1DU6A

Solution structure of the truncated pbx homeodomain
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
64
structure length
64
Chain Sequence
SSGHIEGRHMNKQATEILNEYFYSHLSNPYPSEEAKEELAKKCGITVSQVSNWFGNKRIRYKKN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Conformational changes in the PBX homeodomain and C-terminal extension upon binding DNA and HOX-derived YPWM peptides.
pubmed doi rcsb
source organism Mus musculus
molecule tags Gene regulation
molecule keywords HOMEOBOX PROTEIN PBX1
total genus 14
structure length 64
sequence length 64
ec nomenclature
pdb deposition date 2000-01-14
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.60 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Homeodomain-like 1du6A00
5E3OA 1I6HJ 4D7NA 2NS8A 3BG5A 1XS9A 1QRYA 1OFCX 1FIPA 1GDTA 2E19A 3GTGJ 4MFDA 2K9SA 1U9OA 1ZK8A 4XRSA 2R5YB 1B8IA 1IGNA 5C4JJ 3O8HA 3S2DJ 3S1MJ 1ETQA 2GBYA 3BR1A 3BTIA 1JJ6C 3MN2A 2L9RA 2O8KA 3OOUA 1IC8A 3S1QJ 3GTKJ 3HOXJ 3HGGA 4M3BA 1BL0A 4DZJA 5J1YA 1ITYA 1TWGJ 1B72A 1QPIA 1JKPC 4M3GA 3LSPA 4Y52J 2EZLA 3B6AA 5GPCA 2EH3A 2HI3A 4CYCA 4A3EJ 1I3QJ 3VPRA 1DU6A 3WHCA 4RBOA 1MBFA 2COBA 3LOCA 2X9DA 5EG0A 1UMQA 2EBIA 3QPLA 1X58A 3BG9A 5J1RA 1MH4A 1VNDA 4DYQA 5EGOA 2ECCA 2Y9ZA 1K83J 2Y9YA 3IH3A 5IYDJ 5M3FJ 4A3CJ 1MSFC 4QIWN 5F27A 4AYBN 4D5FA 4FISA 2Y2ZA 3A02A 1U9NA 2IBDA 3TW6A 1ETOA 3JREA 4A3DJ 3JRHA 4IHWA 1S7EA 2M2EA 2CRGA 2WAQN 2O9LA 1Z77A 3L1PA 2FJ1A 1X2MA 5F1JA 2LD5A 4AC0A 4RDUA 2XB0X 1MNMC 3PO3J 3M3YJ 5M5XJ 3G1LA 3K7AJ 2FQ4A 4JX5A 4XICA 3HKZN 2VUMJ 3JRBA 2KDZA 1TWCJ 2NVTJ 1APLC 3LSRA 2TCTA 2EZKA 3JR9A 3Q0VA 3S2HJ 2DMPA 1IJWC 2XPWA 3Q3SA 1TC3C 2R7ZJ 2IEKA 3H0GJ 2CU7A 3ZOBA 2LR8A 5IOZA 5IOYA 4M3FA 2DA3A 3HB9A 3JRCA 1AHDP 3MVPA 3RQIA 1A5JA 4UUTA 5GPAA 3G1MA 5J1UA 4XRMA 3GTOJ 3BQYA 3GTQJ 4M3EA 1DU0A 4DW6A 4V2GA 1H88C 4IHXA 2CQXA 1ZKGA 2AO9A 5EF6A 3B6CA 4AUXA 2HOAA 4MFEA 3S17J 2XSDC 2N8GA 2QCOA 3TP3A 5DTDA 2D5VA 3JRGA 5E3LA 3HGYA 1PUFA 1F43A 2E1OA 4BKXA 1LFUP 1RKTA 3LNQA 2NOGA 3IH4A 1MBKA 1JJ8C 4CYCB 1RESA 2Y30A 4J19A 2G0EA 4GFBA 3W6VA 3OIOA 2HXOA 4FCYA 5EG0B 4A3JJ 1XG1A 1G2HA 4A3LJ 5EGOB 1WGXA 4V2FA 5J3LA 1GV2A 2R0QC 1JKQC 4UUSA 2YUSA 1IDZA 3PM1A 4C3IJ 5IYBJ 4A3IJ 2K9NA 3OSFA 2DJNA 1H8AC 1EF4A 2R5YA 2XGDA 2LY9A 2TRTA 2KT0A 2JA6J 2CUFA 1JT6A 2EZHA 4DYRA 2X6OA 2MG4A 1ETXA 1HDDC 4MLOA 2E2HJ 4D5CA 1HDPA 4B3AA 1QVTA 5GP9A 1BW5A 1FTZA 3BR0A 3FKIJ 1GUUA 1ZGWA 1TWAJ 1OCTC 3BR3A 1ENHA 2HYJA 1LE8A 4JX6A 1HLVA 1IDYA 2I10A 1IRZA 2DA2A 2M9HA 2DA7A 1W0UA 3ZQFA 1GV5A 4MO7A 1MBEA 2XPUA 1BW6A 1FIAA 1TWHJ 4IEJA 2FD5A 2XGCA 3D1NI 3QPSA 1RPWA 2HXIA 5JLWA 3ZQLA 5IP9J 1H89C 5M5WJ 2GM4A 2DTZA 3GTJJ 3CDLA 2GLOA 3C2BA 4I76A 2DA5A 1O4XA 1RKWA 2VKEA 1AU7A 3ZQIA 3F0CA 3M4OJ 3NAUA 1LFBA 3HOUJ 4FTHA 2FX0A 3IH2A 5HODA 1BA5A 2M8GX 1UHSA 1ORKA 4IHYA 1PUFB 5F04A 3BQZA 2NS7A 5IP6A 3SDGA 2NVXJ 3JRIA 1K61A 3A01B 1NK3P 1RETA 1MBJA 4B1RA 3BT9A 4IHVA 2DMNA 4BBSJ 5F0FA 4M6VA 3HOWJ 3FIWA 4A3MJ 2K9QA 2JA5J 4M3DA 1ZTRA 2LKXA 5JLXA 1F36A 1ZR2A 2ZB9A 3BTJA 2DA6A 1P7IA 3G1OA 3E7LA 3RKQA 1A6IA 2LLKA 2E2JJ 1I50J 3LSGA 2LFBA 1ETWA 4L5EA 3BR2A 3TEDA 2R92J 4A3GJ 5C44J 1P7JA 1VFCA 2WB1N 2XGEA 2DA1A 4W1UA 5FJ8J 5FLVA 2O7OA 3TW7A 3HDDA 2AHQA 4W97A 1HF0A 5FKNA 1AKHB 1T33A 3BG3A 3QQAA 3CQZJ 4C2MJ 2K40A 3HOYJ 9ANTA 2ID6A 4Y7NJ 1CQTA 3H3VK 4UUSB 1JGGA 2DMTA 3WHBA 1MBHA 1WH5A 4XRSG 4MIMA 5E3MA 2X48A 1WH7A 2ELKA 1NTCA 4JP0A 3FK6A 2JJ7A 4JYKA 2NVYJ 4BXXJ 3FK7A 2Y0SN 1JTYA 2E2IJ 2R5ZA 2HDDA 1SFOJ 3K2AA 2YU9J 3GTLJ 1OJLA 1ETYA 1U8BA 2DMQA 4A93J 3RZDJ 5IYCJ 3GTPJ 2CQQA 2QF7A 4I6ZA 1ZQ3P 1Y1VJ 3MKLA 3BR6A 2CUEA 2P81A 3BR5A 1ETKA 4XK4A 3RZOJ 3S16J 3PO2J 5K7ZA 3I4NJ 3BTLA 3DEWA 2ID3A 3SJMA 3UKGA 2ME0A 3S1RJ 2LK2A 1BJZA 2ME6A 5FKOA 1B72B 2DA4A 3GTMJ 4FE4A 3TP0A 2ECBA 3HBLA 5FKLA 5E3NA 3S15J 1SANA 2XPVA 2R93J 3O8GA 4DZPA 4BY7J 5EYRA 2LP0A 5EDNA 3JRAA 5F08A 1VF9A 2OF7A 3JRDA 5BNGA 3S14J 4G12A 1HOMA 2XB5A 2HOSA 1Y1WJ 1JUSA 2VI6A 3HOZJ 2EQRA 2L7FP 5IP7J 2L0KA 4LOCA 4BY1J 3OSGA 2PMZN 2JN6A 2XRLA 2HOTA 1POGA 1LE8B 1HCRA 1D5YA 1JT0A 2LVSA 1IUFA 4QSHA 2B63J 1JUPA 2JK3A 2WV1A 5K7HA 4C3HJ 1GVDA 1JTXA 1Z0XA 4XIDA 1JKOC 5M3MJ 1FTTA 1GT0C 1YRNA 1WPKA 4JX4A 3ZQCA 2JA7J 1OCPA 1MSEC 3FISA 2DMUA 2VPRA 4A3FJ 1VI0A 1R9TJ 4NDLA 1ETVA 4HNVA 3HM5A 3HEFA 1JKRC 3HOVJ 2OPTA 5F0HA 1T56A 2NVQJ 3JRFA 2W48A 3Q0UA 4A3KJ 5EEAA 1JUMA 3SFIA 2L7MP 2DN0A 5C3EJ 1FEXA 5FLMJ 2L7ZA 2M34A 2HQ5A 5DS9A 2H8RA 5IPAA 1IG7A 2YS9A 1RR7A 1ZR4A 3GBGA 1X2NA 1FJLA 2MGQA 3A03A 3A01A 4B4CA 3NARA 1WCMJ 2Y31A 4DYCA 1E3OC 5F0CA 4BBRJ 1B8IB 4X1EA 3DCFA 2CJJA 4A3BJ 5C4XJ 2JA8J 2MW8A 4C3JJ 4QTRA 3ZQHA 3S1NJ 3CMYA 4A69C 2R5ZB 4FE7A 1QVUA 5EZHA 1Q1VA 2H1KA 3I4MJ 1XC5A 2EZIA 1MH3A 5FKKA 5K7FA 2LTPA 3BTCA 2JMWA 4EEFG 4D7MA 1WI3A 2RAEA 1UG2A 1AKHA 3Q0WA 1NK2P 5EZGA 2M0CA 2IAIA 3LSJA 3IV5A 2JWTA 1YRNB 4X6AJ 5FKMA 3CCYA 4S0HB 2MSYA 4ABZA 5M5YJ 1TWFJ 1W0TA 1U78A 1MBGA 1IV6A 3ZQGA 2VKVA
chains in the Genus database with same CATH superfamily
3TGNA 4P9FA 3KEYA 3K1MA 2CYYA 3BG5A 2KFDA 1FIPA 1O57A 3BG7A 4MFDA 4UV8A 2DW4A 1IGNA 1W7PB 5J8CA 1LNWA 2BW3B 3O8HA 3OYHA 1ZN2A 1JJ6C 3BTIA 1PJRA 5FD5A 2O8KA 1IRGA 3HOXJ 4OIOF 3NWSA 1TWGJ 3LFUA 2DU9A 4HDUA 2EA2A 2DK5A 3HRSA 1BN5A 1QPIA 4UNOA 2BE5F 1Z3YA 4Y52J 5E18F 2EZLA 2STWA 3CJNA 4F3QA 4E6KG 4ESBA 4HW0A 2PMUA 3OWTA 1DU6A 2COBA 4AIKA 3S8PA 2LDUA 5EG0A 2HR3A 4GRIA 3QPLA 1MMNA 3BG9A 1K83J 2ZKZA 2ZO4A 3HZJA 3IH3A 4ZZLA 5M3FJ 1P4AA 4A3CJ 4HYEA 1E3PA 4N9HA 1OR7C 3HC7A 2Z5UA 1U9NA 3TW6A 2H09A 2R7DA 1X4OA 2IGMA 3N4MA 1E3HA 3WTVC 1YTYA 1O3RA 3JRHA 4BQAA 5IT9Z 5CVIA 2JPCA 4IOAF 3ZXSA 3HRUA 1UELB 1TP4A 2CRGA 4L0YB 4NC8A 1CGPA 5FROA 4HLYA 4ZYGA 4XSZF 5F1JA 5K5OA 2HDCA 4XLFA 3CDHA 2XB0X 1IF1A 3BOQA 2IT0A 2VODA 4YFKF 2PJRA 2FRHA 3I53A 5ICEA 5DCMB 2VQHA 2KDZA 1A04A 5JR3A 4XLCA 3BZKA 3SEQA 1ZRFA 4I2OA 4FASD 3L2CA 1FOWA 3TL4X 3O6BB 3WGIA 2DFEA 4AM3A 2A6HF 1T6SA 3FMQA 3Q3SA 5JI6A 4G8XA 5DUIA 1TC3C 4EM2A 2OU2A 3E6BA 5IOYA 2DA3A 4HX7A 1AHDP 4CHUA 4OMYA 2DPDA 2PQ8A 3L09A 3RQIA 5GTIC 1RIOH 2V1DA 3G1MA 3CO6C 2Z99A 3G6EI 3KP2A 3K2ZA 4M3EA 3F8MA 2FOWA 4XLPF 1YI2I 4YELA 3GCMA 3ASNH 2VB6A 4V2GA 3REOA 2CQKA 3RYPA 3ERED 2YSRA 2DDBA 5EF6A 3GZNB 4AUXA 4KN4X 5HLIA 2N8GA 3TP3A 1T38A 1TL8A 5D5UB 4JQFA 2V79A 1WJFA 4M72A 1T2KA 4EJVA 1X1BA 4C9YA 2IP2A 2QSHX 4YFNF 4U7DA 2CGPA 1XD7A 3Q9VA 2CW7A 2F4OB 4L9VA 1K7AA 1MMDA 3K0LA 4U7BA 3JSOA 1SFEA 3LNQA 3V42A 3BPVA 2LF7A 2IGOA 2X1DA 1R36A 1HW5A 4QPOA 3WG7H 1QBJA 2W00A 4R1HA 4J19A 4V19K 3W6VA 3WTZA 2M4KA 3M07A 4B3XA 3CCRI 2XGXA 1IO2A 1MMAA 2Z16A 1KU3A 4A3JJ 1GLNA 4BAYA 3LSIA 4V2FA 3W6KB 3AG4H 4N0BA 3GF2A 4PFOA 2RKHA 1MGTA 1U6GA 1A6QA 2WTEA 4DNCA 4Y15A 3AL0B 3OYNA 3LMMA 4ZDLA 2G7UA 5KAIC 3I59B 3DU5A 3B73A 1XB4A 2YUSA 4C3IJ 1JXSA 2ZNYA 3OL3A 2VQCA 5TISC 4GCVA 3OS2A 1RI7A 1W7PA 3ZCOA 1S8NA 1R6RA 2LY9A 1ZG3A 2X0LA 3RKYA 5IT9K 1YYVA 2CFOA 3HTUA 3FXUA 2MH9A 4HSRA 4A0YA 4ZTJA 3CUQA 3ZP5A 1ETXA 3BJ6A 3VYRB 4YEJA 4U0VA 5GP9A 1FTZA 1SD5A 3V7CA 2R7UA 3BR0A 3WU1B 1GUUA 2BBYA 1OCTC 1Z6RA 3JW4A 2AS5F 4JX6A 3MKYB 3CCJI 2CS3A 1IRZA 2YX7A 2DA2A 3TMOA 3A4CA 3TOBA 2LH9A 3SXYA 3EUAA 5D5VB 2GAUA 1ZG1A 1GV5A 2JSPA 4MO7A 1D0ZA 1TLHB 4HLXA 1OPCA 1BW6A 3T0YA 5HNHA 1FSHA 5E17F 5IP9J 1KU9A 4LMYA 3GTJJ 1S9HA 2GLOA 1GXQA 2V9VA 3AG3H 1O4XA 4G7ZF 1AU7A 3ZQIA 1LFBA 4RB1A 2GOXB 5HDKA 1XDSA 2DT6A 2FX0A 3WE2A 4FTHA 1QQIA 3IUOA 1J59A 1ORKA 4RM2A 3CCSI 5ED4A 5F04A 4XLHA 1E2XA 5IP6A 3SDGA 4WWCA 2NVXJ 3JRIA 3DPUA 2J5PA 4EATA 4XLEA 2VJ4A 4AYBA 1WJDA 3FMSA 1QNTA 1RETA 2D2WA 4BBSJ 4A3MJ 3C2HA 3RQ4A 4M3DA 1ZTRA 3BJOA 3TOAA 2VLAA 5FO5A 2ELJA 1F36A 3RI4A 3H5RA 3C2GA 2ZB9A 3HHHA 2HS5A 2Q8KA 2H94A 4O3MA 2E1MB 2R7SA 1YX5A 4F55A 2KQRA 4L5EA 2L3DA 3E6CC 3KX2A 4OIQF 2FSWA 3AL0C 3BDDA 5C44J 2UV1A 4YG2F 2R7RA 5GADJ 3LL7A 2XGEA 3K1PA 3PNVA 3P7NA 4M9ZA 3TW7A 5F1RA 3EDPA 5CKTA 1D1CA 4I09A 3CQZJ 4C2MJ 2EPFA 1YOVB 4CCLA 2F2EA 3HOYJ 9ANTA 4KMUX 3LSMA 4Y7NJ 1X3WB 1CQTA 2HVQA 1VQ6I 2FNPA 3FM3A 2OTJI 3GX4X 4BJ6C 3PSFA 1MBHA 1WH5A 5E3MA 1HKQA 4UXNA 3OV8A 4HNUA 3KEOA 4BNCA 2IXSA 4JP0A 1RC9A 3TO6A 5LFAA 1LVKA 1MJAA 1X1AA 2NVYJ 4A5NA 2ZFWA 3FK7A 2Y0SN 3K1NA 2OAZA 2HDDA 1SFOJ 2YU9J 3GFMA 1ETYA 1U8BA 1U0JA 1V4RA 5D5XB 4B47A 1LVAA 2Y69H 4LLLA 4H4KC 1OCCH 4BDYA 3MKLA 1LEBA 4XOPA 2EV6A 3BR5A 2V7FA 1V54H 5FLXZ 1FP2A 1R4NB 3SZPA 3PO2J 3I4NJ 5K7ZA 3WU2C 2R7OA 2NVUB 3F8CA 1HSTA 3S3OA 3MCZA 3CUQB 4RAZA 1WKMA 3RKWA 2L5QA 5BPIA 3DPTA 2XC7A 1HXDA 1XMAA 5FKOA 4JK1X 3FXOA 3K70C 4PUSA 3KETA 4FE4A 4OWRB 3JCUC 1HKTA 2ECBA 2KJCA 2R93J 3IHUA 3KP6A 3WGGA 2RQQA 2XAGA 2PI0A 3MWMA 2EFQA 2WADA 2Y0SA 4LD5A 5TGTA 2PEXA 4XORA 4MGRA 5KVRA 2OF7A 2OCEA 1HOMA 2P7VB 2WC2A 4G12A 1Y1WJ 3LQQA 3Q5FA 5IP7J 2BYVE 3QP5A 4UUVA 2JN6A 3OIPA 4RGUA 5D8KB 4BHCA 2HOTA 3T5XA 3TDZC 4DBRA 1ULYA 3O3KA 3CUOA 4ZDOA 2UWMA 1TNSA 2VJIA 4CCJA 4HG2A 5BPDA 2B63J 2BXZA 2WV1A 2OC6A 1X1DA 1ZARA 1D1AA 4EVIA 1WFXA 2LKPA 1FNNA 1XMXA 5E20A 1FTTA 4PGGA 4Y33A 1HSJA 4Z2YA 2YU3A 3WE3A 1WPKA 2BZTA 3ZQCA 3HRMA 1EH6A 2OD5A 1MSEC 1XTAA 1NHAA 2DFFA 2K9LA 2PN6A 4A3FJ 4RM3A 1D8JA 1SD6A 1T0FA 5KK1A 2OPTA 1YS6A 4A0XA 3OOPA 2KIFA 1LB2A 1IN6A 1TT0A 4O6JA 1OKRA 3F3XA 4BYYA 1M1EB 3BP8A 3FZVA 1UJ8A 2W1OA 4HEA2 1ZR4A 4NUBA 2DT5A 2ZMEC 4XQFA 3K4KA 4CA0A 4MEYF 4B8XA 2A6TA 1Z67A 5ICGA 3J81K 1FMWA 1B8IB 2K4BA 2JPBA 4I0BA 3QRFF 4A3BJ 1VQ4I 1S3JA 3L00A 3R6SA 2VC0A 5C4XJ 2Z1DA 3F72A 2F5CA 4ZYEA 2O03A 3CMYA 1PYVA 4YFXF 3HOSA 3C1DA 2QZ8A 1Q1VA 1FYLA 3I4MJ 1X19A 4ENMA 1XC5A 2EZIA 1MH3A 3HKZA 1DPUA 1BIBA 3JTHA 3OYEA 1KA8A 5J8FA 2DI3A 3BJAA 2LTPA 4Y4RA 2GXGA 3G2BA 2X6WA 2E1NA 3PFYA 4MHGA 1X3UA 2F5EA 2M0CA 4L5JA 3LSJA 3IV5A 1SMTA 2KKOA 5FKMA 5M5YJ 2H1LA 4HA8A 1UFMA 3KIOA 1NG7A 2MLGA 1MBGA 5CLSA 2VASA 2ZXIA 2LOOA 1SD4A 1WI9A 3F6OA 5E3OA 1F1ZA 2ESHA 1ZREA 2J5OA 4D7NA 3FBNB 1QZZA 2NS8A 1WSUA 1GDTA 1IXSB 2K9SA 1EH8A 2FOKA 1ZK8A 1D3YA 1VZ0A 4HX8A 1A36A 3GMEA 3BLYA 1DGWY 3J7ZI 3VWBA 3GLXA 1YJ9I 2MD5A 2FQ3A 1LJ9A 1S7AA 3LWFA 4A12A 4JBAA 4S05A 3VDXA 2DQLA 3ROUA 2QBYA 2XSJC 2H6BA 2V6CA 3OYBA 2KLOA 3GUDA 3CP2A 2JZYA 3GXOA 1JKPC 1X3ZB 4OIPF 3BROA 3CMMA 2PFBA 4EM0B 1MDMA 1JHHA 1H9GA 4BXFA 1T39A 2HI3A 3CCMI 4ZTFA 1E17A 1B59A 3HTSB 2X1CA 3LOCA 2KPMA 2BXYA 2GWRA 3J7AY 4XLNF 5EGOA 1MH4A 2ECCA 2Y9ZA 4XLAA 2W85A 2PMZA 5H6QA 4QWQA 4D5FA 2TDXA 2QKMB 4FISA 2Y2ZA 4E7HA 3JREA 3F21A 3MZYA 1S7EA 2M2EA 2VN2A 2WAQN 2WY7Q 2X51A 3QYEA 1ZLKA 5J4YA 3L1PA 3OS0A 2FJ1A 2MLKA 2PBIA 2HQRA 2HDWA 4AC0A 2LD5A 3PO3J 5DM7F 5M5XJ 5A2QZ 2H27A 2IS2A 4JX5A 3LSKA 4XICA 1TWCJ 2V26A 1APLC 3WTXC 2ZC2A 3OYKA 2YX4A 3Q0VA 2MC4A 2LY1A 2DMPA 2P8TA 5EEGA 2R7ZJ 3H0GJ 1OYIA 3FDYA 2CU7A 4P1WA 2LR8A 3ZOBA 1U3EM 3M8FA 2HPMA 1J09A 1WJBA 2G7HA 1ACIA 3JRCA 3HB9A 3WTTC 3MVPA 3AG1H 3ZMZA 2NNNA 3WU0A 2DTRA 4UUTA 3CJTB 3FM5A 5HLGA 3BQYA 2RC4A 1BI2A 1DP3A 3F9KA 1BI0A 2KJBA 3HSFA 4DW6A 4D9JA 3I54A 4IHXA 6PAXA 3MD2A 5HOOA 2YR2A 2CMPA 2EINH 1NG6A 3B6CA 1D0YA 4BJ5C 2HOAA 2A5YB 3DF8A 4MFEA 3S17J 2EV5A 5AIQA 5DDGA 3AG2H 2QYOA 3FXLA 3PUFA 2CG4A 2KRFA 1EH7A 5E3LA 3MMYB 1UB9A 2F48A 5KNLA 4L18B 1F43A 2E1OA 3QU6A 1FBSA 2UXXA 2R7WA 4LIVA 1KONA 4IRHA 3BC8A 2NOGA 3SYTA 3IH4A 3MZHA 1OMIA 2L4AA 4IVNA 5HS8A 5JVGF 3E5UA 2Y30A 2VKDA 3WODF 4AIHA 1WJCA 3OIOA 1G3WA 3R4KA 4FCYA 1W5SA 4CGZA 1T8IA 5EGOB 4XN3A 3L2UA 4KMFA 2VBXA 3KCCA 2W24A 5J3LA 1GV2A 4BE2A 2IRFG 3E5QA 2DOAA 2DJIA 4WXHA 4FETA 1OYYA 2Z3YA 1OR7A 4ETSA 4MTEA 3IAM2 4KJZA 3PM1A 3R61A 3SDBA 3KE2A 2CQNA 1FYKA 3VB2A 4A6DA 1S7OA 5LHIA 2BY0A 3LA2A 2R5YA 2KP6A 2DCEA 4IQJA 3K69A 2RDPA 2TRTA 3E5XA 4C2TA 2M7BA 4IO9F 3NWTA 3OYIA 2EZHA 4DYRA 2X6OA 3WTYC 1HDDC 1FOKA 1AOYA 1HA8A 1RZ4A 2OCCH 2CUJA 1BW5A 1XCBA 3FKIJ 4AVPA 4MQVA 2XUBA 4D1QA 2EFPA 2IVMA 1PDNC 4LGWA 1W1WE 3GW2A 1DGRM 1KU2A 4LB5A 5FFXA 2M9HA 5BS6A 3H9JA 1VQ8I 1MMGA 3DTIA 5D8LB 3DPLC 2QQBA 2MD0A 2LRDA 2ZFUA 4ZDPA 3RSNA 2AQEA 2XPUA 3HRTA 3H92A 2FD5A 1R7JA 1N75A 1BM9A 3QPSA 1RPWA 3GZ5A 3ZQLA 1H89C 1FC3A 1YE9A 1VQNI 3ZMUA 2BY2A 3ABLH 3CDLA 4RAYA 5GAHJ 3I56I 2C6YA 2DOFA 3HHGA 2ZBKA 1DQUA 5LLQA 1KQ8A 2MC3A 2RNGA 4H0EA 3NAUA 4Q4ZF 3E3VA 2XF5A 3IH2A 5HODA 2VBYA 4N9IA 1DP7P 4KN7X 1PUFB 3L2WA 1L3LA 2HTJA 3SEZA 1YG2A 4EM1A 1WWXA 3CMAI 1NK3P 4P55A 1U8RA 4IHVA 2DMNA 5F0FA 4CSWA 2V9KA 4U88A 2VBWA 2K9QA 1P4WA 1ZG5A 4U0WA 5DCMA 2LKXA 5JLXA 1UG0A 2V6EA 2F5FA 3LSHA 3GWZA 2F6CA 3E7LA 4WXCA 1A6IA 1W5CC 4KIBA 3IL2A 2E2JJ 3OR1C 2ZXHA 5LGUA 1SEUA 2XF6A 2OJED 3K4LA 4DOZA 3BR2A 4HSTA 2UZKA 3QODA 2ADUA 3TEDA 2EJRA 2R3SA 3KP3A 4A3GJ 3S3NA 2QSFX 1RNLA 3P9IA 1P7JA 2WB1N 5FRNA 2FMYA 3GFJA 4W1UA 3CC2I 5CVRA 1QU3A 3M9AA 2OUMA 3FXRA 3CLQA 4CCOA 2QSGX 5FLVA 2O7OA 1V3FA 5FKNA 1AKHB 4HV6A 3BG3A 2COMA 3QQAA 3VODA 3L2VA 4HBLA 2K40A 3F8NA 4R79A 5HDGA 4BHBA 1YHQI 2ID6A 4ENNA 4UUSB 1SVLA 3WHBA 4RA2A 4XRSG 4HV5A 1MNEA 5ICCA 2GXBA 2JJ7A 2HEOA 4BJTA 1USSA 4JYKA 2IGNA 1ERDA 1XSDA 3PNYA 4PDKA 3GZ6A 3DWLE 2L01A 3G3ZA 3UNGC 3VFZA 3K4CA 1N25A 2UXNA 4XOTA 2EFWA 3VSLA 2PJPA 1T08B 1OLTA 4EJWA 1TW3A 4YIFA 5IYCJ 2QF7A 3ABTA 3I64A 4I6ZA 1ZQ3P 3J80Z 1BBYA 2CUEA 2XDVA 2P81A 4BEHA 5KAFC 5D4RA 3VEPA 4E7LA 1ETKA 4NQWA 2V1NA 5LGNA 3S16J 4LK0F 1DDNA 1R71A 3RPQA 2VJJA 2ID3A 3UKGA 2NOJB 1OCRH 3S1RJ 4R8HA 4LLGF 5E1XA 3EYYA 3MZ8A 1HBXG 2D1VA 2LK2A 4C2UA 2BEOA 2M7AA 1BJZA 2ME6A 3K4NA 1B72B 3KEQA 2ZJRF 4PFPA 1I39A 3HBLA 3UR3C 2LYCA 1VQLI 4CYDA 1U5TB 5CVUA 2L2OA 2QBYB 4BY7J 2HOEA 3JRAA 3MQ0A 1OISA 1HW1A 4G6QA 2LNBA 1VF9A 1BR1A 4I02A 4HNTA 2HOSA 2KIQA 2AXLA 5LGTA 4BY1J 2DFHA 2ZMEA 2V4JC 4HF0A 2VKHA 4ESFA 5CJ9A 5KCMA 3S3MA 1JT0A 2LVSA 5AONA 4QSHA 1R1TA 3JAMK 3H9QA 1JUPA 3SFZA 3ULQB 5K7HA 3J7AO 2HQNA 1F5TA 4IQ4A 4C3HJ 4S04A 1JTXA 1T0FC 3X2QH 1JKOC 4ZYDA 3C7JA 2R7QA 1TBXA 3FBIB 2KHMA 2HFHA 4CO8A 3CD6I 1J9IA 2CV2A 4JX4A 3H1CA 2JA7J 5K5QA 3DKYA 1R9TJ 1OCZH 2CW8A 4NDLA 3HM5A 2M30A 3HEFA 1FMVA 4XONA 5TRDA 1O3SA 1Z91A 4UVAA 5GTHC 3V8KA 4B44A 5F0HA 3RPUD 3WG9A 4QPQA 3Q0UA 3ZMDA 4A3KJ 2GZWA 1JUMA 1FOYA 2DN0A 3L2RA 2LG4A 2RQPA 2WAEA 1H9TA 4MQ9F 2FUG2 4IX7A 2XAQA 2M34A 1Y39A 4Q48A 3KLOA 5IPAA 2YS9A 4Q47A 2KISA 4PJMA 5B1BH 3ONQA 1PVEA 4YIIA 2UUZA 4B4CA 2Y31A 2BVLA 1YITI 1XSVA 1R5GA 3I5UA 1UHMA 1Y56A 2JA8J 3RKXA 2DYRH 1FSEA 5FB2A 3K4MA 3FMRA 2E5NA 3S1NJ 4KISA 2NYXA 2R5ZB 1YLFA 1QVUA 4RAFA 2V9PA 3ELKA 4PJNA 2E1MC 1Z9CA 1LFPA 2ETHA 1YS7A 1KZHA 2DPUA 2E1CA 3DP7A 1QZEA 4D7MA 2IS1A 4GXOA 1SVMA 2LBFA 4HX4A 1WI3A 2RGVA 3FHZA 1IRXA 1UCRA 1UG2A 3H3ZA 5EZGA 1SMYF 4CDGA 2IAIA 3CO7C 2O8XA 5EEHA 1YRNB 3CC4I 5H6RA 3CCYA 4S0HB 5B3SH 4U87A 4UB6C 4ABZA 4EV0A 1W0TA 1U78A 3OL4A 4RGSA 3ZQGA 2HVSA 2VKVA 3VOEA 5LEKA 2AQFA 4G9YA 4O5VA 3DEEA 5ERIA 4CICA 1I6HJ 1ONVA 2HZDA 3HUGB 1K78B 4MTDA 2HWVA 2CH0A 1XS9A 1VQMI 2E19A 2KRHA 2W84A 3GTGJ 1FP1D 1TTYA 1L0OC 1BR4A 4XRSA 1B8IA 2QENA 2X85A 3U21A 5C4JJ 3B02A 2GBYA 2EV0A 1BIAA 3BR1A 4KT6A 2HYGD 2L9RA 4LIUA 3CJQB 3OOUA 4AVZA 4NBQA 3HPGA 2K5CA 4HF1A 2CO5A 2QM3A 1F4KA 3GTKJ 3HGGA 4M3BA 1BL0A 3S1QJ 4CXFA 2XIGA 3BWGA 4IXAA 4DZJA 3NEUA 4M9SA 1B72A 2ZJPF 2EK5A 3EUHA 4M3GA 3LSPA 2IA2A 5FLXK 3B6AA 2ESNA 1YW8A 5CYVA 1HQCA 5GPCA 3OYFA 2GXAA 1V55H 3VPRA 1G6NA 2QVOA 4DQ2A 1I3AA 1BC8C 1MBFA 2X9DA 4N4OB 3HIFA 3HPHA 2EBIA 5F64A 1X58A 2LY2A 2HKOA 4DYQA 4DJAA 2IW5A 1C0WA 2Y9YA 3DLAA 3JTGA 5IYDJ 2WAQA 4M74A 4E7JA 1FYMA 4LK1F 5L3CA 1MSFC 4QIWN 4L9JA 2JTVA 3K6GA 3RYRA 3QPTA 3BCAA 1KQ9A 1ETOA 5K1YA 3E6MA 1W4MA 1G59A 4IHWA 2H8WA 4UHTA 1R1UA 4EJOA 3ZN0A 2VC1A 1XCVA 1T98A 1SFKA 1VTNC 1X2MA 4HDVA 2MYSA 1MNMC 4BE0A 3ECOA 5HLHA 3T1BA 3M3YJ 2VPLA 3K7AJ 2XV4S 3HKZN 3JRBA 1QZYA 3LSRA 4PJLA 1K4SA 4M6XA 2EZKA 1REPC 2Q0OA 3S2HJ 3TO7A 1P6RA 2DT7B 2JRMA 2M0MA 3L2QA 1YQAA 2A3SA 4PSWA 3ABMH 3I0TA 3IKVA 1IJWC 2XPWA 1Y8QB 1MD0A 4BQQA 5IOZA 2F5DA 4M3FA 1IUYA 2E71A 3V4GA 1EJ9A 4D0PA 3F6VA 1B9NA 5LD2C 1JE8A 2V1UA 2F4IA 1O7LA 5J1UA 4XN0A 4XRMA 3GTQJ 3KYDB 4GGGA 1DUXC 5ILSA 1UAAA 1IXCA 2PG4A 1ZELA 2HNHA 2I5UA 4B09A 3KZIC 3LSTA 4YIRX 1WJEA 2XSDC 2A5WA 2QQAA 1S5LC 1FT9A 2ZXJA 3S32A 3I4PA 2HQAA 2ZSIB 4FT8A 3F23A 3JRGA 4GYGA 3LQRA 2YPRA 4FHTA 1X1CA 3HGYA 1PUFA 3EUKL 1LFUP 3J80K 2RREA 3ERMA 5B5EC 1RKTA 3PFIA 3NRVA 1D1BA 5L3FA 1FBQA 1JJ8C 4CYCB 4GFBA 2NXNB 3H3UA 4AU7A 3C3WA 3W2AA 2HXOA 1XG1A 4A3LJ 1XDUA 2M3AA 1WGXA 4B48A 4RGXA 2HU9A 4GYIA 3PQKA 2R0QC 2O5RA 4HOBA 1V5GA 1B6AA 3ESWB 1TQIA 4A2UA 4BHPA 2WV0A 4A6EA 2LSOA 5HVQC 4BEHB 3H36A 4BGDA 1IN8A 2BHZA 4OAZA 4A3IJ 2K9NA 2KRCA 4G94A 5BOXA 3KYCB 2M1BA 1WQ2A 2ELHA 3ZMTA 2XASA 1ON2A 4ZC3A 3HXLA 1EV7A 2L9VA 5LRRA 4CCNA 1IN4A 2X4HA 2KT0A 3BCBA 2JA6J 1K4TA 4KNYA 1IW7F 4KIGA 3M8JA 3HUGA 1K78A 3OIQA 4MLOA 2CSOA 1W36C 4LFUA 4B3AA 3D0SA 2R7VA 1P2FA 4Y17A 3BR3A 1ENHA 3JAMZ 1XGMA 1LE8A 1HLVA 2R7TA 3LFKA 2I10A 5E1ZB 1ZLJA 5F6FA 2DA7A 4MEXF 3F22A 3CJRB 2VE8A 4L9TA 2VOPA 3IP4B 1MBEA 2GQQA 1FIAA 3WTSC 1IN7A 3CCQI 1O3TA 2XGCA 5DUKA 3PJRA 2HXIA 4CUGA 5JLWA 2KZVA 4CZZA 3FF5A 3OYAA 1ZHFA 2DTZA 2GM4A 2P6SA 3H0DA 3C2BA 2GIZA 3MAJA 4KITB 4I76A 4LB6B 1J75A 1TT5B 2DYSH 1RKWA 2VKEA 3CCUI 2P7CB 3M4OJ 3OYGA 4PK4A 2FEZA 4HQMA 2JUGA 2E36A 4EJTA 4IHYA 2JT1A 2ACJA 3QYBA 2VONA 4EMSA 2NS7A 1FBUA 1K61A 2XHKA 4PCQA 3SZTA 3KP7A 1IRFA 4IPAA 5LHGA 4B1RA 3HJEA 2BOLA 2KMUA 3FIWA 3FHNA 4BE1A 2Z2SB 3HOWJ 4I0AA 3KZYA 3U9GA 2JA5J 2P5KA 3E6DA 2PX9A 1ZR2A 3CESA 3BTJA 2DA6A 2MA3A 5A2QK 1K6OA 3G1OA 3LAJA 3E97A 1Z05A 2E7XA 3RKQA 2CWEA 2LKSA 2L02A 4RS8A 3VYSB 3MFKA 2LLKA 2DDAA 3LSGA 2LFBA 1ETWA 4ZH4F 2JRTA 3KP5A 1H0MA 2R92J 2P0WA 2Y0MA 1Z6TA 1J7KA 2L9NA 3EPZA 1MMSA 2R7XA 2STTA 1J2XA 2DA1A 3SHFA 5K5RA 5DEQA 3VSKA 4IJAA 1U2WA 3HYIA 5DCFA 4A0ZA 2DOEA 3IKTA 4W97A 3BG6A 5D5WB 3F8BA 2K4JA 2M8EA 2VE9A 1JGGA 5L3DA 2LMDA 4AIDA 2CV1A 4BU2A 2GIVA 2X48A 5IY5H 2ELKA 2PJRB 2QGUA 1R58A 5HNFA 1PP8F 3H9GA 1D0XA 2HZTA 2R5ZA 2DO7A 4FQGA 4C30A 1VQKI 1D5VA 3GTLJ 2EIJH 3LA7A 1JGSA 4XL9A 2H6CA 5DV5A 2CQQA 1BOAA 2ICWG 5FFZA 1D8KA 4NB5A 4RAGA 2X1EA 3V7SA 2R4GA 1YW9A 4F92B 4WK8F 1MW7A 1P92A 3SJMA 2ME0A 1R49A 5DYMA 2IA0A 2KIMA 4NQWB 3JSPA 3BZ6A 1Y8RB 4NC6A 3EUHC 2VIXA 2P4WA 2DQRA 3OS1A 4LLNA 2EIKH 5E3NA 5J4VA 1SVOA 1K6YA 4BQOA 3S15J 2XPVA 3I58A 4IOCF 3K9TA 3MKZA 2NAZA 2ISYA 2WY8Q 2LP0A 5EYRA 3Q9SA 3C18A 2W7NA 3P5JA 4EGYA 5F08A 3U2RA 4XNFA 3JRDA 5BNGA 3ZMSA 1JUSA 3DU6A 4E7SA 3LAPA 3HOZJ 3BZCA 4LOCA 3CC7I 1R4MB 1PP7U 5J47A 4E4HA 5E79C 2GA2A 3ZMVA 3R0JA 2VQLA 4UVBA 3CMEI 1POGA 1LE8B 2AXTC 5JFRA 5TJJA 1D5YA 2A05A 2BGCA 1HCRA 1J5YA 1Y0UA 3I55I 1IUFA 2RVCA 1ODDA 1KQ0A 1ZYRF 1Z7LA 2XAUA 3ECHA 3FWEA 2A69F 5B66C 4PZJA 2EIMH 4Z6YA 2ZMEB 2XAHA 5CQGA 1TW2A 2BV6A 1GVDA 1SFUA 4XIDA 4MNUA 3IWZA 2W25A 2FU4A 4CCKA 2MBFA 4ITVA 2VT2A 1GT0C 4RGRA 2VXZA 4RMNA 1OCPA 1KYZA 3FISA 2DMUA 3ZN1A 4HF2A 4G7OF 2VPRA 4OAYA 2WAFA 3FXQA 2QEXI 3OYCA 1OQYA 4BL0B 1JKRC 2K9MA 3HOVJ 4X0GA 4WXDA 1BR2A 5EJCA 3JRFA 2W48A 2HVRA 5EEAA 1CF7A 5H20A 1IAWA 3DXJF 3SFIA 2L7MP 1FEXA 4F93B 1X1PA 4WX9A 2L7ZA 2JSCA 5DS9A 2Q2EB 1Z1DA 3ABUA 3ISPA 3GBGA 1FY7A 2ZJQF 1X2NA 1UHWA 2MGQA 5J40A 3A03A 4OMZA 4AIJA 4G6DA 2M4GA 2E7WA 1WCMJ 4DYCA 2IPQX 4HPQA 1E3OC 2B7EA 4X1EA 3DCFA 2CJJA 4G6TB 3AFHA 4IKFA 1Z3XA 5CVVA 1RRJA 4TV7A 2VXDA 4C3JJ 5LHHA 3WGHA 2FNAA 2XAFA 3ZQHA 2O3FA 2Y75A 4FE7A 5GAGJ 4NC7A 3OYLA 5EZHA 2H1KA 1Z7UA 2JVHA 3M1CA 1T95A 3D5RC 1X4PA 4I7HA 5FKKA 1BI1A 5FD6A 5K7FA 2A07F 3BTCA 2JMWA 4EEFG 1W36D 3PQJA 4M73A 3DEUA 4CH7A 5BMZA 4IHSA 4BXUA 4A5MA 1YIJI 2FF4A 3M1EA 2RAEA 1AKHA 1QHHD 3Q0WA 3U1DA 2JWTA 4Y13A 4J00A 2IGKA 3R60A 1FZPB 1ZRCA 4LG0A 1IV6A 2BW3A 2M5WA 4A3EJ 3QOEA 2JUCA 2ZXWH 3ML6A 1P9QC 3ZGKA 3KYLA 3QP6A 4II3A 2E35A 2EFNA 5B1AH 2M45A 4IRIA 1QRYA 1OFCX 2M87A 5ICFA 3DTKA 2OA4A 1U9OA 2R5YB 4PJ0C 1P4XA 2IS6A 4L9NA 3KPHA 4CZCA 3S2DJ 2W4SA 1ETQA 3S1MJ 1XGSA 1JI8A 3MN2A 1IC8A 1SD7A 4FX0A 3VYUB 2P5LC 1HC8A 5J1YA 1ITYA 1F9NA 3DBLB 2K02A 3RIRA 2OTLI 1VQ9I 2NRAC 4HAMA 4P96A 1WZ2A 1USTA 1YO5C 3CF2A 2KDOA 3I9V2 2EH3A 4CYCA 3HG9A 1I3QJ 2QKLB 3WHCA 4GO1A 4RBOA 4DIQA 3KZZA 1LUJB 3P9CA 1QO0D 1UMQA 3DQVC 4M71A 5J1RA 1VNDA 2MFZA 3E1SA 4KDPA 1R00A 2B0LA 2XROA 4XBFA 3AKZA 2ISZA 5F27A 4AYBN 4XR6A 4DBQA 2VBZA 4AWXB 2OQGA 1AA7A 2IBDA 3A02A 3CLOA 2CV0A 4A3DJ 3J81Z 3J7YJ 3L7WA 1G8XA 3FX3A 5JHUA 2QA4I 2O9LA 4AD9A 3W2WA 1Z77A 4LJZF 5E8GA 3COAC 1N78A 3N97A 4RDUA 2A68F 3KFWX 3TBIA 1Q1HA 3A0HC 3G1LA 4F91B 3PIOF 1A31A 2K3FA 3H5NA 2FQ4A 3EYIA 3FKJA 5CVJA 5GAEJ 1FPQA 4EJUA 5L3EA 4WCGA 2VUMJ 2NVTJ 2LREA 4BUPA 2TCTA 5HDNA 3JR9A 1ZRDA 2OBPA 4LG0B 2L4MA 3HSRA 3I3LA 3IRRA 3CTAA 2CW0F 2IEKA 1YJWI 4NHJA 2I8DA 3CCEI 1RUOA 4M9XA 3SQNA 1G4DA 3GVAA 2F4MB 2VT3A 1MKMA 3PL8A 1VQ5I 5DM6F 1A5JA 5GPAA 3GTOJ 2K27A 1XSXA 1MJ9A 2P5VA 2NNYA 2DAOA 1DU0A 1EA3A 1H88C 2CQXA 1ZKGA 1TQMA 2AO9A 5DD8A 1W5TA 2F5VA 3OR2C 3GYHX 2QCOA 5DTDA 1Z21A 2CFXA 1YW7A 5D4SA 5FRMA 2D5VA 1I5ZA 1U5TA 2OQRA 3GEZA 3KP4A 3MEXA 3TDUC 1TZLA 2VL8A 4BKXA 1FWZA 2XF7A 4F52A 5D6EA 4J01A 3RDIA 2WB1A 3IC7A 3DV8A 1MBKA 2P6TA 4BS9A 4XSXF 3OMYA 2ZSHB 4HRIA 1RESA 2G0EA 2Q2EA 3QWLA 4U0YA 3GO5A 5EG0B 4K2EA 3WTUC 2HGCA 4RLQA 1G2HA 4XRFA 4IZZA 5HLTA 3W6JB 1LKXA 2XKPA 4ASNA 1JKQC 2K3PA 2E60A 1KU7A 4UB8C 4UUSA 3IRQA 4LITA 2BY1A 3TQNA 2Y48A 3A1YA 1HKSA 5FGMA 1IDZA 5IYBJ 2Z9OA 3OSFA 1WHUA 3GLLA 3QAHA 2DJNA 3D5SC 1H8AC 5ILVA 4KYWA 1EF4A 2XGDA 1QA6A 1G3YA 1XMKA 1LPQA 2CUFA 2D1HA 1JT6A 4L5IA 3V8JA 3K70D 2MG4A 5L3GA 2X6XA 3GFIA 1WRJA 4UVCA 2E2HJ 4D5CA 1HDPA 3PNTA 1QVTA 2XKOA 1LDJA 2HTSA 3TO9A 1ZGWA 1K79A 1TWAJ 3P9KA 3ZQ7A 1J0RA 2HYJA 4ENKA 1IDYA 2BY3A 3ABKH 1R1VA 1U5TC 3EQLF 1G3SA 2L54A 2OZUA 1W0UA 1QHGA 2FA5A 3ZQFA 5L3BA 4ZZDA 4RB3C 3N05A 1YFHA 1A35A 1XGNA 3F8FA 1TWHJ 4IEJA 3L9FA 4BQNA 1V5EA 2K86A 2RN7A 3G73A 2O61A 3D1NI 5E1WA 1FX7A 2JVGA 5M5WJ 4GDFA 1GHCA 3PUBA 1KGSA 4WF2A 4I99C 3IAS2 3NQOA 1XN7A 2Z33A 2DA5A 2PLYA 5LRSA 2KL4A 1AWCA 2IJLA 3BPXA 1SAUA 3F0CA 3CF5F 1PUEE 2OV7A 1QPMA 3HOUJ 2EB7A 3D5LA 3RCOA 1I27A 3W2VA 3FXMA 1BA5A 2M8GX 1UHSA 2EA4A 4NNJA 5HS7A 1NH3A 2HKXA 3T8RA 2VOOA 1IZ1A 2EFOA 3BQZA 2CQ7A 4IL6C 4YRVA 3PSIA 3A01B 1MBJA 2FXAA 3BT9A 3ZPLA 5H2FC 1GVJA 4M6VA 1OCOH 1TQPA 4B43A 3W3CA 2GA1A 2A61A 4BDZA 1RUNA 2QUFA 2E5ZA 3QU3A 1P7IA 2DLLA 4F7ZA 4RLFA 4RB2C 5JVTA 2XRNA 4JOMA 1STZA 3DLLF 3CCLI 1I50J 2XAJA 2DBBA 3I71A 1FOXA 1YIOA 2ZNZA 3PIPF 3K10A 2D45A 4ON0A 1ZGAA 2DK8A 2MABA 3G4SI 4BACA 1VFCA 2RV8A 2QLZA 4ENJA 3A2KA 5FJ8J 4KUMA 4P9UA 3RTRA 3O2PE 2FMLA 3OY9A 3CCVI 2WA0A 3DKWA 1YJNI 5LEJA 1BC7C 2AHQA 3HDDA 1HF0A 1R23A 2FBHA 2ZJ2A 1T33A 3TKYA 1GXPA 3DKXA 2DXIA 1E0EA 1LDDA 4XKBA 1ZH5A 1I1SA 2JA2A 5AIPA 3H3VK 2DMTA 2FBIA 2X6YA 3HL2A 4ZJZA 4II2A 4MIMA 2ZCWA 1YX3A 4IRGA 1LDKB 3OYMA 3CZ6A 1WH7A 2K7LA 1NTCA 3FK6A 2RNJA 4UY8I 1MDMB 1JHFA 1ON1A 1Y0NA 4BXXJ 1XPXA 2G9WA 2VQGA 1JTYA 2E2IJ 4OIRF 2B9SA 2A6EF 2XVCA 4KICA 2WBMA 3K2AA 4QLCU 1OJLA 4E70A 2HPIA 1S29A 2DMQA 3QYFA 3RZDJ 4A93J 1UZCA 3ZQQA 3GTPJ 1Y1VJ 3BR6A 3RJPA 1MNDA 3WTWC 4XK4A 4KA4A 3RZOJ 4KT5C 3CDIA 3GFLA 3K4BA 3BTLA 3DEWA 3QPHA 1DPRA 1BOBA 1CF7B 1SC7A 3H35A 3DFGA 1MIJA 2DFIA 1S72I 2OZ6A 4LG3A 1WJAA 1B1BA 3GTMJ 2DA4A 3RPUA 3TP0A 2L7KA 1VQPI 3DBHB 1RR8C 2V1XA 5FKLA 2KZGA 1SANA 2W57A 3IWFA 4XKVA 3ASOH 4KFCA 3O8GA 1O3QA 4DZPA 2FBKA 5BQTA 1VQ7I 3FXKA 2NS0A 5EDNA 4N4NB 5KHDA 2IA1A 3S14J 2XB5A 2VJ5A 1I1GA 1G3TA 2VI6A 2EQRA 2L7FP 2L0KA 4OU0A 1BJAA 1B4AA 3OSGA 2PMZN 3FXJA 2Q1ZB 3EETA 5ILUA 1R22A 2XRLA 2LF8A 3A0BC 2KIUA 3LA3A 5IT3A 5J6XA 1BI3A 2BVMA 2K85A 4KIFA 1MJBA 1QGPA 3KLNA 3DBRB 5DD4A 3HSEA 1I6XA 2JK3A 3V8LA 4ZYHA 1V5FA 2PMHA 4OOIA 1Z0XA 4E7KA 3I59A 5M3MJ 4E7IA 4EGZA 1SFXA 4ANJA 2IS4A 4E7ZA 1YRNA 4BH9A 4G7HF 1HW2A 1Y6IA 1SAXA 1W7PD 4XMYA 1VI0A 4HNVA 1ETVA 3M8EA 2LBFB 1EKEA 1R5ID 2O6GE 2QQ8A 1T56A 2BHYA 4PJJA 4UV9A 1VQOI 4L0ZB 2NVQJ 1O7FA 1S6LA 5C3EJ 3OYJA 5FLMJ 4HZFA 4XKCA 4I01A 2HYFA 2GOMA 2HQ5A 1OYWA 5JHFA 2H8RA 3SZGA 3BY6A 1IG7A 1B9MA 3DTEA 1RR7A 5LBQA 3OYDA 4OINF 2L9SA 1LQ1A 1R5HA 1FJLA 3K4JA 3A01A 1WVRA 1TNTA 3VYTB 3NARA 2R7FA 5F0CA 4BBRJ 3G71I 2JQ7A 3E0JB 4FX4A 1KYWA 3U1KA 2CUZA 1IV8A 1ZGJA 2QWWA 4I98B 2MW8A 4XM3A 4XKWA 3R0AA 4QTRA 1XGOA 4HQEA 3AAFA 3CUQC 2LC2A 3S2WA 4A69C 3M7GA 1LEAA 1IN5A 4DGWB 4Q5SF 4ZYAA 2QQ9A 3ZR8X 2EILH 3QOPA 4P5OA 2EWNA 3MKWB 1N77A 1IXRC 2FE3A 1WJ5A 5CPRB 3CP8A 4PSXA 4IF4A 1MZBA 4EQQA 5E8IA 4M6YA 4PGHA 4IHTA 1ZAOA 1XX5A 4CCMA 4Y3OA 3S93A 3HOTA 2MH2A 5D6FA 1NK2P 2W82A 5HS9A 3ZRGA 4X6AJ 3H5AA 2O0YA 2DODA 4ESJA 2MSYA 1TWFJ 1FLIA 3V7RA 2E34A 2WWYA 4RB0A 3T8TA 5CQEA
chains in the Genus database with same CATH topology
5E3OA 1I6HJ 4D7NA 2NS8A 3BG5A 1XS9A 1QRYA 1OFCX 1FIPA 1GDTA 2E19A 3GTGJ 4MFDA 2K9SA 1U9OA 1ZK8A 4XRSA 2R5YB 1B8IA 1IGNA 5C4JJ 3O8HA 3S2DJ 3S1MJ 1ETQA 2GBYA 3BR1A 3BTIA 1JJ6C 3MN2A 2L9RA 2O8KA 3OOUA 1IC8A 3S1QJ 3GTKJ 3HOXJ 3HGGA 4M3BA 1BL0A 4DZJA 5J1YA 1ITYA 1TWGJ 1B72A 1QPIA 1JKPC 4M3GA 3LSPA 4Y52J 2EZLA 3B6AA 5GPCA 2EH3A 2HI3A 4CYCA 4A3EJ 1I3QJ 3VPRA 1DU6A 3WHCA 4RBOA 1MBFA 2COBA 3LOCA 2X9DA 5EG0A 1UMQA 2EBIA 3QPLA 1X58A 3BG9A 5J1RA 1MH4A 1VNDA 4DYQA 5EGOA 2ECCA 2Y9ZA 1K83J 2Y9YA 3IH3A 5IYDJ 5M3FJ 4A3CJ 1MSFC 4QIWN 5F27A 4AYBN 4D5FA 4FISA 2Y2ZA 3A02A 1U9NA 2IBDA 3TW6A 1ETOA 3JREA 4A3DJ 3JRHA 4IHWA 1S7EA 2M2EA 2CRGA 2WAQN 2O9LA 1Z77A 3L1PA 2FJ1A 1X2MA 5F1JA 2LD5A 4AC0A 4RDUA 2XB0X 1MNMC 3PO3J 3M3YJ 5M5XJ 3G1LA 3K7AJ 2FQ4A 4JX5A 4XICA 3HKZN 2VUMJ 3JRBA 2KDZA 1TWCJ 2NVTJ 1APLC 3LSRA 2TCTA 2EZKA 3JR9A 3Q0VA 3S2HJ 2DMPA 1IJWC 2XPWA 3Q3SA 1TC3C 2R7ZJ 2IEKA 3H0GJ 2CU7A 3ZOBA 2LR8A 5IOZA 5IOYA 4M3FA 2DA3A 3HB9A 3JRCA 1AHDP 3MVPA 3RQIA 1A5JA 4UUTA 5GPAA 3G1MA 5J1UA 4XRMA 3GTOJ 3BQYA 3GTQJ 4M3EA 1DU0A 4DW6A 4V2GA 1H88C 4IHXA 2CQXA 1ZKGA 2AO9A 5EF6A 3B6CA 4AUXA 2HOAA 4MFEA 3S17J 2XSDC 2N8GA 2QCOA 3TP3A 5DTDA 2D5VA 3JRGA 5E3LA 3HGYA 1PUFA 1F43A 2E1OA 4BKXA 1LFUP 1RKTA 3LNQA 2NOGA 3IH4A 1MBKA 1JJ8C 4CYCB 1RESA 2Y30A 4J19A 2G0EA 4GFBA 3W6VA 3OIOA 2HXOA 4FCYA 5EG0B 4A3JJ 1XG1A 1G2HA 4A3LJ 5EGOB 1WGXA 4V2FA 5J3LA 1GV2A 2R0QC 1JKQC 4UUSA 2YUSA 1IDZA 3PM1A 4C3IJ 5IYBJ 4A3IJ 2K9NA 3OSFA 2DJNA 1H8AC 1EF4A 2R5YA 2XGDA 2LY9A 2TRTA 2KT0A 2JA6J 2CUFA 1JT6A 2EZHA 4DYRA 2X6OA 2MG4A 1ETXA 1HDDC 4MLOA 2E2HJ 4D5CA 1HDPA 4B3AA 1QVTA 5GP9A 1BW5A 1FTZA 3BR0A 3FKIJ 1GUUA 1ZGWA 1TWAJ 1OCTC 3BR3A 1ENHA 2HYJA 1LE8A 4JX6A 1HLVA 1IDYA 2I10A 1IRZA 2DA2A 2M9HA 2DA7A 1W0UA 3ZQFA 1GV5A 4MO7A 1MBEA 2XPUA 1BW6A 1FIAA 1TWHJ 4IEJA 2FD5A 2XGCA 3D1NI 3QPSA 1RPWA 2HXIA 5JLWA 3ZQLA 5IP9J 1H89C 5M5WJ 2GM4A 2DTZA 3GTJJ 3CDLA 2GLOA 3C2BA 4I76A 2DA5A 1O4XA 1RKWA 2VKEA 1AU7A 3ZQIA 3F0CA 3M4OJ 3NAUA 1LFBA 3HOUJ 4FTHA 2FX0A 3IH2A 5HODA 1BA5A 2M8GX 1UHSA 1ORKA 4IHYA 1PUFB 5F04A 3BQZA 2NS7A 5IP6A 3SDGA 2NVXJ 3JRIA 1K61A 3A01B 1NK3P 1RETA 1MBJA 4B1RA 3BT9A 4IHVA 2DMNA 4BBSJ 5F0FA 4M6VA 3HOWJ 3FIWA 4A3MJ 2K9QA 2JA5J 4M3DA 1ZTRA 2LKXA 5JLXA 1F36A 1ZR2A 2ZB9A 3BTJA 2DA6A 1P7IA 3G1OA 3E7LA 3RKQA 1A6IA 2LLKA 2E2JJ 1I50J 3LSGA 2LFBA 1ETWA 4L5EA 3BR2A 3TEDA 2R92J 4A3GJ 5C44J 1P7JA 1VFCA 2WB1N 2XGEA 2DA1A 4W1UA 5FJ8J 5FLVA 2O7OA 3TW7A 3HDDA 2AHQA 4W97A 1HF0A 5FKNA 1AKHB 1T33A 3BG3A 3QQAA 3CQZJ 4C2MJ 2K40A 3HOYJ 9ANTA 2ID6A 4Y7NJ 1CQTA 3H3VK 4UUSB 1JGGA 2DMTA 3WHBA 1MBHA 1WH5A 4XRSG 4MIMA 5E3MA 2X48A 1WH7A 2ELKA 1NTCA 4JP0A 3FK6A 2JJ7A 4JYKA 2NVYJ 4BXXJ 3FK7A 2Y0SN 1JTYA 2E2IJ 2R5ZA 2HDDA 1SFOJ 3K2AA 2YU9J 3GTLJ 1OJLA 1ETYA 1U8BA 2DMQA 4A93J 3RZDJ 5IYCJ 3GTPJ 2CQQA 2QF7A 4I6ZA 1ZQ3P 1Y1VJ 3MKLA 3BR6A 2CUEA 2P81A 3BR5A 1ETKA 4XK4A 3RZOJ 3S16J 3PO2J 5K7ZA 3I4NJ 3BTLA 3DEWA 2ID3A 3SJMA 3UKGA 2ME0A 3S1RJ 2LK2A 1BJZA 2ME6A 5FKOA 1B72B 2DA4A 3GTMJ 4FE4A 3TP0A 2ECBA 3HBLA 5FKLA 5E3NA 3S15J 1SANA 2XPVA 2R93J 3O8GA 4DZPA 4BY7J 5EYRA 2LP0A 5EDNA 3JRAA 5F08A 1VF9A 2OF7A 3JRDA 5BNGA 3S14J 4G12A 1HOMA 2XB5A 2HOSA 1Y1WJ 1JUSA 2VI6A 3HOZJ 2EQRA 2L7FP 5IP7J 2L0KA 4LOCA 4BY1J 3OSGA 2PMZN 2JN6A 2XRLA 2HOTA 1POGA 1LE8B 1HCRA 1D5YA 1JT0A 2LVSA 1IUFA 4QSHA 2B63J 1JUPA 2JK3A 2WV1A 5K7HA 4C3HJ 1GVDA 1JTXA 1Z0XA 4XIDA 1JKOC 5M3MJ 1FTTA 1GT0C 1YRNA 1WPKA 4JX4A 3ZQCA 2JA7J 1OCPA 1MSEC 3FISA 2DMUA 2VPRA 4A3FJ 1VI0A 1R9TJ 4NDLA 1ETVA 4HNVA 3HM5A 3HEFA 1JKRC 3HOVJ 2OPTA 5F0HA 1T56A 2NVQJ 3JRFA 2W48A 3Q0UA 4A3KJ 5EEAA 1JUMA 3SFIA 2L7MP 2DN0A 5C3EJ 1FEXA 5FLMJ 2L7ZA 2M34A 2HQ5A 5DS9A 2H8RA 5IPAA 1IG7A 2YS9A 1RR7A 1ZR4A 3GBGA 1X2NA 1FJLA 2MGQA 3A03A 3A01A 4B4CA 3NARA 1WCMJ 2Y31A 4DYCA 1E3OC 5F0CA 4BBRJ 1B8IB 4X1EA 3DCFA 2CJJA 4A3BJ 5C4XJ 2JA8J 2MW8A 4C3JJ 4QTRA 3ZQHA 3S1NJ 3CMYA 4A69C 2R5ZB 4FE7A 1QVUA 5EZHA 1Q1VA 2H1KA 3I4MJ 1XC5A 2EZIA 1MH3A 5FKKA 5K7FA 2LTPA 3BTCA 2JMWA 4EEFG 4D7MA 1WI3A 2RAEA 1UG2A 1AKHA 3Q0WA 1NK2P 5EZGA 2M0CA 2IAIA 3LSJA 3IV5A 2JWTA 1YRNB 4X6AJ 5FKMA 3CCYA 4S0HB 2MSYA 4ABZA 5M5YJ 1TWFJ 1W0TA 1U78A 1MBGA 1IV6A 3ZQGA 2VKVA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5E3O A;  1I6H J;  4D7N A;  2NS8 A;  3BG5 A;  1XS9 A;  1QRY A;  1OFC X;  1FIP A;  1GDT A;  2E19 A;  3GTG J;  4MFD A;  2K9S A;  1U9O A;  1ZK8 A;  4XRS A;  2R5Y B;  1B8I A;  1IGN A;  5C4J J;  3O8H A;  3S2D J;  3S1M J;  1ETQ A;  2GBY A;  3BR1 A;  3BTI A;  1JJ6 C;  3MN2 A;  2L9R A;  2O8K A;  3OOU A;  1IC8 A;  3S1Q J;  3GTK J;  3HOX J;  3HGG A;  4M3B A;  1BL0 A;  4DZJ A;  5J1Y A;  1ITY A;  1TWG J;  1B72 A;  1QPI A;  1JKP C;  4M3G A;  3LSP A;  4Y52 J;  2EZL A;  3B6A A;  5GPC A;  2EH3 A;  2HI3 A;  4CYC A;  4A3E J;  1I3Q J;  3VPR A;  1DU6 A;  3WHC A;  4RBO A;  1MBF A;  2COB A;  3LOC A;  2X9D A;  5EG0 A;  1UMQ A;  2EBI A;  3QPL A;  1X58 A;  3BG9 A;  5J1R A;  1MH4 A;  1VND A;  4DYQ A;  5EGO A;  2ECC A;  2Y9Z A;  1K83 J;  2Y9Y A;  3IH3 A;  5IYD J;  5M3F J;  4A3C J;  1MSF C;  4QIW N;  5F27 A;  4AYB N;  4D5F A;  4FIS A;  2Y2Z A;  3A02 A;  1U9N A;  2IBD A;  3TW6 A;  1ETO A;  3JRE A;  4A3D J;  3JRH A;  4IHW A;  1S7E A;  2M2E A;  2CRG A;  2WAQ N;  2O9L A;  1Z77 A;  3L1P A;  2FJ1 A;  1X2M A;  5F1J A;  2LD5 A;  4AC0 A;  4RDU A;  2XB0 X;  1MNM C;  3PO3 J;  3M3Y J;  5M5X J;  3G1L A;  3K7A J;  2FQ4 A;  4JX5 A;  4XIC A;  3HKZ N;  2VUM J;  3JRB A;  2KDZ A;  1TWC J;  2NVT J;  1APL C;  3LSR A;  2TCT A;  2EZK A;  3JR9 A;  3Q0V A;  3S2H J;  2DMP A;  1IJW C;  2XPW A;  3Q3S A;  1TC3 C;  2R7Z J;  2IEK A;  3H0G J;  2CU7 A;  3ZOB A;  2LR8 A;  5IOZ A;  5IOY A;  4M3F A;  2DA3 A;  3HB9 A;  3JRC A;  1AHD P;  3MVP A;  3RQI A;  1A5J A;  4UUT A;  5GPA A;  3G1M A;  5J1U A;  4XRM A;  3GTO J;  3BQY A;  3GTQ J;  4M3E A;  1DU0 A;  4DW6 A;  4V2G A;  1H88 C;  4IHX A;  2CQX A;  1ZKG A;  2AO9 A;  5EF6 A;  3B6C A;  4AUX A;  2HOA A;  4MFE A;  3S17 J;  2XSD C;  2N8G A;  2QCO A;  3TP3 A;  5DTD A;  2D5V A;  3JRG A;  5E3L A;  3HGY A;  1PUF A;  1F43 A;  2E1O A;  4BKX A;  1LFU P;  1RKT A;  3LNQ A;  2NOG A;  3IH4 A;  1MBK A;  1JJ8 C;  4CYC B;  1RES A;  2Y30 A;  4J19 A;  2G0E A;  4GFB A;  3W6V A;  3OIO A;  2HXO A;  4FCY A;  5EG0 B;  4A3J J;  1XG1 A;  1G2H A;  4A3L J;  5EGO B;  1WGX A;  4V2F A;  5J3L A;  1GV2 A;  2R0Q C;  1JKQ C;  4UUS A;  2YUS A;  1IDZ A;  3PM1 A;  4C3I J;  5IYB J;  4A3I J;  2K9N A;  3OSF A;  2DJN A;  1H8A C;  1EF4 A;  2R5Y A;  2XGD A;  2LY9 A;  2TRT A;  2KT0 A;  2JA6 J;  2CUF A;  1JT6 A;  2EZH A;  4DYR A;  2X6O A;  2MG4 A;  1ETX A;  1HDD C;  4MLO A;  2E2H J;  4D5C A;  1HDP A;  4B3A A;  1QVT A;  5GP9 A;  1BW5 A;  1FTZ A;  3BR0 A;  3FKI J;  1GUU A;  1ZGW A;  1TWA J;  1OCT C;  3BR3 A;  1ENH A;  2HYJ A;  1LE8 A;  4JX6 A;  1HLV A;  1IDY A;  2I10 A;  1IRZ A;  2DA2 A;  2M9H A;  2DA7 A;  1W0U A;  3ZQF A;  1GV5 A;  4MO7 A;  1MBE A;  2XPU A;  1BW6 A;  1FIA A;  1TWH J;  4IEJ A;  2FD5 A;  2XGC A;  3D1N I;  3QPS A;  1RPW A;  2HXI A;  5JLW A;  3ZQL A;  5IP9 J;  1H89 C;  5M5W J;  2GM4 A;  2DTZ A;  3GTJ J;  3CDL A;  2GLO A;  3C2B A;  4I76 A;  2DA5 A;  1O4X A;  1RKW A;  2VKE A;  1AU7 A;  3ZQI A;  3F0C A;  3M4O J;  3NAU A;  1LFB A;  3HOU J;  4FTH A;  2FX0 A;  3IH2 A;  5HOD A;  1BA5 A;  2M8G X;  1UHS A;  1ORK A;  4IHY A;  1PUF B;  5F04 A;  3BQZ A;  2NS7 A;  5IP6 A;  3SDG A;  2NVX J;  3JRI A;  1K61 A;  3A01 B;  1NK3 P;  1RET A;  1MBJ A;  4B1R A;  3BT9 A;  4IHV A;  2DMN A;  4BBS J;  5F0F A;  4M6V A;  3HOW J;  3FIW A;  4A3M J;  2K9Q A;  2JA5 J;  4M3D A;  1ZTR A;  2LKX A;  5JLX A;  1F36 A;  1ZR2 A;  2ZB9 A;  3BTJ A;  2DA6 A;  1P7I A;  3G1O A;  3E7L A;  3RKQ A;  1A6I A;  2LLK A;  2E2J J;  1I50 J;  3LSG A;  2LFB A;  1ETW A;  4L5E A;  3BR2 A;  3TED A;  2R92 J;  4A3G J;  5C44 J;  1P7J A;  1VFC A;  2WB1 N;  2XGE A;  2DA1 A;  4W1U A;  5FJ8 J;  5FLV A;  2O7O A;  3TW7 A;  3HDD A;  2AHQ A;  4W97 A;  1HF0 A;  5FKN A;  1AKH B;  1T33 A;  3BG3 A;  3QQA A;  3CQZ J;  4C2M J;  2K40 A;  3HOY J;  9ANT A;  2ID6 A;  4Y7N J;  1CQT A;  3H3V K;  4UUS B;  1JGG A;  2DMT A;  3WHB A;  1MBH A;  1WH5 A;  4XRS G;  4MIM A;  5E3M A;  2X48 A;  1WH7 A;  2ELK A;  1NTC A;  4JP0 A;  3FK6 A;  2JJ7 A;  4JYK A;  2NVY J;  4BXX J;  3FK7 A;  2Y0S N;  1JTY A;  2E2I J;  2R5Z A;  2HDD A;  1SFO J;  3K2A A;  2YU9 J;  3GTL J;  1OJL A;  1ETY A;  1U8B A;  2DMQ A;  4A93 J;  3RZD J;  5IYC J;  3GTP J;  2CQQ A;  2QF7 A;  4I6Z A;  1ZQ3 P;  1Y1V J;  3MKL A;  3BR6 A;  2CUE A;  2P81 A;  3BR5 A;  1ETK A;  4XK4 A;  3RZO J;  3S16 J;  3PO2 J;  5K7Z A;  3I4N J;  3BTL A;  3DEW A;  2ID3 A;  3SJM A;  3UKG A;  2ME0 A;  3S1R J;  2LK2 A;  1BJZ A;  2ME6 A;  5FKO A;  1B72 B;  2DA4 A;  3GTM J;  4FE4 A;  3TP0 A;  2ECB A;  3HBL A;  5FKL A;  5E3N A;  3S15 J;  1SAN A;  2XPV A;  2R93 J;  3O8G A;  4DZP A;  4BY7 J;  5EYR A;  2LP0 A;  5EDN A;  3JRA A;  5F08 A;  1VF9 A;  2OF7 A;  3JRD A;  5BNG A;  3S14 J;  4G12 A;  1HOM A;  2XB5 A;  2HOS A;  1Y1W J;  1JUS A;  2VI6 A;  3HOZ J;  2EQR A;  2L7F P;  5IP7 J;  2L0K A;  4LOC A;  4BY1 J;  3OSG A;  2PMZ N;  2JN6 A;  2XRL A;  2HOT A;  1POG A;  1LE8 B;  1HCR A;  1D5Y A;  1JT0 A;  2LVS A;  1IUF A;  4QSH A;  2B63 J;  1JUP A;  2JK3 A;  2WV1 A;  5K7H A;  4C3H J;  1GVD A;  1JTX A;  1Z0X A;  4XID A;  1JKO C;  5M3M J;  1FTT A;  1GT0 C;  1YRN A;  1WPK A;  4JX4 A;  3ZQC A;  2JA7 J;  1OCP A;  1MSE C;  3FIS A;  2DMU A;  2VPR A;  4A3F J;  1VI0 A;  1R9T J;  4NDL A;  1ETV A;  4HNV A;  3HM5 A;  3HEF A;  1JKR C;  3HOV J;  2OPT A;  5F0H A;  1T56 A;  2NVQ J;  3JRF A;  2W48 A;  3Q0U A;  4A3K J;  5EEA A;  1JUM A;  3SFI A;  2L7M P;  2DN0 A;  5C3E J;  1FEX A;  5FLM J;  2L7Z A;  2M34 A;  2HQ5 A;  5DS9 A;  2H8R A;  5IPA A;  1IG7 A;  2YS9 A;  1RR7 A;  1ZR4 A;  3GBG A;  1X2N A;  1FJL A;  2MGQ A;  3A03 A;  3A01 A;  4B4C A;  3NAR A;  1WCM J;  2Y31 A;  4DYC A;  1E3O C;  5F0C A;  4BBR J;  1B8I B;  4X1E A;  3DCF A;  2CJJ A;  4A3B J;  5C4X J;  2JA8 J;  2MW8 A;  4C3J J;  4QTR A;  3ZQH A;  3S1N J;  3CMY A;  4A69 C;  2R5Z B;  4FE7 A;  1QVU A;  5EZH A;  1Q1V A;  2H1K A;  3I4M J;  1XC5 A;  2EZI A;  1MH3 A;  5FKK A;  5K7F A;  2LTP A;  3BTC A;  2JMW A;  4EEF G;  4D7M A;  1WI3 A;  2RAE A;  1UG2 A;  1AKH A;  3Q0W A;  1NK2 P;  5EZG A;  2M0C A;  2IAI A;  3LSJ A;  3IV5 A;  2JWT A;  1YRN B;  4X6A J;  5FKM A;  3CCY A;  4S0H B;  2MSY A;  4ABZ A;  5M5Y J;  1TWF J;  1W0T A;  1U78 A;  1MBG A;  1IV6 A;  3ZQG A;  2VKV A; 
#chains in the Genus database with same CATH topology
 3TGN A;  4P9F A;  3KEY A;  3K1M A;  2CYY A;  3BG5 A;  2KFD A;  1FIP A;  1O57 A;  3BG7 A;  4MFD A;  4UV8 A;  2DW4 A;  1IGN A;  1W7P B;  5J8C A;  1LNW A;  2BW3 B;  3O8H A;  3OYH A;  1ZN2 A;  1JJ6 C;  3BTI A;  1PJR A;  5FD5 A;  2O8K A;  1IRG A;  3HOX J;  4OIO F;  3NWS A;  1TWG J;  3LFU A;  2DU9 A;  4HDU A;  2EA2 A;  2DK5 A;  3HRS A;  1BN5 A;  1QPI A;  4UNO A;  2BE5 F;  1Z3Y A;  4Y52 J;  5E18 F;  2EZL A;  2STW A;  3CJN A;  4F3Q A;  4E6K G;  4ESB A;  4HW0 A;  2PMU A;  3OWT A;  1DU6 A;  2COB A;  4AIK A;  3S8P A;  2LDU A;  5EG0 A;  2HR3 A;  4GRI A;  3QPL A;  1MMN A;  3BG9 A;  1K83 J;  2ZKZ A;  2ZO4 A;  3HZJ A;  3IH3 A;  4ZZL A;  5M3F J;  1P4A A;  4A3C J;  4HYE A;  1E3P A;  4N9H A;  1OR7 C;  3HC7 A;  2Z5U A;  1U9N A;  3TW6 A;  2H09 A;  2R7D A;  1X4O A;  2IGM A;  3N4M A;  1E3H A;  3WTV C;  1YTY A;  1O3R A;  3JRH A;  4BQA A;  5IT9 Z;  5CVI A;  2JPC A;  4IOA F;  3ZXS A;  3HRU A;  1UEL B;  1TP4 A;  2CRG A;  4L0Y B;  4NC8 A;  1CGP A;  5FRO A;  4HLY A;  4ZYG A;  4XSZ F;  5F1J A;  5K5O A;  2HDC A;  4XLF A;  3CDH A;  2XB0 X;  1IF1 A;  3BOQ A;  2IT0 A;  2VOD A;  4YFK F;  2PJR A;  2FRH A;  3I53 A;  5ICE A;  5DCM B;  2VQH A;  2KDZ A;  1A04 A;  5JR3 A;  4XLC A;  3BZK A;  3SEQ A;  1ZRF A;  4I2O A;  4FAS D;  3L2C A;  1FOW A;  3TL4 X;  3O6B B;  3WGI A;  2DFE A;  4AM3 A;  2A6H F;  1T6S A;  3FMQ A;  3Q3S A;  5JI6 A;  4G8X A;  5DUI A;  1TC3 C;  4EM2 A;  2OU2 A;  3E6B A;  5IOY A;  2DA3 A;  4HX7 A;  1AHD P;  4CHU A;  4OMY A;  2DPD A;  2PQ8 A;  3L09 A;  3RQI A;  5GTI C;  1RIO H;  2V1D A;  3G1M A;  3CO6 C;  2Z99 A;  3G6E I;  3KP2 A;  3K2Z A;  4M3E A;  3F8M A;  2FOW A;  4XLP F;  1YI2 I;  4YEL A;  3GCM A;  3ASN H;  2VB6 A;  4V2G A;  3REO A;  2CQK A;  3RYP A;  3ERE D;  2YSR A;  2DDB A;  5EF6 A;  3GZN B;  4AUX A;  4KN4 X;  5HLI A;  2N8G A;  3TP3 A;  1T38 A;  1TL8 A;  5D5U B;  4JQF A;  2V79 A;  1WJF A;  4M72 A;  1T2K A;  4EJV A;  1X1B A;  4C9Y A;  2IP2 A;  2QSH X;  4YFN F;  4U7D A;  2CGP A;  1XD7 A;  3Q9V A;  2CW7 A;  2F4O B;  4L9V A;  1K7A A;  1MMD A;  3K0L A;  4U7B A;  3JSO A;  1SFE A;  3LNQ A;  3V42 A;  3BPV A;  2LF7 A;  2IGO A;  2X1D A;  1R36 A;  1HW5 A;  4QPO A;  3WG7 H;  1QBJ A;  2W00 A;  4R1H A;  4J19 A;  4V19 K;  3W6V A;  3WTZ A;  2M4K A;  3M07 A;  4B3X A;  3CCR I;  2XGX A;  1IO2 A;  1MMA A;  2Z16 A;  1KU3 A;  4A3J J;  1GLN A;  4BAY A;  3LSI A;  4V2F A;  3W6K B;  3AG4 H;  4N0B A;  3GF2 A;  4PFO A;  2RKH A;  1MGT A;  1U6G A;  1A6Q A;  2WTE A;  4DNC A;  4Y15 A;  3AL0 B;  3OYN A;  3LMM A;  4ZDL A;  2G7U A;  5KAI C;  3I59 B;  3DU5 A;  3B73 A;  1XB4 A;  2YUS A;  4C3I J;  1JXS A;  2ZNY A;  3OL3 A;  2VQC A;  5TIS C;  4GCV A;  3OS2 A;  1RI7 A;  1W7P A;  3ZCO A;  1S8N A;  1R6R A;  2LY9 A;  1ZG3 A;  2X0L A;  3RKY A;  5IT9 K;  1YYV A;  2CFO A;  3HTU A;  3FXU A;  2MH9 A;  4HSR A;  4A0Y A;  4ZTJ A;  3CUQ A;  3ZP5 A;  1ETX A;  3BJ6 A;  3VYR B;  4YEJ A;  4U0V A;  5GP9 A;  1FTZ A;  1SD5 A;  3V7C A;  2R7U A;  3BR0 A;  3WU1 B;  1GUU A;  2BBY A;  1OCT C;  1Z6R A;  3JW4 A;  2AS5 F;  4JX6 A;  3MKY B;  3CCJ I;  2CS3 A;  1IRZ A;  2YX7 A;  2DA2 A;  3TMO A;  3A4C A;  3TOB A;  2LH9 A;  3SXY A;  3EUA A;  5D5V B;  2GAU A;  1ZG1 A;  1GV5 A;  2JSP A;  4MO7 A;  1D0Z A;  1TLH B;  4HLX A;  1OPC A;  1BW6 A;  3T0Y A;  5HNH A;  1FSH A;  5E17 F;  5IP9 J;  1KU9 A;  4LMY A;  3GTJ J;  1S9H A;  2GLO A;  1GXQ A;  2V9V A;  3AG3 H;  1O4X A;  4G7Z F;  1AU7 A;  3ZQI A;  1LFB A;  4RB1 A;  2GOX B;  5HDK A;  1XDS A;  2DT6 A;  2FX0 A;  3WE2 A;  4FTH A;  1QQI A;  3IUO A;  1J59 A;  1ORK A;  4RM2 A;  3CCS I;  5ED4 A;  5F04 A;  4XLH A;  1E2X A;  5IP6 A;  3SDG A;  4WWC A;  2NVX J;  3JRI A;  3DPU A;  2J5P A;  4EAT A;  4XLE A;  2VJ4 A;  4AYB A;  1WJD A;  3FMS A;  1QNT A;  1RET A;  2D2W A;  4BBS J;  4A3M J;  3C2H A;  3RQ4 A;  4M3D A;  1ZTR A;  3BJO A;  3TOA A;  2VLA A;  5FO5 A;  2ELJ A;  1F36 A;  3RI4 A;  3H5R A;  3C2G A;  2ZB9 A;  3HHH A;  2HS5 A;  2Q8K A;  2H94 A;  4O3M A;  2E1M B;  2R7S A;  1YX5 A;  4F55 A;  2KQR A;  4L5E A;  2L3D A;  3E6C C;  3KX2 A;  4OIQ F;  2FSW A;  3AL0 C;  3BDD A;  5C44 J;  2UV1 A;  4YG2 F;  2R7R A;  5GAD J;  3LL7 A;  2XGE A;  3K1P A;  3PNV A;  3P7N A;  4M9Z A;  3TW7 A;  5F1R A;  3EDP A;  5CKT A;  1D1C A;  4I09 A;  3CQZ J;  4C2M J;  2EPF A;  1YOV B;  4CCL A;  2F2E A;  3HOY J;  9ANT A;  4KMU X;  3LSM A;  4Y7N J;  1X3W B;  1CQT A;  2HVQ A;  1VQ6 I;  2FNP A;  3FM3 A;  2OTJ I;  3GX4 X;  4BJ6 C;  3PSF A;  1MBH A;  1WH5 A;  5E3M A;  1HKQ A;  4UXN A;  3OV8 A;  4HNU A;  3KEO A;  4BNC A;  2IXS A;  4JP0 A;  1RC9 A;  3TO6 A;  5LFA A;  1LVK A;  1MJA A;  1X1A A;  2NVY J;  4A5N A;  2ZFW A;  3FK7 A;  2Y0S N;  3K1N A;  2OAZ A;  2HDD A;  1SFO J;  2YU9 J;  3GFM A;  1ETY A;  1U8B A;  1U0J A;  1V4R A;  5D5X B;  4B47 A;  1LVA A;  2Y69 H;  4LLL A;  4H4K C;  1OCC H;  4BDY A;  3MKL A;  1LEB A;  4XOP A;  2EV6 A;  3BR5 A;  2V7F A;  1V54 H;  5FLX Z;  1FP2 A;  1R4N B;  3SZP A;  3PO2 J;  3I4N J;  5K7Z A;  3WU2 C;  2R7O A;  2NVU B;  3F8C A;  1HST A;  3S3O A;  3MCZ A;  3CUQ B;  4RAZ A;  1WKM A;  3RKW A;  2L5Q A;  5BPI A;  3DPT A;  2XC7 A;  1HXD A;  1XMA A;  5FKO A;  4JK1 X;  3FXO A;  3K70 C;  4PUS A;  3KET A;  4FE4 A;  4OWR B;  3JCU C;  1HKT A;  2ECB A;  2KJC A;  2R93 J;  3IHU A;  3KP6 A;  3WGG A;  2RQQ A;  2XAG A;  2PI0 A;  3MWM A;  2EFQ A;  2WAD A;  2Y0S A;  4LD5 A;  5TGT A;  2PEX A;  4XOR A;  4MGR A;  5KVR A;  2OF7 A;  2OCE A;  1HOM A;  2P7V B;  2WC2 A;  4G12 A;  1Y1W J;  3LQQ A;  3Q5F A;  5IP7 J;  2BYV E;  3QP5 A;  4UUV A;  2JN6 A;  3OIP A;  4RGU A;  5D8K B;  4BHC A;  2HOT A;  3T5X A;  3TDZ C;  4DBR A;  1ULY A;  3O3K A;  3CUO A;  4ZDO A;  2UWM A;  1TNS A;  2VJI A;  4CCJ A;  4HG2 A;  5BPD A;  2B63 J;  2BXZ A;  2WV1 A;  2OC6 A;  1X1D A;  1ZAR A;  1D1A A;  4EVI A;  1WFX A;  2LKP A;  1FNN A;  1XMX A;  5E20 A;  1FTT A;  4PGG A;  4Y33 A;  1HSJ A;  4Z2Y A;  2YU3 A;  3WE3 A;  1WPK A;  2BZT A;  3ZQC A;  3HRM A;  1EH6 A;  2OD5 A;  1MSE C;  1XTA A;  1NHA A;  2DFF A;  2K9L A;  2PN6 A;  4A3F J;  4RM3 A;  1D8J A;  1SD6 A;  1T0F A;  5KK1 A;  2OPT A;  1YS6 A;  4A0X A;  3OOP A;  2KIF A;  1LB2 A;  1IN6 A;  1TT0 A;  4O6J A;  1OKR A;  3F3X A;  4BYY A;  1M1E B;  3BP8 A;  3FZV A;  1UJ8 A;  2W1O A;  4HEA 2;  1ZR4 A;  4NUB A;  2DT5 A;  2ZME C;  4XQF A;  3K4K A;  4CA0 A;  4MEY F;  4B8X A;  2A6T A;  1Z67 A;  5ICG A;  3J81 K;  1FMW A;  1B8I B;  2K4B A;  2JPB A;  4I0B A;  3QRF F;  4A3B J;  1VQ4 I;  1S3J A;  3L00 A;  3R6S A;  2VC0 A;  5C4X J;  2Z1D A;  3F72 A;  2F5C A;  4ZYE A;  2O03 A;  3CMY A;  1PYV A;  4YFX F;  3HOS A;  3C1D A;  2QZ8 A;  1Q1V A;  1FYL A;  3I4M J;  1X19 A;  4ENM A;  1XC5 A;  2EZI A;  1MH3 A;  3HKZ A;  1DPU A;  1BIB A;  3JTH A;  3OYE A;  1KA8 A;  5J8F A;  2DI3 A;  3BJA A;  2LTP A;  4Y4R A;  2GXG A;  3G2B A;  2X6W A;  2E1N A;  3PFY A;  4MHG A;  1X3U A;  2F5E A;  2M0C A;  4L5J A;  3LSJ A;  3IV5 A;  1SMT A;  2KKO A;  5FKM A;  5M5Y J;  2H1L A;  4HA8 A;  1UFM A;  3KIO A;  1NG7 A;  2MLG A;  1MBG A;  5CLS A;  2VAS A;  2ZXI A;  2LOO A;  1SD4 A;  1WI9 A;  3F6O A;  5E3O A;  1F1Z A;  2ESH A;  1ZRE A;  2J5O A;  4D7N A;  3FBN B;  1QZZ A;  2NS8 A;  1WSU A;  1GDT A;  1IXS B;  2K9S A;  1EH8 A;  2FOK A;  1ZK8 A;  1D3Y A;  1VZ0 A;  4HX8 A;  1A36 A;  3GME A;  3BLY A;  1DGW Y;  3J7Z I;  3VWB A;  3GLX A;  1YJ9 I;  2MD5 A;  2FQ3 A;  1LJ9 A;  1S7A A;  3LWF A;  4A12 A;  4JBA A;  4S05 A;  3VDX A;  2DQL A;  3ROU A;  2QBY A;  2XSJ C;  2H6B A;  2V6C A;  3OYB A;  2KLO A;  3GUD A;  3CP2 A;  2JZY A;  3GXO A;  1JKP C;  1X3Z B;  4OIP F;  3BRO A;  3CMM A;  2PFB A;  4EM0 B;  1MDM A;  1JHH A;  1H9G A;  4BXF A;  1T39 A;  2HI3 A;  3CCM I;  4ZTF A;  1E17 A;  1B59 A;  3HTS B;  2X1C A;  3LOC A;  2KPM A;  2BXY A;  2GWR A;  3J7A Y;  4XLN F;  5EGO A;  1MH4 A;  2ECC A;  2Y9Z A;  4XLA A;  2W85 A;  2PMZ A;  5H6Q A;  4QWQ A;  4D5F A;  2TDX A;  2QKM B;  4FIS A;  2Y2Z A;  4E7H A;  3JRE A;  3F21 A;  3MZY A;  1S7E A;  2M2E A;  2VN2 A;  2WAQ N;  2WY7 Q;  2X51 A;  3QYE A;  1ZLK A;  5J4Y A;  3L1P A;  3OS0 A;  2FJ1 A;  2MLK A;  2PBI A;  2HQR A;  2HDW A;  4AC0 A;  2LD5 A;  3PO3 J;  5DM7 F;  5M5X J;  5A2Q Z;  2H27 A;  2IS2 A;  4JX5 A;  3LSK A;  4XIC A;  1TWC J;  2V26 A;  1APL C;  3WTX C;  2ZC2 A;  3OYK A;  2YX4 A;  3Q0V A;  2MC4 A;  2LY1 A;  2DMP A;  2P8T A;  5EEG A;  2R7Z J;  3H0G J;  1OYI A;  3FDY A;  2CU7 A;  4P1W A;  2LR8 A;  3ZOB A;  1U3E M;  3M8F A;  2HPM A;  1J09 A;  1WJB A;  2G7H A;  1ACI A;  3JRC A;  3HB9 A;  3WTT C;  3MVP A;  3AG1 H;  3ZMZ A;  2NNN A;  3WU0 A;  2DTR A;  4UUT A;  3CJT B;  3FM5 A;  5HLG A;  3BQY A;  2RC4 A;  1BI2 A;  1DP3 A;  3F9K A;  1BI0 A;  2KJB A;  3HSF A;  4DW6 A;  4D9J A;  3I54 A;  4IHX A;  6PAX A;  3MD2 A;  5HOO A;  2YR2 A;  2CMP A;  2EIN H;  1NG6 A;  3B6C A;  1D0Y A;  4BJ5 C;  2HOA A;  2A5Y B;  3DF8 A;  4MFE A;  3S17 J;  2EV5 A;  5AIQ A;  5DDG A;  3AG2 H;  2QYO A;  3FXL A;  3PUF A;  2CG4 A;  2KRF A;  1EH7 A;  5E3L A;  3MMY B;  1UB9 A;  2F48 A;  5KNL A;  4L18 B;  1F43 A;  2E1O A;  3QU6 A;  1FBS A;  2UXX A;  2R7W A;  4LIV A;  1KON A;  4IRH A;  3BC8 A;  2NOG A;  3SYT A;  3IH4 A;  3MZH A;  1OMI A;  2L4A A;  4IVN A;  5HS8 A;  5JVG F;  3E5U A;  2Y30 A;  2VKD A;  3WOD F;  4AIH A;  1WJC A;  3OIO A;  1G3W A;  3R4K A;  4FCY A;  1W5S A;  4CGZ A;  1T8I A;  5EGO B;  4XN3 A;  3L2U A;  4KMF A;  2VBX A;  3KCC A;  2W24 A;  5J3L A;  1GV2 A;  4BE2 A;  2IRF G;  3E5Q A;  2DOA A;  2DJI A;  4WXH A;  4FET A;  1OYY A;  2Z3Y A;  1OR7 A;  4ETS A;  4MTE A;  3IAM 2;  4KJZ A;  3PM1 A;  3R61 A;  3SDB A;  3KE2 A;  2CQN A;  1FYK A;  3VB2 A;  4A6D A;  1S7O A;  5LHI A;  2BY0 A;  3LA2 A;  2R5Y A;  2KP6 A;  2DCE A;  4IQJ A;  3K69 A;  2RDP A;  2TRT A;  3E5X A;  4C2T A;  2M7B A;  4IO9 F;  3NWT A;  3OYI A;  2EZH A;  4DYR A;  2X6O A;  3WTY C;  1HDD C;  1FOK A;  1AOY A;  1HA8 A;  1RZ4 A;  2OCC H;  2CUJ A;  1BW5 A;  1XCB A;  3FKI J;  4AVP A;  4MQV A;  2XUB A;  4D1Q A;  2EFP A;  2IVM A;  1PDN C;  4LGW A;  1W1W E;  3GW2 A;  1DGR M;  1KU2 A;  4LB5 A;  5FFX A;  2M9H A;  5BS6 A;  3H9J A;  1VQ8 I;  1MMG A;  3DTI A;  5D8L B;  3DPL C;  2QQB A;  2MD0 A;  2LRD A;  2ZFU A;  4ZDP A;  3RSN A;  2AQE A;  2XPU A;  3HRT A;  3H92 A;  2FD5 A;  1R7J A;  1N75 A;  1BM9 A;  3QPS A;  1RPW A;  3GZ5 A;  3ZQL A;  1H89 C;  1FC3 A;  1YE9 A;  1VQN I;  3ZMU A;  2BY2 A;  3ABL H;  3CDL A;  4RAY A;  5GAH J;  3I56 I;  2C6Y A;  2DOF A;  3HHG A;  2ZBK A;  1DQU A;  5LLQ A;  1KQ8 A;  2MC3 A;  2RNG A;  4H0E A;  3NAU A;  4Q4Z F;  3E3V A;  2XF5 A;  3IH2 A;  5HOD A;  2VBY A;  4N9I A;  1DP7 P;  4KN7 X;  1PUF B;  3L2W A;  1L3L A;  2HTJ A;  3SEZ A;  1YG2 A;  4EM1 A;  1WWX A;  3CMA I;  1NK3 P;  4P55 A;  1U8R A;  4IHV A;  2DMN A;  5F0F A;  4CSW A;  2V9K A;  4U88 A;  2VBW A;  2K9Q A;  1P4W A;  1ZG5 A;  4U0W A;  5DCM A;  2LKX A;  5JLX A;  1UG0 A;  2V6E A;  2F5F A;  3LSH A;  3GWZ A;  2F6C A;  3E7L A;  4WXC A;  1A6I A;  1W5C C;  4KIB A;  3IL2 A;  2E2J J;  3OR1 C;  2ZXH A;  5LGU A;  1SEU A;  2XF6 A;  2OJE D;  3K4L A;  4DOZ A;  3BR2 A;  4HST A;  2UZK A;  3QOD A;  2ADU A;  3TED A;  2EJR A;  2R3S A;  3KP3 A;  4A3G J;  3S3N A;  2QSF X;  1RNL A;  3P9I A;  1P7J A;  2WB1 N;  5FRN A;  2FMY A;  3GFJ A;  4W1U A;  3CC2 I;  5CVR A;  1QU3 A;  3M9A A;  2OUM A;  3FXR A;  3CLQ A;  4CCO A;  2QSG X;  5FLV A;  2O7O A;  1V3F A;  5FKN A;  1AKH B;  4HV6 A;  3BG3 A;  2COM A;  3QQA A;  3VOD A;  3L2V A;  4HBL A;  2K40 A;  3F8N A;  4R79 A;  5HDG A;  4BHB A;  1YHQ I;  2ID6 A;  4ENN A;  4UUS B;  1SVL A;  3WHB A;  4RA2 A;  4XRS G;  4HV5 A;  1MNE A;  5ICC A;  2GXB A;  2JJ7 A;  2HEO A;  4BJT A;  1USS A;  4JYK A;  2IGN A;  1ERD A;  1XSD A;  3PNY A;  4PDK A;  3GZ6 A;  3DWL E;  2L01 A;  3G3Z A;  3UNG C;  3VFZ A;  3K4C A;  1N25 A;  2UXN A;  4XOT A;  2EFW A;  3VSL A;  2PJP A;  1T08 B;  1OLT A;  4EJW A;  1TW3 A;  4YIF A;  5IYC J;  2QF7 A;  3ABT A;  3I64 A;  4I6Z A;  1ZQ3 P;  3J80 Z;  1BBY A;  2CUE A;  2XDV A;  2P81 A;  4BEH A;  5KAF C;  5D4R A;  3VEP A;  4E7L A;  1ETK A;  4NQW A;  2V1N A;  5LGN A;  3S16 J;  4LK0 F;  1DDN A;  1R71 A;  3RPQ A;  2VJJ A;  2ID3 A;  3UKG A;  2NOJ B;  1OCR H;  3S1R J;  4R8H A;  4LLG F;  5E1X A;  3EYY A;  3MZ8 A;  1HBX G;  2D1V A;  2LK2 A;  4C2U A;  2BEO A;  2M7A A;  1BJZ A;  2ME6 A;  3K4N A;  1B72 B;  3KEQ A;  2ZJR F;  4PFP A;  1I39 A;  3HBL A;  3UR3 C;  2LYC A;  1VQL I;  4CYD A;  1U5T B;  5CVU A;  2L2O A;  2QBY B;  4BY7 J;  2HOE A;  3JRA A;  3MQ0 A;  1OIS A;  1HW1 A;  4G6Q A;  2LNB A;  1VF9 A;  1BR1 A;  4I02 A;  4HNT A;  2HOS A;  2KIQ A;  2AXL A;  5LGT A;  4BY1 J;  2DFH A;  2ZME A;  2V4J C;  4HF0 A;  2VKH A;  4ESF A;  5CJ9 A;  5KCM A;  3S3M A;  1JT0 A;  2LVS A;  5AON A;  4QSH A;  1R1T A;  3JAM K;  3H9Q A;  1JUP A;  3SFZ A;  3ULQ B;  5K7H A;  3J7A O;  2HQN A;  1F5T A;  4IQ4 A;  4C3H J;  4S04 A;  1JTX A;  1T0F C;  3X2Q H;  1JKO C;  4ZYD A;  3C7J A;  2R7Q A;  1TBX A;  3FBI B;  2KHM A;  2HFH A;  4CO8 A;  3CD6 I;  1J9I A;  2CV2 A;  4JX4 A;  3H1C A;  2JA7 J;  5K5Q A;  3DKY A;  1R9T J;  1OCZ H;  2CW8 A;  4NDL A;  3HM5 A;  2M30 A;  3HEF A;  1FMV A;  4XON A;  5TRD A;  1O3S A;  1Z91 A;  4UVA A;  5GTH C;  3V8K A;  4B44 A;  5F0H A;  3RPU D;  3WG9 A;  4QPQ A;  3Q0U A;  3ZMD A;  4A3K J;  2GZW A;  1JUM A;  1FOY A;  2DN0 A;  3L2R A;  2LG4 A;  2RQP A;  2WAE A;  1H9T A;  4MQ9 F;  2FUG 2;  4IX7 A;  2XAQ A;  2M34 A;  1Y39 A;  4Q48 A;  3KLO A;  5IPA A;  2YS9 A;  4Q47 A;  2KIS A;  4PJM A;  5B1B H;  3ONQ A;  1PVE A;  4YII A;  2UUZ A;  4B4C A;  2Y31 A;  2BVL A;  1YIT I;  1XSV A;  1R5G A;  3I5U A;  1UHM A;  1Y56 A;  2JA8 J;  3RKX A;  2DYR H;  1FSE A;  5FB2 A;  3K4M A;  3FMR A;  2E5N A;  3S1N J;  4KIS A;  2NYX A;  2R5Z B;  1YLF A;  1QVU A;  4RAF A;  2V9P A;  3ELK A;  4PJN A;  2E1M C;  1Z9C A;  1LFP A;  2ETH A;  1YS7 A;  1KZH A;  2DPU A;  2E1C A;  3DP7 A;  1QZE A;  4D7M A;  2IS1 A;  4GXO A;  1SVM A;  2LBF A;  4HX4 A;  1WI3 A;  2RGV A;  3FHZ A;  1IRX A;  1UCR A;  1UG2 A;  3H3Z A;  5EZG A;  1SMY F;  4CDG A;  2IAI A;  3CO7 C;  2O8X A;  5EEH A;  1YRN B;  3CC4 I;  5H6R A;  3CCY A;  4S0H B;  5B3S H;  4U87 A;  4UB6 C;  4ABZ A;  4EV0 A;  1W0T A;  1U78 A;  3OL4 A;  4RGS A;  3ZQG A;  2HVS A;  2VKV A;  3VOE A;  5LEK A;  2AQF A;  4G9Y A;  4O5V A;  3DEE A;  5ERI A;  4CIC A;  1I6H J;  1ONV A;  2HZD A;  3HUG B;  1K78 B;  4MTD A;  2HWV A;  2CH0 A;  1XS9 A;  1VQM I;  2E19 A;  2KRH A;  2W84 A;  3GTG J;  1FP1 D;  1TTY A;  1L0O C;  1BR4 A;  4XRS A;  1B8I A;  2QEN A;  2X85 A;  3U21 A;  5C4J J;  3B02 A;  2GBY A;  2EV0 A;  1BIA A;  3BR1 A;  4KT6 A;  2HYG D;  2L9R A;  4LIU A;  3CJQ B;  3OOU A;  4AVZ A;  4NBQ A;  3HPG A;  2K5C A;  4HF1 A;  2CO5 A;  2QM3 A;  1F4K A;  3GTK J;  3HGG A;  4M3B A;  1BL0 A;  3S1Q J;  4CXF A;  2XIG A;  3BWG A;  4IXA A;  4DZJ A;  3NEU A;  4M9S A;  1B72 A;  2ZJP F;  2EK5 A;  3EUH A;  4M3G A;  3LSP A;  2IA2 A;  5FLX K;  3B6A A;  2ESN A;  1YW8 A;  5CYV A;  1HQC A;  5GPC A;  3OYF A;  2GXA A;  1V55 H;  3VPR A;  1G6N A;  2QVO A;  4DQ2 A;  1I3A A;  1BC8 C;  1MBF A;  2X9D A;  4N4O B;  3HIF A;  3HPH A;  2EBI A;  5F64 A;  1X58 A;  2LY2 A;  2HKO A;  4DYQ A;  4DJA A;  2IW5 A;  1C0W A;  2Y9Y A;  3DLA A;  3JTG A;  5IYD J;  2WAQ A;  4M74 A;  4E7J A;  1FYM A;  4LK1 F;  5L3C A;  1MSF C;  4QIW N;  4L9J A;  2JTV A;  3K6G A;  3RYR A;  3QPT A;  3BCA A;  1KQ9 A;  1ETO A;  5K1Y A;  3E6M A;  1W4M A;  1G59 A;  4IHW A;  2H8W A;  4UHT A;  1R1U A;  4EJO A;  3ZN0 A;  2VC1 A;  1XCV A;  1T98 A;  1SFK A;  1VTN C;  1X2M A;  4HDV A;  2MYS A;  1MNM C;  4BE0 A;  3ECO A;  5HLH A;  3T1B A;  3M3Y J;  2VPL A;  3K7A J;  2XV4 S;  3HKZ N;  3JRB A;  1QZY A;  3LSR A;  4PJL A;  1K4S A;  4M6X A;  2EZK A;  1REP C;  2Q0O A;  3S2H J;  3TO7 A;  1P6R A;  2DT7 B;  2JRM A;  2M0M A;  3L2Q A;  1YQA A;  2A3S A;  4PSW A;  3ABM H;  3I0T A;  3IKV A;  1IJW C;  2XPW A;  1Y8Q B;  1MD0 A;  4BQQ A;  5IOZ A;  2F5D A;  4M3F A;  1IUY A;  2E71 A;  3V4G A;  1EJ9 A;  4D0P A;  3F6V A;  1B9N A;  5LD2 C;  1JE8 A;  2V1U A;  2F4I A;  1O7L A;  5J1U A;  4XN0 A;  4XRM A;  3GTQ J;  3KYD B;  4GGG A;  1DUX C;  5ILS A;  1UAA A;  1IXC A;  2PG4 A;  1ZEL A;  2HNH A;  2I5U A;  4B09 A;  3KZI C;  3LST A;  4YIR X;  1WJE A;  2XSD C;  2A5W A;  2QQA A;  1S5L C;  1FT9 A;  2ZXJ A;  3S32 A;  3I4P A;  2HQA A;  2ZSI B;  4FT8 A;  3F23 A;  3JRG A;  4GYG A;  3LQR A;  2YPR A;  4FHT A;  1X1C A;  3HGY A;  1PUF A;  3EUK L;  1LFU P;  3J80 K;  2RRE A;  3ERM A;  5B5E C;  1RKT A;  3PFI A;  3NRV A;  1D1B A;  5L3F A;  1FBQ A;  1JJ8 C;  4CYC B;  4GFB A;  2NXN B;  3H3U A;  4AU7 A;  3C3W A;  3W2A A;  2HXO A;  1XG1 A;  4A3L J;  1XDU A;  2M3A A;  1WGX A;  4B48 A;  4RGX A;  2HU9 A;  4GYI A;  3PQK A;  2R0Q C;  2O5R A;  4HOB A;  1V5G A;  1B6A A;  3ESW B;  1TQI A;  4A2U A;  4BHP A;  2WV0 A;  4A6E A;  2LSO A;  5HVQ C;  4BEH B;  3H36 A;  4BGD A;  1IN8 A;  2BHZ A;  4OAZ A;  4A3I J;  2K9N A;  2KRC A;  4G94 A;  5BOX A;  3KYC B;  2M1B A;  1WQ2 A;  2ELH A;  3ZMT A;  2XAS A;  1ON2 A;  4ZC3 A;  3HXL A;  1EV7 A;  2L9V A;  5LRR A;  4CCN A;  1IN4 A;  2X4H A;  2KT0 A;  3BCB A;  2JA6 J;  1K4T A;  4KNY A;  1IW7 F;  4KIG A;  3M8J A;  3HUG A;  1K78 A;  3OIQ A;  4MLO A;  2CSO A;  1W36 C;  4LFU A;  4B3A A;  3D0S A;  2R7V A;  1P2F A;  4Y17 A;  3BR3 A;  1ENH A;  3JAM Z;  1XGM A;  1LE8 A;  1HLV A;  2R7T A;  3LFK A;  2I10 A;  5E1Z B;  1ZLJ A;  5F6F A;  2DA7 A;  4MEX F;  3F22 A;  3CJR B;  2VE8 A;  4L9T A;  2VOP A;  3IP4 B;  1MBE A;  2GQQ A;  1FIA A;  3WTS C;  1IN7 A;  3CCQ I;  1O3T A;  2XGC A;  5DUK A;  3PJR A;  2HXI A;  4CUG A;  5JLW A;  2KZV A;  4CZZ A;  3FF5 A;  3OYA A;  1ZHF A;  2DTZ A;  2GM4 A;  2P6S A;  3H0D A;  3C2B A;  2GIZ A;  3MAJ A;  4KIT B;  4I76 A;  4LB6 B;  1J75 A;  1TT5 B;  2DYS H;  1RKW A;  2VKE A;  3CCU I;  2P7C B;  3M4O J;  3OYG A;  4PK4 A;  2FEZ A;  4HQM A;  2JUG A;  2E36 A;  4EJT A;  4IHY A;  2JT1 A;  2ACJ A;  3QYB A;  2VON A;  4EMS A;  2NS7 A;  1FBU A;  1K61 A;  2XHK A;  4PCQ A;  3SZT A;  3KP7 A;  1IRF A;  4IPA A;  5LHG A;  4B1R A;  3HJE A;  2BOL A;  2KMU A;  3FIW A;  3FHN A;  4BE1 A;  2Z2S B;  3HOW J;  4I0A A;  3KZY A;  3U9G A;  2JA5 J;  2P5K A;  3E6D A;  2PX9 A;  1ZR2 A;  3CES A;  3BTJ A;  2DA6 A;  2MA3 A;  5A2Q K;  1K6O A;  3G1O A;  3LAJ A;  3E97 A;  1Z05 A;  2E7X A;  3RKQ A;  2CWE A;  2LKS A;  2L02 A;  4RS8 A;  3VYS B;  3MFK A;  2LLK A;  2DDA A;  3LSG A;  2LFB A;  1ETW A;  4ZH4 F;  2JRT A;  3KP5 A;  1H0M A;  2R92 J;  2P0W A;  2Y0M A;  1Z6T A;  1J7K A;  2L9N A;  3EPZ A;  1MMS A;  2R7X A;  2STT A;  1J2X A;  2DA1 A;  3SHF A;  5K5R A;  5DEQ A;  3VSK A;  4IJA A;  1U2W A;  3HYI A;  5DCF A;  4A0Z A;  2DOE A;  3IKT A;  4W97 A;  3BG6 A;  5D5W B;  3F8B A;  2K4J A;  2M8E A;  2VE9 A;  1JGG A;  5L3D A;  2LMD A;  4AID A;  2CV1 A;  4BU2 A;  2GIV A;  2X48 A;  5IY5 H;  2ELK A;  2PJR B;  2QGU A;  1R58 A;  5HNF A;  1PP8 F;  3H9G A;  1D0X A;  2HZT A;  2R5Z A;  2DO7 A;  4FQG A;  4C30 A;  1VQK I;  1D5V A;  3GTL J;  2EIJ H;  3LA7 A;  1JGS A;  4XL9 A;  2H6C A;  5DV5 A;  2CQQ A;  1BOA A;  2ICW G;  5FFZ A;  1D8K A;  4NB5 A;  4RAG A;  2X1E A;  3V7S A;  2R4G A;  1YW9 A;  4F92 B;  4WK8 F;  1MW7 A;  1P92 A;  3SJM A;  2ME0 A;  1R49 A;  5DYM A;  2IA0 A;  2KIM A;  4NQW B;  3JSP A;  3BZ6 A;  1Y8R B;  4NC6 A;  3EUH C;  2VIX A;  2P4W A;  2DQR A;  3OS1 A;  4LLN A;  2EIK H;  5E3N A;  5J4V A;  1SVO A;  1K6Y A;  4BQO A;  3S15 J;  2XPV A;  3I58 A;  4IOC F;  3K9T A;  3MKZ A;  2NAZ A;  2ISY A;  2WY8 Q;  2LP0 A;  5EYR A;  3Q9S A;  3C18 A;  2W7N A;  3P5J A;  4EGY A;  5F08 A;  3U2R A;  4XNF A;  3JRD A;  5BNG A;  3ZMS A;  1JUS A;  3DU6 A;  4E7S A;  3LAP A;  3HOZ J;  3BZC A;  4LOC A;  3CC7 I;  1R4M B;  1PP7 U;  5J47 A;  4E4H A;  5E79 C;  2GA2 A;  3ZMV A;  3R0J A;  2VQL A;  4UVB A;  3CME I;  1POG A;  1LE8 B;  2AXT C;  5JFR A;  5TJJ A;  1D5Y A;  2A05 A;  2BGC A;  1HCR A;  1J5Y A;  1Y0U A;  3I55 I;  1IUF A;  2RVC A;  1ODD A;  1KQ0 A;  1ZYR F;  1Z7L A;  2XAU A;  3ECH A;  3FWE A;  2A69 F;  5B66 C;  4PZJ A;  2EIM H;  4Z6Y A;  2ZME B;  2XAH A;  5CQG A;  1TW2 A;  2BV6 A;  1GVD A;  1SFU A;  4XID A;  4MNU A;  3IWZ A;  2W25 A;  2FU4 A;  4CCK A;  2MBF A;  4ITV A;  2VT2 A;  1GT0 C;  4RGR A;  2VXZ A;  4RMN A;  1OCP A;  1KYZ A;  3FIS A;  2DMU A;  3ZN1 A;  4HF2 A;  4G7O F;  2VPR A;  4OAY A;  2WAF A;  3FXQ A;  2QEX I;  3OYC A;  1OQY A;  4BL0 B;  1JKR C;  2K9M A;  3HOV J;  4X0G A;  4WXD A;  1BR2 A;  5EJC A;  3JRF A;  2W48 A;  2HVR A;  5EEA A;  1CF7 A;  5H20 A;  1IAW A;  3DXJ F;  3SFI A;  2L7M P;  1FEX A;  4F93 B;  1X1P A;  4WX9 A;  2L7Z A;  2JSC A;  5DS9 A;  2Q2E B;  1Z1D A;  3ABU A;  3ISP A;  3GBG A;  1FY7 A;  2ZJQ F;  1X2N A;  1UHW A;  2MGQ A;  5J40 A;  3A03 A;  4OMZ A;  4AIJ A;  4G6D A;  2M4G A;  2E7W A;  1WCM J;  4DYC A;  2IPQ X;  4HPQ A;  1E3O C;  2B7E A;  4X1E A;  3DCF A;  2CJJ A;  4G6T B;  3AFH A;  4IKF A;  1Z3X A;  5CVV A;  1RRJ A;  4TV7 A;  2VXD A;  4C3J J;  5LHH A;  3WGH A;  2FNA A;  2XAF A;  3ZQH A;  2O3F A;  2Y75 A;  4FE7 A;  5GAG J;  4NC7 A;  3OYL A;  5EZH A;  2H1K A;  1Z7U A;  2JVH A;  3M1C A;  1T95 A;  3D5R C;  1X4P A;  4I7H A;  5FKK A;  1BI1 A;  5FD6 A;  5K7F A;  2A07 F;  3BTC A;  2JMW A;  4EEF G;  1W36 D;  3PQJ A;  4M73 A;  3DEU A;  4CH7 A;  5BMZ A;  4IHS A;  4BXU A;  4A5M A;  1YIJ I;  2FF4 A;  3M1E A;  2RAE A;  1AKH A;  1QHH D;  3Q0W A;  3U1D A;  2JWT A;  4Y13 A;  4J00 A;  2IGK A;  3R60 A;  1FZP B;  1ZRC A;  4LG0 A;  1IV6 A;  2BW3 A;  2M5W A;  4A3E J;  3QOE A;  2JUC A;  2ZXW H;  3ML6 A;  1P9Q C;  3ZGK A;  3KYL A;  3QP6 A;  4II3 A;  2E35 A;  2EFN A;  5B1A H;  2M45 A;  4IRI A;  1QRY A;  1OFC X;  2M87 A;  5ICF A;  3DTK A;  2OA4 A;  1U9O A;  2R5Y B;  4PJ0 C;  1P4X A;  2IS6 A;  4L9N A;  3KPH A;  4CZC A;  3S2D J;  2W4S A;  1ETQ A;  3S1M J;  1XGS A;  1JI8 A;  3MN2 A;  1IC8 A;  1SD7 A;  4FX0 A;  3VYU B;  2P5L C;  1HC8 A;  5J1Y A;  1ITY A;  1F9N A;  3DBL B;  2K02 A;  3RIR A;  2OTL I;  1VQ9 I;  2NRA C;  4HAM A;  4P96 A;  1WZ2 A;  1UST A;  1YO5 C;  3CF2 A;  2KDO A;  3I9V 2;  2EH3 A;  4CYC A;  3HG9 A;  1I3Q J;  2QKL B;  3WHC A;  4GO1 A;  4RBO A;  4DIQ A;  3KZZ A;  1LUJ B;  3P9C A;  1QO0 D;  1UMQ A;  3DQV C;  4M71 A;  5J1R A;  1VND A;  2MFZ A;  3E1S A;  4KDP A;  1R00 A;  2B0L A;  2XRO A;  4XBF A;  3AKZ A;  2ISZ A;  5F27 A;  4AYB N;  4XR6 A;  4DBQ A;  2VBZ A;  4AWX B;  2OQG A;  1AA7 A;  2IBD A;  3A02 A;  3CLO A;  2CV0 A;  4A3D J;  3J81 Z;  3J7Y J;  3L7W A;  1G8X A;  3FX3 A;  5JHU A;  2QA4 I;  2O9L A;  4AD9 A;  3W2W A;  1Z77 A;  4LJZ F;  5E8G A;  3COA C;  1N78 A;  3N97 A;  4RDU A;  2A68 F;  3KFW X;  3TBI A;  1Q1H A;  3A0H C;  3G1L A;  4F91 B;  3PIO F;  1A31 A;  2K3F A;  3H5N A;  2FQ4 A;  3EYI A;  3FKJ A;  5CVJ A;  5GAE J;  1FPQ A;  4EJU A;  5L3E A;  4WCG A;  2VUM J;  2NVT J;  2LRE A;  4BUP A;  2TCT A;  5HDN A;  3JR9 A;  1ZRD A;  2OBP A;  4LG0 B;  2L4M A;  3HSR A;  3I3L A;  3IRR A;  3CTA A;  2CW0 F;  2IEK A;  1YJW I;  4NHJ A;  2I8D A;  3CCE I;  1RUO A;  4M9X A;  3SQN A;  1G4D A;  3GVA A;  2F4M B;  2VT3 A;  1MKM A;  3PL8 A;  1VQ5 I;  5DM6 F;  1A5J A;  5GPA A;  3GTO J;  2K27 A;  1XSX A;  1MJ9 A;  2P5V A;  2NNY A;  2DAO A;  1DU0 A;  1EA3 A;  1H88 C;  2CQX A;  1ZKG A;  1TQM A;  2AO9 A;  5DD8 A;  1W5T A;  2F5V A;  3OR2 C;  3GYH X;  2QCO A;  5DTD A;  1Z21 A;  2CFX A;  1YW7 A;  5D4S A;  5FRM A;  2D5V A;  1I5Z A;  1U5T A;  2OQR A;  3GEZ A;  3KP4 A;  3MEX A;  3TDU C;  1TZL A;  2VL8 A;  4BKX A;  1FWZ A;  2XF7 A;  4F52 A;  5D6E A;  4J01 A;  3RDI A;  2WB1 A;  3IC7 A;  3DV8 A;  1MBK A;  2P6T A;  4BS9 A;  4XSX F;  3OMY A;  2ZSH B;  4HRI A;  1RES A;  2G0E A;  2Q2E A;  3QWL A;  4U0Y A;  3GO5 A;  5EG0 B;  4K2E A;  3WTU C;  2HGC A;  4RLQ A;  1G2H A;  4XRF A;  4IZZ A;  5HLT A;  3W6J B;  1LKX A;  2XKP A;  4ASN A;  1JKQ C;  2K3P A;  2E60 A;  1KU7 A;  4UB8 C;  4UUS A;  3IRQ A;  4LIT A;  2BY1 A;  3TQN A;  2Y48 A;  3A1Y A;  1HKS A;  5FGM A;  1IDZ A;  5IYB J;  2Z9O A;  3OSF A;  1WHU A;  3GLL A;  3QAH A;  2DJN A;  3D5S C;  1H8A C;  5ILV A;  4KYW A;  1EF4 A;  2XGD A;  1QA6 A;  1G3Y A;  1XMK A;  1LPQ A;  2CUF A;  2D1H A;  1JT6 A;  4L5I A;  3V8J A;  3K70 D;  2MG4 A;  5L3G A;  2X6X A;  3GFI A;  1WRJ A;  4UVC A;  2E2H J;  4D5C A;  1HDP A;  3PNT A;  1QVT A;  2XKO A;  1LDJ A;  2HTS A;  3TO9 A;  1ZGW A;  1K79 A;  1TWA J;  3P9K A;  3ZQ7 A;  1J0R A;  2HYJ A;  4ENK A;  1IDY A;  2BY3 A;  3ABK H;  1R1V A;  1U5T C;  3EQL F;  1G3S A;  2L54 A;  2OZU A;  1W0U A;  1QHG A;  2FA5 A;  3ZQF A;  5L3B A;  4ZZD A;  4RB3 C;  3N05 A;  1YFH A;  1A35 A;  1XGN A;  3F8F A;  1TWH J;  4IEJ A;  3L9F A;  4BQN A;  1V5E A;  2K86 A;  2RN7 A;  3G73 A;  2O61 A;  3D1N I;  5E1W A;  1FX7 A;  2JVG A;  5M5W J;  4GDF A;  1GHC A;  3PUB A;  1KGS A;  4WF2 A;  4I99 C;  3IAS 2;  3NQO A;  1XN7 A;  2Z33 A;  2DA5 A;  2PLY A;  5LRS A;  2KL4 A;  1AWC A;  2IJL A;  3BPX A;  1SAU A;  3F0C A;  3CF5 F;  1PUE E;  2OV7 A;  1QPM A;  3HOU J;  2EB7 A;  3D5L A;  3RCO A;  1I27 A;  3W2V A;  3FXM A;  1BA5 A;  2M8G X;  1UHS A;  2EA4 A;  4NNJ A;  5HS7 A;  1NH3 A;  2HKX A;  3T8R A;  2VOO A;  1IZ1 A;  2EFO A;  3BQZ A;  2CQ7 A;  4IL6 C;  4YRV A;  3PSI A;  3A01 B;  1MBJ A;  2FXA A;  3BT9 A;  3ZPL A;  5H2F C;  1GVJ A;  4M6V A;  1OCO H;  1TQP A;  4B43 A;  3W3C A;  2GA1 A;  2A61 A;  4BDZ A;  1RUN A;  2QUF A;  2E5Z A;  3QU3 A;  1P7I A;  2DLL A;  4F7Z A;  4RLF A;  4RB2 C;  5JVT A;  2XRN A;  4JOM A;  1STZ A;  3DLL F;  3CCL I;  1I50 J;  2XAJ A;  2DBB A;  3I71 A;  1FOX A;  1YIO A;  2ZNZ A;  3PIP F;  3K10 A;  2D45 A;  4ON0 A;  1ZGA A;  2DK8 A;  2MAB A;  3G4S I;  4BAC A;  1VFC A;  2RV8 A;  2QLZ A;  4ENJ A;  3A2K A;  5FJ8 J;  4KUM A;  4P9U A;  3RTR A;  3O2P E;  2FML A;  3OY9 A;  3CCV I;  2WA0 A;  3DKW A;  1YJN I;  5LEJ A;  1BC7 C;  2AHQ A;  3HDD A;  1HF0 A;  1R23 A;  2FBH A;  2ZJ2 A;  1T33 A;  3TKY A;  1GXP A;  3DKX A;  2DXI A;  1E0E A;  1LDD A;  4XKB A;  1ZH5 A;  1I1S A;  2JA2 A;  5AIP A;  3H3V K;  2DMT A;  2FBI A;  2X6Y A;  3HL2 A;  4ZJZ A;  4II2 A;  4MIM A;  2ZCW A;  1YX3 A;  4IRG A;  1LDK B;  3OYM A;  3CZ6 A;  1WH7 A;  2K7L A;  1NTC A;  3FK6 A;  2RNJ A;  4UY8 I;  1MDM B;  1JHF A;  1ON1 A;  1Y0N A;  4BXX J;  1XPX A;  2G9W A;  2VQG A;  1JTY A;  2E2I J;  4OIR F;  2B9S A;  2A6E F;  2XVC A;  4KIC A;  2WBM A;  3K2A A;  4QLC U;  1OJL A;  4E70 A;  2HPI A;  1S29 A;  2DMQ A;  3QYF A;  3RZD J;  4A93 J;  1UZC A;  3ZQQ A;  3GTP J;  1Y1V J;  3BR6 A;  3RJP A;  1MND A;  3WTW C;  4XK4 A;  4KA4 A;  3RZO J;  4KT5 C;  3CDI A;  3GFL A;  3K4B A;  3BTL A;  3DEW A;  3QPH A;  1DPR A;  1BOB A;  1CF7 B;  1SC7 A;  3H35 A;  3DFG A;  1MIJ A;  2DFI A;  1S72 I;  2OZ6 A;  4LG3 A;  1WJA A;  1B1B A;  3GTM J;  2DA4 A;  3RPU A;  3TP0 A;  2L7K A;  1VQP I;  3DBH B;  1RR8 C;  2V1X A;  5FKL A;  2KZG A;  1SAN A;  2W57 A;  3IWF A;  4XKV A;  3ASO H;  4KFC A;  3O8G A;  1O3Q A;  4DZP A;  2FBK A;  5BQT A;  1VQ7 I;  3FXK A;  2NS0 A;  5EDN A;  4N4N B;  5KHD A;  2IA1 A;  3S14 J;  2XB5 A;  2VJ5 A;  1I1G A;  1G3T A;  2VI6 A;  2EQR A;  2L7F P;  2L0K A;  4OU0 A;  1BJA A;  1B4A A;  3OSG A;  2PMZ N;  3FXJ A;  2Q1Z B;  3EET A;  5ILU A;  1R22 A;  2XRL A;  2LF8 A;  3A0B C;  2KIU A;  3LA3 A;  5IT3 A;  5J6X A;  1BI3 A;  2BVM A;  2K85 A;  4KIF A;  1MJB A;  1QGP A;  3KLN A;  3DBR B;  5DD4 A;  3HSE A;  1I6X A;  2JK3 A;  3V8L A;  4ZYH A;  1V5F A;  2PMH A;  4OOI A;  1Z0X A;  4E7K A;  3I59 A;  5M3M J;  4E7I A;  4EGZ A;  1SFX A;  4ANJ A;  2IS4 A;  4E7Z A;  1YRN A;  4BH9 A;  4G7H F;  1HW2 A;  1Y6I A;  1SAX A;  1W7P D;  4XMY A;  1VI0 A;  4HNV A;  1ETV A;  3M8E A;  2LBF B;  1EKE A;  1R5I D;  2O6G E;  2QQ8 A;  1T56 A;  2BHY A;  4PJJ A;  4UV9 A;  1VQO I;  4L0Z B;  2NVQ J;  1O7F A;  1S6L A;  5C3E J;  3OYJ A;  5FLM J;  4HZF A;  4XKC A;  4I01 A;  2HYF A;  2GOM A;  2HQ5 A;  1OYW A;  5JHF A;  2H8R A;  3SZG A;  3BY6 A;  1IG7 A;  1B9M A;  3DTE A;  1RR7 A;  5LBQ A;  3OYD A;  4OIN F;  2L9S A;  1LQ1 A;  1R5H A;  1FJL A;  3K4J A;  3A01 A;  1WVR A;  1TNT A;  3VYT B;  3NAR A;  2R7F A;  5F0C A;  4BBR J;  3G71 I;  2JQ7 A;  3E0J B;  4FX4 A;  1KYW A;  3U1K A;  2CUZ A;  1IV8 A;  1ZGJ A;  2QWW A;  4I98 B;  2MW8 A;  4XM3 A;  4XKW A;  3R0A A;  4QTR A;  1XGO A;  4HQE A;  3AAF A;  3CUQ C;  2LC2 A;  3S2W A;  4A69 C;  3M7G A;  1LEA A;  1IN5 A;  4DGW B;  4Q5S F;  4ZYA A;  2QQ9 A;  3ZR8 X;  2EIL H;  3QOP A;  4P5O A;  2EWN A;  3MKW B;  1N77 A;  1IXR C;  2FE3 A;  1WJ5 A;  5CPR B;  3CP8 A;  4PSX A;  4IF4 A;  1MZB A;  4EQQ A;  5E8I A;  4M6Y A;  4PGH A;  4IHT A;  1ZAO A;  1XX5 A;  4CCM A;  4Y3O A;  3S93 A;  3HOT A;  2MH2 A;  5D6F A;  1NK2 P;  2W82 A;  5HS9 A;  3ZRG A;  4X6A J;  3H5A A;  2O0Y A;  2DOD A;  4ESJ A;  2MSY A;  1TWF J;  1FLI A;  3V7R A;  2E34 A;  2WWY A;  4RB0 A;  3T8T A;  5CQE A; 
#chains in the Genus database with same CATH homology
 5E3O A;  1I6H J;  4D7N A;  2NS8 A;  3BG5 A;  1XS9 A;  1QRY A;  1OFC X;  1FIP A;  1GDT A;  2E19 A;  3GTG J;  4MFD A;  2K9S A;  1U9O A;  1ZK8 A;  4XRS A;  2R5Y B;  1B8I A;  1IGN A;  5C4J J;  3O8H A;  3S2D J;  3S1M J;  1ETQ A;  2GBY A;  3BR1 A;  3BTI A;  1JJ6 C;  3MN2 A;  2L9R A;  2O8K A;  3OOU A;  1IC8 A;  3S1Q J;  3GTK J;  3HOX J;  3HGG A;  4M3B A;  1BL0 A;  4DZJ A;  5J1Y A;  1ITY A;  1TWG J;  1B72 A;  1QPI A;  1JKP C;  4M3G A;  3LSP A;  4Y52 J;  2EZL A;  3B6A A;  5GPC A;  2EH3 A;  2HI3 A;  4CYC A;  4A3E J;  1I3Q J;  3VPR A;  1DU6 A;  3WHC A;  4RBO A;  1MBF A;  2COB A;  3LOC A;  2X9D A;  5EG0 A;  1UMQ A;  2EBI A;  3QPL A;  1X58 A;  3BG9 A;  5J1R A;  1MH4 A;  1VND A;  4DYQ A;  5EGO A;  2ECC A;  2Y9Z A;  1K83 J;  2Y9Y A;  3IH3 A;  5IYD J;  5M3F J;  4A3C J;  1MSF C;  4QIW N;  5F27 A;  4AYB N;  4D5F A;  4FIS A;  2Y2Z A;  3A02 A;  1U9N A;  2IBD A;  3TW6 A;  1ETO A;  3JRE A;  4A3D J;  3JRH A;  4IHW A;  1S7E A;  2M2E A;  2CRG A;  2WAQ N;  2O9L A;  1Z77 A;  3L1P A;  2FJ1 A;  1X2M A;  5F1J A;  2LD5 A;  4AC0 A;  4RDU A;  2XB0 X;  1MNM C;  3PO3 J;  3M3Y J;  5M5X J;  3G1L A;  3K7A J;  2FQ4 A;  4JX5 A;  4XIC A;  3HKZ N;  2VUM J;  3JRB A;  2KDZ A;  1TWC J;  2NVT J;  1APL C;  3LSR A;  2TCT A;  2EZK A;  3JR9 A;  3Q0V A;  3S2H J;  2DMP A;  1IJW C;  2XPW A;  3Q3S A;  1TC3 C;  2R7Z J;  2IEK A;  3H0G J;  2CU7 A;  3ZOB A;  2LR8 A;  5IOZ A;  5IOY A;  4M3F A;  2DA3 A;  3HB9 A;  3JRC A;  1AHD P;  3MVP A;  3RQI A;  1A5J A;  4UUT A;  5GPA A;  3G1M A;  5J1U A;  4XRM A;  3GTO J;  3BQY A;  3GTQ J;  4M3E A;  1DU0 A;  4DW6 A;  4V2G A;  1H88 C;  4IHX A;  2CQX A;  1ZKG A;  2AO9 A;  5EF6 A;  3B6C A;  4AUX A;  2HOA A;  4MFE A;  3S17 J;  2XSD C;  2N8G A;  2QCO A;  3TP3 A;  5DTD A;  2D5V A;  3JRG A;  5E3L A;  3HGY A;  1PUF A;  1F43 A;  2E1O A;  4BKX A;  1LFU P;  1RKT A;  3LNQ A;  2NOG A;  3IH4 A;  1MBK A;  1JJ8 C;  4CYC B;  1RES A;  2Y30 A;  4J19 A;  2G0E A;  4GFB A;  3W6V A;  3OIO A;  2HXO A;  4FCY A;  5EG0 B;  4A3J J;  1XG1 A;  1G2H A;  4A3L J;  5EGO B;  1WGX A;  4V2F A;  5J3L A;  1GV2 A;  2R0Q C;  1JKQ C;  4UUS A;  2YUS A;  1IDZ A;  3PM1 A;  4C3I J;  5IYB J;  4A3I J;  2K9N A;  3OSF A;  2DJN A;  1H8A C;  1EF4 A;  2R5Y A;  2XGD A;  2LY9 A;  2TRT A;  2KT0 A;  2JA6 J;  2CUF A;  1JT6 A;  2EZH A;  4DYR A;  2X6O A;  2MG4 A;  1ETX A;  1HDD C;  4MLO A;  2E2H J;  4D5C A;  1HDP A;  4B3A A;  1QVT A;  5GP9 A;  1BW5 A;  1FTZ A;  3BR0 A;  3FKI J;  1GUU A;  1ZGW A;  1TWA J;  1OCT C;  3BR3 A;  1ENH A;  2HYJ A;  1LE8 A;  4JX6 A;  1HLV A;  1IDY A;  2I10 A;  1IRZ A;  2DA2 A;  2M9H A;  2DA7 A;  1W0U A;  3ZQF A;  1GV5 A;  4MO7 A;  1MBE A;  2XPU A;  1BW6 A;  1FIA A;  1TWH J;  4IEJ A;  2FD5 A;  2XGC A;  3D1N I;  3QPS A;  1RPW A;  2HXI A;  5JLW A;  3ZQL A;  5IP9 J;  1H89 C;  5M5W J;  2GM4 A;  2DTZ A;  3GTJ J;  3CDL A;  2GLO A;  3C2B A;  4I76 A;  2DA5 A;  1O4X A;  1RKW A;  2VKE A;  1AU7 A;  3ZQI A;  3F0C A;  3M4O J;  3NAU A;  1LFB A;  3HOU J;  4FTH A;  2FX0 A;  3IH2 A;  5HOD A;  1BA5 A;  2M8G X;  1UHS A;  1ORK A;  4IHY A;  1PUF B;  5F04 A;  3BQZ A;  2NS7 A;  5IP6 A;  3SDG A;  2NVX J;  3JRI A;  1K61 A;  3A01 B;  1NK3 P;  1RET A;  1MBJ A;  4B1R A;  3BT9 A;  4IHV A;  2DMN A;  4BBS J;  5F0F A;  4M6V A;  3HOW J;  3FIW A;  4A3M J;  2K9Q A;  2JA5 J;  4M3D A;  1ZTR A;  2LKX A;  5JLX A;  1F36 A;  1ZR2 A;  2ZB9 A;  3BTJ A;  2DA6 A;  1P7I A;  3G1O A;  3E7L A;  3RKQ A;  1A6I A;  2LLK A;  2E2J J;  1I50 J;  3LSG A;  2LFB A;  1ETW A;  4L5E A;  3BR2 A;  3TED A;  2R92 J;  4A3G J;  5C44 J;  1P7J A;  1VFC A;  2WB1 N;  2XGE A;  2DA1 A;  4W1U A;  5FJ8 J;  5FLV A;  2O7O A;  3TW7 A;  3HDD A;  2AHQ A;  4W97 A;  1HF0 A;  5FKN A;  1AKH B;  1T33 A;  3BG3 A;  3QQA A;  3CQZ J;  4C2M J;  2K40 A;  3HOY J;  9ANT A;  2ID6 A;  4Y7N J;  1CQT A;  3H3V K;  4UUS B;  1JGG A;  2DMT A;  3WHB A;  1MBH A;  1WH5 A;  4XRS G;  4MIM A;  5E3M A;  2X48 A;  1WH7 A;  2ELK A;  1NTC A;  4JP0 A;  3FK6 A;  2JJ7 A;  4JYK A;  2NVY J;  4BXX J;  3FK7 A;  2Y0S N;  1JTY A;  2E2I J;  2R5Z A;  2HDD A;  1SFO J;  3K2A A;  2YU9 J;  3GTL J;  1OJL A;  1ETY A;  1U8B A;  2DMQ A;  4A93 J;  3RZD J;  5IYC J;  3GTP J;  2CQQ A;  2QF7 A;  4I6Z A;  1ZQ3 P;  1Y1V J;  3MKL A;  3BR6 A;  2CUE A;  2P81 A;  3BR5 A;  1ETK A;  4XK4 A;  3RZO J;  3S16 J;  3PO2 J;  5K7Z A;  3I4N J;  3BTL A;  3DEW A;  2ID3 A;  3SJM A;  3UKG A;  2ME0 A;  3S1R J;  2LK2 A;  1BJZ A;  2ME6 A;  5FKO A;  1B72 B;  2DA4 A;  3GTM J;  4FE4 A;  3TP0 A;  2ECB A;  3HBL A;  5FKL A;  5E3N A;  3S15 J;  1SAN A;  2XPV A;  2R93 J;  3O8G A;  4DZP A;  4BY7 J;  5EYR A;  2LP0 A;  5EDN A;  3JRA A;  5F08 A;  1VF9 A;  2OF7 A;  3JRD A;  5BNG A;  3S14 J;  4G12 A;  1HOM A;  2XB5 A;  2HOS A;  1Y1W J;  1JUS A;  2VI6 A;  3HOZ J;  2EQR A;  2L7F P;  5IP7 J;  2L0K A;  4LOC A;  4BY1 J;  3OSG A;  2PMZ N;  2JN6 A;  2XRL A;  2HOT A;  1POG A;  1LE8 B;  1HCR A;  1D5Y A;  1JT0 A;  2LVS A;  1IUF A;  4QSH A;  2B63 J;  1JUP A;  2JK3 A;  2WV1 A;  5K7H A;  4C3H J;  1GVD A;  1JTX A;  1Z0X A;  4XID A;  1JKO C;  5M3M J;  1FTT A;  1GT0 C;  1YRN A;  1WPK A;  4JX4 A;  3ZQC A;  2JA7 J;  1OCP A;  1MSE C;  3FIS A;  2DMU A;  2VPR A;  4A3F J;  1VI0 A;  1R9T J;  4NDL A;  1ETV A;  4HNV A;  3HM5 A;  3HEF A;  1JKR C;  3HOV J;  2OPT A;  5F0H A;  1T56 A;  2NVQ J;  3JRF A;  2W48 A;  3Q0U A;  4A3K J;  5EEA A;  1JUM A;  3SFI A;  2L7M P;  2DN0 A;  5C3E J;  1FEX A;  5FLM J;  2L7Z A;  2M34 A;  2HQ5 A;  5DS9 A;  2H8R A;  5IPA A;  1IG7 A;  2YS9 A;  1RR7 A;  1ZR4 A;  3GBG A;  1X2N A;  1FJL A;  2MGQ A;  3A03 A;  3A01 A;  4B4C A;  3NAR A;  1WCM J;  2Y31 A;  4DYC A;  1E3O C;  5F0C A;  4BBR J;  1B8I B;  4X1E A;  3DCF A;  2CJJ A;  4A3B J;  5C4X J;  2JA8 J;  2MW8 A;  4C3J J;  4QTR A;  3ZQH A;  3S1N J;  3CMY A;  4A69 C;  2R5Z B;  4FE7 A;  1QVU A;  5EZH A;  1Q1V A;  2H1K A;  3I4M J;  1XC5 A;  2EZI A;  1MH3 A;  5FKK A;  5K7F A;  2LTP A;  3BTC A;  2JMW A;  4EEF G;  4D7M A;  1WI3 A;  2RAE A;  1UG2 A;  1AKH A;  3Q0W A;  1NK2 P;  5EZG A;  2M0C A;  2IAI A;  3LSJ A;  3IV5 A;  2JWT A;  1YRN B;  4X6A J;  5FKM A;  3CCY A;  4S0H B;  2MSY A;  4ABZ A;  5M5Y J;  1TWF J;  1W0T A;  1U78 A;  1MBG A;  1IV6 A;  3ZQG A;  2VKV A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...