2ZJRF

Refined native structure of the large ribosomal subunit (50s) from deinococcus radiodurans
Total Genus 11
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
11
sequence length
71
structure length
71
Chain Sequence
b'MSYLIRKAAGIGKGSSTPNKAKVGKLNWDQVLEIAKTKMPDLNAGSVEAAANTVAGTARSMGVTVEGGPNA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords ribosomal 23S RNA
publication title Translational regulation via L11: molecular switches on the ribosome turned on and off by thiostrepton and micrococcin.
pubmed doi rcsb
molecule tags Ribosome
total genus 11
structure length 71
sequence length 71
ec nomenclature
pdb deposition date 2008-03-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
F PF00298 Ribosomal_L11 Ribosomal protein L11, RNA binding domain
F PF03946 Ribosomal_L11_N Ribosomal protein L11, N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.250 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Ribosomal protein L11, C-terminal domain 2zjrF00
2OTLI 1FOYA 3I55I 3I56I 2E35A 1VQOI 2QEXI 2E36A 1VQMI 1FOXA 5GAEJ 2QA4I 1ACIA 2FOWA 2ZJRF 1VQLI 3CCUI 1VQ9I 1FOWA 3CMAI 5GAGJ 4IO9F 3CCQI 3CD6I 1MMSA 1Y39A 5GADJ 4IOCF 3CCSI 1YI2I 1VQNI 3CCJI 5DM6F 2H8WA 2E34A 3G6EI 1YIJI 1YJWI 3CMEI 1QA6A 3CCMI 3CC4I 4UY8I 3CCEI 3G71I 2K3FA 3DLLF 5DM7F 1VQ5I 3J7ZI 3CC7I 1S72I 2NXNB 3CJTB 1VQ4I 1VQ6I 1YJNI 3G4SI 1HC8A 3CF5F 5GAHJ 1VQKI 3J7YJ 4IOAF 2ZJPF 5JVGF 4V19K 3CC2I 3PIOF 2ZJQF 3CCRI 1YITI 3CCLI 1VQ7I 1YJ9I 2JQ7A 1YHQI 1VQ8I 2OTJI 3CCVI 1VQPI 3PIPF
chains in the Genus database with same CATH superfamily
4N4NB 4PGGA 3QPTA 1QZYA 1KONA 3DP7A 3ISPA 3KYCB 1D3YA 4PSWA 2ETHA 2XF6A 1G3TA 3LA2A 5DCFA 2EFQA 3MEXA 4P96A 5EG0B 1J9IA 2XGXA 2AQEA 3BJAA 3JRBA 1FBQA 2RKHA 2WAQA 3D0SA 3ZMVA 2QQBA 5DUIA 2EH3A 3NQOA 3W2WA 4DYCA 1ERDA 2A3SA 2JTVA 3A1YA 1BN5A 3IKVA 4MO7A 4GYGA 3G1LA 4XNFA 5TISC 4KIFA 4EATA 5K5QA 1WCMJ 4RAZA 1SFXA 1ZR4A 1R7JA 4Q47A 1WHUA 3OMYA 3HXLA 4WXCA 1GDTA 1A6IA 3G1MA 4PGHA 2ZXJA 4NQWB 3WG9A 4RMNA 4P5OA 1P7JA 4M73A 5FLVA 1U8BA 1MMAA 2H8WA 5L3BA 1MJ9A 3EDPA 4ASNA 3DKWA 5L3EA 3ZMTA 3BLYA 2BGCA 3E6CC 1J75A 3QRFF 3CUQC 2XASA 4DNCA 4BE1A 3DU5A 3E0JB 3QP6A 1JKPC 4IKFA 2V4JC 2O9LA 3BCAA 2E5NA 2CUJA 2E60A 3J7ZI 1DUXC 2JVHA 1OR7C 4A12A 3S16J 4KMUX 1Y0UA 2BXZA 2CFOA 2XRLA 2DA3A 5ICGA 2V1DA 1APLC 4S04A 3ZQHA 3KP2A 2A07F 5DDGA 2R5YB 3K4JA 3VODA 3HSFA 2HQNA 2VE8A 3ZCOA 5M5XJ 3Q0WA 1WI3A 4B09A 2MC4A 3LSHA 4G6TB 4M9XA 4ESFA 5HLHA 1UB9A 2FOKA 2JN6A 4CCLA 3IH4A 3FM5A 3K4BA 2GXGA 4DZJA 4HDUA 2P5VA 2HOTA 3T5XA 3S8PA 3GWZA 4NC8A 4WWCA 3MZHA 1W5SA 5B1AH 5F6FA 4O5VA 4H0EA 3RYPA 1ZELA 2ZJ2A 4C2TA 3BG3A 4RDUA 1NTCA 1Z0XA 4Y7NJ 3HOWJ 1IO2A 3N05A 4PUSA 5TGTA 3G3ZA 3S15J 3B73A 4RGRA 2AXLA 4IXAA 3TP3A 3C7JA 3RSNA 2WY7Q 3SXYA 2Y69H 4V2FA 1MD0A 2DJNA 3KETA 3OS0A 2NNYA 2W00A 5D6FA 2R7ZJ 2H09A 2R7DA 2V1NA 4HBLA 2EINH 1XG1A 5CVJA 3C2GA 1FP1D 2CFXA 1G3SA 1QQIA 2FD5A 2R7UA 5B3SH 5GTHC 5ICEA 4LK1F 5LGNA 1FMVA 1T0FA 3GMEA 4WK8F 3RI4A 2X0LA 2HDDA 3ABUA 2HVQA 5IP9J 4IRIA 3KEQA 3IUOA 1RNLA 2L2OA 3R60A 2UWMA 2JRTA 3LSRA 5FJ8J 3CO6C 2ISZA 4U88A 2Q2EA 3SFIA 3N4MA 4EGYA 1WGXA 4W1UA 2HYGD 2FXAA 4D1QA 3D1NI 4RGXA 2IS6A 1LVKA 2UUZA 5FFZA 3M4OJ 4I01A 5BQTA 1YLFA 1FTZA 5FKOA 4BBSJ 4I7HA 2ME6A 2KZVA 3CP8A 5IT9K 1R22A 3ZXSA 3WE2A 5J4VA 1W1WE 3BPXA 4X0GA 4BHCA 2E34A 1XDSA 5LLQA 4F92B 1REPC 4G7ZF 4Z2YA 3SEQA 3KP7A 2O6GE 1TLHB 4CH7A 2LF8A 1Z7LA 4RM3A 1WJBA 3PNTA 4L9JA 3RQIA 2E1NA 1HXDA 1MBGA 1TP4A 3OIPA 1CF7A 3K70C 4OIQF 9ANTA 1D5VA 2JK3A 4YIRX 1U0JA 4WX9A 1WJDA 4IRGA 1JUPA 2CW0F 4XM3A 2HTSA 1O3RA 3CJTB 5K7ZA 5K1YA 4XICA 2IJLA 5TJJA 2F48A 5KAFC 3M1CA 1S6LA 4WXDA 3HOZJ 2I8DA 3K1PA 1UJ8A 1USSA 2XKPA 5FROA 1IN4A 3JSPA 3G2BA 4PDKA 2QSGX 2FNAA 3H92A 3LFUA 4KN4X 4A3DJ 5H20A 3KLNA 5F08A 2E1OA 1HQCA 3MCZA 4BUPA 1VQ7I 3G73A 5KHDA 5AONA 3WGIA 2ESNA 4LG0A 2DFIA 3X2QH 2P5LC 2ZFUA 5BOXA 1PP7U 3CCYA 2X6XA 1OYYA 4A6EA 2VI6A 1MBEA 2KHMA 2EIJH 3K7AJ 1ON2A 1ZHFA 4Y3OA 2QGUA 4O3MA 2E35A 2HVRA 2F5DA 2WAQN 1K61A 3LQRA 1U5TB 4EJTA 1K83J 2XB5A 2HTJA 4DYRA 4U7BA 4L9NA 4ZDLA 4AUXA 2QCOA 1BI2A 1Z91A 2ZSIB 4ABZA 3PJRA 1WJCA 3EYIA 2ZSHB 2LK2A 1IC8A 2VUMJ 1IJWC 2X51A 3BG9A 1VTNC 1RC9A 2OD5A 1X1AA 2EILH 2Z3YA 1TQIA 5D5XB 1ETXA 2MSYA 3MVPA 3F8MA 2X48A 1B72A 2BHYA 2EFWA 5B1BH 3QOPA 5DUKA 5FKMA 2L01A 3O8GA 1ZRFA 5J4YA 1ETKA 2YPRA 1Q1HA 3I4PA 1G3YA 2E19A 2RDPA 3S1RJ 2MGQA 3I5UA 3LSMA 3CDLA 4ZC3A 5LGTA 4AYBA 1ORKA 4BKXA 1K4TA 1OLTA 1HW2A 1A35A 5K7FA 2H8RA 3I59B 3CC4I 2EV0A 2KMUA 5LHIA 4QSHA 2QQ9A 4BEHB 5CQEA 1QBJA 4KT5C 4YFXF 4P9FA 4YG2F 1LB2A 2K86A 5EG0A 4NBQA 4E7KA 4JX6A 4AIKA 1F4KA 3TO6A 2XHKA 1BR4A 4ZTJA 2NAZA 3JR9A 3CUQA 5LRSA 2Z5UA 4JX4A 5F0CA 3G4SI 1IG7A 4HF0A 1Z3YA 5J40A 2NVQJ 3TDZC 1HC8A 4YFKF 3VYSB 3H3VK 4LIVA 5CVRA 4YFNF 3I53A 1OR7A 1WQ2A 4MGRA 2D1VA 2M1BA 3VFZA 1B8IA 3BC8A 1KU2A 4CICA 1YYVA 2CUZA 3HUGA 5HNFA 5JVGF 1GV5A 2R3SA 3DTEA 1ODDA 3HPGA 1YITI 5BMZA 5E1WA 4CCNA 1YJ9I 4L9VA 1HW5A 3LA7A 3MWMA 3UR3C 3LSKA 3BG5A 1UAAA 1ONVA 2XB0X 4OAYA 3IWZA 1USTA 1D0XA 3ONQA 2QBYB 3E3VA 1HSTA 1E3OC 2BXYA 2EV6A 2QKMB 3K4KA 2LY9A 4MNUA 5CQGA 3FWEA 2HDCA 4I2OA 2M4GA 3QU6A 3M07A 2MYSA 1S7EA 2DFFA 3I64A 5EYRA 3RKWA 2K40A 2DQLA 4F3QA 1T38A 3VYUB 2DK8A 2BVLA 3MD2A 4PJLA 1KYWA 3ZN0A 1UG0A 2QA4I 4PCQA 4A0ZA 4CSWA 2EFNA 2RVCA 2VE9A 2KIFA 1X4PA 2XV4S 1R4NB 3HHGA 2E7XA 2ZNYA 3M1EA 3OYFA 2VL8A 1LFPA 3QODA 1EA3A 4KDPA 2OAZA 2L9RA 3NARA 1JHHA 4F52A 1P9QC 5HLTA 2BY1A 3KPHA 1H88C 5GADJ 1U3EM 1YI2I 4MIMA 4FASD 3OYNA 2P4WA 2VQCA 3GFLA 3VEPA 1OCOH 1ZH5A 2A6TA 4BJTA 4E7LA 2OQGA 1W4MA 2W84A 1FSHA 2KRCA 3JTHA 4NC7A 2CQXA 1HSJA 1TWFJ 2EWNA 5CKTA 1Y1WJ 4I76A 2DBBA 2K3FA 1X1BA 2FA5A 2JSCA 4XSXF 4HNTA 4C30A 2CQQA 2X1EA 2ICWG 5HS8A 3TL4X 1XGOA 3AG2H 3L00A 1ZRDA 2MW8A 2EZKA 2WBMA 1FSEA 5AIQA 5H2FC 4DIQA 1MMDA 4C2UA 5J8CA 5D6EA 4A0XA 1Z6RA 2P0WA 2Q8KA 1B6AA 3I58A 5F04A 2RNJA 3CF5F 1DPUA 4IQ4A 2R7XA 4FE7A 3CMYA 2F4OB 3U1KA 4IX7A 5CJ9A 2W7NA 2ACJA 1IF1A 2LOOA 2M87A 3JAMZ 2DFHA 3HOXJ 5IOYA 2KIMA 1HDDC 1F43A 5EF6A 2EFOA 2BV6A 4M9ZA 1YHQI 3L2QA 2ESHA 2OF7A 1KU7A 1KYZA 5IP7J 3Q0UA 3HC7A 5IPAA 4BU2A 5K5OA 1FTTA 5CLSA 3HGGA 2K85A 1YS7A 2LMDA 1FIPA 3I9V2 2XGEA 4AM3A 3PIPF 4HF2A 2IA0A 1YTYA 2XVCA 3LOCA 3K1NA 1V4RA 2JJ7A 2LFBA 4IZZA 5D8LB 4EM2A 4OU0A 1U6GA 1P6RA 2QVOA 1XCVA 4ENNA 2DTRA 3RZOJ 1DDNA 5AIPA 4Y13A 3IAM2 4EM0B 4QTRA 1R5ID 1V3FA 1S8NA 5JLXA 3S3OA 2CWEA 2Y2ZA 4ZYHA 4DOZA 2DA7A 4RGUA 4Q4ZF 1VF9A 2RREA 1SMTA 3IC7A 2XAQA 4S0HB 3WHCA 2ZKZA 3V7RA 1K78A 1YW7A 3EUKL 2XAUA 2ZXWH 1H89C 3CF2A 2EA2A 3OR1C 3VYTB 4EV0A 2HNHA 1XGSA 4M74A 2IGKA 3LMMA 3HSRA 3SZGA 3J80K 3BTJA 1QRYA 3DBRB 4YIIA 3RIRA 3QOEA 3AFHA 5E3OA 1IN6A 3T1BA 1OCTC 4MFEA 2OV7A 3R0JA 3TOAA 4NHJA 5DM6F 1GXPA 1I3AA 3G6EI 1O3QA 5DD8A 4XOTA 4BQAA 2QSFX 3WU2C 4ON0A 4F93B 2M7BA 1IRZA 4U0WA 2GOMA 1WH5A 2WV0A 2DOAA 5A2QK 1LE8A 4YIFA 5GPCA 2VQLA 1U5TA 5CPRB 4D0PA 4ESBA 3TOBA 1YG2A 4IHTA 3V8LA 1IUYA 1BBYA 4GO1A 2EPFA 2KT0A 1FC3A 1YW8A 2BY0A 3GFIA 2G7UA 5IYCJ 3QPSA 2PI0A 3MQ0A 1BR2A 4CYDA 4D5FA 3L9FA 3WGHA 3S2WA 2KKOA 2PFBA 2MH2A 1E3PA 2BYVE 2OA4A 1J09A 1ZR2A 3EUHC 1T33A 2P7CB 3AL0B 3B02A 4HSTA 5D5VB 2A68F 2BOLA 2Z9OA 1JKOC 2BY3A 2V6CA 1VQ8I 2CMPA 3OYKA 4JQFA 1ZRCA 2MLGA 3ABKH 4BS9A 4LJZF 3WU0A 2KPMA 1HDPA 3TW7A 2AS5F 1E3HA 2LKXA 5HLGA 3C2BA 2K4BA 2IVMA 2PQ8A 2X6OA 3FK6A 4GRIA 1IUFA 1MSEC 5FLMJ 1O4XA 2V7FA 1K4SA 4G7OF 1SD5A 4HV6A 2V6EA 3HTSB 4BDYA 4C3JJ 2MH9A 2XKOA 4QLCU 2XF7A 3MN2A 2JA8J 1W7PA 3SYTA 3H5AA 1NG7A 3ZMUA 2HFHA 1MGTA 2CSOA 2GXBA 1YE9A 1ZG3A 5M3MJ 4L18B 2VONA 3CJQB 1L0OC 4U7DA 4FX0A 1ZAOA 3ZQQA 5H6QA 4K2EA 5GAEJ 2RN7A 4FE4A 1O3SA 1FP2A 4E4HA 2VODA 3DU6A 1VQLI 1P4XA 1X58A 1U8RA 2PJRA 3WE3A 5JLWA 2ZCWA 3P7NA 5FLXK 1ZKGA 2MBFA 4J01A 3GZ5A 1N25A 3M8EA 4ENMA 2VC1A 4MTDA 3O8HA 4L9TA 1FYMA 2R7OA 2IW5A 3I54A 2VIXA 3GTOJ 2VJIA 4IOCF 3OS1A 4I99C 3PSFA 4JP0A 2LDUA 3CCSI 2F2EA 1TL8A 5JVTA 3CJRB 3GCMA 3FHZA 3U9GA 1RUNA 5EJCA 2Y0SN 1Z6TA 2CUEA 2GZWA 3CUQB 2OBPA 4XLNF 4L0ZB 1QVUA 4XKCA 4DGWB 4A3BJ 2QBYA 1QU3A 3EYYA 1O7FA 3LL7A 2J5OA 2VQHA 3SJMA 5HDNA 3KZYA 4A0YA 3IH2A 3GUDA 1DU0A 3V7SA 4HRIA 1IDZA 2C6YA 1AKHA 3S1MJ 1UFMA 1B8IB 3HGYA 4E7IA 2JUCA 3HUGB 4A3EJ 2ZMEC 4HW0A 3ZOBA 4HNVA 5H6RA 4XLAA 4GXOA 2LLKA 2XPWA 4M6VA 2G9WA 2K9LA 5E1XA 3BZKA 1G2HA 2FBKA 4A2UA 1YX3A 3QQAA 3ZMDA 5HNHA 2WA0A 3VOEA 2GWRA 4HX8A 1FIAA 1I6XA 1X2MA 2DOEA 4ZZDA 1A6QA 3HHHA 3CP2A 4AIDA 4UV8A 2A6HF 1TQPA 1JKRC 1P7IA 2ZJPF 1BL0A 1R5HA 2D5VA 4G6QA 5IOZA 1QGPA 3I4MJ 4AVPA 4KMFA 2IGOA 1G59A 3L2RA 4BH9A 4A3FJ 3OWTA 1IN5A 2J5PA 2X1DA 3RQ4A 3L2WA 1XGMA 5KVRA 2RC4A 1TT0A 1WVRA 2MFZA 1X3WB 3DEWA 5BPIA 2KZGA 3M9AA 3A0BC 3PO2J 2RQPA 2QQAA 3QAHA 4AD9A 5GP9A 4WF2A 3S32A 3JRIA 3PM1A 2EA4A 3ABLH 3HOTA 2IS1A 3GYHX 1OCPA 4XKVA 4QPQA 4E7SA 3JRCA 3HL2A 1ULYA 1GV2A 4XQFA 2HVSA 2MC3A 3IH3A 1WKMA 3AG1H 4JOMA 3LSGA 3DQVC 2R7FA 4A3GJ 4NB5A 5EGOA 2WWYA 3PFIA 4CCOA 5J47A 2Y0MA 1M1EB 4GYIA 2NS8A 2Y30A 3F8BA 2CG4A 3JW4A 2FMYA 1J59A 2JPBA 3PFYA 4DBQA 3FXQA 4FHTA 3J81Z 1ETQA 3E5QA 3OOUA 3TW6A 2V1UA 4WXHA 1XB4A 2P6TA 3E6BA 5DV5A 2ADUA 1R1VA 3MKLA 5E79C 2JA5J 3W6JB 3E7LA 1BC8C 1JE8A 2CV1A 1JGSA 2M8GX 4XL9A 1TTYA 2YSRA 1D8JA 2VKEA 4UUSB 1JJ6C 4HX4A 2FE3A 4LLNA 1Y0NA 3IL2A 1W36C 2DMNA 1ETWA 3GTJJ 3M7GA 3VWBA 4N9IA 4HNUA 4ZYDA 4OIOF 3OIOA 2QF7A 3CZ6A 4R1HA 5HDKA 5D4RA 1QNTA 3GLXA 4I0AA 1IZ1A 2DK5A 2V26A 4CGZA 1FWZA 4JX5A 5ILSA 2OC6A 1OFCX 2M30A 5F64A 1OCCH 4B48A 5CVIA 1OYWA 4UB6C 4G94A 2Z16A 2LBFA 4DJAA 3F0CA 2VBWA 2L9SA 3N97A 1E0EA 4MHGA 1IV8A 5BS6A 4EJVA 3BTIA 3H9QA 2V1XA 3FIWA 2ZXIA 3QPHA 2M0CA 1S72I 3FXUA 1T56A 1POGA 1XC5A 3SZPA 1G4DA 1BI1A 1Y1VJ 1YJNI 2P7VB 4N9HA 2VXDA 1EV7A 3DF8A 3M8JA 2RQQA 3FXMA 5CVUA 1BR1A 2Z33A 1R23A 2JA7J 4BY1J 4CCMA 1LDJA 3BJOA 1SVLA 4F91B 2AQFA 3NRVA 2BW3A 1CGPA 1MKMA 3QYEA 3LSPA 4XRSG 5B66C 1MMGA 4CA0A 3JSOA 2DT7B 1I50J 6PAXA 2VN2A 5FD5A 1IV6A 1BJZA 3WTSC 3EUHA 3FBNB 5KCMA 5ERIA 3REOA 3W3CA 4CUGA 2OZ6A 5BNGA 3L2VA 2YX7A 1A31A 1KZHA 4ZYAA 1SAUA 2LKSA 3HRMA 1FNNA 1BI3A 2LP0A 1IAWA 4BGDA 2LY2A 2CQ7A 1K78B 3HRSA 1VNDA 3RKXA 2HGCA 2M0MA 3ECOA 1FY7A 1F1ZA 3I71A 2GXAA 2STWA 2LYCA 1BOAA 1I39A 2VT2A 2DDAA 3RPUA 3L09A 1EF4A 3JRAA 1MDMA 2B7EA 3TP0A 3W2AA 3Q9VA 1SANA 2COBA 2QQ8A 3WTXC 2LVSA 1BJAA 3K70D 1PJRA 2L7FP 3GVAA 3COAC 1XSXA 2QUFA 1LE8B 3SQNA 4M3BA 4RLFA 3HSEA 3OSFA 3ABTA 2FBHA 3KE2A 1AOYA 1JGGA 1UCRA 1NHAA 1Y8QB 4GDFA 2X9DA 1SMYF 3NWTA 4IEJA 3T8TA 4BAYA 3GTLJ 4HLXA 1N78A 1XGNA 4RLQA 3KFWX 2P6SA 4ESJA 4U0YA 1EH8A 3LFKA 4S05A 2FQ4A 2IAIA 4EEFG 3A4CA 3PQKA 2XIGA 3K9TA 3FISA 1WPKA 4MFDA 4Y33A 1BA5A 2BVMA 4Y17A 2NVTJ 2FMLA 1A36A 3HJEA 3PUBA 3OY9A 2DMUA 5KNLA 2CQNA 1NK2P 2BEOA 1EKEA 3BJ6A 2P81A 3ULQB 2IA2A 1V5GA 2D45A 2A5YB 1VQ6I 4CXFA 4J19A 1R9TJ 2K7LA 3IRRA 4A5MA 2AO9A 5EZGA 3DPUA 2M4KA 1TWGJ 3ZQ7A 1TWHJ 4ENKA 2KP6A 4OAZA 3VSLA 1YS6A 3I3LA 4BQQA 1RI7A 2CV0A 1VQKI 1OMIA 2ZMEA 4M3EA 3S93A 4B1RA 3TMOA 1HA8A 2GQQA 3EQLF 4DQ2A 4V19K 5IT9Z 3PIOF 3CCRI 4IHSA 3BR0A 3CDIA 3T8RA 2GLOA 2QKLB 1W7PB 2IP2A 2FNPA 1U9NA 3BR2A 2GAUA 1P4AA 2DA4A 4BNCA 2H6CA 3OR2C 5J3LA 2DA1A 2LKPA 3ASOH 3FM3A 4XLHA 1W0TA 3PO3J 4JYKA 3QU3A 3RJPA 3GTKJ 2JVGA 3W2VA 5EEAA 3GEZA 1EJ9A 4KISA 4XRMA 3KZZA 5D8KB 1TC3C 2PJRB 4N4OB 2ZB9A 1BW6A 5HS7A 4HLYA 2EZLA 4EJWA 3JAMK 2VC0A 3AG4H 2XC7A 1GHCA 5HOOA 2B0LA 2PX9A 3GBGA 4LIUA 4I6ZA 1HKSA 2XPUA 2DFEA 3UNGC 1YO5C 3GX4X 2STTA 3M3YJ 2R7VA 3HRUA 2TDXA 3ZQGA 1SFKA 2VJJA 2IGMA 3B6AA 3DLAA 4XOPA 4CYCA 5HODA 1QVTA 3DKXA 3L7WA 2ZBKA 2A05A 3ZQIA 1OJLA 5LGUA 2QENA 5FKNA 4BE2A 1J2XA 2EBIA 2P5KA 3PNVA 3GO5A 4MQVA 4E7JA 4PJJA 2GA2A 1XX5A 3BPVA 1ZLKA 2D2WA 4YRVA 3KYDB 3D5SC 3F72A 2GOXB 1AKHB 5ICCA 2OJED 5FFXA 3K2ZA 2R93J 1PYVA 2HKOA 1K6OA 4ITVA 2KQRA 2DCEA 4JBAA 3HB9A 1UHMA 2R7WA 4IHVA 4V2GA 2NOJB 2PMZN 2MG4A 2M7AA 3SEZA 1X4OA 2W82A 3R0AA 3G71I 2DA2A 2KFDA 4GFBA 2VOPA 3K4MA 3V8JA 2BHZA 1MIJA 2WY8Q 1W7PD 5C3EJ 1O57A 1QPIA 2XRNA 1SD6A 2W4SA 3OYGA 1W0UA 3JRFA 1LPQA 3TKYA 4BBRJ 3KEYA 1RR7A 4KUMA 2O7OA 4M9SA 3TDUC 5GTIC 3WTVC 3HM5A 5E18F 1WZ2A 4OOIA 5M3FJ 4IHXA 2H94A 5K5RA 3BR3A 5K7HA 2XAHA 3DTKA 2RGVA 4PFOA 3HKZN 3H9JA 3EUAA 2Y0SA 4IOAF 3BTCA 4RB2C 5F27A 2F5EA 2OCCH 2PEXA 4M6YA 4UUSA 2VB6A 3GTPJ 5ILUA 2CV2A 4LB6B 2NYXA 5LRRA 3ZMSA 2GA1A 3OYHA 4M3GA 1LVAA 2FX0A 2ZC2A 5HS9A 1UHSA 2OQRA 4PJNA 1GLNA 4WCGA 1U78A 4B8XA 3NWSA 4L5IA 3VDXA 3IAS2 5EGOB 2FEZA 4KN7X 3RZDJ 3F22A 2X6WA 3KYLA 4ZH4F 3S3MA 2DJIA 2DQRA 1XN7A 3ZRGA 2E1MB 1GT0C 1W5TA 2ELJA 4HX7A 1T8IA 2PBIA 2W85A 4D7NA 2YU3A 4UUTA 2PG4A 5L3FA 2HS5A 2PMUA 1R6RA 4MLOA 3DCFA 2BZTA 2XF5A 3RYRA 1I1GA 1IN8A 3BR1A 2P8TA 5E8GA 2QEXI 3FDYA 4EMSA 2VOOA 1OQYA 1AWCA 1WFXA 1JTYA 2L4AA 1S7AA 2X4HA 5E8IA 4CO8A 1X1DA 1WWXA 1KA8A 2ZJRF 3ZGKA 3CCUI 1XSDA 3DKYA 1Y56A 4RAGA 1MBFA 1UMQA 3S2DJ 3J7AO 3WTTC 3CMAI 3OYCA 1IRXA 2XDVA 3H3UA 2E1MC 2NOGA 2VASA 1Z05A 2FJ1A 4U87A 1Z1DA 4AU7A 2KIUA 1IRFA 2NS7A 1MMSA 4LLLA 4ETSA 1XD7A 1ZGAA 2LBFB 3S14J 3ESWB 1Z7UA 5JR3A 2OCEA 2TRTA 4I0BA 2JUGA 2YU9J 5FD6A 1V5EA 3DV8A 2QSHX 3HPHA 1TWAJ 2BY2A 3CQZJ 4OINF 3E97A 2R4GA 3PUFA 4TV7A 4IQJA 1YJWI 2Q1ZB 3OIQA 5LD2C 1ZG1A 4UY8I 3CCEI 1DQUA 4AIHA 1MJAA 3RDIA 1WJEA 2K02A 3KP6A 3F9KA 1UZCA 4A6DA 1FZPB 1XMXA 3E6DA 2WAFA 3Q9SA 4G6DA 2BW3B 2LH9A 3I0TA 2B63J 4BL0B 4BDZA 2DPUA 1T95A 3BG7A 2EIKH 2L54A 1BI0A 1JT0A 1K7AA 3E5XA 4M6XA 2HPIA 4A3IJ 3KEOA 3E6MA 3ZN1A 4B3AA 1J0RA 5J1RA 3OYDA 1TQMA 3JREA 1IRGA 2A69F 2XAJA 1P92A 1X1PA 3H5RA 4Z6YA 2XUBA 4UNOA 1Z3XA 2CYYA 4JK1X 1S9HA 5FB2A 1XSVA 2M34A 1IXCA 2XSJC 2JPCA 3O2PE 1UELB 3CCLI 3LSJA 2XAGA 2R7RA 1DP7P 3RPQA 4UVAA 4C3IJ 2OUMA 2LG4A 3HDDA 2K3PA 4ANJA 2WADA 1NK3P 5L3CA 3DWLE 4N0BA 1FOYA 1ZYRF 3VPRA 1MDMB 1DU6A 1K6YA 2E2JJ 4CHUA 4HYEA 3MFKA 4CCKA 1OPCA 1WJAA 4XRFA 4PFPA 4A3JJ 1YRNB 5DCMA 3AKZA 3R4KA 4IRHA 2CQKA 1TZLA 1B9MA 3H3ZA 2KJBA 2UXNA 2K4JA 2HQRA 3A03A 3EETA 1FYKA 3PSIA 2A5WA 2QLZA 3DXJF 4HA8A 5DS9A 3ZQLA 5EZHA 3S1NJ 2QWWA 4G12A 4P55A 1DGRM 5JHUA 3QWLA 2GIZA 1PUEE 2VKVA 2JMWA 2Y48A 2HEOA 4LK0F 2NS0A 4IL6C 3BQZA 3WTWC 1R4MB 4XIDA 5DYMA 1H0MA 3K4CA 2FRHA 2FF4A 2DYSH 1NH3A 4ZDOA 2IEKA 3FXOA 1ZK8A 4CZZA 1T98A 2DT6A 4LGWA 5EEGA 1N75A 4Y52J 1X3UA 3KP4A 2H1KA 4KITB 2RV8A 2CH0A 3D5RC 5LHGA 2DO7A 3KX2A 3HIFA 3OYMA 3SZTA 3IRQA 3EPZA 1OCZH 4BXXJ 3LSTA 2F5VA 1SVOA 2E5ZA 2AHQA 3LQQA 2ZMEB 1HW1A 3C3WA 4XKWA 1ZGJA 4B43A 1VFCA 3G1OA 3OYJA 1KU3A 4DW6A 3OYEA 4H4KC 2NXNB 3HRTA 1LFBA 2JZYA 3RPUD 1FT9A 2JWTA 3DBHB 4XONA 4OIPF 3WTYC 1GUUA 2L0KA 2OZUA 2HI3A 2N8GA 4HZFA 1MNDA 1S7OA 4OMZA 3A0HC 3DEUA 1DGWY 5D5UB 4FTHA 1B59A 3ELKA 3J7YJ 1LEAA 4MEXF 2DODA 3F8NA 1IXRC 2IPQX 1YFHA 1IN7A 3J80Z 1RR8C 4HQMA 1FX7A 3K4NA 5LFAA 3H36A 2QZ8A 1RZ4A 1WH7A 3FZVA 4QPOA 1R49A 1FJLA 1R00A 4A3KJ 3BROA 4BQNA 2OU2A 1NG6A 1SFUA 3CCVI 2EK5A 3UKGA 1PP8F 1H8AC 1VQPI 1F5TA 5A2QZ 4EJUA 2HR3A 2V79A 2IRFG 2VKDA 4Y4RA 4Q5SF 2OTLI 2EZHA 1SFOJ 5FO5A 4II2A 1YOVB 2R5ZB 4HOBA 4CYCB 3HOUJ 1PUFA 2W48A 4BY7J 2GM4A 1D0ZA 3I4NJ 2DMPA 4YEJA 1HOMA 4KYWA 4IHYA 2E36A 2A61A 5F1JA 4EQQA 2IXSA 2CRGA 2IA1A 2LC2A 3GF2A 4E7HA 5DTDA 4BXFA 2EB7A 3W6KB 4X6AJ 3LAJA 2XPVA 3HYIA 2CGPA 3BZCA 2R7SA 1JKQC 4E6KG 3OYLA 3R6SA 4KIBA 2F6CA 3ROUA 3ERED 1LQ1A 2DPDA 3WHBA 3DEEA 2QM3A 2KDOA 2IT0A 2JSPA 2O0YA 3QYFA 3LSIA 2M2EA 1ZTRA 1V54H 5EDNA 2L02A 5FKLA 4PZJA 1HF0A 1QPMA 2ZO4A 1WRJA 2H1LA 1SEUA 2RNGA 5JFRA 3IWFA 4UVCA 1MBHA 2JRMA 1D1AA 5FGMA 4FQGA 2UXXA 5HDGA 5L3DA 1MJBA 1RKTA 3ZMZA 5IP6A 1SC7A 5TRDA 4EM1A 1LNWA 5DEQA 1XMAA 3DLLF 5DM7F 3K6GA 1QHHD 2VPRA 4KA4A 2HZTA 3S3NA 5HLIA 1MBJA 4B47A 5BPDA 3O6BB 3ECHA 1XCBA 2NVUB 1DP3A 3WTUC 4UV9A 1R1TA 3CLOA 1FBSA 2DXIA 3GLLA 4ZYEA 1KQ9A 2NVYJ 3QP5A 5FLXZ 2L9NA 2R7QA 5FRNA 1R36A 3DFGA 2UV1A 3S1QJ 5DD4A 3KZIC 2FUG2 2O8XA 2Y9ZA 3AG3H 3HG9A 3VB2A 1QHGA 3BOQA 2HYFA 2YS9A 3ZQCA 1ETVA 4ZZLA 3GTMJ 3FMRA 2DYRH 4A93J 3L2CA 2EQRA 3E5UA 2VKHA 3K10A 1IDYA 4KT6A 2VPLA 4OMYA 3KCCA 5JHFA 4FCYA 1L3LA 2FBIA 2PMZA 4IVNA 1TNTA 3R61A 2FU4A 3TO9A 5EEHA 3O3KA 2JA2A 4L5EA 1D1BA 3OL3A 3E1SA 3U2RA 3S17J 2E2HJ 3ASNH 2OTJI 4DZPA 4D7MA 1T39A 1QO0D 1TBXA 1Z9CA 4F55A 3HZJA 4FISA 2M45A 3OYIA 1K79A 3WTZA 2WTEA 2EZIA 5J8FA 1W36D 4F7ZA 3S2HJ 3C18A 2COMA 3GFMA 3HKZA 1LKXA 1SD7A 2IS4A 3F3XA 3FMQA 1R1UA 3P9CA 2HDWA 4LFUA 1RRJA 5E3LA 3H35A 3F6OA 1S3JA 3BQYA 4HEA2 2L4MA 4LITA 2WB1A 3TBIA 1X1CA 3VSKA 1N77A 2W24A 5LHHA 4CCJA 4UUVA 4RB3C 1ETYA 4KIGA 5GAGJ 2HKXA 3FXRA 3TGNA 4XLCA 3JRGA 3CCQI 3MAJA 2KJCA 2FQ3A 4NDLA 3HOVJ 2VT3A 1MSFC 1Q1VA 1X19A 2K9NA 3FKIJ 5B5EC 2F5FA 5J1UA 2Y9YA 2PJPA 3ML6A 1HBXG 3FXLA 2X85A 2TCTA 1FBUA 4NC6A 5JI6A 2CU7A 3CMEI 2HZDA 1QZEA 5C4JJ 2ISYA 2VBXA 1RIOH 2R0QC 4EVIA 3PL8A 2G0EA 1I27A 2EIMH 2L7KA 2MD0A 5M5YJ 1YRNA 3NAUA 1VQ5I 5LEJA 3H9GA 4XLFA 4E70A 1I3QJ 3KP3A 4I98B 3V4GA 5M5WJ 1Y6IA 3DPLC 3GW2A 1B1BA 5E17F 2WC2A 4BHBA 4XORA 1P4WA 4D5CA 1KU9A 3GXOA 4BACA 2LD5A 3CO7C 4M3FA 2L3DA 3KP5A 2DU9A 3TQNA 3P9IA 2X1CA 1JUSA 2R7TA 5GAHJ 2XGDA 3MZYA 4LOCA 4RS8A 3JTGA 4HF1A 3ABMH 5IYDJ 4W97A 3OOPA 3C1DA 1E2XA 5L3GA 4QWQA 1O7LA 5KK1A 4HQEA 3W6VA 3TEDA 3RCOA 2ZJQF 1QZZA 3HOYJ 2EFPA 2JQ7A 1MZBA 4LLGF 1OYIA 5DCMB 4PJ0C 4D9JA 2Z2SB 1ENHA 4BYYA 4C2MJ 3GZNB 1A04A 2DMQA 1FOKA 3HEFA 1IW7F 2VJ5A 2HQAA 4G7HF 4I02A 1XMKA 2M9HA 1T2KA 1BOBA 1SAXA 1PVEA 4XRSA 4KNYA 4PK4A 4ZJZA 4XLEA 1DPRA 3QPLA 2O8KA 2VLAA 1FLIA 3MMYB 3FF5A 2KLOA 4MEYF 5ICFA 3KLOA 4P1WA 1STZA 2I10A 3SHFA 5CVVA 1TWCJ 1MMNA 1U5TC 2DDBA 1VQMI 3K1MA 1FOXA 4FETA 4BE0A 4PJMA 4EGZA 3GFJA 4RBOA 2V9KA 2Y31A 2MD5A 2LSOA 2L9VA 4RA2A 1BIAA 1T08B 2CS3A 4L5JA 2HXIA 3BZ6A 1FOWA 1LDKB 3F8FA 4ZDPA 2PMHA 1B9NA 2BBYA 1TT5B 1XTAA 1IXSB 5C44J 3NEUA 1BM9A 1Z67A 4NNJA 3GZ6A 2JT1A 3CD6I 1F9NA 4OIRF 4BJ6C 1LDDA 1AA7A 2XAFA 3MKZA 3V42A 2ME0A 2E1CA 3D5LA 3IV5A 2W1OA 2ELKA 3A01B 1VQNI 3CCJI 3FKJA 2YR2A 1A5JA 1Z21A 1GVJA 2DN0A 3J7AY 5D5WB 4LG3A 2L7ZA 2R5ZA 3BP8A 1YIOA 1EH6A 3H1CA 4XMYA 1I6HJ 3GTQJ 2ECBA 3T0YA 1J7KA 4KICA 4AVZA 5F1RA 1R71A 1YX5A 3WG7H 2LNBA 2DT5A 4IJAA 3IP4B 3ZQFA 4NQWA 3F21A 2F4MB 2ID3A 3IKTA 3K2AA 4CDGA 2HXOA 1SFEA 4GCVA 1PDNC 1UHWA 2ZXHA 5CYVA 2MA3A 2E7WA 5KAIC 1G8XA 3K4LA 2HWVA 3K0LA 2IS2A 4RGSA 1F36A 1ZARA 3FHNA 2CW7A 1Y8RB 2CUFA 4R79A 2LY1A 1V55H 4HAMA 2LTPA 3LWFA 4XBFA 5F0FA 1E17A 4KFCA 2GBYA 1X2NA 5D4SA 1PUFB 1UG2A 2ZFWA 3FBIB 4L0YB 1YQAA 4UHTA 4XN0A 2R5YA 4B4CA 3F6VA 3BWGA 1ZQ3P 1OISA 1ZG5A 3H0DA 1TW3A 3CESA 2KL4A 3FX3A 2Y75A 1WI9A 3U21A 4ENJA 1WJFA 3PQJA 3V7CA 5IT3A 1HCRA 4DYQA 1VI0A 1GXQA 2IGNA 2H6BA 2Q0OA 1FMWA 5IY5H 3CDHA 3DTIA 3KIOA 1KGSA 3I55I 2QYOA 1XS9A 2GIVA 2PLYA 4R8HA 5ILVA 2ID6A 2WB1N 1D8KA 4EJOA 3MKYB 1TNSA 1OKRA 1FYLA 2FOWA 3HTUA 1FPQA 2JA6J 3AAFA 3QYBA 3RKYA 1YW9A 1JJ8C 4BJ5C 4GGGA 3LAPA 1S5LC 2DLLA 2DA6A 4IO9F 2WV1A 1JTXA 3P5JA 2MABA 1BW5A 3CLQA 3M8FA 4XN3A 1B4AA 3MZ8A 2DOFA 2HOAA 4IPAA 2CW8A 4M71A 1MH3A 4II3A 3F23A 4B3XA 1WJ5A 4XLPF 4YELA 1RKWA 4AC0A 1IGNA 1R5GA 4XSZF 4CZCA 2KIQA 2M8EA 4NUBA 4PSXA 2XSDC 2NVXJ 3OV8A 2EJRA 2ZNZA 3CMMA 4IF4A 4OWRB 3BR5A 1SVMA 4B44A 3OS2A 4Y15A 1AU7A 4HPQA 4MQ9F 2HQ5A 4RB1A 5E3NA 2M3AA 2HYJA 2LR8A 2RAEA 3SFZA 3WU1B 2HPMA 3CC7I 1OCRH 3ERMA 3JCUC 2A6EF 2WAEA 2CO5A 3LA3A 2HU9A 3CTAA 4I09A 4XKBA 3L2UA 3ZP5A 2DI3A 2VBYA 1MNMC 1RETA 2VXZA 4C9YA 5LEKA 4FT8A 5E3MA 1JI8A 4LB5A 3DBLB 3TO7A 2YUSA 5C4XJ 3FXJA 3GTGJ 1MBKA 2BE5F 1LUJB 2LRDA 2O61A 1JUMA 2K9SA 2Q2EB 4DBRA 2DAOA 2Z1DA 3P9KA 4KJZA 3LNQA 2OPTA 3RTRA 5IYBJ 4U0VA 1LFUP 1ZGWA 2B9SA 2LREA 1JXSA 2HOSA 4J00A 4A5NA 4A3CJ 4HSRA 4M3DA 4A69C 1XDUA 3C2HA 4MTEA 2L7MP 4HV5A 2VJ4A 1S29A 1U2WA 3CJNA 3OYBA 3BTLA 2XROA 2X6YA 2FSWA 1TW2A 2K27A 4RAYA 2VQGA 1T0FC 2E71A 1JHFA 2KDZA 4RAFA 1P2FA 4UXNA 3IHUA 3I56I 1SD4A 1AHDP 2CJJA 3WODF 4BXUA 3BT9A 1HKTA 1BIBA 4AYBN 2D1HA 1ZLJA 1VQOI 2IBDA 3JRHA 1D0YA 4BHPA 1H9TA 2DTZA 2DW4A 4AWXB 1CF7B 3A2KA 2H27A 5E1ZB 3WGGA 1C0WA 4HG2A 3FXKA 4C3HJ 1ZN2A 1ACIA 4UVBA 4XR6A 4E7ZA 2K5CA 3HOSA 2PN6A 1J5YA 5FKKA 4ZYGA 1RUOA 3H5NA 1KQ0A 4RM2A 1Z77A 1VQ9I 1JT6A 2ELHA 1G3WA 3CUOA 1HLVA 2W25A 1V5FA 3OYAA 1WSUA 1G6NA 1H9GA 4QIWN 1Y39A 3FK7A 1W5CC 5J1YA 3SDBA 5LBQA 3BG6A 2O03A 2DA5A 5GPAA 3Q0VA 3BR6A 1U9OA 4UB8C 2DMTA 2KISA 4G8XA 2E2IJ 2M5WA 3BDDA 3SDGA 2R92J 3VYRB 1I5ZA 3BY6A 4LG0B 2K9MA 4P9UA 3OL4A 2AXTC 1YIJI 3MKWB 2KRHA 2V9VA 1QA6A 4XK4A 4AIJA 2EV5A 3CCMI 3ZR8X 1XPXA 4A3LJ 4Q48A 1GVDA 2UZKA 2YX4A 3JRDA 4ZTFA 1MW7A 4RB0A 4HDVA 4LMYA 1D1CA 4FX4A 3PNYA 3FMSA 1CQTA 2MLKA 3RKQA 2O3FA 4A3MJ 2L5QA 1KQ8A 2ECCA 2VBZA 3B6CA 2F4IA 2F5CA 5J6XA 5F0HA 2Z99A 1ON1A 1VQ4I 3K69A 2W57A 1HKQA 3I59A 4LD5A 1LJ9A 2V9PA 2HOEA 1MH4A 3Q3SA 3U1DA 3OSGA 3ZPLA 4BEHA 2O5RA 1R58A 1ZREA 1O3TA 2LF7A 1T6SA 3J81K 4G9YA 2NRAC 1EH7A 3H0GJ 1B72B 3L1PA 3V8KA 3CC2I 2G7HA 5ED4A 3AL0C 1ITYA 1D5YA 5HVQC 3A01A 4IHWA 3F8CA 2XGCA 3BCBA 1X3ZB 3HBLA 3A02A 3Q5FA 4O6JA 1BC7C 2NNNA 1MNEA 4BQOA 1ETOA 2I5UA 1I1SA 5E20A 1LEBA 5FRMA 1RESA 1VZ0A 1RPWA 2KRFA 1FEXA 2K9QA 4M72A 4X1EA 3DPTA
chains in the Genus database with same CATH topology
2OTLI 1FOYA 3I55I 3I56I 2E35A 1VQOI 2QEXI 2E36A 1VQMI 1FOXA 5GAEJ 2QA4I 1ACIA 2FOWA 2ZJRF 1VQLI 3CCUI 1VQ9I 1FOWA 3CMAI 5GAGJ 4IO9F 3CCQI 3CD6I 1MMSA 1Y39A 5GADJ 4IOCF 3CCSI 1YI2I 1VQNI 3CCJI 5DM6F 2H8WA 2E34A 3G6EI 1YIJI 1YJWI 3CMEI 1QA6A 3CCMI 3CC4I 4UY8I 3CCEI 3G71I 2K3FA 3DLLF 5DM7F 1VQ5I 3J7ZI 3CC7I 1S72I 2NXNB 3CJTB 1VQ4I 1VQ6I 1YJNI 3G4SI 1HC8A 3CF5F 5GAHJ 1VQKI 3J7YJ 4IOAF 2ZJPF 5JVGF 4V19K 3CC2I 3PIOF 2ZJQF 3CCRI 1YITI 3CCLI 1VQ7I 1YJ9I 2JQ7A 1YHQI 1VQ8I 2OTJI 3CCVI 1VQPI 3PIPF
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2OTL I;  1FOY A;  3I55 I;  3I56 I;  2E35 A;  1VQO I;  2QEX I;  2E36 A;  1VQM I;  1FOX A;  5GAE J;  2QA4 I;  1ACI A;  2FOW A;  2ZJR F;  1VQL I;  3CCU I;  1VQ9 I;  1FOW A;  3CMA I;  5GAG J;  4IO9 F;  3CCQ I;  3CD6 I;  1MMS A;  1Y39 A;  5GAD J;  4IOC F;  3CCS I;  1YI2 I;  1VQN I;  3CCJ I;  5DM6 F;  2H8W A;  2E34 A;  3G6E I;  1YIJ I;  1YJW I;  3CME I;  1QA6 A;  3CCM I;  3CC4 I;  4UY8 I;  3CCE I;  3G71 I;  2K3F A;  3DLL F;  5DM7 F;  1VQ5 I;  3J7Z I;  3CC7 I;  1S72 I;  2NXN B;  3CJT B;  1VQ4 I;  1VQ6 I;  1YJN I;  3G4S I;  1HC8 A;  3CF5 F;  5GAH J;  1VQK I;  3J7Y J;  4IOA F;  2ZJP F;  5JVG F;  4V19 K;  3CC2 I;  3PIO F;  2ZJQ F;  3CCR I;  1YIT I;  3CCL I;  1VQ7 I;  1YJ9 I;  2JQ7 A;  1YHQ I;  1VQ8 I;  2OTJ I;  3CCV I;  1VQP I;  3PIP F; 
#chains in the Genus database with same CATH topology
 4N4N B;  4PGG A;  3QPT A;  1QZY A;  1KON A;  3DP7 A;  3ISP A;  3KYC B;  1D3Y A;  4PSW A;  2ETH A;  2XF6 A;  1G3T A;  3LA2 A;  5DCF A;  2EFQ A;  3MEX A;  4P96 A;  5EG0 B;  1J9I A;  2XGX A;  2AQE A;  3BJA A;  3JRB A;  1FBQ A;  2RKH A;  2WAQ A;  3D0S A;  3ZMV A;  2QQB A;  5DUI A;  2EH3 A;  3NQO A;  3W2W A;  4DYC A;  1ERD A;  2A3S A;  2JTV A;  3A1Y A;  1BN5 A;  3IKV A;  4MO7 A;  4GYG A;  3G1L A;  4XNF A;  5TIS C;  4KIF A;  4EAT A;  5K5Q A;  1WCM J;  4RAZ A;  1SFX A;  1ZR4 A;  1R7J A;  4Q47 A;  1WHU A;  3OMY A;  3HXL A;  4WXC A;  1GDT A;  1A6I A;  3G1M A;  4PGH A;  2ZXJ A;  4NQW B;  3WG9 A;  4RMN A;  4P5O A;  1P7J A;  4M73 A;  5FLV A;  1U8B A;  1MMA A;  2H8W A;  5L3B A;  1MJ9 A;  3EDP A;  4ASN A;  3DKW A;  5L3E A;  3ZMT A;  3BLY A;  2BGC A;  3E6C C;  1J75 A;  3QRF F;  3CUQ C;  2XAS A;  4DNC A;  4BE1 A;  3DU5 A;  3E0J B;  3QP6 A;  1JKP C;  4IKF A;  2V4J C;  2O9L A;  3BCA A;  2E5N A;  2CUJ A;  2E60 A;  3J7Z I;  1DUX C;  2JVH A;  1OR7 C;  4A12 A;  3S16 J;  4KMU X;  1Y0U A;  2BXZ A;  2CFO A;  2XRL A;  2DA3 A;  5ICG A;  2V1D A;  1APL C;  4S04 A;  3ZQH A;  3KP2 A;  2A07 F;  5DDG A;  2R5Y B;  3K4J A;  3VOD A;  3HSF A;  2HQN A;  2VE8 A;  3ZCO A;  5M5X J;  3Q0W A;  1WI3 A;  4B09 A;  2MC4 A;  3LSH A;  4G6T B;  4M9X A;  4ESF A;  5HLH A;  1UB9 A;  2FOK A;  2JN6 A;  4CCL A;  3IH4 A;  3FM5 A;  3K4B A;  2GXG A;  4DZJ A;  4HDU A;  2P5V A;  2HOT A;  3T5X A;  3S8P A;  3GWZ A;  4NC8 A;  4WWC A;  3MZH A;  1W5S A;  5B1A H;  5F6F A;  4O5V A;  4H0E A;  3RYP A;  1ZEL A;  2ZJ2 A;  4C2T A;  3BG3 A;  4RDU A;  1NTC A;  1Z0X A;  4Y7N J;  3HOW J;  1IO2 A;  3N05 A;  4PUS A;  5TGT A;  3G3Z A;  3S15 J;  3B73 A;  4RGR A;  2AXL A;  4IXA A;  3TP3 A;  3C7J A;  3RSN A;  2WY7 Q;  3SXY A;  2Y69 H;  4V2F A;  1MD0 A;  2DJN A;  3KET A;  3OS0 A;  2NNY A;  2W00 A;  5D6F A;  2R7Z J;  2H09 A;  2R7D A;  2V1N A;  4HBL A;  2EIN H;  1XG1 A;  5CVJ A;  3C2G A;  1FP1 D;  2CFX A;  1G3S A;  1QQI A;  2FD5 A;  2R7U A;  5B3S H;  5GTH C;  5ICE A;  4LK1 F;  5LGN A;  1FMV A;  1T0F A;  3GME A;  4WK8 F;  3RI4 A;  2X0L A;  2HDD A;  3ABU A;  2HVQ A;  5IP9 J;  4IRI A;  3KEQ A;  3IUO A;  1RNL A;  2L2O A;  3R60 A;  2UWM A;  2JRT A;  3LSR A;  5FJ8 J;  3CO6 C;  2ISZ A;  4U88 A;  2Q2E A;  3SFI A;  3N4M A;  4EGY A;  1WGX A;  4W1U A;  2HYG D;  2FXA A;  4D1Q A;  3D1N I;  4RGX A;  2IS6 A;  1LVK A;  2UUZ A;  5FFZ A;  3M4O J;  4I01 A;  5BQT A;  1YLF A;  1FTZ A;  5FKO A;  4BBS J;  4I7H A;  2ME6 A;  2KZV A;  3CP8 A;  5IT9 K;  1R22 A;  3ZXS A;  3WE2 A;  5J4V A;  1W1W E;  3BPX A;  4X0G A;  4BHC A;  2E34 A;  1XDS A;  5LLQ A;  4F92 B;  1REP C;  4G7Z F;  4Z2Y A;  3SEQ A;  3KP7 A;  2O6G E;  1TLH B;  4CH7 A;  2LF8 A;  1Z7L A;  4RM3 A;  1WJB A;  3PNT A;  4L9J A;  3RQI A;  2E1N A;  1HXD A;  1MBG A;  1TP4 A;  3OIP A;  1CF7 A;  3K70 C;  4OIQ F;  9ANT A;  1D5V A;  2JK3 A;  4YIR X;  1U0J A;  4WX9 A;  1WJD A;  4IRG A;  1JUP A;  2CW0 F;  4XM3 A;  2HTS A;  1O3R A;  3CJT B;  5K7Z A;  5K1Y A;  4XIC A;  2IJL A;  5TJJ A;  2F48 A;  5KAF C;  3M1C A;  1S6L A;  4WXD A;  3HOZ J;  2I8D A;  3K1P A;  1UJ8 A;  1USS A;  2XKP A;  5FRO A;  1IN4 A;  3JSP A;  3G2B A;  4PDK A;  2QSG X;  2FNA A;  3H92 A;  3LFU A;  4KN4 X;  4A3D J;  5H20 A;  3KLN A;  5F08 A;  2E1O A;  1HQC A;  3MCZ A;  4BUP A;  1VQ7 I;  3G73 A;  5KHD A;  5AON A;  3WGI A;  2ESN A;  4LG0 A;  2DFI A;  3X2Q H;  2P5L C;  2ZFU A;  5BOX A;  1PP7 U;  3CCY A;  2X6X A;  1OYY A;  4A6E A;  2VI6 A;  1MBE A;  2KHM A;  2EIJ H;  3K7A J;  1ON2 A;  1ZHF A;  4Y3O A;  2QGU A;  4O3M A;  2E35 A;  2HVR A;  2F5D A;  2WAQ N;  1K61 A;  3LQR A;  1U5T B;  4EJT A;  1K83 J;  2XB5 A;  2HTJ A;  4DYR A;  4U7B A;  4L9N A;  4ZDL A;  4AUX A;  2QCO A;  1BI2 A;  1Z91 A;  2ZSI B;  4ABZ A;  3PJR A;  1WJC A;  3EYI A;  2ZSH B;  2LK2 A;  1IC8 A;  2VUM J;  1IJW C;  2X51 A;  3BG9 A;  1VTN C;  1RC9 A;  2OD5 A;  1X1A A;  2EIL H;  2Z3Y A;  1TQI A;  5D5X B;  1ETX A;  2MSY A;  3MVP A;  3F8M A;  2X48 A;  1B72 A;  2BHY A;  2EFW A;  5B1B H;  3QOP A;  5DUK A;  5FKM A;  2L01 A;  3O8G A;  1ZRF A;  5J4Y A;  1ETK A;  2YPR A;  1Q1H A;  3I4P A;  1G3Y A;  2E19 A;  2RDP A;  3S1R J;  2MGQ A;  3I5U A;  3LSM A;  3CDL A;  4ZC3 A;  5LGT A;  4AYB A;  1ORK A;  4BKX A;  1K4T A;  1OLT A;  1HW2 A;  1A35 A;  5K7F A;  2H8R A;  3I59 B;  3CC4 I;  2EV0 A;  2KMU A;  5LHI A;  4QSH A;  2QQ9 A;  4BEH B;  5CQE A;  1QBJ A;  4KT5 C;  4YFX F;  4P9F A;  4YG2 F;  1LB2 A;  2K86 A;  5EG0 A;  4NBQ A;  4E7K A;  4JX6 A;  4AIK A;  1F4K A;  3TO6 A;  2XHK A;  1BR4 A;  4ZTJ A;  2NAZ A;  3JR9 A;  3CUQ A;  5LRS A;  2Z5U A;  4JX4 A;  5F0C A;  3G4S I;  1IG7 A;  4HF0 A;  1Z3Y A;  5J40 A;  2NVQ J;  3TDZ C;  1HC8 A;  4YFK F;  3VYS B;  3H3V K;  4LIV A;  5CVR A;  4YFN F;  3I53 A;  1OR7 A;  1WQ2 A;  4MGR A;  2D1V A;  2M1B A;  3VFZ A;  1B8I A;  3BC8 A;  1KU2 A;  4CIC A;  1YYV A;  2CUZ A;  3HUG A;  5HNF A;  5JVG F;  1GV5 A;  2R3S A;  3DTE A;  1ODD A;  3HPG A;  1YIT I;  5BMZ A;  5E1W A;  4CCN A;  1YJ9 I;  4L9V A;  1HW5 A;  3LA7 A;  3MWM A;  3UR3 C;  3LSK A;  3BG5 A;  1UAA A;  1ONV A;  2XB0 X;  4OAY A;  3IWZ A;  1UST A;  1D0X A;  3ONQ A;  2QBY B;  3E3V A;  1HST A;  1E3O C;  2BXY A;  2EV6 A;  2QKM B;  3K4K A;  2LY9 A;  4MNU A;  5CQG A;  3FWE A;  2HDC A;  4I2O A;  2M4G A;  3QU6 A;  3M07 A;  2MYS A;  1S7E A;  2DFF A;  3I64 A;  5EYR A;  3RKW A;  2K40 A;  2DQL A;  4F3Q A;  1T38 A;  3VYU B;  2DK8 A;  2BVL A;  3MD2 A;  4PJL A;  1KYW A;  3ZN0 A;  1UG0 A;  2QA4 I;  4PCQ A;  4A0Z A;  4CSW A;  2EFN A;  2RVC A;  2VE9 A;  2KIF A;  1X4P A;  2XV4 S;  1R4N B;  3HHG A;  2E7X A;  2ZNY A;  3M1E A;  3OYF A;  2VL8 A;  1LFP A;  3QOD A;  1EA3 A;  4KDP A;  2OAZ A;  2L9R A;  3NAR A;  1JHH A;  4F52 A;  1P9Q C;  5HLT A;  2BY1 A;  3KPH A;  1H88 C;  5GAD J;  1U3E M;  1YI2 I;  4MIM A;  4FAS D;  3OYN A;  2P4W A;  2VQC A;  3GFL A;  3VEP A;  1OCO H;  1ZH5 A;  2A6T A;  4BJT A;  4E7L A;  2OQG A;  1W4M A;  2W84 A;  1FSH A;  2KRC A;  3JTH A;  4NC7 A;  2CQX A;  1HSJ A;  1TWF J;  2EWN A;  5CKT A;  1Y1W J;  4I76 A;  2DBB A;  2K3F A;  1X1B A;  2FA5 A;  2JSC A;  4XSX F;  4HNT A;  4C30 A;  2CQQ A;  2X1E A;  2ICW G;  5HS8 A;  3TL4 X;  1XGO A;  3AG2 H;  3L00 A;  1ZRD A;  2MW8 A;  2EZK A;  2WBM A;  1FSE A;  5AIQ A;  5H2F C;  4DIQ A;  1MMD A;  4C2U A;  5J8C A;  5D6E A;  4A0X A;  1Z6R A;  2P0W A;  2Q8K A;  1B6A A;  3I58 A;  5F04 A;  2RNJ A;  3CF5 F;  1DPU A;  4IQ4 A;  2R7X A;  4FE7 A;  3CMY A;  2F4O B;  3U1K A;  4IX7 A;  5CJ9 A;  2W7N A;  2ACJ A;  1IF1 A;  2LOO A;  2M87 A;  3JAM Z;  2DFH A;  3HOX J;  5IOY A;  2KIM A;  1HDD C;  1F43 A;  5EF6 A;  2EFO A;  2BV6 A;  4M9Z A;  1YHQ I;  3L2Q A;  2ESH A;  2OF7 A;  1KU7 A;  1KYZ A;  5IP7 J;  3Q0U A;  3HC7 A;  5IPA A;  4BU2 A;  5K5O A;  1FTT A;  5CLS A;  3HGG A;  2K85 A;  1YS7 A;  2LMD A;  1FIP A;  3I9V 2;  2XGE A;  4AM3 A;  3PIP F;  4HF2 A;  2IA0 A;  1YTY A;  2XVC A;  3LOC A;  3K1N A;  1V4R A;  2JJ7 A;  2LFB A;  4IZZ A;  5D8L B;  4EM2 A;  4OU0 A;  1U6G A;  1P6R A;  2QVO A;  1XCV A;  4ENN A;  2DTR A;  3RZO J;  1DDN A;  5AIP A;  4Y13 A;  3IAM 2;  4EM0 B;  4QTR A;  1R5I D;  1V3F A;  1S8N A;  5JLX A;  3S3O A;  2CWE A;  2Y2Z A;  4ZYH A;  4DOZ A;  2DA7 A;  4RGU A;  4Q4Z F;  1VF9 A;  2RRE A;  1SMT A;  3IC7 A;  2XAQ A;  4S0H B;  3WHC A;  2ZKZ A;  3V7R A;  1K78 A;  1YW7 A;  3EUK L;  2XAU A;  2ZXW H;  1H89 C;  3CF2 A;  2EA2 A;  3OR1 C;  3VYT B;  4EV0 A;  2HNH A;  1XGS A;  4M74 A;  2IGK A;  3LMM A;  3HSR A;  3SZG A;  3J80 K;  3BTJ A;  1QRY A;  3DBR B;  4YII A;  3RIR A;  3QOE A;  3AFH A;  5E3O A;  1IN6 A;  3T1B A;  1OCT C;  4MFE A;  2OV7 A;  3R0J A;  3TOA A;  4NHJ A;  5DM6 F;  1GXP A;  1I3A A;  3G6E I;  1O3Q A;  5DD8 A;  4XOT A;  4BQA A;  2QSF X;  3WU2 C;  4ON0 A;  4F93 B;  2M7B A;  1IRZ A;  4U0W A;  2GOM A;  1WH5 A;  2WV0 A;  2DOA A;  5A2Q K;  1LE8 A;  4YIF A;  5GPC A;  2VQL A;  1U5T A;  5CPR B;  4D0P A;  4ESB A;  3TOB A;  1YG2 A;  4IHT A;  3V8L A;  1IUY A;  1BBY A;  4GO1 A;  2EPF A;  2KT0 A;  1FC3 A;  1YW8 A;  2BY0 A;  3GFI A;  2G7U A;  5IYC J;  3QPS A;  2PI0 A;  3MQ0 A;  1BR2 A;  4CYD A;  4D5F A;  3L9F A;  3WGH A;  3S2W A;  2KKO A;  2PFB A;  2MH2 A;  1E3P A;  2BYV E;  2OA4 A;  1J09 A;  1ZR2 A;  3EUH C;  1T33 A;  2P7C B;  3AL0 B;  3B02 A;  4HST A;  5D5V B;  2A68 F;  2BOL A;  2Z9O A;  1JKO C;  2BY3 A;  2V6C A;  1VQ8 I;  2CMP A;  3OYK A;  4JQF A;  1ZRC A;  2MLG A;  3ABK H;  4BS9 A;  4LJZ F;  3WU0 A;  2KPM A;  1HDP A;  3TW7 A;  2AS5 F;  1E3H A;  2LKX A;  5HLG A;  3C2B A;  2K4B A;  2IVM A;  2PQ8 A;  2X6O A;  3FK6 A;  4GRI A;  1IUF A;  1MSE C;  5FLM J;  1O4X A;  2V7F A;  1K4S A;  4G7O F;  1SD5 A;  4HV6 A;  2V6E A;  3HTS B;  4BDY A;  4C3J J;  2MH9 A;  2XKO A;  4QLC U;  2XF7 A;  3MN2 A;  2JA8 J;  1W7P A;  3SYT A;  3H5A A;  1NG7 A;  3ZMU A;  2HFH A;  1MGT A;  2CSO A;  2GXB A;  1YE9 A;  1ZG3 A;  5M3M J;  4L18 B;  2VON A;  3CJQ B;  1L0O C;  4U7D A;  4FX0 A;  1ZAO A;  3ZQQ A;  5H6Q A;  4K2E A;  5GAE J;  2RN7 A;  4FE4 A;  1O3S A;  1FP2 A;  4E4H A;  2VOD A;  3DU6 A;  1VQL I;  1P4X A;  1X58 A;  1U8R A;  2PJR A;  3WE3 A;  5JLW A;  2ZCW A;  3P7N A;  5FLX K;  1ZKG A;  2MBF A;  4J01 A;  3GZ5 A;  1N25 A;  3M8E A;  4ENM A;  2VC1 A;  4MTD A;  3O8H A;  4L9T A;  1FYM A;  2R7O A;  2IW5 A;  3I54 A;  2VIX A;  3GTO J;  2VJI A;  4IOC F;  3OS1 A;  4I99 C;  3PSF A;  4JP0 A;  2LDU A;  3CCS I;  2F2E A;  1TL8 A;  5JVT A;  3CJR B;  3GCM A;  3FHZ A;  3U9G A;  1RUN A;  5EJC A;  2Y0S N;  1Z6T A;  2CUE A;  2GZW A;  3CUQ B;  2OBP A;  4XLN F;  4L0Z B;  1QVU A;  4XKC A;  4DGW B;  4A3B J;  2QBY A;  1QU3 A;  3EYY A;  1O7F A;  3LL7 A;  2J5O A;  2VQH A;  3SJM A;  5HDN A;  3KZY A;  4A0Y A;  3IH2 A;  3GUD A;  1DU0 A;  3V7S A;  4HRI A;  1IDZ A;  2C6Y A;  1AKH A;  3S1M J;  1UFM A;  1B8I B;  3HGY A;  4E7I A;  2JUC A;  3HUG B;  4A3E J;  2ZME C;  4HW0 A;  3ZOB A;  4HNV A;  5H6R A;  4XLA A;  4GXO A;  2LLK A;  2XPW A;  4M6V A;  2G9W A;  2K9L A;  5E1X A;  3BZK A;  1G2H A;  2FBK A;  4A2U A;  1YX3 A;  3QQA A;  3ZMD A;  5HNH A;  2WA0 A;  3VOE A;  2GWR A;  4HX8 A;  1FIA A;  1I6X A;  1X2M A;  2DOE A;  4ZZD A;  1A6Q A;  3HHH A;  3CP2 A;  4AID A;  4UV8 A;  2A6H F;  1TQP A;  1JKR C;  1P7I A;  2ZJP F;  1BL0 A;  1R5H A;  2D5V A;  4G6Q A;  5IOZ A;  1QGP A;  3I4M J;  4AVP A;  4KMF A;  2IGO A;  1G59 A;  3L2R A;  4BH9 A;  4A3F J;  3OWT A;  1IN5 A;  2J5P A;  2X1D A;  3RQ4 A;  3L2W A;  1XGM A;  5KVR A;  2RC4 A;  1TT0 A;  1WVR A;  2MFZ A;  1X3W B;  3DEW A;  5BPI A;  2KZG A;  3M9A A;  3A0B C;  3PO2 J;  2RQP A;  2QQA A;  3QAH A;  4AD9 A;  5GP9 A;  4WF2 A;  3S32 A;  3JRI A;  3PM1 A;  2EA4 A;  3ABL H;  3HOT A;  2IS1 A;  3GYH X;  1OCP A;  4XKV A;  4QPQ A;  4E7S A;  3JRC A;  3HL2 A;  1ULY A;  1GV2 A;  4XQF A;  2HVS A;  2MC3 A;  3IH3 A;  1WKM A;  3AG1 H;  4JOM A;  3LSG A;  3DQV C;  2R7F A;  4A3G J;  4NB5 A;  5EGO A;  2WWY A;  3PFI A;  4CCO A;  5J47 A;  2Y0M A;  1M1E B;  4GYI A;  2NS8 A;  2Y30 A;  3F8B A;  2CG4 A;  3JW4 A;  2FMY A;  1J59 A;  2JPB A;  3PFY A;  4DBQ A;  3FXQ A;  4FHT A;  3J81 Z;  1ETQ A;  3E5Q A;  3OOU A;  3TW6 A;  2V1U A;  4WXH A;  1XB4 A;  2P6T A;  3E6B A;  5DV5 A;  2ADU A;  1R1V A;  3MKL A;  5E79 C;  2JA5 J;  3W6J B;  3E7L A;  1BC8 C;  1JE8 A;  2CV1 A;  1JGS A;  2M8G X;  4XL9 A;  1TTY A;  2YSR A;  1D8J A;  2VKE A;  4UUS B;  1JJ6 C;  4HX4 A;  2FE3 A;  4LLN A;  1Y0N A;  3IL2 A;  1W36 C;  2DMN A;  1ETW A;  3GTJ J;  3M7G A;  3VWB A;  4N9I A;  4HNU A;  4ZYD A;  4OIO F;  3OIO A;  2QF7 A;  3CZ6 A;  4R1H A;  5HDK A;  5D4R A;  1QNT A;  3GLX A;  4I0A A;  1IZ1 A;  2DK5 A;  2V26 A;  4CGZ A;  1FWZ A;  4JX5 A;  5ILS A;  2OC6 A;  1OFC X;  2M30 A;  5F64 A;  1OCC H;  4B48 A;  5CVI A;  1OYW A;  4UB6 C;  4G94 A;  2Z16 A;  2LBF A;  4DJA A;  3F0C A;  2VBW A;  2L9S A;  3N97 A;  1E0E A;  4MHG A;  1IV8 A;  5BS6 A;  4EJV A;  3BTI A;  3H9Q A;  2V1X A;  3FIW A;  2ZXI A;  3QPH A;  2M0C A;  1S72 I;  3FXU A;  1T56 A;  1POG A;  1XC5 A;  3SZP A;  1G4D A;  1BI1 A;  1Y1V J;  1YJN I;  2P7V B;  4N9H A;  2VXD A;  1EV7 A;  3DF8 A;  3M8J A;  2RQQ A;  3FXM A;  5CVU A;  1BR1 A;  2Z33 A;  1R23 A;  2JA7 J;  4BY1 J;  4CCM A;  1LDJ A;  3BJO A;  1SVL A;  4F91 B;  2AQF A;  3NRV A;  2BW3 A;  1CGP A;  1MKM A;  3QYE A;  3LSP A;  4XRS G;  5B66 C;  1MMG A;  4CA0 A;  3JSO A;  2DT7 B;  1I50 J;  6PAX A;  2VN2 A;  5FD5 A;  1IV6 A;  1BJZ A;  3WTS C;  3EUH A;  3FBN B;  5KCM A;  5ERI A;  3REO A;  3W3C A;  4CUG A;  2OZ6 A;  5BNG A;  3L2V A;  2YX7 A;  1A31 A;  1KZH A;  4ZYA A;  1SAU A;  2LKS A;  3HRM A;  1FNN A;  1BI3 A;  2LP0 A;  1IAW A;  4BGD A;  2LY2 A;  2CQ7 A;  1K78 B;  3HRS A;  1VND A;  3RKX A;  2HGC A;  2M0M A;  3ECO A;  1FY7 A;  1F1Z A;  3I71 A;  2GXA A;  2STW A;  2LYC A;  1BOA A;  1I39 A;  2VT2 A;  2DDA A;  3RPU A;  3L09 A;  1EF4 A;  3JRA A;  1MDM A;  2B7E A;  3TP0 A;  3W2A A;  3Q9V A;  1SAN A;  2COB A;  2QQ8 A;  3WTX C;  2LVS A;  1BJA A;  3K70 D;  1PJR A;  2L7F P;  3GVA A;  3COA C;  1XSX A;  2QUF A;  1LE8 B;  3SQN A;  4M3B A;  4RLF A;  3HSE A;  3OSF A;  3ABT A;  2FBH A;  3KE2 A;  1AOY A;  1JGG A;  1UCR A;  1NHA A;  1Y8Q B;  4GDF A;  2X9D A;  1SMY F;  3NWT A;  4IEJ A;  3T8T A;  4BAY A;  3GTL J;  4HLX A;  1N78 A;  1XGN A;  4RLQ A;  3KFW X;  2P6S A;  4ESJ A;  4U0Y A;  1EH8 A;  3LFK A;  4S05 A;  2FQ4 A;  2IAI A;  4EEF G;  3A4C A;  3PQK A;  2XIG A;  3K9T A;  3FIS A;  1WPK A;  4MFD A;  4Y33 A;  1BA5 A;  2BVM A;  4Y17 A;  2NVT J;  2FML A;  1A36 A;  3HJE A;  3PUB A;  3OY9 A;  2DMU A;  5KNL A;  2CQN A;  1NK2 P;  2BEO A;  1EKE A;  3BJ6 A;  2P81 A;  3ULQ B;  2IA2 A;  1V5G A;  2D45 A;  2A5Y B;  1VQ6 I;  4CXF A;  4J19 A;  1R9T J;  2K7L A;  3IRR A;  4A5M A;  2AO9 A;  5EZG A;  3DPU A;  2M4K A;  1TWG J;  3ZQ7 A;  1TWH J;  4ENK A;  2KP6 A;  4OAZ A;  3VSL A;  1YS6 A;  3I3L A;  4BQQ A;  1RI7 A;  2CV0 A;  1VQK I;  1OMI A;  2ZME A;  4M3E A;  3S93 A;  4B1R A;  3TMO A;  1HA8 A;  2GQQ A;  3EQL F;  4DQ2 A;  4V19 K;  5IT9 Z;  3PIO F;  3CCR I;  4IHS A;  3BR0 A;  3CDI A;  3T8R A;  2GLO A;  2QKL B;  1W7P B;  2IP2 A;  2FNP A;  1U9N A;  3BR2 A;  2GAU A;  1P4A A;  2DA4 A;  4BNC A;  2H6C A;  3OR2 C;  5J3L A;  2DA1 A;  2LKP A;  3ASO H;  3FM3 A;  4XLH A;  1W0T A;  3PO3 J;  4JYK A;  3QU3 A;  3RJP A;  3GTK J;  2JVG A;  3W2V A;  5EEA A;  3GEZ A;  1EJ9 A;  4KIS A;  4XRM A;  3KZZ A;  5D8K B;  1TC3 C;  2PJR B;  4N4O B;  2ZB9 A;  1BW6 A;  5HS7 A;  4HLY A;  2EZL A;  4EJW A;  3JAM K;  2VC0 A;  3AG4 H;  2XC7 A;  1GHC A;  5HOO A;  2B0L A;  2PX9 A;  3GBG A;  4LIU A;  4I6Z A;  1HKS A;  2XPU A;  2DFE A;  3UNG C;  1YO5 C;  3GX4 X;  2STT A;  3M3Y J;  2R7V A;  3HRU A;  2TDX A;  3ZQG A;  1SFK A;  2VJJ A;  2IGM A;  3B6A A;  3DLA A;  4XOP A;  4CYC A;  5HOD A;  1QVT A;  3DKX A;  3L7W A;  2ZBK A;  2A05 A;  3ZQI A;  1OJL A;  5LGU A;  2QEN A;  5FKN A;  4BE2 A;  1J2X A;  2EBI A;  2P5K A;  3PNV A;  3GO5 A;  4MQV A;  4E7J A;  4PJJ A;  2GA2 A;  1XX5 A;  3BPV A;  1ZLK A;  2D2W A;  4YRV A;  3KYD B;  3D5S C;  3F72 A;  2GOX B;  1AKH B;  5ICC A;  2OJE D;  5FFX A;  3K2Z A;  2R93 J;  1PYV A;  2HKO A;  1K6O A;  4ITV A;  2KQR A;  2DCE A;  4JBA A;  3HB9 A;  1UHM A;  2R7W A;  4IHV A;  4V2G A;  2NOJ B;  2PMZ N;  2MG4 A;  2M7A A;  3SEZ A;  1X4O A;  2W82 A;  3R0A A;  3G71 I;  2DA2 A;  2KFD A;  4GFB A;  2VOP A;  3K4M A;  3V8J A;  2BHZ A;  1MIJ A;  2WY8 Q;  1W7P D;  5C3E J;  1O57 A;  1QPI A;  2XRN A;  1SD6 A;  2W4S A;  3OYG A;  1W0U A;  3JRF A;  1LPQ A;  3TKY A;  4BBR J;  3KEY A;  1RR7 A;  4KUM A;  2O7O A;  4M9S A;  3TDU C;  5GTI C;  3WTV C;  3HM5 A;  5E18 F;  1WZ2 A;  4OOI A;  5M3F J;  4IHX A;  2H94 A;  5K5R A;  3BR3 A;  5K7H A;  2XAH A;  3DTK A;  2RGV A;  4PFO A;  3HKZ N;  3H9J A;  3EUA A;  2Y0S A;  4IOA F;  3BTC A;  4RB2 C;  5F27 A;  2F5E A;  2OCC H;  2PEX A;  4M6Y A;  4UUS A;  2VB6 A;  3GTP J;  5ILU A;  2CV2 A;  4LB6 B;  2NYX A;  5LRR A;  3ZMS A;  2GA1 A;  3OYH A;  4M3G A;  1LVA A;  2FX0 A;  2ZC2 A;  5HS9 A;  1UHS A;  2OQR A;  4PJN A;  1GLN A;  4WCG A;  1U78 A;  4B8X A;  3NWS A;  4L5I A;  3VDX A;  3IAS 2;  5EGO B;  2FEZ A;  4KN7 X;  3RZD J;  3F22 A;  2X6W A;  3KYL A;  4ZH4 F;  3S3M A;  2DJI A;  2DQR A;  1XN7 A;  3ZRG A;  2E1M B;  1GT0 C;  1W5T A;  2ELJ A;  4HX7 A;  1T8I A;  2PBI A;  2W85 A;  4D7N A;  2YU3 A;  4UUT A;  2PG4 A;  5L3F A;  2HS5 A;  2PMU A;  1R6R A;  4MLO A;  3DCF A;  2BZT A;  2XF5 A;  3RYR A;  1I1G A;  1IN8 A;  3BR1 A;  2P8T A;  5E8G A;  2QEX I;  3FDY A;  4EMS A;  2VOO A;  1OQY A;  1AWC A;  1WFX A;  1JTY A;  2L4A A;  1S7A A;  2X4H A;  5E8I A;  4CO8 A;  1X1D A;  1WWX A;  1KA8 A;  2ZJR F;  3ZGK A;  3CCU I;  1XSD A;  3DKY A;  1Y56 A;  4RAG A;  1MBF A;  1UMQ A;  3S2D J;  3J7A O;  3WTT C;  3CMA I;  3OYC A;  1IRX A;  2XDV A;  3H3U A;  2E1M C;  2NOG A;  2VAS A;  1Z05 A;  2FJ1 A;  4U87 A;  1Z1D A;  4AU7 A;  2KIU A;  1IRF A;  2NS7 A;  1MMS A;  4LLL A;  4ETS A;  1XD7 A;  1ZGA A;  2LBF B;  3S14 J;  3ESW B;  1Z7U A;  5JR3 A;  2OCE A;  2TRT A;  4I0B A;  2JUG A;  2YU9 J;  5FD6 A;  1V5E A;  3DV8 A;  2QSH X;  3HPH A;  1TWA J;  2BY2 A;  3CQZ J;  4OIN F;  3E97 A;  2R4G A;  3PUF A;  4TV7 A;  4IQJ A;  1YJW I;  2Q1Z B;  3OIQ A;  5LD2 C;  1ZG1 A;  4UY8 I;  3CCE I;  1DQU A;  4AIH A;  1MJA A;  3RDI A;  1WJE A;  2K02 A;  3KP6 A;  3F9K A;  1UZC A;  4A6D A;  1FZP B;  1XMX A;  3E6D A;  2WAF A;  3Q9S A;  4G6D A;  2BW3 B;  2LH9 A;  3I0T A;  2B63 J;  4BL0 B;  4BDZ A;  2DPU A;  1T95 A;  3BG7 A;  2EIK H;  2L54 A;  1BI0 A;  1JT0 A;  1K7A A;  3E5X A;  4M6X A;  2HPI A;  4A3I J;  3KEO A;  3E6M A;  3ZN1 A;  4B3A A;  1J0R A;  5J1R A;  3OYD A;  1TQM A;  3JRE A;  1IRG A;  2A69 F;  2XAJ A;  1P92 A;  1X1P A;  3H5R A;  4Z6Y A;  2XUB A;  4UNO A;  1Z3X A;  2CYY A;  4JK1 X;  1S9H A;  5FB2 A;  1XSV A;  2M34 A;  1IXC A;  2XSJ C;  2JPC A;  3O2P E;  1UEL B;  3CCL I;  3LSJ A;  2XAG A;  2R7R A;  1DP7 P;  3RPQ A;  4UVA A;  4C3I J;  2OUM A;  2LG4 A;  3HDD A;  2K3P A;  4ANJ A;  2WAD A;  1NK3 P;  5L3C A;  3DWL E;  4N0B A;  1FOY A;  1ZYR F;  3VPR A;  1MDM B;  1DU6 A;  1K6Y A;  2E2J J;  4CHU A;  4HYE A;  3MFK A;  4CCK A;  1OPC A;  1WJA A;  4XRF A;  4PFP A;  4A3J J;  1YRN B;  5DCM A;  3AKZ A;  3R4K A;  4IRH A;  2CQK A;  1TZL A;  1B9M A;  3H3Z A;  2KJB A;  2UXN A;  2K4J A;  2HQR A;  3A03 A;  3EET A;  1FYK A;  3PSI A;  2A5W A;  2QLZ A;  3DXJ F;  4HA8 A;  5DS9 A;  3ZQL A;  5EZH A;  3S1N J;  2QWW A;  4G12 A;  4P55 A;  1DGR M;  5JHU A;  3QWL A;  2GIZ A;  1PUE E;  2VKV A;  2JMW A;  2Y48 A;  2HEO A;  4LK0 F;  2NS0 A;  4IL6 C;  3BQZ A;  3WTW C;  1R4M B;  4XID A;  5DYM A;  1H0M A;  3K4C A;  2FRH A;  2FF4 A;  2DYS H;  1NH3 A;  4ZDO A;  2IEK A;  3FXO A;  1ZK8 A;  4CZZ A;  1T98 A;  2DT6 A;  4LGW A;  5EEG A;  1N75 A;  4Y52 J;  1X3U A;  3KP4 A;  2H1K A;  4KIT B;  2RV8 A;  2CH0 A;  3D5R C;  5LHG A;  2DO7 A;  3KX2 A;  3HIF A;  3OYM A;  3SZT A;  3IRQ A;  3EPZ A;  1OCZ H;  4BXX J;  3LST A;  2F5V A;  1SVO A;  2E5Z A;  2AHQ A;  3LQQ A;  2ZME B;  1HW1 A;  3C3W A;  4XKW A;  1ZGJ A;  4B43 A;  1VFC A;  3G1O A;  3OYJ A;  1KU3 A;  4DW6 A;  3OYE A;  4H4K C;  2NXN B;  3HRT A;  1LFB A;  2JZY A;  3RPU D;  1FT9 A;  2JWT A;  3DBH B;  4XON A;  4OIP F;  3WTY C;  1GUU A;  2L0K A;  2OZU A;  2HI3 A;  2N8G A;  4HZF A;  1MND A;  1S7O A;  4OMZ A;  3A0H C;  3DEU A;  1DGW Y;  5D5U B;  4FTH A;  1B59 A;  3ELK A;  3J7Y J;  1LEA A;  4MEX F;  2DOD A;  3F8N A;  1IXR C;  2IPQ X;  1YFH A;  1IN7 A;  3J80 Z;  1RR8 C;  4HQM A;  1FX7 A;  3K4N A;  5LFA A;  3H36 A;  2QZ8 A;  1RZ4 A;  1WH7 A;  3FZV A;  4QPO A;  1R49 A;  1FJL A;  1R00 A;  4A3K J;  3BRO A;  4BQN A;  2OU2 A;  1NG6 A;  1SFU A;  3CCV I;  2EK5 A;  3UKG A;  1PP8 F;  1H8A C;  1VQP I;  1F5T A;  5A2Q Z;  4EJU A;  2HR3 A;  2V79 A;  2IRF G;  2VKD A;  4Y4R A;  4Q5S F;  2OTL I;  2EZH A;  1SFO J;  5FO5 A;  4II2 A;  1YOV B;  2R5Z B;  4HOB A;  4CYC B;  3HOU J;  1PUF A;  2W48 A;  4BY7 J;  2GM4 A;  1D0Z A;  3I4N J;  2DMP A;  4YEJ A;  1HOM A;  4KYW A;  4IHY A;  2E36 A;  2A61 A;  5F1J A;  4EQQ A;  2IXS A;  2CRG A;  2IA1 A;  2LC2 A;  3GF2 A;  4E7H A;  5DTD A;  4BXF A;  2EB7 A;  3W6K B;  4X6A J;  3LAJ A;  2XPV A;  3HYI A;  2CGP A;  3BZC A;  2R7S A;  1JKQ C;  4E6K G;  3OYL A;  3R6S A;  4KIB A;  2F6C A;  3ROU A;  3ERE D;  1LQ1 A;  2DPD A;  3WHB A;  3DEE A;  2QM3 A;  2KDO A;  2IT0 A;  2JSP A;  2O0Y A;  3QYF A;  3LSI A;  2M2E A;  1ZTR A;  1V54 H;  5EDN A;  2L02 A;  5FKL A;  4PZJ A;  1HF0 A;  1QPM A;  2ZO4 A;  1WRJ A;  2H1L A;  1SEU A;  2RNG A;  5JFR A;  3IWF A;  4UVC A;  1MBH A;  2JRM A;  1D1A A;  5FGM A;  4FQG A;  2UXX A;  5HDG A;  5L3D A;  1MJB A;  1RKT A;  3ZMZ A;  5IP6 A;  1SC7 A;  5TRD A;  4EM1 A;  1LNW A;  5DEQ A;  1XMA A;  3DLL F;  5DM7 F;  3K6G A;  1QHH D;  2VPR A;  4KA4 A;  2HZT A;  3S3N A;  5HLI A;  1MBJ A;  4B47 A;  5BPD A;  3O6B B;  3ECH A;  1XCB A;  2NVU B;  1DP3 A;  3WTU C;  4UV9 A;  1R1T A;  3CLO A;  1FBS A;  2DXI A;  3GLL A;  4ZYE A;  1KQ9 A;  2NVY J;  3QP5 A;  5FLX Z;  2L9N A;  2R7Q A;  5FRN A;  1R36 A;  3DFG A;  2UV1 A;  3S1Q J;  5DD4 A;  3KZI C;  2FUG 2;  2O8X A;  2Y9Z A;  3AG3 H;  3HG9 A;  3VB2 A;  1QHG A;  3BOQ A;  2HYF A;  2YS9 A;  3ZQC A;  1ETV A;  4ZZL A;  3GTM J;  3FMR A;  2DYR H;  4A93 J;  3L2C A;  2EQR A;  3E5U A;  2VKH A;  3K10 A;  1IDY A;  4KT6 A;  2VPL A;  4OMY A;  3KCC A;  5JHF A;  4FCY A;  1L3L A;  2FBI A;  2PMZ A;  4IVN A;  1TNT A;  3R61 A;  2FU4 A;  3TO9 A;  5EEH A;  3O3K A;  2JA2 A;  4L5E A;  1D1B A;  3OL3 A;  3E1S A;  3U2R A;  3S17 J;  2E2H J;  3ASN H;  2OTJ I;  4DZP A;  4D7M A;  1T39 A;  1QO0 D;  1TBX A;  1Z9C A;  4F55 A;  3HZJ A;  4FIS A;  2M45 A;  3OYI A;  1K79 A;  3WTZ A;  2WTE A;  2EZI A;  5J8F A;  1W36 D;  4F7Z A;  3S2H J;  3C18 A;  2COM A;  3GFM A;  3HKZ A;  1LKX A;  1SD7 A;  2IS4 A;  3F3X A;  3FMQ A;  1R1U A;  3P9C A;  2HDW A;  4LFU A;  1RRJ A;  5E3L A;  3H35 A;  3F6O A;  1S3J A;  3BQY A;  4HEA 2;  2L4M A;  4LIT A;  2WB1 A;  3TBI A;  1X1C A;  3VSK A;  1N77 A;  2W24 A;  5LHH A;  4CCJ A;  4UUV A;  4RB3 C;  1ETY A;  4KIG A;  5GAG J;  2HKX A;  3FXR A;  3TGN A;  4XLC A;  3JRG A;  3CCQ I;  3MAJ A;  2KJC A;  2FQ3 A;  4NDL A;  3HOV J;  2VT3 A;  1MSF C;  1Q1V A;  1X19 A;  2K9N A;  3FKI J;  5B5E C;  2F5F A;  5J1U A;  2Y9Y A;  2PJP A;  3ML6 A;  1HBX G;  3FXL A;  2X85 A;  2TCT A;  1FBU A;  4NC6 A;  5JI6 A;  2CU7 A;  3CME I;  2HZD A;  1QZE A;  5C4J J;  2ISY A;  2VBX A;  1RIO H;  2R0Q C;  4EVI A;  3PL8 A;  2G0E A;  1I27 A;  2EIM H;  2L7K A;  2MD0 A;  5M5Y J;  1YRN A;  3NAU A;  1VQ5 I;  5LEJ A;  3H9G A;  4XLF A;  4E70 A;  1I3Q J;  3KP3 A;  4I98 B;  3V4G A;  5M5W J;  1Y6I A;  3DPL C;  3GW2 A;  1B1B A;  5E17 F;  2WC2 A;  4BHB A;  4XOR A;  1P4W A;  4D5C A;  1KU9 A;  3GXO A;  4BAC A;  2LD5 A;  3CO7 C;  4M3F A;  2L3D A;  3KP5 A;  2DU9 A;  3TQN A;  3P9I A;  2X1C A;  1JUS A;  2R7T A;  5GAH J;  2XGD A;  3MZY A;  4LOC A;  4RS8 A;  3JTG A;  4HF1 A;  3ABM H;  5IYD J;  4W97 A;  3OOP A;  3C1D A;  1E2X A;  5L3G A;  4QWQ A;  1O7L A;  5KK1 A;  4HQE A;  3W6V A;  3TED A;  3RCO A;  2ZJQ F;  1QZZ A;  3HOY J;  2EFP A;  2JQ7 A;  1MZB A;  4LLG F;  1OYI A;  5DCM B;  4PJ0 C;  4D9J A;  2Z2S B;  1ENH A;  4BYY A;  4C2M J;  3GZN B;  1A04 A;  2DMQ A;  1FOK A;  3HEF A;  1IW7 F;  2VJ5 A;  2HQA A;  4G7H F;  4I02 A;  1XMK A;  2M9H A;  1T2K A;  1BOB A;  1SAX A;  1PVE A;  4XRS A;  4KNY A;  4PK4 A;  4ZJZ A;  4XLE A;  1DPR A;  3QPL A;  2O8K A;  2VLA A;  1FLI A;  3MMY B;  3FF5 A;  2KLO A;  4MEY F;  5ICF A;  3KLO A;  4P1W A;  1STZ A;  2I10 A;  3SHF A;  5CVV A;  1TWC J;  1MMN A;  1U5T C;  2DDB A;  1VQM I;  3K1M A;  1FOX A;  4FET A;  4BE0 A;  4PJM A;  4EGZ A;  3GFJ A;  4RBO A;  2V9K A;  2Y31 A;  2MD5 A;  2LSO A;  2L9V A;  4RA2 A;  1BIA A;  1T08 B;  2CS3 A;  4L5J A;  2HXI A;  3BZ6 A;  1FOW A;  1LDK B;  3F8F A;  4ZDP A;  2PMH A;  1B9N A;  2BBY A;  1TT5 B;  1XTA A;  1IXS B;  5C44 J;  3NEU A;  1BM9 A;  1Z67 A;  4NNJ A;  3GZ6 A;  2JT1 A;  3CD6 I;  1F9N A;  4OIR F;  4BJ6 C;  1LDD A;  1AA7 A;  2XAF A;  3MKZ A;  3V42 A;  2ME0 A;  2E1C A;  3D5L A;  3IV5 A;  2W1O A;  2ELK A;  3A01 B;  1VQN I;  3CCJ I;  3FKJ A;  2YR2 A;  1A5J A;  1Z21 A;  1GVJ A;  2DN0 A;  3J7A Y;  5D5W B;  4LG3 A;  2L7Z A;  2R5Z A;  3BP8 A;  1YIO A;  1EH6 A;  3H1C A;  4XMY A;  1I6H J;  3GTQ J;  2ECB A;  3T0Y A;  1J7K A;  4KIC A;  4AVZ A;  5F1R A;  1R71 A;  1YX5 A;  3WG7 H;  2LNB A;  2DT5 A;  4IJA A;  3IP4 B;  3ZQF A;  4NQW A;  3F21 A;  2F4M B;  2ID3 A;  3IKT A;  3K2A A;  4CDG A;  2HXO A;  1SFE A;  4GCV A;  1PDN C;  1UHW A;  2ZXH A;  5CYV A;  2MA3 A;  2E7W A;  5KAI C;  1G8X A;  3K4L A;  2HWV A;  3K0L A;  2IS2 A;  4RGS A;  1F36 A;  1ZAR A;  3FHN A;  2CW7 A;  1Y8R B;  2CUF A;  4R79 A;  2LY1 A;  1V55 H;  4HAM A;  2LTP A;  3LWF A;  4XBF A;  5F0F A;  1E17 A;  4KFC A;  2GBY A;  1X2N A;  5D4S A;  1PUF B;  1UG2 A;  2ZFW A;  3FBI B;  4L0Y B;  1YQA A;  4UHT A;  4XN0 A;  2R5Y A;  4B4C A;  3F6V A;  3BWG A;  1ZQ3 P;  1OIS A;  1ZG5 A;  3H0D A;  1TW3 A;  3CES A;  2KL4 A;  3FX3 A;  2Y75 A;  1WI9 A;  3U21 A;  4ENJ A;  1WJF A;  3PQJ A;  3V7C A;  5IT3 A;  1HCR A;  4DYQ A;  1VI0 A;  1GXQ A;  2IGN A;  2H6B A;  2Q0O A;  1FMW A;  5IY5 H;  3CDH A;  3DTI A;  3KIO A;  1KGS A;  3I55 I;  2QYO A;  1XS9 A;  2GIV A;  2PLY A;  4R8H A;  5ILV A;  2ID6 A;  2WB1 N;  1D8K A;  4EJO A;  3MKY B;  1TNS A;  1OKR A;  1FYL A;  2FOW A;  3HTU A;  1FPQ A;  2JA6 J;  3AAF A;  3QYB A;  3RKY A;  1YW9 A;  1JJ8 C;  4BJ5 C;  4GGG A;  3LAP A;  1S5L C;  2DLL A;  2DA6 A;  4IO9 F;  2WV1 A;  1JTX A;  3P5J A;  2MAB A;  1BW5 A;  3CLQ A;  3M8F A;  4XN3 A;  1B4A A;  3MZ8 A;  2DOF A;  2HOA A;  4IPA A;  2CW8 A;  4M71 A;  1MH3 A;  4II3 A;  3F23 A;  4B3X A;  1WJ5 A;  4XLP F;  4YEL A;  1RKW A;  4AC0 A;  1IGN A;  1R5G A;  4XSZ F;  4CZC A;  2KIQ A;  2M8E A;  4NUB A;  4PSX A;  2XSD C;  2NVX J;  3OV8 A;  2EJR A;  2ZNZ A;  3CMM A;  4IF4 A;  4OWR B;  3BR5 A;  1SVM A;  4B44 A;  3OS2 A;  4Y15 A;  1AU7 A;  4HPQ A;  4MQ9 F;  2HQ5 A;  4RB1 A;  5E3N A;  2M3A A;  2HYJ A;  2LR8 A;  2RAE A;  3SFZ A;  3WU1 B;  2HPM A;  3CC7 I;  1OCR H;  3ERM A;  3JCU C;  2A6E F;  2WAE A;  2CO5 A;  3LA3 A;  2HU9 A;  3CTA A;  4I09 A;  4XKB A;  3L2U A;  3ZP5 A;  2DI3 A;  2VBY A;  1MNM C;  1RET A;  2VXZ A;  4C9Y A;  5LEK A;  4FT8 A;  5E3M A;  1JI8 A;  4LB5 A;  3DBL B;  3TO7 A;  2YUS A;  5C4X J;  3FXJ A;  3GTG J;  1MBK A;  2BE5 F;  1LUJ B;  2LRD A;  2O61 A;  1JUM A;  2K9S A;  2Q2E B;  4DBR A;  2DAO A;  2Z1D A;  3P9K A;  4KJZ A;  3LNQ A;  2OPT A;  3RTR A;  5IYB J;  4U0V A;  1LFU P;  1ZGW A;  2B9S A;  2LRE A;  1JXS A;  2HOS A;  4J00 A;  4A5N A;  4A3C J;  4HSR A;  4M3D A;  4A69 C;  1XDU A;  3C2H A;  4MTE A;  2L7M P;  4HV5 A;  2VJ4 A;  1S29 A;  1U2W A;  3CJN A;  3OYB A;  3BTL A;  2XRO A;  2X6Y A;  2FSW A;  1TW2 A;  2K27 A;  4RAY A;  2VQG A;  1T0F C;  2E71 A;  1JHF A;  2KDZ A;  4RAF A;  1P2F A;  4UXN A;  3IHU A;  3I56 I;  1SD4 A;  1AHD P;  2CJJ A;  3WOD F;  4BXU A;  3BT9 A;  1HKT A;  1BIB A;  4AYB N;  2D1H A;  1ZLJ A;  1VQO I;  2IBD A;  3JRH A;  1D0Y A;  4BHP A;  1H9T A;  2DTZ A;  2DW4 A;  4AWX B;  1CF7 B;  3A2K A;  2H27 A;  5E1Z B;  3WGG A;  1C0W A;  4HG2 A;  3FXK A;  4C3H J;  1ZN2 A;  1ACI A;  4UVB A;  4XR6 A;  4E7Z A;  2K5C A;  3HOS A;  2PN6 A;  1J5Y A;  5FKK A;  4ZYG A;  1RUO A;  3H5N A;  1KQ0 A;  4RM2 A;  1Z77 A;  1VQ9 I;  1JT6 A;  2ELH A;  1G3W A;  3CUO A;  1HLV A;  2W25 A;  1V5F A;  3OYA A;  1WSU A;  1G6N A;  1H9G A;  4QIW N;  1Y39 A;  3FK7 A;  1W5C C;  5J1Y A;  3SDB A;  5LBQ A;  3BG6 A;  2O03 A;  2DA5 A;  5GPA A;  3Q0V A;  3BR6 A;  1U9O A;  4UB8 C;  2DMT A;  2KIS A;  4G8X A;  2E2I J;  2M5W A;  3BDD A;  3SDG A;  2R92 J;  3VYR B;  1I5Z A;  3BY6 A;  4LG0 B;  2K9M A;  4P9U A;  3OL4 A;  2AXT C;  1YIJ I;  3MKW B;  2KRH A;  2V9V A;  1QA6 A;  4XK4 A;  4AIJ A;  2EV5 A;  3CCM I;  3ZR8 X;  1XPX A;  4A3L J;  4Q48 A;  1GVD A;  2UZK A;  2YX4 A;  3JRD A;  4ZTF A;  1MW7 A;  4RB0 A;  4HDV A;  4LMY A;  1D1C A;  4FX4 A;  3PNY A;  3FMS A;  1CQT A;  2MLK A;  3RKQ A;  2O3F A;  4A3M J;  2L5Q A;  1KQ8 A;  2ECC A;  2VBZ A;  3B6C A;  2F4I A;  2F5C A;  5J6X A;  5F0H A;  2Z99 A;  1ON1 A;  1VQ4 I;  3K69 A;  2W57 A;  1HKQ A;  3I59 A;  4LD5 A;  1LJ9 A;  2V9P A;  2HOE A;  1MH4 A;  3Q3S A;  3U1D A;  3OSG A;  3ZPL A;  4BEH A;  2O5R A;  1R58 A;  1ZRE A;  1O3T A;  2LF7 A;  1T6S A;  3J81 K;  4G9Y A;  2NRA C;  1EH7 A;  3H0G J;  1B72 B;  3L1P A;  3V8K A;  3CC2 I;  2G7H A;  5ED4 A;  3AL0 C;  1ITY A;  1D5Y A;  5HVQ C;  3A01 A;  4IHW A;  3F8C A;  2XGC A;  3BCB A;  1X3Z B;  3HBL A;  3A02 A;  3Q5F A;  4O6J A;  1BC7 C;  2NNN A;  1MNE A;  4BQO A;  1ETO A;  2I5U A;  1I1S A;  5E20 A;  1LEB A;  5FRM A;  1RES A;  1VZ0 A;  1RPW A;  2KRF A;  1FEX A;  2K9Q A;  4M72 A;  4X1E A;  3DPT A; 
#chains in the Genus database with same CATH homology
 2OTL I;  1FOY A;  3I55 I;  3I56 I;  2E35 A;  1VQO I;  2QEX I;  2E36 A;  1VQM I;  1FOX A;  5GAE J;  2QA4 I;  1ACI A;  2FOW A;  2ZJR F;  1VQL I;  3CCU I;  1VQ9 I;  1FOW A;  3CMA I;  5GAG J;  4IO9 F;  3CCQ I;  3CD6 I;  1MMS A;  1Y39 A;  5GAD J;  4IOC F;  3CCS I;  1YI2 I;  1VQN I;  3CCJ I;  5DM6 F;  2H8W A;  2E34 A;  3G6E I;  1YIJ I;  1YJW I;  3CME I;  1QA6 A;  3CCM I;  3CC4 I;  4UY8 I;  3CCE I;  3G71 I;  2K3F A;  3DLL F;  5DM7 F;  1VQ5 I;  3J7Z I;  3CC7 I;  1S72 I;  2NXN B;  3CJT B;  1VQ4 I;  1VQ6 I;  1YJN I;  3G4S I;  1HC8 A;  3CF5 F;  5GAH J;  1VQK I;  3J7Y J;  4IOA F;  2ZJP F;  5JVG F;  4V19 K;  3CC2 I;  3PIO F;  2ZJQ F;  3CCR I;  1YIT I;  3CCL I;  1VQ7 I;  1YJ9 I;  2JQ7 A;  1YHQ I;  1VQ8 I;  2OTJ I;  3CCV I;  1VQP I;  3PIP F; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...