2ZJRF

Refined native structure of the large ribosomal subunit (50s) from deinococcus radiodurans
Total Genus 11
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
11
sequence length
71
structure length
71
Chain Sequence
MSYLIRKAAGIGKGSSTPNKAKVGKLNWDQVLEIAKTKMPDLNAGSVEAAANTVAGTARSMGVTVEGGPNA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Translational regulation via L11: molecular switches on the ribosome turned on and off by thiostrepton and micrococcin.
pubmed doi rcsb
molecule tags Ribosome
molecule keywords ribosomal 23S RNA
total genus 11
structure length 71
sequence length 71
ec nomenclature
pdb deposition date 2008-03-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
F PF00298 Ribosomal_L11 Ribosomal protein L11, RNA binding domain
F PF03946 Ribosomal_L11_N Ribosomal protein L11, N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.250 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Ribosomal protein L11, C-terminal domain 2zjrF00
1YITI 3CCJI 2ZJQF 2FOWA 3PIPF 3CCVI 2QA4I 1YJ9I 3G4SI 1S72I 1VQNI 1VQ5I 3CC4I 2OTJI 5DM6F 2K3FA 2ZJRF 1QA6A 4IOAF 1VQKI 3G71I 1HC8A 3G6EI 1VQOI 1VQ6I 3J7ZI 1VQLI 4UY8I 5GADJ 2QEXI 1FOWA 3I55I 3I56I 5DM7F 3CF5F 1YIJI 4V19K 3CC7I 3J7YJ 2H8WA 2OTLI 4IO9F 1YI2I 1VQPI 2E35A 1Y39A 3CC2I 1FOYA 4IOCF 1VQMI 5GAHJ 1VQ9I 1VQ4I 1FOXA 3CMEI 5GAGJ 3CJTB 2JQ7A 1ACIA 2NXNB 2E36A 1YJWI 1VQ7I 3CCUI 3CCEI 1YHQI 1MMSA 3CD6I 1YJNI 3CCLI 3CCRI 3CMAI 5GAEJ 3DLLF 3CCMI 2E34A 2ZJPF 3CCSI 3PIOF 1VQ8I 3CCQI 5JVGF
chains in the Genus database with same CATH superfamily
4J01A 2A61A 4ASNA 2BOLA 1ZG3A 4FISA 2LRDA 2JPBA 1ZQ3P 3REOA 1OCPA 1KGSA 3PFIA 5BNGA 3F8NA 4RB0A 4FASD 4IO9F 2E2IJ 3BTJA 2KZVA 1T95A 2PJRA 2LY2A 2CGPA 2LC2A 3VYTB 4A5NA 1XDUA 4C3HJ 1P2FA 2Q2EA 2P8TA 3H9GA 2L3DA 2HYJA 1Z1DA 4K2EA 3CCUI 4G7OF 1YX5A 4QIWN 2M2EA 2JWTA 4ZYDA 3SJMA 2R5ZA 1Q1VA 1IDZA 1HW2A 2OBPA 3BQZA 1KU7A 5LHHA 4OAZA 4AUXA 1IRXA 2H6BA 5C44J 3CF5F 4U0YA 1FEXA 9ANTA 2CV1A 4L9VA 4GFBA 4Y3OA 2XASA 3ZQQA 3FHNA 4UB6C 2B9SA 3K4KA 6PAXA 2D2WA 2P5VA 2DPUA 2M0MA 1LDDA 1GXQA 3WGIA 1LDJA 3QRFF 3OYNA 3CCRI 3HRUA 1X1BA 2ZNZA 4N9IA 1V3FA 3IH3A 1HKTA 2LR8A 3OYMA 2K27A 4M6VA 2M87A 3DPUA 4DIQA 2VKDA 2JTVA 5D5VB 4LGWA 3G6EI 1MMAA 2R5YB 2Z5UA 5J40A 3LSKA 4PJLA 3TO7A 4P9FA 2JRMA 3O8GA 5L3EA 1JHHA 5LGNA 2X6YA 3L00A 3NWSA 2XGEA 4R8HA 2GOMA 3KP5A 2K9SA 3BWGA 5D5WB 2X1CA 4A3DJ 2W48A 1A6QA 3QU6A 5GAEJ 2LMDA 2ZNYA 1Q1HA 1BR1A 1JXSA 3FKJA 1WFXA 2QQAA 1AU7A 1XD7A 1QGPA 3BZ6A 1LQ1A 1K4SA 1GVDA 4R79A 2CS3A 3C7JA 3JRHA 2EA2A 4A3MJ 3KETA 3I55I 1O3TA 1R1TA 2NS0A 1Z67A 4PGGA 3HDDA 3C3WA 4ESJA 2RKHA 2JVHA 3CMEI 2B0LA 4FETA 1J75A 3ZN1A 3HB9A 2M45A 3OS1A 4PFPA 3SDGA 5J8FA 2DYSH 4ITVA 2LY9A 4XRFA 1WJBA 1WCMJ 2V9VA 2ZMEC 1V55H 4HOBA 3PSIA 3GTLJ 2F5VA 3S1MJ 1QHHD 3QYBA 1GV2A 2PQ8A 5E17F 4M3GA 4M6YA 1LUJB 5F1JA 2YPRA 2F4IA 2Z33A 1ZKGA 4HQEA 1BC8C 2CO5A 3N05A 3AAFA 1VQPI 3JREA 1CF7A 2L4AA 2O0YA 2DYRH 3I59B 3LFKA 1WJAA 2Y2ZA 2F5FA 4WXHA 2I8DA 2K86A 2M3AA 4F7ZA 1PUEE 3BG6A 5HLIA 4BHPA 3HPGA 1KONA 2EILH 3KZIC 4CYCB 2K3PA 3VSLA 1S5LC 2VE9A 5LHGA 5E20A 3G73A 3ZN0A 3ZMVA 3HGYA 3ESWB 1I27A 4RM3A 4BDYA 3K70C 1FBSA 2W57A 4M3DA 1E17A 4BXFA 2G7UA 4CCLA 2YU3A 1OR7C 1FZPB 1G8XA 4B3XA 1R5HA 1ENHA 1SD6A 4Q48A 4G7HF 1V5EA 3BPVA 2FE3A 2ME6A 4RB2C 2XGDA 3OYKA 2R7UA 2Y69H 2G0EA 3IKTA 1T98A 1WPKA 3SZGA 4WWCA 3QOEA 2O9LA 1VI0A 2DCEA 4ABZA 5B5EC 2HTJA 1PP8F 3AG4H 2WB1N 1P6RA 4KICA 3RKWA 4NHJA 1W7PB 5J6XA 2V1DA 2L7ZA 4CYCA 2NS7A 4NBQA 2P6SA 4Z2YA 4LB5A 5KHDA 2VN2A 3BR0A 1TQPA 2O61A 2OQGA 2NVQJ 1MNEA 1WRJA 2XV4S 2PMUA 3DU6A 5F08A 3BQYA 1R49A 2BGCA 1QHGA 5F0FA 1EJ9A 1U8BA 1Y8QB 4PJMA 4DYRA 4ZH4F 2QSHX 3BJ6A 1LE8A 2WV1A 4LLLA 4KT6A 5CPRB 4QTRA 1SAXA 1YYVA 4M3BA 3OR2C 2DBBA 3G4SI 5H6QA 2BV6A 2E19A 3HSEA 3RPUD 2LREA 3S2DJ 1WJFA 3AG3H 5D5XB 1EA3A 4MNUA 2DA1A 1HW1A 3I0TA 3HHHA 5BPIA 2OQRA 1E0EA 1WJ5A 1FBQA 3EPZA 2YU9J 5C4XJ 4S04A 3CD6I 4HQMA 2HPIA 1FOKA 4OIRF 3OYAA 3Q9VA 4UUSB 2DT5A 3SFIA 1IXSB 5HVQC 4RLFA 4HEA2 3G71I 1QU3A 3TL4X 4C2TA 2QSFX 4G6DA 4X0GA 2UWMA 2EFWA 1XMAA 3ASOH 4JYKA 2LYCA 1TNSA 4L5EA 2XAHA 3M1CA 4E7KA 3H5AA 1BIBA 5FLMJ 5KK1A 1DPUA 1U6GA 3HUGB 5IT9K 3OV8A 4EMSA 3GTPJ 2NOJB 1J09A 3C2GA 4UV8A 5DUIA 1F36A 2FF4A 3LMMA 1XGOA 3RJPA 2DN0A 2IGMA 2M8GX 1DP7P 3WTZA 5JI6A 4D5FA 4ENMA 1JGSA 2DPDA 5IPAA 2R7TA 3E0JB 4UVBA 2IA0A 3UR3C 2KKOA 1U3EM 3UKGA 4L0YB 5BS6A 2L0KA 1BC7C 4PZJA 1K6OA 1NK2P 4M9ZA 2HOSA 2LKPA 3RKYA 4RS8A 2R0QC 4UUSA 2LK2A 2VL8A 3IHUA 1BN5A 5J4VA 1ACIA 4IL6C 2PLYA 2CUFA 2ID3A 4HLXA 3MKWB 1D5VA 3VYRB 4AVPA 2ZO4A 3S2HJ 1R7JA 2DA4A 1UHWA 5E8IA 5LD2C 2VONA 4RGXA 2FSWA 1ERDA 3Q0VA 4JQFA 1VQNI 2L02A 4HG2A 5DD8A 3HUGA 4IJAA 1OCCH 1RNLA 4C3IJ 1GUUA 3H1CA 4PJNA 4XK4A 2L4MA 3AL0B 2H1KA 3E6CC 4Q4ZF 2XAFA 1WI3A 2H8RA 1X3UA 4N4NB 2DFEA 3DP7A 2V9KA 4XKVA 1TW2A 2NAZA 4XLEA 3QWLA 5EYRA 5ED4A 1W4MA 1DDNA 1SVLA 3GUDA 1XCVA 3TO6A 5DCFA 1UJ8A 1SD4A 5E1ZB 4B44A 2A5WA 5K1YA 3PNVA 3ABMH 3W6JB 3PSFA 2L2OA 2XDVA 3S32A 1IG7A 2DMTA 4LG0A 5F0CA 1LVAA 4RB1A 2VKEA 4A3JJ 1MBFA 2FJ1A 4W97A 5DDGA 3CC7I 5HDNA 2VI6A 3U1DA 4IOCF 3SFZA 2LSOA 2EZHA 5GAHJ 1KQ0A 3HPHA 3KCCA 5L3FA 1N25A 5HLTA 1R5ID 2CUZA 2QQ8A 2HQ5A 2Y0SN 2DOAA 4XL9A 1YW9A 1YOVB 1Z91A 2E5ZA 1B6AA 2D1HA 3GTKJ 4BGDA 2X51A 2HOTA 2OV7A 3HC7A 1T2KA 4OAYA 1IJWC 2X0LA 1ZRCA 1ETQA 4V19K 1JUPA 5FKOA 4ENJA 2P5LC 2JA5J 2VOPA 2K5CA 1MMGA 5E3LA 2WBMA 5IYBJ 3JR9A 2IRFG 3HBLA 1T0FC 1FMWA 4II2A 4BJ5C 4KT5C 4LG0B 1J9IA 4P5OA 4TV7A 2MD0A 1RR7A 1YIOA 5CJ9A 4Y13A 2VBZA 4M6XA 3FXUA 1KU2A 2XGCA 3DEUA 1USTA 3F3XA 3S8PA 5EZGA 1BR4A 3ZGKA 3HXLA 4YG2F 3F72A 1IO2A 3V4GA 3ZQFA 2DA7A 2Y9YA 4MFEA 1PP7U 1IN8A 5FFZA 2QKLB 2XAUA 3FBNB 4IHSA 2JUCA 1SD7A 4BQNA 2OPTA 4ZZDA 3WTWC 3FK6A 1H8AC 1WSUA 3CCMI 3OYJA 3SYTA 1REPC 5BQTA 3ZMTA 1T39A 4U0WA 1FY7A 2DQRA 1W36C 5IOYA 1NTCA 5M5XJ 4BQAA 1MMDA 2H94A 2GXAA 3E3VA 5H6RA 4NC8A 2Z2SB 3E1SA 5A2QK 4BJTA 3J7ZI 2XRLA 3CJQB 1MSFC 4GYIA 4RGRA 2ESHA 2H1LA 2M4GA 4RM2A 1KU9A 3K4NA 5L3GA 4G7ZF 1YW7A 1I1SA 2MGQA 2NXNB 3S3NA 4A3FJ 4XKCA 1V5GA 3GFMA 5LEJA 4A2UA 2KRHA 3BDDA 2J5PA 3CCVI 1OPCA 1NHAA 1SFEA 1U5TC 4P55A 2A6HF 2DA6A 5GTHC 5DV5A 4WF2A 1KYZA 2QSGX 1FOWA 4L5JA 1ZGWA 2VIXA 4G9YA 4XN3A 4CCNA 2RNGA 4XSZF 2WTEA 4LIVA 1Y1VJ 2MH9A 1MMNA 4HNTA 1XPXA 2E1CA 1ZK8A 3F8CA 5ICEA 1H9GA 2IS6A 1MGTA 3TW7A 3GLLA 3CJRB 2GWRA 4C9YA 2J5OA 1KQ9A 3KYDB 2E7XA 1DU0A 3ONQA 2IA1A 2KISA 1YS6A 3OS0A 3K70D 1D3YA 3CUQB 4L9JA 1MNMC 2JSCA 1BBYA 3C2HA 2MC3A 2NVXJ 1ZAOA 1Y6IA 4ZTJA 4IHTA 1LDKB 4YELA 2BY1A 3RYPA 4KMUX 3NEUA 4G6QA 5BOXA 2RN7A 2L9NA 1Z7LA 3CZ6A 4XLAA 2ELKA 2DI3A 1TC3C 3A4CA 4XICA 2L9RA 3E6BA 1JUMA 5DEQA 5EF6A 1BI1A 4EJTA 5HS9A 3W2AA 1RESA 4BYYA 2QEXI 1MJ9A 2DMQA 3F8BA 1U5TB 2L9VA 2Z99A 3A1YA 3RZOJ 3K1NA 1CGPA 4ZDOA 4ETSA 3RTRA 2DFIA 2VE8A 4PFOA 3IRRA 3CJTB 5C4JJ 1R9TJ 4P9UA 3D5RC 4JX4A 4HBLA 3LAJA 4JP0A 4RGSA 4YFKF 1X3WB 3CUQA 4FHTA 4IHXA 1K7AA 1XS9A 1ZLJA 1KYWA 3EUHA 3ZQHA 3NARA 4HSRA 3EQLF 5B1BH 4IHVA 1RKWA 1ZGAA 3FXQA 2HNHA 3H5RA 3ZQLA 5FGMA 3SQNA 2M7AA 2CWEA 5E1WA 3CJNA 4A3LJ 5JLXA 3K2ZA 3OYDA 1R5GA 4MIMA 3SXYA 3F8MA 4EGZA 1YTYA 1XTAA 2BHYA 2XF6A 1LEAA 3M8JA 2QF7A 3MVPA 1ZARA 3W6KB 3KYLA 2Y31A 3E5XA 1RR8C 4GRIA 4IRGA 2EJRA 1FWZA 2DTRA 1QPIA 3L2QA 3C1DA 3B6AA 1RKTA 3H92A 3PL8A 2F4OB 5GADJ 4E6KG 5FLXZ 2FBHA 5IT9Z 2EB7A 4XKBA 3WU0A 2LVSA 5DCMB 1N77A 3GWZA 2F2EA 3QYFA 3BCBA 3ECHA 5LRSA 3RKXA 3VB2A 1PUFB 1MBEA 3V8JA 2QZ8A 5F1RA 1YHQI 3CP8A 3O2PE 1KQ8A 1UMQA 1EH8A 1LB2A 2A5YB 5ICCA 4ZTFA 5K7HA 2GLOA 3WTXC 4EM2A 2ZMEA 1BW5A 2FBKA 1OCTC 5HNHA 3GMEA 1Z9CA 2QVOA 5IOZA 3EETA 4RDUA 2V6EA 5D8KB 4XSXF 2H8WA 3PUBA 2JJ7A 3WGGA 4RAGA 3OYLA 1YE9A 2W24A 1FOXA 3KYCB 4KN4X 5JFRA 4I99C 2LFBA 3WGHA 4GGGA 2KJBA 3FMRA 5E79C 1IUFA 1NG7A 2MSYA 1EV7A 1TTYA 2HDWA 3LWFA 4QLCU 3OYCA 4IHYA 3R6SA 3JW4A 3HGGA 5DCMA 1XG1A 4XRMA 2IXSA 2L54A 2HKXA 3M1EA 4ZYGA 2D1VA 2OC6A 4BQOA 5F0HA 5KNLA 1WQ2A 4RAZA 3IKVA 1PUFA 2FBIA 1U9NA 3LA7A 1TW3A 3OWTA 1S6LA 3TDUC 1ETYA 4EATA 2ESNA 4DYQA 1VNDA 1U9OA 5CQEA 1UAAA 5FRMA 1H89C 2FU4A 4A3EJ 1FLIA 2KDZA 2XKPA 1AA7A 3PQKA 3BZCA 4KISA 4D7MA 1FJLA 4M73A 3GEZA 1X2MA 2VLAA 3TP3A 3HYIA 1T38A 5FKNA 4BS9A 2OAZA 4YIFA 5LFAA 3I56I 5GTIC 4ENKA 2LLKA 2OCEA 4LG3A 2EIKH 2KIQA 1FOYA 5JLWA 2Q1ZB 4CZZA 2DOEA 1HOMA 3HJEA 2AS5F 2V1XA 2LOOA 2R3SA 4L9NA 4QSHA 1BI2A 2MC4A 4A0YA 3ABUA 1HKSA 5AONA 1B8IB 4XLFA 2P7VB 1F1ZA 4PSWA 3DKWA 5ICFA 4D7NA 1ZHFA 4BNCA 2EV6A 4II3A 3S93A 2ZXWH 4FQGA 3K4BA 3BLYA 3F9KA 1VTNC 4AIJA 5EG0B 1BOBA 1K6YA 4MEYF 4EV0A 1Y39A 2R7ZJ 2IAIA 1K78B 1HCRA 5D4SA 4F52A 4E7LA 1WJDA 1L0OC 2KZGA 1JJ8C 4N4OB 4W1UA 2Z16A 3ZMUA 2NRAC 1Y0NA 4WXDA 1RI7A 4NUBA 2OTJI 1BA5A 2R7QA 3H35A 2ZSHB 4E7HA 1VQ6I 3I4PA 4AWXB 1JT6A 4I6ZA 2VKVA 3F8FA 3IAS2 5D8LB 2DLLA 2MLKA 4UHTA 3G3ZA 1B8IA 4HPQA 1Y56A 5F64A 5M5WJ 1OKRA 3VEPA 1K4TA 4ZZLA 3X2QH 5GPCA 3C18A 3FX3A 5EG0A 3J80Z 2VT3A 1Y1WJ 4B3AA 5K7ZA 1T56A 2HFHA 1JHFA 3D5SC 5EJCA 1XMXA 2O8KA 2R7SA 2DDAA 3KZZA 4XLPF 4LOCA 1MBJA 4JBAA 5HODA 2YSRA 2DAOA 2XF7A 4OINF 3IV5A 3DFGA 2P0WA 4LK0F 3A01B 1ITYA 2V1NA 4AD9A 1VQ7I 1JE8A 2ICWG 2RNJA 2PBIA 3TBIA 5FKKA 3IC7A 3MCZA 4HSTA 3CCLI 4HRIA 2QBYA 3EDPA 1O57A 3DEWA 5DD4A 4IQJA 1J0RA 1RC9A 3L2WA 2DDBA 4BJ6C 3PNYA 1MH4A 1ODDA 1R00A 3O8HA 1UHMA 3OYHA 4I0BA 3DPTA 4XBFA 3HTSB 2COBA 1HKQA 1YO5C 1VQ9I 2HYGD 4KIBA 4KYWA 5DUKA 5HLHA 2MD5A 2JZYA 1FYLA 2G7HA 1TWAJ 3H9JA 2F5DA 2ETHA 3FXJA 3L2VA 2HVSA 1MJBA 2IGKA 2LTPA 2HDDA 3MAJA 4XRSA 2E1NA 3KEOA 1WH7A 2CV2A 2KL4A 1W0TA 2R93J 2BBYA 1I3AA 4D0PA 2E7WA 2GXGA 3BJAA 2YX7A 1IXCA 2EBIA 2D45A 4DBRA 1R22A 1R36A 2O03A 3ZXSA 2AQFA 4IVNA 2D5VA 3RI4A 1BR2A 3K6GA 1XC5A 1JGGA 3KP7A 1YS7A 3KX2A 2MA3A 1ZYRF 2E60A 3JRGA 1M1EB 2EQRA 2M7BA 3PO3J 4DBQA 1RPWA 4IRIA 2ELJA 1DP3A 2IEKA 1SC7A 4QPQA 3Q9SA 2Q0OA 4A6EA 2PI0A 3E5QA 3KEQA 2ACJA 2PJPA 2VPLA 3TOBA 2DJNA 2XGXA 3KZYA 3VOEA 5L3BA 2RV8A 3ZQIA 2RDPA 3JRDA 3OIPA 3A03A 3I9V2 1HA8A 2O3FA 1L3LA 1BIAA 2FA5A 1SFKA 3M07A 3WTVC 1K83J 4G12A 3U1KA 4UVAA 2WY8Q 2IS2A 3DTEA 4P1WA 1Z77A 5EEGA 4HW0A 2XKOA 1JKRC 3R61A 2R7XA 1E2XA 2BW3B 2LBFA 4XMYA 3L2UA 3ZQ7A 3V7SA 1R1UA 2BXZA 3GXOA 3JCUC 1Z3XA 2EZIA 2NYXA 3GTJJ 2XROA 1O3RA 3CLQA 1VQMI 1TNTA 1LVKA 1V4RA 2A3SA 3F21A 4Y33A 4I0AA 2M4KA 4EJUA 3DKYA 1QZYA 4FE4A 3PO2J 3HOYJ 1P4WA 2KFDA 3I53A 5J1RA 3S3MA 4DGWB 1ETKA 3MKZA 5B66C 4D1QA 3E6MA 5F6FA 5TRDA 1O4XA 3OYEA 2HZTA 4FE7A 1DQUA 4BY7J 3VSKA 4BU2A 1FNNA 1G3TA 2HZDA 1BOAA 4JK1X 2DMNA 3HKZA 3JTGA 3CO6C 1FSHA 4Y17A 1J59A 2BY2A 1IGNA 2LKSA 4QWQA 3BR6A 1BW6A 2PFBA 4ZJZA 1W5SA 1WJEA 1ON2A 5LLQA 1NK3P 2CUJA 2A07F 1W5CC 4KMFA 2E1OA 4JOMA 1AOYA 1Z7UA 2E2HJ 1ZR4A 4FTHA 1QZZA 1OYIA 2GZWA 3SDBA 2K3FA 5LBQA 2ZXIA 1TT5B 1XGSA 1MDMB 2LF7A 2Y0SA 2RC4A 4C30A 1TBXA 1O3QA 4A93J 5CQGA 3CC2I 4Y4RA 2VXZA 3F22A 4X6AJ 2HI3A 1IXRC 4DYCA 2X1DA 3FKIJ 1YW8A 2K9QA 2ISYA 3SZTA 3S15J 4ZC3A 4EGYA 4XORA 2EIJH 3I4MJ 3R4KA 4L9TA 1IZ1A 3HRTA 1QVTA 2ZFWA 2HKOA 1HBXG 3HOWJ 3E6DA 3BTCA 1S72I 2FEZA 1FMVA 1R71A 2IS1A 3CC4I 1QA6A 3AKZA 2EWNA 3ZP5A 1IN4A 5ILUA 2OUMA 1YIJI 2JN6A 4XKWA 3HEFA 4ZDLA 3RKQA 1LEBA 2WAFA 2F48A 1MBKA 4FCYA 2L01A 2DK8A 2WADA 1UELB 2JMWA 2HXOA 4DW6A 3Q3SA 5FKLA 2M30A 3OS2A 2R5YA 4UVCA 2M5WA 4GO1A 1TL8A 2QM3A 2HQNA 3EUKL 2HOAA 3OIOA 1BM9A 1YQAA 3FM3A 5H20A 3DWLE 1G59A 1TLHB 1WI9A 2ME0A 2JA6J 2DA3A 1JKOC 1D0YA 3F6VA 2IPQX 3D0SA 5IYDJ 2H6CA 4FX0A 2YR2A 2ZXJA 3WG7H 2FNAA 2IP2A 4M9XA 1BJZA 1HF0A 1ON1A 4CICA 4A12A 2LY1A 1MSEC 3W2VA 1OLTA 3LQRA 4DOZA 1FSEA 3MFKA 2NNNA 1USSA 3IUOA 5E3NA 2DA2A 3FF5A 2W82A 1S7OA 2L7MP 1D5YA 3K10A 2CV0A 3FWEA 3RQ4A 2LH9A 5J47A 2M8EA 2QENA 3HRMA 1MD0A 4WXCA 5F27A 2ZJRF 1QBJA 4HV5A 4BE1A 2ZC2A 4UY8I 5HDKA 3LSMA 5DM7F 1DPRA 4GXOA 2R7VA 4YRVA 1FTTA 3O3KA 4CCOA 3S2WA 2HOEA 2WC2A 1ZH5A 3MWMA 3LOCA 2X4HA 4U88A 3OL3A 2ZBKA 1G6NA 1YJNI 5HLGA 4BQQA 1FT9A 2KT0A 1ZELA 3FDYA 1CF7B 1SFXA 1ZGJA 4GDFA 1O3SA 4AM3A 2HEOA 3Q0UA 4S05A 3I59A 3GTQJ 5A2QZ 3FXKA 1RUNA 5E3OA 5D4RA 1X58A 2WWYA 1MKMA 4NB5A 3JSOA 5TGTA 4RBOA 2CMPA 3G2BA 1TQIA 5M3FJ 2VXDA 1G3SA 4BE2A 1S9HA 1S7EA 2DFHA 3J80K 2CW7A 4WX9A 2CJJA 3CCEI 4LLNA 4F93B 2XAQA 5LGTA 3BR3A 2TCTA 3ABKH 4RGUA 4CUGA 2HTSA 1RRJA 4E70A 2DMPA 3F23A 3TP0A 4CSWA 1D1CA 1RUOA 1YLFA 2K9NA 2QWWA 5LGUA 4J19A 1I50J 1D1AA 1Z6RA 5LEKA 3ZMZA 1QPMA 2FOKA 1S8NA 2X6XA 1D0ZA 1LNWA 2JA2A 2FNPA 4MTDA 3WE2A 2H09A 3V7RA 3ECOA 2UXXA 4O5VA 3FK7A 2CSOA 4AIHA 1MMSA 4B48A 4F55A 1VFCA 3DPLC 2R7WA 1IRFA 2QKMB 3CCSI 1W7PA 3DKXA 4M74A 1Z0XA 1YFHA 1LPQA 4F3QA 3CCJI 5CVRA 1GDTA 3H0DA 3DF8A 5H2FC 1P4AA 4A3KJ 3PJRA 3G1LA 2TRTA 3QPHA 1LE8B 2E35A 1XSVA 2HVRA 4I76A 4CXFA 5K5QA 2PX9A 1E3OC 4UV9A 3ZMDA 2VQCA 3FMQA 3QP5A 2R7RA 3L7WA 5IP7J 3PUFA 2OA4A 2GM4A 3GTGJ 1GV5A 2ISZA 1I3QJ 4OMYA 1TQMA 3DBLB 1R4MB 3WU2C 3TKYA 2R7DA 1R23A 3OIQA 5CYVA 3CCQI 1PDNC 1F43A 4E7IA 1B9NA 1SVMA 4RAFA 4BL0B 4GYGA 4EJVA 3A02A 2DQLA 2XRNA 3FBIB 4IPAA 2MBFA 3C2BA 3K4JA 3QPTA 1P4XA 1IUYA 3R0AA 2EV5A 2OU2A 3N4MA 4F92B 4NC6A 1F4KA 1F5TA 4OIOF 3CF2A 2XPVA 1A04A 3FXOA 3L1PA 2VODA 3H36A 3ULQB 2R7OA 5JR3A 4XN0A 1VF9A 1G3WA 3QODA 1X1DA 3TMOA 2Y9ZA 5BPDA 1YRNB 4H4KC 2VUMJ 1OYWA 3OSFA 1VQOI 4PK4A 4MHGA 1XB4A 2K4JA 1T08B 3ROUA 4EVIA 5ILSA 4A0ZA 1W36D 1YI2I 3VDXA 1XSDA 2V9PA 5L3DA 3MKYB 1POGA 2NVYJ 3O6BB 4DJAA 1SEUA 2DU9A 3HL2A 4E7JA 2P4WA 2BY3A 1HDDC 2C6YA 4AIDA 2HYFA 5CVJA 3TQNA 2GQQA 4ESBA 3PQJA 1MIJA 3CDIA 2E34A 2RQQA 2QLZA 4J00A 3KLNA 2KRCA 1A35A 1BI3A 2AQEA 1LFBA 1FP1D 1FX7A 4OMZA 3ERED 2A05A 1W0UA 4NNJA 3GTMJ 1GT0C 4IQ4A 2E1MB 2QCOA 1T0FA 5JVTA 1X1AA 1SAUA 1YRNA 1GHCA 4A5MA 2L5QA 1FPQA 3OSGA 3IL2A 1ZLKA 3GF2A 3K9TA 3BT9A 4I01A 5FJ8J 2IS4A 2AHQA 4LFUA 1AWCA 2ADUA 2DO7A 1EH6A 5F04A 2ZJQF 2MFZA 3LQQA 4HDUA 3LFUA 1X19A 3LL7A 2CFOA 4XLHA 1VQKI 4IHWA 2GAUA 1APLC 3VODA 1BJAA 3RZDJ 1MJAA 4CCMA 3KP2A 3KPHA 3MQ0A 4MGRA 4MQ9F 1GLNA 2EZKA 2VBWA 3FXRA 1T6SA 1VQ4I 2FMYA 4EM0B 3LSTA 3P7NA 2JQ7A 1WJCA 1IN6A 5EZHA 1OR7A 1D1BA 1H9TA 5HS7A 2IGNA 2VT2A 3BOQA 3BY6A 3KP3A 1VZ0A 5M5YJ 1B1BA 4A3CJ 2KP6A 1ETXA 3S1RJ 1ZG5A 2EINH 5LRRA 4F91B 1VQ5I 1I1GA 2DODA 4IKFA 4BDZA 1CQTA 3GFIA 1N75A 2I5UA 3BTIA 2VKHA 3T5XA 2W84A 1UG0A 1QQIA 4KIFA 3IH2A 3KIOA 3GYHX 1TWGJ 2K40A 3ZPLA 2V6CA 2E71A 1SMYF 3N97A 1IRGA 2V7FA 4Q5SF 4A69C 3K1PA 4LITA 5K5RA 1UCRA 3G1OA 5B1AH 2NVUB 5BMZA 2EFPA 2HPMA 1K61A 5JVGF 2P81A 3JAMZ 1MBGA 3V8KA 3S3OA 4EJWA 4UUTA 5K5OA 2A6TA 2BHZA 5J1YA 2Q8KA 5FLVA 1T33A 2XAGA 2DTZA 4EJOA 1TWHJ 4KJZA 2WV0A 2FD5A 3QAHA 3ABLH 4RB3C 2X9DA 2BVMA 3ASNH 3IAM2 3RCOA 4CCJA 3BG3A 2JUGA 2I10A 1JKQC 4YIRX 4HF2A 1ZREA 3ISPA 1TZLA 4HDVA 3JTHA 2VBYA 4A0XA 2XAJA 4RAYA 2HDCA 2MH2A 2VC0A 1H88C 3JRFA 3B6CA 1ETOA 2KRFA 3K2AA 4U87A 1UG2A 3E5UA 3J7AO 2NS8A 3M8FA 2LKXA 4XOPA 4UNOA 3WTSC 1WWXA 3RSNA 3K69A 2QUFA 4BY1J 2KJCA 1JI8A 2OJED 1YJWI 2DT7B 1X4PA 1UZCA 3BTLA 1SANA 3AG2H 4MLOA 3L9FA 3OOPA 5IT3A 2CW0F 3JSPA 3TW6A 2KDOA 4MFDA 3RIRA 1E3HA 2JRTA 2Z1DA 1XX5A 3M3YJ 4L5IA 1I39A 2BVLA 2JSPA 4LMYA 5FKMA 2VB6A 1BI0A 4DZJA 4OIQF 3BJOA 4XR6A 1QNTA 4XRSG 1VQLI 3TOAA 1MNDA 4XLCA 1MBHA 2OCCH 2IJLA 1IV8A 3K7AJ 5KVRA 4CA0A 4E7ZA 5HDGA 2MLGA 2XC7A 1P7JA 2DFFA 3U9GA 3I64A 3COAC 2E2JJ 5EGOB 4CYDA 3WTYC 1HXDA 3QQAA 2HQRA 1DGWY 1X1PA 4BXUA 2K4BA 4NQWA 2CQNA 2OZUA 2RQPA 4BUPA 4AIKA 2TDXA 3CCYA 3ZOBA 2JA8J 4FT8A 2W1OA 2ECCA 4XOTA 2VBXA 3GO5A 4HF0A 4YIIA 3PNTA 4YFXF 2HR3A 1MZBA 1S3JA 3D5LA 4XM3A 1Y0UA 3T8TA 4KDPA 5LHIA 2IW5A 2AO9A 2HXIA 3MEXA 2HU9A 2JVGA 1SMTA 2F5EA 3HOUJ 1O7LA 1IV6A 3A2KA 3VWBA 1G3YA 1I5ZA 2OZ6A 1OJLA 2XIGA 3IH4A 2DW4A 2WB1A 5FROA 4A3BJ 4RLQA 4V2GA 3VPRA 5L3CA 2ZJ2A 4O3MA 2VQHA 3I58A 5EEAA 5EGOA 2EA4A 4HX8A 1SVOA 1PJRA 4B43A 1A6IA 1MH3A 1ZG1A 3KP4A 5K7FA 1TP4A 3LSRA 3U21A 1BL0A 3CMYA 4NQWB 2XUBA 1XCBA 1UB9A 4U7DA 2LD5A 1U2WA 3S16J 2QQBA 1WHUA 4CH7A 2XF5A 1FP2A 4LD5A 5E18F 4CGZA 3B73A 3CESA 4PUSA 3DLAA 2X6WA 2ZJPF 1U5TA 3PIOF 1IF1A 2R7FA 1QO0D 3MD2A 5FD6A 3ML6A 4L18B 1YG2A 3WU1B 1R4NB 2FQ4A 2CRGA 2HQAA 2K9MA 5DTDA 1QVUA 3BG5A 4MQVA 4UUVA 5AIQA 1JT0A 1ZR2A 2O8XA 1PVEA 2M9HA 2PMHA 2W4SA 4LK1F 2CH0A 3ABTA 4EEFG 5HNFA 2ZB9A 4M3EA 1HLVA 2E36A 2M1BA 2Y48A 3KEYA 2WAQN 3ZCOA 4AYBN 4XIDA 1RETA 5KAIC 1OISA 4UXNA 3HIFA 1XSXA 2VJ4A 3LSJA 3P9KA 5M3MJ 2JA7J 3GW2A 3P5JA 1XDSA 3CUQC 3BC8A 2V26A 3AFHA 3LA3A 1OYYA 3CO7C 3FIWA 2X85A 2QYOA 1RZ4A 1HW5A 3KP6A 3BR1A 5E8GA 3Q0WA 4JX6A 4C2MJ 3SEQA 4BBSJ 5CLSA 2PN6A 4B09A 1EF4A 2AXTC 3WTTC 1Z05A 4CDGA 4ZYHA 4KFCA 2FMLA 5TISC 3LSIA 1IN5A 3H3ZA 2PMZN 5GPAA 2DK5A 4IRHA 4XONA 2H27A 4I02A 3VYSB 3ZQGA 1LFPA 3LSPA 2EFOA 2EH3A 2GA1A 4CO8A 5DS9A 5JHUA 2Y0MA 1TT0A 2UXNA 2HS5A 4CZCA 4A3IJ 4HX4A 5D6FA 2XSDC 1ONVA 2IBDA 4G8XA 3SZPA 4CHUA 3QU3A 2FX0A 3FXLA 3K1MA 2UUZA 2IT0A 2HGCA 1OFCX 2ZMEB 1LJ9A 3L2RA 4XNFA 3I71A 1FIAA 3K4MA 4ZYEA 1W5TA 3V7CA 4QPOA 4BBRJ 2STTA 2ECBA 1JTXA 2VJ5A 4M3FA 3W3CA 5TJJA 3OR1C 4KIGA 1KZHA 2DMUA 1YITI 2IGOA 1F9NA 1W1WE 3HTUA 3MZYA 3T1BA 5DYMA 5DM6F 3Q5FA 2DXIA 2PMZA 3JRBA 4HYEA 2JT1A 4PCQA 1J2XA 1EKEA 4XQFA 2PG4A 1GVJA 5IP9J 3TGNA 2VQGA 2F6CA 4DZPA 2V79A 1IRZA 1QRYA 2COMA 2EV0A 3QP6A 4B8XA 5CVUA 3H0GJ 4IX7A 2GXBA 4IEJA 1Y8RB 2ZFUA 2ELHA 3ZQCA 3QYEA 3UNGC 2YUSA 3JAMK 5KAFC 2P6TA 3VFZA 2GIVA 1D8KA 1TWFJ 1XMKA 1OCRH 4KITB 2VOOA 2BYVE 1NG6A 2MG4A 3KE2A 3JRIA 4D9JA 3OY9A 1JJ6C 3E97A 2Y75A 4Y15A 1OMIA 1N78A 1X4OA 3QPSA 2R92J 1P7IA 3QOPA 4OU0A 1ZTRA 2KPMA 3GVAA 2GA2A 3GFJA 4BH9A 4AYBA 3FISA 4M9SA 4PJ0C 3BP8A 3ZRGA 3J81K 1B4AA 4U0VA 1AHDP 1IN7A 4HNUA 5J8CA 2WY7Q 2L7KA 2CQXA 2VJIA 2CQQA 3P9CA 2BY0A 3J7AY 5CVVA 1X1CA 2EPFA 3CLOA 2KLOA 4HX7A 3RPUA 3BROA 1XN7A 4KNYA 2W25A 4N9HA 3LNQA 3S1NJ 3DBRB 2CQ7A 4KA4A 3V42A 1SFOJ 1AKHB 3P9IA 4BAYA 3DBHB 2LNBA 4KUMA 2DA5A 3PFYA 1C0WA 5ERIA 2K7LA 2QQ9A 5E3MA 3EUHC 1K79A 1ZRDA 1R6RA 3LAPA 3J81Z 2QA4I 2VC1A 2FRHA 2O7OA 1QZEA 3ERMA 1HC8A 4NC7A 3OYGA 2NVTJ 3GLXA 3HG9A 3FMSA 2DOFA 3H3UA 1SFUA 3KFWX 1ZN2A 3NQOA 2CFXA 4A3GJ 1XGNA 1I6HJ 3A0HC 2L7FP 1J7KA 4BEHB 2IA2A 1A31A 1J5YA 2RGVA 3GBGA 2W85A 4R1HA 4C3JJ 1JKPC 1ULYA 3OYBA 2E5NA 2K85A 5FLXK 3M9AA 2VJJA 1W7PD 3LA2A 2EZLA 1DUXC 3CMMA 5E1XA 4ZDPA 3WODF 3HOTA 2A68F 3AL0C 2A69F 3HHGA 4S0HB 3MZHA 1A5JA 1AKHA 5D5UB 3OMYA 2RAEA 2GOXB 4I98B 3EUAA 3IWFA 3WE3A 1G2HA 4E7SA 1D8JA 3J7YJ 5J1UA 2W7NA 1FTZA 3RYRA 3U2RA 5KCMA 3ZMSA 3B02A 3M8EA 4HZFA 4E4HA 2KHMA 2KIFA 3BG7A 4B1RA 1OCOH 1PYVA 3OL4A 4BXXJ 3ZR8X 4MEXF 4H0EA 4XLNF 4BEHA 3PIPF 1TWCJ 2GBYA 2W00A 2O5RA 2A6EF 1D0XA 1Z6TA 2LP0A 3QPLA 3CDLA 1B72B 4YEJA 5J3LA 3FXMA 2WAEA 2BXYA 3CUOA 1G4DA 5IY5H 3HZJA 3BR5A 1HSTA 4ON0A 1LFUP 1U78A 2K02A 2XVCA 1V5FA 4D5CA 5EDNA 3GCMA 3OOUA 3DTIA 3GZ5A 4I2OA 2G9WA 1KA8A 2XPWA 4BHBA 3HRSA 5EEHA 2RVCA 2CYYA 4BE0A 2EFQA 2VASA 4AC0A 1MW7A 3V8LA 2EK5A 3I54A 2F5CA 2FOWA 1K78A 2FUG2 1KU3A 4IOAF 1O7FA 1WGXA 4EM1A 2OF7A 4A6DA 1FC3A 3W6VA 1STZA 2WAQA 2STWA 2UZKA 2CQKA 1UHSA 2ZXHA 2PEXA 3WHBA 2B63J 5J4YA 2N8GA 2R4GA 4CCKA 4LJZF 1V54H 1WKMA 3HOZJ 2VQLA 3HOXJ 1B72A 2XB0X 2KIMA 2Z9OA 3FM5A 3T8RA 2V1UA 4I7HA 3DEEA 1GXPA 5ICGA 4AU7A 2VPRA 4ZYAA 3HM5A 2LG4A 1RIOH 4LLGF 1ETWA 4HV6A 1UFMA 3CTAA 3MZ8A 4IXAA 3RDIA 1OCZH 4HLYA 3WTUC 2P5KA 3MMYB 2LF8A 2OD5A 3JRAA 1IC8A 3ELKA 3MKLA 3DTKA 3GTOJ 3BCAA 3OYFA 1ETVA 4RA2A 5CKTA 2YS9A 3R60A 1FYMA 2UV1A 4PDKA 4O6JA 3NAUA 1B9MA 3GZ6A 1VQ8I 1YX3A 3BPXA 1SD5A 3H9QA 2DJIA 1NH3A 3A01A 2XPUA 1FBUA 4ESFA 2YX4A 4DQ2A 3L09A 2KIUA 3DCFA 1ORKA 1Z21A 2KMUA 3IRQA 3BZKA 4G6TB 3PM1A 1X2NA 2QBYB 1S29A 1JTYA 2B7EA 2ZSIB 4B47A 3F6OA 4ENNA 1ZRFA 2ZCWA 4Y7NJ 1P92A 5GP9A 4DNCA 3NRVA 4IF4A 2XHKA 4AVZA 2BW3A 4NDLA 2LBFB 4X1EA 3AG1H 4V2FA 2E1MC 4FX4A 3DU5A 2BZTA 2EFNA 1EH7A 2MW8A 5FRNA 4OIPF 3LSGA 4WK8F 1YJ9I 4Q47A 3DV8A 1LKXA 2L9SA 4Z6YA 2Y30A 3CP2A 2ID6A 2X1EA 1E3PA 3SEZA 1JUSA 5FFXA 3E7LA 1IAWA 3EYIA 1IW7F 3NWTA 4HAMA 1OQYA 2HVQA 2RREA 3IWZA 2X48A 2LDUA 3BR2A 3TO9A 4C2UA 1R58A 3DXJF 4ANJA 2AXLA 5ILVA 3HOSA 2DT6A 2Z3YA 2CW8A 3M7GA 3F0CA 1R1VA 2WA0A 4BACA 2V4JC 1A36A 4EQQA 3EYYA 4Y52J 2X6OA 4HNVA 4WCGA 1U0JA 3A0BC 1DU6A 4P96A 3H5NA 4PJJA 2GIZA 3GX4X 3WG9A 3CQZJ 3W2WA 4MO7A 2HWVA 2M0CA 3VYUB 1H0MA 2BE5F 2KQRA 5D6EA 3KLOA 5GAGJ 1FIPA 3HOVJ 3IP4B 1MDMA 4BHCA 2MABA 3TEDA 2O6GE 1WH5A 3R0JA 2JPCA 3DLLF 2P7CB 1P9QC 2FXAA 4LIUA 5FB2A 3I4NJ 2F4MB 3H3VK 2K9LA 1FYKA 1X3ZB 4M71A 3T0YA 4UB8C 4OOIA 5C3EJ 4HF1A 5IYCJ 4I09A 3WHCA 3RQIA 5IP6A 3TDZC 3L2CA 1DGRM 3HSRA 1WVRA 3OYIA 3CDHA 3LSHA 3M4OJ 5FD5A 2IVMA 1S7AA 3JRCA 3K4CA 4HA8A 4BKXA 3S17J 5HS8A 2QGUA 5CVIA 1I6XA 3HKZN 3GZNB 2NNYA 1HSJA 5JHFA 2M34A 3K4LA 4YFNF 3SHFA 3S1QJ 5AIPA 3I5UA 1HDPA 2PJRB 4IZZA 3FHZA 4L0ZB 2MYSA 1HQCA 3DQVC 2Q2EB 4B4CA 2NOGA 1B59A 4U7BA 4KN7X 3G1MA 3I3LA 4M72A 4GCVA 3S14J 4MTEA 5B3SH 2CUEA 2CG4A 2OTLI 3HSFA 1IDYA 4PSXA 2R5ZB 3GFLA 3D1NI 2EIMH 4LB6B 4G94A 4OWRB 3K0LA 2XSJC 1U8RA 2JK3A 2FQ3A 1WZ2A 4N0BA 3BG9A 5FO5A 4RMNA 5HOOA 4PGHA 3MN2A 1Z3YA 3CMAI 2BEOA 1T8IA 4JX5A 2CU7A 2XB5A 3RPQA 3FZVA 2ZKZA 1XGMA
chains in the Genus database with same CATH topology
1YITI 3CCJI 2ZJQF 2FOWA 3PIPF 3CCVI 2QA4I 1YJ9I 3G4SI 1S72I 1VQNI 1VQ5I 3CC4I 2OTJI 5DM6F 2K3FA 2ZJRF 1QA6A 4IOAF 1VQKI 3G71I 1HC8A 3G6EI 1VQOI 1VQ6I 3J7ZI 1VQLI 4UY8I 5GADJ 2QEXI 1FOWA 3I55I 3I56I 5DM7F 3CF5F 1YIJI 4V19K 3CC7I 3J7YJ 2H8WA 2OTLI 4IO9F 1YI2I 1VQPI 2E35A 1Y39A 3CC2I 1FOYA 4IOCF 1VQMI 5GAHJ 1VQ9I 1VQ4I 1FOXA 3CMEI 5GAGJ 3CJTB 2JQ7A 1ACIA 2NXNB 2E36A 1YJWI 1VQ7I 3CCUI 3CCEI 1YHQI 1MMSA 3CD6I 1YJNI 3CCLI 3CCRI 3CMAI 5GAEJ 3DLLF 3CCMI 2E34A 2ZJPF 3CCSI 3PIOF 1VQ8I 3CCQI 5JVGF
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1YIT I;  3CCJ I;  2ZJQ F;  2FOW A;  3PIP F;  3CCV I;  2QA4 I;  1YJ9 I;  3G4S I;  1S72 I;  1VQN I;  1VQ5 I;  3CC4 I;  2OTJ I;  5DM6 F;  2K3F A;  2ZJR F;  1QA6 A;  4IOA F;  1VQK I;  3G71 I;  1HC8 A;  3G6E I;  1VQO I;  1VQ6 I;  3J7Z I;  1VQL I;  4UY8 I;  5GAD J;  2QEX I;  1FOW A;  3I55 I;  3I56 I;  5DM7 F;  3CF5 F;  1YIJ I;  4V19 K;  3CC7 I;  3J7Y J;  2H8W A;  2OTL I;  4IO9 F;  1YI2 I;  1VQP I;  2E35 A;  1Y39 A;  3CC2 I;  1FOY A;  4IOC F;  1VQM I;  5GAH J;  1VQ9 I;  1VQ4 I;  1FOX A;  3CME I;  5GAG J;  3CJT B;  2JQ7 A;  1ACI A;  2NXN B;  2E36 A;  1YJW I;  1VQ7 I;  3CCU I;  3CCE I;  1YHQ I;  1MMS A;  3CD6 I;  1YJN I;  3CCL I;  3CCR I;  3CMA I;  5GAE J;  3DLL F;  3CCM I;  2E34 A;  2ZJP F;  3CCS I;  3PIO F;  1VQ8 I;  3CCQ I;  5JVG F; 
#chains in the Genus database with same CATH topology
 4J01 A;  2A61 A;  4ASN A;  2BOL A;  1ZG3 A;  4FIS A;  2LRD A;  2JPB A;  1ZQ3 P;  3REO A;  1OCP A;  1KGS A;  3PFI A;  5BNG A;  3F8N A;  4RB0 A;  4FAS D;  4IO9 F;  2E2I J;  3BTJ A;  2KZV A;  1T95 A;  2PJR A;  2LY2 A;  2CGP A;  2LC2 A;  3VYT B;  4A5N A;  1XDU A;  4C3H J;  1P2F A;  2Q2E A;  2P8T A;  3H9G A;  2L3D A;  2HYJ A;  1Z1D A;  4K2E A;  3CCU I;  4G7O F;  1YX5 A;  4QIW N;  2M2E A;  2JWT A;  4ZYD A;  3SJM A;  2R5Z A;  1Q1V A;  1IDZ A;  1HW2 A;  2OBP A;  3BQZ A;  1KU7 A;  5LHH A;  4OAZ A;  4AUX A;  1IRX A;  2H6B A;  5C44 J;  3CF5 F;  4U0Y A;  1FEX A;  9ANT A;  2CV1 A;  4L9V A;  4GFB A;  4Y3O A;  2XAS A;  3ZQQ A;  3FHN A;  4UB6 C;  2B9S A;  3K4K A;  6PAX A;  2D2W A;  2P5V A;  2DPU A;  2M0M A;  1LDD A;  1GXQ A;  3WGI A;  1LDJ A;  3QRF F;  3OYN A;  3CCR I;  3HRU A;  1X1B A;  2ZNZ A;  4N9I A;  1V3F A;  3IH3 A;  1HKT A;  2LR8 A;  3OYM A;  2K27 A;  4M6V A;  2M87 A;  3DPU A;  4DIQ A;  2VKD A;  2JTV A;  5D5V B;  4LGW A;  3G6E I;  1MMA A;  2R5Y B;  2Z5U A;  5J40 A;  3LSK A;  4PJL A;  3TO7 A;  4P9F A;  2JRM A;  3O8G A;  5L3E A;  1JHH A;  5LGN A;  2X6Y A;  3L00 A;  3NWS A;  2XGE A;  4R8H A;  2GOM A;  3KP5 A;  2K9S A;  3BWG A;  5D5W B;  2X1C A;  4A3D J;  2W48 A;  1A6Q A;  3QU6 A;  5GAE J;  2LMD A;  2ZNY A;  1Q1H A;  1BR1 A;  1JXS A;  3FKJ A;  1WFX A;  2QQA A;  1AU7 A;  1XD7 A;  1QGP A;  3BZ6 A;  1LQ1 A;  1K4S A;  1GVD A;  4R79 A;  2CS3 A;  3C7J A;  3JRH A;  2EA2 A;  4A3M J;  3KET A;  3I55 I;  1O3T A;  1R1T A;  2NS0 A;  1Z67 A;  4PGG A;  3HDD A;  3C3W A;  4ESJ A;  2RKH A;  2JVH A;  3CME I;  2B0L A;  4FET A;  1J75 A;  3ZN1 A;  3HB9 A;  2M45 A;  3OS1 A;  4PFP A;  3SDG A;  5J8F A;  2DYS H;  4ITV A;  2LY9 A;  4XRF A;  1WJB A;  1WCM J;  2V9V A;  2ZME C;  1V55 H;  4HOB A;  3PSI A;  3GTL J;  2F5V A;  3S1M J;  1QHH D;  3QYB A;  1GV2 A;  2PQ8 A;  5E17 F;  4M3G A;  4M6Y A;  1LUJ B;  5F1J A;  2YPR A;  2F4I A;  2Z33 A;  1ZKG A;  4HQE A;  1BC8 C;  2CO5 A;  3N05 A;  3AAF A;  1VQP I;  3JRE A;  1CF7 A;  2L4A A;  2O0Y A;  2DYR H;  3I59 B;  3LFK A;  1WJA A;  2Y2Z A;  2F5F A;  4WXH A;  2I8D A;  2K86 A;  2M3A A;  4F7Z A;  1PUE E;  3BG6 A;  5HLI A;  4BHP A;  3HPG A;  1KON A;  2EIL H;  3KZI C;  4CYC B;  2K3P A;  3VSL A;  1S5L C;  2VE9 A;  5LHG A;  5E20 A;  3G73 A;  3ZN0 A;  3ZMV A;  3HGY A;  3ESW B;  1I27 A;  4RM3 A;  4BDY A;  3K70 C;  1FBS A;  2W57 A;  4M3D A;  1E17 A;  4BXF A;  2G7U A;  4CCL A;  2YU3 A;  1OR7 C;  1FZP B;  1G8X A;  4B3X A;  1R5H A;  1ENH A;  1SD6 A;  4Q48 A;  4G7H F;  1V5E A;  3BPV A;  2FE3 A;  2ME6 A;  4RB2 C;  2XGD A;  3OYK A;  2R7U A;  2Y69 H;  2G0E A;  3IKT A;  1T98 A;  1WPK A;  3SZG A;  4WWC A;  3QOE A;  2O9L A;  1VI0 A;  2DCE A;  4ABZ A;  5B5E C;  2HTJ A;  1PP8 F;  3AG4 H;  2WB1 N;  1P6R A;  4KIC A;  3RKW A;  4NHJ A;  1W7P B;  5J6X A;  2V1D A;  2L7Z A;  4CYC A;  2NS7 A;  4NBQ A;  2P6S A;  4Z2Y A;  4LB5 A;  5KHD A;  2VN2 A;  3BR0 A;  1TQP A;  2O61 A;  2OQG A;  2NVQ J;  1MNE A;  1WRJ A;  2XV4 S;  2PMU A;  3DU6 A;  5F08 A;  3BQY A;  1R49 A;  2BGC A;  1QHG A;  5F0F A;  1EJ9 A;  1U8B A;  1Y8Q B;  4PJM A;  4DYR A;  4ZH4 F;  2QSH X;  3BJ6 A;  1LE8 A;  2WV1 A;  4LLL A;  4KT6 A;  5CPR B;  4QTR A;  1SAX A;  1YYV A;  4M3B A;  3OR2 C;  2DBB A;  3G4S I;  5H6Q A;  2BV6 A;  2E19 A;  3HSE A;  3RPU D;  2LRE A;  3S2D J;  1WJF A;  3AG3 H;  5D5X B;  1EA3 A;  4MNU A;  2DA1 A;  1HW1 A;  3I0T A;  3HHH A;  5BPI A;  2OQR A;  1E0E A;  1WJ5 A;  1FBQ A;  3EPZ A;  2YU9 J;  5C4X J;  4S04 A;  3CD6 I;  4HQM A;  2HPI A;  1FOK A;  4OIR F;  3OYA A;  3Q9V A;  4UUS B;  2DT5 A;  3SFI A;  1IXS B;  5HVQ C;  4RLF A;  4HEA 2;  3G71 I;  1QU3 A;  3TL4 X;  4C2T A;  2QSF X;  4G6D A;  4X0G A;  2UWM A;  2EFW A;  1XMA A;  3ASO H;  4JYK A;  2LYC A;  1TNS A;  4L5E A;  2XAH A;  3M1C A;  4E7K A;  3H5A A;  1BIB A;  5FLM J;  5KK1 A;  1DPU A;  1U6G A;  3HUG B;  5IT9 K;  3OV8 A;  4EMS A;  3GTP J;  2NOJ B;  1J09 A;  3C2G A;  4UV8 A;  5DUI A;  1F36 A;  2FF4 A;  3LMM A;  1XGO A;  3RJP A;  2DN0 A;  2IGM A;  2M8G X;  1DP7 P;  3WTZ A;  5JI6 A;  4D5F A;  4ENM A;  1JGS A;  2DPD A;  5IPA A;  2R7T A;  3E0J B;  4UVB A;  2IA0 A;  3UR3 C;  2KKO A;  1U3E M;  3UKG A;  4L0Y B;  5BS6 A;  2L0K A;  1BC7 C;  4PZJ A;  1K6O A;  1NK2 P;  4M9Z A;  2HOS A;  2LKP A;  3RKY A;  4RS8 A;  2R0Q C;  4UUS A;  2LK2 A;  2VL8 A;  3IHU A;  1BN5 A;  5J4V A;  1ACI A;  4IL6 C;  2PLY A;  2CUF A;  2ID3 A;  4HLX A;  3MKW B;  1D5V A;  3VYR B;  4AVP A;  2ZO4 A;  3S2H J;  1R7J A;  2DA4 A;  1UHW A;  5E8I A;  5LD2 C;  2VON A;  4RGX A;  2FSW A;  1ERD A;  3Q0V A;  4JQF A;  1VQN I;  2L02 A;  4HG2 A;  5DD8 A;  3HUG A;  4IJA A;  1OCC H;  1RNL A;  4C3I J;  1GUU A;  3H1C A;  4PJN A;  4XK4 A;  2L4M A;  3AL0 B;  2H1K A;  3E6C C;  4Q4Z F;  2XAF A;  1WI3 A;  2H8R A;  1X3U A;  4N4N B;  2DFE A;  3DP7 A;  2V9K A;  4XKV A;  1TW2 A;  2NAZ A;  4XLE A;  3QWL A;  5EYR A;  5ED4 A;  1W4M A;  1DDN A;  1SVL A;  3GUD A;  1XCV A;  3TO6 A;  5DCF A;  1UJ8 A;  1SD4 A;  5E1Z B;  4B44 A;  2A5W A;  5K1Y A;  3PNV A;  3ABM H;  3W6J B;  3PSF A;  2L2O A;  2XDV A;  3S32 A;  1IG7 A;  2DMT A;  4LG0 A;  5F0C A;  1LVA A;  4RB1 A;  2VKE A;  4A3J J;  1MBF A;  2FJ1 A;  4W97 A;  5DDG A;  3CC7 I;  5HDN A;  2VI6 A;  3U1D A;  4IOC F;  3SFZ A;  2LSO A;  2EZH A;  5GAH J;  1KQ0 A;  3HPH A;  3KCC A;  5L3F A;  1N25 A;  5HLT A;  1R5I D;  2CUZ A;  2QQ8 A;  2HQ5 A;  2Y0S N;  2DOA A;  4XL9 A;  1YW9 A;  1YOV B;  1Z91 A;  2E5Z A;  1B6A A;  2D1H A;  3GTK J;  4BGD A;  2X51 A;  2HOT A;  2OV7 A;  3HC7 A;  1T2K A;  4OAY A;  1IJW C;  2X0L A;  1ZRC A;  1ETQ A;  4V19 K;  1JUP A;  5FKO A;  4ENJ A;  2P5L C;  2JA5 J;  2VOP A;  2K5C A;  1MMG A;  5E3L A;  2WBM A;  5IYB J;  3JR9 A;  2IRF G;  3HBL A;  1T0F C;  1FMW A;  4II2 A;  4BJ5 C;  4KT5 C;  4LG0 B;  1J9I A;  4P5O A;  4TV7 A;  2MD0 A;  1RR7 A;  1YIO A;  5CJ9 A;  4Y13 A;  2VBZ A;  4M6X A;  3FXU A;  1KU2 A;  2XGC A;  3DEU A;  1UST A;  3F3X A;  3S8P A;  5EZG A;  1BR4 A;  3ZGK A;  3HXL A;  4YG2 F;  3F72 A;  1IO2 A;  3V4G A;  3ZQF A;  2DA7 A;  2Y9Y A;  4MFE A;  1PP7 U;  1IN8 A;  5FFZ A;  2QKL B;  2XAU A;  3FBN B;  4IHS A;  2JUC A;  1SD7 A;  4BQN A;  2OPT A;  4ZZD A;  3WTW C;  3FK6 A;  1H8A C;  1WSU A;  3CCM I;  3OYJ A;  3SYT A;  1REP C;  5BQT A;  3ZMT A;  1T39 A;  4U0W A;  1FY7 A;  2DQR A;  1W36 C;  5IOY A;  1NTC A;  5M5X J;  4BQA A;  1MMD A;  2H94 A;  2GXA A;  3E3V A;  5H6R A;  4NC8 A;  2Z2S B;  3E1S A;  5A2Q K;  4BJT A;  3J7Z I;  2XRL A;  3CJQ B;  1MSF C;  4GYI A;  4RGR A;  2ESH A;  2H1L A;  2M4G A;  4RM2 A;  1KU9 A;  3K4N A;  5L3G A;  4G7Z F;  1YW7 A;  1I1S A;  2MGQ A;  2NXN B;  3S3N A;  4A3F J;  4XKC A;  1V5G A;  3GFM A;  5LEJ A;  4A2U A;  2KRH A;  3BDD A;  2J5P A;  3CCV I;  1OPC A;  1NHA A;  1SFE A;  1U5T C;  4P55 A;  2A6H F;  2DA6 A;  5GTH C;  5DV5 A;  4WF2 A;  1KYZ A;  2QSG X;  1FOW A;  4L5J A;  1ZGW A;  2VIX A;  4G9Y A;  4XN3 A;  4CCN A;  2RNG A;  4XSZ F;  2WTE A;  4LIV A;  1Y1V J;  2MH9 A;  1MMN A;  4HNT A;  1XPX A;  2E1C A;  1ZK8 A;  3F8C A;  5ICE A;  1H9G A;  2IS6 A;  1MGT A;  3TW7 A;  3GLL A;  3CJR B;  2GWR A;  4C9Y A;  2J5O A;  1KQ9 A;  3KYD B;  2E7X A;  1DU0 A;  3ONQ A;  2IA1 A;  2KIS A;  1YS6 A;  3OS0 A;  3K70 D;  1D3Y A;  3CUQ B;  4L9J A;  1MNM C;  2JSC A;  1BBY A;  3C2H A;  2MC3 A;  2NVX J;  1ZAO A;  1Y6I A;  4ZTJ A;  4IHT A;  1LDK B;  4YEL A;  2BY1 A;  3RYP A;  4KMU X;  3NEU A;  4G6Q A;  5BOX A;  2RN7 A;  2L9N A;  1Z7L A;  3CZ6 A;  4XLA A;  2ELK A;  2DI3 A;  1TC3 C;  3A4C A;  4XIC A;  2L9R A;  3E6B A;  1JUM A;  5DEQ A;  5EF6 A;  1BI1 A;  4EJT A;  5HS9 A;  3W2A A;  1RES A;  4BYY A;  2QEX I;  1MJ9 A;  2DMQ A;  3F8B A;  1U5T B;  2L9V A;  2Z99 A;  3A1Y A;  3RZO J;  3K1N A;  1CGP A;  4ZDO A;  4ETS A;  3RTR A;  2DFI A;  2VE8 A;  4PFO A;  3IRR A;  3CJT B;  5C4J J;  1R9T J;  4P9U A;  3D5R C;  4JX4 A;  4HBL A;  3LAJ A;  4JP0 A;  4RGS A;  4YFK F;  1X3W B;  3CUQ A;  4FHT A;  4IHX A;  1K7A A;  1XS9 A;  1ZLJ A;  1KYW A;  3EUH A;  3ZQH A;  3NAR A;  4HSR A;  3EQL F;  5B1B H;  4IHV A;  1RKW A;  1ZGA A;  3FXQ A;  2HNH A;  3H5R A;  3ZQL A;  5FGM A;  3SQN A;  2M7A A;  2CWE A;  5E1W A;  3CJN A;  4A3L J;  5JLX A;  3K2Z A;  3OYD A;  1R5G A;  4MIM A;  3SXY A;  3F8M A;  4EGZ A;  1YTY A;  1XTA A;  2BHY A;  2XF6 A;  1LEA A;  3M8J A;  2QF7 A;  3MVP A;  1ZAR A;  3W6K B;  3KYL A;  2Y31 A;  3E5X A;  1RR8 C;  4GRI A;  4IRG A;  2EJR A;  1FWZ A;  2DTR A;  1QPI A;  3L2Q A;  3C1D A;  3B6A A;  1RKT A;  3H92 A;  3PL8 A;  2F4O B;  5GAD J;  4E6K G;  5FLX Z;  2FBH A;  5IT9 Z;  2EB7 A;  4XKB A;  3WU0 A;  2LVS A;  5DCM B;  1N77 A;  3GWZ A;  2F2E A;  3QYF A;  3BCB A;  3ECH A;  5LRS A;  3RKX A;  3VB2 A;  1PUF B;  1MBE A;  3V8J A;  2QZ8 A;  5F1R A;  1YHQ I;  3CP8 A;  3O2P E;  1KQ8 A;  1UMQ A;  1EH8 A;  1LB2 A;  2A5Y B;  5ICC A;  4ZTF A;  5K7H A;  2GLO A;  3WTX C;  4EM2 A;  2ZME A;  1BW5 A;  2FBK A;  1OCT C;  5HNH A;  3GME A;  1Z9C A;  2QVO A;  5IOZ A;  3EET A;  4RDU A;  2V6E A;  5D8K B;  4XSX F;  2H8W A;  3PUB A;  2JJ7 A;  3WGG A;  4RAG A;  3OYL A;  1YE9 A;  2W24 A;  1FOX A;  3KYC B;  4KN4 X;  5JFR A;  4I99 C;  2LFB A;  3WGH A;  4GGG A;  2KJB A;  3FMR A;  5E79 C;  1IUF A;  1NG7 A;  2MSY A;  1EV7 A;  1TTY A;  2HDW A;  3LWF A;  4QLC U;  3OYC A;  4IHY A;  3R6S A;  3JW4 A;  3HGG A;  5DCM A;  1XG1 A;  4XRM A;  2IXS A;  2L54 A;  2HKX A;  3M1E A;  4ZYG A;  2D1V A;  2OC6 A;  4BQO A;  5F0H A;  5KNL A;  1WQ2 A;  4RAZ A;  3IKV A;  1PUF A;  2FBI A;  1U9N A;  3LA7 A;  1TW3 A;  3OWT A;  1S6L A;  3TDU C;  1ETY A;  4EAT A;  2ESN A;  4DYQ A;  1VND A;  1U9O A;  5CQE A;  1UAA A;  5FRM A;  1H89 C;  2FU4 A;  4A3E J;  1FLI A;  2KDZ A;  2XKP A;  1AA7 A;  3PQK A;  3BZC A;  4KIS A;  4D7M A;  1FJL A;  4M73 A;  3GEZ A;  1X2M A;  2VLA A;  3TP3 A;  3HYI A;  1T38 A;  5FKN A;  4BS9 A;  2OAZ A;  4YIF A;  5LFA A;  3I56 I;  5GTI C;  4ENK A;  2LLK A;  2OCE A;  4LG3 A;  2EIK H;  2KIQ A;  1FOY A;  5JLW A;  2Q1Z B;  4CZZ A;  2DOE A;  1HOM A;  3HJE A;  2AS5 F;  2V1X A;  2LOO A;  2R3S A;  4L9N A;  4QSH A;  1BI2 A;  2MC4 A;  4A0Y A;  3ABU A;  1HKS A;  5AON A;  1B8I B;  4XLF A;  2P7V B;  1F1Z A;  4PSW A;  3DKW A;  5ICF A;  4D7N A;  1ZHF A;  4BNC A;  2EV6 A;  4II3 A;  3S93 A;  2ZXW H;  4FQG A;  3K4B A;  3BLY A;  3F9K A;  1VTN C;  4AIJ A;  5EG0 B;  1BOB A;  1K6Y A;  4MEY F;  4EV0 A;  1Y39 A;  2R7Z J;  2IAI A;  1K78 B;  1HCR A;  5D4S A;  4F52 A;  4E7L A;  1WJD A;  1L0O C;  2KZG A;  1JJ8 C;  4N4O B;  4W1U A;  2Z16 A;  3ZMU A;  2NRA C;  1Y0N A;  4WXD A;  1RI7 A;  4NUB A;  2OTJ I;  1BA5 A;  2R7Q A;  3H35 A;  2ZSH B;  4E7H A;  1VQ6 I;  3I4P A;  4AWX B;  1JT6 A;  4I6Z A;  2VKV A;  3F8F A;  3IAS 2;  5D8L B;  2DLL A;  2MLK A;  4UHT A;  3G3Z A;  1B8I A;  4HPQ A;  1Y56 A;  5F64 A;  5M5W J;  1OKR A;  3VEP A;  1K4T A;  4ZZL A;  3X2Q H;  5GPC A;  3C18 A;  3FX3 A;  5EG0 A;  3J80 Z;  2VT3 A;  1Y1W J;  4B3A A;  5K7Z A;  1T56 A;  2HFH A;  1JHF A;  3D5S C;  5EJC A;  1XMX A;  2O8K A;  2R7S A;  2DDA A;  3KZZ A;  4XLP F;  4LOC A;  1MBJ A;  4JBA A;  5HOD A;  2YSR A;  2DAO A;  2XF7 A;  4OIN F;  3IV5 A;  3DFG A;  2P0W A;  4LK0 F;  3A01 B;  1ITY A;  2V1N A;  4AD9 A;  1VQ7 I;  1JE8 A;  2ICW G;  2RNJ A;  2PBI A;  3TBI A;  5FKK A;  3IC7 A;  3MCZ A;  4HST A;  3CCL I;  4HRI A;  2QBY A;  3EDP A;  1O57 A;  3DEW A;  5DD4 A;  4IQJ A;  1J0R A;  1RC9 A;  3L2W A;  2DDB A;  4BJ6 C;  3PNY A;  1MH4 A;  1ODD A;  1R00 A;  3O8H A;  1UHM A;  3OYH A;  4I0B A;  3DPT A;  4XBF A;  3HTS B;  2COB A;  1HKQ A;  1YO5 C;  1VQ9 I;  2HYG D;  4KIB A;  4KYW A;  5DUK A;  5HLH A;  2MD5 A;  2JZY A;  1FYL A;  2G7H A;  1TWA J;  3H9J A;  2F5D A;  2ETH A;  3FXJ A;  3L2V A;  2HVS A;  1MJB A;  2IGK A;  2LTP A;  2HDD A;  3MAJ A;  4XRS A;  2E1N A;  3KEO A;  1WH7 A;  2CV2 A;  2KL4 A;  1W0T A;  2R93 J;  2BBY A;  1I3A A;  4D0P A;  2E7W A;  2GXG A;  3BJA A;  2YX7 A;  1IXC A;  2EBI A;  2D45 A;  4DBR A;  1R22 A;  1R36 A;  2O03 A;  3ZXS A;  2AQF A;  4IVN A;  2D5V A;  3RI4 A;  1BR2 A;  3K6G A;  1XC5 A;  1JGG A;  3KP7 A;  1YS7 A;  3KX2 A;  2MA3 A;  1ZYR F;  2E60 A;  3JRG A;  1M1E B;  2EQR A;  2M7B A;  3PO3 J;  4DBQ A;  1RPW A;  4IRI A;  2ELJ A;  1DP3 A;  2IEK A;  1SC7 A;  4QPQ A;  3Q9S A;  2Q0O A;  4A6E A;  2PI0 A;  3E5Q A;  3KEQ A;  2ACJ A;  2PJP A;  2VPL A;  3TOB A;  2DJN A;  2XGX A;  3KZY A;  3VOE A;  5L3B A;  2RV8 A;  3ZQI A;  2RDP A;  3JRD A;  3OIP A;  3A03 A;  3I9V 2;  1HA8 A;  2O3F A;  1L3L A;  1BIA A;  2FA5 A;  1SFK A;  3M07 A;  3WTV C;  1K83 J;  4G12 A;  3U1K A;  4UVA A;  2WY8 Q;  2IS2 A;  3DTE A;  4P1W A;  1Z77 A;  5EEG A;  4HW0 A;  2XKO A;  1JKR C;  3R61 A;  2R7X A;  1E2X A;  2BW3 B;  2LBF A;  4XMY A;  3L2U A;  3ZQ7 A;  3V7S A;  1R1U A;  2BXZ A;  3GXO A;  3JCU C;  1Z3X A;  2EZI A;  2NYX A;  3GTJ J;  2XRO A;  1O3R A;  3CLQ A;  1VQM I;  1TNT A;  1LVK A;  1V4R A;  2A3S A;  3F21 A;  4Y33 A;  4I0A A;  2M4K A;  4EJU A;  3DKY A;  1QZY A;  4FE4 A;  3PO2 J;  3HOY J;  1P4W A;  2KFD A;  3I53 A;  5J1R A;  3S3M A;  4DGW B;  1ETK A;  3MKZ A;  5B66 C;  4D1Q A;  3E6M A;  5F6F A;  5TRD A;  1O4X A;  3OYE A;  2HZT A;  4FE7 A;  1DQU A;  4BY7 J;  3VSK A;  4BU2 A;  1FNN A;  1G3T A;  2HZD A;  1BOA A;  4JK1 X;  2DMN A;  3HKZ A;  3JTG A;  3CO6 C;  1FSH A;  4Y17 A;  1J59 A;  2BY2 A;  1IGN A;  2LKS A;  4QWQ A;  3BR6 A;  1BW6 A;  2PFB A;  4ZJZ A;  1W5S A;  1WJE A;  1ON2 A;  5LLQ A;  1NK3 P;  2CUJ A;  2A07 F;  1W5C C;  4KMF A;  2E1O A;  4JOM A;  1AOY A;  1Z7U A;  2E2H J;  1ZR4 A;  4FTH A;  1QZZ A;  1OYI A;  2GZW A;  3SDB A;  2K3F A;  5LBQ A;  2ZXI A;  1TT5 B;  1XGS A;  1MDM B;  2LF7 A;  2Y0S A;  2RC4 A;  4C30 A;  1TBX A;  1O3Q A;  4A93 J;  5CQG A;  3CC2 I;  4Y4R A;  2VXZ A;  3F22 A;  4X6A J;  2HI3 A;  1IXR C;  4DYC A;  2X1D A;  3FKI J;  1YW8 A;  2K9Q A;  2ISY A;  3SZT A;  3S15 J;  4ZC3 A;  4EGY A;  4XOR A;  2EIJ H;  3I4M J;  3R4K A;  4L9T A;  1IZ1 A;  3HRT A;  1QVT A;  2ZFW A;  2HKO A;  1HBX G;  3HOW J;  3E6D A;  3BTC A;  1S72 I;  2FEZ A;  1FMV A;  1R71 A;  2IS1 A;  3CC4 I;  1QA6 A;  3AKZ A;  2EWN A;  3ZP5 A;  1IN4 A;  5ILU A;  2OUM A;  1YIJ I;  2JN6 A;  4XKW A;  3HEF A;  4ZDL A;  3RKQ A;  1LEB A;  2WAF A;  2F48 A;  1MBK A;  4FCY A;  2L01 A;  2DK8 A;  2WAD A;  1UEL B;  2JMW A;  2HXO A;  4DW6 A;  3Q3S A;  5FKL A;  2M30 A;  3OS2 A;  2R5Y A;  4UVC A;  2M5W A;  4GO1 A;  1TL8 A;  2QM3 A;  2HQN A;  3EUK L;  2HOA A;  3OIO A;  1BM9 A;  1YQA A;  3FM3 A;  5H20 A;  3DWL E;  1G59 A;  1TLH B;  1WI9 A;  2ME0 A;  2JA6 J;  2DA3 A;  1JKO C;  1D0Y A;  3F6V A;  2IPQ X;  3D0S A;  5IYD J;  2H6C A;  4FX0 A;  2YR2 A;  2ZXJ A;  3WG7 H;  2FNA A;  2IP2 A;  4M9X A;  1BJZ A;  1HF0 A;  1ON1 A;  4CIC A;  4A12 A;  2LY1 A;  1MSE C;  3W2V A;  1OLT A;  3LQR A;  4DOZ A;  1FSE A;  3MFK A;  2NNN A;  1USS A;  3IUO A;  5E3N A;  2DA2 A;  3FF5 A;  2W82 A;  1S7O A;  2L7M P;  1D5Y A;  3K10 A;  2CV0 A;  3FWE A;  3RQ4 A;  2LH9 A;  5J47 A;  2M8E A;  2QEN A;  3HRM A;  1MD0 A;  4WXC A;  5F27 A;  2ZJR F;  1QBJ A;  4HV5 A;  4BE1 A;  2ZC2 A;  4UY8 I;  5HDK A;  3LSM A;  5DM7 F;  1DPR A;  4GXO A;  2R7V A;  4YRV A;  1FTT A;  3O3K A;  4CCO A;  3S2W A;  2HOE A;  2WC2 A;  1ZH5 A;  3MWM A;  3LOC A;  2X4H A;  4U88 A;  3OL3 A;  2ZBK A;  1G6N A;  1YJN I;  5HLG A;  4BQQ A;  1FT9 A;  2KT0 A;  1ZEL A;  3FDY A;  1CF7 B;  1SFX A;  1ZGJ A;  4GDF A;  1O3S A;  4AM3 A;  2HEO A;  3Q0U A;  4S05 A;  3I59 A;  3GTQ J;  5A2Q Z;  3FXK A;  1RUN A;  5E3O A;  5D4R A;  1X58 A;  2WWY A;  1MKM A;  4NB5 A;  3JSO A;  5TGT A;  4RBO A;  2CMP A;  3G2B A;  1TQI A;  5M3F J;  2VXD A;  1G3S A;  4BE2 A;  1S9H A;  1S7E A;  2DFH A;  3J80 K;  2CW7 A;  4WX9 A;  2CJJ A;  3CCE I;  4LLN A;  4F93 B;  2XAQ A;  5LGT A;  3BR3 A;  2TCT A;  3ABK H;  4RGU A;  4CUG A;  2HTS A;  1RRJ A;  4E70 A;  2DMP A;  3F23 A;  3TP0 A;  4CSW A;  1D1C A;  1RUO A;  1YLF A;  2K9N A;  2QWW A;  5LGU A;  4J19 A;  1I50 J;  1D1A A;  1Z6R A;  5LEK A;  3ZMZ A;  1QPM A;  2FOK A;  1S8N A;  2X6X A;  1D0Z A;  1LNW A;  2JA2 A;  2FNP A;  4MTD A;  3WE2 A;  2H09 A;  3V7R A;  3ECO A;  2UXX A;  4O5V A;  3FK7 A;  2CSO A;  4AIH A;  1MMS A;  4B48 A;  4F55 A;  1VFC A;  3DPL C;  2R7W A;  1IRF A;  2QKM B;  3CCS I;  1W7P A;  3DKX A;  4M74 A;  1Z0X A;  1YFH A;  1LPQ A;  4F3Q A;  3CCJ I;  5CVR A;  1GDT A;  3H0D A;  3DF8 A;  5H2F C;  1P4A A;  4A3K J;  3PJR A;  3G1L A;  2TRT A;  3QPH A;  1LE8 B;  2E35 A;  1XSV A;  2HVR A;  4I76 A;  4CXF A;  5K5Q A;  2PX9 A;  1E3O C;  4UV9 A;  3ZMD A;  2VQC A;  3FMQ A;  3QP5 A;  2R7R A;  3L7W A;  5IP7 J;  3PUF A;  2OA4 A;  2GM4 A;  3GTG J;  1GV5 A;  2ISZ A;  1I3Q J;  4OMY A;  1TQM A;  3DBL B;  1R4M B;  3WU2 C;  3TKY A;  2R7D A;  1R23 A;  3OIQ A;  5CYV A;  3CCQ I;  1PDN C;  1F43 A;  4E7I A;  1B9N A;  1SVM A;  4RAF A;  4BL0 B;  4GYG A;  4EJV A;  3A02 A;  2DQL A;  2XRN A;  3FBI B;  4IPA A;  2MBF A;  3C2B A;  3K4J A;  3QPT A;  1P4X A;  1IUY A;  3R0A A;  2EV5 A;  2OU2 A;  3N4M A;  4F92 B;  4NC6 A;  1F4K A;  1F5T A;  4OIO F;  3CF2 A;  2XPV A;  1A04 A;  3FXO A;  3L1P A;  2VOD A;  3H36 A;  3ULQ B;  2R7O A;  5JR3 A;  4XN0 A;  1VF9 A;  1G3W A;  3QOD A;  1X1D A;  3TMO A;  2Y9Z A;  5BPD A;  1YRN B;  4H4K C;  2VUM J;  1OYW A;  3OSF A;  1VQO I;  4PK4 A;  4MHG A;  1XB4 A;  2K4J A;  1T08 B;  3ROU A;  4EVI A;  5ILS A;  4A0Z A;  1W36 D;  1YI2 I;  3VDX A;  1XSD A;  2V9P A;  5L3D A;  3MKY B;  1POG A;  2NVY J;  3O6B B;  4DJA A;  1SEU A;  2DU9 A;  3HL2 A;  4E7J A;  2P4W A;  2BY3 A;  1HDD C;  2C6Y A;  4AID A;  2HYF A;  5CVJ A;  3TQN A;  2GQQ A;  4ESB A;  3PQJ A;  1MIJ A;  3CDI A;  2E34 A;  2RQQ A;  2QLZ A;  4J00 A;  3KLN A;  2KRC A;  1A35 A;  1BI3 A;  2AQE A;  1LFB A;  1FP1 D;  1FX7 A;  4OMZ A;  3ERE D;  2A05 A;  1W0U A;  4NNJ A;  3GTM J;  1GT0 C;  4IQ4 A;  2E1M B;  2QCO A;  1T0F A;  5JVT A;  1X1A A;  1SAU A;  1YRN A;  1GHC A;  4A5M A;  2L5Q A;  1FPQ A;  3OSG A;  3IL2 A;  1ZLK A;  3GF2 A;  3K9T A;  3BT9 A;  4I01 A;  5FJ8 J;  2IS4 A;  2AHQ A;  4LFU A;  1AWC A;  2ADU A;  2DO7 A;  1EH6 A;  5F04 A;  2ZJQ F;  2MFZ A;  3LQQ A;  4HDU A;  3LFU A;  1X19 A;  3LL7 A;  2CFO A;  4XLH A;  1VQK I;  4IHW A;  2GAU A;  1APL C;  3VOD A;  1BJA A;  3RZD J;  1MJA A;  4CCM A;  3KP2 A;  3KPH A;  3MQ0 A;  4MGR A;  4MQ9 F;  1GLN A;  2EZK A;  2VBW A;  3FXR A;  1T6S A;  1VQ4 I;  2FMY A;  4EM0 B;  3LST A;  3P7N A;  2JQ7 A;  1WJC A;  1IN6 A;  5EZH A;  1OR7 A;  1D1B A;  1H9T A;  5HS7 A;  2IGN A;  2VT2 A;  3BOQ A;  3BY6 A;  3KP3 A;  1VZ0 A;  5M5Y J;  1B1B A;  4A3C J;  2KP6 A;  1ETX A;  3S1R J;  1ZG5 A;  2EIN H;  5LRR A;  4F91 B;  1VQ5 I;  1I1G A;  2DOD A;  4IKF A;  4BDZ A;  1CQT A;  3GFI A;  1N75 A;  2I5U A;  3BTI A;  2VKH A;  3T5X A;  2W84 A;  1UG0 A;  1QQI A;  4KIF A;  3IH2 A;  3KIO A;  3GYH X;  1TWG J;  2K40 A;  3ZPL A;  2V6C A;  2E71 A;  1SMY F;  3N97 A;  1IRG A;  2V7F A;  4Q5S F;  4A69 C;  3K1P A;  4LIT A;  5K5R A;  1UCR A;  3G1O A;  5B1A H;  2NVU B;  5BMZ A;  2EFP A;  2HPM A;  1K61 A;  5JVG F;  2P81 A;  3JAM Z;  1MBG A;  3V8K A;  3S3O A;  4EJW A;  4UUT A;  5K5O A;  2A6T A;  2BHZ A;  5J1Y A;  2Q8K A;  5FLV A;  1T33 A;  2XAG A;  2DTZ A;  4EJO A;  1TWH J;  4KJZ A;  2WV0 A;  2FD5 A;  3QAH A;  3ABL H;  4RB3 C;  2X9D A;  2BVM A;  3ASN H;  3IAM 2;  3RCO A;  4CCJ A;  3BG3 A;  2JUG A;  2I10 A;  1JKQ C;  4YIR X;  4HF2 A;  1ZRE A;  3ISP A;  1TZL A;  4HDV A;  3JTH A;  2VBY A;  4A0X A;  2XAJ A;  4RAY A;  2HDC A;  2MH2 A;  2VC0 A;  1H88 C;  3JRF A;  3B6C A;  1ETO A;  2KRF A;  3K2A A;  4U87 A;  1UG2 A;  3E5U A;  3J7A O;  2NS8 A;  3M8F A;  2LKX A;  4XOP A;  4UNO A;  3WTS C;  1WWX A;  3RSN A;  3K69 A;  2QUF A;  4BY1 J;  2KJC A;  1JI8 A;  2OJE D;  1YJW I;  2DT7 B;  1X4P A;  1UZC A;  3BTL A;  1SAN A;  3AG2 H;  4MLO A;  3L9F A;  3OOP A;  5IT3 A;  2CW0 F;  3JSP A;  3TW6 A;  2KDO A;  4MFD A;  3RIR A;  1E3H A;  2JRT A;  2Z1D A;  1XX5 A;  3M3Y J;  4L5I A;  1I39 A;  2BVL A;  2JSP A;  4LMY A;  5FKM A;  2VB6 A;  1BI0 A;  4DZJ A;  4OIQ F;  3BJO A;  4XR6 A;  1QNT A;  4XRS G;  1VQL I;  3TOA A;  1MND A;  4XLC A;  1MBH A;  2OCC H;  2IJL A;  1IV8 A;  3K7A J;  5KVR A;  4CA0 A;  4E7Z A;  5HDG A;  2MLG A;  2XC7 A;  1P7J A;  2DFF A;  3U9G A;  3I64 A;  3COA C;  2E2J J;  5EGO B;  4CYD A;  3WTY C;  1HXD A;  3QQA A;  2HQR A;  1DGW Y;  1X1P A;  4BXU A;  2K4B A;  4NQW A;  2CQN A;  2OZU A;  2RQP A;  4BUP A;  4AIK A;  2TDX A;  3CCY A;  3ZOB A;  2JA8 J;  4FT8 A;  2W1O A;  2ECC A;  4XOT A;  2VBX A;  3GO5 A;  4HF0 A;  4YII A;  3PNT A;  4YFX F;  2HR3 A;  1MZB A;  1S3J A;  3D5L A;  4XM3 A;  1Y0U A;  3T8T A;  4KDP A;  5LHI A;  2IW5 A;  2AO9 A;  2HXI A;  3MEX A;  2HU9 A;  2JVG A;  1SMT A;  2F5E A;  3HOU J;  1O7L A;  1IV6 A;  3A2K A;  3VWB A;  1G3Y A;  1I5Z A;  2OZ6 A;  1OJL A;  2XIG A;  3IH4 A;  2DW4 A;  2WB1 A;  5FRO A;  4A3B J;  4RLQ A;  4V2G A;  3VPR A;  5L3C A;  2ZJ2 A;  4O3M A;  2VQH A;  3I58 A;  5EEA A;  5EGO A;  2EA4 A;  4HX8 A;  1SVO A;  1PJR A;  4B43 A;  1A6I A;  1MH3 A;  1ZG1 A;  3KP4 A;  5K7F A;  1TP4 A;  3LSR A;  3U21 A;  1BL0 A;  3CMY A;  4NQW B;  2XUB A;  1XCB A;  1UB9 A;  4U7D A;  2LD5 A;  1U2W A;  3S16 J;  2QQB A;  1WHU A;  4CH7 A;  2XF5 A;  1FP2 A;  4LD5 A;  5E18 F;  4CGZ A;  3B73 A;  3CES A;  4PUS A;  3DLA A;  2X6W A;  2ZJP F;  1U5T A;  3PIO F;  1IF1 A;  2R7F A;  1QO0 D;  3MD2 A;  5FD6 A;  3ML6 A;  4L18 B;  1YG2 A;  3WU1 B;  1R4N B;  2FQ4 A;  2CRG A;  2HQA A;  2K9M A;  5DTD A;  1QVU A;  3BG5 A;  4MQV A;  4UUV A;  5AIQ A;  1JT0 A;  1ZR2 A;  2O8X A;  1PVE A;  2M9H A;  2PMH A;  2W4S A;  4LK1 F;  2CH0 A;  3ABT A;  4EEF G;  5HNF A;  2ZB9 A;  4M3E A;  1HLV A;  2E36 A;  2M1B A;  2Y48 A;  3KEY A;  2WAQ N;  3ZCO A;  4AYB N;  4XID A;  1RET A;  5KAI C;  1OIS A;  4UXN A;  3HIF A;  1XSX A;  2VJ4 A;  3LSJ A;  3P9K A;  5M3M J;  2JA7 J;  3GW2 A;  3P5J A;  1XDS A;  3CUQ C;  3BC8 A;  2V26 A;  3AFH A;  3LA3 A;  1OYY A;  3CO7 C;  3FIW A;  2X85 A;  2QYO A;  1RZ4 A;  1HW5 A;  3KP6 A;  3BR1 A;  5E8G A;  3Q0W A;  4JX6 A;  4C2M J;  3SEQ A;  4BBS J;  5CLS A;  2PN6 A;  4B09 A;  1EF4 A;  2AXT C;  3WTT C;  1Z05 A;  4CDG A;  4ZYH A;  4KFC A;  2FML A;  5TIS C;  3LSI A;  1IN5 A;  3H3Z A;  2PMZ N;  5GPA A;  2DK5 A;  4IRH A;  4XON A;  2H27 A;  4I02 A;  3VYS B;  3ZQG A;  1LFP A;  3LSP A;  2EFO A;  2EH3 A;  2GA1 A;  4CO8 A;  5DS9 A;  5JHU A;  2Y0M A;  1TT0 A;  2UXN A;  2HS5 A;  4CZC A;  4A3I J;  4HX4 A;  5D6F A;  2XSD C;  1ONV A;  2IBD A;  4G8X A;  3SZP A;  4CHU A;  3QU3 A;  2FX0 A;  3FXL A;  3K1M A;  2UUZ A;  2IT0 A;  2HGC A;  1OFC X;  2ZME B;  1LJ9 A;  3L2R A;  4XNF A;  3I71 A;  1FIA A;  3K4M A;  4ZYE A;  1W5T A;  3V7C A;  4QPO A;  4BBR J;  2STT A;  2ECB A;  1JTX A;  2VJ5 A;  4M3F A;  3W3C A;  5TJJ A;  3OR1 C;  4KIG A;  1KZH A;  2DMU A;  1YIT I;  2IGO A;  1F9N A;  1W1W E;  3HTU A;  3MZY A;  3T1B A;  5DYM A;  5DM6 F;  3Q5F A;  2DXI A;  2PMZ A;  3JRB A;  4HYE A;  2JT1 A;  4PCQ A;  1J2X A;  1EKE A;  4XQF A;  2PG4 A;  1GVJ A;  5IP9 J;  3TGN A;  2VQG A;  2F6C A;  4DZP A;  2V79 A;  1IRZ A;  1QRY A;  2COM A;  2EV0 A;  3QP6 A;  4B8X A;  5CVU A;  3H0G J;  4IX7 A;  2GXB A;  4IEJ A;  1Y8R B;  2ZFU A;  2ELH A;  3ZQC A;  3QYE A;  3UNG C;  2YUS A;  3JAM K;  5KAF C;  2P6T A;  3VFZ A;  2GIV A;  1D8K A;  1TWF J;  1XMK A;  1OCR H;  4KIT B;  2VOO A;  2BYV E;  1NG6 A;  2MG4 A;  3KE2 A;  3JRI A;  4D9J A;  3OY9 A;  1JJ6 C;  3E97 A;  2Y75 A;  4Y15 A;  1OMI A;  1N78 A;  1X4O A;  3QPS A;  2R92 J;  1P7I A;  3QOP A;  4OU0 A;  1ZTR A;  2KPM A;  3GVA A;  2GA2 A;  3GFJ A;  4BH9 A;  4AYB A;  3FIS A;  4M9S A;  4PJ0 C;  3BP8 A;  3ZRG A;  3J81 K;  1B4A A;  4U0V A;  1AHD P;  1IN7 A;  4HNU A;  5J8C A;  2WY7 Q;  2L7K A;  2CQX A;  2VJI A;  2CQQ A;  3P9C A;  2BY0 A;  3J7A Y;  5CVV A;  1X1C A;  2EPF A;  3CLO A;  2KLO A;  4HX7 A;  3RPU A;  3BRO A;  1XN7 A;  4KNY A;  2W25 A;  4N9H A;  3LNQ A;  3S1N J;  3DBR B;  2CQ7 A;  4KA4 A;  3V42 A;  1SFO J;  1AKH B;  3P9I A;  4BAY A;  3DBH B;  2LNB A;  4KUM A;  2DA5 A;  3PFY A;  1C0W A;  5ERI A;  2K7L A;  2QQ9 A;  5E3M A;  3EUH C;  1K79 A;  1ZRD A;  1R6R A;  3LAP A;  3J81 Z;  2QA4 I;  2VC1 A;  2FRH A;  2O7O A;  1QZE A;  3ERM A;  1HC8 A;  4NC7 A;  3OYG A;  2NVT J;  3GLX A;  3HG9 A;  3FMS A;  2DOF A;  3H3U A;  1SFU A;  3KFW X;  1ZN2 A;  3NQO A;  2CFX A;  4A3G J;  1XGN A;  1I6H J;  3A0H C;  2L7F P;  1J7K A;  4BEH B;  2IA2 A;  1A31 A;  1J5Y A;  2RGV A;  3GBG A;  2W85 A;  4R1H A;  4C3J J;  1JKP C;  1ULY A;  3OYB A;  2E5N A;  2K85 A;  5FLX K;  3M9A A;  2VJJ A;  1W7P D;  3LA2 A;  2EZL A;  1DUX C;  3CMM A;  5E1X A;  4ZDP A;  3WOD F;  3HOT A;  2A68 F;  3AL0 C;  2A69 F;  3HHG A;  4S0H B;  3MZH A;  1A5J A;  1AKH A;  5D5U B;  3OMY A;  2RAE A;  2GOX B;  4I98 B;  3EUA A;  3IWF A;  3WE3 A;  1G2H A;  4E7S A;  1D8J A;  3J7Y J;  5J1U A;  2W7N A;  1FTZ A;  3RYR A;  3U2R A;  5KCM A;  3ZMS A;  3B02 A;  3M8E A;  4HZF A;  4E4H A;  2KHM A;  2KIF A;  3BG7 A;  4B1R A;  1OCO H;  1PYV A;  3OL4 A;  4BXX J;  3ZR8 X;  4MEX F;  4H0E A;  4XLN F;  4BEH A;  3PIP F;  1TWC J;  2GBY A;  2W00 A;  2O5R A;  2A6E F;  1D0X A;  1Z6T A;  2LP0 A;  3QPL A;  3CDL A;  1B72 B;  4YEJ A;  5J3L A;  3FXM A;  2WAE A;  2BXY A;  3CUO A;  1G4D A;  5IY5 H;  3HZJ A;  3BR5 A;  1HST A;  4ON0 A;  1LFU P;  1U78 A;  2K02 A;  2XVC A;  1V5F A;  4D5C A;  5EDN A;  3GCM A;  3OOU A;  3DTI A;  3GZ5 A;  4I2O A;  2G9W A;  1KA8 A;  2XPW A;  4BHB A;  3HRS A;  5EEH A;  2RVC A;  2CYY A;  4BE0 A;  2EFQ A;  2VAS A;  4AC0 A;  1MW7 A;  3V8L A;  2EK5 A;  3I54 A;  2F5C A;  2FOW A;  1K78 A;  2FUG 2;  1KU3 A;  4IOA F;  1O7F A;  1WGX A;  4EM1 A;  2OF7 A;  4A6D A;  1FC3 A;  3W6V A;  1STZ A;  2WAQ A;  2STW A;  2UZK A;  2CQK A;  1UHS A;  2ZXH A;  2PEX A;  3WHB A;  2B63 J;  5J4Y A;  2N8G A;  2R4G A;  4CCK A;  4LJZ F;  1V54 H;  1WKM A;  3HOZ J;  2VQL A;  3HOX J;  1B72 A;  2XB0 X;  2KIM A;  2Z9O A;  3FM5 A;  3T8R A;  2V1U A;  4I7H A;  3DEE A;  1GXP A;  5ICG A;  4AU7 A;  2VPR A;  4ZYA A;  3HM5 A;  2LG4 A;  1RIO H;  4LLG F;  1ETW A;  4HV6 A;  1UFM A;  3CTA A;  3MZ8 A;  4IXA A;  3RDI A;  1OCZ H;  4HLY A;  3WTU C;  2P5K A;  3MMY B;  2LF8 A;  2OD5 A;  3JRA A;  1IC8 A;  3ELK A;  3MKL A;  3DTK A;  3GTO J;  3BCA A;  3OYF A;  1ETV A;  4RA2 A;  5CKT A;  2YS9 A;  3R60 A;  1FYM A;  2UV1 A;  4PDK A;  4O6J A;  3NAU A;  1B9M A;  3GZ6 A;  1VQ8 I;  1YX3 A;  3BPX A;  1SD5 A;  3H9Q A;  2DJI A;  1NH3 A;  3A01 A;  2XPU A;  1FBU A;  4ESF A;  2YX4 A;  4DQ2 A;  3L09 A;  2KIU A;  3DCF A;  1ORK A;  1Z21 A;  2KMU A;  3IRQ A;  3BZK A;  4G6T B;  3PM1 A;  1X2N A;  2QBY B;  1S29 A;  1JTY A;  2B7E A;  2ZSI B;  4B47 A;  3F6O A;  4ENN A;  1ZRF A;  2ZCW A;  4Y7N J;  1P92 A;  5GP9 A;  4DNC A;  3NRV A;  4IF4 A;  2XHK A;  4AVZ A;  2BW3 A;  4NDL A;  2LBF B;  4X1E A;  3AG1 H;  4V2F A;  2E1M C;  4FX4 A;  3DU5 A;  2BZT A;  2EFN A;  1EH7 A;  2MW8 A;  5FRN A;  4OIP F;  3LSG A;  4WK8 F;  1YJ9 I;  4Q47 A;  3DV8 A;  1LKX A;  2L9S A;  4Z6Y A;  2Y30 A;  3CP2 A;  2ID6 A;  2X1E A;  1E3P A;  3SEZ A;  1JUS A;  5FFX A;  3E7L A;  1IAW A;  3EYI A;  1IW7 F;  3NWT A;  4HAM A;  1OQY A;  2HVQ A;  2RRE A;  3IWZ A;  2X48 A;  2LDU A;  3BR2 A;  3TO9 A;  4C2U A;  1R58 A;  3DXJ F;  4ANJ A;  2AXL A;  5ILV A;  3HOS A;  2DT6 A;  2Z3Y A;  2CW8 A;  3M7G A;  3F0C A;  1R1V A;  2WA0 A;  4BAC A;  2V4J C;  1A36 A;  4EQQ A;  3EYY A;  4Y52 J;  2X6O A;  4HNV A;  4WCG A;  1U0J A;  3A0B C;  1DU6 A;  4P96 A;  3H5N A;  4PJJ A;  2GIZ A;  3GX4 X;  3WG9 A;  3CQZ J;  3W2W A;  4MO7 A;  2HWV A;  2M0C A;  3VYU B;  1H0M A;  2BE5 F;  2KQR A;  5D6E A;  3KLO A;  5GAG J;  1FIP A;  3HOV J;  3IP4 B;  1MDM A;  4BHC A;  2MAB A;  3TED A;  2O6G E;  1WH5 A;  3R0J A;  2JPC A;  3DLL F;  2P7C B;  1P9Q C;  2FXA A;  4LIU A;  5FB2 A;  3I4N J;  2F4M B;  3H3V K;  2K9L A;  1FYK A;  1X3Z B;  4M71 A;  3T0Y A;  4UB8 C;  4OOI A;  5C3E J;  4HF1 A;  5IYC J;  4I09 A;  3WHC A;  3RQI A;  5IP6 A;  3TDZ C;  3L2C A;  1DGR M;  3HSR A;  1WVR A;  3OYI A;  3CDH A;  3LSH A;  3M4O J;  5FD5 A;  2IVM A;  1S7A A;  3JRC A;  3K4C A;  4HA8 A;  4BKX A;  3S17 J;  5HS8 A;  2QGU A;  5CVI A;  1I6X A;  3HKZ N;  3GZN B;  2NNY A;  1HSJ A;  5JHF A;  2M34 A;  3K4L A;  4YFN F;  3SHF A;  3S1Q J;  5AIP A;  3I5U A;  1HDP A;  2PJR B;  4IZZ A;  3FHZ A;  4L0Z B;  2MYS A;  1HQC A;  3DQV C;  2Q2E B;  4B4C A;  2NOG A;  1B59 A;  4U7B A;  4KN7 X;  3G1M A;  3I3L A;  4M72 A;  4GCV A;  3S14 J;  4MTE A;  5B3S H;  2CUE A;  2CG4 A;  2OTL I;  3HSF A;  1IDY A;  4PSX A;  2R5Z B;  3GFL A;  3D1N I;  2EIM H;  4LB6 B;  4G94 A;  4OWR B;  3K0L A;  2XSJ C;  1U8R A;  2JK3 A;  2FQ3 A;  1WZ2 A;  4N0B A;  3BG9 A;  5FO5 A;  4RMN A;  5HOO A;  4PGH A;  3MN2 A;  1Z3Y A;  3CMA I;  2BEO A;  1T8I A;  4JX5 A;  2CU7 A;  2XB5 A;  3RPQ A;  3FZV A;  2ZKZ A;  1XGM A; 
#chains in the Genus database with same CATH homology
 1YIT I;  3CCJ I;  2ZJQ F;  2FOW A;  3PIP F;  3CCV I;  2QA4 I;  1YJ9 I;  3G4S I;  1S72 I;  1VQN I;  1VQ5 I;  3CC4 I;  2OTJ I;  5DM6 F;  2K3F A;  2ZJR F;  1QA6 A;  4IOA F;  1VQK I;  3G71 I;  1HC8 A;  3G6E I;  1VQO I;  1VQ6 I;  3J7Z I;  1VQL I;  4UY8 I;  5GAD J;  2QEX I;  1FOW A;  3I55 I;  3I56 I;  5DM7 F;  3CF5 F;  1YIJ I;  4V19 K;  3CC7 I;  3J7Y J;  2H8W A;  2OTL I;  4IO9 F;  1YI2 I;  1VQP I;  2E35 A;  1Y39 A;  3CC2 I;  1FOY A;  4IOC F;  1VQM I;  5GAH J;  1VQ9 I;  1VQ4 I;  1FOX A;  3CME I;  5GAG J;  3CJT B;  2JQ7 A;  1ACI A;  2NXN B;  2E36 A;  1YJW I;  1VQ7 I;  3CCU I;  3CCE I;  1YHQ I;  1MMS A;  3CD6 I;  1YJN I;  3CCL I;  3CCR I;  3CMA I;  5GAE J;  3DLL F;  3CCM I;  2E34 A;  2ZJP F;  3CCS I;  3PIO F;  1VQ8 I;  3CCQ I;  5JVG F; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...