5KHDA

Structure of 1.75 a bldd c-domain-c-di-gmp complex
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
72
structure length
72
Chain Sequence
KLVLDLERLAHVPQEKAGPLQRYAATIQSQRGDYNGKVLSIRQDDLRTLAVIYDQSPSVLTEQLISWGVLDA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords DNA-binding protein
publication title Tetrameric c-di-GMP mediates effective transcription factor dimerization to control Streptomyces development.
pubmed doi rcsb
source organism Streptomyces venezuelae
molecule tags Dna binding protein
total genus 29
structure length 72
sequence length 72
chains with identical sequence R
ec nomenclature
pdb deposition date 2016-06-14
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.1930 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Arc Repressor Mutant, subunit A 5khdA00
5KHDA 2MC4A 4OAYA 4OAZA
chains in the Genus database with same CATH superfamily
3BTIA 2PN6A 4RAFA 1KONA 2PFBA 1G4DA 1YFHA 3BZKA 4XLEA 1FOYA 3OSGA 2EZIA 3FBNB 4N4NB 3SZTA 2KISA 3CJNA 5C3EJ 1TT0A 2RC4A 2JRMA 4HLXA 3FX3A 4EJTA 2VKDA 1FP1D 2EFPA 5HS7A 3OYAA 1B6AA 3CCQI 1J59A 2F5EA 2RQQA 3GVAA 4LITA 2XHKA 3HSEA 3KP7A 4BY7J 3CJQB 2E71A 5JLXA 4LOCA 1W5TA 1H0MA 2E1OA 3LSMA 2KRHA 3RQIA 3OYBA 4ENMA 2QF7A 3HSRA 1TC3C 3LSIA 3JRBA 2YPRA 5ED4A 4EM0B 1XMKA 1S72I 2QBYA 3GTJJ 1G2HA 1LFBA 3FXLA 2E2IJ 1XMAA 5LGUA 2VKVA 3KYLA 3QQAA 2GWRA 4BJ5C 1AWCA 5DTDA 2R5YB 4UUTA 4ZYEA 2F2EA 4WK8F 3VODA 5IT9K 3ZQFA 5E8GA 4UY8I 2JSCA 4KMUX 1ENHA 2E1MB 4NC8A 2HTSA 3U1DA 3L2RA 4F7ZA 3H9JA 3I3LA 1YIJI 1B9NA 1ORKA 4MIMA 2Y9ZA 3MN2A 4XRSG 5DM6F 2A5WA 1TQPA 1MMDA 2Q2EB 3TP3A 3REOA 4BU2A 3HEFA 5B3SH 2QCOA 3KZZA 2Z33A 2XAHA 3L2WA 3DTKA 4MEXF 2DTZA 1VQKI 2NXNB 4UUSA 4AIKA 5E8IA 1U78A 2KQRA 2A6TA 3R61A 1PYVA 1RIOH 3F8FA 1X4PA 2K9NA 3BT9A 1VQ7I 3SZGA 3FKJA 2QM3A 2GXGA 4GXOA 4RB2C 5C4JJ 3U1KA 3HUGB 1LDDA 1AU7A 2EQRA 1E3HA 1Z3YA 2JUGA 2G7HA 1ZG5A 4CA0A 3ML6A 3MZYA 3K2ZA 3ZRGA 3FXMA 4YFKF 1ZR4A 5LHHA 5J47A 2V9VA 4Y52J 2PEXA 4ZDLA 2M0MA 1OR7C 3HPGA 5DCMB 4XICA 1V5GA 3JSOA 3ZQQA 2R7XA 2JWTA 4AM3A 2MD0A 2BY0A 4JYKA 2R7ZJ 1FPQA 3I4NJ 2IS1A 2X0LA 3HOVJ 1XGNA 2JMWA 4KN4X 1R58A 2XUBA 4OIOF 4BEHA 1MZBA 2CFOA 1QVUA 2L7ZA 2DA7A 2ZB9A 2GIZA 3BR3A 3S1QJ 5KCMA 4WF2A 1I5ZA 2GA2A 4B43A 2BYVE 1W5CC 3A0BC 1E3OC 4HLYA 4E4HA 2E36A 2IEKA 4HSRA 4GGGA 2XGXA 4G6TB 1V5EA 1R9TJ 4AC0A 1F36A 3SEQA 3M8JA 4M9SA 2FRHA 2V1NA 4KISA 1ZR2A 1S5LC 4KFCA 4XSXF 2X9DA 5D5XB 2GLOA 1RKWA 3M7GA 4BY1J 2L3DA 5C4XJ 2VBWA 2CMPA 1SVLA 1VZ0A 3D5RC 3V8JA 3AFHA 4GO1A 4BJTA 2RGVA 4ENKA 1MIJA 1N75A 2KHMA 3V7SA 2R7UA 5KNLA 2VPRA 1HW5A 3AG4H 1WI3A 2BXZA 3K4BA 2DO7A 2W25A 3K69A 3A01B 3FMSA 2EIJH 3V8KA 5EF6A 4XLFA 3IH4A 3FISA 3GUDA 3LSTA 2ISZA 3HRUA 1YW9A 2E1MC 1IRGA 3L2VA 2ZNZA 3ZMZA 1IN5A 1D1BA 1V54H 1JJ8C 1GDTA 4Q4ZF 3A1YA 3MMYB 2ZMEB 5H20A 2QKLB 3JRGA 2WC2A 2EINH 2FEZA 1WJAA 2LKSA 4X0GA 2ZXJA 4M6XA 4IX7A 3OV8A 4G6DA 1YX5A 1FNNA 2DDBA 1BIBA 3H5AA 1QU3A 2WB1A 4ESJA 4Y3OA 2R7OA 3GZ5A 4NNJA 4LGWA 1VQLI 4BHBA 5D5UB 1VI0A 5IP7J 3P9IA 2QEXI 2PJRB 3CLQA 4U0YA 4NC7A 3PJRA 1OPCA 3A2KA 1DPRA 2HNHA 5HS8A 4A0ZA 4CGZA 4RAGA 5J1RA 2R7FA 4GRIA 3JRAA 3GTMJ 3M4OJ 2F48A 1ZKGA 1H8AC 5L3GA 1JGGA 4L9VA 1LFUP 3DTEA 4F52A 1LQ1A 1ZK8A 2LYCA 3WGIA 2ZJQF 1SC7A 2MC4A 2F5FA 2KIQA 4U88A 4DYQA 2HU9A 5FD5A 2A61A 5IT3A 3CCSI 2COMA 2V26A 3OR2C 1H88C 1U0JA 3GTGJ 1D0XA 5J4YA 4PSXA 3Q0VA 1ON2A 2ZFUA 1TLHB 2JN6A 1TQMA 4LD5A 4XOTA 4ZTJA 1JHFA 4C2UA 2O0YA 5H6RA 4M72A 1SD6A 3L2QA 4HQEA 3OY9A 3RJPA 3VPRA 5HDGA 1B9MA 4CCLA 3N97A 4UHTA 4N4OB 3S2WA 3C2GA 3I53A 3ABMH 5D5VB 2KMUA 2DT6A 3OIOA 1T33A 2HOEA 2VC1A 3O2PE 2FMLA 4LB5A 2R7RA 3ABTA 3DXJF 3MKZA 4ENJA 5FGMA 5L3EA 1R00A 3JRCA 2AHQA 3PNTA 4LK1F 1X1PA 2M7AA 4PJLA 4XKCA 2BVLA 3QODA 2Y69H 3NAUA 2R5ZB 2NNYA 2BW3A 2DLLA 3CQZJ 3OWTA 2IS2A 1MNMC 3DWLE 1F43A 4FETA 1FC3A 4B8XA 4C2TA 3CDHA 1IAWA 3FWEA 3CMMA 3FXJA 1VQOI 4ANJA 4WX9A 1VTNC 2NAZA 3F8NA 5DUKA 1XMXA 1YJWI 1XX5A 4C3IJ 2O7OA 2ZMEC 3HHGA 4HAMA 1WGXA 1SANA 3L1PA 5F0HA 2Y2ZA 3FMRA 3HOTA 5DV5A 4CCMA 2FXAA 1OQYA 2XASA 5HNFA 4RAYA 2CUJA 3CLOA 3ECHA 1P4WA 3BG6A 5FB2A 2ELJA 3RQ4A 1G3WA 5JHFA 3P9CA 4DW6A 1R4NB 2IJLA 4B4CA 4KNYA 4IOCF 2XF7A 3CDIA 3MWMA 1U8BA 4E7JA 1B72A 1POGA 2OZUA 2DOEA 3GEZA 3K2AA 4OAYA 3E5UA 2MLGA 2W84A 2Y0MA 2M30A 5DD8A 2IGKA 4Z2YA 3X2QH 3LSRA 5EG0A 3F0CA 1U9NA 1FT9A 4OMZA 1IN7A 2WBMA 3OYHA 3TKYA 3GTLJ 2X1CA 3CMEI 1FLIA 3QYEA 3S17J 4JBAA 3H35A 2CO5A 2ZSHB 4X1EA 3CDLA 1T0FA 3BJ6A 2EPFA 2KL4A 4PGGA 5HNHA 5EDNA 1YRNA 3MKLA 2FA5A 5FO5A 2W4SA 2KKOA 4E70A 3KFWX 2KJCA 3AG2H 1FOXA 2YU9J 4FISA 1BR1A 4HSTA 1JKRC 2PG4A 1T38A 3U2RA 4DBQA 4G7HF 1I3AA 3DKWA 3BR6A 3S2DJ 4B09A 2ADUA 1OISA 1J7KA 1LDKB 4BE2A 1EJ9A 3TDZC 3PQKA 1LUJB 1QQIA 3K7AJ 5LBQA 3TQNA 2EH3A 4I7HA 2IAIA 4TV7A 4YEJA 5E18F 2QA4I 2STWA 3E97A 3S2HJ 4ON0A 3I59B 1FOKA 1WJ5A 4QTRA 5EGOA 2VBXA 2O8XA 5CVIA 1W7PA 4D5CA 4G7ZF 1S6LA 1J5YA 5GTHC 3VOEA 4MO7A 4I76A 2R7QA 3QPLA 3GFLA 4IHSA 2ZFWA 2KFDA 3GLXA 1SVMA 4FQGA 2LF8A 1SEUA 4AU7A 3C3WA 3WG7H 2TCTA 3EETA 1ETQA 3IKVA 5K5RA 2A3SA 3DKXA 3HC7A 1VQ4I 3E6MA 5B66C 2F4MB 2VKHA 1HA8A 3HOXJ 2EILH 3JRIA 2LDUA 2H6BA 4I09A 3OYMA 4ZC3A 4S04A 3BTCA 4R1HA 3VYRB 4HA8A 2DA4A 1XTAA 3OYJA 5K5OA 2Z5UA 4Y7NJ 1MW7A 5CVVA 5F27A 1FEXA 1U8RA 4YIFA 3IRRA 2W57A 2D1HA 4BH9A 2MGQA 1X3ZB 4Y15A 1MMSA 4HRIA 3TMOA 3OOUA 4P9UA 4PJMA 2DT5A 2EIMH 4NQWA 1X2MA 2WAQA 1W4MA 3FXQA 2M7BA 1I27A 3SXYA 5D4SA 2H94A 3R0JA 2LY2A 1N78A 1R23A 2E35A 2XPUA 1BL0A 2DYRH 2R3SA 3ZXSA 3V8LA 2HTJA 2PLYA 2EA4A 2HKOA 3CJTB 3VWBA 3T8RA 1FBSA 2IA0A 4L5IA 5L3DA 3V7CA 4XRSA 3D1NI 3ZOBA 3WU2C 3GX4X 3BQZA 4IHWA 3T8TA 3HBLA 3CCVI 4XLPF 4IHVA 2UWMA 3FXUA 2KLOA 4AIHA 3G1MA 2M4KA 3ZMSA 1G6NA 3MFKA 3ONQA 1B4AA 3F6OA 4CHUA 5EZGA 3SJMA 2BBYA 2LMDA 1MDMA 4MTDA 4IQJA 3HOWJ 3NQOA 2DBBA 5FKLA 3H3ZA 4B47A 2L01A 2XAFA 1H9TA 4F91B 1WJBA 1PUFB 4ZDPA 2IGNA 4BHPA 2VBYA 4O6JA 4QPQA 1LFPA 4DOZA 1IUYA 2VXDA 4LIVA 4HNUA 4R8HA 1UMQA 2K3FA 1R6RA 1HKQA 2I8DA 3E6DA 3I54A 2RAEA 4ZH4F 4G8XA 4UB8C 5E1ZB 1Y0UA 3TW7A 5IT9Z 2CFXA 2LP0A 1A35A 2JT1A 4KT6A 2L7MP 1UG2A 3O6BB 4ASNA 4LG0B 2HVRA 1SFKA 3V42A 1QGPA 1BC8C 4UNOA 3G1OA 1XCVA 3F6VA 4UVCA 4A0YA 1FX7A 5B1BH 3ELKA 3W2AA 3BLYA 1VQMI 3BTJA 1I3QJ 3EPZA 1W7PD 1XCBA 3IWZA 3ZQGA 1SMTA 2KPMA 3CO7C 2NRAC 3LQQA 2JPCA 2M8EA 3B6CA 1DP7P 3Q9SA 1JT0A 2VQLA 2GM4A 1BJAA 2ZNYA 4CYDA 3BR5A 3HB9A 2ECCA 3E7LA 2MG4A 3KLNA 3TO6A 1FTZA 1PDNC 1HC8A 3GBGA 4QIWN 4R79A 2N8GA 1OCTC 4B3AA 5KK1A 4CCOA 1MMAA 4D9JA 1PJRA 2Z2SB 2FUG2 2LREA 1JXSA 1LB2A 5E3OA 3K4MA 1JUMA 4ESFA 2XKOA 1OFCX 4MHGA 2CS3A 2L7FP 1QZYA 2OBPA 3HJEA 2ECBA 1U2WA 1JTYA 1QRYA 4CH7A 2B63J 3H0GJ 2DK8A 1Z6TA 3ZPLA 1YOVB 2MH2A 5TISC 1OYYA 1HQCA 5LEJA 2R7WA 2EV6A 1U6GA 3FBIB 3K4LA 1WFXA 3BPXA 4A5NA 2DPDA 2V1XA 2LKXA 1XSXA 1Y0NA 2FD5A 5DYMA 4XN3A 1M1EB 1HKTA 1V5FA 1TNSA 2CJJA 1TL8A 1DPUA 2M5WA 1ZGJA 2NS7A 1XSDA 4BXFA 2FSWA 3B6AA 1Q1VA 2ID6A 5FJ8J 1BW6A 3RPQA 3SFZA 4HBLA 2HPIA 2VB6A 4HZFA 3WTWC 4NC6A 1K83J 3O3KA 4XSZF 1ZRFA 3JREA 1DU0A 1DQUA 1IW7F 4U7DA 1GLNA 1R1UA 2LNBA 3WU1B 2VODA 2D1VA 1HLVA 3H3VK 1XDSA 1G8XA 1RZ4A 4Q48A 2BHYA 2W7NA 1BJZA 1IV8A 5GPAA 1P92A 2E7XA 2M3AA 5M3FJ 5KAFC 2HWVA 2O5RA 3ZCOA 2ESHA 2E7WA 3PO3J 4L9NA 1FP2A 2P8TA 3CCEI 4UVBA 5H2FC 4EJUA 5H6QA 3OYCA 1SAUA 2XF5A 2W00A 4F55A 1HBXG 2X51A 1DGWY 2RNJA 2O8KA 3FM5A 3WTUC 1IC8A 1R5HA 4G6QA 3PNYA 5FLXK 2AXTC 5K7FA 3J7AY 5DM7F 1KA8A 1P2FA 3BR0A 2V4JC 3TGNA 5HOOA 3HKZN 4LG3A 5FKOA 2PX9A 5CQGA 5KVRA 2WTEA 1LE8A 1MMGA 3H92A 3OIQA 3OL3A 4XLHA 2DA2A 1JT6A 2DCEA 3ULQB 5BPIA 1RR7A 4EGZA 1XN7A 1ZARA 3ABKH 3S1NJ 2FQ3A 1ETVA 4L0ZB 1X1BA 2HQNA 3ZGKA 1VQPI 5CVUA 1DGRM 3VSLA 3OS0A 1Z7LA 4RMNA 4S05A 3HL2A 2E1NA 2GAUA 2HOAA 2L5QA 3EUHA 2DK5A 4XIDA 1SVOA 3L2CA 2QSHX 4IZZA 2NVTJ 3K4JA 2P7CB 1Y6IA 3P7NA 2X6WA 4E7KA 1FZPB 1APLC 3ZQCA 3VSKA 5KAIC 2H1KA 1ON1A 2XRLA 2YX7A 4LLGF 4YELA 4N9HA 2PI0A 2PMUA 3DEUA 2L54A 5DEQA 1ZGWA 1FTTA 4HQMA 1EH7A 3W2WA 4C3JJ 2AO9A 1KQ8A 3HRSA 5B5EC 1KU2A 3UKGA 2PQ8A 1HDDC 1GHCA 2I10A 3GF2A 1P9QC 1L3LA 3NEUA 2NS0A 4IRHA 1HOMA 9ANTA 4RB1A 1H89C 3IRQA 2M34A 2BW3B 3F8BA 4HNVA 2O61A 5F1JA 2E5NA 1KU3A 3BZCA 4M3EA 2IA1A 3S3MA 2PJPA 2WY7Q 3K0LA 4X6AJ 4UUVA 3KLOA 3CC4I 2IRFG 2IT0A 1FIPA 4QLCU 1RETA 1YIOA 4XRFA 1MJ9A 4FASD 2JVGA 1MD0A 1P4AA 2M1BA 5GAGJ 3JCUC 3I58A 3W6VA 4Z6YA 1N25A 4GYGA 2PMHA 1ERDA 3BTLA 1R1VA 4I01A 2ME0A 1SFXA 3K70D 2E5ZA 1F4KA 5EEHA 4HF1A 2CW7A 1JTXA 4Y33A 1VNDA 2DYSH 2MBFA 2MLKA 3GTQJ 3IP4B 2VOPA 1MGTA 2UUZA 3S1MJ 3HPHA 3KEYA 1I1SA 2HS5A 1YTYA 1RC9A 2BY3A 4CYCB 4XR6A 3GWZA 4XOPA 2LY9A 3FF5A 4EJWA 3QYFA 2EBIA 3KPHA 3GXOA 4PFPA 3T0YA 3CCMI 2CH0A 1EH8A 3E1SA 2L4AA 4I99C 5LD2C 2QKMB 3TL4X 5J6XA 3WTSC 1YW7A 4FCYA 2VJJA 5BNGA 3E6CC 2ETHA 1YRNB 4PUSA 2QQ9A 1QNTA 5L3BA 2HDWA 5GADJ 1WJDA 2R4GA 1ZRDA 2L02A 2BGCA 4IO9F 4HYEA 1TWHJ 4BYYA 1KZHA 3KZIC 4I02A 3DU5A 4A0XA 1D0ZA 1HSJA 2KT0A 4CCNA 1R71A 3MKWB 3WHCA 5FD6A 1NK3P 1OR7A 3OYNA 1F5TA 4KICA 3LSPA 4BQOA 1ZRCA 2HXOA 2V9PA 2BZTA 1DP3A 1YE9A 2JK3A 5BMZA 2XSJC 2BOLA 1QBJA 2OCCH 2EA2A 4A3LJ 4F93B 3G1LA 2BEOA 2M4GA 4LLLA 2DT7B 2ICWG 5FKKA 4MFDA 3ERMA 2E2JJ 2FF4A 1XC5A 1O3RA 1WVRA 1OLTA 2CYYA 3BROA 4BKXA 4G7OF 2DOAA 3CJRB 5IYDJ 1IN8A 3DEWA 4V2FA 2HYFA 2XKPA 3SEZA 1Z9CA 2STTA 2DFEA 2XGEA 3CMAI 1GXPA 5HLIA 2NOGA 5E3MA 2CQKA 2ESNA 1EA3A 4HV6A 4BQNA 4WWCA 1FSHA 3ZP5A 1OJLA 2LR8A 3LWFA 2K9SA 3ZN0A 1R36A 4A3FJ 3BOQA 4XBFA 1KQ0A 1D1CA 1FYMA 1WJEA 4AUXA 1R5GA 3KEQA 2DMPA 3CF2A 2OF7A 2X6YA 4LMYA 5FRMA 2BVMA 3E5QA 4Y17A 3J7ZI 2CQ7A 2FU4A 3OYFA 2ISYA 2MD5A 3PL8A 2OV7A 5F0CA 4EEFG 5IP9J 1QHGA 3HG9A 3GTOJ 1BI1A 4LIUA 1MKMA 4BGDA 3F9KA 1R5ID 1IF1A 2R7SA 1YJNI 4L0YB 3RKQA 3K4KA 5E1WA 2E19A 4CDGA 5D6FA 4AVZA 1T08B 4BNCA 1BA5A 4IVNA 4BDYA 4MTEA 4IHTA 1RPWA 4G9YA 2P5KA 4IL6C 1AA7A 5DD4A 3SYTA 1AKHB 2NNNA 4ZYDA 2P0WA 2FQ4A 4D1QA 4WXHA 4XKWA 4A3KJ 3AG1H 5F64A 1YHQI 3H3UA 3OL4A 3I56I 4U0VA 3DKYA 3M8EA 4HG2A 5D8LB 2F5CA 4DZPA 4FTHA 4RGUA 4XLNF 1SFOJ 1ZN2A 3RCOA 2XC7A 1B1BA 3TO9A 1J75A 3PM1A 3O8GA 1RESA 2UXNA 2K85A 2CWEA 4V2GA 2VQHA 2KDZA 4E7HA 4M71A 2LD5A 1T0FC 4ENNA 1OCRH 1JJ6C 1D5VA 3BPVA 1JHHA 2ZO4A 2XDVA 3ZN1A 3LSJA 4NUBA 3JTHA 1MDMB 5HDNA 4EGYA 4I2OA 2YSRA 5GAHJ 4A2UA 1QPMA 3OS2A 2EFNA 3FMQA 1LDJA 3ZQ7A 2CW0F 2CW8A 3JAMK 3CUOA 5F6FA 3IUOA 3IAM2 4JQFA 1Z7UA 5DCMA 5EYRA 4W1UA 1MNDA 5ICCA 1LPQA 4RLFA 1QA6A 2W48A 4RM2A 4QWQA 4C9YA 5LHIA 4UVAA 5K5QA 1GV2A 1QHHD 4YRVA 1HSTA 3SFIA 1O7LA 1HW2A 4FE4A 2XAJA 4EV0A 4AIJA 1V3FA 1K4SA 2OJED 2V7FA 3BQYA 3QP5A 3FIWA 1A6QA 4AYBN 1X58A 1TWFJ 2XV4S 1ZLKA 3FZVA 1R1TA 1T98A 3RZDJ 2FBHA 1TW3A 3JW4A 2RKHA 3ZQHA 4WXCA 1IN6A 4DJAA 2P81A 1O3TA 1B8IA 3DP7A 3BG5A 3FK6A 1T6SA 2W82A 3CESA 4O5VA 3CD6I 4WCGA 1USTA 4Y4RA 1T39A 3PNVA 3KYCB 4QSHA 2Q8KA 2IW5A 5HODA 4BHCA 4EJVA 2HOTA 4LLNA 2YU3A 3B73A 4PSWA 1WPKA 4A69C 3WTVC 2OA4A 3COAC 3MCZA 2DPUA 1OCOH 1WH5A 2G0EA 2RNGA 4HPQA 3HOUJ 3E5XA 2LG4A 1Z05A 2DFIA 3OYEA 3CCRI 4V19K 4M6VA 2YX4A 1LVAA 3CCYA 2O9LA 3L2UA 5LLQA 2XB0X 1QZZA 2HOSA 3Q9VA 2VN2A 3A01A 2DFFA 2XVCA 3DFGA 2R7VA 3I4PA 2GIVA 3GCMA 4MGRA 1G3SA 3R60A 4BACA 5M5XJ 1O4XA 2MSYA 6PAXA 1D1AA 1NH3A 2LC2A 1W36D 4D5FA 2HVSA 3U9GA 2F4IA 2KDOA 3LQRA 4II2A 4RBOA 2O3FA 1X4OA 3JSPA 2DXIA 3VB2A 1K78A 2WV0A 2EZLA 1VQNI 1Z0XA 1ZG1A 3RKXA 1IV6A 3K4CA 1ZTRA 3SDBA 4BL0B 3PFIA 2QGUA 2XROA 2MW8A 4LK0F 3MAJA 1W1WE 1OCPA 2M9HA 1IUFA 4XKBA 2A05A 5CJ9A 2K40A 2HPMA 3G4SI 1XGOA 3RTRA 4FT8A 3OS1A 2PJRA 2JA6J 3ZMUA 3HTUA 3CUQB 2EZHA 3I64A 3OYGA 3BCAA 4L9JA 2JRTA 3F21A 3LAPA 3KP6A 3D5LA 1VQ8I 1D0YA 2IPQX 3UNGC 2K02A 4CZCA 2LKPA 4MFEA 4IJAA 2XAQA 5ERIA 1EV7A 4PK4A 1BC7C 2VL8A 5TGTA 3S15J 2VI6A 4EATA 3T1BA 1WCMJ 3GMEA 1HDPA 4A3BJ 1ZREA 3K9TA 3KETA 3A4CA 1N77A 2LK2A 3QOEA 2EWNA 2V1DA 4M3FA 2FBIA 1AOYA 3EUKL 1O3QA 4DZJA 4AYBA 4GYIA 4E7SA 1CF7A 5CPRB 4OWRB 2RREA 1CGPA 3SHFA 2F6CA 3MZHA 4E7IA 5EZHA 1QO0D 2L9VA 3RPUA 4LB6B 2H8WA 3S16J 2EFOA 2QENA 2VJ5A 1RKTA 2HXIA 2HDCA 3J7AO 3LNQA 1SD7A 5EEGA 3W3CA 3W6JB 2D5VA 3GZ6A 5E17F 1P6RA 5FLXZ 3M1EA 2L7KA 1VQ9I 1V55H 3BCBA 3JRFA 4XKVA 2OTLI 3QP6A 2IS4A 4L9TA 1IJWC 2Z1DA 4CCKA 1Q1HA 2MYSA 2QBYB 2DJNA 3H1CA 1XGMA 3VYSB 2KZGA 3LOCA 1TTYA 2M0CA 1T8IA 2K3PA 3E6BA 3EQLF 5AIQA 2HEOA 3CC2I 3C18A 5KHDA 4OIQF 1S7AA 1TP4A 5LFAA 2LSOA 3JR9A 2KP6A 3GO5A 2GOXB 3CO6C 4XL9A 2EV0A 1LEAA 2DOFA 4MEYF 1YS7A 3ESWB 5F04A 1FMVA 2GXAA 2DODA 2YR2A 1GUUA 3ERED 4RGXA 2VOOA 4DBRA 3HGGA 2LBFA 2VQCA 1F9NA 4I6ZA 1BR2A 5K1YA 4BXUA 3FXRA 4UUSB 5E1XA 2KZVA 3BG7A 4LJZF 4DNCA 3M1CA 3CCJI 2LY1A 2CV2A 2V6CA 1G3YA 2XB5A 4MNUA 2ELKA 2RV8A 2EFWA 4KIBA 3W2VA 1G59A 4CICA 3KP4A 4II3A 2K4BA 4OINF 1MMNA 4L5JA 3TDUC 1XDUA 1B59A 1E2XA 5HLGA 4CSWA 3CUQC 1HCRA 3DPLC 2IS6A 1IN4A 2DAOA 1A36A 4RA2A 1X1AA 4XORA 3MD2A 4IQ4A 1R22A 2CRGA 1SD4A 1U5TA 2XRNA 2NOJB 3FHNA 1O57A 1GXQA 2A6HF 4OAZA 4BEHB 5K7ZA 3M8FA 3G71I 1GVJA 3FXKA 2IA2A 1I1GA 4QPOA 3K70C 4XLCA 2ZXHA 1R7JA 1LJ9A 1X1DA 2FMYA 2FJ1A 4F3QA 1EF4A 5LRRA 2DMQA 2DQRA 2VT3A 3OYDA 3SZPA 3TOBA 4B44A 3VDXA 2A6EF 3CP2A 4FE7A 1DDNA 3V4GA 1A31A 3K6GA 2B0LA 3BR1A 2B7EA 2E60A 3C7JA 1MH4A 2GBYA 1Y56A 4IRGA 2V9KA 3J80K 5FRNA 2IVMA 1GVDA 2R7TA 4H0EA 4A5MA 2CQNA 2ID3A 3QAHA 1J2XA 2JPBA 3WTYC 4E7ZA 2F5VA 1FMWA 2WAFA 1JUPA 3I59A 3BC8A 3DPUA 3KE2A 3RPUD 3KP5A 3VYTB 3KX2A 4HW0A 4JP0A 3I5UA 1S9HA 2RVCA 4B1RA 1W0TA 3ASOH 2JA7J 3GYHX 1LNWA 2ZSIB 4JOMA 4XMYA 3HGYA 4ZJZA 2CQXA 3OYLA 2JA5J 1MBJA 1HXDA 2LLKA 3N4MA 2Y48A 2VE8A 1E0EA 3MVPA 3OYKA 1YQAA 1BI2A 1ZH5A 3BG3A 3R0AA 3EUHC 3H9QA 2GZWA 5HS9A 3DLAA 2A68F 3WTZA 2JUCA 2ME6A 4KDPA 4ZDOA 1IGNA 2H09A 2Z3YA 2V6EA 4JK1X 5J4VA 1ITYA 1R4MB 3F8CA 3BJAA 4E6KG 1ACIA 4NDLA 3NRVA 2K5CA 2OZ6A 1MJBA 2IP2A 4XQFA 2TRTA 3HOZJ 3WGGA 2XGDA 1IDZA 5F08A 4A6DA 5AIPA 1UJ8A 2K4JA 1K6OA 4S0HB 2L4MA 4XRMA 1VQ5I 2RQPA 3LSHA 3L9FA 2MA3A 1BI3A 3DTIA 1PP8F 1LKXA 1QZEA 1E17A 3HM5A 5J1YA 2JA8J 1ZG3A 5E3LA 2F4OB 1ZLJA 5J8FA 1BOAA 3KYDB 2E2HJ 2IXSA 2HQRA 2Y0SN 1UCRA 1ONVA 4YG2F 1BOBA 4A12A 3RSNA 3KP3A 4U0WA 1WHUA 4AVPA 1YO5C 3A03A 1S3JA 2W1OA 1TZLA 3PSIA 4KITB 1YI2I 2H27A 2XAGA 3K1NA 4AD9A 4EVIA 4KMFA 2HFHA 3Q0UA 4HX4A 1IXCA 2CUEA 2XIGA 2YUSA 5A2QK 1Z6RA 2VJ4A 4DYCA 3HYIA 3G73A 3ISPA 2WA0A 2NVYJ 1QVTA 5BOXA 1FWZA 2QSGX 1E3PA 1PUFA 2EFQA 1KU9A 2I5UA 3DBRB 2FOWA 1BBYA 1IXRC 1DUXC 2FOKA 1F1ZA 4P5OA 1U9OA 3J81K 4Q47A 2JJ7A 3GLLA 3H9GA 5FLVA 3KCCA 4DGWB 4PJNA 2CG4A 2DMNA 2BY2A 4PDKA 2KRCA 4UXNA 2XPWA 1MBKA 5K7HA 3IV5A 3ASNH 5IY5H 1I6HJ 2CU7A 4EM1A 4N9IA 3GW2A 2AXLA 2OD5A 4LG0A 4A3EJ 5JFRA 4WXDA 1UHMA 2NS8A 2WB1N 2HI3A 2JA2A 4E7LA 1Y8RB 4YIIA 1RUNA 2CV0A 3O8HA 1ZGAA 1YITI 3DPTA 4D7NA 2H8RA 4MQVA 2L2OA 4IXAA 2DTRA 3TW6A 4MQ9F 4OIRF 3C2BA 1FBQA 4G94A 1ULYA 2W85A 3HOSA 1X3UA 4DQ2A 3DU6A 3IWFA 2WWYA 5DUIA 1L0OC 4U87A 3QYBA 1HW1A 4A3IJ 4B48A 5E79C 1OCZH 3G2BA 4EMSA 2DU9A 3DBHB 2VJIA 4C3HJ 4EM2A 3DQVC 4GDFA 4Q5SF 1FBUA 3JAMZ 3LMMA 3RYRA 4KYWA 3HZJA 1MBGA 2X6XA 4IPAA 2HQAA 1FYLA 5BPDA 2DQLA 1MH3A 3HOYJ 3G3ZA 4YFNF 4NHJA 2K9MA 4ESBA 5ILUA 1Z67A 2LFBA 1B72B 4LFUA 2QUFA 3HKZA 3BJOA 2L0KA 3EYYA 2OQRA 2Z16A 3QRFF 1O3SA 2OAZA 2BV6A 3L7WA 5EG0B 1X3WB 2ZBKA 4PGHA 3H5NA 2Y0SA 3GFJA 5LRSA 5HDKA 1UHWA 3E3VA 1B8IB 1KQ9A 3KEOA 2GA1A 3UR3C 3V7RA 3ZR8X 3TEDA 1FOWA 5JLWA 4RLQA 5D5WB 2QLZA 2QWWA 4BQQA 4M9ZA 2HVQA 5TJJA 2MH9A 4RGRA 4MLOA 4P96A 3CP8A 3FKIJ 4A3MJ 3FXOA 2G7UA 2XGCA 2C6YA 3IHUA 1PP7U 1OCCH 1U3EM 2HDDA 3HTSB 4ITVA 4YIRX 2TDXA 2JQ7A 4CXFA 1VQ6I 3OIPA 2VBZA 5J1UA 2RN7A 5FLMJ 4M3GA 1JE8A 1V4RA 2BY1A 4JX5A 4P1WA 1D8JA 1W36C 3QPTA 5ICEA 4FX4A 1X2NA 1YX3A 2EV5A 2IGMA 2VKEA 2QSFX 5CLSA 1ZYRF 1Y1WJ 3F72A 2M87A 3FDYA 3BZ6A 4JX6A 5EGOB 2WADA 1UHSA 4HX8A 5F0FA 3NARA 3LSGA 3QPHA 1W7PB 2JSPA 3IH3A 3Q3SA 4KN7X 5J8CA 3LAJA 2CV1A 2Z9OA 2Z99A 2OCEA 3OMYA 1K78B 1OYIA 3PQJA 1TQIA 1K6YA 2MC3A 2X1DA 3F23A 1WRJA 4PCQA 5GTIC 4N0BA 1WQ2A 3AG3H 5LHGA 1BN5A 5JR3A 4A6EA 4D0PA 3HRTA 3EYIA 3JRDA 4J19A 1ETOA 4IRIA 4RAZA 4OIPF 2KIMA 4C30A 2P6SA 2NVQJ 4W97A 3HRMA 3HSFA 2WV1A 5CKTA 4J00A 2DA3A 1YW8A 1Y1VJ 2R92J 4UB6C 2EJRA 4PZJA 1KYZA 2UZKA 1IRFA 3GFMA 3ABLH 1I39A 1MBFA 2V79A 4BJ6C 1K79A 3Q5FA 4BE1A 4IHYA 1WKMA 2CQQA 2AQEA 5JVGF 2Q1ZB 2VASA 2EZKA 2LTPA 1MBHA 3H5RA 2M2EA 4NQWB 3VYUB 4RDUA 3JRHA 4BXXJ 3EUAA 2R5YA 3IH2A 1RRJA 1ETWA 1ODDA 2DFHA 1YYVA 2VXZA 3HHHA 3A0HC 1CF7B 4A3DJ 1UZCA 1MBEA 1KGSA 1Z21A 1G3TA 2LRDA 3FK7A 3ECOA 4G12A 5GP9A 4BAYA 3N05A 2VQGA 4YFXF 3K1MA 1ZHFA 2Q2EA 3S3NA 1HF0A 1TW2A 5FKMA 1BIAA 3SDGA 4ZYGA 4ETSA 4ZZDA 4PJ0C 1K61A 5F1RA 2H6CA 3QWLA 2Y9YA 3QU3A 4HF2A 2ZXIA 2P4WA 4FX0A 1UELB 2HYGD 2M45A 5DDGA 1C0WA 1DU6A 3CMYA 4KT5C 3HUGA 5TRDA 5ICGA 5B1AH 2PMZN 2DJIA 3QOPA 4JX4A 4XN0A 1TNTA 3T5XA 3WG9A 2QQAA 5BQTA 3LA2A 2VE9A 3W6KB 1Z3XA 4L18B 2MABA 5JHUA 3K1PA 2ZC2A 1D8KA 3WHBA 3TP0A 1ETKA 2P5VA 3CTAA 3DF8A 4J01A 1BR4A 1KU7A 1WI9A 1NG6A 5FFXA 4EQQA 3C1DA 5IYBJ 4M74A 3WTXC 2K7LA 2LOOA 4I0BA 2XAUA 3ABUA 1S8NA 4HV5A 2FNAA 1WH7A 2VLAA 4XM3A 2L9SA 2FBKA 4IEJA 2HYJA 2OUMA 2VIXA 2LBFB 4L5EA 1OYWA 1Y8QB 3RIRA 1YLFA 3GFIA 1JKQC 4FHTA 1Z1DA 3SQNA 4DYRA 3CF5F 3ZQIA 3F8MA 3BR2A 3M3YJ 2MFZA 2CSOA 5M5WJ 2ZKZA 1EKEA 1WJCA 4M3BA 5J40A 5HLHA 3Q0WA 3WE3A 3FHZA 1UAAA 5EJCA 2DI3A 1P4XA 5IPAA 1OMIA 3TO7A 1XG1A 1Z91A 2WAQN 5IOYA 1YJ9I 1IRZA 2BE5F 2E34A 4H4KC 3C2HA 2Y30A 4CYCA 2KRFA 1SD5A 2QVOA 4NB5A 1BI0A 3S1RJ 1U5TB 2JZYA 2FX0A 2W24A 4GCVA 3OSFA 1H9GA 2HGCA 3LFUA 3CCLI 2CUFA 2KIUA 1K4TA 1YG2A 2DA6A 5LGNA 4RM3A 3AL0B 1A04A 4BDZA 3J7YJ 2EB7A 1ETYA 1X1CA 4B3XA 5D4RA 5DS9A 3EDPA 1MJAA 3LA3A 2R93J 1LEBA 1JGSA 2NYXA 5CQEA 4U7BA 1IXSB 1NTCA 2PBIA 3JTGA 4BS9A 4F92B 4K2EA 3CC7I 3G6EI 1JI8A 2J5PA 2L9RA 2ZMEA 2NVUB 3HIFA 5C44J 1UG0A 3DEEA 5GAEJ 3I9V2 4NBQA 1J0RA 1FSEA 1W5SA 2X4HA 4CCJA 2D2WA 5GPCA 2OC6A 4IKFA 1BW5A 3PIPF 5L3FA 5D8KB 2DDAA 2QYOA 1RI7A 4I98B 3NWTA 3J80Z 3K4NA 3I4MJ 5FKNA 3WGHA 3QPSA 5AONA 4AIDA 1ZAOA 2PMZA 1P7IA 3CCUI 3RDIA 4KA4A 4ZYAA 5JVTA 2AQFA 3GTKJ 1WJFA 1YS6A 2DMTA 1XPXA 2QZ8A 4OU0A 1BM9A 5M3MJ 2O6GE 1I6XA 2Y31A 1SFEA 3R4KA 2BHZA 5FFZA 3S3OA 2OPTA 4OMYA 2ZJPF 2K86A 2KIFA 2OQGA 5FROA 3I55I 1J9IA 2ZXWH 4KIFA 3P9KA 2M8GX 3TOAA 3S93A 3WODF 2VT2A 1USSA 2P6TA 3RKWA 4CO8A 2K9LA 2EIKH 2D45A 1WSUA 5IP6A 4RB3C 4HDUA 2A5YB 3PSFA 5CVJA 4RS8A 1S7OA 1T95A 5ILSA 3S32A 3I0TA 4D7MA 3ZMVA 3ZQLA 3BDDA 3OYIA 2O03A 2Q0OA 2UV1A 3WE2A 2F5DA 3U21A 3QU6A 2ZJRF 2OTJI 3MEXA 4ZZLA 1AKHA 2YS9A 3LA7A 4HNTA 5EEAA 2R0QC 1CQTA 2VC0A 1LE8B 5JI6A 1S29A 2BXYA 5E3NA 2XPVA 4IHXA 1Z77A 1JKPC 4GFBA 4KIGA 1U5TC 2LF7A 3ZMDA 2HQ5A 3HXLA 2EK5A 3NWSA 4EJOA 1NHAA 4A93J 2COBA 5DCFA 1WWXA 1VFCA 2GXBA 2R5ZA 2CUZA 1SAXA 3RI4A 3PFYA 3AL0C 1I50J 4P9FA 1R49A 4BBSJ 2A69F 2QQBA 2QQ8A 1FIAA 3H36A 4ABZA 3ROUA 2VONA 1A5JA 3BY6A 5ILVA 3F3XA 1VF9A 4PJJA 1NK2P 1OKRA 3WU0A 1LVKA 3IAS2 1MNEA 3K10A 5ICFA 3DBLB 4AWXB 5A2QZ 3D5SC 1IG7A 1FYKA 3RZOJ 1FJLA 1IO2A 1HKSA 2RDPA 4OOIA 4RGSA 2UXXA 1AHDP 1GT0C 3M9AA 1ETXA 4M9XA 4CUGA 3VEPA 5LGTA 3F22A 1XSVA 2LVSA 4BBRJ 1TBXA 3J81Z 4HEA2 1IRXA 2K9QA 2X48A 1TT5B 5CYVA 1ZQ3P 2B9SA 3MQ0A 3KIOA 3PO2J 1W0UA 2K27A 2NVXJ 1UB9A 1X19A 3WTTC 2V1UA 2HR3A 3RYPA 2ELHA 1RNLA 1XGSA 2X6OA 5LEKA 3DV8A 1P7JA 5D6EA 2OU2A 4XK4A 1K7AA 3M07A 2AS5F 2A07F 2X1EA 3VFZA 4M73A 1D3YA 1MSFC 1IDYA 3KP2A 1XD7A 3IL2A 2J5OA 1FY7A 5E20A 3I71A 2ZJ2A 2H1LA 3H0DA 4HOBA 4KJZA 1RUOA 4KUMA 4I0AA 2DA1A 1QPIA 4UV9A 1T56A 5IOZA 2GOMA 3PIOF 3PUBA 3GZNB 2XF6A 3TBIA 3BWGA 2ACJA 3BP8A 2HKXA 1EH6A 5BS6A 1NG7A 2ZCWA 3DLLF 2E1CA 1STZA 1TWCJ 3ZMTA 3MKYB 1PUEE 3PUFA 5L3CA 2P7VB 3A02A 3P5JA 2DN0A 4XONA 3L00A 1S7EA 1SMYF 4XNFA 2DMUA 2Y75A 4BE0A 3KZYA 5CVRA 4BQAA 4M6YA 2CGPA 3IC7A 4ZYHA 3LL7A 1TWAJ 2WAEA 1SFUA 4Y13A 4UV8A 4ZTFA 2JVHA 5J3LA 3S8PA 3DCFA 2VPLA 1JKOC 2DA5A 2FE3A 1JUSA 1UFMA 4A3JJ 2FNPA 1Y39A 3GTPJ 2L9NA 3FM3A 3D0SA 5HVQC 3S14J 4IOAF 2IGOA 3CZ6A 1O7FA 3MZ8A 3OR1C 4A3CJ 4RB0A 2DW4A 5HLTA 3CUQA 4IF4A 4A3GJ 1PVEA 4HX7A 3RKYA 4O3MA 3IKTA 2HZTA 4HDVA 1RR8C 2HZDA 4DIQA 1REPC 1T2KA 2P5LC 1J09A 4PFOA 2JTVA 2LH9A 2X85A 3BG9A 2WY8Q 2GQQA 1MSEC 1XS9A 3R6SA 2G9WA 1WZ2A 5IYCJ 5M5YJ 4CZZA 3B02A 2XSDC 1ZELA 4M3DA 2R7DA 1XB4A 4XLAA 1GV5A 3LFKA 4BUPA 3OOPA 3AAFA 3E0JB 2KJBA 3L09A 4P55A 1A6IA 3LSKA 3HDDA 1D5YA 3AKZA 1IZ1A 1TWGJ 2VUMJ 1KYWA 2IBDA 4HF0A 4C2MJ
chains in the Genus database with same CATH topology
3OIPA 4ZDPA 2IGNA 4P1WA 1KONA 4QPQA 1LFPA 4DOZA 1W36C 2VXDA 4XLEA 4LIVA 4DJAA 4HNUA 4N4NB 3FBNB 1YX3A 2IGMA 1TT0A 2W82A 1R6RA 3CESA 2I8DA 4Y4RA 2VKDA 3PNVA 3FDYA 3OYAA 2WADA 4LITA 2RQQA 4PSWA 3LSGA 4KT6A 2JSPA 3CJQB 2CV1A 3LSMA 2KRHA 3OMYA 3OYBA 2RNGA 2HVRA 1SFKA 3LSIA 4HPQA 3V42A 1K6YA 2LG4A 2X1DA 3OYEA 3KYLA 3L2UA 4BJ5C 3W2AA 3BLYA 3EPZA 2E1MB 2R7VA 4NC8A 4C30A 3L2RA 4J00A 2KPMA 3H9JA 3I3LA 5CKTA 4BACA 2A5WA 2VQLA 1D1AA 1MMDA 2Q2EB 2LC2A 1W36D 4BU2A 2HVSA 2F4IA 2KDOA 4II2A 4BJ6C 3L2WA 3DTKA 1X4OA 2DXIA 3GBGA 4BE1A 2KQRA 2A6TA 1PYVA 3K4CA 4R79A 2AQEA 3SDBA 4BL0B 4CCOA 1X4PA 1MMAA 2Q1ZB 2VASA 1PJRA 2Z2SB 4D9JA 3H5RA 2FUG2 2LREA 3SZGA 3FKJA 4NQWB 3VYUB 3EUAA 3HUGB 3K4MA 4XKBA 2HPMA 3RTRA 3OS1A 1Z3YA 2PJRA 2JUGA 2VXZA 4CA0A 3OYGA 2CS3A 3BCAA 1Z21A 3ZRGA 2LRDA 3N05A 2VQGA 3D5LA 1D0YA 3S3NA 3UNGC 4CH7A 4ZDLA 2M0MA 4CZCA 1OR7C 3HPGA 1V5GA 3ZQQA 2R7XA 2MD0A 4PK4A 2R7WA 2IS1A 2VL8A 5TGTA 4BEHA 3FBIB 2CFOA 3K4LA 1WFXA 2ZXIA 4EATA 1UELB 4XN3A 1N77A 3A4CA 3QOEA 5KCMA 3EUKL 1V5FA 4B43A 2DJIA 4XN0A 4AYBA 4E4HA 1Z3XA 4E7SA 4HSRA 2MABA 5CPRB 4OWRB 4BXFA 4G6TB 2RREA 1V5EA 2F6CA 4E7IA 3SEQA 2HPIA 2VB6A 3M8JA 4J01A 1BR4A 1DQUA 1NG6A 2V1NA 4KISA 1GLNA 2VJ5A 2LOOA 2XAUA 3W3CA 2VLAA 4XM3A 2L9SA 2LBFB 2OUMA 2VIXA 1G8XA 2L7KA 2W7NA 2CMPA 1VZ0A 3BCBA 3D5RC 4XKVA 3AFHA 2IS4A 2M3AA 4BJTA 2Z1DA 4CCKA 2MYSA 2O5RA 1N75A 2KHMA 3ZCOA 2R7UA 3VYSB 5KNLA 3OYCA 2MFZA 1SAUA 3K4BA 1WJCA 2XF5A 2W00A 2K3PA 4F55A 2X51A 1DGWY 5KHDA 1UAAA 4XLFA 5LFAA 2KP6A 2GOXB 4XL9A 3PNYA 2E1MC 3J7AY 3L2VA 2V4JC 1FMVA 1D1BA 4H4KC 5HOOA 4LG3A 3C2HA 3A1YA 4DBRA 3MMYB 5CQGA 2LBFA 2QKLB 2VQCA 4X0GA 1MMGA 1BR2A 1WJAA 3OIQA 3OL3A 4XLHA 2DCEA 4IX7A 1YX5A 2KZVA 3BG7A 3H5AA 1QU3A 2WB1A 3M1CA 4Y3OA 3LFUA 2LY1A 2CV2A 2R7OA 1X1BA 3ZGKA 4NNJA 4RM3A 3AL0B 4BDZA 3W2VA 1G59A 1X1CA 4B3XA 1DGRM 3VSLA 4II3A 3OS0A 1Z7LA 4RMNA 3HL2A 2PJRB 1MMNA 2L5QA 4NC7A 5CQEA 4U7BA 3PJRA 3A2KA 4BS9A 2HNHA 4CSWA 4F92B 4GRIA 4IZZA 3DPLC 2IS6A 3K4JA 1JI8A 1X1AA 1Y6IA 3DTEA 4F52A 2LYCA 2X6WA 4XORA 4E7KA 3MD2A 2MC4A 4IQ4A 3VSKA 1UG0A 2HU9A 3DEEA 3I9V2 2NOJB 3FHNA 4OAZA 4BEHB 4YELA 4CCJA 2V26A 3OR2C 4QPOA 2OC6A 3K70C 1U0JA 4XLCA 4IKFA 1D0XA 2ZXHA 4PSXA 3NWTA 3W2WA 3K4NA 2ZFUA 1X1DA 4F3QA 4XOTA 2PMZA 1P9QC 3OYDA 4ZTJA 4ZYAA 4C2UA 4B44A 3VDXA 3CP2A 2AQFA 3L2QA 3OY9A 1WJFA 2BW3B 3K6GA 4CCLA 2E5NA 2E60A 4N4OB 1Y56A 3S3MA 2V9KA 3C2GA 2WY7Q 3S3OA 5FRNA 2R7TA 2KMUA 5FROA 2DT6A 4E7ZA 2F5VA 1FMWA 3S93A 2R7RA 4FASD 2WAFA 2JVGA 3RPUD 3BC8A 3DPUA 3MKZA 3VYTB 3KX2A 2K9LA 1ERDA 3PNTA 1S9HA 2M7AA 4PJLA 4XKCA 3K70D 2BVLA 3PSFA 2ZSIB 2E5ZA 3QODA 4JOMA 4XMYA 4ZJZA 1T95A 3S32A 3OYLA 2BW3A 2CW7A 3OWTA 4Y33A 2IS2A 3IP4B 3OYIA 3DWLE 4FETA 1E0EA 3OYKA 4C2TA 2UUZA 2UV1A 3U21A 3EUHC 3H9QA 4ZDOA 3HPHA 3DLAA 3CMMA 3KEYA 4HNTA 4XR6A 4ANJA 2V6EA 3QYFA 4E6KG 4PFPA 2CH0A 3E1SA 2K5CA 3HOTA 5LD2C 2QKMB 3TL4X 3HXLA 3NWSA 4CCMA 4XQFA 5HNFA 2VJJA 2CUJA 3BG6A 2CUZA 4PUSA 3PFYA 3AL0C 2ELJA 3RQ4A 5JHFA 2HDWA 1WJDA 2R4GA 2XF7A 3LSHA 4PJJA 3DTIA 3DU5A 1LKXA 4E7JA 1D0ZA 4CCNA 1LVKA 3IAS2 1MNEA 3K10A 4OAYA 3MKWB 3D5SC 2IGKA 3OYNA 2IXSA 4BQOA 2WBMA 3OYHA 1BOBA 1DP3A 1YE9A 2X1CA 3RSNA 3QYEA 2XSJC 2BOLA 3H35A 4CUGA 4F93B 2M4GA 2DT7B 2ZSHB 5HNHA 2KL4A 2W1OA 1TZLA 3PSIA 4KITB 4HEA2 1IRXA 1OLTA 2W4SA 2DOAA 3CJRB 2VJ4A 3SEZA 1X19A 1BR1A 4HSTA 2WA0A 4DBQA 1EA3A 4BQNA 1LDKB 4BE2A 2X1EA 4P5OA 3H9GA 1D1CA 1WJEA 4DGWB 4YEJA 4PJNA 3CF2A 2X6YA 5FRMA 2BVMA 2KRCA 1WJ5A 3H0DA 4KJZA 3OYFA 3PL8A 2OV7A 1QHGA 3HG9A 2GOMA 4LIUA 4BGDA 3F9KA 3PUBA 4E7LA 2R7SA 2JA2A 2R7QA 2CV0A 3K4KA 2XF6A 3TBIA 3DPTA 4AVZA 4AU7A 2L2OA 4BDYA 1NG7A 3SYTA 1AA7A 2P0WA 4D1QA 3MKYB 3DKXA 3HC7A 4XKWA 3OL4A 4XONA 2VKHA 3HOSA 1HA8A 3DU6A 3DKYA 4XNFA 4HG2A 4U87A 4BE0A 3QYBA 4B48A 3OYMA 3G2BA 4ZC3A 3LL7A 2VJIA 2WAEA 3RCOA 3VYRB 3OYJA 3DQVC 2XC7A 3LMMA 1MW7A 4ZTFA 2JVHA 3S8PA 2VQHA 4E7HA 2VPLA 2X6XA 1T0FC 4HRIA 3TMOA 2HQAA 3OOUA 2L9NA 4PJMA 2XDVA 2K9MA 2WAQA 4NUBA 5HVQC 2M7BA 2IGOA 3CZ6A 3OR1C 3HKZA 5HLTA 2LY2A 1N78A 3OS2A 2Z16A 3ZXSA 2CW8A 2HZDA 4DIQA 3IUOA 3VWBA 3H5NA 3IAM2 2Y0SA 1J09A 4PFOA 2LH9A 4JQFA 2X85A 3UR3C 3ZR8X 2WY8Q 4RLQA 1MNDA 4BQQA 2HVQA 4RLFA 4RM2A 4MLOA 4C9YA 2UWMA 3CP8A 2KLOA 1QHHD 4YRVA 1ZELA 2M4KA 4BUPA 4XLAA 3ONQA 3E0JB 4ITVA 3LSKA 2V7FA 4IQJA 3AKZA 4B47A 4F91B 4XOPA 1WJBA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5KHD A;  2MC4 A;  4OAY A;  4OAZ A; 
#chains in the Genus database with same CATH topology
 3BTI A;  2PN6 A;  4RAF A;  1KON A;  2PFB A;  1G4D A;  1YFH A;  3BZK A;  4XLE A;  1FOY A;  3OSG A;  2EZI A;  3FBN B;  4N4N B;  3SZT A;  2KIS A;  3CJN A;  5C3E J;  1TT0 A;  2RC4 A;  2JRM A;  4HLX A;  3FX3 A;  4EJT A;  2VKD A;  1FP1 D;  2EFP A;  5HS7 A;  3OYA A;  1B6A A;  3CCQ I;  1J59 A;  2F5E A;  2RQQ A;  3GVA A;  4LIT A;  2XHK A;  3HSE A;  3KP7 A;  4BY7 J;  3CJQ B;  2E71 A;  5JLX A;  4LOC A;  1W5T A;  1H0M A;  2E1O A;  3LSM A;  2KRH A;  3RQI A;  3OYB A;  4ENM A;  2QF7 A;  3HSR A;  1TC3 C;  3LSI A;  3JRB A;  2YPR A;  5ED4 A;  4EM0 B;  1XMK A;  1S72 I;  2QBY A;  3GTJ J;  1G2H A;  1LFB A;  3FXL A;  2E2I J;  1XMA A;  5LGU A;  2VKV A;  3KYL A;  3QQA A;  2GWR A;  4BJ5 C;  1AWC A;  5DTD A;  2R5Y B;  4UUT A;  4ZYE A;  2F2E A;  4WK8 F;  3VOD A;  5IT9 K;  3ZQF A;  5E8G A;  4UY8 I;  2JSC A;  4KMU X;  1ENH A;  2E1M B;  4NC8 A;  2HTS A;  3U1D A;  3L2R A;  4F7Z A;  3H9J A;  3I3L A;  1YIJ I;  1B9N A;  1ORK A;  4MIM A;  2Y9Z A;  3MN2 A;  4XRS G;  5DM6 F;  2A5W A;  1TQP A;  1MMD A;  2Q2E B;  3TP3 A;  3REO A;  4BU2 A;  3HEF A;  5B3S H;  2QCO A;  3KZZ A;  2Z33 A;  2XAH A;  3L2W A;  3DTK A;  4MEX F;  2DTZ A;  1VQK I;  2NXN B;  4UUS A;  4AIK A;  5E8I A;  1U78 A;  2KQR A;  2A6T A;  3R61 A;  1PYV A;  1RIO H;  3F8F A;  1X4P A;  2K9N A;  3BT9 A;  1VQ7 I;  3SZG A;  3FKJ A;  2QM3 A;  2GXG A;  4GXO A;  4RB2 C;  5C4J J;  3U1K A;  3HUG B;  1LDD A;  1AU7 A;  2EQR A;  1E3H A;  1Z3Y A;  2JUG A;  2G7H A;  1ZG5 A;  4CA0 A;  3ML6 A;  3MZY A;  3K2Z A;  3ZRG A;  3FXM A;  4YFK F;  1ZR4 A;  5LHH A;  5J47 A;  2V9V A;  4Y52 J;  2PEX A;  4ZDL A;  2M0M A;  1OR7 C;  3HPG A;  5DCM B;  4XIC A;  1V5G A;  3JSO A;  3ZQQ A;  2R7X A;  2JWT A;  4AM3 A;  2MD0 A;  2BY0 A;  4JYK A;  2R7Z J;  1FPQ A;  3I4N J;  2IS1 A;  2X0L A;  3HOV J;  1XGN A;  2JMW A;  4KN4 X;  1R58 A;  2XUB A;  4OIO F;  4BEH A;  1MZB A;  2CFO A;  1QVU A;  2L7Z A;  2DA7 A;  2ZB9 A;  2GIZ A;  3BR3 A;  3S1Q J;  5KCM A;  4WF2 A;  1I5Z A;  2GA2 A;  4B43 A;  2BYV E;  1W5C C;  3A0B C;  1E3O C;  4HLY A;  4E4H A;  2E36 A;  2IEK A;  4HSR A;  4GGG A;  2XGX A;  4G6T B;  1V5E A;  1R9T J;  4AC0 A;  1F36 A;  3SEQ A;  3M8J A;  4M9S A;  2FRH A;  2V1N A;  4KIS A;  1ZR2 A;  1S5L C;  4KFC A;  4XSX F;  2X9D A;  5D5X B;  2GLO A;  1RKW A;  3M7G A;  4BY1 J;  2L3D A;  5C4X J;  2VBW A;  2CMP A;  1SVL A;  1VZ0 A;  3D5R C;  3V8J A;  3AFH A;  4GO1 A;  4BJT A;  2RGV A;  4ENK A;  1MIJ A;  1N75 A;  2KHM A;  3V7S A;  2R7U A;  5KNL A;  2VPR A;  1HW5 A;  3AG4 H;  1WI3 A;  2BXZ A;  3K4B A;  2DO7 A;  2W25 A;  3K69 A;  3A01 B;  3FMS A;  2EIJ H;  3V8K A;  5EF6 A;  4XLF A;  3IH4 A;  3FIS A;  3GUD A;  3LST A;  2ISZ A;  3HRU A;  1YW9 A;  2E1M C;  1IRG A;  3L2V A;  2ZNZ A;  3ZMZ A;  1IN5 A;  1D1B A;  1V54 H;  1JJ8 C;  1GDT A;  4Q4Z F;  3A1Y A;  3MMY B;  2ZME B;  5H20 A;  2QKL B;  3JRG A;  2WC2 A;  2EIN H;  2FEZ A;  1WJA A;  2LKS A;  4X0G A;  2ZXJ A;  4M6X A;  4IX7 A;  3OV8 A;  4G6D A;  1YX5 A;  1FNN A;  2DDB A;  1BIB A;  3H5A A;  1QU3 A;  2WB1 A;  4ESJ A;  4Y3O A;  2R7O A;  3GZ5 A;  4NNJ A;  4LGW A;  1VQL I;  4BHB A;  5D5U B;  1VI0 A;  5IP7 J;  3P9I A;  2QEX I;  2PJR B;  3CLQ A;  4U0Y A;  4NC7 A;  3PJR A;  1OPC A;  3A2K A;  1DPR A;  2HNH A;  5HS8 A;  4A0Z A;  4CGZ A;  4RAG A;  5J1R A;  2R7F A;  4GRI A;  3JRA A;  3GTM J;  3M4O J;  2F48 A;  1ZKG A;  1H8A C;  5L3G A;  1JGG A;  4L9V A;  1LFU P;  3DTE A;  4F52 A;  1LQ1 A;  1ZK8 A;  2LYC A;  3WGI A;  2ZJQ F;  1SC7 A;  2MC4 A;  2F5F A;  2KIQ A;  4U88 A;  4DYQ A;  2HU9 A;  5FD5 A;  2A61 A;  5IT3 A;  3CCS I;  2COM A;  2V26 A;  3OR2 C;  1H88 C;  1U0J A;  3GTG J;  1D0X A;  5J4Y A;  4PSX A;  3Q0V A;  1ON2 A;  2ZFU A;  1TLH B;  2JN6 A;  1TQM A;  4LD5 A;  4XOT A;  4ZTJ A;  1JHF A;  4C2U A;  2O0Y A;  5H6R A;  4M72 A;  1SD6 A;  3L2Q A;  4HQE A;  3OY9 A;  3RJP A;  3VPR A;  5HDG A;  1B9M A;  4CCL A;  3N97 A;  4UHT A;  4N4O B;  3S2W A;  3C2G A;  3I53 A;  3ABM H;  5D5V B;  2KMU A;  2DT6 A;  3OIO A;  1T33 A;  2HOE A;  2VC1 A;  3O2P E;  2FML A;  4LB5 A;  2R7R A;  3ABT A;  3DXJ F;  3MKZ A;  4ENJ A;  5FGM A;  5L3E A;  1R00 A;  3JRC A;  2AHQ A;  3PNT A;  4LK1 F;  1X1P A;  2M7A A;  4PJL A;  4XKC A;  2BVL A;  3QOD A;  2Y69 H;  3NAU A;  2R5Z B;  2NNY A;  2BW3 A;  2DLL A;  3CQZ J;  3OWT A;  2IS2 A;  1MNM C;  3DWL E;  1F43 A;  4FET A;  1FC3 A;  4B8X A;  4C2T A;  3CDH A;  1IAW A;  3FWE A;  3CMM A;  3FXJ A;  1VQO I;  4ANJ A;  4WX9 A;  1VTN C;  2NAZ A;  3F8N A;  5DUK A;  1XMX A;  1YJW I;  1XX5 A;  4C3I J;  2O7O A;  2ZME C;  3HHG A;  4HAM A;  1WGX A;  1SAN A;  3L1P A;  5F0H A;  2Y2Z A;  3FMR A;  3HOT A;  5DV5 A;  4CCM A;  2FXA A;  1OQY A;  2XAS A;  5HNF A;  4RAY A;  2CUJ A;  3CLO A;  3ECH A;  1P4W A;  3BG6 A;  5FB2 A;  2ELJ A;  3RQ4 A;  1G3W A;  5JHF A;  3P9C A;  4DW6 A;  1R4N B;  2IJL A;  4B4C A;  4KNY A;  4IOC F;  2XF7 A;  3CDI A;  3MWM A;  1U8B A;  4E7J A;  1B72 A;  1POG A;  2OZU A;  2DOE A;  3GEZ A;  3K2A A;  4OAY A;  3E5U A;  2MLG A;  2W84 A;  2Y0M A;  2M30 A;  5DD8 A;  2IGK A;  4Z2Y A;  3X2Q H;  3LSR A;  5EG0 A;  3F0C A;  1U9N A;  1FT9 A;  4OMZ A;  1IN7 A;  2WBM A;  3OYH A;  3TKY A;  3GTL J;  2X1C A;  3CME I;  1FLI A;  3QYE A;  3S17 J;  4JBA A;  3H35 A;  2CO5 A;  2ZSH B;  4X1E A;  3CDL A;  1T0F A;  3BJ6 A;  2EPF A;  2KL4 A;  4PGG A;  5HNH A;  5EDN A;  1YRN A;  3MKL A;  2FA5 A;  5FO5 A;  2W4S A;  2KKO A;  4E70 A;  3KFW X;  2KJC A;  3AG2 H;  1FOX A;  2YU9 J;  4FIS A;  1BR1 A;  4HST A;  1JKR C;  2PG4 A;  1T38 A;  3U2R A;  4DBQ A;  4G7H F;  1I3A A;  3DKW A;  3BR6 A;  3S2D J;  4B09 A;  2ADU A;  1OIS A;  1J7K A;  1LDK B;  4BE2 A;  1EJ9 A;  3TDZ C;  3PQK A;  1LUJ B;  1QQI A;  3K7A J;  5LBQ A;  3TQN A;  2EH3 A;  4I7H A;  2IAI A;  4TV7 A;  4YEJ A;  5E18 F;  2QA4 I;  2STW A;  3E97 A;  3S2H J;  4ON0 A;  3I59 B;  1FOK A;  1WJ5 A;  4QTR A;  5EGO A;  2VBX A;  2O8X A;  5CVI A;  1W7P A;  4D5C A;  4G7Z F;  1S6L A;  1J5Y A;  5GTH C;  3VOE A;  4MO7 A;  4I76 A;  2R7Q A;  3QPL A;  3GFL A;  4IHS A;  2ZFW A;  2KFD A;  3GLX A;  1SVM A;  4FQG A;  2LF8 A;  1SEU A;  4AU7 A;  3C3W A;  3WG7 H;  2TCT A;  3EET A;  1ETQ A;  3IKV A;  5K5R A;  2A3S A;  3DKX A;  3HC7 A;  1VQ4 I;  3E6M A;  5B66 C;  2F4M B;  2VKH A;  1HA8 A;  3HOX J;  2EIL H;  3JRI A;  2LDU A;  2H6B A;  4I09 A;  3OYM A;  4ZC3 A;  4S04 A;  3BTC A;  4R1H A;  3VYR B;  4HA8 A;  2DA4 A;  1XTA A;  3OYJ A;  5K5O A;  2Z5U A;  4Y7N J;  1MW7 A;  5CVV A;  5F27 A;  1FEX A;  1U8R A;  4YIF A;  3IRR A;  2W57 A;  2D1H A;  4BH9 A;  2MGQ A;  1X3Z B;  4Y15 A;  1MMS A;  4HRI A;  3TMO A;  3OOU A;  4P9U A;  4PJM A;  2DT5 A;  2EIM H;  4NQW A;  1X2M A;  2WAQ A;  1W4M A;  3FXQ A;  2M7B A;  1I27 A;  3SXY A;  5D4S A;  2H94 A;  3R0J A;  2LY2 A;  1N78 A;  1R23 A;  2E35 A;  2XPU A;  1BL0 A;  2DYR H;  2R3S A;  3ZXS A;  3V8L A;  2HTJ A;  2PLY A;  2EA4 A;  2HKO A;  3CJT B;  3VWB A;  3T8R A;  1FBS A;  2IA0 A;  4L5I A;  5L3D A;  3V7C A;  4XRS A;  3D1N I;  3ZOB A;  3WU2 C;  3GX4 X;  3BQZ A;  4IHW A;  3T8T A;  3HBL A;  3CCV I;  4XLP F;  4IHV A;  2UWM A;  3FXU A;  2KLO A;  4AIH A;  3G1M A;  2M4K A;  3ZMS A;  1G6N A;  3MFK A;  3ONQ A;  1B4A A;  3F6O A;  4CHU A;  5EZG A;  3SJM A;  2BBY A;  2LMD A;  1MDM A;  4MTD A;  4IQJ A;  3HOW J;  3NQO A;  2DBB A;  5FKL A;  3H3Z A;  4B47 A;  2L01 A;  2XAF A;  1H9T A;  4F91 B;  1WJB A;  1PUF B;  4ZDP A;  2IGN A;  4BHP A;  2VBY A;  4O6J A;  4QPQ A;  1LFP A;  4DOZ A;  1IUY A;  2VXD A;  4LIV A;  4HNU A;  4R8H A;  1UMQ A;  2K3F A;  1R6R A;  1HKQ A;  2I8D A;  3E6D A;  3I54 A;  2RAE A;  4ZH4 F;  4G8X A;  4UB8 C;  5E1Z B;  1Y0U A;  3TW7 A;  5IT9 Z;  2CFX A;  2LP0 A;  1A35 A;  2JT1 A;  4KT6 A;  2L7M P;  1UG2 A;  3O6B B;  4ASN A;  4LG0 B;  2HVR A;  1SFK A;  3V42 A;  1QGP A;  1BC8 C;  4UNO A;  3G1O A;  1XCV A;  3F6V A;  4UVC A;  4A0Y A;  1FX7 A;  5B1B H;  3ELK A;  3W2A A;  3BLY A;  1VQM I;  3BTJ A;  1I3Q J;  3EPZ A;  1W7P D;  1XCB A;  3IWZ A;  3ZQG A;  1SMT A;  2KPM A;  3CO7 C;  2NRA C;  3LQQ A;  2JPC A;  2M8E A;  3B6C A;  1DP7 P;  3Q9S A;  1JT0 A;  2VQL A;  2GM4 A;  1BJA A;  2ZNY A;  4CYD A;  3BR5 A;  3HB9 A;  2ECC A;  3E7L A;  2MG4 A;  3KLN A;  3TO6 A;  1FTZ A;  1PDN C;  1HC8 A;  3GBG A;  4QIW N;  4R79 A;  2N8G A;  1OCT C;  4B3A A;  5KK1 A;  4CCO A;  1MMA A;  4D9J A;  1PJR A;  2Z2S B;  2FUG 2;  2LRE A;  1JXS A;  1LB2 A;  5E3O A;  3K4M A;  1JUM A;  4ESF A;  2XKO A;  1OFC X;  4MHG A;  2CS3 A;  2L7F P;  1QZY A;  2OBP A;  3HJE A;  2ECB A;  1U2W A;  1JTY A;  1QRY A;  4CH7 A;  2B63 J;  3H0G J;  2DK8 A;  1Z6T A;  3ZPL A;  1YOV B;  2MH2 A;  5TIS C;  1OYY A;  1HQC A;  5LEJ A;  2R7W A;  2EV6 A;  1U6G A;  3FBI B;  3K4L A;  1WFX A;  3BPX A;  4A5N A;  2DPD A;  2V1X A;  2LKX A;  1XSX A;  1Y0N A;  2FD5 A;  5DYM A;  4XN3 A;  1M1E B;  1HKT A;  1V5F A;  1TNS A;  2CJJ A;  1TL8 A;  1DPU A;  2M5W A;  1ZGJ A;  2NS7 A;  1XSD A;  4BXF A;  2FSW A;  3B6A A;  1Q1V A;  2ID6 A;  5FJ8 J;  1BW6 A;  3RPQ A;  3SFZ A;  4HBL A;  2HPI A;  2VB6 A;  4HZF A;  3WTW C;  4NC6 A;  1K83 J;  3O3K A;  4XSZ F;  1ZRF A;  3JRE A;  1DU0 A;  1DQU A;  1IW7 F;  4U7D A;  1GLN A;  1R1U A;  2LNB A;  3WU1 B;  2VOD A;  2D1V A;  1HLV A;  3H3V K;  1XDS A;  1G8X A;  1RZ4 A;  4Q48 A;  2BHY A;  2W7N A;  1BJZ A;  1IV8 A;  5GPA A;  1P92 A;  2E7X A;  2M3A A;  5M3F J;  5KAF C;  2HWV A;  2O5R A;  3ZCO A;  2ESH A;  2E7W A;  3PO3 J;  4L9N A;  1FP2 A;  2P8T A;  3CCE I;  4UVB A;  5H2F C;  4EJU A;  5H6Q A;  3OYC A;  1SAU A;  2XF5 A;  2W00 A;  4F55 A;  1HBX G;  2X51 A;  1DGW Y;  2RNJ A;  2O8K A;  3FM5 A;  3WTU C;  1IC8 A;  1R5H A;  4G6Q A;  3PNY A;  5FLX K;  2AXT C;  5K7F A;  3J7A Y;  5DM7 F;  1KA8 A;  1P2F A;  3BR0 A;  2V4J C;  3TGN A;  5HOO A;  3HKZ N;  4LG3 A;  5FKO A;  2PX9 A;  5CQG A;  5KVR A;  2WTE A;  1LE8 A;  1MMG A;  3H92 A;  3OIQ A;  3OL3 A;  4XLH A;  2DA2 A;  1JT6 A;  2DCE A;  3ULQ B;  5BPI A;  1RR7 A;  4EGZ A;  1XN7 A;  1ZAR A;  3ABK H;  3S1N J;  2FQ3 A;  1ETV A;  4L0Z B;  1X1B A;  2HQN A;  3ZGK A;  1VQP I;  5CVU A;  1DGR M;  3VSL A;  3OS0 A;  1Z7L A;  4RMN A;  4S05 A;  3HL2 A;  2E1N A;  2GAU A;  2HOA A;  2L5Q A;  3EUH A;  2DK5 A;  4XID A;  1SVO A;  3L2C A;  2QSH X;  4IZZ A;  2NVT J;  3K4J A;  2P7C B;  1Y6I A;  3P7N A;  2X6W A;  4E7K A;  1FZP B;  1APL C;  3ZQC A;  3VSK A;  5KAI C;  2H1K A;  1ON1 A;  2XRL A;  2YX7 A;  4LLG F;  4YEL A;  4N9H A;  2PI0 A;  2PMU A;  3DEU A;  2L54 A;  5DEQ A;  1ZGW A;  1FTT A;  4HQM A;  1EH7 A;  3W2W A;  4C3J J;  2AO9 A;  1KQ8 A;  3HRS A;  5B5E C;  1KU2 A;  3UKG A;  2PQ8 A;  1HDD C;  1GHC A;  2I10 A;  3GF2 A;  1P9Q C;  1L3L A;  3NEU A;  2NS0 A;  4IRH A;  1HOM A;  9ANT A;  4RB1 A;  1H89 C;  3IRQ A;  2M34 A;  2BW3 B;  3F8B A;  4HNV A;  2O61 A;  5F1J A;  2E5N A;  1KU3 A;  3BZC A;  4M3E A;  2IA1 A;  3S3M A;  2PJP A;  2WY7 Q;  3K0L A;  4X6A J;  4UUV A;  3KLO A;  3CC4 I;  2IRF G;  2IT0 A;  1FIP A;  4QLC U;  1RET A;  1YIO A;  4XRF A;  1MJ9 A;  4FAS D;  2JVG A;  1MD0 A;  1P4A A;  2M1B A;  5GAG J;  3JCU C;  3I58 A;  3W6V A;  4Z6Y A;  1N25 A;  4GYG A;  2PMH A;  1ERD A;  3BTL A;  1R1V A;  4I01 A;  2ME0 A;  1SFX A;  3K70 D;  2E5Z A;  1F4K A;  5EEH A;  4HF1 A;  2CW7 A;  1JTX A;  4Y33 A;  1VND A;  2DYS H;  2MBF A;  2MLK A;  3GTQ J;  3IP4 B;  2VOP A;  1MGT A;  2UUZ A;  3S1M J;  3HPH A;  3KEY A;  1I1S A;  2HS5 A;  1YTY A;  1RC9 A;  2BY3 A;  4CYC B;  4XR6 A;  3GWZ A;  4XOP A;  2LY9 A;  3FF5 A;  4EJW A;  3QYF A;  2EBI A;  3KPH A;  3GXO A;  4PFP A;  3T0Y A;  3CCM I;  2CH0 A;  1EH8 A;  3E1S A;  2L4A A;  4I99 C;  5LD2 C;  2QKM B;  3TL4 X;  5J6X A;  3WTS C;  1YW7 A;  4FCY A;  2VJJ A;  5BNG A;  3E6C C;  2ETH A;  1YRN B;  4PUS A;  2QQ9 A;  1QNT A;  5L3B A;  2HDW A;  5GAD J;  1WJD A;  2R4G A;  1ZRD A;  2L02 A;  2BGC A;  4IO9 F;  4HYE A;  1TWH J;  4BYY A;  1KZH A;  3KZI C;  4I02 A;  3DU5 A;  4A0X A;  1D0Z A;  1HSJ A;  2KT0 A;  4CCN A;  1R71 A;  3MKW B;  3WHC A;  5FD6 A;  1NK3 P;  1OR7 A;  3OYN A;  1F5T A;  4KIC A;  3LSP A;  4BQO A;  1ZRC A;  2HXO A;  2V9P A;  2BZT A;  1DP3 A;  1YE9 A;  2JK3 A;  5BMZ A;  2XSJ C;  2BOL A;  1QBJ A;  2OCC H;  2EA2 A;  4A3L J;  4F93 B;  3G1L A;  2BEO A;  2M4G A;  4LLL A;  2DT7 B;  2ICW G;  5FKK A;  4MFD A;  3ERM A;  2E2J J;  2FF4 A;  1XC5 A;  1O3R A;  1WVR A;  1OLT A;  2CYY A;  3BRO A;  4BKX A;  4G7O F;  2DOA A;  3CJR B;  5IYD J;  1IN8 A;  3DEW A;  4V2F A;  2HYF A;  2XKP A;  3SEZ A;  1Z9C A;  2STT A;  2DFE A;  2XGE A;  3CMA I;  1GXP A;  5HLI A;  2NOG A;  5E3M A;  2CQK A;  2ESN A;  1EA3 A;  4HV6 A;  4BQN A;  4WWC A;  1FSH A;  3ZP5 A;  1OJL A;  2LR8 A;  3LWF A;  2K9S A;  3ZN0 A;  1R36 A;  4A3F J;  3BOQ A;  4XBF A;  1KQ0 A;  1D1C A;  1FYM A;  1WJE A;  4AUX A;  1R5G A;  3KEQ A;  2DMP A;  3CF2 A;  2OF7 A;  2X6Y A;  4LMY A;  5FRM A;  2BVM A;  3E5Q A;  4Y17 A;  3J7Z I;  2CQ7 A;  2FU4 A;  3OYF A;  2ISY A;  2MD5 A;  3PL8 A;  2OV7 A;  5F0C A;  4EEF G;  5IP9 J;  1QHG A;  3HG9 A;  3GTO J;  1BI1 A;  4LIU A;  1MKM A;  4BGD A;  3F9K A;  1R5I D;  1IF1 A;  2R7S A;  1YJN I;  4L0Y B;  3RKQ A;  3K4K A;  5E1W A;  2E19 A;  4CDG A;  5D6F A;  4AVZ A;  1T08 B;  4BNC A;  1BA5 A;  4IVN A;  4BDY A;  4MTE A;  4IHT A;  1RPW A;  4G9Y A;  2P5K A;  4IL6 C;  1AA7 A;  5DD4 A;  3SYT A;  1AKH B;  2NNN A;  4ZYD A;  2P0W A;  2FQ4 A;  4D1Q A;  4WXH A;  4XKW A;  4A3K J;  3AG1 H;  5F64 A;  1YHQ I;  3H3U A;  3OL4 A;  3I56 I;  4U0V A;  3DKY A;  3M8E A;  4HG2 A;  5D8L B;  2F5C A;  4DZP A;  4FTH A;  4RGU A;  4XLN F;  1SFO J;  1ZN2 A;  3RCO A;  2XC7 A;  1B1B A;  3TO9 A;  1J75 A;  3PM1 A;  3O8G A;  1RES A;  2UXN A;  2K85 A;  2CWE A;  4V2G A;  2VQH A;  2KDZ A;  4E7H A;  4M71 A;  2LD5 A;  1T0F C;  4ENN A;  1OCR H;  1JJ6 C;  1D5V A;  3BPV A;  1JHH A;  2ZO4 A;  2XDV A;  3ZN1 A;  3LSJ A;  4NUB A;  3JTH A;  1MDM B;  5HDN A;  4EGY A;  4I2O A;  2YSR A;  5GAH J;  4A2U A;  1QPM A;  3OS2 A;  2EFN A;  3FMQ A;  1LDJ A;  3ZQ7 A;  2CW0 F;  2CW8 A;  3JAM K;  3CUO A;  5F6F A;  3IUO A;  3IAM 2;  4JQF A;  1Z7U A;  5DCM A;  5EYR A;  4W1U A;  1MND A;  5ICC A;  1LPQ A;  4RLF A;  1QA6 A;  2W48 A;  4RM2 A;  4QWQ A;  4C9Y A;  5LHI A;  4UVA A;  5K5Q A;  1GV2 A;  1QHH D;  4YRV A;  1HST A;  3SFI A;  1O7L A;  1HW2 A;  4FE4 A;  2XAJ A;  4EV0 A;  4AIJ A;  1V3F A;  1K4S A;  2OJE D;  2V7F A;  3BQY A;  3QP5 A;  3FIW A;  1A6Q A;  4AYB N;  1X58 A;  1TWF J;  2XV4 S;  1ZLK A;  3FZV A;  1R1T A;  1T98 A;  3RZD J;  2FBH A;  1TW3 A;  3JW4 A;  2RKH A;  3ZQH A;  4WXC A;  1IN6 A;  4DJA A;  2P81 A;  1O3T A;  1B8I A;  3DP7 A;  3BG5 A;  3FK6 A;  1T6S A;  2W82 A;  3CES A;  4O5V A;  3CD6 I;  4WCG A;  1UST A;  4Y4R A;  1T39 A;  3PNV A;  3KYC B;  4QSH A;  2Q8K A;  2IW5 A;  5HOD A;  4BHC A;  4EJV A;  2HOT A;  4LLN A;  2YU3 A;  3B73 A;  4PSW A;  1WPK A;  4A69 C;  3WTV C;  2OA4 A;  3COA C;  3MCZ A;  2DPU A;  1OCO H;  1WH5 A;  2G0E A;  2RNG A;  4HPQ A;  3HOU J;  3E5X A;  2LG4 A;  1Z05 A;  2DFI A;  3OYE A;  3CCR I;  4V19 K;  4M6V A;  2YX4 A;  1LVA A;  3CCY A;  2O9L A;  3L2U A;  5LLQ A;  2XB0 X;  1QZZ A;  2HOS A;  3Q9V A;  2VN2 A;  3A01 A;  2DFF A;  2XVC A;  3DFG A;  2R7V A;  3I4P A;  2GIV A;  3GCM A;  4MGR A;  1G3S A;  3R60 A;  4BAC A;  5M5X J;  1O4X A;  2MSY A;  6PAX A;  1D1A A;  1NH3 A;  2LC2 A;  1W36 D;  4D5F A;  2HVS A;  3U9G A;  2F4I A;  2KDO A;  3LQR A;  4II2 A;  4RBO A;  2O3F A;  1X4O A;  3JSP A;  2DXI A;  3VB2 A;  1K78 A;  2WV0 A;  2EZL A;  1VQN I;  1Z0X A;  1ZG1 A;  3RKX A;  1IV6 A;  3K4C A;  1ZTR A;  3SDB A;  4BL0 B;  3PFI A;  2QGU A;  2XRO A;  2MW8 A;  4LK0 F;  3MAJ A;  1W1W E;  1OCP A;  2M9H A;  1IUF A;  4XKB A;  2A05 A;  5CJ9 A;  2K40 A;  2HPM A;  3G4S I;  1XGO A;  3RTR A;  4FT8 A;  3OS1 A;  2PJR A;  2JA6 J;  3ZMU A;  3HTU A;  3CUQ B;  2EZH A;  3I64 A;  3OYG A;  3BCA A;  4L9J A;  2JRT A;  3F21 A;  3LAP A;  3KP6 A;  3D5L A;  1VQ8 I;  1D0Y A;  2IPQ X;  3UNG C;  2K02 A;  4CZC A;  2LKP A;  4MFE A;  4IJA A;  2XAQ A;  5ERI A;  1EV7 A;  4PK4 A;  1BC7 C;  2VL8 A;  5TGT A;  3S15 J;  2VI6 A;  4EAT A;  3T1B A;  1WCM J;  3GME A;  1HDP A;  4A3B J;  1ZRE A;  3K9T A;  3KET A;  3A4C A;  1N77 A;  2LK2 A;  3QOE A;  2EWN A;  2V1D A;  4M3F A;  2FBI A;  1AOY A;  3EUK L;  1O3Q A;  4DZJ A;  4AYB A;  4GYI A;  4E7S A;  1CF7 A;  5CPR B;  4OWR B;  2RRE A;  1CGP A;  3SHF A;  2F6C A;  3MZH A;  4E7I A;  5EZH A;  1QO0 D;  2L9V A;  3RPU A;  4LB6 B;  2H8W A;  3S16 J;  2EFO A;  2QEN A;  2VJ5 A;  1RKT A;  2HXI A;  2HDC A;  3J7A O;  3LNQ A;  1SD7 A;  5EEG A;  3W3C A;  3W6J B;  2D5V A;  3GZ6 A;  5E17 F;  1P6R A;  5FLX Z;  3M1E A;  2L7K A;  1VQ9 I;  1V55 H;  3BCB A;  3JRF A;  4XKV A;  2OTL I;  3QP6 A;  2IS4 A;  4L9T A;  1IJW C;  2Z1D A;  4CCK A;  1Q1H A;  2MYS A;  2QBY B;  2DJN A;  3H1C A;  1XGM A;  3VYS B;  2KZG A;  3LOC A;  1TTY A;  2M0C A;  1T8I A;  2K3P A;  3E6B A;  3EQL F;  5AIQ A;  2HEO A;  3CC2 I;  3C18 A;  5KHD A;  4OIQ F;  1S7A A;  1TP4 A;  5LFA A;  2LSO A;  3JR9 A;  2KP6 A;  3GO5 A;  2GOX B;  3CO6 C;  4XL9 A;  2EV0 A;  1LEA A;  2DOF A;  4MEY F;  1YS7 A;  3ESW B;  5F04 A;  1FMV A;  2GXA A;  2DOD A;  2YR2 A;  1GUU A;  3ERE D;  4RGX A;  2VOO A;  4DBR A;  3HGG A;  2LBF A;  2VQC A;  1F9N A;  4I6Z A;  1BR2 A;  5K1Y A;  4BXU A;  3FXR A;  4UUS B;  5E1X A;  2KZV A;  3BG7 A;  4LJZ F;  4DNC A;  3M1C A;  3CCJ I;  2LY1 A;  2CV2 A;  2V6C A;  1G3Y A;  2XB5 A;  4MNU A;  2ELK A;  2RV8 A;  2EFW A;  4KIB A;  3W2V A;  1G59 A;  4CIC A;  3KP4 A;  4II3 A;  2K4B A;  4OIN F;  1MMN A;  4L5J A;  3TDU C;  1XDU A;  1B59 A;  1E2X A;  5HLG A;  4CSW A;  3CUQ C;  1HCR A;  3DPL C;  2IS6 A;  1IN4 A;  2DAO A;  1A36 A;  4RA2 A;  1X1A A;  4XOR A;  3MD2 A;  4IQ4 A;  1R22 A;  2CRG A;  1SD4 A;  1U5T A;  2XRN A;  2NOJ B;  3FHN A;  1O57 A;  1GXQ A;  2A6H F;  4OAZ A;  4BEH B;  5K7Z A;  3M8F A;  3G71 I;  1GVJ A;  3FXK A;  2IA2 A;  1I1G A;  4QPO A;  3K70 C;  4XLC A;  2ZXH A;  1R7J A;  1LJ9 A;  1X1D A;  2FMY A;  2FJ1 A;  4F3Q A;  1EF4 A;  5LRR A;  2DMQ A;  2DQR A;  2VT3 A;  3OYD A;  3SZP A;  3TOB A;  4B44 A;  3VDX A;  2A6E F;  3CP2 A;  4FE7 A;  1DDN A;  3V4G A;  1A31 A;  3K6G A;  2B0L A;  3BR1 A;  2B7E A;  2E60 A;  3C7J A;  1MH4 A;  2GBY A;  1Y56 A;  4IRG A;  2V9K A;  3J80 K;  5FRN A;  2IVM A;  1GVD A;  2R7T A;  4H0E A;  4A5M A;  2CQN A;  2ID3 A;  3QAH A;  1J2X A;  2JPB A;  3WTY C;  4E7Z A;  2F5V A;  1FMW A;  2WAF A;  1JUP A;  3I59 A;  3BC8 A;  3DPU A;  3KE2 A;  3RPU D;  3KP5 A;  3VYT B;  3KX2 A;  4HW0 A;  4JP0 A;  3I5U A;  1S9H A;  2RVC A;  4B1R A;  1W0T A;  3ASO H;  2JA7 J;  3GYH X;  1LNW A;  2ZSI B;  4JOM A;  4XMY A;  3HGY A;  4ZJZ A;  2CQX A;  3OYL A;  2JA5 J;  1MBJ A;  1HXD A;  2LLK A;  3N4M A;  2Y48 A;  2VE8 A;  1E0E A;  3MVP A;  3OYK A;  1YQA A;  1BI2 A;  1ZH5 A;  3BG3 A;  3R0A A;  3EUH C;  3H9Q A;  2GZW A;  5HS9 A;  3DLA A;  2A68 F;  3WTZ A;  2JUC A;  2ME6 A;  4KDP A;  4ZDO A;  1IGN A;  2H09 A;  2Z3Y A;  2V6E A;  4JK1 X;  5J4V A;  1ITY A;  1R4M B;  3F8C A;  3BJA A;  4E6K G;  1ACI A;  4NDL A;  3NRV A;  2K5C A;  2OZ6 A;  1MJB A;  2IP2 A;  4XQF A;  2TRT A;  3HOZ J;  3WGG A;  2XGD A;  1IDZ A;  5F08 A;  4A6D A;  5AIP A;  1UJ8 A;  2K4J A;  1K6O A;  4S0H B;  2L4M A;  4XRM A;  1VQ5 I;  2RQP A;  3LSH A;  3L9F A;  2MA3 A;  1BI3 A;  3DTI A;  1PP8 F;  1LKX A;  1QZE A;  1E17 A;  3HM5 A;  5J1Y A;  2JA8 J;  1ZG3 A;  5E3L A;  2F4O B;  1ZLJ A;  5J8F A;  1BOA A;  3KYD B;  2E2H J;  2IXS A;  2HQR A;  2Y0S N;  1UCR A;  1ONV A;  4YG2 F;  1BOB A;  4A12 A;  3RSN A;  3KP3 A;  4U0W A;  1WHU A;  4AVP A;  1YO5 C;  3A03 A;  1S3J A;  2W1O A;  1TZL A;  3PSI A;  4KIT B;  1YI2 I;  2H27 A;  2XAG A;  3K1N A;  4AD9 A;  4EVI A;  4KMF A;  2HFH A;  3Q0U A;  4HX4 A;  1IXC A;  2CUE A;  2XIG A;  2YUS A;  5A2Q K;  1Z6R A;  2VJ4 A;  4DYC A;  3HYI A;  3G73 A;  3ISP A;  2WA0 A;  2NVY J;  1QVT A;  5BOX A;  1FWZ A;  2QSG X;  1E3P A;  1PUF A;  2EFQ A;  1KU9 A;  2I5U A;  3DBR B;  2FOW A;  1BBY A;  1IXR C;  1DUX C;  2FOK A;  1F1Z A;  4P5O A;  1U9O A;  3J81 K;  4Q47 A;  2JJ7 A;  3GLL A;  3H9G A;  5FLV A;  3KCC A;  4DGW B;  4PJN A;  2CG4 A;  2DMN A;  2BY2 A;  4PDK A;  2KRC A;  4UXN A;  2XPW A;  1MBK A;  5K7H A;  3IV5 A;  3ASN H;  5IY5 H;  1I6H J;  2CU7 A;  4EM1 A;  4N9I A;  3GW2 A;  2AXL A;  2OD5 A;  4LG0 A;  4A3E J;  5JFR A;  4WXD A;  1UHM A;  2NS8 A;  2WB1 N;  2HI3 A;  2JA2 A;  4E7L A;  1Y8R B;  4YII A;  1RUN A;  2CV0 A;  3O8H A;  1ZGA A;  1YIT I;  3DPT A;  4D7N A;  2H8R A;  4MQV A;  2L2O A;  4IXA A;  2DTR A;  3TW6 A;  4MQ9 F;  4OIR F;  3C2B A;  1FBQ A;  4G94 A;  1ULY A;  2W85 A;  3HOS A;  1X3U A;  4DQ2 A;  3DU6 A;  3IWF A;  2WWY A;  5DUI A;  1L0O C;  4U87 A;  3QYB A;  1HW1 A;  4A3I J;  4B48 A;  5E79 C;  1OCZ H;  3G2B A;  4EMS A;  2DU9 A;  3DBH B;  2VJI A;  4C3H J;  4EM2 A;  3DQV C;  4GDF A;  4Q5S F;  1FBU A;  3JAM Z;  3LMM A;  3RYR A;  4KYW A;  3HZJ A;  1MBG A;  2X6X A;  4IPA A;  2HQA A;  1FYL A;  5BPD A;  2DQL A;  1MH3 A;  3HOY J;  3G3Z A;  4YFN F;  4NHJ A;  2K9M A;  4ESB A;  5ILU A;  1Z67 A;  2LFB A;  1B72 B;  4LFU A;  2QUF A;  3HKZ A;  3BJO A;  2L0K A;  3EYY A;  2OQR A;  2Z16 A;  3QRF F;  1O3S A;  2OAZ A;  2BV6 A;  3L7W A;  5EG0 B;  1X3W B;  2ZBK A;  4PGH A;  3H5N A;  2Y0S A;  3GFJ A;  5LRS A;  5HDK A;  1UHW A;  3E3V A;  1B8I B;  1KQ9 A;  3KEO A;  2GA1 A;  3UR3 C;  3V7R A;  3ZR8 X;  3TED A;  1FOW A;  5JLW A;  4RLQ A;  5D5W B;  2QLZ A;  2QWW A;  4BQQ A;  4M9Z A;  2HVQ A;  5TJJ A;  2MH9 A;  4RGR A;  4MLO A;  4P96 A;  3CP8 A;  3FKI J;  4A3M J;  3FXO A;  2G7U A;  2XGC A;  2C6Y A;  3IHU A;  1PP7 U;  1OCC H;  1U3E M;  2HDD A;  3HTS B;  4ITV A;  4YIR X;  2TDX A;  2JQ7 A;  4CXF A;  1VQ6 I;  3OIP A;  2VBZ A;  5J1U A;  2RN7 A;  5FLM J;  4M3G A;  1JE8 A;  1V4R A;  2BY1 A;  4JX5 A;  4P1W A;  1D8J A;  1W36 C;  3QPT A;  5ICE A;  4FX4 A;  1X2N A;  1YX3 A;  2EV5 A;  2IGM A;  2VKE A;  2QSF X;  5CLS A;  1ZYR F;  1Y1W J;  3F72 A;  2M87 A;  3FDY A;  3BZ6 A;  4JX6 A;  5EGO B;  2WAD A;  1UHS A;  4HX8 A;  5F0F A;  3NAR A;  3LSG A;  3QPH A;  1W7P B;  2JSP A;  3IH3 A;  3Q3S A;  4KN7 X;  5J8C A;  3LAJ A;  2CV1 A;  2Z9O A;  2Z99 A;  2OCE A;  3OMY A;  1K78 B;  1OYI A;  3PQJ A;  1TQI A;  1K6Y A;  2MC3 A;  2X1D A;  3F23 A;  1WRJ A;  4PCQ A;  5GTI C;  4N0B A;  1WQ2 A;  3AG3 H;  5LHG A;  1BN5 A;  5JR3 A;  4A6E A;  4D0P A;  3HRT A;  3EYI A;  3JRD A;  4J19 A;  1ETO A;  4IRI A;  4RAZ A;  4OIP F;  2KIM A;  4C30 A;  2P6S A;  2NVQ J;  4W97 A;  3HRM A;  3HSF A;  2WV1 A;  5CKT A;  4J00 A;  2DA3 A;  1YW8 A;  1Y1V J;  2R92 J;  4UB6 C;  2EJR A;  4PZJ A;  1KYZ A;  2UZK A;  1IRF A;  3GFM A;  3ABL H;  1I39 A;  1MBF A;  2V79 A;  4BJ6 C;  1K79 A;  3Q5F A;  4BE1 A;  4IHY A;  1WKM A;  2CQQ A;  2AQE A;  5JVG F;  2Q1Z B;  2VAS A;  2EZK A;  2LTP A;  1MBH A;  3H5R A;  2M2E A;  4NQW B;  3VYU B;  4RDU A;  3JRH A;  4BXX J;  3EUA A;  2R5Y A;  3IH2 A;  1RRJ A;  1ETW A;  1ODD A;  2DFH A;  1YYV A;  2VXZ A;  3HHH A;  3A0H C;  1CF7 B;  4A3D J;  1UZC A;  1MBE A;  1KGS A;  1Z21 A;  1G3T A;  2LRD A;  3FK7 A;  3ECO A;  4G12 A;  5GP9 A;  4BAY A;  3N05 A;  2VQG A;  4YFX F;  3K1M A;  1ZHF A;  2Q2E A;  3S3N A;  1HF0 A;  1TW2 A;  5FKM A;  1BIA A;  3SDG A;  4ZYG A;  4ETS A;  4ZZD A;  4PJ0 C;  1K61 A;  5F1R A;  2H6C A;  3QWL A;  2Y9Y A;  3QU3 A;  4HF2 A;  2ZXI A;  2P4W A;  4FX0 A;  1UEL B;  2HYG D;  2M45 A;  5DDG A;  1C0W A;  1DU6 A;  3CMY A;  4KT5 C;  3HUG A;  5TRD A;  5ICG A;  5B1A H;  2PMZ N;  2DJI A;  3QOP A;  4JX4 A;  4XN0 A;  1TNT A;  3T5X A;  3WG9 A;  2QQA A;  5BQT A;  3LA2 A;  2VE9 A;  3W6K B;  1Z3X A;  4L18 B;  2MAB A;  5JHU A;  3K1P A;  2ZC2 A;  1D8K A;  3WHB A;  3TP0 A;  1ETK A;  2P5V A;  3CTA A;  3DF8 A;  4J01 A;  1BR4 A;  1KU7 A;  1WI9 A;  1NG6 A;  5FFX A;  4EQQ A;  3C1D A;  5IYB J;  4M74 A;  3WTX C;  2K7L A;  2LOO A;  4I0B A;  2XAU A;  3ABU A;  1S8N A;  4HV5 A;  2FNA A;  1WH7 A;  2VLA A;  4XM3 A;  2L9S A;  2FBK A;  4IEJ A;  2HYJ A;  2OUM A;  2VIX A;  2LBF B;  4L5E A;  1OYW A;  1Y8Q B;  3RIR A;  1YLF A;  3GFI A;  1JKQ C;  4FHT A;  1Z1D A;  3SQN A;  4DYR A;  3CF5 F;  3ZQI A;  3F8M A;  3BR2 A;  3M3Y J;  2MFZ A;  2CSO A;  5M5W J;  2ZKZ A;  1EKE A;  1WJC A;  4M3B A;  5J40 A;  5HLH A;  3Q0W A;  3WE3 A;  3FHZ A;  1UAA A;  5EJC A;  2DI3 A;  1P4X A;  5IPA A;  1OMI A;  3TO7 A;  1XG1 A;  1Z91 A;  2WAQ N;  5IOY A;  1YJ9 I;  1IRZ A;  2BE5 F;  2E34 A;  4H4K C;  3C2H A;  2Y30 A;  4CYC A;  2KRF A;  1SD5 A;  2QVO A;  4NB5 A;  1BI0 A;  3S1R J;  1U5T B;  2JZY A;  2FX0 A;  2W24 A;  4GCV A;  3OSF A;  1H9G A;  2HGC A;  3LFU A;  3CCL I;  2CUF A;  2KIU A;  1K4T A;  1YG2 A;  2DA6 A;  5LGN A;  4RM3 A;  3AL0 B;  1A04 A;  4BDZ A;  3J7Y J;  2EB7 A;  1ETY A;  1X1C A;  4B3X A;  5D4R A;  5DS9 A;  3EDP A;  1MJA A;  3LA3 A;  2R93 J;  1LEB A;  1JGS A;  2NYX A;  5CQE A;  4U7B A;  1IXS B;  1NTC A;  2PBI A;  3JTG A;  4BS9 A;  4F92 B;  4K2E A;  3CC7 I;  3G6E I;  1JI8 A;  2J5P A;  2L9R A;  2ZME A;  2NVU B;  3HIF A;  5C44 J;  1UG0 A;  3DEE A;  5GAE J;  3I9V 2;  4NBQ A;  1J0R A;  1FSE A;  1W5S A;  2X4H A;  4CCJ A;  2D2W A;  5GPC A;  2OC6 A;  4IKF A;  1BW5 A;  3PIP F;  5L3F A;  5D8K B;  2DDA A;  2QYO A;  1RI7 A;  4I98 B;  3NWT A;  3J80 Z;  3K4N A;  3I4M J;  5FKN A;  3WGH A;  3QPS A;  5AON A;  4AID A;  1ZAO A;  2PMZ A;  1P7I A;  3CCU I;  3RDI A;  4KA4 A;  4ZYA A;  5JVT A;  2AQF A;  3GTK J;  1WJF A;  1YS6 A;  2DMT A;  1XPX A;  2QZ8 A;  4OU0 A;  1BM9 A;  5M3M J;  2O6G E;  1I6X A;  2Y31 A;  1SFE A;  3R4K A;  2BHZ A;  5FFZ A;  3S3O A;  2OPT A;  4OMY A;  2ZJP F;  2K86 A;  2KIF A;  2OQG A;  5FRO A;  3I55 I;  1J9I A;  2ZXW H;  4KIF A;  3P9K A;  2M8G X;  3TOA A;  3S93 A;  3WOD F;  2VT2 A;  1USS A;  2P6T A;  3RKW A;  4CO8 A;  2K9L A;  2EIK H;  2D45 A;  1WSU A;  5IP6 A;  4RB3 C;  4HDU A;  2A5Y B;  3PSF A;  5CVJ A;  4RS8 A;  1S7O A;  1T95 A;  5ILS A;  3S32 A;  3I0T A;  4D7M A;  3ZMV A;  3ZQL A;  3BDD A;  3OYI A;  2O03 A;  2Q0O A;  2UV1 A;  3WE2 A;  2F5D A;  3U21 A;  3QU6 A;  2ZJR F;  2OTJ I;  3MEX A;  4ZZL A;  1AKH A;  2YS9 A;  3LA7 A;  4HNT A;  5EEA A;  2R0Q C;  1CQT A;  2VC0 A;  1LE8 B;  5JI6 A;  1S29 A;  2BXY A;  5E3N A;  2XPV A;  4IHX A;  1Z77 A;  1JKP C;  4GFB A;  4KIG A;  1U5T C;  2LF7 A;  3ZMD A;  2HQ5 A;  3HXL A;  2EK5 A;  3NWS A;  4EJO A;  1NHA A;  4A93 J;  2COB A;  5DCF A;  1WWX A;  1VFC A;  2GXB A;  2R5Z A;  2CUZ A;  1SAX A;  3RI4 A;  3PFY A;  3AL0 C;  1I50 J;  4P9F A;  1R49 A;  4BBS J;  2A69 F;  2QQB A;  2QQ8 A;  1FIA A;  3H36 A;  4ABZ A;  3ROU A;  2VON A;  1A5J A;  3BY6 A;  5ILV A;  3F3X A;  1VF9 A;  4PJJ A;  1NK2 P;  1OKR A;  3WU0 A;  1LVK A;  3IAS 2;  1MNE A;  3K10 A;  5ICF A;  3DBL B;  4AWX B;  5A2Q Z;  3D5S C;  1IG7 A;  1FYK A;  3RZO J;  1FJL A;  1IO2 A;  1HKS A;  2RDP A;  4OOI A;  4RGS A;  2UXX A;  1AHD P;  1GT0 C;  3M9A A;  1ETX A;  4M9X A;  4CUG A;  3VEP A;  5LGT A;  3F22 A;  1XSV A;  2LVS A;  4BBR J;  1TBX A;  3J81 Z;  4HEA 2;  1IRX A;  2K9Q A;  2X48 A;  1TT5 B;  5CYV A;  1ZQ3 P;  2B9S A;  3MQ0 A;  3KIO A;  3PO2 J;  1W0U A;  2K27 A;  2NVX J;  1UB9 A;  1X19 A;  3WTT C;  2V1U A;  2HR3 A;  3RYP A;  2ELH A;  1RNL A;  1XGS A;  2X6O A;  5LEK A;  3DV8 A;  1P7J A;  5D6E A;  2OU2 A;  4XK4 A;  1K7A A;  3M07 A;  2AS5 F;  2A07 F;  2X1E A;  3VFZ A;  4M73 A;  1D3Y A;  1MSF C;  1IDY A;  3KP2 A;  1XD7 A;  3IL2 A;  2J5O A;  1FY7 A;  5E20 A;  3I71 A;  2ZJ2 A;  2H1L A;  3H0D A;  4HOB A;  4KJZ A;  1RUO A;  4KUM A;  4I0A A;  2DA1 A;  1QPI A;  4UV9 A;  1T56 A;  5IOZ A;  2GOM A;  3PIO F;  3PUB A;  3GZN B;  2XF6 A;  3TBI A;  3BWG A;  2ACJ A;  3BP8 A;  2HKX A;  1EH6 A;  5BS6 A;  1NG7 A;  2ZCW A;  3DLL F;  2E1C A;  1STZ A;  1TWC J;  3ZMT A;  3MKY B;  1PUE E;  3PUF A;  5L3C A;  2P7V B;  3A02 A;  3P5J A;  2DN0 A;  4XON A;  3L00 A;  1S7E A;  1SMY F;  4XNF A;  2DMU A;  2Y75 A;  4BE0 A;  3KZY A;  5CVR A;  4BQA A;  4M6Y A;  2CGP A;  3IC7 A;  4ZYH A;  3LL7 A;  1TWA J;  2WAE A;  1SFU A;  4Y13 A;  4UV8 A;  4ZTF A;  2JVH A;  5J3L A;  3S8P A;  3DCF A;  2VPL A;  1JKO C;  2DA5 A;  2FE3 A;  1JUS A;  1UFM A;  4A3J J;  2FNP A;  1Y39 A;  3GTP J;  2L9N A;  3FM3 A;  3D0S A;  5HVQ C;  3S14 J;  4IOA F;  2IGO A;  3CZ6 A;  1O7F A;  3MZ8 A;  3OR1 C;  4A3C J;  4RB0 A;  2DW4 A;  5HLT A;  3CUQ A;  4IF4 A;  4A3G J;  1PVE A;  4HX7 A;  3RKY A;  4O3M A;  3IKT A;  2HZT A;  4HDV A;  1RR8 C;  2HZD A;  4DIQ A;  1REP C;  1T2K A;  2P5L C;  1J09 A;  4PFO A;  2JTV A;  2LH9 A;  2X85 A;  3BG9 A;  2WY8 Q;  2GQQ A;  1MSE C;  1XS9 A;  3R6S A;  2G9W A;  1WZ2 A;  5IYC J;  5M5Y J;  4CZZ A;  3B02 A;  2XSD C;  1ZEL A;  4M3D A;  2R7D A;  1XB4 A;  4XLA A;  1GV5 A;  3LFK A;  4BUP A;  3OOP A;  3AAF A;  3E0J B;  2KJB A;  3L09 A;  4P55 A;  1A6I A;  3LSK A;  3HDD A;  1D5Y A;  3AKZ A;  1IZ1 A;  1TWG J;  2VUM J;  1KYW A;  2IBD A;  4HF0 A;  4C2M J; 
#chains in the Genus database with same CATH homology
 3OIP A;  4ZDP A;  2IGN A;  4P1W A;  1KON A;  4QPQ A;  1LFP A;  4DOZ A;  1W36 C;  2VXD A;  4XLE A;  4LIV A;  4DJA A;  4HNU A;  4N4N B;  3FBN B;  1YX3 A;  2IGM A;  1TT0 A;  2W82 A;  1R6R A;  3CES A;  2I8D A;  4Y4R A;  2VKD A;  3PNV A;  3FDY A;  3OYA A;  2WAD A;  4LIT A;  2RQQ A;  4PSW A;  3LSG A;  4KT6 A;  2JSP A;  3CJQ B;  2CV1 A;  3LSM A;  2KRH A;  3OMY A;  3OYB A;  2RNG A;  2HVR A;  1SFK A;  3LSI A;  4HPQ A;  3V42 A;  1K6Y A;  2LG4 A;  2X1D A;  3OYE A;  3KYL A;  3L2U A;  4BJ5 C;  3W2A A;  3BLY A;  3EPZ A;  2E1M B;  2R7V A;  4NC8 A;  4C30 A;  3L2R A;  4J00 A;  2KPM A;  3H9J A;  3I3L A;  5CKT A;  4BAC A;  2A5W A;  2VQL A;  1D1A A;  1MMD A;  2Q2E B;  2LC2 A;  1W36 D;  4BU2 A;  2HVS A;  2F4I A;  2KDO A;  4II2 A;  4BJ6 C;  3L2W A;  3DTK A;  1X4O A;  2DXI A;  3GBG A;  4BE1 A;  2KQR A;  2A6T A;  1PYV A;  3K4C A;  4R79 A;  2AQE A;  3SDB A;  4BL0 B;  4CCO A;  1X4P A;  1MMA A;  2Q1Z B;  2VAS A;  1PJR A;  2Z2S B;  4D9J A;  3H5R A;  2FUG 2;  2LRE A;  3SZG A;  3FKJ A;  4NQW B;  3VYU B;  3EUA A;  3HUG B;  3K4M A;  4XKB A;  2HPM A;  3RTR A;  3OS1 A;  1Z3Y A;  2PJR A;  2JUG A;  2VXZ A;  4CA0 A;  3OYG A;  2CS3 A;  3BCA A;  1Z21 A;  3ZRG A;  2LRD A;  3N05 A;  2VQG A;  3D5L A;  1D0Y A;  3S3N A;  3UNG C;  4CH7 A;  4ZDL A;  2M0M A;  4CZC A;  1OR7 C;  3HPG A;  1V5G A;  3ZQQ A;  2R7X A;  2MD0 A;  4PK4 A;  2R7W A;  2IS1 A;  2VL8 A;  5TGT A;  4BEH A;  3FBI B;  2CFO A;  3K4L A;  1WFX A;  2ZXI A;  4EAT A;  1UEL B;  4XN3 A;  1N77 A;  3A4C A;  3QOE A;  5KCM A;  3EUK L;  1V5F A;  4B43 A;  2DJI A;  4XN0 A;  4AYB A;  4E4H A;  1Z3X A;  4E7S A;  4HSR A;  2MAB A;  5CPR B;  4OWR B;  4BXF A;  4G6T B;  2RRE A;  1V5E A;  2F6C A;  4E7I A;  3SEQ A;  2HPI A;  2VB6 A;  3M8J A;  4J01 A;  1BR4 A;  1DQU A;  1NG6 A;  2V1N A;  4KIS A;  1GLN A;  2VJ5 A;  2LOO A;  2XAU A;  3W3C A;  2VLA A;  4XM3 A;  2L9S A;  2LBF B;  2OUM A;  2VIX A;  1G8X A;  2L7K A;  2W7N A;  2CMP A;  1VZ0 A;  3BCB A;  3D5R C;  4XKV A;  3AFH A;  2IS4 A;  2M3A A;  4BJT A;  2Z1D A;  4CCK A;  2MYS A;  2O5R A;  1N75 A;  2KHM A;  3ZCO A;  2R7U A;  3VYS B;  5KNL A;  3OYC A;  2MFZ A;  1SAU A;  3K4B A;  1WJC A;  2XF5 A;  2W00 A;  2K3P A;  4F55 A;  2X51 A;  1DGW Y;  5KHD A;  1UAA A;  4XLF A;  5LFA A;  2KP6 A;  2GOX B;  4XL9 A;  3PNY A;  2E1M C;  3J7A Y;  3L2V A;  2V4J C;  1FMV A;  1D1B A;  4H4K C;  5HOO A;  4LG3 A;  3C2H A;  3A1Y A;  4DBR A;  3MMY B;  5CQG A;  2LBF A;  2QKL B;  2VQC A;  4X0G A;  1MMG A;  1BR2 A;  1WJA A;  3OIQ A;  3OL3 A;  4XLH A;  2DCE A;  4IX7 A;  1YX5 A;  2KZV A;  3BG7 A;  3H5A A;  1QU3 A;  2WB1 A;  3M1C A;  4Y3O A;  3LFU A;  2LY1 A;  2CV2 A;  2R7O A;  1X1B A;  3ZGK A;  4NNJ A;  4RM3 A;  3AL0 B;  4BDZ A;  3W2V A;  1G59 A;  1X1C A;  4B3X A;  1DGR M;  3VSL A;  4II3 A;  3OS0 A;  1Z7L A;  4RMN A;  3HL2 A;  2PJR B;  1MMN A;  2L5Q A;  4NC7 A;  5CQE A;  4U7B A;  3PJR A;  3A2K A;  4BS9 A;  2HNH A;  4CSW A;  4F92 B;  4GRI A;  4IZZ A;  3DPL C;  2IS6 A;  3K4J A;  1JI8 A;  1X1A A;  1Y6I A;  3DTE A;  4F52 A;  2LYC A;  2X6W A;  4XOR A;  4E7K A;  3MD2 A;  2MC4 A;  4IQ4 A;  3VSK A;  1UG0 A;  2HU9 A;  3DEE A;  3I9V 2;  2NOJ B;  3FHN A;  4OAZ A;  4BEH B;  4YEL A;  4CCJ A;  2V26 A;  3OR2 C;  4QPO A;  2OC6 A;  3K70 C;  1U0J A;  4XLC A;  4IKF A;  1D0X A;  2ZXH A;  4PSX A;  3NWT A;  3W2W A;  3K4N A;  2ZFU A;  1X1D A;  4F3Q A;  4XOT A;  2PMZ A;  1P9Q C;  3OYD A;  4ZTJ A;  4ZYA A;  4C2U A;  4B44 A;  3VDX A;  3CP2 A;  2AQF A;  3L2Q A;  3OY9 A;  1WJF A;  2BW3 B;  3K6G A;  4CCL A;  2E5N A;  2E60 A;  4N4O B;  1Y56 A;  3S3M A;  2V9K A;  3C2G A;  2WY7 Q;  3S3O A;  5FRN A;  2R7T A;  2KMU A;  5FRO A;  2DT6 A;  4E7Z A;  2F5V A;  1FMW A;  3S93 A;  2R7R A;  4FAS D;  2WAF A;  2JVG A;  3RPU D;  3BC8 A;  3DPU A;  3MKZ A;  3VYT B;  3KX2 A;  2K9L A;  1ERD A;  3PNT A;  1S9H A;  2M7A A;  4PJL A;  4XKC A;  3K70 D;  2BVL A;  3PSF A;  2ZSI B;  2E5Z A;  3QOD A;  4JOM A;  4XMY A;  4ZJZ A;  1T95 A;  3S32 A;  3OYL A;  2BW3 A;  2CW7 A;  3OWT A;  4Y33 A;  2IS2 A;  3IP4 B;  3OYI A;  3DWL E;  4FET A;  1E0E A;  3OYK A;  4C2T A;  2UUZ A;  2UV1 A;  3U21 A;  3EUH C;  3H9Q A;  4ZDO A;  3HPH A;  3DLA A;  3CMM A;  3KEY A;  4HNT A;  4XR6 A;  4ANJ A;  2V6E A;  3QYF A;  4E6K G;  4PFP A;  2CH0 A;  3E1S A;  2K5C A;  3HOT A;  5LD2 C;  2QKM B;  3TL4 X;  3HXL A;  3NWS A;  4CCM A;  4XQF A;  5HNF A;  2VJJ A;  2CUJ A;  3BG6 A;  2CUZ A;  4PUS A;  3PFY A;  3AL0 C;  2ELJ A;  3RQ4 A;  5JHF A;  2HDW A;  1WJD A;  2R4G A;  2XF7 A;  3LSH A;  4PJJ A;  3DTI A;  3DU5 A;  1LKX A;  4E7J A;  1D0Z A;  4CCN A;  1LVK A;  3IAS 2;  1MNE A;  3K10 A;  4OAY A;  3MKW B;  3D5S C;  2IGK A;  3OYN A;  2IXS A;  4BQO A;  2WBM A;  3OYH A;  1BOB A;  1DP3 A;  1YE9 A;  2X1C A;  3RSN A;  3QYE A;  2XSJ C;  2BOL A;  3H35 A;  4CUG A;  4F93 B;  2M4G A;  2DT7 B;  2ZSH B;  5HNH A;  2KL4 A;  2W1O A;  1TZL A;  3PSI A;  4KIT B;  4HEA 2;  1IRX A;  1OLT A;  2W4S A;  2DOA A;  3CJR B;  2VJ4 A;  3SEZ A;  1X19 A;  1BR1 A;  4HST A;  2WA0 A;  4DBQ A;  1EA3 A;  4BQN A;  1LDK B;  4BE2 A;  2X1E A;  4P5O A;  3H9G A;  1D1C A;  1WJE A;  4DGW B;  4YEJ A;  4PJN A;  3CF2 A;  2X6Y A;  5FRM A;  2BVM A;  2KRC A;  1WJ5 A;  3H0D A;  4KJZ A;  3OYF A;  3PL8 A;  2OV7 A;  1QHG A;  3HG9 A;  2GOM A;  4LIU A;  4BGD A;  3F9K A;  3PUB A;  4E7L A;  2R7S A;  2JA2 A;  2R7Q A;  2CV0 A;  3K4K A;  2XF6 A;  3TBI A;  3DPT A;  4AVZ A;  4AU7 A;  2L2O A;  4BDY A;  1NG7 A;  3SYT A;  1AA7 A;  2P0W A;  4D1Q A;  3MKY B;  3DKX A;  3HC7 A;  4XKW A;  3OL4 A;  4XON A;  2VKH A;  3HOS A;  1HA8 A;  3DU6 A;  3DKY A;  4XNF A;  4HG2 A;  4U87 A;  4BE0 A;  3QYB A;  4B48 A;  3OYM A;  3G2B A;  4ZC3 A;  3LL7 A;  2VJI A;  2WAE A;  3RCO A;  3VYR B;  3OYJ A;  3DQV C;  2XC7 A;  3LMM A;  1MW7 A;  4ZTF A;  2JVH A;  3S8P A;  2VQH A;  4E7H A;  2VPL A;  2X6X A;  1T0F C;  4HRI A;  3TMO A;  2HQA A;  3OOU A;  2L9N A;  4PJM A;  2XDV A;  2K9M A;  2WAQ A;  4NUB A;  5HVQ C;  2M7B A;  2IGO A;  3CZ6 A;  3OR1 C;  3HKZ A;  5HLT A;  2LY2 A;  1N78 A;  3OS2 A;  2Z16 A;  3ZXS A;  2CW8 A;  2HZD A;  4DIQ A;  3IUO A;  3VWB A;  3H5N A;  3IAM 2;  2Y0S A;  1J09 A;  4PFO A;  2LH9 A;  4JQF A;  2X85 A;  3UR3 C;  3ZR8 X;  2WY8 Q;  4RLQ A;  1MND A;  4BQQ A;  2HVQ A;  4RLF A;  4RM2 A;  4MLO A;  4C9Y A;  2UWM A;  3CP8 A;  2KLO A;  1QHH D;  4YRV A;  1ZEL A;  2M4K A;  4BUP A;  4XLA A;  3ONQ A;  3E0J B;  4ITV A;  3LSK A;  2V7F A;  4IQJ A;  3AKZ A;  4B47 A;  4F91 B;  4XOP A;  1WJB A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...