2ZJRF

Refined native structure of the large ribosomal subunit (50s) from deinococcus radiodurans
Total Genus 11
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
11
sequence length
71
structure length
71
Chain Sequence
MSYLIRKAAGIGKGSSTPNKAKVGKLNWDQVLEIAKTKMPDLNAGSVEAAANTVAGTARSMGVTVEGGPNA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Ribosome
molecule keywords ribosomal 23S RNA
publication title Translational regulation via L11: molecular switches on the ribosome turned on and off by thiostrepton and micrococcin.
pubmed doi rcsb
total genus 11
structure length 71
sequence length 71
ec nomenclature
pdb deposition date 2008-03-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
F PF00298 Ribosomal_L11 Ribosomal protein L11, RNA binding domain
F PF03946 Ribosomal_L11_N Ribosomal protein L11, N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.250 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Ribosomal protein L11, C-terminal domain 2zjrF00
3I55I 2OTJI 1YJNI 1YJ9I 1VQ4I 2ZJRF 5GAHJ 1VQ8I 1Y39A 1VQPI 1VQKI 1MMSA 3J7YJ 3CD6I 3CF5F 3CCMI 3CCQI 1VQ6I 3CMEI 4V19K 1FOWA 2E36A 3CCEI 1VQ7I 3CCUI 3G71I 3CCSI 1FOXA 4IOAF 2E34A 1VQLI 2OTLI 3CCLI 4IO9F 1YI2I 1ACIA 3PIPF 3CMAI 3CCJI 3CJTB 3CC4I 3G6EI 3DLLF 2QEXI 2ZJQF 1YITI 1VQ9I 1S72I 2QA4I 1VQMI 4IOCF 1YIJI 3PIOF 2NXNB 2JQ7A 1QA6A 3J7ZI 5GAEJ 5GAGJ 1YJWI 2E35A 1VQNI 3CC7I 2FOWA 3G4SI 1FOYA 3CCVI 1YHQI 5DM6F 3I56I 5GADJ 5JVGF 5DM7F 1VQOI 1VQ5I 3CC2I 2H8WA 4UY8I 2ZJPF 3CCRI 2K3FA 1HC8A
chains in the Genus database with same CATH superfamily
2W85A 3DPUA 1QPIA 3QPTA 4CDGA 4RA2A 3LQRA 4G9YA 4ZDOA 3G3ZA 1LVKA 1I50J 2EQRA 5CQGA 2ME6A 4B3XA 2XASA 2DXIA 2DTZA 2LREA 5J40A 1Z91A 1RKTA 1X2NA 3CCYA 3U1KA 4A3CJ 1WRJA 5FJ8J 2K4BA 3KP5A 5LGUA 1XMKA 2ZSIB 2LF7A 3HGGA 2LF8A 3K7AJ 5AONA 1MMGA 4P96A 3TKYA 1ZGJA 4EJVA 3W2VA 2JUCA 2Y9YA 5EDNA 3LMMA 1TWGJ 1KYZA 1SVLA 1T33A 2DQRA 5LHIA 1POGA 1FOKA 2DAOA 1R6RA 2YX4A 5GTHC 5CLSA 1FYMA 1WWXA 2FMLA 2EA4A 2PMHA 1IN4A 3UKGA 2PX9A 1PP8F 5EZHA 4OINF 1K7AA 3E6BA 4XBFA 3C2BA 1Q1VA 5D5UB 3S3MA 3EYIA 4PJMA 2GOMA 1Z1DA 4L9TA 2DYRH 2E7WA 2KP6A 2BY1A 5ICFA 4LK1F 4LFUA 2P7CB 2QWWA 1ZH5A 1F1ZA 2WV1A 1MBHA 2X1DA 2M4GA 3QYEA 3L2VA 2ZJQF 1FBQA 1OCRH 3J7AO 1PYVA 2K9LA 2M5WA 4OMYA 2K40A 4MQVA 4U87A 1X58A 4BUPA 4F93B 4P55A 4I02A 4BH9A 2MC4A 3OYEA 3KEQA 2AQEA 2LOOA 5FGMA 2HYFA 2K4JA 2RKHA 3A02A 3IUOA 2EBIA 3V8LA 5M3FJ 4E70A 1J9IA 4EVIA 2ETHA 5FLVA 2HR3A 4AD9A 4IKFA 4YIFA 2DT6A 5FD6A 3S3NA 1MMDA 3X2QH 1A31A 2HWVA 3I56I 3FM3A 4HQEA 3A4CA 1ZR4A 2JA7J 3BR0A 1MBJA 1DGWY 4HA8A 3VDXA 1UG0A 4BEHA 2OQGA 3L09A 3TP0A 4JX5A 1TWCJ 4EJTA 4BAYA 2ZC2A 3W3CA 3KP2A 2V7FA 2M3AA 5CQEA 4Q47A 5BPDA 1SFKA 1DP3A 1QZZA 2QQ8A 3BP8A 4L0ZB 5IP9J 5L3CA 1HW5A 5CVUA 4ENJA 2LFBA 1RC9A 4PJJA 2YR2A 5LFAA 1VQKI 4BY1J 3CF5F 3SZTA 1MJAA 4E7SA 3OY9A 2VKDA 1H89C 3HRUA 1VQ6I 2QBYA 2M30A 1XSVA 4V19K 3HKZN 4W1UA 5FO5A 3H9GA 3CCEI 4YIRX 4KDPA 2NNYA 4GYIA 1O4XA 4CCLA 4Y15A 1APLC 1YO5C 1D5VA 2VBWA 4XNFA 2PQ8A 1FJLA 1JHHA 2DW4A 4PUSA 3VOEA 3CDIA 4HX8A 3Q0VA 4GO1A 2O8KA 3HM5A 2W57A 1ACIA 4ABZA 3W6KB 3I53A 3PIPF 1XTAA 4HRIA 1S7OA 4KICA 2O7OA 3M8FA 1O3TA 2WB1N 1ETWA 3HJEA 3CJNA 3G6EI 3M3YJ 1A6IA 3FXLA 3ECOA 3HOWJ 1K6YA 3FXMA 2QSGX 1YITI 4Z2YA 1BC8C 3ZQ7A 3F8NA 5J4VA 3HOZJ 2R7SA 3RCOA 4S04A 3DEEA 2K7LA 4XICA 5EYRA 2E7XA 4MGRA 2HDCA 4NB5A 2H8RA 1YIJI 1LDKB 1T6SA 1WJDA 5HDKA 4RAFA 2QZ8A 4G7ZF 1FSEA 5D6EA 5D5XB 2F5VA 2XGDA 4WXDA 3OYBA 1QA6A 1WFXA 3ROUA 2H6BA 3HTUA 4L9JA 2EFOA 2WAEA 2ELJA 2DA1A 2DA2A 2DMPA 1AU7A 1IN8A 3BQZA 1DU6A 1WSUA 2P6SA 5BNGA 2WBMA 4U0YA 3ERED 1F9NA 2DA6A 1PUFB 2FMYA 2H1KA 4I99C 3PUBA 2OF7A 4G8XA 4L5JA 3ABTA 2DA3A 5TRDA 3G73A 3W2AA 4HNVA 3BG6A 1QNTA 5C4XJ 3CDLA 1ZK8A 4UHTA 2EV0A 3N05A 4LG0A 1PVEA 4ZYEA 1EH7A 1PJRA 5J1UA 3E6DA 4EM0B 2MSYA 1VQ5I 1Z3YA 1R23A 3K4KA 3IKTA 2E2HJ 3CC2I 2DU9A 2A6TA 2IAIA 4NQWB 4BQOA 1UELB 1JUSA 2ZJPF 4E7HA 2KIUA 3HZJA 1BC7C 1X1PA 3NWSA 2E1MB 3QPLA 2K86A 2BW3B 3LSHA 1ON1A 2EFNA 2EFQA 4QLCU 4I0BA 5D8LB 2ZJRF 2E1OA 4N0BA 2FQ3A 1U0JA 1X19A 2FBKA 1R4NB 1YYVA 4RGXA 3KCCA 1FIPA 3ABKH 3FXUA 1Y39A 4HF0A 4UV8A 2HPIA 2VASA 3MMYB 2UUZA 1OQYA 2BZTA 5F64A 4GYGA 3T5XA 3CD6I 4BDZA 1TP4A 1K4TA 1B8IA 3CCMI 5CJ9A 5GPCA 1WI3A 2FD5A 3JCUC 1KU3A 4PCQA 3TL4X 3GFLA 1ZN2A 2Q8KA 2XHKA 4NDLA 3OYLA 1ITYA 1BA5A 2LBFA 1QQIA 1BL0A 2E1NA 3FHZA 4GFBA 4D7NA 1ZG3A 2IA0A 2EFPA 5IOZA 3KETA 2IP2A 2BHZA 4EMSA 2O6GE 3WHBA 2F5DA 2EZLA 4XLEA 5CPRB 4I2OA 3IKVA 4IPAA 3K0LA 2HDWA 2XDVA 3RTRA 2CYYA 1VTNC 3FXRA 3GUDA 1Q1HA 3VODA 3BTIA 1FP2A 3GTQJ 1B6AA 2ICWG 4MFEA 1VQ9I 2IS4A 1D0ZA 1KA8A 1S72I 1K6OA 2JA6J 3E1SA 3S2WA 4G12A 1U78A 3RPQA 4MQ9F 2AQFA 1YS6A 3IP4B 2Y0SN 4I98B 2FF4A 3MCZA 5F1JA 2BY0A 1MDMA 3WGHA 1A6QA 2COBA 4A0YA 1ODDA 2M0CA 1MKMA 5BPIA 2VQCA 4N9HA 1QO0D 3KX2A 1HSTA 1U2WA 5J1YA 2ID3A 3JAMK 1O3RA 2QM3A 4U7BA 2DBBA 5EG0B 2R7DA 5E17F 1GV5A 3PFIA 1Y1VJ 2JPCA 3V7CA 2Y75A 3CCVI 5DM6F 4IHTA 2ZFWA 3GTMJ 1RZ4A 1SD5A 1BIAA 1LJ9A 4XRSA 3JRFA 4H0EA 2UWMA 1BJZA 1MW7A 3K2ZA 3HRSA 4XSZF 1WJBA 2D1VA 3M4OJ 4FISA 2DJNA 2M1BA 1RR7A 4AUXA 3CUQC 5E8GA 4E4HA 2XRNA 4OOIA 2A6EF 4GGGA 4BL0B 4HDVA 4DJAA 3I4NJ 3CCRI 1O7LA 5FKNA 1R1VA 1N75A 1WJ5A 1UHWA 3TO9A 1F5TA 1YJ9I 5FROA 1BW5A 1ORKA 1VQ4I 1S9HA 2OUMA 1P7JA 3FZVA 1EF4A 1IN6A 5HOOA 1AA7A 3LSKA 3RKXA 1PP7U 2I8DA 2VN2A 4A3EJ 2KJBA 2M8GX 4HSRA 3G2BA 1HQCA 4BBRJ 2LR8A 5F0FA 2LYCA 5LBQA 1JT0A 2PFBA 2MG4A 3R4KA 3G71I 3R0AA 4A6DA 2V9KA 3SDGA 3RZOJ 2XPUA 1I39A 4CHUA 1KU9A 3ZQFA 3WTTC 3C18A 3PQJA 3OV8A 2Z33A 4N4NB 2DK5A 2MC3A 3Q3SA 2LG4A 3JAMZ 1LE8A 3LNQA 2G7UA 2NNNA 4CGZA 3R61A 2LKXA 2RAEA 3VYSB 2TCTA 2X6YA 2DFFA 3ESWB 5IYBJ 2CV1A 2A5YB 3BZCA 2R5YA 3MQ0A 5E20A 3E6MA 4WWCA 1S5LC 1RI7A 3EPZA 2E60A 3V8JA 3OR2C 4QIWN 2MW8A 1BOAA 4L18B 2VQLA 2V6EA 4RGUA 2CUZA 4FTHA 2DOFA 5FD5A 2I5UA 3DFGA 2LH9A 2AO9A 2CG4A 1IDYA 2M45A 2VKEA 1JKRC 1BN5A 1FTZA 1P2FA 2Q1ZB 4EEFG 3H1CA 4M74A 5F27A 5CVJA 2HPMA 1R7JA 4ENNA 2HYJA 2L3DA 3CUOA 3FK7A 1STZA 4XLHA 3ZXSA 1HKTA 4DBRA 1W0TA 5LRSA 2X51A 3LSGA 2VE9A 3KZIC 2FOWA 1BR4A 4CCJA 3LSTA 6PAXA 3LAJA 2L01A 3WGGA 3OSGA 3CLOA 1KGSA 2HVSA 2HQ5A 5IP7J 4HBLA 2L7KA 2AXTC 1OYWA 5EF6A 5E18F 5KNLA 3ZMTA 3QOPA 2KZVA 1SFOJ 1ERDA 2QENA 4RB3C 4I6ZA 4BHCA 2X9DA 1LFUP 3E5UA 3IAM2 3WTYC 3AL0C 4XLAA 2H8WA 3WTZA 5ED4A 2V1UA 5KVRA 2IBDA 3K1NA 4AIKA 1U8BA 2F5EA 2L9VA 2CGPA 2DA5A 1DDNA 1FYKA 3HC7A 2XGCA 2BVLA 2RGVA 3LSJA 2MYSA 4I7HA 1DPUA 4EGYA 2QUFA 1UJ8A 2JTVA 1NG7A 3OS0A 3MKZA 2EIJH 2AHQA 3BZKA 1ETVA 1SAXA 1B4AA 1HBXG 4KN4X 3JTGA 4I01A 2P8TA 3IH4A 5E1ZB 4D5FA 4ESFA 3MZHA 2ZMEC 2D1HA 4BACA 2L9RA 3BOQA 3CCUI 1EJ9A 5E3OA 2PMUA 3WE3A 4TV7A 1V5GA 3WHCA 3F21A 3BWGA 5LLQA 3F22A 2IS6A 2HTSA 3QYBA 3SDBA 3FISA 4UB6C 4F91B 4A12A 3FXJA 3RKYA 4CCKA 2CJJA 2EZIA 2DMUA 1HW2A 4JBAA 1T98A 3O8GA 1FSHA 2JWTA 2F5FA 2L9SA 5J8CA 2QKMB 3B6AA 4IF4A 1TWAJ 5D5VB 3ZRGA 2FJ1A 2NVYJ 1R58A 5KK1A 3H36A 2L7ZA 3CP2A 2XF5A 2ZFUA 1YW9A 3U2RA 3A1YA 4XRSG 1YTYA 3HDDA 2LMDA 1HDPA 2DFIA 4GRIA 3FMRA 4IRIA 5IYDJ 2L4MA 5LEJA 3ZMSA 3M7GA 3TEDA 1FZPB 2JSCA 4C2MJ 4AWXB 2OPTA 4NC7A 4NHJA 3I9V2 1VI0A 3S2DJ 3DV8A 1BR1A 3KLOA 1PUFA 2MLKA 3HOSA 1FIAA 1JT6A 2DFHA 4CA0A 2A05A 3QWLA 4M73A 1W7PD 3NRVA 3JSOA 2NVXJ 2ECBA 2GAUA 1WCMJ 2ESNA 4CZZA 2HI3A 3OOUA 1A5JA 2OC6A 2ZO4A 4B1RA 1GDTA 4P9FA 1ZGWA 1ZKGA 1W0UA 2KRCA 2VQGA 4AYBA 3L2WA 2A07F 3GVAA 2W48A 3JTHA 3E5QA 4EM1A 1HSJA 4E7KA 4BY7J 1DUXC 2KMUA 4CH7A 1X3ZB 4AC0A 4IHYA 3DBLB 5ICGA 1ZAOA 5DD8A 2V9PA 5GAHJ 2EFWA 1U3EM 1K61A 3PSFA 2XGXA 3GTKJ 2BOLA 2R7TA 4UVCA 1ZRFA 4Y17A 3F3XA 4FETA 3FXQA 3MAJA 2K9SA 3LFKA 1SD6A 1GT0C 1YLFA 3M8JA 3O8HA 5JLWA 5E8IA 2PMZA 1OLTA 3WU0A 3CJRB 4LLLA 3VB2A 3WU1B 3IH2A 2F5CA 4XL9A 3L7WA 2GLOA 3M8EA 1XMAA 3AG1H 3WTUC 1OCCH 4FX0A 2KISA 1HW1A 3BPVA 1Z9CA 1TL8A 2QKLB 3ISPA 1O3QA 3GZNB 4IOAF 4JQFA 4DYQA 1WHUA 1YX5A 3HRMA 3NWTA 1NK2P 3QRFF 1K79A 1Y1WJ 4XN3A 2XB0X 2X48A 1E0EA 2E71A 1N77A 1X1DA 2QCOA 2QYOA 1V5FA 2G0EA 3P9IA 4XKBA 3NQOA 3EUAA 2ZBKA 3R60A 4YEJA 5FKOA 1SEUA 4IVNA 1RRJA 4DIQA 4XLNF 1XSXA 1X3UA 2P7VB 2M8EA 1LEAA 3RI4A 5E3NA 1UZCA 4IX7A 2MH9A 2VIXA 3WG9A 3V7RA 2PG4A 3AG2H 1TT0A 4XLCA 2LD5A 1V5EA 3O6BB 3ZQGA 4AIHA 3BR1A 2FA5A 3D5LA 1Z6TA 2M34A 1MH3A 5HS8A 5JLXA 3ZQLA 4IHSA 3DF8A 5GTIC 4ASNA 4QWQA 1Z67A 3RDIA 3ZMUA 4BQNA 2P0WA 3OWTA 2B63J 1P4AA 1K78B 1MNEA 1I6HJ 4U7DA 1U5TA 1T56A 1TTYA 4BQAA 5D8KB 3KEOA 5H6QA 2E2IJ 4HV5A 2L4AA 5CVRA 4YFNF 4UUTA 3TO7A 1ETXA 1W5TA 2HYGD 1OFCX 2OV7A 1T2KA 5FB2A 2R0QC 3HPHA 4BE0A 5IPAA 1YRNA 3K2AA 2JVGA 1Z77A 3GX4X 2H1LA 1SVMA 3U9GA 1HC8A 3VWBA 2R7FA 4MIMA 3TDUC 3FIWA 2M4KA 5DDGA 5DCFA 1U9NA 5K7ZA 2KHMA 5CKTA 4LK0F 2Y30A 1ZQ3P 5TJJA 3BZ6A 3R0JA 4RMNA 3J7YJ 1B72A 1S7AA 3J80K 3BT9A 4MHGA 4V2FA 5F08A 4CICA 3ELKA 1W7PB 3COAC 1IZ1A 2LY2A 3HOYJ 1G2HA 2GOXB 3SFIA 3GTLJ 3BG5A 3CTAA 1AKHB 3KYDB 3PL8A 2WADA 3JR9A 2UXNA 4K2EA 2BY3A 3BLYA 4HX4A 3RPUD 4XR6A 2CQKA 3FXKA 3LSPA 2CWEA 5HODA 1Y0NA 2CRGA 2XAJA 1B59A 1RNLA 2IS1A 2RDPA 4G7HF 4M6YA 2Y69H 1MMNA 3HL2A 1ZG5A 4RAZA 2ZMEA 1WKMA 1IRZA 2VXDA 1J09A 2EV6A 3OS1A 1YX3A 3FHNA 1CF7A 1R1UA 1I5ZA 4XSXF 3TW7A 3H0DA 3L00A 3HUGB 3H9JA 1HA8A 3EYYA 3QQAA 3H92A 3S1RJ 3DQVC 3I4MJ 2ZXHA 2Z9OA 3LA2A 3W2WA 4CYDA 2NAZA 2LC2A 1X2MA 4BJTA 1W5CC 4PFPA 2XC7A 1C0WA 5LGTA 1MH4A 3BCAA 2WAQN 5EGOA 4YG2F 1XSDA 4KIBA 4E7ZA 1UCRA 2HXIA 4DYCA 2M2EA 4XIDA 1Z21A 1FP1D 2VODA 3MFKA 4WF2A 2MLGA 1D3YA 1OCOH 3F6OA 3FBNB 1IO2A 1MBFA 2BYVE 4B44A 5IOYA 5LGNA 5GAGJ 4NC6A 4ETSA 1YOVB 1MD0A 3QP6A 1WJAA 4U88A 4M6VA 1IN7A 3MZ8A 4HNUA 1FOYA 2DLLA 1REPC 4IHVA 1I1SA 3F23A 2HVRA 4DZJA 2IW5A 3F9KA 2R92J 4B09A 1KYWA 4KISA 1IXSB 3A0BC 5FLXK 2M7BA 4Y7NJ 5IYCJ 2W4SA 3I5UA 4XONA 4YFXF 4L9VA 2VOOA 4ZYAA 2NVTJ 2NS7A 2DFEA 2BEOA 3S93A 3JRBA 2Y0MA 4B4CA 4LB5A 4Q48A 4HDUA 1UAAA 1I6XA 4EM2A 3HSEA 4M3DA 1FT9A 3FMSA 5L3GA 2EV5A 4XOPA 5BS6A 4G94A 4AU7A 5K1YA 5D4RA 2HEOA 5DYMA 5HNHA 3HEFA 4ZYDA 1VQPI 3SQNA 2IS2A 3S32A 3CJQB 1BR2A 1V54H 1OYYA 2KIQA 3P7NA 4MO7A 1WPKA 3KYCB 1USTA 4F3QA 4MTDA 1YFHA 4Q5SF 3BY6A 2Z3YA 2CFXA 3KIOA 4N9IA 2QGUA 3BPXA 4F7ZA 1QHGA 2RNJA 1ZLKA 3I0TA 3N97A 5ERIA 4OAYA 2K5CA 3HHGA 1OISA 3LSMA 4LLNA 4KA4A 1BIBA 3I59B 3S1QJ 1ETYA 1R00A 3HBLA 1IV6A 4KN7X 2GXBA 2DMNA 1YIOA 3I54A 3RKWA 5LHHA 1XDSA 2R5ZB 2IJLA 3A01A 3EQLF 1P7IA 4DQ2A 1O3SA 1G3SA 1I3QJ 3CJTB 2HDDA 2X85A 2VB6A 4ZDLA 4F55A 2LVSA 4LLGF 3L2UA 1LFBA 3DCFA 5FKLA 4HSTA 3VEPA 4HPQA 3ASOH 4LB6B 5DCMA 2JA2A 4OIOF 2VBYA 5FFXA 4UUSB 2QA4I 3K4NA 4O3MA 4D0PA 2O03A 4IQ4A 1R5ID 3JSPA 2H6CA 2IA1A 1QVTA 1XGOA 3OIQA 1LB2A 2ZJ2A 1JXSA 3SHFA 4ANJA 3RYRA 1IJWC 2O5RA 4FT8A 3OYHA 1MZBA 2BXYA 2FUG2 4B8XA 4MEXF 3GLXA 3IRRA 3ZR8X 3HOXJ 3CO6C 4PSXA 3CC7I 4EQQA 3I58A 3IH3A 4QPQA 4CXFA 2ZSHB 4FE4A 2FBHA 1J5YA 1F36A 2Z1DA 4CUGA 2K02A 4PFOA 1I3AA 3CMMA 2ZCWA 1TLHB 2DT7B 3OYAA 5GADJ 3HOUJ 5JVGF 2LSOA 1H9TA 1UHSA 1XB4A 4F52A 3ABMH 1IV8A 3ZMZA 3JRAA 2KIFA 4A5MA 2HNHA 3I71A 3C3WA 3RQIA 3HYIA 2ELKA 3AKZA 3M9AA 4BU2A 2GZWA 4Q4ZF 2Q2EA 4M6XA 2RN7A 5E1WA 5TISC 1UHMA 2V1DA 1CGPA 1OCTC 1HDDC 4ZC3A 4A3MJ 1WQ2A 4IZZA 5FRMA 4A93J 4FE7A 5BMZA 1JJ8C 2EZHA 2DI3A 2PLYA 2EIKH 4Z6YA 2YU9J 3OIPA 5J3LA 3RZDJ 1F43A 2IA2A 2TDXA 4A3JJ 3KP4A 3U1DA 3K4BA 2PJRA 1BW6A 4PJNA 1R36A 2RVCA 3W6JB 1GVDA 1IXRC 5DTDA 2OZ6A 4LG3A 2VC0A 5KHDA 3ZN1A 4BE2A 1UG2A 1MGTA 1VQLI 3ABLH 4KMFA 3GO5A 2GXAA 4D7MA 4HF2A 5F0CA 3K70C 1E17A 2P5KA 2VE8A 1ETOA 3H3ZA 2DMQA 2YS9A 2ZNYA 3G1MA 5HS9A 3IHUA 3DBHB 3CC4I 1RESA 3ECHA 4II3A 2P4WA 3DLLF 3MWMA 3MKWB 4XLFA 2VJIA 3AL0B 1OPCA 4KT6A 2BY2A 3ZP5A 4XK4A 4YIIA 4LMYA 1FMWA 1Y56A 4RM3A 4XOTA 2XGEA 5IP6A 3DWLE 3REOA 1T8IA 4J01A 3KEYA 2WY8Q 3RYPA 1BI2A 5B66C 2LK2A 4BEHB 5L3FA 1KONA 2A69F 2K27A 3PO3J 2TRTA 3L9FA 3V4GA 2WY7Q 4OIRF 5JHUA 3KP6A 4YELA 2R7XA 5J1RA 4RGRA 3BQYA 1YJWI 1G8XA 2KLOA 2NS0A 3KZZA 4MEYF 4V2GA 4RS8A 2IGMA 3S17J 3PJRA 1ZG1A 4L5IA 2EINH 2JMWA 2XPVA 4HYEA 1P9QC 1Y0UA 3C2GA 5TGTA 3WTSC 2VUMJ 2L7MP 1J7KA 4FQGA 4G6QA 4ZJZA 2P5LC 4HLYA 1GXPA 3OSFA 2X6WA 1U5TC 2QBYB 5E79C 3MN2A 3EETA 1S6LA 2XF6A 4X6AJ 5JR3A 4NBQA 3S1NJ 1U9OA 3TOAA 3IWZA 2VLAA 4IHWA 1WJFA 4KYWA 1VNDA 3LOCA 1Y8RB 2EK5A 3OYGA 2RC4A 2J5OA 3IRQA 4KJZA 4D5CA 4EGZA 3VYTB 2KJCA 3TQNA 3ZQHA 1TT5B 1OYIA 1F4KA 2F4IA 4HNTA 1BM9A 2HQNA 4WK8F 3AAFA 3HXLA 5FKKA 1MMAA 3GFIA 3MEXA 1BI0A 3K1MA 4OAZA 4R8HA 1ZRCA 4KNYA 4BGDA 2LY9A 3LAPA 3CCQI 1JGSA 4BQQA 1WJCA 1ZREA 3V7SA 3T8TA 1QZYA 1FOWA 3D1NI 2DPDA 2BXZA 1GHCA 4M72A 5ILSA 4O6JA 4DNCA 1NTCA 1EA3A 4UNOA 4EV0A 1UB9A 3F8FA 1FOXA 1IW7F 2F4MB 4A0ZA 2X6XA 1ZR2A 2XF7A 3PFYA 2D2WA 1E3HA 2VONA 2JA5J 2E34A 2FEZA 2B7EA 4MNUA 4C3HJ 3E5XA 4A3FJ 1WJEA 3PM1A 4D1QA 5M5XJ 2RQPA 1MJ9A 3N4MA 2VJ4A 3OYMA 5AIPA 4BYYA 4WCGA 3FF5A 1D0YA 1TNTA 1TQMA 2EB7A 3F0CA 5KCMA 1A04A 3GCMA 2RREA 1IUFA 3QU3A 3DKYA 3ZMDA 3TO6A 2F6CA 3NARA 3R6SA 2LP0A 2JSPA 2R7VA 4C9YA 5HLGA 3OMYA 1IN5A 3WTXC 3S2HJ 4S05A 1TC3C 4LG0B 3VYUB 2Q0OA 2YPRA 5LD2C 2GA1A 4OMZA 3WE2A 3Q0UA 4P1WA 4LGWA 5M5WJ 1B1BA 2VT3A 2QF7A 1D5YA 4FHTA 3ZOBA 5A2QK 1D8JA 4A3KJ 2XAQA 3KE2A 2CS3A 5LRRA 1GUUA 5HNFA 1IDZA 1G4DA 2H27A 1VQNI 1U6GA 5L3BA 1OJLA 1RPWA 2STTA 1ZRDA 1FWZA 2OU2A 4RBOA 2G7HA 2XROA 1RUNA 1XGNA 2HGCA 1VZ0A 3B6CA 1QBJA 2HS5A 2OJED 2DDAA 3L2CA 4BNCA 3CQZJ 4IRGA 3EDPA 3H5AA 4I0AA 3OR1C 2VOPA 2IT0A 2XRLA 3ASNH 3DEWA 2R93J 1B8IB 2O8XA 4ESJA 1WH7A 3D0SA 5DM7F 3AFHA 3H3UA 1VQOI 3ZMVA 2ACJA 3HKZA 4P9UA 1SAUA 5JHFA 4UY8I 4KITB 2GIZA 1HF0A 1TNSA 2LBFB 1XS9A 3Q9VA 3WTWC 3L1PA 4ZZDA 2CQ7A 5IT9K 3O3KA 3BR3A 3I55I 4HEA2 2N8GA 4S0HB 3PNVA 1TW2A 2X1EA 1T39A 5DUKA 2F4OB 3BJOA 1HKQA 2HOAA 3K9TA 1Z0XA 3B02A 3GEZA 5FRNA 3JRHA 2R4GA 2HQRA 2C6YA 1FBUA 3OL3A 3Q0WA 2GIVA 3IAS2 2I10A 2WB1A 2RV8A 1T0FA 1VFCA 4NC8A 1D0XA 3GTGJ 3PO2J 4YFKF 4FX4A 2UZKA 1XC5A 3C1DA 1MJBA 2XSJC 5EZGA 4NQWA 4B43A 2DYSH 3LSRA 1RR8C 2Y2ZA 3SXYA 1EH8A 4X1EA 2BW3A 2G9WA 2HZDA 2K9QA 1X4PA 3HG9A 3ABUA 5FKMA 3OS2A 4HV6A 1H88C 2VQHA 3DXJF 4A6EA 4HQMA 1Z7LA 1MDMB 2HQAA 5J6XA 1SMYF 1IG7A 1JE8A 2Y48A 1OKRA 1B9NA 5EJCA 4BXFA 3H0GJ 2BGCA 5J8FA 4HLXA 1IRXA 2FOKA 1D1CA 4LIUA 2CMPA 4HOBA 3H5NA 3QODA 3UR3C 2V26A 4IRHA 4UVBA 3FKIJ 2Z16A 3DLAA 1MSEC 1SD7A 2JPBA 4GXOA 4D9JA 5HDNA 2DT5A 2FQ4A 3K6GA 1O57A 4HW0A 2DTRA 3HGYA 3MKLA 4BJ5C 5DUIA 3DBRB 2BV6A 4I09A 2DN0A 1NG6A 5IT9Z 3EUHC 3KP3A 2IPQX 1Z3XA 3V8KA 3GMEA 1BJAA 2Z2SB 2NS8A 3CLQA 3GTPJ 2W00A 2FXAA 2H94A 2VBXA 2K9NA 3DU6A 1JTYA 4JP0A 3E97A 1R9TJ 2XSDC 1MNDA 3I64A 2CV0A 2HOTA 3VFZA 4BHBA 1E2XA 3G4SI 1T95A 4M9XA 4DBQA 2EILH 5B5EC 4RLFA 1YHQI 1LVAA 1GLNA 3T8RA 2IXSA 2JRTA 1QHHD 4AVZA 2NRAC 2CV2A 3JRIA 1LPQA 4C30A 2CO5A 2WA0A 3AG4H 2JJ7A 1TQPA 3F72A 1SMTA 2KRHA 2CQNA 4MFDA 4EJOA 4EJWA 2DA4A 5ILVA 1ETKA 1EH6A 2O9LA 1SD4A 2M9HA 5KAFC 1FTTA 3OOPA 4CO8A 4GDFA 1USSA 2Y31A 3E3VA 4WX9A 1LKXA 2KDZA 2E5ZA 3WTVC 2IEKA 2K85A 3F8BA 4OIPF 1FY7A 2PBIA 5EG0A 2F2EA 4BJ6C 4J00A 3MZYA 1LE8B 1H9GA 4BKXA 1QPMA 4PSWA 9ANTA 2EA2A 1BI3A 2R5YB 3CMEI 3K4LA 3PNTA 4HF1A 4I76A 4M3EA 1H8AC 2ZXWH 5HS7A 3GTJJ 1PUEE 4LITA 1BBYA 1ENHA 2KZGA 3V42A 3ZCOA 1QZEA 3DTKA 3KYLA 2CSOA 2D45A 3F8CA 3RIRA 3OYIA 1CQTA 2Y0SA 1YQAA 3BDDA 1EV7A 3HRTA 2YX7A 5JI6A 1YI2I 2E5NA 4IQJA 2FNAA 5M5YJ 1SANA 3JREA 2R7ZJ 1X4OA 1FEXA 5CYVA 1ZYRF 3PQKA 2W24A 4A3LJ 2JA8J 5AIQA 4JX6A 5D6FA 4II2A 3J7AY 1TZLA 2CW7A 1LDJA 3RKQA 2ESHA 2PN6A 2WWYA 2BHYA 1R5HA 4P5OA 5DV5A 3FBIB 1J75A 3KLNA 3C2HA 2DJIA 2ME0A 2E19A 3FXOA 3QU6A 1N78A 5K5OA 2XPWA 3PUFA 2WC2A 1OMIA 4BXUA 2UXXA 5E3LA 4BE1A 2EIMH 4RLQA 2H09A 5K5RA 3K70D 2ZNZA 2CQXA 3RJPA 4F92B 2DA7A 3JRDA 4QSHA 4AVPA 5HLHA 2NOJB 2XAFA 2OCEA 2JK3A 1MNMC 4R79A 1E3PA 1R1TA 3HHHA 5GPAA 1XD7A 3H5RA 3D5RC 5JFRA 2KFDA 4KMUX 4AM3A 2VKHA 2EWNA 2XAGA 2NVUB 1JHFA 2B9SA 3NEUA 3P9KA 4QTRA 4E7JA 4XRMA 4ZH4F 3BJ6A 3BTJA 2NVQJ 4DW6A 2EJRA 3L2RA 2IGNA 3K10A 1AWCA 1TW3A 3WG7H 4ZZLA 4L9NA 1W36C 1V55H 2XIGA 1YJNI 2AXLA 2IGKA 4A0XA 4BXXJ 2V1NA 2XVCA 1X1CA 4UXNA 2A68F 2HU9A 1J2XA 3J80Z 1JI8A 2FE3A 3RQ4A 4C2TA 3IWFA 2XV4S 1TQIA 1MMSA 2LDUA 2CUJA 4XM3A 4X0GA 5H20A 2VXZA 1YW7A 2VPRA 3ZPLA 4U0VA 2LNBA 4UUVA 4JOMA 3BR2A 5EEHA 2JVHA 3OYNA 1ZARA 4M3GA 2JN6A 5K7FA 1HLVA 3TBIA 2YUSA 2P5VA 2JUGA 4CCMA 3A03A 4AYBN 1R4MB 2W84A 3F6VA 4AIDA 1X3WB 2ID6A 1YS7A 2DMTA 2W25A 2HTJA 2DCEA 1S7EA 1Z6RA 3S15J 2QLZA 1L3LA 2VJJA 4BHPA 1S29A 2GQQA 4B3AA 1R71A 4IHXA 1HOMA 4XORA 1RETA 2R7WA 4JYKA 2VPLA 4XRFA 1LEBA 5F04A 4NUBA 5C44J 2PMZN 2A5WA 5C4JJ 1YW8A 3C7JA 2XKOA 3FK6A 1OR7C 3F8MA 2BVMA 4CSWA 2CW0F 4A3GJ 2B0LA 1SVOA 4Y13A 1NHAA 1P6RA 3SJMA 3TOBA 2PEXA 4IJAA 3T1BA 2O0YA 1J0RA 2NXNB 2XAUA 3P9CA 2ZXIA 1LFPA 3HIFA 3J7ZI 2Z99A 3BCBA 3GFJA 4OWRB 1A35A 2A61A 4XQFA 4CYCB 2MGQA 1S3JA 4ZTFA 1BI1A 2X6OA 1QVUA 3ZQCA 4RGSA 2E35A 2AS5F 2X1CA 1IRGA 3KFWX 4KIGA 2L7FP 4EATA 3W6VA 3QPSA 4Y52J 4LIVA 1ULYA 3FX3A 1IUYA 1FMVA 3CUQB 1IF1A 3G1OA 1LQ1A 3EUHA 3MD2A 5FLXZ 5DEQA 3TW6A 1MBKA 5K5QA 4ON0A 4B47A 2DDBA 2V1XA 3LSIA 4OIQF 1Y8QB 2OD5A 3SZGA 1D1AA 2J5PA 3B73A 2VKVA 3BR6A 2FBIA 2L5QA 2MD5A 3BR5A 2HOEA 1KU2A 3TP3A 4XKVA 3PNYA 3CO7C 1ZELA 2FNPA 3FDYA 1DP7P 1X1AA 4HX7A 4EJUA 1XDUA 2MABA 2OZUA 5M3MJ 1ZHFA 4PGHA 4IEJA 4C3JJ 2KRFA 1SFEA 5IT3A 3OYDA 5J47A 3CMYA 3DP7A 2EH3A 4ITVA 1FC3A 4XMYA 1JTXA 3SYTA 1GVJA 3SFZA 2L0KA 4FCYA 2FU4A 2W1OA 4ZYHA 3DTIA 1MSFC 1XGSA 4RB1A 2V79A 1KQ8A 4ENMA 3S1MJ 2D5VA 3FWEA 2WTEA 3UNGC 1XCBA 1YE9A 4A3IJ 1JKOC 1IC8A 1ON2A 1ZGAA 3JRGA 4DGWB 3GTOJ 1UMQA 1VQ7I 5ICCA 4IL6C 3NAUA 3BG3A 4M3FA 1N25A 5EEGA 1T0FC 1QU3A 2R3SA 1ZLJA 2RQQA 3BC8A 4MTEA 3K4CA 1FYLA 1D8KA 3HB9A 3JRCA 3LA3A 1HKSA 1IGNA 3CCLI 2OTLI 4CCNA 3OYKA 1W4MA 4KFCA 4JX4A 4A5NA 1RKWA 1KQ0A 5B1AH 3CMAI 2PJPA 2E1MC 1G3YA 2OAZA 3BJAA 3LWFA 2ISZA 3M07A 2CH0A 3BG9A 3QOEA 5ILUA 3E6CC 2QSHX 4XLPF 3CDHA 5J4YA 1MBEA 3LFUA 2LLKA 1U5TB 2MD0A 2FX0A 2A3SA 2KIMA 4WXHA 4CCOA 5FLMJ 2DQLA 3FMQA 2KL4A 3G1LA 1EKEA 5DS9A 2X0LA 2HXOA 2E1CA 3K69A 3TDZC 2V9VA 2A6HF 3QP5A 1YRNB 2IVMA 3E0JB 5HLIA 3GF2A 2PI0A 3WU2C 1R49A 2JT1A 3KPHA 1LUJB 3Q5FA 1JKQC 5GAEJ 1IRFA 2LRDA 2YU3A 1G3WA 1L0OC 1S8NA 2HFHA 1JKPC 5B1BH 3WODF 2MA3A 5C3EJ 1LDDA 3ULQB 3GLLA 4E7LA 3H9QA 1B72B 1ZTRA 1KQ9A 2M87A 2L54A 4RM2A 3M1EA 5IY5H 1JUMA 1O7FA 4UV9A 4ESBA 1FPQA 1NK3P 1FLIA 2XAHA 5JVTA 4G6DA 1V4RA 3SZPA 1B9MA 5L3EA 1G3TA 3J81K 2O61A 3DTEA 3S3OA 1OCPA 1AOYA 2OQRA 1G59A 2CUFA 2QQ9A 1DU0A 3CESA 2OTJI 2UV1A 1GV2A 1P4WA 2HZTA 2Z5UA 2IRFG 1TWFJ 2STWA 3OL4A 1K78A 4RB2C 1TWHJ 5GP9A 1Z7UA 2OBPA 5L3DA 4E6KG 2ZMEB 2WAFA 1HCRA 1Z05A 1CF7B 4AIJA 3QYFA 1DPRA 5B3SH 3T0YA 4L0YB 1G6NA 2F48A 2EPFA 2HKOA 3LA7A 4J19A 2P6TA 2VI6A 3SEZA 1DGRM 5H6RA 3FKJA 5H2FC 3I3LA 3M1CA 4GCVA 3VPRA 2W82A 4UB8C 2O3FA 2OCCH 3CCSI 3JW4A 4O5VA 3TGNA 2R7UA 1XCVA 1KU7A 5EGOB 4BS9A 1HXDA 1DQUA 2IGOA 4IO9F 1T38A 3GZ5A 4RDUA 1A36A 2V4JC 3CCJI 3Q9SA 2VL8A 4PGGA 2CU7A 3DKWA 1XGMA 4B48A 2HKXA 4A69C 3RSNA 1D1BA 1M1EB 3HOTA 5D4SA 3BG7A 4XKWA 1W7PA 2DOEA 2L9NA 4ZDPA 5E3MA 2QVOA 1ETQA 2ADUA 1R22A 2L02A 3DPLC 2M7AA 1GXQA 3MVPA 4IXAA 2HOSA 5HDGA 4M3BA 3GW2A 1AKHA 3VSKA 2QSFX 2CUEA 4XKCA 3S16J 3HSRA 4L5EA 4C2UA 3IC7A 2L2OA 2XKPA 4XN0A 4KUMA 4LD5A 5BQTA 3J81Z 3QAHA 4BBSJ 4BDYA 1PDNC 1Y6IA 1NH3A 3I4PA 2DODA 1OR7A 2GXGA 3GXOA 4H4KC 3TMOA 1UFMA 1I27A 2GWRA 2WV0A 1XG1A 4R1HA 4HG2A 4UVAA 3VYRB 2DO7A 3OYCA 4C3IJ 3KP7A 1XN7A 4A3BJ 3AG3H 3DPTA 2R7QA 3A2KA 3CP8A 3HUGA 3E7LA 1P4XA 4DOZA 1RIOH 2LKSA 4NNJA 4N4OB 5ICEA 3IV5A 3LL7A 4G6TB 3BTLA 3ONQA 2K9MA 4A2UA 2GM4A 4PZJA 5HVQC 5E1XA 3H35A 1XMXA 3IL2A 1QRYA 2CFOA 2HVQA 2KDOA 1AHDP 2KQRA 2VT2A 4A3DJ 1JGGA 2DOAA 1XPXA 2OA4A 2K3FA 4M9SA 5KAIC 1H0MA 4Y33A 4KT5C 2KKOA 2ZXJA 3A0HC 2ISYA 4FASD 4KIFA 1E3OC 3BTCA 3P5JA 5BOXA 1SFUA 1VQ8I 2DPUA 3GZ6A 2LKPA 4M71A 4WXCA 3CZ6A 3DU5A 4LOCA 3A01B 2M0MA 5DD4A 2FSWA 1SC7A 3KZYA 3HOVJ 2X4HA 2LTPA 1QGPA 1WZ2A 2RNGA 3GYHX 1J59A 4Y4RA 3VSLA 1U8RA 3U21A 2VC1A 4DYRA 5DCMB 4ZTJA 1RUOA 4LJZF 1ONVA 1YG2A 3S8PA 2E36A 3DKXA 2GA2A 1WI9A 2BE5F 1I1GA 1W36D 3BROA 1BOBA 2WAQA 5HLTA 1WGXA 4PJ0C 3S14J 1FNNA 1MIJA 5F1RA 2R7OA 1W5SA 4HZFA 4ZYGA 2BBYA 5F6FA 2E2JJ 2QQBA 3OYFA 3CF2A 3GBGA 3ZQQA 3K4JA 3OYJA 3OIOA 1WH5A 2QQAA 3O2PE 1R5GA 2MFZA 3K4MA 5D5WB 2KT0A 5FFZA 2DK8A 4Y3OA 5LHGA 2QEXI 4G7OF 4QPOA 1VF9A 4W97A 2MH2A 2XUBA 3WGIA 1K83J 1VQMI 3GWZA 5EEAA 1V3FA 1JUPA 2ELHA 2GBYA 2MBFA 4IOCF 1WVRA 3I59A 2V6CA 5CVIA 3PIOF 4MLOA 3ZGKA 5CVVA 5A2QZ 3ERMA 4PK4A 2ZB9A 3H3VK 1FX7A 1IAWA 3DEUA 3ZN0A 4RAYA 4U0WA 1FBSA 3GFMA 1P92A 4CZCA 2JQ7A 2VJ5A 1K4SA 2KPMA 3QPHA 4OU0A 4PDKA 1W1WE 4PJLA 4ENKA 3HTSB 2K3PA 2R5ZA 1LNWA 3L2QA 3EUKL 3HPGA 2FRHA 2Q2EB 3ML6A 4CYCA 2W7NA 1OCZH 1KZHA 4DZPA 3SEQA 4YRVA 5K7HA 2CQQA 3LQQA 2COMA 2NOGA 2P81A 3MKYB 3K1PA 1X1BA 2EZKA 4M9ZA 1T08B 2JRMA 2VBZA 2YSRA 5LEKA 4UUSA 3D5SC 3CUQA 1MBGA 3HSFA 5F0HA 1SFXA 2ZKZA 1TBXA 2LY1A 4RB0A 4E7IA 2ECCA 4RAGA 2NYXA 4HAMA 3PSIA 3RPUA 3FM5A 4JK1X 1XX5A 2PJRB 2R7RA 2CW8A 1JJ6C 1IXCA 2JZYA 2Y9ZA 3ZQIA 2XB5A
chains in the Genus database with same CATH topology
3I55I 2OTJI 1YJNI 1YJ9I 1VQ4I 2ZJRF 5GAHJ 1VQ8I 1Y39A 1VQPI 1VQKI 1MMSA 3J7YJ 3CD6I 3CF5F 3CCMI 3CCQI 1VQ6I 3CMEI 4V19K 1FOWA 2E36A 3CCEI 1VQ7I 3CCUI 3G71I 3CCSI 1FOXA 4IOAF 2E34A 1VQLI 2OTLI 3CCLI 4IO9F 1YI2I 1ACIA 3PIPF 3CMAI 3CCJI 3CJTB 3CC4I 3G6EI 3DLLF 2QEXI 2ZJQF 1YITI 1VQ9I 1S72I 2QA4I 1VQMI 4IOCF 1YIJI 3PIOF 2NXNB 2JQ7A 1QA6A 3J7ZI 5GAEJ 5GAGJ 1YJWI 2E35A 1VQNI 3CC7I 2FOWA 3G4SI 1FOYA 3CCVI 1YHQI 5DM6F 3I56I 5GADJ 5JVGF 5DM7F 1VQOI 1VQ5I 3CC2I 2H8WA 4UY8I 2ZJPF 3CCRI 2K3FA 1HC8A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3I55 I;  2OTJ I;  1YJN I;  1YJ9 I;  1VQ4 I;  2ZJR F;  5GAH J;  1VQ8 I;  1Y39 A;  1VQP I;  1VQK I;  1MMS A;  3J7Y J;  3CD6 I;  3CF5 F;  3CCM I;  3CCQ I;  1VQ6 I;  3CME I;  4V19 K;  1FOW A;  2E36 A;  3CCE I;  1VQ7 I;  3CCU I;  3G71 I;  3CCS I;  1FOX A;  4IOA F;  2E34 A;  1VQL I;  2OTL I;  3CCL I;  4IO9 F;  1YI2 I;  1ACI A;  3PIP F;  3CMA I;  3CCJ I;  3CJT B;  3CC4 I;  3G6E I;  3DLL F;  2QEX I;  2ZJQ F;  1YIT I;  1VQ9 I;  1S72 I;  2QA4 I;  1VQM I;  4IOC F;  1YIJ I;  3PIO F;  2NXN B;  2JQ7 A;  1QA6 A;  3J7Z I;  5GAE J;  5GAG J;  1YJW I;  2E35 A;  1VQN I;  3CC7 I;  2FOW A;  3G4S I;  1FOY A;  3CCV I;  1YHQ I;  5DM6 F;  3I56 I;  5GAD J;  5JVG F;  5DM7 F;  1VQO I;  1VQ5 I;  3CC2 I;  2H8W A;  4UY8 I;  2ZJP F;  3CCR I;  2K3F A;  1HC8 A; 
#chains in the Genus database with same CATH topology
 2W85 A;  3DPU A;  1QPI A;  3QPT A;  4CDG A;  4RA2 A;  3LQR A;  4G9Y A;  4ZDO A;  3G3Z A;  1LVK A;  1I50 J;  2EQR A;  5CQG A;  2ME6 A;  4B3X A;  2XAS A;  2DXI A;  2DTZ A;  2LRE A;  5J40 A;  1Z91 A;  1RKT A;  1X2N A;  3CCY A;  3U1K A;  4A3C J;  1WRJ A;  5FJ8 J;  2K4B A;  3KP5 A;  5LGU A;  1XMK A;  2ZSI B;  2LF7 A;  3HGG A;  2LF8 A;  3K7A J;  5AON A;  1MMG A;  4P96 A;  3TKY A;  1ZGJ A;  4EJV A;  3W2V A;  2JUC A;  2Y9Y A;  5EDN A;  3LMM A;  1TWG J;  1KYZ A;  1SVL A;  1T33 A;  2DQR A;  5LHI A;  1POG A;  1FOK A;  2DAO A;  1R6R A;  2YX4 A;  5GTH C;  5CLS A;  1FYM A;  1WWX A;  2FML A;  2EA4 A;  2PMH A;  1IN4 A;  3UKG A;  2PX9 A;  1PP8 F;  5EZH A;  4OIN F;  1K7A A;  3E6B A;  4XBF A;  3C2B A;  1Q1V A;  5D5U B;  3S3M A;  3EYI A;  4PJM A;  2GOM A;  1Z1D A;  4L9T A;  2DYR H;  2E7W A;  2KP6 A;  2BY1 A;  5ICF A;  4LK1 F;  4LFU A;  2P7C B;  2QWW A;  1ZH5 A;  1F1Z A;  2WV1 A;  1MBH A;  2X1D A;  2M4G A;  3QYE A;  3L2V A;  2ZJQ F;  1FBQ A;  1OCR H;  3J7A O;  1PYV A;  2K9L A;  2M5W A;  4OMY A;  2K40 A;  4MQV A;  4U87 A;  1X58 A;  4BUP A;  4F93 B;  4P55 A;  4I02 A;  4BH9 A;  2MC4 A;  3OYE A;  3KEQ A;  2AQE A;  2LOO A;  5FGM A;  2HYF A;  2K4J A;  2RKH A;  3A02 A;  3IUO A;  2EBI A;  3V8L A;  5M3F J;  4E70 A;  1J9I A;  4EVI A;  2ETH A;  5FLV A;  2HR3 A;  4AD9 A;  4IKF A;  4YIF A;  2DT6 A;  5FD6 A;  3S3N A;  1MMD A;  3X2Q H;  1A31 A;  2HWV A;  3I56 I;  3FM3 A;  4HQE A;  3A4C A;  1ZR4 A;  2JA7 J;  3BR0 A;  1MBJ A;  1DGW Y;  4HA8 A;  3VDX A;  1UG0 A;  4BEH A;  2OQG A;  3L09 A;  3TP0 A;  4JX5 A;  1TWC J;  4EJT A;  4BAY A;  2ZC2 A;  3W3C A;  3KP2 A;  2V7F A;  2M3A A;  5CQE A;  4Q47 A;  5BPD A;  1SFK A;  1DP3 A;  1QZZ A;  2QQ8 A;  3BP8 A;  4L0Z B;  5IP9 J;  5L3C A;  1HW5 A;  5CVU A;  4ENJ A;  2LFB A;  1RC9 A;  4PJJ A;  2YR2 A;  5LFA A;  1VQK I;  4BY1 J;  3CF5 F;  3SZT A;  1MJA A;  4E7S A;  3OY9 A;  2VKD A;  1H89 C;  3HRU A;  1VQ6 I;  2QBY A;  2M30 A;  1XSV A;  4V19 K;  3HKZ N;  4W1U A;  5FO5 A;  3H9G A;  3CCE I;  4YIR X;  4KDP A;  2NNY A;  4GYI A;  1O4X A;  4CCL A;  4Y15 A;  1APL C;  1YO5 C;  1D5V A;  2VBW A;  4XNF A;  2PQ8 A;  1FJL A;  1JHH A;  2DW4 A;  4PUS A;  3VOE A;  3CDI A;  4HX8 A;  3Q0V A;  4GO1 A;  2O8K A;  3HM5 A;  2W57 A;  1ACI A;  4ABZ A;  3W6K B;  3I53 A;  3PIP F;  1XTA A;  4HRI A;  1S7O A;  4KIC A;  2O7O A;  3M8F A;  1O3T A;  2WB1 N;  1ETW A;  3HJE A;  3CJN A;  3G6E I;  3M3Y J;  1A6I A;  3FXL A;  3ECO A;  3HOW J;  1K6Y A;  3FXM A;  2QSG X;  1YIT I;  4Z2Y A;  1BC8 C;  3ZQ7 A;  3F8N A;  5J4V A;  3HOZ J;  2R7S A;  3RCO A;  4S04 A;  3DEE A;  2K7L A;  4XIC A;  5EYR A;  2E7X A;  4MGR A;  2HDC A;  4NB5 A;  2H8R A;  1YIJ I;  1LDK B;  1T6S A;  1WJD A;  5HDK A;  4RAF A;  2QZ8 A;  4G7Z F;  1FSE A;  5D6E A;  5D5X B;  2F5V A;  2XGD A;  4WXD A;  3OYB A;  1QA6 A;  1WFX A;  3ROU A;  2H6B A;  3HTU A;  4L9J A;  2EFO A;  2WAE A;  2ELJ A;  2DA1 A;  2DA2 A;  2DMP A;  1AU7 A;  1IN8 A;  3BQZ A;  1DU6 A;  1WSU A;  2P6S A;  5BNG A;  2WBM A;  4U0Y A;  3ERE D;  1F9N A;  2DA6 A;  1PUF B;  2FMY A;  2H1K A;  4I99 C;  3PUB A;  2OF7 A;  4G8X A;  4L5J A;  3ABT A;  2DA3 A;  5TRD A;  3G73 A;  3W2A A;  4HNV A;  3BG6 A;  1QNT A;  5C4X J;  3CDL A;  1ZK8 A;  4UHT A;  2EV0 A;  3N05 A;  4LG0 A;  1PVE A;  4ZYE A;  1EH7 A;  1PJR A;  5J1U A;  3E6D A;  4EM0 B;  2MSY A;  1VQ5 I;  1Z3Y A;  1R23 A;  3K4K A;  3IKT A;  2E2H J;  3CC2 I;  2DU9 A;  2A6T A;  2IAI A;  4NQW B;  4BQO A;  1UEL B;  1JUS A;  2ZJP F;  4E7H A;  2KIU A;  3HZJ A;  1BC7 C;  1X1P A;  3NWS A;  2E1M B;  3QPL A;  2K86 A;  2BW3 B;  3LSH A;  1ON1 A;  2EFN A;  2EFQ A;  4QLC U;  4I0B A;  5D8L B;  2ZJR F;  2E1O A;  4N0B A;  2FQ3 A;  1U0J A;  1X19 A;  2FBK A;  1R4N B;  1YYV A;  4RGX A;  3KCC A;  1FIP A;  3ABK H;  3FXU A;  1Y39 A;  4HF0 A;  4UV8 A;  2HPI A;  2VAS A;  3MMY B;  2UUZ A;  1OQY A;  2BZT A;  5F64 A;  4GYG A;  3T5X A;  3CD6 I;  4BDZ A;  1TP4 A;  1K4T A;  1B8I A;  3CCM I;  5CJ9 A;  5GPC A;  1WI3 A;  2FD5 A;  3JCU C;  1KU3 A;  4PCQ A;  3TL4 X;  3GFL A;  1ZN2 A;  2Q8K A;  2XHK A;  4NDL A;  3OYL A;  1ITY A;  1BA5 A;  2LBF A;  1QQI A;  1BL0 A;  2E1N A;  3FHZ A;  4GFB A;  4D7N A;  1ZG3 A;  2IA0 A;  2EFP A;  5IOZ A;  3KET A;  2IP2 A;  2BHZ A;  4EMS A;  2O6G E;  3WHB A;  2F5D A;  2EZL A;  4XLE A;  5CPR B;  4I2O A;  3IKV A;  4IPA A;  3K0L A;  2HDW A;  2XDV A;  3RTR A;  2CYY A;  1VTN C;  3FXR A;  3GUD A;  1Q1H A;  3VOD A;  3BTI A;  1FP2 A;  3GTQ J;  1B6A A;  2ICW G;  4MFE A;  1VQ9 I;  2IS4 A;  1D0Z A;  1KA8 A;  1S72 I;  1K6O A;  2JA6 J;  3E1S A;  3S2W A;  4G12 A;  1U78 A;  3RPQ A;  4MQ9 F;  2AQF A;  1YS6 A;  3IP4 B;  2Y0S N;  4I98 B;  2FF4 A;  3MCZ A;  5F1J A;  2BY0 A;  1MDM A;  3WGH A;  1A6Q A;  2COB A;  4A0Y A;  1ODD A;  2M0C A;  1MKM A;  5BPI A;  2VQC A;  4N9H A;  1QO0 D;  3KX2 A;  1HST A;  1U2W A;  5J1Y A;  2ID3 A;  3JAM K;  1O3R A;  2QM3 A;  4U7B A;  2DBB A;  5EG0 B;  2R7D A;  5E17 F;  1GV5 A;  3PFI A;  1Y1V J;  2JPC A;  3V7C A;  2Y75 A;  3CCV I;  5DM6 F;  4IHT A;  2ZFW A;  3GTM J;  1RZ4 A;  1SD5 A;  1BIA A;  1LJ9 A;  4XRS A;  3JRF A;  4H0E A;  2UWM A;  1BJZ A;  1MW7 A;  3K2Z A;  3HRS A;  4XSZ F;  1WJB A;  2D1V A;  3M4O J;  4FIS A;  2DJN A;  2M1B A;  1RR7 A;  4AUX A;  3CUQ C;  5E8G A;  4E4H A;  2XRN A;  4OOI A;  2A6E F;  4GGG A;  4BL0 B;  4HDV A;  4DJA A;  3I4N J;  3CCR I;  1O7L A;  5FKN A;  1R1V A;  1N75 A;  1WJ5 A;  1UHW A;  3TO9 A;  1F5T A;  1YJ9 I;  5FRO A;  1BW5 A;  1ORK A;  1VQ4 I;  1S9H A;  2OUM A;  1P7J A;  3FZV A;  1EF4 A;  1IN6 A;  5HOO A;  1AA7 A;  3LSK A;  3RKX A;  1PP7 U;  2I8D A;  2VN2 A;  4A3E J;  2KJB A;  2M8G X;  4HSR A;  3G2B A;  1HQC A;  4BBR J;  2LR8 A;  5F0F A;  2LYC A;  5LBQ A;  1JT0 A;  2PFB A;  2MG4 A;  3R4K A;  3G71 I;  3R0A A;  4A6D A;  2V9K A;  3SDG A;  3RZO J;  2XPU A;  1I39 A;  4CHU A;  1KU9 A;  3ZQF A;  3WTT C;  3C18 A;  3PQJ A;  3OV8 A;  2Z33 A;  4N4N B;  2DK5 A;  2MC3 A;  3Q3S A;  2LG4 A;  3JAM Z;  1LE8 A;  3LNQ A;  2G7U A;  2NNN A;  4CGZ A;  3R61 A;  2LKX A;  2RAE A;  3VYS B;  2TCT A;  2X6Y A;  2DFF A;  3ESW B;  5IYB J;  2CV1 A;  2A5Y B;  3BZC A;  2R5Y A;  3MQ0 A;  5E20 A;  3E6M A;  4WWC A;  1S5L C;  1RI7 A;  3EPZ A;  2E60 A;  3V8J A;  3OR2 C;  4QIW N;  2MW8 A;  1BOA A;  4L18 B;  2VQL A;  2V6E A;  4RGU A;  2CUZ A;  4FTH A;  2DOF A;  5FD5 A;  2I5U A;  3DFG A;  2LH9 A;  2AO9 A;  2CG4 A;  1IDY A;  2M45 A;  2VKE A;  1JKR C;  1BN5 A;  1FTZ A;  1P2F A;  2Q1Z B;  4EEF G;  3H1C A;  4M74 A;  5F27 A;  5CVJ A;  2HPM A;  1R7J A;  4ENN A;  2HYJ A;  2L3D A;  3CUO A;  3FK7 A;  1STZ A;  4XLH A;  3ZXS A;  1HKT A;  4DBR A;  1W0T A;  5LRS A;  2X51 A;  3LSG A;  2VE9 A;  3KZI C;  2FOW A;  1BR4 A;  4CCJ A;  3LST A;  6PAX A;  3LAJ A;  2L01 A;  3WGG A;  3OSG A;  3CLO A;  1KGS A;  2HVS A;  2HQ5 A;  5IP7 J;  4HBL A;  2L7K A;  2AXT C;  1OYW A;  5EF6 A;  5E18 F;  5KNL A;  3ZMT A;  3QOP A;  2KZV A;  1SFO J;  1ERD A;  2QEN A;  4RB3 C;  4I6Z A;  4BHC A;  2X9D A;  1LFU P;  3E5U A;  3IAM 2;  3WTY C;  3AL0 C;  4XLA A;  2H8W A;  3WTZ A;  5ED4 A;  2V1U A;  5KVR A;  2IBD A;  3K1N A;  4AIK A;  1U8B A;  2F5E A;  2L9V A;  2CGP A;  2DA5 A;  1DDN A;  1FYK A;  3HC7 A;  2XGC A;  2BVL A;  2RGV A;  3LSJ A;  2MYS A;  4I7H A;  1DPU A;  4EGY A;  2QUF A;  1UJ8 A;  2JTV A;  1NG7 A;  3OS0 A;  3MKZ A;  2EIJ H;  2AHQ A;  3BZK A;  1ETV A;  1SAX A;  1B4A A;  1HBX G;  4KN4 X;  3JTG A;  4I01 A;  2P8T A;  3IH4 A;  5E1Z B;  4D5F A;  4ESF A;  3MZH A;  2ZME C;  2D1H A;  4BAC A;  2L9R A;  3BOQ A;  3CCU I;  1EJ9 A;  5E3O A;  2PMU A;  3WE3 A;  4TV7 A;  1V5G A;  3WHC A;  3F21 A;  3BWG A;  5LLQ A;  3F22 A;  2IS6 A;  2HTS A;  3QYB A;  3SDB A;  3FIS A;  4UB6 C;  4F91 B;  4A12 A;  3FXJ A;  3RKY A;  4CCK A;  2CJJ A;  2EZI A;  2DMU A;  1HW2 A;  4JBA A;  1T98 A;  3O8G A;  1FSH A;  2JWT A;  2F5F A;  2L9S A;  5J8C A;  2QKM B;  3B6A A;  4IF4 A;  1TWA J;  5D5V B;  3ZRG A;  2FJ1 A;  2NVY J;  1R58 A;  5KK1 A;  3H36 A;  2L7Z A;  3CP2 A;  2XF5 A;  2ZFU A;  1YW9 A;  3U2R A;  3A1Y A;  4XRS G;  1YTY A;  3HDD A;  2LMD A;  1HDP A;  2DFI A;  4GRI A;  3FMR A;  4IRI A;  5IYD J;  2L4M A;  5LEJ A;  3ZMS A;  3M7G A;  3TED A;  1FZP B;  2JSC A;  4C2M J;  4AWX B;  2OPT A;  4NC7 A;  4NHJ A;  3I9V 2;  1VI0 A;  3S2D J;  3DV8 A;  1BR1 A;  3KLO A;  1PUF A;  2MLK A;  3HOS A;  1FIA A;  1JT6 A;  2DFH A;  4CA0 A;  2A05 A;  3QWL A;  4M73 A;  1W7P D;  3NRV A;  3JSO A;  2NVX J;  2ECB A;  2GAU A;  1WCM J;  2ESN A;  4CZZ A;  2HI3 A;  3OOU A;  1A5J A;  2OC6 A;  2ZO4 A;  4B1R A;  1GDT A;  4P9F A;  1ZGW A;  1ZKG A;  1W0U A;  2KRC A;  2VQG A;  4AYB A;  3L2W A;  2A07 F;  3GVA A;  2W48 A;  3JTH A;  3E5Q A;  4EM1 A;  1HSJ A;  4E7K A;  4BY7 J;  1DUX C;  2KMU A;  4CH7 A;  1X3Z B;  4AC0 A;  4IHY A;  3DBL B;  5ICG A;  1ZAO A;  5DD8 A;  2V9P A;  5GAH J;  2EFW A;  1U3E M;  1K61 A;  3PSF A;  2XGX A;  3GTK J;  2BOL A;  2R7T A;  4UVC A;  1ZRF A;  4Y17 A;  3F3X A;  4FET A;  3FXQ A;  3MAJ A;  2K9S A;  3LFK A;  1SD6 A;  1GT0 C;  1YLF A;  3M8J A;  3O8H A;  5JLW A;  5E8I A;  2PMZ A;  1OLT A;  3WU0 A;  3CJR B;  4LLL A;  3VB2 A;  3WU1 B;  3IH2 A;  2F5C A;  4XL9 A;  3L7W A;  2GLO A;  3M8E A;  1XMA A;  3AG1 H;  3WTU C;  1OCC H;  4FX0 A;  2KIS A;  1HW1 A;  3BPV A;  1Z9C A;  1TL8 A;  2QKL B;  3ISP A;  1O3Q A;  3GZN B;  4IOA F;  4JQF A;  4DYQ A;  1WHU A;  1YX5 A;  3HRM A;  3NWT A;  1NK2 P;  3QRF F;  1K79 A;  1Y1W J;  4XN3 A;  2XB0 X;  2X48 A;  1E0E A;  2E71 A;  1N77 A;  1X1D A;  2QCO A;  2QYO A;  1V5F A;  2G0E A;  3P9I A;  4XKB A;  3NQO A;  3EUA A;  2ZBK A;  3R60 A;  4YEJ A;  5FKO A;  1SEU A;  4IVN A;  1RRJ A;  4DIQ A;  4XLN F;  1XSX A;  1X3U A;  2P7V B;  2M8E A;  1LEA A;  3RI4 A;  5E3N A;  1UZC A;  4IX7 A;  2MH9 A;  2VIX A;  3WG9 A;  3V7R A;  2PG4 A;  3AG2 H;  1TT0 A;  4XLC A;  2LD5 A;  1V5E A;  3O6B B;  3ZQG A;  4AIH A;  3BR1 A;  2FA5 A;  3D5L A;  1Z6T A;  2M34 A;  1MH3 A;  5HS8 A;  5JLX A;  3ZQL A;  4IHS A;  3DF8 A;  5GTI C;  4ASN A;  4QWQ A;  1Z67 A;  3RDI A;  3ZMU A;  4BQN A;  2P0W A;  3OWT A;  2B63 J;  1P4A A;  1K78 B;  1MNE A;  1I6H J;  4U7D A;  1U5T A;  1T56 A;  1TTY A;  4BQA A;  5D8K B;  3KEO A;  5H6Q A;  2E2I J;  4HV5 A;  2L4A A;  5CVR A;  4YFN F;  4UUT A;  3TO7 A;  1ETX A;  1W5T A;  2HYG D;  1OFC X;  2OV7 A;  1T2K A;  5FB2 A;  2R0Q C;  3HPH A;  4BE0 A;  5IPA A;  1YRN A;  3K2A A;  2JVG A;  1Z77 A;  3GX4 X;  2H1L A;  1SVM A;  3U9G A;  1HC8 A;  3VWB A;  2R7F A;  4MIM A;  3TDU C;  3FIW A;  2M4K A;  5DDG A;  5DCF A;  1U9N A;  5K7Z A;  2KHM A;  5CKT A;  4LK0 F;  2Y30 A;  1ZQ3 P;  5TJJ A;  3BZ6 A;  3R0J A;  4RMN A;  3J7Y J;  1B72 A;  1S7A A;  3J80 K;  3BT9 A;  4MHG A;  4V2F A;  5F08 A;  4CIC A;  3ELK A;  1W7P B;  3COA C;  1IZ1 A;  2LY2 A;  3HOY J;  1G2H A;  2GOX B;  3SFI A;  3GTL J;  3BG5 A;  3CTA A;  1AKH B;  3KYD B;  3PL8 A;  2WAD A;  3JR9 A;  2UXN A;  4K2E A;  2BY3 A;  3BLY A;  4HX4 A;  3RPU D;  4XR6 A;  2CQK A;  3FXK A;  3LSP A;  2CWE A;  5HOD A;  1Y0N A;  2CRG A;  2XAJ A;  1B59 A;  1RNL A;  2IS1 A;  2RDP A;  4G7H F;  4M6Y A;  2Y69 H;  1MMN A;  3HL2 A;  1ZG5 A;  4RAZ A;  2ZME A;  1WKM A;  1IRZ A;  2VXD A;  1J09 A;  2EV6 A;  3OS1 A;  1YX3 A;  3FHN A;  1CF7 A;  1R1U A;  1I5Z A;  4XSX F;  3TW7 A;  3H0D A;  3L00 A;  3HUG B;  3H9J A;  1HA8 A;  3EYY A;  3QQA A;  3H92 A;  3S1R J;  3DQV C;  3I4M J;  2ZXH A;  2Z9O A;  3LA2 A;  3W2W A;  4CYD A;  2NAZ A;  2LC2 A;  1X2M A;  4BJT A;  1W5C C;  4PFP A;  2XC7 A;  1C0W A;  5LGT A;  1MH4 A;  3BCA A;  2WAQ N;  5EGO A;  4YG2 F;  1XSD A;  4KIB A;  4E7Z A;  1UCR A;  2HXI A;  4DYC A;  2M2E A;  4XID A;  1Z21 A;  1FP1 D;  2VOD A;  3MFK A;  4WF2 A;  2MLG A;  1D3Y A;  1OCO H;  3F6O A;  3FBN B;  1IO2 A;  1MBF A;  2BYV E;  4B44 A;  5IOY A;  5LGN A;  5GAG J;  4NC6 A;  4ETS A;  1YOV B;  1MD0 A;  3QP6 A;  1WJA A;  4U88 A;  4M6V A;  1IN7 A;  3MZ8 A;  4HNU A;  1FOY A;  2DLL A;  1REP C;  4IHV A;  1I1S A;  3F23 A;  2HVR A;  4DZJ A;  2IW5 A;  3F9K A;  2R92 J;  4B09 A;  1KYW A;  4KIS A;  1IXS B;  3A0B C;  5FLX K;  2M7B A;  4Y7N J;  5IYC J;  2W4S A;  3I5U A;  4XON A;  4YFX F;  4L9V A;  2VOO A;  4ZYA A;  2NVT J;  2NS7 A;  2DFE A;  2BEO A;  3S93 A;  3JRB A;  2Y0M A;  4B4C A;  4LB5 A;  4Q48 A;  4HDU A;  1UAA A;  1I6X A;  4EM2 A;  3HSE A;  4M3D A;  1FT9 A;  3FMS A;  5L3G A;  2EV5 A;  4XOP A;  5BS6 A;  4G94 A;  4AU7 A;  5K1Y A;  5D4R A;  2HEO A;  5DYM A;  5HNH A;  3HEF A;  4ZYD A;  1VQP I;  3SQN A;  2IS2 A;  3S32 A;  3CJQ B;  1BR2 A;  1V54 H;  1OYY A;  2KIQ A;  3P7N A;  4MO7 A;  1WPK A;  3KYC B;  1UST A;  4F3Q A;  4MTD A;  1YFH A;  4Q5S F;  3BY6 A;  2Z3Y A;  2CFX A;  3KIO A;  4N9I A;  2QGU A;  3BPX A;  4F7Z A;  1QHG A;  2RNJ A;  1ZLK A;  3I0T A;  3N97 A;  5ERI A;  4OAY A;  2K5C A;  3HHG A;  1OIS A;  3LSM A;  4LLN A;  4KA4 A;  1BIB A;  3I59 B;  3S1Q J;  1ETY A;  1R00 A;  3HBL A;  1IV6 A;  4KN7 X;  2GXB A;  2DMN A;  1YIO A;  3I54 A;  3RKW A;  5LHH A;  1XDS A;  2R5Z B;  2IJL A;  3A01 A;  3EQL F;  1P7I A;  4DQ2 A;  1O3S A;  1G3S A;  1I3Q J;  3CJT B;  2HDD A;  2X85 A;  2VB6 A;  4ZDL A;  4F55 A;  2LVS A;  4LLG F;  3L2U A;  1LFB A;  3DCF A;  5FKL A;  4HST A;  3VEP A;  4HPQ A;  3ASO H;  4LB6 B;  5DCM A;  2JA2 A;  4OIO F;  2VBY A;  5FFX A;  4UUS B;  2QA4 I;  3K4N A;  4O3M A;  4D0P A;  2O03 A;  4IQ4 A;  1R5I D;  3JSP A;  2H6C A;  2IA1 A;  1QVT A;  1XGO A;  3OIQ A;  1LB2 A;  2ZJ2 A;  1JXS A;  3SHF A;  4ANJ A;  3RYR A;  1IJW C;  2O5R A;  4FT8 A;  3OYH A;  1MZB A;  2BXY A;  2FUG 2;  4B8X A;  4MEX F;  3GLX A;  3IRR A;  3ZR8 X;  3HOX J;  3CO6 C;  4PSX A;  3CC7 I;  4EQQ A;  3I58 A;  3IH3 A;  4QPQ A;  4CXF A;  2ZSH B;  4FE4 A;  2FBH A;  1J5Y A;  1F36 A;  2Z1D A;  4CUG A;  2K02 A;  4PFO A;  1I3A A;  3CMM A;  2ZCW A;  1TLH B;  2DT7 B;  3OYA A;  5GAD J;  3HOU J;  5JVG F;  2LSO A;  1H9T A;  1UHS A;  1XB4 A;  4F52 A;  3ABM H;  1IV8 A;  3ZMZ A;  3JRA A;  2KIF A;  4A5M A;  2HNH A;  3I71 A;  3C3W A;  3RQI A;  3HYI A;  2ELK A;  3AKZ A;  3M9A A;  4BU2 A;  2GZW A;  4Q4Z F;  2Q2E A;  4M6X A;  2RN7 A;  5E1W A;  5TIS C;  1UHM A;  2V1D A;  1CGP A;  1OCT C;  1HDD C;  4ZC3 A;  4A3M J;  1WQ2 A;  4IZZ A;  5FRM A;  4A93 J;  4FE7 A;  5BMZ A;  1JJ8 C;  2EZH A;  2DI3 A;  2PLY A;  2EIK H;  4Z6Y A;  2YU9 J;  3OIP A;  5J3L A;  3RZD J;  1F43 A;  2IA2 A;  2TDX A;  4A3J J;  3KP4 A;  3U1D A;  3K4B A;  2PJR A;  1BW6 A;  4PJN A;  1R36 A;  2RVC A;  3W6J B;  1GVD A;  1IXR C;  5DTD A;  2OZ6 A;  4LG3 A;  2VC0 A;  5KHD A;  3ZN1 A;  4BE2 A;  1UG2 A;  1MGT A;  1VQL I;  3ABL H;  4KMF A;  3GO5 A;  2GXA A;  4D7M A;  4HF2 A;  5F0C A;  3K70 C;  1E17 A;  2P5K A;  2VE8 A;  1ETO A;  3H3Z A;  2DMQ A;  2YS9 A;  2ZNY A;  3G1M A;  5HS9 A;  3IHU A;  3DBH B;  3CC4 I;  1RES A;  3ECH A;  4II3 A;  2P4W A;  3DLL F;  3MWM A;  3MKW B;  4XLF A;  2VJI A;  3AL0 B;  1OPC A;  4KT6 A;  2BY2 A;  3ZP5 A;  4XK4 A;  4YII A;  4LMY A;  1FMW A;  1Y56 A;  4RM3 A;  4XOT A;  2XGE A;  5IP6 A;  3DWL E;  3REO A;  1T8I A;  4J01 A;  3KEY A;  2WY8 Q;  3RYP A;  1BI2 A;  5B66 C;  2LK2 A;  4BEH B;  5L3F A;  1KON A;  2A69 F;  2K27 A;  3PO3 J;  2TRT A;  3L9F A;  3V4G A;  2WY7 Q;  4OIR F;  5JHU A;  3KP6 A;  4YEL A;  2R7X A;  5J1R A;  4RGR A;  3BQY A;  1YJW I;  1G8X A;  2KLO A;  2NS0 A;  3KZZ A;  4MEY F;  4V2G A;  4RS8 A;  2IGM A;  3S17 J;  3PJR A;  1ZG1 A;  4L5I A;  2EIN H;  2JMW A;  2XPV A;  4HYE A;  1P9Q C;  1Y0U A;  3C2G A;  5TGT A;  3WTS C;  2VUM J;  2L7M P;  1J7K A;  4FQG A;  4G6Q A;  4ZJZ A;  2P5L C;  4HLY A;  1GXP A;  3OSF A;  2X6W A;  1U5T C;  2QBY B;  5E79 C;  3MN2 A;  3EET A;  1S6L A;  2XF6 A;  4X6A J;  5JR3 A;  4NBQ A;  3S1N J;  1U9O A;  3TOA A;  3IWZ A;  2VLA A;  4IHW A;  1WJF A;  4KYW A;  1VND A;  3LOC A;  1Y8R B;  2EK5 A;  3OYG A;  2RC4 A;  2J5O A;  3IRQ A;  4KJZ A;  4D5C A;  4EGZ A;  3VYT B;  2KJC A;  3TQN A;  3ZQH A;  1TT5 B;  1OYI A;  1F4K A;  2F4I A;  4HNT A;  1BM9 A;  2HQN A;  4WK8 F;  3AAF A;  3HXL A;  5FKK A;  1MMA A;  3GFI A;  3MEX A;  1BI0 A;  3K1M A;  4OAZ A;  4R8H A;  1ZRC A;  4KNY A;  4BGD A;  2LY9 A;  3LAP A;  3CCQ I;  1JGS A;  4BQQ A;  1WJC A;  1ZRE A;  3V7S A;  3T8T A;  1QZY A;  1FOW A;  3D1N I;  2DPD A;  2BXZ A;  1GHC A;  4M72 A;  5ILS A;  4O6J A;  4DNC A;  1NTC A;  1EA3 A;  4UNO A;  4EV0 A;  1UB9 A;  3F8F A;  1FOX A;  1IW7 F;  2F4M B;  4A0Z A;  2X6X A;  1ZR2 A;  2XF7 A;  3PFY A;  2D2W A;  1E3H A;  2VON A;  2JA5 J;  2E34 A;  2FEZ A;  2B7E A;  4MNU A;  4C3H J;  3E5X A;  4A3F J;  1WJE A;  3PM1 A;  4D1Q A;  5M5X J;  2RQP A;  1MJ9 A;  3N4M A;  2VJ4 A;  3OYM A;  5AIP A;  4BYY A;  4WCG A;  3FF5 A;  1D0Y A;  1TNT A;  1TQM A;  2EB7 A;  3F0C A;  5KCM A;  1A04 A;  3GCM A;  2RRE A;  1IUF A;  3QU3 A;  3DKY A;  3ZMD A;  3TO6 A;  2F6C A;  3NAR A;  3R6S A;  2LP0 A;  2JSP A;  2R7V A;  4C9Y A;  5HLG A;  3OMY A;  1IN5 A;  3WTX C;  3S2H J;  4S05 A;  1TC3 C;  4LG0 B;  3VYU B;  2Q0O A;  2YPR A;  5LD2 C;  2GA1 A;  4OMZ A;  3WE2 A;  3Q0U A;  4P1W A;  4LGW A;  5M5W J;  1B1B A;  2VT3 A;  2QF7 A;  1D5Y A;  4FHT A;  3ZOB A;  5A2Q K;  1D8J A;  4A3K J;  2XAQ A;  3KE2 A;  2CS3 A;  5LRR A;  1GUU A;  5HNF A;  1IDZ A;  1G4D A;  2H27 A;  1VQN I;  1U6G A;  5L3B A;  1OJL A;  1RPW A;  2STT A;  1ZRD A;  1FWZ A;  2OU2 A;  4RBO A;  2G7H A;  2XRO A;  1RUN A;  1XGN A;  2HGC A;  1VZ0 A;  3B6C A;  1QBJ A;  2HS5 A;  2OJE D;  2DDA A;  3L2C A;  4BNC A;  3CQZ J;  4IRG A;  3EDP A;  3H5A A;  4I0A A;  3OR1 C;  2VOP A;  2IT0 A;  2XRL A;  3ASN H;  3DEW A;  2R93 J;  1B8I B;  2O8X A;  4ESJ A;  1WH7 A;  3D0S A;  5DM7 F;  3AFH A;  3H3U A;  1VQO I;  3ZMV A;  2ACJ A;  3HKZ A;  4P9U A;  1SAU A;  5JHF A;  4UY8 I;  4KIT B;  2GIZ A;  1HF0 A;  1TNS A;  2LBF B;  1XS9 A;  3Q9V A;  3WTW C;  3L1P A;  4ZZD A;  2CQ7 A;  5IT9 K;  3O3K A;  3BR3 A;  3I55 I;  4HEA 2;  2N8G A;  4S0H B;  3PNV A;  1TW2 A;  2X1E A;  1T39 A;  5DUK A;  2F4O B;  3BJO A;  1HKQ A;  2HOA A;  3K9T A;  1Z0X A;  3B02 A;  3GEZ A;  5FRN A;  3JRH A;  2R4G A;  2HQR A;  2C6Y A;  1FBU A;  3OL3 A;  3Q0W A;  2GIV A;  3IAS 2;  2I10 A;  2WB1 A;  2RV8 A;  1T0F A;  1VFC A;  4NC8 A;  1D0X A;  3GTG J;  3PO2 J;  4YFK F;  4FX4 A;  2UZK A;  1XC5 A;  3C1D A;  1MJB A;  2XSJ C;  5EZG A;  4NQW A;  4B43 A;  2DYS H;  3LSR A;  1RR8 C;  2Y2Z A;  3SXY A;  1EH8 A;  4X1E A;  2BW3 A;  2G9W A;  2HZD A;  2K9Q A;  1X4P A;  3HG9 A;  3ABU A;  5FKM A;  3OS2 A;  4HV6 A;  1H88 C;  2VQH A;  3DXJ F;  4A6E A;  4HQM A;  1Z7L A;  1MDM B;  2HQA A;  5J6X A;  1SMY F;  1IG7 A;  1JE8 A;  2Y48 A;  1OKR A;  1B9N A;  5EJC A;  4BXF A;  3H0G J;  2BGC A;  5J8F A;  4HLX A;  1IRX A;  2FOK A;  1D1C A;  4LIU A;  2CMP A;  4HOB A;  3H5N A;  3QOD A;  3UR3 C;  2V26 A;  4IRH A;  4UVB A;  3FKI J;  2Z16 A;  3DLA A;  1MSE C;  1SD7 A;  2JPB A;  4GXO A;  4D9J A;  5HDN A;  2DT5 A;  2FQ4 A;  3K6G A;  1O57 A;  4HW0 A;  2DTR A;  3HGY A;  3MKL A;  4BJ5 C;  5DUI A;  3DBR B;  2BV6 A;  4I09 A;  2DN0 A;  1NG6 A;  5IT9 Z;  3EUH C;  3KP3 A;  2IPQ X;  1Z3X A;  3V8K A;  3GME A;  1BJA A;  2Z2S B;  2NS8 A;  3CLQ A;  3GTP J;  2W00 A;  2FXA A;  2H94 A;  2VBX A;  2K9N A;  3DU6 A;  1JTY A;  4JP0 A;  3E97 A;  1R9T J;  2XSD C;  1MND A;  3I64 A;  2CV0 A;  2HOT A;  3VFZ A;  4BHB A;  1E2X A;  3G4S I;  1T95 A;  4M9X A;  4DBQ A;  2EIL H;  5B5E C;  4RLF A;  1YHQ I;  1LVA A;  1GLN A;  3T8R A;  2IXS A;  2JRT A;  1QHH D;  4AVZ A;  2NRA C;  2CV2 A;  3JRI A;  1LPQ A;  4C30 A;  2CO5 A;  2WA0 A;  3AG4 H;  2JJ7 A;  1TQP A;  3F72 A;  1SMT A;  2KRH A;  2CQN A;  4MFD A;  4EJO A;  4EJW A;  2DA4 A;  5ILV A;  1ETK A;  1EH6 A;  2O9L A;  1SD4 A;  2M9H A;  5KAF C;  1FTT A;  3OOP A;  4CO8 A;  4GDF A;  1USS A;  2Y31 A;  3E3V A;  4WX9 A;  1LKX A;  2KDZ A;  2E5Z A;  3WTV C;  2IEK A;  2K85 A;  3F8B A;  4OIP F;  1FY7 A;  2PBI A;  5EG0 A;  2F2E A;  4BJ6 C;  4J00 A;  3MZY A;  1LE8 B;  1H9G A;  4BKX A;  1QPM A;  4PSW A;  9ANT A;  2EA2 A;  1BI3 A;  2R5Y B;  3CME I;  3K4L A;  3PNT A;  4HF1 A;  4I76 A;  4M3E A;  1H8A C;  2ZXW H;  5HS7 A;  3GTJ J;  1PUE E;  4LIT A;  1BBY A;  1ENH A;  2KZG A;  3V42 A;  3ZCO A;  1QZE A;  3DTK A;  3KYL A;  2CSO A;  2D45 A;  3F8C A;  3RIR A;  3OYI A;  1CQT A;  2Y0S A;  1YQA A;  3BDD A;  1EV7 A;  3HRT A;  2YX7 A;  5JI6 A;  1YI2 I;  2E5N A;  4IQJ A;  2FNA A;  5M5Y J;  1SAN A;  3JRE A;  2R7Z J;  1X4O A;  1FEX A;  5CYV A;  1ZYR F;  3PQK A;  2W24 A;  4A3L J;  2JA8 J;  5AIQ A;  4JX6 A;  5D6F A;  4II2 A;  3J7A Y;  1TZL A;  2CW7 A;  1LDJ A;  3RKQ A;  2ESH A;  2PN6 A;  2WWY A;  2BHY A;  1R5H A;  4P5O A;  5DV5 A;  3FBI B;  1J75 A;  3KLN A;  3C2H A;  2DJI A;  2ME0 A;  2E19 A;  3FXO A;  3QU6 A;  1N78 A;  5K5O A;  2XPW A;  3PUF A;  2WC2 A;  1OMI A;  4BXU A;  2UXX A;  5E3L A;  4BE1 A;  2EIM H;  4RLQ A;  2H09 A;  5K5R A;  3K70 D;  2ZNZ A;  2CQX A;  3RJP A;  4F92 B;  2DA7 A;  3JRD A;  4QSH A;  4AVP A;  5HLH A;  2NOJ B;  2XAF A;  2OCE A;  2JK3 A;  1MNM C;  4R79 A;  1E3P A;  1R1T A;  3HHH A;  5GPA A;  1XD7 A;  3H5R A;  3D5R C;  5JFR A;  2KFD A;  4KMU X;  4AM3 A;  2VKH A;  2EWN A;  2XAG A;  2NVU B;  1JHF A;  2B9S A;  3NEU A;  3P9K A;  4QTR A;  4E7J A;  4XRM A;  4ZH4 F;  3BJ6 A;  3BTJ A;  2NVQ J;  4DW6 A;  2EJR A;  3L2R A;  2IGN A;  3K10 A;  1AWC A;  1TW3 A;  3WG7 H;  4ZZL A;  4L9N A;  1W36 C;  1V55 H;  2XIG A;  1YJN I;  2AXL A;  2IGK A;  4A0X A;  4BXX J;  2V1N A;  2XVC A;  1X1C A;  4UXN A;  2A68 F;  2HU9 A;  1J2X A;  3J80 Z;  1JI8 A;  2FE3 A;  3RQ4 A;  4C2T A;  3IWF A;  2XV4 S;  1TQI A;  1MMS A;  2LDU A;  2CUJ A;  4XM3 A;  4X0G A;  5H20 A;  2VXZ A;  1YW7 A;  2VPR A;  3ZPL A;  4U0V A;  2LNB A;  4UUV A;  4JOM A;  3BR2 A;  5EEH A;  2JVH A;  3OYN A;  1ZAR A;  4M3G A;  2JN6 A;  5K7F A;  1HLV A;  3TBI A;  2YUS A;  2P5V A;  2JUG A;  4CCM A;  3A03 A;  4AYB N;  1R4M B;  2W84 A;  3F6V A;  4AID A;  1X3W B;  2ID6 A;  1YS7 A;  2DMT A;  2W25 A;  2HTJ A;  2DCE A;  1S7E A;  1Z6R A;  3S15 J;  2QLZ A;  1L3L A;  2VJJ A;  4BHP A;  1S29 A;  2GQQ A;  4B3A A;  1R71 A;  4IHX A;  1HOM A;  4XOR A;  1RET A;  2R7W A;  4JYK A;  2VPL A;  4XRF A;  1LEB A;  5F04 A;  4NUB A;  5C44 J;  2PMZ N;  2A5W A;  5C4J J;  1YW8 A;  3C7J A;  2XKO A;  3FK6 A;  1OR7 C;  3F8M A;  2BVM A;  4CSW A;  2CW0 F;  4A3G J;  2B0L A;  1SVO A;  4Y13 A;  1NHA A;  1P6R A;  3SJM A;  3TOB A;  2PEX A;  4IJA A;  3T1B A;  2O0Y A;  1J0R A;  2NXN B;  2XAU A;  3P9C A;  2ZXI A;  1LFP A;  3HIF A;  3J7Z I;  2Z99 A;  3BCB A;  3GFJ A;  4OWR B;  1A35 A;  2A61 A;  4XQF A;  4CYC B;  2MGQ A;  1S3J A;  4ZTF A;  1BI1 A;  2X6O A;  1QVU A;  3ZQC A;  4RGS A;  2E35 A;  2AS5 F;  2X1C A;  1IRG A;  3KFW X;  4KIG A;  2L7F P;  4EAT A;  3W6V A;  3QPS A;  4Y52 J;  4LIV A;  1ULY A;  3FX3 A;  1IUY A;  1FMV A;  3CUQ B;  1IF1 A;  3G1O A;  1LQ1 A;  3EUH A;  3MD2 A;  5FLX Z;  5DEQ A;  3TW6 A;  1MBK A;  5K5Q A;  4ON0 A;  4B47 A;  2DDB A;  2V1X A;  3LSI A;  4OIQ F;  1Y8Q B;  2OD5 A;  3SZG A;  1D1A A;  2J5P A;  3B73 A;  2VKV A;  3BR6 A;  2FBI A;  2L5Q A;  2MD5 A;  3BR5 A;  2HOE A;  1KU2 A;  3TP3 A;  4XKV A;  3PNY A;  3CO7 C;  1ZEL A;  2FNP A;  3FDY A;  1DP7 P;  1X1A A;  4HX7 A;  4EJU A;  1XDU A;  2MAB A;  2OZU A;  5M3M J;  1ZHF A;  4PGH A;  4IEJ A;  4C3J J;  2KRF A;  1SFE A;  5IT3 A;  3OYD A;  5J47 A;  3CMY A;  3DP7 A;  2EH3 A;  4ITV A;  1FC3 A;  4XMY A;  1JTX A;  3SYT A;  1GVJ A;  3SFZ A;  2L0K A;  4FCY A;  2FU4 A;  2W1O A;  4ZYH A;  3DTI A;  1MSF C;  1XGS A;  4RB1 A;  2V79 A;  1KQ8 A;  4ENM A;  3S1M J;  2D5V A;  3FWE A;  2WTE A;  3UNG C;  1XCB A;  1YE9 A;  4A3I J;  1JKO C;  1IC8 A;  1ON2 A;  1ZGA A;  3JRG A;  4DGW B;  3GTO J;  1UMQ A;  1VQ7 I;  5ICC A;  4IL6 C;  3NAU A;  3BG3 A;  4M3F A;  1N25 A;  5EEG A;  1T0F C;  1QU3 A;  2R3S A;  1ZLJ A;  2RQQ A;  3BC8 A;  4MTE A;  3K4C A;  1FYL A;  1D8K A;  3HB9 A;  3JRC A;  3LA3 A;  1HKS A;  1IGN A;  3CCL I;  2OTL I;  4CCN A;  3OYK A;  1W4M A;  4KFC A;  4JX4 A;  4A5N A;  1RKW A;  1KQ0 A;  5B1A H;  3CMA I;  2PJP A;  2E1M C;  1G3Y A;  2OAZ A;  3BJA A;  3LWF A;  2ISZ A;  3M07 A;  2CH0 A;  3BG9 A;  3QOE A;  5ILU A;  3E6C C;  2QSH X;  4XLP F;  3CDH A;  5J4Y A;  1MBE A;  3LFU A;  2LLK A;  1U5T B;  2MD0 A;  2FX0 A;  2A3S A;  2KIM A;  4WXH A;  4CCO A;  5FLM J;  2DQL A;  3FMQ A;  2KL4 A;  3G1L A;  1EKE A;  5DS9 A;  2X0L A;  2HXO A;  2E1C A;  3K69 A;  3TDZ C;  2V9V A;  2A6H F;  3QP5 A;  1YRN B;  2IVM A;  3E0J B;  5HLI A;  3GF2 A;  2PI0 A;  3WU2 C;  1R49 A;  2JT1 A;  3KPH A;  1LUJ B;  3Q5F A;  1JKQ C;  5GAE J;  1IRF A;  2LRD A;  2YU3 A;  1G3W A;  1L0O C;  1S8N A;  2HFH A;  1JKP C;  5B1B H;  3WOD F;  2MA3 A;  5C3E J;  1LDD A;  3ULQ B;  3GLL A;  4E7L A;  3H9Q A;  1B72 B;  1ZTR A;  1KQ9 A;  2M87 A;  2L54 A;  4RM2 A;  3M1E A;  5IY5 H;  1JUM A;  1O7F A;  4UV9 A;  4ESB A;  1FPQ A;  1NK3 P;  1FLI A;  2XAH A;  5JVT A;  4G6D A;  1V4R A;  3SZP A;  1B9M A;  5L3E A;  1G3T A;  3J81 K;  2O61 A;  3DTE A;  3S3O A;  1OCP A;  1AOY A;  2OQR A;  1G59 A;  2CUF A;  2QQ9 A;  1DU0 A;  3CES A;  2OTJ I;  2UV1 A;  1GV2 A;  1P4W A;  2HZT A;  2Z5U A;  2IRF G;  1TWF J;  2STW A;  3OL4 A;  1K78 A;  4RB2 C;  1TWH J;  5GP9 A;  1Z7U A;  2OBP A;  5L3D A;  4E6K G;  2ZME B;  2WAF A;  1HCR A;  1Z05 A;  1CF7 B;  4AIJ A;  3QYF A;  1DPR A;  5B3S H;  3T0Y A;  4L0Y B;  1G6N A;  2F48 A;  2EPF A;  2HKO A;  3LA7 A;  4J19 A;  2P6T A;  2VI6 A;  3SEZ A;  1DGR M;  5H6R A;  3FKJ A;  5H2F C;  3I3L A;  3M1C A;  4GCV A;  3VPR A;  2W82 A;  4UB8 C;  2O3F A;  2OCC H;  3CCS I;  3JW4 A;  4O5V A;  3TGN A;  2R7U A;  1XCV A;  1KU7 A;  5EGO B;  4BS9 A;  1HXD A;  1DQU A;  2IGO A;  4IO9 F;  1T38 A;  3GZ5 A;  4RDU A;  1A36 A;  2V4J C;  3CCJ I;  3Q9S A;  2VL8 A;  4PGG A;  2CU7 A;  3DKW A;  1XGM A;  4B48 A;  2HKX A;  4A69 C;  3RSN A;  1D1B A;  1M1E B;  3HOT A;  5D4S A;  3BG7 A;  4XKW A;  1W7P A;  2DOE A;  2L9N A;  4ZDP A;  5E3M A;  2QVO A;  1ETQ A;  2ADU A;  1R22 A;  2L02 A;  3DPL C;  2M7A A;  1GXQ A;  3MVP A;  4IXA A;  2HOS A;  5HDG A;  4M3B A;  3GW2 A;  1AKH A;  3VSK A;  2QSF X;  2CUE A;  4XKC A;  3S16 J;  3HSR A;  4L5E A;  4C2U A;  3IC7 A;  2L2O A;  2XKP A;  4XN0 A;  4KUM A;  4LD5 A;  5BQT A;  3J81 Z;  3QAH A;  4BBS J;  4BDY A;  1PDN C;  1Y6I A;  1NH3 A;  3I4P A;  2DOD A;  1OR7 A;  2GXG A;  3GXO A;  4H4K C;  3TMO A;  1UFM A;  1I27 A;  2GWR A;  2WV0 A;  1XG1 A;  4R1H A;  4HG2 A;  4UVA A;  3VYR B;  2DO7 A;  3OYC A;  4C3I J;  3KP7 A;  1XN7 A;  4A3B J;  3AG3 H;  3DPT A;  2R7Q A;  3A2K A;  3CP8 A;  3HUG A;  3E7L A;  1P4X A;  4DOZ A;  1RIO H;  2LKS A;  4NNJ A;  4N4O B;  5ICE A;  3IV5 A;  3LL7 A;  4G6T B;  3BTL A;  3ONQ A;  2K9M A;  4A2U A;  2GM4 A;  4PZJ A;  5HVQ C;  5E1X A;  3H35 A;  1XMX A;  3IL2 A;  1QRY A;  2CFO A;  2HVQ A;  2KDO A;  1AHD P;  2KQR A;  2VT2 A;  4A3D J;  1JGG A;  2DOA A;  1XPX A;  2OA4 A;  2K3F A;  4M9S A;  5KAI C;  1H0M A;  4Y33 A;  4KT5 C;  2KKO A;  2ZXJ A;  3A0H C;  2ISY A;  4FAS D;  4KIF A;  1E3O C;  3BTC A;  3P5J A;  5BOX A;  1SFU A;  1VQ8 I;  2DPU A;  3GZ6 A;  2LKP A;  4M71 A;  4WXC A;  3CZ6 A;  3DU5 A;  4LOC A;  3A01 B;  2M0M A;  5DD4 A;  2FSW A;  1SC7 A;  3KZY A;  3HOV J;  2X4H A;  2LTP A;  1QGP A;  1WZ2 A;  2RNG A;  3GYH X;  1J59 A;  4Y4R A;  3VSL A;  1U8R A;  3U21 A;  2VC1 A;  4DYR A;  5DCM B;  4ZTJ A;  1RUO A;  4LJZ F;  1ONV A;  1YG2 A;  3S8P A;  2E36 A;  3DKX A;  2GA2 A;  1WI9 A;  2BE5 F;  1I1G A;  1W36 D;  3BRO A;  1BOB A;  2WAQ A;  5HLT A;  1WGX A;  4PJ0 C;  3S14 J;  1FNN A;  1MIJ A;  5F1R A;  2R7O A;  1W5S A;  4HZF A;  4ZYG A;  2BBY A;  5F6F A;  2E2J J;  2QQB A;  3OYF A;  3CF2 A;  3GBG A;  3ZQQ A;  3K4J A;  3OYJ A;  3OIO A;  1WH5 A;  2QQA A;  3O2P E;  1R5G A;  2MFZ A;  3K4M A;  5D5W B;  2KT0 A;  5FFZ A;  2DK8 A;  4Y3O A;  5LHG A;  2QEX I;  4G7O F;  4QPO A;  1VF9 A;  4W97 A;  2MH2 A;  2XUB A;  3WGI A;  1K83 J;  1VQM I;  3GWZ A;  5EEA A;  1V3F A;  1JUP A;  2ELH A;  2GBY A;  2MBF A;  4IOC F;  1WVR A;  3I59 A;  2V6C A;  5CVI A;  3PIO F;  4MLO A;  3ZGK A;  5CVV A;  5A2Q Z;  3ERM A;  4PK4 A;  2ZB9 A;  3H3V K;  1FX7 A;  1IAW A;  3DEU A;  3ZN0 A;  4RAY A;  4U0W A;  1FBS A;  3GFM A;  1P92 A;  4CZC A;  2JQ7 A;  2VJ5 A;  1K4S A;  2KPM A;  3QPH A;  4OU0 A;  4PDK A;  1W1W E;  4PJL A;  4ENK A;  3HTS B;  2K3P A;  2R5Z A;  1LNW A;  3L2Q A;  3EUK L;  3HPG A;  2FRH A;  2Q2E B;  3ML6 A;  4CYC A;  2W7N A;  1OCZ H;  1KZH A;  4DZP A;  3SEQ A;  4YRV A;  5K7H A;  2CQQ A;  3LQQ A;  2COM A;  2NOG A;  2P81 A;  3MKY B;  3K1P A;  1X1B A;  2EZK A;  4M9Z A;  1T08 B;  2JRM A;  2VBZ A;  2YSR A;  5LEK A;  4UUS A;  3D5S C;  3CUQ A;  1MBG A;  3HSF A;  5F0H A;  1SFX A;  2ZKZ A;  1TBX A;  2LY1 A;  4RB0 A;  4E7I A;  2ECC A;  4RAG A;  2NYX A;  4HAM A;  3PSI A;  3RPU A;  3FM5 A;  4JK1 X;  1XX5 A;  2PJR B;  2R7R A;  2CW8 A;  1JJ6 C;  1IXC A;  2JZY A;  2Y9Z A;  3ZQI A;  2XB5 A; 
#chains in the Genus database with same CATH homology
 3I55 I;  2OTJ I;  1YJN I;  1YJ9 I;  1VQ4 I;  2ZJR F;  5GAH J;  1VQ8 I;  1Y39 A;  1VQP I;  1VQK I;  1MMS A;  3J7Y J;  3CD6 I;  3CF5 F;  3CCM I;  3CCQ I;  1VQ6 I;  3CME I;  4V19 K;  1FOW A;  2E36 A;  3CCE I;  1VQ7 I;  3CCU I;  3G71 I;  3CCS I;  1FOX A;  4IOA F;  2E34 A;  1VQL I;  2OTL I;  3CCL I;  4IO9 F;  1YI2 I;  1ACI A;  3PIP F;  3CMA I;  3CCJ I;  3CJT B;  3CC4 I;  3G6E I;  3DLL F;  2QEX I;  2ZJQ F;  1YIT I;  1VQ9 I;  1S72 I;  2QA4 I;  1VQM I;  4IOC F;  1YIJ I;  3PIO F;  2NXN B;  2JQ7 A;  1QA6 A;  3J7Z I;  5GAE J;  5GAG J;  1YJW I;  2E35 A;  1VQN I;  3CC7 I;  2FOW A;  3G4S I;  1FOY A;  3CCV I;  1YHQ I;  5DM6 F;  3I56 I;  5GAD J;  5JVG F;  5DM7 F;  1VQO I;  1VQ5 I;  3CC2 I;  2H8W A;  4UY8 I;  2ZJP F;  3CCR I;  2K3F A;  1HC8 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...