1DU6A

Solution structure of the truncated pbx homeodomain
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
64
structure length
64
Chain Sequence
SSGHIEGRHMNKQATEILNEYFYSHLSNPYPSEEAKEELAKKCGITVSQVSNWFGNKRIRYKKN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Gene regulation
molecule keywords HOMEOBOX PROTEIN PBX1
publication title Conformational changes in the PBX homeodomain and C-terminal extension upon binding DNA and HOX-derived YPWM peptides.
pubmed doi rcsb
source organism Mus musculus
total genus 14
structure length 64
sequence length 64
ec nomenclature
pdb deposition date 2000-01-14
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.60 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Homeodomain-like 1du6A00
3O8HA 1IDYA 2VI6A 1GVDA 4BBRJ 5M3MJ 4V2FA 3S15J 5E3LA 2AHQA 2HXOA 3BR5A 4FTHA 5JLWA 2JA5J 2EZIA 5BNGA 2R0QC 1W0UA 1S7EA 3H0GJ 4D7MA 1ENHA 1MNMC 1SFOJ 2AO9A 2CQQA 1JKOC 4UUTA 4V2GA 1JJ6C 1A6IA 3BR0A 2Y0SN 5IP7J 1ZTRA 3F0CA 4RBOA 1TC3C 1YRNA 9ANTA 3GTPJ 2K9SA 2LVSA 4XRSG 2EQRA 1HOMA 1LE8B 3IV5A 2DMPA 4I76A 5E3MA 3B6AA 2E2JJ 1WI3A 2XB5A 5EZHA 3HOZJ 3JRGA 3RZDJ 2HOSA 1ETXA 1JUSA 1UG2A 4D7NA 3BR1A 1OFCX 5F0CA 2LLKA 3OIOA 2YU9J 2XRLA 3LSPA 1F43A 4FCYA 4JX4A 3CCYA 3A02A 1X2NA 4A69C 2L0KA 2MGQA 4A3KJ 5M5YJ 3BG9A 3CMYA 2NVTJ 3TW7A 5EZGA 3TEDA 2HQ5A 3PO3J 5FKNA 5K7HA 3A03A 2CJJA 2TRTA 2GM4A 3A01B 1SANA 3JRBA 2VUMJ 2VPRA 5K7ZA 1K61A 2NVQJ 1JUMA 4MO7A 1X2MA 2O7OA 4XICA 3M3YJ 5GP9A 2N8GA 1ZR2A 1JJ8C 4CYCA 3CDLA 3Q0WA 1FIPA 3QQAA 2NOGA 3ZQGA 2DA7A 2K9QA 3Q3SA 3JRIA 3S1QJ 1U8BA 4C3HJ 2NVXJ 1FTZA 2EZLA 2LK2A 3FK7A 4QIWN 5FKMA 5FLVA 1LFBA 3HDDA 4XRMA 3E7LA 4DZPA 2OF7A 2HXIA 3I4MJ 1AU7A 3OOUA 5E3NA 3G1OA 1ZK8A 4JP0A 2HDDA 3MKLA 1DU6A 1QVUA 1ZGWA 3HOUJ 1PUFA 1GDTA 3W6VA 1P7JA 4A3GJ 1UHSA 1YRNB 2VKVA 3QPSA 5F0HA 2WV1A 4S0HB 5J1UA 2WB1N 2HOTA 2X9DA 1IUFA 1K83J 1JUPA 1U9OA 1FTTA 2YS9A 3VPRA 4BKXA 2OPTA 3BTCA 1RKTA 2R7ZJ 3S1RJ 1MBEA 3HOYJ 4A3FJ 2JJ7A 1RR7A 4M3GA 5C3EJ 4D5CA 2DA2A 1TWFJ 4AC0A 4M6VA 3CQZJ 5JLXA 1MBGA 1RPWA 1MBHA 4D5FA 3C2BA 1Y1VJ 3JREA 5C4XJ 2B63J 2EBIA 2ME6A 1ZR4A 2LD5A 2XB0X 2DMQA 3OSGA 4DW6A 5IP6A 3BR6A 4J19A 1HF0A 4GFBA 1MSFC 3B6CA 2DJNA 2KT0A 3S1MJ 1TWHJ 1HDDC 4X6AJ 2DA1A 4C3JJ 1RESA 5DTDA 1Y1WJ 5EG0A 3GTKJ 1ETYA 1MH3A 1MSEC 4AYBN 3RQIA 2K40A 5FJ8J 4BXXJ 4A3DJ 1XG1A 2EH3A 4QTRA 4JYKA 3HOWJ 5F27A 1JKRC 3BTIA 3WHCA 3OSFA 1A5JA 4G12A 2JWTA 2ME0A 2E1OA 3GTLJ 3S2HJ 2NVYJ 2DN0A 2M8GX 1X58A 2PMZN 1NTCA 3BQYA 4MFDA 1JTYA 1IRZA 3TP3A 3HM5A 2DA4A 3SFIA 1PUFB 5GPAA 3JRDA 5IOYA 1ITYA 4XIDA 1B8IA 2X48A 4DZJA 1JT6A 2E19A 5FKLA 1BJZA 1O4XA 1HLVA 3LOCA 2R93J 4XK4A 5IYDJ 1JKPC 2K9NA 1ORKA 2LR8A 2HYJA 3JRAA 2NS7A 1ETOA 2XPWA 5GPCA 1AHDP 2FJ1A 2NS8A 1APLC 1HCRA 3BTLA 2Y9YA 2MW8A 2GLOA 5M3FJ 1B72A 5F04A 3S2DJ 2QF7A 1WH5A 3IH3A 2L7MP 2LTPA 3SDGA 2DMTA 4JX6A 4XRSA 2O8KA 4A93J 2Y31A 2R92J 1WPKA 3LNQA 2DA6A 4HNVA 2I10A 1IG7A 2FQ4A 3HKZN 4C3IJ 1EF4A 3HGGA 2DA5A 2XSDC 2E2IJ 2ECCA 2DMNA 1IDZA 2ID3A 2LY9A 2H1KA 2M9HA 2ZB9A 3HGYA 4EEFG 2HOAA 3FKIJ 4A3MJ 2RAEA 5EG0B 1BW6A 1TWGJ 3GTQJ 4DYRA 3S14J 2LKXA 4B4CA 3HOVJ 2JA8J 2DA3A 5J3LA 3ZQFA 3ZOBA 3ZQLA 2IEKA 5EEAA 5C44J 1QPIA 3ZQCA 2IBDA 5EDNA 1T33A 5J1RA 4M3BA 3BR3A 1BL0A 4X1EA 1JTXA 2DMUA 4B3AA 5M5WJ 2CUEA 1T56A 5EF6A 2MG4A 3BTJA 1VF9A 2LFBA 4M3FA 1UMQA 5IYCJ 5IP9J 3UKGA 1W0TA 4BBSJ 1P7IA 2JMWA 1POGA 5F08A 3JRCA 1B8IB 3TP0A 3G1MA 3QPLA 5FLMJ 1TWAJ 3FK6A 3PM1A 4NDLA 2FD5A 2XGCA 3S17J 3WHBA 2XGEA 2JA7J 3NARA 1U78A 3I4NJ 3DEWA 1D5YA 1GV2A 1RKWA 4BY1J 1B72B 1U9NA 2L7ZA 4AUXA 1ETKA 1BW5A 2COBA 4Y52J 4IEJA 3ZQHA 5E3OA 1H8AC 3BT9A 4FISA 4A3BJ 3D1NI 3LSGA 4M3EA 1JT0A 4CYCB 3GTGJ 2ELKA 1MBFA 1WH7A 2R5YA 1ETWA 1GV5A 2CQXA 4I6ZA 1IJWC 1GUUA 2Y2ZA 4FE4A 2L7FP 4A3IJ 4DYCA 1ZKGA 3H3VK 3GTMJ 1GT0C 4C2MJ 3BG3A 4IHYA 2G0EA 4LOCA 2DTZA 3FISA 3O8GA 2X6OA 3MVPA 1AKHA 1BA5A 4RDUA 2GBYA 1OCTC 4UUSA 3HBLA 1NK2P 5M5XJ 5EGOA 3GTOJ 4A3JJ 3MN2A 5IOZA 1OCPA 2L9RA 1CQTA 1XC5A 4Y7NJ 5C4JJ 1RETA 1ETQA 3HOXJ 3GTJJ 2XPUA 2ECBA 1QVTA 2HI3A 2TCTA 5DS9A 4W1UA 5K7FA 5J1YA 1G2HA 3M4OJ 2R5ZA 3NAUA 4IHVA 2M0CA 3G1LA 5EYRA 1VNDA 2CUFA 4DYQA 2FX0A 1WGXA 5FKKA 4IHWA 3K2AA 5F0FA 4W97A 4JX5A 1ZQ3P 2CRGA 3JRFA 1MH4A 3K7AJ 3Q0UA 3ZQIA 1NK3P 3PO2J 2IAIA 2JK3A 2WAQN 5IYBJ 4M3DA 3FIWA 3S16J 1HDPA 1MBJA 1Q1VA 3LSJA 3JRHA 4A3LJ 1JKQC 1F36A 5HODA 3IH4A 1I6HJ 2CU7A 2LP0A 1OJLA 2P81A 4IHXA 1XS9A 2R5YB 1LFUP 1MBKA 1R9TJ 3LSRA 3BR2A 2YUSA 1LE8A 5FKOA 3RZOJ 2M2EA 4MIMA 3GBGA 1VI0A 4MLOA 1AKHB 3Q0VA 4A3CJ 4BY7J 5IPAA 4UUSB 1Z0XA 3TW6A 2QCOA 5EGOB 2M34A 2XPVA 3BQZA 2XGDA 4B1RA 3L1PA 1WCMJ 2EZHA 3JR9A 1Z77A 2EZKA 4A3EJ 2E2HJ 1H88C 3S1NJ 2H8RA 1FIAA 1FEXA 1IGNA 2Y30A 3A01A 2KDZA 1IC8A 4L5EA 1E3OC 3HB9A 1IV6A 3SJMA 1I50J 2JA6J 2R5ZB 1DU0A 2O9LA 4MFEA 4ABZA 2ID6A 1ETVA 1TWCJ 1H89C 2D5VA 1QRYA 2JN6A 1VFCA 2VKEA 3RKQA 2Y9ZA 2W48A 1FJLA 4FE7A 1I3QJ 3BG5A 2MSYA 3IH2A 4QSHA 3DCFA 3HEFA 5F1JA 1JGGA
chains in the Genus database with same CATH superfamily
3O8HA 1G3YA 2UUZA 2W82A 4L9TA 3S3MA 3CUQC 1J2XA 1I6XA 4UY8I 1USSA 1P4AA 3T5XA 1R1TA 2K3PA 5JLWA 5ICEA 2JA5J 2E5NA 2XKOA 2O8XA 1I5ZA 3EUHA 3ZR8X 5DCMA 2KKOA 3DTKA 2DFFA 1YI2I 3KZZA 1JKOC 4F52A 3A1YA 1JJ6C 1A6IA 1YRNA 5IP7J 1ZTRA 4M73A 4I98B 2LKPA 2K9SA 2CS3A 2EQRA 3AG4H 1ZRDA 1U6GA 3FX3A 5LHHA 3B6AA 2E2JJ 2RGVA 2HFHA 4IOCF 5DUKA 4PSWA 3JRGA 2HOSA 1JUSA 2QQ8A 2IS4A 3F6VA 3MKWB 3CMAI 3OIOA 1D1AA 2YU9J 1WRJA 1Z6RA 2DU9A 2VJJA 2VPLA 3HHGA 3OYAA 3DKYA 4B43A 4WXCA 4EM1A 4PGGA 1XTAA 3VODA 1G59A 3A03A 2CJJA 4YIIA 5B3SH 3BOQA 3LWFA 5CKTA 3SEQA 1IN5A 2CH0A 1ODDA 5LEKA 5FLXZ 3EDPA 3OYFA 1X3ZB 3W3CA 2VL8A 3MZ8A 1JUMA 3FF5A 2UXXA 1ZYRF 2CFOA 5FO5A 2IPQX 3M3YJ 2PI0A 5GP9A 1OCCH 2DQLA 3WG7H 3PNTA 1ZR2A 4CYCA 4ZZLA 4KA4A 2DT5A 3Q0WA 4MHGA 1NH3A 5DD8A 1R4NB 2DA7A 4O6JA 3JRIA 2ISYA 2MC3A 2MA3A 3S1QJ 1U8BA 1UG0A 4G6DA 1EV7A 1R4MB 3FK7A 2KIUA 5FLVA 4ENKA 3O2PE 1O3QA 2ZXIA 3VFZA 3M8JA 1AU7A 2F5CA 2PEXA 3ZMSA 2DFEA 2FQ3A 4E70A 2QZ8A 3UNGC 3HOUJ 4EJVA 3HRTA 3W6KB 3KCCA 4XLAA 3WTWC 5J4VA 1UHSA 4FX4A 5HNFA 2QVOA 3CMEI 3BCBA 2P6TA 3GMEA 4HPQA 1CF7A 2GA1A 2VT2A 5DDGA 3WGHA 2R7FA 1U9OA 3K4KA 1W36D 4L18B 3VSKA 4IRIA 4GDFA 1YE9A 4KISA 5LFAA 3BTCA 1HBXG 1RKTA 1IO2A 4ESFA 2R7ZJ 4DJAA 2HYGD 2VBZA 4XQFA 1YX3A 3KPHA 4A3FJ 3KIOA 4D5CA 4BGDA 4A0XA 3L9FA 1N77A 2XUBA 1MBGA 4M9ZA 1RPWA 4MTDA 3PFYA 3B73A 3F8MA 3OS1A 1RUNA 3MZHA 2MH2A 4L9VA 3R60A 5C4XJ 5ED4A 2LOOA 2EBIA 3S8PA 2PJRB 1HC8A 4S04A 2ME6A 3DU6A 4UB6C 2LD5A 2NS0A 5GADJ 4EVIA 2STWA 3LSTA 3PFIA 1JHHA 5TGTA 4DW6A 2BW3B 2P5VA 3E6CC 3V7CA 1A31A 3DQVC 3I3LA 4LB6B 2O0YA 1PJRA 2XROA 3S1MJ 5BMZA 3ZN0A 1XDUA 1MDMB 2K85A 2OCCH 4C3JJ 4BHPA 4XLCA 1FY7A 5EG0A 1MH3A 4B8XA 4PGHA 2DT7B 5FJ8J 3AKZA 3H0DA 1XG1A 2EH3A 3M8EA 1MGTA 1D1BA 2HQNA 3HSRA 4P9UA 2R7XA 1PUEE 1BBYA 3P5JA 1G3SA 3W2AA 2WADA 1A5JA 2ELHA 2D1HA 2ME0A 2VE8A 1TT5B 2DAOA 2X6XA 3U1KA 4FASD 4X0GA 3F22A 1O3SA 2EIKH 1QZEA 4HQEA 2NOJB 3LQRA 2EFNA 2OZUA 1WZ2A 4BXFA 3AFHA 1MW7A 1PUFB 3ECOA 3H36A 4ANJA 3ZQQA 2RVCA 4XIDA 3HPGA 4GGGA 1XSXA 4N4OB 4UVAA 5FKLA 3LOCA 3LSKA 1S5LC 4XK4A 2R93J 1JKPC 2F5EA 2GXAA 1OMIA 1IXCA 2XAFA 2HYJA 3RTRA 3DF8A 3K1PA 2BXZA 2NS8A 1E3PA 2UXNA 1IN6A 4RGXA 2QF7A 3HTUA 1T2KA 3TDZC 4HYEA 2HPIA 4CYDA 5CVVA 5HDKA 3ISPA 1SFUA 2P0WA 4ZJZA 1BM9A 2QEXI 4IRHA 4XLHA 2VOPA 2DMTA 2COMA 2WY7Q 4UVBA 5GTHC 2P5LC 3BG7A 4FT8A 2W84A 4NNJA 2DA6A 2L3DA 1FT9A 1R5ID 2FU4A 4F92B 3HGGA 3OYNA 3RKYA 2HVSA 4G6TB 3E5XA 2ZBKA 3DXJF 2ZB9A 1TQIA 4EEFG 1U3EM 2CMPA 2RAEA 4KIFA 2LDUA 5KK1A 1K4SA 4B4CA 2DOEA 3H9QA 4HV6A 4L0YB 2JA8J 5J3LA 3ZOBA 3ABKH 3H3ZA 2FXAA 5EEAA 5C44J 1ACIA 1RR8C 2H94A 3EYYA 1T33A 5K5RA 1BN5A 2GOMA 2QWWA 5GTIC 2VJIA 1ON2A 5EEGA 2W4SA 2DMUA 3MCZA 5M5WJ 4I7HA 2KQRA 4MGRA 2UZKA 1VF9A 5IYCJ 1W0TA 1UMQA 5IP9J 2HVQA 4HNUA 2FMLA 3DKWA 3SZPA 4GYGA 3TP0A 2CGPA 5E17F 1LNWA 2R7UA 3E5UA 3EPZA 1TWAJ 2HGCA 4NDLA 4B09A 4RAZA 4F93B 5HVQC 4IHTA 4IVNA 2LC2A 1SD7A 3DBHB 1PP7U 3FXQA 1G8XA 6PAXA 3NARA 5AIPA 3DEWA 1D5YA 1D1CA 3S2WA 1GV2A 2H27A 3IC7A 4HOBA 1X1AA 4LG3A 1FYLA 1E3HA 4AUXA 2F2EA 4Y52J 1RC9A 5LGTA 2E7XA 1BOBA 2K4BA 3OWTA 1D8KA 1Z1DA 1FSEA 2RNGA 3LSGA 1JT0A 3L2CA 4CYCB 1T0FC 3AL0B 1FPQA 1WH7A 5E18F 2A5WA 2ETHA 1IJWC 3DV8A 2GOXB 3NWSA 3D0SA 3VYTB 3FXOA 2L7FP 1ZKGA 2LF7A 3H3VK 4LOCA 2LNBA 4GRIA 5FGMA 4WX9A 2X6OA 1BR1A 3I5UA 2GBYA 2IA2A 3WTSC 2A5YB 1NK2P 4M9XA 4CH7A 3MN2A 1FOWA 1HXDA 3OYIA 2L9RA 5FRMA 4AIHA 4JBAA 4LG0B 1KU2A 1CQTA 4I01A 3TOAA 1BI0A 1IRGA 2O6GE 2PX9A 1I1SA 4V19K 4HNTA 5K7FA 4E6KG 5J1YA 4E7HA 3HPHA 3WTTC 2IA1A 1Z67A 4IL6C 4BJ5C 3BP8A 5H6QA 2PLYA 3SQNA 2KIFA 2FUG2 2L4MA 4EJOA 2ZFWA 3G1LA 4CCMA 4DOZA 1YG2A 4M72A 2ZJPF 1VNDA 4KN4X 3K2AA 3PIOF 4W97A 2E1CA 2X51A 1V3FA 3Q0UA 2HPMA 1MMNA 3HJEA 4II3A 1DUXC 2M3AA 4F7ZA 3KE2A 3S16J 2FMYA 2V26A 4I99C 4CCNA 3LSJA 1JKQC 4AIJA 2Q1ZB 5HODA 4WXHA 4A6EA 1LDDA 5LGUA 1ZGJA 4Z6YA 3L2UA 4HLYA 3MZYA 4DQ2A 2K3FA 2ZNZA 1HKQA 2WB1A 3I59B 4IPAA 4AIDA 2R5YB 1LFUP 3C1DA 5J8FA 1TBXA 1SFKA 1R6RA 1MBKA 3QOPA 3BR2A 1XGMA 3LSMA 5FKOA 2R7WA 3NEUA 4XLPF 3GLLA 3E97A 3V8JA 1W7PB 1VI0A 4A3CJ 3QPTA 1BC8C 1ZN2A 4PUSA 4G9YA 1IRFA 4BY7J 4UUSB 1SVLA 3TW6A 4HEA2 4IZZA 5EGOB 4U88A 3BQZA 4PJLA 4HX8A 4EQQA 5HDNA 2NRAC 5IT3A 4BQQA 1SD5A 1XB4A 2EZHA 3FHNA 1WSUA 2X1EA 1PP8F 1H88C 2GXBA 3RDIA 5BS6A 3F8NA 3GEZA 4XM3A 2D45A 1FIAA 1FEXA 3WG9A 2JRMA 2KDZA 1U8RA 1DGRM 2HQRA 5LEJA 1X1BA 3SJMA 4Z2YA 2JA6J 3MFKA 2BY0A 1W4MA 1T8IA 2OJED 3JSOA 2R5ZB 4HX4A 1DU0A 2XRNA 4LJZF 3O6BB 5CVUA 2EPFA 1YS6A 1T98A 4ENJA 2OA4A 2D5VA 3ZMTA 1LKXA 3R0AA 3F6OA 1EJ9A 3RKQA 1FNNA 3KP3A 3W2WA 1FJLA 3BG5A 3WE2A 2MSYA 2A68F 3SZGA 1LVAA 2AXTC 4QSHA 1P9QC 1WQ2A 2FBIA 4N9IA 4DIQA 4CCOA 4HDUA 1EA3A 1FYKA 3OIPA 2KISA 3HEFA 5F1JA 1O3TA 1YJWI 3GZ5A 2PMZA 1GXQA 2VI6A 1GVDA 3CESA 3PNVA 2RC4A 3QU3A 5E3LA 5CPRB 1LEBA 2HXOA 1ULYA 3H5NA 2FA5A 1MNEA 2ELJA 4E7KA 2IJLA 3HC7A 4D7MA 1YTYA 4WWCA 1SFOJ 1FMWA 4HZFA 2KLOA 2CQQA 3OR1C 1BI1A 4HA8A 9ANTA 2VQCA 3F0CA 3E1SA 4KMUX 1TQMA 1SMTA 5CVJA 2R4GA 3JSPA 4XRSG 1UHWA 4LLNA 1HOMA 1W5CC 3K6GA 2DDBA 2DMPA 2YR2A 1WI3A 2HDWA 3WU0A 2XASA 5EZHA 3HOZJ 2HKXA 3K4JA 1KQ8A 5D8KB 1B1BA 5ICCA 1UG2A 4D7NA 1KONA 1S72I 4BNCA 5F0CA 3CUQB 2V6CA 1I3AA 1Y8RB 3H9JA 3CCYA 4JX4A 3A02A 4XNFA 3J7ZI 2QSHX 2BVMA 2L0KA 3ZGKA 2J5PA 3CJQB 1Y8QB 2CW7A 3TW7A 2HQ5A 2F4IA 2ESHA 4Y15A 5J47A 5FKNA 3PO3J 3K4MA 2DO7A 5LBQA 3HKZA 1OYIA 2GM4A 3QRFF 3A01B 2PJRA 1SANA 4PFOA 3D5RC 4IRGA 1K61A 3G4SI 4PZJA 2NVQJ 2BW3A 4MO7A 2O7OA 3KP6A 4XN3A 2QSFX 4YEJA 5BOXA 1IXSB 4BE0A 1XGSA 2EA4A 2FSWA 2N8GA 3KZYA 3DBRB 3EUKL 2M45A 4XLEA 2CV1A 1FIPA 2RKHA 2NOGA 2BV6A 5GAGJ 1UFMA 3ZMDA 3C2GA 3L2RA 3PQKA 2VJ4A 2NVXJ 1FTZA 1IW7F 2BHYA 4CICA 3KEYA 3R0JA 4QIWN 2VQLA 3HDDA 1B59A 3E6MA 4DZPA 2FEZA 2OF7A 2HXIA 3FMSA 2STTA 1O7FA 4ZZDA 1LEAA 1OQYA 3OOUA 4PJ0C 1MIJA 4QLCU 1XMXA 1ZK8A 2MFZA 2QLZA 1PUFA 1GDTA 1QZYA 5KHDA 1P7JA 2DT6A 2BY3A 5HLIA 4FETA 3DTIA 1QGPA 5J1UA 2MBFA 3PQJA 5J4YA 3O3KA 4BAYA 1IUFA 2CWEA 4A2UA 1J7KA 4PDKA 4F3QA 1JUPA 2HZDA 2KPMA 2V1NA 2YS9A 5LLQA 3KLOA 3GF2A 3IRRA 1IF1A 2QENA 3G6EI 3LAJA 5JHFA 3VPRA 2Y0MA 1NG6A 4M9SA 5CVRA 3N4MA 3GFMA 1MNDA 1MBEA 3UR3C 3VB2A 2ACJA 2KJBA 3K1MA 2KRHA 2HOEA 2XGXA 1VQ8I 1TWFJ 4AC0A 5ILVA 3CQZJ 3BZKA 2ZSHB 3DEUA 3A4CA 1UB9A 2B9SA 1MBHA 2PMHA 3C2BA 1Y1VJ 3JREA 2RDPA 2DFIA 4HSRA 2X85A 1QO0D 1IUYA 4UVCA 5DM6F 2I8DA 4HX7A 1ZR4A 1U5TA 2RN7A 5FRNA 2OV7A 3OYCA 3V7RA 2DMQA 1XSVA 3GUDA 3OSGA 5TISC 4ENNA 2OAZA 4GFBA 1MSFC 2X6YA 4RAFA 2MABA 2LH9A 3K4LA 2IGKA 3HTSB 2KFDA 4IJAA 2EIJH 1Y0UA 2F5VA 2RQQA 1HDDC 2DA1A 5DUIA 3DTEA 3CO7C 3NWTA 3U9GA 1Y6IA 1MKMA 1FWZA 3ML6A 3SZTA 2ZMEC 1IRXA 3LA7A 4RM3A 3RQIA 1MSEC 3WODF 1MMAA 3PUFA 2PJPA 1YX5A 2V1XA 4QTRA 1OR7C 1TNTA 3VOEA 1UCRA 1JKRC 3FXJA 3OSFA 4CHUA 2WA0A 4IXAA 2M8GX 1L3LA 3VYUB 3N97A 1NTCA 5KVRA 1VQKI 4ZYEA 1XMKA 3TP3A 3HM5A 2M7AA 1BIAA 4NQWA 2E36A 2DA4A 4E7JA 2IA0A 2GZWA 5IOYA 2WC2A 3KYLA 1YW7A 3QP6A 1ITYA 3S93A 4DZJA 5HS8A 1JT6A 1QZZA 2AQEA 2E19A 4M74A 2HVRA 2E1MC 1HSJA 2M1BA 2K9NA 4NHJA 3M07A 1ORKA 2LR8A 4BH9A 3LMMA 1R36A 3JRAA 2EINH 3FXLA 2XPWA 3WTYC 2O5RA 2Y9YA 1NHAA 1BR4A 2WWYA 5M3FJ 5F04A 3L2VA 3RPQA 3CCQI 3PUBA 1XCBA 3CCUI 2XF7A 3CCSI 1SFXA 2Y75A 3C2HA 4XLNF 4XRSA 4A93J 1Z3YA 2Q8KA 1J9IA 1WPKA 3TKYA 1FMVA 3KP4A 2P8TA 3I56I 1IG7A 1X4PA 2FQ4A 1FYMA 2DQRA 2ECCA 4ZYHA 3KFWX 3LL7A 2LY9A 2V79A 2QQ9A 2EK5A 2WV0A 1X4OA 2M9HA 1XGOA 4MQVA 3FKIJ 3ERMA 2JA2A 5FFZA 4B3XA 2GIZA 1BW6A 1FBQA 4BUPA 1TL8A 1VQLI 3FKJA 4LG0A 2L9NA 5E1ZB 2IRFG 3WU2C 5CLSA 4PJMA 5J6XA 5CJ9A 3HRMA 1QPIA 1XSDA 5BPIA 5J1RA 2QQBA 2BE5F 4X1EA 4UXNA 4A6DA 5L3GA 2PG4A 1T56A 4XSXF 2HNHA 5EF6A 3S3OA 1OKRA 2MG4A 1I27A 2ZJQF 1HW5A 5HLHA 4A12A 2JMWA 1VQ5I 3CCLI 1SEUA 1W5SA 4XKBA 3C7JA 1YYVA 3QPLA 1O3RA 4XKWA 3F3XA 1HW1A 3FK6A 3PM1A 2L9SA 4RS8A 2FD5A 3SEZA 2EV0A 4HLXA 3WHBA 4H4KC 2XF6A 2XAGA 2XGEA 2W24A 3VEPA 1D0YA 5JHUA 3BCAA 3ABTA 3DU5A 3OYKA 2W7NA 1B72B 1U9NA 3T0YA 1ZLJA 2M4KA 1HKTA 3F8CA 4AD9A 2ZCWA 2UWMA 2L4AA 2VC1A 5JR3A 1WJ5A 2OZ6A 3BT9A 4FISA 4A3BJ 4M3EA 3TDUC 1AWCA 2OQGA 2FOKA 2ELKA 2P6SA 4IOAF 3I59A 1H0MA 1MBFA 3EYIA 2R5YA 1ETWA 3CMMA 4BJ6C 3ELKA 3F9KA 2ADUA 4FE4A 1ZAOA 2DPUA 4DYCA 3KEOA 5ILSA 4NBQA 3FM5A 2PBIA 3CC2I 4D0PA 4YFXF 1W7PA 3O8GA 3W2VA 1BA5A 4UUSA 3FMQA 4RGRA 5JI6A 5M5XJ 5EGOA 3ABLH 4BS9A 5IOZA 1OCPA 3LFUA 4Y13A 1KU7A 1MZBA 2V9PA 1XC5A 4Y7NJ 2AXLA 3HOXJ 3HZJA 1FBSA 2L01A 2JSPA 3AAFA 2JZYA 2K9MA 2AQFA 5LD2C 3N05A 4UV9A 3FHZA 2XDVA 2Z99A 3KEQA 3PSFA 4ZYAA 2R5ZA 3NAUA 2G9WA 3ABUA 3DBLB 1JGSA 2FBHA 4OIPF 4LITA 4NUBA 4KICA 4ZDPA 5E8GA 4HG2A 2MC4A 3TO7A 5F0FA 1ZQ3P 4JX5A 2E5ZA 3ECHA 4KN7X 3IKTA 3ZQIA 3KYDB 2K7LA 3PO2J 2IAIA 3CP2A 5DCFA 1U5TB 3H92A 5IYBJ 1TLHB 3LSHA 5K1YA 1X1PA 4M3DA 3FIWA 2HWVA 2M30A 1HDPA 1N25A 5E1XA 3SXYA 4A3LJ 1LDJA 1R1VA 4LK1F 4OINF 3TO9A 2ZXWH 2A6HF 4EJWA 1W1WE 1ZELA 3FXRA 4H0EA 2LP0A 1OJLA 3OYLA 1XDSA 4KUMA 1SAUA 3HUGB 2KIQA 3BG6A 1Y0NA 4LIUA 2K02A 4U7DA 3LSIA 1RNLA 4PCQA 5CVIA 1YW9A 5D6EA 1S7OA 1R9TJ 3I0TA 2FRHA 1DQUA 2RNJA 2YUSA 4YIRX 1R5HA 1P92A 4RB3C 4LK0F 4G7OF 3QP5A 3RSNA 4LGWA 1S7AA 3G2BA 4RB2C 1YO5C 1AKHB 4M71A 5IPAA 1Z0XA 3PL8A 4NQWB 1VQPI 2O03A 5E8IA 1X19A 3HSEA 2X1CA 3CUQA 4CCJA 1ZGAA 4D9JA 2Q2EB 1OYWA 3ZN1A 1Z77A 4A3EJ 3GFLA 2EB7A 3OYJA 2IT0A 2F4OB 3KYCB 5CQEA 3BJ6A 1IGNA 4Q48A 2Z1DA 1ZREA 2Y30A 3A01A 1WI9A 1E3OC 4L5EA 1IV6A 3EUAA 4R79A 3D5LA 2L7KA 4G6QA 5CYVA 2O9LA 4XR6A 2P7CB 3CLQA 4I0AA 1PYVA 1IV8A 3KP2A 3DWLE 1R1UA 4U0WA 4IQJA 4AYBA 3M1EA 4CO8A 1WFXA 1F1ZA 3Q9SA 5F64A 2Y9ZA 2Y0SA 3GFJA 3SHFA 4L9NA 1TT0A 3IL2A 4BQAA 2X0LA 3IH2A 4G7HF 1K7AA 2LRDA 2EV5A 4ZTFA 3CCJI 4C2UA 2FF4A 3M9AA 3K69A 4IF4A 3GXOA 4XLFA 2R7QA 1MD0A 5M3MJ 4AIKA 1W7PD 2VIXA 4GXOA 3PSIA 3FM3A 4A0YA 1FOKA 2ZJRF 2AHQA 3BR5A 4CDGA 5D4RA 1EKEA 2Z2SB 2NXNB 2TDXA 3VWBA 3WGIA 2R0QC 4K2EA 1W0UA 3H0GJ 1ONVA 1Z3XA 2JPCA 3CDHA 2OC6A 3W6JB 1MNMC 4HW0A 1GLNA 5ICGA 4UUTA 2ZKZA 4CCKA 1YIJI 3HOTA 2Y0SN 1TC3C 1W36C 2V1UA 2A69F 1MJAA 1WJAA 1WKMA 3T8TA 1HSTA 3IV5A 2XAQA 2A6TA 4I76A 5E3MA 3ZP5A 1VZ0A 2XB5A 1FP2A 1QHGA 1EH7A 2M8EA 5A2QK 1ETXA 5L3CA 5IT9K 3QWLA 3QU6A 5HS9A 2LLKA 4GO1A 4FCYA 1X2NA 4A69C 3HL2A 2MGQA 2YPRA 5M5YJ 2OUMA 3CMYA 2HEOA 2BY1A 5EZGA 4A5MA 3TEDA 3M8FA 4UV8A 3I64A 1BI3A 3TQNA 3CJTB 2QM3A 2DXIA 2TRTA 2M5WA 1Y39A 2P7VB 4HRIA 2VPRA 3EUHC 3BWGA 1XN7A 2CUZA 2ESNA 1X2MA 3I71A 3RQ4A 1Z7UA 1LQ1A 4L0ZB 4II2A 5DV5A 5ERIA 3EETA 1J09A 1NG7A 3P9CA 4NB5A 3IWFA 1G4DA 1T95A 3QQAA 2DYRH 3ZQGA 1RIOH 2M4GA 3U1DA 3Q3SA 2VJ5A 2ZSIB 1HKSA 1MMDA 2EZLA 2KJCA 1XGNA 2I5UA 2XVCA 2GIVA 4BU2A 4UB8C 2EIMH 3IKVA 1LFBA 4XRMA 3E7LA 4OMZA 3SDBA 4BE2A 1USTA 2BZTA 3I4MJ 4U87A 2D1VA 5FROA 2DW4A 2VB6A 3D5SC 3CZ6A 3G1OA 2OTJI 5KAIC 4ON0A 1QVUA 4MEYF 3OR2C 3W6VA 5D4SA 5B1AH 1J5YA 1Z9CA 4I2OA 2GWRA 3MKYB 2VKVA 2CSOA 3QPSA 2UV1A 2DBBA 5F0HA 1QU3A 1E0EA 1S6LA 2WB1N 4RAYA 1ERDA 2X9DA 1T39A 2CV0A 1K83J 2JPBA 2JT1A 1G6NA 3OYDA 1KU9A 3S1RJ 1STZA 3OY9A 3JCUC 2R7DA 2MD5A 2JJ7A 2PN6A 3TMOA 5C3EJ 2A6EF 1QNTA 3CCMI 2DA2A 4DNCA 1X1CA 3FXKA 2IXSA 4M6VA 4XSZF 2CO5A 3DPUA 2K9LA 4HQMA 4XMYA 1V4RA 4O5VA 4D5FA 1TZLA 2VXZA 3BY6A 4OAZA 2X6WA 4S05A 1F4KA 1DGWY 2B63J 2IW5A 2YX4A 1LUJB 5D5WB 1Z7LA 2WBMA 2XB0X 1O7LA 3P9IA 2QKLB 4ZH4F 3L2QA 2KDOA 1YITI 4J19A 1YLFA 5EEHA 3B6CA 2K4JA 5H6RA 5BPDA 2KT0A 4FHTA 2BXYA 2F4MB 1RESA 5HDGA 5A2QZ 4ZYDA 4BQOA 4P1WA 3BJAA 4RLQA 4KMFA 1TQPA 4BEHA 4FX0A 2Q0OA 4A3DJ 4J00A 2VQHA 2KHMA 4HF0A 2H09A 5F27A 4Q4ZF 3BTIA 3K70D 3WHCA 4XONA 4KJZA 2QA4I 3TO6A 1D0ZA 2CQKA 2FNPA 3CCEI 4G8XA 2QBYA 1UZCA 2OU2A 3S2HJ 1X58A 4CGZA 2PMZN 3I53A 5FD5A 4MFDA 2R7RA 1JTYA 1IRZA 4RAGA 3SFIA 5GPAA 3G71I 2NAZA 3JRDA 4BDYA 3P9KA 4EV0A 2X48A 2XAJA 2BGCA 5K5OA 1O4XA 1HLVA 3MQ0A 1IZ1A 4BDZA 5IYDJ 3RI4A 5HOOA 2M7BA 2VC0A 3H3UA 1FC3A 1A6QA 2A05A 2A3SA 2LYCA 2NS7A 2L2OA 5F6FA 4EMSA 5TJJA 1HCRA 1APLC 2JVGA 4RMNA 5H20A 2MW8A 1B72A 3S2DJ 1WH5A 1UELB 1M1EB 2FE3A 4HF2A 3E5QA 1G3WA 2BYVE 1YHQI 1V5FA 3CTAA 3RYPA 2HTJA 2O8KA 2W00A 3IAS2 2R92J 1VTNC 4AWXB 3BJOA 5EJCA 4HNVA 1XPXA 3GYHX 2E1MB 3HKZN 4C3IJ 1EF4A 2GQQA 2DA5A 1V54H 2RV8A 3MAJA 1W5TA 2W85A 3RCOA 2H1KA 5HLGA 4E7IA 2VONA 3HGYA 2HOAA 4A3MJ 2DDAA 1KQ0A 1TWGJ 3GTQJ 5HNHA 4AM3A 3S14J 3AG1H 2Y48A 2DA3A 2NNNA 3ZQFA 1SD6A 3J81K 1J59A 3ZQLA 3BPVA 3ZRGA 3ZQCA 2IBDA 2JVHA 1A36A 3BR3A 3FBIB 1TW2A 3ONQA 1T0FA 2B0LA 2HR3A 1H9TA 1JTXA 1SVOA 1UJ8A 1D5VA 3LA3A 4WK8F 3WTXC 3ULQB 3ESWB 4YRVA 1PDNC 3BZCA 1K78B 3R4KA 4KYWA 3BTJA 1XCVA 2LFBA 3UKGA 5LHGA 4BBSJ 1FOYA 1HA8A 1P7IA 2NYXA 2ZC2A 3JRCA 2FNAA 1B8IB 3HRSA 2V4JC 4YFKF 3OYBA 5AIQA 3G1MA 3OYHA 4UNOA 3JW4A 2XV4S 3EQLF 2BOLA 5LHIA 3A0HC 1TP4A 2XHKA 3FMRA 4HV5A 1Z91A 3MD2A 2R7SA 3FXMA 2V9VA 5JFRA 2PFBA 1XX5A 2JA7J 4E4HA 3I4NJ 1LDKB 1ON1A 1RKWA 4BY1J 2OQRA 3ZXSA 4YG2F 2L7ZA 5H2FC 1MJBA 1ETKA 1IAWA 1BW5A 4CUGA 2OCEA 4IEJA 3ZQHA 3D1NI 1Z6TA 3GTGJ 5B1BH 3HUGA 3G73A 4RB1A 1MMSA 5ILUA 4LLLA 1Z05A 2F5FA 1GV5A 4MTEA 2CQXA 1GUUA 4RA2A 2WAEA 2P5KA 1ZH5A 4C2MJ 4CXFA 4IHYA 2DJIA 1QQIA 4GYIA 3S32A 1FP1D 2DTZA 3FISA 4YFNF 1H9GA 1AKHA 3S3NA 2BHZA 2EJRA 3H5RA 4L5JA 1I1GA 4DBRA 3HBLA 2Z9OA 4A0ZA 1E2XA 3GTOJ 1P4XA 3HYIA 2GXGA 2HU9A 2Q2EA 2FBKA 2KL4A 3OMYA 1VQ6I 5C4JJ 1ETQA 4CZCA 2G7HA 4ITVA 1A35A 2XPUA 2WAQA 4F91B 3GWZA 3DPTA 1BIBA 4L9JA 3CF5F 1D3YA 3V42A 4W1UA 5TRDA 1N78A 3R6SA 4Y3OA 2CYYA 2DOFA 4QPOA 4IO9F 1KYWA 4D1QA 3C18A 2WY8Q 4IHVA 1J75A 3FBNB 2CW0F 3WE3A 2ZXJA 1WJCA 1R7JA 5CQGA 5E20A 5GAHJ 4KDPA 2IGOA 1RI7A 4EJUA 2VE9A 3K4NA 3G3ZA 2FX0A 1WGXA 5D8LB 1V5GA 2CRGA 3ABMH 3JRFA 1S9HA 4ZYGA 3K7AJ 2DYSH 2LG4A 1NK3P 2W25A 3E6DA 3QOEA 3TOBA 4OMYA 2JK3A 2WAQN 1R49A 3J7AY 2O61A 3J81Z 1XMAA 3MEXA 3A0BC 1SMYF 3KETA 1Q1VA 5LRRA 2VASA 3IRQA 1UHMA 1ZG5A 4BL0B 1YIOA 3IHUA 2CU7A 3K70C 2P81A 1XS9A 2E34A 3OS2A 4BEHB 4A5NA 1BOAA 1QPMA 3ZQ7A 1KA8A 3X2QH 3JAMK 2IP2A 2VT3A 1ZLKA 3M7GA 3OIQA 1WJDA 3RZOJ 4MIMA 2OBPA 1T08B 3CLOA 3GBGA 4OU0A 3WTUC 3ZMZA 2QBYB 4MLOA 2EFOA 5DD4A 2QCOA 3ZMVA 4BQNA 3H1CA 2VXDA 2OD5A 2BVLA 2M34A 2XPVA 3OYMA 1B9MA 3RKWA 1WCMJ 2CG4A 4BHCA 2DOAA 2VKHA 1AA7A 3CCRI 1R22A 3DPLC 2DI3A 2IGNA 2PMUA 2E2HJ 5LRSA 1K6OA 2H8RA 4ZTJA 2R7VA 4PFPA 4OIOF 1P2FA 1OISA 2L54A 2EFWA 3SYTA 3HB9A 3WTVC 3CO6C 1D0XA 1KQ9A 4GCVA 1I50J 2CQNA 4JK1X 2XSJC 5BQTA 4MFEA 3QYEA 1R58A 4OWRB 4ABZA 3F23A 1ETVA 3GVAA 4DBQA 3QYBA 4OAYA 2LBFB 1DPRA 1H89C 2DLLA 3B02A 1CGPA 1SAXA 1X1DA 3HSFA 4Y4RA 2XAUA 5DYMA 1I3QJ 4RM2A 1YFHA 3ASOH 4BJTA 1SD4A 3T1BA 3DCFA 1ZG3A 2E7WA 4OOIA 3CUOA 4P5OA 2VLAA 1R5GA 5DM7F 1IDYA 2QQAA 4BBRJ 1J0RA 3HXLA 4V2FA 3S15J 5JVGF 1OCRH 2QSGX 4FTHA 1WJFA 4RGUA 2ISZA 2EZIA 1OLTA 4IQ4A 1BR2A 5BNGA 1TW3A 3FWEA 4I09A 3H5AA 1S7EA 3V4GA 3HHHA 3SFZA 1ENHA 4BYYA 4CZZA 1ZRFA 2AO9A 3I9V2 5K5QA 1LPQA 4XBFA 1A04A 4V2GA 4MEXF 2ZJ2A 3BR0A 4N4NB 4RBOA 1U0JA 1TNSA 1T6SA 3GTPJ 4EGYA 1S29A 2LVSA 3BPXA 4HAMA 1QHHD 3JTGA 1LE8B 4U0VA 4XN0A 4FQGA 2L02A 1D8JA 3CP8A 2VBYA 3RZDJ 3LFKA 3TBIA 2MYSA 4E7ZA 3DKXA 1OCOH 3BR1A 4YIFA 1OFCX 4P55A 1ZHFA 2XRLA 3LSPA 1F43A 3V8LA 2E1NA 4A3KJ 2K5CA 3BG9A 2NVTJ 2VBXA 2VQGA 2EV6A 2E71A 2F6CA 2QYOA 2NNYA 5K7HA 2JQ7A 3REOA 2XIGA 1BC7C 3JRBA 2VUMJ 2B7EA 2MD0A 1YW8A 5K7ZA 5KAFC 4HDVA 3QYFA 3JAMZ 2O3FA 2CUJA 1TTYA 1X3UA 3PNYA 4OIQF 5DEQA 4XICA 2WAFA 4PK4A 1JJ8C 1S8NA 3I4PA 1OCZH 3JTHA 3CDLA 3K0LA 3FXUA 1B9NA 1ZARA 1BJAA 1P6RA 5HS7A 5IY5H 4BACA 2K9QA 3I55I 1B4AA 2ZFUA 4C3HJ 4ETSA 1KZHA 1R71A 1F9NA 2LK2A 3E0JB 4Q5SF 1XD7A 3KZIC 2KRFA 5FKMA 1EH8A 2KP6A 3ZMUA 3J80K 2LSOA 4NC8A 4UHTA 4CSWA 5E3NA 4KITB 2VODA 4JP0A 2HDDA 3MKLA 1DU6A 1ZGWA 5DCMB 3BROA 4HF1A 5J8CA 2OTLI 4A3GJ 2QGUA 2H8WA 1YRNB 1VQ4I 2WV1A 4RB0A 4S0HB 4KFCA 2NVUB 2L5QA 2HOTA 2LREA 2HTSA 1FBUA 2LY2A 1YOVB 1FTTA 2LF8A 2ZMEA 2FOWA 3RPUA 2DK5A 4KIGA 5B66C 5LGNA 2DK8A 1OR7A 4BKXA 2OPTA 1LFPA 2G7UA 3HOYJ 2KRCA 3ERED 5D5VB 1JE8A 4ESJA 1RR7A 4M3GA 3K4BA 1IN4A 4E7SA 2XAHA 3HOSA 4PJNA 2EFQA 2KZVA 4C30A 3RIRA 5JLXA 2H6BA 4AU7A 3DP7A 3GO5A 4I0BA 2JUCA 2W1OA 2DODA 3AG2H 1KGSA 5GAEJ 5IP6A 3BR6A 1HF0A 2R7OA 4XL9A 4HSTA 2ZXHA 4QWQA 2DJNA 3BZ6A 2DCEA 4R1HA 3DLAA 4Y17A 4BE1A 1TWHJ 4X6AJ 2VKDA 4LFUA 2PQ8A 3KLNA 4IKFA 2DTRA 2W57A 3K9TA 5DTDA 4ENMA 1Y1WJ 3GTKJ 1ETYA 2K27A 3E3VA 4AYBN 5KNLA 2EA2A 2K40A 4RLFA 4BXXJ 2D2WA 4G94A 4JYKA 3HOWJ 3I54A 4E7LA 4C2TA 3DEEA 3I58A 4G12A 1V5EA 2MLKA 3KP7A 2JWTA 5D6FA 3GW2A 2E1OA 1FX7A 3CDIA 4WXDA 3FDYA 3P7NA 4ZC3A 3COAC 3GTLJ 2NVYJ 1LVKA 2DN0A 3VYSB 2XF5A 3BQYA 2CW8A 2IGMA 4XOTA 4Q47A 2XKPA 1K78A 3A2KA 1IN7A 3WU1B 3F8BA 3K4CA 2E60A 4O3MA 2HQAA 1U5TC 4B48A 1B8IA 1BJZA 2P4WA 3MKZA 4Y33A 1CF7B 4RGSA 4ZDOA 4P96A 1ETOA 5E1WA 3GFIA 5GPCA 3WGGA 1AHDP 2FJ1A 2JTVA 3VDXA 2IS1A 1Y56A 3BTLA 1E17A 2GLOA 5ICFA 3OL4A 2J5OA 3IH3A 2LY1A 3J80Z 2L7MP 4ZDLA 1U2WA 3QAHA 2LTPA 3SDGA 1WHUA 4BHBA 4KNYA 2YX7A 1VQMI 2BEOA 3E6BA 4JX6A 2Y31A 2ZNYA 4ASNA 1Q1HA 4EATA 4U7BA 3MMYB 2R7TA 5HLTA 4EGZA 4YELA 1SC7A 2EILH 3LNQA 2ICWG 3LQQA 2I10A 3RJPA 5D5XB 3OOPA 3R61A 3OL3A 2XSDC 2E2IJ 3HG9A 2DMNA 2HKOA 1IDZA 1OPCA 2ID3A 1UAAA 4PJJA 1L0OC 5AONA 5E79C 1FLIA 1LB2A 3KP5A 1X3WB 3NQOA 3H35A 4XORA 5EG0B 3QODA 4LLGF 4DYRA 3L2WA 3IUOA 4LD5A 4HBLA 3BLYA 4CCLA 2LKXA 3HOVJ 1DP3A 4EJTA 1AOYA 3KX2A 2IEKA 3QPHA 3L00A 5EDNA 1KYZA 4M3BA 3ZPLA 3RPUD 1BL0A 4B3AA 1KU3A 2CUEA 4B44A 3V7SA 4WCGA 2Y69H 2V1DA 1BI2A 4AVPA 3AL0C 4M3FA 3U21A 5JVTA 1K6YA 5B5EC 5F08A 1POGA 2A07F 1GXPA 3L09A 1REPC 2F48A 1GHCA 2KMUA 3TGNA 4UUVA 2V6EA 5FLMJ 1K4TA 5L3BA 2H6CA 4QPQA 3K1NA 3Q9VA 2VN2A 2XGCA 2Z3YA 1HW2A 3S17J 3OS0A 1JXSA 2WTEA 2GA2A 3LAPA 4XKCA 4N9HA 3HRUA 3M1CA 5L3FA 3GZNB 1U78A 3IAM2 3RYRA 4BXUA 2KIMA 3ASNH 1OYYA 5FD6A 1P4WA 3K10A 5FFXA 2COBA 2R3SA 2F5DA 3CJRB 2BY2A 3H9GA 3MWMA 4N0BA 1WWXA 1H8AC 5E3OA 4LMYA 4C9YA 2V9KA 4M6XA 3TL4X 5IT9Z 4G7ZF 2YU3A 1SFEA 4EM2A 2HYFA 4WF2A 1ZRCA 5D5UB 4I6ZA 5F1RA 3V8KA 2Y2ZA 1RUOA 2JSCA 2V7FA 2VOOA 4A3IJ 4U0YA 2X1DA 3GTMJ 2EFPA 1GT0C 1S3JA 3BG3A 3HIFA 1LJ9A 2G0EA 1DP7P 1FZPB 2JUGA 3CJNA 3CC7I 3MVPA 5L3DA 2M87A 4RDUA 1OCTC 3F72A 4JQFA 1VQOI 2Z5UA 2CFXA 1WJBA 1F5TA 4A3JJ 1WJEA 1IN8A 2AS5F 4R8HA 1YJNI 1I39A 1QA6A 4MNUA 4CA0A 4NC7A 4P9FA 1RETA 3GTJJ 2ECBA 1QVTA 2HI3A 2TCTA 1T38A 4EM0B 4IX7A 5DS9A 2ZMEB 1O57A 3K2ZA 1G2HA 2IS6A 3M4OJ 3GLXA 2L9VA 4KT5C 1FOXA 1R00A 4JOMA 3T8RA 2M0CA 1JI8A 4OIRF 2QUFA 2LBFA 3RKXA 2BBYA 1SVMA 3U2RA 1WVRA 5EYRA 3L7WA 4LIVA 4XOPA 2CUFA 1EH6A 4DGWB 1B6AA 1YQAA 4DYQA 4J01A 5FKKA 4IHWA 1JHFA 4AVZA 3PJRA 1MH4A 2A61A 1Z21A 2C6YA 2E35A 5FB2A 2M0MA 4MQ9F 4LB5A 2JRTA 3IP4B 3CC4I 2ZO4A 3C3WA 4I02A 1YJ9I 2DFHA 2Z16A 1MBJA 2H1LA 3OYEA 3JRHA 1F36A 3DLLF 4KT6A 2K86A 2CV2A 1GVJA 3CCVI 3ZCOA 1RRJA 4B47A 3IH4A 1V55H 1I6HJ 1MDMA 5J40A 3GX4X 1C0WA 3VYRB 1VQNI 2Z33A 4ESBA 4IHXA 3OV8A 2IVMA 3J7YJ 1IXRC 3DFGA 1VQ9I 1N75A 5L3EA 3PIPF 1DDNA 2IS2A 3NRVA 5FLXK 3OYGA 2HZTA 1VQ7I 3LSRA 4XRFA 2VBWA 1LE8A 2GAUA 2M2EA 2XC7A 2MH9A 4M6YA 2EWNA 1ZG1A 3CF2A 4NC6A 3F21A 3Q0VA 3BDDA 2HDCA 4F55A 2DPDA 3VSLA 3F8FA 2XGDA 4B1RA 1QBJA 3J7AO 3CD6I 2YSRA 3IWZA 3L1PA 5KCMA 1FSHA 3ROUA 3JR9A 2LKSA 3GCMA 2EZKA 3BC8A 3S1NJ 1R23A 4XKVA 1HQCA 1G3TA 3FZVA 1IC8A 3LA2A 4PSXA 1MMGA 4KIBA 2MLGA 2RREA 2LMDA 1DPUA 2ID6A 1MJ9A 1K79A 1TWCJ 2KZGA 1QRYA 2JN6A 1VFCA 2VKEA 2QKMB 4IHSA 2W48A 2HS5A 2X4HA 3AG3H 4TV7A 3WTZA 4FE7A 3Q5FA 4L5IA 1PVEA 3GZ6A 1YS7A 1RZ4A 2RQPA 2CQ7A 1JGGA
chains in the Genus database with same CATH topology
3O8HA 1IDYA 2VI6A 1GVDA 4BBRJ 5M3MJ 4V2FA 3S15J 5E3LA 2AHQA 2HXOA 3BR5A 4FTHA 5JLWA 2JA5J 2EZIA 5BNGA 2R0QC 1W0UA 1S7EA 3H0GJ 4D7MA 1ENHA 1MNMC 1SFOJ 2AO9A 2CQQA 1JKOC 4UUTA 4V2GA 1JJ6C 1A6IA 3BR0A 2Y0SN 5IP7J 1ZTRA 3F0CA 4RBOA 1TC3C 1YRNA 9ANTA 3GTPJ 2K9SA 2LVSA 4XRSG 2EQRA 1HOMA 1LE8B 3IV5A 2DMPA 4I76A 5E3MA 3B6AA 2E2JJ 1WI3A 2XB5A 5EZHA 3HOZJ 3JRGA 3RZDJ 2HOSA 1ETXA 1JUSA 1UG2A 4D7NA 3BR1A 1OFCX 5F0CA 2LLKA 3OIOA 2YU9J 2XRLA 3LSPA 1F43A 4FCYA 4JX4A 3CCYA 3A02A 1X2NA 4A69C 2L0KA 2MGQA 4A3KJ 5M5YJ 3BG9A 3CMYA 2NVTJ 3TW7A 5EZGA 3TEDA 2HQ5A 3PO3J 5FKNA 5K7HA 3A03A 2CJJA 2TRTA 2GM4A 3A01B 1SANA 3JRBA 2VUMJ 2VPRA 5K7ZA 1K61A 2NVQJ 1JUMA 4MO7A 1X2MA 2O7OA 4XICA 3M3YJ 5GP9A 2N8GA 1ZR2A 1JJ8C 4CYCA 3CDLA 3Q0WA 1FIPA 3QQAA 2NOGA 3ZQGA 2DA7A 2K9QA 3Q3SA 3JRIA 3S1QJ 1U8BA 4C3HJ 2NVXJ 1FTZA 2EZLA 2LK2A 3FK7A 4QIWN 5FKMA 5FLVA 1LFBA 3HDDA 4XRMA 3E7LA 4DZPA 2OF7A 2HXIA 3I4MJ 1AU7A 3OOUA 5E3NA 3G1OA 1ZK8A 4JP0A 2HDDA 3MKLA 1DU6A 1QVUA 1ZGWA 3HOUJ 1PUFA 1GDTA 3W6VA 1P7JA 4A3GJ 1UHSA 1YRNB 2VKVA 3QPSA 5F0HA 2WV1A 4S0HB 5J1UA 2WB1N 2HOTA 2X9DA 1IUFA 1K83J 1JUPA 1U9OA 1FTTA 2YS9A 3VPRA 4BKXA 2OPTA 3BTCA 1RKTA 2R7ZJ 3S1RJ 1MBEA 3HOYJ 4A3FJ 2JJ7A 1RR7A 4M3GA 5C3EJ 4D5CA 2DA2A 1TWFJ 4AC0A 4M6VA 3CQZJ 5JLXA 1MBGA 1RPWA 1MBHA 4D5FA 3C2BA 1Y1VJ 3JREA 5C4XJ 2B63J 2EBIA 2ME6A 1ZR4A 2LD5A 2XB0X 2DMQA 3OSGA 4DW6A 5IP6A 3BR6A 4J19A 1HF0A 4GFBA 1MSFC 3B6CA 2DJNA 2KT0A 3S1MJ 1TWHJ 1HDDC 4X6AJ 2DA1A 4C3JJ 1RESA 5DTDA 1Y1WJ 5EG0A 3GTKJ 1ETYA 1MH3A 1MSEC 4AYBN 3RQIA 2K40A 5FJ8J 4BXXJ 4A3DJ 1XG1A 2EH3A 4QTRA 4JYKA 3HOWJ 5F27A 1JKRC 3BTIA 3WHCA 3OSFA 1A5JA 4G12A 2JWTA 2ME0A 2E1OA 3GTLJ 3S2HJ 2NVYJ 2DN0A 2M8GX 1X58A 2PMZN 1NTCA 3BQYA 4MFDA 1JTYA 1IRZA 3TP3A 3HM5A 2DA4A 3SFIA 1PUFB 5GPAA 3JRDA 5IOYA 1ITYA 4XIDA 1B8IA 2X48A 4DZJA 1JT6A 2E19A 5FKLA 1BJZA 1O4XA 1HLVA 3LOCA 2R93J 4XK4A 5IYDJ 1JKPC 2K9NA 1ORKA 2LR8A 2HYJA 3JRAA 2NS7A 1ETOA 2XPWA 5GPCA 1AHDP 2FJ1A 2NS8A 1APLC 1HCRA 3BTLA 2Y9YA 2MW8A 2GLOA 5M3FJ 1B72A 5F04A 3S2DJ 2QF7A 1WH5A 3IH3A 2L7MP 2LTPA 3SDGA 2DMTA 4JX6A 4XRSA 2O8KA 4A93J 2Y31A 2R92J 1WPKA 3LNQA 2DA6A 4HNVA 2I10A 1IG7A 2FQ4A 3HKZN 4C3IJ 1EF4A 3HGGA 2DA5A 2XSDC 2E2IJ 2ECCA 2DMNA 1IDZA 2ID3A 2LY9A 2H1KA 2M9HA 2ZB9A 3HGYA 4EEFG 2HOAA 3FKIJ 4A3MJ 2RAEA 5EG0B 1BW6A 1TWGJ 3GTQJ 4DYRA 3S14J 2LKXA 4B4CA 3HOVJ 2JA8J 2DA3A 5J3LA 3ZQFA 3ZOBA 3ZQLA 2IEKA 5EEAA 5C44J 1QPIA 3ZQCA 2IBDA 5EDNA 1T33A 5J1RA 4M3BA 3BR3A 1BL0A 4X1EA 1JTXA 2DMUA 4B3AA 5M5WJ 2CUEA 1T56A 5EF6A 2MG4A 3BTJA 1VF9A 2LFBA 4M3FA 1UMQA 5IYCJ 5IP9J 3UKGA 1W0TA 4BBSJ 1P7IA 2JMWA 1POGA 5F08A 3JRCA 1B8IB 3TP0A 3G1MA 3QPLA 5FLMJ 1TWAJ 3FK6A 3PM1A 4NDLA 2FD5A 2XGCA 3S17J 3WHBA 2XGEA 2JA7J 3NARA 1U78A 3I4NJ 3DEWA 1D5YA 1GV2A 1RKWA 4BY1J 1B72B 1U9NA 2L7ZA 4AUXA 1ETKA 1BW5A 2COBA 4Y52J 4IEJA 3ZQHA 5E3OA 1H8AC 3BT9A 4FISA 4A3BJ 3D1NI 3LSGA 4M3EA 1JT0A 4CYCB 3GTGJ 2ELKA 1MBFA 1WH7A 2R5YA 1ETWA 1GV5A 2CQXA 4I6ZA 1IJWC 1GUUA 2Y2ZA 4FE4A 2L7FP 4A3IJ 4DYCA 1ZKGA 3H3VK 3GTMJ 1GT0C 4C2MJ 3BG3A 4IHYA 2G0EA 4LOCA 2DTZA 3FISA 3O8GA 2X6OA 3MVPA 1AKHA 1BA5A 4RDUA 2GBYA 1OCTC 4UUSA 3HBLA 1NK2P 5M5XJ 5EGOA 3GTOJ 4A3JJ 3MN2A 5IOZA 1OCPA 2L9RA 1CQTA 1XC5A 4Y7NJ 5C4JJ 1RETA 1ETQA 3HOXJ 3GTJJ 2XPUA 2ECBA 1QVTA 2HI3A 2TCTA 5DS9A 4W1UA 5K7FA 5J1YA 1G2HA 3M4OJ 2R5ZA 3NAUA 4IHVA 2M0CA 3G1LA 5EYRA 1VNDA 2CUFA 4DYQA 2FX0A 1WGXA 5FKKA 4IHWA 3K2AA 5F0FA 4W97A 4JX5A 1ZQ3P 2CRGA 3JRFA 1MH4A 3K7AJ 3Q0UA 3ZQIA 1NK3P 3PO2J 2IAIA 2JK3A 2WAQN 5IYBJ 4M3DA 3FIWA 3S16J 1HDPA 1MBJA 1Q1VA 3LSJA 3JRHA 4A3LJ 1JKQC 1F36A 5HODA 3IH4A 1I6HJ 2CU7A 2LP0A 1OJLA 2P81A 4IHXA 1XS9A 2R5YB 1LFUP 1MBKA 1R9TJ 3LSRA 3BR2A 2YUSA 1LE8A 5FKOA 3RZOJ 2M2EA 4MIMA 3GBGA 1VI0A 4MLOA 1AKHB 3Q0VA 4A3CJ 4BY7J 5IPAA 4UUSB 1Z0XA 3TW6A 2QCOA 5EGOB 2M34A 2XPVA 3BQZA 2XGDA 4B1RA 3L1PA 1WCMJ 2EZHA 3JR9A 1Z77A 2EZKA 4A3EJ 2E2HJ 1H88C 3S1NJ 2H8RA 1FIAA 1FEXA 1IGNA 2Y30A 3A01A 2KDZA 1IC8A 4L5EA 1E3OC 3HB9A 1IV6A 3SJMA 1I50J 2JA6J 2R5ZB 1DU0A 2O9LA 4MFEA 4ABZA 2ID6A 1ETVA 1TWCJ 1H89C 2D5VA 1QRYA 2JN6A 1VFCA 2VKEA 3RKQA 2Y9ZA 2W48A 1FJLA 4FE7A 1I3QJ 3BG5A 2MSYA 3IH2A 4QSHA 3DCFA 3HEFA 5F1JA 1JGGA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3O8H A;  1IDY A;  2VI6 A;  1GVD A;  4BBR J;  5M3M J;  4V2F A;  3S15 J;  5E3L A;  2AHQ A;  2HXO A;  3BR5 A;  4FTH A;  5JLW A;  2JA5 J;  2EZI A;  5BNG A;  2R0Q C;  1W0U A;  1S7E A;  3H0G J;  4D7M A;  1ENH A;  1MNM C;  1SFO J;  2AO9 A;  2CQQ A;  1JKO C;  4UUT A;  4V2G A;  1JJ6 C;  1A6I A;  3BR0 A;  2Y0S N;  5IP7 J;  1ZTR A;  3F0C A;  4RBO A;  1TC3 C;  1YRN A;  9ANT A;  3GTP J;  2K9S A;  2LVS A;  4XRS G;  2EQR A;  1HOM A;  1LE8 B;  3IV5 A;  2DMP A;  4I76 A;  5E3M A;  3B6A A;  2E2J J;  1WI3 A;  2XB5 A;  5EZH A;  3HOZ J;  3JRG A;  3RZD J;  2HOS A;  1ETX A;  1JUS A;  1UG2 A;  4D7N A;  3BR1 A;  1OFC X;  5F0C A;  2LLK A;  3OIO A;  2YU9 J;  2XRL A;  3LSP A;  1F43 A;  4FCY A;  4JX4 A;  3CCY A;  3A02 A;  1X2N A;  4A69 C;  2L0K A;  2MGQ A;  4A3K J;  5M5Y J;  3BG9 A;  3CMY A;  2NVT J;  3TW7 A;  5EZG A;  3TED A;  2HQ5 A;  3PO3 J;  5FKN A;  5K7H A;  3A03 A;  2CJJ A;  2TRT A;  2GM4 A;  3A01 B;  1SAN A;  3JRB A;  2VUM J;  2VPR A;  5K7Z A;  1K61 A;  2NVQ J;  1JUM A;  4MO7 A;  1X2M A;  2O7O A;  4XIC A;  3M3Y J;  5GP9 A;  2N8G A;  1ZR2 A;  1JJ8 C;  4CYC A;  3CDL A;  3Q0W A;  1FIP A;  3QQA A;  2NOG A;  3ZQG A;  2DA7 A;  2K9Q A;  3Q3S A;  3JRI A;  3S1Q J;  1U8B A;  4C3H J;  2NVX J;  1FTZ A;  2EZL A;  2LK2 A;  3FK7 A;  4QIW N;  5FKM A;  5FLV A;  1LFB A;  3HDD A;  4XRM A;  3E7L A;  4DZP A;  2OF7 A;  2HXI A;  3I4M J;  1AU7 A;  3OOU A;  5E3N A;  3G1O A;  1ZK8 A;  4JP0 A;  2HDD A;  3MKL A;  1DU6 A;  1QVU A;  1ZGW A;  3HOU J;  1PUF A;  1GDT A;  3W6V A;  1P7J A;  4A3G J;  1UHS A;  1YRN B;  2VKV A;  3QPS A;  5F0H A;  2WV1 A;  4S0H B;  5J1U A;  2WB1 N;  2HOT A;  2X9D A;  1IUF A;  1K83 J;  1JUP A;  1U9O A;  1FTT A;  2YS9 A;  3VPR A;  4BKX A;  2OPT A;  3BTC A;  1RKT A;  2R7Z J;  3S1R J;  1MBE A;  3HOY J;  4A3F J;  2JJ7 A;  1RR7 A;  4M3G A;  5C3E J;  4D5C A;  2DA2 A;  1TWF J;  4AC0 A;  4M6V A;  3CQZ J;  5JLX A;  1MBG A;  1RPW A;  1MBH A;  4D5F A;  3C2B A;  1Y1V J;  3JRE A;  5C4X J;  2B63 J;  2EBI A;  2ME6 A;  1ZR4 A;  2LD5 A;  2XB0 X;  2DMQ A;  3OSG A;  4DW6 A;  5IP6 A;  3BR6 A;  4J19 A;  1HF0 A;  4GFB A;  1MSF C;  3B6C A;  2DJN A;  2KT0 A;  3S1M J;  1TWH J;  1HDD C;  4X6A J;  2DA1 A;  4C3J J;  1RES A;  5DTD A;  1Y1W J;  5EG0 A;  3GTK J;  1ETY A;  1MH3 A;  1MSE C;  4AYB N;  3RQI A;  2K40 A;  5FJ8 J;  4BXX J;  4A3D J;  1XG1 A;  2EH3 A;  4QTR A;  4JYK A;  3HOW J;  5F27 A;  1JKR C;  3BTI A;  3WHC A;  3OSF A;  1A5J A;  4G12 A;  2JWT A;  2ME0 A;  2E1O A;  3GTL J;  3S2H J;  2NVY J;  2DN0 A;  2M8G X;  1X58 A;  2PMZ N;  1NTC A;  3BQY A;  4MFD A;  1JTY A;  1IRZ A;  3TP3 A;  3HM5 A;  2DA4 A;  3SFI A;  1PUF B;  5GPA A;  3JRD A;  5IOY A;  1ITY A;  4XID A;  1B8I A;  2X48 A;  4DZJ A;  1JT6 A;  2E19 A;  5FKL A;  1BJZ A;  1O4X A;  1HLV A;  3LOC A;  2R93 J;  4XK4 A;  5IYD J;  1JKP C;  2K9N A;  1ORK A;  2LR8 A;  2HYJ A;  3JRA A;  2NS7 A;  1ETO A;  2XPW A;  5GPC A;  1AHD P;  2FJ1 A;  2NS8 A;  1APL C;  1HCR A;  3BTL A;  2Y9Y A;  2MW8 A;  2GLO A;  5M3F J;  1B72 A;  5F04 A;  3S2D J;  2QF7 A;  1WH5 A;  3IH3 A;  2L7M P;  2LTP A;  3SDG A;  2DMT A;  4JX6 A;  4XRS A;  2O8K A;  4A93 J;  2Y31 A;  2R92 J;  1WPK A;  3LNQ A;  2DA6 A;  4HNV A;  2I10 A;  1IG7 A;  2FQ4 A;  3HKZ N;  4C3I J;  1EF4 A;  3HGG A;  2DA5 A;  2XSD C;  2E2I J;  2ECC A;  2DMN A;  1IDZ A;  2ID3 A;  2LY9 A;  2H1K A;  2M9H A;  2ZB9 A;  3HGY A;  4EEF G;  2HOA A;  3FKI J;  4A3M J;  2RAE A;  5EG0 B;  1BW6 A;  1TWG J;  3GTQ J;  4DYR A;  3S14 J;  2LKX A;  4B4C A;  3HOV J;  2JA8 J;  2DA3 A;  5J3L A;  3ZQF A;  3ZOB A;  3ZQL A;  2IEK A;  5EEA A;  5C44 J;  1QPI A;  3ZQC A;  2IBD A;  5EDN A;  1T33 A;  5J1R A;  4M3B A;  3BR3 A;  1BL0 A;  4X1E A;  1JTX A;  2DMU A;  4B3A A;  5M5W J;  2CUE A;  1T56 A;  5EF6 A;  2MG4 A;  3BTJ A;  1VF9 A;  2LFB A;  4M3F A;  1UMQ A;  5IYC J;  5IP9 J;  3UKG A;  1W0T A;  4BBS J;  1P7I A;  2JMW A;  1POG A;  5F08 A;  3JRC A;  1B8I B;  3TP0 A;  3G1M A;  3QPL A;  5FLM J;  1TWA J;  3FK6 A;  3PM1 A;  4NDL A;  2FD5 A;  2XGC A;  3S17 J;  3WHB A;  2XGE A;  2JA7 J;  3NAR A;  1U78 A;  3I4N J;  3DEW A;  1D5Y A;  1GV2 A;  1RKW A;  4BY1 J;  1B72 B;  1U9N A;  2L7Z A;  4AUX A;  1ETK A;  1BW5 A;  2COB A;  4Y52 J;  4IEJ A;  3ZQH A;  5E3O A;  1H8A C;  3BT9 A;  4FIS A;  4A3B J;  3D1N I;  3LSG A;  4M3E A;  1JT0 A;  4CYC B;  3GTG J;  2ELK A;  1MBF A;  1WH7 A;  2R5Y A;  1ETW A;  1GV5 A;  2CQX A;  4I6Z A;  1IJW C;  1GUU A;  2Y2Z A;  4FE4 A;  2L7F P;  4A3I J;  4DYC A;  1ZKG A;  3H3V K;  3GTM J;  1GT0 C;  4C2M J;  3BG3 A;  4IHY A;  2G0E A;  4LOC A;  2DTZ A;  3FIS A;  3O8G A;  2X6O A;  3MVP A;  1AKH A;  1BA5 A;  4RDU A;  2GBY A;  1OCT C;  4UUS A;  3HBL A;  1NK2 P;  5M5X J;  5EGO A;  3GTO J;  4A3J J;  3MN2 A;  5IOZ A;  1OCP A;  2L9R A;  1CQT A;  1XC5 A;  4Y7N J;  5C4J J;  1RET A;  1ETQ A;  3HOX J;  3GTJ J;  2XPU A;  2ECB A;  1QVT A;  2HI3 A;  2TCT A;  5DS9 A;  4W1U A;  5K7F A;  5J1Y A;  1G2H A;  3M4O J;  2R5Z A;  3NAU A;  4IHV A;  2M0C A;  3G1L A;  5EYR A;  1VND A;  2CUF A;  4DYQ A;  2FX0 A;  1WGX A;  5FKK A;  4IHW A;  3K2A A;  5F0F A;  4W97 A;  4JX5 A;  1ZQ3 P;  2CRG A;  3JRF A;  1MH4 A;  3K7A J;  3Q0U A;  3ZQI A;  1NK3 P;  3PO2 J;  2IAI A;  2JK3 A;  2WAQ N;  5IYB J;  4M3D A;  3FIW A;  3S16 J;  1HDP A;  1MBJ A;  1Q1V A;  3LSJ A;  3JRH A;  4A3L J;  1JKQ C;  1F36 A;  5HOD A;  3IH4 A;  1I6H J;  2CU7 A;  2LP0 A;  1OJL A;  2P81 A;  4IHX A;  1XS9 A;  2R5Y B;  1LFU P;  1MBK A;  1R9T J;  3LSR A;  3BR2 A;  2YUS A;  1LE8 A;  5FKO A;  3RZO J;  2M2E A;  4MIM A;  3GBG A;  1VI0 A;  4MLO A;  1AKH B;  3Q0V A;  4A3C J;  4BY7 J;  5IPA A;  4UUS B;  1Z0X A;  3TW6 A;  2QCO A;  5EGO B;  2M34 A;  2XPV A;  3BQZ A;  2XGD A;  4B1R A;  3L1P A;  1WCM J;  2EZH A;  3JR9 A;  1Z77 A;  2EZK A;  4A3E J;  2E2H J;  1H88 C;  3S1N J;  2H8R A;  1FIA A;  1FEX A;  1IGN A;  2Y30 A;  3A01 A;  2KDZ A;  1IC8 A;  4L5E A;  1E3O C;  3HB9 A;  1IV6 A;  3SJM A;  1I50 J;  2JA6 J;  2R5Z B;  1DU0 A;  2O9L A;  4MFE A;  4ABZ A;  2ID6 A;  1ETV A;  1TWC J;  1H89 C;  2D5V A;  1QRY A;  2JN6 A;  1VFC A;  2VKE A;  3RKQ A;  2Y9Z A;  2W48 A;  1FJL A;  4FE7 A;  1I3Q J;  3BG5 A;  2MSY A;  3IH2 A;  4QSH A;  3DCF A;  3HEF A;  5F1J A;  1JGG A; 
#chains in the Genus database with same CATH topology
 3O8H A;  1G3Y A;  2UUZ A;  2W82 A;  4L9T A;  3S3M A;  3CUQ C;  1J2X A;  1I6X A;  4UY8 I;  1USS A;  1P4A A;  3T5X A;  1R1T A;  2K3P A;  5JLW A;  5ICE A;  2JA5 J;  2E5N A;  2XKO A;  2O8X A;  1I5Z A;  3EUH A;  3ZR8 X;  5DCM A;  2KKO A;  3DTK A;  2DFF A;  1YI2 I;  3KZZ A;  1JKO C;  4F52 A;  3A1Y A;  1JJ6 C;  1A6I A;  1YRN A;  5IP7 J;  1ZTR A;  4M73 A;  4I98 B;  2LKP A;  2K9S A;  2CS3 A;  2EQR A;  3AG4 H;  1ZRD A;  1U6G A;  3FX3 A;  5LHH A;  3B6A A;  2E2J J;  2RGV A;  2HFH A;  4IOC F;  5DUK A;  4PSW A;  3JRG A;  2HOS A;  1JUS A;  2QQ8 A;  2IS4 A;  3F6V A;  3MKW B;  3CMA I;  3OIO A;  1D1A A;  2YU9 J;  1WRJ A;  1Z6R A;  2DU9 A;  2VJJ A;  2VPL A;  3HHG A;  3OYA A;  3DKY A;  4B43 A;  4WXC A;  4EM1 A;  4PGG A;  1XTA A;  3VOD A;  1G59 A;  3A03 A;  2CJJ A;  4YII A;  5B3S H;  3BOQ A;  3LWF A;  5CKT A;  3SEQ A;  1IN5 A;  2CH0 A;  1ODD A;  5LEK A;  5FLX Z;  3EDP A;  3OYF A;  1X3Z B;  3W3C A;  2VL8 A;  3MZ8 A;  1JUM A;  3FF5 A;  2UXX A;  1ZYR F;  2CFO A;  5FO5 A;  2IPQ X;  3M3Y J;  2PI0 A;  5GP9 A;  1OCC H;  2DQL A;  3WG7 H;  3PNT A;  1ZR2 A;  4CYC A;  4ZZL A;  4KA4 A;  2DT5 A;  3Q0W A;  4MHG A;  1NH3 A;  5DD8 A;  1R4N B;  2DA7 A;  4O6J A;  3JRI A;  2ISY A;  2MC3 A;  2MA3 A;  3S1Q J;  1U8B A;  1UG0 A;  4G6D A;  1EV7 A;  1R4M B;  3FK7 A;  2KIU A;  5FLV A;  4ENK A;  3O2P E;  1O3Q A;  2ZXI A;  3VFZ A;  3M8J A;  1AU7 A;  2F5C A;  2PEX A;  3ZMS A;  2DFE A;  2FQ3 A;  4E70 A;  2QZ8 A;  3UNG C;  3HOU J;  4EJV A;  3HRT A;  3W6K B;  3KCC A;  4XLA A;  3WTW C;  5J4V A;  1UHS A;  4FX4 A;  5HNF A;  2QVO A;  3CME I;  3BCB A;  2P6T A;  3GME A;  4HPQ A;  1CF7 A;  2GA1 A;  2VT2 A;  5DDG A;  3WGH A;  2R7F A;  1U9O A;  3K4K A;  1W36 D;  4L18 B;  3VSK A;  4IRI A;  4GDF A;  1YE9 A;  4KIS A;  5LFA A;  3BTC A;  1HBX G;  1RKT A;  1IO2 A;  4ESF A;  2R7Z J;  4DJA A;  2HYG D;  2VBZ A;  4XQF A;  1YX3 A;  3KPH A;  4A3F J;  3KIO A;  4D5C A;  4BGD A;  4A0X A;  3L9F A;  1N77 A;  2XUB A;  1MBG A;  4M9Z A;  1RPW A;  4MTD A;  3PFY A;  3B73 A;  3F8M A;  3OS1 A;  1RUN A;  3MZH A;  2MH2 A;  4L9V A;  3R60 A;  5C4X J;  5ED4 A;  2LOO A;  2EBI A;  3S8P A;  2PJR B;  1HC8 A;  4S04 A;  2ME6 A;  3DU6 A;  4UB6 C;  2LD5 A;  2NS0 A;  5GAD J;  4EVI A;  2STW A;  3LST A;  3PFI A;  1JHH A;  5TGT A;  4DW6 A;  2BW3 B;  2P5V A;  3E6C C;  3V7C A;  1A31 A;  3DQV C;  3I3L A;  4LB6 B;  2O0Y A;  1PJR A;  2XRO A;  3S1M J;  5BMZ A;  3ZN0 A;  1XDU A;  1MDM B;  2K85 A;  2OCC H;  4C3J J;  4BHP A;  4XLC A;  1FY7 A;  5EG0 A;  1MH3 A;  4B8X A;  4PGH A;  2DT7 B;  5FJ8 J;  3AKZ A;  3H0D A;  1XG1 A;  2EH3 A;  3M8E A;  1MGT A;  1D1B A;  2HQN A;  3HSR A;  4P9U A;  2R7X A;  1PUE E;  1BBY A;  3P5J A;  1G3S A;  3W2A A;  2WAD A;  1A5J A;  2ELH A;  2D1H A;  2ME0 A;  2VE8 A;  1TT5 B;  2DAO A;  2X6X A;  3U1K A;  4FAS D;  4X0G A;  3F22 A;  1O3S A;  2EIK H;  1QZE A;  4HQE A;  2NOJ B;  3LQR A;  2EFN A;  2OZU A;  1WZ2 A;  4BXF A;  3AFH A;  1MW7 A;  1PUF B;  3ECO A;  3H36 A;  4ANJ A;  3ZQQ A;  2RVC A;  4XID A;  3HPG A;  4GGG A;  1XSX A;  4N4O B;  4UVA A;  5FKL A;  3LOC A;  3LSK A;  1S5L C;  4XK4 A;  2R93 J;  1JKP C;  2F5E A;  2GXA A;  1OMI A;  1IXC A;  2XAF A;  2HYJ A;  3RTR A;  3DF8 A;  3K1P A;  2BXZ A;  2NS8 A;  1E3P A;  2UXN A;  1IN6 A;  4RGX A;  2QF7 A;  3HTU A;  1T2K A;  3TDZ C;  4HYE A;  2HPI A;  4CYD A;  5CVV A;  5HDK A;  3ISP A;  1SFU A;  2P0W A;  4ZJZ A;  1BM9 A;  2QEX I;  4IRH A;  4XLH A;  2VOP A;  2DMT A;  2COM A;  2WY7 Q;  4UVB A;  5GTH C;  2P5L C;  3BG7 A;  4FT8 A;  2W84 A;  4NNJ A;  2DA6 A;  2L3D A;  1FT9 A;  1R5I D;  2FU4 A;  4F92 B;  3HGG A;  3OYN A;  3RKY A;  2HVS A;  4G6T B;  3E5X A;  2ZBK A;  3DXJ F;  2ZB9 A;  1TQI A;  4EEF G;  1U3E M;  2CMP A;  2RAE A;  4KIF A;  2LDU A;  5KK1 A;  1K4S A;  4B4C A;  2DOE A;  3H9Q A;  4HV6 A;  4L0Y B;  2JA8 J;  5J3L A;  3ZOB A;  3ABK H;  3H3Z A;  2FXA A;  5EEA A;  5C44 J;  1ACI A;  1RR8 C;  2H94 A;  3EYY A;  1T33 A;  5K5R A;  1BN5 A;  2GOM A;  2QWW A;  5GTI C;  2VJI A;  1ON2 A;  5EEG A;  2W4S A;  2DMU A;  3MCZ A;  5M5W J;  4I7H A;  2KQR A;  4MGR A;  2UZK A;  1VF9 A;  5IYC J;  1W0T A;  1UMQ A;  5IP9 J;  2HVQ A;  4HNU A;  2FML A;  3DKW A;  3SZP A;  4GYG A;  3TP0 A;  2CGP A;  5E17 F;  1LNW A;  2R7U A;  3E5U A;  3EPZ A;  1TWA J;  2HGC A;  4NDL A;  4B09 A;  4RAZ A;  4F93 B;  5HVQ C;  4IHT A;  4IVN A;  2LC2 A;  1SD7 A;  3DBH B;  1PP7 U;  3FXQ A;  1G8X A;  6PAX A;  3NAR A;  5AIP A;  3DEW A;  1D5Y A;  1D1C A;  3S2W A;  1GV2 A;  2H27 A;  3IC7 A;  4HOB A;  1X1A A;  4LG3 A;  1FYL A;  1E3H A;  4AUX A;  2F2E A;  4Y52 J;  1RC9 A;  5LGT A;  2E7X A;  1BOB A;  2K4B A;  3OWT A;  1D8K A;  1Z1D A;  1FSE A;  2RNG A;  3LSG A;  1JT0 A;  3L2C A;  4CYC B;  1T0F C;  3AL0 B;  1FPQ A;  1WH7 A;  5E18 F;  2A5W A;  2ETH A;  1IJW C;  3DV8 A;  2GOX B;  3NWS A;  3D0S A;  3VYT B;  3FXO A;  2L7F P;  1ZKG A;  2LF7 A;  3H3V K;  4LOC A;  2LNB A;  4GRI A;  5FGM A;  4WX9 A;  2X6O A;  1BR1 A;  3I5U A;  2GBY A;  2IA2 A;  3WTS C;  2A5Y B;  1NK2 P;  4M9X A;  4CH7 A;  3MN2 A;  1FOW A;  1HXD A;  3OYI A;  2L9R A;  5FRM A;  4AIH A;  4JBA A;  4LG0 B;  1KU2 A;  1CQT A;  4I01 A;  3TOA A;  1BI0 A;  1IRG A;  2O6G E;  2PX9 A;  1I1S A;  4V19 K;  4HNT A;  5K7F A;  4E6K G;  5J1Y A;  4E7H A;  3HPH A;  3WTT C;  2IA1 A;  1Z67 A;  4IL6 C;  4BJ5 C;  3BP8 A;  5H6Q A;  2PLY A;  3SQN A;  2KIF A;  2FUG 2;  2L4M A;  4EJO A;  2ZFW A;  3G1L A;  4CCM A;  4DOZ A;  1YG2 A;  4M72 A;  2ZJP F;  1VND A;  4KN4 X;  3K2A A;  3PIO F;  4W97 A;  2E1C A;  2X51 A;  1V3F A;  3Q0U A;  2HPM A;  1MMN A;  3HJE A;  4II3 A;  1DUX C;  2M3A A;  4F7Z A;  3KE2 A;  3S16 J;  2FMY A;  2V26 A;  4I99 C;  4CCN A;  3LSJ A;  1JKQ C;  4AIJ A;  2Q1Z B;  5HOD A;  4WXH A;  4A6E A;  1LDD A;  5LGU A;  1ZGJ A;  4Z6Y A;  3L2U A;  4HLY A;  3MZY A;  4DQ2 A;  2K3F A;  2ZNZ A;  1HKQ A;  2WB1 A;  3I59 B;  4IPA A;  4AID A;  2R5Y B;  1LFU P;  3C1D A;  5J8F A;  1TBX A;  1SFK A;  1R6R A;  1MBK A;  3QOP A;  3BR2 A;  1XGM A;  3LSM A;  5FKO A;  2R7W A;  3NEU A;  4XLP F;  3GLL A;  3E97 A;  3V8J A;  1W7P B;  1VI0 A;  4A3C J;  3QPT A;  1BC8 C;  1ZN2 A;  4PUS A;  4G9Y A;  1IRF A;  4BY7 J;  4UUS B;  1SVL A;  3TW6 A;  4HEA 2;  4IZZ A;  5EGO B;  4U88 A;  3BQZ A;  4PJL A;  4HX8 A;  4EQQ A;  5HDN A;  2NRA C;  5IT3 A;  4BQQ A;  1SD5 A;  1XB4 A;  2EZH A;  3FHN A;  1WSU A;  2X1E A;  1PP8 F;  1H88 C;  2GXB A;  3RDI A;  5BS6 A;  3F8N A;  3GEZ A;  4XM3 A;  2D45 A;  1FIA A;  1FEX A;  3WG9 A;  2JRM A;  2KDZ A;  1U8R A;  1DGR M;  2HQR A;  5LEJ A;  1X1B A;  3SJM A;  4Z2Y A;  2JA6 J;  3MFK A;  2BY0 A;  1W4M A;  1T8I A;  2OJE D;  3JSO A;  2R5Z B;  4HX4 A;  1DU0 A;  2XRN A;  4LJZ F;  3O6B B;  5CVU A;  2EPF A;  1YS6 A;  1T98 A;  4ENJ A;  2OA4 A;  2D5V A;  3ZMT A;  1LKX A;  3R0A A;  3F6O A;  1EJ9 A;  3RKQ A;  1FNN A;  3KP3 A;  3W2W A;  1FJL A;  3BG5 A;  3WE2 A;  2MSY A;  2A68 F;  3SZG A;  1LVA A;  2AXT C;  4QSH A;  1P9Q C;  1WQ2 A;  2FBI A;  4N9I A;  4DIQ A;  4CCO A;  4HDU A;  1EA3 A;  1FYK A;  3OIP A;  2KIS A;  3HEF A;  5F1J A;  1O3T A;  1YJW I;  3GZ5 A;  2PMZ A;  1GXQ A;  2VI6 A;  1GVD A;  3CES A;  3PNV A;  2RC4 A;  3QU3 A;  5E3L A;  5CPR B;  1LEB A;  2HXO A;  1ULY A;  3H5N A;  2FA5 A;  1MNE A;  2ELJ A;  4E7K A;  2IJL A;  3HC7 A;  4D7M A;  1YTY A;  4WWC A;  1SFO J;  1FMW A;  4HZF A;  2KLO A;  2CQQ A;  3OR1 C;  1BI1 A;  4HA8 A;  9ANT A;  2VQC A;  3F0C A;  3E1S A;  4KMU X;  1TQM A;  1SMT A;  5CVJ A;  2R4G A;  3JSP A;  4XRS G;  1UHW A;  4LLN A;  1HOM A;  1W5C C;  3K6G A;  2DDB A;  2DMP A;  2YR2 A;  1WI3 A;  2HDW A;  3WU0 A;  2XAS A;  5EZH A;  3HOZ J;  2HKX A;  3K4J A;  1KQ8 A;  5D8K B;  1B1B A;  5ICC A;  1UG2 A;  4D7N A;  1KON A;  1S72 I;  4BNC A;  5F0C A;  3CUQ B;  2V6C A;  1I3A A;  1Y8R B;  3H9J A;  3CCY A;  4JX4 A;  3A02 A;  4XNF A;  3J7Z I;  2QSH X;  2BVM A;  2L0K A;  3ZGK A;  2J5P A;  3CJQ B;  1Y8Q B;  2CW7 A;  3TW7 A;  2HQ5 A;  2F4I A;  2ESH A;  4Y15 A;  5J47 A;  5FKN A;  3PO3 J;  3K4M A;  2DO7 A;  5LBQ A;  3HKZ A;  1OYI A;  2GM4 A;  3QRF F;  3A01 B;  2PJR A;  1SAN A;  4PFO A;  3D5R C;  4IRG A;  1K61 A;  3G4S I;  4PZJ A;  2NVQ J;  2BW3 A;  4MO7 A;  2O7O A;  3KP6 A;  4XN3 A;  2QSF X;  4YEJ A;  5BOX A;  1IXS B;  4BE0 A;  1XGS A;  2EA4 A;  2FSW A;  2N8G A;  3KZY A;  3DBR B;  3EUK L;  2M45 A;  4XLE A;  2CV1 A;  1FIP A;  2RKH A;  2NOG A;  2BV6 A;  5GAG J;  1UFM A;  3ZMD A;  3C2G A;  3L2R A;  3PQK A;  2VJ4 A;  2NVX J;  1FTZ A;  1IW7 F;  2BHY A;  4CIC A;  3KEY A;  3R0J A;  4QIW N;  2VQL A;  3HDD A;  1B59 A;  3E6M A;  4DZP A;  2FEZ A;  2OF7 A;  2HXI A;  3FMS A;  2STT A;  1O7F A;  4ZZD A;  1LEA A;  1OQY A;  3OOU A;  4PJ0 C;  1MIJ A;  4QLC U;  1XMX A;  1ZK8 A;  2MFZ A;  2QLZ A;  1PUF A;  1GDT A;  1QZY A;  5KHD A;  1P7J A;  2DT6 A;  2BY3 A;  5HLI A;  4FET A;  3DTI A;  1QGP A;  5J1U A;  2MBF A;  3PQJ A;  5J4Y A;  3O3K A;  4BAY A;  1IUF A;  2CWE A;  4A2U A;  1J7K A;  4PDK A;  4F3Q A;  1JUP A;  2HZD A;  2KPM A;  2V1N A;  2YS9 A;  5LLQ A;  3KLO A;  3GF2 A;  3IRR A;  1IF1 A;  2QEN A;  3G6E I;  3LAJ A;  5JHF A;  3VPR A;  2Y0M A;  1NG6 A;  4M9S A;  5CVR A;  3N4M A;  3GFM A;  1MND A;  1MBE A;  3UR3 C;  3VB2 A;  2ACJ A;  2KJB A;  3K1M A;  2KRH A;  2HOE A;  2XGX A;  1VQ8 I;  1TWF J;  4AC0 A;  5ILV A;  3CQZ J;  3BZK A;  2ZSH B;  3DEU A;  3A4C A;  1UB9 A;  2B9S A;  1MBH A;  2PMH A;  3C2B A;  1Y1V J;  3JRE A;  2RDP A;  2DFI A;  4HSR A;  2X85 A;  1QO0 D;  1IUY A;  4UVC A;  5DM6 F;  2I8D A;  4HX7 A;  1ZR4 A;  1U5T A;  2RN7 A;  5FRN A;  2OV7 A;  3OYC A;  3V7R A;  2DMQ A;  1XSV A;  3GUD A;  3OSG A;  5TIS C;  4ENN A;  2OAZ A;  4GFB A;  1MSF C;  2X6Y A;  4RAF A;  2MAB A;  2LH9 A;  3K4L A;  2IGK A;  3HTS B;  2KFD A;  4IJA A;  2EIJ H;  1Y0U A;  2F5V A;  2RQQ A;  1HDD C;  2DA1 A;  5DUI A;  3DTE A;  3CO7 C;  3NWT A;  3U9G A;  1Y6I A;  1MKM A;  1FWZ A;  3ML6 A;  3SZT A;  2ZME C;  1IRX A;  3LA7 A;  4RM3 A;  3RQI A;  1MSE C;  3WOD F;  1MMA A;  3PUF A;  2PJP A;  1YX5 A;  2V1X A;  4QTR A;  1OR7 C;  1TNT A;  3VOE A;  1UCR A;  1JKR C;  3FXJ A;  3OSF A;  4CHU A;  2WA0 A;  4IXA A;  2M8G X;  1L3L A;  3VYU B;  3N97 A;  1NTC A;  5KVR A;  1VQK I;  4ZYE A;  1XMK A;  3TP3 A;  3HM5 A;  2M7A A;  1BIA A;  4NQW A;  2E36 A;  2DA4 A;  4E7J A;  2IA0 A;  2GZW A;  5IOY A;  2WC2 A;  3KYL A;  1YW7 A;  3QP6 A;  1ITY A;  3S93 A;  4DZJ A;  5HS8 A;  1JT6 A;  1QZZ A;  2AQE A;  2E19 A;  4M74 A;  2HVR A;  2E1M C;  1HSJ A;  2M1B A;  2K9N A;  4NHJ A;  3M07 A;  1ORK A;  2LR8 A;  4BH9 A;  3LMM A;  1R36 A;  3JRA A;  2EIN H;  3FXL A;  2XPW A;  3WTY C;  2O5R A;  2Y9Y A;  1NHA A;  1BR4 A;  2WWY A;  5M3F J;  5F04 A;  3L2V A;  3RPQ A;  3CCQ I;  3PUB A;  1XCB A;  3CCU I;  2XF7 A;  3CCS I;  1SFX A;  2Y75 A;  3C2H A;  4XLN F;  4XRS A;  4A93 J;  1Z3Y A;  2Q8K A;  1J9I A;  1WPK A;  3TKY A;  1FMV A;  3KP4 A;  2P8T A;  3I56 I;  1IG7 A;  1X4P A;  2FQ4 A;  1FYM A;  2DQR A;  2ECC A;  4ZYH A;  3KFW X;  3LL7 A;  2LY9 A;  2V79 A;  2QQ9 A;  2EK5 A;  2WV0 A;  1X4O A;  2M9H A;  1XGO A;  4MQV A;  3FKI J;  3ERM A;  2JA2 A;  5FFZ A;  4B3X A;  2GIZ A;  1BW6 A;  1FBQ A;  4BUP A;  1TL8 A;  1VQL I;  3FKJ A;  4LG0 A;  2L9N A;  5E1Z B;  2IRF G;  3WU2 C;  5CLS A;  4PJM A;  5J6X A;  5CJ9 A;  3HRM A;  1QPI A;  1XSD A;  5BPI A;  5J1R A;  2QQB A;  2BE5 F;  4X1E A;  4UXN A;  4A6D A;  5L3G A;  2PG4 A;  1T56 A;  4XSX F;  2HNH A;  5EF6 A;  3S3O A;  1OKR A;  2MG4 A;  1I27 A;  2ZJQ F;  1HW5 A;  5HLH A;  4A12 A;  2JMW A;  1VQ5 I;  3CCL I;  1SEU A;  1W5S A;  4XKB A;  3C7J A;  1YYV A;  3QPL A;  1O3R A;  4XKW A;  3F3X A;  1HW1 A;  3FK6 A;  3PM1 A;  2L9S A;  4RS8 A;  2FD5 A;  3SEZ A;  2EV0 A;  4HLX A;  3WHB A;  4H4K C;  2XF6 A;  2XAG A;  2XGE A;  2W24 A;  3VEP A;  1D0Y A;  5JHU A;  3BCA A;  3ABT A;  3DU5 A;  3OYK A;  2W7N A;  1B72 B;  1U9N A;  3T0Y A;  1ZLJ A;  2M4K A;  1HKT A;  3F8C A;  4AD9 A;  2ZCW A;  2UWM A;  2L4A A;  2VC1 A;  5JR3 A;  1WJ5 A;  2OZ6 A;  3BT9 A;  4FIS A;  4A3B J;  4M3E A;  3TDU C;  1AWC A;  2OQG A;  2FOK A;  2ELK A;  2P6S A;  4IOA F;  3I59 A;  1H0M A;  1MBF A;  3EYI A;  2R5Y A;  1ETW A;  3CMM A;  4BJ6 C;  3ELK A;  3F9K A;  2ADU A;  4FE4 A;  1ZAO A;  2DPU A;  4DYC A;  3KEO A;  5ILS A;  4NBQ A;  3FM5 A;  2PBI A;  3CC2 I;  4D0P A;  4YFX F;  1W7P A;  3O8G A;  3W2V A;  1BA5 A;  4UUS A;  3FMQ A;  4RGR A;  5JI6 A;  5M5X J;  5EGO A;  3ABL H;  4BS9 A;  5IOZ A;  1OCP A;  3LFU A;  4Y13 A;  1KU7 A;  1MZB A;  2V9P A;  1XC5 A;  4Y7N J;  2AXL A;  3HOX J;  3HZJ A;  1FBS A;  2L01 A;  2JSP A;  3AAF A;  2JZY A;  2K9M A;  2AQF A;  5LD2 C;  3N05 A;  4UV9 A;  3FHZ A;  2XDV A;  2Z99 A;  3KEQ A;  3PSF A;  4ZYA A;  2R5Z A;  3NAU A;  2G9W A;  3ABU A;  3DBL B;  1JGS A;  2FBH A;  4OIP F;  4LIT A;  4NUB A;  4KIC A;  4ZDP A;  5E8G A;  4HG2 A;  2MC4 A;  3TO7 A;  5F0F A;  1ZQ3 P;  4JX5 A;  2E5Z A;  3ECH A;  4KN7 X;  3IKT A;  3ZQI A;  3KYD B;  2K7L A;  3PO2 J;  2IAI A;  3CP2 A;  5DCF A;  1U5T B;  3H92 A;  5IYB J;  1TLH B;  3LSH A;  5K1Y A;  1X1P A;  4M3D A;  3FIW A;  2HWV A;  2M30 A;  1HDP A;  1N25 A;  5E1X A;  3SXY A;  4A3L J;  1LDJ A;  1R1V A;  4LK1 F;  4OIN F;  3TO9 A;  2ZXW H;  2A6H F;  4EJW A;  1W1W E;  1ZEL A;  3FXR A;  4H0E A;  2LP0 A;  1OJL A;  3OYL A;  1XDS A;  4KUM A;  1SAU A;  3HUG B;  2KIQ A;  3BG6 A;  1Y0N A;  4LIU A;  2K02 A;  4U7D A;  3LSI A;  1RNL A;  4PCQ A;  5CVI A;  1YW9 A;  5D6E A;  1S7O A;  1R9T J;  3I0T A;  2FRH A;  1DQU A;  2RNJ A;  2YUS A;  4YIR X;  1R5H A;  1P92 A;  4RB3 C;  4LK0 F;  4G7O F;  3QP5 A;  3RSN A;  4LGW A;  1S7A A;  3G2B A;  4RB2 C;  1YO5 C;  1AKH B;  4M71 A;  5IPA A;  1Z0X A;  3PL8 A;  4NQW B;  1VQP I;  2O03 A;  5E8I A;  1X19 A;  3HSE A;  2X1C A;  3CUQ A;  4CCJ A;  1ZGA A;  4D9J A;  2Q2E B;  1OYW A;  3ZN1 A;  1Z77 A;  4A3E J;  3GFL A;  2EB7 A;  3OYJ A;  2IT0 A;  2F4O B;  3KYC B;  5CQE A;  3BJ6 A;  1IGN A;  4Q48 A;  2Z1D A;  1ZRE A;  2Y30 A;  3A01 A;  1WI9 A;  1E3O C;  4L5E A;  1IV6 A;  3EUA A;  4R79 A;  3D5L A;  2L7K A;  4G6Q A;  5CYV A;  2O9L A;  4XR6 A;  2P7C B;  3CLQ A;  4I0A A;  1PYV A;  1IV8 A;  3KP2 A;  3DWL E;  1R1U A;  4U0W A;  4IQJ A;  4AYB A;  3M1E A;  4CO8 A;  1WFX A;  1F1Z A;  3Q9S A;  5F64 A;  2Y9Z A;  2Y0S A;  3GFJ A;  3SHF A;  4L9N A;  1TT0 A;  3IL2 A;  4BQA A;  2X0L A;  3IH2 A;  4G7H F;  1K7A A;  2LRD A;  2EV5 A;  4ZTF A;  3CCJ I;  4C2U A;  2FF4 A;  3M9A A;  3K69 A;  4IF4 A;  3GXO A;  4XLF A;  2R7Q A;  1MD0 A;  5M3M J;  4AIK A;  1W7P D;  2VIX A;  4GXO A;  3PSI A;  3FM3 A;  4A0Y A;  1FOK A;  2ZJR F;  2AHQ A;  3BR5 A;  4CDG A;  5D4R A;  1EKE A;  2Z2S B;  2NXN B;  2TDX A;  3VWB A;  3WGI A;  2R0Q C;  4K2E A;  1W0U A;  3H0G J;  1ONV A;  1Z3X A;  2JPC A;  3CDH A;  2OC6 A;  3W6J B;  1MNM C;  4HW0 A;  1GLN A;  5ICG A;  4UUT A;  2ZKZ A;  4CCK A;  1YIJ I;  3HOT A;  2Y0S N;  1TC3 C;  1W36 C;  2V1U A;  2A69 F;  1MJA A;  1WJA A;  1WKM A;  3T8T A;  1HST A;  3IV5 A;  2XAQ A;  2A6T A;  4I76 A;  5E3M A;  3ZP5 A;  1VZ0 A;  2XB5 A;  1FP2 A;  1QHG A;  1EH7 A;  2M8E A;  5A2Q K;  1ETX A;  5L3C A;  5IT9 K;  3QWL A;  3QU6 A;  5HS9 A;  2LLK A;  4GO1 A;  4FCY A;  1X2N A;  4A69 C;  3HL2 A;  2MGQ A;  2YPR A;  5M5Y J;  2OUM A;  3CMY A;  2HEO A;  2BY1 A;  5EZG A;  4A5M A;  3TED A;  3M8F A;  4UV8 A;  3I64 A;  1BI3 A;  3TQN A;  3CJT B;  2QM3 A;  2DXI A;  2TRT A;  2M5W A;  1Y39 A;  2P7V B;  4HRI A;  2VPR A;  3EUH C;  3BWG A;  1XN7 A;  2CUZ A;  2ESN A;  1X2M A;  3I71 A;  3RQ4 A;  1Z7U A;  1LQ1 A;  4L0Z B;  4II2 A;  5DV5 A;  5ERI A;  3EET A;  1J09 A;  1NG7 A;  3P9C A;  4NB5 A;  3IWF A;  1G4D A;  1T95 A;  3QQA A;  2DYR H;  3ZQG A;  1RIO H;  2M4G A;  3U1D A;  3Q3S A;  2VJ5 A;  2ZSI B;  1HKS A;  1MMD A;  2EZL A;  2KJC A;  1XGN A;  2I5U A;  2XVC A;  2GIV A;  4BU2 A;  4UB8 C;  2EIM H;  3IKV A;  1LFB A;  4XRM A;  3E7L A;  4OMZ A;  3SDB A;  4BE2 A;  1UST A;  2BZT A;  3I4M J;  4U87 A;  2D1V A;  5FRO A;  2DW4 A;  2VB6 A;  3D5S C;  3CZ6 A;  3G1O A;  2OTJ I;  5KAI C;  4ON0 A;  1QVU A;  4MEY F;  3OR2 C;  3W6V A;  5D4S A;  5B1A H;  1J5Y A;  1Z9C A;  4I2O A;  2GWR A;  3MKY B;  2VKV A;  2CSO A;  3QPS A;  2UV1 A;  2DBB A;  5F0H A;  1QU3 A;  1E0E A;  1S6L A;  2WB1 N;  4RAY A;  1ERD A;  2X9D A;  1T39 A;  2CV0 A;  1K83 J;  2JPB A;  2JT1 A;  1G6N A;  3OYD A;  1KU9 A;  3S1R J;  1STZ A;  3OY9 A;  3JCU C;  2R7D A;  2MD5 A;  2JJ7 A;  2PN6 A;  3TMO A;  5C3E J;  2A6E F;  1QNT A;  3CCM I;  2DA2 A;  4DNC A;  1X1C A;  3FXK A;  2IXS A;  4M6V A;  4XSZ F;  2CO5 A;  3DPU A;  2K9L A;  4HQM A;  4XMY A;  1V4R A;  4O5V A;  4D5F A;  1TZL A;  2VXZ A;  3BY6 A;  4OAZ A;  2X6W A;  4S05 A;  1F4K A;  1DGW Y;  2B63 J;  2IW5 A;  2YX4 A;  1LUJ B;  5D5W B;  1Z7L A;  2WBM A;  2XB0 X;  1O7L A;  3P9I A;  2QKL B;  4ZH4 F;  3L2Q A;  2KDO A;  1YIT I;  4J19 A;  1YLF A;  5EEH A;  3B6C A;  2K4J A;  5H6R A;  5BPD A;  2KT0 A;  4FHT A;  2BXY A;  2F4M B;  1RES A;  5HDG A;  5A2Q Z;  4ZYD A;  4BQO A;  4P1W A;  3BJA A;  4RLQ A;  4KMF A;  1TQP A;  4BEH A;  4FX0 A;  2Q0O A;  4A3D J;  4J00 A;  2VQH A;  2KHM A;  4HF0 A;  2H09 A;  5F27 A;  4Q4Z F;  3BTI A;  3K70 D;  3WHC A;  4XON A;  4KJZ A;  2QA4 I;  3TO6 A;  1D0Z A;  2CQK A;  2FNP A;  3CCE I;  4G8X A;  2QBY A;  1UZC A;  2OU2 A;  3S2H J;  1X58 A;  4CGZ A;  2PMZ N;  3I53 A;  5FD5 A;  4MFD A;  2R7R A;  1JTY A;  1IRZ A;  4RAG A;  3SFI A;  5GPA A;  3G71 I;  2NAZ A;  3JRD A;  4BDY A;  3P9K A;  4EV0 A;  2X48 A;  2XAJ A;  2BGC A;  5K5O A;  1O4X A;  1HLV A;  3MQ0 A;  1IZ1 A;  4BDZ A;  5IYD J;  3RI4 A;  5HOO A;  2M7B A;  2VC0 A;  3H3U A;  1FC3 A;  1A6Q A;  2A05 A;  2A3S A;  2LYC A;  2NS7 A;  2L2O A;  5F6F A;  4EMS A;  5TJJ A;  1HCR A;  1APL C;  2JVG A;  4RMN A;  5H20 A;  2MW8 A;  1B72 A;  3S2D J;  1WH5 A;  1UEL B;  1M1E B;  2FE3 A;  4HF2 A;  3E5Q A;  1G3W A;  2BYV E;  1YHQ I;  1V5F A;  3CTA A;  3RYP A;  2HTJ A;  2O8K A;  2W00 A;  3IAS 2;  2R92 J;  1VTN C;  4AWX B;  3BJO A;  5EJC A;  4HNV A;  1XPX A;  3GYH X;  2E1M B;  3HKZ N;  4C3I J;  1EF4 A;  2GQQ A;  2DA5 A;  1V54 H;  2RV8 A;  3MAJ A;  1W5T A;  2W85 A;  3RCO A;  2H1K A;  5HLG A;  4E7I A;  2VON A;  3HGY A;  2HOA A;  4A3M J;  2DDA A;  1KQ0 A;  1TWG J;  3GTQ J;  5HNH A;  4AM3 A;  3S14 J;  3AG1 H;  2Y48 A;  2DA3 A;  2NNN A;  3ZQF A;  1SD6 A;  3J81 K;  1J59 A;  3ZQL A;  3BPV A;  3ZRG A;  3ZQC A;  2IBD A;  2JVH A;  1A36 A;  3BR3 A;  3FBI B;  1TW2 A;  3ONQ A;  1T0F A;  2B0L A;  2HR3 A;  1H9T A;  1JTX A;  1SVO A;  1UJ8 A;  1D5V A;  3LA3 A;  4WK8 F;  3WTX C;  3ULQ B;  3ESW B;  4YRV A;  1PDN C;  3BZC A;  1K78 B;  3R4K A;  4KYW A;  3BTJ A;  1XCV A;  2LFB A;  3UKG A;  5LHG A;  4BBS J;  1FOY A;  1HA8 A;  1P7I A;  2NYX A;  2ZC2 A;  3JRC A;  2FNA A;  1B8I B;  3HRS A;  2V4J C;  4YFK F;  3OYB A;  5AIQ A;  3G1M A;  3OYH A;  4UNO A;  3JW4 A;  2XV4 S;  3EQL F;  2BOL A;  5LHI A;  3A0H C;  1TP4 A;  2XHK A;  3FMR A;  4HV5 A;  1Z91 A;  3MD2 A;  2R7S A;  3FXM A;  2V9V A;  5JFR A;  2PFB A;  1XX5 A;  2JA7 J;  4E4H A;  3I4N J;  1LDK B;  1ON1 A;  1RKW A;  4BY1 J;  2OQR A;  3ZXS A;  4YG2 F;  2L7Z A;  5H2F C;  1MJB A;  1ETK A;  1IAW A;  1BW5 A;  4CUG A;  2OCE A;  4IEJ A;  3ZQH A;  3D1N I;  1Z6T A;  3GTG J;  5B1B H;  3HUG A;  3G73 A;  4RB1 A;  1MMS A;  5ILU A;  4LLL A;  1Z05 A;  2F5F A;  1GV5 A;  4MTE A;  2CQX A;  1GUU A;  4RA2 A;  2WAE A;  2P5K A;  1ZH5 A;  4C2M J;  4CXF A;  4IHY A;  2DJI A;  1QQI A;  4GYI A;  3S32 A;  1FP1 D;  2DTZ A;  3FIS A;  4YFN F;  1H9G A;  1AKH A;  3S3N A;  2BHZ A;  2EJR A;  3H5R A;  4L5J A;  1I1G A;  4DBR A;  3HBL A;  2Z9O A;  4A0Z A;  1E2X A;  3GTO J;  1P4X A;  3HYI A;  2GXG A;  2HU9 A;  2Q2E A;  2FBK A;  2KL4 A;  3OMY A;  1VQ6 I;  5C4J J;  1ETQ A;  4CZC A;  2G7H A;  4ITV A;  1A35 A;  2XPU A;  2WAQ A;  4F91 B;  3GWZ A;  3DPT A;  1BIB A;  4L9J A;  3CF5 F;  1D3Y A;  3V42 A;  4W1U A;  5TRD A;  1N78 A;  3R6S A;  4Y3O A;  2CYY A;  2DOF A;  4QPO A;  4IO9 F;  1KYW A;  4D1Q A;  3C18 A;  2WY8 Q;  4IHV A;  1J75 A;  3FBN B;  2CW0 F;  3WE3 A;  2ZXJ A;  1WJC A;  1R7J A;  5CQG A;  5E20 A;  5GAH J;  4KDP A;  2IGO A;  1RI7 A;  4EJU A;  2VE9 A;  3K4N A;  3G3Z A;  2FX0 A;  1WGX A;  5D8L B;  1V5G A;  2CRG A;  3ABM H;  3JRF A;  1S9H A;  4ZYG A;  3K7A J;  2DYS H;  2LG4 A;  1NK3 P;  2W25 A;  3E6D A;  3QOE A;  3TOB A;  4OMY A;  2JK3 A;  2WAQ N;  1R49 A;  3J7A Y;  2O61 A;  3J81 Z;  1XMA A;  3MEX A;  3A0B C;  1SMY F;  3KET A;  1Q1V A;  5LRR A;  2VAS A;  3IRQ A;  1UHM A;  1ZG5 A;  4BL0 B;  1YIO A;  3IHU A;  2CU7 A;  3K70 C;  2P81 A;  1XS9 A;  2E34 A;  3OS2 A;  4BEH B;  4A5N A;  1BOA A;  1QPM A;  3ZQ7 A;  1KA8 A;  3X2Q H;  3JAM K;  2IP2 A;  2VT3 A;  1ZLK A;  3M7G A;  3OIQ A;  1WJD A;  3RZO J;  4MIM A;  2OBP A;  1T08 B;  3CLO A;  3GBG A;  4OU0 A;  3WTU C;  3ZMZ A;  2QBY B;  4MLO A;  2EFO A;  5DD4 A;  2QCO A;  3ZMV A;  4BQN A;  3H1C A;  2VXD A;  2OD5 A;  2BVL A;  2M34 A;  2XPV A;  3OYM A;  1B9M A;  3RKW A;  1WCM J;  2CG4 A;  4BHC A;  2DOA A;  2VKH A;  1AA7 A;  3CCR I;  1R22 A;  3DPL C;  2DI3 A;  2IGN A;  2PMU A;  2E2H J;  5LRS A;  1K6O A;  2H8R A;  4ZTJ A;  2R7V A;  4PFP A;  4OIO F;  1P2F A;  1OIS A;  2L54 A;  2EFW A;  3SYT A;  3HB9 A;  3WTV C;  3CO6 C;  1D0X A;  1KQ9 A;  4GCV A;  1I50 J;  2CQN A;  4JK1 X;  2XSJ C;  5BQT A;  4MFE A;  3QYE A;  1R58 A;  4OWR B;  4ABZ A;  3F23 A;  1ETV A;  3GVA A;  4DBQ A;  3QYB A;  4OAY A;  2LBF B;  1DPR A;  1H89 C;  2DLL A;  3B02 A;  1CGP A;  1SAX A;  1X1D A;  3HSF A;  4Y4R A;  2XAU A;  5DYM A;  1I3Q J;  4RM2 A;  1YFH A;  3ASO H;  4BJT A;  1SD4 A;  3T1B A;  3DCF A;  1ZG3 A;  2E7W A;  4OOI A;  3CUO A;  4P5O A;  2VLA A;  1R5G A;  5DM7 F;  1IDY A;  2QQA A;  4BBR J;  1J0R A;  3HXL A;  4V2F A;  3S15 J;  5JVG F;  1OCR H;  2QSG X;  4FTH A;  1WJF A;  4RGU A;  2ISZ A;  2EZI A;  1OLT A;  4IQ4 A;  1BR2 A;  5BNG A;  1TW3 A;  3FWE A;  4I09 A;  3H5A A;  1S7E A;  3V4G A;  3HHH A;  3SFZ A;  1ENH A;  4BYY A;  4CZZ A;  1ZRF A;  2AO9 A;  3I9V 2;  5K5Q A;  1LPQ A;  4XBF A;  1A04 A;  4V2G A;  4MEX F;  2ZJ2 A;  3BR0 A;  4N4N B;  4RBO A;  1U0J A;  1TNS A;  1T6S A;  3GTP J;  4EGY A;  1S29 A;  2LVS A;  3BPX A;  4HAM A;  1QHH D;  3JTG A;  1LE8 B;  4U0V A;  4XN0 A;  4FQG A;  2L02 A;  1D8J A;  3CP8 A;  2VBY A;  3RZD J;  3LFK A;  3TBI A;  2MYS A;  4E7Z A;  3DKX A;  1OCO H;  3BR1 A;  4YIF A;  1OFC X;  4P55 A;  1ZHF A;  2XRL A;  3LSP A;  1F43 A;  3V8L A;  2E1N A;  4A3K J;  2K5C A;  3BG9 A;  2NVT J;  2VBX A;  2VQG A;  2EV6 A;  2E71 A;  2F6C A;  2QYO A;  2NNY A;  5K7H A;  2JQ7 A;  3REO A;  2XIG A;  1BC7 C;  3JRB A;  2VUM J;  2B7E A;  2MD0 A;  1YW8 A;  5K7Z A;  5KAF C;  4HDV A;  3QYF A;  3JAM Z;  2O3F A;  2CUJ A;  1TTY A;  1X3U A;  3PNY A;  4OIQ F;  5DEQ A;  4XIC A;  2WAF A;  4PK4 A;  1JJ8 C;  1S8N A;  3I4P A;  1OCZ H;  3JTH A;  3CDL A;  3K0L A;  3FXU A;  1B9N A;  1ZAR A;  1BJA A;  1P6R A;  5HS7 A;  5IY5 H;  4BAC A;  2K9Q A;  3I55 I;  1B4A A;  2ZFU A;  4C3H J;  4ETS A;  1KZH A;  1R71 A;  1F9N A;  2LK2 A;  3E0J B;  4Q5S F;  1XD7 A;  3KZI C;  2KRF A;  5FKM A;  1EH8 A;  2KP6 A;  3ZMU A;  3J80 K;  2LSO A;  4NC8 A;  4UHT A;  4CSW A;  5E3N A;  4KIT B;  2VOD A;  4JP0 A;  2HDD A;  3MKL A;  1DU6 A;  1ZGW A;  5DCM B;  3BRO A;  4HF1 A;  5J8C A;  2OTL I;  4A3G J;  2QGU A;  2H8W A;  1YRN B;  1VQ4 I;  2WV1 A;  4RB0 A;  4S0H B;  4KFC A;  2NVU B;  2L5Q A;  2HOT A;  2LRE A;  2HTS A;  1FBU A;  2LY2 A;  1YOV B;  1FTT A;  2LF8 A;  2ZME A;  2FOW A;  3RPU A;  2DK5 A;  4KIG A;  5B66 C;  5LGN A;  2DK8 A;  1OR7 A;  4BKX A;  2OPT A;  1LFP A;  2G7U A;  3HOY J;  2KRC A;  3ERE D;  5D5V B;  1JE8 A;  4ESJ A;  1RR7 A;  4M3G A;  3K4B A;  1IN4 A;  4E7S A;  2XAH A;  3HOS A;  4PJN A;  2EFQ A;  2KZV A;  4C30 A;  3RIR A;  5JLX A;  2H6B A;  4AU7 A;  3DP7 A;  3GO5 A;  4I0B A;  2JUC A;  2W1O A;  2DOD A;  3AG2 H;  1KGS A;  5GAE J;  5IP6 A;  3BR6 A;  1HF0 A;  2R7O A;  4XL9 A;  4HST A;  2ZXH A;  4QWQ A;  2DJN A;  3BZ6 A;  2DCE A;  4R1H A;  3DLA A;  4Y17 A;  4BE1 A;  1TWH J;  4X6A J;  2VKD A;  4LFU A;  2PQ8 A;  3KLN A;  4IKF A;  2DTR A;  2W57 A;  3K9T A;  5DTD A;  4ENM A;  1Y1W J;  3GTK J;  1ETY A;  2K27 A;  3E3V A;  4AYB N;  5KNL A;  2EA2 A;  2K40 A;  4RLF A;  4BXX J;  2D2W A;  4G94 A;  4JYK A;  3HOW J;  3I54 A;  4E7L A;  4C2T A;  3DEE A;  3I58 A;  4G12 A;  1V5E A;  2MLK A;  3KP7 A;  2JWT A;  5D6F A;  3GW2 A;  2E1O A;  1FX7 A;  3CDI A;  4WXD A;  3FDY A;  3P7N A;  4ZC3 A;  3COA C;  3GTL J;  2NVY J;  1LVK A;  2DN0 A;  3VYS B;  2XF5 A;  3BQY A;  2CW8 A;  2IGM A;  4XOT A;  4Q47 A;  2XKP A;  1K78 A;  3A2K A;  1IN7 A;  3WU1 B;  3F8B A;  3K4C A;  2E60 A;  4O3M A;  2HQA A;  1U5T C;  4B48 A;  1B8I A;  1BJZ A;  2P4W A;  3MKZ A;  4Y33 A;  1CF7 B;  4RGS A;  4ZDO A;  4P96 A;  1ETO A;  5E1W A;  3GFI A;  5GPC A;  3WGG A;  1AHD P;  2FJ1 A;  2JTV A;  3VDX A;  2IS1 A;  1Y56 A;  3BTL A;  1E17 A;  2GLO A;  5ICF A;  3OL4 A;  2J5O A;  3IH3 A;  2LY1 A;  3J80 Z;  2L7M P;  4ZDL A;  1U2W A;  3QAH A;  2LTP A;  3SDG A;  1WHU A;  4BHB A;  4KNY A;  2YX7 A;  1VQM I;  2BEO A;  3E6B A;  4JX6 A;  2Y31 A;  2ZNY A;  4ASN A;  1Q1H A;  4EAT A;  4U7B A;  3MMY B;  2R7T A;  5HLT A;  4EGZ A;  4YEL A;  1SC7 A;  2EIL H;  3LNQ A;  2ICW G;  3LQQ A;  2I10 A;  3RJP A;  5D5X B;  3OOP A;  3R61 A;  3OL3 A;  2XSD C;  2E2I J;  3HG9 A;  2DMN A;  2HKO A;  1IDZ A;  1OPC A;  2ID3 A;  1UAA A;  4PJJ A;  1L0O C;  5AON A;  5E79 C;  1FLI A;  1LB2 A;  3KP5 A;  1X3W B;  3NQO A;  3H35 A;  4XOR A;  5EG0 B;  3QOD A;  4LLG F;  4DYR A;  3L2W A;  3IUO A;  4LD5 A;  4HBL A;  3BLY A;  4CCL A;  2LKX A;  3HOV J;  1DP3 A;  4EJT A;  1AOY A;  3KX2 A;  2IEK A;  3QPH A;  3L00 A;  5EDN A;  1KYZ A;  4M3B A;  3ZPL A;  3RPU D;  1BL0 A;  4B3A A;  1KU3 A;  2CUE A;  4B44 A;  3V7S A;  4WCG A;  2Y69 H;  2V1D A;  1BI2 A;  4AVP A;  3AL0 C;  4M3F A;  3U21 A;  5JVT A;  1K6Y A;  5B5E C;  5F08 A;  1POG A;  2A07 F;  1GXP A;  3L09 A;  1REP C;  2F48 A;  1GHC A;  2KMU A;  3TGN A;  4UUV A;  2V6E A;  5FLM J;  1K4T A;  5L3B A;  2H6C A;  4QPQ A;  3K1N A;  3Q9V A;  2VN2 A;  2XGC A;  2Z3Y A;  1HW2 A;  3S17 J;  3OS0 A;  1JXS A;  2WTE A;  2GA2 A;  3LAP A;  4XKC A;  4N9H A;  3HRU A;  3M1C A;  5L3F A;  3GZN B;  1U78 A;  3IAM 2;  3RYR A;  4BXU A;  2KIM A;  3ASN H;  1OYY A;  5FD6 A;  1P4W A;  3K10 A;  5FFX A;  2COB A;  2R3S A;  2F5D A;  3CJR B;  2BY2 A;  3H9G A;  3MWM A;  4N0B A;  1WWX A;  1H8A C;  5E3O A;  4LMY A;  4C9Y A;  2V9K A;  4M6X A;  3TL4 X;  5IT9 Z;  4G7Z F;  2YU3 A;  1SFE A;  4EM2 A;  2HYF A;  4WF2 A;  1ZRC A;  5D5U B;  4I6Z A;  5F1R A;  3V8K A;  2Y2Z A;  1RUO A;  2JSC A;  2V7F A;  2VOO A;  4A3I J;  4U0Y A;  2X1D A;  3GTM J;  2EFP A;  1GT0 C;  1S3J A;  3BG3 A;  3HIF A;  1LJ9 A;  2G0E A;  1DP7 P;  1FZP B;  2JUG A;  3CJN A;  3CC7 I;  3MVP A;  5L3D A;  2M87 A;  4RDU A;  1OCT C;  3F72 A;  4JQF A;  1VQO I;  2Z5U A;  2CFX A;  1WJB A;  1F5T A;  4A3J J;  1WJE A;  1IN8 A;  2AS5 F;  4R8H A;  1YJN I;  1I39 A;  1QA6 A;  4MNU A;  4CA0 A;  4NC7 A;  4P9F A;  1RET A;  3GTJ J;  2ECB A;  1QVT A;  2HI3 A;  2TCT A;  1T38 A;  4EM0 B;  4IX7 A;  5DS9 A;  2ZME B;  1O57 A;  3K2Z A;  1G2H A;  2IS6 A;  3M4O J;  3GLX A;  2L9V A;  4KT5 C;  1FOX A;  1R00 A;  4JOM A;  3T8R A;  2M0C A;  1JI8 A;  4OIR F;  2QUF A;  2LBF A;  3RKX A;  2BBY A;  1SVM A;  3U2R A;  1WVR A;  5EYR A;  3L7W A;  4LIV A;  4XOP A;  2CUF A;  1EH6 A;  4DGW B;  1B6A A;  1YQA A;  4DYQ A;  4J01 A;  5FKK A;  4IHW A;  1JHF A;  4AVZ A;  3PJR A;  1MH4 A;  2A61 A;  1Z21 A;  2C6Y A;  2E35 A;  5FB2 A;  2M0M A;  4MQ9 F;  4LB5 A;  2JRT A;  3IP4 B;  3CC4 I;  2ZO4 A;  3C3W A;  4I02 A;  1YJ9 I;  2DFH A;  2Z16 A;  1MBJ A;  2H1L A;  3OYE A;  3JRH A;  1F36 A;  3DLL F;  4KT6 A;  2K86 A;  2CV2 A;  1GVJ A;  3CCV I;  3ZCO A;  1RRJ A;  4B47 A;  3IH4 A;  1V55 H;  1I6H J;  1MDM A;  5J40 A;  3GX4 X;  1C0W A;  3VYR B;  1VQN I;  2Z33 A;  4ESB A;  4IHX A;  3OV8 A;  2IVM A;  3J7Y J;  1IXR C;  3DFG A;  1VQ9 I;  1N75 A;  5L3E A;  3PIP F;  1DDN A;  2IS2 A;  3NRV A;  5FLX K;  3OYG A;  2HZT A;  1VQ7 I;  3LSR A;  4XRF A;  2VBW A;  1LE8 A;  2GAU A;  2M2E A;  2XC7 A;  2MH9 A;  4M6Y A;  2EWN A;  1ZG1 A;  3CF2 A;  4NC6 A;  3F21 A;  3Q0V A;  3BDD A;  2HDC A;  4F55 A;  2DPD A;  3VSL A;  3F8F A;  2XGD A;  4B1R A;  1QBJ A;  3J7A O;  3CD6 I;  2YSR A;  3IWZ A;  3L1P A;  5KCM A;  1FSH A;  3ROU A;  3JR9 A;  2LKS A;  3GCM A;  2EZK A;  3BC8 A;  3S1N J;  1R23 A;  4XKV A;  1HQC A;  1G3T A;  3FZV A;  1IC8 A;  3LA2 A;  4PSX A;  1MMG A;  4KIB A;  2MLG A;  2RRE A;  2LMD A;  1DPU A;  2ID6 A;  1MJ9 A;  1K79 A;  1TWC J;  2KZG A;  1QRY A;  2JN6 A;  1VFC A;  2VKE A;  2QKM B;  4IHS A;  2W48 A;  2HS5 A;  2X4H A;  3AG3 H;  4TV7 A;  3WTZ A;  4FE7 A;  3Q5F A;  4L5I A;  1PVE A;  3GZ6 A;  1YS7 A;  1RZ4 A;  2RQP A;  2CQ7 A;  1JGG A; 
#chains in the Genus database with same CATH homology
 3O8H A;  1IDY A;  2VI6 A;  1GVD A;  4BBR J;  5M3M J;  4V2F A;  3S15 J;  5E3L A;  2AHQ A;  2HXO A;  3BR5 A;  4FTH A;  5JLW A;  2JA5 J;  2EZI A;  5BNG A;  2R0Q C;  1W0U A;  1S7E A;  3H0G J;  4D7M A;  1ENH A;  1MNM C;  1SFO J;  2AO9 A;  2CQQ A;  1JKO C;  4UUT A;  4V2G A;  1JJ6 C;  1A6I A;  3BR0 A;  2Y0S N;  5IP7 J;  1ZTR A;  3F0C A;  4RBO A;  1TC3 C;  1YRN A;  9ANT A;  3GTP J;  2K9S A;  2LVS A;  4XRS G;  2EQR A;  1HOM A;  1LE8 B;  3IV5 A;  2DMP A;  4I76 A;  5E3M A;  3B6A A;  2E2J J;  1WI3 A;  2XB5 A;  5EZH A;  3HOZ J;  3JRG A;  3RZD J;  2HOS A;  1ETX A;  1JUS A;  1UG2 A;  4D7N A;  3BR1 A;  1OFC X;  5F0C A;  2LLK A;  3OIO A;  2YU9 J;  2XRL A;  3LSP A;  1F43 A;  4FCY A;  4JX4 A;  3CCY A;  3A02 A;  1X2N A;  4A69 C;  2L0K A;  2MGQ A;  4A3K J;  5M5Y J;  3BG9 A;  3CMY A;  2NVT J;  3TW7 A;  5EZG A;  3TED A;  2HQ5 A;  3PO3 J;  5FKN A;  5K7H A;  3A03 A;  2CJJ A;  2TRT A;  2GM4 A;  3A01 B;  1SAN A;  3JRB A;  2VUM J;  2VPR A;  5K7Z A;  1K61 A;  2NVQ J;  1JUM A;  4MO7 A;  1X2M A;  2O7O A;  4XIC A;  3M3Y J;  5GP9 A;  2N8G A;  1ZR2 A;  1JJ8 C;  4CYC A;  3CDL A;  3Q0W A;  1FIP A;  3QQA A;  2NOG A;  3ZQG A;  2DA7 A;  2K9Q A;  3Q3S A;  3JRI A;  3S1Q J;  1U8B A;  4C3H J;  2NVX J;  1FTZ A;  2EZL A;  2LK2 A;  3FK7 A;  4QIW N;  5FKM A;  5FLV A;  1LFB A;  3HDD A;  4XRM A;  3E7L A;  4DZP A;  2OF7 A;  2HXI A;  3I4M J;  1AU7 A;  3OOU A;  5E3N A;  3G1O A;  1ZK8 A;  4JP0 A;  2HDD A;  3MKL A;  1DU6 A;  1QVU A;  1ZGW A;  3HOU J;  1PUF A;  1GDT A;  3W6V A;  1P7J A;  4A3G J;  1UHS A;  1YRN B;  2VKV A;  3QPS A;  5F0H A;  2WV1 A;  4S0H B;  5J1U A;  2WB1 N;  2HOT A;  2X9D A;  1IUF A;  1K83 J;  1JUP A;  1U9O A;  1FTT A;  2YS9 A;  3VPR A;  4BKX A;  2OPT A;  3BTC A;  1RKT A;  2R7Z J;  3S1R J;  1MBE A;  3HOY J;  4A3F J;  2JJ7 A;  1RR7 A;  4M3G A;  5C3E J;  4D5C A;  2DA2 A;  1TWF J;  4AC0 A;  4M6V A;  3CQZ J;  5JLX A;  1MBG A;  1RPW A;  1MBH A;  4D5F A;  3C2B A;  1Y1V J;  3JRE A;  5C4X J;  2B63 J;  2EBI A;  2ME6 A;  1ZR4 A;  2LD5 A;  2XB0 X;  2DMQ A;  3OSG A;  4DW6 A;  5IP6 A;  3BR6 A;  4J19 A;  1HF0 A;  4GFB A;  1MSF C;  3B6C A;  2DJN A;  2KT0 A;  3S1M J;  1TWH J;  1HDD C;  4X6A J;  2DA1 A;  4C3J J;  1RES A;  5DTD A;  1Y1W J;  5EG0 A;  3GTK J;  1ETY A;  1MH3 A;  1MSE C;  4AYB N;  3RQI A;  2K40 A;  5FJ8 J;  4BXX J;  4A3D J;  1XG1 A;  2EH3 A;  4QTR A;  4JYK A;  3HOW J;  5F27 A;  1JKR C;  3BTI A;  3WHC A;  3OSF A;  1A5J A;  4G12 A;  2JWT A;  2ME0 A;  2E1O A;  3GTL J;  3S2H J;  2NVY J;  2DN0 A;  2M8G X;  1X58 A;  2PMZ N;  1NTC A;  3BQY A;  4MFD A;  1JTY A;  1IRZ A;  3TP3 A;  3HM5 A;  2DA4 A;  3SFI A;  1PUF B;  5GPA A;  3JRD A;  5IOY A;  1ITY A;  4XID A;  1B8I A;  2X48 A;  4DZJ A;  1JT6 A;  2E19 A;  5FKL A;  1BJZ A;  1O4X A;  1HLV A;  3LOC A;  2R93 J;  4XK4 A;  5IYD J;  1JKP C;  2K9N A;  1ORK A;  2LR8 A;  2HYJ A;  3JRA A;  2NS7 A;  1ETO A;  2XPW A;  5GPC A;  1AHD P;  2FJ1 A;  2NS8 A;  1APL C;  1HCR A;  3BTL A;  2Y9Y A;  2MW8 A;  2GLO A;  5M3F J;  1B72 A;  5F04 A;  3S2D J;  2QF7 A;  1WH5 A;  3IH3 A;  2L7M P;  2LTP A;  3SDG A;  2DMT A;  4JX6 A;  4XRS A;  2O8K A;  4A93 J;  2Y31 A;  2R92 J;  1WPK A;  3LNQ A;  2DA6 A;  4HNV A;  2I10 A;  1IG7 A;  2FQ4 A;  3HKZ N;  4C3I J;  1EF4 A;  3HGG A;  2DA5 A;  2XSD C;  2E2I J;  2ECC A;  2DMN A;  1IDZ A;  2ID3 A;  2LY9 A;  2H1K A;  2M9H A;  2ZB9 A;  3HGY A;  4EEF G;  2HOA A;  3FKI J;  4A3M J;  2RAE A;  5EG0 B;  1BW6 A;  1TWG J;  3GTQ J;  4DYR A;  3S14 J;  2LKX A;  4B4C A;  3HOV J;  2JA8 J;  2DA3 A;  5J3L A;  3ZQF A;  3ZOB A;  3ZQL A;  2IEK A;  5EEA A;  5C44 J;  1QPI A;  3ZQC A;  2IBD A;  5EDN A;  1T33 A;  5J1R A;  4M3B A;  3BR3 A;  1BL0 A;  4X1E A;  1JTX A;  2DMU A;  4B3A A;  5M5W J;  2CUE A;  1T56 A;  5EF6 A;  2MG4 A;  3BTJ A;  1VF9 A;  2LFB A;  4M3F A;  1UMQ A;  5IYC J;  5IP9 J;  3UKG A;  1W0T A;  4BBS J;  1P7I A;  2JMW A;  1POG A;  5F08 A;  3JRC A;  1B8I B;  3TP0 A;  3G1M A;  3QPL A;  5FLM J;  1TWA J;  3FK6 A;  3PM1 A;  4NDL A;  2FD5 A;  2XGC A;  3S17 J;  3WHB A;  2XGE A;  2JA7 J;  3NAR A;  1U78 A;  3I4N J;  3DEW A;  1D5Y A;  1GV2 A;  1RKW A;  4BY1 J;  1B72 B;  1U9N A;  2L7Z A;  4AUX A;  1ETK A;  1BW5 A;  2COB A;  4Y52 J;  4IEJ A;  3ZQH A;  5E3O A;  1H8A C;  3BT9 A;  4FIS A;  4A3B J;  3D1N I;  3LSG A;  4M3E A;  1JT0 A;  4CYC B;  3GTG J;  2ELK A;  1MBF A;  1WH7 A;  2R5Y A;  1ETW A;  1GV5 A;  2CQX A;  4I6Z A;  1IJW C;  1GUU A;  2Y2Z A;  4FE4 A;  2L7F P;  4A3I J;  4DYC A;  1ZKG A;  3H3V K;  3GTM J;  1GT0 C;  4C2M J;  3BG3 A;  4IHY A;  2G0E A;  4LOC A;  2DTZ A;  3FIS A;  3O8G A;  2X6O A;  3MVP A;  1AKH A;  1BA5 A;  4RDU A;  2GBY A;  1OCT C;  4UUS A;  3HBL A;  1NK2 P;  5M5X J;  5EGO A;  3GTO J;  4A3J J;  3MN2 A;  5IOZ A;  1OCP A;  2L9R A;  1CQT A;  1XC5 A;  4Y7N J;  5C4J J;  1RET A;  1ETQ A;  3HOX J;  3GTJ J;  2XPU A;  2ECB A;  1QVT A;  2HI3 A;  2TCT A;  5DS9 A;  4W1U A;  5K7F A;  5J1Y A;  1G2H A;  3M4O J;  2R5Z A;  3NAU A;  4IHV A;  2M0C A;  3G1L A;  5EYR A;  1VND A;  2CUF A;  4DYQ A;  2FX0 A;  1WGX A;  5FKK A;  4IHW A;  3K2A A;  5F0F A;  4W97 A;  4JX5 A;  1ZQ3 P;  2CRG A;  3JRF A;  1MH4 A;  3K7A J;  3Q0U A;  3ZQI A;  1NK3 P;  3PO2 J;  2IAI A;  2JK3 A;  2WAQ N;  5IYB J;  4M3D A;  3FIW A;  3S16 J;  1HDP A;  1MBJ A;  1Q1V A;  3LSJ A;  3JRH A;  4A3L J;  1JKQ C;  1F36 A;  5HOD A;  3IH4 A;  1I6H J;  2CU7 A;  2LP0 A;  1OJL A;  2P81 A;  4IHX A;  1XS9 A;  2R5Y B;  1LFU P;  1MBK A;  1R9T J;  3LSR A;  3BR2 A;  2YUS A;  1LE8 A;  5FKO A;  3RZO J;  2M2E A;  4MIM A;  3GBG A;  1VI0 A;  4MLO A;  1AKH B;  3Q0V A;  4A3C J;  4BY7 J;  5IPA A;  4UUS B;  1Z0X A;  3TW6 A;  2QCO A;  5EGO B;  2M34 A;  2XPV A;  3BQZ A;  2XGD A;  4B1R A;  3L1P A;  1WCM J;  2EZH A;  3JR9 A;  1Z77 A;  2EZK A;  4A3E J;  2E2H J;  1H88 C;  3S1N J;  2H8R A;  1FIA A;  1FEX A;  1IGN A;  2Y30 A;  3A01 A;  2KDZ A;  1IC8 A;  4L5E A;  1E3O C;  3HB9 A;  1IV6 A;  3SJM A;  1I50 J;  2JA6 J;  2R5Z B;  1DU0 A;  2O9L A;  4MFE A;  4ABZ A;  2ID6 A;  1ETV A;  1TWC J;  1H89 C;  2D5V A;  1QRY A;  2JN6 A;  1VFC A;  2VKE A;  3RKQ A;  2Y9Z A;  2W48 A;  1FJL A;  4FE7 A;  1I3Q J;  3BG5 A;  2MSY A;  3IH2 A;  4QSH A;  3DCF A;  3HEF A;  5F1J A;  1JGG A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...