1DU6A

Solution structure of the truncated pbx homeodomain
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
64
structure length
64
Chain Sequence
SSGHIEGRHMNKQATEILNEYFYSHLSNPYPSEEAKEELAKKCGITVSQVSNWFGNKRIRYKKN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords HOMEOBOX PROTEIN PBX1
publication title Conformational changes in the PBX homeodomain and C-terminal extension upon binding DNA and HOX-derived YPWM peptides.
pubmed doi rcsb
source organism Mus musculus
molecule tags Gene regulation
total genus 14
structure length 64
sequence length 64
ec nomenclature
pdb deposition date 2000-01-14
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.60 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Homeodomain-like 1du6A00
3CDLA 1O4XA 4D5FA 1APLC 5J3LA 3IH4A 2Y2ZA 4CYCB 2FQ4A 2ID3A 2NOGA 2ECCA 2JA6J 4CYCA 1NTCA 5FKNA 3DEWA 5M5XJ 3FISA 4FTHA 3ZQIA 1U9NA 2NVTJ 3BT9A 2G0EA 3TP3A 1WH7A 2NVYJ 1H8AC 2HOAA 3JRFA 3BQYA 4BBSJ 1RETA 1H88C 1T56A 2DMNA 2NVXJ 1ETOA 1GVDA 4ABZA 2E2JJ 5EZHA 3PO2J 3MN2A 1IV6A 2DA5A 1JJ8C 5M5WJ 1TWCJ 1EF4A 5FLMJ 2X6OA 3BTIA 1MSFC 1IG7A 2EQRA 1QVTA 1TC3C 2B63J 3MKLA 4DZJA 1RESA 4JP0A 1AKHB 4Y7NJ 2DMUA 2DA4A 3H3VK 4Y52J 4M3GA 1AKHA 3BTLA 4DZPA 4RDUA 3JRCA 1FTTA 3HOUJ 2L9RA 2WV1A 3LSRA 4JX5A 3HM5A 5DS9A 4A3CJ 2E2IJ 4M3DA 1RKTA 1IC8A 5FKOA 1JT0A 2YUSA 4M6VA 1XC5A 4IHYA 3JRIA 3GTQJ 1F36A 1AU7A 1WH5A 2QF7A 3BTCA 5IP7J 3HOYJ 2LP0A 1JKOC 3FK6A 3K7AJ 1WCMJ 3GTJJ 2AHQA 3O8GA 3BQZA 3GTPJ 4L5EA 1OCPA 5FKMA 1JJ6C 5EYRA 2K9QA 1VFCA 2TRTA 3NAUA 3A01A 2JA7J 2DJNA 1FIAA 2FJ1A 2ELKA 2Y9YA 5E3MA 1FIPA 2K9NA 2HOTA 2GLOA 2DN0A 2E19A 3HBLA 5J1UA 1HDPA 2H8RA 3GTLJ 4QIWN 2HDDA 1SFOJ 1OFCX 2JK3A 4HNVA 1PUFB 4DYRA 3GTOJ 1ENHA 1ZR4A 2JA5J 5GPAA 1UHSA 1Z77A 1W0UA 1PUFA 1MBFA 2JMWA 3TP0A 5IOZA 1H89C 3FKIJ 3I4NJ 3JRGA 3HB9A 2XPUA 3GTKJ 2DTZA 4QSHA 2R7ZJ 5C4JJ 2K40A 3CMYA 2NS7A 1POGA 2NS8A 2N8GA 2XGEA 3JRAA 1BW6A 1ETVA 3H0GJ 1VNDA 5F1JA 2HQ5A 2LKXA 4MIMA 2HXOA 1OCTC 2LK2A 4A3EJ 3S1NJ 1K61A 1K83J 2EBIA 2IAIA 1X2MA 2DA7A 2L0KA 3Q3SA 5J1YA 2YU9J 1HOMA 1QPIA 3ZOBA 1GDTA 1P7JA 3C2BA 3S1QJ 2ME0A 2YS9A 2XPVA 3D1NI 2XGCA 1GV2A 1BW5A 2JJ7A 3HOZJ 4V2GA 1CQTA 4M3BA 1F43A 1Z0XA 4MLOA 5FKLA 4B4CA 1MH3A 1IUFA 4MO7A 2E1OA 1YRNB 4IHVA 2DA6A 2R5YA 3HGGA 3WHCA 3RQIA 1YRNA 1ETKA 5IP6A 4XICA 2QCOA 3JRHA 2EZIA 1NK2P 2D5VA 1JUSA 1ETQA 4X1EA 2CRGA 4C3JJ 2JN6A 1ETYA 5IPAA 2XSDC 2R93J 3BR1A 4JX4A 2XPWA 4XRSA 4A3FJ 3S1RJ 2L7FP 2LVSA 2VKEA 3Q0VA 1E3OC 2DMPA 5E3NA 2MSYA 3BR0A 2O7OA 4A3JJ 1R9TJ 4C3HJ 3ZQGA 1JKPC 5K7HA 3TW6A 4IHXA 3CCYA 4BKXA 2AO9A 3BG5A 4DYQA 2CU7A 1MH4A 4A3LJ 3IH3A 4W1UA 4D7MA 2XB0X 4FE4A 3HKZN 1OJLA 3HOXJ 3S15J 4AUXA 2DMTA 4I76A 2XRLA 5K7ZA 1MBHA 4XRSG 3TW7A 3FK7A 2VPRA 3M4OJ 2MGQA 3Q0UA 2DMQA 1LE8B 2H1KA 3HOVJ 4IEJA 1X58A 4A3BJ 4A3MJ 1LE8A 1FJLA 2RAEA 5IYCJ 3QQAA 3A01B 1IJWC 1P7IA 4JX6A 2X48A 3BG9A 4XK4A 3Q0WA 4XIDA 1GV5A 1T33A 3K2AA 2M2EA 5DTDA 4UUTA 2DA1A 3S17J 4X6AJ 4I6ZA 1JKRC 4AC0A 1JKQC 1QRYA 2Y0SN 4A93J 1ITYA 1D5YA 1HCRA 3JRDA 1LFUP 1ZTRA 3OOUA 3SDGA 3ZQHA 3JREA 1U9OA 4B1RA 4B3AA 1JUPA 2LD5A 3E7LA 1I3QJ 5E3OA 4BBRJ 1ETXA 3BR6A 4V2FA 3BR2A 4AYBN 4LOCA 1MBJA 3TEDA 1XG1A 2WAQN 2Y30A 3PO3J 1TWGJ 1WPKA 2GM4A 4UUSA 1DU0A 5EZGA 1RR7A 5IOYA 5M3MJ 2ZB9A 4FCYA 3I4MJ 1A6IA 5JLXA 3G1LA 2IBDA 3ZQCA 1BJZA 4A3DJ 5C3EJ 5FJ8J 1GUUA 2K9SA 2FX0A 1IDYA 2HOSA 1ORKA 3BR3A 3LSPA 3F0CA 4EEFG 3W6VA 2FD5A 2ME6A 4C2MJ 5IP9J 4IHWA 2MW8A 4RBOA 4GFBA 3SJMA 1I50J 4MFDA 5E3LA 4W97A 1IGNA 1TWAJ 3OSGA 3S1MJ 5C44J 1GT0C 1ZQ3P 1AHDP 2R0QC 2LR8A 2Y9ZA 5FKKA 3S14J 2R5YB 4A69C 1MSEC 1ETWA 2LY9A 5F08A 1B8IB 3S2DJ 1G2HA 4DW6A 1RKWA 1B8IA 3IV5A 1JTXA 1LFBA 3OSFA 2ECBA 4BY7J 1IDZA 3HOWJ 5EG0B 5JLWA 4D7NA 2DA2A 3OIOA 5EG0A 1ZKGA 2EZHA 9ANTA 1MBEA 4FISA 4J19A 4S0HB 3L1PA 3VPRA 2GBYA 1ZR2A 2XB5A 2IEKA 2X9DA 3LSGA 1QVUA 1MNMC 5C4XJ 2KT0A 4M3FA 5J1RA 4XRMA 5EGOB 2VUMJ 2PMZN 4QTRA 5EGOA 5FLVA 3QPSA 4A3IJ 1VF9A 5GPCA 2KDZA 2E2HJ 3IH2A 2I10A 4A3KJ 2Y31A 1ZK8A 2XGDA 3UKGA 3RKQA 1HLVA 1RPWA 3B6AA 3HGYA 2M9HA 2O8KA 3GBGA 4BXXJ 1MBKA 1SANA 1DU6A 3WHBA 1FEXA 1IRZA 2OF7A 2VKVA 1TWFJ 3RZDJ 2ID6A 1I6HJ 5IYBJ 3HEFA 1UG2A 4C3IJ 5EDNA 2R5ZB 3RZOJ 2CJJA 2R5ZA 2L7MP 2HI3A 2JWTA 4DYCA 2HXIA 1HDDC 4NDLA 2COBA 2M0CA 3BG3A 3BR5A 2CUEA 3QPLA 3DCFA 1FTZA 5M3FJ 2DA3A 2EZLA 1NK3P 4MFEA 3BTJA 3JR9A 5IYDJ 1W0TA 3A02A 3ZQFA 5BNGA 2M8GX 1TWHJ 1MBGA 5GP9A 1U8BA 2O9LA 3G1MA 2NVQJ 2W48A 1XS9A 4D5CA 5F27A 4BY1J 2P81A 1A5JA 3MVPA 1BA5A 3B6CA 1Q1VA 1S7EA 3LNQA 3FIWA 3O8HA 1HF0A 2WB1N 4UUSB 1JTYA 2OPTA 3S2HJ 5M5YJ 3HDDA 2EZKA 2MG4A 4FE7A 1U78A 1B72B 5HODA 2HYJA 3S16J 3GTGJ 1B72A 2LTPA 2VI6A 1UMQA 3PM1A 3G1OA 3A03A 3M3YJ 4A3GJ 2R92J 2LLKA 1WGXA 3GTMJ 5K7FA 1WI3A 3CQZJ 2TCTA 4JYKA 3LSJA 2CUFA 4G12A 4M3EA 5F04A 5F0CA 1Y1WJ 2M34A 5F0HA 1ZGWA 3ZQLA 1BL0A 2LFBA 5F0FA 3SFIA 1Y1VJ 2JA8J 2EH3A 3NARA 1JUMA 2L7ZA 1JGGA 5EEAA 1X2NA 2CQQA 1VI0A 3LOCA 1JT6A 5EF6A 3JRBA 2CQXA
chains in the Genus database with same CATH superfamily
1OCCH 4U87A 3F8MA 3R60A 3SHFA 3TOAA 4D5FA 1APLC 2LF8A 1WJAA 1XDSA 4CYCB 2FQ4A 2XC7A 2ECCA 2JVGA 4S04A 2WTEA 3KYCB 1X1DA 1NTCA 2P6SA 3CP8A 1RZ4A 1XDUA 3E97A 2F4IA 4HSRA 5CQEA 1WJCA 2D1HA 1YG2A 3ZQIA 3BT9A 4HEA2 2F6CA 3KZYA 3MZYA 3EQLF 3UR3C 1OKRA 2EJRA 5LRSA 3E6CC 2OJED 1U0JA 4RA2A 2NVYJ 1WQ2A 1H8AC 1ZRCA 2HVQA 3IRRA 3JRFA 3MKYB 1RETA 1IN4A 4ZH4F 5FGMA 3DLAA 4ZZDA 3MWMA 1LUJB 1T56A 2NVXJ 2DQLA 2X85A 1GVDA 3HOSA 5EZHA 4YEJA 3V7SA 3WTWC 3I4PA 2R7RA 3MN2A 3FXKA 1ZG3A 3L2CA 5KVRA 1FMVA 2ESNA 2GA2A 2VKDA 3CCSI 3BTIA 1IG7A 3HC7A 1WRJA 2RNJA 3L7WA 1FNNA 2JVHA 3KYLA 1XSDA 2NYXA 1MMAA 2A5YB 1WJEA 4ENJA 4Q4ZF 4Y7NJ 1OCOH 2L3DA 4NQWA 3E1SA 1UCRA 4Y17A 3RTRA 4EJUA 3JRCA 1FTTA 4EM0B 1XD7A 1D8KA 2V9VA 2WV1A 4EJWA 2HDCA 1FT9A 2VASA 3CCRI 3BDDA 4HW0A 4JX5A 3QYBA 5FKOA 4M6VA 1ZELA 3GTQJ 4PFPA 1F36A 4N0BA 1AU7A 1WH5A 3BTCA 2RQQA 1P4XA 5TJJA 1JKOC 1OQYA 2RREA 5DCMA 1DPRA 2DDAA 3JW4A 4O5VA 3BG6A 4BQNA 4AIDA 4DBRA 1IRXA 4ESFA 1IV8A 4EJVA 4B47A 4WCGA 4PJMA 3NAUA 3A01A 3F22A 5KCMA 2R7SA 1OYWA 2ELKA 3PNVA 3SFZA 1OMIA 1TL8A 3ZN1A 2I8DA 2LKSA 2E19A 2DTRA 3HBLA 2VODA 3GFIA 2J5PA 3DP7A 3FXQA 4OU0A 2PN6A 1SFOJ 1LEBA 4L9NA 2OC6A 3TGNA 3OYEA 2GXGA 2LKPA 3M1CA 1ENHA 5FD5A 5B3SH 3GTOJ 2JA5J 1RC9A 4XMYA 3SZTA 1PUFA 1MBFA 1KQ0A 2JMWA 4WK8F 4FETA 5IOZA 1ODDA 3FKIJ 3I59A 1K78A 3K1PA 2OTLI 4GCVA 2VQHA 4QSHA 2QA4I 2P0WA 2K40A 4RGXA 3K2ZA 4R79A 2NS8A 4O3MA 2CQNA 2DPDA 2IT0A 1XGSA 2VPLA 1J0RA 2KRHA 4LK1F 2EA4A 3CJQB 2FF4A 3WE2A 2R7XA 1REPC 2O6GE 2FSWA 4LFUA 4UVBA 2WY8Q 1EH8A 3I3LA 4G6DA 1E3PA 2V1UA 2LKXA 2HXOA 3CLQA 3K10A 3H35A 1F5TA 4ZDPA 2VQGA 4KISA 3CUQA 2BGCA 1K61A 2EBIA 3Q3SA 1HOMA 2UZKA 1O3RA 4XLNF 3ZOBA 1P7JA 1QPMA 5HDGA 2BYVE 2Z16A 4FX0A 5J8CA 3HOZJ 1WJBA 1XCBA 2IW5A 4L0ZB 2V7FA 2V1NA 2KFDA 3J7ZI 2EA2A 2FNAA 4Q47A 1MH3A 2DT5A 4MO7A 1YRNB 2E71A 4IHVA 3TO9A 2DA6A 3DXJF 2V1DA 4A6DA 2HDWA 4ZTJA 4RAYA 1ZH5A 1TBXA 3OYJA 3DBRB 4IL6C 3VYRB 5FRNA 2KPMA 2QCOA 3S8PA 1NG6A 1PYVA 2EZIA 1NK2P 4EGYA 3V8KA 4AU7A 2JN6A 5D6FA 2HTJA 1HW5A 4BJTA 2M45A 1R1VA 2XPWA 4JX4A 3S1RJ 3PQJA 4PDKA 2W57A 2DMPA 3U1KA 4ZYEA 2MSYA 3BR0A 4A3JJ 2UXXA 1R6RA 1R9TJ 1U5TA 2Z5UA 2JPBA 4IQ4A 3L2RA 1X3WB 5K7HA 1XPXA 1YW8A 4XR6A 4IO9F 4CZCA 1FSEA 2KISA 3LSIA 3M8EA 3G2BA 2EIKH 2YX4A 4FE4A 1V3FA 1OJLA 1BOAA 4CO8A 3E0JB 3FMSA 3OYNA 2M7AA 3S15J 3E5XA 3OL3A 2XRLA 4MTDA 2EINH 2Y75A 1FBSA 1YE9A 1TNTA 4N9HA 4L9VA 3PNYA 3TW7A 4HNUA 4H0EA 4YFXF 3H0DA 4CCLA 4N4NB 2HPMA 1R23A 1TZLA 2LF7A 4XLFA 1DPUA 1E17A 3B73A 1LE8A 3PSIA 4XSXF 4XNFA 2F5FA 1MZBA 3DPTA 3GFMA 1UAAA 2IVMA 3WU2C 1JI8A 1LEAA 1IJWC 1P7IA 2VE9A 3BG9A 3PL8A 3WTTC 3DWLE 4XK4A 1GV5A 1T33A 4I09A 5DTDA 3KE2A 2QM3A 3DU6A 4IXAA 3RJPA 3S17J 1B9NA 1Y39A 1HKSA 4I6ZA 2A6HF 3WGIA 1QRYA 2OTJI 5A2QK 2BOLA 3JRDA 1KQ8A 3GZNB 4ZJZA 4PGGA 3V8JA 3CCEI 1W7PD 3PSFA 4PJ0C 1IW7F 2VXZA 2K7LA 1TTYA 2LD5A 3IL2A 1BI3A 2DFIA 1BI0A 4JQFA 4A0YA 2VOPA 4BBRJ 3BR6A 3TEDA 1WJFA 2WAFA 4LIUA 3PO3J 5KAIC 1TWGJ 4FQGA 2GAUA 3F23A 4HRIA 1G6NA 1DU0A 2WV0A 2NS0A 3KX2A 2R7UA 3D5SC 1XGOA 3H5RA 2X1DA 2QSHX 2IBDA 1OYYA 3AFHA 4OWRB 5C3EJ 5HLHA 2K9SA 4WWCA 1KQ9A 1R4MB 4EEFG 2YU3A 1Z21A 2IGMA 4IJAA 3HKZA 4RAGA 2H09A 1I50J 5E3LA 4PFOA 4AVZA 1TWAJ 4YFKF 3GFJA 2VQCA 2F5DA 2WC2A 3CC7I 2LR8A 3S14J 3CUQC 3DLLF 4DNCA 4BACA 3DFGA 1ETWA 3CCUI 5F08A 2Z99A 1B8IB 4E4HA 4I2OA 3U9GA 2HZTA 3ZR8X 1JTXA 5K1YA 3IV5A 2PJRB 5E17F 4U7BA 4E7KA 1GLNA 3PQKA 5JLWA 3W2WA 4D7NA 2DA2A 4MNUA 3OIOA 1JXSA 2IGOA 5EG0A 3ISPA 3EYYA 4BL0B 1YJ9I 3BG7A 1MBEA 1N75A 1W7PB 2LNBA 4S0HB 5DYMA 1ZR2A 2LREA 4HNTA 3F21A 2JRMA 2P5KA 5C4XJ 2ZXWH 4M3FA 3K4JA 5IT9K 3T8TA 2CYYA 4QTRA 1Y8QB 5EGOA 3CESA 2PQ8A 4RAZA 2BY0A 3IHUA 5CVJA 5D4SA 3V4GA 2R7DA 4HSTA 2FOKA 5J4YA 3AAFA 2I10A 2VT2A 5FROA 1FLIA 1ZK8A 3UKGA 4UXNA 1HLVA 1U5TC 2DXIA 2Y69H 1BI2A 2O8KA 3GBGA 1FC3A 4BXXJ 1EKEA 2KJBA 1UHMA 2OF7A 2RN7A 3CP2A 1KYZA 1T6SA 3R4KA 3WTSC 4LIVA 4BE0A 3IAS2 1O3QA 2CMPA 3RZDJ 3L2WA 1I6HJ 3P9CA 2EFPA 3ZN0A 2EFOA 5EDNA 2OU2A 1FBUA 3Q9SA 2XAQA 2CWEA 2KQRA 4NC8A 4A5MA 5JVGF 3TDZC 4G7ZF 3QU6A 1D0YA 3BR5A 4KUMA 2RV8A 3V42A 4PJNA 2XF7A 5A2QZ 1S29A 4RB0A 4MFEA 4XOPA 1A35A 2NNYA 5IYDJ 1LB2A 3B02A 3ZQFA 3K4NA 1Z05A 1TWHJ 1MBGA 1U8BA 3G1MA 4LG3A 1DGWY 1YOVB 2ZMEB 3ROUA 1IN6A 4BQOA 2JT1A 5DDGA 1J75A 1XS9A 5F27A 2CV0A 2HQNA 1MMDA 2P81A 1A5JA 2R7WA 1WWXA 4RB1A 1YQAA 4UHTA 5CLSA 2DPUA 1HF0A 5D6EA 2WB1N 1IRGA 1YLFA 4HYEA 2NVUB 3CF5F 1XMKA 2YSRA 2HEOA 4IOCF 5M5YJ 1F9NA 2VBZA 4FE7A 1U78A 2BXYA 5LD2C 3LA2A 1B72B 3OIQA 3MMYB 2EFQA 1Y6IA 2HQRA 1B4AA 1R4NB 3I71A 2V6CA 4E6KG 3A03A 1J2XA 4IQJA 2A07F 3WG7H 2CS3A 2PBIA 5K7FA 3N4MA 4P5OA 3AG1H 3NRVA 2TCTA 5CVVA 4IOAF 1LNWA 2CUFA 2PMUA 2XDVA 1J7KA 3S3OA 2EIMH 3PNTA 1Y1WJ 2XASA 5D8LB 4HA8A 1ZGWA 1KU9A 2BHZA 3BPXA 1DUXC 2JA8J 1I27A 2EH3A 2W7NA 2F5CA 4XONA 2EV6A 3AG3H 2VXDA 2DT7B 3KEOA 2OAZA 4BEHA 1JGGA 4CCNA 1X2NA 3ZMVA 1O7LA 5EF6A 3CJTB 3J7AO 4PGHA 3JRBA 2CQXA 2K5CA 4ESJA 3L2VA 3CDLA 3ZMSA 3WE3A 1BM9A 2KIUA 3IH4A 2A3SA 1SAXA 2AXLA 3CC4I 2XKPA 2K9LA 2JA6J 3QPTA 4JOMA 4QWQA 2FOWA 3KZIC 3DEWA 5D5WB 4LGWA 4B44A 2F48A 4HLXA 3RI4A 2DCEA 4I98B 2XGXA 2NVTJ 1NG7A 5LHIA 1S3JA 5IT9Z 1NHAA 2W24A 2CSOA 1RIOH 1WH7A 1HSTA 3LAJA 2AQFA 4DJAA 1WSUA 3KP7A 3FZVA 4P9UA 4XSZF 2ZO4A 1I1GA 2DMNA 3CCJI 2HTSA 2H94A 5JFRA 1ETOA 1YO5C 4RGSA 3C7JA 4RB2C 1O57A 2QGUA 4E7ZA 3PO2J 4CCMA 2YX7A 2O61A 2FMLA 1IV6A 4PCQA 2E60A 2XSJC 1L0OC 3ECOA 2CO5A 1ZLJA 5FLMJ 4MTEA 2EQRA 2KJCA 4IF4A 3R0AA 2HWVA 1QVTA 1QBJA 3C3WA 2DK5A 1IO2A 2B63J 3CJNA 1RESA 2ZSHB 4HX7A 3OYAA 2J5OA 3ZMUA 3H9JA 3N97A 3H3VK 1CF7B 2M7BA 1AKHA 4DZPA 2IGNA 3HSEA 4RDUA 1R7JA 2QEXI 4WXCA 3HOUJ 1U3EM 2VLAA 1R49A 2CG4A 3IWFA 3LSRA 3V7RA 1YTYA 2OZ6A 5ILSA 1LPQA 1M1EB 1FMWA 1USTA 4KT6A 4M3DA 4B8XA 5GTIC 5ED4A 4DIQA 4UNOA 3MKWB 1R00A 1XC5A 5CKTA 3JRIA 2Z9OA 3HRUA 3HOYJ 3E5QA 3SZPA 3A0BC 3K7AJ 2JRTA 4K2EA 3O6BB 1X4PA 2QLZA 1W5SA 4U88A 2WBMA 4BDZA 3BQZA 2W82A 1G3YA 2CW0F 3FKJA 5FKMA 4KYWA 2K9QA 1VFCA 1K4TA 2TRTA 1FOWA 1MIJA 2GXAA 2K9MA 3FHZA 2FJ1A 4JBAA 3HPHA 2Y9YA 5E3MA 1FIPA 2K9NA 4J00A 1SMTA 5FLXZ 5J1UA 2R7QA 3K0LA 1HDPA 3KEQA 5GTHC 1QA6A 3GCMA 3GTLJ 3K6GA 2HDDA 1OFCX 2F2EA 2JK3A 3LQQA 3DTIA 4HNVA 4Y3OA 2RNGA 3RIRA 1QO0D 3OWTA 2FEZA 2DYSH 5L3CA 5HNFA 1Z77A 2BHYA 2BW3B 1ZR4A 2PMZA 2FE3A 4RAFA 1D8JA 5DM7F 3JRGA 4OAZA 3HB9A 1TW2A 2XPUA 5F6FA 3H9QA 1FP1D 2R7ZJ 3MKZA 4M71A 4BQAA 1POGA 2ISZA 1HSJA 2N8GA 3JAMZ 2XGEA 1BW6A 5FD6A 1MDMA 4ZDOA 1KZHA 3OS2A 1DP3A 2JA2A 2W00A 3S3MA 3BJAA 4MIMA 4IZZA 1OCTC 1UELB 1IRFA 1XN7A 3GX4X 4A3EJ 3S1NJ 4LK0F 1MJ9A 1KGSA 5J1YA 1U8RA 2HQAA 4RB3C 2WWYA 1X1CA 1GDTA 1BW5A 2XGCA 2JJ7A 5FRMA 3Q5FA 3RYPA 4V2GA 1W5TA 1F43A 3FXRA 2KDOA 1HA8A 3MFKA 3PUBA 1IUFA 2NAZA 1ZLKA 4L0YB 2HFHA 2QQ8A 1QHGA 4Q5SF 3JTGA 4RS8A 1W36D 2PG4A 4AIJA 2CUZA 4BJ6C 1JUSA 1LDDA 3W2AA 2CRGA 4C3JJ 1ETYA 4WXDA 4C30A 3RKWA 3GVAA 4BE1A 2KP6A 4LB5A 2CFXA 2ISYA 3X2QH 2K85A 4EJOA 3CCMI 4KNYA 3WGHA 4I99C 4UV8A 4XRSA 1LQ1A 2LVSA 2HR3A 4JK1X 2GZWA 2KRFA 2HYFA 4HBLA 3T5XA 5E3NA 3DBHB 3GYHX 1SVLA 2QWWA 3WG9A 3ML6A 2AXTC 4C3HJ 3ZQGA 3RQ4A 3IKTA 4C2UA 5KAFC 2DAOA 1R5ID 3M7GA 4IHXA 1ACIA 2OUMA 3BG5A 2LYCA 2A05A 4UUVA 3IH3A 3QYFA 4W1UA 4D7MA 1X3UA 1QGPA 3K70C 3WTVC 5KK1A 2M4KA 2VBWA 1XCVA 2DMTA 2QQAA 4XN0A 3BC8A 4PK4A 4BHCA 3LSHA 3CO7C 2VPRA 3J80Z 1SD7A 1S72I 2MGQA 4AWXB 3Q0UA 1DP7P 2L9NA 2V1XA 4IEJA 4A3BJ 4A3MJ 1FJLA 5BQTA 1MW7A 2DBBA 1O3SA 1QHHD 4KICA 2X48A 3Q9VA 3AG2H 3E3VA 3SEZA 2HVRA 3NWSA 4XIDA 3OYLA 2IXSA 2M2EA 1ZAOA 3K4LA 3ERED 2QZ8A 5F1RA 2V26A 2YPRA 4KT5C 1YW9A 1D5YA 1HCRA 1T0FC 3HSFA 3OYBA 1ZTRA 1ON2A 1Q1HA 3SDGA 3GW2A 1FBQA 1V4RA 4XKCA 3ZQHA 4M9ZA 5FO5A 3JREA 3BCAA 4B1RA 4B3AA 2A6TA 3FF5A 1MNEA 1UFMA 4OIPF 2GWRA 1J59A 3E7LA 4P96A 5JR3A 2FBHA 3C18A 4CH7A 3BR2A 3JTHA 1MBJA 2E7WA 1T98A 1VQ8I 2VBYA 4P9FA 1WVRA 2R3SA 2H27A 3G71I 4ENKA 1QU3A 5EZGA 2E35A 1D1BA 1RNLA 3KZZA 4LJZF 3GFLA 3CMAI 1MNDA 2A69F 2UUZA 1A6IA 2OCCH 3ABLH 3ZCOA 2D2WA 3ZQCA 4HLYA 1BJZA 4A3DJ 2LG4A 5LGNA 4PJJA 5B66C 4XKWA 2E1NA 4ZC3A 2ZKZA 2QBYB 2BV6A 2XVCA 1IXCA 3RPUA 3NQOA 4J01A 1UB9A 4C2MJ 5HDNA 2EB7A 3PUFA 4IHWA 4RGRA 4EATA 2RGVA 4GFBA 3ZPLA 2DFHA 2LH9A 2Y0MA 1Y0UA 1SFKA 2CFOA 1KONA 1ZGAA 3BLYA 4HV5A 5CPRB 4YG2F 2HPIA 3LAPA 1GT0C 2WAEA 2L7KA 4LLLA 2R0QC 4KA4A 3MCZA 5FKKA 4OIOF 3DPUA 3HHHA 5L3FA 2ADUA 1X1PA 2R5YB 4E7JA 4NC6A 4A69C 3GLXA 2LY9A 3PFIA 1G2HA 4XLPF 2IS1A 2QENA 1TQPA 1ZARA 3T8RA 4ETSA 4DGWB 1LFBA 4LLGF 4WX9A 4UY8I 3LA7A 4BY7J 5J4VA 4KFCA 1IDZA 4MQ9F 2KZVA 2QVOA 4F3QA 3H36A 5D5XB 1ZKGA 4GXOA 2OD5A 2BY3A 4UV9A 4EJTA 2UWMA 2L9SA 4GGGA 3L1PA 3FXOA 4KN7X 2EFWA 2X9DA 3LSGA 4F52A 2HKOA 4BJ5C 1BC8C 2KT0A 4HX8A 4XRMA 4AIKA 1RR8C 3ZP5A 5B1BH 2PMZN 4D9JA 1GXQA 2XUBA 1CGPA 4EGZA 3MD2A 1BC7C 3KYDB 3OIPA 2W84A 5GPCA 4L18B 3FHNA 4L5IA 3RSNA 5ILVA 2KDZA 2B7EA 4AYBA 3PFYA 4I0BA 2E5ZA 2DOAA 3RKQA 5E8GA 1FWZA 1IUYA 3KFWX 1RPWA 4PUSA 2G7HA 4HG2A 3OY9A 4HDUA 2CGPA 3HTUA 1MBKA 4FASD 3QP6A 1FEXA 1Z91A 4LG0B 2ETHA 4ZDLA 1D1CA 3BZ6A 4PZJA 3HOTA 4I01A 3EYIA 2MLGA 4GRIA 3LMMA 5ERIA 2R5ZB 2ZNZA 3JCUC 3IP4B 2F5EA 2FUG2 3F8CA 3RZOJ 2P5VA 3VEPA 1FYLA 3I54A 4NDLA 2COBA 2M0CA 3KLNA 2CUEA 1HW2A 1Z9CA 4II3A 1NK3P 3JR9A 3A02A 2M8GX 1B59A 2MD5A 4X0GA 4Y4RA 2W48A 3V7CA 2DOEA 2JTVA 3K4CA 2QSFX 1AWCA 3B6CA 2EFNA 1RUOA 1GHCA 1S7EA 1YI2I 3A4CA 3LNQA 3FIWA 4KN4X 1LDKB 3BROA 2ZXHA 4UUSB 3S2HJ 1RI7A 2DFFA 2Q2EA 2EV5A 2EZKA 4XLCA 2ZMEC 1KU7A 1XMAA 5B5EC 2LBFB 3GTGJ 4QPOA 5BMZA 2LTPA 2M30A 2GOXB 2XAFA 3G1OA 2V9KA 4M6XA 2FRHA 4V19K 3M3YJ 5E1XA 1X19A 1WGXA 1V55H 2JSCA 2ZFUA 3BJOA 3CDIA 3QU3A 5FFXA 3OYMA 2GXBA 2VE8A 2FMYA 2L9VA 2EV0A 1J5YA 5HS7A 2V4JC 1R5GA 2M34A 1R1TA 5F0HA 3GZ6A 2LFBA 3W6KB 3DF8A 5GADJ 2O8XA 1JUMA 1MMNA 4U7DA 1HBXG 1AA7A 5TGTA 4E7HA 1FZPB 1A31A 2P4WA 3DBLB 1D3YA 3OYCA 3LOCA 1HKQA 4HF0A 5H20A 3HRSA 1O4XA 1QZEA 4BS9A 1WJDA 2MH9A 5J3LA 4ZYGA 3HG9A 5HDKA 1T08B 3MEXA 5AIPA 1LVAA 2RKHA 4CGZA 1JHFA 1IXRC 4CYCA 3A2KA 3KP2A 5FKNA 1Y0NA 2XKOA 3PIPF 1FOKA 3FISA 4IRHA 1SMYF 1U9NA 1N78A 2W85A 2Y0SA 2IP2A 5J47A 3EDPA 2G0EA 1PVEA 1R1UA 2XF5A 3K4MA 2GOMA 2K02A 4PSWA 4CYDA 3AKZA 3SZGA 4IX7A 1YIOA 3KP6A 2R4GA 3EPZA 2MABA 3HSRA 3ECHA 1H88C 3ULQB 4L5JA 4OIQF 4E70A 2W25A 2E2JJ 2WAQA 3LSMA 4FHTA 1SAUA 1VQMI 2DA5A 1JJ8C 4HDVA 4ENMA 1TWCJ 1G3TA 2QKLB 4LITA 2M8EA 2X6OA 2VC1A 1I1SA 5F64A 2W4SA 5K5OA 1TC3C 3RYRA 4NQWB 3MKLA 4JP0A 2XAUA 1ZREA 3BJ6A 3E6DA 3E6BA 1USSA 3F8FA 3I55I 3DKWA 4A2UA 4MEYF 2L9RA 2ICWG 3BPVA 3HM5A 5DS9A 1J09A 4A3CJ 2E2IJ 1RKTA 1IC8A 3A1YA 2R7OA 1BJAA 3OR2C 2YUSA 3G73A 4CCKA 2L5QA 2X6YA 5DCMB 4CZZA 3REOA 4G6TB 1WCMJ 3GTJJ 3COAC 2UV1A 2DT6A 3VB2A 3W6JB 3O8GA 3ABMH 2PLYA 4DQ2A 3GTPJ 1P92A 5HLTA 5EYRA 2M1BA 3ASNH 4LLNA 2JA7J 1UZCA 2DJNA 4HV6A 2H1LA 2VJ5A 2MC4A 2GLOA 2HOTA 1MD0A 1EJ9A 1Z6RA 2H8RA 2FQ3A 3P5JA 4LD5A 4QIWN 4CXFA 4G9YA 1FPQA 5FLXK 3DTEA 1OR7C 1PUFB 1MGTA 5GPAA 1K78B 2XROA 3ZQQA 3TP0A 5E1ZB 1H89C 4CA0A 3U2RA 2HS5A 3I4NJ 3VOEA 2XAHA 3GTKJ 1FSHA 4Z2YA 2Z1DA 3ONQA 3WGGA 3FMQA 3RKXA 2H8WA 3S93A 2KIFA 5LHHA 4E7SA 3JRAA 4EV0A 4MQVA 2F4MB 1B6AA 5EEHA 4YELA 1ETVA 3H0GJ 1VNDA 1E2XA 2VBXA 5CVUA 5DUKA 3SQNA 3ZMZA 4AVPA 5F1JA 3JAMK 5H6QA 1HQCA 2E5NA 3CUQB 1VQNI 1XMXA 1WHUA 1DGRM 4GYIA 2MA3A 3VSKA 2JZYA 2IAIA 1LFPA 1X2MA 2YU9J 3P9IA 1D0XA 3D0SA 4E7IA 1QPIA 2ZJ2A 1S7AA 5L3DA 2X1EA 3C2BA 3S1QJ 2ME0A 2YS9A 1BN5A 3D1NI 1IN5A 4GDFA 1TW3A 4EVIA 1XGMA 2QKMB 3SEQA 4OINF 5BOXA 4NNJA 3J81Z 5L3GA 1CQTA 2NXNB 5LLQA 2PEXA 3F8NA 4XLEA 1Z0XA 4MLOA 5FKLA 4B4CA 2E1OA 2QQ9A 2R5YA 3HGGA 3TMOA 4BGDA 4BQQA 3RQIA 1YRNA 3QODA 3I9V2 2O3FA 3T1BA 1R71A 2VOOA 1JGSA 4XKBA 2A6EF 4XICA 2RQPA 3TBIA 1O3TA 3JRHA 3VODA 3VSLA 2BZTA 2ZXIA 1G59A 3D5LA 3R0JA 5IPAA 5J8FA 3BR1A 3K4BA 3KP5A 1G4DA 2PX9A 2L7FP 2QSGX 3ERMA 3Q0VA 3M07A 1E3OC 1UJ8A 2VJ4A 4B48A 5K5RA 2O7OA 5HVQC 4YFNF 4ESBA 1Z1DA 2K3PA 4AM3A 2QQBA 3FWEA 1ULYA 2KHMA 5JHUA 5IT3A 1OPCA 3TW6A 2Q8KA 3CCYA 1BR1A 1BR2A 3T0YA 2AO9A 3F8BA 3GEZA 4DYQA 2LDUA 1MH4A 4A3LJ 1E0EA 3HKZN 4KIFA 4I76A 3IKVA 1WI9A 4KMUX 1TNSA 5K7ZA 4HZFA 5H6RA 4XRSG 1OISA 2DJIA 3QOEA 3FK7A 2DDBA 4F55A 2STTA 2DMQA 5HNHA 1LE8B 5ICEA 3OYIA 2G9WA 2H1KA 2EK5A 3J80K 4LG0A 3HOVJ 1ERDA 5LGTA 1A36A 1VQLI 2RAEA 3KCCA 2GIZA 1FYKA 3QQAA 1T0FA 4KJZA 4XKVA 4JX6A 2ZC2A 1BIAA 1O7FA 2CQKA 3GO5A 3I58A 4GO1A 1TQIA 4IHTA 2MC3A 2VJIA 4X6AJ 2KMUA 3RKYA 3BZCA 5D5UB 1JKRC 5FFZA 1UG0A 2EIJH 4AC0A 2IS6A 2Y0SN 1ITYA 5TISC 1LFUP 2VQLA 3OOUA 2MFZA 5BS6A 2MLKA 2NOJB 1JHHA 1HXDA 1JUPA 1YS7A 3H5NA 3K9TA 2MBFA 3ABTA 1I3QJ 4M9XA 1FY7A 2A5WA 5E3OA 1TT0A 4C2TA 4V2FA 2UXNA 3CUOA 1VZ0A 4LOCA 1XG1A 2KRCA 3I53A 5ICFA 2WAQN 2Y30A 3CF2A 4P55A 1WPKA 3QPHA 1W36C 1K6YA 2E1MB 4UUSA 4RGUA 5IOYA 1T8IA 4BDYA 4FCYA 2OQRA 3GUDA 5CYVA 5DV5A 5LFAA 3H92A 1YIJI 3G1LA 2FBIA 2K4BA 2L2OA 2LSOA 4LB6B 2IS4A 5LEKA 1U6GA 5FJ8J 2HKXA 2FX0A 2HOSA 1ORKA 3BR3A 2CW7A 1YX3A 3F0CA 4ZYAA 3P9KA 2ME6A 2ESHA 5IP9J 1SFXA 3ESWB 3IC7A 4ON0A 4RBOA 1OLTA 3NWTA 3SJMA 4E7LA 1IAWA 3EETA 4W97A 1IGNA 3KP4A 1XX5A 1ZQ3P 4HAMA 4XLAA 3M8FA 1H9GA 2Y9ZA 2DFEA 3WTXC 1Y56A 1ZRDA 1PJRA 3PJRA 3H3ZA 1V54H 1MSEC 1E3HA 2G7UA 1B9MA 1P4WA 3S2DJ 4DW6A 5L3EA 4BHPA 3OL4A 2EPFA 4QPQA 1B8IA 5D4RA 2W1OA 3ABUA 3SYTA 3DEEA 3OSFA 4OMZA 2ECBA 3ZMTA 2ACJA 2L54A 3F3XA 2PJRA 3HOWJ 5EG0B 4CUGA 2LMDA 3HUGB 3IWZA 5DCFA 1MJBA 5EJCA 2OA4A 1MKMA 2EZHA 1TQMA 2QUFA 9ANTA 4FISA 3H9GA 3L09A 4BXUA 3VPRA 1OCRH 3OYGA 2XB5A 1BI1A 2ZSIB 1G3WA 4QLCU 1W7PA 2IEKA 1GVJA 3O3KA 1YW7A 3FMRA 3VFZA 1QVUA 3S32A 1K4SA 1MNMC 4F7ZA 5EGOB 1WZ2A 1ZN2A 2VUMJ 3AL0B 4WXHA 2A61A 1VQ9I 5FLVA 4EM2A 1SD4A 1S5LC 2Z3YA 4Z6YA 2V9PA 4A3IJ 1VF9A 3VYSB 4RLFA 4A3KJ 4IKFA 2Y31A 2XGDA 1BR4A 3L00A 3L2UA 4MHGA 1OCZH 3NEUA 4B43A 3RCOA 1DU6A 3WHBA 3KP3A 1T39A 1IRZA 4A6EA 3CCQI 3LQRA 3RDIA 4F91B 3LSTA 2B9SA 1TWFJ 1VQ5I 2M5WA 3MAJA 2DI3A 2VC0A 3I5UA 2VB6A 2XRNA 3R6SA 3TQNA 4A0XA 1XTAA 2CJJA 3OYHA 2BXZA 2L7MP 2Z2SB 4KIBA 2HI3A 3G3ZA 5JHFA 2HXIA 2P8TA 4XBFA 3H3UA 3W2VA 3BG3A 1TLHB 1FTZA 4ITVA 5ICCA 4I02A 2DA3A 1I39A 2L4MA 4F92B 4O6JA 3O2PE 3CC2I 3QOPA 2IPQX 4YIRX 3ZQ7A 5BNGA 3QAHA 5E8IA 5GP9A 4A0ZA 1S8NA 2NVQJ 4CCOA 3ZMDA 4G6QA 4G8XA 2ZMEA 3MVPA 1KYWA 4BXFA 2VKHA 2Y48A 3JSPA 2XIGA 4YIIA 4HF1A 3WTUC 3L2QA 2LC2A 2OBPA 4BU2A 4R1HA 4XRFA 3O8HA 2CUJA 2X1CA 1W4MA 1H0MA 1F4KA 1OYIA 2OPTA 2V79A 1J9IA 2KZGA 3HRTA 2IRFG 2O5RA 4RM3A 4IHSA 5EEGA 2WADA 1XGNA 1YJNI 1B72A 4NUBA 1ON1A 2VI6A 3K70D 1XSVA 1SEUA 4A3GJ 2R92J 2LLKA 5AIQA 3U1DA 4M6YA 3GTMJ 1WI3A 3CQZJ 4JYKA 2HU9A 3LSJA 3IUOA 1X1AA 4U0YA 4G12A 4M3EA 5F04A 5F0CA 2CH0A 2JSPA 3L9FA 3WTYC 1R5HA 3GXOA 3HIFA 5F0FA 1BBYA 3NARA 2IA0A 4CDGA 4BEHB 2HOEA 2X0LA 1T2KA 1VQ6I 5JVTA 5EEAA 2FBKA 1EV7A 3BOQA 1MMGA 2D45A 5H2FC 3DU5A 1Z3XA 1VQ4I 5AONA 1ZG1A 2Y2ZA 2ID3A 2DK8A 2NOGA 4RLQA 2RVCA 3CCLI 4C9YA 1VQKI 2O0YA 3C2HA 3VWBA 2LOOA 5M5XJ 2WA0A 2OCEA 4M74A 4M9SA 4UVCA 4FTHA 1N77A 2NNNA 3TP3A 2EWNA 3M9AA 5E1WA 1BIBA 2XHKA 2XAJA 1SFEA 2HOAA 3QRFF 4BBSJ 3BQYA 3OYDA 3TKYA 5DD4A 1L3LA 3HXLA 2B0LA 3I64A 5D8KB 4D0PA 5BPDA 5KNLA 4G7OF 2WB1A 4ABZA 3UNGC 3QP5A 3WU0A 1MMSA 5M5WJ 4N9IA 1EF4A 1TP4A 3S3NA 3ZXSA 2P6TA 2GA1A 2LY1A 1MSFC 1W1WE 4B3XA 1IN7A 3S2WA 1XB4A 4N4OB 1BOBA 4DZJA 1B1BA 4I0AA 1AKHB 2DMUA 5HS9A 2XF6A 2DA4A 4UVAA 2STWA 4XN3A 3KLOA 4Y52J 4M3GA 2DYRH 3BTLA 5J40A 5LRRA 1HKTA 1CF7A 2K3FA 2KLOA 1SVMA 5DD8A 1DDNA 3E5UA 2LY2A 3GWZA 1JT0A 2ZNYA 4BHBA 3LL7A 4IHYA 2QF7A 4NBQA 2KIMA 5IP7J 2D1VA 3FXLA 2V6EA 4YIFA 2LP0A 1PDNC 3FK6A 1Z67A 2AHQA 2ELHA 4L5EA 1OCPA 4HQEA 1JJ6C 1OR7A 3DPLC 3LA3A 3CCVI 2NRAC 2L4AA 4U0VA 1HC8A 2F4OB 1FIAA 1SC7A 3BZKA 4H4KC 3P7NA 4L9JA 5B1AH 1K7AA 4IPAA 2C6YA 2KIQA 2DN0A 3CJRB 4A5NA 4L9TA 4GYGA 1V5FA 4RMNA 1RUNA 4DYRA 4HF2A 1ONVA 1UHSA 3KPHA 5ILUA 1W0UA 4OAYA 3BP8A 2BW3A 1VQ7I 3F6VA 2GQQA 2HZDA 2DTZA 3RPQA 5C4JJ 4XL9A 4LMYA 3CMYA 2NS7A 2GIVA 1P2FA 1MDMB 2DU9A 1SVOA 4BNCA 2Z33A 5FB2A 4ZYDA 3HZJA 4R8HA 3OYKA 1I6XA 2HQ5A 2LK2A 3TDUC 2PJPA 3M8JA 1X1BA 1ZRFA 3ZRGA 3DQVC 2L02A 2DODA 1K83J 2DA7A 2L0KA 3KIOA 2COMA 4ENNA 1H9TA 1FOXA 4CICA 1IN8A 1P6RA 3C1DA 1X3ZB 2XPVA 4Y33A 1GV2A 4BUPA 2IS2A 1EH6A 1PP8F 1U2WA 4M3BA 2XV4S 2DQRA 1ZHFA 2FU4A 2R7VA 3J81K 2ZCWA 3WHCA 1S9HA 4G7HF 3LWFA 1ETKA 1Z7LA 4Y15A 5IP6A 3KEYA 5K5QA 1V5EA 3WU1B 2LRDA 3DTKA 3FDYA 3OYFA 1Z7UA 2D5VA 2ZJRF 1ETQA 4X1EA 4KDPA 1QZZA 5DM6F 4PSXA 4B09A 3HUGA 2XSDC 5LGUA 4EM1A 2R93J 1IZ1A 4A3FJ 1EA3A 4DBQA 2VKEA 2H6BA 3J7AY 2VL8A 1UHWA 2K86A 4HQMA 2X51A 4HPQA 3OV8A 3EUHA 2PI0A 3V8LA 2DOFA 4NB5A 3G4SI 2WY7Q 1JKPC 1P9QC 3DKYA 4KIGA 4BKXA 2CV1A 1A04A 1P4AA 5HS8A 2CU7A 2BVMA 2Q0OA 3VDXA 2XB0X 2M3AA 3KETA 3RPUD 2I5UA 5CQGA 2JQ7A 3HOXJ 2X6WA 4AUXA 4RM2A 3DKXA 3QWLA 2JUGA 2OZUA 3H5AA 1MBHA 2FA5A 3I0TA 2BEOA 3FM5A 3HPGA 1I3AA 2RC4A 3M4OJ 2IA1A 3C2GA 1S6LA 1STZA 2ELJA 1FP2A 4CHUA 1X58A 3CTAA 4FX4A 2BY2A 3EUKL 3CD6I 1T95A 1YJWI 2QYOA 3DEUA 4IVNA 3K1MA 3LSKA 4OOIA 3F72A 5IYCJ 3A01B 2M4GA 1K6OA 3VYTB 2DLLA 2E7XA 1QZYA 4XM3A 3Q0WA 3FBIB 2VT3A 4CCJA 3K2AA 5GAEJ 4A12A 1N25A 4ZTFA 4UUTA 3GZ5A 2DA1A 3HJEA 2FNPA 2IGKA 5L3BA 1JKQC 4A93J 2CW8A 1X4OA 3HTSB 3A0HC 1LJ9A 4NHJA 1FX7A 4BAYA 2KKOA 3GLLA 3CMMA 1U9OA 1G3SA 3I59B 1AOYA 4UB6C 1T38A 3AG4H 2M0MA 3MZ8A 1TT5B 1ETXA 4Y13A 1Z3YA 4AYBN 3MZHA 3BCBA 3FBNB 1VQOI 1R36A 3CMEI 2GM4A 4XOTA 1ZGJA 1RR7A 4G94A 1WFXA 5M3MJ 2ZB9A 1PUEE 3I4MJ 1YFHA 2AS5F 1G8XA 5CVRA 5JLXA 5E18F 4EQQA 1GXPA 1SD6A 5E79C 1KU2A 2BBYA 1WKMA 1GUUA 4I7HA 3ZGKA 1IDYA 5BPIA 1R58A 1C0WA 3OOPA 3LSPA 2QBYA 6PAXA 1WJ5A 5E20A 3FXUA 5GAHJ 3W6VA 2FD5A 4XORA 3HHGA 2E1MC 3CO6C 2MW8A 4MFDA 2FXAA 3CDHA 3OSGA 3S1MJ 5LEJA 5C44J 5JI6A 4XQFA 1AHDP 3E6MA 3N05A 4ZYHA 3R61A 1MJAA 4MEXF 3TO6A 1K79A 3FXMA 2L01A 3GF2A 2JUCA 1RKWA 4PJLA 3TOBA 5HLGA 5CVIA 2HGCA 1SFUA 1DQUA 3TL4X 1FYMA 2ZJPF 1YX5A 4S05A 2TDXA 2BE5F 3SXYA 2VONA 5LHGA 1R22A 2KL4A 2ZXJA 2YR2A 3MQ0A 3VYUB 3PIOF 4HX4A 4J19A 1V5GA 1XSXA 4UB8C 3OS1A 2GBYA 4Q48A 1U5TB 4TV7A 1HW1A 4HOBA 2CQ7A 2XAGA 4OIRF 2PFBA 5HLIA 4EMSA 2K4JA 1ZG5A 5ICGA 5J1RA 2X4HA 1YYVA 2JPCA 4AD9A 1PP7U 2BVLA 2P7VB 4XLHA 1RRJA 3QPSA 2O03A 1LVKA 2BY1A 3HL2A 1Y8RB 3ASOH 1IF1A 2DO7A 3FXJA 2E2HJ 3IH2A 3M1EA 3K1NA 2ZFWA 2K27A 3EUHC 1IXSB 2EILH 3B6AA 3HGYA 4YRVA 2M9HA 1D1AA 1QQIA 2VIXA 1SANA 2ZJQF 1FOYA 2DW4A 3AL0C 1D0ZA 2VKVA 1YS6A 5KHDA 3OMYA 4CSWA 4OMYA 3GMEA 4MGRA 3QYEA 4BE2A 2ID6A 1LDJA 5IYBJ 2RDPA 1ZYRF 1I5ZA 3BWGA 3W3CA 2CV2A 3HEFA 3K69A 1UG2A 4C3IJ 4P1WA 3ABKH 5DUIA 2R5ZA 2OQGA 5J6XA 1A6QA 4WF2A 2JWTA 4DYCA 4BYYA 4D1QA 3OS0A 1HDDC 2IA2A 3QPLA 2E36A 2X6XA 3DCFA 4U0WA 5GAGJ 5M3FJ 1F1ZA 2E34A 3LFKA 3ELKA 2EZLA 1D5VA 2AQEA 3SDBA 3BTJA 3K4KA 4ASNA 3WODF 1W0TA 1EH7A 2M87A 3OR1C 2MYSA 2VN2A 2O9LA 2VJJA 2R7TA 1Z6TA 3J7YJ 2IJLA 3I56I 5D5VB 4D5CA 4BY1J 4BH9A 2MD0A 1BA5A 5HOOA 1Q1VA 3CZ6A 1VQPI 2OV7A 5IY5H 4F93B 2Q2EB 2H6CA 3DV8A 3D5RC 3G6EI 1QNTA 1W5CC 1JTYA 3BY6A 2P5LC 3HRMA 5LBQA 3HDDA 1JE8A 2MG4A 1VTNC 3IAM2 1NH3A 1YITI 5HODA 2HYJA 4IRGA 3S16J 4M73A 2E1CA 1UMQA 2LBFA 3PM1A 4M72A 3F6OA 2MH2A 5CJ9A 5TRDA 5DEQA 1SD5A 4II2A 3H1CA 3WTZA 2HNHA 3FX3A 3EUAA 1YHQI 2R7FA 2HYGD 2Q1ZB 2A68F 1LKXA 4AIHA 1S7OA 3ZQLA 1BL0A 1KA8A 3SFIA 1Y1VJ 3HYIA 2F5VA 3FM3A 4KITB 1KU3A 3TO7A 2HVSA 2L7ZA 3IRQA 4DOZA 2P7CB 4FT8A 4ZZLA 3F9KA 2CQQA 3LFUA 1VI0A 4ANJA 1JT6A 3JSOA 2ZBKA 4IRIA 3CLOA 2PMHA 3U21A 4KMFA 4NC7A
chains in the Genus database with same CATH topology
3CDLA 1O4XA 4D5FA 1APLC 5J3LA 3IH4A 2Y2ZA 4CYCB 2FQ4A 2ID3A 2NOGA 2ECCA 2JA6J 4CYCA 1NTCA 5FKNA 3DEWA 5M5XJ 3FISA 4FTHA 3ZQIA 1U9NA 2NVTJ 3BT9A 2G0EA 3TP3A 1WH7A 2NVYJ 1H8AC 2HOAA 3JRFA 3BQYA 4BBSJ 1RETA 1H88C 1T56A 2DMNA 2NVXJ 1ETOA 1GVDA 4ABZA 2E2JJ 5EZHA 3PO2J 3MN2A 1IV6A 2DA5A 1JJ8C 5M5WJ 1TWCJ 1EF4A 5FLMJ 2X6OA 3BTIA 1MSFC 1IG7A 2EQRA 1QVTA 1TC3C 2B63J 3MKLA 4DZJA 1RESA 4JP0A 1AKHB 4Y7NJ 2DMUA 2DA4A 3H3VK 4Y52J 4M3GA 1AKHA 3BTLA 4DZPA 4RDUA 3JRCA 1FTTA 3HOUJ 2L9RA 2WV1A 3LSRA 4JX5A 3HM5A 5DS9A 4A3CJ 2E2IJ 4M3DA 1RKTA 1IC8A 5FKOA 1JT0A 2YUSA 4M6VA 1XC5A 4IHYA 3JRIA 3GTQJ 1F36A 1AU7A 1WH5A 2QF7A 3BTCA 5IP7J 3HOYJ 2LP0A 1JKOC 3FK6A 3K7AJ 1WCMJ 3GTJJ 2AHQA 3O8GA 3BQZA 3GTPJ 4L5EA 1OCPA 5FKMA 1JJ6C 5EYRA 2K9QA 1VFCA 2TRTA 3NAUA 3A01A 2JA7J 2DJNA 1FIAA 2FJ1A 2ELKA 2Y9YA 5E3MA 1FIPA 2K9NA 2HOTA 2GLOA 2DN0A 2E19A 3HBLA 5J1UA 1HDPA 2H8RA 3GTLJ 4QIWN 2HDDA 1SFOJ 1OFCX 2JK3A 4HNVA 1PUFB 4DYRA 3GTOJ 1ENHA 1ZR4A 2JA5J 5GPAA 1UHSA 1Z77A 1W0UA 1PUFA 1MBFA 2JMWA 3TP0A 5IOZA 1H89C 3FKIJ 3I4NJ 3JRGA 3HB9A 2XPUA 3GTKJ 2DTZA 4QSHA 2R7ZJ 5C4JJ 2K40A 3CMYA 2NS7A 1POGA 2NS8A 2N8GA 2XGEA 3JRAA 1BW6A 1ETVA 3H0GJ 1VNDA 5F1JA 2HQ5A 2LKXA 4MIMA 2HXOA 1OCTC 2LK2A 4A3EJ 3S1NJ 1K61A 1K83J 2EBIA 2IAIA 1X2MA 2DA7A 2L0KA 3Q3SA 5J1YA 2YU9J 1HOMA 1QPIA 3ZOBA 1GDTA 1P7JA 3C2BA 3S1QJ 2ME0A 2YS9A 2XPVA 3D1NI 2XGCA 1GV2A 1BW5A 2JJ7A 3HOZJ 4V2GA 1CQTA 4M3BA 1F43A 1Z0XA 4MLOA 5FKLA 4B4CA 1MH3A 1IUFA 4MO7A 2E1OA 1YRNB 4IHVA 2DA6A 2R5YA 3HGGA 3WHCA 3RQIA 1YRNA 1ETKA 5IP6A 4XICA 2QCOA 3JRHA 2EZIA 1NK2P 2D5VA 1JUSA 1ETQA 4X1EA 2CRGA 4C3JJ 2JN6A 1ETYA 5IPAA 2XSDC 2R93J 3BR1A 4JX4A 2XPWA 4XRSA 4A3FJ 3S1RJ 2L7FP 2LVSA 2VKEA 3Q0VA 1E3OC 2DMPA 5E3NA 2MSYA 3BR0A 2O7OA 4A3JJ 1R9TJ 4C3HJ 3ZQGA 1JKPC 5K7HA 3TW6A 4IHXA 3CCYA 4BKXA 2AO9A 3BG5A 4DYQA 2CU7A 1MH4A 4A3LJ 3IH3A 4W1UA 4D7MA 2XB0X 4FE4A 3HKZN 1OJLA 3HOXJ 3S15J 4AUXA 2DMTA 4I76A 2XRLA 5K7ZA 1MBHA 4XRSG 3TW7A 3FK7A 2VPRA 3M4OJ 2MGQA 3Q0UA 2DMQA 1LE8B 2H1KA 3HOVJ 4IEJA 1X58A 4A3BJ 4A3MJ 1LE8A 1FJLA 2RAEA 5IYCJ 3QQAA 3A01B 1IJWC 1P7IA 4JX6A 2X48A 3BG9A 4XK4A 3Q0WA 4XIDA 1GV5A 1T33A 3K2AA 2M2EA 5DTDA 4UUTA 2DA1A 3S17J 4X6AJ 4I6ZA 1JKRC 4AC0A 1JKQC 1QRYA 2Y0SN 4A93J 1ITYA 1D5YA 1HCRA 3JRDA 1LFUP 1ZTRA 3OOUA 3SDGA 3ZQHA 3JREA 1U9OA 4B1RA 4B3AA 1JUPA 2LD5A 3E7LA 1I3QJ 5E3OA 4BBRJ 1ETXA 3BR6A 4V2FA 3BR2A 4AYBN 4LOCA 1MBJA 3TEDA 1XG1A 2WAQN 2Y30A 3PO3J 1TWGJ 1WPKA 2GM4A 4UUSA 1DU0A 5EZGA 1RR7A 5IOYA 5M3MJ 2ZB9A 4FCYA 3I4MJ 1A6IA 5JLXA 3G1LA 2IBDA 3ZQCA 1BJZA 4A3DJ 5C3EJ 5FJ8J 1GUUA 2K9SA 2FX0A 1IDYA 2HOSA 1ORKA 3BR3A 3LSPA 3F0CA 4EEFG 3W6VA 2FD5A 2ME6A 4C2MJ 5IP9J 4IHWA 2MW8A 4RBOA 4GFBA 3SJMA 1I50J 4MFDA 5E3LA 4W97A 1IGNA 1TWAJ 3OSGA 3S1MJ 5C44J 1GT0C 1ZQ3P 1AHDP 2R0QC 2LR8A 2Y9ZA 5FKKA 3S14J 2R5YB 4A69C 1MSEC 1ETWA 2LY9A 5F08A 1B8IB 3S2DJ 1G2HA 4DW6A 1RKWA 1B8IA 3IV5A 1JTXA 1LFBA 3OSFA 2ECBA 4BY7J 1IDZA 3HOWJ 5EG0B 5JLWA 4D7NA 2DA2A 3OIOA 5EG0A 1ZKGA 2EZHA 9ANTA 1MBEA 4FISA 4J19A 4S0HB 3L1PA 3VPRA 2GBYA 1ZR2A 2XB5A 2IEKA 2X9DA 3LSGA 1QVUA 1MNMC 5C4XJ 2KT0A 4M3FA 5J1RA 4XRMA 5EGOB 2VUMJ 2PMZN 4QTRA 5EGOA 5FLVA 3QPSA 4A3IJ 1VF9A 5GPCA 2KDZA 2E2HJ 3IH2A 2I10A 4A3KJ 2Y31A 1ZK8A 2XGDA 3UKGA 3RKQA 1HLVA 1RPWA 3B6AA 3HGYA 2M9HA 2O8KA 3GBGA 4BXXJ 1MBKA 1SANA 1DU6A 3WHBA 1FEXA 1IRZA 2OF7A 2VKVA 1TWFJ 3RZDJ 2ID6A 1I6HJ 5IYBJ 3HEFA 1UG2A 4C3IJ 5EDNA 2R5ZB 3RZOJ 2CJJA 2R5ZA 2L7MP 2HI3A 2JWTA 4DYCA 2HXIA 1HDDC 4NDLA 2COBA 2M0CA 3BG3A 3BR5A 2CUEA 3QPLA 3DCFA 1FTZA 5M3FJ 2DA3A 2EZLA 1NK3P 4MFEA 3BTJA 3JR9A 5IYDJ 1W0TA 3A02A 3ZQFA 5BNGA 2M8GX 1TWHJ 1MBGA 5GP9A 1U8BA 2O9LA 3G1MA 2NVQJ 2W48A 1XS9A 4D5CA 5F27A 4BY1J 2P81A 1A5JA 3MVPA 1BA5A 3B6CA 1Q1VA 1S7EA 3LNQA 3FIWA 3O8HA 1HF0A 2WB1N 4UUSB 1JTYA 2OPTA 3S2HJ 5M5YJ 3HDDA 2EZKA 2MG4A 4FE7A 1U78A 1B72B 5HODA 2HYJA 3S16J 3GTGJ 1B72A 2LTPA 2VI6A 1UMQA 3PM1A 3G1OA 3A03A 3M3YJ 4A3GJ 2R92J 2LLKA 1WGXA 3GTMJ 5K7FA 1WI3A 3CQZJ 2TCTA 4JYKA 3LSJA 2CUFA 4G12A 4M3EA 5F04A 5F0CA 1Y1WJ 2M34A 5F0HA 1ZGWA 3ZQLA 1BL0A 2LFBA 5F0FA 3SFIA 1Y1VJ 2JA8J 2EH3A 3NARA 1JUMA 2L7ZA 1JGGA 5EEAA 1X2NA 2CQQA 1VI0A 3LOCA 1JT6A 5EF6A 3JRBA 2CQXA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3CDL A;  1O4X A;  4D5F A;  1APL C;  5J3L A;  3IH4 A;  2Y2Z A;  4CYC B;  2FQ4 A;  2ID3 A;  2NOG A;  2ECC A;  2JA6 J;  4CYC A;  1NTC A;  5FKN A;  3DEW A;  5M5X J;  3FIS A;  4FTH A;  3ZQI A;  1U9N A;  2NVT J;  3BT9 A;  2G0E A;  3TP3 A;  1WH7 A;  2NVY J;  1H8A C;  2HOA A;  3JRF A;  3BQY A;  4BBS J;  1RET A;  1H88 C;  1T56 A;  2DMN A;  2NVX J;  1ETO A;  1GVD A;  4ABZ A;  2E2J J;  5EZH A;  3PO2 J;  3MN2 A;  1IV6 A;  2DA5 A;  1JJ8 C;  5M5W J;  1TWC J;  1EF4 A;  5FLM J;  2X6O A;  3BTI A;  1MSF C;  1IG7 A;  2EQR A;  1QVT A;  1TC3 C;  2B63 J;  3MKL A;  4DZJ A;  1RES A;  4JP0 A;  1AKH B;  4Y7N J;  2DMU A;  2DA4 A;  3H3V K;  4Y52 J;  4M3G A;  1AKH A;  3BTL A;  4DZP A;  4RDU A;  3JRC A;  1FTT A;  3HOU J;  2L9R A;  2WV1 A;  3LSR A;  4JX5 A;  3HM5 A;  5DS9 A;  4A3C J;  2E2I J;  4M3D A;  1RKT A;  1IC8 A;  5FKO A;  1JT0 A;  2YUS A;  4M6V A;  1XC5 A;  4IHY A;  3JRI A;  3GTQ J;  1F36 A;  1AU7 A;  1WH5 A;  2QF7 A;  3BTC A;  5IP7 J;  3HOY J;  2LP0 A;  1JKO C;  3FK6 A;  3K7A J;  1WCM J;  3GTJ J;  2AHQ A;  3O8G A;  3BQZ A;  3GTP J;  4L5E A;  1OCP A;  5FKM A;  1JJ6 C;  5EYR A;  2K9Q A;  1VFC A;  2TRT A;  3NAU A;  3A01 A;  2JA7 J;  2DJN A;  1FIA A;  2FJ1 A;  2ELK A;  2Y9Y A;  5E3M A;  1FIP A;  2K9N A;  2HOT A;  2GLO A;  2DN0 A;  2E19 A;  3HBL A;  5J1U A;  1HDP A;  2H8R A;  3GTL J;  4QIW N;  2HDD A;  1SFO J;  1OFC X;  2JK3 A;  4HNV A;  1PUF B;  4DYR A;  3GTO J;  1ENH A;  1ZR4 A;  2JA5 J;  5GPA A;  1UHS A;  1Z77 A;  1W0U A;  1PUF A;  1MBF A;  2JMW A;  3TP0 A;  5IOZ A;  1H89 C;  3FKI J;  3I4N J;  3JRG A;  3HB9 A;  2XPU A;  3GTK J;  2DTZ A;  4QSH A;  2R7Z J;  5C4J J;  2K40 A;  3CMY A;  2NS7 A;  1POG A;  2NS8 A;  2N8G A;  2XGE A;  3JRA A;  1BW6 A;  1ETV A;  3H0G J;  1VND A;  5F1J A;  2HQ5 A;  2LKX A;  4MIM A;  2HXO A;  1OCT C;  2LK2 A;  4A3E J;  3S1N J;  1K61 A;  1K83 J;  2EBI A;  2IAI A;  1X2M A;  2DA7 A;  2L0K A;  3Q3S A;  5J1Y A;  2YU9 J;  1HOM A;  1QPI A;  3ZOB A;  1GDT A;  1P7J A;  3C2B A;  3S1Q J;  2ME0 A;  2YS9 A;  2XPV A;  3D1N I;  2XGC A;  1GV2 A;  1BW5 A;  2JJ7 A;  3HOZ J;  4V2G A;  1CQT A;  4M3B A;  1F43 A;  1Z0X A;  4MLO A;  5FKL A;  4B4C A;  1MH3 A;  1IUF A;  4MO7 A;  2E1O A;  1YRN B;  4IHV A;  2DA6 A;  2R5Y A;  3HGG A;  3WHC A;  3RQI A;  1YRN A;  1ETK A;  5IP6 A;  4XIC A;  2QCO A;  3JRH A;  2EZI A;  1NK2 P;  2D5V A;  1JUS A;  1ETQ A;  4X1E A;  2CRG A;  4C3J J;  2JN6 A;  1ETY A;  5IPA A;  2XSD C;  2R93 J;  3BR1 A;  4JX4 A;  2XPW A;  4XRS A;  4A3F J;  3S1R J;  2L7F P;  2LVS A;  2VKE A;  3Q0V A;  1E3O C;  2DMP A;  5E3N A;  2MSY A;  3BR0 A;  2O7O A;  4A3J J;  1R9T J;  4C3H J;  3ZQG A;  1JKP C;  5K7H A;  3TW6 A;  4IHX A;  3CCY A;  4BKX A;  2AO9 A;  3BG5 A;  4DYQ A;  2CU7 A;  1MH4 A;  4A3L J;  3IH3 A;  4W1U A;  4D7M A;  2XB0 X;  4FE4 A;  3HKZ N;  1OJL A;  3HOX J;  3S15 J;  4AUX A;  2DMT A;  4I76 A;  2XRL A;  5K7Z A;  1MBH A;  4XRS G;  3TW7 A;  3FK7 A;  2VPR A;  3M4O J;  2MGQ A;  3Q0U A;  2DMQ A;  1LE8 B;  2H1K A;  3HOV J;  4IEJ A;  1X58 A;  4A3B J;  4A3M J;  1LE8 A;  1FJL A;  2RAE A;  5IYC J;  3QQA A;  3A01 B;  1IJW C;  1P7I A;  4JX6 A;  2X48 A;  3BG9 A;  4XK4 A;  3Q0W A;  4XID A;  1GV5 A;  1T33 A;  3K2A A;  2M2E A;  5DTD A;  4UUT A;  2DA1 A;  3S17 J;  4X6A J;  4I6Z A;  1JKR C;  4AC0 A;  1JKQ C;  1QRY A;  2Y0S N;  4A93 J;  1ITY A;  1D5Y A;  1HCR A;  3JRD A;  1LFU P;  1ZTR A;  3OOU A;  3SDG A;  3ZQH A;  3JRE A;  1U9O A;  4B1R A;  4B3A A;  1JUP A;  2LD5 A;  3E7L A;  1I3Q J;  5E3O A;  4BBR J;  1ETX A;  3BR6 A;  4V2F A;  3BR2 A;  4AYB N;  4LOC A;  1MBJ A;  3TED A;  1XG1 A;  2WAQ N;  2Y30 A;  3PO3 J;  1TWG J;  1WPK A;  2GM4 A;  4UUS A;  1DU0 A;  5EZG A;  1RR7 A;  5IOY A;  5M3M J;  2ZB9 A;  4FCY A;  3I4M J;  1A6I A;  5JLX A;  3G1L A;  2IBD A;  3ZQC A;  1BJZ A;  4A3D J;  5C3E J;  5FJ8 J;  1GUU A;  2K9S A;  2FX0 A;  1IDY A;  2HOS A;  1ORK A;  3BR3 A;  3LSP A;  3F0C A;  4EEF G;  3W6V A;  2FD5 A;  2ME6 A;  4C2M J;  5IP9 J;  4IHW A;  2MW8 A;  4RBO A;  4GFB A;  3SJM A;  1I50 J;  4MFD A;  5E3L A;  4W97 A;  1IGN A;  1TWA J;  3OSG A;  3S1M J;  5C44 J;  1GT0 C;  1ZQ3 P;  1AHD P;  2R0Q C;  2LR8 A;  2Y9Z A;  5FKK A;  3S14 J;  2R5Y B;  4A69 C;  1MSE C;  1ETW A;  2LY9 A;  5F08 A;  1B8I B;  3S2D J;  1G2H A;  4DW6 A;  1RKW A;  1B8I A;  3IV5 A;  1JTX A;  1LFB A;  3OSF A;  2ECB A;  4BY7 J;  1IDZ A;  3HOW J;  5EG0 B;  5JLW A;  4D7N A;  2DA2 A;  3OIO A;  5EG0 A;  1ZKG A;  2EZH A;  9ANT A;  1MBE A;  4FIS A;  4J19 A;  4S0H B;  3L1P A;  3VPR A;  2GBY A;  1ZR2 A;  2XB5 A;  2IEK A;  2X9D A;  3LSG A;  1QVU A;  1MNM C;  5C4X J;  2KT0 A;  4M3F A;  5J1R A;  4XRM A;  5EGO B;  2VUM J;  2PMZ N;  4QTR A;  5EGO A;  5FLV A;  3QPS A;  4A3I J;  1VF9 A;  5GPC A;  2KDZ A;  2E2H J;  3IH2 A;  2I10 A;  4A3K J;  2Y31 A;  1ZK8 A;  2XGD A;  3UKG A;  3RKQ A;  1HLV A;  1RPW A;  3B6A A;  3HGY A;  2M9H A;  2O8K A;  3GBG A;  4BXX J;  1MBK A;  1SAN A;  1DU6 A;  3WHB A;  1FEX A;  1IRZ A;  2OF7 A;  2VKV A;  1TWF J;  3RZD J;  2ID6 A;  1I6H J;  5IYB J;  3HEF A;  1UG2 A;  4C3I J;  5EDN A;  2R5Z B;  3RZO J;  2CJJ A;  2R5Z A;  2L7M P;  2HI3 A;  2JWT A;  4DYC A;  2HXI A;  1HDD C;  4NDL A;  2COB A;  2M0C A;  3BG3 A;  3BR5 A;  2CUE A;  3QPL A;  3DCF A;  1FTZ A;  5M3F J;  2DA3 A;  2EZL A;  1NK3 P;  4MFE A;  3BTJ A;  3JR9 A;  5IYD J;  1W0T A;  3A02 A;  3ZQF A;  5BNG A;  2M8G X;  1TWH J;  1MBG A;  5GP9 A;  1U8B A;  2O9L A;  3G1M A;  2NVQ J;  2W48 A;  1XS9 A;  4D5C A;  5F27 A;  4BY1 J;  2P81 A;  1A5J A;  3MVP A;  1BA5 A;  3B6C A;  1Q1V A;  1S7E A;  3LNQ A;  3FIW A;  3O8H A;  1HF0 A;  2WB1 N;  4UUS B;  1JTY A;  2OPT A;  3S2H J;  5M5Y J;  3HDD A;  2EZK A;  2MG4 A;  4FE7 A;  1U78 A;  1B72 B;  5HOD A;  2HYJ A;  3S16 J;  3GTG J;  1B72 A;  2LTP A;  2VI6 A;  1UMQ A;  3PM1 A;  3G1O A;  3A03 A;  3M3Y J;  4A3G J;  2R92 J;  2LLK A;  1WGX A;  3GTM J;  5K7F A;  1WI3 A;  3CQZ J;  2TCT A;  4JYK A;  3LSJ A;  2CUF A;  4G12 A;  4M3E A;  5F04 A;  5F0C A;  1Y1W J;  2M34 A;  5F0H A;  1ZGW A;  3ZQL A;  1BL0 A;  2LFB A;  5F0F A;  3SFI A;  1Y1V J;  2JA8 J;  2EH3 A;  3NAR A;  1JUM A;  2L7Z A;  1JGG A;  5EEA A;  1X2N A;  2CQQ A;  1VI0 A;  3LOC A;  1JT6 A;  5EF6 A;  3JRB A;  2CQX A; 
#chains in the Genus database with same CATH topology
 1OCC H;  4U87 A;  3F8M A;  3R60 A;  3SHF A;  3TOA A;  4D5F A;  1APL C;  2LF8 A;  1WJA A;  1XDS A;  4CYC B;  2FQ4 A;  2XC7 A;  2ECC A;  2JVG A;  4S04 A;  2WTE A;  3KYC B;  1X1D A;  1NTC A;  2P6S A;  3CP8 A;  1RZ4 A;  1XDU A;  3E97 A;  2F4I A;  4HSR A;  5CQE A;  1WJC A;  2D1H A;  1YG2 A;  3ZQI A;  3BT9 A;  4HEA 2;  2F6C A;  3KZY A;  3MZY A;  3EQL F;  3UR3 C;  1OKR A;  2EJR A;  5LRS A;  3E6C C;  2OJE D;  1U0J A;  4RA2 A;  2NVY J;  1WQ2 A;  1H8A C;  1ZRC A;  2HVQ A;  3IRR A;  3JRF A;  3MKY B;  1RET A;  1IN4 A;  4ZH4 F;  5FGM A;  3DLA A;  4ZZD A;  3MWM A;  1LUJ B;  1T56 A;  2NVX J;  2DQL A;  2X85 A;  1GVD A;  3HOS A;  5EZH A;  4YEJ A;  3V7S A;  3WTW C;  3I4P A;  2R7R A;  3MN2 A;  3FXK A;  1ZG3 A;  3L2C A;  5KVR A;  1FMV A;  2ESN A;  2GA2 A;  2VKD A;  3CCS I;  3BTI A;  1IG7 A;  3HC7 A;  1WRJ A;  2RNJ A;  3L7W A;  1FNN A;  2JVH A;  3KYL A;  1XSD A;  2NYX A;  1MMA A;  2A5Y B;  1WJE A;  4ENJ A;  4Q4Z F;  4Y7N J;  1OCO H;  2L3D A;  4NQW A;  3E1S A;  1UCR A;  4Y17 A;  3RTR A;  4EJU A;  3JRC A;  1FTT A;  4EM0 B;  1XD7 A;  1D8K A;  2V9V A;  2WV1 A;  4EJW A;  2HDC A;  1FT9 A;  2VAS A;  3CCR I;  3BDD A;  4HW0 A;  4JX5 A;  3QYB A;  5FKO A;  4M6V A;  1ZEL A;  3GTQ J;  4PFP A;  1F36 A;  4N0B A;  1AU7 A;  1WH5 A;  3BTC A;  2RQQ A;  1P4X A;  5TJJ A;  1JKO C;  1OQY A;  2RRE A;  5DCM A;  1DPR A;  2DDA A;  3JW4 A;  4O5V A;  3BG6 A;  4BQN A;  4AID A;  4DBR A;  1IRX A;  4ESF A;  1IV8 A;  4EJV A;  4B47 A;  4WCG A;  4PJM A;  3NAU A;  3A01 A;  3F22 A;  5KCM A;  2R7S A;  1OYW A;  2ELK A;  3PNV A;  3SFZ A;  1OMI A;  1TL8 A;  3ZN1 A;  2I8D A;  2LKS A;  2E19 A;  2DTR A;  3HBL A;  2VOD A;  3GFI A;  2J5P A;  3DP7 A;  3FXQ A;  4OU0 A;  2PN6 A;  1SFO J;  1LEB A;  4L9N A;  2OC6 A;  3TGN A;  3OYE A;  2GXG A;  2LKP A;  3M1C A;  1ENH A;  5FD5 A;  5B3S H;  3GTO J;  2JA5 J;  1RC9 A;  4XMY A;  3SZT A;  1PUF A;  1MBF A;  1KQ0 A;  2JMW A;  4WK8 F;  4FET A;  5IOZ A;  1ODD A;  3FKI J;  3I59 A;  1K78 A;  3K1P A;  2OTL I;  4GCV A;  2VQH A;  4QSH A;  2QA4 I;  2P0W A;  2K40 A;  4RGX A;  3K2Z A;  4R79 A;  2NS8 A;  4O3M A;  2CQN A;  2DPD A;  2IT0 A;  1XGS A;  2VPL A;  1J0R A;  2KRH A;  4LK1 F;  2EA4 A;  3CJQ B;  2FF4 A;  3WE2 A;  2R7X A;  1REP C;  2O6G E;  2FSW A;  4LFU A;  4UVB A;  2WY8 Q;  1EH8 A;  3I3L A;  4G6D A;  1E3P A;  2V1U A;  2LKX A;  2HXO A;  3CLQ A;  3K10 A;  3H35 A;  1F5T A;  4ZDP A;  2VQG A;  4KIS A;  3CUQ A;  2BGC A;  1K61 A;  2EBI A;  3Q3S A;  1HOM A;  2UZK A;  1O3R A;  4XLN F;  3ZOB A;  1P7J A;  1QPM A;  5HDG A;  2BYV E;  2Z16 A;  4FX0 A;  5J8C A;  3HOZ J;  1WJB A;  1XCB A;  2IW5 A;  4L0Z B;  2V7F A;  2V1N A;  2KFD A;  3J7Z I;  2EA2 A;  2FNA A;  4Q47 A;  1MH3 A;  2DT5 A;  4MO7 A;  1YRN B;  2E71 A;  4IHV A;  3TO9 A;  2DA6 A;  3DXJ F;  2V1D A;  4A6D A;  2HDW A;  4ZTJ A;  4RAY A;  1ZH5 A;  1TBX A;  3OYJ A;  3DBR B;  4IL6 C;  3VYR B;  5FRN A;  2KPM A;  2QCO A;  3S8P A;  1NG6 A;  1PYV A;  2EZI A;  1NK2 P;  4EGY A;  3V8K A;  4AU7 A;  2JN6 A;  5D6F A;  2HTJ A;  1HW5 A;  4BJT A;  2M45 A;  1R1V A;  2XPW A;  4JX4 A;  3S1R J;  3PQJ A;  4PDK A;  2W57 A;  2DMP A;  3U1K A;  4ZYE A;  2MSY A;  3BR0 A;  4A3J J;  2UXX A;  1R6R A;  1R9T J;  1U5T A;  2Z5U A;  2JPB A;  4IQ4 A;  3L2R A;  1X3W B;  5K7H A;  1XPX A;  1YW8 A;  4XR6 A;  4IO9 F;  4CZC A;  1FSE A;  2KIS A;  3LSI A;  3M8E A;  3G2B A;  2EIK H;  2YX4 A;  4FE4 A;  1V3F A;  1OJL A;  1BOA A;  4CO8 A;  3E0J B;  3FMS A;  3OYN A;  2M7A A;  3S15 J;  3E5X A;  3OL3 A;  2XRL A;  4MTD A;  2EIN H;  2Y75 A;  1FBS A;  1YE9 A;  1TNT A;  4N9H A;  4L9V A;  3PNY A;  3TW7 A;  4HNU A;  4H0E A;  4YFX F;  3H0D A;  4CCL A;  4N4N B;  2HPM A;  1R23 A;  1TZL A;  2LF7 A;  4XLF A;  1DPU A;  1E17 A;  3B73 A;  1LE8 A;  3PSI A;  4XSX F;  4XNF A;  2F5F A;  1MZB A;  3DPT A;  3GFM A;  1UAA A;  2IVM A;  3WU2 C;  1JI8 A;  1LEA A;  1IJW C;  1P7I A;  2VE9 A;  3BG9 A;  3PL8 A;  3WTT C;  3DWL E;  4XK4 A;  1GV5 A;  1T33 A;  4I09 A;  5DTD A;  3KE2 A;  2QM3 A;  3DU6 A;  4IXA A;  3RJP A;  3S17 J;  1B9N A;  1Y39 A;  1HKS A;  4I6Z A;  2A6H F;  3WGI A;  1QRY A;  2OTJ I;  5A2Q K;  2BOL A;  3JRD A;  1KQ8 A;  3GZN B;  4ZJZ A;  4PGG A;  3V8J A;  3CCE I;  1W7P D;  3PSF A;  4PJ0 C;  1IW7 F;  2VXZ A;  2K7L A;  1TTY A;  2LD5 A;  3IL2 A;  1BI3 A;  2DFI A;  1BI0 A;  4JQF A;  4A0Y A;  2VOP A;  4BBR J;  3BR6 A;  3TED A;  1WJF A;  2WAF A;  4LIU A;  3PO3 J;  5KAI C;  1TWG J;  4FQG A;  2GAU A;  3F23 A;  4HRI A;  1G6N A;  1DU0 A;  2WV0 A;  2NS0 A;  3KX2 A;  2R7U A;  3D5S C;  1XGO A;  3H5R A;  2X1D A;  2QSH X;  2IBD A;  1OYY A;  3AFH A;  4OWR B;  5C3E J;  5HLH A;  2K9S A;  4WWC A;  1KQ9 A;  1R4M B;  4EEF G;  2YU3 A;  1Z21 A;  2IGM A;  4IJA A;  3HKZ A;  4RAG A;  2H09 A;  1I50 J;  5E3L A;  4PFO A;  4AVZ A;  1TWA J;  4YFK F;  3GFJ A;  2VQC A;  2F5D A;  2WC2 A;  3CC7 I;  2LR8 A;  3S14 J;  3CUQ C;  3DLL F;  4DNC A;  4BAC A;  3DFG A;  1ETW A;  3CCU I;  5F08 A;  2Z99 A;  1B8I B;  4E4H A;  4I2O A;  3U9G A;  2HZT A;  3ZR8 X;  1JTX A;  5K1Y A;  3IV5 A;  2PJR B;  5E17 F;  4U7B A;  4E7K A;  1GLN A;  3PQK A;  5JLW A;  3W2W A;  4D7N A;  2DA2 A;  4MNU A;  3OIO A;  1JXS A;  2IGO A;  5EG0 A;  3ISP A;  3EYY A;  4BL0 B;  1YJ9 I;  3BG7 A;  1MBE A;  1N75 A;  1W7P B;  2LNB A;  4S0H B;  5DYM A;  1ZR2 A;  2LRE A;  4HNT A;  3F21 A;  2JRM A;  2P5K A;  5C4X J;  2ZXW H;  4M3F A;  3K4J A;  5IT9 K;  3T8T A;  2CYY A;  4QTR A;  1Y8Q B;  5EGO A;  3CES A;  2PQ8 A;  4RAZ A;  2BY0 A;  3IHU A;  5CVJ A;  5D4S A;  3V4G A;  2R7D A;  4HST A;  2FOK A;  5J4Y A;  3AAF A;  2I10 A;  2VT2 A;  5FRO A;  1FLI A;  1ZK8 A;  3UKG A;  4UXN A;  1HLV A;  1U5T C;  2DXI A;  2Y69 H;  1BI2 A;  2O8K A;  3GBG A;  1FC3 A;  4BXX J;  1EKE A;  2KJB A;  1UHM A;  2OF7 A;  2RN7 A;  3CP2 A;  1KYZ A;  1T6S A;  3R4K A;  3WTS C;  4LIV A;  4BE0 A;  3IAS 2;  1O3Q A;  2CMP A;  3RZD J;  3L2W A;  1I6H J;  3P9C A;  2EFP A;  3ZN0 A;  2EFO A;  5EDN A;  2OU2 A;  1FBU A;  3Q9S A;  2XAQ A;  2CWE A;  2KQR A;  4NC8 A;  4A5M A;  5JVG F;  3TDZ C;  4G7Z F;  3QU6 A;  1D0Y A;  3BR5 A;  4KUM A;  2RV8 A;  3V42 A;  4PJN A;  2XF7 A;  5A2Q Z;  1S29 A;  4RB0 A;  4MFE A;  4XOP A;  1A35 A;  2NNY A;  5IYD J;  1LB2 A;  3B02 A;  3ZQF A;  3K4N A;  1Z05 A;  1TWH J;  1MBG A;  1U8B A;  3G1M A;  4LG3 A;  1DGW Y;  1YOV B;  2ZME B;  3ROU A;  1IN6 A;  4BQO A;  2JT1 A;  5DDG A;  1J75 A;  1XS9 A;  5F27 A;  2CV0 A;  2HQN A;  1MMD A;  2P81 A;  1A5J A;  2R7W A;  1WWX A;  4RB1 A;  1YQA A;  4UHT A;  5CLS A;  2DPU A;  1HF0 A;  5D6E A;  2WB1 N;  1IRG A;  1YLF A;  4HYE A;  2NVU B;  3CF5 F;  1XMK A;  2YSR A;  2HEO A;  4IOC F;  5M5Y J;  1F9N A;  2VBZ A;  4FE7 A;  1U78 A;  2BXY A;  5LD2 C;  3LA2 A;  1B72 B;  3OIQ A;  3MMY B;  2EFQ A;  1Y6I A;  2HQR A;  1B4A A;  1R4N B;  3I71 A;  2V6C A;  4E6K G;  3A03 A;  1J2X A;  4IQJ A;  2A07 F;  3WG7 H;  2CS3 A;  2PBI A;  5K7F A;  3N4M A;  4P5O A;  3AG1 H;  3NRV A;  2TCT A;  5CVV A;  4IOA F;  1LNW A;  2CUF A;  2PMU A;  2XDV A;  1J7K A;  3S3O A;  2EIM H;  3PNT A;  1Y1W J;  2XAS A;  5D8L B;  4HA8 A;  1ZGW A;  1KU9 A;  2BHZ A;  3BPX A;  1DUX C;  2JA8 J;  1I27 A;  2EH3 A;  2W7N A;  2F5C A;  4XON A;  2EV6 A;  3AG3 H;  2VXD A;  2DT7 B;  3KEO A;  2OAZ A;  4BEH A;  1JGG A;  4CCN A;  1X2N A;  3ZMV A;  1O7L A;  5EF6 A;  3CJT B;  3J7A O;  4PGH A;  3JRB A;  2CQX A;  2K5C A;  4ESJ A;  3L2V A;  3CDL A;  3ZMS A;  3WE3 A;  1BM9 A;  2KIU A;  3IH4 A;  2A3S A;  1SAX A;  2AXL A;  3CC4 I;  2XKP A;  2K9L A;  2JA6 J;  3QPT A;  4JOM A;  4QWQ A;  2FOW A;  3KZI C;  3DEW A;  5D5W B;  4LGW A;  4B44 A;  2F48 A;  4HLX A;  3RI4 A;  2DCE A;  4I98 B;  2XGX A;  2NVT J;  1NG7 A;  5LHI A;  1S3J A;  5IT9 Z;  1NHA A;  2W24 A;  2CSO A;  1RIO H;  1WH7 A;  1HST A;  3LAJ A;  2AQF A;  4DJA A;  1WSU A;  3KP7 A;  3FZV A;  4P9U A;  4XSZ F;  2ZO4 A;  1I1G A;  2DMN A;  3CCJ I;  2HTS A;  2H94 A;  5JFR A;  1ETO A;  1YO5 C;  4RGS A;  3C7J A;  4RB2 C;  1O57 A;  2QGU A;  4E7Z A;  3PO2 J;  4CCM A;  2YX7 A;  2O61 A;  2FML A;  1IV6 A;  4PCQ A;  2E60 A;  2XSJ C;  1L0O C;  3ECO A;  2CO5 A;  1ZLJ A;  5FLM J;  4MTE A;  2EQR A;  2KJC A;  4IF4 A;  3R0A A;  2HWV A;  1QVT A;  1QBJ A;  3C3W A;  2DK5 A;  1IO2 A;  2B63 J;  3CJN A;  1RES A;  2ZSH B;  4HX7 A;  3OYA A;  2J5O A;  3ZMU A;  3H9J A;  3N97 A;  3H3V K;  1CF7 B;  2M7B A;  1AKH A;  4DZP A;  2IGN A;  3HSE A;  4RDU A;  1R7J A;  2QEX I;  4WXC A;  3HOU J;  1U3E M;  2VLA A;  1R49 A;  2CG4 A;  3IWF A;  3LSR A;  3V7R A;  1YTY A;  2OZ6 A;  5ILS A;  1LPQ A;  1M1E B;  1FMW A;  1UST A;  4KT6 A;  4M3D A;  4B8X A;  5GTI C;  5ED4 A;  4DIQ A;  4UNO A;  3MKW B;  1R00 A;  1XC5 A;  5CKT A;  3JRI A;  2Z9O A;  3HRU A;  3HOY J;  3E5Q A;  3SZP A;  3A0B C;  3K7A J;  2JRT A;  4K2E A;  3O6B B;  1X4P A;  2QLZ A;  1W5S A;  4U88 A;  2WBM A;  4BDZ A;  3BQZ A;  2W82 A;  1G3Y A;  2CW0 F;  3FKJ A;  5FKM A;  4KYW A;  2K9Q A;  1VFC A;  1K4T A;  2TRT A;  1FOW A;  1MIJ A;  2GXA A;  2K9M A;  3FHZ A;  2FJ1 A;  4JBA A;  3HPH A;  2Y9Y A;  5E3M A;  1FIP A;  2K9N A;  4J00 A;  1SMT A;  5FLX Z;  5J1U A;  2R7Q A;  3K0L A;  1HDP A;  3KEQ A;  5GTH C;  1QA6 A;  3GCM A;  3GTL J;  3K6G A;  2HDD A;  1OFC X;  2F2E A;  2JK3 A;  3LQQ A;  3DTI A;  4HNV A;  4Y3O A;  2RNG A;  3RIR A;  1QO0 D;  3OWT A;  2FEZ A;  2DYS H;  5L3C A;  5HNF A;  1Z77 A;  2BHY A;  2BW3 B;  1ZR4 A;  2PMZ A;  2FE3 A;  4RAF A;  1D8J A;  5DM7 F;  3JRG A;  4OAZ A;  3HB9 A;  1TW2 A;  2XPU A;  5F6F A;  3H9Q A;  1FP1 D;  2R7Z J;  3MKZ A;  4M71 A;  4BQA A;  1POG A;  2ISZ A;  1HSJ A;  2N8G A;  3JAM Z;  2XGE A;  1BW6 A;  5FD6 A;  1MDM A;  4ZDO A;  1KZH A;  3OS2 A;  1DP3 A;  2JA2 A;  2W00 A;  3S3M A;  3BJA A;  4MIM A;  4IZZ A;  1OCT C;  1UEL B;  1IRF A;  1XN7 A;  3GX4 X;  4A3E J;  3S1N J;  4LK0 F;  1MJ9 A;  1KGS A;  5J1Y A;  1U8R A;  2HQA A;  4RB3 C;  2WWY A;  1X1C A;  1GDT A;  1BW5 A;  2XGC A;  2JJ7 A;  5FRM A;  3Q5F A;  3RYP A;  4V2G A;  1W5T A;  1F43 A;  3FXR A;  2KDO A;  1HA8 A;  3MFK A;  3PUB A;  1IUF A;  2NAZ A;  1ZLK A;  4L0Y B;  2HFH A;  2QQ8 A;  1QHG A;  4Q5S F;  3JTG A;  4RS8 A;  1W36 D;  2PG4 A;  4AIJ A;  2CUZ A;  4BJ6 C;  1JUS A;  1LDD A;  3W2A A;  2CRG A;  4C3J J;  1ETY A;  4WXD A;  4C30 A;  3RKW A;  3GVA A;  4BE1 A;  2KP6 A;  4LB5 A;  2CFX A;  2ISY A;  3X2Q H;  2K85 A;  4EJO A;  3CCM I;  4KNY A;  3WGH A;  4I99 C;  4UV8 A;  4XRS A;  1LQ1 A;  2LVS A;  2HR3 A;  4JK1 X;  2GZW A;  2KRF A;  2HYF A;  4HBL A;  3T5X A;  5E3N A;  3DBH B;  3GYH X;  1SVL A;  2QWW A;  3WG9 A;  3ML6 A;  2AXT C;  4C3H J;  3ZQG A;  3RQ4 A;  3IKT A;  4C2U A;  5KAF C;  2DAO A;  1R5I D;  3M7G A;  4IHX A;  1ACI A;  2OUM A;  3BG5 A;  2LYC A;  2A05 A;  4UUV A;  3IH3 A;  3QYF A;  4W1U A;  4D7M A;  1X3U A;  1QGP A;  3K70 C;  3WTV C;  5KK1 A;  2M4K A;  2VBW A;  1XCV A;  2DMT A;  2QQA A;  4XN0 A;  3BC8 A;  4PK4 A;  4BHC A;  3LSH A;  3CO7 C;  2VPR A;  3J80 Z;  1SD7 A;  1S72 I;  2MGQ A;  4AWX B;  3Q0U A;  1DP7 P;  2L9N A;  2V1X A;  4IEJ A;  4A3B J;  4A3M J;  1FJL A;  5BQT A;  1MW7 A;  2DBB A;  1O3S A;  1QHH D;  4KIC A;  2X48 A;  3Q9V A;  3AG2 H;  3E3V A;  3SEZ A;  2HVR A;  3NWS A;  4XID A;  3OYL A;  2IXS A;  2M2E A;  1ZAO A;  3K4L A;  3ERE D;  2QZ8 A;  5F1R A;  2V26 A;  2YPR A;  4KT5 C;  1YW9 A;  1D5Y A;  1HCR A;  1T0F C;  3HSF A;  3OYB A;  1ZTR A;  1ON2 A;  1Q1H A;  3SDG A;  3GW2 A;  1FBQ A;  1V4R A;  4XKC A;  3ZQH A;  4M9Z A;  5FO5 A;  3JRE A;  3BCA A;  4B1R A;  4B3A A;  2A6T A;  3FF5 A;  1MNE A;  1UFM A;  4OIP F;  2GWR A;  1J59 A;  3E7L A;  4P96 A;  5JR3 A;  2FBH A;  3C18 A;  4CH7 A;  3BR2 A;  3JTH A;  1MBJ A;  2E7W A;  1T98 A;  1VQ8 I;  2VBY A;  4P9F A;  1WVR A;  2R3S A;  2H27 A;  3G71 I;  4ENK A;  1QU3 A;  5EZG A;  2E35 A;  1D1B A;  1RNL A;  3KZZ A;  4LJZ F;  3GFL A;  3CMA I;  1MND A;  2A69 F;  2UUZ A;  1A6I A;  2OCC H;  3ABL H;  3ZCO A;  2D2W A;  3ZQC A;  4HLY A;  1BJZ A;  4A3D J;  2LG4 A;  5LGN A;  4PJJ A;  5B66 C;  4XKW A;  2E1N A;  4ZC3 A;  2ZKZ A;  2QBY B;  2BV6 A;  2XVC A;  1IXC A;  3RPU A;  3NQO A;  4J01 A;  1UB9 A;  4C2M J;  5HDN A;  2EB7 A;  3PUF A;  4IHW A;  4RGR A;  4EAT A;  2RGV A;  4GFB A;  3ZPL A;  2DFH A;  2LH9 A;  2Y0M A;  1Y0U A;  1SFK A;  2CFO A;  1KON A;  1ZGA A;  3BLY A;  4HV5 A;  5CPR B;  4YG2 F;  2HPI A;  3LAP A;  1GT0 C;  2WAE A;  2L7K A;  4LLL A;  2R0Q C;  4KA4 A;  3MCZ A;  5FKK A;  4OIO F;  3DPU A;  3HHH A;  5L3F A;  2ADU A;  1X1P A;  2R5Y B;  4E7J A;  4NC6 A;  4A69 C;  3GLX A;  2LY9 A;  3PFI A;  1G2H A;  4XLP F;  2IS1 A;  2QEN A;  1TQP A;  1ZAR A;  3T8R A;  4ETS A;  4DGW B;  1LFB A;  4LLG F;  4WX9 A;  4UY8 I;  3LA7 A;  4BY7 J;  5J4V A;  4KFC A;  1IDZ A;  4MQ9 F;  2KZV A;  2QVO A;  4F3Q A;  3H36 A;  5D5X B;  1ZKG A;  4GXO A;  2OD5 A;  2BY3 A;  4UV9 A;  4EJT A;  2UWM A;  2L9S A;  4GGG A;  3L1P A;  3FXO A;  4KN7 X;  2EFW A;  2X9D A;  3LSG A;  4F52 A;  2HKO A;  4BJ5 C;  1BC8 C;  2KT0 A;  4HX8 A;  4XRM A;  4AIK A;  1RR8 C;  3ZP5 A;  5B1B H;  2PMZ N;  4D9J A;  1GXQ A;  2XUB A;  1CGP A;  4EGZ A;  3MD2 A;  1BC7 C;  3KYD B;  3OIP A;  2W84 A;  5GPC A;  4L18 B;  3FHN A;  4L5I A;  3RSN A;  5ILV A;  2KDZ A;  2B7E A;  4AYB A;  3PFY A;  4I0B A;  2E5Z A;  2DOA A;  3RKQ A;  5E8G A;  1FWZ A;  1IUY A;  3KFW X;  1RPW A;  4PUS A;  2G7H A;  4HG2 A;  3OY9 A;  4HDU A;  2CGP A;  3HTU A;  1MBK A;  4FAS D;  3QP6 A;  1FEX A;  1Z91 A;  4LG0 B;  2ETH A;  4ZDL A;  1D1C A;  3BZ6 A;  4PZJ A;  3HOT A;  4I01 A;  3EYI A;  2MLG A;  4GRI A;  3LMM A;  5ERI A;  2R5Z B;  2ZNZ A;  3JCU C;  3IP4 B;  2F5E A;  2FUG 2;  3F8C A;  3RZO J;  2P5V A;  3VEP A;  1FYL A;  3I54 A;  4NDL A;  2COB A;  2M0C A;  3KLN A;  2CUE A;  1HW2 A;  1Z9C A;  4II3 A;  1NK3 P;  3JR9 A;  3A02 A;  2M8G X;  1B59 A;  2MD5 A;  4X0G A;  4Y4R A;  2W48 A;  3V7C A;  2DOE A;  2JTV A;  3K4C A;  2QSF X;  1AWC A;  3B6C A;  2EFN A;  1RUO A;  1GHC A;  1S7E A;  1YI2 I;  3A4C A;  3LNQ A;  3FIW A;  4KN4 X;  1LDK B;  3BRO A;  2ZXH A;  4UUS B;  3S2H J;  1RI7 A;  2DFF A;  2Q2E A;  2EV5 A;  2EZK A;  4XLC A;  2ZME C;  1KU7 A;  1XMA A;  5B5E C;  2LBF B;  3GTG J;  4QPO A;  5BMZ A;  2LTP A;  2M30 A;  2GOX B;  2XAF A;  3G1O A;  2V9K A;  4M6X A;  2FRH A;  4V19 K;  3M3Y J;  5E1X A;  1X19 A;  1WGX A;  1V55 H;  2JSC A;  2ZFU A;  3BJO A;  3CDI A;  3QU3 A;  5FFX A;  3OYM A;  2GXB A;  2VE8 A;  2FMY A;  2L9V A;  2EV0 A;  1J5Y A;  5HS7 A;  2V4J C;  1R5G A;  2M34 A;  1R1T A;  5F0H A;  3GZ6 A;  2LFB A;  3W6K B;  3DF8 A;  5GAD J;  2O8X A;  1JUM A;  1MMN A;  4U7D A;  1HBX G;  1AA7 A;  5TGT A;  4E7H A;  1FZP B;  1A31 A;  2P4W A;  3DBL B;  1D3Y A;  3OYC A;  3LOC A;  1HKQ A;  4HF0 A;  5H20 A;  3HRS A;  1O4X A;  1QZE A;  4BS9 A;  1WJD A;  2MH9 A;  5J3L A;  4ZYG A;  3HG9 A;  5HDK A;  1T08 B;  3MEX A;  5AIP A;  1LVA A;  2RKH A;  4CGZ A;  1JHF A;  1IXR C;  4CYC A;  3A2K A;  3KP2 A;  5FKN A;  1Y0N A;  2XKO A;  3PIP F;  1FOK A;  3FIS A;  4IRH A;  1SMY F;  1U9N A;  1N78 A;  2W85 A;  2Y0S A;  2IP2 A;  5J47 A;  3EDP A;  2G0E A;  1PVE A;  1R1U A;  2XF5 A;  3K4M A;  2GOM A;  2K02 A;  4PSW A;  4CYD A;  3AKZ A;  3SZG A;  4IX7 A;  1YIO A;  3KP6 A;  2R4G A;  3EPZ A;  2MAB A;  3HSR A;  3ECH A;  1H88 C;  3ULQ B;  4L5J A;  4OIQ F;  4E70 A;  2W25 A;  2E2J J;  2WAQ A;  3LSM A;  4FHT A;  1SAU A;  1VQM I;  2DA5 A;  1JJ8 C;  4HDV A;  4ENM A;  1TWC J;  1G3T A;  2QKL B;  4LIT A;  2M8E A;  2X6O A;  2VC1 A;  1I1S A;  5F64 A;  2W4S A;  5K5O A;  1TC3 C;  3RYR A;  4NQW B;  3MKL A;  4JP0 A;  2XAU A;  1ZRE A;  3BJ6 A;  3E6D A;  3E6B A;  1USS A;  3F8F A;  3I55 I;  3DKW A;  4A2U A;  4MEY F;  2L9R A;  2ICW G;  3BPV A;  3HM5 A;  5DS9 A;  1J09 A;  4A3C J;  2E2I J;  1RKT A;  1IC8 A;  3A1Y A;  2R7O A;  1BJA A;  3OR2 C;  2YUS A;  3G73 A;  4CCK A;  2L5Q A;  2X6Y A;  5DCM B;  4CZZ A;  3REO A;  4G6T B;  1WCM J;  3GTJ J;  3COA C;  2UV1 A;  2DT6 A;  3VB2 A;  3W6J B;  3O8G A;  3ABM H;  2PLY A;  4DQ2 A;  3GTP J;  1P92 A;  5HLT A;  5EYR A;  2M1B A;  3ASN H;  4LLN A;  2JA7 J;  1UZC A;  2DJN A;  4HV6 A;  2H1L A;  2VJ5 A;  2MC4 A;  2GLO A;  2HOT A;  1MD0 A;  1EJ9 A;  1Z6R A;  2H8R A;  2FQ3 A;  3P5J A;  4LD5 A;  4QIW N;  4CXF A;  4G9Y A;  1FPQ A;  5FLX K;  3DTE A;  1OR7 C;  1PUF B;  1MGT A;  5GPA A;  1K78 B;  2XRO A;  3ZQQ A;  3TP0 A;  5E1Z B;  1H89 C;  4CA0 A;  3U2R A;  2HS5 A;  3I4N J;  3VOE A;  2XAH A;  3GTK J;  1FSH A;  4Z2Y A;  2Z1D A;  3ONQ A;  3WGG A;  3FMQ A;  3RKX A;  2H8W A;  3S93 A;  2KIF A;  5LHH A;  4E7S A;  3JRA A;  4EV0 A;  4MQV A;  2F4M B;  1B6A A;  5EEH A;  4YEL A;  1ETV A;  3H0G J;  1VND A;  1E2X A;  2VBX A;  5CVU A;  5DUK A;  3SQN A;  3ZMZ A;  4AVP A;  5F1J A;  3JAM K;  5H6Q A;  1HQC A;  2E5N A;  3CUQ B;  1VQN I;  1XMX A;  1WHU A;  1DGR M;  4GYI A;  2MA3 A;  3VSK A;  2JZY A;  2IAI A;  1LFP A;  1X2M A;  2YU9 J;  3P9I A;  1D0X A;  3D0S A;  4E7I A;  1QPI A;  2ZJ2 A;  1S7A A;  5L3D A;  2X1E A;  3C2B A;  3S1Q J;  2ME0 A;  2YS9 A;  1BN5 A;  3D1N I;  1IN5 A;  4GDF A;  1TW3 A;  4EVI A;  1XGM A;  2QKM B;  3SEQ A;  4OIN F;  5BOX A;  4NNJ A;  3J81 Z;  5L3G A;  1CQT A;  2NXN B;  5LLQ A;  2PEX A;  3F8N A;  4XLE A;  1Z0X A;  4MLO A;  5FKL A;  4B4C A;  2E1O A;  2QQ9 A;  2R5Y A;  3HGG A;  3TMO A;  4BGD A;  4BQQ A;  3RQI A;  1YRN A;  3QOD A;  3I9V 2;  2O3F A;  3T1B A;  1R71 A;  2VOO A;  1JGS A;  4XKB A;  2A6E F;  4XIC A;  2RQP A;  3TBI A;  1O3T A;  3JRH A;  3VOD A;  3VSL A;  2BZT A;  2ZXI A;  1G59 A;  3D5L A;  3R0J A;  5IPA A;  5J8F A;  3BR1 A;  3K4B A;  3KP5 A;  1G4D A;  2PX9 A;  2L7F P;  2QSG X;  3ERM A;  3Q0V A;  3M07 A;  1E3O C;  1UJ8 A;  2VJ4 A;  4B48 A;  5K5R A;  2O7O A;  5HVQ C;  4YFN F;  4ESB A;  1Z1D A;  2K3P A;  4AM3 A;  2QQB A;  3FWE A;  1ULY A;  2KHM A;  5JHU A;  5IT3 A;  1OPC A;  3TW6 A;  2Q8K A;  3CCY A;  1BR1 A;  1BR2 A;  3T0Y A;  2AO9 A;  3F8B A;  3GEZ A;  4DYQ A;  2LDU A;  1MH4 A;  4A3L J;  1E0E A;  3HKZ N;  4KIF A;  4I76 A;  3IKV A;  1WI9 A;  4KMU X;  1TNS A;  5K7Z A;  4HZF A;  5H6R A;  4XRS G;  1OIS A;  2DJI A;  3QOE A;  3FK7 A;  2DDB A;  4F55 A;  2STT A;  2DMQ A;  5HNH A;  1LE8 B;  5ICE A;  3OYI A;  2G9W A;  2H1K A;  2EK5 A;  3J80 K;  4LG0 A;  3HOV J;  1ERD A;  5LGT A;  1A36 A;  1VQL I;  2RAE A;  3KCC A;  2GIZ A;  1FYK A;  3QQA A;  1T0F A;  4KJZ A;  4XKV A;  4JX6 A;  2ZC2 A;  1BIA A;  1O7F A;  2CQK A;  3GO5 A;  3I58 A;  4GO1 A;  1TQI A;  4IHT A;  2MC3 A;  2VJI A;  4X6A J;  2KMU A;  3RKY A;  3BZC A;  5D5U B;  1JKR C;  5FFZ A;  1UG0 A;  2EIJ H;  4AC0 A;  2IS6 A;  2Y0S N;  1ITY A;  5TIS C;  1LFU P;  2VQL A;  3OOU A;  2MFZ A;  5BS6 A;  2MLK A;  2NOJ B;  1JHH A;  1HXD A;  1JUP A;  1YS7 A;  3H5N A;  3K9T A;  2MBF A;  3ABT A;  1I3Q J;  4M9X A;  1FY7 A;  2A5W A;  5E3O A;  1TT0 A;  4C2T A;  4V2F A;  2UXN A;  3CUO A;  1VZ0 A;  4LOC A;  1XG1 A;  2KRC A;  3I53 A;  5ICF A;  2WAQ N;  2Y30 A;  3CF2 A;  4P55 A;  1WPK A;  3QPH A;  1W36 C;  1K6Y A;  2E1M B;  4UUS A;  4RGU A;  5IOY A;  1T8I A;  4BDY A;  4FCY A;  2OQR A;  3GUD A;  5CYV A;  5DV5 A;  5LFA A;  3H92 A;  1YIJ I;  3G1L A;  2FBI A;  2K4B A;  2L2O A;  2LSO A;  4LB6 B;  2IS4 A;  5LEK A;  1U6G A;  5FJ8 J;  2HKX A;  2FX0 A;  2HOS A;  1ORK A;  3BR3 A;  2CW7 A;  1YX3 A;  3F0C A;  4ZYA A;  3P9K A;  2ME6 A;  2ESH A;  5IP9 J;  1SFX A;  3ESW B;  3IC7 A;  4ON0 A;  4RBO A;  1OLT A;  3NWT A;  3SJM A;  4E7L A;  1IAW A;  3EET A;  4W97 A;  1IGN A;  3KP4 A;  1XX5 A;  1ZQ3 P;  4HAM A;  4XLA A;  3M8F A;  1H9G A;  2Y9Z A;  2DFE A;  3WTX C;  1Y56 A;  1ZRD A;  1PJR A;  3PJR A;  3H3Z A;  1V54 H;  1MSE C;  1E3H A;  2G7U A;  1B9M A;  1P4W A;  3S2D J;  4DW6 A;  5L3E A;  4BHP A;  3OL4 A;  2EPF A;  4QPQ A;  1B8I A;  5D4R A;  2W1O A;  3ABU A;  3SYT A;  3DEE A;  3OSF A;  4OMZ A;  2ECB A;  3ZMT A;  2ACJ A;  2L54 A;  3F3X A;  2PJR A;  3HOW J;  5EG0 B;  4CUG A;  2LMD A;  3HUG B;  3IWZ A;  5DCF A;  1MJB A;  5EJC A;  2OA4 A;  1MKM A;  2EZH A;  1TQM A;  2QUF A;  9ANT A;  4FIS A;  3H9G A;  3L09 A;  4BXU A;  3VPR A;  1OCR H;  3OYG A;  2XB5 A;  1BI1 A;  2ZSI B;  1G3W A;  4QLC U;  1W7P A;  2IEK A;  1GVJ A;  3O3K A;  1YW7 A;  3FMR A;  3VFZ A;  1QVU A;  3S32 A;  1K4S A;  1MNM C;  4F7Z A;  5EGO B;  1WZ2 A;  1ZN2 A;  2VUM J;  3AL0 B;  4WXH A;  2A61 A;  1VQ9 I;  5FLV A;  4EM2 A;  1SD4 A;  1S5L C;  2Z3Y A;  4Z6Y A;  2V9P A;  4A3I J;  1VF9 A;  3VYS B;  4RLF A;  4A3K J;  4IKF A;  2Y31 A;  2XGD A;  1BR4 A;  3L00 A;  3L2U A;  4MHG A;  1OCZ H;  3NEU A;  4B43 A;  3RCO A;  1DU6 A;  3WHB A;  3KP3 A;  1T39 A;  1IRZ A;  4A6E A;  3CCQ I;  3LQR A;  3RDI A;  4F91 B;  3LST A;  2B9S A;  1TWF J;  1VQ5 I;  2M5W A;  3MAJ A;  2DI3 A;  2VC0 A;  3I5U A;  2VB6 A;  2XRN A;  3R6S A;  3TQN A;  4A0X A;  1XTA A;  2CJJ A;  3OYH A;  2BXZ A;  2L7M P;  2Z2S B;  4KIB A;  2HI3 A;  3G3Z A;  5JHF A;  2HXI A;  2P8T A;  4XBF A;  3H3U A;  3W2V A;  3BG3 A;  1TLH B;  1FTZ A;  4ITV A;  5ICC A;  4I02 A;  2DA3 A;  1I39 A;  2L4M A;  4F92 B;  4O6J A;  3O2P E;  3CC2 I;  3QOP A;  2IPQ X;  4YIR X;  3ZQ7 A;  5BNG A;  3QAH A;  5E8I A;  5GP9 A;  4A0Z A;  1S8N A;  2NVQ J;  4CCO A;  3ZMD A;  4G6Q A;  4G8X A;  2ZME A;  3MVP A;  1KYW A;  4BXF A;  2VKH A;  2Y48 A;  3JSP A;  2XIG A;  4YII A;  4HF1 A;  3WTU C;  3L2Q A;  2LC2 A;  2OBP A;  4BU2 A;  4R1H A;  4XRF A;  3O8H A;  2CUJ A;  2X1C A;  1W4M A;  1H0M A;  1F4K A;  1OYI A;  2OPT A;  2V79 A;  1J9I A;  2KZG A;  3HRT A;  2IRF G;  2O5R A;  4RM3 A;  4IHS A;  5EEG A;  2WAD A;  1XGN A;  1YJN I;  1B72 A;  4NUB A;  1ON1 A;  2VI6 A;  3K70 D;  1XSV A;  1SEU A;  4A3G J;  2R92 J;  2LLK A;  5AIQ A;  3U1D A;  4M6Y A;  3GTM J;  1WI3 A;  3CQZ J;  4JYK A;  2HU9 A;  3LSJ A;  3IUO A;  1X1A A;  4U0Y A;  4G12 A;  4M3E A;  5F04 A;  5F0C A;  2CH0 A;  2JSP A;  3L9F A;  3WTY C;  1R5H A;  3GXO A;  3HIF A;  5F0F A;  1BBY A;  3NAR A;  2IA0 A;  4CDG A;  4BEH B;  2HOE A;  2X0L A;  1T2K A;  1VQ6 I;  5JVT A;  5EEA A;  2FBK A;  1EV7 A;  3BOQ A;  1MMG A;  2D45 A;  5H2F C;  3DU5 A;  1Z3X A;  1VQ4 I;  5AON A;  1ZG1 A;  2Y2Z A;  2ID3 A;  2DK8 A;  2NOG A;  4RLQ A;  2RVC A;  3CCL I;  4C9Y A;  1VQK I;  2O0Y A;  3C2H A;  3VWB A;  2LOO A;  5M5X J;  2WA0 A;  2OCE A;  4M74 A;  4M9S A;  4UVC A;  4FTH A;  1N77 A;  2NNN A;  3TP3 A;  2EWN A;  3M9A A;  5E1W A;  1BIB A;  2XHK A;  2XAJ A;  1SFE A;  2HOA A;  3QRF F;  4BBS J;  3BQY A;  3OYD A;  3TKY A;  5DD4 A;  1L3L A;  3HXL A;  2B0L A;  3I64 A;  5D8K B;  4D0P A;  5BPD A;  5KNL A;  4G7O F;  2WB1 A;  4ABZ A;  3UNG C;  3QP5 A;  3WU0 A;  1MMS A;  5M5W J;  4N9I A;  1EF4 A;  1TP4 A;  3S3N A;  3ZXS A;  2P6T A;  2GA1 A;  2LY1 A;  1MSF C;  1W1W E;  4B3X A;  1IN7 A;  3S2W A;  1XB4 A;  4N4O B;  1BOB A;  4DZJ A;  1B1B A;  4I0A A;  1AKH B;  2DMU A;  5HS9 A;  2XF6 A;  2DA4 A;  4UVA A;  2STW A;  4XN3 A;  3KLO A;  4Y52 J;  4M3G A;  2DYR H;  3BTL A;  5J40 A;  5LRR A;  1HKT A;  1CF7 A;  2K3F A;  2KLO A;  1SVM A;  5DD8 A;  1DDN A;  3E5U A;  2LY2 A;  3GWZ A;  1JT0 A;  2ZNY A;  4BHB A;  3LL7 A;  4IHY A;  2QF7 A;  4NBQ A;  2KIM A;  5IP7 J;  2D1V A;  3FXL A;  2V6E A;  4YIF A;  2LP0 A;  1PDN C;  3FK6 A;  1Z67 A;  2AHQ A;  2ELH A;  4L5E A;  1OCP A;  4HQE A;  1JJ6 C;  1OR7 A;  3DPL C;  3LA3 A;  3CCV I;  2NRA C;  2L4A A;  4U0V A;  1HC8 A;  2F4O B;  1FIA A;  1SC7 A;  3BZK A;  4H4K C;  3P7N A;  4L9J A;  5B1A H;  1K7A A;  4IPA A;  2C6Y A;  2KIQ A;  2DN0 A;  3CJR B;  4A5N A;  4L9T A;  4GYG A;  1V5F A;  4RMN A;  1RUN A;  4DYR A;  4HF2 A;  1ONV A;  1UHS A;  3KPH A;  5ILU A;  1W0U A;  4OAY A;  3BP8 A;  2BW3 A;  1VQ7 I;  3F6V A;  2GQQ A;  2HZD A;  2DTZ A;  3RPQ A;  5C4J J;  4XL9 A;  4LMY A;  3CMY A;  2NS7 A;  2GIV A;  1P2F A;  1MDM B;  2DU9 A;  1SVO A;  4BNC A;  2Z33 A;  5FB2 A;  4ZYD A;  3HZJ A;  4R8H A;  3OYK A;  1I6X A;  2HQ5 A;  2LK2 A;  3TDU C;  2PJP A;  3M8J A;  1X1B A;  1ZRF A;  3ZRG A;  3DQV C;  2L02 A;  2DOD A;  1K83 J;  2DA7 A;  2L0K A;  3KIO A;  2COM A;  4ENN A;  1H9T A;  1FOX A;  4CIC A;  1IN8 A;  1P6R A;  3C1D A;  1X3Z B;  2XPV A;  4Y33 A;  1GV2 A;  4BUP A;  2IS2 A;  1EH6 A;  1PP8 F;  1U2W A;  4M3B A;  2XV4 S;  2DQR A;  1ZHF A;  2FU4 A;  2R7V A;  3J81 K;  2ZCW A;  3WHC A;  1S9H A;  4G7H F;  3LWF A;  1ETK A;  1Z7L A;  4Y15 A;  5IP6 A;  3KEY A;  5K5Q A;  1V5E A;  3WU1 B;  2LRD A;  3DTK A;  3FDY A;  3OYF A;  1Z7U A;  2D5V A;  2ZJR F;  1ETQ A;  4X1E A;  4KDP A;  1QZZ A;  5DM6 F;  4PSX A;  4B09 A;  3HUG A;  2XSD C;  5LGU A;  4EM1 A;  2R93 J;  1IZ1 A;  4A3F J;  1EA3 A;  4DBQ A;  2VKE A;  2H6B A;  3J7A Y;  2VL8 A;  1UHW A;  2K86 A;  4HQM A;  2X51 A;  4HPQ A;  3OV8 A;  3EUH A;  2PI0 A;  3V8L A;  2DOF A;  4NB5 A;  3G4S I;  2WY7 Q;  1JKP C;  1P9Q C;  3DKY A;  4KIG A;  4BKX A;  2CV1 A;  1A04 A;  1P4A A;  5HS8 A;  2CU7 A;  2BVM A;  2Q0O A;  3VDX A;  2XB0 X;  2M3A A;  3KET A;  3RPU D;  2I5U A;  5CQG A;  2JQ7 A;  3HOX J;  2X6W A;  4AUX A;  4RM2 A;  3DKX A;  3QWL A;  2JUG A;  2OZU A;  3H5A A;  1MBH A;  2FA5 A;  3I0T A;  2BEO A;  3FM5 A;  3HPG A;  1I3A A;  2RC4 A;  3M4O J;  2IA1 A;  3C2G A;  1S6L A;  1STZ A;  2ELJ A;  1FP2 A;  4CHU A;  1X58 A;  3CTA A;  4FX4 A;  2BY2 A;  3EUK L;  3CD6 I;  1T95 A;  1YJW I;  2QYO A;  3DEU A;  4IVN A;  3K1M A;  3LSK A;  4OOI A;  3F72 A;  5IYC J;  3A01 B;  2M4G A;  1K6O A;  3VYT B;  2DLL A;  2E7X A;  1QZY A;  4XM3 A;  3Q0W A;  3FBI B;  2VT3 A;  4CCJ A;  3K2A A;  5GAE J;  4A12 A;  1N25 A;  4ZTF A;  4UUT A;  3GZ5 A;  2DA1 A;  3HJE A;  2FNP A;  2IGK A;  5L3B A;  1JKQ C;  4A93 J;  2CW8 A;  1X4O A;  3HTS B;  3A0H C;  1LJ9 A;  4NHJ A;  1FX7 A;  4BAY A;  2KKO A;  3GLL A;  3CMM A;  1U9O A;  1G3S A;  3I59 B;  1AOY A;  4UB6 C;  1T38 A;  3AG4 H;  2M0M A;  3MZ8 A;  1TT5 B;  1ETX A;  4Y13 A;  1Z3Y A;  4AYB N;  3MZH A;  3BCB A;  3FBN B;  1VQO I;  1R36 A;  3CME I;  2GM4 A;  4XOT A;  1ZGJ A;  1RR7 A;  4G94 A;  1WFX A;  5M3M J;  2ZB9 A;  1PUE E;  3I4M J;  1YFH A;  2AS5 F;  1G8X A;  5CVR A;  5JLX A;  5E18 F;  4EQQ A;  1GXP A;  1SD6 A;  5E79 C;  1KU2 A;  2BBY A;  1WKM A;  1GUU A;  4I7H A;  3ZGK A;  1IDY A;  5BPI A;  1R58 A;  1C0W A;  3OOP A;  3LSP A;  2QBY A;  6PAX A;  1WJ5 A;  5E20 A;  3FXU A;  5GAH J;  3W6V A;  2FD5 A;  4XOR A;  3HHG A;  2E1M C;  3CO6 C;  2MW8 A;  4MFD A;  2FXA A;  3CDH A;  3OSG A;  3S1M J;  5LEJ A;  5C44 J;  5JI6 A;  4XQF A;  1AHD P;  3E6M A;  3N05 A;  4ZYH A;  3R61 A;  1MJA A;  4MEX F;  3TO6 A;  1K79 A;  3FXM A;  2L01 A;  3GF2 A;  2JUC A;  1RKW A;  4PJL A;  3TOB A;  5HLG A;  5CVI A;  2HGC A;  1SFU A;  1DQU A;  3TL4 X;  1FYM A;  2ZJP F;  1YX5 A;  4S05 A;  2TDX A;  2BE5 F;  3SXY A;  2VON A;  5LHG A;  1R22 A;  2KL4 A;  2ZXJ A;  2YR2 A;  3MQ0 A;  3VYU B;  3PIO F;  4HX4 A;  4J19 A;  1V5G A;  1XSX A;  4UB8 C;  3OS1 A;  2GBY A;  4Q48 A;  1U5T B;  4TV7 A;  1HW1 A;  4HOB A;  2CQ7 A;  2XAG A;  4OIR F;  2PFB A;  5HLI A;  4EMS A;  2K4J A;  1ZG5 A;  5ICG A;  5J1R A;  2X4H A;  1YYV A;  2JPC A;  4AD9 A;  1PP7 U;  2BVL A;  2P7V B;  4XLH A;  1RRJ A;  3QPS A;  2O03 A;  1LVK A;  2BY1 A;  3HL2 A;  1Y8R B;  3ASO H;  1IF1 A;  2DO7 A;  3FXJ A;  2E2H J;  3IH2 A;  3M1E A;  3K1N A;  2ZFW A;  2K27 A;  3EUH C;  1IXS B;  2EIL H;  3B6A A;  3HGY A;  4YRV A;  2M9H A;  1D1A A;  1QQI A;  2VIX A;  1SAN A;  2ZJQ F;  1FOY A;  2DW4 A;  3AL0 C;  1D0Z A;  2VKV A;  1YS6 A;  5KHD A;  3OMY A;  4CSW A;  4OMY A;  3GME A;  4MGR A;  3QYE A;  4BE2 A;  2ID6 A;  1LDJ A;  5IYB J;  2RDP A;  1ZYR F;  1I5Z A;  3BWG A;  3W3C A;  2CV2 A;  3HEF A;  3K69 A;  1UG2 A;  4C3I J;  4P1W A;  3ABK H;  5DUI A;  2R5Z A;  2OQG A;  5J6X A;  1A6Q A;  4WF2 A;  2JWT A;  4DYC A;  4BYY A;  4D1Q A;  3OS0 A;  1HDD C;  2IA2 A;  3QPL A;  2E36 A;  2X6X A;  3DCF A;  4U0W A;  5GAG J;  5M3F J;  1F1Z A;  2E34 A;  3LFK A;  3ELK A;  2EZL A;  1D5V A;  2AQE A;  3SDB A;  3BTJ A;  3K4K A;  4ASN A;  3WOD F;  1W0T A;  1EH7 A;  2M87 A;  3OR1 C;  2MYS A;  2VN2 A;  2O9L A;  2VJJ A;  2R7T A;  1Z6T A;  3J7Y J;  2IJL A;  3I56 I;  5D5V B;  4D5C A;  4BY1 J;  4BH9 A;  2MD0 A;  1BA5 A;  5HOO A;  1Q1V A;  3CZ6 A;  1VQP I;  2OV7 A;  5IY5 H;  4F93 B;  2Q2E B;  2H6C A;  3DV8 A;  3D5R C;  3G6E I;  1QNT A;  1W5C C;  1JTY A;  3BY6 A;  2P5L C;  3HRM A;  5LBQ A;  3HDD A;  1JE8 A;  2MG4 A;  1VTN C;  3IAM 2;  1NH3 A;  1YIT I;  5HOD A;  2HYJ A;  4IRG A;  3S16 J;  4M73 A;  2E1C A;  1UMQ A;  2LBF A;  3PM1 A;  4M72 A;  3F6O A;  2MH2 A;  5CJ9 A;  5TRD A;  5DEQ A;  1SD5 A;  4II2 A;  3H1C A;  3WTZ A;  2HNH A;  3FX3 A;  3EUA A;  1YHQ I;  2R7F A;  2HYG D;  2Q1Z B;  2A68 F;  1LKX A;  4AIH A;  1S7O A;  3ZQL A;  1BL0 A;  1KA8 A;  3SFI A;  1Y1V J;  3HYI A;  2F5V A;  3FM3 A;  4KIT B;  1KU3 A;  3TO7 A;  2HVS A;  2L7Z A;  3IRQ A;  4DOZ A;  2P7C B;  4FT8 A;  4ZZL A;  3F9K A;  2CQQ A;  3LFU A;  1VI0 A;  4ANJ A;  1JT6 A;  3JSO A;  2ZBK A;  4IRI A;  3CLO A;  2PMH A;  3U21 A;  4KMF A;  4NC7 A; 
#chains in the Genus database with same CATH homology
 3CDL A;  1O4X A;  4D5F A;  1APL C;  5J3L A;  3IH4 A;  2Y2Z A;  4CYC B;  2FQ4 A;  2ID3 A;  2NOG A;  2ECC A;  2JA6 J;  4CYC A;  1NTC A;  5FKN A;  3DEW A;  5M5X J;  3FIS A;  4FTH A;  3ZQI A;  1U9N A;  2NVT J;  3BT9 A;  2G0E A;  3TP3 A;  1WH7 A;  2NVY J;  1H8A C;  2HOA A;  3JRF A;  3BQY A;  4BBS J;  1RET A;  1H88 C;  1T56 A;  2DMN A;  2NVX J;  1ETO A;  1GVD A;  4ABZ A;  2E2J J;  5EZH A;  3PO2 J;  3MN2 A;  1IV6 A;  2DA5 A;  1JJ8 C;  5M5W J;  1TWC J;  1EF4 A;  5FLM J;  2X6O A;  3BTI A;  1MSF C;  1IG7 A;  2EQR A;  1QVT A;  1TC3 C;  2B63 J;  3MKL A;  4DZJ A;  1RES A;  4JP0 A;  1AKH B;  4Y7N J;  2DMU A;  2DA4 A;  3H3V K;  4Y52 J;  4M3G A;  1AKH A;  3BTL A;  4DZP A;  4RDU A;  3JRC A;  1FTT A;  3HOU J;  2L9R A;  2WV1 A;  3LSR A;  4JX5 A;  3HM5 A;  5DS9 A;  4A3C J;  2E2I J;  4M3D A;  1RKT A;  1IC8 A;  5FKO A;  1JT0 A;  2YUS A;  4M6V A;  1XC5 A;  4IHY A;  3JRI A;  3GTQ J;  1F36 A;  1AU7 A;  1WH5 A;  2QF7 A;  3BTC A;  5IP7 J;  3HOY J;  2LP0 A;  1JKO C;  3FK6 A;  3K7A J;  1WCM J;  3GTJ J;  2AHQ A;  3O8G A;  3BQZ A;  3GTP J;  4L5E A;  1OCP A;  5FKM A;  1JJ6 C;  5EYR A;  2K9Q A;  1VFC A;  2TRT A;  3NAU A;  3A01 A;  2JA7 J;  2DJN A;  1FIA A;  2FJ1 A;  2ELK A;  2Y9Y A;  5E3M A;  1FIP A;  2K9N A;  2HOT A;  2GLO A;  2DN0 A;  2E19 A;  3HBL A;  5J1U A;  1HDP A;  2H8R A;  3GTL J;  4QIW N;  2HDD A;  1SFO J;  1OFC X;  2JK3 A;  4HNV A;  1PUF B;  4DYR A;  3GTO J;  1ENH A;  1ZR4 A;  2JA5 J;  5GPA A;  1UHS A;  1Z77 A;  1W0U A;  1PUF A;  1MBF A;  2JMW A;  3TP0 A;  5IOZ A;  1H89 C;  3FKI J;  3I4N J;  3JRG A;  3HB9 A;  2XPU A;  3GTK J;  2DTZ A;  4QSH A;  2R7Z J;  5C4J J;  2K40 A;  3CMY A;  2NS7 A;  1POG A;  2NS8 A;  2N8G A;  2XGE A;  3JRA A;  1BW6 A;  1ETV A;  3H0G J;  1VND A;  5F1J A;  2HQ5 A;  2LKX A;  4MIM A;  2HXO A;  1OCT C;  2LK2 A;  4A3E J;  3S1N J;  1K61 A;  1K83 J;  2EBI A;  2IAI A;  1X2M A;  2DA7 A;  2L0K A;  3Q3S A;  5J1Y A;  2YU9 J;  1HOM A;  1QPI A;  3ZOB A;  1GDT A;  1P7J A;  3C2B A;  3S1Q J;  2ME0 A;  2YS9 A;  2XPV A;  3D1N I;  2XGC A;  1GV2 A;  1BW5 A;  2JJ7 A;  3HOZ J;  4V2G A;  1CQT A;  4M3B A;  1F43 A;  1Z0X A;  4MLO A;  5FKL A;  4B4C A;  1MH3 A;  1IUF A;  4MO7 A;  2E1O A;  1YRN B;  4IHV A;  2DA6 A;  2R5Y A;  3HGG A;  3WHC A;  3RQI A;  1YRN A;  1ETK A;  5IP6 A;  4XIC A;  2QCO A;  3JRH A;  2EZI A;  1NK2 P;  2D5V A;  1JUS A;  1ETQ A;  4X1E A;  2CRG A;  4C3J J;  2JN6 A;  1ETY A;  5IPA A;  2XSD C;  2R93 J;  3BR1 A;  4JX4 A;  2XPW A;  4XRS A;  4A3F J;  3S1R J;  2L7F P;  2LVS A;  2VKE A;  3Q0V A;  1E3O C;  2DMP A;  5E3N A;  2MSY A;  3BR0 A;  2O7O A;  4A3J J;  1R9T J;  4C3H J;  3ZQG A;  1JKP C;  5K7H A;  3TW6 A;  4IHX A;  3CCY A;  4BKX A;  2AO9 A;  3BG5 A;  4DYQ A;  2CU7 A;  1MH4 A;  4A3L J;  3IH3 A;  4W1U A;  4D7M A;  2XB0 X;  4FE4 A;  3HKZ N;  1OJL A;  3HOX J;  3S15 J;  4AUX A;  2DMT A;  4I76 A;  2XRL A;  5K7Z A;  1MBH A;  4XRS G;  3TW7 A;  3FK7 A;  2VPR A;  3M4O J;  2MGQ A;  3Q0U A;  2DMQ A;  1LE8 B;  2H1K A;  3HOV J;  4IEJ A;  1X58 A;  4A3B J;  4A3M J;  1LE8 A;  1FJL A;  2RAE A;  5IYC J;  3QQA A;  3A01 B;  1IJW C;  1P7I A;  4JX6 A;  2X48 A;  3BG9 A;  4XK4 A;  3Q0W A;  4XID A;  1GV5 A;  1T33 A;  3K2A A;  2M2E A;  5DTD A;  4UUT A;  2DA1 A;  3S17 J;  4X6A J;  4I6Z A;  1JKR C;  4AC0 A;  1JKQ C;  1QRY A;  2Y0S N;  4A93 J;  1ITY A;  1D5Y A;  1HCR A;  3JRD A;  1LFU P;  1ZTR A;  3OOU A;  3SDG A;  3ZQH A;  3JRE A;  1U9O A;  4B1R A;  4B3A A;  1JUP A;  2LD5 A;  3E7L A;  1I3Q J;  5E3O A;  4BBR J;  1ETX A;  3BR6 A;  4V2F A;  3BR2 A;  4AYB N;  4LOC A;  1MBJ A;  3TED A;  1XG1 A;  2WAQ N;  2Y30 A;  3PO3 J;  1TWG J;  1WPK A;  2GM4 A;  4UUS A;  1DU0 A;  5EZG A;  1RR7 A;  5IOY A;  5M3M J;  2ZB9 A;  4FCY A;  3I4M J;  1A6I A;  5JLX A;  3G1L A;  2IBD A;  3ZQC A;  1BJZ A;  4A3D J;  5C3E J;  5FJ8 J;  1GUU A;  2K9S A;  2FX0 A;  1IDY A;  2HOS A;  1ORK A;  3BR3 A;  3LSP A;  3F0C A;  4EEF G;  3W6V A;  2FD5 A;  2ME6 A;  4C2M J;  5IP9 J;  4IHW A;  2MW8 A;  4RBO A;  4GFB A;  3SJM A;  1I50 J;  4MFD A;  5E3L A;  4W97 A;  1IGN A;  1TWA J;  3OSG A;  3S1M J;  5C44 J;  1GT0 C;  1ZQ3 P;  1AHD P;  2R0Q C;  2LR8 A;  2Y9Z A;  5FKK A;  3S14 J;  2R5Y B;  4A69 C;  1MSE C;  1ETW A;  2LY9 A;  5F08 A;  1B8I B;  3S2D J;  1G2H A;  4DW6 A;  1RKW A;  1B8I A;  3IV5 A;  1JTX A;  1LFB A;  3OSF A;  2ECB A;  4BY7 J;  1IDZ A;  3HOW J;  5EG0 B;  5JLW A;  4D7N A;  2DA2 A;  3OIO A;  5EG0 A;  1ZKG A;  2EZH A;  9ANT A;  1MBE A;  4FIS A;  4J19 A;  4S0H B;  3L1P A;  3VPR A;  2GBY A;  1ZR2 A;  2XB5 A;  2IEK A;  2X9D A;  3LSG A;  1QVU A;  1MNM C;  5C4X J;  2KT0 A;  4M3F A;  5J1R A;  4XRM A;  5EGO B;  2VUM J;  2PMZ N;  4QTR A;  5EGO A;  5FLV A;  3QPS A;  4A3I J;  1VF9 A;  5GPC A;  2KDZ A;  2E2H J;  3IH2 A;  2I10 A;  4A3K J;  2Y31 A;  1ZK8 A;  2XGD A;  3UKG A;  3RKQ A;  1HLV A;  1RPW A;  3B6A A;  3HGY A;  2M9H A;  2O8K A;  3GBG A;  4BXX J;  1MBK A;  1SAN A;  1DU6 A;  3WHB A;  1FEX A;  1IRZ A;  2OF7 A;  2VKV A;  1TWF J;  3RZD J;  2ID6 A;  1I6H J;  5IYB J;  3HEF A;  1UG2 A;  4C3I J;  5EDN A;  2R5Z B;  3RZO J;  2CJJ A;  2R5Z A;  2L7M P;  2HI3 A;  2JWT A;  4DYC A;  2HXI A;  1HDD C;  4NDL A;  2COB A;  2M0C A;  3BG3 A;  3BR5 A;  2CUE A;  3QPL A;  3DCF A;  1FTZ A;  5M3F J;  2DA3 A;  2EZL A;  1NK3 P;  4MFE A;  3BTJ A;  3JR9 A;  5IYD J;  1W0T A;  3A02 A;  3ZQF A;  5BNG A;  2M8G X;  1TWH J;  1MBG A;  5GP9 A;  1U8B A;  2O9L A;  3G1M A;  2NVQ J;  2W48 A;  1XS9 A;  4D5C A;  5F27 A;  4BY1 J;  2P81 A;  1A5J A;  3MVP A;  1BA5 A;  3B6C A;  1Q1V A;  1S7E A;  3LNQ A;  3FIW A;  3O8H A;  1HF0 A;  2WB1 N;  4UUS B;  1JTY A;  2OPT A;  3S2H J;  5M5Y J;  3HDD A;  2EZK A;  2MG4 A;  4FE7 A;  1U78 A;  1B72 B;  5HOD A;  2HYJ A;  3S16 J;  3GTG J;  1B72 A;  2LTP A;  2VI6 A;  1UMQ A;  3PM1 A;  3G1O A;  3A03 A;  3M3Y J;  4A3G J;  2R92 J;  2LLK A;  1WGX A;  3GTM J;  5K7F A;  1WI3 A;  3CQZ J;  2TCT A;  4JYK A;  3LSJ A;  2CUF A;  4G12 A;  4M3E A;  5F04 A;  5F0C A;  1Y1W J;  2M34 A;  5F0H A;  1ZGW A;  3ZQL A;  1BL0 A;  2LFB A;  5F0F A;  3SFI A;  1Y1V J;  2JA8 J;  2EH3 A;  3NAR A;  1JUM A;  2L7Z A;  1JGG A;  5EEA A;  1X2N A;  2CQQ A;  1VI0 A;  3LOC A;  1JT6 A;  5EF6 A;  3JRB A;  2CQX A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...