3IWFA

The crystal structure of the n-terminal domain of a rpir transcriptional regulator from staphylococcus epidermidis to 1.4a
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
102
structure length
89
Chain Sequence
MPNILYKIDNQYPYFTKNEKKIAQFILNYPHKVVNMTSQEIANQLETSSTSIIRLSKKVTPGGFNELKTRLSKFLPKEVTQYNNKLHSR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The Crystal Structure of the N-terminal domain of a RpiR Transcriptional Regulator from Staphylococcus epidermidis to 1.4A
rcsb
source organism Staphylococcus epidermidis
molecule tags Transcription regulator
molecule keywords Transcription regulator RpiR family
total genus 32
structure length 89
sequence length 102
chains with identical sequence B
ec nomenclature
pdb deposition date 2009-09-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01418 HTH_6 Helix-turn-helix domain, rpiR family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 3iwfA00
1Z05A 1BIBA 1YIOA 4ON0A 1P4XA 4EQQA 2HKXA 4B09A 3I59A 3FF5A 4U88A 1KU2A 5LGNA 5ILUA 3LWFA 1T6SA 5D8LB 1FSHA 1RI7A 2OA4A 4HF2A 2VBYA 2VT2A 1KGSA 3WGHA 1ZRCA 3F3XA 1ZN2A 2RQPA 4MHGA 2MH9A 4HZFA 2YU3A 4L9TA 3TDUC 3P9CA 2W85A 3T0YA 2YPRA 4Q4ZF 5AIPA 4LLNA 1ZLKA 1U2WA 1Z6RA 3TQNA 5BOXA 3M9AA 1LEAA 1J75A 1WQ2A 1IN4A 3R0AA 2F5DA 2CWEA 3FXQA 3JW4A 2KIFA 1MKMA 3ZN0A 5CVRA 1BC7C 2Z3YA 3NQOA 5L3EA 4P55A 1J0RA 4HLXA 4KN4X 4OOIA 4AD9A 3K69A 1R36A 3BPVA 1EH8A 2PEXA 2XHKA 4NHJA 1MGTA 1YLFA 1Z91A 4UNOA 2YSRA 1T39A 1D3YA 1OYWA 2EA4A 3F8MA 1SD6A 1HKSA 2ESNA 4P9UA 1LDDA 3R0JA 2F5FA 3ZP5A 5K5OA 3GZ6A 1U5TB 1H0MA 2V6CA 1FP1D 3WE3A 3SXYA 2VBZA 1G3TA 4LMYA 3ERED 1ZG3A 4RS8A 4A0YA 4EGZA 3EUHA 3BJ6A 5J8FA 1UHWA 1KYWA 3GFMA 3L9FA 2JPBA 1SFEA 3HSRA 3V4GA 4A5NA 1FBSA 3J80Z 2H94A 3JAMZ 1DPUA 4Y17A 1IXCA 3DQVC 3WTVC 4L18B 2P5LC 4HBLA 4WCGA 5D5UB 2QQBA 5E1XA 4RGRA 2IT0A 5DD8A 1LDJA 4LJZF 1O3QA 3ZMSA 3IHUA 1XMAA 4M6YA 5ILVA 1CF7A 2QWWA 4RAYA 5BQTA 2A68F 3E6CC 3J80K 5CLSA 1IN5A 4Y15A 1L3LA 4ASNA 4YIIA 3REOA 2XAFA 1U3EM 1JGSA 4WWCA 4MGRA 5D6EA 4WXDA 2PLYA 1BOAA 2CSOA 4LFUA 2DLLA 4N0BA 5FB2A 3U9GA 5L3BA 4I98B 1K78A 1TW2A 2XAGA 3SFZA 3HTUA 3JSOA 2UWMA 1HQCA 2FEZA 2AXLA 1O7LA 1KQ8A 2HS5A 4D0PA 4UV8A 1I6XA 1OYIA 3V8LA 4EJTA 4CO8A 3TKYA 2QBYB 4ZYGA 2RGVA 2A3SA 2CYYA 5J6XA 1ZLJA 2IP2A 5TRDA 4HDVA 1TTYA 4XSZF 2ZCWA 2EFWA 4YIFA 2A6EF 4P9FA 3RKXA 1WRJA 4BYYA 2DPDA 3ML6A 2MA3A 3QOPA 1LNWA 1TQIA 2E7WA 1W5TA 2KKOA 4U0VA 1I27A 2QQAA 3N4MA 3WTYC 4ENJA 3CTAA 3HSFA 3L09A 1BI1A 4ZYEA 2O6GE 2QZ8A 4UVBA 4OMZA 2P5KA 4I2OA 2WWYA 4A2UA 4ESJA 1UB9A 4OIOF 2DBBA 3HOTA 5HDGA 3IWFA 2FBHA 1FP2A 1D8JA 5EEGA 4XLPF 2HEOA 5JR3A 4XBFA 1IZ1A 2LF7A 2GQQA 4BHBA 2STTA 2DT5A 1JXSA 1HSJA 2E1CA 2FE3A 3K9TA 3Q5FA 1QO0D 3J7AO 2HOEA 5DUKA 3RYRA 1USTA 3PQKA 3V8JA 3SQNA 2OAZA 2RC4A 3LFKA 3U2RA 1YW7A 1AWCA 3L00A 4E70A 4IHTA 2IPQX 2QLZA 3KP3A 2HQRA 2Y48A 3KP6A 3VFZA 4IRGA 3QU6A 4RB0A 2V1UA 4N9IA 4A5MA 2HKOA 1YW9A 3M8EA 5D4RA 5J8CA 1NHAA 3WTTC 2VOPA 1G3YA 3DP7A 1U8RA 1XGMA 2L4MA 2H6BA 3F22A 4LD5A 4M9ZA 4LB5A 3GFIA 3P9IA 5LGUA 2G7HA 3IKTA 2HZTA 3I53A 4R8HA 1XD7A 2M5WA 3IWZA 1SAXA 3RTRA 3FX3A 2DK5A 5F64A 4FX0A 4IF4A 2HGCA 2K4JA 2FNAA 3QP6A 4EMSA 5KVRA 1ZHFA 4CZZA 4ZH4F 2IJLA 3M7GA 4EVIA 2KIMA 5LHHA 1XGOA 2RDPA 5E18F 1YS6A 4Z2YA 1WKMA 3VODA 2W24A 4KT5C 2FMYA 3R60A 4WXHA 4JK1X 3Q9VA 5FFZA 1I1GA 1B4AA 1MDMA 4MEXF 2FBKA 4O3MA 2ZNZA 5FGMA 5IT9Z 5DCFA 2ZKZA 3N97A 3MWMA 5ED4A 2VOOA 4A12A 1BBYA 3FMSA 2L54A 4ETSA 4GCVA 2ZMEB 3FM5A 4GYGA 5H6RA 3DEUA 2HWVA 4IVNA 2H27A 3IC7A 5HDNA 2K4BA 3RPQA 4ENKA 2XGXA 1FBUA 2PG4A 1B6AA 2BEOA 2EV6A 2KJCA 2DPUA 2K02A 3MEXA 2XAHA 3QRFF 3R4KA 1XCVA 2FXAA 5A2QK 4PGHA 4MTEA 2PMHA 5ICFA 4HF1A 4I0AA 1ZH5A 2K7LA 2NRAC 1DP7P 1KQ9A 3F23A 1HKTA 2GA1A 4UHTA 1T98A 4CXFA 3WG9A 2EFOA 1R5GA 2HYGD 2Q8KA 1R7JA 1XDUA 5E20A 2BGCA 5BPDA 1K7AA 2GAUA 3WTUC 2OZUA 2D45A 3HRTA 1YG2A 3JSPA 3M8FA 4S04A 1VTNC 1IN8A 2LDUA 4O6JA 4U7BA 1SFUA 3F6VA 1SMTA 4EJWA 3GF2A 4Q48A 1V4RA 4G7ZF 4KUMA 2LSOA 2YX7A 4I09A 4KMFA 4IJAA 3BWGA 3KCCA 4FX4A 3BDDA 2EV0A 3F6OA 4QLCU 2HQNA 4LB6B 1W4MA 1XSDA 5L3CA 3I58A 1OMIA 3PFIA 4M71A 4OIQF 1P92A 3MFKA 4L9NA 2IA2A 1Z6TA 1GHCA 3VEPA 3R61A 3HRSA 4G6DA 3ROUA 1PP7U 5H6QA 5K5RA 2PFBA 3GW2A 1GVJA 4RGSA 3WGIA 2XAJA 2HDCA 4YG2F 3GO5A 2OZ6A 3E5QA 3HRUA 1YYVA 2X0LA 4CICA 3GUDA 5LLQA 1S7OA 2A61A 3T8RA 3TDZC 2TDXA 4UVAA 4BQAA 3LQRA 3RKWA 2ADUA 4G7HF 2J5OA 3DKWA 4JBAA 1XDSA 2Z33A 5LRRA 3Q9SA 3IKVA 4AIKA 1F9NA 3CDHA 4EJUA 4LG0A 5HLHA 1O3SA 2V1DA 5DUIA 2B0LA 1J5YA 4F7ZA 1ULYA 3J81Z 3RKYA 1R22A 4OU0A 1ZRFA 1USSA 2P4WA 2O0YA 3QP5A 2JTVA 4LLLA 1U5TC 2WTEA 1YO5C 2ELHA 1H9GA 1TQMA 2V79A 4PGGA 2ETHA 4AWXB 3KZZA 5DV5A 2IW5A 3RI4A 4NQWA 5DDGA 5ERIA 3M1EA 5E8IA 4WX9A 1XCBA 2QENA 1BN5A 3BOQA 4G7OF 2G9WA 1FBQA 1BM9A 1QZZA 3E97A 3ZMDA 1BJAA 4WXCA 2DQLA 1R23A 4KFCA 5E1WA 3WODF 1QQIA 2VBWA 6PAXA 4HOBA 5FLXZ 3GEZA 4EV0A 5DYMA 1XN7A 3T1BA 4OIRF 2RV8A 3ZMVA 1S29A 4HLYA 1B1BA 5LGTA 1MJBA 2ZBKA 5ILSA 1O3TA 3IRRA 4KMUX 1FZPB 3DF8A 4A6EA 2VBXA 4YFKF 4HA8A 2ESHA 2QVOA 1S6LA 1LEBA 1R58A 3KP5A 4HYEA 3D5LA 4KIBA 1FWZA 2Y0MA 1ZG1A 3EQLF 3MZHA 3T5XA 4HQMA 3FMQA 5CVUA 5HVQC 2X4HA 4B8XA 3K2ZA 2UXNA 3K1NA 5AONA 4EJOA 1O3RA 1A04A 1DPRA 1PP8F 5JHUA 3BY6A 3FMRA 3KZYA 2QUFA 1SD7A 2PJPA 5CVIA 2OU2A 4RGUA 3MAJA 2Z99A 4R79A 2IRFG 2XVCA 2MH2A 3V7SA 3ELKA 3TOAA 1W7PA 2A6HF 2PMUA 1G3WA 2O8XA 1ON2A 1LDKB 4EM2A 4KICA 2DU9A 2PBIA 2GA2A 4EGYA 4BHCA 1JE8A 1E2XA 2DO7A 2Q0OA 5LEJA 1PDNC 3QAHA 4EM1A 2NNYA 3DFGA 1DDNA 5AIQA 4NB5A 2PN6A 1U5TA 3F72A 2L02A 2BV6A 2W84A 5ICGA 1IXSB 3GFJA 3ZQ7A 5JVTA 2ZNYA 4PZJA 2KIUA 2CGPA 1IRFA 2JZYA 4KIGA 3ZMTA 1S7AA 4YFXF 4Q47A 5L3FA 4I01A 1Y0UA 3D0SA 4UUVA 3E6DA 1MD0A 2GWRA 1C0WA 5LEKA 2GIVA 2VT3A 3JAMK 3B02A 3TO6A 5ICEA 2EFQA 3LQQA 3GZ5A 4XLNF 5CJ9A 1FC3A 3KETA 1IUYA 4XSXF 5HS8A 2CG4A 4KDPA 1FYMA 3WE2A 3RYPA 5CVJA 3ZPLA 2O61A 5DCMB 4UV9A 3HIFA 1XSVA 2RN7A 1KU3A 3QU3A 2IA1A 1FSEA 1IN6A 2O03A 2Y75A 3F8BA 3IL2A 4RB2C 2QQ9A 2R7FA 2P7CB 4EM0B 3FXRA 2OBPA 2YR2A 3LAJA 1R1TA 4I02A 3VB2A 3G3ZA 4BXUA 3ECOA 2W25A 2QM3A 4M9SA 3QPHA 1T2KA 2XRNA 3TGNA 1GXPA 1JHFA 1T38A 4UXNA 1HW1A 4KN7X 5HOOA 4GXOA 1ZYRF 2FNPA 2FOKA 2IVMA 5EEHA 5BS6A 3GFLA 3I54A 4M74A 2QBYA 1IW7F 1R5HA 2LNBA 5E1ZB 3LA7A 1YFHA 2UZKA 1ZG5A 2FU4A 2YX4A 1QPMA 5E17F 4GO1A 3R6SA 4ESFA 3QPTA 5D5VB 2M87A 3LSTA 2VE9A 3I71A 4HV5A 2C6YA 4QWQA 1RIOH 2RKHA 4U0YA 3KEOA 1Z7UA 1JHHA 5K5QA 1ZGAA 3CUQA 1EV7A 3HOSA 1J9IA 2ZO4A 2FRHA 1Z1DA 1B9NA 3HRMA 3OOPA 4BHPA 4MQ9F 3RDIA 1OR7A 5K1YA 1HBXG 1TNSA 2P7VB 4A6DA 2XAQA 4PDKA 1IRGA 1W7PD 3JTGA 2OQRA 4RB1A 2D1HA 2EV5A 1OYYA 5IT3A 3COAC 1BI0A 3NRVA 3MQ0A 2VONA 2DAOA 3E3VA 4P96A 1RUOA 4OINF 1ZRDA 2FSWA 2P6TA 3ZMUA 2MLKA 2P8TA 4KA4A 4Q5SF 1WSUA 2MBFA 2Q2EA 3OV8A 5D5WB 3AAFA 1G6NA 4HX8A 1AOYA 1L0OC 2JPCA 2XV4S 4H0EA 2JSCA 3EETA 3KEQA 3C3WA 4MQVA 3HTSB 3MCZA 4DNCA 4G6QA 2H09A 1KYZA 5DD4A 1D5VA 4GYIA 2BBYA 2R3SA 4LG0B 2D2WA 1F1ZA 5JFRA 2FQ3A 3GYHX 2D1VA 2J5PA 5F1RA 1UHMA 2L01A 4M73A 3GXOA 1ZAOA 1LQ1A 2ISYA 3O6BB 1KA8A 2JT1A 4LLGF 1TLHB 3WGGA 3SHFA 3WU0A 1WWXA 2G7UA 4ZZLA 3WTSC 4P5OA 1UFMA 3KE2A 4AVPA 2A5YB 4IHSA 3L2CA 2FF4A 3EDPA 1QBJA 4M6XA 5L3GA 3CO7C 4KIFA 1SMYF 2ZXJA 3BJOA 2HFHA 5CYVA 5D8KB 1BI3A 1G4DA 4LGWA 3DPTA 4HW0A 4M72A 3TOBA 2EJRA 3ISPA 2DFIA 1FX7A 3P7NA 3BP8A 1HW2A 2DTRA 2ZJ2A 3RIRA 2XUBA 2VC0A 1MZBA 1ZGJA 1XMKA 3ABTA 5HLIA 4ESBA 3WTWC 1FNNA 2DW4A 1MDMB 2L4AA 5BPIA 5HS7A 1LVAA 1FT9A 3F8NA 5HS9A 3WTZA 4ZYDA 1K6OA 2Z9OA 4A0XA 2CW0F 3P9KA 3B73A 2AS5F 1OPCA 2HR3A 4RGXA 1RUNA 2IA0A 1P2FA 3ULQB 2EFPA 1PUEE 1CGPA 1O57A 1QNTA 4S05A 2ZMEA 1TNTA 1QGPA 3KLOA 1ODDA 2ZFWA 1TBXA 4CGZA 3HHGA 2M8EA 3HUGA 4N9HA 3I59B 3FZVA 2STWA 3C18A 5A2QZ 3TO7A 3DV8A 3O3KA 1ON1A 1P6RA 4IXAA 1ZREA 3CO6C 2CQKA 5FD5A 1BI2A 1W5SA 4L9JA 2FA5A 4I0BA 3BZ6A 4KNYA 3ECHA 2E7XA 2NS0A 2XROA 2EWNA 3T8TA 1R1UA 2LKPA 1F5TA 4ENNA 3ABUA 4HDUA 3DXJF 3F21A 3I64A 1GXQA 3RJPA 3HSEA 1HXDA 1V3FA 3JTHA 3E5UA 1KQ0A 5D4SA 3E6BA 1RZ4A 2K86A 3GWZA 5FD6A 3ZMZA 1SD4A 4BAYA 1XGSA 2PI0A 1ONVA 2WV0A 2V9VA 1OKRA 3V7CA 1S8NA 2LF8A 5E8GA 1TQPA 2NNNA 4HX7A 2VODA 1XGNA 3CUOA 2XIGA 2MC3A 4HQEA 4WK8F 1I1SA 5ICCA 2GZWA 3F8FA 4U7DA 3HHHA 5D5XB 3GLXA 2H6CA 2VN2A 3FWEA 2DI3A 4IPAA 2CFXA 4MNUA 3EYIA 3KLNA 1FYLA 1FLIA 3K1MA 4MEYF 2E1NA 2VXZA 2W57A 2MD5A 3U1DA 2GXBA 3FXUA 3KP4A 4U0WA 1DUXC 1HSTA 2FMLA 4EJVA 3G73A 5DCMA 1HW5A 4YFNF 3HYIA 4FHTA 4XRFA 1LJ9A 4L5IA 4GGGA 3H3ZA 1FY7A 1IAWA 4RB3C 3I4PA 2M30A 4RAZA 2DK8A 4L9VA 2O3FA 4CYDA 3TO9A 5FO5A 3W6KB 5H20A 4L5JA 3H92A 1BC8C 3LAPA 2VE8A 1HKQA 2EB7A 4WF2A 3E6MA 2RNJA 3LA2A 1UCRA 4O5VA 4AIJA 5IT9K 3I0TA 1CF7B 5CVVA 2L3DA 1YW8A 2EA2A 1BIAA 4OMYA 2PQ8A 3GVAA 3KP2A 3L7WA 3I5UA 4A0ZA 2NYXA 2KRFA 2UXXA 2A69F 2EK5A 4L0YB 5FLXK 5L3DA 1Z9CA 1G3SA 1R1VA 2RVCA 2HTSA 2BE5F 1MJAA 1K78B 3LA3A 2WC2A 4G8XA 3FHZA 1IN7A 4R1HA 5TJJA 3K1PA 1R00A 2P6SA 1FOKA 2F5CA 3CUQB 4TV7A 1KU7A 1Q1HA 4BH9A 4G94A 4CDGA 1TW3A 1SFXA 2Z5UA 3CLOA 1D8KA 4KYWA 2M1BA 4HV6A 4PCQA 2V1XA 1X3UA 4JQFA 1H9TA 4HAMA 2XASA 4AIHA 2R7DA 1IXRC 4M9XA 1REPC 1KU9A 1F4KA 3F8CA 2KJBA 4ENMA 1EH6A 1S3JA 3V8KA 2HTJA 2CO5A 3GX4X 5LHIA 4CHUA 1J7KA 3C7JA 5BMZA 4LK1F 1J59A 1I5ZA 1FPQA 3WU1B 5DEQA 3SZPA 4MTDA 2OQGA 2ISZA 5HLGA 2M45A 3PQJA 5LBQA 5LRSA 1IF1A 1E17A 5KK1A 3CJNA 3KP7A 2P5VA 4K2EA 1RNLA 1XSXA 3S2WA 3J81K 1T0FA 3ZN1A 4BNCA 2JRTA 2COMA 3O2PE 1EH7A 4HX4A 5JI6A 1MJ9A 3IRQA 3H3UA 3BPXA 3MZYA 5FFXA 4OIPF 1U78A 1P4AA 2GXGA 2MLGA 1LB2A 1STZA 2QYOA 1WI9A 3K0LA 4ZZDA 2VC1A 3SZTA 4DQ2A 2NAZA 3EYYA 3RPUA 1U6GA 3CUQC 1ZARA 3FM3A 1W7PB 1SD5A 2K27A 4IRHA 4Y13A 5F6FA 3W6JB 4FT8A 4ZYHA 3C1DA 5LHGA 2XKOA 3V7RA 4IRIA 2ACJA 2XKPA 3WTXC 3BROA 2EFNA 1P4WA 3DPLC 1K79A 2BYVE 2OD5A 5HDKA 3KFWX 3E5XA 5D6FA 4LK0F 3VOEA 1O7FA 2F2EA 1B59A 4L0ZB 1J2XA 1QZYA 4UVCA 4G9YA 2A07F 1YQAA 1FYKA 3NEUA 4I7HA 4HF0A 2FBIA 1YTYA 2HYFA 3BJAA 1XB4A 1YS7A 2F5EA 1B9MA 2DQRA
chains in the Genus database with same CATH superfamily
2JSPA 1Z05A 3S3OA 1BIBA 3SDBA 1YIOA 4ON0A 4XOPA 4XRSG 1P4XA 4AU7A 4EQQA 1QVUA 2ELJA 5K7ZA 2EBIA 2HKXA 3JRAA 3MZ8A 4B09A 3I59A 2XGCA 3FF5A 3JRHA 3CJQB 3CF2A 2OTJI 3CDIA 3AL0C 4U88A 1KU2A 3WHCA 2GOXB 5LGNA 5ILUA 3LWFA 1T6SA 2BVLA 5D8LB 3DPUA 1U9NA 1FSHA 1RI7A 1TWAJ 2GIZA 4JX5A 3JRIA 2OA4A 5B5EC 4HF2A 3HOWJ 2NVUB 1WJAA 3WG7H 3QYBA 2VBYA 2VT2A 1KGSA 3WGHA 3E7LA 3RQ4A 1ZRCA 3F3XA 1ZN2A 2VIXA 2RQPA 4MHGA 5EGOA 2MH9A 4C3IJ 4LG3A 4HZFA 4MLOA 2YU3A 4L9TA 2A05A 3TDUC 3P9CA 1T8IA 2W85A 1APLC 3MD2A 3T0YA 2YPRA 4Q4ZF 5AIPA 4LLNA 1ZLKA 2CQQA 3BCBA 2HQAA 1U2WA 4HNUA 1Z6RA 3TQNA 5BOXA 2VKEA 3M9AA 1I3QJ 1LEAA 1J75A 2KISA 1WQ2A 1IN4A 3JRBA 3R0AA 2F5DA 2XPUA 4CCKA 3SFIA 2E71A 2CWEA 3FXQA 1WJEA 3JW4A 2KIFA 5FKLA 3RPUD 5BNGA 4XKBA 4XLHA 1MKMA 1QA6A 3ZN0A 1TWGJ 4UB8C 1X58A 1P7JA 5CVRA 5IOYA 3I4MJ 3OIPA 2HYJA 5GPCA 1IUFA 4PJLA 4JOMA 1BC7C 1AU7A 3FXJA 2Z3YA 3NQOA 5L3EA 4P55A 3FK7A 1J0RA 4HLXA 4KN4X 4OOIA 4AD9A 3K69A 1JTYA 2AQEA 4B47A 3OYNA 1R36A 3BPVA 3G1OA 2DT6A 1ETWA 4HSRA 2R7XA 1P9QC 4II3A 3J7AY 1W1WE 2Y0SA 1EH8A 2L7MP 2PEXA 2XHKA 2E1OA 1FOWA 3CF5F 1MGTA 3BTIA 4NHJA 4N4NB 1YLFA 3CCMI 2KDZA 9ANTA 1Z91A 4A3MJ 2B63J 2M7AA 4UNOA 4PJ0C 1SFOJ 2YSRA 1T39A 1D3YA 1MBKA 1OYWA 2EA4A 3F8MA 1SD6A 2XSJC 3O8HA 1HKSA 4MFEA 1Q1VA 2ESNA 2X6YA 4P9UA 1X4OA 2HI3A 3UR3C 1VQ9I 1LDDA 3R0JA 2F5FA 3ZP5A 5K5OA 1X3WB 3GZ6A 2JWTA 1U5TB 1H0MA 2V6CA 1FP1D 1RR8C 2H1KA 1ZTRA 1ETXA 3WE3A 2LR8A 3SXYA 2VBZA 4FE7A 1IGNA 2W00A 2L5QA 4BUPA 1G3TA 4LMYA 3ERED 2UV1A 2Y0SN 2JK3A 3EUKL 4UUTA 1ZG3A 2ID6A 4RS8A 4A0YA 4EGZA 3EUHA 3BJ6A 5JLXA 4E7IA 1TL8A 3K10A 5J8FA 1UHWA 1KYWA 3OOUA 1YJNI 2HQ5A 2JN6A 5F08A 3PIOF 5M3MJ 4KISA 3GFMA 3L9FA 1HOMA 1WFXA 2JPBA 2O9LA 1IJWC 1SFEA 3HSRA 1VI0A 3AG4H 1MIJA 3V4GA 4A5NA 1B8IA 3L2UA 1RKTA 2JVGA 1FBSA 3J80Z 3OYFA 2H94A 5IP6A 3LL7A 3JAMZ 1EJ9A 2BZTA 1DPUA 4Y17A 1IXCA 4IHWA 2EH3A 3DQVC 3H9QA 3WTVC 2F4OB 4L18B 1IV8A 3OYLA 2P5LC 4IHVA 4HBLA 4F93B 2JA6J 4WCGA 3DTIA 5D5UB 2QQBA 4XONA 2R7WA 2DA1A 4J00A 5E1XA 3A03A 4RGRA 2IT0A 3D5SC 1O4XA 4G12A 3LSGA 5DD8A 3F0CA 3HKZA 3HPGA 1LDJA 2LBFA 4LJZF 1O3QA 3PNTA 1RRJA 3ERMA 4CYCA 2V26A 3ZMSA 3IHUA 1PUFB 1XMAA 2R5YA 4ZTJA 4M6YA 2GBYA 5ILVA 1CF7A 4XKVA 5F0CA 5M3FJ 4F3QA 2QWWA 4RAYA 4DIQA 5BQTA 5EG0A 2A68F 3E6CC 3J80K 5CLSA 1IN5A 4Y15A 3HJEA 4LIVA 1L3LA 4ASNA 4YIIA 3REOA 4Y33A 2XAFA 4BY1J 2EZLA 1U3EM 4AYBA 1JGSA 3G71I 2IS4A 4WWCA 4MGRA 2XPVA 4WXDA 5D6EA 2LMDA 2PLYA 1BOAA 2CSOA 4LFUA 2DLLA 4D7MA 4N0BA 5FB2A 2HNHA 3U9GA 5L3BA 4I98B 2UUZA 1U8BA 4JP0A 1ITYA 1K78A 1TW2A 2XAGA 3SFZA 4A3JJ 1ZELA 3HTUA 3JSOA 2P0WA 5GTIC 2Y69H 3PNYA 3L2QA 2UWMA 1HQCA 4BY7J 2FEZA 1MW7A 2AXLA 1IC8A 1O7LA 1KQ8A 2HS5A 4V19K 1OFCX 1Z3XA 2JA2A 4D0PA 4A3KJ 4UV8A 1I6XA 1OYIA 3V8LA 2EIJH 4CO8A 5C44J 2ZJRF 5H2FC 4EJTA 3TKYA 3TMOA 2QBYB 4ZYGA 2XPWA 1VQ7I 5FRNA 2R7UA 2RGVA 4M6VA 3FXKA 3Q0WA 2A3SA 2CYYA 4AUXA 4DBQA 5J6XA 1ZLJA 2IP2A 5TRDA 1MSFC 4HDVA 1TTYA 2FQ4A 1JJ6C 4XSZF 3OIOA 3DWLE 2ZCWA 3NWSA 2EFWA 1VFCA 2Z1DA 3PO2J 2LK2A 4YIFA 3HG9A 2IBDA 2A6EF 1Z7LA 1DU6A 2RNGA 2CV1A 4P9FA 3RKXA 2R7ZJ 1WRJA 2KPMA 4BYYA 3H36A 2DPDA 2LD5A 2HPMA 3ML6A 2FUG2 2MA3A 3QOPA 1LNWA 1TQIA 2W1OA 2E7WA 2CQNA 1RC9A 1W5TA 2KKOA 3BR3A 4U0VA 3F9KA 1I27A 2QQAA 1ACIA 4M3EA 5KNLA 3N4MA 2V9KA 3GMEA 3WTYC 3Q3SA 4ENJA 4Y52J 2X85A 2KRHA 3B6AA 3CTAA 3HSFA 3L09A 3ZQFA 2DYSH 1BI1A 4ZYEA 5K7FA 2QZ8A 2O6GE 4UVBA 3L2RA 4OMZA 2P5KA 2R5ZA 4I2OA 2WWYA 3BR5A 4A2UA 3JCUC 4B44A 4ESJA 5JLWA 2JA7J 3Q0VA 3CC2I 1UB9A 4EATA 2PMZA 1LUJB 3I3LA 4IX7A 4NUBA 1NK2P 4OIOF 3DCFA 2DBBA 1Y1VJ 1PYVA 3HOTA 1JT6A 1FOXA 5HDGA 5K7HA 1VF9A 3IWFA 1FP2A 2FBHA 2Y9ZA 1D8JA 5EEGA 4XLPF 2HEOA 2O8KA 4MO7A 2BW3B 5JR3A 4XBFA 2ZFUA 4YELA 1Y8QB 1IZ1A 3S1QJ 1ETQA 2LF7A 3BLYA 2GQQA 4BHBA 1MBJA 2STTA 2DT5A 1XG1A 1JXSA 1HSJA 3TW7A 3CJTB 2E1CA 2FE3A 1SVMA 3DBLB 3C2GA 3ZCOA 3K9TA 3Q5FA 1QO0D 1K4SA 3WU2C 3J7AO 2JMWA 4XRSA 3PUBA 1IO2A 2HOEA 4B4CA 5DUKA 4IKFA 3RYRA 4C2TA 1MNMC 1VQOI 3TP0A 1USTA 2DOEA 3PQKA 3V8JA 4CCOA 2GOMA 3SQNA 2OAZA 2E36A 5C4XJ 2WY8Q 2RC4A 3OS2A 2IGOA 3LFKA 2QF7A 3U2RA 3K7AJ 4OWRB 1YW7A 3FK6A 1AWCA 2L9VA 3A2KA 3L00A 3LSHA 5CKTA 3H3VK 5F04A 1MMAA 4B1RA 2IPQX 2VQHA 2QLZA 2VQGA 3KP3A 4E70A 4IHTA 3ABKH 2HQRA 2Y48A 3E1SA 3KP6A 2ZSIB 3VFZA 4IRGA 3QU6A 4IO9F 3HDDA 5TGTA 3VYSB 4RB0A 1VQ8I 1X2NA 3IP4B 1QZEA 3H9GA 2IS2A 3P5JA 4N9IA 2V1UA 1W5CC 5E79C 3M3YJ 4E6KG 4A5MA 2R7OA 4W1UA 2GM4A 2NVXJ 4C3HJ 2HKOA 3BG5A 4HNTA 1YW9A 1NK3P 4M3BA 2W7NA 3BG6A 3M8EA 5D4RA 3CC4I 3DEWA 2QKLB 3SDGA 1GV2A 2KIQA 3TW6A 4BDYA 3QPSA 5J8CA 3S1NJ 5TISC 3CP8A 5F0FA 3CCVI 1NHAA 4C9YA 2QEXI 3WTTC 2FX0A 2MSYA 2VQCA 1YX5A 4AC0A 2VOPA 1G3YA 3W2VA 3LSRA 3DP7A 1U8RA 2VI6A 1XGMA 1GUUA 1X4PA 2X1EA 1SVOA 2R7RA 2L4MA 2H6BA 3F22A 4IOCF 4LD5A 4M9ZA 4E7KA 4BGDA 1G59A 4LB5A 3GFIA 3P9IA 2HXOA 3H9JA 5LGUA 2G7HA 2F5VA 4HPQA 3IKTA 2QGUA 2HZTA 3I53A 4R8HA 1XD7A 2M5WA 2WY7Q 4ZDPA 3IWZA 1SAXA 3RTRA 2V6EA 1ZR4A 3FX3A 4PFOA 3NARA 2DK5A 1JUPA 5F64A 1X1DA 1WJ5A 4FX0A 4IF4A 2HGCA 2K4JA 1YRNA 3VWBA 2FNAA 3QP6A 5M5XJ 4EMSA 5KVRA 1ZHFA 2RQQA 4B43A 4BEHA 4CZZA 1D5YA 4ZH4F 2IJLA 3M7GA 4EVIA 2KIMA 2LC2A 5LHHA 1XGOA 2RDPA 3HEFA 5E18F 1YS6A 2K9SA 4Z2YA 2KLOA 2NOJB 1WKMA 3VODA 2M2EA 1H89C 2W24A 4KT5C 1S5LC 2FMYA 3R60A 4WXHA 1UJ8A 1OCPA 3K4CA 3M07A 2LY1A 2DFEA 4JK1X 3OR1C 3HC7A 3Q9VA 5E3OA 1RR7A 5FFZA 1I1GA 3KPHA 1B4AA 1MDMA 2LTPA 1XX5A 4HNVA 4MEXF 1TT5B 2FBKA 1A36A 4O3MA 4JYKA 2ZNZA 5FGMA 1ZK8A 2EZKA 3BT9A 5IT9Z 4ZC3A 1SVLA 2OTLI 2XSDC 5DCFA 2E2JJ 2JRMA 2ZKZA 5B1AH 3MWMA 3N97A 1DU0A 5ED4A 2X48A 2VOOA 4A12A 1BBYA 4L5EA 2LFBA 4A3LJ 3FMSA 4B48A 2L54A 4BJ6C 4ETSA 5M5WJ 4GCVA 2KP6A 3OL3A 2ZMEB 2CW8A 3FM5A 4GYGA 2DTZA 1JKOC 5H6RA 3DEUA 2HWVA 4IVNA 4XRMA 2H27A 3H5NA 3IC7A 5HDNA 1X1AA 2EQRA 2K4BA 3RPQA 4ENKA 3BG9A 2ECBA 3IH3A 2XGXA 1WJFA 1FBUA 1VQ5I 3KX2A 1F43A 2PG4A 1B6AA 2BEOA 2EV6A 5KCMA 4UUSB 2KJCA 2KT0A 4BJTA 2DPUA 2K02A 3MEXA 2XAHA 2AHQA 1E3PA 2IS1A 4BDZA 3GTQJ 4CH7A 3K70D 2WAEA 3R4KA 1XCVA 3QRFF 2FXAA 2PMZN 5A2QK 2LKXA 4PGHA 1OCOH 4MTEA 1BR1A 5GPAA 2PMHA 5ICFA 2L7FP 4HF1A 4OAZA 4I0AA 3WHBA 2ZSHB 4E7LA 1R49A 1ZH5A 1OLTA 1D0ZA 2K7LA 3OYCA 2NRAC 5LD2C 1DP7P 1KQ9A 4ITVA 3F23A 3FISA 1HKTA 2GA1A 3CCEI 1TZLA 4UHTA 1T98A 1X19A 3S32A 3CP2A 4CXFA 3ABMH 3WG9A 2EFOA 1R5GA 1ZQ3P 3S3MA 2BY1A 1Z0XA 2HYGD 4QTRA 2Q8KA 1R7JA 1XDUA 5E20A 4CCNA 2BGCA 5BPDA 1K7AA 2GAUA 3OS0A 2XGDA 4CZCA 1VNDA 3WTUC 2MYSA 1OQYA 2OZUA 2D45A 5GAEJ 4RLQA 3HRTA 3BTJA 3AKZA 1YG2A 2QSFX 2MW8A 3JSPA 1LKXA 3AG3H 3CCLI 3M8FA 3CQZJ 1K4TA 4S04A 3C2BA 1VTNC 3OSGA 2DA5A 1IN8A 2LDUA 5IY5H 4O6JA 4U7BA 1SFUA 2OF7A 3FBNB 2HZDA 3H0DA 2CQ7A 2DA3A 1HCRA 2KZVA 3F6VA 1SMTA 1N25A 4EJWA 1E3OC 4AM3A 4XN3A 2NVTJ 1JI8A 3GF2A 2I10A 4Q48A 1V4RA 4G7ZF 4KUMA 2LSOA 2YX7A 4I09A 5GAHJ 4KMFA 4IJAA 2VXDA 2CUFA 3U1KA 3BWGA 3KCCA 4FX4A 3BDDA 5B1BH 2EV0A 3F6OA 4QLCU 3PO3J 2HQNA 3HOVJ 1LE8B 4LB6B 1W4MA 1XSDA 1VQLI 4CCLA 1OJLA 5L3CA 3MN2A 3I58A 3GBGA 1OMIA 2VLAA 4C2UA 1DGWY 3PFIA 2DOFA 1AKHA 2FOWA 3LSKA 3K4MA 4M71A 4OIQF 3K4LA 3S1MJ 2HU9A 1P92A 3MFKA 4L9NA 2X9DA 5KAIC 1V5FA 1G8XA 1GT0C 2IA2A 1Z6TA 3H5RA 3D5RC 1MMSA 1GHCA 3VEPA 1Y1WJ 3R61A 1D1CA 3HRSA 1WJCA 4G6DA 2FJ1A 3GTLJ 3ROUA 3TP3A 1PP7U 5H6QA 4C30A 3KYCB 4PJJA 2PFBA 5K5RA 2DA7A 5DS9A 3CCJI 2NVQJ 3GW2A 1GVJA 1WJDA 4RGSA 3QOEA 4DW6A 2JA8J 3WGIA 3OS1A 2XAJA 2HDCA 4YG2F 3GO5A 3U21A 2OZ6A 3E5QA 3HRUA 2K3FA 2F6CA 2KHMA 1YYVA 1YJWI 4U87A 4BQQA 2X0LA 4CICA 3GUDA 5LLQA 2B9SA 1QPIA 3CC7I 1S7OA 2A61A 1JT0A 1EF4A 2M9HA 2Q2EB 2WAFA 3T8RA 4YEJA 4QSHA 3OSFA 3TDZC 3HOXJ 2WADA 3H35A 2TDXA 4UVAA 1YE9A 1D1AA 4BQAA 3LQRA 3RKWA 1R4NB 1HDDC 2ZJQF 2E35A 2ADUA 4G7HF 3A02A 2Z2SB 2J5OA 3DKWA 4JBAA 1XDSA 2Z33A 1RKWA 5LRRA 4XLAA 3Q9SA 2ECCA 2DMPA 3GTMJ 3BTCA 3A4CA 3IKVA 1UMQA 4AIKA 1MMNA 1F9NA 3CDHA 4EJUA 4LG0A 5HLHA 1O3SA 2V1DA 5DUIA 3ZOBA 2B0LA 1IG7A 1J5YA 4F7ZA 1ULYA 3RKYA 3J81Z 5FROA 3DKYA 3PL8A 1R22A 4OU0A 3KYLA 1F36A 1K83J 1ZRFA 1USSA 1SAUA 2P4WA 4AYBN 4A3CJ 1T0FC 2O0YA 2E60A 2R7VA 2VPRA 3ZQGA 4D5CA 3PJRA 1UG2A 3QP5A 2JTVA 1LPQA 1MMGA 4LLLA 1BL0A 1U5TC 2WTEA 1YO5C 4DJAA 2WA0A 2ELHA 1H9GA 2ZXHA 1TQMA 2V79A 4PGGA 4XM3A 3LFUA 3QWLA 5HODA 1X3ZB 1MBEA 2JUCA 2ETHA 4AWXB 2BVMA 1FEXA 2LOOA 2MG4A 3KZZA 3TL4X 5DV5A 2IW5A 3RI4A 2XDVA 4NQWA 5DDGA 4HSTA 3SYTA 2W4SA 5ERIA 3M1EA 5E8IA 4E7ZA 2KFDA 4WX9A 1XCBA 2QENA 4BBSJ 1BN5A 3BOQA 4G7OF 2G9WA 1FBQA 1BM9A 1QZZA 4D7NA 2OCEA 3TEDA 3E97A 3ZMDA 3Q0UA 2IAIA 3D1NI 1EKEA 3IV5A 3FKIJ 3PUFA 2OPTA 1BJAA 2MGQA 4WXCA 2DQLA 1VQNI 1R23A 4KFCA 2MABA 5E1WA 3WODF 1QQIA 1UHSA 1DGRM 2VBWA 6PAXA 2HVQA 2VUMJ 1PVEA 1LFBA 4IEJA 3G4SI 2LVSA 2QKMB 4HOBA 2IGKA 5FLXZ 1WZ2A 3GEZA 4EV0A 5DYMA 3ZQCA 1XN7A 2QCOA 2VJIA 4UY8I 1OCZH 3T1BA 4OIRF 1SC7A 2RV8A 5FLVA 3ZMVA 3HKZN 1S29A 4HLYA 3W2AA 1B1BA 5KAFC 2K40A 5LGTA 1MJBA 4A93J 2ZBKA 5ILSA 1O3TA 3IRRA 4KMUX 3S3NA 1FZPB 2G0EA 4IZZA 1UG0A 3DF8A 4A6EA 2GXAA 2VBXA 1OR7C 4BQOA 4YFKF 4HA8A 2ESHA 1FMVA 2CJJA 2QVOA 1S6LA 1LEBA 1FIAA 1R58A 5EGOB 3KP5A 4HYEA 3D5LA 3G2BA 4KIBA 1BW6A 1FWZA 2Y0MA 5FJ8J 1Z77A 1ZG1A 3EQLF 2EPFA 3MZHA 3T5XA 1X2MA 1JKQC 2DMUA 3O8GA 4HQMA 3FMQA 5CVUA 5HVQC 5GTHC 4XLCA 4BS9A 4Y4RA 3HUGB 3FDYA 2X4HA 4C3JJ 5EZHA 4B8XA 3K2ZA 2KRCA 4XLFA 2Y2ZA 2UXNA 3K1NA 1N77A 2X1DA 3K4KA 5AONA 4EJOA 1O3RA 1A04A 1DPRA 1FMWA 3JRDA 1B72B 2CUJA 1WH7A 1WCMJ 4RBOA 5JHUA 1PP8F 1OCCH 3BY6A 3IAS2 3HXLA 3FMRA 1IDYA 3KZYA 2NVYJ 2QUFA 3VYUB 3FXMA 1SD7A 3VYRB 5IOZA 2AQFA 2PJPA 5CVIA 3BR1A 4GFBA 2OU2A 4RGUA 3MAJA 2Z99A 3FXOA 2LP0A 2CV0A 3ASNH 4R79A 2IRFG 3RZOJ 2XVCA 2MH2A 3V7SA 3ELKA 3TOAA 1RPWA 1W7PA 2IGMA 2I8DA 2A6HF 2VB6A 2PMUA 1G3WA 2O8XA 1ON2A 2OUMA 1LDKB 4EM2A 3KEYA 2DU9A 4KICA 2PBIA 4RAFA 2GA2A 2BXYA 4EGYA 2E5NA 1D0YA 1D1BA 2N8GA 4BHCA 1JE8A 1E2XA 2DO7A 3VPRA 2Q0OA 5LEJA 4PSWA 3QAHA 1GDTA 5DTDA 4EM1A 1PDNC 3PFYA 2NNYA 3DFGA 1DDNA 2COBA 3LMMA 5AIQA 4NB5A 3MKLA 2PN6A 3W6VA 2TRTA 1U5TA 2CS3A 3F72A 2L02A 3CMMA 3OYGA 2BV6A 2IGNA 2W84A 5ICGA 1IXSB 3GFJA 4FTHA 3A01B 3K4NA 3ZQ7A 5JVTA 4G6TB 2ZNYA 4PZJA 1UAAA 2EIMH 3DU5A 4H4KC 4XN0A 2ZMEC 1X1PA 2KIUA 1IRFA 2JZYA 4KIGA 3ZMTA 2CGPA 4IHYA 2CUZA 1S7AA 4BXXJ 4YFXF 1A5JA 4Q47A 2K9LA 5L3FA 4I01A 5IP9J 1Y0UA 1MBHA 3D0SA 4UUVA 3ZXSA 3E6DA 4KT6A 1MD0A 2GWRA 3CMAI 1C0WA 5LEKA 2GIVA 4P1WA 2VT3A 4DYQA 3JAMK 3B02A 3TO6A 2I5UA 5ICEA 4A3BJ 1OISA 3ESWB 3HGGA 2HVSA 2L9SA 2RREA 2EFQA 3LQQA 3GZ5A 4XLNF 1W0TA 5CJ9A 1V5GA 3BQYA 2PJRA 1FC3A 3KETA 1VQPI 4XSXF 1IUYA 5HS8A 2CG4A 4KDPA 2ELKA 1FYMA 3WE2A 3RYPA 1S7EA 5CVJA 3G6EI 2LREA 3ZPLA 2DOAA 2EZIA 2R92J 3HOZJ 2O61A 2ICWG 5DCMB 4UV9A 4XKWA 3HIFA 4RM2A 3M4OJ 3BCAA 4KITB 1XSVA 2A6TA 2RN7A 2FD5A 2WV1A 4DGWB 1KU3A 2D5VA 5LFAA 3QU3A 4D9JA 2IA1A 1FSEA 2CQXA 3DTEA 1IN6A 2O03A 1JUSA 3OYAA 2Y75A 4UUSA 3F8BA 3IL2A 4RB2C 1A35A 2E5ZA 3NAUA 2QQ9A 5EJCA 2R7FA 1H8AC 3ASOH 2P7CB 1BR2A 5J4YA 4EM0B 3FXRA 2OBPA 4XKCA 2YR2A 3LAJA 1R1TA 4FE4A 4NC7A 4I02A 3VB2A 4BJ5C 3G3ZA 4BXUA 3ECOA 2W25A 2QM3A 4D1QA 4M9SA 2OJED 3QPHA 1T2KA 2ME6A 3IUOA 3TBIA 2XRNA 1WPKA 3TGNA 1GXPA 5M5YJ 1JHFA 1T38A 4UXNA 4ZYAA 3AG2H 1HW1A 4KN7X 3OIQA 5HOOA 1S9HA 4MFDA 1FOYA 3KIOA 4GXOA 3MKWB 4E4HA 1PJRA 1ZYRF 2Q1ZB 3W3CA 2FNPA 3ONQA 2TCTA 2FOKA 2IVMA 1LFUP 1ETKA 4E7JA 5EEHA 5BS6A 4V2FA 4XL9A 3GFLA 3I54A 1NH3A 5HNFA 2Y31A 3K6GA 4CCJA 2KZGA 4M3GA 4M74A 2QBYA 4IHXA 1IW7F 1R5HA 2K3PA 4HRIA 2LNBA 1QRYA 2DODA 5E1ZB 2MFZA 3ZRGA 3CMYA 4HEA2 1BOBA 1HLVA 3LA7A 1YFHA 4A3FJ 5KHDA 2UZKA 2X6WA 1ZG5A 2FU4A 2YX4A 1QPMA 2CH0A 5E17F 4GO1A 1NG6A 3R6SA 4PJNA 2DYRH 2VJ5A 4ESFA 3OYKA 1OCTC 3QPTA 5D5VB 1ENHA 2M87A 5C4JJ 1WHUA 3LSTA 3ZQIA 2VE9A 3I71A 3LOCA 3I4NJ 4HV5A 1IDZA 2XF5A 1Z3YA 2MD0A 2C6YA 4QWQA 3L2WA 4DZPA 1RIOH 4KJZA 2RKHA 4U0YA 3KEOA 1Z7UA 1MMDA 4PK4A 2XB0X 3HZJA 1JHHA 5K5QA 3BG3A 1HC8A 1ZGAA 2DJNA 3CUQA 3FXLA 1EV7A 1JUMA 5FLMJ 4A3EJ 2LH9A 2HDWA 4DOZA 2X6OA 1SFKA 3HOSA 1J9IA 2ZO4A 2FRHA 4CCMA 1Z1DA 1B9NA 3HRMA 3OOPA 4BHPA 2AXTC 4MQ9F 3RDIA 5IP7J 4E7HA 3HGYA 3V42A 3VSKA 5JVGF 1N78A 2EINH 2DCEA 1OR7A 5K1YA 2BY3A 3DBRB 3N05A 1HBXG 1TNSA 2P7VB 4A6DA 1I50J 2XAQA 4PDKA 1IRGA 1W7PD 3JTGA 3LSPA 2DFHA 2OQRA 4XNFA 4RB1A 2D1HA 2EV5A 1OYYA 4PFPA 5IT3A 3OMYA 3COAC 2VJJA 3LSJA 1J09A 2O7OA 1BI0A 1N75A 3I55I 4A69C 3NRVA 1QVTA 1MH3A 1QHHD 3MQ0A 2HXIA 2VONA 2DAOA 3E3VA 4P96A 2ZXWH 1RUOA 2ZXIA 2E2HJ 4OINF 1ZRDA 3BR6A 2FSWA 2X51A 2P6TA 3ZMUA 2MLKA 2P8TA 4BBRJ 4KA4A 3KZIC 1POGA 4Q5SF 1WSUA 2MBFA 2Q2EA 3OV8A 2LBFB 1RETA 2YUSA 5D5WB 3AAFA 1G6NA 4HX8A 4EEFG 3A0HC 2EIKH 1AOYA 1L0OC 4CYCB 2JPCA 2XV4S 2R5YB 4H0EA 2QQ8A 2JSCA 3EETA 5FKMA 3HPHA 3KEQA 2M34A 2WB1N 3C3WA 5FKOA 1ZR2A 4MQVA 3HTSB 3MCZA 4DNCA 4G6QA 1S72I 2H09A 3HOYJ 4LOCA 3BC8A 1KYZA 4XLEA 4FQGA 5DD4A 3SEZA 5IYCJ 1D5VA 1TC3C 4GYIA 2BBYA 2R3SA 4LG0B 2D2WA 1F1ZA 5JFRA 2FQ3A 3GYHX 2D1VA 3DKXA 3K70C 2J5PA 4NNJA 1ERDA 5F0HA 3L1PA 5F1RA 1UHMA 4I99C 1QHGA 2K5CA 2K9MA 2YS9A 2L01A 2HOSA 4M73A 3GXOA 1ZAOA 1LQ1A 1JTXA 2DA6A 2ISYA 2M4GA 3O6BB 1KA8A 4F55A 4QIWN 4BACA 4C2MJ 2JT1A 3OL4A 4LLGF 1TLHB 3WGGA 5J1UA 3SHFA 2VKVA 3WU0A 1WWXA 2G7UA 4ZZLA 3GLLA 3WTSC 3CCRI 4P5OA 1UFMA 4IQJA 3FBIB 3GZNB 3KE2A 2H8RA 2WAQA 4AVPA 1A6IA 3JRGA 2A5YB 3GTJJ 4IHSA 1Y56A 3L2CA 2FF4A 3EDPA 1QBJA 4NC8A 4M6XA 3J7ZI 4LITA 5L3GA 3CO7C 4KIFA 1R9TJ 1TWFJ 1SMYF 2ZXJA 2WBMA 2HFHA 3BJOA 5CYVA 5D8KB 1BI3A 1G4DA 1SANA 4LGWA 3DPTA 4F52A 4X6AJ 4HW0A 3BR0A 4M72A 4HG2A 3TOBA 1NTCA 2EJRA 4ANJA 1K61A 3ISPA 1FJLA 1MNEA 2DFIA 1XMXA 2CU7A 1FX7A 2M0CA 3P7NA 2CV2A 5B66C 1YI2I 3OYIA 1Z67A 4W97A 3BP8A 1MSEC 1WGXA 2JA5J 2YU9J 1HW2A 2DTRA 2ZJ2A 3RIRA 3DLLF 4BE1A 2XUBA 4BE0A 2VC0A 2WAQN 4XR6A 3RZDJ 2Y30A 1SEUA 3BG7A 1KZHA 1MZBA 3RQIA 3JREA 1ZGJA 1XMKA 1H88C 3ABTA 5FKKA 5HLIA 3SEQA 4ESBA 3WTWC 1FNNA 2DW4A 5BPIA 2L4AA 5B3SH 5HS7A 1LVAA 1FT9A 3F8NA 5HS9A 3WTZA 4RM3A 4ZYDA 1K6OA 4JX4A 2L0KA 2V4JC 2Z9OA 4A0XA 2CW0F 3P9KA 3B73A 2AS5F 1OPCA 1HF0A 5IYBJ 4J19A 2HR3A 3CLQA 2BHZA 3MKZA 4RGXA 2QSGX 2HOTA 2V9PA 2L7ZA 4D5FA 4YIRX 3AL0B 1RUNA 1BA5A 1MBFA 3FHNA 2IA0A 1P2FA 4B3AA 3ULQB 2EFPA 3EUAA 3SZGA 3CESA 1PUEE 1CGPA 3GTOJ 2LRDA 3JRCA 1I3AA 1W36C 1O57A 4XOTA 1QNTA 4S05A 5IPAA 2ZMEA 4NBQA 1TNTA 3VSLA 4CA0A 1JKRC 1QGPA 4A3DJ 3KLOA 1ODDA 5EYRA 1R6RA 2ZFWA 3MMYB 1TBXA 4CGZA 3HHGA 2M8EA 3HUGA 2XB5A 4N9HA 2ZC2A 3I59B 3PM1A 3OYMA 3FZVA 2STWA 2X1CA 5E3MA 2F4MB 3C18A 5A2QZ 3TO7A 2R93J 3DV8A 4DBRA 3O3KA 4RDUA 2KDOA 2JQ7A 3GTPJ 2DT7B 3K4BA 2LY2A 1ON1A 1P6RA 3H0GJ 4IXAA 5CQEA 1WJBA 5EDNA 1ZREA 1DQUA 2X6XA 3S2HJ 4RLFA 3CO6C 3UKGA 2MC4A 2CQKA 2F4IA 1FIPA 2LKSA 4XIDA 1E0EA 4XICA 2HVRA 2LYCA 1BI2A 1T33A 5FD5A 1YIJI 1W5SA 4L9JA 2FA5A 4I0BA 3BZ6A 4KNYA 5F27A 3ECHA 1V55H 2E7XA 3G1LA 3MKYB 2H1LA 2NS0A 2XROA 1YJ9I 1ORKA 2EWNA 3T8TA 1R1UA 2LKPA 1A31A 1Y8RB 2RAEA 1F5TA 4ENNA 5GP9A 3ABUA 5EEAA 1ZKGA 3DEEA 4HDUA 3DXJF 1OCRH 4I76A 2ID3A 2NS7A 4ZDLA 3F21A 4JX6A 3I64A 1GXQA 3RJPA 3HSEA 1HXDA 1V3FA 1BJZA 4FETA 1ETYA 3JTHA 4UB6C 4LIUA 4DYRA 3E5UA 1KQ0A 5D4SA 5EF6A 4A3IJ 3E6BA 2ME0A 1JGGA 1RZ4A 2R7SA 2DJIA 4BKXA 2K86A 3GWZA 3KYDB 1E3HA 4ZDOA 2M7BA 5FD6A 2OCCH 3C2HA 3HB9A 3ZMZA 1SD4A 4BAYA 1XGSA 2PI0A 1ONVA 2WV0A 2V9VA 1QU3A 2EZHA 1OKRA 1YOVB 3V7CA 2NOGA 1EA3A 1S8NA 2LF8A 4ABZA 5HNHA 2OC6A 3CCUI 2DMTA 5E8GA 1TQPA 2NNNA 4HX7A 2VODA 3HM5A 4NC6A 1XGNA 3OYHA 2E1MB 1GLNA 3CUOA 1T08B 4CSWA 2XAUA 2XIGA 2MC3A 4HQEA 4WK8F 3QODA 1I1SA 5ICCA 2GZWA 3B6CA 3F8FA 4U7DA 3HHHA 5D5XB 3GLXA 1MDMB 2DDBA 2H6CA 4Z6YA 3S15J 1JJ8C 3VDXA 3MVPA 4AVZA 2CRGA 2VN2A 3FWEA 2ZJPF 2DI3A 4IPAA 4AIDA 2CFXA 2V7FA 4MNUA 2CUEA 3AG1H 3EYIA 1WH5A 3KLNA 2E34A 2L9RA 1FYLA 4IL6C 1LE8A 3K1MA 5JHFA 1FLIA 3AFHA 1YRNB 4MEYF 2E1NA 2VXZA 2W57A 4BEHB 4S0HB 5E3LA 2CFOA 2MD5A 3U1DA 4PJMA 4FISA 3E0JB 4BQNA 3FXUA 3KP4A 2GXBA 4U0WA 1DUXC 1HSTA 1W0UA 2QSHX 3OY9A 2FMLA 1AKHB 4YRVA 4EJVA 2B7EA 1YHQI 1ETVA 2P81A 3G73A 2VQLA 5DCMA 3H5AA 3LNQA 1Y6IA 2NXNB 1HW5A 2XC7A 4YFNF 2LLKA 3HYIA 3A1YA 4FHTA 1U9OA 1ZGWA 3K4JA 3S17J 2HPIA 3J7YJ 4XRFA 3BQZA 1LJ9A 2VJ4A 1LVKA 3S8PA 2KL4A 3CMEI 1VQ6I 4L5IA 2HOAA 4GGGA 3H3ZA 3JR9A 1FY7A 3G1MA 5DM7F 1B8IB 1IAWA 2JUGA 4RB3C 3I4PA 5E3NA 3QPLA 2R4GA 1YX3A 2M30A 4RAZA 2AO9A 2DK8A 2M4KA 4L9VA 2O3FA 4CYDA 1X1CA 4IOAF 3TO9A 5FO5A 3W6KB 5J4VA 5H20A 1AHDP 3HOUJ 3NWTA 4DZJA 1BR4A 1LFPA 4L5JA 3H92A 1BC8C 3LAPA 1RESA 2VE8A 1HKQA 2EB7A 1Y39A 2M0MA 1GVDA 4WF2A 1FTTA 5IYDJ 3E6MA 2RNJA 3LA2A 5GADJ 5HLTA 1I39A 3PNVA 1UCRA 1VQ4I 2BXZA 4I6ZA 4O5VA 4AIJA 1JKPC 5IT9K 1PUFA 2XF6A 3I0TA 1CF7B 1BW5A 2DMNA 5CVVA 2L3DA 1YW8A 2EA2A 3OYJA 5EG0B 1BIAA 4QPQA 4OMYA 1VZ0A 2PQ8A 3GVAA 3KP2A 2GLOA 3L7WA 3OYDA 3I5UA 4A0ZA 2NYXA 2KRFA 5CPRB 2UXXA 4F92B 5J1YA 1YITI 2A69F 1MBGA 1XC5A 2EK5A 1U0JA 4RA2A 5FRMA 4ZTFA 2XRLA 4L0YB 5FLXK 5L3DA 3M1CA 1Z9CA 1G3SA 4F91B 1IRXA 1WI3A 1R1VA 3CJRB 2RVCA 2HTSA 1I6HJ 1A6QA 3DLAA 2BE5F 3RSNA 1K6YA 1MJAA 1K78B 3QQAA 3LA3A 2WC2A 4ZJZA 4G8XA 2BHYA 3K2AA 2BY2A 1W36D 3FHZA 3IH4A 1IN7A 4R1HA 3H1CA 1T56A 5TJJA 4FASD 2DMQA 3K1PA 1VQMI 1R00A 2K9QA 2P6SA 4Y3OA 1FOKA 2F5CA 3VYTB 1MH4A 2W82A 4X1EA 1XS9A 2H8WA 3CUQB 4TV7A 2R0QC 4NQWB 3DTKA 2BOLA 3DBHB 1KU7A 1Q1HA 4BH9A 4G94A 4CDGA 1TW3A 1SFXA 2Z5UA 3CLOA 2L7KA 5CQGA 1D8KA 2NS8A 4XMYA 4KYWA 2M1BA 4HV6A 4PCQA 2V1XA 1XPXA 3OR2C 2PX9A 2KQRA 3GTGJ 3UNGC 3LSIA 1X3UA 2Z16A 4JQFA 4DYCA 1H9TA 3CCYA 4HAMA 2XASA 3DU6A 4AIHA 3ABLH 2R7DA 3S2DJ 3HL2A 4Y7NJ 1IXRC 3RKQA 2R7QA 4M9XA 1REPC 1KU9A 3F8CA 1F4KA 3A0BC 2KJBA 1V5EA 4ENMA 1EH6A 3IAM2 4IQ4A 1G2HA 1S3JA 2E2IJ 4BL0B 3GCMA 3V8KA 3L2VA 2HTJA 2CO5A 3GX4X 3BZCA 5LHIA 4CHUA 4M3DA 1J7KA 3JRFA 3C7JA 3RCOA 2CMPA 2BY0A 5BMZA 1HDPA 3CDLA 2ZB9A 4LK1F 1J59A 3S16J 2M3AA 2R5ZB 1HA8A 1I5ZA 3LSMA 1R5ID 2DXIA 4GRIA 2VPLA 1FPQA 2WB1A 1XTAA 5DEQA 3WU1B 3SZPA 4MTDA 2OQGA 1Y0NA 5GAGJ 2ISZA 5HLGA 2M45A 3PQJA 2LY9A 5LBQA 5LRSA 4J01A 3PSFA 4X0GA 1IF1A 4II2A 2XF7A 1E17A 2V1NA 3BTLA 5KK1A 4RAGA 2JVHA 3CJNA 1ETOA 3PSIA 3ZQQA 1TT0A 4XK4A 3KP7A 2P5VA 4K2EA 4GDFA 2DA2A 1RNLA 1XSXA 3HBLA 3S2WA 3I56I 2O5RA 3J81K 3ZQHA 1T0FA 2BW3A 3ZN1A 4B3XA 4BNCA 5J3LA 1R71A 4BXFA 4BU2A 2JRTA 2COMA 1UELB 2DDAA 3O2PE 4XORA 4A3GJ 1EH7A 3FIWA 1DP3A 1M1EB 5FKNA 2K9NA 4V2GA 4HX4A 1D0XA 3ZR8X 5JI6A 1MJ9A 3CCSI 4MIMA 3IRQA 2CW7A 3H3UA 3BPXA 3MZYA 1B72A 3CZ6A 1UZCA 5FFXA 1MNDA 1IRZA 1TWHJ 4FCYA 4OIPF 2IS6A 1U78A 1CQTA 1P4AA 5EZGA 3CD6I 4M3FA 2LG4A 4OAYA 2GXGA 2MLGA 1LB2A 1FTZA 1Z21A 1STZA 2QYOA 1WI9A 3K0LA 4ZZDA 2VC1A 3SZTA 4DQ2A 2NAZA 4XQFA 3EYYA 4E7SA 2L9NA 3ZQLA 3QYEA 3RPUA 1U6GA 2E1MC 2VL8A 1ZARA 3CUQC 3FM3A 1W7PB 1SD5A 2K27A 2Y9YA 2VASA 4N4OB 4IRHA 4Y13A 3OYBA 5F6FA 3FKJA 3W6JB 2JJ7A 3X2QH 1T95A 4RMNA 4FT8A 4ZYHA 3BZKA 3I9V2 2DFFA 3C1DA 2EILH 5LHGA 2XKOA 1X1BA 3V7RA 4IRIA 2ACJA 2XKPA 2IXSA 3WTXC 3S1RJ 3BROA 2EFNA 3PIPF 4CUGA 4NDLA 1P4WA 3DPLC 3SJMA 1AA7A 2DA4A 3CCQI 3S14J 1TWCJ 2K85A 3A01A 1KONA 1V54H 3S93A 2BYVE 1K79A 2OD5A 3IH2A 5HDKA 3KFWX 3ZGKA 4QPOA 3OWTA 1IV6A 3E5XA 2E19A 3BR2A 5D6FA 2R7TA 5F1JA 3OYEA 3GTKJ 4LK0F 3VOEA 1GV5A 1WVRA 1O7FA 2F2EA 2IEKA 2XGEA 1P7IA 1B59A 5J47A 4L0ZB 1J2XA 2HDDA 1QZYA 4UVCA 5C3EJ 1R4MB 2VKDA 4G9YA 2A07F 4BE2A 1YQAA 1VQKI 2DN0A 1FYKA 2VKHA 3NEUA 3QYFA 2OV7A 2F48A 4I7HA 2L2OA 3EPZA 4PUSA 2QA4I 4HF0A 2FBIA 1YTYA 3M8JA 2A5WA 2KMUA 2W48A 2HYFA 1NG7A 3BJAA 2PJRB 1XB4A 1YS7A 3W2WA 2F5EA 1B9MA 1TP4A 2M8GX 5J40A 3EUHC 5DM6F 4PSXA 5J1RA 2DQRA
chains in the Genus database with same CATH topology
1Z05A 1BIBA 1YIOA 4ON0A 1P4XA 4EQQA 2HKXA 4B09A 3I59A 3FF5A 4U88A 1KU2A 5LGNA 5ILUA 3LWFA 1T6SA 5D8LB 1FSHA 1RI7A 2OA4A 4HF2A 2VBYA 2VT2A 1KGSA 3WGHA 1ZRCA 3F3XA 1ZN2A 2RQPA 4MHGA 2MH9A 4HZFA 2YU3A 4L9TA 3TDUC 3P9CA 2W85A 3T0YA 2YPRA 4Q4ZF 5AIPA 4LLNA 1ZLKA 1U2WA 1Z6RA 3TQNA 5BOXA 3M9AA 1LEAA 1J75A 1WQ2A 1IN4A 3R0AA 2F5DA 2CWEA 3FXQA 3JW4A 2KIFA 1MKMA 3ZN0A 5CVRA 1BC7C 2Z3YA 3NQOA 5L3EA 4P55A 1J0RA 4HLXA 4KN4X 4OOIA 4AD9A 3K69A 1R36A 3BPVA 1EH8A 2PEXA 2XHKA 4NHJA 1MGTA 1YLFA 1Z91A 4UNOA 2YSRA 1T39A 1D3YA 1OYWA 2EA4A 3F8MA 1SD6A 1HKSA 2ESNA 4P9UA 1LDDA 3R0JA 2F5FA 3ZP5A 5K5OA 3GZ6A 1U5TB 1H0MA 2V6CA 1FP1D 3WE3A 3SXYA 2VBZA 1G3TA 4LMYA 3ERED 1ZG3A 4RS8A 4A0YA 4EGZA 3EUHA 3BJ6A 5J8FA 1UHWA 1KYWA 3GFMA 3L9FA 2JPBA 1SFEA 3HSRA 3V4GA 4A5NA 1FBSA 3J80Z 2H94A 3JAMZ 1DPUA 4Y17A 1IXCA 3DQVC 3WTVC 4L18B 2P5LC 4HBLA 4WCGA 5D5UB 2QQBA 5E1XA 4RGRA 2IT0A 5DD8A 1LDJA 4LJZF 1O3QA 3ZMSA 3IHUA 1XMAA 4M6YA 5ILVA 1CF7A 2QWWA 4RAYA 5BQTA 2A68F 3E6CC 3J80K 5CLSA 1IN5A 4Y15A 1L3LA 4ASNA 4YIIA 3REOA 2XAFA 1U3EM 1JGSA 4WWCA 4MGRA 5D6EA 4WXDA 2PLYA 1BOAA 2CSOA 4LFUA 2DLLA 4N0BA 5FB2A 3U9GA 5L3BA 4I98B 1K78A 1TW2A 2XAGA 3SFZA 3HTUA 3JSOA 2UWMA 1HQCA 2FEZA 2AXLA 1O7LA 1KQ8A 2HS5A 4D0PA 4UV8A 1I6XA 1OYIA 3V8LA 4EJTA 4CO8A 3TKYA 2QBYB 4ZYGA 2RGVA 2A3SA 2CYYA 5J6XA 1ZLJA 2IP2A 5TRDA 4HDVA 1TTYA 4XSZF 2ZCWA 2EFWA 4YIFA 2A6EF 4P9FA 3RKXA 1WRJA 4BYYA 2DPDA 3ML6A 2MA3A 3QOPA 1LNWA 1TQIA 2E7WA 1W5TA 2KKOA 4U0VA 1I27A 2QQAA 3N4MA 3WTYC 4ENJA 3CTAA 3HSFA 3L09A 1BI1A 4ZYEA 2O6GE 2QZ8A 4UVBA 4OMZA 2P5KA 4I2OA 2WWYA 4A2UA 4ESJA 1UB9A 4OIOF 2DBBA 3HOTA 5HDGA 3IWFA 2FBHA 1FP2A 1D8JA 5EEGA 4XLPF 2HEOA 5JR3A 4XBFA 1IZ1A 2LF7A 2GQQA 4BHBA 2STTA 2DT5A 1JXSA 1HSJA 2E1CA 2FE3A 3K9TA 3Q5FA 1QO0D 3J7AO 2HOEA 5DUKA 3RYRA 1USTA 3PQKA 3V8JA 3SQNA 2OAZA 2RC4A 3LFKA 3U2RA 1YW7A 1AWCA 3L00A 4E70A 4IHTA 2IPQX 2QLZA 3KP3A 2HQRA 2Y48A 3KP6A 3VFZA 4IRGA 3QU6A 4RB0A 2V1UA 4N9IA 4A5MA 2HKOA 1YW9A 3M8EA 5D4RA 5J8CA 1NHAA 3WTTC 2VOPA 1G3YA 3DP7A 1U8RA 1XGMA 2L4MA 2H6BA 3F22A 4LD5A 4M9ZA 4LB5A 3GFIA 3P9IA 5LGUA 2G7HA 3IKTA 2HZTA 3I53A 4R8HA 1XD7A 2M5WA 3IWZA 1SAXA 3RTRA 3FX3A 2DK5A 5F64A 4FX0A 4IF4A 2HGCA 2K4JA 2FNAA 3QP6A 4EMSA 5KVRA 1ZHFA 4CZZA 4ZH4F 2IJLA 3M7GA 4EVIA 2KIMA 5LHHA 1XGOA 2RDPA 5E18F 1YS6A 4Z2YA 1WKMA 3VODA 2W24A 4KT5C 2FMYA 3R60A 4WXHA 4JK1X 3Q9VA 5FFZA 1I1GA 1B4AA 1MDMA 4MEXF 2FBKA 4O3MA 2ZNZA 5FGMA 5IT9Z 5DCFA 2ZKZA 3N97A 3MWMA 5ED4A 2VOOA 4A12A 1BBYA 3FMSA 2L54A 4ETSA 4GCVA 2ZMEB 3FM5A 4GYGA 5H6RA 3DEUA 2HWVA 4IVNA 2H27A 3IC7A 5HDNA 2K4BA 3RPQA 4ENKA 2XGXA 1FBUA 2PG4A 1B6AA 2BEOA 2EV6A 2KJCA 2DPUA 2K02A 3MEXA 2XAHA 3QRFF 3R4KA 1XCVA 2FXAA 5A2QK 4PGHA 4MTEA 2PMHA 5ICFA 4HF1A 4I0AA 1ZH5A 2K7LA 2NRAC 1DP7P 1KQ9A 3F23A 1HKTA 2GA1A 4UHTA 1T98A 4CXFA 3WG9A 2EFOA 1R5GA 2HYGD 2Q8KA 1R7JA 1XDUA 5E20A 2BGCA 5BPDA 1K7AA 2GAUA 3WTUC 2OZUA 2D45A 3HRTA 1YG2A 3JSPA 3M8FA 4S04A 1VTNC 1IN8A 2LDUA 4O6JA 4U7BA 1SFUA 3F6VA 1SMTA 4EJWA 3GF2A 4Q48A 1V4RA 4G7ZF 4KUMA 2LSOA 2YX7A 4I09A 4KMFA 4IJAA 3BWGA 3KCCA 4FX4A 3BDDA 2EV0A 3F6OA 4QLCU 2HQNA 4LB6B 1W4MA 1XSDA 5L3CA 3I58A 1OMIA 3PFIA 4M71A 4OIQF 1P92A 3MFKA 4L9NA 2IA2A 1Z6TA 1GHCA 3VEPA 3R61A 3HRSA 4G6DA 3ROUA 1PP7U 5H6QA 5K5RA 2PFBA 3GW2A 1GVJA 4RGSA 3WGIA 2XAJA 2HDCA 4YG2F 3GO5A 2OZ6A 3E5QA 3HRUA 1YYVA 2X0LA 4CICA 3GUDA 5LLQA 1S7OA 2A61A 3T8RA 3TDZC 2TDXA 4UVAA 4BQAA 3LQRA 3RKWA 2ADUA 4G7HF 2J5OA 3DKWA 4JBAA 1XDSA 2Z33A 5LRRA 3Q9SA 3IKVA 4AIKA 1F9NA 3CDHA 4EJUA 4LG0A 5HLHA 1O3SA 2V1DA 5DUIA 2B0LA 1J5YA 4F7ZA 1ULYA 3J81Z 3RKYA 1R22A 4OU0A 1ZRFA 1USSA 2P4WA 2O0YA 3QP5A 2JTVA 4LLLA 1U5TC 2WTEA 1YO5C 2ELHA 1H9GA 1TQMA 2V79A 4PGGA 2ETHA 4AWXB 3KZZA 5DV5A 2IW5A 3RI4A 4NQWA 5DDGA 5ERIA 3M1EA 5E8IA 4WX9A 1XCBA 2QENA 1BN5A 3BOQA 4G7OF 2G9WA 1FBQA 1BM9A 1QZZA 3E97A 3ZMDA 1BJAA 4WXCA 2DQLA 1R23A 4KFCA 5E1WA 3WODF 1QQIA 2VBWA 6PAXA 4HOBA 5FLXZ 3GEZA 4EV0A 5DYMA 1XN7A 3T1BA 4OIRF 2RV8A 3ZMVA 1S29A 4HLYA 1B1BA 5LGTA 1MJBA 2ZBKA 5ILSA 1O3TA 3IRRA 4KMUX 1FZPB 3DF8A 4A6EA 2VBXA 4YFKF 4HA8A 2ESHA 2QVOA 1S6LA 1LEBA 1R58A 3KP5A 4HYEA 3D5LA 4KIBA 1FWZA 2Y0MA 1ZG1A 3EQLF 3MZHA 3T5XA 4HQMA 3FMQA 5CVUA 5HVQC 2X4HA 4B8XA 3K2ZA 2UXNA 3K1NA 5AONA 4EJOA 1O3RA 1A04A 1DPRA 1PP8F 5JHUA 3BY6A 3FMRA 3KZYA 2QUFA 1SD7A 2PJPA 5CVIA 2OU2A 4RGUA 3MAJA 2Z99A 4R79A 2IRFG 2XVCA 2MH2A 3V7SA 3ELKA 3TOAA 1W7PA 2A6HF 2PMUA 1G3WA 2O8XA 1ON2A 1LDKB 4EM2A 4KICA 2DU9A 2PBIA 2GA2A 4EGYA 4BHCA 1JE8A 1E2XA 2DO7A 2Q0OA 5LEJA 1PDNC 3QAHA 4EM1A 2NNYA 3DFGA 1DDNA 5AIQA 4NB5A 2PN6A 1U5TA 3F72A 2L02A 2BV6A 2W84A 5ICGA 1IXSB 3GFJA 3ZQ7A 5JVTA 2ZNYA 4PZJA 2KIUA 2CGPA 1IRFA 2JZYA 4KIGA 3ZMTA 1S7AA 4YFXF 4Q47A 5L3FA 4I01A 1Y0UA 3D0SA 4UUVA 3E6DA 1MD0A 2GWRA 1C0WA 5LEKA 2GIVA 2VT3A 3JAMK 3B02A 3TO6A 5ICEA 2EFQA 3LQQA 3GZ5A 4XLNF 5CJ9A 1FC3A 3KETA 1IUYA 4XSXF 5HS8A 2CG4A 4KDPA 1FYMA 3WE2A 3RYPA 5CVJA 3ZPLA 2O61A 5DCMB 4UV9A 3HIFA 1XSVA 2RN7A 1KU3A 3QU3A 2IA1A 1FSEA 1IN6A 2O03A 2Y75A 3F8BA 3IL2A 4RB2C 2QQ9A 2R7FA 2P7CB 4EM0B 3FXRA 2OBPA 2YR2A 3LAJA 1R1TA 4I02A 3VB2A 3G3ZA 4BXUA 3ECOA 2W25A 2QM3A 4M9SA 3QPHA 1T2KA 2XRNA 3TGNA 1GXPA 1JHFA 1T38A 4UXNA 1HW1A 4KN7X 5HOOA 4GXOA 1ZYRF 2FNPA 2FOKA 2IVMA 5EEHA 5BS6A 3GFLA 3I54A 4M74A 2QBYA 1IW7F 1R5HA 2LNBA 5E1ZB 3LA7A 1YFHA 2UZKA 1ZG5A 2FU4A 2YX4A 1QPMA 5E17F 4GO1A 3R6SA 4ESFA 3QPTA 5D5VB 2M87A 3LSTA 2VE9A 3I71A 4HV5A 2C6YA 4QWQA 1RIOH 2RKHA 4U0YA 3KEOA 1Z7UA 1JHHA 5K5QA 1ZGAA 3CUQA 1EV7A 3HOSA 1J9IA 2ZO4A 2FRHA 1Z1DA 1B9NA 3HRMA 3OOPA 4BHPA 4MQ9F 3RDIA 1OR7A 5K1YA 1HBXG 1TNSA 2P7VB 4A6DA 2XAQA 4PDKA 1IRGA 1W7PD 3JTGA 2OQRA 4RB1A 2D1HA 2EV5A 1OYYA 5IT3A 3COAC 1BI0A 3NRVA 3MQ0A 2VONA 2DAOA 3E3VA 4P96A 1RUOA 4OINF 1ZRDA 2FSWA 2P6TA 3ZMUA 2MLKA 2P8TA 4KA4A 4Q5SF 1WSUA 2MBFA 2Q2EA 3OV8A 5D5WB 3AAFA 1G6NA 4HX8A 1AOYA 1L0OC 2JPCA 2XV4S 4H0EA 2JSCA 3EETA 3KEQA 3C3WA 4MQVA 3HTSB 3MCZA 4DNCA 4G6QA 2H09A 1KYZA 5DD4A 1D5VA 4GYIA 2BBYA 2R3SA 4LG0B 2D2WA 1F1ZA 5JFRA 2FQ3A 3GYHX 2D1VA 2J5PA 5F1RA 1UHMA 2L01A 4M73A 3GXOA 1ZAOA 1LQ1A 2ISYA 3O6BB 1KA8A 2JT1A 4LLGF 1TLHB 3WGGA 3SHFA 3WU0A 1WWXA 2G7UA 4ZZLA 3WTSC 4P5OA 1UFMA 3KE2A 4AVPA 2A5YB 4IHSA 3L2CA 2FF4A 3EDPA 1QBJA 4M6XA 5L3GA 3CO7C 4KIFA 1SMYF 2ZXJA 3BJOA 2HFHA 5CYVA 5D8KB 1BI3A 1G4DA 4LGWA 3DPTA 4HW0A 4M72A 3TOBA 2EJRA 3ISPA 2DFIA 1FX7A 3P7NA 3BP8A 1HW2A 2DTRA 2ZJ2A 3RIRA 2XUBA 2VC0A 1MZBA 1ZGJA 1XMKA 3ABTA 5HLIA 4ESBA 3WTWC 1FNNA 2DW4A 1MDMB 2L4AA 5BPIA 5HS7A 1LVAA 1FT9A 3F8NA 5HS9A 3WTZA 4ZYDA 1K6OA 2Z9OA 4A0XA 2CW0F 3P9KA 3B73A 2AS5F 1OPCA 2HR3A 4RGXA 1RUNA 2IA0A 1P2FA 3ULQB 2EFPA 1PUEE 1CGPA 1O57A 1QNTA 4S05A 2ZMEA 1TNTA 1QGPA 3KLOA 1ODDA 2ZFWA 1TBXA 4CGZA 3HHGA 2M8EA 3HUGA 4N9HA 3I59B 3FZVA 2STWA 3C18A 5A2QZ 3TO7A 3DV8A 3O3KA 1ON1A 1P6RA 4IXAA 1ZREA 3CO6C 2CQKA 5FD5A 1BI2A 1W5SA 4L9JA 2FA5A 4I0BA 3BZ6A 4KNYA 3ECHA 2E7XA 2NS0A 2XROA 2EWNA 3T8TA 1R1UA 2LKPA 1F5TA 4ENNA 3ABUA 4HDUA 3DXJF 3F21A 3I64A 1GXQA 3RJPA 3HSEA 1HXDA 1V3FA 3JTHA 3E5UA 1KQ0A 5D4SA 3E6BA 1RZ4A 2K86A 3GWZA 5FD6A 3ZMZA 1SD4A 4BAYA 1XGSA 2PI0A 1ONVA 2WV0A 2V9VA 1OKRA 3V7CA 1S8NA 2LF8A 5E8GA 1TQPA 2NNNA 4HX7A 2VODA 1XGNA 3CUOA 2XIGA 2MC3A 4HQEA 4WK8F 1I1SA 5ICCA 2GZWA 3F8FA 4U7DA 3HHHA 5D5XB 3GLXA 2H6CA 2VN2A 3FWEA 2DI3A 4IPAA 2CFXA 4MNUA 3EYIA 3KLNA 1FYLA 1FLIA 3K1MA 4MEYF 2E1NA 2VXZA 2W57A 2MD5A 3U1DA 2GXBA 3FXUA 3KP4A 4U0WA 1DUXC 1HSTA 2FMLA 4EJVA 3G73A 5DCMA 1HW5A 4YFNF 3HYIA 4FHTA 4XRFA 1LJ9A 4L5IA 4GGGA 3H3ZA 1FY7A 1IAWA 4RB3C 3I4PA 2M30A 4RAZA 2DK8A 4L9VA 2O3FA 4CYDA 3TO9A 5FO5A 3W6KB 5H20A 4L5JA 3H92A 1BC8C 3LAPA 2VE8A 1HKQA 2EB7A 4WF2A 3E6MA 2RNJA 3LA2A 1UCRA 4O5VA 4AIJA 5IT9K 3I0TA 1CF7B 5CVVA 2L3DA 1YW8A 2EA2A 1BIAA 4OMYA 2PQ8A 3GVAA 3KP2A 3L7WA 3I5UA 4A0ZA 2NYXA 2KRFA 2UXXA 2A69F 2EK5A 4L0YB 5FLXK 5L3DA 1Z9CA 1G3SA 1R1VA 2RVCA 2HTSA 2BE5F 1MJAA 1K78B 3LA3A 2WC2A 4G8XA 3FHZA 1IN7A 4R1HA 5TJJA 3K1PA 1R00A 2P6SA 1FOKA 2F5CA 3CUQB 4TV7A 1KU7A 1Q1HA 4BH9A 4G94A 4CDGA 1TW3A 1SFXA 2Z5UA 3CLOA 1D8KA 4KYWA 2M1BA 4HV6A 4PCQA 2V1XA 1X3UA 4JQFA 1H9TA 4HAMA 2XASA 4AIHA 2R7DA 1IXRC 4M9XA 1REPC 1KU9A 1F4KA 3F8CA 2KJBA 4ENMA 1EH6A 1S3JA 3V8KA 2HTJA 2CO5A 3GX4X 5LHIA 4CHUA 1J7KA 3C7JA 5BMZA 4LK1F 1J59A 1I5ZA 1FPQA 3WU1B 5DEQA 3SZPA 4MTDA 2OQGA 2ISZA 5HLGA 2M45A 3PQJA 5LBQA 5LRSA 1IF1A 1E17A 5KK1A 3CJNA 3KP7A 2P5VA 4K2EA 1RNLA 1XSXA 3S2WA 3J81K 1T0FA 3ZN1A 4BNCA 2JRTA 2COMA 3O2PE 1EH7A 4HX4A 5JI6A 1MJ9A 3IRQA 3H3UA 3BPXA 3MZYA 5FFXA 4OIPF 1U78A 1P4AA 2GXGA 2MLGA 1LB2A 1STZA 2QYOA 1WI9A 3K0LA 4ZZDA 2VC1A 3SZTA 4DQ2A 2NAZA 3EYYA 3RPUA 1U6GA 3CUQC 1ZARA 3FM3A 1W7PB 1SD5A 2K27A 4IRHA 4Y13A 5F6FA 3W6JB 4FT8A 4ZYHA 3C1DA 5LHGA 2XKOA 3V7RA 4IRIA 2ACJA 2XKPA 3WTXC 3BROA 2EFNA 1P4WA 3DPLC 1K79A 2BYVE 2OD5A 5HDKA 3KFWX 3E5XA 5D6FA 4LK0F 3VOEA 1O7FA 2F2EA 1B59A 4L0ZB 1J2XA 1QZYA 4UVCA 4G9YA 2A07F 1YQAA 1FYKA 3NEUA 4I7HA 4HF0A 2FBIA 1YTYA 2HYFA 3BJAA 1XB4A 1YS7A 2F5EA 1B9MA 2DQRA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1Z05 A;  1BIB A;  1YIO A;  4ON0 A;  1P4X A;  4EQQ A;  2HKX A;  4B09 A;  3I59 A;  3FF5 A;  4U88 A;  1KU2 A;  5LGN A;  5ILU A;  3LWF A;  1T6S A;  5D8L B;  1FSH A;  1RI7 A;  2OA4 A;  4HF2 A;  2VBY A;  2VT2 A;  1KGS A;  3WGH A;  1ZRC A;  3F3X A;  1ZN2 A;  2RQP A;  4MHG A;  2MH9 A;  4HZF A;  2YU3 A;  4L9T A;  3TDU C;  3P9C A;  2W85 A;  3T0Y A;  2YPR A;  4Q4Z F;  5AIP A;  4LLN A;  1ZLK A;  1U2W A;  1Z6R A;  3TQN A;  5BOX A;  3M9A A;  1LEA A;  1J75 A;  1WQ2 A;  1IN4 A;  3R0A A;  2F5D A;  2CWE A;  3FXQ A;  3JW4 A;  2KIF A;  1MKM A;  3ZN0 A;  5CVR A;  1BC7 C;  2Z3Y A;  3NQO A;  5L3E A;  4P55 A;  1J0R A;  4HLX A;  4KN4 X;  4OOI A;  4AD9 A;  3K69 A;  1R36 A;  3BPV A;  1EH8 A;  2PEX A;  2XHK A;  4NHJ A;  1MGT A;  1YLF A;  1Z91 A;  4UNO A;  2YSR A;  1T39 A;  1D3Y A;  1OYW A;  2EA4 A;  3F8M A;  1SD6 A;  1HKS A;  2ESN A;  4P9U A;  1LDD A;  3R0J A;  2F5F A;  3ZP5 A;  5K5O A;  3GZ6 A;  1U5T B;  1H0M A;  2V6C A;  1FP1 D;  3WE3 A;  3SXY A;  2VBZ A;  1G3T A;  4LMY A;  3ERE D;  1ZG3 A;  4RS8 A;  4A0Y A;  4EGZ A;  3EUH A;  3BJ6 A;  5J8F A;  1UHW A;  1KYW A;  3GFM A;  3L9F A;  2JPB A;  1SFE A;  3HSR A;  3V4G A;  4A5N A;  1FBS A;  3J80 Z;  2H94 A;  3JAM Z;  1DPU A;  4Y17 A;  1IXC A;  3DQV C;  3WTV C;  4L18 B;  2P5L C;  4HBL A;  4WCG A;  5D5U B;  2QQB A;  5E1X A;  4RGR A;  2IT0 A;  5DD8 A;  1LDJ A;  4LJZ F;  1O3Q A;  3ZMS A;  3IHU A;  1XMA A;  4M6Y A;  5ILV A;  1CF7 A;  2QWW A;  4RAY A;  5BQT A;  2A68 F;  3E6C C;  3J80 K;  5CLS A;  1IN5 A;  4Y15 A;  1L3L A;  4ASN A;  4YII A;  3REO A;  2XAF A;  1U3E M;  1JGS A;  4WWC A;  4MGR A;  5D6E A;  4WXD A;  2PLY A;  1BOA A;  2CSO A;  4LFU A;  2DLL A;  4N0B A;  5FB2 A;  3U9G A;  5L3B A;  4I98 B;  1K78 A;  1TW2 A;  2XAG A;  3SFZ A;  3HTU A;  3JSO A;  2UWM A;  1HQC A;  2FEZ A;  2AXL A;  1O7L A;  1KQ8 A;  2HS5 A;  4D0P A;  4UV8 A;  1I6X A;  1OYI A;  3V8L A;  4EJT A;  4CO8 A;  3TKY A;  2QBY B;  4ZYG A;  2RGV A;  2A3S A;  2CYY A;  5J6X A;  1ZLJ A;  2IP2 A;  5TRD A;  4HDV A;  1TTY A;  4XSZ F;  2ZCW A;  2EFW A;  4YIF A;  2A6E F;  4P9F A;  3RKX A;  1WRJ A;  4BYY A;  2DPD A;  3ML6 A;  2MA3 A;  3QOP A;  1LNW A;  1TQI A;  2E7W A;  1W5T A;  2KKO A;  4U0V A;  1I27 A;  2QQA A;  3N4M A;  3WTY C;  4ENJ A;  3CTA A;  3HSF A;  3L09 A;  1BI1 A;  4ZYE A;  2O6G E;  2QZ8 A;  4UVB A;  4OMZ A;  2P5K A;  4I2O A;  2WWY A;  4A2U A;  4ESJ A;  1UB9 A;  4OIO F;  2DBB A;  3HOT A;  5HDG A;  3IWF A;  2FBH A;  1FP2 A;  1D8J A;  5EEG A;  4XLP F;  2HEO A;  5JR3 A;  4XBF A;  1IZ1 A;  2LF7 A;  2GQQ A;  4BHB A;  2STT A;  2DT5 A;  1JXS A;  1HSJ A;  2E1C A;  2FE3 A;  3K9T A;  3Q5F A;  1QO0 D;  3J7A O;  2HOE A;  5DUK A;  3RYR A;  1UST A;  3PQK A;  3V8J A;  3SQN A;  2OAZ A;  2RC4 A;  3LFK A;  3U2R A;  1YW7 A;  1AWC A;  3L00 A;  4E70 A;  4IHT A;  2IPQ X;  2QLZ A;  3KP3 A;  2HQR A;  2Y48 A;  3KP6 A;  3VFZ A;  4IRG A;  3QU6 A;  4RB0 A;  2V1U A;  4N9I A;  4A5M A;  2HKO A;  1YW9 A;  3M8E A;  5D4R A;  5J8C A;  1NHA A;  3WTT C;  2VOP A;  1G3Y A;  3DP7 A;  1U8R A;  1XGM A;  2L4M A;  2H6B A;  3F22 A;  4LD5 A;  4M9Z A;  4LB5 A;  3GFI A;  3P9I A;  5LGU A;  2G7H A;  3IKT A;  2HZT A;  3I53 A;  4R8H A;  1XD7 A;  2M5W A;  3IWZ A;  1SAX A;  3RTR A;  3FX3 A;  2DK5 A;  5F64 A;  4FX0 A;  4IF4 A;  2HGC A;  2K4J A;  2FNA A;  3QP6 A;  4EMS A;  5KVR A;  1ZHF A;  4CZZ A;  4ZH4 F;  2IJL A;  3M7G A;  4EVI A;  2KIM A;  5LHH A;  1XGO A;  2RDP A;  5E18 F;  1YS6 A;  4Z2Y A;  1WKM A;  3VOD A;  2W24 A;  4KT5 C;  2FMY A;  3R60 A;  4WXH A;  4JK1 X;  3Q9V A;  5FFZ A;  1I1G A;  1B4A A;  1MDM A;  4MEX F;  2FBK A;  4O3M A;  2ZNZ A;  5FGM A;  5IT9 Z;  5DCF A;  2ZKZ A;  3N97 A;  3MWM A;  5ED4 A;  2VOO A;  4A12 A;  1BBY A;  3FMS A;  2L54 A;  4ETS A;  4GCV A;  2ZME B;  3FM5 A;  4GYG A;  5H6R A;  3DEU A;  2HWV A;  4IVN A;  2H27 A;  3IC7 A;  5HDN A;  2K4B A;  3RPQ A;  4ENK A;  2XGX A;  1FBU A;  2PG4 A;  1B6A A;  2BEO A;  2EV6 A;  2KJC A;  2DPU A;  2K02 A;  3MEX A;  2XAH A;  3QRF F;  3R4K A;  1XCV A;  2FXA A;  5A2Q K;  4PGH A;  4MTE A;  2PMH A;  5ICF A;  4HF1 A;  4I0A A;  1ZH5 A;  2K7L A;  2NRA C;  1DP7 P;  1KQ9 A;  3F23 A;  1HKT A;  2GA1 A;  4UHT A;  1T98 A;  4CXF A;  3WG9 A;  2EFO A;  1R5G A;  2HYG D;  2Q8K A;  1R7J A;  1XDU A;  5E20 A;  2BGC A;  5BPD A;  1K7A A;  2GAU A;  3WTU C;  2OZU A;  2D45 A;  3HRT A;  1YG2 A;  3JSP A;  3M8F A;  4S04 A;  1VTN C;  1IN8 A;  2LDU A;  4O6J A;  4U7B A;  1SFU A;  3F6V A;  1SMT A;  4EJW A;  3GF2 A;  4Q48 A;  1V4R A;  4G7Z F;  4KUM A;  2LSO A;  2YX7 A;  4I09 A;  4KMF A;  4IJA A;  3BWG A;  3KCC A;  4FX4 A;  3BDD A;  2EV0 A;  3F6O A;  4QLC U;  2HQN A;  4LB6 B;  1W4M A;  1XSD A;  5L3C A;  3I58 A;  1OMI A;  3PFI A;  4M71 A;  4OIQ F;  1P92 A;  3MFK A;  4L9N A;  2IA2 A;  1Z6T A;  1GHC A;  3VEP A;  3R61 A;  3HRS A;  4G6D A;  3ROU A;  1PP7 U;  5H6Q A;  5K5R A;  2PFB A;  3GW2 A;  1GVJ A;  4RGS A;  3WGI A;  2XAJ A;  2HDC A;  4YG2 F;  3GO5 A;  2OZ6 A;  3E5Q A;  3HRU A;  1YYV A;  2X0L A;  4CIC A;  3GUD A;  5LLQ A;  1S7O A;  2A61 A;  3T8R A;  3TDZ C;  2TDX A;  4UVA A;  4BQA A;  3LQR A;  3RKW A;  2ADU A;  4G7H F;  2J5O A;  3DKW A;  4JBA A;  1XDS A;  2Z33 A;  5LRR A;  3Q9S A;  3IKV A;  4AIK A;  1F9N A;  3CDH A;  4EJU A;  4LG0 A;  5HLH A;  1O3S A;  2V1D A;  5DUI A;  2B0L A;  1J5Y A;  4F7Z A;  1ULY A;  3J81 Z;  3RKY A;  1R22 A;  4OU0 A;  1ZRF A;  1USS A;  2P4W A;  2O0Y A;  3QP5 A;  2JTV A;  4LLL A;  1U5T C;  2WTE A;  1YO5 C;  2ELH A;  1H9G A;  1TQM A;  2V79 A;  4PGG A;  2ETH A;  4AWX B;  3KZZ A;  5DV5 A;  2IW5 A;  3RI4 A;  4NQW A;  5DDG A;  5ERI A;  3M1E A;  5E8I A;  4WX9 A;  1XCB A;  2QEN A;  1BN5 A;  3BOQ A;  4G7O F;  2G9W A;  1FBQ A;  1BM9 A;  1QZZ A;  3E97 A;  3ZMD A;  1BJA A;  4WXC A;  2DQL A;  1R23 A;  4KFC A;  5E1W A;  3WOD F;  1QQI A;  2VBW A;  6PAX A;  4HOB A;  5FLX Z;  3GEZ A;  4EV0 A;  5DYM A;  1XN7 A;  3T1B A;  4OIR F;  2RV8 A;  3ZMV A;  1S29 A;  4HLY A;  1B1B A;  5LGT A;  1MJB A;  2ZBK A;  5ILS A;  1O3T A;  3IRR A;  4KMU X;  1FZP B;  3DF8 A;  4A6E A;  2VBX A;  4YFK F;  4HA8 A;  2ESH A;  2QVO A;  1S6L A;  1LEB A;  1R58 A;  3KP5 A;  4HYE A;  3D5L A;  4KIB A;  1FWZ A;  2Y0M A;  1ZG1 A;  3EQL F;  3MZH A;  3T5X A;  4HQM A;  3FMQ A;  5CVU A;  5HVQ C;  2X4H A;  4B8X A;  3K2Z A;  2UXN A;  3K1N A;  5AON A;  4EJO A;  1O3R A;  1A04 A;  1DPR A;  1PP8 F;  5JHU A;  3BY6 A;  3FMR A;  3KZY A;  2QUF A;  1SD7 A;  2PJP A;  5CVI A;  2OU2 A;  4RGU A;  3MAJ A;  2Z99 A;  4R79 A;  2IRF G;  2XVC A;  2MH2 A;  3V7S A;  3ELK A;  3TOA A;  1W7P A;  2A6H F;  2PMU A;  1G3W A;  2O8X A;  1ON2 A;  1LDK B;  4EM2 A;  4KIC A;  2DU9 A;  2PBI A;  2GA2 A;  4EGY A;  4BHC A;  1JE8 A;  1E2X A;  2DO7 A;  2Q0O A;  5LEJ A;  1PDN C;  3QAH A;  4EM1 A;  2NNY A;  3DFG A;  1DDN A;  5AIQ A;  4NB5 A;  2PN6 A;  1U5T A;  3F72 A;  2L02 A;  2BV6 A;  2W84 A;  5ICG A;  1IXS B;  3GFJ A;  3ZQ7 A;  5JVT A;  2ZNY A;  4PZJ A;  2KIU A;  2CGP A;  1IRF A;  2JZY A;  4KIG A;  3ZMT A;  1S7A A;  4YFX F;  4Q47 A;  5L3F A;  4I01 A;  1Y0U A;  3D0S A;  4UUV A;  3E6D A;  1MD0 A;  2GWR A;  1C0W A;  5LEK A;  2GIV A;  2VT3 A;  3JAM K;  3B02 A;  3TO6 A;  5ICE A;  2EFQ A;  3LQQ A;  3GZ5 A;  4XLN F;  5CJ9 A;  1FC3 A;  3KET A;  1IUY A;  4XSX F;  5HS8 A;  2CG4 A;  4KDP A;  1FYM A;  3WE2 A;  3RYP A;  5CVJ A;  3ZPL A;  2O61 A;  5DCM B;  4UV9 A;  3HIF A;  1XSV A;  2RN7 A;  1KU3 A;  3QU3 A;  2IA1 A;  1FSE A;  1IN6 A;  2O03 A;  2Y75 A;  3F8B A;  3IL2 A;  4RB2 C;  2QQ9 A;  2R7F A;  2P7C B;  4EM0 B;  3FXR A;  2OBP A;  2YR2 A;  3LAJ A;  1R1T A;  4I02 A;  3VB2 A;  3G3Z A;  4BXU A;  3ECO A;  2W25 A;  2QM3 A;  4M9S A;  3QPH A;  1T2K A;  2XRN A;  3TGN A;  1GXP A;  1JHF A;  1T38 A;  4UXN A;  1HW1 A;  4KN7 X;  5HOO A;  4GXO A;  1ZYR F;  2FNP A;  2FOK A;  2IVM A;  5EEH A;  5BS6 A;  3GFL A;  3I54 A;  4M74 A;  2QBY A;  1IW7 F;  1R5H A;  2LNB A;  5E1Z B;  3LA7 A;  1YFH A;  2UZK A;  1ZG5 A;  2FU4 A;  2YX4 A;  1QPM A;  5E17 F;  4GO1 A;  3R6S A;  4ESF A;  3QPT A;  5D5V B;  2M87 A;  3LST A;  2VE9 A;  3I71 A;  4HV5 A;  2C6Y A;  4QWQ A;  1RIO H;  2RKH A;  4U0Y A;  3KEO A;  1Z7U A;  1JHH A;  5K5Q A;  1ZGA A;  3CUQ A;  1EV7 A;  3HOS A;  1J9I A;  2ZO4 A;  2FRH A;  1Z1D A;  1B9N A;  3HRM A;  3OOP A;  4BHP A;  4MQ9 F;  3RDI A;  1OR7 A;  5K1Y A;  1HBX G;  1TNS A;  2P7V B;  4A6D A;  2XAQ A;  4PDK A;  1IRG A;  1W7P D;  3JTG A;  2OQR A;  4RB1 A;  2D1H A;  2EV5 A;  1OYY A;  5IT3 A;  3COA C;  1BI0 A;  3NRV A;  3MQ0 A;  2VON A;  2DAO A;  3E3V A;  4P96 A;  1RUO A;  4OIN F;  1ZRD A;  2FSW A;  2P6T A;  3ZMU A;  2MLK A;  2P8T A;  4KA4 A;  4Q5S F;  1WSU A;  2MBF A;  2Q2E A;  3OV8 A;  5D5W B;  3AAF A;  1G6N A;  4HX8 A;  1AOY A;  1L0O C;  2JPC A;  2XV4 S;  4H0E A;  2JSC A;  3EET A;  3KEQ A;  3C3W A;  4MQV A;  3HTS B;  3MCZ A;  4DNC A;  4G6Q A;  2H09 A;  1KYZ A;  5DD4 A;  1D5V A;  4GYI A;  2BBY A;  2R3S A;  4LG0 B;  2D2W A;  1F1Z A;  5JFR A;  2FQ3 A;  3GYH X;  2D1V A;  2J5P A;  5F1R A;  1UHM A;  2L01 A;  4M73 A;  3GXO A;  1ZAO A;  1LQ1 A;  2ISY A;  3O6B B;  1KA8 A;  2JT1 A;  4LLG F;  1TLH B;  3WGG A;  3SHF A;  3WU0 A;  1WWX A;  2G7U A;  4ZZL A;  3WTS C;  4P5O A;  1UFM A;  3KE2 A;  4AVP A;  2A5Y B;  4IHS A;  3L2C A;  2FF4 A;  3EDP A;  1QBJ A;  4M6X A;  5L3G A;  3CO7 C;  4KIF A;  1SMY F;  2ZXJ A;  3BJO A;  2HFH A;  5CYV A;  5D8K B;  1BI3 A;  1G4D A;  4LGW A;  3DPT A;  4HW0 A;  4M72 A;  3TOB A;  2EJR A;  3ISP A;  2DFI A;  1FX7 A;  3P7N A;  3BP8 A;  1HW2 A;  2DTR A;  2ZJ2 A;  3RIR A;  2XUB A;  2VC0 A;  1MZB A;  1ZGJ A;  1XMK A;  3ABT A;  5HLI A;  4ESB A;  3WTW C;  1FNN A;  2DW4 A;  1MDM B;  2L4A A;  5BPI A;  5HS7 A;  1LVA A;  1FT9 A;  3F8N A;  5HS9 A;  3WTZ A;  4ZYD A;  1K6O A;  2Z9O A;  4A0X A;  2CW0 F;  3P9K A;  3B73 A;  2AS5 F;  1OPC A;  2HR3 A;  4RGX A;  1RUN A;  2IA0 A;  1P2F A;  3ULQ B;  2EFP A;  1PUE E;  1CGP A;  1O57 A;  1QNT A;  4S05 A;  2ZME A;  1TNT A;  1QGP A;  3KLO A;  1ODD A;  2ZFW A;  1TBX A;  4CGZ A;  3HHG A;  2M8E A;  3HUG A;  4N9H A;  3I59 B;  3FZV A;  2STW A;  3C18 A;  5A2Q Z;  3TO7 A;  3DV8 A;  3O3K A;  1ON1 A;  1P6R A;  4IXA A;  1ZRE A;  3CO6 C;  2CQK A;  5FD5 A;  1BI2 A;  1W5S A;  4L9J A;  2FA5 A;  4I0B A;  3BZ6 A;  4KNY A;  3ECH A;  2E7X A;  2NS0 A;  2XRO A;  2EWN A;  3T8T A;  1R1U A;  2LKP A;  1F5T A;  4ENN A;  3ABU A;  4HDU A;  3DXJ F;  3F21 A;  3I64 A;  1GXQ A;  3RJP A;  3HSE A;  1HXD A;  1V3F A;  3JTH A;  3E5U A;  1KQ0 A;  5D4S A;  3E6B A;  1RZ4 A;  2K86 A;  3GWZ A;  5FD6 A;  3ZMZ A;  1SD4 A;  4BAY A;  1XGS A;  2PI0 A;  1ONV A;  2WV0 A;  2V9V A;  1OKR A;  3V7C A;  1S8N A;  2LF8 A;  5E8G A;  1TQP A;  2NNN A;  4HX7 A;  2VOD A;  1XGN A;  3CUO A;  2XIG A;  2MC3 A;  4HQE A;  4WK8 F;  1I1S A;  5ICC A;  2GZW A;  3F8F A;  4U7D A;  3HHH A;  5D5X B;  3GLX A;  2H6C A;  2VN2 A;  3FWE A;  2DI3 A;  4IPA A;  2CFX A;  4MNU A;  3EYI A;  3KLN A;  1FYL A;  1FLI A;  3K1M A;  4MEY F;  2E1N A;  2VXZ A;  2W57 A;  2MD5 A;  3U1D A;  2GXB A;  3FXU A;  3KP4 A;  4U0W A;  1DUX C;  1HST A;  2FML A;  4EJV A;  3G73 A;  5DCM A;  1HW5 A;  4YFN F;  3HYI A;  4FHT A;  4XRF A;  1LJ9 A;  4L5I A;  4GGG A;  3H3Z A;  1FY7 A;  1IAW A;  4RB3 C;  3I4P A;  2M30 A;  4RAZ A;  2DK8 A;  4L9V A;  2O3F A;  4CYD A;  3TO9 A;  5FO5 A;  3W6K B;  5H20 A;  4L5J A;  3H92 A;  1BC8 C;  3LAP A;  2VE8 A;  1HKQ A;  2EB7 A;  4WF2 A;  3E6M A;  2RNJ A;  3LA2 A;  1UCR A;  4O5V A;  4AIJ A;  5IT9 K;  3I0T A;  1CF7 B;  5CVV A;  2L3D A;  1YW8 A;  2EA2 A;  1BIA A;  4OMY A;  2PQ8 A;  3GVA A;  3KP2 A;  3L7W A;  3I5U A;  4A0Z A;  2NYX A;  2KRF A;  2UXX A;  2A69 F;  2EK5 A;  4L0Y B;  5FLX K;  5L3D A;  1Z9C A;  1G3S A;  1R1V A;  2RVC A;  2HTS A;  2BE5 F;  1MJA A;  1K78 B;  3LA3 A;  2WC2 A;  4G8X A;  3FHZ A;  1IN7 A;  4R1H A;  5TJJ A;  3K1P A;  1R00 A;  2P6S A;  1FOK A;  2F5C A;  3CUQ B;  4TV7 A;  1KU7 A;  1Q1H A;  4BH9 A;  4G94 A;  4CDG A;  1TW3 A;  1SFX A;  2Z5U A;  3CLO A;  1D8K A;  4KYW A;  2M1B A;  4HV6 A;  4PCQ A;  2V1X A;  1X3U A;  4JQF A;  1H9T A;  4HAM A;  2XAS A;  4AIH A;  2R7D A;  1IXR C;  4M9X A;  1REP C;  1KU9 A;  1F4K A;  3F8C A;  2KJB A;  4ENM A;  1EH6 A;  1S3J A;  3V8K A;  2HTJ A;  2CO5 A;  3GX4 X;  5LHI A;  4CHU A;  1J7K A;  3C7J A;  5BMZ A;  4LK1 F;  1J59 A;  1I5Z A;  1FPQ A;  3WU1 B;  5DEQ A;  3SZP A;  4MTD A;  2OQG A;  2ISZ A;  5HLG A;  2M45 A;  3PQJ A;  5LBQ A;  5LRS A;  1IF1 A;  1E17 A;  5KK1 A;  3CJN A;  3KP7 A;  2P5V A;  4K2E A;  1RNL A;  1XSX A;  3S2W A;  3J81 K;  1T0F A;  3ZN1 A;  4BNC A;  2JRT A;  2COM A;  3O2P E;  1EH7 A;  4HX4 A;  5JI6 A;  1MJ9 A;  3IRQ A;  3H3U A;  3BPX A;  3MZY A;  5FFX A;  4OIP F;  1U78 A;  1P4A A;  2GXG A;  2MLG A;  1LB2 A;  1STZ A;  2QYO A;  1WI9 A;  3K0L A;  4ZZD A;  2VC1 A;  3SZT A;  4DQ2 A;  2NAZ A;  3EYY A;  3RPU A;  1U6G A;  3CUQ C;  1ZAR A;  3FM3 A;  1W7P B;  1SD5 A;  2K27 A;  4IRH A;  4Y13 A;  5F6F A;  3W6J B;  4FT8 A;  4ZYH A;  3C1D A;  5LHG A;  2XKO A;  3V7R A;  4IRI A;  2ACJ A;  2XKP A;  3WTX C;  3BRO A;  2EFN A;  1P4W A;  3DPL C;  1K79 A;  2BYV E;  2OD5 A;  5HDK A;  3KFW X;  3E5X A;  5D6F A;  4LK0 F;  3VOE A;  1O7F A;  2F2E A;  1B59 A;  4L0Z B;  1J2X A;  1QZY A;  4UVC A;  4G9Y A;  2A07 F;  1YQA A;  1FYK A;  3NEU A;  4I7H A;  4HF0 A;  2FBI A;  1YTY A;  2HYF A;  3BJA A;  1XB4 A;  1YS7 A;  2F5E A;  1B9M A;  2DQR A; 
#chains in the Genus database with same CATH topology
 2JSP A;  1Z05 A;  3S3O A;  1BIB A;  3SDB A;  1YIO A;  4ON0 A;  4XOP A;  4XRS G;  1P4X A;  4AU7 A;  4EQQ A;  1QVU A;  2ELJ A;  5K7Z A;  2EBI A;  2HKX A;  3JRA A;  3MZ8 A;  4B09 A;  3I59 A;  2XGC A;  3FF5 A;  3JRH A;  3CJQ B;  3CF2 A;  2OTJ I;  3CDI A;  3AL0 C;  4U88 A;  1KU2 A;  3WHC A;  2GOX B;  5LGN A;  5ILU A;  3LWF A;  1T6S A;  2BVL A;  5D8L B;  3DPU A;  1U9N A;  1FSH A;  1RI7 A;  1TWA J;  2GIZ A;  4JX5 A;  3JRI A;  2OA4 A;  5B5E C;  4HF2 A;  3HOW J;  2NVU B;  1WJA A;  3WG7 H;  3QYB A;  2VBY A;  2VT2 A;  1KGS A;  3WGH A;  3E7L A;  3RQ4 A;  1ZRC A;  3F3X A;  1ZN2 A;  2VIX A;  2RQP A;  4MHG A;  5EGO A;  2MH9 A;  4C3I J;  4LG3 A;  4HZF A;  4MLO A;  2YU3 A;  4L9T A;  2A05 A;  3TDU C;  3P9C A;  1T8I A;  2W85 A;  1APL C;  3MD2 A;  3T0Y A;  2YPR A;  4Q4Z F;  5AIP A;  4LLN A;  1ZLK A;  2CQQ A;  3BCB A;  2HQA A;  1U2W A;  4HNU A;  1Z6R A;  3TQN A;  5BOX A;  2VKE A;  3M9A A;  1I3Q J;  1LEA A;  1J75 A;  2KIS A;  1WQ2 A;  1IN4 A;  3JRB A;  3R0A A;  2F5D A;  2XPU A;  4CCK A;  3SFI A;  2E71 A;  2CWE A;  3FXQ A;  1WJE A;  3JW4 A;  2KIF A;  5FKL A;  3RPU D;  5BNG A;  4XKB A;  4XLH A;  1MKM A;  1QA6 A;  3ZN0 A;  1TWG J;  4UB8 C;  1X58 A;  1P7J A;  5CVR A;  5IOY A;  3I4M J;  3OIP A;  2HYJ A;  5GPC A;  1IUF A;  4PJL A;  4JOM A;  1BC7 C;  1AU7 A;  3FXJ A;  2Z3Y A;  3NQO A;  5L3E A;  4P55 A;  3FK7 A;  1J0R A;  4HLX A;  4KN4 X;  4OOI A;  4AD9 A;  3K69 A;  1JTY A;  2AQE A;  4B47 A;  3OYN A;  1R36 A;  3BPV A;  3G1O A;  2DT6 A;  1ETW A;  4HSR A;  2R7X A;  1P9Q C;  4II3 A;  3J7A Y;  1W1W E;  2Y0S A;  1EH8 A;  2L7M P;  2PEX A;  2XHK A;  2E1O A;  1FOW A;  3CF5 F;  1MGT A;  3BTI A;  4NHJ A;  4N4N B;  1YLF A;  3CCM I;  2KDZ A;  9ANT A;  1Z91 A;  4A3M J;  2B63 J;  2M7A A;  4UNO A;  4PJ0 C;  1SFO J;  2YSR A;  1T39 A;  1D3Y A;  1MBK A;  1OYW A;  2EA4 A;  3F8M A;  1SD6 A;  2XSJ C;  3O8H A;  1HKS A;  4MFE A;  1Q1V A;  2ESN A;  2X6Y A;  4P9U A;  1X4O A;  2HI3 A;  3UR3 C;  1VQ9 I;  1LDD A;  3R0J A;  2F5F A;  3ZP5 A;  5K5O A;  1X3W B;  3GZ6 A;  2JWT A;  1U5T B;  1H0M A;  2V6C A;  1FP1 D;  1RR8 C;  2H1K A;  1ZTR A;  1ETX A;  3WE3 A;  2LR8 A;  3SXY A;  2VBZ A;  4FE7 A;  1IGN A;  2W00 A;  2L5Q A;  4BUP A;  1G3T A;  4LMY A;  3ERE D;  2UV1 A;  2Y0S N;  2JK3 A;  3EUK L;  4UUT A;  1ZG3 A;  2ID6 A;  4RS8 A;  4A0Y A;  4EGZ A;  3EUH A;  3BJ6 A;  5JLX A;  4E7I A;  1TL8 A;  3K10 A;  5J8F A;  1UHW A;  1KYW A;  3OOU A;  1YJN I;  2HQ5 A;  2JN6 A;  5F08 A;  3PIO F;  5M3M J;  4KIS A;  3GFM A;  3L9F A;  1HOM A;  1WFX A;  2JPB A;  2O9L A;  1IJW C;  1SFE A;  3HSR A;  1VI0 A;  3AG4 H;  1MIJ A;  3V4G A;  4A5N A;  1B8I A;  3L2U A;  1RKT A;  2JVG A;  1FBS A;  3J80 Z;  3OYF A;  2H94 A;  5IP6 A;  3LL7 A;  3JAM Z;  1EJ9 A;  2BZT A;  1DPU A;  4Y17 A;  1IXC A;  4IHW A;  2EH3 A;  3DQV C;  3H9Q A;  3WTV C;  2F4O B;  4L18 B;  1IV8 A;  3OYL A;  2P5L C;  4IHV A;  4HBL A;  4F93 B;  2JA6 J;  4WCG A;  3DTI A;  5D5U B;  2QQB A;  4XON A;  2R7W A;  2DA1 A;  4J00 A;  5E1X A;  3A03 A;  4RGR A;  2IT0 A;  3D5S C;  1O4X A;  4G12 A;  3LSG A;  5DD8 A;  3F0C A;  3HKZ A;  3HPG A;  1LDJ A;  2LBF A;  4LJZ F;  1O3Q A;  3PNT A;  1RRJ A;  3ERM A;  4CYC A;  2V26 A;  3ZMS A;  3IHU A;  1PUF B;  1XMA A;  2R5Y A;  4ZTJ A;  4M6Y A;  2GBY A;  5ILV A;  1CF7 A;  4XKV A;  5F0C A;  5M3F J;  4F3Q A;  2QWW A;  4RAY A;  4DIQ A;  5BQT A;  5EG0 A;  2A68 F;  3E6C C;  3J80 K;  5CLS A;  1IN5 A;  4Y15 A;  3HJE A;  4LIV A;  1L3L A;  4ASN A;  4YII A;  3REO A;  4Y33 A;  2XAF A;  4BY1 J;  2EZL A;  1U3E M;  4AYB A;  1JGS A;  3G71 I;  2IS4 A;  4WWC A;  4MGR A;  2XPV A;  4WXD A;  5D6E A;  2LMD A;  2PLY A;  1BOA A;  2CSO A;  4LFU A;  2DLL A;  4D7M A;  4N0B A;  5FB2 A;  2HNH A;  3U9G A;  5L3B A;  4I98 B;  2UUZ A;  1U8B A;  4JP0 A;  1ITY A;  1K78 A;  1TW2 A;  2XAG A;  3SFZ A;  4A3J J;  1ZEL A;  3HTU A;  3JSO A;  2P0W A;  5GTI C;  2Y69 H;  3PNY A;  3L2Q A;  2UWM A;  1HQC A;  4BY7 J;  2FEZ A;  1MW7 A;  2AXL A;  1IC8 A;  1O7L A;  1KQ8 A;  2HS5 A;  4V19 K;  1OFC X;  1Z3X A;  2JA2 A;  4D0P A;  4A3K J;  4UV8 A;  1I6X A;  1OYI A;  3V8L A;  2EIJ H;  4CO8 A;  5C44 J;  2ZJR F;  5H2F C;  4EJT A;  3TKY A;  3TMO A;  2QBY B;  4ZYG A;  2XPW A;  1VQ7 I;  5FRN A;  2R7U A;  2RGV A;  4M6V A;  3FXK A;  3Q0W A;  2A3S A;  2CYY A;  4AUX A;  4DBQ A;  5J6X A;  1ZLJ A;  2IP2 A;  5TRD A;  1MSF C;  4HDV A;  1TTY A;  2FQ4 A;  1JJ6 C;  4XSZ F;  3OIO A;  3DWL E;  2ZCW A;  3NWS A;  2EFW A;  1VFC A;  2Z1D A;  3PO2 J;  2LK2 A;  4YIF A;  3HG9 A;  2IBD A;  2A6E F;  1Z7L A;  1DU6 A;  2RNG A;  2CV1 A;  4P9F A;  3RKX A;  2R7Z J;  1WRJ A;  2KPM A;  4BYY A;  3H36 A;  2DPD A;  2LD5 A;  2HPM A;  3ML6 A;  2FUG 2;  2MA3 A;  3QOP A;  1LNW A;  1TQI A;  2W1O A;  2E7W A;  2CQN A;  1RC9 A;  1W5T A;  2KKO A;  3BR3 A;  4U0V A;  3F9K A;  1I27 A;  2QQA A;  1ACI A;  4M3E A;  5KNL A;  3N4M A;  2V9K A;  3GME A;  3WTY C;  3Q3S A;  4ENJ A;  4Y52 J;  2X85 A;  2KRH A;  3B6A A;  3CTA A;  3HSF A;  3L09 A;  3ZQF A;  2DYS H;  1BI1 A;  4ZYE A;  5K7F A;  2QZ8 A;  2O6G E;  4UVB A;  3L2R A;  4OMZ A;  2P5K A;  2R5Z A;  4I2O A;  2WWY A;  3BR5 A;  4A2U A;  3JCU C;  4B44 A;  4ESJ A;  5JLW A;  2JA7 J;  3Q0V A;  3CC2 I;  1UB9 A;  4EAT A;  2PMZ A;  1LUJ B;  3I3L A;  4IX7 A;  4NUB A;  1NK2 P;  4OIO F;  3DCF A;  2DBB A;  1Y1V J;  1PYV A;  3HOT A;  1JT6 A;  1FOX A;  5HDG A;  5K7H A;  1VF9 A;  3IWF A;  1FP2 A;  2FBH A;  2Y9Z A;  1D8J A;  5EEG A;  4XLP F;  2HEO A;  2O8K A;  4MO7 A;  2BW3 B;  5JR3 A;  4XBF A;  2ZFU A;  4YEL A;  1Y8Q B;  1IZ1 A;  3S1Q J;  1ETQ A;  2LF7 A;  3BLY A;  2GQQ A;  4BHB A;  1MBJ A;  2STT A;  2DT5 A;  1XG1 A;  1JXS A;  1HSJ A;  3TW7 A;  3CJT B;  2E1C A;  2FE3 A;  1SVM A;  3DBL B;  3C2G A;  3ZCO A;  3K9T A;  3Q5F A;  1QO0 D;  1K4S A;  3WU2 C;  3J7A O;  2JMW A;  4XRS A;  3PUB A;  1IO2 A;  2HOE A;  4B4C A;  5DUK A;  4IKF A;  3RYR A;  4C2T A;  1MNM C;  1VQO I;  3TP0 A;  1UST A;  2DOE A;  3PQK A;  3V8J A;  4CCO A;  2GOM A;  3SQN A;  2OAZ A;  2E36 A;  5C4X J;  2WY8 Q;  2RC4 A;  3OS2 A;  2IGO A;  3LFK A;  2QF7 A;  3U2R A;  3K7A J;  4OWR B;  1YW7 A;  3FK6 A;  1AWC A;  2L9V A;  3A2K A;  3L00 A;  3LSH A;  5CKT A;  3H3V K;  5F04 A;  1MMA A;  4B1R A;  2IPQ X;  2VQH A;  2QLZ A;  2VQG A;  3KP3 A;  4E70 A;  4IHT A;  3ABK H;  2HQR A;  2Y48 A;  3E1S A;  3KP6 A;  2ZSI B;  3VFZ A;  4IRG A;  3QU6 A;  4IO9 F;  3HDD A;  5TGT A;  3VYS B;  4RB0 A;  1VQ8 I;  1X2N A;  3IP4 B;  1QZE A;  3H9G A;  2IS2 A;  3P5J A;  4N9I A;  2V1U A;  1W5C C;  5E79 C;  3M3Y J;  4E6K G;  4A5M A;  2R7O A;  4W1U A;  2GM4 A;  2NVX J;  4C3H J;  2HKO A;  3BG5 A;  4HNT A;  1YW9 A;  1NK3 P;  4M3B A;  2W7N A;  3BG6 A;  3M8E A;  5D4R A;  3CC4 I;  3DEW A;  2QKL B;  3SDG A;  1GV2 A;  2KIQ A;  3TW6 A;  4BDY A;  3QPS A;  5J8C A;  3S1N J;  5TIS C;  3CP8 A;  5F0F A;  3CCV I;  1NHA A;  4C9Y A;  2QEX I;  3WTT C;  2FX0 A;  2MSY A;  2VQC A;  1YX5 A;  4AC0 A;  2VOP A;  1G3Y A;  3W2V A;  3LSR A;  3DP7 A;  1U8R A;  2VI6 A;  1XGM A;  1GUU A;  1X4P A;  2X1E A;  1SVO A;  2R7R A;  2L4M A;  2H6B A;  3F22 A;  4IOC F;  4LD5 A;  4M9Z A;  4E7K A;  4BGD A;  1G59 A;  4LB5 A;  3GFI A;  3P9I A;  2HXO A;  3H9J A;  5LGU A;  2G7H A;  2F5V A;  4HPQ A;  3IKT A;  2QGU A;  2HZT A;  3I53 A;  4R8H A;  1XD7 A;  2M5W A;  2WY7 Q;  4ZDP A;  3IWZ A;  1SAX A;  3RTR A;  2V6E A;  1ZR4 A;  3FX3 A;  4PFO A;  3NAR A;  2DK5 A;  1JUP A;  5F64 A;  1X1D A;  1WJ5 A;  4FX0 A;  4IF4 A;  2HGC A;  2K4J A;  1YRN A;  3VWB A;  2FNA A;  3QP6 A;  5M5X J;  4EMS A;  5KVR A;  1ZHF A;  2RQQ A;  4B43 A;  4BEH A;  4CZZ A;  1D5Y A;  4ZH4 F;  2IJL A;  3M7G A;  4EVI A;  2KIM A;  2LC2 A;  5LHH A;  1XGO A;  2RDP A;  3HEF A;  5E18 F;  1YS6 A;  2K9S A;  4Z2Y A;  2KLO A;  2NOJ B;  1WKM A;  3VOD A;  2M2E A;  1H89 C;  2W24 A;  4KT5 C;  1S5L C;  2FMY A;  3R60 A;  4WXH A;  1UJ8 A;  1OCP A;  3K4C A;  3M07 A;  2LY1 A;  2DFE A;  4JK1 X;  3OR1 C;  3HC7 A;  3Q9V A;  5E3O A;  1RR7 A;  5FFZ A;  1I1G A;  3KPH A;  1B4A A;  1MDM A;  2LTP A;  1XX5 A;  4HNV A;  4MEX F;  1TT5 B;  2FBK A;  1A36 A;  4O3M A;  4JYK A;  2ZNZ A;  5FGM A;  1ZK8 A;  2EZK A;  3BT9 A;  5IT9 Z;  4ZC3 A;  1SVL A;  2OTL I;  2XSD C;  5DCF A;  2E2J J;  2JRM A;  2ZKZ A;  5B1A H;  3MWM A;  3N97 A;  1DU0 A;  5ED4 A;  2X48 A;  2VOO A;  4A12 A;  1BBY A;  4L5E A;  2LFB A;  4A3L J;  3FMS A;  4B48 A;  2L54 A;  4BJ6 C;  4ETS A;  5M5W J;  4GCV A;  2KP6 A;  3OL3 A;  2ZME B;  2CW8 A;  3FM5 A;  4GYG A;  2DTZ A;  1JKO C;  5H6R A;  3DEU A;  2HWV A;  4IVN A;  4XRM A;  2H27 A;  3H5N A;  3IC7 A;  5HDN A;  1X1A A;  2EQR A;  2K4B A;  3RPQ A;  4ENK A;  3BG9 A;  2ECB A;  3IH3 A;  2XGX A;  1WJF A;  1FBU A;  1VQ5 I;  3KX2 A;  1F43 A;  2PG4 A;  1B6A A;  2BEO A;  2EV6 A;  5KCM A;  4UUS B;  2KJC A;  2KT0 A;  4BJT A;  2DPU A;  2K02 A;  3MEX A;  2XAH A;  2AHQ A;  1E3P A;  2IS1 A;  4BDZ A;  3GTQ J;  4CH7 A;  3K70 D;  2WAE A;  3R4K A;  1XCV A;  3QRF F;  2FXA A;  2PMZ N;  5A2Q K;  2LKX A;  4PGH A;  1OCO H;  4MTE A;  1BR1 A;  5GPA A;  2PMH A;  5ICF A;  2L7F P;  4HF1 A;  4OAZ A;  4I0A A;  3WHB A;  2ZSH B;  4E7L A;  1R49 A;  1ZH5 A;  1OLT A;  1D0Z A;  2K7L A;  3OYC A;  2NRA C;  5LD2 C;  1DP7 P;  1KQ9 A;  4ITV A;  3F23 A;  3FIS A;  1HKT A;  2GA1 A;  3CCE I;  1TZL A;  4UHT A;  1T98 A;  1X19 A;  3S32 A;  3CP2 A;  4CXF A;  3ABM H;  3WG9 A;  2EFO A;  1R5G A;  1ZQ3 P;  3S3M A;  2BY1 A;  1Z0X A;  2HYG D;  4QTR A;  2Q8K A;  1R7J A;  1XDU A;  5E20 A;  4CCN A;  2BGC A;  5BPD A;  1K7A A;  2GAU A;  3OS0 A;  2XGD A;  4CZC A;  1VND A;  3WTU C;  2MYS A;  1OQY A;  2OZU A;  2D45 A;  5GAE J;  4RLQ A;  3HRT A;  3BTJ A;  3AKZ A;  1YG2 A;  2QSF X;  2MW8 A;  3JSP A;  1LKX A;  3AG3 H;  3CCL I;  3M8F A;  3CQZ J;  1K4T A;  4S04 A;  3C2B A;  1VTN C;  3OSG A;  2DA5 A;  1IN8 A;  2LDU A;  5IY5 H;  4O6J A;  4U7B A;  1SFU A;  2OF7 A;  3FBN B;  2HZD A;  3H0D A;  2CQ7 A;  2DA3 A;  1HCR A;  2KZV A;  3F6V A;  1SMT A;  1N25 A;  4EJW A;  1E3O C;  4AM3 A;  4XN3 A;  2NVT J;  1JI8 A;  3GF2 A;  2I10 A;  4Q48 A;  1V4R A;  4G7Z F;  4KUM A;  2LSO A;  2YX7 A;  4I09 A;  5GAH J;  4KMF A;  4IJA A;  2VXD A;  2CUF A;  3U1K A;  3BWG A;  3KCC A;  4FX4 A;  3BDD A;  5B1B H;  2EV0 A;  3F6O A;  4QLC U;  3PO3 J;  2HQN A;  3HOV J;  1LE8 B;  4LB6 B;  1W4M A;  1XSD A;  1VQL I;  4CCL A;  1OJL A;  5L3C A;  3MN2 A;  3I58 A;  3GBG A;  1OMI A;  2VLA A;  4C2U A;  1DGW Y;  3PFI A;  2DOF A;  1AKH A;  2FOW A;  3LSK A;  3K4M A;  4M71 A;  4OIQ F;  3K4L A;  3S1M J;  2HU9 A;  1P92 A;  3MFK A;  4L9N A;  2X9D A;  5KAI C;  1V5F A;  1G8X A;  1GT0 C;  2IA2 A;  1Z6T A;  3H5R A;  3D5R C;  1MMS A;  1GHC A;  3VEP A;  1Y1W J;  3R61 A;  1D1C A;  3HRS A;  1WJC A;  4G6D A;  2FJ1 A;  3GTL J;  3ROU A;  3TP3 A;  1PP7 U;  5H6Q A;  4C30 A;  3KYC B;  4PJJ A;  2PFB A;  5K5R A;  2DA7 A;  5DS9 A;  3CCJ I;  2NVQ J;  3GW2 A;  1GVJ A;  1WJD A;  4RGS A;  3QOE A;  4DW6 A;  2JA8 J;  3WGI A;  3OS1 A;  2XAJ A;  2HDC A;  4YG2 F;  3GO5 A;  3U21 A;  2OZ6 A;  3E5Q A;  3HRU A;  2K3F A;  2F6C A;  2KHM A;  1YYV A;  1YJW I;  4U87 A;  4BQQ A;  2X0L A;  4CIC A;  3GUD A;  5LLQ A;  2B9S A;  1QPI A;  3CC7 I;  1S7O A;  2A61 A;  1JT0 A;  1EF4 A;  2M9H A;  2Q2E B;  2WAF A;  3T8R A;  4YEJ A;  4QSH A;  3OSF A;  3TDZ C;  3HOX J;  2WAD A;  3H35 A;  2TDX A;  4UVA A;  1YE9 A;  1D1A A;  4BQA A;  3LQR A;  3RKW A;  1R4N B;  1HDD C;  2ZJQ F;  2E35 A;  2ADU A;  4G7H F;  3A02 A;  2Z2S B;  2J5O A;  3DKW A;  4JBA A;  1XDS A;  2Z33 A;  1RKW A;  5LRR A;  4XLA A;  3Q9S A;  2ECC A;  2DMP A;  3GTM J;  3BTC A;  3A4C A;  3IKV A;  1UMQ A;  4AIK A;  1MMN A;  1F9N A;  3CDH A;  4EJU A;  4LG0 A;  5HLH A;  1O3S A;  2V1D A;  5DUI A;  3ZOB A;  2B0L A;  1IG7 A;  1J5Y A;  4F7Z A;  1ULY A;  3RKY A;  3J81 Z;  5FRO A;  3DKY A;  3PL8 A;  1R22 A;  4OU0 A;  3KYL A;  1F36 A;  1K83 J;  1ZRF A;  1USS A;  1SAU A;  2P4W A;  4AYB N;  4A3C J;  1T0F C;  2O0Y A;  2E60 A;  2R7V A;  2VPR A;  3ZQG A;  4D5C A;  3PJR A;  1UG2 A;  3QP5 A;  2JTV A;  1LPQ A;  1MMG A;  4LLL A;  1BL0 A;  1U5T C;  2WTE A;  1YO5 C;  4DJA A;  2WA0 A;  2ELH A;  1H9G A;  2ZXH A;  1TQM A;  2V79 A;  4PGG A;  4XM3 A;  3LFU A;  3QWL A;  5HOD A;  1X3Z B;  1MBE A;  2JUC A;  2ETH A;  4AWX B;  2BVM A;  1FEX A;  2LOO A;  2MG4 A;  3KZZ A;  3TL4 X;  5DV5 A;  2IW5 A;  3RI4 A;  2XDV A;  4NQW A;  5DDG A;  4HST A;  3SYT A;  2W4S A;  5ERI A;  3M1E A;  5E8I A;  4E7Z A;  2KFD A;  4WX9 A;  1XCB A;  2QEN A;  4BBS J;  1BN5 A;  3BOQ A;  4G7O F;  2G9W A;  1FBQ A;  1BM9 A;  1QZZ A;  4D7N A;  2OCE A;  3TED A;  3E97 A;  3ZMD A;  3Q0U A;  2IAI A;  3D1N I;  1EKE A;  3IV5 A;  3FKI J;  3PUF A;  2OPT A;  1BJA A;  2MGQ A;  4WXC A;  2DQL A;  1VQN I;  1R23 A;  4KFC A;  2MAB A;  5E1W A;  3WOD F;  1QQI A;  1UHS A;  1DGR M;  2VBW A;  6PAX A;  2HVQ A;  2VUM J;  1PVE A;  1LFB A;  4IEJ A;  3G4S I;  2LVS A;  2QKM B;  4HOB A;  2IGK A;  5FLX Z;  1WZ2 A;  3GEZ A;  4EV0 A;  5DYM A;  3ZQC A;  1XN7 A;  2QCO A;  2VJI A;  4UY8 I;  1OCZ H;  3T1B A;  4OIR F;  1SC7 A;  2RV8 A;  5FLV A;  3ZMV A;  3HKZ N;  1S29 A;  4HLY A;  3W2A A;  1B1B A;  5KAF C;  2K40 A;  5LGT A;  1MJB A;  4A93 J;  2ZBK A;  5ILS A;  1O3T A;  3IRR A;  4KMU X;  3S3N A;  1FZP B;  2G0E A;  4IZZ A;  1UG0 A;  3DF8 A;  4A6E A;  2GXA A;  2VBX A;  1OR7 C;  4BQO A;  4YFK F;  4HA8 A;  2ESH A;  1FMV A;  2CJJ A;  2QVO A;  1S6L A;  1LEB A;  1FIA A;  1R58 A;  5EGO B;  3KP5 A;  4HYE A;  3D5L A;  3G2B A;  4KIB A;  1BW6 A;  1FWZ A;  2Y0M A;  5FJ8 J;  1Z77 A;  1ZG1 A;  3EQL F;  2EPF A;  3MZH A;  3T5X A;  1X2M A;  1JKQ C;  2DMU A;  3O8G A;  4HQM A;  3FMQ A;  5CVU A;  5HVQ C;  5GTH C;  4XLC A;  4BS9 A;  4Y4R A;  3HUG B;  3FDY A;  2X4H A;  4C3J J;  5EZH A;  4B8X A;  3K2Z A;  2KRC A;  4XLF A;  2Y2Z A;  2UXN A;  3K1N A;  1N77 A;  2X1D A;  3K4K A;  5AON A;  4EJO A;  1O3R A;  1A04 A;  1DPR A;  1FMW A;  3JRD A;  1B72 B;  2CUJ A;  1WH7 A;  1WCM J;  4RBO A;  5JHU A;  1PP8 F;  1OCC H;  3BY6 A;  3IAS 2;  3HXL A;  3FMR A;  1IDY A;  3KZY A;  2NVY J;  2QUF A;  3VYU B;  3FXM A;  1SD7 A;  3VYR B;  5IOZ A;  2AQF A;  2PJP A;  5CVI A;  3BR1 A;  4GFB A;  2OU2 A;  4RGU A;  3MAJ A;  2Z99 A;  3FXO A;  2LP0 A;  2CV0 A;  3ASN H;  4R79 A;  2IRF G;  3RZO J;  2XVC A;  2MH2 A;  3V7S A;  3ELK A;  3TOA A;  1RPW A;  1W7P A;  2IGM A;  2I8D A;  2A6H F;  2VB6 A;  2PMU A;  1G3W A;  2O8X A;  1ON2 A;  2OUM A;  1LDK B;  4EM2 A;  3KEY A;  2DU9 A;  4KIC A;  2PBI A;  4RAF A;  2GA2 A;  2BXY A;  4EGY A;  2E5N A;  1D0Y A;  1D1B A;  2N8G A;  4BHC A;  1JE8 A;  1E2X A;  2DO7 A;  3VPR A;  2Q0O A;  5LEJ A;  4PSW A;  3QAH A;  1GDT A;  5DTD A;  4EM1 A;  1PDN C;  3PFY A;  2NNY A;  3DFG A;  1DDN A;  2COB A;  3LMM A;  5AIQ A;  4NB5 A;  3MKL A;  2PN6 A;  3W6V A;  2TRT A;  1U5T A;  2CS3 A;  3F72 A;  2L02 A;  3CMM A;  3OYG A;  2BV6 A;  2IGN A;  2W84 A;  5ICG A;  1IXS B;  3GFJ A;  4FTH A;  3A01 B;  3K4N A;  3ZQ7 A;  5JVT A;  4G6T B;  2ZNY A;  4PZJ A;  1UAA A;  2EIM H;  3DU5 A;  4H4K C;  4XN0 A;  2ZME C;  1X1P A;  2KIU A;  1IRF A;  2JZY A;  4KIG A;  3ZMT A;  2CGP A;  4IHY A;  2CUZ A;  1S7A A;  4BXX J;  4YFX F;  1A5J A;  4Q47 A;  2K9L A;  5L3F A;  4I01 A;  5IP9 J;  1Y0U A;  1MBH A;  3D0S A;  4UUV A;  3ZXS A;  3E6D A;  4KT6 A;  1MD0 A;  2GWR A;  3CMA I;  1C0W A;  5LEK A;  2GIV A;  4P1W A;  2VT3 A;  4DYQ A;  3JAM K;  3B02 A;  3TO6 A;  2I5U A;  5ICE A;  4A3B J;  1OIS A;  3ESW B;  3HGG A;  2HVS A;  2L9S A;  2RRE A;  2EFQ A;  3LQQ A;  3GZ5 A;  4XLN F;  1W0T A;  5CJ9 A;  1V5G A;  3BQY A;  2PJR A;  1FC3 A;  3KET A;  1VQP I;  4XSX F;  1IUY A;  5HS8 A;  2CG4 A;  4KDP A;  2ELK A;  1FYM A;  3WE2 A;  3RYP A;  1S7E A;  5CVJ A;  3G6E I;  2LRE A;  3ZPL A;  2DOA A;  2EZI A;  2R92 J;  3HOZ J;  2O61 A;  2ICW G;  5DCM B;  4UV9 A;  4XKW A;  3HIF A;  4RM2 A;  3M4O J;  3BCA A;  4KIT B;  1XSV A;  2A6T A;  2RN7 A;  2FD5 A;  2WV1 A;  4DGW B;  1KU3 A;  2D5V A;  5LFA A;  3QU3 A;  4D9J A;  2IA1 A;  1FSE A;  2CQX A;  3DTE A;  1IN6 A;  2O03 A;  1JUS A;  3OYA A;  2Y75 A;  4UUS A;  3F8B A;  3IL2 A;  4RB2 C;  1A35 A;  2E5Z A;  3NAU A;  2QQ9 A;  5EJC A;  2R7F A;  1H8A C;  3ASO H;  2P7C B;  1BR2 A;  5J4Y A;  4EM0 B;  3FXR A;  2OBP A;  4XKC A;  2YR2 A;  3LAJ A;  1R1T A;  4FE4 A;  4NC7 A;  4I02 A;  3VB2 A;  4BJ5 C;  3G3Z A;  4BXU A;  3ECO A;  2W25 A;  2QM3 A;  4D1Q A;  4M9S A;  2OJE D;  3QPH A;  1T2K A;  2ME6 A;  3IUO A;  3TBI A;  2XRN A;  1WPK A;  3TGN A;  1GXP A;  5M5Y J;  1JHF A;  1T38 A;  4UXN A;  4ZYA A;  3AG2 H;  1HW1 A;  4KN7 X;  3OIQ A;  5HOO A;  1S9H A;  4MFD A;  1FOY A;  3KIO A;  4GXO A;  3MKW B;  4E4H A;  1PJR A;  1ZYR F;  2Q1Z B;  3W3C A;  2FNP A;  3ONQ A;  2TCT A;  2FOK A;  2IVM A;  1LFU P;  1ETK A;  4E7J A;  5EEH A;  5BS6 A;  4V2F A;  4XL9 A;  3GFL A;  3I54 A;  1NH3 A;  5HNF A;  2Y31 A;  3K6G A;  4CCJ A;  2KZG A;  4M3G A;  4M74 A;  2QBY A;  4IHX A;  1IW7 F;  1R5H A;  2K3P A;  4HRI A;  2LNB A;  1QRY A;  2DOD A;  5E1Z B;  2MFZ A;  3ZRG A;  3CMY A;  4HEA 2;  1BOB A;  1HLV A;  3LA7 A;  1YFH A;  4A3F J;  5KHD A;  2UZK A;  2X6W A;  1ZG5 A;  2FU4 A;  2YX4 A;  1QPM A;  2CH0 A;  5E17 F;  4GO1 A;  1NG6 A;  3R6S A;  4PJN A;  2DYR H;  2VJ5 A;  4ESF A;  3OYK A;  1OCT C;  3QPT A;  5D5V B;  1ENH A;  2M87 A;  5C4J J;  1WHU A;  3LST A;  3ZQI A;  2VE9 A;  3I71 A;  3LOC A;  3I4N J;  4HV5 A;  1IDZ A;  2XF5 A;  1Z3Y A;  2MD0 A;  2C6Y A;  4QWQ A;  3L2W A;  4DZP A;  1RIO H;  4KJZ A;  2RKH A;  4U0Y A;  3KEO A;  1Z7U A;  1MMD A;  4PK4 A;  2XB0 X;  3HZJ A;  1JHH A;  5K5Q A;  3BG3 A;  1HC8 A;  1ZGA A;  2DJN A;  3CUQ A;  3FXL A;  1EV7 A;  1JUM A;  5FLM J;  4A3E J;  2LH9 A;  2HDW A;  4DOZ A;  2X6O A;  1SFK A;  3HOS A;  1J9I A;  2ZO4 A;  2FRH A;  4CCM A;  1Z1D A;  1B9N A;  3HRM A;  3OOP A;  4BHP A;  2AXT C;  4MQ9 F;  3RDI A;  5IP7 J;  4E7H A;  3HGY A;  3V42 A;  3VSK A;  5JVG F;  1N78 A;  2EIN H;  2DCE A;  1OR7 A;  5K1Y A;  2BY3 A;  3DBR B;  3N05 A;  1HBX G;  1TNS A;  2P7V B;  4A6D A;  1I50 J;  2XAQ A;  4PDK A;  1IRG A;  1W7P D;  3JTG A;  3LSP A;  2DFH A;  2OQR A;  4XNF A;  4RB1 A;  2D1H A;  2EV5 A;  1OYY A;  4PFP A;  5IT3 A;  3OMY A;  3COA C;  2VJJ A;  3LSJ A;  1J09 A;  2O7O A;  1BI0 A;  1N75 A;  3I55 I;  4A69 C;  3NRV A;  1QVT A;  1MH3 A;  1QHH D;  3MQ0 A;  2HXI A;  2VON A;  2DAO A;  3E3V A;  4P96 A;  2ZXW H;  1RUO A;  2ZXI A;  2E2H J;  4OIN F;  1ZRD A;  3BR6 A;  2FSW A;  2X51 A;  2P6T A;  3ZMU A;  2MLK A;  2P8T A;  4BBR J;  4KA4 A;  3KZI C;  1POG A;  4Q5S F;  1WSU A;  2MBF A;  2Q2E A;  3OV8 A;  2LBF B;  1RET A;  2YUS A;  5D5W B;  3AAF A;  1G6N A;  4HX8 A;  4EEF G;  3A0H C;  2EIK H;  1AOY A;  1L0O C;  4CYC B;  2JPC A;  2XV4 S;  2R5Y B;  4H0E A;  2QQ8 A;  2JSC A;  3EET A;  5FKM A;  3HPH A;  3KEQ A;  2M34 A;  2WB1 N;  3C3W A;  5FKO A;  1ZR2 A;  4MQV A;  3HTS B;  3MCZ A;  4DNC A;  4G6Q A;  1S72 I;  2H09 A;  3HOY J;  4LOC A;  3BC8 A;  1KYZ A;  4XLE A;  4FQG A;  5DD4 A;  3SEZ A;  5IYC J;  1D5V A;  1TC3 C;  4GYI A;  2BBY A;  2R3S A;  4LG0 B;  2D2W A;  1F1Z A;  5JFR A;  2FQ3 A;  3GYH X;  2D1V A;  3DKX A;  3K70 C;  2J5P A;  4NNJ A;  1ERD A;  5F0H A;  3L1P A;  5F1R A;  1UHM A;  4I99 C;  1QHG A;  2K5C A;  2K9M A;  2YS9 A;  2L01 A;  2HOS A;  4M73 A;  3GXO A;  1ZAO A;  1LQ1 A;  1JTX A;  2DA6 A;  2ISY A;  2M4G A;  3O6B B;  1KA8 A;  4F55 A;  4QIW N;  4BAC A;  4C2M J;  2JT1 A;  3OL4 A;  4LLG F;  1TLH B;  3WGG A;  5J1U A;  3SHF A;  2VKV A;  3WU0 A;  1WWX A;  2G7U A;  4ZZL A;  3GLL A;  3WTS C;  3CCR I;  4P5O A;  1UFM A;  4IQJ A;  3FBI B;  3GZN B;  3KE2 A;  2H8R A;  2WAQ A;  4AVP A;  1A6I A;  3JRG A;  2A5Y B;  3GTJ J;  4IHS A;  1Y56 A;  3L2C A;  2FF4 A;  3EDP A;  1QBJ A;  4NC8 A;  4M6X A;  3J7Z I;  4LIT A;  5L3G A;  3CO7 C;  4KIF A;  1R9T J;  1TWF J;  1SMY F;  2ZXJ A;  2WBM A;  2HFH A;  3BJO A;  5CYV A;  5D8K B;  1BI3 A;  1G4D A;  1SAN A;  4LGW A;  3DPT A;  4F52 A;  4X6A J;  4HW0 A;  3BR0 A;  4M72 A;  4HG2 A;  3TOB A;  1NTC A;  2EJR A;  4ANJ A;  1K61 A;  3ISP A;  1FJL A;  1MNE A;  2DFI A;  1XMX A;  2CU7 A;  1FX7 A;  2M0C A;  3P7N A;  2CV2 A;  5B66 C;  1YI2 I;  3OYI A;  1Z67 A;  4W97 A;  3BP8 A;  1MSE C;  1WGX A;  2JA5 J;  2YU9 J;  1HW2 A;  2DTR A;  2ZJ2 A;  3RIR A;  3DLL F;  4BE1 A;  2XUB A;  4BE0 A;  2VC0 A;  2WAQ N;  4XR6 A;  3RZD J;  2Y30 A;  1SEU A;  3BG7 A;  1KZH A;  1MZB A;  3RQI A;  3JRE A;  1ZGJ A;  1XMK A;  1H88 C;  3ABT A;  5FKK A;  5HLI A;  3SEQ A;  4ESB A;  3WTW C;  1FNN A;  2DW4 A;  5BPI A;  2L4A A;  5B3S H;  5HS7 A;  1LVA A;  1FT9 A;  3F8N A;  5HS9 A;  3WTZ A;  4RM3 A;  4ZYD A;  1K6O A;  4JX4 A;  2L0K A;  2V4J C;  2Z9O A;  4A0X A;  2CW0 F;  3P9K A;  3B73 A;  2AS5 F;  1OPC A;  1HF0 A;  5IYB J;  4J19 A;  2HR3 A;  3CLQ A;  2BHZ A;  3MKZ A;  4RGX A;  2QSG X;  2HOT A;  2V9P A;  2L7Z A;  4D5F A;  4YIR X;  3AL0 B;  1RUN A;  1BA5 A;  1MBF A;  3FHN A;  2IA0 A;  1P2F A;  4B3A A;  3ULQ B;  2EFP A;  3EUA A;  3SZG A;  3CES A;  1PUE E;  1CGP A;  3GTO J;  2LRD A;  3JRC A;  1I3A A;  1W36 C;  1O57 A;  4XOT A;  1QNT A;  4S05 A;  5IPA A;  2ZME A;  4NBQ A;  1TNT A;  3VSL A;  4CA0 A;  1JKR C;  1QGP A;  4A3D J;  3KLO A;  1ODD A;  5EYR A;  1R6R A;  2ZFW A;  3MMY B;  1TBX A;  4CGZ A;  3HHG A;  2M8E A;  3HUG A;  2XB5 A;  4N9H A;  2ZC2 A;  3I59 B;  3PM1 A;  3OYM A;  3FZV A;  2STW A;  2X1C A;  5E3M A;  2F4M B;  3C18 A;  5A2Q Z;  3TO7 A;  2R93 J;  3DV8 A;  4DBR A;  3O3K A;  4RDU A;  2KDO A;  2JQ7 A;  3GTP J;  2DT7 B;  3K4B A;  2LY2 A;  1ON1 A;  1P6R A;  3H0G J;  4IXA A;  5CQE A;  1WJB A;  5EDN A;  1ZRE A;  1DQU A;  2X6X A;  3S2H J;  4RLF A;  3CO6 C;  3UKG A;  2MC4 A;  2CQK A;  2F4I A;  1FIP A;  2LKS A;  4XID A;  1E0E A;  4XIC A;  2HVR A;  2LYC A;  1BI2 A;  1T33 A;  5FD5 A;  1YIJ I;  1W5S A;  4L9J A;  2FA5 A;  4I0B A;  3BZ6 A;  4KNY A;  5F27 A;  3ECH A;  1V55 H;  2E7X A;  3G1L A;  3MKY B;  2H1L A;  2NS0 A;  2XRO A;  1YJ9 I;  1ORK A;  2EWN A;  3T8T A;  1R1U A;  2LKP A;  1A31 A;  1Y8R B;  2RAE A;  1F5T A;  4ENN A;  5GP9 A;  3ABU A;  5EEA A;  1ZKG A;  3DEE A;  4HDU A;  3DXJ F;  1OCR H;  4I76 A;  2ID3 A;  2NS7 A;  4ZDL A;  3F21 A;  4JX6 A;  3I64 A;  1GXQ A;  3RJP A;  3HSE A;  1HXD A;  1V3F A;  1BJZ A;  4FET A;  1ETY A;  3JTH A;  4UB6 C;  4LIU A;  4DYR A;  3E5U A;  1KQ0 A;  5D4S A;  5EF6 A;  4A3I J;  3E6B A;  2ME0 A;  1JGG A;  1RZ4 A;  2R7S A;  2DJI A;  4BKX A;  2K86 A;  3GWZ A;  3KYD B;  1E3H A;  4ZDO A;  2M7B A;  5FD6 A;  2OCC H;  3C2H A;  3HB9 A;  3ZMZ A;  1SD4 A;  4BAY A;  1XGS A;  2PI0 A;  1ONV A;  2WV0 A;  2V9V A;  1QU3 A;  2EZH A;  1OKR A;  1YOV B;  3V7C A;  2NOG A;  1EA3 A;  1S8N A;  2LF8 A;  4ABZ A;  5HNH A;  2OC6 A;  3CCU I;  2DMT A;  5E8G A;  1TQP A;  2NNN A;  4HX7 A;  2VOD A;  3HM5 A;  4NC6 A;  1XGN A;  3OYH A;  2E1M B;  1GLN A;  3CUO A;  1T08 B;  4CSW A;  2XAU A;  2XIG A;  2MC3 A;  4HQE A;  4WK8 F;  3QOD A;  1I1S A;  5ICC A;  2GZW A;  3B6C A;  3F8F A;  4U7D A;  3HHH A;  5D5X B;  3GLX A;  1MDM B;  2DDB A;  2H6C A;  4Z6Y A;  3S15 J;  1JJ8 C;  3VDX A;  3MVP A;  4AVZ A;  2CRG A;  2VN2 A;  3FWE A;  2ZJP F;  2DI3 A;  4IPA A;  4AID A;  2CFX A;  2V7F A;  4MNU A;  2CUE A;  3AG1 H;  3EYI A;  1WH5 A;  3KLN A;  2E34 A;  2L9R A;  1FYL A;  4IL6 C;  1LE8 A;  3K1M A;  5JHF A;  1FLI A;  3AFH A;  1YRN B;  4MEY F;  2E1N A;  2VXZ A;  2W57 A;  4BEH B;  4S0H B;  5E3L A;  2CFO A;  2MD5 A;  3U1D A;  4PJM A;  4FIS A;  3E0J B;  4BQN A;  3FXU A;  3KP4 A;  2GXB A;  4U0W A;  1DUX C;  1HST A;  1W0U A;  2QSH X;  3OY9 A;  2FML A;  1AKH B;  4YRV A;  4EJV A;  2B7E A;  1YHQ I;  1ETV A;  2P81 A;  3G73 A;  2VQL A;  5DCM A;  3H5A A;  3LNQ A;  1Y6I A;  2NXN B;  1HW5 A;  2XC7 A;  4YFN F;  2LLK A;  3HYI A;  3A1Y A;  4FHT A;  1U9O A;  1ZGW A;  3K4J A;  3S17 J;  2HPI A;  3J7Y J;  4XRF A;  3BQZ A;  1LJ9 A;  2VJ4 A;  1LVK A;  3S8P A;  2KL4 A;  3CME I;  1VQ6 I;  4L5I A;  2HOA A;  4GGG A;  3H3Z A;  3JR9 A;  1FY7 A;  3G1M A;  5DM7 F;  1B8I B;  1IAW A;  2JUG A;  4RB3 C;  3I4P A;  5E3N A;  3QPL A;  2R4G A;  1YX3 A;  2M30 A;  4RAZ A;  2AO9 A;  2DK8 A;  2M4K A;  4L9V A;  2O3F A;  4CYD A;  1X1C A;  4IOA F;  3TO9 A;  5FO5 A;  3W6K B;  5J4V A;  5H20 A;  1AHD P;  3HOU J;  3NWT A;  4DZJ A;  1BR4 A;  1LFP A;  4L5J A;  3H92 A;  1BC8 C;  3LAP A;  1RES A;  2VE8 A;  1HKQ A;  2EB7 A;  1Y39 A;  2M0M A;  1GVD A;  4WF2 A;  1FTT A;  5IYD J;  3E6M A;  2RNJ A;  3LA2 A;  5GAD J;  5HLT A;  1I39 A;  3PNV A;  1UCR A;  1VQ4 I;  2BXZ A;  4I6Z A;  4O5V A;  4AIJ A;  1JKP C;  5IT9 K;  1PUF A;  2XF6 A;  3I0T A;  1CF7 B;  1BW5 A;  2DMN A;  5CVV A;  2L3D A;  1YW8 A;  2EA2 A;  3OYJ A;  5EG0 B;  1BIA A;  4QPQ A;  4OMY A;  1VZ0 A;  2PQ8 A;  3GVA A;  3KP2 A;  2GLO A;  3L7W A;  3OYD A;  3I5U A;  4A0Z A;  2NYX A;  2KRF A;  5CPR B;  2UXX A;  4F92 B;  5J1Y A;  1YIT I;  2A69 F;  1MBG A;  1XC5 A;  2EK5 A;  1U0J A;  4RA2 A;  5FRM A;  4ZTF A;  2XRL A;  4L0Y B;  5FLX K;  5L3D A;  3M1C A;  1Z9C A;  1G3S A;  4F91 B;  1IRX A;  1WI3 A;  1R1V A;  3CJR B;  2RVC A;  2HTS A;  1I6H J;  1A6Q A;  3DLA A;  2BE5 F;  3RSN A;  1K6Y A;  1MJA A;  1K78 B;  3QQA A;  3LA3 A;  2WC2 A;  4ZJZ A;  4G8X A;  2BHY A;  3K2A A;  2BY2 A;  1W36 D;  3FHZ A;  3IH4 A;  1IN7 A;  4R1H A;  3H1C A;  1T56 A;  5TJJ A;  4FAS D;  2DMQ A;  3K1P A;  1VQM I;  1R00 A;  2K9Q A;  2P6S A;  4Y3O A;  1FOK A;  2F5C A;  3VYT B;  1MH4 A;  2W82 A;  4X1E A;  1XS9 A;  2H8W A;  3CUQ B;  4TV7 A;  2R0Q C;  4NQW B;  3DTK A;  2BOL A;  3DBH B;  1KU7 A;  1Q1H A;  4BH9 A;  4G94 A;  4CDG A;  1TW3 A;  1SFX A;  2Z5U A;  3CLO A;  2L7K A;  5CQG A;  1D8K A;  2NS8 A;  4XMY A;  4KYW A;  2M1B A;  4HV6 A;  4PCQ A;  2V1X A;  1XPX A;  3OR2 C;  2PX9 A;  2KQR A;  3GTG J;  3UNG C;  3LSI A;  1X3U A;  2Z16 A;  4JQF A;  4DYC A;  1H9T A;  3CCY A;  4HAM A;  2XAS A;  3DU6 A;  4AIH A;  3ABL H;  2R7D A;  3S2D J;  3HL2 A;  4Y7N J;  1IXR C;  3RKQ A;  2R7Q A;  4M9X A;  1REP C;  1KU9 A;  3F8C A;  1F4K A;  3A0B C;  2KJB A;  1V5E A;  4ENM A;  1EH6 A;  3IAM 2;  4IQ4 A;  1G2H A;  1S3J A;  2E2I J;  4BL0 B;  3GCM A;  3V8K A;  3L2V A;  2HTJ A;  2CO5 A;  3GX4 X;  3BZC A;  5LHI A;  4CHU A;  4M3D A;  1J7K A;  3JRF A;  3C7J A;  3RCO A;  2CMP A;  2BY0 A;  5BMZ A;  1HDP A;  3CDL A;  2ZB9 A;  4LK1 F;  1J59 A;  3S16 J;  2M3A A;  2R5Z B;  1HA8 A;  1I5Z A;  3LSM A;  1R5I D;  2DXI A;  4GRI A;  2VPL A;  1FPQ A;  2WB1 A;  1XTA A;  5DEQ A;  3WU1 B;  3SZP A;  4MTD A;  2OQG A;  1Y0N A;  5GAG J;  2ISZ A;  5HLG A;  2M45 A;  3PQJ A;  2LY9 A;  5LBQ A;  5LRS A;  4J01 A;  3PSF A;  4X0G A;  1IF1 A;  4II2 A;  2XF7 A;  1E17 A;  2V1N A;  3BTL A;  5KK1 A;  4RAG A;  2JVH A;  3CJN A;  1ETO A;  3PSI A;  3ZQQ A;  1TT0 A;  4XK4 A;  3KP7 A;  2P5V A;  4K2E A;  4GDF A;  2DA2 A;  1RNL A;  1XSX A;  3HBL A;  3S2W A;  3I56 I;  2O5R A;  3J81 K;  3ZQH A;  1T0F A;  2BW3 A;  3ZN1 A;  4B3X A;  4BNC A;  5J3L A;  1R71 A;  4BXF A;  4BU2 A;  2JRT A;  2COM A;  1UEL B;  2DDA A;  3O2P E;  4XOR A;  4A3G J;  1EH7 A;  3FIW A;  1DP3 A;  1M1E B;  5FKN A;  2K9N A;  4V2G A;  4HX4 A;  1D0X A;  3ZR8 X;  5JI6 A;  1MJ9 A;  3CCS I;  4MIM A;  3IRQ A;  2CW7 A;  3H3U A;  3BPX A;  3MZY A;  1B72 A;  3CZ6 A;  1UZC A;  5FFX A;  1MND A;  1IRZ A;  1TWH J;  4FCY A;  4OIP F;  2IS6 A;  1U78 A;  1CQT A;  1P4A A;  5EZG A;  3CD6 I;  4M3F A;  2LG4 A;  4OAY A;  2GXG A;  2MLG A;  1LB2 A;  1FTZ A;  1Z21 A;  1STZ A;  2QYO A;  1WI9 A;  3K0L A;  4ZZD A;  2VC1 A;  3SZT A;  4DQ2 A;  2NAZ A;  4XQF A;  3EYY A;  4E7S A;  2L9N A;  3ZQL A;  3QYE A;  3RPU A;  1U6G A;  2E1M C;  2VL8 A;  1ZAR A;  3CUQ C;  3FM3 A;  1W7P B;  1SD5 A;  2K27 A;  2Y9Y A;  2VAS A;  4N4O B;  4IRH A;  4Y13 A;  3OYB A;  5F6F A;  3FKJ A;  3W6J B;  2JJ7 A;  3X2Q H;  1T95 A;  4RMN A;  4FT8 A;  4ZYH A;  3BZK A;  3I9V 2;  2DFF A;  3C1D A;  2EIL H;  5LHG A;  2XKO A;  1X1B A;  3V7R A;  4IRI A;  2ACJ A;  2XKP A;  2IXS A;  3WTX C;  3S1R J;  3BRO A;  2EFN A;  3PIP F;  4CUG A;  4NDL A;  1P4W A;  3DPL C;  3SJM A;  1AA7 A;  2DA4 A;  3CCQ I;  3S14 J;  1TWC J;  2K85 A;  3A01 A;  1KON A;  1V54 H;  3S93 A;  2BYV E;  1K79 A;  2OD5 A;  3IH2 A;  5HDK A;  3KFW X;  3ZGK A;  4QPO A;  3OWT A;  1IV6 A;  3E5X A;  2E19 A;  3BR2 A;  5D6F A;  2R7T A;  5F1J A;  3OYE A;  3GTK J;  4LK0 F;  3VOE A;  1GV5 A;  1WVR A;  1O7F A;  2F2E A;  2IEK A;  2XGE A;  1P7I A;  1B59 A;  5J47 A;  4L0Z B;  1J2X A;  2HDD A;  1QZY A;  4UVC A;  5C3E J;  1R4M B;  2VKD A;  4G9Y A;  2A07 F;  4BE2 A;  1YQA A;  1VQK I;  2DN0 A;  1FYK A;  2VKH A;  3NEU A;  3QYF A;  2OV7 A;  2F48 A;  4I7H A;  2L2O A;  3EPZ A;  4PUS A;  2QA4 I;  4HF0 A;  2FBI A;  1YTY A;  3M8J A;  2A5W A;  2KMU A;  2W48 A;  2HYF A;  1NG7 A;  3BJA A;  2PJR B;  1XB4 A;  1YS7 A;  3W2W A;  2F5E A;  1B9M A;  1TP4 A;  2M8G X;  5J40 A;  3EUH C;  5DM6 F;  4PSX A;  5J1R A;  2DQR A; 
#chains in the Genus database with same CATH homology
 1Z05 A;  1BIB A;  1YIO A;  4ON0 A;  1P4X A;  4EQQ A;  2HKX A;  4B09 A;  3I59 A;  3FF5 A;  4U88 A;  1KU2 A;  5LGN A;  5ILU A;  3LWF A;  1T6S A;  5D8L B;  1FSH A;  1RI7 A;  2OA4 A;  4HF2 A;  2VBY A;  2VT2 A;  1KGS A;  3WGH A;  1ZRC A;  3F3X A;  1ZN2 A;  2RQP A;  4MHG A;  2MH9 A;  4HZF A;  2YU3 A;  4L9T A;  3TDU C;  3P9C A;  2W85 A;  3T0Y A;  2YPR A;  4Q4Z F;  5AIP A;  4LLN A;  1ZLK A;  1U2W A;  1Z6R A;  3TQN A;  5BOX A;  3M9A A;  1LEA A;  1J75 A;  1WQ2 A;  1IN4 A;  3R0A A;  2F5D A;  2CWE A;  3FXQ A;  3JW4 A;  2KIF A;  1MKM A;  3ZN0 A;  5CVR A;  1BC7 C;  2Z3Y A;  3NQO A;  5L3E A;  4P55 A;  1J0R A;  4HLX A;  4KN4 X;  4OOI A;  4AD9 A;  3K69 A;  1R36 A;  3BPV A;  1EH8 A;  2PEX A;  2XHK A;  4NHJ A;  1MGT A;  1YLF A;  1Z91 A;  4UNO A;  2YSR A;  1T39 A;  1D3Y A;  1OYW A;  2EA4 A;  3F8M A;  1SD6 A;  1HKS A;  2ESN A;  4P9U A;  1LDD A;  3R0J A;  2F5F A;  3ZP5 A;  5K5O A;  3GZ6 A;  1U5T B;  1H0M A;  2V6C A;  1FP1 D;  3WE3 A;  3SXY A;  2VBZ A;  1G3T A;  4LMY A;  3ERE D;  1ZG3 A;  4RS8 A;  4A0Y A;  4EGZ A;  3EUH A;  3BJ6 A;  5J8F A;  1UHW A;  1KYW A;  3GFM A;  3L9F A;  2JPB A;  1SFE A;  3HSR A;  3V4G A;  4A5N A;  1FBS A;  3J80 Z;  2H94 A;  3JAM Z;  1DPU A;  4Y17 A;  1IXC A;  3DQV C;  3WTV C;  4L18 B;  2P5L C;  4HBL A;  4WCG A;  5D5U B;  2QQB A;  5E1X A;  4RGR A;  2IT0 A;  5DD8 A;  1LDJ A;  4LJZ F;  1O3Q A;  3ZMS A;  3IHU A;  1XMA A;  4M6Y A;  5ILV A;  1CF7 A;  2QWW A;  4RAY A;  5BQT A;  2A68 F;  3E6C C;  3J80 K;  5CLS A;  1IN5 A;  4Y15 A;  1L3L A;  4ASN A;  4YII A;  3REO A;  2XAF A;  1U3E M;  1JGS A;  4WWC A;  4MGR A;  5D6E A;  4WXD A;  2PLY A;  1BOA A;  2CSO A;  4LFU A;  2DLL A;  4N0B A;  5FB2 A;  3U9G A;  5L3B A;  4I98 B;  1K78 A;  1TW2 A;  2XAG A;  3SFZ A;  3HTU A;  3JSO A;  2UWM A;  1HQC A;  2FEZ A;  2AXL A;  1O7L A;  1KQ8 A;  2HS5 A;  4D0P A;  4UV8 A;  1I6X A;  1OYI A;  3V8L A;  4EJT A;  4CO8 A;  3TKY A;  2QBY B;  4ZYG A;  2RGV A;  2A3S A;  2CYY A;  5J6X A;  1ZLJ A;  2IP2 A;  5TRD A;  4HDV A;  1TTY A;  4XSZ F;  2ZCW A;  2EFW A;  4YIF A;  2A6E F;  4P9F A;  3RKX A;  1WRJ A;  4BYY A;  2DPD A;  3ML6 A;  2MA3 A;  3QOP A;  1LNW A;  1TQI A;  2E7W A;  1W5T A;  2KKO A;  4U0V A;  1I27 A;  2QQA A;  3N4M A;  3WTY C;  4ENJ A;  3CTA A;  3HSF A;  3L09 A;  1BI1 A;  4ZYE A;  2O6G E;  2QZ8 A;  4UVB A;  4OMZ A;  2P5K A;  4I2O A;  2WWY A;  4A2U A;  4ESJ A;  1UB9 A;  4OIO F;  2DBB A;  3HOT A;  5HDG A;  3IWF A;  2FBH A;  1FP2 A;  1D8J A;  5EEG A;  4XLP F;  2HEO A;  5JR3 A;  4XBF A;  1IZ1 A;  2LF7 A;  2GQQ A;  4BHB A;  2STT A;  2DT5 A;  1JXS A;  1HSJ A;  2E1C A;  2FE3 A;  3K9T A;  3Q5F A;  1QO0 D;  3J7A O;  2HOE A;  5DUK A;  3RYR A;  1UST A;  3PQK A;  3V8J A;  3SQN A;  2OAZ A;  2RC4 A;  3LFK A;  3U2R A;  1YW7 A;  1AWC A;  3L00 A;  4E70 A;  4IHT A;  2IPQ X;  2QLZ A;  3KP3 A;  2HQR A;  2Y48 A;  3KP6 A;  3VFZ A;  4IRG A;  3QU6 A;  4RB0 A;  2V1U A;  4N9I A;  4A5M A;  2HKO A;  1YW9 A;  3M8E A;  5D4R A;  5J8C A;  1NHA A;  3WTT C;  2VOP A;  1G3Y A;  3DP7 A;  1U8R A;  1XGM A;  2L4M A;  2H6B A;  3F22 A;  4LD5 A;  4M9Z A;  4LB5 A;  3GFI A;  3P9I A;  5LGU A;  2G7H A;  3IKT A;  2HZT A;  3I53 A;  4R8H A;  1XD7 A;  2M5W A;  3IWZ A;  1SAX A;  3RTR A;  3FX3 A;  2DK5 A;  5F64 A;  4FX0 A;  4IF4 A;  2HGC A;  2K4J A;  2FNA A;  3QP6 A;  4EMS A;  5KVR A;  1ZHF A;  4CZZ A;  4ZH4 F;  2IJL A;  3M7G A;  4EVI A;  2KIM A;  5LHH A;  1XGO A;  2RDP A;  5E18 F;  1YS6 A;  4Z2Y A;  1WKM A;  3VOD A;  2W24 A;  4KT5 C;  2FMY A;  3R60 A;  4WXH A;  4JK1 X;  3Q9V A;  5FFZ A;  1I1G A;  1B4A A;  1MDM A;  4MEX F;  2FBK A;  4O3M A;  2ZNZ A;  5FGM A;  5IT9 Z;  5DCF A;  2ZKZ A;  3N97 A;  3MWM A;  5ED4 A;  2VOO A;  4A12 A;  1BBY A;  3FMS A;  2L54 A;  4ETS A;  4GCV A;  2ZME B;  3FM5 A;  4GYG A;  5H6R A;  3DEU A;  2HWV A;  4IVN A;  2H27 A;  3IC7 A;  5HDN A;  2K4B A;  3RPQ A;  4ENK A;  2XGX A;  1FBU A;  2PG4 A;  1B6A A;  2BEO A;  2EV6 A;  2KJC A;  2DPU A;  2K02 A;  3MEX A;  2XAH A;  3QRF F;  3R4K A;  1XCV A;  2FXA A;  5A2Q K;  4PGH A;  4MTE A;  2PMH A;  5ICF A;  4HF1 A;  4I0A A;  1ZH5 A;  2K7L A;  2NRA C;  1DP7 P;  1KQ9 A;  3F23 A;  1HKT A;  2GA1 A;  4UHT A;  1T98 A;  4CXF A;  3WG9 A;  2EFO A;  1R5G A;  2HYG D;  2Q8K A;  1R7J A;  1XDU A;  5E20 A;  2BGC A;  5BPD A;  1K7A A;  2GAU A;  3WTU C;  2OZU A;  2D45 A;  3HRT A;  1YG2 A;  3JSP A;  3M8F A;  4S04 A;  1VTN C;  1IN8 A;  2LDU A;  4O6J A;  4U7B A;  1SFU A;  3F6V A;  1SMT A;  4EJW A;  3GF2 A;  4Q48 A;  1V4R A;  4G7Z F;  4KUM A;  2LSO A;  2YX7 A;  4I09 A;  4KMF A;  4IJA A;  3BWG A;  3KCC A;  4FX4 A;  3BDD A;  2EV0 A;  3F6O A;  4QLC U;  2HQN A;  4LB6 B;  1W4M A;  1XSD A;  5L3C A;  3I58 A;  1OMI A;  3PFI A;  4M71 A;  4OIQ F;  1P92 A;  3MFK A;  4L9N A;  2IA2 A;  1Z6T A;  1GHC A;  3VEP A;  3R61 A;  3HRS A;  4G6D A;  3ROU A;  1PP7 U;  5H6Q A;  5K5R A;  2PFB A;  3GW2 A;  1GVJ A;  4RGS A;  3WGI A;  2XAJ A;  2HDC A;  4YG2 F;  3GO5 A;  2OZ6 A;  3E5Q A;  3HRU A;  1YYV A;  2X0L A;  4CIC A;  3GUD A;  5LLQ A;  1S7O A;  2A61 A;  3T8R A;  3TDZ C;  2TDX A;  4UVA A;  4BQA A;  3LQR A;  3RKW A;  2ADU A;  4G7H F;  2J5O A;  3DKW A;  4JBA A;  1XDS A;  2Z33 A;  5LRR A;  3Q9S A;  3IKV A;  4AIK A;  1F9N A;  3CDH A;  4EJU A;  4LG0 A;  5HLH A;  1O3S A;  2V1D A;  5DUI A;  2B0L A;  1J5Y A;  4F7Z A;  1ULY A;  3J81 Z;  3RKY A;  1R22 A;  4OU0 A;  1ZRF A;  1USS A;  2P4W A;  2O0Y A;  3QP5 A;  2JTV A;  4LLL A;  1U5T C;  2WTE A;  1YO5 C;  2ELH A;  1H9G A;  1TQM A;  2V79 A;  4PGG A;  2ETH A;  4AWX B;  3KZZ A;  5DV5 A;  2IW5 A;  3RI4 A;  4NQW A;  5DDG A;  5ERI A;  3M1E A;  5E8I A;  4WX9 A;  1XCB A;  2QEN A;  1BN5 A;  3BOQ A;  4G7O F;  2G9W A;  1FBQ A;  1BM9 A;  1QZZ A;  3E97 A;  3ZMD A;  1BJA A;  4WXC A;  2DQL A;  1R23 A;  4KFC A;  5E1W A;  3WOD F;  1QQI A;  2VBW A;  6PAX A;  4HOB A;  5FLX Z;  3GEZ A;  4EV0 A;  5DYM A;  1XN7 A;  3T1B A;  4OIR F;  2RV8 A;  3ZMV A;  1S29 A;  4HLY A;  1B1B A;  5LGT A;  1MJB A;  2ZBK A;  5ILS A;  1O3T A;  3IRR A;  4KMU X;  1FZP B;  3DF8 A;  4A6E A;  2VBX A;  4YFK F;  4HA8 A;  2ESH A;  2QVO A;  1S6L A;  1LEB A;  1R58 A;  3KP5 A;  4HYE A;  3D5L A;  4KIB A;  1FWZ A;  2Y0M A;  1ZG1 A;  3EQL F;  3MZH A;  3T5X A;  4HQM A;  3FMQ A;  5CVU A;  5HVQ C;  2X4H A;  4B8X A;  3K2Z A;  2UXN A;  3K1N A;  5AON A;  4EJO A;  1O3R A;  1A04 A;  1DPR A;  1PP8 F;  5JHU A;  3BY6 A;  3FMR A;  3KZY A;  2QUF A;  1SD7 A;  2PJP A;  5CVI A;  2OU2 A;  4RGU A;  3MAJ A;  2Z99 A;  4R79 A;  2IRF G;  2XVC A;  2MH2 A;  3V7S A;  3ELK A;  3TOA A;  1W7P A;  2A6H F;  2PMU A;  1G3W A;  2O8X A;  1ON2 A;  1LDK B;  4EM2 A;  4KIC A;  2DU9 A;  2PBI A;  2GA2 A;  4EGY A;  4BHC A;  1JE8 A;  1E2X A;  2DO7 A;  2Q0O A;  5LEJ A;  1PDN C;  3QAH A;  4EM1 A;  2NNY A;  3DFG A;  1DDN A;  5AIQ A;  4NB5 A;  2PN6 A;  1U5T A;  3F72 A;  2L02 A;  2BV6 A;  2W84 A;  5ICG A;  1IXS B;  3GFJ A;  3ZQ7 A;  5JVT A;  2ZNY A;  4PZJ A;  2KIU A;  2CGP A;  1IRF A;  2JZY A;  4KIG A;  3ZMT A;  1S7A A;  4YFX F;  4Q47 A;  5L3F A;  4I01 A;  1Y0U A;  3D0S A;  4UUV A;  3E6D A;  1MD0 A;  2GWR A;  1C0W A;  5LEK A;  2GIV A;  2VT3 A;  3JAM K;  3B02 A;  3TO6 A;  5ICE A;  2EFQ A;  3LQQ A;  3GZ5 A;  4XLN F;  5CJ9 A;  1FC3 A;  3KET A;  1IUY A;  4XSX F;  5HS8 A;  2CG4 A;  4KDP A;  1FYM A;  3WE2 A;  3RYP A;  5CVJ A;  3ZPL A;  2O61 A;  5DCM B;  4UV9 A;  3HIF A;  1XSV A;  2RN7 A;  1KU3 A;  3QU3 A;  2IA1 A;  1FSE A;  1IN6 A;  2O03 A;  2Y75 A;  3F8B A;  3IL2 A;  4RB2 C;  2QQ9 A;  2R7F A;  2P7C B;  4EM0 B;  3FXR A;  2OBP A;  2YR2 A;  3LAJ A;  1R1T A;  4I02 A;  3VB2 A;  3G3Z A;  4BXU A;  3ECO A;  2W25 A;  2QM3 A;  4M9S A;  3QPH A;  1T2K A;  2XRN A;  3TGN A;  1GXP A;  1JHF A;  1T38 A;  4UXN A;  1HW1 A;  4KN7 X;  5HOO A;  4GXO A;  1ZYR F;  2FNP A;  2FOK A;  2IVM A;  5EEH A;  5BS6 A;  3GFL A;  3I54 A;  4M74 A;  2QBY A;  1IW7 F;  1R5H A;  2LNB A;  5E1Z B;  3LA7 A;  1YFH A;  2UZK A;  1ZG5 A;  2FU4 A;  2YX4 A;  1QPM A;  5E17 F;  4GO1 A;  3R6S A;  4ESF A;  3QPT A;  5D5V B;  2M87 A;  3LST A;  2VE9 A;  3I71 A;  4HV5 A;  2C6Y A;  4QWQ A;  1RIO H;  2RKH A;  4U0Y A;  3KEO A;  1Z7U A;  1JHH A;  5K5Q A;  1ZGA A;  3CUQ A;  1EV7 A;  3HOS A;  1J9I A;  2ZO4 A;  2FRH A;  1Z1D A;  1B9N A;  3HRM A;  3OOP A;  4BHP A;  4MQ9 F;  3RDI A;  1OR7 A;  5K1Y A;  1HBX G;  1TNS A;  2P7V B;  4A6D A;  2XAQ A;  4PDK A;  1IRG A;  1W7P D;  3JTG A;  2OQR A;  4RB1 A;  2D1H A;  2EV5 A;  1OYY A;  5IT3 A;  3COA C;  1BI0 A;  3NRV A;  3MQ0 A;  2VON A;  2DAO A;  3E3V A;  4P96 A;  1RUO A;  4OIN F;  1ZRD A;  2FSW A;  2P6T A;  3ZMU A;  2MLK A;  2P8T A;  4KA4 A;  4Q5S F;  1WSU A;  2MBF A;  2Q2E A;  3OV8 A;  5D5W B;  3AAF A;  1G6N A;  4HX8 A;  1AOY A;  1L0O C;  2JPC A;  2XV4 S;  4H0E A;  2JSC A;  3EET A;  3KEQ A;  3C3W A;  4MQV A;  3HTS B;  3MCZ A;  4DNC A;  4G6Q A;  2H09 A;  1KYZ A;  5DD4 A;  1D5V A;  4GYI A;  2BBY A;  2R3S A;  4LG0 B;  2D2W A;  1F1Z A;  5JFR A;  2FQ3 A;  3GYH X;  2D1V A;  2J5P A;  5F1R A;  1UHM A;  2L01 A;  4M73 A;  3GXO A;  1ZAO A;  1LQ1 A;  2ISY A;  3O6B B;  1KA8 A;  2JT1 A;  4LLG F;  1TLH B;  3WGG A;  3SHF A;  3WU0 A;  1WWX A;  2G7U A;  4ZZL A;  3WTS C;  4P5O A;  1UFM A;  3KE2 A;  4AVP A;  2A5Y B;  4IHS A;  3L2C A;  2FF4 A;  3EDP A;  1QBJ A;  4M6X A;  5L3G A;  3CO7 C;  4KIF A;  1SMY F;  2ZXJ A;  3BJO A;  2HFH A;  5CYV A;  5D8K B;  1BI3 A;  1G4D A;  4LGW A;  3DPT A;  4HW0 A;  4M72 A;  3TOB A;  2EJR A;  3ISP A;  2DFI A;  1FX7 A;  3P7N A;  3BP8 A;  1HW2 A;  2DTR A;  2ZJ2 A;  3RIR A;  2XUB A;  2VC0 A;  1MZB A;  1ZGJ A;  1XMK A;  3ABT A;  5HLI A;  4ESB A;  3WTW C;  1FNN A;  2DW4 A;  1MDM B;  2L4A A;  5BPI A;  5HS7 A;  1LVA A;  1FT9 A;  3F8N A;  5HS9 A;  3WTZ A;  4ZYD A;  1K6O A;  2Z9O A;  4A0X A;  2CW0 F;  3P9K A;  3B73 A;  2AS5 F;  1OPC A;  2HR3 A;  4RGX A;  1RUN A;  2IA0 A;  1P2F A;  3ULQ B;  2EFP A;  1PUE E;  1CGP A;  1O57 A;  1QNT A;  4S05 A;  2ZME A;  1TNT A;  1QGP A;  3KLO A;  1ODD A;  2ZFW A;  1TBX A;  4CGZ A;  3HHG A;  2M8E A;  3HUG A;  4N9H A;  3I59 B;  3FZV A;  2STW A;  3C18 A;  5A2Q Z;  3TO7 A;  3DV8 A;  3O3K A;  1ON1 A;  1P6R A;  4IXA A;  1ZRE A;  3CO6 C;  2CQK A;  5FD5 A;  1BI2 A;  1W5S A;  4L9J A;  2FA5 A;  4I0B A;  3BZ6 A;  4KNY A;  3ECH A;  2E7X A;  2NS0 A;  2XRO A;  2EWN A;  3T8T A;  1R1U A;  2LKP A;  1F5T A;  4ENN A;  3ABU A;  4HDU A;  3DXJ F;  3F21 A;  3I64 A;  1GXQ A;  3RJP A;  3HSE A;  1HXD A;  1V3F A;  3JTH A;  3E5U A;  1KQ0 A;  5D4S A;  3E6B A;  1RZ4 A;  2K86 A;  3GWZ A;  5FD6 A;  3ZMZ A;  1SD4 A;  4BAY A;  1XGS A;  2PI0 A;  1ONV A;  2WV0 A;  2V9V A;  1OKR A;  3V7C A;  1S8N A;  2LF8 A;  5E8G A;  1TQP A;  2NNN A;  4HX7 A;  2VOD A;  1XGN A;  3CUO A;  2XIG A;  2MC3 A;  4HQE A;  4WK8 F;  1I1S A;  5ICC A;  2GZW A;  3F8F A;  4U7D A;  3HHH A;  5D5X B;  3GLX A;  2H6C A;  2VN2 A;  3FWE A;  2DI3 A;  4IPA A;  2CFX A;  4MNU A;  3EYI A;  3KLN A;  1FYL A;  1FLI A;  3K1M A;  4MEY F;  2E1N A;  2VXZ A;  2W57 A;  2MD5 A;  3U1D A;  2GXB A;  3FXU A;  3KP4 A;  4U0W A;  1DUX C;  1HST A;  2FML A;  4EJV A;  3G73 A;  5DCM A;  1HW5 A;  4YFN F;  3HYI A;  4FHT A;  4XRF A;  1LJ9 A;  4L5I A;  4GGG A;  3H3Z A;  1FY7 A;  1IAW A;  4RB3 C;  3I4P A;  2M30 A;  4RAZ A;  2DK8 A;  4L9V A;  2O3F A;  4CYD A;  3TO9 A;  5FO5 A;  3W6K B;  5H20 A;  4L5J A;  3H92 A;  1BC8 C;  3LAP A;  2VE8 A;  1HKQ A;  2EB7 A;  4WF2 A;  3E6M A;  2RNJ A;  3LA2 A;  1UCR A;  4O5V A;  4AIJ A;  5IT9 K;  3I0T A;  1CF7 B;  5CVV A;  2L3D A;  1YW8 A;  2EA2 A;  1BIA A;  4OMY A;  2PQ8 A;  3GVA A;  3KP2 A;  3L7W A;  3I5U A;  4A0Z A;  2NYX A;  2KRF A;  2UXX A;  2A69 F;  2EK5 A;  4L0Y B;  5FLX K;  5L3D A;  1Z9C A;  1G3S A;  1R1V A;  2RVC A;  2HTS A;  2BE5 F;  1MJA A;  1K78 B;  3LA3 A;  2WC2 A;  4G8X A;  3FHZ A;  1IN7 A;  4R1H A;  5TJJ A;  3K1P A;  1R00 A;  2P6S A;  1FOK A;  2F5C A;  3CUQ B;  4TV7 A;  1KU7 A;  1Q1H A;  4BH9 A;  4G94 A;  4CDG A;  1TW3 A;  1SFX A;  2Z5U A;  3CLO A;  1D8K A;  4KYW A;  2M1B A;  4HV6 A;  4PCQ A;  2V1X A;  1X3U A;  4JQF A;  1H9T A;  4HAM A;  2XAS A;  4AIH A;  2R7D A;  1IXR C;  4M9X A;  1REP C;  1KU9 A;  1F4K A;  3F8C A;  2KJB A;  4ENM A;  1EH6 A;  1S3J A;  3V8K A;  2HTJ A;  2CO5 A;  3GX4 X;  5LHI A;  4CHU A;  1J7K A;  3C7J A;  5BMZ A;  4LK1 F;  1J59 A;  1I5Z A;  1FPQ A;  3WU1 B;  5DEQ A;  3SZP A;  4MTD A;  2OQG A;  2ISZ A;  5HLG A;  2M45 A;  3PQJ A;  5LBQ A;  5LRS A;  1IF1 A;  1E17 A;  5KK1 A;  3CJN A;  3KP7 A;  2P5V A;  4K2E A;  1RNL A;  1XSX A;  3S2W A;  3J81 K;  1T0F A;  3ZN1 A;  4BNC A;  2JRT A;  2COM A;  3O2P E;  1EH7 A;  4HX4 A;  5JI6 A;  1MJ9 A;  3IRQ A;  3H3U A;  3BPX A;  3MZY A;  5FFX A;  4OIP F;  1U78 A;  1P4A A;  2GXG A;  2MLG A;  1LB2 A;  1STZ A;  2QYO A;  1WI9 A;  3K0L A;  4ZZD A;  2VC1 A;  3SZT A;  4DQ2 A;  2NAZ A;  3EYY A;  3RPU A;  1U6G A;  3CUQ C;  1ZAR A;  3FM3 A;  1W7P B;  1SD5 A;  2K27 A;  4IRH A;  4Y13 A;  5F6F A;  3W6J B;  4FT8 A;  4ZYH A;  3C1D A;  5LHG A;  2XKO A;  3V7R A;  4IRI A;  2ACJ A;  2XKP A;  3WTX C;  3BRO A;  2EFN A;  1P4W A;  3DPL C;  1K79 A;  2BYV E;  2OD5 A;  5HDK A;  3KFW X;  3E5X A;  5D6F A;  4LK0 F;  3VOE A;  1O7F A;  2F2E A;  1B59 A;  4L0Z B;  1J2X A;  1QZY A;  4UVC A;  4G9Y A;  2A07 F;  1YQA A;  1FYK A;  3NEU A;  4I7H A;  4HF0 A;  2FBI A;  1YTY A;  2HYF A;  3BJA A;  1XB4 A;  1YS7 A;  2F5E A;  1B9M A;  2DQR A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...