3IWFA

The crystal structure of the n-terminal domain of a rpir transcriptional regulator from staphylococcus epidermidis to 1.4a
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
102
structure length
89
Chain Sequence
MPNILYKIDNQYPYFTKNEKKIAQFILNYPHKVVNMTSQEIANQLETSSTSIIRLSKKVTPGGFNELKTRLSKFLPKEVTQYNNKLHSR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transcription regulator
molecule keywords Transcription regulator RpiR family
publication title The Crystal Structure of the N-terminal domain of a RpiR Transcriptional Regulator from Staphylococcus epidermidis to 1.4A
rcsb
source organism Staphylococcus epidermidis
total genus 32
structure length 89
sequence length 102
chains with identical sequence B
ec nomenclature
pdb deposition date 2009-09-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01418 HTH_6 Helix-turn-helix domain, rpiR family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 3iwfA00
3CUQB 1TW2A 3ZN1A 2VT2A 2XRNA 4M6YA 2RDPA 4JBAA 2P7CB 2EFQA 3HTUA 2YU3A 1ZLKA 3MAJA 5TJJA 2HTJA 4WCGA 3ZP5A 4EJOA 2STWA 2OA4A 2E1NA 3EUHA 4P55A 5AIPA 2ZBKA 2GXGA 3F72A 1XSXA 4HLXA 3GX4X 5TRDA 3F23A 1XMAA 1HBXG 2VC0A 3DEUA 4MQ9F 1ONVA 1IXCA 2MC3A 3F8FA 3FX3A 5EEGA 1HW2A 4RB1A 1IUYA 3G73A 3FF5A 1QZZA 3D5LA 3V8LA 5LRSA 3DPTA 3SZTA 5IT3A 3QAHA 3GXOA 2E7WA 4CGZA 1OYWA 3LFKA 1IN4A 1LDKB 4O6JA 3WE3A 3L09A 3U9GA 2VN2A 1K6OA 4HDVA 4RGSA 3RPQA 1S8NA 3KEOA 5HLIA 5HS8A 4A5MA 4PCQA 4AIHA 1K78A 1W7PA 2HGCA 2VBZA 2K7LA 2EWNA 1T2KA 1KU7A 2ZO4A 4P9FA 5JHUA 3ROUA 1S6LA 2OZ6A 4B8XA 1JHHA 1U6GA 1KU3A 5K5QA 1UHWA 2XKOA 2XROA 2CYYA 3JAMK 1LEAA 2J5PA 3BOQA 4JQFA 3I0TA 3RDIA 3ZN0A 3EETA 4KDPA 4M73A 4KA4A 4HF2A 2RKHA 3E3VA 4HX7A 5D4SA 2DLLA 4KMFA 1BI0A 2PN6A 5L3GA 1S7AA 2H94A 2DK8A 3VFZA 2Y48A 1D8JA 1BOAA 1KQ8A 3KE2A 2A6EF 4AVPA 3FXQA 4EMSA 2W24A 2CFXA 1F1ZA 5E1ZB 2D1HA 2RQPA 1AWCA 3N4MA 2PLYA 2CO5A 4XSXF 4Z2YA 5D6FA 3I59A 1P2FA 4PGHA 1OR7A 4UVAA 1Z6RA 3J80Z 2YPRA 3H3ZA 1XCVA 4Q47A 2M87A 1PDNC 3DFGA 1WI9A 3V4GA 4UV9A 2KJCA 4BHPA 4KIGA 4ZYDA 1R7JA 2W25A 5JFRA 4KT5C 1R00A 1K78B 1Z7UA 1P6RA 1W7PB 1D3YA 1EH6A 4L5JA 4ZH4F 4FX4A 3EDPA 3E5QA 1UFMA 1BC7C 1SFEA 5HS9A 3FMSA 3ECOA 5E8IA 4IVNA 1LJ9A 2K02A 2YX7A 1H9TA 5D4RA 1SD7A 4OU0A 1XDSA 2O61A 4UVBA 2RNJA 2XUBA 3CUOA 4EM1A 2ACJA 4K2EA 1LEBA 5ICEA 3HSRA 4B09A 3ML6A 2H27A 3LAJA 2VXZA 2NYXA 5DUKA 4ESBA 1EH7A 1B59A 1XGSA 4EVIA 2JPCA 4HF1A 3CLOA 3EQLF 3R0JA 4HBLA 2ISYA 4MTEA 5CVUA 4KICA 2STTA 1KYZA 1KU9A 2E7XA 5L3BA 5H6QA 4LB5A 5CVIA 3VEPA 4MHGA 4LG0B 1HKSA 5IT9Z 4LGWA 3REOA 4LLNA 4UUVA 2V1UA 1MGTA 1CGPA 4RGRA 3HRSA 4ETSA 4O3MA 2CQKA 4YIFA 2CWEA 2DO7A 2IP2A 1RI7A 4BYYA 2G7HA 3F22A 3C7JA 2ESHA 2FU4A 3QPHA 5ICFA 4EJTA 5CVVA 4G7OF 3R61A 5CLSA 5A2QZ 5BPIA 2NAZA 3LA2A 3PQJA 2ZXJA 3BY6A 3E5XA 3H92A 3TDZC 4HLYA 2IRFG 2V6CA 2UZKA 5H20A 1IRGA 1R1VA 4N9IA 2O3FA 1QO0D 2DFIA 3LAPA 2RC4A 3RKWA 2HWVA 4R8HA 2OQGA 1R23A 1G3YA 3T8RA 1SFUA 3FXRA 1ZH5A 4E70A 4HA8A 3QP6A 5E8GA 4G6DA 2A5YB 3E97A 3ZQ7A 2IW5A 4CYDA 3CJNA 4GXOA 1OYIA 1JGSA 5DYMA 4LD5A 4MEXF 4IJAA 4O5VA 3TGNA 2OU2A 4AIKA 1DPRA 2P8TA 1LB2A 1J75A 4GGGA 1ZRDA 4OIOF 1BM9A 1CF7A 1ZREA 3WTZA 3KP4A 4ZYGA 2EB7A 2DPDA 2P5KA 1XGNA 1RZ4A 1ON1A 3KFWX 5FD6A 2D1VA 1HKQA 1A04A 1IRFA 1LDDA 1OYYA 2M30A 3MWMA 1EH8A 2XVCA 3LQRA 3F6VA 1P4XA 1B4AA 1GXQA 4TV7A 3KLNA 1FWZA 2XAFA 4PDKA 4HV6A 2HYFA 5L3FA 4BHCA 4BXUA 4EJWA 4YG2F 1U3EM 4ZYEA 1ZG1A 3J81Z 3SQNA 3KZYA 1U2WA 1YO5C 1S3JA 1OKRA 4IXAA 1QPMA 2QVOA 2M45A 1Z6TA 2DQLA 2QWWA 3DF8A 2Z9OA 2QYOA 3BJ6A 4M6XA 2EK5A 2VE9A 2R7FA 2Z5UA 3JSOA 2F5FA 3FM3A 3DP7A 4L0ZB 2O8XA 2BYVE 1RUOA 2YX4A 3LSTA 3B02A 1EV7A 3HIFA 4L9JA 3I64A 1G4DA 3GYHX 1DDNA 3K69A 2KIUA 4HV5A 3T5XA 3WTTC 1IN7A 1U5TA 4IRGA 3BDDA 1O7FA 4IPAA 2V79A 2ZMEB 2EFWA 3K2ZA 4P96A 3M8FA 1MJAA 3H3UA 1FBUA 3HTSB 3MZYA 4UXNA 2FBKA 1I5ZA 2MLGA 4WXHA 1QBJA 2PI0A 4G9YA 1MKMA 5ILSA 3RJPA 1OPCA 3BWGA 2OQRA 4R79A 4FT8A 3BP8A 4U0VA 5LEJA 1ZRCA 2FNAA 1JE8A 4HZFA 1SD6A 5BPDA 1FBQA 3R6SA 1GVJA 4UNOA 2K86A 3TDUC 4EGZA 1NHAA 3I58A 1H9GA 5K5OA 1J0RA 1IXRC 3F8CA 3KP5A 1BI1A 2QQAA 2L54A 4BAYA 5D5VB 2FBHA 3SZPA 1YYVA 5ILVA 4ENNA 2FQ3A 2FEZA 3W6KB 1KU2A 1TQMA 5D8LB 1SMTA 3I54A 2K4BA 2ZJ2A 1W5TA 4NB5A 2PFBA 2PQ8A 3KP3A 1JHFA 2XV4S 3IHUA 4UV8A 2VT3A 1U5TB 2NRAC 2LF7A 3TO7A 2FF4A 4RAZA 2BEOA 1FSEA 4M72A 1XSDA 4M9SA 2YR2A 3GLXA 1HW5A 2DQRA 4WXDA 4IRIA 3CTAA 2EJRA 1YQAA 5LHHA 2A6HF 1WSUA 5LGTA 2GAUA 1BIBA 3PQKA 1V4RA 1Z1DA 3MFKA 5HOOA 3OV8A 1YW8A 2IT0A 4PGGA 2P6SA 4NHJA 2A61A 5CJ9A 2IA1A 2QBYA 4HAMA 3WU1B 3R4KA 2IA0A 5LGNA 3BJAA 2HS5A 3RYPA 3ISPA 5H6RA 2ELHA 5JI6A 4XLNF 1B9NA 4AD9A 1O3QA 3QU3A 3JAMZ 3I4PA 2Q2EA 2EV6A 1FZPB 4OMZA 4BHBA 2LDUA 2LNBA 4KN7X 3EYIA 2AXLA 1HW1A 2XHKA 1X3UA 3KLOA 4L0YB 2Z33A 2HR3A 1SMYF 4L5IA 1S29A 5E18F 4YIIA 4EJUA 4HW0A 1FYMA 4GYIA 2KIFA 2FMYA 2Y75A 1IN8A 4NQWA 2EFOA 1SAXA 4WWCA 2FSWA 4RB2C 4KN4X 1TQPA 1TNTA 3HSEA 2QLZA 2ADUA 4LMYA 4L9VA 2DTRA 3T0YA 2F5CA 3E6CC 1FOKA 1UHMA 3M9AA 4HX4A 3T1BA 1MJ9A 1ZN2A 2E1CA 4I02A 4FX0A 2HYGD 3F3XA 2Y0MA 3WGHA 2ZNYA 1K79A 2QBYB 2K4JA 2C6YA 3AAFA 1F4KA 1BIAA 3F6OA 2EFPA 4EV0A 5FFXA 4Q4ZF 5DCFA 1YLFA 4Y15A 2DI3A 4ENJA 5L3EA 2V1DA 3LA3A 1XSVA 1DP7P 3CUQC 1XGMA 5ILUA 1ZARA 3VB2A 1W7PD 3CDHA 5ED4A 3HOTA 1S7OA 3Q9SA 1FC3A 2GA1A 5FLXK 1G3TA 4CO8A 1FLIA 2JT1A 3GUDA 5HDNA 1AOYA 5L3CA 2L3DA 1W5SA 4FHTA 3KEQA 4A6EA 1T39A 2HOEA 4PZJA 2JRTA 1TBXA 2IJLA 3I59B 4Q48A 1E2XA 4A5NA 1J2XA 4L9TA 2XAHA 3OOPA 2NNYA 2EV0A 3V8JA 4ZZDA 1L0OC 4M9XA 4OIPF 4I01A 1ULYA 2R7DA 2HEOA 2PMHA 5IT9K 4HOBA 1GXPA 2VONA 4ESJA 4RGXA 2P6TA 4I0BA 1U5TC 2A07F 3WE2A 3Q5FA 1ZGJA 4AWXB 3K1NA 2WV0A 4XRFA 5E20A 1O3TA 3N97A 4U0WA 3R60A 2KRFA 4WX9A 3IRQA 1FNNA 1YS7A 1T38A 5K1YA 1R36A 2QUFA 4WF2A 1J59A 2DT5A 4I09A 2EFNA 2MLKA 4ENKA 2ETHA 3FHZA 4P5OA 2VOOA 3FMRA 2XAJA 2F2EA 2JPBA 1B1BA 1KQ0A 5LRRA 2M1BA 4BQAA 2OBPA 1KGSA 4RAYA 1F5TA 3ECHA 4LFUA 3HHGA 1L3LA 2DW4A 2RV8A 3RPUA 1KYWA 1Y0UA 5EEHA 4I7HA 2H6BA 5DUIA 4S04A 2JTVA 4A0YA 4XBFA 2VBXA 1RIOH 3V8KA 5AONA 4HQMA 4M71A 1B9MA 2G9WA 2O03A 3RYRA 1IN5A 2L4MA 2GZWA 1FSHA 2M5WA 3P7NA 5J8FA 4BH9A 2NNNA 3R0AA 3ZPLA 1TLHB 3MQ0A 3KZZA 4G8XA 1O7LA 1DPUA 2D2WA 3NEUA 4KYWA 3DQVC 2PMUA 4LLLA 2HQNA 2Z99A 5E17F 3QP5A 3W6JB 3TO9A 3KP2A 3IWZA 2OAZA 2F5DA 3F21A 3F8BA 1T0FA 4M9ZA 4LJZF 2O0YA 1O3SA 4LK0F 3I5UA 2BE5F 2UXXA 1BBYA 2W84A 3FXUA 3RKYA 4HQEA 2W57A 5F1RA 4HYEA 4I0AA 4YFKF 5DV5A 1QGPA 1T98A 5JVTA 1FP2A 4LB6B 4YFNF 5JR3A 1HXDA 4H0EA 3WGGA 1SD5A 4ASNA 3QU6A 4OINF 5BQTA 2L4AA 3I53A 3JW4A 2F5EA 3P9IA 3SXYA 1WWXA 2UWMA 3O6BB 1CF7B 2A3SA 2CW0F 4YFXF 3WTUC 4RB3C 1IAWA 3SHFA 1WKMA 2Q0OA 4N0BA 1YS6A 3CO7C 1XMKA 5DD4A 1HQCA 1MZBA 3BPVA 3V7SA 3QOPA 3JTHA 2XAGA 2FMLA 4ESFA 1PUEE 4EGYA 4JK1X 1XCBA 2PG4A 2H6CA 1ZHFA 3ZMTA 2DK5A 3LQQA 4RB0A 2VBWA 1I1SA 3ZMVA 3ZMZA 4EJVA 5LHGA 4G7ZF 1YW7A 3FWEA 1U8RA 1FPQA 3IKVA 3IL2A 3KETA 1FYLA 1RUNA 1USTA 1TTYA 2RVCA 4DNCA 1J9IA 2DU9A 3WG9A 2WWYA 1D8KA 3KP6A 3BZ6A 4IF4A 5HLHA 1I27A 2P4WA 1Z05A 3ZMUA 2YSRA 1ZG5A 2IPQX 3WTYC 3MZHA 4N9HA 3KP7A 4I2OA 2A69F 1FY7A 2VBYA 3O3KA 3IRRA 3B73A 3HOSA 5D5WB 2ISZA 2LKPA 3DXJF 1QNTA 2BBYA 4MNUA 4EM0B 3ULQB 3TQNA 3BJOA 1F9NA 3ELKA 1LNWA 5L3DA 4L18B 2J5OA 4A12A 2OD5A 3FZVA 4CDGA 5J6XA 5CVJA 2G7UA 2XAQA 3TO6A 5DCMA 1T6SA 5F64A 1FP1D 1R22A 5KK1A 3U1DA 2K27A 5LBQA 2CGPA 3VODA 3DV8A 4KIFA 4Q5SF 3D0SA 5ICCA 5E1XA 2FXAA 1J7KA 4KMUX 5HDKA 1ZGAA 1XD7A 3C3WA 1O57A 4KNYA 5D5XB 1SFXA 2QM3A 1VTNC 4P9UA 3IWFA 1I6XA 2MH2A 2ZCWA 1TQIA 1XN7A 2ZKZA 5E1WA 2P5LC 4OOIA 4HDUA 3QRFF 1K7AA 1TW3A 2HKXA 1UB9A 3TKYA 1R5GA 1MD0A 5DDGA 2HDCA 4A0XA 2IVMA 4GYGA 2BV6A 2FOKA 3GFIA 1BJAA 1HSJA 5LHIA 3M7GA 1TNSA 2L01A 2HZTA 2KIMA 1ZRFA 4U7DA 1R1UA 2RGVA 4MGRA 2XKPA 1YG2A 3GWZA 3LA7A 1I1GA 5BS6A 3I71A 1KQ9A 3EYYA 3DKWA 3CO6C 4MQVA 4GO1A 2W85A 4CXFA 3GFJA 2ZNZA 1G6NA 3K1MA 5DCMB 5FB2A 3J7AO 4KFCA 3ERED 4CZZA 3U2RA 5HVQC 1J5YA 2NS0A 3RI4A 3PFIA 3V7RA 3ABTA 1HSTA 1BC8C 3J80K 4CICA 3M1EA 3HSFA 3HRMA 3FMQA 2XASA 2QQ9A 4LG0A 4RGUA 2GWRA 1H0MA 1REPC 3O2PE 3F8NA 5HLGA 4U0YA 1BI3A 1ODDA 3MEXA 4XLPF 3GZ6A 1UCRA 3WTVC 2XGXA 2AS5F 5ICGA 2EA2A 1YW9A 4LLGF 2A68F 2X0LA 2JZYA 6PAXA 3P9KA 4G94A 3S2WA 2QENA 3E6MA 3MCZA 3SFZA 5D8KB 4DQ2A 4BNCA 4QWQA 1D5VA 5FO5A 1OMIA 5F6FA 3V7CA 4HX8A 2EV5A 1R1TA 2LF8A 2GXBA 3GZ5A 1R5HA 1ZYRF 3QPTA 4OIRF 4UVCA 1IW7F 3WU0A 1SD4A 3RKXA 5FLXZ 1U78A 4G7HF 1Z9CA 1FYKA 1IZ1A 2V9VA 4R1HA 2M8EA 5KVRA 5CYVA 3M8EA 3GF2A 2CG4A 3L00A 4Y17A 1FBSA 2MA3A 2FNPA 3TOBA 2MD5A 4ZZLA 1W4MA 2PJPA 2RN7A 4F7ZA 2VOPA 5D6EA 1YIOA 4U88A 4L9NA 1RNLA 2HFHA 3GFLA 2H09A 3WTWC 1BI2A 2Q8KA 3HUGA 4UHTA 5LEKA 5BMZA 3GEZA 1ZAOA 1WQ2A 2LSOA 3HYIA 1LDJA 2X4HA 3BPXA 3K9TA 1LQ1A 2VC1A 5CVRA 1R58A 1P4AA 5A2QK 2JSCA 2FBIA 4RS8A 3ZMSA 4G6QA 3JTGA 2ZFWA 5HDGA 3HRTA 1ON2A 2GQQA 5DD8A 2OZUA 5LLQA 4MTDA 3VOEA 5FD5A 2DPUA 3DPLC 3RIRA 2QQBA 2PBIA 2BGCA 4OIQF 2L02A 3E6BA 1FX7A 4WXCA 4U7BA 3GFMA 3E5UA 1KA8A 2COMA 2IA2A 2WTEA 3K1PA 4IHTA 2DAOA 1P92A 2HTSA 3RTRA 1ZLJA 2FA5A 1E17A 3C1DA 3P9CA 2QZ8A 5J8CA 1YTYA 1MJBA 2R3SA 3TOAA 1P4WA 3L7WA 5DEQA 1V3FA 1MDMA 1C0WA 4EQQA 1JXSA 3NQOA 3F8MA 2XIGA 1PP8F 4WK8F 1USSA 4ENMA 2O6GE 1LVAA 3T8TA 2TDXA 4M74A 1IN6A 3G3ZA 1Q1HA 5HS7A 3K0LA 1IXSB 5FGMA 5AIQA 1IF1A 3E6DA 2ZMEA 2P7VB 4QLCU 2CSOA 2KKOA 4IHSA 2EA4A 2VE8A 5D5UB 1FT9A 3CUQA 4CHUA 4OMYA 2GIVA 3WODF 4A2UA 3IKTA 1PP7U 2FRHA 3Q9VA 3LWFA 2MBFA 3J81K 1O3RA 2DBBA 4KUMA 2KJBA 2V1XA 2UXNA 2WC2A 1STZA 5FFZA 1XGOA 3FM5A 4HF0A 3ABUA 3IC7A 4LK1F 1BN5A 4XSZF 2B0LA 2Z3YA 3WTSC 2HKOA 1XDUA 3NRVA 3GO5A 2FE3A 4KIBA 4S05A 1MDMB 5K5RA 1YFHA 4IRHA 3KCCA 1GHCA 3GW2A 2GA2A 4EM2A 4A0ZA 3L2CA 1G3WA 4A6DA 1Z91A 2PEXA 3HHHA 3COAC 3L9FA 1G3SA 3GVAA 3WTXC 2P5VA 2HQRA 1QQIA 4AIJA 1B6AA 1QZYA 4ZYHA 1ZG3A 3HRUA 4MEYF 1HKTA 2VODA 1XB4A 3C18A 3JSPA 3BROA 4I98B 3ZMDA 1WRJA 3WGIA 4GCVA 1DUXC 2ESNA 5LGUA 2MH9A 4D0PA 2D45A 4Y13A 4ON0A 5ERIA 5BOXA
chains in the Genus database with same CATH superfamily
2WY7Q 3S8PA 1A6IA 3CUQB 1PUFB 1TW2A 3ZN1A 2VT2A 2XRNA 4M6YA 2RDPA 2FX0A 4JBAA 1YIJI 2R5ZA 2MABA 2P7CB 2EFQA 3HTUA 1VQ4I 2YU3A 1ZLKA 3MAJA 5TJJA 5FROA 2HTJA 2NVYJ 1RC9A 4WCGA 3ZP5A 4EJOA 3PIOF 2STWA 2OA4A 2E1NA 5DTDA 3AL0C 3EUHA 4P55A 2L0KA 5AIPA 5FKMA 2P81A 5M5XJ 1K61A 2ZBKA 2GXGA 3F72A 1QHGA 1XSXA 3H9GA 5EG0B 4HLXA 1LPQA 3VPRA 3GX4X 2LKSA 2MC4A 3H9QA 5TRDA 3F23A 1XMAA 4IOAF 2ELKA 1HBXG 1A6QA 2VC0A 3DEUA 1X4OA 4A3KJ 4MQ9F 1ONVA 3F0CA 1W36D 1IXCA 4XKVA 3LOCA 2RREA 4BDZA 1TL8A 4XRSA 2UUZA 4JP0A 2MC3A 3F8FA 3FX3A 4KITB 3CMYA 2HVSA 4M3FA 3U21A 5EEGA 1HW2A 1GV2A 2DFEA 4RB1A 2CW8A 1IUYA 3PSIA 3G73A 4FE4A 4GFBA 3FF5A 2R7ZJ 3M1CA 1QZZA 2K9LA 2EZHA 3D5LA 3V8LA 4J00A 5LRSA 3DPTA 3SZTA 2Y0SN 5IT3A 3QAHA 3OSGA 1M1EB 3GXOA 2E7WA 4CGZA 1DP3A 1OYWA 3JCUC 1OCCH 1IN4A 1LDKB 2I5UA 3LFKA 2ZJQF 4O6JA 4NC8A 3ZQIA 1YRNA 4BE1A 2TCTA 3WE3A 1PYVA 3K7AJ 3L09A 2G0EA 3U9GA 2VN2A 4Y3OA 1K6OA 4HDVA 4RGSA 3RPQA 1S8NA 2VJJA 3OR2C 4JX4A 3KEOA 5HLIA 1Y39A 1D5YA 5HS8A 2E1MB 2EBIA 2CS3A 4A5MA 4PCQA 4AIHA 1K78A 3BTIA 2LD5A 5GAGJ 1W7PA 2HGCA 2VBZA 2K7LA 4DZPA 4RBOA 2OTLI 2EWNA 4BGDA 4L5EA 1T2KA 1KU7A 2ZO4A 4P9FA 3HL2A 5JHUA 3ROUA 1S6LA 2OZ6A 2LKXA 4B8XA 1JHHA 1U6GA 1KU3A 3B6CA 2HQAA 2KIQA 1SVMA 3PL8A 1UHWA 4HG2A 5K5QA 2DMUA 3BTJA 3VWBA 2XKOA 4ZDPA 4RMNA 4E6KG 3QYFA 3WHBA 1QVTA 5IOZA 2XROA 3ZQQA 4B3XA 2PMZA 2CYYA 3JAMK 1LEAA 2V26A 1OCOH 2J5PA 2E60A 3BOQA 3CCYA 4JQFA 2DODA 4A3JJ 3OOUA 4XKWA 2HOTA 3I0TA 3RDIA 3ZN0A 1AKHA 3I4NJ 3DKXA 2V9KA 3VYUB 3EETA 4KDPA 2JA6J 2LP0A 5E3MA 4M73A 4UB6C 3DTEA 5J4VA 4KA4A 4HF2A 1D1BA 2RKHA 3E3VA 3HGGA 4HX7A 5D4SA 3JRGA 2FOWA 4A3IJ 2DLLA 4KMFA 1BI0A 2PN6A 3A0BC 1S7AA 5L3GA 3A1YA 2H94A 2DK8A 3VFZA 2Y48A 1D8JA 1WHUA 1BOAA 1KQ8A 3KE2A 2A6EF 3S3MA 4AVPA 4HNTA 1V5GA 3FXQA 4EMSA 5IOYA 1K6YA 2W24A 2CFXA 1F1ZA 5C3EJ 5E1ZB 3JRDA 4ZDLA 3D5SC 3J7ZI 2D1HA 3G6EI 1JTXA 2RQPA 3CDLA 2JJ7A 4G12A 1AWCA 3N4MA 2VQGA 2PLYA 2CO5A 2ZFUA 1MSFC 3PIPF 4XSXF 4Z2YA 3UKGA 3NAUA 5D6FA 3I59A 1P2FA 4PGHA 1OR7A 3VSLA 2HOAA 4UVAA 2BY1A 3ASOH 2KISA 1YRNB 3QOEA 1Z6RA 3J80Z 2JRMA 2YPRA 3H3ZA 5GAHJ 5FJ8J 1XCVA 4Q47A 2M87A 4D5FA 1U8BA 4BE0A 4BY7J 4UUSA 1HC8A 5C4XJ 3OYHA 2BW3A 1PDNC 3DFGA 3CCVI 4NBQA 1WI9A 3V4GA 2E19A 4I76A 4UV9A 2KJCA 4BHPA 4C3HJ 4KIGA 3OIPA 4ZYDA 1R7JA 2NVTJ 2W25A 1GVDA 5JFRA 4KT5C 1T08B 3PJRA 4D7NA 2AHQA 1R00A 1K78B 1Z7UA 1P6RA 1W7PB 2JA8J 3HB9A 1D3YA 1EH6A 5EEAA 4L5JA 4ZH4F 4FX4A 1JUPA 2X6YA 4N4NB 3AG3H 3EDPA 1YI2I 3E5QA 1UFMA 1BC7C 1SFEA 1I50J 5HS9A 3FMSA 2LR8A 3ECOA 3LSHA 5E8IA 1AA7A 1LJ9A 4IVNA 5E79C 3BR6A 3GTLJ 4CYCA 4ZC3A 2K02A 1A35A 2YX7A 3SEZA 3ZQLA 4U87A 1K83J 1H9TA 1N25A 5HNHA 4I99C 5D4RA 4XICA 1E3OC 4PFPA 1SD7A 3LSMA 4OU0A 5FKKA 1W1WE 1XDSA 2O61A 2DA2A 3V42A 2A5WA 4UVBA 1X1AA 3L2WA 2RNJA 4S0HB 2XUBA 1I3AA 3CUOA 4EM1A 2ACJA 4K2EA 2VJ5A 1HOMA 2M9HA 1LEBA 3F9KA 4ZYAA 5KAFC 5ICEA 3HSRA 2M4GA 1ERDA 5EJCA 1T0FC 2B7EA 4B09A 5B5EC 3ML6A 2H27A 3LSPA 4QPOA 3W3CA 3LAJA 2VXZA 4MO7A 2NYXA 1F43A 2LG4A 5DUKA 5CKTA 1Z7LA 2ZXHA 4ESBA 3OMYA 3GTMJ 1EH7A 4M3EA 1B59A 1XGSA 5DM7F 1J09A 3L2RA 5LD2C 4EVIA 2JPCA 1WJCA 4HF1A 3IH2A 3CLOA 3EQLF 3R0JA 4HBLA 2ISYA 4XOPA 4MTEA 1YX3A 2VKHA 5F0CA 2R93J 5CVUA 4KICA 2IEKA 2STTA 1KYZA 1KU9A 1MBJA 4ZTJA 2E7XA 3I4MJ 2VQHA 2R5YA 3ZCOA 3G71I 2DOEA 3BQYA 3HC7A 4V19K 1HA8A 3LSJA 5L3BA 3A0HC 1IO2A 1QU3A 5H6QA 4DJAA 1GV5A 4BJ6C 4EEFG 4LB5A 2DYSH 3DBHB 5CVIA 2JVGA 3VEPA 4MHGA 2CUZA 4LG0B 3K6GA 1LFBA 3QPLA 3J7YJ 1MNMC 1HKSA 5IT9Z 4UUSB 4LGWA 2K85A 3REOA 4D1QA 1BW6A 2BW3B 2YS9A 1MGTA 3ZQCA 2V1UA 4LLNA 4UUVA 1CGPA 3OS2A 1WJFA 4RGRA 3E1SA 1ETOA 3HRSA 2ZJRF 4ETSA 4O3MA 2CQKA 4YIFA 2CWEA 4DOZA 1OCRH 2DO7A 2IP2A 3RZOJ 2JK3A 2N8GA 1RI7A 4BYYA 2G7HA 3C7JA 3F22A 2ESHA 2FU4A 2KLOA 3QPHA 5ICFA 1FMWA 2GM4A 4EJTA 5CVVA 4GRIA 4G7OF 3R61A 1H89C 5CLSA 3SDGA 5GP9A 5A2QZ 3GLLA 2L9RA 5BPIA 2NAZA 4LIVA 2MYSA 3LA2A 3PQJA 4AVZA 1VQNI 3S14J 4CYCB 2ZXJA 3BY6A 2JA2A 3E5XA 3H92A 3TDZC 4HLYA 2L9NA 1AU7A 2IRFG 2MFZA 2V6CA 2UZKA 5H20A 2E1MC 2E5NA 3MD2A 2R92J 2Z1DA 3ZQGA 1IRGA 1R1VA 2V9PA 4XLHA 4N9IA 2O3FA 1QO0D 2DFIA 3LAPA 2RC4A 4FASD 1TWCJ 2DMQA 4V2FA 3RKWA 4BJ5C 5KHDA 2HWVA 5J1RA 2QA4I 4R8HA 2OQGA 1R23A 2DJNA 3I9V2 3HOWJ 1G3YA 3T8RA 1SFUA 3KEYA 1QPIA 2NVQJ 1E3HA 3FXRA 1TT5B 1ZH5A 4E70A 3HOYJ 4HA8A 3C2GA 3QP6A 5E8GA 1LFUP 4G6DA 5IY5H 2A5YB 2W48A 2MW8A 2CRGA 2KDOA 5J3LA 3E97A 3HOVJ 3H9JA 3ZQ7A 2IW5A 4C30A 3UNGC 4IQJA 2EZIA 4CYDA 3CJNA 4GXOA 1OYIA 1JGSA 5DYMA 4QTRA 4LD5A 4MEXF 4AIDA 4IJAA 3L2UA 4O5VA 4A69C 3TGNA 3QYEA 4BY1J 1SFKA 2EZKA 2OU2A 2F6CA 1DPRA 2P8TA 4AIKA 2KL4A 3H5NA 1S72I 1LB2A 2IGMA 3L1PA 2X48A 2P0WA 2R5YB 1J75A 5EGOA 3A2KA 4GGGA 1ZRDA 4OIOF 1BM9A 2M7BA 1CF7A 1ZREA 3WTZA 5HODA 4HSTA 3KP4A 3DBRB 4XORA 3HUGB 2ZSIB 3OYBA 1UAAA 2F48A 2HVQA 4ZYGA 3I56I 2EB7A 1OCTC 2DPDA 2P5KA 1XGNA 1RZ4A 1NG6A 2VPLA 1ON1A 3KFWX 5IP7J 2AQEA 5B1AH 2R7OA 3Q0UA 2D1VA 3GBGA 1HKQA 5FD6A 2R7XA 1A04A 1X2NA 1IRFA 1LDDA 1OYYA 3GTGJ 3S15J 4RAFA 4YIRX 2M30A 4BE2A 2IXSA 2COBA 3MWMA 1EH8A 2XVCA 4YRVA 3CJQB 2XPWA 3LQRA 3F6VA 4XLAA 1P4XA 1B4AA 3EUAA 3BR3A 1N75A 1GXQA 4TV7A 1MIJA 2NOJB 3KLNA 2CJJA 2JSPA 1FWZA 2R7VA 2XRLA 2XAFA 4PDKA 4HV6A 2DA4A 2HYFA 5L3FA 3B6AA 4BHCA 4BXUA 5J1YA 4EJWA 4YG2F 1U3EM 4ZYEA 1ZG1A 2LTPA 1I39A 3SQNA 3J81Z 1R71A 2DFFA 1U2WA 3KZYA 1FMVA 1YO5C 3MVPA 1S3JA 1OKRA 2VXDA 4IXAA 2KZVA 1QPMA 3DTIA 2NS7A 2QVOA 3CP8A 3MN2A 4FISA 2M45A 1NH3A 1G59A 1Z6TA 2HVRA 2DQLA 3OYKA 2QWWA 5GTIC 4ZTFA 4BUPA 3DF8A 3O8GA 3I55I 4DBQA 2Z9OA 2LY1A 2ID6A 2QYOA 4AC0A 4J19A 3BJ6A 3PM1A 2BHYA 4M6XA 2EK5A 4CCKA 2VE9A 1BR1A 2HPMA 2R7FA 2L9VA 2Z5UA 3OS0A 4A3BJ 3JSOA 2OV7A 2F5FA 2PX9A 1XPXA 5M5YJ 2GLOA 3FM3A 4B43A 4IKFA 2L2OA 2XGEA 3DP7A 4W1UA 4L0ZB 5IP6A 4CH7A 2O8XA 2BYVE 1RUOA 2YX4A 3LSTA 3DLLF 3B02A 2FJ1A 5EGOB 1EV7A 3HIFA 4L9JA 3I64A 1G4DA 2O9LA 4PUSA 2IS6A 4XL9A 3GYHX 1DDNA 3K69A 1TWGJ 2KIUA 4HV5A 4ANJA 4DGWB 4HSRA 3T5XA 3WTTC 3AFHA 5F27A 3BG3A 1IN7A 2LVSA 1U5TA 2R7QA 3OYNA 4IRGA 3BDDA 3GTQJ 3PUBA 3A4CA 5E3OA 3PNVA 1O7FA 1D0XA 3RPUD 5CPRB 3TBIA 1DQUA 3CZ6A 4IPAA 4CCOA 2V79A 3IUOA 2ZMEB 2EFWA 4II3A 3K2ZA 1X1DA 4PK4A 4P96A 3M8FA 1MJAA 1WVRA 3H3UA 3LMMA 1FBUA 4AYBA 1OR7C 3HTSB 4RDUA 3MZYA 4UXNA 1HDDC 2FBKA 2GXAA 1XX5A 2F4MB 2R7RA 1I5ZA 2MLGA 3CMMA 4WXHA 1QBJA 2KRHA 4PJNA 4JX5A 2PI0A 4G9YA 2R7TA 2DXIA 1MKMA 3EPZA 5ILSA 3W6VA 3RJPA 1OPCA 3BWGA 4UY8I 1MH3A 4C3JJ 2OQRA 2IS4A 4R79A 4FT8A 3BP8A 2HZDA 4U0VA 3JREA 2EQRA 5LEJA 3G1OA 1D1AA 1ZRCA 2DA3A 2WAFA 4X1EA 1YHQI 2FNAA 1JE8A 4HZFA 2L7FP 2MGQA 2XC7A 4BXFA 4IHYA 1JKQC 1SD6A 5BPDA 3RZDJ 1IC8A 3LSGA 1FBQA 2XPUA 1JUSA 5DS9A 3R6SA 1XG1A 1GVJA 3OYDA 3CCLI 1DU0A 4UNOA 3H5AA 2K86A 3TDUC 4EGZA 3TEDA 1NHAA 1MMGA 3I58A 2BOLA 1S9HA 1H9GA 2MG4A 5K5OA 1J0RA 1IXRC 3F8CA 1Q1VA 3FKJA 1JKRC 3KP5A 3K4KA 1K4TA 3PSFA 3KYDB 1IRXA 1BI1A 2QQAA 2L54A 2ME0A 4BAYA 5D5VB 2FBHA 3SZGA 3SZPA 1YYVA 5ILVA 2CFOA 4ENNA 3VSKA 4B1RA 3FISA 2FQ3A 2XGDA 2FEZA 2WADA 4CA0A 3W6KB 1KU2A 1TQMA 3DU6A 4CSWA 3S2HJ 1EF4A 5D8LB 4A3LJ 1SMTA 3I54A 1ZKGA 4OAYA 3AG4H 4IX7A 2K4BA 1IJWC 2ZJ2A 2NVUB 1W5TA 2HI3A 4NB5A 2PFBA 2EPFA 2PQ8A 2IGOA 2IS2A 3KP3A 1JHFA 3LSKA 2XV4S 2YU9J 3IHUA 4UV8A 3A02A 2VT3A 1U5TB 2NRAC 4DBRA 2LF7A 3TO7A 2KPMA 1VQ6I 2DA6A 5GPAA 2FF4A 4RAZA 1VFCA 2BEOA 1FSEA 4M72A 4ABZA 3OYJA 3BR2A 1XSDA 4M9SA 4BJTA 2Y0SA 4KISA 2YR2A 3GLXA 2LC2A 5IYDJ 1HW5A 3VYTB 2IS1A 2DQRA 2BXZA 4WXDA 2XF7A 4IRIA 4RM3A 3CTAA 2EJRA 2V1NA 1YQAA 5LHHA 2VQLA 2A6HF 1H8AC 1WSUA 5LGTA 2GAUA 3HJEA 1BIBA 3PQKA 1V4RA 3LSIA 1Z1DA 1TWAJ 3MFKA 5HOOA 3NWTA 3OV8A 1YW8A 4BS9A 4KT6A 2IT0A 4PGGA 3K4LA 2P6SA 4NHJA 4IOCF 1MMSA 2A6TA 1W0UA 2A61A 5CJ9A 2IA1A 2QBYA 2DJIA 2CQQA 3E0JB 3MKWB 4HAMA 2R5ZB 1OCZH 4XRMA 3WU1B 3R4KA 2IA0A 1H88C 4IHWA 2WAQN 1MBGA 5LGNA 2OC6A 2DDAA 2LH9A 2CQXA 3BJAA 1JKOC 1SEUA 1F36A 2PMZN 2HS5A 3RYPA 2E35A 4BU2A 3MZ8A 3ISPA 5H6RA 2ELHA 5JI6A 3BTCA 5M3FJ 4XLNF 1B9NA 2WY8Q 4C2UA 4AD9A 1RR8C 1O3QA 3QU3A 1VQ9I 3TMOA 3JAMZ 1GDTA 3I4PA 2Q2EA 2EV6A 1FZPB 2IAIA 4OMZA 2HU9A 3ABMH 3BCAA 4BHBA 2LDUA 1JTYA 3AG1H 1VQOI 5TISC 2LNBA 4KN7X 1HF0A 2QEXI 1Z21A 5LFAA 3EYIA 1SC7A 2AXLA 1HW1A 3BTLA 1BR2A 2XHKA 4LOCA 1JJ8C 1X3UA 4LG3A 4F52A 1Z3YA 4A3CJ 3KLOA 4L0YB 1X1PA 1VQ7I 1BA5A 2Z33A 3G2BA 4E4HA 2HR3A 1SMYF 4L5IA 1S29A 3HG9A 5H2FC 5E18F 2MSYA 1E0EA 4YIIA 4EJUA 3EUKL 2LREA 4HW0A 1FYMA 4GYIA 2KIFA 3BZCA 4DYRA 2E1OA 2FMYA 2Y75A 2CUFA 1IN8A 1LVKA 1MH4A 2K3PA 2VKVA 2XB5A 4NQWA 1NK2P 2EFOA 2H1LA 3JRBA 1MSEC 2ZB9A 4HRIA 1SAXA 1YJWI 4WWCA 1UELB 2KT0A 2E2HJ 2FSWA 3FXLA 4RB2C 4E7IA 5K7FA 2W00A 3KX2A 4KN4X 1DGWY 1TQPA 1TNTA 3HSEA 4RAGA 1OFCX 1FIAA 3GCMA 3K4JA 2QLZA 5E3NA 3S1NJ 1I6HJ 2CQ7A 2LLKA 1ORKA 2DFHA 3ZXSA 2ADUA 1MMNA 1LFPA 4LMYA 3CDIA 4L9VA 1B8IA 2DTRA 3T0YA 2F5CA 3BCBA 3E6CC 4A3GJ 1FOKA 4YELA 2HOSA 1UHMA 2M0CA 3M9AA 1X3WB 2EIMH 4HX4A 3T1BA 1MJ9A 1ZN2A 1R9TJ 2E1CA 1EA3A 5K7ZA 1SAUA 4I02A 4FX0A 2HYGD 2JA7J 3F3XA 2Y0MA 3WGHA 5JHFA 4F93B 1RKTA 2ZNYA 1RKWA 1K79A 1WZ2A 2QBYB 2K4JA 3L2QA 3RCOA 3S1QJ 2C6YA 3AAFA 1F4KA 1BIAA 1Z67A 3F6OA 1ITYA 2ZMEC 2EFPA 4NC7A 2E71A 4EV0A 5FFXA 1EJ9A 4FQGA 2OJED 4Q4ZF 4B3AA 3K4CA 3JRFA 5DCFA 2L7MP 2QF7A 5KCMA 1YLFA 2BY3A 4Y15A 3OY9A 2DI3A 2DYRH 4ENJA 5L3EA 2V1DA 2K9SA 3OYMA 1AKHB 3FBIB 4HEA2 3LA3A 1XSVA 3KYCB 1DP7P 2Q2EB 3CUQC 1XGMA 5ILUA 1ZARA 3S2DJ 3OYAA 3VB2A 3CCSI 1VF9A 1VQKI 1W7PD 2VPRA 4IHXA 1JJ6C 3CDHA 1BL0A 5ED4A 1TWHJ 3N05A 1BJZA 3HOTA 4ZDOA 2AQFA 1S7OA 3Q9SA 2VKDA 1FC3A 1Y56A 5FLVA 2GA1A 5FLXK 2VL8A 1G3TA 3IP4B 4CO8A 1TZLA 1FLIA 2JT1A 4ITVA 3PO3J 3GUDA 5HDNA 1AOYA 2OTJI 5L3CA 2L3DA 1W5SA 4FHTA 3KEQA 4A6EA 1T39A 1NTCA 1WGXA 3OL4A 4BBSJ 4NUBA 2HOEA 2BY0A 4PJ0C 2V4JC 3OYGA 4PZJA 4NQWB 2JRTA 1TBXA 1RR7A 2IJLA 3I59B 4Q48A 1WI3A 1E2XA 3ABLH 4A5NA 3GZNB 1ETVA 4B44A 1J2XA 2JVHA 4L9TA 2XAHA 2R7WA 3OOPA 2NNYA 3H0DA 1QVUA 3S32A 1IV8A 2KDZA 2DDBA 3KZIC 2EV0A 3V8JA 4ZZDA 3BG7A 1P7IA 1L0OC 5EZHA 4M9XA 4OIPF 4I01A 3S16J 1ULYA 2R7DA 1B8IB 2HEOA 2PMHA 2WA0A 4Y4RA 2GBYA 5IT9K 2L9SA 4A3FJ 2AXTC 4HOBA 3MMYB 2HPIA 1GXPA 2VONA 5BNGA 5F0HA 4BDYA 3DCFA 4ESJA 4RGXA 4RA2A 4V2GA 2IBDA 2P6TA 2D5VA 4I0BA 4CCLA 5IYCJ 1U5TC 2A07F 3RKQA 3WE2A 3Q5FA 3JRAA 3DU5A 1ZGJA 3TW6A 1O4XA 3ASNH 4AWXB 2EILH 2CW7A 4DYCA 3A01A 3K1NA 2WV0A 4XRFA 5E20A 4DZJA 1O3TA 1ACIA 1IGNA 3N97A 1S7EA 4U0WA 3OYIA 3R60A 2KRFA 3HDDA 2X6XA 4WX9A 2M4KA 3OWTA 3IRQA 1FNNA 1YS7A 2WBMA 1T38A 3QQAA 1V54H 5K1YA 2JQ7A 1G2HA 1R36A 2ZC2A 1D1CA 2JWTA 2QUFA 3FDYA 3CLQA 4WF2A 1J59A 2DT5A 4I09A 2EFNA 2MLKA 1A31A 4ENKA 2ETHA 2X9DA 3RQIA 4Y7NJ 3K2AA 1X19A 2KZGA 1AHDP 4J01A 5FRMA 3FHZA 4IL6C 2E36A 4P5OA 2VOOA 2I8DA 3FMRA 1GT0C 2HQ5A 3JRCA 2M2EA 1X3ZB 2Y9YA 2XAJA 2F2EA 3HZJA 5J4YA 3CC7I 2O7OA 2AO9A 2JPBA 1G8XA 1B1BA 1KQ0A 3EUHC 3LL7A 5IYBJ 5LRRA 3SEQA 1Y8RB 3G4SI 5F1JA 2M1BA 4BQAA 3CCUI 2OBPA 1KGSA 4RAYA 1F5TA 4JOMA 4JYKA 2XGCA 3OR1C 5TGTA 3WG7H 9ANTA 3ECHA 4BKXA 3GMEA 1QA6A 4M3GA 4LFUA 3HHGA 2BHZA 2Y69H 3HOUJ 5EDNA 3H36A 3HBLA 1L3LA 2DW4A 1UMQA 2RV8A 3D5RC 1ETWA 1MNDA 2WB1A 3RPUA 1KYWA 1Y0UA 5EEHA 4IQ4A 3CCJI 2KRCA 3H3VK 1WFXA 4I7HA 2H6BA 5DUIA 4S04A 3S93A 1D0ZA 2JTVA 3QODA 4A0YA 4XBFA 3IH4A 2EINH 1T33A 2VKEA 2VBXA 1VQPI 1RIOH 3FK6A 3V8KA 3ZQHA 5AONA 1IUFA 4HQMA 4M71A 1ENHA 1B9MA 1WJ5A 5EF6A 2G9WA 2O03A 2DMNA 3RYRA 1IN5A 2L4MA 1OJLA 4BEHA 3LFUA 2M0MA 4A3DJ 4A93J 1MBFA 2HYJA 2GZWA 2JA5J 1FSHA 2M5WA 1FEXA 3P7NA 5J8FA 2VI6A 4BH9A 2NNNA 3R0AA 3ZPLA 2BZTA 1TLHB 3MQ0A 4NC6A 2UV1A 3KZZA 2K9MA 1ZGWA 4G8XA 1O7LA 1DPUA 2D2WA 3NEUA 4KYWA 4UB8C 1K4SA 3A01B 3DQVC 2DMPA 4I6ZA 2PMUA 1FOWA 1W5CC 5FKNA 2VB6A 4LLLA 2HQNA 5M3MJ 1BOBA 2Z99A 1PJRA 5E17F 4FTHA 3QP5A 3W6JB 3TO9A 3KP2A 3IWZA 2OAZA 1MNEA 1FIPA 3DWLE 2H8WA 3KPHA 4D9JA 2F5DA 1Z3XA 3F21A 3F8BA 3ZR8X 1T95A 2V7FA 1T0FA 3S1RJ 4M9ZA 4LJZF 3TP0A 2M8GX 2K3FA 1Y1WJ 4HNUA 2O0YA 2ECCA 1O3SA 4F55A 4XKCA 4BQOA 3DEWA 4LK0F 1ETQA 2BE5F 2DTZA 3I5UA 3IH3A 2UXXA 1BBYA 2W84A 2DOFA 1QZEA 3FXUA 3RKYA 4HQEA 2W57A 5F1RA 4HYEA 4I0AA 4YFKF 5DV5A 3HXLA 1QGPA 3DLAA 1T98A 5JVTA 1FP2A 1OQYA 4LB6B 4YFNF 3RQ4A 5JR3A 1HXDA 1VQMI 1U9OA 4H0EA 1XS9A 1WH7A 3S1MJ 2BY2A 3WGGA 1SD5A 4ASNA 3QU6A 2CV2A 2LBFA 4OINF 5BQTA 2L4AA 5GTHC 4E7LA 4XLEA 4AM3A 3I53A 3JW4A 3CJTB 2F5EA 3P9IA 3SXYA 1WWXA 1FJLA 2UWMA 3O6BB 1CF7B 1WCMJ 2A3SA 2CW0F 2FD5A 3S3OA 4YFXF 3WTUC 1P9QC 4RB3C 3CMEI 1TT0A 2HDWA 1IAWA 3SHFA 1WKMA 2Q0OA 2EZLA 4N0BA 1B72A 2LYCA 1YS6A 4EATA 3CO7C 3LNQA 3K4MA 1XMKA 4IO9F 5DD4A 3NWSA 1HQCA 2X1DA 1VQ8I 2LOOA 5JLWA 4AUXA 4BL0B 1MZBA 2CUEA 3BPVA 3QOPA 3V7SA 4BEHB 3JTHA 4XOTA 2XAGA 2FMLA 2QKLB 4ESFA 1PUEE 1T56A 4ZJZA 4EGYA 4B47A 2K5CA 5DM6F 1EKEA 4AYBN 4JK1X 4B48A 2QSGX 1XCBA 2PG4A 2H6CA 4E7JA 1ZHFA 3ZMTA 2K9QA 2DK5A 3LQQA 3HKZA 2MD0A 2ZJPF 4MLOA 4RB0A 2VBWA 3BG6A 1I1SA 3ZMVA 3ZMZA 4EJVA 1V5EA 5LHGA 4G7ZF 1R49A 3GTKJ 1YW7A 3FWEA 1U8RA 1FOYA 2V6EA 2GIZA 4XLCA 1FPQA 5JLXA 3IKVA 1DU6A 3KIOA 3IL2A 3KETA 1FYLA 1RUNA 4F3QA 1WJAA 1USTA 1TTYA 2RVCA 4DNCA 1J9IA 2DU9A 3WG9A 1N78A 2WWYA 1D8KA 3KP6A 4CCJA 3BZ6A 4IF4A 5B66C 1OLTA 5HLHA 2RQQA 1FTTA 1RPWA 2ECBA 2IGNA 1I27A 2P4WA 2X51A 1Z05A 4G6TB 3ZMUA 3OIOA 2YSRA 1ZG5A 3M4OJ 2IPQX 4RLFA 4CCNA 3WTYC 1X1BA 2ELJA 5KAIC 3MZHA 3FKIJ 2K40A 3KP7A 4N9HA 4I2OA 2BVMA 1D0YA 2A69F 2CH0A 1FY7A 2VBYA 3O3KA 3IRRA 3B73A 3HOSA 2GOMA 1ZK8A 3CF2A 5D5WB 2ISZA 3CC4I 2LKPA 3DXJF 1Y6IA 2HXIA 1QNTA 2CUJA 2F4OB 4MFDA 2BBYA 4MNUA 1UG2A 4BBRJ 4EM0B 3ULQB 2K9NA 2ZSHB 3FXOA 4BXXJ 3TQNA 3A03A 3BJOA 1F9NA 3BG9A 3SDBA 2VLAA 1WH5A 3ELKA 2QCOA 1LE8A 1LNWA 5L3DA 4QSHA 5B3SH 4L18B 1R5ID 2J5OA 4A12A 5M5WJ 2OD5A 3FZVA 4CDGA 5J6XA 4E7HA 5CVJA 4XN3A 2G7UA 1VI0A 2LBFB 1Z0XA 2XAQA 2WAEA 5DCMA 3TO6A 2Y9ZA 1T6SA 5F64A 3KYLA 1FP1D 3K70C 1ETXA 1BR4A 2W4SA 3GTJJ 4XIDA 1R22A 5KK1A 2OPTA 3U1DA 3CMAI 1TWFJ 2X1EA 3BG5A 2K27A 2VJ4A 5LBQA 2CGPA 1MBKA 3VODA 3DV8A 2OF7A 4DYQA 4KIFA 5EYRA 2JUCA 1B72B 4Q5SF 3D0SA 5ICCA 4OAZA 5E1XA 3BC8A 2FXAA 1J7KA 4KMUX 4M3BA 2NOGA 1ETYA 5HDKA 2NS8A 1ETKA 3HM5A 1XTAA 1ZGAA 4P1WA 1JGGA 3CCQI 1XD7A 3C3WA 2QQ8A 1O57A 3IAM2 4KNYA 5D5XB 3JR9A 1SFXA 2QM3A 1VTNC 4XKBA 1R4NB 4P9UA 3ONQA 3IWFA 1I6XA 1W0TA 3BR0A 4LIUA 1TC3C 3BZKA 2MH2A 2ZCWA 2GOXB 1TQIA 3X2QH 4W97A 1VQ5I 1XN7A 2ZKZA 4HPQA 2IGKA 2LFBA 5E1WA 2P5LC 4OOIA 4HDUA 3QRFF 1HLVA 1K7AA 2EH3A 1TW3A 3C2HA 3ZOBA 2KMUA 4FCYA 2HKXA 2KP6A 1MBEA 2R4GA 2ME6A 1XMXA 4BQQA 1U0JA 1UB9A 3TKYA 4XMYA 2XB0X 3DBLB 4D7MA 1R5GA 1MD0A 5DDGA 2HDCA 4A0XA 2TRTA 2IVMA 3K4NA 4GYGA 3ESWB 3BR1A 2BV6A 5F0FA 2FOKA 4M3DA 1APLC 3HPGA 4H4KC 3GFIA 1BJAA 1MMDA 1HSJA 2WAQA 5LHIA 3M7GA 1S5LC 2VIXA 3OL3A 3IV5A 1TNSA 3CESA 2L01A 2HZTA 3BT9A 2KIMA 1ZRFA 4U7DA 1ZQ3P 2QSFX 1R1UA 4E7ZA 3VYRB 2RGVA 2DN0A 2HXOA 1XC5A 4MGRA 2XKPA 4GDFA 1OCPA 2DMTA 3CQZJ 3Q0VA 1OISA 1YG2A 3GWZA 5E3LA 4NNJA 2Y30A 3LA7A 1X1CA 4PJJA 1I1GA 5BS6A 3I71A 4F91B 1KQ9A 2VUMJ 2W1OA 3EYYA 2NVXJ 2L7ZA 3DKWA 1LE8B 1HDPA 1SANA 3L2VA 4PSWA 3CO6C 3NARA 4MQVA 4GO1A 2LMDA 2W85A 4CXFA 3GFJA 1MW7A 2ZNZA 1G6NA 3K1MA 5FKOA 3MKZA 5DCMB 5FB2A 3TL4X 3J7AO 4KFCA 3FIWA 3ERED 1T8IA 1X2MA 3WHCA 1IDYA 2BXYA 1QHHD 2DA7A 5J40A 4CZZA 3H1CA 3U2RA 4XK4A 5HVQC 2H1KA 1J5YA 1WPKA 4DW6A 1FOXA 1TP4A 2NS0A 3W2VA 3RI4A 3PFIA 3H35A 3V7RA 3ABTA 4MIMA 4C2MJ 1JI8A 1SFOJ 1HSTA 1BC8C 3J80K 4CICA 3BLYA 1GLNA 1VZ0A 3M1EA 3H5RA 3HSFA 3HRMA 3FMQA 3FXMA 2XASA 3JRIA 4XRSG 2QQ9A 4LG0A 4IZZA 4RGUA 3FXKA 2GWRA 3H0GJ 2QKMB 2CMPA 2JUGA 3DTKA 1H0MA 1REPC 1WJBA 2LY2A 1PVEA 2FUG2 3O2PE 4X0GA 3F8NA 1P7JA 2B63J 5HLGA 4U0YA 1BI3A 5K7HA 2LY9A 1UHSA 1ODDA 3CF5F 3MEXA 3OS1A 4XLPF 1X58A 1MBHA 4JX6A 3GZ6A 1UCRA 3WTVC 2XGXA 3QWLA 2AS5F 5ICGA 2EA2A 2Z16A 1YW9A 4LLGF 4Z6YA 3SFIA 3Q0WA 1R6RA 2A68F 1Z77A 2JZYA 2X0LA 6PAXA 3M3YJ 3P9KA 4G94A 3S2WA 3GTPJ 3M07A 2W82A 1JT6A 2QENA 4N4OB 3E6MA 2KQRA 3MCZA 5EZGA 2F5VA 3SFZA 5D8KB 4DQ2A 4BNCA 4QWQA 3FK7A 1D5VA 1A5JA 5FO5A 1OMIA 2O5RA 5F6FA 3QYBA 4BACA 3V7CA 4HX8A 2EV5A 4X6AJ 3Q3SA 1R1TA 2LF8A 1NG7A 2GXBA 3K10A 3GZ5A 5JVGF 1R5HA 1UZCA 1ZELA 1ZYRF 3DEEA 3QPTA 4UVCA 4OIRF 1IW7F 3WU0A 4CCMA 1SD4A 4PJMA 2OUMA 3RKXA 2FQ4A 1UJ8A 4E7KA 1W36C 5FLXZ 3MKYB 3CC2I 3PO2J 1U78A 4G7HF 4QIWN 3PUFA 1Z9CA 1FYKA 2LRDA 2RAEA 1SVLA 1BW5A 1IZ1A 2V9VA 4IEJA 5KNLA 2CV1A 4C2TA 3HGYA 4R1HA 2M8EA 3BR5A 2DOAA 5KVRA 5CYVA 4PFOA 1IRZA 2HNHA 3M8EA 2ID3A 3GF2A 2CG4A 3L00A 4Y17A 1FBSA 2MA3A 2FNPA 4NDLA 4XR6A 4XONA 3W2WA 1V55H 2MD5A 3TOBA 1W4MA 4ZZLA 2PJPA 1RETA 2M3AA 2RN7A 4F7ZA 5HLTA 2PJRA 4C9YA 3O8HA 2VOPA 5D6EA 1YIOA 4U88A 4QPQA 1SVOA 4L9NA 1RNLA 2Q1ZB 2BVLA 3LSRA 2HFHA 3GFLA 2EIKH 2XSDC 1I3QJ 2DT7B 2H09A 3WTWC 3AG2H 1BI2A 3SYTA 3OSFA 1YJNI 1JT0A 2Q8KA 5GADJ 3HUGA 4UHTA 1ZR4A 5LEKA 2XSJC 3E7LA 2DA5A 4OWRB 4AU7A 5BMZA 2Z2SB 1ZAOA 2JMWA 3GEZA 3ZGKA 1WQ2A 2LSOA 3PNYA 3OIQA 4MFEA 3HYIA 1LDJA 2X4HA 3BPXA 3K9TA 1LQ1A 2VC1A 5B1BH 2XDVA 2EIJH 5CVRA 1MMAA 3W2AA 1R58A 1P4AA 2DT6A 5A2QK 2JSCA 2FBIA 4RS8A 3ZMSA 4G6QA 3AL0B 3JTGA 1RESA 3ZRGA 2ZFWA 5HDGA 3IAS2 1CQTA 2B9SA 3HRTA 4CUGA 1ON2A 2OCEA 2GQQA 3TP3A 3CCEI 2R0QC 3S17J 5DD8A 2OZUA 5LLQA 2CV0A 2E5ZA 4MTDA 3VOEA 5FD5A 2I10A 2E2IJ 2DPUA 3RSNA 3DPLC 3RIRA 5J1UA 1VNDA 2QQBA 2PBIA 2BGCA 3QPSA 4OIQF 2DCEA 3PFYA 3D1NI 2L02A 2A05A 3E6BA 1FX7A 4WXCA 4U7BA 3G1MA 3GFMA 4RM2A 3E5UA 1KA8A 2COMA 2IA2A 3FXJA 3G1LA 4XM3A 4PSXA 4Y52J 2WTEA 1YITI 3K1PA 3FBNB 3OYCA 4IHTA 2DAOA 1P92A 2HTSA 3RTRA 1ZLJA 2H8RA 2R7SA 2FA5A 1E17A 5F04A 3C1DA 2E2JJ 3P9CA 3DKYA 3TW7A 1YOVB 2X6OA 4RLQA 2QZ8A 2XPVA 1R4MB 4XLFA 2XF6A 5J8CA 3HEFA 2WB1N 1WJDA 1YTYA 1MJBA 1JKPC 2R3SA 2HDDA 3TOAA 1P4WA 2E34A 1V5FA 5CQEA 5IPAA 3L7WA 5DEQA 1V3FA 1MDMA 2PJRB 5GPCA 4EQQA 5C44J 1C0WA 2L7KA 1JXSA 4M6VA 1WJEA 3NQOA 3CP2A 4KJZA 1HCRA 3OYLA 3K70D 1YX5A 3OYFA 2X6WA 4LITA 3VYSB 3FHNA 3F8MA 2XIGA 3OYEA 1PP8F 1QRYA 1ZR2A 1FTZA 4WK8F 1VQLI 4PJLA 1USSA 2XF5A 2W7NA 2ICWG 4ENMA 2O6GE 1LVAA 2CU7A 3P5JA 2X85A 1KONA 4Y33A 1KZHA 3T8TA 3S3NA 3JRHA 3GTOJ 2OCCH 1Y8QB 3SJMA 2F4IA 2TDXA 3ABKH 4M74A 1IN6A 1YE9A 3M8JA 3G3ZA 1Q1HA 1X4PA 5HS7A 3K0LA 1IXSB 5FGMA 5AIQA 1YJ9I 1IF1A 3MKLA 1GUUA 3E6DA 2ZMEA 5FRNA 2P7VB 1POGA 4QLCU 2WV1A 2CSOA 1Y0NA 3AKZA 5C4JJ 1IG7A 2RNGA 2KKOA 4IHSA 2EA4A 2VASA 2VE8A 3DPUA 5D5UB 1FT9A 2Y2ZA 3CUQA 1PUFA 4CHUA 4C3IJ 4OMYA 2GIVA 4DIQA 3J7AY 4YEJA 3WODF 4A2UA 2LK2A 3ERMA 3IKTA 5GAEJ 3HOZJ 1PP7U 2X1CA 2QSHX 4UUTA 2FRHA 4XQFA 1NK3P 3Q9VA 3LWFA 1IV6A 2MBFA 3J81K 4F92B 2L5QA 1O3RA 2DBBA 2Y31A 4KUMA 2KJBA 2V1XA 2UXNA 2WC2A 3WU2C 1STZA 3CJRB 1U9NA 5FFZA 2VQCA 2NXNB 4E7SA 3ZQFA 4FE7A 2R7UA 1LUJB 5EG0A 1XGOA 3UR3C 4A3MJ 4II2A 3FM5A 4HF0A 3CD6I 3ABUA 3IC7A 2ZXWH 3CCRI 2VJIA 4LK1F 1N77A 3PNTA 5F08A 4D5CA 1BN5A 4XSZF 5CQGA 4A3EJ 2B0LA 2QGUA 2Z3YA 4IHVA 3WTSC 2HKOA 1XDUA 2XAUA 5IP9J 1IDZA 1E3PA 3NRVA 3GO5A 2KFDA 2FE3A 4KIBA 4S05A 1UG0A 1MDMB 5K5RA 1RRJA 1YFHA 2M7AA 3KCCA 4IRHA 1GHCA 3I3LA 5FKLA 2ZXIA 3GW2A 2GA2A 4HNVA 4EM2A 4A0ZA 3L2CA 4CZCA 1G3WA 4A6DA 1Z91A 2PEXA 3CCMI 3HHHA 3COAC 3L9FA 1G3SA 2JN6A 1JUMA 3GVAA 3WTXC 4FETA 4BQNA 2P5VA 3U1KA 4B4CA 2HQRA 1QQIA 3K4BA 4AIJA 1B6AA 3C2BA 1QZYA 4ZYHA 2O8KA 1ZG3A 3HRUA 3HKZN 4MEYF 1HKTA 2VODA 4XNFA 1XB4A 5FLMJ 3BQZA 1ZTRA 3C18A 1LKXA 3JSPA 5HNFA 3BROA 2KHMA 3HOXJ 4I98B 2YUSA 3ZMDA 1WRJA 3WGIA 2CQNA 1A36A 4GCVA 5J47A 1DUXC 2ESNA 5LGUA 2DA1A 2MH9A 4XN0A 4D0PA 4Y13A 2M34A 2D45A 1DGRM 3HPHA 1Y1VJ 4ON0A 5ERIA 3VDXA 5BOXA
chains in the Genus database with same CATH topology
3CUQB 1TW2A 3ZN1A 2VT2A 2XRNA 4M6YA 2RDPA 4JBAA 2P7CB 2EFQA 3HTUA 2YU3A 1ZLKA 3MAJA 5TJJA 2HTJA 4WCGA 3ZP5A 4EJOA 2STWA 2OA4A 2E1NA 3EUHA 4P55A 5AIPA 2ZBKA 2GXGA 3F72A 1XSXA 4HLXA 3GX4X 5TRDA 3F23A 1XMAA 1HBXG 2VC0A 3DEUA 4MQ9F 1ONVA 1IXCA 2MC3A 3F8FA 3FX3A 5EEGA 1HW2A 4RB1A 1IUYA 3G73A 3FF5A 1QZZA 3D5LA 3V8LA 5LRSA 3DPTA 3SZTA 5IT3A 3QAHA 3GXOA 2E7WA 4CGZA 1OYWA 3LFKA 1IN4A 1LDKB 4O6JA 3WE3A 3L09A 3U9GA 2VN2A 1K6OA 4HDVA 4RGSA 3RPQA 1S8NA 3KEOA 5HLIA 5HS8A 4A5MA 4PCQA 4AIHA 1K78A 1W7PA 2HGCA 2VBZA 2K7LA 2EWNA 1T2KA 1KU7A 2ZO4A 4P9FA 5JHUA 3ROUA 1S6LA 2OZ6A 4B8XA 1JHHA 1U6GA 1KU3A 5K5QA 1UHWA 2XKOA 2XROA 2CYYA 3JAMK 1LEAA 2J5PA 3BOQA 4JQFA 3I0TA 3RDIA 3ZN0A 3EETA 4KDPA 4M73A 4KA4A 4HF2A 2RKHA 3E3VA 4HX7A 5D4SA 2DLLA 4KMFA 1BI0A 2PN6A 5L3GA 1S7AA 2H94A 2DK8A 3VFZA 2Y48A 1D8JA 1BOAA 1KQ8A 3KE2A 2A6EF 4AVPA 3FXQA 4EMSA 2W24A 2CFXA 1F1ZA 5E1ZB 2D1HA 2RQPA 1AWCA 3N4MA 2PLYA 2CO5A 4XSXF 4Z2YA 5D6FA 3I59A 1P2FA 4PGHA 1OR7A 4UVAA 1Z6RA 3J80Z 2YPRA 3H3ZA 1XCVA 4Q47A 2M87A 1PDNC 3DFGA 1WI9A 3V4GA 4UV9A 2KJCA 4BHPA 4KIGA 4ZYDA 1R7JA 2W25A 5JFRA 4KT5C 1R00A 1K78B 1Z7UA 1P6RA 1W7PB 1D3YA 1EH6A 4L5JA 4ZH4F 4FX4A 3EDPA 3E5QA 1UFMA 1BC7C 1SFEA 5HS9A 3FMSA 3ECOA 5E8IA 4IVNA 1LJ9A 2K02A 2YX7A 1H9TA 5D4RA 1SD7A 4OU0A 1XDSA 2O61A 4UVBA 2RNJA 2XUBA 3CUOA 4EM1A 2ACJA 4K2EA 1LEBA 5ICEA 3HSRA 4B09A 3ML6A 2H27A 3LAJA 2VXZA 2NYXA 5DUKA 4ESBA 1EH7A 1B59A 1XGSA 4EVIA 2JPCA 4HF1A 3CLOA 3EQLF 3R0JA 4HBLA 2ISYA 4MTEA 5CVUA 4KICA 2STTA 1KYZA 1KU9A 2E7XA 5L3BA 5H6QA 4LB5A 5CVIA 3VEPA 4MHGA 4LG0B 1HKSA 5IT9Z 4LGWA 3REOA 4LLNA 4UUVA 2V1UA 1MGTA 1CGPA 4RGRA 3HRSA 4ETSA 4O3MA 2CQKA 4YIFA 2CWEA 2DO7A 2IP2A 1RI7A 4BYYA 2G7HA 3F22A 3C7JA 2ESHA 2FU4A 3QPHA 5ICFA 4EJTA 5CVVA 4G7OF 3R61A 5CLSA 5A2QZ 5BPIA 2NAZA 3LA2A 3PQJA 2ZXJA 3BY6A 3E5XA 3H92A 3TDZC 4HLYA 2IRFG 2V6CA 2UZKA 5H20A 1IRGA 1R1VA 4N9IA 2O3FA 1QO0D 2DFIA 3LAPA 2RC4A 3RKWA 2HWVA 4R8HA 2OQGA 1R23A 1G3YA 3T8RA 1SFUA 3FXRA 1ZH5A 4E70A 4HA8A 3QP6A 5E8GA 4G6DA 2A5YB 3E97A 3ZQ7A 2IW5A 4CYDA 3CJNA 4GXOA 1OYIA 1JGSA 5DYMA 4LD5A 4MEXF 4IJAA 4O5VA 3TGNA 2OU2A 4AIKA 1DPRA 2P8TA 1LB2A 1J75A 4GGGA 1ZRDA 4OIOF 1BM9A 1CF7A 1ZREA 3WTZA 3KP4A 4ZYGA 2EB7A 2DPDA 2P5KA 1XGNA 1RZ4A 1ON1A 3KFWX 5FD6A 2D1VA 1HKQA 1A04A 1IRFA 1LDDA 1OYYA 2M30A 3MWMA 1EH8A 2XVCA 3LQRA 3F6VA 1P4XA 1B4AA 1GXQA 4TV7A 3KLNA 1FWZA 2XAFA 4PDKA 4HV6A 2HYFA 5L3FA 4BHCA 4BXUA 4EJWA 4YG2F 1U3EM 4ZYEA 1ZG1A 3J81Z 3SQNA 3KZYA 1U2WA 1YO5C 1S3JA 1OKRA 4IXAA 1QPMA 2QVOA 2M45A 1Z6TA 2DQLA 2QWWA 3DF8A 2Z9OA 2QYOA 3BJ6A 4M6XA 2EK5A 2VE9A 2R7FA 2Z5UA 3JSOA 2F5FA 3FM3A 3DP7A 4L0ZB 2O8XA 2BYVE 1RUOA 2YX4A 3LSTA 3B02A 1EV7A 3HIFA 4L9JA 3I64A 1G4DA 3GYHX 1DDNA 3K69A 2KIUA 4HV5A 3T5XA 3WTTC 1IN7A 1U5TA 4IRGA 3BDDA 1O7FA 4IPAA 2V79A 2ZMEB 2EFWA 3K2ZA 4P96A 3M8FA 1MJAA 3H3UA 1FBUA 3HTSB 3MZYA 4UXNA 2FBKA 1I5ZA 2MLGA 4WXHA 1QBJA 2PI0A 4G9YA 1MKMA 5ILSA 3RJPA 1OPCA 3BWGA 2OQRA 4R79A 4FT8A 3BP8A 4U0VA 5LEJA 1ZRCA 2FNAA 1JE8A 4HZFA 1SD6A 5BPDA 1FBQA 3R6SA 1GVJA 4UNOA 2K86A 3TDUC 4EGZA 1NHAA 3I58A 1H9GA 5K5OA 1J0RA 1IXRC 3F8CA 3KP5A 1BI1A 2QQAA 2L54A 4BAYA 5D5VB 2FBHA 3SZPA 1YYVA 5ILVA 4ENNA 2FQ3A 2FEZA 3W6KB 1KU2A 1TQMA 5D8LB 1SMTA 3I54A 2K4BA 2ZJ2A 1W5TA 4NB5A 2PFBA 2PQ8A 3KP3A 1JHFA 2XV4S 3IHUA 4UV8A 2VT3A 1U5TB 2NRAC 2LF7A 3TO7A 2FF4A 4RAZA 2BEOA 1FSEA 4M72A 1XSDA 4M9SA 2YR2A 3GLXA 1HW5A 2DQRA 4WXDA 4IRIA 3CTAA 2EJRA 1YQAA 5LHHA 2A6HF 1WSUA 5LGTA 2GAUA 1BIBA 3PQKA 1V4RA 1Z1DA 3MFKA 5HOOA 3OV8A 1YW8A 2IT0A 4PGGA 2P6SA 4NHJA 2A61A 5CJ9A 2IA1A 2QBYA 4HAMA 3WU1B 3R4KA 2IA0A 5LGNA 3BJAA 2HS5A 3RYPA 3ISPA 5H6RA 2ELHA 5JI6A 4XLNF 1B9NA 4AD9A 1O3QA 3QU3A 3JAMZ 3I4PA 2Q2EA 2EV6A 1FZPB 4OMZA 4BHBA 2LDUA 2LNBA 4KN7X 3EYIA 2AXLA 1HW1A 2XHKA 1X3UA 3KLOA 4L0YB 2Z33A 2HR3A 1SMYF 4L5IA 1S29A 5E18F 4YIIA 4EJUA 4HW0A 1FYMA 4GYIA 2KIFA 2FMYA 2Y75A 1IN8A 4NQWA 2EFOA 1SAXA 4WWCA 2FSWA 4RB2C 4KN4X 1TQPA 1TNTA 3HSEA 2QLZA 2ADUA 4LMYA 4L9VA 2DTRA 3T0YA 2F5CA 3E6CC 1FOKA 1UHMA 3M9AA 4HX4A 3T1BA 1MJ9A 1ZN2A 2E1CA 4I02A 4FX0A 2HYGD 3F3XA 2Y0MA 3WGHA 2ZNYA 1K79A 2QBYB 2K4JA 2C6YA 3AAFA 1F4KA 1BIAA 3F6OA 2EFPA 4EV0A 5FFXA 4Q4ZF 5DCFA 1YLFA 4Y15A 2DI3A 4ENJA 5L3EA 2V1DA 3LA3A 1XSVA 1DP7P 3CUQC 1XGMA 5ILUA 1ZARA 3VB2A 1W7PD 3CDHA 5ED4A 3HOTA 1S7OA 3Q9SA 1FC3A 2GA1A 5FLXK 1G3TA 4CO8A 1FLIA 2JT1A 3GUDA 5HDNA 1AOYA 5L3CA 2L3DA 1W5SA 4FHTA 3KEQA 4A6EA 1T39A 2HOEA 4PZJA 2JRTA 1TBXA 2IJLA 3I59B 4Q48A 1E2XA 4A5NA 1J2XA 4L9TA 2XAHA 3OOPA 2NNYA 2EV0A 3V8JA 4ZZDA 1L0OC 4M9XA 4OIPF 4I01A 1ULYA 2R7DA 2HEOA 2PMHA 5IT9K 4HOBA 1GXPA 2VONA 4ESJA 4RGXA 2P6TA 4I0BA 1U5TC 2A07F 3WE2A 3Q5FA 1ZGJA 4AWXB 3K1NA 2WV0A 4XRFA 5E20A 1O3TA 3N97A 4U0WA 3R60A 2KRFA 4WX9A 3IRQA 1FNNA 1YS7A 1T38A 5K1YA 1R36A 2QUFA 4WF2A 1J59A 2DT5A 4I09A 2EFNA 2MLKA 4ENKA 2ETHA 3FHZA 4P5OA 2VOOA 3FMRA 2XAJA 2F2EA 2JPBA 1B1BA 1KQ0A 5LRRA 2M1BA 4BQAA 2OBPA 1KGSA 4RAYA 1F5TA 3ECHA 4LFUA 3HHGA 1L3LA 2DW4A 2RV8A 3RPUA 1KYWA 1Y0UA 5EEHA 4I7HA 2H6BA 5DUIA 4S04A 2JTVA 4A0YA 4XBFA 2VBXA 1RIOH 3V8KA 5AONA 4HQMA 4M71A 1B9MA 2G9WA 2O03A 3RYRA 1IN5A 2L4MA 2GZWA 1FSHA 2M5WA 3P7NA 5J8FA 4BH9A 2NNNA 3R0AA 3ZPLA 1TLHB 3MQ0A 3KZZA 4G8XA 1O7LA 1DPUA 2D2WA 3NEUA 4KYWA 3DQVC 2PMUA 4LLLA 2HQNA 2Z99A 5E17F 3QP5A 3W6JB 3TO9A 3KP2A 3IWZA 2OAZA 2F5DA 3F21A 3F8BA 1T0FA 4M9ZA 4LJZF 2O0YA 1O3SA 4LK0F 3I5UA 2BE5F 2UXXA 1BBYA 2W84A 3FXUA 3RKYA 4HQEA 2W57A 5F1RA 4HYEA 4I0AA 4YFKF 5DV5A 1QGPA 1T98A 5JVTA 1FP2A 4LB6B 4YFNF 5JR3A 1HXDA 4H0EA 3WGGA 1SD5A 4ASNA 3QU6A 4OINF 5BQTA 2L4AA 3I53A 3JW4A 2F5EA 3P9IA 3SXYA 1WWXA 2UWMA 3O6BB 1CF7B 2A3SA 2CW0F 4YFXF 3WTUC 4RB3C 1IAWA 3SHFA 1WKMA 2Q0OA 4N0BA 1YS6A 3CO7C 1XMKA 5DD4A 1HQCA 1MZBA 3BPVA 3V7SA 3QOPA 3JTHA 2XAGA 2FMLA 4ESFA 1PUEE 4EGYA 4JK1X 1XCBA 2PG4A 2H6CA 1ZHFA 3ZMTA 2DK5A 3LQQA 4RB0A 2VBWA 1I1SA 3ZMVA 3ZMZA 4EJVA 5LHGA 4G7ZF 1YW7A 3FWEA 1U8RA 1FPQA 3IKVA 3IL2A 3KETA 1FYLA 1RUNA 1USTA 1TTYA 2RVCA 4DNCA 1J9IA 2DU9A 3WG9A 2WWYA 1D8KA 3KP6A 3BZ6A 4IF4A 5HLHA 1I27A 2P4WA 1Z05A 3ZMUA 2YSRA 1ZG5A 2IPQX 3WTYC 3MZHA 4N9HA 3KP7A 4I2OA 2A69F 1FY7A 2VBYA 3O3KA 3IRRA 3B73A 3HOSA 5D5WB 2ISZA 2LKPA 3DXJF 1QNTA 2BBYA 4MNUA 4EM0B 3ULQB 3TQNA 3BJOA 1F9NA 3ELKA 1LNWA 5L3DA 4L18B 2J5OA 4A12A 2OD5A 3FZVA 4CDGA 5J6XA 5CVJA 2G7UA 2XAQA 3TO6A 5DCMA 1T6SA 5F64A 1FP1D 1R22A 5KK1A 3U1DA 2K27A 5LBQA 2CGPA 3VODA 3DV8A 4KIFA 4Q5SF 3D0SA 5ICCA 5E1XA 2FXAA 1J7KA 4KMUX 5HDKA 1ZGAA 1XD7A 3C3WA 1O57A 4KNYA 5D5XB 1SFXA 2QM3A 1VTNC 4P9UA 3IWFA 1I6XA 2MH2A 2ZCWA 1TQIA 1XN7A 2ZKZA 5E1WA 2P5LC 4OOIA 4HDUA 3QRFF 1K7AA 1TW3A 2HKXA 1UB9A 3TKYA 1R5GA 1MD0A 5DDGA 2HDCA 4A0XA 2IVMA 4GYGA 2BV6A 2FOKA 3GFIA 1BJAA 1HSJA 5LHIA 3M7GA 1TNSA 2L01A 2HZTA 2KIMA 1ZRFA 4U7DA 1R1UA 2RGVA 4MGRA 2XKPA 1YG2A 3GWZA 3LA7A 1I1GA 5BS6A 3I71A 1KQ9A 3EYYA 3DKWA 3CO6C 4MQVA 4GO1A 2W85A 4CXFA 3GFJA 2ZNZA 1G6NA 3K1MA 5DCMB 5FB2A 3J7AO 4KFCA 3ERED 4CZZA 3U2RA 5HVQC 1J5YA 2NS0A 3RI4A 3PFIA 3V7RA 3ABTA 1HSTA 1BC8C 3J80K 4CICA 3M1EA 3HSFA 3HRMA 3FMQA 2XASA 2QQ9A 4LG0A 4RGUA 2GWRA 1H0MA 1REPC 3O2PE 3F8NA 5HLGA 4U0YA 1BI3A 1ODDA 3MEXA 4XLPF 3GZ6A 1UCRA 3WTVC 2XGXA 2AS5F 5ICGA 2EA2A 1YW9A 4LLGF 2A68F 2X0LA 2JZYA 6PAXA 3P9KA 4G94A 3S2WA 2QENA 3E6MA 3MCZA 3SFZA 5D8KB 4DQ2A 4BNCA 4QWQA 1D5VA 5FO5A 1OMIA 5F6FA 3V7CA 4HX8A 2EV5A 1R1TA 2LF8A 2GXBA 3GZ5A 1R5HA 1ZYRF 3QPTA 4OIRF 4UVCA 1IW7F 3WU0A 1SD4A 3RKXA 5FLXZ 1U78A 4G7HF 1Z9CA 1FYKA 1IZ1A 2V9VA 4R1HA 2M8EA 5KVRA 5CYVA 3M8EA 3GF2A 2CG4A 3L00A 4Y17A 1FBSA 2MA3A 2FNPA 3TOBA 2MD5A 4ZZLA 1W4MA 2PJPA 2RN7A 4F7ZA 2VOPA 5D6EA 1YIOA 4U88A 4L9NA 1RNLA 2HFHA 3GFLA 2H09A 3WTWC 1BI2A 2Q8KA 3HUGA 4UHTA 5LEKA 5BMZA 3GEZA 1ZAOA 1WQ2A 2LSOA 3HYIA 1LDJA 2X4HA 3BPXA 3K9TA 1LQ1A 2VC1A 5CVRA 1R58A 1P4AA 5A2QK 2JSCA 2FBIA 4RS8A 3ZMSA 4G6QA 3JTGA 2ZFWA 5HDGA 3HRTA 1ON2A 2GQQA 5DD8A 2OZUA 5LLQA 4MTDA 3VOEA 5FD5A 2DPUA 3DPLC 3RIRA 2QQBA 2PBIA 2BGCA 4OIQF 2L02A 3E6BA 1FX7A 4WXCA 4U7BA 3GFMA 3E5UA 1KA8A 2COMA 2IA2A 2WTEA 3K1PA 4IHTA 2DAOA 1P92A 2HTSA 3RTRA 1ZLJA 2FA5A 1E17A 3C1DA 3P9CA 2QZ8A 5J8CA 1YTYA 1MJBA 2R3SA 3TOAA 1P4WA 3L7WA 5DEQA 1V3FA 1MDMA 1C0WA 4EQQA 1JXSA 3NQOA 3F8MA 2XIGA 1PP8F 4WK8F 1USSA 4ENMA 2O6GE 1LVAA 3T8TA 2TDXA 4M74A 1IN6A 3G3ZA 1Q1HA 5HS7A 3K0LA 1IXSB 5FGMA 5AIQA 1IF1A 3E6DA 2ZMEA 2P7VB 4QLCU 2CSOA 2KKOA 4IHSA 2EA4A 2VE8A 5D5UB 1FT9A 3CUQA 4CHUA 4OMYA 2GIVA 3WODF 4A2UA 3IKTA 1PP7U 2FRHA 3Q9VA 3LWFA 2MBFA 3J81K 1O3RA 2DBBA 4KUMA 2KJBA 2V1XA 2UXNA 2WC2A 1STZA 5FFZA 1XGOA 3FM5A 4HF0A 3ABUA 3IC7A 4LK1F 1BN5A 4XSZF 2B0LA 2Z3YA 3WTSC 2HKOA 1XDUA 3NRVA 3GO5A 2FE3A 4KIBA 4S05A 1MDMB 5K5RA 1YFHA 4IRHA 3KCCA 1GHCA 3GW2A 2GA2A 4EM2A 4A0ZA 3L2CA 1G3WA 4A6DA 1Z91A 2PEXA 3HHHA 3COAC 3L9FA 1G3SA 3GVAA 3WTXC 2P5VA 2HQRA 1QQIA 4AIJA 1B6AA 1QZYA 4ZYHA 1ZG3A 3HRUA 4MEYF 1HKTA 2VODA 1XB4A 3C18A 3JSPA 3BROA 4I98B 3ZMDA 1WRJA 3WGIA 4GCVA 1DUXC 2ESNA 5LGUA 2MH9A 4D0PA 2D45A 4Y13A 4ON0A 5ERIA 5BOXA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3CUQ B;  1TW2 A;  3ZN1 A;  2VT2 A;  2XRN A;  4M6Y A;  2RDP A;  4JBA A;  2P7C B;  2EFQ A;  3HTU A;  2YU3 A;  1ZLK A;  3MAJ A;  5TJJ A;  2HTJ A;  4WCG A;  3ZP5 A;  4EJO A;  2STW A;  2OA4 A;  2E1N A;  3EUH A;  4P55 A;  5AIP A;  2ZBK A;  2GXG A;  3F72 A;  1XSX A;  4HLX A;  3GX4 X;  5TRD A;  3F23 A;  1XMA A;  1HBX G;  2VC0 A;  3DEU A;  4MQ9 F;  1ONV A;  1IXC A;  2MC3 A;  3F8F A;  3FX3 A;  5EEG A;  1HW2 A;  4RB1 A;  1IUY A;  3G73 A;  3FF5 A;  1QZZ A;  3D5L A;  3V8L A;  5LRS A;  3DPT A;  3SZT A;  5IT3 A;  3QAH A;  3GXO A;  2E7W A;  4CGZ A;  1OYW A;  3LFK A;  1IN4 A;  1LDK B;  4O6J A;  3WE3 A;  3L09 A;  3U9G A;  2VN2 A;  1K6O A;  4HDV A;  4RGS A;  3RPQ A;  1S8N A;  3KEO A;  5HLI A;  5HS8 A;  4A5M A;  4PCQ A;  4AIH A;  1K78 A;  1W7P A;  2HGC A;  2VBZ A;  2K7L A;  2EWN A;  1T2K A;  1KU7 A;  2ZO4 A;  4P9F A;  5JHU A;  3ROU A;  1S6L A;  2OZ6 A;  4B8X A;  1JHH A;  1U6G A;  1KU3 A;  5K5Q A;  1UHW A;  2XKO A;  2XRO A;  2CYY A;  3JAM K;  1LEA A;  2J5P A;  3BOQ A;  4JQF A;  3I0T A;  3RDI A;  3ZN0 A;  3EET A;  4KDP A;  4M73 A;  4KA4 A;  4HF2 A;  2RKH A;  3E3V A;  4HX7 A;  5D4S A;  2DLL A;  4KMF A;  1BI0 A;  2PN6 A;  5L3G A;  1S7A A;  2H94 A;  2DK8 A;  3VFZ A;  2Y48 A;  1D8J A;  1BOA A;  1KQ8 A;  3KE2 A;  2A6E F;  4AVP A;  3FXQ A;  4EMS A;  2W24 A;  2CFX A;  1F1Z A;  5E1Z B;  2D1H A;  2RQP A;  1AWC A;  3N4M A;  2PLY A;  2CO5 A;  4XSX F;  4Z2Y A;  5D6F A;  3I59 A;  1P2F A;  4PGH A;  1OR7 A;  4UVA A;  1Z6R A;  3J80 Z;  2YPR A;  3H3Z A;  1XCV A;  4Q47 A;  2M87 A;  1PDN C;  3DFG A;  1WI9 A;  3V4G A;  4UV9 A;  2KJC A;  4BHP A;  4KIG A;  4ZYD A;  1R7J A;  2W25 A;  5JFR A;  4KT5 C;  1R00 A;  1K78 B;  1Z7U A;  1P6R A;  1W7P B;  1D3Y A;  1EH6 A;  4L5J A;  4ZH4 F;  4FX4 A;  3EDP A;  3E5Q A;  1UFM A;  1BC7 C;  1SFE A;  5HS9 A;  3FMS A;  3ECO A;  5E8I A;  4IVN A;  1LJ9 A;  2K02 A;  2YX7 A;  1H9T A;  5D4R A;  1SD7 A;  4OU0 A;  1XDS A;  2O61 A;  4UVB A;  2RNJ A;  2XUB A;  3CUO A;  4EM1 A;  2ACJ A;  4K2E A;  1LEB A;  5ICE A;  3HSR A;  4B09 A;  3ML6 A;  2H27 A;  3LAJ A;  2VXZ A;  2NYX A;  5DUK A;  4ESB A;  1EH7 A;  1B59 A;  1XGS A;  4EVI A;  2JPC A;  4HF1 A;  3CLO A;  3EQL F;  3R0J A;  4HBL A;  2ISY A;  4MTE A;  5CVU A;  4KIC A;  2STT A;  1KYZ A;  1KU9 A;  2E7X A;  5L3B A;  5H6Q A;  4LB5 A;  5CVI A;  3VEP A;  4MHG A;  4LG0 B;  1HKS A;  5IT9 Z;  4LGW A;  3REO A;  4LLN A;  4UUV A;  2V1U A;  1MGT A;  1CGP A;  4RGR A;  3HRS A;  4ETS A;  4O3M A;  2CQK A;  4YIF A;  2CWE A;  2DO7 A;  2IP2 A;  1RI7 A;  4BYY A;  2G7H A;  3F22 A;  3C7J A;  2ESH A;  2FU4 A;  3QPH A;  5ICF A;  4EJT A;  5CVV A;  4G7O F;  3R61 A;  5CLS A;  5A2Q Z;  5BPI A;  2NAZ A;  3LA2 A;  3PQJ A;  2ZXJ A;  3BY6 A;  3E5X A;  3H92 A;  3TDZ C;  4HLY A;  2IRF G;  2V6C A;  2UZK A;  5H20 A;  1IRG A;  1R1V A;  4N9I A;  2O3F A;  1QO0 D;  2DFI A;  3LAP A;  2RC4 A;  3RKW A;  2HWV A;  4R8H A;  2OQG A;  1R23 A;  1G3Y A;  3T8R A;  1SFU A;  3FXR A;  1ZH5 A;  4E70 A;  4HA8 A;  3QP6 A;  5E8G A;  4G6D A;  2A5Y B;  3E97 A;  3ZQ7 A;  2IW5 A;  4CYD A;  3CJN A;  4GXO A;  1OYI A;  1JGS A;  5DYM A;  4LD5 A;  4MEX F;  4IJA A;  4O5V A;  3TGN A;  2OU2 A;  4AIK A;  1DPR A;  2P8T A;  1LB2 A;  1J75 A;  4GGG A;  1ZRD A;  4OIO F;  1BM9 A;  1CF7 A;  1ZRE A;  3WTZ A;  3KP4 A;  4ZYG A;  2EB7 A;  2DPD A;  2P5K A;  1XGN A;  1RZ4 A;  1ON1 A;  3KFW X;  5FD6 A;  2D1V A;  1HKQ A;  1A04 A;  1IRF A;  1LDD A;  1OYY A;  2M30 A;  3MWM A;  1EH8 A;  2XVC A;  3LQR A;  3F6V A;  1P4X A;  1B4A A;  1GXQ A;  4TV7 A;  3KLN A;  1FWZ A;  2XAF A;  4PDK A;  4HV6 A;  2HYF A;  5L3F A;  4BHC A;  4BXU A;  4EJW A;  4YG2 F;  1U3E M;  4ZYE A;  1ZG1 A;  3J81 Z;  3SQN A;  3KZY A;  1U2W A;  1YO5 C;  1S3J A;  1OKR A;  4IXA A;  1QPM A;  2QVO A;  2M45 A;  1Z6T A;  2DQL A;  2QWW A;  3DF8 A;  2Z9O A;  2QYO A;  3BJ6 A;  4M6X A;  2EK5 A;  2VE9 A;  2R7F A;  2Z5U A;  3JSO A;  2F5F A;  3FM3 A;  3DP7 A;  4L0Z B;  2O8X A;  2BYV E;  1RUO A;  2YX4 A;  3LST A;  3B02 A;  1EV7 A;  3HIF A;  4L9J A;  3I64 A;  1G4D A;  3GYH X;  1DDN A;  3K69 A;  2KIU A;  4HV5 A;  3T5X A;  3WTT C;  1IN7 A;  1U5T A;  4IRG A;  3BDD A;  1O7F A;  4IPA A;  2V79 A;  2ZME B;  2EFW A;  3K2Z A;  4P96 A;  3M8F A;  1MJA A;  3H3U A;  1FBU A;  3HTS B;  3MZY A;  4UXN A;  2FBK A;  1I5Z A;  2MLG A;  4WXH A;  1QBJ A;  2PI0 A;  4G9Y A;  1MKM A;  5ILS A;  3RJP A;  1OPC A;  3BWG A;  2OQR A;  4R79 A;  4FT8 A;  3BP8 A;  4U0V A;  5LEJ A;  1ZRC A;  2FNA A;  1JE8 A;  4HZF A;  1SD6 A;  5BPD A;  1FBQ A;  3R6S A;  1GVJ A;  4UNO A;  2K86 A;  3TDU C;  4EGZ A;  1NHA A;  3I58 A;  1H9G A;  5K5O A;  1J0R A;  1IXR C;  3F8C A;  3KP5 A;  1BI1 A;  2QQA A;  2L54 A;  4BAY A;  5D5V B;  2FBH A;  3SZP A;  1YYV A;  5ILV A;  4ENN A;  2FQ3 A;  2FEZ A;  3W6K B;  1KU2 A;  1TQM A;  5D8L B;  1SMT A;  3I54 A;  2K4B A;  2ZJ2 A;  1W5T A;  4NB5 A;  2PFB A;  2PQ8 A;  3KP3 A;  1JHF A;  2XV4 S;  3IHU A;  4UV8 A;  2VT3 A;  1U5T B;  2NRA C;  2LF7 A;  3TO7 A;  2FF4 A;  4RAZ A;  2BEO A;  1FSE A;  4M72 A;  1XSD A;  4M9S A;  2YR2 A;  3GLX A;  1HW5 A;  2DQR A;  4WXD A;  4IRI A;  3CTA A;  2EJR A;  1YQA A;  5LHH A;  2A6H F;  1WSU A;  5LGT A;  2GAU A;  1BIB A;  3PQK A;  1V4R A;  1Z1D A;  3MFK A;  5HOO A;  3OV8 A;  1YW8 A;  2IT0 A;  4PGG A;  2P6S A;  4NHJ A;  2A61 A;  5CJ9 A;  2IA1 A;  2QBY A;  4HAM A;  3WU1 B;  3R4K A;  2IA0 A;  5LGN A;  3BJA A;  2HS5 A;  3RYP A;  3ISP A;  5H6R A;  2ELH A;  5JI6 A;  4XLN F;  1B9N A;  4AD9 A;  1O3Q A;  3QU3 A;  3JAM Z;  3I4P A;  2Q2E A;  2EV6 A;  1FZP B;  4OMZ A;  4BHB A;  2LDU A;  2LNB A;  4KN7 X;  3EYI A;  2AXL A;  1HW1 A;  2XHK A;  1X3U A;  3KLO A;  4L0Y B;  2Z33 A;  2HR3 A;  1SMY F;  4L5I A;  1S29 A;  5E18 F;  4YII A;  4EJU A;  4HW0 A;  1FYM A;  4GYI A;  2KIF A;  2FMY A;  2Y75 A;  1IN8 A;  4NQW A;  2EFO A;  1SAX A;  4WWC A;  2FSW A;  4RB2 C;  4KN4 X;  1TQP A;  1TNT A;  3HSE A;  2QLZ A;  2ADU A;  4LMY A;  4L9V A;  2DTR A;  3T0Y A;  2F5C A;  3E6C C;  1FOK A;  1UHM A;  3M9A A;  4HX4 A;  3T1B A;  1MJ9 A;  1ZN2 A;  2E1C A;  4I02 A;  4FX0 A;  2HYG D;  3F3X A;  2Y0M A;  3WGH A;  2ZNY A;  1K79 A;  2QBY B;  2K4J A;  2C6Y A;  3AAF A;  1F4K A;  1BIA A;  3F6O A;  2EFP A;  4EV0 A;  5FFX A;  4Q4Z F;  5DCF A;  1YLF A;  4Y15 A;  2DI3 A;  4ENJ A;  5L3E A;  2V1D A;  3LA3 A;  1XSV A;  1DP7 P;  3CUQ C;  1XGM A;  5ILU A;  1ZAR A;  3VB2 A;  1W7P D;  3CDH A;  5ED4 A;  3HOT A;  1S7O A;  3Q9S A;  1FC3 A;  2GA1 A;  5FLX K;  1G3T A;  4CO8 A;  1FLI A;  2JT1 A;  3GUD A;  5HDN A;  1AOY A;  5L3C A;  2L3D A;  1W5S A;  4FHT A;  3KEQ A;  4A6E A;  1T39 A;  2HOE A;  4PZJ A;  2JRT A;  1TBX A;  2IJL A;  3I59 B;  4Q48 A;  1E2X A;  4A5N A;  1J2X A;  4L9T A;  2XAH A;  3OOP A;  2NNY A;  2EV0 A;  3V8J A;  4ZZD A;  1L0O C;  4M9X A;  4OIP F;  4I01 A;  1ULY A;  2R7D A;  2HEO A;  2PMH A;  5IT9 K;  4HOB A;  1GXP A;  2VON A;  4ESJ A;  4RGX A;  2P6T A;  4I0B A;  1U5T C;  2A07 F;  3WE2 A;  3Q5F A;  1ZGJ A;  4AWX B;  3K1N A;  2WV0 A;  4XRF A;  5E20 A;  1O3T A;  3N97 A;  4U0W A;  3R60 A;  2KRF A;  4WX9 A;  3IRQ A;  1FNN A;  1YS7 A;  1T38 A;  5K1Y A;  1R36 A;  2QUF A;  4WF2 A;  1J59 A;  2DT5 A;  4I09 A;  2EFN A;  2MLK A;  4ENK A;  2ETH A;  3FHZ A;  4P5O A;  2VOO A;  3FMR A;  2XAJ A;  2F2E A;  2JPB A;  1B1B A;  1KQ0 A;  5LRR A;  2M1B A;  4BQA A;  2OBP A;  1KGS A;  4RAY A;  1F5T A;  3ECH A;  4LFU A;  3HHG A;  1L3L A;  2DW4 A;  2RV8 A;  3RPU A;  1KYW A;  1Y0U A;  5EEH A;  4I7H A;  2H6B A;  5DUI A;  4S04 A;  2JTV A;  4A0Y A;  4XBF A;  2VBX A;  1RIO H;  3V8K A;  5AON A;  4HQM A;  4M71 A;  1B9M A;  2G9W A;  2O03 A;  3RYR A;  1IN5 A;  2L4M A;  2GZW A;  1FSH A;  2M5W A;  3P7N A;  5J8F A;  4BH9 A;  2NNN A;  3R0A A;  3ZPL A;  1TLH B;  3MQ0 A;  3KZZ A;  4G8X A;  1O7L A;  1DPU A;  2D2W A;  3NEU A;  4KYW A;  3DQV C;  2PMU A;  4LLL A;  2HQN A;  2Z99 A;  5E17 F;  3QP5 A;  3W6J B;  3TO9 A;  3KP2 A;  3IWZ A;  2OAZ A;  2F5D A;  3F21 A;  3F8B A;  1T0F A;  4M9Z A;  4LJZ F;  2O0Y A;  1O3S A;  4LK0 F;  3I5U A;  2BE5 F;  2UXX A;  1BBY A;  2W84 A;  3FXU A;  3RKY A;  4HQE A;  2W57 A;  5F1R A;  4HYE A;  4I0A A;  4YFK F;  5DV5 A;  1QGP A;  1T98 A;  5JVT A;  1FP2 A;  4LB6 B;  4YFN F;  5JR3 A;  1HXD A;  4H0E A;  3WGG A;  1SD5 A;  4ASN A;  3QU6 A;  4OIN F;  5BQT A;  2L4A A;  3I53 A;  3JW4 A;  2F5E A;  3P9I A;  3SXY A;  1WWX A;  2UWM A;  3O6B B;  1CF7 B;  2A3S A;  2CW0 F;  4YFX F;  3WTU C;  4RB3 C;  1IAW A;  3SHF A;  1WKM A;  2Q0O A;  4N0B A;  1YS6 A;  3CO7 C;  1XMK A;  5DD4 A;  1HQC A;  1MZB A;  3BPV A;  3V7S A;  3QOP A;  3JTH A;  2XAG A;  2FML A;  4ESF A;  1PUE E;  4EGY A;  4JK1 X;  1XCB A;  2PG4 A;  2H6C A;  1ZHF A;  3ZMT A;  2DK5 A;  3LQQ A;  4RB0 A;  2VBW A;  1I1S A;  3ZMV A;  3ZMZ A;  4EJV A;  5LHG A;  4G7Z F;  1YW7 A;  3FWE A;  1U8R A;  1FPQ A;  3IKV A;  3IL2 A;  3KET A;  1FYL A;  1RUN A;  1UST A;  1TTY A;  2RVC A;  4DNC A;  1J9I A;  2DU9 A;  3WG9 A;  2WWY A;  1D8K A;  3KP6 A;  3BZ6 A;  4IF4 A;  5HLH A;  1I27 A;  2P4W A;  1Z05 A;  3ZMU A;  2YSR A;  1ZG5 A;  2IPQ X;  3WTY C;  3MZH A;  4N9H A;  3KP7 A;  4I2O A;  2A69 F;  1FY7 A;  2VBY A;  3O3K A;  3IRR A;  3B73 A;  3HOS A;  5D5W B;  2ISZ A;  2LKP A;  3DXJ F;  1QNT A;  2BBY A;  4MNU A;  4EM0 B;  3ULQ B;  3TQN A;  3BJO A;  1F9N A;  3ELK A;  1LNW A;  5L3D A;  4L18 B;  2J5O A;  4A12 A;  2OD5 A;  3FZV A;  4CDG A;  5J6X A;  5CVJ A;  2G7U A;  2XAQ A;  3TO6 A;  5DCM A;  1T6S A;  5F64 A;  1FP1 D;  1R22 A;  5KK1 A;  3U1D A;  2K27 A;  5LBQ A;  2CGP A;  3VOD A;  3DV8 A;  4KIF A;  4Q5S F;  3D0S A;  5ICC A;  5E1X A;  2FXA A;  1J7K A;  4KMU X;  5HDK A;  1ZGA A;  1XD7 A;  3C3W A;  1O57 A;  4KNY A;  5D5X B;  1SFX A;  2QM3 A;  1VTN C;  4P9U A;  3IWF A;  1I6X A;  2MH2 A;  2ZCW A;  1TQI A;  1XN7 A;  2ZKZ A;  5E1W A;  2P5L C;  4OOI A;  4HDU A;  3QRF F;  1K7A A;  1TW3 A;  2HKX A;  1UB9 A;  3TKY A;  1R5G A;  1MD0 A;  5DDG A;  2HDC A;  4A0X A;  2IVM A;  4GYG A;  2BV6 A;  2FOK A;  3GFI A;  1BJA A;  1HSJ A;  5LHI A;  3M7G A;  1TNS A;  2L01 A;  2HZT A;  2KIM A;  1ZRF A;  4U7D A;  1R1U A;  2RGV A;  4MGR A;  2XKP A;  1YG2 A;  3GWZ A;  3LA7 A;  1I1G A;  5BS6 A;  3I71 A;  1KQ9 A;  3EYY A;  3DKW A;  3CO6 C;  4MQV A;  4GO1 A;  2W85 A;  4CXF A;  3GFJ A;  2ZNZ A;  1G6N A;  3K1M A;  5DCM B;  5FB2 A;  3J7A O;  4KFC A;  3ERE D;  4CZZ A;  3U2R A;  5HVQ C;  1J5Y A;  2NS0 A;  3RI4 A;  3PFI A;  3V7R A;  3ABT A;  1HST A;  1BC8 C;  3J80 K;  4CIC A;  3M1E A;  3HSF A;  3HRM A;  3FMQ A;  2XAS A;  2QQ9 A;  4LG0 A;  4RGU A;  2GWR A;  1H0M A;  1REP C;  3O2P E;  3F8N A;  5HLG A;  4U0Y A;  1BI3 A;  1ODD A;  3MEX A;  4XLP F;  3GZ6 A;  1UCR A;  3WTV C;  2XGX A;  2AS5 F;  5ICG A;  2EA2 A;  1YW9 A;  4LLG F;  2A68 F;  2X0L A;  2JZY A;  6PAX A;  3P9K A;  4G94 A;  3S2W A;  2QEN A;  3E6M A;  3MCZ A;  3SFZ A;  5D8K B;  4DQ2 A;  4BNC A;  4QWQ A;  1D5V A;  5FO5 A;  1OMI A;  5F6F A;  3V7C A;  4HX8 A;  2EV5 A;  1R1T A;  2LF8 A;  2GXB A;  3GZ5 A;  1R5H A;  1ZYR F;  3QPT A;  4OIR F;  4UVC A;  1IW7 F;  3WU0 A;  1SD4 A;  3RKX A;  5FLX Z;  1U78 A;  4G7H F;  1Z9C A;  1FYK A;  1IZ1 A;  2V9V A;  4R1H A;  2M8E A;  5KVR A;  5CYV A;  3M8E A;  3GF2 A;  2CG4 A;  3L00 A;  4Y17 A;  1FBS A;  2MA3 A;  2FNP A;  3TOB A;  2MD5 A;  4ZZL A;  1W4M A;  2PJP A;  2RN7 A;  4F7Z A;  2VOP A;  5D6E A;  1YIO A;  4U88 A;  4L9N A;  1RNL A;  2HFH A;  3GFL A;  2H09 A;  3WTW C;  1BI2 A;  2Q8K A;  3HUG A;  4UHT A;  5LEK A;  5BMZ A;  3GEZ A;  1ZAO A;  1WQ2 A;  2LSO A;  3HYI A;  1LDJ A;  2X4H A;  3BPX A;  3K9T A;  1LQ1 A;  2VC1 A;  5CVR A;  1R58 A;  1P4A A;  5A2Q K;  2JSC A;  2FBI A;  4RS8 A;  3ZMS A;  4G6Q A;  3JTG A;  2ZFW A;  5HDG A;  3HRT A;  1ON2 A;  2GQQ A;  5DD8 A;  2OZU A;  5LLQ A;  4MTD A;  3VOE A;  5FD5 A;  2DPU A;  3DPL C;  3RIR A;  2QQB A;  2PBI A;  2BGC A;  4OIQ F;  2L02 A;  3E6B A;  1FX7 A;  4WXC A;  4U7B A;  3GFM A;  3E5U A;  1KA8 A;  2COM A;  2IA2 A;  2WTE A;  3K1P A;  4IHT A;  2DAO A;  1P92 A;  2HTS A;  3RTR A;  1ZLJ A;  2FA5 A;  1E17 A;  3C1D A;  3P9C A;  2QZ8 A;  5J8C A;  1YTY A;  1MJB A;  2R3S A;  3TOA A;  1P4W A;  3L7W A;  5DEQ A;  1V3F A;  1MDM A;  1C0W A;  4EQQ A;  1JXS A;  3NQO A;  3F8M A;  2XIG A;  1PP8 F;  4WK8 F;  1USS A;  4ENM A;  2O6G E;  1LVA A;  3T8T A;  2TDX A;  4M74 A;  1IN6 A;  3G3Z A;  1Q1H A;  5HS7 A;  3K0L A;  1IXS B;  5FGM A;  5AIQ A;  1IF1 A;  3E6D A;  2ZME A;  2P7V B;  4QLC U;  2CSO A;  2KKO A;  4IHS A;  2EA4 A;  2VE8 A;  5D5U B;  1FT9 A;  3CUQ A;  4CHU A;  4OMY A;  2GIV A;  3WOD F;  4A2U A;  3IKT A;  1PP7 U;  2FRH A;  3Q9V A;  3LWF A;  2MBF A;  3J81 K;  1O3R A;  2DBB A;  4KUM A;  2KJB A;  2V1X A;  2UXN A;  2WC2 A;  1STZ A;  5FFZ A;  1XGO A;  3FM5 A;  4HF0 A;  3ABU A;  3IC7 A;  4LK1 F;  1BN5 A;  4XSZ F;  2B0L A;  2Z3Y A;  3WTS C;  2HKO A;  1XDU A;  3NRV A;  3GO5 A;  2FE3 A;  4KIB A;  4S05 A;  1MDM B;  5K5R A;  1YFH A;  4IRH A;  3KCC A;  1GHC A;  3GW2 A;  2GA2 A;  4EM2 A;  4A0Z A;  3L2C A;  1G3W A;  4A6D A;  1Z91 A;  2PEX A;  3HHH A;  3COA C;  3L9F A;  1G3S A;  3GVA A;  3WTX C;  2P5V A;  2HQR A;  1QQI A;  4AIJ A;  1B6A A;  1QZY A;  4ZYH A;  1ZG3 A;  3HRU A;  4MEY F;  1HKT A;  2VOD A;  1XB4 A;  3C18 A;  3JSP A;  3BRO A;  4I98 B;  3ZMD A;  1WRJ A;  3WGI A;  4GCV A;  1DUX C;  2ESN A;  5LGU A;  2MH9 A;  4D0P A;  2D45 A;  4Y13 A;  4ON0 A;  5ERI A;  5BOX A; 
#chains in the Genus database with same CATH topology
 2WY7 Q;  3S8P A;  1A6I A;  3CUQ B;  1PUF B;  1TW2 A;  3ZN1 A;  2VT2 A;  2XRN A;  4M6Y A;  2RDP A;  2FX0 A;  4JBA A;  1YIJ I;  2R5Z A;  2MAB A;  2P7C B;  2EFQ A;  3HTU A;  1VQ4 I;  2YU3 A;  1ZLK A;  3MAJ A;  5TJJ A;  5FRO A;  2HTJ A;  2NVY J;  1RC9 A;  4WCG A;  3ZP5 A;  4EJO A;  3PIO F;  2STW A;  2OA4 A;  2E1N A;  5DTD A;  3AL0 C;  3EUH A;  4P55 A;  2L0K A;  5AIP A;  5FKM A;  2P81 A;  5M5X J;  1K61 A;  2ZBK A;  2GXG A;  3F72 A;  1QHG A;  1XSX A;  3H9G A;  5EG0 B;  4HLX A;  1LPQ A;  3VPR A;  3GX4 X;  2LKS A;  2MC4 A;  3H9Q A;  5TRD A;  3F23 A;  1XMA A;  4IOA F;  2ELK A;  1HBX G;  1A6Q A;  2VC0 A;  3DEU A;  1X4O A;  4A3K J;  4MQ9 F;  1ONV A;  3F0C A;  1W36 D;  1IXC A;  4XKV A;  3LOC A;  2RRE A;  4BDZ A;  1TL8 A;  4XRS A;  2UUZ A;  4JP0 A;  2MC3 A;  3F8F A;  3FX3 A;  4KIT B;  3CMY A;  2HVS A;  4M3F A;  3U21 A;  5EEG A;  1HW2 A;  1GV2 A;  2DFE A;  4RB1 A;  2CW8 A;  1IUY A;  3PSI A;  3G73 A;  4FE4 A;  4GFB A;  3FF5 A;  2R7Z J;  3M1C A;  1QZZ A;  2K9L A;  2EZH A;  3D5L A;  3V8L A;  4J00 A;  5LRS A;  3DPT A;  3SZT A;  2Y0S N;  5IT3 A;  3QAH A;  3OSG A;  1M1E B;  3GXO A;  2E7W A;  4CGZ A;  1DP3 A;  1OYW A;  3JCU C;  1OCC H;  1IN4 A;  1LDK B;  2I5U A;  3LFK A;  2ZJQ F;  4O6J A;  4NC8 A;  3ZQI A;  1YRN A;  4BE1 A;  2TCT A;  3WE3 A;  1PYV A;  3K7A J;  3L09 A;  2G0E A;  3U9G A;  2VN2 A;  4Y3O A;  1K6O A;  4HDV A;  4RGS A;  3RPQ A;  1S8N A;  2VJJ A;  3OR2 C;  4JX4 A;  3KEO A;  5HLI A;  1Y39 A;  1D5Y A;  5HS8 A;  2E1M B;  2EBI A;  2CS3 A;  4A5M A;  4PCQ A;  4AIH A;  1K78 A;  3BTI A;  2LD5 A;  5GAG J;  1W7P A;  2HGC A;  2VBZ A;  2K7L A;  4DZP A;  4RBO A;  2OTL I;  2EWN A;  4BGD A;  4L5E A;  1T2K A;  1KU7 A;  2ZO4 A;  4P9F A;  3HL2 A;  5JHU A;  3ROU A;  1S6L A;  2OZ6 A;  2LKX A;  4B8X A;  1JHH A;  1U6G A;  1KU3 A;  3B6C A;  2HQA A;  2KIQ A;  1SVM A;  3PL8 A;  1UHW A;  4HG2 A;  5K5Q A;  2DMU A;  3BTJ A;  3VWB A;  2XKO A;  4ZDP A;  4RMN A;  4E6K G;  3QYF A;  3WHB A;  1QVT A;  5IOZ A;  2XRO A;  3ZQQ A;  4B3X A;  2PMZ A;  2CYY A;  3JAM K;  1LEA A;  2V26 A;  1OCO H;  2J5P A;  2E60 A;  3BOQ A;  3CCY A;  4JQF A;  2DOD A;  4A3J J;  3OOU A;  4XKW A;  2HOT A;  3I0T A;  3RDI A;  3ZN0 A;  1AKH A;  3I4N J;  3DKX A;  2V9K A;  3VYU B;  3EET A;  4KDP A;  2JA6 J;  2LP0 A;  5E3M A;  4M73 A;  4UB6 C;  3DTE A;  5J4V A;  4KA4 A;  4HF2 A;  1D1B A;  2RKH A;  3E3V A;  3HGG A;  4HX7 A;  5D4S A;  3JRG A;  2FOW A;  4A3I J;  2DLL A;  4KMF A;  1BI0 A;  2PN6 A;  3A0B C;  1S7A A;  5L3G A;  3A1Y A;  2H94 A;  2DK8 A;  3VFZ A;  2Y48 A;  1D8J A;  1WHU A;  1BOA A;  1KQ8 A;  3KE2 A;  2A6E F;  3S3M A;  4AVP A;  4HNT A;  1V5G A;  3FXQ A;  4EMS A;  5IOY A;  1K6Y A;  2W24 A;  2CFX A;  1F1Z A;  5C3E J;  5E1Z B;  3JRD A;  4ZDL A;  3D5S C;  3J7Z I;  2D1H A;  3G6E I;  1JTX A;  2RQP A;  3CDL A;  2JJ7 A;  4G12 A;  1AWC A;  3N4M A;  2VQG A;  2PLY A;  2CO5 A;  2ZFU A;  1MSF C;  3PIP F;  4XSX F;  4Z2Y A;  3UKG A;  3NAU A;  5D6F A;  3I59 A;  1P2F A;  4PGH A;  1OR7 A;  3VSL A;  2HOA A;  4UVA A;  2BY1 A;  3ASO H;  2KIS A;  1YRN B;  3QOE A;  1Z6R A;  3J80 Z;  2JRM A;  2YPR A;  3H3Z A;  5GAH J;  5FJ8 J;  1XCV A;  4Q47 A;  2M87 A;  4D5F A;  1U8B A;  4BE0 A;  4BY7 J;  4UUS A;  1HC8 A;  5C4X J;  3OYH A;  2BW3 A;  1PDN C;  3DFG A;  3CCV I;  4NBQ A;  1WI9 A;  3V4G A;  2E19 A;  4I76 A;  4UV9 A;  2KJC A;  4BHP A;  4C3H J;  4KIG A;  3OIP A;  4ZYD A;  1R7J A;  2NVT J;  2W25 A;  1GVD A;  5JFR A;  4KT5 C;  1T08 B;  3PJR A;  4D7N A;  2AHQ A;  1R00 A;  1K78 B;  1Z7U A;  1P6R A;  1W7P B;  2JA8 J;  3HB9 A;  1D3Y A;  1EH6 A;  5EEA A;  4L5J A;  4ZH4 F;  4FX4 A;  1JUP A;  2X6Y A;  4N4N B;  3AG3 H;  3EDP A;  1YI2 I;  3E5Q A;  1UFM A;  1BC7 C;  1SFE A;  1I50 J;  5HS9 A;  3FMS A;  2LR8 A;  3ECO A;  3LSH A;  5E8I A;  1AA7 A;  1LJ9 A;  4IVN A;  5E79 C;  3BR6 A;  3GTL J;  4CYC A;  4ZC3 A;  2K02 A;  1A35 A;  2YX7 A;  3SEZ A;  3ZQL A;  4U87 A;  1K83 J;  1H9T A;  1N25 A;  5HNH A;  4I99 C;  5D4R A;  4XIC A;  1E3O C;  4PFP A;  1SD7 A;  3LSM A;  4OU0 A;  5FKK A;  1W1W E;  1XDS A;  2O61 A;  2DA2 A;  3V42 A;  2A5W A;  4UVB A;  1X1A A;  3L2W A;  2RNJ A;  4S0H B;  2XUB A;  1I3A A;  3CUO A;  4EM1 A;  2ACJ A;  4K2E A;  2VJ5 A;  1HOM A;  2M9H A;  1LEB A;  3F9K A;  4ZYA A;  5KAF C;  5ICE A;  3HSR A;  2M4G A;  1ERD A;  5EJC A;  1T0F C;  2B7E A;  4B09 A;  5B5E C;  3ML6 A;  2H27 A;  3LSP A;  4QPO A;  3W3C A;  3LAJ A;  2VXZ A;  4MO7 A;  2NYX A;  1F43 A;  2LG4 A;  5DUK A;  5CKT A;  1Z7L A;  2ZXH A;  4ESB A;  3OMY A;  3GTM J;  1EH7 A;  4M3E A;  1B59 A;  1XGS A;  5DM7 F;  1J09 A;  3L2R A;  5LD2 C;  4EVI A;  2JPC A;  1WJC A;  4HF1 A;  3IH2 A;  3CLO A;  3EQL F;  3R0J A;  4HBL A;  2ISY A;  4XOP A;  4MTE A;  1YX3 A;  2VKH A;  5F0C A;  2R93 J;  5CVU A;  4KIC A;  2IEK A;  2STT A;  1KYZ A;  1KU9 A;  1MBJ A;  4ZTJ A;  2E7X A;  3I4M J;  2VQH A;  2R5Y A;  3ZCO A;  3G71 I;  2DOE A;  3BQY A;  3HC7 A;  4V19 K;  1HA8 A;  3LSJ A;  5L3B A;  3A0H C;  1IO2 A;  1QU3 A;  5H6Q A;  4DJA A;  1GV5 A;  4BJ6 C;  4EEF G;  4LB5 A;  2DYS H;  3DBH B;  5CVI A;  2JVG A;  3VEP A;  4MHG A;  2CUZ A;  4LG0 B;  3K6G A;  1LFB A;  3QPL A;  3J7Y J;  1MNM C;  1HKS A;  5IT9 Z;  4UUS B;  4LGW A;  2K85 A;  3REO A;  4D1Q A;  1BW6 A;  2BW3 B;  2YS9 A;  1MGT A;  3ZQC A;  2V1U A;  4LLN A;  4UUV A;  1CGP A;  3OS2 A;  1WJF A;  4RGR A;  3E1S A;  1ETO A;  3HRS A;  2ZJR F;  4ETS A;  4O3M A;  2CQK A;  4YIF A;  2CWE A;  4DOZ A;  1OCR H;  2DO7 A;  2IP2 A;  3RZO J;  2JK3 A;  2N8G A;  1RI7 A;  4BYY A;  2G7H A;  3C7J A;  3F22 A;  2ESH A;  2FU4 A;  2KLO A;  3QPH A;  5ICF A;  1FMW A;  2GM4 A;  4EJT A;  5CVV A;  4GRI A;  4G7O F;  3R61 A;  1H89 C;  5CLS A;  3SDG A;  5GP9 A;  5A2Q Z;  3GLL A;  2L9R A;  5BPI A;  2NAZ A;  4LIV A;  2MYS A;  3LA2 A;  3PQJ A;  4AVZ A;  1VQN I;  3S14 J;  4CYC B;  2ZXJ A;  3BY6 A;  2JA2 A;  3E5X A;  3H92 A;  3TDZ C;  4HLY A;  2L9N A;  1AU7 A;  2IRF G;  2MFZ A;  2V6C A;  2UZK A;  5H20 A;  2E1M C;  2E5N A;  3MD2 A;  2R92 J;  2Z1D A;  3ZQG A;  1IRG A;  1R1V A;  2V9P A;  4XLH A;  4N9I A;  2O3F A;  1QO0 D;  2DFI A;  3LAP A;  2RC4 A;  4FAS D;  1TWC J;  2DMQ A;  4V2F A;  3RKW A;  4BJ5 C;  5KHD A;  2HWV A;  5J1R A;  2QA4 I;  4R8H A;  2OQG A;  1R23 A;  2DJN A;  3I9V 2;  3HOW J;  1G3Y A;  3T8R A;  1SFU A;  3KEY A;  1QPI A;  2NVQ J;  1E3H A;  3FXR A;  1TT5 B;  1ZH5 A;  4E70 A;  3HOY J;  4HA8 A;  3C2G A;  3QP6 A;  5E8G A;  1LFU P;  4G6D A;  5IY5 H;  2A5Y B;  2W48 A;  2MW8 A;  2CRG A;  2KDO A;  5J3L A;  3E97 A;  3HOV J;  3H9J A;  3ZQ7 A;  2IW5 A;  4C30 A;  3UNG C;  4IQJ A;  2EZI A;  4CYD A;  3CJN A;  4GXO A;  1OYI A;  1JGS A;  5DYM A;  4QTR A;  4LD5 A;  4MEX F;  4AID A;  4IJA A;  3L2U A;  4O5V A;  4A69 C;  3TGN A;  3QYE A;  4BY1 J;  1SFK A;  2EZK A;  2OU2 A;  2F6C A;  1DPR A;  2P8T A;  4AIK A;  2KL4 A;  3H5N A;  1S72 I;  1LB2 A;  2IGM A;  3L1P A;  2X48 A;  2P0W A;  2R5Y B;  1J75 A;  5EGO A;  3A2K A;  4GGG A;  1ZRD A;  4OIO F;  1BM9 A;  2M7B A;  1CF7 A;  1ZRE A;  3WTZ A;  5HOD A;  4HST A;  3KP4 A;  3DBR B;  4XOR A;  3HUG B;  2ZSI B;  3OYB A;  1UAA A;  2F48 A;  2HVQ A;  4ZYG A;  3I56 I;  2EB7 A;  1OCT C;  2DPD A;  2P5K A;  1XGN A;  1RZ4 A;  1NG6 A;  2VPL A;  1ON1 A;  3KFW X;  5IP7 J;  2AQE A;  5B1A H;  2R7O A;  3Q0U A;  2D1V A;  3GBG A;  1HKQ A;  5FD6 A;  2R7X A;  1A04 A;  1X2N A;  1IRF A;  1LDD A;  1OYY A;  3GTG J;  3S15 J;  4RAF A;  4YIR X;  2M30 A;  4BE2 A;  2IXS A;  2COB A;  3MWM A;  1EH8 A;  2XVC A;  4YRV A;  3CJQ B;  2XPW A;  3LQR A;  3F6V A;  4XLA A;  1P4X A;  1B4A A;  3EUA A;  3BR3 A;  1N75 A;  1GXQ A;  4TV7 A;  1MIJ A;  2NOJ B;  3KLN A;  2CJJ A;  2JSP A;  1FWZ A;  2R7V A;  2XRL A;  2XAF A;  4PDK A;  4HV6 A;  2DA4 A;  2HYF A;  5L3F A;  3B6A A;  4BHC A;  4BXU A;  5J1Y A;  4EJW A;  4YG2 F;  1U3E M;  4ZYE A;  1ZG1 A;  2LTP A;  1I39 A;  3SQN A;  3J81 Z;  1R71 A;  2DFF A;  1U2W A;  3KZY A;  1FMV A;  1YO5 C;  3MVP A;  1S3J A;  1OKR A;  2VXD A;  4IXA A;  2KZV A;  1QPM A;  3DTI A;  2NS7 A;  2QVO A;  3CP8 A;  3MN2 A;  4FIS A;  2M45 A;  1NH3 A;  1G59 A;  1Z6T A;  2HVR A;  2DQL A;  3OYK A;  2QWW A;  5GTI C;  4ZTF A;  4BUP A;  3DF8 A;  3O8G A;  3I55 I;  4DBQ A;  2Z9O A;  2LY1 A;  2ID6 A;  2QYO A;  4AC0 A;  4J19 A;  3BJ6 A;  3PM1 A;  2BHY A;  4M6X A;  2EK5 A;  4CCK A;  2VE9 A;  1BR1 A;  2HPM A;  2R7F A;  2L9V A;  2Z5U A;  3OS0 A;  4A3B J;  3JSO A;  2OV7 A;  2F5F A;  2PX9 A;  1XPX A;  5M5Y J;  2GLO A;  3FM3 A;  4B43 A;  4IKF A;  2L2O A;  2XGE A;  3DP7 A;  4W1U A;  4L0Z B;  5IP6 A;  4CH7 A;  2O8X A;  2BYV E;  1RUO A;  2YX4 A;  3LST A;  3DLL F;  3B02 A;  2FJ1 A;  5EGO B;  1EV7 A;  3HIF A;  4L9J A;  3I64 A;  1G4D A;  2O9L A;  4PUS A;  2IS6 A;  4XL9 A;  3GYH X;  1DDN A;  3K69 A;  1TWG J;  2KIU A;  4HV5 A;  4ANJ A;  4DGW B;  4HSR A;  3T5X A;  3WTT C;  3AFH A;  5F27 A;  3BG3 A;  1IN7 A;  2LVS A;  1U5T A;  2R7Q A;  3OYN A;  4IRG A;  3BDD A;  3GTQ J;  3PUB A;  3A4C A;  5E3O A;  3PNV A;  1O7F A;  1D0X A;  3RPU D;  5CPR B;  3TBI A;  1DQU A;  3CZ6 A;  4IPA A;  4CCO A;  2V79 A;  3IUO A;  2ZME B;  2EFW A;  4II3 A;  3K2Z A;  1X1D A;  4PK4 A;  4P96 A;  3M8F A;  1MJA A;  1WVR A;  3H3U A;  3LMM A;  1FBU A;  4AYB A;  1OR7 C;  3HTS B;  4RDU A;  3MZY A;  4UXN A;  1HDD C;  2FBK A;  2GXA A;  1XX5 A;  2F4M B;  2R7R A;  1I5Z A;  2MLG A;  3CMM A;  4WXH A;  1QBJ A;  2KRH A;  4PJN A;  4JX5 A;  2PI0 A;  4G9Y A;  2R7T A;  2DXI A;  1MKM A;  3EPZ A;  5ILS A;  3W6V A;  3RJP A;  1OPC A;  3BWG A;  4UY8 I;  1MH3 A;  4C3J J;  2OQR A;  2IS4 A;  4R79 A;  4FT8 A;  3BP8 A;  2HZD A;  4U0V A;  3JRE A;  2EQR A;  5LEJ A;  3G1O A;  1D1A A;  1ZRC A;  2DA3 A;  2WAF A;  4X1E A;  1YHQ I;  2FNA A;  1JE8 A;  4HZF A;  2L7F P;  2MGQ A;  2XC7 A;  4BXF A;  4IHY A;  1JKQ C;  1SD6 A;  5BPD A;  3RZD J;  1IC8 A;  3LSG A;  1FBQ A;  2XPU A;  1JUS A;  5DS9 A;  3R6S A;  1XG1 A;  1GVJ A;  3OYD A;  3CCL I;  1DU0 A;  4UNO A;  3H5A A;  2K86 A;  3TDU C;  4EGZ A;  3TED A;  1NHA A;  1MMG A;  3I58 A;  2BOL A;  1S9H A;  1H9G A;  2MG4 A;  5K5O A;  1J0R A;  1IXR C;  3F8C A;  1Q1V A;  3FKJ A;  1JKR C;  3KP5 A;  3K4K A;  1K4T A;  3PSF A;  3KYD B;  1IRX A;  1BI1 A;  2QQA A;  2L54 A;  2ME0 A;  4BAY A;  5D5V B;  2FBH A;  3SZG A;  3SZP A;  1YYV A;  5ILV A;  2CFO A;  4ENN A;  3VSK A;  4B1R A;  3FIS A;  2FQ3 A;  2XGD A;  2FEZ A;  2WAD A;  4CA0 A;  3W6K B;  1KU2 A;  1TQM A;  3DU6 A;  4CSW A;  3S2H J;  1EF4 A;  5D8L B;  4A3L J;  1SMT A;  3I54 A;  1ZKG A;  4OAY A;  3AG4 H;  4IX7 A;  2K4B A;  1IJW C;  2ZJ2 A;  2NVU B;  1W5T A;  2HI3 A;  4NB5 A;  2PFB A;  2EPF A;  2PQ8 A;  2IGO A;  2IS2 A;  3KP3 A;  1JHF A;  3LSK A;  2XV4 S;  2YU9 J;  3IHU A;  4UV8 A;  3A02 A;  2VT3 A;  1U5T B;  2NRA C;  4DBR A;  2LF7 A;  3TO7 A;  2KPM A;  1VQ6 I;  2DA6 A;  5GPA A;  2FF4 A;  4RAZ A;  1VFC A;  2BEO A;  1FSE A;  4M72 A;  4ABZ A;  3OYJ A;  3BR2 A;  1XSD A;  4M9S A;  4BJT A;  2Y0S A;  4KIS A;  2YR2 A;  3GLX A;  2LC2 A;  5IYD J;  1HW5 A;  3VYT B;  2IS1 A;  2DQR A;  2BXZ A;  4WXD A;  2XF7 A;  4IRI A;  4RM3 A;  3CTA A;  2EJR A;  2V1N A;  1YQA A;  5LHH A;  2VQL A;  2A6H F;  1H8A C;  1WSU A;  5LGT A;  2GAU A;  3HJE A;  1BIB A;  3PQK A;  1V4R A;  3LSI A;  1Z1D A;  1TWA J;  3MFK A;  5HOO A;  3NWT A;  3OV8 A;  1YW8 A;  4BS9 A;  4KT6 A;  2IT0 A;  4PGG A;  3K4L A;  2P6S A;  4NHJ A;  4IOC F;  1MMS A;  2A6T A;  1W0U A;  2A61 A;  5CJ9 A;  2IA1 A;  2QBY A;  2DJI A;  2CQQ A;  3E0J B;  3MKW B;  4HAM A;  2R5Z B;  1OCZ H;  4XRM A;  3WU1 B;  3R4K A;  2IA0 A;  1H88 C;  4IHW A;  2WAQ N;  1MBG A;  5LGN A;  2OC6 A;  2DDA A;  2LH9 A;  2CQX A;  3BJA A;  1JKO C;  1SEU A;  1F36 A;  2PMZ N;  2HS5 A;  3RYP A;  2E35 A;  4BU2 A;  3MZ8 A;  3ISP A;  5H6R A;  2ELH A;  5JI6 A;  3BTC A;  5M3F J;  4XLN F;  1B9N A;  2WY8 Q;  4C2U A;  4AD9 A;  1RR8 C;  1O3Q A;  3QU3 A;  1VQ9 I;  3TMO A;  3JAM Z;  1GDT A;  3I4P A;  2Q2E A;  2EV6 A;  1FZP B;  2IAI A;  4OMZ A;  2HU9 A;  3ABM H;  3BCA A;  4BHB A;  2LDU A;  1JTY A;  3AG1 H;  1VQO I;  5TIS C;  2LNB A;  4KN7 X;  1HF0 A;  2QEX I;  1Z21 A;  5LFA A;  3EYI A;  1SC7 A;  2AXL A;  1HW1 A;  3BTL A;  1BR2 A;  2XHK A;  4LOC A;  1JJ8 C;  1X3U A;  4LG3 A;  4F52 A;  1Z3Y A;  4A3C J;  3KLO A;  4L0Y B;  1X1P A;  1VQ7 I;  1BA5 A;  2Z33 A;  3G2B A;  4E4H A;  2HR3 A;  1SMY F;  4L5I A;  1S29 A;  3HG9 A;  5H2F C;  5E18 F;  2MSY A;  1E0E A;  4YII A;  4EJU A;  3EUK L;  2LRE A;  4HW0 A;  1FYM A;  4GYI A;  2KIF A;  3BZC A;  4DYR A;  2E1O A;  2FMY A;  2Y75 A;  2CUF A;  1IN8 A;  1LVK A;  1MH4 A;  2K3P A;  2VKV A;  2XB5 A;  4NQW A;  1NK2 P;  2EFO A;  2H1L A;  3JRB A;  1MSE C;  2ZB9 A;  4HRI A;  1SAX A;  1YJW I;  4WWC A;  1UEL B;  2KT0 A;  2E2H J;  2FSW A;  3FXL A;  4RB2 C;  4E7I A;  5K7F A;  2W00 A;  3KX2 A;  4KN4 X;  1DGW Y;  1TQP A;  1TNT A;  3HSE A;  4RAG A;  1OFC X;  1FIA A;  3GCM A;  3K4J A;  2QLZ A;  5E3N A;  3S1N J;  1I6H J;  2CQ7 A;  2LLK A;  1ORK A;  2DFH A;  3ZXS A;  2ADU A;  1MMN A;  1LFP A;  4LMY A;  3CDI A;  4L9V A;  1B8I A;  2DTR A;  3T0Y A;  2F5C A;  3BCB A;  3E6C C;  4A3G J;  1FOK A;  4YEL A;  2HOS A;  1UHM A;  2M0C A;  3M9A A;  1X3W B;  2EIM H;  4HX4 A;  3T1B A;  1MJ9 A;  1ZN2 A;  1R9T J;  2E1C A;  1EA3 A;  5K7Z A;  1SAU A;  4I02 A;  4FX0 A;  2HYG D;  2JA7 J;  3F3X A;  2Y0M A;  3WGH A;  5JHF A;  4F93 B;  1RKT A;  2ZNY A;  1RKW A;  1K79 A;  1WZ2 A;  2QBY B;  2K4J A;  3L2Q A;  3RCO A;  3S1Q J;  2C6Y A;  3AAF A;  1F4K A;  1BIA A;  1Z67 A;  3F6O A;  1ITY A;  2ZME C;  2EFP A;  4NC7 A;  2E71 A;  4EV0 A;  5FFX A;  1EJ9 A;  4FQG A;  2OJE D;  4Q4Z F;  4B3A A;  3K4C A;  3JRF A;  5DCF A;  2L7M P;  2QF7 A;  5KCM A;  1YLF A;  2BY3 A;  4Y15 A;  3OY9 A;  2DI3 A;  2DYR H;  4ENJ A;  5L3E A;  2V1D A;  2K9S A;  3OYM A;  1AKH B;  3FBI B;  4HEA 2;  3LA3 A;  1XSV A;  3KYC B;  1DP7 P;  2Q2E B;  3CUQ C;  1XGM A;  5ILU A;  1ZAR A;  3S2D J;  3OYA A;  3VB2 A;  3CCS I;  1VF9 A;  1VQK I;  1W7P D;  2VPR A;  4IHX A;  1JJ6 C;  3CDH A;  1BL0 A;  5ED4 A;  1TWH J;  3N05 A;  1BJZ A;  3HOT A;  4ZDO A;  2AQF A;  1S7O A;  3Q9S A;  2VKD A;  1FC3 A;  1Y56 A;  5FLV A;  2GA1 A;  5FLX K;  2VL8 A;  1G3T A;  3IP4 B;  4CO8 A;  1TZL A;  1FLI A;  2JT1 A;  4ITV A;  3PO3 J;  3GUD A;  5HDN A;  1AOY A;  2OTJ I;  5L3C A;  2L3D A;  1W5S A;  4FHT A;  3KEQ A;  4A6E A;  1T39 A;  1NTC A;  1WGX A;  3OL4 A;  4BBS J;  4NUB A;  2HOE A;  2BY0 A;  4PJ0 C;  2V4J C;  3OYG A;  4PZJ A;  4NQW B;  2JRT A;  1TBX A;  1RR7 A;  2IJL A;  3I59 B;  4Q48 A;  1WI3 A;  1E2X A;  3ABL H;  4A5N A;  3GZN B;  1ETV A;  4B44 A;  1J2X A;  2JVH A;  4L9T A;  2XAH A;  2R7W A;  3OOP A;  2NNY A;  3H0D A;  1QVU A;  3S32 A;  1IV8 A;  2KDZ A;  2DDB A;  3KZI C;  2EV0 A;  3V8J A;  4ZZD A;  3BG7 A;  1P7I A;  1L0O C;  5EZH A;  4M9X A;  4OIP F;  4I01 A;  3S16 J;  1ULY A;  2R7D A;  1B8I B;  2HEO A;  2PMH A;  2WA0 A;  4Y4R A;  2GBY A;  5IT9 K;  2L9S A;  4A3F J;  2AXT C;  4HOB A;  3MMY B;  2HPI A;  1GXP A;  2VON A;  5BNG A;  5F0H A;  4BDY A;  3DCF A;  4ESJ A;  4RGX A;  4RA2 A;  4V2G A;  2IBD A;  2P6T A;  2D5V A;  4I0B A;  4CCL A;  5IYC J;  1U5T C;  2A07 F;  3RKQ A;  3WE2 A;  3Q5F A;  3JRA A;  3DU5 A;  1ZGJ A;  3TW6 A;  1O4X A;  3ASN H;  4AWX B;  2EIL H;  2CW7 A;  4DYC A;  3A01 A;  3K1N A;  2WV0 A;  4XRF A;  5E20 A;  4DZJ A;  1O3T A;  1ACI A;  1IGN A;  3N97 A;  1S7E A;  4U0W A;  3OYI A;  3R60 A;  2KRF A;  3HDD A;  2X6X A;  4WX9 A;  2M4K A;  3OWT A;  3IRQ A;  1FNN A;  1YS7 A;  2WBM A;  1T38 A;  3QQA A;  1V54 H;  5K1Y A;  2JQ7 A;  1G2H A;  1R36 A;  2ZC2 A;  1D1C A;  2JWT A;  2QUF A;  3FDY A;  3CLQ A;  4WF2 A;  1J59 A;  2DT5 A;  4I09 A;  2EFN A;  2MLK A;  1A31 A;  4ENK A;  2ETH A;  2X9D A;  3RQI A;  4Y7N J;  3K2A A;  1X19 A;  2KZG A;  1AHD P;  4J01 A;  5FRM A;  3FHZ A;  4IL6 C;  2E36 A;  4P5O A;  2VOO A;  2I8D A;  3FMR A;  1GT0 C;  2HQ5 A;  3JRC A;  2M2E A;  1X3Z B;  2Y9Y A;  2XAJ A;  2F2E A;  3HZJ A;  5J4Y A;  3CC7 I;  2O7O A;  2AO9 A;  2JPB A;  1G8X A;  1B1B A;  1KQ0 A;  3EUH C;  3LL7 A;  5IYB J;  5LRR A;  3SEQ A;  1Y8R B;  3G4S I;  5F1J A;  2M1B A;  4BQA A;  3CCU I;  2OBP A;  1KGS A;  4RAY A;  1F5T A;  4JOM A;  4JYK A;  2XGC A;  3OR1 C;  5TGT A;  3WG7 H;  9ANT A;  3ECH A;  4BKX A;  3GME A;  1QA6 A;  4M3G A;  4LFU A;  3HHG A;  2BHZ A;  2Y69 H;  3HOU J;  5EDN A;  3H36 A;  3HBL A;  1L3L A;  2DW4 A;  1UMQ A;  2RV8 A;  3D5R C;  1ETW A;  1MND A;  2WB1 A;  3RPU A;  1KYW A;  1Y0U A;  5EEH A;  4IQ4 A;  3CCJ I;  2KRC A;  3H3V K;  1WFX A;  4I7H A;  2H6B A;  5DUI A;  4S04 A;  3S93 A;  1D0Z A;  2JTV A;  3QOD A;  4A0Y A;  4XBF A;  3IH4 A;  2EIN H;  1T33 A;  2VKE A;  2VBX A;  1VQP I;  1RIO H;  3FK6 A;  3V8K A;  3ZQH A;  5AON A;  1IUF A;  4HQM A;  4M71 A;  1ENH A;  1B9M A;  1WJ5 A;  5EF6 A;  2G9W A;  2O03 A;  2DMN A;  3RYR A;  1IN5 A;  2L4M A;  1OJL A;  4BEH A;  3LFU A;  2M0M A;  4A3D J;  4A93 J;  1MBF A;  2HYJ A;  2GZW A;  2JA5 J;  1FSH A;  2M5W A;  1FEX A;  3P7N A;  5J8F A;  2VI6 A;  4BH9 A;  2NNN A;  3R0A A;  3ZPL A;  2BZT A;  1TLH B;  3MQ0 A;  4NC6 A;  2UV1 A;  3KZZ A;  2K9M A;  1ZGW A;  4G8X A;  1O7L A;  1DPU A;  2D2W A;  3NEU A;  4KYW A;  4UB8 C;  1K4S A;  3A01 B;  3DQV C;  2DMP A;  4I6Z A;  2PMU A;  1FOW A;  1W5C C;  5FKN A;  2VB6 A;  4LLL A;  2HQN A;  5M3M J;  1BOB A;  2Z99 A;  1PJR A;  5E17 F;  4FTH A;  3QP5 A;  3W6J B;  3TO9 A;  3KP2 A;  3IWZ A;  2OAZ A;  1MNE A;  1FIP A;  3DWL E;  2H8W A;  3KPH A;  4D9J A;  2F5D A;  1Z3X A;  3F21 A;  3F8B A;  3ZR8 X;  1T95 A;  2V7F A;  1T0F A;  3S1R J;  4M9Z A;  4LJZ F;  3TP0 A;  2M8G X;  2K3F A;  1Y1W J;  4HNU A;  2O0Y A;  2ECC A;  1O3S A;  4F55 A;  4XKC A;  4BQO A;  3DEW A;  4LK0 F;  1ETQ A;  2BE5 F;  2DTZ A;  3I5U A;  3IH3 A;  2UXX A;  1BBY A;  2W84 A;  2DOF A;  1QZE A;  3FXU A;  3RKY A;  4HQE A;  2W57 A;  5F1R A;  4HYE A;  4I0A A;  4YFK F;  5DV5 A;  3HXL A;  1QGP A;  3DLA A;  1T98 A;  5JVT A;  1FP2 A;  1OQY A;  4LB6 B;  4YFN F;  3RQ4 A;  5JR3 A;  1HXD A;  1VQM I;  1U9O A;  4H0E A;  1XS9 A;  1WH7 A;  3S1M J;  2BY2 A;  3WGG A;  1SD5 A;  4ASN A;  3QU6 A;  2CV2 A;  2LBF A;  4OIN F;  5BQT A;  2L4A A;  5GTH C;  4E7L A;  4XLE A;  4AM3 A;  3I53 A;  3JW4 A;  3CJT B;  2F5E A;  3P9I A;  3SXY A;  1WWX A;  1FJL A;  2UWM A;  3O6B B;  1CF7 B;  1WCM J;  2A3S A;  2CW0 F;  2FD5 A;  3S3O A;  4YFX F;  3WTU C;  1P9Q C;  4RB3 C;  3CME I;  1TT0 A;  2HDW A;  1IAW A;  3SHF A;  1WKM A;  2Q0O A;  2EZL A;  4N0B A;  1B72 A;  2LYC A;  1YS6 A;  4EAT A;  3CO7 C;  3LNQ A;  3K4M A;  1XMK A;  4IO9 F;  5DD4 A;  3NWS A;  1HQC A;  2X1D A;  1VQ8 I;  2LOO A;  5JLW A;  4AUX A;  4BL0 B;  1MZB A;  2CUE A;  3BPV A;  3QOP A;  3V7S A;  4BEH B;  3JTH A;  4XOT A;  2XAG A;  2FML A;  2QKL B;  4ESF A;  1PUE E;  1T56 A;  4ZJZ A;  4EGY A;  4B47 A;  2K5C A;  5DM6 F;  1EKE A;  4AYB N;  4JK1 X;  4B48 A;  2QSG X;  1XCB A;  2PG4 A;  2H6C A;  4E7J A;  1ZHF A;  3ZMT A;  2K9Q A;  2DK5 A;  3LQQ A;  3HKZ A;  2MD0 A;  2ZJP F;  4MLO A;  4RB0 A;  2VBW A;  3BG6 A;  1I1S A;  3ZMV A;  3ZMZ A;  4EJV A;  1V5E A;  5LHG A;  4G7Z F;  1R49 A;  3GTK J;  1YW7 A;  3FWE A;  1U8R A;  1FOY A;  2V6E A;  2GIZ A;  4XLC A;  1FPQ A;  5JLX A;  3IKV A;  1DU6 A;  3KIO A;  3IL2 A;  3KET A;  1FYL A;  1RUN A;  4F3Q A;  1WJA A;  1UST A;  1TTY A;  2RVC A;  4DNC A;  1J9I A;  2DU9 A;  3WG9 A;  1N78 A;  2WWY A;  1D8K A;  3KP6 A;  4CCJ A;  3BZ6 A;  4IF4 A;  5B66 C;  1OLT A;  5HLH A;  2RQQ A;  1FTT A;  1RPW A;  2ECB A;  2IGN A;  1I27 A;  2P4W A;  2X51 A;  1Z05 A;  4G6T B;  3ZMU A;  3OIO A;  2YSR A;  1ZG5 A;  3M4O J;  2IPQ X;  4RLF A;  4CCN A;  3WTY C;  1X1B A;  2ELJ A;  5KAI C;  3MZH A;  3FKI J;  2K40 A;  3KP7 A;  4N9H A;  4I2O A;  2BVM A;  1D0Y A;  2A69 F;  2CH0 A;  1FY7 A;  2VBY A;  3O3K A;  3IRR A;  3B73 A;  3HOS A;  2GOM A;  1ZK8 A;  3CF2 A;  5D5W B;  2ISZ A;  3CC4 I;  2LKP A;  3DXJ F;  1Y6I A;  2HXI A;  1QNT A;  2CUJ A;  2F4O B;  4MFD A;  2BBY A;  4MNU A;  1UG2 A;  4BBR J;  4EM0 B;  3ULQ B;  2K9N A;  2ZSH B;  3FXO A;  4BXX J;  3TQN A;  3A03 A;  3BJO A;  1F9N A;  3BG9 A;  3SDB A;  2VLA A;  1WH5 A;  3ELK A;  2QCO A;  1LE8 A;  1LNW A;  5L3D A;  4QSH A;  5B3S H;  4L18 B;  1R5I D;  2J5O A;  4A12 A;  5M5W J;  2OD5 A;  3FZV A;  4CDG A;  5J6X A;  4E7H A;  5CVJ A;  4XN3 A;  2G7U A;  1VI0 A;  2LBF B;  1Z0X A;  2XAQ A;  2WAE A;  5DCM A;  3TO6 A;  2Y9Z A;  1T6S A;  5F64 A;  3KYL A;  1FP1 D;  3K70 C;  1ETX A;  1BR4 A;  2W4S A;  3GTJ J;  4XID A;  1R22 A;  5KK1 A;  2OPT A;  3U1D A;  3CMA I;  1TWF J;  2X1E A;  3BG5 A;  2K27 A;  2VJ4 A;  5LBQ A;  2CGP A;  1MBK A;  3VOD A;  3DV8 A;  2OF7 A;  4DYQ A;  4KIF A;  5EYR A;  2JUC A;  1B72 B;  4Q5S F;  3D0S A;  5ICC A;  4OAZ A;  5E1X A;  3BC8 A;  2FXA A;  1J7K A;  4KMU X;  4M3B A;  2NOG A;  1ETY A;  5HDK A;  2NS8 A;  1ETK A;  3HM5 A;  1XTA A;  1ZGA A;  4P1W A;  1JGG A;  3CCQ I;  1XD7 A;  3C3W A;  2QQ8 A;  1O57 A;  3IAM 2;  4KNY A;  5D5X B;  3JR9 A;  1SFX A;  2QM3 A;  1VTN C;  4XKB A;  1R4N B;  4P9U A;  3ONQ A;  3IWF A;  1I6X A;  1W0T A;  3BR0 A;  4LIU A;  1TC3 C;  3BZK A;  2MH2 A;  2ZCW A;  2GOX B;  1TQI A;  3X2Q H;  4W97 A;  1VQ5 I;  1XN7 A;  2ZKZ A;  4HPQ A;  2IGK A;  2LFB A;  5E1W A;  2P5L C;  4OOI A;  4HDU A;  3QRF F;  1HLV A;  1K7A A;  2EH3 A;  1TW3 A;  3C2H A;  3ZOB A;  2KMU A;  4FCY A;  2HKX A;  2KP6 A;  1MBE A;  2R4G A;  2ME6 A;  1XMX A;  4BQQ A;  1U0J A;  1UB9 A;  3TKY A;  4XMY A;  2XB0 X;  3DBL B;  4D7M A;  1R5G A;  1MD0 A;  5DDG A;  2HDC A;  4A0X A;  2TRT A;  2IVM A;  3K4N A;  4GYG A;  3ESW B;  3BR1 A;  2BV6 A;  5F0F A;  2FOK A;  4M3D A;  1APL C;  3HPG A;  4H4K C;  3GFI A;  1BJA A;  1MMD A;  1HSJ A;  2WAQ A;  5LHI A;  3M7G A;  1S5L C;  2VIX A;  3OL3 A;  3IV5 A;  1TNS A;  3CES A;  2L01 A;  2HZT A;  3BT9 A;  2KIM A;  1ZRF A;  4U7D A;  1ZQ3 P;  2QSF X;  1R1U A;  4E7Z A;  3VYR B;  2RGV A;  2DN0 A;  2HXO A;  1XC5 A;  4MGR A;  2XKP A;  4GDF A;  1OCP A;  2DMT A;  3CQZ J;  3Q0V A;  1OIS A;  1YG2 A;  3GWZ A;  5E3L A;  4NNJ A;  2Y30 A;  3LA7 A;  1X1C A;  4PJJ A;  1I1G A;  5BS6 A;  3I71 A;  4F91 B;  1KQ9 A;  2VUM J;  2W1O A;  3EYY A;  2NVX J;  2L7Z A;  3DKW A;  1LE8 B;  1HDP A;  1SAN A;  3L2V A;  4PSW A;  3CO6 C;  3NAR A;  4MQV A;  4GO1 A;  2LMD A;  2W85 A;  4CXF A;  3GFJ A;  1MW7 A;  2ZNZ A;  1G6N A;  3K1M A;  5FKO A;  3MKZ A;  5DCM B;  5FB2 A;  3TL4 X;  3J7A O;  4KFC A;  3FIW A;  3ERE D;  1T8I A;  1X2M A;  3WHC A;  1IDY A;  2BXY A;  1QHH D;  2DA7 A;  5J40 A;  4CZZ A;  3H1C A;  3U2R A;  4XK4 A;  5HVQ C;  2H1K A;  1J5Y A;  1WPK A;  4DW6 A;  1FOX A;  1TP4 A;  2NS0 A;  3W2V A;  3RI4 A;  3PFI A;  3H35 A;  3V7R A;  3ABT A;  4MIM A;  4C2M J;  1JI8 A;  1SFO J;  1HST A;  1BC8 C;  3J80 K;  4CIC A;  3BLY A;  1GLN A;  1VZ0 A;  3M1E A;  3H5R A;  3HSF A;  3HRM A;  3FMQ A;  3FXM A;  2XAS A;  3JRI A;  4XRS G;  2QQ9 A;  4LG0 A;  4IZZ A;  4RGU A;  3FXK A;  2GWR A;  3H0G J;  2QKM B;  2CMP A;  2JUG A;  3DTK A;  1H0M A;  1REP C;  1WJB A;  2LY2 A;  1PVE A;  2FUG 2;  3O2P E;  4X0G A;  3F8N A;  1P7J A;  2B63 J;  5HLG A;  4U0Y A;  1BI3 A;  5K7H A;  2LY9 A;  1UHS A;  1ODD A;  3CF5 F;  3MEX A;  3OS1 A;  4XLP F;  1X58 A;  1MBH A;  4JX6 A;  3GZ6 A;  1UCR A;  3WTV C;  2XGX A;  3QWL A;  2AS5 F;  5ICG A;  2EA2 A;  2Z16 A;  1YW9 A;  4LLG F;  4Z6Y A;  3SFI A;  3Q0W A;  1R6R A;  2A68 F;  1Z77 A;  2JZY A;  2X0L A;  6PAX A;  3M3Y J;  3P9K A;  4G94 A;  3S2W A;  3GTP J;  3M07 A;  2W82 A;  1JT6 A;  2QEN A;  4N4O B;  3E6M A;  2KQR A;  3MCZ A;  5EZG A;  2F5V A;  3SFZ A;  5D8K B;  4DQ2 A;  4BNC A;  4QWQ A;  3FK7 A;  1D5V A;  1A5J A;  5FO5 A;  1OMI A;  2O5R A;  5F6F A;  3QYB A;  4BAC A;  3V7C A;  4HX8 A;  2EV5 A;  4X6A J;  3Q3S A;  1R1T A;  2LF8 A;  1NG7 A;  2GXB A;  3K10 A;  3GZ5 A;  5JVG F;  1R5H A;  1UZC A;  1ZEL A;  1ZYR F;  3DEE A;  3QPT A;  4UVC A;  4OIR F;  1IW7 F;  3WU0 A;  4CCM A;  1SD4 A;  4PJM A;  2OUM A;  3RKX A;  2FQ4 A;  1UJ8 A;  4E7K A;  1W36 C;  5FLX Z;  3MKY B;  3CC2 I;  3PO2 J;  1U78 A;  4G7H F;  4QIW N;  3PUF A;  1Z9C A;  1FYK A;  2LRD A;  2RAE A;  1SVL A;  1BW5 A;  1IZ1 A;  2V9V A;  4IEJ A;  5KNL A;  2CV1 A;  4C2T A;  3HGY A;  4R1H A;  2M8E A;  3BR5 A;  2DOA A;  5KVR A;  5CYV A;  4PFO A;  1IRZ A;  2HNH A;  3M8E A;  2ID3 A;  3GF2 A;  2CG4 A;  3L00 A;  4Y17 A;  1FBS A;  2MA3 A;  2FNP A;  4NDL A;  4XR6 A;  4XON A;  3W2W A;  1V55 H;  2MD5 A;  3TOB A;  1W4M A;  4ZZL A;  2PJP A;  1RET A;  2M3A A;  2RN7 A;  4F7Z A;  5HLT A;  2PJR A;  4C9Y A;  3O8H A;  2VOP A;  5D6E A;  1YIO A;  4U88 A;  4QPQ A;  1SVO A;  4L9N A;  1RNL A;  2Q1Z B;  2BVL A;  3LSR A;  2HFH A;  3GFL A;  2EIK H;  2XSD C;  1I3Q J;  2DT7 B;  2H09 A;  3WTW C;  3AG2 H;  1BI2 A;  3SYT A;  3OSF A;  1YJN I;  1JT0 A;  2Q8K A;  5GAD J;  3HUG A;  4UHT A;  1ZR4 A;  5LEK A;  2XSJ C;  3E7L A;  2DA5 A;  4OWR B;  4AU7 A;  5BMZ A;  2Z2S B;  1ZAO A;  2JMW A;  3GEZ A;  3ZGK A;  1WQ2 A;  2LSO A;  3PNY A;  3OIQ A;  4MFE A;  3HYI A;  1LDJ A;  2X4H A;  3BPX A;  3K9T A;  1LQ1 A;  2VC1 A;  5B1B H;  2XDV A;  2EIJ H;  5CVR A;  1MMA A;  3W2A A;  1R58 A;  1P4A A;  2DT6 A;  5A2Q K;  2JSC A;  2FBI A;  4RS8 A;  3ZMS A;  4G6Q A;  3AL0 B;  3JTG A;  1RES A;  3ZRG A;  2ZFW A;  5HDG A;  3IAS 2;  1CQT A;  2B9S A;  3HRT A;  4CUG A;  1ON2 A;  2OCE A;  2GQQ A;  3TP3 A;  3CCE I;  2R0Q C;  3S17 J;  5DD8 A;  2OZU A;  5LLQ A;  2CV0 A;  2E5Z A;  4MTD A;  3VOE A;  5FD5 A;  2I10 A;  2E2I J;  2DPU A;  3RSN A;  3DPL C;  3RIR A;  5J1U A;  1VND A;  2QQB A;  2PBI A;  2BGC A;  3QPS A;  4OIQ F;  2DCE A;  3PFY A;  3D1N I;  2L02 A;  2A05 A;  3E6B A;  1FX7 A;  4WXC A;  4U7B A;  3G1M A;  3GFM A;  4RM2 A;  3E5U A;  1KA8 A;  2COM A;  2IA2 A;  3FXJ A;  3G1L A;  4XM3 A;  4PSX A;  4Y52 J;  2WTE A;  1YIT I;  3K1P A;  3FBN B;  3OYC A;  4IHT A;  2DAO A;  1P92 A;  2HTS A;  3RTR A;  1ZLJ A;  2H8R A;  2R7S A;  2FA5 A;  1E17 A;  5F04 A;  3C1D A;  2E2J J;  3P9C A;  3DKY A;  3TW7 A;  1YOV B;  2X6O A;  4RLQ A;  2QZ8 A;  2XPV A;  1R4M B;  4XLF A;  2XF6 A;  5J8C A;  3HEF A;  2WB1 N;  1WJD A;  1YTY A;  1MJB A;  1JKP C;  2R3S A;  2HDD A;  3TOA A;  1P4W A;  2E34 A;  1V5F A;  5CQE A;  5IPA A;  3L7W A;  5DEQ A;  1V3F A;  1MDM A;  2PJR B;  5GPC A;  4EQQ A;  5C44 J;  1C0W A;  2L7K A;  1JXS A;  4M6V A;  1WJE A;  3NQO A;  3CP2 A;  4KJZ A;  1HCR A;  3OYL A;  3K70 D;  1YX5 A;  3OYF A;  2X6W A;  4LIT A;  3VYS B;  3FHN A;  3F8M A;  2XIG A;  3OYE A;  1PP8 F;  1QRY A;  1ZR2 A;  1FTZ A;  4WK8 F;  1VQL I;  4PJL A;  1USS A;  2XF5 A;  2W7N A;  2ICW G;  4ENM A;  2O6G E;  1LVA A;  2CU7 A;  3P5J A;  2X85 A;  1KON A;  4Y33 A;  1KZH A;  3T8T A;  3S3N A;  3JRH A;  3GTO J;  2OCC H;  1Y8Q B;  3SJM A;  2F4I A;  2TDX A;  3ABK H;  4M74 A;  1IN6 A;  1YE9 A;  3M8J A;  3G3Z A;  1Q1H A;  1X4P A;  5HS7 A;  3K0L A;  1IXS B;  5FGM A;  5AIQ A;  1YJ9 I;  1IF1 A;  3MKL A;  1GUU A;  3E6D A;  2ZME A;  5FRN A;  2P7V B;  1POG A;  4QLC U;  2WV1 A;  2CSO A;  1Y0N A;  3AKZ A;  5C4J J;  1IG7 A;  2RNG A;  2KKO A;  4IHS A;  2EA4 A;  2VAS A;  2VE8 A;  3DPU A;  5D5U B;  1FT9 A;  2Y2Z A;  3CUQ A;  1PUF A;  4CHU A;  4C3I J;  4OMY A;  2GIV A;  4DIQ A;  3J7A Y;  4YEJ A;  3WOD F;  4A2U A;  2LK2 A;  3ERM A;  3IKT A;  5GAE J;  3HOZ J;  1PP7 U;  2X1C A;  2QSH X;  4UUT A;  2FRH A;  4XQF A;  1NK3 P;  3Q9V A;  3LWF A;  1IV6 A;  2MBF A;  3J81 K;  4F92 B;  2L5Q A;  1O3R A;  2DBB A;  2Y31 A;  4KUM A;  2KJB A;  2V1X A;  2UXN A;  2WC2 A;  3WU2 C;  1STZ A;  3CJR B;  1U9N A;  5FFZ A;  2VQC A;  2NXN B;  4E7S A;  3ZQF A;  4FE7 A;  2R7U A;  1LUJ B;  5EG0 A;  1XGO A;  3UR3 C;  4A3M J;  4II2 A;  3FM5 A;  4HF0 A;  3CD6 I;  3ABU A;  3IC7 A;  2ZXW H;  3CCR I;  2VJI A;  4LK1 F;  1N77 A;  3PNT A;  5F08 A;  4D5C A;  1BN5 A;  4XSZ F;  5CQG A;  4A3E J;  2B0L A;  2QGU A;  2Z3Y A;  4IHV A;  3WTS C;  2HKO A;  1XDU A;  2XAU A;  5IP9 J;  1IDZ A;  1E3P A;  3NRV A;  3GO5 A;  2KFD A;  2FE3 A;  4KIB A;  4S05 A;  1UG0 A;  1MDM B;  5K5R A;  1RRJ A;  1YFH A;  2M7A A;  3KCC A;  4IRH A;  1GHC A;  3I3L A;  5FKL A;  2ZXI A;  3GW2 A;  2GA2 A;  4HNV A;  4EM2 A;  4A0Z A;  3L2C A;  4CZC A;  1G3W A;  4A6D A;  1Z91 A;  2PEX A;  3CCM I;  3HHH A;  3COA C;  3L9F A;  1G3S A;  2JN6 A;  1JUM A;  3GVA A;  3WTX C;  4FET A;  4BQN A;  2P5V A;  3U1K A;  4B4C A;  2HQR A;  1QQI A;  3K4B A;  4AIJ A;  1B6A A;  3C2B A;  1QZY A;  4ZYH A;  2O8K A;  1ZG3 A;  3HRU A;  3HKZ N;  4MEY F;  1HKT A;  2VOD A;  4XNF A;  1XB4 A;  5FLM J;  3BQZ A;  1ZTR A;  3C18 A;  1LKX A;  3JSP A;  5HNF A;  3BRO A;  2KHM A;  3HOX J;  4I98 B;  2YUS A;  3ZMD A;  1WRJ A;  3WGI A;  2CQN A;  1A36 A;  4GCV A;  5J47 A;  1DUX C;  2ESN A;  5LGU A;  2DA1 A;  2MH9 A;  4XN0 A;  4D0P A;  4Y13 A;  2M34 A;  2D45 A;  1DGR M;  3HPH A;  1Y1V J;  4ON0 A;  5ERI A;  3VDX A;  5BOX A; 
#chains in the Genus database with same CATH homology
 3CUQ B;  1TW2 A;  3ZN1 A;  2VT2 A;  2XRN A;  4M6Y A;  2RDP A;  4JBA A;  2P7C B;  2EFQ A;  3HTU A;  2YU3 A;  1ZLK A;  3MAJ A;  5TJJ A;  2HTJ A;  4WCG A;  3ZP5 A;  4EJO A;  2STW A;  2OA4 A;  2E1N A;  3EUH A;  4P55 A;  5AIP A;  2ZBK A;  2GXG A;  3F72 A;  1XSX A;  4HLX A;  3GX4 X;  5TRD A;  3F23 A;  1XMA A;  1HBX G;  2VC0 A;  3DEU A;  4MQ9 F;  1ONV A;  1IXC A;  2MC3 A;  3F8F A;  3FX3 A;  5EEG A;  1HW2 A;  4RB1 A;  1IUY A;  3G73 A;  3FF5 A;  1QZZ A;  3D5L A;  3V8L A;  5LRS A;  3DPT A;  3SZT A;  5IT3 A;  3QAH A;  3GXO A;  2E7W A;  4CGZ A;  1OYW A;  3LFK A;  1IN4 A;  1LDK B;  4O6J A;  3WE3 A;  3L09 A;  3U9G A;  2VN2 A;  1K6O A;  4HDV A;  4RGS A;  3RPQ A;  1S8N A;  3KEO A;  5HLI A;  5HS8 A;  4A5M A;  4PCQ A;  4AIH A;  1K78 A;  1W7P A;  2HGC A;  2VBZ A;  2K7L A;  2EWN A;  1T2K A;  1KU7 A;  2ZO4 A;  4P9F A;  5JHU A;  3ROU A;  1S6L A;  2OZ6 A;  4B8X A;  1JHH A;  1U6G A;  1KU3 A;  5K5Q A;  1UHW A;  2XKO A;  2XRO A;  2CYY A;  3JAM K;  1LEA A;  2J5P A;  3BOQ A;  4JQF A;  3I0T A;  3RDI A;  3ZN0 A;  3EET A;  4KDP A;  4M73 A;  4KA4 A;  4HF2 A;  2RKH A;  3E3V A;  4HX7 A;  5D4S A;  2DLL A;  4KMF A;  1BI0 A;  2PN6 A;  5L3G A;  1S7A A;  2H94 A;  2DK8 A;  3VFZ A;  2Y48 A;  1D8J A;  1BOA A;  1KQ8 A;  3KE2 A;  2A6E F;  4AVP A;  3FXQ A;  4EMS A;  2W24 A;  2CFX A;  1F1Z A;  5E1Z B;  2D1H A;  2RQP A;  1AWC A;  3N4M A;  2PLY A;  2CO5 A;  4XSX F;  4Z2Y A;  5D6F A;  3I59 A;  1P2F A;  4PGH A;  1OR7 A;  4UVA A;  1Z6R A;  3J80 Z;  2YPR A;  3H3Z A;  1XCV A;  4Q47 A;  2M87 A;  1PDN C;  3DFG A;  1WI9 A;  3V4G A;  4UV9 A;  2KJC A;  4BHP A;  4KIG A;  4ZYD A;  1R7J A;  2W25 A;  5JFR A;  4KT5 C;  1R00 A;  1K78 B;  1Z7U A;  1P6R A;  1W7P B;  1D3Y A;  1EH6 A;  4L5J A;  4ZH4 F;  4FX4 A;  3EDP A;  3E5Q A;  1UFM A;  1BC7 C;  1SFE A;  5HS9 A;  3FMS A;  3ECO A;  5E8I A;  4IVN A;  1LJ9 A;  2K02 A;  2YX7 A;  1H9T A;  5D4R A;  1SD7 A;  4OU0 A;  1XDS A;  2O61 A;  4UVB A;  2RNJ A;  2XUB A;  3CUO A;  4EM1 A;  2ACJ A;  4K2E A;  1LEB A;  5ICE A;  3HSR A;  4B09 A;  3ML6 A;  2H27 A;  3LAJ A;  2VXZ A;  2NYX A;  5DUK A;  4ESB A;  1EH7 A;  1B59 A;  1XGS A;  4EVI A;  2JPC A;  4HF1 A;  3CLO A;  3EQL F;  3R0J A;  4HBL A;  2ISY A;  4MTE A;  5CVU A;  4KIC A;  2STT A;  1KYZ A;  1KU9 A;  2E7X A;  5L3B A;  5H6Q A;  4LB5 A;  5CVI A;  3VEP A;  4MHG A;  4LG0 B;  1HKS A;  5IT9 Z;  4LGW A;  3REO A;  4LLN A;  4UUV A;  2V1U A;  1MGT A;  1CGP A;  4RGR A;  3HRS A;  4ETS A;  4O3M A;  2CQK A;  4YIF A;  2CWE A;  2DO7 A;  2IP2 A;  1RI7 A;  4BYY A;  2G7H A;  3F22 A;  3C7J A;  2ESH A;  2FU4 A;  3QPH A;  5ICF A;  4EJT A;  5CVV A;  4G7O F;  3R61 A;  5CLS A;  5A2Q Z;  5BPI A;  2NAZ A;  3LA2 A;  3PQJ A;  2ZXJ A;  3BY6 A;  3E5X A;  3H92 A;  3TDZ C;  4HLY A;  2IRF G;  2V6C A;  2UZK A;  5H20 A;  1IRG A;  1R1V A;  4N9I A;  2O3F A;  1QO0 D;  2DFI A;  3LAP A;  2RC4 A;  3RKW A;  2HWV A;  4R8H A;  2OQG A;  1R23 A;  1G3Y A;  3T8R A;  1SFU A;  3FXR A;  1ZH5 A;  4E70 A;  4HA8 A;  3QP6 A;  5E8G A;  4G6D A;  2A5Y B;  3E97 A;  3ZQ7 A;  2IW5 A;  4CYD A;  3CJN A;  4GXO A;  1OYI A;  1JGS A;  5DYM A;  4LD5 A;  4MEX F;  4IJA A;  4O5V A;  3TGN A;  2OU2 A;  4AIK A;  1DPR A;  2P8T A;  1LB2 A;  1J75 A;  4GGG A;  1ZRD A;  4OIO F;  1BM9 A;  1CF7 A;  1ZRE A;  3WTZ A;  3KP4 A;  4ZYG A;  2EB7 A;  2DPD A;  2P5K A;  1XGN A;  1RZ4 A;  1ON1 A;  3KFW X;  5FD6 A;  2D1V A;  1HKQ A;  1A04 A;  1IRF A;  1LDD A;  1OYY A;  2M30 A;  3MWM A;  1EH8 A;  2XVC A;  3LQR A;  3F6V A;  1P4X A;  1B4A A;  1GXQ A;  4TV7 A;  3KLN A;  1FWZ A;  2XAF A;  4PDK A;  4HV6 A;  2HYF A;  5L3F A;  4BHC A;  4BXU A;  4EJW A;  4YG2 F;  1U3E M;  4ZYE A;  1ZG1 A;  3J81 Z;  3SQN A;  3KZY A;  1U2W A;  1YO5 C;  1S3J A;  1OKR A;  4IXA A;  1QPM A;  2QVO A;  2M45 A;  1Z6T A;  2DQL A;  2QWW A;  3DF8 A;  2Z9O A;  2QYO A;  3BJ6 A;  4M6X A;  2EK5 A;  2VE9 A;  2R7F A;  2Z5U A;  3JSO A;  2F5F A;  3FM3 A;  3DP7 A;  4L0Z B;  2O8X A;  2BYV E;  1RUO A;  2YX4 A;  3LST A;  3B02 A;  1EV7 A;  3HIF A;  4L9J A;  3I64 A;  1G4D A;  3GYH X;  1DDN A;  3K69 A;  2KIU A;  4HV5 A;  3T5X A;  3WTT C;  1IN7 A;  1U5T A;  4IRG A;  3BDD A;  1O7F A;  4IPA A;  2V79 A;  2ZME B;  2EFW A;  3K2Z A;  4P96 A;  3M8F A;  1MJA A;  3H3U A;  1FBU A;  3HTS B;  3MZY A;  4UXN A;  2FBK A;  1I5Z A;  2MLG A;  4WXH A;  1QBJ A;  2PI0 A;  4G9Y A;  1MKM A;  5ILS A;  3RJP A;  1OPC A;  3BWG A;  2OQR A;  4R79 A;  4FT8 A;  3BP8 A;  4U0V A;  5LEJ A;  1ZRC A;  2FNA A;  1JE8 A;  4HZF A;  1SD6 A;  5BPD A;  1FBQ A;  3R6S A;  1GVJ A;  4UNO A;  2K86 A;  3TDU C;  4EGZ A;  1NHA A;  3I58 A;  1H9G A;  5K5O A;  1J0R A;  1IXR C;  3F8C A;  3KP5 A;  1BI1 A;  2QQA A;  2L54 A;  4BAY A;  5D5V B;  2FBH A;  3SZP A;  1YYV A;  5ILV A;  4ENN A;  2FQ3 A;  2FEZ A;  3W6K B;  1KU2 A;  1TQM A;  5D8L B;  1SMT A;  3I54 A;  2K4B A;  2ZJ2 A;  1W5T A;  4NB5 A;  2PFB A;  2PQ8 A;  3KP3 A;  1JHF A;  2XV4 S;  3IHU A;  4UV8 A;  2VT3 A;  1U5T B;  2NRA C;  2LF7 A;  3TO7 A;  2FF4 A;  4RAZ A;  2BEO A;  1FSE A;  4M72 A;  1XSD A;  4M9S A;  2YR2 A;  3GLX A;  1HW5 A;  2DQR A;  4WXD A;  4IRI A;  3CTA A;  2EJR A;  1YQA A;  5LHH A;  2A6H F;  1WSU A;  5LGT A;  2GAU A;  1BIB A;  3PQK A;  1V4R A;  1Z1D A;  3MFK A;  5HOO A;  3OV8 A;  1YW8 A;  2IT0 A;  4PGG A;  2P6S A;  4NHJ A;  2A61 A;  5CJ9 A;  2IA1 A;  2QBY A;  4HAM A;  3WU1 B;  3R4K A;  2IA0 A;  5LGN A;  3BJA A;  2HS5 A;  3RYP A;  3ISP A;  5H6R A;  2ELH A;  5JI6 A;  4XLN F;  1B9N A;  4AD9 A;  1O3Q A;  3QU3 A;  3JAM Z;  3I4P A;  2Q2E A;  2EV6 A;  1FZP B;  4OMZ A;  4BHB A;  2LDU A;  2LNB A;  4KN7 X;  3EYI A;  2AXL A;  1HW1 A;  2XHK A;  1X3U A;  3KLO A;  4L0Y B;  2Z33 A;  2HR3 A;  1SMY F;  4L5I A;  1S29 A;  5E18 F;  4YII A;  4EJU A;  4HW0 A;  1FYM A;  4GYI A;  2KIF A;  2FMY A;  2Y75 A;  1IN8 A;  4NQW A;  2EFO A;  1SAX A;  4WWC A;  2FSW A;  4RB2 C;  4KN4 X;  1TQP A;  1TNT A;  3HSE A;  2QLZ A;  2ADU A;  4LMY A;  4L9V A;  2DTR A;  3T0Y A;  2F5C A;  3E6C C;  1FOK A;  1UHM A;  3M9A A;  4HX4 A;  3T1B A;  1MJ9 A;  1ZN2 A;  2E1C A;  4I02 A;  4FX0 A;  2HYG D;  3F3X A;  2Y0M A;  3WGH A;  2ZNY A;  1K79 A;  2QBY B;  2K4J A;  2C6Y A;  3AAF A;  1F4K A;  1BIA A;  3F6O A;  2EFP A;  4EV0 A;  5FFX A;  4Q4Z F;  5DCF A;  1YLF A;  4Y15 A;  2DI3 A;  4ENJ A;  5L3E A;  2V1D A;  3LA3 A;  1XSV A;  1DP7 P;  3CUQ C;  1XGM A;  5ILU A;  1ZAR A;  3VB2 A;  1W7P D;  3CDH A;  5ED4 A;  3HOT A;  1S7O A;  3Q9S A;  1FC3 A;  2GA1 A;  5FLX K;  1G3T A;  4CO8 A;  1FLI A;  2JT1 A;  3GUD A;  5HDN A;  1AOY A;  5L3C A;  2L3D A;  1W5S A;  4FHT A;  3KEQ A;  4A6E A;  1T39 A;  2HOE A;  4PZJ A;  2JRT A;  1TBX A;  2IJL A;  3I59 B;  4Q48 A;  1E2X A;  4A5N A;  1J2X A;  4L9T A;  2XAH A;  3OOP A;  2NNY A;  2EV0 A;  3V8J A;  4ZZD A;  1L0O C;  4M9X A;  4OIP F;  4I01 A;  1ULY A;  2R7D A;  2HEO A;  2PMH A;  5IT9 K;  4HOB A;  1GXP A;  2VON A;  4ESJ A;  4RGX A;  2P6T A;  4I0B A;  1U5T C;  2A07 F;  3WE2 A;  3Q5F A;  1ZGJ A;  4AWX B;  3K1N A;  2WV0 A;  4XRF A;  5E20 A;  1O3T A;  3N97 A;  4U0W A;  3R60 A;  2KRF A;  4WX9 A;  3IRQ A;  1FNN A;  1YS7 A;  1T38 A;  5K1Y A;  1R36 A;  2QUF A;  4WF2 A;  1J59 A;  2DT5 A;  4I09 A;  2EFN A;  2MLK A;  4ENK A;  2ETH A;  3FHZ A;  4P5O A;  2VOO A;  3FMR A;  2XAJ A;  2F2E A;  2JPB A;  1B1B A;  1KQ0 A;  5LRR A;  2M1B A;  4BQA A;  2OBP A;  1KGS A;  4RAY A;  1F5T A;  3ECH A;  4LFU A;  3HHG A;  1L3L A;  2DW4 A;  2RV8 A;  3RPU A;  1KYW A;  1Y0U A;  5EEH A;  4I7H A;  2H6B A;  5DUI A;  4S04 A;  2JTV A;  4A0Y A;  4XBF A;  2VBX A;  1RIO H;  3V8K A;  5AON A;  4HQM A;  4M71 A;  1B9M A;  2G9W A;  2O03 A;  3RYR A;  1IN5 A;  2L4M A;  2GZW A;  1FSH A;  2M5W A;  3P7N A;  5J8F A;  4BH9 A;  2NNN A;  3R0A A;  3ZPL A;  1TLH B;  3MQ0 A;  3KZZ A;  4G8X A;  1O7L A;  1DPU A;  2D2W A;  3NEU A;  4KYW A;  3DQV C;  2PMU A;  4LLL A;  2HQN A;  2Z99 A;  5E17 F;  3QP5 A;  3W6J B;  3TO9 A;  3KP2 A;  3IWZ A;  2OAZ A;  2F5D A;  3F21 A;  3F8B A;  1T0F A;  4M9Z A;  4LJZ F;  2O0Y A;  1O3S A;  4LK0 F;  3I5U A;  2BE5 F;  2UXX A;  1BBY A;  2W84 A;  3FXU A;  3RKY A;  4HQE A;  2W57 A;  5F1R A;  4HYE A;  4I0A A;  4YFK F;  5DV5 A;  1QGP A;  1T98 A;  5JVT A;  1FP2 A;  4LB6 B;  4YFN F;  5JR3 A;  1HXD A;  4H0E A;  3WGG A;  1SD5 A;  4ASN A;  3QU6 A;  4OIN F;  5BQT A;  2L4A A;  3I53 A;  3JW4 A;  2F5E A;  3P9I A;  3SXY A;  1WWX A;  2UWM A;  3O6B B;  1CF7 B;  2A3S A;  2CW0 F;  4YFX F;  3WTU C;  4RB3 C;  1IAW A;  3SHF A;  1WKM A;  2Q0O A;  4N0B A;  1YS6 A;  3CO7 C;  1XMK A;  5DD4 A;  1HQC A;  1MZB A;  3BPV A;  3V7S A;  3QOP A;  3JTH A;  2XAG A;  2FML A;  4ESF A;  1PUE E;  4EGY A;  4JK1 X;  1XCB A;  2PG4 A;  2H6C A;  1ZHF A;  3ZMT A;  2DK5 A;  3LQQ A;  4RB0 A;  2VBW A;  1I1S A;  3ZMV A;  3ZMZ A;  4EJV A;  5LHG A;  4G7Z F;  1YW7 A;  3FWE A;  1U8R A;  1FPQ A;  3IKV A;  3IL2 A;  3KET A;  1FYL A;  1RUN A;  1UST A;  1TTY A;  2RVC A;  4DNC A;  1J9I A;  2DU9 A;  3WG9 A;  2WWY A;  1D8K A;  3KP6 A;  3BZ6 A;  4IF4 A;  5HLH A;  1I27 A;  2P4W A;  1Z05 A;  3ZMU A;  2YSR A;  1ZG5 A;  2IPQ X;  3WTY C;  3MZH A;  4N9H A;  3KP7 A;  4I2O A;  2A69 F;  1FY7 A;  2VBY A;  3O3K A;  3IRR A;  3B73 A;  3HOS A;  5D5W B;  2ISZ A;  2LKP A;  3DXJ F;  1QNT A;  2BBY A;  4MNU A;  4EM0 B;  3ULQ B;  3TQN A;  3BJO A;  1F9N A;  3ELK A;  1LNW A;  5L3D A;  4L18 B;  2J5O A;  4A12 A;  2OD5 A;  3FZV A;  4CDG A;  5J6X A;  5CVJ A;  2G7U A;  2XAQ A;  3TO6 A;  5DCM A;  1T6S A;  5F64 A;  1FP1 D;  1R22 A;  5KK1 A;  3U1D A;  2K27 A;  5LBQ A;  2CGP A;  3VOD A;  3DV8 A;  4KIF A;  4Q5S F;  3D0S A;  5ICC A;  5E1X A;  2FXA A;  1J7K A;  4KMU X;  5HDK A;  1ZGA A;  1XD7 A;  3C3W A;  1O57 A;  4KNY A;  5D5X B;  1SFX A;  2QM3 A;  1VTN C;  4P9U A;  3IWF A;  1I6X A;  2MH2 A;  2ZCW A;  1TQI A;  1XN7 A;  2ZKZ A;  5E1W A;  2P5L C;  4OOI A;  4HDU A;  3QRF F;  1K7A A;  1TW3 A;  2HKX A;  1UB9 A;  3TKY A;  1R5G A;  1MD0 A;  5DDG A;  2HDC A;  4A0X A;  2IVM A;  4GYG A;  2BV6 A;  2FOK A;  3GFI A;  1BJA A;  1HSJ A;  5LHI A;  3M7G A;  1TNS A;  2L01 A;  2HZT A;  2KIM A;  1ZRF A;  4U7D A;  1R1U A;  2RGV A;  4MGR A;  2XKP A;  1YG2 A;  3GWZ A;  3LA7 A;  1I1G A;  5BS6 A;  3I71 A;  1KQ9 A;  3EYY A;  3DKW A;  3CO6 C;  4MQV A;  4GO1 A;  2W85 A;  4CXF A;  3GFJ A;  2ZNZ A;  1G6N A;  3K1M A;  5DCM B;  5FB2 A;  3J7A O;  4KFC A;  3ERE D;  4CZZ A;  3U2R A;  5HVQ C;  1J5Y A;  2NS0 A;  3RI4 A;  3PFI A;  3V7R A;  3ABT A;  1HST A;  1BC8 C;  3J80 K;  4CIC A;  3M1E A;  3HSF A;  3HRM A;  3FMQ A;  2XAS A;  2QQ9 A;  4LG0 A;  4RGU A;  2GWR A;  1H0M A;  1REP C;  3O2P E;  3F8N A;  5HLG A;  4U0Y A;  1BI3 A;  1ODD A;  3MEX A;  4XLP F;  3GZ6 A;  1UCR A;  3WTV C;  2XGX A;  2AS5 F;  5ICG A;  2EA2 A;  1YW9 A;  4LLG F;  2A68 F;  2X0L A;  2JZY A;  6PAX A;  3P9K A;  4G94 A;  3S2W A;  2QEN A;  3E6M A;  3MCZ A;  3SFZ A;  5D8K B;  4DQ2 A;  4BNC A;  4QWQ A;  1D5V A;  5FO5 A;  1OMI A;  5F6F A;  3V7C A;  4HX8 A;  2EV5 A;  1R1T A;  2LF8 A;  2GXB A;  3GZ5 A;  1R5H A;  1ZYR F;  3QPT A;  4OIR F;  4UVC A;  1IW7 F;  3WU0 A;  1SD4 A;  3RKX A;  5FLX Z;  1U78 A;  4G7H F;  1Z9C A;  1FYK A;  1IZ1 A;  2V9V A;  4R1H A;  2M8E A;  5KVR A;  5CYV A;  3M8E A;  3GF2 A;  2CG4 A;  3L00 A;  4Y17 A;  1FBS A;  2MA3 A;  2FNP A;  3TOB A;  2MD5 A;  4ZZL A;  1W4M A;  2PJP A;  2RN7 A;  4F7Z A;  2VOP A;  5D6E A;  1YIO A;  4U88 A;  4L9N A;  1RNL A;  2HFH A;  3GFL A;  2H09 A;  3WTW C;  1BI2 A;  2Q8K A;  3HUG A;  4UHT A;  5LEK A;  5BMZ A;  3GEZ A;  1ZAO A;  1WQ2 A;  2LSO A;  3HYI A;  1LDJ A;  2X4H A;  3BPX A;  3K9T A;  1LQ1 A;  2VC1 A;  5CVR A;  1R58 A;  1P4A A;  5A2Q K;  2JSC A;  2FBI A;  4RS8 A;  3ZMS A;  4G6Q A;  3JTG A;  2ZFW A;  5HDG A;  3HRT A;  1ON2 A;  2GQQ A;  5DD8 A;  2OZU A;  5LLQ A;  4MTD A;  3VOE A;  5FD5 A;  2DPU A;  3DPL C;  3RIR A;  2QQB A;  2PBI A;  2BGC A;  4OIQ F;  2L02 A;  3E6B A;  1FX7 A;  4WXC A;  4U7B A;  3GFM A;  3E5U A;  1KA8 A;  2COM A;  2IA2 A;  2WTE A;  3K1P A;  4IHT A;  2DAO A;  1P92 A;  2HTS A;  3RTR A;  1ZLJ A;  2FA5 A;  1E17 A;  3C1D A;  3P9C A;  2QZ8 A;  5J8C A;  1YTY A;  1MJB A;  2R3S A;  3TOA A;  1P4W A;  3L7W A;  5DEQ A;  1V3F A;  1MDM A;  1C0W A;  4EQQ A;  1JXS A;  3NQO A;  3F8M A;  2XIG A;  1PP8 F;  4WK8 F;  1USS A;  4ENM A;  2O6G E;  1LVA A;  3T8T A;  2TDX A;  4M74 A;  1IN6 A;  3G3Z A;  1Q1H A;  5HS7 A;  3K0L A;  1IXS B;  5FGM A;  5AIQ A;  1IF1 A;  3E6D A;  2ZME A;  2P7V B;  4QLC U;  2CSO A;  2KKO A;  4IHS A;  2EA4 A;  2VE8 A;  5D5U B;  1FT9 A;  3CUQ A;  4CHU A;  4OMY A;  2GIV A;  3WOD F;  4A2U A;  3IKT A;  1PP7 U;  2FRH A;  3Q9V A;  3LWF A;  2MBF A;  3J81 K;  1O3R A;  2DBB A;  4KUM A;  2KJB A;  2V1X A;  2UXN A;  2WC2 A;  1STZ A;  5FFZ A;  1XGO A;  3FM5 A;  4HF0 A;  3ABU A;  3IC7 A;  4LK1 F;  1BN5 A;  4XSZ F;  2B0L A;  2Z3Y A;  3WTS C;  2HKO A;  1XDU A;  3NRV A;  3GO5 A;  2FE3 A;  4KIB A;  4S05 A;  1MDM B;  5K5R A;  1YFH A;  4IRH A;  3KCC A;  1GHC A;  3GW2 A;  2GA2 A;  4EM2 A;  4A0Z A;  3L2C A;  1G3W A;  4A6D A;  1Z91 A;  2PEX A;  3HHH A;  3COA C;  3L9F A;  1G3S A;  3GVA A;  3WTX C;  2P5V A;  2HQR A;  1QQI A;  4AIJ A;  1B6A A;  1QZY A;  4ZYH A;  1ZG3 A;  3HRU A;  4MEY F;  1HKT A;  2VOD A;  1XB4 A;  3C18 A;  3JSP A;  3BRO A;  4I98 B;  3ZMD A;  1WRJ A;  3WGI A;  4GCV A;  1DUX C;  2ESN A;  5LGU A;  2MH9 A;  4D0P A;  2D45 A;  4Y13 A;  4ON0 A;  5ERI A;  5BOX A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...