5KHDA

Structure of 1.75 a bldd c-domain-c-di-gmp complex
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
72
structure length
72
Chain Sequence
KLVLDLERLAHVPQEKAGPLQRYAATIQSQRGDYNGKVLSIRQDDLRTLAVIYDQSPSVLTEQLISWGVLDA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Dna binding protein
molecule keywords DNA-binding protein
publication title Tetrameric c-di-GMP mediates effective transcription factor dimerization to control Streptomyces development.
pubmed doi rcsb
source organism Streptomyces venezuelae
total genus 29
structure length 72
sequence length 72
chains with identical sequence R
ec nomenclature
pdb deposition date 2016-06-14
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.1930 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Arc Repressor Mutant, subunit A 5khdA00
5KHDA 2MC4A 4OAZA 4OAYA
chains in the Genus database with same CATH superfamily
4EMSA 5FJ8J 1PYVA 1AHDP 5FFZA 3S16J 4P96A 2XGCA 4Q47A 2WY8Q 1SC7A 1X2MA 2JUGA 3SXYA 3HOVJ 1Z9CA 2WY7Q 3R4KA 3E5QA 2UXNA 2DMTA 3AG3H 1XB4A 3PQKA 4CUGA 1XSDA 1J5YA 4AIHA 1YX5A 1STZA 2XROA 2R5ZB 5HODA 3C2HA 1FSEA 1HCRA 1BI0A 1X58A 1QPIA 3JCUC 2FJ1A 1YFHA 2H27A 5K5OA 4PJMA 2XASA 2XUBA 2BHYA 3ULQB 4OIRF 3IKTA 4I09A 3WU2C 4BXXJ 2XAFA 4L9JA 3WTSC 2H8WA 5H6RA 3UKGA 2IA2A 2VC1A 3BR1A 3J80K 3RIRA 5C3EJ 2KDOA 1HDDC 2E1CA 2JUCA 3LAPA 3BTIA 2XVCA 2COMA 3LA3A 2IGNA 1DU0A 2GLOA 2JSCA 2ETHA 3V7RA 2E1OA 2ECBA 3FK7A 4CO8A 2XB0X 4R8HA 5FB2A 5FGMA 2XRLA 1WPKA 3V8KA 2BBYA 3SQNA 3K4MA 2V1UA 3MZHA 4CCJA 2VASA 2A68F 5IT9Z 4CYCB 2ZFWA 2H09A 4BHPA 3PIOF 2VQCA 4BL0B 2ZMEB 3HOUJ 4NB5A 2FBIA 3M9AA 4DBQA 5IPAA 3BTCA 5K1YA 2M87A 2VN2A 4BJTA 3PM1A 3LSGA 4BY7J 2W85A 3DPLC 2K02A 3P7NA 3GLLA 2NVQJ 2R7ZJ 1QO0D 1XSXA 3JRHA 1Z05A 2DA4A 4ZDPA 1J0RA 3RQIA 2F5FA 2J5PA 2CRGA 2DO7A 4HW0A 3RI4A 4NUBA 3OS0A 1O3QA 3GEZA 4Q4ZF 5IYDJ 1JKRC 3MKWB 3LSTA 5HLGA 5D5XB 3T0YA 4NC6A 4F93B 2EH3A 3HOXJ 1T38A 3ZQGA 1YI2I 3N4MA 2FX0A 5BNGA 2ZXWH 3WG7H 1UHMA 1BW6A 3IWFA 2VBZA 4J00A 1G2HA 5JVGF 3NWSA 2ESNA 5GAGJ 5L3BA 1MBJA 3H3ZA 4E7KA 3OYAA 2RNGA 3H3VK 2EIMH 5LBQA 3HPHA 1J09A 2Y31A 2L4MA 5AIQA 1IN7A 4Z2YA 1SD6A 3K9TA 2DCEA 1IN5A 1A5JA 2QEXI 1HXDA 3OR1C 3T8TA 3P9IA 4M3EA 4XSZF 4ON0A 4KT6A 4E6KG 3JSPA 3QPLA 5D5UB 2QUFA 1WVRA 4DQ2A 4Y13A 1MBHA 1K61A 3W6KB 1X3UA 4JX6A 4I99C 5FKMA 2HPIA 2OTLI 4Q5SF 2HYFA 1P4WA 4QPOA 4GCVA 2E19A 5F0CA 4YFXF 4XLPF 3U1DA 4B8XA 1UELB 3P9CA 5EJCA 2IS6A 5EF6A 1WH7A 4GO1A 1FX7A 1JUMA 2V6CA 3F8MA 3CJNA 2VT2A 2JWTA 1IGNA 1VQ8I 4MEXF 3HXLA 5DEQA 1OR7A 2ME0A 2GWRA 3OYJA 4LB6B 1D3YA 1KU3A 3V8LA 5C4XJ 1YLFA 1ZLKA 1FP1D 4JX5A 3W6JB 2DOFA 2E5ZA 4A3EJ 1F1ZA 3DLLF 1Y8QB 3WTUC 1D5YA 1UHWA 3Q9SA 3NQOA 3LA2A 3KZYA 3PFIA 1IRZA 1O7LA 3F8NA 1DPRA 1DQUA 3KEOA 2IBDA 2MH9A 4WK8F 3QOPA 2BY1A 1KU2A 2X51A 2PMZN 3J7YJ 2LH9A 3E7LA 2XAUA 2DMNA 2EA2A 2K9LA 1JUSA 2Y9YA 4FISA 4WWCA 4A12A 1X2NA 3IL2A 3PJRA 4G12A 2M2EA 2B9SA 1F43A 1H0MA 4YFNF 1MDMA 1D0YA 1VQ6I 5BPIA 4UVAA 3JRAA 4IL6C 1TQPA 4DBRA 4F55A 5JHUA 3C2GA 4DJAA 3CCVI 4EM1A 2M5WA 3RQ4A 2Y75A 3OIPA 5FFXA 3VYRB 1ODDA 4I7HA 1GXPA 4HSTA 1YRNA 1LDDA 3BG9A 3I56I 4OAZA 5IT9K 4MGRA 5F0FA 2QQBA 3KPHA 4RBOA 1EF4A 3ZQQA 2CW7A 3IH4A 3R0AA 4BGDA 3BJOA 3ASNH 2K86A 3RPUA 2VQHA 1U3EM 2P0WA 2L5QA 4Y17A 1I27A 1UCRA 2IPQX 2IJLA 3H9QA 2XAJA 2FMLA 3KP2A 5B5EC 5ICGA 5HS7A 1Q1HA 2UWMA 4XKBA 1V5EA 2CO5A 1REPC 3S8PA 5A2QZ 3BC8A 2ZXIA 5LHHA 3LFUA 3CCEI 4WXDA 5IYBJ 1ON1A 4N0BA 1ZAOA 1K6OA 5L3FA 3JTHA 2VE9A 5J8CA 1AU7A 2COBA 1BM9A 4XLHA 3IRRA 2VJJA 2VBWA 4GDFA 1XGNA 4KITB 5AIPA 1G4DA 2V26A 5LGTA 2EB7A 2VJ4A 4N9HA 5M3MJ 2CJJA 2JJ7A 4E4HA 5GAEJ 2ZJRF 2IS1A 3FISA 2QGUA 3TGNA 2QLZA 1JHFA 1Z6RA 1LFUP 1S72I 2DT5A 3F6VA 3F3XA 3FWEA 3WTTC 1GT0C 2AQEA 4DNCA 4PCQA 2OJED 3JW4A 3BZ6A 4DYQA 5K7FA 4A3CJ 2JA8J 4RGRA 1Z0XA 1T56A 3FBNB 3FKJA 1D0XA 2CQQA 2PBIA 4XONA 4XM3A 2E60A 3L2QA 3GO5A 1T0FC 2HXOA 4Y15A 2OV7A 4P9FA 5H6QA 2NNYA 2B63J 1Z6TA 3A01B 4CCLA 1ZARA 3CO6C 4QPQA 1U2WA 4IVNA 2KPMA 2MFZA 3R60A 5FKKA 3CMAI 4HRIA 2X6XA 1LUJB 2LY9A 3KP7A 2O61A 4PFPA 3CLQA 3S32A 2RC4A 1OCOH 5LHGA 4XIDA 4P55A 2L3DA 1ZRFA 4EJVA 3AL0B 1HSTA 4A69C 2I10A 1LE8B 1TWAJ 2G7HA 2HI3A 3ZXSA 1BR1A 3OYHA 2PQ8A 2O8XA 1R00A 3OL4A 2R5YA 2ELKA 3M8FA 1JHHA 1K4TA 1IUFA 1NTCA 3O8HA 4HA8A 3L9FA 3A1YA 5CVVA 1DDNA 2IVMA 4XLCA 2MSYA 2QSFX 3F8CA 5FKLA 2FXAA 4FETA 2L9VA 2YU3A 3HOZJ 2X6OA 3BTLA 1P9QC 1TWFJ 1Z3YA 1AWCA 2ZXJA 3ZQHA 5E3NA 1R36A 3SZTA 2L7ZA 1U8RA 3QU6A 2CQ7A 5J1RA 4XBFA 2FRHA 2ZJ2A 5DTDA 3MVPA 2A07F 2BV6A 4S0HB 2DA5A 2P6SA 3C1DA 3IWZA 4BHBA 5D5VB 2DXIA 2ECCA 4HLYA 4RLQA 2DBBA 1R5HA 2JPBA 2LBFA 5HS9A 4BACA 4AD9A 5GTIC 4CXFA 4UUVA 3BG7A 1R4NB 1NG7A 4RB1A 1ACIA 2EFNA 4HPQA 2D1VA 3QYEA 3JSOA 1V54H 2GOXB 3K1MA 1YITI 2F5CA 2IRFG 1ETKA 1MIJA 5KHDA 1EKEA 1TL8A 5GADJ 4ZTFA 3AG2H 3B73A 2X9DA 2Y30A 2WC2A 3OIOA 4RGXA 2Z33A 4WX9A 2V9KA 3QPSA 1WJ5A 3IRQA 2VI6A 4A93J 2DMPA 3BJ6A 1YS7A 1UG0A 2A5YB 2R92J 1R58A 1W7PD 3HTUA 1H8AC 3C18A 2HTSA 2ESHA 3QWLA 3U9GA 3JRDA 4KIGA 1S3JA 4II2A 3ZMUA 3BR3A 4B4CA 2F4IA 4AWXB 3GZ6A 1TQMA 4KMUX 2QQAA 1ERDA 2KKOA 3L2CA 1EH8A 1X19A 4C9YA 2JA6J 4LK1F 1D1BA 5A2QK 3FZVA 1XX5A 2B0LA 5EDNA 1PDNC 3RCOA 3CDHA 1AKHB 3HHHA 3HPGA 4JX4A 4G94A 1KU7A 1Z91A 3D5RC 2HOSA 1U8BA 3BT9A 1DGWY 3TEDA 2AHQA 2NOGA 2YR2A 3DFGA 4V19K 3OYGA 3ZR8X 4QIWN 2MD5A 4FASD 2XV4S 2VKVA 2DK5A 4U88A 3QYFA 3F6OA 1XG1A 4B48A 1W0UA 4LK0F 3FKIJ 2AS5F 2DAOA 1K7AA 3CESA 1SD4A 2Z99A 3UNGC 1Z1DA 2PMZA 1I50J 2WAEA 2ZO4A 4C3IJ 4HDVA 5F08A 2F4MB 3E5XA 4Y7NJ 3B6AA 2DFFA 5KAIC 3S3NA 4B3AA 3RKXA 1KU9A 1LEBA 1QGPA 1YO5C 2HDCA 4YIFA 1A36A 3N97A 4M72A 2PFBA 3ELKA 3OYMA 1JT6A 1N75A 2HVQA 1W7PB 5J3LA 2JQ7A 3FXLA 2EFPA 3WU1B 2NVUB 5CLSA 4L18B 1R9TJ 3QODA 1N78A 3S3OA 3G73A 3LOCA 2KISA 5BPDA 2OCEA 4RGSA 3G4SI 3F0CA 5EZGA 2TDXA 3EQLF 1QZYA 3KETA 3PFYA 3AKZA 2OU2A 2H94A 2IEKA 3I5UA 1APLC 5F27A 1B4AA 3FM3A 3R6SA 3HOTA 1HKTA 4AVZA 5CVRA 1HF0A 2P6TA 5BMZA 1Q1VA 4M3BA 4IKFA 2K85A 1BN5A 2K7LA 1HW2A 2JTVA 1D1CA 3E6CC 2HVRA 3K1NA 3PL8A 3K69A 1Z7LA 3O6BB 4GRIA 2I8DA 5CKTA 3U21A 2KFDA 5JI6A 5EGOA 1FWZA 1UJ8A 1DGRM 1IZ1A 2Q1ZB 2P5LC 1VQ4I 3H3UA 1BIAA 1FY7A 1W36D 1I3AA 4KDPA 3E3VA 1SVMA 3JR9A 1W0TA 1RI7A 1W4MA 5DYMA 3EYYA 2V4JC 3RJPA 1OLTA 1S9HA 2HNHA 3CLOA 5HDKA 3IV5A 4LIVA 3LNQA 4A3MJ 4BUPA 3QP5A 3S15J 1I6HJ 5CPRB 1UZCA 3NARA 3COAC 2XDVA 3SEZA 3JRIA 3K70C 3GTJJ 1XCVA 2NNNA 4WF2A 1JI8A 3CCSI 3MKLA 2MG4A 1MSEC 3CUOA 4U0WA 1HBXG 1TTYA 1OCCH 2E1MC 1PUFB 1HLVA 2GIVA 2XAHA 1K79A 2L01A 1T95A 1YW9A 1VNDA 2BXZA 5F1RA 1O7FA 3KEQA 3CCYA 2DA2A 2R7OA 4L5IA 3G71I 3ZQLA 1ZREA 1GLNA 4AVPA 4E7LA 3H5AA 1MDMB 5FO5A 2YPRA 1MMAA 4BKXA 4KA4A 2M4KA 2LC2A 2GXBA 3HYIA 3WTWC 1ETYA 1E3PA 2WBMA 1TW2A 2M8GX 4P5OA 1ITYA 3PNVA 3GBGA 5K5RA 3K4BA 3K4JA 3VB2A 4S05A 1MH3A 3SJMA 1YRNB 1Y8RB 4IOCF 4ABZA 1Y1VJ 2R7QA 3ZN1A 2M8EA 3H0DA 2LREA 3ML6A 2KIQA 1P4AA 3BWGA 2M1BA 2DFIA 4EJWA 1ZK8A 2HVSA 3GFLA 3T5XA 1QNTA 4RM3A 2EILH 1X1PA 1MD0A 2Z16A 2R7FA 2VKHA 2LG4A 2FOKA 1FT9A 5ICCA 5E3LA 3S2WA 4ENKA 4LMYA 1FP2A 2OAZA 4M6YA 3SFIA 5M3FJ 5B1AH 3HRSA 1VQLI 3CP2A 3F22A 1DPUA 3BG3A 3BTJA 2LKXA 3MD2A 4ZC3A 2KJCA 3CQZJ 2XF5A 1ZELA 2K9QA 1SVLA 4RGUA 3HOSA 2KQRA 2PJRB 3DTKA 5TISC 2E5NA 1P2FA 3CZ6A 5L3DA 3G1LA 3GTMJ 1JJ6C 4LLNA 2DODA 4EGYA 2K9SA 1IW7F 2DYSH 3ZCOA 2NVXJ 4C30A 3ONQA 1ZGWA 4EJUA 1WCMJ 5IP7J 3GWZA 4PDKA 3R61A 1J7KA 4BAYA 2PG4A 1HOMA 2BY2A 3GXOA 4HAMA 1ZLJA 3M8JA 1KGSA 1MBGA 3ASOH 1ZRCA 5DV5A 3CC7I 3FXJA 4YELA 1RUOA 3PSFA 4U7DA 3CUQC 3OYFA 2AXTC 1EH6A 1LVKA 2V79A 5FRNA 3LWFA 1USTA 1IXCA 4X6AJ 2DA3A 1R49A 2X6YA 4DZJA 4ENMA 2EFWA 3H0GJ 2D45A 2XGEA 2M30A 2L4AA 1TNSA 1MMSA 1KYZA 3OYNA 2DDBA 3JRFA 1SFEA 2HYGD 2QZ8A 3HKZA 3GUDA 1R4MB 3DBHB 1JKQC 2VJ5A 1LFPA 3OMYA 3GFMA 3S14J 4I76A 1XMXA 3RYPA 1A35A 4YG2F 2A3SA 2KJBA 3CUQA 2EV5A 2YUSA 3LSKA 4XN0A 4PJNA 1VQ5I 2HQ5A 3FF5A 5LGNA 5B66C 2LLKA 1ORKA 1QBJA 3L7WA 2HQAA 2PJPA 2ZKZA 4JYKA 2JA2A 1XCBA 3JRBA 1FNNA 5DM6F 3G1OA 4IF4A 1VQPI 2GBYA 2HEOA 1BOAA 4ZDLA 1JXSA 2K3FA 3CCRI 2RREA 4ZYGA 1K78B 4XR6A 3CMYA 2X6WA 2BW3A 2LRDA 4MLOA 4M9ZA 2CW0F 1IRFA 4DIQA 1G6NA 1DUXC 2O5RA 4QLCU 2R7XA 4PUSA 4BNCA 3LQQA 5D4RA 2HKXA 4Q48A 1IJWC 1B8IB 2MYSA 5DS9A 3WG9A 2F5EA 1JGSA 2ISYA 2WADA 1LNWA 3J7ZI 1YG2A 1D8KA 3M3YJ 3S93A 1ETXA 1XDSA 3RDIA 3P5JA 3HUGB 3EDPA 3OYLA 1T8IA 2E71A 3DLAA 1JKOC 2HTJA 1HA8A 2E1NA 2AXLA 2W7NA 2X48A 1FBSA 2MLGA 3ERMA 2X1DA 2W82A 4CCOA 2OQRA 2CGPA 1YJNI 3L2VA 2EZLA 2PX9A 3BZKA 3GMEA 1ZKGA 1VTNC 4F92B 4MFEA 5EEHA 1NK3P 4FX0A 2HOAA 4XICA 2MW8A 2R93J 2K27A 3LQRA 1OR7C 3W2AA 3U2RA 3Q0WA 5CYVA 2VQLA 4XQFA 5GPAA 2VE8A 2LF8A 1WJCA 1B59A 2XHKA 4X1EA 3WU0A 1AA7A 3HB9A 4L0YB 2ZB9A 2Q8KA 4PK4A 2Q2EB 5LGUA 4CZZA 2Z2SB 5DD4A 2VXZA 3BCAA 1LFBA 1O3SA 1IV8A 3MKZA 4IRGA 3OY9A 2ZXHA 3W3CA 3SFZA 1B72B 1A6IA 4XKVA 2G0EA 4ZYAA 1H89C 1Z21A 2OZUA 1QU3A 2FUG2 3W2VA 3SEQA 1A04A 2FD5A 4HBLA 2FNAA 3DKXA 1KQ9A 1E3OC 2LY1A 3A4CA 3PIPF 2VC0A 2O03A 1F36A 2IAIA 4XKWA 2QKMB 5KK1A 3LSIA 4YEJA 5FD5A 3HM5A 2RAEA 3NRVA 2M7BA 3VWBA 4CDGA 3F9KA 4A3LJ 2VIXA 1U5TC 2ID6A 2IW5A 2UXXA 4CGZA 4I02A 4M6VA 3DPUA 4XN3A 1GDTA 2G9WA 3BP8A 4RAGA 1FMVA 2MGQA 2O3FA 3Q9VA 5EYRA 2MABA 2ZC2A 3WE2A 3I3LA 4MTDA 1ZH5A 4OINF 2GZWA 1TW3A 2W4SA 2ACJA 1LKXA 2K3PA 5FKNA 4E7ZA 3HHGA 3SZPA 2VQGA 3RSNA 5BQTA 3E6MA 1XMKA 1ZN2A 3LSMA 2ID3A 3BQZA 2DA6A 2V1XA 3BROA 1JUPA 5ILVA 2K9NA 2RNJA 3DCFA 1U5TA 4BDYA 3NEUA 3C7JA 3HSRA 3ZPLA 4BY1J 1B9MA 2LFBA 2R7DA 4M9SA 5CJ9A 1RNLA 1K6YA 3LSRA 1PP7U 4LGWA 4XLAA 3GYHX 2QENA 4IHVA 3EPZA 4AIDA 2M7AA 4AYBN 1WZ2A 2FBKA 2TRTA 1NG6A 2DI3A 2XSJC 3WHCA 3F72A 5HNFA 2CWEA 1R5GA 1BR4A 4CCMA 2HPMA 4UUTA 3DV8A 5EG0A 4D0PA 3A2KA 4U7BA 1QRYA 2E7WA 3KLOA 2DPDA 4HV6A 3FIWA 4HNUA 3HIFA 3H35A 3TL4X 1I5ZA 4L0ZB 4ZDOA 3PSIA 1U78A 3CCLI 1G3YA 5HDGA 2E34A 4PJ0C 2FBHA 2JSPA 5ILSA 5DDGA 5GPCA 2JA7J 3S1MJ 3MAJA 4MNUA 3EYIA 3PO2J 4A3BJ 1FEXA 4CICA 4FE4A 4EM2A 1FBUA 2BVMA 3DWLE 3WE3A 3FBIB 3D5SC 3IKVA 3JRGA 4J19A 3K4CA 2OUMA 1H9TA 2YX7A 2A05A 1MNMC 5HLHA 1TWGJ 5LRSA 2MBFA 3CF5F 1R7JA 2LMDA 1BA5A 5F04A 3OYDA 3TO6A 3GW2A 2A6HF 2CH0A 2ME6A 1R1VA 4ZZLA 4PSWA 3F8FA 4UV8A 4OMZA 2HGCA 1UMQA 3PNTA 3WHBA 1WJBA 2VBXA 2CFXA 2P8TA 2DTZA 4OIOF 1RR7A 4N4OB 3BOQA 3BPVA 4L9NA 5ED4A 2MA3A 2EFOA 3BR0A 4RMNA 3G1MA 4NC7A 1ZTRA 2MH2A 4FHTA 2EIJH 3Q0VA 1WWXA 4BS9A 4M3GA 2QBYB 3CCMI 2PEXA 2ZFUA 2KIMA 1OCRH 2EWNA 1UFMA 5ICEA 5HDNA 1YX3A 1D1AA 4OMYA 2VKDA 3N05A 3QP6A 4ZTJA 4KYWA 3OIQA 3I59B 4CZCA 1IRGA 1I3QJ 4NQWB 2KL4A 2M34A 2HZDA 3HSEA 5JHFA 3CO7C 2VL8A 2XPVA 3FX3A 2BE5F 1R22A 3K2ZA 3REOA 1ETVA 2HOTA 2EIKH 2GIZA 2LP0A 2OQGA 3K4NA 2Z9OA 3O3KA 1QQIA 1FZPB 1MJBA 1SFOJ 1VQNI 4LG0A 3FXUA 3QU3A 1L3LA 4DYRA 4CYCA 2BOLA 3K4LA 3E5UA 3WTXC 1XSVA 2ZMEA 4IPAA 5DUKA 2DJNA 2WTEA 3DTEA 3CCQI 3ZN0A 1SD5A 3HRUA 4UV9A 1RZ4A 4QTRA 5L3CA 3DP7A 3A03A 1ZG5A 4BU2A 1DP3A 5GTHC 2OF7A 5KVRA 4KT5C 1WJEA 3AFHA 3OYEA 3TO9A 4A2UA 2CMPA 3LSHA 4KICA 4OU0A 4UHTA 3ABTA 1FMWA 1TZLA 2FA5A 1ZG3A 4ENJA 1JKPC 1BC8C 4CCKA 2XRNA 2YU9J 5H2FC 2GA1A 3GLXA 1G8XA 1Y0NA 2K5CA 4U0VA 3S2DJ 2R7VA 4G7ZF 4ASNA 3T1BA 2AQFA 4CCNA 3CMEI 1XPXA 1X3ZB 4PZJA 3CD6I 2W48A 1PVEA 3V42A 1K83J 1VZ0A 5ERIA 3KP3A 4FX4A 4GYIA 4F3QA 1ETQA 5E3MA 1VQ9I 3ZQ7A 4BQAA 1WJDA 3B02A 3VSLA 3JREA 4DZPA 2UV1A 4I0BA 2ZCWA 4RB0A 1FIPA 3ZMDA 1TC3C 4RA2A 3FK6A 2X0LA 3VFZA 2DOAA 3HKZN 3RZDJ 2OCCH 5J1YA 2M3AA 1JGGA 3CUQB 1YQAA 1SFKA 3DF8A 3NWTA 1MMDA 5E20A 3OYKA 1HKSA 4M74A 3S1RJ 1OCZH 1WJAA 2B7EA 5H20A 4OWRB 2KRHA 2FF4A 2LNBA 1DU6A 5E8GA 4EATA 4BBSJ 4ZYHA 3KZIC 2D2WA 1JE8A 3A0HC 1S29A 2L9NA 3WTZA 2WAFA 1YE9A 1XS9A 5DCMA 4LFUA 2RN7A 1Y6IA 1BJZA 3HTSB 2VOPA 1P7JA 4AC0A 2HQRA 3DKYA 3E6DA 1FLIA 3HOWJ 1YOVB 5GP9A 2A69F 2EK5A 2MC3A 1QA6A 3A02A 4YFKF 3K6GA 4KN7X 1K4SA 3HC7A 3JAMZ 3TOAA 2QQ8A 4Y52J 4AU7A 2GXAA 2KMUA 3FXOA 2KZGA 3DQVC 2VB6A 5E1XA 2CUZA 1YW8A 2XB5A 3ABMH 3HL2A 5D6EA 1IXSB 1FBQA 3K4KA 4J01A 1P7IA 4MIMA 1OYIA 3I4NJ 4DYCA 1TP4A 2LDUA 2V9PA 4BJ6C 3F23A 3EUAA 2DQLA 4XL9A 5FLVA 4KISA 2F48A 3RKYA 3FHNA 1Y39A 2F6CA 3I54A 1G3WA 3ZMTA 1R6RA 5KAFC 3L2UA 1JTYA 4XRSA 3F21A 1WH5A 5DCFA 4U87A 3WTVC 2R7RA 1ZR4A 1CQTA 1P92A 2PMUA 4AUXA 1ZGAA 4RAZA 4IEJA 4M9XA 2CQNA 4NNJA 2EV0A 2DJIA 5FLMJ 2HXIA 3Q0UA 2IA1A 1EA3A 3RZOJ 4L5JA 4XK4A 3P9KA 5CVUA 2VBYA 4XOTA 3CJTB 2BYVE 3AAFA 2E36A 2O8KA 2HFHA 2AO9A 2LK2A 1G3SA 2CW8A 4NC8A 2F2EA 2L2OA 4M6XA 2ADUA 4MFDA 4AYBA 3MFKA 3RPQA 2BGCA 3H1CA 4M73A 1ZYRF 4I01A 2DA1A 3GVAA 4OIQF 2LVSA 4HSRA 5HS8A 2BEOA 2QSHX 4B09A 2EA4A 2QQ9A 4HX8A 2JZYA 2LF7A 4O5VA 4E7SA 2CUEA 4I2OA 4CH7A 2E2IJ 3X2QH 4GYGA 4HDUA 4RS8A 4UB8C 1T08B 3DXJF 3FXQA 4HX4A 3I71A 2CV2A 1RUNA 2QWWA 1OISA 1OJLA 1VF9A 3H92A 3ZGKA 4S04A 3SDBA 2KRCA 5LLQA 2FEZA 2HDWA 2X4HA 3VODA 3IAS2 3OS1A 2DOEA 3V7CA 1IXRC 2EJRA 2ICWG 1FTTA 1RC9A 4U0YA 1J59A 3I58A 5KNLA 1XMAA 3TKYA 1FPQA 1MJAA 2OZ6A 4PJLA 4HG2A 4KIBA 3OSFA 4O6JA 2E7XA 3BR5A 1R1UA 3BZCA 4N9IA 2H1LA 2R7WA 2OTJI 2ELHA 1H9GA 4LLLA 3LAJA 3D5LA 4LD5A 4NHJA 4H0EA 2FQ3A 3OR2C 2QCOA 5D6FA 2A6TA 2XGXA 2Y0SA 4FTHA 3SYTA 1MJ9A 4B43A 2CYYA 3TOBA 3GFJA 4QSHA 4E7JA 1Z3XA 2I5UA 1I1SA 1U5TB 3OL3A 4G9YA 3CJQB 1V55H 4G8XA 1O4XA 1SAUA 2QM3A 1ZG1A 3G3ZA 3KZZA 1IRXA 4RAYA 1Y1WJ 1LQ1A 2LR8A 3CMMA 3M1EA 5IP9J 1QHHD 2CFOA 2Y69H 1SMYF 2OD5A 5EEGA 1O57A 1TLHB 3CJRB 5M5YJ 2QA4I 3A01A 1BI1A 1I1GA 1QVTA 4FQGA 3KP6A 4Y33A 3ZOBA 4AM3A 5EG0B 2IGKA 5LFAA 3O8GA 1J2XA 1WHUA 1JTXA 1OYYA 4CHUA 4EM0B 2QSGX 2Z3YA 3LA7A 5FD6A 5K5QA 3GZ5A 4I6ZA 3ZQCA 2Y48A 4Y3OA 2P5VA 3UR3C 1WJFA 1X4PA 3JAMK 2LSOA 2R7UA 2KRFA 3QOEA 3I0TA 1KYWA 3SDGA 2R7TA 3LMMA 1FOKA 4A3IJ 2M4GA 5ICFA 2F4OB 4A3JJ 1LDKB 4A3FJ 4KIFA 4BH9A 2K40A 2V6EA 1SVOA 5DUIA 2O0YA 2PLYA 1UAAA 1D5VA 1OCTC 1IDZA 3RYRA 4E7HA 1GVDA 4ZJZA 3D0SA 1TT5B 3CC4I 1BW5A 1OYWA 3H9JA 1RRJA 2Y2ZA 4PJJA 3S3MA 4C2UA 4HV5A 1S7AA 2DYRH 5E8IA 2ZNZA 3TP3A 4WXCA 4ESFA 2L54A 3S2HJ 5DM7F 1T39A 2H8RA 5IT3A 2H6BA 3FXKA 3MZYA 1G59A 2NYXA 4A3KJ 4IRHA 4KMFA 2RQPA 1ETOA 2DT6A 4O3MA 2VPLA 4A3GJ 4UVCA 1LDJA 2BXYA 1HDPA 4D7NA 3VSKA 3HBLA 4ESBA 4GGGA 1CF7A 3DEEA 3S1NJ 2DDAA 2IS4A 3H5NA 1A6QA 2CQKA 3AG1H 2JVGA 4E70A 1MMGA 3E1SA 3RKQA 1Z77A 2R5YB 3MQ0A 2ZNYA 5C4JJ 1GXQA 4HNTA 2TCTA 4ENNA 3TO7A 3SHFA 5IY5H 1BBYA 1NK2P 4BBRJ 1GV5A 4HQMA 4BE1A 4RB3C 1YS6A 2V7FA 4G6QA 2VPRA 4UXNA 2CUJA 2ELJA 2L7FP 2WV1A 3GTOJ 4LG0B 2IXSA 1Z67A 5AONA 2XPUA 1M1EB 3CTAA 4IHYA 1VQMI 5F64A 1HW5A 2IS2A 3VDXA 3CP8A 3HJEA 2YX4A 3TBIA 4DGWB 2W00A 3C3WA 3L2RA 3BCBA 4I0AA 3KP4A 1SFXA 2W24A 3MWMA 1HKQA 3W2WA 5BOXA 2NS7A 2VONA 2LTPA 4P9UA 2LBFB 3NAUA 4W97A 1AKHA 1SMTA 3T8RA 3WGGA 4GFBA 4BEHA 2JK3A 3FHZA 3H36A 2BVLA 4ZYEA 3MKYB 1BI2A 4EQQA 2JPCA 1FOXA 3WGHA 3J81Z 3DPTA 1X1AA 4KJZA 3IUOA 2YSRA 4B1RA 4ETSA 4LJZF 4XRMA 4JOMA 4G7OF 3GTPJ 4HZFA 2DPUA 3MEXA 3ZP5A 2DN0A 2EZKA 5FKOA 4Y4RA 1V4RA 2DTRA 5CVJA 1P4XA 1IUYA 5CQGA 4WXHA 4YIIA 1PP8F 1RETA 1FYLA 3K0LA 2J5OA 2VOOA 4ZH4F 3PUFA 2JA5J 1W5TA 1Y0UA 2DK8A 1R23A 2KHMA 3DU5A 3IH3A 3M8EA 3ZQFA 5M5XJ 1A31A 1WQ2A 3ECHA 4A0ZA 4IX7A 1W7PA 3MZ8A 2BHZA 1MH4A 1R5ID 2OPTA 3FDYA 4D7MA 1WSUA 1NHAA 4RLFA 1AOYA 3DEUA 2K4BA 4H4KC 2L7MP 3KEYA 2WAQA 4HYEA 1XD7A 5JLWA 3M07A 1R71A 3CDLA 4MO7A 5D8LB 2A6EF 3HOYJ 3WGIA 1KONA 3BLYA 4G6DA 4IO9F 2P5KA 5FRMA 4Z6YA 4EJTA 1S8NA 1NH3A 4MHGA 1WI3A 2GXGA 5DCMB 4UNOA 4RAFA 4HF2A 5B3SH 2MD0A 1X3WB 3BY6A 2R4GA 3BPXA 3H5RA 4XMYA 2V1NA 3I9V2 4JQFA 1N25A 4XNFA 2OC6A 1IO2A 4OAYA 2L9RA 2W1OA 1VQ7I 2P7VB 1IF1A 1S5LC 2HU9A 5J40A 2ZSHB 1Z7UA 2D1HA 4P1WA 1TT0A 1LB2A 1B1BA 2DA7A 1V3FA 3FXMA 3K1PA 4UB6C 2GQQA 3GF2A 4G6TB 3QAHA 4PGHA 3ZMZA 2W84A 1TNTA 4IXAA 4L9VA 1SAXA 3VPRA 1IAWA 2NS0A 3VYTB 2KLOA 1D0ZA 2JVHA 2V9VA 2O7OA 4IQJA 5KCMA 4IJAA 3OS2A 1BJAA 2KIFA 1V5FA 5LEJA 4KN4X 4XORA 4L5EA 1PUFA 3OWTA 1T6SA 3E97A 5IP6A 2LYCA 4FCYA 2X1CA 3MMYB 2FOWA 2M0CA 3IC7A 2OA4A 3EUHC 2HDDA 3ESWB 1B6AA 2BZTA 3HSFA 4UUSA 3L2WA 2F5VA 3E6BA 1X1DA 2XKPA 3TW7A 4BJ5C 2DW4A 1TQIA 2HYJA 3K70D 1I39A 2VODA 2LD5A 2NS8A 4F52A 2JMWA 3BR2A 3DTIA 2Y0MA 2CSOA 1W36C 1OMIA 1TWCJ 3KYCB 4BE2A 3JRCA 2GAUA 2XF7A 5E1ZB 1SD7A 1ZRDA 2QKLB 2JRMA 4JP0A 5M5WJ 2Z1DA 4R1HA 1UHSA 2E35A 3DBLB 3OYBA 3VOEA 1TWHJ 3DBRB 1MBFA 4X0GA 1QZEA 3K10A 4AIKA 5EGOB 4KUMA 5D8KB 1J9IA 5E18F 4BQOA 1ULYA 4V2GA 3EUHA 3ABLH 2HOEA 2G7UA 2RV8A 3IH2A 1VI0A 3VEPA 1YJWI 1IDYA 1S6LA 4EEFG 5J6XA 2BY3A 3K7AJ 4A0XA 2M9HA 5F6FA 2XKOA 5K7ZA 4IZZA 2DFHA 2IA0A 1P6RA 1O3RA 4XOPA 3ZRGA 4EGZA 1YHQI 1T98A 2F5DA 1XN7A 4CSWA 1USSA 3DKWA 1GUUA 3VYSB 1KA8A 1BI3A 5J1UA 3TP0A 4UY8I 2IGOA 2NXNB 1G3TA 1WKMA 1FYKA 1C0WA 2DT7B 4HQEA 3J81K 3GTLJ 1F9NA 2ZJQF 3FXRA 4XLFA 4C3JJ 2RQQA 3OV8A 4CYDA 2RDPA 3G2BA 4JK1X 1WI9A 2N8GA 4V2FA 4C2TA 2PJRA 1GVJA 1YIOA 3HGGA 2EPFA 2LY2A 3I4PA 3WTYC 2LKPA 4BQNA 1U6GA 3I53A 2HKOA 3CDIA 2ISZA 4XLEA 1S7EA 3RKWA 3ZMSA 2M0MA 1E0EA 4K2EA 2R5ZA 2XPWA 3ERED 1OKRA 4C3HJ 2CU7A 1T33A 2E1MB 3HG9A 5LHIA 4WCGA 3GTGJ 3CC2I 1OCPA 1H88C 9ANTA 2Y0SN 4MTEA 1UG2A 2XAQA 5TGTA 1XTAA 5HOOA 3V8JA 3J7AY 1UB9A 2VXDA 1FYMA 1MNEA 1ENHA 3C2BA 2ZMEC 3BJAA 4MEYF 3QYBA 2E2HJ 2RVCA 2DLLA 2JT1A 2P4WA 1EJ9A 3A0BC 1YIJI 1GV2A 2QYOA 4BXUA 2O9LA 2Z5UA 2V1DA 3L09A 4HEA2 1X1BA 3QRFF 3ISPA 2PN6A 5JLXA 4BXFA 2KIUA 1BL0A 2UUZA 3FMQA 2VT3A 4A3DJ 3BR6A 5CQEA 2PMHA 2WV0A 2WB1N 2LOOA 3QPHA 1IV6A 1L0OC 3KYDB 3G6EI 1YYVA 1F5TA 4IHXA 3GTKJ 2KP6A 4LIUA 1HC8A 1VQOI 4AIJA 3RTRA 1HW1A 5JR3A 4TV7A 4D5FA 2LKSA 2VKEA 2VUMJ 1T0FA 3LSJA 4I98B 1LVAA 2H6CA 2O6GE 1TBXA 1E17A 1E3HA 5J4YA 4F91B 2XAGA 3OOPA 1KQ8A 1RKTA 2ZJPF 4RB2C 4A6DA 3OSGA 3KYLA 1QZZA 2NRAC 1U9NA 4LLGF 4R79A 3GCMA 1X1CA 5TJJA 1KZHA 4LB5A 1K78A 2EZHA 2NOJB 1FOWA 5IYCJ 1BIBA 4BE0A 2H1KA 3IP4B 2XF6A 5GAHJ 1B8IA 4HF1A 2RGVA 1MW7A 3PNYA 5FROA 4JBAA 3FMSA 2FMYA 3LFKA 3KE2A 3R0JA 3AG4H 3K2AA 4L9TA 4OOIA 1FSHA 2L0KA 3GZNB 3OOUA 1MMNA 4LITA 1MKMA 1JT0A 3HUGA 3Q3SA 3V7SA 1CF7B 4M71A 4NDLA 4KNYA 3KLNA 4IRIA 2CV0A 3TW6A 4BHCA 1RESA 2L02A 4HF0A 3ECOA 5J8FA 2GM4A 1S7OA 4FT8A 1W5SA 3F8BA 1QHGA 1BOBA 5FLXZ 2HS5A 1WRJA 3PO3J 2P81A 3FMRA 2DFEA 1YJ9I 2IGMA 2WA0A 2X1EA 1OPCA 4F7ZA 5J47A 1JJ8C 3OYIA 1VQKI 4NBQA 3U1KA 1ZHFA 1FTZA 5JVTA 1ONVA 5HLIA 2OBPA 2BY0A 3KP5A 2EINH 2L9SA 1N77A 2NAZA 1MGTA 1BR2A 2YS9A 2XIGA 2FU4A 4IOAF 2DQRA 2Q2EA 2HQNA 3ROUA 2K4JA 4FE7A 2BW3B 3WODF 5D5WB 3M1CA 5LEKA 5E17F 1DP7P 3Q5FA 3M7GA 3DEWA 1RKWA 5E1WA 1ON2A 1IC8A 2E2JJ 1B72A 4BEHB 2GOMA 3KFWX 1MZBA 2MC4A 5JFRA 2CG4A 3E0JB 3HRMA 5LRRA 3DU6A 4A5NA 4RDUA 5IOZA 5HVQC 3KIOA 4YRVA 1X4OA 3LSPA 5F0HA 2R7SA 1MSFC 4ESJA 1ZGJA 3S1QJ 1HQCA 3CCJI 3HEFA 1IN6A 4C2MJ 2QVOA 3BG5A 1D8JA 5HNHA 1FIAA 1ZQ3P 2GA2A 4HLXA 4PGGA 2NVTJ 2DU9A 4A0YA 4OIPF 1MNDA 3B6CA 3J7AO 5K7HA 4DW6A 1Y56A 2EBIA 2XSDC 3MN2A 4B47A 3OYCA 3IHUA 3PQJA 2CS3A 4M3DA 4B44A 1XGOA 3I4MJ 5ILUA 3HRTA 5IOYA 1FC3A 4BDZA 1BC7C 3V4GA 1QVUA 2L7KA 5B1BH 4KFCA 4DOZA 2EZIA 3J80Z 4HX7A 4HNVA 1SANA 5F1JA 1FJLA 4GXOA 3M4OJ 4UVBA 4ZZDA 1W5CC 3JTGA 2R0QC 1POGA 2M45A 2WAQN 2WWYA 4M3FA 3RPUD 1PUEE 2MLKA 1RPWA 2C6YA 1VFCA 1I6XA 5EZHA 1V5GA 4A6EA 4E7IA 1FOYA 4IQ4A 4MQ9F 4XRSG 4LOCA 3KCCA 1IN4A 3ZMVA 5E79C 4XRFA 1YW7A 3BG6A 1RR8C 3LL7A 1MBEA 2A61A 5HLTA 1XDUA 2EFQA 5DD8A 2DMQA 2FE3A 2FSWA 3ZQIA 2DMUA 3ABKH 2VLAA 1EH7A 2ZBKA 2P7CB 1PJRA 3HDDA 4ANJA 1F4KA 3S17J 1RIOH 4W1UA 3EUKL 1LPQA 4RM2A 2CQXA 1XGSA 3KX2A 4A5MA 3L1PA 2UZKA 2VJIA 1KQ0A 4EJOA 1LEAA 2W25A 5C44J 2HZTA 3EETA 5CVIA 3H9GA 2HWVA 2RKHA 1J75A 5E3OA 4MQVA 3CCUI 1O3TA 1XC5A 3I64A 1SEUA 4QWQA 2PI0A 2Q0OA 2X85A 3TDUC 1IN8A 4PFOA 4BQQA 3TMOA 4B3XA 3CF2A 2W57A 2CV1A 4UUSB 4XLNF 1LJ9A 1U9OA 6PAXA 2EV6A 4ITVA 4PSXA 2Y9ZA 3L00A 3AL0C 5J4VA 1WGXA 1SFUA 2K9MA 5TRDA 1HSJA 3ABUA 4N4NB 5FLXK 2NVYJ 3HZJA 3IAM2 5L3GA 2JN6A 4LG3A 1R1TA 4D9JA 2FQ4A 1W1WE 1U0JA 2FNPA 3QQAA 2STTA 4XKCA 4D5CA 4IHSA 4IHTA 3I55I 3QPTA 2IT0A 3GTQJ 4G7HF 3TDZC 3PUBA 5D4SA 1OQYA 2R3SA 2STWA 5EEAA 1E2XA 2KDZA 1YTYA 4HOBA 1GHCA 1IG7A 4CA0A 5LD2C 2WB1A 1B9NA 3W6VA 2QBYA 2XGDA 3VYUB 2D5VA 2KT0A 1QPMA 2JRTA 4XSXF 3TQNA 4EVIA 4YIRX 3GX4X 2IP2A 3BQYA 2KZVA 1OFCX 4EV0A 5L3EA 4ZYDA 1LE8A 2XC7A 4D1QA 3HGYA 3BDDA 2CUFA 3MCZA 2ZSIB 4IHWA 1WFXA 3I59A 1MBKA 1ETWA 1CGPA 2HR3A 2EQRA 4II3A 4BYYA 3SZGA 1XGMA 4NQWA 3O2PE 5BS6A 3FM5A 1T2KA 2QF7A 1ZR2A 2A5WA 3GFIA 3D1NI 1EV7A
chains in the Genus database with same CATH topology
3BLYA 4N4OB 3S3NA 1PYVA 5FRMA 2WY8Q 4RMNA 4NC7A 2JUGA 4BS9A 3OYMA 2WY7Q 1N75A 2HVQA 2MD0A 3H5RA 2R4GA 2ZFUA 4XMYA 2V1NA 3I9V2 4JQFA 4CUGA 1N78A 4XNFA 1YX3A 1D1AA 2OC6A 3QODA 4OAYA 3S3OA 1YX5A 2VKDA 3N05A 4ZTJA 2W1OA 3OIQA 4CZCA 3C2HA 2HU9A 4NQWB 2KL4A 2HZDA 2ZSHB 5JHFA 4P1WA 2VL8A 1TT0A 4PJMA 3K4NA 3PFYA 3AKZA 4G6TB 3HOTA 4AVZA 2BOLA 3K4LA 3VYTB 2KDOA 2KLOA 1D0ZA 2JVHA 4IKFA 4IQJA 3DTEA 5KCMA 3OS2A 1D1CA 2HVRA 1V5FA 2IGNA 4XORA 3PL8A 3OWTA 2LYCA 1Z7LA 4GRIA 2X1CA 2I8DA 3MMYB 5CKTA 3U21A 4BU2A 1DP3A 1DGRM 2Q1ZB 3EUHC 3L2WA 1W36D 1WJEA 2F5VA 3AFHA 1X1DA 3OYEA 4BJ5C 2CMPA 3LSHA 3K4MA 2V4JC 1FMWA 1TZLA 3K70D 1OLTA 1S9HA 2HNHA 4CCKA 4LIVA 4CCJA 2VASA 4BUPA 4F52A 5CPRB 3DTIA 1W36C 1G8XA 4BE2A 2K5CA 2XDVA 2VQCA 2XF7A 4BL0B 3SEZA 2R7VA 3K70C 2QKLB 2AQFA 4CCNA 1JI8A 2Z1DA 4DBQA 2E1MC 3OYBA 3V42A 1VZ0A 1T95A 4X0GA 4BJTA 3K10A 3LSGA 4F3QA 3DPLC 4BQOA 1WJDA 2R7OA 3VSLA 1GLNA 2UV1A 4E7LA 3H5AA 4ZDPA 1MMAA 2M4KA 4NUBA 2LC2A 2DOAA 3OS0A 4IZZA 4XOPA 3MKWB 2WBMA 3ZRGA 2M3AA 4P5OA 3PNVA 4CSWA 1SFKA 3GBGA 3NWTA 1MMDA 4F93B 3K4BA 3OYKA 3K4JA 1WJAA 3VYSB 4OWRB 2KRHA 2R7QA 2IGOA 3H0DA 2LREA 4EATA 4J00A 2DT7B 3NWSA 2L9NA 2WAFA 1YE9A 2RQQA 4XLFA 4E7KA 3OYAA 2RNGA 1Y6IA 2HVSA 3G2BA 3HPHA 1J09A 4RM3A 2PJRA 4C2TA 3DKYA 2LY2A 2Z16A 4BQNA 2VKHA 4XLEA 2DCEA 2LG4A 2M0MA 1E0EA 3K6GA 3OR1C 3HC7A 2E1MB 3HG9A 4AU7A 2KMUA 4KT6A 4E6KG 3DQVC 2VB6A 3HL2A 2CUZA 3CP2A 5TGTA 3K4KA 5HOOA 4J01A 3J7AY 2VXDA 3MD2A 4ZC3A 1MNEA 2HPIA 4BJ6C 3EUAA 2XF5A 4XL9A 4QPOA 1ZELA 3QYBA 3HOSA 4KISA 2KQRA 2PJRB 3FHNA 2F6CA 1UELB 3DTKA 1R6RA 2E5NA 3L2UA 3CZ6A 2IS6A 4U87A 2R7RA 4HEA2 1X1BA 3ZCOA 4NNJA 4BXFA 3HXLA 2DJIA 2UUZA 3ONQA 4C30A 1EA3A 3OYJA 5CQEA 2LOOA 4XOTA 2KP6A 3M8JA 2E5ZA 4LIUA 2CW8A 4YELA 4NC8A 2L2OA 3PSFA 4AYBA 3RTRA 3OYFA 1DQUA 1LVKA 4HSRA 5FRNA 2X6YA 2X51A 4F91B 2LH9A 2XAUA 4E7SA 2K9LA 3KYLA 3PJRA 4CH7A 3OYNA 1D0YA 4R79A 3HKZA 1X1CA 4DBRA 4F55A 2CV2A 2VJ5A 1LFPA 3C2GA 3OMYA 3ZGKA 4DJAA 2NOJB 3SDBA 2KRCA 2HDWA 3RQ4A 4BE0A 3OIPA 3IP4B 2XF6A 3LSKA 4XN0A 4PJNA 5FROA 1MW7A 3IAS2 3PNYA 3VYRB 3OS1A 4HSTA 4OAZA 2HQAA 3OOUA 1MMNA 5KNLA 4LITA 3ZQQA 2JA2A 2CW7A 4PJLA 4HG2A 4BGDA 4ZDLA 2RREA 2VQHA 2CV0A 2P0WA 2L5QA 4XR6A 2R7WA 2X6WA 2BW3A 2LRDA 4MLOA 3D5LA 4DIQA 3H9QA 2O5RA 1QHGA 3OR2C 2R7XA 4PUSA 1BOBA 2UWMA 4XKBA 2A6TA 2Y0SA 2MYSA 2IGMA 3SYTA 2WA0A 1V5EA 2X1EA 4B43A 2WADA 3S8PA 3OYIA 4E7JA 3BC8A 2ZXIA 3LFUA 1Z3XA 3OL3A 3CJQB 3S93A 1SAUA 2L9SA 3HUGB 3OYLA 1N77A 1IRXA 3DLAA 1BR2A 1HA8A 3CMMA 2W7NA 4XLHA 2VJJA 2X1DA 2W82A 1QHHD 2CFOA 4CCOA 4KITB 3CJRB 3L2VA 2V26A 2BW3B 2VJ4A 4F92B 3M1CA 4E4HA 4Y33A 2IGKA 5LFAA 2IS1A 4BEHB 1OR7C 2GOMA 2MC4A 3E0JB 3W2AA 3DU6A 2VQLA 4XQFA 2AQEA 5HVQC 1WJCA 4YRVA 4Y3OA 1AA7A 3FBNB 1X4OA 1WJFA 3FKJA 3UR3C 1D0XA 1X4PA 2R7SA 2R7UA 4XONA 4XM3A 4PK4A 2E60A 2Q2EB 3L2QA 3QOEA 1T0FC 2Z2SB 2OV7A 2R7TA 2VXZA 3BCAA 3LMMA 5HNHA 2M4GA 4CCLA 3MKZA 3OY9A 1LDKB 4QPQA 2ZXHA 3W3CA 2KPMA 2MFZA 2V6EA 1MNDA 4HRIA 2X6XA 1UAAA 1Y56A 4XKVA 4E7HA 4ZYAA 4ZJZA 4PFPA 4B47A 1Z21A 3OYCA 3S32A 1QU3A 2FUG2 3W2VA 2CS3A 3SEQA 4B44A 3H9JA 3AL0B 4PJJA 3S3MA 4C2UA 4BDZA 3DKXA 2L7KA 3ZXSA 2LY1A 3A4CA 1BR1A 3OYHA 4DOZA 3OL4A 4XKWA 2QKMB 3LSIA 4YEJA 3A1YA 1G59A 2M7BA 3VWBA 4XLCA 3F9KA 2DT6A 3RPUD 2VPLA 2VIXA 4FETA 4XN3A 3DPUA 1V5GA 4E7IA 1FMVA 1P9QC 1Z3YA 3VSKA 4IQ4A 2MABA 3DEEA 3I3LA 2IS4A 3H5NA 3BG6A 2W4SA 2DXIA 1LKXA 2JVGA 3LL7A 1MMGA 3E1SA 4RLQA 5HLTA 2K3PA 4E7ZA 2VQGA 2VLAA 4HNTA 2LBFA 1PJRA 3RSNA 4BACA 4ANJA 3BG7A 3LSMA 1NG7A 4BE1A 4HPQA 3EUKL 4RM2A 2V7FA 3QYEA 2CUJA 2ELJA 3KX2A 4BDYA 2GOXB 2IXSA 2VJIA 5KHDA 1K6YA 3H9GA 4XLAA 4ZTFA 2IS2A 3VDXA 3CP8A 3EPZA 3TBIA 4DGWB 2W00A 3L2RA 2M7AA 3BCBA 2V9KA 2X85A 4PFOA 3W2WA 1WJ5A 1NG6A 4BQQA 2XSJC 3TMOA 5HNFA 4B3XA 3CF2A 2LBFB 1BR4A 4CCMA 2HPMA 2CV1A 1UG0A 3A2KA 4BEHA 4U7BA 4ITVA 4PSXA 2BVLA 4HNUA 3MKYB 4II2A 3H35A 3TL4X 3AL0C 4ZDOA 2F4IA 2K9MA 3PSIA 3DPTA 4N4NB 3IAM2 1X1AA 4KJZA 3IUOA 4LG3A 4D9JA 1ERDA 1X19A 4C9YA 1U0JA 1D1BA 2JSPA 4XKCA 4JOMA 3RCOA 4Y4RA 2BVMA 3PUBA 3DWLE 3FBIB 3D5SC 3HPGA 3K4CA 2OUMA 3D5RC 5CQGA 1DGWY 4CA0A 5LD2C 2WB1A 2KHMA 3DU5A 3VYUB 3OYGA 3ZR8X 4FASD 4IX7A 2KZVA 3QYFA 3OYDA 2XC7A 4B48A 4D1QA 2CH0A 3FDYA 2ZSIB 4RLFA 3CESA 1WFXA 4PSWA 3UNGC 4H4KC 3KEYA 4II3A 2WAQA 3PNTA 3SZGA 1WJBA 2PMZA 2WAEA 2A5WA 1KONA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5KHD A;  2MC4 A;  4OAZ A;  4OAY A; 
#chains in the Genus database with same CATH topology
 4EMS A;  5FJ8 J;  1PYV A;  1AHD P;  5FFZ A;  3S16 J;  4P96 A;  2XGC A;  4Q47 A;  2WY8 Q;  1SC7 A;  1X2M A;  2JUG A;  3SXY A;  3HOV J;  1Z9C A;  2WY7 Q;  3R4K A;  3E5Q A;  2UXN A;  2DMT A;  3AG3 H;  1XB4 A;  3PQK A;  4CUG A;  1XSD A;  1J5Y A;  4AIH A;  1YX5 A;  1STZ A;  2XRO A;  2R5Z B;  5HOD A;  3C2H A;  1FSE A;  1HCR A;  1BI0 A;  1X58 A;  1QPI A;  3JCU C;  2FJ1 A;  1YFH A;  2H27 A;  5K5O A;  4PJM A;  2XAS A;  2XUB A;  2BHY A;  3ULQ B;  4OIR F;  3IKT A;  4I09 A;  3WU2 C;  4BXX J;  2XAF A;  4L9J A;  3WTS C;  2H8W A;  5H6R A;  3UKG A;  2IA2 A;  2VC1 A;  3BR1 A;  3J80 K;  3RIR A;  5C3E J;  2KDO A;  1HDD C;  2E1C A;  2JUC A;  3LAP A;  3BTI A;  2XVC A;  2COM A;  3LA3 A;  2IGN A;  1DU0 A;  2GLO A;  2JSC A;  2ETH A;  3V7R A;  2E1O A;  2ECB A;  3FK7 A;  4CO8 A;  2XB0 X;  4R8H A;  5FB2 A;  5FGM A;  2XRL A;  1WPK A;  3V8K A;  2BBY A;  3SQN A;  3K4M A;  2V1U A;  3MZH A;  4CCJ A;  2VAS A;  2A68 F;  5IT9 Z;  4CYC B;  2ZFW A;  2H09 A;  4BHP A;  3PIO F;  2VQC A;  4BL0 B;  2ZME B;  3HOU J;  4NB5 A;  2FBI A;  3M9A A;  4DBQ A;  5IPA A;  3BTC A;  5K1Y A;  2M87 A;  2VN2 A;  4BJT A;  3PM1 A;  3LSG A;  4BY7 J;  2W85 A;  3DPL C;  2K02 A;  3P7N A;  3GLL A;  2NVQ J;  2R7Z J;  1QO0 D;  1XSX A;  3JRH A;  1Z05 A;  2DA4 A;  4ZDP A;  1J0R A;  3RQI A;  2F5F A;  2J5P A;  2CRG A;  2DO7 A;  4HW0 A;  3RI4 A;  4NUB A;  3OS0 A;  1O3Q A;  3GEZ A;  4Q4Z F;  5IYD J;  1JKR C;  3MKW B;  3LST A;  5HLG A;  5D5X B;  3T0Y A;  4NC6 A;  4F93 B;  2EH3 A;  3HOX J;  1T38 A;  3ZQG A;  1YI2 I;  3N4M A;  2FX0 A;  5BNG A;  2ZXW H;  3WG7 H;  1UHM A;  1BW6 A;  3IWF A;  2VBZ A;  4J00 A;  1G2H A;  5JVG F;  3NWS A;  2ESN A;  5GAG J;  5L3B A;  1MBJ A;  3H3Z A;  4E7K A;  3OYA A;  2RNG A;  3H3V K;  2EIM H;  5LBQ A;  3HPH A;  1J09 A;  2Y31 A;  2L4M A;  5AIQ A;  1IN7 A;  4Z2Y A;  1SD6 A;  3K9T A;  2DCE A;  1IN5 A;  1A5J A;  2QEX I;  1HXD A;  3OR1 C;  3T8T A;  3P9I A;  4M3E A;  4XSZ F;  4ON0 A;  4KT6 A;  4E6K G;  3JSP A;  3QPL A;  5D5U B;  2QUF A;  1WVR A;  4DQ2 A;  4Y13 A;  1MBH A;  1K61 A;  3W6K B;  1X3U A;  4JX6 A;  4I99 C;  5FKM A;  2HPI A;  2OTL I;  4Q5S F;  2HYF A;  1P4W A;  4QPO A;  4GCV A;  2E19 A;  5F0C A;  4YFX F;  4XLP F;  3U1D A;  4B8X A;  1UEL B;  3P9C A;  5EJC A;  2IS6 A;  5EF6 A;  1WH7 A;  4GO1 A;  1FX7 A;  1JUM A;  2V6C A;  3F8M A;  3CJN A;  2VT2 A;  2JWT A;  1IGN A;  1VQ8 I;  4MEX F;  3HXL A;  5DEQ A;  1OR7 A;  2ME0 A;  2GWR A;  3OYJ A;  4LB6 B;  1D3Y A;  1KU3 A;  3V8L A;  5C4X J;  1YLF A;  1ZLK A;  1FP1 D;  4JX5 A;  3W6J B;  2DOF A;  2E5Z A;  4A3E J;  1F1Z A;  3DLL F;  1Y8Q B;  3WTU C;  1D5Y A;  1UHW A;  3Q9S A;  3NQO A;  3LA2 A;  3KZY A;  3PFI A;  1IRZ A;  1O7L A;  3F8N A;  1DPR A;  1DQU A;  3KEO A;  2IBD A;  2MH9 A;  4WK8 F;  3QOP A;  2BY1 A;  1KU2 A;  2X51 A;  2PMZ N;  3J7Y J;  2LH9 A;  3E7L A;  2XAU A;  2DMN A;  2EA2 A;  2K9L A;  1JUS A;  2Y9Y A;  4FIS A;  4WWC A;  4A12 A;  1X2N A;  3IL2 A;  3PJR A;  4G12 A;  2M2E A;  2B9S A;  1F43 A;  1H0M A;  4YFN F;  1MDM A;  1D0Y A;  1VQ6 I;  5BPI A;  4UVA A;  3JRA A;  4IL6 C;  1TQP A;  4DBR A;  4F55 A;  5JHU A;  3C2G A;  4DJA A;  3CCV I;  4EM1 A;  2M5W A;  3RQ4 A;  2Y75 A;  3OIP A;  5FFX A;  3VYR B;  1ODD A;  4I7H A;  1GXP A;  4HST A;  1YRN A;  1LDD A;  3BG9 A;  3I56 I;  4OAZ A;  5IT9 K;  4MGR A;  5F0F A;  2QQB A;  3KPH A;  4RBO A;  1EF4 A;  3ZQQ A;  2CW7 A;  3IH4 A;  3R0A A;  4BGD A;  3BJO A;  3ASN H;  2K86 A;  3RPU A;  2VQH A;  1U3E M;  2P0W A;  2L5Q A;  4Y17 A;  1I27 A;  1UCR A;  2IPQ X;  2IJL A;  3H9Q A;  2XAJ A;  2FML A;  3KP2 A;  5B5E C;  5ICG A;  5HS7 A;  1Q1H A;  2UWM A;  4XKB A;  1V5E A;  2CO5 A;  1REP C;  3S8P A;  5A2Q Z;  3BC8 A;  2ZXI A;  5LHH A;  3LFU A;  3CCE I;  4WXD A;  5IYB J;  1ON1 A;  4N0B A;  1ZAO A;  1K6O A;  5L3F A;  3JTH A;  2VE9 A;  5J8C A;  1AU7 A;  2COB A;  1BM9 A;  4XLH A;  3IRR A;  2VJJ A;  2VBW A;  4GDF A;  1XGN A;  4KIT B;  5AIP A;  1G4D A;  2V26 A;  5LGT A;  2EB7 A;  2VJ4 A;  4N9H A;  5M3M J;  2CJJ A;  2JJ7 A;  4E4H A;  5GAE J;  2ZJR F;  2IS1 A;  3FIS A;  2QGU A;  3TGN A;  2QLZ A;  1JHF A;  1Z6R A;  1LFU P;  1S72 I;  2DT5 A;  3F6V A;  3F3X A;  3FWE A;  3WTT C;  1GT0 C;  2AQE A;  4DNC A;  4PCQ A;  2OJE D;  3JW4 A;  3BZ6 A;  4DYQ A;  5K7F A;  4A3C J;  2JA8 J;  4RGR A;  1Z0X A;  1T56 A;  3FBN B;  3FKJ A;  1D0X A;  2CQQ A;  2PBI A;  4XON A;  4XM3 A;  2E60 A;  3L2Q A;  3GO5 A;  1T0F C;  2HXO A;  4Y15 A;  2OV7 A;  4P9F A;  5H6Q A;  2NNY A;  2B63 J;  1Z6T A;  3A01 B;  4CCL A;  1ZAR A;  3CO6 C;  4QPQ A;  1U2W A;  4IVN A;  2KPM A;  2MFZ A;  3R60 A;  5FKK A;  3CMA I;  4HRI A;  2X6X A;  1LUJ B;  2LY9 A;  3KP7 A;  2O61 A;  4PFP A;  3CLQ A;  3S32 A;  2RC4 A;  1OCO H;  5LHG A;  4XID A;  4P55 A;  2L3D A;  1ZRF A;  4EJV A;  3AL0 B;  1HST A;  4A69 C;  2I10 A;  1LE8 B;  1TWA J;  2G7H A;  2HI3 A;  3ZXS A;  1BR1 A;  3OYH A;  2PQ8 A;  2O8X A;  1R00 A;  3OL4 A;  2R5Y A;  2ELK A;  3M8F A;  1JHH A;  1K4T A;  1IUF A;  1NTC A;  3O8H A;  4HA8 A;  3L9F A;  3A1Y A;  5CVV A;  1DDN A;  2IVM A;  4XLC A;  2MSY A;  2QSF X;  3F8C A;  5FKL A;  2FXA A;  4FET A;  2L9V A;  2YU3 A;  3HOZ J;  2X6O A;  3BTL A;  1P9Q C;  1TWF J;  1Z3Y A;  1AWC A;  2ZXJ A;  3ZQH A;  5E3N A;  1R36 A;  3SZT A;  2L7Z A;  1U8R A;  3QU6 A;  2CQ7 A;  5J1R A;  4XBF A;  2FRH A;  2ZJ2 A;  5DTD A;  3MVP A;  2A07 F;  2BV6 A;  4S0H B;  2DA5 A;  2P6S A;  3C1D A;  3IWZ A;  4BHB A;  5D5V B;  2DXI A;  2ECC A;  4HLY A;  4RLQ A;  2DBB A;  1R5H A;  2JPB A;  2LBF A;  5HS9 A;  4BAC A;  4AD9 A;  5GTI C;  4CXF A;  4UUV A;  3BG7 A;  1R4N B;  1NG7 A;  4RB1 A;  1ACI A;  2EFN A;  4HPQ A;  2D1V A;  3QYE A;  3JSO A;  1V54 H;  2GOX B;  3K1M A;  1YIT I;  2F5C A;  2IRF G;  1ETK A;  1MIJ A;  5KHD A;  1EKE A;  1TL8 A;  5GAD J;  4ZTF A;  3AG2 H;  3B73 A;  2X9D A;  2Y30 A;  2WC2 A;  3OIO A;  4RGX A;  2Z33 A;  4WX9 A;  2V9K A;  3QPS A;  1WJ5 A;  3IRQ A;  2VI6 A;  4A93 J;  2DMP A;  3BJ6 A;  1YS7 A;  1UG0 A;  2A5Y B;  2R92 J;  1R58 A;  1W7P D;  3HTU A;  1H8A C;  3C18 A;  2HTS A;  2ESH A;  3QWL A;  3U9G A;  3JRD A;  4KIG A;  1S3J A;  4II2 A;  3ZMU A;  3BR3 A;  4B4C A;  2F4I A;  4AWX B;  3GZ6 A;  1TQM A;  4KMU X;  2QQA A;  1ERD A;  2KKO A;  3L2C A;  1EH8 A;  1X19 A;  4C9Y A;  2JA6 J;  4LK1 F;  1D1B A;  5A2Q K;  3FZV A;  1XX5 A;  2B0L A;  5EDN A;  1PDN C;  3RCO A;  3CDH A;  1AKH B;  3HHH A;  3HPG A;  4JX4 A;  4G94 A;  1KU7 A;  1Z91 A;  3D5R C;  2HOS A;  1U8B A;  3BT9 A;  1DGW Y;  3TED A;  2AHQ A;  2NOG A;  2YR2 A;  3DFG A;  4V19 K;  3OYG A;  3ZR8 X;  4QIW N;  2MD5 A;  4FAS D;  2XV4 S;  2VKV A;  2DK5 A;  4U88 A;  3QYF A;  3F6O A;  1XG1 A;  4B48 A;  1W0U A;  4LK0 F;  3FKI J;  2AS5 F;  2DAO A;  1K7A A;  3CES A;  1SD4 A;  2Z99 A;  3UNG C;  1Z1D A;  2PMZ A;  1I50 J;  2WAE A;  2ZO4 A;  4C3I J;  4HDV A;  5F08 A;  2F4M B;  3E5X A;  4Y7N J;  3B6A A;  2DFF A;  5KAI C;  3S3N A;  4B3A A;  3RKX A;  1KU9 A;  1LEB A;  1QGP A;  1YO5 C;  2HDC A;  4YIF A;  1A36 A;  3N97 A;  4M72 A;  2PFB A;  3ELK A;  3OYM A;  1JT6 A;  1N75 A;  2HVQ A;  1W7P B;  5J3L A;  2JQ7 A;  3FXL A;  2EFP A;  3WU1 B;  2NVU B;  5CLS A;  4L18 B;  1R9T J;  3QOD A;  1N78 A;  3S3O A;  3G73 A;  3LOC A;  2KIS A;  5BPD A;  2OCE A;  4RGS A;  3G4S I;  3F0C A;  5EZG A;  2TDX A;  3EQL F;  1QZY A;  3KET A;  3PFY A;  3AKZ A;  2OU2 A;  2H94 A;  2IEK A;  3I5U A;  1APL C;  5F27 A;  1B4A A;  3FM3 A;  3R6S A;  3HOT A;  1HKT A;  4AVZ A;  5CVR A;  1HF0 A;  2P6T A;  5BMZ A;  1Q1V A;  4M3B A;  4IKF A;  2K85 A;  1BN5 A;  2K7L A;  1HW2 A;  2JTV A;  1D1C A;  3E6C C;  2HVR A;  3K1N A;  3PL8 A;  3K69 A;  1Z7L A;  3O6B B;  4GRI A;  2I8D A;  5CKT A;  3U21 A;  2KFD A;  5JI6 A;  5EGO A;  1FWZ A;  1UJ8 A;  1DGR M;  1IZ1 A;  2Q1Z B;  2P5L C;  1VQ4 I;  3H3U A;  1BIA A;  1FY7 A;  1W36 D;  1I3A A;  4KDP A;  3E3V A;  1SVM A;  3JR9 A;  1W0T A;  1RI7 A;  1W4M A;  5DYM A;  3EYY A;  2V4J C;  3RJP A;  1OLT A;  1S9H A;  2HNH A;  3CLO A;  5HDK A;  3IV5 A;  4LIV A;  3LNQ A;  4A3M J;  4BUP A;  3QP5 A;  3S15 J;  1I6H J;  5CPR B;  1UZC A;  3NAR A;  3COA C;  2XDV A;  3SEZ A;  3JRI A;  3K70 C;  3GTJ J;  1XCV A;  2NNN A;  4WF2 A;  1JI8 A;  3CCS I;  3MKL A;  2MG4 A;  1MSE C;  3CUO A;  4U0W A;  1HBX G;  1TTY A;  1OCC H;  2E1M C;  1PUF B;  1HLV A;  2GIV A;  2XAH A;  1K79 A;  2L01 A;  1T95 A;  1YW9 A;  1VND A;  2BXZ A;  5F1R A;  1O7F A;  3KEQ A;  3CCY A;  2DA2 A;  2R7O A;  4L5I A;  3G71 I;  3ZQL A;  1ZRE A;  1GLN A;  4AVP A;  4E7L A;  3H5A A;  1MDM B;  5FO5 A;  2YPR A;  1MMA A;  4BKX A;  4KA4 A;  2M4K A;  2LC2 A;  2GXB A;  3HYI A;  3WTW C;  1ETY A;  1E3P A;  2WBM A;  1TW2 A;  2M8G X;  4P5O A;  1ITY A;  3PNV A;  3GBG A;  5K5R A;  3K4B A;  3K4J A;  3VB2 A;  4S05 A;  1MH3 A;  3SJM A;  1YRN B;  1Y8R B;  4IOC F;  4ABZ A;  1Y1V J;  2R7Q A;  3ZN1 A;  2M8E A;  3H0D A;  2LRE A;  3ML6 A;  2KIQ A;  1P4A A;  3BWG A;  2M1B A;  2DFI A;  4EJW A;  1ZK8 A;  2HVS A;  3GFL A;  3T5X A;  1QNT A;  4RM3 A;  2EIL H;  1X1P A;  1MD0 A;  2Z16 A;  2R7F A;  2VKH A;  2LG4 A;  2FOK A;  1FT9 A;  5ICC A;  5E3L A;  3S2W A;  4ENK A;  4LMY A;  1FP2 A;  2OAZ A;  4M6Y A;  3SFI A;  5M3F J;  5B1A H;  3HRS A;  1VQL I;  3CP2 A;  3F22 A;  1DPU A;  3BG3 A;  3BTJ A;  2LKX A;  3MD2 A;  4ZC3 A;  2KJC A;  3CQZ J;  2XF5 A;  1ZEL A;  2K9Q A;  1SVL A;  4RGU A;  3HOS A;  2KQR A;  2PJR B;  3DTK A;  5TIS C;  2E5N A;  1P2F A;  3CZ6 A;  5L3D A;  3G1L A;  3GTM J;  1JJ6 C;  4LLN A;  2DOD A;  4EGY A;  2K9S A;  1IW7 F;  2DYS H;  3ZCO A;  2NVX J;  4C30 A;  3ONQ A;  1ZGW A;  4EJU A;  1WCM J;  5IP7 J;  3GWZ A;  4PDK A;  3R61 A;  1J7K A;  4BAY A;  2PG4 A;  1HOM A;  2BY2 A;  3GXO A;  4HAM A;  1ZLJ A;  3M8J A;  1KGS A;  1MBG A;  3ASO H;  1ZRC A;  5DV5 A;  3CC7 I;  3FXJ A;  4YEL A;  1RUO A;  3PSF A;  4U7D A;  3CUQ C;  3OYF A;  2AXT C;  1EH6 A;  1LVK A;  2V79 A;  5FRN A;  3LWF A;  1UST A;  1IXC A;  4X6A J;  2DA3 A;  1R49 A;  2X6Y A;  4DZJ A;  4ENM A;  2EFW A;  3H0G J;  2D45 A;  2XGE A;  2M30 A;  2L4A A;  1TNS A;  1MMS A;  1KYZ A;  3OYN A;  2DDB A;  3JRF A;  1SFE A;  2HYG D;  2QZ8 A;  3HKZ A;  3GUD A;  1R4M B;  3DBH B;  1JKQ C;  2VJ5 A;  1LFP A;  3OMY A;  3GFM A;  3S14 J;  4I76 A;  1XMX A;  3RYP A;  1A35 A;  4YG2 F;  2A3S A;  2KJB A;  3CUQ A;  2EV5 A;  2YUS A;  3LSK A;  4XN0 A;  4PJN A;  1VQ5 I;  2HQ5 A;  3FF5 A;  5LGN A;  5B66 C;  2LLK A;  1ORK A;  1QBJ A;  3L7W A;  2HQA A;  2PJP A;  2ZKZ A;  4JYK A;  2JA2 A;  1XCB A;  3JRB A;  1FNN A;  5DM6 F;  3G1O A;  4IF4 A;  1VQP I;  2GBY A;  2HEO A;  1BOA A;  4ZDL A;  1JXS A;  2K3F A;  3CCR I;  2RRE A;  4ZYG A;  1K78 B;  4XR6 A;  3CMY A;  2X6W A;  2BW3 A;  2LRD A;  4MLO A;  4M9Z A;  2CW0 F;  1IRF A;  4DIQ A;  1G6N A;  1DUX C;  2O5R A;  4QLC U;  2R7X A;  4PUS A;  4BNC A;  3LQQ A;  5D4R A;  2HKX A;  4Q48 A;  1IJW C;  1B8I B;  2MYS A;  5DS9 A;  3WG9 A;  2F5E A;  1JGS A;  2ISY A;  2WAD A;  1LNW A;  3J7Z I;  1YG2 A;  1D8K A;  3M3Y J;  3S93 A;  1ETX A;  1XDS A;  3RDI A;  3P5J A;  3HUG B;  3EDP A;  3OYL A;  1T8I A;  2E71 A;  3DLA A;  1JKO C;  2HTJ A;  1HA8 A;  2E1N A;  2AXL A;  2W7N A;  2X48 A;  1FBS A;  2MLG A;  3ERM A;  2X1D A;  2W82 A;  4CCO A;  2OQR A;  2CGP A;  1YJN I;  3L2V A;  2EZL A;  2PX9 A;  3BZK A;  3GME A;  1ZKG A;  1VTN C;  4F92 B;  4MFE A;  5EEH A;  1NK3 P;  4FX0 A;  2HOA A;  4XIC A;  2MW8 A;  2R93 J;  2K27 A;  3LQR A;  1OR7 C;  3W2A A;  3U2R A;  3Q0W A;  5CYV A;  2VQL A;  4XQF A;  5GPA A;  2VE8 A;  2LF8 A;  1WJC A;  1B59 A;  2XHK A;  4X1E A;  3WU0 A;  1AA7 A;  3HB9 A;  4L0Y B;  2ZB9 A;  2Q8K A;  4PK4 A;  2Q2E B;  5LGU A;  4CZZ A;  2Z2S B;  5DD4 A;  2VXZ A;  3BCA A;  1LFB A;  1O3S A;  1IV8 A;  3MKZ A;  4IRG A;  3OY9 A;  2ZXH A;  3W3C A;  3SFZ A;  1B72 B;  1A6I A;  4XKV A;  2G0E A;  4ZYA A;  1H89 C;  1Z21 A;  2OZU A;  1QU3 A;  2FUG 2;  3W2V A;  3SEQ A;  1A04 A;  2FD5 A;  4HBL A;  2FNA A;  3DKX A;  1KQ9 A;  1E3O C;  2LY1 A;  3A4C A;  3PIP F;  2VC0 A;  2O03 A;  1F36 A;  2IAI A;  4XKW A;  2QKM B;  5KK1 A;  3LSI A;  4YEJ A;  5FD5 A;  3HM5 A;  2RAE A;  3NRV A;  2M7B A;  3VWB A;  4CDG A;  3F9K A;  4A3L J;  2VIX A;  1U5T C;  2ID6 A;  2IW5 A;  2UXX A;  4CGZ A;  4I02 A;  4M6V A;  3DPU A;  4XN3 A;  1GDT A;  2G9W A;  3BP8 A;  4RAG A;  1FMV A;  2MGQ A;  2O3F A;  3Q9V A;  5EYR A;  2MAB A;  2ZC2 A;  3WE2 A;  3I3L A;  4MTD A;  1ZH5 A;  4OIN F;  2GZW A;  1TW3 A;  2W4S A;  2ACJ A;  1LKX A;  2K3P A;  5FKN A;  4E7Z A;  3HHG A;  3SZP A;  2VQG A;  3RSN A;  5BQT A;  3E6M A;  1XMK A;  1ZN2 A;  3LSM A;  2ID3 A;  3BQZ A;  2DA6 A;  2V1X A;  3BRO A;  1JUP A;  5ILV A;  2K9N A;  2RNJ A;  3DCF A;  1U5T A;  4BDY A;  3NEU A;  3C7J A;  3HSR A;  3ZPL A;  4BY1 J;  1B9M A;  2LFB A;  2R7D A;  4M9S A;  5CJ9 A;  1RNL A;  1K6Y A;  3LSR A;  1PP7 U;  4LGW A;  4XLA A;  3GYH X;  2QEN A;  4IHV A;  3EPZ A;  4AID A;  2M7A A;  4AYB N;  1WZ2 A;  2FBK A;  2TRT A;  1NG6 A;  2DI3 A;  2XSJ C;  3WHC A;  3F72 A;  5HNF A;  2CWE A;  1R5G A;  1BR4 A;  4CCM A;  2HPM A;  4UUT A;  3DV8 A;  5EG0 A;  4D0P A;  3A2K A;  4U7B A;  1QRY A;  2E7W A;  3KLO A;  2DPD A;  4HV6 A;  3FIW A;  4HNU A;  3HIF A;  3H35 A;  3TL4 X;  1I5Z A;  4L0Z B;  4ZDO A;  3PSI A;  1U78 A;  3CCL I;  1G3Y A;  5HDG A;  2E34 A;  4PJ0 C;  2FBH A;  2JSP A;  5ILS A;  5DDG A;  5GPC A;  2JA7 J;  3S1M J;  3MAJ A;  4MNU A;  3EYI A;  3PO2 J;  4A3B J;  1FEX A;  4CIC A;  4FE4 A;  4EM2 A;  1FBU A;  2BVM A;  3DWL E;  3WE3 A;  3FBI B;  3D5S C;  3IKV A;  3JRG A;  4J19 A;  3K4C A;  2OUM A;  1H9T A;  2YX7 A;  2A05 A;  1MNM C;  5HLH A;  1TWG J;  5LRS A;  2MBF A;  3CF5 F;  1R7J A;  2LMD A;  1BA5 A;  5F04 A;  3OYD A;  3TO6 A;  3GW2 A;  2A6H F;  2CH0 A;  2ME6 A;  1R1V A;  4ZZL A;  4PSW A;  3F8F A;  4UV8 A;  4OMZ A;  2HGC A;  1UMQ A;  3PNT A;  3WHB A;  1WJB A;  2VBX A;  2CFX A;  2P8T A;  2DTZ A;  4OIO F;  1RR7 A;  4N4O B;  3BOQ A;  3BPV A;  4L9N A;  5ED4 A;  2MA3 A;  2EFO A;  3BR0 A;  4RMN A;  3G1M A;  4NC7 A;  1ZTR A;  2MH2 A;  4FHT A;  2EIJ H;  3Q0V A;  1WWX A;  4BS9 A;  4M3G A;  2QBY B;  3CCM I;  2PEX A;  2ZFU A;  2KIM A;  1OCR H;  2EWN A;  1UFM A;  5ICE A;  5HDN A;  1YX3 A;  1D1A A;  4OMY A;  2VKD A;  3N05 A;  3QP6 A;  4ZTJ A;  4KYW A;  3OIQ A;  3I59 B;  4CZC A;  1IRG A;  1I3Q J;  4NQW B;  2KL4 A;  2M34 A;  2HZD A;  3HSE A;  5JHF A;  3CO7 C;  2VL8 A;  2XPV A;  3FX3 A;  2BE5 F;  1R22 A;  3K2Z A;  3REO A;  1ETV A;  2HOT A;  2EIK H;  2GIZ A;  2LP0 A;  2OQG A;  3K4N A;  2Z9O A;  3O3K A;  1QQI A;  1FZP B;  1MJB A;  1SFO J;  1VQN I;  4LG0 A;  3FXU A;  3QU3 A;  1L3L A;  4DYR A;  4CYC A;  2BOL A;  3K4L A;  3E5U A;  3WTX C;  1XSV A;  2ZME A;  4IPA A;  5DUK A;  2DJN A;  2WTE A;  3DTE A;  3CCQ I;  3ZN0 A;  1SD5 A;  3HRU A;  4UV9 A;  1RZ4 A;  4QTR A;  5L3C A;  3DP7 A;  3A03 A;  1ZG5 A;  4BU2 A;  1DP3 A;  5GTH C;  2OF7 A;  5KVR A;  4KT5 C;  1WJE A;  3AFH A;  3OYE A;  3TO9 A;  4A2U A;  2CMP A;  3LSH A;  4KIC A;  4OU0 A;  4UHT A;  3ABT A;  1FMW A;  1TZL A;  2FA5 A;  1ZG3 A;  4ENJ A;  1JKP C;  1BC8 C;  4CCK A;  2XRN A;  2YU9 J;  5H2F C;  2GA1 A;  3GLX A;  1G8X A;  1Y0N A;  2K5C A;  4U0V A;  3S2D J;  2R7V A;  4G7Z F;  4ASN A;  3T1B A;  2AQF A;  4CCN A;  3CME I;  1XPX A;  1X3Z B;  4PZJ A;  3CD6 I;  2W48 A;  1PVE A;  3V42 A;  1K83 J;  1VZ0 A;  5ERI A;  3KP3 A;  4FX4 A;  4GYI A;  4F3Q A;  1ETQ A;  5E3M A;  1VQ9 I;  3ZQ7 A;  4BQA A;  1WJD A;  3B02 A;  3VSL A;  3JRE A;  4DZP A;  2UV1 A;  4I0B A;  2ZCW A;  4RB0 A;  1FIP A;  3ZMD A;  1TC3 C;  4RA2 A;  3FK6 A;  2X0L A;  3VFZ A;  2DOA A;  3HKZ N;  3RZD J;  2OCC H;  5J1Y A;  2M3A A;  1JGG A;  3CUQ B;  1YQA A;  1SFK A;  3DF8 A;  3NWT A;  1MMD A;  5E20 A;  3OYK A;  1HKS A;  4M74 A;  3S1R J;  1OCZ H;  1WJA A;  2B7E A;  5H20 A;  4OWR B;  2KRH A;  2FF4 A;  2LNB A;  1DU6 A;  5E8G A;  4EAT A;  4BBS J;  4ZYH A;  3KZI C;  2D2W A;  1JE8 A;  3A0H C;  1S29 A;  2L9N A;  3WTZ A;  2WAF A;  1YE9 A;  1XS9 A;  5DCM A;  4LFU A;  2RN7 A;  1Y6I A;  1BJZ A;  3HTS B;  2VOP A;  1P7J A;  4AC0 A;  2HQR A;  3DKY A;  3E6D A;  1FLI A;  3HOW J;  1YOV B;  5GP9 A;  2A69 F;  2EK5 A;  2MC3 A;  1QA6 A;  3A02 A;  4YFK F;  3K6G A;  4KN7 X;  1K4S A;  3HC7 A;  3JAM Z;  3TOA A;  2QQ8 A;  4Y52 J;  4AU7 A;  2GXA A;  2KMU A;  3FXO A;  2KZG A;  3DQV C;  2VB6 A;  5E1X A;  2CUZ A;  1YW8 A;  2XB5 A;  3ABM H;  3HL2 A;  5D6E A;  1IXS B;  1FBQ A;  3K4K A;  4J01 A;  1P7I A;  4MIM A;  1OYI A;  3I4N J;  4DYC A;  1TP4 A;  2LDU A;  2V9P A;  4BJ6 C;  3F23 A;  3EUA A;  2DQL A;  4XL9 A;  5FLV A;  4KIS A;  2F48 A;  3RKY A;  3FHN A;  1Y39 A;  2F6C A;  3I54 A;  1G3W A;  3ZMT A;  1R6R A;  5KAF C;  3L2U A;  1JTY A;  4XRS A;  3F21 A;  1WH5 A;  5DCF A;  4U87 A;  3WTV C;  2R7R A;  1ZR4 A;  1CQT A;  1P92 A;  2PMU A;  4AUX A;  1ZGA A;  4RAZ A;  4IEJ A;  4M9X A;  2CQN A;  4NNJ A;  2EV0 A;  2DJI A;  5FLM J;  2HXI A;  3Q0U A;  2IA1 A;  1EA3 A;  3RZO J;  4L5J A;  4XK4 A;  3P9K A;  5CVU A;  2VBY A;  4XOT A;  3CJT B;  2BYV E;  3AAF A;  2E36 A;  2O8K A;  2HFH A;  2AO9 A;  2LK2 A;  1G3S A;  2CW8 A;  4NC8 A;  2F2E A;  2L2O A;  4M6X A;  2ADU A;  4MFD A;  4AYB A;  3MFK A;  3RPQ A;  2BGC A;  3H1C A;  4M73 A;  1ZYR F;  4I01 A;  2DA1 A;  3GVA A;  4OIQ F;  2LVS A;  4HSR A;  5HS8 A;  2BEO A;  2QSH X;  4B09 A;  2EA4 A;  2QQ9 A;  4HX8 A;  2JZY A;  2LF7 A;  4O5V A;  4E7S A;  2CUE A;  4I2O A;  4CH7 A;  2E2I J;  3X2Q H;  4GYG A;  4HDU A;  4RS8 A;  4UB8 C;  1T08 B;  3DXJ F;  3FXQ A;  4HX4 A;  3I71 A;  2CV2 A;  1RUN A;  2QWW A;  1OIS A;  1OJL A;  1VF9 A;  3H92 A;  3ZGK A;  4S04 A;  3SDB A;  2KRC A;  5LLQ A;  2FEZ A;  2HDW A;  2X4H A;  3VOD A;  3IAS 2;  3OS1 A;  2DOE A;  3V7C A;  1IXR C;  2EJR A;  2ICW G;  1FTT A;  1RC9 A;  4U0Y A;  1J59 A;  3I58 A;  5KNL A;  1XMA A;  3TKY A;  1FPQ A;  1MJA A;  2OZ6 A;  4PJL A;  4HG2 A;  4KIB A;  3OSF A;  4O6J A;  2E7X A;  3BR5 A;  1R1U A;  3BZC A;  4N9I A;  2H1L A;  2R7W A;  2OTJ I;  2ELH A;  1H9G A;  4LLL A;  3LAJ A;  3D5L A;  4LD5 A;  4NHJ A;  4H0E A;  2FQ3 A;  3OR2 C;  2QCO A;  5D6F A;  2A6T A;  2XGX A;  2Y0S A;  4FTH A;  3SYT A;  1MJ9 A;  4B43 A;  2CYY A;  3TOB A;  3GFJ A;  4QSH A;  4E7J A;  1Z3X A;  2I5U A;  1I1S A;  1U5T B;  3OL3 A;  4G9Y A;  3CJQ B;  1V55 H;  4G8X A;  1O4X A;  1SAU A;  2QM3 A;  1ZG1 A;  3G3Z A;  3KZZ A;  1IRX A;  4RAY A;  1Y1W J;  1LQ1 A;  2LR8 A;  3CMM A;  3M1E A;  5IP9 J;  1QHH D;  2CFO A;  2Y69 H;  1SMY F;  2OD5 A;  5EEG A;  1O57 A;  1TLH B;  3CJR B;  5M5Y J;  2QA4 I;  3A01 A;  1BI1 A;  1I1G A;  1QVT A;  4FQG A;  3KP6 A;  4Y33 A;  3ZOB A;  4AM3 A;  5EG0 B;  2IGK A;  5LFA A;  3O8G A;  1J2X A;  1WHU A;  1JTX A;  1OYY A;  4CHU A;  4EM0 B;  2QSG X;  2Z3Y A;  3LA7 A;  5FD6 A;  5K5Q A;  3GZ5 A;  4I6Z A;  3ZQC A;  2Y48 A;  4Y3O A;  2P5V A;  3UR3 C;  1WJF A;  1X4P A;  3JAM K;  2LSO A;  2R7U A;  2KRF A;  3QOE A;  3I0T A;  1KYW A;  3SDG A;  2R7T A;  3LMM A;  1FOK A;  4A3I J;  2M4G A;  5ICF A;  2F4O B;  4A3J J;  1LDK B;  4A3F J;  4KIF A;  4BH9 A;  2K40 A;  2V6E A;  1SVO A;  5DUI A;  2O0Y A;  2PLY A;  1UAA A;  1D5V A;  1OCT C;  1IDZ A;  3RYR A;  4E7H A;  1GVD A;  4ZJZ A;  3D0S A;  1TT5 B;  3CC4 I;  1BW5 A;  1OYW A;  3H9J A;  1RRJ A;  2Y2Z A;  4PJJ A;  3S3M A;  4C2U A;  4HV5 A;  1S7A A;  2DYR H;  5E8I A;  2ZNZ A;  3TP3 A;  4WXC A;  4ESF A;  2L54 A;  3S2H J;  5DM7 F;  1T39 A;  2H8R A;  5IT3 A;  2H6B A;  3FXK A;  3MZY A;  1G59 A;  2NYX A;  4A3K J;  4IRH A;  4KMF A;  2RQP A;  1ETO A;  2DT6 A;  4O3M A;  2VPL A;  4A3G J;  4UVC A;  1LDJ A;  2BXY A;  1HDP A;  4D7N A;  3VSK A;  3HBL A;  4ESB A;  4GGG A;  1CF7 A;  3DEE A;  3S1N J;  2DDA A;  2IS4 A;  3H5N A;  1A6Q A;  2CQK A;  3AG1 H;  2JVG A;  4E70 A;  1MMG A;  3E1S A;  3RKQ A;  1Z77 A;  2R5Y B;  3MQ0 A;  2ZNY A;  5C4J J;  1GXQ A;  4HNT A;  2TCT A;  4ENN A;  3TO7 A;  3SHF A;  5IY5 H;  1BBY A;  1NK2 P;  4BBR J;  1GV5 A;  4HQM A;  4BE1 A;  4RB3 C;  1YS6 A;  2V7F A;  4G6Q A;  2VPR A;  4UXN A;  2CUJ A;  2ELJ A;  2L7F P;  2WV1 A;  3GTO J;  4LG0 B;  2IXS A;  1Z67 A;  5AON A;  2XPU A;  1M1E B;  3CTA A;  4IHY A;  1VQM I;  5F64 A;  1HW5 A;  2IS2 A;  3VDX A;  3CP8 A;  3HJE A;  2YX4 A;  3TBI A;  4DGW B;  2W00 A;  3C3W A;  3L2R A;  3BCB A;  4I0A A;  3KP4 A;  1SFX A;  2W24 A;  3MWM A;  1HKQ A;  3W2W A;  5BOX A;  2NS7 A;  2VON A;  2LTP A;  4P9U A;  2LBF B;  3NAU A;  4W97 A;  1AKH A;  1SMT A;  3T8R A;  3WGG A;  4GFB A;  4BEH A;  2JK3 A;  3FHZ A;  3H36 A;  2BVL A;  4ZYE A;  3MKY B;  1BI2 A;  4EQQ A;  2JPC A;  1FOX A;  3WGH A;  3J81 Z;  3DPT A;  1X1A A;  4KJZ A;  3IUO A;  2YSR A;  4B1R A;  4ETS A;  4LJZ F;  4XRM A;  4JOM A;  4G7O F;  3GTP J;  4HZF A;  2DPU A;  3MEX A;  3ZP5 A;  2DN0 A;  2EZK A;  5FKO A;  4Y4R A;  1V4R A;  2DTR A;  5CVJ A;  1P4X A;  1IUY A;  5CQG A;  4WXH A;  4YII A;  1PP8 F;  1RET A;  1FYL A;  3K0L A;  2J5O A;  2VOO A;  4ZH4 F;  3PUF A;  2JA5 J;  1W5T A;  1Y0U A;  2DK8 A;  1R23 A;  2KHM A;  3DU5 A;  3IH3 A;  3M8E A;  3ZQF A;  5M5X J;  1A31 A;  1WQ2 A;  3ECH A;  4A0Z A;  4IX7 A;  1W7P A;  3MZ8 A;  2BHZ A;  1MH4 A;  1R5I D;  2OPT A;  3FDY A;  4D7M A;  1WSU A;  1NHA A;  4RLF A;  1AOY A;  3DEU A;  2K4B A;  4H4K C;  2L7M P;  3KEY A;  2WAQ A;  4HYE A;  1XD7 A;  5JLW A;  3M07 A;  1R71 A;  3CDL A;  4MO7 A;  5D8L B;  2A6E F;  3HOY J;  3WGI A;  1KON A;  3BLY A;  4G6D A;  4IO9 F;  2P5K A;  5FRM A;  4Z6Y A;  4EJT A;  1S8N A;  1NH3 A;  4MHG A;  1WI3 A;  2GXG A;  5DCM B;  4UNO A;  4RAF A;  4HF2 A;  5B3S H;  2MD0 A;  1X3W B;  3BY6 A;  2R4G A;  3BPX A;  3H5R A;  4XMY A;  2V1N A;  3I9V 2;  4JQF A;  1N25 A;  4XNF A;  2OC6 A;  1IO2 A;  4OAY A;  2L9R A;  2W1O A;  1VQ7 I;  2P7V B;  1IF1 A;  1S5L C;  2HU9 A;  5J40 A;  2ZSH B;  1Z7U A;  2D1H A;  4P1W A;  1TT0 A;  1LB2 A;  1B1B A;  2DA7 A;  1V3F A;  3FXM A;  3K1P A;  4UB6 C;  2GQQ A;  3GF2 A;  4G6T B;  3QAH A;  4PGH A;  3ZMZ A;  2W84 A;  1TNT A;  4IXA A;  4L9V A;  1SAX A;  3VPR A;  1IAW A;  2NS0 A;  3VYT B;  2KLO A;  1D0Z A;  2JVH A;  2V9V A;  2O7O A;  4IQJ A;  5KCM A;  4IJA A;  3OS2 A;  1BJA A;  2KIF A;  1V5F A;  5LEJ A;  4KN4 X;  4XOR A;  4L5E A;  1PUF A;  3OWT A;  1T6S A;  3E97 A;  5IP6 A;  2LYC A;  4FCY A;  2X1C A;  3MMY B;  2FOW A;  2M0C A;  3IC7 A;  2OA4 A;  3EUH C;  2HDD A;  3ESW B;  1B6A A;  2BZT A;  3HSF A;  4UUS A;  3L2W A;  2F5V A;  3E6B A;  1X1D A;  2XKP A;  3TW7 A;  4BJ5 C;  2DW4 A;  1TQI A;  2HYJ A;  3K70 D;  1I39 A;  2VOD A;  2LD5 A;  2NS8 A;  4F52 A;  2JMW A;  3BR2 A;  3DTI A;  2Y0M A;  2CSO A;  1W36 C;  1OMI A;  1TWC J;  3KYC B;  4BE2 A;  3JRC A;  2GAU A;  2XF7 A;  5E1Z B;  1SD7 A;  1ZRD A;  2QKL B;  2JRM A;  4JP0 A;  5M5W J;  2Z1D A;  4R1H A;  1UHS A;  2E35 A;  3DBL B;  3OYB A;  3VOE A;  1TWH J;  3DBR B;  1MBF A;  4X0G A;  1QZE A;  3K10 A;  4AIK A;  5EGO B;  4KUM A;  5D8K B;  1J9I A;  5E18 F;  4BQO A;  1ULY A;  4V2G A;  3EUH A;  3ABL H;  2HOE A;  2G7U A;  2RV8 A;  3IH2 A;  1VI0 A;  3VEP A;  1YJW I;  1IDY A;  1S6L A;  4EEF G;  5J6X A;  2BY3 A;  3K7A J;  4A0X A;  2M9H A;  5F6F A;  2XKO A;  5K7Z A;  4IZZ A;  2DFH A;  2IA0 A;  1P6R A;  1O3R A;  4XOP A;  3ZRG A;  4EGZ A;  1YHQ I;  1T98 A;  2F5D A;  1XN7 A;  4CSW A;  1USS A;  3DKW A;  1GUU A;  3VYS B;  1KA8 A;  1BI3 A;  5J1U A;  3TP0 A;  4UY8 I;  2IGO A;  2NXN B;  1G3T A;  1WKM A;  1FYK A;  1C0W A;  2DT7 B;  4HQE A;  3J81 K;  3GTL J;  1F9N A;  2ZJQ F;  3FXR A;  4XLF A;  4C3J J;  2RQQ A;  3OV8 A;  4CYD A;  2RDP A;  3G2B A;  4JK1 X;  1WI9 A;  2N8G A;  4V2F A;  4C2T A;  2PJR A;  1GVJ A;  1YIO A;  3HGG A;  2EPF A;  2LY2 A;  3I4P A;  3WTY C;  2LKP A;  4BQN A;  1U6G A;  3I53 A;  2HKO A;  3CDI A;  2ISZ A;  4XLE A;  1S7E A;  3RKW A;  3ZMS A;  2M0M A;  1E0E A;  4K2E A;  2R5Z A;  2XPW A;  3ERE D;  1OKR A;  4C3H J;  2CU7 A;  1T33 A;  2E1M B;  3HG9 A;  5LHI A;  4WCG A;  3GTG J;  3CC2 I;  1OCP A;  1H88 C;  9ANT A;  2Y0S N;  4MTE A;  1UG2 A;  2XAQ A;  5TGT A;  1XTA A;  5HOO A;  3V8J A;  3J7A Y;  1UB9 A;  2VXD A;  1FYM A;  1MNE A;  1ENH A;  3C2B A;  2ZME C;  3BJA A;  4MEY F;  3QYB A;  2E2H J;  2RVC A;  2DLL A;  2JT1 A;  2P4W A;  1EJ9 A;  3A0B C;  1YIJ I;  1GV2 A;  2QYO A;  4BXU A;  2O9L A;  2Z5U A;  2V1D A;  3L09 A;  4HEA 2;  1X1B A;  3QRF F;  3ISP A;  2PN6 A;  5JLX A;  4BXF A;  2KIU A;  1BL0 A;  2UUZ A;  3FMQ A;  2VT3 A;  4A3D J;  3BR6 A;  5CQE A;  2PMH A;  2WV0 A;  2WB1 N;  2LOO A;  3QPH A;  1IV6 A;  1L0O C;  3KYD B;  3G6E I;  1YYV A;  1F5T A;  4IHX A;  3GTK J;  2KP6 A;  4LIU A;  1HC8 A;  1VQO I;  4AIJ A;  3RTR A;  1HW1 A;  5JR3 A;  4TV7 A;  4D5F A;  2LKS A;  2VKE A;  2VUM J;  1T0F A;  3LSJ A;  4I98 B;  1LVA A;  2H6C A;  2O6G E;  1TBX A;  1E17 A;  1E3H A;  5J4Y A;  4F91 B;  2XAG A;  3OOP A;  1KQ8 A;  1RKT A;  2ZJP F;  4RB2 C;  4A6D A;  3OSG A;  3KYL A;  1QZZ A;  2NRA C;  1U9N A;  4LLG F;  4R79 A;  3GCM A;  1X1C A;  5TJJ A;  1KZH A;  4LB5 A;  1K78 A;  2EZH A;  2NOJ B;  1FOW A;  5IYC J;  1BIB A;  4BE0 A;  2H1K A;  3IP4 B;  2XF6 A;  5GAH J;  1B8I A;  4HF1 A;  2RGV A;  1MW7 A;  3PNY A;  5FRO A;  4JBA A;  3FMS A;  2FMY A;  3LFK A;  3KE2 A;  3R0J A;  3AG4 H;  3K2A A;  4L9T A;  4OOI A;  1FSH A;  2L0K A;  3GZN B;  3OOU A;  1MMN A;  4LIT A;  1MKM A;  1JT0 A;  3HUG A;  3Q3S A;  3V7S A;  1CF7 B;  4M71 A;  4NDL A;  4KNY A;  3KLN A;  4IRI A;  2CV0 A;  3TW6 A;  4BHC A;  1RES A;  2L02 A;  4HF0 A;  3ECO A;  5J8F A;  2GM4 A;  1S7O A;  4FT8 A;  1W5S A;  3F8B A;  1QHG A;  1BOB A;  5FLX Z;  2HS5 A;  1WRJ A;  3PO3 J;  2P81 A;  3FMR A;  2DFE A;  1YJ9 I;  2IGM A;  2WA0 A;  2X1E A;  1OPC A;  4F7Z A;  5J47 A;  1JJ8 C;  3OYI A;  1VQK I;  4NBQ A;  3U1K A;  1ZHF A;  1FTZ A;  5JVT A;  1ONV A;  5HLI A;  2OBP A;  2BY0 A;  3KP5 A;  2EIN H;  2L9S A;  1N77 A;  2NAZ A;  1MGT A;  1BR2 A;  2YS9 A;  2XIG A;  2FU4 A;  4IOA F;  2DQR A;  2Q2E A;  2HQN A;  3ROU A;  2K4J A;  4FE7 A;  2BW3 B;  3WOD F;  5D5W B;  3M1C A;  5LEK A;  5E17 F;  1DP7 P;  3Q5F A;  3M7G A;  3DEW A;  1RKW A;  5E1W A;  1ON2 A;  1IC8 A;  2E2J J;  1B72 A;  4BEH B;  2GOM A;  3KFW X;  1MZB A;  2MC4 A;  5JFR A;  2CG4 A;  3E0J B;  3HRM A;  5LRR A;  3DU6 A;  4A5N A;  4RDU A;  5IOZ A;  5HVQ C;  3KIO A;  4YRV A;  1X4O A;  3LSP A;  5F0H A;  2R7S A;  1MSF C;  4ESJ A;  1ZGJ A;  3S1Q J;  1HQC A;  3CCJ I;  3HEF A;  1IN6 A;  4C2M J;  2QVO A;  3BG5 A;  1D8J A;  5HNH A;  1FIA A;  1ZQ3 P;  2GA2 A;  4HLX A;  4PGG A;  2NVT J;  2DU9 A;  4A0Y A;  4OIP F;  1MND A;  3B6C A;  3J7A O;  5K7H A;  4DW6 A;  1Y56 A;  2EBI A;  2XSD C;  3MN2 A;  4B47 A;  3OYC A;  3IHU A;  3PQJ A;  2CS3 A;  4M3D A;  4B44 A;  1XGO A;  3I4M J;  5ILU A;  3HRT A;  5IOY A;  1FC3 A;  4BDZ A;  1BC7 C;  3V4G A;  1QVU A;  2L7K A;  5B1B H;  4KFC A;  4DOZ A;  2EZI A;  3J80 Z;  4HX7 A;  4HNV A;  1SAN A;  5F1J A;  1FJL A;  4GXO A;  3M4O J;  4UVB A;  4ZZD A;  1W5C C;  3JTG A;  2R0Q C;  1POG A;  2M45 A;  2WAQ N;  2WWY A;  4M3F A;  3RPU D;  1PUE E;  2MLK A;  1RPW A;  2C6Y A;  1VFC A;  1I6X A;  5EZH A;  1V5G A;  4A6E A;  4E7I A;  1FOY A;  4IQ4 A;  4MQ9 F;  4XRS G;  4LOC A;  3KCC A;  1IN4 A;  3ZMV A;  5E79 C;  4XRF A;  1YW7 A;  3BG6 A;  1RR8 C;  3LL7 A;  1MBE A;  2A61 A;  5HLT A;  1XDU A;  2EFQ A;  5DD8 A;  2DMQ A;  2FE3 A;  2FSW A;  3ZQI A;  2DMU A;  3ABK H;  2VLA A;  1EH7 A;  2ZBK A;  2P7C B;  1PJR A;  3HDD A;  4ANJ A;  1F4K A;  3S17 J;  1RIO H;  4W1U A;  3EUK L;  1LPQ A;  4RM2 A;  2CQX A;  1XGS A;  3KX2 A;  4A5M A;  3L1P A;  2UZK A;  2VJI A;  1KQ0 A;  4EJO A;  1LEA A;  2W25 A;  5C44 J;  2HZT A;  3EET A;  5CVI A;  3H9G A;  2HWV A;  2RKH A;  1J75 A;  5E3O A;  4MQV A;  3CCU I;  1O3T A;  1XC5 A;  3I64 A;  1SEU A;  4QWQ A;  2PI0 A;  2Q0O A;  2X85 A;  3TDU C;  1IN8 A;  4PFO A;  4BQQ A;  3TMO A;  4B3X A;  3CF2 A;  2W57 A;  2CV1 A;  4UUS B;  4XLN F;  1LJ9 A;  1U9O A;  6PAX A;  2EV6 A;  4ITV A;  4PSX A;  2Y9Z A;  3L00 A;  3AL0 C;  5J4V A;  1WGX A;  1SFU A;  2K9M A;  5TRD A;  1HSJ A;  3ABU A;  4N4N B;  5FLX K;  2NVY J;  3HZJ A;  3IAM 2;  5L3G A;  2JN6 A;  4LG3 A;  1R1T A;  4D9J A;  2FQ4 A;  1W1W E;  1U0J A;  2FNP A;  3QQA A;  2STT A;  4XKC A;  4D5C A;  4IHS A;  4IHT A;  3I55 I;  3QPT A;  2IT0 A;  3GTQ J;  4G7H F;  3TDZ C;  3PUB A;  5D4S A;  1OQY A;  2R3S A;  2STW A;  5EEA A;  1E2X A;  2KDZ A;  1YTY A;  4HOB A;  1GHC A;  1IG7 A;  4CA0 A;  5LD2 C;  2WB1 A;  1B9N A;  3W6V A;  2QBY A;  2XGD A;  3VYU B;  2D5V A;  2KT0 A;  1QPM A;  2JRT A;  4XSX F;  3TQN A;  4EVI A;  4YIR X;  3GX4 X;  2IP2 A;  3BQY A;  2KZV A;  1OFC X;  4EV0 A;  5L3E A;  4ZYD A;  1LE8 A;  2XC7 A;  4D1Q A;  3HGY A;  3BDD A;  2CUF A;  3MCZ A;  2ZSI B;  4IHW A;  1WFX A;  3I59 A;  1MBK A;  1ETW A;  1CGP A;  2HR3 A;  2EQR A;  4II3 A;  4BYY A;  3SZG A;  1XGM A;  4NQW A;  3O2P E;  5BS6 A;  3FM5 A;  1T2K A;  2QF7 A;  1ZR2 A;  2A5W A;  3GFI A;  3D1N I;  1EV7 A; 
#chains in the Genus database with same CATH homology
 3BLY A;  4N4O B;  3S3N A;  1PYV A;  5FRM A;  2WY8 Q;  4RMN A;  4NC7 A;  2JUG A;  4BS9 A;  3OYM A;  2WY7 Q;  1N75 A;  2HVQ A;  2MD0 A;  3H5R A;  2R4G A;  2ZFU A;  4XMY A;  2V1N A;  3I9V 2;  4JQF A;  4CUG A;  1N78 A;  4XNF A;  1YX3 A;  1D1A A;  2OC6 A;  3QOD A;  4OAY A;  3S3O A;  1YX5 A;  2VKD A;  3N05 A;  4ZTJ A;  2W1O A;  3OIQ A;  4CZC A;  3C2H A;  2HU9 A;  4NQW B;  2KL4 A;  2HZD A;  2ZSH B;  5JHF A;  4P1W A;  2VL8 A;  1TT0 A;  4PJM A;  3K4N A;  3PFY A;  3AKZ A;  4G6T B;  3HOT A;  4AVZ A;  2BOL A;  3K4L A;  3VYT B;  2KDO A;  2KLO A;  1D0Z A;  2JVH A;  4IKF A;  4IQJ A;  3DTE A;  5KCM A;  3OS2 A;  1D1C A;  2HVR A;  1V5F A;  2IGN A;  4XOR A;  3PL8 A;  3OWT A;  2LYC A;  1Z7L A;  4GRI A;  2X1C A;  2I8D A;  3MMY B;  5CKT A;  3U21 A;  4BU2 A;  1DP3 A;  1DGR M;  2Q1Z B;  3EUH C;  3L2W A;  1W36 D;  1WJE A;  2F5V A;  3AFH A;  1X1D A;  3OYE A;  4BJ5 C;  2CMP A;  3LSH A;  3K4M A;  2V4J C;  1FMW A;  1TZL A;  3K70 D;  1OLT A;  1S9H A;  2HNH A;  4CCK A;  4LIV A;  4CCJ A;  2VAS A;  4BUP A;  4F52 A;  5CPR B;  3DTI A;  1W36 C;  1G8X A;  4BE2 A;  2K5C A;  2XDV A;  2VQC A;  2XF7 A;  4BL0 B;  3SEZ A;  2R7V A;  3K70 C;  2QKL B;  2AQF A;  4CCN A;  1JI8 A;  2Z1D A;  4DBQ A;  2E1M C;  3OYB A;  3V42 A;  1VZ0 A;  1T95 A;  4X0G A;  4BJT A;  3K10 A;  3LSG A;  4F3Q A;  3DPL C;  4BQO A;  1WJD A;  2R7O A;  3VSL A;  1GLN A;  2UV1 A;  4E7L A;  3H5A A;  4ZDP A;  1MMA A;  2M4K A;  4NUB A;  2LC2 A;  2DOA A;  3OS0 A;  4IZZ A;  4XOP A;  3MKW B;  2WBM A;  3ZRG A;  2M3A A;  4P5O A;  3PNV A;  4CSW A;  1SFK A;  3GBG A;  3NWT A;  1MMD A;  4F93 B;  3K4B A;  3OYK A;  3K4J A;  1WJA A;  3VYS B;  4OWR B;  2KRH A;  2R7Q A;  2IGO A;  3H0D A;  2LRE A;  4EAT A;  4J00 A;  2DT7 B;  3NWS A;  2L9N A;  2WAF A;  1YE9 A;  2RQQ A;  4XLF A;  4E7K A;  3OYA A;  2RNG A;  1Y6I A;  2HVS A;  3G2B A;  3HPH A;  1J09 A;  4RM3 A;  2PJR A;  4C2T A;  3DKY A;  2LY2 A;  2Z16 A;  4BQN A;  2VKH A;  4XLE A;  2DCE A;  2LG4 A;  2M0M A;  1E0E A;  3K6G A;  3OR1 C;  3HC7 A;  2E1M B;  3HG9 A;  4AU7 A;  2KMU A;  4KT6 A;  4E6K G;  3DQV C;  2VB6 A;  3HL2 A;  2CUZ A;  3CP2 A;  5TGT A;  3K4K A;  5HOO A;  4J01 A;  3J7A Y;  2VXD A;  3MD2 A;  4ZC3 A;  1MNE A;  2HPI A;  4BJ6 C;  3EUA A;  2XF5 A;  4XL9 A;  4QPO A;  1ZEL A;  3QYB A;  3HOS A;  4KIS A;  2KQR A;  2PJR B;  3FHN A;  2F6C A;  1UEL B;  3DTK A;  1R6R A;  2E5N A;  3L2U A;  3CZ6 A;  2IS6 A;  4U87 A;  2R7R A;  4HEA 2;  1X1B A;  3ZCO A;  4NNJ A;  4BXF A;  3HXL A;  2DJI A;  2UUZ A;  3ONQ A;  4C30 A;  1EA3 A;  3OYJ A;  5CQE A;  2LOO A;  4XOT A;  2KP6 A;  3M8J A;  2E5Z A;  4LIU A;  2CW8 A;  4YEL A;  4NC8 A;  2L2O A;  3PSF A;  4AYB A;  3RTR A;  3OYF A;  1DQU A;  1LVK A;  4HSR A;  5FRN A;  2X6Y A;  2X51 A;  4F91 B;  2LH9 A;  2XAU A;  4E7S A;  2K9L A;  3KYL A;  3PJR A;  4CH7 A;  3OYN A;  1D0Y A;  4R79 A;  3HKZ A;  1X1C A;  4DBR A;  4F55 A;  2CV2 A;  2VJ5 A;  1LFP A;  3C2G A;  3OMY A;  3ZGK A;  4DJA A;  2NOJ B;  3SDB A;  2KRC A;  2HDW A;  3RQ4 A;  4BE0 A;  3OIP A;  3IP4 B;  2XF6 A;  3LSK A;  4XN0 A;  4PJN A;  5FRO A;  1MW7 A;  3IAS 2;  3PNY A;  3VYR B;  3OS1 A;  4HST A;  4OAZ A;  2HQA A;  3OOU A;  1MMN A;  5KNL A;  4LIT A;  3ZQQ A;  2JA2 A;  2CW7 A;  4PJL A;  4HG2 A;  4BGD A;  4ZDL A;  2RRE A;  2VQH A;  2CV0 A;  2P0W A;  2L5Q A;  4XR6 A;  2R7W A;  2X6W A;  2BW3 A;  2LRD A;  4MLO A;  3D5L A;  4DIQ A;  3H9Q A;  2O5R A;  1QHG A;  3OR2 C;  2R7X A;  4PUS A;  1BOB A;  2UWM A;  4XKB A;  2A6T A;  2Y0S A;  2MYS A;  2IGM A;  3SYT A;  2WA0 A;  1V5E A;  2X1E A;  4B43 A;  2WAD A;  3S8P A;  3OYI A;  4E7J A;  3BC8 A;  2ZXI A;  3LFU A;  1Z3X A;  3OL3 A;  3CJQ B;  3S93 A;  1SAU A;  2L9S A;  3HUG B;  3OYL A;  1N77 A;  1IRX A;  3DLA A;  1BR2 A;  1HA8 A;  3CMM A;  2W7N A;  4XLH A;  2VJJ A;  2X1D A;  2W82 A;  1QHH D;  2CFO A;  4CCO A;  4KIT B;  3CJR B;  3L2V A;  2V26 A;  2BW3 B;  2VJ4 A;  4F92 B;  3M1C A;  4E4H A;  4Y33 A;  2IGK A;  5LFA A;  2IS1 A;  4BEH B;  1OR7 C;  2GOM A;  2MC4 A;  3E0J B;  3W2A A;  3DU6 A;  2VQL A;  4XQF A;  2AQE A;  5HVQ C;  1WJC A;  4YRV A;  4Y3O A;  1AA7 A;  3FBN B;  1X4O A;  1WJF A;  3FKJ A;  3UR3 C;  1D0X A;  1X4P A;  2R7S A;  2R7U A;  4XON A;  4XM3 A;  4PK4 A;  2E60 A;  2Q2E B;  3L2Q A;  3QOE A;  1T0F C;  2Z2S B;  2OV7 A;  2R7T A;  2VXZ A;  3BCA A;  3LMM A;  5HNH A;  2M4G A;  4CCL A;  3MKZ A;  3OY9 A;  1LDK B;  4QPQ A;  2ZXH A;  3W3C A;  2KPM A;  2MFZ A;  2V6E A;  1MND A;  4HRI A;  2X6X A;  1UAA A;  1Y56 A;  4XKV A;  4E7H A;  4ZYA A;  4ZJZ A;  4PFP A;  4B47 A;  1Z21 A;  3OYC A;  3S32 A;  1QU3 A;  2FUG 2;  3W2V A;  2CS3 A;  3SEQ A;  4B44 A;  3H9J A;  3AL0 B;  4PJJ A;  3S3M A;  4C2U A;  4BDZ A;  3DKX A;  2L7K A;  3ZXS A;  2LY1 A;  3A4C A;  1BR1 A;  3OYH A;  4DOZ A;  3OL4 A;  4XKW A;  2QKM B;  3LSI A;  4YEJ A;  3A1Y A;  1G59 A;  2M7B A;  3VWB A;  4XLC A;  3F9K A;  2DT6 A;  3RPU D;  2VPL A;  2VIX A;  4FET A;  4XN3 A;  3DPU A;  1V5G A;  4E7I A;  1FMV A;  1P9Q C;  1Z3Y A;  3VSK A;  4IQ4 A;  2MAB A;  3DEE A;  3I3L A;  2IS4 A;  3H5N A;  3BG6 A;  2W4S A;  2DXI A;  1LKX A;  2JVG A;  3LL7 A;  1MMG A;  3E1S A;  4RLQ A;  5HLT A;  2K3P A;  4E7Z A;  2VQG A;  2VLA A;  4HNT A;  2LBF A;  1PJR A;  3RSN A;  4BAC A;  4ANJ A;  3BG7 A;  3LSM A;  1NG7 A;  4BE1 A;  4HPQ A;  3EUK L;  4RM2 A;  2V7F A;  3QYE A;  2CUJ A;  2ELJ A;  3KX2 A;  4BDY A;  2GOX B;  2IXS A;  2VJI A;  5KHD A;  1K6Y A;  3H9G A;  4XLA A;  4ZTF A;  2IS2 A;  3VDX A;  3CP8 A;  3EPZ A;  3TBI A;  4DGW B;  2W00 A;  3L2R A;  2M7A A;  3BCB A;  2V9K A;  2X85 A;  4PFO A;  3W2W A;  1WJ5 A;  1NG6 A;  4BQQ A;  2XSJ C;  3TMO A;  5HNF A;  4B3X A;  3CF2 A;  2LBF B;  1BR4 A;  4CCM A;  2HPM A;  2CV1 A;  1UG0 A;  3A2K A;  4BEH A;  4U7B A;  4ITV A;  4PSX A;  2BVL A;  4HNU A;  3MKY B;  4II2 A;  3H35 A;  3TL4 X;  3AL0 C;  4ZDO A;  2F4I A;  2K9M A;  3PSI A;  3DPT A;  4N4N B;  3IAM 2;  1X1A A;  4KJZ A;  3IUO A;  4LG3 A;  4D9J A;  1ERD A;  1X19 A;  4C9Y A;  1U0J A;  1D1B A;  2JSP A;  4XKC A;  4JOM A;  3RCO A;  4Y4R A;  2BVM A;  3PUB A;  3DWL E;  3FBI B;  3D5S C;  3HPG A;  3K4C A;  2OUM A;  3D5R C;  5CQG A;  1DGW Y;  4CA0 A;  5LD2 C;  2WB1 A;  2KHM A;  3DU5 A;  3VYU B;  3OYG A;  3ZR8 X;  4FAS D;  4IX7 A;  2KZV A;  3QYF A;  3OYD A;  2XC7 A;  4B48 A;  4D1Q A;  2CH0 A;  3FDY A;  2ZSI B;  4RLF A;  3CES A;  1WFX A;  4PSW A;  3UNG C;  4H4K C;  3KEY A;  4II3 A;  2WAQ A;  3PNT A;  3SZG A;  1WJB A;  2PMZ A;  2WAE A;  2A5W A;  1KON A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...