2ZJRF

Refined native structure of the large ribosomal subunit (50s) from deinococcus radiodurans
Total Genus 11
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
11
sequence length
71
structure length
71
Chain Sequence
MSYLIRKAAGIGKGSSTPNKAKVGKLNWDQVLEIAKTKMPDLNAGSVEAAANTVAGTARSMGVTVEGGPNA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Translational regulation via L11: molecular switches on the ribosome turned on and off by thiostrepton and micrococcin.
pubmed doi rcsb
molecule tags Ribosome
molecule keywords ribosomal 23S RNA
total genus 11
structure length 71
sequence length 71
ec nomenclature
pdb deposition date 2008-03-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
F PF00298 Ribosomal_L11 Ribosomal protein L11, RNA binding domain
F PF03946 Ribosomal_L11_N Ribosomal protein L11, N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.250 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Ribosomal protein L11, C-terminal domain 2zjrF00
1HC8A 2E34A 5DM7F 1VQ8I 1FOYA 1VQ5I 2JQ7A 1FOWA 1VQPI 3I56I 3G71I 5GADJ 1VQ6I 3CCRI 1VQ4I 2ZJQF 1Y39A 3CMEI 3CCVI 3G6EI 1YHQI 3CCUI 1VQOI 3CCSI 3CCLI 3I55I 2FOWA 3J7YJ 2ZJRF 1YITI 3CCQI 3CJTB 3PIOF 1VQ9I 5DM6F 1YJ9I 2QEXI 1VQMI 1ACIA 1YIJI 2NXNB 1VQ7I 1VQLI 3G4SI 3CC4I 2H8WA 3CC2I 2E36A 3J7ZI 3CCEI 2OTLI 5GAEJ 3CF5F 5JVGF 3CCJI 3CCMI 3CC7I 3PIPF 5GAHJ 3DLLF 2E35A 1YJWI 1QA6A 2ZJPF 2QA4I 4IO9F 4IOCF 4IOAF 1MMSA 4UY8I 2OTJI 5GAGJ 3CMAI 1S72I 3CD6I 2K3FA 4V19K 1YI2I 1FOXA 1YJNI 1VQNI 1VQKI
chains in the Genus database with same CATH superfamily
2QQAA 4L18B 3GW2A 3HBLA 1MIJA 1JTXA 1W5SA 2DA7A 1SMYF 3O8GA 4IHYA 3HM5A 3IKTA 1T6SA 3T0YA 5CVRA 2FBIA 1ETVA 4M6XA 3HOUJ 2NS7A 4RB2C 2KL4A 4BHPA 4OIPF 3SZGA 2K9LA 3S1NJ 1W1WE 1TWHJ 1ZG5A 3TO7A 2V79A 1XPXA 1PUEE 2ZXHA 3ABTA 2PMZA 3I64A 4G6TB 3MWMA 1ETQA 3LSGA 4CDGA 5DCMB 2NNNA 3WTSC 3WTZA 4DYCA 4QPQA 2WTEA 1T38A 2Q2EA 2XRLA 3E6MA 2X1EA 4AYBA 4KNYA 2W24A 3CC2I 1JKOC 3J7ZI 3Q9VA 1A5JA 2K9QA 4PSXA 1YW7A 3OIOA 5IYBJ 3CO6C 2QVOA 4C30A 1I3AA 4WXCA 3I54A 3BTJA 1FWZA 3H9QA 4BEHA 4PGHA 3OSFA 2PJPA 4BY7J 1E3HA 5IOYA 1BI3A 1MDMA 3DF8A 4A3DJ 3S32A 2N8GA 1BR2A 1I6XA 4KT5C 4CA0A 2E7XA 5HDKA 1S9HA 3FKIJ 2XF5A 1SFUA 3ZQGA 2OA4A 4ZJZA 3HB9A 2GIZA 3RQ4A 3CC4I 3BR0A 2EFNA 2VIXA 2FEZA 4UVAA 4EJTA 3CC7I 1U6GA 4HAMA 4LIUA 1AKHA 1CGPA 1LDJA 1MBGA 1AA7A 2CQXA 3BR1A 4I6ZA 1D8JA 2HZDA 3QPTA 4A3EJ 4YEJA 4XLPF 2CU7A 1ZELA 1MBFA 2DYSH 4L5EA 3AG4H 3CUQB 2NYXA 1BI2A 2ZJQF 4IHTA 2DMNA 4ANJA 2JUCA 4IL6C 1GLNA 2CV1A 1TTYA 5DD4A 1U8RA 4S0HB 5E8IA 2XGXA 2XC7A 4RA2A 3FXUA 1RKTA 5FFZA 4WK8F 1WKMA 4BU2A 1JT6A 5L3BA 4IHSA 4G8XA 2LK2A 3TBIA 2FMYA 2EB7A 1WJBA 2DMQA 3K4MA 1O3QA 3CUQC 1OCOH 4N9HA 1IDYA 1T08B 2ZXJA 2ZXWH 3ABMH 3LAPA 2YU9J 2LF7A 2Y0SA 3FZVA 3ZR8X 2YS9A 2X0LA 1MBHA 4Z2YA 1OCZH 2QM3A 4ZTFA 3VSKA 4PJLA 2EILH 1R5HA 3ECHA 1S5LC 1XSXA 2OZUA 2P8TA 4LFUA 3U1DA 1R49A 2H8WA 4S05A 1IN4A 5HLTA 3W2AA 3CDLA 2AXLA 4W1UA 1JGGA 4GCVA 3H0DA 1Y0NA 1WHUA 3VWBA 1WJ5A 4V19K 1GV5A 2IPQX 2FBHA 3S3NA 5FRNA 1N78A 2X6YA 4DZJA 3EDPA 4E7IA 3GUDA 4A0YA 2Y30A 3QP5A 2ZKZA 5LHHA 2A6HF 3FBIB 4BHCA 2Y2ZA 3HG9A 4I7HA 4ABZA 1X3ZB 5D4RA 2VJJA 2XPVA 4PUSA 2DLLA 2JZYA 3KPHA 4ON0A 2IA2A 2ZO4A 4XSXF 4LB5A 3ASNH 3RKYA 3V8KA 1LVKA 1A35A 2WAEA 3BC8A 2GWRA 3SDGA 1JT0A 4PFOA 3O2PE 1S6LA 2ZMEB 3Q9SA 2G7HA 3VPRA 4IVNA 2LNBA 3CTAA 4EJWA 2WAQA 2XV4S 1UFMA 1UG0A 1B9NA 3CJQB 4RDUA 4IHVA 5F6FA 2MW8A 3F22A 5J1YA 3H1CA 3V8JA 2FF4A 3M8EA 4XRMA 4IOAF 1MH4A 1O7FA 1TT0A 2H8RA 2R7QA 4ZYGA 2GM4A 2H6CA 3H3UA 2W7NA 2Z5UA 4ENMA 3HKZA 2IGOA 2A68F 1QQIA 4IKFA 1EH6A 3GZNB 2W57A 1LEAA 2A5YB 2F4IA 1I5ZA 4AM3A 4F7ZA 4JOMA 4ESFA 1WJFA 2ISYA 3ZCOA 3EYIA 2WC2A 2E71A 2R5YA 5HS7A 3ZPLA 1LKXA 3C2GA 1U78A 3S15J 5C4XJ 4M71A 2NNYA 3SZTA 4XQFA 2VJIA 2CFOA 2IVMA 1K83J 3EUHA 4BQNA 1NH3A 1FP2A 1X1PA 2FRHA 3Q3SA 2HU9A 2O6GE 5IYDJ 3NEUA 1B8IA 1BA5A 3PO3J 4WF2A 1OCCH 3LQQA 5CPRB 2O61A 3F21A 1U5TA 2QEXI 2RQPA 3LFKA 2JRTA 2H27A 4M3FA 2DA3A 1MJ9A 1LVAA 2GAUA 5E3LA 3CCJI 2EFQA 1JHHA 2Q0OA 4HF2A 4A3FJ 3K1NA 2JT1A 3QPLA 4A3GJ 2FU4A 2EZHA 2EIKH 1VQ8I 3KEOA 1VQ5I 4HG2A 2LY2A 1IW7F 1XGSA 3S3OA 2KIUA 1Z91A 3ZMVA 4KIBA 1H88C 2L9NA 2DT5A 4A3IJ 3OIQA 4BJTA 2E60A 3HIFA 2B0LA 3HUGB 2JA8J 2L7MP 3F72A 3IAS2 4HOBA 2IA1A 3V4GA 1XSDA 1OCTC 1LB2A 3L09A 3J81K 2M0MA 1BR4A 5ILVA 3OIPA 3UR3C 2IT0A 1FBQA 2LBFA 2B63J 2NVXJ 2KIQA 4JQFA 5DYMA 5D6EA 5TRDA 2BE5F 4OINF 2X1CA 1H89C 4BXUA 2JPCA 2QGUA 4II3A 1JKQC 4PFPA 1MSEC 1FC3A 5M5YJ 2ADUA 3WGIA 3LSIA 3VOEA 2LY1A 1DPRA 2R7WA 3GTOJ 2VKHA 2HI3A 3WHBA 4E4HA 1JUMA 3D5LA 2IS2A 3K4KA 3K4NA 3T1BA 3X2QH 3IRRA 4JYKA 1SD6A 1FIAA 2E1CA 2JVGA 3T8TA 1S7EA 5E1WA 3SYTA 4M6VA 2VC1A 1HW5A 2XAUA 2ZFUA 3A0HC 2DU9A 2HQRA 1IN6A 2VBWA 4BBRJ 2A5WA 1YS7A 4AD9A 4A0XA 1KYZA 1ULYA 1O7LA 2KT0A 3LA2A 4IPAA 5IPAA 2RV8A 1U3EM 2LFBA 1E17A 4LLLA 2R7ZJ 3F8FA 3ERMA 3GTJJ 3M07A 4Q48A 1SFEA 2DAOA 4ZDLA 2M8GX 3DEWA 2Z16A 3KX2A 2LR8A 5TGTA 4XLHA 1X4PA 4Y7NJ 2JPBA 2R7VA 3WTTC 4ZDPA 1WWXA 2CS3A 1Y0UA 2V4JC 3GYHX 2NVTJ 4RB3C 2IEKA 3IWFA 1FNNA 2OCCH 2ME6A 3F3XA 2UXXA 1OKRA 2ID3A 1XX5A 2M8EA 3KFWX 3DWLE 2JQ7A 3QODA 1S3JA 4Y13A 2JRMA 5JR3A 5LGTA 2BY3A 3ASOH 3LQRA 4HLYA 3HOWJ 1OMIA 3H92A 1IXCA 2DMPA 5A2QZ 1P4WA 3R4KA 5FB2A 4MEYF 1KQ9A 3MKWB 4FHTA 3QRFF 1B9MA 2JUGA 3LSTA 3DTKA 4BAYA 3TQNA 4AIDA 5L3DA 2XIGA 3M3YJ 1LE8A 1Q1HA 3FHZA 5BMZA 1MMAA 2K86A 5J8CA 2VASA 1FSHA 3BR2A 4AWXB 3S1QJ 4MTDA 3CLQA 1P6RA 3BP8A 4KUMA 2VODA 2MGQA 3QQAA 1XG1A 3BG3A 4M6YA 3N05A 2DMTA 2XDVA 1FOYA 3BOQA 3EUKL 2ZXIA 1UCRA 4YG2F 2LTPA 2IAIA 1ONVA 1R6RA 4MQ9F 4OIOF 3RPQA 4HPQA 5HDNA 1X3UA 3S16J 4IHWA 5E17F 4J19A 2CRGA 2M34A 4DOZA 1LFUP 3DPTA 2ELJA 2PMHA 2HFHA 3BQZA 3DU5A 4W97A 3H3ZA 5GAHJ 1QA6A 5FRMA 2EJRA 4C2UA 3IH4A 5IP6A 3KZYA 5GAGJ 1SAXA 2M4GA 4A12A 1RRJA 2LYCA 4DIQA 4LJZF 3FXOA 3U9GA 5JVTA 2CYYA 5HNFA 2KIMA 5KCMA 4KJZA 5E3MA 4KDPA 1ON2A 3A2KA 2PBIA 3TO6A 1DQUA 5D8LB 1HSTA 1G2HA 4ZZDA 4UUTA 2VPLA 3CCLI 4B3XA 4ESBA 5FJ8J 1P2FA 1UELB 1AU7A 4FX4A 3HYIA 4XBFA 1DGRM 2M45A 3FIWA 4AIHA 3WTYC 2TCTA 2HTJA 5EGOB 2E2HJ 1IXRC 3GCMA 2F5FA 1YX5A 3OYDA 2IBDA 5DTDA 2DFFA 2E1NA 3JRGA 4PJJA 1PVEA 2NVYJ 2PEXA 2YU3A 4KITB 1S7AA 3TP3A 1TL8A 1BJAA 3SZPA 2XAFA 2R7TA 1ETYA 4F3QA 3CCUI 4PCQA 4PK4A 3CJTB 2LF8A 3GFMA 3W2WA 1JKRC 2FQ4A 4RMNA 4Y15A 3VB2A 1FBSA 5D5VB 4HZFA 3G1MA 2STTA 5DD8A 2EWNA 4JP0A 2V9KA 4MIMA 5CJ9A 5C44J 1HQCA 5IT9Z 4I0AA 3VYRB 5FD5A 4E7SA 2CW0F 3BR3A 2BXZA 1ZH5A 2DA4A 3DQVC 2XF7A 2Z1DA 1IJWC 1HLVA 4BXFA 2F4MB 3VODA 3OR1C 5GTHC 3PL8A 3TGNA 1T56A 1BI0A 3N4MA 4M9ZA 3CZ6A 2CW8A 5E79C 1IUYA 4MLOA 1VF9A 2W25A 3KZZA 3EQLF 1PP8F 6PAXA 3K4BA 3TOBA 1ZR2A 1IRFA 3DBLB 3HL2A 4N4OB 4BDYA 2XVCA 4UXNA 3HSEA 3RYPA 1QPMA 3CCYA 3SFIA 5C4JJ 1HSJA 2MABA 4XLNF 2GOMA 2OUMA 3CQZJ 2BOLA 1Z1DA 1ZAOA 2EBIA 3BLYA 3GMEA 2LBFB 4XK4A 2A07F 1N75A 5H6QA 1RIOH 3Q0UA 5F64A 5EGOA 1DGWY 5ICGA 1T95A 3I5UA 3PSIA 2KDZA 2CH0A 1LQ1A 3HUGA 4KFCA 4G7OF 1FYLA 2P7CB 2QSHX 5HLHA 2MC4A 4M3EA 4DYRA 2MYSA 4G94A 2RAEA 3G1LA 1UMQA 2L01A 2MD5A 4U7DA 1XSVA 4L9NA 1Z21A 3GXOA 1QGPA 2VT2A 4LLGF 5E8GA 1D1AA 1J5YA 1OCPA 3Q0WA 3U2RA 3GF2A 4A5MA 1HA8A 1YTYA 1RKWA 5F0HA 2LSOA 3CCRI 2V1NA 5EF6A 2MH9A 1D0XA 2E2JJ 3GTMJ 1X58A 2ZSIB 2XGCA 3E5XA 3VDXA 1YFHA 2DFIA 2GA2A 4NQWB 3LL7A 4A3BJ 3FM3A 1YOVB 4JX5A 1YRNB 3DP7A 1W4MA 1WGXA 1NG7A 3DBHB 1TWAJ 2HKOA 4XN3A 4EGYA 4NC8A 2HQNA 3MQ0A 2JA5J 1EA3A 3BG6A 3M8JA 1VQPI 2EPFA 3CESA 3M1EA 3CMEI 3CCVI 5E3NA 2K5CA 2ZCWA 4OAZA 3FK7A 3MMYB 5L3EA 4YRVA 4HEA2 4A6EA 5D5WB 1JUPA 2VBZA 5HDGA 2AS5F 1QU3A 2HVRA 1TQMA 1KU3A 4XMYA 3EYYA 3PNYA 5IP9J 3ZMUA 1ZQ3P 3BCAA 3HOXJ 2FD5A 1C0WA 2O3FA 4ZYHA 3OY9A 1XS9A 2W84A 2IS4A 4NB5A 1HXDA 2JK3A 1IV8A 4U0WA 4D9JA 5DDGA 4BACA 3L2QA 1LUJB 1MNMC 2O0YA 4BH9A 2BZTA 3CCSI 2F5EA 1IRXA 2PQ8A 4OOIA 4O5VA 4CO8A 3J80K 1U5TC 1ENHA 3ZN0A 5LLQA 2CV2A 4MO7A 5F1RA 5LHIA 2ZMEA 3I4NJ 4LIVA 4HNVA 5FLVA 3T8RA 4F92B 4U7BA 2M9HA 5K7HA 2IA0A 2YX7A 3HRSA 1Z05A 1OCRH 4JX6A 2ESHA 3WGGA 1EV7A 2ZBKA 5LEKA 3F8BA 2VJ5A 2ZSHB 3I4MJ 2GA1A 1F1ZA 4BHBA 2Y31A 2XUBA 5DV5A 5ILSA 4AYBN 1ODDA 1VQMI 3FISA 3FXKA 3K0LA 2KZVA 5FKOA 4AC0A 3IUOA 2HPMA 3H5NA 1D3YA 1USTA 2DQRA 5H6RA 5M3MJ 3E97A 1IF1A 2MBFA 1WJAA 1U8BA 2EFWA 1YJNI 2UWMA 1FP1D 3R61A 3FM5A 3SFZA 2QSGX 4I98B 2PLYA 2NVQJ 2IS1A 5E18F 3JRFA 4I09A 5FO5A 5M5XJ 4BJ5C 1H0MA 3KZIC 1N25A 3PIOF 3JTHA 2W1OA 4IF4A 4CXFA 1OPCA 3V7SA 2I8DA 2EZIA 4YFXF 2JWTA 1Z6TA 2LH9A 5GP9A 5HVQC 2DA1A 3CCEI 5EZHA 2O5RA 2FMLA 4UB8C 2X4HA 1G8XA 5J6XA 2HNHA 2VB6A 1Y1WJ 3KLOA 4PDKA 2R7OA 2XGDA 4B3AA 3A01B 3HJEA 5LGNA 3IL2A 3ZRGA 3ULQB 2IJLA 3DV8A 2KHMA 2LVSA 4NHJA 4ENNA 2RN7A 1HW2A 2Y9ZA 1W5CC 4HV5A 3WE2A 1FOKA 2BXYA 2NRAC 2XPWA 3CUQA 2MLGA 3FF5A 3RTRA 5IT3A 2F5DA 4XR6A 3F0CA 2GOXB 1ETWA 1APLC 3QYBA 2RGVA 4HSTA 9ANTA 1AKHB 3L7WA 2X51A 3Q0VA 2LREA 4EM1A 4N9IA 1B1BA 4FISA 4JK1X 2ME0A 3B02A 1TT5B 3SDBA 3VYTB 2R7XA 2HDWA 2R0QC 3S1RJ 2O8XA 1K78A 1RI7A 1Z3YA 4M9XA 3CJRB 5TJJA 1R5GA 2P7VB 3IV5A 4BQAA 3DPLC 1BIAA 4XNFA 2HPIA 3BY6A 3R60A 4HX4A 3WG7H 3J80Z 3IKVA 4NC6A 1ETOA 1UG2A 3KYDB 3TMOA 4AIJA 1MDMB 2XAQA 1OJLA 1WPKA 3MN2A 2MFZA 2K9SA 4B47A 1QHGA 3CP2A 4FT8A 2YPRA 4K2EA 3S93A 1EKEA 2WY7Q 2O03A 1NHAA 4Y33A 2P0WA 3OYIA 3GBGA 3CD6I 5JHUA 3GEZA 3ISPA 2IGMA 2QF7A 4KMFA 3JREA 1P4XA 1IC8A 4UNOA 4YIFA 2R93J 1J09A 1BL0A 1BOBA 1ORKA 4CCOA 3OYBA 4YIIA 3CMYA 1WI9A 3QPHA 1K7AA 5JLXA 3H36A 1SVLA 2DA5A 2IXSA 1P92A 2HQAA 2Q8KA 2HKXA 2DXIA 5DCMA 4FQGA 2D5VA 2W00A 5BNGA 2VONA 1K78B 5DUKA 1IN5A 4U0VA 5F0FA 2XHKA 3S3MA 1W5TA 3FKJA 1U9NA 2DA2A 1IRGA 2K3FA 1T0FC 4BEHB 3W6KB 3BTLA 3R0JA 5D4SA 3LAJA 3I59A 3DTIA 4RGRA 5ERIA 2F2EA 4AVPA 1HDDC 3KLNA 2KJBA 3WTXC 2PG4A 2LRDA 1VQ9I 1K6OA 4BQOA 4HF1A 4KMUX 4CCJA 5M3FJ 2WADA 1RPWA 4L5IA 2K85A 2QYOA 2MLKA 1W0UA 3IWZA 1WCMJ 3K70D 3AL0B 1ZRFA 3A01A 4LK1F 2Y75A 5FFXA 4ZYDA 1GXQA 5ILUA 3HGGA 2CJJA 4IRIA 1ZK8A 1F9NA 3QYFA 3BG5A 2VOOA 2CUZA 4ENKA 1D8KA 2XROA 4XN0A 3LSRA 2F5CA 3ZP5A 3JAMZ 4GYGA 1YJ9I 2DPDA 2YSRA 5HS8A 2QUFA 1OYWA 2HWVA 1MMDA 1NK3P 5E3OA 5H2FC 1PUFA 2HOAA 4MQVA 5C3EJ 2QA4I 2E1MC 4V2GA 4QLCU 3WTVC 3KP6A 1SVOA 2ECBA 1PUFB 2KLOA 3K6GA 2BVMA 2CUEA 3HHHA 3OYAA 2DT7B 4D1QA 1FLIA 1UHWA 1WVRA 3CDIA 5IT9K 1E0EA 4DJAA 1NG6A 3C18A 3K69A 3P9IA 5DM6F 2KQRA 2R7DA 4M3BA 4Q47A 3OS1A 1QVTA 1KA8A 2ECCA 2CUFA 2L4MA 2M30A 2JSPA 2CUJA 3VYUB 1BBYA 4F91B 5FKMA 3OYLA 3LA3A 1R9TJ 5BPDA 3Q5FA 4XLFA 4RM2A 1YW8A 4XLEA 4E70A 1KU2A 1F5TA 3KCCA 2KFDA 1D1CA 2JA7J 4RB1A 5GPCA 1BN5A 1L3LA 2EA4A 4B43A 3GTPJ 5K7ZA 4DYQA 2VQGA 4LMYA 3HTUA 1GHCA 2D1HA 2AQEA 4RS8A 3I59B 1FPQA 1TLHB 4RBOA 2BW3B 4L5JA 3NARA 4KIGA 3PFYA 2EV6A 3FHNA 3OS2A 2CG4A 2DFHA 4C3IJ 1JTYA 5J3LA 3VEPA 4XRSA 5FROA 3S14J 2GQQA 4BL0B 2DFEA 1SFXA 5AONA 2Z3YA 3OS0A 3E6DA 4HW0A 4BQQA 1R4MB 2UV1A 3WU1B 2RNGA 1FEXA 1SD4A 5GTIC 1SAUA 2P6SA 3OYFA 2KPMA 1BW5A 2EIMH 5B66C 4U0YA 2Y0MA 2NOJB 4DQ2A 1J0RA 4XOPA 3BJAA 5LFAA 1VFCA 1DP7P 1VQKI 5KK1A 3CP8A 1Z7UA 5EEHA 2GXAA 1FOWA 1SC7A 4NQWA 1O3RA 1QBJA 2LY9A 1OYYA 3RZDJ 5HS9A 3JAMK 4X0GA 2R3SA 3GZ5A 4O3MA 5KNLA 1LNWA 4H0EA 3QU6A 1G6NA 2L02A 1DU0A 2FX0A 1FMVA 1UJ8A 2XRNA 4LB6B 4MGRA 2V1XA 3CLOA 4WCGA 2A05A 4OMZA 1OLTA 5D6FA 5L3GA 3IP4B 4PSWA 5EYRA 1G4DA 3HPGA 2QQ8A 1NK2P 3OYGA 3DCFA 2PI0A 4IRGA 2KISA 3I3LA 1MNDA 2CMPA 4AVZA 4M3GA 5CYVA 1B4AA 4MFEA 2QENA 2TDXA 5LRRA 5FKKA 1XGMA 3RI4A 1W36D 3LSJA 1BOAA 2ZNYA 3BTCA 3M8FA 1ITYA 2L3DA 3MKLA 4I2OA 1PJRA 2M87A 5GAEJ 5K5OA 1FBUA 3WU0A 1O3SA 4M72A 4XKWA 4MHGA 1TP4A 4PJNA 3GTQJ 3SEQA 4ETSA 3F8CA 2DOEA 3A1YA 2EFOA 4UUVA 4QIWN 1OFCX 1LJ9A 4CH7A 2B9SA 1MSFC 1J59A 4V2FA 2BYVE 4X6AJ 5K7FA 3REOA 4S04A 3K1MA 5KVRA 1PP7U 5HLIA 4UV9A 3JTGA 2R7SA 5IP7J 4M74A 1E3PA 3LOCA 3ROUA 2MC3A 2CV0A 3AG1H 2CW7A 1O3TA 4CGZA 3M4OJ 3G4SI 1YIOA 3ZQLA 1YQAA 4EM0B 2K27A 4P1WA 1B72A 4BE2A 2HDDA 2LKPA 2OZ6A 1P7IA 1D0YA 5ICEA 3CMAI 1SVMA 3KEYA 5CVVA 4I76A 5J1RA 3ZQIA 3KYLA 2JVHA 1BR1A 5JHFA 3M1CA 1IZ1A 1T39A 1IN8A 2E5NA 3FXLA 2XB5A 5D8KB 3F9KA 2P5LC 1X3WB 4HV6A 1I1GA 5EEAA 3KETA 1T33A 3MZHA 3G3ZA 2PX9A 3OYCA 1P9QC 3NRVA 1A31A 3GTKJ 1FMWA 1XDSA 1XDUA 3KYCB 1I6HJ 4UUSB 3QYEA 1VNDA 1Z0XA 1YI2I 1B59A 2RKHA 3W6VA 1IRZA 2KIFA 2ZJ2A 5CQEA 2DT6A 1MKMA 2BEOA 3UKGA 2AQFA 1TQPA 3HRUA 4QPOA 5BPIA 1N77A 2EFPA 1SD7A 4ZC3A 1REPC 1HKQA 3I71A 3PO2J 3I0TA 2H94A 1TW2A 1X1CA 5F0CA 3L00A 1QO0D 2FQ3A 2LKSA 3RCOA 1ZN2A 2VQHA 4GXOA 4CCKA 4C2TA 1MJBA 4R1HA 3DLLF 1UZCA 2LOOA 1D5YA 4L9VA 1GVDA 4F55A 3S2DJ 1JHFA 3DLAA 3ZMDA 3H9GA 3BROA 3G73A 3CF2A 4FCYA 4B48A 4IX7A 3SHFA 2WV1A 3EUAA 2E2IJ 1HC8A 3O6BB 5DCFA 3MZYA 4IJAA 1UAAA 4XICA 1TC3C 2X9DA 1X1BA 3WTWC 3HHGA 1MGTA 4CUGA 5L3CA 1LDKB 4CYDA 3ABUA 3R6SA 4TV7A 1KQ8A 2BHYA 1VI0A 1HKTA 4A5NA 4H4KC 1NTCA 4NNJA 1A6QA 1ON1A 2KDOA 2HEOA 1J9IA 3PIPF 1W36C 2K40A 3BTIA 1MMSA 1UHMA 1I39A 4G6QA 3WG9A 4FASD 1OQYA 3HDDA 2VLAA 4UVBA 3F6VA 1YRNA 2VBYA 1JGSA 4L9JA 3KP3A 1ZR4A 3ZQHA 4P55A 1STZA 1OR7C 3RSNA 1G59A 3AL0C 2ID6A 2XKOA 2BHZA 2CWEA 4HQMA 1JJ8C 4B8XA 4L0ZB 3TO9A 3K4LA 4MFDA 3AKZA 2O7OA 4NDLA 1WRJA 2CGPA 2H09A 2HXOA 3QWLA 1UB9A 1X1DA 4II2A 3P9CA 1U2WA 3B73A 3JRDA 2CFXA 1KQ0A 1BM9A 2DDAA 1D1BA 1IO2A 4FE7A 2X85A 3CUOA 4A93J 4MNUA 1CF7A 2BBYA 2HVQA 3DEEA 1Z77A 3LA7A 3C7JA 3WODF 5LRSA 2R7RA 1Q1VA 2LG4A 2L7KA 2QQBA 2O9LA 1DPUA 5JVGF 1F36A 3RJPA 3P5JA 2MD0A 4J01A 1RZ4A 1YO5C 3ZQCA 3DTEA 1O57A 1XMAA 3WHCA 4AU7A 2QSFX 3B6AA 2G7UA 2L7FP 1Z6RA 4U87A 3AG2H 4HNUA 1WH5A 2DQLA 2E1OA 5FGMA 5ED4A 1FTZA 1I50J 4EJUA 1Z3XA 4R8HA 3IH3A 2FNAA 3C2HA 4A69C 3BZ6A 3OYKA 4LK0F 2XAJA 4LG3A 2EV0A 3IRQA 2OV7A 3P7NA 2FNPA 4LITA 5IOZA 3H3VK 2J5OA 4GGGA 2ETHA 3BPXA 3K4CA 2JTVA 1X2NA 2KMUA 1SFOJ 1QNTA 2UZKA 1RUNA 3RKWA 1MBEA 4KN7X 4XSZF 4BYYA 1YHQI 2ESNA 1S7OA 3DEUA 2DI3A 3GFJA 2UXNA 3HC7A 4JBAA 1YIJI 2L5QA 1H9TA 3HOVJ 1MMNA 2M0CA 2EINH 1T98A 2E36A 5F1JA 2FOKA 5EEGA 3JW4A 4UVCA 4ASNA 2VL8A 3BWGA 4HNTA 3WU2C 3KP5A 1WQ2A 2BY2A 2FE3A 3H35A 1D5VA 4WX9A 2E19A 4GYIA 1RUOA 1QVUA 1HCRA 3HZJA 1R58A 4GRIA 3JRHA 2K3PA 1V55H 3QU3A 3S1MJ 4EM2A 3OWTA 3PSFA 2K7LA 1MW7A 4XOTA 3VSLA 3ZXSA 1MBKA 4EVIA 1K61A 3H5RA 3M7GA 2XASA 2F6CA 4IXAA 3DKWA 5CLSA 1R22A 5J8FA 4I99C 2XSJC 2WA0A 3JRCA 4I0BA 5M5WJ 4E7ZA 2W85A 2ZJPF 1Y56A 4KIFA 2LD5A 2W82A 2EZKA 1V5GA 3KP2A 4CZZA 4EV0A 4XL9A 1BIBA 2M7AA 3PNTA 3VFZA 4YFNF 1DP3A 1XMXA 1R4NB 2Y9YA 3D0SA 3SEZA 4A2UA 4B4CA 3KE2A 1JI8A 5BS6A 4PJMA 2LC2A 2CQ7A 2GXGA 1M1EB 1R7JA 3MZ8A 3V42A 3D5RC 2J5PA 1X2MA 4L0YB 3ZQFA 4P5OA 1CQTA 5AIPA 4UY8I 2FUG2 5E1XA 3LWFA 4GFBA 2LMDA 2WB1A 3PUFA 5E1ZB 3OYMA 3BG9A 1XCVA 2H6BA 1AOYA 1D0ZA 3K2AA 4NBQA 4CYCA 3OR2C 2XF6A 1LE8B 4XORA 2OQGA 3S8PA 1TWFJ 2PN6A 2R92J 2OBPA 1KYWA 4CCLA 5LHGA 3LMMA 5HODA 2PMZN 2A69F 4Q4ZF 4KA4A 3SJMA 4HLXA 3R0AA 3RQIA 3GTLJ 4OAYA 2PFBA 4ZH4F 1V4RA 4E7HA 4QWQA 2X48A 4ESJA 2E35A 4XLAA 4I02A 2AXTC 2NS0A 4A3KJ 3N97A 3H5AA 3HSRA 2V9PA 2M7BA 3QAHA 3HOYJ 3ZMSA 1S29A 1MNEA 5JI6A 2F48A 2TRTA 4M3DA 2Z2SB 3ERED 1RETA 3OYJA 2KKOA 2QLZA 3HRTA 1ZKGA 3W2VA 1IGNA 4KICA 4A0ZA 3OYHA 4XLCA 3V7CA 3L2VA 4C2MJ 1V5FA 5B1BH 3E6CC 4IQ4A 4A3CJ 3E0JB 3T5XA 3C1DA 1F4KA 1J2XA 1TNSA 5D5XB 3V8LA 2DW4A 5LD2C 1BJZA 2MG4A 2P4WA 2RQQA 2G9WA 1AHDP 4MTEA 1ZLJA 1GUUA 2CQNA 3TW7A 3ZQ7A 2QCOA 3CJNA 4C3HJ 1FX7A 3RIRA 2HYGD 3OYEA 3HGYA 3TL4X 4Q5SF 2O8KA 1ZGJA 1XD7A 1YW9A 4Y4RA 4DBRA 2L9VA 1W0TA 3MVPA 4HDUA 3E6BA 2EK5A 2DOAA 2V1DA 5A2QK 4RAYA 2V1UA 1XTAA 3HOTA 1XMKA 3HOZJ 2HOEA 4ZDOA 2L9SA 3P9KA 1QZZA 3D1NI 4XRSG 2VPRA 3TDZC 3RPUA 1LFPA 2ZNZA 2A6TA 2XGEA 3ML6A 3F6OA 5EDNA 5GPAA 4LLNA 1FZPB 1ZYRF 3OOUA 3EUHC 3GWZA 1FJLA 2BVLA 2R7FA 2R5ZA 2OD5A 3HXLA 1YLFA 1TNTA 4XKBA 3M9AA 2DYRH 3FK6A 1SD5A 4ZZLA 3JRBA 3A03A 1YITI 2XAGA 3BR6A 5LGUA 3EETA 1ACIA 3ABLH 3L2WA 5EJCA 2ZC2A 1HBXG 4OMYA 2JMWA 4CYCB 2QKMB 3RYRA 1J7KA 1VTNC 2W4SA 2K4JA 1Z7LA 3L1PA 3LSKA 1MH3A 3ABKH 1GXPA 2IGKA 4RAFA 1SANA 4GO1A 3GO5A 2GLOA 2KRFA 5DEQA 4IQJA 1Y39A 4CCNA 1BI1A 1SMTA 5K5RA 4YFKF 3HTSB 5ICCA 2DDBA 1JUSA 1G3TA 2R7UA 3K4JA 3FMQA 4G9YA 1YE9A 1VQLI 2E7WA 2GIVA 2KRHA 3PNVA 4OWRB 2GZWA 1IDZA 1XC5A 1QHHD 5ICFA 1FT9A 1RNLA 3BPVA 3OV8A 4E7JA 3PFIA 3LFUA 3LSMA 3W6JB 3ESWB 1R23A 3DKXA 1UHSA 1A04A 2D1VA 2K9NA 2VE8A 2XB0X 3PQKA 1L0OC 5FKLA 2KJCA 5GADJ 2CO5A 4EQQA 2ELHA 4BDZA 1R71A 1U5TB 1WFXA 2IW5A 4P96A 4CZCA 1GVJA 5LBQA 2EA2A 3ZGKA 4P9UA 1B8IB 3PJRA 5BQTA 3JSPA 1PYVA 5JFRA 3L9FA 4WXHA 3O3KA 2D2WA 4A6DA 3CCMI 1V3FA 2WB1N 2WAFA 3U1KA 3BG7A 1BW6A 1RC9A 1V54H 5FLMJ 2R5YB 1ZGAA 2CSOA 4G7HF 4E7KA 2I5UA 3DBRB 4R79A 3JSOA 5H20A 4E6KG 4CSWA 2HS5A 3GTGJ 1S8NA 3FXRA 1EH7A 3K1PA 2K9MA 4RB0A 1A6IA 1RESA 4B1RA 3JR9A 3NWTA 3QOPA 1IN7A 2R5ZB 2F4OB 2ACJA 4LOCA 2VC0A 5F27A 4OIRF 3I53A 1JE8A 2OQRA 1QPIA 3QP6A 1XB4A 2VQCA 5JLWA 4AIKA 2L9RA 5FD6A 1R5ID 3WGHA 2DCEA 1TWGJ 2Z9OA 2XKPA 5B5EC 3H0GJ 4IEJA 1KZHA 4HYEA 4HBLA 2FSWA 2G0EA 3HRMA 5B3SH 4F52A 1RR8C 4XONA 2ZJRF 4XKCA 2EZLA 3COAC 1K4SA 1IAWA 2WBMA 4Y52J 4M9SA 3TW6A 2COBA 2P5VA 2P5KA 2X1DA 3BJ6A 4D5CA 5E20A 4LGWA 1X4OA 4O6JA 1KU7A 1R36A 2HDCA 2VKEA 1ETXA 4F93B 2Y0SN 3IH2A 4A3MJ 1SEUA 2OTJI 1LPQA 5BOXA 1XGNA 2OF7A 2DK8A 2DPUA 2L4AA 2M4KA 3H9JA 1X19A 3NAUA 3V7RA 4FTHA 1ZG1A 3I58A 1FTTA 2VQLA 3GFIA 2RDPA 3HSFA 5F04A 5TISC 2H1KA 2PMUA 2JSCA 2DMUA 2EQRA 2MA3A 1QZEA 1Y8RB 3GVAA 1P4AA 5CVJA 3FWEA 1POGA 2W48A 3FXJA 2IRFG 3NQOA 1CF7B 1MD0A 4BXXJ 4KN4X 3CF5F 2JJ7A 2LP0A 3K10A 3UNGC 1YJWI 5J4VA 3W3CA 4HRIA 5FLXZ 3RPUD 1H9GA 3FBNB 3IHUA 2FJ1A 2WV0A 4WXDA 4DBQA 1JJ6C 1IV6A 1FYMA 1R1TA 2L0KA 1VZ0A 5L3FA 1HDPA 4RGUA 4BNCA 3E1SA 3KIOA 2DO7A 1PDNC 4HQEA 2YX4A 1WJEA 3GLXA 4B44A 4DGWB 2FBKA 5HLGA 3HOSA 2Z33A 1J75A 3ELKA 2A3SA 4IO9F 4IRHA 4IHXA 5EZGA 3BCBA 3C2BA 3GFLA 3I9V2 4LD5A 3F8NA 2DJIA 1U9OA 3OSGA 2HGCA 2P6TA 1Z9CA 2DOFA 1Z67A 3AG3H 3K2ZA 3ZMTA 4CCMA 5K5QA 1TZLA 2HYJA 1ZLKA 3RZOJ 2FOWA 1W7PD 2WY8Q 3GX4X 1XGOA 2LKXA 1MMGA 2HYFA 3EPZA 4BUPA 3ZMZA 2EIJH 1VQ7I 1JKPC 1TWCJ 3NWSA 5AIQA 2OJED 4BJ6C 1GT0C 2VOPA 1R1VA 3OL4A 2VXZA 2V6CA 1ZARA 3MD2A 1ZTRA 2DTZA 1S72I 3OOPA 1E2XA 3MCZA 1W7PB 3AAFA 1P7JA 2YR2A 2OU2A 4XM3A 3F8MA 2E5ZA 2I10A 1WSUA 1IXSB 5DS9A 1R00A 1I27A 3CCQI 3K9TA 1X1AA 3RDIA 1U0JA 4LG0A 3OL3A 3S17J 2IS6A 3MEXA 2KRCA 2YUSA 2ICWG 1XCBA 2A61A 2B7EA 3TP0A 2LLKA 3VYSB 1FYKA 2XAHA 1GV2A 1I3QJ 4FX0A 2COMA 2QKLB 1WJCA 2X6OA 2X6XA 3K7AJ 2HQ5A 4MEXF 3J7AO 2KZGA 2JA6J 4ZTJA 5B1AH 2Q1ZB 4D5FA 3ONQA 1ZREA 4DNCA 4G7ZF 4KYWA 2VI6A 1IG7A 1VQ6I 4XRFA 3A0BC 4NC7A 1WJDA 2V7FA 4EJVA 3D5SC 1OISA 2V26A 1HW1A 1MZBA 2AO9A 2HXIA 2Q2EB 3BDDA 5LEJA 3WTUC 4OU0A 3KEQA 4YIRX 2V6EA 3RKQA 4BGDA 3J7AY 2M3AA 3O8HA 1ZHFA 2EV5A 1K4TA 2Y48A 5D5UB 3KP4A 2V9VA 4E7LA 2NS8A 4I01A 4HF0A 5CVUA 3FX3A 1QZYA 4BE0A 5K1YA 3I56I 2ELKA 5J40A 4EGZA 4BS9A 3PUBA 3G6EI 3BZCA 1ZRCA 1TW3A 3E5QA 2R4GA 2BGCA 3FXMA 2DA6A 2XPUA 4PZJA 2M2EA 4BE1A 2CQQA 2H1LA 5HNHA 1LEBA 2MH2A 1Y1VJ 1OR7A 3QOEA 4HX7A 2BY1A 4UB6C 4JX4A 3ZOBA 3IAM2 2EH3A 5EG0A 2CQKA 2JA2A 1FOXA 3HPHA 2Y69H 3PQJA 5DM7F 3ZQQA 1TQIA 2QZ8A 4CHUA 3IC7A 2BV6A 3FXQA 2PJRA 1EF4A 4QSHA 4G12A 2GXBA 2HTSA 4ZYEA 2LDUA 2ZB9A 1VQOI 2X6WA 2WAQN 1SFKA 1HOMA 1YYVA 4Y3OA 4M73A 1OYIA 2K4BA 4C9YA 5KAIC 2DN0A 3DFGA 4G6DA 3B6CA 1G3WA 4C3JJ 1XN7A 2VKVA 4EJOA 1Y6IA 4BBSJ 4D0PA 2NOGA 3A02A 1ETKA 3WE3A 4AUXA 4IZZA 2QBYA 1FIPA 3DU6A 5CKTA 1AWCA 1I1SA 2IGNA 3MKZA 1R1UA 3BZKA 3JRIA 1DUXC 2OPTA 1JXSA 3GLLA 2RREA 2VXDA 4RGSA 3J7YJ 2F5VA 2FA5A 1YS6A 1G3YA 4HX8A 4A3JJ 3QPSA 2UUZA 3CDHA 4ZYAA 2NVUB 2WWYA 3K70C 1DU6A 4RLQA 3PM1A 4RLFA 2ZMEC 2VUMJ 1MJAA 3TDUC 2KP6A 4KISA 4X1EA 2IP2A 4NUBA 1DDNA 1V5EA 2E34A 3JRAA 4D7MA 5F08A 5CVIA 2QWWA 3MKYB 1VQ4I 1O4XA 2A6EF 3L2UA 2DTRA 3I55I 4LG0B 3F23A 3LSHA 2VN2A 3G1OA 3A4CA 1E3OC 3BR5A 4FE4A 2RC4A 3S2WA 4Y17A 2AHQA 1H8AC 3DKYA 2STWA 4A3LJ 2HOSA 3S2HJ 1W7PA 4OIQF 1ZRDA 2VKDA 5FKNA 2NAZA 5DUIA 4ITVA 2RNJA 1WZ2A 4J00A 3FDYA 3L2RA 2DK5A 1EJ9A 4YELA 3LNQA 1YG2A 1YX3A 2BW3A 3MAJA 3OYNA 4Z6YA 1USSA 4XIDA 3ECOA 3LSPA 3BT9A 1ERDA 4L9TA 3SQNA 4GDFA 3OMYA 4EATA 1LDDA 4UHTA 4D7NA 2HVSA 3FMSA 1HF0A 5CQGA 1IUFA 2NXNB 1K6YA 2OCEA 3ZN1A 3E3VA 4N0BA 4XKVA 2E1MB 4CICA 2XSDC 3E5UA 2JN6A 3FMRA 1A36A 4KT6A 2GBYA 3RKXA 3HKZN 2FXAA 1FSEA 4UV8A 2ZFWA 3CO7C 4P9FA 3AFHA 4PGGA 4UUSA 1WH7A 4HA8A 4BKXA 5J4YA 5IYCJ 2DODA 1B6AA 1K79A 1BC8C 3SXYA 1BC7C 4RAZA 2VE9A 4HDVA 1MBJA 5KAFC 2QQ9A 3DPUA 1WI3A 4RGXA 3MFKA 1GDTA 3BQYA 3CMMA 4DW6A 4QTRA 1G3SA 3I4PA 2ISZA 2D45A 1Y8QB 2DJNA 1HKSA 4WWCA 2HR3A 5IY5H 3C3WA 4EMSA 1T8IA 3U21A 2M5WA 2P81A 2C6YA 5J1UA 2HOTA 2RVCA 3TOAA 1KGSA 1F43A 2QBYB 5FLXK 2L7ZA 5J47A 2M1BA 1VQNI 2L54A 2VT3A 1ZGWA 4U88A 1B72B 3E7LA 3G71I 1QRYA 5HOOA 2DBBA 3TEDA 3G2BA 2Z99A 4BY1J 3GZ6A 1TBXA 3TKYA 4HSRA 4RAGA 3DXJF 1FY7A 2BY0A 2HZTA 2L2OA 3HEFA 4RM3A 1RR7A 3BJOA 4N4NB 2OAZA 2K02A 3J81Z 4ENJA 1T2KA 2VBXA 2PJRB 2OTLI 4B09A 2OC6A 4EEFG 1EH8A 3JCUC 4IOCF 2MSYA 1KONA 5EG0B 2VJ4A 4FETA 5KHDA 1ZG3A 1KU9A 3L2CA 1LFBA 3KP7A 1T0FA 4DZPA 4PJ0C
chains in the Genus database with same CATH topology
1HC8A 2E34A 5DM7F 1VQ8I 1FOYA 1VQ5I 2JQ7A 1FOWA 1VQPI 3I56I 3G71I 5GADJ 1VQ6I 3CCRI 1VQ4I 2ZJQF 1Y39A 3CMEI 3CCVI 3G6EI 1YHQI 3CCUI 1VQOI 3CCSI 3CCLI 3I55I 2FOWA 3J7YJ 2ZJRF 1YITI 3CCQI 3CJTB 3PIOF 1VQ9I 5DM6F 1YJ9I 2QEXI 1VQMI 1ACIA 1YIJI 2NXNB 1VQ7I 1VQLI 3G4SI 3CC4I 2H8WA 3CC2I 2E36A 3J7ZI 3CCEI 2OTLI 5GAEJ 3CF5F 5JVGF 3CCJI 3CCMI 3CC7I 3PIPF 5GAHJ 3DLLF 2E35A 1YJWI 1QA6A 2ZJPF 2QA4I 4IO9F 4IOCF 4IOAF 1MMSA 4UY8I 2OTJI 5GAGJ 3CMAI 1S72I 3CD6I 2K3FA 4V19K 1YI2I 1FOXA 1YJNI 1VQNI 1VQKI
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1HC8 A;  2E34 A;  5DM7 F;  1VQ8 I;  1FOY A;  1VQ5 I;  2JQ7 A;  1FOW A;  1VQP I;  3I56 I;  3G71 I;  5GAD J;  1VQ6 I;  3CCR I;  1VQ4 I;  2ZJQ F;  1Y39 A;  3CME I;  3CCV I;  3G6E I;  1YHQ I;  3CCU I;  1VQO I;  3CCS I;  3CCL I;  3I55 I;  2FOW A;  3J7Y J;  2ZJR F;  1YIT I;  3CCQ I;  3CJT B;  3PIO F;  1VQ9 I;  5DM6 F;  1YJ9 I;  2QEX I;  1VQM I;  1ACI A;  1YIJ I;  2NXN B;  1VQ7 I;  1VQL I;  3G4S I;  3CC4 I;  2H8W A;  3CC2 I;  2E36 A;  3J7Z I;  3CCE I;  2OTL I;  5GAE J;  3CF5 F;  5JVG F;  3CCJ I;  3CCM I;  3CC7 I;  3PIP F;  5GAH J;  3DLL F;  2E35 A;  1YJW I;  1QA6 A;  2ZJP F;  2QA4 I;  4IO9 F;  4IOC F;  4IOA F;  1MMS A;  4UY8 I;  2OTJ I;  5GAG J;  3CMA I;  1S72 I;  3CD6 I;  2K3F A;  4V19 K;  1YI2 I;  1FOX A;  1YJN I;  1VQN I;  1VQK I; 
#chains in the Genus database with same CATH topology
 2QQA A;  4L18 B;  3GW2 A;  3HBL A;  1MIJ A;  1JTX A;  1W5S A;  2DA7 A;  1SMY F;  3O8G A;  4IHY A;  3HM5 A;  3IKT A;  1T6S A;  3T0Y A;  5CVR A;  2FBI A;  1ETV A;  4M6X A;  3HOU J;  2NS7 A;  4RB2 C;  2KL4 A;  4BHP A;  4OIP F;  3SZG A;  2K9L A;  3S1N J;  1W1W E;  1TWH J;  1ZG5 A;  3TO7 A;  2V79 A;  1XPX A;  1PUE E;  2ZXH A;  3ABT A;  2PMZ A;  3I64 A;  4G6T B;  3MWM A;  1ETQ A;  3LSG A;  4CDG A;  5DCM B;  2NNN A;  3WTS C;  3WTZ A;  4DYC A;  4QPQ A;  2WTE A;  1T38 A;  2Q2E A;  2XRL A;  3E6M A;  2X1E A;  4AYB A;  4KNY A;  2W24 A;  3CC2 I;  1JKO C;  3J7Z I;  3Q9V A;  1A5J A;  2K9Q A;  4PSX A;  1YW7 A;  3OIO A;  5IYB J;  3CO6 C;  2QVO A;  4C30 A;  1I3A A;  4WXC A;  3I54 A;  3BTJ A;  1FWZ A;  3H9Q A;  4BEH A;  4PGH A;  3OSF A;  2PJP A;  4BY7 J;  1E3H A;  5IOY A;  1BI3 A;  1MDM A;  3DF8 A;  4A3D J;  3S32 A;  2N8G A;  1BR2 A;  1I6X A;  4KT5 C;  4CA0 A;  2E7X A;  5HDK A;  1S9H A;  3FKI J;  2XF5 A;  1SFU A;  3ZQG A;  2OA4 A;  4ZJZ A;  3HB9 A;  2GIZ A;  3RQ4 A;  3CC4 I;  3BR0 A;  2EFN A;  2VIX A;  2FEZ A;  4UVA A;  4EJT A;  3CC7 I;  1U6G A;  4HAM A;  4LIU A;  1AKH A;  1CGP A;  1LDJ A;  1MBG A;  1AA7 A;  2CQX A;  3BR1 A;  4I6Z A;  1D8J A;  2HZD A;  3QPT A;  4A3E J;  4YEJ A;  4XLP F;  2CU7 A;  1ZEL A;  1MBF A;  2DYS H;  4L5E A;  3AG4 H;  3CUQ B;  2NYX A;  1BI2 A;  2ZJQ F;  4IHT A;  2DMN A;  4ANJ A;  2JUC A;  4IL6 C;  1GLN A;  2CV1 A;  1TTY A;  5DD4 A;  1U8R A;  4S0H B;  5E8I A;  2XGX A;  2XC7 A;  4RA2 A;  3FXU A;  1RKT A;  5FFZ A;  4WK8 F;  1WKM A;  4BU2 A;  1JT6 A;  5L3B A;  4IHS A;  4G8X A;  2LK2 A;  3TBI A;  2FMY A;  2EB7 A;  1WJB A;  2DMQ A;  3K4M A;  1O3Q A;  3CUQ C;  1OCO H;  4N9H A;  1IDY A;  1T08 B;  2ZXJ A;  2ZXW H;  3ABM H;  3LAP A;  2YU9 J;  2LF7 A;  2Y0S A;  3FZV A;  3ZR8 X;  2YS9 A;  2X0L A;  1MBH A;  4Z2Y A;  1OCZ H;  2QM3 A;  4ZTF A;  3VSK A;  4PJL A;  2EIL H;  1R5H A;  3ECH A;  1S5L C;  1XSX A;  2OZU A;  2P8T A;  4LFU A;  3U1D A;  1R49 A;  2H8W A;  4S05 A;  1IN4 A;  5HLT A;  3W2A A;  3CDL A;  2AXL A;  4W1U A;  1JGG A;  4GCV A;  3H0D A;  1Y0N A;  1WHU A;  3VWB A;  1WJ5 A;  4V19 K;  1GV5 A;  2IPQ X;  2FBH A;  3S3N A;  5FRN A;  1N78 A;  2X6Y A;  4DZJ A;  3EDP A;  4E7I A;  3GUD A;  4A0Y A;  2Y30 A;  3QP5 A;  2ZKZ A;  5LHH A;  2A6H F;  3FBI B;  4BHC A;  2Y2Z A;  3HG9 A;  4I7H A;  4ABZ A;  1X3Z B;  5D4R A;  2VJJ A;  2XPV A;  4PUS A;  2DLL A;  2JZY A;  3KPH A;  4ON0 A;  2IA2 A;  2ZO4 A;  4XSX F;  4LB5 A;  3ASN H;  3RKY A;  3V8K A;  1LVK A;  1A35 A;  2WAE A;  3BC8 A;  2GWR A;  3SDG A;  1JT0 A;  4PFO A;  3O2P E;  1S6L A;  2ZME B;  3Q9S A;  2G7H A;  3VPR A;  4IVN A;  2LNB A;  3CTA A;  4EJW A;  2WAQ A;  2XV4 S;  1UFM A;  1UG0 A;  1B9N A;  3CJQ B;  4RDU A;  4IHV A;  5F6F A;  2MW8 A;  3F22 A;  5J1Y A;  3H1C A;  3V8J A;  2FF4 A;  3M8E A;  4XRM A;  4IOA F;  1MH4 A;  1O7F A;  1TT0 A;  2H8R A;  2R7Q A;  4ZYG A;  2GM4 A;  2H6C A;  3H3U A;  2W7N A;  2Z5U A;  4ENM A;  3HKZ A;  2IGO A;  2A68 F;  1QQI A;  4IKF A;  1EH6 A;  3GZN B;  2W57 A;  1LEA A;  2A5Y B;  2F4I A;  1I5Z A;  4AM3 A;  4F7Z A;  4JOM A;  4ESF A;  1WJF A;  2ISY A;  3ZCO A;  3EYI A;  2WC2 A;  2E71 A;  2R5Y A;  5HS7 A;  3ZPL A;  1LKX A;  3C2G A;  1U78 A;  3S15 J;  5C4X J;  4M71 A;  2NNY A;  3SZT A;  4XQF A;  2VJI A;  2CFO A;  2IVM A;  1K83 J;  3EUH A;  4BQN A;  1NH3 A;  1FP2 A;  1X1P A;  2FRH A;  3Q3S A;  2HU9 A;  2O6G E;  5IYD J;  3NEU A;  1B8I A;  1BA5 A;  3PO3 J;  4WF2 A;  1OCC H;  3LQQ A;  5CPR B;  2O61 A;  3F21 A;  1U5T A;  2QEX I;  2RQP A;  3LFK A;  2JRT A;  2H27 A;  4M3F A;  2DA3 A;  1MJ9 A;  1LVA A;  2GAU A;  5E3L A;  3CCJ I;  2EFQ A;  1JHH A;  2Q0O A;  4HF2 A;  4A3F J;  3K1N A;  2JT1 A;  3QPL A;  4A3G J;  2FU4 A;  2EZH A;  2EIK H;  1VQ8 I;  3KEO A;  1VQ5 I;  4HG2 A;  2LY2 A;  1IW7 F;  1XGS A;  3S3O A;  2KIU A;  1Z91 A;  3ZMV A;  4KIB A;  1H88 C;  2L9N A;  2DT5 A;  4A3I J;  3OIQ A;  4BJT A;  2E60 A;  3HIF A;  2B0L A;  3HUG B;  2JA8 J;  2L7M P;  3F72 A;  3IAS 2;  4HOB A;  2IA1 A;  3V4G A;  1XSD A;  1OCT C;  1LB2 A;  3L09 A;  3J81 K;  2M0M A;  1BR4 A;  5ILV A;  3OIP A;  3UR3 C;  2IT0 A;  1FBQ A;  2LBF A;  2B63 J;  2NVX J;  2KIQ A;  4JQF A;  5DYM A;  5D6E A;  5TRD A;  2BE5 F;  4OIN F;  2X1C A;  1H89 C;  4BXU A;  2JPC A;  2QGU A;  4II3 A;  1JKQ C;  4PFP A;  1MSE C;  1FC3 A;  5M5Y J;  2ADU A;  3WGI A;  3LSI A;  3VOE A;  2LY1 A;  1DPR A;  2R7W A;  3GTO J;  2VKH A;  2HI3 A;  3WHB A;  4E4H A;  1JUM A;  3D5L A;  2IS2 A;  3K4K A;  3K4N A;  3T1B A;  3X2Q H;  3IRR A;  4JYK A;  1SD6 A;  1FIA A;  2E1C A;  2JVG A;  3T8T A;  1S7E A;  5E1W A;  3SYT A;  4M6V A;  2VC1 A;  1HW5 A;  2XAU A;  2ZFU A;  3A0H C;  2DU9 A;  2HQR A;  1IN6 A;  2VBW A;  4BBR J;  2A5W A;  1YS7 A;  4AD9 A;  4A0X A;  1KYZ A;  1ULY A;  1O7L A;  2KT0 A;  3LA2 A;  4IPA A;  5IPA A;  2RV8 A;  1U3E M;  2LFB A;  1E17 A;  4LLL A;  2R7Z J;  3F8F A;  3ERM A;  3GTJ J;  3M07 A;  4Q48 A;  1SFE A;  2DAO A;  4ZDL A;  2M8G X;  3DEW A;  2Z16 A;  3KX2 A;  2LR8 A;  5TGT A;  4XLH A;  1X4P A;  4Y7N J;  2JPB A;  2R7V A;  3WTT C;  4ZDP A;  1WWX A;  2CS3 A;  1Y0U A;  2V4J C;  3GYH X;  2NVT J;  4RB3 C;  2IEK A;  3IWF A;  1FNN A;  2OCC H;  2ME6 A;  3F3X A;  2UXX A;  1OKR A;  2ID3 A;  1XX5 A;  2M8E A;  3KFW X;  3DWL E;  2JQ7 A;  3QOD A;  1S3J A;  4Y13 A;  2JRM A;  5JR3 A;  5LGT A;  2BY3 A;  3ASO H;  3LQR A;  4HLY A;  3HOW J;  1OMI A;  3H92 A;  1IXC A;  2DMP A;  5A2Q Z;  1P4W A;  3R4K A;  5FB2 A;  4MEY F;  1KQ9 A;  3MKW B;  4FHT A;  3QRF F;  1B9M A;  2JUG A;  3LST A;  3DTK A;  4BAY A;  3TQN A;  4AID A;  5L3D A;  2XIG A;  3M3Y J;  1LE8 A;  1Q1H A;  3FHZ A;  5BMZ A;  1MMA A;  2K86 A;  5J8C A;  2VAS A;  1FSH A;  3BR2 A;  4AWX B;  3S1Q J;  4MTD A;  3CLQ A;  1P6R A;  3BP8 A;  4KUM A;  2VOD A;  2MGQ A;  3QQA A;  1XG1 A;  3BG3 A;  4M6Y A;  3N05 A;  2DMT A;  2XDV A;  1FOY A;  3BOQ A;  3EUK L;  2ZXI A;  1UCR A;  4YG2 F;  2LTP A;  2IAI A;  1ONV A;  1R6R A;  4MQ9 F;  4OIO F;  3RPQ A;  4HPQ A;  5HDN A;  1X3U A;  3S16 J;  4IHW A;  5E17 F;  4J19 A;  2CRG A;  2M34 A;  4DOZ A;  1LFU P;  3DPT A;  2ELJ A;  2PMH A;  2HFH A;  3BQZ A;  3DU5 A;  4W97 A;  3H3Z A;  5GAH J;  1QA6 A;  5FRM A;  2EJR A;  4C2U A;  3IH4 A;  5IP6 A;  3KZY A;  5GAG J;  1SAX A;  2M4G A;  4A12 A;  1RRJ A;  2LYC A;  4DIQ A;  4LJZ F;  3FXO A;  3U9G A;  5JVT A;  2CYY A;  5HNF A;  2KIM A;  5KCM A;  4KJZ A;  5E3M A;  4KDP A;  1ON2 A;  3A2K A;  2PBI A;  3TO6 A;  1DQU A;  5D8L B;  1HST A;  1G2H A;  4ZZD A;  4UUT A;  2VPL A;  3CCL I;  4B3X A;  4ESB A;  5FJ8 J;  1P2F A;  1UEL B;  1AU7 A;  4FX4 A;  3HYI A;  4XBF A;  1DGR M;  2M45 A;  3FIW A;  4AIH A;  3WTY C;  2TCT A;  2HTJ A;  5EGO B;  2E2H J;  1IXR C;  3GCM A;  2F5F A;  1YX5 A;  3OYD A;  2IBD A;  5DTD A;  2DFF A;  2E1N A;  3JRG A;  4PJJ A;  1PVE A;  2NVY J;  2PEX A;  2YU3 A;  4KIT B;  1S7A A;  3TP3 A;  1TL8 A;  1BJA A;  3SZP A;  2XAF A;  2R7T A;  1ETY A;  4F3Q A;  3CCU I;  4PCQ A;  4PK4 A;  3CJT B;  2LF8 A;  3GFM A;  3W2W A;  1JKR C;  2FQ4 A;  4RMN A;  4Y15 A;  3VB2 A;  1FBS A;  5D5V B;  4HZF A;  3G1M A;  2STT A;  5DD8 A;  2EWN A;  4JP0 A;  2V9K A;  4MIM A;  5CJ9 A;  5C44 J;  1HQC A;  5IT9 Z;  4I0A A;  3VYR B;  5FD5 A;  4E7S A;  2CW0 F;  3BR3 A;  2BXZ A;  1ZH5 A;  2DA4 A;  3DQV C;  2XF7 A;  2Z1D A;  1IJW C;  1HLV A;  4BXF A;  2F4M B;  3VOD A;  3OR1 C;  5GTH C;  3PL8 A;  3TGN A;  1T56 A;  1BI0 A;  3N4M A;  4M9Z A;  3CZ6 A;  2CW8 A;  5E79 C;  1IUY A;  4MLO A;  1VF9 A;  2W25 A;  3KZZ A;  3EQL F;  1PP8 F;  6PAX A;  3K4B A;  3TOB A;  1ZR2 A;  1IRF A;  3DBL B;  3HL2 A;  4N4O B;  4BDY A;  2XVC A;  4UXN A;  3HSE A;  3RYP A;  1QPM A;  3CCY A;  3SFI A;  5C4J J;  1HSJ A;  2MAB A;  4XLN F;  2GOM A;  2OUM A;  3CQZ J;  2BOL A;  1Z1D A;  1ZAO A;  2EBI A;  3BLY A;  3GME A;  2LBF B;  4XK4 A;  2A07 F;  1N75 A;  5H6Q A;  1RIO H;  3Q0U A;  5F64 A;  5EGO A;  1DGW Y;  5ICG A;  1T95 A;  3I5U A;  3PSI A;  2KDZ A;  2CH0 A;  1LQ1 A;  3HUG A;  4KFC A;  4G7O F;  1FYL A;  2P7C B;  2QSH X;  5HLH A;  2MC4 A;  4M3E A;  4DYR A;  2MYS A;  4G94 A;  2RAE A;  3G1L A;  1UMQ A;  2L01 A;  2MD5 A;  4U7D A;  1XSV A;  4L9N A;  1Z21 A;  3GXO A;  1QGP A;  2VT2 A;  4LLG F;  5E8G A;  1D1A A;  1J5Y A;  1OCP A;  3Q0W A;  3U2R A;  3GF2 A;  4A5M A;  1HA8 A;  1YTY A;  1RKW A;  5F0H A;  2LSO A;  3CCR I;  2V1N A;  5EF6 A;  2MH9 A;  1D0X A;  2E2J J;  3GTM J;  1X58 A;  2ZSI B;  2XGC A;  3E5X A;  3VDX A;  1YFH A;  2DFI A;  2GA2 A;  4NQW B;  3LL7 A;  4A3B J;  3FM3 A;  1YOV B;  4JX5 A;  1YRN B;  3DP7 A;  1W4M A;  1WGX A;  1NG7 A;  3DBH B;  1TWA J;  2HKO A;  4XN3 A;  4EGY A;  4NC8 A;  2HQN A;  3MQ0 A;  2JA5 J;  1EA3 A;  3BG6 A;  3M8J A;  1VQP I;  2EPF A;  3CES A;  3M1E A;  3CME I;  3CCV I;  5E3N A;  2K5C A;  2ZCW A;  4OAZ A;  3FK7 A;  3MMY B;  5L3E A;  4YRV A;  4HEA 2;  4A6E A;  5D5W B;  1JUP A;  2VBZ A;  5HDG A;  2AS5 F;  1QU3 A;  2HVR A;  1TQM A;  1KU3 A;  4XMY A;  3EYY A;  3PNY A;  5IP9 J;  3ZMU A;  1ZQ3 P;  3BCA A;  3HOX J;  2FD5 A;  1C0W A;  2O3F A;  4ZYH A;  3OY9 A;  1XS9 A;  2W84 A;  2IS4 A;  4NB5 A;  1HXD A;  2JK3 A;  1IV8 A;  4U0W A;  4D9J A;  5DDG A;  4BAC A;  3L2Q A;  1LUJ B;  1MNM C;  2O0Y A;  4BH9 A;  2BZT A;  3CCS I;  2F5E A;  1IRX A;  2PQ8 A;  4OOI A;  4O5V A;  4CO8 A;  3J80 K;  1U5T C;  1ENH A;  3ZN0 A;  5LLQ A;  2CV2 A;  4MO7 A;  5F1R A;  5LHI A;  2ZME A;  3I4N J;  4LIV A;  4HNV A;  5FLV A;  3T8R A;  4F92 B;  4U7B A;  2M9H A;  5K7H A;  2IA0 A;  2YX7 A;  3HRS A;  1Z05 A;  1OCR H;  4JX6 A;  2ESH A;  3WGG A;  1EV7 A;  2ZBK A;  5LEK A;  3F8B A;  2VJ5 A;  2ZSH B;  3I4M J;  2GA1 A;  1F1Z A;  4BHB A;  2Y31 A;  2XUB A;  5DV5 A;  5ILS A;  4AYB N;  1ODD A;  1VQM I;  3FIS A;  3FXK A;  3K0L A;  2KZV A;  5FKO A;  4AC0 A;  3IUO A;  2HPM A;  3H5N A;  1D3Y A;  1UST A;  2DQR A;  5H6R A;  5M3M J;  3E97 A;  1IF1 A;  2MBF A;  1WJA A;  1U8B A;  2EFW A;  1YJN I;  2UWM A;  1FP1 D;  3R61 A;  3FM5 A;  3SFZ A;  2QSG X;  4I98 B;  2PLY A;  2NVQ J;  2IS1 A;  5E18 F;  3JRF A;  4I09 A;  5FO5 A;  5M5X J;  4BJ5 C;  1H0M A;  3KZI C;  1N25 A;  3PIO F;  3JTH A;  2W1O A;  4IF4 A;  4CXF A;  1OPC A;  3V7S A;  2I8D A;  2EZI A;  4YFX F;  2JWT A;  1Z6T A;  2LH9 A;  5GP9 A;  5HVQ C;  2DA1 A;  3CCE I;  5EZH A;  2O5R A;  2FML A;  4UB8 C;  2X4H A;  1G8X A;  5J6X A;  2HNH A;  2VB6 A;  1Y1W J;  3KLO A;  4PDK A;  2R7O A;  2XGD A;  4B3A A;  3A01 B;  3HJE A;  5LGN A;  3IL2 A;  3ZRG A;  3ULQ B;  2IJL A;  3DV8 A;  2KHM A;  2LVS A;  4NHJ A;  4ENN A;  2RN7 A;  1HW2 A;  2Y9Z A;  1W5C C;  4HV5 A;  3WE2 A;  1FOK A;  2BXY A;  2NRA C;  2XPW A;  3CUQ A;  2MLG A;  3FF5 A;  3RTR A;  5IT3 A;  2F5D A;  4XR6 A;  3F0C A;  2GOX B;  1ETW A;  1APL C;  3QYB A;  2RGV A;  4HST A;  9ANT A;  1AKH B;  3L7W A;  2X51 A;  3Q0V A;  2LRE A;  4EM1 A;  4N9I A;  1B1B A;  4FIS A;  4JK1 X;  2ME0 A;  3B02 A;  1TT5 B;  3SDB A;  3VYT B;  2R7X A;  2HDW A;  2R0Q C;  3S1R J;  2O8X A;  1K78 A;  1RI7 A;  1Z3Y A;  4M9X A;  3CJR B;  5TJJ A;  1R5G A;  2P7V B;  3IV5 A;  4BQA A;  3DPL C;  1BIA A;  4XNF A;  2HPI A;  3BY6 A;  3R60 A;  4HX4 A;  3WG7 H;  3J80 Z;  3IKV A;  4NC6 A;  1ETO A;  1UG2 A;  3KYD B;  3TMO A;  4AIJ A;  1MDM B;  2XAQ A;  1OJL A;  1WPK A;  3MN2 A;  2MFZ A;  2K9S A;  4B47 A;  1QHG A;  3CP2 A;  4FT8 A;  2YPR A;  4K2E A;  3S93 A;  1EKE A;  2WY7 Q;  2O03 A;  1NHA A;  4Y33 A;  2P0W A;  3OYI A;  3GBG A;  3CD6 I;  5JHU A;  3GEZ A;  3ISP A;  2IGM A;  2QF7 A;  4KMF A;  3JRE A;  1P4X A;  1IC8 A;  4UNO A;  4YIF A;  2R93 J;  1J09 A;  1BL0 A;  1BOB A;  1ORK A;  4CCO A;  3OYB A;  4YII A;  3CMY A;  1WI9 A;  3QPH A;  1K7A A;  5JLX A;  3H36 A;  1SVL A;  2DA5 A;  2IXS A;  1P92 A;  2HQA A;  2Q8K A;  2HKX A;  2DXI A;  5DCM A;  4FQG A;  2D5V A;  2W00 A;  5BNG A;  2VON A;  1K78 B;  5DUK A;  1IN5 A;  4U0V A;  5F0F A;  2XHK A;  3S3M A;  1W5T A;  3FKJ A;  1U9N A;  2DA2 A;  1IRG A;  2K3F A;  1T0F C;  4BEH B;  3W6K B;  3BTL A;  3R0J A;  5D4S A;  3LAJ A;  3I59 A;  3DTI A;  4RGR A;  5ERI A;  2F2E A;  4AVP A;  1HDD C;  3KLN A;  2KJB A;  3WTX C;  2PG4 A;  2LRD A;  1VQ9 I;  1K6O A;  4BQO A;  4HF1 A;  4KMU X;  4CCJ A;  5M3F J;  2WAD A;  1RPW A;  4L5I A;  2K85 A;  2QYO A;  2MLK A;  1W0U A;  3IWZ A;  1WCM J;  3K70 D;  3AL0 B;  1ZRF A;  3A01 A;  4LK1 F;  2Y75 A;  5FFX A;  4ZYD A;  1GXQ A;  5ILU A;  3HGG A;  2CJJ A;  4IRI A;  1ZK8 A;  1F9N A;  3QYF A;  3BG5 A;  2VOO A;  2CUZ A;  4ENK A;  1D8K A;  2XRO A;  4XN0 A;  3LSR A;  2F5C A;  3ZP5 A;  3JAM Z;  4GYG A;  1YJ9 I;  2DPD A;  2YSR A;  5HS8 A;  2QUF A;  1OYW A;  2HWV A;  1MMD A;  1NK3 P;  5E3O A;  5H2F C;  1PUF A;  2HOA A;  4MQV A;  5C3E J;  2QA4 I;  2E1M C;  4V2G A;  4QLC U;  3WTV C;  3KP6 A;  1SVO A;  2ECB A;  1PUF B;  2KLO A;  3K6G A;  2BVM A;  2CUE A;  3HHH A;  3OYA A;  2DT7 B;  4D1Q A;  1FLI A;  1UHW A;  1WVR A;  3CDI A;  5IT9 K;  1E0E A;  4DJA A;  1NG6 A;  3C18 A;  3K69 A;  3P9I A;  5DM6 F;  2KQR A;  2R7D A;  4M3B A;  4Q47 A;  3OS1 A;  1QVT A;  1KA8 A;  2ECC A;  2CUF A;  2L4M A;  2M30 A;  2JSP A;  2CUJ A;  3VYU B;  1BBY A;  4F91 B;  5FKM A;  3OYL A;  3LA3 A;  1R9T J;  5BPD A;  3Q5F A;  4XLF A;  4RM2 A;  1YW8 A;  4XLE A;  4E70 A;  1KU2 A;  1F5T A;  3KCC A;  2KFD A;  1D1C A;  2JA7 J;  4RB1 A;  5GPC A;  1BN5 A;  1L3L A;  2EA4 A;  4B43 A;  3GTP J;  5K7Z A;  4DYQ A;  2VQG A;  4LMY A;  3HTU A;  1GHC A;  2D1H A;  2AQE A;  4RS8 A;  3I59 B;  1FPQ A;  1TLH B;  4RBO A;  2BW3 B;  4L5J A;  3NAR A;  4KIG A;  3PFY A;  2EV6 A;  3FHN A;  3OS2 A;  2CG4 A;  2DFH A;  4C3I J;  1JTY A;  5J3L A;  3VEP A;  4XRS A;  5FRO A;  3S14 J;  2GQQ A;  4BL0 B;  2DFE A;  1SFX A;  5AON A;  2Z3Y A;  3OS0 A;  3E6D A;  4HW0 A;  4BQQ A;  1R4M B;  2UV1 A;  3WU1 B;  2RNG A;  1FEX A;  1SD4 A;  5GTI C;  1SAU A;  2P6S A;  3OYF A;  2KPM A;  1BW5 A;  2EIM H;  5B66 C;  4U0Y A;  2Y0M A;  2NOJ B;  4DQ2 A;  1J0R A;  4XOP A;  3BJA A;  5LFA A;  1VFC A;  1DP7 P;  1VQK I;  5KK1 A;  3CP8 A;  1Z7U A;  5EEH A;  2GXA A;  1FOW A;  1SC7 A;  4NQW A;  1O3R A;  1QBJ A;  2LY9 A;  1OYY A;  3RZD J;  5HS9 A;  3JAM K;  4X0G A;  2R3S A;  3GZ5 A;  4O3M A;  5KNL A;  1LNW A;  4H0E A;  3QU6 A;  1G6N A;  2L02 A;  1DU0 A;  2FX0 A;  1FMV A;  1UJ8 A;  2XRN A;  4LB6 B;  4MGR A;  2V1X A;  3CLO A;  4WCG A;  2A05 A;  4OMZ A;  1OLT A;  5D6F A;  5L3G A;  3IP4 B;  4PSW A;  5EYR A;  1G4D A;  3HPG A;  2QQ8 A;  1NK2 P;  3OYG A;  3DCF A;  2PI0 A;  4IRG A;  2KIS A;  3I3L A;  1MND A;  2CMP A;  4AVZ A;  4M3G A;  5CYV A;  1B4A A;  4MFE A;  2QEN A;  2TDX A;  5LRR A;  5FKK A;  1XGM A;  3RI4 A;  1W36 D;  3LSJ A;  1BOA A;  2ZNY A;  3BTC A;  3M8F A;  1ITY A;  2L3D A;  3MKL A;  4I2O A;  1PJR A;  2M87 A;  5GAE J;  5K5O A;  1FBU A;  3WU0 A;  1O3S A;  4M72 A;  4XKW A;  4MHG A;  1TP4 A;  4PJN A;  3GTQ J;  3SEQ A;  4ETS A;  3F8C A;  2DOE A;  3A1Y A;  2EFO A;  4UUV A;  4QIW N;  1OFC X;  1LJ9 A;  4CH7 A;  2B9S A;  1MSF C;  1J59 A;  4V2F A;  2BYV E;  4X6A J;  5K7F A;  3REO A;  4S04 A;  3K1M A;  5KVR A;  1PP7 U;  5HLI A;  4UV9 A;  3JTG A;  2R7S A;  5IP7 J;  4M74 A;  1E3P A;  3LOC A;  3ROU A;  2MC3 A;  2CV0 A;  3AG1 H;  2CW7 A;  1O3T A;  4CGZ A;  3M4O J;  3G4S I;  1YIO A;  3ZQL A;  1YQA A;  4EM0 B;  2K27 A;  4P1W A;  1B72 A;  4BE2 A;  2HDD A;  2LKP A;  2OZ6 A;  1P7I A;  1D0Y A;  5ICE A;  3CMA I;  1SVM A;  3KEY A;  5CVV A;  4I76 A;  5J1R A;  3ZQI A;  3KYL A;  2JVH A;  1BR1 A;  5JHF A;  3M1C A;  1IZ1 A;  1T39 A;  1IN8 A;  2E5N A;  3FXL A;  2XB5 A;  5D8K B;  3F9K A;  2P5L C;  1X3W B;  4HV6 A;  1I1G A;  5EEA A;  3KET A;  1T33 A;  3MZH A;  3G3Z A;  2PX9 A;  3OYC A;  1P9Q C;  3NRV A;  1A31 A;  3GTK J;  1FMW A;  1XDS A;  1XDU A;  3KYC B;  1I6H J;  4UUS B;  3QYE A;  1VND A;  1Z0X A;  1YI2 I;  1B59 A;  2RKH A;  3W6V A;  1IRZ A;  2KIF A;  2ZJ2 A;  5CQE A;  2DT6 A;  1MKM A;  2BEO A;  3UKG A;  2AQF A;  1TQP A;  3HRU A;  4QPO A;  5BPI A;  1N77 A;  2EFP A;  1SD7 A;  4ZC3 A;  1REP C;  1HKQ A;  3I71 A;  3PO2 J;  3I0T A;  2H94 A;  1TW2 A;  1X1C A;  5F0C A;  3L00 A;  1QO0 D;  2FQ3 A;  2LKS A;  3RCO A;  1ZN2 A;  2VQH A;  4GXO A;  4CCK A;  4C2T A;  1MJB A;  4R1H A;  3DLL F;  1UZC A;  2LOO A;  1D5Y A;  4L9V A;  1GVD A;  4F55 A;  3S2D J;  1JHF A;  3DLA A;  3ZMD A;  3H9G A;  3BRO A;  3G73 A;  3CF2 A;  4FCY A;  4B48 A;  4IX7 A;  3SHF A;  2WV1 A;  3EUA A;  2E2I J;  1HC8 A;  3O6B B;  5DCF A;  3MZY A;  4IJA A;  1UAA A;  4XIC A;  1TC3 C;  2X9D A;  1X1B A;  3WTW C;  3HHG A;  1MGT A;  4CUG A;  5L3C A;  1LDK B;  4CYD A;  3ABU A;  3R6S A;  4TV7 A;  1KQ8 A;  2BHY A;  1VI0 A;  1HKT A;  4A5N A;  4H4K C;  1NTC A;  4NNJ A;  1A6Q A;  1ON1 A;  2KDO A;  2HEO A;  1J9I A;  3PIP F;  1W36 C;  2K40 A;  3BTI A;  1MMS A;  1UHM A;  1I39 A;  4G6Q A;  3WG9 A;  4FAS D;  1OQY A;  3HDD A;  2VLA A;  4UVB A;  3F6V A;  1YRN A;  2VBY A;  1JGS A;  4L9J A;  3KP3 A;  1ZR4 A;  3ZQH A;  4P55 A;  1STZ A;  1OR7 C;  3RSN A;  1G59 A;  3AL0 C;  2ID6 A;  2XKO A;  2BHZ A;  2CWE A;  4HQM A;  1JJ8 C;  4B8X A;  4L0Z B;  3TO9 A;  3K4L A;  4MFD A;  3AKZ A;  2O7O A;  4NDL A;  1WRJ A;  2CGP A;  2H09 A;  2HXO A;  3QWL A;  1UB9 A;  1X1D A;  4II2 A;  3P9C A;  1U2W A;  3B73 A;  3JRD A;  2CFX A;  1KQ0 A;  1BM9 A;  2DDA A;  1D1B A;  1IO2 A;  4FE7 A;  2X85 A;  3CUO A;  4A93 J;  4MNU A;  1CF7 A;  2BBY A;  2HVQ A;  3DEE A;  1Z77 A;  3LA7 A;  3C7J A;  3WOD F;  5LRS A;  2R7R A;  1Q1V A;  2LG4 A;  2L7K A;  2QQB A;  2O9L A;  1DPU A;  5JVG F;  1F36 A;  3RJP A;  3P5J A;  2MD0 A;  4J01 A;  1RZ4 A;  1YO5 C;  3ZQC A;  3DTE A;  1O57 A;  1XMA A;  3WHC A;  4AU7 A;  2QSF X;  3B6A A;  2G7U A;  2L7F P;  1Z6R A;  4U87 A;  3AG2 H;  4HNU A;  1WH5 A;  2DQL A;  2E1O A;  5FGM A;  5ED4 A;  1FTZ A;  1I50 J;  4EJU A;  1Z3X A;  4R8H A;  3IH3 A;  2FNA A;  3C2H A;  4A69 C;  3BZ6 A;  3OYK A;  4LK0 F;  2XAJ A;  4LG3 A;  2EV0 A;  3IRQ A;  2OV7 A;  3P7N A;  2FNP A;  4LIT A;  5IOZ A;  3H3V K;  2J5O A;  4GGG A;  2ETH A;  3BPX A;  3K4C A;  2JTV A;  1X2N A;  2KMU A;  1SFO J;  1QNT A;  2UZK A;  1RUN A;  3RKW A;  1MBE A;  4KN7 X;  4XSZ F;  4BYY A;  1YHQ I;  2ESN A;  1S7O A;  3DEU A;  2DI3 A;  3GFJ A;  2UXN A;  3HC7 A;  4JBA A;  1YIJ I;  2L5Q A;  1H9T A;  3HOV J;  1MMN A;  2M0C A;  2EIN H;  1T98 A;  2E36 A;  5F1J A;  2FOK A;  5EEG A;  3JW4 A;  4UVC A;  4ASN A;  2VL8 A;  3BWG A;  4HNT A;  3WU2 C;  3KP5 A;  1WQ2 A;  2BY2 A;  2FE3 A;  3H35 A;  1D5V A;  4WX9 A;  2E19 A;  4GYI A;  1RUO A;  1QVU A;  1HCR A;  3HZJ A;  1R58 A;  4GRI A;  3JRH A;  2K3P A;  1V55 H;  3QU3 A;  3S1M J;  4EM2 A;  3OWT A;  3PSF A;  2K7L A;  1MW7 A;  4XOT A;  3VSL A;  3ZXS A;  1MBK A;  4EVI A;  1K61 A;  3H5R A;  3M7G A;  2XAS A;  2F6C A;  4IXA A;  3DKW A;  5CLS A;  1R22 A;  5J8F A;  4I99 C;  2XSJ C;  2WA0 A;  3JRC A;  4I0B A;  5M5W J;  4E7Z A;  2W85 A;  2ZJP F;  1Y56 A;  4KIF A;  2LD5 A;  2W82 A;  2EZK A;  1V5G A;  3KP2 A;  4CZZ A;  4EV0 A;  4XL9 A;  1BIB A;  2M7A A;  3PNT A;  3VFZ A;  4YFN F;  1DP3 A;  1XMX A;  1R4N B;  2Y9Y A;  3D0S A;  3SEZ A;  4A2U A;  4B4C A;  3KE2 A;  1JI8 A;  5BS6 A;  4PJM A;  2LC2 A;  2CQ7 A;  2GXG A;  1M1E B;  1R7J A;  3MZ8 A;  3V42 A;  3D5R C;  2J5P A;  1X2M A;  4L0Y B;  3ZQF A;  4P5O A;  1CQT A;  5AIP A;  4UY8 I;  2FUG 2;  5E1X A;  3LWF A;  4GFB A;  2LMD A;  2WB1 A;  3PUF A;  5E1Z B;  3OYM A;  3BG9 A;  1XCV A;  2H6B A;  1AOY A;  1D0Z A;  3K2A A;  4NBQ A;  4CYC A;  3OR2 C;  2XF6 A;  1LE8 B;  4XOR A;  2OQG A;  3S8P A;  1TWF J;  2PN6 A;  2R92 J;  2OBP A;  1KYW A;  4CCL A;  5LHG A;  3LMM A;  5HOD A;  2PMZ N;  2A69 F;  4Q4Z F;  4KA4 A;  3SJM A;  4HLX A;  3R0A A;  3RQI A;  3GTL J;  4OAY A;  2PFB A;  4ZH4 F;  1V4R A;  4E7H A;  4QWQ A;  2X48 A;  4ESJ A;  2E35 A;  4XLA A;  4I02 A;  2AXT C;  2NS0 A;  4A3K J;  3N97 A;  3H5A A;  3HSR A;  2V9P A;  2M7B A;  3QAH A;  3HOY J;  3ZMS A;  1S29 A;  1MNE A;  5JI6 A;  2F48 A;  2TRT A;  4M3D A;  2Z2S B;  3ERE D;  1RET A;  3OYJ A;  2KKO A;  2QLZ A;  3HRT A;  1ZKG A;  3W2V A;  1IGN A;  4KIC A;  4A0Z A;  3OYH A;  4XLC A;  3V7C A;  3L2V A;  4C2M J;  1V5F A;  5B1B H;  3E6C C;  4IQ4 A;  4A3C J;  3E0J B;  3T5X A;  3C1D A;  1F4K A;  1J2X A;  1TNS A;  5D5X B;  3V8L A;  2DW4 A;  5LD2 C;  1BJZ A;  2MG4 A;  2P4W A;  2RQQ A;  2G9W A;  1AHD P;  4MTE A;  1ZLJ A;  1GUU A;  2CQN A;  3TW7 A;  3ZQ7 A;  2QCO A;  3CJN A;  4C3H J;  1FX7 A;  3RIR A;  2HYG D;  3OYE A;  3HGY A;  3TL4 X;  4Q5S F;  2O8K A;  1ZGJ A;  1XD7 A;  1YW9 A;  4Y4R A;  4DBR A;  2L9V A;  1W0T A;  3MVP A;  4HDU A;  3E6B A;  2EK5 A;  2DOA A;  2V1D A;  5A2Q K;  4RAY A;  2V1U A;  1XTA A;  3HOT A;  1XMK A;  3HOZ J;  2HOE A;  4ZDO A;  2L9S A;  3P9K A;  1QZZ A;  3D1N I;  4XRS G;  2VPR A;  3TDZ C;  3RPU A;  1LFP A;  2ZNZ A;  2A6T A;  2XGE A;  3ML6 A;  3F6O A;  5EDN A;  5GPA A;  4LLN A;  1FZP B;  1ZYR F;  3OOU A;  3EUH C;  3GWZ A;  1FJL A;  2BVL A;  2R7F A;  2R5Z A;  2OD5 A;  3HXL A;  1YLF A;  1TNT A;  4XKB A;  3M9A A;  2DYR H;  3FK6 A;  1SD5 A;  4ZZL A;  3JRB A;  3A03 A;  1YIT I;  2XAG A;  3BR6 A;  5LGU A;  3EET A;  1ACI A;  3ABL H;  3L2W A;  5EJC A;  2ZC2 A;  1HBX G;  4OMY A;  2JMW A;  4CYC B;  2QKM B;  3RYR A;  1J7K A;  1VTN C;  2W4S A;  2K4J A;  1Z7L A;  3L1P A;  3LSK A;  1MH3 A;  3ABK H;  1GXP A;  2IGK A;  4RAF A;  1SAN A;  4GO1 A;  3GO5 A;  2GLO A;  2KRF A;  5DEQ A;  4IQJ A;  1Y39 A;  4CCN A;  1BI1 A;  1SMT A;  5K5R A;  4YFK F;  3HTS B;  5ICC A;  2DDB A;  1JUS A;  1G3T A;  2R7U A;  3K4J A;  3FMQ A;  4G9Y A;  1YE9 A;  1VQL I;  2E7W A;  2GIV A;  2KRH A;  3PNV A;  4OWR B;  2GZW A;  1IDZ A;  1XC5 A;  1QHH D;  5ICF A;  1FT9 A;  1RNL A;  3BPV A;  3OV8 A;  4E7J A;  3PFI A;  3LFU A;  3LSM A;  3W6J B;  3ESW B;  1R23 A;  3DKX A;  1UHS A;  1A04 A;  2D1V A;  2K9N A;  2VE8 A;  2XB0 X;  3PQK A;  1L0O C;  5FKL A;  2KJC A;  5GAD J;  2CO5 A;  4EQQ A;  2ELH A;  4BDZ A;  1R71 A;  1U5T B;  1WFX A;  2IW5 A;  4P96 A;  4CZC A;  1GVJ A;  5LBQ A;  2EA2 A;  3ZGK A;  4P9U A;  1B8I B;  3PJR A;  5BQT A;  3JSP A;  1PYV A;  5JFR A;  3L9F A;  4WXH A;  3O3K A;  2D2W A;  4A6D A;  3CCM I;  1V3F A;  2WB1 N;  2WAF A;  3U1K A;  3BG7 A;  1BW6 A;  1RC9 A;  1V54 H;  5FLM J;  2R5Y B;  1ZGA A;  2CSO A;  4G7H F;  4E7K A;  2I5U A;  3DBR B;  4R79 A;  3JSO A;  5H20 A;  4E6K G;  4CSW A;  2HS5 A;  3GTG J;  1S8N A;  3FXR A;  1EH7 A;  3K1P A;  2K9M A;  4RB0 A;  1A6I A;  1RES A;  4B1R A;  3JR9 A;  3NWT A;  3QOP A;  1IN7 A;  2R5Z B;  2F4O B;  2ACJ A;  4LOC A;  2VC0 A;  5F27 A;  4OIR F;  3I53 A;  1JE8 A;  2OQR A;  1QPI A;  3QP6 A;  1XB4 A;  2VQC A;  5JLW A;  4AIK A;  2L9R A;  5FD6 A;  1R5I D;  3WGH A;  2DCE A;  1TWG J;  2Z9O A;  2XKP A;  5B5E C;  3H0G J;  4IEJ A;  1KZH A;  4HYE A;  4HBL A;  2FSW A;  2G0E A;  3HRM A;  5B3S H;  4F52 A;  1RR8 C;  4XON A;  2ZJR F;  4XKC A;  2EZL A;  3COA C;  1K4S A;  1IAW A;  2WBM A;  4Y52 J;  4M9S A;  3TW6 A;  2COB A;  2P5V A;  2P5K A;  2X1D A;  3BJ6 A;  4D5C A;  5E20 A;  4LGW A;  1X4O A;  4O6J A;  1KU7 A;  1R36 A;  2HDC A;  2VKE A;  1ETX A;  4F93 B;  2Y0S N;  3IH2 A;  4A3M J;  1SEU A;  2OTJ I;  1LPQ A;  5BOX A;  1XGN A;  2OF7 A;  2DK8 A;  2DPU A;  2L4A A;  2M4K A;  3H9J A;  1X19 A;  3NAU A;  3V7R A;  4FTH A;  1ZG1 A;  3I58 A;  1FTT A;  2VQL A;  3GFI A;  2RDP A;  3HSF A;  5F04 A;  5TIS C;  2H1K A;  2PMU A;  2JSC A;  2DMU A;  2EQR A;  2MA3 A;  1QZE A;  1Y8R B;  3GVA A;  1P4A A;  5CVJ A;  3FWE A;  1POG A;  2W48 A;  3FXJ A;  2IRF G;  3NQO A;  1CF7 B;  1MD0 A;  4BXX J;  4KN4 X;  3CF5 F;  2JJ7 A;  2LP0 A;  3K10 A;  3UNG C;  1YJW I;  5J4V A;  3W3C A;  4HRI A;  5FLX Z;  3RPU D;  1H9G A;  3FBN B;  3IHU A;  2FJ1 A;  2WV0 A;  4WXD A;  4DBQ A;  1JJ6 C;  1IV6 A;  1FYM A;  1R1T A;  2L0K A;  1VZ0 A;  5L3F A;  1HDP A;  4RGU A;  4BNC A;  3E1S A;  3KIO A;  2DO7 A;  1PDN C;  4HQE A;  2YX4 A;  1WJE A;  3GLX A;  4B44 A;  4DGW B;  2FBK A;  5HLG A;  3HOS A;  2Z33 A;  1J75 A;  3ELK A;  2A3S A;  4IO9 F;  4IRH A;  4IHX A;  5EZG A;  3BCB A;  3C2B A;  3GFL A;  3I9V 2;  4LD5 A;  3F8N A;  2DJI A;  1U9O A;  3OSG A;  2HGC A;  2P6T A;  1Z9C A;  2DOF A;  1Z67 A;  3AG3 H;  3K2Z A;  3ZMT A;  4CCM A;  5K5Q A;  1TZL A;  2HYJ A;  1ZLK A;  3RZO J;  2FOW A;  1W7P D;  2WY8 Q;  3GX4 X;  1XGO A;  2LKX A;  1MMG A;  2HYF A;  3EPZ A;  4BUP A;  3ZMZ A;  2EIJ H;  1VQ7 I;  1JKP C;  1TWC J;  3NWS A;  5AIQ A;  2OJE D;  4BJ6 C;  1GT0 C;  2VOP A;  1R1V A;  3OL4 A;  2VXZ A;  2V6C A;  1ZAR A;  3MD2 A;  1ZTR A;  2DTZ A;  1S72 I;  3OOP A;  1E2X A;  3MCZ A;  1W7P B;  3AAF A;  1P7J A;  2YR2 A;  2OU2 A;  4XM3 A;  3F8M A;  2E5Z A;  2I10 A;  1WSU A;  1IXS B;  5DS9 A;  1R00 A;  1I27 A;  3CCQ I;  3K9T A;  1X1A A;  3RDI A;  1U0J A;  4LG0 A;  3OL3 A;  3S17 J;  2IS6 A;  3MEX A;  2KRC A;  2YUS A;  2ICW G;  1XCB A;  2A61 A;  2B7E A;  3TP0 A;  2LLK A;  3VYS B;  1FYK A;  2XAH A;  1GV2 A;  1I3Q J;  4FX0 A;  2COM A;  2QKL B;  1WJC A;  2X6O A;  2X6X A;  3K7A J;  2HQ5 A;  4MEX F;  3J7A O;  2KZG A;  2JA6 J;  4ZTJ A;  5B1A H;  2Q1Z B;  4D5F A;  3ONQ A;  1ZRE A;  4DNC A;  4G7Z F;  4KYW A;  2VI6 A;  1IG7 A;  1VQ6 I;  4XRF A;  3A0B C;  4NC7 A;  1WJD A;  2V7F A;  4EJV A;  3D5S C;  1OIS A;  2V26 A;  1HW1 A;  1MZB A;  2AO9 A;  2HXI A;  2Q2E B;  3BDD A;  5LEJ A;  3WTU C;  4OU0 A;  3KEQ A;  4YIR X;  2V6E A;  3RKQ A;  4BGD A;  3J7A Y;  2M3A A;  3O8H A;  1ZHF A;  2EV5 A;  1K4T A;  2Y48 A;  5D5U B;  3KP4 A;  2V9V A;  4E7L A;  2NS8 A;  4I01 A;  4HF0 A;  5CVU A;  3FX3 A;  1QZY A;  4BE0 A;  5K1Y A;  3I56 I;  2ELK A;  5J40 A;  4EGZ A;  4BS9 A;  3PUB A;  3G6E I;  3BZC A;  1ZRC A;  1TW3 A;  3E5Q A;  2R4G A;  2BGC A;  3FXM A;  2DA6 A;  2XPU A;  4PZJ A;  2M2E A;  4BE1 A;  2CQQ A;  2H1L A;  5HNH A;  1LEB A;  2MH2 A;  1Y1V J;  1OR7 A;  3QOE A;  4HX7 A;  2BY1 A;  4UB6 C;  4JX4 A;  3ZOB A;  3IAM 2;  2EH3 A;  5EG0 A;  2CQK A;  2JA2 A;  1FOX A;  3HPH A;  2Y69 H;  3PQJ A;  5DM7 F;  3ZQQ A;  1TQI A;  2QZ8 A;  4CHU A;  3IC7 A;  2BV6 A;  3FXQ A;  2PJR A;  1EF4 A;  4QSH A;  4G12 A;  2GXB A;  2HTS A;  4ZYE A;  2LDU A;  2ZB9 A;  1VQO I;  2X6W A;  2WAQ N;  1SFK A;  1HOM A;  1YYV A;  4Y3O A;  4M73 A;  1OYI A;  2K4B A;  4C9Y A;  5KAI C;  2DN0 A;  3DFG A;  4G6D A;  3B6C A;  1G3W A;  4C3J J;  1XN7 A;  2VKV A;  4EJO A;  1Y6I A;  4BBS J;  4D0P A;  2NOG A;  3A02 A;  1ETK A;  3WE3 A;  4AUX A;  4IZZ A;  2QBY A;  1FIP A;  3DU6 A;  5CKT A;  1AWC A;  1I1S A;  2IGN A;  3MKZ A;  1R1U A;  3BZK A;  3JRI A;  1DUX C;  2OPT A;  1JXS A;  3GLL A;  2RRE A;  2VXD A;  4RGS A;  3J7Y J;  2F5V A;  2FA5 A;  1YS6 A;  1G3Y A;  4HX8 A;  4A3J J;  3QPS A;  2UUZ A;  3CDH A;  4ZYA A;  2NVU B;  2WWY A;  3K70 C;  1DU6 A;  4RLQ A;  3PM1 A;  4RLF A;  2ZME C;  2VUM J;  1MJA A;  3TDU C;  2KP6 A;  4KIS A;  4X1E A;  2IP2 A;  4NUB A;  1DDN A;  1V5E A;  2E34 A;  3JRA A;  4D7M A;  5F08 A;  5CVI A;  2QWW A;  3MKY B;  1VQ4 I;  1O4X A;  2A6E F;  3L2U A;  2DTR A;  3I55 I;  4LG0 B;  3F23 A;  3LSH A;  2VN2 A;  3G1O A;  3A4C A;  1E3O C;  3BR5 A;  4FE4 A;  2RC4 A;  3S2W A;  4Y17 A;  2AHQ A;  1H8A C;  3DKY A;  2STW A;  4A3L J;  2HOS A;  3S2H J;  1W7P A;  4OIQ F;  1ZRD A;  2VKD A;  5FKN A;  2NAZ A;  5DUI A;  4ITV A;  2RNJ A;  1WZ2 A;  4J00 A;  3FDY A;  3L2R A;  2DK5 A;  1EJ9 A;  4YEL A;  3LNQ A;  1YG2 A;  1YX3 A;  2BW3 A;  3MAJ A;  3OYN A;  4Z6Y A;  1USS A;  4XID A;  3ECO A;  3LSP A;  3BT9 A;  1ERD A;  4L9T A;  3SQN A;  4GDF A;  3OMY A;  4EAT A;  1LDD A;  4UHT A;  4D7N A;  2HVS A;  3FMS A;  1HF0 A;  5CQG A;  1IUF A;  2NXN B;  1K6Y A;  2OCE A;  3ZN1 A;  3E3V A;  4N0B A;  4XKV A;  2E1M B;  4CIC A;  2XSD C;  3E5U A;  2JN6 A;  3FMR A;  1A36 A;  4KT6 A;  2GBY A;  3RKX A;  3HKZ N;  2FXA A;  1FSE A;  4UV8 A;  2ZFW A;  3CO7 C;  4P9F A;  3AFH A;  4PGG A;  4UUS A;  1WH7 A;  4HA8 A;  4BKX A;  5J4Y A;  5IYC J;  2DOD A;  1B6A A;  1K79 A;  1BC8 C;  3SXY A;  1BC7 C;  4RAZ A;  2VE9 A;  4HDV A;  1MBJ A;  5KAF C;  2QQ9 A;  3DPU A;  1WI3 A;  4RGX A;  3MFK A;  1GDT A;  3BQY A;  3CMM A;  4DW6 A;  4QTR A;  1G3S A;  3I4P A;  2ISZ A;  2D45 A;  1Y8Q B;  2DJN A;  1HKS A;  4WWC A;  2HR3 A;  5IY5 H;  3C3W A;  4EMS A;  1T8I A;  3U21 A;  2M5W A;  2P81 A;  2C6Y A;  5J1U A;  2HOT A;  2RVC A;  3TOA A;  1KGS A;  1F43 A;  2QBY B;  5FLX K;  2L7Z A;  5J47 A;  2M1B A;  1VQN I;  2L54 A;  2VT3 A;  1ZGW A;  4U88 A;  1B72 B;  3E7L A;  3G71 I;  1QRY A;  5HOO A;  2DBB A;  3TED A;  3G2B A;  2Z99 A;  4BY1 J;  3GZ6 A;  1TBX A;  3TKY A;  4HSR A;  4RAG A;  3DXJ F;  1FY7 A;  2BY0 A;  2HZT A;  2L2O A;  3HEF A;  4RM3 A;  1RR7 A;  3BJO A;  4N4N B;  2OAZ A;  2K02 A;  3J81 Z;  4ENJ A;  1T2K A;  2VBX A;  2PJR B;  2OTL I;  4B09 A;  2OC6 A;  4EEF G;  1EH8 A;  3JCU C;  4IOC F;  2MSY A;  1KON A;  5EG0 B;  2VJ4 A;  4FET A;  5KHD A;  1ZG3 A;  1KU9 A;  3L2C A;  1LFB A;  3KP7 A;  1T0F A;  4DZP A;  4PJ0 C; 
#chains in the Genus database with same CATH homology
 1HC8 A;  2E34 A;  5DM7 F;  1VQ8 I;  1FOY A;  1VQ5 I;  2JQ7 A;  1FOW A;  1VQP I;  3I56 I;  3G71 I;  5GAD J;  1VQ6 I;  3CCR I;  1VQ4 I;  2ZJQ F;  1Y39 A;  3CME I;  3CCV I;  3G6E I;  1YHQ I;  3CCU I;  1VQO I;  3CCS I;  3CCL I;  3I55 I;  2FOW A;  3J7Y J;  2ZJR F;  1YIT I;  3CCQ I;  3CJT B;  3PIO F;  1VQ9 I;  5DM6 F;  1YJ9 I;  2QEX I;  1VQM I;  1ACI A;  1YIJ I;  2NXN B;  1VQ7 I;  1VQL I;  3G4S I;  3CC4 I;  2H8W A;  3CC2 I;  2E36 A;  3J7Z I;  3CCE I;  2OTL I;  5GAE J;  3CF5 F;  5JVG F;  3CCJ I;  3CCM I;  3CC7 I;  3PIP F;  5GAH J;  3DLL F;  2E35 A;  1YJW I;  1QA6 A;  2ZJP F;  2QA4 I;  4IO9 F;  4IOC F;  4IOA F;  1MMS A;  4UY8 I;  2OTJ I;  5GAG J;  3CMA I;  1S72 I;  3CD6 I;  2K3F A;  4V19 K;  1YI2 I;  1FOX A;  1YJN I;  1VQN I;  1VQK I; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...