4ZZDA

Crystal structure of multidrug resistance regulator lmrr bound to riboflavin
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
104
structure length
98
Chain Sequence
PKEMLRAQTNVILLNVLKQGDNYVYGIIKQVKEASNGEMELNEATLYTIFKRLEKDGIISSYWGDRKYYRLTEIGHENMRLAFESWSRVDKIIENLEA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transcription
molecule keywords TRANSCRIPTIONAL REGULATOR, PADR-LIKE FAMILY
publication title Binding of the Lactococcal Drug Dependent Transcriptional Regulator LmrR to Its Ligands and Responsive Promoter Regions.
pubmed doi rcsb
source organism Lactococcus lactis subsp. cremoris mg1363
total genus 36
structure length 98
sequence length 104
ec nomenclature
pdb deposition date 2015-05-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03551 PadR Transcriptional regulator PadR-like family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 4zzdA00
2EFOA 2FQ3A 1K78A 3JSOA 4WXDA 3G3ZA 4AIHA 3FHZA 2YR2A 2V6CA 1XMKA 2FBHA 1U6GA 2DO7A 3V8KA 2P5KA 1KU3A 5HOOA 2XUBA 1FBSA 5J8CA 2Y48A 3D5LA 4U7DA 1R7JA 3LQQA 1HBXG 3RKYA 2K7LA 4L5JA 5FD6A 3O2PE 2EFWA 3LAPA 2EWNA 4HF0A 4M9XA 3T1BA 1LQ1A 1YO5C 3DP7A 5E1WA 2ZCWA 5HS8A 1G3WA 4O6JA 1MDMB 3WE3A 4GGGA 1XCBA 2VT3A 1K78B 1IN4A 4BHCA 2P7VB 3OOPA 3ZMUA 5D5WB 1TQPA 3RYRA 4MGRA 1SFUA 5LLQA 2YU3A 4R79A 3KEOA 5FB2A 1RUOA 1ZGJA 2QENA 2VBWA 2W24A 2L4AA 2VBXA 3RKWA 3WODF 1U2WA 1SD7A 2IPQX 3WTZA 5JR3A 4OU0A 1KQ9A 1YG2A 1QZYA 2FA5A 4ESJA 1KGSA 2Q2EA 2CSOA 2EK5A 2RVCA 4QWQA 5FO5A 2HKOA 2VE8A 1RNLA 2JPCA 1R22A 2IW5A 2CGPA 4L9TA 3RDIA 4PGGA 1TNTA 1JXSA 4MNUA 4I7HA 2VN2A 3KEQA 4HOBA 1XGSA 1IN8A 1QPMA 4IXAA 1I27A 4LLLA 2M87A 4UV8A 5H6RA 1FY7A 4L0ZB 2PFBA 4P9FA 4A0XA 1PP8F 3QRFF 3ROUA 2RV8A 1USSA 1G6NA 2XGXA 4AIJA 3F8CA 1LNWA 2ZO4A 2HGCA 3DPTA 3R0AA 3G73A 1TTYA 4A5MA 3J81Z 4G9YA 1YFHA 2FNAA 4I0BA 3H92A 3LSTA 1ZG3A 3TGNA 2X0LA 4HBLA 3IRQA 2GXGA 5HS7A 1FSHA 3BDDA 4HZFA 3GZ6A 1W4MA 5DDGA 4OIQF 1XSVA 3HTUA 5JVTA 4ESFA 3E5QA 5HDNA 4H0EA 4NHJA 3E3VA 3HYIA 2XIGA 3JTGA 3WTVC 2JRTA 3P9CA 3EQLF 4RGUA 3I5UA 1LDKB 3GFIA 3RPQA 3ZP5A 3FXUA 2P6SA 3GWZA 5FLXZ 2VT2A 4LGWA 4ZYEA 3RIRA 1UHWA 2HQRA 4N0BA 2BYVE 1O57A 2ELHA 3DV8A 4CZZA 1FX7A 1HXDA 2MH9A 1H0MA 5E1ZB 5BPIA 4HQMA 2O61A 2D1VA 1MKMA 2E1NA 4HW0A 2TDXA 2NAZA 2OU2A 3ERED 1UHMA 4G6DA 2HKXA 1J9IA 1F9NA 3L9FA 1XGMA 2WV0A 2OD5A 3LA3A 1V4RA 3V7SA 4HX4A 4RB2C 1WRJA 1B1BA 4S04A 2BV6A 1WKMA 3GFLA 1E2XA 4M71A 3SFZA 2NNYA 2FOKA 3QP5A 3B73A 2COMA 2CYYA 1BIAA 1T6SA 3IC7A 4XSXF 3REOA 3WU1B 1U5TA 4ESBA 4YFNF 1RZ4A 1IN6A 4RGSA 1LEAA 1SFXA 2NS0A 4BXUA 2EV5A 3E6CC 2HZTA 3E5XA 3NEUA 4GXOA 3CUQB 4BYYA 2NRAC 3M1EA 3QPTA 1FOKA 1U3EM 2BBYA 4EGZA 3EDPA 3NQOA 4OMYA 2ZMEA 4HQEA 2PBIA 3M8EA 3KFWX 1OYIA 5E17F 3T8TA 4P55A 3KP4A 3EUHA 4MQ9F 2VOPA 2CWEA 2V1XA 2FBIA 3Q9VA 5D8KB 1PP7U 4RAZA 1UCRA 1IXRC 1YQAA 5E18F 3K2ZA 2GIVA 2DU9A 4U0YA 4QLCU 2LF8A 2OAZA 1MJ9A 4CDGA 4KT5C 3EYIA 2GXBA 5A2QK 1EH8A 3IRRA 3ZMTA 2F5FA 3MZHA 2KRFA 3ABTA 5CVIA 4M74A 3TDZC 4UNOA 2M5WA 1GXPA 2YX4A 2GA1A 1W7PA 3QU3A 4ZH4F 5KK1A 3VFZA 4KDPA 1J0RA 5D4RA 1S7AA 2Y75A 3BZ6A 1XB4A 4M72A 1DUXC 3MWMA 1F5TA 3K69A 3I71A 4B8XA 3HSRA 4EM2A 2A07F 5L3CA 2D1HA 2MBFA 1HSJA 2V9VA 5L3GA 1IN7A 1QZZA 2DQLA 3IWFA 2ACJA 4FHTA 1G3YA 4HF2A 1A04A 1IZ1A 2EV6A 1XGOA 4CXFA 2IA2A 3BPVA 2Z9OA 3HSEA 4UUVA 3VEPA 2P5VA 5LHHA 5EEHA 1U78A 1BI1A 2HYGD 3JAMK 1REPC 2H6BA 5F6FA 3HRMA 1BC7C 3F21A 5D8LB 5LRRA 5LEKA 4KIBA 3WTUC 1W7PB 1KYZA 1CGPA 4ON0A 1T39A 2A61A 5FFZA 4HV6A 2W57A 3C1DA 1EH7A 4HV5A 1O3SA 1FSEA 1IUYA 1FBUA 5F1RA 1R23A 2A3SA 1SD5A 3WU0A 3H3ZA 2M8EA 1U8RA 3E6BA 1STZA 3T8RA 1I6XA 3WGIA 4HDVA 3BY6A 1SFEA 5DCFA 4KMFA 2UXNA 3ZQ7A 4EGYA 4RGXA 4WXHA 3GZ5A 5DYMA 3MZYA 3TO6A 3ML6A 2PLYA 4XLNF 6PAXA 5FGMA 1FBQA 2WWYA 4Y13A 1TLHB 3V7RA 1S7OA 1B9MA 2IVMA 1Z6RA 4BH9A 4ZYGA 3ECHA 1FNNA 1E17A 3J80K 2HOEA 4Y17A 2XAHA 2JZYA 1BC8C 3U2RA 4LLGF 3ECOA 2QYOA 2D45A 1G3SA 4R8HA 4OMZA 4Q5SF 1S6LA 2DQRA 3KP3A 2YPRA 3TQNA 4PZJA 2EA4A 2G9WA 2PI0A 3GF2A 5LBQA 2M30A 4Q4ZF 4CHUA 2ZNZA 2O03A 2QQBA 3I54A 3JW4A 4CGZA 1UB9A 2XHKA 1MZBA 3SZPA 2K27A 3ZN0A 1P4WA 5BOXA 2ZBKA 1BI3A 1R5GA 3WTSC 2MD5A 2HYFA 4AVPA 2H6CA 3WTWC 4U0VA 1NHAA 2P4WA 3HRSA 5CLSA 2IP2A 2XAGA 3WGHA 4N9IA 3L09A 1HKQA 3Q9SA 3GX4X 1R1UA 3HIFA 4N9HA 2IA1A 4KFCA 2RKHA 4G7HF 3VOEA 2VC1A 1QO0D 1FYMA 1OYYA 1W5SA 2MA3A 4IJAA 2DI3A 3CLOA 4ENJA 3AAFA 4JQFA 4RB1A 1B9NA 3GYHX 4HLYA 2M45A 3GXOA 1TW2A 4IF4A 5FFXA 1P2FA 1D5VA 5ERIA 1H9TA 5D6FA 4GYGA 2RGVA 3K9TA 3KZZA 1ON1A 2ISZA 4F7ZA 3KP7A 2FE3A 3SHFA 1J59A 2A5YB 1K7AA 2QUFA 1QNTA 4OINF 3WG9A 3E6MA 1IN5A 2JPBA 1B4AA 4KIGA 4RS8A 2FMYA 3F8BA 3T0YA 3E97A 3EETA 5DUKA 2OQGA 3R0JA 1LVAA 3KETA 5LEJA 3I58A 2LKPA 2UZKA 4I01A 4ZZDA 2DK8A 1RI7A 4YIIA 2QQAA 2HR3A 1O3QA 4B09A 5F64A 1SMTA 2HWVA 4TV7A 2JT1A 2O6GE 1KQ0A 1ODDA 1ZH5A 2OBPA 4U7BA 4EMSA 1D8KA 1HW1A 2FU4A 5IT9Z 5L3BA 5BQTA 1ZRDA 4A6DA 1PUEE 3TO9A 3CDHA 4EJUA 2VE9A 1K79A 4RAYA 1BI0A 4WF2A 1R1VA 3ABUA 1BJAA 1OYWA 5HDKA 3P7NA 4KUMA 2L02A 1F1ZA 1I5ZA 3HOSA 1R58A 2A68F 3FZVA 3T5XA 2XAQA 1GHCA 3L00A 1Z7UA 1ZARA 2J5PA 1DPUA 1T2KA 3M7GA 3MEXA 4A0YA 4UHTA 2Z99A 2XV4S 4OIOF 2M1BA 1J75A 4LG0B 4WXCA 4ZZLA 3CUQA 3GVAA 2KIUA 3C18A 3GEZA 5K5QA 2X4HA 1FZPB 3L2CA 3RTRA 4HYEA 1TQMA 1OMIA 4IPAA 1IXSB 1B6AA 2KJBA 5D6EA 5JI6A 5D4SA 3RKXA 2CG4A 2L4MA 5CJ9A 2AS5F 4CO8A 4U0WA 5AIPA 4ENNA 2VBYA 3BJAA 2ZFWA 2BEOA 2XRNA 1IAWA 2HFHA 4XLPF 4IHSA 3ZMVA 1GVJA 3CTAA 1S3JA 1D3YA 2P8TA 4G94A 4RGRA 2H27A 2RNJA 1I1GA 3LA7A 2FNPA 2GA2A 1YYVA 4ASNA 4UXNA 3QP6A 2MH2A 4HX7A 2YSRA 3W6JB 2Q0OA 3SZTA 3MFKA 1FYKA 1YS6A 5K5OA 2DK5A 3F8NA 1JE8A 2RC4A 3FX3A 3BROA 3CO6C 1W5TA 3KZYA 4KNYA 4D0PA 3W6KB 4HX8A 3J7AO 4AIKA 3IL2A 3KCCA 4L0YB 1PDNC 3HOTA 3K1NA 3GW2A 1Z91A 3F23A 5L3FA 1EH6A 3GO5A 4M73A 2W25A 4UVAA 1KU2A 2R7FA 4AD9A 1LJ9A 4PDKA 1QBJA 4MHGA 4LB6B 2Z3YA 3U9GA 4ZYHA 5AIQA 3LAJA 3TKYA 3DKWA 2DFIA 3K1PA 5DCMB 2UXXA 1KU9A 1V3FA 5FD5A 3VODA 3FMQA 1BOAA 2RN7A 4IRIA 1USTA 4EJWA 2KJCA 4EVIA 4MEXF 5HS9A 4M9SA 4EJVA 3HUGA 3HTSB 4MTDA 3WE2A 1FYLA 3WGGA 4L5IA 3FMSA 3WTXC 2AXLA 4LD5A 3IKVA 4DQ2A 5ICGA 1ZREA 2CO5A 1XMAA 2MC3A 3I0TA 3ZN1A 3F3XA 1YW8A 3HRTA 3LWFA 1BM9A 1AOYA 3LFKA 2DT5A 2XROA 2GQQA 3IWZA 1D8JA 2K86A 1KQ8A 4ENKA 5BMZA 2QWWA 1R1TA 3J81K 4UVCA 3KP5A 4A5NA 2ZJ2A 1RUNA 1TQIA 1ZAOA 4A2UA 5ICEA 4A12A 1OR7A 2G7HA 5DV5A 2A69F 1AWCA 2K02A 4XBFA 3JSPA 4G8XA 2HDCA 2V79A 5JHUA 3F8FA 1WSUA 1HSTA 4L9VA 1MD0A 3FXQA 2DLLA 1YTYA 1QGPA 2EFQA 4GCVA 5TRDA 1O3TA 4KN7X 4P96A 5LGUA 4NQWA 4DNCA 2STWA 3FMRA 2DPDA 2WC2A 5CVVA 3ZMSA 4CYDA 2WTEA 2OZ6A 5LHIA 2FXAA 2VODA 1T38A 3I53A 5L3EA 5ED4A 1XGNA 1Z6TA 3S2WA 4I0AA 2DW4A 3F22A 4BNCA 5E8IA 5FLXK 2K4BA 5EEGA 3GFMA 3VB2A 2HEOA 1XN7A 3RYPA 1TNSA 3CO7C 5KVRA 2OZUA 2DPUA 1Z1DA 3KP6A 2R7DA 2XAJA 3GLXA 4BHPA 3RPUA 4WCGA 2UWMA 1QQIA 1YLFA 2KIFA 3DPLC 1U5TC 2PMHA 3BJ6A 1MJAA 1ZG5A 3ISPA 4EJOA 4BQAA 3QAHA 5LGNA 4KA4A 2PG4A 2IT0A 1DDNA 1SD6A 2NYXA 1L3LA 5DUIA 2EB7A 2FBKA 2BE5F 4YFXF 4KMUX 4L18B 4Y15A 3FXRA 1WWXA 1IF1A 2RQPA 3DEUA 2E1CA 4K2EA 2ESNA 1LB2A 3CJNA 5LHGA 2PMUA 3C3WA 3HHGA 4KYWA 1J5YA 2Q8KA 2O0YA 2A6HF 4U88A 3F6OA 2ETHA 3IKTA 2JTVA 1TBXA 4RB3C 4FT8A 3TO7A 2XKPA 2ZXJA 4IRGA 1Q1HA 2ADUA 4HLXA 4EJTA 2NNNA 5D5UB 4ZYDA 2V1UA 1ZRFA 3BWGA 3DQVC 5K5RA 4I09A 5A2QZ 4BAYA 5ICFA 3NRVA 2PEXA 1J2XA 2P5LC 4G7ZF 1FPQA 4UV9A 1LDDA 1P92A 3WTYC 5H20A 3HHHA 4EQQA 2LDUA 1ZGAA 1Y0UA 1XDSA 2Z33A 3HRUA 5TJJA 1IRFA 1I1SA 1P4XA 2P7CB 5HDGA 4L9JA 2DTRA 4RB0A 2ISYA 2B0LA 4LJZF 5IT3A 1R00A 4M9ZA 4ENMA 5D5XB 4GO1A 4O5VA 4G7OF 2XKOA 4EV0A 3RI4A 4LLNA 5LGTA 3BJOA 1LEBA 3FM3A 4P9UA 1G3TA 4PCQA 3DFGA 4LK1F 4G6QA 1ONVA 3JAMZ 1HKSA 3R4KA 5HLGA 1LDJA 5DD4A 1JHHA 2PJPA 3COAC 2CFXA 3O6BB 4ETSA 1BBYA 1ZYRF 1J7KA 2FMLA 2HS5A 1T0FA 2QZ8A 4LG0A 1S29A 4UVBA 2GAUA 3SXYA 1YW7A 1FWZA 1ZRCA 3R6SA 3ZPLA 1KA8A 2O8XA 5K1YA 1HW2A 1BIBA 4YG2F 1YW9A 4L9NA 3N4MA 4S05A 1GXQA 3KLNA 2V1DA 1XCVA 3GUDA 4MQVA 4GYIA 5JFRA 3M9AA 1FT9A 3E6DA 2YX7A 5CVJA 1R36A 4XRFA 1P4AA 5CVUA 4LB5A 1ULYA 2XASA 4CICA 3LQRA 1IXCA 3K0LA 4HF1A 3QU6A 4FX0A 4EM0B 1ZG1A 3V8JA 4I02A 3V8LA 2XVCA 3RJPA 3TOAA 1MJBA 2Z5UA 2ZNYA 3PQJA 1RIOH 3GFJA 5HLHA 4WX9A 2VOOA 4E70A 2QBYA 2OA4A 2A6EF 1OPCA 2F2EA 3FWEA 1EV7A 4PGHA 3U1DA 1VTNC 2ZKZA 4OIRF 3CUOA 5BS6A 3J80Z 4FX4A 2K4JA 1SMYF 2CW0F 3O3KA 2HTSA 1MGTA 1B59A 2BGCA 3DF8A 2H94A 2HTJA 1Z05A 5BPDA 3KLOA 3E5UA 1ZN2A 1CF7A 4XSZF 3R61A 2VBZA 5J6XA 4M6YA 2EA2A 2L54A 3Q5FA 5L3DA 2QBYB 5DCMA 1BN5A 3ZMDA 2D2WA 3MAJA 1Z9CA 5D5VB 1XSDA 3TDUC 2JSCA 4P5OA 3WTTC 1O3RA 3V7CA 2EFNA 1WI9A 2O3FA 5ILSA 1HQCA 3F8MA 3ZMZA 5ILUA 2E7XA 2QQ9A 5DD8A 3BP8A 1ZLJA 3QOPA 2PN6A 5HVQC 1FC3A 1TW3A 1R5HA 4YFKF 1ZHFA 1IRGA 4EM1A 5H6QA 2VXZA 4IVNA 4AWXB 2STTA 1CF7B 2ESHA 4R1HA 4KIFA 2FSWA 3SQNA 1KYWA 3F72A 1IW7F 1YIOA 5CVRA 3BPXA 3P9KA 3QPHA 5E1XA 4YIFA 2P6TA 2KKOA 4Z2YA 2R3SA 2VONA 5ICCA 2Y0MA 2H09A 2FRHA 4KN4X 1XD7A 4I98B 1KU7A 4LK0F 1U5TB 1O7LA 1HKTA 2DBBA 3PQKA 2QM3A 4Q47A 3F6VA 1UFMA 3DXJF 3I59A 2RDPA 5E20A 2F5CA 1OKRA 3MCZA 2W85A 3ULQB 2IJLA 2ZMEB 1L0OC 2LF7A 4KICA 5DEQA 1F4KA 4O3MA 2VC0A 3TOBA 3K1MA 1O7FA 1S8NA 4M6XA 4A6EA 4IHTA 2L3DA 3OV8A 1H9GA 5E8GA 1WQ2A 1X3UA 4I2OA 1P6RA 1T98A 5CYVA 2GZWA 1JHFA 3M8FA 5HLIA 3IHUA 3R60A 3I64A 1ON2A 2IRFG 2FF4A 1JGSA 3V4GA 4WK8F 2KIMA 2G7UA 3P9IA 2LSOA 2DAOA 3C7JA 3D0SA 2IA0A 3I59B 5AONA 3N97A 1W7PD 1G4DA 2QLZA 1C0WA 1XDUA 1FLIA 4Q48A 1HW5A 2EJRA 2MLGA 1BI2A 2E7WA 3H3UA 1SAXA 2PQ8A 2J5OA 3LA2A 2EV0A 4JK1X 4OOIA 3EYYA 3MQ0A 1SD4A 5ILVA 2F5EA 2OQRA 5IT9K 1YS7A 2L01A 1K6OA 4OIPF 4MTEA 2QVOA 3I4PA 1FP1D 3JTHA 1FP2A 2C6YA 3CUQC 4NB5A 4MEYF 4A0ZA 3FM5A 2F5DA 4HAMA 3BOQA 1DPRA 3FF5A 3KE2A 4HDUA 4IRHA 3HSFA 4LMYA 1ZLKA 2EFPA 4HA8A 2W84A 1DP7P 3ELKA 4LFUA 5J8FA 2CQKA 4WWCA 2LNBA 5LRSA 2HQNA 3KP2A 2XAFA 1XSXA 3L7WA 2GWRA 1MDMA 2FEZA 4JBAA 3PFIA 2MLKA 3B02A 4BHBA
chains in the Genus database with same CATH superfamily
2EH3A 3CCRI 2EFOA 5B66C 2YS9A 3LSRA 2FQ3A 5EG0B 2V1NA 3MZ8A 1K78A 5GTHC 2X1EA 4XLHA 3JSOA 3GCMA 4WXDA 5KAIC 3G3ZA 4AIHA 3FHZA 1Y1WJ 1PP8F 2WY8Q 4IL6C 2IEKA 2YR2A 2IGOA 2V6CA 1XMKA 4N4OB 4E7KA 2FBHA 4BUPA 1U6GA 2DO7A 3V8KA 2P5KA 4C2UA 5B1AH 1A6IA 2KLOA 1VQLI 2KZGA 1KU3A 5HOOA 2XUBA 1V5FA 1YX5A 1FBSA 3H35A 3I3LA 4RM3A 5J8CA 3ZOBA 2ZJRF 2Y48A 3D5LA 4U7DA 1TP4A 4BQNA 4XLFA 1R7JA 3W2WA 3VSKA 3LQQA 5B3SH 3L2UA 1HBXG 2DT7B 4HG2A 3RKYA 2K7LA 3CF2A 4L5JA 5FD6A 2B63J 1IJWC 3O2PE 2EFWA 3LAPA 3OWTA 3Q3SA 2EWNA 3KZIC 2ECBA 4HF0A 4M9XA 3GTJJ 4C3IJ 3T1BA 1LQ1A 1E3PA 2R4GA 1YO5C 1D1BA 3NAUA 3DP7A 3GTLJ 5E1WA 3HXLA 2ZCWA 5HS8A 3I56I 5M3FJ 2ID3A 1G3WA 4O6JA 4FTHA 1P9QC 1WJCA 1MDMB 4HEA2 3A2KA 3RZDJ 3WE3A 4GGGA 1XCBA 2AHQA 3HOXJ 1EJ9A 2VT3A 4MLOA 4DBRA 2OC6A 1K78B 1X2NA 3BTCA 2DMTA 1D1CA 4AVZA 1IN4A 4BHCA 2P7VB 3OOPA 3ZMUA 5D5WB 1TQPA 3RYRA 1IV8A 2CW7A 4MGRA 3SZGA 4BGDA 5LLQA 3AG4H 3ABMH 5EZGA 1VQ9I 5IP7J 2YU3A 3CQZJ 4R79A 2HVQA 3KEOA 5FB2A 1RUOA 1FEXA 1ZGJA 4PJMA 1PUFB 2QENA 1OJLA 3TP0A 2VBWA 2W24A 1AU7A 1X2MA 1Z21A 4X0GA 2L4AA 4ZC3A 2VBXA 2HXOA 1YOVB 1GLNA 3RKWA 1YHQI 3WODF 4A3FJ 3GTPJ 4QSHA 3BCAA 1U2WA 1MSEC 4A3EJ 2O8KA 1SD7A 1WH7A 2IPQX 3BR2A 3ZXSA 3WTZA 1IV6A 3WU2C 5JR3A 4OU0A 3ZQHA 1KQ9A 4XR6A 1YG2A 1QZYA 2FA5A 4ESJA 2R5ZA 1KGSA 2Q2EA 2E2HJ 1U9NA 3VYSB 2CSOA 2EK5A 2RVCA 3BR5A 4QWQA 5FO5A 2HKOA 5K7FA 2ZJPF 5J40A 2VE8A 1PVEA 1RNLA 2JPCA 3CC2I 4D5FA 1X3WB 1R22A 1N75A 1MNMC 2IW5A 1PYVA 2ZJQF 2CGPA 4L9TA 4M3DA 3RDIA 1JI8A 4PGGA 1TNTA 3BQYA 2E71A 4MNUA 1JTYA 4I7HA 3ZQGA 1JXSA 3LSPA 2VN2A 3KEQA 4HOBA 1XGSA 3CCEI 1IN8A 1QPMA 3W6VA 5K7ZA 1UAAA 2HYJA 4IXAA 1I27A 4RLQA 4LLLA 1JT6A 1CQTA 5M5YJ 2ECCA 2M87A 4UV8A 5H6RA 1FY7A 4L0ZB 2PFBA 4P9FA 4A0XA 1DU0A 2CUJA 4PJLA 1OISA 2E5ZA 4XRSG 4M3EA 3MD2A 3L2VA 2QKMB 3ROUA 2ME0A 3QRFF 3E1SA 2RV8A 1USSA 1G6NA 2XGXA 4KT6A 3U21A 1UG0A 2AQEA 4AIJA 4V19K 3F8CA 1LNWA 1N25A 2ZO4A 5LFAA 4BDYA 2X9DA 5J4YA 2HGCA 3DPTA 3ASNH 3R0AA 1R9TJ 1RC9A 4B1RA 3G73A 3HEFA 2NOGA 3FXJA 1TTYA 3GTOJ 3ZR8X 4A5MA 3MKLA 3J81Z 4G9YA 1YFHA 2FNAA 2O7OA 3H92A 4I0BA 3LSTA 1OFCX 3C2GA 4C2MJ 1W36C 1A6QA 1ZG3A 3TGNA 2Q2EB 2X0LA 1OR7C 4HBLA 3WHBA 2OPTA 3IRQA 3VPRA 5M3MJ 2QF7A 3LSGA 2GXGA 5HS7A 2E1MB 3Q0VA 3QOEA 1FSHA 3BDDA 4HZFA 3GZ6A 1W4MA 5DDGA 2JVGA 2XB5A 3AG2H 4J00A 3KEYA 4OIQF 2DA1A 4B44A 1ETYA 1XSVA 3HTUA 4ABZA 5JVTA 4ESFA 3E5QA 4HNUA 5HDNA 4H0EA 2X1DA 4NHJA 3OSFA 1LKXA 2W82A 2QCOA 3E3VA 3HYIA 3RQ4A 2XIGA 5DM7F 2E2IJ 3TW6A 3JTGA 1WCMJ 3WTVC 1UHSA 2JRTA 3P9CA 2V9PA 4HSTA 4LG3A 3IP4B 3DBLB 1LVKA 2CQNA 2VJ5A 5IP9J 3EQLF 4RGUA 5IYCJ 2QEXI 2DN0A 2R7VA 4CCNA 4XN0A 3I5UA 2GM4A 1LDKB 3GFIA 2RAEA 2V6EA 3RPQA 4V2GA 3ZP5A 1XX5A 2B7EA 3DWLE 3FXUA 2P6SA 3GWZA 4Z6YA 5FLXZ 1APLC 2VT2A 4LGWA 3CCVI 2RREA 4ZYEA 1QVUA 2Y69H 3RIRA 1K61A 1UHWA 2HQRA 4N0BA 2IBDA 2F4IA 2BYVE 5F27A 3JRHA 1O57A 1G2HA 1D1AA 1JUMA 2KT0A 1YIJI 1SC7A 4AUXA 2ELHA 3DV8A 4CZZA 4ZTFA 3CMMA 1FX7A 2XPUA 5EJCA 3B6CA 1HXDA 1Y39A 5IY5H 2K3PA 2MH9A 1H0MA 5E1ZB 3BG5A 2R7XA 1S7EA 5BPIA 4HQMA 2O61A 5B1BH 3CF5F 2D1VA 3DU6A 1MKMA 2E1NA 4HW0A 2TDXA 2NAZA 2OU2A 3ERED 3I55I 2DA7A 1UHMA 4G6DA 2EPFA 2HKXA 1J9IA 1F9NA 2L0KA 3L9FA 1XGMA 2XSDC 2WV0A 2L7MP 2OD5A 3OOUA 4AIDA 4CZCA 2BHYA 3LA3A 1V4RA 4D9JA 4W97A 4A93J 3V7SA 4HX4A 1QZEA 4PJJA 5CQEA 1D5YA 4RB2C 2DYRH 5GP9A 1WRJA 4RAFA 1B1BA 4S04A 2BV6A 1WKMA 3A4CA 4XNFA 3S2HJ 4NUBA 3ZCOA 3GFLA 2GLOA 2NXNB 1E2XA 4M71A 3SFZA 3CCMI 2NNYA 1XTAA 1VNDA 1IDYA 5HODA 1JUPA 3OYAA 2FOKA 3QP5A 3B73A 2COMA 2CYYA 3ASOH 3BCBA 4F93B 1BIAA 4DJAA 1T6SA 3IC7A 4XSXF 5C4JJ 2OF7A 3REOA 4F91B 3OYGA 2IXSA 3WU1B 1HF0A 1Z0XA 1U5TA 4ESBA 1MMAA 1RETA 3H9GA 1RZ4A 4YFNF 1IN6A 4RGSA 2Z1DA 3JRGA 1TWCJ 1LFBA 1LEAA 1SFXA 2EZLA 2NS0A 2EV5A 1SVOA 2HZTA 2QSFX 3E5XA 3NEUA 4GXOA 4BXUA 3E6CC 3CUQB 3PM1A 1TWHJ 2F6CA 5JLWA 4BYYA 2QKLB 2NRAC 1TL8A 2E5NA 3M1EA 3H36A 3QPTA 1FOKA 1U3EM 2BBYA 3OYNA 4EGZA 2QA4I 3EDPA 3PIPF 3FXKA 3NQOA 3GZNB 4ITVA 2XF6A 2OUMA 4OMYA 2R7TA 3E7LA 2ZMEA 4HQEA 2PBIA 1Y8QB 3RSNA 4UUSA 3OYKA 3VSLA 2CV1A 1R6RA 2GBYA 2W00A 3M8EA 2WB1N 3KFWX 2BXZA 4PK4A 3JREA 1OYIA 5E17F 3T8TA 3MVPA 4P55A 1QVTA 2VXDA 3KP4A 3EUHA 4MQ9F 2VOPA 1HOMA 1WGXA 4DIQA 2F48A 1Y56A 2CWEA 1FJLA 2V1XA 3ESWB 1WJDA 3DPUA 4P1WA 1VQMI 2FBIA 5GPAA 3Q9VA 3A1YA 1A5JA 4ZDPA 4S0HB 5D8KB 2HU9A 3DKYA 1PP7U 5C4XJ 4RAZA 2M7AA 1BR4A 1UCRA 2OV7A 1IXRC 2M0CA 3K4JA 1MMSA 2Z16A 1YQAA 2FQ4A 5E18F 1WH5A 3K2ZA 2GIVA 2OCEA 1ETVA 2DU9A 3NARA 4U0YA 2VUMJ 1P7IA 4FE7A 4QLCU 2LF8A 2OAZA 1MJ9A 4CDGA 4KT5C 2XPVA 4Y3OA 1NK2P 2F4MB 3EYIA 2GXBA 5A2QK 1EH8A 3IRRA 5FLVA 4PFPA 4E7SA 3ZMTA 4XRMA 2DA3A 2F5FA 3MZHA 3PJRA 2HXIA 2KRFA 2XC7A 2CUZA 4NC6A 2L9RA 3ABTA 5CVIA 2WADA 4M3BA 4H4KC 2MG4A 4M74A 3W2VA 4UUSB 3TDZC 4UNOA 5J1RA 2M5WA 4CCLA 2VKHA 5FRNA 1GXPA 1IUFA 3SYTA 5DS9A 2YX4A 2GA1A 1W7PA 1YITI 3QU3A 2N8GA 4ZH4F 5KK1A 3VFZA 4KDPA 2ZSHB 1J0RA 5D4RA 1S7AA 2Y75A 1GDTA 3S1MJ 1XC5A 3BZ6A 1XB4A 2EINH 4M72A 1UMQA 2Q1ZB 3FHNA 1BJZA 3VYTB 3MWMA 1DUXC 5E3NA 1F5TA 3K69A 1JKRC 2X85A 2I8DA 3I71A 4B8XA 5J1YA 3HSRA 9ANTA 1T0FC 1I3QJ 4EM2A 2A07F 5L3CA 3JRBA 1SVLA 2BZTA 2D1HA 2MBFA 1ZR4A 1HSJA 2V9VA 1ACIA 2NVQJ 4NC8A 5L3GA 1IN7A 1QZZA 3HM5A 2DQLA 3SEZA 2WB1A 3IWFA 2ACJA 2ZFUA 5JHFA 4FHTA 5FJ8J 1G3YA 4HF2A 1A04A 1IZ1A 1D0YA 5E3LA 2EV6A 3FK6A 1XGOA 4CXFA 4UY8I 4QTRA 5IOZA 2R7QA 3VYRB 2IA2A 3BPVA 4YRVA 2Z9OA 3HSEA 4GRIA 4UUVA 2NVTJ 4Y52J 2FUG2 3VEPA 2P5VA 3ABKH 2QQ8A 5LHHA 1IRXA 5EEHA 1U78A 1BI1A 4DYCA 2HYGD 2X6WA 3QWLA 2R7SA 3JAMK 3CCSI 1GVDA 1REPC 1EF4A 1XPXA 5IYDJ 2H6BA 2I5UA 3OL4A 5F6FA 3HRMA 1BC7C 4AM3A 4E7ZA 3F21A 2LD5A 1K6YA 5D8LB 4A3GJ 4IHVA 5LRRA 5LEKA 4KIBA 3WTUC 1Z77A 1W7PB 1RESA 3O8HA 4BACA 1KYZA 4ANJA 2IS2A 1CGPA 4I99C 4ON0A 1WJEA 1T39A 2A61A 5FFZA 4HV6A 2W57A 3C1DA 1EH7A 4HV5A 1O3SA 1FSEA 1IUYA 3A01A 5EG0A 1FBUA 5F1RA 1R23A 2A3SA 1SD5A 2P81A 3WU0A 3H3ZA 2M8EA 1TT5B 1U8RA 4A3KJ 1JKPC 2HPIA 1Q1VA 3E6BA 1STZA 3T8RA 1S72I 1I6XA 2W48A 3WGIA 1IRZA 3IH4A 3PNTA 3G4SI 4HDVA 3BY6A 3VYUB 2E2JJ 1SANA 1SFEA 5M5XJ 5DCFA 1T33A 4KMFA 5F1JA 2UXNA 2VIXA 1U0JA 3WHCA 5HLTA 1W36D 3ZQ7A 4EGYA 4RGXA 4WXHA 3GZ5A 2PMZN 1FIAA 4CSWA 1XS9A 2JN6A 5DYMA 3MZYA 1YRNA 3TO6A 3OYFA 3ML6A 1T95A 5IPAA 2KISA 1ZTRA 2PLYA 4XLNF 6PAXA 2VJ4A 2X6OA 5FGMA 1FBQA 5DTDA 2WWYA 2HOAA 2GXAA 2KQRA 2M4KA 5M5WJ 5GAHJ 4Y13A 2R7UA 4IOAF 1BOBA 1TLHB 3V7RA 4YELA 3K6GA 1OCOH 1Y0NA 3AL0B 1S7OA 3BTLA 2NS8A 2JA5J 1JGGA 1B9MA 2VB6A 2YUSA 4C2TA 2E60A 1DQUA 2BY1A 2M8GX 3M3YJ 2CQ7A 3LSKA 2IVMA 3RQIA 2CW8A 1Z6RA 4BH9A 4ZYGA 4JX6A 4PFOA 3A01B 3ECHA 2DFHA 4XICA 1HLVA 1FNNA 1E17A 3J80K 2HOEA 4Y17A 2XAHA 2JZYA 1BC8C 3U2RA 4LLGF 2LBFA 3ECOA 1KZHA 2QYOA 2HPMA 2KPMA 2D45A 3K4MA 1G3SA 4J01A 2LH9A 3ZRGA 4R8HA 1TWGJ 2Y0SN 4OMZA 4Q5SF 1PUFA 1S6LA 5IOYA 2DQRA 5F0CA 3KP3A 1OLTA 3RKQA 2W7NA 2GOXB 5FLMJ 4NQWB 2XB0X 2YPRA 3LMMA 3PSIA 3TQNA 5C3EJ 1FMWA 3TW7A 2LFBA 2XPWA 3FXOA 4PZJA 2EA4A 2G9WA 3DCFA 4A3JJ 2PI0A 3GF2A 1YRNB 5BNGA 2XF5A 2M30A 2IGNA 2RQQA 3QYEA 3SDBA 5LBQA 4Q4ZF 2ZNZA 3AKZA 2M34A 2O03A 2QQBA 4CCOA 4XRSA 2Y9ZA 3I54A 3JW4A 5GAGJ 4CGZA 1UB9A 4DZPA 1VQKI 1QA6A 2XHKA 1MZBA 3SZPA 2K27A 3ZN0A 1P4WA 5BOXA 2XDVA 3KX2A 3MKZA 2ZBKA 3CCUI 1BI3A 1QHGA 1R5GA 4EATA 3WTSC 2MD5A 3PUFA 1ORKA 3C2BA 3RPUD 2HYFA 4AVPA 4RA2A 1MBGA 2R93J 2H6CA 3WTWC 4U0VA 3IUOA 3BT9A 2Z2SB 2IAIA 3DTEA 1NHAA 4CCJA 3KIOA 2LLKA 2P4WA 2PMZA 3HRSA 2FOWA 5CLSA 2IP2A 2XAGA 3WGHA 4N9IA 2M7BA 2KRCA 1HKQA 3L09A 3Q9SA 3GX4X 1R1UA 2L7FP 2H8RA 1MMGA 3HIFA 2L7KA 3BQZA 2DYSH 4G6TB 2LY1A 4N9HA 2LBFB 2IS6A 2UUZA 2K40A 4L5EA 4D7MA 4BS9A 1GT0C 2IA1A 4KFCA 2RKHA 4G7HF 3S3MA 4IKFA 2LP0A 3VOEA 2VC1A 1NTCA 1QO0D 1FYMA 1OYYA 1W5SA 2K5CA 3QPSA 3L1PA 2EIJH 3OSGA 1Z3XA 1TWFJ 2MA3A 3SFIA 4IJAA 2DI3A 3CLOA 3S16J 3CESA 4ENJA 3ABLH 3BC8A 1B8IA 3AAFA 3BZKA 2VKDA 3DTIA 4JQFA 4MFEA 3OYEA 4RB1A 1B9NA 1WJBA 3GYHX 3UR3C 3CP2A 4HLYA 4XK4A 1X1CA 2M45A 3GXOA 1TW2A 4XKVA 1AKHB 3GLLA 4FE4A 3S1QJ 4UB6C 2Y0SA 1Y8RB 4BXFA 2OTLI 1VZ0A 2JA2A 3QQAA 4IF4A 2V4JC 5FFXA 1JKQC 1P2FA 1D5VA 5ERIA 4A3MJ 4KISA 2K3FA 2MFZA 1H9TA 5D6FA 1I39A 4GYGA 2CV0A 2RGVA 5F04A 3K9TA 3KZZA 1ON1A 3G1OA 2ISZA 4F7ZA 3KP7A 2R7WA 2FE3A 3SHFA 1J59A 2A5YB 1K7AA 2QUFA 3FISA 2LYCA 2KP6A 1G59A 2DMQA 1QNTA 2AQFA 3CD6I 2TRTA 1MH4A 4PUSA 4OINF 3WG9A 5EYRA 2JA7J 3E6MA 1IN5A 2JPBA 2XSJC 4BBRJ 1ETOA 1Z67A 1B4AA 4KIGA 1OCZH 3H5AA 5JLXA 4DOZA 4RS8A 1RPWA 2DOFA 2FMYA 3F8BA 2EILH 3T0YA 4LIUA 4UB8C 5J47A 3E97A 3EETA 1B8IB 3K2AA 3SEQA 1HDPA 3OMYA 1RR7A 2MC4A 2OQGA 3CLQA 5DUKA 3R0JA 1X58A 3CMYA 1LVAA 4DGWB 2EZHA 3KETA 5LEJA 2CU7A 4DYRA 3I58A 2LKPA 2UZKA 3A0BC 2CUFA 3S8PA 4I01A 4ZZDA 4DYQA 2DK8A 1RI7A 1Z7LA 1LUJB 4YIIA 3OS1A 4HNVA 2DJIA 1N78A 3G6EI 3I4NJ 3DBRB 2QQAA 5HNFA 5GPCA 2HR3A 1O3QA 4B09A 1SMTA 5F64A 3IV5A 4Y7NJ 3UNGC 2KDOA 2HWVA 3CJRB 4TV7A 4C9YA 1JKOC 2JT1A 2OJED 2O6GE 1KQ0A 1ODDA 1ZH5A 2OBPA 4BJTA 4FETA 4U7BA 4EMSA 4E7HA 1D8KA 4ZYAA 1HW1A 5GADJ 2FU4A 2X48A 3EUAA 3H5RA 3S93A 5IT9Z 1W0TA 4E7LA 5L3BA 5BQTA 5FKOA 1ZRDA 4GFBA 3PNVA 4X1EA 3JRIA 3S1RJ 5F0HA 1TWAJ 2X51A 4A6DA 4OAZA 1PUEE 3TO9A 2YU9J 3CDHA 1QU3A 4EJUA 2L9VA 4BL0B 2VE9A 3TEDA 1K79A 2TCTA 2JJ7A 2VQHA 4RAYA 2X1CA 1BI0A 3OIPA 4JX4A 4WF2A 1A35A 1R1VA 3VWBA 3ABUA 1BJAA 5J3LA 1OYWA 5HDKA 3P7NA 4KUMA 2L02A 4YEJA 1MNDA 1F1ZA 1I5ZA 4RLFA 3HOSA 2DXIA 3IAS2 1R58A 1FOYA 2A68F 2ZXWH 3FZVA 5FKNA 3T5XA 2XAQA 4IOCF 1GHCA 3L00A 3OY9A 3JRCA 1Z7UA 1ZARA 1HDDC 4PSXA 1X1PA 4BDZA 2J5PA 2Y30A 4PJNA 3FKIJ 1DPUA 3DLLF 3MMYB 3UKGA 5FROA 1M1EB 1T2KA 3M7GA 3MEXA 4A0YA 2D5VA 3OS0A 4UHTA 1IO2A 2Z99A 2XV4S 1YI2I 4OIOF 4LIVA 3PFYA 2M1BA 2R7ZJ 1J75A 4LG0B 3MKWB 4CH7A 4WXCA 5EGOA 4ZZLA 4RM2A 3CUQA 3GVAA 5TISC 2KIUA 1LPQA 2WAEA 1ETWA 1FTTA 3Q0UA 4N4NB 2EIMH 3C18A 3GEZA 5K5QA 2NS7A 2X4HA 1FZPB 3L2CA 3RTRA 2ME6A 1E3OC 4HYEA 3PSFA 1TQMA 3CDIA 1OMIA 4IPAA 1IXSB 1B6AA 2KJBA 5D6EA 4DZJA 5JI6A 5D4SA 2VQGA 5CPRB 3RKXA 2Y2ZA 2CG4A 3BZCA 3ZQLA 1MBJA 2BXYA 2L4MA 2BW3B 1K83J 5CJ9A 2AS5F 3V42A 3C2HA 3K4NA 4CO8A 4U0WA 5AIPA 4ENNA 5F0FA 1VFCA 2VBYA 3BJAA 2VI6A 2ZFWA 2BEOA 1GV2A 3TL4X 2XRNA 3H5NA 1IAWA 2HFHA 4XLPF 3D5RC 4IHSA 3GTQJ 3ZMVA 1GVJA 3CTAA 1XMXA 1JUSA 1S3JA 2LC2A 1D3YA 2OCCH 2P8TA 4G94A 4RGRA 2H27A 3BG7A 2RNJA 3BR3A 1I1GA 5FKLA 1FOWA 3LA7A 4BE0A 2CQQA 2E35A 2WV1A 2FNPA 4HSRA 3P5JA 2GA2A 1YYVA 1ZQ3P 3M8JA 4II3A 4UXNA 4ASNA 3QP6A 4B3XA 1H8AC 2BY3A 2A05A 2MH2A 4HX7A 5EGOB 2YSRA 3W6JB 3KYLA 2Q0OA 3JRDA 3SZTA 4BBSJ 4XONA 3MFKA 2MYSA 1FYKA 4F92B 1YS6A 5GAEJ 3KYCB 4BJ5C 5K5OA 4BY1J 4XIDA 4BE2A 2DK5A 4A3LJ 4Y33A 1MMDA 3F8NA 1JE8A 1G8XA 2RNGA 2W1OA 5E79C 2RC4A 4KITB 3FX3A 2BY0A 3BROA 5KAFC 3K70C 3CO6C 1W5TA 3KZYA 3W3CA 3L2WA 4KNYA 4V2FA 5KCMA 2KDZA 4D0PA 3BTIA 3W6KB 4HX8A 3J7AO 4AIKA 4HRIA 3IL2A 3KCCA 3VDXA 3L2QA 1J09A 3PO3J 3K7AJ 4L0YB 1PDNC 1WZ2A 4BU2A 1OCCH 3EPZA 3AG1H 4ZDLA 3HOTA 3K1NA 3GW2A 1Z91A 4BEHA 3F23A 1ETQA 4XL9A 3F0CA 5L3FA 5LD2C 5FRMA 2JQ7A 1EH6A 3GO5A 4XN3A 4M73A 4XORA 4E7JA 2W25A 4UVAA 2UV1A 1KU2A 2R7FA 3H0DA 4B4CA 3CCQI 4AD9A 3MN2A 4IO9F 1LJ9A 4A3CJ 1I50J 4PDKA 5C44J 1QBJA 1BA5A 4MHGA 4LB6B 3FBIB 1UELB 1S5LC 2HVRA 2Z3YA 3U9GA 1UZCA 4ZYHA 4FASD 5AIQA 5DM6F 5EEAA 3LAJA 3TKYA 3DKWA 2DFIA 3K1PA 5DCMB 2WA0A 2COBA 2UXXA 2DT6A 1KU9A 1V3FA 5FD5A 2VQCA 4IZZA 3VODA 3FMQA 3FXLA 2EQRA 2FD5A 2ZC2A 1BOAA 2RN7A 4IRIA 2AO9A 1USTA 1X1DA 2HQAA 4IQJA 4EJWA 3FXMA 3S3OA 3FBNB 2KJCA 2LG4A 4BKXA 4AC0A 4EVIA 5TGTA 4MEXF 5HS9A 4M6VA 4M9SA 2CH0A 4EJVA 1X1BA 3WG7H 3HUGA 5J1UA 1V55H 3HTSB 3DLAA 1VQ5I 4MTDA 1R71A 3FDYA 3WE2A 1FYLA 3WGGA 1IG7A 4L5IA 3FMSA 3G1LA 1MBFA 3WTXC 2LRDA 2EIKH 2V9KA 4BEHB 4F52A 2AXLA 4LD5A 1AA7A 3IKVA 3GTGJ 4DQ2A 3HJEA 5HNHA 3BR0A 5ICGA 3OYMA 1ZREA 3HGGA 1DU6A 2H1LA 1MH3A 3HZJA 2ELKA 2EZKA 2CO5A 4XMYA 2M4GA 1XMAA 3HOZJ 2MC3A 3JR9A 3I0TA 3ZN1A 3F3XA 1YW8A 5KNLA 3HRTA 2MD0A 1POGA 1F43A 3CC7I 3OYHA 2E34A 3PNYA 3LWFA 1BM9A 1AOYA 4XOTA 3LFKA 2H1KA 5CQGA 2DT5A 1EA3A 2OTJI 4OWRB 2XROA 4E6KG 2GQQA 2LMDA 3S14J 2JMWA 3I9V2 3H9QA 3IWZA 1UJ8A 2XAUA 1D8JA 2K86A 3D5SC 1KQ8A 1ETKA 4ENKA 1WFXA 3CCJI 5BMZA 2CUEA 2QWWA 3B6AA 1R1TA 4PJ0C 4MFDA 3OR1C 3J81K 4UVCA 3KP5A 4A5NA 3HUGB 2ZJ2A 1RUNA 3K4KA 3H0GJ 1TQIA 1ZAOA 4QPOA 4F3QA 4A2UA 5ICEA 4A12A 4E7IA 2V26A 3DEEA 4B48A 1OR7A 3BR6A 3LSHA 4BJ6C 1LE8A 3NWTA 2G7HA 5DV5A 4JX5A 3HDDA 2A69F 1AWCA 2K02A 4XBFA 3JSPA 1IGNA 2K85A 4G8XA 2HDCA 3NWSA 2V79A 4B3AA 1DGWY 3F8FA 5JHUA 1WSUA 1HSTA 1R4NB 2DMPA 1OCTC 4IHWA 4L9VA 1R4MB 3QODA 1MD0A 1MMNA 1P7JA 3FXQA 2DLLA 3O8GA 1YTYA 1QGPA 2EFQA 3CJQB 3Q0WA 4GCVA 5TRDA 1O3TA 3S32A 4KN7X 1NH3A 1AHDP 1JT0A 2DMNA 1MBHA 4P96A 4XKBA 3E0JB 5LGUA 4XOPA 4NQWA 5IP6A 4DNCA 2B9SA 3FMRA 2STWA 2DPDA 5H2FC 3ZQCA 2WC2A 5CVVA 3ZMSA 4CYDA 3OYLA 4Y4RA 2WTEA 3DEWA 3U1KA 5E3MA 2OZ6A 5LHIA 4D1QA 2FXAA 2VODA 1T38A 3I53A 5L3EA 5ED4A 1XGNA 1Z6TA 3S2WA 4II2A 3LNQA 1ZR2A 2R7RA 4I0AA 2DW4A 3HOWJ 2ELJA 3F22A 4BNCA 5E8IA 5FLXK 2KL4A 1FTZA 3SDGA 2K4BA 1WJAA 2DA6A 3GFMA 5EEGA 3VB2A 3CJTB 3LSIA 1T08B 2HEOA 1XN7A 3RYPA 1TNSA 2HDWA 4XKCA 2DOAA 1LE8B 2JA6J 3CO7C 5KVRA 2XGDA 2OZUA 2WBMA 2DPUA 3AFHA 1Z1DA 3KP6A 2R7DA 1WPKA 2XAJA 1Z3YA 3DBHB 3GLXA 4BHPA 3S15J 5GTIC 3RPUA 1MW7A 4WCGA 2UWMA 4XQFA 2X6XA 1LFPA 2H8WA 1VF9A 3CC4I 1QQIA 4IHXA 1YLFA 2KIFA 2ZB9A 3GMEA 2ZXHA 1ENHA 3DPLC 1U5TC 2PMHA 3BJ6A 1MNEA 2MGQA 3FK7A 1MJAA 1ZG5A 3ISPA 4EJOA 4BQAA 3L2RA 3QAHA 5LGNA 4KA4A 3OS2A 3IH3A 2PG4A 2IT0A 1DDNA 1SD6A 2IGKA 2NYXA 5EDNA 2VPRA 1L3LA 3TBIA 1WVRA 2DA5A 5DUIA 2EB7A 2FBKA 2BE5F 2VLAA 2M9HA 3OYCA 4YFXF 4KMUX 4ZJZA 3HOUJ 4C3JJ 4L18B 2WAQN 1RR8C 4Y15A 3FXRA 1AKHA 1WWXA 3DU5A 1IF1A 2RQPA 2L7ZA 3DEUA 2O5RA 4CYCA 2E1CA 4A3DJ 3HPGA 3G2BA 4K2EA 2ZMEC 2ESNA 2XGEA 1LB2A 1N77A 3CJNA 5LHGA 2PMUA 2HVSA 3C3WA 2BHZA 2CQXA 2JK3A 2BVLA 3HHGA 4KYWA 1J5YA 2Q8KA 2O0YA 2PX9A 2A6HF 4U88A 3EUHC 3F6OA 4QIWN 2NOJB 2ETHA 1HC8A 1KONA 3IKTA 1K4TA 2JTVA 1TBXA 4A3BJ 4RB3C 4FT8A 3TO7A 2QSHX 2XKPA 2E1OA 3J7YJ 2ZXJA 4IRGA 1Q1HA 2ADUA 2DCEA 4HLXA 1VQOI 4EJTA 2LKSA 2VKVA 1WJ5A 2NNNA 3HC7A 5D5UB 4AYBN 4ZYDA 2GIZA 1ZRFA 2V1UA 3OYDA 3BWGA 3A0HC 3DQVC 3IAM2 1MIJA 3OYJA 2QGUA 4FISA 5K5RA 4I09A 4M3GA 5A2QZ 2PJRA 4BAYA 5ICFA 3NRVA 2PEXA 1JJ8C 2NVXJ 1J2XA 2P5LC 4G7ZF 4CYCB 1FPQA 4UV9A 1LDDA 2VL8A 1EKEA 2DA4A 3K4CA 1P92A 3WTYC 3BR1A 5H20A 3HHHA 4EQQA 3DTKA 2LDUA 1ZGAA 1Y0UA 4J19A 1XDSA 2LOOA 2JWTA 2EBIA 4YIRX 4RDUA 3KPHA 2Z33A 3LSJA 3HRUA 5TJJA 1IRFA 1I1SA 1P4XA 2EZIA 4JP0A 2P7CB 5HDGA 4L9JA 2DTRA 2WAQA 1H89C 2LK2A 1SFOJ 3N05A 4RB0A 2ISYA 2B0LA 2WAFA 2KZVA 4LJZF 1BR1A 3K70D 4CA0A 1SEUA 5IT3A 1Y6IA 2G0EA 1E3HA 1R00A 2W4SA 4M9ZA 1WJFA 4ENMA 1TZLA 5D5XB 4GO1A 4XLEA 1RKWA 3HGYA 4O5VA 4G7OF 2XKOA 5IYBJ 4EV0A 3RI4A 4LLNA 3PUBA 3BJOA 5LGTA 1LEBA 3FM3A 2KFDA 1BL0A 4P9UA 4LOCA 3D1NI 2BVMA 3M07A 2XF7A 1G3TA 4PCQA 3DFGA 1V54H 2PJRB 4LK1F 4B43A 4XLCA 4G6QA 2ICWG 3OYIA 1TT0A 1ONVA 2DDAA 1OCRH 2ID6A 3JAMZ 3HG9A 1HKSA 1FIPA 3R4KA 5HLGA 1LDJA 5DD4A 4IHYA 1JHHA 1W1WE 2K9SA 3X2QH 3COAC 2PJPA 3AL0C 4HPQA 1VQPI 3S2DJ 3KYDB 4FQGA 2R5ZB 2CFXA 1UG2A 3O6BB 4AYBA 4ETSA 3J7AY 1BBYA 1NK3P 1ZYRF 1J7KA 3H1CA 4NC7A 2FMLA 2HS5A 1JJ6C 1VQ4I 1T0FA 2DOEA 2QZ8A 4LG0A 1S29A 4UVBA 1ZELA 2GAUA 2Y9YA 2L9SA 3OIOA 3SXYA 1YW7A 1FWZA 1ZRCA 3R6SA 3TMOA 3ZPLA 4U87A 2KMUA 1KA8A 3HL2A 2M3AA 2O8XA 3A03A 5K1YA 1HW2A 1BIBA 2E19A 4YG2F 1YW9A 4L9NA 3GTKJ 2HOTA 1SAUA 2VKEA 3N4MA 3S1NJ 1X19A 1VQ8I 4S05A 5K7HA 1GXQA 3KLNA 1ITYA 2V1DA 1XCVA 3GUDA 4MQVA 4GYIA 2BW3A 3DKXA 1X4OA 5JFRA 3M9AA 1FT9A 3E6DA 2YX7A 3JCUC 5CVJA 1R36A 4XRFA 3ZQIA 1P4AA 5CVUA 4LB5A 1ULYA 2XASA 2MABA 4CICA 3LQRA 1E0EA 2DFEA 1IXCA 3K0LA 2IS4A 4HF1A 3QU6A 4FX0A 2HDDA 1FOXA 4EM0B 1ZG1A 1ZGWA 2CS3A 3V8JA 4I02A 3V8LA 2XVCA 3RJPA 3TOAA 1MJBA 2BOLA 2Z5UA 3QYFA 2ZNYA 3PQJA 2R5YA 1RIOH 3GFJA 5HLHA 4WX9A 3ZQFA 4A69C 2VOOA 4E70A 2QBYA 4XLAA 2OA4A 2LY9A 2A6EF 1QRYA 1OPCA 2F2EA 3FWEA 1H88C 1EV7A 2VQLA 2LR8A 2K9NA 3HPHA 4BQOA 4PGHA 2F5VA 1LFUP 3U1DA 1VTNC 2ZKZA 3CCYA 1A31A 3CZ6A 4OIRF 3CUOA 5BS6A 4ZDOA 2DJNA 3J80Z 4M3FA 4FX4A 3OL3A 2K4JA 3QYBA 3M4OJ 1FMVA 1SMYF 2CW0F 4X6AJ 3O3KA 2HTSA 1MGTA 1B59A 3CMAI 2JA8J 4F55A 2BGCA 2A6TA 3DF8A 3ONQA 2H94A 1K4SA 3BG9A 2HTJA 1Z05A 2HQ5A 1MSFC 1OQYA 2HZDA 1HCRA 1HA8A 5BPDA 1DP3A 2ZXIA 1JTXA 3GTMJ 3KLOA 2L2OA 3E5UA 1YJWI 1ZN2A 3HOYJ 1SFUA 1NG6A 1CF7A 2JVHA 4BE1A 4XSZF 1Y1VJ 3R61A 3HB9A 4BQQA 2VBZA 5J6XA 1F36A 2IS1A 4M6YA 5KHDA 2DDBA 1U9OA 2JUGA 3HOVJ 2R5YB 2EA2A 2L54A 2LREA 3G71I 1NG7A 3Q5FA 5L3DA 2WY7Q 2BY2A 2QBYB 2JSPA 3ZGKA 5DCMA 1BN5A 3ZMDA 2D2WA 1W0UA 1D0ZA 3FKJA 3MAJA 4NBQA 1Z9CA 4I6ZA 5D5VB 1XSDA 1A36A 3TDUC 4RMNA 4JOMA 2JSCA 2DFFA 4P5OA 2F4OB 1YJNI 3I4MJ 1YE9A 4OAYA 3PIOF 3WTTC 2DA2A 3BTJA 3CCLI 1O3RA 3V7CA 2EFNA 2P0WA 2I10A 1WI9A 3K4LA 2O3FA 5ILSA 2KHMA 1HQCA 3IH2A 1RKTA 3F8MA 3LSMA 3ZMZA 5ILUA 2E7XA 2QQ9A 5DD8A 1W5CC 1ZLJA 3BP8A 1OCPA 2PN6A 3QOPA 5HVQC 1QPIA 1FC3A 1TW3A 2LKXA 1R5HA 4FCYA 4QPQA 4YFKF 1ZHFA 1IRGA 2VPLA 4EM1A 5H6QA 3HBLA 2VXZA 4IVNA 4AWXB 1GUUA 2STTA 5JVGF 3BG3A 1CF7B 2ESHA 4R1HA 5B5EC 3LOCA 2DMUA 4KIFA 2HOSA 2FSWA 2E1MC 3SQNA 1KYWA 3F72A 1IW7F 3MKYB 1YIOA 5CVRA 3BPXA 1IC8A 3P9KA 3QPHA 2A5WA 5E1XA 1BW6A 4YIFA 3RZOJ 2P6TA 1RRJA 1B72A 2KKOA 4C30A 4Z2YA 2R3SA 2VONA 5ICCA 3A02A 2Y0MA 2L5QA 1GV5A 1U8BA 2H09A 2FRHA 1I3AA 1XD7A 4KN4X 5EZHA 4I98B 1V5EA 3BG6A 2CRGA 5CKTA 4CUGA 1KU7A 2VJJA 4LK0F 1QHHD 1U5TB 4GDFA 1VI0A 1O7LA 4CHUA 1HKTA 3G1MA 3LL7A 3ERMA 2DBBA 4MIMA 1R49A 1ZK8A 3PQKA 2QM3A 4Q47A 1YX3A 4AU7A 3F6VA 1UFMA 3ZQQA 3DXJF 1SFKA 1X4PA 3I59A 2VJIA 2RDPA 5E20A 2ZSIB 1D0XA 2F5CA 1WI3A 4B47A 1OKRA 5F08A 3H3VK 2V7FA 3MCZA 2JUCA 2AXTC 2K9LA 2W85A 2IJLA 3ULQB 2LVSA 2ZMEB 1L0OC 2LF7A 3K4BA 1V5GA 1WHUA 2GOMA 4KICA 5DEQA 2HNHA 1F4KA 2FX0A 3OR2C 3JRFA 1VQNI 4O3MA 4C3HJ 1B72B 2VC0A 2NVUB 3TOBA 3K1MA 1O7FA 1S8NA 4M6XA 4IX7A 4A6EA 2CJJA 2CMPA 4IHTA 2L3DA 3OV8A 1H9GA 4W1UA 5E8GA 3EUKL 3RCOA 2QSGX 1WQ2A 2DODA 1X3UA 3CP8A 4BY7J 2XGCA 4I2OA 4CCKA 3FIWA 1P6RA 1T98A 5CYVA 2M0MA 3CDLA 4EEFG 2GZWA 1JHFA 3M8FA 5HLIA 2X6YA 3IHUA 3R60A 3I64A 4XM3A 1ON2A 5FKKA 2IRFG 2MSYA 1DGRM 1JGSA 2FF4A 3V4GA 4WK8F 2KIMA 4E4HA 1BR2A 1PJRA 2M2EA 3HKZN 1BW5A 2G7UA 3P9IA 2LSOA 2DAOA 1VQ7I 3D0SA 3C7JA 2IA0A 4NDLA 2FJ1A 5EF6A 3OIQA 2Y31A 3I59B 5AONA 3N97A 1W7PD 1G4DA 2QLZA 4RAGA 1XDUA 1C0WA 1FLIA 3JRAA 4Q48A 4DBQA 1HW5A 4IEJA 2O9LA 3W2AA 2EJRA 2MLGA 1BI2A 2E7WA 2LY2A 2IGMA 3H3UA 2NVYJ 1SAXA 1ETXA 2CFOA 2PQ8A 2R92J 2J5OA 3LA2A 2EV0A 2VASA 5J4VA 3F9KA 2LTPA 3H9JA 2K9QA 3J7ZI 1T8IA 3AG3H 4JK1X 2HI3A 4OOIA 4LITA 2CV2A 3S3NA 3EYYA 3MQ0A 4UUTA 1MBEA 1SD4A 5ILVA 2F5EA 4CCMA 2OQRA 5IT9K 1YS7A 3TP3A 4HNTA 2L01A 1K6OA 4OIPF 1XG1A 2QVOA 1X3ZB 3LFUA 4MTEA 3OYBA 4NNJA 4RBOA 2E36A 3I4PA 1FP1D 3JTHA 4KJZA 1FP2A 3CMEI 3CUQC 4IQ4A 4NB5A 2C6YA 2XRLA 3PL8A 4MEYF 4I76A 4A0ZA 3FM5A 2F5DA 4HAMA 2R7OA 1VQ6I 2R0QC 3S17J 3BOQA 1ERDA 2JRMA 1DPRA 3FF5A 1T56A 1O4XA 3KE2A 4HDUA 4DW6A 1X1AA 1YJ9I 4IRHA 3HSFA 4LMYA 4D7NA 4G12A 1ZLKA 4MO7A 1SVMA 2EFPA 4HA8A 2W84A 1DP7P 1TC3C 3GBGA 2KRHA 3ELKA 4LFUA 2MW8A 1MBKA 4A3IJ 1I6HJ 4JYKA 2L9NA 5J8FA 2CQKA 4WWCA 4ZTJA 2DTZA 2LNBA 1R5ID 5LRSA 2K9MA 3SJMA 2HQNA 3K10A 2KIQA 4XKWA 1S9HA 3KP2A 1IDZA 2XAFA 4PSWA 5FKMA 4D5CA 3HKZA 1XSXA 3L7WA 3BLYA 2GWRA 5E3OA 3QPLA 3M1CA 3PO2J 1MDMA 2FEZA 4BXXJ 4JBAA 3PFIA 2MLKA 3B02A 4BHBA 1ZKGA
chains in the Genus database with same CATH topology
2EFOA 2FQ3A 1K78A 3JSOA 4WXDA 3G3ZA 4AIHA 3FHZA 2YR2A 2V6CA 1XMKA 2FBHA 1U6GA 2DO7A 3V8KA 2P5KA 1KU3A 5HOOA 2XUBA 1FBSA 5J8CA 2Y48A 3D5LA 4U7DA 1R7JA 3LQQA 1HBXG 3RKYA 2K7LA 4L5JA 5FD6A 3O2PE 2EFWA 3LAPA 2EWNA 4HF0A 4M9XA 3T1BA 1LQ1A 1YO5C 3DP7A 5E1WA 2ZCWA 5HS8A 1G3WA 4O6JA 1MDMB 3WE3A 4GGGA 1XCBA 2VT3A 1K78B 1IN4A 4BHCA 2P7VB 3OOPA 3ZMUA 5D5WB 1TQPA 3RYRA 4MGRA 1SFUA 5LLQA 2YU3A 4R79A 3KEOA 5FB2A 1RUOA 1ZGJA 2QENA 2VBWA 2W24A 2L4AA 2VBXA 3RKWA 3WODF 1U2WA 1SD7A 2IPQX 3WTZA 5JR3A 4OU0A 1KQ9A 1YG2A 1QZYA 2FA5A 4ESJA 1KGSA 2Q2EA 2CSOA 2EK5A 2RVCA 4QWQA 5FO5A 2HKOA 2VE8A 1RNLA 2JPCA 1R22A 2IW5A 2CGPA 4L9TA 3RDIA 4PGGA 1TNTA 1JXSA 4MNUA 4I7HA 2VN2A 3KEQA 4HOBA 1XGSA 1IN8A 1QPMA 4IXAA 1I27A 4LLLA 2M87A 4UV8A 5H6RA 1FY7A 4L0ZB 2PFBA 4P9FA 4A0XA 1PP8F 3QRFF 3ROUA 2RV8A 1USSA 1G6NA 2XGXA 4AIJA 3F8CA 1LNWA 2ZO4A 2HGCA 3DPTA 3R0AA 3G73A 1TTYA 4A5MA 3J81Z 4G9YA 1YFHA 2FNAA 4I0BA 3H92A 3LSTA 1ZG3A 3TGNA 2X0LA 4HBLA 3IRQA 2GXGA 5HS7A 1FSHA 3BDDA 4HZFA 3GZ6A 1W4MA 5DDGA 4OIQF 1XSVA 3HTUA 5JVTA 4ESFA 3E5QA 5HDNA 4H0EA 4NHJA 3E3VA 3HYIA 2XIGA 3JTGA 3WTVC 2JRTA 3P9CA 3EQLF 4RGUA 3I5UA 1LDKB 3GFIA 3RPQA 3ZP5A 3FXUA 2P6SA 3GWZA 5FLXZ 2VT2A 4LGWA 4ZYEA 3RIRA 1UHWA 2HQRA 4N0BA 2BYVE 1O57A 2ELHA 3DV8A 4CZZA 1FX7A 1HXDA 2MH9A 1H0MA 5E1ZB 5BPIA 4HQMA 2O61A 2D1VA 1MKMA 2E1NA 4HW0A 2TDXA 2NAZA 2OU2A 3ERED 1UHMA 4G6DA 2HKXA 1J9IA 1F9NA 3L9FA 1XGMA 2WV0A 2OD5A 3LA3A 1V4RA 3V7SA 4HX4A 4RB2C 1WRJA 1B1BA 4S04A 2BV6A 1WKMA 3GFLA 1E2XA 4M71A 3SFZA 2NNYA 2FOKA 3QP5A 3B73A 2COMA 2CYYA 1BIAA 1T6SA 3IC7A 4XSXF 3REOA 3WU1B 1U5TA 4ESBA 4YFNF 1RZ4A 1IN6A 4RGSA 1LEAA 1SFXA 2NS0A 4BXUA 2EV5A 3E6CC 2HZTA 3E5XA 3NEUA 4GXOA 3CUQB 4BYYA 2NRAC 3M1EA 3QPTA 1FOKA 1U3EM 2BBYA 4EGZA 3EDPA 3NQOA 4OMYA 2ZMEA 4HQEA 2PBIA 3M8EA 3KFWX 1OYIA 5E17F 3T8TA 4P55A 3KP4A 3EUHA 4MQ9F 2VOPA 2CWEA 2V1XA 2FBIA 3Q9VA 5D8KB 1PP7U 4RAZA 1UCRA 1IXRC 1YQAA 5E18F 3K2ZA 2GIVA 2DU9A 4U0YA 4QLCU 2LF8A 2OAZA 1MJ9A 4CDGA 4KT5C 3EYIA 2GXBA 5A2QK 1EH8A 3IRRA 3ZMTA 2F5FA 3MZHA 2KRFA 3ABTA 5CVIA 4M74A 3TDZC 4UNOA 2M5WA 1GXPA 2YX4A 2GA1A 1W7PA 3QU3A 4ZH4F 5KK1A 3VFZA 4KDPA 1J0RA 5D4RA 1S7AA 2Y75A 3BZ6A 1XB4A 4M72A 1DUXC 3MWMA 1F5TA 3K69A 3I71A 4B8XA 3HSRA 4EM2A 2A07F 5L3CA 2D1HA 2MBFA 1HSJA 2V9VA 5L3GA 1IN7A 1QZZA 2DQLA 3IWFA 2ACJA 4FHTA 1G3YA 4HF2A 1A04A 1IZ1A 2EV6A 1XGOA 4CXFA 2IA2A 3BPVA 2Z9OA 3HSEA 4UUVA 3VEPA 2P5VA 5LHHA 5EEHA 1U78A 1BI1A 2HYGD 3JAMK 1REPC 2H6BA 5F6FA 3HRMA 1BC7C 3F21A 5D8LB 5LRRA 5LEKA 4KIBA 3WTUC 1W7PB 1KYZA 1CGPA 4ON0A 1T39A 2A61A 5FFZA 4HV6A 2W57A 3C1DA 1EH7A 4HV5A 1O3SA 1FSEA 1IUYA 1FBUA 5F1RA 1R23A 2A3SA 1SD5A 3WU0A 3H3ZA 2M8EA 1U8RA 3E6BA 1STZA 3T8RA 1I6XA 3WGIA 4HDVA 3BY6A 1SFEA 5DCFA 4KMFA 2UXNA 3ZQ7A 4EGYA 4RGXA 4WXHA 3GZ5A 5DYMA 3MZYA 3TO6A 3ML6A 2PLYA 4XLNF 6PAXA 5FGMA 1FBQA 2WWYA 4Y13A 1TLHB 3V7RA 1S7OA 1B9MA 2IVMA 1Z6RA 4BH9A 4ZYGA 3ECHA 1FNNA 1E17A 3J80K 2HOEA 4Y17A 2XAHA 2JZYA 1BC8C 3U2RA 4LLGF 3ECOA 2QYOA 2D45A 1G3SA 4R8HA 4OMZA 4Q5SF 1S6LA 2DQRA 3KP3A 2YPRA 3TQNA 4PZJA 2EA4A 2G9WA 2PI0A 3GF2A 5LBQA 2M30A 4Q4ZF 4CHUA 2ZNZA 2O03A 2QQBA 3I54A 3JW4A 4CGZA 1UB9A 2XHKA 1MZBA 3SZPA 2K27A 3ZN0A 1P4WA 5BOXA 2ZBKA 1BI3A 1R5GA 3WTSC 2MD5A 2HYFA 4AVPA 2H6CA 3WTWC 4U0VA 1NHAA 2P4WA 3HRSA 5CLSA 2IP2A 2XAGA 3WGHA 4N9IA 3L09A 1HKQA 3Q9SA 3GX4X 1R1UA 3HIFA 4N9HA 2IA1A 4KFCA 2RKHA 4G7HF 3VOEA 2VC1A 1QO0D 1FYMA 1OYYA 1W5SA 2MA3A 4IJAA 2DI3A 3CLOA 4ENJA 3AAFA 4JQFA 4RB1A 1B9NA 3GYHX 4HLYA 2M45A 3GXOA 1TW2A 4IF4A 5FFXA 1P2FA 1D5VA 5ERIA 1H9TA 5D6FA 4GYGA 2RGVA 3K9TA 3KZZA 1ON1A 2ISZA 4F7ZA 3KP7A 2FE3A 3SHFA 1J59A 2A5YB 1K7AA 2QUFA 1QNTA 4OINF 3WG9A 3E6MA 1IN5A 2JPBA 1B4AA 4KIGA 4RS8A 2FMYA 3F8BA 3T0YA 3E97A 3EETA 5DUKA 2OQGA 3R0JA 1LVAA 3KETA 5LEJA 3I58A 2LKPA 2UZKA 4I01A 4ZZDA 2DK8A 1RI7A 4YIIA 2QQAA 2HR3A 1O3QA 4B09A 5F64A 1SMTA 2HWVA 4TV7A 2JT1A 2O6GE 1KQ0A 1ODDA 1ZH5A 2OBPA 4U7BA 4EMSA 1D8KA 1HW1A 2FU4A 5IT9Z 5L3BA 5BQTA 1ZRDA 4A6DA 1PUEE 3TO9A 3CDHA 4EJUA 2VE9A 1K79A 4RAYA 1BI0A 4WF2A 1R1VA 3ABUA 1BJAA 1OYWA 5HDKA 3P7NA 4KUMA 2L02A 1F1ZA 1I5ZA 3HOSA 1R58A 2A68F 3FZVA 3T5XA 2XAQA 1GHCA 3L00A 1Z7UA 1ZARA 2J5PA 1DPUA 1T2KA 3M7GA 3MEXA 4A0YA 4UHTA 2Z99A 2XV4S 4OIOF 2M1BA 1J75A 4LG0B 4WXCA 4ZZLA 3CUQA 3GVAA 2KIUA 3C18A 3GEZA 5K5QA 2X4HA 1FZPB 3L2CA 3RTRA 4HYEA 1TQMA 1OMIA 4IPAA 1IXSB 1B6AA 2KJBA 5D6EA 5JI6A 5D4SA 3RKXA 2CG4A 2L4MA 5CJ9A 2AS5F 4CO8A 4U0WA 5AIPA 4ENNA 2VBYA 3BJAA 2ZFWA 2BEOA 2XRNA 1IAWA 2HFHA 4XLPF 4IHSA 3ZMVA 1GVJA 3CTAA 1S3JA 1D3YA 2P8TA 4G94A 4RGRA 2H27A 2RNJA 1I1GA 3LA7A 2FNPA 2GA2A 1YYVA 4ASNA 4UXNA 3QP6A 2MH2A 4HX7A 2YSRA 3W6JB 2Q0OA 3SZTA 3MFKA 1FYKA 1YS6A 5K5OA 2DK5A 3F8NA 1JE8A 2RC4A 3FX3A 3BROA 3CO6C 1W5TA 3KZYA 4KNYA 4D0PA 3W6KB 4HX8A 3J7AO 4AIKA 3IL2A 3KCCA 4L0YB 1PDNC 3HOTA 3K1NA 3GW2A 1Z91A 3F23A 5L3FA 1EH6A 3GO5A 4M73A 2W25A 4UVAA 1KU2A 2R7FA 4AD9A 1LJ9A 4PDKA 1QBJA 4MHGA 4LB6B 2Z3YA 3U9GA 4ZYHA 5AIQA 3LAJA 3TKYA 3DKWA 2DFIA 3K1PA 5DCMB 2UXXA 1KU9A 1V3FA 5FD5A 3VODA 3FMQA 1BOAA 2RN7A 4IRIA 1USTA 4EJWA 2KJCA 4EVIA 4MEXF 5HS9A 4M9SA 4EJVA 3HUGA 3HTSB 4MTDA 3WE2A 1FYLA 3WGGA 4L5IA 3FMSA 3WTXC 2AXLA 4LD5A 3IKVA 4DQ2A 5ICGA 1ZREA 2CO5A 1XMAA 2MC3A 3I0TA 3ZN1A 3F3XA 1YW8A 3HRTA 3LWFA 1BM9A 1AOYA 3LFKA 2DT5A 2XROA 2GQQA 3IWZA 1D8JA 2K86A 1KQ8A 4ENKA 5BMZA 2QWWA 1R1TA 3J81K 4UVCA 3KP5A 4A5NA 2ZJ2A 1RUNA 1TQIA 1ZAOA 4A2UA 5ICEA 4A12A 1OR7A 2G7HA 5DV5A 2A69F 1AWCA 2K02A 4XBFA 3JSPA 4G8XA 2HDCA 2V79A 5JHUA 3F8FA 1WSUA 1HSTA 4L9VA 1MD0A 3FXQA 2DLLA 1YTYA 1QGPA 2EFQA 4GCVA 5TRDA 1O3TA 4KN7X 4P96A 5LGUA 4NQWA 4DNCA 2STWA 3FMRA 2DPDA 2WC2A 5CVVA 3ZMSA 4CYDA 2WTEA 2OZ6A 5LHIA 2FXAA 2VODA 1T38A 3I53A 5L3EA 5ED4A 1XGNA 1Z6TA 3S2WA 4I0AA 2DW4A 3F22A 4BNCA 5E8IA 5FLXK 2K4BA 5EEGA 3GFMA 3VB2A 2HEOA 1XN7A 3RYPA 1TNSA 3CO7C 5KVRA 2OZUA 2DPUA 1Z1DA 3KP6A 2R7DA 2XAJA 3GLXA 4BHPA 3RPUA 4WCGA 2UWMA 1QQIA 1YLFA 2KIFA 3DPLC 1U5TC 2PMHA 3BJ6A 1MJAA 1ZG5A 3ISPA 4EJOA 4BQAA 3QAHA 5LGNA 4KA4A 2PG4A 2IT0A 1DDNA 1SD6A 2NYXA 1L3LA 5DUIA 2EB7A 2FBKA 2BE5F 4YFXF 4KMUX 4L18B 4Y15A 3FXRA 1WWXA 1IF1A 2RQPA 3DEUA 2E1CA 4K2EA 2ESNA 1LB2A 3CJNA 5LHGA 2PMUA 3C3WA 3HHGA 4KYWA 1J5YA 2Q8KA 2O0YA 2A6HF 4U88A 3F6OA 2ETHA 3IKTA 2JTVA 1TBXA 4RB3C 4FT8A 3TO7A 2XKPA 2ZXJA 4IRGA 1Q1HA 2ADUA 4HLXA 4EJTA 2NNNA 5D5UB 4ZYDA 2V1UA 1ZRFA 3BWGA 3DQVC 5K5RA 4I09A 5A2QZ 4BAYA 5ICFA 3NRVA 2PEXA 1J2XA 2P5LC 4G7ZF 1FPQA 4UV9A 1LDDA 1P92A 3WTYC 5H20A 3HHHA 4EQQA 2LDUA 1ZGAA 1Y0UA 1XDSA 2Z33A 3HRUA 5TJJA 1IRFA 1I1SA 1P4XA 2P7CB 5HDGA 4L9JA 2DTRA 4RB0A 2ISYA 2B0LA 4LJZF 5IT3A 1R00A 4M9ZA 4ENMA 5D5XB 4GO1A 4O5VA 4G7OF 2XKOA 4EV0A 3RI4A 4LLNA 5LGTA 3BJOA 1LEBA 3FM3A 4P9UA 1G3TA 4PCQA 3DFGA 4LK1F 4G6QA 1ONVA 3JAMZ 1HKSA 3R4KA 5HLGA 1LDJA 5DD4A 1JHHA 2PJPA 3COAC 2CFXA 3O6BB 4ETSA 1BBYA 1ZYRF 1J7KA 2FMLA 2HS5A 1T0FA 2QZ8A 4LG0A 1S29A 4UVBA 2GAUA 3SXYA 1YW7A 1FWZA 1ZRCA 3R6SA 3ZPLA 1KA8A 2O8XA 5K1YA 1HW2A 1BIBA 4YG2F 1YW9A 4L9NA 3N4MA 4S05A 1GXQA 3KLNA 2V1DA 1XCVA 3GUDA 4MQVA 4GYIA 5JFRA 3M9AA 1FT9A 3E6DA 2YX7A 5CVJA 1R36A 4XRFA 1P4AA 5CVUA 4LB5A 1ULYA 2XASA 4CICA 3LQRA 1IXCA 3K0LA 4HF1A 3QU6A 4FX0A 4EM0B 1ZG1A 3V8JA 4I02A 3V8LA 2XVCA 3RJPA 3TOAA 1MJBA 2Z5UA 2ZNYA 3PQJA 1RIOH 3GFJA 5HLHA 4WX9A 2VOOA 4E70A 2QBYA 2OA4A 2A6EF 1OPCA 2F2EA 3FWEA 1EV7A 4PGHA 3U1DA 1VTNC 2ZKZA 4OIRF 3CUOA 5BS6A 3J80Z 4FX4A 2K4JA 1SMYF 2CW0F 3O3KA 2HTSA 1MGTA 1B59A 2BGCA 3DF8A 2H94A 2HTJA 1Z05A 5BPDA 3KLOA 3E5UA 1ZN2A 1CF7A 4XSZF 3R61A 2VBZA 5J6XA 4M6YA 2EA2A 2L54A 3Q5FA 5L3DA 2QBYB 5DCMA 1BN5A 3ZMDA 2D2WA 3MAJA 1Z9CA 5D5VB 1XSDA 3TDUC 2JSCA 4P5OA 3WTTC 1O3RA 3V7CA 2EFNA 1WI9A 2O3FA 5ILSA 1HQCA 3F8MA 3ZMZA 5ILUA 2E7XA 2QQ9A 5DD8A 3BP8A 1ZLJA 3QOPA 2PN6A 5HVQC 1FC3A 1TW3A 1R5HA 4YFKF 1ZHFA 1IRGA 4EM1A 5H6QA 2VXZA 4IVNA 4AWXB 2STTA 1CF7B 2ESHA 4R1HA 4KIFA 2FSWA 3SQNA 1KYWA 3F72A 1IW7F 1YIOA 5CVRA 3BPXA 3P9KA 3QPHA 5E1XA 4YIFA 2P6TA 2KKOA 4Z2YA 2R3SA 2VONA 5ICCA 2Y0MA 2H09A 2FRHA 4KN4X 1XD7A 4I98B 1KU7A 4LK0F 1U5TB 1O7LA 1HKTA 2DBBA 3PQKA 2QM3A 4Q47A 3F6VA 1UFMA 3DXJF 3I59A 2RDPA 5E20A 2F5CA 1OKRA 3MCZA 2W85A 3ULQB 2IJLA 2ZMEB 1L0OC 2LF7A 4KICA 5DEQA 1F4KA 4O3MA 2VC0A 3TOBA 3K1MA 1O7FA 1S8NA 4M6XA 4A6EA 4IHTA 2L3DA 3OV8A 1H9GA 5E8GA 1WQ2A 1X3UA 4I2OA 1P6RA 1T98A 5CYVA 2GZWA 1JHFA 3M8FA 5HLIA 3IHUA 3R60A 3I64A 1ON2A 2IRFG 2FF4A 1JGSA 3V4GA 4WK8F 2KIMA 2G7UA 3P9IA 2LSOA 2DAOA 3C7JA 3D0SA 2IA0A 3I59B 5AONA 3N97A 1W7PD 1G4DA 2QLZA 1C0WA 1XDUA 1FLIA 4Q48A 1HW5A 2EJRA 2MLGA 1BI2A 2E7WA 3H3UA 1SAXA 2PQ8A 2J5OA 3LA2A 2EV0A 4JK1X 4OOIA 3EYYA 3MQ0A 1SD4A 5ILVA 2F5EA 2OQRA 5IT9K 1YS7A 2L01A 1K6OA 4OIPF 4MTEA 2QVOA 3I4PA 1FP1D 3JTHA 1FP2A 2C6YA 3CUQC 4NB5A 4MEYF 4A0ZA 3FM5A 2F5DA 4HAMA 3BOQA 1DPRA 3FF5A 3KE2A 4HDUA 4IRHA 3HSFA 4LMYA 1ZLKA 2EFPA 4HA8A 2W84A 1DP7P 3ELKA 4LFUA 5J8FA 2CQKA 4WWCA 2LNBA 5LRSA 2HQNA 3KP2A 2XAFA 1XSXA 3L7WA 2GWRA 1MDMA 2FEZA 4JBAA 3PFIA 2MLKA 3B02A 4BHBA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2EFO A;  2FQ3 A;  1K78 A;  3JSO A;  4WXD A;  3G3Z A;  4AIH A;  3FHZ A;  2YR2 A;  2V6C A;  1XMK A;  2FBH A;  1U6G A;  2DO7 A;  3V8K A;  2P5K A;  1KU3 A;  5HOO A;  2XUB A;  1FBS A;  5J8C A;  2Y48 A;  3D5L A;  4U7D A;  1R7J A;  3LQQ A;  1HBX G;  3RKY A;  2K7L A;  4L5J A;  5FD6 A;  3O2P E;  2EFW A;  3LAP A;  2EWN A;  4HF0 A;  4M9X A;  3T1B A;  1LQ1 A;  1YO5 C;  3DP7 A;  5E1W A;  2ZCW A;  5HS8 A;  1G3W A;  4O6J A;  1MDM B;  3WE3 A;  4GGG A;  1XCB A;  2VT3 A;  1K78 B;  1IN4 A;  4BHC A;  2P7V B;  3OOP A;  3ZMU A;  5D5W B;  1TQP A;  3RYR A;  4MGR A;  1SFU A;  5LLQ A;  2YU3 A;  4R79 A;  3KEO A;  5FB2 A;  1RUO A;  1ZGJ A;  2QEN A;  2VBW A;  2W24 A;  2L4A A;  2VBX A;  3RKW A;  3WOD F;  1U2W A;  1SD7 A;  2IPQ X;  3WTZ A;  5JR3 A;  4OU0 A;  1KQ9 A;  1YG2 A;  1QZY A;  2FA5 A;  4ESJ A;  1KGS A;  2Q2E A;  2CSO A;  2EK5 A;  2RVC A;  4QWQ A;  5FO5 A;  2HKO A;  2VE8 A;  1RNL A;  2JPC A;  1R22 A;  2IW5 A;  2CGP A;  4L9T A;  3RDI A;  4PGG A;  1TNT A;  1JXS A;  4MNU A;  4I7H A;  2VN2 A;  3KEQ A;  4HOB A;  1XGS A;  1IN8 A;  1QPM A;  4IXA A;  1I27 A;  4LLL A;  2M87 A;  4UV8 A;  5H6R A;  1FY7 A;  4L0Z B;  2PFB A;  4P9F A;  4A0X A;  1PP8 F;  3QRF F;  3ROU A;  2RV8 A;  1USS A;  1G6N A;  2XGX A;  4AIJ A;  3F8C A;  1LNW A;  2ZO4 A;  2HGC A;  3DPT A;  3R0A A;  3G73 A;  1TTY A;  4A5M A;  3J81 Z;  4G9Y A;  1YFH A;  2FNA A;  4I0B A;  3H92 A;  3LST A;  1ZG3 A;  3TGN A;  2X0L A;  4HBL A;  3IRQ A;  2GXG A;  5HS7 A;  1FSH A;  3BDD A;  4HZF A;  3GZ6 A;  1W4M A;  5DDG A;  4OIQ F;  1XSV A;  3HTU A;  5JVT A;  4ESF A;  3E5Q A;  5HDN A;  4H0E A;  4NHJ A;  3E3V A;  3HYI A;  2XIG A;  3JTG A;  3WTV C;  2JRT A;  3P9C A;  3EQL F;  4RGU A;  3I5U A;  1LDK B;  3GFI A;  3RPQ A;  3ZP5 A;  3FXU A;  2P6S A;  3GWZ A;  5FLX Z;  2VT2 A;  4LGW A;  4ZYE A;  3RIR A;  1UHW A;  2HQR A;  4N0B A;  2BYV E;  1O57 A;  2ELH A;  3DV8 A;  4CZZ A;  1FX7 A;  1HXD A;  2MH9 A;  1H0M A;  5E1Z B;  5BPI A;  4HQM A;  2O61 A;  2D1V A;  1MKM A;  2E1N A;  4HW0 A;  2TDX A;  2NAZ A;  2OU2 A;  3ERE D;  1UHM A;  4G6D A;  2HKX A;  1J9I A;  1F9N A;  3L9F A;  1XGM A;  2WV0 A;  2OD5 A;  3LA3 A;  1V4R A;  3V7S A;  4HX4 A;  4RB2 C;  1WRJ A;  1B1B A;  4S04 A;  2BV6 A;  1WKM A;  3GFL A;  1E2X A;  4M71 A;  3SFZ A;  2NNY A;  2FOK A;  3QP5 A;  3B73 A;  2COM A;  2CYY A;  1BIA A;  1T6S A;  3IC7 A;  4XSX F;  3REO A;  3WU1 B;  1U5T A;  4ESB A;  4YFN F;  1RZ4 A;  1IN6 A;  4RGS A;  1LEA A;  1SFX A;  2NS0 A;  4BXU A;  2EV5 A;  3E6C C;  2HZT A;  3E5X A;  3NEU A;  4GXO A;  3CUQ B;  4BYY A;  2NRA C;  3M1E A;  3QPT A;  1FOK A;  1U3E M;  2BBY A;  4EGZ A;  3EDP A;  3NQO A;  4OMY A;  2ZME A;  4HQE A;  2PBI A;  3M8E A;  3KFW X;  1OYI A;  5E17 F;  3T8T A;  4P55 A;  3KP4 A;  3EUH A;  4MQ9 F;  2VOP A;  2CWE A;  2V1X A;  2FBI A;  3Q9V A;  5D8K B;  1PP7 U;  4RAZ A;  1UCR A;  1IXR C;  1YQA A;  5E18 F;  3K2Z A;  2GIV A;  2DU9 A;  4U0Y A;  4QLC U;  2LF8 A;  2OAZ A;  1MJ9 A;  4CDG A;  4KT5 C;  3EYI A;  2GXB A;  5A2Q K;  1EH8 A;  3IRR A;  3ZMT A;  2F5F A;  3MZH A;  2KRF A;  3ABT A;  5CVI A;  4M74 A;  3TDZ C;  4UNO A;  2M5W A;  1GXP A;  2YX4 A;  2GA1 A;  1W7P A;  3QU3 A;  4ZH4 F;  5KK1 A;  3VFZ A;  4KDP A;  1J0R A;  5D4R A;  1S7A A;  2Y75 A;  3BZ6 A;  1XB4 A;  4M72 A;  1DUX C;  3MWM A;  1F5T A;  3K69 A;  3I71 A;  4B8X A;  3HSR A;  4EM2 A;  2A07 F;  5L3C A;  2D1H A;  2MBF A;  1HSJ A;  2V9V A;  5L3G A;  1IN7 A;  1QZZ A;  2DQL A;  3IWF A;  2ACJ A;  4FHT A;  1G3Y A;  4HF2 A;  1A04 A;  1IZ1 A;  2EV6 A;  1XGO A;  4CXF A;  2IA2 A;  3BPV A;  2Z9O A;  3HSE A;  4UUV A;  3VEP A;  2P5V A;  5LHH A;  5EEH A;  1U78 A;  1BI1 A;  2HYG D;  3JAM K;  1REP C;  2H6B A;  5F6F A;  3HRM A;  1BC7 C;  3F21 A;  5D8L B;  5LRR A;  5LEK A;  4KIB A;  3WTU C;  1W7P B;  1KYZ A;  1CGP A;  4ON0 A;  1T39 A;  2A61 A;  5FFZ A;  4HV6 A;  2W57 A;  3C1D A;  1EH7 A;  4HV5 A;  1O3S A;  1FSE A;  1IUY A;  1FBU A;  5F1R A;  1R23 A;  2A3S A;  1SD5 A;  3WU0 A;  3H3Z A;  2M8E A;  1U8R A;  3E6B A;  1STZ A;  3T8R A;  1I6X A;  3WGI A;  4HDV A;  3BY6 A;  1SFE A;  5DCF A;  4KMF A;  2UXN A;  3ZQ7 A;  4EGY A;  4RGX A;  4WXH A;  3GZ5 A;  5DYM A;  3MZY A;  3TO6 A;  3ML6 A;  2PLY A;  4XLN F;  6PAX A;  5FGM A;  1FBQ A;  2WWY A;  4Y13 A;  1TLH B;  3V7R A;  1S7O A;  1B9M A;  2IVM A;  1Z6R A;  4BH9 A;  4ZYG A;  3ECH A;  1FNN A;  1E17 A;  3J80 K;  2HOE A;  4Y17 A;  2XAH A;  2JZY A;  1BC8 C;  3U2R A;  4LLG F;  3ECO A;  2QYO A;  2D45 A;  1G3S A;  4R8H A;  4OMZ A;  4Q5S F;  1S6L A;  2DQR A;  3KP3 A;  2YPR A;  3TQN A;  4PZJ A;  2EA4 A;  2G9W A;  2PI0 A;  3GF2 A;  5LBQ A;  2M30 A;  4Q4Z F;  4CHU A;  2ZNZ A;  2O03 A;  2QQB A;  3I54 A;  3JW4 A;  4CGZ A;  1UB9 A;  2XHK A;  1MZB A;  3SZP A;  2K27 A;  3ZN0 A;  1P4W A;  5BOX A;  2ZBK A;  1BI3 A;  1R5G A;  3WTS C;  2MD5 A;  2HYF A;  4AVP A;  2H6C A;  3WTW C;  4U0V A;  1NHA A;  2P4W A;  3HRS A;  5CLS A;  2IP2 A;  2XAG A;  3WGH A;  4N9I A;  3L09 A;  1HKQ A;  3Q9S A;  3GX4 X;  1R1U A;  3HIF A;  4N9H A;  2IA1 A;  4KFC A;  2RKH A;  4G7H F;  3VOE A;  2VC1 A;  1QO0 D;  1FYM A;  1OYY A;  1W5S A;  2MA3 A;  4IJA A;  2DI3 A;  3CLO A;  4ENJ A;  3AAF A;  4JQF A;  4RB1 A;  1B9N A;  3GYH X;  4HLY A;  2M45 A;  3GXO A;  1TW2 A;  4IF4 A;  5FFX A;  1P2F A;  1D5V A;  5ERI A;  1H9T A;  5D6F A;  4GYG A;  2RGV A;  3K9T A;  3KZZ A;  1ON1 A;  2ISZ A;  4F7Z A;  3KP7 A;  2FE3 A;  3SHF A;  1J59 A;  2A5Y B;  1K7A A;  2QUF A;  1QNT A;  4OIN F;  3WG9 A;  3E6M A;  1IN5 A;  2JPB A;  1B4A A;  4KIG A;  4RS8 A;  2FMY A;  3F8B A;  3T0Y A;  3E97 A;  3EET A;  5DUK A;  2OQG A;  3R0J A;  1LVA A;  3KET A;  5LEJ A;  3I58 A;  2LKP A;  2UZK A;  4I01 A;  4ZZD A;  2DK8 A;  1RI7 A;  4YII A;  2QQA A;  2HR3 A;  1O3Q A;  4B09 A;  5F64 A;  1SMT A;  2HWV A;  4TV7 A;  2JT1 A;  2O6G E;  1KQ0 A;  1ODD A;  1ZH5 A;  2OBP A;  4U7B A;  4EMS A;  1D8K A;  1HW1 A;  2FU4 A;  5IT9 Z;  5L3B A;  5BQT A;  1ZRD A;  4A6D A;  1PUE E;  3TO9 A;  3CDH A;  4EJU A;  2VE9 A;  1K79 A;  4RAY A;  1BI0 A;  4WF2 A;  1R1V A;  3ABU A;  1BJA A;  1OYW A;  5HDK A;  3P7N A;  4KUM A;  2L02 A;  1F1Z A;  1I5Z A;  3HOS A;  1R58 A;  2A68 F;  3FZV A;  3T5X A;  2XAQ A;  1GHC A;  3L00 A;  1Z7U A;  1ZAR A;  2J5P A;  1DPU A;  1T2K A;  3M7G A;  3MEX A;  4A0Y A;  4UHT A;  2Z99 A;  2XV4 S;  4OIO F;  2M1B A;  1J75 A;  4LG0 B;  4WXC A;  4ZZL A;  3CUQ A;  3GVA A;  2KIU A;  3C18 A;  3GEZ A;  5K5Q A;  2X4H A;  1FZP B;  3L2C A;  3RTR A;  4HYE A;  1TQM A;  1OMI A;  4IPA A;  1IXS B;  1B6A A;  2KJB A;  5D6E A;  5JI6 A;  5D4S A;  3RKX A;  2CG4 A;  2L4M A;  5CJ9 A;  2AS5 F;  4CO8 A;  4U0W A;  5AIP A;  4ENN A;  2VBY A;  3BJA A;  2ZFW A;  2BEO A;  2XRN A;  1IAW A;  2HFH A;  4XLP F;  4IHS A;  3ZMV A;  1GVJ A;  3CTA A;  1S3J A;  1D3Y A;  2P8T A;  4G94 A;  4RGR A;  2H27 A;  2RNJ A;  1I1G A;  3LA7 A;  2FNP A;  2GA2 A;  1YYV A;  4ASN A;  4UXN A;  3QP6 A;  2MH2 A;  4HX7 A;  2YSR A;  3W6J B;  2Q0O A;  3SZT A;  3MFK A;  1FYK A;  1YS6 A;  5K5O A;  2DK5 A;  3F8N A;  1JE8 A;  2RC4 A;  3FX3 A;  3BRO A;  3CO6 C;  1W5T A;  3KZY A;  4KNY A;  4D0P A;  3W6K B;  4HX8 A;  3J7A O;  4AIK A;  3IL2 A;  3KCC A;  4L0Y B;  1PDN C;  3HOT A;  3K1N A;  3GW2 A;  1Z91 A;  3F23 A;  5L3F A;  1EH6 A;  3GO5 A;  4M73 A;  2W25 A;  4UVA A;  1KU2 A;  2R7F A;  4AD9 A;  1LJ9 A;  4PDK A;  1QBJ A;  4MHG A;  4LB6 B;  2Z3Y A;  3U9G A;  4ZYH A;  5AIQ A;  3LAJ A;  3TKY A;  3DKW A;  2DFI A;  3K1P A;  5DCM B;  2UXX A;  1KU9 A;  1V3F A;  5FD5 A;  3VOD A;  3FMQ A;  1BOA A;  2RN7 A;  4IRI A;  1UST A;  4EJW A;  2KJC A;  4EVI A;  4MEX F;  5HS9 A;  4M9S A;  4EJV A;  3HUG A;  3HTS B;  4MTD A;  3WE2 A;  1FYL A;  3WGG A;  4L5I A;  3FMS A;  3WTX C;  2AXL A;  4LD5 A;  3IKV A;  4DQ2 A;  5ICG A;  1ZRE A;  2CO5 A;  1XMA A;  2MC3 A;  3I0T A;  3ZN1 A;  3F3X A;  1YW8 A;  3HRT A;  3LWF A;  1BM9 A;  1AOY A;  3LFK A;  2DT5 A;  2XRO A;  2GQQ A;  3IWZ A;  1D8J A;  2K86 A;  1KQ8 A;  4ENK A;  5BMZ A;  2QWW A;  1R1T A;  3J81 K;  4UVC A;  3KP5 A;  4A5N A;  2ZJ2 A;  1RUN A;  1TQI A;  1ZAO A;  4A2U A;  5ICE A;  4A12 A;  1OR7 A;  2G7H A;  5DV5 A;  2A69 F;  1AWC A;  2K02 A;  4XBF A;  3JSP A;  4G8X A;  2HDC A;  2V79 A;  5JHU A;  3F8F A;  1WSU A;  1HST A;  4L9V A;  1MD0 A;  3FXQ A;  2DLL A;  1YTY A;  1QGP A;  2EFQ A;  4GCV A;  5TRD A;  1O3T A;  4KN7 X;  4P96 A;  5LGU A;  4NQW A;  4DNC A;  2STW A;  3FMR A;  2DPD A;  2WC2 A;  5CVV A;  3ZMS A;  4CYD A;  2WTE A;  2OZ6 A;  5LHI A;  2FXA A;  2VOD A;  1T38 A;  3I53 A;  5L3E A;  5ED4 A;  1XGN A;  1Z6T A;  3S2W A;  4I0A A;  2DW4 A;  3F22 A;  4BNC A;  5E8I A;  5FLX K;  2K4B A;  5EEG A;  3GFM A;  3VB2 A;  2HEO A;  1XN7 A;  3RYP A;  1TNS A;  3CO7 C;  5KVR A;  2OZU A;  2DPU A;  1Z1D A;  3KP6 A;  2R7D A;  2XAJ A;  3GLX A;  4BHP A;  3RPU A;  4WCG A;  2UWM A;  1QQI A;  1YLF A;  2KIF A;  3DPL C;  1U5T C;  2PMH A;  3BJ6 A;  1MJA A;  1ZG5 A;  3ISP A;  4EJO A;  4BQA A;  3QAH A;  5LGN A;  4KA4 A;  2PG4 A;  2IT0 A;  1DDN A;  1SD6 A;  2NYX A;  1L3L A;  5DUI A;  2EB7 A;  2FBK A;  2BE5 F;  4YFX F;  4KMU X;  4L18 B;  4Y15 A;  3FXR A;  1WWX A;  1IF1 A;  2RQP A;  3DEU A;  2E1C A;  4K2E A;  2ESN A;  1LB2 A;  3CJN A;  5LHG A;  2PMU A;  3C3W A;  3HHG A;  4KYW A;  1J5Y A;  2Q8K A;  2O0Y A;  2A6H F;  4U88 A;  3F6O A;  2ETH A;  3IKT A;  2JTV A;  1TBX A;  4RB3 C;  4FT8 A;  3TO7 A;  2XKP A;  2ZXJ A;  4IRG A;  1Q1H A;  2ADU A;  4HLX A;  4EJT A;  2NNN A;  5D5U B;  4ZYD A;  2V1U A;  1ZRF A;  3BWG A;  3DQV C;  5K5R A;  4I09 A;  5A2Q Z;  4BAY A;  5ICF A;  3NRV A;  2PEX A;  1J2X A;  2P5L C;  4G7Z F;  1FPQ A;  4UV9 A;  1LDD A;  1P92 A;  3WTY C;  5H20 A;  3HHH A;  4EQQ A;  2LDU A;  1ZGA A;  1Y0U A;  1XDS A;  2Z33 A;  3HRU A;  5TJJ A;  1IRF A;  1I1S A;  1P4X A;  2P7C B;  5HDG A;  4L9J A;  2DTR A;  4RB0 A;  2ISY A;  2B0L A;  4LJZ F;  5IT3 A;  1R00 A;  4M9Z A;  4ENM A;  5D5X B;  4GO1 A;  4O5V A;  4G7O F;  2XKO A;  4EV0 A;  3RI4 A;  4LLN A;  5LGT A;  3BJO A;  1LEB A;  3FM3 A;  4P9U A;  1G3T A;  4PCQ A;  3DFG A;  4LK1 F;  4G6Q A;  1ONV A;  3JAM Z;  1HKS A;  3R4K A;  5HLG A;  1LDJ A;  5DD4 A;  1JHH A;  2PJP A;  3COA C;  2CFX A;  3O6B B;  4ETS A;  1BBY A;  1ZYR F;  1J7K A;  2FML A;  2HS5 A;  1T0F A;  2QZ8 A;  4LG0 A;  1S29 A;  4UVB A;  2GAU A;  3SXY A;  1YW7 A;  1FWZ A;  1ZRC A;  3R6S A;  3ZPL A;  1KA8 A;  2O8X A;  5K1Y A;  1HW2 A;  1BIB A;  4YG2 F;  1YW9 A;  4L9N A;  3N4M A;  4S05 A;  1GXQ A;  3KLN A;  2V1D A;  1XCV A;  3GUD A;  4MQV A;  4GYI A;  5JFR A;  3M9A A;  1FT9 A;  3E6D A;  2YX7 A;  5CVJ A;  1R36 A;  4XRF A;  1P4A A;  5CVU A;  4LB5 A;  1ULY A;  2XAS A;  4CIC A;  3LQR A;  1IXC A;  3K0L A;  4HF1 A;  3QU6 A;  4FX0 A;  4EM0 B;  1ZG1 A;  3V8J A;  4I02 A;  3V8L A;  2XVC A;  3RJP A;  3TOA A;  1MJB A;  2Z5U A;  2ZNY A;  3PQJ A;  1RIO H;  3GFJ A;  5HLH A;  4WX9 A;  2VOO A;  4E70 A;  2QBY A;  2OA4 A;  2A6E F;  1OPC A;  2F2E A;  3FWE A;  1EV7 A;  4PGH A;  3U1D A;  1VTN C;  2ZKZ A;  4OIR F;  3CUO A;  5BS6 A;  3J80 Z;  4FX4 A;  2K4J A;  1SMY F;  2CW0 F;  3O3K A;  2HTS A;  1MGT A;  1B59 A;  2BGC A;  3DF8 A;  2H94 A;  2HTJ A;  1Z05 A;  5BPD A;  3KLO A;  3E5U A;  1ZN2 A;  1CF7 A;  4XSZ F;  3R61 A;  2VBZ A;  5J6X A;  4M6Y A;  2EA2 A;  2L54 A;  3Q5F A;  5L3D A;  2QBY B;  5DCM A;  1BN5 A;  3ZMD A;  2D2W A;  3MAJ A;  1Z9C A;  5D5V B;  1XSD A;  3TDU C;  2JSC A;  4P5O A;  3WTT C;  1O3R A;  3V7C A;  2EFN A;  1WI9 A;  2O3F A;  5ILS A;  1HQC A;  3F8M A;  3ZMZ A;  5ILU A;  2E7X A;  2QQ9 A;  5DD8 A;  3BP8 A;  1ZLJ A;  3QOP A;  2PN6 A;  5HVQ C;  1FC3 A;  1TW3 A;  1R5H A;  4YFK F;  1ZHF A;  1IRG A;  4EM1 A;  5H6Q A;  2VXZ A;  4IVN A;  4AWX B;  2STT A;  1CF7 B;  2ESH A;  4R1H A;  4KIF A;  2FSW A;  3SQN A;  1KYW A;  3F72 A;  1IW7 F;  1YIO A;  5CVR A;  3BPX A;  3P9K A;  3QPH A;  5E1X A;  4YIF A;  2P6T A;  2KKO A;  4Z2Y A;  2R3S A;  2VON A;  5ICC A;  2Y0M A;  2H09 A;  2FRH A;  4KN4 X;  1XD7 A;  4I98 B;  1KU7 A;  4LK0 F;  1U5T B;  1O7L A;  1HKT A;  2DBB A;  3PQK A;  2QM3 A;  4Q47 A;  3F6V A;  1UFM A;  3DXJ F;  3I59 A;  2RDP A;  5E20 A;  2F5C A;  1OKR A;  3MCZ A;  2W85 A;  3ULQ B;  2IJL A;  2ZME B;  1L0O C;  2LF7 A;  4KIC A;  5DEQ A;  1F4K A;  4O3M A;  2VC0 A;  3TOB A;  3K1M A;  1O7F A;  1S8N A;  4M6X A;  4A6E A;  4IHT A;  2L3D A;  3OV8 A;  1H9G A;  5E8G A;  1WQ2 A;  1X3U A;  4I2O A;  1P6R A;  1T98 A;  5CYV A;  2GZW A;  1JHF A;  3M8F A;  5HLI A;  3IHU A;  3R60 A;  3I64 A;  1ON2 A;  2IRF G;  2FF4 A;  1JGS A;  3V4G A;  4WK8 F;  2KIM A;  2G7U A;  3P9I A;  2LSO A;  2DAO A;  3C7J A;  3D0S A;  2IA0 A;  3I59 B;  5AON A;  3N97 A;  1W7P D;  1G4D A;  2QLZ A;  1C0W A;  1XDU A;  1FLI A;  4Q48 A;  1HW5 A;  2EJR A;  2MLG A;  1BI2 A;  2E7W A;  3H3U A;  1SAX A;  2PQ8 A;  2J5O A;  3LA2 A;  2EV0 A;  4JK1 X;  4OOI A;  3EYY A;  3MQ0 A;  1SD4 A;  5ILV A;  2F5E A;  2OQR A;  5IT9 K;  1YS7 A;  2L01 A;  1K6O A;  4OIP F;  4MTE A;  2QVO A;  3I4P A;  1FP1 D;  3JTH A;  1FP2 A;  2C6Y A;  3CUQ C;  4NB5 A;  4MEY F;  4A0Z A;  3FM5 A;  2F5D A;  4HAM A;  3BOQ A;  1DPR A;  3FF5 A;  3KE2 A;  4HDU A;  4IRH A;  3HSF A;  4LMY A;  1ZLK A;  2EFP A;  4HA8 A;  2W84 A;  1DP7 P;  3ELK A;  4LFU A;  5J8F A;  2CQK A;  4WWC A;  2LNB A;  5LRS A;  2HQN A;  3KP2 A;  2XAF A;  1XSX A;  3L7W A;  2GWR A;  1MDM A;  2FEZ A;  4JBA A;  3PFI A;  2MLK A;  3B02 A;  4BHB A; 
#chains in the Genus database with same CATH topology
 2EH3 A;  3CCR I;  2EFO A;  5B66 C;  2YS9 A;  3LSR A;  2FQ3 A;  5EG0 B;  2V1N A;  3MZ8 A;  1K78 A;  5GTH C;  2X1E A;  4XLH A;  3JSO A;  3GCM A;  4WXD A;  5KAI C;  3G3Z A;  4AIH A;  3FHZ A;  1Y1W J;  1PP8 F;  2WY8 Q;  4IL6 C;  2IEK A;  2YR2 A;  2IGO A;  2V6C A;  1XMK A;  4N4O B;  4E7K A;  2FBH A;  4BUP A;  1U6G A;  2DO7 A;  3V8K A;  2P5K A;  4C2U A;  5B1A H;  1A6I A;  2KLO A;  1VQL I;  2KZG A;  1KU3 A;  5HOO A;  2XUB A;  1V5F A;  1YX5 A;  1FBS A;  3H35 A;  3I3L A;  4RM3 A;  5J8C A;  3ZOB A;  2ZJR F;  2Y48 A;  3D5L A;  4U7D A;  1TP4 A;  4BQN A;  4XLF A;  1R7J A;  3W2W A;  3VSK A;  3LQQ A;  5B3S H;  3L2U A;  1HBX G;  2DT7 B;  4HG2 A;  3RKY A;  2K7L A;  3CF2 A;  4L5J A;  5FD6 A;  2B63 J;  1IJW C;  3O2P E;  2EFW A;  3LAP A;  3OWT A;  3Q3S A;  2EWN A;  3KZI C;  2ECB A;  4HF0 A;  4M9X A;  3GTJ J;  4C3I J;  3T1B A;  1LQ1 A;  1E3P A;  2R4G A;  1YO5 C;  1D1B A;  3NAU A;  3DP7 A;  3GTL J;  5E1W A;  3HXL A;  2ZCW A;  5HS8 A;  3I56 I;  5M3F J;  2ID3 A;  1G3W A;  4O6J A;  4FTH A;  1P9Q C;  1WJC A;  1MDM B;  4HEA 2;  3A2K A;  3RZD J;  3WE3 A;  4GGG A;  1XCB A;  2AHQ A;  3HOX J;  1EJ9 A;  2VT3 A;  4MLO A;  4DBR A;  2OC6 A;  1K78 B;  1X2N A;  3BTC A;  2DMT A;  1D1C A;  4AVZ A;  1IN4 A;  4BHC A;  2P7V B;  3OOP A;  3ZMU A;  5D5W B;  1TQP A;  3RYR A;  1IV8 A;  2CW7 A;  4MGR A;  3SZG A;  4BGD A;  5LLQ A;  3AG4 H;  3ABM H;  5EZG A;  1VQ9 I;  5IP7 J;  2YU3 A;  3CQZ J;  4R79 A;  2HVQ A;  3KEO A;  5FB2 A;  1RUO A;  1FEX A;  1ZGJ A;  4PJM A;  1PUF B;  2QEN A;  1OJL A;  3TP0 A;  2VBW A;  2W24 A;  1AU7 A;  1X2M A;  1Z21 A;  4X0G A;  2L4A A;  4ZC3 A;  2VBX A;  2HXO A;  1YOV B;  1GLN A;  3RKW A;  1YHQ I;  3WOD F;  4A3F J;  3GTP J;  4QSH A;  3BCA A;  1U2W A;  1MSE C;  4A3E J;  2O8K A;  1SD7 A;  1WH7 A;  2IPQ X;  3BR2 A;  3ZXS A;  3WTZ A;  1IV6 A;  3WU2 C;  5JR3 A;  4OU0 A;  3ZQH A;  1KQ9 A;  4XR6 A;  1YG2 A;  1QZY A;  2FA5 A;  4ESJ A;  2R5Z A;  1KGS A;  2Q2E A;  2E2H J;  1U9N A;  3VYS B;  2CSO A;  2EK5 A;  2RVC A;  3BR5 A;  4QWQ A;  5FO5 A;  2HKO A;  5K7F A;  2ZJP F;  5J40 A;  2VE8 A;  1PVE A;  1RNL A;  2JPC A;  3CC2 I;  4D5F A;  1X3W B;  1R22 A;  1N75 A;  1MNM C;  2IW5 A;  1PYV A;  2ZJQ F;  2CGP A;  4L9T A;  4M3D A;  3RDI A;  1JI8 A;  4PGG A;  1TNT A;  3BQY A;  2E71 A;  4MNU A;  1JTY A;  4I7H A;  3ZQG A;  1JXS A;  3LSP A;  2VN2 A;  3KEQ A;  4HOB A;  1XGS A;  3CCE I;  1IN8 A;  1QPM A;  3W6V A;  5K7Z A;  1UAA A;  2HYJ A;  4IXA A;  1I27 A;  4RLQ A;  4LLL A;  1JT6 A;  1CQT A;  5M5Y J;  2ECC A;  2M87 A;  4UV8 A;  5H6R A;  1FY7 A;  4L0Z B;  2PFB A;  4P9F A;  4A0X A;  1DU0 A;  2CUJ A;  4PJL A;  1OIS A;  2E5Z A;  4XRS G;  4M3E A;  3MD2 A;  3L2V A;  2QKM B;  3ROU A;  2ME0 A;  3QRF F;  3E1S A;  2RV8 A;  1USS A;  1G6N A;  2XGX A;  4KT6 A;  3U21 A;  1UG0 A;  2AQE A;  4AIJ A;  4V19 K;  3F8C A;  1LNW A;  1N25 A;  2ZO4 A;  5LFA A;  4BDY A;  2X9D A;  5J4Y A;  2HGC A;  3DPT A;  3ASN H;  3R0A A;  1R9T J;  1RC9 A;  4B1R A;  3G73 A;  3HEF A;  2NOG A;  3FXJ A;  1TTY A;  3GTO J;  3ZR8 X;  4A5M A;  3MKL A;  3J81 Z;  4G9Y A;  1YFH A;  2FNA A;  2O7O A;  3H92 A;  4I0B A;  3LST A;  1OFC X;  3C2G A;  4C2M J;  1W36 C;  1A6Q A;  1ZG3 A;  3TGN A;  2Q2E B;  2X0L A;  1OR7 C;  4HBL A;  3WHB A;  2OPT A;  3IRQ A;  3VPR A;  5M3M J;  2QF7 A;  3LSG A;  2GXG A;  5HS7 A;  2E1M B;  3Q0V A;  3QOE A;  1FSH A;  3BDD A;  4HZF A;  3GZ6 A;  1W4M A;  5DDG A;  2JVG A;  2XB5 A;  3AG2 H;  4J00 A;  3KEY A;  4OIQ F;  2DA1 A;  4B44 A;  1ETY A;  1XSV A;  3HTU A;  4ABZ A;  5JVT A;  4ESF A;  3E5Q A;  4HNU A;  5HDN A;  4H0E A;  2X1D A;  4NHJ A;  3OSF A;  1LKX A;  2W82 A;  2QCO A;  3E3V A;  3HYI A;  3RQ4 A;  2XIG A;  5DM7 F;  2E2I J;  3TW6 A;  3JTG A;  1WCM J;  3WTV C;  1UHS A;  2JRT A;  3P9C A;  2V9P A;  4HST A;  4LG3 A;  3IP4 B;  3DBL B;  1LVK A;  2CQN A;  2VJ5 A;  5IP9 J;  3EQL F;  4RGU A;  5IYC J;  2QEX I;  2DN0 A;  2R7V A;  4CCN A;  4XN0 A;  3I5U A;  2GM4 A;  1LDK B;  3GFI A;  2RAE A;  2V6E A;  3RPQ A;  4V2G A;  3ZP5 A;  1XX5 A;  2B7E A;  3DWL E;  3FXU A;  2P6S A;  3GWZ A;  4Z6Y A;  5FLX Z;  1APL C;  2VT2 A;  4LGW A;  3CCV I;  2RRE A;  4ZYE A;  1QVU A;  2Y69 H;  3RIR A;  1K61 A;  1UHW A;  2HQR A;  4N0B A;  2IBD A;  2F4I A;  2BYV E;  5F27 A;  3JRH A;  1O57 A;  1G2H A;  1D1A A;  1JUM A;  2KT0 A;  1YIJ I;  1SC7 A;  4AUX A;  2ELH A;  3DV8 A;  4CZZ A;  4ZTF A;  3CMM A;  1FX7 A;  2XPU A;  5EJC A;  3B6C A;  1HXD A;  1Y39 A;  5IY5 H;  2K3P A;  2MH9 A;  1H0M A;  5E1Z B;  3BG5 A;  2R7X A;  1S7E A;  5BPI A;  4HQM A;  2O61 A;  5B1B H;  3CF5 F;  2D1V A;  3DU6 A;  1MKM A;  2E1N A;  4HW0 A;  2TDX A;  2NAZ A;  2OU2 A;  3ERE D;  3I55 I;  2DA7 A;  1UHM A;  4G6D A;  2EPF A;  2HKX A;  1J9I A;  1F9N A;  2L0K A;  3L9F A;  1XGM A;  2XSD C;  2WV0 A;  2L7M P;  2OD5 A;  3OOU A;  4AID A;  4CZC A;  2BHY A;  3LA3 A;  1V4R A;  4D9J A;  4W97 A;  4A93 J;  3V7S A;  4HX4 A;  1QZE A;  4PJJ A;  5CQE A;  1D5Y A;  4RB2 C;  2DYR H;  5GP9 A;  1WRJ A;  4RAF A;  1B1B A;  4S04 A;  2BV6 A;  1WKM A;  3A4C A;  4XNF A;  3S2H J;  4NUB A;  3ZCO A;  3GFL A;  2GLO A;  2NXN B;  1E2X A;  4M71 A;  3SFZ A;  3CCM I;  2NNY A;  1XTA A;  1VND A;  1IDY A;  5HOD A;  1JUP A;  3OYA A;  2FOK A;  3QP5 A;  3B73 A;  2COM A;  2CYY A;  3ASO H;  3BCB A;  4F93 B;  1BIA A;  4DJA A;  1T6S A;  3IC7 A;  4XSX F;  5C4J J;  2OF7 A;  3REO A;  4F91 B;  3OYG A;  2IXS A;  3WU1 B;  1HF0 A;  1Z0X A;  1U5T A;  4ESB A;  1MMA A;  1RET A;  3H9G A;  1RZ4 A;  4YFN F;  1IN6 A;  4RGS A;  2Z1D A;  3JRG A;  1TWC J;  1LFB A;  1LEA A;  1SFX A;  2EZL A;  2NS0 A;  2EV5 A;  1SVO A;  2HZT A;  2QSF X;  3E5X A;  3NEU A;  4GXO A;  4BXU A;  3E6C C;  3CUQ B;  3PM1 A;  1TWH J;  2F6C A;  5JLW A;  4BYY A;  2QKL B;  2NRA C;  1TL8 A;  2E5N A;  3M1E A;  3H36 A;  3QPT A;  1FOK A;  1U3E M;  2BBY A;  3OYN A;  4EGZ A;  2QA4 I;  3EDP A;  3PIP F;  3FXK A;  3NQO A;  3GZN B;  4ITV A;  2XF6 A;  2OUM A;  4OMY A;  2R7T A;  3E7L A;  2ZME A;  4HQE A;  2PBI A;  1Y8Q B;  3RSN A;  4UUS A;  3OYK A;  3VSL A;  2CV1 A;  1R6R A;  2GBY A;  2W00 A;  3M8E A;  2WB1 N;  3KFW X;  2BXZ A;  4PK4 A;  3JRE A;  1OYI A;  5E17 F;  3T8T A;  3MVP A;  4P55 A;  1QVT A;  2VXD A;  3KP4 A;  3EUH A;  4MQ9 F;  2VOP A;  1HOM A;  1WGX A;  4DIQ A;  2F48 A;  1Y56 A;  2CWE A;  1FJL A;  2V1X A;  3ESW B;  1WJD A;  3DPU A;  4P1W A;  1VQM I;  2FBI A;  5GPA A;  3Q9V A;  3A1Y A;  1A5J A;  4ZDP A;  4S0H B;  5D8K B;  2HU9 A;  3DKY A;  1PP7 U;  5C4X J;  4RAZ A;  2M7A A;  1BR4 A;  1UCR A;  2OV7 A;  1IXR C;  2M0C A;  3K4J A;  1MMS A;  2Z16 A;  1YQA A;  2FQ4 A;  5E18 F;  1WH5 A;  3K2Z A;  2GIV A;  2OCE A;  1ETV A;  2DU9 A;  3NAR A;  4U0Y A;  2VUM J;  1P7I A;  4FE7 A;  4QLC U;  2LF8 A;  2OAZ A;  1MJ9 A;  4CDG A;  4KT5 C;  2XPV A;  4Y3O A;  1NK2 P;  2F4M B;  3EYI A;  2GXB A;  5A2Q K;  1EH8 A;  3IRR A;  5FLV A;  4PFP A;  4E7S A;  3ZMT A;  4XRM A;  2DA3 A;  2F5F A;  3MZH A;  3PJR A;  2HXI A;  2KRF A;  2XC7 A;  2CUZ A;  4NC6 A;  2L9R A;  3ABT A;  5CVI A;  2WAD A;  4M3B A;  4H4K C;  2MG4 A;  4M74 A;  3W2V A;  4UUS B;  3TDZ C;  4UNO A;  5J1R A;  2M5W A;  4CCL A;  2VKH A;  5FRN A;  1GXP A;  1IUF A;  3SYT A;  5DS9 A;  2YX4 A;  2GA1 A;  1W7P A;  1YIT I;  3QU3 A;  2N8G A;  4ZH4 F;  5KK1 A;  3VFZ A;  4KDP A;  2ZSH B;  1J0R A;  5D4R A;  1S7A A;  2Y75 A;  1GDT A;  3S1M J;  1XC5 A;  3BZ6 A;  1XB4 A;  2EIN H;  4M72 A;  1UMQ A;  2Q1Z B;  3FHN A;  1BJZ A;  3VYT B;  3MWM A;  1DUX C;  5E3N A;  1F5T A;  3K69 A;  1JKR C;  2X85 A;  2I8D A;  3I71 A;  4B8X A;  5J1Y A;  3HSR A;  9ANT A;  1T0F C;  1I3Q J;  4EM2 A;  2A07 F;  5L3C A;  3JRB A;  1SVL A;  2BZT A;  2D1H A;  2MBF A;  1ZR4 A;  1HSJ A;  2V9V A;  1ACI A;  2NVQ J;  4NC8 A;  5L3G A;  1IN7 A;  1QZZ A;  3HM5 A;  2DQL A;  3SEZ A;  2WB1 A;  3IWF A;  2ACJ A;  2ZFU A;  5JHF A;  4FHT A;  5FJ8 J;  1G3Y A;  4HF2 A;  1A04 A;  1IZ1 A;  1D0Y A;  5E3L A;  2EV6 A;  3FK6 A;  1XGO A;  4CXF A;  4UY8 I;  4QTR A;  5IOZ A;  2R7Q A;  3VYR B;  2IA2 A;  3BPV A;  4YRV A;  2Z9O A;  3HSE A;  4GRI A;  4UUV A;  2NVT J;  4Y52 J;  2FUG 2;  3VEP A;  2P5V A;  3ABK H;  2QQ8 A;  5LHH A;  1IRX A;  5EEH A;  1U78 A;  1BI1 A;  4DYC A;  2HYG D;  2X6W A;  3QWL A;  2R7S A;  3JAM K;  3CCS I;  1GVD A;  1REP C;  1EF4 A;  1XPX A;  5IYD J;  2H6B A;  2I5U A;  3OL4 A;  5F6F A;  3HRM A;  1BC7 C;  4AM3 A;  4E7Z A;  3F21 A;  2LD5 A;  1K6Y A;  5D8L B;  4A3G J;  4IHV A;  5LRR A;  5LEK A;  4KIB A;  3WTU C;  1Z77 A;  1W7P B;  1RES A;  3O8H A;  4BAC A;  1KYZ A;  4ANJ A;  2IS2 A;  1CGP A;  4I99 C;  4ON0 A;  1WJE A;  1T39 A;  2A61 A;  5FFZ A;  4HV6 A;  2W57 A;  3C1D A;  1EH7 A;  4HV5 A;  1O3S A;  1FSE A;  1IUY A;  3A01 A;  5EG0 A;  1FBU A;  5F1R A;  1R23 A;  2A3S A;  1SD5 A;  2P81 A;  3WU0 A;  3H3Z A;  2M8E A;  1TT5 B;  1U8R A;  4A3K J;  1JKP C;  2HPI A;  1Q1V A;  3E6B A;  1STZ A;  3T8R A;  1S72 I;  1I6X A;  2W48 A;  3WGI A;  1IRZ A;  3IH4 A;  3PNT A;  3G4S I;  4HDV A;  3BY6 A;  3VYU B;  2E2J J;  1SAN A;  1SFE A;  5M5X J;  5DCF A;  1T33 A;  4KMF A;  5F1J A;  2UXN A;  2VIX A;  1U0J A;  3WHC A;  5HLT A;  1W36 D;  3ZQ7 A;  4EGY A;  4RGX A;  4WXH A;  3GZ5 A;  2PMZ N;  1FIA A;  4CSW A;  1XS9 A;  2JN6 A;  5DYM A;  3MZY A;  1YRN A;  3TO6 A;  3OYF A;  3ML6 A;  1T95 A;  5IPA A;  2KIS A;  1ZTR A;  2PLY A;  4XLN F;  6PAX A;  2VJ4 A;  2X6O A;  5FGM A;  1FBQ A;  5DTD A;  2WWY A;  2HOA A;  2GXA A;  2KQR A;  2M4K A;  5M5W J;  5GAH J;  4Y13 A;  2R7U A;  4IOA F;  1BOB A;  1TLH B;  3V7R A;  4YEL A;  3K6G A;  1OCO H;  1Y0N A;  3AL0 B;  1S7O A;  3BTL A;  2NS8 A;  2JA5 J;  1JGG A;  1B9M A;  2VB6 A;  2YUS A;  4C2T A;  2E60 A;  1DQU A;  2BY1 A;  2M8G X;  3M3Y J;  2CQ7 A;  3LSK A;  2IVM A;  3RQI A;  2CW8 A;  1Z6R A;  4BH9 A;  4ZYG A;  4JX6 A;  4PFO A;  3A01 B;  3ECH A;  2DFH A;  4XIC A;  1HLV A;  1FNN A;  1E17 A;  3J80 K;  2HOE A;  4Y17 A;  2XAH A;  2JZY A;  1BC8 C;  3U2R A;  4LLG F;  2LBF A;  3ECO A;  1KZH A;  2QYO A;  2HPM A;  2KPM A;  2D45 A;  3K4M A;  1G3S A;  4J01 A;  2LH9 A;  3ZRG A;  4R8H A;  1TWG J;  2Y0S N;  4OMZ A;  4Q5S F;  1PUF A;  1S6L A;  5IOY A;  2DQR A;  5F0C A;  3KP3 A;  1OLT A;  3RKQ A;  2W7N A;  2GOX B;  5FLM J;  4NQW B;  2XB0 X;  2YPR A;  3LMM A;  3PSI A;  3TQN A;  5C3E J;  1FMW A;  3TW7 A;  2LFB A;  2XPW A;  3FXO A;  4PZJ A;  2EA4 A;  2G9W A;  3DCF A;  4A3J J;  2PI0 A;  3GF2 A;  1YRN B;  5BNG A;  2XF5 A;  2M30 A;  2IGN A;  2RQQ A;  3QYE A;  3SDB A;  5LBQ A;  4Q4Z F;  2ZNZ A;  3AKZ A;  2M34 A;  2O03 A;  2QQB A;  4CCO A;  4XRS A;  2Y9Z A;  3I54 A;  3JW4 A;  5GAG J;  4CGZ A;  1UB9 A;  4DZP A;  1VQK I;  1QA6 A;  2XHK A;  1MZB A;  3SZP A;  2K27 A;  3ZN0 A;  1P4W A;  5BOX A;  2XDV A;  3KX2 A;  3MKZ A;  2ZBK A;  3CCU I;  1BI3 A;  1QHG A;  1R5G A;  4EAT A;  3WTS C;  2MD5 A;  3PUF A;  1ORK A;  3C2B A;  3RPU D;  2HYF A;  4AVP A;  4RA2 A;  1MBG A;  2R93 J;  2H6C A;  3WTW C;  4U0V A;  3IUO A;  3BT9 A;  2Z2S B;  2IAI A;  3DTE A;  1NHA A;  4CCJ A;  3KIO A;  2LLK A;  2P4W A;  2PMZ A;  3HRS A;  2FOW A;  5CLS A;  2IP2 A;  2XAG A;  3WGH A;  4N9I A;  2M7B A;  2KRC A;  1HKQ A;  3L09 A;  3Q9S A;  3GX4 X;  1R1U A;  2L7F P;  2H8R A;  1MMG A;  3HIF A;  2L7K A;  3BQZ A;  2DYS H;  4G6T B;  2LY1 A;  4N9H A;  2LBF B;  2IS6 A;  2UUZ A;  2K40 A;  4L5E A;  4D7M A;  4BS9 A;  1GT0 C;  2IA1 A;  4KFC A;  2RKH A;  4G7H F;  3S3M A;  4IKF A;  2LP0 A;  3VOE A;  2VC1 A;  1NTC A;  1QO0 D;  1FYM A;  1OYY A;  1W5S A;  2K5C A;  3QPS A;  3L1P A;  2EIJ H;  3OSG A;  1Z3X A;  1TWF J;  2MA3 A;  3SFI A;  4IJA A;  2DI3 A;  3CLO A;  3S16 J;  3CES A;  4ENJ A;  3ABL H;  3BC8 A;  1B8I A;  3AAF A;  3BZK A;  2VKD A;  3DTI A;  4JQF A;  4MFE A;  3OYE A;  4RB1 A;  1B9N A;  1WJB A;  3GYH X;  3UR3 C;  3CP2 A;  4HLY A;  4XK4 A;  1X1C A;  2M45 A;  3GXO A;  1TW2 A;  4XKV A;  1AKH B;  3GLL A;  4FE4 A;  3S1Q J;  4UB6 C;  2Y0S A;  1Y8R B;  4BXF A;  2OTL I;  1VZ0 A;  2JA2 A;  3QQA A;  4IF4 A;  2V4J C;  5FFX A;  1JKQ C;  1P2F A;  1D5V A;  5ERI A;  4A3M J;  4KIS A;  2K3F A;  2MFZ A;  1H9T A;  5D6F A;  1I39 A;  4GYG A;  2CV0 A;  2RGV A;  5F04 A;  3K9T A;  3KZZ A;  1ON1 A;  3G1O A;  2ISZ A;  4F7Z A;  3KP7 A;  2R7W A;  2FE3 A;  3SHF A;  1J59 A;  2A5Y B;  1K7A A;  2QUF A;  3FIS A;  2LYC A;  2KP6 A;  1G59 A;  2DMQ A;  1QNT A;  2AQF A;  3CD6 I;  2TRT A;  1MH4 A;  4PUS A;  4OIN F;  3WG9 A;  5EYR A;  2JA7 J;  3E6M A;  1IN5 A;  2JPB A;  2XSJ C;  4BBR J;  1ETO A;  1Z67 A;  1B4A A;  4KIG A;  1OCZ H;  3H5A A;  5JLX A;  4DOZ A;  4RS8 A;  1RPW A;  2DOF A;  2FMY A;  3F8B A;  2EIL H;  3T0Y A;  4LIU A;  4UB8 C;  5J47 A;  3E97 A;  3EET A;  1B8I B;  3K2A A;  3SEQ A;  1HDP A;  3OMY A;  1RR7 A;  2MC4 A;  2OQG A;  3CLQ A;  5DUK A;  3R0J A;  1X58 A;  3CMY A;  1LVA A;  4DGW B;  2EZH A;  3KET A;  5LEJ A;  2CU7 A;  4DYR A;  3I58 A;  2LKP A;  2UZK A;  3A0B C;  2CUF A;  3S8P A;  4I01 A;  4ZZD A;  4DYQ A;  2DK8 A;  1RI7 A;  1Z7L A;  1LUJ B;  4YII A;  3OS1 A;  4HNV A;  2DJI A;  1N78 A;  3G6E I;  3I4N J;  3DBR B;  2QQA A;  5HNF A;  5GPC A;  2HR3 A;  1O3Q A;  4B09 A;  1SMT A;  5F64 A;  3IV5 A;  4Y7N J;  3UNG C;  2KDO A;  2HWV A;  3CJR B;  4TV7 A;  4C9Y A;  1JKO C;  2JT1 A;  2OJE D;  2O6G E;  1KQ0 A;  1ODD A;  1ZH5 A;  2OBP A;  4BJT A;  4FET A;  4U7B A;  4EMS A;  4E7H A;  1D8K A;  4ZYA A;  1HW1 A;  5GAD J;  2FU4 A;  2X48 A;  3EUA A;  3H5R A;  3S93 A;  5IT9 Z;  1W0T A;  4E7L A;  5L3B A;  5BQT A;  5FKO A;  1ZRD A;  4GFB A;  3PNV A;  4X1E A;  3JRI A;  3S1R J;  5F0H A;  1TWA J;  2X51 A;  4A6D A;  4OAZ A;  1PUE E;  3TO9 A;  2YU9 J;  3CDH A;  1QU3 A;  4EJU A;  2L9V A;  4BL0 B;  2VE9 A;  3TED A;  1K79 A;  2TCT A;  2JJ7 A;  2VQH A;  4RAY A;  2X1C A;  1BI0 A;  3OIP A;  4JX4 A;  4WF2 A;  1A35 A;  1R1V A;  3VWB A;  3ABU A;  1BJA A;  5J3L A;  1OYW A;  5HDK A;  3P7N A;  4KUM A;  2L02 A;  4YEJ A;  1MND A;  1F1Z A;  1I5Z A;  4RLF A;  3HOS A;  2DXI A;  3IAS 2;  1R58 A;  1FOY A;  2A68 F;  2ZXW H;  3FZV A;  5FKN A;  3T5X A;  2XAQ A;  4IOC F;  1GHC A;  3L00 A;  3OY9 A;  3JRC A;  1Z7U A;  1ZAR A;  1HDD C;  4PSX A;  1X1P A;  4BDZ A;  2J5P A;  2Y30 A;  4PJN A;  3FKI J;  1DPU A;  3DLL F;  3MMY B;  3UKG A;  5FRO A;  1M1E B;  1T2K A;  3M7G A;  3MEX A;  4A0Y A;  2D5V A;  3OS0 A;  4UHT A;  1IO2 A;  2Z99 A;  2XV4 S;  1YI2 I;  4OIO F;  4LIV A;  3PFY A;  2M1B A;  2R7Z J;  1J75 A;  4LG0 B;  3MKW B;  4CH7 A;  4WXC A;  5EGO A;  4ZZL A;  4RM2 A;  3CUQ A;  3GVA A;  5TIS C;  2KIU A;  1LPQ A;  2WAE A;  1ETW A;  1FTT A;  3Q0U A;  4N4N B;  2EIM H;  3C18 A;  3GEZ A;  5K5Q A;  2NS7 A;  2X4H A;  1FZP B;  3L2C A;  3RTR A;  2ME6 A;  1E3O C;  4HYE A;  3PSF A;  1TQM A;  3CDI A;  1OMI A;  4IPA A;  1IXS B;  1B6A A;  2KJB A;  5D6E A;  4DZJ A;  5JI6 A;  5D4S A;  2VQG A;  5CPR B;  3RKX A;  2Y2Z A;  2CG4 A;  3BZC A;  3ZQL A;  1MBJ A;  2BXY A;  2L4M A;  2BW3 B;  1K83 J;  5CJ9 A;  2AS5 F;  3V42 A;  3C2H A;  3K4N A;  4CO8 A;  4U0W A;  5AIP A;  4ENN A;  5F0F A;  1VFC A;  2VBY A;  3BJA A;  2VI6 A;  2ZFW A;  2BEO A;  1GV2 A;  3TL4 X;  2XRN A;  3H5N A;  1IAW A;  2HFH A;  4XLP F;  3D5R C;  4IHS A;  3GTQ J;  3ZMV A;  1GVJ A;  3CTA A;  1XMX A;  1JUS A;  1S3J A;  2LC2 A;  1D3Y A;  2OCC H;  2P8T A;  4G94 A;  4RGR A;  2H27 A;  3BG7 A;  2RNJ A;  3BR3 A;  1I1G A;  5FKL A;  1FOW A;  3LA7 A;  4BE0 A;  2CQQ A;  2E35 A;  2WV1 A;  2FNP A;  4HSR A;  3P5J A;  2GA2 A;  1YYV A;  1ZQ3 P;  3M8J A;  4II3 A;  4UXN A;  4ASN A;  3QP6 A;  4B3X A;  1H8A C;  2BY3 A;  2A05 A;  2MH2 A;  4HX7 A;  5EGO B;  2YSR A;  3W6J B;  3KYL A;  2Q0O A;  3JRD A;  3SZT A;  4BBS J;  4XON A;  3MFK A;  2MYS A;  1FYK A;  4F92 B;  1YS6 A;  5GAE J;  3KYC B;  4BJ5 C;  5K5O A;  4BY1 J;  4XID A;  4BE2 A;  2DK5 A;  4A3L J;  4Y33 A;  1MMD A;  3F8N A;  1JE8 A;  1G8X A;  2RNG A;  2W1O A;  5E79 C;  2RC4 A;  4KIT B;  3FX3 A;  2BY0 A;  3BRO A;  5KAF C;  3K70 C;  3CO6 C;  1W5T A;  3KZY A;  3W3C A;  3L2W A;  4KNY A;  4V2F A;  5KCM A;  2KDZ A;  4D0P A;  3BTI A;  3W6K B;  4HX8 A;  3J7A O;  4AIK A;  4HRI A;  3IL2 A;  3KCC A;  3VDX A;  3L2Q A;  1J09 A;  3PO3 J;  3K7A J;  4L0Y B;  1PDN C;  1WZ2 A;  4BU2 A;  1OCC H;  3EPZ A;  3AG1 H;  4ZDL A;  3HOT A;  3K1N A;  3GW2 A;  1Z91 A;  4BEH A;  3F23 A;  1ETQ A;  4XL9 A;  3F0C A;  5L3F A;  5LD2 C;  5FRM A;  2JQ7 A;  1EH6 A;  3GO5 A;  4XN3 A;  4M73 A;  4XOR A;  4E7J A;  2W25 A;  4UVA A;  2UV1 A;  1KU2 A;  2R7F A;  3H0D A;  4B4C A;  3CCQ I;  4AD9 A;  3MN2 A;  4IO9 F;  1LJ9 A;  4A3C J;  1I50 J;  4PDK A;  5C44 J;  1QBJ A;  1BA5 A;  4MHG A;  4LB6 B;  3FBI B;  1UEL B;  1S5L C;  2HVR A;  2Z3Y A;  3U9G A;  1UZC A;  4ZYH A;  4FAS D;  5AIQ A;  5DM6 F;  5EEA A;  3LAJ A;  3TKY A;  3DKW A;  2DFI A;  3K1P A;  5DCM B;  2WA0 A;  2COB A;  2UXX A;  2DT6 A;  1KU9 A;  1V3F A;  5FD5 A;  2VQC A;  4IZZ A;  3VOD A;  3FMQ A;  3FXL A;  2EQR A;  2FD5 A;  2ZC2 A;  1BOA A;  2RN7 A;  4IRI A;  2AO9 A;  1UST A;  1X1D A;  2HQA A;  4IQJ A;  4EJW A;  3FXM A;  3S3O A;  3FBN B;  2KJC A;  2LG4 A;  4BKX A;  4AC0 A;  4EVI A;  5TGT A;  4MEX F;  5HS9 A;  4M6V A;  4M9S A;  2CH0 A;  4EJV A;  1X1B A;  3WG7 H;  3HUG A;  5J1U A;  1V55 H;  3HTS B;  3DLA A;  1VQ5 I;  4MTD A;  1R71 A;  3FDY A;  3WE2 A;  1FYL A;  3WGG A;  1IG7 A;  4L5I A;  3FMS A;  3G1L A;  1MBF A;  3WTX C;  2LRD A;  2EIK H;  2V9K A;  4BEH B;  4F52 A;  2AXL A;  4LD5 A;  1AA7 A;  3IKV A;  3GTG J;  4DQ2 A;  3HJE A;  5HNH A;  3BR0 A;  5ICG A;  3OYM A;  1ZRE A;  3HGG A;  1DU6 A;  2H1L A;  1MH3 A;  3HZJ A;  2ELK A;  2EZK A;  2CO5 A;  4XMY A;  2M4G A;  1XMA A;  3HOZ J;  2MC3 A;  3JR9 A;  3I0T A;  3ZN1 A;  3F3X A;  1YW8 A;  5KNL A;  3HRT A;  2MD0 A;  1POG A;  1F43 A;  3CC7 I;  3OYH A;  2E34 A;  3PNY A;  3LWF A;  1BM9 A;  1AOY A;  4XOT A;  3LFK A;  2H1K A;  5CQG A;  2DT5 A;  1EA3 A;  2OTJ I;  4OWR B;  2XRO A;  4E6K G;  2GQQ A;  2LMD A;  3S14 J;  2JMW A;  3I9V 2;  3H9Q A;  3IWZ A;  1UJ8 A;  2XAU A;  1D8J A;  2K86 A;  3D5S C;  1KQ8 A;  1ETK A;  4ENK A;  1WFX A;  3CCJ I;  5BMZ A;  2CUE A;  2QWW A;  3B6A A;  1R1T A;  4PJ0 C;  4MFD A;  3OR1 C;  3J81 K;  4UVC A;  3KP5 A;  4A5N A;  3HUG B;  2ZJ2 A;  1RUN A;  3K4K A;  3H0G J;  1TQI A;  1ZAO A;  4QPO A;  4F3Q A;  4A2U A;  5ICE A;  4A12 A;  4E7I A;  2V26 A;  3DEE A;  4B48 A;  1OR7 A;  3BR6 A;  3LSH A;  4BJ6 C;  1LE8 A;  3NWT A;  2G7H A;  5DV5 A;  4JX5 A;  3HDD A;  2A69 F;  1AWC A;  2K02 A;  4XBF A;  3JSP A;  1IGN A;  2K85 A;  4G8X A;  2HDC A;  3NWS A;  2V79 A;  4B3A A;  1DGW Y;  3F8F A;  5JHU A;  1WSU A;  1HST A;  1R4N B;  2DMP A;  1OCT C;  4IHW A;  4L9V A;  1R4M B;  3QOD A;  1MD0 A;  1MMN A;  1P7J A;  3FXQ A;  2DLL A;  3O8G A;  1YTY A;  1QGP A;  2EFQ A;  3CJQ B;  3Q0W A;  4GCV A;  5TRD A;  1O3T A;  3S32 A;  4KN7 X;  1NH3 A;  1AHD P;  1JT0 A;  2DMN A;  1MBH A;  4P96 A;  4XKB A;  3E0J B;  5LGU A;  4XOP A;  4NQW A;  5IP6 A;  4DNC A;  2B9S A;  3FMR A;  2STW A;  2DPD A;  5H2F C;  3ZQC A;  2WC2 A;  5CVV A;  3ZMS A;  4CYD A;  3OYL A;  4Y4R A;  2WTE A;  3DEW A;  3U1K A;  5E3M A;  2OZ6 A;  5LHI A;  4D1Q A;  2FXA A;  2VOD A;  1T38 A;  3I53 A;  5L3E A;  5ED4 A;  1XGN A;  1Z6T A;  3S2W A;  4II2 A;  3LNQ A;  1ZR2 A;  2R7R A;  4I0A A;  2DW4 A;  3HOW J;  2ELJ A;  3F22 A;  4BNC A;  5E8I A;  5FLX K;  2KL4 A;  1FTZ A;  3SDG A;  2K4B A;  1WJA A;  2DA6 A;  3GFM A;  5EEG A;  3VB2 A;  3CJT B;  3LSI A;  1T08 B;  2HEO A;  1XN7 A;  3RYP A;  1TNS A;  2HDW A;  4XKC A;  2DOA A;  1LE8 B;  2JA6 J;  3CO7 C;  5KVR A;  2XGD A;  2OZU A;  2WBM A;  2DPU A;  3AFH A;  1Z1D A;  3KP6 A;  2R7D A;  1WPK A;  2XAJ A;  1Z3Y A;  3DBH B;  3GLX A;  4BHP A;  3S15 J;  5GTI C;  3RPU A;  1MW7 A;  4WCG A;  2UWM A;  4XQF A;  2X6X A;  1LFP A;  2H8W A;  1VF9 A;  3CC4 I;  1QQI A;  4IHX A;  1YLF A;  2KIF A;  2ZB9 A;  3GME A;  2ZXH A;  1ENH A;  3DPL C;  1U5T C;  2PMH A;  3BJ6 A;  1MNE A;  2MGQ A;  3FK7 A;  1MJA A;  1ZG5 A;  3ISP A;  4EJO A;  4BQA A;  3L2R A;  3QAH A;  5LGN A;  4KA4 A;  3OS2 A;  3IH3 A;  2PG4 A;  2IT0 A;  1DDN A;  1SD6 A;  2IGK A;  2NYX A;  5EDN A;  2VPR A;  1L3L A;  3TBI A;  1WVR A;  2DA5 A;  5DUI A;  2EB7 A;  2FBK A;  2BE5 F;  2VLA A;  2M9H A;  3OYC A;  4YFX F;  4KMU X;  4ZJZ A;  3HOU J;  4C3J J;  4L18 B;  2WAQ N;  1RR8 C;  4Y15 A;  3FXR A;  1AKH A;  1WWX A;  3DU5 A;  1IF1 A;  2RQP A;  2L7Z A;  3DEU A;  2O5R A;  4CYC A;  2E1C A;  4A3D J;  3HPG A;  3G2B A;  4K2E A;  2ZME C;  2ESN A;  2XGE A;  1LB2 A;  1N77 A;  3CJN A;  5LHG A;  2PMU A;  2HVS A;  3C3W A;  2BHZ A;  2CQX A;  2JK3 A;  2BVL A;  3HHG A;  4KYW A;  1J5Y A;  2Q8K A;  2O0Y A;  2PX9 A;  2A6H F;  4U88 A;  3EUH C;  3F6O A;  4QIW N;  2NOJ B;  2ETH A;  1HC8 A;  1KON A;  3IKT A;  1K4T A;  2JTV A;  1TBX A;  4A3B J;  4RB3 C;  4FT8 A;  3TO7 A;  2QSH X;  2XKP A;  2E1O A;  3J7Y J;  2ZXJ A;  4IRG A;  1Q1H A;  2ADU A;  2DCE A;  4HLX A;  1VQO I;  4EJT A;  2LKS A;  2VKV A;  1WJ5 A;  2NNN A;  3HC7 A;  5D5U B;  4AYB N;  4ZYD A;  2GIZ A;  1ZRF A;  2V1U A;  3OYD A;  3BWG A;  3A0H C;  3DQV C;  3IAM 2;  1MIJ A;  3OYJ A;  2QGU A;  4FIS A;  5K5R A;  4I09 A;  4M3G A;  5A2Q Z;  2PJR A;  4BAY A;  5ICF A;  3NRV A;  2PEX A;  1JJ8 C;  2NVX J;  1J2X A;  2P5L C;  4G7Z F;  4CYC B;  1FPQ A;  4UV9 A;  1LDD A;  2VL8 A;  1EKE A;  2DA4 A;  3K4C A;  1P92 A;  3WTY C;  3BR1 A;  5H20 A;  3HHH A;  4EQQ A;  3DTK A;  2LDU A;  1ZGA A;  1Y0U A;  4J19 A;  1XDS A;  2LOO A;  2JWT A;  2EBI A;  4YIR X;  4RDU A;  3KPH A;  2Z33 A;  3LSJ A;  3HRU A;  5TJJ A;  1IRF A;  1I1S A;  1P4X A;  2EZI A;  4JP0 A;  2P7C B;  5HDG A;  4L9J A;  2DTR A;  2WAQ A;  1H89 C;  2LK2 A;  1SFO J;  3N05 A;  4RB0 A;  2ISY A;  2B0L A;  2WAF A;  2KZV A;  4LJZ F;  1BR1 A;  3K70 D;  4CA0 A;  1SEU A;  5IT3 A;  1Y6I A;  2G0E A;  1E3H A;  1R00 A;  2W4S A;  4M9Z A;  1WJF A;  4ENM A;  1TZL A;  5D5X B;  4GO1 A;  4XLE A;  1RKW A;  3HGY A;  4O5V A;  4G7O F;  2XKO A;  5IYB J;  4EV0 A;  3RI4 A;  4LLN A;  3PUB A;  3BJO A;  5LGT A;  1LEB A;  3FM3 A;  2KFD A;  1BL0 A;  4P9U A;  4LOC A;  3D1N I;  2BVM A;  3M07 A;  2XF7 A;  1G3T A;  4PCQ A;  3DFG A;  1V54 H;  2PJR B;  4LK1 F;  4B43 A;  4XLC A;  4G6Q A;  2ICW G;  3OYI A;  1TT0 A;  1ONV A;  2DDA A;  1OCR H;  2ID6 A;  3JAM Z;  3HG9 A;  1HKS A;  1FIP A;  3R4K A;  5HLG A;  1LDJ A;  5DD4 A;  4IHY A;  1JHH A;  1W1W E;  2K9S A;  3X2Q H;  3COA C;  2PJP A;  3AL0 C;  4HPQ A;  1VQP I;  3S2D J;  3KYD B;  4FQG A;  2R5Z B;  2CFX A;  1UG2 A;  3O6B B;  4AYB A;  4ETS A;  3J7A Y;  1BBY A;  1NK3 P;  1ZYR F;  1J7K A;  3H1C A;  4NC7 A;  2FML A;  2HS5 A;  1JJ6 C;  1VQ4 I;  1T0F A;  2DOE A;  2QZ8 A;  4LG0 A;  1S29 A;  4UVB A;  1ZEL A;  2GAU A;  2Y9Y A;  2L9S A;  3OIO A;  3SXY A;  1YW7 A;  1FWZ A;  1ZRC A;  3R6S A;  3TMO A;  3ZPL A;  4U87 A;  2KMU A;  1KA8 A;  3HL2 A;  2M3A A;  2O8X A;  3A03 A;  5K1Y A;  1HW2 A;  1BIB A;  2E19 A;  4YG2 F;  1YW9 A;  4L9N A;  3GTK J;  2HOT A;  1SAU A;  2VKE A;  3N4M A;  3S1N J;  1X19 A;  1VQ8 I;  4S05 A;  5K7H A;  1GXQ A;  3KLN A;  1ITY A;  2V1D A;  1XCV A;  3GUD A;  4MQV A;  4GYI A;  2BW3 A;  3DKX A;  1X4O A;  5JFR A;  3M9A A;  1FT9 A;  3E6D A;  2YX7 A;  3JCU C;  5CVJ A;  1R36 A;  4XRF A;  3ZQI A;  1P4A A;  5CVU A;  4LB5 A;  1ULY A;  2XAS A;  2MAB A;  4CIC A;  3LQR A;  1E0E A;  2DFE A;  1IXC A;  3K0L A;  2IS4 A;  4HF1 A;  3QU6 A;  4FX0 A;  2HDD A;  1FOX A;  4EM0 B;  1ZG1 A;  1ZGW A;  2CS3 A;  3V8J A;  4I02 A;  3V8L A;  2XVC A;  3RJP A;  3TOA A;  1MJB A;  2BOL A;  2Z5U A;  3QYF A;  2ZNY A;  3PQJ A;  2R5Y A;  1RIO H;  3GFJ A;  5HLH A;  4WX9 A;  3ZQF A;  4A69 C;  2VOO A;  4E70 A;  2QBY A;  4XLA A;  2OA4 A;  2LY9 A;  2A6E F;  1QRY A;  1OPC A;  2F2E A;  3FWE A;  1H88 C;  1EV7 A;  2VQL A;  2LR8 A;  2K9N A;  3HPH A;  4BQO A;  4PGH A;  2F5V A;  1LFU P;  3U1D A;  1VTN C;  2ZKZ A;  3CCY A;  1A31 A;  3CZ6 A;  4OIR F;  3CUO A;  5BS6 A;  4ZDO A;  2DJN A;  3J80 Z;  4M3F A;  4FX4 A;  3OL3 A;  2K4J A;  3QYB A;  3M4O J;  1FMV A;  1SMY F;  2CW0 F;  4X6A J;  3O3K A;  2HTS A;  1MGT A;  1B59 A;  3CMA I;  2JA8 J;  4F55 A;  2BGC A;  2A6T A;  3DF8 A;  3ONQ A;  2H94 A;  1K4S A;  3BG9 A;  2HTJ A;  1Z05 A;  2HQ5 A;  1MSF C;  1OQY A;  2HZD A;  1HCR A;  1HA8 A;  5BPD A;  1DP3 A;  2ZXI A;  1JTX A;  3GTM J;  3KLO A;  2L2O A;  3E5U A;  1YJW I;  1ZN2 A;  3HOY J;  1SFU A;  1NG6 A;  1CF7 A;  2JVH A;  4BE1 A;  4XSZ F;  1Y1V J;  3R61 A;  3HB9 A;  4BQQ A;  2VBZ A;  5J6X A;  1F36 A;  2IS1 A;  4M6Y A;  5KHD A;  2DDB A;  1U9O A;  2JUG A;  3HOV J;  2R5Y B;  2EA2 A;  2L54 A;  2LRE A;  3G71 I;  1NG7 A;  3Q5F A;  5L3D A;  2WY7 Q;  2BY2 A;  2QBY B;  2JSP A;  3ZGK A;  5DCM A;  1BN5 A;  3ZMD A;  2D2W A;  1W0U A;  1D0Z A;  3FKJ A;  3MAJ A;  4NBQ A;  1Z9C A;  4I6Z A;  5D5V B;  1XSD A;  1A36 A;  3TDU C;  4RMN A;  4JOM A;  2JSC A;  2DFF A;  4P5O A;  2F4O B;  1YJN I;  3I4M J;  1YE9 A;  4OAY A;  3PIO F;  3WTT C;  2DA2 A;  3BTJ A;  3CCL I;  1O3R A;  3V7C A;  2EFN A;  2P0W A;  2I10 A;  1WI9 A;  3K4L A;  2O3F A;  5ILS A;  2KHM A;  1HQC A;  3IH2 A;  1RKT A;  3F8M A;  3LSM A;  3ZMZ A;  5ILU A;  2E7X A;  2QQ9 A;  5DD8 A;  1W5C C;  1ZLJ A;  3BP8 A;  1OCP A;  2PN6 A;  3QOP A;  5HVQ C;  1QPI A;  1FC3 A;  1TW3 A;  2LKX A;  1R5H A;  4FCY A;  4QPQ A;  4YFK F;  1ZHF A;  1IRG A;  2VPL A;  4EM1 A;  5H6Q A;  3HBL A;  2VXZ A;  4IVN A;  4AWX B;  1GUU A;  2STT A;  5JVG F;  3BG3 A;  1CF7 B;  2ESH A;  4R1H A;  5B5E C;  3LOC A;  2DMU A;  4KIF A;  2HOS A;  2FSW A;  2E1M C;  3SQN A;  1KYW A;  3F72 A;  1IW7 F;  3MKY B;  1YIO A;  5CVR A;  3BPX A;  1IC8 A;  3P9K A;  3QPH A;  2A5W A;  5E1X A;  1BW6 A;  4YIF A;  3RZO J;  2P6T A;  1RRJ A;  1B72 A;  2KKO A;  4C30 A;  4Z2Y A;  2R3S A;  2VON A;  5ICC A;  3A02 A;  2Y0M A;  2L5Q A;  1GV5 A;  1U8B A;  2H09 A;  2FRH A;  1I3A A;  1XD7 A;  4KN4 X;  5EZH A;  4I98 B;  1V5E A;  3BG6 A;  2CRG A;  5CKT A;  4CUG A;  1KU7 A;  2VJJ A;  4LK0 F;  1QHH D;  1U5T B;  4GDF A;  1VI0 A;  1O7L A;  4CHU A;  1HKT A;  3G1M A;  3LL7 A;  3ERM A;  2DBB A;  4MIM A;  1R49 A;  1ZK8 A;  3PQK A;  2QM3 A;  4Q47 A;  1YX3 A;  4AU7 A;  3F6V A;  1UFM A;  3ZQQ A;  3DXJ F;  1SFK A;  1X4P A;  3I59 A;  2VJI A;  2RDP A;  5E20 A;  2ZSI B;  1D0X A;  2F5C A;  1WI3 A;  4B47 A;  1OKR A;  5F08 A;  3H3V K;  2V7F A;  3MCZ A;  2JUC A;  2AXT C;  2K9L A;  2W85 A;  2IJL A;  3ULQ B;  2LVS A;  2ZME B;  1L0O C;  2LF7 A;  3K4B A;  1V5G A;  1WHU A;  2GOM A;  4KIC A;  5DEQ A;  2HNH A;  1F4K A;  2FX0 A;  3OR2 C;  3JRF A;  1VQN I;  4O3M A;  4C3H J;  1B72 B;  2VC0 A;  2NVU B;  3TOB A;  3K1M A;  1O7F A;  1S8N A;  4M6X A;  4IX7 A;  4A6E A;  2CJJ A;  2CMP A;  4IHT A;  2L3D A;  3OV8 A;  1H9G A;  4W1U A;  5E8G A;  3EUK L;  3RCO A;  2QSG X;  1WQ2 A;  2DOD A;  1X3U A;  3CP8 A;  4BY7 J;  2XGC A;  4I2O A;  4CCK A;  3FIW A;  1P6R A;  1T98 A;  5CYV A;  2M0M A;  3CDL A;  4EEF G;  2GZW A;  1JHF A;  3M8F A;  5HLI A;  2X6Y A;  3IHU A;  3R60 A;  3I64 A;  4XM3 A;  1ON2 A;  5FKK A;  2IRF G;  2MSY A;  1DGR M;  1JGS A;  2FF4 A;  3V4G A;  4WK8 F;  2KIM A;  4E4H A;  1BR2 A;  1PJR A;  2M2E A;  3HKZ N;  1BW5 A;  2G7U A;  3P9I A;  2LSO A;  2DAO A;  1VQ7 I;  3D0S A;  3C7J A;  2IA0 A;  4NDL A;  2FJ1 A;  5EF6 A;  3OIQ A;  2Y31 A;  3I59 B;  5AON A;  3N97 A;  1W7P D;  1G4D A;  2QLZ A;  4RAG A;  1XDU A;  1C0W A;  1FLI A;  3JRA A;  4Q48 A;  4DBQ A;  1HW5 A;  4IEJ A;  2O9L A;  3W2A A;  2EJR A;  2MLG A;  1BI2 A;  2E7W A;  2LY2 A;  2IGM A;  3H3U A;  2NVY J;  1SAX A;  1ETX A;  2CFO A;  2PQ8 A;  2R92 J;  2J5O A;  3LA2 A;  2EV0 A;  2VAS A;  5J4V A;  3F9K A;  2LTP A;  3H9J A;  2K9Q A;  3J7Z I;  1T8I A;  3AG3 H;  4JK1 X;  2HI3 A;  4OOI A;  4LIT A;  2CV2 A;  3S3N A;  3EYY A;  3MQ0 A;  4UUT A;  1MBE A;  1SD4 A;  5ILV A;  2F5E A;  4CCM A;  2OQR A;  5IT9 K;  1YS7 A;  3TP3 A;  4HNT A;  2L01 A;  1K6O A;  4OIP F;  1XG1 A;  2QVO A;  1X3Z B;  3LFU A;  4MTE A;  3OYB A;  4NNJ A;  4RBO A;  2E36 A;  3I4P A;  1FP1 D;  3JTH A;  4KJZ A;  1FP2 A;  3CME I;  3CUQ C;  4IQ4 A;  4NB5 A;  2C6Y A;  2XRL A;  3PL8 A;  4MEY F;  4I76 A;  4A0Z A;  3FM5 A;  2F5D A;  4HAM A;  2R7O A;  1VQ6 I;  2R0Q C;  3S17 J;  3BOQ A;  1ERD A;  2JRM A;  1DPR A;  3FF5 A;  1T56 A;  1O4X A;  3KE2 A;  4HDU A;  4DW6 A;  1X1A A;  1YJ9 I;  4IRH A;  3HSF A;  4LMY A;  4D7N A;  4G12 A;  1ZLK A;  4MO7 A;  1SVM A;  2EFP A;  4HA8 A;  2W84 A;  1DP7 P;  1TC3 C;  3GBG A;  2KRH A;  3ELK A;  4LFU A;  2MW8 A;  1MBK A;  4A3I J;  1I6H J;  4JYK A;  2L9N A;  5J8F A;  2CQK A;  4WWC A;  4ZTJ A;  2DTZ A;  2LNB A;  1R5I D;  5LRS A;  2K9M A;  3SJM A;  2HQN A;  3K10 A;  2KIQ A;  4XKW A;  1S9H A;  3KP2 A;  1IDZ A;  2XAF A;  4PSW A;  5FKM A;  4D5C A;  3HKZ A;  1XSX A;  3L7W A;  3BLY A;  2GWR A;  5E3O A;  3QPL A;  3M1C A;  3PO2 J;  1MDM A;  2FEZ A;  4BXX J;  4JBA A;  3PFI A;  2MLK A;  3B02 A;  4BHB A;  1ZKG A; 
#chains in the Genus database with same CATH homology
 2EFO A;  2FQ3 A;  1K78 A;  3JSO A;  4WXD A;  3G3Z A;  4AIH A;  3FHZ A;  2YR2 A;  2V6C A;  1XMK A;  2FBH A;  1U6G A;  2DO7 A;  3V8K A;  2P5K A;  1KU3 A;  5HOO A;  2XUB A;  1FBS A;  5J8C A;  2Y48 A;  3D5L A;  4U7D A;  1R7J A;  3LQQ A;  1HBX G;  3RKY A;  2K7L A;  4L5J A;  5FD6 A;  3O2P E;  2EFW A;  3LAP A;  2EWN A;  4HF0 A;  4M9X A;  3T1B A;  1LQ1 A;  1YO5 C;  3DP7 A;  5E1W A;  2ZCW A;  5HS8 A;  1G3W A;  4O6J A;  1MDM B;  3WE3 A;  4GGG A;  1XCB A;  2VT3 A;  1K78 B;  1IN4 A;  4BHC A;  2P7V B;  3OOP A;  3ZMU A;  5D5W B;  1TQP A;  3RYR A;  4MGR A;  1SFU A;  5LLQ A;  2YU3 A;  4R79 A;  3KEO A;  5FB2 A;  1RUO A;  1ZGJ A;  2QEN A;  2VBW A;  2W24 A;  2L4A A;  2VBX A;  3RKW A;  3WOD F;  1U2W A;  1SD7 A;  2IPQ X;  3WTZ A;  5JR3 A;  4OU0 A;  1KQ9 A;  1YG2 A;  1QZY A;  2FA5 A;  4ESJ A;  1KGS A;  2Q2E A;  2CSO A;  2EK5 A;  2RVC A;  4QWQ A;  5FO5 A;  2HKO A;  2VE8 A;  1RNL A;  2JPC A;  1R22 A;  2IW5 A;  2CGP A;  4L9T A;  3RDI A;  4PGG A;  1TNT A;  1JXS A;  4MNU A;  4I7H A;  2VN2 A;  3KEQ A;  4HOB A;  1XGS A;  1IN8 A;  1QPM A;  4IXA A;  1I27 A;  4LLL A;  2M87 A;  4UV8 A;  5H6R A;  1FY7 A;  4L0Z B;  2PFB A;  4P9F A;  4A0X A;  1PP8 F;  3QRF F;  3ROU A;  2RV8 A;  1USS A;  1G6N A;  2XGX A;  4AIJ A;  3F8C A;  1LNW A;  2ZO4 A;  2HGC A;  3DPT A;  3R0A A;  3G73 A;  1TTY A;  4A5M A;  3J81 Z;  4G9Y A;  1YFH A;  2FNA A;  4I0B A;  3H92 A;  3LST A;  1ZG3 A;  3TGN A;  2X0L A;  4HBL A;  3IRQ A;  2GXG A;  5HS7 A;  1FSH A;  3BDD A;  4HZF A;  3GZ6 A;  1W4M A;  5DDG A;  4OIQ F;  1XSV A;  3HTU A;  5JVT A;  4ESF A;  3E5Q A;  5HDN A;  4H0E A;  4NHJ A;  3E3V A;  3HYI A;  2XIG A;  3JTG A;  3WTV C;  2JRT A;  3P9C A;  3EQL F;  4RGU A;  3I5U A;  1LDK B;  3GFI A;  3RPQ A;  3ZP5 A;  3FXU A;  2P6S A;  3GWZ A;  5FLX Z;  2VT2 A;  4LGW A;  4ZYE A;  3RIR A;  1UHW A;  2HQR A;  4N0B A;  2BYV E;  1O57 A;  2ELH A;  3DV8 A;  4CZZ A;  1FX7 A;  1HXD A;  2MH9 A;  1H0M A;  5E1Z B;  5BPI A;  4HQM A;  2O61 A;  2D1V A;  1MKM A;  2E1N A;  4HW0 A;  2TDX A;  2NAZ A;  2OU2 A;  3ERE D;  1UHM A;  4G6D A;  2HKX A;  1J9I A;  1F9N A;  3L9F A;  1XGM A;  2WV0 A;  2OD5 A;  3LA3 A;  1V4R A;  3V7S A;  4HX4 A;  4RB2 C;  1WRJ A;  1B1B A;  4S04 A;  2BV6 A;  1WKM A;  3GFL A;  1E2X A;  4M71 A;  3SFZ A;  2NNY A;  2FOK A;  3QP5 A;  3B73 A;  2COM A;  2CYY A;  1BIA A;  1T6S A;  3IC7 A;  4XSX F;  3REO A;  3WU1 B;  1U5T A;  4ESB A;  4YFN F;  1RZ4 A;  1IN6 A;  4RGS A;  1LEA A;  1SFX A;  2NS0 A;  4BXU A;  2EV5 A;  3E6C C;  2HZT A;  3E5X A;  3NEU A;  4GXO A;  3CUQ B;  4BYY A;  2NRA C;  3M1E A;  3QPT A;  1FOK A;  1U3E M;  2BBY A;  4EGZ A;  3EDP A;  3NQO A;  4OMY A;  2ZME A;  4HQE A;  2PBI A;  3M8E A;  3KFW X;  1OYI A;  5E17 F;  3T8T A;  4P55 A;  3KP4 A;  3EUH A;  4MQ9 F;  2VOP A;  2CWE A;  2V1X A;  2FBI A;  3Q9V A;  5D8K B;  1PP7 U;  4RAZ A;  1UCR A;  1IXR C;  1YQA A;  5E18 F;  3K2Z A;  2GIV A;  2DU9 A;  4U0Y A;  4QLC U;  2LF8 A;  2OAZ A;  1MJ9 A;  4CDG A;  4KT5 C;  3EYI A;  2GXB A;  5A2Q K;  1EH8 A;  3IRR A;  3ZMT A;  2F5F A;  3MZH A;  2KRF A;  3ABT A;  5CVI A;  4M74 A;  3TDZ C;  4UNO A;  2M5W A;  1GXP A;  2YX4 A;  2GA1 A;  1W7P A;  3QU3 A;  4ZH4 F;  5KK1 A;  3VFZ A;  4KDP A;  1J0R A;  5D4R A;  1S7A A;  2Y75 A;  3BZ6 A;  1XB4 A;  4M72 A;  1DUX C;  3MWM A;  1F5T A;  3K69 A;  3I71 A;  4B8X A;  3HSR A;  4EM2 A;  2A07 F;  5L3C A;  2D1H A;  2MBF A;  1HSJ A;  2V9V A;  5L3G A;  1IN7 A;  1QZZ A;  2DQL A;  3IWF A;  2ACJ A;  4FHT A;  1G3Y A;  4HF2 A;  1A04 A;  1IZ1 A;  2EV6 A;  1XGO A;  4CXF A;  2IA2 A;  3BPV A;  2Z9O A;  3HSE A;  4UUV A;  3VEP A;  2P5V A;  5LHH A;  5EEH A;  1U78 A;  1BI1 A;  2HYG D;  3JAM K;  1REP C;  2H6B A;  5F6F A;  3HRM A;  1BC7 C;  3F21 A;  5D8L B;  5LRR A;  5LEK A;  4KIB A;  3WTU C;  1W7P B;  1KYZ A;  1CGP A;  4ON0 A;  1T39 A;  2A61 A;  5FFZ A;  4HV6 A;  2W57 A;  3C1D A;  1EH7 A;  4HV5 A;  1O3S A;  1FSE A;  1IUY A;  1FBU A;  5F1R A;  1R23 A;  2A3S A;  1SD5 A;  3WU0 A;  3H3Z A;  2M8E A;  1U8R A;  3E6B A;  1STZ A;  3T8R A;  1I6X A;  3WGI A;  4HDV A;  3BY6 A;  1SFE A;  5DCF A;  4KMF A;  2UXN A;  3ZQ7 A;  4EGY A;  4RGX A;  4WXH A;  3GZ5 A;  5DYM A;  3MZY A;  3TO6 A;  3ML6 A;  2PLY A;  4XLN F;  6PAX A;  5FGM A;  1FBQ A;  2WWY A;  4Y13 A;  1TLH B;  3V7R A;  1S7O A;  1B9M A;  2IVM A;  1Z6R A;  4BH9 A;  4ZYG A;  3ECH A;  1FNN A;  1E17 A;  3J80 K;  2HOE A;  4Y17 A;  2XAH A;  2JZY A;  1BC8 C;  3U2R A;  4LLG F;  3ECO A;  2QYO A;  2D45 A;  1G3S A;  4R8H A;  4OMZ A;  4Q5S F;  1S6L A;  2DQR A;  3KP3 A;  2YPR A;  3TQN A;  4PZJ A;  2EA4 A;  2G9W A;  2PI0 A;  3GF2 A;  5LBQ A;  2M30 A;  4Q4Z F;  4CHU A;  2ZNZ A;  2O03 A;  2QQB A;  3I54 A;  3JW4 A;  4CGZ A;  1UB9 A;  2XHK A;  1MZB A;  3SZP A;  2K27 A;  3ZN0 A;  1P4W A;  5BOX A;  2ZBK A;  1BI3 A;  1R5G A;  3WTS C;  2MD5 A;  2HYF A;  4AVP A;  2H6C A;  3WTW C;  4U0V A;  1NHA A;  2P4W A;  3HRS A;  5CLS A;  2IP2 A;  2XAG A;  3WGH A;  4N9I A;  3L09 A;  1HKQ A;  3Q9S A;  3GX4 X;  1R1U A;  3HIF A;  4N9H A;  2IA1 A;  4KFC A;  2RKH A;  4G7H F;  3VOE A;  2VC1 A;  1QO0 D;  1FYM A;  1OYY A;  1W5S A;  2MA3 A;  4IJA A;  2DI3 A;  3CLO A;  4ENJ A;  3AAF A;  4JQF A;  4RB1 A;  1B9N A;  3GYH X;  4HLY A;  2M45 A;  3GXO A;  1TW2 A;  4IF4 A;  5FFX A;  1P2F A;  1D5V A;  5ERI A;  1H9T A;  5D6F A;  4GYG A;  2RGV A;  3K9T A;  3KZZ A;  1ON1 A;  2ISZ A;  4F7Z A;  3KP7 A;  2FE3 A;  3SHF A;  1J59 A;  2A5Y B;  1K7A A;  2QUF A;  1QNT A;  4OIN F;  3WG9 A;  3E6M A;  1IN5 A;  2JPB A;  1B4A A;  4KIG A;  4RS8 A;  2FMY A;  3F8B A;  3T0Y A;  3E97 A;  3EET A;  5DUK A;  2OQG A;  3R0J A;  1LVA A;  3KET A;  5LEJ A;  3I58 A;  2LKP A;  2UZK A;  4I01 A;  4ZZD A;  2DK8 A;  1RI7 A;  4YII A;  2QQA A;  2HR3 A;  1O3Q A;  4B09 A;  5F64 A;  1SMT A;  2HWV A;  4TV7 A;  2JT1 A;  2O6G E;  1KQ0 A;  1ODD A;  1ZH5 A;  2OBP A;  4U7B A;  4EMS A;  1D8K A;  1HW1 A;  2FU4 A;  5IT9 Z;  5L3B A;  5BQT A;  1ZRD A;  4A6D A;  1PUE E;  3TO9 A;  3CDH A;  4EJU A;  2VE9 A;  1K79 A;  4RAY A;  1BI0 A;  4WF2 A;  1R1V A;  3ABU A;  1BJA A;  1OYW A;  5HDK A;  3P7N A;  4KUM A;  2L02 A;  1F1Z A;  1I5Z A;  3HOS A;  1R58 A;  2A68 F;  3FZV A;  3T5X A;  2XAQ A;  1GHC A;  3L00 A;  1Z7U A;  1ZAR A;  2J5P A;  1DPU A;  1T2K A;  3M7G A;  3MEX A;  4A0Y A;  4UHT A;  2Z99 A;  2XV4 S;  4OIO F;  2M1B A;  1J75 A;  4LG0 B;  4WXC A;  4ZZL A;  3CUQ A;  3GVA A;  2KIU A;  3C18 A;  3GEZ A;  5K5Q A;  2X4H A;  1FZP B;  3L2C A;  3RTR A;  4HYE A;  1TQM A;  1OMI A;  4IPA A;  1IXS B;  1B6A A;  2KJB A;  5D6E A;  5JI6 A;  5D4S A;  3RKX A;  2CG4 A;  2L4M A;  5CJ9 A;  2AS5 F;  4CO8 A;  4U0W A;  5AIP A;  4ENN A;  2VBY A;  3BJA A;  2ZFW A;  2BEO A;  2XRN A;  1IAW A;  2HFH A;  4XLP F;  4IHS A;  3ZMV A;  1GVJ A;  3CTA A;  1S3J A;  1D3Y A;  2P8T A;  4G94 A;  4RGR A;  2H27 A;  2RNJ A;  1I1G A;  3LA7 A;  2FNP A;  2GA2 A;  1YYV A;  4ASN A;  4UXN A;  3QP6 A;  2MH2 A;  4HX7 A;  2YSR A;  3W6J B;  2Q0O A;  3SZT A;  3MFK A;  1FYK A;  1YS6 A;  5K5O A;  2DK5 A;  3F8N A;  1JE8 A;  2RC4 A;  3FX3 A;  3BRO A;  3CO6 C;  1W5T A;  3KZY A;  4KNY A;  4D0P A;  3W6K B;  4HX8 A;  3J7A O;  4AIK A;  3IL2 A;  3KCC A;  4L0Y B;  1PDN C;  3HOT A;  3K1N A;  3GW2 A;  1Z91 A;  3F23 A;  5L3F A;  1EH6 A;  3GO5 A;  4M73 A;  2W25 A;  4UVA A;  1KU2 A;  2R7F A;  4AD9 A;  1LJ9 A;  4PDK A;  1QBJ A;  4MHG A;  4LB6 B;  2Z3Y A;  3U9G A;  4ZYH A;  5AIQ A;  3LAJ A;  3TKY A;  3DKW A;  2DFI A;  3K1P A;  5DCM B;  2UXX A;  1KU9 A;  1V3F A;  5FD5 A;  3VOD A;  3FMQ A;  1BOA A;  2RN7 A;  4IRI A;  1UST A;  4EJW A;  2KJC A;  4EVI A;  4MEX F;  5HS9 A;  4M9S A;  4EJV A;  3HUG A;  3HTS B;  4MTD A;  3WE2 A;  1FYL A;  3WGG A;  4L5I A;  3FMS A;  3WTX C;  2AXL A;  4LD5 A;  3IKV A;  4DQ2 A;  5ICG A;  1ZRE A;  2CO5 A;  1XMA A;  2MC3 A;  3I0T A;  3ZN1 A;  3F3X A;  1YW8 A;  3HRT A;  3LWF A;  1BM9 A;  1AOY A;  3LFK A;  2DT5 A;  2XRO A;  2GQQ A;  3IWZ A;  1D8J A;  2K86 A;  1KQ8 A;  4ENK A;  5BMZ A;  2QWW A;  1R1T A;  3J81 K;  4UVC A;  3KP5 A;  4A5N A;  2ZJ2 A;  1RUN A;  1TQI A;  1ZAO A;  4A2U A;  5ICE A;  4A12 A;  1OR7 A;  2G7H A;  5DV5 A;  2A69 F;  1AWC A;  2K02 A;  4XBF A;  3JSP A;  4G8X A;  2HDC A;  2V79 A;  5JHU A;  3F8F A;  1WSU A;  1HST A;  4L9V A;  1MD0 A;  3FXQ A;  2DLL A;  1YTY A;  1QGP A;  2EFQ A;  4GCV A;  5TRD A;  1O3T A;  4KN7 X;  4P96 A;  5LGU A;  4NQW A;  4DNC A;  2STW A;  3FMR A;  2DPD A;  2WC2 A;  5CVV A;  3ZMS A;  4CYD A;  2WTE A;  2OZ6 A;  5LHI A;  2FXA A;  2VOD A;  1T38 A;  3I53 A;  5L3E A;  5ED4 A;  1XGN A;  1Z6T A;  3S2W A;  4I0A A;  2DW4 A;  3F22 A;  4BNC A;  5E8I A;  5FLX K;  2K4B A;  5EEG A;  3GFM A;  3VB2 A;  2HEO A;  1XN7 A;  3RYP A;  1TNS A;  3CO7 C;  5KVR A;  2OZU A;  2DPU A;  1Z1D A;  3KP6 A;  2R7D A;  2XAJ A;  3GLX A;  4BHP A;  3RPU A;  4WCG A;  2UWM A;  1QQI A;  1YLF A;  2KIF A;  3DPL C;  1U5T C;  2PMH A;  3BJ6 A;  1MJA A;  1ZG5 A;  3ISP A;  4EJO A;  4BQA A;  3QAH A;  5LGN A;  4KA4 A;  2PG4 A;  2IT0 A;  1DDN A;  1SD6 A;  2NYX A;  1L3L A;  5DUI A;  2EB7 A;  2FBK A;  2BE5 F;  4YFX F;  4KMU X;  4L18 B;  4Y15 A;  3FXR A;  1WWX A;  1IF1 A;  2RQP A;  3DEU A;  2E1C A;  4K2E A;  2ESN A;  1LB2 A;  3CJN A;  5LHG A;  2PMU A;  3C3W A;  3HHG A;  4KYW A;  1J5Y A;  2Q8K A;  2O0Y A;  2A6H F;  4U88 A;  3F6O A;  2ETH A;  3IKT A;  2JTV A;  1TBX A;  4RB3 C;  4FT8 A;  3TO7 A;  2XKP A;  2ZXJ A;  4IRG A;  1Q1H A;  2ADU A;  4HLX A;  4EJT A;  2NNN A;  5D5U B;  4ZYD A;  2V1U A;  1ZRF A;  3BWG A;  3DQV C;  5K5R A;  4I09 A;  5A2Q Z;  4BAY A;  5ICF A;  3NRV A;  2PEX A;  1J2X A;  2P5L C;  4G7Z F;  1FPQ A;  4UV9 A;  1LDD A;  1P92 A;  3WTY C;  5H20 A;  3HHH A;  4EQQ A;  2LDU A;  1ZGA A;  1Y0U A;  1XDS A;  2Z33 A;  3HRU A;  5TJJ A;  1IRF A;  1I1S A;  1P4X A;  2P7C B;  5HDG A;  4L9J A;  2DTR A;  4RB0 A;  2ISY A;  2B0L A;  4LJZ F;  5IT3 A;  1R00 A;  4M9Z A;  4ENM A;  5D5X B;  4GO1 A;  4O5V A;  4G7O F;  2XKO A;  4EV0 A;  3RI4 A;  4LLN A;  5LGT A;  3BJO A;  1LEB A;  3FM3 A;  4P9U A;  1G3T A;  4PCQ A;  3DFG A;  4LK1 F;  4G6Q A;  1ONV A;  3JAM Z;  1HKS A;  3R4K A;  5HLG A;  1LDJ A;  5DD4 A;  1JHH A;  2PJP A;  3COA C;  2CFX A;  3O6B B;  4ETS A;  1BBY A;  1ZYR F;  1J7K A;  2FML A;  2HS5 A;  1T0F A;  2QZ8 A;  4LG0 A;  1S29 A;  4UVB A;  2GAU A;  3SXY A;  1YW7 A;  1FWZ A;  1ZRC A;  3R6S A;  3ZPL A;  1KA8 A;  2O8X A;  5K1Y A;  1HW2 A;  1BIB A;  4YG2 F;  1YW9 A;  4L9N A;  3N4M A;  4S05 A;  1GXQ A;  3KLN A;  2V1D A;  1XCV A;  3GUD A;  4MQV A;  4GYI A;  5JFR A;  3M9A A;  1FT9 A;  3E6D A;  2YX7 A;  5CVJ A;  1R36 A;  4XRF A;  1P4A A;  5CVU A;  4LB5 A;  1ULY A;  2XAS A;  4CIC A;  3LQR A;  1IXC A;  3K0L A;  4HF1 A;  3QU6 A;  4FX0 A;  4EM0 B;  1ZG1 A;  3V8J A;  4I02 A;  3V8L A;  2XVC A;  3RJP A;  3TOA A;  1MJB A;  2Z5U A;  2ZNY A;  3PQJ A;  1RIO H;  3GFJ A;  5HLH A;  4WX9 A;  2VOO A;  4E70 A;  2QBY A;  2OA4 A;  2A6E F;  1OPC A;  2F2E A;  3FWE A;  1EV7 A;  4PGH A;  3U1D A;  1VTN C;  2ZKZ A;  4OIR F;  3CUO A;  5BS6 A;  3J80 Z;  4FX4 A;  2K4J A;  1SMY F;  2CW0 F;  3O3K A;  2HTS A;  1MGT A;  1B59 A;  2BGC A;  3DF8 A;  2H94 A;  2HTJ A;  1Z05 A;  5BPD A;  3KLO A;  3E5U A;  1ZN2 A;  1CF7 A;  4XSZ F;  3R61 A;  2VBZ A;  5J6X A;  4M6Y A;  2EA2 A;  2L54 A;  3Q5F A;  5L3D A;  2QBY B;  5DCM A;  1BN5 A;  3ZMD A;  2D2W A;  3MAJ A;  1Z9C A;  5D5V B;  1XSD A;  3TDU C;  2JSC A;  4P5O A;  3WTT C;  1O3R A;  3V7C A;  2EFN A;  1WI9 A;  2O3F A;  5ILS A;  1HQC A;  3F8M A;  3ZMZ A;  5ILU A;  2E7X A;  2QQ9 A;  5DD8 A;  3BP8 A;  1ZLJ A;  3QOP A;  2PN6 A;  5HVQ C;  1FC3 A;  1TW3 A;  1R5H A;  4YFK F;  1ZHF A;  1IRG A;  4EM1 A;  5H6Q A;  2VXZ A;  4IVN A;  4AWX B;  2STT A;  1CF7 B;  2ESH A;  4R1H A;  4KIF A;  2FSW A;  3SQN A;  1KYW A;  3F72 A;  1IW7 F;  1YIO A;  5CVR A;  3BPX A;  3P9K A;  3QPH A;  5E1X A;  4YIF A;  2P6T A;  2KKO A;  4Z2Y A;  2R3S A;  2VON A;  5ICC A;  2Y0M A;  2H09 A;  2FRH A;  4KN4 X;  1XD7 A;  4I98 B;  1KU7 A;  4LK0 F;  1U5T B;  1O7L A;  1HKT A;  2DBB A;  3PQK A;  2QM3 A;  4Q47 A;  3F6V A;  1UFM A;  3DXJ F;  3I59 A;  2RDP A;  5E20 A;  2F5C A;  1OKR A;  3MCZ A;  2W85 A;  3ULQ B;  2IJL A;  2ZME B;  1L0O C;  2LF7 A;  4KIC A;  5DEQ A;  1F4K A;  4O3M A;  2VC0 A;  3TOB A;  3K1M A;  1O7F A;  1S8N A;  4M6X A;  4A6E A;  4IHT A;  2L3D A;  3OV8 A;  1H9G A;  5E8G A;  1WQ2 A;  1X3U A;  4I2O A;  1P6R A;  1T98 A;  5CYV A;  2GZW A;  1JHF A;  3M8F A;  5HLI A;  3IHU A;  3R60 A;  3I64 A;  1ON2 A;  2IRF G;  2FF4 A;  1JGS A;  3V4G A;  4WK8 F;  2KIM A;  2G7U A;  3P9I A;  2LSO A;  2DAO A;  3C7J A;  3D0S A;  2IA0 A;  3I59 B;  5AON A;  3N97 A;  1W7P D;  1G4D A;  2QLZ A;  1C0W A;  1XDU A;  1FLI A;  4Q48 A;  1HW5 A;  2EJR A;  2MLG A;  1BI2 A;  2E7W A;  3H3U A;  1SAX A;  2PQ8 A;  2J5O A;  3LA2 A;  2EV0 A;  4JK1 X;  4OOI A;  3EYY A;  3MQ0 A;  1SD4 A;  5ILV A;  2F5E A;  2OQR A;  5IT9 K;  1YS7 A;  2L01 A;  1K6O A;  4OIP F;  4MTE A;  2QVO A;  3I4P A;  1FP1 D;  3JTH A;  1FP2 A;  2C6Y A;  3CUQ C;  4NB5 A;  4MEY F;  4A0Z A;  3FM5 A;  2F5D A;  4HAM A;  3BOQ A;  1DPR A;  3FF5 A;  3KE2 A;  4HDU A;  4IRH A;  3HSF A;  4LMY A;  1ZLK A;  2EFP A;  4HA8 A;  2W84 A;  1DP7 P;  3ELK A;  4LFU A;  5J8F A;  2CQK A;  4WWC A;  2LNB A;  5LRS A;  2HQN A;  3KP2 A;  2XAF A;  1XSX A;  3L7W A;  2GWR A;  1MDM A;  2FEZ A;  4JBA A;  3PFI A;  2MLK A;  3B02 A;  4BHB A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...