2ZJRF

Refined native structure of the large ribosomal subunit (50s) from deinococcus radiodurans
Total Genus 11
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
11
sequence length
71
structure length
71
Chain Sequence
MSYLIRKAAGIGKGSSTPNKAKVGKLNWDQVLEIAKTKMPDLNAGSVEAAANTVAGTARSMGVTVEGGPNA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords ribosomal 23S RNA
publication title Translational regulation via L11: molecular switches on the ribosome turned on and off by thiostrepton and micrococcin.
pubmed doi rcsb
molecule tags Ribosome
total genus 11
structure length 71
sequence length 71
ec nomenclature
pdb deposition date 2008-03-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
F PF00298 Ribosomal_L11 Ribosomal protein L11, RNA binding domain
F PF03946 Ribosomal_L11_N Ribosomal protein L11, N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.250 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Ribosomal protein L11, C-terminal domain 2zjrF00
1YHQI 1VQ7I 3CCQI 3CCEI 3CC7I 1YJNI 2K3FA 2E36A 3CCUI 1HC8A 3G4SI 3G6EI 3J7YJ 5GADJ 4IOCF 2FOWA 2OTLI 5JVGF 4IOAF 5GAGJ 1YJWI 1VQOI 1VQPI 3G71I 1VQ4I 3CCLI 2QEXI 1VQ6I 1VQNI 1YI2I 5GAHJ 1YITI 3CMEI 3CMAI 2QA4I 3CD6I 1MMSA 1S72I 1VQMI 4IO9F 1FOYA 1VQLI 1QA6A 1ACIA 4UY8I 2OTJI 1VQ5I 2NXNB 3I55I 4V19K 3CC4I 3CCRI 1FOWA 3I56I 2ZJQF 5DM7F 1Y39A 3DLLF 2E35A 1VQ8I 3CCJI 3CJTB 1YIJI 2JQ7A 3CC2I 1VQ9I 2E34A 5DM6F 2H8WA 3CCSI 3PIPF 1VQKI 3CCVI 2ZJPF 3CCMI 2ZJRF 3PIOF 5GAEJ 1FOXA 3J7ZI 1YJ9I 3CF5F
chains in the Genus database with same CATH superfamily
3CO6C 4ZYDA 1ZR2A 1J7KA 2W7NA 3J80Z 5DTDA 3K9TA 3F21A 1TTYA 2DFEA 1BR4A 2VXDA 2OCEA 1MSFC 2XKPA 3TP0A 4KIFA 1DUXC 2AQEA 2HS5A 1ORKA 2E1MB 2PFBA 1ONVA 2H09A 2XGXA 3VPRA 3PO3J 1O7FA 3A1YA 3A01A 1G8XA 4PSWA 5HLGA 2EV5A 2BE5F 2JUCA 1W0UA 2LSOA 2NRAC 3H9QA 1KQ9A 1Y8QB 2EPFA 3DKWA 4LIUA 2YSRA 2X0LA 3SFIA 3KP7A 1APLC 2M2EA 5JFRA 1WKMA 3VODA 4HLYA 3ASNH 4WCGA 1V5EA 2JN6A 1XMXA 2Y69H 2JMWA 2FD5A 5FKNA 2DDAA 3R0AA 2CO5A 2COMA 3HM5A 1BI2A 1UCRA 4AM3A 1K6YA 2X1DA 4BHPA 2DODA 1TL8A 3E97A 4IO9F 1J2XA 1LQ1A 1BI1A 1ON2A 3F72A 1PP7U 1U3EM 4EJVA 4DJAA 1UFMA 4NC8A 4UUVA 4M6XA 4UY8I 1YYVA 3FBIB 4IPAA 1V5FA 2HYFA 2Q2EA 4LIVA 4AIDA 3WG9A 2LH9A 2FRHA 2NS8A 1F4KA 1MNMC 2PG4A 3CUQA 4FTHA 2ETHA 3F3XA 1EJ9A 1WRJA 4RLQA 5H6RA 2HQNA 2EV6A 1B9MA 2ZJQF 3W6VA 4MTDA 4M9ZA 2A05A 1BOBA 4WXDA 5E3MA 3H5RA 3DF8A 1RETA 1BW6A 2LTPA 3IAS2 2IS2A 1W5CC 4BHBA 4HDUA 2HVSA 2Q2EB 4N4NB 2VPLA 1P2FA 1OCRH 3TO9A 2TCTA 3KCCA 2IEKA 3CQZJ 3CUQB 4EATA 2G7HA 5GTHC 4MQVA 2DTRA 3TP3A 4Y15A 2M45A 1MJ9A 1ZARA 2R7TA 4XLEA 3JRCA 2H8WA 1D0XA 4XLNF 1VQKI 3K4JA 4OINF 5LRSA 2A68F 3VSLA 2VJ4A 4G94A 2KZVA 3QU3A 1BIAA 2ZMEA 2JPCA 4G12A 2IGKA 2LREA 1HXDA 1X4PA 4YFXF 1XN7A 1OR7A 4F55A 4U7DA 2GXBA 1FBSA 3C2HA 3MN2A 4XM3A 4WWCA 1ENHA 1EH7A 1K79A 5ICGA 2Z99A 4L5JA 1J0RA 3L2VA 1CF7A 1STZA 3VYSB 1QPMA 1OPCA 2V4JC 2W00A 3IWZA 5JR3A 4U88A 4DBQA 4YEJA 1SFOJ 2CRGA 4Y13A 3G6EI 4BS9A 3S2DJ 4NQWB 2KHMA 1JJ8C 4KNYA 1HCRA 2VT3A 2DA7A 4C3IJ 2M8EA 5J8FA 1H88C 2GA1A 2ZMEB 4BEHA 3JRAA 1VF9A 2MH9A 1Z67A 2NVYJ 1FYKA 1P4WA 4XOPA 2VOOA 3CMYA 3CDHA 3PFIA 2E5NA 4OIRF 1YJWI 3KP3A 4B8XA 2AXLA 1VQPI 2AQFA 3IAM2 1QNTA 3S3NA 3TBIA 3RYRA 1BC7C 4U0WA 4A3KJ 2RGVA 3S16J 3EQLF 1BOAA 4WXHA 4XSZF 3WU2C 4CCNA 1XPXA 4CSWA 4A12A 1P7JA 4IXAA 2DMTA 1EH8A 4A2UA 2J5OA 5LHHA 3BG9A 1USTA 3CD6I 2JK3A 3ZOBA 4C3HJ 3PFYA 2KLOA 4M9XA 2K9MA 1ITYA 1ETYA 2EFPA 3E5QA 5DV5A 3BQYA 3EUAA 2FBIA 5M5XJ 1REPC 4M9SA 4KT6A 1T95A 2JA8J 1MIJA 3R6SA 1ZYRF 2F5FA 3IV5A 4IZZA 2CQ7A 3EUKL 3M4OJ 1QZYA 3HL2A 2Y75A 4Q47A 1A5JA 2EB7A 5L3GA 2EIKH 1WJEA 1WJDA 1XGOA 1KZHA 3TOAA 5K1YA 4Y52J 5M3MJ 1SFUA 3KPHA 5EGOB 1E0EA 1KYZA 2CU7A 2KDOA 2E1NA 3QYBA 4L9NA 3I4PA 1IN7A 2JTVA 1K7AA 2VI6A 5FFXA 4BXXJ 3I0TA 4YELA 5FKKA 3TW7A 3SZTA 5M5YJ 4IRIA 2F5CA 3QYFA 3FX3A 5HLIA 2MGQA 2OC6A 4EQQA 1WPKA 2JVHA 2BV6A 4ZH4F 5GTIC 3CC2I 4DZJA 2KIQA 3HOYJ 1FBUA 4DYRA 2OAZA 4J00A 1AOYA 4P9UA 4FT8A 2EK5A 2FNAA 2MABA 5H20A 5HS9A 1OISA 1R71A 3LSKA 4PDKA 2EFNA 1QU3A 4XKCA 1D1CA 1ZN2A 1MMDA 1X2NA 4KICA 1Z3XA 3PIOF 4ON0A 2UXNA 5KAFC 1MJBA 3OYNA 3BWGA 4KT5C 1PP8F 2VJIA 4X1EA 3FXJA 3F8CA 2LG4A 3W3CA 1IF1A 2VKDA 5FLXZ 4E7SA 2PQ8A 4N0BA 1VQ7I 5BS6A 3DU5A 3JAMZ 3H3UA 3U9GA 1TLHB 3CC7I 4HBLA 4EM1A 1GV5A 2E36A 2IP2A 3BDDA 3OS1A 2HOAA 2HWVA 4I76A 2XDVA 1ETWA 2QQ9A 1MDMA 3F6VA 1I6HJ 5K5OA 3F23A 5C4JJ 5TGTA 2FOWA 1X3WB 3K10A 1YO5C 3HOUJ 3PSIA 3L2QA 1IN6A 2IJLA 2QQAA 4KDPA 5LD2C 3EPZA 5J4VA 4C3JJ 4CH7A 1B8IA 3P9KA 3WHBA 2HDDA 1OYWA 5FO5A 4XK4A 4IHXA 2RVCA 3K69A 3MKLA 4S0HB 5KNLA 2XSJC 3CCLI 4M3BA 3BC8A 1SD4A 4YFNF 2LY9A 1ZKGA 3L2CA 3WGHA 3FHNA 3LSGA 2QKMB 1S8NA 3CJRB 5IT9K 4A3BJ 2O8XA 2WAQN 1FY7A 3QYEA 1TQPA 1FOYA 3S2WA 4A0XA 1XGMA 2R7WA 3HOWJ 3Q3SA 3LSRA 4BY7J 3VFZA 3AL0C 4ZDOA 1H9GA 2JA5J 2OF7A 3OSGA 4L5IA 4BL0B 2W57A 1S7EA 3FXOA 5CVJA 1S6LA 5LFAA 2KQRA 1OLTA 3HHHA 3KZZA 4DZPA 1EF4A 2RC4A 5TISC 3L7WA 2L7KA 3CCYA 1LNWA 1NH3A 1X58A 2CUJA 1TQIA 1SAXA 4PFPA 4PJJA 1K78A 2R5YA 2W1OA 1OMIA 5DD8A 2DOAA 1WJFA 2MFZA 2IT0A 3DEUA 2L7ZA 4OIQF 1HF0A 2Z16A 2HOSA 2M8GX 4M3DA 2P4WA 2QSGX 2XGCA 1LDDA 2P81A 4RGSA 1SD7A 4I0BA 1SAUA 4IQ4A 3BPVA 5J8CA 3ASOH 3I59A 1RR8C 2DFFA 5HODA 3QWLA 2A6EF 2R93J 3E3VA 4KITB 5D4SA 4HSTA 3OIQA 4G7OF 3MKYB 5BOXA 1XMAA 1IGNA 3GLLA 3ZP5A 3NAUA 2V1XA 1A35A 2V1UA 3GZ6A 3WODF 1LVKA 3K7AJ 3BQZA 5FLVA 4F52A 4RB2C 3J81Z 3RZDJ 3I59B 5GP9A 1FMWA 2KKOA 3CDIA 2MLKA 3MAJA 3TEDA 4BNCA 3TQNA 4IX7A 2DMPA 3HOVJ 3CCEI 2BZTA 3ECOA 2HDCA 4ZZDA 1UELB 2IW5A 3BPXA 1A36A 5ILVA 4E6KG 3QP6A 4WXCA 1YQAA 4LFUA 1U5TA 3LQQA 3KIOA 3QU6A 4JBAA 3RKWA 2MC3A 2BY3A 3HKZA 3L09A 4G6DA 3RPUA 3V8KA 5JHFA 2BBYA 1QBJA 4KFCA 1AKHA 1Z7UA 3GBGA 4G8XA 5H6QA 4XRSA 2R4GA 2HYGD 4CICA 4C2TA 4DNCA 1YX3A 4HSRA 3G71I 4G6TB 1W36C 4BQQA 1VQ4I 3W6KB 4RB0A 2BY0A 4AWXB 3JSPA 5AIQA 3RPQA 2HXIA 2YPRA 3S32A 1YI2I 2CG4A 1FLIA 1CQTA 2BGCA 4LLLA 2OCCH 1NK3P 2OZ6A 3WE2A 5C3EJ 5DCMB 1Q1VA 2M0CA 3JTGA 3ZN0A 1B9NA 1F43A 5F1RA 5KAIC 2DMQA 1JTYA 4ENMA 2DA4A 3JSOA 4LB6B 2VB6A 4HW0A 1V55H 4BE1A 1PVEA 2H1LA 4FX4A 3CLQA 5HS8A 3J80K 3LSPA 4RLFA 4BQNA 1IN8A 1JTXA 3DBRB 1SFEA 5DS9A 1ETOA 2CUFA 1EV7A 2P8TA 1LEAA 3ESWB 4R8HA 2RQQA 4QTRA 3SJMA 2IXSA 2X85A 2LP0A 2W84A 2EA2A 3C7JA 4UVCA 2FEZA 1E3PA 1RNLA 5CVIA 2DA1A 1XDUA 2QSHX 5FKMA 2MC4A 2F48A 2O8KA 4XR6A 1TNTA 2EH3A 3LSJA 4JQFA 2VBXA 2E7WA 1D1AA 1LDJA 3C2GA 2KRHA 3M3YJ 5IYDJ 3OYDA 2IA1A 3GO5A 3DWLE 5BPDA 2LKPA 5E8GA 3ABLH 1GVJA 1PUFA 4BAYA 5IP9J 2DFIA 2EFQA 4B48A 2HVQA 4DYCA 2UWMA 5IP6A 2BHYA 3MZ8A 2HGCA 4BKXA 3K1NA 3KLOA 1V54H 1OCZH 2IPQX 4F92B 2L4MA 2VKHA 4KA4A 1S5LC 5LGNA 1LKXA 3JRHA 4IRGA 1R1VA 3KEYA 2QSFX 2O3FA 1YS7A 4L18B 2Q0OA 3HOZJ 3EETA 3E0JB 2R7RA 3BT9A 2K02A 4DW6A 1P4XA 3IWFA 2WADA 2DQLA 1MMGA 2XAQA 4XLPF 1GVDA 2W4SA 3O3KA 5ILUA 3SEQA 2Y0SN 2HU9A 3DLAA 4PGGA 3U1KA 5J4YA 2DK8A 1MJAA 4A3IJ 2L5QA 2L9RA 5J6XA 1UHSA 5C4XJ 5GPCA 5CVRA 3RPUD 2IAIA 1F1ZA 3F8NA 4Z6YA 5E18F 2QA4I 2E19A 1IXSB 5CVUA 2I8DA 4EGYA 4RGRA 2CV2A 1WSUA 4KN4X 2DT5A 3LSIA 4L9TA 5HNHA 5CQGA 1VI0A 1ZLKA 2WAEA 3LA7A 3VYTB 4A0YA 4AYBN 2LD5A 2Y9ZA 3IC7A 1WCMJ 2ME6A 1VQ5I 2KRCA 1D1BA 1NG7A 3E6BA 3IRRA 3EUHC 3JRGA 2WB1A 5B66C 1FSEA 1WQ2A 3OOUA 1DP3A 1LFUP 1T33A 3CC4I 4W97A 2M34A 3MFKA 2L3DA 2VKVA 2K86A 3M9AA 2PJPA 1XCVA 2FE3A 5K7HA 2NNYA 1BJZA 4BDZA 2AO9A 2G9WA 3ERED 1H8AC 2JZYA 1IZ1A 2GOXB 1K83J 1OJLA 2UUZA 1N77A 2EFWA 3C2BA 2CYYA 1JUPA 1R1UA 1TT5B 2KJBA 2XGEA 4XKVA 4Y3OA 3GFLA 4GCVA 4RAZA 3WTXC 4V2FA 2EINH 5E1WA 3QQAA 4A3CJ 4M3FA 1IXCA 3HUGB 1UHMA 2HXOA 2NVTJ 1VQ9I 2GZWA 4GO1A 3E6DA 2BHZA 5BQTA 1LE8A 1I5ZA 5B3SH 2XF7A 3H35A 1W5SA 2EV0A 3VWBA 2DOEA 3HHGA 5LRRA 2OJED 4M3EA 2ACJA 5CKTA 3TGNA 4IJAA 1PDNC 5KHDA 3MEXA 4E7JA 2YR2A 2CWEA 3H1CA 2R7XA 4LG0B 3PUBA 2Y31A 4CXFA 4LMYA 1U6GA 3FXMA 4LOCA 5D8KB 3OWTA 4IHWA 2CQQA 4P96A 1WJ5A 2K3FA 2RNJA 3B02A 4A3DJ 1PUEE 1BC8C 2IS4A 5FKLA 1DGRM 3BJAA 4DBRA 4B44A 4CCMA 2OZUA 5EEGA 3U21A 1S7AA 3CLOA 3FISA 4I2OA 3P9IA 4XSXF 1LEBA 2MYSA 4RMNA 1JGSA 4YG2F 4Y7NJ 1IRXA 2X4HA 3RSNA 1F36A 2ZC2A 2Y0MA 5JVTA 4N9IA 2RV8A 4DYQA 3K4LA 5D5XB 3FK7A 3SFZA 2R7UA 2QQBA 2K4JA 1IRFA 3Q5FA 2OQRA 3K4MA 1N78A 2E7XA 2CUEA 1XGNA 3V4GA 2BXZA 3F9KA 2EZHA 4M71A 1T0FA 4UVBA 3WTVC 5F0CA 3K1PA 3VB2A 5ERIA 2Z3YA 4D5FA 4JK1X 1RKTA 1X1DA 2E2IJ 4BJTA 2YX4A 3BR0A 1D5VA 4HOBA 2ZXJA 3W2VA 3HSFA 3CTAA 4ESJA 3PSFA 3MQ0A 3O2PE 3NEUA 3I55I 1R6RA 3KP2A 4JP0A 3DTKA 1FP2A 2CUZA 2AHQA 5A2QZ 4BHCA 4ZDLA 4L0ZB 1JT0A 1B4AA 3HRMA 4AD9A 3ZCOA 3I53A 1WI3A 3HPGA 2EZIA 2E35A 3ZMUA 3OYMA 1GDTA 4WK8F 3GTJJ 3G73A 2DCEA 1XGSA 2YU3A 2STWA 5D6EA 3F8BA 2XAJA 2L7FP 3ABMH 4XONA 1BW5A 1TT0A 1BL0A 4LK0F 4EJUA 1U2WA 2KL4A 2K3PA 5HDNA 1W5TA 4QLCU 1FPQA 1P7IA 3JW4A 5DM6F 4B1RA 2ZXHA 2XSDC 1Y1VJ 2KISA 2ZJPF 1MNDA 5F04A 4HYEA 1ZELA 2D1VA 3L00A 2HPMA 1TC3C 4C30A 3RDIA 4A3GJ 3P5JA 1HLVA 5LBQA 5AIPA 5J40A 5HOOA 2STTA 3IKTA 1LB2A 1FOXA 1KU3A 2QUFA 1V3FA 2L4AA 1V4RA 2X51A 1WZ2A 1X3ZB 3ONQA 3PNTA 3DQVC 3OYCA 2QLZA 2ZXIA 3A0BC 4YIRX 3E6CC 3HOTA 4M73A 2R3SA 4JYKA 2LY2A 2XB5A 1Y1WJ 2OPTA 1MD0A 3KZYA 4Y4RA 2IA2A 3ULQB 1QZZA 2A6HF 3GYHX 1U9NA 3FXLA 2M5WA 1X2MA 4XKBA 1XX5A 4NQWA 3HOXJ 1HKQA 3OIOA 3U1DA 3AL0B 2DN0A 2JJ7A 4I6ZA 1YIOA 3DBHB 4II3A 3ZXSA 1RIOH 4I98B 3PQJA 3AKZA 4CCOA 2Z2SB 1U8RA 1DDNA 4ENKA 1O57A 3TDUC 3A2KA 3DXJF 2IVMA 4D9JA 3WE3A 2DA3A 3A03A 4MEXF 1FTTA 4OIPF 2WB1N 4U87A 2GM4A 2ZB9A 2OU2A 2KZGA 3CESA 5GAHJ 3I4MJ 2PI0A 1ZGJA 2W25A 2QZ8A 1YS6A 3ZMZA 1R5HA 2BVLA 3QODA 3K4KA 1T2KA 3H9GA 4BXUA 1X1CA 2WWYA 4NUBA 3KP5A 2YS9A 2EJRA 5CPRB 3ZPLA 3ELKA 4ENJA 4CYCB 1HDDC 4J19A 2XAFA 1SEUA 5ILSA 3C3WA 4HDVA 3CO7C 5EGOA 1LFBA 1JUMA 4XRSG 3QOEA 3FMRA 1JGGA 1GLNA 2OV7A 5L3BA 2X6YA 1TNSA 2CJJA 2M0MA 1JKRC 3S1NJ 3K2AA 3SEZA 5IOZA 4U0YA 3Q0VA 3BG5A 2NOGA 2QVOA 3OYIA 1R5ID 5K7FA 1NK2P 3MD2A 3HPHA 2CFOA 4P1WA 4HNTA 1YRNB 4XOTA 2NVXJ 3SYTA 1WJBA 3WGGA 1Y8RB 5IPAA 3FHZA 4NHJA 2IGNA 3KP6A 3K1MA 3ZQQA 2K9SA 3L1PA 3BROA 3V8JA 1ZAOA 2JWTA 3PUFA 1YJ9I 4D5CA 3B6CA 3TMOA 1G4DA 3L2UA 5JLWA 3ZMVA 4QPQA 2HKOA 1DPUA 5LGUA 2DA6A 4I99C 3GTQJ 5EZHA 2HI3A 2LKSA 4YFKF 2G7UA 1XSVA 2P5LC 3WU0A 2TDXA 2VL8A 3BR3A 1ZG1A 3AG3H 4GGGA 5HLHA 1VNDA 1IXRC 2MA3A 2XVCA 4AVPA 1QVUA 4ZYHA 3DKXA 5K5QA 2EZLA 3E1SA 4OAYA 4KIGA 3Q9VA 1BI3A 1TW2A 3G1LA 3HXLA 1DPRA 1FSHA 1YW7A 5GPAA 3OIPA 2VKEA 5FKOA 1GUUA 1MBGA 2LR8A 4I02A 4QPOA 1UJ8A 3E6MA 2HOTA 2Z1DA 2DPDA 2A6TA 2M7AA 3DPTA 1IUFA 3S3OA 4BDYA 1I1GA 3FZVA 3S2HJ 3OV8A 1W7PB 2LVSA 1OKRA 1VQLI 3RQ4A 4FE4A 3FXQA 4XIDA 3RI4A 3K0LA 4E70A 1XMKA 3ERMA 1IRZA 3NWSA 5J1YA 2RDPA 3BTIA 1ZK8A 2PEXA 3ZQGA 3S93A 3OL4A 4RS8A 4M74A 3H0DA 5DUIA 3DLLF 2XAUA 1UHWA 2XRNA 1ZRFA 2XF6A 1EA3A 3JTHA 3OMYA 4BGDA 5H2FC 2B0LA 2I10A 2FMYA 1SC7A 1F9NA 1T39A 3UR3C 1RZ4A 3MKZA 1IJWC 2DI3A 4I0AA 1QHGA 2BW3B 2GAUA 1XCBA 2LDUA 2XROA 4XQFA 3DPLC 3B73A 3ZMTA 2A5YB 3S1RJ 4EM2A 5F27A 2XHKA 1X4OA 1DQUA 5LHIA 5F6FA 2IA0A 1AA7A 4A6DA 4II2A 4IHYA 2DBBA 1U9OA 3RKYA 2ZJRF 3S8PA 5ED4A 4A5NA 1I6XA 1MH3A 4RB3C 4B47A 3CUOA 3G1OA 1HDPA 5FJ8J 5EZGA 2VUMJ 4BU2A 1W4MA 1FYLA 3QRFF 4UV8A 1W36D 1FEXA 2LY1A 4LITA 2KDZA 5LLQA 6PAXA 1IV6A 2IBDA 3JRFA 1UZCA 2NYXA 3EUHA 3BLYA 2GLOA 1Z91A 2R7VA 4BACA 2DW4A 2V1DA 5IT3A 1TWGJ 2DA5A 2O03A 2E2HJ 3E7LA 4R79A 2LKXA 4MLOA 3T5XA 1BI0A 2ISYA 3IHUA 3I71A 4AUXA 4XNFA 5FRMA 1MBFA 1HQCA 3H3ZA 4BJ5C 1Y0UA 1GXQA 2A5WA 2FBKA 4QWQA 1XB4A 2O5RA 1JJ6C 2CW0F 1BIBA 2XAHA 2R7OA 1HKTA 2QM3A 1B1BA 1LUJB 1I39A 4HRIA 2OQGA 1JKOC 1VQ6I 5EEHA 1BA5A 3QAHA 1YW8A 1W7PD 1YITI 3SZGA 3T1BA 3RKQA 2K4BA 4NNJA 5ICFA 1FT9A 2FNPA 1KONA 1R7JA 2CSOA 2EZKA 3REOA 1B59A 3ZMDA 3ZN1A 5DCMA 1QRYA 3OR2C 3HJEA 1N75A 5CYVA 2OTJI 4IRHA 1RKWA 1YG2A 2BOLA 2I5UA 4PUSA 2R92J 5FD5A 2KFDA 2DFHA 1TWFJ 2PMZA 1W1WE 4HLXA 2NOJB 1ZQ3P 4EJTA 3TKYA 3GX4X 2R7ZJ 2O0YA 1I27A 1SANA 1XD7A 3ZQCA 3ZR8X 2O6GE 1YFHA 4IHVA 4HX8A 3QPLA 3IRQA 4IHTA 3GXOA 1TW3A 1HKSA 3KEQA 5E20A 1X1AA 2PBIA 1HW5A 3GVAA 3N4MA 3WTUC 2QBYB 4U0VA 4LLNA 1YIJI 4X6AJ 3FXKA 5L3DA 4F3QA 4ENNA 3OYAA 2GQQA 4XLAA 2E1CA 2IRFG 2JQ7A 2GWRA 1ETKA 2ME0A 2VIXA 3LFKA 3U2RA 2BYVE 5EJCA 2CH0A 3JRIA 3T8RA 3ZQHA 2HZDA 2JVGA 3PQKA 3ZRGA 3WG7H 5IYCJ 3OYJA 2DMNA 1SFXA 4P5OA 3OYBA 5B1AH 3ECHA 1XTAA 1RUNA 2W24A 3NWTA 1SFKA 1HOMA 1Z21A 3IH4A 4ZZLA 4A3FJ 5L3FA 2M4GA 4UUSB 2GOMA 4IEJA 4E7HA 4S04A 3SHFA 2HTJA 2DPUA 5D8LB 2LRDA 4YIIA 3KETA 3CCUI 1D0ZA 1MZBA 2UV1A 2WY7Q 1HC8A 1ETQA 1FMVA 3RTRA 4AVZA 3F0CA 4CYDA 5FB2A 4JX6A 4CZZA 4LB5A 1FX7A 4LG3A 2YUSA 2JA7J 2OTLI 1MBHA 2PMUA 1RPWA 1JKPC 3GTGJ 3HB9A 1G3SA 2A69F 2DXIA 1G6NA 2V6EA 3T0YA 4A6EA 2RREA 2PN6A 4ZTFA 1ZLJA 4MEYF 1UB9A 1Z05A 1AWCA 2NS0A 2A61A 1QO0D 2QKLB 4EMSA 4FISA 3DFGA 3OS0A 2DA2A 4FQGA 3K4BA 1Z3YA 2BY1A 3CMEI 2KIFA 2A3SA 1Z6RA 5J47A 1DU0A 4UV9A 4XKWA 1OCTC 3BZCA 4XBFA 2M30A 5L3CA 2ADUA 1QA6A 1ACIA 2PLYA 3X2QH 1R5GA 2K85A 2DJNA 1MBKA 1K4SA 2RQPA 2XGDA 3JRBA 2WC2A 1YE9A 2NXNB 3SZPA 2ZCWA 4WX9A 1NG6A 3VSKA 4UB6C 1KU9A 2GIVA 3VOEA 4BXFA 1FOWA 4D7NA 2VE9A 1WFXA 2K40A 4QSHA 4OMYA 5DM7F 2K9QA 3V42A 1Y39A 1I3AA 3BZ6A 1D5YA 4KISA 3HRTA 3BR1A 2N8GA 4NC6A 2WA0A 3HSEA 4MFEA 4UHTA 4BBSJ 5IOYA 2VBYA 4UUTA 2D1HA 4Z2YA 2HR3A 2BXYA 3ROUA 4H0EA 5CVVA 4Q5SF 3J7AO 2IGOA 1B72B 4FE7A 4L9JA 1X3UA 1R58A 4XMYA 2O7OA 3EYYA 2HQ5A 3HUGA 5M5WJ 3OSFA 2VJJA 3A02A 3UKGA 3OR1C 2OA4A 3KE2A 2J5PA 2LF7A 2Z5UA 1T6SA 3SXYA 1WH7A 2QQ8A 2RNGA 1OCOH 4F91B 4Q48A 1BBYA 1MSEC 2MLGA 3ML6A 2VXZA 3COAC 5BPIA 2VT2A 2B63J 5EEAA 2DYSH 4B4CA 4G7ZF 2MSYA 2ZO4A 4HNVA 2AXTC 2HOEA 4PJMA 1U8BA 1HBXG 3KYLA 2XPUA 2L7MP 4LG0A 1D8JA 2O9LA 2GA2A 3CCQI 1S29A 1YJNI 2JRTA 3BCAA 1FZPB 3QP5A 4ZDPA 3AFHA 2G0EA 4RAGA 1JUSA 3LSTA 3MCZA 2V6CA 2V9PA 3F8FA 2DQRA 5KVRA 2FU4A 1C0WA 3KYCB 1XDSA 4PZJA 1BR2A 2HDWA 1KA8A 3PNVA 9ANTA 2MG4A 5C44J 3LFUA 4J01A 4EEFG 2K9NA 3HKZN 5GAGJ 4B3AA 5EG0A 3GTMJ 2GXGA 4OU0A 1IN4A 4M6YA 2L9SA 3L9FA 3ABUA 3I64A 1HSJA 3P7NA 1ULYA 3W2AA 3RCOA 1T8IA 2LF8A 2JA6J 1N25A 2VPRA 2PMHA 2H6CA 3GF2A 4L0YB 1KU7A 4F7ZA 1U5TC 1FIPA 5BMZA 4HQEA 3DV8A 2EILH 3K6GA 1FBQA 2Q1ZB 2X9DA 5J1RA 1LPQA 2O61A 4PJ0C 3HDDA 2MD5A 3HIFA 2Y30A 4ZTJA 1AHDP 2V79A 5EG0B 3S1MJ 2JT1A 1FJLA 1A04A 2RKHA 1LJ9A 1I1SA 4CZCA 3K4CA 1WJAA 1KU2A 4PK4A 1BN5A 1I3QJ 4Y17A 5HS7A 4F93B 1U78A 2M9HA 5ICEA 1BJAA 5F0HA 3OYKA 3NARA 3MKWB 3M8EA 4BBRJ 3I54A 4AIKA 3K70C 5DUKA 1VQ8I 4ZC3A 2R5ZB 3CJTB 2L2OA 4EVIA 3HTSB 3AG4H 1M1EB 1FIAA 5D4RA 3BJ6A 3MZYA 3FKJA 4NBQA 4IL6C 1TZLA 5IY5H 3HOSA 4KMFA 1JI8A 1ERDA 2E34A 3A0HC 4LK1F 4XRMA 2NVUB 5EDNA 5FLXK 2H1KA 1RR7A 3OY9A 1VTNC 3M7GA 1A6IA 2H94A 2V9KA 3P9CA 3JAMK 3S14J 3I4NJ 2JA2A 2LLKA 1K6OA 3NQOA 4MIMA 2ZFUA 1R49A 3O8GA 2V7FA 2Y9YA 4R1HA 4PCQA 3LNQA 4ANJA 3OYLA 4I09A 3TDZC 2VE8A 4CCJA 5GAEJ 1IDZA 5IP7J 4DIQA 3BJOA 3HYIA 2B7EA 3Q0WA 3R61A 3HGYA 2XUBA 1EKEA 3VDXA 3Q9SA 2ID3A 1NTCA 1FWZA 3MZHA 1S9HA 2ELKA 2HFHA 4BY1J 1HA8A 3RJPA 5DEQA 4P9FA 3H5NA 1PYVA 4EJWA 2TRTA 1A31A 2LC2A 1FNNA 3BTCA 5GADJ 3A01B 2QENA 1Z77A 1ZH5A 2MW8A 5E17F 4GFBA 4HX7A 3OYGA 4L9VA 4MTEA 2CV0A 2FF4A 1IN5A 4XN3A 4UVAA 3A4CA 3H0GJ 4GRIA 1T38A 1OCCH 4XN0A 1IRGA 3FM3A 3FM5A 1FYMA 1FTZA 3R0JA 3WU1B 2WAQA 3DTEA 5JHUA 2MH2A 3GMEA 4AC0A 2V1NA 2CMPA 1RUOA 1JE8A 4UNOA 2FMLA 1GV2A 4E4HA 3PM1A 1V5GA 4D1QA 2BY2A 3GWZA 2GXAA 1MMSA 2XPWA 1ZREA 1LVAA 5KK1A 4IHSA 3LA2A 1YOVB 3FIWA 1GXPA 4NC7A 2QWWA 1W0TA 5E8IA 4M6VA 3H36A 2LYCA 2R7DA 4RM3A 1MW7A 3K2ZA 5F1JA 3FMSA 4G6QA 1T56A 3KP4A 3L2RA 2RAEA 3HBLA 1XG1A 5D5WB 4ZJZA 4V19K 2VASA 5DDGA 3D5RC 5EYRA 1LFPA 3H3VK 4D7MA 3BG3A 4CDGA 2XPVA 3IH3A 4CYCA 3GCMA 3DEWA 3CP8A 3M8JA 2XIGA 4KJZA 5F64A 1MBEA 1OFCX 3DCFA 4JOMA 4OAZA 3FBNB 4HAMA 1K61A 3N05A 2IGMA 2X1CA 2E1OA 1R4MB 3I3LA 4W1UA 3S15J 1OCPA 1ZRCA 4HF1A 2XC7A 2H6BA 2ISZA 1BM9A 2HTSA 5FROA 3OOPA 3R60A 2CQKA 1FOKA 3Q0UA 4E7ZA 1S3JA 3DPUA 3J81K 2LFBA 5EF6A 1YRNA 5DD4A 2Z9OA 4PGHA 2EBIA 3CCSI 2V26A 2W48A 5E79C 3QPSA 2BVMA 1KYWA 2E5ZA 1X1BA 2PX9A 3GFMA 2LBFA 1RRJA 5J3LA 3SDGA 2P7CB 2F4IA 3H5AA 4CCKA 2VC1A 3DP7A 4LLGF 4S05A 4BQAA 3ZQIA 2Z33A 2NNNA 1IC8A 3GLXA 2HQRA 2F5VA 1Y6IA 3V7SA 2K5CA 4A3LJ 1HW1A 4IKFA 1CF7B 3LMMA 4ZYEA 2HKXA 2DK5A 3F6OA 2OD5A 3LA3A 3C1DA 4N9HA 3WHCA 3V7RA 4AIJA 2ESNA 2A07F 2NVQJ 2JSPA 2XV4S 3E5XA 2FOKA 4PJLA 4EGZA 1IV8A 2F5EA 3J7YJ 1E2XA 2M1BA 2LBFB 3ZQ7A 4BEHB 4ZYGA 2VN2A 5IYBJ 3ZGKA 2ZNZA 3WTSC 1LDKB 4BQOA 1IW7F 2ID6A 2MD0A 2F4MB 5LGTA 3OYHA 3N97A 3QPTA 1G3TA 2X6XA 1X19A 1R22A 3AG1H 2KIMA 2L9NA 5FGMA 1E3OC 5FD6A 4A0ZA 3WTWC 2KJCA 3H92A 1P4AA 2IS6A 2L01A 5D5VB 1KQ0A 3FWEA 1GT0C 1SD5A 4P55A 2E1MC 2VQLA 4I01A 2VONA 3BZKA 1VQMI 2K9LA 4OOIA 1W7PA 4PJNA 4XL9A 1NHAA 1DGWY 2JUGA 3I9V2 4M72A 3BTJA 3TO6A 1UG0A 1JKQC 3FF5A 3ZMSA 2EIMH 2C6YA 3DEEA 4XLCA 5FLMJ 5E1XA 2F2EA 1O3SA 2EIJH 2DU9A 1R00A 2ZBKA 2LK2A 1T0FC 4RGXA 1ZG5A 2Y2ZA 1TBXA 2FQ3A 3I58A 3OL3A 1IUYA 1SD6A 2LOOA 3LOCA 3OYFA 4EJOA 3PJRA 1QPIA 3TW6A 2HQAA 2DT7B 1H9TA 3RZOJ 2DTZA 5E3NA 2ZKZA 3PO2J 2KT0A 5CJ9A 3KEOA 4MGRA 4B09A 4B43A 3UNGC 3DU6A 1QZEA 2EQRA 1J09A 1MNEA 2P5KA 1WH5A 2BW3A 2Q8KA 2CW8A 4C2UA 4XLFA 4BYYA 3I5UA 3PIPF 5TRDA 4BE0A 3CCMI 2EFOA 2ZSIB 2E71A 2HZTA 3MWMA 2JPBA 1XC5A 4AIHA 4X0GA 3D5SC 4AU7A 3GTKJ 3OYEA 4RAYA 1Z9CA 3CF2A 4L5EA 2FXAA 1ZHFA 4BUPA 4PSXA 3CUQC 1DU6A 5E1ZB 1JXSA 3FDYA 4UB8C 4DGWB 4LD5A 3S3MA 3S17J 1MDMB 2HVRA 3EYIA 3G4SI 1TWAJ 3CJQB 3CJNA 1IO2A 3D5LA 3BP8A 2B9SA 2HYJA 4G9YA 2UXXA 5HDKA 1EH6A 1D0YA 3GUDA 2ESHA 4N4OB 2Y0SA 1TP4A 2D2WA 2R7QA 1B8IB 3RYPA 1SMYF 2BEOA 4FETA 1H0MA 4XLHA 5KCMA 2WV1A 2CV1A 1QVTA 4WF2A 5B5EC 4IF4A 3AG2H 1SMTA 3MMYB 3HEFA 3R4KA 4FHTA 2VLAA 2XASA 3LSHA 4E7KA 3CMAI 3C18A 3TOBA 4AYBA 1TWHJ 1YW9A 5D5UB 4FASD 2ZMEC 1JHHA 3IKVA 3VYRB 1P6RA 1OR7C 4HV5A 3M1EA 3HG9A 2AS5F 2ZXWH 1VZ0A 5DYMA 1T08B 2QYOA 5L3EA 3IP4B 3IUOA 3QPHA 3GTOJ 3O8HA 2VOPA 2DMUA 2ICWG 2W82A 3CCRI 2HNHA 2R5YB 1K78B 1XSXA 4RA2A 1ETVA 4JX4A 3IL2A 4CHUA 2CFXA 4JX5A 1D3YA 3LWFA 3BY6A 2H8RA 1MKMA 1SVOA 2DDBA 3M07A 1H89C 3D0SA 2M4KA 2QBYA 3BR5A 4KYWA 3NRVA 5B1BH 3WTTC 1WWXA 2ZSHB 3PNYA 2DAOA 4RGUA 3T8TA 5E3LA 4HPQA 4CUGA 2QGUA 3HZJA 1RESA 4GDFA 2FA5A 3QOPA 4LJZF 2WAFA 1R4NB 3FK6A 2HPIA 2FUG2 4BE2A 3V7CA 3CCVI 3WTYC 1WI9A 3LQRA 2L54A 4RM2A 1CGPA 4MFDA 1O3QA 5BNGA 3JREA 2L02A 2CW7A 2XB0X 4E7IA 1USSA 2PJRA 1L0OC 1DP7P 1P9QC 1P92A 1XS9A 1R23A 4GXOA 4E7LA 1O3TA 5D6FA 1L3LA 3ABKH 1O7LA 1SVLA 2XKOA 2HEOA 2GIZA 4V2GA 3OS2A 2FX0A 1GHCA 4U7BA 3HGGA 4UUSA 4KN7X 4A3MJ 1Z6TA 3HSRA 1QQIA 3K4NA 4TV7A 1KQ8A 2F5DA 3W6JB 2P7VB 2ZJ2A 1ZGWA 4A3EJ 2DYRH 1MBJA 3ABTA 2LMDA 3BG6A 4BH9A 2M3AA 2OUMA 1U5TB 3GTPJ 4FX0A 3KYDB 2PJRB 4KMUX 4BJ6C 4IQJA 3HRUA 3KFWX 1Z7LA 3TL4X 1AKHB 2JSCA 2KRFA 2P0WA 3KX2A 4CO8A 2ECBA 5JI6A 5JVGF 5FRNA 4IOAF 2IS1A 2K27A 2X6OA 3FKIJ 4NB5A 2E2JJ 1ZGAA 3VYUB 1VQOI 2L9VA 3JRDA 2FBHA 2NS7A 1K4TA 3LL7A 2DJIA 2DLLA 3B6AA 4KIBA 1VQNI 4A3JJ 1PJRA 2COBA 1MH4A 5FFZA 3DTIA 4B3XA 5F0FA 5LEJA 2QF7A 4DOZA 2VC0A 3D1NI 2VODA 4YIFA 1JT6A 5A2QK 2R7SA 2XF5A 3GZNB 1OYIA 3PL8A 3L2WA 3GTLJ 2WTEA 4H4KC 5J1UA 5HVQC 5HLTA 4A5MA 1J9IA 1BR1A 1WVRA 4CCLA 4PFOA 1MMNA 3ISPA 4HZFA 2EWNA 1FP1D 1MMAA 1R36A 4ESFA 2CGPA 3JR9A 2E60A 2M87A 3V8LA 2WBMA 2XRLA 1VFCA 3I56I 1G2HA 4OIOF 4I7HA 1YLFA 2KIUA 1WGXA 3WTZA 4ETSA 4IVNA 3GW2A 3H9JA 3KLNA 2CS3A 1ZR4A 3EDPA 2X48A 3BTLA 2KMUA 3TO7A 2WV0A 3CZ6A 4UXNA 2D5VA 2KP6A 1UMQA 4MO7A 1IDYA 4RB1A 1WHUA 1R1TA 2X1EA 3VEPA 2FSWA 1B72A 3BCBA 4HF2A 1TWCJ 5F08A 5TJJA 1JHFA 3FXUA 3MVPA 1OQYA 2VQCA 4OWRB 2CQNA 4ASNA 4CGZA 4GYIA 1FC3A 5IT9Z 1G3YA 2P6SA 1MGTA 3BR6A 3M1CA 2H27A 3HRSA 3F8MA 1OYYA 3GZ5A 2WY8Q 2NAZA 3SDBA 1PUFB 3O6BB 1I50J 1QGPA 4RBOA 1ODDA 1G3WA 3J7ZI 3HC7A 1XSDA 2XAGA 2F4OB 2F6CA 3G3ZA 5HNFA 2D45A 4Y33A 3BR2A 2V9VA 1YHQI 1QHHD 3GFIA 3ZQFA 2GBYA 5E3OA 1ZTRA 4CA0A 3M8FA 2DO7A 2ZFWA 4D0PA 3CMMA 1TQMA 3ZQLA 3E5UA 2ELJA 4A69C 1B6AA 1O3RA 3RIRA 5LEKA 2Y48A 1WJCA 2UZKA 2M7BA 2JRMA 5M3FJ 4IOCF 1UAAA 2VJ5A 1X1PA 5LHGA 3J7AY 4G7HF 3S1QJ 4O3MA 3DKYA 4XICA 1S7OA 4HEA2 2LNBA 3CP2A 1AU7A 4O6JA 5CQEA 2QEXI 1HW2A 3LAJA 4XORA 4HX4A 1D8KA 2P5VA 3LSMA 1Z0XA 5ICCA 1A6QA 3IH2A 3K70D 1S72I 3JCUC 1POGA 3DBLB 1T98A 1UG2A 2ELHA 2RN7A 4OMZA 5K5RA 2L0KA 1RI7A 3GEZA 2FQ4A 2VQGA 2DOFA 3G2BA 4A93J 4EM0B 2P6TA 2ZNYA 3G1MA 2R0QC 1IG7A 3HTUA 4MHGA 2KPMA 3BOQA 4HG2A 1IAWA 1Q1HA 4ZYAA 2PMZN 3W2WA 2MBFA 1R9TJ 4K2EA 4O5VA 2K7LA 3GFJA 2EA4A 2VBWA 1F5TA 5AONA 2X6WA 1ETXA 5DCFA 2YU9J 3WGIA 1G59A 2R7FA 4HF0A 3CDLA 3AAFA 4NDLA 4KUMA 1SVMA 3CCJI 4ABZA 1E3HA 1J5YA 2R5ZA 4ITVA 4M3GA 2VBZA 3KZIC 4XRFA 3RKXA 3BG7A 1HSTA 2DT6A 2OBPA 5HDGA 2CQXA 3RQIA 1ZRDA 1Y0NA 2QCOA 4RAFA 5CLSA 1E17A 5K7ZA 1LE8B 5JLXA 1KGSA 2W85A 1U0JA 1YX5A 3SQNA 3FMQA 4C2MJ 4LGWA 4Q4ZF 1J59A 4HV6A 4EV0A 1ON1A 1Z1DA 2FJ1A 1Y56A 3FXRA 1RC9A 4GYGA 1O4XA 4YRVA 4FCYA 4C9YA 4HQMA 4MNUA 4ESBA 4RDUA 4HNUA 2ECCA 1ZG3A 1YTYA 4MQ9F 1J75A 3LAPA 2YX7A 3CF5F 4QIWN 3F22A 4HA8A 4DQ2A 2VQHA
chains in the Genus database with same CATH topology
1YHQI 1VQ7I 3CCQI 3CCEI 3CC7I 1YJNI 2K3FA 2E36A 3CCUI 1HC8A 3G4SI 3G6EI 3J7YJ 5GADJ 4IOCF 2FOWA 2OTLI 5JVGF 4IOAF 5GAGJ 1YJWI 1VQOI 1VQPI 3G71I 1VQ4I 3CCLI 2QEXI 1VQ6I 1VQNI 1YI2I 5GAHJ 1YITI 3CMEI 3CMAI 2QA4I 3CD6I 1MMSA 1S72I 1VQMI 4IO9F 1FOYA 1VQLI 1QA6A 1ACIA 4UY8I 2OTJI 1VQ5I 2NXNB 3I55I 4V19K 3CC4I 3CCRI 1FOWA 3I56I 2ZJQF 5DM7F 1Y39A 3DLLF 2E35A 1VQ8I 3CCJI 3CJTB 1YIJI 2JQ7A 3CC2I 1VQ9I 2E34A 5DM6F 2H8WA 3CCSI 3PIPF 1VQKI 3CCVI 2ZJPF 3CCMI 2ZJRF 3PIOF 5GAEJ 1FOXA 3J7ZI 1YJ9I 3CF5F
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1YHQ I;  1VQ7 I;  3CCQ I;  3CCE I;  3CC7 I;  1YJN I;  2K3F A;  2E36 A;  3CCU I;  1HC8 A;  3G4S I;  3G6E I;  3J7Y J;  5GAD J;  4IOC F;  2FOW A;  2OTL I;  5JVG F;  4IOA F;  5GAG J;  1YJW I;  1VQO I;  1VQP I;  3G71 I;  1VQ4 I;  3CCL I;  2QEX I;  1VQ6 I;  1VQN I;  1YI2 I;  5GAH J;  1YIT I;  3CME I;  3CMA I;  2QA4 I;  3CD6 I;  1MMS A;  1S72 I;  1VQM I;  4IO9 F;  1FOY A;  1VQL I;  1QA6 A;  1ACI A;  4UY8 I;  2OTJ I;  1VQ5 I;  2NXN B;  3I55 I;  4V19 K;  3CC4 I;  3CCR I;  1FOW A;  3I56 I;  2ZJQ F;  5DM7 F;  1Y39 A;  3DLL F;  2E35 A;  1VQ8 I;  3CCJ I;  3CJT B;  1YIJ I;  2JQ7 A;  3CC2 I;  1VQ9 I;  2E34 A;  5DM6 F;  2H8W A;  3CCS I;  3PIP F;  1VQK I;  3CCV I;  2ZJP F;  3CCM I;  2ZJR F;  3PIO F;  5GAE J;  1FOX A;  3J7Z I;  1YJ9 I;  3CF5 F; 
#chains in the Genus database with same CATH topology
 3CO6 C;  4ZYD A;  1ZR2 A;  1J7K A;  2W7N A;  3J80 Z;  5DTD A;  3K9T A;  3F21 A;  1TTY A;  2DFE A;  1BR4 A;  2VXD A;  2OCE A;  1MSF C;  2XKP A;  3TP0 A;  4KIF A;  1DUX C;  2AQE A;  2HS5 A;  1ORK A;  2E1M B;  2PFB A;  1ONV A;  2H09 A;  2XGX A;  3VPR A;  3PO3 J;  1O7F A;  3A1Y A;  3A01 A;  1G8X A;  4PSW A;  5HLG A;  2EV5 A;  2BE5 F;  2JUC A;  1W0U A;  2LSO A;  2NRA C;  3H9Q A;  1KQ9 A;  1Y8Q B;  2EPF A;  3DKW A;  4LIU A;  2YSR A;  2X0L A;  3SFI A;  3KP7 A;  1APL C;  2M2E A;  5JFR A;  1WKM A;  3VOD A;  4HLY A;  3ASN H;  4WCG A;  1V5E A;  2JN6 A;  1XMX A;  2Y69 H;  2JMW A;  2FD5 A;  5FKN A;  2DDA A;  3R0A A;  2CO5 A;  2COM A;  3HM5 A;  1BI2 A;  1UCR A;  4AM3 A;  1K6Y A;  2X1D A;  4BHP A;  2DOD A;  1TL8 A;  3E97 A;  4IO9 F;  1J2X A;  1LQ1 A;  1BI1 A;  1ON2 A;  3F72 A;  1PP7 U;  1U3E M;  4EJV A;  4DJA A;  1UFM A;  4NC8 A;  4UUV A;  4M6X A;  4UY8 I;  1YYV A;  3FBI B;  4IPA A;  1V5F A;  2HYF A;  2Q2E A;  4LIV A;  4AID A;  3WG9 A;  2LH9 A;  2FRH A;  2NS8 A;  1F4K A;  1MNM C;  2PG4 A;  3CUQ A;  4FTH A;  2ETH A;  3F3X A;  1EJ9 A;  1WRJ A;  4RLQ A;  5H6R A;  2HQN A;  2EV6 A;  1B9M A;  2ZJQ F;  3W6V A;  4MTD A;  4M9Z A;  2A05 A;  1BOB A;  4WXD A;  5E3M A;  3H5R A;  3DF8 A;  1RET A;  1BW6 A;  2LTP A;  3IAS 2;  2IS2 A;  1W5C C;  4BHB A;  4HDU A;  2HVS A;  2Q2E B;  4N4N B;  2VPL A;  1P2F A;  1OCR H;  3TO9 A;  2TCT A;  3KCC A;  2IEK A;  3CQZ J;  3CUQ B;  4EAT A;  2G7H A;  5GTH C;  4MQV A;  2DTR A;  3TP3 A;  4Y15 A;  2M45 A;  1MJ9 A;  1ZAR A;  2R7T A;  4XLE A;  3JRC A;  2H8W A;  1D0X A;  4XLN F;  1VQK I;  3K4J A;  4OIN F;  5LRS A;  2A68 F;  3VSL A;  2VJ4 A;  4G94 A;  2KZV A;  3QU3 A;  1BIA A;  2ZME A;  2JPC A;  4G12 A;  2IGK A;  2LRE A;  1HXD A;  1X4P A;  4YFX F;  1XN7 A;  1OR7 A;  4F55 A;  4U7D A;  2GXB A;  1FBS A;  3C2H A;  3MN2 A;  4XM3 A;  4WWC A;  1ENH A;  1EH7 A;  1K79 A;  5ICG A;  2Z99 A;  4L5J A;  1J0R A;  3L2V A;  1CF7 A;  1STZ A;  3VYS B;  1QPM A;  1OPC A;  2V4J C;  2W00 A;  3IWZ A;  5JR3 A;  4U88 A;  4DBQ A;  4YEJ A;  1SFO J;  2CRG A;  4Y13 A;  3G6E I;  4BS9 A;  3S2D J;  4NQW B;  2KHM A;  1JJ8 C;  4KNY A;  1HCR A;  2VT3 A;  2DA7 A;  4C3I J;  2M8E A;  5J8F A;  1H88 C;  2GA1 A;  2ZME B;  4BEH A;  3JRA A;  1VF9 A;  2MH9 A;  1Z67 A;  2NVY J;  1FYK A;  1P4W A;  4XOP A;  2VOO A;  3CMY A;  3CDH A;  3PFI A;  2E5N A;  4OIR F;  1YJW I;  3KP3 A;  4B8X A;  2AXL A;  1VQP I;  2AQF A;  3IAM 2;  1QNT A;  3S3N A;  3TBI A;  3RYR A;  1BC7 C;  4U0W A;  4A3K J;  2RGV A;  3S16 J;  3EQL F;  1BOA A;  4WXH A;  4XSZ F;  3WU2 C;  4CCN A;  1XPX A;  4CSW A;  4A12 A;  1P7J A;  4IXA A;  2DMT A;  1EH8 A;  4A2U A;  2J5O A;  5LHH A;  3BG9 A;  1UST A;  3CD6 I;  2JK3 A;  3ZOB A;  4C3H J;  3PFY A;  2KLO A;  4M9X A;  2K9M A;  1ITY A;  1ETY A;  2EFP A;  3E5Q A;  5DV5 A;  3BQY A;  3EUA A;  2FBI A;  5M5X J;  1REP C;  4M9S A;  4KT6 A;  1T95 A;  2JA8 J;  1MIJ A;  3R6S A;  1ZYR F;  2F5F A;  3IV5 A;  4IZZ A;  2CQ7 A;  3EUK L;  3M4O J;  1QZY A;  3HL2 A;  2Y75 A;  4Q47 A;  1A5J A;  2EB7 A;  5L3G A;  2EIK H;  1WJE A;  1WJD A;  1XGO A;  1KZH A;  3TOA A;  5K1Y A;  4Y52 J;  5M3M J;  1SFU A;  3KPH A;  5EGO B;  1E0E A;  1KYZ A;  2CU7 A;  2KDO A;  2E1N A;  3QYB A;  4L9N A;  3I4P A;  1IN7 A;  2JTV A;  1K7A A;  2VI6 A;  5FFX A;  4BXX J;  3I0T A;  4YEL A;  5FKK A;  3TW7 A;  3SZT A;  5M5Y J;  4IRI A;  2F5C A;  3QYF A;  3FX3 A;  5HLI A;  2MGQ A;  2OC6 A;  4EQQ A;  1WPK A;  2JVH A;  2BV6 A;  4ZH4 F;  5GTI C;  3CC2 I;  4DZJ A;  2KIQ A;  3HOY J;  1FBU A;  4DYR A;  2OAZ A;  4J00 A;  1AOY A;  4P9U A;  4FT8 A;  2EK5 A;  2FNA A;  2MAB A;  5H20 A;  5HS9 A;  1OIS A;  1R71 A;  3LSK A;  4PDK A;  2EFN A;  1QU3 A;  4XKC A;  1D1C A;  1ZN2 A;  1MMD A;  1X2N A;  4KIC A;  1Z3X A;  3PIO F;  4ON0 A;  2UXN A;  5KAF C;  1MJB A;  3OYN A;  3BWG A;  4KT5 C;  1PP8 F;  2VJI A;  4X1E A;  3FXJ A;  3F8C A;  2LG4 A;  3W3C A;  1IF1 A;  2VKD A;  5FLX Z;  4E7S A;  2PQ8 A;  4N0B A;  1VQ7 I;  5BS6 A;  3DU5 A;  3JAM Z;  3H3U A;  3U9G A;  1TLH B;  3CC7 I;  4HBL A;  4EM1 A;  1GV5 A;  2E36 A;  2IP2 A;  3BDD A;  3OS1 A;  2HOA A;  2HWV A;  4I76 A;  2XDV A;  1ETW A;  2QQ9 A;  1MDM A;  3F6V A;  1I6H J;  5K5O A;  3F23 A;  5C4J J;  5TGT A;  2FOW A;  1X3W B;  3K10 A;  1YO5 C;  3HOU J;  3PSI A;  3L2Q A;  1IN6 A;  2IJL A;  2QQA A;  4KDP A;  5LD2 C;  3EPZ A;  5J4V A;  4C3J J;  4CH7 A;  1B8I A;  3P9K A;  3WHB A;  2HDD A;  1OYW A;  5FO5 A;  4XK4 A;  4IHX A;  2RVC A;  3K69 A;  3MKL A;  4S0H B;  5KNL A;  2XSJ C;  3CCL I;  4M3B A;  3BC8 A;  1SD4 A;  4YFN F;  2LY9 A;  1ZKG A;  3L2C A;  3WGH A;  3FHN A;  3LSG A;  2QKM B;  1S8N A;  3CJR B;  5IT9 K;  4A3B J;  2O8X A;  2WAQ N;  1FY7 A;  3QYE A;  1TQP A;  1FOY A;  3S2W A;  4A0X A;  1XGM A;  2R7W A;  3HOW J;  3Q3S A;  3LSR A;  4BY7 J;  3VFZ A;  3AL0 C;  4ZDO A;  1H9G A;  2JA5 J;  2OF7 A;  3OSG A;  4L5I A;  4BL0 B;  2W57 A;  1S7E A;  3FXO A;  5CVJ A;  1S6L A;  5LFA A;  2KQR A;  1OLT A;  3HHH A;  3KZZ A;  4DZP A;  1EF4 A;  2RC4 A;  5TIS C;  3L7W A;  2L7K A;  3CCY A;  1LNW A;  1NH3 A;  1X58 A;  2CUJ A;  1TQI A;  1SAX A;  4PFP A;  4PJJ A;  1K78 A;  2R5Y A;  2W1O A;  1OMI A;  5DD8 A;  2DOA A;  1WJF A;  2MFZ A;  2IT0 A;  3DEU A;  2L7Z A;  4OIQ F;  1HF0 A;  2Z16 A;  2HOS A;  2M8G X;  4M3D A;  2P4W A;  2QSG X;  2XGC A;  1LDD A;  2P81 A;  4RGS A;  1SD7 A;  4I0B A;  1SAU A;  4IQ4 A;  3BPV A;  5J8C A;  3ASO H;  3I59 A;  1RR8 C;  2DFF A;  5HOD A;  3QWL A;  2A6E F;  2R93 J;  3E3V A;  4KIT B;  5D4S A;  4HST A;  3OIQ A;  4G7O F;  3MKY B;  5BOX A;  1XMA A;  1IGN A;  3GLL A;  3ZP5 A;  3NAU A;  2V1X A;  1A35 A;  2V1U A;  3GZ6 A;  3WOD F;  1LVK A;  3K7A J;  3BQZ A;  5FLV A;  4F52 A;  4RB2 C;  3J81 Z;  3RZD J;  3I59 B;  5GP9 A;  1FMW A;  2KKO A;  3CDI A;  2MLK A;  3MAJ A;  3TED A;  4BNC A;  3TQN A;  4IX7 A;  2DMP A;  3HOV J;  3CCE I;  2BZT A;  3ECO A;  2HDC A;  4ZZD A;  1UEL B;  2IW5 A;  3BPX A;  1A36 A;  5ILV A;  4E6K G;  3QP6 A;  4WXC A;  1YQA A;  4LFU A;  1U5T A;  3LQQ A;  3KIO A;  3QU6 A;  4JBA A;  3RKW A;  2MC3 A;  2BY3 A;  3HKZ A;  3L09 A;  4G6D A;  3RPU A;  3V8K A;  5JHF A;  2BBY A;  1QBJ A;  4KFC A;  1AKH A;  1Z7U A;  3GBG A;  4G8X A;  5H6Q A;  4XRS A;  2R4G A;  2HYG D;  4CIC A;  4C2T A;  4DNC A;  1YX3 A;  4HSR A;  3G71 I;  4G6T B;  1W36 C;  4BQQ A;  1VQ4 I;  3W6K B;  4RB0 A;  2BY0 A;  4AWX B;  3JSP A;  5AIQ A;  3RPQ A;  2HXI A;  2YPR A;  3S32 A;  1YI2 I;  2CG4 A;  1FLI A;  1CQT A;  2BGC A;  4LLL A;  2OCC H;  1NK3 P;  2OZ6 A;  3WE2 A;  5C3E J;  5DCM B;  1Q1V A;  2M0C A;  3JTG A;  3ZN0 A;  1B9N A;  1F43 A;  5F1R A;  5KAI C;  2DMQ A;  1JTY A;  4ENM A;  2DA4 A;  3JSO A;  4LB6 B;  2VB6 A;  4HW0 A;  1V55 H;  4BE1 A;  1PVE A;  2H1L A;  4FX4 A;  3CLQ A;  5HS8 A;  3J80 K;  3LSP A;  4RLF A;  4BQN A;  1IN8 A;  1JTX A;  3DBR B;  1SFE A;  5DS9 A;  1ETO A;  2CUF A;  1EV7 A;  2P8T A;  1LEA A;  3ESW B;  4R8H A;  2RQQ A;  4QTR A;  3SJM A;  2IXS A;  2X85 A;  2LP0 A;  2W84 A;  2EA2 A;  3C7J A;  4UVC A;  2FEZ A;  1E3P A;  1RNL A;  5CVI A;  2DA1 A;  1XDU A;  2QSH X;  5FKM A;  2MC4 A;  2F48 A;  2O8K A;  4XR6 A;  1TNT A;  2EH3 A;  3LSJ A;  4JQF A;  2VBX A;  2E7W A;  1D1A A;  1LDJ A;  3C2G A;  2KRH A;  3M3Y J;  5IYD J;  3OYD A;  2IA1 A;  3GO5 A;  3DWL E;  5BPD A;  2LKP A;  5E8G A;  3ABL H;  1GVJ A;  1PUF A;  4BAY A;  5IP9 J;  2DFI A;  2EFQ A;  4B48 A;  2HVQ A;  4DYC A;  2UWM A;  5IP6 A;  2BHY A;  3MZ8 A;  2HGC A;  4BKX A;  3K1N A;  3KLO A;  1V54 H;  1OCZ H;  2IPQ X;  4F92 B;  2L4M A;  2VKH A;  4KA4 A;  1S5L C;  5LGN A;  1LKX A;  3JRH A;  4IRG A;  1R1V A;  3KEY A;  2QSF X;  2O3F A;  1YS7 A;  4L18 B;  2Q0O A;  3HOZ J;  3EET A;  3E0J B;  2R7R A;  3BT9 A;  2K02 A;  4DW6 A;  1P4X A;  3IWF A;  2WAD A;  2DQL A;  1MMG A;  2XAQ A;  4XLP F;  1GVD A;  2W4S A;  3O3K A;  5ILU A;  3SEQ A;  2Y0S N;  2HU9 A;  3DLA A;  4PGG A;  3U1K A;  5J4Y A;  2DK8 A;  1MJA A;  4A3I J;  2L5Q A;  2L9R A;  5J6X A;  1UHS A;  5C4X J;  5GPC A;  5CVR A;  3RPU D;  2IAI A;  1F1Z A;  3F8N A;  4Z6Y A;  5E18 F;  2QA4 I;  2E19 A;  1IXS B;  5CVU A;  2I8D A;  4EGY A;  4RGR A;  2CV2 A;  1WSU A;  4KN4 X;  2DT5 A;  3LSI A;  4L9T A;  5HNH A;  5CQG A;  1VI0 A;  1ZLK A;  2WAE A;  3LA7 A;  3VYT B;  4A0Y A;  4AYB N;  2LD5 A;  2Y9Z A;  3IC7 A;  1WCM J;  2ME6 A;  1VQ5 I;  2KRC A;  1D1B A;  1NG7 A;  3E6B A;  3IRR A;  3EUH C;  3JRG A;  2WB1 A;  5B66 C;  1FSE A;  1WQ2 A;  3OOU A;  1DP3 A;  1LFU P;  1T33 A;  3CC4 I;  4W97 A;  2M34 A;  3MFK A;  2L3D A;  2VKV A;  2K86 A;  3M9A A;  2PJP A;  1XCV A;  2FE3 A;  5K7H A;  2NNY A;  1BJZ A;  4BDZ A;  2AO9 A;  2G9W A;  3ERE D;  1H8A C;  2JZY A;  1IZ1 A;  2GOX B;  1K83 J;  1OJL A;  2UUZ A;  1N77 A;  2EFW A;  3C2B A;  2CYY A;  1JUP A;  1R1U A;  1TT5 B;  2KJB A;  2XGE A;  4XKV A;  4Y3O A;  3GFL A;  4GCV A;  4RAZ A;  3WTX C;  4V2F A;  2EIN H;  5E1W A;  3QQA A;  4A3C J;  4M3F A;  1IXC A;  3HUG B;  1UHM A;  2HXO A;  2NVT J;  1VQ9 I;  2GZW A;  4GO1 A;  3E6D A;  2BHZ A;  5BQT A;  1LE8 A;  1I5Z A;  5B3S H;  2XF7 A;  3H35 A;  1W5S A;  2EV0 A;  3VWB A;  2DOE A;  3HHG A;  5LRR A;  2OJE D;  4M3E A;  2ACJ A;  5CKT A;  3TGN A;  4IJA A;  1PDN C;  5KHD A;  3MEX A;  4E7J A;  2YR2 A;  2CWE A;  3H1C A;  2R7X A;  4LG0 B;  3PUB A;  2Y31 A;  4CXF A;  4LMY A;  1U6G A;  3FXM A;  4LOC A;  5D8K B;  3OWT A;  4IHW A;  2CQQ A;  4P96 A;  1WJ5 A;  2K3F A;  2RNJ A;  3B02 A;  4A3D J;  1PUE E;  1BC8 C;  2IS4 A;  5FKL A;  1DGR M;  3BJA A;  4DBR A;  4B44 A;  4CCM A;  2OZU A;  5EEG A;  3U21 A;  1S7A A;  3CLO A;  3FIS A;  4I2O A;  3P9I A;  4XSX F;  1LEB A;  2MYS A;  4RMN A;  1JGS A;  4YG2 F;  4Y7N J;  1IRX A;  2X4H A;  3RSN A;  1F36 A;  2ZC2 A;  2Y0M A;  5JVT A;  4N9I A;  2RV8 A;  4DYQ A;  3K4L A;  5D5X B;  3FK7 A;  3SFZ A;  2R7U A;  2QQB A;  2K4J A;  1IRF A;  3Q5F A;  2OQR A;  3K4M A;  1N78 A;  2E7X A;  2CUE A;  1XGN A;  3V4G A;  2BXZ A;  3F9K A;  2EZH A;  4M71 A;  1T0F A;  4UVB A;  3WTV C;  5F0C A;  3K1P A;  3VB2 A;  5ERI A;  2Z3Y A;  4D5F A;  4JK1 X;  1RKT A;  1X1D A;  2E2I J;  4BJT A;  2YX4 A;  3BR0 A;  1D5V A;  4HOB A;  2ZXJ A;  3W2V A;  3HSF A;  3CTA A;  4ESJ A;  3PSF A;  3MQ0 A;  3O2P E;  3NEU A;  3I55 I;  1R6R A;  3KP2 A;  4JP0 A;  3DTK A;  1FP2 A;  2CUZ A;  2AHQ A;  5A2Q Z;  4BHC A;  4ZDL A;  4L0Z B;  1JT0 A;  1B4A A;  3HRM A;  4AD9 A;  3ZCO A;  3I53 A;  1WI3 A;  3HPG A;  2EZI A;  2E35 A;  3ZMU A;  3OYM A;  1GDT A;  4WK8 F;  3GTJ J;  3G73 A;  2DCE A;  1XGS A;  2YU3 A;  2STW A;  5D6E A;  3F8B A;  2XAJ A;  2L7F P;  3ABM H;  4XON A;  1BW5 A;  1TT0 A;  1BL0 A;  4LK0 F;  4EJU A;  1U2W A;  2KL4 A;  2K3P A;  5HDN A;  1W5T A;  4QLC U;  1FPQ A;  1P7I A;  3JW4 A;  5DM6 F;  4B1R A;  2ZXH A;  2XSD C;  1Y1V J;  2KIS A;  2ZJP F;  1MND A;  5F04 A;  4HYE A;  1ZEL A;  2D1V A;  3L00 A;  2HPM A;  1TC3 C;  4C30 A;  3RDI A;  4A3G J;  3P5J A;  1HLV A;  5LBQ A;  5AIP A;  5J40 A;  5HOO A;  2STT A;  3IKT A;  1LB2 A;  1FOX A;  1KU3 A;  2QUF A;  1V3F A;  2L4A A;  1V4R A;  2X51 A;  1WZ2 A;  1X3Z B;  3ONQ A;  3PNT A;  3DQV C;  3OYC A;  2QLZ A;  2ZXI A;  3A0B C;  4YIR X;  3E6C C;  3HOT A;  4M73 A;  2R3S A;  4JYK A;  2LY2 A;  2XB5 A;  1Y1W J;  2OPT A;  1MD0 A;  3KZY A;  4Y4R A;  2IA2 A;  3ULQ B;  1QZZ A;  2A6H F;  3GYH X;  1U9N A;  3FXL A;  2M5W A;  1X2M A;  4XKB A;  1XX5 A;  4NQW A;  3HOX J;  1HKQ A;  3OIO A;  3U1D A;  3AL0 B;  2DN0 A;  2JJ7 A;  4I6Z A;  1YIO A;  3DBH B;  4II3 A;  3ZXS A;  1RIO H;  4I98 B;  3PQJ A;  3AKZ A;  4CCO A;  2Z2S B;  1U8R A;  1DDN A;  4ENK A;  1O57 A;  3TDU C;  3A2K A;  3DXJ F;  2IVM A;  4D9J A;  3WE3 A;  2DA3 A;  3A03 A;  4MEX F;  1FTT A;  4OIP F;  2WB1 N;  4U87 A;  2GM4 A;  2ZB9 A;  2OU2 A;  2KZG A;  3CES A;  5GAH J;  3I4M J;  2PI0 A;  1ZGJ A;  2W25 A;  2QZ8 A;  1YS6 A;  3ZMZ A;  1R5H A;  2BVL A;  3QOD A;  3K4K A;  1T2K A;  3H9G A;  4BXU A;  1X1C A;  2WWY A;  4NUB A;  3KP5 A;  2YS9 A;  2EJR A;  5CPR B;  3ZPL A;  3ELK A;  4ENJ A;  4CYC B;  1HDD C;  4J19 A;  2XAF A;  1SEU A;  5ILS A;  3C3W A;  4HDV A;  3CO7 C;  5EGO A;  1LFB A;  1JUM A;  4XRS G;  3QOE A;  3FMR A;  1JGG A;  1GLN A;  2OV7 A;  5L3B A;  2X6Y A;  1TNS A;  2CJJ A;  2M0M A;  1JKR C;  3S1N J;  3K2A A;  3SEZ A;  5IOZ A;  4U0Y A;  3Q0V A;  3BG5 A;  2NOG A;  2QVO A;  3OYI A;  1R5I D;  5K7F A;  1NK2 P;  3MD2 A;  3HPH A;  2CFO A;  4P1W A;  4HNT A;  1YRN B;  4XOT A;  2NVX J;  3SYT A;  1WJB A;  3WGG A;  1Y8R B;  5IPA A;  3FHZ A;  4NHJ A;  2IGN A;  3KP6 A;  3K1M A;  3ZQQ A;  2K9S A;  3L1P A;  3BRO A;  3V8J A;  1ZAO A;  2JWT A;  3PUF A;  1YJ9 I;  4D5C A;  3B6C A;  3TMO A;  1G4D A;  3L2U A;  5JLW A;  3ZMV A;  4QPQ A;  2HKO A;  1DPU A;  5LGU A;  2DA6 A;  4I99 C;  3GTQ J;  5EZH A;  2HI3 A;  2LKS A;  4YFK F;  2G7U A;  1XSV A;  2P5L C;  3WU0 A;  2TDX A;  2VL8 A;  3BR3 A;  1ZG1 A;  3AG3 H;  4GGG A;  5HLH A;  1VND A;  1IXR C;  2MA3 A;  2XVC A;  4AVP A;  1QVU A;  4ZYH A;  3DKX A;  5K5Q A;  2EZL A;  3E1S A;  4OAY A;  4KIG A;  3Q9V A;  1BI3 A;  1TW2 A;  3G1L A;  3HXL A;  1DPR A;  1FSH A;  1YW7 A;  5GPA A;  3OIP A;  2VKE A;  5FKO A;  1GUU A;  1MBG A;  2LR8 A;  4I02 A;  4QPO A;  1UJ8 A;  3E6M A;  2HOT A;  2Z1D A;  2DPD A;  2A6T A;  2M7A A;  3DPT A;  1IUF A;  3S3O A;  4BDY A;  1I1G A;  3FZV A;  3S2H J;  3OV8 A;  1W7P B;  2LVS A;  1OKR A;  1VQL I;  3RQ4 A;  4FE4 A;  3FXQ A;  4XID A;  3RI4 A;  3K0L A;  4E70 A;  1XMK A;  3ERM A;  1IRZ A;  3NWS A;  5J1Y A;  2RDP A;  3BTI A;  1ZK8 A;  2PEX A;  3ZQG A;  3S93 A;  3OL4 A;  4RS8 A;  4M74 A;  3H0D A;  5DUI A;  3DLL F;  2XAU A;  1UHW A;  2XRN A;  1ZRF A;  2XF6 A;  1EA3 A;  3JTH A;  3OMY A;  4BGD A;  5H2F C;  2B0L A;  2I10 A;  2FMY A;  1SC7 A;  1F9N A;  1T39 A;  3UR3 C;  1RZ4 A;  3MKZ A;  1IJW C;  2DI3 A;  4I0A A;  1QHG A;  2BW3 B;  2GAU A;  1XCB A;  2LDU A;  2XRO A;  4XQF A;  3DPL C;  3B73 A;  3ZMT A;  2A5Y B;  3S1R J;  4EM2 A;  5F27 A;  2XHK A;  1X4O A;  1DQU A;  5LHI A;  5F6F A;  2IA0 A;  1AA7 A;  4A6D A;  4II2 A;  4IHY A;  2DBB A;  1U9O A;  3RKY A;  2ZJR F;  3S8P A;  5ED4 A;  4A5N A;  1I6X A;  1MH3 A;  4RB3 C;  4B47 A;  3CUO A;  3G1O A;  1HDP A;  5FJ8 J;  5EZG A;  2VUM J;  4BU2 A;  1W4M A;  1FYL A;  3QRF F;  4UV8 A;  1W36 D;  1FEX A;  2LY1 A;  4LIT A;  2KDZ A;  5LLQ A;  6PAX A;  1IV6 A;  2IBD A;  3JRF A;  1UZC A;  2NYX A;  3EUH A;  3BLY A;  2GLO A;  1Z91 A;  2R7V A;  4BAC A;  2DW4 A;  2V1D A;  5IT3 A;  1TWG J;  2DA5 A;  2O03 A;  2E2H J;  3E7L A;  4R79 A;  2LKX A;  4MLO A;  3T5X A;  1BI0 A;  2ISY A;  3IHU A;  3I71 A;  4AUX A;  4XNF A;  5FRM A;  1MBF A;  1HQC A;  3H3Z A;  4BJ5 C;  1Y0U A;  1GXQ A;  2A5W A;  2FBK A;  4QWQ A;  1XB4 A;  2O5R A;  1JJ6 C;  2CW0 F;  1BIB A;  2XAH A;  2R7O A;  1HKT A;  2QM3 A;  1B1B A;  1LUJ B;  1I39 A;  4HRI A;  2OQG A;  1JKO C;  1VQ6 I;  5EEH A;  1BA5 A;  3QAH A;  1YW8 A;  1W7P D;  1YIT I;  3SZG A;  3T1B A;  3RKQ A;  2K4B A;  4NNJ A;  5ICF A;  1FT9 A;  2FNP A;  1KON A;  1R7J A;  2CSO A;  2EZK A;  3REO A;  1B59 A;  3ZMD A;  3ZN1 A;  5DCM A;  1QRY A;  3OR2 C;  3HJE A;  1N75 A;  5CYV A;  2OTJ I;  4IRH A;  1RKW A;  1YG2 A;  2BOL A;  2I5U A;  4PUS A;  2R92 J;  5FD5 A;  2KFD A;  2DFH A;  1TWF J;  2PMZ A;  1W1W E;  4HLX A;  2NOJ B;  1ZQ3 P;  4EJT A;  3TKY A;  3GX4 X;  2R7Z J;  2O0Y A;  1I27 A;  1SAN A;  1XD7 A;  3ZQC A;  3ZR8 X;  2O6G E;  1YFH A;  4IHV A;  4HX8 A;  3QPL A;  3IRQ A;  4IHT A;  3GXO A;  1TW3 A;  1HKS A;  3KEQ A;  5E20 A;  1X1A A;  2PBI A;  1HW5 A;  3GVA A;  3N4M A;  3WTU C;  2QBY B;  4U0V A;  4LLN A;  1YIJ I;  4X6A J;  3FXK A;  5L3D A;  4F3Q A;  4ENN A;  3OYA A;  2GQQ A;  4XLA A;  2E1C A;  2IRF G;  2JQ7 A;  2GWR A;  1ETK A;  2ME0 A;  2VIX A;  3LFK A;  3U2R A;  2BYV E;  5EJC A;  2CH0 A;  3JRI A;  3T8R A;  3ZQH A;  2HZD A;  2JVG A;  3PQK A;  3ZRG A;  3WG7 H;  5IYC J;  3OYJ A;  2DMN A;  1SFX A;  4P5O A;  3OYB A;  5B1A H;  3ECH A;  1XTA A;  1RUN A;  2W24 A;  3NWT A;  1SFK A;  1HOM A;  1Z21 A;  3IH4 A;  4ZZL A;  4A3F J;  5L3F A;  2M4G A;  4UUS B;  2GOM A;  4IEJ A;  4E7H A;  4S04 A;  3SHF A;  2HTJ A;  2DPU A;  5D8L B;  2LRD A;  4YII A;  3KET A;  3CCU I;  1D0Z A;  1MZB A;  2UV1 A;  2WY7 Q;  1HC8 A;  1ETQ A;  1FMV A;  3RTR A;  4AVZ A;  3F0C A;  4CYD A;  5FB2 A;  4JX6 A;  4CZZ A;  4LB5 A;  1FX7 A;  4LG3 A;  2YUS A;  2JA7 J;  2OTL I;  1MBH A;  2PMU A;  1RPW A;  1JKP C;  3GTG J;  3HB9 A;  1G3S A;  2A69 F;  2DXI A;  1G6N A;  2V6E A;  3T0Y A;  4A6E A;  2RRE A;  2PN6 A;  4ZTF A;  1ZLJ A;  4MEY F;  1UB9 A;  1Z05 A;  1AWC A;  2NS0 A;  2A61 A;  1QO0 D;  2QKL B;  4EMS A;  4FIS A;  3DFG A;  3OS0 A;  2DA2 A;  4FQG A;  3K4B A;  1Z3Y A;  2BY1 A;  3CME I;  2KIF A;  2A3S A;  1Z6R A;  5J47 A;  1DU0 A;  4UV9 A;  4XKW A;  1OCT C;  3BZC A;  4XBF A;  2M30 A;  5L3C A;  2ADU A;  1QA6 A;  1ACI A;  2PLY A;  3X2Q H;  1R5G A;  2K85 A;  2DJN A;  1MBK A;  1K4S A;  2RQP A;  2XGD A;  3JRB A;  2WC2 A;  1YE9 A;  2NXN B;  3SZP A;  2ZCW A;  4WX9 A;  1NG6 A;  3VSK A;  4UB6 C;  1KU9 A;  2GIV A;  3VOE A;  4BXF A;  1FOW A;  4D7N A;  2VE9 A;  1WFX A;  2K40 A;  4QSH A;  4OMY A;  5DM7 F;  2K9Q A;  3V42 A;  1Y39 A;  1I3A A;  3BZ6 A;  1D5Y A;  4KIS A;  3HRT A;  3BR1 A;  2N8G A;  4NC6 A;  2WA0 A;  3HSE A;  4MFE A;  4UHT A;  4BBS J;  5IOY A;  2VBY A;  4UUT A;  2D1H A;  4Z2Y A;  2HR3 A;  2BXY A;  3ROU A;  4H0E A;  5CVV A;  4Q5S F;  3J7A O;  2IGO A;  1B72 B;  4FE7 A;  4L9J A;  1X3U A;  1R58 A;  4XMY A;  2O7O A;  3EYY A;  2HQ5 A;  3HUG A;  5M5W J;  3OSF A;  2VJJ A;  3A02 A;  3UKG A;  3OR1 C;  2OA4 A;  3KE2 A;  2J5P A;  2LF7 A;  2Z5U A;  1T6S A;  3SXY A;  1WH7 A;  2QQ8 A;  2RNG A;  1OCO H;  4F91 B;  4Q48 A;  1BBY A;  1MSE C;  2MLG A;  3ML6 A;  2VXZ A;  3COA C;  5BPI A;  2VT2 A;  2B63 J;  5EEA A;  2DYS H;  4B4C A;  4G7Z F;  2MSY A;  2ZO4 A;  4HNV A;  2AXT C;  2HOE A;  4PJM A;  1U8B A;  1HBX G;  3KYL A;  2XPU A;  2L7M P;  4LG0 A;  1D8J A;  2O9L A;  2GA2 A;  3CCQ I;  1S29 A;  1YJN I;  2JRT A;  3BCA A;  1FZP B;  3QP5 A;  4ZDP A;  3AFH A;  2G0E A;  4RAG A;  1JUS A;  3LST A;  3MCZ A;  2V6C A;  2V9P A;  3F8F A;  2DQR A;  5KVR A;  2FU4 A;  1C0W A;  3KYC B;  1XDS A;  4PZJ A;  1BR2 A;  2HDW A;  1KA8 A;  3PNV A;  9ANT A;  2MG4 A;  5C44 J;  3LFU A;  4J01 A;  4EEF G;  2K9N A;  3HKZ N;  5GAG J;  4B3A A;  5EG0 A;  3GTM J;  2GXG A;  4OU0 A;  1IN4 A;  4M6Y A;  2L9S A;  3L9F A;  3ABU A;  3I64 A;  1HSJ A;  3P7N A;  1ULY A;  3W2A A;  3RCO A;  1T8I A;  2LF8 A;  2JA6 J;  1N25 A;  2VPR A;  2PMH A;  2H6C A;  3GF2 A;  4L0Y B;  1KU7 A;  4F7Z A;  1U5T C;  1FIP A;  5BMZ A;  4HQE A;  3DV8 A;  2EIL H;  3K6G A;  1FBQ A;  2Q1Z B;  2X9D A;  5J1R A;  1LPQ A;  2O61 A;  4PJ0 C;  3HDD A;  2MD5 A;  3HIF A;  2Y30 A;  4ZTJ A;  1AHD P;  2V79 A;  5EG0 B;  3S1M J;  2JT1 A;  1FJL A;  1A04 A;  2RKH A;  1LJ9 A;  1I1S A;  4CZC A;  3K4C A;  1WJA A;  1KU2 A;  4PK4 A;  1BN5 A;  1I3Q J;  4Y17 A;  5HS7 A;  4F93 B;  1U78 A;  2M9H A;  5ICE A;  1BJA A;  5F0H A;  3OYK A;  3NAR A;  3MKW B;  3M8E A;  4BBR J;  3I54 A;  4AIK A;  3K70 C;  5DUK A;  1VQ8 I;  4ZC3 A;  2R5Z B;  3CJT B;  2L2O A;  4EVI A;  3HTS B;  3AG4 H;  1M1E B;  1FIA A;  5D4R A;  3BJ6 A;  3MZY A;  3FKJ A;  4NBQ A;  4IL6 C;  1TZL A;  5IY5 H;  3HOS A;  4KMF A;  1JI8 A;  1ERD A;  2E34 A;  3A0H C;  4LK1 F;  4XRM A;  2NVU B;  5EDN A;  5FLX K;  2H1K A;  1RR7 A;  3OY9 A;  1VTN C;  3M7G A;  1A6I A;  2H94 A;  2V9K A;  3P9C A;  3JAM K;  3S14 J;  3I4N J;  2JA2 A;  2LLK A;  1K6O A;  3NQO A;  4MIM A;  2ZFU A;  1R49 A;  3O8G A;  2V7F A;  2Y9Y A;  4R1H A;  4PCQ A;  3LNQ A;  4ANJ A;  3OYL A;  4I09 A;  3TDZ C;  2VE8 A;  4CCJ A;  5GAE J;  1IDZ A;  5IP7 J;  4DIQ A;  3BJO A;  3HYI A;  2B7E A;  3Q0W A;  3R61 A;  3HGY A;  2XUB A;  1EKE A;  3VDX A;  3Q9S A;  2ID3 A;  1NTC A;  1FWZ A;  3MZH A;  1S9H A;  2ELK A;  2HFH A;  4BY1 J;  1HA8 A;  3RJP A;  5DEQ A;  4P9F A;  3H5N A;  1PYV A;  4EJW A;  2TRT A;  1A31 A;  2LC2 A;  1FNN A;  3BTC A;  5GAD J;  3A01 B;  2QEN A;  1Z77 A;  1ZH5 A;  2MW8 A;  5E17 F;  4GFB A;  4HX7 A;  3OYG A;  4L9V A;  4MTE A;  2CV0 A;  2FF4 A;  1IN5 A;  4XN3 A;  4UVA A;  3A4C A;  3H0G J;  4GRI A;  1T38 A;  1OCC H;  4XN0 A;  1IRG A;  3FM3 A;  3FM5 A;  1FYM A;  1FTZ A;  3R0J A;  3WU1 B;  2WAQ A;  3DTE A;  5JHU A;  2MH2 A;  3GME A;  4AC0 A;  2V1N A;  2CMP A;  1RUO A;  1JE8 A;  4UNO A;  2FML A;  1GV2 A;  4E4H A;  3PM1 A;  1V5G A;  4D1Q A;  2BY2 A;  3GWZ A;  2GXA A;  1MMS A;  2XPW A;  1ZRE A;  1LVA A;  5KK1 A;  4IHS A;  3LA2 A;  1YOV B;  3FIW A;  1GXP A;  4NC7 A;  2QWW A;  1W0T A;  5E8I A;  4M6V A;  3H36 A;  2LYC A;  2R7D A;  4RM3 A;  1MW7 A;  3K2Z A;  5F1J A;  3FMS A;  4G6Q A;  1T56 A;  3KP4 A;  3L2R A;  2RAE A;  3HBL A;  1XG1 A;  5D5W B;  4ZJZ A;  4V19 K;  2VAS A;  5DDG A;  3D5R C;  5EYR A;  1LFP A;  3H3V K;  4D7M A;  3BG3 A;  4CDG A;  2XPV A;  3IH3 A;  4CYC A;  3GCM A;  3DEW A;  3CP8 A;  3M8J A;  2XIG A;  4KJZ A;  5F64 A;  1MBE A;  1OFC X;  3DCF A;  4JOM A;  4OAZ A;  3FBN B;  4HAM A;  1K61 A;  3N05 A;  2IGM A;  2X1C A;  2E1O A;  1R4M B;  3I3L A;  4W1U A;  3S15 J;  1OCP A;  1ZRC A;  4HF1 A;  2XC7 A;  2H6B A;  2ISZ A;  1BM9 A;  2HTS A;  5FRO A;  3OOP A;  3R60 A;  2CQK A;  1FOK A;  3Q0U A;  4E7Z A;  1S3J A;  3DPU A;  3J81 K;  2LFB A;  5EF6 A;  1YRN A;  5DD4 A;  2Z9O A;  4PGH A;  2EBI A;  3CCS I;  2V26 A;  2W48 A;  5E79 C;  3QPS A;  2BVM A;  1KYW A;  2E5Z A;  1X1B A;  2PX9 A;  3GFM A;  2LBF A;  1RRJ A;  5J3L A;  3SDG A;  2P7C B;  2F4I A;  3H5A A;  4CCK A;  2VC1 A;  3DP7 A;  4LLG F;  4S05 A;  4BQA A;  3ZQI A;  2Z33 A;  2NNN A;  1IC8 A;  3GLX A;  2HQR A;  2F5V A;  1Y6I A;  3V7S A;  2K5C A;  4A3L J;  1HW1 A;  4IKF A;  1CF7 B;  3LMM A;  4ZYE A;  2HKX A;  2DK5 A;  3F6O A;  2OD5 A;  3LA3 A;  3C1D A;  4N9H A;  3WHC A;  3V7R A;  4AIJ A;  2ESN A;  2A07 F;  2NVQ J;  2JSP A;  2XV4 S;  3E5X A;  2FOK A;  4PJL A;  4EGZ A;  1IV8 A;  2F5E A;  3J7Y J;  1E2X A;  2M1B A;  2LBF B;  3ZQ7 A;  4BEH B;  4ZYG A;  2VN2 A;  5IYB J;  3ZGK A;  2ZNZ A;  3WTS C;  1LDK B;  4BQO A;  1IW7 F;  2ID6 A;  2MD0 A;  2F4M B;  5LGT A;  3OYH A;  3N97 A;  3QPT A;  1G3T A;  2X6X A;  1X19 A;  1R22 A;  3AG1 H;  2KIM A;  2L9N A;  5FGM A;  1E3O C;  5FD6 A;  4A0Z A;  3WTW C;  2KJC A;  3H92 A;  1P4A A;  2IS6 A;  2L01 A;  5D5V B;  1KQ0 A;  3FWE A;  1GT0 C;  1SD5 A;  4P55 A;  2E1M C;  2VQL A;  4I01 A;  2VON A;  3BZK A;  1VQM I;  2K9L A;  4OOI A;  1W7P A;  4PJN A;  4XL9 A;  1NHA A;  1DGW Y;  2JUG A;  3I9V 2;  4M72 A;  3BTJ A;  3TO6 A;  1UG0 A;  1JKQ C;  3FF5 A;  3ZMS A;  2EIM H;  2C6Y A;  3DEE A;  4XLC A;  5FLM J;  5E1X A;  2F2E A;  1O3S A;  2EIJ H;  2DU9 A;  1R00 A;  2ZBK A;  2LK2 A;  1T0F C;  4RGX A;  1ZG5 A;  2Y2Z A;  1TBX A;  2FQ3 A;  3I58 A;  3OL3 A;  1IUY A;  1SD6 A;  2LOO A;  3LOC A;  3OYF A;  4EJO A;  3PJR A;  1QPI A;  3TW6 A;  2HQA A;  2DT7 B;  1H9T A;  3RZO J;  2DTZ A;  5E3N A;  2ZKZ A;  3PO2 J;  2KT0 A;  5CJ9 A;  3KEO A;  4MGR A;  4B09 A;  4B43 A;  3UNG C;  3DU6 A;  1QZE A;  2EQR A;  1J09 A;  1MNE A;  2P5K A;  1WH5 A;  2BW3 A;  2Q8K A;  2CW8 A;  4C2U A;  4XLF A;  4BYY A;  3I5U A;  3PIP F;  5TRD A;  4BE0 A;  3CCM I;  2EFO A;  2ZSI B;  2E71 A;  2HZT A;  3MWM A;  2JPB A;  1XC5 A;  4AIH A;  4X0G A;  3D5S C;  4AU7 A;  3GTK J;  3OYE A;  4RAY A;  1Z9C A;  3CF2 A;  4L5E A;  2FXA A;  1ZHF A;  4BUP A;  4PSX A;  3CUQ C;  1DU6 A;  5E1Z B;  1JXS A;  3FDY A;  4UB8 C;  4DGW B;  4LD5 A;  3S3M A;  3S17 J;  1MDM B;  2HVR A;  3EYI A;  3G4S I;  1TWA J;  3CJQ B;  3CJN A;  1IO2 A;  3D5L A;  3BP8 A;  2B9S A;  2HYJ A;  4G9Y A;  2UXX A;  5HDK A;  1EH6 A;  1D0Y A;  3GUD A;  2ESH A;  4N4O B;  2Y0S A;  1TP4 A;  2D2W A;  2R7Q A;  1B8I B;  3RYP A;  1SMY F;  2BEO A;  4FET A;  1H0M A;  4XLH A;  5KCM A;  2WV1 A;  2CV1 A;  1QVT A;  4WF2 A;  5B5E C;  4IF4 A;  3AG2 H;  1SMT A;  3MMY B;  3HEF A;  3R4K A;  4FHT A;  2VLA A;  2XAS A;  3LSH A;  4E7K A;  3CMA I;  3C18 A;  3TOB A;  4AYB A;  1TWH J;  1YW9 A;  5D5U B;  4FAS D;  2ZME C;  1JHH A;  3IKV A;  3VYR B;  1P6R A;  1OR7 C;  4HV5 A;  3M1E A;  3HG9 A;  2AS5 F;  2ZXW H;  1VZ0 A;  5DYM A;  1T08 B;  2QYO A;  5L3E A;  3IP4 B;  3IUO A;  3QPH A;  3GTO J;  3O8H A;  2VOP A;  2DMU A;  2ICW G;  2W82 A;  3CCR I;  2HNH A;  2R5Y B;  1K78 B;  1XSX A;  4RA2 A;  1ETV A;  4JX4 A;  3IL2 A;  4CHU A;  2CFX A;  4JX5 A;  1D3Y A;  3LWF A;  3BY6 A;  2H8R A;  1MKM A;  1SVO A;  2DDB A;  3M07 A;  1H89 C;  3D0S A;  2M4K A;  2QBY A;  3BR5 A;  4KYW A;  3NRV A;  5B1B H;  3WTT C;  1WWX A;  2ZSH B;  3PNY A;  2DAO A;  4RGU A;  3T8T A;  5E3L A;  4HPQ A;  4CUG A;  2QGU A;  3HZJ A;  1RES A;  4GDF A;  2FA5 A;  3QOP A;  4LJZ F;  2WAF A;  1R4N B;  3FK6 A;  2HPI A;  2FUG 2;  4BE2 A;  3V7C A;  3CCV I;  3WTY C;  1WI9 A;  3LQR A;  2L54 A;  4RM2 A;  1CGP A;  4MFD A;  1O3Q A;  5BNG A;  3JRE A;  2L02 A;  2CW7 A;  2XB0 X;  4E7I A;  1USS A;  2PJR A;  1L0O C;  1DP7 P;  1P9Q C;  1P92 A;  1XS9 A;  1R23 A;  4GXO A;  4E7L A;  1O3T A;  5D6F A;  1L3L A;  3ABK H;  1O7L A;  1SVL A;  2XKO A;  2HEO A;  2GIZ A;  4V2G A;  3OS2 A;  2FX0 A;  1GHC A;  4U7B A;  3HGG A;  4UUS A;  4KN7 X;  4A3M J;  1Z6T A;  3HSR A;  1QQI A;  3K4N A;  4TV7 A;  1KQ8 A;  2F5D A;  3W6J B;  2P7V B;  2ZJ2 A;  1ZGW A;  4A3E J;  2DYR H;  1MBJ A;  3ABT A;  2LMD A;  3BG6 A;  4BH9 A;  2M3A A;  2OUM A;  1U5T B;  3GTP J;  4FX0 A;  3KYD B;  2PJR B;  4KMU X;  4BJ6 C;  4IQJ A;  3HRU A;  3KFW X;  1Z7L A;  3TL4 X;  1AKH B;  2JSC A;  2KRF A;  2P0W A;  3KX2 A;  4CO8 A;  2ECB A;  5JI6 A;  5JVG F;  5FRN A;  4IOA F;  2IS1 A;  2K27 A;  2X6O A;  3FKI J;  4NB5 A;  2E2J J;  1ZGA A;  3VYU B;  1VQO I;  2L9V A;  3JRD A;  2FBH A;  2NS7 A;  1K4T A;  3LL7 A;  2DJI A;  2DLL A;  3B6A A;  4KIB A;  1VQN I;  4A3J J;  1PJR A;  2COB A;  1MH4 A;  5FFZ A;  3DTI A;  4B3X A;  5F0F A;  5LEJ A;  2QF7 A;  4DOZ A;  2VC0 A;  3D1N I;  2VOD A;  4YIF A;  1JT6 A;  5A2Q K;  2R7S A;  2XF5 A;  3GZN B;  1OYI A;  3PL8 A;  3L2W A;  3GTL J;  2WTE A;  4H4K C;  5J1U A;  5HVQ C;  5HLT A;  4A5M A;  1J9I A;  1BR1 A;  1WVR A;  4CCL A;  4PFO A;  1MMN A;  3ISP A;  4HZF A;  2EWN A;  1FP1 D;  1MMA A;  1R36 A;  4ESF A;  2CGP A;  3JR9 A;  2E60 A;  2M87 A;  3V8L A;  2WBM A;  2XRL A;  1VFC A;  3I56 I;  1G2H A;  4OIO F;  4I7H A;  1YLF A;  2KIU A;  1WGX A;  3WTZ A;  4ETS A;  4IVN A;  3GW2 A;  3H9J A;  3KLN A;  2CS3 A;  1ZR4 A;  3EDP A;  2X48 A;  3BTL A;  2KMU A;  3TO7 A;  2WV0 A;  3CZ6 A;  4UXN A;  2D5V A;  2KP6 A;  1UMQ A;  4MO7 A;  1IDY A;  4RB1 A;  1WHU A;  1R1T A;  2X1E A;  3VEP A;  2FSW A;  1B72 A;  3BCB A;  4HF2 A;  1TWC J;  5F08 A;  5TJJ A;  1JHF A;  3FXU A;  3MVP A;  1OQY A;  2VQC A;  4OWR B;  2CQN A;  4ASN A;  4CGZ A;  4GYI A;  1FC3 A;  5IT9 Z;  1G3Y A;  2P6S A;  1MGT A;  3BR6 A;  3M1C A;  2H27 A;  3HRS A;  3F8M A;  1OYY A;  3GZ5 A;  2WY8 Q;  2NAZ A;  3SDB A;  1PUF B;  3O6B B;  1I50 J;  1QGP A;  4RBO A;  1ODD A;  1G3W A;  3J7Z I;  3HC7 A;  1XSD A;  2XAG A;  2F4O B;  2F6C A;  3G3Z A;  5HNF A;  2D45 A;  4Y33 A;  3BR2 A;  2V9V A;  1YHQ I;  1QHH D;  3GFI A;  3ZQF A;  2GBY A;  5E3O A;  1ZTR A;  4CA0 A;  3M8F A;  2DO7 A;  2ZFW A;  4D0P A;  3CMM A;  1TQM A;  3ZQL A;  3E5U A;  2ELJ A;  4A69 C;  1B6A A;  1O3R A;  3RIR A;  5LEK A;  2Y48 A;  1WJC A;  2UZK A;  2M7B A;  2JRM A;  5M3F J;  4IOC F;  1UAA A;  2VJ5 A;  1X1P A;  5LHG A;  3J7A Y;  4G7H F;  3S1Q J;  4O3M A;  3DKY A;  4XIC A;  1S7O A;  4HEA 2;  2LNB A;  3CP2 A;  1AU7 A;  4O6J A;  5CQE A;  2QEX I;  1HW2 A;  3LAJ A;  4XOR A;  4HX4 A;  1D8K A;  2P5V A;  3LSM A;  1Z0X A;  5ICC A;  1A6Q A;  3IH2 A;  3K70 D;  1S72 I;  3JCU C;  1POG A;  3DBL B;  1T98 A;  1UG2 A;  2ELH A;  2RN7 A;  4OMZ A;  5K5R A;  2L0K A;  1RI7 A;  3GEZ A;  2FQ4 A;  2VQG A;  2DOF A;  3G2B A;  4A93 J;  4EM0 B;  2P6T A;  2ZNY A;  3G1M A;  2R0Q C;  1IG7 A;  3HTU A;  4MHG A;  2KPM A;  3BOQ A;  4HG2 A;  1IAW A;  1Q1H A;  4ZYA A;  2PMZ N;  3W2W A;  2MBF A;  1R9T J;  4K2E A;  4O5V A;  2K7L A;  3GFJ A;  2EA4 A;  2VBW A;  1F5T A;  5AON A;  2X6W A;  1ETX A;  5DCF A;  2YU9 J;  3WGI A;  1G59 A;  2R7F A;  4HF0 A;  3CDL A;  3AAF A;  4NDL A;  4KUM A;  1SVM A;  3CCJ I;  4ABZ A;  1E3H A;  1J5Y A;  2R5Z A;  4ITV A;  4M3G A;  2VBZ A;  3KZI C;  4XRF A;  3RKX A;  3BG7 A;  1HST A;  2DT6 A;  2OBP A;  5HDG A;  2CQX A;  3RQI A;  1ZRD A;  1Y0N A;  2QCO A;  4RAF A;  5CLS A;  1E17 A;  5K7Z A;  1LE8 B;  5JLX A;  1KGS A;  2W85 A;  1U0J A;  1YX5 A;  3SQN A;  3FMQ A;  4C2M J;  4LGW A;  4Q4Z F;  1J59 A;  4HV6 A;  4EV0 A;  1ON1 A;  1Z1D A;  2FJ1 A;  1Y56 A;  3FXR A;  1RC9 A;  4GYG A;  1O4X A;  4YRV A;  4FCY A;  4C9Y A;  4HQM A;  4MNU A;  4ESB A;  4RDU A;  4HNU A;  2ECC A;  1ZG3 A;  1YTY A;  4MQ9 F;  1J75 A;  3LAP A;  2YX7 A;  3CF5 F;  4QIW N;  3F22 A;  4HA8 A;  4DQ2 A;  2VQH A; 
#chains in the Genus database with same CATH homology
 1YHQ I;  1VQ7 I;  3CCQ I;  3CCE I;  3CC7 I;  1YJN I;  2K3F A;  2E36 A;  3CCU I;  1HC8 A;  3G4S I;  3G6E I;  3J7Y J;  5GAD J;  4IOC F;  2FOW A;  2OTL I;  5JVG F;  4IOA F;  5GAG J;  1YJW I;  1VQO I;  1VQP I;  3G71 I;  1VQ4 I;  3CCL I;  2QEX I;  1VQ6 I;  1VQN I;  1YI2 I;  5GAH J;  1YIT I;  3CME I;  3CMA I;  2QA4 I;  3CD6 I;  1MMS A;  1S72 I;  1VQM I;  4IO9 F;  1FOY A;  1VQL I;  1QA6 A;  1ACI A;  4UY8 I;  2OTJ I;  1VQ5 I;  2NXN B;  3I55 I;  4V19 K;  3CC4 I;  3CCR I;  1FOW A;  3I56 I;  2ZJQ F;  5DM7 F;  1Y39 A;  3DLL F;  2E35 A;  1VQ8 I;  3CCJ I;  3CJT B;  1YIJ I;  2JQ7 A;  3CC2 I;  1VQ9 I;  2E34 A;  5DM6 F;  2H8W A;  3CCS I;  3PIP F;  1VQK I;  3CCV I;  2ZJP F;  3CCM I;  2ZJR F;  3PIO F;  5GAE J;  1FOX A;  3J7Z I;  1YJ9 I;  3CF5 F; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...