2ZJRF

Refined native structure of the large ribosomal subunit (50s) from deinococcus radiodurans
Total Genus 11
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
11
sequence length
71
structure length
71
Chain Sequence
b'MSYLIRKAAGIGKGSSTPNKAKVGKLNWDQVLEIAKTKMPDLNAGSVEAAANTVAGTARSMGVTVEGGPNA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords ribosomal 23S RNA
molecule tags Ribosome
publication title Translational regulation via L11: molecular switches on the ribosome turned on and off by thiostrepton and micrococcin.
pubmed doi rcsb
total genus 11
structure length 71
sequence length 71
ec nomenclature
pdb deposition date 2008-03-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
F PF00298 Ribosomal_L11 Ribosomal protein L11, RNA binding domain
F PF03946 Ribosomal_L11_N Ribosomal protein L11, N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.250 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Ribosomal protein L11, C-terminal domain 2zjrF00
3DLLF 1VQMI 3CCLI 3CCMI 5JVGF 3CC4I 1YITI 4IOAF 2K3FA 1YJNI 3PIPF 3CCJI 1VQOI 1VQ4I 2JQ7A 1ACIA 3CMAI 3J7ZI 3CCRI 4IO9F 1VQ8I 2NXNB 3J7YJ 1HC8A 5DM6F 1FOXA 3PIOF 1YI2I 2QEXI 1MMSA 3G4SI 1YIJI 1VQ5I 1S72I 3I56I 4UY8I 5GADJ 2H8WA 4V19K 1VQPI 1YHQI 5GAGJ 3G71I 3CCSI 2E34A 3CCVI 1YJ9I 1YJWI 2E35A 5GAHJ 1VQ9I 1VQLI 1VQKI 4IOCF 3CC2I 1VQNI 2E36A 3CCQI 5GAEJ 1Y39A 3CCEI 3CF5F 3I55I 3CMEI 1QA6A 2OTLI 1FOYA 2ZJPF 5DM7F 3CC7I 3CD6I 2OTJI 3G6EI 2FOWA 1FOWA 3CCUI 2ZJQF 2QA4I 1VQ7I 3CJTB 2ZJRF 1VQ6I
chains in the Genus database with same CATH superfamily
1Z05A 2QGUA 2XAJA 2M4KA 2LOOA 2IAIA 3IL2A 4E7SA 3L2WA 3CCJI 5BMZA 4WF2A 4P5OA 3S14J 3WU2C 4B43A 5TRDA 2FBKA 2M8EA 5A2QK 4P9FA 2V9KA 2A68F 4MTDA 4KA4A 5M3FJ 4CO8A 1TWHJ 2M0MA 4HF2A 2MBFA 3LFUA 2P5KA 3K4LA 3TQNA 2AQFA 3V42A 2GAUA 4N4OB 4XRSA 4PK4A 3RZDJ 2CFOA 3JRGA 1XMAA 2ZJQF 2HYFA 3I59B 4BUPA 1WJCA 1JKQC 1FP2A 2JMWA 2O03A 5CQEA 3MKYB 2XSJC 4A3EJ 2DLLA 5F0HA 1T6SA 2O0YA 1XD7A 2VBXA 2YU9J 1XSDA 3IRRA 1Y8RB 2QSFX 1JGGA 4I02A 2VT2A 3SEZA 4BJ6C 1TWGJ 5KAFC 1MBFA 2CW0F 2X85A 4UVAA 4ZTFA 4ZYHA 1Z91A 1SMYF 4G7HF 2H6BA 2K9LA 1TQPA 2EFPA 4XNFA 4F92B 3CCUI 5HODA 2NVTJ 3A1YA 1O7FA 1HQCA 5IYCJ 3FKJA 3E97A 3CQZJ 5IT3A 4E7LA 4A3DJ 4Z2YA 5DCMA 1O7LA 1IUFA 2STWA 4ASNA 5D5WB 3FHZA 2XPVA 4YIIA 1PDNC 1CF7B 4BS9A 2CU7A 1JTYA 2HNHA 3MAJA 1VI0A 3VSKA 1OCCH 1YS7A 1ZG1A 1VQ9I 1XGOA 2DI3A 4KT5C 4QPOA 1AOYA 1BJAA 3IRQA 3GF2A 1XCVA 4GGGA 1XTAA 4RB3C 2R3SA 2F2EA 3KP2A 3SQNA 2COMA 2DFFA 2GZWA 2X9DA 4B4CA 1ZTRA 2OZ6A 3S93A 3J81Z 4A5MA 2JSPA 2NAZA 5FROA 4PJNA 1JE8A 2PJRB 2XAQA 2KISA 4D5CA 4XICA 5CLSA 2OC6A 3KZZA 1HKQA 4LOCA 4D9JA 3CLOA 4KIFA 4E7HA 2TCTA 4LJZF 2M9HA 3O2PE 2CV0A 3MCZA 1XMXA 1A35A 2WAQN 1R22A 2DA1A 1BM9A 3CLQA 4BKXA 2K27A 5JHFA 3QYEA 3OYMA 4XR6A 5B1AH 3OYDA 1FOXA 3J80Z 2VQLA 1MW7A 1DUXC 2P6TA 4XLEA 2VOOA 3BROA 4Y17A 3QPSA 4M3DA 2EJRA 3RKWA 1VQKI 4AM3A 2DA6A 3JTGA 1OFCX 4M3FA 5J6XA 3OYHA 4M9SA 3EPZA 1K4SA 2GIVA 4CCKA 2CW7A 2I5UA 2DXIA 1N77A 5C4JJ 5FFZA 4BXXJ 4GFBA 1ETXA 3K10A 2XAFA 1UB9A 1TTYA 3FDYA 4A3GJ 4OAZA 2OPTA 4N0BA 1YFHA 5FLXK 1BI2A 4TV7A 4IHVA 4B48A 1IZ1A 3BZKA 3U1KA 2ZC2A 3M3YJ 2R7ZJ 3J81K 1YI2I 4UB8C 1ZRCA 2CG4A 2X6XA 2LY1A 3TMOA 4G7ZF 3AG2H 5E1WA 3DU6A 5IP9J 4M9ZA 2LK2A 3HUGA 3OSFA 3J7AO 4H4KC 3HOXJ 1I6HJ 5TJJA 3CJTB 1R1UA 1FJLA 4I98B 3PUBA 2UV1A 3GEZA 2ZMEC 1ZN2A 3V8LA 1YW7A 4E7KA 4FTHA 3E5XA 4X0GA 3PIOF 1BN5A 3ZQ7A 1WFXA 3T0YA 4E7IA 5ED4A 4XRMA 1XGNA 2XF5A 3K4MA 2H6CA 1Z21A 4PUSA 3FXJA 4Y15A 3WODF 2IS1A 2XGXA 5FLMJ 4DNCA 2VLAA 2MD5A 4BHBA 2HQAA 1PP7U 2V79A 1AKHA 4FASD 1SD4A 4O5VA 2X1EA 2O61A 1IN6A 3CJQB 3M8EA 1UZCA 1DGRM 5DD8A 2K85A 1TW3A 2ME6A 3JRCA 1AKHB 3J7YJ 1EA3A 2D5VA 5IT9Z 5JHUA 3VDXA 3LSPA 4XLFA 4IQJA 1RPWA 4Y52J 4G6QA 4M6YA 5ICFA 3MFKA 3S3NA 5E8IA 1GDTA 2XHKA 3E6DA 4UUSB 2HS5A 1ZRDA 4HG2A 4YIFA 2F6CA 3W6VA 1I6XA 3IKTA 3EYYA 5KAIC 4I2OA 4XSXF 1MMNA 1V3FA 1SVOA 1K6YA 1S29A 4XLHA 1ZAOA 1HDDC 3I9V2 3PO2J 3GTJJ 5FKNA 2V1XA 2Y2ZA 3H1CA 3G4SI 4XK4A 4Y7NJ 2E60A 3HOYJ 5KHDA 4KMUX 1IF1A 4LK1F 4PDKA 4D1QA 4Q4ZF 1R7JA 6PAXA 1YOVB 5C4XJ 1F36A 3DKYA 3BTCA 2ZJPF 1X3WB 5DEQA 2HOTA 3CJNA 1R36A 4MNUA 3M1EA 3IH4A 3L7WA 1IN8A 4XBFA 2WAEA 1TL8A 4M3GA 1BR2A 4UUVA 4ZZDA 1ZGJA 1R9TJ 2VONA 1S3JA 2YX4A 4AYBA 2VBWA 1SC7A 1I3AA 3ECOA 4NQWB 3TW7A 5FKOA 1IAWA 1X1CA 1JUSA 2D45A 1HDPA 2KIUA 2VT3A 4PSWA 3RQ4A 1MZBA 1HBXG 4EM0B 5F04A 2E71A 1O3QA 1MNEA 1YW9A 1JHHA 3VYSB 1IDYA 4HLXA 4C2MJ 4I6ZA 2IVMA 3K1PA 4CZZA 4E7JA 1YJNI 2VQCA 5F27A 5DCFA 2LTPA 3ECHA 4IRHA 5LHHA 2FUG2 4ESBA 1NTCA 2FQ3A 3HTUA 5BPDA 3P5JA 3QPTA 4CCJA 1WGXA 1KQ9A 3CUQB 4XKCA 2VJJA 3OL3A 3OYIA 4XRFA 1U3EM 1ITYA 3K1NA 5LGNA 3K4JA 5LHGA 1MBKA 5EG0B 1QVTA 1TWFJ 2KZGA 3AL0B 1QVUA 3RKYA 1LEAA 1IJWC 1Z9CA 1HSJA 5EG0A 2JA7J 4HPQA 1A36A 3HRUA 1VQOI 4CCNA 2K3PA 1HKTA 3K4NA 4E7ZA 2OZUA 1X3ZB 2JRTA 1XX5A 1U8BA 3I56I 2GA2A 1B9NA 3I58A 3V8KA 4KNYA 4RLQA 4J01A 3JRFA 3ULQB 1J5YA 4RB0A 2JPCA 5ERIA 2DFIA 1QZEA 3ASNH 3WTXC 3DQVC 2JPBA 4DYRA 9ANTA 3FBIB 4OIQF 4RGRA 5LRSA 3HOVJ 2J5OA 3BJAA 4UHTA 5LGUA 3M07A 3TGNA 1W5SA 1ZR2A 1IN7A 1BJZA 3MZ8A 3SZGA 2R7DA 2EIMH 4JQFA 4IEJA 3I71A 3H5AA 3MD2A 3WHBA 3LSIA 3HSEA 1MBGA 2EFWA 3BJOA 2DCEA 3HOWJ 3K0LA 3KLOA 3IWZA 3P7NA 3CC2I 3IUOA 2BGCA 5E3LA 1T39A 5CKTA 2F4MB 1TQIA 2FNAA 2LFBA 2ZXWH 4BL0B 1IDZA 1LEBA 2EBIA 5D4SA 4M72A 5DS9A 2R7VA 3KP7A 3BR2A 3F3XA 3LOCA 3ZQCA 4B09A 4A6DA 5FLXZ 5DM6F 4FQGA 5EZHA 1K4TA 4MLOA 1BBYA 1D1AA 3K4KA 2GLOA 5L3BA 2LKPA 2VBYA 5GAGJ 1UELB 1XDUA 3LQQA 4LGWA 3FK6A 1XB4A 1ZKGA 4Z6YA 2FSWA 4YRVA 4NHJA 2XF7A 1F43A 3IH3A 3M9AA 4A3FJ 1WQ2A 2EIJH 3GO5A 3PFYA 5L3GA 1T0FC 1R00A 3GLXA 4U87A 3CESA 5HNHA 1YX3A 2FEZA 2JT1A 4QIWN 2OUMA 2IS4A 4CCOA 2Z33A 1U8RA 2L5QA 1PUFB 2CUEA 3EUAA 4ZJZA 2K02A 1XCBA 1W36C 3K70D 4HNUA 2ZFUA 1LKXA 3H0DA 3L2QA 3QYFA 1L3LA 4E70A 2ID6A 3NWTA 1N75A 1P4XA 4LG0B 1BI3A 1Y0NA 2E36A 4XLAA 3U9GA 3ZPLA 4M74A 3I55I 2KIQA 5IPAA 4A3LJ 4U0YA 2BVMA 3BY6A 3GZNB 3O8GA 2Y75A 2ME0A 5F6FA 2Q2EA 3QP5A 3CMYA 4L5EA 2DO7A 2XDVA 4DYCA 2KRCA 2ZXIA 1VQ8I 1AHDP 1X58A 2GBYA 2MH2A 2L4MA 2EFOA 2CQKA 2DN0A 2V1DA 4LMYA 4RDUA 2M30A 5EYRA 5H2FC 1KYZA 1R71A 5FD6A 4NC6A 2IGMA 3G71I 3GLLA 4BDZA 5K5RA 4BE0A 1XN7A 2CUJA 2K7LA 4X1EA 3DFGA 5BOXA 2R7SA 3MEXA 3MN2A 2NS0A 4XLCA 4A12A 1UHWA 5FB2A 1Z0XA 4ITVA 3R61A 3WE2A 3E0JB 1XS9A 1JJ8C 3W6JB 4IJAA 4IHWA 4UB6C 2FXAA 1P6RA 1NG6A 3HKZN 2JTVA 3QQAA 4QWQA 2MC4A 3PQJA 2L9SA 2GXGA 4K2EA 3EUHA 2VBZA 1ZHFA 4I0AA 1FYKA 4PZJA 3FM5A 3EETA 2FX0A 2VQHA 1ZG5A 2F4IA 2LH9A 1TBXA 2ZFWA 3S2HJ 4MEXF 3CCQI 5GAEJ 2M4GA 2H1KA 4GDFA 1JKOC 3VEPA 3F0CA 2P5LC 2CRGA 2A6TA 2E2HJ 5JVTA 1B9MA 4HRIA 3Q0UA 1Y8QB 2GOXB 1L0OC 2ZMEA 3I4NJ 5DTDA 1FMVA 2IPQX 2HDDA 1KA8A 3H3UA 3AG1H 1ZRFA 2EZLA 3W2VA 4C3JJ 3VYUB 2QENA 5EEGA 3HSRA 1BC8C 4ENJA 3LA3A 3IWFA 4WCGA 1YRNA 2NRAC 4U7BA 2WA0A 2E34A 2LREA 1YW8A 4D7NA 5EGOA 1WI3A 2A3SA 2LY9A 3GFMA 4A3BJ 1MBEA 3CMEI 3BR5A 3FK7A 3OS2A 4G6DA 1ZGWA 5DCMB 1FTZA 2ETHA 4XONA 2QUFA 3KZYA 3R6SA 5HDKA 2R0QC 5JVGF 3LAPA 4ENKA 3BG3A 4EGZA 4BH9A 3BR1A 2AXLA 3V7SA 2EINH 5BPIA 2P81A 4JYKA 5FJ8J 4MFEA 1DP3A 4RLFA 1LNWA 4HF0A 3DU5A 4LD5A 1MNDA 1WVRA 1MSEC 4LK0F 2P4WA 3F72A 4S04A 2NVUB 1HSTA 2W82A 3MKLA 1QZYA 3PNTA 2VIXA 3GFJA 1W5TA 2K9MA 3HL2A 3JSPA 4MIMA 1WPKA 1RRJA 1R1TA 2ZJRF 1T56A 1S5LC 3I59A 1DU6A 1RETA 4L5IA 1OCPA 2BXYA 2Z5UA 2PEXA 5FFXA 2RREA 3Q3SA 2HKOA 2ID3A 4Q47A 3ZP5A 3C18A 1XPXA 2ZKZA 1FSHA 2VKHA 3LSRA 1QHHD 2BVLA 1WSUA 3RYPA 3KZIC 2HDCA 3M1CA 2NVXJ 3Q9VA 2VB6A 4RB1A 3MWMA 4WXCA 1XGMA 2E35A 2XV4S 1F5TA 2F5CA 2UZKA 1LE8A 2RQQA 4ESJA 5IT9K 3OS1A 1IRFA 3O8HA 3NEUA 4GYIA 2XC7A 1UCRA 3OMYA 2B9SA 3PL8A 5M3MJ 3V4GA 1IUYA 2K40A 1ETKA 2EQRA 2EV5A 5IYBJ 4IX7A 3OS0A 4CCLA 1JUPA 1Z7LA 2LRDA 1FZPB 2ELJA 3BOQA 3HHHA 4RAYA 3I3LA 2HDWA 5K1YA 3HHGA 1UJ8A 2Y0MA 4A93J 4U88A 2H8RA 2ZSIB 2Z99A 1SFXA 1PUEE 3EYIA 1FPQA 1UMQA 1ZREA 2W24A 3V7CA 2JA6J 2CSOA 4ETSA 2VJ5A 2P5VA 1XDSA 3CTAA 4HA8A 1ZYRF 1X1PA 4RGSA 5KNLA 5TGTA 4M73A 1GVJA 3ABUA 2X0LA 1O3RA 3U21A 2HPMA 5B3SH 2A07F 2E19A 4BJTA 5CVJA 2DAOA 4IRGA 1E0EA 1P2FA 5J47A 5CQGA 3IC7A 4CH7A 1T08B 2BHZA 2DFHA 2DT6A 1MIJA 1Y56A 1MJ9A 3IV5A 4PJLA 1M1EB 1C0WA 2EPFA 3WG7H 3JRDA 3VYRB 1Z6TA 1H88C 3DBHB 1FSEA 1RZ4A 2CQ7A 4IXAA 3A01A 4A0YA 3CDIA 1JHFA 3KYCB 2JVGA 4C9YA 2FA5A 4MEYF 1HKSA 1B72A 2DDBA 4U0VA 2DTRA 2G0EA 1TQMA 1KQ0A 2JA5J 1S7OA 2DU9A 4BU2A 3S1MJ 3DXJF 4IHSA 3CMAI 4DQ2A 1K78B 1YIJI 3GX4X 5F0FA 4V19K 3P9IA 3GTGJ 2Z9OA 3H5RA 2FQ4A 3L2CA 5E3OA 3KX2A 3J80K 2LKSA 2H94A 3V8JA 1WWXA 2N8GA 5CJ9A 1ON2A 3SYTA 1O3TA 4AD9A 2KMUA 1S9HA 2CO5A 4E4HA 3AKZA 3PO3J 1X4OA 3OYJA 1DGWY 1ULYA 2Z2SB 5GTIC 2EZHA 5KK1A 1WJEA 4JK1X 1XGSA 3HOUJ 3BLYA 4HEA2 2XF6A 4R79A 1SEUA 4S0HB 2WB1A 4BQNA 3E5UA 1X4PA 2DA7A 3BR0A 4BHPA 1IC8A 4DJAA 1K6OA 4PCQA 3W2WA 4B3AA 1U0JA 4FISA 2AO9A 2I10A 4MGRA 3QU3A 2IA2A 3MKZA 2R7UA 3R0JA 4P1WA 5C3EJ 5M5WJ 3L1PA 2XASA 3PIPF 2JQ7A 2HXOA 1BI1A 3HOTA 3GXOA 4BQOA 3FISA 4BDYA 5J4YA 3OYKA 4ENNA 2BBYA 4IF4A 3BTLA 3OWTA 1G6NA 1WJFA 1OCRH 3GW2A 3A0BC 2CQXA 2OV7A 1T98A 4OIOF 2G7HA 3IH2A 1HW2A 2R5ZA 3HOZJ 3G6EI 1G3WA 5GPAA 1QBJA 2GOMA 2LNBA 4OIRF 2PFBA 4I09A 4II3A 3GFLA 5HNFA 1FC3A 2RGVA 3SDBA 4IHXA 4DIQA 4Y13A 3CMMA 2KIMA 1V5EA 4GYGA 2WAFA 4RM2A 4XOPA 4BACA 2MH9A 3KEYA 3FXRA 2JVHA 1T2KA 1HW5A 1SFEA 4O3MA 4EQQA 1D1BA 3TDUC 3R60A 5IOYA 1D0XA 2XROA 1LFBA 2KJBA 4X6AJ 3OR1C 2ZNZA 4BJ5C 3KYLA 5C44J 2RNJA 1GXPA 1T33A 1E2XA 3FXQA 2XAHA 2CJJA 2G9WA 2Z16A 3HBLA 4M9XA 2R5YB 5CPRB 2DT7B 3LAJA 2GWRA 2WAQA 1PUFA 2M45A 1QZZA 2P6SA 2HI3A 4WX9A 1OCOH 1P9QC 4CYCA 2Y9YA 4I01A 2Y30A 3ZN0A 1D1CA 2LR8A 2VC1A 3LFKA 4V2GA 4ZDOA 2E1NA 3BG6A 3JRHA 1W0UA 1QO0D 3UR3C 3FXOA 4RAGA 2UUZA 3DKXA 1S7EA 5DUKA 1O4XA 2K5CA 3QAHA 2QQ9A 4PFOA 2XPWA 4KN4X 4GCVA 2O8XA 4HDUA 4AIKA 3ZMTA 5M5YJ 3BCAA 1MJAA 3ZXSA 2NVQJ 1D8JA 2ZMEB 2DMTA 5EZGA 1OCZH 3PJRA 2X48A 2KKOA 1IN4A 2VQGA 5BQTA 5ICCA 1VQNI 1GV5A 1R49A 2YS9A 1OLTA 1NK2P 2UXXA 3FMSA 3RPQA 2MLGA 2BXZA 2GIZA 3BWGA 5FRMA 5EEAA 2A5WA 2DTZA 2MW8A 1PYVA 2G7UA 3B02A 2FOKA 1JTXA 4PJ0C 1Z3YA 3ZQIA 2KHMA 3TP3A 5HOOA 3WHCA 4OIPF 1HOMA 1JKRC 3ZMUA 4UY8I 5GADJ 4BAYA 2JUGA 3I54A 2VPRA 1MH3A 4LFUA 4EVIA 3C7JA 2D1VA 3H5NA 3BPVA 1USTA 4HF1A 1SD5A 3CF2A 3K69A 3IAM2 2EA4A 2VN2A 2HGCA 3H92A 1T95A 3A0HC 3BTIA 4DZPA 3H3VK 1YQAA 3MZYA 2OD5A 2FBIA 3DWLE 2Q8KA 4NNJA 4FHTA 3TO6A 1OISA 2V4JC 2ZXHA 3O3KA 3QODA 4AVZA 2LSOA 1MH4A 1FP1D 2AHQA 4EJWA 3W3CA 2BW3A 2V6CA 2M7AA 1LVKA 2QQAA 2BY2A 3BT9A 5J1RA 4HX7A 2MSYA 4B1RA 5D8KB 1FWZA 3K2ZA 1D0YA 5HDNA 5TISC 3S32A 3CCEI 3RIRA 2M3AA 4P96A 1E3OC 5FKLA 2DMPA 2O3FA 2ACJA 1FOWA 3K2AA 2IRFG 1W1WE 4BY7J 3SDGA 5J1YA 4NDLA 2WY7Q 3HXLA 3AAFA 1ZLKA 1F1ZA 1J7KA 4I0BA 2KQRA 4J19A 2UWMA 2E1OA 3HG9A 3HTSB 1HA8A 2VC0A 1SAUA 1BOAA 1Y0UA 3B6AA 3G1MA 4AIDA 3F9KA 5F08A 3ZQQA 1IV8A 2HTSA 2OCEA 5CVIA 2DT5A 2O9LA 2IGOA 3CCVI 1YJWI 1VQLI 2K9QA 3PSIA 2KRHA 1JXSA 3S1NJ 2JJ7A 1ORKA 1B8IA 3VODA 2XGDA 3DTIA 2PMZN 1XG1A 2CS3A 1BIAA 4LLNA 3S15J 4EJTA 4F93B 4AU7A 3C3WA 2EZIA 1IO2A 2HYGD 2LF7A 3PFIA 3RKXA 4WK8F 3WU1B 3FXLA 1TT0A 3OIQA 4XLNF 2RDPA 1OR7A 4NQWA 1E3PA 1KZHA 2CQQA 1UHSA 2KJCA 1W36D 4HOBA 4IRIA 3P9CA 4C2UA 2WB1N 1R6RA 2MG4A 3I5UA 1YLFA 3SHFA 3T1BA 1GHCA 5E79C 4CZCA 4AVPA 5BS6A 2IS2A 3HJEA 2TDXA 1DQUA 4G6TB 4XN3A 2ELKA 3GTMJ 2R4GA 3E7LA 1Q1VA 3D5LA 2FMYA 3WG9A 1WZ2A 2L02A 3AFHA 4XMYA 5LRRA 3BG5A 4ESFA 1NH3A 4BY1J 2RVCA 1LFUP 2BYVE 1P7IA 4U0WA 2K4BA 1A31A 2XB5A 4A0XA 2HQRA 1YHQI 1GT0C 3GCMA 4IQ4A 1POGA 2X51A 4YELA 3HRTA 4PSXA 5HVQC 4CCMA 1B8IB 2KDZA 5HLGA 2M87A 5EF6A 2WC2A 5LEJA 1VF9A 1GXQA 3N97A 2HZDA 3WTUC 4UNOA 1Q1HA 3L00A 4I99C 5FKKA 2KT0A 1ONVA 4YFKF 2K86A 5CYVA 4XORA 4CA0A 2BOLA 2XKOA 3X2QH 3DEUA 3EDPA 4BBSJ 1DPRA 3ASOH 1ZGAA 2BW3B 2Y48A 2H1LA 3KE2A 3ABKH 1MD0A 2VOPA 4XLPF 1FOYA 3DKWA 4HDVA 3RKQA 4B44A 1ETWA 1SFOJ 4MHGA 5H6QA 1B4AA 1Z7UA 4KISA 2QKMB 3CCMI 2EH3A 3BZCA 1YITI 1I3QJ 4QSHA 3L2UA 3ZMVA 3CCRI 3RI4A 2F5FA 2HTJA 4ZC3A 2WY8Q 1I1GA 1X2NA 3CDLA 2NNYA 4AUXA 2EB7A 2VXZA 4BNCA 1XSXA 4HZFA 2JK3A 1W0TA 2VI6A 5IP7J 4BQAA 2L7ZA 2AXTC 5J8CA 1U6GA 4QTRA 4IOCF 1LQ1A 4OMZA 1WHUA 4C30A 1U9NA 2YUSA 2QBYA 3B73A 4XQFA 4LIUA 3RSNA 4J00A 4OAYA 5DD4A 5H6RA 1NHAA 4XKVA 4YG2F 3KP4A 2V1UA 5E3MA 1USSA 3LSKA 1R5GA 1I39A 2PQ8A 1S72I 4A0ZA 2YPRA 2LBFB 3G3ZA 4C2TA 5H20A 4UUSA 5D5XB 1WH7A 2E2JJ 1DPUA 1ENHA 2I8DA 1W7PD 1B1BA 4FETA 2LKXA 1KQ8A 5HS9A 2EV6A 5E8GA 2VKDA 4N4NB 2MA3A 2HOSA 1BR1A 2ADUA 2XKPA 1W7PA 5L3EA 2UXNA 2L7FP 2DQRA 3F21A 1ERDA 2GQQA 4GO1A 2HU9A 2PMZA 1MMSA 4XSZF 5A2QZ 1LDDA 4EJVA 1SMTA 3ZMDA 1HF0A 4OOIA 4I76A 2VE9A 3FXKA 5JI6A 3TBIA 2EV0A 3H9JA 3S1RJ 3Q5FA 3QOPA 1ETVA 1WRJA 5K5QA 1TC3C 3GBGA 3E6BA 3MMYB 4RBOA 2R7TA 3F6OA 2VPLA 2HZTA 3ELKA 3NARA 1OCTC 1NG7A 3GFIA 2W25A 2DQLA 3DPUA 2DK5A 3QWLA 3ESWB 3G73A 3VOEA 4L18B 2XGCA 4F55A 3LA2A 2NXNB 3EUHC 5J4VA 5LHIA 2LC2A 3CUQC 4N9IA 5AONA 1GVDA 2A05A 3FF5A 3K70C 2FNPA 2P0WA 3GUDA 1V55H 4W97A 3HGYA 3TL4X 2KFDA 4FX0A 2LG4A 3BZ6A 2O8KA 4XN0A 2DOEA 4KYWA 1V54H 2YU3A 5GP9A 1G59A 1DDNA 4EGYA 5ILVA 1YTYA 2DA3A 4JBAA 5ILSA 4IHYA 2MC3A 2W1OA 4HQMA 4ZYDA 4F52A 4XM3A 4ANJA 3CZ6A 2FD5A 1P4AA 1FIAA 4W1UA 4YFNF 1CF7A 5J3LA 4GXOA 2L3DA 1IXRC 1KYWA 2ISZA 2O7OA 2DOAA 2K9NA 5AIQA 3Q9SA 4L5JA 2M2EA 3NWSA 4M6XA 2PN6A 4HQEA 1Y39A 5L3FA 1N78A 2Q1ZB 1XSVA 1GV2A 4CDGA 3F6VA 3CJRB 3GVAA 2HOEA 1MMAA 3CUOA 3GTPJ 3HKZA 1FYLA 3ZQHA 1S8NA 2BHYA 3F8CA 4CHUA 3JTHA 4JX5A 2ELHA 1YRNB 3DV8A 1FT9A 4HSRA 3KEQA 1TNTA 1QPMA 3K1MA 3ZRGA 3ZMZA 3S1QJ 2H8WA 3U1DA 3HYIA 1LE8B 1I1SA 4JX4A 2E1MC 2DJIA 4FCYA 1SFUA 3MZHA 1WI9A 3KCCA 4KIGA 3R4KA 2QYOA 2OJED 3GWZA 2Z1DA 5E1XA 2EFNA 1A6QA 4PJMA 4F7ZA 2L9NA 3P9KA 3SZTA 3FWEA 2NS8A 3LSHA 2R92J 5LLQA 2VKEA 1Y1WJ 3D5SC 2Z3YA 3F8MA 1DP7P 1E17A 2EFQA 5ICEA 3PM1A 3OV8A 4HBLA 3BQZA 4CYCB 3JAMZ 1MMDA 1KU9A 2XAGA 3GTQJ 3D5RC 1TW2A 3DCFA 1OPCA 1K78A 3OOUA 4ZDPA 2DA2A 4OMYA 2R7OA 3SZPA 3ZQLA 1G8XA 1TNSA 3LQRA 1E3HA 1GUUA 2PMUA 1JJ6C 1Z1DA 2EIKH 1VQ6I 2DBBA 1REPC 3A03A 2ZJ2A 1A6IA 2A5YB 4G94A 1MGTA 3BDDA 3FMQA 2DYRH 2DYSH 2HQ5A 1K61A 5E18F 5K7FA 3VB2A 2IA1A 5BNGA 3L2RA 2H27A 2J5PA 5GAHJ 1D5YA 2X4HA 3OYLA 4WXHA 2IP2A 4CYDA 3CP2A 2PX9A 5FRNA 2FBHA 1U5TB 4EV0A 3BG9A 3FXMA 2XSDC 3DLLF 4NC7A 5B66C 2X1CA 3H9QA 3S17J 1O57A 2E7WA 3BP8A 1V4RA 1QHGA 2HPIA 3HM5A 4HV5A 4XRSG 1Z67A 3AG3H 2RC4A 3KP6A 4EMSA 2C6YA 1SFKA 3WGIA 3IAS2 5ICGA 2X6YA 2DDAA 2QSHX 3DF8A 4AIJA 4KFCA 3F23A 3DTKA 1B59A 1X3UA 3OYCA 4KDPA 1YX5A 2M1BA 3WE3A 4DBRA 2L9VA 2JZYA 3DPTA 1R5HA 2KIFA 1S7AA 3ABTA 2R5ZB 2IS6A 2IEKA 1LFPA 1XMKA 4D0PA 1OKRA 2A6EF 2ZXJA 3A4CA 2QBYB 4HLYA 1BA5A 2F4OB 3WU0A 4DZJA 2VKVA 1K7AA 1S6LA 2K4JA 1SVMA 1EV7A 1D8KA 5GTHC 1VQ5I 1TT5B 3OYGA 3LMMA 2P8TA 5IP6A 3NQOA 2RKHA 5JLXA 2DMNA 5HLHA 3OYNA 2Y0SA 3ROUA 3WTVC 1IN5A 5DM7F 4I7HA 1UAAA 2HFHA 2RQPA 3BR6A 2ICWG 4AIHA 1H8AC 2V7FA 1WKMA 3R0AA 4G9YA 3OYFA 1IXCA 3J7AY 1WH5A 2A69F 4U7DA 1RIOH 5DV5A 2BZTA 1ETOA 1G2HA 1WJ5A 1U78A 3ISPA 4LB6B 4P9UA 2EK5A 1I5ZA 1OQYA 3CDHA 2AS5F 3N05A 2ESHA 1HC8A 2QEXI 3O6BB 5E20A 1HXDA 4D5FA 2VE8A 4LG0A 1YE9A 1BC7C 4EATA 5LEKA 4BYYA 2Q0OA 4A2UA 3K7AJ 3T8RA 2DA4A 1XC5A 1T8IA 3GTOJ 4V2FA 3KP5A 3H9GA 3GZ6A 1U5TC 4YIRX 3S2DJ 1FBSA 4A3MJ 3H0GJ 4MQ9F 3UNGC 1X2MA 4E6KG 2FF4A 2OA4A 2CUZA 4XIDA 3WTSC 1X1DA 4Y33A 3ZOBA 5F1RA 3D1NI 3VSLA 5ILUA 3E6MA 2DMUA 3ZQFA 2E7XA 3KFWX 3FXUA 1K83J 4XOTA 1NK3P 1F4KA 1RUOA 4M3BA 5KVRA 3B6CA 3C2GA 4A3IJ 4F91B 1BL0A 3NAUA 1N25A 2F5VA 2XPUA 2PBIA 2COBA 2X1DA 3DP7A 4DW6A 1MBJA 5CVRA 4ZZLA 2BY3A 2FOWA 3C2HA 4KUMA 4L0ZB 1WCMJ 1VQMI 2F5DA 1IRGA 3HGGA 1AA7A 2XRNA 3HSFA 3WGGA 4B3XA 3N4MA 1ZLJA 1RR7A 1YIOA 2B63J 2CYYA 2LDUA 4B47A 2JN6A 4Y4RA 3ZMSA 2MFZA 2KRFA 3K4BA 4HAMA 4BGDA 5HS8A 4BXFA 1FYMA 4YEJA 3OYAA 2ESNA 2WTEA 1DU0A 4RGXA 1APLC 3F8BA 1EH6A 2R7FA 3E6CC 2LLKA 1WJDA 1R4NB 4A3JJ 1VQ4I 3CO6C 3L09A 3ERMA 3RTRA 3A2KA 4CUGA 2O6GE 3D0SA 3E1SA 1RUNA 2HVSA 1PP8F 2QWWA 4ZYGA 4DOZA 2DA5A 1FX7A 4BQQA 1YJ9I 3RQIA 4JOMA 2M0CA 4HNTA 1D5VA 3CC7I 4FT8A 3F22A 2D1HA 5HS7A 3TP0A 3VFZA 2A6HF 2KZVA 5K7ZA 1HW1A 3WTWC 5D6FA 1FLIA 4CICA 3KIOA 1ACIA 2MLKA 5M5XJ 5LGTA 2NOJB 1Z77A 1LDKB 4NBQA 2JA2A 4HW0A 2L4AA 2Y0SN 5JFRA 1RC9A 1ZELA 1H0MA 3CCYA 5K5OA 2JUCA 2OF7A 2IW5A 3I64A 2OQRA 2QLZA 5E17F 3QRFF 1CGPA 3M8FA 2LVSA 1H9TA 5EEHA 1QGPA 5HLIA 4ON0A 5F64A 4DYQA 3J7ZI 2L54A 1FMWA 2E1CA 5CVVA 2NVYJ 2QF7A 3COAC 1P7JA 2OCCH 2XAUA 2IT0A 2CFXA 1EH7A 3KYDB 1BR4A 3A01B 3IKVA 4JX6A 4RB2C 1TWAJ 2M7BA 1W7PB 2R5YA 1LPQA 3ERED 1BW6A 2K9SA 4RAFA 5DDGA 1OYIA 5HLTA 1G3SA 3FIWA 2O5RA 4FE7A 1H9GA 3T8TA 3JRBA 3RJPA 1X1BA 1SD7A 2IBDA 1CQTA 1BOBA 3HDDA 1EKEA 4KJZA 1R1VA 3RCOA 1D3YA 3G1LA 2HWVA 3IP4B 4BBRJ 1R5ID 2V9VA 3DTEA 4MFDA 3DBLB 2XVCA 3OIPA 3WTZA 3BPXA 5FO5A 2KDOA 2L0KA 2NOGA 4RM3A 3DEWA 3FMRA 4UUTA 2GM4A 1MBHA 3CF5F 4UV9A 3ZQGA 1MKMA 5F1JA 4O6JA 3JRAA 5DYMA 2R7WA 3FHNA 2DFEA 3OR2C 4ZDLA 5FLVA 2RN7A 2XUBA 1FY7A 3CC4I 2FE3A 3JREA 3I4PA 3PSFA 4BHCA 2DPDA 1G3YA 3JR9A 4HYEA 2HXIA 1ZH5A 3FX3A 4IO9F 1IRZA 1SANA 1JKPC 4C3IJ 2LYCA 3BC8A 4KIBA 4DBQA 5LFAA 3RZOJ 4OINF 1IG7A 1I50J 1R23A 1STZA 2HR3A 4WXDA 2W48A 1IRXA 1SAXA 1J0RA 1Y1VJ 1FBUA 3WTTC 3KP3A 5DUIA 4IHTA 3QOEA 1JUMA 1UHMA 4A3KJ 2CUFA 5EGOB 2CV2A 2RNGA 2Y69H 1ZARA 5D6EA 4AC0A 3LA7A 3ML6A 3U2RA 3JCUC 2OAZA 1J2XA 4BE1A 5LBQA 1HLVA 3FZVA 3W6KB 2HVQA 3I0TA 3TO7A 4ZYEA 3BQYA 1OYYA 1U5TA 2QVOA 3QP6A 4P55A 5F0CA 4UVBA 3S3MA 3EQLF 2H09A 1V5FA 2V1NA 3PNVA 4UVCA 2MABA 3DPLC 5D8LB 4KITB 1GLNA 3M4OJ 2W00A 1KGSA 5D5VB 3ZCOA 2GXBA 3KLNA 4LLGF 1ETQA 4ZTJA 3HZJA 1FIPA 3L9FA 2W57A 1ODDA 2HEOA 2ECBA 2XIGA 2BY0A 4M6VA 4ABZA 5D5UB 2CWEA 3HRSA 3HC7A 2W4SA 2YX7A 2CH0A 5FGMA 4II2A 3RPUD 3ZR8X 1J9IA 2QM3A 3SFIA 3F8FA 2V26A 2BV6A 4L9NA 2FJ1A 1QQIA 3TO9A 3OIOA 4CGZA 1T0FA 3NRVA 4Q48A 2PJRA 1SD6A 2X6OA 5JR3A 3LSTA 3DLAA 2WADA 2FRHA 1IXSB 4MO7A 4NUBA 3TW6A 3BG7A 4UXNA 3QU6A 5EDNA 3PNYA 3FKIJ 2ZO4A 2X6WA 4MTEA 2DK8A 4DGWB 1QNTA 2LY2A 3MKWB 4PGGA 2ZBKA 1Y6IA 2VASA 4L9TA 4RAZA 1VZ0A 3G1OA 1IW7F 3C2BA 4NC8A 4CXFA 1P92A 4L9JA 2HVRA 1MJBA 3HEFA 1U2WA 3LNQA 2WWYA 4EM1A 2RV8A 3GMEA 4A69C 3HOSA 1OR7C 3CP8A 1H89C 2ZB9A 4IZZA 3CD6I 2OU2A 2F48A 2OTJI 4RS8A 1LUJB 3LSMA 2A61A 1J59A 1MMGA 2HKXA 3AG4H 3LL7A 2B0LA 2VJIA 4G12A 2TRTA 2ECCA 3LSJA 2Y9ZA 2QQBA 2WV1A 1TLHB 3TDZC 3ABMH 1FOKA 5FKMA 5J40A 2R7QA 2MYSA 2E2IJ 1RKWA 2R7RA 2CV1A 3SXYA 3ZGKA 4R8HA 3K9TA 4BXUA 2VL8A 2D2WA 2E5NA 2KP6A 1LB2A 2L7MP 1Z3XA 3TOBA 1VFCA 2NYXA 2W7NA 1FEXA 1IGNA 3SEQA 2OQGA 4CSWA 1U9OA 1KU7A 1VQ7I 2QA4I 2PG4A 3BR3A 2QQ8A 3FBNB 5HDGA 2STTA 3LWFA 2DW4A 3KETA 5E1ZB 4UV8A 3V7RA 4M3EA 2AQEA 2NS7A 1R4MB 5L3DA 5JLWA 1T38A 5IOZA 2V6EA 4HX8A 1YG2A 1MNMC 2QKLB 4HV6A 1MDMB 3I4MJ 1RESA 2JRMA 5FD5A 3REOA 1KU2A 2YR2A 3DBRB 4JP0A 3S3OA 5CVUA 2HQNA 2P7VB 1YYVA 5D4RA 4A3CJ 4FE4A 3VWBA 1ETYA 2EWNA 3F8NA 4KN7X 2JSCA 4R1HA 1LDJA 3WTYC 4XKBA 4NB5A 4G8XA 2LBFA 4YFXF 1JT0A 1X19A 3M7GA 2HOAA 3KEOA 1X1AA 3ONQA 2EILH 3FM3A 2IA0A 3H3ZA 5B1BH 1TWCJ 4QLCU 1EF4A 3C1DA 1EH8A 3GYHX 2PMHA 2PI0A 2CW8A 1B6AA 3Q0WA 1BW5A 2VODA 3OOPA 3RDIA 4AYBN 2VUMJ 2BEOA 1JGSA 4IKFA 2DOFA 2XB0X 3JSOA 4KMFA 3RYRA 1LVAA 1W4MA 3K6GA 4ZYAA 3HIFA 3S16J 4EJOA 3QPHA 3BTJA 4HNVA 2PJPA 2E1MB 2WV0A 5J1UA 2OBPA 2L9RA 2FU4A 3ZN1A 2W85A 3EUKL 1UG0A 2CGPA 2CMPA 1PVEA 3GTLJ 3OYBA 4BE2A 4ENMA 2IGNA 3L2VA 2GA1A 3M8JA 2OTLI 3GZ5A 4EM2A 2LMDA 3IHUA 4OU0A 4WWCA 2Y31A 1QPIA 2CQNA 3OSGA 1KU3A 3KPHA 1YS6A 1SVLA 4OWRB 2V9PA 4IOAF 3QPLA 1PJRA 3TKYA 1A04A 4RGUA 1LJ9A 1IV6A 4S05A 1FTTA 4RA2A 5J8FA 1K79A 2JA8J 1R58A 4LLLA 1ZQ3P 1W5CC 4KT6A 3S2WA 1MSFC 1EJ9A 5LD2C 4BEHA 3VPRA 4FX4A 4A6EA 2IJLA 3K4CA 1YO5C 4B8XA 1RI7A 2NNNA 4N9HA 4PJJA 1AU7A 2LP0A 2LD5A 3BJ6A 1J75A 1F9NA 2IXSA 2PLYA 3OY9A 3A02A 2XGEA 1D0ZA 3S8PA 4ZH4F 3HPGA 2R93J 2RAEA 3E3VA 3LSGA 1A5JA 2DPUA 5IYDJ 2KPMA 3JAMK 3HRMA 2JWTA 1O3SA 1RKTA 2L7KA 3Q0VA 1HCRA 3CCSI 3I53A 2QCOA 1AWCA 4Y3OA 4H0EA 1MDMA 2Q2EB 3CUQA 4HSTA 2LF8A 4LG3A 5L3CA 1OYWA 3ABLH 4LB5A 3WGHA 2F5EA 4HX4A 1VNDA 4EEFG 4IVNA 1RR8C 2B7EA 3DEEA 2VXDA 2K3FA 2MGQA 2EZKA 5EJCA 4MQVA 3T5XA 3SFZA 4M71A 3E5QA 4KICA 5AIPA 2KLOA 1ZR4A 4L0YB 4RMNA 4XL9A 1OJLA 3OL4A 2L01A 4LITA 2MD0A 4PGHA 5E3NA 1V5GA 2L2OA 4BEHB 1ON1A 1Z6RA 3MQ0A 1OMIA 4IPAA 3TEDA 2GXAA 3PUFA 2ZCWA 5IY5H 1UG2A 4C3HJ 2M34A 3GTKJ 4AWXB 4Q5SF 3HB9A 4F3QA 3MVPA 3AL0C 1FNNA 4A5NA 4LIVA 3W2AA 4XKWA 2KL4A 2DODA 1ZG3A 3BCBA 2XRLA 1WJAA 3PQKA 2QSGX 3QYBA 1G3TA 2EA2A 2WBMA 4EJUA 1QRYA 2IGKA 4GRIA 1VQPI 2R7XA 1ZK8A 2YSRA 3G2BA 1QU3A 4IL6C 2BY1A 2FMLA 1UFMA 3TOAA 1G4DA 2W84A 3UKGA 5GPCA 1P4WA 2HYJA 2BE5F 2ZSHB 3CCLI 1TP4A 4PFPA 1J09A 1BIBA 2VJ4A 1VTNC 1KONA 2M8GX 3RPUA 2P7CB 2DMQA 4G7OF 1BI0A 1TZLA 1RNLA 3H36A 5K7HA 3CO7C 2ZNYA 4L9VA 3VYTB 1I27A 2E5ZA 4D7MA 2DJNA 3JRIA 4QPQA 1QA6A 5KCMA 2QZ8A 3SJMA 1JI8A 1FBQA 3HUGB 5B5EC 1WJBA 3H35A 1JT6A 3JW4A 1B72B 2M5WA 2ISYA 3HPHA 3OYEA
chains in the Genus database with same CATH topology
3DLLF 1VQMI 3CCLI 3CCMI 5JVGF 3CC4I 1YITI 4IOAF 2K3FA 1YJNI 3PIPF 3CCJI 1VQOI 1VQ4I 2JQ7A 1ACIA 3CMAI 3J7ZI 3CCRI 4IO9F 1VQ8I 2NXNB 3J7YJ 1HC8A 5DM6F 1FOXA 3PIOF 1YI2I 2QEXI 1MMSA 3G4SI 1YIJI 1VQ5I 1S72I 3I56I 4UY8I 5GADJ 2H8WA 4V19K 1VQPI 1YHQI 5GAGJ 3G71I 3CCSI 2E34A 3CCVI 1YJ9I 1YJWI 2E35A 5GAHJ 1VQ9I 1VQLI 1VQKI 4IOCF 3CC2I 1VQNI 2E36A 3CCQI 5GAEJ 1Y39A 3CCEI 3CF5F 3I55I 3CMEI 1QA6A 2OTLI 1FOYA 2ZJPF 5DM7F 3CC7I 3CD6I 2OTJI 3G6EI 2FOWA 1FOWA 3CCUI 2ZJQF 2QA4I 1VQ7I 3CJTB 2ZJRF 1VQ6I
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3DLL F;  1VQM I;  3CCL I;  3CCM I;  5JVG F;  3CC4 I;  1YIT I;  4IOA F;  2K3F A;  1YJN I;  3PIP F;  3CCJ I;  1VQO I;  1VQ4 I;  2JQ7 A;  1ACI A;  3CMA I;  3J7Z I;  3CCR I;  4IO9 F;  1VQ8 I;  2NXN B;  3J7Y J;  1HC8 A;  5DM6 F;  1FOX A;  3PIO F;  1YI2 I;  2QEX I;  1MMS A;  3G4S I;  1YIJ I;  1VQ5 I;  1S72 I;  3I56 I;  4UY8 I;  5GAD J;  2H8W A;  4V19 K;  1VQP I;  1YHQ I;  5GAG J;  3G71 I;  3CCS I;  2E34 A;  3CCV I;  1YJ9 I;  1YJW I;  2E35 A;  5GAH J;  1VQ9 I;  1VQL I;  1VQK I;  4IOC F;  3CC2 I;  1VQN I;  2E36 A;  3CCQ I;  5GAE J;  1Y39 A;  3CCE I;  3CF5 F;  3I55 I;  3CME I;  1QA6 A;  2OTL I;  1FOY A;  2ZJP F;  5DM7 F;  3CC7 I;  3CD6 I;  2OTJ I;  3G6E I;  2FOW A;  1FOW A;  3CCU I;  2ZJQ F;  2QA4 I;  1VQ7 I;  3CJT B;  2ZJR F;  1VQ6 I; 
#chains in the Genus database with same CATH topology
 1Z05 A;  2QGU A;  2XAJ A;  2M4K A;  2LOO A;  2IAI A;  3IL2 A;  4E7S A;  3L2W A;  3CCJ I;  5BMZ A;  4WF2 A;  4P5O A;  3S14 J;  3WU2 C;  4B43 A;  5TRD A;  2FBK A;  2M8E A;  5A2Q K;  4P9F A;  2V9K A;  2A68 F;  4MTD A;  4KA4 A;  5M3F J;  4CO8 A;  1TWH J;  2M0M A;  4HF2 A;  2MBF A;  3LFU A;  2P5K A;  3K4L A;  3TQN A;  2AQF A;  3V42 A;  2GAU A;  4N4O B;  4XRS A;  4PK4 A;  3RZD J;  2CFO A;  3JRG A;  1XMA A;  2ZJQ F;  2HYF A;  3I59 B;  4BUP A;  1WJC A;  1JKQ C;  1FP2 A;  2JMW A;  2O03 A;  5CQE A;  3MKY B;  2XSJ C;  4A3E J;  2DLL A;  5F0H A;  1T6S A;  2O0Y A;  1XD7 A;  2VBX A;  2YU9 J;  1XSD A;  3IRR A;  1Y8R B;  2QSF X;  1JGG A;  4I02 A;  2VT2 A;  3SEZ A;  4BJ6 C;  1TWG J;  5KAF C;  1MBF A;  2CW0 F;  2X85 A;  4UVA A;  4ZTF A;  4ZYH A;  1Z91 A;  1SMY F;  4G7H F;  2H6B A;  2K9L A;  1TQP A;  2EFP A;  4XNF A;  4F92 B;  3CCU I;  5HOD A;  2NVT J;  3A1Y A;  1O7F A;  1HQC A;  5IYC J;  3FKJ A;  3E97 A;  3CQZ J;  5IT3 A;  4E7L A;  4A3D J;  4Z2Y A;  5DCM A;  1O7L A;  1IUF A;  2STW A;  4ASN A;  5D5W B;  3FHZ A;  2XPV A;  4YII A;  1PDN C;  1CF7 B;  4BS9 A;  2CU7 A;  1JTY A;  2HNH A;  3MAJ A;  1VI0 A;  3VSK A;  1OCC H;  1YS7 A;  1ZG1 A;  1VQ9 I;  1XGO A;  2DI3 A;  4KT5 C;  4QPO A;  1AOY A;  1BJA A;  3IRQ A;  3GF2 A;  1XCV A;  4GGG A;  1XTA A;  4RB3 C;  2R3S A;  2F2E A;  3KP2 A;  3SQN A;  2COM A;  2DFF A;  2GZW A;  2X9D A;  4B4C A;  1ZTR A;  2OZ6 A;  3S93 A;  3J81 Z;  4A5M A;  2JSP A;  2NAZ A;  5FRO A;  4PJN A;  1JE8 A;  2PJR B;  2XAQ A;  2KIS A;  4D5C A;  4XIC A;  5CLS A;  2OC6 A;  3KZZ A;  1HKQ A;  4LOC A;  4D9J A;  3CLO A;  4KIF A;  4E7H A;  2TCT A;  4LJZ F;  2M9H A;  3O2P E;  2CV0 A;  3MCZ A;  1XMX A;  1A35 A;  2WAQ N;  1R22 A;  2DA1 A;  1BM9 A;  3CLQ A;  4BKX A;  2K27 A;  5JHF A;  3QYE A;  3OYM A;  4XR6 A;  5B1A H;  3OYD A;  1FOX A;  3J80 Z;  2VQL A;  1MW7 A;  1DUX C;  2P6T A;  4XLE A;  2VOO A;  3BRO A;  4Y17 A;  3QPS A;  4M3D A;  2EJR A;  3RKW A;  1VQK I;  4AM3 A;  2DA6 A;  3JTG A;  1OFC X;  4M3F A;  5J6X A;  3OYH A;  4M9S A;  3EPZ A;  1K4S A;  2GIV A;  4CCK A;  2CW7 A;  2I5U A;  2DXI A;  1N77 A;  5C4J J;  5FFZ A;  4BXX J;  4GFB A;  1ETX A;  3K10 A;  2XAF A;  1UB9 A;  1TTY A;  3FDY A;  4A3G J;  4OAZ A;  2OPT A;  4N0B A;  1YFH A;  5FLX K;  1BI2 A;  4TV7 A;  4IHV A;  4B48 A;  1IZ1 A;  3BZK A;  3U1K A;  2ZC2 A;  3M3Y J;  2R7Z J;  3J81 K;  1YI2 I;  4UB8 C;  1ZRC A;  2CG4 A;  2X6X A;  2LY1 A;  3TMO A;  4G7Z F;  3AG2 H;  5E1W A;  3DU6 A;  5IP9 J;  4M9Z A;  2LK2 A;  3HUG A;  3OSF A;  3J7A O;  4H4K C;  3HOX J;  1I6H J;  5TJJ A;  3CJT B;  1R1U A;  1FJL A;  4I98 B;  3PUB A;  2UV1 A;  3GEZ A;  2ZME C;  1ZN2 A;  3V8L A;  1YW7 A;  4E7K A;  4FTH A;  3E5X A;  4X0G A;  3PIO F;  1BN5 A;  3ZQ7 A;  1WFX A;  3T0Y A;  4E7I A;  5ED4 A;  4XRM A;  1XGN A;  2XF5 A;  3K4M A;  2H6C A;  1Z21 A;  4PUS A;  3FXJ A;  4Y15 A;  3WOD F;  2IS1 A;  2XGX A;  5FLM J;  4DNC A;  2VLA A;  2MD5 A;  4BHB A;  2HQA A;  1PP7 U;  2V79 A;  1AKH A;  4FAS D;  1SD4 A;  4O5V A;  2X1E A;  2O61 A;  1IN6 A;  3CJQ B;  3M8E A;  1UZC A;  1DGR M;  5DD8 A;  2K85 A;  1TW3 A;  2ME6 A;  3JRC A;  1AKH B;  3J7Y J;  1EA3 A;  2D5V A;  5IT9 Z;  5JHU A;  3VDX A;  3LSP A;  4XLF A;  4IQJ A;  1RPW A;  4Y52 J;  4G6Q A;  4M6Y A;  5ICF A;  3MFK A;  3S3N A;  5E8I A;  1GDT A;  2XHK A;  3E6D A;  4UUS B;  2HS5 A;  1ZRD A;  4HG2 A;  4YIF A;  2F6C A;  3W6V A;  1I6X A;  3IKT A;  3EYY A;  5KAI C;  4I2O A;  4XSX F;  1MMN A;  1V3F A;  1SVO A;  1K6Y A;  1S29 A;  4XLH A;  1ZAO A;  1HDD C;  3I9V 2;  3PO2 J;  3GTJ J;  5FKN A;  2V1X A;  2Y2Z A;  3H1C A;  3G4S I;  4XK4 A;  4Y7N J;  2E60 A;  3HOY J;  5KHD A;  4KMU X;  1IF1 A;  4LK1 F;  4PDK A;  4D1Q A;  4Q4Z F;  1R7J A;  6PAX A;  1YOV B;  5C4X J;  1F36 A;  3DKY A;  3BTC A;  2ZJP F;  1X3W B;  5DEQ A;  2HOT A;  3CJN A;  1R36 A;  4MNU A;  3M1E A;  3IH4 A;  3L7W A;  1IN8 A;  4XBF A;  2WAE A;  1TL8 A;  4M3G A;  1BR2 A;  4UUV A;  4ZZD A;  1ZGJ A;  1R9T J;  2VON A;  1S3J A;  2YX4 A;  4AYB A;  2VBW A;  1SC7 A;  1I3A A;  3ECO A;  4NQW B;  3TW7 A;  5FKO A;  1IAW A;  1X1C A;  1JUS A;  2D45 A;  1HDP A;  2KIU A;  2VT3 A;  4PSW A;  3RQ4 A;  1MZB A;  1HBX G;  4EM0 B;  5F04 A;  2E71 A;  1O3Q A;  1MNE A;  1YW9 A;  1JHH A;  3VYS B;  1IDY A;  4HLX A;  4C2M J;  4I6Z A;  2IVM A;  3K1P A;  4CZZ A;  4E7J A;  1YJN I;  2VQC A;  5F27 A;  5DCF A;  2LTP A;  3ECH A;  4IRH A;  5LHH A;  2FUG 2;  4ESB A;  1NTC A;  2FQ3 A;  3HTU A;  5BPD A;  3P5J A;  3QPT A;  4CCJ A;  1WGX A;  1KQ9 A;  3CUQ B;  4XKC A;  2VJJ A;  3OL3 A;  3OYI A;  4XRF A;  1U3E M;  1ITY A;  3K1N A;  5LGN A;  3K4J A;  5LHG A;  1MBK A;  5EG0 B;  1QVT A;  1TWF J;  2KZG A;  3AL0 B;  1QVU A;  3RKY A;  1LEA A;  1IJW C;  1Z9C A;  1HSJ A;  5EG0 A;  2JA7 J;  4HPQ A;  1A36 A;  3HRU A;  1VQO I;  4CCN A;  2K3P A;  1HKT A;  3K4N A;  4E7Z A;  2OZU A;  1X3Z B;  2JRT A;  1XX5 A;  1U8B A;  3I56 I;  2GA2 A;  1B9N A;  3I58 A;  3V8K A;  4KNY A;  4RLQ A;  4J01 A;  3JRF A;  3ULQ B;  1J5Y A;  4RB0 A;  2JPC A;  5ERI A;  2DFI A;  1QZE A;  3ASN H;  3WTX C;  3DQV C;  2JPB A;  4DYR A;  9ANT A;  3FBI B;  4OIQ F;  4RGR A;  5LRS A;  3HOV J;  2J5O A;  3BJA A;  4UHT A;  5LGU A;  3M07 A;  3TGN A;  1W5S A;  1ZR2 A;  1IN7 A;  1BJZ A;  3MZ8 A;  3SZG A;  2R7D A;  2EIM H;  4JQF A;  4IEJ A;  3I71 A;  3H5A A;  3MD2 A;  3WHB A;  3LSI A;  3HSE A;  1MBG A;  2EFW A;  3BJO A;  2DCE A;  3HOW J;  3K0L A;  3KLO A;  3IWZ A;  3P7N A;  3CC2 I;  3IUO A;  2BGC A;  5E3L A;  1T39 A;  5CKT A;  2F4M B;  1TQI A;  2FNA A;  2LFB A;  2ZXW H;  4BL0 B;  1IDZ A;  1LEB A;  2EBI A;  5D4S A;  4M72 A;  5DS9 A;  2R7V A;  3KP7 A;  3BR2 A;  3F3X A;  3LOC A;  3ZQC A;  4B09 A;  4A6D A;  5FLX Z;  5DM6 F;  4FQG A;  5EZH A;  1K4T A;  4MLO A;  1BBY A;  1D1A A;  3K4K A;  2GLO A;  5L3B A;  2LKP A;  2VBY A;  5GAG J;  1UEL B;  1XDU A;  3LQQ A;  4LGW A;  3FK6 A;  1XB4 A;  1ZKG A;  4Z6Y A;  2FSW A;  4YRV A;  4NHJ A;  2XF7 A;  1F43 A;  3IH3 A;  3M9A A;  4A3F J;  1WQ2 A;  2EIJ H;  3GO5 A;  3PFY A;  5L3G A;  1T0F C;  1R00 A;  3GLX A;  4U87 A;  3CES A;  5HNH A;  1YX3 A;  2FEZ A;  2JT1 A;  4QIW N;  2OUM A;  2IS4 A;  4CCO A;  2Z33 A;  1U8R A;  2L5Q A;  1PUF B;  2CUE A;  3EUA A;  4ZJZ A;  2K02 A;  1XCB A;  1W36 C;  3K70 D;  4HNU A;  2ZFU A;  1LKX A;  3H0D A;  3L2Q A;  3QYF A;  1L3L A;  4E70 A;  2ID6 A;  3NWT A;  1N75 A;  1P4X A;  4LG0 B;  1BI3 A;  1Y0N A;  2E36 A;  4XLA A;  3U9G A;  3ZPL A;  4M74 A;  3I55 I;  2KIQ A;  5IPA A;  4A3L J;  4U0Y A;  2BVM A;  3BY6 A;  3GZN B;  3O8G A;  2Y75 A;  2ME0 A;  5F6F A;  2Q2E A;  3QP5 A;  3CMY A;  4L5E A;  2DO7 A;  2XDV A;  4DYC A;  2KRC A;  2ZXI A;  1VQ8 I;  1AHD P;  1X58 A;  2GBY A;  2MH2 A;  2L4M A;  2EFO A;  2CQK A;  2DN0 A;  2V1D A;  4LMY A;  4RDU A;  2M30 A;  5EYR A;  5H2F C;  1KYZ A;  1R71 A;  5FD6 A;  4NC6 A;  2IGM A;  3G71 I;  3GLL A;  4BDZ A;  5K5R A;  4BE0 A;  1XN7 A;  2CUJ A;  2K7L A;  4X1E A;  3DFG A;  5BOX A;  2R7S A;  3MEX A;  3MN2 A;  2NS0 A;  4XLC A;  4A12 A;  1UHW A;  5FB2 A;  1Z0X A;  4ITV A;  3R61 A;  3WE2 A;  3E0J B;  1XS9 A;  1JJ8 C;  3W6J B;  4IJA A;  4IHW A;  4UB6 C;  2FXA A;  1P6R A;  1NG6 A;  3HKZ N;  2JTV A;  3QQA A;  4QWQ A;  2MC4 A;  3PQJ A;  2L9S A;  2GXG A;  4K2E A;  3EUH A;  2VBZ A;  1ZHF A;  4I0A A;  1FYK A;  4PZJ A;  3FM5 A;  3EET A;  2FX0 A;  2VQH A;  1ZG5 A;  2F4I A;  2LH9 A;  1TBX A;  2ZFW A;  3S2H J;  4MEX F;  3CCQ I;  5GAE J;  2M4G A;  2H1K A;  4GDF A;  1JKO C;  3VEP A;  3F0C A;  2P5L C;  2CRG A;  2A6T A;  2E2H J;  5JVT A;  1B9M A;  4HRI A;  3Q0U A;  1Y8Q B;  2GOX B;  1L0O C;  2ZME A;  3I4N J;  5DTD A;  1FMV A;  2IPQ X;  2HDD A;  1KA8 A;  3H3U A;  3AG1 H;  1ZRF A;  2EZL A;  3W2V A;  4C3J J;  3VYU B;  2QEN A;  5EEG A;  3HSR A;  1BC8 C;  4ENJ A;  3LA3 A;  3IWF A;  4WCG A;  1YRN A;  2NRA C;  4U7B A;  2WA0 A;  2E34 A;  2LRE A;  1YW8 A;  4D7N A;  5EGO A;  1WI3 A;  2A3S A;  2LY9 A;  3GFM A;  4A3B J;  1MBE A;  3CME I;  3BR5 A;  3FK7 A;  3OS2 A;  4G6D A;  1ZGW A;  5DCM B;  1FTZ A;  2ETH A;  4XON A;  2QUF A;  3KZY A;  3R6S A;  5HDK A;  2R0Q C;  5JVG F;  3LAP A;  4ENK A;  3BG3 A;  4EGZ A;  4BH9 A;  3BR1 A;  2AXL A;  3V7S A;  2EIN H;  5BPI A;  2P81 A;  4JYK A;  5FJ8 J;  4MFE A;  1DP3 A;  4RLF A;  1LNW A;  4HF0 A;  3DU5 A;  4LD5 A;  1MND A;  1WVR A;  1MSE C;  4LK0 F;  2P4W A;  3F72 A;  4S04 A;  2NVU B;  1HST A;  2W82 A;  3MKL A;  1QZY A;  3PNT A;  2VIX A;  3GFJ A;  1W5T A;  2K9M A;  3HL2 A;  3JSP A;  4MIM A;  1WPK A;  1RRJ A;  1R1T A;  2ZJR F;  1T56 A;  1S5L C;  3I59 A;  1DU6 A;  1RET A;  4L5I A;  1OCP A;  2BXY A;  2Z5U A;  2PEX A;  5FFX A;  2RRE A;  3Q3S A;  2HKO A;  2ID3 A;  4Q47 A;  3ZP5 A;  3C18 A;  1XPX A;  2ZKZ A;  1FSH A;  2VKH A;  3LSR A;  1QHH D;  2BVL A;  1WSU A;  3RYP A;  3KZI C;  2HDC A;  3M1C A;  2NVX J;  3Q9V A;  2VB6 A;  4RB1 A;  3MWM A;  4WXC A;  1XGM A;  2E35 A;  2XV4 S;  1F5T A;  2F5C A;  2UZK A;  1LE8 A;  2RQQ A;  4ESJ A;  5IT9 K;  3OS1 A;  1IRF A;  3O8H A;  3NEU A;  4GYI A;  2XC7 A;  1UCR A;  3OMY A;  2B9S A;  3PL8 A;  5M3M J;  3V4G A;  1IUY A;  2K40 A;  1ETK A;  2EQR A;  2EV5 A;  5IYB J;  4IX7 A;  3OS0 A;  4CCL A;  1JUP A;  1Z7L A;  2LRD A;  1FZP B;  2ELJ A;  3BOQ A;  3HHH A;  4RAY A;  3I3L A;  2HDW A;  5K1Y A;  3HHG A;  1UJ8 A;  2Y0M A;  4A93 J;  4U88 A;  2H8R A;  2ZSI B;  2Z99 A;  1SFX A;  1PUE E;  3EYI A;  1FPQ A;  1UMQ A;  1ZRE A;  2W24 A;  3V7C A;  2JA6 J;  2CSO A;  4ETS A;  2VJ5 A;  2P5V A;  1XDS A;  3CTA A;  4HA8 A;  1ZYR F;  1X1P A;  4RGS A;  5KNL A;  5TGT A;  4M73 A;  1GVJ A;  3ABU A;  2X0L A;  1O3R A;  3U21 A;  2HPM A;  5B3S H;  2A07 F;  2E19 A;  4BJT A;  5CVJ A;  2DAO A;  4IRG A;  1E0E A;  1P2F A;  5J47 A;  5CQG A;  3IC7 A;  4CH7 A;  1T08 B;  2BHZ A;  2DFH A;  2DT6 A;  1MIJ A;  1Y56 A;  1MJ9 A;  3IV5 A;  4PJL A;  1M1E B;  1C0W A;  2EPF A;  3WG7 H;  3JRD A;  3VYR B;  1Z6T A;  1H88 C;  3DBH B;  1FSE A;  1RZ4 A;  2CQ7 A;  4IXA A;  3A01 A;  4A0Y A;  3CDI A;  1JHF A;  3KYC B;  2JVG A;  4C9Y A;  2FA5 A;  4MEY F;  1HKS A;  1B72 A;  2DDB A;  4U0V A;  2DTR A;  2G0E A;  1TQM A;  1KQ0 A;  2JA5 J;  1S7O A;  2DU9 A;  4BU2 A;  3S1M J;  3DXJ F;  4IHS A;  3CMA I;  4DQ2 A;  1K78 B;  1YIJ I;  3GX4 X;  5F0F A;  4V19 K;  3P9I A;  3GTG J;  2Z9O A;  3H5R A;  2FQ4 A;  3L2C A;  5E3O A;  3KX2 A;  3J80 K;  2LKS A;  2H94 A;  3V8J A;  1WWX A;  2N8G A;  5CJ9 A;  1ON2 A;  3SYT A;  1O3T A;  4AD9 A;  2KMU A;  1S9H A;  2CO5 A;  4E4H A;  3AKZ A;  3PO3 J;  1X4O A;  3OYJ A;  1DGW Y;  1ULY A;  2Z2S B;  5GTI C;  2EZH A;  5KK1 A;  1WJE A;  4JK1 X;  1XGS A;  3HOU J;  3BLY A;  4HEA 2;  2XF6 A;  4R79 A;  1SEU A;  4S0H B;  2WB1 A;  4BQN A;  3E5U A;  1X4P A;  2DA7 A;  3BR0 A;  4BHP A;  1IC8 A;  4DJA A;  1K6O A;  4PCQ A;  3W2W A;  4B3A A;  1U0J A;  4FIS A;  2AO9 A;  2I10 A;  4MGR A;  3QU3 A;  2IA2 A;  3MKZ A;  2R7U A;  3R0J A;  4P1W A;  5C3E J;  5M5W J;  3L1P A;  2XAS A;  3PIP F;  2JQ7 A;  2HXO A;  1BI1 A;  3HOT A;  3GXO A;  4BQO A;  3FIS A;  4BDY A;  5J4Y A;  3OYK A;  4ENN A;  2BBY A;  4IF4 A;  3BTL A;  3OWT A;  1G6N A;  1WJF A;  1OCR H;  3GW2 A;  3A0B C;  2CQX A;  2OV7 A;  1T98 A;  4OIO F;  2G7H A;  3IH2 A;  1HW2 A;  2R5Z A;  3HOZ J;  3G6E I;  1G3W A;  5GPA A;  1QBJ A;  2GOM A;  2LNB A;  4OIR F;  2PFB A;  4I09 A;  4II3 A;  3GFL A;  5HNF A;  1FC3 A;  2RGV A;  3SDB A;  4IHX A;  4DIQ A;  4Y13 A;  3CMM A;  2KIM A;  1V5E A;  4GYG A;  2WAF A;  4RM2 A;  4XOP A;  4BAC A;  2MH9 A;  3KEY A;  3FXR A;  2JVH A;  1T2K A;  1HW5 A;  1SFE A;  4O3M A;  4EQQ A;  1D1B A;  3TDU C;  3R60 A;  5IOY A;  1D0X A;  2XRO A;  1LFB A;  2KJB A;  4X6A J;  3OR1 C;  2ZNZ A;  4BJ5 C;  3KYL A;  5C44 J;  2RNJ A;  1GXP A;  1T33 A;  1E2X A;  3FXQ A;  2XAH A;  2CJJ A;  2G9W A;  2Z16 A;  3HBL A;  4M9X A;  2R5Y B;  5CPR B;  2DT7 B;  3LAJ A;  2GWR A;  2WAQ A;  1PUF A;  2M45 A;  1QZZ A;  2P6S A;  2HI3 A;  4WX9 A;  1OCO H;  1P9Q C;  4CYC A;  2Y9Y A;  4I01 A;  2Y30 A;  3ZN0 A;  1D1C A;  2LR8 A;  2VC1 A;  3LFK A;  4V2G A;  4ZDO A;  2E1N A;  3BG6 A;  3JRH A;  1W0U A;  1QO0 D;  3UR3 C;  3FXO A;  4RAG A;  2UUZ A;  3DKX A;  1S7E A;  5DUK A;  1O4X A;  2K5C A;  3QAH A;  2QQ9 A;  4PFO A;  2XPW A;  4KN4 X;  4GCV A;  2O8X A;  4HDU A;  4AIK A;  3ZMT A;  5M5Y J;  3BCA A;  1MJA A;  3ZXS A;  2NVQ J;  1D8J A;  2ZME B;  2DMT A;  5EZG A;  1OCZ H;  3PJR A;  2X48 A;  2KKO A;  1IN4 A;  2VQG A;  5BQT A;  5ICC A;  1VQN I;  1GV5 A;  1R49 A;  2YS9 A;  1OLT A;  1NK2 P;  2UXX A;  3FMS A;  3RPQ A;  2MLG A;  2BXZ A;  2GIZ A;  3BWG A;  5FRM A;  5EEA A;  2A5W A;  2DTZ A;  2MW8 A;  1PYV A;  2G7U A;  3B02 A;  2FOK A;  1JTX A;  4PJ0 C;  1Z3Y A;  3ZQI A;  2KHM A;  3TP3 A;  5HOO A;  3WHC A;  4OIP F;  1HOM A;  1JKR C;  3ZMU A;  4UY8 I;  5GAD J;  4BAY A;  2JUG A;  3I54 A;  2VPR A;  1MH3 A;  4LFU A;  4EVI A;  3C7J A;  2D1V A;  3H5N A;  3BPV A;  1UST A;  4HF1 A;  1SD5 A;  3CF2 A;  3K69 A;  3IAM 2;  2EA4 A;  2VN2 A;  2HGC A;  3H92 A;  1T95 A;  3A0H C;  3BTI A;  4DZP A;  3H3V K;  1YQA A;  3MZY A;  2OD5 A;  2FBI A;  3DWL E;  2Q8K A;  4NNJ A;  4FHT A;  3TO6 A;  1OIS A;  2V4J C;  2ZXH A;  3O3K A;  3QOD A;  4AVZ A;  2LSO A;  1MH4 A;  1FP1 D;  2AHQ A;  4EJW A;  3W3C A;  2BW3 A;  2V6C A;  2M7A A;  1LVK A;  2QQA A;  2BY2 A;  3BT9 A;  5J1R A;  4HX7 A;  2MSY A;  4B1R A;  5D8K B;  1FWZ A;  3K2Z A;  1D0Y A;  5HDN A;  5TIS C;  3S32 A;  3CCE I;  3RIR A;  2M3A A;  4P96 A;  1E3O C;  5FKL A;  2DMP A;  2O3F A;  2ACJ A;  1FOW A;  3K2A A;  2IRF G;  1W1W E;  4BY7 J;  3SDG A;  5J1Y A;  4NDL A;  2WY7 Q;  3HXL A;  3AAF A;  1ZLK A;  1F1Z A;  1J7K A;  4I0B A;  2KQR A;  4J19 A;  2UWM A;  2E1O A;  3HG9 A;  3HTS B;  1HA8 A;  2VC0 A;  1SAU A;  1BOA A;  1Y0U A;  3B6A A;  3G1M A;  4AID A;  3F9K A;  5F08 A;  3ZQQ A;  1IV8 A;  2HTS A;  2OCE A;  5CVI A;  2DT5 A;  2O9L A;  2IGO A;  3CCV I;  1YJW I;  1VQL I;  2K9Q A;  3PSI A;  2KRH A;  1JXS A;  3S1N J;  2JJ7 A;  1ORK A;  1B8I A;  3VOD A;  2XGD A;  3DTI A;  2PMZ N;  1XG1 A;  2CS3 A;  1BIA A;  4LLN A;  3S15 J;  4EJT A;  4F93 B;  4AU7 A;  3C3W A;  2EZI A;  1IO2 A;  2HYG D;  2LF7 A;  3PFI A;  3RKX A;  4WK8 F;  3WU1 B;  3FXL A;  1TT0 A;  3OIQ A;  4XLN F;  2RDP A;  1OR7 A;  4NQW A;  1E3P A;  1KZH A;  2CQQ A;  1UHS A;  2KJC A;  1W36 D;  4HOB A;  4IRI A;  3P9C A;  4C2U A;  2WB1 N;  1R6R A;  2MG4 A;  3I5U A;  1YLF A;  3SHF A;  3T1B A;  1GHC A;  5E79 C;  4CZC A;  4AVP A;  5BS6 A;  2IS2 A;  3HJE A;  2TDX A;  1DQU A;  4G6T B;  4XN3 A;  2ELK A;  3GTM J;  2R4G A;  3E7L A;  1Q1V A;  3D5L A;  2FMY A;  3WG9 A;  1WZ2 A;  2L02 A;  3AFH A;  4XMY A;  5LRR A;  3BG5 A;  4ESF A;  1NH3 A;  4BY1 J;  2RVC A;  1LFU P;  2BYV E;  1P7I A;  4U0W A;  2K4B A;  1A31 A;  2XB5 A;  4A0X A;  2HQR A;  1YHQ I;  1GT0 C;  3GCM A;  4IQ4 A;  1POG A;  2X51 A;  4YEL A;  3HRT A;  4PSX A;  5HVQ C;  4CCM A;  1B8I B;  2KDZ A;  5HLG A;  2M87 A;  5EF6 A;  2WC2 A;  5LEJ A;  1VF9 A;  1GXQ A;  3N97 A;  2HZD A;  3WTU C;  4UNO A;  1Q1H A;  3L00 A;  4I99 C;  5FKK A;  2KT0 A;  1ONV A;  4YFK F;  2K86 A;  5CYV A;  4XOR A;  4CA0 A;  2BOL A;  2XKO A;  3X2Q H;  3DEU A;  3EDP A;  4BBS J;  1DPR A;  3ASO H;  1ZGA A;  2BW3 B;  2Y48 A;  2H1L A;  3KE2 A;  3ABK H;  1MD0 A;  2VOP A;  4XLP F;  1FOY A;  3DKW A;  4HDV A;  3RKQ A;  4B44 A;  1ETW A;  1SFO J;  4MHG A;  5H6Q A;  1B4A A;  1Z7U A;  4KIS A;  2QKM B;  3CCM I;  2EH3 A;  3BZC A;  1YIT I;  1I3Q J;  4QSH A;  3L2U A;  3ZMV A;  3CCR I;  3RI4 A;  2F5F A;  2HTJ A;  4ZC3 A;  2WY8 Q;  1I1G A;  1X2N A;  3CDL A;  2NNY A;  4AUX A;  2EB7 A;  2VXZ A;  4BNC A;  1XSX A;  4HZF A;  2JK3 A;  1W0T A;  2VI6 A;  5IP7 J;  4BQA A;  2L7Z A;  2AXT C;  5J8C A;  1U6G A;  4QTR A;  4IOC F;  1LQ1 A;  4OMZ A;  1WHU A;  4C30 A;  1U9N A;  2YUS A;  2QBY A;  3B73 A;  4XQF A;  4LIU A;  3RSN A;  4J00 A;  4OAY A;  5DD4 A;  5H6R A;  1NHA A;  4XKV A;  4YG2 F;  3KP4 A;  2V1U A;  5E3M A;  1USS A;  3LSK A;  1R5G A;  1I39 A;  2PQ8 A;  1S72 I;  4A0Z A;  2YPR A;  2LBF B;  3G3Z A;  4C2T A;  5H20 A;  4UUS A;  5D5X B;  1WH7 A;  2E2J J;  1DPU A;  1ENH A;  2I8D A;  1W7P D;  1B1B A;  4FET A;  2LKX A;  1KQ8 A;  5HS9 A;  2EV6 A;  5E8G A;  2VKD A;  4N4N B;  2MA3 A;  2HOS A;  1BR1 A;  2ADU A;  2XKP A;  1W7P A;  5L3E A;  2UXN A;  2L7F P;  2DQR A;  3F21 A;  1ERD A;  2GQQ A;  4GO1 A;  2HU9 A;  2PMZ A;  1MMS A;  4XSZ F;  5A2Q Z;  1LDD A;  4EJV A;  1SMT A;  3ZMD A;  1HF0 A;  4OOI A;  4I76 A;  2VE9 A;  3FXK A;  5JI6 A;  3TBI A;  2EV0 A;  3H9J A;  3S1R J;  3Q5F A;  3QOP A;  1ETV A;  1WRJ A;  5K5Q A;  1TC3 C;  3GBG A;  3E6B A;  3MMY B;  4RBO A;  2R7T A;  3F6O A;  2VPL A;  2HZT A;  3ELK A;  3NAR A;  1OCT C;  1NG7 A;  3GFI A;  2W25 A;  2DQL A;  3DPU A;  2DK5 A;  3QWL A;  3ESW B;  3G73 A;  3VOE A;  4L18 B;  2XGC A;  4F55 A;  3LA2 A;  2NXN B;  3EUH C;  5J4V A;  5LHI A;  2LC2 A;  3CUQ C;  4N9I A;  5AON A;  1GVD A;  2A05 A;  3FF5 A;  3K70 C;  2FNP A;  2P0W A;  3GUD A;  1V55 H;  4W97 A;  3HGY A;  3TL4 X;  2KFD A;  4FX0 A;  2LG4 A;  3BZ6 A;  2O8K A;  4XN0 A;  2DOE A;  4KYW A;  1V54 H;  2YU3 A;  5GP9 A;  1G59 A;  1DDN A;  4EGY A;  5ILV A;  1YTY A;  2DA3 A;  4JBA A;  5ILS A;  4IHY A;  2MC3 A;  2W1O A;  4HQM A;  4ZYD A;  4F52 A;  4XM3 A;  4ANJ A;  3CZ6 A;  2FD5 A;  1P4A A;  1FIA A;  4W1U A;  4YFN F;  1CF7 A;  5J3L A;  4GXO A;  2L3D A;  1IXR C;  1KYW A;  2ISZ A;  2O7O A;  2DOA A;  2K9N A;  5AIQ A;  3Q9S A;  4L5J A;  2M2E A;  3NWS A;  4M6X A;  2PN6 A;  4HQE A;  1Y39 A;  5L3F A;  1N78 A;  2Q1Z B;  1XSV A;  1GV2 A;  4CDG A;  3F6V A;  3CJR B;  3GVA A;  2HOE A;  1MMA A;  3CUO A;  3GTP J;  3HKZ A;  1FYL A;  3ZQH A;  1S8N A;  2BHY A;  3F8C A;  4CHU A;  3JTH A;  4JX5 A;  2ELH A;  1YRN B;  3DV8 A;  1FT9 A;  4HSR A;  3KEQ A;  1TNT A;  1QPM A;  3K1M A;  3ZRG A;  3ZMZ A;  3S1Q J;  2H8W A;  3U1D A;  3HYI A;  1LE8 B;  1I1S A;  4JX4 A;  2E1M C;  2DJI A;  4FCY A;  1SFU A;  3MZH A;  1WI9 A;  3KCC A;  4KIG A;  3R4K A;  2QYO A;  2OJE D;  3GWZ A;  2Z1D A;  5E1X A;  2EFN A;  1A6Q A;  4PJM A;  4F7Z A;  2L9N A;  3P9K A;  3SZT A;  3FWE A;  2NS8 A;  3LSH A;  2R92 J;  5LLQ A;  2VKE A;  1Y1W J;  3D5S C;  2Z3Y A;  3F8M A;  1DP7 P;  1E17 A;  2EFQ A;  5ICE A;  3PM1 A;  3OV8 A;  4HBL A;  3BQZ A;  4CYC B;  3JAM Z;  1MMD A;  1KU9 A;  2XAG A;  3GTQ J;  3D5R C;  1TW2 A;  3DCF A;  1OPC A;  1K78 A;  3OOU A;  4ZDP A;  2DA2 A;  4OMY A;  2R7O A;  3SZP A;  3ZQL A;  1G8X A;  1TNS A;  3LQR A;  1E3H A;  1GUU A;  2PMU A;  1JJ6 C;  1Z1D A;  2EIK H;  1VQ6 I;  2DBB A;  1REP C;  3A03 A;  2ZJ2 A;  1A6I A;  2A5Y B;  4G94 A;  1MGT A;  3BDD A;  3FMQ A;  2DYR H;  2DYS H;  2HQ5 A;  1K61 A;  5E18 F;  5K7F A;  3VB2 A;  2IA1 A;  5BNG A;  3L2R A;  2H27 A;  2J5P A;  5GAH J;  1D5Y A;  2X4H A;  3OYL A;  4WXH A;  2IP2 A;  4CYD A;  3CP2 A;  2PX9 A;  5FRN A;  2FBH A;  1U5T B;  4EV0 A;  3BG9 A;  3FXM A;  2XSD C;  3DLL F;  4NC7 A;  5B66 C;  2X1C A;  3H9Q A;  3S17 J;  1O57 A;  2E7W A;  3BP8 A;  1V4R A;  1QHG A;  2HPI A;  3HM5 A;  4HV5 A;  4XRS G;  1Z67 A;  3AG3 H;  2RC4 A;  3KP6 A;  4EMS A;  2C6Y A;  1SFK A;  3WGI A;  3IAS 2;  5ICG A;  2X6Y A;  2DDA A;  2QSH X;  3DF8 A;  4AIJ A;  4KFC A;  3F23 A;  3DTK A;  1B59 A;  1X3U A;  3OYC A;  4KDP A;  1YX5 A;  2M1B A;  3WE3 A;  4DBR A;  2L9V A;  2JZY A;  3DPT A;  1R5H A;  2KIF A;  1S7A A;  3ABT A;  2R5Z B;  2IS6 A;  2IEK A;  1LFP A;  1XMK A;  4D0P A;  1OKR A;  2A6E F;  2ZXJ A;  3A4C A;  2QBY B;  4HLY A;  1BA5 A;  2F4O B;  3WU0 A;  4DZJ A;  2VKV A;  1K7A A;  1S6L A;  2K4J A;  1SVM A;  1EV7 A;  1D8K A;  5GTH C;  1VQ5 I;  1TT5 B;  3OYG A;  3LMM A;  2P8T A;  5IP6 A;  3NQO A;  2RKH A;  5JLX A;  2DMN A;  5HLH A;  3OYN A;  2Y0S A;  3ROU A;  3WTV C;  1IN5 A;  5DM7 F;  4I7H A;  1UAA A;  2HFH A;  2RQP A;  3BR6 A;  2ICW G;  4AIH A;  1H8A C;  2V7F A;  1WKM A;  3R0A A;  4G9Y A;  3OYF A;  1IXC A;  3J7A Y;  1WH5 A;  2A69 F;  4U7D A;  1RIO H;  5DV5 A;  2BZT A;  1ETO A;  1G2H A;  1WJ5 A;  1U78 A;  3ISP A;  4LB6 B;  4P9U A;  2EK5 A;  1I5Z A;  1OQY A;  3CDH A;  2AS5 F;  3N05 A;  2ESH A;  1HC8 A;  2QEX I;  3O6B B;  5E20 A;  1HXD A;  4D5F A;  2VE8 A;  4LG0 A;  1YE9 A;  1BC7 C;  4EAT A;  5LEK A;  4BYY A;  2Q0O A;  4A2U A;  3K7A J;  3T8R A;  2DA4 A;  1XC5 A;  1T8I A;  3GTO J;  4V2F A;  3KP5 A;  3H9G A;  3GZ6 A;  1U5T C;  4YIR X;  3S2D J;  1FBS A;  4A3M J;  3H0G J;  4MQ9 F;  3UNG C;  1X2M A;  4E6K G;  2FF4 A;  2OA4 A;  2CUZ A;  4XID A;  3WTS C;  1X1D A;  4Y33 A;  3ZOB A;  5F1R A;  3D1N I;  3VSL A;  5ILU A;  3E6M A;  2DMU A;  3ZQF A;  2E7X A;  3KFW X;  3FXU A;  1K83 J;  4XOT A;  1NK3 P;  1F4K A;  1RUO A;  4M3B A;  5KVR A;  3B6C A;  3C2G A;  4A3I J;  4F91 B;  1BL0 A;  3NAU A;  1N25 A;  2F5V A;  2XPU A;  2PBI A;  2COB A;  2X1D A;  3DP7 A;  4DW6 A;  1MBJ A;  5CVR A;  4ZZL A;  2BY3 A;  2FOW A;  3C2H A;  4KUM A;  4L0Z B;  1WCM J;  1VQM I;  2F5D A;  1IRG A;  3HGG A;  1AA7 A;  2XRN A;  3HSF A;  3WGG A;  4B3X A;  3N4M A;  1ZLJ A;  1RR7 A;  1YIO A;  2B63 J;  2CYY A;  2LDU A;  4B47 A;  2JN6 A;  4Y4R A;  3ZMS A;  2MFZ A;  2KRF A;  3K4B A;  4HAM A;  4BGD A;  5HS8 A;  4BXF A;  1FYM A;  4YEJ A;  3OYA A;  2ESN A;  2WTE A;  1DU0 A;  4RGX A;  1APL C;  3F8B A;  1EH6 A;  2R7F A;  3E6C C;  2LLK A;  1WJD A;  1R4N B;  4A3J J;  1VQ4 I;  3CO6 C;  3L09 A;  3ERM A;  3RTR A;  3A2K A;  4CUG A;  2O6G E;  3D0S A;  3E1S A;  1RUN A;  2HVS A;  1PP8 F;  2QWW A;  4ZYG A;  4DOZ A;  2DA5 A;  1FX7 A;  4BQQ A;  1YJ9 I;  3RQI A;  4JOM A;  2M0C A;  4HNT A;  1D5V A;  3CC7 I;  4FT8 A;  3F22 A;  2D1H A;  5HS7 A;  3TP0 A;  3VFZ A;  2A6H F;  2KZV A;  5K7Z A;  1HW1 A;  3WTW C;  5D6F A;  1FLI A;  4CIC A;  3KIO A;  1ACI A;  2MLK A;  5M5X J;  5LGT A;  2NOJ B;  1Z77 A;  1LDK B;  4NBQ A;  2JA2 A;  4HW0 A;  2L4A A;  2Y0S N;  5JFR A;  1RC9 A;  1ZEL A;  1H0M A;  3CCY A;  5K5O A;  2JUC A;  2OF7 A;  2IW5 A;  3I64 A;  2OQR A;  2QLZ A;  5E17 F;  3QRF F;  1CGP A;  3M8F A;  2LVS A;  1H9T A;  5EEH A;  1QGP A;  5HLI A;  4ON0 A;  5F64 A;  4DYQ A;  3J7Z I;  2L54 A;  1FMW A;  2E1C A;  5CVV A;  2NVY J;  2QF7 A;  3COA C;  1P7J A;  2OCC H;  2XAU A;  2IT0 A;  2CFX A;  1EH7 A;  3KYD B;  1BR4 A;  3A01 B;  3IKV A;  4JX6 A;  4RB2 C;  1TWA J;  2M7B A;  1W7P B;  2R5Y A;  1LPQ A;  3ERE D;  1BW6 A;  2K9S A;  4RAF A;  5DDG A;  1OYI A;  5HLT A;  1G3S A;  3FIW A;  2O5R A;  4FE7 A;  1H9G A;  3T8T A;  3JRB A;  3RJP A;  1X1B A;  1SD7 A;  2IBD A;  1CQT A;  1BOB A;  3HDD A;  1EKE A;  4KJZ A;  1R1V A;  3RCO A;  1D3Y A;  3G1L A;  2HWV A;  3IP4 B;  4BBR J;  1R5I D;  2V9V A;  3DTE A;  4MFD A;  3DBL B;  2XVC A;  3OIP A;  3WTZ A;  3BPX A;  5FO5 A;  2KDO A;  2L0K A;  2NOG A;  4RM3 A;  3DEW A;  3FMR A;  4UUT A;  2GM4 A;  1MBH A;  3CF5 F;  4UV9 A;  3ZQG A;  1MKM A;  5F1J A;  4O6J A;  3JRA A;  5DYM A;  2R7W A;  3FHN A;  2DFE A;  3OR2 C;  4ZDL A;  5FLV A;  2RN7 A;  2XUB A;  1FY7 A;  3CC4 I;  2FE3 A;  3JRE A;  3I4P A;  3PSF A;  4BHC A;  2DPD A;  1G3Y A;  3JR9 A;  4HYE A;  2HXI A;  1ZH5 A;  3FX3 A;  4IO9 F;  1IRZ A;  1SAN A;  1JKP C;  4C3I J;  2LYC A;  3BC8 A;  4KIB A;  4DBQ A;  5LFA A;  3RZO J;  4OIN F;  1IG7 A;  1I50 J;  1R23 A;  1STZ A;  2HR3 A;  4WXD A;  2W48 A;  1IRX A;  1SAX A;  1J0R A;  1Y1V J;  1FBU A;  3WTT C;  3KP3 A;  5DUI A;  4IHT A;  3QOE A;  1JUM A;  1UHM A;  4A3K J;  2CUF A;  5EGO B;  2CV2 A;  2RNG A;  2Y69 H;  1ZAR A;  5D6E A;  4AC0 A;  3LA7 A;  3ML6 A;  3U2R A;  3JCU C;  2OAZ A;  1J2X A;  4BE1 A;  5LBQ A;  1HLV A;  3FZV A;  3W6K B;  2HVQ A;  3I0T A;  3TO7 A;  4ZYE A;  3BQY A;  1OYY A;  1U5T A;  2QVO A;  3QP6 A;  4P55 A;  5F0C A;  4UVB A;  3S3M A;  3EQL F;  2H09 A;  1V5F A;  2V1N A;  3PNV A;  4UVC A;  2MAB A;  3DPL C;  5D8L B;  4KIT B;  1GLN A;  3M4O J;  2W00 A;  1KGS A;  5D5V B;  3ZCO A;  2GXB A;  3KLN A;  4LLG F;  1ETQ A;  4ZTJ A;  3HZJ A;  1FIP A;  3L9F A;  2W57 A;  1ODD A;  2HEO A;  2ECB A;  2XIG A;  2BY0 A;  4M6V A;  4ABZ A;  5D5U B;  2CWE A;  3HRS A;  3HC7 A;  2W4S A;  2YX7 A;  2CH0 A;  5FGM A;  4II2 A;  3RPU D;  3ZR8 X;  1J9I A;  2QM3 A;  3SFI A;  3F8F A;  2V26 A;  2BV6 A;  4L9N A;  2FJ1 A;  1QQI A;  3TO9 A;  3OIO A;  4CGZ A;  1T0F A;  3NRV A;  4Q48 A;  2PJR A;  1SD6 A;  2X6O A;  5JR3 A;  3LST A;  3DLA A;  2WAD A;  2FRH A;  1IXS B;  4MO7 A;  4NUB A;  3TW6 A;  3BG7 A;  4UXN A;  3QU6 A;  5EDN A;  3PNY A;  3FKI J;  2ZO4 A;  2X6W A;  4MTE A;  2DK8 A;  4DGW B;  1QNT A;  2LY2 A;  3MKW B;  4PGG A;  2ZBK A;  1Y6I A;  2VAS A;  4L9T A;  4RAZ A;  1VZ0 A;  3G1O A;  1IW7 F;  3C2B A;  4NC8 A;  4CXF A;  1P92 A;  4L9J A;  2HVR A;  1MJB A;  3HEF A;  1U2W A;  3LNQ A;  2WWY A;  4EM1 A;  2RV8 A;  3GME A;  4A69 C;  3HOS A;  1OR7 C;  3CP8 A;  1H89 C;  2ZB9 A;  4IZZ A;  3CD6 I;  2OU2 A;  2F48 A;  2OTJ I;  4RS8 A;  1LUJ B;  3LSM A;  2A61 A;  1J59 A;  1MMG A;  2HKX A;  3AG4 H;  3LL7 A;  2B0L A;  2VJI A;  4G12 A;  2TRT A;  2ECC A;  3LSJ A;  2Y9Z A;  2QQB A;  2WV1 A;  1TLH B;  3TDZ C;  3ABM H;  1FOK A;  5FKM A;  5J40 A;  2R7Q A;  2MYS A;  2E2I J;  1RKW A;  2R7R A;  2CV1 A;  3SXY A;  3ZGK A;  4R8H A;  3K9T A;  4BXU A;  2VL8 A;  2D2W A;  2E5N A;  2KP6 A;  1LB2 A;  2L7M P;  1Z3X A;  3TOB A;  1VFC A;  2NYX A;  2W7N A;  1FEX A;  1IGN A;  3SEQ A;  2OQG A;  4CSW A;  1U9O A;  1KU7 A;  1VQ7 I;  2QA4 I;  2PG4 A;  3BR3 A;  2QQ8 A;  3FBN B;  5HDG A;  2STT A;  3LWF A;  2DW4 A;  3KET A;  5E1Z B;  4UV8 A;  3V7R A;  4M3E A;  2AQE A;  2NS7 A;  1R4M B;  5L3D A;  5JLW A;  1T38 A;  5IOZ A;  2V6E A;  4HX8 A;  1YG2 A;  1MNM C;  2QKL B;  4HV6 A;  1MDM B;  3I4M J;  1RES A;  2JRM A;  5FD5 A;  3REO A;  1KU2 A;  2YR2 A;  3DBR B;  4JP0 A;  3S3O A;  5CVU A;  2HQN A;  2P7V B;  1YYV A;  5D4R A;  4A3C J;  4FE4 A;  3VWB A;  1ETY A;  2EWN A;  3F8N A;  4KN7 X;  2JSC A;  4R1H A;  1LDJ A;  3WTY C;  4XKB A;  4NB5 A;  4G8X A;  2LBF A;  4YFX F;  1JT0 A;  1X19 A;  3M7G A;  2HOA A;  3KEO A;  1X1A A;  3ONQ A;  2EIL H;  3FM3 A;  2IA0 A;  3H3Z A;  5B1B H;  1TWC J;  4QLC U;  1EF4 A;  3C1D A;  1EH8 A;  3GYH X;  2PMH A;  2PI0 A;  2CW8 A;  1B6A A;  3Q0W A;  1BW5 A;  2VOD A;  3OOP A;  3RDI A;  4AYB N;  2VUM J;  2BEO A;  1JGS A;  4IKF A;  2DOF A;  2XB0 X;  3JSO A;  4KMF A;  3RYR A;  1LVA A;  1W4M A;  3K6G A;  4ZYA A;  3HIF A;  3S16 J;  4EJO A;  3QPH A;  3BTJ A;  4HNV A;  2PJP A;  2E1M B;  2WV0 A;  5J1U A;  2OBP A;  2L9R A;  2FU4 A;  3ZN1 A;  2W85 A;  3EUK L;  1UG0 A;  2CGP A;  2CMP A;  1PVE A;  3GTL J;  3OYB A;  4BE2 A;  4ENM A;  2IGN A;  3L2V A;  2GA1 A;  3M8J A;  2OTL I;  3GZ5 A;  4EM2 A;  2LMD A;  3IHU A;  4OU0 A;  4WWC A;  2Y31 A;  1QPI A;  2CQN A;  3OSG A;  1KU3 A;  3KPH A;  1YS6 A;  1SVL A;  4OWR B;  2V9P A;  4IOA F;  3QPL A;  1PJR A;  3TKY A;  1A04 A;  4RGU A;  1LJ9 A;  1IV6 A;  4S05 A;  1FTT A;  4RA2 A;  5J8F A;  1K79 A;  2JA8 J;  1R58 A;  4LLL A;  1ZQ3 P;  1W5C C;  4KT6 A;  3S2W A;  1MSF C;  1EJ9 A;  5LD2 C;  4BEH A;  3VPR A;  4FX4 A;  4A6E A;  2IJL A;  3K4C A;  1YO5 C;  4B8X A;  1RI7 A;  2NNN A;  4N9H A;  4PJJ A;  1AU7 A;  2LP0 A;  2LD5 A;  3BJ6 A;  1J75 A;  1F9N A;  2IXS A;  2PLY A;  3OY9 A;  3A02 A;  2XGE A;  1D0Z A;  3S8P A;  4ZH4 F;  3HPG A;  2R93 J;  2RAE A;  3E3V A;  3LSG A;  1A5J A;  2DPU A;  5IYD J;  2KPM A;  3JAM K;  3HRM A;  2JWT A;  1O3S A;  1RKT A;  2L7K A;  3Q0V A;  1HCR A;  3CCS I;  3I53 A;  2QCO A;  1AWC A;  4Y3O A;  4H0E A;  1MDM A;  2Q2E B;  3CUQ A;  4HST A;  2LF8 A;  4LG3 A;  5L3C A;  1OYW A;  3ABL H;  4LB5 A;  3WGH A;  2F5E A;  4HX4 A;  1VND A;  4EEF G;  4IVN A;  1RR8 C;  2B7E A;  3DEE A;  2VXD A;  2K3F A;  2MGQ A;  2EZK A;  5EJC A;  4MQV A;  3T5X A;  3SFZ A;  4M71 A;  3E5Q A;  4KIC A;  5AIP A;  2KLO A;  1ZR4 A;  4L0Y B;  4RMN A;  4XL9 A;  1OJL A;  3OL4 A;  2L01 A;  4LIT A;  2MD0 A;  4PGH A;  5E3N A;  1V5G A;  2L2O A;  4BEH B;  1ON1 A;  1Z6R A;  3MQ0 A;  1OMI A;  4IPA A;  3TED A;  2GXA A;  3PUF A;  2ZCW A;  5IY5 H;  1UG2 A;  4C3H J;  2M34 A;  3GTK J;  4AWX B;  4Q5S F;  3HB9 A;  4F3Q A;  3MVP A;  3AL0 C;  1FNN A;  4A5N A;  4LIV A;  3W2A A;  4XKW A;  2KL4 A;  2DOD A;  1ZG3 A;  3BCB A;  2XRL A;  1WJA A;  3PQK A;  2QSG X;  3QYB A;  1G3T A;  2EA2 A;  2WBM A;  4EJU A;  1QRY A;  2IGK A;  4GRI A;  1VQP I;  2R7X A;  1ZK8 A;  2YSR A;  3G2B A;  1QU3 A;  4IL6 C;  2BY1 A;  2FML A;  1UFM A;  3TOA A;  1G4D A;  2W84 A;  3UKG A;  5GPC A;  1P4W A;  2HYJ A;  2BE5 F;  2ZSH B;  3CCL I;  1TP4 A;  4PFP A;  1J09 A;  1BIB A;  2VJ4 A;  1VTN C;  1KON A;  2M8G X;  3RPU A;  2P7C B;  2DMQ A;  4G7O F;  1BI0 A;  1TZL A;  1RNL A;  3H36 A;  5K7H A;  3CO7 C;  2ZNY A;  4L9V A;  3VYT B;  1I27 A;  2E5Z A;  4D7M A;  2DJN A;  3JRI A;  4QPQ A;  1QA6 A;  5KCM A;  2QZ8 A;  3SJM A;  1JI8 A;  1FBQ A;  3HUG B;  5B5E C;  1WJB A;  3H35 A;  1JT6 A;  3JW4 A;  1B72 B;  2M5W A;  2ISY A;  3HPH A;  3OYE A; 
#chains in the Genus database with same CATH homology
 3DLL F;  1VQM I;  3CCL I;  3CCM I;  5JVG F;  3CC4 I;  1YIT I;  4IOA F;  2K3F A;  1YJN I;  3PIP F;  3CCJ I;  1VQO I;  1VQ4 I;  2JQ7 A;  1ACI A;  3CMA I;  3J7Z I;  3CCR I;  4IO9 F;  1VQ8 I;  2NXN B;  3J7Y J;  1HC8 A;  5DM6 F;  1FOX A;  3PIO F;  1YI2 I;  2QEX I;  1MMS A;  3G4S I;  1YIJ I;  1VQ5 I;  1S72 I;  3I56 I;  4UY8 I;  5GAD J;  2H8W A;  4V19 K;  1VQP I;  1YHQ I;  5GAG J;  3G71 I;  3CCS I;  2E34 A;  3CCV I;  1YJ9 I;  1YJW I;  2E35 A;  5GAH J;  1VQ9 I;  1VQL I;  1VQK I;  4IOC F;  3CC2 I;  1VQN I;  2E36 A;  3CCQ I;  5GAE J;  1Y39 A;  3CCE I;  3CF5 F;  3I55 I;  3CME I;  1QA6 A;  2OTL I;  1FOY A;  2ZJP F;  5DM7 F;  3CC7 I;  3CD6 I;  2OTJ I;  3G6E I;  2FOW A;  1FOW A;  3CCU I;  2ZJQ F;  2QA4 I;  1VQ7 I;  3CJT B;  2ZJR F;  1VQ6 I; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...