5HS9A

Crystal structure of the quinone-bound yodb from b. subtilis
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
95
structure length
88
Chain Sequence
CPKMESAFSLLGKRWNGLIIHVLMDGPKRFKEITETIPMISQKMLAERLKELEQNEIVERQVVIYTLTEKGTALQAVFQEMQAWADQF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords HTH-type transcriptional regulator YodB
publication title Two distinct mechanisms of transcriptional regulation by the redox sensor YodB
pubmed doi rcsb
source organism Bacillus subtilis
molecule tags Dna binding protein
total genus 29
structure length 88
sequence length 95
chains with identical sequence B
ec nomenclature
pdb deposition date 2016-01-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01638 HxlR HxlR-like helix-turn-helix
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 5hs9A00
4TV7A 4A6EA 3C18A 2BE5F 3RI4A 1G3SA 1U2WA 4AIJA 2RV8A 3HSEA 3BOQA 3HRUA 2M5WA 1XSDA 2KJBA 2DAOA 2XAHA 4BHCA 3KZYA 3FM5A 2VOOA 2V9VA 3BPVA 3KZZA 4EV0A 3TO9A 1TW3A 2HZTA 3EYIA 2MD5A 2QQBA 4FX4A 5ILVA 1IRFA 2FXAA 2M1BA 4IHSA 1QO0D 4LLLA 4JQFA 3F6VA 5ED4A 2ZNZA 4YFKF 5DCMA 4R1HA 1LB2A 2CSOA 1W5SA 2FBHA 2BGCA 3PFIA 1G4DA 2HYFA 2OBPA 1JE8A 3GWZA 2M45A 4RB0A 4Y15A 2YX7A 1FSHA 2UWMA 2A5YB 5CVIA 2H6BA 2Z3YA 4LG0B 5E8GA 3LWFA 1XDUA 4I0BA 2LF8A 3W6KB 4N0BA 4LGWA 3F8BA 1U8RA 1YQAA 3V7RA 1KU7A 3B02A 3BJAA 3DF8A 3KE2A 4CZZA 3KP3A 4Q5SF 1O3QA 1IRGA 1O57A 2J5PA 2ZMEA 3FHZA 2ETHA 4IRIA 3N97A 1ZG5A 2QWWA 3T1BA 2O6GE 2PG4A 2R7DA 4L9NA 2FMYA 4G6DA 1FBQA 5L3EA 1H9TA 3SHFA 4R8HA 3SZTA 3ABTA 3KCCA 1K78B 4JBAA 3BZ6A 1FNNA 4CXFA 3SQNA 3KEQA 4L9VA 3BWGA 3M9AA 5BPIA 3RYRA 4ESBA 5D5VB 1J7KA 3VB2A 1R7JA 3QP5A 2ZFWA 5L3GA 3PQKA 4BHPA 3ML6A 3K9TA 3EETA 3MWMA 1XB4A 4RGXA 3JW4A 1ZYRF 1LNWA 2ZKZA 3WGIA 2EA2A 2P4WA 2VT2A 1J5YA 3DQVC 3IL2A 4K2EA 3KP4A 2HDCA 3GLXA 5D4SA 3C3WA 1LDDA 1R1VA 4IXAA 1FY7A 3QU3A 4HX8A 1FPQA 3K1MA 4L0ZB 4OOIA 4IPAA 3P9KA 1YFHA 4EJTA 1Q1HA 4OIQF 2EWNA 1BIBA 2E1NA 1STZA 4YG2F 1HSTA 3WU0A 4YIFA 3T5XA 2D1VA 4HLXA 1R5HA 3I58A 3ZMSA 2J5OA 4KA4A 1TLHB 1J59A 1RIOH 1K7AA 2G7HA 1QZYA 4JK1X 1P6RA 1U5TC 3ZN0A 1QBJA 4LLGF 1J2XA 2TDXA 4N9IA 1DUXC 2YR2A 2L4MA 2MH9A 4WXDA 3ECOA 3ZMDA 3P9CA 2FRHA 4WXHA 2OAZA 4EGZA 3VEPA 1QPMA 3Q5FA 2WTEA 1XGSA 3I4PA 4A12A 1RNLA 1P92A 5K5QA 2ELHA 1S8NA 4IRHA 4MNUA 1ZG3A 1PUEE 2JRTA 1WWXA 4O5VA 5J6XA 4P5OA 2W24A 4QLCU 3GYHX 3U2RA 1T6SA 2P7VB 2HQNA 1CGPA 2RN7A 4OMZA 5LGTA 3G73A 1TNSA 4LK0F 2XAGA 4ESJA 5AONA 4BXUA 5D5UB 3R4KA 4A0ZA 3LA3A 1HKSA 3OV8A 2W57A 2E1CA 2V6CA 1UB9A 1ZRCA 1ZN2A 2A6EF 4NB5A 3CUQB 2P6TA 4GO1A 1LVAA 4GGGA 2Z99A 2A07F 3L00A 3RDIA 4I2OA 1BBYA 5E8IA 3BROA 3RJPA 1GXPA 4XBFA 2EFQA 4GYGA 4AWXB 3I71A 2PQ8A 3F72A 4LMYA 4RGUA 4CYDA 2NNYA 1CF7B 5L3FA 1LDKB 3B73A 5TJJA 4LG0A 4L9JA 3R61A 1TQMA 2KIMA 4KICA 3I53A 2O61A 1PP8F 2W25A 3BJ6A 3HIFA 1LJ9A 1BIAA 2DK8A 1ZGJA 4MGRA 1S7OA 3K0LA 4M73A 4U7DA 4MEYF 4KN7X 1SFXA 3TQNA 3TOBA 2ZBKA 4FT8A 3GFLA 5DYMA 5L3CA 3FZVA 3J7AO 3E6CC 3F8MA 3Q9SA 4A0YA 1B59A 4H0EA 3R0AA 3D0SA 2VBXA 2EV5A 1O7LA 1J9IA 4BHBA 2BEOA 4M6XA 1BI2A 2GZWA 1K78A 3OOPA 3F8CA 2IT0A 3ECHA 3I64A 1YS7A 3FXQA 1OYIA 2P6SA 3F8NA 4MTEA 2XIGA 3T8RA 5DUIA 3EUHA 5E18F 2LNBA 4I01A 2NRAC 4RAZA 1UFMA 3NQOA 1GHCA 2NS0A 4KNYA 5ICEA 1YS6A 2R7FA 1R36A 1D5VA 1IXSB 1IXCA 4EM1A 3O3KA 2DQRA 3HUGA 3LAJA 2HTSA 4KMFA 1I27A 2COMA 5HS8A 4HV5A 5KK1A 1W7PA 2F5DA 1KQ0A 1E17A 3ISPA 1WKMA 2K86A 2AXLA 3JSPA 1DPUA 3FMRA 1O3TA 5A2QZ 5AIPA 1FBSA 5ILSA 3TOAA 1I6XA 5DEQA 1ODDA 4HX4A 3DP7A 2L4AA 3GW2A 3T0YA 5IT9Z 5D8KB 3IWZA 1B9NA 2FNAA 1SAXA 4UHTA 1YTYA 3WE3A 2RVCA 3GX4X 4G6QA 1XCBA 3KLOA 4U88A 2QBYB 1K79A 1FLIA 4LFUA 2Z9OA 3WTSC 4U0WA 1BN5A 2QM3A 1ZREA 4XLNF 4A5NA 2O03A 3ULQB 4HDUA 5HS9A 5E1WA 2E7XA 2CGPA 1ZLJA 4UVCA 1XGNA 4QWQA 4ON0A 1IN8A 2CYYA 1BC8C 1IF1A 1FOKA 3DPTA 3ZMZA 2OQGA 4Y17A 1O3SA 1BM9A 1Y0UA 5CJ9A 4ZZLA 4DQ2A 2K7LA 2L01A 2P5LC 2F2EA 2YU3A 3T8TA 4KYWA 1IN6A 3CLOA 2ZCWA 3SXYA 2KRFA 1SD5A 1I1GA 1KYWA 5D6EA 2Z33A 1YIOA 2VT3A 5HLIA 1C0WA 4M72A 1HW5A 4XSXF 1LDJA 3CUOA 3P7NA 3CUQA 4UV9A 3F8FA 5HDGA 3FXRA 2VBZA 3I5UA 2FBIA 2CW0F 1T98A 1W7PD 4WK8F 2QQAA 2BV6A 2M87A 1UHWA 3KFWX 4RAYA 3QOPA 4O3MA 5F6FA 1HBXG 1CF7A 4ZYGA 3KEOA 2EFPA 1HW2A 3V8LA 3GF2A 2RC4A 2VXZA 1MJAA 4IJAA 4U0YA 1U78A 2PEXA 1P4XA 3L2CA 1EH7A 1D8KA 1TW2A 2LF7A 2Y75A 1FP2A 3O2PE 1KU3A 2F5FA 4BNCA 2M8EA 1R1UA 4UVAA 1OYYA 1OKRA 4P9FA 5ILUA 4EJWA 1HKTA 1ZG1A 3MFKA 4EGYA 3RKWA 4G8XA 1BI1A 1IXRC 2FA5A 3S2WA 5F64A 3G3ZA 3DKWA 1OYWA 3MZYA 2VN2A 1H0MA 1KU2A 2GAUA 3GUDA 4RB2C 2A69F 5LGNA 5FLXZ 1Z9CA 2STTA 2EA4A 4A2UA 1TQIA 3V8KA 1XSVA 2ZNYA 2DPUA 2VBWA 3HRSA 1MZBA 2L02A 1P4WA 4I0AA 1KQ9A 1LEAA 4HZFA 4AIKA 4KIGA 2Q2EA 1T0FA 3FMSA 3I59B 3QU6A 5HVQC 2HKXA 3E5QA 5DUKA 3IWFA 3N4MA 1FYMA 4BH9A 2F5CA 2O8XA 1AOYA 5ERIA 2W85A 1EH6A 1S7AA 4KDPA 1Z1DA 2UXXA 2Y0MA 5LEKA 1AWCA 2GXBA 3I54A 3QPTA 1FSEA 1BOAA 3F21A 2HYGD 3J81Z 3E6MA 4L5JA 5D8LB 2CFXA 1W4MA 4PCQA 1W7PB 3WODF 2RKHA 4Z2YA 3VOEA 1S3JA 5LHIA 2OD5A 2FE3A 2PFBA 2UXNA 4UNOA 1Z91A 3HOSA 3M1EA 1S6LA 1YLFA 2DT5A 2OA4A 2P7CB 1GXQA 3TDUC 2HOEA 4ETSA 4M9SA 3IRQA 3MAJA 5DD8A 2FEZA 5ICFA 2V1UA 4EQQA 5E20A 3ZQ7A 2AS5F 4EVIA 2XKOA 5FFXA 3R60A 1B1BA 1ZGAA 2QBYA 2DI3A 3MZHA 5HDKA 4M6YA 1IN5A 1XGOA 3KP2A 1HXDA 1F4KA 3EQLF 2WWYA 4G7ZF 5A2QK 5TRDA 4CGZA 1ZH5A 3GEZA 1V3FA 5E1XA 5J8FA 2VC0A 4L9TA 2HTJA 3F23A 5IT9K 3ABUA 4F7ZA 1WRJA 4PZJA 1IW7F 1SMTA 2MC3A 2XHKA 2PLYA 2OZUA 1HQCA 2KIFA 2JPBA 2O0YA 1Z6RA 3BY6A 1HW1A 3WGGA 3CDHA 1OR7A 3LQRA 3LSTA 2EB7A 2XAFA 4UV8A 2XAQA 2EK5A 3WTUC 3HYIA 2FF4A 3RIRA 4ZYEA 1HSJA 1GVJA 2XUBA 2V1DA 4MQ9F 4Q4ZF 5CLSA 2XGXA 3WTTC 3WGHA 4PDKA 4UUVA 4WWCA 2KIUA 4HX7A 1IN7A 1ONVA 5E1ZB 2EFOA 2RQPA 4Y13A 3FM3A 1G3WA 2E7WA 2ADUA 2A61A 1QZZA 1WI9A 5K5OA 1L0OC 3HSFA 2X4HA 1OPCA 2EJRA 5CVRA 1NHAA 5LRRA 3H3UA 5HDNA 2JTVA 2GA2A 1FT9A 1KGSA 2Z5UA 4D0PA 2XROA 1B6AA 1XDSA 1XN7A 1REPC 2ESNA 1XMKA 4MHGA 1LEBA 3SZPA 1G3TA 1R23A 1XCVA 4I02A 1MJ9A 5BPDA 3IKVA 4HV6A 2VONA 3WTWC 3ZMUA 5EEHA 2A6HF 2ZJ2A 1SFUA 2QZ8A 4WCGA 2L3DA 3J80Z 4UXNA 1XGMA 3KLNA 4LB5A 3BPXA 5ICGA 3WTXC 1MJBA 1SD6A 4EMSA 4LD5A 1YO5C 1R5GA 3HHHA 4N9HA 5D5WB 3E3VA 4LJZF 3ZN1A 3ZMVA 1KA8A 2MLKA 1JHHA 2H27A 4OIOF 3ZPLA 5FD6A 4B8XA 1F9NA 3HRTA 3I59A 5BQTA 1U5TB 3TKYA 5FLXK 4FHTA 1SD4A 2HR3A 4HQMA 4I98B 2BYVE 5L3DA 1J75A 4HOBA 3K2ZA 2M30A 4ESFA 2DLLA 5DCFA 2P8TA 4AD9A 3PQJA 2IW5A 1FBUA 2DU9A 3TO6A 1YW8A 3QPHA 4XRFA 4E70A 1QQIA 3LA7A 3DEUA 4KIBA 1K6OA 1I5ZA 4WXCA 3L7WA 2FQ3A 3HOTA 2FU4A 3J81K 3V7SA 2WC2A 4ENJA 2VOPA 3GFIA 3V8JA 2FSWA 3E6BA 5LEJA 4R79A 1KU9A 3CO7C 4HAMA 2LSOA 5K1YA 2G9WA 1SMYF 1R1TA 4U0VA 2CQKA 3M7GA 3WTVC 2HKOA 4HYEA 1L3LA 4AIHA 2GWRA 4HBLA 2GA1A 4PGGA 4P55A 2HWVA 5F1RA 2MLGA 3BJOA 4YIIA 3IKTA 2ZXJA 1MDMB 1MKMA 4P96A 5E17F 3EYYA 3VODA 3RKXA 3COAC 5AIQA 4HF1A 2DFIA 1FWZA 2IA0A 1X3UA 2OZ6A 2DK5A 3D5LA 5HS7A 4M74A 4A6DA 4XSZF 5IT3A 2H09A 3WG9A 4CO8A 1TNTA 3GFMA 2XKPA 1O3RA 2EFWA 2D45A 4KT5C 4HW0A 1ZARA 3ZMTA 2YPRA 1BC7C 2FNPA 2DO7A 5FB2A 2O3FA 5FO5A 1FP1D 4OINF 1RZ4A 5LLQA 1ZRDA 2LDUA 3KP6A 4RB1A 2OU2A 5HLHA 2B0LA 3C1DA 2HEOA 3E5UA 4YFNF 4BQAA 3W6JB 5BMZA 2FBKA 2QQ9A 4L18B 1KYZA 1P4AA 1W5TA 3BP8A 4S05A 4KUMA 5D4RA 3ELKA 2XAJA 5D5XB 2KJCA 4A0XA 4O6JA 3LQQA 5H6QA 4RGSA 2PBIA 2PJPA 3JAMK 4ENKA 4IRGA 5JFRA 2PMHA 2IA2A 3HTSB 3CO6C 1P2FA 3GVAA 2JZYA 1FX7A 2A3SA 1USSA 2HGCA 2KKOA 1R58A 1WQ2A 1J0RA 1FZPB 2LKPA 3HRMA 3BDDA 5FD5A 2GXGA 2X0LA 1JGSA 3JSOA 4AVPA 4OU0A 3QP6A 4WF2A 3RPUA 5L3BA 1EV7A 4ZH4F 1MD0A 4PGHA 1R00A 4LLNA 3ZP5A 1B4AA 3FMQA 2ISYA 4MQVA 3MEXA 2P5VA 2QVOA 2NNNA 2XASA 3MQ0A 3DPLC 3CUQC 2IRFG 2ISZA 4MEXF 3J80K 2JPCA 1XD7A 5DV5A 1U5TA 1EH8A 5FGMA 5LGUA 3I0TA 1LQ1A 1VTNC 3RKYA 4GCVA 2MA3A 2PMUA 1U6GA 3VFZA 3M8EA 4RS8A 1DDNA 5LRSA 2VE9A 2QENA 2ESHA 4KN4X 5D6FA 2D2WA 3GO5A 1ZAOA 3GXOA 1YG2A 4UVBA 4IVNA 3TO7A 2F5EA 1V4RA 2DPDA 4EJUA 3P9IA 4HLYA 4B09A 2RDPA 1B9MA 3TGNA 1BI3A 3LA2A 2VC1A 1UHMA 1OMIA 4CDGA 3L9FA 3LAPA 3V7CA 4IHTA 4DNCA 2QYOA 1ULYA 2JT1A 1O7FA 4L0YB 1FC3A 3U9GA 3R0JA 2RGVA 4I09A 3WE2A 1IZ1A 5KVRA 1DP7P 2V1XA 5CVVA 1JHFA 3HTUA 1MDMA 1KQ8A 2ACJA 2BBYA 1R22A 3QAHA 4Q47A 3ROUA 5JR3A 3DFGA 1T39A 2NYXA 3RYPA 2PN6A 1TTYA 4IF4A 3WU1B 1IAWA 4ZYHA 3FXUA 3Q9VA 2Q8KA 2FMLA 4WX9A 5K5RA 2P5KA 1BJAA 3FF5A 4EJVA 2DTRA 4MTDA 4M71A 3IHUA 5HLGA 3E5XA 2NAZA 2ZO4A 2G7UA 4HQEA 4CICA 1SD7A 2Q0OA 5BS6A 1RUOA 1Z6TA 1XMAA 4OMYA 4OIPF 3REOA 3GZ6A 2IJLA 3GFJA 4KMUX 1U3EM 4ENMA 1T38A 5DDGA 1ZLKA 1DPRA 1SFEA 4EM2A 1RI7A 4NHJA 1H9GA 2K02A 4P9UA 2GQQA 3F22A 2CWEA 3JAMZ 1PDNC 1ZRFA 1BI0A 3M8FA 4FX0A 4LB6B 1S29A 3LFKA 2IP2A 5DCMB 2R3SA 2IPQX 2VE8A 2DW4A 3O6BB 3GZ5A 1RUNA 4ZZDA 4HDVA 1T2KA 5CVUA 2W84A 4G7OF 2MBFA 2IVMA 1D8JA 1UCRA 3H92A 5JHUA 3KP5A 1FYKA 2QUFA 3CJNA 5H6RA 4ASNA 3RTRA 3ERED 3IC7A 1YW7A 4LK1F 3CTAA 1MGTA 2CO5A 3L09A 3QRFF 5H20A 1Z7UA 3DV8A 4HF2A 2IA1A 1JXSA 3HHGA 2K4BA 3K69A 1E2XA 4A5MA 3RPQA 3WTYC 5EEGA 4RB3C 1ON2A 2K4JA 1G6NA 2ZMEB 5JVTA 3JTHA 1I1SA 3K1PA 2H6CA 4EM0B 2WV0A 4YFXF 3NEUA 4M9XA 4NQWA 3DXJF 2A68F 3C7JA 1TQPA 1F1ZA 2RNJA 1FYLA 3AAFA 2VODA 2HQRA 5JI6A 4S04A 2EFNA 4GXOA 4KIFA 4G94A 5FFZA 4KFCA 4ZYDA 1YW9A 5J8CA 4CHUA 2OQRA 2D1HA 2PI0A 2VBYA 2HFHA 2EV0A 2YX4A 3HSRA 2K27A 4HA8A 2C6YA 5LHHA 5LBQA 3F3XA 1USTA 3TDZC 1ZHFA 4RGRA 1PP7U 2MH2A 3R6SA 3FWEA 5LHGA 4I7HA 3U1DA 1Z05A 2CG4A 4BAYA 5BOXA 2DBBA 1IUYA 2FOKA 1G3YA 3KETA 4OIRF 1QNTA 2L54A 3FX3A 5ICCA 3NRVA 3H3ZA 2XV4S 2H94A 3MCZA 3K1NA 2Y48A 3JTGA 1WSUA 5DD4A 3EDPA 3IRRA 4HF0A 1YYVA 1ON1A 1A04A 4G7HF 4M9ZA 2XRNA 4GYIA 2DQLA 4Q48A 3F6OA 3KP7A 4L5IA 4XLPF 2EV6A 2V79A 3E6DA 1D3YA 2XVCA 3SFZA 5HOOA 1QGPA 2STWA 2YSRA 3V4GA 1XSXA 1HKQA 1IN4A 2QLZA 2GIVA 3E97A 4EJOA 2UZKA 4G9YA 6PAXA 1F5TA 2JSCA 4BYYA 5CYVA 4ENNA 1TBXA 4U7BA 5CVJA 3WTZA 2HS5A
chains in the Genus database with same CATH superfamily
4TV7A 4A6EA 3C18A 2HDDA 4IHWA 2BE5F 3RI4A 1MMGA 1G3SA 2XF7A 1U2WA 3JRDA 5B1BH 4AIJA 2X6WA 2RV8A 2GOXB 3PM1A 5B66C 3CLQA 1JGGA 3HSEA 3NWSA 3BOQA 3HRUA 1ETQA 1Y8QB 4XR6A 4X0GA 2ZB9A 1ZQ3P 4KT6A 2M5WA 3LSMA 1XSDA 2KJBA 2DAOA 3OSGA 1WZ2A 2XAHA 4BHCA 3KZYA 3FM5A 2VOOA 2V9VA 3BPVA 3KZZA 4EV0A 3TO9A 3H5RA 4ZC3A 3C2GA 1TW3A 2HZTA 1LUJB 4Y33A 3EYIA 3GTGJ 3LOCA 2MD5A 2QQBA 4IZZA 2V1NA 3E7LA 4FX4A 1Y1WJ 5ILVA 4XONA 1B8IB 1OCTC 1IRFA 2HDWA 2FXAA 1VNDA 1TWAJ 2M1BA 2VJIA 4MIMA 1K4SA 2DMNA 4IHSA 4X6AJ 1QO0D 3DTIA 4LLLA 3L2UA 2E2JJ 4JQFA 3I9V2 2V9PA 3F6VA 2ZNZA 4YFKF 5DCMA 5ED4A 4R1HA 1LB2A 2CSOA 3J7YJ 1W5SA 2FBHA 2IBDA 2BGCA 3PFIA 1G4DA 2HYFA 2OBPA 4RM2A 1JE8A 4KISA 2AQEA 3GWZA 2M45A 4RB0A 4Y15A 2YX7A 1FSHA 4BE1A 2UWMA 2CQ7A 2A5WA 2EPFA 2Y31A 3G1LA 3HJEA 2A5YB 5CVIA 2H6BA 3HGYA 4PJMA 1VQ5I 2Z3YA 3H9QA 4LG0B 5E8GA 3LWFA 1XDUA 4I0BA 1TC3C 2LF8A 3W6KB 3ZRGA 2AO9A 3A2KA 4N0BA 3GTMJ 3ZQHA 4LGWA 3FBIB 3F8BA 1U8RA 1ACIA 1ZGWA 1FMWA 2K5CA 1X1PA 1YQAA 3V7RA 2IGOA 1KU7A 3B02A 3BJAA 3DF8A 3KE2A 4BJ6C 4CZZA 3KP3A 3K2AA 3OYMA 4XRSG 3DU6A 4Q5SF 3CCYA 3OS1A 1B72A 4CCLA 1MBFA 2K9MA 1O3QA 5FJ8J 2OF7A 3MD2A 1IRGA 1O57A 2QSGX 2J5PA 1WPKA 2ZMEA 3FHZA 2ETHA 1IDYA 3N97A 4IRIA 2R7SA 2VIXA 1ZG5A 4LITA 2QWWA 3T1BA 2O6GE 2VKVA 2PG4A 2R7DA 2V26A 2E2IJ 4L9NA 2X1DA 2CUJA 2FMYA 4G6DA 1FBQA 5L3EA 1H9TA 2WAFA 3SHFA 4PJNA 4R8HA 3SZTA 3ABTA 3KCCA 1K78B 1POGA 4JBAA 2VI6A 3BZ6A 1FNNA 1X1DA 4CXFA 3SQNA 3KEQA 4L9VA 3C2HA 3BWGA 3HB9A 3H9JA 3M9AA 5BPIA 3RYRA 4J19A 4ESBA 5D5VB 1J7KA 3CCLI 1MBHA 3VB2A 1R7JA 2M2EA 1D5YA 3QP5A 2ZFWA 4IL6C 2E60A 4XK4A 5L3GA 1X1AA 2XGEA 5CKTA 2VQGA 3PQKA 2ZXWH 3ML6A 3K9TA 4BHPA 4QPOA 2VJJA 2HI3A 3EETA 4BBRJ 5KAFC 3MWMA 3OIPA 1XB4A 4RGXA 2JUGA 3E0JB 3JW4A 1ZYRF 4DIQA 1S5LC 2R7VA 1LNWA 2ZKZA 3WGIA 2EA2A 2MD0A 2P4WA 1IC8A 1FIAA 1J5YA 2VT2A 3DQVC 5EYRA 1W1WE 1R49A 3S15J 1GVDA 3IL2A 4K2EA 2Y9ZA 5FKMA 2ZJQF 2FUG2 3KP4A 3BG6A 1DU0A 1YRNA 3HUGB 1HOMA 3SJMA 2EIJH 4CYCB 2BHZA 2HDCA 3IAM2 3K4NA 1LKXA 1T08B 2CQQA 2LOOA 3GLXA 3W2VA 5D4SA 1QA6A 2DN0A 3C3WA 1R4NB 1LDDA 1R1VA 1XMXA 2F4MB 4IXAA 1FY7A 3QU3A 2DCEA 4HX8A 1FPQA 3K1MA 1IGNA 4HPQA 4L0ZB 4OOIA 2EILH 3RKQA 4N4OB 3PIPF 3LFUA 1YJNI 4IPAA 3P9KA 2VL8A 1YFHA 2DFFA 2JA7J 1VQ7I 4CA0A 3GTKJ 4EJTA 3I4MJ 1Q1HA 4OIQF 2EWNA 3AG1H 1JT0A 3JRBA 1BIBA 2E1NA 4B43A 2IXSA 1X19A 1DP3A 1STZA 5IP9J 1AKHB 4YG2F 1HSTA 1JI8A 2F6CA 4M3DA 3WU0A 3ASNH 4YIFA 3T5XA 5FRMA 4OAYA 2AXTC 2D1VA 4BL0B 1XPXA 2LTPA 4HLXA 1R5HA 3I58A 1V55H 3DTEA 2FQ4A 3ZMSA 2J5OA 3K6GA 4KA4A 1TLHB 3OL3A 1J59A 1RIOH 1Z67A 1K7AA 1T95A 4B4CA 4XN0A 2G7HA 1QZYA 3HBLA 4JK1X 1P6RA 3PIOF 1U5TC 4S0HB 4A3CJ 3ZN0A 1QBJA 4LLGF 1J2XA 3BR3A 2TDXA 4NC6A 1MW7A 4N9IA 2R5YA 3PSIA 1DUXC 2YR2A 2L4MA 2MH9A 4WXDA 3ECOA 3ZMDA 2RREA 2F5VA 3P9CA 4BDZA 2FRHA 2DA5A 4JX4A 4JX6A 4WXHA 3HC7A 2OTLI 2OAZA 4EGZA 2O9LA 2LFBA 3VEPA 2QGUA 1QPMA 3Q5FA 1MMDA 1GT0C 2WTEA 1XGSA 3I4PA 4A12A 3OYBA 1RNLA 1P92A 1FOWA 5K5QA 1LFUP 1A36A 4BXFA 2ELHA 3OYCA 2JA6J 2DA3A 2IEKA 1W36C 1S8NA 4IRHA 4MNUA 1ZG3A 1PUEE 2JRTA 2CS3A 2OCCH 5E3NA 1X1CA 4HEA2 4IKFA 5IP6A 1WWXA 4O5VA 2K85A 5J6XA 2ZXIA 4P5OA 2W24A 4QLCU 3MKWB 2NOJB 4PK4A 4E7ZA 2ZC2A 2L7MP 1E3PA 3PL8A 3GYHX 3U2RA 3IV5A 1T6SA 2P7VB 5LFAA 4A3MJ 2VPLA 2HQNA 3ABKH 2RN7A 4OMZA 5LGTA 3JRFA 3G73A 1CGPA 1TNSA 4LK0F 2XAGA 4RMNA 2DMPA 4ESJA 5AONA 2HVQA 4BXUA 3R4KA 5D5UB 4A0ZA 5H2FC 4XKBA 3LA3A 1X58A 1B8IA 1HKSA 2I5UA 3IAS2 3OV8A 2W57A 2E1CA 1X3ZB 1TWGJ 2ZSIB 1AU7A 3ZQGA 2V6CA 3S1RJ 1AA7A 1UB9A 3VSLA 4XM3A 3LL7A 4F91B 4E7JA 1ZRCA 2CU7A 1ZN2A 2A6EF 4QIWN 4NB5A 3CUQB 3S1QJ 5J4VA 2P6TA 4GO1A 1LVAA 4XL9A 4RM3A 1H89C 2R92J 4GGGA 1OLTA 2Z99A 1MMNA 2A07F 1YJWI 3L00A 3RDIA 4I2OA 1BBYA 5E8IA 2IGNA 3BROA 3RJPA 1GXPA 3MVPA 4XBFA 3BG9A 1MH3A 3K4LA 2EFQA 3I71A 4GYGA 3TBIA 2JVGA 2PQ8A 3F72A 4AWXB 1JUMA 2Y2ZA 2DA4A 4LMYA 2LG4A 4RGUA 4CYDA 5GAEJ 4C2UA 3D5RC 3V42A 5FROA 3UKGA 2NNYA 1CF7B 5L3FA 1XTAA 1LDKB 3B73A 5TJJA 2XSDC 4LG0A 4CCKA 3A4CA 4L9JA 3R61A 2X6XA 1TQMA 2L7KA 1K83J 4F52A 4A3GJ 2KIMA 4KICA 5GP9A 3I53A 2XGDA 1PP8F 2O61A 4XRMA 2QA4I 2W25A 3BJ6A 3HIFA 1LJ9A 1TWFJ 3CJRB 1BIAA 2DK8A 2JJ7A 1ZGJA 1X2NA 4MGRA 1S7OA 2MG4A 2E35A 2HXIA 5CPRB 3TEDA 3K0LA 4I76A 3BTCA 5GAHJ 4M73A 3LSGA 4U7DA 4MEYF 2E5NA 3QODA 4KN7X 1SFXA 4ZTJA 3TQNA 3TOBA 2ZBKA 4FT8A 1VQ9I 3GFLA 4FE7A 3OYAA 4II3A 5DYMA 1P7JA 2R93J 4FASD 5L3CA 3FZVA 3QWLA 3J7AO 1RRJA 3E6CC 1BW5A 2HOTA 3GTOJ 3F8MA 3Q9SA 2ICWG 3O8HA 4A0YA 2QEXI 1B59A 4UUTA 4H0EA 4MO7A 1OQYA 3R0AA 3D0SA 2VBXA 2EV5A 1O7LA 2XGCA 1J9IA 2WBMA 4BHBA 1QZEA 2BEOA 2KIQA 4M6XA 2GM4A 1BI2A 2GZWA 1K78A 5E3OA 2R7RA 2LBFB 4JX5A 3OOPA 3F8CA 2IT0A 3ECHA 3I64A 3LSRA 3H0DA 1YS7A 3FXQA 4ZTFA 1OYIA 2P6SA 5FKOA 3IH4A 1HF0A 3F8NA 4MTEA 2XIGA 3T8RA 5DUIA 1R4MB 3IH2A 5EJCA 3EUHA 2Q2EB 2GBYA 5E18F 3CF2A 2LNBA 2Y0SA 4I01A 4PFPA 2NRAC 4RAZA 1UFMA 3RCOA 2HU9A 3NQOA 3BR2A 5E3MA 3CDIA 2LMDA 1GHCA 2NS0A 4KNYA 5E3LA 2X1CA 5ICEA 1YS6A 2R7FA 3CZ6A 1WGXA 3OSFA 1R36A 4YELA 1V5EA 1XS9A 3DBHB 2CW7A 3CCMI 2VKHA 3ERMA 3W3CA 1D5VA 1IXSB 1IXCA 4EM1A 2DA7A 3CCUI 3O3KA 2DQRA 3HUGA 3LAJA 4CYCA 3I3LA 2E5ZA 3JCUC 2HTSA 4KMFA 1I27A 1UZCA 2K9SA 2COMA 1RKWA 2R5ZA 1QPIA 5HS8A 4HV5A 5KK1A 1W7PA 1OCCH 4E7LA 4AUXA 2F5DA 1KQ0A 4F3QA 1WJCA 4BDYA 3LNQA 1E17A 4M3BA 3L1PA 2E2HJ 4YIRX 2VXDA 4JYKA 3ISPA 1WKMA 2K86A 2AXLA 4PUSA 3JSPA 1DPUA 3FMRA 3EUKL 3KZIC 1O3TA 5A2QZ 5AIPA 1WCMJ 2WAQA 2MGQA 1WJEA 5IOYA 1FBSA 4FE4A 5ILSA 3CESA 3TOAA 4NNJA 1AKHA 2JMWA 2EQRA 2P0WA 3CD6I 1I6XA 2M3AA 1WJFA 2M0MA 5DEQA 1ODDA 4HX4A 3DP7A 2L4AA 3GW2A 3EUAA 3T0YA 4EATA 5IT9Z 2DMQA 2JA2A 5D8KB 3CCEI 3IWZA 1B9NA 4CCJA 3Q0WA 2FNAA 5C44J 1SAXA 3UR3C 3CP8A 4A3IJ 4UHTA 1YTYA 1TWHJ 3WE3A 3GTLJ 4XLEA 1LVKA 2RVCA 3GX4X 4G6QA 1XCBA 2DYSH 4PSXA 3KLOA 4U88A 2QBYB 1K79A 2HOSA 3DLLF 4DBRA 2BY0A 1FLIA 1WVRA 2MABA 3FKIJ 4LFUA 4II2A 4DOZA 2Z9OA 3WTSC 3QYFA 3CMAI 4U0WA 1BN5A 2QM3A 2E34A 1ZREA 2DT7B 2ID3A 4XLNF 4A5NA 3I4NJ 1K6YA 2O03A 3ULQB 4HDUA 1R71A 2UV1A 3KEYA 4B3AA 5M5WJ 3G1MA 3KYCB 4XLAA 2LP0A 3CP2A 5HS9A 3HG9A 3HM5A 5E1WA 5K7FA 2E7XA 1GDTA 2CGPA 1ZLJA 2RQQA 4UVCA 1Z3YA 4F93B 1XGNA 4UY8I 4QWQA 4FISA 1JJ6C 4ON0A 1IN8A 2CYYA 4M3FA 2DODA 3I55I 1BC8C 3SFIA 4RAGA 4FTHA 3KPHA 3UNGC 1DQUA 1IF1A 1I3QJ 2CV1A 2BVLA 2L5QA 1FOKA 3DPTA 2DOEA 2M9HA 2N8GA 3ZMZA 3C2BA 2OQGA 3FKJA 4Y17A 1O3SA 2QQ8A 4AVZA 1BM9A 1JKRC 1Y0UA 5CJ9A 1WFXA 4ZZLA 1X4PA 4DQ2A 2K7LA 3CQZJ 2EINH 2QF7A 3CC4I 3OIQA 2L01A 2P5LC 3S14J 2F2EA 2YU3A 3T8TA 4LG3A 2LR8A 1X2MA 5KCMA 3HDDA 3H9GA 4KYWA 2VQLA 2HPMA 2RAEA 4U87A 1IN6A 3CLOA 3AG4H 2ZCWA 3SXYA 3DKYA 4CSWA 2KRFA 1SD5A 1I1GA 3BG3A 5GPCA 1KYWA 3AG2H 5D6EA 3GMEA 2F48A 5IYBJ 2Z33A 1YIOA 2VT3A 2ZSHB 4A3FJ 4DBQA 3S8PA 5HLIA 1AHDP 1C0WA 4BY1J 4M72A 1HW5A 4XSXF 1LDJA 3CUOA 3P7NA 1Z7LA 3CUQA 9ANTA 2AHQA 4UV9A 5LD2C 3F8FA 5HDGA 3FXRA 2VBZA 3I5UA 3M1CA 4AYBN 2FBIA 3FXMA 3AFHA 2CW0F 1T98A 1W7PD 2AQFA 4WK8F 1FJLA 2QQAA 2BV6A 2RNGA 2M87A 1R6RA 1W0UA 1UHWA 2E1OA 3KFWX 4RAYA 2IGKA 4XQFA 3QOPA 2WV1A 5F6FA 4O3MA 1HBXG 1CF7A 4ZYGA 2IS1A 3KEOA 5EEAA 1W0TA 2WA0A 2Y0SN 2EFPA 1HW2A 2CQXA 2L9NA 3V8LA 3GF2A 2RC4A 2VXZA 1MJAA 4IJAA 4U0YA 1U78A 2E1MB 3RSNA 2PEXA 1P4XA 2CQNA 2ME6A 4JOMA 3L2CA 1EH7A 1D8KA 1TW2A 2LF7A 2Y75A 1FP2A 3SEQA 3O2PE 1KU3A 4IQJA 1V5FA 2Y30A 2F5FA 3SZGA 2CUEA 4BNCA 2M8EA 1R1UA 3FIWA 2LVSA 4UVAA 1OYYA 1OKRA 1ZELA 1RR8C 3QOEA 4P9FA 4DGWB 3PFYA 4EJWA 5ILUA 1HKTA 1P7IA 1ZG1A 2CUFA 3MFKA 4EGYA 3RKWA 4G8XA 1BI1A 2BXYA 3HZJA 2L0KA 4D1QA 2GLOA 3HPGA 1IG7A 1IXRC 3PJRA 2FA5A 3S2WA 4XLCA 5F64A 2TCTA 4M3EA 3G3ZA 3DKWA 3S3MA 1OYWA 3MZYA 1SFKA 2VN2A 1H0MA 1KU2A 4BBSJ 4C3IJ 2GAUA 1ETYA 1D0ZA 3GUDA 4RB2C 2A69F 5LGNA 3KYLA 5FLXZ 1Z9CA 2BZTA 1FMVA 1SVLA 2STTA 2EA4A 3VYRB 4A2UA 2JRMA 2BW3B 1TQIA 3V8KA 3L2WA 2FD5A 1XSVA 2ZNYA 2LBFA 2DPUA 2VBWA 1Y8RB 2WAQN 3DWLE 1MZBA 2O5RA 3HRSA 1IUFA 2MYSA 2L02A 1P4WA 4I0AA 3TW7A 1SVOA 2CW8A 1KQ9A 2BHYA 1LEAA 4HZFA 4AIKA 1Y56A 2IS4A 4KIGA 3W2WA 2XPWA 2Q2EA 1ERDA 4DYCA 1T0FA 3FMSA 1UJ8A 2DMTA 1SVMA 3I59B 4XOPA 3VYUB 2ME0A 1SANA 3BZCA 2LD5A 3QU6A 5HVQC 2HKXA 2HPIA 3E5QA 5DUKA 3IWFA 3N4MA 1FYMA 2HZDA 4BH9A 2F5CA 2O8XA 1AOYA 5ERIA 1BA5A 1RR7A 2W85A 1EH6A 1S7AA 4KDPA 4D7MA 5EZGA 1Z1DA 2UXXA 2Y0MA 3BR5A 3ZQIA 5LEKA 1AWCA 3TP3A 3I54A 3QPTA 2GXBA 4LIVA 1FSEA 1BOAA 2OCEA 2HYGD 3B6CA 3F21A 1V5GA 3J81Z 5GAGJ 3E6MA 3LSIA 5J1YA 4L5JA 2JUCA 2JK3A 5D8LB 2CFXA 1YI2I 2R7XA 4V2GA 1W4MA 2R5ZB 4PCQA 4NDLA 1W7PB 4CH7A 2IS6A 3WODF 2JN6A 3ABLH 2W00A 2VLAA 2RKHA 4Z2YA 3VOEA 2KMUA 3AG3H 4AC0A 2OTJI 1S3JA 1EJ9A 5LHIA 1MNDA 1LFPA 4A3EJ 2VB6A 2OD5A 2FE3A 2PFBA 2UXNA 2KISA 3OL4A 4UNOA 1T33A 3S1NJ 1Z91A 3HOSA 3M1EA 3HPHA 1R5ID 1S6LA 3DU5A 2OA4A 1YLFA 2DT5A 2P7CB 3ABMH 1GXQA 1ETOA 2WB1N 4W1UA 5HNFA 3K4JA 3TDUC 2HOEA 4ETSA 1RPWA 3A03A 1OCPA 2KFDA 2ZMEC 4M9SA 5GPAA 3IRQA 3MAJA 5DD8A 3PNYA 2FEZA 5ICFA 2JWTA 2V1UA 4EQQA 5E20A 3ZQ7A 1HLVA 2AS5F 4EVIA 5DM7F 2XKOA 2MFZA 1HA8A 5FFXA 3R60A 5EF6A 1B1BA 1ZGAA 2CRGA 3HXLA 3A01B 1JUPA 3H1CA 2QBYA 5J3LA 2DI3A 3MZHA 2K9NA 5HDKA 4M6YA 1IN5A 4BEHB 2BOLA 1XGOA 4D9JA 3KP2A 1HXDA 1F4KA 2DOAA 3EQLF 2WWYA 4G7ZF 5A2QK 5TRDA 4CGZA 1ZH5A 3GEZA 1V3FA 5E1XA 3CC7I 5J8FA 2VC0A 4L9TA 4CCOA 3OYDA 2BY1A 3AL0C 2H8WA 3ESWB 1P9QC 4D5FA 4RAFA 5HODA 2HTJA 3F23A 1MMSA 1PUFB 1MNEA 4UUSB 5IT9K 3ABUA 4F7ZA 1A6QA 5IY5H 2P81A 1WRJA 2QSFX 2XB5A 4PZJA 4AU7A 4DZJA 5J1UA 3CMMA 2HQAA 2KZGA 1GUUA 1MNMC 3RPUD 1IW7F 1SMTA 2MC3A 2VJ5A 2XHKA 2XSJC 2PLYA 2OZUA 1HQCA 3OR1C 4A69C 5DS9A 3HOVJ 2KIFA 1I39A 2PX9A 2JPBA 2O0YA 1XG1A 1E3HA 2DJNA 4PJ0C 2A6TA 1Z6RA 1WH7A 3MMYB 3BY6A 1ZKGA 5IP7J 1HW1A 3S16J 3D5SC 4PFOA 3WGGA 5EG0A 2V6EA 3CDHA 1OR7A 3LQRA 3LSTA 3OYGA 2EB7A 1GV2A 2QCOA 3BR6A 2XAFA 4CCNA 4UV8A 2XAQA 2ID6A 2NVTJ 1VQ4I 3IH3A 1FTZA 2EK5A 4PJLA 2DTZA 2XF6A 4FETA 2VQCA 2F4OB 1R9TJ 2MW8A 3WTUC 3HYIA 2FF4A 4M6VA 3RIRA 4ZYEA 5JLWA 2DFEA 2Y9YA 4Y52J 1HSJA 2GXAA 3WU2C 1GVJA 2L9VA 2XUBA 2V1DA 5B1AH 1XC5A 4MQ9F 4Q4ZF 5CLSA 4V19K 1LFBA 2XGXA 3LSPA 3OY9A 3WTTC 3QQAA 3WGHA 4PDKA 4RLQA 2ECCA 4UUVA 4WWCA 2KIUA 2O7OA 4HX7A 3BC8A 1IN7A 1ONVA 5E1ZB 4QPQA 3G71I 4A3KJ 2EFOA 4BU2A 3ONQA 2RQPA 1YIJI 4E7SA 4Y13A 2CV2A 3QYBA 2HYJA 3FM3A 4A3JJ 5F08A 1QU3A 2JA8J 1W36D 1G3WA 2E7WA 3HEFA 2ADUA 2A61A 1QZZA 3Q3SA 4C9YA 4AM3A 1WI9A 5K5OA 3K4BA 3S3NA 1K4TA 1L0OC 2VUMJ 3HSFA 2X4HA 1OPCA 1W5CC 2Y69H 2EJRA 3U1KA 5CVRA 1NHAA 5LRRA 4NC8A 3H3UA 5HDNA 2JTVA 4XICA 2GA2A 5DM6F 2Q1ZB 1FT9A 1KGSA 2KQRA 2Z5UA 4D0PA 2XROA 1B6AA 1ETXA 1XDSA 3FK6A 4E7HA 1ETKA 1XN7A 1REPC 2ESNA 1XMKA 3LSHA 3Q0UA 2GIZA 1PYVA 5FKKA 3VYSB 4MHGA 1LEBA 2DA6A 3DCFA 4MLOA 3SZPA 4ZYAA 1G3TA 5KAIC 1R23A 1XCVA 4I02A 2KL4A 1MJ9A 4GRIA 5BPDA 3G1OA 4YRVA 2D5VA 3IKVA 3D1NI 4HV6A 5FRNA 3QPLA 2VONA 3WTWC 4JP0A 3ZMUA 5EEHA 4ZDPA 2DDAA 2A6HF 4NC7A 3B6AA 2ZJ2A 4IX7A 3FXOA 3ZQLA 3PSFA 1SFUA 1YOVB 2QZ8A 4WCGA 2L3DA 3J80Z 4UXNA 1XGMA 3KLNA 1BR2A 2L2OA 4LB5A 3BPXA 5ICGA 3WHCA 5CQGA 3W2AA 3WTXC 1MJBA 1ETVA 2BW3A 2R0QC 3CCJI 4W97A 2PJRB 4AYBA 1SD6A 4Y4RA 4C3HJ 4EMSA 4LD5A 1YO5C 1R5GA 3GTQJ 2DJIA 2K40A 3HHHA 4N9HA 5D5WB 3E3VA 2HQ5A 1D1BA 1MBEA 1A5JA 4LJZF 3FISA 3ZN1A 3ZMVA 1KA8A 3MZ8A 2MLKA 1JHHA 3ZCOA 2H27A 4OIOF 1BR1A 3NWTA 2W1OA 4B48A 3ZPLA 5FD6A 4B8XA 5F04A 2V9KA 1NG7A 1F9NA 2VPRA 4A3BJ 3HRTA 3I59A 2EZLA 4ITVA 2OJED 5BQTA 1U5TB 3TKYA 5FLXK 3DPUA 4FHTA 1HCRA 2DFHA 2H8RA 3HL2A 2X85A 1SD4A 2HR3A 4HQMA 3K70D 1JUSA 4I98B 4XKVA 3JR9A 4HG2A 5M3FJ 2BYVE 4B3XA 2L7ZA 2LRDA 5L3DA 1J75A 4HOBA 3K2ZA 2M30A 4ESFA 1OFCX 2DLLA 2DA1A 5C3EJ 1BW6A 2CJJA 5DCFA 2P8TA 4AD9A 4I99C 4X1EA 3O8GA 2CFOA 3PQJA 1VQPI 4GFBA 2DA2A 2IW5A 2HVSA 4BUPA 3TMOA 1FBUA 2EH3A 2NXNB 2DU9A 2LYCA 1VQKI 3TO6A 2M34A 1YW8A 1SFOJ 1N75A 1X3WB 3QPHA 5IPAA 1JKPC 4XRFA 4E70A 1QQIA 3LA7A 3DEUA 4KIBA 1K6OA 4V2FA 4XLHA 5F27A 1I5ZA 3A0BC 3PNVA 3L7WA 2FQ3A 4WXCA 3HOTA 3M3YJ 1HDDC 2FU4A 3TP0A 3J81K 3V7SA 1N78A 1HC8A 2WC2A 4ENJA 2VOPA 3GFIA 2E19A 3QYEA 2LREA 3V8JA 1Y39A 2FSWA 2DYRH 3E6BA 3OR2C 5LEJA 3FXJA 3H5AA 4R79A 1KU9A 3CO7C 4HNUA 1LE8B 4HAMA 5F1JA 2LSOA 5K1YA 3OYNA 4G6TB 2G9WA 4XOTA 1X4OA 1SMYF 3A01A 1R1TA 4U0VA 3JRHA 2CQKA 3M7GA 5B5EC 1MBKA 4BEHA 1FOXA 5J47A 3WTVC 4PSWA 2HKOA 3E1SA 4HYEA 4N4NB 3DEWA 3ZQCA 1L3LA 4AIHA 1X1BA 4RA2A 3M8JA 2CH0A 2GWRA 4HBLA 2GA1A 1UG2A 4PGGA 3EUHC 2M8GX 2DXIA 5J40A 3WHBA 4P55A 4GDFA 2B9SA 1I3AA 2HWVA 1D0XA 2HXOA 5F1RA 1H88C 2MLGA 3BJOA 4YIIA 1PUFA 3IKTA 4UUSA 2ZXJA 2EZHA 1ZR4A 1MDMB 1MKMA 4XKCA 5FLMJ 3CDLA 4IEJA 1IDZA 1V54H 3OOUA 3ZOBA 2CMPA 4P96A 2TRTA 1U0JA 2QSHX 5E17F 3EYYA 3VODA 3RKXA 2M4KA 3FDYA 3COAC 1O4XA 5AIQA 4HF1A 2DFIA 1FWZA 2EZIA 2IA0A 1X3UA 2OZ6A 2KRCA 4ZJZA 1G2HA 2DK5A 2XDVA 3D5LA 5HS7A 4BJTA 3OYHA 1YITI 2WB1A 1J09A 1PJRA 4M74A 5EG0B 4A6DA 2V4JC 4XSZF 5IT3A 4HSRA 3HOYJ 2H09A 3X2QH 3CF5F 4Y3OA 3WG9A 2K9QA 1TT0A 3RZDJ 4CO8A 1TNTA 2LH9A 1VF9A 1YX3A 3GFMA 2XKPA 3KX2A 1O3RA 2EFWA 2D45A 2WADA 4KT5C 4HW0A 3ZQQA 1IO2A 1ZARA 3ZMTA 3L2VA 1E0EA 2YPRA 1Y1VJ 4XORA 3BCAA 1EKEA 1BC7C 2IS2A 2FNPA 2DO7A 3DBRB 5FB2A 2O3FA 5FO5A 5EGOB 1FP1D 3A1YA 4BQOA 2F4IA 1RESA 3TW6A 4C30A 1NK3P 1S72I 4OINF 3OYFA 1RZ4A 3CJTB 1H8AC 5LLQA 4RLFA 3FHNA 1ZRDA 2FX0A 2LDUA 3KP6A 4Z6YA 3KIOA 4ABZA 2OU2A 4RB1A 5HLHA 2B0LA 3C1DA 2HEOA 1T56A 3E5UA 2DT6A 4RDUA 3NAUA 4YFNF 2E36A 3EPZA 4XLFA 3BT9A 4BQAA 3W6JB 3G2BA 5BMZA 1NK2P 2FBKA 2QQ9A 1A6IA 4L18B 4IHYA 1KYZA 1OCZH 1P4AA 1W5TA 5TISC 3BZKA 1TL8A 3BP8A 4S05A 3OYEA 1EF4A 2WY8Q 3CJQB 4KUMA 4B44A 5D4RA 4H4KC 3ELKA 2XAJA 5D5XB 4IO9F 3VWBA 1KONA 2NVQJ 2JQ7A 2KJCA 4A0XA 4O6JA 3KYDB 2NVXJ 1NTCA 2A05A 5FLVA 3LQQA 5M5YJ 5H6QA 4RGSA 1PVEA 1IRXA 1VQ6I 4P1WA 2PBIA 3K4KA 1SEUA 2PJPA 3JAMK 4ENKA 4IRGA 5JFRA 3PUFA 2PMHA 2IA2A 1BOBA 3HTSB 5KHDA 3CO6C 1P2FA 3GVAA 3QPSA 2JZYA 3HOXJ 1FX7A 2A3SA 1USSA 2HGCA 2KKOA 1R58A 3VPRA 3K4MA 1TP4A 1WHUA 2Z1DA 2JSPA 1WQ2A 1MH4A 1J0RA 3AKZA 1FZPB 3G6EI 2LKPA 1DU6A 3HRMA 3BDDA 5FD5A 2GXGA 2X0LA 3NARA 1MSEC 1JGSA 3JSOA 5JHFA 4AVPA 2NS7A 3Q0VA 4OU0A 1Z3XA 5M3MJ 2NVYJ 5J4YA 1OISA 2BVMA 1ZK8A 1OCRH 4HNVA 3QP6A 4WF2A 3RPUA 2PJRA 5L3BA 4D7NA 1EV7A 4ZH4F 2X51A 4YEJA 1MD0A 4PGHA 1R00A 3DKXA 1RC9A 1ZR2A 2K9LA 4LLNA 3ZP5A 1B4AA 1ZTRA 3FMQA 2R7QA 5F0HA 3BTJA 2ISYA 4MQVA 3MEXA 2P5VA 2QVOA 3BLYA 2NNNA 1NG6A 2XASA 5JLXA 2R7WA 3MQ0A 4NQWB 4RBOA 3DPLC 2Z2SB 5F0CA 3CUQC 5HLTA 2K3PA 2W7NA 3L2QA 2IRFG 2ISZA 1QVUA 3GZNB 5BNGA 3JRCA 3HOUJ 4MEXF 3J80K 3M07A 2JPCA 1XD7A 5DV5A 1U5TA 3MN2A 3VYTB 1EH8A 3BQYA 5FGMA 5LGUA 3I0TA 4AIDA 4XN3A 5TGTA 1SC7A 1LQ1A 2PMZA 3ZQFA 4IHXA 2M7AA 3LMMA 4ZDOA 4BY7J 1VTNC 3RKYA 4GCVA 2MA3A 1A35A 2XAUA 2KDOA 2M7BA 3ZGKA 2PMUA 1U6GA 3OIOA 2LKSA 3M8EA 3VFZA 3BQZA 1CQTA 2XRLA 4RS8A 4C2MJ 2CV0A 2WAEA 3MKYB 1DDNA 3H3VK 1MBGA 4DW6A 5LRSA 2DOFA 2OUMA 2VE9A 2QENA 1BR4A 3LSJA 3HOZJ 5EDNA 2ESHA 2KRHA 2CUZA 4KN4X 4OAZA 5J1RA 5D6FA 5M5XJ 1FOYA 1JT6A 2LY1A 5GTHC 2D2WA 4MFDA 1IJWC 3GO5A 1EA3A 1ZAOA 3GXOA 3H36A 1YG2A 3CCRI 1UAAA 1APLC 4UVBA 1Y0NA 2QKLB 4IVNA 4PJJA 3S32A 3TO7A 4XKWA 2F5EA 1V4RA 2L7FP 2DPDA 4EJUA 1QRYA 1WH5A 3P9IA 1UG0A 4HLYA 2ZFUA 2X6YA 2LK2A 4B09A 2OC6A 2RDPA 4NUBA 5KNLA 1B9MA 3TGNA 4F55A 1BI3A 2EIKH 5FKNA 2JA5J 3SDBA 3LA2A 3TL4X 3VDXA 1FIPA 2VC1A 2IGMA 4ZDLA 1UHMA 1D1AA 1OMIA 4J01A 4CDGA 1LE8A 2V7FA 3L9FA 3LAPA 5E79C 4B47A 2X48A 1E3OC 3K7AJ 3HOWJ 2KLOA 4E7IA 1G59A 3CCSI 3HKZA 4BQNA 4A3LJ 3M4OJ 3V7CA 4IHTA 4EEFG 3JREA 1RETA 4DNCA 3BR0A 3FXLA 2QYOA 5K7ZA 1JKQC 2MC4A 1ULYA 2JT1A 5GTIC 1O7FA 4L0YB 4BS9A 1FC3A 2MSYA 3U9GA 3R0JA 2RGVA 4I09A 3SDGA 3WE2A 4NBQA 4B1RA 4IOAF 1T0FC 1IZ1A 2I10A 5KVRA 1DP7P 2V1XA 2IAIA 2KT0A 3H35A 5CVVA 1JHFA 2YUSA 2ZJPF 3HTUA 3A0HC 1TT5B 1VQLI 4QTRA 1MDMA 2VKEA 2LC2A 2ACJA 1KQ8A 2BBYA 1R22A 2EZKA 3S3OA 4G12A 3QAHA 4HRIA 2WY7Q 4BQQA 3JRAA 3K10A 1S7EA 4Q47A 3ROUA 5JR3A 2W48A 3DFGA 1T39A 2NYXA 3RYPA 2PN6A 1N77A 1BJZA 1TTYA 2X6OA 1MSFC 4IF4A 3WU1B 4BE2A 1ORKA 5K7HA 3PO2J 1WJ5A 4Y7NJ 1IV8A 3FK7A 4IOCF 4KJZA 1YX5A 1IAWA 1IRZA 4ZYHA 3FXUA 3Q9VA 4LOCA 1S9HA 2Q8KA 2GOMA 2FMLA 4WX9A 5K5RA 2P5KA 1BJAA 1FTTA 3FF5A 3BCBA 4EJVA 2DTRA 4MTDA 4M71A 4CUGA 3IHUA 1VI0A 2E71A 3OWTA 5HLGA 3E5XA 4FCYA 3FBNB 1GLNA 2NAZA 1Y6IA 2ZO4A 1T8IA 3CC2I 1XX5A 2ZJRF 4E7KA 2G7UA 4HNTA 3VSKA 4CICA 2ELKA 2VQHA 4HQEA 1SD7A 2Q0OA 5BS6A 1Z21A 2HNHA 1OCOH 1A31A 1Z6TA 2FJ1A 1XMAA 1RUOA 2XF5A 4OMYA 4BXXJ 1VQ8I 2R7TA 5EGOA 4OIPF 3REOA 3RZOJ 1MBJA 2R7UA 3GZ6A 2IJLA 3GFJA 4KMUX 1U3EM 4ENMA 1T38A 5DDGA 1ZLKA 3PO3J 1DPRA 1SFEA 2LKXA 2BY2A 4EM2A 1RI7A 2COBA 4NHJA 1H9GA 2K02A 4P9UA 2GQQA 3OYKA 3WG7H 3F22A 2R7OA 2CWEA 3MKLA 3JAMZ 1PDNC 2ELJA 3GTJJ 3S2HJ 1ZRFA 1JTYA 2LY9A 4LIUA 1BI0A 3M8FA 4FX0A 3OS0A 4LB6B 1S29A 2KHMA 3LFKA 2IP2A 5DCMB 2R3SA 2IPQX 2VE8A 3RQIA 4DZPA 2EIMH 2DW4A 3O6BB 4MFEA 3GZ5A 1RUNA 1WI3A 3BTIA 2R7ZJ 1HDPA 4ZZDA 4HDVA 1VQNI 1T2KA 3JRGA 4CCMA 3MKZA 5CVUA 4J00A 2PMZN 2W84A 4CZCA 2X9DA 1OJLA 4G7OF 2MBFA 2H1LA 2IVMA 2LY2A 2JVHA 1VQOI 1D8JA 1UCRA 3DTKA 4L5EA 3H92A 5JHUA 3KP5A 1FYKA 2QUFA 4UB8C 1QHHD 1IV6A 3IUOA 3CJNA 5H6RA 4ASNA 2DMUA 2R4GA 2YS9A 3RTRA 4ANJA 1UHSA 2HVRA 3ERED 4DYRA 4IQ4A 3IC7A 5HNHA 2QKMB 1YW7A 1Z0XA 4LK1F 2O8KA 3CTAA 3BTLA 1MGTA 2CO5A 3A02A 3L09A 5C4JJ 1M1EB 2OPTA 5F0FA 3QRFF 5H20A 2M4GA 2XC7A 1Z7UA 3DV8A 4HF2A 3OYJA 2IA1A 3PNTA 1JXSA 3CMEI 1OR7C 1WJBA 1ITYA 3HHGA 1JJ8C 2K4BA 2H1KA 3K69A 1E2XA 1WJAA 4A5MA 3RPQA 3WTYC 1TZLA 1B72B 5EEGA 3ZXSA 4RB3C 3OYIA 3HGGA 3K70C 1ON2A 1JKOC 2KDZA 2K4JA 3ZR8X 1G6NA 2VKDA 2ZMEB 3L2RA 1LPQA 3H5NA 4IHVA 5JVTA 1YJ9I 3JTHA 1I1SA 3IP4B 1U9NA 3F9KA 3K1PA 2H6CA 3S2DJ 4EM0B 1U8BA 1ENHA 2G0EA 2WV0A 4YFXF 4A3DJ 1ETWA 2BXZA 4KITB 3NEUA 4M9XA 4NQWA 5GADJ 3DXJF 4C3JJ 2A68F 2LLKA 2OV7A 3C7JA 1TQPA 1F1ZA 2RNJA 1FYLA 3OYLA 3AAFA 2HQRA 2VODA 5JI6A 4S04A 3HKZN 2EFNA 2BY3A 4GXOA 4KIFA 4G94A 1UMQA 3DBLB 5IYCJ 3S1MJ 3H0GJ 4XIDA 5FFZA 2UUZA 4OWRB 4KFCA 4ZYDA 1YW9A 5J8CA 3DLAA 4CHUA 4XNFA 5C4XJ 2OQRA 2D1HA 3W6VA 2PI0A 2VBYA 2HFHA 3AL0B 2EV0A 4BGDA 3U21A 2YX4A 3HSRA 2K27A 4HA8A 3CMYA 2C6YA 3BG5A 5LHHA 2KPMA 5LBQA 2ZXHA 3BG7A 5B3SH 1F36A 3GLLA 3F3XA 5EZHA 4I6ZA 4M3GA 2E1MC 3RQ4A 1USTA 1BL0A 5CQEA 3TDZC 1K61A 5DTDA 1ZHFA 4RGRA 4XRSA 3OS2A 1Z77A 1N25A 1PP7U 2MH2A 3LSKA 3R6SA 3FWEA 3SYTA 3N05A 4I7HA 3U1DA 5LHGA 1Z05A 2XB0X 4DJAA 1YRNB 1NH3A 2L9RA 4DYQA 2CG4A 3CCVI 4BAYA 5BOXA 5IYDJ 2DBBA 1IUYA 2FOKA 2M0CA 1G3YA 2W4SA 3KETA 4OIRF 2L54A 1QNTA 2FOWA 1D1CA 1Q1VA 1JTXA 3FX3A 1FEXA 5ICCA 3NRVA 3H3ZA 1MIJA 3PUBA 2K3FA 3OMYA 2XV4S 2KP6A 2H94A 1U9OA 4E4HA 3MCZA 1I50J 1QVTA 4D5CA 2B7EA 4QSHA 3JRIA 3K1NA 2Y48A 3J7AY 3I56I 2DDBA 3F0CA 4F92B 3JTGA 1WSUA 3S93A 5DD4A 2ECBA 3EDPA 3IRRA 4HF0A 1GV5A 3S17J 1YYVA 2YU9J 2XPUA 2EBIA 3BR1A 1ON1A 1A04A 4G7HF 4M9ZA 2XRNA 1YHQI 4UB6C 3GBGA 4GYIA 4BKXA 1SAUA 2KZVA 3ASOH 1YE9A 2VJ4A 2L9SA 2DQLA 4Q48A 2Z16A 1TWCJ 3GCMA 3F6OA 3KP7A 4L5IA 4XLPF 2EV6A 2V79A 2W82A 3GTPJ 3E6DA 5FKLA 3FXKA 4BACA 1D3YA 2I8DA 2XVCA 1DGWY 3SFZA 1RKTA 5HOOA 1QGPA 4XMYA 1WJDA 2STWA 4BJ5C 1MMAA 1D0YA 2VASA 5JVGF 1I6HJ 2YSRA 2NOGA 2NVUB 1VFCA 3V4GA 4FQGA 1QHGA 4HSTA 1XSXA 1HKQA 2R5YB 1IN4A 2QLZA 3DEEA 2HOAA 1VQMI 2GIVA 3E97A 3P5JA 4EJOA 2UZKA 2XPVA 3J7ZI 1DGRM 1UELB 1F43A 3CCQI 4G9YA 4A93J 6PAXA 3SEZA 1F5TA 2NS8A 1VZ0A 2JSCA 4BYYA 4E6KG 1KZHA 5IOZA 5CYVA 2B63J 4ENNA 4C2TA 3K4CA 2X1EA 1TBXA 3G4SI 4U7BA 1G8XA 4BE0A 5CVJA 3WTZA 2HS5A
chains in the Genus database with same CATH topology
4TV7A 4A6EA 3C18A 2BE5F 3RI4A 1G3SA 1U2WA 4AIJA 2RV8A 3HSEA 3BOQA 3HRUA 2M5WA 1XSDA 2KJBA 2DAOA 2XAHA 4BHCA 3KZYA 3FM5A 2VOOA 2V9VA 3BPVA 3KZZA 4EV0A 3TO9A 1TW3A 2HZTA 3EYIA 2MD5A 2QQBA 4FX4A 5ILVA 1IRFA 2FXAA 2M1BA 4IHSA 1QO0D 4LLLA 4JQFA 3F6VA 5ED4A 2ZNZA 4YFKF 5DCMA 4R1HA 1LB2A 2CSOA 1W5SA 2FBHA 2BGCA 3PFIA 1G4DA 2HYFA 2OBPA 1JE8A 3GWZA 2M45A 4RB0A 4Y15A 2YX7A 1FSHA 2UWMA 2A5YB 5CVIA 2H6BA 2Z3YA 4LG0B 5E8GA 3LWFA 1XDUA 4I0BA 2LF8A 3W6KB 4N0BA 4LGWA 3F8BA 1U8RA 1YQAA 3V7RA 1KU7A 3B02A 3BJAA 3DF8A 3KE2A 4CZZA 3KP3A 4Q5SF 1O3QA 1IRGA 1O57A 2J5PA 2ZMEA 3FHZA 2ETHA 4IRIA 3N97A 1ZG5A 2QWWA 3T1BA 2O6GE 2PG4A 2R7DA 4L9NA 2FMYA 4G6DA 1FBQA 5L3EA 1H9TA 3SHFA 4R8HA 3SZTA 3ABTA 3KCCA 1K78B 4JBAA 3BZ6A 1FNNA 4CXFA 3SQNA 3KEQA 4L9VA 3BWGA 3M9AA 5BPIA 3RYRA 4ESBA 5D5VB 1J7KA 3VB2A 1R7JA 3QP5A 2ZFWA 5L3GA 3PQKA 4BHPA 3ML6A 3K9TA 3EETA 3MWMA 1XB4A 4RGXA 3JW4A 1ZYRF 1LNWA 2ZKZA 3WGIA 2EA2A 2P4WA 2VT2A 1J5YA 3DQVC 3IL2A 4K2EA 3KP4A 2HDCA 3GLXA 5D4SA 3C3WA 1LDDA 1R1VA 4IXAA 1FY7A 3QU3A 4HX8A 1FPQA 3K1MA 4L0ZB 4OOIA 4IPAA 3P9KA 1YFHA 4EJTA 1Q1HA 4OIQF 2EWNA 1BIBA 2E1NA 1STZA 4YG2F 1HSTA 3WU0A 4YIFA 3T5XA 2D1VA 4HLXA 1R5HA 3I58A 3ZMSA 2J5OA 4KA4A 1TLHB 1J59A 1RIOH 1K7AA 2G7HA 1QZYA 4JK1X 1P6RA 1U5TC 3ZN0A 1QBJA 4LLGF 1J2XA 2TDXA 4N9IA 1DUXC 2YR2A 2L4MA 2MH9A 4WXDA 3ECOA 3ZMDA 3P9CA 2FRHA 4WXHA 2OAZA 4EGZA 3VEPA 1QPMA 3Q5FA 2WTEA 1XGSA 3I4PA 4A12A 1RNLA 1P92A 5K5QA 2ELHA 1S8NA 4IRHA 4MNUA 1ZG3A 1PUEE 2JRTA 1WWXA 4O5VA 5J6XA 4P5OA 2W24A 4QLCU 3GYHX 3U2RA 1T6SA 2P7VB 2HQNA 1CGPA 2RN7A 4OMZA 5LGTA 3G73A 1TNSA 4LK0F 2XAGA 4ESJA 5AONA 4BXUA 5D5UB 3R4KA 4A0ZA 3LA3A 1HKSA 3OV8A 2W57A 2E1CA 2V6CA 1UB9A 1ZRCA 1ZN2A 2A6EF 4NB5A 3CUQB 2P6TA 4GO1A 1LVAA 4GGGA 2Z99A 2A07F 3L00A 3RDIA 4I2OA 1BBYA 5E8IA 3BROA 3RJPA 1GXPA 4XBFA 2EFQA 4GYGA 4AWXB 3I71A 2PQ8A 3F72A 4LMYA 4RGUA 4CYDA 2NNYA 1CF7B 5L3FA 1LDKB 3B73A 5TJJA 4LG0A 4L9JA 3R61A 1TQMA 2KIMA 4KICA 3I53A 2O61A 1PP8F 2W25A 3BJ6A 3HIFA 1LJ9A 1BIAA 2DK8A 1ZGJA 4MGRA 1S7OA 3K0LA 4M73A 4U7DA 4MEYF 4KN7X 1SFXA 3TQNA 3TOBA 2ZBKA 4FT8A 3GFLA 5DYMA 5L3CA 3FZVA 3J7AO 3E6CC 3F8MA 3Q9SA 4A0YA 1B59A 4H0EA 3R0AA 3D0SA 2VBXA 2EV5A 1O7LA 1J9IA 4BHBA 2BEOA 4M6XA 1BI2A 2GZWA 1K78A 3OOPA 3F8CA 2IT0A 3ECHA 3I64A 1YS7A 3FXQA 1OYIA 2P6SA 3F8NA 4MTEA 2XIGA 3T8RA 5DUIA 3EUHA 5E18F 2LNBA 4I01A 2NRAC 4RAZA 1UFMA 3NQOA 1GHCA 2NS0A 4KNYA 5ICEA 1YS6A 2R7FA 1R36A 1D5VA 1IXSB 1IXCA 4EM1A 3O3KA 2DQRA 3HUGA 3LAJA 2HTSA 4KMFA 1I27A 2COMA 5HS8A 4HV5A 5KK1A 1W7PA 2F5DA 1KQ0A 1E17A 3ISPA 1WKMA 2K86A 2AXLA 3JSPA 1DPUA 3FMRA 1O3TA 5A2QZ 5AIPA 1FBSA 5ILSA 3TOAA 1I6XA 5DEQA 1ODDA 4HX4A 3DP7A 2L4AA 3GW2A 3T0YA 5IT9Z 5D8KB 3IWZA 1B9NA 2FNAA 1SAXA 4UHTA 1YTYA 3WE3A 2RVCA 3GX4X 4G6QA 1XCBA 3KLOA 4U88A 2QBYB 1K79A 1FLIA 4LFUA 2Z9OA 3WTSC 4U0WA 1BN5A 2QM3A 1ZREA 4XLNF 4A5NA 2O03A 3ULQB 4HDUA 5HS9A 5E1WA 2E7XA 2CGPA 1ZLJA 4UVCA 1XGNA 4QWQA 4ON0A 1IN8A 2CYYA 1BC8C 1IF1A 1FOKA 3DPTA 3ZMZA 2OQGA 4Y17A 1O3SA 1BM9A 1Y0UA 5CJ9A 4ZZLA 4DQ2A 2K7LA 2L01A 2P5LC 2F2EA 2YU3A 3T8TA 4KYWA 1IN6A 3CLOA 2ZCWA 3SXYA 2KRFA 1SD5A 1I1GA 1KYWA 5D6EA 2Z33A 1YIOA 2VT3A 5HLIA 1C0WA 4M72A 1HW5A 4XSXF 1LDJA 3CUOA 3P7NA 3CUQA 4UV9A 3F8FA 5HDGA 3FXRA 2VBZA 3I5UA 2FBIA 2CW0F 1T98A 1W7PD 4WK8F 2QQAA 2BV6A 2M87A 1UHWA 3KFWX 4RAYA 3QOPA 4O3MA 5F6FA 1HBXG 1CF7A 4ZYGA 3KEOA 2EFPA 1HW2A 3V8LA 3GF2A 2RC4A 2VXZA 1MJAA 4IJAA 4U0YA 1U78A 2PEXA 1P4XA 3L2CA 1EH7A 1D8KA 1TW2A 2LF7A 2Y75A 1FP2A 3O2PE 1KU3A 2F5FA 4BNCA 2M8EA 1R1UA 4UVAA 1OYYA 1OKRA 4P9FA 5ILUA 4EJWA 1HKTA 1ZG1A 3MFKA 4EGYA 3RKWA 4G8XA 1BI1A 1IXRC 2FA5A 3S2WA 5F64A 3G3ZA 3DKWA 1OYWA 3MZYA 2VN2A 1H0MA 1KU2A 2GAUA 3GUDA 4RB2C 2A69F 5LGNA 5FLXZ 1Z9CA 2STTA 2EA4A 4A2UA 1TQIA 3V8KA 1XSVA 2ZNYA 2DPUA 2VBWA 3HRSA 1MZBA 2L02A 1P4WA 4I0AA 1KQ9A 1LEAA 4HZFA 4AIKA 4KIGA 2Q2EA 1T0FA 3FMSA 3I59B 3QU6A 5HVQC 2HKXA 3E5QA 5DUKA 3IWFA 3N4MA 1FYMA 4BH9A 2F5CA 2O8XA 1AOYA 5ERIA 2W85A 1EH6A 1S7AA 4KDPA 1Z1DA 2UXXA 2Y0MA 5LEKA 1AWCA 2GXBA 3I54A 3QPTA 1FSEA 1BOAA 3F21A 2HYGD 3J81Z 3E6MA 4L5JA 5D8LB 2CFXA 1W4MA 4PCQA 1W7PB 3WODF 2RKHA 4Z2YA 3VOEA 1S3JA 5LHIA 2OD5A 2FE3A 2PFBA 2UXNA 4UNOA 1Z91A 3HOSA 3M1EA 1S6LA 1YLFA 2DT5A 2OA4A 2P7CB 1GXQA 3TDUC 2HOEA 4ETSA 4M9SA 3IRQA 3MAJA 5DD8A 2FEZA 5ICFA 2V1UA 4EQQA 5E20A 3ZQ7A 2AS5F 4EVIA 2XKOA 5FFXA 3R60A 1B1BA 1ZGAA 2QBYA 2DI3A 3MZHA 5HDKA 4M6YA 1IN5A 1XGOA 3KP2A 1HXDA 1F4KA 3EQLF 2WWYA 4G7ZF 5A2QK 5TRDA 4CGZA 1ZH5A 3GEZA 1V3FA 5E1XA 5J8FA 2VC0A 4L9TA 2HTJA 3F23A 5IT9K 3ABUA 4F7ZA 1WRJA 4PZJA 1IW7F 1SMTA 2MC3A 2XHKA 2PLYA 2OZUA 1HQCA 2KIFA 2JPBA 2O0YA 1Z6RA 3BY6A 1HW1A 3WGGA 3CDHA 1OR7A 3LQRA 3LSTA 2EB7A 2XAFA 4UV8A 2XAQA 2EK5A 3WTUC 3HYIA 2FF4A 3RIRA 4ZYEA 1HSJA 1GVJA 2XUBA 2V1DA 4MQ9F 4Q4ZF 5CLSA 2XGXA 3WTTC 3WGHA 4PDKA 4UUVA 4WWCA 2KIUA 4HX7A 1IN7A 1ONVA 5E1ZB 2EFOA 2RQPA 4Y13A 3FM3A 1G3WA 2E7WA 2ADUA 2A61A 1QZZA 1WI9A 5K5OA 1L0OC 3HSFA 2X4HA 1OPCA 2EJRA 5CVRA 1NHAA 5LRRA 3H3UA 5HDNA 2JTVA 2GA2A 1FT9A 1KGSA 2Z5UA 4D0PA 2XROA 1B6AA 1XDSA 1XN7A 1REPC 2ESNA 1XMKA 4MHGA 1LEBA 3SZPA 1G3TA 1R23A 1XCVA 4I02A 1MJ9A 5BPDA 3IKVA 4HV6A 2VONA 3WTWC 3ZMUA 5EEHA 2A6HF 2ZJ2A 1SFUA 2QZ8A 4WCGA 2L3DA 3J80Z 4UXNA 1XGMA 3KLNA 4LB5A 3BPXA 5ICGA 3WTXC 1MJBA 1SD6A 4EMSA 4LD5A 1YO5C 1R5GA 3HHHA 4N9HA 5D5WB 3E3VA 4LJZF 3ZN1A 3ZMVA 1KA8A 2MLKA 1JHHA 2H27A 4OIOF 3ZPLA 5FD6A 4B8XA 1F9NA 3HRTA 3I59A 5BQTA 1U5TB 3TKYA 5FLXK 4FHTA 1SD4A 2HR3A 4HQMA 4I98B 2BYVE 5L3DA 1J75A 4HOBA 3K2ZA 2M30A 4ESFA 2DLLA 5DCFA 2P8TA 4AD9A 3PQJA 2IW5A 1FBUA 2DU9A 3TO6A 1YW8A 3QPHA 4XRFA 4E70A 1QQIA 3LA7A 3DEUA 4KIBA 1K6OA 1I5ZA 4WXCA 3L7WA 2FQ3A 3HOTA 2FU4A 3J81K 3V7SA 2WC2A 4ENJA 2VOPA 3GFIA 3V8JA 2FSWA 3E6BA 5LEJA 4R79A 1KU9A 3CO7C 4HAMA 2LSOA 5K1YA 2G9WA 1SMYF 1R1TA 4U0VA 2CQKA 3M7GA 3WTVC 2HKOA 4HYEA 1L3LA 4AIHA 2GWRA 4HBLA 2GA1A 4PGGA 4P55A 2HWVA 5F1RA 2MLGA 3BJOA 4YIIA 3IKTA 2ZXJA 1MDMB 1MKMA 4P96A 5E17F 3EYYA 3VODA 3RKXA 3COAC 5AIQA 4HF1A 2DFIA 1FWZA 2IA0A 1X3UA 2OZ6A 2DK5A 3D5LA 5HS7A 4M74A 4A6DA 4XSZF 5IT3A 2H09A 3WG9A 4CO8A 1TNTA 3GFMA 2XKPA 1O3RA 2EFWA 2D45A 4KT5C 4HW0A 1ZARA 3ZMTA 2YPRA 1BC7C 2FNPA 2DO7A 5FB2A 2O3FA 5FO5A 1FP1D 4OINF 1RZ4A 5LLQA 1ZRDA 2LDUA 3KP6A 4RB1A 2OU2A 5HLHA 2B0LA 3C1DA 2HEOA 3E5UA 4YFNF 4BQAA 3W6JB 5BMZA 2FBKA 2QQ9A 4L18B 1KYZA 1P4AA 1W5TA 3BP8A 4S05A 4KUMA 5D4RA 3ELKA 2XAJA 5D5XB 2KJCA 4A0XA 4O6JA 3LQQA 5H6QA 4RGSA 2PBIA 2PJPA 3JAMK 4ENKA 4IRGA 5JFRA 2PMHA 2IA2A 3HTSB 3CO6C 1P2FA 3GVAA 2JZYA 1FX7A 2A3SA 1USSA 2HGCA 2KKOA 1R58A 1WQ2A 1J0RA 1FZPB 2LKPA 3HRMA 3BDDA 5FD5A 2GXGA 2X0LA 1JGSA 3JSOA 4AVPA 4OU0A 3QP6A 4WF2A 3RPUA 5L3BA 1EV7A 4ZH4F 1MD0A 4PGHA 1R00A 4LLNA 3ZP5A 1B4AA 3FMQA 2ISYA 4MQVA 3MEXA 2P5VA 2QVOA 2NNNA 2XASA 3MQ0A 3DPLC 3CUQC 2IRFG 2ISZA 4MEXF 3J80K 2JPCA 1XD7A 5DV5A 1U5TA 1EH8A 5FGMA 5LGUA 3I0TA 1LQ1A 1VTNC 3RKYA 4GCVA 2MA3A 2PMUA 1U6GA 3VFZA 3M8EA 4RS8A 1DDNA 5LRSA 2VE9A 2QENA 2ESHA 4KN4X 5D6FA 2D2WA 3GO5A 1ZAOA 3GXOA 1YG2A 4UVBA 4IVNA 3TO7A 2F5EA 1V4RA 2DPDA 4EJUA 3P9IA 4HLYA 4B09A 2RDPA 1B9MA 3TGNA 1BI3A 3LA2A 2VC1A 1UHMA 1OMIA 4CDGA 3L9FA 3LAPA 3V7CA 4IHTA 4DNCA 2QYOA 1ULYA 2JT1A 1O7FA 4L0YB 1FC3A 3U9GA 3R0JA 2RGVA 4I09A 3WE2A 1IZ1A 5KVRA 1DP7P 2V1XA 5CVVA 1JHFA 3HTUA 1MDMA 1KQ8A 2ACJA 2BBYA 1R22A 3QAHA 4Q47A 3ROUA 5JR3A 3DFGA 1T39A 2NYXA 3RYPA 2PN6A 1TTYA 4IF4A 3WU1B 1IAWA 4ZYHA 3FXUA 3Q9VA 2Q8KA 2FMLA 4WX9A 5K5RA 2P5KA 1BJAA 3FF5A 4EJVA 2DTRA 4MTDA 4M71A 3IHUA 5HLGA 3E5XA 2NAZA 2ZO4A 2G7UA 4HQEA 4CICA 1SD7A 2Q0OA 5BS6A 1RUOA 1Z6TA 1XMAA 4OMYA 4OIPF 3REOA 3GZ6A 2IJLA 3GFJA 4KMUX 1U3EM 4ENMA 1T38A 5DDGA 1ZLKA 1DPRA 1SFEA 4EM2A 1RI7A 4NHJA 1H9GA 2K02A 4P9UA 2GQQA 3F22A 2CWEA 3JAMZ 1PDNC 1ZRFA 1BI0A 3M8FA 4FX0A 4LB6B 1S29A 3LFKA 2IP2A 5DCMB 2R3SA 2IPQX 2VE8A 2DW4A 3O6BB 3GZ5A 1RUNA 4ZZDA 4HDVA 1T2KA 5CVUA 2W84A 4G7OF 2MBFA 2IVMA 1D8JA 1UCRA 3H92A 5JHUA 3KP5A 1FYKA 2QUFA 3CJNA 5H6RA 4ASNA 3RTRA 3ERED 3IC7A 1YW7A 4LK1F 3CTAA 1MGTA 2CO5A 3L09A 3QRFF 5H20A 1Z7UA 3DV8A 4HF2A 2IA1A 1JXSA 3HHGA 2K4BA 3K69A 1E2XA 4A5MA 3RPQA 3WTYC 5EEGA 4RB3C 1ON2A 2K4JA 1G6NA 2ZMEB 5JVTA 3JTHA 1I1SA 3K1PA 2H6CA 4EM0B 2WV0A 4YFXF 3NEUA 4M9XA 4NQWA 3DXJF 2A68F 3C7JA 1TQPA 1F1ZA 2RNJA 1FYLA 3AAFA 2VODA 2HQRA 5JI6A 4S04A 2EFNA 4GXOA 4KIFA 4G94A 5FFZA 4KFCA 4ZYDA 1YW9A 5J8CA 4CHUA 2OQRA 2D1HA 2PI0A 2VBYA 2HFHA 2EV0A 2YX4A 3HSRA 2K27A 4HA8A 2C6YA 5LHHA 5LBQA 3F3XA 1USTA 3TDZC 1ZHFA 4RGRA 1PP7U 2MH2A 3R6SA 3FWEA 5LHGA 4I7HA 3U1DA 1Z05A 2CG4A 4BAYA 5BOXA 2DBBA 1IUYA 2FOKA 1G3YA 3KETA 4OIRF 1QNTA 2L54A 3FX3A 5ICCA 3NRVA 3H3ZA 2XV4S 2H94A 3MCZA 3K1NA 2Y48A 3JTGA 1WSUA 5DD4A 3EDPA 3IRRA 4HF0A 1YYVA 1ON1A 1A04A 4G7HF 4M9ZA 2XRNA 4GYIA 2DQLA 4Q48A 3F6OA 3KP7A 4L5IA 4XLPF 2EV6A 2V79A 3E6DA 1D3YA 2XVCA 3SFZA 5HOOA 1QGPA 2STWA 2YSRA 3V4GA 1XSXA 1HKQA 1IN4A 2QLZA 2GIVA 3E97A 4EJOA 2UZKA 4G9YA 6PAXA 1F5TA 2JSCA 4BYYA 5CYVA 4ENNA 1TBXA 4U7BA 5CVJA 3WTZA 2HS5A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4TV7 A;  4A6E A;  3C18 A;  2BE5 F;  3RI4 A;  1G3S A;  1U2W A;  4AIJ A;  2RV8 A;  3HSE A;  3BOQ A;  3HRU A;  2M5W A;  1XSD A;  2KJB A;  2DAO A;  2XAH A;  4BHC A;  3KZY A;  3FM5 A;  2VOO A;  2V9V A;  3BPV A;  3KZZ A;  4EV0 A;  3TO9 A;  1TW3 A;  2HZT A;  3EYI A;  2MD5 A;  2QQB A;  4FX4 A;  5ILV A;  1IRF A;  2FXA A;  2M1B A;  4IHS A;  1QO0 D;  4LLL A;  4JQF A;  3F6V A;  5ED4 A;  2ZNZ A;  4YFK F;  5DCM A;  4R1H A;  1LB2 A;  2CSO A;  1W5S A;  2FBH A;  2BGC A;  3PFI A;  1G4D A;  2HYF A;  2OBP A;  1JE8 A;  3GWZ A;  2M45 A;  4RB0 A;  4Y15 A;  2YX7 A;  1FSH A;  2UWM A;  2A5Y B;  5CVI A;  2H6B A;  2Z3Y A;  4LG0 B;  5E8G A;  3LWF A;  1XDU A;  4I0B A;  2LF8 A;  3W6K B;  4N0B A;  4LGW A;  3F8B A;  1U8R A;  1YQA A;  3V7R A;  1KU7 A;  3B02 A;  3BJA A;  3DF8 A;  3KE2 A;  4CZZ A;  3KP3 A;  4Q5S F;  1O3Q A;  1IRG A;  1O57 A;  2J5P A;  2ZME A;  3FHZ A;  2ETH A;  4IRI A;  3N97 A;  1ZG5 A;  2QWW A;  3T1B A;  2O6G E;  2PG4 A;  2R7D A;  4L9N A;  2FMY A;  4G6D A;  1FBQ A;  5L3E A;  1H9T A;  3SHF A;  4R8H A;  3SZT A;  3ABT A;  3KCC A;  1K78 B;  4JBA A;  3BZ6 A;  1FNN A;  4CXF A;  3SQN A;  3KEQ A;  4L9V A;  3BWG A;  3M9A A;  5BPI A;  3RYR A;  4ESB A;  5D5V B;  1J7K A;  3VB2 A;  1R7J A;  3QP5 A;  2ZFW A;  5L3G A;  3PQK A;  4BHP A;  3ML6 A;  3K9T A;  3EET A;  3MWM A;  1XB4 A;  4RGX A;  3JW4 A;  1ZYR F;  1LNW A;  2ZKZ A;  3WGI A;  2EA2 A;  2P4W A;  2VT2 A;  1J5Y A;  3DQV C;  3IL2 A;  4K2E A;  3KP4 A;  2HDC A;  3GLX A;  5D4S A;  3C3W A;  1LDD A;  1R1V A;  4IXA A;  1FY7 A;  3QU3 A;  4HX8 A;  1FPQ A;  3K1M A;  4L0Z B;  4OOI A;  4IPA A;  3P9K A;  1YFH A;  4EJT A;  1Q1H A;  4OIQ F;  2EWN A;  1BIB A;  2E1N A;  1STZ A;  4YG2 F;  1HST A;  3WU0 A;  4YIF A;  3T5X A;  2D1V A;  4HLX A;  1R5H A;  3I58 A;  3ZMS A;  2J5O A;  4KA4 A;  1TLH B;  1J59 A;  1RIO H;  1K7A A;  2G7H A;  1QZY A;  4JK1 X;  1P6R A;  1U5T C;  3ZN0 A;  1QBJ A;  4LLG F;  1J2X A;  2TDX A;  4N9I A;  1DUX C;  2YR2 A;  2L4M A;  2MH9 A;  4WXD A;  3ECO A;  3ZMD A;  3P9C A;  2FRH A;  4WXH A;  2OAZ A;  4EGZ A;  3VEP A;  1QPM A;  3Q5F A;  2WTE A;  1XGS A;  3I4P A;  4A12 A;  1RNL A;  1P92 A;  5K5Q A;  2ELH A;  1S8N A;  4IRH A;  4MNU A;  1ZG3 A;  1PUE E;  2JRT A;  1WWX A;  4O5V A;  5J6X A;  4P5O A;  2W24 A;  4QLC U;  3GYH X;  3U2R A;  1T6S A;  2P7V B;  2HQN A;  1CGP A;  2RN7 A;  4OMZ A;  5LGT A;  3G73 A;  1TNS A;  4LK0 F;  2XAG A;  4ESJ A;  5AON A;  4BXU A;  5D5U B;  3R4K A;  4A0Z A;  3LA3 A;  1HKS A;  3OV8 A;  2W57 A;  2E1C A;  2V6C A;  1UB9 A;  1ZRC A;  1ZN2 A;  2A6E F;  4NB5 A;  3CUQ B;  2P6T A;  4GO1 A;  1LVA A;  4GGG A;  2Z99 A;  2A07 F;  3L00 A;  3RDI A;  4I2O A;  1BBY A;  5E8I A;  3BRO A;  3RJP A;  1GXP A;  4XBF A;  2EFQ A;  4GYG A;  4AWX B;  3I71 A;  2PQ8 A;  3F72 A;  4LMY A;  4RGU A;  4CYD A;  2NNY A;  1CF7 B;  5L3F A;  1LDK B;  3B73 A;  5TJJ A;  4LG0 A;  4L9J A;  3R61 A;  1TQM A;  2KIM A;  4KIC A;  3I53 A;  2O61 A;  1PP8 F;  2W25 A;  3BJ6 A;  3HIF A;  1LJ9 A;  1BIA A;  2DK8 A;  1ZGJ A;  4MGR A;  1S7O A;  3K0L A;  4M73 A;  4U7D A;  4MEY F;  4KN7 X;  1SFX A;  3TQN A;  3TOB A;  2ZBK A;  4FT8 A;  3GFL A;  5DYM A;  5L3C A;  3FZV A;  3J7A O;  3E6C C;  3F8M A;  3Q9S A;  4A0Y A;  1B59 A;  4H0E A;  3R0A A;  3D0S A;  2VBX A;  2EV5 A;  1O7L A;  1J9I A;  4BHB A;  2BEO A;  4M6X A;  1BI2 A;  2GZW A;  1K78 A;  3OOP A;  3F8C A;  2IT0 A;  3ECH A;  3I64 A;  1YS7 A;  3FXQ A;  1OYI A;  2P6S A;  3F8N A;  4MTE A;  2XIG A;  3T8R A;  5DUI A;  3EUH A;  5E18 F;  2LNB A;  4I01 A;  2NRA C;  4RAZ A;  1UFM A;  3NQO A;  1GHC A;  2NS0 A;  4KNY A;  5ICE A;  1YS6 A;  2R7F A;  1R36 A;  1D5V A;  1IXS B;  1IXC A;  4EM1 A;  3O3K A;  2DQR A;  3HUG A;  3LAJ A;  2HTS A;  4KMF A;  1I27 A;  2COM A;  5HS8 A;  4HV5 A;  5KK1 A;  1W7P A;  2F5D A;  1KQ0 A;  1E17 A;  3ISP A;  1WKM A;  2K86 A;  2AXL A;  3JSP A;  1DPU A;  3FMR A;  1O3T A;  5A2Q Z;  5AIP A;  1FBS A;  5ILS A;  3TOA A;  1I6X A;  5DEQ A;  1ODD A;  4HX4 A;  3DP7 A;  2L4A A;  3GW2 A;  3T0Y A;  5IT9 Z;  5D8K B;  3IWZ A;  1B9N A;  2FNA A;  1SAX A;  4UHT A;  1YTY A;  3WE3 A;  2RVC A;  3GX4 X;  4G6Q A;  1XCB A;  3KLO A;  4U88 A;  2QBY B;  1K79 A;  1FLI A;  4LFU A;  2Z9O A;  3WTS C;  4U0W A;  1BN5 A;  2QM3 A;  1ZRE A;  4XLN F;  4A5N A;  2O03 A;  3ULQ B;  4HDU A;  5HS9 A;  5E1W A;  2E7X A;  2CGP A;  1ZLJ A;  4UVC A;  1XGN A;  4QWQ A;  4ON0 A;  1IN8 A;  2CYY A;  1BC8 C;  1IF1 A;  1FOK A;  3DPT A;  3ZMZ A;  2OQG A;  4Y17 A;  1O3S A;  1BM9 A;  1Y0U A;  5CJ9 A;  4ZZL A;  4DQ2 A;  2K7L A;  2L01 A;  2P5L C;  2F2E A;  2YU3 A;  3T8T A;  4KYW A;  1IN6 A;  3CLO A;  2ZCW A;  3SXY A;  2KRF A;  1SD5 A;  1I1G A;  1KYW A;  5D6E A;  2Z33 A;  1YIO A;  2VT3 A;  5HLI A;  1C0W A;  4M72 A;  1HW5 A;  4XSX F;  1LDJ A;  3CUO A;  3P7N A;  3CUQ A;  4UV9 A;  3F8F A;  5HDG A;  3FXR A;  2VBZ A;  3I5U A;  2FBI A;  2CW0 F;  1T98 A;  1W7P D;  4WK8 F;  2QQA A;  2BV6 A;  2M87 A;  1UHW A;  3KFW X;  4RAY A;  3QOP A;  4O3M A;  5F6F A;  1HBX G;  1CF7 A;  4ZYG A;  3KEO A;  2EFP A;  1HW2 A;  3V8L A;  3GF2 A;  2RC4 A;  2VXZ A;  1MJA A;  4IJA A;  4U0Y A;  1U78 A;  2PEX A;  1P4X A;  3L2C A;  1EH7 A;  1D8K A;  1TW2 A;  2LF7 A;  2Y75 A;  1FP2 A;  3O2P E;  1KU3 A;  2F5F A;  4BNC A;  2M8E A;  1R1U A;  4UVA A;  1OYY A;  1OKR A;  4P9F A;  5ILU A;  4EJW A;  1HKT A;  1ZG1 A;  3MFK A;  4EGY A;  3RKW A;  4G8X A;  1BI1 A;  1IXR C;  2FA5 A;  3S2W A;  5F64 A;  3G3Z A;  3DKW A;  1OYW A;  3MZY A;  2VN2 A;  1H0M A;  1KU2 A;  2GAU A;  3GUD A;  4RB2 C;  2A69 F;  5LGN A;  5FLX Z;  1Z9C A;  2STT A;  2EA4 A;  4A2U A;  1TQI A;  3V8K A;  1XSV A;  2ZNY A;  2DPU A;  2VBW A;  3HRS A;  1MZB A;  2L02 A;  1P4W A;  4I0A A;  1KQ9 A;  1LEA A;  4HZF A;  4AIK A;  4KIG A;  2Q2E A;  1T0F A;  3FMS A;  3I59 B;  3QU6 A;  5HVQ C;  2HKX A;  3E5Q A;  5DUK A;  3IWF A;  3N4M A;  1FYM A;  4BH9 A;  2F5C A;  2O8X A;  1AOY A;  5ERI A;  2W85 A;  1EH6 A;  1S7A A;  4KDP A;  1Z1D A;  2UXX A;  2Y0M A;  5LEK A;  1AWC A;  2GXB A;  3I54 A;  3QPT A;  1FSE A;  1BOA A;  3F21 A;  2HYG D;  3J81 Z;  3E6M A;  4L5J A;  5D8L B;  2CFX A;  1W4M A;  4PCQ A;  1W7P B;  3WOD F;  2RKH A;  4Z2Y A;  3VOE A;  1S3J A;  5LHI A;  2OD5 A;  2FE3 A;  2PFB A;  2UXN A;  4UNO A;  1Z91 A;  3HOS A;  3M1E A;  1S6L A;  1YLF A;  2DT5 A;  2OA4 A;  2P7C B;  1GXQ A;  3TDU C;  2HOE A;  4ETS A;  4M9S A;  3IRQ A;  3MAJ A;  5DD8 A;  2FEZ A;  5ICF A;  2V1U A;  4EQQ A;  5E20 A;  3ZQ7 A;  2AS5 F;  4EVI A;  2XKO A;  5FFX A;  3R60 A;  1B1B A;  1ZGA A;  2QBY A;  2DI3 A;  3MZH A;  5HDK A;  4M6Y A;  1IN5 A;  1XGO A;  3KP2 A;  1HXD A;  1F4K A;  3EQL F;  2WWY A;  4G7Z F;  5A2Q K;  5TRD A;  4CGZ A;  1ZH5 A;  3GEZ A;  1V3F A;  5E1X A;  5J8F A;  2VC0 A;  4L9T A;  2HTJ A;  3F23 A;  5IT9 K;  3ABU A;  4F7Z A;  1WRJ A;  4PZJ A;  1IW7 F;  1SMT A;  2MC3 A;  2XHK A;  2PLY A;  2OZU A;  1HQC A;  2KIF A;  2JPB A;  2O0Y A;  1Z6R A;  3BY6 A;  1HW1 A;  3WGG A;  3CDH A;  1OR7 A;  3LQR A;  3LST A;  2EB7 A;  2XAF A;  4UV8 A;  2XAQ A;  2EK5 A;  3WTU C;  3HYI A;  2FF4 A;  3RIR A;  4ZYE A;  1HSJ A;  1GVJ A;  2XUB A;  2V1D A;  4MQ9 F;  4Q4Z F;  5CLS A;  2XGX A;  3WTT C;  3WGH A;  4PDK A;  4UUV A;  4WWC A;  2KIU A;  4HX7 A;  1IN7 A;  1ONV A;  5E1Z B;  2EFO A;  2RQP A;  4Y13 A;  3FM3 A;  1G3W A;  2E7W A;  2ADU A;  2A61 A;  1QZZ A;  1WI9 A;  5K5O A;  1L0O C;  3HSF A;  2X4H A;  1OPC A;  2EJR A;  5CVR A;  1NHA A;  5LRR A;  3H3U A;  5HDN A;  2JTV A;  2GA2 A;  1FT9 A;  1KGS A;  2Z5U A;  4D0P A;  2XRO A;  1B6A A;  1XDS A;  1XN7 A;  1REP C;  2ESN A;  1XMK A;  4MHG A;  1LEB A;  3SZP A;  1G3T A;  1R23 A;  1XCV A;  4I02 A;  1MJ9 A;  5BPD A;  3IKV A;  4HV6 A;  2VON A;  3WTW C;  3ZMU A;  5EEH A;  2A6H F;  2ZJ2 A;  1SFU A;  2QZ8 A;  4WCG A;  2L3D A;  3J80 Z;  4UXN A;  1XGM A;  3KLN A;  4LB5 A;  3BPX A;  5ICG A;  3WTX C;  1MJB A;  1SD6 A;  4EMS A;  4LD5 A;  1YO5 C;  1R5G A;  3HHH A;  4N9H A;  5D5W B;  3E3V A;  4LJZ F;  3ZN1 A;  3ZMV A;  1KA8 A;  2MLK A;  1JHH A;  2H27 A;  4OIO F;  3ZPL A;  5FD6 A;  4B8X A;  1F9N A;  3HRT A;  3I59 A;  5BQT A;  1U5T B;  3TKY A;  5FLX K;  4FHT A;  1SD4 A;  2HR3 A;  4HQM A;  4I98 B;  2BYV E;  5L3D A;  1J75 A;  4HOB A;  3K2Z A;  2M30 A;  4ESF A;  2DLL A;  5DCF A;  2P8T A;  4AD9 A;  3PQJ A;  2IW5 A;  1FBU A;  2DU9 A;  3TO6 A;  1YW8 A;  3QPH A;  4XRF A;  4E70 A;  1QQI A;  3LA7 A;  3DEU A;  4KIB A;  1K6O A;  1I5Z A;  4WXC A;  3L7W A;  2FQ3 A;  3HOT A;  2FU4 A;  3J81 K;  3V7S A;  2WC2 A;  4ENJ A;  2VOP A;  3GFI A;  3V8J A;  2FSW A;  3E6B A;  5LEJ A;  4R79 A;  1KU9 A;  3CO7 C;  4HAM A;  2LSO A;  5K1Y A;  2G9W A;  1SMY F;  1R1T A;  4U0V A;  2CQK A;  3M7G A;  3WTV C;  2HKO A;  4HYE A;  1L3L A;  4AIH A;  2GWR A;  4HBL A;  2GA1 A;  4PGG A;  4P55 A;  2HWV A;  5F1R A;  2MLG A;  3BJO A;  4YII A;  3IKT A;  2ZXJ A;  1MDM B;  1MKM A;  4P96 A;  5E17 F;  3EYY A;  3VOD A;  3RKX A;  3COA C;  5AIQ A;  4HF1 A;  2DFI A;  1FWZ A;  2IA0 A;  1X3U A;  2OZ6 A;  2DK5 A;  3D5L A;  5HS7 A;  4M74 A;  4A6D A;  4XSZ F;  5IT3 A;  2H09 A;  3WG9 A;  4CO8 A;  1TNT A;  3GFM A;  2XKP A;  1O3R A;  2EFW A;  2D45 A;  4KT5 C;  4HW0 A;  1ZAR A;  3ZMT A;  2YPR A;  1BC7 C;  2FNP A;  2DO7 A;  5FB2 A;  2O3F A;  5FO5 A;  1FP1 D;  4OIN F;  1RZ4 A;  5LLQ A;  1ZRD A;  2LDU A;  3KP6 A;  4RB1 A;  2OU2 A;  5HLH A;  2B0L A;  3C1D A;  2HEO A;  3E5U A;  4YFN F;  4BQA A;  3W6J B;  5BMZ A;  2FBK A;  2QQ9 A;  4L18 B;  1KYZ A;  1P4A A;  1W5T A;  3BP8 A;  4S05 A;  4KUM A;  5D4R A;  3ELK A;  2XAJ A;  5D5X B;  2KJC A;  4A0X A;  4O6J A;  3LQQ A;  5H6Q A;  4RGS A;  2PBI A;  2PJP A;  3JAM K;  4ENK A;  4IRG A;  5JFR A;  2PMH A;  2IA2 A;  3HTS B;  3CO6 C;  1P2F A;  3GVA A;  2JZY A;  1FX7 A;  2A3S A;  1USS A;  2HGC A;  2KKO A;  1R58 A;  1WQ2 A;  1J0R A;  1FZP B;  2LKP A;  3HRM A;  3BDD A;  5FD5 A;  2GXG A;  2X0L A;  1JGS A;  3JSO A;  4AVP A;  4OU0 A;  3QP6 A;  4WF2 A;  3RPU A;  5L3B A;  1EV7 A;  4ZH4 F;  1MD0 A;  4PGH A;  1R00 A;  4LLN A;  3ZP5 A;  1B4A A;  3FMQ A;  2ISY A;  4MQV A;  3MEX A;  2P5V A;  2QVO A;  2NNN A;  2XAS A;  3MQ0 A;  3DPL C;  3CUQ C;  2IRF G;  2ISZ A;  4MEX F;  3J80 K;  2JPC A;  1XD7 A;  5DV5 A;  1U5T A;  1EH8 A;  5FGM A;  5LGU A;  3I0T A;  1LQ1 A;  1VTN C;  3RKY A;  4GCV A;  2MA3 A;  2PMU A;  1U6G A;  3VFZ A;  3M8E A;  4RS8 A;  1DDN A;  5LRS A;  2VE9 A;  2QEN A;  2ESH A;  4KN4 X;  5D6F A;  2D2W A;  3GO5 A;  1ZAO A;  3GXO A;  1YG2 A;  4UVB A;  4IVN A;  3TO7 A;  2F5E A;  1V4R A;  2DPD A;  4EJU A;  3P9I A;  4HLY A;  4B09 A;  2RDP A;  1B9M A;  3TGN A;  1BI3 A;  3LA2 A;  2VC1 A;  1UHM A;  1OMI A;  4CDG A;  3L9F A;  3LAP A;  3V7C A;  4IHT A;  4DNC A;  2QYO A;  1ULY A;  2JT1 A;  1O7F A;  4L0Y B;  1FC3 A;  3U9G A;  3R0J A;  2RGV A;  4I09 A;  3WE2 A;  1IZ1 A;  5KVR A;  1DP7 P;  2V1X A;  5CVV A;  1JHF A;  3HTU A;  1MDM A;  1KQ8 A;  2ACJ A;  2BBY A;  1R22 A;  3QAH A;  4Q47 A;  3ROU A;  5JR3 A;  3DFG A;  1T39 A;  2NYX A;  3RYP A;  2PN6 A;  1TTY A;  4IF4 A;  3WU1 B;  1IAW A;  4ZYH A;  3FXU A;  3Q9V A;  2Q8K A;  2FML A;  4WX9 A;  5K5R A;  2P5K A;  1BJA A;  3FF5 A;  4EJV A;  2DTR A;  4MTD A;  4M71 A;  3IHU A;  5HLG A;  3E5X A;  2NAZ A;  2ZO4 A;  2G7U A;  4HQE A;  4CIC A;  1SD7 A;  2Q0O A;  5BS6 A;  1RUO A;  1Z6T A;  1XMA A;  4OMY A;  4OIP F;  3REO A;  3GZ6 A;  2IJL A;  3GFJ A;  4KMU X;  1U3E M;  4ENM A;  1T38 A;  5DDG A;  1ZLK A;  1DPR A;  1SFE A;  4EM2 A;  1RI7 A;  4NHJ A;  1H9G A;  2K02 A;  4P9U A;  2GQQ A;  3F22 A;  2CWE A;  3JAM Z;  1PDN C;  1ZRF A;  1BI0 A;  3M8F A;  4FX0 A;  4LB6 B;  1S29 A;  3LFK A;  2IP2 A;  5DCM B;  2R3S A;  2IPQ X;  2VE8 A;  2DW4 A;  3O6B B;  3GZ5 A;  1RUN A;  4ZZD A;  4HDV A;  1T2K A;  5CVU A;  2W84 A;  4G7O F;  2MBF A;  2IVM A;  1D8J A;  1UCR A;  3H92 A;  5JHU A;  3KP5 A;  1FYK A;  2QUF A;  3CJN A;  5H6R A;  4ASN A;  3RTR A;  3ERE D;  3IC7 A;  1YW7 A;  4LK1 F;  3CTA A;  1MGT A;  2CO5 A;  3L09 A;  3QRF F;  5H20 A;  1Z7U A;  3DV8 A;  4HF2 A;  2IA1 A;  1JXS A;  3HHG A;  2K4B A;  3K69 A;  1E2X A;  4A5M A;  3RPQ A;  3WTY C;  5EEG A;  4RB3 C;  1ON2 A;  2K4J A;  1G6N A;  2ZME B;  5JVT A;  3JTH A;  1I1S A;  3K1P A;  2H6C A;  4EM0 B;  2WV0 A;  4YFX F;  3NEU A;  4M9X A;  4NQW A;  3DXJ F;  2A68 F;  3C7J A;  1TQP A;  1F1Z A;  2RNJ A;  1FYL A;  3AAF A;  2VOD A;  2HQR A;  5JI6 A;  4S04 A;  2EFN A;  4GXO A;  4KIF A;  4G94 A;  5FFZ A;  4KFC A;  4ZYD A;  1YW9 A;  5J8C A;  4CHU A;  2OQR A;  2D1H A;  2PI0 A;  2VBY A;  2HFH A;  2EV0 A;  2YX4 A;  3HSR A;  2K27 A;  4HA8 A;  2C6Y A;  5LHH A;  5LBQ A;  3F3X A;  1UST A;  3TDZ C;  1ZHF A;  4RGR A;  1PP7 U;  2MH2 A;  3R6S A;  3FWE A;  5LHG A;  4I7H A;  3U1D A;  1Z05 A;  2CG4 A;  4BAY A;  5BOX A;  2DBB A;  1IUY A;  2FOK A;  1G3Y A;  3KET A;  4OIR F;  1QNT A;  2L54 A;  3FX3 A;  5ICC A;  3NRV A;  3H3Z A;  2XV4 S;  2H94 A;  3MCZ A;  3K1N A;  2Y48 A;  3JTG A;  1WSU A;  5DD4 A;  3EDP A;  3IRR A;  4HF0 A;  1YYV A;  1ON1 A;  1A04 A;  4G7H F;  4M9Z A;  2XRN A;  4GYI A;  2DQL A;  4Q48 A;  3F6O A;  3KP7 A;  4L5I A;  4XLP F;  2EV6 A;  2V79 A;  3E6D A;  1D3Y A;  2XVC A;  3SFZ A;  5HOO A;  1QGP A;  2STW A;  2YSR A;  3V4G A;  1XSX A;  1HKQ A;  1IN4 A;  2QLZ A;  2GIV A;  3E97 A;  4EJO A;  2UZK A;  4G9Y A;  6PAX A;  1F5T A;  2JSC A;  4BYY A;  5CYV A;  4ENN A;  1TBX A;  4U7B A;  5CVJ A;  3WTZ A;  2HS5 A; 
#chains in the Genus database with same CATH topology
 4TV7 A;  4A6E A;  3C18 A;  2HDD A;  4IHW A;  2BE5 F;  3RI4 A;  1MMG A;  1G3S A;  2XF7 A;  1U2W A;  3JRD A;  5B1B H;  4AIJ A;  2X6W A;  2RV8 A;  2GOX B;  3PM1 A;  5B66 C;  3CLQ A;  1JGG A;  3HSE A;  3NWS A;  3BOQ A;  3HRU A;  1ETQ A;  1Y8Q B;  4XR6 A;  4X0G A;  2ZB9 A;  1ZQ3 P;  4KT6 A;  2M5W A;  3LSM A;  1XSD A;  2KJB A;  2DAO A;  3OSG A;  1WZ2 A;  2XAH A;  4BHC A;  3KZY A;  3FM5 A;  2VOO A;  2V9V A;  3BPV A;  3KZZ A;  4EV0 A;  3TO9 A;  3H5R A;  4ZC3 A;  3C2G A;  1TW3 A;  2HZT A;  1LUJ B;  4Y33 A;  3EYI A;  3GTG J;  3LOC A;  2MD5 A;  2QQB A;  4IZZ A;  2V1N A;  3E7L A;  4FX4 A;  1Y1W J;  5ILV A;  4XON A;  1B8I B;  1OCT C;  1IRF A;  2HDW A;  2FXA A;  1VND A;  1TWA J;  2M1B A;  2VJI A;  4MIM A;  1K4S A;  2DMN A;  4IHS A;  4X6A J;  1QO0 D;  3DTI A;  4LLL A;  3L2U A;  2E2J J;  4JQF A;  3I9V 2;  2V9P A;  3F6V A;  2ZNZ A;  4YFK F;  5DCM A;  5ED4 A;  4R1H A;  1LB2 A;  2CSO A;  3J7Y J;  1W5S A;  2FBH A;  2IBD A;  2BGC A;  3PFI A;  1G4D A;  2HYF A;  2OBP A;  4RM2 A;  1JE8 A;  4KIS A;  2AQE A;  3GWZ A;  2M45 A;  4RB0 A;  4Y15 A;  2YX7 A;  1FSH A;  4BE1 A;  2UWM A;  2CQ7 A;  2A5W A;  2EPF A;  2Y31 A;  3G1L A;  3HJE A;  2A5Y B;  5CVI A;  2H6B A;  3HGY A;  4PJM A;  1VQ5 I;  2Z3Y A;  3H9Q A;  4LG0 B;  5E8G A;  3LWF A;  1XDU A;  4I0B A;  1TC3 C;  2LF8 A;  3W6K B;  3ZRG A;  2AO9 A;  3A2K A;  4N0B A;  3GTM J;  3ZQH A;  4LGW A;  3FBI B;  3F8B A;  1U8R A;  1ACI A;  1ZGW A;  1FMW A;  2K5C A;  1X1P A;  1YQA A;  3V7R A;  2IGO A;  1KU7 A;  3B02 A;  3BJA A;  3DF8 A;  3KE2 A;  4BJ6 C;  4CZZ A;  3KP3 A;  3K2A A;  3OYM A;  4XRS G;  3DU6 A;  4Q5S F;  3CCY A;  3OS1 A;  1B72 A;  4CCL A;  1MBF A;  2K9M A;  1O3Q A;  5FJ8 J;  2OF7 A;  3MD2 A;  1IRG A;  1O57 A;  2QSG X;  2J5P A;  1WPK A;  2ZME A;  3FHZ A;  2ETH A;  1IDY A;  3N97 A;  4IRI A;  2R7S A;  2VIX A;  1ZG5 A;  4LIT A;  2QWW A;  3T1B A;  2O6G E;  2VKV A;  2PG4 A;  2R7D A;  2V26 A;  2E2I J;  4L9N A;  2X1D A;  2CUJ A;  2FMY A;  4G6D A;  1FBQ A;  5L3E A;  1H9T A;  2WAF A;  3SHF A;  4PJN A;  4R8H A;  3SZT A;  3ABT A;  3KCC A;  1K78 B;  1POG A;  4JBA A;  2VI6 A;  3BZ6 A;  1FNN A;  1X1D A;  4CXF A;  3SQN A;  3KEQ A;  4L9V A;  3C2H A;  3BWG A;  3HB9 A;  3H9J A;  3M9A A;  5BPI A;  3RYR A;  4J19 A;  4ESB A;  5D5V B;  1J7K A;  3CCL I;  1MBH A;  3VB2 A;  1R7J A;  2M2E A;  1D5Y A;  3QP5 A;  2ZFW A;  4IL6 C;  2E60 A;  4XK4 A;  5L3G A;  1X1A A;  2XGE A;  5CKT A;  2VQG A;  3PQK A;  2ZXW H;  3ML6 A;  3K9T A;  4BHP A;  4QPO A;  2VJJ A;  2HI3 A;  3EET A;  4BBR J;  5KAF C;  3MWM A;  3OIP A;  1XB4 A;  4RGX A;  2JUG A;  3E0J B;  3JW4 A;  1ZYR F;  4DIQ A;  1S5L C;  2R7V A;  1LNW A;  2ZKZ A;  3WGI A;  2EA2 A;  2MD0 A;  2P4W A;  1IC8 A;  1FIA A;  1J5Y A;  2VT2 A;  3DQV C;  5EYR A;  1W1W E;  1R49 A;  3S15 J;  1GVD A;  3IL2 A;  4K2E A;  2Y9Z A;  5FKM A;  2ZJQ F;  2FUG 2;  3KP4 A;  3BG6 A;  1DU0 A;  1YRN A;  3HUG B;  1HOM A;  3SJM A;  2EIJ H;  4CYC B;  2BHZ A;  2HDC A;  3IAM 2;  3K4N A;  1LKX A;  1T08 B;  2CQQ A;  2LOO A;  3GLX A;  3W2V A;  5D4S A;  1QA6 A;  2DN0 A;  3C3W A;  1R4N B;  1LDD A;  1R1V A;  1XMX A;  2F4M B;  4IXA A;  1FY7 A;  3QU3 A;  2DCE A;  4HX8 A;  1FPQ A;  3K1M A;  1IGN A;  4HPQ A;  4L0Z B;  4OOI A;  2EIL H;  3RKQ A;  4N4O B;  3PIP F;  3LFU A;  1YJN I;  4IPA A;  3P9K A;  2VL8 A;  1YFH A;  2DFF A;  2JA7 J;  1VQ7 I;  4CA0 A;  3GTK J;  4EJT A;  3I4M J;  1Q1H A;  4OIQ F;  2EWN A;  3AG1 H;  1JT0 A;  3JRB A;  1BIB A;  2E1N A;  4B43 A;  2IXS A;  1X19 A;  1DP3 A;  1STZ A;  5IP9 J;  1AKH B;  4YG2 F;  1HST A;  1JI8 A;  2F6C A;  4M3D A;  3WU0 A;  3ASN H;  4YIF A;  3T5X A;  5FRM A;  4OAY A;  2AXT C;  2D1V A;  4BL0 B;  1XPX A;  2LTP A;  4HLX A;  1R5H A;  3I58 A;  1V55 H;  3DTE A;  2FQ4 A;  3ZMS A;  2J5O A;  3K6G A;  4KA4 A;  1TLH B;  3OL3 A;  1J59 A;  1RIO H;  1Z67 A;  1K7A A;  1T95 A;  4B4C A;  4XN0 A;  2G7H A;  1QZY A;  3HBL A;  4JK1 X;  1P6R A;  3PIO F;  1U5T C;  4S0H B;  4A3C J;  3ZN0 A;  1QBJ A;  4LLG F;  1J2X A;  3BR3 A;  2TDX A;  4NC6 A;  1MW7 A;  4N9I A;  2R5Y A;  3PSI A;  1DUX C;  2YR2 A;  2L4M A;  2MH9 A;  4WXD A;  3ECO A;  3ZMD A;  2RRE A;  2F5V A;  3P9C A;  4BDZ A;  2FRH A;  2DA5 A;  4JX4 A;  4JX6 A;  4WXH A;  3HC7 A;  2OTL I;  2OAZ A;  4EGZ A;  2O9L A;  2LFB A;  3VEP A;  2QGU A;  1QPM A;  3Q5F A;  1MMD A;  1GT0 C;  2WTE A;  1XGS A;  3I4P A;  4A12 A;  3OYB A;  1RNL A;  1P92 A;  1FOW A;  5K5Q A;  1LFU P;  1A36 A;  4BXF A;  2ELH A;  3OYC A;  2JA6 J;  2DA3 A;  2IEK A;  1W36 C;  1S8N A;  4IRH A;  4MNU A;  1ZG3 A;  1PUE E;  2JRT A;  2CS3 A;  2OCC H;  5E3N A;  1X1C A;  4HEA 2;  4IKF A;  5IP6 A;  1WWX A;  4O5V A;  2K85 A;  5J6X A;  2ZXI A;  4P5O A;  2W24 A;  4QLC U;  3MKW B;  2NOJ B;  4PK4 A;  4E7Z A;  2ZC2 A;  2L7M P;  1E3P A;  3PL8 A;  3GYH X;  3U2R A;  3IV5 A;  1T6S A;  2P7V B;  5LFA A;  4A3M J;  2VPL A;  2HQN A;  3ABK H;  2RN7 A;  4OMZ A;  5LGT A;  3JRF A;  3G73 A;  1CGP A;  1TNS A;  4LK0 F;  2XAG A;  4RMN A;  2DMP A;  4ESJ A;  5AON A;  2HVQ A;  4BXU A;  3R4K A;  5D5U B;  4A0Z A;  5H2F C;  4XKB A;  3LA3 A;  1X58 A;  1B8I A;  1HKS A;  2I5U A;  3IAS 2;  3OV8 A;  2W57 A;  2E1C A;  1X3Z B;  1TWG J;  2ZSI B;  1AU7 A;  3ZQG A;  2V6C A;  3S1R J;  1AA7 A;  1UB9 A;  3VSL A;  4XM3 A;  3LL7 A;  4F91 B;  4E7J A;  1ZRC A;  2CU7 A;  1ZN2 A;  2A6E F;  4QIW N;  4NB5 A;  3CUQ B;  3S1Q J;  5J4V A;  2P6T A;  4GO1 A;  1LVA A;  4XL9 A;  4RM3 A;  1H89 C;  2R92 J;  4GGG A;  1OLT A;  2Z99 A;  1MMN A;  2A07 F;  1YJW I;  3L00 A;  3RDI A;  4I2O A;  1BBY A;  5E8I A;  2IGN A;  3BRO A;  3RJP A;  1GXP A;  3MVP A;  4XBF A;  3BG9 A;  1MH3 A;  3K4L A;  2EFQ A;  3I71 A;  4GYG A;  3TBI A;  2JVG A;  2PQ8 A;  3F72 A;  4AWX B;  1JUM A;  2Y2Z A;  2DA4 A;  4LMY A;  2LG4 A;  4RGU A;  4CYD A;  5GAE J;  4C2U A;  3D5R C;  3V42 A;  5FRO A;  3UKG A;  2NNY A;  1CF7 B;  5L3F A;  1XTA A;  1LDK B;  3B73 A;  5TJJ A;  2XSD C;  4LG0 A;  4CCK A;  3A4C A;  4L9J A;  3R61 A;  2X6X A;  1TQM A;  2L7K A;  1K83 J;  4F52 A;  4A3G J;  2KIM A;  4KIC A;  5GP9 A;  3I53 A;  2XGD A;  1PP8 F;  2O61 A;  4XRM A;  2QA4 I;  2W25 A;  3BJ6 A;  3HIF A;  1LJ9 A;  1TWF J;  3CJR B;  1BIA A;  2DK8 A;  2JJ7 A;  1ZGJ A;  1X2N A;  4MGR A;  1S7O A;  2MG4 A;  2E35 A;  2HXI A;  5CPR B;  3TED A;  3K0L A;  4I76 A;  3BTC A;  5GAH J;  4M73 A;  3LSG A;  4U7D A;  4MEY F;  2E5N A;  3QOD A;  4KN7 X;  1SFX A;  4ZTJ A;  3TQN A;  3TOB A;  2ZBK A;  4FT8 A;  1VQ9 I;  3GFL A;  4FE7 A;  3OYA A;  4II3 A;  5DYM A;  1P7J A;  2R93 J;  4FAS D;  5L3C A;  3FZV A;  3QWL A;  3J7A O;  1RRJ A;  3E6C C;  1BW5 A;  2HOT A;  3GTO J;  3F8M A;  3Q9S A;  2ICW G;  3O8H A;  4A0Y A;  2QEX I;  1B59 A;  4UUT A;  4H0E A;  4MO7 A;  1OQY A;  3R0A A;  3D0S A;  2VBX A;  2EV5 A;  1O7L A;  2XGC A;  1J9I A;  2WBM A;  4BHB A;  1QZE A;  2BEO A;  2KIQ A;  4M6X A;  2GM4 A;  1BI2 A;  2GZW A;  1K78 A;  5E3O A;  2R7R A;  2LBF B;  4JX5 A;  3OOP A;  3F8C A;  2IT0 A;  3ECH A;  3I64 A;  3LSR A;  3H0D A;  1YS7 A;  3FXQ A;  4ZTF A;  1OYI A;  2P6S A;  5FKO A;  3IH4 A;  1HF0 A;  3F8N A;  4MTE A;  2XIG A;  3T8R A;  5DUI A;  1R4M B;  3IH2 A;  5EJC A;  3EUH A;  2Q2E B;  2GBY A;  5E18 F;  3CF2 A;  2LNB A;  2Y0S A;  4I01 A;  4PFP A;  2NRA C;  4RAZ A;  1UFM A;  3RCO A;  2HU9 A;  3NQO A;  3BR2 A;  5E3M A;  3CDI A;  2LMD A;  1GHC A;  2NS0 A;  4KNY A;  5E3L A;  2X1C A;  5ICE A;  1YS6 A;  2R7F A;  3CZ6 A;  1WGX A;  3OSF A;  1R36 A;  4YEL A;  1V5E A;  1XS9 A;  3DBH B;  2CW7 A;  3CCM I;  2VKH A;  3ERM A;  3W3C A;  1D5V A;  1IXS B;  1IXC A;  4EM1 A;  2DA7 A;  3CCU I;  3O3K A;  2DQR A;  3HUG A;  3LAJ A;  4CYC A;  3I3L A;  2E5Z A;  3JCU C;  2HTS A;  4KMF A;  1I27 A;  1UZC A;  2K9S A;  2COM A;  1RKW A;  2R5Z A;  1QPI A;  5HS8 A;  4HV5 A;  5KK1 A;  1W7P A;  1OCC H;  4E7L A;  4AUX A;  2F5D A;  1KQ0 A;  4F3Q A;  1WJC A;  4BDY A;  3LNQ A;  1E17 A;  4M3B A;  3L1P A;  2E2H J;  4YIR X;  2VXD A;  4JYK A;  3ISP A;  1WKM A;  2K86 A;  2AXL A;  4PUS A;  3JSP A;  1DPU A;  3FMR A;  3EUK L;  3KZI C;  1O3T A;  5A2Q Z;  5AIP A;  1WCM J;  2WAQ A;  2MGQ A;  1WJE A;  5IOY A;  1FBS A;  4FE4 A;  5ILS A;  3CES A;  3TOA A;  4NNJ A;  1AKH A;  2JMW A;  2EQR A;  2P0W A;  3CD6 I;  1I6X A;  2M3A A;  1WJF A;  2M0M A;  5DEQ A;  1ODD A;  4HX4 A;  3DP7 A;  2L4A A;  3GW2 A;  3EUA A;  3T0Y A;  4EAT A;  5IT9 Z;  2DMQ A;  2JA2 A;  5D8K B;  3CCE I;  3IWZ A;  1B9N A;  4CCJ A;  3Q0W A;  2FNA A;  5C44 J;  1SAX A;  3UR3 C;  3CP8 A;  4A3I J;  4UHT A;  1YTY A;  1TWH J;  3WE3 A;  3GTL J;  4XLE A;  1LVK A;  2RVC A;  3GX4 X;  4G6Q A;  1XCB A;  2DYS H;  4PSX A;  3KLO A;  4U88 A;  2QBY B;  1K79 A;  2HOS A;  3DLL F;  4DBR A;  2BY0 A;  1FLI A;  1WVR A;  2MAB A;  3FKI J;  4LFU A;  4II2 A;  4DOZ A;  2Z9O A;  3WTS C;  3QYF A;  3CMA I;  4U0W A;  1BN5 A;  2QM3 A;  2E34 A;  1ZRE A;  2DT7 B;  2ID3 A;  4XLN F;  4A5N A;  3I4N J;  1K6Y A;  2O03 A;  3ULQ B;  4HDU A;  1R71 A;  2UV1 A;  3KEY A;  4B3A A;  5M5W J;  3G1M A;  3KYC B;  4XLA A;  2LP0 A;  3CP2 A;  5HS9 A;  3HG9 A;  3HM5 A;  5E1W A;  5K7F A;  2E7X A;  1GDT A;  2CGP A;  1ZLJ A;  2RQQ A;  4UVC A;  1Z3Y A;  4F93 B;  1XGN A;  4UY8 I;  4QWQ A;  4FIS A;  1JJ6 C;  4ON0 A;  1IN8 A;  2CYY A;  4M3F A;  2DOD A;  3I55 I;  1BC8 C;  3SFI A;  4RAG A;  4FTH A;  3KPH A;  3UNG C;  1DQU A;  1IF1 A;  1I3Q J;  2CV1 A;  2BVL A;  2L5Q A;  1FOK A;  3DPT A;  2DOE A;  2M9H A;  2N8G A;  3ZMZ A;  3C2B A;  2OQG A;  3FKJ A;  4Y17 A;  1O3S A;  2QQ8 A;  4AVZ A;  1BM9 A;  1JKR C;  1Y0U A;  5CJ9 A;  1WFX A;  4ZZL A;  1X4P A;  4DQ2 A;  2K7L A;  3CQZ J;  2EIN H;  2QF7 A;  3CC4 I;  3OIQ A;  2L01 A;  2P5L C;  3S14 J;  2F2E A;  2YU3 A;  3T8T A;  4LG3 A;  2LR8 A;  1X2M A;  5KCM A;  3HDD A;  3H9G A;  4KYW A;  2VQL A;  2HPM A;  2RAE A;  4U87 A;  1IN6 A;  3CLO A;  3AG4 H;  2ZCW A;  3SXY A;  3DKY A;  4CSW A;  2KRF A;  1SD5 A;  1I1G A;  3BG3 A;  5GPC A;  1KYW A;  3AG2 H;  5D6E A;  3GME A;  2F48 A;  5IYB J;  2Z33 A;  1YIO A;  2VT3 A;  2ZSH B;  4A3F J;  4DBQ A;  3S8P A;  5HLI A;  1AHD P;  1C0W A;  4BY1 J;  4M72 A;  1HW5 A;  4XSX F;  1LDJ A;  3CUO A;  3P7N A;  1Z7L A;  3CUQ A;  9ANT A;  2AHQ A;  4UV9 A;  5LD2 C;  3F8F A;  5HDG A;  3FXR A;  2VBZ A;  3I5U A;  3M1C A;  4AYB N;  2FBI A;  3FXM A;  3AFH A;  2CW0 F;  1T98 A;  1W7P D;  2AQF A;  4WK8 F;  1FJL A;  2QQA A;  2BV6 A;  2RNG A;  2M87 A;  1R6R A;  1W0U A;  1UHW A;  2E1O A;  3KFW X;  4RAY A;  2IGK A;  4XQF A;  3QOP A;  2WV1 A;  5F6F A;  4O3M A;  1HBX G;  1CF7 A;  4ZYG A;  2IS1 A;  3KEO A;  5EEA A;  1W0T A;  2WA0 A;  2Y0S N;  2EFP A;  1HW2 A;  2CQX A;  2L9N A;  3V8L A;  3GF2 A;  2RC4 A;  2VXZ A;  1MJA A;  4IJA A;  4U0Y A;  1U78 A;  2E1M B;  3RSN A;  2PEX A;  1P4X A;  2CQN A;  2ME6 A;  4JOM A;  3L2C A;  1EH7 A;  1D8K A;  1TW2 A;  2LF7 A;  2Y75 A;  1FP2 A;  3SEQ A;  3O2P E;  1KU3 A;  4IQJ A;  1V5F A;  2Y30 A;  2F5F A;  3SZG A;  2CUE A;  4BNC A;  2M8E A;  1R1U A;  3FIW A;  2LVS A;  4UVA A;  1OYY A;  1OKR A;  1ZEL A;  1RR8 C;  3QOE A;  4P9F A;  4DGW B;  3PFY A;  4EJW A;  5ILU A;  1HKT A;  1P7I A;  1ZG1 A;  2CUF A;  3MFK A;  4EGY A;  3RKW A;  4G8X A;  1BI1 A;  2BXY A;  3HZJ A;  2L0K A;  4D1Q A;  2GLO A;  3HPG A;  1IG7 A;  1IXR C;  3PJR A;  2FA5 A;  3S2W A;  4XLC A;  5F64 A;  2TCT A;  4M3E A;  3G3Z A;  3DKW A;  3S3M A;  1OYW A;  3MZY A;  1SFK A;  2VN2 A;  1H0M A;  1KU2 A;  4BBS J;  4C3I J;  2GAU A;  1ETY A;  1D0Z A;  3GUD A;  4RB2 C;  2A69 F;  5LGN A;  3KYL A;  5FLX Z;  1Z9C A;  2BZT A;  1FMV A;  1SVL A;  2STT A;  2EA4 A;  3VYR B;  4A2U A;  2JRM A;  2BW3 B;  1TQI A;  3V8K A;  3L2W A;  2FD5 A;  1XSV A;  2ZNY A;  2LBF A;  2DPU A;  2VBW A;  1Y8R B;  2WAQ N;  3DWL E;  1MZB A;  2O5R A;  3HRS A;  1IUF A;  2MYS A;  2L02 A;  1P4W A;  4I0A A;  3TW7 A;  1SVO A;  2CW8 A;  1KQ9 A;  2BHY A;  1LEA A;  4HZF A;  4AIK A;  1Y56 A;  2IS4 A;  4KIG A;  3W2W A;  2XPW A;  2Q2E A;  1ERD A;  4DYC A;  1T0F A;  3FMS A;  1UJ8 A;  2DMT A;  1SVM A;  3I59 B;  4XOP A;  3VYU B;  2ME0 A;  1SAN A;  3BZC A;  2LD5 A;  3QU6 A;  5HVQ C;  2HKX A;  2HPI A;  3E5Q A;  5DUK A;  3IWF A;  3N4M A;  1FYM A;  2HZD A;  4BH9 A;  2F5C A;  2O8X A;  1AOY A;  5ERI A;  1BA5 A;  1RR7 A;  2W85 A;  1EH6 A;  1S7A A;  4KDP A;  4D7M A;  5EZG A;  1Z1D A;  2UXX A;  2Y0M A;  3BR5 A;  3ZQI A;  5LEK A;  1AWC A;  3TP3 A;  3I54 A;  3QPT A;  2GXB A;  4LIV A;  1FSE A;  1BOA A;  2OCE A;  2HYG D;  3B6C A;  3F21 A;  1V5G A;  3J81 Z;  5GAG J;  3E6M A;  3LSI A;  5J1Y A;  4L5J A;  2JUC A;  2JK3 A;  5D8L B;  2CFX A;  1YI2 I;  2R7X A;  4V2G A;  1W4M A;  2R5Z B;  4PCQ A;  4NDL A;  1W7P B;  4CH7 A;  2IS6 A;  3WOD F;  2JN6 A;  3ABL H;  2W00 A;  2VLA A;  2RKH A;  4Z2Y A;  3VOE A;  2KMU A;  3AG3 H;  4AC0 A;  2OTJ I;  1S3J A;  1EJ9 A;  5LHI A;  1MND A;  1LFP A;  4A3E J;  2VB6 A;  2OD5 A;  2FE3 A;  2PFB A;  2UXN A;  2KIS A;  3OL4 A;  4UNO A;  1T33 A;  3S1N J;  1Z91 A;  3HOS A;  3M1E A;  3HPH A;  1R5I D;  1S6L A;  3DU5 A;  2OA4 A;  1YLF A;  2DT5 A;  2P7C B;  3ABM H;  1GXQ A;  1ETO A;  2WB1 N;  4W1U A;  5HNF A;  3K4J A;  3TDU C;  2HOE A;  4ETS A;  1RPW A;  3A03 A;  1OCP A;  2KFD A;  2ZME C;  4M9S A;  5GPA A;  3IRQ A;  3MAJ A;  5DD8 A;  3PNY A;  2FEZ A;  5ICF A;  2JWT A;  2V1U A;  4EQQ A;  5E20 A;  3ZQ7 A;  1HLV A;  2AS5 F;  4EVI A;  5DM7 F;  2XKO A;  2MFZ A;  1HA8 A;  5FFX A;  3R60 A;  5EF6 A;  1B1B A;  1ZGA A;  2CRG A;  3HXL A;  3A01 B;  1JUP A;  3H1C A;  2QBY A;  5J3L A;  2DI3 A;  3MZH A;  2K9N A;  5HDK A;  4M6Y A;  1IN5 A;  4BEH B;  2BOL A;  1XGO A;  4D9J A;  3KP2 A;  1HXD A;  1F4K A;  2DOA A;  3EQL F;  2WWY A;  4G7Z F;  5A2Q K;  5TRD A;  4CGZ A;  1ZH5 A;  3GEZ A;  1V3F A;  5E1X A;  3CC7 I;  5J8F A;  2VC0 A;  4L9T A;  4CCO A;  3OYD A;  2BY1 A;  3AL0 C;  2H8W A;  3ESW B;  1P9Q C;  4D5F A;  4RAF A;  5HOD A;  2HTJ A;  3F23 A;  1MMS A;  1PUF B;  1MNE A;  4UUS B;  5IT9 K;  3ABU A;  4F7Z A;  1A6Q A;  5IY5 H;  2P81 A;  1WRJ A;  2QSF X;  2XB5 A;  4PZJ A;  4AU7 A;  4DZJ A;  5J1U A;  3CMM A;  2HQA A;  2KZG A;  1GUU A;  1MNM C;  3RPU D;  1IW7 F;  1SMT A;  2MC3 A;  2VJ5 A;  2XHK A;  2XSJ C;  2PLY A;  2OZU A;  1HQC A;  3OR1 C;  4A69 C;  5DS9 A;  3HOV J;  2KIF A;  1I39 A;  2PX9 A;  2JPB A;  2O0Y A;  1XG1 A;  1E3H A;  2DJN A;  4PJ0 C;  2A6T A;  1Z6R A;  1WH7 A;  3MMY B;  3BY6 A;  1ZKG A;  5IP7 J;  1HW1 A;  3S16 J;  3D5S C;  4PFO A;  3WGG A;  5EG0 A;  2V6E A;  3CDH A;  1OR7 A;  3LQR A;  3LST A;  3OYG A;  2EB7 A;  1GV2 A;  2QCO A;  3BR6 A;  2XAF A;  4CCN A;  4UV8 A;  2XAQ A;  2ID6 A;  2NVT J;  1VQ4 I;  3IH3 A;  1FTZ A;  2EK5 A;  4PJL A;  2DTZ A;  2XF6 A;  4FET A;  2VQC A;  2F4O B;  1R9T J;  2MW8 A;  3WTU C;  3HYI A;  2FF4 A;  4M6V A;  3RIR A;  4ZYE A;  5JLW A;  2DFE A;  2Y9Y A;  4Y52 J;  1HSJ A;  2GXA A;  3WU2 C;  1GVJ A;  2L9V A;  2XUB A;  2V1D A;  5B1A H;  1XC5 A;  4MQ9 F;  4Q4Z F;  5CLS A;  4V19 K;  1LFB A;  2XGX A;  3LSP A;  3OY9 A;  3WTT C;  3QQA A;  3WGH A;  4PDK A;  4RLQ A;  2ECC A;  4UUV A;  4WWC A;  2KIU A;  2O7O A;  4HX7 A;  3BC8 A;  1IN7 A;  1ONV A;  5E1Z B;  4QPQ A;  3G71 I;  4A3K J;  2EFO A;  4BU2 A;  3ONQ A;  2RQP A;  1YIJ I;  4E7S A;  4Y13 A;  2CV2 A;  3QYB A;  2HYJ A;  3FM3 A;  4A3J J;  5F08 A;  1QU3 A;  2JA8 J;  1W36 D;  1G3W A;  2E7W A;  3HEF A;  2ADU A;  2A61 A;  1QZZ A;  3Q3S A;  4C9Y A;  4AM3 A;  1WI9 A;  5K5O A;  3K4B A;  3S3N A;  1K4T A;  1L0O C;  2VUM J;  3HSF A;  2X4H A;  1OPC A;  1W5C C;  2Y69 H;  2EJR A;  3U1K A;  5CVR A;  1NHA A;  5LRR A;  4NC8 A;  3H3U A;  5HDN A;  2JTV A;  4XIC A;  2GA2 A;  5DM6 F;  2Q1Z B;  1FT9 A;  1KGS A;  2KQR A;  2Z5U A;  4D0P A;  2XRO A;  1B6A A;  1ETX A;  1XDS A;  3FK6 A;  4E7H A;  1ETK A;  1XN7 A;  1REP C;  2ESN A;  1XMK A;  3LSH A;  3Q0U A;  2GIZ A;  1PYV A;  5FKK A;  3VYS B;  4MHG A;  1LEB A;  2DA6 A;  3DCF A;  4MLO A;  3SZP A;  4ZYA A;  1G3T A;  5KAI C;  1R23 A;  1XCV A;  4I02 A;  2KL4 A;  1MJ9 A;  4GRI A;  5BPD A;  3G1O A;  4YRV A;  2D5V A;  3IKV A;  3D1N I;  4HV6 A;  5FRN A;  3QPL A;  2VON A;  3WTW C;  4JP0 A;  3ZMU A;  5EEH A;  4ZDP A;  2DDA A;  2A6H F;  4NC7 A;  3B6A A;  2ZJ2 A;  4IX7 A;  3FXO A;  3ZQL A;  3PSF A;  1SFU A;  1YOV B;  2QZ8 A;  4WCG A;  2L3D A;  3J80 Z;  4UXN A;  1XGM A;  3KLN A;  1BR2 A;  2L2O A;  4LB5 A;  3BPX A;  5ICG A;  3WHC A;  5CQG A;  3W2A A;  3WTX C;  1MJB A;  1ETV A;  2BW3 A;  2R0Q C;  3CCJ I;  4W97 A;  2PJR B;  4AYB A;  1SD6 A;  4Y4R A;  4C3H J;  4EMS A;  4LD5 A;  1YO5 C;  1R5G A;  3GTQ J;  2DJI A;  2K40 A;  3HHH A;  4N9H A;  5D5W B;  3E3V A;  2HQ5 A;  1D1B A;  1MBE A;  1A5J A;  4LJZ F;  3FIS A;  3ZN1 A;  3ZMV A;  1KA8 A;  3MZ8 A;  2MLK A;  1JHH A;  3ZCO A;  2H27 A;  4OIO F;  1BR1 A;  3NWT A;  2W1O A;  4B48 A;  3ZPL A;  5FD6 A;  4B8X A;  5F04 A;  2V9K A;  1NG7 A;  1F9N A;  2VPR A;  4A3B J;  3HRT A;  3I59 A;  2EZL A;  4ITV A;  2OJE D;  5BQT A;  1U5T B;  3TKY A;  5FLX K;  3DPU A;  4FHT A;  1HCR A;  2DFH A;  2H8R A;  3HL2 A;  2X85 A;  1SD4 A;  2HR3 A;  4HQM A;  3K70 D;  1JUS A;  4I98 B;  4XKV A;  3JR9 A;  4HG2 A;  5M3F J;  2BYV E;  4B3X A;  2L7Z A;  2LRD A;  5L3D A;  1J75 A;  4HOB A;  3K2Z A;  2M30 A;  4ESF A;  1OFC X;  2DLL A;  2DA1 A;  5C3E J;  1BW6 A;  2CJJ A;  5DCF A;  2P8T A;  4AD9 A;  4I99 C;  4X1E A;  3O8G A;  2CFO A;  3PQJ A;  1VQP I;  4GFB A;  2DA2 A;  2IW5 A;  2HVS A;  4BUP A;  3TMO A;  1FBU A;  2EH3 A;  2NXN B;  2DU9 A;  2LYC A;  1VQK I;  3TO6 A;  2M34 A;  1YW8 A;  1SFO J;  1N75 A;  1X3W B;  3QPH A;  5IPA A;  1JKP C;  4XRF A;  4E70 A;  1QQI A;  3LA7 A;  3DEU A;  4KIB A;  1K6O A;  4V2F A;  4XLH A;  5F27 A;  1I5Z A;  3A0B C;  3PNV A;  3L7W A;  2FQ3 A;  4WXC A;  3HOT A;  3M3Y J;  1HDD C;  2FU4 A;  3TP0 A;  3J81 K;  3V7S A;  1N78 A;  1HC8 A;  2WC2 A;  4ENJ A;  2VOP A;  3GFI A;  2E19 A;  3QYE A;  2LRE A;  3V8J A;  1Y39 A;  2FSW A;  2DYR H;  3E6B A;  3OR2 C;  5LEJ A;  3FXJ A;  3H5A A;  4R79 A;  1KU9 A;  3CO7 C;  4HNU A;  1LE8 B;  4HAM A;  5F1J A;  2LSO A;  5K1Y A;  3OYN A;  4G6T B;  2G9W A;  4XOT A;  1X4O A;  1SMY F;  3A01 A;  1R1T A;  4U0V A;  3JRH A;  2CQK A;  3M7G A;  5B5E C;  1MBK A;  4BEH A;  1FOX A;  5J47 A;  3WTV C;  4PSW A;  2HKO A;  3E1S A;  4HYE A;  4N4N B;  3DEW A;  3ZQC A;  1L3L A;  4AIH A;  1X1B A;  4RA2 A;  3M8J A;  2CH0 A;  2GWR A;  4HBL A;  2GA1 A;  1UG2 A;  4PGG A;  3EUH C;  2M8G X;  2DXI A;  5J40 A;  3WHB A;  4P55 A;  4GDF A;  2B9S A;  1I3A A;  2HWV A;  1D0X A;  2HXO A;  5F1R A;  1H88 C;  2MLG A;  3BJO A;  4YII A;  1PUF A;  3IKT A;  4UUS A;  2ZXJ A;  2EZH A;  1ZR4 A;  1MDM B;  1MKM A;  4XKC A;  5FLM J;  3CDL A;  4IEJ A;  1IDZ A;  1V54 H;  3OOU A;  3ZOB A;  2CMP A;  4P96 A;  2TRT A;  1U0J A;  2QSH X;  5E17 F;  3EYY A;  3VOD A;  3RKX A;  2M4K A;  3FDY A;  3COA C;  1O4X A;  5AIQ A;  4HF1 A;  2DFI A;  1FWZ A;  2EZI A;  2IA0 A;  1X3U A;  2OZ6 A;  2KRC A;  4ZJZ A;  1G2H A;  2DK5 A;  2XDV A;  3D5L A;  5HS7 A;  4BJT A;  3OYH A;  1YIT I;  2WB1 A;  1J09 A;  1PJR A;  4M74 A;  5EG0 B;  4A6D A;  2V4J C;  4XSZ F;  5IT3 A;  4HSR A;  3HOY J;  2H09 A;  3X2Q H;  3CF5 F;  4Y3O A;  3WG9 A;  2K9Q A;  1TT0 A;  3RZD J;  4CO8 A;  1TNT A;  2LH9 A;  1VF9 A;  1YX3 A;  3GFM A;  2XKP A;  3KX2 A;  1O3R A;  2EFW A;  2D45 A;  2WAD A;  4KT5 C;  4HW0 A;  3ZQQ A;  1IO2 A;  1ZAR A;  3ZMT A;  3L2V A;  1E0E A;  2YPR A;  1Y1V J;  4XOR A;  3BCA A;  1EKE A;  1BC7 C;  2IS2 A;  2FNP A;  2DO7 A;  3DBR B;  5FB2 A;  2O3F A;  5FO5 A;  5EGO B;  1FP1 D;  3A1Y A;  4BQO A;  2F4I A;  1RES A;  3TW6 A;  4C30 A;  1NK3 P;  1S72 I;  4OIN F;  3OYF A;  1RZ4 A;  3CJT B;  1H8A C;  5LLQ A;  4RLF A;  3FHN A;  1ZRD A;  2FX0 A;  2LDU A;  3KP6 A;  4Z6Y A;  3KIO A;  4ABZ A;  2OU2 A;  4RB1 A;  5HLH A;  2B0L A;  3C1D A;  2HEO A;  1T56 A;  3E5U A;  2DT6 A;  4RDU A;  3NAU A;  4YFN F;  2E36 A;  3EPZ A;  4XLF A;  3BT9 A;  4BQA A;  3W6J B;  3G2B A;  5BMZ A;  1NK2 P;  2FBK A;  2QQ9 A;  1A6I A;  4L18 B;  4IHY A;  1KYZ A;  1OCZ H;  1P4A A;  1W5T A;  5TIS C;  3BZK A;  1TL8 A;  3BP8 A;  4S05 A;  3OYE A;  1EF4 A;  2WY8 Q;  3CJQ B;  4KUM A;  4B44 A;  5D4R A;  4H4K C;  3ELK A;  2XAJ A;  5D5X B;  4IO9 F;  3VWB A;  1KON A;  2NVQ J;  2JQ7 A;  2KJC A;  4A0X A;  4O6J A;  3KYD B;  2NVX J;  1NTC A;  2A05 A;  5FLV A;  3LQQ A;  5M5Y J;  5H6Q A;  4RGS A;  1PVE A;  1IRX A;  1VQ6 I;  4P1W A;  2PBI A;  3K4K A;  1SEU A;  2PJP A;  3JAM K;  4ENK A;  4IRG A;  5JFR A;  3PUF A;  2PMH A;  2IA2 A;  1BOB A;  3HTS B;  5KHD A;  3CO6 C;  1P2F A;  3GVA A;  3QPS A;  2JZY A;  3HOX J;  1FX7 A;  2A3S A;  1USS A;  2HGC A;  2KKO A;  1R58 A;  3VPR A;  3K4M A;  1TP4 A;  1WHU A;  2Z1D A;  2JSP A;  1WQ2 A;  1MH4 A;  1J0R A;  3AKZ A;  1FZP B;  3G6E I;  2LKP A;  1DU6 A;  3HRM A;  3BDD A;  5FD5 A;  2GXG A;  2X0L A;  3NAR A;  1MSE C;  1JGS A;  3JSO A;  5JHF A;  4AVP A;  2NS7 A;  3Q0V A;  4OU0 A;  1Z3X A;  5M3M J;  2NVY J;  5J4Y A;  1OIS A;  2BVM A;  1ZK8 A;  1OCR H;  4HNV A;  3QP6 A;  4WF2 A;  3RPU A;  2PJR A;  5L3B A;  4D7N A;  1EV7 A;  4ZH4 F;  2X51 A;  4YEJ A;  1MD0 A;  4PGH A;  1R00 A;  3DKX A;  1RC9 A;  1ZR2 A;  2K9L A;  4LLN A;  3ZP5 A;  1B4A A;  1ZTR A;  3FMQ A;  2R7Q A;  5F0H A;  3BTJ A;  2ISY A;  4MQV A;  3MEX A;  2P5V A;  2QVO A;  3BLY A;  2NNN A;  1NG6 A;  2XAS A;  5JLX A;  2R7W A;  3MQ0 A;  4NQW B;  4RBO A;  3DPL C;  2Z2S B;  5F0C A;  3CUQ C;  5HLT A;  2K3P A;  2W7N A;  3L2Q A;  2IRF G;  2ISZ A;  1QVU A;  3GZN B;  5BNG A;  3JRC A;  3HOU J;  4MEX F;  3J80 K;  3M07 A;  2JPC A;  1XD7 A;  5DV5 A;  1U5T A;  3MN2 A;  3VYT B;  1EH8 A;  3BQY A;  5FGM A;  5LGU A;  3I0T A;  4AID A;  4XN3 A;  5TGT A;  1SC7 A;  1LQ1 A;  2PMZ A;  3ZQF A;  4IHX A;  2M7A A;  3LMM A;  4ZDO A;  4BY7 J;  1VTN C;  3RKY A;  4GCV A;  2MA3 A;  1A35 A;  2XAU A;  2KDO A;  2M7B A;  3ZGK A;  2PMU A;  1U6G A;  3OIO A;  2LKS A;  3M8E A;  3VFZ A;  3BQZ A;  1CQT A;  2XRL A;  4RS8 A;  4C2M J;  2CV0 A;  2WAE A;  3MKY B;  1DDN A;  3H3V K;  1MBG A;  4DW6 A;  5LRS A;  2DOF A;  2OUM A;  2VE9 A;  2QEN A;  1BR4 A;  3LSJ A;  3HOZ J;  5EDN A;  2ESH A;  2KRH A;  2CUZ A;  4KN4 X;  4OAZ A;  5J1R A;  5D6F A;  5M5X J;  1FOY A;  1JT6 A;  2LY1 A;  5GTH C;  2D2W A;  4MFD A;  1IJW C;  3GO5 A;  1EA3 A;  1ZAO A;  3GXO A;  3H36 A;  1YG2 A;  3CCR I;  1UAA A;  1APL C;  4UVB A;  1Y0N A;  2QKL B;  4IVN A;  4PJJ A;  3S32 A;  3TO7 A;  4XKW A;  2F5E A;  1V4R A;  2L7F P;  2DPD A;  4EJU A;  1QRY A;  1WH5 A;  3P9I A;  1UG0 A;  4HLY A;  2ZFU A;  2X6Y A;  2LK2 A;  4B09 A;  2OC6 A;  2RDP A;  4NUB A;  5KNL A;  1B9M A;  3TGN A;  4F55 A;  1BI3 A;  2EIK H;  5FKN A;  2JA5 J;  3SDB A;  3LA2 A;  3TL4 X;  3VDX A;  1FIP A;  2VC1 A;  2IGM A;  4ZDL A;  1UHM A;  1D1A A;  1OMI A;  4J01 A;  4CDG A;  1LE8 A;  2V7F A;  3L9F A;  3LAP A;  5E79 C;  4B47 A;  2X48 A;  1E3O C;  3K7A J;  3HOW J;  2KLO A;  4E7I A;  1G59 A;  3CCS I;  3HKZ A;  4BQN A;  4A3L J;  3M4O J;  3V7C A;  4IHT A;  4EEF G;  3JRE A;  1RET A;  4DNC A;  3BR0 A;  3FXL A;  2QYO A;  5K7Z A;  1JKQ C;  2MC4 A;  1ULY A;  2JT1 A;  5GTI C;  1O7F A;  4L0Y B;  4BS9 A;  1FC3 A;  2MSY A;  3U9G A;  3R0J A;  2RGV A;  4I09 A;  3SDG A;  3WE2 A;  4NBQ A;  4B1R A;  4IOA F;  1T0F C;  1IZ1 A;  2I10 A;  5KVR A;  1DP7 P;  2V1X A;  2IAI A;  2KT0 A;  3H35 A;  5CVV A;  1JHF A;  2YUS A;  2ZJP F;  3HTU A;  3A0H C;  1TT5 B;  1VQL I;  4QTR A;  1MDM A;  2VKE A;  2LC2 A;  2ACJ A;  1KQ8 A;  2BBY A;  1R22 A;  2EZK A;  3S3O A;  4G12 A;  3QAH A;  4HRI A;  2WY7 Q;  4BQQ A;  3JRA A;  3K10 A;  1S7E A;  4Q47 A;  3ROU A;  5JR3 A;  2W48 A;  3DFG A;  1T39 A;  2NYX A;  3RYP A;  2PN6 A;  1N77 A;  1BJZ A;  1TTY A;  2X6O A;  1MSF C;  4IF4 A;  3WU1 B;  4BE2 A;  1ORK A;  5K7H A;  3PO2 J;  1WJ5 A;  4Y7N J;  1IV8 A;  3FK7 A;  4IOC F;  4KJZ A;  1YX5 A;  1IAW A;  1IRZ A;  4ZYH A;  3FXU A;  3Q9V A;  4LOC A;  1S9H A;  2Q8K A;  2GOM A;  2FML A;  4WX9 A;  5K5R A;  2P5K A;  1BJA A;  1FTT A;  3FF5 A;  3BCB A;  4EJV A;  2DTR A;  4MTD A;  4M71 A;  4CUG A;  3IHU A;  1VI0 A;  2E71 A;  3OWT A;  5HLG A;  3E5X A;  4FCY A;  3FBN B;  1GLN A;  2NAZ A;  1Y6I A;  2ZO4 A;  1T8I A;  3CC2 I;  1XX5 A;  2ZJR F;  4E7K A;  2G7U A;  4HNT A;  3VSK A;  4CIC A;  2ELK A;  2VQH A;  4HQE A;  1SD7 A;  2Q0O A;  5BS6 A;  1Z21 A;  2HNH A;  1OCO H;  1A31 A;  1Z6T A;  2FJ1 A;  1XMA A;  1RUO A;  2XF5 A;  4OMY A;  4BXX J;  1VQ8 I;  2R7T A;  5EGO A;  4OIP F;  3REO A;  3RZO J;  1MBJ A;  2R7U A;  3GZ6 A;  2IJL A;  3GFJ A;  4KMU X;  1U3E M;  4ENM A;  1T38 A;  5DDG A;  1ZLK A;  3PO3 J;  1DPR A;  1SFE A;  2LKX A;  2BY2 A;  4EM2 A;  1RI7 A;  2COB A;  4NHJ A;  1H9G A;  2K02 A;  4P9U A;  2GQQ A;  3OYK A;  3WG7 H;  3F22 A;  2R7O A;  2CWE A;  3MKL A;  3JAM Z;  1PDN C;  2ELJ A;  3GTJ J;  3S2H J;  1ZRF A;  1JTY A;  2LY9 A;  4LIU A;  1BI0 A;  3M8F A;  4FX0 A;  3OS0 A;  4LB6 B;  1S29 A;  2KHM A;  3LFK A;  2IP2 A;  5DCM B;  2R3S A;  2IPQ X;  2VE8 A;  3RQI A;  4DZP A;  2EIM H;  2DW4 A;  3O6B B;  4MFE A;  3GZ5 A;  1RUN A;  1WI3 A;  3BTI A;  2R7Z J;  1HDP A;  4ZZD A;  4HDV A;  1VQN I;  1T2K A;  3JRG A;  4CCM A;  3MKZ A;  5CVU A;  4J00 A;  2PMZ N;  2W84 A;  4CZC A;  2X9D A;  1OJL A;  4G7O F;  2MBF A;  2H1L A;  2IVM A;  2LY2 A;  2JVH A;  1VQO I;  1D8J A;  1UCR A;  3DTK A;  4L5E A;  3H92 A;  5JHU A;  3KP5 A;  1FYK A;  2QUF A;  4UB8 C;  1QHH D;  1IV6 A;  3IUO A;  3CJN A;  5H6R A;  4ASN A;  2DMU A;  2R4G A;  2YS9 A;  3RTR A;  4ANJ A;  1UHS A;  2HVR A;  3ERE D;  4DYR A;  4IQ4 A;  3IC7 A;  5HNH A;  2QKM B;  1YW7 A;  1Z0X A;  4LK1 F;  2O8K A;  3CTA A;  3BTL A;  1MGT A;  2CO5 A;  3A02 A;  3L09 A;  5C4J J;  1M1E B;  2OPT A;  5F0F A;  3QRF F;  5H20 A;  2M4G A;  2XC7 A;  1Z7U A;  3DV8 A;  4HF2 A;  3OYJ A;  2IA1 A;  3PNT A;  1JXS A;  3CME I;  1OR7 C;  1WJB A;  1ITY A;  3HHG A;  1JJ8 C;  2K4B A;  2H1K A;  3K69 A;  1E2X A;  1WJA A;  4A5M A;  3RPQ A;  3WTY C;  1TZL A;  1B72 B;  5EEG A;  3ZXS A;  4RB3 C;  3OYI A;  3HGG A;  3K70 C;  1ON2 A;  1JKO C;  2KDZ A;  2K4J A;  3ZR8 X;  1G6N A;  2VKD A;  2ZME B;  3L2R A;  1LPQ A;  3H5N A;  4IHV A;  5JVT A;  1YJ9 I;  3JTH A;  1I1S A;  3IP4 B;  1U9N A;  3F9K A;  3K1P A;  2H6C A;  3S2D J;  4EM0 B;  1U8B A;  1ENH A;  2G0E A;  2WV0 A;  4YFX F;  4A3D J;  1ETW A;  2BXZ A;  4KIT B;  3NEU A;  4M9X A;  4NQW A;  5GAD J;  3DXJ F;  4C3J J;  2A68 F;  2LLK A;  2OV7 A;  3C7J A;  1TQP A;  1F1Z A;  2RNJ A;  1FYL A;  3OYL A;  3AAF A;  2HQR A;  2VOD A;  5JI6 A;  4S04 A;  3HKZ N;  2EFN A;  2BY3 A;  4GXO A;  4KIF A;  4G94 A;  1UMQ A;  3DBL B;  5IYC J;  3S1M J;  3H0G J;  4XID A;  5FFZ A;  2UUZ A;  4OWR B;  4KFC A;  4ZYD A;  1YW9 A;  5J8C A;  3DLA A;  4CHU A;  4XNF A;  5C4X J;  2OQR A;  2D1H A;  3W6V A;  2PI0 A;  2VBY A;  2HFH A;  3AL0 B;  2EV0 A;  4BGD A;  3U21 A;  2YX4 A;  3HSR A;  2K27 A;  4HA8 A;  3CMY A;  2C6Y A;  3BG5 A;  5LHH A;  2KPM A;  5LBQ A;  2ZXH A;  3BG7 A;  5B3S H;  1F36 A;  3GLL A;  3F3X A;  5EZH A;  4I6Z A;  4M3G A;  2E1M C;  3RQ4 A;  1UST A;  1BL0 A;  5CQE A;  3TDZ C;  1K61 A;  5DTD A;  1ZHF A;  4RGR A;  4XRS A;  3OS2 A;  1Z77 A;  1N25 A;  1PP7 U;  2MH2 A;  3LSK A;  3R6S A;  3FWE A;  3SYT A;  3N05 A;  4I7H A;  3U1D A;  5LHG A;  1Z05 A;  2XB0 X;  4DJA A;  1YRN B;  1NH3 A;  2L9R A;  4DYQ A;  2CG4 A;  3CCV I;  4BAY A;  5BOX A;  5IYD J;  2DBB A;  1IUY A;  2FOK A;  2M0C A;  1G3Y A;  2W4S A;  3KET A;  4OIR F;  2L54 A;  1QNT A;  2FOW A;  1D1C A;  1Q1V A;  1JTX A;  3FX3 A;  1FEX A;  5ICC A;  3NRV A;  3H3Z A;  1MIJ A;  3PUB A;  2K3F A;  3OMY A;  2XV4 S;  2KP6 A;  2H94 A;  1U9O A;  4E4H A;  3MCZ A;  1I50 J;  1QVT A;  4D5C A;  2B7E A;  4QSH A;  3JRI A;  3K1N A;  2Y48 A;  3J7A Y;  3I56 I;  2DDB A;  3F0C A;  4F92 B;  3JTG A;  1WSU A;  3S93 A;  5DD4 A;  2ECB A;  3EDP A;  3IRR A;  4HF0 A;  1GV5 A;  3S17 J;  1YYV A;  2YU9 J;  2XPU A;  2EBI A;  3BR1 A;  1ON1 A;  1A04 A;  4G7H F;  4M9Z A;  2XRN A;  1YHQ I;  4UB6 C;  3GBG A;  4GYI A;  4BKX A;  1SAU A;  2KZV A;  3ASO H;  1YE9 A;  2VJ4 A;  2L9S A;  2DQL A;  4Q48 A;  2Z16 A;  1TWC J;  3GCM A;  3F6O A;  3KP7 A;  4L5I A;  4XLP F;  2EV6 A;  2V79 A;  2W82 A;  3GTP J;  3E6D A;  5FKL A;  3FXK A;  4BAC A;  1D3Y A;  2I8D A;  2XVC A;  1DGW Y;  3SFZ A;  1RKT A;  5HOO A;  1QGP A;  4XMY A;  1WJD A;  2STW A;  4BJ5 C;  1MMA A;  1D0Y A;  2VAS A;  5JVG F;  1I6H J;  2YSR A;  2NOG A;  2NVU B;  1VFC A;  3V4G A;  4FQG A;  1QHG A;  4HST A;  1XSX A;  1HKQ A;  2R5Y B;  1IN4 A;  2QLZ A;  3DEE A;  2HOA A;  1VQM I;  2GIV A;  3E97 A;  3P5J A;  4EJO A;  2UZK A;  2XPV A;  3J7Z I;  1DGR M;  1UEL B;  1F43 A;  3CCQ I;  4G9Y A;  4A93 J;  6PAX A;  3SEZ A;  1F5T A;  2NS8 A;  1VZ0 A;  2JSC A;  4BYY A;  4E6K G;  1KZH A;  5IOZ A;  5CYV A;  2B63 J;  4ENN A;  4C2T A;  3K4C A;  2X1E A;  1TBX A;  3G4S I;  4U7B A;  1G8X A;  4BE0 A;  5CVJ A;  3WTZ A;  2HS5 A; 
#chains in the Genus database with same CATH homology
 4TV7 A;  4A6E A;  3C18 A;  2BE5 F;  3RI4 A;  1G3S A;  1U2W A;  4AIJ A;  2RV8 A;  3HSE A;  3BOQ A;  3HRU A;  2M5W A;  1XSD A;  2KJB A;  2DAO A;  2XAH A;  4BHC A;  3KZY A;  3FM5 A;  2VOO A;  2V9V A;  3BPV A;  3KZZ A;  4EV0 A;  3TO9 A;  1TW3 A;  2HZT A;  3EYI A;  2MD5 A;  2QQB A;  4FX4 A;  5ILV A;  1IRF A;  2FXA A;  2M1B A;  4IHS A;  1QO0 D;  4LLL A;  4JQF A;  3F6V A;  5ED4 A;  2ZNZ A;  4YFK F;  5DCM A;  4R1H A;  1LB2 A;  2CSO A;  1W5S A;  2FBH A;  2BGC A;  3PFI A;  1G4D A;  2HYF A;  2OBP A;  1JE8 A;  3GWZ A;  2M45 A;  4RB0 A;  4Y15 A;  2YX7 A;  1FSH A;  2UWM A;  2A5Y B;  5CVI A;  2H6B A;  2Z3Y A;  4LG0 B;  5E8G A;  3LWF A;  1XDU A;  4I0B A;  2LF8 A;  3W6K B;  4N0B A;  4LGW A;  3F8B A;  1U8R A;  1YQA A;  3V7R A;  1KU7 A;  3B02 A;  3BJA A;  3DF8 A;  3KE2 A;  4CZZ A;  3KP3 A;  4Q5S F;  1O3Q A;  1IRG A;  1O57 A;  2J5P A;  2ZME A;  3FHZ A;  2ETH A;  4IRI A;  3N97 A;  1ZG5 A;  2QWW A;  3T1B A;  2O6G E;  2PG4 A;  2R7D A;  4L9N A;  2FMY A;  4G6D A;  1FBQ A;  5L3E A;  1H9T A;  3SHF A;  4R8H A;  3SZT A;  3ABT A;  3KCC A;  1K78 B;  4JBA A;  3BZ6 A;  1FNN A;  4CXF A;  3SQN A;  3KEQ A;  4L9V A;  3BWG A;  3M9A A;  5BPI A;  3RYR A;  4ESB A;  5D5V B;  1J7K A;  3VB2 A;  1R7J A;  3QP5 A;  2ZFW A;  5L3G A;  3PQK A;  4BHP A;  3ML6 A;  3K9T A;  3EET A;  3MWM A;  1XB4 A;  4RGX A;  3JW4 A;  1ZYR F;  1LNW A;  2ZKZ A;  3WGI A;  2EA2 A;  2P4W A;  2VT2 A;  1J5Y A;  3DQV C;  3IL2 A;  4K2E A;  3KP4 A;  2HDC A;  3GLX A;  5D4S A;  3C3W A;  1LDD A;  1R1V A;  4IXA A;  1FY7 A;  3QU3 A;  4HX8 A;  1FPQ A;  3K1M A;  4L0Z B;  4OOI A;  4IPA A;  3P9K A;  1YFH A;  4EJT A;  1Q1H A;  4OIQ F;  2EWN A;  1BIB A;  2E1N A;  1STZ A;  4YG2 F;  1HST A;  3WU0 A;  4YIF A;  3T5X A;  2D1V A;  4HLX A;  1R5H A;  3I58 A;  3ZMS A;  2J5O A;  4KA4 A;  1TLH B;  1J59 A;  1RIO H;  1K7A A;  2G7H A;  1QZY A;  4JK1 X;  1P6R A;  1U5T C;  3ZN0 A;  1QBJ A;  4LLG F;  1J2X A;  2TDX A;  4N9I A;  1DUX C;  2YR2 A;  2L4M A;  2MH9 A;  4WXD A;  3ECO A;  3ZMD A;  3P9C A;  2FRH A;  4WXH A;  2OAZ A;  4EGZ A;  3VEP A;  1QPM A;  3Q5F A;  2WTE A;  1XGS A;  3I4P A;  4A12 A;  1RNL A;  1P92 A;  5K5Q A;  2ELH A;  1S8N A;  4IRH A;  4MNU A;  1ZG3 A;  1PUE E;  2JRT A;  1WWX A;  4O5V A;  5J6X A;  4P5O A;  2W24 A;  4QLC U;  3GYH X;  3U2R A;  1T6S A;  2P7V B;  2HQN A;  1CGP A;  2RN7 A;  4OMZ A;  5LGT A;  3G73 A;  1TNS A;  4LK0 F;  2XAG A;  4ESJ A;  5AON A;  4BXU A;  5D5U B;  3R4K A;  4A0Z A;  3LA3 A;  1HKS A;  3OV8 A;  2W57 A;  2E1C A;  2V6C A;  1UB9 A;  1ZRC A;  1ZN2 A;  2A6E F;  4NB5 A;  3CUQ B;  2P6T A;  4GO1 A;  1LVA A;  4GGG A;  2Z99 A;  2A07 F;  3L00 A;  3RDI A;  4I2O A;  1BBY A;  5E8I A;  3BRO A;  3RJP A;  1GXP A;  4XBF A;  2EFQ A;  4GYG A;  4AWX B;  3I71 A;  2PQ8 A;  3F72 A;  4LMY A;  4RGU A;  4CYD A;  2NNY A;  1CF7 B;  5L3F A;  1LDK B;  3B73 A;  5TJJ A;  4LG0 A;  4L9J A;  3R61 A;  1TQM A;  2KIM A;  4KIC A;  3I53 A;  2O61 A;  1PP8 F;  2W25 A;  3BJ6 A;  3HIF A;  1LJ9 A;  1BIA A;  2DK8 A;  1ZGJ A;  4MGR A;  1S7O A;  3K0L A;  4M73 A;  4U7D A;  4MEY F;  4KN7 X;  1SFX A;  3TQN A;  3TOB A;  2ZBK A;  4FT8 A;  3GFL A;  5DYM A;  5L3C A;  3FZV A;  3J7A O;  3E6C C;  3F8M A;  3Q9S A;  4A0Y A;  1B59 A;  4H0E A;  3R0A A;  3D0S A;  2VBX A;  2EV5 A;  1O7L A;  1J9I A;  4BHB A;  2BEO A;  4M6X A;  1BI2 A;  2GZW A;  1K78 A;  3OOP A;  3F8C A;  2IT0 A;  3ECH A;  3I64 A;  1YS7 A;  3FXQ A;  1OYI A;  2P6S A;  3F8N A;  4MTE A;  2XIG A;  3T8R A;  5DUI A;  3EUH A;  5E18 F;  2LNB A;  4I01 A;  2NRA C;  4RAZ A;  1UFM A;  3NQO A;  1GHC A;  2NS0 A;  4KNY A;  5ICE A;  1YS6 A;  2R7F A;  1R36 A;  1D5V A;  1IXS B;  1IXC A;  4EM1 A;  3O3K A;  2DQR A;  3HUG A;  3LAJ A;  2HTS A;  4KMF A;  1I27 A;  2COM A;  5HS8 A;  4HV5 A;  5KK1 A;  1W7P A;  2F5D A;  1KQ0 A;  1E17 A;  3ISP A;  1WKM A;  2K86 A;  2AXL A;  3JSP A;  1DPU A;  3FMR A;  1O3T A;  5A2Q Z;  5AIP A;  1FBS A;  5ILS A;  3TOA A;  1I6X A;  5DEQ A;  1ODD A;  4HX4 A;  3DP7 A;  2L4A A;  3GW2 A;  3T0Y A;  5IT9 Z;  5D8K B;  3IWZ A;  1B9N A;  2FNA A;  1SAX A;  4UHT A;  1YTY A;  3WE3 A;  2RVC A;  3GX4 X;  4G6Q A;  1XCB A;  3KLO A;  4U88 A;  2QBY B;  1K79 A;  1FLI A;  4LFU A;  2Z9O A;  3WTS C;  4U0W A;  1BN5 A;  2QM3 A;  1ZRE A;  4XLN F;  4A5N A;  2O03 A;  3ULQ B;  4HDU A;  5HS9 A;  5E1W A;  2E7X A;  2CGP A;  1ZLJ A;  4UVC A;  1XGN A;  4QWQ A;  4ON0 A;  1IN8 A;  2CYY A;  1BC8 C;  1IF1 A;  1FOK A;  3DPT A;  3ZMZ A;  2OQG A;  4Y17 A;  1O3S A;  1BM9 A;  1Y0U A;  5CJ9 A;  4ZZL A;  4DQ2 A;  2K7L A;  2L01 A;  2P5L C;  2F2E A;  2YU3 A;  3T8T A;  4KYW A;  1IN6 A;  3CLO A;  2ZCW A;  3SXY A;  2KRF A;  1SD5 A;  1I1G A;  1KYW A;  5D6E A;  2Z33 A;  1YIO A;  2VT3 A;  5HLI A;  1C0W A;  4M72 A;  1HW5 A;  4XSX F;  1LDJ A;  3CUO A;  3P7N A;  3CUQ A;  4UV9 A;  3F8F A;  5HDG A;  3FXR A;  2VBZ A;  3I5U A;  2FBI A;  2CW0 F;  1T98 A;  1W7P D;  4WK8 F;  2QQA A;  2BV6 A;  2M87 A;  1UHW A;  3KFW X;  4RAY A;  3QOP A;  4O3M A;  5F6F A;  1HBX G;  1CF7 A;  4ZYG A;  3KEO A;  2EFP A;  1HW2 A;  3V8L A;  3GF2 A;  2RC4 A;  2VXZ A;  1MJA A;  4IJA A;  4U0Y A;  1U78 A;  2PEX A;  1P4X A;  3L2C A;  1EH7 A;  1D8K A;  1TW2 A;  2LF7 A;  2Y75 A;  1FP2 A;  3O2P E;  1KU3 A;  2F5F A;  4BNC A;  2M8E A;  1R1U A;  4UVA A;  1OYY A;  1OKR A;  4P9F A;  5ILU A;  4EJW A;  1HKT A;  1ZG1 A;  3MFK A;  4EGY A;  3RKW A;  4G8X A;  1BI1 A;  1IXR C;  2FA5 A;  3S2W A;  5F64 A;  3G3Z A;  3DKW A;  1OYW A;  3MZY A;  2VN2 A;  1H0M A;  1KU2 A;  2GAU A;  3GUD A;  4RB2 C;  2A69 F;  5LGN A;  5FLX Z;  1Z9C A;  2STT A;  2EA4 A;  4A2U A;  1TQI A;  3V8K A;  1XSV A;  2ZNY A;  2DPU A;  2VBW A;  3HRS A;  1MZB A;  2L02 A;  1P4W A;  4I0A A;  1KQ9 A;  1LEA A;  4HZF A;  4AIK A;  4KIG A;  2Q2E A;  1T0F A;  3FMS A;  3I59 B;  3QU6 A;  5HVQ C;  2HKX A;  3E5Q A;  5DUK A;  3IWF A;  3N4M A;  1FYM A;  4BH9 A;  2F5C A;  2O8X A;  1AOY A;  5ERI A;  2W85 A;  1EH6 A;  1S7A A;  4KDP A;  1Z1D A;  2UXX A;  2Y0M A;  5LEK A;  1AWC A;  2GXB A;  3I54 A;  3QPT A;  1FSE A;  1BOA A;  3F21 A;  2HYG D;  3J81 Z;  3E6M A;  4L5J A;  5D8L B;  2CFX A;  1W4M A;  4PCQ A;  1W7P B;  3WOD F;  2RKH A;  4Z2Y A;  3VOE A;  1S3J A;  5LHI A;  2OD5 A;  2FE3 A;  2PFB A;  2UXN A;  4UNO A;  1Z91 A;  3HOS A;  3M1E A;  1S6L A;  1YLF A;  2DT5 A;  2OA4 A;  2P7C B;  1GXQ A;  3TDU C;  2HOE A;  4ETS A;  4M9S A;  3IRQ A;  3MAJ A;  5DD8 A;  2FEZ A;  5ICF A;  2V1U A;  4EQQ A;  5E20 A;  3ZQ7 A;  2AS5 F;  4EVI A;  2XKO A;  5FFX A;  3R60 A;  1B1B A;  1ZGA A;  2QBY A;  2DI3 A;  3MZH A;  5HDK A;  4M6Y A;  1IN5 A;  1XGO A;  3KP2 A;  1HXD A;  1F4K A;  3EQL F;  2WWY A;  4G7Z F;  5A2Q K;  5TRD A;  4CGZ A;  1ZH5 A;  3GEZ A;  1V3F A;  5E1X A;  5J8F A;  2VC0 A;  4L9T A;  2HTJ A;  3F23 A;  5IT9 K;  3ABU A;  4F7Z A;  1WRJ A;  4PZJ A;  1IW7 F;  1SMT A;  2MC3 A;  2XHK A;  2PLY A;  2OZU A;  1HQC A;  2KIF A;  2JPB A;  2O0Y A;  1Z6R A;  3BY6 A;  1HW1 A;  3WGG A;  3CDH A;  1OR7 A;  3LQR A;  3LST A;  2EB7 A;  2XAF A;  4UV8 A;  2XAQ A;  2EK5 A;  3WTU C;  3HYI A;  2FF4 A;  3RIR A;  4ZYE A;  1HSJ A;  1GVJ A;  2XUB A;  2V1D A;  4MQ9 F;  4Q4Z F;  5CLS A;  2XGX A;  3WTT C;  3WGH A;  4PDK A;  4UUV A;  4WWC A;  2KIU A;  4HX7 A;  1IN7 A;  1ONV A;  5E1Z B;  2EFO A;  2RQP A;  4Y13 A;  3FM3 A;  1G3W A;  2E7W A;  2ADU A;  2A61 A;  1QZZ A;  1WI9 A;  5K5O A;  1L0O C;  3HSF A;  2X4H A;  1OPC A;  2EJR A;  5CVR A;  1NHA A;  5LRR A;  3H3U A;  5HDN A;  2JTV A;  2GA2 A;  1FT9 A;  1KGS A;  2Z5U A;  4D0P A;  2XRO A;  1B6A A;  1XDS A;  1XN7 A;  1REP C;  2ESN A;  1XMK A;  4MHG A;  1LEB A;  3SZP A;  1G3T A;  1R23 A;  1XCV A;  4I02 A;  1MJ9 A;  5BPD A;  3IKV A;  4HV6 A;  2VON A;  3WTW C;  3ZMU A;  5EEH A;  2A6H F;  2ZJ2 A;  1SFU A;  2QZ8 A;  4WCG A;  2L3D A;  3J80 Z;  4UXN A;  1XGM A;  3KLN A;  4LB5 A;  3BPX A;  5ICG A;  3WTX C;  1MJB A;  1SD6 A;  4EMS A;  4LD5 A;  1YO5 C;  1R5G A;  3HHH A;  4N9H A;  5D5W B;  3E3V A;  4LJZ F;  3ZN1 A;  3ZMV A;  1KA8 A;  2MLK A;  1JHH A;  2H27 A;  4OIO F;  3ZPL A;  5FD6 A;  4B8X A;  1F9N A;  3HRT A;  3I59 A;  5BQT A;  1U5T B;  3TKY A;  5FLX K;  4FHT A;  1SD4 A;  2HR3 A;  4HQM A;  4I98 B;  2BYV E;  5L3D A;  1J75 A;  4HOB A;  3K2Z A;  2M30 A;  4ESF A;  2DLL A;  5DCF A;  2P8T A;  4AD9 A;  3PQJ A;  2IW5 A;  1FBU A;  2DU9 A;  3TO6 A;  1YW8 A;  3QPH A;  4XRF A;  4E70 A;  1QQI A;  3LA7 A;  3DEU A;  4KIB A;  1K6O A;  1I5Z A;  4WXC A;  3L7W A;  2FQ3 A;  3HOT A;  2FU4 A;  3J81 K;  3V7S A;  2WC2 A;  4ENJ A;  2VOP A;  3GFI A;  3V8J A;  2FSW A;  3E6B A;  5LEJ A;  4R79 A;  1KU9 A;  3CO7 C;  4HAM A;  2LSO A;  5K1Y A;  2G9W A;  1SMY F;  1R1T A;  4U0V A;  2CQK A;  3M7G A;  3WTV C;  2HKO A;  4HYE A;  1L3L A;  4AIH A;  2GWR A;  4HBL A;  2GA1 A;  4PGG A;  4P55 A;  2HWV A;  5F1R A;  2MLG A;  3BJO A;  4YII A;  3IKT A;  2ZXJ A;  1MDM B;  1MKM A;  4P96 A;  5E17 F;  3EYY A;  3VOD A;  3RKX A;  3COA C;  5AIQ A;  4HF1 A;  2DFI A;  1FWZ A;  2IA0 A;  1X3U A;  2OZ6 A;  2DK5 A;  3D5L A;  5HS7 A;  4M74 A;  4A6D A;  4XSZ F;  5IT3 A;  2H09 A;  3WG9 A;  4CO8 A;  1TNT A;  3GFM A;  2XKP A;  1O3R A;  2EFW A;  2D45 A;  4KT5 C;  4HW0 A;  1ZAR A;  3ZMT A;  2YPR A;  1BC7 C;  2FNP A;  2DO7 A;  5FB2 A;  2O3F A;  5FO5 A;  1FP1 D;  4OIN F;  1RZ4 A;  5LLQ A;  1ZRD A;  2LDU A;  3KP6 A;  4RB1 A;  2OU2 A;  5HLH A;  2B0L A;  3C1D A;  2HEO A;  3E5U A;  4YFN F;  4BQA A;  3W6J B;  5BMZ A;  2FBK A;  2QQ9 A;  4L18 B;  1KYZ A;  1P4A A;  1W5T A;  3BP8 A;  4S05 A;  4KUM A;  5D4R A;  3ELK A;  2XAJ A;  5D5X B;  2KJC A;  4A0X A;  4O6J A;  3LQQ A;  5H6Q A;  4RGS A;  2PBI A;  2PJP A;  3JAM K;  4ENK A;  4IRG A;  5JFR A;  2PMH A;  2IA2 A;  3HTS B;  3CO6 C;  1P2F A;  3GVA A;  2JZY A;  1FX7 A;  2A3S A;  1USS A;  2HGC A;  2KKO A;  1R58 A;  1WQ2 A;  1J0R A;  1FZP B;  2LKP A;  3HRM A;  3BDD A;  5FD5 A;  2GXG A;  2X0L A;  1JGS A;  3JSO A;  4AVP A;  4OU0 A;  3QP6 A;  4WF2 A;  3RPU A;  5L3B A;  1EV7 A;  4ZH4 F;  1MD0 A;  4PGH A;  1R00 A;  4LLN A;  3ZP5 A;  1B4A A;  3FMQ A;  2ISY A;  4MQV A;  3MEX A;  2P5V A;  2QVO A;  2NNN A;  2XAS A;  3MQ0 A;  3DPL C;  3CUQ C;  2IRF G;  2ISZ A;  4MEX F;  3J80 K;  2JPC A;  1XD7 A;  5DV5 A;  1U5T A;  1EH8 A;  5FGM A;  5LGU A;  3I0T A;  1LQ1 A;  1VTN C;  3RKY A;  4GCV A;  2MA3 A;  2PMU A;  1U6G A;  3VFZ A;  3M8E A;  4RS8 A;  1DDN A;  5LRS A;  2VE9 A;  2QEN A;  2ESH A;  4KN4 X;  5D6F A;  2D2W A;  3GO5 A;  1ZAO A;  3GXO A;  1YG2 A;  4UVB A;  4IVN A;  3TO7 A;  2F5E A;  1V4R A;  2DPD A;  4EJU A;  3P9I A;  4HLY A;  4B09 A;  2RDP A;  1B9M A;  3TGN A;  1BI3 A;  3LA2 A;  2VC1 A;  1UHM A;  1OMI A;  4CDG A;  3L9F A;  3LAP A;  3V7C A;  4IHT A;  4DNC A;  2QYO A;  1ULY A;  2JT1 A;  1O7F A;  4L0Y B;  1FC3 A;  3U9G A;  3R0J A;  2RGV A;  4I09 A;  3WE2 A;  1IZ1 A;  5KVR A;  1DP7 P;  2V1X A;  5CVV A;  1JHF A;  3HTU A;  1MDM A;  1KQ8 A;  2ACJ A;  2BBY A;  1R22 A;  3QAH A;  4Q47 A;  3ROU A;  5JR3 A;  3DFG A;  1T39 A;  2NYX A;  3RYP A;  2PN6 A;  1TTY A;  4IF4 A;  3WU1 B;  1IAW A;  4ZYH A;  3FXU A;  3Q9V A;  2Q8K A;  2FML A;  4WX9 A;  5K5R A;  2P5K A;  1BJA A;  3FF5 A;  4EJV A;  2DTR A;  4MTD A;  4M71 A;  3IHU A;  5HLG A;  3E5X A;  2NAZ A;  2ZO4 A;  2G7U A;  4HQE A;  4CIC A;  1SD7 A;  2Q0O A;  5BS6 A;  1RUO A;  1Z6T A;  1XMA A;  4OMY A;  4OIP F;  3REO A;  3GZ6 A;  2IJL A;  3GFJ A;  4KMU X;  1U3E M;  4ENM A;  1T38 A;  5DDG A;  1ZLK A;  1DPR A;  1SFE A;  4EM2 A;  1RI7 A;  4NHJ A;  1H9G A;  2K02 A;  4P9U A;  2GQQ A;  3F22 A;  2CWE A;  3JAM Z;  1PDN C;  1ZRF A;  1BI0 A;  3M8F A;  4FX0 A;  4LB6 B;  1S29 A;  3LFK A;  2IP2 A;  5DCM B;  2R3S A;  2IPQ X;  2VE8 A;  2DW4 A;  3O6B B;  3GZ5 A;  1RUN A;  4ZZD A;  4HDV A;  1T2K A;  5CVU A;  2W84 A;  4G7O F;  2MBF A;  2IVM A;  1D8J A;  1UCR A;  3H92 A;  5JHU A;  3KP5 A;  1FYK A;  2QUF A;  3CJN A;  5H6R A;  4ASN A;  3RTR A;  3ERE D;  3IC7 A;  1YW7 A;  4LK1 F;  3CTA A;  1MGT A;  2CO5 A;  3L09 A;  3QRF F;  5H20 A;  1Z7U A;  3DV8 A;  4HF2 A;  2IA1 A;  1JXS A;  3HHG A;  2K4B A;  3K69 A;  1E2X A;  4A5M A;  3RPQ A;  3WTY C;  5EEG A;  4RB3 C;  1ON2 A;  2K4J A;  1G6N A;  2ZME B;  5JVT A;  3JTH A;  1I1S A;  3K1P A;  2H6C A;  4EM0 B;  2WV0 A;  4YFX F;  3NEU A;  4M9X A;  4NQW A;  3DXJ F;  2A68 F;  3C7J A;  1TQP A;  1F1Z A;  2RNJ A;  1FYL A;  3AAF A;  2VOD A;  2HQR A;  5JI6 A;  4S04 A;  2EFN A;  4GXO A;  4KIF A;  4G94 A;  5FFZ A;  4KFC A;  4ZYD A;  1YW9 A;  5J8C A;  4CHU A;  2OQR A;  2D1H A;  2PI0 A;  2VBY A;  2HFH A;  2EV0 A;  2YX4 A;  3HSR A;  2K27 A;  4HA8 A;  2C6Y A;  5LHH A;  5LBQ A;  3F3X A;  1UST A;  3TDZ C;  1ZHF A;  4RGR A;  1PP7 U;  2MH2 A;  3R6S A;  3FWE A;  5LHG A;  4I7H A;  3U1D A;  1Z05 A;  2CG4 A;  4BAY A;  5BOX A;  2DBB A;  1IUY A;  2FOK A;  1G3Y A;  3KET A;  4OIR F;  1QNT A;  2L54 A;  3FX3 A;  5ICC A;  3NRV A;  3H3Z A;  2XV4 S;  2H94 A;  3MCZ A;  3K1N A;  2Y48 A;  3JTG A;  1WSU A;  5DD4 A;  3EDP A;  3IRR A;  4HF0 A;  1YYV A;  1ON1 A;  1A04 A;  4G7H F;  4M9Z A;  2XRN A;  4GYI A;  2DQL A;  4Q48 A;  3F6O A;  3KP7 A;  4L5I A;  4XLP F;  2EV6 A;  2V79 A;  3E6D A;  1D3Y A;  2XVC A;  3SFZ A;  5HOO A;  1QGP A;  2STW A;  2YSR A;  3V4G A;  1XSX A;  1HKQ A;  1IN4 A;  2QLZ A;  2GIV A;  3E97 A;  4EJO A;  2UZK A;  4G9Y A;  6PAX A;  1F5T A;  2JSC A;  4BYY A;  5CYV A;  4ENN A;  1TBX A;  4U7B A;  5CVJ A;  3WTZ A;  2HS5 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...