3IWFA

The crystal structure of the n-terminal domain of a rpir transcriptional regulator from staphylococcus epidermidis to 1.4a
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
102
structure length
89
Chain Sequence
MPNILYKIDNQYPYFTKNEKKIAQFILNYPHKVVNMTSQEIANQLETSSTSIIRLSKKVTPGGFNELKTRLSKFLPKEVTQYNNKLHSR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Transcription regulator RpiR family
publication title The Crystal Structure of the N-terminal domain of a RpiR Transcriptional Regulator from Staphylococcus epidermidis to 1.4A
rcsb
source organism Staphylococcus epidermidis
molecule tags Transcription regulator
total genus 32
structure length 89
sequence length 102
chains with identical sequence B
ec nomenclature
pdb deposition date 2009-09-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01418 HTH_6 Helix-turn-helix domain, rpiR family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 3iwfA00
2P7CB 4I7HA 2DK8A 1IAWA 2KKOA 4GGGA 2KIUA 1R1TA 2F5FA 1XGNA 1O3SA 4KIFA 1WI9A 2HDCA 2VT3A 3F8CA 3FM3A 4Z2YA 2FBIA 1V3FA 3HYIA 4YG2F 4OIQF 2ZKZA 4YFNF 1BBYA 2M87A 4U0VA 1E17A 2XRNA 1IN8A 2XVCA 4NB5A 2QUFA 1SFXA 2A07F 4CO8A 2Z5UA 4OIOF 3NQOA 5LRRA 1W5SA 1RZ4A 3M8FA 4O5VA 4I0BA 2YU3A 4EQQA 4KIGA 5LRSA 1LEBA 3JAMZ 2F2EA 1KU7A 2A68F 2F5CA 1UCRA 4EVIA 1I27A 4U0YA 3ZMVA 1O57A 1QZYA 1T98A 2W24A 2UZKA 3WE2A 2JSCA 2GQQA 3CO6C 1SD6A 1F9NA 3ABTA 2P5KA 4YFKF 1LNWA 1OYWA 1BI1A 3BJOA 2H94A 4WXCA 1O3TA 5HLGA 3DF8A 1QNTA 4PCQA 1QZZA 2ESNA 5J6XA 2HQRA 4IPAA 3ECOA 1U78A 1CF7A 2P6TA 2HYFA 4HYEA 2FF4A 3FWEA 2PMHA 3ZMSA 3P9IA 1T6SA 1DUXC 1P6RA 4HAMA 1HBXG 1OKRA 1UHMA 5F1RA 3K1NA 3Q5FA 2D1HA 4HQMA 3S2WA 4OINF 4EM1A 4MEXF 1YW7A 4RAYA 3EETA 1SAXA 2IT0A 2H09A 5DD4A 5AONA 2Z33A 1R5HA 2E7XA 3AAFA 4OOIA 3QAHA 5BS6A 1J0RA 2G9WA 1JGSA 2IPQX 4P5OA 2DBBA 3TO9A 1U8RA 4N9HA 2LNBA 1D5VA 4A0XA 4AIHA 2RDPA 2FSWA 2VOPA 5D6FA 1FP2A 4FX0A 3MWMA 5K5OA 1P2FA 1YS7A 3FF5A 2P7VB 2MA3A 4R79A 5ED4A 5H6QA 2YR2A 3E97A 2DPDA 2VC0A 3T5XA 1K78A 3O3KA 2XIGA 3GZ5A 4ENKA 1MJAA 1YW8A 3ZPLA 1ZG5A 1Z05A 2E1CA 5KK1A 2AS5F 1KU2A 4WK8F 1HKSA 2XAJA 2EB7A 2Z3YA 3TDZC 3QP6A 2YX7A 3JAMK 1KA8A 2HZTA 3ECHA 1FWZA 2E7WA 2JRTA 4ASNA 4UUVA 2G7UA 2STTA 1ZH5A 4EJUA 1IUYA 3KZYA 4MEYF 1S7AA 1USTA 1W7PA 2Z9OA 4EM0B 4HX4A 4BH9A 2HKOA 4GO1A 4LG0A 2J5PA 5E1ZB 1ZGJA 1REPC 3WTZA 1P4WA 3BOQA 1RUOA 4N0BA 3WTTC 4DQ2A 1FBQA 3GVAA 3SXYA 1PP8F 4U0WA 2J5OA 2DAOA 3T8RA 4D0PA 5FFZA 3RPUA 1TNSA 2VONA 4P96A 4ENNA 1U5TC 3BP8A 3WU1B 3PQJA 1Q1HA 2K4BA 5BQTA 2EK5A 4CYDA 4ZH4F 3IRQA 3QPHA 3C3WA 4O3MA 1TNTA 2K4JA 5ICEA 1B4AA 1YYVA 2EV0A 3DXJF 2VC1A 1IN5A 3L9FA 1R23A 3D0SA 2VBXA 3LQQA 2P8TA 1WWXA 5E1WA 2VXZA 4ON0A 5DEQA 3WGGA 4IVNA 4GYGA 1ZHFA 2QYOA 5FFXA 2O61A 2E1NA 4YFXF 1ZRCA 4WXHA 3I71A 1U6GA 2G7HA 1MDMA 3RKWA 1XSVA 2XGXA 1KQ0A 4XLPF 3CDHA 3RYPA 1ZLKA 3MFKA 5HDGA 3KP7A 1L3LA 1LJ9A 2HKXA 1I1SA 2K7LA 1BN5A 4IF4A 2EA2A 3I58A 2R3SA 1U5TB 2P4WA 2L02A 1Y0UA 2DO7A 3CUQC 4BYYA 3HHHA 4BAYA 1P92A 2IRFG 4KFCA 2QBYA 1OR7A 2TDXA 3CUOA 2B0LA 2M5WA 5LHGA 3HTSB 3VODA 2UXNA 5L3BA 1T0FA 3IKTA 2JPBA 2KJCA 2FNPA 1MGTA 4K2EA 3B02A 3BDDA 3DFGA 1EV7A 3E6DA 3M9AA 2A6HF 3JSPA 3G3ZA 2Q0OA 1USSA 4UHTA 3T0YA 1LB2A 2MLKA 4OU0A 2A5YB 1JHHA 2OD5A 1YQAA 4ENJA 1IRGA 3L00A 3F72A 3P9CA 5E17F 3LWFA 4AD9A 4MQVA 1ON1A 5E8GA 5ILUA 3V8KA 4BHCA 4MGRA 3LA3A 3WG9A 1GXQA 3CUQB 1BC7C 5HDKA 4XRFA 3R0JA 3I0TA 2K86A 1MD0A 4CHUA 5LHHA 3HHGA 3GO5A 1FSHA 1G3SA 4EGYA 2OU2A 2PJPA 2FEZA 3DPTA 1ODDA 4EV0A 4BXUA 5FD6A 1R36A 1K7AA 1R00A 2O03A 2RNJA 3RJPA 5H6RA 1I6XA 4KA4A 1FBUA 3H92A 2Q8KA 4XBFA 3SZTA 3HIFA 4KIBA 2QQAA 3GFLA 4RB0A 3IHUA 3W6KB 3IKVA 2L54A 1HKQA 3FM5A 1YTYA 1S6LA 1R1VA 3EQLF 1GXPA 3RI4A 3COAC 4ESBA 5HLIA 2VE9A 4I02A 3QOPA 4MTEA 3JW4A 1IN6A 4IJAA 3FHZA 3LAJA 3GF2A 2K27A 2HTJA 2IA1A 3D5LA 4R1HA 4LLNA 4RB2C 4EJOA 1IXSB 2MH9A 5FD5A 4YIIA 4CZZA 4KT5C 5L3GA 2ETHA 4HF1A 2FA5A 4ENMA 1O3QA 3ROUA 3C7JA 3HSRA 5D6EA 5IT3A 1P4XA 4ZYDA 2COMA 5IT9K 5CYVA 5BOXA 2ZXJA 1ZGAA 2O8XA 1RNLA 3DEUA 5TRDA 4ZZDA 2FBHA 4Y13A 2ZFWA 4JQFA 2L3DA 2EFPA 5K1YA 1G3YA 4Y15A 3ZMZA 3F22A 2XAQA 3GYHX 2V9VA 2VODA 2OQGA 5BMZA 4HLXA 3KP4A 3U2RA 2XASA 2RC4A 3HOTA 3HOSA 3REOA 2W57A 4WWCA 1U3EM 5D5UB 2ZJ2A 2AXLA 1Z6TA 5FB2A 5F6FA 1B9MA 1ONVA 4CDGA 2NRAC 4A5MA 1R5GA 3ZQ7A 1FC3A 4IXAA 2JTVA 5DYMA 1XMKA 1ZRFA 3BZ6A 2VBWA 4P9UA 1F5TA 3O2PE 3ABUA 3I5UA 4S05A 1FNNA 2X4HA 2ZMEB 1KU9A 2GWRA 1U5TA 2IA0A 3T1BA 4B8XA 1RIOH 2Q2EA 3CLOA 5CVVA 3SFZA 2GA2A 2XUBA 5KVRA 3WTUC 4WXDA 4ZYHA 4CXFA 3E6MA 1B6AA 3KZZA 5FLXZ 1FT9A 2IJLA 3DPLC 2V6CA 4KYWA 1S7OA 3IC7A 5LHIA 3I59B 2CW0F 3LA2A 3KP3A 1Z1DA 2ADUA 2FBKA 2L4MA 2FE3A 2NS0A 2P5VA 1WKMA 2DFIA 2W84A 5ICFA 3K2ZA 3HTUA 5FO5A 1F4KA 1IN4A 2CGPA 2BYVE 1A04A 3KEQA 1XCVA 4HF2A 5DCMA 4QLCU 1BC8C 4GXOA 5D4RA 3OOPA 3WTVC 3R0AA 2D2WA 1JXSA 2GZWA 4UXNA 3MAJA 2OZUA 3TQNA 3L2CA 1XN7A 2Y48A 4LJZF 1KQ9A 4EJVA 4XLNF 4HQEA 3HSEA 3VEPA 3KP2A 2CSOA 2IW5A 2XAGA 3I4PA 1IZ1A 2EV5A 4G7ZF 2BBYA 1X3UA 3RPQA 2M30A 2PN6A 1XDUA 5D4SA 1KGSA 3P7NA 2NAZA 4ESFA 3MZHA 1BI0A 4CICA 2ESHA 3E3VA 1C0WA 4F7ZA 3WODF 4L5JA 4L18B 2HFHA 1LDJA 1HXDA 4KMFA 4HX8A 3ZP5A 4HA8A 4BHBA 1ULYA 2RV8A 4ZZLA 4O6JA 4M72A 2CQKA 4WCGA 2XHKA 1YO5C 1DPRA 5FLXK 2YSRA 5L3CA 4U7DA 1SMYF 1ON2A 3IWZA 2DLLA 2FU4A 1J5YA 4M9SA 1S29A 2ISZA 3WTXC 4L9JA 3LFKA 2FQ3A 3HSFA 2VOOA 2VN2A 1J59A 1ZRDA 1T2KA 4A12A 3SZPA 4RGRA 5LGTA 4MNUA 2XROA 1BOAA 2OAZA 1RI7A 3W6JB 4AVPA 3KETA 4LB5A 1I5ZA 5TJJA 3RTRA 1UFMA 3PQKA 2DQRA 1D3YA 1XCBA 3KLNA 5BPDA 2EFWA 5K5QA 3NEUA 3V8LA 4L9TA 3TOBA 4IHTA 3R60A 2BGCA 1K79A 2V79A 1BJAA 3ZN0A 5ICGA 1SD5A 1QPMA 3KP6A 1L0OC 1XDSA 3DQVC 4A2UA 2FOKA 1YFHA 4HBLA 1KYZA 2PBIA 1RUNA 2ZNZA 3F6OA 1R22A 3I53A 5A2QK 4UV8A 5E20A 2CFXA 3F6VA 1LDKB 2A61A 1DPUA 5AIPA 3G73A 4KN7X 3I54A 2WWYA 3HRMA 5D5VB 3KP5A 2Z99A 1BIBA 1H9TA 1TQPA 3HUGA 1G4DA 1PUEE 2PI0A 4P9FA 5ICCA 3DP7A 2RN7A 3F8FA 4HOBA 3RYRA 4M6YA 4QWQA 4HF0A 4BHPA 3BPVA 2Y0MA 1W7PD 2DK5A 3QP5A 4G7OF 4NQWA 2DU9A 4KMUX 3MQ0A 1GVJA 3ML6A 3VFZA 1CF7B 4Y17A 1D8KA 4M73A 2DTRA 5IT9Z 1ZREA 2EV6A 2IVMA 4MHGA 1Z6RA 4M6XA 3GFIA 2L4AA 4PGHA 5HVQC 2PMUA 2MLGA 1MJBA 1SFEA 3EUHA 4NHJA 3TDUC 2H27A 3ZMDA 3VB2A 3ZMTA 4LB6B 3H3ZA 5E18F 5CJ9A 2A3SA 5L3EA 2QQ9A 3KFWX 3BROA 5JR3A 3FXRA 2EFNA 2L01A 3HRSA 5D8KB 1TW2A 2OBPA 1UB9A 1YW9A 3F21A 1YG2A 2VBYA 4EJTA 5EEHA 2GXGA 2KRFA 4EJWA 1TQMA 3LA7A 1ZN2A 4I0AA 1STZA 3TOAA 1K78B 5DV5A 3V7SA 2F5EA 4ETSA 1LQ1A 1FLIA 1B59A 3K1MA 1SD7A 4LFUA 2HEOA 2XAFA 5DCFA 4L0YB 2MD5A 2JT1A 4HX7A 2ZO4A 5DD8A 3GFMA 3U1DA 2F5DA 1B1BA 3K1PA 2O3FA 4UVCA 2HYGD 4MQ9F 4G6DA 1W7PB 1FY7A 1YS6A 4G8XA 4OIRF 2RQPA 3KLOA 4OIPF 2VT2A 2Y75A 3R4KA 2GAUA 3Q9VA 3V8JA 1G6NA 1WSUA 4A0YA 1HSJA 3WGIA 4LG0B 2VBZA 2ISYA 1LDDA 4PZJA 1IN7A 4UVAA 2IP2A 3BJ6A 5L3FA 1WRJA 2RGVA 1SD4A 3E5QA 2D1VA 4EM2A 2STWA 5DUKA 1EH7A 4RB3C 2EWNA 1FZPB 4EMSA 1KYWA 1S8NA 2QQBA 2DQLA 2HWVA 2QZ8A 2X0LA 2C6YA 1MZBA 5D5XB 2HOEA 2R7FA 2P6SA 5LEKA 3TKYA 1CGPA 1E2XA 4BNCA 3GLXA 4RB1A 2GA1A 4S04A 2W85A 4L5IA 3DV8A 2YX4A 5CVIA 3V7CA 4XSXF 1OPCA 3FMRA 1QO0D 3TO6A 4LK1F 1S3JA 2PQ8A 4IRIA 4DNCA 1MDMB 3GX4X 5HS9A 2XKOA 3DKWA 3M7GA 1QGPA 2FNAA 1IRFA 3V4GA 1TBXA 3QRFF 5E1XA 3WU0A 1R58A 4P55A 3QU6A 3EYIA 1F1ZA 2BEOA 2NNYA 1AWCA 2XAHA 4IHSA 5DDGA 4WX9A 1MKMA 4L9VA 1R7JA 4Q5SF 3J7AO 3WE3A 3TGNA 2QBYB 1PDNC 1IW7F 2FMYA 4ZYEA 4OMZA 3GWZA 1VTNC 4RGXA 4FT8A 3KCCA 5HS7A 3J81Z 2ELHA 2EA4A 3LQRA 2HTSA 5L3DA 2V1UA 4M9XA 1PP7U 1XGSA 2DW4A 4L9NA 4G94A 3BJAA 2HS5A 3RKXA 1O3RA 3O6BB 2HGCA 5BPIA 4LD5A 2KIFA 2DI3A 1ZG3A 5FGMA 2ACJA 3ULQB 5HS8A 1D8JA 4M74A 1G3TA 1K6OA 1TQIA 2PG4A 3CUQA 2LF7A 1O7LA 1XSDA 2RVCA 2YPRA 5CVRA 3IWFA 3SHFA 1OYYA 2WTEA 2ZNYA 4HV6A 3KEOA 4M9ZA 1NHAA 3JSOA 5CVUA 3E5XA 5CLSA 2IA2A 3F8BA 3U9GA 4A0ZA 2D45A 4WF2A 2BV6A 5A2QZ 3WTWC 2P5LC 2A69F 1Z9CA 3LAPA 1T39A 2NYXA 4L0ZB 2QENA 1HSTA 1ZAOA 1XSXA 4LLGF 1V4RA 3HRUA 4IRHA 3GEZA 5HLHA 2QLZA 1WQ2A 3RKYA 1FSEA 3K9TA 1FYLA 4UV9A 4UVBA 1U2WA 3C1DA 2CWEA 1FBSA 5JHUA 3WTSC 3M1EA 2MC3A 2A6EF 2QVOA 5DUIA 2FRHA 3Q9SA 4E70A 1T38A 4BQAA 4YIFA 4KN4X 4HZFA 5LGUA 3J81K 5CVJA 3L09A 1J2XA 1ZLJA 4RGUA 1FX7A 2KIMA 5J8CA 4XSZF 3H3UA 3MCZA 5JVTA 1J75A 1BI3A 2H6BA 5F64A 2LDUA 4MTDA 1W5TA 4GCVA 3FMSA 2UWMA 2RKHA 4FX4A 2M1BA 2FXAA 1QQIA 3J80Z 1IXCA 1SFUA 2V1XA 1XGOA 2VE8A 2JZYA 4LK0F 2CO5A 5HDNA 4Q4ZF 4KDPA 4R8HA 3QU3A 1P4AA 2DPUA 4CGZA 3L7WA 2MH2A 2OZ6A 3N4MA 5LLQA 4H0EA 6PAXA 3LSTA 2R7DA 1TTYA 1XMAA 3FXQA 5ILSA 4LLLA 3NRVA 2CG4A 4I09A 4M71A 3KE2A 5ILVA 4A6DA 3T8TA 3V7RA 4AIJA 3IRRA 4PDKA 5JI6A 1Z7UA 4G6QA 3FXUA 2QWWA 3BY6A 3EDPA 1EH8A 3IL2A 4HV5A 3CJNA 4KUMA 4Q47A 2ZCWA 3E5UA 1AOYA 1OMIA 1HW2A 4I01A 3BPXA 1XGMA 4AWXB 1OYIA 5AIQA 2ZMEA 4RGSA 2LF8A 3GW2A 2BE5F 1I1GA 2EFQA 3N97A 4LGWA 2OA4A 1TLHB 2PLYA 3RIRA 3VOEA 2O0YA 2W25A 1R1UA 2HR3A 5ERIA 3ZN1A 1XB4A 5LEJA 3E6CC 3I59A 3K0LA 4KNYA 1SMTA 1HKTA 4HW0A 4JK1X 2GXBA 1G3WA 3ERED 3K69A 4FHTA 3M8EA 1UHWA 2XV4S 3CO7C 3WGHA 3MZYA 2V1DA 4TV7A 4Q48A 1FP1D 4KICA 4AIKA 2M45A 2H6CA 3F8NA 4JBAA 4I2OA 1J7KA 3ISPA 1IXRC 5DCMB 3C18A 1JE8A 1GHCA 3HRTA 4B09A 1FOKA 1FYKA 1FPQA 2LKPA 3J80K 4EGZA 1LVAA 2LSOA 1J9IA 2PFBA 1TW3A 5LBQA 3E6BA 2UXXA 4PGGA 1H0MA 1DDNA 2MBFA 3F23A 3MEXA 4GYIA 3JTHA 3WTYC 4A6EA 1MJ9A 1Z91A 2EJRA 4G7HF 3P9KA 1ZYRF 4HDUA 1DP7P 4HLYA 1BM9A 2WC2A 3F3XA 2PEXA 1HW1A 3B73A 3FX3A 4N9IA 1XD7A 5JFRA 2EFOA 1HW5A 4LMYA 3I64A 1B9NA 2OQRA 3OV8A 5J8FA 3ZMUA 3R6SA 3F8MA 2HQNA 4G9YA 1KQ8A 1KU3A 3GXOA 1H9GA 4RS8A 2GIVA 2FMLA 5HOOA 3PFIA 4I98B 2CYYA 3ELKA 5K5RA 1QBJA 2KJBA 3GFJA 4U88A 3SQNA 1BIAA 3TO7A 3RDIA 2DT5A 1ZG1A 5E8IA 1W4MA 3CTAA 2O6GE 2NNNA 5H20A 4OMYA 1O7FA 3GUDA 3R61A 1YIOA 1BI2A 4ZYGA 4ESJA 1EH6A 3FMQA 4RAZA 4U7BA 1YLFA 2M8EA 4IRGA 4A5NA 2XKPA 5D5WB 3BWGA 2QM3A 1ZARA 1IF1A 5D8LB 3QPTA 2JPCA 3FZVA 2K02A 4HDVA 1JHFA 3GZ6A 2WV0A 2ZBKA 3EYYA 4UNOA 5LGNA 1HQCA 1LEAA 3JTGA 1FYMA 5EEGA
chains in the Genus database with same CATH superfamily
3H9GA 2P7CB 4I7HA 2DK8A 3P5JA 3BCBA 1R71A 4Y52J 1IAWA 2KKOA 2DA6A 3HOXJ 4GGGA 1NK2P 5EG0A 4FISA 3J7ZI 2KIUA 1R1TA 2F5FA 4BY7J 1XGNA 5EEAA 1O3SA 4IEJA 3AG4H 1VI0A 2KZVA 4KIFA 5HLTA 4A3JJ 4XKCA 3TW6A 1WI9A 1X3WB 2HDCA 2VT3A 2NS7A 3F8CA 3FM3A 4Z2YA 4DW6A 2LP0A 3TBIA 2FBIA 2R7SA 1V3FA 4PJJA 3HYIA 4YG2F 2DODA 2F4OB 4OIQF 3ZQLA 1VQ7I 3UKGA 2ZKZA 2E1OA 4YFNF 1BBYA 2M87A 1IJWC 1EF4A 4U0VA 4IOAF 1E17A 3MKWB 1LFBA 5IPAA 2XRNA 1IN8A 2XVCA 4NB5A 1FMVA 4AIDA 5JVGF 2QUFA 4XKWA 3H3VK 3CJQB 1OCTC 1SFXA 2A07F 3BG7A 1OQYA 1ORKA 2LVSA 2R7OA 4CO8A 2Z5UA 4XLFA 4PSXA 4OIOF 2HU9A 4Y33A 3NQOA 5LRRA 4G6TB 1W5SA 2W7NA 2EQRA 1RZ4A 3M8FA 1BL0A 4NUBA 4O5VA 3DEEA 3K4LA 2CW8A 4I0BA 3DEWA 2HYJA 1W0UA 2YU3A 5J4VA 4EQQA 1TWGJ 4KIGA 4W97A 5LRSA 1LEBA 3JAMZ 2F2EA 1KU7A 2A68F 2F5CA 1UCRA 4HPQA 4M3DA 4EVIA 3ZQFA 1I27A 2NVQJ 2FX0A 4U0YA 3ZMVA 1O57A 1QZYA 1T98A 2VQHA 2W24A 4Z6YA 2UZKA 3WE2A 2JSCA 3S1MJ 3CCSI 2GQQA 1UZCA 2EH3A 3CO6C 1SD6A 1F9NA 3ABTA 4NC6A 2P5KA 4YFKF 1LNWA 1OYWA 4AUXA 1BI1A 1OCZH 3BJOA 3SYTA 3BLYA 3BG3A 2H94A 4WXCA 1LFUP 3RSNA 1O3TA 4M3FA 1R9TJ 3BG5A 4PFPA 5HLGA 5KCMA 1JT0A 2LREA 2OCCH 3CD6I 2UUZA 3DF8A 3S17J 1QNTA 4PCQA 3JRGA 2HVRA 1QZZA 5E3MA 2L9VA 2ESNA 3IAS2 5J6XA 1Y0NA 5EJCA 2HQRA 4E7SA 2D5VA 3FBIB 4IPAA 3ECOA 1U78A 1CF7A 1ETXA 2P6TA 2NVYJ 3AFHA 4ZYAA 2HYFA 4HYEA 2FF4A 3FWEA 2PMHA 4XICA 3ZMSA 3P9IA 3CC7I 1T6SA 5FROA 4HNVA 1DUXC 1MMSA 2H8WA 1P6RA 4NQWB 2JJ7A 4HAMA 5J1UA 1HBXG 1OKRA 2R5ZA 1UHMA 3HGGA 2LR8A 4GRIA 3K1NA 4C30A 3FXOA 2K3PA 5F1RA 4AVZA 3Q5FA 2D1HA 4HQMA 3S2WA 4OINF 4HSRA 1JTYA 1FJLA 4EM1A 4MEXF 1YW7A 3CCMI 4RAYA 5KAFC 2DFHA 3EETA 1SAXA 2IT0A 3GTLJ 3ZOBA 2QQ8A 2H09A 2W00A 4FTHA 5DD4A 4F91B 2X6OA 5AONA 3RZDJ 2Z33A 1R5HA 3DLLF 4XIDA 2E7XA 4RDUA 3JRFA 2R4GA 3AAFA 2LRDA 4OOIA 3E7LA 3QAHA 1TWAJ 2K9NA 5DM6F 5BS6A 1J0RA 1T56A 1Y1VJ 2G9WA 1JGSA 2IPQX 2LFBA 4P5OA 4B48A 2DFEA 2DBBA 1SVLA 3TO9A 1U8RA 4N9HA 4C2TA 2LNBA 3MZ8A 1D5VA 2BHZA 2YUSA 4A0XA 3ZR8X 1MBFA 5DM7F 4AIHA 1UHSA 4AU7A 3OYJA 2FD5A 2H1KA 2RDPA 2FSWA 1WJBA 2VOPA 5D6FA 1FP2A 4FX0A 4MLOA 1AKHB 3MWMA 5K5OA 1P2FA 1YS7A 3FF5A 1T95A 2P7VB 1Y39A 2MFZA 1MSFC 2MA3A 4R79A 5ED4A 2Q1ZB 5H6QA 3VWBA 2YR2A 1U9NA 3E97A 2DPDA 3I55I 2O9LA 2VC0A 3K4KA 1FOXA 4LIVA 3T5XA 4A3IJ 2ZFUA 2JWTA 3BTJA 3H0GJ 1K78A 3CDIA 1MH3A 3O3KA 2XIGA 3S14J 3GZ5A 2MABA 3BC8A 1TT5B 4ENKA 1BR1A 1MJAA 1YW8A 5DS9A 3ZPLA 1ZG5A 1Z05A 2E1CA 3LSKA 2VJ5A 5KK1A 4II3A 2AS5F 2BY0A 2DXIA 1KU2A 5K7ZA 4WK8F 2VPLA 1I6HJ 1HKSA 5IP7J 2XAJA 2EB7A 2PJRA 3IH2A 2Z3YA 2X6XA 1HA8A 3TDZC 3QP6A 1HOMA 2QCOA 2YX7A 3K70D 3JAMK 1KA8A 2HZTA 3ECHA 1FWZA 1X1BA 2E7WA 2JRTA 4ASNA 4UUVA 2G7UA 2STTA 1ZH5A 3H0DA 4EJUA 1IUYA 3KZYA 4M3BA 2VKVA 2R92J 3O8HA 4MEYF 3HOVJ 2XF5A 1S7AA 1USTA 2DA4A 1W7PA 4XLAA 2Z9OA 3HEFA 2E5ZA 2EPFA 3CP8A 4EM0B 5GPCA 4HX4A 2N8GA 4BH9A 2HKOA 5KHDA 4GO1A 3KYDB 4LG0A 2J5PA 2EBIA 1VQ9I 1K4TA 5E1ZB 1ZGJA 4IQ4A 3CMYA 1YHQI 4AYBN 1IV6A 1REPC 4C2MJ 3OL3A 3WTZA 3G6EI 1P4WA 3E0JB 1JI8A 2NVXJ 3BOQA 1RUOA 2IGOA 4N0BA 2EIJH 3K70C 3WTTC 3LSPA 3FDYA 1WI3A 4DQ2A 1FBQA 3G1LA 4CCLA 3GVAA 3SXYA 1PP8F 4U0WA 2DOFA 3VSLA 2M8GX 2LMDA 5JHFA 1RETA 1HCRA 5J4YA 2J5OA 2DAOA 5FKKA 3T8RA 4D0PA 4I6ZA 5FFZA 1SAUA 3RPUA 1TNSA 2LBFA 2VONA 4P96A 1HDPA 4ENNA 2B63J 1U5TC 3BP8A 3WU1B 1B8IA 3PQJA 1Q1HA 2K4BA 5BQTA 2EK5A 2HNHA 1V5EA 4CYDA 4ZH4F 1BOBA 3OYAA 3IRQA 3QPHA 4V19K 3C3WA 2EIKH 4O3MA 5M5YJ 1TNTA 2K4JA 5ICEA 9ANTA 1B4AA 1YYVA 2EV0A 3DXJF 3CCQI 2VC1A 1IN5A 3L9FA 4S0HB 1R23A 2V7FA 3O8GA 2HOSA 3D0SA 2VBXA 1TWFJ 3K4BA 3LQQA 2P8TA 1WWXA 3IH4A 5E1WA 1OCPA 4ABZA 2VXZA 4ON0A 2R7VA 2LY1A 2O5RA 4IVNA 5DEQA 3WGGA 3OS2A 3TEDA 4GYGA 2WY7Q 1ZHFA 3D5RC 3HKZA 2QYOA 5FFXA 2O61A 2IBDA 1N75A 2LY2A 2ID3A 2E1NA 3A02A 4YFXF 1ZRCA 3DKXA 4WXHA 1IDYA 1FMWA 3OR1C 4YRVA 1NG7A 3I71A 1U6GA 3OR2C 2G7HA 3BG6A 2M4GA 4RA2A 5E3LA 2B7EA 4E4HA 1MBHA 1MDMA 3RKWA 1XSVA 2XGXA 1KQ0A 3RKQA 2DOEA 4XLPF 3RCOA 3CDHA 4KJZA 4JX6A 1FTZA 2YS9A 3RYPA 4B44A 2ICWG 1ZLKA 3MFKA 3MVPA 1RESA 3BQZA 3JREA 2M34A 2R7UA 5E79C 4QPOA 5E3OA 5HDGA 3KP7A 5KAIC 1ETYA 1L3LA 4A3BJ 3W6VA 1RKTA 1V5FA 1LJ9A 3VPRA 2HKXA 1I1SA 4CCOA 2VQLA 2K7LA 3DBHB 1GDTA 1BN5A 2OC6A 4IF4A 2EA2A 3I58A 2R3SA 1U5TB 2P4WA 3OIPA 2L02A 1Y0UA 2DO7A 4UB6C 5FLMJ 2XDVA 3PIOF 3CUQC 2L0KA 2Q2EB 4BYYA 3HHHA 1AU7A 4UUSB 4BAYA 5EGOA 1P92A 1HDDC 3A2KA 3OYNA 2IRFG 4KFCA 2QBYA 3H5AA 1OR7A 2X6WA 3QPLA 1WH7A 2TDXA 3OOUA 3CUOA 2GOMA 2LLKA 3OSFA 2B0LA 3CMAI 2GLOA 2IEKA 2M5WA 2KISA 4E7ZA 4EEFG 1WGXA 1WCMJ 4XORA 3C2HA 2CUJA 5LHGA 3J7YJ 5GADJ 3HTSB 3GTPJ 1RPWA 3VODA 2JA2A 2UXNA 5L3BA 1T0FA 3IKTA 1XMXA 2JPBA 1VZ0A 2KJCA 4C9YA 2FNPA 1MGTA 4K2EA 4XONA 1ZELA 3B02A 3GTMJ 3BDDA 3DFGA 1EV7A 2VXDA 1XX5A 3CESA 4HSTA 2MW8A 3E6DA 3M9AA 1YX5A 2A6HF 3JSPA 3G3ZA 1D1BA 1LE8A 1PVEA 4H4KC 4LOCA 2CS3A 2OJED 2Z1DA 4M3GA 1F43A 2LC2A 2Q0OA 4W1UA 1USSA 4IHWA 2MD0A 4YIRX 4UHTA 3JRBA 3T0YA 1LB2A 2MLKA 4OU0A 2A5YB 3JR9A 1JHHA 2OD5A 1YQAA 4ENJA 2DMTA 4JX5A 1IRGA 3L00A 3F72A 3P9CA 4DYQA 3CLQA 4F93B 4B4CA 3LWFA 4AD9A 1RRJA 5E17F 4MQVA 4DIQA 4IL6C 3EUAA 3B6AA 1ON1A 5E8GA 2XSJC 5ILUA 3V8KA 4BHCA 4MGRA 4A3MJ 5FKMA 5F0CA 2DA5A 3LA3A 2F6CA 1GXQA 3WG9A 5JLWA 3JRAA 3CUQB 2JA6J 1BC7C 1T33A 3HJEA 5HDKA 3S3MA 4XRFA 1X1CA 1AKHA 4QIWN 2V4JC 3R0JA 3I0TA 2K86A 1MD0A 3HKZN 4CHUA 1FTTA 2R7WA 1SFKA 5LHHA 3HHGA 4CYCB 2X1CA 3GO5A 1FSHA 1G3SA 2HDWA 4CH7A 4EGYA 2OU2A 2X6YA 3FK7A 2PJPA 1DP3A 4BACA 2M2EA 2FEZA 3DPTA 1ODDA 1Q1VA 2ZSIB 2E34A 4BQNA 4EV0A 4BXUA 5FD6A 1B72B 1R36A 4D9JA 1K7AA 1R00A 2O03A 2WAEA 2ZXIA 1D1CA 4JOMA 2RNJA 3RJPA 4UUTA 3KYCB 2RNGA 5H6RA 4B47A 3QOEA 1I6XA 4KA4A 3PO2J 1FBUA 3H92A 2Q8KA 1WJEA 4UY8I 2DMNA 2K9SA 4XBFA 4XQFA 4FQGA 3SZTA 2ZJRF 2XPVA 3HIFA 4KIBA 2QQAA 1MNMC 3FXKA 2JVGA 3GFLA 4RB0A 3IHUA 3W6KB 3IKVA 2L54A 3QYFA 4MO7A 1HKQA 2EILH 3FM5A 3GLLA 4ZJZA 5IYCJ 1YRNA 3SFIA 2HZDA 1DQUA 1YTYA 2K9MA 4XR6A 2QSGX 3MKZA 2IGKA 1S6LA 1R1VA 3EQLF 1GXPA 3RI4A 4JYKA 4D5FA 2L9SA 3H9JA 3COAC 3I3LA 1AA7A 5HLIA 4BEHB 4ESBA 2VE9A 2BZTA 2IS6A 3HPHA 2M0CA 3QOPA 4I02A 4MTEA 1WJCA 3JW4A 2CQXA 2Y30A 3RZOJ 1IN6A 3A0BC 4IJAA 3FHZA 1QVTA 2IGMA 3LAJA 3GF2A 3I4MJ 2B9SA 2K27A 3NWTA 3OIOA 4E7IA 2HTJA 2IA1A 4HEA2 2WBMA 1J09A 3D5LA 4R1HA 4LLNA 4RB2C 4EJOA 1IXSB 2MH9A 5FD5A 4YIIA 4CZZA 4KT5C 1WVRA 5L3GA 2O7OA 2ETHA 4HF1A 2FA5A 4ENMA 5FRMA 1O3QA 3ROUA 4DOZA 2R7ZJ 1QPIA 3C7JA 5K7HA 2K3FA 3HSRA 3DU5A 5D6EA 5IT3A 1P4XA 2Y31A 4ZYDA 1IUFA 2COMA 3CP2A 5EZGA 5IT9K 2DDBA 2ZMEC 5CYVA 5BOXA 2PX9A 2ZXJA 1ZGAA 2O8XA 4BKXA 4E6KG 1BW6A 1RNLA 3DEUA 5TRDA 5C44J 2KFDA 4ZZDA 4GFBA 2E36A 2FBHA 4Y13A 2ZFWA 3IUOA 4JQFA 2L3DA 2EFPA 5K1YA 1G3YA 4XN0A 2GXAA 4Y15A 3ZMZA 3F22A 2XAQA 2W82A 4PJ0C 3GYHX 2I8DA 2DT7B 2V9VA 2OQGA 5BMZA 1XG1A 4DBRA 2VODA 4HLXA 5CQGA 3KP4A 3U2RA 2EZLA 2XASA 2RC4A 2HXIA 3HOTA 3HOSA 3REOA 1HLVA 2W57A 2R7RA 1R49A 4WWCA 3PM1A 1U3EM 5D5UB 2E35A 2DOAA 2ZJ2A 2R7TA 1SC7A 4YELA 2A6TA 2AXLA 3K10A 1Z6TA 3CCYA 2CJJA 2X1DA 4DGWB 2DMPA 3CJRB 4XM3A 5CKTA 5FB2A 5F6FA 1B9MA 1MIJA 2Z16A 1ONVA 2MGQA 4CDGA 2NRAC 4A5MA 1R5GA 3ZQ7A 2NOGA 1FC3A 4D1QA 4IXAA 2ZB9A 4CCMA 1DU0A 2JTVA 5DYMA 1XMKA 2BOLA 1ZRFA 2DT6A 3SEZA 3EUHC 3BZ6A 1X1DA 2EIMH 2VBWA 4IHYA 5BNGA 3H36A 4P9UA 4QPQA 4XOPA 1JKOC 1F5TA 1GV2A 3O2PE 3ABUA 1H8AC 2COBA 3I5UA 4S05A 1SFOJ 1FNNA 1VNDA 2X4HA 2GM4A 2Y9YA 2Z2SB 2ZMEB 1KU9A 2GWRA 1U5TA 2IA0A 3T1BA 4B8XA 3HUGB 1RIOH 1R5ID 2Q2EA 3CLOA 2HQ5A 3ABLH 5CVVA 3SFZA 2GA2A 3BCAA 2XUBA 5KVRA 2DA3A 4F52A 2L2OA 1E3HA 1WZ2A 2EZIA 1D0XA 1R4NB 2KPMA 4OAYA 3WTUC 1FOWA 4WXDA 4ZYHA 1S5LC 5B66C 4CXFA 3PJRA 3E6MA 1B6AA 3KZZA 5TISC 5FLXZ 2ZJPF 1FT9A 2VUMJ 4RM3A 2IJLA 2BY3A 3DPLC 3A0HC 2KZGA 2R5YB 1X2MA 2V6CA 3MKLA 1K83J 2QSHX 1S7OA 2L9NA 4KYWA 3IC7A 4NBQA 5LHIA 3I59B 2CW0F 2AXTC 2HOAA 3LA2A 4J01A 3KP3A 1Z1DA 2LKXA 2ADUA 2FBKA 2IGNA 5M5XJ 2L4MA 2FE3A 3S2DJ 2NS0A 2P5VA 1WKMA 2DFIA 2CUFA 3OIQA 2W84A 5ICFA 1GV5A 1AHDP 3K2ZA 3HTUA 4XRSG 5FO5A 1ETKA 1YI2I 1F4KA 1IN4A 2CGPA 1MMDA 2BYVE 3OSGA 1A04A 2Y69H 1V55H 3KEQA 4BXXJ 1XCVA 1YOVB 4HF2A 5DCMA 3I9V2 4QLCU 3L2VA 1BC8C 3L1PA 5EYRA 4GXOA 5D4RA 3OOPA 3WTVC 3ZRGA 3R0AA 2RQQA 3CC2I 1ETWA 1JGGA 2D2WA 1JXSA 2GZWA 3Q3SA 3DPUA 5GAEJ 3FK6A 3PFYA 4UXNA 4PK4A 3MAJA 5FJ8J 3LFUA 1JKRC 2OZUA 2QA4I 2DTZA 1MBJA 1O4XA 3AG3H 3TQNA 3L2CA 1LVKA 1VQNI 3W2AA 1XN7A 2OTLI 2Y48A 4LJZF 1Z3YA 1E0EA 1KQ9A 4EJVA 4JP0A 2CUEA 2E1MC 4XLNF 3OYIA 5IYDJ 4HQEA 3HSEA 2K5CA 3VEPA 1FEXA 1ZGWA 3KP2A 2CSOA 2IW5A 2JRMA 2VJIA 2XAGA 1Z3XA 3FKIJ 3I4PA 1IZ1A 2EV5A 2LD5A 1N77A 4LITA 4G7ZF 5F1JA 2BBYA 1S72I 1X3UA 1VQ5I 3GTKJ 3RPQA 2M30A 4OAZA 2PN6A 4FE4A 1XDUA 2CH0A 3ZQCA 3PSIA 5D4SA 1KGSA 3P7NA 2NAZA 4ESFA 5IYBJ 2JUCA 4A3LJ 3K4MA 1Z7LA 1YJWI 3IAM2 3MZHA 3FXJA 4IQJA 5C4XJ 1BI0A 4CICA 2IAIA 2ESHA 3E3VA 1C0WA 2WA0A 5FKOA 2BW3A 4F7ZA 3WODF 4EATA 3RQ4A 4XL9A 3QYEA 4L5JA 4L18B 2HFHA 2VQCA 1POGA 1LDJA 3BTCA 4PJNA 1HXDA 4KMFA 4HX8A 2XF6A 5GAHJ 3ZP5A 3BR3A 4HA8A 2ID6A 3FISA 3GMEA 1ULYA 3G1OA 4BHBA 3GTOJ 2RV8A 4XLHA 2DA2A 2EZKA 4ZZLA 4O6JA 3A1YA 3QODA 3HOZJ 4M72A 2CQKA 4WCGA 2XHKA 4FASD 1YO5C 1DPRA 2ZSHB 3D5SC 3U1KA 3A01B 1IRXA 2KT0A 5FLXK 2CV2A 3K4CA 2IS4A 3LMMA 4XMYA 1P7JA 3BR5A 1ETQA 2YSRA 2R7QA 5L3CA 4U7DA 2JA8J 4ZDPA 2EINH 4B3AA 5GAGJ 1SMYF 2X1EA 3OYCA 2V1NA 4PJLA 2VJJA 1Z21A 3VYSB 1ON2A 3IWZA 2CMPA 5J3LA 2DLLA 2FU4A 2E1MB 1IDZA 5J40A 1J5YA 4M9SA 4X0GA 3HL2A 1JKPC 2LOOA 1S29A 2LTPA 2OUMA 2ISZA 3WTXC 3PNTA 4L9JA 3LFKA 3HM5A 2FQ3A 3HSFA 4RMNA 2VOOA 3AG2H 2VN2A 4IZZA 1J59A 1ZRDA 1T2KA 2IXSA 3UR3C 4A12A 2JK3A 2MC4A 3SZPA 1WH5A 2JA7J 2CU7A 3GTQJ 3ZQGA 3BQYA 4RGRA 5LGTA 4MNUA 2XROA 2XGDA 1YX3A 1BOAA 2VKDA 2I10A 2OAZA 3Q0WA 2XPWA 3F9KA 1RI7A 4BE2A 3W6JB 4AVPA 3KETA 1PUFB 2HOTA 4LB5A 1I5ZA 3HOYJ 1IV8A 4IHXA 5TJJA 3K4NA 1NK3P 2HVSA 3RTRA 1UFMA 1JUPA 1X1AA 1D0ZA 3PQKA 4YEJA 2W48A 3HDDA 2DQRA 1D3YA 1XCBA 3KLNA 3DWLE 5BPDA 2EFWA 5K5QA 3NEUA 3V8LA 4L9TA 3TOBA 5EG0B 4IHTA 3UNGC 2DYRH 1DGWY 2BXYA 3ASNH 3R60A 1XTAA 2BGCA 1U0JA 1K79A 3CMMA 2V79A 4AC0A 3BZKA 1BJAA 3GTGJ 4HNTA 3ZN0A 2VL8A 1DGRM 2M3AA 4PJMA 5ICGA 2F5VA 1SD5A 1QPMA 1WHUA 3KP6A 1L0OC 1XDSA 3DQVC 4A2UA 2FOKA 2E2JJ 1YFHA 1ZKGA 1N25A 4G12A 4A3DJ 1YIJI 4HBLA 3PNYA 1KYZA 1QA6A 2PBIA 2ZXHA 4RLQA 2ZNZA 1RUNA 3BTIA 4BJ6C 1LPQA 1M1EB 4NC8A 3S15J 3F6OA 4BE0A 1R22A 3I53A 5A2QK 2VASA 2M9HA 4UV8A 5E20A 3W2WA 1EKEA 4DZPA 4CZCA 5GTIC 2EZHA 3TP0A 2CFXA 3F6VA 2GOXB 1LDKB 2A61A 1DPUA 1SEUA 2BY1A 1BA5A 2E19A 1IRZA 5AIPA 3G73A 3CCJI 4KN7X 3TL4X 4HNUA 3I54A 2WWYA 1FOYA 3HRMA 4XK4A 5D5VB 3S1QJ 3LSRA 3L2RA 3KP5A 2Z99A 1BIBA 2E71A 3VDXA 2L7MP 1QHGA 1H9TA 2OF7A 1TQPA 3HUGA 1TL8A 3OS0A 1G4DA 1PUEE 5C3EJ 2PI0A 1UAAA 3EPZA 4XRSA 5F27A 4P9FA 5ICCA 2XAUA 3DP7A 1U9OA 2NXNB 2RN7A 2JN6A 1IC8A 3F8FA 2QKLB 4HOBA 5H2FC 3RYRA 4E7KA 4M6YA 4QWQA 5F08A 4HF0A 4BHPA 2VQGA 4MIMA 2R5YA 1QRYA 3BPVA 3LSIA 1MW7A 2Y0MA 1W7PD 2DDAA 4Y3OA 2DK5A 3QP5A 4FCYA 4G7OF 4NQWA 2DU9A 4KMUX 3HBLA 1XC5A 1GVJA 3MQ0A 3ZXSA 3ML6A 1GVDA 3VFZA 1ETOA 4B1RA 3LOCA 4Y17A 1CF7B 1D8KA 1Y6IA 2QF7A 4M73A 4BY1J 2DTRA 5IT9Z 4X6AJ 1ZREA 3OS1A 2EV6A 1G8XA 3VYTB 4CCKA 2IVMA 2QSFX 2R5ZB 4MHGA 4Y7NJ 1Z6RA 2AQFA 5GPAA 3IP4B 1WJ5A 5HNHA 4M6XA 5J1RA 3GFIA 2L4AA 4NDLA 4PGHA 5HVQC 2PMUA 2MLGA 1MJBA 2OTJI 1SFEA 3EUHA 1HF0A 4NHJA 3TDUC 1VQ6I 1ETVA 4ANJA 2H27A 3ZMDA 4LIUA 3VB2A 3ZMTA 4LB6B 3H3ZA 5E18F 2A05A 3S3OA 1JT6A 3I4NJ 5CJ9A 2A3SA 5L3EA 3RPUD 4QTRA 4RAFA 2XPUA 2QQ9A 2ME6A 3KFWX 3BG9A 4D7NA 3BROA 1K61A 5JR3A 1JKQC 3FXRA 2EFNA 2L01A 4KISA 3HRSA 3QPSA 1ENHA 2VI6A 4BE1A 3ZQHA 2L7ZA 5C4JJ 2WB1A 4F3QA 5D8KB 4ZTFA 1TW2A 2OBPA 2X9DA 1UB9A 3ABKH 2M7AA 1YW9A 4XN3A 3BR2A 3F21A 1D1AA 3VSKA 1YG2A 3K6GA 2VBYA 4EJTA 4DYRA 5EEHA 2GXGA 2LY9A 2KRFA 3D1NI 3DU6A 4EJWA 2E5NA 1TQMA 3LA7A 5IOYA 3MMYB 1ZN2A 3NAUA 4I0AA 1PYVA 1STZA 2F4IA 4RAGA 4RM2A 3CF2A 3TOAA 3OYKA 5DV5A 1K78B 2DCEA 3V7SA 1SANA 2F5EA 4ETSA 1VQMI 4J00A 4CA0A 1LQ1A 1X19A 1FLIA 1Y56A 1B59A 3K1MA 1SD7A 2QEXI 3SJMA 4LFUA 2HEOA 2XAFA 1A5JA 4X1EA 4MFEA 5DCFA 2TRTA 4U87A 4L0YB 2MD5A 2MYSA 2JT1A 4HX7A 2ZO4A 5DD8A 1OJLA 3W2VA 3HOUJ 3HOWJ 4PUSA 2L7FP 3KEYA 3GFMA 2ZXWH 1IG7A 3U1DA 1EJ9A 1YJ9I 3W3CA 2F5DA 1B1BA 4BJ5C 3K1PA 2IS1A 2O3FA 3QQAA 2VLAA 4UVCA 3MD2A 2HYGD 2XGCA 4MQ9F 2KDOA 4G6DA 5DTDA 2AHQA 3M07A 1WJAA 2ZC2A 3FHNA 2R93J 3U21A 1GT0C 1W7PB 1FY7A 4V2FA 2KDZA 1YS6A 4G8XA 3TW7A 4OIRF 2RQPA 5B1AH 3KLOA 1RR8C 4OIPF 3K7AJ 2DA1A 4M6VA 2VT2A 2RREA 2Y75A 1FIAA 2GAUA 3Q9VA 3R4KA 5TGTA 3V8JA 1G6NA 2R7XA 1MMGA 1WSUA 4A0YA 1XPXA 2CQQA 1YE9A 2BVLA 2VB6A 2KQRA 1HSJA 3WGIA 4LG0B 2WV1A 2VBZA 5EDNA 1S9HA 2ISYA 1LDDA 3AKZA 3S1NJ 2DN0A 4CUGA 1R6RA 4PZJA 1A36A 1IN7A 4UVAA 2F48A 1F36A 2IP2A 5M3FJ 4CCNA 2L7KA 3LSHA 1W5CC 3BJ6A 2F4MB 1WPKA 5IOZA 2CQNA 5L3FA 1WRJA 3VYUB 1QU3A 2RGVA 4BQOA 3DTKA 1TWCJ 1SD4A 3E5QA 2D1VA 4EM2A 3S1RJ 2STWA 5DUKA 1EH7A 4RB3C 2EWNA 2LBFB 1Y8RB 1KZHA 4EMSA 1FZPB 4BUPA 1B8IB 1MBEA 1KYWA 1S8NA 2R0QC 2QQBA 3J7AY 4ZC3A 2DQLA 2HWVA 2QZ8A 2X0LA 3WG7H 2C6YA 3PSFA 1I3QJ 4BBSJ 1MZBA 5D5XB 2HOEA 2R7FA 1JTXA 1P9QC 3BR0A 2YU9J 2P6SA 1OR7C 4J19A 2CRGA 5LEKA 3CCVI 3TKYA 3RQIA 1ZR4A 1TP4A 1VQOI 1CGPA 1E2XA 4BNCA 3GLXA 4RB1A 2JA5J 3SZGA 1E3PA 3GCMA 2GA1A 4S04A 3OL4A 1QZEA 2KP6A 2W85A 4DYCA 4L5IA 2M4KA 3DV8A 2YX4A 3ZGKA 5CVIA 2WB1N 3PIPF 2HDDA 3V7CA 4XSXF 3S93A 1ERDA 3DTEA 2FQ4A 1T0FC 5HODA 1OPCA 3HGYA 3FMRA 1D5YA 2IS2A 4C3HJ 1X4OA 1QO0D 3TO6A 2H8RA 4LK1F 1S3JA 2PQ8A 4IRIA 4JX4A 4DNCA 1MDMB 1MNEA 1X3ZB 2XB0X 4KT6A 2DA7A 4C3IJ 3GX4X 3LNQA 2JVHA 5HS9A 5FRNA 2XKOA 3H9QA 1QHHD 3DKWA 3M7GA 3KYLA 1OCOH 1QGPA 2FNAA 1IRFA 1TZLA 3ESWB 3V4GA 1TBXA 2VKHA 2M7BA 3QRFF 5E1XA 3WU0A 1R58A 5M3MJ 2ELJA 3BT9A 4N4NB 4P55A 3QU6A 3EYIA 1F1ZA 2BEOA 1MH4A 2GIZA 4UUSA 1ACIA 3EUKL 2NNYA 1AWCA 3OYBA 2XAHA 4IHSA 5DDGA 1K4SA 5FLVA 2XF7A 4WX9A 1NH3A 4BBRJ 4BDZA 1G2HA 4C3JJ 1MKMA 4L9VA 4BDYA 1R7JA 2AO9A 5EGOB 4Q5SF 3J7AO 3WE3A 4B43A 4BJTA 2ELKA 3DBLB 3TGNA 2QBYB 1PDNC 1IW7F 1MBGA 2FMYA 4IKFA 4ZYEA 4OMZA 2NVUB 5J1YA 3GWZA 2L5QA 4RGXA 4D5CA 1VTNC 4FT8A 1IGNA 3KCCA 3K4JA 4XLCA 4QSHA 5HS7A 3J81Z 2ELHA 2EA4A 3VYRB 4XOTA 3LQRA 2HTSA 3OMYA 2L9RA 4AYBA 4E7LA 5L3DA 2VPRA 3PO3J 2V1UA 4M9XA 4AM3A 1VF9A 1PP7U 4A3CJ 2NS8A 2OCEA 1XGSA 2DW4A 4L9NA 4M3EA 3ZCOA 4G94A 3BJAA 3TMOA 1H88C 2HS5A 3RKXA 1O3RA 3O6BB 2K9LA 1LE8B 2HGCA 2XB5A 5BPIA 4LD5A 1UG0A 2H1LA 5B5EC 2KIFA 2DI3A 3FIWA 2K40A 1ZG3A 5FGMA 2NVTJ 1UG2A 2ACJA 3ULQB 2CW7A 5HS8A 1D8JA 1TWHJ 1G3TA 2RAEA 4M74A 1TQIA 2PG4A 1K6OA 3C2BA 2Y0SA 3TP3A 3ABMH 3CUQA 4D7MA 4A3KJ 2LF7A 1O7LA 1XSDA 1P7IA 2RVCA 2YPRA 5CVRA 2KLOA 2DFFA 3BR6A 3IWFA 2ECBA 3L2UA 1Z0XA 3SHFA 2PMZA 1W36D 3CCRI 2XSDC 1T08B 2UV1A 1OYYA 2WTEA 2JUGA 2ZNYA 1Y1WJ 4HV6A 4CYCA 3KEOA 4II2A 4M9ZA 4Y4RA 4CCJA 1NHAA 2P81A 3G1MA 3LSGA 3OYEA 3X2QH 3JSOA 5LD2C 5CVUA 4PSWA 3CDLA 2BXZA 3E5XA 5CLSA 3OYHA 2IA2A 3F8BA 3U9GA 4A0ZA 2D45A 1ITYA 4WF2A 2DJNA 2BVMA 3PNVA 1APLC 1Z67A 2CQ7A 3HC7A 2BV6A 4NNJA 2ME0A 5A2QZ 3WTWC 2P5LC 1B72A 1Y8QB 5J47A 2VKEA 1RR7A 2A69F 5IP6A 4B3XA 1JJ6C 1Z9CA 3LAPA 5K7FA 1T39A 2NYXA 4L0ZB 2DMUA 1X1PA 2QENA 1HSTA 5F0FA 3KX2A 2XC7A 1ZAOA 3PL8A 1XSXA 1ZTRA 2MG4A 4LLGF 2DMQA 1V4RA 3HRUA 1I39A 1X2NA 2WAFA 4BXFA 5M5WJ 1W36C 1A6IA 4IRHA 1JJ8C 5IP9J 5LFAA 3GEZA 5HLHA 2QLZA 1WFXA 2Y2ZA 1SVMA 1LKXA 4A3GJ 1WQ2A 3RKYA 2X85A 1FSEA 3K9TA 1FYLA 4UV9A 4UVBA 1U2WA 3C1DA 2V9PA 2CWEA 4IX7A 1FBSA 5JHUA 3WTSC 4BEHA 3M1EA 4C2UA 3QYBA 3V42A 1E3OC 1X4PA 4CSWA 2MC3A 2HPMA 1YRNB 2A6EF 3I56I 2OV7A 2JSPA 2QVOA 5DUIA 4I99C 2FRHA 3OYLA 4FE7A 3Q9SA 4E70A 1T38A 4BQAA 3F0CA 4YIFA 4KN4X 4IOCF 4HZFA 5LGUA 2VJ4A 3DBRB 3J81K 5CVJA 3L09A 1J2XA 1ZLJA 4RGUA 1FX7A 2KIMA 5J8CA 4XSZF 2GBYA 3H3UA 3CCEI 4E7HA 3MCZA 2LH9A 3GTJJ 4BL0B 3GZNB 5JVTA 4I76A 1J75A 3JRCA 2BHYA 4A3FJ 1BI3A 2H6BA 2V6EA 4XRMA 1A6QA 5F64A 1Z77A 2LDUA 4LG3A 3OYMA 2TCTA 4MTDA 1W5TA 3C2GA 3K2AA 1EA3A 4GCVA 3FMSA 2E60A 1MSEC 2KL4A 5E3NA 1H89C 2UWMA 2JQ7A 2FJ1A 2RKHA 2X51A 2E2IJ 4FX4A 2M1BA 5FKNA 2FXAA 1QQIA 3J80Z 1IXCA 5FKLA 1UMQA 1SFUA 2V1XA 1R4MB 1XGOA 2VE8A 2JZYA 3ERMA 4LK0F 1GUUA 1ZR2A 2CO5A 5HDNA 4BQQA 3S8PA 2CUZA 4Q4ZF 4KDPA 4R8HA 4F92B 4RLFA 1OISA 3QU3A 4KITB 1P4AA 2DPUA 4CGZA 3AL0C 3L7WA 2HVQA 2MH2A 2OZ6A 2WY8Q 3N4MA 2Y0SN 5LLQA 5GP9A 3SDGA 1VQ8I 3ZQQA 5B3SH 4H0EA 6PAXA 2PMZN 3LSTA 2R7DA 4XLEA 3H5NA 1GLNA 3CCLI 1TTYA 1XMAA 3FXQA 3DTIA 1NG6A 1KONA 5ILSA 4LLLA 3NRVA 3M8JA 1QVUA 2CG4A 4I09A 1RC9A 5EF6A 1YJNI 4M71A 2ECCA 3KE2A 3PUBA 5ILVA 4A6DA 3T8TA 1BW5A 3V7RA 4AIJA 3IRRA 4PDKA 5JI6A 1Z7UA 4G6QA 3FXUA 2QWWA 3BY6A 3IV5A 3EDPA 4XKBA 1EH8A 2K85A 3IL2A 4HV5A 1MMNA 1WJFA 3CJNA 4KUMA 3FKJA 4Q47A 3L2WA 1I3AA 2ZCWA 1G59A 2KRCA 3E5UA 4E7JA 1AOYA 1OMIA 1HW2A 2LKSA 4DZJA 4I01A 3BPXA 1XGMA 4AWXB 1I50J 3NARA 1OYIA 5AIQA 3CCUI 4PFOA 2P0WA 2HQAA 2ZMEA 4RGSA 2CV0A 3OYGA 3N05A 4ITVA 1VQLI 2LF8A 3BR1A 3KZIC 4L5EA 4DBQA 4P1WA 2A5WA 1OCRH 3GW2A 1W0TA 2BE5F 1I1GA 2EFQA 4ZDOA 3N97A 4LGWA 2OA4A 1OLTA 1TLHB 3S32A 2PLYA 3RIRA 3VOEA 2O0YA 2W25A 3G2BA 1R1UA 1MBKA 2HR3A 3IH3A 1VQPI 5ERIA 4V2GA 2Y9ZA 3DKYA 1VQKI 1D0YA 5HNFA 2I5UA 3GBGA 5F04A 3ZN1A 1VFCA 1XB4A 3ASOH 2FUG2 3AL0B 5LEJA 3E6CC 3I59A 4BS9A 2HI3A 3K0LA 1MMAA 1T8IA 4KNYA 1SMTA 1FIPA 1N78A 4OWRB 1HKTA 4HW0A 2DJIA 1RKWA 1VQ4I 4JK1X 2GXBA 1G3WA 3LSMA 3ERED 3FXMA 3KIOA 3K69A 1ZK8A 2W4SA 4FHTA 4A93J 1JUMA 3HPGA 3M8EA 1UHWA 3JRDA 4GDFA 2XV4S 2LG4A 1HC8A 1UELB 3CO7C 1U8BA 3WGHA 3A4CA 4HG2A 3MZYA 2V1DA 3MN2A 4XNFA 4TV7A 3DCFA 4Q48A 1FP1D 4KICA 4ZDLA 4AIKA 2M45A 3HZJA 3Q0VA 4BU2A 2H6CA 3F8NA 4JBAA 4I2OA 3ONQA 1J7KA 3ISPA 1IXRC 3Q0UA 3E1SA 5DCMB 3CZ6A 1WJDA 3C18A 1K6YA 1JE8A 1GHCA 3CQZJ 2CFOA 3HRTA 4B09A 3A03A 1FOKA 2WAQA 3LL7A 1FPQA 1FYKA 3B6CA 3HB9A 2LKPA 3J80K 4EGZA 1LVAA 2LSOA 1J9IA 2E2HJ 2PFBA 1TW3A 1IO2A 5LBQA 2FOWA 3HG9A 3E6BA 1S7EA 2UXXA 4PGGA 1H0MA 2WADA 1DDNA 1V54H 2MBFA 3F23A 3MEXA 4GYIA 3JTHA 3FXLA 3WTYC 4A3EJ 3OWTA 3BTLA 1UJ8A 3M1CA 2BY2A 4A6EA 3S2HJ 1MJ9A 1Z91A 3PUFA 4N4OB 2EJRA 2K9QA 4G7HF 3JCUC 3P9KA 1ZYRF 4F55A 4HDUA 2CV1A 1NTCA 3WU2C 1DP7P 4HLYA 1BM9A 2HPIA 2WC2A 3S16J 3CJTB 3F3XA 4MFDA 2PEXA 2V26A 1HW1A 4XKVA 3SEQA 3B73A 2X48A 5KNLA 1BR2A 3FX3A 1TT0A 4N9IA 3OYFA 2W1OA 1X58A 1XD7A 5JFRA 2EFOA 1HW5A 4LMYA 3MKYB 1CQTA 2AQEA 5CQEA 2QKMB 3JRHA 1TC3C 2V9KA 1A31A 2XRLA 3I64A 2JMWA 1B9NA 1ZQ3P 3BZCA 2OQRA 3OV8A 5J8FA 4DJAA 3ZMUA 3SDBA 3H35A 5B1BH 1XS9A 4A69C 3R6SA 4IO9F 2QGUA 3OYDA 3F8MA 2HQNA 4G9YA 3KPHA 1KQ8A 1KU3A 2PJRB 3GXOA 1MNDA 1H9GA 2BW3B 2O8KA 3G4SI 5EZHA 4RS8A 1BJZA 1PJRA 1V5GA 3H5RA 2GIVA 3QWLA 2FMLA 5HOOA 2LYCA 3CC4I 3PFIA 4I98B 3CMEI 2CYYA 3ELKA 2M0MA 5K5RA 5CPRB 1QBJA 2KJBA 3GFJA 4U88A 3A01A 2VIXA 3M3YJ 4ZTJA 3FBNB 3SQNA 1BIAA 3TO7A 3RDIA 2DT5A 1OFCX 1A35A 4NC7A 1ZG1A 5E8IA 1LFPA 1W4MA 1BR4A 2MSYA 3CTAA 5JLXA 3WHBA 3WHCA 2O6GE 2NNNA 5H20A 4OMYA 1O7FA 3AG1H 2OPTA 3GUDA 3R61A 1YIOA 2KMUA 3G71I 2DYSH 3ZQIA 1BI2A 4ZYGA 3JRIA 4ESJA 1EH6A 3FMQA 4RAZA 2KIQA 4UB8C 4U7BA 3HXLA 1YLFA 2M8EA 4IRGA 4A5NA 3CF5F 2LK2A 2XKPA 5D5WB 1SVOA 3BWGA 2QM3A 2G0EA 1ZARA 1W1WE 1IF1A 3M4OJ 5D8LB 3QPTA 1JUSA 2JPCA 3DLAA 2HXOA 4BGDA 2NOJB 3LSJA 3FZVA 2K02A 3OY9A 4HDVA 1JHFA 3GZ6A 4HRIA 2WV0A 5F0HA 2ZBKA 4FETA 4IHVA 2KRHA 3EYYA 1PUFA 3S3NA 1YITI 5IY5H 4RBOA 3L2QA 2WAQN 4UNOA 5LGNA 1DU6A 1HQCA 1LEAA 3NWSA 3JTGA 2ZJQF 2KHMA 3H1CA 1FYMA 5EEGA 5GTHC 2XGEA 1OCCH 1LUJB
chains in the Genus database with same CATH topology
2P7CB 4I7HA 2DK8A 1IAWA 2KKOA 4GGGA 2KIUA 1R1TA 2F5FA 1XGNA 1O3SA 4KIFA 1WI9A 2HDCA 2VT3A 3F8CA 3FM3A 4Z2YA 2FBIA 1V3FA 3HYIA 4YG2F 4OIQF 2ZKZA 4YFNF 1BBYA 2M87A 4U0VA 1E17A 2XRNA 1IN8A 2XVCA 4NB5A 2QUFA 1SFXA 2A07F 4CO8A 2Z5UA 4OIOF 3NQOA 5LRRA 1W5SA 1RZ4A 3M8FA 4O5VA 4I0BA 2YU3A 4EQQA 4KIGA 5LRSA 1LEBA 3JAMZ 2F2EA 1KU7A 2A68F 2F5CA 1UCRA 4EVIA 1I27A 4U0YA 3ZMVA 1O57A 1QZYA 1T98A 2W24A 2UZKA 3WE2A 2JSCA 2GQQA 3CO6C 1SD6A 1F9NA 3ABTA 2P5KA 4YFKF 1LNWA 1OYWA 1BI1A 3BJOA 2H94A 4WXCA 1O3TA 5HLGA 3DF8A 1QNTA 4PCQA 1QZZA 2ESNA 5J6XA 2HQRA 4IPAA 3ECOA 1U78A 1CF7A 2P6TA 2HYFA 4HYEA 2FF4A 3FWEA 2PMHA 3ZMSA 3P9IA 1T6SA 1DUXC 1P6RA 4HAMA 1HBXG 1OKRA 1UHMA 5F1RA 3K1NA 3Q5FA 2D1HA 4HQMA 3S2WA 4OINF 4EM1A 4MEXF 1YW7A 4RAYA 3EETA 1SAXA 2IT0A 2H09A 5DD4A 5AONA 2Z33A 1R5HA 2E7XA 3AAFA 4OOIA 3QAHA 5BS6A 1J0RA 2G9WA 1JGSA 2IPQX 4P5OA 2DBBA 3TO9A 1U8RA 4N9HA 2LNBA 1D5VA 4A0XA 4AIHA 2RDPA 2FSWA 2VOPA 5D6FA 1FP2A 4FX0A 3MWMA 5K5OA 1P2FA 1YS7A 3FF5A 2P7VB 2MA3A 4R79A 5ED4A 5H6QA 2YR2A 3E97A 2DPDA 2VC0A 3T5XA 1K78A 3O3KA 2XIGA 3GZ5A 4ENKA 1MJAA 1YW8A 3ZPLA 1ZG5A 1Z05A 2E1CA 5KK1A 2AS5F 1KU2A 4WK8F 1HKSA 2XAJA 2EB7A 2Z3YA 3TDZC 3QP6A 2YX7A 3JAMK 1KA8A 2HZTA 3ECHA 1FWZA 2E7WA 2JRTA 4ASNA 4UUVA 2G7UA 2STTA 1ZH5A 4EJUA 1IUYA 3KZYA 4MEYF 1S7AA 1USTA 1W7PA 2Z9OA 4EM0B 4HX4A 4BH9A 2HKOA 4GO1A 4LG0A 2J5PA 5E1ZB 1ZGJA 1REPC 3WTZA 1P4WA 3BOQA 1RUOA 4N0BA 3WTTC 4DQ2A 1FBQA 3GVAA 3SXYA 1PP8F 4U0WA 2J5OA 2DAOA 3T8RA 4D0PA 5FFZA 3RPUA 1TNSA 2VONA 4P96A 4ENNA 1U5TC 3BP8A 3WU1B 3PQJA 1Q1HA 2K4BA 5BQTA 2EK5A 4CYDA 4ZH4F 3IRQA 3QPHA 3C3WA 4O3MA 1TNTA 2K4JA 5ICEA 1B4AA 1YYVA 2EV0A 3DXJF 2VC1A 1IN5A 3L9FA 1R23A 3D0SA 2VBXA 3LQQA 2P8TA 1WWXA 5E1WA 2VXZA 4ON0A 5DEQA 3WGGA 4IVNA 4GYGA 1ZHFA 2QYOA 5FFXA 2O61A 2E1NA 4YFXF 1ZRCA 4WXHA 3I71A 1U6GA 2G7HA 1MDMA 3RKWA 1XSVA 2XGXA 1KQ0A 4XLPF 3CDHA 3RYPA 1ZLKA 3MFKA 5HDGA 3KP7A 1L3LA 1LJ9A 2HKXA 1I1SA 2K7LA 1BN5A 4IF4A 2EA2A 3I58A 2R3SA 1U5TB 2P4WA 2L02A 1Y0UA 2DO7A 3CUQC 4BYYA 3HHHA 4BAYA 1P92A 2IRFG 4KFCA 2QBYA 1OR7A 2TDXA 3CUOA 2B0LA 2M5WA 5LHGA 3HTSB 3VODA 2UXNA 5L3BA 1T0FA 3IKTA 2JPBA 2KJCA 2FNPA 1MGTA 4K2EA 3B02A 3BDDA 3DFGA 1EV7A 3E6DA 3M9AA 2A6HF 3JSPA 3G3ZA 2Q0OA 1USSA 4UHTA 3T0YA 1LB2A 2MLKA 4OU0A 2A5YB 1JHHA 2OD5A 1YQAA 4ENJA 1IRGA 3L00A 3F72A 3P9CA 5E17F 3LWFA 4AD9A 4MQVA 1ON1A 5E8GA 5ILUA 3V8KA 4BHCA 4MGRA 3LA3A 3WG9A 1GXQA 3CUQB 1BC7C 5HDKA 4XRFA 3R0JA 3I0TA 2K86A 1MD0A 4CHUA 5LHHA 3HHGA 3GO5A 1FSHA 1G3SA 4EGYA 2OU2A 2PJPA 2FEZA 3DPTA 1ODDA 4EV0A 4BXUA 5FD6A 1R36A 1K7AA 1R00A 2O03A 2RNJA 3RJPA 5H6RA 1I6XA 4KA4A 1FBUA 3H92A 2Q8KA 4XBFA 3SZTA 3HIFA 4KIBA 2QQAA 3GFLA 4RB0A 3IHUA 3W6KB 3IKVA 2L54A 1HKQA 3FM5A 1YTYA 1S6LA 1R1VA 3EQLF 1GXPA 3RI4A 3COAC 4ESBA 5HLIA 2VE9A 4I02A 3QOPA 4MTEA 3JW4A 1IN6A 4IJAA 3FHZA 3LAJA 3GF2A 2K27A 2HTJA 2IA1A 3D5LA 4R1HA 4LLNA 4RB2C 4EJOA 1IXSB 2MH9A 5FD5A 4YIIA 4CZZA 4KT5C 5L3GA 2ETHA 4HF1A 2FA5A 4ENMA 1O3QA 3ROUA 3C7JA 3HSRA 5D6EA 5IT3A 1P4XA 4ZYDA 2COMA 5IT9K 5CYVA 5BOXA 2ZXJA 1ZGAA 2O8XA 1RNLA 3DEUA 5TRDA 4ZZDA 2FBHA 4Y13A 2ZFWA 4JQFA 2L3DA 2EFPA 5K1YA 1G3YA 4Y15A 3ZMZA 3F22A 2XAQA 3GYHX 2V9VA 2VODA 2OQGA 5BMZA 4HLXA 3KP4A 3U2RA 2XASA 2RC4A 3HOTA 3HOSA 3REOA 2W57A 4WWCA 1U3EM 5D5UB 2ZJ2A 2AXLA 1Z6TA 5FB2A 5F6FA 1B9MA 1ONVA 4CDGA 2NRAC 4A5MA 1R5GA 3ZQ7A 1FC3A 4IXAA 2JTVA 5DYMA 1XMKA 1ZRFA 3BZ6A 2VBWA 4P9UA 1F5TA 3O2PE 3ABUA 3I5UA 4S05A 1FNNA 2X4HA 2ZMEB 1KU9A 2GWRA 1U5TA 2IA0A 3T1BA 4B8XA 1RIOH 2Q2EA 3CLOA 5CVVA 3SFZA 2GA2A 2XUBA 5KVRA 3WTUC 4WXDA 4ZYHA 4CXFA 3E6MA 1B6AA 3KZZA 5FLXZ 1FT9A 2IJLA 3DPLC 2V6CA 4KYWA 1S7OA 3IC7A 5LHIA 3I59B 2CW0F 3LA2A 3KP3A 1Z1DA 2ADUA 2FBKA 2L4MA 2FE3A 2NS0A 2P5VA 1WKMA 2DFIA 2W84A 5ICFA 3K2ZA 3HTUA 5FO5A 1F4KA 1IN4A 2CGPA 2BYVE 1A04A 3KEQA 1XCVA 4HF2A 5DCMA 4QLCU 1BC8C 4GXOA 5D4RA 3OOPA 3WTVC 3R0AA 2D2WA 1JXSA 2GZWA 4UXNA 3MAJA 2OZUA 3TQNA 3L2CA 1XN7A 2Y48A 4LJZF 1KQ9A 4EJVA 4XLNF 4HQEA 3HSEA 3VEPA 3KP2A 2CSOA 2IW5A 2XAGA 3I4PA 1IZ1A 2EV5A 4G7ZF 2BBYA 1X3UA 3RPQA 2M30A 2PN6A 1XDUA 5D4SA 1KGSA 3P7NA 2NAZA 4ESFA 3MZHA 1BI0A 4CICA 2ESHA 3E3VA 1C0WA 4F7ZA 3WODF 4L5JA 4L18B 2HFHA 1LDJA 1HXDA 4KMFA 4HX8A 3ZP5A 4HA8A 4BHBA 1ULYA 2RV8A 4ZZLA 4O6JA 4M72A 2CQKA 4WCGA 2XHKA 1YO5C 1DPRA 5FLXK 2YSRA 5L3CA 4U7DA 1SMYF 1ON2A 3IWZA 2DLLA 2FU4A 1J5YA 4M9SA 1S29A 2ISZA 3WTXC 4L9JA 3LFKA 2FQ3A 3HSFA 2VOOA 2VN2A 1J59A 1ZRDA 1T2KA 4A12A 3SZPA 4RGRA 5LGTA 4MNUA 2XROA 1BOAA 2OAZA 1RI7A 3W6JB 4AVPA 3KETA 4LB5A 1I5ZA 5TJJA 3RTRA 1UFMA 3PQKA 2DQRA 1D3YA 1XCBA 3KLNA 5BPDA 2EFWA 5K5QA 3NEUA 3V8LA 4L9TA 3TOBA 4IHTA 3R60A 2BGCA 1K79A 2V79A 1BJAA 3ZN0A 5ICGA 1SD5A 1QPMA 3KP6A 1L0OC 1XDSA 3DQVC 4A2UA 2FOKA 1YFHA 4HBLA 1KYZA 2PBIA 1RUNA 2ZNZA 3F6OA 1R22A 3I53A 5A2QK 4UV8A 5E20A 2CFXA 3F6VA 1LDKB 2A61A 1DPUA 5AIPA 3G73A 4KN7X 3I54A 2WWYA 3HRMA 5D5VB 3KP5A 2Z99A 1BIBA 1H9TA 1TQPA 3HUGA 1G4DA 1PUEE 2PI0A 4P9FA 5ICCA 3DP7A 2RN7A 3F8FA 4HOBA 3RYRA 4M6YA 4QWQA 4HF0A 4BHPA 3BPVA 2Y0MA 1W7PD 2DK5A 3QP5A 4G7OF 4NQWA 2DU9A 4KMUX 3MQ0A 1GVJA 3ML6A 3VFZA 1CF7B 4Y17A 1D8KA 4M73A 2DTRA 5IT9Z 1ZREA 2EV6A 2IVMA 4MHGA 1Z6RA 4M6XA 3GFIA 2L4AA 4PGHA 5HVQC 2PMUA 2MLGA 1MJBA 1SFEA 3EUHA 4NHJA 3TDUC 2H27A 3ZMDA 3VB2A 3ZMTA 4LB6B 3H3ZA 5E18F 5CJ9A 2A3SA 5L3EA 2QQ9A 3KFWX 3BROA 5JR3A 3FXRA 2EFNA 2L01A 3HRSA 5D8KB 1TW2A 2OBPA 1UB9A 1YW9A 3F21A 1YG2A 2VBYA 4EJTA 5EEHA 2GXGA 2KRFA 4EJWA 1TQMA 3LA7A 1ZN2A 4I0AA 1STZA 3TOAA 1K78B 5DV5A 3V7SA 2F5EA 4ETSA 1LQ1A 1FLIA 1B59A 3K1MA 1SD7A 4LFUA 2HEOA 2XAFA 5DCFA 4L0YB 2MD5A 2JT1A 4HX7A 2ZO4A 5DD8A 3GFMA 3U1DA 2F5DA 1B1BA 3K1PA 2O3FA 4UVCA 2HYGD 4MQ9F 4G6DA 1W7PB 1FY7A 1YS6A 4G8XA 4OIRF 2RQPA 3KLOA 4OIPF 2VT2A 2Y75A 3R4KA 2GAUA 3Q9VA 3V8JA 1G6NA 1WSUA 4A0YA 1HSJA 3WGIA 4LG0B 2VBZA 2ISYA 1LDDA 4PZJA 1IN7A 4UVAA 2IP2A 3BJ6A 5L3FA 1WRJA 2RGVA 1SD4A 3E5QA 2D1VA 4EM2A 2STWA 5DUKA 1EH7A 4RB3C 2EWNA 1FZPB 4EMSA 1KYWA 1S8NA 2QQBA 2DQLA 2HWVA 2QZ8A 2X0LA 2C6YA 1MZBA 5D5XB 2HOEA 2R7FA 2P6SA 5LEKA 3TKYA 1CGPA 1E2XA 4BNCA 3GLXA 4RB1A 2GA1A 4S04A 2W85A 4L5IA 3DV8A 2YX4A 5CVIA 3V7CA 4XSXF 1OPCA 3FMRA 1QO0D 3TO6A 4LK1F 1S3JA 2PQ8A 4IRIA 4DNCA 1MDMB 3GX4X 5HS9A 2XKOA 3DKWA 3M7GA 1QGPA 2FNAA 1IRFA 3V4GA 1TBXA 3QRFF 5E1XA 3WU0A 1R58A 4P55A 3QU6A 3EYIA 1F1ZA 2BEOA 2NNYA 1AWCA 2XAHA 4IHSA 5DDGA 4WX9A 1MKMA 4L9VA 1R7JA 4Q5SF 3J7AO 3WE3A 3TGNA 2QBYB 1PDNC 1IW7F 2FMYA 4ZYEA 4OMZA 3GWZA 1VTNC 4RGXA 4FT8A 3KCCA 5HS7A 3J81Z 2ELHA 2EA4A 3LQRA 2HTSA 5L3DA 2V1UA 4M9XA 1PP7U 1XGSA 2DW4A 4L9NA 4G94A 3BJAA 2HS5A 3RKXA 1O3RA 3O6BB 2HGCA 5BPIA 4LD5A 2KIFA 2DI3A 1ZG3A 5FGMA 2ACJA 3ULQB 5HS8A 1D8JA 4M74A 1G3TA 1K6OA 1TQIA 2PG4A 3CUQA 2LF7A 1O7LA 1XSDA 2RVCA 2YPRA 5CVRA 3IWFA 3SHFA 1OYYA 2WTEA 2ZNYA 4HV6A 3KEOA 4M9ZA 1NHAA 3JSOA 5CVUA 3E5XA 5CLSA 2IA2A 3F8BA 3U9GA 4A0ZA 2D45A 4WF2A 2BV6A 5A2QZ 3WTWC 2P5LC 2A69F 1Z9CA 3LAPA 1T39A 2NYXA 4L0ZB 2QENA 1HSTA 1ZAOA 1XSXA 4LLGF 1V4RA 3HRUA 4IRHA 3GEZA 5HLHA 2QLZA 1WQ2A 3RKYA 1FSEA 3K9TA 1FYLA 4UV9A 4UVBA 1U2WA 3C1DA 2CWEA 1FBSA 5JHUA 3WTSC 3M1EA 2MC3A 2A6EF 2QVOA 5DUIA 2FRHA 3Q9SA 4E70A 1T38A 4BQAA 4YIFA 4KN4X 4HZFA 5LGUA 3J81K 5CVJA 3L09A 1J2XA 1ZLJA 4RGUA 1FX7A 2KIMA 5J8CA 4XSZF 3H3UA 3MCZA 5JVTA 1J75A 1BI3A 2H6BA 5F64A 2LDUA 4MTDA 1W5TA 4GCVA 3FMSA 2UWMA 2RKHA 4FX4A 2M1BA 2FXAA 1QQIA 3J80Z 1IXCA 1SFUA 2V1XA 1XGOA 2VE8A 2JZYA 4LK0F 2CO5A 5HDNA 4Q4ZF 4KDPA 4R8HA 3QU3A 1P4AA 2DPUA 4CGZA 3L7WA 2MH2A 2OZ6A 3N4MA 5LLQA 4H0EA 6PAXA 3LSTA 2R7DA 1TTYA 1XMAA 3FXQA 5ILSA 4LLLA 3NRVA 2CG4A 4I09A 4M71A 3KE2A 5ILVA 4A6DA 3T8TA 3V7RA 4AIJA 3IRRA 4PDKA 5JI6A 1Z7UA 4G6QA 3FXUA 2QWWA 3BY6A 3EDPA 1EH8A 3IL2A 4HV5A 3CJNA 4KUMA 4Q47A 2ZCWA 3E5UA 1AOYA 1OMIA 1HW2A 4I01A 3BPXA 1XGMA 4AWXB 1OYIA 5AIQA 2ZMEA 4RGSA 2LF8A 3GW2A 2BE5F 1I1GA 2EFQA 3N97A 4LGWA 2OA4A 1TLHB 2PLYA 3RIRA 3VOEA 2O0YA 2W25A 1R1UA 2HR3A 5ERIA 3ZN1A 1XB4A 5LEJA 3E6CC 3I59A 3K0LA 4KNYA 1SMTA 1HKTA 4HW0A 4JK1X 2GXBA 1G3WA 3ERED 3K69A 4FHTA 3M8EA 1UHWA 2XV4S 3CO7C 3WGHA 3MZYA 2V1DA 4TV7A 4Q48A 1FP1D 4KICA 4AIKA 2M45A 2H6CA 3F8NA 4JBAA 4I2OA 1J7KA 3ISPA 1IXRC 5DCMB 3C18A 1JE8A 1GHCA 3HRTA 4B09A 1FOKA 1FYKA 1FPQA 2LKPA 3J80K 4EGZA 1LVAA 2LSOA 1J9IA 2PFBA 1TW3A 5LBQA 3E6BA 2UXXA 4PGGA 1H0MA 1DDNA 2MBFA 3F23A 3MEXA 4GYIA 3JTHA 3WTYC 4A6EA 1MJ9A 1Z91A 2EJRA 4G7HF 3P9KA 1ZYRF 4HDUA 1DP7P 4HLYA 1BM9A 2WC2A 3F3XA 2PEXA 1HW1A 3B73A 3FX3A 4N9IA 1XD7A 5JFRA 2EFOA 1HW5A 4LMYA 3I64A 1B9NA 2OQRA 3OV8A 5J8FA 3ZMUA 3R6SA 3F8MA 2HQNA 4G9YA 1KQ8A 1KU3A 3GXOA 1H9GA 4RS8A 2GIVA 2FMLA 5HOOA 3PFIA 4I98B 2CYYA 3ELKA 5K5RA 1QBJA 2KJBA 3GFJA 4U88A 3SQNA 1BIAA 3TO7A 3RDIA 2DT5A 1ZG1A 5E8IA 1W4MA 3CTAA 2O6GE 2NNNA 5H20A 4OMYA 1O7FA 3GUDA 3R61A 1YIOA 1BI2A 4ZYGA 4ESJA 1EH6A 3FMQA 4RAZA 4U7BA 1YLFA 2M8EA 4IRGA 4A5NA 2XKPA 5D5WB 3BWGA 2QM3A 1ZARA 1IF1A 5D8LB 3QPTA 2JPCA 3FZVA 2K02A 4HDVA 1JHFA 3GZ6A 2WV0A 2ZBKA 3EYYA 4UNOA 5LGNA 1HQCA 1LEAA 3JTGA 1FYMA 5EEGA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2P7C B;  4I7H A;  2DK8 A;  1IAW A;  2KKO A;  4GGG A;  2KIU A;  1R1T A;  2F5F A;  1XGN A;  1O3S A;  4KIF A;  1WI9 A;  2HDC A;  2VT3 A;  3F8C A;  3FM3 A;  4Z2Y A;  2FBI A;  1V3F A;  3HYI A;  4YG2 F;  4OIQ F;  2ZKZ A;  4YFN F;  1BBY A;  2M87 A;  4U0V A;  1E17 A;  2XRN A;  1IN8 A;  2XVC A;  4NB5 A;  2QUF A;  1SFX A;  2A07 F;  4CO8 A;  2Z5U A;  4OIO F;  3NQO A;  5LRR A;  1W5S A;  1RZ4 A;  3M8F A;  4O5V A;  4I0B A;  2YU3 A;  4EQQ A;  4KIG A;  5LRS A;  1LEB A;  3JAM Z;  2F2E A;  1KU7 A;  2A68 F;  2F5C A;  1UCR A;  4EVI A;  1I27 A;  4U0Y A;  3ZMV A;  1O57 A;  1QZY A;  1T98 A;  2W24 A;  2UZK A;  3WE2 A;  2JSC A;  2GQQ A;  3CO6 C;  1SD6 A;  1F9N A;  3ABT A;  2P5K A;  4YFK F;  1LNW A;  1OYW A;  1BI1 A;  3BJO A;  2H94 A;  4WXC A;  1O3T A;  5HLG A;  3DF8 A;  1QNT A;  4PCQ A;  1QZZ A;  2ESN A;  5J6X A;  2HQR A;  4IPA A;  3ECO A;  1U78 A;  1CF7 A;  2P6T A;  2HYF A;  4HYE A;  2FF4 A;  3FWE A;  2PMH A;  3ZMS A;  3P9I A;  1T6S A;  1DUX C;  1P6R A;  4HAM A;  1HBX G;  1OKR A;  1UHM A;  5F1R A;  3K1N A;  3Q5F A;  2D1H A;  4HQM A;  3S2W A;  4OIN F;  4EM1 A;  4MEX F;  1YW7 A;  4RAY A;  3EET A;  1SAX A;  2IT0 A;  2H09 A;  5DD4 A;  5AON A;  2Z33 A;  1R5H A;  2E7X A;  3AAF A;  4OOI A;  3QAH A;  5BS6 A;  1J0R A;  2G9W A;  1JGS A;  2IPQ X;  4P5O A;  2DBB A;  3TO9 A;  1U8R A;  4N9H A;  2LNB A;  1D5V A;  4A0X A;  4AIH A;  2RDP A;  2FSW A;  2VOP A;  5D6F A;  1FP2 A;  4FX0 A;  3MWM A;  5K5O A;  1P2F A;  1YS7 A;  3FF5 A;  2P7V B;  2MA3 A;  4R79 A;  5ED4 A;  5H6Q A;  2YR2 A;  3E97 A;  2DPD A;  2VC0 A;  3T5X A;  1K78 A;  3O3K A;  2XIG A;  3GZ5 A;  4ENK A;  1MJA A;  1YW8 A;  3ZPL A;  1ZG5 A;  1Z05 A;  2E1C A;  5KK1 A;  2AS5 F;  1KU2 A;  4WK8 F;  1HKS A;  2XAJ A;  2EB7 A;  2Z3Y A;  3TDZ C;  3QP6 A;  2YX7 A;  3JAM K;  1KA8 A;  2HZT A;  3ECH A;  1FWZ A;  2E7W A;  2JRT A;  4ASN A;  4UUV A;  2G7U A;  2STT A;  1ZH5 A;  4EJU A;  1IUY A;  3KZY A;  4MEY F;  1S7A A;  1UST A;  1W7P A;  2Z9O A;  4EM0 B;  4HX4 A;  4BH9 A;  2HKO A;  4GO1 A;  4LG0 A;  2J5P A;  5E1Z B;  1ZGJ A;  1REP C;  3WTZ A;  1P4W A;  3BOQ A;  1RUO A;  4N0B A;  3WTT C;  4DQ2 A;  1FBQ A;  3GVA A;  3SXY A;  1PP8 F;  4U0W A;  2J5O A;  2DAO A;  3T8R A;  4D0P A;  5FFZ A;  3RPU A;  1TNS A;  2VON A;  4P96 A;  4ENN A;  1U5T C;  3BP8 A;  3WU1 B;  3PQJ A;  1Q1H A;  2K4B A;  5BQT A;  2EK5 A;  4CYD A;  4ZH4 F;  3IRQ A;  3QPH A;  3C3W A;  4O3M A;  1TNT A;  2K4J A;  5ICE A;  1B4A A;  1YYV A;  2EV0 A;  3DXJ F;  2VC1 A;  1IN5 A;  3L9F A;  1R23 A;  3D0S A;  2VBX A;  3LQQ A;  2P8T A;  1WWX A;  5E1W A;  2VXZ A;  4ON0 A;  5DEQ A;  3WGG A;  4IVN A;  4GYG A;  1ZHF A;  2QYO A;  5FFX A;  2O61 A;  2E1N A;  4YFX F;  1ZRC A;  4WXH A;  3I71 A;  1U6G A;  2G7H A;  1MDM A;  3RKW A;  1XSV A;  2XGX A;  1KQ0 A;  4XLP F;  3CDH A;  3RYP A;  1ZLK A;  3MFK A;  5HDG A;  3KP7 A;  1L3L A;  1LJ9 A;  2HKX A;  1I1S A;  2K7L A;  1BN5 A;  4IF4 A;  2EA2 A;  3I58 A;  2R3S A;  1U5T B;  2P4W A;  2L02 A;  1Y0U A;  2DO7 A;  3CUQ C;  4BYY A;  3HHH A;  4BAY A;  1P92 A;  2IRF G;  4KFC A;  2QBY A;  1OR7 A;  2TDX A;  3CUO A;  2B0L A;  2M5W A;  5LHG A;  3HTS B;  3VOD A;  2UXN A;  5L3B A;  1T0F A;  3IKT A;  2JPB A;  2KJC A;  2FNP A;  1MGT A;  4K2E A;  3B02 A;  3BDD A;  3DFG A;  1EV7 A;  3E6D A;  3M9A A;  2A6H F;  3JSP A;  3G3Z A;  2Q0O A;  1USS A;  4UHT A;  3T0Y A;  1LB2 A;  2MLK A;  4OU0 A;  2A5Y B;  1JHH A;  2OD5 A;  1YQA A;  4ENJ A;  1IRG A;  3L00 A;  3F72 A;  3P9C A;  5E17 F;  3LWF A;  4AD9 A;  4MQV A;  1ON1 A;  5E8G A;  5ILU A;  3V8K A;  4BHC A;  4MGR A;  3LA3 A;  3WG9 A;  1GXQ A;  3CUQ B;  1BC7 C;  5HDK A;  4XRF A;  3R0J A;  3I0T A;  2K86 A;  1MD0 A;  4CHU A;  5LHH A;  3HHG A;  3GO5 A;  1FSH A;  1G3S A;  4EGY A;  2OU2 A;  2PJP A;  2FEZ A;  3DPT A;  1ODD A;  4EV0 A;  4BXU A;  5FD6 A;  1R36 A;  1K7A A;  1R00 A;  2O03 A;  2RNJ A;  3RJP A;  5H6R A;  1I6X A;  4KA4 A;  1FBU A;  3H92 A;  2Q8K A;  4XBF A;  3SZT A;  3HIF A;  4KIB A;  2QQA A;  3GFL A;  4RB0 A;  3IHU A;  3W6K B;  3IKV A;  2L54 A;  1HKQ A;  3FM5 A;  1YTY A;  1S6L A;  1R1V A;  3EQL F;  1GXP A;  3RI4 A;  3COA C;  4ESB A;  5HLI A;  2VE9 A;  4I02 A;  3QOP A;  4MTE A;  3JW4 A;  1IN6 A;  4IJA A;  3FHZ A;  3LAJ A;  3GF2 A;  2K27 A;  2HTJ A;  2IA1 A;  3D5L A;  4R1H A;  4LLN A;  4RB2 C;  4EJO A;  1IXS B;  2MH9 A;  5FD5 A;  4YII A;  4CZZ A;  4KT5 C;  5L3G A;  2ETH A;  4HF1 A;  2FA5 A;  4ENM A;  1O3Q A;  3ROU A;  3C7J A;  3HSR A;  5D6E A;  5IT3 A;  1P4X A;  4ZYD A;  2COM A;  5IT9 K;  5CYV A;  5BOX A;  2ZXJ A;  1ZGA A;  2O8X A;  1RNL A;  3DEU A;  5TRD A;  4ZZD A;  2FBH A;  4Y13 A;  2ZFW A;  4JQF A;  2L3D A;  2EFP A;  5K1Y A;  1G3Y A;  4Y15 A;  3ZMZ A;  3F22 A;  2XAQ A;  3GYH X;  2V9V A;  2VOD A;  2OQG A;  5BMZ A;  4HLX A;  3KP4 A;  3U2R A;  2XAS A;  2RC4 A;  3HOT A;  3HOS A;  3REO A;  2W57 A;  4WWC A;  1U3E M;  5D5U B;  2ZJ2 A;  2AXL A;  1Z6T A;  5FB2 A;  5F6F A;  1B9M A;  1ONV A;  4CDG A;  2NRA C;  4A5M A;  1R5G A;  3ZQ7 A;  1FC3 A;  4IXA A;  2JTV A;  5DYM A;  1XMK A;  1ZRF A;  3BZ6 A;  2VBW A;  4P9U A;  1F5T A;  3O2P E;  3ABU A;  3I5U A;  4S05 A;  1FNN A;  2X4H A;  2ZME B;  1KU9 A;  2GWR A;  1U5T A;  2IA0 A;  3T1B A;  4B8X A;  1RIO H;  2Q2E A;  3CLO A;  5CVV A;  3SFZ A;  2GA2 A;  2XUB A;  5KVR A;  3WTU C;  4WXD A;  4ZYH A;  4CXF A;  3E6M A;  1B6A A;  3KZZ A;  5FLX Z;  1FT9 A;  2IJL A;  3DPL C;  2V6C A;  4KYW A;  1S7O A;  3IC7 A;  5LHI A;  3I59 B;  2CW0 F;  3LA2 A;  3KP3 A;  1Z1D A;  2ADU A;  2FBK A;  2L4M A;  2FE3 A;  2NS0 A;  2P5V A;  1WKM A;  2DFI A;  2W84 A;  5ICF A;  3K2Z A;  3HTU A;  5FO5 A;  1F4K A;  1IN4 A;  2CGP A;  2BYV E;  1A04 A;  3KEQ A;  1XCV A;  4HF2 A;  5DCM A;  4QLC U;  1BC8 C;  4GXO A;  5D4R A;  3OOP A;  3WTV C;  3R0A A;  2D2W A;  1JXS A;  2GZW A;  4UXN A;  3MAJ A;  2OZU A;  3TQN A;  3L2C A;  1XN7 A;  2Y48 A;  4LJZ F;  1KQ9 A;  4EJV A;  4XLN F;  4HQE A;  3HSE A;  3VEP A;  3KP2 A;  2CSO A;  2IW5 A;  2XAG A;  3I4P A;  1IZ1 A;  2EV5 A;  4G7Z F;  2BBY A;  1X3U A;  3RPQ A;  2M30 A;  2PN6 A;  1XDU A;  5D4S A;  1KGS A;  3P7N A;  2NAZ A;  4ESF A;  3MZH A;  1BI0 A;  4CIC A;  2ESH A;  3E3V A;  1C0W A;  4F7Z A;  3WOD F;  4L5J A;  4L18 B;  2HFH A;  1LDJ A;  1HXD A;  4KMF A;  4HX8 A;  3ZP5 A;  4HA8 A;  4BHB A;  1ULY A;  2RV8 A;  4ZZL A;  4O6J A;  4M72 A;  2CQK A;  4WCG A;  2XHK A;  1YO5 C;  1DPR A;  5FLX K;  2YSR A;  5L3C A;  4U7D A;  1SMY F;  1ON2 A;  3IWZ A;  2DLL A;  2FU4 A;  1J5Y A;  4M9S A;  1S29 A;  2ISZ A;  3WTX C;  4L9J A;  3LFK A;  2FQ3 A;  3HSF A;  2VOO A;  2VN2 A;  1J59 A;  1ZRD A;  1T2K A;  4A12 A;  3SZP A;  4RGR A;  5LGT A;  4MNU A;  2XRO A;  1BOA A;  2OAZ A;  1RI7 A;  3W6J B;  4AVP A;  3KET A;  4LB5 A;  1I5Z A;  5TJJ A;  3RTR A;  1UFM A;  3PQK A;  2DQR A;  1D3Y A;  1XCB A;  3KLN A;  5BPD A;  2EFW A;  5K5Q A;  3NEU A;  3V8L A;  4L9T A;  3TOB A;  4IHT A;  3R60 A;  2BGC A;  1K79 A;  2V79 A;  1BJA A;  3ZN0 A;  5ICG A;  1SD5 A;  1QPM A;  3KP6 A;  1L0O C;  1XDS A;  3DQV C;  4A2U A;  2FOK A;  1YFH A;  4HBL A;  1KYZ A;  2PBI A;  1RUN A;  2ZNZ A;  3F6O A;  1R22 A;  3I53 A;  5A2Q K;  4UV8 A;  5E20 A;  2CFX A;  3F6V A;  1LDK B;  2A61 A;  1DPU A;  5AIP A;  3G73 A;  4KN7 X;  3I54 A;  2WWY A;  3HRM A;  5D5V B;  3KP5 A;  2Z99 A;  1BIB A;  1H9T A;  1TQP A;  3HUG A;  1G4D A;  1PUE E;  2PI0 A;  4P9F A;  5ICC A;  3DP7 A;  2RN7 A;  3F8F A;  4HOB A;  3RYR A;  4M6Y A;  4QWQ A;  4HF0 A;  4BHP A;  3BPV A;  2Y0M A;  1W7P D;  2DK5 A;  3QP5 A;  4G7O F;  4NQW A;  2DU9 A;  4KMU X;  3MQ0 A;  1GVJ A;  3ML6 A;  3VFZ A;  1CF7 B;  4Y17 A;  1D8K A;  4M73 A;  2DTR A;  5IT9 Z;  1ZRE A;  2EV6 A;  2IVM A;  4MHG A;  1Z6R A;  4M6X A;  3GFI A;  2L4A A;  4PGH A;  5HVQ C;  2PMU A;  2MLG A;  1MJB A;  1SFE A;  3EUH A;  4NHJ A;  3TDU C;  2H27 A;  3ZMD A;  3VB2 A;  3ZMT A;  4LB6 B;  3H3Z A;  5E18 F;  5CJ9 A;  2A3S A;  5L3E A;  2QQ9 A;  3KFW X;  3BRO A;  5JR3 A;  3FXR A;  2EFN A;  2L01 A;  3HRS A;  5D8K B;  1TW2 A;  2OBP A;  1UB9 A;  1YW9 A;  3F21 A;  1YG2 A;  2VBY A;  4EJT A;  5EEH A;  2GXG A;  2KRF A;  4EJW A;  1TQM A;  3LA7 A;  1ZN2 A;  4I0A A;  1STZ A;  3TOA A;  1K78 B;  5DV5 A;  3V7S A;  2F5E A;  4ETS A;  1LQ1 A;  1FLI A;  1B59 A;  3K1M A;  1SD7 A;  4LFU A;  2HEO A;  2XAF A;  5DCF A;  4L0Y B;  2MD5 A;  2JT1 A;  4HX7 A;  2ZO4 A;  5DD8 A;  3GFM A;  3U1D A;  2F5D A;  1B1B A;  3K1P A;  2O3F A;  4UVC A;  2HYG D;  4MQ9 F;  4G6D A;  1W7P B;  1FY7 A;  1YS6 A;  4G8X A;  4OIR F;  2RQP A;  3KLO A;  4OIP F;  2VT2 A;  2Y75 A;  3R4K A;  2GAU A;  3Q9V A;  3V8J A;  1G6N A;  1WSU A;  4A0Y A;  1HSJ A;  3WGI A;  4LG0 B;  2VBZ A;  2ISY A;  1LDD A;  4PZJ A;  1IN7 A;  4UVA A;  2IP2 A;  3BJ6 A;  5L3F A;  1WRJ A;  2RGV A;  1SD4 A;  3E5Q A;  2D1V A;  4EM2 A;  2STW A;  5DUK A;  1EH7 A;  4RB3 C;  2EWN A;  1FZP B;  4EMS A;  1KYW A;  1S8N A;  2QQB A;  2DQL A;  2HWV A;  2QZ8 A;  2X0L A;  2C6Y A;  1MZB A;  5D5X B;  2HOE A;  2R7F A;  2P6S A;  5LEK A;  3TKY A;  1CGP A;  1E2X A;  4BNC A;  3GLX A;  4RB1 A;  2GA1 A;  4S04 A;  2W85 A;  4L5I A;  3DV8 A;  2YX4 A;  5CVI A;  3V7C A;  4XSX F;  1OPC A;  3FMR A;  1QO0 D;  3TO6 A;  4LK1 F;  1S3J A;  2PQ8 A;  4IRI A;  4DNC A;  1MDM B;  3GX4 X;  5HS9 A;  2XKO A;  3DKW A;  3M7G A;  1QGP A;  2FNA A;  1IRF A;  3V4G A;  1TBX A;  3QRF F;  5E1X A;  3WU0 A;  1R58 A;  4P55 A;  3QU6 A;  3EYI A;  1F1Z A;  2BEO A;  2NNY A;  1AWC A;  2XAH A;  4IHS A;  5DDG A;  4WX9 A;  1MKM A;  4L9V A;  1R7J A;  4Q5S F;  3J7A O;  3WE3 A;  3TGN A;  2QBY B;  1PDN C;  1IW7 F;  2FMY A;  4ZYE A;  4OMZ A;  3GWZ A;  1VTN C;  4RGX A;  4FT8 A;  3KCC A;  5HS7 A;  3J81 Z;  2ELH A;  2EA4 A;  3LQR A;  2HTS A;  5L3D A;  2V1U A;  4M9X A;  1PP7 U;  1XGS A;  2DW4 A;  4L9N A;  4G94 A;  3BJA A;  2HS5 A;  3RKX A;  1O3R A;  3O6B B;  2HGC A;  5BPI A;  4LD5 A;  2KIF A;  2DI3 A;  1ZG3 A;  5FGM A;  2ACJ A;  3ULQ B;  5HS8 A;  1D8J A;  4M74 A;  1G3T A;  1K6O A;  1TQI A;  2PG4 A;  3CUQ A;  2LF7 A;  1O7L A;  1XSD A;  2RVC A;  2YPR A;  5CVR A;  3IWF A;  3SHF A;  1OYY A;  2WTE A;  2ZNY A;  4HV6 A;  3KEO A;  4M9Z A;  1NHA A;  3JSO A;  5CVU A;  3E5X A;  5CLS A;  2IA2 A;  3F8B A;  3U9G A;  4A0Z A;  2D45 A;  4WF2 A;  2BV6 A;  5A2Q Z;  3WTW C;  2P5L C;  2A69 F;  1Z9C A;  3LAP A;  1T39 A;  2NYX A;  4L0Z B;  2QEN A;  1HST A;  1ZAO A;  1XSX A;  4LLG F;  1V4R A;  3HRU A;  4IRH A;  3GEZ A;  5HLH A;  2QLZ A;  1WQ2 A;  3RKY A;  1FSE A;  3K9T A;  1FYL A;  4UV9 A;  4UVB A;  1U2W A;  3C1D A;  2CWE A;  1FBS A;  5JHU A;  3WTS C;  3M1E A;  2MC3 A;  2A6E F;  2QVO A;  5DUI A;  2FRH A;  3Q9S A;  4E70 A;  1T38 A;  4BQA A;  4YIF A;  4KN4 X;  4HZF A;  5LGU A;  3J81 K;  5CVJ A;  3L09 A;  1J2X A;  1ZLJ A;  4RGU A;  1FX7 A;  2KIM A;  5J8C A;  4XSZ F;  3H3U A;  3MCZ A;  5JVT A;  1J75 A;  1BI3 A;  2H6B A;  5F64 A;  2LDU A;  4MTD A;  1W5T A;  4GCV A;  3FMS A;  2UWM A;  2RKH A;  4FX4 A;  2M1B A;  2FXA A;  1QQI A;  3J80 Z;  1IXC A;  1SFU A;  2V1X A;  1XGO A;  2VE8 A;  2JZY A;  4LK0 F;  2CO5 A;  5HDN A;  4Q4Z F;  4KDP A;  4R8H A;  3QU3 A;  1P4A A;  2DPU A;  4CGZ A;  3L7W A;  2MH2 A;  2OZ6 A;  3N4M A;  5LLQ A;  4H0E A;  6PAX A;  3LST A;  2R7D A;  1TTY A;  1XMA A;  3FXQ A;  5ILS A;  4LLL A;  3NRV A;  2CG4 A;  4I09 A;  4M71 A;  3KE2 A;  5ILV A;  4A6D A;  3T8T A;  3V7R A;  4AIJ A;  3IRR A;  4PDK A;  5JI6 A;  1Z7U A;  4G6Q A;  3FXU A;  2QWW A;  3BY6 A;  3EDP A;  1EH8 A;  3IL2 A;  4HV5 A;  3CJN A;  4KUM A;  4Q47 A;  2ZCW A;  3E5U A;  1AOY A;  1OMI A;  1HW2 A;  4I01 A;  3BPX A;  1XGM A;  4AWX B;  1OYI A;  5AIQ A;  2ZME A;  4RGS A;  2LF8 A;  3GW2 A;  2BE5 F;  1I1G A;  2EFQ A;  3N97 A;  4LGW A;  2OA4 A;  1TLH B;  2PLY A;  3RIR A;  3VOE A;  2O0Y A;  2W25 A;  1R1U A;  2HR3 A;  5ERI A;  3ZN1 A;  1XB4 A;  5LEJ A;  3E6C C;  3I59 A;  3K0L A;  4KNY A;  1SMT A;  1HKT A;  4HW0 A;  4JK1 X;  2GXB A;  1G3W A;  3ERE D;  3K69 A;  4FHT A;  3M8E A;  1UHW A;  2XV4 S;  3CO7 C;  3WGH A;  3MZY A;  2V1D A;  4TV7 A;  4Q48 A;  1FP1 D;  4KIC A;  4AIK A;  2M45 A;  2H6C A;  3F8N A;  4JBA A;  4I2O A;  1J7K A;  3ISP A;  1IXR C;  5DCM B;  3C18 A;  1JE8 A;  1GHC A;  3HRT A;  4B09 A;  1FOK A;  1FYK A;  1FPQ A;  2LKP A;  3J80 K;  4EGZ A;  1LVA A;  2LSO A;  1J9I A;  2PFB A;  1TW3 A;  5LBQ A;  3E6B A;  2UXX A;  4PGG A;  1H0M A;  1DDN A;  2MBF A;  3F23 A;  3MEX A;  4GYI A;  3JTH A;  3WTY C;  4A6E A;  1MJ9 A;  1Z91 A;  2EJR A;  4G7H F;  3P9K A;  1ZYR F;  4HDU A;  1DP7 P;  4HLY A;  1BM9 A;  2WC2 A;  3F3X A;  2PEX A;  1HW1 A;  3B73 A;  3FX3 A;  4N9I A;  1XD7 A;  5JFR A;  2EFO A;  1HW5 A;  4LMY A;  3I64 A;  1B9N A;  2OQR A;  3OV8 A;  5J8F A;  3ZMU A;  3R6S A;  3F8M A;  2HQN A;  4G9Y A;  1KQ8 A;  1KU3 A;  3GXO A;  1H9G A;  4RS8 A;  2GIV A;  2FML A;  5HOO A;  3PFI A;  4I98 B;  2CYY A;  3ELK A;  5K5R A;  1QBJ A;  2KJB A;  3GFJ A;  4U88 A;  3SQN A;  1BIA A;  3TO7 A;  3RDI A;  2DT5 A;  1ZG1 A;  5E8I A;  1W4M A;  3CTA A;  2O6G E;  2NNN A;  5H20 A;  4OMY A;  1O7F A;  3GUD A;  3R61 A;  1YIO A;  1BI2 A;  4ZYG A;  4ESJ A;  1EH6 A;  3FMQ A;  4RAZ A;  4U7B A;  1YLF A;  2M8E A;  4IRG A;  4A5N A;  2XKP A;  5D5W B;  3BWG A;  2QM3 A;  1ZAR A;  1IF1 A;  5D8L B;  3QPT A;  2JPC A;  3FZV A;  2K02 A;  4HDV A;  1JHF A;  3GZ6 A;  2WV0 A;  2ZBK A;  3EYY A;  4UNO A;  5LGN A;  1HQC A;  1LEA A;  3JTG A;  1FYM A;  5EEG A; 
#chains in the Genus database with same CATH topology
 3H9G A;  2P7C B;  4I7H A;  2DK8 A;  3P5J A;  3BCB A;  1R71 A;  4Y52 J;  1IAW A;  2KKO A;  2DA6 A;  3HOX J;  4GGG A;  1NK2 P;  5EG0 A;  4FIS A;  3J7Z I;  2KIU A;  1R1T A;  2F5F A;  4BY7 J;  1XGN A;  5EEA A;  1O3S A;  4IEJ A;  3AG4 H;  1VI0 A;  2KZV A;  4KIF A;  5HLT A;  4A3J J;  4XKC A;  3TW6 A;  1WI9 A;  1X3W B;  2HDC A;  2VT3 A;  2NS7 A;  3F8C A;  3FM3 A;  4Z2Y A;  4DW6 A;  2LP0 A;  3TBI A;  2FBI A;  2R7S A;  1V3F A;  4PJJ A;  3HYI A;  4YG2 F;  2DOD A;  2F4O B;  4OIQ F;  3ZQL A;  1VQ7 I;  3UKG A;  2ZKZ A;  2E1O A;  4YFN F;  1BBY A;  2M87 A;  1IJW C;  1EF4 A;  4U0V A;  4IOA F;  1E17 A;  3MKW B;  1LFB A;  5IPA A;  2XRN A;  1IN8 A;  2XVC A;  4NB5 A;  1FMV A;  4AID A;  5JVG F;  2QUF A;  4XKW A;  3H3V K;  3CJQ B;  1OCT C;  1SFX A;  2A07 F;  3BG7 A;  1OQY A;  1ORK A;  2LVS A;  2R7O A;  4CO8 A;  2Z5U A;  4XLF A;  4PSX A;  4OIO F;  2HU9 A;  4Y33 A;  3NQO A;  5LRR A;  4G6T B;  1W5S A;  2W7N A;  2EQR A;  1RZ4 A;  3M8F A;  1BL0 A;  4NUB A;  4O5V A;  3DEE A;  3K4L A;  2CW8 A;  4I0B A;  3DEW A;  2HYJ A;  1W0U A;  2YU3 A;  5J4V A;  4EQQ A;  1TWG J;  4KIG A;  4W97 A;  5LRS A;  1LEB A;  3JAM Z;  2F2E A;  1KU7 A;  2A68 F;  2F5C A;  1UCR A;  4HPQ A;  4M3D A;  4EVI A;  3ZQF A;  1I27 A;  2NVQ J;  2FX0 A;  4U0Y A;  3ZMV A;  1O57 A;  1QZY A;  1T98 A;  2VQH A;  2W24 A;  4Z6Y A;  2UZK A;  3WE2 A;  2JSC A;  3S1M J;  3CCS I;  2GQQ A;  1UZC A;  2EH3 A;  3CO6 C;  1SD6 A;  1F9N A;  3ABT A;  4NC6 A;  2P5K A;  4YFK F;  1LNW A;  1OYW A;  4AUX A;  1BI1 A;  1OCZ H;  3BJO A;  3SYT A;  3BLY A;  3BG3 A;  2H94 A;  4WXC A;  1LFU P;  3RSN A;  1O3T A;  4M3F A;  1R9T J;  3BG5 A;  4PFP A;  5HLG A;  5KCM A;  1JT0 A;  2LRE A;  2OCC H;  3CD6 I;  2UUZ A;  3DF8 A;  3S17 J;  1QNT A;  4PCQ A;  3JRG A;  2HVR A;  1QZZ A;  5E3M A;  2L9V A;  2ESN A;  3IAS 2;  5J6X A;  1Y0N A;  5EJC A;  2HQR A;  4E7S A;  2D5V A;  3FBI B;  4IPA A;  3ECO A;  1U78 A;  1CF7 A;  1ETX A;  2P6T A;  2NVY J;  3AFH A;  4ZYA A;  2HYF A;  4HYE A;  2FF4 A;  3FWE A;  2PMH A;  4XIC A;  3ZMS A;  3P9I A;  3CC7 I;  1T6S A;  5FRO A;  4HNV A;  1DUX C;  1MMS A;  2H8W A;  1P6R A;  4NQW B;  2JJ7 A;  4HAM A;  5J1U A;  1HBX G;  1OKR A;  2R5Z A;  1UHM A;  3HGG A;  2LR8 A;  4GRI A;  3K1N A;  4C30 A;  3FXO A;  2K3P A;  5F1R A;  4AVZ A;  3Q5F A;  2D1H A;  4HQM A;  3S2W A;  4OIN F;  4HSR A;  1JTY A;  1FJL A;  4EM1 A;  4MEX F;  1YW7 A;  3CCM I;  4RAY A;  5KAF C;  2DFH A;  3EET A;  1SAX A;  2IT0 A;  3GTL J;  3ZOB A;  2QQ8 A;  2H09 A;  2W00 A;  4FTH A;  5DD4 A;  4F91 B;  2X6O A;  5AON A;  3RZD J;  2Z33 A;  1R5H A;  3DLL F;  4XID A;  2E7X A;  4RDU A;  3JRF A;  2R4G A;  3AAF A;  2LRD A;  4OOI A;  3E7L A;  3QAH A;  1TWA J;  2K9N A;  5DM6 F;  5BS6 A;  1J0R A;  1T56 A;  1Y1V J;  2G9W A;  1JGS A;  2IPQ X;  2LFB A;  4P5O A;  4B48 A;  2DFE A;  2DBB A;  1SVL A;  3TO9 A;  1U8R A;  4N9H A;  4C2T A;  2LNB A;  3MZ8 A;  1D5V A;  2BHZ A;  2YUS A;  4A0X A;  3ZR8 X;  1MBF A;  5DM7 F;  4AIH A;  1UHS A;  4AU7 A;  3OYJ A;  2FD5 A;  2H1K A;  2RDP A;  2FSW A;  1WJB A;  2VOP A;  5D6F A;  1FP2 A;  4FX0 A;  4MLO A;  1AKH B;  3MWM A;  5K5O A;  1P2F A;  1YS7 A;  3FF5 A;  1T95 A;  2P7V B;  1Y39 A;  2MFZ A;  1MSF C;  2MA3 A;  4R79 A;  5ED4 A;  2Q1Z B;  5H6Q A;  3VWB A;  2YR2 A;  1U9N A;  3E97 A;  2DPD A;  3I55 I;  2O9L A;  2VC0 A;  3K4K A;  1FOX A;  4LIV A;  3T5X A;  4A3I J;  2ZFU A;  2JWT A;  3BTJ A;  3H0G J;  1K78 A;  3CDI A;  1MH3 A;  3O3K A;  2XIG A;  3S14 J;  3GZ5 A;  2MAB A;  3BC8 A;  1TT5 B;  4ENK A;  1BR1 A;  1MJA A;  1YW8 A;  5DS9 A;  3ZPL A;  1ZG5 A;  1Z05 A;  2E1C A;  3LSK A;  2VJ5 A;  5KK1 A;  4II3 A;  2AS5 F;  2BY0 A;  2DXI A;  1KU2 A;  5K7Z A;  4WK8 F;  2VPL A;  1I6H J;  1HKS A;  5IP7 J;  2XAJ A;  2EB7 A;  2PJR A;  3IH2 A;  2Z3Y A;  2X6X A;  1HA8 A;  3TDZ C;  3QP6 A;  1HOM A;  2QCO A;  2YX7 A;  3K70 D;  3JAM K;  1KA8 A;  2HZT A;  3ECH A;  1FWZ A;  1X1B A;  2E7W A;  2JRT A;  4ASN A;  4UUV A;  2G7U A;  2STT A;  1ZH5 A;  3H0D A;  4EJU A;  1IUY A;  3KZY A;  4M3B A;  2VKV A;  2R92 J;  3O8H A;  4MEY F;  3HOV J;  2XF5 A;  1S7A A;  1UST A;  2DA4 A;  1W7P A;  4XLA A;  2Z9O A;  3HEF A;  2E5Z A;  2EPF A;  3CP8 A;  4EM0 B;  5GPC A;  4HX4 A;  2N8G A;  4BH9 A;  2HKO A;  5KHD A;  4GO1 A;  3KYD B;  4LG0 A;  2J5P A;  2EBI A;  1VQ9 I;  1K4T A;  5E1Z B;  1ZGJ A;  4IQ4 A;  3CMY A;  1YHQ I;  4AYB N;  1IV6 A;  1REP C;  4C2M J;  3OL3 A;  3WTZ A;  3G6E I;  1P4W A;  3E0J B;  1JI8 A;  2NVX J;  3BOQ A;  1RUO A;  2IGO A;  4N0B A;  2EIJ H;  3K70 C;  3WTT C;  3LSP A;  3FDY A;  1WI3 A;  4DQ2 A;  1FBQ A;  3G1L A;  4CCL A;  3GVA A;  3SXY A;  1PP8 F;  4U0W A;  2DOF A;  3VSL A;  2M8G X;  2LMD A;  5JHF A;  1RET A;  1HCR A;  5J4Y A;  2J5O A;  2DAO A;  5FKK A;  3T8R A;  4D0P A;  4I6Z A;  5FFZ A;  1SAU A;  3RPU A;  1TNS A;  2LBF A;  2VON A;  4P96 A;  1HDP A;  4ENN A;  2B63 J;  1U5T C;  3BP8 A;  3WU1 B;  1B8I A;  3PQJ A;  1Q1H A;  2K4B A;  5BQT A;  2EK5 A;  2HNH A;  1V5E A;  4CYD A;  4ZH4 F;  1BOB A;  3OYA A;  3IRQ A;  3QPH A;  4V19 K;  3C3W A;  2EIK H;  4O3M A;  5M5Y J;  1TNT A;  2K4J A;  5ICE A;  9ANT A;  1B4A A;  1YYV A;  2EV0 A;  3DXJ F;  3CCQ I;  2VC1 A;  1IN5 A;  3L9F A;  4S0H B;  1R23 A;  2V7F A;  3O8G A;  2HOS A;  3D0S A;  2VBX A;  1TWF J;  3K4B A;  3LQQ A;  2P8T A;  1WWX A;  3IH4 A;  5E1W A;  1OCP A;  4ABZ A;  2VXZ A;  4ON0 A;  2R7V A;  2LY1 A;  2O5R A;  4IVN A;  5DEQ A;  3WGG A;  3OS2 A;  3TED A;  4GYG A;  2WY7 Q;  1ZHF A;  3D5R C;  3HKZ A;  2QYO A;  5FFX A;  2O61 A;  2IBD A;  1N75 A;  2LY2 A;  2ID3 A;  2E1N A;  3A02 A;  4YFX F;  1ZRC A;  3DKX A;  4WXH A;  1IDY A;  1FMW A;  3OR1 C;  4YRV A;  1NG7 A;  3I71 A;  1U6G A;  3OR2 C;  2G7H A;  3BG6 A;  2M4G A;  4RA2 A;  5E3L A;  2B7E A;  4E4H A;  1MBH A;  1MDM A;  3RKW A;  1XSV A;  2XGX A;  1KQ0 A;  3RKQ A;  2DOE A;  4XLP F;  3RCO A;  3CDH A;  4KJZ A;  4JX6 A;  1FTZ A;  2YS9 A;  3RYP A;  4B44 A;  2ICW G;  1ZLK A;  3MFK A;  3MVP A;  1RES A;  3BQZ A;  3JRE A;  2M34 A;  2R7U A;  5E79 C;  4QPO A;  5E3O A;  5HDG A;  3KP7 A;  5KAI C;  1ETY A;  1L3L A;  4A3B J;  3W6V A;  1RKT A;  1V5F A;  1LJ9 A;  3VPR A;  2HKX A;  1I1S A;  4CCO A;  2VQL A;  2K7L A;  3DBH B;  1GDT A;  1BN5 A;  2OC6 A;  4IF4 A;  2EA2 A;  3I58 A;  2R3S A;  1U5T B;  2P4W A;  3OIP A;  2L02 A;  1Y0U A;  2DO7 A;  4UB6 C;  5FLM J;  2XDV A;  3PIO F;  3CUQ C;  2L0K A;  2Q2E B;  4BYY A;  3HHH A;  1AU7 A;  4UUS B;  4BAY A;  5EGO A;  1P92 A;  1HDD C;  3A2K A;  3OYN A;  2IRF G;  4KFC A;  2QBY A;  3H5A A;  1OR7 A;  2X6W A;  3QPL A;  1WH7 A;  2TDX A;  3OOU A;  3CUO A;  2GOM A;  2LLK A;  3OSF A;  2B0L A;  3CMA I;  2GLO A;  2IEK A;  2M5W A;  2KIS A;  4E7Z A;  4EEF G;  1WGX A;  1WCM J;  4XOR A;  3C2H A;  2CUJ A;  5LHG A;  3J7Y J;  5GAD J;  3HTS B;  3GTP J;  1RPW A;  3VOD A;  2JA2 A;  2UXN A;  5L3B A;  1T0F A;  3IKT A;  1XMX A;  2JPB A;  1VZ0 A;  2KJC A;  4C9Y A;  2FNP A;  1MGT A;  4K2E A;  4XON A;  1ZEL A;  3B02 A;  3GTM J;  3BDD A;  3DFG A;  1EV7 A;  2VXD A;  1XX5 A;  3CES A;  4HST A;  2MW8 A;  3E6D A;  3M9A A;  1YX5 A;  2A6H F;  3JSP A;  3G3Z A;  1D1B A;  1LE8 A;  1PVE A;  4H4K C;  4LOC A;  2CS3 A;  2OJE D;  2Z1D A;  4M3G A;  1F43 A;  2LC2 A;  2Q0O A;  4W1U A;  1USS A;  4IHW A;  2MD0 A;  4YIR X;  4UHT A;  3JRB A;  3T0Y A;  1LB2 A;  2MLK A;  4OU0 A;  2A5Y B;  3JR9 A;  1JHH A;  2OD5 A;  1YQA A;  4ENJ A;  2DMT A;  4JX5 A;  1IRG A;  3L00 A;  3F72 A;  3P9C A;  4DYQ A;  3CLQ A;  4F93 B;  4B4C A;  3LWF A;  4AD9 A;  1RRJ A;  5E17 F;  4MQV A;  4DIQ A;  4IL6 C;  3EUA A;  3B6A A;  1ON1 A;  5E8G A;  2XSJ C;  5ILU A;  3V8K A;  4BHC A;  4MGR A;  4A3M J;  5FKM A;  5F0C A;  2DA5 A;  3LA3 A;  2F6C A;  1GXQ A;  3WG9 A;  5JLW A;  3JRA A;  3CUQ B;  2JA6 J;  1BC7 C;  1T33 A;  3HJE A;  5HDK A;  3S3M A;  4XRF A;  1X1C A;  1AKH A;  4QIW N;  2V4J C;  3R0J A;  3I0T A;  2K86 A;  1MD0 A;  3HKZ N;  4CHU A;  1FTT A;  2R7W A;  1SFK A;  5LHH A;  3HHG A;  4CYC B;  2X1C A;  3GO5 A;  1FSH A;  1G3S A;  2HDW A;  4CH7 A;  4EGY A;  2OU2 A;  2X6Y A;  3FK7 A;  2PJP A;  1DP3 A;  4BAC A;  2M2E A;  2FEZ A;  3DPT A;  1ODD A;  1Q1V A;  2ZSI B;  2E34 A;  4BQN A;  4EV0 A;  4BXU A;  5FD6 A;  1B72 B;  1R36 A;  4D9J A;  1K7A A;  1R00 A;  2O03 A;  2WAE A;  2ZXI A;  1D1C A;  4JOM A;  2RNJ A;  3RJP A;  4UUT A;  3KYC B;  2RNG A;  5H6R A;  4B47 A;  3QOE A;  1I6X A;  4KA4 A;  3PO2 J;  1FBU A;  3H92 A;  2Q8K A;  1WJE A;  4UY8 I;  2DMN A;  2K9S A;  4XBF A;  4XQF A;  4FQG A;  3SZT A;  2ZJR F;  2XPV A;  3HIF A;  4KIB A;  2QQA A;  1MNM C;  3FXK A;  2JVG A;  3GFL A;  4RB0 A;  3IHU A;  3W6K B;  3IKV A;  2L54 A;  3QYF A;  4MO7 A;  1HKQ A;  2EIL H;  3FM5 A;  3GLL A;  4ZJZ A;  5IYC J;  1YRN A;  3SFI A;  2HZD A;  1DQU A;  1YTY A;  2K9M A;  4XR6 A;  2QSG X;  3MKZ A;  2IGK A;  1S6L A;  1R1V A;  3EQL F;  1GXP A;  3RI4 A;  4JYK A;  4D5F A;  2L9S A;  3H9J A;  3COA C;  3I3L A;  1AA7 A;  5HLI A;  4BEH B;  4ESB A;  2VE9 A;  2BZT A;  2IS6 A;  3HPH A;  2M0C A;  3QOP A;  4I02 A;  4MTE A;  1WJC A;  3JW4 A;  2CQX A;  2Y30 A;  3RZO J;  1IN6 A;  3A0B C;  4IJA A;  3FHZ A;  1QVT A;  2IGM A;  3LAJ A;  3GF2 A;  3I4M J;  2B9S A;  2K27 A;  3NWT A;  3OIO A;  4E7I A;  2HTJ A;  2IA1 A;  4HEA 2;  2WBM A;  1J09 A;  3D5L A;  4R1H A;  4LLN A;  4RB2 C;  4EJO A;  1IXS B;  2MH9 A;  5FD5 A;  4YII A;  4CZZ A;  4KT5 C;  1WVR A;  5L3G A;  2O7O A;  2ETH A;  4HF1 A;  2FA5 A;  4ENM A;  5FRM A;  1O3Q A;  3ROU A;  4DOZ A;  2R7Z J;  1QPI A;  3C7J A;  5K7H A;  2K3F A;  3HSR A;  3DU5 A;  5D6E A;  5IT3 A;  1P4X A;  2Y31 A;  4ZYD A;  1IUF A;  2COM A;  3CP2 A;  5EZG A;  5IT9 K;  2DDB A;  2ZME C;  5CYV A;  5BOX A;  2PX9 A;  2ZXJ A;  1ZGA A;  2O8X A;  4BKX A;  4E6K G;  1BW6 A;  1RNL A;  3DEU A;  5TRD A;  5C44 J;  2KFD A;  4ZZD A;  4GFB A;  2E36 A;  2FBH A;  4Y13 A;  2ZFW A;  3IUO A;  4JQF A;  2L3D A;  2EFP A;  5K1Y A;  1G3Y A;  4XN0 A;  2GXA A;  4Y15 A;  3ZMZ A;  3F22 A;  2XAQ A;  2W82 A;  4PJ0 C;  3GYH X;  2I8D A;  2DT7 B;  2V9V A;  2OQG A;  5BMZ A;  1XG1 A;  4DBR A;  2VOD A;  4HLX A;  5CQG A;  3KP4 A;  3U2R A;  2EZL A;  2XAS A;  2RC4 A;  2HXI A;  3HOT A;  3HOS A;  3REO A;  1HLV A;  2W57 A;  2R7R A;  1R49 A;  4WWC A;  3PM1 A;  1U3E M;  5D5U B;  2E35 A;  2DOA A;  2ZJ2 A;  2R7T A;  1SC7 A;  4YEL A;  2A6T A;  2AXL A;  3K10 A;  1Z6T A;  3CCY A;  2CJJ A;  2X1D A;  4DGW B;  2DMP A;  3CJR B;  4XM3 A;  5CKT A;  5FB2 A;  5F6F A;  1B9M A;  1MIJ A;  2Z16 A;  1ONV A;  2MGQ A;  4CDG A;  2NRA C;  4A5M A;  1R5G A;  3ZQ7 A;  2NOG A;  1FC3 A;  4D1Q A;  4IXA A;  2ZB9 A;  4CCM A;  1DU0 A;  2JTV A;  5DYM A;  1XMK A;  2BOL A;  1ZRF A;  2DT6 A;  3SEZ A;  3EUH C;  3BZ6 A;  1X1D A;  2EIM H;  2VBW A;  4IHY A;  5BNG A;  3H36 A;  4P9U A;  4QPQ A;  4XOP A;  1JKO C;  1F5T A;  1GV2 A;  3O2P E;  3ABU A;  1H8A C;  2COB A;  3I5U A;  4S05 A;  1SFO J;  1FNN A;  1VND A;  2X4H A;  2GM4 A;  2Y9Y A;  2Z2S B;  2ZME B;  1KU9 A;  2GWR A;  1U5T A;  2IA0 A;  3T1B A;  4B8X A;  3HUG B;  1RIO H;  1R5I D;  2Q2E A;  3CLO A;  2HQ5 A;  3ABL H;  5CVV A;  3SFZ A;  2GA2 A;  3BCA A;  2XUB A;  5KVR A;  2DA3 A;  4F52 A;  2L2O A;  1E3H A;  1WZ2 A;  2EZI A;  1D0X A;  1R4N B;  2KPM A;  4OAY A;  3WTU C;  1FOW A;  4WXD A;  4ZYH A;  1S5L C;  5B66 C;  4CXF A;  3PJR A;  3E6M A;  1B6A A;  3KZZ A;  5TIS C;  5FLX Z;  2ZJP F;  1FT9 A;  2VUM J;  4RM3 A;  2IJL A;  2BY3 A;  3DPL C;  3A0H C;  2KZG A;  2R5Y B;  1X2M A;  2V6C A;  3MKL A;  1K83 J;  2QSH X;  1S7O A;  2L9N A;  4KYW A;  3IC7 A;  4NBQ A;  5LHI A;  3I59 B;  2CW0 F;  2AXT C;  2HOA A;  3LA2 A;  4J01 A;  3KP3 A;  1Z1D A;  2LKX A;  2ADU A;  2FBK A;  2IGN A;  5M5X J;  2L4M A;  2FE3 A;  3S2D J;  2NS0 A;  2P5V A;  1WKM A;  2DFI A;  2CUF A;  3OIQ A;  2W84 A;  5ICF A;  1GV5 A;  1AHD P;  3K2Z A;  3HTU A;  4XRS G;  5FO5 A;  1ETK A;  1YI2 I;  1F4K A;  1IN4 A;  2CGP A;  1MMD A;  2BYV E;  3OSG A;  1A04 A;  2Y69 H;  1V55 H;  3KEQ A;  4BXX J;  1XCV A;  1YOV B;  4HF2 A;  5DCM A;  3I9V 2;  4QLC U;  3L2V A;  1BC8 C;  3L1P A;  5EYR A;  4GXO A;  5D4R A;  3OOP A;  3WTV C;  3ZRG A;  3R0A A;  2RQQ A;  3CC2 I;  1ETW A;  1JGG A;  2D2W A;  1JXS A;  2GZW A;  3Q3S A;  3DPU A;  5GAE J;  3FK6 A;  3PFY A;  4UXN A;  4PK4 A;  3MAJ A;  5FJ8 J;  3LFU A;  1JKR C;  2OZU A;  2QA4 I;  2DTZ A;  1MBJ A;  1O4X A;  3AG3 H;  3TQN A;  3L2C A;  1LVK A;  1VQN I;  3W2A A;  1XN7 A;  2OTL I;  2Y48 A;  4LJZ F;  1Z3Y A;  1E0E A;  1KQ9 A;  4EJV A;  4JP0 A;  2CUE A;  2E1M C;  4XLN F;  3OYI A;  5IYD J;  4HQE A;  3HSE A;  2K5C A;  3VEP A;  1FEX A;  1ZGW A;  3KP2 A;  2CSO A;  2IW5 A;  2JRM A;  2VJI A;  2XAG A;  1Z3X A;  3FKI J;  3I4P A;  1IZ1 A;  2EV5 A;  2LD5 A;  1N77 A;  4LIT A;  4G7Z F;  5F1J A;  2BBY A;  1S72 I;  1X3U A;  1VQ5 I;  3GTK J;  3RPQ A;  2M30 A;  4OAZ A;  2PN6 A;  4FE4 A;  1XDU A;  2CH0 A;  3ZQC A;  3PSI A;  5D4S A;  1KGS A;  3P7N A;  2NAZ A;  4ESF A;  5IYB J;  2JUC A;  4A3L J;  3K4M A;  1Z7L A;  1YJW I;  3IAM 2;  3MZH A;  3FXJ A;  4IQJ A;  5C4X J;  1BI0 A;  4CIC A;  2IAI A;  2ESH A;  3E3V A;  1C0W A;  2WA0 A;  5FKO A;  2BW3 A;  4F7Z A;  3WOD F;  4EAT A;  3RQ4 A;  4XL9 A;  3QYE A;  4L5J A;  4L18 B;  2HFH A;  2VQC A;  1POG A;  1LDJ A;  3BTC A;  4PJN A;  1HXD A;  4KMF A;  4HX8 A;  2XF6 A;  5GAH J;  3ZP5 A;  3BR3 A;  4HA8 A;  2ID6 A;  3FIS A;  3GME A;  1ULY A;  3G1O A;  4BHB A;  3GTO J;  2RV8 A;  4XLH A;  2DA2 A;  2EZK A;  4ZZL A;  4O6J A;  3A1Y A;  3QOD A;  3HOZ J;  4M72 A;  2CQK A;  4WCG A;  2XHK A;  4FAS D;  1YO5 C;  1DPR A;  2ZSH B;  3D5S C;  3U1K A;  3A01 B;  1IRX A;  2KT0 A;  5FLX K;  2CV2 A;  3K4C A;  2IS4 A;  3LMM A;  4XMY A;  1P7J A;  3BR5 A;  1ETQ A;  2YSR A;  2R7Q A;  5L3C A;  4U7D A;  2JA8 J;  4ZDP A;  2EIN H;  4B3A A;  5GAG J;  1SMY F;  2X1E A;  3OYC A;  2V1N A;  4PJL A;  2VJJ A;  1Z21 A;  3VYS B;  1ON2 A;  3IWZ A;  2CMP A;  5J3L A;  2DLL A;  2FU4 A;  2E1M B;  1IDZ A;  5J40 A;  1J5Y A;  4M9S A;  4X0G A;  3HL2 A;  1JKP C;  2LOO A;  1S29 A;  2LTP A;  2OUM A;  2ISZ A;  3WTX C;  3PNT A;  4L9J A;  3LFK A;  3HM5 A;  2FQ3 A;  3HSF A;  4RMN A;  2VOO A;  3AG2 H;  2VN2 A;  4IZZ A;  1J59 A;  1ZRD A;  1T2K A;  2IXS A;  3UR3 C;  4A12 A;  2JK3 A;  2MC4 A;  3SZP A;  1WH5 A;  2JA7 J;  2CU7 A;  3GTQ J;  3ZQG A;  3BQY A;  4RGR A;  5LGT A;  4MNU A;  2XRO A;  2XGD A;  1YX3 A;  1BOA A;  2VKD A;  2I10 A;  2OAZ A;  3Q0W A;  2XPW A;  3F9K A;  1RI7 A;  4BE2 A;  3W6J B;  4AVP A;  3KET A;  1PUF B;  2HOT A;  4LB5 A;  1I5Z A;  3HOY J;  1IV8 A;  4IHX A;  5TJJ A;  3K4N A;  1NK3 P;  2HVS A;  3RTR A;  1UFM A;  1JUP A;  1X1A A;  1D0Z A;  3PQK A;  4YEJ A;  2W48 A;  3HDD A;  2DQR A;  1D3Y A;  1XCB A;  3KLN A;  3DWL E;  5BPD A;  2EFW A;  5K5Q A;  3NEU A;  3V8L A;  4L9T A;  3TOB A;  5EG0 B;  4IHT A;  3UNG C;  2DYR H;  1DGW Y;  2BXY A;  3ASN H;  3R60 A;  1XTA A;  2BGC A;  1U0J A;  1K79 A;  3CMM A;  2V79 A;  4AC0 A;  3BZK A;  1BJA A;  3GTG J;  4HNT A;  3ZN0 A;  2VL8 A;  1DGR M;  2M3A A;  4PJM A;  5ICG A;  2F5V A;  1SD5 A;  1QPM A;  1WHU A;  3KP6 A;  1L0O C;  1XDS A;  3DQV C;  4A2U A;  2FOK A;  2E2J J;  1YFH A;  1ZKG A;  1N25 A;  4G12 A;  4A3D J;  1YIJ I;  4HBL A;  3PNY A;  1KYZ A;  1QA6 A;  2PBI A;  2ZXH A;  4RLQ A;  2ZNZ A;  1RUN A;  3BTI A;  4BJ6 C;  1LPQ A;  1M1E B;  4NC8 A;  3S15 J;  3F6O A;  4BE0 A;  1R22 A;  3I53 A;  5A2Q K;  2VAS A;  2M9H A;  4UV8 A;  5E20 A;  3W2W A;  1EKE A;  4DZP A;  4CZC A;  5GTI C;  2EZH A;  3TP0 A;  2CFX A;  3F6V A;  2GOX B;  1LDK B;  2A61 A;  1DPU A;  1SEU A;  2BY1 A;  1BA5 A;  2E19 A;  1IRZ A;  5AIP A;  3G73 A;  3CCJ I;  4KN7 X;  3TL4 X;  4HNU A;  3I54 A;  2WWY A;  1FOY A;  3HRM A;  4XK4 A;  5D5V B;  3S1Q J;  3LSR A;  3L2R A;  3KP5 A;  2Z99 A;  1BIB A;  2E71 A;  3VDX A;  2L7M P;  1QHG A;  1H9T A;  2OF7 A;  1TQP A;  3HUG A;  1TL8 A;  3OS0 A;  1G4D A;  1PUE E;  5C3E J;  2PI0 A;  1UAA A;  3EPZ A;  4XRS A;  5F27 A;  4P9F A;  5ICC A;  2XAU A;  3DP7 A;  1U9O A;  2NXN B;  2RN7 A;  2JN6 A;  1IC8 A;  3F8F A;  2QKL B;  4HOB A;  5H2F C;  3RYR A;  4E7K A;  4M6Y A;  4QWQ A;  5F08 A;  4HF0 A;  4BHP A;  2VQG A;  4MIM A;  2R5Y A;  1QRY A;  3BPV A;  3LSI A;  1MW7 A;  2Y0M A;  1W7P D;  2DDA A;  4Y3O A;  2DK5 A;  3QP5 A;  4FCY A;  4G7O F;  4NQW A;  2DU9 A;  4KMU X;  3HBL A;  1XC5 A;  1GVJ A;  3MQ0 A;  3ZXS A;  3ML6 A;  1GVD A;  3VFZ A;  1ETO A;  4B1R A;  3LOC A;  4Y17 A;  1CF7 B;  1D8K A;  1Y6I A;  2QF7 A;  4M73 A;  4BY1 J;  2DTR A;  5IT9 Z;  4X6A J;  1ZRE A;  3OS1 A;  2EV6 A;  1G8X A;  3VYT B;  4CCK A;  2IVM A;  2QSF X;  2R5Z B;  4MHG A;  4Y7N J;  1Z6R A;  2AQF A;  5GPA A;  3IP4 B;  1WJ5 A;  5HNH A;  4M6X A;  5J1R A;  3GFI A;  2L4A A;  4NDL A;  4PGH A;  5HVQ C;  2PMU A;  2MLG A;  1MJB A;  2OTJ I;  1SFE A;  3EUH A;  1HF0 A;  4NHJ A;  3TDU C;  1VQ6 I;  1ETV A;  4ANJ A;  2H27 A;  3ZMD A;  4LIU A;  3VB2 A;  3ZMT A;  4LB6 B;  3H3Z A;  5E18 F;  2A05 A;  3S3O A;  1JT6 A;  3I4N J;  5CJ9 A;  2A3S A;  5L3E A;  3RPU D;  4QTR A;  4RAF A;  2XPU A;  2QQ9 A;  2ME6 A;  3KFW X;  3BG9 A;  4D7N A;  3BRO A;  1K61 A;  5JR3 A;  1JKQ C;  3FXR A;  2EFN A;  2L01 A;  4KIS A;  3HRS A;  3QPS A;  1ENH A;  2VI6 A;  4BE1 A;  3ZQH A;  2L7Z A;  5C4J J;  2WB1 A;  4F3Q A;  5D8K B;  4ZTF A;  1TW2 A;  2OBP A;  2X9D A;  1UB9 A;  3ABK H;  2M7A A;  1YW9 A;  4XN3 A;  3BR2 A;  3F21 A;  1D1A A;  3VSK A;  1YG2 A;  3K6G A;  2VBY A;  4EJT A;  4DYR A;  5EEH A;  2GXG A;  2LY9 A;  2KRF A;  3D1N I;  3DU6 A;  4EJW A;  2E5N A;  1TQM A;  3LA7 A;  5IOY A;  3MMY B;  1ZN2 A;  3NAU A;  4I0A A;  1PYV A;  1STZ A;  2F4I A;  4RAG A;  4RM2 A;  3CF2 A;  3TOA A;  3OYK A;  5DV5 A;  1K78 B;  2DCE A;  3V7S A;  1SAN A;  2F5E A;  4ETS A;  1VQM I;  4J00 A;  4CA0 A;  1LQ1 A;  1X19 A;  1FLI A;  1Y56 A;  1B59 A;  3K1M A;  1SD7 A;  2QEX I;  3SJM A;  4LFU A;  2HEO A;  2XAF A;  1A5J A;  4X1E A;  4MFE A;  5DCF A;  2TRT A;  4U87 A;  4L0Y B;  2MD5 A;  2MYS A;  2JT1 A;  4HX7 A;  2ZO4 A;  5DD8 A;  1OJL A;  3W2V A;  3HOU J;  3HOW J;  4PUS A;  2L7F P;  3KEY A;  3GFM A;  2ZXW H;  1IG7 A;  3U1D A;  1EJ9 A;  1YJ9 I;  3W3C A;  2F5D A;  1B1B A;  4BJ5 C;  3K1P A;  2IS1 A;  2O3F A;  3QQA A;  2VLA A;  4UVC A;  3MD2 A;  2HYG D;  2XGC A;  4MQ9 F;  2KDO A;  4G6D A;  5DTD A;  2AHQ A;  3M07 A;  1WJA A;  2ZC2 A;  3FHN A;  2R93 J;  3U21 A;  1GT0 C;  1W7P B;  1FY7 A;  4V2F A;  2KDZ A;  1YS6 A;  4G8X A;  3TW7 A;  4OIR F;  2RQP A;  5B1A H;  3KLO A;  1RR8 C;  4OIP F;  3K7A J;  2DA1 A;  4M6V A;  2VT2 A;  2RRE A;  2Y75 A;  1FIA A;  2GAU A;  3Q9V A;  3R4K A;  5TGT A;  3V8J A;  1G6N A;  2R7X A;  1MMG A;  1WSU A;  4A0Y A;  1XPX A;  2CQQ A;  1YE9 A;  2BVL A;  2VB6 A;  2KQR A;  1HSJ A;  3WGI A;  4LG0 B;  2WV1 A;  2VBZ A;  5EDN A;  1S9H A;  2ISY A;  1LDD A;  3AKZ A;  3S1N J;  2DN0 A;  4CUG A;  1R6R A;  4PZJ A;  1A36 A;  1IN7 A;  4UVA A;  2F48 A;  1F36 A;  2IP2 A;  5M3F J;  4CCN A;  2L7K A;  3LSH A;  1W5C C;  3BJ6 A;  2F4M B;  1WPK A;  5IOZ A;  2CQN A;  5L3F A;  1WRJ A;  3VYU B;  1QU3 A;  2RGV A;  4BQO A;  3DTK A;  1TWC J;  1SD4 A;  3E5Q A;  2D1V A;  4EM2 A;  3S1R J;  2STW A;  5DUK A;  1EH7 A;  4RB3 C;  2EWN A;  2LBF B;  1Y8R B;  1KZH A;  4EMS A;  1FZP B;  4BUP A;  1B8I B;  1MBE A;  1KYW A;  1S8N A;  2R0Q C;  2QQB A;  3J7A Y;  4ZC3 A;  2DQL A;  2HWV A;  2QZ8 A;  2X0L A;  3WG7 H;  2C6Y A;  3PSF A;  1I3Q J;  4BBS J;  1MZB A;  5D5X B;  2HOE A;  2R7F A;  1JTX A;  1P9Q C;  3BR0 A;  2YU9 J;  2P6S A;  1OR7 C;  4J19 A;  2CRG A;  5LEK A;  3CCV I;  3TKY A;  3RQI A;  1ZR4 A;  1TP4 A;  1VQO I;  1CGP A;  1E2X A;  4BNC A;  3GLX A;  4RB1 A;  2JA5 J;  3SZG A;  1E3P A;  3GCM A;  2GA1 A;  4S04 A;  3OL4 A;  1QZE A;  2KP6 A;  2W85 A;  4DYC A;  4L5I A;  2M4K A;  3DV8 A;  2YX4 A;  3ZGK A;  5CVI A;  2WB1 N;  3PIP F;  2HDD A;  3V7C A;  4XSX F;  3S93 A;  1ERD A;  3DTE A;  2FQ4 A;  1T0F C;  5HOD A;  1OPC A;  3HGY A;  3FMR A;  1D5Y A;  2IS2 A;  4C3H J;  1X4O A;  1QO0 D;  3TO6 A;  2H8R A;  4LK1 F;  1S3J A;  2PQ8 A;  4IRI A;  4JX4 A;  4DNC A;  1MDM B;  1MNE A;  1X3Z B;  2XB0 X;  4KT6 A;  2DA7 A;  4C3I J;  3GX4 X;  3LNQ A;  2JVH A;  5HS9 A;  5FRN A;  2XKO A;  3H9Q A;  1QHH D;  3DKW A;  3M7G A;  3KYL A;  1OCO H;  1QGP A;  2FNA A;  1IRF A;  1TZL A;  3ESW B;  3V4G A;  1TBX A;  2VKH A;  2M7B A;  3QRF F;  5E1X A;  3WU0 A;  1R58 A;  5M3M J;  2ELJ A;  3BT9 A;  4N4N B;  4P55 A;  3QU6 A;  3EYI A;  1F1Z A;  2BEO A;  1MH4 A;  2GIZ A;  4UUS A;  1ACI A;  3EUK L;  2NNY A;  1AWC A;  3OYB A;  2XAH A;  4IHS A;  5DDG A;  1K4S A;  5FLV A;  2XF7 A;  4WX9 A;  1NH3 A;  4BBR J;  4BDZ A;  1G2H A;  4C3J J;  1MKM A;  4L9V A;  4BDY A;  1R7J A;  2AO9 A;  5EGO B;  4Q5S F;  3J7A O;  3WE3 A;  4B43 A;  4BJT A;  2ELK A;  3DBL B;  3TGN A;  2QBY B;  1PDN C;  1IW7 F;  1MBG A;  2FMY A;  4IKF A;  4ZYE A;  4OMZ A;  2NVU B;  5J1Y A;  3GWZ A;  2L5Q A;  4RGX A;  4D5C A;  1VTN C;  4FT8 A;  1IGN A;  3KCC A;  3K4J A;  4XLC A;  4QSH A;  5HS7 A;  3J81 Z;  2ELH A;  2EA4 A;  3VYR B;  4XOT A;  3LQR A;  2HTS A;  3OMY A;  2L9R A;  4AYB A;  4E7L A;  5L3D A;  2VPR A;  3PO3 J;  2V1U A;  4M9X A;  4AM3 A;  1VF9 A;  1PP7 U;  4A3C J;  2NS8 A;  2OCE A;  1XGS A;  2DW4 A;  4L9N A;  4M3E A;  3ZCO A;  4G94 A;  3BJA A;  3TMO A;  1H88 C;  2HS5 A;  3RKX A;  1O3R A;  3O6B B;  2K9L A;  1LE8 B;  2HGC A;  2XB5 A;  5BPI A;  4LD5 A;  1UG0 A;  2H1L A;  5B5E C;  2KIF A;  2DI3 A;  3FIW A;  2K40 A;  1ZG3 A;  5FGM A;  2NVT J;  1UG2 A;  2ACJ A;  3ULQ B;  2CW7 A;  5HS8 A;  1D8J A;  1TWH J;  1G3T A;  2RAE A;  4M74 A;  1TQI A;  2PG4 A;  1K6O A;  3C2B A;  2Y0S A;  3TP3 A;  3ABM H;  3CUQ A;  4D7M A;  4A3K J;  2LF7 A;  1O7L A;  1XSD A;  1P7I A;  2RVC A;  2YPR A;  5CVR A;  2KLO A;  2DFF A;  3BR6 A;  3IWF A;  2ECB A;  3L2U A;  1Z0X A;  3SHF A;  2PMZ A;  1W36 D;  3CCR I;  2XSD C;  1T08 B;  2UV1 A;  1OYY A;  2WTE A;  2JUG A;  2ZNY A;  1Y1W J;  4HV6 A;  4CYC A;  3KEO A;  4II2 A;  4M9Z A;  4Y4R A;  4CCJ A;  1NHA A;  2P81 A;  3G1M A;  3LSG A;  3OYE A;  3X2Q H;  3JSO A;  5LD2 C;  5CVU A;  4PSW A;  3CDL A;  2BXZ A;  3E5X A;  5CLS A;  3OYH A;  2IA2 A;  3F8B A;  3U9G A;  4A0Z A;  2D45 A;  1ITY A;  4WF2 A;  2DJN A;  2BVM A;  3PNV A;  1APL C;  1Z67 A;  2CQ7 A;  3HC7 A;  2BV6 A;  4NNJ A;  2ME0 A;  5A2Q Z;  3WTW C;  2P5L C;  1B72 A;  1Y8Q B;  5J47 A;  2VKE A;  1RR7 A;  2A69 F;  5IP6 A;  4B3X A;  1JJ6 C;  1Z9C A;  3LAP A;  5K7F A;  1T39 A;  2NYX A;  4L0Z B;  2DMU A;  1X1P A;  2QEN A;  1HST A;  5F0F A;  3KX2 A;  2XC7 A;  1ZAO A;  3PL8 A;  1XSX A;  1ZTR A;  2MG4 A;  4LLG F;  2DMQ A;  1V4R A;  3HRU A;  1I39 A;  1X2N A;  2WAF A;  4BXF A;  5M5W J;  1W36 C;  1A6I A;  4IRH A;  1JJ8 C;  5IP9 J;  5LFA A;  3GEZ A;  5HLH A;  2QLZ A;  1WFX A;  2Y2Z A;  1SVM A;  1LKX A;  4A3G J;  1WQ2 A;  3RKY A;  2X85 A;  1FSE A;  3K9T A;  1FYL A;  4UV9 A;  4UVB A;  1U2W A;  3C1D A;  2V9P A;  2CWE A;  4IX7 A;  1FBS A;  5JHU A;  3WTS C;  4BEH A;  3M1E A;  4C2U A;  3QYB A;  3V42 A;  1E3O C;  1X4P A;  4CSW A;  2MC3 A;  2HPM A;  1YRN B;  2A6E F;  3I56 I;  2OV7 A;  2JSP A;  2QVO A;  5DUI A;  4I99 C;  2FRH A;  3OYL A;  4FE7 A;  3Q9S A;  4E70 A;  1T38 A;  4BQA A;  3F0C A;  4YIF A;  4KN4 X;  4IOC F;  4HZF A;  5LGU A;  2VJ4 A;  3DBR B;  3J81 K;  5CVJ A;  3L09 A;  1J2X A;  1ZLJ A;  4RGU A;  1FX7 A;  2KIM A;  5J8C A;  4XSZ F;  2GBY A;  3H3U A;  3CCE I;  4E7H A;  3MCZ A;  2LH9 A;  3GTJ J;  4BL0 B;  3GZN B;  5JVT A;  4I76 A;  1J75 A;  3JRC A;  2BHY A;  4A3F J;  1BI3 A;  2H6B A;  2V6E A;  4XRM A;  1A6Q A;  5F64 A;  1Z77 A;  2LDU A;  4LG3 A;  3OYM A;  2TCT A;  4MTD A;  1W5T A;  3C2G A;  3K2A A;  1EA3 A;  4GCV A;  3FMS A;  2E60 A;  1MSE C;  2KL4 A;  5E3N A;  1H89 C;  2UWM A;  2JQ7 A;  2FJ1 A;  2RKH A;  2X51 A;  2E2I J;  4FX4 A;  2M1B A;  5FKN A;  2FXA A;  1QQI A;  3J80 Z;  1IXC A;  5FKL A;  1UMQ A;  1SFU A;  2V1X A;  1R4M B;  1XGO A;  2VE8 A;  2JZY A;  3ERM A;  4LK0 F;  1GUU A;  1ZR2 A;  2CO5 A;  5HDN A;  4BQQ A;  3S8P A;  2CUZ A;  4Q4Z F;  4KDP A;  4R8H A;  4F92 B;  4RLF A;  1OIS A;  3QU3 A;  4KIT B;  1P4A A;  2DPU A;  4CGZ A;  3AL0 C;  3L7W A;  2HVQ A;  2MH2 A;  2OZ6 A;  2WY8 Q;  3N4M A;  2Y0S N;  5LLQ A;  5GP9 A;  3SDG A;  1VQ8 I;  3ZQQ A;  5B3S H;  4H0E A;  6PAX A;  2PMZ N;  3LST A;  2R7D A;  4XLE A;  3H5N A;  1GLN A;  3CCL I;  1TTY A;  1XMA A;  3FXQ A;  3DTI A;  1NG6 A;  1KON A;  5ILS A;  4LLL A;  3NRV A;  3M8J A;  1QVU A;  2CG4 A;  4I09 A;  1RC9 A;  5EF6 A;  1YJN I;  4M71 A;  2ECC A;  3KE2 A;  3PUB A;  5ILV A;  4A6D A;  3T8T A;  1BW5 A;  3V7R A;  4AIJ A;  3IRR A;  4PDK A;  5JI6 A;  1Z7U A;  4G6Q A;  3FXU A;  2QWW A;  3BY6 A;  3IV5 A;  3EDP A;  4XKB A;  1EH8 A;  2K85 A;  3IL2 A;  4HV5 A;  1MMN A;  1WJF A;  3CJN A;  4KUM A;  3FKJ A;  4Q47 A;  3L2W A;  1I3A A;  2ZCW A;  1G59 A;  2KRC A;  3E5U A;  4E7J A;  1AOY A;  1OMI A;  1HW2 A;  2LKS A;  4DZJ A;  4I01 A;  3BPX A;  1XGM A;  4AWX B;  1I50 J;  3NAR A;  1OYI A;  5AIQ A;  3CCU I;  4PFO A;  2P0W A;  2HQA A;  2ZME A;  4RGS A;  2CV0 A;  3OYG A;  3N05 A;  4ITV A;  1VQL I;  2LF8 A;  3BR1 A;  3KZI C;  4L5E A;  4DBQ A;  4P1W A;  2A5W A;  1OCR H;  3GW2 A;  1W0T A;  2BE5 F;  1I1G A;  2EFQ A;  4ZDO A;  3N97 A;  4LGW A;  2OA4 A;  1OLT A;  1TLH B;  3S32 A;  2PLY A;  3RIR A;  3VOE A;  2O0Y A;  2W25 A;  3G2B A;  1R1U A;  1MBK A;  2HR3 A;  3IH3 A;  1VQP I;  5ERI A;  4V2G A;  2Y9Z A;  3DKY A;  1VQK I;  1D0Y A;  5HNF A;  2I5U A;  3GBG A;  5F04 A;  3ZN1 A;  1VFC A;  1XB4 A;  3ASO H;  2FUG 2;  3AL0 B;  5LEJ A;  3E6C C;  3I59 A;  4BS9 A;  2HI3 A;  3K0L A;  1MMA A;  1T8I A;  4KNY A;  1SMT A;  1FIP A;  1N78 A;  4OWR B;  1HKT A;  4HW0 A;  2DJI A;  1RKW A;  1VQ4 I;  4JK1 X;  2GXB A;  1G3W A;  3LSM A;  3ERE D;  3FXM A;  3KIO A;  3K69 A;  1ZK8 A;  2W4S A;  4FHT A;  4A93 J;  1JUM A;  3HPG A;  3M8E A;  1UHW A;  3JRD A;  4GDF A;  2XV4 S;  2LG4 A;  1HC8 A;  1UEL B;  3CO7 C;  1U8B A;  3WGH A;  3A4C A;  4HG2 A;  3MZY A;  2V1D A;  3MN2 A;  4XNF A;  4TV7 A;  3DCF A;  4Q48 A;  1FP1 D;  4KIC A;  4ZDL A;  4AIK A;  2M45 A;  3HZJ A;  3Q0V A;  4BU2 A;  2H6C A;  3F8N A;  4JBA A;  4I2O A;  3ONQ A;  1J7K A;  3ISP A;  1IXR C;  3Q0U A;  3E1S A;  5DCM B;  3CZ6 A;  1WJD A;  3C18 A;  1K6Y A;  1JE8 A;  1GHC A;  3CQZ J;  2CFO A;  3HRT A;  4B09 A;  3A03 A;  1FOK A;  2WAQ A;  3LL7 A;  1FPQ A;  1FYK A;  3B6C A;  3HB9 A;  2LKP A;  3J80 K;  4EGZ A;  1LVA A;  2LSO A;  1J9I A;  2E2H J;  2PFB A;  1TW3 A;  1IO2 A;  5LBQ A;  2FOW A;  3HG9 A;  3E6B A;  1S7E A;  2UXX A;  4PGG A;  1H0M A;  2WAD A;  1DDN A;  1V54 H;  2MBF A;  3F23 A;  3MEX A;  4GYI A;  3JTH A;  3FXL A;  3WTY C;  4A3E J;  3OWT A;  3BTL A;  1UJ8 A;  3M1C A;  2BY2 A;  4A6E A;  3S2H J;  1MJ9 A;  1Z91 A;  3PUF A;  4N4O B;  2EJR A;  2K9Q A;  4G7H F;  3JCU C;  3P9K A;  1ZYR F;  4F55 A;  4HDU A;  2CV1 A;  1NTC A;  3WU2 C;  1DP7 P;  4HLY A;  1BM9 A;  2HPI A;  2WC2 A;  3S16 J;  3CJT B;  3F3X A;  4MFD A;  2PEX A;  2V26 A;  1HW1 A;  4XKV A;  3SEQ A;  3B73 A;  2X48 A;  5KNL A;  1BR2 A;  3FX3 A;  1TT0 A;  4N9I A;  3OYF A;  2W1O A;  1X58 A;  1XD7 A;  5JFR A;  2EFO A;  1HW5 A;  4LMY A;  3MKY B;  1CQT A;  2AQE A;  5CQE A;  2QKM B;  3JRH A;  1TC3 C;  2V9K A;  1A31 A;  2XRL A;  3I64 A;  2JMW A;  1B9N A;  1ZQ3 P;  3BZC A;  2OQR A;  3OV8 A;  5J8F A;  4DJA A;  3ZMU A;  3SDB A;  3H35 A;  5B1B H;  1XS9 A;  4A69 C;  3R6S A;  4IO9 F;  2QGU A;  3OYD A;  3F8M A;  2HQN A;  4G9Y A;  3KPH A;  1KQ8 A;  1KU3 A;  2PJR B;  3GXO A;  1MND A;  1H9G A;  2BW3 B;  2O8K A;  3G4S I;  5EZH A;  4RS8 A;  1BJZ A;  1PJR A;  1V5G A;  3H5R A;  2GIV A;  3QWL A;  2FML A;  5HOO A;  2LYC A;  3CC4 I;  3PFI A;  4I98 B;  3CME I;  2CYY A;  3ELK A;  2M0M A;  5K5R A;  5CPR B;  1QBJ A;  2KJB A;  3GFJ A;  4U88 A;  3A01 A;  2VIX A;  3M3Y J;  4ZTJ A;  3FBN B;  3SQN A;  1BIA A;  3TO7 A;  3RDI A;  2DT5 A;  1OFC X;  1A35 A;  4NC7 A;  1ZG1 A;  5E8I A;  1LFP A;  1W4M A;  1BR4 A;  2MSY A;  3CTA A;  5JLX A;  3WHB A;  3WHC A;  2O6G E;  2NNN A;  5H20 A;  4OMY A;  1O7F A;  3AG1 H;  2OPT A;  3GUD A;  3R61 A;  1YIO A;  2KMU A;  3G71 I;  2DYS H;  3ZQI A;  1BI2 A;  4ZYG A;  3JRI A;  4ESJ A;  1EH6 A;  3FMQ A;  4RAZ A;  2KIQ A;  4UB8 C;  4U7B A;  3HXL A;  1YLF A;  2M8E A;  4IRG A;  4A5N A;  3CF5 F;  2LK2 A;  2XKP A;  5D5W B;  1SVO A;  3BWG A;  2QM3 A;  2G0E A;  1ZAR A;  1W1W E;  1IF1 A;  3M4O J;  5D8L B;  3QPT A;  1JUS A;  2JPC A;  3DLA A;  2HXO A;  4BGD A;  2NOJ B;  3LSJ A;  3FZV A;  2K02 A;  3OY9 A;  4HDV A;  1JHF A;  3GZ6 A;  4HRI A;  2WV0 A;  5F0H A;  2ZBK A;  4FET A;  4IHV A;  2KRH A;  3EYY A;  1PUF A;  3S3N A;  1YIT I;  5IY5 H;  4RBO A;  3L2Q A;  2WAQ N;  4UNO A;  5LGN A;  1DU6 A;  1HQC A;  1LEA A;  3NWS A;  3JTG A;  2ZJQ F;  2KHM A;  3H1C A;  1FYM A;  5EEG A;  5GTH C;  2XGE A;  1OCC H;  1LUJ B; 
#chains in the Genus database with same CATH homology
 2P7C B;  4I7H A;  2DK8 A;  1IAW A;  2KKO A;  4GGG A;  2KIU A;  1R1T A;  2F5F A;  1XGN A;  1O3S A;  4KIF A;  1WI9 A;  2HDC A;  2VT3 A;  3F8C A;  3FM3 A;  4Z2Y A;  2FBI A;  1V3F A;  3HYI A;  4YG2 F;  4OIQ F;  2ZKZ A;  4YFN F;  1BBY A;  2M87 A;  4U0V A;  1E17 A;  2XRN A;  1IN8 A;  2XVC A;  4NB5 A;  2QUF A;  1SFX A;  2A07 F;  4CO8 A;  2Z5U A;  4OIO F;  3NQO A;  5LRR A;  1W5S A;  1RZ4 A;  3M8F A;  4O5V A;  4I0B A;  2YU3 A;  4EQQ A;  4KIG A;  5LRS A;  1LEB A;  3JAM Z;  2F2E A;  1KU7 A;  2A68 F;  2F5C A;  1UCR A;  4EVI A;  1I27 A;  4U0Y A;  3ZMV A;  1O57 A;  1QZY A;  1T98 A;  2W24 A;  2UZK A;  3WE2 A;  2JSC A;  2GQQ A;  3CO6 C;  1SD6 A;  1F9N A;  3ABT A;  2P5K A;  4YFK F;  1LNW A;  1OYW A;  1BI1 A;  3BJO A;  2H94 A;  4WXC A;  1O3T A;  5HLG A;  3DF8 A;  1QNT A;  4PCQ A;  1QZZ A;  2ESN A;  5J6X A;  2HQR A;  4IPA A;  3ECO A;  1U78 A;  1CF7 A;  2P6T A;  2HYF A;  4HYE A;  2FF4 A;  3FWE A;  2PMH A;  3ZMS A;  3P9I A;  1T6S A;  1DUX C;  1P6R A;  4HAM A;  1HBX G;  1OKR A;  1UHM A;  5F1R A;  3K1N A;  3Q5F A;  2D1H A;  4HQM A;  3S2W A;  4OIN F;  4EM1 A;  4MEX F;  1YW7 A;  4RAY A;  3EET A;  1SAX A;  2IT0 A;  2H09 A;  5DD4 A;  5AON A;  2Z33 A;  1R5H A;  2E7X A;  3AAF A;  4OOI A;  3QAH A;  5BS6 A;  1J0R A;  2G9W A;  1JGS A;  2IPQ X;  4P5O A;  2DBB A;  3TO9 A;  1U8R A;  4N9H A;  2LNB A;  1D5V A;  4A0X A;  4AIH A;  2RDP A;  2FSW A;  2VOP A;  5D6F A;  1FP2 A;  4FX0 A;  3MWM A;  5K5O A;  1P2F A;  1YS7 A;  3FF5 A;  2P7V B;  2MA3 A;  4R79 A;  5ED4 A;  5H6Q A;  2YR2 A;  3E97 A;  2DPD A;  2VC0 A;  3T5X A;  1K78 A;  3O3K A;  2XIG A;  3GZ5 A;  4ENK A;  1MJA A;  1YW8 A;  3ZPL A;  1ZG5 A;  1Z05 A;  2E1C A;  5KK1 A;  2AS5 F;  1KU2 A;  4WK8 F;  1HKS A;  2XAJ A;  2EB7 A;  2Z3Y A;  3TDZ C;  3QP6 A;  2YX7 A;  3JAM K;  1KA8 A;  2HZT A;  3ECH A;  1FWZ A;  2E7W A;  2JRT A;  4ASN A;  4UUV A;  2G7U A;  2STT A;  1ZH5 A;  4EJU A;  1IUY A;  3KZY A;  4MEY F;  1S7A A;  1UST A;  1W7P A;  2Z9O A;  4EM0 B;  4HX4 A;  4BH9 A;  2HKO A;  4GO1 A;  4LG0 A;  2J5P A;  5E1Z B;  1ZGJ A;  1REP C;  3WTZ A;  1P4W A;  3BOQ A;  1RUO A;  4N0B A;  3WTT C;  4DQ2 A;  1FBQ A;  3GVA A;  3SXY A;  1PP8 F;  4U0W A;  2J5O A;  2DAO A;  3T8R A;  4D0P A;  5FFZ A;  3RPU A;  1TNS A;  2VON A;  4P96 A;  4ENN A;  1U5T C;  3BP8 A;  3WU1 B;  3PQJ A;  1Q1H A;  2K4B A;  5BQT A;  2EK5 A;  4CYD A;  4ZH4 F;  3IRQ A;  3QPH A;  3C3W A;  4O3M A;  1TNT A;  2K4J A;  5ICE A;  1B4A A;  1YYV A;  2EV0 A;  3DXJ F;  2VC1 A;  1IN5 A;  3L9F A;  1R23 A;  3D0S A;  2VBX A;  3LQQ A;  2P8T A;  1WWX A;  5E1W A;  2VXZ A;  4ON0 A;  5DEQ A;  3WGG A;  4IVN A;  4GYG A;  1ZHF A;  2QYO A;  5FFX A;  2O61 A;  2E1N A;  4YFX F;  1ZRC A;  4WXH A;  3I71 A;  1U6G A;  2G7H A;  1MDM A;  3RKW A;  1XSV A;  2XGX A;  1KQ0 A;  4XLP F;  3CDH A;  3RYP A;  1ZLK A;  3MFK A;  5HDG A;  3KP7 A;  1L3L A;  1LJ9 A;  2HKX A;  1I1S A;  2K7L A;  1BN5 A;  4IF4 A;  2EA2 A;  3I58 A;  2R3S A;  1U5T B;  2P4W A;  2L02 A;  1Y0U A;  2DO7 A;  3CUQ C;  4BYY A;  3HHH A;  4BAY A;  1P92 A;  2IRF G;  4KFC A;  2QBY A;  1OR7 A;  2TDX A;  3CUO A;  2B0L A;  2M5W A;  5LHG A;  3HTS B;  3VOD A;  2UXN A;  5L3B A;  1T0F A;  3IKT A;  2JPB A;  2KJC A;  2FNP A;  1MGT A;  4K2E A;  3B02 A;  3BDD A;  3DFG A;  1EV7 A;  3E6D A;  3M9A A;  2A6H F;  3JSP A;  3G3Z A;  2Q0O A;  1USS A;  4UHT A;  3T0Y A;  1LB2 A;  2MLK A;  4OU0 A;  2A5Y B;  1JHH A;  2OD5 A;  1YQA A;  4ENJ A;  1IRG A;  3L00 A;  3F72 A;  3P9C A;  5E17 F;  3LWF A;  4AD9 A;  4MQV A;  1ON1 A;  5E8G A;  5ILU A;  3V8K A;  4BHC A;  4MGR A;  3LA3 A;  3WG9 A;  1GXQ A;  3CUQ B;  1BC7 C;  5HDK A;  4XRF A;  3R0J A;  3I0T A;  2K86 A;  1MD0 A;  4CHU A;  5LHH A;  3HHG A;  3GO5 A;  1FSH A;  1G3S A;  4EGY A;  2OU2 A;  2PJP A;  2FEZ A;  3DPT A;  1ODD A;  4EV0 A;  4BXU A;  5FD6 A;  1R36 A;  1K7A A;  1R00 A;  2O03 A;  2RNJ A;  3RJP A;  5H6R A;  1I6X A;  4KA4 A;  1FBU A;  3H92 A;  2Q8K A;  4XBF A;  3SZT A;  3HIF A;  4KIB A;  2QQA A;  3GFL A;  4RB0 A;  3IHU A;  3W6K B;  3IKV A;  2L54 A;  1HKQ A;  3FM5 A;  1YTY A;  1S6L A;  1R1V A;  3EQL F;  1GXP A;  3RI4 A;  3COA C;  4ESB A;  5HLI A;  2VE9 A;  4I02 A;  3QOP A;  4MTE A;  3JW4 A;  1IN6 A;  4IJA A;  3FHZ A;  3LAJ A;  3GF2 A;  2K27 A;  2HTJ A;  2IA1 A;  3D5L A;  4R1H A;  4LLN A;  4RB2 C;  4EJO A;  1IXS B;  2MH9 A;  5FD5 A;  4YII A;  4CZZ A;  4KT5 C;  5L3G A;  2ETH A;  4HF1 A;  2FA5 A;  4ENM A;  1O3Q A;  3ROU A;  3C7J A;  3HSR A;  5D6E A;  5IT3 A;  1P4X A;  4ZYD A;  2COM A;  5IT9 K;  5CYV A;  5BOX A;  2ZXJ A;  1ZGA A;  2O8X A;  1RNL A;  3DEU A;  5TRD A;  4ZZD A;  2FBH A;  4Y13 A;  2ZFW A;  4JQF A;  2L3D A;  2EFP A;  5K1Y A;  1G3Y A;  4Y15 A;  3ZMZ A;  3F22 A;  2XAQ A;  3GYH X;  2V9V A;  2VOD A;  2OQG A;  5BMZ A;  4HLX A;  3KP4 A;  3U2R A;  2XAS A;  2RC4 A;  3HOT A;  3HOS A;  3REO A;  2W57 A;  4WWC A;  1U3E M;  5D5U B;  2ZJ2 A;  2AXL A;  1Z6T A;  5FB2 A;  5F6F A;  1B9M A;  1ONV A;  4CDG A;  2NRA C;  4A5M A;  1R5G A;  3ZQ7 A;  1FC3 A;  4IXA A;  2JTV A;  5DYM A;  1XMK A;  1ZRF A;  3BZ6 A;  2VBW A;  4P9U A;  1F5T A;  3O2P E;  3ABU A;  3I5U A;  4S05 A;  1FNN A;  2X4H A;  2ZME B;  1KU9 A;  2GWR A;  1U5T A;  2IA0 A;  3T1B A;  4B8X A;  1RIO H;  2Q2E A;  3CLO A;  5CVV A;  3SFZ A;  2GA2 A;  2XUB A;  5KVR A;  3WTU C;  4WXD A;  4ZYH A;  4CXF A;  3E6M A;  1B6A A;  3KZZ A;  5FLX Z;  1FT9 A;  2IJL A;  3DPL C;  2V6C A;  4KYW A;  1S7O A;  3IC7 A;  5LHI A;  3I59 B;  2CW0 F;  3LA2 A;  3KP3 A;  1Z1D A;  2ADU A;  2FBK A;  2L4M A;  2FE3 A;  2NS0 A;  2P5V A;  1WKM A;  2DFI A;  2W84 A;  5ICF A;  3K2Z A;  3HTU A;  5FO5 A;  1F4K A;  1IN4 A;  2CGP A;  2BYV E;  1A04 A;  3KEQ A;  1XCV A;  4HF2 A;  5DCM A;  4QLC U;  1BC8 C;  4GXO A;  5D4R A;  3OOP A;  3WTV C;  3R0A A;  2D2W A;  1JXS A;  2GZW A;  4UXN A;  3MAJ A;  2OZU A;  3TQN A;  3L2C A;  1XN7 A;  2Y48 A;  4LJZ F;  1KQ9 A;  4EJV A;  4XLN F;  4HQE A;  3HSE A;  3VEP A;  3KP2 A;  2CSO A;  2IW5 A;  2XAG A;  3I4P A;  1IZ1 A;  2EV5 A;  4G7Z F;  2BBY A;  1X3U A;  3RPQ A;  2M30 A;  2PN6 A;  1XDU A;  5D4S A;  1KGS A;  3P7N A;  2NAZ A;  4ESF A;  3MZH A;  1BI0 A;  4CIC A;  2ESH A;  3E3V A;  1C0W A;  4F7Z A;  3WOD F;  4L5J A;  4L18 B;  2HFH A;  1LDJ A;  1HXD A;  4KMF A;  4HX8 A;  3ZP5 A;  4HA8 A;  4BHB A;  1ULY A;  2RV8 A;  4ZZL A;  4O6J A;  4M72 A;  2CQK A;  4WCG A;  2XHK A;  1YO5 C;  1DPR A;  5FLX K;  2YSR A;  5L3C A;  4U7D A;  1SMY F;  1ON2 A;  3IWZ A;  2DLL A;  2FU4 A;  1J5Y A;  4M9S A;  1S29 A;  2ISZ A;  3WTX C;  4L9J A;  3LFK A;  2FQ3 A;  3HSF A;  2VOO A;  2VN2 A;  1J59 A;  1ZRD A;  1T2K A;  4A12 A;  3SZP A;  4RGR A;  5LGT A;  4MNU A;  2XRO A;  1BOA A;  2OAZ A;  1RI7 A;  3W6J B;  4AVP A;  3KET A;  4LB5 A;  1I5Z A;  5TJJ A;  3RTR A;  1UFM A;  3PQK A;  2DQR A;  1D3Y A;  1XCB A;  3KLN A;  5BPD A;  2EFW A;  5K5Q A;  3NEU A;  3V8L A;  4L9T A;  3TOB A;  4IHT A;  3R60 A;  2BGC A;  1K79 A;  2V79 A;  1BJA A;  3ZN0 A;  5ICG A;  1SD5 A;  1QPM A;  3KP6 A;  1L0O C;  1XDS A;  3DQV C;  4A2U A;  2FOK A;  1YFH A;  4HBL A;  1KYZ A;  2PBI A;  1RUN A;  2ZNZ A;  3F6O A;  1R22 A;  3I53 A;  5A2Q K;  4UV8 A;  5E20 A;  2CFX A;  3F6V A;  1LDK B;  2A61 A;  1DPU A;  5AIP A;  3G73 A;  4KN7 X;  3I54 A;  2WWY A;  3HRM A;  5D5V B;  3KP5 A;  2Z99 A;  1BIB A;  1H9T A;  1TQP A;  3HUG A;  1G4D A;  1PUE E;  2PI0 A;  4P9F A;  5ICC A;  3DP7 A;  2RN7 A;  3F8F A;  4HOB A;  3RYR A;  4M6Y A;  4QWQ A;  4HF0 A;  4BHP A;  3BPV A;  2Y0M A;  1W7P D;  2DK5 A;  3QP5 A;  4G7O F;  4NQW A;  2DU9 A;  4KMU X;  3MQ0 A;  1GVJ A;  3ML6 A;  3VFZ A;  1CF7 B;  4Y17 A;  1D8K A;  4M73 A;  2DTR A;  5IT9 Z;  1ZRE A;  2EV6 A;  2IVM A;  4MHG A;  1Z6R A;  4M6X A;  3GFI A;  2L4A A;  4PGH A;  5HVQ C;  2PMU A;  2MLG A;  1MJB A;  1SFE A;  3EUH A;  4NHJ A;  3TDU C;  2H27 A;  3ZMD A;  3VB2 A;  3ZMT A;  4LB6 B;  3H3Z A;  5E18 F;  5CJ9 A;  2A3S A;  5L3E A;  2QQ9 A;  3KFW X;  3BRO A;  5JR3 A;  3FXR A;  2EFN A;  2L01 A;  3HRS A;  5D8K B;  1TW2 A;  2OBP A;  1UB9 A;  1YW9 A;  3F21 A;  1YG2 A;  2VBY A;  4EJT A;  5EEH A;  2GXG A;  2KRF A;  4EJW A;  1TQM A;  3LA7 A;  1ZN2 A;  4I0A A;  1STZ A;  3TOA A;  1K78 B;  5DV5 A;  3V7S A;  2F5E A;  4ETS A;  1LQ1 A;  1FLI A;  1B59 A;  3K1M A;  1SD7 A;  4LFU A;  2HEO A;  2XAF A;  5DCF A;  4L0Y B;  2MD5 A;  2JT1 A;  4HX7 A;  2ZO4 A;  5DD8 A;  3GFM A;  3U1D A;  2F5D A;  1B1B A;  3K1P A;  2O3F A;  4UVC A;  2HYG D;  4MQ9 F;  4G6D A;  1W7P B;  1FY7 A;  1YS6 A;  4G8X A;  4OIR F;  2RQP A;  3KLO A;  4OIP F;  2VT2 A;  2Y75 A;  3R4K A;  2GAU A;  3Q9V A;  3V8J A;  1G6N A;  1WSU A;  4A0Y A;  1HSJ A;  3WGI A;  4LG0 B;  2VBZ A;  2ISY A;  1LDD A;  4PZJ A;  1IN7 A;  4UVA A;  2IP2 A;  3BJ6 A;  5L3F A;  1WRJ A;  2RGV A;  1SD4 A;  3E5Q A;  2D1V A;  4EM2 A;  2STW A;  5DUK A;  1EH7 A;  4RB3 C;  2EWN A;  1FZP B;  4EMS A;  1KYW A;  1S8N A;  2QQB A;  2DQL A;  2HWV A;  2QZ8 A;  2X0L A;  2C6Y A;  1MZB A;  5D5X B;  2HOE A;  2R7F A;  2P6S A;  5LEK A;  3TKY A;  1CGP A;  1E2X A;  4BNC A;  3GLX A;  4RB1 A;  2GA1 A;  4S04 A;  2W85 A;  4L5I A;  3DV8 A;  2YX4 A;  5CVI A;  3V7C A;  4XSX F;  1OPC A;  3FMR A;  1QO0 D;  3TO6 A;  4LK1 F;  1S3J A;  2PQ8 A;  4IRI A;  4DNC A;  1MDM B;  3GX4 X;  5HS9 A;  2XKO A;  3DKW A;  3M7G A;  1QGP A;  2FNA A;  1IRF A;  3V4G A;  1TBX A;  3QRF F;  5E1X A;  3WU0 A;  1R58 A;  4P55 A;  3QU6 A;  3EYI A;  1F1Z A;  2BEO A;  2NNY A;  1AWC A;  2XAH A;  4IHS A;  5DDG A;  4WX9 A;  1MKM A;  4L9V A;  1R7J A;  4Q5S F;  3J7A O;  3WE3 A;  3TGN A;  2QBY B;  1PDN C;  1IW7 F;  2FMY A;  4ZYE A;  4OMZ A;  3GWZ A;  1VTN C;  4RGX A;  4FT8 A;  3KCC A;  5HS7 A;  3J81 Z;  2ELH A;  2EA4 A;  3LQR A;  2HTS A;  5L3D A;  2V1U A;  4M9X A;  1PP7 U;  1XGS A;  2DW4 A;  4L9N A;  4G94 A;  3BJA A;  2HS5 A;  3RKX A;  1O3R A;  3O6B B;  2HGC A;  5BPI A;  4LD5 A;  2KIF A;  2DI3 A;  1ZG3 A;  5FGM A;  2ACJ A;  3ULQ B;  5HS8 A;  1D8J A;  4M74 A;  1G3T A;  1K6O A;  1TQI A;  2PG4 A;  3CUQ A;  2LF7 A;  1O7L A;  1XSD A;  2RVC A;  2YPR A;  5CVR A;  3IWF A;  3SHF A;  1OYY A;  2WTE A;  2ZNY A;  4HV6 A;  3KEO A;  4M9Z A;  1NHA A;  3JSO A;  5CVU A;  3E5X A;  5CLS A;  2IA2 A;  3F8B A;  3U9G A;  4A0Z A;  2D45 A;  4WF2 A;  2BV6 A;  5A2Q Z;  3WTW C;  2P5L C;  2A69 F;  1Z9C A;  3LAP A;  1T39 A;  2NYX A;  4L0Z B;  2QEN A;  1HST A;  1ZAO A;  1XSX A;  4LLG F;  1V4R A;  3HRU A;  4IRH A;  3GEZ A;  5HLH A;  2QLZ A;  1WQ2 A;  3RKY A;  1FSE A;  3K9T A;  1FYL A;  4UV9 A;  4UVB A;  1U2W A;  3C1D A;  2CWE A;  1FBS A;  5JHU A;  3WTS C;  3M1E A;  2MC3 A;  2A6E F;  2QVO A;  5DUI A;  2FRH A;  3Q9S A;  4E70 A;  1T38 A;  4BQA A;  4YIF A;  4KN4 X;  4HZF A;  5LGU A;  3J81 K;  5CVJ A;  3L09 A;  1J2X A;  1ZLJ A;  4RGU A;  1FX7 A;  2KIM A;  5J8C A;  4XSZ F;  3H3U A;  3MCZ A;  5JVT A;  1J75 A;  1BI3 A;  2H6B A;  5F64 A;  2LDU A;  4MTD A;  1W5T A;  4GCV A;  3FMS A;  2UWM A;  2RKH A;  4FX4 A;  2M1B A;  2FXA A;  1QQI A;  3J80 Z;  1IXC A;  1SFU A;  2V1X A;  1XGO A;  2VE8 A;  2JZY A;  4LK0 F;  2CO5 A;  5HDN A;  4Q4Z F;  4KDP A;  4R8H A;  3QU3 A;  1P4A A;  2DPU A;  4CGZ A;  3L7W A;  2MH2 A;  2OZ6 A;  3N4M A;  5LLQ A;  4H0E A;  6PAX A;  3LST A;  2R7D A;  1TTY A;  1XMA A;  3FXQ A;  5ILS A;  4LLL A;  3NRV A;  2CG4 A;  4I09 A;  4M71 A;  3KE2 A;  5ILV A;  4A6D A;  3T8T A;  3V7R A;  4AIJ A;  3IRR A;  4PDK A;  5JI6 A;  1Z7U A;  4G6Q A;  3FXU A;  2QWW A;  3BY6 A;  3EDP A;  1EH8 A;  3IL2 A;  4HV5 A;  3CJN A;  4KUM A;  4Q47 A;  2ZCW A;  3E5U A;  1AOY A;  1OMI A;  1HW2 A;  4I01 A;  3BPX A;  1XGM A;  4AWX B;  1OYI A;  5AIQ A;  2ZME A;  4RGS A;  2LF8 A;  3GW2 A;  2BE5 F;  1I1G A;  2EFQ A;  3N97 A;  4LGW A;  2OA4 A;  1TLH B;  2PLY A;  3RIR A;  3VOE A;  2O0Y A;  2W25 A;  1R1U A;  2HR3 A;  5ERI A;  3ZN1 A;  1XB4 A;  5LEJ A;  3E6C C;  3I59 A;  3K0L A;  4KNY A;  1SMT A;  1HKT A;  4HW0 A;  4JK1 X;  2GXB A;  1G3W A;  3ERE D;  3K69 A;  4FHT A;  3M8E A;  1UHW A;  2XV4 S;  3CO7 C;  3WGH A;  3MZY A;  2V1D A;  4TV7 A;  4Q48 A;  1FP1 D;  4KIC A;  4AIK A;  2M45 A;  2H6C A;  3F8N A;  4JBA A;  4I2O A;  1J7K A;  3ISP A;  1IXR C;  5DCM B;  3C18 A;  1JE8 A;  1GHC A;  3HRT A;  4B09 A;  1FOK A;  1FYK A;  1FPQ A;  2LKP A;  3J80 K;  4EGZ A;  1LVA A;  2LSO A;  1J9I A;  2PFB A;  1TW3 A;  5LBQ A;  3E6B A;  2UXX A;  4PGG A;  1H0M A;  1DDN A;  2MBF A;  3F23 A;  3MEX A;  4GYI A;  3JTH A;  3WTY C;  4A6E A;  1MJ9 A;  1Z91 A;  2EJR A;  4G7H F;  3P9K A;  1ZYR F;  4HDU A;  1DP7 P;  4HLY A;  1BM9 A;  2WC2 A;  3F3X A;  2PEX A;  1HW1 A;  3B73 A;  3FX3 A;  4N9I A;  1XD7 A;  5JFR A;  2EFO A;  1HW5 A;  4LMY A;  3I64 A;  1B9N A;  2OQR A;  3OV8 A;  5J8F A;  3ZMU A;  3R6S A;  3F8M A;  2HQN A;  4G9Y A;  1KQ8 A;  1KU3 A;  3GXO A;  1H9G A;  4RS8 A;  2GIV A;  2FML A;  5HOO A;  3PFI A;  4I98 B;  2CYY A;  3ELK A;  5K5R A;  1QBJ A;  2KJB A;  3GFJ A;  4U88 A;  3SQN A;  1BIA A;  3TO7 A;  3RDI A;  2DT5 A;  1ZG1 A;  5E8I A;  1W4M A;  3CTA A;  2O6G E;  2NNN A;  5H20 A;  4OMY A;  1O7F A;  3GUD A;  3R61 A;  1YIO A;  1BI2 A;  4ZYG A;  4ESJ A;  1EH6 A;  3FMQ A;  4RAZ A;  4U7B A;  1YLF A;  2M8E A;  4IRG A;  4A5N A;  2XKP A;  5D5W B;  3BWG A;  2QM3 A;  1ZAR A;  1IF1 A;  5D8L B;  3QPT A;  2JPC A;  3FZV A;  2K02 A;  4HDV A;  1JHF A;  3GZ6 A;  2WV0 A;  2ZBK A;  3EYY A;  4UNO A;  5LGN A;  1HQC A;  1LEA A;  3JTG A;  1FYM A;  5EEG A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...