5KHDA

Structure of 1.75 a bldd c-domain-c-di-gmp complex
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
72
structure length
72
Chain Sequence
KLVLDLERLAHVPQEKAGPLQRYAATIQSQRGDYNGKVLSIRQDDLRTLAVIYDQSPSVLTEQLISWGVLDA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords DNA-binding protein
publication title Tetrameric c-di-GMP mediates effective transcription factor dimerization to control Streptomyces development.
pubmed doi rcsb
source organism Streptomyces venezuelae
molecule tags Dna binding protein
total genus 29
structure length 72
sequence length 72
chains with identical sequence R
ec nomenclature
pdb deposition date 2016-06-14
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.1930 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Arc Repressor Mutant, subunit A 5khdA00
4OAYA 4OAZA 5KHDA 2MC4A
chains in the Genus database with same CATH superfamily
1AOYA 4M6YA 4D7NA 2QEXI 1OCTC 2P7VB 4DBQA 1U78A 3J7ZI 3H92A 1IGNA 2DDBA 1OPCA 4MIMA 1XCVA 2JRMA 5LD2C 2DOEA 5BQTA 2M0MA 5HNFA 2VBWA 3BR3A 4H4KC 3KP7A 2NXNB 1SMYF 3G1MA 3KYDB 4WXCA 4EJVA 1TC3C 2CQ7A 4P9UA 2HOTA 2G0EA 1P2FA 3K6GA 3F8FA 5D5WB 3ONQA 3BTLA 2DJIA 3N97A 1MIJA 4XM3A 6PAXA 2HXIA 3TBIA 2MABA 3DU5A 1WHUA 2FMYA 4BE2A 3EQLF 4E7SA 4HEA2 4JOMA 5ICFA 2L9NA 2KRCA 5D8LB 4BH9A 3OS1A 3JRDA 4IJAA 2Y0SA 4A0ZA 4HW0A 1A6QA 5IP7J 1U3EM 2DW4A 2BY3A 1IN8A 3BTJA 4LB6B 5E8IA 1U8BA 4B4CA 3DPTA 2FOWA 2PN6A 1YTYA 2XGCA 2RQQA 3HBLA 3BT9A 3EUAA 2VOOA 3TW7A 4UB8C 4XKCA 1JUSA 3DKYA 4BDYA 3L2QA 3T1BA 2OTJI 2F4OB 4D9JA 3S3NA 2KIMA 2IS6A 4HSTA 1BI1A 4I99C 4CCMA 4FX4A 2IPQX 4BJ5C 2WC2A 4E6KG 1BI2A 4EATA 3BG3A 1SD7A 2NNNA 4ZYHA 4BJ6C 1IW7F 3TP3A 5LHIA 3SQNA 3H9QA 2ZFWA 4E7HA 3IH4A 1QA6A 4WCGA 2TCTA 1YX5A 3BZKA 3DP7A 3M9AA 1ZG3A 4U0VA 3GCMA 4PJNA 3H3VK 2F5VA 3HRSA 1XS9A 3O3KA 2DMQA 3FKJA 4IF4A 3MZHA 1XGNA 3HUGB 3K4CA 4UUTA 3MKLA 2EV0A 1R7JA 4AYBA 3CCQI 3RI4A 5HS8A 1SD4A 4XLNF 2DA2A 3Q0WA 2FNAA 4V2GA 4MFEA 1XDSA 4OMYA 2KZVA 2E34A 1ITYA 5JHFA 1U6GA 2CV2A 2ZMEB 1LDDA 1KU2A 1USSA 4I98B 3GTKJ 2HWVA 4H0EA 3LSGA 3ABTA 2VPLA 2DK8A 3MQ0A 1J75A 1HKTA 2FNPA 2HOAA 1FT9A 3ZGKA 5GAEJ 3L2CA 2IP2A 2VL8A 3KZIC 4UVBA 3IWZA 4HA8A 2BY0A 5FLXZ 5E18F 1IRGA 3MD2A 4IPAA 1W7PA 3CMAI 3K70D 1RPWA 2VUMJ 2R92J 1RKWA 4B09A 2DA4A 2C6YA 3N05A 2PMUA 3H35A 2NAZA 2UXXA 3PL8A 4GYIA 1K78A 2LBFA 3S1MJ 5IYCJ 4DGWB 3S14J 3WE2A 1XPXA 3E6DA 4L9NA 3ZQIA 2CFOA 5M5WJ 2GA1A 5EEHA 1YJNI 3FHZA 2VXZA 4HDUA 2GLOA 5C4JJ 3VEPA 1MJ9A 1ZGJA 3FISA 4PGGA 5KCMA 1XD7A 2ZKZA 1O7FA 4HV6A 5HS7A 3K9TA 5JFRA 3W3CA 1VI0A 3KP3A 4KUMA 3IRQA 4CGZA 5L3FA 3H9GA 2XRLA 2CV1A 1BIBA 3A0HC 2RNJA 2GXGA 1HSJA 4IQ4A 1G4DA 3PQJA 2E5ZA 2MG4A 4FHTA 5DCMA 4YELA 1POGA 4IOAF 4X6AJ 3F9KA 5CVRA 3T8TA 5F1JA 4RM2A 1AKHA 4F52A 4KN7X 1XDUA 1X2MA 4GCVA 3HZJA 4FX0A 2LC2A 2MC4A 3PQKA 1ON2A 1YG2A 4BEHA 1XSXA 1H88C 3SDGA 2VQGA 1OCRH 1AHDP 1QO0D 4DQ2A 3IH2A 2B7EA 1QBJA 4IKFA 2M1BA 1Z21A 1ZARA 1ZLJA 1X4PA 5EZHA 3K10A 2RDPA 3TOBA 1FIPA 2CH0A 3LSRA 3B02A 4N4OB 2KPMA 1E3HA 4P55A 1DP7P 5J4VA 2JTVA 5EGOA 2R5ZA 1XSDA 1IF1A 4LG0A 2IGNA 3DPLC 2L9VA 2KFDA 1S29A 1IUFA 4EMSA 1D1AA 4K2EA 2HDWA 2Y69H 4NBQA 2CQKA 3FHNA 1QZEA 2LF7A 1ODDA 1FZPB 4NHJA 1VQ7I 2MLGA 2DYSH 3HM5A 2A07F 3BR6A 1R23A 4UUSB 3GTLJ 4OWRB 4ZC3A 4M3EA 4HLXA 4CZCA 1GT0C 2J5PA 4IHXA 4ZZDA 1X1AA 2JA8J 2FJ1A 2CWEA 4HNTA 1MKMA 1SEUA 2R4GA 2EIJH 5LRSA 1D8JA 2MH2A 2O5RA 3K4BA 3TQNA 1Y8QB 4CO8A 4DW6A 3PFYA 4ZYAA 1YS7A 2QLZA 3HOXJ 1QRYA 2E1MC 4ENKA 2HNHA 1VQ9I 2IXSA 1UELB 4QIWN 3CUQC 3HTSB 2PX9A 4UB6C 4OAYA 5J6XA 3HHGA 1VQOI 2G9WA 2NOJB 1B72A 3TEDA 5B5EC 2NS7A 1KQ9A 4GFBA 3QODA 1ERDA 2H8RA 2GM4A 2QCOA 3E3VA 4DNCA 4YG2F 3OYCA 5CQEA 3UNGC 1T95A 3SDBA 1U8RA 2Z5UA 1E3OC 4PFPA 1ETQA 2MLKA 2PEXA 2EZIA 2BVLA 3K0LA 2OJED 3BG6A 4KA4A 4U88A 4W97A 5L3EA 1LEAA 2IBDA 5DD8A 4EVIA 3BJAA 2BXYA 3I54A 2HOSA 4ZYGA 4QWQA 3U9GA 4KNYA 1YQAA 2IW5A 5EDNA 5FO5A 2OPTA 1USTA 1YW7A 1MMGA 2DQLA 2Z99A 4Z2YA 1Z6TA 1VQ8I 5BMZA 4HDVA 2OCCH 4F92B 4RB3C 1QQIA 3SXYA 5B3SH 1C0WA 1HKQA 4J19A 1L3LA 2XGEA 2E1NA 1QPIA 2O6GE 4BBSJ 1I6XA 1EV7A 1GV5A 3AG3H 2GIVA 2F5EA 1LVAA 2OC6A 2XPWA 3HRUA 3IL2A 5IPAA 3CCJI 3HL2A 4M3GA 2LVSA 2XPUA 5FB2A 2LY9A 4N4NB 2VJIA 4N0BA 3BPVA 3QQAA 1UHMA 5IP6A 3K4NA 3KYLA 2Q1ZB 2OU2A 2VBZA 2E7XA 1HCRA 1WI9A 1X1PA 3K70C 3OS0A 3ISPA 2CYYA 4YFKF 4CICA 1P7JA 4I0AA 1R5ID 2NVQJ 2L2OA 1FOYA 1P4AA 2KT0A 5GTIC 1TQPA 5F0FA 3LA7A 1LB2A 2IA2A 5M3FJ 3MAJA 2KIQA 4L18B 1FC3A 1ZTRA 3LSIA 2NVUB 5GPAA 3GUDA 5IT3A 4U7DA 4G7ZF 3K7AJ 2H27A 5HOOA 1JKRC 2IVMA 2NOGA 2R7DA 1OQYA 5D5XB 1VQ4I 4Y3OA 3Q3SA 3W2VA 2A3SA 3LSKA 1QVUA 2ECCA 4D5CA 3LA2A 3AL0C 5J3LA 2L9RA 3F6VA 4A5NA 1Z67A 5KHDA 3K69A 2QA4I 4KIBA 1A6IA 4XK4A 2K3PA 2D45A 2MYSA 2WY8Q 2WV0A 1RRJA 1HW5A 2DYRH 2EWNA 2RAEA 4XBFA 1X3UA 2O03A 1ZG5A 2WADA 4XKVA 1D1CA 3A01A 3J7AY 4Y7NJ 1U9NA 1TTYA 3GBGA 5ILUA 2RV8A 3FMRA 5HLTA 3CDLA 4XICA 1IN7A 2XDVA 1P4XA 3D5LA 3VSLA 1K6YA 2W48A 2IJLA 4FE4A 2DMNA 5LHHA 2FQ4A 3NQOA 5LHGA 5IT9Z 2PJRA 3DCFA 4XLFA 1WWXA 3C2GA 3PSIA 1QU3A 4XLHA 2CUZA 4QTRA 4E7IA 2B9SA 2R7XA 3PIPF 2DFFA 3B6CA 4BQOA 1XMXA 1R71A 4B1RA 1SFXA 2CUEA 4RAZA 4MQVA 3DKWA 4Y33A 3F23A 3F8MA 3KETA 1MSEC 4P5OA 4PJLA 3PNTA 3K1MA 3IRRA 1ON1A 4KICA 5EG0B 4AWXB 2A61A 2RN7A 3HKZA 4IVNA 4ESBA 3GTPJ 5FLXK 3A4CA 4XOPA 2NRAC 1ZLKA 5LEKA 3C2BA 4LMYA 2MC3A 2HVSA 1YI2I 1YFHA 3FK7A 4HX8A 4Y13A 1YRNA 2VJ5A 2O8XA 3E5UA 4NB5A 5F27A 3DWLE 3JRBA 4B8XA 1LE8A 2WAQN 4HNUA 1VQLI 2L54A 2WV1A 3CP8A 1TT5B 4KN4X 2LD5A 4JQFA 4BHBA 2ZC2A 4I7HA 2O61A 3WU0A 1WJ5A 1JHHA 1YW9A 4KT6A 4CSWA 2KDOA 5C3EJ 1T0FA 3E5QA 3HYIA 2VQLA 4C3HJ 2MH9A 3VB2A 3S1RJ 5FFZA 4DJAA 1V5GA 1YJ9I 1BOAA 2CG4A 3H36A 2FEZA 2IAIA 5K7HA 3VYRB 4BUPA 3M8JA 3PUFA 1P7IA 1BW6A 2R7FA 1BC8C 3BJOA 2MW8A 2K4JA 5CVJA 2LYCA 3CCVI 4IHTA 3FX3A 2X1CA 4L5EA 2QGUA 1H9TA 2D2WA 4DYRA 2ACJA 2M9HA 2FQ3A 2MD0A 3EUHC 2E1CA 3O8GA 1OISA 2R7RA 4P1WA 1JKPC 3LMMA 2DTZA 3Q5FA 5D8KB 2DJNA 2YPRA 1Y0NA 3GW2A 3FBIB 1S72I 1YYVA 4ITVA 1R5HA 4A3DJ 2VT2A 1B8IA 2F6CA 2MA3A 5TJJA 3V4GA 3OS2A 1WRJA 1WSUA 3MCZA 3PNYA 2R0QC 4IZZA 1X3WB 3F3XA 3J80K 1O7LA 2K9SA 4PDKA 2LSOA 2F5FA 3ROUA 4ETSA 3HRTA 4F91B 1TW3A 4HSRA 1QVTA 2EZHA 4LB5A 1R36A 1JUPA 1FMVA 4YEJA 5GP9A 2OD5A 3DQVC 2JPBA 2E2JJ 3TGNA 2D5VA 4ZJZA 1BM9A 1STZA 3LSMA 3RZDJ 3EYIA 3S2WA 5IYDJ 1R49A 1I27A 1TQIA 1IDZA 3EPZA 3QU3A 4Q48A 5GPCA 1E17A 5L3DA 3H0GJ 3MMYB 2LH9A 5CVVA 4ABZA 4QPQA 3W6JB 3MFKA 2LDUA 2STTA 3U1DA 2NVYJ 1T2KA 2EJRA 2K85A 2Y31A 1XGSA 5ICGA 3LWFA 1QNTA 2CSOA 2FUG2 4M6XA 1U5TB 2K86A 3HSFA 5IY5H 4A3MJ 1MNMC 2H09A 5FKLA 1BBYA 4C3JJ 2LTPA 4RAGA 3CCYA 2VONA 2L02A 1S7AA 1LNWA 3M7GA 3FXLA 5DM7F 3Q9SA 3BR0A 5GADJ 4F93B 5E8GA 1HOMA 3CCRI 4OIPF 1GVJA 3L09A 2GXBA 3QYBA 3CTAA 3QAHA 3E6CC 4ENJA 4A3BJ 4BAYA 3PFIA 2WB1N 1XG1A 2DO7A 2EZLA 4YFXF 1GVDA 2P4WA 1FBUA 2Y0MA 4B3AA 3M3YJ 1LFBA 4ZYEA 3KYCB 2K5CA 3DPUA 3BG9A 5JLXA 1PP7U 5KK1A 2JA5J 2PLYA 3JTGA 4BKXA 2BW3A 1Z05A 3JRFA 4A93J 1OR7C 1WH5A 4AC0A 4PSWA 3UR3C 1I3AA 5IOYA 1KGSA 2LY2A 4XLPF 1OJLA 3FMSA 2LR8A 1FSHA 3CCLI 1ZK8A 2YU3A 3GMEA 1V5EA 2OF7A 1PUEE 1DP3A 2V6EA 1LPQA 2COBA 1DUXC 1TWFJ 4XR6A 1YIJI 2ETHA 5AIPA 3OYNA 2E36A 2TRTA 2M3AA 3EETA 2CUFA 3L2WA 3ZXSA 1JJ6C 3FXUA 1B4AA 2QENA 3GVAA 1APLC 2IS1A 3CD6I 1O3TA 1ZGAA 4UNOA 3KLNA 4HRIA 2LMDA 2QUFA 2X6WA 5CVUA 2EK5A 3QPSA 3G1OA 3P5JA 2G7UA 1P6RA 4B48A 2Z9OA 3I9V2 4XIDA 1EH8A 2BVMA 4PGHA 3IH3A 2VPRA 4A6EA 3KEYA 4IX7A 1R9TJ 1BW5A 3VYUB 3H0DA 3MZYA 1U9OA 1JTYA 2A5WA 1I3QJ 1YLFA 4MEXF 4XORA 2EBIA 4HF2A 4CYCA 2VKHA 3I5UA 3KX2A 5CPRB 1FOXA 5FKOA 1Z91A 2ZMEC 3CMYA 4E70A 1HXDA 1TL8A 3PO3J 4Q5SF 2VXDA 2ICWG 4FCYA 1FX7A 2VLAA 4GO1A 1UFMA 5BS6A 3A0BC 4YRVA 3FM3A 3T8RA 2OTLI 4BQAA 3KZZA 1MDMA 2VIXA 3F8CA 1QPMA 1MH4A 3S17J 5DDGA 4A3LJ 1KU7A 1R4MB 4JP0A 2QF7A 3SZPA 5E3LA 1O3RA 1BI3A 3RDIA 1Y1WJ 1YIOA 2DAOA 3ULQB 2I8DA 1MW7A 2CU7A 3LAPA 4E7LA 4XOTA 5J1UA 1T56A 4FQGA 2LY1A 3J7YJ 4HZFA 2P0WA 3GLXA 2NVTJ 2PG4A 1J09A 2K40A 3B6AA 3E0JB 4FE7A 4A3FJ 1XN7A 5ED4A 2NS8A 3BR5A 1UZCA 4MTEA 1NK3P 2DTRA 3R60A 2DI3A 2O7OA 3TMOA 3R4KA 1I39A 3DTIA 4A3JJ 3J7AO 1HW1A 4Q47A 4LK0F 2GOMA 4HYEA 4XRFA 5GAGJ 5H2FC 2ME0A 1RESA 5ICEA 4UY8I 5FRMA 3CC4I 3EYYA 2O0YA 4CUGA 2W4SA 1RR8C 2KL4A 2K4BA 2V1DA 2HVQA 4UXNA 3V7SA 1Y1VJ 2JSPA 1YO5C 3F8NA 4ENMA 2KLOA 2Q2EB 2JMWA 2CO5A 1N25A 1T38A 3ZQ7A 2DMUA 1QHGA 2QSHX 1CF7A 1SFUA 2R7OA 3G2BA 3GEZA 3WU1B 1ETKA 1IZ1A 1ONVA 1TW2A 2HR3A 4ZZLA 1DQUA 4II2A 4A12A 1NK2P 3R61A 2A05A 3OYFA 4BHCA 3OYMA 4JX6A 3HG9A 5TRDA 4IOCF 5LFAA 2KRHA 4XRSA 1VTNC 4RLFA 2WBMA 3K2ZA 4WF2A 2W57A 2HKXA 1ZAOA 1X1CA 4AM3A 1OCCH 3M4OJ 3AFHA 2UWMA 1DGRM 4RGUA 3MEXA 1KYWA 4Z6YA 3ZQGA 5B1BH 2UUZA 4NNJA 4RDUA 1A35A 3PIOF 2R5YA 3QOPA 1Q1VA 3LSTA 5HNHA 4A3IJ 4Y15A 3FWEA 3R0JA 3WGGA 1LFUP 1SVLA 1J7KA 2L7FP 4M9XA 1REPC 4U87A 5AIQA 5DV5A 2WAFA 2JA7J 4HF0A 2LLKA 2L9SA 3K4LA 3SZTA 3PO2J 4F3QA 2A6TA 4EM2A 2H8WA 2F4MB 2V9PA 3AG4H 3K1PA 2O8KA 5B66C 3G4SI 2W24A 1W5TA 1Z77A 1VF9A 3DBHB 4DOZA 1HBXG 1Y8RB 3HSRA 4G12A 2LKSA 1O3QA 5AONA 2EIKH 3ZMSA 1FY7A 3HOUJ 2ZSIB 2EIMH 3RKQA 1Y6IA 2K02A 2AO9A 1JHFA 2JVGA 4XN3A 4V2FA 3RKXA 2YX7A 4OIOF 1HSTA 3QPTA 2NVXJ 2ZBKA 4AVPA 1M1EB 1B9NA 2RGVA 1B1BA 2VOPA 1W36C 2X6OA 2EA2A 1ZH5A 2DODA 1WPKA 1WJFA 4L9VA 2VB6A 3HOWJ 3IUOA 4ZYDA 4M74A 1BJAA 1IN6A 4WX9A 3GTOJ 3F6OA 4ZDLA 2CS3A 2HTSA 3VOEA 5GTHC 1RIOH 2EB7A 3QU6A 2I5UA 2XASA 2B63J 4QPOA 2V79A 3G71I 2Z3YA 1U0JA 4BE0A 2HGCA 3K4KA 2OBPA 1PVEA 2CFXA 1WFXA 4C2TA 3D0SA 2IGOA 3KE2A 1F36A 2A68F 2Z2SB 4DYCA 2ID3A 2DA1A 4M3FA 2DPUA 2A6EF 1WJAA 3NEUA 4JK1X 4XKBA 4P9FA 3P9KA 2Y9YA 2Z33A 4EJWA 4C2MJ 2DK5A 3ERMA 2E71A 2GWRA 3WE3A 4BYYA 4HX4A 2LKPA 5HLGA 1ZKGA 4RM3A 5E79C 1LQ1A 1SFOJ 3ML6A 2OZUA 2MGQA 3IP4B 1O3SA 2Y0SN 1DPUA 2DBBA 1TLHB 2P8TA 3ABUA 1MMNA 4BY1J 1T98A 1J0RA 2YR2A 3ECHA 5CYVA 1ZR4A 5KNLA 2BXZA 4EM1A 1FOKA 1G59A 3R0AA 1MZBA 4LJZF 1OMIA 2XAGA 5L3BA 3GFJA 4KIFA 4I76A 4M3BA 3CLQA 1S9HA 3ZMTA 3RZOJ 1IJWC 2FBIA 4KITB 1T33A 2JUCA 3N4MA 5DTDA 2X1DA 4RGRA 3FDYA 3TO9A 1S6LA 3G73A 2XROA 3WTXC 3HUGA 2VN2A 1ZELA 3CMMA 3V7RA 1F1ZA 3BG5A 4A2UA 3JRHA 2M8EA 1IXSB 2V6CA 1B9MA 1DDNA 3U2RA 4WXDA 3VYSB 2JJ7A 3IAM2 4P96A 1WVRA 2X0LA 4EJTA 1TBXA 3LSHA 2BY1A 2YUSA 3G3ZA 2L01A 2HYJA 4CCOA 4UVCA 2XB0X 3SEZA 5DUIA 5FFXA 2AXTC 1JXSA 3OR1C 2GZWA 3HOZJ 3ESWB 4KFCA 1UHWA 3CF2A 1DU6A 2O3FA 1MD0A 1KA8A 1Y56A 4CCKA 1NTCA 4CCNA 1SC7A 4MLOA 1JGGA 4U7BA 4OIQF 3E5XA 4ZTJA 2K7LA 3HB9A 4A5MA 4LLGF 3OYHA 3I4NJ 2Q0OA 1FP1D 4EJUA 2ZFUA 2JQ7A 1JGSA 3V7CA 4AVZA 9ANTA 2G7HA 2BEOA 3QYEA 4KISA 4I09A 2F2EA 4R1HA 3ZMVA 2EQRA 2XKPA 1ZRDA 3C18A 2DA5A 2FE3A 3ABLH 1FTTA 2HZDA 2W00A 1S7EA 4PJMA 4NDLA 2V1UA 3FMQA 2XAJA 1XSVA 3OIOA 2ELHA 2LOOA 2HEOA 1OYYA 4ZDOA 2X1EA 4Y4RA 4M3DA 4G8XA 4HQMA 3GXOA 2H1LA 3SZGA 4YFNF 4NQWB 1PYVA 3RIRA 2EV6A 3D5SC 3QP6A 1WKMA 1LFPA 1VNDA 5K7FA 1CQTA 1NG7A 4WK8F 5HLIA 3HHHA 2DXIA 1X1BA 2DFHA 2J5OA 3LA3A 4A0XA 5E1WA 2VBYA 5FD5A 1D3YA 1V3FA 2JN6A 4W1UA 2P5LC 3C3WA 3JRGA 2ZXIA 2W85A 1FYMA 3C2HA 2P5VA 5L3GA 1JKQC 3DKXA 3OYGA 2XF6A 2X6XA 3CDHA 2HPIA 4A69C 3W6VA 2K9MA 3I58A 5FLVA 4N9IA 1ZG1A 1Q1HA 2MFZA 2HXOA 4HPQA 5M5XJ 2VQHA 4OIRF 5D4SA 3LFKA 1HQCA 1A31A 1MJAA 1MMSA 1BR2A 3GF2A 2OCEA 3TL4X 1PUFB 1W0TA 4EQQA 3SJMA 1X4OA 1Z7LA 3HPGA 1CGPA 2EZKA 1VQ5I 2V9KA 1OCZH 3K1NA 4HBLA 1F4KA 2WB1A 4LIUA 3JAMZ 4UV8A 3HPHA 5ILVA 3IC7A 2HYFA 3GYHX 4IEJA 3HOTA 2ELJA 1LDKB 2R93J 1BIAA 2IGMA 2ESHA 2L7MP 1YS6A 3ASOH 3F8BA 4L0ZB 2K9NA 4F7ZA 3ABKH 3VSKA 4UUSA 4ZDPA 2XRNA 3OYJA 3WTYC 2FBKA 2M5WA 4IQJA 5K7ZA 2CQXA 3RJPA 2R3SA 5JI6A 2ESNA 1E2XA 4LITA 3I59A 4HV5A 2JZYA 2XAHA 4I02A 4MTDA 2Q8KA 1VQPI 1TP4A 1SFKA 1T8IA 2CW0F 1UHSA 1XGOA 3IKVA 4IL6C 1JE8A 2HPMA 2QBYA 4OINF 3WU2C 4ZH4F 2DFIA 3COAC 5DS9A 1ZRFA 3RPUA 1RZ4A 1OKRA 1ENHA 2OQRA 4I2OA 1X1DA 4M71A 3QPLA 3LQRA 1K4TA 2GXAA 3CDIA 2DFEA 3I4MJ 2WTEA 2IEKA 4EM0B 1FJLA 3TO7A 1FLIA 2KQRA 5A2QZ 1FYKA 1I5ZA 4M6VA 5DUKA 5HLHA 4HG2A 4AD9A 3GTGJ 4G6TB 5B1AH 5E1XA 3JR9A 1NH3A 1KQ0A 1I50J 2Y2ZA 4D7MA 3ZMZA 2EILH 3OYBA 1MBFA 3TW6A 3GX4X 1TNSA 1Z0XA 3DEUA 4LD5A 3HOYJ 3S2DJ 1LVKA 4BHPA 2M7BA 2CV0A 1K83J 3ASNH 2R7ZJ 3I56I 3O6BB 2DU9A 2IS2A 4OOIA 2Z16A 3BZCA 2ZXJA 2DCEA 5KVRA 4OMZA 3W6KB 2JPCA 4IRHA 5EF6A 5K5QA 2WWYA 3LFUA 2KISA 4L0YB 5TGTA 3ZMUA 2M30A 4YIIA 1UJ8A 2VT3A 4BU2A 3CQZJ 1FNNA 2DMPA 2L0KA 2RVCA 3O8HA 3PJRA 5J1RA 1U5TC 4BJTA 3D1NI 3CUQA 1XTAA 2IRFG 2EFPA 3S3MA 2FD5A 3H5RA 3A03A 3KEOA 2E2HJ 2ZXWH 4EGYA 1OCPA 1N75A 1X58A 2R7WA 1H9GA 1W4MA 2VJJA 3QP5A 5H20A 2IGKA 5LGTA 3OY9A 2IA1A 4GXOA 4C3IJ 5FD6A 2QZ8A 1N78A 4BGDA 3LSPA 1AU7A 1J2XA 4HF1A 2KP6A 2PMZN 2MBFA 1V54H 2M87A 1GUUA 3HOSA 4ON0A 4ENNA 4E7JA 2FOKA 4PUSA 3CO6C 1ZQ3P 3CZ6A 5HODA 1SD6A 2LK2A 3ZCOA 3I0TA 4KMFA 5D6FA 2Y48A 3HSEA 3GFIA 2CW8A 1ZR2A 4LIVA 2L4MA 2ZJRF 2DDAA 2E35A 4KMUX 3KP6A 5IOZA 2W84A 3BDDA 4BQNA 1IXCA 5IYBJ 4G6QA 4RA2A 3MKZA 1OYIA 4JX4A 5CVIA 3EDPA 3IAS2 2JA6J 1MBJA 4R79A 3K4JA 2AHQA 2KJBA 4IRIA 1X3ZB 1KONA 1EH6A 3HIFA 1NG6A 3K4MA 3P9CA 1XX5A 1Z3XA 2B0LA 2K9LA 4HNVA 2F5DA 4WWCA 5FLMJ 2GA2A 2M45A 1JJ8C 3S32A 3BPXA 2R7SA 3BWGA 3CJTB 1XCBA 1T6SA 2GAUA 4X0GA 2RNGA 1W7PB 4PSXA 3BQYA 4RMNA 1IC8A 5J4YA 1VQ6I 3BOQA 2CQNA 1SAXA 2X48A 3E6BA 1AWCA 2N8GA 3PUBA 1HDDC 1K78B 4PCQA 2LBFB 1UG0A 3VYTB 4HOBA 2HQAA 3HJEA 2EFQA 5M3MJ 4KYWA 1FPQA 2PBIA 4IHSA 1P4WA 5FROA 3MWMA 4XLEA 4HLYA 1TT0A 3OR2C 2YSRA 5HDNA 5F0CA 3OOPA 3H3UA 4BXUA 4ESFA 1WH7A 4G7HF 5J8CA 3M8FA 4LFUA 4O3MA 3FXOA 2DA6A 2F5CA 4S04A 3H9JA 3RTRA 2FSWA 2GOXB 2FX0A 3LNQA 3BG7A 2FBHA 2DPDA 2PI0A 2P6SA 4WXHA 3OYAA 5EG0A 1A36A 3ZMDA 2WA0A 3OYDA 3NRVA 4LG3A 4RLQA 2VKDA 1SANA 5DCMB 3T5XA 1W36D 2H6BA 2ISZA 2W82A 2L4AA 1AKHB 2XB5A 5DM6F 2A69F 4O5VA 4MGRA 1MH3A 4XRSG 2VE8A 3GFLA 4A3GJ 4I01A 2M34A 4BEHB 5JVGF 4A3KJ 2K3FA 3C1DA 5BPIA 4J00A 1MBHA 2VODA 1FSEA 1T08B 5KAFC 1ULYA 4DBRA 1EJ9A 2ZSHB 2QM3A 3RQ4A 4MO7A 1HF0A 1R1VA 1YOVB 2STWA 3S15J 4CCJA 3L1PA 2HI3A 4GGGA 1EKEA 2KHMA 3BQZA 5D6EA 4C2UA 3HKZN 3ZN0A 5FJ8J 3HXLA 3H5NA 5EGOB 2R5ZB 3L2VA 2XGXA 4LG0B 4PZJA 1FBSA 1G3WA 1VZ0A 2GQQA 3CJRB 1TWGJ 1TWAJ 1R00A 3HDDA 2M4KA 4BBRJ 1VQMI 2TDXA 3I64A 3A02A 1WZ2A 3DLAA 4XSXF 3ABMH 2JWTA 5LRRA 4U0YA 3E97A 1NHAA 3G6EI 1B59A 4JBAA 3L2UA 3A1YA 4O6JA 4A6DA 3C7JA 1EF4A 1J5YA 2LNBA 4BE1A 3OYKA 2AXLA 3CJQB 3WTZA 3J81Z 1SAUA 2XGDA 1QZYA 1EH7A 2H94A 3SHFA 1FEXA 2DLLA 2X51A 4Q4ZF 4PFOA 1RUNA 4QLCU 1IRFA 1F43A 4LGWA 3KIOA 5ICCA 1LJ9A 1LUJB 1WJEA 4U0WA 4NC7A 4KJZA 2KZGA 4MHGA 3TO6A 3FF5A 1DPRA 4HAMA 5GAHJ 3OYIA 2XAFA 5IT9K 4GYGA 2YX4A 3WG7H 2VC1A 4FISA 1YHQI 3JAMK 1S7OA 1WI3A 1O57A 1JI8A 3RKYA 1U2WA 2E19A 1B72B 2R7TA 5H6QA 2ME6A 4ASNA 1X2NA 5HDGA 4QSHA 3GFMA 2BOLA 3VPRA 2HFHA 1Z9CA 1XMAA 3CF5F 3KZYA 3RYPA 2LREA 3GZNB 3DTEA 1V5FA 4C9YA 2VASA 1I1SA 5TISC 2EINH 3HGYA 4FETA 1RI7A 2EV5A 4RAYA 2XIGA 5L3CA 4UHTA 2UZKA 4NUBA 4E7KA 2BHYA 2BZTA 1L0OC 3LL7A 4S05A 1LDJA 4AIJA 1FWZA 2BBYA 3S16J 1G3SA 1P9QC 2WY7Q 1HDPA 1I1GA 4V19K 3EUHA 4MFDA 3KFWX 5HDKA 4D0PA 5JLWA 2XUBA 4BXFA 4Y52J 3M8EA 3BY6A 3PNVA 1G6NA 5E1ZB 4FTHA 3WGIA 1R22A 1Z1DA 2V9VA 4BQQA 2UV1A 3SFIA 2P5KA 3CCSI 3ELKA 5FKKA 2XAQA 3I3LA 1N77A 1ETOA 4XLCA 2F48A 1W1WE 5A2QK 1U5TA 1YE9A 1EA3A 1KU9A 2FU4A 2JA2A 2QQBA 2RC4A 4CA0A 2MSYA 2HS5A 3U21A 1V4RA 3OSFA 3JW4A 3RCOA 2O9LA 3BR2A 3K2AA 5EEAA 1VFCA 3DTKA 1UMQA 1S3JA 4MEYF 3ZQHA 4L9JA 3S3OA 4KIGA 1RNLA 2EFOA 2Y9ZA 2NS0A 1K6OA 1HW2A 1ZYRF 3GO5A 1IO2A 2ADUA 3DBLB 1AA7A 4TV7A 3MZ8A 4DIQA 2XV4S 1GXPA 2X85A 1IV6A 2E2IJ 3MN2A 2LKXA 3CJNA 3V8JA 4N9HA 3ZOBA 3NAUA 2FXAA 1JT0A 4EV0A 5DYMA 3OIQA 2MD5A 3TOAA 1G8XA 2PMHA 1FYLA 1RR7A 2V7FA 2QSGX 1TWHJ 3H1CA 1HA8A 2OV7A 4BACA 3I53A 2DT7B 2KDZA 1ZGWA 2BE5F 5J1YA 3DV8A 5CKTA 2QQAA 5FKNA 4RS8A 4AIDA 3CCMI 4LLNA 1TZLA 1WJDA 1ETXA 4G94A 1J59A 1XC5A 4ZTFA 2HDDA 2QWWA 3ZP5A 2LFBA 2VKEA 3P9IA 4EGZA 3KPHA 5EZGA 4IRGA 3JSPA 1XMKA 1BOBA 2QKLB 1ETYA 1BR1A 2X6YA 2XKOA 3A01B 4IO9F 3WODF 3VODA 3GZ5A 3DLLF 3S93A 5LEJA 2AQFA 3Q0UA 2ZXHA 3RYRA 3OWTA 3QWLA 1SVOA 1JTXA 4DZPA 2D1HA 2XSDC 2E60A 1KZHA 2PJRB 2OZ6A 2DQRA 3QYFA 3L9FA 3GWZA 4RGXA 1ZREA 1MBEA 1T0FC 2VI6A 4IHYA 1F9NA 4CHUA 3JRAA 3ZN1A 2L7KA 3GTQJ 1W0UA 1MGTA 2K9QA 1BI0A 3AAFA 3DF8A 2IS4A 3J80Z 3CMEI 1FP2A 2QYOA 1VQKI 3SYTA 2RKHA 1SVMA 3KLOA 4M9ZA 2WAQA 4RB2C 5F1RA 2XAUA 1UG2A 3MKYB 4X1EA 4CZZA 1OR7A 3LAJA 1GLNA 2L3DA 4PK4A 1JKOC 1PP8F 1FBQA 1MJBA 2WAEA 4XNFA 3I59B 1MMAA 1K4SA 2LRDA 2I10A 3P7NA 3OSGA 1B6AA 3PSFA 3IWFA 2X4HA 3LQQA 2V26A 1YRNB 4PJJA 5F6FA 3OYEA 1D5YA 3S2HJ 2CJJA 1F5TA 4IHWA 4CXFA 2ZJQF 2OA4A 3OYLA 2GBYA 2QBYB 2JUGA 1XGMA 1LE8B 5CQGA 3RPQA 5E3NA 4GRIA 2EA4A 1ACIA 3ZQCA 1R58A 1YW8A 2CMPA 3ECOA 3FZVA 4RGSA 5M5YJ 2A6HF 3TKYA 3LSJA 2H1KA 1KU3A 2D1VA 3KEQA 3NWSA 3RSNA 3VDXA 3KP2A 4BL0B 1HLVA 1IN4A 3BP8A 5JHUA 1WJBA 1TWCJ 1Y39A 3EUKL 5F08A 1J9IA 2DOFA 2FF4A 4J01A 4PJ0C 2H6CA 4RBOA 2BHZA 2DT5A 2L5QA 1UCRA 2FA5A 4XRMA 1OLTA 2DMTA 4RAFA 2FRHA 1QGPA 2ZMEA 5ILSA 5EEGA 3AG1H 1OYWA 3BZ6A 4XN0A 2W7NA 2ZO4A 1MMDA 1TNTA 4D5FA 2Q2EA 4JYKA 2LP0A 4UV9A 3ZR8X 1UAAA 2ZNZA 4AYBN 3O2PE 3CC7I 1W7PD 2DN0A 3JREA 4RB0A 5LLQA 5F64A 2HQRA 4M72A 3FIWA 4R8HA 4XMYA 4XLAA 3BTCA 4B43A 3IHUA 2E1MB 1S5LC 2PMZA 1B8IB 1GHCA 1DU0A 1V55H 2Y75A 2HZTA 3CUQB 2CUJA 2KRFA 2VBXA 5E17F 3OL3A 4XQFA 1MBGA 2HTJA 3T0YA 3GLLA 3FKIJ 1QZZA 5LGNA 2RREA 3JRIA 2KMUA 3DBRB 4D1QA 1R1TA 1K79A 2JSCA 3SFZA 1JUMA 3NARA 5CLSA 2DOAA 3RKWA 3U1KA 5E3OA 4HX7A 3ZQFA 3Q0VA 1G2HA 3J81K 1IAWA 1BA5A 1UB9A 3F0CA 2CRGA 4XONA 5E20A 3CCUI 1D0ZA 2OQGA 3JCUC 1HKSA 1W5SA 5K5OA 3HGGA 5DEQA 1D0XA 4G7OF 4EEFG 2CQQA 5HS9A 3ZQQA 2HVRA 2QQ9A 5EJCA 2XF5A 3WTSC 5IP9J 1RETA 2ISYA 2XSJC 2E7WA 2PFBA 4A0YA 3ZPLA 1IDYA 3L2RA 1HC8A 2V4JC 4EJOA 5BPDA 2W25A 5J40A 3S1QJ 1Y0UA 2OUMA 3CLOA 1GDTA 1ORKA 1ZN2A 3S8PA 4I0BA 3FXKA 2GIZA 5CJ9A 3F72A 3F21A 3DU6A 3WGHA 4NC8A 2IA0A 5FKMA 3BR1A 1G3TA 2PJPA 1S8NA 2M8GX 3ZRGA 1H8AC 3I55I 1I6HJ 5D4RA 1MSFC 3CC2I 2Z1DA 1GV2A 4LK1F 5F04A 1BL0A 2CW7A 2E5NA 3DFGA 1MBKA 3Q9VA 1IUYA 3CP2A 1E3PA 2HKOA 2Y30A 3QRFF 4II3A 2VC0A 4E4HA 3JTHA 2HYGD 1W5CC 3GTMJ 2P81A 2BGCA 4A3EJ 2FMLA 5DCFA 3BCAA 4YIRX 2R7VA 3FBNB 1FMWA 2X9DA 1K7AA 3L7WA 4KDPA 1ZHFA 3SEQA 2YU9J 4AUXA 4CDGA 3JSOA 2HQ5A 3DXJF 4BY7J 3IKTA 2W1OA 2XF7A 5K1YA 5EYRA 1DGWY 2HOEA 4CH7A 4BNCA 2EFNA 2A5YB 2QQ8A 3D5RC 2CGPA 1E0EA 5FRNA 1IN5A 1BN5A 2BW3B 1WQ2A 4BDZA 5FGMA 2VQCA 3W2AA 5KAIC 4L5JA 4AIKA 3AL0B 1KQ8A 2OAZA 2L7ZA 2ZJPF 3F22A 2YS9A 4MNUA 1XB4A 4Y17A 3HOVJ 2KIUA 1FOWA 2EPFA 2R7QA 4L9TA 3RQIA 2JRTA 1IG7A 3OV8A 3E6MA 1MNEA 1TQMA 2BV6A 2XPVA 5D5VB 2VJ4A 3HC7A 4MQ9F 3GTJJ 3MVPA 4RB1A 1T39A 3WTTC 3H5AA 4S0HB 3QOEA 1O4XA 1ETWA 4IXAA 2M2EA 1R1UA 5DD4A 3CO7C 1Z7UA 4NC6A 1A5JA 4AU7A 4B3XA 4CYDA 4XL9A 3KCCA 1VQNI 5F0HA 3OIPA 1SFEA 1FTZA 3S1NJ 1RKTA 3HEFA 1H89C 1FIAA 2JK3A 2M4GA 2DA3A 2RQPA 2HQNA 4CYCB 3BCBA 4XSZF 3G1LA 2KKOA 4CCLA 3WTWC 4I6ZA 1D0YA 4BXXJ 5H6RA 1GXQA 1Z6RA 3VFZA 2DT6A 5BNGA 2ECBA 3BROA 2HDCA 2BY2A 1IRZA 3E1SA 3L00A 4FASD 2COMA 2UXNA 1MDMB 1IRXA 1QHHD 3R6SA 3FXQA 1IV8A 2QKMB 3I4PA 3MKWB 1Z3YA 4OAZA 2KIFA 4KT5C 5JVTA 1ETVA 1BC7C 2QVOA 1D8KA 2ZCWA 3QPHA 1X19A 3HRMA 4G6DA 4E7ZA 1OFCX 2NNYA 4UUVA 3GZ6A 2ELKA 2NYXA 2P6TA 3V8LA 4C30A 2V1XA 3WG9A 3FXRA 4NQWA 3OL4A 2KJCA 2M7AA 3TDUC 1YJWI 3ERED 5HVQC 3AKZA 2VKVA 1D1BA 1PJRA 3OMYA 4L5IA 2XHKA 3WTVC 2JVHA 1WCMJ 2K27A 4HQEA 3IV5A 4B47A 5E3MA 3VWBA 4JX5A 3PM1A 4B44A 1SD5A 1CF7B 5J47A 2JT1A 3BC8A 3M1CA 2AS5F 3AG2H 3DEWA 3OOUA 3WHCA 3CCEI 4F55A 3M07A 3DEEA 4XKWA 5J8FA 3B73A 1YITI 3FM5A 1PUFA 2V1NA 4BS9A 4GDFA 3BLYA 4YIFA 3I71A 4M73A 1LEBA 2VE9A 2IT0A 4LOCA 5LGUA 3KP4A 2EH3A 3FXJA 2EFWA 3LOCA 4DYQA 5D5UB 3A2KA 5LBQA 4A3CJ 1D5VA 4ESJA 5ERIA 5JR3A 1WGXA 3BTIA 2LG4A 2XVCA 2ZNYA 2LF8A 1A04A 2M0CA 3W2WA 1R6RA 3E7LA 3NWTA 3BJ6A 3CESA 3M1EA 2R5YB 3UKGA 2HU9A 4IHVA 3FXMA 3FK6A 5C44J 4DZJA 4AIHA 1ZRCA 1R4NB 2ID6A 2P7CB 1G3YA 3TDZC 2DA7A 4FT8A 3JRCA 1PDNC 1OCOH 1WJCA 1BJZA 2AQEA 2XC7A 3V8KA 3WHBA 1K61A 3TP0A 5K5RA 5C4XJ 4M9SA 1MNDA 2ZB9A 3KP5A 1KYZA 1R5GA 4ANJA 2QSFX 3WTUC 3HTUA 3V42A 1JT6A 2F4IA 1IXRC 1RC9A 3X2QH 1BR4A 1P92A 3ZQLA 4OU0A 5BOXA 4G9YA 2ZJ2A 3RPUD 2R7UA 3REOA 3CUOA 2PQ8A 4LLLA 1SMTA 2E1OA 4UVAA 1LKXA 1RUOA 2BYVE 3H3ZA 1H0MA 1YX3A
chains in the Genus database with same CATH topology
4AVZA 3OIQA 4DBQA 2LYCA 3QYEA 1G8XA 4KISA 2V7FA 2X1CA 5LD2C 1HA8A 2OV7A 4BACA 2M0MA 5HNFA 2DT7B 4H4KC 2HZDA 2MD0A 3EUHC 2W00A 5CKTA 2R7RA 4P1WA 4PJMA 3LMMA 2LOOA 4ZDOA 2X1EA 3K6GA 3FBIB 4Y4RA 3SZGA 3ONQA 1TZLA 2DJIA 1WJDA 4NQWB 1PYVA 4XM3A 3TBIA 4ZTFA 2MABA 3D5SC 3DU5A 4ITVA 4BE2A 4E7SA 1LFPA 4HEA2 4JOMA 2F6CA 1NG7A 2L9NA 2DXIA 1BOBA 1X1BA 2QKLB 2KRCA 1BR1A 2X6YA 3OS1A 3OS2A 3PNYA 2Y0SA 3S93A 4IZZA 2AQFA 2ZXIA 2ZXHA 3OWTA 3C2HA 3DPTA 2E60A 3DKXA 3OYGA 2PJRB 4F91B 2XF6A 2X6XA 2RQQA 2HPIA 3EUAA 3QYFA 2K9MA 4XKCA 3DKYA 1T0FC 4HSRA 4BDYA 3L2QA 2MFZA 4HPQA 2VQHA 1FMVA 4D9JA 2L7KA 4YEJA 3S3NA 2IS6A 3DQVC 4HSTA 1BR2A 3TL4X 2IS4A 4CCMA 4ZJZA 4BJ5C 3LSMA 1X4OA 1Z7LA 3HPGA 3SYTA 4E6KG 4EATA 2WAQA 4BJ6C 3EPZA 2V9KA 2XAUA 3MKYB 2WB1A 4LIUA 3H9QA 4E7HA 3MMYB 2LH9A 1GLNA 4QPQA 4PK4A 3HPHA 1YX5A 4XNFA 2WAEA 3HOTA 1MMAA 2ELJA 4PJNA 1LDKB 2LRDA 2F5VA 2IGMA 3PSFA 3FKJA 2V26A 4PJJA 3OYEA 2FUG2 3HUGB 3K4CA 3OYLA 3VSKA 2JUGA 4AYBA 4ZDPA 5CQGA 3OYJA 4GRIA 4IQJA 4LITA 2KZVA 5JHFA 2CMPA 2CV2A 3NWSA 3RSNA 3VDXA 4BL0B 3LSGA 1SFKA 2VPLA 4F93B 1WJBA 2HPMA 3EUKL 3QYBA 3ZGKA 4J01A 2VL8A 2L5QA 1OLTA 1X1DA 3MD2A 3K70D 4XN0A 2K5CA 3DPUA 2W7NA 1MMDA 2KQRA 3N05A 3H35A 3PL8A 2LBFA 4DGWB 2BW3A 4HG2A 3ZR8X 2CFOA 1OR7C 4G6TB 1UAAA 4PSWA 3UR3C 2LY2A 2VXZA 3OYBA 1V5EA 1DP3A 2V6EA 4XMYA 1LVKA 2M7BA 4XLAA 2CV0A 4B43A 4XR6A 2E1MB 5KCMA 2PMZA 3OYNA 3W3CA 2IS2A 2CUJA 2Z16A 3OL3A 4XQFA 2DCEA 2M3AA 3L2WA 3H9GA 3ZXSA 2CV1A 4IQ4A 3LFUA 2IS1A 2RREA 2E5ZA 5TGTA 2KMUA 4YELA 4D1QA 4HRIA 3F9KA 2X6WA 2DOAA 4BU2A 4RM2A 4F52A 3PJRA 4B48A 3I9V2 4XONA 2BVMA 2LC2A 1D0ZA 2MC4A 4BJTA 3KEYA 4BEHA 1D0XA 4IX7A 2VQGA 3VYUB 3H5RA 3H0DA 3S3MA 3ZQQA 2HVRA 2A5WA 4XORA 1Z21A 1X4PA 1N75A 2R7WA 2VKHA 3KX2A 5CPRB 2VJJA 2XF5A 3K10A 2IGKA 2CH0A 3OY9A 4N4OB 2KPMA 2VXDA 2XSJC 1N78A 4BGDA 2IGNA 3DPLC 2VLAA 2KP6A 1D1AA 4YRVA 2HDWA 3HOSA 3L2RA 2V4JC 4E7JA 4PUSA 2VIXA 3FHNA 2OUMA 3CZ6A 3S8PA 3ZCOA 2CW8A 3DU6A 2I8DA 1MW7A 4NC8A 4LIVA 4E7LA 4XOTA 4OWRB 4ZC3A 3ZRGA 4CZCA 4BQNA 2Z1DA 1X1AA 2LY1A 2P0WA 2CW7A 2E5NA 4HNTA 3MKZA 1J09A 3E0JB 2R4GA 3CP2A 3IAS2 4R79A 3K4JA 2O5RA 3K4BA 1KONA 3K4MA 1NG6A 4II3A 3PFYA 4ZYAA 3TMOA 4E4HA 3DTIA 1Z3XA 2K9LA 2E1MC 2HNHA 2IXSA 3BCAA 3S32A 2R7SA 2R7VA 3FBNB 1FMWA 1UELB 2GOMA 4OAYA 3SEQA 4X0GA 5FRMA 2NOJB 2RNGA 4CUGA 2W4SA 2KL4A 4PSXA 4RMNA 2HVQA 2W1OA 2XF7A 1DGWY 2JSPA 4CH7A 3QODA 1ERDA 2KLOA 2Q2EB 3PUBA 3OYCA 5CQEA 1UG0A 3D5RC 2LBFB 1T95A 3UNGC 3VYTB 5FRNA 2HQAA 1QHGA 3SDBA 2BW3B 1E0EA 4BDZA 2R7OA 3G2BA 4PFPA 4IKFA 2BVLA 1DQUA 2VQCA 4II2A 3W2AA 3BG6A 5FROA 3OYFA 4XLEA 3OYMA 3AL0B 3HG9A 1TT0A 3OR2C 5LFAA 2KRHA 4RLFA 2WBMA 1X1CA 2R7QA 3H9JA 3RTRA 2GOXB 3AFHA 2UWMA 3BG7A 1DGRM 1MNEA 1MMGA 3OYAA 2UUZA 2WA0A 3OYDA 4NNJA 4LG3A 4RLQA 2VJ4A 3HC7A 2VKDA 3H5AA 3QOEA 1W36D 4F92B 2W82A 5HNHA 4AU7A 4B3XA 2OC6A 4XL9A 4BEHB 3HL2A 4J00A 3OIPA 4U87A 2WAFA 4DBRA 2ZSHB 3RQ4A 2M4GA 4N4NB 2VJIA 2L9SA 3K4LA 4F3QA 4CCJA 2A6TA 2KHMA 3BCBA 3K4NA 2Q1ZB 3KYLA 4C2UA 4CCLA 3HXLA 1D0YA 3K70C 3H5NA 3OS0A 4DOZA 3L2VA 1VZ0A 2DT6A 3CJRB 2L2OA 2M4KA 2ZSIB 1Y6IA 4XN3A 2JVGA 3E1SA 3DLAA 4FASD 3LSIA 1IRXA 1QHHD 3L2UA 3A1YA 2QKMB 3MKWB 1W36C 1Z3YA 4OAZA 4BE1A 3OYKA 1WJFA 5HOOA 3CJQB 1SAUA 2VB6A 3IUOA 2X51A 4PFOA 4Y3OA 3W2VA 1X19A 4E7ZA 3LSKA 1WJEA 4NC7A 3AL0C 4KJZA 5KHDA 4ZDLA 2CS3A 4C30A 4QPOA 3OYIA 2K3PA 2MYSA 3OL4A 2WY8Q 2M7AA 5HVQC 3AKZA 1U0JA 1D1BA 4BE0A 1PJRA 3K4KA 3OMYA 2WADA 4XKVA 1D1CA 2JVHA 3J7AY 1JI8A 1WFXA 4C2TA 2R7TA 3GBGA 2IGOA 5HLTA 2Z2SB 2XDVA 2BOLA 3D5LA 3VSLA 1K6YA 4B47A 3VWBA 1WJAA 2LREA 3DTEA 4XKBA 4B44A 2PJRA 1V5FA 3BC8A 3M1CA 4C9YA 4XLFA 3C2GA 3PSIA 1QU3A 2VASA 4XLHA 2CUZA 3OOUA 4E7IA 4F55A 3DEEA 4FETA 4XKWA 4RM3A 2R7XA 4BQOA 3IP4B 2V1NA 4BS9A 3BLYA 4NUBA 4E7KA 1MMNA 3LL7A 4Y33A 4P5OA 1P9QC 4PJLA 5KNLA 3A2KA 2WY7Q 3PNTA 1G59A 2LG4A 3W2WA 3HKZA 1R6RA 3NWTA 3CESA 4BXFA 1S9HA 2HU9A 3PNVA 3A4CA 4XOPA 4KITB 2HVSA 4BQQA 2UV1A 2X1DA 3FDYA 1WJCA 3I3LA 1N77A 2VJ5A 2AQEA 4XLCA 1ZELA 3CMMA 2XC7A 1YE9A 1EA3A 2JA2A 3DWLE 4CA0A 3U21A 3RCOA 4HNUA 1MNDA 3VYSB 3IAM2 3CP8A 3DTKA 4ANJA 3LSHA 3S3OA 4JQFA 3V42A 1WJ5A 2F4IA 4CCOA 4KT6A 4CSWA 1BR4A 1AA7A 3SEZA 2KDOA 4DIQA 2VQLA 3OR1C 4DJAA 1V5GA 3CF2A 3RPUD 2R7UA 2X85A 1Y56A 4CCKA 4CCNA 4MLOA 4U7BA 1LKXA 4ZTJA 3VYRB 4BUPA 3OYHA 3M8JA 1YX3A 2ZFUA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4OAY A;  4OAZ A;  5KHD A;  2MC4 A; 
#chains in the Genus database with same CATH topology
 1AOY A;  4M6Y A;  4D7N A;  2QEX I;  1OCT C;  2P7V B;  4DBQ A;  1U78 A;  3J7Z I;  3H92 A;  1IGN A;  2DDB A;  1OPC A;  4MIM A;  1XCV A;  2JRM A;  5LD2 C;  2DOE A;  5BQT A;  2M0M A;  5HNF A;  2VBW A;  3BR3 A;  4H4K C;  3KP7 A;  2NXN B;  1SMY F;  3G1M A;  3KYD B;  4WXC A;  4EJV A;  1TC3 C;  2CQ7 A;  4P9U A;  2HOT A;  2G0E A;  1P2F A;  3K6G A;  3F8F A;  5D5W B;  3ONQ A;  3BTL A;  2DJI A;  3N97 A;  1MIJ A;  4XM3 A;  6PAX A;  2HXI A;  3TBI A;  2MAB A;  3DU5 A;  1WHU A;  2FMY A;  4BE2 A;  3EQL F;  4E7S A;  4HEA 2;  4JOM A;  5ICF A;  2L9N A;  2KRC A;  5D8L B;  4BH9 A;  3OS1 A;  3JRD A;  4IJA A;  2Y0S A;  4A0Z A;  4HW0 A;  1A6Q A;  5IP7 J;  1U3E M;  2DW4 A;  2BY3 A;  1IN8 A;  3BTJ A;  4LB6 B;  5E8I A;  1U8B A;  4B4C A;  3DPT A;  2FOW A;  2PN6 A;  1YTY A;  2XGC A;  2RQQ A;  3HBL A;  3BT9 A;  3EUA A;  2VOO A;  3TW7 A;  4UB8 C;  4XKC A;  1JUS A;  3DKY A;  4BDY A;  3L2Q A;  3T1B A;  2OTJ I;  2F4O B;  4D9J A;  3S3N A;  2KIM A;  2IS6 A;  4HST A;  1BI1 A;  4I99 C;  4CCM A;  4FX4 A;  2IPQ X;  4BJ5 C;  2WC2 A;  4E6K G;  1BI2 A;  4EAT A;  3BG3 A;  1SD7 A;  2NNN A;  4ZYH A;  4BJ6 C;  1IW7 F;  3TP3 A;  5LHI A;  3SQN A;  3H9Q A;  2ZFW A;  4E7H A;  3IH4 A;  1QA6 A;  4WCG A;  2TCT A;  1YX5 A;  3BZK A;  3DP7 A;  3M9A A;  1ZG3 A;  4U0V A;  3GCM A;  4PJN A;  3H3V K;  2F5V A;  3HRS A;  1XS9 A;  3O3K A;  2DMQ A;  3FKJ A;  4IF4 A;  3MZH A;  1XGN A;  3HUG B;  3K4C A;  4UUT A;  3MKL A;  2EV0 A;  1R7J A;  4AYB A;  3CCQ I;  3RI4 A;  5HS8 A;  1SD4 A;  4XLN F;  2DA2 A;  3Q0W A;  2FNA A;  4V2G A;  4MFE A;  1XDS A;  4OMY A;  2KZV A;  2E34 A;  1ITY A;  5JHF A;  1U6G A;  2CV2 A;  2ZME B;  1LDD A;  1KU2 A;  1USS A;  4I98 B;  3GTK J;  2HWV A;  4H0E A;  3LSG A;  3ABT A;  2VPL A;  2DK8 A;  3MQ0 A;  1J75 A;  1HKT A;  2FNP A;  2HOA A;  1FT9 A;  3ZGK A;  5GAE J;  3L2C A;  2IP2 A;  2VL8 A;  3KZI C;  4UVB A;  3IWZ A;  4HA8 A;  2BY0 A;  5FLX Z;  5E18 F;  1IRG A;  3MD2 A;  4IPA A;  1W7P A;  3CMA I;  3K70 D;  1RPW A;  2VUM J;  2R92 J;  1RKW A;  4B09 A;  2DA4 A;  2C6Y A;  3N05 A;  2PMU A;  3H35 A;  2NAZ A;  2UXX A;  3PL8 A;  4GYI A;  1K78 A;  2LBF A;  3S1M J;  5IYC J;  4DGW B;  3S14 J;  3WE2 A;  1XPX A;  3E6D A;  4L9N A;  3ZQI A;  2CFO A;  5M5W J;  2GA1 A;  5EEH A;  1YJN I;  3FHZ A;  2VXZ A;  4HDU A;  2GLO A;  5C4J J;  3VEP A;  1MJ9 A;  1ZGJ A;  3FIS A;  4PGG A;  5KCM A;  1XD7 A;  2ZKZ A;  1O7F A;  4HV6 A;  5HS7 A;  3K9T A;  5JFR A;  3W3C A;  1VI0 A;  3KP3 A;  4KUM A;  3IRQ A;  4CGZ A;  5L3F A;  3H9G A;  2XRL A;  2CV1 A;  1BIB A;  3A0H C;  2RNJ A;  2GXG A;  1HSJ A;  4IQ4 A;  1G4D A;  3PQJ A;  2E5Z A;  2MG4 A;  4FHT A;  5DCM A;  4YEL A;  1POG A;  4IOA F;  4X6A J;  3F9K A;  5CVR A;  3T8T A;  5F1J A;  4RM2 A;  1AKH A;  4F52 A;  4KN7 X;  1XDU A;  1X2M A;  4GCV A;  3HZJ A;  4FX0 A;  2LC2 A;  2MC4 A;  3PQK A;  1ON2 A;  1YG2 A;  4BEH A;  1XSX A;  1H88 C;  3SDG A;  2VQG A;  1OCR H;  1AHD P;  1QO0 D;  4DQ2 A;  3IH2 A;  2B7E A;  1QBJ A;  4IKF A;  2M1B A;  1Z21 A;  1ZAR A;  1ZLJ A;  1X4P A;  5EZH A;  3K10 A;  2RDP A;  3TOB A;  1FIP A;  2CH0 A;  3LSR A;  3B02 A;  4N4O B;  2KPM A;  1E3H A;  4P55 A;  1DP7 P;  5J4V A;  2JTV A;  5EGO A;  2R5Z A;  1XSD A;  1IF1 A;  4LG0 A;  2IGN A;  3DPL C;  2L9V A;  2KFD A;  1S29 A;  1IUF A;  4EMS A;  1D1A A;  4K2E A;  2HDW A;  2Y69 H;  4NBQ A;  2CQK A;  3FHN A;  1QZE A;  2LF7 A;  1ODD A;  1FZP B;  4NHJ A;  1VQ7 I;  2MLG A;  2DYS H;  3HM5 A;  2A07 F;  3BR6 A;  1R23 A;  4UUS B;  3GTL J;  4OWR B;  4ZC3 A;  4M3E A;  4HLX A;  4CZC A;  1GT0 C;  2J5P A;  4IHX A;  4ZZD A;  1X1A A;  2JA8 J;  2FJ1 A;  2CWE A;  4HNT A;  1MKM A;  1SEU A;  2R4G A;  2EIJ H;  5LRS A;  1D8J A;  2MH2 A;  2O5R A;  3K4B A;  3TQN A;  1Y8Q B;  4CO8 A;  4DW6 A;  3PFY A;  4ZYA A;  1YS7 A;  2QLZ A;  3HOX J;  1QRY A;  2E1M C;  4ENK A;  2HNH A;  1VQ9 I;  2IXS A;  1UEL B;  4QIW N;  3CUQ C;  3HTS B;  2PX9 A;  4UB6 C;  4OAY A;  5J6X A;  3HHG A;  1VQO I;  2G9W A;  2NOJ B;  1B72 A;  3TED A;  5B5E C;  2NS7 A;  1KQ9 A;  4GFB A;  3QOD A;  1ERD A;  2H8R A;  2GM4 A;  2QCO A;  3E3V A;  4DNC A;  4YG2 F;  3OYC A;  5CQE A;  3UNG C;  1T95 A;  3SDB A;  1U8R A;  2Z5U A;  1E3O C;  4PFP A;  1ETQ A;  2MLK A;  2PEX A;  2EZI A;  2BVL A;  3K0L A;  2OJE D;  3BG6 A;  4KA4 A;  4U88 A;  4W97 A;  5L3E A;  1LEA A;  2IBD A;  5DD8 A;  4EVI A;  3BJA A;  2BXY A;  3I54 A;  2HOS A;  4ZYG A;  4QWQ A;  3U9G A;  4KNY A;  1YQA A;  2IW5 A;  5EDN A;  5FO5 A;  2OPT A;  1UST A;  1YW7 A;  1MMG A;  2DQL A;  2Z99 A;  4Z2Y A;  1Z6T A;  1VQ8 I;  5BMZ A;  4HDV A;  2OCC H;  4F92 B;  4RB3 C;  1QQI A;  3SXY A;  5B3S H;  1C0W A;  1HKQ A;  4J19 A;  1L3L A;  2XGE A;  2E1N A;  1QPI A;  2O6G E;  4BBS J;  1I6X A;  1EV7 A;  1GV5 A;  3AG3 H;  2GIV A;  2F5E A;  1LVA A;  2OC6 A;  2XPW A;  3HRU A;  3IL2 A;  5IPA A;  3CCJ I;  3HL2 A;  4M3G A;  2LVS A;  2XPU A;  5FB2 A;  2LY9 A;  4N4N B;  2VJI A;  4N0B A;  3BPV A;  3QQA A;  1UHM A;  5IP6 A;  3K4N A;  3KYL A;  2Q1Z B;  2OU2 A;  2VBZ A;  2E7X A;  1HCR A;  1WI9 A;  1X1P A;  3K70 C;  3OS0 A;  3ISP A;  2CYY A;  4YFK F;  4CIC A;  1P7J A;  4I0A A;  1R5I D;  2NVQ J;  2L2O A;  1FOY A;  1P4A A;  2KT0 A;  5GTI C;  1TQP A;  5F0F A;  3LA7 A;  1LB2 A;  2IA2 A;  5M3F J;  3MAJ A;  2KIQ A;  4L18 B;  1FC3 A;  1ZTR A;  3LSI A;  2NVU B;  5GPA A;  3GUD A;  5IT3 A;  4U7D A;  4G7Z F;  3K7A J;  2H27 A;  5HOO A;  1JKR C;  2IVM A;  2NOG A;  2R7D A;  1OQY A;  5D5X B;  1VQ4 I;  4Y3O A;  3Q3S A;  3W2V A;  2A3S A;  3LSK A;  1QVU A;  2ECC A;  4D5C A;  3LA2 A;  3AL0 C;  5J3L A;  2L9R A;  3F6V A;  4A5N A;  1Z67 A;  5KHD A;  3K69 A;  2QA4 I;  4KIB A;  1A6I A;  4XK4 A;  2K3P A;  2D45 A;  2MYS A;  2WY8 Q;  2WV0 A;  1RRJ A;  1HW5 A;  2DYR H;  2EWN A;  2RAE A;  4XBF A;  1X3U A;  2O03 A;  1ZG5 A;  2WAD A;  4XKV A;  1D1C A;  3A01 A;  3J7A Y;  4Y7N J;  1U9N A;  1TTY A;  3GBG A;  5ILU A;  2RV8 A;  3FMR A;  5HLT A;  3CDL A;  4XIC A;  1IN7 A;  2XDV A;  1P4X A;  3D5L A;  3VSL A;  1K6Y A;  2W48 A;  2IJL A;  4FE4 A;  2DMN A;  5LHH A;  2FQ4 A;  3NQO A;  5LHG A;  5IT9 Z;  2PJR A;  3DCF A;  4XLF A;  1WWX A;  3C2G A;  3PSI A;  1QU3 A;  4XLH A;  2CUZ A;  4QTR A;  4E7I A;  2B9S A;  2R7X A;  3PIP F;  2DFF A;  3B6C A;  4BQO A;  1XMX A;  1R71 A;  4B1R A;  1SFX A;  2CUE A;  4RAZ A;  4MQV A;  3DKW A;  4Y33 A;  3F23 A;  3F8M A;  3KET A;  1MSE C;  4P5O A;  4PJL A;  3PNT A;  3K1M A;  3IRR A;  1ON1 A;  4KIC A;  5EG0 B;  4AWX B;  2A61 A;  2RN7 A;  3HKZ A;  4IVN A;  4ESB A;  3GTP J;  5FLX K;  3A4C A;  4XOP A;  2NRA C;  1ZLK A;  5LEK A;  3C2B A;  4LMY A;  2MC3 A;  2HVS A;  1YI2 I;  1YFH A;  3FK7 A;  4HX8 A;  4Y13 A;  1YRN A;  2VJ5 A;  2O8X A;  3E5U A;  4NB5 A;  5F27 A;  3DWL E;  3JRB A;  4B8X A;  1LE8 A;  2WAQ N;  4HNU A;  1VQL I;  2L54 A;  2WV1 A;  3CP8 A;  1TT5 B;  4KN4 X;  2LD5 A;  4JQF A;  4BHB A;  2ZC2 A;  4I7H A;  2O61 A;  3WU0 A;  1WJ5 A;  1JHH A;  1YW9 A;  4KT6 A;  4CSW A;  2KDO A;  5C3E J;  1T0F A;  3E5Q A;  3HYI A;  2VQL A;  4C3H J;  2MH9 A;  3VB2 A;  3S1R J;  5FFZ A;  4DJA A;  1V5G A;  1YJ9 I;  1BOA A;  2CG4 A;  3H36 A;  2FEZ A;  2IAI A;  5K7H A;  3VYR B;  4BUP A;  3M8J A;  3PUF A;  1P7I A;  1BW6 A;  2R7F A;  1BC8 C;  3BJO A;  2MW8 A;  2K4J A;  5CVJ A;  2LYC A;  3CCV I;  4IHT A;  3FX3 A;  2X1C A;  4L5E A;  2QGU A;  1H9T A;  2D2W A;  4DYR A;  2ACJ A;  2M9H A;  2FQ3 A;  2MD0 A;  3EUH C;  2E1C A;  3O8G A;  1OIS A;  2R7R A;  4P1W A;  1JKP C;  3LMM A;  2DTZ A;  3Q5F A;  5D8K B;  2DJN A;  2YPR A;  1Y0N A;  3GW2 A;  3FBI B;  1S72 I;  1YYV A;  4ITV A;  1R5H A;  4A3D J;  2VT2 A;  1B8I A;  2F6C A;  2MA3 A;  5TJJ A;  3V4G A;  3OS2 A;  1WRJ A;  1WSU A;  3MCZ A;  3PNY A;  2R0Q C;  4IZZ A;  1X3W B;  3F3X A;  3J80 K;  1O7L A;  2K9S A;  4PDK A;  2LSO A;  2F5F A;  3ROU A;  4ETS A;  3HRT A;  4F91 B;  1TW3 A;  4HSR A;  1QVT A;  2EZH A;  4LB5 A;  1R36 A;  1JUP A;  1FMV A;  4YEJ A;  5GP9 A;  2OD5 A;  3DQV C;  2JPB A;  2E2J J;  3TGN A;  2D5V A;  4ZJZ A;  1BM9 A;  1STZ A;  3LSM A;  3RZD J;  3EYI A;  3S2W A;  5IYD J;  1R49 A;  1I27 A;  1TQI A;  1IDZ A;  3EPZ A;  3QU3 A;  4Q48 A;  5GPC A;  1E17 A;  5L3D A;  3H0G J;  3MMY B;  2LH9 A;  5CVV A;  4ABZ A;  4QPQ A;  3W6J B;  3MFK A;  2LDU A;  2STT A;  3U1D A;  2NVY J;  1T2K A;  2EJR A;  2K85 A;  2Y31 A;  1XGS A;  5ICG A;  3LWF A;  1QNT A;  2CSO A;  2FUG 2;  4M6X A;  1U5T B;  2K86 A;  3HSF A;  5IY5 H;  4A3M J;  1MNM C;  2H09 A;  5FKL A;  1BBY A;  4C3J J;  2LTP A;  4RAG A;  3CCY A;  2VON A;  2L02 A;  1S7A A;  1LNW A;  3M7G A;  3FXL A;  5DM7 F;  3Q9S A;  3BR0 A;  5GAD J;  4F93 B;  5E8G A;  1HOM A;  3CCR I;  4OIP F;  1GVJ A;  3L09 A;  2GXB A;  3QYB A;  3CTA A;  3QAH A;  3E6C C;  4ENJ A;  4A3B J;  4BAY A;  3PFI A;  2WB1 N;  1XG1 A;  2DO7 A;  2EZL A;  4YFX F;  1GVD A;  2P4W A;  1FBU A;  2Y0M A;  4B3A A;  3M3Y J;  1LFB A;  4ZYE A;  3KYC B;  2K5C A;  3DPU A;  3BG9 A;  5JLX A;  1PP7 U;  5KK1 A;  2JA5 J;  2PLY A;  3JTG A;  4BKX A;  2BW3 A;  1Z05 A;  3JRF A;  4A93 J;  1OR7 C;  1WH5 A;  4AC0 A;  4PSW A;  3UR3 C;  1I3A A;  5IOY A;  1KGS A;  2LY2 A;  4XLP F;  1OJL A;  3FMS A;  2LR8 A;  1FSH A;  3CCL I;  1ZK8 A;  2YU3 A;  3GME A;  1V5E A;  2OF7 A;  1PUE E;  1DP3 A;  2V6E A;  1LPQ A;  2COB A;  1DUX C;  1TWF J;  4XR6 A;  1YIJ I;  2ETH A;  5AIP A;  3OYN A;  2E36 A;  2TRT A;  2M3A A;  3EET A;  2CUF A;  3L2W A;  3ZXS A;  1JJ6 C;  3FXU A;  1B4A A;  2QEN A;  3GVA A;  1APL C;  2IS1 A;  3CD6 I;  1O3T A;  1ZGA A;  4UNO A;  3KLN A;  4HRI A;  2LMD A;  2QUF A;  2X6W A;  5CVU A;  2EK5 A;  3QPS A;  3G1O A;  3P5J A;  2G7U A;  1P6R A;  4B48 A;  2Z9O A;  3I9V 2;  4XID A;  1EH8 A;  2BVM A;  4PGH A;  3IH3 A;  2VPR A;  4A6E A;  3KEY A;  4IX7 A;  1R9T J;  1BW5 A;  3VYU B;  3H0D A;  3MZY A;  1U9O A;  1JTY A;  2A5W A;  1I3Q J;  1YLF A;  4MEX F;  4XOR A;  2EBI A;  4HF2 A;  4CYC A;  2VKH A;  3I5U A;  3KX2 A;  5CPR B;  1FOX A;  5FKO A;  1Z91 A;  2ZME C;  3CMY A;  4E70 A;  1HXD A;  1TL8 A;  3PO3 J;  4Q5S F;  2VXD A;  2ICW G;  4FCY A;  1FX7 A;  2VLA A;  4GO1 A;  1UFM A;  5BS6 A;  3A0B C;  4YRV A;  3FM3 A;  3T8R A;  2OTL I;  4BQA A;  3KZZ A;  1MDM A;  2VIX A;  3F8C A;  1QPM A;  1MH4 A;  3S17 J;  5DDG A;  4A3L J;  1KU7 A;  1R4M B;  4JP0 A;  2QF7 A;  3SZP A;  5E3L A;  1O3R A;  1BI3 A;  3RDI A;  1Y1W J;  1YIO A;  2DAO A;  3ULQ B;  2I8D A;  1MW7 A;  2CU7 A;  3LAP A;  4E7L A;  4XOT A;  5J1U A;  1T56 A;  4FQG A;  2LY1 A;  3J7Y J;  4HZF A;  2P0W A;  3GLX A;  2NVT J;  2PG4 A;  1J09 A;  2K40 A;  3B6A A;  3E0J B;  4FE7 A;  4A3F J;  1XN7 A;  5ED4 A;  2NS8 A;  3BR5 A;  1UZC A;  4MTE A;  1NK3 P;  2DTR A;  3R60 A;  2DI3 A;  2O7O A;  3TMO A;  3R4K A;  1I39 A;  3DTI A;  4A3J J;  3J7A O;  1HW1 A;  4Q47 A;  4LK0 F;  2GOM A;  4HYE A;  4XRF A;  5GAG J;  5H2F C;  2ME0 A;  1RES A;  5ICE A;  4UY8 I;  5FRM A;  3CC4 I;  3EYY A;  2O0Y A;  4CUG A;  2W4S A;  1RR8 C;  2KL4 A;  2K4B A;  2V1D A;  2HVQ A;  4UXN A;  3V7S A;  1Y1V J;  2JSP A;  1YO5 C;  3F8N A;  4ENM A;  2KLO A;  2Q2E B;  2JMW A;  2CO5 A;  1N25 A;  1T38 A;  3ZQ7 A;  2DMU A;  1QHG A;  2QSH X;  1CF7 A;  1SFU A;  2R7O A;  3G2B A;  3GEZ A;  3WU1 B;  1ETK A;  1IZ1 A;  1ONV A;  1TW2 A;  2HR3 A;  4ZZL A;  1DQU A;  4II2 A;  4A12 A;  1NK2 P;  3R61 A;  2A05 A;  3OYF A;  4BHC A;  3OYM A;  4JX6 A;  3HG9 A;  5TRD A;  4IOC F;  5LFA A;  2KRH A;  4XRS A;  1VTN C;  4RLF A;  2WBM A;  3K2Z A;  4WF2 A;  2W57 A;  2HKX A;  1ZAO A;  1X1C A;  4AM3 A;  1OCC H;  3M4O J;  3AFH A;  2UWM A;  1DGR M;  4RGU A;  3MEX A;  1KYW A;  4Z6Y A;  3ZQG A;  5B1B H;  2UUZ A;  4NNJ A;  4RDU A;  1A35 A;  3PIO F;  2R5Y A;  3QOP A;  1Q1V A;  3LST A;  5HNH A;  4A3I J;  4Y15 A;  3FWE A;  3R0J A;  3WGG A;  1LFU P;  1SVL A;  1J7K A;  2L7F P;  4M9X A;  1REP C;  4U87 A;  5AIQ A;  5DV5 A;  2WAF A;  2JA7 J;  4HF0 A;  2LLK A;  2L9S A;  3K4L A;  3SZT A;  3PO2 J;  4F3Q A;  2A6T A;  4EM2 A;  2H8W A;  2F4M B;  2V9P A;  3AG4 H;  3K1P A;  2O8K A;  5B66 C;  3G4S I;  2W24 A;  1W5T A;  1Z77 A;  1VF9 A;  3DBH B;  4DOZ A;  1HBX G;  1Y8R B;  3HSR A;  4G12 A;  2LKS A;  1O3Q A;  5AON A;  2EIK H;  3ZMS A;  1FY7 A;  3HOU J;  2ZSI B;  2EIM H;  3RKQ A;  1Y6I A;  2K02 A;  2AO9 A;  1JHF A;  2JVG A;  4XN3 A;  4V2F A;  3RKX A;  2YX7 A;  4OIO F;  1HST A;  3QPT A;  2NVX J;  2ZBK A;  4AVP A;  1M1E B;  1B9N A;  2RGV A;  1B1B A;  2VOP A;  1W36 C;  2X6O A;  2EA2 A;  1ZH5 A;  2DOD A;  1WPK A;  1WJF A;  4L9V A;  2VB6 A;  3HOW J;  3IUO A;  4ZYD A;  4M74 A;  1BJA A;  1IN6 A;  4WX9 A;  3GTO J;  3F6O A;  4ZDL A;  2CS3 A;  2HTS A;  3VOE A;  5GTH C;  1RIO H;  2EB7 A;  3QU6 A;  2I5U A;  2XAS A;  2B63 J;  4QPO A;  2V79 A;  3G71 I;  2Z3Y A;  1U0J A;  4BE0 A;  2HGC A;  3K4K A;  2OBP A;  1PVE A;  2CFX A;  1WFX A;  4C2T A;  3D0S A;  2IGO A;  3KE2 A;  1F36 A;  2A68 F;  2Z2S B;  4DYC A;  2ID3 A;  2DA1 A;  4M3F A;  2DPU A;  2A6E F;  1WJA A;  3NEU A;  4JK1 X;  4XKB A;  4P9F A;  3P9K A;  2Y9Y A;  2Z33 A;  4EJW A;  4C2M J;  2DK5 A;  3ERM A;  2E71 A;  2GWR A;  3WE3 A;  4BYY A;  4HX4 A;  2LKP A;  5HLG A;  1ZKG A;  4RM3 A;  5E79 C;  1LQ1 A;  1SFO J;  3ML6 A;  2OZU A;  2MGQ A;  3IP4 B;  1O3S A;  2Y0S N;  1DPU A;  2DBB A;  1TLH B;  2P8T A;  3ABU A;  1MMN A;  4BY1 J;  1T98 A;  1J0R A;  2YR2 A;  3ECH A;  5CYV A;  1ZR4 A;  5KNL A;  2BXZ A;  4EM1 A;  1FOK A;  1G59 A;  3R0A A;  1MZB A;  4LJZ F;  1OMI A;  2XAG A;  5L3B A;  3GFJ A;  4KIF A;  4I76 A;  4M3B A;  3CLQ A;  1S9H A;  3ZMT A;  3RZO J;  1IJW C;  2FBI A;  4KIT B;  1T33 A;  2JUC A;  3N4M A;  5DTD A;  2X1D A;  4RGR A;  3FDY A;  3TO9 A;  1S6L A;  3G73 A;  2XRO A;  3WTX C;  3HUG A;  2VN2 A;  1ZEL A;  3CMM A;  3V7R A;  1F1Z A;  3BG5 A;  4A2U A;  3JRH A;  2M8E A;  1IXS B;  2V6C A;  1B9M A;  1DDN A;  3U2R A;  4WXD A;  3VYS B;  2JJ7 A;  3IAM 2;  4P96 A;  1WVR A;  2X0L A;  4EJT A;  1TBX A;  3LSH A;  2BY1 A;  2YUS A;  3G3Z A;  2L01 A;  2HYJ A;  4CCO A;  4UVC A;  2XB0 X;  3SEZ A;  5DUI A;  5FFX A;  2AXT C;  1JXS A;  3OR1 C;  2GZW A;  3HOZ J;  3ESW B;  4KFC A;  1UHW A;  3CF2 A;  1DU6 A;  2O3F A;  1MD0 A;  1KA8 A;  1Y56 A;  4CCK A;  1NTC A;  4CCN A;  1SC7 A;  4MLO A;  1JGG A;  4U7B A;  4OIQ F;  3E5X A;  4ZTJ A;  2K7L A;  3HB9 A;  4A5M A;  4LLG F;  3OYH A;  3I4N J;  2Q0O A;  1FP1 D;  4EJU A;  2ZFU A;  2JQ7 A;  1JGS A;  3V7C A;  4AVZ A;  9ANT A;  2G7H A;  2BEO A;  3QYE A;  4KIS A;  4I09 A;  2F2E A;  4R1H A;  3ZMV A;  2EQR A;  2XKP A;  1ZRD A;  3C18 A;  2DA5 A;  2FE3 A;  3ABL H;  1FTT A;  2HZD A;  2W00 A;  1S7E A;  4PJM A;  4NDL A;  2V1U A;  3FMQ A;  2XAJ A;  1XSV A;  3OIO A;  2ELH A;  2LOO A;  2HEO A;  1OYY A;  4ZDO A;  2X1E A;  4Y4R A;  4M3D A;  4G8X A;  4HQM A;  3GXO A;  2H1L A;  3SZG A;  4YFN F;  4NQW B;  1PYV A;  3RIR A;  2EV6 A;  3D5S C;  3QP6 A;  1WKM A;  1LFP A;  1VND A;  5K7F A;  1CQT A;  1NG7 A;  4WK8 F;  5HLI A;  3HHH A;  2DXI A;  1X1B A;  2DFH A;  2J5O A;  3LA3 A;  4A0X A;  5E1W A;  2VBY A;  5FD5 A;  1D3Y A;  1V3F A;  2JN6 A;  4W1U A;  2P5L C;  3C3W A;  3JRG A;  2ZXI A;  2W85 A;  1FYM A;  3C2H A;  2P5V A;  5L3G A;  1JKQ C;  3DKX A;  3OYG A;  2XF6 A;  2X6X A;  3CDH A;  2HPI A;  4A69 C;  3W6V A;  2K9M A;  3I58 A;  5FLV A;  4N9I A;  1ZG1 A;  1Q1H A;  2MFZ A;  2HXO A;  4HPQ A;  5M5X J;  2VQH A;  4OIR F;  5D4S A;  3LFK A;  1HQC A;  1A31 A;  1MJA A;  1MMS A;  1BR2 A;  3GF2 A;  2OCE A;  3TL4 X;  1PUF B;  1W0T A;  4EQQ A;  3SJM A;  1X4O A;  1Z7L A;  3HPG A;  1CGP A;  2EZK A;  1VQ5 I;  2V9K A;  1OCZ H;  3K1N A;  4HBL A;  1F4K A;  2WB1 A;  4LIU A;  3JAM Z;  4UV8 A;  3HPH A;  5ILV A;  3IC7 A;  2HYF A;  3GYH X;  4IEJ A;  3HOT A;  2ELJ A;  1LDK B;  2R93 J;  1BIA A;  2IGM A;  2ESH A;  2L7M P;  1YS6 A;  3ASO H;  3F8B A;  4L0Z B;  2K9N A;  4F7Z A;  3ABK H;  3VSK A;  4UUS A;  4ZDP A;  2XRN A;  3OYJ A;  3WTY C;  2FBK A;  2M5W A;  4IQJ A;  5K7Z A;  2CQX A;  3RJP A;  2R3S A;  5JI6 A;  2ESN A;  1E2X A;  4LIT A;  3I59 A;  4HV5 A;  2JZY A;  2XAH A;  4I02 A;  4MTD A;  2Q8K A;  1VQP I;  1TP4 A;  1SFK A;  1T8I A;  2CW0 F;  1UHS A;  1XGO A;  3IKV A;  4IL6 C;  1JE8 A;  2HPM A;  2QBY A;  4OIN F;  3WU2 C;  4ZH4 F;  2DFI A;  3COA C;  5DS9 A;  1ZRF A;  3RPU A;  1RZ4 A;  1OKR A;  1ENH A;  2OQR A;  4I2O A;  1X1D A;  4M71 A;  3QPL A;  3LQR A;  1K4T A;  2GXA A;  3CDI A;  2DFE A;  3I4M J;  2WTE A;  2IEK A;  4EM0 B;  1FJL A;  3TO7 A;  1FLI A;  2KQR A;  5A2Q Z;  1FYK A;  1I5Z A;  4M6V A;  5DUK A;  5HLH A;  4HG2 A;  4AD9 A;  3GTG J;  4G6T B;  5B1A H;  5E1X A;  3JR9 A;  1NH3 A;  1KQ0 A;  1I50 J;  2Y2Z A;  4D7M A;  3ZMZ A;  2EIL H;  3OYB A;  1MBF A;  3TW6 A;  3GX4 X;  1TNS A;  1Z0X A;  3DEU A;  4LD5 A;  3HOY J;  3S2D J;  1LVK A;  4BHP A;  2M7B A;  2CV0 A;  1K83 J;  3ASN H;  2R7Z J;  3I56 I;  3O6B B;  2DU9 A;  2IS2 A;  4OOI A;  2Z16 A;  3BZC A;  2ZXJ A;  2DCE A;  5KVR A;  4OMZ A;  3W6K B;  2JPC A;  4IRH A;  5EF6 A;  5K5Q A;  2WWY A;  3LFU A;  2KIS A;  4L0Y B;  5TGT A;  3ZMU A;  2M30 A;  4YII A;  1UJ8 A;  2VT3 A;  4BU2 A;  3CQZ J;  1FNN A;  2DMP A;  2L0K A;  2RVC A;  3O8H A;  3PJR A;  5J1R A;  1U5T C;  4BJT A;  3D1N I;  3CUQ A;  1XTA A;  2IRF G;  2EFP A;  3S3M A;  2FD5 A;  3H5R A;  3A03 A;  3KEO A;  2E2H J;  2ZXW H;  4EGY A;  1OCP A;  1N75 A;  1X58 A;  2R7W A;  1H9G A;  1W4M A;  2VJJ A;  3QP5 A;  5H20 A;  2IGK A;  5LGT A;  3OY9 A;  2IA1 A;  4GXO A;  4C3I J;  5FD6 A;  2QZ8 A;  1N78 A;  4BGD A;  3LSP A;  1AU7 A;  1J2X A;  4HF1 A;  2KP6 A;  2PMZ N;  2MBF A;  1V54 H;  2M87 A;  1GUU A;  3HOS A;  4ON0 A;  4ENN A;  4E7J A;  2FOK A;  4PUS A;  3CO6 C;  1ZQ3 P;  3CZ6 A;  5HOD A;  1SD6 A;  2LK2 A;  3ZCO A;  3I0T A;  4KMF A;  5D6F A;  2Y48 A;  3HSE A;  3GFI A;  2CW8 A;  1ZR2 A;  4LIV A;  2L4M A;  2ZJR F;  2DDA A;  2E35 A;  4KMU X;  3KP6 A;  5IOZ A;  2W84 A;  3BDD A;  4BQN A;  1IXC A;  5IYB J;  4G6Q A;  4RA2 A;  3MKZ A;  1OYI A;  4JX4 A;  5CVI A;  3EDP A;  3IAS 2;  2JA6 J;  1MBJ A;  4R79 A;  3K4J A;  2AHQ A;  2KJB A;  4IRI A;  1X3Z B;  1KON A;  1EH6 A;  3HIF A;  1NG6 A;  3K4M A;  3P9C A;  1XX5 A;  1Z3X A;  2B0L A;  2K9L A;  4HNV A;  2F5D A;  4WWC A;  5FLM J;  2GA2 A;  2M45 A;  1JJ8 C;  3S32 A;  3BPX A;  2R7S A;  3BWG A;  3CJT B;  1XCB A;  1T6S A;  2GAU A;  4X0G A;  2RNG A;  1W7P B;  4PSX A;  3BQY A;  4RMN A;  1IC8 A;  5J4Y A;  1VQ6 I;  3BOQ A;  2CQN A;  1SAX A;  2X48 A;  3E6B A;  1AWC A;  2N8G A;  3PUB A;  1HDD C;  1K78 B;  4PCQ A;  2LBF B;  1UG0 A;  3VYT B;  4HOB A;  2HQA A;  3HJE A;  2EFQ A;  5M3M J;  4KYW A;  1FPQ A;  2PBI A;  4IHS A;  1P4W A;  5FRO A;  3MWM A;  4XLE A;  4HLY A;  1TT0 A;  3OR2 C;  2YSR A;  5HDN A;  5F0C A;  3OOP A;  3H3U A;  4BXU A;  4ESF A;  1WH7 A;  4G7H F;  5J8C A;  3M8F A;  4LFU A;  4O3M A;  3FXO A;  2DA6 A;  2F5C A;  4S04 A;  3H9J A;  3RTR A;  2FSW A;  2GOX B;  2FX0 A;  3LNQ A;  3BG7 A;  2FBH A;  2DPD A;  2PI0 A;  2P6S A;  4WXH A;  3OYA A;  5EG0 A;  1A36 A;  3ZMD A;  2WA0 A;  3OYD A;  3NRV A;  4LG3 A;  4RLQ A;  2VKD A;  1SAN A;  5DCM B;  3T5X A;  1W36 D;  2H6B A;  2ISZ A;  2W82 A;  2L4A A;  1AKH B;  2XB5 A;  5DM6 F;  2A69 F;  4O5V A;  4MGR A;  1MH3 A;  4XRS G;  2VE8 A;  3GFL A;  4A3G J;  4I01 A;  2M34 A;  4BEH B;  5JVG F;  4A3K J;  2K3F A;  3C1D A;  5BPI A;  4J00 A;  1MBH A;  2VOD A;  1FSE A;  1T08 B;  5KAF C;  1ULY A;  4DBR A;  1EJ9 A;  2ZSH B;  2QM3 A;  3RQ4 A;  4MO7 A;  1HF0 A;  1R1V A;  1YOV B;  2STW A;  3S15 J;  4CCJ A;  3L1P A;  2HI3 A;  4GGG A;  1EKE A;  2KHM A;  3BQZ A;  5D6E A;  4C2U A;  3HKZ N;  3ZN0 A;  5FJ8 J;  3HXL A;  3H5N A;  5EGO B;  2R5Z B;  3L2V A;  2XGX A;  4LG0 B;  4PZJ A;  1FBS A;  1G3W A;  1VZ0 A;  2GQQ A;  3CJR B;  1TWG J;  1TWA J;  1R00 A;  3HDD A;  2M4K A;  4BBR J;  1VQM I;  2TDX A;  3I64 A;  3A02 A;  1WZ2 A;  3DLA A;  4XSX F;  3ABM H;  2JWT A;  5LRR A;  4U0Y A;  3E97 A;  1NHA A;  3G6E I;  1B59 A;  4JBA A;  3L2U A;  3A1Y A;  4O6J A;  4A6D A;  3C7J A;  1EF4 A;  1J5Y A;  2LNB A;  4BE1 A;  3OYK A;  2AXL A;  3CJQ B;  3WTZ A;  3J81 Z;  1SAU A;  2XGD A;  1QZY A;  1EH7 A;  2H94 A;  3SHF A;  1FEX A;  2DLL A;  2X51 A;  4Q4Z F;  4PFO A;  1RUN A;  4QLC U;  1IRF A;  1F43 A;  4LGW A;  3KIO A;  5ICC A;  1LJ9 A;  1LUJ B;  1WJE A;  4U0W A;  4NC7 A;  4KJZ A;  2KZG A;  4MHG A;  3TO6 A;  3FF5 A;  1DPR A;  4HAM A;  5GAH J;  3OYI A;  2XAF A;  5IT9 K;  4GYG A;  2YX4 A;  3WG7 H;  2VC1 A;  4FIS A;  1YHQ I;  3JAM K;  1S7O A;  1WI3 A;  1O57 A;  1JI8 A;  3RKY A;  1U2W A;  2E19 A;  1B72 B;  2R7T A;  5H6Q A;  2ME6 A;  4ASN A;  1X2N A;  5HDG A;  4QSH A;  3GFM A;  2BOL A;  3VPR A;  2HFH A;  1Z9C A;  1XMA A;  3CF5 F;  3KZY A;  3RYP A;  2LRE A;  3GZN B;  3DTE A;  1V5F A;  4C9Y A;  2VAS A;  1I1S A;  5TIS C;  2EIN H;  3HGY A;  4FET A;  1RI7 A;  2EV5 A;  4RAY A;  2XIG A;  5L3C A;  4UHT A;  2UZK A;  4NUB A;  4E7K A;  2BHY A;  2BZT A;  1L0O C;  3LL7 A;  4S05 A;  1LDJ A;  4AIJ A;  1FWZ A;  2BBY A;  3S16 J;  1G3S A;  1P9Q C;  2WY7 Q;  1HDP A;  1I1G A;  4V19 K;  3EUH A;  4MFD A;  3KFW X;  5HDK A;  4D0P A;  5JLW A;  2XUB A;  4BXF A;  4Y52 J;  3M8E A;  3BY6 A;  3PNV A;  1G6N A;  5E1Z B;  4FTH A;  3WGI A;  1R22 A;  1Z1D A;  2V9V A;  4BQQ A;  2UV1 A;  3SFI A;  2P5K A;  3CCS I;  3ELK A;  5FKK A;  2XAQ A;  3I3L A;  1N77 A;  1ETO A;  4XLC A;  2F48 A;  1W1W E;  5A2Q K;  1U5T A;  1YE9 A;  1EA3 A;  1KU9 A;  2FU4 A;  2JA2 A;  2QQB A;  2RC4 A;  4CA0 A;  2MSY A;  2HS5 A;  3U21 A;  1V4R A;  3OSF A;  3JW4 A;  3RCO A;  2O9L A;  3BR2 A;  3K2A A;  5EEA A;  1VFC A;  3DTK A;  1UMQ A;  1S3J A;  4MEY F;  3ZQH A;  4L9J A;  3S3O A;  4KIG A;  1RNL A;  2EFO A;  2Y9Z A;  2NS0 A;  1K6O A;  1HW2 A;  1ZYR F;  3GO5 A;  1IO2 A;  2ADU A;  3DBL B;  1AA7 A;  4TV7 A;  3MZ8 A;  4DIQ A;  2XV4 S;  1GXP A;  2X85 A;  1IV6 A;  2E2I J;  3MN2 A;  2LKX A;  3CJN A;  3V8J A;  4N9H A;  3ZOB A;  3NAU A;  2FXA A;  1JT0 A;  4EV0 A;  5DYM A;  3OIQ A;  2MD5 A;  3TOA A;  1G8X A;  2PMH A;  1FYL A;  1RR7 A;  2V7F A;  2QSG X;  1TWH J;  3H1C A;  1HA8 A;  2OV7 A;  4BAC A;  3I53 A;  2DT7 B;  2KDZ A;  1ZGW A;  2BE5 F;  5J1Y A;  3DV8 A;  5CKT A;  2QQA A;  5FKN A;  4RS8 A;  4AID A;  3CCM I;  4LLN A;  1TZL A;  1WJD A;  1ETX A;  4G94 A;  1J59 A;  1XC5 A;  4ZTF A;  2HDD A;  2QWW A;  3ZP5 A;  2LFB A;  2VKE A;  3P9I A;  4EGZ A;  3KPH A;  5EZG A;  4IRG A;  3JSP A;  1XMK A;  1BOB A;  2QKL B;  1ETY A;  1BR1 A;  2X6Y A;  2XKO A;  3A01 B;  4IO9 F;  3WOD F;  3VOD A;  3GZ5 A;  3DLL F;  3S93 A;  5LEJ A;  2AQF A;  3Q0U A;  2ZXH A;  3RYR A;  3OWT A;  3QWL A;  1SVO A;  1JTX A;  4DZP A;  2D1H A;  2XSD C;  2E60 A;  1KZH A;  2PJR B;  2OZ6 A;  2DQR A;  3QYF A;  3L9F A;  3GWZ A;  4RGX A;  1ZRE A;  1MBE A;  1T0F C;  2VI6 A;  4IHY A;  1F9N A;  4CHU A;  3JRA A;  3ZN1 A;  2L7K A;  3GTQ J;  1W0U A;  1MGT A;  2K9Q A;  1BI0 A;  3AAF A;  3DF8 A;  2IS4 A;  3J80 Z;  3CME I;  1FP2 A;  2QYO A;  1VQK I;  3SYT A;  2RKH A;  1SVM A;  3KLO A;  4M9Z A;  2WAQ A;  4RB2 C;  5F1R A;  2XAU A;  1UG2 A;  3MKY B;  4X1E A;  4CZZ A;  1OR7 A;  3LAJ A;  1GLN A;  2L3D A;  4PK4 A;  1JKO C;  1PP8 F;  1FBQ A;  1MJB A;  2WAE A;  4XNF A;  3I59 B;  1MMA A;  1K4S A;  2LRD A;  2I10 A;  3P7N A;  3OSG A;  1B6A A;  3PSF A;  3IWF A;  2X4H A;  3LQQ A;  2V26 A;  1YRN B;  4PJJ A;  5F6F A;  3OYE A;  1D5Y A;  3S2H J;  2CJJ A;  1F5T A;  4IHW A;  4CXF A;  2ZJQ F;  2OA4 A;  3OYL A;  2GBY A;  2QBY B;  2JUG A;  1XGM A;  1LE8 B;  5CQG A;  3RPQ A;  5E3N A;  4GRI A;  2EA4 A;  1ACI A;  3ZQC A;  1R58 A;  1YW8 A;  2CMP A;  3ECO A;  3FZV A;  4RGS A;  5M5Y J;  2A6H F;  3TKY A;  3LSJ A;  2H1K A;  1KU3 A;  2D1V A;  3KEQ A;  3NWS A;  3RSN A;  3VDX A;  3KP2 A;  4BL0 B;  1HLV A;  1IN4 A;  3BP8 A;  5JHU A;  1WJB A;  1TWC J;  1Y39 A;  3EUK L;  5F08 A;  1J9I A;  2DOF A;  2FF4 A;  4J01 A;  4PJ0 C;  2H6C A;  4RBO A;  2BHZ A;  2DT5 A;  2L5Q A;  1UCR A;  2FA5 A;  4XRM A;  1OLT A;  2DMT A;  4RAF A;  2FRH A;  1QGP A;  2ZME A;  5ILS A;  5EEG A;  3AG1 H;  1OYW A;  3BZ6 A;  4XN0 A;  2W7N A;  2ZO4 A;  1MMD A;  1TNT A;  4D5F A;  2Q2E A;  4JYK A;  2LP0 A;  4UV9 A;  3ZR8 X;  1UAA A;  2ZNZ A;  4AYB N;  3O2P E;  3CC7 I;  1W7P D;  2DN0 A;  3JRE A;  4RB0 A;  5LLQ A;  5F64 A;  2HQR A;  4M72 A;  3FIW A;  4R8H A;  4XMY A;  4XLA A;  3BTC A;  4B43 A;  3IHU A;  2E1M B;  1S5L C;  2PMZ A;  1B8I B;  1GHC A;  1DU0 A;  1V55 H;  2Y75 A;  2HZT A;  3CUQ B;  2CUJ A;  2KRF A;  2VBX A;  5E17 F;  3OL3 A;  4XQF A;  1MBG A;  2HTJ A;  3T0Y A;  3GLL A;  3FKI J;  1QZZ A;  5LGN A;  2RRE A;  3JRI A;  2KMU A;  3DBR B;  4D1Q A;  1R1T A;  1K79 A;  2JSC A;  3SFZ A;  1JUM A;  3NAR A;  5CLS A;  2DOA A;  3RKW A;  3U1K A;  5E3O A;  4HX7 A;  3ZQF A;  3Q0V A;  1G2H A;  3J81 K;  1IAW A;  1BA5 A;  1UB9 A;  3F0C A;  2CRG A;  4XON A;  5E20 A;  3CCU I;  1D0Z A;  2OQG A;  3JCU C;  1HKS A;  1W5S A;  5K5O A;  3HGG A;  5DEQ A;  1D0X A;  4G7O F;  4EEF G;  2CQQ A;  5HS9 A;  3ZQQ A;  2HVR A;  2QQ9 A;  5EJC A;  2XF5 A;  3WTS C;  5IP9 J;  1RET A;  2ISY A;  2XSJ C;  2E7W A;  2PFB A;  4A0Y A;  3ZPL A;  1IDY A;  3L2R A;  1HC8 A;  2V4J C;  4EJO A;  5BPD A;  2W25 A;  5J40 A;  3S1Q J;  1Y0U A;  2OUM A;  3CLO A;  1GDT A;  1ORK A;  1ZN2 A;  3S8P A;  4I0B A;  3FXK A;  2GIZ A;  5CJ9 A;  3F72 A;  3F21 A;  3DU6 A;  3WGH A;  4NC8 A;  2IA0 A;  5FKM A;  3BR1 A;  1G3T A;  2PJP A;  1S8N A;  2M8G X;  3ZRG A;  1H8A C;  3I55 I;  1I6H J;  5D4R A;  1MSF C;  3CC2 I;  2Z1D A;  1GV2 A;  4LK1 F;  5F04 A;  1BL0 A;  2CW7 A;  2E5N A;  3DFG A;  1MBK A;  3Q9V A;  1IUY A;  3CP2 A;  1E3P A;  2HKO A;  2Y30 A;  3QRF F;  4II3 A;  2VC0 A;  4E4H A;  3JTH A;  2HYG D;  1W5C C;  3GTM J;  2P81 A;  2BGC A;  4A3E J;  2FML A;  5DCF A;  3BCA A;  4YIR X;  2R7V A;  3FBN B;  1FMW A;  2X9D A;  1K7A A;  3L7W A;  4KDP A;  1ZHF A;  3SEQ A;  2YU9 J;  4AUX A;  4CDG A;  3JSO A;  2HQ5 A;  3DXJ F;  4BY7 J;  3IKT A;  2W1O A;  2XF7 A;  5K1Y A;  5EYR A;  1DGW Y;  2HOE A;  4CH7 A;  4BNC A;  2EFN A;  2A5Y B;  2QQ8 A;  3D5R C;  2CGP A;  1E0E A;  5FRN A;  1IN5 A;  1BN5 A;  2BW3 B;  1WQ2 A;  4BDZ A;  5FGM A;  2VQC A;  3W2A A;  5KAI C;  4L5J A;  4AIK A;  3AL0 B;  1KQ8 A;  2OAZ A;  2L7Z A;  2ZJP F;  3F22 A;  2YS9 A;  4MNU A;  1XB4 A;  4Y17 A;  3HOV J;  2KIU A;  1FOW A;  2EPF A;  2R7Q A;  4L9T A;  3RQI A;  2JRT A;  1IG7 A;  3OV8 A;  3E6M A;  1MNE A;  1TQM A;  2BV6 A;  2XPV A;  5D5V B;  2VJ4 A;  3HC7 A;  4MQ9 F;  3GTJ J;  3MVP A;  4RB1 A;  1T39 A;  3WTT C;  3H5A A;  4S0H B;  3QOE A;  1O4X A;  1ETW A;  4IXA A;  2M2E A;  1R1U A;  5DD4 A;  3CO7 C;  1Z7U A;  4NC6 A;  1A5J A;  4AU7 A;  4B3X A;  4CYD A;  4XL9 A;  3KCC A;  1VQN I;  5F0H A;  3OIP A;  1SFE A;  1FTZ A;  3S1N J;  1RKT A;  3HEF A;  1H89 C;  1FIA A;  2JK3 A;  2M4G A;  2DA3 A;  2RQP A;  2HQN A;  4CYC B;  3BCB A;  4XSZ F;  3G1L A;  2KKO A;  4CCL A;  3WTW C;  4I6Z A;  1D0Y A;  4BXX J;  5H6R A;  1GXQ A;  1Z6R A;  3VFZ A;  2DT6 A;  5BNG A;  2ECB A;  3BRO A;  2HDC A;  2BY2 A;  1IRZ A;  3E1S A;  3L00 A;  4FAS D;  2COM A;  2UXN A;  1MDM B;  1IRX A;  1QHH D;  3R6S A;  3FXQ A;  1IV8 A;  2QKM B;  3I4P A;  3MKW B;  1Z3Y A;  4OAZ A;  2KIF A;  4KT5 C;  5JVT A;  1ETV A;  1BC7 C;  2QVO A;  1D8K A;  2ZCW A;  3QPH A;  1X19 A;  3HRM A;  4G6D A;  4E7Z A;  1OFC X;  2NNY A;  4UUV A;  3GZ6 A;  2ELK A;  2NYX A;  2P6T A;  3V8L A;  4C30 A;  2V1X A;  3WG9 A;  3FXR A;  4NQW A;  3OL4 A;  2KJC A;  2M7A A;  3TDU C;  1YJW I;  3ERE D;  5HVQ C;  3AKZ A;  2VKV A;  1D1B A;  1PJR A;  3OMY A;  4L5I A;  2XHK A;  3WTV C;  2JVH A;  1WCM J;  2K27 A;  4HQE A;  3IV5 A;  4B47 A;  5E3M A;  3VWB A;  4JX5 A;  3PM1 A;  4B44 A;  1SD5 A;  1CF7 B;  5J47 A;  2JT1 A;  3BC8 A;  3M1C A;  2AS5 F;  3AG2 H;  3DEW A;  3OOU A;  3WHC A;  3CCE I;  4F55 A;  3M07 A;  3DEE A;  4XKW A;  5J8F A;  3B73 A;  1YIT I;  3FM5 A;  1PUF A;  2V1N A;  4BS9 A;  4GDF A;  3BLY A;  4YIF A;  3I71 A;  4M73 A;  1LEB A;  2VE9 A;  2IT0 A;  4LOC A;  5LGU A;  3KP4 A;  2EH3 A;  3FXJ A;  2EFW A;  3LOC A;  4DYQ A;  5D5U B;  3A2K A;  5LBQ A;  4A3C J;  1D5V A;  4ESJ A;  5ERI A;  5JR3 A;  1WGX A;  3BTI A;  2LG4 A;  2XVC A;  2ZNY A;  2LF8 A;  1A04 A;  2M0C A;  3W2W A;  1R6R A;  3E7L A;  3NWT A;  3BJ6 A;  3CES A;  3M1E A;  2R5Y B;  3UKG A;  2HU9 A;  4IHV A;  3FXM A;  3FK6 A;  5C44 J;  4DZJ A;  4AIH A;  1ZRC A;  1R4N B;  2ID6 A;  2P7C B;  1G3Y A;  3TDZ C;  2DA7 A;  4FT8 A;  3JRC A;  1PDN C;  1OCO H;  1WJC A;  1BJZ A;  2AQE A;  2XC7 A;  3V8K A;  3WHB A;  1K61 A;  3TP0 A;  5K5R A;  5C4X J;  4M9S A;  1MND A;  2ZB9 A;  3KP5 A;  1KYZ A;  1R5G A;  4ANJ A;  2QSF X;  3WTU C;  3HTU A;  3V42 A;  1JT6 A;  2F4I A;  1IXR C;  1RC9 A;  3X2Q H;  1BR4 A;  1P92 A;  3ZQL A;  4OU0 A;  5BOX A;  4G9Y A;  2ZJ2 A;  3RPU D;  2R7U A;  3REO A;  3CUO A;  2PQ8 A;  4LLL A;  1SMT A;  2E1O A;  4UVA A;  1LKX A;  1RUO A;  2BYV E;  3H3Z A;  1H0M A;  1YX3 A; 
#chains in the Genus database with same CATH homology
 4AVZ A;  3OIQ A;  4DBQ A;  2LYC A;  3QYE A;  1G8X A;  4KIS A;  2V7F A;  2X1C A;  5LD2 C;  1HA8 A;  2OV7 A;  4BAC A;  2M0M A;  5HNF A;  2DT7 B;  4H4K C;  2HZD A;  2MD0 A;  3EUH C;  2W00 A;  5CKT A;  2R7R A;  4P1W A;  4PJM A;  3LMM A;  2LOO A;  4ZDO A;  2X1E A;  3K6G A;  3FBI B;  4Y4R A;  3SZG A;  3ONQ A;  1TZL A;  2DJI A;  1WJD A;  4NQW B;  1PYV A;  4XM3 A;  3TBI A;  4ZTF A;  2MAB A;  3D5S C;  3DU5 A;  4ITV A;  4BE2 A;  4E7S A;  1LFP A;  4HEA 2;  4JOM A;  2F6C A;  1NG7 A;  2L9N A;  2DXI A;  1BOB A;  1X1B A;  2QKL B;  2KRC A;  1BR1 A;  2X6Y A;  3OS1 A;  3OS2 A;  3PNY A;  2Y0S A;  3S93 A;  4IZZ A;  2AQF A;  2ZXI A;  2ZXH A;  3OWT A;  3C2H A;  3DPT A;  2E60 A;  3DKX A;  3OYG A;  2PJR B;  4F91 B;  2XF6 A;  2X6X A;  2RQQ A;  2HPI A;  3EUA A;  3QYF A;  2K9M A;  4XKC A;  3DKY A;  1T0F C;  4HSR A;  4BDY A;  3L2Q A;  2MFZ A;  4HPQ A;  2VQH A;  1FMV A;  4D9J A;  2L7K A;  4YEJ A;  3S3N A;  2IS6 A;  3DQV C;  4HST A;  1BR2 A;  3TL4 X;  2IS4 A;  4CCM A;  4ZJZ A;  4BJ5 C;  3LSM A;  1X4O A;  1Z7L A;  3HPG A;  3SYT A;  4E6K G;  4EAT A;  2WAQ A;  4BJ6 C;  3EPZ A;  2V9K A;  2XAU A;  3MKY B;  2WB1 A;  4LIU A;  3H9Q A;  4E7H A;  3MMY B;  2LH9 A;  1GLN A;  4QPQ A;  4PK4 A;  3HPH A;  1YX5 A;  4XNF A;  2WAE A;  3HOT A;  1MMA A;  2ELJ A;  4PJN A;  1LDK B;  2LRD A;  2F5V A;  2IGM A;  3PSF A;  3FKJ A;  2V26 A;  4PJJ A;  3OYE A;  2FUG 2;  3HUG B;  3K4C A;  3OYL A;  3VSK A;  2JUG A;  4AYB A;  4ZDP A;  5CQG A;  3OYJ A;  4GRI A;  4IQJ A;  4LIT A;  2KZV A;  5JHF A;  2CMP A;  2CV2 A;  3NWS A;  3RSN A;  3VDX A;  4BL0 B;  3LSG A;  1SFK A;  2VPL A;  4F93 B;  1WJB A;  2HPM A;  3EUK L;  3QYB A;  3ZGK A;  4J01 A;  2VL8 A;  2L5Q A;  1OLT A;  1X1D A;  3MD2 A;  3K70 D;  4XN0 A;  2K5C A;  3DPU A;  2W7N A;  1MMD A;  2KQR A;  3N05 A;  3H35 A;  3PL8 A;  2LBF A;  4DGW B;  2BW3 A;  4HG2 A;  3ZR8 X;  2CFO A;  1OR7 C;  4G6T B;  1UAA A;  4PSW A;  3UR3 C;  2LY2 A;  2VXZ A;  3OYB A;  1V5E A;  1DP3 A;  2V6E A;  4XMY A;  1LVK A;  2M7B A;  4XLA A;  2CV0 A;  4B43 A;  4XR6 A;  2E1M B;  5KCM A;  2PMZ A;  3OYN A;  3W3C A;  2IS2 A;  2CUJ A;  2Z16 A;  3OL3 A;  4XQF A;  2DCE A;  2M3A A;  3L2W A;  3H9G A;  3ZXS A;  2CV1 A;  4IQ4 A;  3LFU A;  2IS1 A;  2RRE A;  2E5Z A;  5TGT A;  2KMU A;  4YEL A;  4D1Q A;  4HRI A;  3F9K A;  2X6W A;  2DOA A;  4BU2 A;  4RM2 A;  4F52 A;  3PJR A;  4B48 A;  3I9V 2;  4XON A;  2BVM A;  2LC2 A;  1D0Z A;  2MC4 A;  4BJT A;  3KEY A;  4BEH A;  1D0X A;  4IX7 A;  2VQG A;  3VYU B;  3H5R A;  3H0D A;  3S3M A;  3ZQQ A;  2HVR A;  2A5W A;  4XOR A;  1Z21 A;  1X4P A;  1N75 A;  2R7W A;  2VKH A;  3KX2 A;  5CPR B;  2VJJ A;  2XF5 A;  3K10 A;  2IGK A;  2CH0 A;  3OY9 A;  4N4O B;  2KPM A;  2VXD A;  2XSJ C;  1N78 A;  4BGD A;  2IGN A;  3DPL C;  2VLA A;  2KP6 A;  1D1A A;  4YRV A;  2HDW A;  3HOS A;  3L2R A;  2V4J C;  4E7J A;  4PUS A;  2VIX A;  3FHN A;  2OUM A;  3CZ6 A;  3S8P A;  3ZCO A;  2CW8 A;  3DU6 A;  2I8D A;  1MW7 A;  4NC8 A;  4LIV A;  4E7L A;  4XOT A;  4OWR B;  4ZC3 A;  3ZRG A;  4CZC A;  4BQN A;  2Z1D A;  1X1A A;  2LY1 A;  2P0W A;  2CW7 A;  2E5N A;  4HNT A;  3MKZ A;  1J09 A;  3E0J B;  2R4G A;  3CP2 A;  3IAS 2;  4R79 A;  3K4J A;  2O5R A;  3K4B A;  1KON A;  3K4M A;  1NG6 A;  4II3 A;  3PFY A;  4ZYA A;  3TMO A;  4E4H A;  3DTI A;  1Z3X A;  2K9L A;  2E1M C;  2HNH A;  2IXS A;  3BCA A;  3S32 A;  2R7S A;  2R7V A;  3FBN B;  1FMW A;  1UEL B;  2GOM A;  4OAY A;  3SEQ A;  4X0G A;  5FRM A;  2NOJ B;  2RNG A;  4CUG A;  2W4S A;  2KL4 A;  4PSX A;  4RMN A;  2HVQ A;  2W1O A;  2XF7 A;  1DGW Y;  2JSP A;  4CH7 A;  3QOD A;  1ERD A;  2KLO A;  2Q2E B;  3PUB A;  3OYC A;  5CQE A;  1UG0 A;  3D5R C;  2LBF B;  1T95 A;  3UNG C;  3VYT B;  5FRN A;  2HQA A;  1QHG A;  3SDB A;  2BW3 B;  1E0E A;  4BDZ A;  2R7O A;  3G2B A;  4PFP A;  4IKF A;  2BVL A;  1DQU A;  2VQC A;  4II2 A;  3W2A A;  3BG6 A;  5FRO A;  3OYF A;  4XLE A;  3OYM A;  3AL0 B;  3HG9 A;  1TT0 A;  3OR2 C;  5LFA A;  2KRH A;  4RLF A;  2WBM A;  1X1C A;  2R7Q A;  3H9J A;  3RTR A;  2GOX B;  3AFH A;  2UWM A;  3BG7 A;  1DGR M;  1MNE A;  1MMG A;  3OYA A;  2UUZ A;  2WA0 A;  3OYD A;  4NNJ A;  4LG3 A;  4RLQ A;  2VJ4 A;  3HC7 A;  2VKD A;  3H5A A;  3QOE A;  1W36 D;  4F92 B;  2W82 A;  5HNH A;  4AU7 A;  4B3X A;  2OC6 A;  4XL9 A;  4BEH B;  3HL2 A;  4J00 A;  3OIP A;  4U87 A;  2WAF A;  4DBR A;  2ZSH B;  3RQ4 A;  2M4G A;  4N4N B;  2VJI A;  2L9S A;  3K4L A;  4F3Q A;  4CCJ A;  2A6T A;  2KHM A;  3BCB A;  3K4N A;  2Q1Z B;  3KYL A;  4C2U A;  4CCL A;  3HXL A;  1D0Y A;  3K70 C;  3H5N A;  3OS0 A;  4DOZ A;  3L2V A;  1VZ0 A;  2DT6 A;  3CJR B;  2L2O A;  2M4K A;  2ZSI B;  1Y6I A;  4XN3 A;  2JVG A;  3E1S A;  3DLA A;  4FAS D;  3LSI A;  1IRX A;  1QHH D;  3L2U A;  3A1Y A;  2QKM B;  3MKW B;  1W36 C;  1Z3Y A;  4OAZ A;  4BE1 A;  3OYK A;  1WJF A;  5HOO A;  3CJQ B;  1SAU A;  2VB6 A;  3IUO A;  2X51 A;  4PFO A;  4Y3O A;  3W2V A;  1X19 A;  4E7Z A;  3LSK A;  1WJE A;  4NC7 A;  3AL0 C;  4KJZ A;  5KHD A;  4ZDL A;  2CS3 A;  4C30 A;  4QPO A;  3OYI A;  2K3P A;  2MYS A;  3OL4 A;  2WY8 Q;  2M7A A;  5HVQ C;  3AKZ A;  1U0J A;  1D1B A;  4BE0 A;  1PJR A;  3K4K A;  3OMY A;  2WAD A;  4XKV A;  1D1C A;  2JVH A;  3J7A Y;  1JI8 A;  1WFX A;  4C2T A;  2R7T A;  3GBG A;  2IGO A;  5HLT A;  2Z2S B;  2XDV A;  2BOL A;  3D5L A;  3VSL A;  1K6Y A;  4B47 A;  3VWB A;  1WJA A;  2LRE A;  3DTE A;  4XKB A;  4B44 A;  2PJR A;  1V5F A;  3BC8 A;  3M1C A;  4C9Y A;  4XLF A;  3C2G A;  3PSI A;  1QU3 A;  2VAS A;  4XLH A;  2CUZ A;  3OOU A;  4E7I A;  4F55 A;  3DEE A;  4FET A;  4XKW A;  4RM3 A;  2R7X A;  4BQO A;  3IP4 B;  2V1N A;  4BS9 A;  3BLY A;  4NUB A;  4E7K A;  1MMN A;  3LL7 A;  4Y33 A;  4P5O A;  1P9Q C;  4PJL A;  5KNL A;  3A2K A;  2WY7 Q;  3PNT A;  1G59 A;  2LG4 A;  3W2W A;  3HKZ A;  1R6R A;  3NWT A;  3CES A;  4BXF A;  1S9H A;  2HU9 A;  3PNV A;  3A4C A;  4XOP A;  4KIT B;  2HVS A;  4BQQ A;  2UV1 A;  2X1D A;  3FDY A;  1WJC A;  3I3L A;  1N77 A;  2VJ5 A;  2AQE A;  4XLC A;  1ZEL A;  3CMM A;  2XC7 A;  1YE9 A;  1EA3 A;  2JA2 A;  3DWL E;  4CA0 A;  3U21 A;  3RCO A;  4HNU A;  1MND A;  3VYS B;  3IAM 2;  3CP8 A;  3DTK A;  4ANJ A;  3LSH A;  3S3O A;  4JQF A;  3V42 A;  1WJ5 A;  2F4I A;  4CCO A;  4KT6 A;  4CSW A;  1BR4 A;  1AA7 A;  3SEZ A;  2KDO A;  4DIQ A;  2VQL A;  3OR1 C;  4DJA A;  1V5G A;  3CF2 A;  3RPU D;  2R7U A;  2X85 A;  1Y56 A;  4CCK A;  4CCN A;  4MLO A;  4U7B A;  1LKX A;  4ZTJ A;  3VYR B;  4BUP A;  3OYH A;  3M8J A;  1YX3 A;  2ZFU A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...