  4G6D A;  3G73 A;  4ETS A;  3DQV C;  3GEZ A;  2WC2 A;  1B59 A;  1R1V A;  2ZCW A;  1U78 A;  1MJB A;  4M9Z A;  5IT3 A;  1QPM A;  3KP7 A;  2V9V A;  2ZO4 A;  2ZJ2 A;  2LNB A;  2P5K A;  4LG0 A;  5K5O A;  2VBZ A;  3GO5 A;  3G3Z A;  3WOD F;  2CFX A;  2GXB A;  3KCC A;  1OMI A;  4UV9 A;  5KK1 A;  2XAG A;  3WGG A;  1BC8 C;  4XSX F;  2OAZ A;  2MA3 A;  3F3X A;  4FX0 A;  3ERE D;  2KIU A;  4HOB A;  3M7G A;  3ZN1 A;  1J75 A;  2QVO A;  3F6O A;  4PZJ A;  5A2Q Z;  1YW9 A;  1KQ9 A;  2HEO A;  1F1Z A;  3BPV A;  3KP3 A;  1J59 A;  3IWF A;  2ESH A;  2ZNY A;  4PGG A;  1IN8 A;  3MZY A;  1G3Y A;  2PG4 A;  2LKP A;  4UUV A;  3CDH A;  2A6E F;  5AIP A;  1G3W A;  4HX8 A;  2EA2 A;  3I5U A;  2IPQ X;  1K79 A;  3WTW C;  5BOX A;  1HST A;  1VTN C;  2VOD A;  3HYI A;  1QZZ A;  4YFX F;  2V1D A;  1E2X A;  3L2C A;  1R1U A;  1WQ2 A;  1OYI A;  3SZT A;  1XMA A;  3K1N A;  2EFQ A;  3R60 A;  2G7H A;  5DD4 A;  1O3T A;  3M8E A;  1TQM A;  1MDM A;  3WTS C;  1F5T A;  4RAY A;  4WXC A;  1C0W A;  4I2O A;  2LF8 A;  1X3U A;  3NRV A;  1O3Q A;  4RGR A;  2QLZ A;  4HBL A;  4UVA A;  4NB5 A;  1ZG5 A;  1G3T A;  4LB6 B;  4IF4 A;  4TV7 A;  1FYL A;  1XDU A;  2GZW A;  2NRA C;  2FOK A;  2H27 A;  4HV5 A;  1QNT A;  2HKX A;  2K4B A;  1LDD A;  2QQA A;  2IP2 A;  4LJZ F;  3KP2 A;  5HLI A;  1R00 A;  4WXH A;  4A5N A;  1LEA A;  1HQC A;  4A0Y A;  1AWC A;  4HX7 A;  2VON A;  3SQN A;  3JTG A;  4CXF A;  3BPX A;  4HV6 A;  2FRH A;  2OQG A;  5D4S A;  2PMH A;  1HKT A;  1V4R A;  4HDV A;  4ESJ A;  1SAX A;  3P9I A;  1ZLK A;  4BQA A;  5J8F A;  2W25 A;  5JHU A;  3RKX A;  4HA8 A;  4CO8 A;  5LEK A;  4KNY A;  3FWE A;  1O7L A;  3HIF A;  2IT0 A;  4MEY F;  2O61 A;  3J81 K;  4Y17 A;  4UV8 A;  2OZ6 A;  1SD6 A;  1G4D A;  4HLX A;  2RKH A;  2H6B A;  3KZY A;  2FML A;  3QU3 A;  2K02 A;  3GX4 X;  3DPL C;  4O5V A;  4AWX B;  5DEQ A;  5ED4 A;  2V1X A;  3M1E A;  2P8T A;  3WTV C;  3RPQ A;  4OIR F;  2F2E A;  2F5C A;  2CO5 A;  1ZAO A;  2EWN A;  4ENN A;  2DLL A;  3L7W A;  4BYY A;  2P6S A;  3V7S A;  1TW3 A;  4XSZ F;  2HYF A;  5KVR A;  1U5T A;  2EFN A;  4HYE A;  3QP5 A;  5HVQ C;  4G7O F;  1GXP A;  2D2W A;  4ZYH A;  1BOA A;  2EFP A;  2E7W A;  3VEP A;  3TKY A;  2NNY A;  3BWG A;  1EH8 A;  4D0P A;  2FBH A;  3RTR A;  4OMZ A;  4PDK A;  1B6A A;  1JE8 A;  2QQ9 A;  1OKR A;  2EV0 A;  4L9T A;  2COM A;  4AIJ A;  5BQT A;  3P7N A;  2D1H A;  4FT8 A;  2PN6 A;  3GUD A;  1HBX G;  3ABU A;  1QO0 D;  4EMS A;  4MQV A;  4AVP A;  4KUM A;  3V8K A;  4G6Q A;  2RVC A;  1JHH A;  1HKQ A;  1Y0U A;  3R0J A;  3LA3 A;  4U7B A;  3LQR A;  2IRF G;  2F5F A;  1YW7 A;  1YFH A;  1UFM A;  2FBK A;  2L4M A;  1IN4 A;  1WSU A;  2QM3 A;  5D8K B;  1W5S A;  3I4P A;  4O3M A;  3RKY A;  1ZYR F;  2DBB A;  3F21 A;  4IRG A;  2JRT A;  2WWY A;  1KQ0 A;  3CTA A;  4YG2 F;  1SFE A;  1TQI A;  2ZFW A;  1D5V A;  3LST A;  4I7H A;  3J80 K;  2ESN A;  6PAX A;  2A68 F;  4KIB A;  3FMQ A;  1Z7U A;  2HS5 A;  2P5V A;  4GGG A;  1KU2 A;  3E5U A;  2MBF A;  4KMU X;  4UXN A;  3IL2 A;  3ZMZ A;  4RGU A;  4WXD A;  1XN7 A;  1IN6 A;  5FGM A;  3SZP A;  3TGN A;  2GWR A;  1T2K A;  4U0W A;  1ZHF A;  1P4W A;  1LNW A;  1YLF A;  2D45 A;  2EJR A;  3I58 A;  4BXU A;  2HQN A;  4CIC A;  1UST A;  2KIM A;  3CUQ B;  4YII A;  2DW4 A;  4E70 A;  4AIK A;  1W4M A;  2GQQ A;  1KU9 A;  2AXL A;  1XGN A;  4OU0 A;  3KP4 A;  1QQI A;  2Q2E A;  4CHU A;  4ENK A;  2OU2 A;  2VBY A;  1FYK A;  3L9F A;  2K27 A;  2Y0M A;  3H92 A;  1XGM A;  2M45 A;  1SMT A;  2CG4 A;  2GA2 A;  5DYM A;  3CUQ A;  1LJ9 A;  2L02 A;  1T98 A;  4R8H A;  1T0F A;  4FHT A;  1KYZ A;  4A6E A;  5E17 F;  3RYR A;  3HRM A;  2M30 A;  3TOB A;  1K7A A;  2XV4 S;  1BC7 C;  1O3S A;  3GWZ A;  5LRR A;  4IRH A;  3GZ6 A;  3K2Z A;  1I1G A;  5H20 A;  4R1H A;  4GCV A;  1IN5 A;  2G7U A;  2YX4 A;  4P9U A;  5E1Z B;  4LLL A;  4L5I A;  1FP2 A;  1S7A A;  2A61 A;  5L3D A;  5LGN A;  3ECH A;  4L0Y B;  4LGW A;  3CO7 C;  1HXD A;  2HWV A;  4WF2 A;  4EM0 B;  4H0E A;  2F5E A;  3U1D A;  1IZ1 A;  4KFC A;  2XAJ A;  3B02 A;  1EH6 A;  1QBJ A;  2HZT A;  1ODD A;  2PJP A;  1T38 A;  3GFI A;  1UHM A;  3WU0 A;  4UNO A;  1FWZ A;  2XAH A;  3ZMS A;  3EYY A;  1SMY F;  4NHJ A;  4OIN F;  4IPA A;  2OBP A;  2VT2 A;  2EB7 A;  4L9V A;  2QEN A;  1B9M A;  4YIF A;  2EV5 A;  1XB4 A;  3RI4 A;  5DCM B;  2IW5 A;  5L3E A;  1O3R A;  2JTV A;  1Z9C A;  2QZ8 A;  3BJ6 A;  1XMK A;  4WX9 A;  2PLY A;  2OD5 A;  3HSR A;  2QBY A;  4O6J A;  3IHU A;  2NNN A;  2GXG A;  1AOY A;  5BS6 A;  3BP8 A;  3KP5 A;  1D8K A;  2Y75 A;  1MGT A;  4U0Y A;  2CQK A;  5DUI A;  4EJO A;  5DCM A;  3TO6 A;  1HW1 A;  3H3U A;  3JAM K;  2Z3Y A;  5HDN A;  2HFH A;  1W7P D;  3QPH A;  1R7J A;  1CF7 A;  4JQF A;  2BE5 F;  3B73 A;  3U2R A;  3W6J B;  2UZK A;  2DTR A;  5DV5 A;  3T8R A;  3H3Z A;  1ZAR A;  1KA8 A;  3I64 A;  3ZMU A;  3KEO A;  3ROU A;  2Q0O A;  2XVC A;  1MD0 A;  2E7X A;  4LMY A;  1WWX A;  3MFK A;  3KP6 A;  3I0T A;  4B09 A;  3HSF A;  4KA4 A;  2HDC A;  3V8J A;  2A69 F;  1LDK B;  1DPU A;  3T1B A;  2TDX A;  1SD4 A;  4L9N A;  3CUQ C;  3PQK A;  2JPC A;  5TRD A;  2V1U A;  1FSE A;  1HKS A;  3JSO A;  3BOQ A;  2RC4 A;  3F6V A;  1MDM B;  4RB2 C;  1CGP A;  2UXX A;  3WTU C;  5CVI A;  5DDG A;  5FD5 A;  2LF7 A;  4EJV A;  2OZU A;  2FQ3 A;  3VFZ A;  4EGZ A;  4EGY A;  5ICE A;  1TQP A;  4EM1 A;  5AIQ A;  2VE9 A;  3ZQ7 A;  5TJJ A;  2H6C A;  5ILV A;  2HYG D;  5E18 F;  3FMS A;  1H9G A;  5IT9 K;  3I53 A;  3WTY C;  1R22 A;  1USS A;  3M8F A;  2CWE A;  4L5J A;  4MTE A;  3QP6 A;  3J7A O;  3E6B A;  2VN2 A;  3O6B B;  3IRR A;  4GYI A;  1RUN A;  2BYV E;  3F8N A;  4KIG A;  2XKO A;  5CVJ A;  1YTY A;  4WK8 F;  3DXJ F;  3FM5 A;  1QGP A;  1BI3 A;  1YS6 A;  4MNU A;  5JI6 A;  1T39 A;  3E97 A;  2JT1 A;  3M9A A;  4M9S A;  2BV6 A;  3FF5 A;  5ILS A;  5L3F A;  3CO6 C;  5BPI A;  4YFK F;  3QAH A;  5K5Q A;  1F9N A;  1IUY A;  2FA5 A;  2DFI A;  5LGT A;  3KET A;  2Z9O A;  1UHW A;  3I59 A;  5CVV A;  4ZH4 F;  2FE3 A;  5CVR A;  5LHG A;  4IHT A;  5E20 A;  5ILU A;  3IKV A;  2CSO A;  5L3G A;  1P2F A;  3LWF A;  1XSX A;  4I01 A;  4A0X A;  1SD7 A;  4LFU A;  3FHZ A;  2M1B A;  1IW7 F;  5E1X A;  1F4K A;  3RYP A;  2HTJ A;  3OOP A;  5HS7 A;  4A5M A;  4EQQ A;  1FBS A;  1U5T B;  4MTD A;  3V8L A;  1FYM A;  2L3D A;  2AS5 F;  4HX4 A;  3HSE A;  2B0L A;  1KQ8 A;  3GVA A;  4BHP A;  2DT5 A;  2EA4 A;  1IN7 A;  2UWM A;  4N9H A;  1STZ A;  1J0R A;  4LK0 F;  5D5U B;  4IXA A;  4PGH A;  3JW4 A;  2DQL A;  1WRJ A;  4RS8 A;  1J2X A;  2O0Y A;  3HOS A;  4JK1 X;  5FLX K;  5HS9 A;  1OYY A;  5EEG A;  1RI7 A;  3ZP5 A;  1BN5 A;  1LB2 A;  1Z6T A;  3KFW X;  1ZG3 A;  4EJU A;  3PFI A;  3ZPL A;  4EJW A;  4RAZ A;  4G9Y A;  2M5W A;  2LSO A;  1H0M A;  1XGS A;  2M8E A;  2V6C A;  5HOO A;  2ADU A;  4I02 A;  2YX7 A;  4HLY A;  2CW0 F;  4LB5 A;  2ZXJ A;  2R7F A;  2Y48 A;  4XBF A;  1BIA A;  4I09 A;  4MEX F;  5IT9 Z;  3FMR A;  2JZY A;  5CYV A;  4U0V A;  1FBU A;  1LDJ A;  1ZG1 A;  2VBW A;  4EJT A;  3O3K A;  5FFX A;  4BNC A;  4OOI A;  3F8F A;  3ECO A;  5J6X A;  2ETH A;  2X0L A;  2DQR A;  3L09 A;  4M71 A;  4L0Z B;  4A12 A;  4XLN F;  1V3F A;  4M73 A;  2PMU A;  1LVA A;  4I0B A;  5E8G A;  1QZY A;  4P9F A;  3BY6 A;  1ON1 A;  3N4M A;  2OQR A;  4HZF A;  2DK8 A;  1FPQ A;  1J9I A;  3E5X A;  3LA2 A;  5EEH A;  2MH2 A;  1DDN A;  5E8I A;  4ZYG A;  2NS0 A;  5ICC A;  1SFX A;  4IJA A;  1G6N A;  4GYG A;  4P96 A;  1HW2 A;  2ELH A;  3J81 Z;  4B8X A;  3GW2 A;  2ACJ A;  1XD7 A;  4Y13 A;  3CJN A;  3V4G A; 
#chains in the Genus database with same CATH topology
 2R7X A;  3LOC A;  4Y15 A;  1T56 A;  1U6G A;  4BE1 A;  4OMY A;  3OR1 C;  2HPM A;  3EUA A;  3OSF A;  3TDZ C;  1S29 A;  3QRF F;  2Z1D A;  2WBM A;  3H35 A;  3ZMT A;  2Z5U A;  2D1V A;  2NOG A;  1V5E A;  2DOE A;  2X1E A;  2R7W A;  3EUH A;  4H4K C;  4A0Z A;  2GA1 A;  5A2Q K;  4A69 C;  1GXQ A;  5F0F A;  1JGS A;  1JTX A;  1I3A A;  3NAU A;  4I99 C;  3TW6 A;  3ZCO A;  2DA6 A;  3PNV A;  1FT9 A;  2RQQ A;  3JSP A;  4HF2 A;  1GUU A;  3KE2 A;  3TL4 X;  3DLA A;  5DD8 A;  3SEQ A;  2HQ5 A;  3U9G A;  2C6Y A;  2XKP A;  2FNP A;  1N25 A;  3N97 A;  2HOE A;  2EV6 A;  4Y4R A;  5HS8 A;  1JT6 A;  3SDB A;  2K5C A;  2XB5 A;  4W1U A;  2BZT A;  1QVU A;  2J5O A;  3JTH A;  1MH3 A;  5J3L A;  2IJL A;  2K9N A;  5HNF A;  3KLO A;  1I6H J;  1U5T C;  5CJ9 A;  4XIC A;  2W57 A;  4MHG A;  2F48 A;  3ZXS A;  4XRF A;  4QPQ A;  1GDT A;  1SVL A;  2Z33 A;  4XLC A;  4UUS B;  4AU7 A;  1KZH A;  3LA7 A;  3V7R A;  2ISY A;  4KIS A;  4F91 B;  1A04 A;  3E0J B;  5HOD A;  5HDG A;  4C3H J;  4CA0 A;  1DP7 P;  2VC1 A;  1ZRC A;  2DMU A;  2PMZ N;  2IA2 A;  3HRT A;  5HLG A;  3HRU A;  4C2U A;  2R7T A;  4BXF A;  3T5X A;  2L7M P;  4RAG A;  4G8X A;  3I56 I;  3E6C C;  5JLW A;  2F5D A;  2L4A A;  2W1O A;  2QWW A;  3CLO A;  1WI3 A;  2DMN A;  3D5L A;  2Q1Z B;  4Z2Y A;  5FLX Z;  3S17 J;  4YFN F;  1IV6 A;  4Y52 J;  3NEU A;  5FB2 A;  3IC7 A;  3ULQ B;  2WA0 A;  1R6R A;  2FD5 A;  2H8W A;  2STT A;  4XN0 A;  5BNG A;  1B72 B;  2IA1 A;  2NAZ A;  3V42 A;  5M3F J;  2Z99 A;  4R79 A;  4UUS A;  1H89 C;  4RA2 A;  2V7F A;  1EH7 A;  2MFZ A;  5D6F A;  1TWF J;  2F4O B;  2WAQ N;  2ZNZ A;  3HHG A;  3WG7 H;  1W5T A;  4IQ4 A;  3G1O A;  4BAY A;  4CCL A;  1WH5 A;  2CUZ A;  2LYC A;  4ASN A;  3FBI B;  3U1K A;  3PFY A;  3D5S C;  1I1S A;  3SHF A;  3BR5 A;  3ZR8 X;  3BCB A;  4A6D A;  4GXO A;  1FSH A;  1IC8 A;  1VQ5 I;  4XNF A;  1Z3Y A;  3G2B A;  3R4K A;  3G4S I;  4PFO A;  2A6H F;  2V79 A;  3WE3 A;  4DBR A;  1P4A A;  2P0W A;  3QOE A;  2EFO A;  2K3F A;  2OJE D;  1MKM A;  3Q9V A;  3HOZ J;  2ZME A;  1B72 A;  3HOT A;  4LG3 A;  2MH9 A;  1IRF A;  4UVC A;  4AD9 A;  3W2W A;  3K1M A;  4QLC U;  2CW8 A;  3UR3 C;  3D5R C;  1MBJ A;  3VB2 A;  1X2M A;  2CMP A;  2X6W A;  2QBY B;  1K6O A;  3E6M A;  1HDD C;  2ZBK A;  3F8B A;  1YS7 A;  4XKW A;  2E1C A;  1S8N A;  2WTE A;  1SFU A;  2BBY A;  3SJM A;  2O3F A;  2EIM H;  3KZZ A;  2VJI A;  3CDL A;  4G7H F;  1XC5 A;  2O5R A;  2KFD A;  3G1M A;  3VYS B;  1A6I A;  3C1D A;  1UCR A;  3WG9 A;  4DZJ A;  1WJB A;  3C7J A;  3CQZ J;  1OPC A;  3KX2 A;  3VOD A;  4N0B A;  1K83 J;  4PUS A;  2GLO A;  1JJ6 C;  1IXC A;  2P81 A;  4M6X A;  5FJ8 J;  2ME6 A;  2VJJ A;  4I98 B;  2FXA A;  4XKC A;  5JVG F;  2LD5 A;  5E3N A;  2VE8 A;  3KPH A;  1A6Q A;  1JXS A;  2DAO A;  3H0D A;  2EZL A;  1XCB A;  4HST A;  3J80 Z;  3ZGK A;  5FD6 A;  1BBY A;  2RRE A;  2R7V A;  1R49 A;  1TNS A;  3VWB A;  1CF7 B;  2XAF A;  2W24 A;  1ZRD A;  5FKN A;  2BHY A;  2JA7 J;  2A3S A;  4HNV A;  1JKR C;  2M0C A;  3FXO A;  1B9N A;  1MZB A;  4RB0 A;  4PK4 A;  1P92 A;  2WB1 N;  2XSJ C;  2EIN H;  2Y2Z A;  1XSD A;  4GFB A;  2OTJ I;  1TBX A;  2XIG A;  2IS6 A;  3E6D A;  1LE8 B;  1LVK A;  3ASO H;  4GO1 A;  3PNY A;  3WTZ A;  4A2U A;  5FO5 A;  1BI1 A;  3K4L A;  5EEA A;  3LAP A;  3S3M A;  3MZ8 A;  3GLL A;  1PJR A;  3W3C A;  2HGC A;  1KU7 A;  2A07 F;  2XAS A;  3H1C A;  5L3C A;  1RZ4 A;  2XGX A;  3NWT A;  1WVR A;  3HUG A;  2XHK A;  1T6S A;  2IVM A;  4CCJ A;  3DTK A;  1WCM J;  1D8J A;  5GAE J;  1AA7 A;  3CCU I;  2E34 A;  5J8C A;  1TTY A;  3JRA A;  5LGU A;  1BW6 A;  4M3F A;  3SEZ A;  3FZV A;  3GLX A;  3HG9 A;  3HHH A;  5TGT A;  4FTH A;  2R92 J;  3EUH C;  1Z77 A;  2G9W A;  2IGK A;  1LE8 A;  3CCQ I;  2W84 A;  1ZLJ A;  3DEU A;  1S5L C;  1Z21 A;  4LK1 F;  3GFM A;  4A3K J;  4IRI A;  1R23 A;  5LHI A;  1GVJ A;  1DUX C;  3DKW A;  4ZYA A;  3TO9 A;  2VXZ A;  3ELK A;  3H5A A;  4DW6 A;  3DTI A;  3CME I;  3OV8 A;  2HDW A;  4EEF G;  5HLH A;  4IOC F;  2FOW A;  5CVU A;  3DF8 A;  1I27 A;  2B7E A;  3F22 A;  1OR7 A;  2M9H A;  4I0A A;  4OIO F;  1YJW I;  3F8M A;  3M07 A;  2HKO A;  3EUK L;  2DMT A;  4P1W A;  4U7D A;  1YQA A;  3OIP A;  4E7S A;  3L2U A;  1A35 A;  1Z6R A;  3K9T A;  2FSW A;  4IX7 A;  2O8K A;  3GFL A;  3IRQ A;  2BEO A;  1XDS A;  3WTT C;  2P6T A;  4F3Q A;  1TLH B;  1MNM C;  3EQL F;  1REP C;  1IAW A;  4KMF A;  3VDX A;  4BJT A;  3TO7 A;  1UEL B;  2E5Z A;  4ZTJ A;  2O6G E;  4HQM A;  3IWZ A;  4RB1 A;  1VQN I;  4N9I A;  4WCG A;  1L3L A;  3E3V A;  1XX5 A;  4ESF A;  4RB3 C;  1ETW A;  1RIO H;  1R1T A;  2E19 A;  3GTM J;  4M6Y A;  3OYI A;  4Q47 A;  3PIP F;  2FQ4 A;  3GZ5 A;  3JCU C;  2K3P A;  1ZGJ A;  3FXU A;  2UXN A;  4HSR A;  1Z1D A;  4XOT A;  4KYW A;  2R7O A;  4JP0 A;  3CUO A;  1YIO A;  2GM4 A;  3TMO A;  3HZJ A;  3OY9 A;  4E4H A;  1Z91 A;  2YU3 A;  4F7Z A;  4Q4Z F;  5DUK A;  3K1P A;  1YI2 I;  1ON2 A;  1XMX A;  3MWM A;  1FEX A;  1MND A;  1TZL A;  4ENJ A;  3M1C A;  5DCF A;  4E7H A;  3S16 J;  2EZH A;  3O8H A;  2KQR A;  1D1A A;  3WGI A;  5ICG A;  3UNG C;  2K86 A;  3C18 A;  4A3F J;  1P9Q C;  4MQ9 F;  3Q0W A;  3AG1 H;  3GCM A;  2LMD A;  4E7Z A;  4B43 A;  3K70 D;  2W85 A;  3GYH X;  1OFC X;  1X3W B;  4JOM A;  3ONQ A;  2JRM A;  2QQB A;  1FIP A;  2EIJ H;  5LLQ A;  4C2M J;  1UB9 A;  3CJT B;  3NQO A;  1SEU A;  1XCV A;  2EK5 A;  3CP2 A;  2R5Z B;  3I59 B;  3RDI A;  2DDA A;  2CV1 A;  1KU3 A;  2RQP A;  2VAS A;  1YRN B;  1U9N A;  2W48 A;  3SXY A;  1SC7 A;  4XON A;  4IOA F;  3T0Y A;  2MD5 A;  5IYC J;  1P6R A;  2KP6 A;  2HDD A;  2IXS A;  1S6L A;  2P4W A;  1TW2 A;  1K78 B;  4Y33 A;  2VBX A;  1PUF A;  4S0H B;  1BI0 A;  1J7K A;  2FBI A;  3FIS A;  4AIH A;  3Q5F A;  2VQL A;  5LHH A;  2DN0 A;  5E3L A;  2OCC H;  4BHB A;  4HDU A;  3MZH A;  3QOP A;  2HOS A;  1IV8 A;  1ZRE A;  1UMQ A;  2HXI A;  2LKS A;  2H1L A;  4PJL A;  4KIC A;  4RM2 A;  2FU4 A;  5D5W B;  4D1Q A;  3F8C A;  4S04 A;  2R5Z A;  3ML6 A;  2M7B A;  2XRN A;  5CPR B;  2CQX A;  3EYI A;  3WU1 B;  3BCA A;  1YRN A;  4P5O A;  5BMZ A;  5LBQ A;  3KLN A;  4B44 A;  4HPQ A;  1HA8 A;  4V19 K;  1FP1 D;  4D5F A;  4A3B J;  3LAJ A;  4LOC A;  4HNU A;  4BDY A;  1K78 A;  3TQN A;  5LRS A;  2V4J C;  2K9M A;  2NXN B;  3RKW A;  3M8J A;  4CGZ A;  2IGM A;  5D4R A;  4KJZ A;  1Z05 A;  4ZYD A;  1LEB A;  3ISP A;  5M5Y J;  1MBE A;  3HKZ A;  5H2F C;  4K2E A;  2DPU A;  1YYV A;  3PQJ A;  3DV8 A;  3TBI A;  1NHA A;  4UUT A;  4DNC A;  5D8L B;  1L0O C;  3OYH A;  1YJ9 I;  4M9X A;  3G6E I;  5K5R A;  1I39 A;  1U2W A;  2R3S A;  2RGV A;  4KIF A;  1U8R A;  2LY9 A;  2K85 A;  4MFD A;  1AU7 A;  2XSD C;  1QHG A;  4S05 A;  3RPU A;  3JAM Z;  2JA8 J;  1WHU A;  2XF7 A;  2RAE A;  3AG2 H;  4KN7 X;  1ETO A;  5ERI A;  4L9J A;  3L1P A;  3GXO A;  2L9S A;  4QWQ A;  1PDN C;  2LK2 A;  2VLA A;  4CZZ A;  3D0S A;  3PNT A;  1GT0 C;  2Q8K A;  3E5Q A;  1E0E A;  3R0A A;  1BR1 A;  4WWC A;  3MKY B;  1RKW A;  2AQF A;  1R58 A;  3AAF A;  4LD5 A;  4CYC B;  2BOL A;  2K9S A;  1HW5 A;  1MJA A;  2ZSI B;  2HU9 A;  4IVN A;  4EVI A;  3HTS B;  1TWC J;  2HNH A;  4YRV A;  4HW0 A;  3LFU A;  4UVB A;  3DWL E;  2A5Y B;  3CCE I;  1BIB A;  1BM9 A;  4U88 A;  1W0U A;  2X4H A;  1RKT A;  1YG2 A;  2X1C A;  3ZMD A;  2R93 J;  2RDP A;  1FNN A;  2RN7 A;  3MCZ A;  1OR7 C;  4KT5 C;  1OCC H;  2E1O A;  1P4X A;  2JJ7 A;  5D6E A;  4J19 A;  3IH3 A;  4XRS G;  3CCL I;  2K9L A;  2KKO A;  4IHX A;  4KDP A;  4BQO A;  5J4V A;  4OIQ F;  1YO5 C;  2VQC A;  1R5H A;  2R4G A;  4M3B A;  5D5V B;  4LLN A;  3HJE A;  2OA4 A;  1IXS B;  2GIZ A;  3P9K A;  4EM2 A;  1Q1H A;  5E79 C;  1SFO J;  3ZQC A;  1T8I A;  1FBQ A;  3HRS A;  2ME0 A;  1JUS A;  2LP0 A;  3OYM A;  3OYK A;  1S3J A;  3ABT A;  3BJO A;  4HF1 A;  3BZ6 A;  3DFG A;  2EFW A;  2VL8 A;  1R36 A;  1SD5 A;  1K4S A;  2H94 A;  3DU6 A;  2QUF A;  1ACI A;  1KGS A;  1EV7 A;  4UB8 C;  1X3Z B;  5H6R A;  1OCR H;  3L00 A;  2PI0 A;  4XL9 A;  3ZN0 A;  2VI6 A;  3I54 A;  3I55 I;  5J1U A;  2YUS A;  1ZGW A;  4YEL A;  5IP7 J;  2M87 A;  2YSR A;  1O7F A;  1V5F A;  1RRJ A;  4HQE A;  1ETK A;  4E6K G;  1X1B A;  5F0C A;  4CZC A;  2E2I J;  3CC2 I;  3H5R A;  3OOU A;  2KIS A;  2MC3 A;  3OYN A;  1XG1 A;  4XLP F;  3QYE A;  2LY1 A;  3J7Y J;  1FZP B;  2FF4 A;  1TNT A;  5FLM J;  3VYT B;  2NS8 A;  3K6G A;  3BRO A;  3I71 A;  1U3E M;  4Q48 A;  2R7D A;  2HPI A;  1O57 A;  5H6Q A;  3FBN B;  3WU2 C;  5BPD A;  1S7O A;  3QYB A;  5JLX A;  4QTR A;  2ISZ A;  1U8B A;  4Q5S F;  4ZDP A;  2YR2 A;  2KDO A;  5GPC A;  3HBL A;  4CCN A;  4CYD A;  2E60 A;  3Q9S A;  1DU0 A;  1IRX A;  4IHY A;  3SFZ A;  5LEJ A;  2IA0 A;  2VOP A;  3EET A;  4ZTF A;  2YPR A;  1IUF A;  1FX7 A;  3R6S A;  1JUP A;  4C30 A;  3K4C A;  2GXA A;  1DPR A;  1WPK A;  3REO A;  2ZKZ A;  3C3W A;  4B1R A;  3KYD B;  2DA4 A;  1ZH5 A;  1ERD A;  5B3S H;  3IV5 A;  2CQQ A;  2H09 A;  3DU5 A;  4BJ5 C;  1MW7 A;  2BY0 A;  4XKV A;  4DYC A;  4JBA A;  5L3B A;  3S2W A;  4V2F A;  3OYC A;  3FXQ A;  1G3S A;  2CYY A;  1HLV A;  3D1N I;  2DI3 A;  2M34 A;  2PQ8 A;  4B3A A;  1RUO A;  2P7V B;  2LTP A;  2HTS A;  3DPT A;  1RR8 C;  3ZQF A;  4KIT B;  2LRD A;  3KEQ A;  2M2E A;  4ZC3 A;  1N75 A;  2O03 A;  3AG3 H;  4RBO A;  4DQ2 A;  2XGC A;  3OL3 A;  4G7Z F;  2P5L C;  4ESB A;  5CLS A;  2K7L A;  2GAU A;  1R5G A;  2CGP A;  1FOK A;  5FFZ A;  4FX4 A;  1ULY A;  2M8G X;  3MD2 A;  2KZG A;  4Y7N J;  5JR3 A;  3BDD A;  2KJB A;  5DTD A;  1TP4 A;  3HM5 A;  1PP8 F;  4GDF A;  3BJA A;  3R61 A;  5F6F A;  3TOA A;  4JX5 A;  3SZG A;  1XSV A;  1MH4 A;  3H5N A;  2L01 A;  1RET A;  2AO9 A;  1Y39 A;  3FDY A;  3CCR I;  1N77 A;  2L7Z A;  1J5Y A;  2RNJ A;  1K61 A;  2JPB A;  2LDU A;  2L2O A;  3DP7 A;  4M72 A;  4BQQ A;  1FC3 A;  1XGO A;  5ICF A;  1H88 C;  3BTI A;  2ICW G;  2L54 A;  5F1R A;  5GTI C;  4L18 B;  2DK5 A;  2FNA A;  3A1Y A;  1T95 A;  3C2G A;  3WHB A;  2QYO A;  3BR2 A;  1LFU P;  2DYS H;  1ONV A;  2HQR A;  1JKO C;  3BTJ A;  3LQQ A;  3COA C;  3ABM H;  2BGC A;  3J7A Y;  2BY2 A;  4AM3 A;  1EKE A;  1OYW A;  2CS3 A;  2LC2 A;  5JFR A;  3W2A A;  2DMQ A;  3K0L A;  4P55 A;  3ZMV A;  2EZK A;  3P9C A;  1MBK A;  2V26 A;  4PCQ A;  1W7P B;  2CQN A;  2DPD A;  5D5X B;  2XAQ A;  3VOE A;  3WHC A;  3C2B A;  4BE2 A;  2JUC A;  2MLK A;  4FQG A;  3PUF A;  3HDD A;  3RKQ A;  3E7L A;  2R5Y B;  3RIR A;  2PJR B;  1OJL A;  1ZN2 A;  4MLO A;  2E1N A;  3FM3 A;  1IXR C;  3GTL J;  2OC6 A;  3QQA A;  1B1B A;  2FMY A;  3IKT A;  3HOX J;  2MLG A;  2XUB A;  2LBF B;  4OAY A;  2G0E A;  1JJ8 C;  5AON A;  4F92 B;  2WY8 Q;  4BHC A;  2RV8 A;  3RJP A;  3GF2 A;  1S9H A;  1FY7 A;  3FXK A;  2KRF A;  3BQY A;  3T8T A;  3VYU B;  4XK4 A;  4ZZD A;  3CD6 I;  2I8D A;  2NYX A;  1W7P A;  3V7C A;  1HSJ A;  1Z7L A;  2KIF A;  9ANT A;  3TDU C;  3VSL A;  4D7M A;  1WI9 A;  4M6V A;  2CUE A;  2B63 J;  3F72 A;  2R7S A;  4B4C A;  2PBI A;  4M74 A;  2R5Y A;  2VOO A;  1I6X A;  2KL4 A;  5K1Y A;  2PJR A;  3ABK H;  3F0C A;  4ZZL A;  3BG7 A;  2X85 A;  4LLG F;  4X1E A;  3RSN A;  3MQ0 A;  3WGH A;  2R7Z J;  2ZME B;  3OSG A;  1ZGA A;  1I5Z A;  4RGX A;  3BZC A;  2MD0 A;  1IRG A;  1WKM A;  2FUG 2;  4B3X A;  1YW8 A;  4ENM A;  3IH2 A;  1D5Y A;  2E1M B;  2LBF A;  3OL4 A;  2KPM A;  4Z6Y A;  1B4A A;  3K4M A;  2XRO A;  2WV0 A;  1E17 A;  2BXY A;  3CF5 F;  2KJC A;  3TED A;  2K4J A;  3H36 A;  1WJD A;  2VXD A;  3BG9 A;  2NVU B;  4NQW B;  1GHC A;  4HAM A;  2J5P A;  5HDK A;  2PFB A;  3PJR A;  2NS7 A;  3LSG A;  1V5G A;  3O2P E;  3MEX A;  4V2G A;  4UHT A;  4LIV A;  2QCO A;  1D3Y A;  4HF0 A;  1BJA A;  3Q0U A;  3OYA A;  3FX3 A;  1YIT I;  1FLI A;  3K2A A;  3LFK A;  4AYB A;  3FXR A;  2L5Q A;  3S1Q J;  1UZC A;  3WE2 A;  4RLQ A;  3HL2 A;  1KYW A;  3GFJ A;  5F64 A;  1H9T A;  3FK6 A;  4ABZ A;  4KN4 X;  2JSC A;  1FOY A;  2HYJ A;  1LQ1 A;  3BG6 A;  3MKW B;  4MIM A;  4RDU A;  3EDP A;  2STW A;  1RC9 A;  3K69 A;  4NQW A;  3F23 A;  4RGS A;  1JHF A;  3PSI A;  4CUG A;  1IF1 A;  4A93 J;  2DJN A;  3HEF A;  4L5E A;  2PEX A;  4RM3 A;  4G94 A;  5E1W A;  1X4O A;  3ABL H;  3QU6 A;  5KNL A;  2QKL B;  3WTX C;  3DTE A;  2XRL A;  3BT9 A;  2DU9 A;  1RNL A;  5JVT A;  4CDG A;  3BTL A;  2CH0 A;  3GZN B;  2JUG A;  3FKJ A;  4DOZ A;  2DTZ A;  1PUE E;  4RAF A;  1IRZ A;  2OTL I;  5EGO B;  4Y3O A;  1V55 H;  4BUP A;  1VQL I;  2K40 A;  3HUG B;  4OIP F;  2DO7 A;  2HR3 A;  4LG0 B;  3HPH A;  4ON0 A;  4EV0 A;  3FXJ A;  1Y8R B;  5FKM A;  2VKD A;  2VT3 A;  3CJR B;  1BI2 A;  2BVL A;  5C44 J;  2O8X A;  2GIV A;  4E7J A;  2TRT A;  3QPT A;  1ZRF A;  2AHQ A;  3K4J A;  3W6K B;  2FX0 A;  3AFH A;  4QSH A;  4UY8 I;  4CCO A;  2P7C B;  2ELJ A;  3BR6 A;  4B47 A;  4MGR A;  3HTU A;  1MJ9 A;  2HI3 A;  1PP7 U;  4ZYE A;  2EPF A;  3MAJ A;  2VC0 A;  4BH9 A;  3OYE A;  2FEZ A;  4G6D A;  3G73 A;  1VQ7 I;  3SDG A;  4BS9 A;  3DQV C;  4ETS A;  3GEZ A;  3OYJ A;  2WC2 A;  1B59 A;  4DIQ A;  1R1V A;  2ZCW A;  3OIO A;  1U78 A;  1MJB A;  3K7A J;  4M9Z A;  5IT3 A;  3LSI A;  1QPM A;  3KP7 A;  2V9V A;  5EGO A;  2Z16 A;  2ZO4 A;  2JA2 A;  2IGO A;  2ZJ2 A;  5GAD J;  2LNB A;  2ECC A;  2P5K A;  4LG0 A;  2EH3 A;  5K5O A;  2VBZ A;  3GO5 A;  2IBD A;  5F08 A;  1YIJ I;  3G3Z A;  1WJE A;  3WOD F;  2CFX A;  2GXB A;  3DBR B;  3ESW B;  3KCC A;  1OMI A;  1X1D A;  4UV9 A;  5KK1 A;  2XAG A;  1JUM A;  1IG7 A;  2K9Q A;  1DGW Y;  1DQU A;  2XPV A;  5F04 A;  3WGG A;  4C9Y A;  1BC8 C;  4XSX F;  3Q0V A;  2OAZ A;  2KLO A;  1HC8 A;  2R0Q C;  1O4X A;  2MA3 A;  2IEK A;  4FIS A;  2DXI A;  3F3X A;  1V54 H;  5B1A H;  4I6Z A;  1R5I D;  4FX0 A;  3ERE D;  1I50 J;  3I9V 2;  1QRY A;  5CQG A;  2KIU A;  5J47 A;  4XQF A;  4HOB A;  3M7G A;  3GTG J;  3ZN1 A;  1J75 A;  2QVO A;  2OCE A;  3F6O A;  3DCF A;  4PZJ A;  5A2Q Z;  3BR0 A;  5FRM A;  1YW9 A;  1KQ9 A;  2HEO A;  4NC8 A;  1F1Z A;  3BPV A;  3QWL A;  3KP3 A;  1J59 A;  3IWF A;  2ESH A;  2ZNY A;  4PGG A;  4OAZ A;  3JR9 A;  2JWT A;  2X6X A;  1IN8 A;  3CZ6 A;  3PIO F;  1A31 A;  3H3V K;  2L9V A;  4W97 A;  2XDV A;  4A3E J;  1WGX A;  2DT6 A;  3MZY A;  1G3Y A;  2NOJ B;  4F93 B;  2HVR A;  2PG4 A;  2LKP A;  4UUV A;  3S1N J;  3CDH A;  1WZ2 A;  2A6E F;  3HB9 A;  4XLH A;  1OCP A;  5AIP A;  2ZJR F;  1D1B A;  3HKZ N;  3CMY A;  3LSP A;  1XTA A;  2L7K A;  1GLN A;  1G3W A;  4HX8 A;  2A6T A;  2MAB A;  4BY7 J;  2DA5 A;  4ZJZ A;  2EA2 A;  1TL8 A;  3I5U A;  2IPQ X;  1K79 A;  3WTW C;  5BOX A;  5E3M A;  1HST A;  1VTN C;  2VOD A;  3HYI A;  1QZZ A;  3FKI J;  1SAN A;  2DCE A;  4YFX F;  3HOU J;  4ZDO A;  2V1D A;  3S2H J;  1E2X A;  1F36 A;  3L2C A;  4BBS J;  3MVP A;  3B6A A;  3CMA I;  2W00 A;  5IP6 A;  3BR3 A;  4FET A;  1R1U A;  2V9K A;  1A36 A;  1ETV A;  1WQ2 A;  2CW7 A;  1X1C A;  2DFF A;  1WJA A;  2ZXH A;  1OYI A;  3SZT A;  2LFB A;  1FOW A;  1VQ8 I;  4PJJ A;  1XMA A;  2GOX B;  3GBG A;  1PUF B;  3K1N A;  1VZ0 A;  4KT6 A;  1LPQ A;  2EFQ A;  3R60 A;  4IQJ A;  2VKH A;  2G7H A;  5DD4 A;  1O3T A;  1PYV A;  3SFI A;  3M8E A;  1NK2 P;  1TQM A;  1MDM A;  3AL0 B;  2L9R A;  1J09 A;  2KHM A;  2WV1 A;  3WTS C;  2ZME C;  1MMG A;  1F5T A;  3CC4 I;  1P7J A;  4RAY A;  2X1D A;  1UG2 A;  3LSM A;  4A3C J;  1JT0 A;  1WJ5 A;  4WXC A;  1MNE A;  3BC8 A;  1K6Y A;  2W82 A;  2E1M C;  4XLF A;  4BDZ A;  1C0W A;  2O9L A;  2LF8 A;  4I2O A;  1X3U A;  4CCK A;  5K7H A;  3NRV A;  1O3Q A;  2E2H J;  4RGR A;  2QLZ A;  3HXL A;  5IOY A;  1MSF C;  4HBL A;  2DJI A;  3S8P A;  4UVA A;  4LIU A;  4NB5 A;  1ZG5 A;  1G3T A;  4LB6 B;  5KHD A;  2DOA A;  4IF4 A;  4EAT A;  2FJ1 A;  2HVQ A;  4TV7 A;  5EJC A;  3G1L A;  1QHH D;  4A3G J;  5IPA A;  1FYL A;  1XDU A;  2GZW A;  2NRA C;  3S1M J;  2FOK A;  2H27 A;  4BJ6 C;  4HV5 A;  1WH7 A;  3OS0 A;  1YOV B;  1QNT A;  2Y0S A;  2HKX A;  2K4B A;  1IJW C;  1LDD A;  4BY1 J;  1GV5 A;  2IP2 A;  2QQA A;  3CCM I;  2JMW A;  1VQ6 I;  1SVM A;  4DYR A;  4LJZ F;  3KP2 A;  5GAG J;  5HLI A;  1R00 A;  4WXH A;  5HLT A;  4A5N A;  1LEA A;  1HQC A;  4A0Y A;  3JRB A;  1AWC A;  4HX7 A;  2VON A;  3SQN A;  3JTG A;  3VYR B;  4CXF A;  3BPX A;  4HV6 A;  2FRH A;  2OQG A;  1MMA A;  2X6Y A;  4XKB A;  2PMH A;  5D4S A;  3KYL A;  1HKT A;  2BHZ A;  1V4R A;  4HDV A;  4ESJ A;  2ZJP F;  1U0J A;  1GVD A;  1ZKG A;  3P9I A;  1SAX A;  1ZLK A;  2UV1 A;  3LMM A;  3OIQ A;  4BQA A;  1ZQ3 P;  5J8F A;  2W25 A;  5JHU A;  1MMS A;  3RKX A;  4J00 A;  4HA8 A;  4DJA A;  1MSE C;  4CO8 A;  5LEK A;  4KNY A;  3ZOB A;  1OIS A;  3FWE A;  1O7L A;  3HIF A;  3OWT A;  2IT0 A;  2DFH A;  3GTJ J;  4MEY F;  1FJL A;  3I3L A;  4D7N A;  2O61 A;  1RR7 A;  1MBG A;  3J81 K;  3CCJ I;  2MG4 A;  5JHF A;  4Y17 A;  1ETQ A;  2IS2 A;  1TT5 B;  2L0K A;  4BU2 A;  3JRC A;  1VQ4 I;  4UV8 A;  2D5V A;  2OZ6 A;  2MYS A;  1SD6 A;  1G4D A;  4HLX A;  2RKH A;  2H6B A;  3KZY A;  2FML A;  3QU3 A;  1W36 C;  5IOZ A;  2K02 A;  3GX4 X;  3DPL C;  3IP4 B;  3GTO J;  2L7F P;  4O5V A;  1DGR M;  5J1R A;  2XGD A;  4FCY A;  4AWX B;  1D1C A;  1ETX A;  5DEQ A;  1W0T A;  2DA2 A;  2O7O A;  1KON A;  5IP9 J;  5HNH A;  5ED4 A;  2CU7 A;  2DOF A;  3CDI A;  4IEJ A;  2V1X A;  3M1E A;  3L2W A;  3GTP J;  2P8T A;  2BXZ A;  5F1J A;  1YX3 A;  1LFB A;  1QVT A;  3WTV C;  4PSX A;  3I4N J;  3RPQ A;  2DA3 A;  4OIR F;  2F2E A;  2F5C A;  2CO5 A;  5EF6 A;  3I4M J;  2Y69 H;  1ZAO A;  5B5E C;  1S72 I;  4AVZ A;  2EWN A;  3FK7 A;  4ENN A;  2DLL A;  3HGG A;  2JVG A;  4BKX A;  2XPU A;  1HCR A;  2W7N A;  4M3E A;  2IGN A;  3L7W A;  4PSW A;  2XF6 A;  2P6S A;  3V7S A;  4BYY A;  1TW3 A;  4XSZ F;  2HYF A;  4IHV A;  5KVR A;  1U5T A;  2EFN A;  1VQ9 I;  3CCY A;  4C2T A;  3A4C A;  4HYE A;  1JKQ C;  3QP5 A;  5HVQ C;  2VPR A;  5TIS C;  4G7O F;  1WFX A;  1GXP A;  1BR4 A;  2DFE A;  2D2W A;  3J7Z I;  4A3I J;  4ZYH A;  2WY7 Q;  1W1W E;  1BOA A;  1AKH B;  2EFP A;  3HOV J;  1YE9 A;  2E7W A;  3VEP A;  1W5C C;  3NAR A;  3QPL A;  3S1R J;  3TKY A;  3BWG A;  2NNY A;  1EH8 A;  4D0P A;  1R4M B;  2FBH A;  3RTR A;  2IAI A;  3K4N A;  4OMZ A;  1Z3X A;  3P5J A;  4PDK A;  3BLY A;  1B6A A;  3BG5 A;  1VFC A;  3S14 J;  5FKK A;  1H8A C;  1JE8 A;  4XRS A;  2QQ9 A;  3ZQH A;  3JRF A;  4X6A J;  3ZQG A;  1R9T J;  3RCO A;  1OKR A;  2EV0 A;  2F5V A;  3PL8 A;  4NC6 A;  4YEJ A;  2V9P A;  1RPW A;  2COM A;  2X6O A;  4L9T A;  4MFE A;  3ZRG A;  4AIJ A;  5BQT A;  3K4K A;  4FAS D;  3S3O A;  2R7R A;  1BA5 A;  4IHW A;  3P7N A;  2N8G A;  2D1H A;  2VQG A;  1A5J A;  4FT8 A;  2PN6 A;  3GUD A;  1AKH A;  2DYR H;  3KZI C;  1HBX G;  3ABU A;  4XR6 A;  1QO0 D;  4EMS A;  4MQV A;  4AVP A;  4KUM A;  3V8K A;  3GME A;  1D0Y A;  4G6Q A;  2OPT A;  1ORK A;  1JHH A;  2RVC A;  2HXO A;  3ZQI A;  1HKQ A;  1Y0U A;  2M7A A;  3R0J A;  3LA3 A;  1X2N A;  2XPW A;  4XMY A;  4U7B A;  3LQR A;  1G59 A;  2IRF G;  2F5F A;  1LFP A;  1YW7 A;  1YFH A;  1UFM A;  2FBK A;  2L4M A;  3A03 A;  4JX4 A;  1IN4 A;  1WSU A;  3BQZ A;  1D0Z A;  3JRI A;  1S7E A;  3LSR A;  3AL0 C;  2VKV A;  2QM3 A;  5D8K B;  1W5S A;  2XGE A;  3I4P A;  4O3M A;  3RKY A;  1SVO A;  1ZYR F;  2DBB A;  2F6C A;  4AC0 A;  4AUX A;  4N4O B;  1EA3 A;  3DBH B;  2MC4 A;  5DS9 A;  2XAU A;  1Z67 A;  3F21 A;  4IRG A;  2M4K A;  2JRT A;  3H0G J;  2WWY A;  2XF5 A;  1KQ0 A;  3CTA A;  4YG2 F;  4BAC A;  1SFE A;  1TQI A;  2ZFW A;  2QQ8 A;  2V1N A;  3VPR A;  1D5V A;  3LST A;  3MMY B;  4I7H A;  1X1A A;  2ESN A;  3J80 K;  1XPX A;  2A68 F;  4KIB A;  1HF0 A;  6PAX A;  3FMQ A;  2LY2 A;  1NG7 A;  3E1S A;  4HG2 A;  2A05 A;  1Z7U A;  3IH4 A;  1UJ8 A;  3PO3 J;  5J4Y A;  2HS5 A;  3UKG A;  2P5V A;  4GGG A;  1G8X A;  1OCT C;  1FTT A;  1KU2 A;  2I10 A;  3E5U A;  3L2R A;  2MBF A;  4IO9 F;  4KMU X;  2VJ4 A;  4UXN A;  3IL2 A;  2EIL H;  5EDN A;  3RQI A;  4AYB N;  1Z0X A;  3NWS A;  3ZMZ A;  4RGU A;  4WXD A;  1XN7 A;  1IN6 A;  5FGM A;  4IKF A;  1DP3 A;  3SZP A;  2Q2E B;  3TGN A;  1JTY A;  1QZE A;  3K10 A;  3GTQ J;  2GWR A;  3OYF A;  3IAS 2;  1T2K A;  4U0W A;  1ZHF A;  2H8R A;  1P4W A;  1LNW A;  1YLF A;  4U87 A;  1TT0 A;  1ZTR A;  2F4M B;  2D45 A;  3S32 A;  3FHN A;  2EJR A;  2QSF X;  2VB6 A;  3I58 A;  4GRI A;  4BXU A;  2HQN A;  4CIC A;  1X1P A;  1UST A;  2KIM A;  4HNT A;  3CUQ B;  4JYK A;  2KIQ A;  2DW4 A;  2DA1 A;  4YII A;  4E70 A;  4AIK A;  1FMV A;  1GV2 A;  1YX5 A;  1W4M A;  2GQQ A;  5IYB J;  1KU9 A;  1YHQ I;  4ITV A;  3W6V A;  2AXL A;  1XGN A;  2EZI A;  1DU6 A;  2NVY J;  4OU0 A;  3KP4 A;  3EPZ A;  3CCV I;  1QQI A;  2Q2E A;  1MBH A;  2IS1 A;  4CHU A;  4ENK A;  4BEH B;  3RZO J;  1LKX A;  2OU2 A;  2VBY A;  1FYK A;  3PUB A;  1B8I B;  3LSK A;  2GBY A;  2LKX A;  3L9F A;  2K27 A;  2Y0M A;  2LH9 A;  2YS9 A;  3MKZ A;  3MN2 A;  1G2H A;  4XLA A;  3H92 A;  3IAM 2;  1XGM A;  2M45 A;  5GAH J;  1SMT A;  5CQE A;  2KT0 A;  5DM6 F;  2CG4 A;  2GA2 A;  5DYM A;  3ZQQ A;  1TWH J;  3CUQ A;  1LJ9 A;  2L02 A;  1T98 A;  4R8H A;  3C2H A;  1T0F A;  4FHT A;  1KYZ A;  2WAE A;  4A6E A;  3A0H C;  1N78 A;  1JKP C;  5E17 F;  3RYR A;  3HRM A;  2M30 A;  4BEH A;  2EIK H;  4QPO A;  1OLT A;  1B8I A;  3TOB A;  1K7A A;  2XV4 S;  2KZV A;  4NBQ A;  5B66 C;  1BC7 C;  1O3S A;  3GWZ A;  5LRR A;  4IRH A;  2W4S A;  5EZG A;  3GZ6 A;  2HQA A;  2AQE A;  3K2Z A;  2EQR A;  1I1G A;  2E5N A;  2ID3 A;  3BTC A;  5C3E J;  5H20 A;  4R1H A;  4GCV A;  5C4J J;  1IN5 A;  2G7U A;  2YX4 A;  4P9U A;  2DA7 A;  3DBL B;  5E1Z B;  2E36 A;  4LLL A;  1ITY A;  2Y9Y A;  3QOD A;  1FP2 A;  1S7A A;  2A61 A;  4L5I A;  5L3D A;  5LGN A;  3ECH A;  4L0Y B;  2BW3 B;  4LGW A;  3HC7 A;  3DKX A;  3RQ4 A;  2CQ7 A;  3CO7 C;  4F52 A;  1HXD A;  2HWV A;  4WF2 A;  4EM0 B;  1Q1V A;  4H0E A;  1X19 A;  2F5E A;  3U1D A;  2QA4 I;  1IZ1 A;  4KFC A;  5J1Y A;  2VUM J;  4QIW N;  2KRC A;  2XAJ A;  3S93 A;  3B02 A;  2X48 A;  1X58 A;  1EH6 A;  1QBJ A;  2HZT A;  4G6T B;  1OCZ H;  1ODD A;  4NC7 A;  2ZC2 A;  2PJP A;  2ZB9 A;  2COB A;  1T38 A;  3GFI A;  2HVS A;  4A3D J;  4MO7 A;  1UHM A;  3WU0 A;  4UNO A;  3KEY A;  1P7I A;  1FWZ A;  1FMW A;  2BW3 A;  3JRE A;  2ID6 A;  2XAH A;  3ZMS A;  3EYY A;  1SMY F;  4NHJ A;  4XOP A;  2YU9 J;  4OIN F;  4IPA A;  2OBP A;  3BZK A;  3HGY A;  4ANJ A;  3A01 B;  2XB0 X;  2VT2 A;  2BVM A;  2EB7 A;  4L9V A;  2QEN A;  1B9M A;  4YIF A;  4DZP A;  1BW5 A;  4NDL A;  2EV5 A;  3Q3S A;  1XB4 A;  4A3J J;  3IUO A;  3RI4 A;  5DCM B;  2IW5 A;  4DGW B;  5L3E A;  1O3R A;  2JTV A;  4LIT A;  1ZEL A;  1T33 A;  1Z9C A;  1MBF A;  2QZ8 A;  3QPS A;  3VSK A;  1NK3 P;  3BJ6 A;  1XMK A;  4CSW A;  4WX9 A;  4A3L J;  1EF4 A;  3M4O J;  4II2 A;  1UG0 A;  2OV7 A;  2OD5 A;  2PLY A;  3HSR A;  2QBY A;  2CUJ A;  1WJC A;  4O6J A;  3LNQ A;  2DMP A;  2ZFU A;  2VPL A;  3IHU A;  2NNN A;  2GXG A;  4BGD A;  4IHS A;  1AOY A;  2BY3 A;  5BS6 A;  3BP8 A;  3KP5 A;  1D8K A;  2Y75 A;  1MGT A;  5GPA A;  4U0Y A;  3CES A;  4II3 A;  5F0H A;  2CQK A;  3S15 J;  3TP3 A;  3A01 A;  2PMZ A;  3HOW J;  3H9G A;  3OS2 A;  4DYQ A;  3OYG A;  4DBQ A;  1T08 B;  2R7Q A;  4NUB A;  5DUI A;  4EJO A;  5DCM A;  3TO6 A;  3OYD A;  1HW1 A;  3H3U A;  1M1E B;  2Z3Y A;  3JAM K;  4J01 A;  3A0B C;  4I76 A;  5HDN A;  5EYR A;  1BL0 A;  2HFH A;  1W7P D;  3QPH A;  1R7J A;  1MMD A;  1CF7 A;  4JQF A;  4M3G A;  2JN6 A;  2Y0S N;  3BG3 A;  2BE5 F;  2ZSH B;  3B73 A;  2WAQ A;  5KAF C;  3LSH A;  3U2R A;  3W6J B;  2UZK A;  2DTR A;  5DV5 A;  3T8R A;  3H3Z A;  1ZAR A;  1KA8 A;  1FTZ A;  3I64 A;  3ZMU A;  1ZR2 A;  3KEO A;  3ROU A;  2Q0O A;  2XVC A;  2JVH A;  1MD0 A;  2E7X A;  2GOM A;  1I3Q J;  4LMY A;  2QSG X;  1WWX A;  3MFK A;  3KP6 A;  3I0T A;  4B09 A;  2QSH X;  3HSF A;  2JSP A;  2MGQ A;  1VF9 A;  4KA4 A;  2HDC A;  4PJ0 C;  3G71 I;  4CCM A;  5C4X J;  3V8J A;  4RMN A;  3N05 A;  5FRN A;  2A69 F;  2HOA A;  3DLL F;  1LDK B;  1DPU A;  3T1B A;  5M5W J;  2TDX A;  1SD4 A;  4L9N A;  2X9D A;  3CUQ C;  3PQK A;  2JPC A;  3O8G A;  3CCS I;  2ZXI A;  5TRD A;  2V1U A;  1T0F C;  1FSE A;  1HKS A;  3OMY A;  4BL0 B;  3JSO A;  3BOQ A;  2RC4 A;  3F6V A;  3FXM A;  1MDM B;  4X0G A;  4CH7 A;  4RB2 C;  4N4N B;  2E2J J;  1POG A;  2LG4 A;  2CFO A;  5EZH A;  1CGP A;  2UXX A;  5KCM A;  2LVS A;  3WTU C;  3FIW A;  5CVI A;  5DDG A;  1NG6 A;  5FD5 A;  2LF7 A;  3JRG A;  4EJV A;  2OZU A;  2ZXW H;  2FQ3 A;  3VFZ A;  3QYF A;  4E7L A;  2NVT J;  2VJ5 A;  4EGZ A;  3JRD A;  4EGY A;  2LR8 A;  1Y0N A;  2TCT A;  5ICE A;  2B9S A;  1TQP A;  1XS9 A;  1VI0 A;  4EM1 A;  1ENH A;  2CV0 A;  5AIQ A;  5J40 A;  2VE9 A;  3ZQ7 A;  2DOD A;  5TJJ A;  2H6C A;  5ILV A;  2H1K A;  2UUZ A;  1IO2 A;  2HYG D;  3M3Y J;  2ELK A;  5E18 F;  2OF7 A;  3FMS A;  2JQ7 A;  4FE4 A;  1H9G A;  5F27 A;  5IT9 K;  3I53 A;  1Y6I A;  2LOO A;  1VQK I;  3WTY C;  2WB1 A;  2QEX I;  1R22 A;  1USS A;  3M8F A;  4HEA 2;  2CWE A;  4BBR J;  3S2D J;  1NH3 A;  4L5J A;  2MSY A;  4XLE A;  3QP6 A;  1U9O A;  4MTE A;  3J7A O;  1ETY A;  3E6B A;  2VN2 A;  3O6B B;  3W2V A;  3IRR A;  1FOX A;  4GYI A;  2MW8 A;  1RUN A;  4HRI A;  1BOB A;  2BYV E;  3X2Q H;  2KDZ A;  3F8N A;  2RNG A;  4KIG A;  2XKO A;  1D0X A;  1K4T A;  5CVJ A;  1YTY A;  2JA5 J;  3CP8 A;  4WK8 F;  3DXJ F;  3PO2 J;  5GTH C;  3FM5 A;  1QGP A;  3H9Q A;  1BI3 A;  1YS6 A;  4MNU A;  5JI6 A;  1T39 A;  5EG0 B;  2QGU A;  5B1B H;  3CC7 I;  1SFK A;  2LRE A;  2JT1 A;  3E97 A;  3M9A A;  2CRG A;  2Y30 A;  4M9S A;  2BV6 A;  3FF5 A;  5ILS A;  5L3F A;  3CO6 C;  5BPI A;  1NTC A;  2XC7 A;  2M0M A;  1F43 A;  4YFK F;  4M3D A;  2E71 A;  2L9N A;  3QAH A;  5K5Q A;  1JGG A;  1WJF A;  3K70 C;  1F9N A;  1IUY A;  1YJN I;  3ERM A;  1W36 D;  2FA5 A;  2VQH A;  2DFI A;  5LGT A;  1UHS A;  3KET A;  1ZR4 A;  2Z9O A;  1UHW A;  1OCO H;  5DM7 F;  3I59 A;  4OWR B;  5CVV A;  3FXL A;  2IS4 A;  3TW7 A;  2X51 A;  4ZH4 F;  2FE3 A;  3AG4 H;  5CVR A;  5LHG A;  4IHT A;  5E20 A;  5ILU A;  3IKV A;  5EG0 A;  1LUJ B;  3U21 A;  2CSO A;  5L3G A;  2HOT A;  1P2F A;  3LWF A;  1MMN A;  1XSX A;  4C3J J;  4A3M J;  4I01 A;  2VIX A;  4A0X A;  5FLV A;  2JA6 J;  1SD7 A;  4LFU A;  5CKT A;  3FHZ A;  5FKL A;  2M1B A;  3OYB A;  1Y1V J;  4PJM A;  1IW7 F;  5E1X A;  1F4K A;  3RYP A;  3JRH A;  2LLK A;  2HTJ A;  3OOP A;  5HS7 A;  2R7U A;  4A5M A;  3OYL A;  4EQQ A;  5IYD J;  1FBS A;  1U5T B;  4MTD A;  2HZD A;  2ECB A;  3V8L A;  1FYM A;  1ZK8 A;  2L3D A;  2NVX J;  1QU3 A;  1HOM A;  2M3A A;  2AS5 F;  4HX4 A;  2M4G A;  3HSE A;  5K7F A;  2B0L A;  2Y9Z A;  1KQ8 A;  2BY1 A;  4UB6 C;  2QKM B;  3GVA A;  4BHP A;  1BJZ A;  2DT5 A;  2EA4 A;  2JK3 A;  1IN7 A;  3HOY J;  5LD2 C;  2DDB A;  2UWM A;  3KYC B;  4N9H A;  4D5C A;  1STZ A;  1J0R A;  4LK0 F;  5D5U B;  5FRO A;  1VQO I;  4FE7 A;  4IXA A;  4PFP A;  2KRH A;  1QPI A;  2CV2 A;  4PGH A;  3JW4 A;  2DQL A;  3ZQL A;  4YIR X;  1WRJ A;  4RS8 A;  1J2X A;  2O0Y A;  3HOS A;  2V6E A;  2NVQ J;  3DPU A;  4JK1 X;  3ASN H;  5FLX K;  4XM3 A;  1OQY A;  5HS9 A;  3HPG A;  4CYC A;  5K7Z A;  1OYY A;  3AKZ A;  4XRM A;  5EEG A;  1RI7 A;  3ZP5 A;  5IY5 H;  1BN5 A;  1JI8 A;  3GTK J;  3LSJ A;  1LB2 A;  1APL C;  1Z6T A;  1TC3 C;  2F4I A;  3CMM A;  3OR2 C;  4C3I J;  3K4B A;  3BR1 A;  2WAD A;  3KFW X;  3A2K A;  3SYT A;  1FIA A;  1ZG3 A;  4EJU A;  2EBI A;  3PFI A;  3ZPL A;  1Y1W J;  4EJW A;  4RAZ A;  3PSF A;  4G9Y A;  2A5W A;  3MKL A;  1X4P A;  2M5W A;  4PJN A;  1EJ9 A;  4E7I A;  4BXX J;  2LSO A;  4BQN A;  1H0M A;  1XGS A;  2M8E A;  2V6C A;  5HOO A;  3DKY A;  2ADU A;  1AHD P;  4I02 A;  2YX7 A;  4HLY A;  1E3P A;  1TWA J;  2CW0 F;  4LB5 A;  2ZXJ A;  2R7F A;  2Y48 A;  1VQP I;  4XBF A;  1BIA A;  1BR2 A;  4D9J A;  1UAA A;  4G12 A;  4I09 A;  1CQT A;  2AXT C;  4MEX F;  2PX9 A;  3OS1 A;  3FMR A;  5IT9 Z;  2WAF A;  1PVE A;  2JZY A;  3PM1 A;  5CYV A;  4U0V A;  4BE0 A;  1SAU A;  1FBU A;  3KIO A;  1R71 A;  4E7K A;  1LDJ A;  1ZG1 A;  1QA6 A;  2VBW A;  4EJT A;  3O3K A;  1RES A;  5FFX A;  4XN3 A;  2DT7 B;  2CJJ A;  5E3O A;  2QF7 A;  2ZJQ F;  5LFA A;  4BNC A;  4OOI A;  5M3M J;  3F8F A;  2CUF A;  3ECO A;  5J6X A;  5M5X J;  1E3H A;  2Z2S B;  3H9J A;  1HDP A;  2KMU A;  2ETH A;  2X0L A;  2DQR A;  3F9K A;  3L09 A;  4M71 A;  3B6C A;  3DEE A;  1Y8Q B;  4RLF A;  4L0Z B;  4IZZ A;  3A02 A;  4A12 A;  5FKO A;  3TP0 A;  3RPU D;  4XLN F;  1Y56 A;  1V3F A;  1TWG J;  4M73 A;  2PMU A;  1LVA A;  4XOR A;  4I0B A;  5E8G A;  4JX6 A;  1QZY A;  4P9F A;  3CJQ B;  1IDY A;  1R4N B;  3BY6 A;  3LL7 A;  3CLQ A;  2OUM A;  1ON1 A;  2E35 A;  3N4M A;  3L2V A;  1MIJ A;  4IL6 C;  2VKE A;  2OQR A;  4HZF A;  2DK8 A;  1FPQ A;  1J9I A;  3RZD J;  3E5X A;  4NNJ A;  1E3O C;  4F55 A;  3LA2 A;  1IGN A;  5EEH A;  2MH2 A;  4AID A;  5E8I A;  1DDN A;  3S3N A;  4B48 A;  4ZYG A;  2NS0 A;  5ICC A;  1SFX A;  2I5U A;  4IJA A;  4ZDL A;  1G6N A;  4GYG A;  4P96 A;  1VND A;  5KAI C;  3DEW A;  1HW2 A;  3L2Q A;  2ELH A;  3J81 Z;  3CF2 A;  1VQM I;  4B8X A;  4XID A;  2Y31 A;  3GW2 A;  2ACJ A;  5GP9 A;  1XD7 A;  1IDZ A;  4Y13 A;  3CJN A;  3V4G A; 
#chains in the Genus database with same CATH homology
 4Y15 A;  1U6G A;  4OMY A;  3TDZ C;  1S29 A;  3QRF F;  3ZMT A;  2Z5U A;  2D1V A;  3EUH A;  4A0Z A;  2GA1 A;  5A2Q K;  1GXQ A;  1JGS A;  1FT9 A;  3JSP A;  4HF2 A;  3U9G A;  3KE2 A;  5DD8 A;  2C6Y A;  2XKP A;  2FNP A;  3N97 A;  2HOE A;  2EV6 A;  5HS8 A;  2J5O A;  3JTH A;  2IJL A;  3KLO A;  1U5T C;  5CJ9 A;  2W57 A;  4MHG A;  4XRF A;  2Z33 A;  3LA7 A;  3V7R A;  2ISY A;  1A04 A;  5HDG A;  1DP7 P;  2VC1 A;  1ZRC A;  3HRT A;  2IA2 A;  5HLG A;  3HRU A;  3T5X A;  4G8X A;  3E6C C;  2F5D A;  2L4A A;  2QWW A;  3CLO A;  3D5L A;  4Z2Y A;  5FLX Z;  4YFN F;  3NEU A;  5FB2 A;  3IC7 A;  3ULQ B;  2STT A;  2IA1 A;  2NAZ A;  2Z99 A;  4R79 A;  1EH7 A;  5D6F A;  2ZNZ A;  3HHG A;  1W5T A;  4BAY A;  4ASN A;  1I1S A;  3SHF A;  4A6D A;  4GXO A;  1FSH A;  3R4K A;  2A6H F;  2V79 A;  3WE3 A;  1P4A A;  2EFO A;  1MKM A;  3Q9V A;  2ZME A;  3HOT A;  2MH9 A;  1IRF A;  4UVC A;  4AD9 A;  3K1M A;  4QLC U;  3VB2 A;  2QBY B;  1K6O A;  3E6M A;  2ZBK A;  3F8B A;  1YS7 A;  2E1C A;  1S8N A;  2WTE A;  1SFU A;  2BBY A;  2O3F A;  3KZZ A;  4G7H F;  3C1D A;  1UCR A;  3WG9 A;  3C7J A;  1OPC A;  3VOD A;  4N0B A;  1IXC A;  4M6X A;  4I98 B;  2FXA A;  2VE8 A;  1JXS A;  2DAO A;  1XCB A;  3J80 Z;  5FD6 A;  1BBY A;  1TNS A;  1CF7 B;  2XAF A;  2W24 A;  1ZRD A;  2A3S A;  1B9N A;  1MZB A;  4RB0 A;  1P92 A;  1XSD A;  1TBX A;  2XIG A;  3E6D A;  4GO1 A;  3WTZ A;  3LAP A;  4A2U A;  5FO5 A;  1BI1 A;  4IHS A;  2HGC A;  1KU7 A;  2A07 F;  2XAS A;  5L3C A;  1RZ4 A;  2XGX A;  3HUG A;  2XHK A;  1T6S A;  2IVM A;  1D8J A;  5J8C A;  1TTY A;  5LGU A;  3FZV A;  3GLX A;  3HHH A;  2G9W A;  2W84 A;  1ZLJ A;  3DEU A;  4LK1 F;  3GFM A;  4IRI A;  1R23 A;  5LHI A;  1GVJ A;  1DUX C;  3DKW A;  3TO9 A;  2VXZ A;  3ELK A;  3OV8 A;  5HLH A;  5CVU A;  3DF8 A;  1I27 A;  3F22 A;  1OR7 A;  4I0A A;  4OIO F;  3F8M A;  2HKO A;  4U7D A;  1YQA A;  1Z6R A;  3K9T A;  2FSW A;  3GFL A;  3IRQ A;  2BEO A;  1XDS A;  3WTT C;  2P6T A;  1TLH B;  3EQL F;  1REP C;  1IAW A;  4KMF A;  3TO7 A;  2O6G E;  4HQM A;  3IWZ A;  4RB1 A;  4N9I A;  4WCG A;  1L3L A;  3E3V A;  4ESF A;  4RB3 C;  1RIO H;  1R1T A;  4M6Y A;  4Q47 A;  3GZ5 A;  1ZGJ A;  3FXU A;  2UXN A;  1Z1D A;  4KYW A;  3CUO A;  1YIO A;  1Z91 A;  2YU3 A;  4F7Z A;  4Q4Z F;  5DUK A;  3K1P A;  1ON2 A;  3MWM A;  4ENJ A;  5DCF A;  3WGI A;  5ICG A;  2K86 A;  3C18 A;  4MQ9 F;  2W85 A;  3GYH X;  2QQB A;  5LLQ A;  1UB9 A;  3NQO A;  1XCV A;  2EK5 A;  3I59 B;  3RDI A;  1KU3 A;  2RQP A;  3SXY A;  3T0Y A;  2MD5 A;  1P6R A;  1S6L A;  2P4W A;  1TW2 A;  1K78 B;  2VBX A;  1BI0 A;  1J7K A;  2FBI A;  4AIH A;  3Q5F A;  5LHH A;  4HDU A;  4BHB A;  3MZH A;  3QOP A;  1ZRE A;  4KIC A;  5D5W B;  2FU4 A;  3F8C A;  4S04 A;  3ML6 A;  2XRN A;  3EYI A;  3WU1 B;  4P5O A;  5BMZ A;  5LBQ A;  3KLN A;  1FP1 D;  3LAJ A;  1K78 A;  3TQN A;  5LRS A;  3RKW A;  4CGZ A;  5D4R A;  1Z05 A;  4ZYD A;  1LEB A;  3ISP A;  4K2E A;  2DPU A;  1YYV A;  3PQJ A;  3DV8 A;  1NHA A;  4DNC A;  5D8L B;  1L0O C;  4M9X A;  5K5R A;  1U2W A;  2R3S A;  2RGV A;  4KIF A;  1U8R A;  4S05 A;  3RPU A;  3JAM Z;  4KN7 X;  5ERI A;  4L9J A;  3GXO A;  1PDN C;  4QWQ A;  4CZZ A;  3D0S A;  2Q8K A;  3E5Q A;  3R0A A;  4WWC A;  1R58 A;  3AAF A;  4LD5 A;  1HW5 A;  1MJA A;  4IVN A;  3HTS B;  4EVI A;  4HW0 A;  4UVB A;  2A5Y B;  1BIB A;  1BM9 A;  4U88 A;  1YG2 A;  2X4H A;  3ZMD A;  2RDP A;  1FNN A;  2RN7 A;  3MCZ A;  4KT5 C;  1P4X A;  5D6E A;  2KKO A;  4KDP A;  4OIQ F;  1YO5 C;  1R5H A;  5D5V B;  4LLN A;  2OA4 A;  1IXS B;  3P9K A;  4EM2 A;  1Q1H A;  1FBQ A;  3HRS A;  1S3J A;  3ABT A;  3BJO A;  4HF1 A;  3BZ6 A;  3DFG A;  2EFW A;  1R36 A;  1SD5 A;  2H94 A;  2QUF A;  1KGS A;  1EV7 A;  5H6R A;  3L00 A;  2PI0 A;  3ZN0 A;  3I54 A;  2M87 A;  2YSR A;  1O7F A;  4HQE A;  2MC3 A;  4XLP F;  1FZP B;  2FF4 A;  1TNT A;  3BRO A;  3I71 A;  1U3E M;  4Q48 A;  2R7D A;  1O57 A;  5H6Q A;  5BPD A;  1S7O A;  2ISZ A;  4Q5S F;  2YR2 A;  4CYD A;  3Q9S A;  3SFZ A;  5LEJ A;  2IA0 A;  2VOP A;  3EET A;  2YPR A;  1FX7 A;  3R6S A;  1DPR A;  3REO A;  2ZKZ A;  3C3W A;  1ZH5 A;  2H09 A;  4JBA A;  5L3B A;  3S2W A;  3FXQ A;  1G3S A;  2CYY A;  2DI3 A;  2PQ8 A;  1RUO A;  2P7V B;  2HTS A;  3DPT A;  3KEQ A;  2O03 A;  4DQ2 A;  4G7Z F;  2P5L C;  4ESB A;  5CLS A;  2K7L A;  2GAU A;  1R5G A;  2CGP A;  1FOK A;  5FFZ A;  4FX4 A;  1ULY A;  5JR3 A;  3BDD A;  2KJB A;  1PP8 F;  3BJA A;  3R61 A;  5F6F A;  3TOA A;  1XSV A;  2L01 A;  1J5Y A;  2RNJ A;  2JPB A;  2LDU A;  3DP7 A;  4M72 A;  1FC3 A;  1XGO A;  5ICF A;  2L54 A;  5F1R A;  4L18 B;  2DK5 A;  2FNA A;  2QYO A;  1ONV A;  2HQR A;  3LQQ A;  3COA C;  2BGC A;  1OYW A;  5JFR A;  3K0L A;  4P55 A;  3ZMV A;  3P9C A;  4PCQ A;  1W7P B;  2DPD A;  5D5X B;  2XAQ A;  3VOE A;  2MLK A;  3RIR A;  1ZN2 A;  2E1N A;  3FM3 A;  1IXR C;  1B1B A;  2FMY A;  3IKT A;  2MLG A;  2XUB A;  5AON A;  4BHC A;  2RV8 A;  3RJP A;  3GF2 A;  1FY7 A;  2KRF A;  3T8T A;  4ZZD A;  2NYX A;  1W7P A;  3V7C A;  1HSJ A;  2KIF A;  3TDU C;  1WI9 A;  3F72 A;  2PBI A;  4M74 A;  2VOO A;  1I6X A;  5K1Y A;  4ZZL A;  4LLG F;  3MQ0 A;  3WGH A;  2ZME B;  1ZGA A;  1I5Z A;  4RGX A;  1IRG A;  1WKM A;  4ENM A;  1YW8 A;  1B4A A;  2XRO A;  2WV0 A;  1E17 A;  2KJC A;  2K4J A;  1GHC A;  4HAM A;  2J5P A;  5HDK A;  2PFB A;  3O2P E;  3MEX A;  4UHT A;  1D3Y A;  4HF0 A;  1BJA A;  3FX3 A;  1FLI A;  3LFK A;  3FXR A;  3WE2 A;  1KYW A;  3GFJ A;  5F64 A;  1H9T A;  4KN4 X;  2JSC A;  1LQ1 A;  3EDP A;  2STW A;  3K69 A;  4NQW A;  3F23 A;  4RGS A;  1JHF A;  1IF1 A;  2PEX A;  4G94 A;  5E1W A;  3QU6 A;  3WTX C;  2DU9 A;  1RNL A;  5JVT A;  4CDG A;  1PUE E;  4OIP F;  2DO7 A;  2HR3 A;  4LG0 B;  4ON0 A;  4EV0 A;  2VT3 A;  1BI2 A;  2O8X A;  2GIV A;  3QPT A;  1ZRF A;  3W6K B;  2P7C B;  4MGR A;  3HTU A;  1MJ9 A;  1PP7 U;  4ZYE A;  3MAJ A;  2VC0 A;  4BH9 A;  2FEZ A;  4G6D A;  3G73 A;  4ETS A;  3DQV C;  3GEZ A;  2WC2 A;  1B59 A;  1R1V A;  2ZCW A;  1U78 A;  1MJB A;  4M9Z A;  5IT3 A;  1QPM A;  3KP7 A;  2V9V A;  2ZO4 A;  2ZJ2 A;  2LNB A;  2P5K A;  4LG0 A;  5K5O A;  2VBZ A;  3GO5 A;  3G3Z A;  3WOD F;  2CFX A;  2GXB A;  3KCC A;  1OMI A;  4UV9 A;  5KK1 A;  2XAG A;  3WGG A;  1BC8 C;  4XSX F;  2OAZ A;  2MA3 A;  3F3X A;  4FX0 A;  3ERE D;  2KIU A;  4HOB A;  3M7G A;  3ZN1 A;  1J75 A;  2QVO A;  3F6O A;  4PZJ A;  5A2Q Z;  1YW9 A;  1KQ9 A;  2HEO A;  1F1Z A;  3BPV A;  3KP3 A;  1J59 A;  3IWF A;  2ESH A;  2ZNY A;  4PGG A;  1IN8 A;  3MZY A;  1G3Y A;  2PG4 A;  2LKP A;  4UUV A;  3CDH A;  2A6E F;  5AIP A;  1G3W A;  4HX8 A;  2EA2 A;  3I5U A;  2IPQ X;  1K79 A;  3WTW C;  5BOX A;  1HST A;  1VTN C;  2VOD A;  3HYI A;  1QZZ A;  4YFX F;  2V1D A;  1E2X A;  3L2C A;  1R1U A;  1WQ2 A;  1OYI A;  3SZT A;  1XMA A;  3K1N A;  2EFQ A;  3R60 A;  2G7H A;  5DD4 A;  1O3T A;  3M8E A;  1TQM A;  1MDM A;  3WTS C;  1F5T A;  4RAY A;  4WXC A;  1C0W A;  4I2O A;  2LF8 A;  1X3U A;  3NRV A;  1O3Q A;  4RGR A;  2QLZ A;  4HBL A;  4UVA A;  4NB5 A;  1ZG5 A;  1G3T A;  4LB6 B;  4IF4 A;  4TV7 A;  1FYL A;  1XDU A;  2GZW A;  2NRA C;  2FOK A;  2H27 A;  4HV5 A;  1QNT A;  2HKX A;  2K4B A;  1LDD A;  2QQA A;  2IP2 A;  4LJZ F;  3KP2 A;  5HLI A;  1R00 A;  4WXH A;  4A5N A;  1LEA A;  1HQC A;  4A0Y A;  1AWC A;  4HX7 A;  2VON A;  3SQN A;  3JTG A;  4CXF A;  3BPX A;  4HV6 A;  2FRH A;  2OQG A;  5D4S A;  2PMH A;  1HKT A;  1V4R A;  4HDV A;  4ESJ A;  1SAX A;  3P9I A;  1ZLK A;  4BQA A;  5J8F A;  2W25 A;  5JHU A;  3RKX A;  4HA8 A;  4CO8 A;  5LEK A;  4KNY A;  3FWE A;  1O7L A;  3HIF A;  2IT0 A;  4MEY F;  2O61 A;  3J81 K;  4Y17 A;  4UV8 A;  2OZ6 A;  1SD6 A;  1G4D A;  4HLX A;  2RKH A;  2H6B A;  3KZY A;  2FML A;  3QU3 A;  2K02 A;  3GX4 X;  3DPL C;  4O5V A;  4AWX B;  5DEQ A;  5ED4 A;  2V1X A;  3M1E A;  2P8T A;  3WTV C;  3RPQ A;  4OIR F;  2F2E A;  2F5C A;  2CO5 A;  1ZAO A;  2EWN A;  4ENN A;  2DLL A;  3L7W A;  4BYY A;  2P6S A;  3V7S A;  1TW3 A;  4XSZ F;  2HYF A;  5KVR A;  1U5T A;  2EFN A;  4HYE A;  3QP5 A;  5HVQ C;  4G7O F;  1GXP A;  2D2W A;  4ZYH A;  1BOA A;  2EFP A;  2E7W A;  3VEP A;  3TKY A;  2NNY A;  3BWG A;  1EH8 A;  4D0P A;  2FBH A;  3RTR A;  4OMZ A;  4PDK A;  1B6A A;  1JE8 A;  2QQ9 A;  1OKR A;  2EV0 A;  4L9T A;  2COM A;  4AIJ A;  5BQT A;  3P7N A;  2D1H A;  4FT8 A;  2PN6 A;  3GUD A;  1HBX G;  3ABU A;  1QO0 D;  4EMS A;  4MQV A;  4AVP A;  4KUM A;  3V8K A;  4G6Q A;  2RVC A;  1JHH A;  1HKQ A;  1Y0U A;  3R0J A;  3LA3 A;  4U7B A;  3LQR A;  2IRF G;  2F5F A;  1YW7 A;  1YFH A;  1UFM A;  2FBK A;  2L4M A;  1IN4 A;  1WSU A;  2QM3 A;  5D8K B;  1W5S A;  3I4P A;  4O3M A;  3RKY A;  1ZYR F;  2DBB A;  3F21 A;  4IRG A;  2JRT A;  2WWY A;  1KQ0 A;  3CTA A;  4YG2 F;  1SFE A;  1TQI A;  2ZFW A;  1D5V A;  3LST A;  4I7H A;  3J80 K;  2ESN A;  6PAX A;  2A68 F;  4KIB A;  3FMQ A;  1Z7U A;  2HS5 A;  2P5V A;  4GGG A;  1KU2 A;  3E5U A;  2MBF A;  4KMU X;  4UXN A;  3IL2 A;  3ZMZ A;  4RGU A;  4WXD A;  1XN7 A;  1IN6 A;  5FGM A;  3SZP A;  3TGN A;  2GWR A;  1T2K A;  4U0W A;  1ZHF A;  1P4W A;  1LNW A;  1YLF A;  2D45 A;  2EJR A;  3I58 A;  4BXU A;  2HQN A;  4CIC A;  1UST A;  2KIM A;  3CUQ B;  4YII A;  2DW4 A;  4E70 A;  4AIK A;  1W4M A;  2GQQ A;  1KU9 A;  2AXL A;  1XGN A;  4OU0 A;  3KP4 A;  1QQI A;  2Q2E A;  4CHU A;  4ENK A;  2OU2 A;  2VBY A;  1FYK A;  3L9F A;  2K27 A;  2Y0M A;  3H92 A;  1XGM A;  2M45 A;  1SMT A;  2CG4 A;  2GA2 A;  5DYM A;  3CUQ A;  1LJ9 A;  2L02 A;  1T98 A;  4R8H A;  1T0F A;  4FHT A;  1KYZ A;  4A6E A;  5E17 F;  3RYR A;  3HRM A;  2M30 A;  3TOB A;  1K7A A;  2XV4 S;  1BC7 C;  1O3S A;  3GWZ A;  5LRR A;  4IRH A;  3GZ6 A;  3K2Z A;  1I1G A;  5H20 A;  4R1H A;  4GCV A;  1IN5 A;  2G7U A;  2YX4 A;  4P9U A;  5E1Z B;  4LLL A;  4L5I A;  1FP2 A;  1S7A A;  2A61 A;  5L3D A;  5LGN A;  3ECH A;  4L0Y B;  4LGW A;  3CO7 C;  1HXD A;  2HWV A;  4WF2 A;  4EM0 B;  4H0E A;  2F5E A;  3U1D A;  1IZ1 A;  4KFC A;  2XAJ A;  3B02 A;  1EH6 A;  1QBJ A;  2HZT A;  1ODD A;  2PJP A;  1T38 A;  3GFI A;  1UHM A;  3WU0 A;  4UNO A;  1FWZ A;  2XAH A;  3ZMS A;  3EYY A;  1SMY F;  4NHJ A;  4OIN F;  4IPA A;  2OBP A;  2VT2 A;  2EB7 A;  4L9V A;  2QEN A;  1B9M A;  4YIF A;  2EV5 A;  1XB4 A;  3RI4 A;  5DCM B;  2IW5 A;  5L3E A;  1O3R A;  2JTV A;  1Z9C A;  2QZ8 A;  3BJ6 A;  1XMK A;  4WX9 A;  2PLY A;  2OD5 A;  3HSR A;  2QBY A;  4O6J A;  3IHU A;  2NNN A;  2GXG A;  1AOY A;  5BS6 A;  3BP8 A;  3KP5 A;  1D8K A;  2Y75 A;  1MGT A;  4U0Y A;  2CQK A;  5DUI A;  4EJO A;  5DCM A;  3TO6 A;  1HW1 A;  3H3U A;  3JAM K;  2Z3Y A;  5HDN A;  2HFH A;  1W7P D;  3QPH A;  1R7J A;  1CF7 A;  4JQF A;  2BE5 F;  3B73 A;  3U2R A;  3W6J B;  2UZK A;  2DTR A;  5DV5 A;  3T8R A;  3H3Z A;  1ZAR A;  1KA8 A;  3I64 A;  3ZMU A;  3KEO A;  3ROU A;  2Q0O A;  2XVC A;  1MD0 A;  2E7X A;  4LMY A;  1WWX A;  3MFK A;  3KP6 A;  3I0T A;  4B09 A;  3HSF A;  4KA4 A;  2HDC A;  3V8J A;  2A69 F;  1LDK B;  1DPU A;  3T1B A;  2TDX A;  1SD4 A;  4L9N A;  3CUQ C;  3PQK A;  2JPC A;  5TRD A;  2V1U A;  1FSE A;  1HKS A;  3JSO A;  3BOQ A;  2RC4 A;  3F6V A;  1MDM B;  4RB2 C;  1CGP A;  2UXX A;  3WTU C;  5CVI A;  5DDG A;  5FD5 A;  2LF7 A;  4EJV A;  2OZU A;  2FQ3 A;  3VFZ A;  4EGZ A;  4EGY A;  5ICE A;  1TQP A;  4EM1 A;  5AIQ A;  2VE9 A;  3ZQ7 A;  5TJJ A;  2H6C A;  5ILV A;  2HYG D;  5E18 F;  3FMS A;  1H9G A;  5IT9 K;  3I53 A;  3WTY C;  1R22 A;  1USS A;  3M8F A;  2CWE A;  4L5J A;  4MTE A;  3QP6 A;  3J7A O;  3E6B A;  2VN2 A;  3O6B B;  3IRR A;  4GYI A;  1RUN A;  2BYV E;  3F8N A;  4KIG A;  2XKO A;  5CVJ A;  1YTY A;  4WK8 F;  3DXJ F;  3FM5 A;  1QGP A;  1BI3 A;  1YS6 A;  4MNU A;  5JI6 A;  1T39 A;  3E97 A;  2JT1 A;  3M9A A;  4M9S A;  2BV6 A;  3FF5 A;  5ILS A;  5L3F A;  3CO6 C;  5BPI A;  4YFK F;  3QAH A;  5K5Q A;  1F9N A;  1IUY A;  2FA5 A;  2DFI A;  5LGT A;  3KET A;  2Z9O A;  1UHW A;  3I59 A;  5CVV A;  4ZH4 F;  2FE3 A;  5CVR A;  5LHG A;  4IHT A;  5E20 A;  5ILU A;  3IKV A;  2CSO A;  5L3G A;  1P2F A;  3LWF A;  1XSX A;  4I01 A;  4A0X A;  1SD7 A;  4LFU A;  3FHZ A;  2M1B A;  1IW7 F;  5E1X A;  1F4K A;  3RYP A;  2HTJ A;  3OOP A;  5HS7 A;  4A5M A;  4EQQ A;  1FBS A;  1U5T B;  4MTD A;  3V8L A;  1FYM A;  2L3D A;  2AS5 F;  4HX4 A;  3HSE A;  2B0L A;  1KQ8 A;  3GVA A;  4BHP A;  2DT5 A;  2EA4 A;  1IN7 A;  2UWM A;  4N9H A;  1STZ A;  1J0R A;  4LK0 F;  5D5U B;  4IXA A;  4PGH A;  3JW4 A;  2DQL A;  1WRJ A;  4RS8 A;  1J2X A;  2O0Y A;  3HOS A;  4JK1 X;  5FLX K;  5HS9 A;  1OYY A;  5EEG A;  1RI7 A;  3ZP5 A;  1BN5 A;  1LB2 A;  1Z6T A;  3KFW X;  1ZG3 A;  4EJU A;  3PFI A;  3ZPL A;  4EJW A;  4RAZ A;  4G9Y A;  2M5W A;  2LSO A;  1H0M A;  1XGS A;  2M8E A;  2V6C A;  5HOO A;  2ADU A;  4I02 A;  2YX7 A;  4HLY A;  2CW0 F;  4LB5 A;  2ZXJ A;  2R7F A;  2Y48 A;  4XBF A;  1BIA A;  4I09 A;  4MEX F;  5IT9 Z;  3FMR A;  2JZY A;  5CYV A;  4U0V A;  1FBU A;  1LDJ A;  1ZG1 A;  2VBW A;  4EJT A;  3O3K A;  5FFX A;  4BNC A;  4OOI A;  3F8F A;  3ECO A;  5J6X A;  2ETH A;  2X0L A;  2DQR A;  3L09 A;  4M71 A;  4L0Z B;  4A12 A;  4XLN F;  1V3F A;  4M73 A;  2PMU A;  1LVA A;  4I0B A;  5E8G A;  1QZY A;  4P9F A;  3BY6 A;  1ON1 A;  3N4M A;  2OQR A;  4HZF A;  2DK8 A;  1FPQ A;  1J9I A;  3E5X A;  3LA2 A;  5EEH A;  2MH2 A;  1DDN A;  5E8I A;  4ZYG A;  2NS0 A;  5ICC A;  1SFX A;  4IJA A;  1G6N A;  4GYG A;  4P96 A;  1HW2 A;  2ELH A;  3J81 Z;  4B8X A;  3GW2 A;  2ACJ A;  1XD7 A;  4Y13 A;  3CJN A;  3V4G A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...