1S72I

Refined crystal structure of the haloarcula marismortui large ribosomal subunit at 2.4 angstrom resolution
Total Genus 16
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
16
sequence length
70
structure length
70
Chain Sequence
GVPPTAELIKDEAGFETGSGEPQEDFVADLSVDQVKQIAEQKHPDLLSYDLTNAAKEVVGTCTSLGVTIE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title The Roles of Ribosomal Proteins in the Structure, Assembly and Evolution of the Large Ribosomal Subunit
pubmed doi rcsb
molecule tags Ribosome
molecule keywords 23S ribosomal RNA
total genus 16
structure length 70
sequence length 70
ec nomenclature
pdb deposition date 2004-01-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
I PF00298 Ribosomal_L11 Ribosomal protein L11, RNA binding domain
I PF03946 Ribosomal_L11_N Ribosomal protein L11, N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.250 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Ribosomal protein L11, C-terminal domain 1s72I00
2E35A 3CF5F 3G71I 3CMAI 3CC7I 1YHQI 3PIPF 3CCJI 2K3FA 3CC2I 3CCUI 3J7ZI 1ACIA 3CCVI 1S72I 1YJWI 1VQKI 5GAGJ 1YJNI 2NXNB 3CJTB 2E36A 4V19K 1MMSA 1FOXA 2FOWA 1VQ4I 3J7YJ 3I56I 5JVGF 2QEXI 4IO9F 1VQ9I 2ZJPF 2ZJQF 1FOWA 3CCEI 5DM6F 3G6EI 1YITI 5GADJ 3CCMI 3CCRI 4UY8I 1VQOI 3CCLI 5GAEJ 2QA4I 1VQMI 1YIJI 2OTJI 1VQNI 1QA6A 1VQ8I 4IOAF 5GAHJ 1VQPI 3CCQI 3CC4I 3I55I 3CD6I 3G4SI 5DM7F 3CCSI 1YJ9I 1Y39A 4IOCF 1VQ7I 1VQ5I 1YI2I 2JQ7A 1VQ6I 1HC8A 1FOYA 3PIOF 2H8WA 2E34A 3CMEI 3DLLF 2ZJRF 1VQLI 2OTLI
chains in the Genus database with same CATH superfamily
2GAUA 5AIQA 1T98A 2K4JA 4IL6C 1T39A 2CFXA 3FMRA 1DU0A 1UZCA 4HOBA 2KJBA 3RSNA 1RC9A 3VSLA 3S3OA 2M5WA 3LAJA 4ZZDA 2Q2EA 2X51A 3H35A 3R0JA 3H3VK 1E3OC 1P2FA 3C2BA 2Z16A 2ZSHB 2Y30A 1B9NA 3D5RC 2GM4A 3BTCA 4ZZLA 5JVTA 4L5JA 5JI6A 3HOTA 3QU6A 1E2XA 3HOVJ 5JFRA 1U8BA 1FZPB 3F21A 2R7SA 1UFMA 2BY0A 2H94A 2HQ5A 1YYVA 4RAYA 3E6CC 2LBFA 1IXRC 2CJJA 2ZXHA 3MKLA 3M8JA 4FETA 2DOFA 1IRXA 3HEFA 3CF5F 1IRFA 3EPZA 4HZFA 4NDLA 3G73A 2L7ZA 5FLMJ 4NBQA 4U0VA 5FKNA 4G94A 3GUDA 3I59B 3ASOH 4GRIA 1MMAA 1W5SA 1YW9A 3DEEA 5L3DA 4KUMA 3KEYA 4UV9A 4O3MA 4J00A 1I50J 2FEZA 2UV1A 4F92B 2QVOA 2V1DA 4A0ZA 3HPGA 3GFMA 2LYCA 4F93B 5ILUA 2WADA 4E7HA 2JA5J 3S1MJ 2CV2A 1ZGAA 3WODF 1WJBA 3AAFA 3EUHC 1Z91A 2DI3A 4KT5C 3SZPA 1D0YA 4YELA 2L7MP 2OCCH 3FBNB 1A35A 1WJCA 4UV8A 4ZJZA 4IXAA 4XN3A 3A01A 4I7HA 4WXDA 3V8JA 3QOPA 4MTEA 3BY6A 2NNYA 3BQZA 1W1WE 3BR6A 3KCCA 1X3ZB 2HYGD 3IL2A 5E20A 1MH4A 4M9XA 2KIUA 4PGGA 2BYVE 2GOMA 4ON0A 1JUSA 1TWAJ 2YX7A 1K78A 1DQUA 4R1HA 3AG3H 1NH3A 2O3FA 4DJAA 1R5HA 2NAZA 2WAEA 4LOCA 2PJPA 3VYSB 2VBZA 3TKYA 2YU3A 4WXCA 4M6YA 1FOWA 3O8GA 2GXGA 2MGQA 1W7PB 1YX5A 4LD5A 3GTPJ 2F4MB 2R7OA 5DTDA 1UG0A 3GW2A 1XN7A 3M8EA 1V3FA 1F4KA 4BJ5C 2QSHX 5EG0A 4HX8A 2P81A 3S1NJ 1BM9A 2DPDA 2HQRA 2IP2A 2D45A 1DP7P 4E70A 1KGSA 3GTGJ 5F04A 2JVHA 2R5YA 4F3QA 1P4XA 1FNNA 1XMXA 4UUSB 2VPLA 1OCPA 4CO8A 1MMSA 1BIBA 3GTOJ 2K27A 3S8PA 4BHBA 3E6DA 3GX4X 2EZLA 1MBJA 5K5RA 2J5OA 5GAEJ 4FHTA 2M2EA 5ILSA 5GAHJ 2R7WA 1LFBA 2JTVA 1YW8A 3W6JB 4AC0A 2D5VA 2ZXJA 3BG3A 3BT9A 2EV0A 3HOXJ 1LKXA 2JA8J 2XROA 3F8MA 2XAHA 4E7ZA 2VN2A 4A3LJ 3BG7A 1KU2A 4I98B 1ACIA 2L02A 2QSFX 2ME6A 2FOWA 2CW7A 1XDSA 2M0CA 3U9GA 1D5YA 4RAFA 5B3SH 4LLLA 2NRAC 3HOZJ 2JVGA 1P9QC 1JHFA 5FB2A 5K5OA 2FRHA 3IHUA 1VQ7I 5EG0B 4AUXA 2EB7A 2HTJA 5E8GA 3EETA 2DA5A 1K4SA 2CU7A 4J01A 1YRNB 3T0YA 2CMPA 3LMMA 4EMSA 2EZIA 2VIXA 4G12A 3KYLA 4A3GJ 5FD5A 3HKZA 3TO6A 4BL0B 2A69F 3HL2A 2VJJA 4L9TA 2JUCA 3CCEI 4XRSA 2LF8A 4DBRA 4QTRA 1UCRA 3QP6A 2L54A 3V7RA 4Y33A 3DLAA 1IN5A 5FFZA 4AIDA 4UB8C 1I1GA 1KYWA 3T5XA 2E7XA 4B43A 2Y9ZA 2LLKA 3MN2A 1ONVA 2G7UA 2PFBA 3DPUA 2EZKA 4M3FA 1ZH5A 4XMYA 4EJWA 1E0EA 3DU6A 3WGGA 2O9LA 1KU9A 1XC5A 1NK3P 2VOOA 1W7PD 2CQKA 2QENA 2GWRA 3M8FA 1B1BA 2R5ZA 3EYIA 4NC8A 5HODA 5E3MA 2F5VA 4XM3A 4ZDPA 3KP2A 1P7IA 1R6RA 3H1CA 4A3IJ 2FA5A 2RNGA 1Y8RB 3ECOA 2TDXA 3PUBA 1JKOC 2W24A 1RZ4A 1BI3A 1I39A 4MO7A 2Y2ZA 3T8RA 3PO3J 4D5FA 2F4OB 3MAJA 1NHAA 3KPHA 1LDDA 1ZG1A 2L9VA 4FE4A 3CCLI 2XKPA 2IA0A 1WI3A 2MABA 3HRUA 3I4PA 3KP3A 4EJOA 3OWTA 4D7NA 3D1NI 2LBFB 3QYEA 4IX7A 3IKVA 3HSFA 3V8LA 4DYQA 5FKKA 3ZQIA 5A2QZ 2XGEA 5H20A 1SD6A 1WSUA 3BCBA 4IQJA 1P4WA 2XGCA 4IF4A 1FBUA 2K85A 2Q0OA 4GGGA 4BY1J 3VYRB 2QQ8A 5LHHA 1K83J 3MFKA 2VQGA 4AD9A 4CYDA 2K86A 2K02A 3B73A 2L4AA 2BXYA 2MLKA 2OTJI 2ID6A 3E97A 4HSTA 1TW2A 2VJIA 3EUAA 3BR0A 5C4JJ 1HA8A 4BEHA 4HF0A 3GFIA 2XB5A 2E7WA 2NOGA 4DOZA 1BW6A 2BVMA 2BXZA 2EFNA 2K5CA 4LB5A 3CJQB 5DS9A 1KQ9A 2LP0A 2ZXIA 1BN5A 2XDVA 1FP1D 3GYHX 2IS1A 4BY7J 3TO9A 3OYIA 2IVMA 2D1HA 3OYEA 4E7KA 2HTSA 3KYCB 3ZCOA 4DZPA 2PG4A 3WE2A 1QZEA 2W82A 3O3KA 3S93A 3FXLA 2PEXA 2UWMA 2OZUA 2XGXA 6PAXA 4EGZA 2P5VA 3GWZA 1N78A 4DIQA 4BDYA 5GTIC 3JTGA 3VWBA 1BC8C 1NG6A 4NUBA 2H6BA 3KYDB 1U3EM 1FTTA 1Z7UA 3BPXA 2XF5A 4G6DA 5J1UA 4DQ2A 5GPCA 4XICA 4U88A 1BI1A 1QBJA 5DD8A 4GO1A 3BDDA 3FKJA 5FLXZ 2F5DA 1XDUA 3CP2A 5CVUA 4OOIA 3H5NA 3K4MA 4KISA 1ZRDA 4NQWA 1TW3A 1X1BA 3CUOA 3F8NA 3PM1A 1D0XA 4O6JA 1YG2A 4RA2A 4XKWA 1YTYA 1X3WB 3WTWC 2E5NA 2VQLA 3DPTA 1MD0A 1GVDA 1ZLJA 2K9SA 4WXHA 2PJRB 3HOUJ 3E3VA 4IOCF 4IJAA 5TRDA 2VT3A 5JHFA 4HQMA 3PNYA 3I54A 1LDJA 4KMFA 4GDFA 2JK3A 3GXOA 4IHSA 1FBSA 2RQQA 3OYNA 2CH0A 1Z9CA 3CC2I 1KQ0A 1I6HJ 4B3AA 2DBBA 3MCZA 3FBIB 4HG2A 5FKOA 4BQNA 4NHJA 4PDKA 5ICEA 2E2JJ 2BGCA 4L9VA 2QEXI 1U78A 1J9IA 4A3DJ 1IZ1A 4OIOF 3CCMI 1O4XA 1LJ9A 1OR7A 1Q1VA 5M3FJ 2ELJA 4A3MJ 3CLOA 1LNWA 4RM3A 4MIMA 1GVJA 1ITYA 1USSA 1R58A 2M8EA 4Y17A 2VQCA 3GVAA 4S05A 1S9HA 2O7OA 4I6ZA 4BH9A 3VFZA 1MBKA 1S3JA 3WGHA 3ERED 4HBLA 2X6WA 4RGXA 2GXAA 2BY2A 5BPDA 2YS9A 3L2CA 3L2WA 4IRGA 3N97A 1A5JA 1Y8QB 2DT6A 3WU0A 4CYCB 3HHHA 2LF7A 4EM2A 3KZYA 3RDIA 4GYIA 3FHZA 3IRRA 4KIBA 4XL9A 5GTHC 4HRIA 5D4SA 2DU9A 2FX0A 2OA4A 2WAFA 3E5XA 5DD4A 3BQYA 5BOXA 2ZJ2A 1D0ZA 1GXPA 1G3SA 4P1WA 2KRFA 3LOCA 2E71A 1FYMA 3EUHA 1ZARA 3DTEA 3L00A 1R36A 3U1DA 4KT6A 1AWCA 2STTA 2I10A 1S72I 4PUSA 2ZC2A 1RI7A 4IHWA 1SC7A 3OS1A 4MFDA 5DUIA 4KYWA 4MFEA 3LWFA 4I01A 3TW7A 1U8RA 4G9YA 3K4BA 4RB0A 1BBYA 4Q47A 2LY2A 5LFAA 4ZYEA 1F36A 1UAAA 4ENJA 5TISC 2AHQA 2VASA 4RGRA 3CO7C 1VQLI 4U7BA 5K5QA 2FUG2 2TRTA 2EWNA 1N25A 5F1JA 4KMUX 2AQEA 3L9FA 4KJZA 4RAZA 2FQ4A 2K3PA 3DP7A 2QSGX 2CW0F 4CGZA 5EYRA 2JT1A 4HX4A 1LEAA 2CG4A 3CZ6A 4XLNF 4LITA 3RPUD 4BBSJ 1WKMA 3ULQB 3J80Z 3DTKA 2MC4A 2BY3A 2WY7Q 2VE9A 3M4OJ 1T95A 3QODA 2OC6A 2IJLA 5F0CA 2NOJB 4UVCA 3RTRA 2FSWA 1VQ6I 2CYYA 3WTVC 2MH9A 1F5TA 2V1NA 3HBLA 1BJAA 3HB9A 3R4KA 3I71A 1IGNA 4D1QA 4S04A 4OAYA 2AO9A 3BTIA 2GA1A 3F9KA 5M5XJ 1YX3A 3OR1C 2EV6A 2YR2A 1HBXG 4XSXF 4WX9A 4XORA 2VODA 3LQRA 4HV5A 2IBDA 1P7JA 4YIRX 5J40A 5ICFA 2BE5F 5FJ8J 1J09A 1FEXA 1YQAA 4CDGA 3Q9SA 4NC7A 2E60A 2OQGA 5J1YA 4CUGA 1N77A 1I27A 1QZYA 3G2BA 2OD5A 4JQFA 2O0YA 3I0TA 1ULYA 2E36A 2X6YA 3IWFA 2CV1A 1LE8A 2L01A 1FX7A 4BE0A 3NWSA 5LRSA 3RZOJ 1ZR2A 3KLNA 1BI0A 3ABLH 1PP8F 3ABTA 2IS4A 4I02A 3VB2A 4A0YA 4XQFA 1VQPI 4JOMA 4XBFA 1BI2A 4IRIA 1SMYF 1LB2A 1P4AA 2NVUB 4P9FA 1ZHFA 4XLFA 2I5UA 1ETYA 2STWA 2CFOA 1V5GA 4AYBA 5HNHA 3FZVA 1RESA 5KNLA 1EH6A 3CUQA 1NTCA 3S3MA 2Y75A 2L4MA 1FJLA 1Z21A 2R7ZJ 2LREA 2IGNA 5HS8A 1OCRH 2DO7A 4XR6A 2K9MA 1IV6A 3PNTA 4UXNA 2A6HF 2OPTA 4P9UA 1G2HA 5IOYA 1ZYRF 1J5YA 4BUPA 4EM0B 1XGNA 4BBRJ 1QO0D 4WCGA 2IGMA 2KIMA 1SAXA 2EIMH 4HF1A 2WTEA 5ED4A 2COBA 3CMMA 5DEQA 5HDNA 3OYDA 3LSPA 3F23A 1HQCA 4I99C 2XVCA 2NS8A 3S16J 4ESFA 1G3TA 3A0HC 2DFHA 3JRIA 5D6EA 4L18B 3LA2A 2DN0A 1R71A 3TMOA 1HKTA 2DLLA 2XPVA 3K6GA 1DP3A 3UKGA 4DGWB 2E1NA 4DW6A 1SFEA 1YIJI 3AFHA 1Y1VJ 1VI0A 4LLGF 5IT9Z 1WVRA 2BVLA 4JYKA 5C4XJ 4HX7A 3I3LA 3K7AJ 1A6QA 1FOYA 2WY8Q 4NQWB 1TQIA 4EVIA 3LSRA 3H92A 3S15J 1U9OA 2M0MA 3G3ZA 5B1BH 3MQ0A 4OWRB 1B59A 2CQNA 4V19K 1UMQA 4IKFA 2R7QA 2B0LA 2XF7A 2P5LC 2PMZN 1FPQA 3T1BA 1XTAA 4CCNA 1SVLA 5E79C 4GCVA 5J8CA 4A12A 2EQRA 5HS7A 3TO7A 3G4SI 5FRNA 3EQLF 3OL4A 3BTJA 5KAIC 2O6GE 4YG2F 3M3YJ 2A07F 4Y7NJ 2JMWA 3FK6A 2QKLB 1WJAA 5LGUA 1XGMA 2XAFA 1YHQI 3ZQ7A 1OJLA 2ID3A 2K9QA 4C3JJ 4ZH4F 4AVPA 4HW0A 4XN0A 3DPLC 1TT0A 3K2AA 3JRDA 4IHTA 2CO5A 2F48A 2HU9A 3MKYB 1BR1A 3E6MA 1E17A 1HW1A 1ETVA 3FIWA 2OV7A 1IC8A 5DCMA 5KVRA 2Q2EB 1DPUA 4XONA 5FRMA 1Q1HA 1ZK8A 3OYMA 4M3GA 4S0HB 4LK0F 3V8KA 1J59A 3OOUA 2MG4A 2ECCA 3ML6A 5L3CA 3FK7A 3OYJA 4BQAA 2MYSA 4XKBA 2RN7A 2OU2A 2L7KA 4YEJA 1HSTA 3ZXSA 1ERDA 4RGSA 5IT3A 5HVQC 2HPMA 3K1PA 3BJAA 4UVBA 1BR4A 1NK2P 5CQEA 3QQAA 2MC3A 1YW7A 2VPRA 3LSIA 2M7BA 2DK8A 3E1SA 2DOAA 3I58A 5EEAA 2EZHA 1W0UA 1ORKA 3JAMZ 1IUFA 3J7AY 4M3EA 3RQ4A 3A1YA 5L3FA 3HM5A 5H2FC 3NQOA 3HOSA 3D0SA 4Q48A 1SANA 2XAUA 3IH2A 3P9IA 5CVVA 5HLTA 5JLWA 2M3AA 2ZJQF 3W2WA 1RRJA 5KCMA 3R60A 5D8LB 1XGSA 5HS9A 3PSFA 4XRSG 1ZRCA 2WAQA 2G7HA 3I9V2 3BZ6A 2O5RA 1S6LA 4Y52J 2ETHA 1MJ9A 1I3AA 2DA6A 2G0EA 1QNTA 3Q3SA 4ZYDA 1ON2A 2KZVA 3CCUI 1IXSB 1WWXA 2DXIA 5GAGJ 1MBGA 3KX2A 2RGVA 3KETA 4HDVA 3CDIA 4JK1X 1S7AA 3VODA 2NS0A 1OLTA 2LG4A 3OSGA 2FQ3A 3MMYB 4A6DA 2IA1A 4L9NA 4U0WA 4KN4X 3DBLB 4MNUA 3GMEA 3KP4A 1HDDC 3AL0B 1WJEA 5C44J 3DF8A 1O7LA 2VT2A 4YFXF 1SAUA 2ISZA 2AXLA 4RBOA 4G7ZF 4XKVA 1LFUP 1GXQA 5CYVA 5F27A 4RB1A 3ZN1A 2QUFA 3K4JA 2FBKA 2KHMA 2KFDA 3QPSA 1XSXA 4RS8A 2LKSA 2ZCWA 1V4RA 1Z77A 2KP6A 3BR1A 1MJBA 3TDUC 5DM6F 1XSVA 2UUZA 1F1ZA 3S2DJ 1VQ8I 4IPAA 4XOTA 1Z7LA 4EV0A 2JUGA 4HEA2 1FIAA 1XCBA 3HGGA 3M07A 5KHDA 1MSEC 3ZN0A 2LDUA 1H89C 4HA8A 2QQAA 4X0GA 5CKTA 3H3ZA 4YFNF 1ZQ3P 5F1RA 3E5UA 1MDMB 2PX9A 3ESWB 2ZB9A 1OKRA 2DT5A 5CVIA 4BGDA 3QAHA 1U5TA 1YIOA 5CLSA 4I0BA 1QPMA 3S2WA 2QBYB 4N0BA 3CJNA 3JRHA 1PDNC 1PYVA 3K1MA 1T0FA 4AYBN 5FGMA 2HZDA 3K4KA 2BW3A 3LSHA 1NG7A 1M1EB 5ICGA 1TWFJ 4EJTA 3GO5A 2ELHA 4DYCA 3J80K 3GTJJ 2ZFUA 1TQMA 1FWZA 1PVEA 3OS2A 3EUKL 2LMDA 3RKQA 1IV8A 4P55A 1K79A 5AONA 4UUSA 2CW8A 2LY1A 4M9SA 1OFCX 1H0MA 2L9NA 4QPQA 4BAYA 2NVYJ 2MH2A 1HLVA 2DA2A 2M4KA 3HKZN 1KONA 4Q4ZF 4F55A 2Y31A 1HOMA 1SD7A 3ZMDA 2YX4A 1OCTC 1VQNI 1J2XA 4IHVA 1X1DA 3ZRGA 3BJ6A 3RIRA 2XGDA 4A5MA 3KZZA 2V4JC 1BL0A 1Y6IA 2EJRA 2E1MC 3UR3C 4J19A 1J75A 5E3NA 2EV5A 3GTQJ 4FTHA 3WTTC 3L1PA 2NVTJ 1OISA 2KLOA 2KZGA 4FISA 5IYBJ 2ZJPF 4EJUA 2XAJA 4JX5A 3BWGA 2A5WA 3FDYA 2ICWG 3ERMA 5ERIA 3CLQA 3JREA 3WE3A 2EBIA 2R3SA 4EM1A 1Y39A 1CF7A 4FASD 2X1EA 4ZC3A 2EIKH 2YU9J 2EFQA 1W36D 2F4IA 5EGOA 3S1RJ 5GPAA 1AA7A 4LK1F 4E7LA 1X1CA 3J81Z 5L3BA 1PUFA 2HNHA 4FCYA 1W4MA 1BA5A 3CJTB 4Y3OA 3A4CA 1O3QA 2MLGA 3LSGA 4V2GA 4M9ZA 1IAWA 1K6YA 1BOBA 2DMUA 1WPKA 3RPQA 2FF4A 2PN6A 5LLQA 4RAGA 2WWYA 4HSRA 2X1DA 2EA2A 2KDOA 2PJRA 3BROA 4KIGA 4JBAA 1ZGJA 1XMKA 3HOYJ 3I59A 3CMAI 2HDCA 2GXBA 5ILVA 3GEZA 1TC3C 2FE3A 2P5KA 4CICA 5BMZA 3T8TA 3PSIA 3TL4X 1U5TC 4LB6B 4KITB 5J8FA 2VBXA 5DV5A 3AKZA 3SHFA 2JRMA 2V9VA 1H8AC 2X9DA 3FMSA 5LEJA 2R92J 3AL0C 2CQXA 3DU5A 2FBHA 1T6SA 4JP0A 1LDKB 1BOAA 1VF9A 2V9KA 4C2MJ 2AQFA 2VQHA 1X2MA 2BY1A 1U2WA 1WH7A 3OYAA 4CZCA 1RUOA 2XAGA 2MBFA 3JSOA 1RR7A 4GFBA 4OIQF 3JTHA 1QQIA 5K7FA 2M8GX 2A5YB 1A04A 2HKXA 2Y69H 2YSRA 5IOZA 4LMYA 2HOTA 1IUYA 2QA4I 1VTNC 1GHCA 3OYCA 5D5UB 2O8XA 2JPBA 2V6EA 2O8KA 3P7NA 5JHUA 3IH3A 1MNDA 3TP0A 3K0LA 1P6RA 3HRSA 2F5EA 3HDDA 4JX6A 3MKZA 2NVXJ 2TCTA 3HXLA 1ON1A 2KISA 3K10A 1R9TJ 2XUBA 1S7EA 5DDGA 3S2HJ 2GQQA 2VJ4A 3AG4H 3CMYA 1X19A 4ZYGA 5C3EJ 1WCMJ 1E3HA 3BP8A 2F2EA 1IRGA 1QHGA 3OY9A 3VYTB 3J7AO 3K4LA 1HCRA 1A6IA 4LG0A 4L0YB 3F6OA 3QYBA 3LSKA 3QYFA 2P7VB 4MLOA 2L9RA 3A03A 5M5YJ 3W6KB 3BZCA 1OYWA 3Q9VA 5IPAA 1AKHA 2XSDC 1JT0A 3ECHA 2E2HJ 3DQVC 1IN6A 2ZO4A 1R00A 1DGRM 2QWWA 1TWCJ 4MGRA 1B8IA 3FKIJ 3PFYA 3WG9A 1G4DA 4RGUA 3I5UA 1S7OA 2M87A 5K7ZA 4UNOA 5HLHA 2CV0A 2HZTA 1OMIA 4ITVA 2HDWA 2M9HA 2RAEA 3JSPA 3WG7H 1HDPA 3C2HA 2KIQA 3WHBA 1T38A 2VB6A 2DA7A 4HF2A 2ZNYA 3DBRB 2DT7B 3GTKJ 1GV2A 4WK8F 2K7LA 2P4WA 1HW5A 3I53A 3F8BA 2JA7J 2DMPA 3D5SC 5EF6A 1YOVB 1X58A 4UUVA 5JVGF 1IN8A 3HZJA 4IO9F 2WB1A 3PL8A 3UNGC 3OYHA 3BR5A 2KRHA 2HR3A 2UXNA 2XHKA 2B7EA 3L7WA 3FXRA 4A3CJ 2FNAA 2ZNZA 1MSFC 1QA6A 4ZTFA 3HJEA 4IEJA 3DV8A 2HEOA 1X1PA 1Y0NA 2V7FA 3DLLF 3FMQA 4UB6C 4CCOA 4M6XA 5IYCJ 2Z9OA 3QOEA 2QF7A 3E7LA 1UJ8A 3NEUA 3ZMUA 1O3RA 3MZYA 3CCVI 3OYKA 5D5WB 3ZQHA 1ZELA 1RETA 5CVRA 5IT9K 2O03A 3OR2C 4D9JA 4FE7A 4R79A 5M5WJ 2HI3A 4HDUA 4ENKA 5LBQA 4LG0B 2HQNA 2MA3A 4BE2A 3HUGB 3H5RA 2KJCA 3S32A 2VKVA 3DEWA 3FISA 4CA0A 2H8RA 3P9KA 3I4NJ 2KL4A 1ZREA 3RZDJ 2LNBA 1FYLA 1XMAA 5E17F 1U0JA 3I4MJ 2IPQX 3DKWA 3JCUC 2DA4A 1D5VA 1K7AA 1FBQA 3ABKH 1W5TA 4CH7A 4XLHA 2IGOA 2WV0A 1WI9A 3OV8A 1LE8B 5E1XA 3FX3A 2GLOA 3WU2C 3JRBA 2LOOA 1BC7C 1Y0UA 3HYIA 3OYLA 2KPMA 1GT0C 2WV1A 2QCOA 2EA4A 3QWLA 1Z6RA 3K2ZA 4F7ZA 3WHCA 2XPWA 4XK4A 2DDAA 2ACJA 3DXJF 2BV6A 3ZQCA 3RKWA 2EFOA 3OSFA 3OOPA 2VE8A 1HXDA 2IAIA 4W1UA 3QPTA 4A93J 1ETWA 1R4NB 3Q0WA 1XCVA 2ISYA 1VQ4I 1QHHD 2VBYA 2VI6A 4M72A 2Y9YA 1ETXA 1B9MA 1V5EA 4KN7X 4RMNA 3D5LA 3KFWX 2DA3A 1EA3A 3IUOA 1QZZA 1QVUA 1MKMA 1EV7A 5F08A 3ZMTA 3F8CA 3NAUA 1SEUA 2K9LA 2RKHA 5D5VB 5JR3A 2QYOA 4CZZA 3G71I 4UUTA 3LSTA 2HS5A 5EJCA 1MMDA 2W4SA 3TOBA 5B1AH 1IXCA 5HLIA 4AIJA 2VKDA 2A6EF 2VKHA 2P8TA 3CESA 3Q5FA 4MEXF 4A5NA 4ENMA 1IW7F 2EPFA 3MZHA 2ZXWH 1T0FC 4KFCA 2OJED 2HOAA 2DCEA 5H6RA 2DTZA 3I55I 2JSCA 3ELKA 2RC4A 2OCEA 5FO5A 5TJJA 3KEOA 3ZP5A 4ZYAA 1WZ2A 2E19A 5FKMA 2PMZA 1Z3YA 3PO2J 2FMLA 2RREA 4DYRA 2M1BA 4DZJA 3U2RA 1E3PA 2IEKA 3BPVA 1FOXA 2W00A 4E6KG 2XV4S 3WTXC 3CCYA 4PJLA 1TNSA 2A6TA 2VLAA 3A02A 3HRMA 1PUFB 3W3CA 2QM3A 3M1CA 3PFIA 1KU3A 3G6EI 1G3WA 1MBHA 1I6XA 3MZ8A 3VPRA 2GBYA 3WTSC 2VUMJ 2FMYA 1EF4A 3QPHA 1R23A 1H88C 3GBGA 3S17J 2A3SA 3GFJA 3PIOF 1WJFA 2WAQN 4ZDOA 1JHHA 3JW4A 3NWTA 5TGTA 4B1RA 2CWEA 1N75A 1R4MB 2OF7A 1H9GA 2X6XA 3PIPF 2R7UA 1LVAA 1W7PA 4D5CA 1G59A 3SXYA 2H1KA 3VYUB 1MIJA 5L3EA 2DJNA 3LSJA 1MW7A 1WRJA 2G9WA 5F64A 2LD5A 1S8NA 1ETKA 3QP5A 1YO5C 1APLC 3Q0UA 1OYYA 1F43A 3JRFA 3DTIA 3PUFA 3K70D 1V55H 1FC3A 2V6CA 2KRCA 1FYKA 2IS2A 2Z1DA 4XLPF 2Z5UA 3K4CA 3RI4A 4I76A 2DTRA 3GZ6A 2IT0A 1TBXA 3LFUA 4OMYA 5FROA 3ZGKA 3VSKA 2DQRA 1REPC 1V5FA 4K2EA 5J47A 3GZ5A 2XKOA 3ABUA 4XLAA 3ISPA 3WGIA 2W1OA 2IS6A 2UXXA 1D8JA 1JKQC 2KIFA 2O61A 3KP5A 4IVNA 2UZKA 4AU7A 5IP6A 3KP6A 2PMUA 3REOA 1FMWA 2L7FP 3RCOA 2E1OA 2W85A 4B47A 5LEKA 1LPQA 1QPIA 5BS6A 4R8HA 5DCMB 2A05A 3S14J 2HWVA 4QIWN 1HC8A 1FSHA 2H8WA 1XG1A 2E1CA 3CDLA 2B63J 2GOXB 1ZRFA 4M73A 4FX0A 5J1RA 1D1AA 3MKWB 1R49A 1R1UA 3V7SA 5B66C 3CCJI 1I5ZA 1U5TB 3FXQA 2EFPA 2LK2A 2QGUA 2BOLA 3LNQA 1B8IB 3DWLE 5EEHA 3ZR8X 3L2RA 1FT9A 3GFLA 1L0OC 1XB4A 3E5QA 5CJ9A 1YRNA 1IN7A 4C30A 2CS3A 3SYTA 1USTA 1HKQA 2OTLI 2FBIA 4A2UA 1X1AA 2NS7A 3B6AA 2VBWA 4YIIA 3L09A 4CCKA 1O3SA 2V1XA 1ZG3A 2VXDA 2NNNA 3PJRA 3IC7A 3IP4B 3Q0VA 1ZN2A 1LFPA 4BE1A 1XSDA 4M74A 4AWXB 9ANTA 1AOYA 3OIQA 2CQQA 4X6AJ 2Z2SB 3CCRI 5ICCA 1TT5B 4XRMA 1JKPC 1WGXA 2JJ7A 4BJ6C 1JXSA 4AM3A 1GLNA 2ZKZA 1JJ6C 3IAM2 2FD5A 3HOWJ 2KMUA 1VQ5I 4A6EA 4RB2C 4BACA 1FY7A 2E34A 4XKCA 2XPUA 4HNTA 3BC8A 4YFKF 5J4YA 4G7OF 1Z1DA 1BW5A 3JAMK 2MFZA 3FHNA 4B3XA 1KA8A 1R5ID 1V54H 4I2OA 2K9NA 2K4BA 3HC7A 1LQ1A 3H9JA 1U6GA 2EILH 1JGSA 3HSRA 5J4VA 3OIOA 4LIVA 5LD2C 2DFIA 1IG7A 3PNVA 1QRYA 2CGPA 3FXJA 3U1KA 2EK5A 4D7MA 1JGGA 2C6YA 2JRTA 1D3YA 2HYFA 2X48A 3DKXA 3FXMA 4ETSA 1YI2I 3CO6C 1BJZA 1F9NA 1JT6A 2KDZA 4A3FJ 4CCMA 4ESJA 3HUGA 1A31A 2OBPA 3H5AA 3X2QH 3AG2H 3LQQA 3SQNA 3CF2A 3DBHB 1ODDA 1ZR4A 2W48A 1IO2A 1FTZA 2X85A 3GZNB 3QRFF 4B48A 1RUNA 1MJAA 1Z67A 2LR8A 5FLXK 2ZSIB 1SMTA 3H9GA 2FXAA 2CUEA 4XNFA 4FQGA 2LSOA 3F72A 2IA2A 1X2NA 2Z3YA 2CUFA 2W7NA 4HPQA 2JQ7A 3AG1H 3FM5A 4IHYA 5LRRA 3K1NA 2ZJRF 1IJWC 1ZAOA 4QWQA 5AIPA 4C3IJ 5M3MJ 1S5LC 1IN4A 1W5CC 2ZFWA 3TEDA 4BQOA 4L9JA 5KAFC 4I09A 1VQKI 2DPUA 2VONA 1H9TA 1U9NA 4OIPF 4E7JA 2NVQJ 4ANJA 1FIPA 1STZA 2R7TA 1JTXA 3H36A 3MWMA 1MBEA 2HOSA 4OIRF 2XC7A 1SFKA 1EH8A 5HOOA 2I8DA 4N9HA 1MNEA 4U87A 5FLVA 4RM2A 1TZLA 2RVCA 1UB9A 3F8FA 3KIOA 2L9SA 5E1WA 4LGWA 1KZHA 2A68F 1JKRC 4YIFA 1GV5A 4PZJA 2X1CA 1WHUA 4XSZF 2LH9A 2HFHA 3K4NA 5B5EC 2FOKA 1RIOH 1EH7A 3CTAA 4BDZA 1MDMA 2M7AA 2QLZA 3GCMA 3O2PE 2KT0A 2DMTA 3S1QJ 2ZBKA 3N05A 3O6BB 3B6CA 2IW5A 4BYYA 3F0CA 1ETOA 2DODA 2DJIA 2LTPA 3LSMA 4HAMA 1IDZA 2Z99A 4Z2YA 4G6QA 4P96A 3BLYA 1YS7A 2K40A 4F52A 4AIKA 3JRAA 1WH5A 2M34A 3RJPA 3C1DA 3TGNA 4PSWA 5E18F 5H6QA 1B72B 1OCZH 1VQOI 1VQMI 4CXFA 2ESNA 4BKXA 2R7XA 3CP8A 4EQQA 2W84A 2XRNA 3JRCA 1C0WA 3DEUA 3IAS2 1Z3XA 4A0XA 2DW4A 1TL8A 1Z05A 3VDXA 1AHDP 3IKTA 1SFOJ 2ZMEB 3QU3A 4FT8A 3ZMZA 2ADUA 2P6TA 4Z6YA 1KQ8A 3CJRB 3F6VA 2EH3A 1BIAA 4KICA 4NNJA 4M71A 2BEOA 2KKOA 5GP9A 1CGPA 2R7RA 2JSPA 5A2QK 1Y1WJ 4KDPA 4EEFG 5F0FA 3WTYC 2QQ9A 5D4RA 3DFGA 3M7GA 1SVMA 1HKSA 1Z0XA 4XOPA 4EATA 4RDUA 4HNUA 1A36A 2L0KA 4B8XA 2Y0MA 4IQ4A 1R22A 2Q1ZB 5E3OA 1G8XA 1WJDA 5HNFA 3C18A 2W25A 1UHSA 2AS5F 3TBIA 5LHGA 4CYCA 1X3UA 4PJMA 2CSOA 3C2GA 4A3JJ 4XLEA 2JPCA 4QPOA 1Z6TA 5DUKA 2WB1N 1TQPA 5J6XA 1GDTA 1T2KA 2LC2A 2VC1A 4D0PA 5LHIA 1L3LA 2DMQA 4LIUA 4PCQA 2HVQA 1IF1A 3GLXA 4HLYA 1ETQA 4PJ0C 2F5FA 4WF2A 5CQGA 1X4OA 4TV7A 3ZPLA 2E5ZA 1QVTA 1MBFA 3CQZJ 3OYFA 3MD2A 4PSXA 3JRGA 1XX5A 3HSEA 5DYMA 5IP7J 4HV6A 4XLCA 5E3LA 1IDYA 3GTMJ 1PP7U 2HVSA 4YRVA 1YJWI 1G6NA 4Y4RA 2V79A 2VOPA 2CRGA 2YUSA 1YE9A 1Y56A 3LA3A 1DPRA 2XAQA 3H3UA 1LVKA 5K7HA 5D5XB 3FF5A 3KP7A 1T08B 3ZQGA 1D1BA 3FWEA 4A3EJ 5EGOB 1D1CA 2CUJA 1DGWY 3W2VA 4ESBA 4H0EA 3KE2A 2XB0X 2R4GA 3MEXA 3RYRA 2JWTA 3OYBA 2DFFA 4BNCA 2COMA 1R7JA 1FP2A 3GF2A 4N4OB 1K4TA 4CCJA 4E4HA 2L5QA 5BQTA 2WC2A 2V1UA 4W97A 2LKPA 2VXZA 2DFEA 4BXXJ 2XASA 2MD0A 3U21A 1K61A 1JJ8C 3V7CA 3CC4I 5IP9J 5DM7F 4C9YA 2WBMA 2P7CB 2IGKA 1O57A 1YS6A 5F6FA 3FM3A 3ZMSA 3HPHA 2CQ7A 4G6TB 3HGYA 1BR2A 3FXOA 3ZQLA 1ENHA 1S29A 3LA7A 1JE8A 1R5GA 3BOQA 2M4GA 4EJVA 2OQRA 1J7KA 1I3QJ 1RNLA 3G1OA 3HIFA 4BU2A 2Y48A 4BEHB 2RDPA 3M9AA 3A01B 3RQIA 2XF6A 3B02A 3DCFA 2R5ZB 1HF0A 5E8IA 4KNYA 2HGCA 2VL8A 3G1LA 1GUUA 3SEZA 2ESHA 3SJMA 4E7IA 5HDGA 2R7FA 2VJ5A 5BPIA 1MZBA 5EZHA 2X4HA 2ECBA 3J7ZI 4OU0A 2R0QC 4M3BA 2HDDA 3NARA 2DAOA 3ZMVA 3ZOBA 3ABMH 4U0YA 3HTSB 4B09A 4KA4A 5L3GA 1WQ2A 2Z33A 2RNJA 2X0LA 1X4PA 3IRQA 1VZ0A 4GYGA 4L5EA 1JTYA 1YJ9I 1RPWA 4A3KJ 2BHZA 3P5JA 2DYRH 4L0ZB 3KZIC 1EJ9A 3L2QA 2LFBA 3TW6A 1I1SA 2B9SA 1OCOH 2M30A 2K3FA 2P6SA 4OAZA 4BJTA 2EIJH 4RLFA 2R7DA 4OMZA 1MNMC 2ME0A 4II3A 1VQ9I 4PK4A 1FMVA 3R61A 4GXOA 2FNPA 3PQKA 1XGOA 3RKXA 1ZKGA 1ZG5A 2HXOA 3OIPA 1TP4A 3CD6I 4LG3A 1MMGA 1RR8C 2F6CA 3HTUA 1T8IA 2AXTC 3KEQA 1SD4A 2L3DA 2H09A 3MVPA 4U7DA 4M6VA 2DOEA 3F22A 4I0AA 2IXSA 1QU3A 3RKYA 3BR3A 2PLYA 5FFXA 1DDNA 2MSYA 2LRDA 3OL3A 2HQAA 2OZ6A 4C2UA 4ENNA 1W36C 2D2WA 3BTLA 3BG5A 3K70C 2GZWA 4UHTA 1LEBA 2HYJA 2HKOA 1T33A 5F0HA 4G7HF 4BXUA 2XRLA 1TWHJ 2Q8KA 3K9TA 4ABZA 1OYIA 2H1LA 1UHWA 4MHGA 5K1YA 4LJZF 3A2KA 3CUQC 5LGNA 4MTDA 3V4GA 5CVJA 1ZLKA 3RPUA 2PQ8A 1YITI 1DU6A 1YLFA 2FJ1A 3L2UA 3CUQB 3DKYA 4UY8I 2WA0A 2BBYA 4N9IA 2R7VA 5KK1A 2QZ8A 1UHMA 2CUZA 3SDGA 4V2FA 2DA1A 3CCQI 1RKWA 5EZGA 4C3HJ 1K6OA 4JX4A 1O3TA 5FKLA 4QSHA 4RLQA 4ASNA 1JUPA 2E35A 1WFXA 2OAZA 4XRFA 4DNCA 2L2OA 4Y15A 3CC7I 5CPRB 4ZDLA 4Y13A 1WJ5A 4RB3C 3IWZA 3IH4A 1DUXC 1K78B 2NXNB 3IV5A 4BQQA 1MH3A 4HLXA 4ZYHA 3J81K 2HXIA 3ZQFA 1SFXA 3LAPA 3F3XA 4HNVA 4PJNA 4PFOA 4NB5A 1PUEE 3H0GJ 4A3BJ 2ZMEA 3LFKA 2LY9A 5BNGA 3FXUA 3WTZA 2DYSH 2W57A 2J5PA 4PJJA 3G1MA 3E0JB 3V42A 3P9CA 3BG9A 3COAC 1ZGWA 1SVOA 2VKEA 3O8HA 2R5YB 2EINH 4AVZA 3W2AA 3A0BC 3H9QA 3JR9A 1B72A 3NRVA 4BS9A 2BW3B 5D6FA 3HG9A 1CF7B 1HW2A 3QPLA 5GADJ 1QGPA 2DMNA 3BJOA 1IRZA 3TP3A 4O5VA 1FOKA 4XIDA 2QKMB 2GA2A 3BCAA 4IOAF 3CDHA 3LL7A 1EKEA 1SD5A 3CCSI 2Y0SN 1POGA 2GIVA 1W0TA 1B4AA 2P0WA 3BR2A 4BXFA 5HDKA 2DDBA 1VFCA 3WTUC 2JA6J 5J3LA 3OMYA 3BG6A 3HHGA 4BHPA 3HRTA 3N4MA 4CSWA 4NC6A 1PJRA 2JA2A 4LFUA 3VEPA 4OINF 1JI8A 2D1VA 5IY5H 3S3NA 3EDPA 3SZTA 4IHXA 4M3DA 1AU7A 4DBQA 4Q5SF 5E1ZB 2OUMA 4HQEA 4ZTJA 4PGHA 1CQTA 2ZMEC 3C7JA 1KYZA 3M1EA 4B44A 3VOEA 1UG2A 2RV8A 2QQBA 4UVAA 2X6OA 4A69C 2LKXA 4X1EA 3WU1B 5LGTA 2F5CA 1MGTA 2MW8A 1YFHA 1YJNI 3ONQA 3GTLJ 1TLHB 1XPXA 2KQRA 2DQLA 2N8GA 4MQVA 3J7YJ 4LLNA 1OR7C 3SEQA 3W6VA 4MEYF 2GIZA 1TNTA 1ZTRA 1MMNA 4KIFA 4II2A 2QBYA 3PQJA 3OS0A 5JLXA 1RKTA 3OYGA 3SFZA 5D8KB 1KU7A 3ZQQA 5EDNA 2XSJC 1VNDA 2E1MB 2HOEA 5HLGA 2PBIA 1D8KA 2DK5A 4HYEA 1JUMA 2JN6A 3BZKA 3E6BA 4QLCU 3R6SA 3TQNA 4AIHA 1OCCH 1SFUA 4CCLA 4MQ9F 4WWCA 3C3WA 1AKHB 4N4NB 2MD5A 2E2IJ 2R93J 3ASNH 3L2VA 1FLIA 1R1VA 3R0AA 2H6CA 1LUJB 2NYXA 2JZYA 3GLLA 3I64A 1TWGJ 3K69A 1G3YA 4CHUA 1HSJA 2YPRA 3SZGA 2PI0A 3TDZC 3KLOA 3CMEI 4B4CA 3SFIA 3FXKA 2M45A 2LVSA 2A61A 4L5IA 5IYDJ 1B6AA 2V26A 4C2TA 1UELB 2XIGA 4H4KC 1XS9A 2IRFG 1TTYA 4FX4A 2VC0A 3EYYA 2BHYA 2RQPA 4BHCA 4EGYA 2BZTA 4IRHA 2HVRA 3I56I 2FU4A 4IZZA 4F91B 2Y0SA 1J0RA 5EEGA 1O7FA 3RYPA 4PFPA 1XD7A 1OQYA 2ELKA 1T56A 2V9PA 3SDBA 5FD6A 4G8XA 3H0DA 3TOAA 4E7SA 4P5OA 1R1TA 5DCFA 1P92A 2PMHA 2HPIA 2EFWA 3ROUA 2H27A 1FSEA 1OPCA
chains in the Genus database with same CATH topology
2E35A 3CF5F 3G71I 3CMAI 3CC7I 1YHQI 3PIPF 3CCJI 2K3FA 3CC2I 3CCUI 3J7ZI 1ACIA 3CCVI 1S72I 1YJWI 1VQKI 5GAGJ 1YJNI 2NXNB 3CJTB 2E36A 4V19K 1MMSA 1FOXA 2FOWA 1VQ4I 3J7YJ 3I56I 5JVGF 2QEXI 4IO9F 1VQ9I 2ZJPF 2ZJQF 1FOWA 3CCEI 5DM6F 3G6EI 1YITI 5GADJ 3CCMI 3CCRI 4UY8I 1VQOI 3CCLI 5GAEJ 2QA4I 1VQMI 1YIJI 2OTJI 1VQNI 1QA6A 1VQ8I 4IOAF 5GAHJ 1VQPI 3CCQI 3CC4I 3I55I 3CD6I 3G4SI 5DM7F 3CCSI 1YJ9I 1Y39A 4IOCF 1VQ7I 1VQ5I 1YI2I 2JQ7A 1VQ6I 1HC8A 1FOYA 3PIOF 2H8WA 2E34A 3CMEI 3DLLF 2ZJRF 1VQLI 2OTLI
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2E35 A;  3CF5 F;  3G71 I;  3CMA I;  3CC7 I;  1YHQ I;  3PIP F;  3CCJ I;  2K3F A;  3CC2 I;  3CCU I;  3J7Z I;  1ACI A;  3CCV I;  1S72 I;  1YJW I;  1VQK I;  5GAG J;  1YJN I;  2NXN B;  3CJT B;  2E36 A;  4V19 K;  1MMS A;  1FOX A;  2FOW A;  1VQ4 I;  3J7Y J;  3I56 I;  5JVG F;  2QEX I;  4IO9 F;  1VQ9 I;  2ZJP F;  2ZJQ F;  1FOW A;  3CCE I;  5DM6 F;  3G6E I;  1YIT I;  5GAD J;  3CCM I;  3CCR I;  4UY8 I;  1VQO I;  3CCL I;  5GAE J;  2QA4 I;  1VQM I;  1YIJ I;  2OTJ I;  1VQN I;  1QA6 A;  1VQ8 I;  4IOA F;  5GAH J;  1VQP I;  3CCQ I;  3CC4 I;  3I55 I;  3CD6 I;  3G4S I;  5DM7 F;  3CCS I;  1YJ9 I;  1Y39 A;  4IOC F;  1VQ7 I;  1VQ5 I;  1YI2 I;  2JQ7 A;  1VQ6 I;  1HC8 A;  1FOY A;  3PIO F;  2H8W A;  2E34 A;  3CME I;  3DLL F;  2ZJR F;  1VQL I;  2OTL I; 
#chains in the Genus database with same CATH topology
 2GAU A;  5AIQ A;  1T98 A;  2K4J A;  4IL6 C;  1T39 A;  2CFX A;  3FMR A;  1DU0 A;  1UZC A;  4HOB A;  2KJB A;  3RSN A;  1RC9 A;  3VSL A;  3S3O A;  2M5W A;  3LAJ A;  4ZZD A;  2Q2E A;  2X51 A;  3H35 A;  3R0J A;  3H3V K;  1E3O C;  1P2F A;  3C2B A;  2Z16 A;  2ZSH B;  2Y30 A;  1B9N A;  3D5R C;  2GM4 A;  3BTC A;  4ZZL A;  5JVT A;  4L5J A;  5JI6 A;  3HOT A;  3QU6 A;  1E2X A;  3HOV J;  5JFR A;  1U8B A;  1FZP B;  3F21 A;  2R7S A;  1UFM A;  2BY0 A;  2H94 A;  2HQ5 A;  1YYV A;  4RAY A;  3E6C C;  2LBF A;  1IXR C;  2CJJ A;  2ZXH A;  3MKL A;  3M8J A;  4FET A;  2DOF A;  1IRX A;  3HEF A;  3CF5 F;  1IRF A;  3EPZ A;  4HZF A;  4NDL A;  3G73 A;  2L7Z A;  5FLM J;  4NBQ A;  4U0V A;  5FKN A;  4G94 A;  3GUD A;  3I59 B;  3ASO H;  4GRI A;  1MMA A;  1W5S A;  1YW9 A;  3DEE A;  5L3D A;  4KUM A;  3KEY A;  4UV9 A;  4O3M A;  4J00 A;  1I50 J;  2FEZ A;  2UV1 A;  4F92 B;  2QVO A;  2V1D A;  4A0Z A;  3HPG A;  3GFM A;  2LYC A;  4F93 B;  5ILU A;  2WAD A;  4E7H A;  2JA5 J;  3S1M J;  2CV2 A;  1ZGA A;  3WOD F;  1WJB A;  3AAF A;  3EUH C;  1Z91 A;  2DI3 A;  4KT5 C;  3SZP A;  1D0Y A;  4YEL A;  2L7M P;  2OCC H;  3FBN B;  1A35 A;  1WJC A;  4UV8 A;  4ZJZ A;  4IXA A;  4XN3 A;  3A01 A;  4I7H A;  4WXD A;  3V8J A;  3QOP A;  4MTE A;  3BY6 A;  2NNY A;  3BQZ A;  1W1W E;  3BR6 A;  3KCC A;  1X3Z B;  2HYG D;  3IL2 A;  5E20 A;  1MH4 A;  4M9X A;  2KIU A;  4PGG A;  2BYV E;  2GOM A;  4ON0 A;  1JUS A;  1TWA J;  2YX7 A;  1K78 A;  1DQU A;  4R1H A;  3AG3 H;  1NH3 A;  2O3F A;  4DJA A;  1R5H A;  2NAZ A;  2WAE A;  4LOC A;  2PJP A;  3VYS B;  2VBZ A;  3TKY A;  2YU3 A;  4WXC A;  4M6Y A;  1FOW A;  3O8G A;  2GXG A;  2MGQ A;  1W7P B;  1YX5 A;  4LD5 A;  3GTP J;  2F4M B;  2R7O A;  5DTD A;  1UG0 A;  3GW2 A;  1XN7 A;  3M8E A;  1V3F A;  1F4K A;  4BJ5 C;  2QSH X;  5EG0 A;  4HX8 A;  2P81 A;  3S1N J;  1BM9 A;  2DPD A;  2HQR A;  2IP2 A;  2D45 A;  1DP7 P;  4E70 A;  1KGS A;  3GTG J;  5F04 A;  2JVH A;  2R5Y A;  4F3Q A;  1P4X A;  1FNN A;  1XMX A;  4UUS B;  2VPL A;  1OCP A;  4CO8 A;  1MMS A;  1BIB A;  3GTO J;  2K27 A;  3S8P A;  4BHB A;  3E6D A;  3GX4 X;  2EZL A;  1MBJ A;  5K5R A;  2J5O A;  5GAE J;  4FHT A;  2M2E A;  5ILS A;  5GAH J;  2R7W A;  1LFB A;  2JTV A;  1YW8 A;  3W6J B;  4AC0 A;  2D5V A;  2ZXJ A;  3BG3 A;  3BT9 A;  2EV0 A;  3HOX J;  1LKX A;  2JA8 J;  2XRO A;  3F8M A;  2XAH A;  4E7Z A;  2VN2 A;  4A3L J;  3BG7 A;  1KU2 A;  4I98 B;  1ACI A;  2L02 A;  2QSF X;  2ME6 A;  2FOW A;  2CW7 A;  1XDS A;  2M0C A;  3U9G A;  1D5Y A;  4RAF A;  5B3S H;  4LLL A;  2NRA C;  3HOZ J;  2JVG A;  1P9Q C;  1JHF A;  5FB2 A;  5K5O A;  2FRH A;  3IHU A;  1VQ7 I;  5EG0 B;  4AUX A;  2EB7 A;  2HTJ A;  5E8G A;  3EET A;  2DA5 A;  1K4S A;  2CU7 A;  4J01 A;  1YRN B;  3T0Y A;  2CMP A;  3LMM A;  4EMS A;  2EZI A;  2VIX A;  4G12 A;  3KYL A;  4A3G J;  5FD5 A;  3HKZ A;  3TO6 A;  4BL0 B;  2A69 F;  3HL2 A;  2VJJ A;  4L9T A;  2JUC A;  3CCE I;  4XRS A;  2LF8 A;  4DBR A;  4QTR A;  1UCR A;  3QP6 A;  2L54 A;  3V7R A;  4Y33 A;  3DLA A;  1IN5 A;  5FFZ A;  4AID A;  4UB8 C;  1I1G A;  1KYW A;  3T5X A;  2E7X A;  4B43 A;  2Y9Z A;  2LLK A;  3MN2 A;  1ONV A;  2G7U A;  2PFB A;  3DPU A;  2EZK A;  4M3F A;  1ZH5 A;  4XMY A;  4EJW A;  1E0E A;  3DU6 A;  3WGG A;  2O9L A;  1KU9 A;  1XC5 A;  1NK3 P;  2VOO A;  1W7P D;  2CQK A;  2QEN A;  2GWR A;  3M8F A;  1B1B A;  2R5Z A;  3EYI A;  4NC8 A;  5HOD A;  5E3M A;  2F5V A;  4XM3 A;  4ZDP A;  3KP2 A;  1P7I A;  1R6R A;  3H1C A;  4A3I J;  2FA5 A;  2RNG A;  1Y8R B;  3ECO A;  2TDX A;  3PUB A;  1JKO C;  2W24 A;  1RZ4 A;  1BI3 A;  1I39 A;  4MO7 A;  2Y2Z A;  3T8R A;  3PO3 J;  4D5F A;  2F4O B;  3MAJ A;  1NHA A;  3KPH A;  1LDD A;  1ZG1 A;  2L9V A;  4FE4 A;  3CCL I;  2XKP A;  2IA0 A;  1WI3 A;  2MAB A;  3HRU A;  3I4P A;  3KP3 A;  4EJO A;  3OWT A;  4D7N A;  3D1N I;  2LBF B;  3QYE A;  4IX7 A;  3IKV A;  3HSF A;  3V8L A;  4DYQ A;  5FKK A;  3ZQI A;  5A2Q Z;  2XGE A;  5H20 A;  1SD6 A;  1WSU A;  3BCB A;  4IQJ A;  1P4W A;  2XGC A;  4IF4 A;  1FBU A;  2K85 A;  2Q0O A;  4GGG A;  4BY1 J;  3VYR B;  2QQ8 A;  5LHH A;  1K83 J;  3MFK A;  2VQG A;  4AD9 A;  4CYD A;  2K86 A;  2K02 A;  3B73 A;  2L4A A;  2BXY A;  2MLK A;  2OTJ I;  2ID6 A;  3E97 A;  4HST A;  1TW2 A;  2VJI A;  3EUA A;  3BR0 A;  5C4J J;  1HA8 A;  4BEH A;  4HF0 A;  3GFI A;  2XB5 A;  2E7W A;  2NOG A;  4DOZ A;  1BW6 A;  2BVM A;  2BXZ A;  2EFN A;  2K5C A;  4LB5 A;  3CJQ B;  5DS9 A;  1KQ9 A;  2LP0 A;  2ZXI A;  1BN5 A;  2XDV A;  1FP1 D;  3GYH X;  2IS1 A;  4BY7 J;  3TO9 A;  3OYI A;  2IVM A;  2D1H A;  3OYE A;  4E7K A;  2HTS A;  3KYC B;  3ZCO A;  4DZP A;  2PG4 A;  3WE2 A;  1QZE A;  2W82 A;  3O3K A;  3S93 A;  3FXL A;  2PEX A;  2UWM A;  2OZU A;  2XGX A;  6PAX A;  4EGZ A;  2P5V A;  3GWZ A;  1N78 A;  4DIQ A;  4BDY A;  5GTI C;  3JTG A;  3VWB A;  1BC8 C;  1NG6 A;  4NUB A;  2H6B A;  3KYD B;  1U3E M;  1FTT A;  1Z7U A;  3BPX A;  2XF5 A;  4G6D A;  5J1U A;  4DQ2 A;  5GPC A;  4XIC A;  4U88 A;  1BI1 A;  1QBJ A;  5DD8 A;  4GO1 A;  3BDD A;  3FKJ A;  5FLX Z;  2F5D A;  1XDU A;  3CP2 A;  5CVU A;  4OOI A;  3H5N A;  3K4M A;  4KIS A;  1ZRD A;  4NQW A;  1TW3 A;  1X1B A;  3CUO A;  3F8N A;  3PM1 A;  1D0X A;  4O6J A;  1YG2 A;  4RA2 A;  4XKW A;  1YTY A;  1X3W B;  3WTW C;  2E5N A;  2VQL A;  3DPT A;  1MD0 A;  1GVD A;  1ZLJ A;  2K9S A;  4WXH A;  2PJR B;  3HOU J;  3E3V A;  4IOC F;  4IJA A;  5TRD A;  2VT3 A;  5JHF A;  4HQM A;  3PNY A;  3I54 A;  1LDJ A;  4KMF A;  4GDF A;  2JK3 A;  3GXO A;  4IHS A;  1FBS A;  2RQQ A;  3OYN A;  2CH0 A;  1Z9C A;  3CC2 I;  1KQ0 A;  1I6H J;  4B3A A;  2DBB A;  3MCZ A;  3FBI B;  4HG2 A;  5FKO A;  4BQN A;  4NHJ A;  4PDK A;  5ICE A;  2E2J J;  2BGC A;  4L9V A;  2QEX I;  1U78 A;  1J9I A;  4A3D J;  1IZ1 A;  4OIO F;  3CCM I;  1O4X A;  1LJ9 A;  1OR7 A;  1Q1V A;  5M3F J;  2ELJ A;  4A3M J;  3CLO A;  1LNW A;  4RM3 A;  4MIM A;  1GVJ A;  1ITY A;  1USS A;  1R58 A;  2M8E A;  4Y17 A;  2VQC A;  3GVA A;  4S05 A;  1S9H A;  2O7O A;  4I6Z A;  4BH9 A;  3VFZ A;  1MBK A;  1S3J A;  3WGH A;  3ERE D;  4HBL A;  2X6W A;  4RGX A;  2GXA A;  2BY2 A;  5BPD A;  2YS9 A;  3L2C A;  3L2W A;  4IRG A;  3N97 A;  1A5J A;  1Y8Q B;  2DT6 A;  3WU0 A;  4CYC B;  3HHH A;  2LF7 A;  4EM2 A;  3KZY A;  3RDI A;  4GYI A;  3FHZ A;  3IRR A;  4KIB A;  4XL9 A;  5GTH C;  4HRI A;  5D4S A;  2DU9 A;  2FX0 A;  2OA4 A;  2WAF A;  3E5X A;  5DD4 A;  3BQY A;  5BOX A;  2ZJ2 A;  1D0Z A;  1GXP A;  1G3S A;  4P1W A;  2KRF A;  3LOC A;  2E71 A;  1FYM A;  3EUH A;  1ZAR A;  3DTE A;  3L00 A;  1R36 A;  3U1D A;  4KT6 A;  1AWC A;  2STT A;  2I10 A;  1S72 I;  4PUS A;  2ZC2 A;  1RI7 A;  4IHW A;  1SC7 A;  3OS1 A;  4MFD A;  5DUI A;  4KYW A;  4MFE A;  3LWF A;  4I01 A;  3TW7 A;  1U8R A;  4G9Y A;  3K4B A;  4RB0 A;  1BBY A;  4Q47 A;  2LY2 A;  5LFA A;  4ZYE A;  1F36 A;  1UAA A;  4ENJ A;  5TIS C;  2AHQ A;  2VAS A;  4RGR A;  3CO7 C;  1VQL I;  4U7B A;  5K5Q A;  2FUG 2;  2TRT A;  2EWN A;  1N25 A;  5F1J A;  4KMU X;  2AQE A;  3L9F A;  4KJZ A;  4RAZ A;  2FQ4 A;  2K3P A;  3DP7 A;  2QSG X;  2CW0 F;  4CGZ A;  5EYR A;  2JT1 A;  4HX4 A;  1LEA A;  2CG4 A;  3CZ6 A;  4XLN F;  4LIT A;  3RPU D;  4BBS J;  1WKM A;  3ULQ B;  3J80 Z;  3DTK A;  2MC4 A;  2BY3 A;  2WY7 Q;  2VE9 A;  3M4O J;  1T95 A;  3QOD A;  2OC6 A;  2IJL A;  5F0C A;  2NOJ B;  4UVC A;  3RTR A;  2FSW A;  1VQ6 I;  2CYY A;  3WTV C;  2MH9 A;  1F5T A;  2V1N A;  3HBL A;  1BJA A;  3HB9 A;  3R4K A;  3I71 A;  1IGN A;  4D1Q A;  4S04 A;  4OAY A;  2AO9 A;  3BTI A;  2GA1 A;  3F9K A;  5M5X J;  1YX3 A;  3OR1 C;  2EV6 A;  2YR2 A;  1HBX G;  4XSX F;  4WX9 A;  4XOR A;  2VOD A;  3LQR A;  4HV5 A;  2IBD A;  1P7J A;  4YIR X;  5J40 A;  5ICF A;  2BE5 F;  5FJ8 J;  1J09 A;  1FEX A;  1YQA A;  4CDG A;  3Q9S A;  4NC7 A;  2E60 A;  2OQG A;  5J1Y A;  4CUG A;  1N77 A;  1I27 A;  1QZY A;  3G2B A;  2OD5 A;  4JQF A;  2O0Y A;  3I0T A;  1ULY A;  2E36 A;  2X6Y A;  3IWF A;  2CV1 A;  1LE8 A;  2L01 A;  1FX7 A;  4BE0 A;  3NWS A;  5LRS A;  3RZO J;  1ZR2 A;  3KLN A;  1BI0 A;  3ABL H;  1PP8 F;  3ABT A;  2IS4 A;  4I02 A;  3VB2 A;  4A0Y A;  4XQF A;  1VQP I;  4JOM A;  4XBF A;  1BI2 A;  4IRI A;  1SMY F;  1LB2 A;  1P4A A;  2NVU B;  4P9F A;  1ZHF A;  4XLF A;  2I5U A;  1ETY A;  2STW A;  2CFO A;  1V5G A;  4AYB A;  5HNH A;  3FZV A;  1RES A;  5KNL A;  1EH6 A;  3CUQ A;  1NTC A;  3S3M A;  2Y75 A;  2L4M A;  1FJL A;  1Z21 A;  2R7Z J;  2LRE A;  2IGN A;  5HS8 A;  1OCR H;  2DO7 A;  4XR6 A;  2K9M A;  1IV6 A;  3PNT A;  4UXN A;  2A6H F;  2OPT A;  4P9U A;  1G2H A;  5IOY A;  1ZYR F;  1J5Y A;  4BUP A;  4EM0 B;  1XGN A;  4BBR J;  1QO0 D;  4WCG A;  2IGM A;  2KIM A;  1SAX A;  2EIM H;  4HF1 A;  2WTE A;  5ED4 A;  2COB A;  3CMM A;  5DEQ A;  5HDN A;  3OYD A;  3LSP A;  3F23 A;  1HQC A;  4I99 C;  2XVC A;  2NS8 A;  3S16 J;  4ESF A;  1G3T A;  3A0H C;  2DFH A;  3JRI A;  5D6E A;  4L18 B;  3LA2 A;  2DN0 A;  1R71 A;  3TMO A;  1HKT A;  2DLL A;  2XPV A;  3K6G A;  1DP3 A;  3UKG A;  4DGW B;  2E1N A;  4DW6 A;  1SFE A;  1YIJ I;  3AFH A;  1Y1V J;  1VI0 A;  4LLG F;  5IT9 Z;  1WVR A;  2BVL A;  4JYK A;  5C4X J;  4HX7 A;  3I3L A;  3K7A J;  1A6Q A;  1FOY A;  2WY8 Q;  4NQW B;  1TQI A;  4EVI A;  3LSR A;  3H92 A;  3S15 J;  1U9O A;  2M0M A;  3G3Z A;  5B1B H;  3MQ0 A;  4OWR B;  1B59 A;  2CQN A;  4V19 K;  1UMQ A;  4IKF A;  2R7Q A;  2B0L A;  2XF7 A;  2P5L C;  2PMZ N;  1FPQ A;  3T1B A;  1XTA A;  4CCN A;  1SVL A;  5E79 C;  4GCV A;  5J8C A;  4A12 A;  2EQR A;  5HS7 A;  3TO7 A;  3G4S I;  5FRN A;  3EQL F;  3OL4 A;  3BTJ A;  5KAI C;  2O6G E;  4YG2 F;  3M3Y J;  2A07 F;  4Y7N J;  2JMW A;  3FK6 A;  2QKL B;  1WJA A;  5LGU A;  1XGM A;  2XAF A;  1YHQ I;  3ZQ7 A;  1OJL A;  2ID3 A;  2K9Q A;  4C3J J;  4ZH4 F;  4AVP A;  4HW0 A;  4XN0 A;  3DPL C;  1TT0 A;  3K2A A;  3JRD A;  4IHT A;  2CO5 A;  2F48 A;  2HU9 A;  3MKY B;  1BR1 A;  3E6M A;  1E17 A;  1HW1 A;  1ETV A;  3FIW A;  2OV7 A;  1IC8 A;  5DCM A;  5KVR A;  2Q2E B;  1DPU A;  4XON A;  5FRM A;  1Q1H A;  1ZK8 A;  3OYM A;  4M3G A;  4S0H B;  4LK0 F;  3V8K A;  1J59 A;  3OOU A;  2MG4 A;  2ECC A;  3ML6 A;  5L3C A;  3FK7 A;  3OYJ A;  4BQA A;  2MYS A;  4XKB A;  2RN7 A;  2OU2 A;  2L7K A;  4YEJ A;  1HST A;  3ZXS A;  1ERD A;  4RGS A;  5IT3 A;  5HVQ C;  2HPM A;  3K1P A;  3BJA A;  4UVB A;  1BR4 A;  1NK2 P;  5CQE A;  3QQA A;  2MC3 A;  1YW7 A;  2VPR A;  3LSI A;  2M7B A;  2DK8 A;  3E1S A;  2DOA A;  3I58 A;  5EEA A;  2EZH A;  1W0U A;  1ORK A;  3JAM Z;  1IUF A;  3J7A Y;  4M3E A;  3RQ4 A;  3A1Y A;  5L3F A;  3HM5 A;  5H2F C;  3NQO A;  3HOS A;  3D0S A;  4Q48 A;  1SAN A;  2XAU A;  3IH2 A;  3P9I A;  5CVV A;  5HLT A;  5JLW A;  2M3A A;  2ZJQ F;  3W2W A;  1RRJ A;  5KCM A;  3R60 A;  5D8L B;  1XGS A;  5HS9 A;  3PSF A;  4XRS G;  1ZRC A;  2WAQ A;  2G7H A;  3I9V 2;  3BZ6 A;  2O5R A;  1S6L A;  4Y52 J;  2ETH A;  1MJ9 A;  1I3A A;  2DA6 A;  2G0E A;  1QNT A;  3Q3S A;  4ZYD A;  1ON2 A;  2KZV A;  3CCU I;  1IXS B;  1WWX A;  2DXI A;  5GAG J;  1MBG A;  3KX2 A;  2RGV A;  3KET A;  4HDV A;  3CDI A;  4JK1 X;  1S7A A;  3VOD A;  2NS0 A;  1OLT A;  2LG4 A;  3OSG A;  2FQ3 A;  3MMY B;  4A6D A;  2IA1 A;  4L9N A;  4U0W A;  4KN4 X;  3DBL B;  4MNU A;  3GME A;  3KP4 A;  1HDD C;  3AL0 B;  1WJE A;  5C44 J;  3DF8 A;  1O7L A;  2VT2 A;  4YFX F;  1SAU A;  2ISZ A;  2AXL A;  4RBO A;  4G7Z F;  4XKV A;  1LFU P;  1GXQ A;  5CYV A;  5F27 A;  4RB1 A;  3ZN1 A;  2QUF A;  3K4J A;  2FBK A;  2KHM A;  2KFD A;  3QPS A;  1XSX A;  4RS8 A;  2LKS A;  2ZCW A;  1V4R A;  1Z77 A;  2KP6 A;  3BR1 A;  1MJB A;  3TDU C;  5DM6 F;  1XSV A;  2UUZ A;  1F1Z A;  3S2D J;  1VQ8 I;  4IPA A;  4XOT A;  1Z7L A;  4EV0 A;  2JUG A;  4HEA 2;  1FIA A;  1XCB A;  3HGG A;  3M07 A;  5KHD A;  1MSE C;  3ZN0 A;  2LDU A;  1H89 C;  4HA8 A;  2QQA A;  4X0G A;  5CKT A;  3H3Z A;  4YFN F;  1ZQ3 P;  5F1R A;  3E5U A;  1MDM B;  2PX9 A;  3ESW B;  2ZB9 A;  1OKR A;  2DT5 A;  5CVI A;  4BGD A;  3QAH A;  1U5T A;  1YIO A;  5CLS A;  4I0B A;  1QPM A;  3S2W A;  2QBY B;  4N0B A;  3CJN A;  3JRH A;  1PDN C;  1PYV A;  3K1M A;  1T0F A;  4AYB N;  5FGM A;  2HZD A;  3K4K A;  2BW3 A;  3LSH A;  1NG7 A;  1M1E B;  5ICG A;  1TWF J;  4EJT A;  3GO5 A;  2ELH A;  4DYC A;  3J80 K;  3GTJ J;  2ZFU A;  1TQM A;  1FWZ A;  1PVE A;  3OS2 A;  3EUK L;  2LMD A;  3RKQ A;  1IV8 A;  4P55 A;  1K79 A;  5AON A;  4UUS A;  2CW8 A;  2LY1 A;  4M9S A;  1OFC X;  1H0M A;  2L9N A;  4QPQ A;  4BAY A;  2NVY J;  2MH2 A;  1HLV A;  2DA2 A;  2M4K A;  3HKZ N;  1KON A;  4Q4Z F;  4F55 A;  2Y31 A;  1HOM A;  1SD7 A;  3ZMD A;  2YX4 A;  1OCT C;  1VQN I;  1J2X A;  4IHV A;  1X1D A;  3ZRG A;  3BJ6 A;  3RIR A;  2XGD A;  4A5M A;  3KZZ A;  2V4J C;  1BL0 A;  1Y6I A;  2EJR A;  2E1M C;  3UR3 C;  4J19 A;  1J75 A;  5E3N A;  2EV5 A;  3GTQ J;  4FTH A;  3WTT C;  3L1P A;  2NVT J;  1OIS A;  2KLO A;  2KZG A;  4FIS A;  5IYB J;  2ZJP F;  4EJU A;  2XAJ A;  4JX5 A;  3BWG A;  2A5W A;  3FDY A;  2ICW G;  3ERM A;  5ERI A;  3CLQ A;  3JRE A;  3WE3 A;  2EBI A;  2R3S A;  4EM1 A;  1Y39 A;  1CF7 A;  4FAS D;  2X1E A;  4ZC3 A;  2EIK H;  2YU9 J;  2EFQ A;  1W36 D;  2F4I A;  5EGO A;  3S1R J;  5GPA A;  1AA7 A;  4LK1 F;  4E7L A;  1X1C A;  3J81 Z;  5L3B A;  1PUF A;  2HNH A;  4FCY A;  1W4M A;  1BA5 A;  3CJT B;  4Y3O A;  3A4C A;  1O3Q A;  2MLG A;  3LSG A;  4V2G A;  4M9Z A;  1IAW A;  1K6Y A;  1BOB A;  2DMU A;  1WPK A;  3RPQ A;  2FF4 A;  2PN6 A;  5LLQ A;  4RAG A;  2WWY A;  4HSR A;  2X1D A;  2EA2 A;  2KDO A;  2PJR A;  3BRO A;  4KIG A;  4JBA A;  1ZGJ A;  1XMK A;  3HOY J;  3I59 A;  3CMA I;  2HDC A;  2GXB A;  5ILV A;  3GEZ A;  1TC3 C;  2FE3 A;  2P5K A;  4CIC A;  5BMZ A;  3T8T A;  3PSI A;  3TL4 X;  1U5T C;  4LB6 B;  4KIT B;  5J8F A;  2VBX A;  5DV5 A;  3AKZ A;  3SHF A;  2JRM A;  2V9V A;  1H8A C;  2X9D A;  3FMS A;  5LEJ A;  2R92 J;  3AL0 C;  2CQX A;  3DU5 A;  2FBH A;  1T6S A;  4JP0 A;  1LDK B;  1BOA A;  1VF9 A;  2V9K A;  4C2M J;  2AQF A;  2VQH A;  1X2M A;  2BY1 A;  1U2W A;  1WH7 A;  3OYA A;  4CZC A;  1RUO A;  2XAG A;  2MBF A;  3JSO A;  1RR7 A;  4GFB A;  4OIQ F;  3JTH A;  1QQI A;  5K7F A;  2M8G X;  2A5Y B;  1A04 A;  2HKX A;  2Y69 H;  2YSR A;  5IOZ A;  4LMY A;  2HOT A;  1IUY A;  2QA4 I;  1VTN C;  1GHC A;  3OYC A;  5D5U B;  2O8X A;  2JPB A;  2V6E A;  2O8K A;  3P7N A;  5JHU A;  3IH3 A;  1MND A;  3TP0 A;  3K0L A;  1P6R A;  3HRS A;  2F5E A;  3HDD A;  4JX6 A;  3MKZ A;  2NVX J;  2TCT A;  3HXL A;  1ON1 A;  2KIS A;  3K10 A;  1R9T J;  2XUB A;  1S7E A;  5DDG A;  3S2H J;  2GQQ A;  2VJ4 A;  3AG4 H;  3CMY A;  1X19 A;  4ZYG A;  5C3E J;  1WCM J;  1E3H A;  3BP8 A;  2F2E A;  1IRG A;  1QHG A;  3OY9 A;  3VYT B;  3J7A O;  3K4L A;  1HCR A;  1A6I A;  4LG0 A;  4L0Y B;  3F6O A;  3QYB A;  3LSK A;  3QYF A;  2P7V B;  4MLO A;  2L9R A;  3A03 A;  5M5Y J;  3W6K B;  3BZC A;  1OYW A;  3Q9V A;  5IPA A;  1AKH A;  2XSD C;  1JT0 A;  3ECH A;  2E2H J;  3DQV C;  1IN6 A;  2ZO4 A;  1R00 A;  1DGR M;  2QWW A;  1TWC J;  4MGR A;  1B8I A;  3FKI J;  3PFY A;  3WG9 A;  1G4D A;  4RGU A;  3I5U A;  1S7O A;  2M87 A;  5K7Z A;  4UNO A;  5HLH A;  2CV0 A;  2HZT A;  1OMI A;  4ITV A;  2HDW A;  2M9H A;  2RAE A;  3JSP A;  3WG7 H;  1HDP A;  3C2H A;  2KIQ A;  3WHB A;  1T38 A;  2VB6 A;  2DA7 A;  4HF2 A;  2ZNY A;  3DBR B;  2DT7 B;  3GTK J;  1GV2 A;  4WK8 F;  2K7L A;  2P4W A;  1HW5 A;  3I53 A;  3F8B A;  2JA7 J;  2DMP A;  3D5S C;  5EF6 A;  1YOV B;  1X58 A;  4UUV A;  5JVG F;  1IN8 A;  3HZJ A;  4IO9 F;  2WB1 A;  3PL8 A;  3UNG C;  3OYH A;  3BR5 A;  2KRH A;  2HR3 A;  2UXN A;  2XHK A;  2B7E A;  3L7W A;  3FXR A;  4A3C J;  2FNA A;  2ZNZ A;  1MSF C;  1QA6 A;  4ZTF A;  3HJE A;  4IEJ A;  3DV8 A;  2HEO A;  1X1P A;  1Y0N A;  2V7F A;  3DLL F;  3FMQ A;  4UB6 C;  4CCO A;  4M6X A;  5IYC J;  2Z9O A;  3QOE A;  2QF7 A;  3E7L A;  1UJ8 A;  3NEU A;  3ZMU A;  1O3R A;  3MZY A;  3CCV I;  3OYK A;  5D5W B;  3ZQH A;  1ZEL A;  1RET A;  5CVR A;  5IT9 K;  2O03 A;  3OR2 C;  4D9J A;  4FE7 A;  4R79 A;  5M5W J;  2HI3 A;  4HDU A;  4ENK A;  5LBQ A;  4LG0 B;  2HQN A;  2MA3 A;  4BE2 A;  3HUG B;  3H5R A;  2KJC A;  3S32 A;  2VKV A;  3DEW A;  3FIS A;  4CA0 A;  2H8R A;  3P9K A;  3I4N J;  2KL4 A;  1ZRE A;  3RZD J;  2LNB A;  1FYL A;  1XMA A;  5E17 F;  1U0J A;  3I4M J;  2IPQ X;  3DKW A;  3JCU C;  2DA4 A;  1D5V A;  1K7A A;  1FBQ A;  3ABK H;  1W5T A;  4CH7 A;  4XLH A;  2IGO A;  2WV0 A;  1WI9 A;  3OV8 A;  1LE8 B;  5E1X A;  3FX3 A;  2GLO A;  3WU2 C;  3JRB A;  2LOO A;  1BC7 C;  1Y0U A;  3HYI A;  3OYL A;  2KPM A;  1GT0 C;  2WV1 A;  2QCO A;  2EA4 A;  3QWL A;  1Z6R A;  3K2Z A;  4F7Z A;  3WHC A;  2XPW A;  4XK4 A;  2DDA A;  2ACJ A;  3DXJ F;  2BV6 A;  3ZQC A;  3RKW A;  2EFO A;  3OSF A;  3OOP A;  2VE8 A;  1HXD A;  2IAI A;  4W1U A;  3QPT A;  4A93 J;  1ETW A;  1R4N B;  3Q0W A;  1XCV A;  2ISY A;  1VQ4 I;  1QHH D;  2VBY A;  2VI6 A;  4M72 A;  2Y9Y A;  1ETX A;  1B9M A;  1V5E A;  4KN7 X;  4RMN A;  3D5L A;  3KFW X;  2DA3 A;  1EA3 A;  3IUO A;  1QZZ A;  1QVU A;  1MKM A;  1EV7 A;  5F08 A;  3ZMT A;  3F8C A;  3NAU A;  1SEU A;  2K9L A;  2RKH A;  5D5V B;  5JR3 A;  2QYO A;  4CZZ A;  3G71 I;  4UUT A;  3LST A;  2HS5 A;  5EJC A;  1MMD A;  2W4S A;  3TOB A;  5B1A H;  1IXC A;  5HLI A;  4AIJ A;  2VKD A;  2A6E F;  2VKH A;  2P8T A;  3CES A;  3Q5F A;  4MEX F;  4A5N A;  4ENM A;  1IW7 F;  2EPF A;  3MZH A;  2ZXW H;  1T0F C;  4KFC A;  2OJE D;  2HOA A;  2DCE A;  5H6R A;  2DTZ A;  3I55 I;  2JSC A;  3ELK A;  2RC4 A;  2OCE A;  5FO5 A;  5TJJ A;  3KEO A;  3ZP5 A;  4ZYA A;  1WZ2 A;  2E19 A;  5FKM A;  2PMZ A;  1Z3Y A;  3PO2 J;  2FML A;  2RRE A;  4DYR A;  2M1B A;  4DZJ A;  3U2R A;  1E3P A;  2IEK A;  3BPV A;  1FOX A;  2W00 A;  4E6K G;  2XV4 S;  3WTX C;  3CCY A;  4PJL A;  1TNS A;  2A6T A;  2VLA A;  3A02 A;  3HRM A;  1PUF B;  3W3C A;  2QM3 A;  3M1C A;  3PFI A;  1KU3 A;  3G6E I;  1G3W A;  1MBH A;  1I6X A;  3MZ8 A;  3VPR A;  2GBY A;  3WTS C;  2VUM J;  2FMY A;  1EF4 A;  3QPH A;  1R23 A;  1H88 C;  3GBG A;  3S17 J;  2A3S A;  3GFJ A;  3PIO F;  1WJF A;  2WAQ N;  4ZDO A;  1JHH A;  3JW4 A;  3NWT A;  5TGT A;  4B1R A;  2CWE A;  1N75 A;  1R4M B;  2OF7 A;  1H9G A;  2X6X A;  3PIP F;  2R7U A;  1LVA A;  1W7P A;  4D5C A;  1G59 A;  3SXY A;  2H1K A;  3VYU B;  1MIJ A;  5L3E A;  2DJN A;  3LSJ A;  1MW7 A;  1WRJ A;  2G9W A;  5F64 A;  2LD5 A;  1S8N A;  1ETK A;  3QP5 A;  1YO5 C;  1APL C;  3Q0U A;  1OYY A;  1F43 A;  3JRF A;  3DTI A;  3PUF A;  3K70 D;  1V55 H;  1FC3 A;  2V6C A;  2KRC A;  1FYK A;  2IS2 A;  2Z1D A;  4XLP F;  2Z5U A;  3K4C A;  3RI4 A;  4I76 A;  2DTR A;  3GZ6 A;  2IT0 A;  1TBX A;  3LFU A;  4OMY A;  5FRO A;  3ZGK A;  3VSK A;  2DQR A;  1REP C;  1V5F A;  4K2E A;  5J47 A;  3GZ5 A;  2XKO A;  3ABU A;  4XLA A;  3ISP A;  3WGI A;  2W1O A;  2IS6 A;  2UXX A;  1D8J A;  1JKQ C;  2KIF A;  2O61 A;  3KP5 A;  4IVN A;  2UZK A;  4AU7 A;  5IP6 A;  3KP6 A;  2PMU A;  3REO A;  1FMW A;  2L7F P;  3RCO A;  2E1O A;  2W85 A;  4B47 A;  5LEK A;  1LPQ A;  1QPI A;  5BS6 A;  4R8H A;  5DCM B;  2A05 A;  3S14 J;  2HWV A;  4QIW N;  1HC8 A;  1FSH A;  2H8W A;  1XG1 A;  2E1C A;  3CDL A;  2B63 J;  2GOX B;  1ZRF A;  4M73 A;  4FX0 A;  5J1R A;  1D1A A;  3MKW B;  1R49 A;  1R1U A;  3V7S A;  5B66 C;  3CCJ I;  1I5Z A;  1U5T B;  3FXQ A;  2EFP A;  2LK2 A;  2QGU A;  2BOL A;  3LNQ A;  1B8I B;  3DWL E;  5EEH A;  3ZR8 X;  3L2R A;  1FT9 A;  3GFL A;  1L0O C;  1XB4 A;  3E5Q A;  5CJ9 A;  1YRN A;  1IN7 A;  4C30 A;  2CS3 A;  3SYT A;  1UST A;  1HKQ A;  2OTL I;  2FBI A;  4A2U A;  1X1A A;  2NS7 A;  3B6A A;  2VBW A;  4YII A;  3L09 A;  4CCK A;  1O3S A;  2V1X A;  1ZG3 A;  2VXD A;  2NNN A;  3PJR A;  3IC7 A;  3IP4 B;  3Q0V A;  1ZN2 A;  1LFP A;  4BE1 A;  1XSD A;  4M74 A;  4AWX B;  9ANT A;  1AOY A;  3OIQ A;  2CQQ A;  4X6A J;  2Z2S B;  3CCR I;  5ICC A;  1TT5 B;  4XRM A;  1JKP C;  1WGX A;  2JJ7 A;  4BJ6 C;  1JXS A;  4AM3 A;  1GLN A;  2ZKZ A;  1JJ6 C;  3IAM 2;  2FD5 A;  3HOW J;  2KMU A;  1VQ5 I;  4A6E A;  4RB2 C;  4BAC A;  1FY7 A;  2E34 A;  4XKC A;  2XPU A;  4HNT A;  3BC8 A;  4YFK F;  5J4Y A;  4G7O F;  1Z1D A;  1BW5 A;  3JAM K;  2MFZ A;  3FHN A;  4B3X A;  1KA8 A;  1R5I D;  1V54 H;  4I2O A;  2K9N A;  2K4B A;  3HC7 A;  1LQ1 A;  3H9J A;  1U6G A;  2EIL H;  1JGS A;  3HSR A;  5J4V A;  3OIO A;  4LIV A;  5LD2 C;  2DFI A;  1IG7 A;  3PNV A;  1QRY A;  2CGP A;  3FXJ A;  3U1K A;  2EK5 A;  4D7M A;  1JGG A;  2C6Y A;  2JRT A;  1D3Y A;  2HYF A;  2X48 A;  3DKX A;  3FXM A;  4ETS A;  1YI2 I;  3CO6 C;  1BJZ A;  1F9N A;  1JT6 A;  2KDZ A;  4A3F J;  4CCM A;  4ESJ A;  3HUG A;  1A31 A;  2OBP A;  3H5A A;  3X2Q H;  3AG2 H;  3LQQ A;  3SQN A;  3CF2 A;  3DBH B;  1ODD A;  1ZR4 A;  2W48 A;  1IO2 A;  1FTZ A;  2X85 A;  3GZN B;  3QRF F;  4B48 A;  1RUN A;  1MJA A;  1Z67 A;  2LR8 A;  5FLX K;  2ZSI B;  1SMT A;  3H9G A;  2FXA A;  2CUE A;  4XNF A;  4FQG A;  2LSO A;  3F72 A;  2IA2 A;  1X2N A;  2Z3Y A;  2CUF A;  2W7N A;  4HPQ A;  2JQ7 A;  3AG1 H;  3FM5 A;  4IHY A;  5LRR A;  3K1N A;  2ZJR F;  1IJW C;  1ZAO A;  4QWQ A;  5AIP A;  4C3I J;  5M3M J;  1S5L C;  1IN4 A;  1W5C C;  2ZFW A;  3TED A;  4BQO A;  4L9J A;  5KAF C;  4I09 A;  1VQK I;  2DPU A;  2VON A;  1H9T A;  1U9N A;  4OIP F;  4E7J A;  2NVQ J;  4ANJ A;  1FIP A;  1STZ A;  2R7T A;  1JTX A;  3H36 A;  3MWM A;  1MBE A;  2HOS A;  4OIR F;  2XC7 A;  1SFK A;  1EH8 A;  5HOO A;  2I8D A;  4N9H A;  1MNE A;  4U87 A;  5FLV A;  4RM2 A;  1TZL A;  2RVC A;  1UB9 A;  3F8F A;  3KIO A;  2L9S A;  5E1W A;  4LGW A;  1KZH A;  2A68 F;  1JKR C;  4YIF A;  1GV5 A;  4PZJ A;  2X1C A;  1WHU A;  4XSZ F;  2LH9 A;  2HFH A;  3K4N A;  5B5E C;  2FOK A;  1RIO H;  1EH7 A;  3CTA A;  4BDZ A;  1MDM A;  2M7A A;  2QLZ A;  3GCM A;  3O2P E;  2KT0 A;  2DMT A;  3S1Q J;  2ZBK A;  3N05 A;  3O6B B;  3B6C A;  2IW5 A;  4BYY A;  3F0C A;  1ETO A;  2DOD A;  2DJI A;  2LTP A;  3LSM A;  4HAM A;  1IDZ A;  2Z99 A;  4Z2Y A;  4G6Q A;  4P96 A;  3BLY A;  1YS7 A;  2K40 A;  4F52 A;  4AIK A;  3JRA A;  1WH5 A;  2M34 A;  3RJP A;  3C1D A;  3TGN A;  4PSW A;  5E18 F;  5H6Q A;  1B72 B;  1OCZ H;  1VQO I;  1VQM I;  4CXF A;  2ESN A;  4BKX A;  2R7X A;  3CP8 A;  4EQQ A;  2W84 A;  2XRN A;  3JRC A;  1C0W A;  3DEU A;  3IAS 2;  1Z3X A;  4A0X A;  2DW4 A;  1TL8 A;  1Z05 A;  3VDX A;  1AHD P;  3IKT A;  1SFO J;  2ZME B;  3QU3 A;  4FT8 A;  3ZMZ A;  2ADU A;  2P6T A;  4Z6Y A;  1KQ8 A;  3CJR B;  3F6V A;  2EH3 A;  1BIA A;  4KIC A;  4NNJ A;  4M71 A;  2BEO A;  2KKO A;  5GP9 A;  1CGP A;  2R7R A;  2JSP A;  5A2Q K;  1Y1W J;  4KDP A;  4EEF G;  5F0F A;  3WTY C;  2QQ9 A;  5D4R A;  3DFG A;  3M7G A;  1SVM A;  1HKS A;  1Z0X A;  4XOP A;  4EAT A;  4RDU A;  4HNU A;  1A36 A;  2L0K A;  4B8X A;  2Y0M A;  4IQ4 A;  1R22 A;  2Q1Z B;  5E3O A;  1G8X A;  1WJD A;  5HNF A;  3C18 A;  2W25 A;  1UHS A;  2AS5 F;  3TBI A;  5LHG A;  4CYC A;  1X3U A;  4PJM A;  2CSO A;  3C2G A;  4A3J J;  4XLE A;  2JPC A;  4QPO A;  1Z6T A;  5DUK A;  2WB1 N;  1TQP A;  5J6X A;  1GDT A;  1T2K A;  2LC2 A;  2VC1 A;  4D0P A;  5LHI A;  1L3L A;  2DMQ A;  4LIU A;  4PCQ A;  2HVQ A;  1IF1 A;  3GLX A;  4HLY A;  1ETQ A;  4PJ0 C;  2F5F A;  4WF2 A;  5CQG A;  1X4O A;  4TV7 A;  3ZPL A;  2E5Z A;  1QVT A;  1MBF A;  3CQZ J;  3OYF A;  3MD2 A;  4PSX A;  3JRG A;  1XX5 A;  3HSE A;  5DYM A;  5IP7 J;  4HV6 A;  4XLC A;  5E3L A;  1IDY A;  3GTM J;  1PP7 U;  2HVS A;  4YRV A;  1YJW I;  1G6N A;  4Y4R A;  2V79 A;  2VOP A;  2CRG A;  2YUS A;  1YE9 A;  1Y56 A;  3LA3 A;  1DPR A;  2XAQ A;  3H3U A;  1LVK A;  5K7H A;  5D5X B;  3FF5 A;  3KP7 A;  1T08 B;  3ZQG A;  1D1B A;  3FWE A;  4A3E J;  5EGO B;  1D1C A;  2CUJ A;  1DGW Y;  3W2V A;  4ESB A;  4H0E A;  3KE2 A;  2XB0 X;  2R4G A;  3MEX A;  3RYR A;  2JWT A;  3OYB A;  2DFF A;  4BNC A;  2COM A;  1R7J A;  1FP2 A;  3GF2 A;  4N4O B;  1K4T A;  4CCJ A;  4E4H A;  2L5Q A;  5BQT A;  2WC2 A;  2V1U A;  4W97 A;  2LKP A;  2VXZ A;  2DFE A;  4BXX J;  2XAS A;  2MD0 A;  3U21 A;  1K61 A;  1JJ8 C;  3V7C A;  3CC4 I;  5IP9 J;  5DM7 F;  4C9Y A;  2WBM A;  2P7C B;  2IGK A;  1O57 A;  1YS6 A;  5F6F A;  3FM3 A;  3ZMS A;  3HPH A;  2CQ7 A;  4G6T B;  3HGY A;  1BR2 A;  3FXO A;  3ZQL A;  1ENH A;  1S29 A;  3LA7 A;  1JE8 A;  1R5G A;  3BOQ A;  2M4G A;  4EJV A;  2OQR A;  1J7K A;  1I3Q J;  1RNL A;  3G1O A;  3HIF A;  4BU2 A;  2Y48 A;  4BEH B;  2RDP A;  3M9A A;  3A01 B;  3RQI A;  2XF6 A;  3B02 A;  3DCF A;  2R5Z B;  1HF0 A;  5E8I A;  4KNY A;  2HGC A;  2VL8 A;  3G1L A;  1GUU A;  3SEZ A;  2ESH A;  3SJM A;  4E7I A;  5HDG A;  2R7F A;  2VJ5 A;  5BPI A;  1MZB A;  5EZH A;  2X4H A;  2ECB A;  3J7Z I;  4OU0 A;  2R0Q C;  4M3B A;  2HDD A;  3NAR A;  2DAO A;  3ZMV A;  3ZOB A;  3ABM H;  4U0Y A;  3HTS B;  4B09 A;  4KA4 A;  5L3G A;  1WQ2 A;  2Z33 A;  2RNJ A;  2X0L A;  1X4P A;  3IRQ A;  1VZ0 A;  4GYG A;  4L5E A;  1JTY A;  1YJ9 I;  1RPW A;  4A3K J;  2BHZ A;  3P5J A;  2DYR H;  4L0Z B;  3KZI C;  1EJ9 A;  3L2Q A;  2LFB A;  3TW6 A;  1I1S A;  2B9S A;  1OCO H;  2M30 A;  2K3F A;  2P6S A;  4OAZ A;  4BJT A;  2EIJ H;  4RLF A;  2R7D A;  4OMZ A;  1MNM C;  2ME0 A;  4II3 A;  1VQ9 I;  4PK4 A;  1FMV A;  3R61 A;  4GXO A;  2FNP A;  3PQK A;  1XGO A;  3RKX A;  1ZKG A;  1ZG5 A;  2HXO A;  3OIP A;  1TP4 A;  3CD6 I;  4LG3 A;  1MMG A;  1RR8 C;  2F6C A;  3HTU A;  1T8I A;  2AXT C;  3KEQ A;  1SD4 A;  2L3D A;  2H09 A;  3MVP A;  4U7D A;  4M6V A;  2DOE A;  3F22 A;  4I0A A;  2IXS A;  1QU3 A;  3RKY A;  3BR3 A;  2PLY A;  5FFX A;  1DDN A;  2MSY A;  2LRD A;  3OL3 A;  2HQA A;  2OZ6 A;  4C2U A;  4ENN A;  1W36 C;  2D2W A;  3BTL A;  3BG5 A;  3K70 C;  2GZW A;  4UHT A;  1LEB A;  2HYJ A;  2HKO A;  1T33 A;  5F0H A;  4G7H F;  4BXU A;  2XRL A;  1TWH J;  2Q8K A;  3K9T A;  4ABZ A;  1OYI A;  2H1L A;  1UHW A;  4MHG A;  5K1Y A;  4LJZ F;  3A2K A;  3CUQ C;  5LGN A;  4MTD A;  3V4G A;  5CVJ A;  1ZLK A;  3RPU A;  2PQ8 A;  1YIT I;  1DU6 A;  1YLF A;  2FJ1 A;  3L2U A;  3CUQ B;  3DKY A;  4UY8 I;  2WA0 A;  2BBY A;  4N9I A;  2R7V A;  5KK1 A;  2QZ8 A;  1UHM A;  2CUZ A;  3SDG A;  4V2F A;  2DA1 A;  3CCQ I;  1RKW A;  5EZG A;  4C3H J;  1K6O A;  4JX4 A;  1O3T A;  5FKL A;  4QSH A;  4RLQ A;  4ASN A;  1JUP A;  2E35 A;  1WFX A;  2OAZ A;  4XRF A;  4DNC A;  2L2O A;  4Y15 A;  3CC7 I;  5CPR B;  4ZDL A;  4Y13 A;  1WJ5 A;  4RB3 C;  3IWZ A;  3IH4 A;  1DUX C;  1K78 B;  2NXN B;  3IV5 A;  4BQQ A;  1MH3 A;  4HLX A;  4ZYH A;  3J81 K;  2HXI A;  3ZQF A;  1SFX A;  3LAP A;  3F3X A;  4HNV A;  4PJN A;  4PFO A;  4NB5 A;  1PUE E;  3H0G J;  4A3B J;  2ZME A;  3LFK A;  2LY9 A;  5BNG A;  3FXU A;  3WTZ A;  2DYS H;  2W57 A;  2J5P A;  4PJJ A;  3G1M A;  3E0J B;  3V42 A;  3P9C A;  3BG9 A;  3COA C;  1ZGW A;  1SVO A;  2VKE A;  3O8H A;  2R5Y B;  2EIN H;  4AVZ A;  3W2A A;  3A0B C;  3H9Q A;  3JR9 A;  1B72 A;  3NRV A;  4BS9 A;  2BW3 B;  5D6F A;  3HG9 A;  1CF7 B;  1HW2 A;  3QPL A;  5GAD J;  1QGP A;  2DMN A;  3BJO A;  1IRZ A;  3TP3 A;  4O5V A;  1FOK A;  4XID A;  2QKM B;  2GA2 A;  3BCA A;  4IOA F;  3CDH A;  3LL7 A;  1EKE A;  1SD5 A;  3CCS I;  2Y0S N;  1POG A;  2GIV A;  1W0T A;  1B4A A;  2P0W A;  3BR2 A;  4BXF A;  5HDK A;  2DDB A;  1VFC A;  3WTU C;  2JA6 J;  5J3L A;  3OMY A;  3BG6 A;  3HHG A;  4BHP A;  3HRT A;  3N4M A;  4CSW A;  4NC6 A;  1PJR A;  2JA2 A;  4LFU A;  3VEP A;  4OIN F;  1JI8 A;  2D1V A;  5IY5 H;  3S3N A;  3EDP A;  3SZT A;  4IHX A;  4M3D A;  1AU7 A;  4DBQ A;  4Q5S F;  5E1Z B;  2OUM A;  4HQE A;  4ZTJ A;  4PGH A;  1CQT A;  2ZME C;  3C7J A;  1KYZ A;  3M1E A;  4B44 A;  3VOE A;  1UG2 A;  2RV8 A;  2QQB A;  4UVA A;  2X6O A;  4A69 C;  2LKX A;  4X1E A;  3WU1 B;  5LGT A;  2F5C A;  1MGT A;  2MW8 A;  1YFH A;  1YJN I;  3ONQ A;  3GTL J;  1TLH B;  1XPX A;  2KQR A;  2DQL A;  2N8G A;  4MQV A;  3J7Y J;  4LLN A;  1OR7 C;  3SEQ A;  3W6V A;  4MEY F;  2GIZ A;  1TNT A;  1ZTR A;  1MMN A;  4KIF A;  4II2 A;  2QBY A;  3PQJ A;  3OS0 A;  5JLX A;  1RKT A;  3OYG A;  3SFZ A;  5D8K B;  1KU7 A;  3ZQQ A;  5EDN A;  2XSJ C;  1VND A;  2E1M B;  2HOE A;  5HLG A;  2PBI A;  1D8K A;  2DK5 A;  4HYE A;  1JUM A;  2JN6 A;  3BZK A;  3E6B A;  4QLC U;  3R6S A;  3TQN A;  4AIH A;  1OCC H;  1SFU A;  4CCL A;  4MQ9 F;  4WWC A;  3C3W A;  1AKH B;  4N4N B;  2MD5 A;  2E2I J;  2R93 J;  3ASN H;  3L2V A;  1FLI A;  1R1V A;  3R0A A;  2H6C A;  1LUJ B;  2NYX A;  2JZY A;  3GLL A;  3I64 A;  1TWG J;  3K69 A;  1G3Y A;  4CHU A;  1HSJ A;  2YPR A;  3SZG A;  2PI0 A;  3TDZ C;  3KLO A;  3CME I;  4B4C A;  3SFI A;  3FXK A;  2M45 A;  2LVS A;  2A61 A;  4L5I A;  5IYD J;  1B6A A;  2V26 A;  4C2T A;  1UEL B;  2XIG A;  4H4K C;  1XS9 A;  2IRF G;  1TTY A;  4FX4 A;  2VC0 A;  3EYY A;  2BHY A;  2RQP A;  4BHC A;  4EGY A;  2BZT A;  4IRH A;  2HVR A;  3I56 I;  2FU4 A;  4IZZ A;  4F91 B;  2Y0S A;  1J0R A;  5EEG A;  1O7F A;  3RYP A;  4PFP A;  1XD7 A;  1OQY A;  2ELK A;  1T56 A;  2V9P A;  3SDB A;  5FD6 A;  4G8X A;  3H0D A;  3TOA A;  4E7S A;  4P5O A;  1R1T A;  5DCF A;  1P92 A;  2PMH A;  2HPI A;  2EFW A;  3ROU A;  2H27 A;  1FSE A;  1OPC A; 
#chains in the Genus database with same CATH homology
 2E35 A;  3CF5 F;  3G71 I;  3CMA I;  3CC7 I;  1YHQ I;  3PIP F;  3CCJ I;  2K3F A;  3CC2 I;  3CCU I;  3J7Z I;  1ACI A;  3CCV I;  1S72 I;  1YJW I;  1VQK I;  5GAG J;  1YJN I;  2NXN B;  3CJT B;  2E36 A;  4V19 K;  1MMS A;  1FOX A;  2FOW A;  1VQ4 I;  3J7Y J;  3I56 I;  5JVG F;  2QEX I;  4IO9 F;  1VQ9 I;  2ZJP F;  2ZJQ F;  1FOW A;  3CCE I;  5DM6 F;  3G6E I;  1YIT I;  5GAD J;  3CCM I;  3CCR I;  4UY8 I;  1VQO I;  3CCL I;  5GAE J;  2QA4 I;  1VQM I;  1YIJ I;  2OTJ I;  1VQN I;  1QA6 A;  1VQ8 I;  4IOA F;  5GAH J;  1VQP I;  3CCQ I;  3CC4 I;  3I55 I;  3CD6 I;  3G4S I;  5DM7 F;  3CCS I;  1YJ9 I;  1Y39 A;  4IOC F;  1VQ7 I;  1VQ5 I;  1YI2 I;  2JQ7 A;  1VQ6 I;  1HC8 A;  1FOY A;  3PIO F;  2H8W A;  2E34 A;  3CME I;  3DLL F;  2ZJR F;  1VQL I;  2OTL I; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...