1S72I

Refined crystal structure of the haloarcula marismortui large ribosomal subunit at 2.4 angstrom resolution
Total Genus 16
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
16
sequence length
70
structure length
70
Chain Sequence
GVPPTAELIKDEAGFETGSGEPQEDFVADLSVDQVKQIAEQKHPDLLSYDLTNAAKEVVGTCTSLGVTIE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title The Roles of Ribosomal Proteins in the Structure, Assembly and Evolution of the Large Ribosomal Subunit
pubmed doi rcsb
molecule tags Ribosome
molecule keywords 23S ribosomal RNA
total genus 16
structure length 70
sequence length 70
ec nomenclature
pdb deposition date 2004-01-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
I PF00298 Ribosomal_L11 Ribosomal protein L11, RNA binding domain
I PF03946 Ribosomal_L11_N Ribosomal protein L11, N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.250 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Ribosomal protein L11, C-terminal domain 1s72I00
2ZJRF 3J7ZI 3G6EI 2QA4I 5JVGF 4IOAF 2OTLI 1MMSA 2FOWA 4IO9F 5GAGJ 2ZJQF 1VQ8I 1VQNI 3CCLI 1Y39A 1QA6A 3CJTB 3CF5F 3CCJI 3CCMI 1YIJI 1YJWI 2H8WA 1FOXA 2QEXI 4IOCF 3G4SI 2OTJI 2E35A 3CD6I 1VQLI 1VQMI 2ZJPF 5DM7F 1YJ9I 5GAEJ 5GAHJ 3J7YJ 3CCVI 3I55I 1S72I 3G71I 1VQ7I 1YI2I 1FOYA 1VQ4I 1VQ5I 2K3FA 1VQ9I 3CC2I 1VQOI 1FOWA 3I56I 1ACIA 1YHQI 2NXNB 1VQKI 3CMAI 1VQ6I 3DLLF 2JQ7A 3CCRI 3CCQI 5GADJ 3CCEI 5DM6F 3PIPF 3CCUI 2E36A 1YJNI 3CC4I 4V19K 2E34A 1HC8A 3CMEI 3CC7I 1YITI 3CCSI 4UY8I 1VQPI 3PIOF
chains in the Genus database with same CATH superfamily
2ZC2A 3SEQA 5LFAA 5AONA 1X4OA 4IO9F 4RLQA 1OR7A 4XONA 3ZGKA 2WAQA 3M3YJ 2BVLA 3PO3J 1BR2A 1I27A 1BC7C 3R61A 2DPUA 4FCYA 3FXJA 5DUIA 3CDHA 2ZFUA 3UNGC 4XKBA 3FMQA 1Q1HA 2L4MA 1ACIA 4Y17A 2OQRA 5K5OA 3QPHA 3LA7A 3VYRB 5JVTA 2P0WA 4FX0A 3OYAA 4CCLA 2HYJA 2CV1A 3JTGA 1E2XA 3A03A 1YE9A 3BROA 3S8PA 3DTIA 4M3FA 1YTYA 2LF7A 3QOEA 4HNVA 2JA5J 4HX8A 1B9NA 5ED4A 3JSOA 5A2QZ 3DKYA 3VEPA 1TW3A 3HGGA 2PLYA 3GFJA 3S1MJ 5HLHA 4I6ZA 1OCCH 1XD7A 5CLSA 5LHGA 3VYTB 3LMMA 1IDYA 4XN0A 3OS1A 5CVRA 1D0XA 2HFHA 3RDIA 5M5XJ 1D8KA 4ANJA 2Y2ZA 1KU3A 5C4JJ 2VQCA 4I01A 2DMUA 3HSEA 3BQYA 3ZPLA 2DFEA 3ML6A 3JRIA 2E2IJ 4ESJA 4ENNA 4BQNA 4HF0A 1RIOH 4EJOA 2ESNA 3OYDA 1AKHA 3K4JA 2FRHA 1MD0A 4LMYA 4FQGA 2V1XA 3DKXA 2L0KA 3VSLA 4RMNA 5FD6A 4J01A 2XF5A 3H0GJ 2A3SA 3GCMA 3PL8A 2LYCA 2QQ8A 4G12A 4DZPA 3S3NA 3ZRGA 3ECOA 1VQ6I 3DLAA 5LLQA 3UR3C 1KU9A 2YR2A 4FASD 2K86A 1HXDA 2FD5A 3CJQB 1YS7A 2JJ7A 5D6FA 1D3YA 5FKMA 5K7ZA 4L0ZB 3B6AA 3E3VA 1WHUA 2ZJ2A 3BCBA 3TP0A 2RQPA 3DEUA 1FNNA 4M74A 5F0CA 4ZZDA 2M5WA 1C0WA 4P9FA 3S3OA 4IJAA 4MTEA 1D8JA 4DIQA 2K9LA 2GA1A 1IXRC 2KRCA 1R00A 3LFKA 2HS5A 1G3SA 5LEJA 2FXAA 4XKWA 1FIAA 3JAMK 1T98A 5E17F 2K27A 5IY5H 4LB5A 2L9RA 3IWFA 5DCMA 1L0OC 3F8NA 1U5TB 4KT6A 1VI0A 3BOQA 4XLAA 4ON0A 4P5OA 4NC7A 3VDXA 4CYCA 1PYVA 2H1KA 4N9IA 2P5LC 3L2RA 3JR9A 1KYZA 1VTNC 3CO7C 2FJ1A 3A1YA 4BXFA 4Z6YA 4UB8C 2K85A 2A69F 2WAFA 3EUKL 2NVTJ 3HOXJ 2F5DA 4E7HA 1XSXA 5EGOB 3HZJA 3OYHA 4RAFA 1T0FA 4O5VA 3DXJF 4L9TA 1XN7A 3JTHA 4HDVA 4ETSA 1YIOA 3QQAA 2LR8A 4B3AA 4A3KJ 2NRAC 3K1PA 1ETWA 1E0EA 1B72A 3F8MA 1SFKA 2E1MB 3AFHA 1K7AA 1GVJA 1UFMA 3JW4A 2QKMB 1FSHA 2XC7A 2O9LA 3N97A 1R1TA 4A3BJ 1E17A 3JREA 1DGWY 2CW0F 1NG7A 1K78B 1QHHD 5FRMA 3E5QA 3HUGA 2DBBA 4HBLA 5CVUA 3F72A 1ZARA 2P6TA 2HTJA 3FXUA 1MKMA 2FU4A 1UB9A 3WGIA 1FYMA 1FMVA 2Y0MA 3P9CA 4IHYA 4DYCA 3WTWC 2ISYA 2M7AA 2HVSA 4WXHA 2BOLA 4MNUA 3L2UA 3D1NI 2WTEA 2KRFA 2ACJA 1R1UA 1WJBA 1YRNB 4G94A 3G4SI 4B48A 2VL8A 3HDDA 3TKYA 2V6EA 1TW2A 4HX4A 1G59A 5JI6A 3S3MA 1YW8A 5B3SH 2ADUA 1BOAA 2L9NA 3PUFA 4A69C 3A01A 4BDYA 2XSJC 5HS8A 1DPUA 4W1UA 4ASNA 3ZMSA 2HYFA 2LSOA 4B8XA 1O57A 4G9YA 4UY8I 3PJRA 3GTQJ 2DK8A 4KIFA 3RI4A 2ZJQF 2FBIA 1FZPB 3SZTA 2DOAA 1P9QC 2K4JA 3IH4A 4EV0A 1W0UA 4S05A 2GIVA 5FROA 2OTJI 2R5YA 1Z7LA 3RPUD 1ZGWA 4KA4A 4JYKA 4JOMA 1FYLA 3BR6A 3IRQA 1R58A 4D0PA 2DA1A 2DU9A 3PO2J 1WPKA 1DP7P 2XIGA 2E2HJ 1QU3A 2FUG2 2IA1A 5LGUA 3BDDA 3CCEI 2KDZA 5TRDA 1MSEC 1Z1DA 5EF6A 3GW2A 4U7DA 1BI3A 2F5CA 3F3XA 2OAZA 3I4NJ 1LDKB 1LVAA 2FSWA 5FKLA 3TBIA 4TV7A 4JBAA 1LEAA 2QSHX 2ZNZA 4B44A 1KQ8A 3BG5A 4CO8A 3ZR8X 3KLOA 3HOWJ 3RZOJ 2HPMA 4EGZA 5CPRB 2HU9A 2D1VA 4FHTA 1KYWA 4FETA 2CGPA 4OOIA 4YIFA 2WWYA 1YRNA 4AUXA 4CDGA 1ENHA 3F0CA 4P96A 1RNLA 1HKQA 3SHFA 1NH3A 1TQPA 1YW7A 4AM3A 3W3CA 2R7XA 1R49A 1YW9A 3HPGA 1MBHA 2UUZA 4EQQA 1B1BA 1XSDA 4M3GA 3ABMH 5HS7A 3FWEA 4WWCA 1GXPA 3CCYA 4A0ZA 3LQQA 3V42A 4BDZA 2OZUA 1F4KA 2YU9J 4KYWA 4HLXA 4IOCF 2XROA 4WCGA 1QHGA 3UKGA 2ETHA 2COBA 3BLYA 3F23A 2NOGA 3FKIJ 2NNYA 1G3WA 2B9SA 2K4BA 2IGNA 5K1YA 1F43A 3BR1A 3SYTA 2E5ZA 3BT9A 1WI9A 2PQ8A 3TDUC 3M4OJ 2EWNA 4J00A 1Z3YA 4IKFA 5ICCA 1ZH5A 1ZN2A 3E6CC 2KIFA 3KLNA 3DKWA 3TO7A 5HDKA 2VJ5A 3PM1A 2QQBA 2VODA 3HIFA 2MG4A 4ZC3A 2JVHA 2FNAA 3L9FA 2HOSA 3FXRA 5J1YA 5DCMB 3CMAI 2M1BA 2Q2EA 1LDDA 5DM6F 2NS8A 4DBQA 3GTGJ 4G6QA 2EZKA 3HRTA 5IP7J 2VBZA 3ONQA 2MD0A 2PN6A 2XRLA 3PNTA 5TISC 1MJBA 2MLKA 3WTYC 3U9GA 2CFOA 3CJTB 1X19A 2YX7A 3GTKJ 3DPTA 1O3TA 4HZFA 4YIIA 4CCMA 3CD6I 2WAEA 3ASNH 3H3ZA 3G1OA 4F52A 1K4TA 4HF2A 4BGDA 3EETA 4AD9A 3PNYA 2K3FA 4A3DJ 2RGVA 2W24A 3OR2C 1MMDA 1W36C 4IHVA 2OCCH 2ESHA 1V5EA 3CCRI 4V2GA 3CCQI 1ORKA 1Z0XA 1ZLJA 3WTSC 1DDNA 1H9GA 2DQLA 2O3FA 5ICFA 4G7ZF 4E4HA 2LBFB 4D1QA 2CQKA 1HA8A 1SC7A 4OWRB 4CHUA 4A12A 1YQAA 2F5FA 1X2NA 3SXYA 2VOOA 1PUFA 3ZQFA 4A2UA 3RSNA 1W7PB 4QIWN 2WC2A 2CJJA 3PSIA 4FISA 1G2HA 2QYOA 3DEWA 2DPDA 1P4XA 4S0HB 4C2TA 3E6MA 4JX6A 1KGSA 3H35A 4OIRF 2NVXJ 2EV0A 3ECHA 1MDMB 1O7FA 2LRDA 3BG9A 5LD2C 3IP4B 1HDPA 1I1GA 4FTHA 3QYFA 1IN6A 2IGMA 4LIUA 4RAGA 3F22A 1F1ZA 4N4NB 4ZZLA 2Q8KA 4EATA 4BH9A 5DM7F 4Y7NJ 1P92A 1FX7A 3GEZA 2LY2A 2FNPA 3KP7A 1ITYA 2ZNYA 4LLLA 1V3FA 3O2PE 3G1MA 3LA3A 2CUJA 3C3WA 1YJNI 3OOPA 2DMQA 1BIBA 5ICGA 1HW2A 4HQEA 1JKRC 1BI2A 2KISA 2IS2A 3OYFA 2DFFA 2OPTA 5FB2A 4IPAA 3KP4A 4LG0A 2D5VA 1BM9A 2DA3A 2I5UA 1HSJA 1I5ZA 2NVQJ 3WG7H 3J80Z 3B6CA 4MFDA 1H9TA 1LNWA 3U1KA 4DBRA 2A61A 1MMNA 4D7MA 2LMDA 5E1XA 4YFKF 3S93A 4CH7A 1WZ2A 3KYDB 2A6HF 1V5FA 2E7XA 2D2WA 3SZPA 3HOYJ 3OYGA 3MVPA 1I6XA 3HOUJ 5CYVA 2OTLI 2JPCA 1KQ0A 1OQYA 2VT3A 3JRGA 3L09A 5KHDA 3JRBA 2BV6A 5JLXA 3CDLA 4BKXA 1WJCA 2EFPA 1DGRM 4JK1X 4AYBN 1RUNA 3PUBA 1ZR2A 1Z3XA 2RV8A 5AIQA 1R5GA 2L7ZA 3MEXA 2LNBA 1ZK8A 3GX4X 2RDPA 4MO7A 2VJIA 3FM3A 4OIPF 1YX5A 3LSPA 4PUSA 2JA6J 2E5NA 4AC0A 2O6GE 1W0TA 2PEXA 2R7UA 5L3EA 2KJCA 1FC3A 3SEZA 2E60A 1SVOA 3U1DA 4YELA 2A05A 4Y52J 3C2GA 2QKLB 2MFZA 3HRUA 2V9PA 5FO5A 5B5EC 3E6BA 2CFXA 3RJPA 2XDVA 1ETOA 2XGXA 5E18F 2H27A 2XUBA 4I0BA 3OSFA 1FY7A 2CUZA 2IXSA 3MD2A 2HKOA 2QBYB 2R7SA 3RYPA 1O7LA 3SFZA 1S29A 1SANA 4UV9A 4G7HF 2EZLA 2A6EF 1JT0A 5FKNA 3E97A 3GTJJ 1SEUA 1RRJA 1LB2A 3ZMDA 5L3DA 2X6OA 3NWTA 1RETA 4HQMA 3I4PA 1X3UA 3FXKA 3S1QJ 1V4RA 3GTOJ 3JRHA 2O61A 1HF0A 2XRNA 1T08B 3H5NA 3HHHA 3LA2A 2R7OA 3GZ6A 1B8IB 1ZQ3P 4IQJA 1TWHJ 1S72I 3ELKA 4K2EA 4XR6A 4A5NA 3KEOA 2DTZA 3ZN1A 2ELHA 4RAZA 3ABLH 2QWWA 4HYEA 3JRAA 1R9TJ 1QZZA 3ZQQA 2HOAA 1DUXC 1MBEA 3KIOA 1L3LA 2VXZA 3OYJA 4A3CJ 3BR3A 5D4RA 4PZJA 2LC2A 2M8EA 1PP7U 3CUQC 2R7VA 1QPMA 1OCPA 3FXOA 1S6LA 2BBYA 3GUDA 2P7CB 2B0LA 2ISZA 2XB5A 3C7JA 4Q47A 3CTAA 4HEA2 2MH9A 4KJZA 2A6TA 1XDUA 2DJIA 3MKWB 5E3MA 3RKQA 2BZTA 2G9WA 4WXCA 2P6SA 5F0FA 1ETYA 3G2BA 4ZDOA 3IKTA 3CCVI 3HOTA 4PFOA 3K1MA 3GVAA 4NQWA 3LL7A 4P1WA 2Z3YA 3AG1H 4ZDPA 1S7OA 2P5VA 4KIBA 5LBQA 5F6FA 1EA3A 2IAIA 4KMFA 4RB3C 3CJNA 4Y13A 3T8TA 4XQFA 4EJUA 2IA0A 1IO2A 2HDDA 3I58A 3DWLE 2CQXA 1Y8RB 4D5CA 4BQQA 1A5JA 1LE8A 5ICEA 2E7WA 1JUSA 3AG3H 3BZ6A 1IV6A 3WTTC 5B66C 2M34A 2NAZA 4UUVA 3Q9VA 4DNCA 1DP3A 4Q4ZF 3WG9A 2ECCA 5GADJ 2DOFA 2WAQN 3BC8A 4DYRA 1AU7A 2K3PA 4BQAA 2MBFA 1YLFA 1FLIA 5EG0A 3MKLA 2JWTA 3H36A 3S17J 4IRIA 2G0EA 5EJCA 1U5TC 3O3KA 2BHZA 5LRSA 2K9MA 3QU3A 3DU6A 1JGSA 2J5OA 2W57A 1WH5A 3W2AA 2A68F 3M1EA 4U7BA 3H92A 4NQWB 1U2WA 4PSWA 1QO0D 1PJRA 5FKOA 4GXOA 1N25A 2DYSH 1LDJA 1Y56A 1JUMA 3IL2A 3RKWA 1ODDA 1X1AA 1A6IA 3KCCA 1Z77A 3GO5A 4ZTJA 1SFOJ 5KAFC 2L54A 1TBXA 2LBFA 3H0DA 2OU2A 1IXCA 3A0BC 2XKPA 4R1HA 3G3ZA 4XBFA 5JFRA 1HBXG 4QSHA 2KP6A 3TEDA 1KA8A 3BG6A 3FXQA 2W00A 3OYKA 1N77A 1XMKA 1LFBA 2XGCA 1NHAA 3GMEA 1H89C 1TNTA 4MQ9F 1SD7A 1XPXA 3SFIA 5CKTA 4P9UA 4C2MJ 2Y30A 2DT5A 3SQNA 3R0AA 3J7ZI 2HGCA 3IAM2 1T8IA 4HF1A 1NK2P 5BQTA 5GAGJ 1FBSA 1ZYRF 3HC7A 1XGSA 2IGKA 3EUHC 3VFZA 3CCMI 2XAHA 2F4IA 3RQ4A 2QM3A 5HLTA 1KZHA 5HDNA 3LNQA 2DODA 1TT5B 2ZXWH 1G8XA 2R93J 2F4OB 4A3LJ 1IJWC 4CYCB 1OCZH 1VQ9I 2ZXHA 3CC2I 1FWZA 3I56I 5E79C 2OZ6A 2LY1A 4A0XA 2G7HA 4CCOA 1MBKA 2PMZN 2L01A 6PAXA 1TWGJ 3VODA 2KIUA 2O03A 3ZQGA 1D0ZA 2DO7A 2LG4A 2XSDC 2VXDA 1IF1A 2UV1A 4EM2A 1ZELA 1NK3P 4A3JJ 2K9QA 4YEJA 3J80K 4GYGA 2Z99A 4N4OB 3QRFF 4FX4A 5EZHA 1XSVA 4UUSB 2IS6A 3FDYA 3DV8A 3T1BA 2F6CA 3QYBA 3IC7A 4O3MA 4CGZA 1HSTA 2P5KA 1LKXA 2Q1ZB 3ABTA 2YUSA 1D1AA 4UV8A 4F91B 4R8HA 1ZLKA 2CQNA 5JHFA 2XASA 1DPRA 2WY8Q 3EYIA 4EM0B 4HNTA 2JSPA 1FOXA 1MNEA 2AXLA 2E35A 3RIRA 2X1CA 3Q0VA 2CG4A 1XC5A 4DW6A 5M5YJ 5GAHJ 3ULQB 5CVIA 3WTVC 2L9SA 1D5YA 1OCOH 2X1DA 4D5FA 1S7EA 3GLLA 1VQKI 1R23A 1AHDP 4L0YB 1JJ8C 4PGGA 2XVCA 4FT8A 3WTZA 3REOA 2EA4A 5GP9A 2H1LA 3FMSA 5EYRA 2BXYA 3BG3A 3VYUB 1IN4A 4OIQF 2IS1A 4LFUA 2UXNA 3HHGA 1VQ8I 2AQEA 2QCOA 3M8EA 3V7CA 3BR5A 5FLXK 4CCNA 4CXFA 3F8FA 1JHFA 3QYEA 2CO5A 1QVTA 3EQLF 4LK0F 3VOEA 3A0HC 3Q9SA 1WRJA 4OU0A 3BP8A 2KKOA 2KQRA 4I09A 2MW8A 4E7JA 3C1DA 4XM3A 1PP8F 4RB0A 4Y15A 3JRCA 1SAXA 1BJAA 4BS9A 3HXLA 2FOKA 4QPOA 2VONA 3R0JA 1EKEA 1PVEA 3ZMZA 4GCVA 4RB2C 1S9HA 1WJDA 4YRVA 3DQVC 5J47A 2Y69H 3IV5A 3S15J 1BA5A 2VOPA 1HDDC 4M9XA 2NYXA 1VQ7I 3G71I 1E3OC 3RPUA 3ZQ7A 3GFIA 4ESBA 2XGDA 3EDPA 1W4MA 2L02A 3BZKA 4NUBA 3CCUI 5JLWA 2V9KA 3RPQA 3BCAA 4DZJA 2FX0A 1QZYA 4XL9A 1P4WA 3KYCB 3H9QA 1UG0A 2ID6A 1A6QA 3TP3A 2IS4A 3LSKA 3FHZA 4M6VA 3X2QH 1BN5A 1K83J 3R60A 4LJZF 3WU0A 2STWA 2CUEA 2QQAA 3RZDJ 2IRFG 3QU6A 1XCBA 3KZIC 2HEOA 3MFKA 2ZSHB 2OA4A 2DMTA 4HX7A 5LHHA 1IRGA 4YG2F 4I02A 2BY3A 3LSGA 3WTXC 3HM5A 2UXXA 3WE3A 2H6BA 1Y39A 3HOZJ 4L9VA 4OIOF 2RN7A 4G6DA 5HNHA 4BUPA 3W2WA 3T5XA 3MZYA 2NS0A 1WI3A 3TGNA 1S3JA 2OCEA 4E7IA 3ZQCA 2NXNB 4GO1A 4KDPA 2FQ3A 2JA8J 4RM3A 3CUOA 5DS9A 2IP2A 2DOEA 4N9HA 2LD5A 1O3QA 4P55A 3JAMZ 3OYCA 1ZG3A 2EFWA 5HVQC 4M72A 4XRMA 4ZYEA 5K7HA 3KETA 5JHUA 3E1SA 3IRRA 4BE1A 3RKYA 1TWAJ 3F8CA 4EJWA 1HOMA 2YX4A 1Z7UA 1J59A 3BQZA 3IUOA 1U6GA 2AHQA 4JP0A 5CQEA 1V55H 1FOKA 1ETQA 4CICA 1T0FC 1A31A 1OYYA 3AG2H 3QAHA 3LWFA 2TRTA 5D6EA 5FKKA 1BJZA 1U9OA 4W97A 3ISPA 1Y6IA 4M9ZA 3TO6A 3K4KA 5E8GA 4AIDA 3FKJA 1BIAA 1SMYF 4OAZA 3IHUA 1GHCA 5DEQA 3EUHA 3ESWB 2KPMA 2EZHA 3K2ZA 3PNVA 2CQ7A 1W36D 3FF5A 3W6KB 1IG7A 4HA8A 4PFPA 2AS5F 5C44J 2VJ4A 1OKRA 3HEFA 3ABUA 1TC3C 2QENA 3CLQA 3KYLA 2QSFX 1EH7A 4I76A 1I50J 4G6TB 2RVCA 3Q0UA 1IRZA 4QWQA 2BGCA 3OL4A 1R1VA 1R4NB 2W25A 2HOEA 3TDZC 9ANTA 5LGTA 1JI8A 2OV7A 2EIJH 1XDSA 3QPTA 1IRFA 2EILH 4JQFA 4LLNA 4LK1F 1V54H 4A5MA 1R6RA 1OPCA 3H5RA 2HQRA 1K6OA 2JZYA 2IA2A 4DOZA 3S2DJ 4NHJA 1KU7A 3WU2C 4EM1A 3C2HA 1ON2A 5DD8A 3H3UA 4IHSA 4BBRJ 2BY0A 5E8IA 1TQIA 1UJ8A 2P81A 1TT0A 1O3RA 2NVUB 3F9KA 2OUMA 3A2KA 4L18B 2FA5A 4U0YA 3MCZA 4I7HA 4PJLA 4QPQA 5D5VB 2VQLA 3EPZA 3S2HJ 3PIPF 3VPRA 2ELJA 5BPDA 3P5JA 4LLGF 4BBSJ 4RS8A 2MA3A 3CP2A 4RAYA 2XAGA 4IRGA 3HTSB 4M6XA 2R7TA 4LOCA 3K2AA 1P7JA 2V1DA 2GQQA 1X1PA 5EEHA 2ID3A 2FBHA 2ZMEC 5LHIA 2PMUA 2R7WA 1T6SA 2TDXA 2DFHA 2QUFA 3J81Z 4GGGA 3RQIA 1K79A 4RGRA 1JUPA 2TCTA 4A6EA 4XN3A 1VQ5I 3JSPA 2GOXB 3E6DA 4AIKA 2ZCWA 5D8LB 5GPCA 1VFCA 2VT2A 2E1NA 3BJAA 1GV2A 1RI7A 1GT0C 1RESA 1HKSA 4M3DA 5IYBJ 1QGPA 3HRMA 3I53A 4UHTA 5KVRA 3P7NA 1HLVA 2Q0OA 2W48A 1JGGA 3FMRA 1G4DA 4L5EA 4NC6A 5BS6A 4CSWA 4D7NA 1VQNI 2VPLA 2X6WA 3LOCA 2AQFA 3R6SA 2N8GA 2CS3A 3FK7A 3KPHA 2VUMJ 1TZLA 1J75A 1T33A 3J7YJ 1ZRDA 5EZGA 1MH4A 1A04A 4BY7J 1FOWA 2DA2A 2OC6A 3KP5A 3V8JA 3K70D 2OJED 1P6RA 3CLOA 2BW3B 1RR7A 4PJNA 2DDBA 2MC4A 4BYYA 5C4XJ 1K61A 4RLFA 1U0JA 4A6DA 3H5AA 5TJJA 3DTKA 1E3PA 2ECBA 4XORA 3CO6C 4DQ2A 4Y33A 2DQRA 1EF4A 5F04A 4I0AA 1E3HA 3DCFA 1SFEA 2EBIA 1GV5A 1XB4A 2HTSA 3MN2A 3MAJA 4IX7A 4E7KA 2KL4A 2EV6A 1MW7A 2M30A 1W5SA 4GFBA 5FFZA 4D9JA 2VBWA 2M45A 2R7DA 1JTYA 2GBYA 1IRXA 1W5TA 4BAYA 2XV4S 2C6YA 1FJLA 2IBDA 2Q2EB 3DTEA 3TOAA 2PX9A 3K4LA 2QA4I 4IXAA 4Z2YA 5DUKA 3ZOBA 3OY9A 2ME0A 1Z21A 2JTVA 3CF5F 2ZO4A 4Q5SF 1WWXA 1SVMA 1H8AC 1T56A 1MBGA 1FTZA 4BJTA 3KP6A 5EGOA 3S2WA 5HOOA 5CJ9A 4XOTA 1CF7B 5AIPA 2JA7J 4UB6C 1FP1D 5EG0B 2L4AA 3F8BA 4G7OF 4WF2A 4ZYAA 2VQHA 1N75A 3NEUA 2Z5UA 1AA7A 2NOJB 3FISA 1XGOA 2DAOA 5IOYA 4HV6A 3AG4H 2K40A 4JX4A 2VQGA 4UVBA 1QA6A 3GTLJ 2E71A 3HUGB 1MMGA 1YIJI 4HG2A 1EV7A 4CCKA 3ASOH 3OYNA 2PMZA 4KISA 1FPQA 5HS9A 3N4MA 2CMPA 1WVRA 2ZMEA 1IUYA 1I3QJ 1X4PA 1LEBA 2P7VB 2UWMA 3SDBA 1CGPA 3CP8A 3KX2A 1IAWA 3GF2A 3HTUA 1G3TA 4KITB 1O3SA 1Y0NA 2WB1A 2LK2A 3PSFA 1ZGJA 3HSRA 3MZ8A 4Y3OA 3BPXA 2BHYA 2W82A 3IH3A 3ROUA 3K7AJ 3LSTA 5KK1A 1UHSA 2B63J 1X1DA 2X0LA 2R3SA 2VIXA 4XK4A 2NS7A 1X3ZB 4E6KG 2A5WA 2IPQX 1K6YA 4FE7A 1X1CA 1GVDA 1FMWA 2VC1A 3M8FA 3M1CA 4WX9A 2GIZA 3NQOA 2WY7Q 5ILUA 2WV0A 1FEXA 3A4CA 3AL0C 2JVGA 3S16J 2HXOA 2HI3A 2DTRA 2RAEA 2GWRA 4XIDA 3JRDA 2XPVA 2BE5F 2HKXA 3OS0A 1YITI 1FBQA 1TP4A 3K70C 2H8RA 1ZAOA 3CZ6A 3OIQA 2GA2A 2O8KA 3N05A 1MNDA 3M7GA 2FEZA 3CQZJ 2JRTA 1VZ0A 2MABA 2W84A 1Y8QB 2XPWA 3MKZA 2X85A 2W7NA 4LGWA 3I5UA 3LSIA 4BHBA 2F4MB 1TWFJ 1VQ4I 4NB5A 1B6AA 4MTDA 1SD4A 4IHXA 5FRNA 1QVUA 1Z91A 1H0MA 1R22A 1XCVA 1ONVA 2LOOA 1D0YA 5B1BH 3DLLF 3OYIA 3FX3A 5IOZA 2BXZA 1REPC 3QPLA 1M1EB 2XF6A 1LFUP 5FJ8J 3COAC 2EJRA 1MH3A 2B7EA 3H3VK 4NNJA 3OR1C 5L3CA 1U8BA 1B9MA 1Q1VA 5F08A 3H1CA 3B73A 2XPUA 1YX3A 1U9NA 2GXGA 1XGMA 1BL0A 4U0VA 2CH0A 4GRIA 2QBYA 5FLXZ 2K5CA 2VB6A 5TGTA 2FMLA 1QNTA 1HKTA 1XMXA 4MIMA 4CZZA 4BACA 5F1JA 4M71A 2HOTA 3K9TA 5IP9J 3QWLA 1ZHFA 4II2A 4AU7A 3H9GA 4M9SA 3M07A 2L7MP 4DYQA 2EFOA 3BTIA 4XRSG 4XLHA 1EJ9A 4EEFG 1OISA 3I64A 3GXOA 1BOBA 2F5EA 1K4SA 2CWEA 4AYBA 1IV8A 3EYYA 2CV0A 3F21A 4IZZA 1ZRFA 5FLMJ 1U3EM 2COMA 2F5VA 5BPIA 4WXDA 3C18A 2PJPA 3CMMA 4IEJA 2K9NA 4ENKA 1D5VA 1UAAA 1IUFA 1MGTA 2MSYA 1HC8A 2HXIA 2EH3A 3DPLC 5IT9Z 3ZP5A 2GXAA 1WJAA 5F27A 5BMZA 4U0WA 2V9VA 4YIRX 4BJ5C 3V4GA 1R7JA 4KT5C 1B72B 3V8KA 2L7FP 3Q5FA 2O0YA 3GLXA 1RR8C 3D0SA 2IVMA 1IN8A 3U21A 2JT1A 2V79A 2R7RA 5B1AH 1MBJA 1P4AA 4N0BA 4ITVA 2P4WA 1ON1A 3HG9A 3TW7A 4AIHA 3C2BA 3RKXA 2X48A 4KN4X 2F48A 2JA2A 2DW4A 3K10A 1YYVA 3KZYA 4YFNF 2PI0A 5DCFA 1Y1VJ 2BYVE 3AL0B 1BR4A 1VF9A 3ZN0A 3CMYA 3O6BB 1KQ9A 2HQ5A 3L2QA 1JKPC 1U5TA 1EH6A 1WSUA 1CQTA 3ZCOA 2HR3A 4E7LA 1K78A 4A3FJ 2GAUA 2Y0SN 3K4BA 3IWZA 1WJ5A 1VQLI 1GUUA 1OMIA 4F92B 1FYKA 4I2OA 1I3AA 1MMAA 4V19K 2KHMA 2M2EA 2XGEA 3QOPA 5EEGA 2JK3A 2LY9A 1IW7F 4HPQA 3ERED 2M87A 3VSKA 2ZXIA 4OMYA 2E34A 3OIOA 4A0YA 5IYCJ 3L2CA 4Y4RA 2LLKA 2W1OA 1GDTA 3ABKH 2PJRA 3FK6A 2I10A 2FOWA 5F64A 2RQQA 4NDLA 3CCJI 5GPAA 1W7PD 1SD6A 1TQMA 2DLLA 3LSMA 5L3GA 5E3NA 2M3AA 2K9SA 4PCQA 3L7WA 4IF4A 3CUQB 1RUOA 1OLTA 3G1LA 5H6RA 2M0CA 3FHNA 2A07F 3HKZA 1W7PA 2Y75A 4CZCA 4H4KC 1ZR4A 5DV5A 3O8GA 4IL6C 5DDGA 1Y0UA 3IAS2 1AOYA 1ZREA 5CVVA 1ETXA 1W5CC 3VYSB 5H2FC 1Z6RA 3AAFA 1V5GA 3I9V2 5H20A 2JSCA 1QQIA 1MNMC 3OYLA 2DYRH 2X4HA 4KIGA 3NARA 3R4KA 4BHPA 1JE8A 2DT7B 1BC8C 3W2VA 4MFEA 2L2OA 4V2FA 3LAJA 4L5IA 2R4GA 5D5XB 3V7RA 1BBYA 5JVGF 4UVCA 1RKTA 5F1RA 2VE8A 1UHWA 1HW5A 5J8FA 2HVQA 1ZG1A 2HQNA 4C3JJ 3HOVJ 2ZFWA 1D1BA 2VKDA 4C2UA 4NC8A 2RREA 5M3FJ 1X58A 2VLAA 1MDMA 2KZVA 2J5PA 3W6VA 2D1HA 3BWGA 1SFXA 2HWVA 2K02A 4WK8F 5BOXA 1MMSA 2DA4A 4XLFA 1B4AA 4M6YA 4C3IJ 4BNCA 3K4MA 5KAIC 3K4NA 3TO9A 2VN2A 3KFWX 3T8RA 1UHMA 3KP3A 4B4CA 4EMSA 3BG7A 3KEQA 2ZB9A 3MQ0A 4XLNF 4RGXA 3GWZA 3WODF 2YS9A 2LKSA 2Z16A 4M3BA 3J81K 3BZCA 3VB2A 1YHQI 1USSA 2R92J 2EIMH 2LF8A 2DI3A 3HB9A 4BQOA 1QRYA 3CC4I 3J7AY 3D5LA 1SD5A 1WCMJ 4X6AJ 4UXNA 4BEHB 5DTDA 2X9DA 2ME6A 4F55A 4IOAF 1DQUA 3WGHA 3K69A 4RDUA 5LEKA 3S1RJ 2UZKA 2ZSIB 1UELB 2M9HA 4HAMA 1VQMI 3FBNB 4FE4A 4EJVA 3I55I 1USTA 3TOBA 5D5UB 3I71A 2F2EA 4CA0A 4ZYDA 1XTAA 2KLOA 2HYGD 3D5SC 4PK4A 1LPQA 1J5YA 5HDGA 2RNGA 4XLEA 2Z9OA 1Z67A 4A93J 1G3YA 1D1CA 5F0HA 3RTRA 1J9IA 4MGRA 1A35A 5D5WB 2Z1DA 3CJRB 1EH8A 3GZ5A 3OOUA 4BY1J 3O8HA 1XX5A 2V1UA 1J09A 2IGOA 1GLNA 2MYSA 4L9NA 5CVJA 3OS2A 3DBHB 5GAEJ 3BTJA 4XSXF 1HW1A 5J1UA 2KJBA 2W4SA 3BPVA 1HQCA 1LVKA 1UZCA 3I3LA 4IRHA 4XMYA 4KN7X 2Y9YA 2HVRA 3A01B 2GZWA 1F5TA 5ERIA 5FLVA 3K0LA 2Y31A 4G8XA 2Z2SB 5E1ZB 1A36A 1Z9CA 4ENJA 3OIPA 1YOVB 3JRFA 1UG2A 2EB7A 4RBOA 2DFIA 4RGUA 4MEXF 2EFQA 3FZVA 1W1WE 3OYBA 5ILVA 2KMUA 2FE3A 2VKEA 2HNHA 4HW0A 2CQQA 1JTXA 3HL2A 4L5JA 5L3FA 3BJOA 4UUSA 3KE2A 4I99C 3OYMA 2O8XA 3ZQIA 4A3IJ 3L2VA 3DPUA 4I98B 2EPFA 4MQVA 2VBYA 5IT9K 1AKHB 3G6EI 1YG2A 4HNUA 1SAUA 1SVLA 2DXIA 5GTHC 1X2MA 2CV2A 2IW5A 1X1BA 3GYHX 4KUMA 3MZHA 1LQ1A 1S5LC 2QEXI 2DDAA 2JMWA 2D45A 1G6NA 5ILSA 4DJAA 4ABZA 4KFCA 3CDIA 1F36A 5EDNA 4RGSA 1R71A 2XKOA 1ZTRA 3TMOA 2FBKA 3ZXSA 1I1SA 5J40A 2E1MC 1OFCX 1WJEA 2OD5A 3BY6A 3HOSA 3QPSA 4II3A 1S7AA 1IZ1A 3SDGA 1PDNC 3CMEI 5A2QK 3PQJA 3CCSI 3E5XA 3BJ6A 3LSRA 3HKZN 2YSRA 4XKVA 5FD5A 1P2FA 1TWCJ 1YFHA 1XG1A 2X51A 5D8KB 4EVIA 2L9VA 1GXQA 1X3WB 2M7BA 2HPIA 2L5QA 1STZA 2LREA 5BNGA 4BL0B 1OCRH 5IT3A 1JJ6C 1MZBA 3F6VA 2VC0A 1OR7C 3M9AA 2QLZA 2RNJA 2M8GX 2CRGA 4CCJA 2V1NA 4RM2A 1H88C 3JCUC 2DK5A 2R7ZJ 3GBGA 3LQRA 5FFXA 1TL8A 1ULYA 5E20A 3K1NA 4MHGA 3V7SA 4YFXF 1WQ2A 3LSHA 1IC8A 1NG6A 2L3DA 1U8RA 5HODA 4PJMA 5EEAA 4PSXA 1FIPA 1R36A 3CCLI 1N78A 3OYEA 1IDZA 3DU5A 2GM4A 4DGWB 1QBJA 1IGNA 1IXSB 3QODA 5E3LA 2P8TA 2LKXA 4XOPA 3NRVA 3WHBA 1XMAA 4CUGA 5KCMA 2JQ7A 3I0TA 4GDFA 3TL4X 4EJTA 2YU3A 4GYIA 2E36A 4ZJZA 3VWBA 2FF4A 3RCOA 1PUEE 4XNFA 2OQGA 2Y48A 2EK5A 3HGYA 5J4YA 2VJJA 2LP0A 3HPHA 2Z33A 3NWSA 4B1RA 1T2KA 3H9JA 3LFUA 1FT9A 3HSFA 1R5HA 2ZJPF 5FGMA 2E19A 1YO5C 1XGNA 2HDWA 3WTUC 5K5QA 2OBPA 2JUGA 1ETVA 1WFXA 5DYMA 2M4GA 4B47A 3ZMVA 2EZIA 2WADA 2YPRA 2BVMA 2FQ4A 2KZGA 3ZMTA 4IHTA 3HJEA 1SMTA 2IEKA 4IHWA 3KZZA 2V26A 2ELKA 2VBXA 4E70A 3SZGA 1F9NA 3HRSA 4M73A 2PFBA 1RPWA 4C30A 4CYDA 1YJ9I 1BR1A 1XS9A 1IN5A 2V6CA 4MEYF 3S1NJ 1UCRA 1VNDA 1YI2I 1FSEA 4ENMA 2DA6A 3B02A 2BY2A 3LAPA 1LE8B 5JR3A 3DEEA 5LGNA 5CQGA 1P7IA 3P9KA 2EIKH 3W6JB 1DU0A 4XRFA 4ZH4F 4AVZA 3GTPJ 2ICWG 4J19A 1B59A 4XSZF 1ZG5A 1VQPI 5IPAA 3GTMJ 3GFMA 2R0QC 4BJ6C 3U2RA 2QGUA 3LSJA 4RB1A 2W85A 5J1RA 2H6CA 2I8DA 2MGQA 1MIJA 1J2XA 1OYIA 2OF7A 1WJFA 5IYDJ 2LH9A 1Y1WJ 1MBFA 4BE0A 1FP2A 2LTPA 2DA5A 1U78A 2KDOA 5E1WA 3DFGA 3L2WA 1CF7A 2A5YB 4OMZA 4AVPA 2JUCA 2G7UA 4AWXB 1BW5A 2XAQA 4B09A 2HQAA 1JKOC 4PJ0C 4KMUX 2VPRA 2VE9A 2X6XA 3DBLB 1WH7A 3D5RC 3DF8A 4OINF 4C9YA 3NAUA 5E3OA 2M4KA 4LITA 5LRRA 2EA2A 1RC9A 2RKHA 3Q0WA 4XLCA 3FIWA 1NTCA 4BHCA 2IT0A 1OYWA 4RA2A 2O5RA 4A3GJ 1MJ9A 3K4CA 1ERDA 2KFDA 3I54A 5M5WJ 4B43A 4EGYA 2WB1N 2CW7A 2R5YB 2CUFA 3E5UA 2LFBA 4X0GA 2KIQA 3FM5A 1I39A 4L9JA 5KNLA 5GTIC 3GFLA 1APLC 4XICA 2IJLA 4PGHA 4HDUA 2E1CA 2DJNA 4ESFA 1T38A 2AXTC 4H0EA 2H8WA 4HRIA 1TTYA 3MWMA 4BEHA 2KT0A 2XB0X 2NVYJ 4ZTFA 3M8JA 4NBQA 2HDCA 4XRSA 2CU7A 4HSTA 5IP6A 2R7FA 3CF2A 3K6GA 1VQOI 3QP6A 4LD5A 2BEOA 3A02A 1JT6A 2RC4A 2GLOA 2V7FA 3FXMA 3OL3A 3FBIB 1B8IA 1UMQA 5K5RA 4E7SA 2KIMA 2BW3A 4F7ZA 3L1PA 4JX5A 1AWCA 4A3MJ 2MD5A 2XHKA 3IH2A 2ZMEB 4U88A 1IN7A 2XAUA 5HLIA 5J3LA 1J0RA 5J8CA 2MH2A 3DBRB 4LB6B 4A3EJ 1FOYA 4F93B 1BI0A 2VKHA 4C3HJ 2LVSA 2WV1A 4IQ4A 5DD4A 4XKCA 3PFYA 3OWTA 2GOMA 4OAYA 3MMYB 1MSFC 3PIOF 2ZJRF 1I6HJ 4O6JA 3G73A 1MJAA 1WGXA 2MC3A 3BTLA 1KONA 1LFPA 2O7OA 5L3BA 3ERMA 2AO9A 2X6YA 1RKWA 4AIJA 2R5ZA 1KU2A 4UVAA 2PBIA 2QSGX 1SFUA 3Q3SA 5HNFA 1R4MB 2PG4A 2QF7A 2DMNA 4KNYA 1BI1A 1ZKGA 3I59B 5J6XA 4MLOA 1HCRA 2XAJA 1PUFB 3TW6A 3RYRA 3AKZA 4LIVA 1QPIA 3EUAA 4LG3A 2JPBA 1YJWI 2FMYA 2Y9ZA 3S32A 2BY1A 1T95A 3PQKA 5D4SA 4LG0B 2VI6A 1TNSA 1LUJB 2QVOA 2LDUA 5C3EJ 1ZRCA 1J7KA 4PDKA 3PFIA 3HBLA 2DT6A 2EV5A 2JRMA 3WE2A 1JXSA 2MLGA 1POGA 3GZNB 4B3XA 3ZQLA 3QP5A 4KICA 5HLGA 2WBMA 1RZ4A 4M3EA 2E1OA 1R5ID 2PJRB 4ZYGA 3HYIA 4HOBA 4HSRA 4BE2A 1Z6TA 1Z05A 2ZBKA 2H09A 2ZXJA 3WGGA 1O4XA 4BXXJ 3BR2A 1FTTA 2WA0A 3J7AO 4Q48A 2VASA 1QZEA 2Y0SA 3V8LA 3IKVA 1JKQC 2QQ9A 2CW8A 2XF7A 4IVNA 2DA7A 4HV5A 3OMYA 5J4VA 3CC7I 2E2JJ 3I59A 2M0MA 2HZTA 2VKVA 3CUQA 2HZDA 3L00A 1OCTC 3E7LA 2ZKZA 2V4JC 2GXBA 2CYYA 2R7QA 4UNOA 1DU6A 2PMHA 1TLHB 3ZMUA 4U87A 2L7KA 3ZQHA 1OJLA 2STTA 3P9IA 3CESA 4XLPF 4BU2A 3DP7A 2X1EA 1ZGAA 1BW6A 3T0YA 3SJMA 2R5ZB 2EINH 2H94A 5M3MJ 5K7FA 2KRHA 5H6QA 1ETKA 2K7LA 2EQRA 1T39A 3OSGA 1FBUA 3WU1B 3KEYA 3S14J 2DN0A 2NNNA 3OV8A 4BXUA 3KP2A 4R79A 3MKYB 2QZ8A 3BR0A 4UUTA 3TQNA 4E7ZA 3FXLA 2EFNA 4F3QA 1YS6A 4QTRA 1S8NA 2DCEA 3E0JB 4ZDLA 1LJ9A 4S04A 4X1EA 3F6OA 4QLCU 2LKPA 4PJJA 4HLYA 3I4MJ 2DMPA 1JHHA 2CSOA 4ZYHA 3BTCA 1WKMA 2JN6A 2XAFA 3WHCA
chains in the Genus database with same CATH topology
2ZJRF 3J7ZI 3G6EI 2QA4I 5JVGF 4IOAF 2OTLI 1MMSA 2FOWA 4IO9F 5GAGJ 2ZJQF 1VQ8I 1VQNI 3CCLI 1Y39A 1QA6A 3CJTB 3CF5F 3CCJI 3CCMI 1YIJI 1YJWI 2H8WA 1FOXA 2QEXI 4IOCF 3G4SI 2OTJI 2E35A 3CD6I 1VQLI 1VQMI 2ZJPF 5DM7F 1YJ9I 5GAEJ 5GAHJ 3J7YJ 3CCVI 3I55I 1S72I 3G71I 1VQ7I 1YI2I 1FOYA 1VQ4I 1VQ5I 2K3FA 1VQ9I 3CC2I 1VQOI 1FOWA 3I56I 1ACIA 1YHQI 2NXNB 1VQKI 3CMAI 1VQ6I 3DLLF 2JQ7A 3CCRI 3CCQI 5GADJ 3CCEI 5DM6F 3PIPF 3CCUI 2E36A 1YJNI 3CC4I 4V19K 2E34A 1HC8A 3CMEI 3CC7I 1YITI 3CCSI 4UY8I 1VQPI 3PIOF
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2ZJR F;  3J7Z I;  3G6E I;  2QA4 I;  5JVG F;  4IOA F;  2OTL I;  1MMS A;  2FOW A;  4IO9 F;  5GAG J;  2ZJQ F;  1VQ8 I;  1VQN I;  3CCL I;  1Y39 A;  1QA6 A;  3CJT B;  3CF5 F;  3CCJ I;  3CCM I;  1YIJ I;  1YJW I;  2H8W A;  1FOX A;  2QEX I;  4IOC F;  3G4S I;  2OTJ I;  2E35 A;  3CD6 I;  1VQL I;  1VQM I;  2ZJP F;  5DM7 F;  1YJ9 I;  5GAE J;  5GAH J;  3J7Y J;  3CCV I;  3I55 I;  1S72 I;  3G71 I;  1VQ7 I;  1YI2 I;  1FOY A;  1VQ4 I;  1VQ5 I;  2K3F A;  1VQ9 I;  3CC2 I;  1VQO I;  1FOW A;  3I56 I;  1ACI A;  1YHQ I;  2NXN B;  1VQK I;  3CMA I;  1VQ6 I;  3DLL F;  2JQ7 A;  3CCR I;  3CCQ I;  5GAD J;  3CCE I;  5DM6 F;  3PIP F;  3CCU I;  2E36 A;  1YJN I;  3CC4 I;  4V19 K;  2E34 A;  1HC8 A;  3CME I;  3CC7 I;  1YIT I;  3CCS I;  4UY8 I;  1VQP I;  3PIO F; 
#chains in the Genus database with same CATH topology
 2ZC2 A;  3SEQ A;  5LFA A;  5AON A;  1X4O A;  4IO9 F;  4RLQ A;  1OR7 A;  4XON A;  3ZGK A;  2WAQ A;  3M3Y J;  2BVL A;  3PO3 J;  1BR2 A;  1I27 A;  1BC7 C;  3R61 A;  2DPU A;  4FCY A;  3FXJ A;  5DUI A;  3CDH A;  2ZFU A;  3UNG C;  4XKB A;  3FMQ A;  1Q1H A;  2L4M A;  1ACI A;  4Y17 A;  2OQR A;  5K5O A;  3QPH A;  3LA7 A;  3VYR B;  5JVT A;  2P0W A;  4FX0 A;  3OYA A;  4CCL A;  2HYJ A;  2CV1 A;  3JTG A;  1E2X A;  3A03 A;  1YE9 A;  3BRO A;  3S8P A;  3DTI A;  4M3F A;  1YTY A;  2LF7 A;  3QOE A;  4HNV A;  2JA5 J;  4HX8 A;  1B9N A;  5ED4 A;  3JSO A;  5A2Q Z;  3DKY A;  3VEP A;  1TW3 A;  3HGG A;  2PLY A;  3GFJ A;  3S1M J;  5HLH A;  4I6Z A;  1OCC H;  1XD7 A;  5CLS A;  5LHG A;  3VYT B;  3LMM A;  1IDY A;  4XN0 A;  3OS1 A;  5CVR A;  1D0X A;  2HFH A;  3RDI A;  5M5X J;  1D8K A;  4ANJ A;  2Y2Z A;  1KU3 A;  5C4J J;  2VQC A;  4I01 A;  2DMU A;  3HSE A;  3BQY A;  3ZPL A;  2DFE A;  3ML6 A;  3JRI A;  2E2I J;  4ESJ A;  4ENN A;  4BQN A;  4HF0 A;  1RIO H;  4EJO A;  2ESN A;  3OYD A;  1AKH A;  3K4J A;  2FRH A;  1MD0 A;  4LMY A;  4FQG A;  2V1X A;  3DKX A;  2L0K A;  3VSL A;  4RMN A;  5FD6 A;  4J01 A;  2XF5 A;  3H0G J;  2A3S A;  3GCM A;  3PL8 A;  2LYC A;  2QQ8 A;  4G12 A;  4DZP A;  3S3N A;  3ZRG A;  3ECO A;  1VQ6 I;  3DLA A;  5LLQ A;  3UR3 C;  1KU9 A;  2YR2 A;  4FAS D;  2K86 A;  1HXD A;  2FD5 A;  3CJQ B;  1YS7 A;  2JJ7 A;  5D6F A;  1D3Y A;  5FKM A;  5K7Z A;  4L0Z B;  3B6A A;  3E3V A;  1WHU A;  2ZJ2 A;  3BCB A;  3TP0 A;  2RQP A;  3DEU A;  1FNN A;  4M74 A;  5F0C A;  4ZZD A;  2M5W A;  1C0W A;  4P9F A;  3S3O A;  4IJA A;  4MTE A;  1D8J A;  4DIQ A;  2K9L A;  2GA1 A;  1IXR C;  2KRC A;  1R00 A;  3LFK A;  2HS5 A;  1G3S A;  5LEJ A;  2FXA A;  4XKW A;  1FIA A;  3JAM K;  1T98 A;  5E17 F;  2K27 A;  5IY5 H;  4LB5 A;  2L9R A;  3IWF A;  5DCM A;  1L0O C;  3F8N A;  1U5T B;  4KT6 A;  1VI0 A;  3BOQ A;  4XLA A;  4ON0 A;  4P5O A;  4NC7 A;  3VDX A;  4CYC A;  1PYV A;  2H1K A;  4N9I A;  2P5L C;  3L2R A;  3JR9 A;  1KYZ A;  1VTN C;  3CO7 C;  2FJ1 A;  3A1Y A;  4BXF A;  4Z6Y A;  4UB8 C;  2K85 A;  2A69 F;  2WAF A;  3EUK L;  2NVT J;  3HOX J;  2F5D A;  4E7H A;  1XSX A;  5EGO B;  3HZJ A;  3OYH A;  4RAF A;  1T0F A;  4O5V A;  3DXJ F;  4L9T A;  1XN7 A;  3JTH A;  4HDV A;  4ETS A;  1YIO A;  3QQA A;  2LR8 A;  4B3A A;  4A3K J;  2NRA C;  3K1P A;  1ETW A;  1E0E A;  1B72 A;  3F8M A;  1SFK A;  2E1M B;  3AFH A;  1K7A A;  1GVJ A;  1UFM A;  3JW4 A;  2QKM B;  1FSH A;  2XC7 A;  2O9L A;  3N97 A;  1R1T A;  4A3B J;  1E17 A;  3JRE A;  1DGW Y;  2CW0 F;  1NG7 A;  1K78 B;  1QHH D;  5FRM A;  3E5Q A;  3HUG A;  2DBB A;  4HBL A;  5CVU A;  3F72 A;  1ZAR A;  2P6T A;  2HTJ A;  3FXU A;  1MKM A;  2FU4 A;  1UB9 A;  3WGI A;  1FYM A;  1FMV A;  2Y0M A;  3P9C A;  4IHY A;  4DYC A;  3WTW C;  2ISY A;  2M7A A;  2HVS A;  4WXH A;  2BOL A;  4MNU A;  3L2U A;  3D1N I;  2WTE A;  2KRF A;  2ACJ A;  1R1U A;  1WJB A;  1YRN B;  4G94 A;  3G4S I;  4B48 A;  2VL8 A;  3HDD A;  3TKY A;  2V6E A;  1TW2 A;  4HX4 A;  1G59 A;  5JI6 A;  3S3M A;  1YW8 A;  5B3S H;  2ADU A;  1BOA A;  2L9N A;  3PUF A;  4A69 C;  3A01 A;  4BDY A;  2XSJ C;  5HS8 A;  1DPU A;  4W1U A;  4ASN A;  3ZMS A;  2HYF A;  2LSO A;  4B8X A;  1O57 A;  4G9Y A;  4UY8 I;  3PJR A;  3GTQ J;  2DK8 A;  4KIF A;  3RI4 A;  2ZJQ F;  2FBI A;  1FZP B;  3SZT A;  2DOA A;  1P9Q C;  2K4J A;  3IH4 A;  4EV0 A;  1W0U A;  4S05 A;  2GIV A;  5FRO A;  2OTJ I;  2R5Y A;  1Z7L A;  3RPU D;  1ZGW A;  4KA4 A;  4JYK A;  4JOM A;  1FYL A;  3BR6 A;  3IRQ A;  1R58 A;  4D0P A;  2DA1 A;  2DU9 A;  3PO2 J;  1WPK A;  1DP7 P;  2XIG A;  2E2H J;  1QU3 A;  2FUG 2;  2IA1 A;  5LGU A;  3BDD A;  3CCE I;  2KDZ A;  5TRD A;  1MSE C;  1Z1D A;  5EF6 A;  3GW2 A;  4U7D A;  1BI3 A;  2F5C A;  3F3X A;  2OAZ A;  3I4N J;  1LDK B;  1LVA A;  2FSW A;  5FKL A;  3TBI A;  4TV7 A;  4JBA A;  1LEA A;  2QSH X;  2ZNZ A;  4B44 A;  1KQ8 A;  3BG5 A;  4CO8 A;  3ZR8 X;  3KLO A;  3HOW J;  3RZO J;  2HPM A;  4EGZ A;  5CPR B;  2HU9 A;  2D1V A;  4FHT A;  1KYW A;  4FET A;  2CGP A;  4OOI A;  4YIF A;  2WWY A;  1YRN A;  4AUX A;  4CDG A;  1ENH A;  3F0C A;  4P96 A;  1RNL A;  1HKQ A;  3SHF A;  1NH3 A;  1TQP A;  1YW7 A;  4AM3 A;  3W3C A;  2R7X A;  1R49 A;  1YW9 A;  3HPG A;  1MBH A;  2UUZ A;  4EQQ A;  1B1B A;  1XSD A;  4M3G A;  3ABM H;  5HS7 A;  3FWE A;  4WWC A;  1GXP A;  3CCY A;  4A0Z A;  3LQQ A;  3V42 A;  4BDZ A;  2OZU A;  1F4K A;  2YU9 J;  4KYW A;  4HLX A;  4IOC F;  2XRO A;  4WCG A;  1QHG A;  3UKG A;  2ETH A;  2COB A;  3BLY A;  3F23 A;  2NOG A;  3FKI J;  2NNY A;  1G3W A;  2B9S A;  2K4B A;  2IGN A;  5K1Y A;  1F43 A;  3BR1 A;  3SYT A;  2E5Z A;  3BT9 A;  1WI9 A;  2PQ8 A;  3TDU C;  3M4O J;  2EWN A;  4J00 A;  1Z3Y A;  4IKF A;  5ICC A;  1ZH5 A;  1ZN2 A;  3E6C C;  2KIF A;  3KLN A;  3DKW A;  3TO7 A;  5HDK A;  2VJ5 A;  3PM1 A;  2QQB A;  2VOD A;  3HIF A;  2MG4 A;  4ZC3 A;  2JVH A;  2FNA A;  3L9F A;  2HOS A;  3FXR A;  5J1Y A;  5DCM B;  3CMA I;  2M1B A;  2Q2E A;  1LDD A;  5DM6 F;  2NS8 A;  4DBQ A;  3GTG J;  4G6Q A;  2EZK A;  3HRT A;  5IP7 J;  2VBZ A;  3ONQ A;  2MD0 A;  2PN6 A;  2XRL A;  3PNT A;  5TIS C;  1MJB A;  2MLK A;  3WTY C;  3U9G A;  2CFO A;  3CJT B;  1X19 A;  2YX7 A;  3GTK J;  3DPT A;  1O3T A;  4HZF A;  4YII A;  4CCM A;  3CD6 I;  2WAE A;  3ASN H;  3H3Z A;  3G1O A;  4F52 A;  1K4T A;  4HF2 A;  4BGD A;  3EET A;  4AD9 A;  3PNY A;  2K3F A;  4A3D J;  2RGV A;  2W24 A;  3OR2 C;  1MMD A;  1W36 C;  4IHV A;  2OCC H;  2ESH A;  1V5E A;  3CCR I;  4V2G A;  3CCQ I;  1ORK A;  1Z0X A;  1ZLJ A;  3WTS C;  1DDN A;  1H9G A;  2DQL A;  2O3F A;  5ICF A;  4G7Z F;  4E4H A;  2LBF B;  4D1Q A;  2CQK A;  1HA8 A;  1SC7 A;  4OWR B;  4CHU A;  4A12 A;  1YQA A;  2F5F A;  1X2N A;  3SXY A;  2VOO A;  1PUF A;  3ZQF A;  4A2U A;  3RSN A;  1W7P B;  4QIW N;  2WC2 A;  2CJJ A;  3PSI A;  4FIS A;  1G2H A;  2QYO A;  3DEW A;  2DPD A;  1P4X A;  4S0H B;  4C2T A;  3E6M A;  4JX6 A;  1KGS A;  3H35 A;  4OIR F;  2NVX J;  2EV0 A;  3ECH A;  1MDM B;  1O7F A;  2LRD A;  3BG9 A;  5LD2 C;  3IP4 B;  1HDP A;  1I1G A;  4FTH A;  3QYF A;  1IN6 A;  2IGM A;  4LIU A;  4RAG A;  3F22 A;  1F1Z A;  4N4N B;  4ZZL A;  2Q8K A;  4EAT A;  4BH9 A;  5DM7 F;  4Y7N J;  1P92 A;  1FX7 A;  3GEZ A;  2LY2 A;  2FNP A;  3KP7 A;  1ITY A;  2ZNY A;  4LLL A;  1V3F A;  3O2P E;  3G1M A;  3LA3 A;  2CUJ A;  3C3W A;  1YJN I;  3OOP A;  2DMQ A;  1BIB A;  5ICG A;  1HW2 A;  4HQE A;  1JKR C;  1BI2 A;  2KIS A;  2IS2 A;  3OYF A;  2DFF A;  2OPT A;  5FB2 A;  4IPA A;  3KP4 A;  4LG0 A;  2D5V A;  1BM9 A;  2DA3 A;  2I5U A;  1HSJ A;  1I5Z A;  2NVQ J;  3WG7 H;  3J80 Z;  3B6C A;  4MFD A;  1H9T A;  1LNW A;  3U1K A;  4DBR A;  2A61 A;  1MMN A;  4D7M A;  2LMD A;  5E1X A;  4YFK F;  3S93 A;  4CH7 A;  1WZ2 A;  3KYD B;  2A6H F;  1V5F A;  2E7X A;  2D2W A;  3SZP A;  3HOY J;  3OYG A;  3MVP A;  1I6X A;  3HOU J;  5CYV A;  2OTL I;  2JPC A;  1KQ0 A;  1OQY A;  2VT3 A;  3JRG A;  3L09 A;  5KHD A;  3JRB A;  2BV6 A;  5JLX A;  3CDL A;  4BKX A;  1WJC A;  2EFP A;  1DGR M;  4JK1 X;  4AYB N;  1RUN A;  3PUB A;  1ZR2 A;  1Z3X A;  2RV8 A;  5AIQ A;  1R5G A;  2L7Z A;  3MEX A;  2LNB A;  1ZK8 A;  3GX4 X;  2RDP A;  4MO7 A;  2VJI A;  3FM3 A;  4OIP F;  1YX5 A;  3LSP A;  4PUS A;  2JA6 J;  2E5N A;  4AC0 A;  2O6G E;  1W0T A;  2PEX A;  2R7U A;  5L3E A;  2KJC A;  1FC3 A;  3SEZ A;  2E60 A;  1SVO A;  3U1D A;  4YEL A;  2A05 A;  4Y52 J;  3C2G A;  2QKL B;  2MFZ A;  3HRU A;  2V9P A;  5FO5 A;  5B5E C;  3E6B A;  2CFX A;  3RJP A;  2XDV A;  1ETO A;  2XGX A;  5E18 F;  2H27 A;  2XUB A;  4I0B A;  3OSF A;  1FY7 A;  2CUZ A;  2IXS A;  3MD2 A;  2HKO A;  2QBY B;  2R7S A;  3RYP A;  1O7L A;  3SFZ A;  1S29 A;  1SAN A;  4UV9 A;  4G7H F;  2EZL A;  2A6E F;  1JT0 A;  5FKN A;  3E97 A;  3GTJ J;  1SEU A;  1RRJ A;  1LB2 A;  3ZMD A;  5L3D A;  2X6O A;  3NWT A;  1RET A;  4HQM A;  3I4P A;  1X3U A;  3FXK A;  3S1Q J;  1V4R A;  3GTO J;  3JRH A;  2O61 A;  1HF0 A;  2XRN A;  1T08 B;  3H5N A;  3HHH A;  3LA2 A;  2R7O A;  3GZ6 A;  1B8I B;  1ZQ3 P;  4IQJ A;  1TWH J;  1S72 I;  3ELK A;  4K2E A;  4XR6 A;  4A5N A;  3KEO A;  2DTZ A;  3ZN1 A;  2ELH A;  4RAZ A;  3ABL H;  2QWW A;  4HYE A;  3JRA A;  1R9T J;  1QZZ A;  3ZQQ A;  2HOA A;  1DUX C;  1MBE A;  3KIO A;  1L3L A;  2VXZ A;  3OYJ A;  4A3C J;  3BR3 A;  5D4R A;  4PZJ A;  2LC2 A;  2M8E A;  1PP7 U;  3CUQ C;  2R7V A;  1QPM A;  1OCP A;  3FXO A;  1S6L A;  2BBY A;  3GUD A;  2P7C B;  2B0L A;  2ISZ A;  2XB5 A;  3C7J A;  4Q47 A;  3CTA A;  4HEA 2;  2MH9 A;  4KJZ A;  2A6T A;  1XDU A;  2DJI A;  3MKW B;  5E3M A;  3RKQ A;  2BZT A;  2G9W A;  4WXC A;  2P6S A;  5F0F A;  1ETY A;  3G2B A;  4ZDO A;  3IKT A;  3CCV I;  3HOT A;  4PFO A;  3K1M A;  3GVA A;  4NQW A;  3LL7 A;  4P1W A;  2Z3Y A;  3AG1 H;  4ZDP A;  1S7O A;  2P5V A;  4KIB A;  5LBQ A;  5F6F A;  1EA3 A;  2IAI A;  4KMF A;  4RB3 C;  3CJN A;  4Y13 A;  3T8T A;  4XQF A;  4EJU A;  2IA0 A;  1IO2 A;  2HDD A;  3I58 A;  3DWL E;  2CQX A;  1Y8R B;  4D5C A;  4BQQ A;  1A5J A;  1LE8 A;  5ICE A;  2E7W A;  1JUS A;  3AG3 H;  3BZ6 A;  1IV6 A;  3WTT C;  5B66 C;  2M34 A;  2NAZ A;  4UUV A;  3Q9V A;  4DNC A;  1DP3 A;  4Q4Z F;  3WG9 A;  2ECC A;  5GAD J;  2DOF A;  2WAQ N;  3BC8 A;  4DYR A;  1AU7 A;  2K3P A;  4BQA A;  2MBF A;  1YLF A;  1FLI A;  5EG0 A;  3MKL A;  2JWT A;  3H36 A;  3S17 J;  4IRI A;  2G0E A;  5EJC A;  1U5T C;  3O3K A;  2BHZ A;  5LRS A;  2K9M A;  3QU3 A;  3DU6 A;  1JGS A;  2J5O A;  2W57 A;  1WH5 A;  3W2A A;  2A68 F;  3M1E A;  4U7B A;  3H92 A;  4NQW B;  1U2W A;  4PSW A;  1QO0 D;  1PJR A;  5FKO A;  4GXO A;  1N25 A;  2DYS H;  1LDJ A;  1Y56 A;  1JUM A;  3IL2 A;  3RKW A;  1ODD A;  1X1A A;  1A6I A;  3KCC A;  1Z77 A;  3GO5 A;  4ZTJ A;  1SFO J;  5KAF C;  2L54 A;  1TBX A;  2LBF A;  3H0D A;  2OU2 A;  1IXC A;  3A0B C;  2XKP A;  4R1H A;  3G3Z A;  4XBF A;  5JFR A;  1HBX G;  4QSH A;  2KP6 A;  3TED A;  1KA8 A;  3BG6 A;  3FXQ A;  2W00 A;  3OYK A;  1N77 A;  1XMK A;  1LFB A;  2XGC A;  1NHA A;  3GME A;  1H89 C;  1TNT A;  4MQ9 F;  1SD7 A;  1XPX A;  3SFI A;  5CKT A;  4P9U A;  4C2M J;  2Y30 A;  2DT5 A;  3SQN A;  3R0A A;  3J7Z I;  2HGC A;  3IAM 2;  1T8I A;  4HF1 A;  1NK2 P;  5BQT A;  5GAG J;  1FBS A;  1ZYR F;  3HC7 A;  1XGS A;  2IGK A;  3EUH C;  3VFZ A;  3CCM I;  2XAH A;  2F4I A;  3RQ4 A;  2QM3 A;  5HLT A;  1KZH A;  5HDN A;  3LNQ A;  2DOD A;  1TT5 B;  2ZXW H;  1G8X A;  2R93 J;  2F4O B;  4A3L J;  1IJW C;  4CYC B;  1OCZ H;  1VQ9 I;  2ZXH A;  3CC2 I;  1FWZ A;  3I56 I;  5E79 C;  2OZ6 A;  2LY1 A;  4A0X A;  2G7H A;  4CCO A;  1MBK A;  2PMZ N;  2L01 A;  6PAX A;  1TWG J;  3VOD A;  2KIU A;  2O03 A;  3ZQG A;  1D0Z A;  2DO7 A;  2LG4 A;  2XSD C;  2VXD A;  1IF1 A;  2UV1 A;  4EM2 A;  1ZEL A;  1NK3 P;  4A3J J;  2K9Q A;  4YEJ A;  3J80 K;  4GYG A;  2Z99 A;  4N4O B;  3QRF F;  4FX4 A;  5EZH A;  1XSV A;  4UUS B;  2IS6 A;  3FDY A;  3DV8 A;  3T1B A;  2F6C A;  3QYB A;  3IC7 A;  4O3M A;  4CGZ A;  1HST A;  2P5K A;  1LKX A;  2Q1Z B;  3ABT A;  2YUS A;  1D1A A;  4UV8 A;  4F91 B;  4R8H A;  1ZLK A;  2CQN A;  5JHF A;  2XAS A;  1DPR A;  2WY8 Q;  3EYI A;  4EM0 B;  4HNT A;  2JSP A;  1FOX A;  1MNE A;  2AXL A;  2E35 A;  3RIR A;  2X1C A;  3Q0V A;  2CG4 A;  1XC5 A;  4DW6 A;  5M5Y J;  5GAH J;  3ULQ B;  5CVI A;  3WTV C;  2L9S A;  1D5Y A;  1OCO H;  2X1D A;  4D5F A;  1S7E A;  3GLL A;  1VQK I;  1R23 A;  1AHD P;  4L0Y B;  1JJ8 C;  4PGG A;  2XVC A;  4FT8 A;  3WTZ A;  3REO A;  2EA4 A;  5GP9 A;  2H1L A;  3FMS A;  5EYR A;  2BXY A;  3BG3 A;  3VYU B;  1IN4 A;  4OIQ F;  2IS1 A;  4LFU A;  2UXN A;  3HHG A;  1VQ8 I;  2AQE A;  2QCO A;  3M8E A;  3V7C A;  3BR5 A;  5FLX K;  4CCN A;  4CXF A;  3F8F A;  1JHF A;  3QYE A;  2CO5 A;  1QVT A;  3EQL F;  4LK0 F;  3VOE A;  3A0H C;  3Q9S A;  1WRJ A;  4OU0 A;  3BP8 A;  2KKO A;  2KQR A;  4I09 A;  2MW8 A;  4E7J A;  3C1D A;  4XM3 A;  1PP8 F;  4RB0 A;  4Y15 A;  3JRC A;  1SAX A;  1BJA A;  4BS9 A;  3HXL A;  2FOK A;  4QPO A;  2VON A;  3R0J A;  1EKE A;  1PVE A;  3ZMZ A;  4GCV A;  4RB2 C;  1S9H A;  1WJD A;  4YRV A;  3DQV C;  5J47 A;  2Y69 H;  3IV5 A;  3S15 J;  1BA5 A;  2VOP A;  1HDD C;  4M9X A;  2NYX A;  1VQ7 I;  3G71 I;  1E3O C;  3RPU A;  3ZQ7 A;  3GFI A;  4ESB A;  2XGD A;  3EDP A;  1W4M A;  2L02 A;  3BZK A;  4NUB A;  3CCU I;  5JLW A;  2V9K A;  3RPQ A;  3BCA A;  4DZJ A;  2FX0 A;  1QZY A;  4XL9 A;  1P4W A;  3KYC B;  3H9Q A;  1UG0 A;  2ID6 A;  1A6Q A;  3TP3 A;  2IS4 A;  3LSK A;  3FHZ A;  4M6V A;  3X2Q H;  1BN5 A;  1K83 J;  3R60 A;  4LJZ F;  3WU0 A;  2STW A;  2CUE A;  2QQA A;  3RZD J;  2IRF G;  3QU6 A;  1XCB A;  3KZI C;  2HEO A;  3MFK A;  2ZSH B;  2OA4 A;  2DMT A;  4HX7 A;  5LHH A;  1IRG A;  4YG2 F;  4I02 A;  2BY3 A;  3LSG A;  3WTX C;  3HM5 A;  2UXX A;  3WE3 A;  2H6B A;  1Y39 A;  3HOZ J;  4L9V A;  4OIO F;  2RN7 A;  4G6D A;  5HNH A;  4BUP A;  3W2W A;  3T5X A;  3MZY A;  2NS0 A;  1WI3 A;  3TGN A;  1S3J A;  2OCE A;  4E7I A;  3ZQC A;  2NXN B;  4GO1 A;  4KDP A;  2FQ3 A;  2JA8 J;  4RM3 A;  3CUO A;  5DS9 A;  2IP2 A;  2DOE A;  4N9H A;  2LD5 A;  1O3Q A;  4P55 A;  3JAM Z;  3OYC A;  1ZG3 A;  2EFW A;  5HVQ C;  4M72 A;  4XRM A;  4ZYE A;  5K7H A;  3KET A;  5JHU A;  3E1S A;  3IRR A;  4BE1 A;  3RKY A;  1TWA J;  3F8C A;  4EJW A;  1HOM A;  2YX4 A;  1Z7U A;  1J59 A;  3BQZ A;  3IUO A;  1U6G A;  2AHQ A;  4JP0 A;  5CQE A;  1V55 H;  1FOK A;  1ETQ A;  4CIC A;  1T0F C;  1A31 A;  1OYY A;  3AG2 H;  3QAH A;  3LWF A;  2TRT A;  5D6E A;  5FKK A;  1BJZ A;  1U9O A;  4W97 A;  3ISP A;  1Y6I A;  4M9Z A;  3TO6 A;  3K4K A;  5E8G A;  4AID A;  3FKJ A;  1BIA A;  1SMY F;  4OAZ A;  3IHU A;  1GHC A;  5DEQ A;  3EUH A;  3ESW B;  2KPM A;  2EZH A;  3K2Z A;  3PNV A;  2CQ7 A;  1W36 D;  3FF5 A;  3W6K B;  1IG7 A;  4HA8 A;  4PFP A;  2AS5 F;  5C44 J;  2VJ4 A;  1OKR A;  3HEF A;  3ABU A;  1TC3 C;  2QEN A;  3CLQ A;  3KYL A;  2QSF X;  1EH7 A;  4I76 A;  1I50 J;  4G6T B;  2RVC A;  3Q0U A;  1IRZ A;  4QWQ A;  2BGC A;  3OL4 A;  1R1V A;  1R4N B;  2W25 A;  2HOE A;  3TDZ C;  9ANT A;  5LGT A;  1JI8 A;  2OV7 A;  2EIJ H;  1XDS A;  3QPT A;  1IRF A;  2EIL H;  4JQF A;  4LLN A;  4LK1 F;  1V54 H;  4A5M A;  1R6R A;  1OPC A;  3H5R A;  2HQR A;  1K6O A;  2JZY A;  2IA2 A;  4DOZ A;  3S2D J;  4NHJ A;  1KU7 A;  3WU2 C;  4EM1 A;  3C2H A;  1ON2 A;  5DD8 A;  3H3U A;  4IHS A;  4BBR J;  2BY0 A;  5E8I A;  1TQI A;  1UJ8 A;  2P81 A;  1TT0 A;  1O3R A;  2NVU B;  3F9K A;  2OUM A;  3A2K A;  4L18 B;  2FA5 A;  4U0Y A;  3MCZ A;  4I7H A;  4PJL A;  4QPQ A;  5D5V B;  2VQL A;  3EPZ A;  3S2H J;  3PIP F;  3VPR A;  2ELJ A;  5BPD A;  3P5J A;  4LLG F;  4BBS J;  4RS8 A;  2MA3 A;  3CP2 A;  4RAY A;  2XAG A;  4IRG A;  3HTS B;  4M6X A;  2R7T A;  4LOC A;  3K2A A;  1P7J A;  2V1D A;  2GQQ A;  1X1P A;  5EEH A;  2ID3 A;  2FBH A;  2ZME C;  5LHI A;  2PMU A;  2R7W A;  1T6S A;  2TDX A;  2DFH A;  2QUF A;  3J81 Z;  4GGG A;  3RQI A;  1K79 A;  4RGR A;  1JUP A;  2TCT A;  4A6E A;  4XN3 A;  1VQ5 I;  3JSP A;  2GOX B;  3E6D A;  4AIK A;  2ZCW A;  5D8L B;  5GPC A;  1VFC A;  2VT2 A;  2E1N A;  3BJA A;  1GV2 A;  1RI7 A;  1GT0 C;  1RES A;  1HKS A;  4M3D A;  5IYB J;  1QGP A;  3HRM A;  3I53 A;  4UHT A;  5KVR A;  3P7N A;  1HLV A;  2Q0O A;  2W48 A;  1JGG A;  3FMR A;  1G4D A;  4L5E A;  4NC6 A;  5BS6 A;  4CSW A;  4D7N A;  1VQN I;  2VPL A;  2X6W A;  3LOC A;  2AQF A;  3R6S A;  2N8G A;  2CS3 A;  3FK7 A;  3KPH A;  2VUM J;  1TZL A;  1J75 A;  1T33 A;  3J7Y J;  1ZRD A;  5EZG A;  1MH4 A;  1A04 A;  4BY7 J;  1FOW A;  2DA2 A;  2OC6 A;  3KP5 A;  3V8J A;  3K70 D;  2OJE D;  1P6R A;  3CLO A;  2BW3 B;  1RR7 A;  4PJN A;  2DDB A;  2MC4 A;  4BYY A;  5C4X J;  1K61 A;  4RLF A;  1U0J A;  4A6D A;  3H5A A;  5TJJ A;  3DTK A;  1E3P A;  2ECB A;  4XOR A;  3CO6 C;  4DQ2 A;  4Y33 A;  2DQR A;  1EF4 A;  5F04 A;  4I0A A;  1E3H A;  3DCF A;  1SFE A;  2EBI A;  1GV5 A;  1XB4 A;  2HTS A;  3MN2 A;  3MAJ A;  4IX7 A;  4E7K A;  2KL4 A;  2EV6 A;  1MW7 A;  2M30 A;  1W5S A;  4GFB A;  5FFZ A;  4D9J A;  2VBW A;  2M45 A;  2R7D A;  1JTY A;  2GBY A;  1IRX A;  1W5T A;  4BAY A;  2XV4 S;  2C6Y A;  1FJL A;  2IBD A;  2Q2E B;  3DTE A;  3TOA A;  2PX9 A;  3K4L A;  2QA4 I;  4IXA A;  4Z2Y A;  5DUK A;  3ZOB A;  3OY9 A;  2ME0 A;  1Z21 A;  2JTV A;  3CF5 F;  2ZO4 A;  4Q5S F;  1WWX A;  1SVM A;  1H8A C;  1T56 A;  1MBG A;  1FTZ A;  4BJT A;  3KP6 A;  5EGO A;  3S2W A;  5HOO A;  5CJ9 A;  4XOT A;  1CF7 B;  5AIP A;  2JA7 J;  4UB6 C;  1FP1 D;  5EG0 B;  2L4A A;  3F8B A;  4G7O F;  4WF2 A;  4ZYA A;  2VQH A;  1N75 A;  3NEU A;  2Z5U A;  1AA7 A;  2NOJ B;  3FIS A;  1XGO A;  2DAO A;  5IOY A;  4HV6 A;  3AG4 H;  2K40 A;  4JX4 A;  2VQG A;  4UVB A;  1QA6 A;  3GTL J;  2E71 A;  3HUG B;  1MMG A;  1YIJ I;  4HG2 A;  1EV7 A;  4CCK A;  3ASO H;  3OYN A;  2PMZ A;  4KIS A;  1FPQ A;  5HS9 A;  3N4M A;  2CMP A;  1WVR A;  2ZME A;  1IUY A;  1I3Q J;  1X4P A;  1LEB A;  2P7V B;  2UWM A;  3SDB A;  1CGP A;  3CP8 A;  3KX2 A;  1IAW A;  3GF2 A;  3HTU A;  1G3T A;  4KIT B;  1O3S A;  1Y0N A;  2WB1 A;  2LK2 A;  3PSF A;  1ZGJ A;  3HSR A;  3MZ8 A;  4Y3O A;  3BPX A;  2BHY A;  2W82 A;  3IH3 A;  3ROU A;  3K7A J;  3LST A;  5KK1 A;  1UHS A;  2B63 J;  1X1D A;  2X0L A;  2R3S A;  2VIX A;  4XK4 A;  2NS7 A;  1X3Z B;  4E6K G;  2A5W A;  2IPQ X;  1K6Y A;  4FE7 A;  1X1C A;  1GVD A;  1FMW A;  2VC1 A;  3M8F A;  3M1C A;  4WX9 A;  2GIZ A;  3NQO A;  2WY7 Q;  5ILU A;  2WV0 A;  1FEX A;  3A4C A;  3AL0 C;  2JVG A;  3S16 J;  2HXO A;  2HI3 A;  2DTR A;  2RAE A;  2GWR A;  4XID A;  3JRD A;  2XPV A;  2BE5 F;  2HKX A;  3OS0 A;  1YIT I;  1FBQ A;  1TP4 A;  3K70 C;  2H8R A;  1ZAO A;  3CZ6 A;  3OIQ A;  2GA2 A;  2O8K A;  3N05 A;  1MND A;  3M7G A;  2FEZ A;  3CQZ J;  2JRT A;  1VZ0 A;  2MAB A;  2W84 A;  1Y8Q B;  2XPW A;  3MKZ A;  2X85 A;  2W7N A;  4LGW A;  3I5U A;  3LSI A;  4BHB A;  2F4M B;  1TWF J;  1VQ4 I;  4NB5 A;  1B6A A;  4MTD A;  1SD4 A;  4IHX A;  5FRN A;  1QVU A;  1Z91 A;  1H0M A;  1R22 A;  1XCV A;  1ONV A;  2LOO A;  1D0Y A;  5B1B H;  3DLL F;  3OYI A;  3FX3 A;  5IOZ A;  2BXZ A;  1REP C;  3QPL A;  1M1E B;  2XF6 A;  1LFU P;  5FJ8 J;  3COA C;  2EJR A;  1MH3 A;  2B7E A;  3H3V K;  4NNJ A;  3OR1 C;  5L3C A;  1U8B A;  1B9M A;  1Q1V A;  5F08 A;  3H1C A;  3B73 A;  2XPU A;  1YX3 A;  1U9N A;  2GXG A;  1XGM A;  1BL0 A;  4U0V A;  2CH0 A;  4GRI A;  2QBY A;  5FLX Z;  2K5C A;  2VB6 A;  5TGT A;  2FML A;  1QNT A;  1HKT A;  1XMX A;  4MIM A;  4CZZ A;  4BAC A;  5F1J A;  4M71 A;  2HOT A;  3K9T A;  5IP9 J;  3QWL A;  1ZHF A;  4II2 A;  4AU7 A;  3H9G A;  4M9S A;  3M07 A;  2L7M P;  4DYQ A;  2EFO A;  3BTI A;  4XRS G;  4XLH A;  1EJ9 A;  4EEF G;  1OIS A;  3I64 A;  3GXO A;  1BOB A;  2F5E A;  1K4S A;  2CWE A;  4AYB A;  1IV8 A;  3EYY A;  2CV0 A;  3F21 A;  4IZZ A;  1ZRF A;  5FLM J;  1U3E M;  2COM A;  2F5V A;  5BPI A;  4WXD A;  3C18 A;  2PJP A;  3CMM A;  4IEJ A;  2K9N A;  4ENK A;  1D5V A;  1UAA A;  1IUF A;  1MGT A;  2MSY A;  1HC8 A;  2HXI A;  2EH3 A;  3DPL C;  5IT9 Z;  3ZP5 A;  2GXA A;  1WJA A;  5F27 A;  5BMZ A;  4U0W A;  2V9V A;  4YIR X;  4BJ5 C;  3V4G A;  1R7J A;  4KT5 C;  1B72 B;  3V8K A;  2L7F P;  3Q5F A;  2O0Y A;  3GLX A;  1RR8 C;  3D0S A;  2IVM A;  1IN8 A;  3U21 A;  2JT1 A;  2V79 A;  2R7R A;  5B1A H;  1MBJ A;  1P4A A;  4N0B A;  4ITV A;  2P4W A;  1ON1 A;  3HG9 A;  3TW7 A;  4AIH A;  3C2B A;  3RKX A;  2X48 A;  4KN4 X;  2F48 A;  2JA2 A;  2DW4 A;  3K10 A;  1YYV A;  3KZY A;  4YFN F;  2PI0 A;  5DCF A;  1Y1V J;  2BYV E;  3AL0 B;  1BR4 A;  1VF9 A;  3ZN0 A;  3CMY A;  3O6B B;  1KQ9 A;  2HQ5 A;  3L2Q A;  1JKP C;  1U5T A;  1EH6 A;  1WSU A;  1CQT A;  3ZCO A;  2HR3 A;  4E7L A;  1K78 A;  4A3F J;  2GAU A;  2Y0S N;  3K4B A;  3IWZ A;  1WJ5 A;  1VQL I;  1GUU A;  1OMI A;  4F92 B;  1FYK A;  4I2O A;  1I3A A;  1MMA A;  4V19 K;  2KHM A;  2M2E A;  2XGE A;  3QOP A;  5EEG A;  2JK3 A;  2LY9 A;  1IW7 F;  4HPQ A;  3ERE D;  2M87 A;  3VSK A;  2ZXI A;  4OMY A;  2E34 A;  3OIO A;  4A0Y A;  5IYC J;  3L2C A;  4Y4R A;  2LLK A;  2W1O A;  1GDT A;  3ABK H;  2PJR A;  3FK6 A;  2I10 A;  2FOW A;  5F64 A;  2RQQ A;  4NDL A;  3CCJ I;  5GPA A;  1W7P D;  1SD6 A;  1TQM A;  2DLL A;  3LSM A;  5L3G A;  5E3N A;  2M3A A;  2K9S A;  4PCQ A;  3L7W A;  4IF4 A;  3CUQ B;  1RUO A;  1OLT A;  3G1L A;  5H6R A;  2M0C A;  3FHN A;  2A07 F;  3HKZ A;  1W7P A;  2Y75 A;  4CZC A;  4H4K C;  1ZR4 A;  5DV5 A;  3O8G A;  4IL6 C;  5DDG A;  1Y0U A;  3IAS 2;  1AOY A;  1ZRE A;  5CVV A;  1ETX A;  1W5C C;  3VYS B;  5H2F C;  1Z6R A;  3AAF A;  1V5G A;  3I9V 2;  5H20 A;  2JSC A;  1QQI A;  1MNM C;  3OYL A;  2DYR H;  2X4H A;  4KIG A;  3NAR A;  3R4K A;  4BHP A;  1JE8 A;  2DT7 B;  1BC8 C;  3W2V A;  4MFE A;  2L2O A;  4V2F A;  3LAJ A;  4L5I A;  2R4G A;  5D5X B;  3V7R A;  1BBY A;  5JVG F;  4UVC A;  1RKT A;  5F1R A;  2VE8 A;  1UHW A;  1HW5 A;  5J8F A;  2HVQ A;  1ZG1 A;  2HQN A;  4C3J J;  3HOV J;  2ZFW A;  1D1B A;  2VKD A;  4C2U A;  4NC8 A;  2RRE A;  5M3F J;  1X58 A;  2VLA A;  1MDM A;  2KZV A;  2J5P A;  3W6V A;  2D1H A;  3BWG A;  1SFX A;  2HWV A;  2K02 A;  4WK8 F;  5BOX A;  1MMS A;  2DA4 A;  4XLF A;  1B4A A;  4M6Y A;  4C3I J;  4BNC A;  3K4M A;  5KAI C;  3K4N A;  3TO9 A;  2VN2 A;  3KFW X;  3T8R A;  1UHM A;  3KP3 A;  4B4C A;  4EMS A;  3BG7 A;  3KEQ A;  2ZB9 A;  3MQ0 A;  4XLN F;  4RGX A;  3GWZ A;  3WOD F;  2YS9 A;  2LKS A;  2Z16 A;  4M3B A;  3J81 K;  3BZC A;  3VB2 A;  1YHQ I;  1USS A;  2R92 J;  2EIM H;  2LF8 A;  2DI3 A;  3HB9 A;  4BQO A;  1QRY A;  3CC4 I;  3J7A Y;  3D5L A;  1SD5 A;  1WCM J;  4X6A J;  4UXN A;  4BEH B;  5DTD A;  2X9D A;  2ME6 A;  4F55 A;  4IOA F;  1DQU A;  3WGH A;  3K69 A;  4RDU A;  5LEK A;  3S1R J;  2UZK A;  2ZSI B;  1UEL B;  2M9H A;  4HAM A;  1VQM I;  3FBN B;  4FE4 A;  4EJV A;  3I55 I;  1UST A;  3TOB A;  5D5U B;  3I71 A;  2F2E A;  4CA0 A;  4ZYD A;  1XTA A;  2KLO A;  2HYG D;  3D5S C;  4PK4 A;  1LPQ A;  1J5Y A;  5HDG A;  2RNG A;  4XLE A;  2Z9O A;  1Z67 A;  4A93 J;  1G3Y A;  1D1C A;  5F0H A;  3RTR A;  1J9I A;  4MGR A;  1A35 A;  5D5W B;  2Z1D A;  3CJR B;  1EH8 A;  3GZ5 A;  3OOU A;  4BY1 J;  3O8H A;  1XX5 A;  2V1U A;  1J09 A;  2IGO A;  1GLN A;  2MYS A;  4L9N A;  5CVJ A;  3OS2 A;  3DBH B;  5GAE J;  3BTJ A;  4XSX F;  1HW1 A;  5J1U A;  2KJB A;  2W4S A;  3BPV A;  1HQC A;  1LVK A;  1UZC A;  3I3L A;  4IRH A;  4XMY A;  4KN7 X;  2Y9Y A;  2HVR A;  3A01 B;  2GZW A;  1F5T A;  5ERI A;  5FLV A;  3K0L A;  2Y31 A;  4G8X A;  2Z2S B;  5E1Z B;  1A36 A;  1Z9C A;  4ENJ A;  3OIP A;  1YOV B;  3JRF A;  1UG2 A;  2EB7 A;  4RBO A;  2DFI A;  4RGU A;  4MEX F;  2EFQ A;  3FZV A;  1W1W E;  3OYB A;  5ILV A;  2KMU A;  2FE3 A;  2VKE A;  2HNH A;  4HW0 A;  2CQQ A;  1JTX A;  3HL2 A;  4L5J A;  5L3F A;  3BJO A;  4UUS A;  3KE2 A;  4I99 C;  3OYM A;  2O8X A;  3ZQI A;  4A3I J;  3L2V A;  3DPU A;  4I98 B;  2EPF A;  4MQV A;  2VBY A;  5IT9 K;  1AKH B;  3G6E I;  1YG2 A;  4HNU A;  1SAU A;  1SVL A;  2DXI A;  5GTH C;  1X2M A;  2CV2 A;  2IW5 A;  1X1B A;  3GYH X;  4KUM A;  3MZH A;  1LQ1 A;  1S5L C;  2QEX I;  2DDA A;  2JMW A;  2D45 A;  1G6N A;  5ILS A;  4DJA A;  4ABZ A;  4KFC A;  3CDI A;  1F36 A;  5EDN A;  4RGS A;  1R71 A;  2XKO A;  1ZTR A;  3TMO A;  2FBK A;  3ZXS A;  1I1S A;  5J40 A;  2E1M C;  1OFC X;  1WJE A;  2OD5 A;  3BY6 A;  3HOS A;  3QPS A;  4II3 A;  1S7A A;  1IZ1 A;  3SDG A;  1PDN C;  3CME I;  5A2Q K;  3PQJ A;  3CCS I;  3E5X A;  3BJ6 A;  3LSR A;  3HKZ N;  2YSR A;  4XKV A;  5FD5 A;  1P2F A;  1TWC J;  1YFH A;  1XG1 A;  2X51 A;  5D8K B;  4EVI A;  2L9V A;  1GXQ A;  1X3W B;  2M7B A;  2HPI A;  2L5Q A;  1STZ A;  2LRE A;  5BNG A;  4BL0 B;  1OCR H;  5IT3 A;  1JJ6 C;  1MZB A;  3F6V A;  2VC0 A;  1OR7 C;  3M9A A;  2QLZ A;  2RNJ A;  2M8G X;  2CRG A;  4CCJ A;  2V1N A;  4RM2 A;  1H88 C;  3JCU C;  2DK5 A;  2R7Z J;  3GBG A;  3LQR A;  5FFX A;  1TL8 A;  1ULY A;  5E20 A;  3K1N A;  4MHG A;  3V7S A;  4YFX F;  1WQ2 A;  3LSH A;  1IC8 A;  1NG6 A;  2L3D A;  1U8R A;  5HOD A;  4PJM A;  5EEA A;  4PSX A;  1FIP A;  1R36 A;  3CCL I;  1N78 A;  3OYE A;  1IDZ A;  3DU5 A;  2GM4 A;  4DGW B;  1QBJ A;  1IGN A;  1IXS B;  3QOD A;  5E3L A;  2P8T A;  2LKX A;  4XOP A;  3NRV A;  3WHB A;  1XMA A;  4CUG A;  5KCM A;  2JQ7 A;  3I0T A;  4GDF A;  3TL4 X;  4EJT A;  2YU3 A;  4GYI A;  2E36 A;  4ZJZ A;  3VWB A;  2FF4 A;  3RCO A;  1PUE E;  4XNF A;  2OQG A;  2Y48 A;  2EK5 A;  3HGY A;  5J4Y A;  2VJJ A;  2LP0 A;  3HPH A;  2Z33 A;  3NWS A;  4B1R A;  1T2K A;  3H9J A;  3LFU A;  1FT9 A;  3HSF A;  1R5H A;  2ZJP F;  5FGM A;  2E19 A;  1YO5 C;  1XGN A;  2HDW A;  3WTU C;  5K5Q A;  2OBP A;  2JUG A;  1ETV A;  1WFX A;  5DYM A;  2M4G A;  4B47 A;  3ZMV A;  2EZI A;  2WAD A;  2YPR A;  2BVM A;  2FQ4 A;  2KZG A;  3ZMT A;  4IHT A;  3HJE A;  1SMT A;  2IEK A;  4IHW A;  3KZZ A;  2V26 A;  2ELK A;  2VBX A;  4E70 A;  3SZG A;  1F9N A;  3HRS A;  4M73 A;  2PFB A;  1RPW A;  4C30 A;  4CYD A;  1YJ9 I;  1BR1 A;  1XS9 A;  1IN5 A;  2V6C A;  4MEY F;  3S1N J;  1UCR A;  1VND A;  1YI2 I;  1FSE A;  4ENM A;  2DA6 A;  3B02 A;  2BY2 A;  3LAP A;  1LE8 B;  5JR3 A;  3DEE A;  5LGN A;  5CQG A;  1P7I A;  3P9K A;  2EIK H;  3W6J B;  1DU0 A;  4XRF A;  4ZH4 F;  4AVZ A;  3GTP J;  2ICW G;  4J19 A;  1B59 A;  4XSZ F;  1ZG5 A;  1VQP I;  5IPA A;  3GTM J;  3GFM A;  2R0Q C;  4BJ6 C;  3U2R A;  2QGU A;  3LSJ A;  4RB1 A;  2W85 A;  5J1R A;  2H6C A;  2I8D A;  2MGQ A;  1MIJ A;  1J2X A;  1OYI A;  2OF7 A;  1WJF A;  5IYD J;  2LH9 A;  1Y1W J;  1MBF A;  4BE0 A;  1FP2 A;  2LTP A;  2DA5 A;  1U78 A;  2KDO A;  5E1W A;  3DFG A;  3L2W A;  1CF7 A;  2A5Y B;  4OMZ A;  4AVP A;  2JUC A;  2G7U A;  4AWX B;  1BW5 A;  2XAQ A;  4B09 A;  2HQA A;  1JKO C;  4PJ0 C;  4KMU X;  2VPR A;  2VE9 A;  2X6X A;  3DBL B;  1WH7 A;  3D5R C;  3DF8 A;  4OIN F;  4C9Y A;  3NAU A;  5E3O A;  2M4K A;  4LIT A;  5LRR A;  2EA2 A;  1RC9 A;  2RKH A;  3Q0W A;  4XLC A;  3FIW A;  1NTC A;  4BHC A;  2IT0 A;  1OYW A;  4RA2 A;  2O5R A;  4A3G J;  1MJ9 A;  3K4C A;  1ERD A;  2KFD A;  3I54 A;  5M5W J;  4B43 A;  4EGY A;  2WB1 N;  2CW7 A;  2R5Y B;  2CUF A;  3E5U A;  2LFB A;  4X0G A;  2KIQ A;  3FM5 A;  1I39 A;  4L9J A;  5KNL A;  5GTI C;  3GFL A;  1APL C;  4XIC A;  2IJL A;  4PGH A;  4HDU A;  2E1C A;  2DJN A;  4ESF A;  1T38 A;  2AXT C;  4H0E A;  2H8W A;  4HRI A;  1TTY A;  3MWM A;  4BEH A;  2KT0 A;  2XB0 X;  2NVY J;  4ZTF A;  3M8J A;  4NBQ A;  2HDC A;  4XRS A;  2CU7 A;  4HST A;  5IP6 A;  2R7F A;  3CF2 A;  3K6G A;  1VQO I;  3QP6 A;  4LD5 A;  2BEO A;  3A02 A;  1JT6 A;  2RC4 A;  2GLO A;  2V7F A;  3FXM A;  3OL3 A;  3FBI B;  1B8I A;  1UMQ A;  5K5R A;  4E7S A;  2KIM A;  2BW3 A;  4F7Z A;  3L1P A;  4JX5 A;  1AWC A;  4A3M J;  2MD5 A;  2XHK A;  3IH2 A;  2ZME B;  4U88 A;  1IN7 A;  2XAU A;  5HLI A;  5J3L A;  1J0R A;  5J8C A;  2MH2 A;  3DBR B;  4LB6 B;  4A3E J;  1FOY A;  4F93 B;  1BI0 A;  2VKH A;  4C3H J;  2LVS A;  2WV1 A;  4IQ4 A;  5DD4 A;  4XKC A;  3PFY A;  3OWT A;  2GOM A;  4OAY A;  3MMY B;  1MSF C;  3PIO F;  2ZJR F;  1I6H J;  4O6J A;  3G73 A;  1MJA A;  1WGX A;  2MC3 A;  3BTL A;  1KON A;  1LFP A;  2O7O A;  5L3B A;  3ERM A;  2AO9 A;  2X6Y A;  1RKW A;  4AIJ A;  2R5Z A;  1KU2 A;  4UVA A;  2PBI A;  2QSG X;  1SFU A;  3Q3S A;  5HNF A;  1R4M B;  2PG4 A;  2QF7 A;  2DMN A;  4KNY A;  1BI1 A;  1ZKG A;  3I59 B;  5J6X A;  4MLO A;  1HCR A;  2XAJ A;  1PUF B;  3TW6 A;  3RYR A;  3AKZ A;  4LIV A;  1QPI A;  3EUA A;  4LG3 A;  2JPB A;  1YJW I;  2FMY A;  2Y9Z A;  3S32 A;  2BY1 A;  1T95 A;  3PQK A;  5D4S A;  4LG0 B;  2VI6 A;  1TNS A;  1LUJ B;  2QVO A;  2LDU A;  5C3E J;  1ZRC A;  1J7K A;  4PDK A;  3PFI A;  3HBL A;  2DT6 A;  2EV5 A;  2JRM A;  3WE2 A;  1JXS A;  2MLG A;  1POG A;  3GZN B;  4B3X A;  3ZQL A;  3QP5 A;  4KIC A;  5HLG A;  2WBM A;  1RZ4 A;  4M3E A;  2E1O A;  1R5I D;  2PJR B;  4ZYG A;  3HYI A;  4HOB A;  4HSR A;  4BE2 A;  1Z6T A;  1Z05 A;  2ZBK A;  2H09 A;  2ZXJ A;  3WGG A;  1O4X A;  4BXX J;  3BR2 A;  1FTT A;  2WA0 A;  3J7A O;  4Q48 A;  2VAS A;  1QZE A;  2Y0S A;  3V8L A;  3IKV A;  1JKQ C;  2QQ9 A;  2CW8 A;  2XF7 A;  4IVN A;  2DA7 A;  4HV5 A;  3OMY A;  5J4V A;  3CC7 I;  2E2J J;  3I59 A;  2M0M A;  2HZT A;  2VKV A;  3CUQ A;  2HZD A;  3L00 A;  1OCT C;  3E7L A;  2ZKZ A;  2V4J C;  2GXB A;  2CYY A;  2R7Q A;  4UNO A;  1DU6 A;  2PMH A;  1TLH B;  3ZMU A;  4U87 A;  2L7K A;  3ZQH A;  1OJL A;  2STT A;  3P9I A;  3CES A;  4XLP F;  4BU2 A;  3DP7 A;  2X1E A;  1ZGA A;  1BW6 A;  3T0Y A;  3SJM A;  2R5Z B;  2EIN H;  2H94 A;  5M3M J;  5K7F A;  2KRH A;  5H6Q A;  1ETK A;  2K7L A;  2EQR A;  1T39 A;  3OSG A;  1FBU A;  3WU1 B;  3KEY A;  3S14 J;  2DN0 A;  2NNN A;  3OV8 A;  4BXU A;  3KP2 A;  4R79 A;  3MKY B;  2QZ8 A;  3BR0 A;  4UUT A;  3TQN A;  4E7Z A;  3FXL A;  2EFN A;  4F3Q A;  1YS6 A;  4QTR A;  1S8N A;  2DCE A;  3E0J B;  4ZDL A;  1LJ9 A;  4S04 A;  4X1E A;  3F6O A;  4QLC U;  2LKP A;  4PJJ A;  4HLY A;  3I4M J;  2DMP A;  1JHH A;  2CSO A;  4ZYH A;  3BTC A;  1WKM A;  2JN6 A;  2XAF A;  3WHC A; 
#chains in the Genus database with same CATH homology
 2ZJR F;  3J7Z I;  3G6E I;  2QA4 I;  5JVG F;  4IOA F;  2OTL I;  1MMS A;  2FOW A;  4IO9 F;  5GAG J;  2ZJQ F;  1VQ8 I;  1VQN I;  3CCL I;  1Y39 A;  1QA6 A;  3CJT B;  3CF5 F;  3CCJ I;  3CCM I;  1YIJ I;  1YJW I;  2H8W A;  1FOX A;  2QEX I;  4IOC F;  3G4S I;  2OTJ I;  2E35 A;  3CD6 I;  1VQL I;  1VQM I;  2ZJP F;  5DM7 F;  1YJ9 I;  5GAE J;  5GAH J;  3J7Y J;  3CCV I;  3I55 I;  1S72 I;  3G71 I;  1VQ7 I;  1YI2 I;  1FOY A;  1VQ4 I;  1VQ5 I;  2K3F A;  1VQ9 I;  3CC2 I;  1VQO I;  1FOW A;  3I56 I;  1ACI A;  1YHQ I;  2NXN B;  1VQK I;  3CMA I;  1VQ6 I;  3DLL F;  2JQ7 A;  3CCR I;  3CCQ I;  5GAD J;  3CCE I;  5DM6 F;  3PIP F;  3CCU I;  2E36 A;  1YJN I;  3CC4 I;  4V19 K;  2E34 A;  1HC8 A;  3CME I;  3CC7 I;  1YIT I;  3CCS I;  4UY8 I;  1VQP I;  3PIO F; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...