5HS9A

Crystal structure of the quinone-bound yodb from b. subtilis
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
95
structure length
88
Chain Sequence
CPKMESAFSLLGKRWNGLIIHVLMDGPKRFKEITETIPMISQKMLAERLKELEQNEIVERQVVIYTLTEKGTALQAVFQEMQAWADQF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Dna binding protein
molecule keywords HTH-type transcriptional regulator YodB
publication title Two distinct mechanisms of transcriptional regulation by the redox sensor YodB
pubmed doi rcsb
source organism Bacillus subtilis
total genus 29
structure length 88
sequence length 95
chains with identical sequence B
ec nomenclature
pdb deposition date 2016-01-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01638 HxlR HxlR-like helix-turn-helix
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 5hs9A00
4NB5A 2V6CA 5BPDA 1RIOH 1OMIA 3GW2A 2K4BA 2RVCA 4BNCA 4CXFA 4RS8A 3V8KA 1TW2A 2IRFG 3QAHA 3EQLF 1O3QA 1OR7A 2QLZA 4UVBA 3R0JA 1F1ZA 4ZZDA 1KU2A 2EK5A 2GQQA 2YPRA 1L0OC 2RV8A 4G6QA 3I54A 2EV5A 4M74A 2KIFA 5CJ9A 1IN5A 2ZJ2A 2MH2A 3KETA 4O6JA 1I1GA 5DEQA 4N9HA 1JHHA 3HRMA 3ZN1A 1Z9CA 1BI2A 2JPCA 1PP7U 2Y75A 1U78A 4ZYGA 2CWEA 3JAMK 1R5GA 3QP6A 1ZG5A 2LNBA 5EEGA 5BS6A 2O03A 4LG0B 2OQRA 4WXDA 1EV7A 4I01A 1S7AA 4B09A 1DUXC 4OU0A 1U2WA 3QPHA 1V4RA 1ZGJA 4Q48A 3DP7A 2X0LA 2VBZA 3TOAA 3E5QA 1ZH5A 4CYDA 5LBQA 1BN5A 3FX3A 4KIGA 2ZMEA 4D0PA 3ZMTA 5LGUA 3ERED 3VEPA 3R61A 3SXYA 4R8HA 4QWQA 3WGIA 5DV5A 3REOA 5FGMA 5IT3A 4JQFA 4KMFA 1Z6TA 2MLGA 3LA2A 1WKMA 5F64A 2GXGA 1KQ0A 5HS7A 3BJOA 3R6SA 1RNLA 3C1DA 5AIQA 1G3TA 3CUQC 5ED4A 1GVJA 3WG9A 4M9SA 3Q9VA 2DFIA 1XD7A 1L3LA 5HDKA 3MFKA 1FZPB 2AXLA 3KEOA 2NS0A 4CICA 5D5VB 2A5YB 2A3SA 3V7RA 3ZN0A 2HFHA 4ESBA 1E2XA 2GIVA 4ESFA 3TDZC 2VBWA 1EH6A 4RGSA 1G3SA 1R58A 5D4RA 3KP6A 1W7PD 1I6XA 5HLHA 1ZLJA 3WTTC 4I02A 4KFCA 2PJPA 4IVNA 3JTGA 4YIFA 3ZMVA 4O5VA 1TTYA 3O3KA 3Q9SA 3DPLC 1BC8C 2HDCA 3KP4A 3JSOA 1QO0D 2JPBA 4HOBA 3CDHA 3TKYA 5E18F 3GXOA 5J8FA 3P9KA 2QQBA 2K27A 3F8NA 5ILVA 2ELHA 4LD5A 4U0VA 3FWEA 3I59B 3BPVA 1LEBA 3FXQA 5LEKA 3P9CA 3WODF 1SFXA 5E20A 4PZJA 4A0XA 1FNNA 4ESJA 1T6SA 1XMAA 3NRVA 1FOKA 4UV8A 4G7OF 2VOPA 3FHZA 2RDPA 5TJJA 4A2UA 3GEZA 3CO6C 2XAJA 5FFZA 5HS9A 5CYVA 1XCBA 2XIGA 3LSTA 4PGGA 4OMYA 5DCFA 3HSEA 3KLNA 3ABUA 4EJVA 3EUHA 4G8XA 2V1XA 2XKPA 1B59A 3JTHA 2VXZA 4A6DA 3HRTA 4NHJA 2ZKZA 3SQNA 1MDMA 1IN8A 4XSZF 3WU1B 2DPDA 2J5OA 3FMRA 2H6CA 5A2QK 1HKQA 4NQWA 1R1TA 4OIRF 2HYFA 4G6DA 4LK0F 5ILUA 4WXCA 1F5TA 1ON1A 3KLOA 4FX0A 3WTZA 3BJ6A 4KN7X 4EM2A 2DLLA 3FMQA 4EM0B 5LGNA 3J81K 4IF4A 4DQ2A 3LAJA 2NYXA 3LQRA 1FC3A 2ETHA 1ZGAA 4LJZF 3LA3A 3DEUA 1LNWA 5JHUA 1SAXA 1FYLA 2XAQA 2FBKA 2ZFWA 4YG2F 2DO7A 2M87A 2DBBA 1I27A 3T1BA 1XMKA 1Z05A 4I0AA 3DPTA 2OD5A 4IHTA 3E6MA 3BDDA 3ECOA 1EH7A 4MHGA 5ICEA 1JXSA 3I64A 1HSJA 2DK8A 1VTNC 2ADUA 3P9IA 5D4SA 1G6NA 3W6KB 1MJBA 4HV6A 4MNUA 2ACJA 1SMTA 5FLXZ 2FRHA 2VE8A 2HEOA 1TQMA 4N0BA 5D6FA 3M8EA 1W5TA 1QGPA 5L3FA 2XROA 3Q5FA 3WTWC 3M7GA 1TQIA 2EFNA 2HKXA 3VODA 2W25A 4G7HF 4HDUA 2BBYA 3WU0A 4PGHA 2VOOA 2ISYA 5E8GA 1IUYA 3MZYA 4TV7A 3KP3A 3BWGA 3CO7C 2L01A 2OA4A 1QQIA 4AD9A 2XAFA 1HSTA 1ODDA 3DV8A 4HX7A 3ABTA 4OIQF 2H6BA 1BOAA 3TO6A 1MKMA 4KDPA 1UB9A 2COMA 3FF5A 2YU3A 2CO5A 3D0SA 5CLSA 1SFUA 1U8RA 2Y0MA 2KJBA 1HW1A 4A5MA 5F1RA 1P4XA 3K0LA 4ZYHA 2DI3A 3IHUA 1Z7UA 3R60A 1KA8A 5FLXK 5AONA 4BHCA 1QPMA 4KT5C 1IF1A 4L9NA 1RUNA 4ZYDA 4DNCA 5L3CA 2MH9A 3CUOA 4BAYA 1EH8A 1OKRA 4HBLA 2HTJA 2XKOA 1LQ1A 1S3JA 5LLQA 2FQ3A 1KYWA 5IT9Z 1G4DA 1FY7A 1IN4A 5HLIA 3I53A 4EVIA 3IC7A 4L9JA 3V7SA 1KU3A 3QRFF 3ZMSA 3GZ6A 2GXBA 1WRJA 2L4MA 1QNTA 3L7WA 2XVCA 2WC2A 4XBFA 5D5UB 1K6OA 3WE2A 3LA7A 4L9VA 4IPAA 1D8JA 1R00A 1V3FA 2HKOA 4KUMA 3B02A 3EDPA 1Z1DA 3JSPA 3JW4A 2L02A 3SHFA 4BHPA 4A0ZA 2Z5UA 1J59A 2B0LA 4HAMA 1PUEE 3GO5A 2EA2A 1O7LA 5D5WB 1O57A 2JT1A 4WXHA 5DCMB 2F5DA 2GA2A 4CDGA 3SFZA 4OINF 2E1NA 2W57A 1YFHA 1MDMB 3D5LA 2DU9A 1XGNA 5E17F 3MZHA 2QENA 2A68F 4EM1A 2R7DA 2HQRA 2LKPA 4FT8A 3RKXA 3DQVC 1ZN2A 1O3RA 3M1EA 2QZ8A 3K1MA 1H0MA 5JVTA 4RGXA 5KK1A 3F8MA 2G7UA 3LFKA 1F9NA 2D45A 2W85A 4S05A 4MEXF 2BE5F 2OZ6A 1WI9A 2EV0A 4YFNF 1HW2A 3NQOA 2BV6A 3RYRA 2FMLA 1S29A 1ZARA 3MAJA 5ERIA 4LB6B 1R1VA 4Y17A 1TNTA 4IJAA 2CG4A 2F2EA 2LSOA 2KJCA 2UXNA 3IRRA 1LJ9A 1P92A 3GLXA 3IKVA 5ICGA 4M72A 1STZA 2IA0A 4L5JA 1FWZA 2PEXA 3V7CA 1ZRFA 3ZPLA 2DTRA 1OYYA 2EFQA 1D3YA 3F8FA 3GZ5A 4LB5A 1QZYA 1IW7F 4CO8A 1J2XA 2KIUA 4FHTA 3BZ6A 2W84A 3H3UA 1YW8A 3GFLA 2ESNA 1IN7A 3QP5A 3TDUC 4KYWA 1P6RA 4OOIA 4HF0A 1UCRA 2FSWA 5E1ZB 4UVAA 2G7HA 1ONVA 1JE8A 2HS5A 2BGCA 1R22A 2O3FA 3B73A 2STTA 3KZZA 2PI0A 2XGXA 5FB2A 1FT9A 1H9TA 3E6BA 5DYMA 1FYMA 3W6JB 3U9GA 3J80Z 1BBYA 4EJTA 4LLGF 4P55A 3ZQ7A 4WK8F 1WWXA 3N97A 1CGPA 1TNSA 1FPQA 3FZVA 1P4WA 4RGRA 1O3SA 3N4MA 2ZCWA 1UHMA 4HX8A 2Z9OA 1BIAA 1UFMA 2E7WA 4EQQA 6PAXA 3LAPA 4EGZA 3GFIA 4UUVA 3ZMZA 2P6SA 1TBXA 5JR3A 1FBSA 3IWFA 3MEXA 3HYIA 4RB1A 2XASA 4U88A 1NHAA 3R4KA 4Q47A 4UV9A 1WQ2A 2P6TA 5DD8A 5D8KB 2EFPA 4AWXB 1O7FA 3FXRA 4KIBA 5BQTA 4IHSA 3RKYA 1F4KA 2M30A 3S2WA 1PP8F 1MJ9A 2XRNA 4EGYA 2FF4A 3F3XA 1YS7A 3IL2A 2G9WA 4F7ZA 3E6CC 4LMYA 5CVJA 5H6QA 1K7AA 1IAWA 3ZMUA 2V1DA 3F22A 3T0YA 5LHHA 3BPXA 2CW0F 2X4HA 2Y48A 1C0WA 1YS6A 3R0AA 4JBAA 2QYOA 3HHGA 5ILSA 1XSXA 3ELKA 4EMSA 3J80K 3VFZA 2OU2A 2XV4S 2C6YA 4OIPF 1IZ1A 1KYZA 3WTSC 3ECHA 1H9GA 2CFXA 4GXOA 4QLCU 4AIKA 1XGSA 1B9MA 2NRAC 3RPUA 3RJPA 4L0ZB 5DCMA 2LF7A 4P96A 5CVUA 2QQAA 2M1BA 1DP7P 3WGHA 3KP7A 3DFGA 5CVVA 1YYVA 2O61A 3V4GA 2P5VA 3CTAA 2MC3A 2ZXJA 2P8TA 3GYHX 3IRQA 3HTUA 3F6OA 1LEAA 3WGGA 4XLPF 4B8XA 3TQNA 1YIOA 4HLYA 4P5OA 2QUFA 2GWRA 4RAZA 3BJAA 3EYIA 4LFUA 3WE3A 2YSRA 2A69F 3HRUA 4EJOA 5JFRA 2DPUA 2QBYA 1OPCA 2CSOA 1SD6A 1BI3A 3ISPA 5LEJA 2QWWA 3KFWX 4ENNA 4U0WA 1ON2A 1MZBA 2PMUA 3RTRA 3L9FA 4I98B 3V8JA 1BC7C 2E1CA 3HOSA 3F8BA 1S8NA 3C7JA 3WTXC 5K5RA 2XUBA 4KICA 1RZ4A 2FU4A 2P5LC 4GCVA 4P9UA 2EFOA 2K7LA 2CYYA 4GYIA 2LF8A 5J8CA 3M8FA 2HZTA 2E7XA 2VBXA 1JHFA 2A6HF 5HLGA 1ZRCA 3K69A 3PQKA 1IXCA 4HQMA 2AS5F 1ZLKA 2FNAA 4JK1X 2O6GE 3FM5A 2RGVA 3GX4X 1G3YA 2K4JA 2Q2EA 1E17A 1SMYF 1T98A 4FX4A 1FSEA 5L3DA 1YG2A 5H20A 4CZZA 4A5NA 2ZBKA 2V1UA 4BYYA 1KGSA 4MEYF 4I2OA 2MD5A 2OQGA 1CF7A 1YW7A 2YX4A 4M73A 2BYVE 3NEUA 3DKWA 3K1PA 1R7JA 2L3DA 1ZREA 3CLOA 5KVRA 2YX7A 3DF8A 1R1UA 4RB3C 4WWCA 4ENJA 2P4WA 3KE2A 1B6AA 2FBIA 1J5YA 3GFJA 3MQ0A 1IN6A 1I1SA 4ZYEA 2FEZA 3RDIA 2IVMA 4RB2C 4ENKA 4K2EA 3E5XA 3ZP5A 2EV6A 1Z91A 2FNPA 2OBPA 1RI7A 2RKHA 2R3SA 1HQCA 1FSHA 1U5TC 1XN7A 1KQ9A 1T39A 1BI1A 3HSFA 2CGPA 4UVCA 3CUQA 4MTDA 3U1DA 3TGNA 3HOTA 1ZG3A 2KKOA 4I7HA 2Z3YA 1LVAA 2WWYA 2RN7A 3U2RA 2PQ8A 2L54A 2IA2A 2GZWA 4XLNF 4EJUA 2EWNA 1T0FA 4IRIA 1DPUA 2PBIA 2W24A 2NNNA 4Y15A 1P2FA 3E5UA 3CJNA 3DXJF 5LGTA 3BY6A 3I0TA 3OV8A 1LB2A 2DAOA 1XDUA 4R79A 2O0YA 2IPQX 3VOEA 1XGMA 3WTYC 3HRSA 1YQAA 5FFXA 2D2WA 3KZYA 2F5EA 4HX4A 4M9XA 3E3VA 1FBQA 3QU6A 1QZZA 1MD0A 2ZNYA 1J75A 5JI6A 1UHWA 5CVIA 2L4AA 1SD7A 1MGTA 4KA4A 2HQNA 4KIFA 1BI0A 2HTSA 2XHKA 3GWZA 2EFWA 3VB2A 2R7FA 2Q0OA 1SFEA 3M9AA 4UXNA 3RKWA 1U3EM 4L5IA 1GXPA 3RIRA 5LRSA 3F72A 3ULQB 2QBYB 2H09A 2VONA 4OMZA 5IT9K 4IXAA 3TO9A 2IW5A 4P9FA 1RUOA 4ETSA 1FLIA 4G9YA 4RGUA 4EV0A 4GYGA 4CHUA 5BMZA 1O3TA 2FA5A 2HGCA 3GVAA 1Y0UA 1D5VA 1K78A 3GUDA 4O3MA 4M71A 1IRGA 3SZPA 5HOOA 4OIOF 1W5SA 2P7CB 4HV5A 2PFBA 2IT0A 5HS8A 5D6EA 3GF2A 4L18B 5FD5A 4UHTA 2CQKA 4Q5SF 2IA1A 2DT5A 2Z99A 1AOYA 4RAYA 4KMUX 2F5FA 4AIJA 3MWMA 2A07F 3EETA 4Q4ZF 3LWFA 1REPC 2HOEA 2STWA 4I0BA 4A6EA 4WF2A 1DPRA 1OYIA 1CF7B 4WX9A 1BM9A 5L3BA 2VC1A 4A0YA 5K5OA 4XSXF 2IJLA 2V79A 2UXXA 3FXUA 4IRHA 3BOQA 4H0EA 3RYPA 4MQVA 4U7BA 1YTYA 4ON0A 3TOBA 3K2ZA 3FMSA 2ISZA 3HTSB 3PQJA 1USTA 5E1WA 2A61A 1FP2A 2PMHA 4M6YA 1XB4A 1T38A 2A6EF 5CVRA 4UNOA 3CUQB 3HUGA 2O8XA 1QBJA 2TDXA 1R5HA 3ML6A 3E97A 2ZNZA 1W7PA 1HXDA 3O6BB 5E1XA 4LGWA 1USSA 2H27A 2VT2A 5A2QZ 4BHBA 3GFMA 2QM3A 3HHHA 2NNYA 4BXUA 1SD4A 1XSVA 4HF1A 5ICFA 4YFXF 2BEOA 1HBXG 3IWZA 5TRDA 1ZHFA 2XAGA 5HDNA 2Z33A 2P5KA 2JRTA 4BH9A 1GXQA 4MGRA 3TO7A 3I71A 3J81Z 5FD6A 1LDDA 3O2PE 1W4MA 2M5WA 2VC0A 1R23A 2J5PA 2LDUA 2FE3A 3LQQA 4E70A 4CGZA 4YIIA 3L09A 1DDNA 4L9TA 5DD4A 1GHCA 1IXRC 2JSCA 2RC4A 2KRFA 3E6DA 1I5ZA 4YFKF 2K86A 1U5TA 4U0YA 3WTUC 4HA8A 2WTEA 1IXSB 1XDSA 2F5CA 5LHIA 2VODA 2PLYA 4XRFA 4EJWA 3QU3A 5FO5A 1TQPA 5BPIA 2KIMA 3G73A 4MQ9F 4G7ZF 1FX7A 3V8LA 3SZTA 3L2CA 5H6RA 1G3WA 3KP5A 4LLNA 1JGSA 3BROA 4PDKA 3QOPA 4Y13A 1TLHB 2ESHA 1HW5A 4HLXA 1J9IA 1U6GA 1PDNC 5DUKA 3K1NA 1AWCA 1OYWA 3KCCA 4ASNA 1Z6RA 5D5XB 1B4AA 1YW9A 1IRFA 1BJAA 2MLKA 3G3ZA 4IRGA 1J7KA 3IKTA 4U7DA 4AVPA 2P7VB 2PG4A 2FOKA 1K78B 3T8TA 2DK5A 3F8CA 1WSUA 3HIFA 3C3WA 3F21A 4L0YB 1S7OA 1YO5C 2OAZA 2UWMA 2GA1A 1SD5A 2DQLA 1KU9A 4PCQA 3KP2A 5BOXA 4N9IA 4KN4X 4LG0A 1J0RA 1ZRDA 2QQ9A 2HWVA 1BIBA 4RB0A 3I4PA 3BP8A 4LLLA 5DUIA 2VE9A 1S6LA 2EJRA 3J7AO 5LRRA 5EEHA 4MTEA 2ZMEB 4WCGA 2D1VA 1B9NA 2XAHA 2IP2A 5K5QA 2GAUA 1FYKA 4R1HA 3KEQA 2M8EA 1KQ8A 5D8LB 3FM3A 1TW3A 4HYEA 5HDGA 4AIHA 2FBHA 4ZH4F 4Z2YA 3HSRA 3L00A 4HF2A 4GGGA 2M45A 3C18A 1A04A 1KU7A 1ULYA 1XCVA 1FBUA 2HYGD 5AIPA 3I5UA 4HDVA 5L3EA 1Q1HA 1XSDA 4M9ZA 3QPTA 2D1HA 2H94A 3MCZA 3P7NA 2EA4A 2WV0A 1T2KA 2NAZA 2RQPA 1LDKB 1K79A 3H92A 5E8IA 1YLFA 2DQRA 2QVOA 4GO1A 1FP1D 3K9TA 2Q8KA 1W7PB 4ZZLA 5F6FA 2VN2A 5L3GA 2FMYA 1ZG1A 2YR2A 3ZMDA 4G94A 2JZYA 4HQEA 3AAFA 2OZUA 2ZO4A 1ZYRF 2MA3A 1HKTA 1HKSA 2JTVA 5ICCA 5HVQC 4BQAA 3PFIA 4I09A 3RI4A 5K1YA 3I58A 1R36A 2RNJA 3F6VA 1D8KA 3ROUA 3RPQA 1P4AA 2UZKA 3COAC 5J6XA 1B1BA 4HZFA 4LK1F 5DDGA 2K02A 1XGOA 3EYYA 1ZAOA 3OOPA 2FXAA 2V9VA 1U5TB 4M6XA 3JAMZ 4A12A 3I59A 3T5XA 2VBYA 2PN6A 2EB7A 2DW4A 4HW0A 3F23A 3T8RA 4KNYA 3WTVC 1MJAA 1LDJA 2HR3A 2MBFA 2VT3A 5LHGA 1X3UA 3H3ZA 4S04A 4ENMA
chains in the Genus database with same CATH superfamily
2P0WA 4NC6A 4NB5A 2Y9YA 3CZ6A 2HDWA 3A02A 2ZJRF 2P81A 1R4MB 1EF4A 3IUOA 2V6CA 5BPDA 1DP3A 1F43A 2WB1N 5GAHJ 1RIOH 1OMIA 2R4GA 2VIXA 3GW2A 1HF0A 2K4BA 4BE2A 2R7RA 2LVSA 2RVCA 3ZGKA 4E7LA 4V19K 5EYRA 4BNCA 4CXFA 4RS8A 3V8KA 4QPOA 1TW2A 2IRFG 2KMUA 3QAHA 2BHYA 4RA2A 2LP0A 4N4NB 3EQLF 4RAGA 3GTMJ 1O3QA 1OR7A 2QLZA 2XB0X 4UVBA 2F48A 3R0JA 1F1ZA 5E79C 4ZZDA 1QA6A 1KU2A 5J3LA 2EK5A 2GQQA 2YPRA 4C2UA 1L0OC 2DFHA 2RV8A 4XM3A 2E36A 4G6QA 2VQHA 3I54A 1D0ZA 2EV5A 3OS1A 4M74A 2KIFA 5CJ9A 1IN5A 1V5EA 1Z77A 5EGOB 4A69C 2ZJ2A 4XOPA 3OR1C 2MH2A 2Y31A 5F0HA 2R7XA 3KETA 2DMNA 4O6JA 4XIDA 2E2IJ 1VI0A 5C3EJ 1I1GA 5M5WJ 5DEQA 2D5VA 1UG0A 2MSYA 4N9HA 1NH3A 1JHHA 2KRCA 3HRMA 3ZN1A 2OUMA 1Z9CA 5K7FA 2CQ7A 4HNVA 1BI2A 2HNHA 2JPCA 2VQLA 1PP7U 2Y75A 1U78A 4XRSA 4ZYGA 2WV1A 2CWEA 3JAMK 2UUZA 5KHDA 1R5GA 4BU2A 2ZSHB 3QP6A 1FTTA 4IHWA 1ZG5A 2LNBA 5EEGA 5BS6A 2O03A 4XN3A 4LG0B 3FISA 5F08A 2OQRA 4WXDA 1EV7A 5EJCA 4L5EA 2VKHA 1D0XA 4I01A 3BZCA 2DJNA 4PJ0C 1MNEA 3BR3A 1S7AA 2YS9A 4B09A 2E5NA 1DUXC 4XKVA 1OLTA 4OU0A 4DGWB 3OYBA 1U2WA 2DFEA 1X2NA 4G6TB 3QPHA 1V4RA 3QPSA 3AL0B 1ZGJA 1YX3A 4Q48A 4UUTA 1JT0A 3DP7A 2X0LA 2BXZA 2VBZA 3TOAA 3E5QA 2A6TA 2JA7J 3OY9A 3DU5A 1RRJA 5H2FC 1ZH5A 4CYDA 5LBQA 3B6AA 1BN5A 3K4BA 2WAFA 3FX3A 4KIGA 2BZTA 2ZMEA 4BEHA 4ZJZA 4D0PA 2JA6J 3ZMTA 3LSKA 5LGUA 3ERED 3VEPA 4N4OB 3R61A 3SXYA 2NVTJ 4R8HA 4QWQA 3WGIA 5DV5A 3REOA 5FGMA 2IGMA 2X6WA 2M7AA 4JQFA 5IT3A 1YJWI 4KMFA 3HPGA 2HPIA 5GPCA 3G1OA 1Z6TA 2MLGA 3LA2A 1JUMA 1WKMA 2DODA 5F64A 2GXGA 1KQ0A 5HS7A 2CRGA 3BJOA 3R6SA 1RNLA 3H9JA 3OYGA 1GV2A 3C1DA 2O5RA 1MBHA 5AIQA 1G3TA 1D1BA 2X1CA 5FKOA 3CUQC 2A05A 4DW6A 5ED4A 1GVJA 1VQPI 3WG9A 2KDZA 4M9SA 3ASNH 3Q9VA 2DFIA 1XD7A 2GOMA 1YX5A 4M3EA 1L3LA 5FRNA 5HDKA 3MFKA 4EATA 1K6YA 1FZPB 1WFXA 2AXLA 3KEOA 4X6AJ 1CQTA 2NS0A 1JKRC 4CICA 5D5VB 2A5YB 2M3AA 2A3SA 2PMZN 3BTIA 1DQUA 4ANJA 4ZTJA 1VFCA 2NVYJ 5F0CA 4X0GA 3V7RA 3ZN0A 4HG2A 1GT0C 2K3PA 1RKWA 2HFHA 5EG0B 2QKMB 1JTXA 4ESBA 3OL3A 5F04A 2JQ7A 1E2XA 2GIVA 4FQGA 4ESFA 3TDZC 2EZHA 2VBWA 1EH6A 5GP9A 4CYCB 4RGSA 2DA1A 4B43A 2OTLI 1G3SA 1R58A 5D4RA 3KP6A 4JP0A 4XICA 5JVGF 1WGXA 3BR0A 1W7PD 1I6XA 4XLFA 3JRFA 5HLHA 1ZLJA 3PIPF 4QIWN 1ZKGA 2LG4A 3WTTC 4I02A 4KFCA 2PJPA 2HXOA 4IVNA 4QPQA 2W1OA 1X1CA 1JJ8C 2CH0A 4BBSJ 3JTGA 4YIFA 2CV1A 3ZMVA 2M7BA 4O5VA 4BE1A 1TTYA 3O3KA 3Q9SA 4V2GA 4IOCF 3DPLC 1BC8C 2R7QA 3W2WA 2HDCA 3KP4A 4PUSA 3JSOA 3FBIB 1QO0D 2JPBA 2GBYA 4II2A 4HOBA 4LOCA 1MNDA 3CDHA 3TKYA 4NNJA 3OYIA 2KFDA 5E18F 1WJCA 3GXOA 5J8FA 1R71A 1U0JA 3KIOA 3P9KA 3CCQI 4BY1J 3H3VK 2QCOA 2QQBA 2K27A 3F8NA 1YRNA 4Y3OA 1NK3P 3S1NJ 5ILVA 3O8HA 2M0CA 2ELHA 5F0FA 4AM3A 4LD5A 2JVGA 3PFYA 3MZ8A 4A3KJ 4M3GA 4AYBN 4U0VA 3HGGA 4BUPA 3FWEA 3I59B 3BPVA 4FETA 1LEBA 4PJNA 3FXQA 5LEKA 1JKOC 3P9CA 3PNVA 3WODF 1VQKI 1SFXA 2ME6A 1WI3A 2EILH 5E20A 1YOVB 4PZJA 4DZPA 4A0XA 3H0GJ 1DGRM 2PX9A 3ABKH 2V4JC 1FNNA 2K9MA 2XC7A 4ESJA 1T6SA 1XMAA 3NRVA 4CH7A 2KZVA 1FOKA 4UV8A 1X4PA 1MH3A 1A6QA 2DTZA 3KX2A 3A2KA 4G7OF 2VOPA 4PSWA 3FHZA 3H9GA 3GCMA 1MMSA 1MMGA 2RDPA 1HLVA 5TJJA 4A2UA 3GEZA 4C30A 3CO6C 2XAJA 5FFZA 1WJBA 5HS9A 5CYVA 4XNFA 1XCBA 3DCFA 5CKTA 2XIGA 3LSTA 1SVLA 4PGGA 5DCFA 4OMYA 3HSEA 3S1QJ 2ZXHA 3KLNA 3UR3C 3ABUA 4EJVA 3EUHA 1T56A 4G8XA 4F55A 1LPQA 4PFPA 2V1XA 2XKPA 1B59A 3JTHA 2GOXB 2VXZA 1LVKA 1UELB 4A6DA 2R7VA 3HRTA 4NHJA 2ZKZA 3SQNA 1MDMA 1IN8A 3RSNA 1ETVA 4XSZF 1YE9A 3WU1B 2J5OA 3CCSI 2DPDA 3FMRA 2H6CA 2VKVA 5A2QK 2B7EA 2BVMA 1HKQA 4NQWA 1R1TA 1OFCX 2HYFA 4OIRF 4G6DA 4LK0F 5M3MJ 5ILUA 4WXCA 1ZTRA 4KITB 3ZQIA 1QHGA 1F5TA 1ON1A 1TZLA 3FK6A 1MBEA 3KLOA 4FX0A 1FTZA 3HG9A 3BG9A 3WTZA 2HZDA 3BJ6A 4KN7X 4EM2A 2DLLA 3FMQA 2RAEA 4EM0B 5LGNA 3TMOA 3VYUB 5LD2C 2MFZA 3J81K 4IF4A 1PVEA 4DQ2A 3LAJA 3SZGA 2NYXA 3LQRA 4DBQA 3IAM2 4F92B 4KT6A 1FC3A 3OYJA 1Z67A 2ETHA 1ZGAA 3KYCB 3LA3A 3DEUA 4LJZF 1LNWA 2IEKA 5JHUA 1SAXA 1FYLA 1IDZA 1XG1A 4IZZA 3FXKA 2XAQA 2R93J 2NS8A 2FBKA 2ZFWA 4BQNA 2CV2A 1X1BA 4YG2F 2DO7A 2M87A 4A3CJ 3ZRGA 4CZCA 4J01A 4Z6YA 2DBBA 2LKXA 1I27A 1XMKA 1Z05A 3T1BA 4I0AA 3GTLJ 5IOZA 2L9VA 3G1LA 3HJEA 1HDPA 3DPTA 4BL0B 2OD5A 5FRMA 4IHTA 3E6MA 3M3YJ 3BDDA 3ECOA 2ZSIB 4F3QA 3L1PA 1EH7A 4MHGA 2R7SA 5ICEA 1ETOA 2EPFA 1JXSA 1VZ0A 3J7YJ 3HBLA 3I64A 1HSJA 2DK8A 4ZDOA 5JLXA 5IPAA 1S7EA 3K4LA 1VTNC 2ADUA 3P9IA 3U1KA 2GIZA 5D4SA 3Q3SA 1G6NA 3W6KB 2NOGA 4BJ5C 1MJBA 4HV6A 4BS9A 2GM4A 1Z3XA 3DLAA 1YIJI 4BEHB 3K10A 4MNUA 2ACJA 1SMTA 1X1PA 5FLXZ 4PJJA 5EZGA 2KQRA 2FRHA 1SEUA 2VE8A 2JRMA 3BG6A 3MKWB 1ZR2A 2HEOA 2XF7A 1TQMA 4N0BA 1K61A 1ETKA 1SFKA 2R7OA 5D6FA 3M8EA 1W5TA 1QGPA 1VQMI 2BY2A 3EUKL 5L3FA 2XROA 3M1CA 3Q5FA 3WTWC 3M7GA 1TQIA 2EIMH 2EFNA 2HKXA 3VODA 2W25A 4BJTA 5KNLA 3CESA 4G7HF 2OJED 4HDUA 2PJRA 4XL9A 2BBYA 3WU0A 4PGHA 1W36D 1EKEA 2VOOA 3JRDA 3GTJJ 2ISYA 4CCNA 1AU7A 5E8GA 3H5RA 2E2JJ 1IUYA 2ZXWH 1LFPA 3HZJA 3MZYA 3CP2A 4TV7A 5IP6A 1ZR4A 2X6XA 1TWGJ 3JRHA 1POGA 4XKWA 3KP3A 3BWGA 3CO7C 2L01A 1OJLA 2OA4A 1QQIA 1R49A 4AD9A 3S32A 2VXDA 2XAFA 1HSTA 2HPMA 1ODDA 2EBIA 3DV8A 4JX5A 4HX7A 4M3DA 3ABTA 4OIQF 2XF5A 5IYBJ 2IS1A 4FE7A 2H6BA 3FXLA 1BOAA 4JX6A 4XLHA 3OYKA 1LE8A 5FKMA 3TO6A 1MKMA 3KZIC 4KDPA 1UB9A 1QVTA 2L7ZA 2E2HJ 4E7JA 3FKIJ 4GFBA 1XC5A 2COMA 2VJ4A 3FF5A 2YU3A 4J19A 2CO5A 2WA0A 3D0SA 4HPQA 1VQ7I 5FKKA 2PMZA 5CLSA 1SFUA 1U8RA 3CD6I 2Y0MA 5C44J 2KJBA 1HW1A 4A5MA 5F1RA 1P4XA 4PJLA 3BLYA 1QPIA 2V26A 3CDLA 3K0LA 4ZYHA 3HKZN 2DI3A 3IHUA 4I76A 1RC9A 1WJAA 1Z7UA 3R60A 1HC8A 1KA8A 5FLXK 5AONA 4HSRA 4BHCA 1QPMA 4KT5C 1MIJA 1IF1A 4RLFA 4L9NA 5GTIC 2BY3A 1RUNA 1RPWA 4ZYDA 4DNCA 5L3CA 1FJLA 2MH9A 4ZTFA 1Q1VA 3CUOA 4BAYA 1EH8A 1OKRA 4HBLA 1YRNB 4ZDLA 2HTJA 2XKOA 5IY5H 1UAAA 5IYDJ 1A5JA 1LQ1A 2VQCA 1S3JA 5LLQA 3CP8A 2DMUA 4IHVA 2FQ3A 4BACA 1KYWA 5IT9Z 2HOSA 1G4DA 1FY7A 1IN4A 4IX7A 1D1AA 5HLIA 3I53A 4A3FJ 4EVIA 3IC7A 4L9JA 2K5CA 3AG3H 3V7SA 1KU3A 3QRFF 1JT6A 2WAQN 3GZNB 3ZMSA 3GZ6A 4RLQA 2GXBA 5KCMA 1WRJA 2L4MA 3PUBA 1QNTA 3L7WA 5BNGA 1G8XA 2XVCA 2WC2A 3EUAA 4XBFA 5B66C 5D5UB 1K6OA 3WE2A 3LA7A 4XRMA 4L9VA 4IPAA 1D8JA 1R00A 1V3FA 2E34A 2HKOA 2HQAA 2MYSA 4KUMA 3AKZA 3B02A 3EDPA 1Z1DA 3JSPA 3J7AY 3JW4A 1UZCA 3VSLA 2L02A 5IOYA 3SHFA 3H1CA 4D5CA 4BHPA 4A0ZA 2R7TA 4FCYA 4ITVA 1VQ6I 2Z5UA 1J59A 2B0LA 3BTLA 2GLOA 4HAMA 1PUEE 2XPUA 3GO5A 2EA2A 1O7LA 4F52A 3BTCA 5D5WB 3VPRA 1O57A 1BR4A 4NC8A 2JT1A 4NBQA 1KONA 2COBA 3QODA 5E3LA 3VDXA 4WXHA 5DCMB 1PYVA 5JHFA 2F5DA 2GA2A 5J4VA 4CDGA 3SFZA 1JJ6C 4IHYA 4OINF 2E1NA 2W57A 1TL8A 1YFHA 4DIQA 3LSRA 1MDMB 3D5LA 2DU9A 1XGNA 5E17F 2YUSA 4OAZA 2OCCH 3MZHA 2IGNA 4NQWB 1NTCA 2IS4A 2V9PA 2DMQA 3L2UA 2QENA 2M2EA 5EEAA 2A68F 2CMPA 4EM1A 2HDDA 2R7DA 4IHXA 1XS9A 2NVQJ 5FLMJ 3VWBA 3NAUA 2HQRA 3CC7I 3M8JA 1IC8A 1BR1A 2RREA 1ERDA 2R5ZB 2LKPA 4FT8A 3RKXA 3DQVC 1ZN2A 1O3RA 3M1EA 2QZ8A 3K1MA 4J00A 1VQ8I 1H0MA 5JVTA 4HNUA 4CCKA 2CUEA 2DFFA 2Z1DA 4RGXA 5KK1A 3G71I 1RKTA 3F8MA 2G7UA 2EZLA 4XKCA 3LFKA 1F9NA 2D45A 2W85A 4S05A 4MEXF 2BE5F 3ERMA 2OZ6A 2JK3A 1WI9A 2DYRH 2EV0A 3K4MA 4YFNF 1HW2A 3LSIA 3HGYA 3NQOA 2BV6A 3RYRA 3PJRA 2FMLA 3P5JA 2Z16A 5M3FJ 1S29A 3NWTA 1ZARA 3MAJA 5ERIA 2IS6A 3SEZA 4LB6B 2LYCA 1R1VA 1T95A 4Y17A 1SFOJ 1TNTA 2NVUB 4IJAA 2CUJA 3BR1A 2CG4A 1WJEA 3ZQFA 3ONQA 3S2HJ 2QGUA 2F2EA 2LSOA 2KJCA 3SJMA 2UXNA 5HLTA 3IRRA 1LJ9A 1P92A 2Y0SN 2VASA 3JRIA 3GLXA 3E0JB 3IKVA 1T33A 2Y2ZA 3RQIA 5ICGA 4M72A 1VQ4I 4DOZA 2AO9A 3FIWA 1STZA 2IA0A 2MC4A 3PNYA 4LIUA 1W36C 5J1UA 4L5JA 1FWZA 2PEXA 2IAIA 1OQYA 3FKJA 4D5FA 3V7CA 1X1AA 1ZRFA 3ZPLA 4KISA 3AFHA 2DTRA 1YHQI 1OYYA 2LR8A 3AG2H 2EFQA 1FOXA 1D3YA 3F8FA 3GZ5A 4LB5A 3IV5A 5F27A 1QZYA 3H5AA 1IW7F 4CO8A 1J2XA 2KIUA 2OF7A 2K40A 4FHTA 2HXIA 4E7SA 3BZ6A 2W84A 3GMEA 3ZQHA 4XLAA 1W1WE 3H3UA 1W0UA 1YW8A 1ORKA 3GFLA 4YRVA 2ESNA 1IN7A 2OC6A 3QP5A 4CSWA 3TDUC 2PJRB 2H1LA 5GPAA 2HOAA 2LLKA 4KYWA 2R7ZJ 1P6RA 2BY1A 4OOIA 3K4JA 3FDYA 4HF0A 1UCRA 1J09A 5IYCJ 2FSWA 5EDNA 5E1ZB 4UVAA 2G7HA 1ONVA 4FASD 1JE8A 2HS5A 2DJIA 2BGCA 3AG4H 1XMXA 1AKHB 2A5WA 3OYHA 1R22A 2CQNA 2O3FA 3B73A 4FISA 2STTA 2VPLA 1GDTA 2EZIA 4DYRA 1Y8QB 3KZZA 2PI0A 2XGXA 3ABLH 4XLEA 2DCEA 5FB2A 5IP7J 3JRAA 1MSFC 3OSGA 1FT9A 3VSKA 1X2MA 3OS2A 1H9TA 3E6BA 5DYMA 3V42A 1FYMA 3BR5A 3W6JB 3HB9A 1T0FC 2BW3A 2FD5A 3U9GA 3J80Z 3JCUC 1BBYA 1B8IA 4A3DJ 4EJTA 4LLGF 4P55A 3ZQ7A 4WK8F 1MBFA 1WWXA 4UB6C 3N97A 1LE8B 5E3OA 1CGPA 1TNSA 3JRBA 2QSHX 3QOEA 1FPQA 2O8KA 3FZVA 1P4WA 3BT9A 4RGRA 2CQQA 4C3IJ 3OYEA 1O3SA 2F6CA 1I39A 3N4MA 2ZCWA 1UHMA 1LFBA 2LREA 4HX8A 2Z9OA 2DMTA 4PK4A 3HOUJ 1BIAA 1UFMA 2E7WA 4EQQA 4DYCA 6PAXA 3A4CA 3LAPA 1RR8C 2JJ7A 3DEWA 4EGZA 4ZYAA 3GFIA 2N8GA 4IO9F 2V1NA 4UUVA 1QU3A 3ZMZA 1BW6A 2P6SA 3LSGA 3W2VA 4AU7A 1TBXA 5JR3A 1FBSA 3HOWJ 3IWFA 3H5NA 3TP0A 1OCZH 3MEXA 3HYIA 4RB1A 2XASA 3VYTB 1IJWC 4U88A 1NHAA 3R4KA 4Q47A 2AQEA 4UV9A 1WQ2A 1RETA 2P6TA 5DD8A 5D8KB 1JUPA 2EFPA 4AWXB 1O7FA 3FXRA 4KIBA 5BQTA 4IHSA 3RKYA 2VUMJ 4A3JJ 1F4KA 2M30A 4M3FA 3ASOH 3S2WA 1TC3C 1BJZA 1PP8F 1MJ9A 2XRNA 5DM7F 4EGYA 2FF4A 3A0HC 3F3XA 1YS7A 3WG7H 3IL2A 2H8RA 1Y1WJ 4G12A 4DJAA 2G9WA 4F7ZA 4A3EJ 3E6CC 4LMYA 5CVJA 2QF7A 5H6QA 1K7AA 1IAWA 3ZMUA 2H8WA 2V1DA 2E1MC 3F22A 3T0YA 5LHHA 3BPXA 3OS0A 3K70D 3I4MJ 2CW0F 4CCJA 2X4HA 1K4TA 2Y48A 3HL2A 1YS6A 3R0AA 1C0WA 3S2DJ 4JBAA 2QYOA 2JA8J 3HHGA 1K4SA 3ZQGA 4MIMA 2DA7A 2KDOA 5ILSA 4IOAF 1XSXA 3ELKA 1B72A 1OR7C 4EMSA 1N75A 1WJDA 3J80K 4MFEA 2JMWA 3VFZA 2OU2A 5DTDA 2XV4S 2WAQA 3BR2A 2C6YA 4OIPF 1IZ1A 1KYZA 2DT6A 2R5YA 2KPMA 3WTSC 2K9NA 5JLWA 4B48A 2AXTC 3ECHA 2V9KA 3OYLA 2CFOA 2K9LA 1H9GA 3IH2A 2CFXA 4GXOA 4QLCU 1TWFJ 1FIPA 2LKSA 1XGSA 4ZDPA 4AIKA 1B9MA 2NRAC 3RPUA 1A35A 3RJPA 1JI8A 2XPVA 4L0ZB 5DCMA 1U8BA 2H1KA 2LF7A 4P96A 5CVUA 2QQAA 3N05A 3CCVI 4OWRB 2M1BA 1GV5A 2CQXA 3I9V2 1DP7P 3WGHA 3KP7A 3DFGA 2OPTA 3C2HA 3QPLA 5CVVA 3RZDJ 3LOCA 1MMAA 1YYVA 2O61A 5F1JA 3V4GA 2P5VA 3CTAA 1P7JA 2MC3A 2ZXJA 2P8TA 3GYHX 3IRQA 3HTUA 3F6OA 1LEAA 3WGGA 4XLPF 2WB1A 3JRCA 4B8XA 1UG2A 3TQNA 1YIOA 4HLYA 4P5OA 3DWLE 2R5ZA 2QUFA 2W00A 5HNHA 2GWRA 4RAZA 3RKQA 2Y9ZA 3BJAA 3VYRB 3EYIA 1RR7A 4LFUA 3WE3A 4A3GJ 2YSRA 2A69F 1Y0NA 3HRUA 4DYQA 2MG4A 2XSJC 3OIQA 1S72I 2VLAA 4EJOA 5JFRA 2DPUA 3C2GA 4A3BJ 2OCEA 4D7NA 2QBYA 3S8PA 1JGGA 1OPCA 4XR6A 2CSOA 3HM5A 1SD6A 3GTGJ 4BDZA 1BI3A 3ISPA 2ZMEC 5LEJA 2QWWA 4BXFA 1TT5B 3CCUI 3KFWX 1ZGWA 4ENNA 4U0WA 1ON2A 1WH7A 1NG6A 1MZBA 2PMUA 3RTRA 1V55H 2WAEA 3CMMA 3OIPA 3L9FA 4I98B 3V8JA 1XTAA 1FMWA 1BC7C 2E1CA 3HOSA 3F8BA 4OAYA 1FIAA 1BW5A 2ECBA 1S8NA 3C7JA 3WTXC 4CCLA 5K5RA 1ZQ3P 2LRDA 2XUBA 2DYSH 4KICA 1RZ4A 2FU4A 2JWTA 2P5LC 2X9DA 2JA2A 4GCVA 2CS3A 4AC0A 4P9UA 3KEYA 2XPWA 2EFOA 2ZB9A 2K7LA 4U87A 3KYLA 3GTPJ 2CYYA 4W1UA 1ETWA 4GYIA 2LF8A 5J8CA 4RDUA 3M8FA 2HZTA 2E7XA 3DTIA 3G6EI 2VBXA 1JHFA 2A6HF 5HLGA 3LSPA 1ZRCA 3MMYB 4FE4A 2DN0A 2W7NA 4GRIA 3I4NJ 3K69A 1LFUP 3PQKA 1JKPC 1IXCA 1H89C 1MW7A 2UV1A 4HQMA 1E3HA 2KIQA 5IP9J 2AS5F 1E0EA 2XSDC 1Y56A 1ZLKA 2FNAA 4JK1X 2O6GE 3FM5A 2RGVA 2DDAA 5GAEJ 4MO7A 4LG3A 2DA4A 3LMMA 3GX4X 1G3YA 4NUBA 1VQ9I 2K4JA 2Q2EA 1E17A 1SMYF 3PNTA 1T98A 3QYBA 3HOYJ 3FK7A 4FX4A 1FSEA 1WVRA 3CCEI 2BOLA 4GDFA 5L3DA 4E4HA 1YG2A 5H20A 4CZZA 4RAFA 4A5NA 1UJ8A 2ZBKA 3KPHA 2F4IA 2V1UA 4BYYA 2VL8A 1KGSA 2EZKA 3DTKA 4MEYF 1AKHA 2LBFA 4I2OA 2MD5A 2OQGA 1IUFA 1CF7A 1YW7A 2ICWG 2YX4A 3SEQA 1FOYA 4M73A 2BW3B 2L9RA 2DA5A 2ZFUA 4XMYA 3SYTA 5LFAA 2KZGA 1MBKA 2BYVE 4E6KG 1B8IB 1SAUA 5KAFC 3NEUA 1U9OA 3DKWA 1R7JA 2L3DA 3CJRB 3K1PA 5B3SH 2FX0A 1ZREA 3A01A 1G2HA 3CLOA 5KVRA 2YX7A 3DF8A 2BVLA 1R1UA 1FEXA 4RB3C 4WWCA 4ENJA 2P4WA 3KE2A 1B6AA 2FBIA 2EIJH 5HODA 1J5YA 2I8DA 4W97A 3GFJA 1WHUA 3MQ0A 1A36A 1N77A 1IN6A 3BG3A 9ANTA 4AUXA 3ZQLA 1I1SA 4ZYEA 2FEZA 3RDIA 3DBHB 2IVMA 1T08B 2I5UA 2M9HA 2TCTA 4RB2C 4ENKA 4K2EA 2VJIA 2R7WA 3A1YA 3E5XA 1V5FA 3ZP5A 4BQQA 2HVSA 3CF2A 2EV6A 3K70C 1OCTC 1Z91A 4XKBA 2QQ8A 2FNPA 3IP4B 2MGQA 2OBPA 2L7FP 2K9QA 5CQEA 5GADJ 1YITI 3L2QA 2M4GA 1RI7A 2RKHA 2R3SA 1HCRA 1HQCA 2GXAA 1VNDA 3CQZJ 4JYKA 1EJ9A 1FSHA 1U5TC 1XN7A 1KQ9A 4D7MA 1BI1A 1T39A 3BZKA 3HSFA 2LTPA 2CGPA 4UVCA 1X1DA 3CUQA 4MTDA 3A0BC 3U1DA 4LITA 1Z3YA 3TGNA 3HOTA 1VF9A 1ZG3A 1YI2I 2KKOA 4I7HA 2Z3YA 1WPKA 1LVAA 2WWYA 2HOTA 4Y4RA 2RN7A 3U2RA 5C4JJ 3JRGA 1OCPA 2PQ8A 5EZHA 2DA2A 2IA2A 2GZWA 2L54A 4XLNF 2EWNA 4EJUA 4YIRX 1T0FA 1AHDP 2O7OA 2ZXIA 3RQ4A 4IRIA 1DPUA 2DA3A 2PBIA 2LC2A 2W24A 2NNNA 4Y15A 1P2FA 3BQYA 1ZELA 3EUHC 3E5UA 3CJNA 3DXJF 2ID3A 3HXLA 5LGTA 3WU2C 3BY6A 3I0TA 2B9SA 2VJJA 1SVMA 3OV8A 1LB2A 2DAOA 1XDUA 4PFOA 1B72B 3QYEA 3SDGA 3H0DA 4R79A 3H36A 2O0YA 3E1SA 1BL0A 1Z7LA 3MVPA 2IPQX 4MLOA 3VOEA 2KISA 4IL6C 1XGMA 4E7KA 2JA5J 3WTYC 2E5ZA 3S1RJ 3HRSA 2R5YB 1YQAA 3FXJA 5FFXA 2D2WA 3KZYA 4AYBA 4V2FA 2F5EA 4ENMA 4CA0A 4HX4A 4M9XA 3D1NI 3E3VA 2W48A 1FBQA 2XGDA 3QU6A 4A3LJ 1QZZA 2V6EA 4QTRA 1MD0A 1EA3A 2ZNYA 1J75A 5JI6A 4BE0A 1UHWA 1ENHA 3CCMI 3CC4I 5CVIA 2LY2A 3S17J 4UUSB 2L4AA 1SD7A 1MGTA 4KA4A 2HQNA 3BCBA 4I99C 4BKXA 4C3JJ 2CW8A 1V5GA 2HYJA 3BG7A 4B3XA 2X51A 3L2WA 2FOWA 3CC2I 5M5XJ 3D5SC 1XPXA 4KIFA 4ABZA 1AA7A 1MH4A 1BI0A 2F5VA 1BOBA 2KRHA 3WHBA 2HTSA 2XHKA 3GTQJ 3Q0UA 3GWZA 3OYNA 2EFWA 2JVHA 5FJ8J 1TP4A 3VB2A 3HOVJ 2RQQA 1F36A 3K4CA 3J7ZI 3FBNB 2R7FA 2HVRA 2Q0OA 2X1EA 1SFEA 3M9AA 1GUUA 1TWHJ 4UXNA 3RKWA 4CCOA 4L5IA 1U3EM 1GXPA 1HOMA 2HQ5A 1R5ID 1RESA 3S3MA 4HEA2 3RIRA 4B47A 1ACIA 2DOEA 5LRSA 3F72A 5J4YA 2IXSA 5TISC 3ULQB 2QBYB 2IGKA 2H09A 3CLQA 2VONA 2E19A 3VYSB 4UB8C 4BXXJ 4OMZA 3GTOJ 5IT9K 3BR6A 1GLNA 2EIKH 2TRTA 3CCJI 3AL0C 4IXAA 3UNGC 3TO9A 2IW5A 4P9FA 1QVUA 1RUOA 4ETSA 4RM3A 3C2BA 1FLIA 5CPRB 3G2BA 4G9YA 2WADA 1BR2A 2QKLB 1OCOH 1Y1VJ 2FJ1A 4RGUA 4EV0A 5FROA 4UY8I 4GYGA 2KHMA 3OL4A 4CHUA 2B63J 3HOZJ 5BMZA 3ZQQA 1O3TA 3PO3J 2KL4A 3RCOA 1E3OC 3TBIA 2FA5A 2G0EA 3DU6A 1I3QJ 2MW8A 3W3CA 2HGCA 4AIDA 3GVAA 2O9LA 1M1EB 1Y0UA 3PSIA 1JUSA 3TW7A 1D5VA 3BTJA 1PUFA 1K78A 5E3NA 2W4SA 3GUDA 4XORA 3IH3A 4O3MA 4M71A 1WZ2A 3SFIA 4A3MJ 1IRGA 2BXYA 3SZPA 5HOOA 5DM6F 3JR9A 4OIOF 1W5SA 4A3IJ 3ZR8X 2P7CB 3GTKJ 1S9HA 4HV5A 3HPHA 3B6CA 4E7IA 2LY1A 2PFBA 2IT0A 4B4CA 5HS8A 1X58A 2LMDA 1IV8A 5D6EA 2BY0A 3GF2A 4L18B 5FD5A 1LUJB 2E1OA 4UHTA 3DEEA 2CQKA 4Q5SF 3ZCOA 1R4NB 2IA1A 2DT5A 2JUGA 2E35A 3TEDA 5FKNA 2Z99A 3DKXA 2Q2EB 3S14J 1AOYA 4RAYA 4KMUX 2F5FA 4AIJA 3MWMA 3PM1A 2NOJB 3FXMA 2A07F 2X85A 3EETA 4Q4ZF 4XK4A 3LWFA 2FQ4A 4RMNA 1REPC 2HOEA 2STWA 2M4KA 2X6OA 2Q1ZB 4I0BA 4A6EA 4CCMA 3S93A 4WF2A 1DPRA 2LBFB 3QQAA 3CCYA 1OYIA 1CF7B 4WX9A 1BM9A 2XB5A 2L5QA 5L3BA 3CMYA 3LSHA 2VC1A 2AQFA 4A0YA 5K5OA 4XSXF 2IJLA 2X6YA 1IV6A 3RZOJ 3BCAA 2V79A 2UXXA 3OIOA 3A01B 3FXUA 4IRHA 3BOQA 4H0EA 3OSFA 2ELKA 3RYPA 4MQVA 1MMDA 4U7BA 1YTYA 4ON0A 3TOBA 1SANA 1JTYA 2X1DA 5C4XJ 4C2MJ 3K2ZA 3ABMH 2IGOA 3FMSA 2L9NA 4B3AA 4Y7NJ 3I3LA 4C3HJ 2ISZA 1UHSA 2M0MA 2K85A 3HTSB 3PQJA 3EPZA 3SDBA 5M5YJ 1VQLI 2BHZA 1USTA 1IO2A 2A61A 5E1WA 1PJRA 3H35A 1FP2A 2PMHA 4M6YA 1XB4A 4P1WA 2DMPA 5K7HA 1T38A 3IAS2 1HDDC 3NWSA 1OISA 1N78A 2Y30A 2LFBA 4JOMA 2A6EF 3HOXJ 5CVRA 1FOWA 1X3WB 2M34A 5J1YA 4UNOA 1Z0XA 2W82A 3CUQB 3HUGA 2O8XA 1QBJA 1P7IA 2TDXA 1R5HA 3ML6A 3E97A 2L9SA 2ZNZA 2L0KA 4XLCA 1W7PA 1HXDA 4XONA 2VJ5A 3O6BB 1VQOI 5E1XA 3OWTA 4LGWA 1USSA 4PJMA 5KAIC 3FHNA 2H27A 2VT2A 5A2QZ 5J47A 4BHBA 4NDLA 3GFMA 1YJNI 2QM3A 3ESWB 3HHHA 2NNYA 3HKZA 4BXUA 2ME0A 1SD4A 1XSVA 4IEJA 5ICFA 4YFXF 4HF1A 3LFUA 1G59A 4FTHA 4I6ZA 1WH5A 3S3OA 1YJ9I 2BEOA 1D0YA 1HBXG 3IWZA 5J1RA 5TRDA 2VQGA 2VPRA 1ZHFA 2XAGA 2KLOA 3GBGA 3IH4A 5HDNA 2FUG2 2Z33A 2P5KA 2VI6A 2JRTA 2OV7A 4BH9A 1GXQA 2AHQA 3DTEA 4MGRA 4Y52J 3TO7A 3I71A 3J81Z 3DLLF 3CDIA 3OYFA 5FD6A 1LDDA 2LK2A 4B44A 3O2PE 1W4MA 2M5WA 1W5CC 1KZHA 1O4XA 4ZC3A 3GLLA 3O8GA 2VC0A 1R23A 2J5PA 3UKGA 4A93J 2LDUA 3QWLA 2DOAA 2FE3A 2HU9A 3LQQA 4E70A 4CGZA 1Y6IA 2NS7A 1DGWY 3F0CA 2VB6A 4YIIA 3L09A 1NG7A 2WY7Q 3K7AJ 1A31A 1DDNA 2EH3A 4L9TA 1ETXA 1P9QC 5DD4A 3BG5A 1IXRC 2JSCA 3CMEI 1GHCA 2KT0A 2RC4A 2KRFA 1DU6A 3E6DA 1I5ZA 4IQJA 4YFKF 2K86A 1MMNA 3RPUD 3ZOBA 3H9QA 1ETYA 1U5TA 1Y8RB 4DBRA 1QRYA 2DDBA 4U0YA 3CCLI 1WJ5A 3BQZA 4XN0A 3WTUC 4HA8A 2WTEA 4UUSA 1T8IA 1IXSB 1XDSA 2CW7A 1ETQA 2F5CA 5LHIA 2EQRA 2CJJA 2VODA 1BA5A 3PIOF 2ZJQF 1S5LC 2PLYA 4XRFA 1WCMJ 3DKYA 3CJTB 4EJWA 2I10A 1IDYA 4DZJA 2E1MB 3QU3A 5FO5A 1TQPA 5BPIA 1X3ZB 2K9SA 2KIMA 3G73A 1DU0A 1JKQC 2NVXJ 5TGTA 4MQ9F 4G7ZF 1FX7A 2JN6A 3V8LA 1MBJA 3SZTA 3L2CA 3MKZA 3Q0VA 3M07A 5H6RA 5B1AH 3S16J 1G3WA 4F93B 2ZC2A 5J40A 4NC7A 1R6RA 2R7UA 3KP5A 4II3A 3I56I 2DA6A 4LLNA 1JGSA 3BROA 4PDKA 3QOPA 2QSGX 4Y13A 1TLHB 2ESHA 3TP3A 2F4OB 2DOFA 1HW5A 1W0TA 3HC7A 5DS9A 3OYAA 4HLXA 1IG7A 2CV0A 1J9IA 1U6GA 3A03A 1PDNC 4RBOA 5DUKA 3U21A 2V7FA 3K1NA 1AWCA 1Z21A 1OYWA 3KCCA 4ASNA 1Z6RA 1OCCH 2Y69H 5D5XB 2YU9J 4HNTA 1B4AA 1TT0A 1QHHD 2HI3A 3DPUA 1YW9A 4E7ZA 1IRFA 2ZJPF 1FMVA 5E3MA 1MBGA 1BJAA 2MLKA 4XQFA 3K4NA 3G3ZA 4IRGA 2Z2SB 1J7KA 4C2TA 3IKTA 4U7DA 4AVPA 2P7VB 3MD2A 2PG4A 2FOKA 1NK2P 5FKLA 3DBLB 4IKFA 1HA8A 3BC8A 5EGOA 1PUFB 3T8TA 1K78B 2DK5A 4E7HA 3F8CA 1WSUA 2ID6A 3LSJA 3OR2C 4D1QA 3HIFA 4YELA 3C3WA 3F21A 4L0YB 1S7OA 1YO5C 1GVDA 1U9NA 3MKLA 3S15J 2OAZA 2UWMA 2GA1A 1SD5A 4XOTA 1IRXA 1KU9A 2DQLA 3M4OJ 4PCQA 2Y0SA 1Y39A 3KP2A 3X2QH 3L2RA 2LD5A 5BOXA 4N9IA 5HNFA 4KN4X 4LG0A 1J0RA 2JUCA 4XRSG 1ZRDA 4M3BA 2RNGA 3TL4X 2QQ9A 2HWVA 5K7ZA 1BIBA 4RB0A 3PL8A 3I4PA 1X4OA 3K6GA 3BP8A 4LLLA 5DUIA 3AG1H 2CU7A 2VE9A 1S6LA 1SVOA 2EJRA 4BY7J 1IGNA 3J7AO 3PO2J 5LRRA 5EEHA 4MTEA 2LOOA 3MKYB 3G4SI 2ZMEB 4WCGA 2D1VA 3PUFA 1B9NA 1I3AA 2XAHA 2EINH 4BJ6C 1LKXA 2IP2A 5K5QA 2GAUA 1FYKA 2X48A 2JSPA 4QSHA 1H88C 3LSMA 4R1HA 3KEQA 2M8EA 3K2AA 1IRZA 1KQ8A 5D8LB 2L7MP 3FM3A 3E7LA 2K3FA 1TW3A 4HYEA 2MD0A 5HDGA 1OCRH 2FBHA 4AIHA 4ZH4F 2M8GX 3FXOA 4X1EA 4Z2YA 1VQNI 3HSRA 1UMQA 3L00A 3D5RC 3F9KA 4HF2A 1APLC 4GGGA 2M45A 3MN2A 3C18A 1A04A 1KU7A 1ULYA 3CJQB 2VKDA 3LL7A 1XCVA 1FBUA 4YEJA 2HYGD 4F91B 2MABA 2WY8Q 5AIPA 3JREA 3I5UA 4HDVA 5L3EA 4BDYA 1D5YA 1Q1HA 4EEFG 5FLVA 1XSDA 2R92J 3OYCA 4M9ZA 4PSXA 3QPTA 2D1HA 2H94A 3W2AA 3K4KA 3MCZA 3ZXSA 4LIVA 2E71A 4BQOA 1QZEA 3P7NA 5EF6A 2EA4A 2WV0A 1T2KA 3ZQCA 2XRLA 2CUFA 1ZK8A 2NAZA 2RQPA 4KJZA 1LDKB 1K79A 2ECCA 3H92A 2XGEA 3HUGB 2E60A 5E8IA 1YLFA 1A6IA 1N25A 3TW6A 1TWAJ 2L7KA 2DQRA 2QVOA 4GO1A 5EG0A 1FP1D 3S3NA 3K9TA 2Q8KA 1W7PB 4ZZLA 3S1MJ 5F6FA 1I50J 2VN2A 2XDVA 3OOUA 3WHCA 2FMYA 5L3GA 1ZG1A 2YR2A 3ZMDA 4CYCA 2CUZA 4G94A 2KP6A 2XAUA 2LH9A 1VQ5I 5GTHC 3HDDA 2JZYA 4HQEA 4JX4A 3AAFA 2OZUA 4BBRJ 2ZO4A 3KYDB 1ZYRF 1SC7A 2MA3A 5B1BH 4S0HB 1HKTA 3DBRB 4Y33A 3G1MA 2IS2A 1HKSA 5GAGJ 4IQ4A 2JTVA 4MFDA 2DT7B 5ICCA 4AVZA 5CQGA 5HVQC 4H4KC 4BGDA 4B1RA 4BQAA 3LNQA 3PFIA 4I09A 3CMAI 3RI4A 1R9TJ 2ELJA 5K1YA 3I58A 1R36A 3OYDA 3OMYA 1K83J 2R0QC 2RNJA 3F6VA 3CCRI 1D8KA 1XX5A 3PSFA 1MNMC 3ROUA 2OTJI 1E3PA 3HEFA 2QEXI 3RPQA 1P4AA 3OYMA 2UZKA 1ITYA 2DXIA 3COAC 1V54H 4D9JA 5J6XA 1B1BA 4HZFA 4LK1F 3CF5F 3Q0WA 5DDGA 1I6HJ 2K02A 1XGOA 3NARA 2XGCA 4HRIA 3QYFA 3EYYA 4C9YA 1TWCJ 1ZAOA 3OOPA 2FXAA 2V9VA 1U5TB 4M6XA 2QA4I 2QSFX 3JAMZ 4A12A 4CUGA 2WBMA 3I59A 3T5XA 2VKEA 4HSTA 2LY9A 3W6VA 2VBYA 2F4MB 2PN6A 2NXNB 2EB7A 3L2VA 2DW4A 2L2OA 4HW0A 3F23A 3T8RA 1D1CA 4KNYA 5B5EC 1MSEC 1WJFA 3WTVC 3I55I 1MJAA 1LDJA 2HR3A 1X19A 2MBFA 2VT3A 5LHGA 1X3UA 3H3ZA 4M6VA 4RM2A 4S04A 1H8AC 2XF6A 2IBDA 2HVQA
chains in the Genus database with same CATH topology
4NB5A 2V6CA 5BPDA 1RIOH 1OMIA 3GW2A 2K4BA 2RVCA 4BNCA 4CXFA 4RS8A 3V8KA 1TW2A 2IRFG 3QAHA 3EQLF 1O3QA 1OR7A 2QLZA 4UVBA 3R0JA 1F1ZA 4ZZDA 1KU2A 2EK5A 2GQQA 2YPRA 1L0OC 2RV8A 4G6QA 3I54A 2EV5A 4M74A 2KIFA 5CJ9A 1IN5A 2ZJ2A 2MH2A 3KETA 4O6JA 1I1GA 5DEQA 4N9HA 1JHHA 3HRMA 3ZN1A 1Z9CA 1BI2A 2JPCA 1PP7U 2Y75A 1U78A 4ZYGA 2CWEA 3JAMK 1R5GA 3QP6A 1ZG5A 2LNBA 5EEGA 5BS6A 2O03A 4LG0B 2OQRA 4WXDA 1EV7A 4I01A 1S7AA 4B09A 1DUXC 4OU0A 1U2WA 3QPHA 1V4RA 1ZGJA 4Q48A 3DP7A 2X0LA 2VBZA 3TOAA 3E5QA 1ZH5A 4CYDA 5LBQA 1BN5A 3FX3A 4KIGA 2ZMEA 4D0PA 3ZMTA 5LGUA 3ERED 3VEPA 3R61A 3SXYA 4R8HA 4QWQA 3WGIA 5DV5A 3REOA 5FGMA 5IT3A 4JQFA 4KMFA 1Z6TA 2MLGA 3LA2A 1WKMA 5F64A 2GXGA 1KQ0A 5HS7A 3BJOA 3R6SA 1RNLA 3C1DA 5AIQA 1G3TA 3CUQC 5ED4A 1GVJA 3WG9A 4M9SA 3Q9VA 2DFIA 1XD7A 1L3LA 5HDKA 3MFKA 1FZPB 2AXLA 3KEOA 2NS0A 4CICA 5D5VB 2A5YB 2A3SA 3V7RA 3ZN0A 2HFHA 4ESBA 1E2XA 2GIVA 4ESFA 3TDZC 2VBWA 1EH6A 4RGSA 1G3SA 1R58A 5D4RA 3KP6A 1W7PD 1I6XA 5HLHA 1ZLJA 3WTTC 4I02A 4KFCA 2PJPA 4IVNA 3JTGA 4YIFA 3ZMVA 4O5VA 1TTYA 3O3KA 3Q9SA 3DPLC 1BC8C 2HDCA 3KP4A 3JSOA 1QO0D 2JPBA 4HOBA 3CDHA 3TKYA 5E18F 3GXOA 5J8FA 3P9KA 2QQBA 2K27A 3F8NA 5ILVA 2ELHA 4LD5A 4U0VA 3FWEA 3I59B 3BPVA 1LEBA 3FXQA 5LEKA 3P9CA 3WODF 1SFXA 5E20A 4PZJA 4A0XA 1FNNA 4ESJA 1T6SA 1XMAA 3NRVA 1FOKA 4UV8A 4G7OF 2VOPA 3FHZA 2RDPA 5TJJA 4A2UA 3GEZA 3CO6C 2XAJA 5FFZA 5HS9A 5CYVA 1XCBA 2XIGA 3LSTA 4PGGA 4OMYA 5DCFA 3HSEA 3KLNA 3ABUA 4EJVA 3EUHA 4G8XA 2V1XA 2XKPA 1B59A 3JTHA 2VXZA 4A6DA 3HRTA 4NHJA 2ZKZA 3SQNA 1MDMA 1IN8A 4XSZF 3WU1B 2DPDA 2J5OA 3FMRA 2H6CA 5A2QK 1HKQA 4NQWA 1R1TA 4OIRF 2HYFA 4G6DA 4LK0F 5ILUA 4WXCA 1F5TA 1ON1A 3KLOA 4FX0A 3WTZA 3BJ6A 4KN7X 4EM2A 2DLLA 3FMQA 4EM0B 5LGNA 3J81K 4IF4A 4DQ2A 3LAJA 2NYXA 3LQRA 1FC3A 2ETHA 1ZGAA 4LJZF 3LA3A 3DEUA 1LNWA 5JHUA 1SAXA 1FYLA 2XAQA 2FBKA 2ZFWA 4YG2F 2DO7A 2M87A 2DBBA 1I27A 3T1BA 1XMKA 1Z05A 4I0AA 3DPTA 2OD5A 4IHTA 3E6MA 3BDDA 3ECOA 1EH7A 4MHGA 5ICEA 1JXSA 3I64A 1HSJA 2DK8A 1VTNC 2ADUA 3P9IA 5D4SA 1G6NA 3W6KB 1MJBA 4HV6A 4MNUA 2ACJA 1SMTA 5FLXZ 2FRHA 2VE8A 2HEOA 1TQMA 4N0BA 5D6FA 3M8EA 1W5TA 1QGPA 5L3FA 2XROA 3Q5FA 3WTWC 3M7GA 1TQIA 2EFNA 2HKXA 3VODA 2W25A 4G7HF 4HDUA 2BBYA 3WU0A 4PGHA 2VOOA 2ISYA 5E8GA 1IUYA 3MZYA 4TV7A 3KP3A 3BWGA 3CO7C 2L01A 2OA4A 1QQIA 4AD9A 2XAFA 1HSTA 1ODDA 3DV8A 4HX7A 3ABTA 4OIQF 2H6BA 1BOAA 3TO6A 1MKMA 4KDPA 1UB9A 2COMA 3FF5A 2YU3A 2CO5A 3D0SA 5CLSA 1SFUA 1U8RA 2Y0MA 2KJBA 1HW1A 4A5MA 5F1RA 1P4XA 3K0LA 4ZYHA 2DI3A 3IHUA 1Z7UA 3R60A 1KA8A 5FLXK 5AONA 4BHCA 1QPMA 4KT5C 1IF1A 4L9NA 1RUNA 4ZYDA 4DNCA 5L3CA 2MH9A 3CUOA 4BAYA 1EH8A 1OKRA 4HBLA 2HTJA 2XKOA 1LQ1A 1S3JA 5LLQA 2FQ3A 1KYWA 5IT9Z 1G4DA 1FY7A 1IN4A 5HLIA 3I53A 4EVIA 3IC7A 4L9JA 3V7SA 1KU3A 3QRFF 3ZMSA 3GZ6A 2GXBA 1WRJA 2L4MA 1QNTA 3L7WA 2XVCA 2WC2A 4XBFA 5D5UB 1K6OA 3WE2A 3LA7A 4L9VA 4IPAA 1D8JA 1R00A 1V3FA 2HKOA 4KUMA 3B02A 3EDPA 1Z1DA 3JSPA 3JW4A 2L02A 3SHFA 4BHPA 4A0ZA 2Z5UA 1J59A 2B0LA 4HAMA 1PUEE 3GO5A 2EA2A 1O7LA 5D5WB 1O57A 2JT1A 4WXHA 5DCMB 2F5DA 2GA2A 4CDGA 3SFZA 4OINF 2E1NA 2W57A 1YFHA 1MDMB 3D5LA 2DU9A 1XGNA 5E17F 3MZHA 2QENA 2A68F 4EM1A 2R7DA 2HQRA 2LKPA 4FT8A 3RKXA 3DQVC 1ZN2A 1O3RA 3M1EA 2QZ8A 3K1MA 1H0MA 5JVTA 4RGXA 5KK1A 3F8MA 2G7UA 3LFKA 1F9NA 2D45A 2W85A 4S05A 4MEXF 2BE5F 2OZ6A 1WI9A 2EV0A 4YFNF 1HW2A 3NQOA 2BV6A 3RYRA 2FMLA 1S29A 1ZARA 3MAJA 5ERIA 4LB6B 1R1VA 4Y17A 1TNTA 4IJAA 2CG4A 2F2EA 2LSOA 2KJCA 2UXNA 3IRRA 1LJ9A 1P92A 3GLXA 3IKVA 5ICGA 4M72A 1STZA 2IA0A 4L5JA 1FWZA 2PEXA 3V7CA 1ZRFA 3ZPLA 2DTRA 1OYYA 2EFQA 1D3YA 3F8FA 3GZ5A 4LB5A 1QZYA 1IW7F 4CO8A 1J2XA 2KIUA 4FHTA 3BZ6A 2W84A 3H3UA 1YW8A 3GFLA 2ESNA 1IN7A 3QP5A 3TDUC 4KYWA 1P6RA 4OOIA 4HF0A 1UCRA 2FSWA 5E1ZB 4UVAA 2G7HA 1ONVA 1JE8A 2HS5A 2BGCA 1R22A 2O3FA 3B73A 2STTA 3KZZA 2PI0A 2XGXA 5FB2A 1FT9A 1H9TA 3E6BA 5DYMA 1FYMA 3W6JB 3U9GA 3J80Z 1BBYA 4EJTA 4LLGF 4P55A 3ZQ7A 4WK8F 1WWXA 3N97A 1CGPA 1TNSA 1FPQA 3FZVA 1P4WA 4RGRA 1O3SA 3N4MA 2ZCWA 1UHMA 4HX8A 2Z9OA 1BIAA 1UFMA 2E7WA 4EQQA 6PAXA 3LAPA 4EGZA 3GFIA 4UUVA 3ZMZA 2P6SA 1TBXA 5JR3A 1FBSA 3IWFA 3MEXA 3HYIA 4RB1A 2XASA 4U88A 1NHAA 3R4KA 4Q47A 4UV9A 1WQ2A 2P6TA 5DD8A 5D8KB 2EFPA 4AWXB 1O7FA 3FXRA 4KIBA 5BQTA 4IHSA 3RKYA 1F4KA 2M30A 3S2WA 1PP8F 1MJ9A 2XRNA 4EGYA 2FF4A 3F3XA 1YS7A 3IL2A 2G9WA 4F7ZA 3E6CC 4LMYA 5CVJA 5H6QA 1K7AA 1IAWA 3ZMUA 2V1DA 3F22A 3T0YA 5LHHA 3BPXA 2CW0F 2X4HA 2Y48A 1C0WA 1YS6A 3R0AA 4JBAA 2QYOA 3HHGA 5ILSA 1XSXA 3ELKA 4EMSA 3J80K 3VFZA 2OU2A 2XV4S 2C6YA 4OIPF 1IZ1A 1KYZA 3WTSC 3ECHA 1H9GA 2CFXA 4GXOA 4QLCU 4AIKA 1XGSA 1B9MA 2NRAC 3RPUA 3RJPA 4L0ZB 5DCMA 2LF7A 4P96A 5CVUA 2QQAA 2M1BA 1DP7P 3WGHA 3KP7A 3DFGA 5CVVA 1YYVA 2O61A 3V4GA 2P5VA 3CTAA 2MC3A 2ZXJA 2P8TA 3GYHX 3IRQA 3HTUA 3F6OA 1LEAA 3WGGA 4XLPF 4B8XA 3TQNA 1YIOA 4HLYA 4P5OA 2QUFA 2GWRA 4RAZA 3BJAA 3EYIA 4LFUA 3WE3A 2YSRA 2A69F 3HRUA 4EJOA 5JFRA 2DPUA 2QBYA 1OPCA 2CSOA 1SD6A 1BI3A 3ISPA 5LEJA 2QWWA 3KFWX 4ENNA 4U0WA 1ON2A 1MZBA 2PMUA 3RTRA 3L9FA 4I98B 3V8JA 1BC7C 2E1CA 3HOSA 3F8BA 1S8NA 3C7JA 3WTXC 5K5RA 2XUBA 4KICA 1RZ4A 2FU4A 2P5LC 4GCVA 4P9UA 2EFOA 2K7LA 2CYYA 4GYIA 2LF8A 5J8CA 3M8FA 2HZTA 2E7XA 2VBXA 1JHFA 2A6HF 5HLGA 1ZRCA 3K69A 3PQKA 1IXCA 4HQMA 2AS5F 1ZLKA 2FNAA 4JK1X 2O6GE 3FM5A 2RGVA 3GX4X 1G3YA 2K4JA 2Q2EA 1E17A 1SMYF 1T98A 4FX4A 1FSEA 5L3DA 1YG2A 5H20A 4CZZA 4A5NA 2ZBKA 2V1UA 4BYYA 1KGSA 4MEYF 4I2OA 2MD5A 2OQGA 1CF7A 1YW7A 2YX4A 4M73A 2BYVE 3NEUA 3DKWA 3K1PA 1R7JA 2L3DA 1ZREA 3CLOA 5KVRA 2YX7A 3DF8A 1R1UA 4RB3C 4WWCA 4ENJA 2P4WA 3KE2A 1B6AA 2FBIA 1J5YA 3GFJA 3MQ0A 1IN6A 1I1SA 4ZYEA 2FEZA 3RDIA 2IVMA 4RB2C 4ENKA 4K2EA 3E5XA 3ZP5A 2EV6A 1Z91A 2FNPA 2OBPA 1RI7A 2RKHA 2R3SA 1HQCA 1FSHA 1U5TC 1XN7A 1KQ9A 1T39A 1BI1A 3HSFA 2CGPA 4UVCA 3CUQA 4MTDA 3U1DA 3TGNA 3HOTA 1ZG3A 2KKOA 4I7HA 2Z3YA 1LVAA 2WWYA 2RN7A 3U2RA 2PQ8A 2L54A 2IA2A 2GZWA 4XLNF 4EJUA 2EWNA 1T0FA 4IRIA 1DPUA 2PBIA 2W24A 2NNNA 4Y15A 1P2FA 3E5UA 3CJNA 3DXJF 5LGTA 3BY6A 3I0TA 3OV8A 1LB2A 2DAOA 1XDUA 4R79A 2O0YA 2IPQX 3VOEA 1XGMA 3WTYC 3HRSA 1YQAA 5FFXA 2D2WA 3KZYA 2F5EA 4HX4A 4M9XA 3E3VA 1FBQA 3QU6A 1QZZA 1MD0A 2ZNYA 1J75A 5JI6A 1UHWA 5CVIA 2L4AA 1SD7A 1MGTA 4KA4A 2HQNA 4KIFA 1BI0A 2HTSA 2XHKA 3GWZA 2EFWA 3VB2A 2R7FA 2Q0OA 1SFEA 3M9AA 4UXNA 3RKWA 1U3EM 4L5IA 1GXPA 3RIRA 5LRSA 3F72A 3ULQB 2QBYB 2H09A 2VONA 4OMZA 5IT9K 4IXAA 3TO9A 2IW5A 4P9FA 1RUOA 4ETSA 1FLIA 4G9YA 4RGUA 4EV0A 4GYGA 4CHUA 5BMZA 1O3TA 2FA5A 2HGCA 3GVAA 1Y0UA 1D5VA 1K78A 3GUDA 4O3MA 4M71A 1IRGA 3SZPA 5HOOA 4OIOF 1W5SA 2P7CB 4HV5A 2PFBA 2IT0A 5HS8A 5D6EA 3GF2A 4L18B 5FD5A 4UHTA 2CQKA 4Q5SF 2IA1A 2DT5A 2Z99A 1AOYA 4RAYA 4KMUX 2F5FA 4AIJA 3MWMA 2A07F 3EETA 4Q4ZF 3LWFA 1REPC 2HOEA 2STWA 4I0BA 4A6EA 4WF2A 1DPRA 1OYIA 1CF7B 4WX9A 1BM9A 5L3BA 2VC1A 4A0YA 5K5OA 4XSXF 2IJLA 2V79A 2UXXA 3FXUA 4IRHA 3BOQA 4H0EA 3RYPA 4MQVA 4U7BA 1YTYA 4ON0A 3TOBA 3K2ZA 3FMSA 2ISZA 3HTSB 3PQJA 1USTA 5E1WA 2A61A 1FP2A 2PMHA 4M6YA 1XB4A 1T38A 2A6EF 5CVRA 4UNOA 3CUQB 3HUGA 2O8XA 1QBJA 2TDXA 1R5HA 3ML6A 3E97A 2ZNZA 1W7PA 1HXDA 3O6BB 5E1XA 4LGWA 1USSA 2H27A 2VT2A 5A2QZ 4BHBA 3GFMA 2QM3A 3HHHA 2NNYA 4BXUA 1SD4A 1XSVA 4HF1A 5ICFA 4YFXF 2BEOA 1HBXG 3IWZA 5TRDA 1ZHFA 2XAGA 5HDNA 2Z33A 2P5KA 2JRTA 4BH9A 1GXQA 4MGRA 3TO7A 3I71A 3J81Z 5FD6A 1LDDA 3O2PE 1W4MA 2M5WA 2VC0A 1R23A 2J5PA 2LDUA 2FE3A 3LQQA 4E70A 4CGZA 4YIIA 3L09A 1DDNA 4L9TA 5DD4A 1GHCA 1IXRC 2JSCA 2RC4A 2KRFA 3E6DA 1I5ZA 4YFKF 2K86A 1U5TA 4U0YA 3WTUC 4HA8A 2WTEA 1IXSB 1XDSA 2F5CA 5LHIA 2VODA 2PLYA 4XRFA 4EJWA 3QU3A 5FO5A 1TQPA 5BPIA 2KIMA 3G73A 4MQ9F 4G7ZF 1FX7A 3V8LA 3SZTA 3L2CA 5H6RA 1G3WA 3KP5A 4LLNA 1JGSA 3BROA 4PDKA 3QOPA 4Y13A 1TLHB 2ESHA 1HW5A 4HLXA 1J9IA 1U6GA 1PDNC 5DUKA 3K1NA 1AWCA 1OYWA 3KCCA 4ASNA 1Z6RA 5D5XB 1B4AA 1YW9A 1IRFA 1BJAA 2MLKA 3G3ZA 4IRGA 1J7KA 3IKTA 4U7DA 4AVPA 2P7VB 2PG4A 2FOKA 1K78B 3T8TA 2DK5A 3F8CA 1WSUA 3HIFA 3C3WA 3F21A 4L0YB 1S7OA 1YO5C 2OAZA 2UWMA 2GA1A 1SD5A 2DQLA 1KU9A 4PCQA 3KP2A 5BOXA 4N9IA 4KN4X 4LG0A 1J0RA 1ZRDA 2QQ9A 2HWVA 1BIBA 4RB0A 3I4PA 3BP8A 4LLLA 5DUIA 2VE9A 1S6LA 2EJRA 3J7AO 5LRRA 5EEHA 4MTEA 2ZMEB 4WCGA 2D1VA 1B9NA 2XAHA 2IP2A 5K5QA 2GAUA 1FYKA 4R1HA 3KEQA 2M8EA 1KQ8A 5D8LB 3FM3A 1TW3A 4HYEA 5HDGA 4AIHA 2FBHA 4ZH4F 4Z2YA 3HSRA 3L00A 4HF2A 4GGGA 2M45A 3C18A 1A04A 1KU7A 1ULYA 1XCVA 1FBUA 2HYGD 5AIPA 3I5UA 4HDVA 5L3EA 1Q1HA 1XSDA 4M9ZA 3QPTA 2D1HA 2H94A 3MCZA 3P7NA 2EA4A 2WV0A 1T2KA 2NAZA 2RQPA 1LDKB 1K79A 3H92A 5E8IA 1YLFA 2DQRA 2QVOA 4GO1A 1FP1D 3K9TA 2Q8KA 1W7PB 4ZZLA 5F6FA 2VN2A 5L3GA 2FMYA 1ZG1A 2YR2A 3ZMDA 4G94A 2JZYA 4HQEA 3AAFA 2OZUA 2ZO4A 1ZYRF 2MA3A 1HKTA 1HKSA 2JTVA 5ICCA 5HVQC 4BQAA 3PFIA 4I09A 3RI4A 5K1YA 3I58A 1R36A 2RNJA 3F6VA 1D8KA 3ROUA 3RPQA 1P4AA 2UZKA 3COAC 5J6XA 1B1BA 4HZFA 4LK1F 5DDGA 2K02A 1XGOA 3EYYA 1ZAOA 3OOPA 2FXAA 2V9VA 1U5TB 4M6XA 3JAMZ 4A12A 3I59A 3T5XA 2VBYA 2PN6A 2EB7A 2DW4A 4HW0A 3F23A 3T8RA 4KNYA 3WTVC 1MJAA 1LDJA 2HR3A 2MBFA 2VT3A 5LHGA 1X3UA 3H3ZA 4S04A 4ENMA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4NB5 A;  2V6C A;  5BPD A;  1RIO H;  1OMI A;  3GW2 A;  2K4B A;  2RVC A;  4BNC A;  4CXF A;  4RS8 A;  3V8K A;  1TW2 A;  2IRF G;  3QAH A;  3EQL F;  1O3Q A;  1OR7 A;  2QLZ A;  4UVB A;  3R0J A;  1F1Z A;  4ZZD A;  1KU2 A;  2EK5 A;  2GQQ A;  2YPR A;  1L0O C;  2RV8 A;  4G6Q A;  3I54 A;  2EV5 A;  4M74 A;  2KIF A;  5CJ9 A;  1IN5 A;  2ZJ2 A;  2MH2 A;  3KET A;  4O6J A;  1I1G A;  5DEQ A;  4N9H A;  1JHH A;  3HRM A;  3ZN1 A;  1Z9C A;  1BI2 A;  2JPC A;  1PP7 U;  2Y75 A;  1U78 A;  4ZYG A;  2CWE A;  3JAM K;  1R5G A;  3QP6 A;  1ZG5 A;  2LNB A;  5EEG A;  5BS6 A;  2O03 A;  4LG0 B;  2OQR A;  4WXD A;  1EV7 A;  4I01 A;  1S7A A;  4B09 A;  1DUX C;  4OU0 A;  1U2W A;  3QPH A;  1V4R A;  1ZGJ A;  4Q48 A;  3DP7 A;  2X0L A;  2VBZ A;  3TOA A;  3E5Q A;  1ZH5 A;  4CYD A;  5LBQ A;  1BN5 A;  3FX3 A;  4KIG A;  2ZME A;  4D0P A;  3ZMT A;  5LGU A;  3ERE D;  3VEP A;  3R61 A;  3SXY A;  4R8H A;  4QWQ A;  3WGI A;  5DV5 A;  3REO A;  5FGM A;  5IT3 A;  4JQF A;  4KMF A;  1Z6T A;  2MLG A;  3LA2 A;  1WKM A;  5F64 A;  2GXG A;  1KQ0 A;  5HS7 A;  3BJO A;  3R6S A;  1RNL A;  3C1D A;  5AIQ A;  1G3T A;  3CUQ C;  5ED4 A;  1GVJ A;  3WG9 A;  4M9S A;  3Q9V A;  2DFI A;  1XD7 A;  1L3L A;  5HDK A;  3MFK A;  1FZP B;  2AXL A;  3KEO A;  2NS0 A;  4CIC A;  5D5V B;  2A5Y B;  2A3S A;  3V7R A;  3ZN0 A;  2HFH A;  4ESB A;  1E2X A;  2GIV A;  4ESF A;  3TDZ C;  2VBW A;  1EH6 A;  4RGS A;  1G3S A;  1R58 A;  5D4R A;  3KP6 A;  1W7P D;  1I6X A;  5HLH A;  1ZLJ A;  3WTT C;  4I02 A;  4KFC A;  2PJP A;  4IVN A;  3JTG A;  4YIF A;  3ZMV A;  4O5V A;  1TTY A;  3O3K A;  3Q9S A;  3DPL C;  1BC8 C;  2HDC A;  3KP4 A;  3JSO A;  1QO0 D;  2JPB A;  4HOB A;  3CDH A;  3TKY A;  5E18 F;  3GXO A;  5J8F A;  3P9K A;  2QQB A;  2K27 A;  3F8N A;  5ILV A;  2ELH A;  4LD5 A;  4U0V A;  3FWE A;  3I59 B;  3BPV A;  1LEB A;  3FXQ A;  5LEK A;  3P9C A;  3WOD F;  1SFX A;  5E20 A;  4PZJ A;  4A0X A;  1FNN A;  4ESJ A;  1T6S A;  1XMA A;  3NRV A;  1FOK A;  4UV8 A;  4G7O F;  2VOP A;  3FHZ A;  2RDP A;  5TJJ A;  4A2U A;  3GEZ A;  3CO6 C;  2XAJ A;  5FFZ A;  5HS9 A;  5CYV A;  1XCB A;  2XIG A;  3LST A;  4PGG A;  4OMY A;  5DCF A;  3HSE A;  3KLN A;  3ABU A;  4EJV A;  3EUH A;  4G8X A;  2V1X A;  2XKP A;  1B59 A;  3JTH A;  2VXZ A;  4A6D A;  3HRT A;  4NHJ A;  2ZKZ A;  3SQN A;  1MDM A;  1IN8 A;  4XSZ F;  3WU1 B;  2DPD A;  2J5O A;  3FMR A;  2H6C A;  5A2Q K;  1HKQ A;  4NQW A;  1R1T A;  4OIR F;  2HYF A;  4G6D A;  4LK0 F;  5ILU A;  4WXC A;  1F5T A;  1ON1 A;  3KLO A;  4FX0 A;  3WTZ A;  3BJ6 A;  4KN7 X;  4EM2 A;  2DLL A;  3FMQ A;  4EM0 B;  5LGN A;  3J81 K;  4IF4 A;  4DQ2 A;  3LAJ A;  2NYX A;  3LQR A;  1FC3 A;  2ETH A;  1ZGA A;  4LJZ F;  3LA3 A;  3DEU A;  1LNW A;  5JHU A;  1SAX A;  1FYL A;  2XAQ A;  2FBK A;  2ZFW A;  4YG2 F;  2DO7 A;  2M87 A;  2DBB A;  1I27 A;  3T1B A;  1XMK A;  1Z05 A;  4I0A A;  3DPT A;  2OD5 A;  4IHT A;  3E6M A;  3BDD A;  3ECO A;  1EH7 A;  4MHG A;  5ICE A;  1JXS A;  3I64 A;  1HSJ A;  2DK8 A;  1VTN C;  2ADU A;  3P9I A;  5D4S A;  1G6N A;  3W6K B;  1MJB A;  4HV6 A;  4MNU A;  2ACJ A;  1SMT A;  5FLX Z;  2FRH A;  2VE8 A;  2HEO A;  1TQM A;  4N0B A;  5D6F A;  3M8E A;  1W5T A;  1QGP A;  5L3F A;  2XRO A;  3Q5F A;  3WTW C;  3M7G A;  1TQI A;  2EFN A;  2HKX A;  3VOD A;  2W25 A;  4G7H F;  4HDU A;  2BBY A;  3WU0 A;  4PGH A;  2VOO A;  2ISY A;  5E8G A;  1IUY A;  3MZY A;  4TV7 A;  3KP3 A;  3BWG A;  3CO7 C;  2L01 A;  2OA4 A;  1QQI A;  4AD9 A;  2XAF A;  1HST A;  1ODD A;  3DV8 A;  4HX7 A;  3ABT A;  4OIQ F;  2H6B A;  1BOA A;  3TO6 A;  1MKM A;  4KDP A;  1UB9 A;  2COM A;  3FF5 A;  2YU3 A;  2CO5 A;  3D0S A;  5CLS A;  1SFU A;  1U8R A;  2Y0M A;  2KJB A;  1HW1 A;  4A5M A;  5F1R A;  1P4X A;  3K0L A;  4ZYH A;  2DI3 A;  3IHU A;  1Z7U A;  3R60 A;  1KA8 A;  5FLX K;  5AON A;  4BHC A;  1QPM A;  4KT5 C;  1IF1 A;  4L9N A;  1RUN A;  4ZYD A;  4DNC A;  5L3C A;  2MH9 A;  3CUO A;  4BAY A;  1EH8 A;  1OKR A;  4HBL A;  2HTJ A;  2XKO A;  1LQ1 A;  1S3J A;  5LLQ A;  2FQ3 A;  1KYW A;  5IT9 Z;  1G4D A;  1FY7 A;  1IN4 A;  5HLI A;  3I53 A;  4EVI A;  3IC7 A;  4L9J A;  3V7S A;  1KU3 A;  3QRF F;  3ZMS A;  3GZ6 A;  2GXB A;  1WRJ A;  2L4M A;  1QNT A;  3L7W A;  2XVC A;  2WC2 A;  4XBF A;  5D5U B;  1K6O A;  3WE2 A;  3LA7 A;  4L9V A;  4IPA A;  1D8J A;  1R00 A;  1V3F A;  2HKO A;  4KUM A;  3B02 A;  3EDP A;  1Z1D A;  3JSP A;  3JW4 A;  2L02 A;  3SHF A;  4BHP A;  4A0Z A;  2Z5U A;  1J59 A;  2B0L A;  4HAM A;  1PUE E;  3GO5 A;  2EA2 A;  1O7L A;  5D5W B;  1O57 A;  2JT1 A;  4WXH A;  5DCM B;  2F5D A;  2GA2 A;  4CDG A;  3SFZ A;  4OIN F;  2E1N A;  2W57 A;  1YFH A;  1MDM B;  3D5L A;  2DU9 A;  1XGN A;  5E17 F;  3MZH A;  2QEN A;  2A68 F;  4EM1 A;  2R7D A;  2HQR A;  2LKP A;  4FT8 A;  3RKX A;  3DQV C;  1ZN2 A;  1O3R A;  3M1E A;  2QZ8 A;  3K1M A;  1H0M A;  5JVT A;  4RGX A;  5KK1 A;  3F8M A;  2G7U A;  3LFK A;  1F9N A;  2D45 A;  2W85 A;  4S05 A;  4MEX F;  2BE5 F;  2OZ6 A;  1WI9 A;  2EV0 A;  4YFN F;  1HW2 A;  3NQO A;  2BV6 A;  3RYR A;  2FML A;  1S29 A;  1ZAR A;  3MAJ A;  5ERI A;  4LB6 B;  1R1V A;  4Y17 A;  1TNT A;  4IJA A;  2CG4 A;  2F2E A;  2LSO A;  2KJC A;  2UXN A;  3IRR A;  1LJ9 A;  1P92 A;  3GLX A;  3IKV A;  5ICG A;  4M72 A;  1STZ A;  2IA0 A;  4L5J A;  1FWZ A;  2PEX A;  3V7C A;  1ZRF A;  3ZPL A;  2DTR A;  1OYY A;  2EFQ A;  1D3Y A;  3F8F A;  3GZ5 A;  4LB5 A;  1QZY A;  1IW7 F;  4CO8 A;  1J2X A;  2KIU A;  4FHT A;  3BZ6 A;  2W84 A;  3H3U A;  1YW8 A;  3GFL A;  2ESN A;  1IN7 A;  3QP5 A;  3TDU C;  4KYW A;  1P6R A;  4OOI A;  4HF0 A;  1UCR A;  2FSW A;  5E1Z B;  4UVA A;  2G7H A;  1ONV A;  1JE8 A;  2HS5 A;  2BGC A;  1R22 A;  2O3F A;  3B73 A;  2STT A;  3KZZ A;  2PI0 A;  2XGX A;  5FB2 A;  1FT9 A;  1H9T A;  3E6B A;  5DYM A;  1FYM A;  3W6J B;  3U9G A;  3J80 Z;  1BBY A;  4EJT A;  4LLG F;  4P55 A;  3ZQ7 A;  4WK8 F;  1WWX A;  3N97 A;  1CGP A;  1TNS A;  1FPQ A;  3FZV A;  1P4W A;  4RGR A;  1O3S A;  3N4M A;  2ZCW A;  1UHM A;  4HX8 A;  2Z9O A;  1BIA A;  1UFM A;  2E7W A;  4EQQ A;  6PAX A;  3LAP A;  4EGZ A;  3GFI A;  4UUV A;  3ZMZ A;  2P6S A;  1TBX A;  5JR3 A;  1FBS A;  3IWF A;  3MEX A;  3HYI A;  4RB1 A;  2XAS A;  4U88 A;  1NHA A;  3R4K A;  4Q47 A;  4UV9 A;  1WQ2 A;  2P6T A;  5DD8 A;  5D8K B;  2EFP A;  4AWX B;  1O7F A;  3FXR A;  4KIB A;  5BQT A;  4IHS A;  3RKY A;  1F4K A;  2M30 A;  3S2W A;  1PP8 F;  1MJ9 A;  2XRN A;  4EGY A;  2FF4 A;  3F3X A;  1YS7 A;  3IL2 A;  2G9W A;  4F7Z A;  3E6C C;  4LMY A;  5CVJ A;  5H6Q A;  1K7A A;  1IAW A;  3ZMU A;  2V1D A;  3F22 A;  3T0Y A;  5LHH A;  3BPX A;  2CW0 F;  2X4H A;  2Y48 A;  1C0W A;  1YS6 A;  3R0A A;  4JBA A;  2QYO A;  3HHG A;  5ILS A;  1XSX A;  3ELK A;  4EMS A;  3J80 K;  3VFZ A;  2OU2 A;  2XV4 S;  2C6Y A;  4OIP F;  1IZ1 A;  1KYZ A;  3WTS C;  3ECH A;  1H9G A;  2CFX A;  4GXO A;  4QLC U;  4AIK A;  1XGS A;  1B9M A;  2NRA C;  3RPU A;  3RJP A;  4L0Z B;  5DCM A;  2LF7 A;  4P96 A;  5CVU A;  2QQA A;  2M1B A;  1DP7 P;  3WGH A;  3KP7 A;  3DFG A;  5CVV A;  1YYV A;  2O61 A;  3V4G A;  2P5V A;  3CTA A;  2MC3 A;  2ZXJ A;  2P8T A;  3GYH X;  3IRQ A;  3HTU A;  3F6O A;  1LEA A;  3WGG A;  4XLP F;  4B8X A;  3TQN A;  1YIO A;  4HLY A;  4P5O A;  2QUF A;  2GWR A;  4RAZ A;  3BJA A;  3EYI A;  4LFU A;  3WE3 A;  2YSR A;  2A69 F;  3HRU A;  4EJO A;  5JFR A;  2DPU A;  2QBY A;  1OPC A;  2CSO A;  1SD6 A;  1BI3 A;  3ISP A;  5LEJ A;  2QWW A;  3KFW X;  4ENN A;  4U0W A;  1ON2 A;  1MZB A;  2PMU A;  3RTR A;  3L9F A;  4I98 B;  3V8J A;  1BC7 C;  2E1C A;  3HOS A;  3F8B A;  1S8N A;  3C7J A;  3WTX C;  5K5R A;  2XUB A;  4KIC A;  1RZ4 A;  2FU4 A;  2P5L C;  4GCV A;  4P9U A;  2EFO A;  2K7L A;  2CYY A;  4GYI A;  2LF8 A;  5J8C A;  3M8F A;  2HZT A;  2E7X A;  2VBX A;  1JHF A;  2A6H F;  5HLG A;  1ZRC A;  3K69 A;  3PQK A;  1IXC A;  4HQM A;  2AS5 F;  1ZLK A;  2FNA A;  4JK1 X;  2O6G E;  3FM5 A;  2RGV A;  3GX4 X;  1G3Y A;  2K4J A;  2Q2E A;  1E17 A;  1SMY F;  1T98 A;  4FX4 A;  1FSE A;  5L3D A;  1YG2 A;  5H20 A;  4CZZ A;  4A5N A;  2ZBK A;  2V1U A;  4BYY A;  1KGS A;  4MEY F;  4I2O A;  2MD5 A;  2OQG A;  1CF7 A;  1YW7 A;  2YX4 A;  4M73 A;  2BYV E;  3NEU A;  3DKW A;  3K1P A;  1R7J A;  2L3D A;  1ZRE A;  3CLO A;  5KVR A;  2YX7 A;  3DF8 A;  1R1U A;  4RB3 C;  4WWC A;  4ENJ A;  2P4W A;  3KE2 A;  1B6A A;  2FBI A;  1J5Y A;  3GFJ A;  3MQ0 A;  1IN6 A;  1I1S A;  4ZYE A;  2FEZ A;  3RDI A;  2IVM A;  4RB2 C;  4ENK A;  4K2E A;  3E5X A;  3ZP5 A;  2EV6 A;  1Z91 A;  2FNP A;  2OBP A;  1RI7 A;  2RKH A;  2R3S A;  1HQC A;  1FSH A;  1U5T C;  1XN7 A;  1KQ9 A;  1T39 A;  1BI1 A;  3HSF A;  2CGP A;  4UVC A;  3CUQ A;  4MTD A;  3U1D A;  3TGN A;  3HOT A;  1ZG3 A;  2KKO A;  4I7H A;  2Z3Y A;  1LVA A;  2WWY A;  2RN7 A;  3U2R A;  2PQ8 A;  2L54 A;  2IA2 A;  2GZW A;  4XLN F;  4EJU A;  2EWN A;  1T0F A;  4IRI A;  1DPU A;  2PBI A;  2W24 A;  2NNN A;  4Y15 A;  1P2F A;  3E5U A;  3CJN A;  3DXJ F;  5LGT A;  3BY6 A;  3I0T A;  3OV8 A;  1LB2 A;  2DAO A;  1XDU A;  4R79 A;  2O0Y A;  2IPQ X;  3VOE A;  1XGM A;  3WTY C;  3HRS A;  1YQA A;  5FFX A;  2D2W A;  3KZY A;  2F5E A;  4HX4 A;  4M9X A;  3E3V A;  1FBQ A;  3QU6 A;  1QZZ A;  1MD0 A;  2ZNY A;  1J75 A;  5JI6 A;  1UHW A;  5CVI A;  2L4A A;  1SD7 A;  1MGT A;  4KA4 A;  2HQN A;  4KIF A;  1BI0 A;  2HTS A;  2XHK A;  3GWZ A;  2EFW A;  3VB2 A;  2R7F A;  2Q0O A;  1SFE A;  3M9A A;  4UXN A;  3RKW A;  1U3E M;  4L5I A;  1GXP A;  3RIR A;  5LRS A;  3F72 A;  3ULQ B;  2QBY B;  2H09 A;  2VON A;  4OMZ A;  5IT9 K;  4IXA A;  3TO9 A;  2IW5 A;  4P9F A;  1RUO A;  4ETS A;  1FLI A;  4G9Y A;  4RGU A;  4EV0 A;  4GYG A;  4CHU A;  5BMZ A;  1O3T A;  2FA5 A;  2HGC A;  3GVA A;  1Y0U A;  1D5V A;  1K78 A;  3GUD A;  4O3M A;  4M71 A;  1IRG A;  3SZP A;  5HOO A;  4OIO F;  1W5S A;  2P7C B;  4HV5 A;  2PFB A;  2IT0 A;  5HS8 A;  5D6E A;  3GF2 A;  4L18 B;  5FD5 A;  4UHT A;  2CQK A;  4Q5S F;  2IA1 A;  2DT5 A;  2Z99 A;  1AOY A;  4RAY A;  4KMU X;  2F5F A;  4AIJ A;  3MWM A;  2A07 F;  3EET A;  4Q4Z F;  3LWF A;  1REP C;  2HOE A;  2STW A;  4I0B A;  4A6E A;  4WF2 A;  1DPR A;  1OYI A;  1CF7 B;  4WX9 A;  1BM9 A;  5L3B A;  2VC1 A;  4A0Y A;  5K5O A;  4XSX F;  2IJL A;  2V79 A;  2UXX A;  3FXU A;  4IRH A;  3BOQ A;  4H0E A;  3RYP A;  4MQV A;  4U7B A;  1YTY A;  4ON0 A;  3TOB A;  3K2Z A;  3FMS A;  2ISZ A;  3HTS B;  3PQJ A;  1UST A;  5E1W A;  2A61 A;  1FP2 A;  2PMH A;  4M6Y A;  1XB4 A;  1T38 A;  2A6E F;  5CVR A;  4UNO A;  3CUQ B;  3HUG A;  2O8X A;  1QBJ A;  2TDX A;  1R5H A;  3ML6 A;  3E97 A;  2ZNZ A;  1W7P A;  1HXD A;  3O6B B;  5E1X A;  4LGW A;  1USS A;  2H27 A;  2VT2 A;  5A2Q Z;  4BHB A;  3GFM A;  2QM3 A;  3HHH A;  2NNY A;  4BXU A;  1SD4 A;  1XSV A;  4HF1 A;  5ICF A;  4YFX F;  2BEO A;  1HBX G;  3IWZ A;  5TRD A;  1ZHF A;  2XAG A;  5HDN A;  2Z33 A;  2P5K A;  2JRT A;  4BH9 A;  1GXQ A;  4MGR A;  3TO7 A;  3I71 A;  3J81 Z;  5FD6 A;  1LDD A;  3O2P E;  1W4M A;  2M5W A;  2VC0 A;  1R23 A;  2J5P A;  2LDU A;  2FE3 A;  3LQQ A;  4E70 A;  4CGZ A;  4YII A;  3L09 A;  1DDN A;  4L9T A;  5DD4 A;  1GHC A;  1IXR C;  2JSC A;  2RC4 A;  2KRF A;  3E6D A;  1I5Z A;  4YFK F;  2K86 A;  1U5T A;  4U0Y A;  3WTU C;  4HA8 A;  2WTE A;  1IXS B;  1XDS A;  2F5C A;  5LHI A;  2VOD A;  2PLY A;  4XRF A;  4EJW A;  3QU3 A;  5FO5 A;  1TQP A;  5BPI A;  2KIM A;  3G73 A;  4MQ9 F;  4G7Z F;  1FX7 A;  3V8L A;  3SZT A;  3L2C A;  5H6R A;  1G3W A;  3KP5 A;  4LLN A;  1JGS A;  3BRO A;  4PDK A;  3QOP A;  4Y13 A;  1TLH B;  2ESH A;  1HW5 A;  4HLX A;  1J9I A;  1U6G A;  1PDN C;  5DUK A;  3K1N A;  1AWC A;  1OYW A;  3KCC A;  4ASN A;  1Z6R A;  5D5X B;  1B4A A;  1YW9 A;  1IRF A;  1BJA A;  2MLK A;  3G3Z A;  4IRG A;  1J7K A;  3IKT A;  4U7D A;  4AVP A;  2P7V B;  2PG4 A;  2FOK A;  1K78 B;  3T8T A;  2DK5 A;  3F8C A;  1WSU A;  3HIF A;  3C3W A;  3F21 A;  4L0Y B;  1S7O A;  1YO5 C;  2OAZ A;  2UWM A;  2GA1 A;  1SD5 A;  2DQL A;  1KU9 A;  4PCQ A;  3KP2 A;  5BOX A;  4N9I A;  4KN4 X;  4LG0 A;  1J0R A;  1ZRD A;  2QQ9 A;  2HWV A;  1BIB A;  4RB0 A;  3I4P A;  3BP8 A;  4LLL A;  5DUI A;  2VE9 A;  1S6L A;  2EJR A;  3J7A O;  5LRR A;  5EEH A;  4MTE A;  2ZME B;  4WCG A;  2D1V A;  1B9N A;  2XAH A;  2IP2 A;  5K5Q A;  2GAU A;  1FYK A;  4R1H A;  3KEQ A;  2M8E A;  1KQ8 A;  5D8L B;  3FM3 A;  1TW3 A;  4HYE A;  5HDG A;  4AIH A;  2FBH A;  4ZH4 F;  4Z2Y A;  3HSR A;  3L00 A;  4HF2 A;  4GGG A;  2M45 A;  3C18 A;  1A04 A;  1KU7 A;  1ULY A;  1XCV A;  1FBU A;  2HYG D;  5AIP A;  3I5U A;  4HDV A;  5L3E A;  1Q1H A;  1XSD A;  4M9Z A;  3QPT A;  2D1H A;  2H94 A;  3MCZ A;  3P7N A;  2EA4 A;  2WV0 A;  1T2K A;  2NAZ A;  2RQP A;  1LDK B;  1K79 A;  3H92 A;  5E8I A;  1YLF A;  2DQR A;  2QVO A;  4GO1 A;  1FP1 D;  3K9T A;  2Q8K A;  1W7P B;  4ZZL A;  5F6F A;  2VN2 A;  5L3G A;  2FMY A;  1ZG1 A;  2YR2 A;  3ZMD A;  4G94 A;  2JZY A;  4HQE A;  3AAF A;  2OZU A;  2ZO4 A;  1ZYR F;  2MA3 A;  1HKT A;  1HKS A;  2JTV A;  5ICC A;  5HVQ C;  4BQA A;  3PFI A;  4I09 A;  3RI4 A;  5K1Y A;  3I58 A;  1R36 A;  2RNJ A;  3F6V A;  1D8K A;  3ROU A;  3RPQ A;  1P4A A;  2UZK A;  3COA C;  5J6X A;  1B1B A;  4HZF A;  4LK1 F;  5DDG A;  2K02 A;  1XGO A;  3EYY A;  1ZAO A;  3OOP A;  2FXA A;  2V9V A;  1U5T B;  4M6X A;  3JAM Z;  4A12 A;  3I59 A;  3T5X A;  2VBY A;  2PN6 A;  2EB7 A;  2DW4 A;  4HW0 A;  3F23 A;  3T8R A;  4KNY A;  3WTV C;  1MJA A;  1LDJ A;  2HR3 A;  2MBF A;  2VT3 A;  5LHG A;  1X3U A;  3H3Z A;  4S04 A;  4ENM A; 
#chains in the Genus database with same CATH topology
 2P0W A;  4NC6 A;  4NB5 A;  2Y9Y A;  3CZ6 A;  2HDW A;  3A02 A;  2ZJR F;  2P81 A;  1R4M B;  1EF4 A;  3IUO A;  2V6C A;  5BPD A;  1DP3 A;  1F43 A;  2WB1 N;  5GAH J;  1RIO H;  1OMI A;  2R4G A;  2VIX A;  3GW2 A;  1HF0 A;  2K4B A;  4BE2 A;  2R7R A;  2LVS A;  2RVC A;  3ZGK A;  4E7L A;  4V19 K;  5EYR A;  4BNC A;  4CXF A;  4RS8 A;  3V8K A;  4QPO A;  1TW2 A;  2IRF G;  2KMU A;  3QAH A;  2BHY A;  4RA2 A;  2LP0 A;  4N4N B;  3EQL F;  4RAG A;  3GTM J;  1O3Q A;  1OR7 A;  2QLZ A;  2XB0 X;  4UVB A;  2F48 A;  3R0J A;  1F1Z A;  5E79 C;  4ZZD A;  1QA6 A;  1KU2 A;  5J3L A;  2EK5 A;  2GQQ A;  2YPR A;  4C2U A;  1L0O C;  2DFH A;  2RV8 A;  4XM3 A;  2E36 A;  4G6Q A;  2VQH A;  3I54 A;  1D0Z A;  2EV5 A;  3OS1 A;  4M74 A;  2KIF A;  5CJ9 A;  1IN5 A;  1V5E A;  1Z77 A;  5EGO B;  4A69 C;  2ZJ2 A;  4XOP A;  3OR1 C;  2MH2 A;  2Y31 A;  5F0H A;  2R7X A;  3KET A;  2DMN A;  4O6J A;  4XID A;  2E2I J;  1VI0 A;  5C3E J;  1I1G A;  5M5W J;  5DEQ A;  2D5V A;  1UG0 A;  2MSY A;  4N9H A;  1NH3 A;  1JHH A;  2KRC A;  3HRM A;  3ZN1 A;  2OUM A;  1Z9C A;  5K7F A;  2CQ7 A;  4HNV A;  1BI2 A;  2HNH A;  2JPC A;  2VQL A;  1PP7 U;  2Y75 A;  1U78 A;  4XRS A;  4ZYG A;  2WV1 A;  2CWE A;  3JAM K;  2UUZ A;  5KHD A;  1R5G A;  4BU2 A;  2ZSH B;  3QP6 A;  1FTT A;  4IHW A;  1ZG5 A;  2LNB A;  5EEG A;  5BS6 A;  2O03 A;  4XN3 A;  4LG0 B;  3FIS A;  5F08 A;  2OQR A;  4WXD A;  1EV7 A;  5EJC A;  4L5E A;  2VKH A;  1D0X A;  4I01 A;  3BZC A;  2DJN A;  4PJ0 C;  1MNE A;  3BR3 A;  1S7A A;  2YS9 A;  4B09 A;  2E5N A;  1DUX C;  4XKV A;  1OLT A;  4OU0 A;  4DGW B;  3OYB A;  1U2W A;  2DFE A;  1X2N A;  4G6T B;  3QPH A;  1V4R A;  3QPS A;  3AL0 B;  1ZGJ A;  1YX3 A;  4Q48 A;  4UUT A;  1JT0 A;  3DP7 A;  2X0L A;  2BXZ A;  2VBZ A;  3TOA A;  3E5Q A;  2A6T A;  2JA7 J;  3OY9 A;  3DU5 A;  1RRJ A;  5H2F C;  1ZH5 A;  4CYD A;  5LBQ A;  3B6A A;  1BN5 A;  3K4B A;  2WAF A;  3FX3 A;  4KIG A;  2BZT A;  2ZME A;  4BEH A;  4ZJZ A;  4D0P A;  2JA6 J;  3ZMT A;  3LSK A;  5LGU A;  3ERE D;  3VEP A;  4N4O B;  3R61 A;  3SXY A;  2NVT J;  4R8H A;  4QWQ A;  3WGI A;  5DV5 A;  3REO A;  5FGM A;  2IGM A;  2X6W A;  2M7A A;  4JQF A;  5IT3 A;  1YJW I;  4KMF A;  3HPG A;  2HPI A;  5GPC A;  3G1O A;  1Z6T A;  2MLG A;  3LA2 A;  1JUM A;  1WKM A;  2DOD A;  5F64 A;  2GXG A;  1KQ0 A;  5HS7 A;  2CRG A;  3BJO A;  3R6S A;  1RNL A;  3H9J A;  3OYG A;  1GV2 A;  3C1D A;  2O5R A;  1MBH A;  5AIQ A;  1G3T A;  1D1B A;  2X1C A;  5FKO A;  3CUQ C;  2A05 A;  4DW6 A;  5ED4 A;  1GVJ A;  1VQP I;  3WG9 A;  2KDZ A;  4M9S A;  3ASN H;  3Q9V A;  2DFI A;  1XD7 A;  2GOM A;  1YX5 A;  4M3E A;  1L3L A;  5FRN A;  5HDK A;  3MFK A;  4EAT A;  1K6Y A;  1FZP B;  1WFX A;  2AXL A;  3KEO A;  4X6A J;  1CQT A;  2NS0 A;  1JKR C;  4CIC A;  5D5V B;  2A5Y B;  2M3A A;  2A3S A;  2PMZ N;  3BTI A;  1DQU A;  4ANJ A;  4ZTJ A;  1VFC A;  2NVY J;  5F0C A;  4X0G A;  3V7R A;  3ZN0 A;  4HG2 A;  1GT0 C;  2K3P A;  1RKW A;  2HFH A;  5EG0 B;  2QKM B;  1JTX A;  4ESB A;  3OL3 A;  5F04 A;  2JQ7 A;  1E2X A;  2GIV A;  4FQG A;  4ESF A;  3TDZ C;  2EZH A;  2VBW A;  1EH6 A;  5GP9 A;  4CYC B;  4RGS A;  2DA1 A;  4B43 A;  2OTL I;  1G3S A;  1R58 A;  5D4R A;  3KP6 A;  4JP0 A;  4XIC A;  5JVG F;  1WGX A;  3BR0 A;  1W7P D;  1I6X A;  4XLF A;  3JRF A;  5HLH A;  1ZLJ A;  3PIP F;  4QIW N;  1ZKG A;  2LG4 A;  3WTT C;  4I02 A;  4KFC A;  2PJP A;  2HXO A;  4IVN A;  4QPQ A;  2W1O A;  1X1C A;  1JJ8 C;  2CH0 A;  4BBS J;  3JTG A;  4YIF A;  2CV1 A;  3ZMV A;  2M7B A;  4O5V A;  4BE1 A;  1TTY A;  3O3K A;  3Q9S A;  4V2G A;  4IOC F;  3DPL C;  1BC8 C;  2R7Q A;  3W2W A;  2HDC A;  3KP4 A;  4PUS A;  3JSO A;  3FBI B;  1QO0 D;  2JPB A;  2GBY A;  4II2 A;  4HOB A;  4LOC A;  1MND A;  3CDH A;  3TKY A;  4NNJ A;  3OYI A;  2KFD A;  5E18 F;  1WJC A;  3GXO A;  5J8F A;  1R71 A;  1U0J A;  3KIO A;  3P9K A;  3CCQ I;  4BY1 J;  3H3V K;  2QCO A;  2QQB A;  2K27 A;  3F8N A;  1YRN A;  4Y3O A;  1NK3 P;  3S1N J;  5ILV A;  3O8H A;  2M0C A;  2ELH A;  5F0F A;  4AM3 A;  4LD5 A;  2JVG A;  3PFY A;  3MZ8 A;  4A3K J;  4M3G A;  4AYB N;  4U0V A;  3HGG A;  4BUP A;  3FWE A;  3I59 B;  3BPV A;  4FET A;  1LEB A;  4PJN A;  3FXQ A;  5LEK A;  1JKO C;  3P9C A;  3PNV A;  3WOD F;  1VQK I;  1SFX A;  2ME6 A;  1WI3 A;  2EIL H;  5E20 A;  1YOV B;  4PZJ A;  4DZP A;  4A0X A;  3H0G J;  1DGR M;  2PX9 A;  3ABK H;  2V4J C;  1FNN A;  2K9M A;  2XC7 A;  4ESJ A;  1T6S A;  1XMA A;  3NRV A;  4CH7 A;  2KZV A;  1FOK A;  4UV8 A;  1X4P A;  1MH3 A;  1A6Q A;  2DTZ A;  3KX2 A;  3A2K A;  4G7O F;  2VOP A;  4PSW A;  3FHZ A;  3H9G A;  3GCM A;  1MMS A;  1MMG A;  2RDP A;  1HLV A;  5TJJ A;  4A2U A;  3GEZ A;  4C30 A;  3CO6 C;  2XAJ A;  5FFZ A;  1WJB A;  5HS9 A;  5CYV A;  4XNF A;  1XCB A;  3DCF A;  5CKT A;  2XIG A;  3LST A;  1SVL A;  4PGG A;  5DCF A;  4OMY A;  3HSE A;  3S1Q J;  2ZXH A;  3KLN A;  3UR3 C;  3ABU A;  4EJV A;  3EUH A;  1T56 A;  4G8X A;  4F55 A;  1LPQ A;  4PFP A;  2V1X A;  2XKP A;  1B59 A;  3JTH A;  2GOX B;  2VXZ A;  1LVK A;  1UEL B;  4A6D A;  2R7V A;  3HRT A;  4NHJ A;  2ZKZ A;  3SQN A;  1MDM A;  1IN8 A;  3RSN A;  1ETV A;  4XSZ F;  1YE9 A;  3WU1 B;  2J5O A;  3CCS I;  2DPD A;  3FMR A;  2H6C A;  2VKV A;  5A2Q K;  2B7E A;  2BVM A;  1HKQ A;  4NQW A;  1R1T A;  1OFC X;  2HYF A;  4OIR F;  4G6D A;  4LK0 F;  5M3M J;  5ILU A;  4WXC A;  1ZTR A;  4KIT B;  3ZQI A;  1QHG A;  1F5T A;  1ON1 A;  1TZL A;  3FK6 A;  1MBE A;  3KLO A;  4FX0 A;  1FTZ A;  3HG9 A;  3BG9 A;  3WTZ A;  2HZD A;  3BJ6 A;  4KN7 X;  4EM2 A;  2DLL A;  3FMQ A;  2RAE A;  4EM0 B;  5LGN A;  3TMO A;  3VYU B;  5LD2 C;  2MFZ A;  3J81 K;  4IF4 A;  1PVE A;  4DQ2 A;  3LAJ A;  3SZG A;  2NYX A;  3LQR A;  4DBQ A;  3IAM 2;  4F92 B;  4KT6 A;  1FC3 A;  3OYJ A;  1Z67 A;  2ETH A;  1ZGA A;  3KYC B;  3LA3 A;  3DEU A;  4LJZ F;  1LNW A;  2IEK A;  5JHU A;  1SAX A;  1FYL A;  1IDZ A;  1XG1 A;  4IZZ A;  3FXK A;  2XAQ A;  2R93 J;  2NS8 A;  2FBK A;  2ZFW A;  4BQN A;  2CV2 A;  1X1B A;  4YG2 F;  2DO7 A;  2M87 A;  4A3C J;  3ZRG A;  4CZC A;  4J01 A;  4Z6Y A;  2DBB A;  2LKX A;  1I27 A;  1XMK A;  1Z05 A;  3T1B A;  4I0A A;  3GTL J;  5IOZ A;  2L9V A;  3G1L A;  3HJE A;  1HDP A;  3DPT A;  4BL0 B;  2OD5 A;  5FRM A;  4IHT A;  3E6M A;  3M3Y J;  3BDD A;  3ECO A;  2ZSI B;  4F3Q A;  3L1P A;  1EH7 A;  4MHG A;  2R7S A;  5ICE A;  1ETO A;  2EPF A;  1JXS A;  1VZ0 A;  3J7Y J;  3HBL A;  3I64 A;  1HSJ A;  2DK8 A;  4ZDO A;  5JLX A;  5IPA A;  1S7E A;  3K4L A;  1VTN C;  2ADU A;  3P9I A;  3U1K A;  2GIZ A;  5D4S A;  3Q3S A;  1G6N A;  3W6K B;  2NOG A;  4BJ5 C;  1MJB A;  4HV6 A;  4BS9 A;  2GM4 A;  1Z3X A;  3DLA A;  1YIJ I;  4BEH B;  3K10 A;  4MNU A;  2ACJ A;  1SMT A;  1X1P A;  5FLX Z;  4PJJ A;  5EZG A;  2KQR A;  2FRH A;  1SEU A;  2VE8 A;  2JRM A;  3BG6 A;  3MKW B;  1ZR2 A;  2HEO A;  2XF7 A;  1TQM A;  4N0B A;  1K61 A;  1ETK A;  1SFK A;  2R7O A;  5D6F A;  3M8E A;  1W5T A;  1QGP A;  1VQM I;  2BY2 A;  3EUK L;  5L3F A;  2XRO A;  3M1C A;  3Q5F A;  3WTW C;  3M7G A;  1TQI A;  2EIM H;  2EFN A;  2HKX A;  3VOD A;  2W25 A;  4BJT A;  5KNL A;  3CES A;  4G7H F;  2OJE D;  4HDU A;  2PJR A;  4XL9 A;  2BBY A;  3WU0 A;  4PGH A;  1W36 D;  1EKE A;  2VOO A;  3JRD A;  3GTJ J;  2ISY A;  4CCN A;  1AU7 A;  5E8G A;  3H5R A;  2E2J J;  1IUY A;  2ZXW H;  1LFP A;  3HZJ A;  3MZY A;  3CP2 A;  4TV7 A;  5IP6 A;  1ZR4 A;  2X6X A;  1TWG J;  3JRH A;  1POG A;  4XKW A;  3KP3 A;  3BWG A;  3CO7 C;  2L01 A;  1OJL A;  2OA4 A;  1QQI A;  1R49 A;  4AD9 A;  3S32 A;  2VXD A;  2XAF A;  1HST A;  2HPM A;  1ODD A;  2EBI A;  3DV8 A;  4JX5 A;  4HX7 A;  4M3D A;  3ABT A;  4OIQ F;  2XF5 A;  5IYB J;  2IS1 A;  4FE7 A;  2H6B A;  3FXL A;  1BOA A;  4JX6 A;  4XLH A;  3OYK A;  1LE8 A;  5FKM A;  3TO6 A;  1MKM A;  3KZI C;  4KDP A;  1UB9 A;  1QVT A;  2L7Z A;  2E2H J;  4E7J A;  3FKI J;  4GFB A;  1XC5 A;  2COM A;  2VJ4 A;  3FF5 A;  2YU3 A;  4J19 A;  2CO5 A;  2WA0 A;  3D0S A;  4HPQ A;  1VQ7 I;  5FKK A;  2PMZ A;  5CLS A;  1SFU A;  1U8R A;  3CD6 I;  2Y0M A;  5C44 J;  2KJB A;  1HW1 A;  4A5M A;  5F1R A;  1P4X A;  4PJL A;  3BLY A;  1QPI A;  2V26 A;  3CDL A;  3K0L A;  4ZYH A;  3HKZ N;  2DI3 A;  3IHU A;  4I76 A;  1RC9 A;  1WJA A;  1Z7U A;  3R60 A;  1HC8 A;  1KA8 A;  5FLX K;  5AON A;  4HSR A;  4BHC A;  1QPM A;  4KT5 C;  1MIJ A;  1IF1 A;  4RLF A;  4L9N A;  5GTI C;  2BY3 A;  1RUN A;  1RPW A;  4ZYD A;  4DNC A;  5L3C A;  1FJL A;  2MH9 A;  4ZTF A;  1Q1V A;  3CUO A;  4BAY A;  1EH8 A;  1OKR A;  4HBL A;  1YRN B;  4ZDL A;  2HTJ A;  2XKO A;  5IY5 H;  1UAA A;  5IYD J;  1A5J A;  1LQ1 A;  2VQC A;  1S3J A;  5LLQ A;  3CP8 A;  2DMU A;  4IHV A;  2FQ3 A;  4BAC A;  1KYW A;  5IT9 Z;  2HOS A;  1G4D A;  1FY7 A;  1IN4 A;  4IX7 A;  1D1A A;  5HLI A;  3I53 A;  4A3F J;  4EVI A;  3IC7 A;  4L9J A;  2K5C A;  3AG3 H;  3V7S A;  1KU3 A;  3QRF F;  1JT6 A;  2WAQ N;  3GZN B;  3ZMS A;  3GZ6 A;  4RLQ A;  2GXB A;  5KCM A;  1WRJ A;  2L4M A;  3PUB A;  1QNT A;  3L7W A;  5BNG A;  1G8X A;  2XVC A;  2WC2 A;  3EUA A;  4XBF A;  5B66 C;  5D5U B;  1K6O A;  3WE2 A;  3LA7 A;  4XRM A;  4L9V A;  4IPA A;  1D8J A;  1R00 A;  1V3F A;  2E34 A;  2HKO A;  2HQA A;  2MYS A;  4KUM A;  3AKZ A;  3B02 A;  3EDP A;  1Z1D A;  3JSP A;  3J7A Y;  3JW4 A;  1UZC A;  3VSL A;  2L02 A;  5IOY A;  3SHF A;  3H1C A;  4D5C A;  4BHP A;  4A0Z A;  2R7T A;  4FCY A;  4ITV A;  1VQ6 I;  2Z5U A;  1J59 A;  2B0L A;  3BTL A;  2GLO A;  4HAM A;  1PUE E;  2XPU A;  3GO5 A;  2EA2 A;  1O7L A;  4F52 A;  3BTC A;  5D5W B;  3VPR A;  1O57 A;  1BR4 A;  4NC8 A;  2JT1 A;  4NBQ A;  1KON A;  2COB A;  3QOD A;  5E3L A;  3VDX A;  4WXH A;  5DCM B;  1PYV A;  5JHF A;  2F5D A;  2GA2 A;  5J4V A;  4CDG A;  3SFZ A;  1JJ6 C;  4IHY A;  4OIN F;  2E1N A;  2W57 A;  1TL8 A;  1YFH A;  4DIQ A;  3LSR A;  1MDM B;  3D5L A;  2DU9 A;  1XGN A;  5E17 F;  2YUS A;  4OAZ A;  2OCC H;  3MZH A;  2IGN A;  4NQW B;  1NTC A;  2IS4 A;  2V9P A;  2DMQ A;  3L2U A;  2QEN A;  2M2E A;  5EEA A;  2A68 F;  2CMP A;  4EM1 A;  2HDD A;  2R7D A;  4IHX A;  1XS9 A;  2NVQ J;  5FLM J;  3VWB A;  3NAU A;  2HQR A;  3CC7 I;  3M8J A;  1IC8 A;  1BR1 A;  2RRE A;  1ERD A;  2R5Z B;  2LKP A;  4FT8 A;  3RKX A;  3DQV C;  1ZN2 A;  1O3R A;  3M1E A;  2QZ8 A;  3K1M A;  4J00 A;  1VQ8 I;  1H0M A;  5JVT A;  4HNU A;  4CCK A;  2CUE A;  2DFF A;  2Z1D A;  4RGX A;  5KK1 A;  3G71 I;  1RKT A;  3F8M A;  2G7U A;  2EZL A;  4XKC A;  3LFK A;  1F9N A;  2D45 A;  2W85 A;  4S05 A;  4MEX F;  2BE5 F;  3ERM A;  2OZ6 A;  2JK3 A;  1WI9 A;  2DYR H;  2EV0 A;  3K4M A;  4YFN F;  1HW2 A;  3LSI A;  3HGY A;  3NQO A;  2BV6 A;  3RYR A;  3PJR A;  2FML A;  3P5J A;  2Z16 A;  5M3F J;  1S29 A;  3NWT A;  1ZAR A;  3MAJ A;  5ERI A;  2IS6 A;  3SEZ A;  4LB6 B;  2LYC A;  1R1V A;  1T95 A;  4Y17 A;  1SFO J;  1TNT A;  2NVU B;  4IJA A;  2CUJ A;  3BR1 A;  2CG4 A;  1WJE A;  3ZQF A;  3ONQ A;  3S2H J;  2QGU A;  2F2E A;  2LSO A;  2KJC A;  3SJM A;  2UXN A;  5HLT A;  3IRR A;  1LJ9 A;  1P92 A;  2Y0S N;  2VAS A;  3JRI A;  3GLX A;  3E0J B;  3IKV A;  1T33 A;  2Y2Z A;  3RQI A;  5ICG A;  4M72 A;  1VQ4 I;  4DOZ A;  2AO9 A;  3FIW A;  1STZ A;  2IA0 A;  2MC4 A;  3PNY A;  4LIU A;  1W36 C;  5J1U A;  4L5J A;  1FWZ A;  2PEX A;  2IAI A;  1OQY A;  3FKJ A;  4D5F A;  3V7C A;  1X1A A;  1ZRF A;  3ZPL A;  4KIS A;  3AFH A;  2DTR A;  1YHQ I;  1OYY A;  2LR8 A;  3AG2 H;  2EFQ A;  1FOX A;  1D3Y A;  3F8F A;  3GZ5 A;  4LB5 A;  3IV5 A;  5F27 A;  1QZY A;  3H5A A;  1IW7 F;  4CO8 A;  1J2X A;  2KIU A;  2OF7 A;  2K40 A;  4FHT A;  2HXI A;  4E7S A;  3BZ6 A;  2W84 A;  3GME A;  3ZQH A;  4XLA A;  1W1W E;  3H3U A;  1W0U A;  1YW8 A;  1ORK A;  3GFL A;  4YRV A;  2ESN A;  1IN7 A;  2OC6 A;  3QP5 A;  4CSW A;  3TDU C;  2PJR B;  2H1L A;  5GPA A;  2HOA A;  2LLK A;  4KYW A;  2R7Z J;  1P6R A;  2BY1 A;  4OOI A;  3K4J A;  3FDY A;  4HF0 A;  1UCR A;  1J09 A;  5IYC J;  2FSW A;  5EDN A;  5E1Z B;  4UVA A;  2G7H A;  1ONV A;  4FAS D;  1JE8 A;  2HS5 A;  2DJI A;  2BGC A;  3AG4 H;  1XMX A;  1AKH B;  2A5W A;  3OYH A;  1R22 A;  2CQN A;  2O3F A;  3B73 A;  4FIS A;  2STT A;  2VPL A;  1GDT A;  2EZI A;  4DYR A;  1Y8Q B;  3KZZ A;  2PI0 A;  2XGX A;  3ABL H;  4XLE A;  2DCE A;  5FB2 A;  5IP7 J;  3JRA A;  1MSF C;  3OSG A;  1FT9 A;  3VSK A;  1X2M A;  3OS2 A;  1H9T A;  3E6B A;  5DYM A;  3V42 A;  1FYM A;  3BR5 A;  3W6J B;  3HB9 A;  1T0F C;  2BW3 A;  2FD5 A;  3U9G A;  3J80 Z;  3JCU C;  1BBY A;  1B8I A;  4A3D J;  4EJT A;  4LLG F;  4P55 A;  3ZQ7 A;  4WK8 F;  1MBF A;  1WWX A;  4UB6 C;  3N97 A;  1LE8 B;  5E3O A;  1CGP A;  1TNS A;  3JRB A;  2QSH X;  3QOE A;  1FPQ A;  2O8K A;  3FZV A;  1P4W A;  3BT9 A;  4RGR A;  2CQQ A;  4C3I J;  3OYE A;  1O3S A;  2F6C A;  1I39 A;  3N4M A;  2ZCW A;  1UHM A;  1LFB A;  2LRE A;  4HX8 A;  2Z9O A;  2DMT A;  4PK4 A;  3HOU J;  1BIA A;  1UFM A;  2E7W A;  4EQQ A;  4DYC A;  6PAX A;  3A4C A;  3LAP A;  1RR8 C;  2JJ7 A;  3DEW A;  4EGZ A;  4ZYA A;  3GFI A;  2N8G A;  4IO9 F;  2V1N A;  4UUV A;  1QU3 A;  3ZMZ A;  1BW6 A;  2P6S A;  3LSG A;  3W2V A;  4AU7 A;  1TBX A;  5JR3 A;  1FBS A;  3HOW J;  3IWF A;  3H5N A;  3TP0 A;  1OCZ H;  3MEX A;  3HYI A;  4RB1 A;  2XAS A;  3VYT B;  1IJW C;  4U88 A;  1NHA A;  3R4K A;  4Q47 A;  2AQE A;  4UV9 A;  1WQ2 A;  1RET A;  2P6T A;  5DD8 A;  5D8K B;  1JUP A;  2EFP A;  4AWX B;  1O7F A;  3FXR A;  4KIB A;  5BQT A;  4IHS A;  3RKY A;  2VUM J;  4A3J J;  1F4K A;  2M30 A;  4M3F A;  3ASO H;  3S2W A;  1TC3 C;  1BJZ A;  1PP8 F;  1MJ9 A;  2XRN A;  5DM7 F;  4EGY A;  2FF4 A;  3A0H C;  3F3X A;  1YS7 A;  3WG7 H;  3IL2 A;  2H8R A;  1Y1W J;  4G12 A;  4DJA A;  2G9W A;  4F7Z A;  4A3E J;  3E6C C;  4LMY A;  5CVJ A;  2QF7 A;  5H6Q A;  1K7A A;  1IAW A;  3ZMU A;  2H8W A;  2V1D A;  2E1M C;  3F22 A;  3T0Y A;  5LHH A;  3BPX A;  3OS0 A;  3K70 D;  3I4M J;  2CW0 F;  4CCJ A;  2X4H A;  1K4T A;  2Y48 A;  3HL2 A;  1YS6 A;  3R0A A;  1C0W A;  3S2D J;  4JBA A;  2QYO A;  2JA8 J;  3HHG A;  1K4S A;  3ZQG A;  4MIM A;  2DA7 A;  2KDO A;  5ILS A;  4IOA F;  1XSX A;  3ELK A;  1B72 A;  1OR7 C;  4EMS A;  1N75 A;  1WJD A;  3J80 K;  4MFE A;  2JMW A;  3VFZ A;  2OU2 A;  5DTD A;  2XV4 S;  2WAQ A;  3BR2 A;  2C6Y A;  4OIP F;  1IZ1 A;  1KYZ A;  2DT6 A;  2R5Y A;  2KPM A;  3WTS C;  2K9N A;  5JLW A;  4B48 A;  2AXT C;  3ECH A;  2V9K A;  3OYL A;  2CFO A;  2K9L A;  1H9G A;  3IH2 A;  2CFX A;  4GXO A;  4QLC U;  1TWF J;  1FIP A;  2LKS A;  1XGS A;  4ZDP A;  4AIK A;  1B9M A;  2NRA C;  3RPU A;  1A35 A;  3RJP A;  1JI8 A;  2XPV A;  4L0Z B;  5DCM A;  1U8B A;  2H1K A;  2LF7 A;  4P96 A;  5CVU A;  2QQA A;  3N05 A;  3CCV I;  4OWR B;  2M1B A;  1GV5 A;  2CQX A;  3I9V 2;  1DP7 P;  3WGH A;  3KP7 A;  3DFG A;  2OPT A;  3C2H A;  3QPL A;  5CVV A;  3RZD J;  3LOC A;  1MMA A;  1YYV A;  2O61 A;  5F1J A;  3V4G A;  2P5V A;  3CTA A;  1P7J A;  2MC3 A;  2ZXJ A;  2P8T A;  3GYH X;  3IRQ A;  3HTU A;  3F6O A;  1LEA A;  3WGG A;  4XLP F;  2WB1 A;  3JRC A;  4B8X A;  1UG2 A;  3TQN A;  1YIO A;  4HLY A;  4P5O A;  3DWL E;  2R5Z A;  2QUF A;  2W00 A;  5HNH A;  2GWR A;  4RAZ A;  3RKQ A;  2Y9Z A;  3BJA A;  3VYR B;  3EYI A;  1RR7 A;  4LFU A;  3WE3 A;  4A3G J;  2YSR A;  2A69 F;  1Y0N A;  3HRU A;  4DYQ A;  2MG4 A;  2XSJ C;  3OIQ A;  1S72 I;  2VLA A;  4EJO A;  5JFR A;  2DPU A;  3C2G A;  4A3B J;  2OCE A;  4D7N A;  2QBY A;  3S8P A;  1JGG A;  1OPC A;  4XR6 A;  2CSO A;  3HM5 A;  1SD6 A;  3GTG J;  4BDZ A;  1BI3 A;  3ISP A;  2ZME C;  5LEJ A;  2QWW A;  4BXF A;  1TT5 B;  3CCU I;  3KFW X;  1ZGW A;  4ENN A;  4U0W A;  1ON2 A;  1WH7 A;  1NG6 A;  1MZB A;  2PMU A;  3RTR A;  1V55 H;  2WAE A;  3CMM A;  3OIP A;  3L9F A;  4I98 B;  3V8J A;  1XTA A;  1FMW A;  1BC7 C;  2E1C A;  3HOS A;  3F8B A;  4OAY A;  1FIA A;  1BW5 A;  2ECB A;  1S8N A;  3C7J A;  3WTX C;  4CCL A;  5K5R A;  1ZQ3 P;  2LRD A;  2XUB A;  2DYS H;  4KIC A;  1RZ4 A;  2FU4 A;  2JWT A;  2P5L C;  2X9D A;  2JA2 A;  4GCV A;  2CS3 A;  4AC0 A;  4P9U A;  3KEY A;  2XPW A;  2EFO A;  2ZB9 A;  2K7L A;  4U87 A;  3KYL A;  3GTP J;  2CYY A;  4W1U A;  1ETW A;  4GYI A;  2LF8 A;  5J8C A;  4RDU A;  3M8F A;  2HZT A;  2E7X A;  3DTI A;  3G6E I;  2VBX A;  1JHF A;  2A6H F;  5HLG A;  3LSP A;  1ZRC A;  3MMY B;  4FE4 A;  2DN0 A;  2W7N A;  4GRI A;  3I4N J;  3K69 A;  1LFU P;  3PQK A;  1JKP C;  1IXC A;  1H89 C;  1MW7 A;  2UV1 A;  4HQM A;  1E3H A;  2KIQ A;  5IP9 J;  2AS5 F;  1E0E A;  2XSD C;  1Y56 A;  1ZLK A;  2FNA A;  4JK1 X;  2O6G E;  3FM5 A;  2RGV A;  2DDA A;  5GAE J;  4MO7 A;  4LG3 A;  2DA4 A;  3LMM A;  3GX4 X;  1G3Y A;  4NUB A;  1VQ9 I;  2K4J A;  2Q2E A;  1E17 A;  1SMY F;  3PNT A;  1T98 A;  3QYB A;  3HOY J;  3FK7 A;  4FX4 A;  1FSE A;  1WVR A;  3CCE I;  2BOL A;  4GDF A;  5L3D A;  4E4H A;  1YG2 A;  5H20 A;  4CZZ A;  4RAF A;  4A5N A;  1UJ8 A;  2ZBK A;  3KPH A;  2F4I A;  2V1U A;  4BYY A;  2VL8 A;  1KGS A;  2EZK A;  3DTK A;  4MEY F;  1AKH A;  2LBF A;  4I2O A;  2MD5 A;  2OQG A;  1IUF A;  1CF7 A;  1YW7 A;  2ICW G;  2YX4 A;  3SEQ A;  1FOY A;  4M73 A;  2BW3 B;  2L9R A;  2DA5 A;  2ZFU A;  4XMY A;  3SYT A;  5LFA A;  2KZG A;  1MBK A;  2BYV E;  4E6K G;  1B8I B;  1SAU A;  5KAF C;  3NEU A;  1U9O A;  3DKW A;  1R7J A;  2L3D A;  3CJR B;  3K1P A;  5B3S H;  2FX0 A;  1ZRE A;  3A01 A;  1G2H A;  3CLO A;  5KVR A;  2YX7 A;  3DF8 A;  2BVL A;  1R1U A;  1FEX A;  4RB3 C;  4WWC A;  4ENJ A;  2P4W A;  3KE2 A;  1B6A A;  2FBI A;  2EIJ H;  5HOD A;  1J5Y A;  2I8D A;  4W97 A;  3GFJ A;  1WHU A;  3MQ0 A;  1A36 A;  1N77 A;  1IN6 A;  3BG3 A;  9ANT A;  4AUX A;  3ZQL A;  1I1S A;  4ZYE A;  2FEZ A;  3RDI A;  3DBH B;  2IVM A;  1T08 B;  2I5U A;  2M9H A;  2TCT A;  4RB2 C;  4ENK A;  4K2E A;  2VJI A;  2R7W A;  3A1Y A;  3E5X A;  1V5F A;  3ZP5 A;  4BQQ A;  2HVS A;  3CF2 A;  2EV6 A;  3K70 C;  1OCT C;  1Z91 A;  4XKB A;  2QQ8 A;  2FNP A;  3IP4 B;  2MGQ A;  2OBP A;  2L7F P;  2K9Q A;  5CQE A;  5GAD J;  1YIT I;  3L2Q A;  2M4G A;  1RI7 A;  2RKH A;  2R3S A;  1HCR A;  1HQC A;  2GXA A;  1VND A;  3CQZ J;  4JYK A;  1EJ9 A;  1FSH A;  1U5T C;  1XN7 A;  1KQ9 A;  4D7M A;  1BI1 A;  1T39 A;  3BZK A;  3HSF A;  2LTP A;  2CGP A;  4UVC A;  1X1D A;  3CUQ A;  4MTD A;  3A0B C;  3U1D A;  4LIT A;  1Z3Y A;  3TGN A;  3HOT A;  1VF9 A;  1ZG3 A;  1YI2 I;  2KKO A;  4I7H A;  2Z3Y A;  1WPK A;  1LVA A;  2WWY A;  2HOT A;  4Y4R A;  2RN7 A;  3U2R A;  5C4J J;  3JRG A;  1OCP A;  2PQ8 A;  5EZH A;  2DA2 A;  2IA2 A;  2GZW A;  2L54 A;  4XLN F;  2EWN A;  4EJU A;  4YIR X;  1T0F A;  1AHD P;  2O7O A;  2ZXI A;  3RQ4 A;  4IRI A;  1DPU A;  2DA3 A;  2PBI A;  2LC2 A;  2W24 A;  2NNN A;  4Y15 A;  1P2F A;  3BQY A;  1ZEL A;  3EUH C;  3E5U A;  3CJN A;  3DXJ F;  2ID3 A;  3HXL A;  5LGT A;  3WU2 C;  3BY6 A;  3I0T A;  2B9S A;  2VJJ A;  1SVM A;  3OV8 A;  1LB2 A;  2DAO A;  1XDU A;  4PFO A;  1B72 B;  3QYE A;  3SDG A;  3H0D A;  4R79 A;  3H36 A;  2O0Y A;  3E1S A;  1BL0 A;  1Z7L A;  3MVP A;  2IPQ X;  4MLO A;  3VOE A;  2KIS A;  4IL6 C;  1XGM A;  4E7K A;  2JA5 J;  3WTY C;  2E5Z A;  3S1R J;  3HRS A;  2R5Y B;  1YQA A;  3FXJ A;  5FFX A;  2D2W A;  3KZY A;  4AYB A;  4V2F A;  2F5E A;  4ENM A;  4CA0 A;  4HX4 A;  4M9X A;  3D1N I;  3E3V A;  2W48 A;  1FBQ A;  2XGD A;  3QU6 A;  4A3L J;  1QZZ A;  2V6E A;  4QTR A;  1MD0 A;  1EA3 A;  2ZNY A;  1J75 A;  5JI6 A;  4BE0 A;  1UHW A;  1ENH A;  3CCM I;  3CC4 I;  5CVI A;  2LY2 A;  3S17 J;  4UUS B;  2L4A A;  1SD7 A;  1MGT A;  4KA4 A;  2HQN A;  3BCB A;  4I99 C;  4BKX A;  4C3J J;  2CW8 A;  1V5G A;  2HYJ A;  3BG7 A;  4B3X A;  2X51 A;  3L2W A;  2FOW A;  3CC2 I;  5M5X J;  3D5S C;  1XPX A;  4KIF A;  4ABZ A;  1AA7 A;  1MH4 A;  1BI0 A;  2F5V A;  1BOB A;  2KRH A;  3WHB A;  2HTS A;  2XHK A;  3GTQ J;  3Q0U A;  3GWZ A;  3OYN A;  2EFW A;  2JVH A;  5FJ8 J;  1TP4 A;  3VB2 A;  3HOV J;  2RQQ A;  1F36 A;  3K4C A;  3J7Z I;  3FBN B;  2R7F A;  2HVR A;  2Q0O A;  2X1E A;  1SFE A;  3M9A A;  1GUU A;  1TWH J;  4UXN A;  3RKW A;  4CCO A;  4L5I A;  1U3E M;  1GXP A;  1HOM A;  2HQ5 A;  1R5I D;  1RES A;  3S3M A;  4HEA 2;  3RIR A;  4B47 A;  1ACI A;  2DOE A;  5LRS A;  3F72 A;  5J4Y A;  2IXS A;  5TIS C;  3ULQ B;  2QBY B;  2IGK A;  2H09 A;  3CLQ A;  2VON A;  2E19 A;  3VYS B;  4UB8 C;  4BXX J;  4OMZ A;  3GTO J;  5IT9 K;  3BR6 A;  1GLN A;  2EIK H;  2TRT A;  3CCJ I;  3AL0 C;  4IXA A;  3UNG C;  3TO9 A;  2IW5 A;  4P9F A;  1QVU A;  1RUO A;  4ETS A;  4RM3 A;  3C2B A;  1FLI A;  5CPR B;  3G2B A;  4G9Y A;  2WAD A;  1BR2 A;  2QKL B;  1OCO H;  1Y1V J;  2FJ1 A;  4RGU A;  4EV0 A;  5FRO A;  4UY8 I;  4GYG A;  2KHM A;  3OL4 A;  4CHU A;  2B63 J;  3HOZ J;  5BMZ A;  3ZQQ A;  1O3T A;  3PO3 J;  2KL4 A;  3RCO A;  1E3O C;  3TBI A;  2FA5 A;  2G0E A;  3DU6 A;  1I3Q J;  2MW8 A;  3W3C A;  2HGC A;  4AID A;  3GVA A;  2O9L A;  1M1E B;  1Y0U A;  3PSI A;  1JUS A;  3TW7 A;  1D5V A;  3BTJ A;  1PUF A;  1K78 A;  5E3N A;  2W4S A;  3GUD A;  4XOR A;  3IH3 A;  4O3M A;  4M71 A;  1WZ2 A;  3SFI A;  4A3M J;  1IRG A;  2BXY A;  3SZP A;  5HOO A;  5DM6 F;  3JR9 A;  4OIO F;  1W5S A;  4A3I J;  3ZR8 X;  2P7C B;  3GTK J;  1S9H A;  4HV5 A;  3HPH A;  3B6C A;  4E7I A;  2LY1 A;  2PFB A;  2IT0 A;  4B4C A;  5HS8 A;  1X58 A;  2LMD A;  1IV8 A;  5D6E A;  2BY0 A;  3GF2 A;  4L18 B;  5FD5 A;  1LUJ B;  2E1O A;  4UHT A;  3DEE A;  2CQK A;  4Q5S F;  3ZCO A;  1R4N B;  2IA1 A;  2DT5 A;  2JUG A;  2E35 A;  3TED A;  5FKN A;  2Z99 A;  3DKX A;  2Q2E B;  3S14 J;  1AOY A;  4RAY A;  4KMU X;  2F5F A;  4AIJ A;  3MWM A;  3PM1 A;  2NOJ B;  3FXM A;  2A07 F;  2X85 A;  3EET A;  4Q4Z F;  4XK4 A;  3LWF A;  2FQ4 A;  4RMN A;  1REP C;  2HOE A;  2STW A;  2M4K A;  2X6O A;  2Q1Z B;  4I0B A;  4A6E A;  4CCM A;  3S93 A;  4WF2 A;  1DPR A;  2LBF B;  3QQA A;  3CCY A;  1OYI A;  1CF7 B;  4WX9 A;  1BM9 A;  2XB5 A;  2L5Q A;  5L3B A;  3CMY A;  3LSH A;  2VC1 A;  2AQF A;  4A0Y A;  5K5O A;  4XSX F;  2IJL A;  2X6Y A;  1IV6 A;  3RZO J;  3BCA A;  2V79 A;  2UXX A;  3OIO A;  3A01 B;  3FXU A;  4IRH A;  3BOQ A;  4H0E A;  3OSF A;  2ELK A;  3RYP A;  4MQV A;  1MMD A;  4U7B A;  1YTY A;  4ON0 A;  3TOB A;  1SAN A;  1JTY A;  2X1D A;  5C4X J;  4C2M J;  3K2Z A;  3ABM H;  2IGO A;  3FMS A;  2L9N A;  4B3A A;  4Y7N J;  3I3L A;  4C3H J;  2ISZ A;  1UHS A;  2M0M A;  2K85 A;  3HTS B;  3PQJ A;  3EPZ A;  3SDB A;  5M5Y J;  1VQL I;  2BHZ A;  1UST A;  1IO2 A;  2A61 A;  5E1W A;  1PJR A;  3H35 A;  1FP2 A;  2PMH A;  4M6Y A;  1XB4 A;  4P1W A;  2DMP A;  5K7H A;  1T38 A;  3IAS 2;  1HDD C;  3NWS A;  1OIS A;  1N78 A;  2Y30 A;  2LFB A;  4JOM A;  2A6E F;  3HOX J;  5CVR A;  1FOW A;  1X3W B;  2M34 A;  5J1Y A;  4UNO A;  1Z0X A;  2W82 A;  3CUQ B;  3HUG A;  2O8X A;  1QBJ A;  1P7I A;  2TDX A;  1R5H A;  3ML6 A;  3E97 A;  2L9S A;  2ZNZ A;  2L0K A;  4XLC A;  1W7P A;  1HXD A;  4XON A;  2VJ5 A;  3O6B B;  1VQO I;  5E1X A;  3OWT A;  4LGW A;  1USS A;  4PJM A;  5KAI C;  3FHN A;  2H27 A;  2VT2 A;  5A2Q Z;  5J47 A;  4BHB A;  4NDL A;  3GFM A;  1YJN I;  2QM3 A;  3ESW B;  3HHH A;  2NNY A;  3HKZ A;  4BXU A;  2ME0 A;  1SD4 A;  1XSV A;  4IEJ A;  5ICF A;  4YFX F;  4HF1 A;  3LFU A;  1G59 A;  4FTH A;  4I6Z A;  1WH5 A;  3S3O A;  1YJ9 I;  2BEO A;  1D0Y A;  1HBX G;  3IWZ A;  5J1R A;  5TRD A;  2VQG A;  2VPR A;  1ZHF A;  2XAG A;  2KLO A;  3GBG A;  3IH4 A;  5HDN A;  2FUG 2;  2Z33 A;  2P5K A;  2VI6 A;  2JRT A;  2OV7 A;  4BH9 A;  1GXQ A;  2AHQ A;  3DTE A;  4MGR A;  4Y52 J;  3TO7 A;  3I71 A;  3J81 Z;  3DLL F;  3CDI A;  3OYF A;  5FD6 A;  1LDD A;  2LK2 A;  4B44 A;  3O2P E;  1W4M A;  2M5W A;  1W5C C;  1KZH A;  1O4X A;  4ZC3 A;  3GLL A;  3O8G A;  2VC0 A;  1R23 A;  2J5P A;  3UKG A;  4A93 J;  2LDU A;  3QWL A;  2DOA A;  2FE3 A;  2HU9 A;  3LQQ A;  4E70 A;  4CGZ A;  1Y6I A;  2NS7 A;  1DGW Y;  3F0C A;  2VB6 A;  4YII A;  3L09 A;  1NG7 A;  2WY7 Q;  3K7A J;  1A31 A;  1DDN A;  2EH3 A;  4L9T A;  1ETX A;  1P9Q C;  5DD4 A;  3BG5 A;  1IXR C;  2JSC A;  3CME I;  1GHC A;  2KT0 A;  2RC4 A;  2KRF A;  1DU6 A;  3E6D A;  1I5Z A;  4IQJ A;  4YFK F;  2K86 A;  1MMN A;  3RPU D;  3ZOB A;  3H9Q A;  1ETY A;  1U5T A;  1Y8R B;  4DBR A;  1QRY A;  2DDB A;  4U0Y A;  3CCL I;  1WJ5 A;  3BQZ A;  4XN0 A;  3WTU C;  4HA8 A;  2WTE A;  4UUS A;  1T8I A;  1IXS B;  1XDS A;  2CW7 A;  1ETQ A;  2F5C A;  5LHI A;  2EQR A;  2CJJ A;  2VOD A;  1BA5 A;  3PIO F;  2ZJQ F;  1S5L C;  2PLY A;  4XRF A;  1WCM J;  3DKY A;  3CJT B;  4EJW A;  2I10 A;  1IDY A;  4DZJ A;  2E1M B;  3QU3 A;  5FO5 A;  1TQP A;  5BPI A;  1X3Z B;  2K9S A;  2KIM A;  3G73 A;  1DU0 A;  1JKQ C;  2NVX J;  5TGT A;  4MQ9 F;  4G7Z F;  1FX7 A;  2JN6 A;  3V8L A;  1MBJ A;  3SZT A;  3L2C A;  3MKZ A;  3Q0V A;  3M07 A;  5H6R A;  5B1A H;  3S16 J;  1G3W A;  4F93 B;  2ZC2 A;  5J40 A;  4NC7 A;  1R6R A;  2R7U A;  3KP5 A;  4II3 A;  3I56 I;  2DA6 A;  4LLN A;  1JGS A;  3BRO A;  4PDK A;  3QOP A;  2QSG X;  4Y13 A;  1TLH B;  2ESH A;  3TP3 A;  2F4O B;  2DOF A;  1HW5 A;  1W0T A;  3HC7 A;  5DS9 A;  3OYA A;  4HLX A;  1IG7 A;  2CV0 A;  1J9I A;  1U6G A;  3A03 A;  1PDN C;  4RBO A;  5DUK A;  3U21 A;  2V7F A;  3K1N A;  1AWC A;  1Z21 A;  1OYW A;  3KCC A;  4ASN A;  1Z6R A;  1OCC H;  2Y69 H;  5D5X B;  2YU9 J;  4HNT A;  1B4A A;  1TT0 A;  1QHH D;  2HI3 A;  3DPU A;  1YW9 A;  4E7Z A;  1IRF A;  2ZJP F;  1FMV A;  5E3M A;  1MBG A;  1BJA A;  2MLK A;  4XQF A;  3K4N A;  3G3Z A;  4IRG A;  2Z2S B;  1J7K A;  4C2T A;  3IKT A;  4U7D A;  4AVP A;  2P7V B;  3MD2 A;  2PG4 A;  2FOK A;  1NK2 P;  5FKL A;  3DBL B;  4IKF A;  1HA8 A;  3BC8 A;  5EGO A;  1PUF B;  3T8T A;  1K78 B;  2DK5 A;  4E7H A;  3F8C A;  1WSU A;  2ID6 A;  3LSJ A;  3OR2 C;  4D1Q A;  3HIF A;  4YEL A;  3C3W A;  3F21 A;  4L0Y B;  1S7O A;  1YO5 C;  1GVD A;  1U9N A;  3MKL A;  3S15 J;  2OAZ A;  2UWM A;  2GA1 A;  1SD5 A;  4XOT A;  1IRX A;  1KU9 A;  2DQL A;  3M4O J;  4PCQ A;  2Y0S A;  1Y39 A;  3KP2 A;  3X2Q H;  3L2R A;  2LD5 A;  5BOX A;  4N9I A;  5HNF A;  4KN4 X;  4LG0 A;  1J0R A;  2JUC A;  4XRS G;  1ZRD A;  4M3B A;  2RNG A;  3TL4 X;  2QQ9 A;  2HWV A;  5K7Z A;  1BIB A;  4RB0 A;  3PL8 A;  3I4P A;  1X4O A;  3K6G A;  3BP8 A;  4LLL A;  5DUI A;  3AG1 H;  2CU7 A;  2VE9 A;  1S6L A;  1SVO A;  2EJR A;  4BY7 J;  1IGN A;  3J7A O;  3PO2 J;  5LRR A;  5EEH A;  4MTE A;  2LOO A;  3MKY B;  3G4S I;  2ZME B;  4WCG A;  2D1V A;  3PUF A;  1B9N A;  1I3A A;  2XAH A;  2EIN H;  4BJ6 C;  1LKX A;  2IP2 A;  5K5Q A;  2GAU A;  1FYK A;  2X48 A;  2JSP A;  4QSH A;  1H88 C;  3LSM A;  4R1H A;  3KEQ A;  2M8E A;  3K2A A;  1IRZ A;  1KQ8 A;  5D8L B;  2L7M P;  3FM3 A;  3E7L A;  2K3F A;  1TW3 A;  4HYE A;  2MD0 A;  5HDG A;  1OCR H;  2FBH A;  4AIH A;  4ZH4 F;  2M8G X;  3FXO A;  4X1E A;  4Z2Y A;  1VQN I;  3HSR A;  1UMQ A;  3L00 A;  3D5R C;  3F9K A;  4HF2 A;  1APL C;  4GGG A;  2M45 A;  3MN2 A;  3C18 A;  1A04 A;  1KU7 A;  1ULY A;  3CJQ B;  2VKD A;  3LL7 A;  1XCV A;  1FBU A;  4YEJ A;  2HYG D;  4F91 B;  2MAB A;  2WY8 Q;  5AIP A;  3JRE A;  3I5U A;  4HDV A;  5L3E A;  4BDY A;  1D5Y A;  1Q1H A;  4EEF G;  5FLV A;  1XSD A;  2R92 J;  3OYC A;  4M9Z A;  4PSX A;  3QPT A;  2D1H A;  2H94 A;  3W2A A;  3K4K A;  3MCZ A;  3ZXS A;  4LIV A;  2E71 A;  4BQO A;  1QZE A;  3P7N A;  5EF6 A;  2EA4 A;  2WV0 A;  1T2K A;  3ZQC A;  2XRL A;  2CUF A;  1ZK8 A;  2NAZ A;  2RQP A;  4KJZ A;  1LDK B;  1K79 A;  2ECC A;  3H92 A;  2XGE A;  3HUG B;  2E60 A;  5E8I A;  1YLF A;  1A6I A;  1N25 A;  3TW6 A;  1TWA J;  2L7K A;  2DQR A;  2QVO A;  4GO1 A;  5EG0 A;  1FP1 D;  3S3N A;  3K9T A;  2Q8K A;  1W7P B;  4ZZL A;  3S1M J;  5F6F A;  1I50 J;  2VN2 A;  2XDV A;  3OOU A;  3WHC A;  2FMY A;  5L3G A;  1ZG1 A;  2YR2 A;  3ZMD A;  4CYC A;  2CUZ A;  4G94 A;  2KP6 A;  2XAU A;  2LH9 A;  1VQ5 I;  5GTH C;  3HDD A;  2JZY A;  4HQE A;  4JX4 A;  3AAF A;  2OZU A;  4BBR J;  2ZO4 A;  3KYD B;  1ZYR F;  1SC7 A;  2MA3 A;  5B1B H;  4S0H B;  1HKT A;  3DBR B;  4Y33 A;  3G1M A;  2IS2 A;  1HKS A;  5GAG J;  4IQ4 A;  2JTV A;  4MFD A;  2DT7 B;  5ICC A;  4AVZ A;  5CQG A;  5HVQ C;  4H4K C;  4BGD A;  4B1R A;  4BQA A;  3LNQ A;  3PFI A;  4I09 A;  3CMA I;  3RI4 A;  1R9T J;  2ELJ A;  5K1Y A;  3I58 A;  1R36 A;  3OYD A;  3OMY A;  1K83 J;  2R0Q C;  2RNJ A;  3F6V A;  3CCR I;  1D8K A;  1XX5 A;  3PSF A;  1MNM C;  3ROU A;  2OTJ I;  1E3P A;  3HEF A;  2QEX I;  3RPQ A;  1P4A A;  3OYM A;  2UZK A;  1ITY A;  2DXI A;  3COA C;  1V54 H;  4D9J A;  5J6X A;  1B1B A;  4HZF A;  4LK1 F;  3CF5 F;  3Q0W A;  5DDG A;  1I6H J;  2K02 A;  1XGO A;  3NAR A;  2XGC A;  4HRI A;  3QYF A;  3EYY A;  4C9Y A;  1TWC J;  1ZAO A;  3OOP A;  2FXA A;  2V9V A;  1U5T B;  4M6X A;  2QA4 I;  2QSF X;  3JAM Z;  4A12 A;  4CUG A;  2WBM A;  3I59 A;  3T5X A;  2VKE A;  4HST A;  2LY9 A;  3W6V A;  2VBY A;  2F4M B;  2PN6 A;  2NXN B;  2EB7 A;  3L2V A;  2DW4 A;  2L2O A;  4HW0 A;  3F23 A;  3T8R A;  1D1C A;  4KNY A;  5B5E C;  1MSE C;  1WJF A;  3WTV C;  3I55 I;  1MJA A;  1LDJ A;  2HR3 A;  1X19 A;  2MBF A;  2VT3 A;  5LHG A;  1X3U A;  3H3Z A;  4M6V A;  4RM2 A;  4S04 A;  1H8A C;  2XF6 A;  2IBD A;  2HVQ A; 
#chains in the Genus database with same CATH homology
 4NB5 A;  2V6C A;  5BPD A;  1RIO H;  1OMI A;  3GW2 A;  2K4B A;  2RVC A;  4BNC A;  4CXF A;  4RS8 A;  3V8K A;  1TW2 A;  2IRF G;  3QAH A;  3EQL F;  1O3Q A;  1OR7 A;  2QLZ A;  4UVB A;  3R0J A;  1F1Z A;  4ZZD A;  1KU2 A;  2EK5 A;  2GQQ A;  2YPR A;  1L0O C;  2RV8 A;  4G6Q A;  3I54 A;  2EV5 A;  4M74 A;  2KIF A;  5CJ9 A;  1IN5 A;  2ZJ2 A;  2MH2 A;  3KET A;  4O6J A;  1I1G A;  5DEQ A;  4N9H A;  1JHH A;  3HRM A;  3ZN1 A;  1Z9C A;  1BI2 A;  2JPC A;  1PP7 U;  2Y75 A;  1U78 A;  4ZYG A;  2CWE A;  3JAM K;  1R5G A;  3QP6 A;  1ZG5 A;  2LNB A;  5EEG A;  5BS6 A;  2O03 A;  4LG0 B;  2OQR A;  4WXD A;  1EV7 A;  4I01 A;  1S7A A;  4B09 A;  1DUX C;  4OU0 A;  1U2W A;  3QPH A;  1V4R A;  1ZGJ A;  4Q48 A;  3DP7 A;  2X0L A;  2VBZ A;  3TOA A;  3E5Q A;  1ZH5 A;  4CYD A;  5LBQ A;  1BN5 A;  3FX3 A;  4KIG A;  2ZME A;  4D0P A;  3ZMT A;  5LGU A;  3ERE D;  3VEP A;  3R61 A;  3SXY A;  4R8H A;  4QWQ A;  3WGI A;  5DV5 A;  3REO A;  5FGM A;  5IT3 A;  4JQF A;  4KMF A;  1Z6T A;  2MLG A;  3LA2 A;  1WKM A;  5F64 A;  2GXG A;  1KQ0 A;  5HS7 A;  3BJO A;  3R6S A;  1RNL A;  3C1D A;  5AIQ A;  1G3T A;  3CUQ C;  5ED4 A;  1GVJ A;  3WG9 A;  4M9S A;  3Q9V A;  2DFI A;  1XD7 A;  1L3L A;  5HDK A;  3MFK A;  1FZP B;  2AXL A;  3KEO A;  2NS0 A;  4CIC A;  5D5V B;  2A5Y B;  2A3S A;  3V7R A;  3ZN0 A;  2HFH A;  4ESB A;  1E2X A;  2GIV A;  4ESF A;  3TDZ C;  2VBW A;  1EH6 A;  4RGS A;  1G3S A;  1R58 A;  5D4R A;  3KP6 A;  1W7P D;  1I6X A;  5HLH A;  1ZLJ A;  3WTT C;  4I02 A;  4KFC A;  2PJP A;  4IVN A;  3JTG A;  4YIF A;  3ZMV A;  4O5V A;  1TTY A;  3O3K A;  3Q9S A;  3DPL C;  1BC8 C;  2HDC A;  3KP4 A;  3JSO A;  1QO0 D;  2JPB A;  4HOB A;  3CDH A;  3TKY A;  5E18 F;  3GXO A;  5J8F A;  3P9K A;  2QQB A;  2K27 A;  3F8N A;  5ILV A;  2ELH A;  4LD5 A;  4U0V A;  3FWE A;  3I59 B;  3BPV A;  1LEB A;  3FXQ A;  5LEK A;  3P9C A;  3WOD F;  1SFX A;  5E20 A;  4PZJ A;  4A0X A;  1FNN A;  4ESJ A;  1T6S A;  1XMA A;  3NRV A;  1FOK A;  4UV8 A;  4G7O F;  2VOP A;  3FHZ A;  2RDP A;  5TJJ A;  4A2U A;  3GEZ A;  3CO6 C;  2XAJ A;  5FFZ A;  5HS9 A;  5CYV A;  1XCB A;  2XIG A;  3LST A;  4PGG A;  4OMY A;  5DCF A;  3HSE A;  3KLN A;  3ABU A;  4EJV A;  3EUH A;  4G8X A;  2V1X A;  2XKP A;  1B59 A;  3JTH A;  2VXZ A;  4A6D A;  3HRT A;  4NHJ A;  2ZKZ A;  3SQN A;  1MDM A;  1IN8 A;  4XSZ F;  3WU1 B;  2DPD A;  2J5O A;  3FMR A;  2H6C A;  5A2Q K;  1HKQ A;  4NQW A;  1R1T A;  4OIR F;  2HYF A;  4G6D A;  4LK0 F;  5ILU A;  4WXC A;  1F5T A;  1ON1 A;  3KLO A;  4FX0 A;  3WTZ A;  3BJ6 A;  4KN7 X;  4EM2 A;  2DLL A;  3FMQ A;  4EM0 B;  5LGN A;  3J81 K;  4IF4 A;  4DQ2 A;  3LAJ A;  2NYX A;  3LQR A;  1FC3 A;  2ETH A;  1ZGA A;  4LJZ F;  3LA3 A;  3DEU A;  1LNW A;  5JHU A;  1SAX A;  1FYL A;  2XAQ A;  2FBK A;  2ZFW A;  4YG2 F;  2DO7 A;  2M87 A;  2DBB A;  1I27 A;  3T1B A;  1XMK A;  1Z05 A;  4I0A A;  3DPT A;  2OD5 A;  4IHT A;  3E6M A;  3BDD A;  3ECO A;  1EH7 A;  4MHG A;  5ICE A;  1JXS A;  3I64 A;  1HSJ A;  2DK8 A;  1VTN C;  2ADU A;  3P9I A;  5D4S A;  1G6N A;  3W6K B;  1MJB A;  4HV6 A;  4MNU A;  2ACJ A;  1SMT A;  5FLX Z;  2FRH A;  2VE8 A;  2HEO A;  1TQM A;  4N0B A;  5D6F A;  3M8E A;  1W5T A;  1QGP A;  5L3F A;  2XRO A;  3Q5F A;  3WTW C;  3M7G A;  1TQI A;  2EFN A;  2HKX A;  3VOD A;  2W25 A;  4G7H F;  4HDU A;  2BBY A;  3WU0 A;  4PGH A;  2VOO A;  2ISY A;  5E8G A;  1IUY A;  3MZY A;  4TV7 A;  3KP3 A;  3BWG A;  3CO7 C;  2L01 A;  2OA4 A;  1QQI A;  4AD9 A;  2XAF A;  1HST A;  1ODD A;  3DV8 A;  4HX7 A;  3ABT A;  4OIQ F;  2H6B A;  1BOA A;  3TO6 A;  1MKM A;  4KDP A;  1UB9 A;  2COM A;  3FF5 A;  2YU3 A;  2CO5 A;  3D0S A;  5CLS A;  1SFU A;  1U8R A;  2Y0M A;  2KJB A;  1HW1 A;  4A5M A;  5F1R A;  1P4X A;  3K0L A;  4ZYH A;  2DI3 A;  3IHU A;  1Z7U A;  3R60 A;  1KA8 A;  5FLX K;  5AON A;  4BHC A;  1QPM A;  4KT5 C;  1IF1 A;  4L9N A;  1RUN A;  4ZYD A;  4DNC A;  5L3C A;  2MH9 A;  3CUO A;  4BAY A;  1EH8 A;  1OKR A;  4HBL A;  2HTJ A;  2XKO A;  1LQ1 A;  1S3J A;  5LLQ A;  2FQ3 A;  1KYW A;  5IT9 Z;  1G4D A;  1FY7 A;  1IN4 A;  5HLI A;  3I53 A;  4EVI A;  3IC7 A;  4L9J A;  3V7S A;  1KU3 A;  3QRF F;  3ZMS A;  3GZ6 A;  2GXB A;  1WRJ A;  2L4M A;  1QNT A;  3L7W A;  2XVC A;  2WC2 A;  4XBF A;  5D5U B;  1K6O A;  3WE2 A;  3LA7 A;  4L9V A;  4IPA A;  1D8J A;  1R00 A;  1V3F A;  2HKO A;  4KUM A;  3B02 A;  3EDP A;  1Z1D A;  3JSP A;  3JW4 A;  2L02 A;  3SHF A;  4BHP A;  4A0Z A;  2Z5U A;  1J59 A;  2B0L A;  4HAM A;  1PUE E;  3GO5 A;  2EA2 A;  1O7L A;  5D5W B;  1O57 A;  2JT1 A;  4WXH A;  5DCM B;  2F5D A;  2GA2 A;  4CDG A;  3SFZ A;  4OIN F;  2E1N A;  2W57 A;  1YFH A;  1MDM B;  3D5L A;  2DU9 A;  1XGN A;  5E17 F;  3MZH A;  2QEN A;  2A68 F;  4EM1 A;  2R7D A;  2HQR A;  2LKP A;  4FT8 A;  3RKX A;  3DQV C;  1ZN2 A;  1O3R A;  3M1E A;  2QZ8 A;  3K1M A;  1H0M A;  5JVT A;  4RGX A;  5KK1 A;  3F8M A;  2G7U A;  3LFK A;  1F9N A;  2D45 A;  2W85 A;  4S05 A;  4MEX F;  2BE5 F;  2OZ6 A;  1WI9 A;  2EV0 A;  4YFN F;  1HW2 A;  3NQO A;  2BV6 A;  3RYR A;  2FML A;  1S29 A;  1ZAR A;  3MAJ A;  5ERI A;  4LB6 B;  1R1V A;  4Y17 A;  1TNT A;  4IJA A;  2CG4 A;  2F2E A;  2LSO A;  2KJC A;  2UXN A;  3IRR A;  1LJ9 A;  1P92 A;  3GLX A;  3IKV A;  5ICG A;  4M72 A;  1STZ A;  2IA0 A;  4L5J A;  1FWZ A;  2PEX A;  3V7C A;  1ZRF A;  3ZPL A;  2DTR A;  1OYY A;  2EFQ A;  1D3Y A;  3F8F A;  3GZ5 A;  4LB5 A;  1QZY A;  1IW7 F;  4CO8 A;  1J2X A;  2KIU A;  4FHT A;  3BZ6 A;  2W84 A;  3H3U A;  1YW8 A;  3GFL A;  2ESN A;  1IN7 A;  3QP5 A;  3TDU C;  4KYW A;  1P6R A;  4OOI A;  4HF0 A;  1UCR A;  2FSW A;  5E1Z B;  4UVA A;  2G7H A;  1ONV A;  1JE8 A;  2HS5 A;  2BGC A;  1R22 A;  2O3F A;  3B73 A;  2STT A;  3KZZ A;  2PI0 A;  2XGX A;  5FB2 A;  1FT9 A;  1H9T A;  3E6B A;  5DYM A;  1FYM A;  3W6J B;  3U9G A;  3J80 Z;  1BBY A;  4EJT A;  4LLG F;  4P55 A;  3ZQ7 A;  4WK8 F;  1WWX A;  3N97 A;  1CGP A;  1TNS A;  1FPQ A;  3FZV A;  1P4W A;  4RGR A;  1O3S A;  3N4M A;  2ZCW A;  1UHM A;  4HX8 A;  2Z9O A;  1BIA A;  1UFM A;  2E7W A;  4EQQ A;  6PAX A;  3LAP A;  4EGZ A;  3GFI A;  4UUV A;  3ZMZ A;  2P6S A;  1TBX A;  5JR3 A;  1FBS A;  3IWF A;  3MEX A;  3HYI A;  4RB1 A;  2XAS A;  4U88 A;  1NHA A;  3R4K A;  4Q47 A;  4UV9 A;  1WQ2 A;  2P6T A;  5DD8 A;  5D8K B;  2EFP A;  4AWX B;  1O7F A;  3FXR A;  4KIB A;  5BQT A;  4IHS A;  3RKY A;  1F4K A;  2M30 A;  3S2W A;  1PP8 F;  1MJ9 A;  2XRN A;  4EGY A;  2FF4 A;  3F3X A;  1YS7 A;  3IL2 A;  2G9W A;  4F7Z A;  3E6C C;  4LMY A;  5CVJ A;  5H6Q A;  1K7A A;  1IAW A;  3ZMU A;  2V1D A;  3F22 A;  3T0Y A;  5LHH A;  3BPX A;  2CW0 F;  2X4H A;  2Y48 A;  1C0W A;  1YS6 A;  3R0A A;  4JBA A;  2QYO A;  3HHG A;  5ILS A;  1XSX A;  3ELK A;  4EMS A;  3J80 K;  3VFZ A;  2OU2 A;  2XV4 S;  2C6Y A;  4OIP F;  1IZ1 A;  1KYZ A;  3WTS C;  3ECH A;  1H9G A;  2CFX A;  4GXO A;  4QLC U;  4AIK A;  1XGS A;  1B9M A;  2NRA C;  3RPU A;  3RJP A;  4L0Z B;  5DCM A;  2LF7 A;  4P96 A;  5CVU A;  2QQA A;  2M1B A;  1DP7 P;  3WGH A;  3KP7 A;  3DFG A;  5CVV A;  1YYV A;  2O61 A;  3V4G A;  2P5V A;  3CTA A;  2MC3 A;  2ZXJ A;  2P8T A;  3GYH X;  3IRQ A;  3HTU A;  3F6O A;  1LEA A;  3WGG A;  4XLP F;  4B8X A;  3TQN A;  1YIO A;  4HLY A;  4P5O A;  2QUF A;  2GWR A;  4RAZ A;  3BJA A;  3EYI A;  4LFU A;  3WE3 A;  2YSR A;  2A69 F;  3HRU A;  4EJO A;  5JFR A;  2DPU A;  2QBY A;  1OPC A;  2CSO A;  1SD6 A;  1BI3 A;  3ISP A;  5LEJ A;  2QWW A;  3KFW X;  4ENN A;  4U0W A;  1ON2 A;  1MZB A;  2PMU A;  3RTR A;  3L9F A;  4I98 B;  3V8J A;  1BC7 C;  2E1C A;  3HOS A;  3F8B A;  1S8N A;  3C7J A;  3WTX C;  5K5R A;  2XUB A;  4KIC A;  1RZ4 A;  2FU4 A;  2P5L C;  4GCV A;  4P9U A;  2EFO A;  2K7L A;  2CYY A;  4GYI A;  2LF8 A;  5J8C A;  3M8F A;  2HZT A;  2E7X A;  2VBX A;  1JHF A;  2A6H F;  5HLG A;  1ZRC A;  3K69 A;  3PQK A;  1IXC A;  4HQM A;  2AS5 F;  1ZLK A;  2FNA A;  4JK1 X;  2O6G E;  3FM5 A;  2RGV A;  3GX4 X;  1G3Y A;  2K4J A;  2Q2E A;  1E17 A;  1SMY F;  1T98 A;  4FX4 A;  1FSE A;  5L3D A;  1YG2 A;  5H20 A;  4CZZ A;  4A5N A;  2ZBK A;  2V1U A;  4BYY A;  1KGS A;  4MEY F;  4I2O A;  2MD5 A;  2OQG A;  1CF7 A;  1YW7 A;  2YX4 A;  4M73 A;  2BYV E;  3NEU A;  3DKW A;  3K1P A;  1R7J A;  2L3D A;  1ZRE A;  3CLO A;  5KVR A;  2YX7 A;  3DF8 A;  1R1U A;  4RB3 C;  4WWC A;  4ENJ A;  2P4W A;  3KE2 A;  1B6A A;  2FBI A;  1J5Y A;  3GFJ A;  3MQ0 A;  1IN6 A;  1I1S A;  4ZYE A;  2FEZ A;  3RDI A;  2IVM A;  4RB2 C;  4ENK A;  4K2E A;  3E5X A;  3ZP5 A;  2EV6 A;  1Z91 A;  2FNP A;  2OBP A;  1RI7 A;  2RKH A;  2R3S A;  1HQC A;  1FSH A;  1U5T C;  1XN7 A;  1KQ9 A;  1T39 A;  1BI1 A;  3HSF A;  2CGP A;  4UVC A;  3CUQ A;  4MTD A;  3U1D A;  3TGN A;  3HOT A;  1ZG3 A;  2KKO A;  4I7H A;  2Z3Y A;  1LVA A;  2WWY A;  2RN7 A;  3U2R A;  2PQ8 A;  2L54 A;  2IA2 A;  2GZW A;  4XLN F;  4EJU A;  2EWN A;  1T0F A;  4IRI A;  1DPU A;  2PBI A;  2W24 A;  2NNN A;  4Y15 A;  1P2F A;  3E5U A;  3CJN A;  3DXJ F;  5LGT A;  3BY6 A;  3I0T A;  3OV8 A;  1LB2 A;  2DAO A;  1XDU A;  4R79 A;  2O0Y A;  2IPQ X;  3VOE A;  1XGM A;  3WTY C;  3HRS A;  1YQA A;  5FFX A;  2D2W A;  3KZY A;  2F5E A;  4HX4 A;  4M9X A;  3E3V A;  1FBQ A;  3QU6 A;  1QZZ A;  1MD0 A;  2ZNY A;  1J75 A;  5JI6 A;  1UHW A;  5CVI A;  2L4A A;  1SD7 A;  1MGT A;  4KA4 A;  2HQN A;  4KIF A;  1BI0 A;  2HTS A;  2XHK A;  3GWZ A;  2EFW A;  3VB2 A;  2R7F A;  2Q0O A;  1SFE A;  3M9A A;  4UXN A;  3RKW A;  1U3E M;  4L5I A;  1GXP A;  3RIR A;  5LRS A;  3F72 A;  3ULQ B;  2QBY B;  2H09 A;  2VON A;  4OMZ A;  5IT9 K;  4IXA A;  3TO9 A;  2IW5 A;  4P9F A;  1RUO A;  4ETS A;  1FLI A;  4G9Y A;  4RGU A;  4EV0 A;  4GYG A;  4CHU A;  5BMZ A;  1O3T A;  2FA5 A;  2HGC A;  3GVA A;  1Y0U A;  1D5V A;  1K78 A;  3GUD A;  4O3M A;  4M71 A;  1IRG A;  3SZP A;  5HOO A;  4OIO F;  1W5S A;  2P7C B;  4HV5 A;  2PFB A;  2IT0 A;  5HS8 A;  5D6E A;  3GF2 A;  4L18 B;  5FD5 A;  4UHT A;  2CQK A;  4Q5S F;  2IA1 A;  2DT5 A;  2Z99 A;  1AOY A;  4RAY A;  4KMU X;  2F5F A;  4AIJ A;  3MWM A;  2A07 F;  3EET A;  4Q4Z F;  3LWF A;  1REP C;  2HOE A;  2STW A;  4I0B A;  4A6E A;  4WF2 A;  1DPR A;  1OYI A;  1CF7 B;  4WX9 A;  1BM9 A;  5L3B A;  2VC1 A;  4A0Y A;  5K5O A;  4XSX F;  2IJL A;  2V79 A;  2UXX A;  3FXU A;  4IRH A;  3BOQ A;  4H0E A;  3RYP A;  4MQV A;  4U7B A;  1YTY A;  4ON0 A;  3TOB A;  3K2Z A;  3FMS A;  2ISZ A;  3HTS B;  3PQJ A;  1UST A;  5E1W A;  2A61 A;  1FP2 A;  2PMH A;  4M6Y A;  1XB4 A;  1T38 A;  2A6E F;  5CVR A;  4UNO A;  3CUQ B;  3HUG A;  2O8X A;  1QBJ A;  2TDX A;  1R5H A;  3ML6 A;  3E97 A;  2ZNZ A;  1W7P A;  1HXD A;  3O6B B;  5E1X A;  4LGW A;  1USS A;  2H27 A;  2VT2 A;  5A2Q Z;  4BHB A;  3GFM A;  2QM3 A;  3HHH A;  2NNY A;  4BXU A;  1SD4 A;  1XSV A;  4HF1 A;  5ICF A;  4YFX F;  2BEO A;  1HBX G;  3IWZ A;  5TRD A;  1ZHF A;  2XAG A;  5HDN A;  2Z33 A;  2P5K A;  2JRT A;  4BH9 A;  1GXQ A;  4MGR A;  3TO7 A;  3I71 A;  3J81 Z;  5FD6 A;  1LDD A;  3O2P E;  1W4M A;  2M5W A;  2VC0 A;  1R23 A;  2J5P A;  2LDU A;  2FE3 A;  3LQQ A;  4E70 A;  4CGZ A;  4YII A;  3L09 A;  1DDN A;  4L9T A;  5DD4 A;  1GHC A;  1IXR C;  2JSC A;  2RC4 A;  2KRF A;  3E6D A;  1I5Z A;  4YFK F;  2K86 A;  1U5T A;  4U0Y A;  3WTU C;  4HA8 A;  2WTE A;  1IXS B;  1XDS A;  2F5C A;  5LHI A;  2VOD A;  2PLY A;  4XRF A;  4EJW A;  3QU3 A;  5FO5 A;  1TQP A;  5BPI A;  2KIM A;  3G73 A;  4MQ9 F;  4G7Z F;  1FX7 A;  3V8L A;  3SZT A;  3L2C A;  5H6R A;  1G3W A;  3KP5 A;  4LLN A;  1JGS A;  3BRO A;  4PDK A;  3QOP A;  4Y13 A;  1TLH B;  2ESH A;  1HW5 A;  4HLX A;  1J9I A;  1U6G A;  1PDN C;  5DUK A;  3K1N A;  1AWC A;  1OYW A;  3KCC A;  4ASN A;  1Z6R A;  5D5X B;  1B4A A;  1YW9 A;  1IRF A;  1BJA A;  2MLK A;  3G3Z A;  4IRG A;  1J7K A;  3IKT A;  4U7D A;  4AVP A;  2P7V B;  2PG4 A;  2FOK A;  1K78 B;  3T8T A;  2DK5 A;  3F8C A;  1WSU A;  3HIF A;  3C3W A;  3F21 A;  4L0Y B;  1S7O A;  1YO5 C;  2OAZ A;  2UWM A;  2GA1 A;  1SD5 A;  2DQL A;  1KU9 A;  4PCQ A;  3KP2 A;  5BOX A;  4N9I A;  4KN4 X;  4LG0 A;  1J0R A;  1ZRD A;  2QQ9 A;  2HWV A;  1BIB A;  4RB0 A;  3I4P A;  3BP8 A;  4LLL A;  5DUI A;  2VE9 A;  1S6L A;  2EJR A;  3J7A O;  5LRR A;  5EEH A;  4MTE A;  2ZME B;  4WCG A;  2D1V A;  1B9N A;  2XAH A;  2IP2 A;  5K5Q A;  2GAU A;  1FYK A;  4R1H A;  3KEQ A;  2M8E A;  1KQ8 A;  5D8L B;  3FM3 A;  1TW3 A;  4HYE A;  5HDG A;  4AIH A;  2FBH A;  4ZH4 F;  4Z2Y A;  3HSR A;  3L00 A;  4HF2 A;  4GGG A;  2M45 A;  3C18 A;  1A04 A;  1KU7 A;  1ULY A;  1XCV A;  1FBU A;  2HYG D;  5AIP A;  3I5U A;  4HDV A;  5L3E A;  1Q1H A;  1XSD A;  4M9Z A;  3QPT A;  2D1H A;  2H94 A;  3MCZ A;  3P7N A;  2EA4 A;  2WV0 A;  1T2K A;  2NAZ A;  2RQP A;  1LDK B;  1K79 A;  3H92 A;  5E8I A;  1YLF A;  2DQR A;  2QVO A;  4GO1 A;  1FP1 D;  3K9T A;  2Q8K A;  1W7P B;  4ZZL A;  5F6F A;  2VN2 A;  5L3G A;  2FMY A;  1ZG1 A;  2YR2 A;  3ZMD A;  4G94 A;  2JZY A;  4HQE A;  3AAF A;  2OZU A;  2ZO4 A;  1ZYR F;  2MA3 A;  1HKT A;  1HKS A;  2JTV A;  5ICC A;  5HVQ C;  4BQA A;  3PFI A;  4I09 A;  3RI4 A;  5K1Y A;  3I58 A;  1R36 A;  2RNJ A;  3F6V A;  1D8K A;  3ROU A;  3RPQ A;  1P4A A;  2UZK A;  3COA C;  5J6X A;  1B1B A;  4HZF A;  4LK1 F;  5DDG A;  2K02 A;  1XGO A;  3EYY A;  1ZAO A;  3OOP A;  2FXA A;  2V9V A;  1U5T B;  4M6X A;  3JAM Z;  4A12 A;  3I59 A;  3T5X A;  2VBY A;  2PN6 A;  2EB7 A;  2DW4 A;  4HW0 A;  3F23 A;  3T8R A;  4KNY A;  3WTV C;  1MJA A;  1LDJ A;  2HR3 A;  2MBF A;  2VT3 A;  5LHG A;  1X3U A;  3H3Z A;  4S04 A;  4ENM A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...