4ZZDA

Crystal structure of multidrug resistance regulator lmrr bound to riboflavin
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
104
structure length
98
Chain Sequence
b'PKEMLRAQTNVILLNVLKQGDNYVYGIIKQVKEASNGEMELNEATLYTIFKRLEKDGIISSYWGDRKYYRLTEIGHENMRLAFESWSRVDKIIENLEA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords TRANSCRIPTIONAL REGULATOR, PADR-LIKE FAMILY
publication title Binding of the Lactococcal Drug Dependent Transcriptional Regulator LmrR to Its Ligands and Responsive Promoter Regions.
pubmed doi rcsb
source organism Lactococcus lactis subsp. cremoris mg1363
molecule tags Transcription
total genus 36
structure length 98
sequence length 104
ec nomenclature
pdb deposition date 2015-05-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03551 PadR Transcriptional regulator PadR-like family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 4zzdA00
2DK8A 2MBFA 1SD5A 3MQ0A 1FLIA 2OQGA 4KNYA 5DV5A 3W6KB 1L0OC 3MFKA 3IRRA 4O3MA 2GZWA 4BXUA 4LMYA 2F5FA 1J2XA 1IW7F 1ZRFA 1IN7A 2TDXA 1F1ZA 3E6BA 3SZTA 3F21A 5LHGA 3Q9SA 2K4JA 1XSVA 3ZMTA 1ZYRF 4HF2A 2PQ8A 2JZYA 5HVQC 1H0MA 1KGSA 1FBQA 4N0BA 2KKOA 3I64A 4NHJA 2PMUA 1LJ9A 2D1VA 4M6YA 3VB2A 1H9TA 5CVUA 4L5JA 3ELKA 4WWCA 1KYWA 2ZBKA 3NEUA 2HKXA 4M74A 3I4PA 5D8LB 2FQ3A 2HWVA 3ULQB 3MZHA 4LK1F 4G6DA 4I98B 4BHCA 3Q5FA 2VE9A 2Q2EA 3OOPA 4I0AA 2CGPA 4ESFA 2ZFWA 4UNOA 5D4RA 3HRUA 5K5RA 1A04A 1TQMA 4Q47A 4OMZA 5H20A 3R0AA 3LQQA 5E17F 4HQMA 3RKWA 1YIOA 3EYYA 1O7LA 2XUBA 4L9TA 1KU9A 5L3CA 2ESHA 4MHGA 5D8KB 1K78A 2G7UA 4EJOA 2RGVA 1ONVA 3IKVA 2O0YA 4UHTA 3GFMA 5A2QZ 2M45A 4S04A 5HLGA 1ZLKA 2NS0A 2PEXA 1BJAA 1WQ2A 5DD8A 1IN6A 1BC8C 5FFXA 2Z3YA 4WXCA 3GO5A 1U3EM 1EV7A 1USTA 2NYXA 4BYYA 1IRFA 5LRSA 1TW3A 2Z33A 4IRHA 4MEYF 2ESNA 1JHFA 1DPRA 2RQPA 4A0ZA 3CO7C 2CSOA 3R4KA 3K1PA 4ASNA 1J59A 4P9UA 3GVAA 1S7AA 3V7SA 4MNUA 4G7OF 3V8KA 1U8RA 2XVCA 3BP8A 2EK5A 3HSFA 2BEOA 3LAJA 3OV8A 3FXUA 1KU3A 2WC2A 3DF8A 2ADUA 3ISPA 4HDUA 2FBHA 1FBSA 1I1GA 4IJAA 3RPQA 2AS5F 2NAZA 1J7KA 3FWEA 3BJAA 4AIKA 3IHUA 2GXBA 1BOAA 1W7PB 1DP7P 6PAXA 1HQCA 1FYLA 1BN5A 2OD5A 1PP8F 2K86A 4LJZF 1QZYA 2A69F 2E7WA 3TO9A 3F8CA 2NRAC 2M5WA 4FHTA 3EETA 3VOEA 2GA2A 2E1NA 2QBYB 4L9JA 2OAZA 4GO1A 4ZYDA 1V3FA 2HTJA 5HOOA 2F5EA 4MTDA 2XROA 2GAUA 5CVIA 2O03A 3HUGA 4G7ZF 1YO5C 5LEJA 5D5WB 4XSXF 3CUQA 3V7RA 3DFGA 2XV4S 1XCVA 3HYIA 3ERED 2D1HA 4ENKA 1S29A 1O3RA 2A68F 1SMTA 3W6JB 4F7ZA 1J5YA 2J5OA 1Z7UA 2VC1A 3QRFF 2UXNA 1F5TA 4P9FA 4KN4X 2CG4A 4RGSA 2FRHA 3J81K 1UHWA 1KQ0A 1IZ1A 3ML6A 3VEPA 1ON2A 4M9ZA 2IVMA 2LDUA 2YPRA 3C7JA 1CGPA 5J8FA 1WSUA 4HX7A 2ISZA 2EB7A 5LGTA 3ZMVA 2OZ6A 1FBUA 3E97A 1PP7U 2OA4A 3REOA 3J80Z 2XAGA 1P92A 5BS6A 3TDUC 5LRRA 2CFXA 2D45A 2FE3A 1G4DA 4WXDA 3KP6A 3I0TA 3RTRA 3RIRA 4U0YA 4NB5A 2HOEA 2VN2A 5K5QA 3GWZA 2P7VB 3RPUA 2P5VA 1RZ4A 3RYPA 1FT9A 2P6SA 1GXPA 3LSTA 4KA4A 5JHUA 1LDDA 1R23A 1S6LA 2QYOA 4NQWA 5A2QK 2F5DA 3QP5A 5HDNA 2FMLA 4QWQA 3HOSA 2P5LC 4AVPA 4ENJA 5HDGA 2RNJA 2O8XA 4EJUA 3H3ZA 4OINF 4BH9A 2VXZA 3B02A 2RV8A 4XLPF 3FF5A 5KK1A 1OPCA 3ZMDA 1R7JA 2KRFA 3HRTA 3PQKA 2IPQX 1IUYA 2HQNA 4MTEA 1IN5A 3JSOA 5AIPA 3CUQC 1R1TA 3WE2A 2EJRA 1IXSB 1T2KA 1GVJA 3COAC 3IRQA 3I54A 4A5MA 2P4WA 3FMQA 3TO6A 2IJLA 2LSOA 4UVAA 3L2CA 1B1BA 3LWFA 1K79A 2M1BA 2PFBA 2V1UA 2DK5A 2CWEA 2QWWA 2P5KA 3QOPA 1P4AA 2DI3A 5EEGA 3G73A 2QZ8A 4A6DA 4M6XA 2YX7A 4B8XA 2CW0F 5BQTA 1QNTA 5DUIA 4KICA 3CJNA 2XKPA 1Q1HA 2HYFA 4YIIA 2CYYA 2BBYA 2ETHA 2Z99A 1FSHA 2W85A 4RGUA 3GFIA 4B09A 3GUDA 5K1YA 1BI0A 3M9AA 3CDHA 4U7BA 3VFZA 3NQOA 2ZMEA 2OQRA 1B9NA 3GF2A 1F4KA 1MGTA 4EMSA 2VBZA 4HV5A 1L3LA 4LD5A 3V4GA 5FD5A 2GXGA 4UVCA 1Z6TA 1VTNC 3R6SA 3WTYC 2EA2A 2DW4A 5DD4A 5H6QA 4RAYA 5DUKA 2A5YB 3U2RA 2L01A 1SMYF 3EQLF 3RKYA 4Q5SF 3TGNA 2KIUA 3N97A 2ZO4A 1O57A 1D8KA 4KUMA 3V7CA 1ULYA 2HS5A 5LEKA 1TBXA 3QPHA 5ICFA 5D5XB 3GXOA 2C6YA 3SQNA 3V8LA 2XAJA 2UXXA 3MCZA 4YG2F 3VODA 2L4MA 1I27A 1Z05A 3MZYA 3L09A 3SZPA 2YR2A 1FYKA 4HOBA 3TOBA 2QUFA 4HAMA 4HQEA 4GYIA 2BYVE 3EUHA 2FBKA 4GXOA 1Y0UA 5IT9K 1SFEA 2HYGD 3J80K 2XASA 3B73A 3GLXA 1H9GA 1BM9A 2HDCA 2JSCA 2XIGA 1XDSA 4L18B 5L3BA 1EH8A 1LNWA 3GEZA 4BNCA 1RNLA 4CDGA 2E1CA 4R79A 4LFUA 4I01A 5CYVA 3RYRA 1K7AA 4Y17A 1W4MA 2STTA 3BDDA 3KETA 2A07F 1OYIA 5D5UB 3J81Z 4UV8A 3KE2A 1DPUA 4M9XA 2NNNA 3QP6A 3O6BB 3U9GA 3LA7A 4KIFA 4HLYA 2VOPA 1YW8A 2QBYA 4O5VA 5L3EA 3TO7A 5LBQA 1T6SA 1D8JA 1W7PD 1YG2A 3DKWA 1O3SA 3F3XA 5E20A 2R3SA 1E17A 4A12A 3KEOA 2K02A 4N9IA 1HXDA 3I59B 1XN7A 1T38A 3KP4A 2NNYA 4DNCA 5FD6A 3JTHA 3FM5A 3HHGA 1LEAA 2GIVA 4JBAA 1MDMB 3F23A 2EV5A 1ZARA 4EM2A 2QQ9A 1IXCA 2JPBA 2FU4A 2PMHA 2K4BA 5IT3A 5KVRA 1SD6A 4OIRF 1LQ1A 2QVOA 4RAZA 1O7FA 5DCMA 1TNSA 2L4AA 1G3SA 2JRTA 1BIBA 1OMIA 2DTRA 5ILUA 2RVCA 3BROA 5D5VB 3DEUA 4OIPF 4LLNA 1U5TA 4EJTA 5LHHA 3NRVA 5HLIA 1AOYA 1ON1A 2GQQA 1DDNA 3CO6C 2VT2A 2A3SA 4ZYEA 3PQJA 4EGZA 3D0SA 3GFJA 3C3WA 2M30A 4L9VA 3O2PE 3KP3A 2IA1A 3KZZA 2RDPA 4LB6B 4TV7A 3E6MA 2YU3A 4I7HA 1XMAA 3E5UA 2V9VA 1ZG1A 5K5OA 4UVBA 3QAHA 4E70A 5JI6A 1QGPA 2R7FA 2H94A 1C0WA 4ON0A 1IRGA 3WTSC 4I2OA 4LB5A 4U88A 2H09A 3LA2A 2FNAA 3QU3A 1HKTA 1HKSA 3K69A 5ED4A 3V8JA 2WTEA 3IKTA 2PJPA 2X0LA 4RB2C 5ILVA 1LEBA 4HYEA 1YQAA 1J75A 1ZG5A 1HW2A 1RI7A 2DU9A 1G6NA 2E7XA 4UV9A 1I6XA 3H3UA 4IRIA 4XSZF 2FXAA 5LGNA 3ZMSA 1EH7A 1KQ8A 4LG0B 4IXAA 4ETSA 1R58A 1R22A 2ZCWA 4HW0A 1Z1DA 1FWZA 1FY7A 2D2WA 2H6BA 2RN7A 3ZP5A 1FP1D 2L3DA 3HSRA 2FSWA 4JQFA 3K9TA 4WX9A 1OKRA 3R0JA 5LLQA 2HFHA 3LFKA 5BPIA 3WTZA 3BY6A 1IN8A 3TOAA 2Y48A 2H6CA 4ZH4F 4OOIA 1K78B 3BJ6A 4WXHA 2IA2A 4MQ9F 5AONA 1QO0D 4PZJA 5D6FA 4OIOF 3JW4A 1U6GA 3KP2A 1TLHB 1ZREA 4CYDA 4HX4A 1BI3A 3RI4A 5IT9Z 1D5VA 1G3TA 1U5TC 3JSPA 4IPAA 1MJBA 3FMSA 4EGYA 4Q4ZF 1KU2A 4YFXF 1TQIA 3FX3A 3IC7A 4A6EA 4LLGF 4FT8A 1B6AA 1BI1A 2KIMA 4G7HF 3F6VA 2LKPA 2ZNZA 1XSDA 1KYZA 4GYGA 2P6TA 4YIFA 1LB2A 4EJVA 2GWRA 3I53A 2HTSA 1E2XA 2A6EF 1ODDA 1IN4A 1J9IA 3F72A 5CJ9A 1TW2A 1HBXG 1HW5A 2X4HA 1ZAOA 3WGGA 3IWFA 3GZ6A 4EM1A 2OBPA 1KQ9A 1IAWA 1PDNC 1R36A 1R1VA 1XGOA 3T8RA 4CZZA 1DUXC 1SFUA 1FSEA 4EQQA 4I09A 1P4WA 4AIHA 2BGCA 2PI0A 4ZYHA 2QLZA 3GFLA 4RB3C 3P7NA 3L00A 4A5NA 2EV6A 2BV6A 2M8EA 4Z2YA 4G94A 2FNPA 2VBWA 4PGHA 4GGGA 4HDVA 1ZGJA 1YS7A 5F6FA 4IF4A 4YFNF 3FMRA 2MA3A 3P9IA 1RIOH 3ABTA 5ICCA 2HGCA 4ESJA 1W5SA 2XAHA 4Q48A 4KYWA 3FXQA 5TRDA 2W84A 4KN7X 2DT5A 1XGNA 4ZZDA 1ZRDA 3M8EA 4MQVA 1MJAA 5HLHA 1WKMA 4QLCU 4OMYA 2A6HF 4OU0A 1T0FA 2HEOA 2VBYA 4PCQA 4IHTA 4HA8A 2Y75A 1MJ9A 2FA5A 2VODA 3BJOA 2ELHA 1JE8A 2XKOA 3D5LA 3KEQA 1I5ZA 1BIAA 3I59A 4D0PA 3E5XA 2HKOA 4R1HA 2DPDA 3SFZA 3WU0A 2QQBA 2QENA 4L0ZB 4G8XA 4Y15A 4HF0A 1R5HA 4YFKF 1OYWA 3DQVC 3ZMUA 3M1EA 3TQNA 1O3QA 1FNNA 1JXSA 4EVIA 1NHAA 2HR3A 3T0YA 1AWCA 1BC7C 4R8HA 5HS9A 1HSTA 2W25A 3G3ZA 2DQRA 4IVNA 5D6EA 1YW7A 3HRMA 2V1XA 2PLYA 3N4MA 2IA0A 2DFIA 1T98A 2JT1A 4AIJA 2IRFG 3JAMZ 5BPDA 4O6JA 1BBYA 4XBFA 2QM3A 2W24A 1ZGAA 2FOKA 2O6GE 2XRNA 1YLFA 1XB4A 5JFRA 1UHMA 1OYYA 2YSRA 3TDZC 2EFWA 2MH2A 3DP7A 1D3YA 3K1NA 1USSA 2WV0A 5J6XA 4ZYGA 2DQLA 1UCRA 4KMUX 1SFXA 3L9FA 4U0VA 2MLKA 4I02A 1WRJA 2W57A 4FX0A 4L5IA 1WI9A 2MC3A 4K2EA 3R60A 4KIBA 3ABUA 1LDKB 2GA1A 5HS7A 1ZH5A 4PGGA 3ZQ7A 3GYHX 2PG4A 3HIFA 4XLNF 5E1ZB 3E6CC 1W7PA 1FX7A 1F9NA 5E1WA 4BQAA 4M73A 2EFNA 2KIFA 2EWNA 5L3FA 4U0WA 2VONA 4HX8A 5CVJA 3GX4X 4CXFA 3ROUA 4EJWA 5DYMA 4ENNA 5ERIA 2R7DA 5HDKA 1FOKA 1YTYA 2XAFA 1J0RA 4MEXF 2ISYA 1IXRC 4IHSA 1YYVA 1CF7B 3HOTA 2DBBA 4LG0A 3O3KA 1I1SA 4Y13A 5CVRA 5ICGA 5BMZA 2V79A 1S8NA 2FMYA 2ZMEB 3KZYA 1IF1A 3TKYA 2IW5A 2Q8KA 3WTVC 3WGHA 3C1DA 2AXLA 1FP2A 3ZPLA 3K0LA 4ESBA 2XGXA 5E8IA 1XSXA 1XCBA 2ZKZA 1GHCA 2JTVA 5D4SA 2V6CA 4LGWA 3KLNA 5FB2A 1WWXA 3I58A 1EH6A 2EV0A 3FZVA 3IWZA 2XHKA 1ZRCA 3RKXA 3CTAA 3I71A 2J5PA 2ZJ2A 3BPVA 5F1RA 2FEZA 1LVAA 3QPTA 2G9WA 2L02A 5FO5A 2MD5A 4CHUA 4RGRA 3F8BA 1FPQA 1ZG3A 4WCGA 2EA4A 3BOQA 3WGIA 1TNTA 2B0LA 3E3VA 2O61A 1MD0A 5ICEA 3WTTC 2LF7A 3BWGA 2PBIA 4AWXB 4EM0B 2BE5F 3EYIA 4I0BA 3F22A 3FM3A 2KJBA 4KDPA 3KLOA 4ENMA 4XRFA 1B9MA 5J8CA 4HLXA 4ZZLA 5DDGA 2JPCA 1TTYA 5CLSA 1X3UA 5TJJA 2DO7A 5E1XA 3EDPA 4UUVA 5E18F 2K7LA 1RUOA 1ZN2A 4WF2A 3JAMK 3DV8A 2DPUA 3J7AO 4RS8A 2CO5A 3T8TA 2V1DA 2Y0MA 5FLXK 2EFPA 5DEQA 4RB0A 3KFWX 3T1BA 1YW9A 3C18A 5JVTA 1R1UA 3M8FA 2FF4A 4A0XA 3HTUA 4JK1X 5JR3A 5CVVA 1FYMA 3L7WA 3DXJF 2IP2A 4CO8A 2MH9A 2VT3A 3HSEA 4M72A 1GXQA 2DLLA 4M71A 3AAFA 1SD4A 3ECOA 4HV6A 2STWA 4P96A 1SD7A 1Z91A 3BPXA 4HZFA 4L9NA 5EEHA 1Z6RA 2M87A 2LNBA 4DQ2A 4RB1A 1U78A 3JTGA 4PDKA 2CQKA 4P5OA 3KCCA 1ZLJA 4CGZA 1HKQA 3R61A 1PUEE 3E6DA 2Q0OA 3RDIA 4LLLA 3QU6A 1T39A 1KU7A 3CUOA 2ZNYA 4KMFA 3SXYA 5DCMB 5LHIA 3F8FA 2WWYA 2K27A 4UXNA 3F8MA 4HF1A 5HS8A 2P8TA 4G9YA 2RKHA 1G3YA 1HSJA 3ZN0A 4G6QA 2ACJA 4BHPA 2XAQA 2Z5UA 3BZ6A 3GZ5A 1U5TB 3T5XA 3ECHA 1KA8A 3F8NA 2HZTA 1ZHFA 3K2ZA 3I5UA 1P2FA 1JGSA 3WG9A 4S05A 3RJPA 1R5GA 4OIQF 2IT0A 1YFHA 4BAYA 3LAPA 5DCFA 2OU2A 5E8GA 1TQPA 3MAJA 1P6RA 2VOOA 5LGUA 3LQRA 4N9HA 1LDJA 3HHHA 3F6OA 3PFIA 4MGRA 4KIGA 1XGSA 4EV0A 4WK8F 4H0EA 3IL2A 1OR7A 3WE3A 2VE8A 3GW2A 3P9CA 5H6RA 2DAOA 2ZXJA 4KFCA 3S2WA 5BOXA 5ILSA 5L3DA 2QQAA 3FXRA 2YX4A 1STZA 4L0YB 1MZBA 1QZZA 3WTXC 2RC4A 4GCVA 3WODF 2VC0A 3E5QA 3KP5A 1K6OA 1Z9CA 1S3JA 3HRSA 2A61A 3Q9VA 1YS6A 3ZMZA 2L54A 1XMKA 1QPMA 3DPLC 2FBIA 3CUQB 5FGMA 4IRGA 3HTSB 1S7OA 4HBLA 5FFZA 1FZPB 2KJCA 1RUNA 2F5CA 5F64A 2VBXA 3KP7A 3WTWC 3P9KA 1QQIA 3DPTA 1JHHA 3M7GA 3MWMA 4LK0F 1P4XA 3FHZA 2H27A 2PN6A 1BI2A 2OZUA 1QBJA 3WU1B 1HW1A 2F2EA 1W5TA 2LF8A 1XDUA 2G7HA 3CLOA 1FC3A 1V4RA 1R00A 1UB9A 4A2UA 1CF7A 1SAXA 4RGXA 2EFQA 1MKMA 1REPC 5L3GA 1XD7A 2O3FA 3SHFA 4KT5C 3MEXA 2MLGA 1MDMA 3U1DA 3H92A 1UFMA 3ZN1A 1XGMA 3LA3A 5AIQA 1B4AA 4P55A 2UZKA 2P7CB 2Z9OA 1U2WA 4BHBA 4CICA 2EFOA 4AD9A 3WTUC 3K1MA 1B59A 2HQRA 4A0YA 2COMA 1O3TA 1G3WA 2UWMA 4M9SA 4FX4A 5FLXZ 4U7DA
chains in the Genus database with same CATH superfamily
3BG6A 4JX6A 1OR7C 3A2KA 4NQWB 2DK8A 3U1KA 3H0DA 1JKRC 4E6KG 1VQPI 2MBFA 1X4OA 2R5YB 1JKPC 1SD5A 4IQ4A 2L7KA 3MQ0A 1Y39A 1FLIA 1PYVA 2OQGA 1I39A 3W2VA 3F9KA 2O9LA 4KNYA 1RKWA 5DV5A 3W6KB 1L0OC 2W4SA 3HKZA 4PJJA 4D1QA 3MFKA 4KT6A 5F08A 3IRRA 4O3MA 4NUBA 2GZWA 3PSIA 4BXUA 4LMYA 2F5FA 1J2XA 3PO2J 3DTIA 1IW7F 3JRAA 1ZRFA 1Y1VJ 1IN7A 2TDXA 3TL4X 1F1ZA 3E6BA 1LKXA 3PSFA 3SZTA 1S5LC 4JYKA 3F21A 1LFBA 5LHGA 2JVGA 3Q9SA 2K4JA 1XSVA 3ZMTA 1ZYRF 2CUJA 1S7EA 1Y56A 4PK4A 2JJ7A 1W1WE 3BTLA 4IHYA 1Y8RB 5J1UA 2V6EA 4HF2A 2PQ8A 5CKTA 3L2UA 2H1LA 1SANA 2JZYA 5HVQC 4RBOA 1HC8A 1H0MA 3H9JA 4A3GJ 3DU6A 3H35A 1KGSA 4Y4RA 3OWTA 1JTXA 1VF9A 4AM3A 1FBQA 4N0BA 2KKOA 3I64A 4NHJA 5FRNA 3FISA 3SFIA 4F92B 1AA7A 2LVSA 2PMUA 3G4SI 1LJ9A 4M3BA 2D1VA 4M6YA 3VB2A 2DMTA 3FHNA 1H9TA 2K9QA 2R7QA 2M0CA 1A31A 2X51A 2DXIA 5CVUA 4BACA 4L5JA 3ELKA 5CPRB 2BY0A 4WWCA 1KYWA 2ZBKA 1YX3A 2HKXA 3NEUA 3ZXSA 1QU3A 4AYBA 3RSNA 3BZKA 5F0CA 4M74A 2IGOA 4ZJZA 3I4PA 5D8LB 2FQ3A 3DKXA 1IV6A 2AHQA 2HWVA 2HQAA 5F0FA 4N4NB 3ULQB 4UUSB 2HOTA 1N78A 3MZHA 4LK1F 4G6DA 2ELKA 2IEKA 1XG1A 1KZHA 1RETA 3OSFA 4I98B 4HSTA 4BHCA 3I56I 3KYLA 3Q5FA 4OAYA 3ZQGA 2VE9A 2E19A 2Q2EA 3OOPA 1VQ7I 4I0AA 2CGPA 3FBNB 4ESFA 2ZXIA 2ZFWA 2DOEA 2V26A 4UNOA 5D4RA 4EATA 2BOLA 2OUMA 4XLFA 3HRUA 2H1KA 5K5RA 3A03A 2DYSH 3EUAA 3DPUA 5C4JJ 5BNGA 1X1PA 3FK6A 1A04A 1TQMA 3L2QA 4AC0A 4Q47A 4OMZA 2L0KA 5H20A 4PJLA 3S17J 3R0AA 4IQJA 4B3AA 3HOZJ 3PJRA 3OL3A 3LQQA 1VQ6I 5K7ZA 4HQMA 5E17F 3RKWA 1YIOA 3EYYA 1O7LA 3K4NA 3FK7A 1W36C 2QF7A 2FJ1A 2XUBA 4CCNA 4L9TA 1KU9A 5L3CA 2LLKA 2ESHA 4MHGA 5D8KB 1K78A 2G7UA 4EJOA 2RGVA 1ONVA 4BGDA 1NK3P 5CQGA 3IKVA 2O0YA 4UHTA 4D5CA 2BY3A 3GFMA 5A2QZ 1POGA 2M45A 4S04A 3S1RJ 5HLGA 1ZLKA 3OYAA 1MBJA 1FOWA 2NS0A 1D1AA 2PEXA 3KYDB 1BJAA 1YOVB 3BTIA 1WQ2A 5J1YA 3E0JB 5DD8A 1IN6A 2JK3A 2OC6A 1BC8C 3KEYA 1UG0A 5KAIC 4PFPA 2Z3YA 5FFXA 4WXCA 3GO5A 1W0UA 2DMUA 1U3EM 1EV7A 1VQKI 1USTA 3ZRGA 2NYXA 5F1JA 2VPRA 3FXOA 4BYYA 1IRFA 3E1SA 5LRSA 1TW3A 2Z33A 2Y9ZA 4IRHA 4MEYF 4AIDA 2ESNA 1EKEA 5EJCA 3ZQQA 1JHFA 1UAAA 1DPRA 3K70C 2RQPA 2F6CA 4A0ZA 3CO7C 1RRJA 2EZKA 2CSOA 3R4KA 3CD6I 3K1PA 4ASNA 1J59A 4P9UA 2Y30A 1WCMJ 3GVAA 4IZZA 5HODA 1S7AA 3V7SA 5FJ8J 4IHXA 4MNUA 4YEJA 1Z77A 4G7OF 3V8KA 5IP7J 4NC7A 4HNVA 1TL8A 3DU5A 1U8RA 2OTLI 2XVCA 3BP8A 4ZTJA 2EK5A 3HSFA 1SFKA 1YRNA 1VQ4I 2L7MP 4D5FA 2DMQA 2BEOA 2MYSA 3LAJA 2R5ZA 2LD5A 1M1EB 3OV8A 5EZGA 3CJRB 3FXUA 2E2HJ 1KU3A 2WC2A 3DF8A 2ADUA 3ISPA 4HDUA 2FBHA 1FBSA 1I1GA 1BL0A 2KQRA 4IJAA 3RPQA 2AS5F 5GPAA 2NAZA 1J7KA 3FWEA 3BJAA 1ZK8A 4AIKA 3IHUA 2GXBA 3PUBA 5E79C 1BOAA 1W7PB 1DP7P 3ZCOA 1HQCA 6PAXA 3OIPA 1FYLA 1BN5A 2OD5A 3ZQCA 1PP8F 2K86A 4LJZF 4YELA 1GDTA 5K7FA 1QZYA 2A69F 2E7WA 2H8RA 3TO9A 1D1CA 2RQQA 3F8CA 2NRAC 3MKWB 2QEXI 2ELJA 2M5WA 2RAEA 3J7YJ 2LBFA 3BCBA 4FHTA 1D5YA 3EETA 3VOEA 3S15J 2GA2A 2E1NA 2QBYB 4L9JA 2JN6A 2OAZA 2MC4A 4S0HB 1JGGA 2HDDA 4GO1A 4ZYDA 1V3FA 2HTJA 1ETKA 2CH0A 5HOOA 2EIKH 2F5EA 4MTDA 5EF6A 2XROA 3M1CA 2GAUA 3UKGA 5CVIA 2ZSIB 2O03A 3HUGA 4G7ZF 1YO5C 5LEJA 5D5WB 4QPOA 2CFOA 1APLC 4XSXF 2EINH 3CUQA 3V7RA 3DFGA 2XV4S 2GBYA 4UUTA 1XCVA 4CZCA 2JSPA 3BT9A 3HYIA 5DTDA 3ERED 4BXXJ 1XX5A 3JRCA 1IUFA 3RKQA 1N77A 2XPVA 3ZGKA 2D1HA 1JT0A 4ENKA 1S29A 1O3RA 2DA3A 2KDZA 2A68F 3CQZJ 4HNTA 1SMTA 2V4JC 3A0HC 3LL7A 3W6JB 4F7ZA 1J5YA 2J5OA 2BW3B 2QSFX 2OF7A 2M7AA 1Z7UA 2VC1A 3X2QH 2K3PA 2UXNA 3QRFF 5FROA 3HOYJ 1F5TA 4H4KC 4P9FA 4XOTA 3HB9A 1OCOH 1V5EA 4KN4X 2CG4A 4RGSA 1S72I 1NH3A 3M3YJ 2LRDA 2FRHA 4HG2A 3J81K 2VJIA 1UHWA 2MABA 2IGKA 4XN0A 4XL9A 5IOZA 1KQ0A 1AU7A 1IZ1A 2KZVA 3ML6A 2CU7A 2IS6A 1VZ0A 2KRCA 1MSEC 2DFFA 2LY1A 3NWTA 4W97A 4IOAF 3DTEA 3E7LA 1ON2A 2X6OA 4M9ZA 3VEPA 2IVMA 2FOWA 1EF4A 2LDUA 2YPRA 3OY9A 1IRZA 3C7JA 1Z3YA 5J8FA 1CGPA 1WSUA 4HX7A 2ISZA 2R7UA 2EB7A 9ANTA 5LGTA 3OYFA 3ZMVA 4JX5A 2OZ6A 4C2UA 1FBUA 3E97A 2JA8J 3SDGA 1PP7U 2OA4A 3REOA 3WG7H 3J80Z 2XAGA 1P92A 5BS6A 3TDUC 3AKZA 5GADJ 5LRRA 3RQIA 2CFXA 2D45A 2FE3A 3PNTA 1BW5A 4MFDA 5HNHA 1G4DA 4WXDA 3Q0UA 3KP6A 3I0TA 5TGTA 3RTRA 3RIRA 4U0YA 4NB5A 2HOEA 2VN2A 2TCTA 2CQ7A 5K5QA 3L2WA 4BS9A 3GWZA 2P7VB 1WVRA 4A3DJ 2CQNA 3RPUA 1LE8A 1R4NB 2P5VA 3W6VA 3JRHA 2DN0A 1RZ4A 1Y0NA 2L2OA 3KX2A 3RYPA 1FT9A 4FQGA 3H9QA 2P6SA 1GXPA 3LSTA 4GRIA 3PFYA 3HGYA 1H8AC 4KA4A 5JHUA 3JRIA 1LDDA 1R23A 1S6LA 2QYOA 4NQWA 5A2QK 1Z3XA 2OCCH 3QYBA 4UY8I 2F5DA 3G2BA 3QP5A 4FETA 5HDNA 2FMLA 3GTLJ 4QWQA 3HOSA 1BR4A 2P5LC 4AVPA 1GLNA 3UR3C 4ENJA 2JQ7A 1T08B 3GTGJ 1DU6A 2Q1ZB 5HDGA 2RNJA 2O8XA 4IOCF 2ZXHA 4HRIA 2EBIA 3LSIA 4EJUA 3LSRA 2NVTJ 3H3ZA 4OINF 4BH9A 2VXZA 3B02A 3G6EI 2RV8A 2QKLB 4XLPF 2DA5A 3FF5A 5KK1A 1JI8A 3CCLI 5LD2C 1OPCA 3K4CA 3ZMDA 3L2VA 1IJWC 4PJMA 4A3EJ 2WY8Q 1DP3A 1R7JA 2KRFA 3HRTA 3PQKA 2IPQX 1IUYA 2HQNA 4MTEA 3WHCA 4BQOA 3CCQI 2Z16A 1IN5A 2WV1A 4B1RA 1U9OA 5IP9J 3OYHA 3JSOA 2VIXA 3N05A 5AIPA 3CUQC 1R1TA 3CMYA 1ETQA 2EJRA 3WE2A 1IXSB 1T2KA 1GVJA 2IXSA 3COAC 3IRQA 2WY7Q 1TT0A 3I54A 3ZQHA 4A5MA 2FQ4A 2GIZA 2P4WA 3FMQA 2CS3A 3IH2A 3TO6A 1GUUA 2IJLA 2LSOA 3VWBA 4UVAA 3L2CA 4GDFA 1B1BA 3LWFA 1K79A 1I6HJ 2M1BA 3PUFA 2PFBA 2V1UA 2DK5A 3W3CA 1VFCA 2CWEA 1BR2A 2QWWA 3G1LA 3OOUA 4J01A 2P5KA 3QOPA 1P4AA 2DI3A 2LR8A 3MKZA 3U21A 5EEGA 4FASD 3G73A 1DGRM 1XMXA 2P0WA 2QZ8A 4A6DA 2E5NA 4M6XA 2YX7A 1UELB 4B8XA 2CW0F 2K40A 5BQTA 1QNTA 5DUIA 2JUCA 4KICA 2XGEA 2LOOA 3CJNA 2XKPA 1Q1HA 2ZC2A 4RAGA 2HYFA 4YIIA 2R92J 2CYYA 2BBYA 2ETHA 2VJ5A 2Z99A 4M3FA 4N4OB 4UUSA 1FSHA 2W85A 3BG7A 1D0YA 4RGUA 3GFIA 4A3IJ 2BZTA 4B09A 3LSKA 5F04A 3GUDA 5K1YA 1BI0A 2H8WA 2V1NA 3M9AA 3CDHA 4U7BA 2WA0A 3VFZA 3HG9A 2ZMEA 3NQOA 1SEUA 2OQRA 1QHGA 1B9NA 3GF2A 1GV5A 1Q1VA 1F4KA 1MGTA 2E60A 4B48A 4EMSA 2VBZA 4HV5A 1L3LA 1RR8C 4LD5A 3V4GA 5FD5A 2MG4A 2GXGA 1RR7A 2M9HA 4BUPA 4UVCA 1Z6TA 1VTNC 3R6SA 3WTYC 2EA2A 2DW4A 3CMAI 5TISC 5DD4A 3BR1A 2FUG2 5H6QA 4RAYA 3HXLA 5DUKA 3ONQA 2A5YB 1OISA 2KIQA 3BTJA 3U2RA 2L01A 1SMYF 3EQLF 3MKLA 3RKYA 4Q5SF 3SYTA 3TGNA 2KIUA 3IH4A 3N97A 2ZO4A 1O57A 2KT0A 1D8KA 2BVMA 4KUMA 3V7CA 1ULYA 5EG0B 2HS5A 2XF5A 2VUMJ 1TP4A 2Y69H 5LEKA 1N75A 1IDZA 3C2BA 3M4OJ 3ERMA 1TBXA 2VKEA 3QPHA 2W48A 2VLAA 5ICFA 5D5XB 3GXOA 2C6YA 1IC8A 4PJ0C 1OCRH 3SQNA 5M5YJ 2WAEA 2JWTA 2X6WA 2XAJA 3V8LA 2NXNB 1R5ID 1ITYA 2PJRA 1JT6A 2UXXA 4F91B 3MCZA 4YG2F 3VODA 1OFCX 2PMZA 2L4MA 1I27A 2VQHA 1PUFA 3HOWJ 1Z05A 3MZYA 5EZHA 3L09A 3JRDA 2WB1N 3SZPA 2YR2A 1FTZA 2XF6A 4Z6YA 2IAIA 1FYKA 4HOBA 3QYEA 3Q3SA 3TOBA 2QUFA 4HAMA 2Y0SA 2GLOA 4HQEA 4GYIA 2CUEA 4PJNA 2BYVE 4CH7A 3EUHA 5GPCA 1AKHB 1KONA 3AL0C 2QGUA 3OYEA 3BR3A 2FBKA 4GXOA 4J00A 1Y0UA 2CQQA 4XIDA 5IT9K 1SFEA 4XM3A 2HYGD 3J80K 2XASA 2EZIA 4FTHA 1ZTRA 3B73A 2DYRH 5KNLA 3TW7A 2EH3A 3GLXA 3KYCB 4NC6A 1H9GA 2NOGA 2ID3A 5DS9A 1BM9A 2HDCA 2JSCA 2XIGA 1XDSA 4ZC3A 4C2MJ 4L18B 3HDDA 2EPFA 5L3BA 1EH8A 3S93A 1LNWA 3GEZA 2VB6A 4BNCA 1T56A 4DYQA 3GBGA 1RNLA 4CDGA 2B7EA 2M8GX 1A35A 1TC3C 2E1CA 4R79A 4AYBN 1X1AA 4LFUA 4I01A 5CYVA 3RYRA 5M3MJ 4Y17A 1W4MA 3HZJA 3W2WA 1K7AA 2STTA 3BDDA 3KETA 2A07F 1OYIA 5D5UB 3J81Z 4X1EA 3LOCA 5GP9A 4UV8A 2ECCA 3KE2A 3LSJA 2EIMH 2ZXWH 2CUZA 1DPUA 3OIQA 1QZEA 2XSJC 4M9XA 2CUFA 2NNNA 3QP6A 3OYIA 3S1QJ 3D5SC 3O6BB 3U9GA 1FMVA 3DBRB 3LA7A 4KIFA 4HLYA 2MD0A 4QTRA 2L5QA 3BZCA 2VOPA 1YW8A 4FE7A 3HOVJ 2QBYA 2F48A 4O5VA 4CCJA 2R7SA 2BY1A 5FKKA 5L3EA 3ZR8X 3TO7A 5LBQA 3OYLA 1AHDP 1T6SA 1D8JA 1W7PD 2OV7A 3ZQIA 3GTPJ 3CMMA 1YG2A 3DKWA 1O3SA 1DGWY 3F3XA 2R3SA 4W1UA 5E20A 1E17A 3OL4A 2DMNA 3S1NJ 1VNDA 2L9NA 3A0BC 4A12A 2NVUB 3KEOA 2K02A 4N9IA 3W2AA 1TWAJ 3J7AY 2UUZA 1HXDA 3I59B 1XN7A 1T38A 3KP4A 4IHVA 2ZMEC 4XOPA 2NNYA 2E2IJ 2DMPA 4DNCA 3PL8A 1MBGA 5FD6A 2R7OA 2HNHA 1U0JA 3JTHA 2ZB9A 3FM5A 2L9SA 3HHGA 3BR0A 2XC7A 1WFXA 2V9KA 1LEAA 5IY5H 2LK2A 2GIVA 1MW7A 3BR2A 4JBAA 3JRFA 3CMEI 3D5RC 3NWSA 1MDMB 4MLOA 2EV5A 5FKMA 1ZARA 3F23A 3KIOA 1UJ8A 4EM2A 2QQ9A 3K2AA 1IXCA 4CCKA 2GOMA 2VQCA 1WH7A 1TWCJ 2JPBA 4NBQA 2FU4A 2PMHA 2K4BA 2X1CA 3QQAA 3SDBA 4ZDOA 5IT3A 5KVRA 1LVKA 1SD6A 4OIRF 1LQ1A 2LC2A 2QVOA 1O7FA 1T33A 4RAZA 5DCMA 2VKVA 1TNSA 2V7FA 1SVMA 2L4AA 1G3SA 2JRTA 3IAS2 2Y9YA 5J4VA 1BIBA 2R7TA 2TRTA 3QYFA 1OMIA 4D9JA 3K4KA 2DTRA 3HC7A 5ILUA 3NAUA 2RVCA 3UNGC 2BHYA 4X0GA 3BC8A 3BROA 3AFHA 5D5VB 3A4CA 3DEUA 5EGOA 4LLNA 1U5TA 4EJTA 4OIPF 5LHHA 2JVHA 3NRVA 3H5NA 5HLIA 4BL0B 1AOYA 1QRYA 3OSGA 1VQLI 1NTCA 3FXLA 1JTYA 4AVZA 1ON1A 2JUGA 2HDWA 2K85A 2XF7A 2GQQA 1DDNA 1Z67A 3EUHC 3CO6C 1BA5A 2VT2A 4E7HA 2A3SA 1B8IA 4ZYEA 3PQJA 2DDAA 4EGZA 3D0SA 3GFJA 2HVQA 2M30A 3C3WA 4L9VA 1D0XA 2AQEA 3O2PE 3KP3A 2QQ8A 2IA1A 3KZZA 2M4KA 2RDPA 4LB6B 4TV7A 4BY7J 4DBQA 3E6MA 2YU3A 4I7HA 3S32A 1XMAA 3E5UA 2Y31A 2KZGA 2V9VA 1ZG1A 5K5OA 3K6GA 1WH5A 4UVBA 1OQYA 2NS7A 2X9DA 1V55H 3QAHA 4E70A 5JI6A 1QGPA 2R7FA 3K4MA 3JCUC 2H94A 3CCRI 4OAZA 4KITB 1C0WA 1HCRA 4ON0A 4D7MA 1A6IA 2O5RA 1IRGA 1J09A 3WTSC 4F55A 4I2OA 4LB5A 4XK4A 4U88A 4PSXA 2X48A 2H09A 1IRXA 3GCMA 2W82A 3LA2A 1W0TA 2FNAA 5E3NA 3QU3A 1HKTA 2QSGX 1HKSA 3K69A 5ED4A 3V8JA 2CV1A 1PJRA 4B44A 5IPAA 1I3QJ 2WTEA 5E3LA 3IKTA 2PJPA 2LMDA 2X0LA 4RB2C 5ILVA 1G2HA 1LEBA 4HYEA 1D1BA 2Y2ZA 4IL6C 1Z0XA 1YQAA 1J75A 1ZG5A 1HW2A 1RI7A 2DU9A 1G6NA 2E7XA 3ABLH 4UV9A 1I6XA 3H3UA 4IRIA 2K9NA 4XSZF 2FXAA 5LGNA 3ZMSA 2HYJA 1EH7A 5FKNA 1KQ8A 2EZLA 4DIQA 4LG0B 4IXAA 4ETSA 3M8JA 1R58A 1R22A 1FEXA 2MGQA 2ZCWA 3QPSA 4HW0A 5J47A 1Z1DA 1FWZA 4RLFA 1XPXA 4DOZA 4E7LA 1P7JA 4ZTFA 4F3QA 1MNDA 1K83J 4BE1A 1FY7A 2BXZA 1HA8A 3OYNA 1VQOI 1X1CA 1UZCA 2D2WA 2H6BA 2RN7A 1T95A 2E1MB 2IGNA 5M5XJ 4DYRA 3ZP5A 4Y3OA 1FP1D 2L3DA 3MN2A 3HSRA 3VYTB 2EILH 2FSWA 3DCFA 4X6AJ 1V54H 2ZJQF 4JQFA 3K9TA 4WX9A 3L1PA 5E3MA 3CLQA 2R93J 4MFEA 1OKRA 3R0JA 2IS4A 5LLQA 5J1RA 2HFHA 2WAQA 3LFKA 5BPIA 3WTZA 3BY6A 3VYUB 1IN8A 3TOAA 1B72A 2Y48A 2H6CA 3OYMA 3OYCA 2E1OA 2K9LA 4ZH4F 3JREA 4OOIA 4RMNA 1K78B 3I4MJ 3BJ6A 2IS2A 4WXHA 2IA2A 4MQ9F 5AONA 1QO0D 4PZJA 3K4LA 5D6FA 1R9TJ 4OIOF 3JW4A 1U6GA 4BU2A 3KP2A 3IH3A 3PO3J 1TLHB 4DYCA 1ZREA 2OTJI 3OMYA 2OPTA 4HX4A 1BI3A 4CYDA 3RI4A 5IT9Z 4RLQA 3HM5A 1D5VA 1G3TA 1U5TC 3JSPA 1EJ9A 1K6YA 4IPAA 1MJBA 3FMSA 2LP0A 4EGYA 4Q4ZF 4KJZA 1KU2A 4YFXF 1TQIA 2FD5A 3FX3A 2E35A 3IC7A 3QWLA 4A6EA 4XRSG 2VJJA 4LLGF 2COBA 4RA2A 4FT8A 1B6AA 1BI1A 2NOJB 4E7KA 5HLTA 2KIMA 4C3HJ 3O8GA 3CF5F 5GTIC 3F6VA 4G7HF 2LKPA 2ZNZA 1XSDA 1KYZA 4GYGA 4BQNA 1F43A 2P6TA 4YIFA 1LB2A 3WHBA 4EJVA 4BJ5C 2GWRA 4YIRX 3I53A 2HTSA 1E2XA 3LSHA 3F0CA 2A6EF 1ODDA 2XPUA 1IN4A 1J9IA 4D7NA 1OCTC 2Z1DA 3F72A 5CJ9A 1TW2A 1HBXG 1HW5A 3CCJI 4II3A 2X4HA 5EG0A 1I3AA 1JKQC 1ZAOA 3WGGA 3IWFA 3GZ6A 3LMMA 4E7IA 1UHSA 2AO9A 3GZNB 4EM1A 5IYCJ 2OBPA 1KQ9A 3DEEA 1IAWA 3CC7I 3MZ8A 4A69C 3A01B 3K10A 2E5ZA 1PDNC 4V19K 4ZDPA 1R36A 2R7VA 1YRNB 1R1VA 1XGOA 2R5ZB 3LSMA 2R5YA 3T8RA 4CZZA 1DUXC 1SFUA 1FSEA 4EQQA 4JX4A 4DGWB 4I09A 1P4WA 2XB0X 4AIHA 2BGCA 2PI0A 4ZYHA 2QLZA 3GFLA 5DM6F 4I6ZA 2DFHA 4RB3C 3CCEI 3IUOA 3P7NA 1EA3A 4XKWA 4CCLA 3L00A 3CP2A 4A5NA 4I99C 3CP8A 2EV6A 3EUKL 2BV6A 2CW8A 2G0EA 2M8EA 4Z2YA 2R7RA 3PNVA 4G94A 2FNPA 2JA5J 2VBWA 4PGHA 4GGGA 2LBFB 3OS1A 4HDVA 3GTKJ 1ZGJA 1Y1WJ 4E4HA 3FIWA 4HEA2 4KISA 1YS7A 2NVYJ 3DKYA 5F6FA 2XPWA 4IF4A 4YFNF 4NNJA 4C2TA 2LH9A 3H36A 3HPGA 4V2FA 2M0MA 3I4NJ 4ZYAA 1VQ5I 2LG4A 3FMRA 4F93B 2MA3A 3P9IA 3HUGB 5E3OA 3BQZA 1RIOH 3ABTA 5ICCA 2HGCA 4ESJA 1LUJB 1W5SA 4M3EA 4AUXA 3H3VK 1HF0A 5B5EC 2XAHA 4Q48A 4CYCB 4KYWA 4NDLA 3FXQA 5TRDA 2GOXB 2VL8A 1WJCA 2W84A 1E3OC 3DLLF 4KN7X 4BEHB 2DT5A 1XGNA 4ZZDA 1ZRDA 3M8EA 4MQVA 1D0ZA 1MJAA 3BQYA 3FBIB 2M7BA 5HLHA 1WKMA 2L7FP 4QLCU 1WZ2A 4XN3A 3J7ZI 4A3MJ 1SAUA 3CDLA 2A6HF 4OMYA 3H1CA 1MMNA 4B43A 3JRGA 4OU0A 1T0FA 2NVQJ 1MMDA 5JLWA 2HEOA 2VBYA 1TWGJ 4PCQA 4IHTA 1X19A 2DA7A 3CCYA 2Y75A 3C2HA 4HA8A 1MJ9A 2FA5A 1P7IA 2VODA 3BJOA 2ELHA 1JE8A 2XKOA 1E3PA 3D5LA 3OR2C 4UB6C 4E7JA 3KEQA 1I5ZA 1BIAA 5JLXA 3TEDA 3I59A 1G59A 1U9NA 4D0PA 3E5XA 2HKOA 4QPQA 4R1HA 4A3KJ 3KZIC 2DPDA 1WJ5A 2CMPA 3OYJA 1MIJA 3SFZA 3WU0A 3BR6A 2QQBA 2QENA 5FKOA 4L0ZB 2OJED 4G8XA 4Y15A 4HF0A 1R5HA 4YFKF 1OYWA 3H0GJ 1BR1A 3DQVC 3ZMUA 3M1EA 3I55I 1YJ9I 2LY9A 3TQNA 4A3BJ 1O3QA 2X1EA 2VKDA 1FNNA 2HI3A 3CESA 1JXSA 3B6AA 4V2GA 4A3JJ 4EVIA 1NHAA 2HR3A 3T0YA 1AWCA 2RNGA 4R8HA 4XICA 1BC7C 1ZQ3P 2K9SA 4B4CA 5HS9A 1HSTA 4RM2A 2W25A 3G3ZA 3GTQJ 2DQRA 4C9YA 5B3SH 4IVNA 2M2EA 5D6EA 1YW7A 3OS0A 3HOXJ 3HRMA 2V1XA 1FOYA 1GV2A 2PLYA 2DOAA 3N4MA 1SFOJ 1MMGA 3LNQA 2E36A 4ZDLA 3L2RA 2IA0A 4XKVA 2DFIA 4BQQA 3HKZN 1T98A 2VJ4A 1LE8B 2HXIA 1G8XA 2JT1A 4AIJA 3AG4H 5IYDJ 2IRFG 3JAMZ 1MMSA 3GTMJ 5BPDA 4O6JA 1BBYA 5LFAA 3CCSI 3BLYA 2QM3A 4XBFA 4J19A 2LFBA 3P5JA 2W24A 1ZGAA 4YRVA 3S16J 4CUGA 3BG5A 2IGMA 2FOKA 1XTAA 1W36D 2O6GE 2XRNA 3GMEA 1YLFA 2I5UA 2JRMA 1XB4A 4IKFA 5JFRA 1UHMA 1OYYA 2LREA 2CQXA 3VPRA 3K4JA 2YSRA 2KPMA 1TWHJ 3TDZC 2EFWA 2NVXJ 2MH2A 2DA1A 3DP7A 3H9GA 4MIMA 1D3YA 2CW7A 3AG2H 4RAFA 4IX7A 1FTTA 3K1NA 1USSA 2HZDA 1BW6A 4HSRA 5M5WJ 3DBHB 2LY2A 2QCOA 2WV0A 5J6XA 4ZYGA 1VI0A 1U8BA 2DQLA 1OCPA 2F4IA 1UCRA 3G1MA 4QIWN 4M3DA 4KMUX 1SFXA 1V5FA 3L9FA 4U0VA 2XB5A 2MLKA 4I02A 2MW8A 3OYKA 4BKXA 1WRJA 2W57A 3KPHA 4FX0A 2DA4A 3O8HA 1WI9A 4L5IA 3ZQFA 5B66C 3AL0B 2MC3A 4K2EA 3R60A 1WI3A 4KIBA 3ABUA 1ETOA 1LDKB 2WB1A 4BJ6C 2GA1A 5HS7A 3QODA 1ZH5A 2VI6A 4PGGA 2K5CA 3ZQ7A 3GYHX 2K3FA 2PG4A 3HIFA 4XLNF 3WU2C 5E1ZB 3BG3A 2WBMA 1LFPA 3E6CC 3RCOA 3K70D 2A6TA 2HOSA 3ABMH 2M4GA 3HOUJ 2DFEA 1W7PA 1A36A 1MBHA 1FX7A 1F9NA 5E1WA 1N25A 4M73A 2EFNA 2HQ5A 2GM4A 4BQAA 4BBSJ 2KIFA 1WJAA 4LG3A 2EWNA 5L3FA 4U0WA 3CZ6A 4II2A 2VONA 4HX8A 1BOBA 3A1YA 5CVJA 3GX4X 2XDVA 2IS1A 4CCMA 1DU0A 1NG6A 3EPZA 4CXFA 2M3AA 1T0FC 3ROUA 4LITA 1X3WB 4EJWA 5DYMA 5KHDA 4ENNA 5ERIA 1WPKA 2QA4I 1WJFA 2R7DA 1A6QA 1JUSA 5HDKA 2ME6A 3VYSB 2ID6A 2X6XA 3CC4I 1FOKA 1YTYA 4IO9F 2XAFA 3S2DJ 1J0RA 4MEXF 4XRSA 2XAUA 1QA6A 1I50J 2ISYA 4DZPA 1IXRC 1MNMC 4BJTA 4IHSA 1YYVA 1CF7B 5J4YA 3HOTA 2DBBA 3LSPA 5B1BH 1E0EA 3PIOF 2MSYA 4LG0A 3O3KA 3FKIJ 4MO7A 2HVSA 1OCZH 2ZSHB 4XNFA 2HOAA 1IGNA 3S3MA 1I1SA 4DZJA 4Y13A 5CVRA 4DJAA 5ICGA 5BMZA 1WJEA 2LYCA 1IV8A 2V79A 1X2MA 1S8NA 2L9VA 1YIJI 3VYRB 1ZELA 5FLVA 2DTZA 4CSWA 4FCYA 1HDPA 2FMYA 5GAHJ 2ZMEB 1ETXA 3KZYA 1IF1A 3TKYA 5JVGF 2W7NA 3QPLA 2IW5A 1RESA 3S2HJ 1OCCH 2BW3A 2DCEA 2Q8KA 2ME0A 3WTVC 1R49A 1CQTA 4DBRA 2F4MB 3WGHA 3C1DA 2KHMA 2AXLA 3S14J 1FP2A 5F0HA 3K0LA 3ZPLA 4ESBA 2XGXA 5E8IA 1XSXA 4P1WA 1XCBA 3GLLA 4QSHA 3JR9A 2KL4A 2ZKZA 4JP0A 1GHCA 3HBLA 1TT5B 2JTVA 3TMOA 5D4SA 3BTCA 2V6CA 4F52A 4BDZA 4LGWA 3KLNA 2PX9A 1HOMA 2X85A 4A93J 5FB2A 1WWXA 1V5GA 4JOMA 4XKBA 5GAEJ 3I58A 1SC7A 3OR1C 1EH6A 1ZGWA 2EV0A 1ERDA 2YUSA 3FZVA 1X3ZB 2XHKA 3IWZA 4BDYA 1ZRCA 1YJWI 3RKXA 3CTAA 3I71A 2J5PA 2LTPA 2ZJ2A 3BPVA 5F1RA 1QPIA 1MBFA 2FEZA 4Y7NJ 3DWLE 1LVAA 4IHWA 3QPTA 2G9WA 3QOEA 2L02A 1R6RA 3V42A 5FO5A 3IP4B 4OWRB 2MD5A 4CHUA 3FKJA 1QVUA 2ICWG 4RGRA 3F8BA 3DTKA 5K7HA 2PJRB 1IDYA 3CC2I 5C44J 1FPQA 1ZG3A 4WCGA 2EA4A 3BOQA 3WGIA 2QKMB 1TNTA 1PUFB 4C30A 3TW6A 3RZOJ 4DW6A 1O4XA 2B0LA 2AXTC 3SEQA 3E3VA 1JUMA 1MD0A 3I3LA 2O61A 2XGDA 5ICEA 3HL2A 2VQGA 5CQEA 3WTTC 1FOXA 2WADA 4AU7A 2LF7A 1RC9A 2M34A 2PBIA 3BWGA 4AWXB 2JA2A 1MSFC 2F5VA 3H5RA 5KCMA 4C3IJ 4EM0B 2BE5F 2R7WA 1Z21A 1RPWA 3EYIA 5HNFA 4B47A 4A3FJ 1LFUP 2UV1A 4I0BA 3I9V2 3F22A 3FM3A 2KJBA 4KDPA 2VKHA 3KLOA 3A01A 3BR5A 2HU9A 3CJTB 4ENMA 3MMYB 4XRFA 1B9MA 1LPQA 2DJNA 5J8CA 4FE4A 4HLXA 4ZZLA 2KISA 3H5AA 5DDGA 2JPCA 1TTYA 2ECBA 1MH4A 5CLSA 1YITI 1X3UA 1Y6IA 5C4XJ 4PUSA 5TJJA 2DO7A 3AG3H 5E1XA 1X1DA 2KMUA 3M07A 3EDPA 4UUVA 3OYDA 2FX0A 5E18F 2K7LA 4U87A 1RUOA 1ZN2A 1WJDA 4WF2A 3JAMK 3DV8A 4ANJA 2DPUA 3J7AO 3ZOBA 5FRMA 4RS8A 2CO5A 3T8TA 4CCOA 2V1DA 2Y0MA 1DQUA 3HJEA 5FLXK 2EFPA 5DEQA 4RB0A 3KFWX 3TP0A 2HPMA 3T1BA 1YW9A 4L5EA 5IOYA 3C18A 5JVTA 2DT7B 1R1UA 3M8FA 1ZR4A 2FF4A 1PVEA 2LKXA 3FDYA 2DDBA 1YJNI 4A0XA 3S1MJ 2OCEA 5KAFC 3HTUA 1YE9A 5F27A 2XSDC 2X1DA 2R7ZJ 4XMYA 4XQFA 2VASA 1A5JA 4JK1X 4A3CJ 5C3EJ 5JR3A 1YX5A 5CVVA 2N8GA 1FYMA 4IEJA 3L7WA 2Q2EB 1W5CC 3DXJF 4BE0A 5EYRA 5IP6A 2IP2A 4CO8A 2WAQN 2MH9A 2E1MC 2VT3A 4CYCA 3HSEA 4M72A 1GXQA 2DLLA 4M71A 3AAFA 1ETVA 1SD4A 3ECOA 4BEHA 4HV6A 2STWA 2DA6A 4P96A 1SD7A 1Z91A 3BPXA 2L7ZA 4HZFA 4L9NA 5EEHA 1Z6RA 2M87A 2V9PA 1HLVA 1JJ8C 3CJQB 2LNBA 4DQ2A 1Y8QB 4RB1A 1U78A 2BVLA 3JTGA 4PDKA 2CQKA 2E2JJ 4P5OA 3KCCA 3SEZA 2HXOA 3VSLA 1ZLJA 4CGZA 1HKQA 3R61A 2D5VA 1XC5A 2MFZA 3RQ4A 1PUEE 3E6DA 2Q0OA 3RDIA 4LLLA 3QU6A 1T39A 1KU7A 3CUOA 2CV2A 2ZNYA 4KMFA 2CRGA 2NS8A 3TBIA 2EIJH 3SXYA 5DCMB 1R71A 5LHIA 3LSGA 3F8FA 2WWYA 4UB8C 3ZQLA 2K27A 1ETYA 4I76A 4UXNA 2P81A 1IO2A 3F8MA 4XLHA 3ASNH 5GAGJ 4LIUA 3K7AJ 4HF1A 5HS8A 2P8TA 3DBLB 2ZJPF 3VSKA 4G9YA 2RKHA 1G3YA 1HSJA 3S3OA 4FISA 3ZN0A 4G6QA 2ACJA 4Y33A 4BHPA 1JUPA 2XAQA 1WGXA 2Z5UA 3BZ6A 3GZ5A 1X58A 4XLCA 5EGOB 1U5TB 3PNYA 3GTJJ 3T5XA 1Z7LA 3ECHA 1KA8A 3HGGA 1GVDA 3F8NA 4A3LJ 3FXKA 2HZTA 3CCMI 1ZHFA 1OJLA 3K2ZA 3I5UA 1P2FA 3SZGA 1JGSA 3WG9A 3CCVI 1SVOA 3VDXA 4S05A 1X1BA 3RJPA 1JJ6C 5H2FC 1B8IB 1ORKA 1R5GA 4OIQF 2IT0A 3CDIA 2JA6J 1YFHA 3JRBA 4BBRJ 4BAYA 3LAPA 4LIVA 5DCFA 4B3XA 1FJLA 2OU2A 5GTHC 5FKLA 3BCAA 3ABKH 3D1NI 4M3GA 1K4SA 2WAFA 5E8GA 1TQPA 3MAJA 4HNUA 1P9QC 4XKCA 1UMQA 1P6RA 2KRHA 5LGUA 1HDDC 2VOOA 3LQRA 1FIPA 4N9HA 3SJMA 1LDJA 2KFDA 3C2GA 2BY2A 3HHHA 3F6OA 3PFIA 4MGRA 2DOFA 4KIGA 1XGSA 2XRLA 4EV0A 1SVLA 4WK8F 4H0EA 1H89C 4G6TB 1E3HA 3IL2A 5J40A 1OR7A 1YI2I 3PM1A 4LOCA 3WE3A 2VE8A 3GW2A 1RKTA 4E7SA 3P9CA 5H6RA 2B9SA 2DAOA 2ZXJA 2RREA 2F4OB 3RPUD 1K4TA 4ABZA 1AKHA 4KFCA 3S2WA 5BOXA 2Z2SB 5ILSA 3Q0VA 3MKYB 5L3DA 2QQAA 3FXRA 3BG9A 2KP6A 2XGCA 2ZJRF 1T8IA 2YX4A 2BHZA 4EEFG 3B6CA 1STZA 1FIAA 2IBDA 4L0YB 1ZKGA 1MZBA 2O7OA 1H88C 1QZZA 1VQ8I 2VXDA 1R4MB 1ZR2A 1JKOC 3WTXC 1K61A 1NK2P 1X4PA 2RC4A 4GCVA 3WODF 2ZFUA 2VC0A 3E5QA 3KP5A 1K6OA 2CJJA 4XORA 1Z9CA 3CCUI 3TP3A 1S3JA 1WJBA 2E71A 5B1AH 3A02A 3HRSA 1UG2A 2A61A 2B63J 2VPLA 3Q9VA 1YS6A 3ZMZA 4XR6A 2L54A 1XMKA 3DEWA 1QPMA 3DPLC 2FBIA 4ITVA 3CUQB 3NARA 1S9HA 5FGMA 4IRGA 3HTSB 1XS9A 4Y52J 1S7OA 4HBLA 5FFZA 1FZPB 1ACIA 1QVTA 4XLEA 1MBEA 3OS2A 2KJCA 2YS9A 4XLAA 4RDUA 1RUNA 2F5CA 2KLOA 5F64A 3S8PA 2GXAA 2VBXA 2VQLA 1MMAA 4HPQA 3HEFA 2O8KA 3KP7A 2DT6A 3WTWC 2QSHX 4BE2A 2W00A 3P9KA 1QQIA 3DPTA 3OYBA 1JHHA 2CV0A 4G12A 3M7GA 3MWMA 4LK0F 3Q0WA 1P4XA 4PFOA 3FHZA 2H27A 2PN6A 1BI2A 5IYBJ 2OZUA 2KDOA 1QBJA 3WU1B 4E7ZA 1HW1A 2F2EA 1W5TA 1YHQI 1TZLA 2LF8A 1XDUA 1WHUA 2G7HA 3CLOA 1FMWA 2JA7J 1FC3A 1V4RA 1R00A 1UB9A 4A2UA 2R7XA 3G71I 2DJIA 1CF7A 5J3LA 3FXMA 1TWFJ 2YU9J 1B72B 2JMWA 1MBKA 3GTOJ 4BY1J 1SAXA 4RGXA 1VQ9I 2EFQA 3ASOH 1MKMA 2DODA 1REPC 5L3GA 1GT0C 3FXJA 4NC8A 1NG7A 1MNEA 1XD7A 4BXFA 1X2NA 1IG7A 2K9MA 2AQFA 2EQRA 1VQMI 2O3FA 4PSWA 2I10A 3SHFA 4KT5C 2A05A 5FLMJ 5EEAA 2I8DA 3MEXA 2R4GA 1QHHD 4RM3A 3PIPF 2HVRA 2MLGA 3K4BA 3HPHA 1MDMA 2A5WA 1ETWA 2X6YA 4M6VA 3U1DA 4GFBA 2DA2A 5DM7F 3AG1H 1F36A 3IV5A 3H92A 1UFMA 3ZN1A 2EZHA 5M3FJ 4XRMA 1XGMA 1MH3A 3LA3A 5AIQA 2HPIA 1OLTA 1B4AA 4P55A 3MVPA 2PMZN 3OYGA 2R0QC 3CF2A 2UZKA 2E34A 1ENHA 2P7CB 2Z9OA 1U2WA 2W1OA 4CA0A 3S3NA 2BXYA 3MD2A 4BHBA 3OIOA 4CICA 2EFOA 4AD9A 3WTUC 3LFUA 2Y0SN 3K1MA 1B59A 3IAM2 2HQRA 1VQNI 4A0YA 2COMA 1O3TA 1G3WA 5EDNA 2UWMA 2L9RA 4M9SA 4FX4A 4C3JJ 5FLXZ 3DLAA 4U7DA 5JHFA 4XONA 3RZDJ 3ESWB 3G1OA 2LKSA 1BJZA
chains in the Genus database with same CATH topology
2DK8A 2MBFA 1SD5A 3MQ0A 1FLIA 2OQGA 4KNYA 5DV5A 3W6KB 1L0OC 3MFKA 3IRRA 4O3MA 2GZWA 4BXUA 4LMYA 2F5FA 1J2XA 1IW7F 1ZRFA 1IN7A 2TDXA 1F1ZA 3E6BA 3SZTA 3F21A 5LHGA 3Q9SA 2K4JA 1XSVA 3ZMTA 1ZYRF 4HF2A 2PQ8A 2JZYA 5HVQC 1H0MA 1KGSA 1FBQA 4N0BA 2KKOA 3I64A 4NHJA 2PMUA 1LJ9A 2D1VA 4M6YA 3VB2A 1H9TA 5CVUA 4L5JA 3ELKA 4WWCA 1KYWA 2ZBKA 3NEUA 2HKXA 4M74A 3I4PA 5D8LB 2FQ3A 2HWVA 3ULQB 3MZHA 4LK1F 4G6DA 4I98B 4BHCA 3Q5FA 2VE9A 2Q2EA 3OOPA 4I0AA 2CGPA 4ESFA 2ZFWA 4UNOA 5D4RA 3HRUA 5K5RA 1A04A 1TQMA 4Q47A 4OMZA 5H20A 3R0AA 3LQQA 5E17F 4HQMA 3RKWA 1YIOA 3EYYA 1O7LA 2XUBA 4L9TA 1KU9A 5L3CA 2ESHA 4MHGA 5D8KB 1K78A 2G7UA 4EJOA 2RGVA 1ONVA 3IKVA 2O0YA 4UHTA 3GFMA 5A2QZ 2M45A 4S04A 5HLGA 1ZLKA 2NS0A 2PEXA 1BJAA 1WQ2A 5DD8A 1IN6A 1BC8C 5FFXA 2Z3YA 4WXCA 3GO5A 1U3EM 1EV7A 1USTA 2NYXA 4BYYA 1IRFA 5LRSA 1TW3A 2Z33A 4IRHA 4MEYF 2ESNA 1JHFA 1DPRA 2RQPA 4A0ZA 3CO7C 2CSOA 3R4KA 3K1PA 4ASNA 1J59A 4P9UA 3GVAA 1S7AA 3V7SA 4MNUA 4G7OF 3V8KA 1U8RA 2XVCA 3BP8A 2EK5A 3HSFA 2BEOA 3LAJA 3OV8A 3FXUA 1KU3A 2WC2A 3DF8A 2ADUA 3ISPA 4HDUA 2FBHA 1FBSA 1I1GA 4IJAA 3RPQA 2AS5F 2NAZA 1J7KA 3FWEA 3BJAA 4AIKA 3IHUA 2GXBA 1BOAA 1W7PB 1DP7P 6PAXA 1HQCA 1FYLA 1BN5A 2OD5A 1PP8F 2K86A 4LJZF 1QZYA 2A69F 2E7WA 3TO9A 3F8CA 2NRAC 2M5WA 4FHTA 3EETA 3VOEA 2GA2A 2E1NA 2QBYB 4L9JA 2OAZA 4GO1A 4ZYDA 1V3FA 2HTJA 5HOOA 2F5EA 4MTDA 2XROA 2GAUA 5CVIA 2O03A 3HUGA 4G7ZF 1YO5C 5LEJA 5D5WB 4XSXF 3CUQA 3V7RA 3DFGA 2XV4S 1XCVA 3HYIA 3ERED 2D1HA 4ENKA 1S29A 1O3RA 2A68F 1SMTA 3W6JB 4F7ZA 1J5YA 2J5OA 1Z7UA 2VC1A 3QRFF 2UXNA 1F5TA 4P9FA 4KN4X 2CG4A 4RGSA 2FRHA 3J81K 1UHWA 1KQ0A 1IZ1A 3ML6A 3VEPA 1ON2A 4M9ZA 2IVMA 2LDUA 2YPRA 3C7JA 1CGPA 5J8FA 1WSUA 4HX7A 2ISZA 2EB7A 5LGTA 3ZMVA 2OZ6A 1FBUA 3E97A 1PP7U 2OA4A 3REOA 3J80Z 2XAGA 1P92A 5BS6A 3TDUC 5LRRA 2CFXA 2D45A 2FE3A 1G4DA 4WXDA 3KP6A 3I0TA 3RTRA 3RIRA 4U0YA 4NB5A 2HOEA 2VN2A 5K5QA 3GWZA 2P7VB 3RPUA 2P5VA 1RZ4A 3RYPA 1FT9A 2P6SA 1GXPA 3LSTA 4KA4A 5JHUA 1LDDA 1R23A 1S6LA 2QYOA 4NQWA 5A2QK 2F5DA 3QP5A 5HDNA 2FMLA 4QWQA 3HOSA 2P5LC 4AVPA 4ENJA 5HDGA 2RNJA 2O8XA 4EJUA 3H3ZA 4OINF 4BH9A 2VXZA 3B02A 2RV8A 4XLPF 3FF5A 5KK1A 1OPCA 3ZMDA 1R7JA 2KRFA 3HRTA 3PQKA 2IPQX 1IUYA 2HQNA 4MTEA 1IN5A 3JSOA 5AIPA 3CUQC 1R1TA 3WE2A 2EJRA 1IXSB 1T2KA 1GVJA 3COAC 3IRQA 3I54A 4A5MA 2P4WA 3FMQA 3TO6A 2IJLA 2LSOA 4UVAA 3L2CA 1B1BA 3LWFA 1K79A 2M1BA 2PFBA 2V1UA 2DK5A 2CWEA 2QWWA 2P5KA 3QOPA 1P4AA 2DI3A 5EEGA 3G73A 2QZ8A 4A6DA 4M6XA 2YX7A 4B8XA 2CW0F 5BQTA 1QNTA 5DUIA 4KICA 3CJNA 2XKPA 1Q1HA 2HYFA 4YIIA 2CYYA 2BBYA 2ETHA 2Z99A 1FSHA 2W85A 4RGUA 3GFIA 4B09A 3GUDA 5K1YA 1BI0A 3M9AA 3CDHA 4U7BA 3VFZA 3NQOA 2ZMEA 2OQRA 1B9NA 3GF2A 1F4KA 1MGTA 4EMSA 2VBZA 4HV5A 1L3LA 4LD5A 3V4GA 5FD5A 2GXGA 4UVCA 1Z6TA 1VTNC 3R6SA 3WTYC 2EA2A 2DW4A 5DD4A 5H6QA 4RAYA 5DUKA 2A5YB 3U2RA 2L01A 1SMYF 3EQLF 3RKYA 4Q5SF 3TGNA 2KIUA 3N97A 2ZO4A 1O57A 1D8KA 4KUMA 3V7CA 1ULYA 2HS5A 5LEKA 1TBXA 3QPHA 5ICFA 5D5XB 3GXOA 2C6YA 3SQNA 3V8LA 2XAJA 2UXXA 3MCZA 4YG2F 3VODA 2L4MA 1I27A 1Z05A 3MZYA 3L09A 3SZPA 2YR2A 1FYKA 4HOBA 3TOBA 2QUFA 4HAMA 4HQEA 4GYIA 2BYVE 3EUHA 2FBKA 4GXOA 1Y0UA 5IT9K 1SFEA 2HYGD 3J80K 2XASA 3B73A 3GLXA 1H9GA 1BM9A 2HDCA 2JSCA 2XIGA 1XDSA 4L18B 5L3BA 1EH8A 1LNWA 3GEZA 4BNCA 1RNLA 4CDGA 2E1CA 4R79A 4LFUA 4I01A 5CYVA 3RYRA 1K7AA 4Y17A 1W4MA 2STTA 3BDDA 3KETA 2A07F 1OYIA 5D5UB 3J81Z 4UV8A 3KE2A 1DPUA 4M9XA 2NNNA 3QP6A 3O6BB 3U9GA 3LA7A 4KIFA 4HLYA 2VOPA 1YW8A 2QBYA 4O5VA 5L3EA 3TO7A 5LBQA 1T6SA 1D8JA 1W7PD 1YG2A 3DKWA 1O3SA 3F3XA 5E20A 2R3SA 1E17A 4A12A 3KEOA 2K02A 4N9IA 1HXDA 3I59B 1XN7A 1T38A 3KP4A 2NNYA 4DNCA 5FD6A 3JTHA 3FM5A 3HHGA 1LEAA 2GIVA 4JBAA 1MDMB 3F23A 2EV5A 1ZARA 4EM2A 2QQ9A 1IXCA 2JPBA 2FU4A 2PMHA 2K4BA 5IT3A 5KVRA 1SD6A 4OIRF 1LQ1A 2QVOA 4RAZA 1O7FA 5DCMA 1TNSA 2L4AA 1G3SA 2JRTA 1BIBA 1OMIA 2DTRA 5ILUA 2RVCA 3BROA 5D5VB 3DEUA 4OIPF 4LLNA 1U5TA 4EJTA 5LHHA 3NRVA 5HLIA 1AOYA 1ON1A 2GQQA 1DDNA 3CO6C 2VT2A 2A3SA 4ZYEA 3PQJA 4EGZA 3D0SA 3GFJA 3C3WA 2M30A 4L9VA 3O2PE 3KP3A 2IA1A 3KZZA 2RDPA 4LB6B 4TV7A 3E6MA 2YU3A 4I7HA 1XMAA 3E5UA 2V9VA 1ZG1A 5K5OA 4UVBA 3QAHA 4E70A 5JI6A 1QGPA 2R7FA 2H94A 1C0WA 4ON0A 1IRGA 3WTSC 4I2OA 4LB5A 4U88A 2H09A 3LA2A 2FNAA 3QU3A 1HKTA 1HKSA 3K69A 5ED4A 3V8JA 2WTEA 3IKTA 2PJPA 2X0LA 4RB2C 5ILVA 1LEBA 4HYEA 1YQAA 1J75A 1ZG5A 1HW2A 1RI7A 2DU9A 1G6NA 2E7XA 4UV9A 1I6XA 3H3UA 4IRIA 4XSZF 2FXAA 5LGNA 3ZMSA 1EH7A 1KQ8A 4LG0B 4IXAA 4ETSA 1R58A 1R22A 2ZCWA 4HW0A 1Z1DA 1FWZA 1FY7A 2D2WA 2H6BA 2RN7A 3ZP5A 1FP1D 2L3DA 3HSRA 2FSWA 4JQFA 3K9TA 4WX9A 1OKRA 3R0JA 5LLQA 2HFHA 3LFKA 5BPIA 3WTZA 3BY6A 1IN8A 3TOAA 2Y48A 2H6CA 4ZH4F 4OOIA 1K78B 3BJ6A 4WXHA 2IA2A 4MQ9F 5AONA 1QO0D 4PZJA 5D6FA 4OIOF 3JW4A 1U6GA 3KP2A 1TLHB 1ZREA 4CYDA 4HX4A 1BI3A 3RI4A 5IT9Z 1D5VA 1G3TA 1U5TC 3JSPA 4IPAA 1MJBA 3FMSA 4EGYA 4Q4ZF 1KU2A 4YFXF 1TQIA 3FX3A 3IC7A 4A6EA 4LLGF 4FT8A 1B6AA 1BI1A 2KIMA 4G7HF 3F6VA 2LKPA 2ZNZA 1XSDA 1KYZA 4GYGA 2P6TA 4YIFA 1LB2A 4EJVA 2GWRA 3I53A 2HTSA 1E2XA 2A6EF 1ODDA 1IN4A 1J9IA 3F72A 5CJ9A 1TW2A 1HBXG 1HW5A 2X4HA 1ZAOA 3WGGA 3IWFA 3GZ6A 4EM1A 2OBPA 1KQ9A 1IAWA 1PDNC 1R36A 1R1VA 1XGOA 3T8RA 4CZZA 1DUXC 1SFUA 1FSEA 4EQQA 4I09A 1P4WA 4AIHA 2BGCA 2PI0A 4ZYHA 2QLZA 3GFLA 4RB3C 3P7NA 3L00A 4A5NA 2EV6A 2BV6A 2M8EA 4Z2YA 4G94A 2FNPA 2VBWA 4PGHA 4GGGA 4HDVA 1ZGJA 1YS7A 5F6FA 4IF4A 4YFNF 3FMRA 2MA3A 3P9IA 1RIOH 3ABTA 5ICCA 2HGCA 4ESJA 1W5SA 2XAHA 4Q48A 4KYWA 3FXQA 5TRDA 2W84A 4KN7X 2DT5A 1XGNA 4ZZDA 1ZRDA 3M8EA 4MQVA 1MJAA 5HLHA 1WKMA 4QLCU 4OMYA 2A6HF 4OU0A 1T0FA 2HEOA 2VBYA 4PCQA 4IHTA 4HA8A 2Y75A 1MJ9A 2FA5A 2VODA 3BJOA 2ELHA 1JE8A 2XKOA 3D5LA 3KEQA 1I5ZA 1BIAA 3I59A 4D0PA 3E5XA 2HKOA 4R1HA 2DPDA 3SFZA 3WU0A 2QQBA 2QENA 4L0ZB 4G8XA 4Y15A 4HF0A 1R5HA 4YFKF 1OYWA 3DQVC 3ZMUA 3M1EA 3TQNA 1O3QA 1FNNA 1JXSA 4EVIA 1NHAA 2HR3A 3T0YA 1AWCA 1BC7C 4R8HA 5HS9A 1HSTA 2W25A 3G3ZA 2DQRA 4IVNA 5D6EA 1YW7A 3HRMA 2V1XA 2PLYA 3N4MA 2IA0A 2DFIA 1T98A 2JT1A 4AIJA 2IRFG 3JAMZ 5BPDA 4O6JA 1BBYA 4XBFA 2QM3A 2W24A 1ZGAA 2FOKA 2O6GE 2XRNA 1YLFA 1XB4A 5JFRA 1UHMA 1OYYA 2YSRA 3TDZC 2EFWA 2MH2A 3DP7A 1D3YA 3K1NA 1USSA 2WV0A 5J6XA 4ZYGA 2DQLA 1UCRA 4KMUX 1SFXA 3L9FA 4U0VA 2MLKA 4I02A 1WRJA 2W57A 4FX0A 4L5IA 1WI9A 2MC3A 4K2EA 3R60A 4KIBA 3ABUA 1LDKB 2GA1A 5HS7A 1ZH5A 4PGGA 3ZQ7A 3GYHX 2PG4A 3HIFA 4XLNF 5E1ZB 3E6CC 1W7PA 1FX7A 1F9NA 5E1WA 4BQAA 4M73A 2EFNA 2KIFA 2EWNA 5L3FA 4U0WA 2VONA 4HX8A 5CVJA 3GX4X 4CXFA 3ROUA 4EJWA 5DYMA 4ENNA 5ERIA 2R7DA 5HDKA 1FOKA 1YTYA 2XAFA 1J0RA 4MEXF 2ISYA 1IXRC 4IHSA 1YYVA 1CF7B 3HOTA 2DBBA 4LG0A 3O3KA 1I1SA 4Y13A 5CVRA 5ICGA 5BMZA 2V79A 1S8NA 2FMYA 2ZMEB 3KZYA 1IF1A 3TKYA 2IW5A 2Q8KA 3WTVC 3WGHA 3C1DA 2AXLA 1FP2A 3ZPLA 3K0LA 4ESBA 2XGXA 5E8IA 1XSXA 1XCBA 2ZKZA 1GHCA 2JTVA 5D4SA 2V6CA 4LGWA 3KLNA 5FB2A 1WWXA 3I58A 1EH6A 2EV0A 3FZVA 3IWZA 2XHKA 1ZRCA 3RKXA 3CTAA 3I71A 2J5PA 2ZJ2A 3BPVA 5F1RA 2FEZA 1LVAA 3QPTA 2G9WA 2L02A 5FO5A 2MD5A 4CHUA 4RGRA 3F8BA 1FPQA 1ZG3A 4WCGA 2EA4A 3BOQA 3WGIA 1TNTA 2B0LA 3E3VA 2O61A 1MD0A 5ICEA 3WTTC 2LF7A 3BWGA 2PBIA 4AWXB 4EM0B 2BE5F 3EYIA 4I0BA 3F22A 3FM3A 2KJBA 4KDPA 3KLOA 4ENMA 4XRFA 1B9MA 5J8CA 4HLXA 4ZZLA 5DDGA 2JPCA 1TTYA 5CLSA 1X3UA 5TJJA 2DO7A 5E1XA 3EDPA 4UUVA 5E18F 2K7LA 1RUOA 1ZN2A 4WF2A 3JAMK 3DV8A 2DPUA 3J7AO 4RS8A 2CO5A 3T8TA 2V1DA 2Y0MA 5FLXK 2EFPA 5DEQA 4RB0A 3KFWX 3T1BA 1YW9A 3C18A 5JVTA 1R1UA 3M8FA 2FF4A 4A0XA 3HTUA 4JK1X 5JR3A 5CVVA 1FYMA 3L7WA 3DXJF 2IP2A 4CO8A 2MH9A 2VT3A 3HSEA 4M72A 1GXQA 2DLLA 4M71A 3AAFA 1SD4A 3ECOA 4HV6A 2STWA 4P96A 1SD7A 1Z91A 3BPXA 4HZFA 4L9NA 5EEHA 1Z6RA 2M87A 2LNBA 4DQ2A 4RB1A 1U78A 3JTGA 4PDKA 2CQKA 4P5OA 3KCCA 1ZLJA 4CGZA 1HKQA 3R61A 1PUEE 3E6DA 2Q0OA 3RDIA 4LLLA 3QU6A 1T39A 1KU7A 3CUOA 2ZNYA 4KMFA 3SXYA 5DCMB 5LHIA 3F8FA 2WWYA 2K27A 4UXNA 3F8MA 4HF1A 5HS8A 2P8TA 4G9YA 2RKHA 1G3YA 1HSJA 3ZN0A 4G6QA 2ACJA 4BHPA 2XAQA 2Z5UA 3BZ6A 3GZ5A 1U5TB 3T5XA 3ECHA 1KA8A 3F8NA 2HZTA 1ZHFA 3K2ZA 3I5UA 1P2FA 1JGSA 3WG9A 4S05A 3RJPA 1R5GA 4OIQF 2IT0A 1YFHA 4BAYA 3LAPA 5DCFA 2OU2A 5E8GA 1TQPA 3MAJA 1P6RA 2VOOA 5LGUA 3LQRA 4N9HA 1LDJA 3HHHA 3F6OA 3PFIA 4MGRA 4KIGA 1XGSA 4EV0A 4WK8F 4H0EA 3IL2A 1OR7A 3WE3A 2VE8A 3GW2A 3P9CA 5H6RA 2DAOA 2ZXJA 4KFCA 3S2WA 5BOXA 5ILSA 5L3DA 2QQAA 3FXRA 2YX4A 1STZA 4L0YB 1MZBA 1QZZA 3WTXC 2RC4A 4GCVA 3WODF 2VC0A 3E5QA 3KP5A 1K6OA 1Z9CA 1S3JA 3HRSA 2A61A 3Q9VA 1YS6A 3ZMZA 2L54A 1XMKA 1QPMA 3DPLC 2FBIA 3CUQB 5FGMA 4IRGA 3HTSB 1S7OA 4HBLA 5FFZA 1FZPB 2KJCA 1RUNA 2F5CA 5F64A 2VBXA 3KP7A 3WTWC 3P9KA 1QQIA 3DPTA 1JHHA 3M7GA 3MWMA 4LK0F 1P4XA 3FHZA 2H27A 2PN6A 1BI2A 2OZUA 1QBJA 3WU1B 1HW1A 2F2EA 1W5TA 2LF8A 1XDUA 2G7HA 3CLOA 1FC3A 1V4RA 1R00A 1UB9A 4A2UA 1CF7A 1SAXA 4RGXA 2EFQA 1MKMA 1REPC 5L3GA 1XD7A 2O3FA 3SHFA 4KT5C 3MEXA 2MLGA 1MDMA 3U1DA 3H92A 1UFMA 3ZN1A 1XGMA 3LA3A 5AIQA 1B4AA 4P55A 2UZKA 2P7CB 2Z9OA 1U2WA 4BHBA 4CICA 2EFOA 4AD9A 3WTUC 3K1MA 1B59A 2HQRA 4A0YA 2COMA 1O3TA 1G3WA 2UWMA 4M9SA 4FX4A 5FLXZ 4U7DA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2DK8 A;  2MBF A;  1SD5 A;  3MQ0 A;  1FLI A;  2OQG A;  4KNY A;  5DV5 A;  3W6K B;  1L0O C;  3MFK A;  3IRR A;  4O3M A;  2GZW A;  4BXU A;  4LMY A;  2F5F A;  1J2X A;  1IW7 F;  1ZRF A;  1IN7 A;  2TDX A;  1F1Z A;  3E6B A;  3SZT A;  3F21 A;  5LHG A;  3Q9S A;  2K4J A;  1XSV A;  3ZMT A;  1ZYR F;  4HF2 A;  2PQ8 A;  2JZY A;  5HVQ C;  1H0M A;  1KGS A;  1FBQ A;  4N0B A;  2KKO A;  3I64 A;  4NHJ A;  2PMU A;  1LJ9 A;  2D1V A;  4M6Y A;  3VB2 A;  1H9T A;  5CVU A;  4L5J A;  3ELK A;  4WWC A;  1KYW A;  2ZBK A;  3NEU A;  2HKX A;  4M74 A;  3I4P A;  5D8L B;  2FQ3 A;  2HWV A;  3ULQ B;  3MZH A;  4LK1 F;  4G6D A;  4I98 B;  4BHC A;  3Q5F A;  2VE9 A;  2Q2E A;  3OOP A;  4I0A A;  2CGP A;  4ESF A;  2ZFW A;  4UNO A;  5D4R A;  3HRU A;  5K5R A;  1A04 A;  1TQM A;  4Q47 A;  4OMZ A;  5H20 A;  3R0A A;  3LQQ A;  5E17 F;  4HQM A;  3RKW A;  1YIO A;  3EYY A;  1O7L A;  2XUB A;  4L9T A;  1KU9 A;  5L3C A;  2ESH A;  4MHG A;  5D8K B;  1K78 A;  2G7U A;  4EJO A;  2RGV A;  1ONV A;  3IKV A;  2O0Y A;  4UHT A;  3GFM A;  5A2Q Z;  2M45 A;  4S04 A;  5HLG A;  1ZLK A;  2NS0 A;  2PEX A;  1BJA A;  1WQ2 A;  5DD8 A;  1IN6 A;  1BC8 C;  5FFX A;  2Z3Y A;  4WXC A;  3GO5 A;  1U3E M;  1EV7 A;  1UST A;  2NYX A;  4BYY A;  1IRF A;  5LRS A;  1TW3 A;  2Z33 A;  4IRH A;  4MEY F;  2ESN A;  1JHF A;  1DPR A;  2RQP A;  4A0Z A;  3CO7 C;  2CSO A;  3R4K A;  3K1P A;  4ASN A;  1J59 A;  4P9U A;  3GVA A;  1S7A A;  3V7S A;  4MNU A;  4G7O F;  3V8K A;  1U8R A;  2XVC A;  3BP8 A;  2EK5 A;  3HSF A;  2BEO A;  3LAJ A;  3OV8 A;  3FXU A;  1KU3 A;  2WC2 A;  3DF8 A;  2ADU A;  3ISP A;  4HDU A;  2FBH A;  1FBS A;  1I1G A;  4IJA A;  3RPQ A;  2AS5 F;  2NAZ A;  1J7K A;  3FWE A;  3BJA A;  4AIK A;  3IHU A;  2GXB A;  1BOA A;  1W7P B;  1DP7 P;  6PAX A;  1HQC A;  1FYL A;  1BN5 A;  2OD5 A;  1PP8 F;  2K86 A;  4LJZ F;  1QZY A;  2A69 F;  2E7W A;  3TO9 A;  3F8C A;  2NRA C;  2M5W A;  4FHT A;  3EET A;  3VOE A;  2GA2 A;  2E1N A;  2QBY B;  4L9J A;  2OAZ A;  4GO1 A;  4ZYD A;  1V3F A;  2HTJ A;  5HOO A;  2F5E A;  4MTD A;  2XRO A;  2GAU A;  5CVI A;  2O03 A;  3HUG A;  4G7Z F;  1YO5 C;  5LEJ A;  5D5W B;  4XSX F;  3CUQ A;  3V7R A;  3DFG A;  2XV4 S;  1XCV A;  3HYI A;  3ERE D;  2D1H A;  4ENK A;  1S29 A;  1O3R A;  2A68 F;  1SMT A;  3W6J B;  4F7Z A;  1J5Y A;  2J5O A;  1Z7U A;  2VC1 A;  3QRF F;  2UXN A;  1F5T A;  4P9F A;  4KN4 X;  2CG4 A;  4RGS A;  2FRH A;  3J81 K;  1UHW A;  1KQ0 A;  1IZ1 A;  3ML6 A;  3VEP A;  1ON2 A;  4M9Z A;  2IVM A;  2LDU A;  2YPR A;  3C7J A;  1CGP A;  5J8F A;  1WSU A;  4HX7 A;  2ISZ A;  2EB7 A;  5LGT A;  3ZMV A;  2OZ6 A;  1FBU A;  3E97 A;  1PP7 U;  2OA4 A;  3REO A;  3J80 Z;  2XAG A;  1P92 A;  5BS6 A;  3TDU C;  5LRR A;  2CFX A;  2D45 A;  2FE3 A;  1G4D A;  4WXD A;  3KP6 A;  3I0T A;  3RTR A;  3RIR A;  4U0Y A;  4NB5 A;  2HOE A;  2VN2 A;  5K5Q A;  3GWZ A;  2P7V B;  3RPU A;  2P5V A;  1RZ4 A;  3RYP A;  1FT9 A;  2P6S A;  1GXP A;  3LST A;  4KA4 A;  5JHU A;  1LDD A;  1R23 A;  1S6L A;  2QYO A;  4NQW A;  5A2Q K;  2F5D A;  3QP5 A;  5HDN A;  2FML A;  4QWQ A;  3HOS A;  2P5L C;  4AVP A;  4ENJ A;  5HDG A;  2RNJ A;  2O8X A;  4EJU A;  3H3Z A;  4OIN F;  4BH9 A;  2VXZ A;  3B02 A;  2RV8 A;  4XLP F;  3FF5 A;  5KK1 A;  1OPC A;  3ZMD A;  1R7J A;  2KRF A;  3HRT A;  3PQK A;  2IPQ X;  1IUY A;  2HQN A;  4MTE A;  1IN5 A;  3JSO A;  5AIP A;  3CUQ C;  1R1T A;  3WE2 A;  2EJR A;  1IXS B;  1T2K A;  1GVJ A;  3COA C;  3IRQ A;  3I54 A;  4A5M A;  2P4W A;  3FMQ A;  3TO6 A;  2IJL A;  2LSO A;  4UVA A;  3L2C A;  1B1B A;  3LWF A;  1K79 A;  2M1B A;  2PFB A;  2V1U A;  2DK5 A;  2CWE A;  2QWW A;  2P5K A;  3QOP A;  1P4A A;  2DI3 A;  5EEG A;  3G73 A;  2QZ8 A;  4A6D A;  4M6X A;  2YX7 A;  4B8X A;  2CW0 F;  5BQT A;  1QNT A;  5DUI A;  4KIC A;  3CJN A;  2XKP A;  1Q1H A;  2HYF A;  4YII A;  2CYY A;  2BBY A;  2ETH A;  2Z99 A;  1FSH A;  2W85 A;  4RGU A;  3GFI A;  4B09 A;  3GUD A;  5K1Y A;  1BI0 A;  3M9A A;  3CDH A;  4U7B A;  3VFZ A;  3NQO A;  2ZME A;  2OQR A;  1B9N A;  3GF2 A;  1F4K A;  1MGT A;  4EMS A;  2VBZ A;  4HV5 A;  1L3L A;  4LD5 A;  3V4G A;  5FD5 A;  2GXG A;  4UVC A;  1Z6T A;  1VTN C;  3R6S A;  3WTY C;  2EA2 A;  2DW4 A;  5DD4 A;  5H6Q A;  4RAY A;  5DUK A;  2A5Y B;  3U2R A;  2L01 A;  1SMY F;  3EQL F;  3RKY A;  4Q5S F;  3TGN A;  2KIU A;  3N97 A;  2ZO4 A;  1O57 A;  1D8K A;  4KUM A;  3V7C A;  1ULY A;  2HS5 A;  5LEK A;  1TBX A;  3QPH A;  5ICF A;  5D5X B;  3GXO A;  2C6Y A;  3SQN A;  3V8L A;  2XAJ A;  2UXX A;  3MCZ A;  4YG2 F;  3VOD A;  2L4M A;  1I27 A;  1Z05 A;  3MZY A;  3L09 A;  3SZP A;  2YR2 A;  1FYK A;  4HOB A;  3TOB A;  2QUF A;  4HAM A;  4HQE A;  4GYI A;  2BYV E;  3EUH A;  2FBK A;  4GXO A;  1Y0U A;  5IT9 K;  1SFE A;  2HYG D;  3J80 K;  2XAS A;  3B73 A;  3GLX A;  1H9G A;  1BM9 A;  2HDC A;  2JSC A;  2XIG A;  1XDS A;  4L18 B;  5L3B A;  1EH8 A;  1LNW A;  3GEZ A;  4BNC A;  1RNL A;  4CDG A;  2E1C A;  4R79 A;  4LFU A;  4I01 A;  5CYV A;  3RYR A;  1K7A A;  4Y17 A;  1W4M A;  2STT A;  3BDD A;  3KET A;  2A07 F;  1OYI A;  5D5U B;  3J81 Z;  4UV8 A;  3KE2 A;  1DPU A;  4M9X A;  2NNN A;  3QP6 A;  3O6B B;  3U9G A;  3LA7 A;  4KIF A;  4HLY A;  2VOP A;  1YW8 A;  2QBY A;  4O5V A;  5L3E A;  3TO7 A;  5LBQ A;  1T6S A;  1D8J A;  1W7P D;  1YG2 A;  3DKW A;  1O3S A;  3F3X A;  5E20 A;  2R3S A;  1E17 A;  4A12 A;  3KEO A;  2K02 A;  4N9I A;  1HXD A;  3I59 B;  1XN7 A;  1T38 A;  3KP4 A;  2NNY A;  4DNC A;  5FD6 A;  3JTH A;  3FM5 A;  3HHG A;  1LEA A;  2GIV A;  4JBA A;  1MDM B;  3F23 A;  2EV5 A;  1ZAR A;  4EM2 A;  2QQ9 A;  1IXC A;  2JPB A;  2FU4 A;  2PMH A;  2K4B A;  5IT3 A;  5KVR A;  1SD6 A;  4OIR F;  1LQ1 A;  2QVO A;  4RAZ A;  1O7F A;  5DCM A;  1TNS A;  2L4A A;  1G3S A;  2JRT A;  1BIB A;  1OMI A;  2DTR A;  5ILU A;  2RVC A;  3BRO A;  5D5V B;  3DEU A;  4OIP F;  4LLN A;  1U5T A;  4EJT A;  5LHH A;  3NRV A;  5HLI A;  1AOY A;  1ON1 A;  2GQQ A;  1DDN A;  3CO6 C;  2VT2 A;  2A3S A;  4ZYE A;  3PQJ A;  4EGZ A;  3D0S A;  3GFJ A;  3C3W A;  2M30 A;  4L9V A;  3O2P E;  3KP3 A;  2IA1 A;  3KZZ A;  2RDP A;  4LB6 B;  4TV7 A;  3E6M A;  2YU3 A;  4I7H A;  1XMA A;  3E5U A;  2V9V A;  1ZG1 A;  5K5O A;  4UVB A;  3QAH A;  4E70 A;  5JI6 A;  1QGP A;  2R7F A;  2H94 A;  1C0W A;  4ON0 A;  1IRG A;  3WTS C;  4I2O A;  4LB5 A;  4U88 A;  2H09 A;  3LA2 A;  2FNA A;  3QU3 A;  1HKT A;  1HKS A;  3K69 A;  5ED4 A;  3V8J A;  2WTE A;  3IKT A;  2PJP A;  2X0L A;  4RB2 C;  5ILV A;  1LEB A;  4HYE A;  1YQA A;  1J75 A;  1ZG5 A;  1HW2 A;  1RI7 A;  2DU9 A;  1G6N A;  2E7X A;  4UV9 A;  1I6X A;  3H3U A;  4IRI A;  4XSZ F;  2FXA A;  5LGN A;  3ZMS A;  1EH7 A;  1KQ8 A;  4LG0 B;  4IXA A;  4ETS A;  1R58 A;  1R22 A;  2ZCW A;  4HW0 A;  1Z1D A;  1FWZ A;  1FY7 A;  2D2W A;  2H6B A;  2RN7 A;  3ZP5 A;  1FP1 D;  2L3D A;  3HSR A;  2FSW A;  4JQF A;  3K9T A;  4WX9 A;  1OKR A;  3R0J A;  5LLQ A;  2HFH A;  3LFK A;  5BPI A;  3WTZ A;  3BY6 A;  1IN8 A;  3TOA A;  2Y48 A;  2H6C A;  4ZH4 F;  4OOI A;  1K78 B;  3BJ6 A;  4WXH A;  2IA2 A;  4MQ9 F;  5AON A;  1QO0 D;  4PZJ A;  5D6F A;  4OIO F;  3JW4 A;  1U6G A;  3KP2 A;  1TLH B;  1ZRE A;  4CYD A;  4HX4 A;  1BI3 A;  3RI4 A;  5IT9 Z;  1D5V A;  1G3T A;  1U5T C;  3JSP A;  4IPA A;  1MJB A;  3FMS A;  4EGY A;  4Q4Z F;  1KU2 A;  4YFX F;  1TQI A;  3FX3 A;  3IC7 A;  4A6E A;  4LLG F;  4FT8 A;  1B6A A;  1BI1 A;  2KIM A;  4G7H F;  3F6V A;  2LKP A;  2ZNZ A;  1XSD A;  1KYZ A;  4GYG A;  2P6T A;  4YIF A;  1LB2 A;  4EJV A;  2GWR A;  3I53 A;  2HTS A;  1E2X A;  2A6E F;  1ODD A;  1IN4 A;  1J9I A;  3F72 A;  5CJ9 A;  1TW2 A;  1HBX G;  1HW5 A;  2X4H A;  1ZAO A;  3WGG A;  3IWF A;  3GZ6 A;  4EM1 A;  2OBP A;  1KQ9 A;  1IAW A;  1PDN C;  1R36 A;  1R1V A;  1XGO A;  3T8R A;  4CZZ A;  1DUX C;  1SFU A;  1FSE A;  4EQQ A;  4I09 A;  1P4W A;  4AIH A;  2BGC A;  2PI0 A;  4ZYH A;  2QLZ A;  3GFL A;  4RB3 C;  3P7N A;  3L00 A;  4A5N A;  2EV6 A;  2BV6 A;  2M8E A;  4Z2Y A;  4G94 A;  2FNP A;  2VBW A;  4PGH A;  4GGG A;  4HDV A;  1ZGJ A;  1YS7 A;  5F6F A;  4IF4 A;  4YFN F;  3FMR A;  2MA3 A;  3P9I A;  1RIO H;  3ABT A;  5ICC A;  2HGC A;  4ESJ A;  1W5S A;  2XAH A;  4Q48 A;  4KYW A;  3FXQ A;  5TRD A;  2W84 A;  4KN7 X;  2DT5 A;  1XGN A;  4ZZD A;  1ZRD A;  3M8E A;  4MQV A;  1MJA A;  5HLH A;  1WKM A;  4QLC U;  4OMY A;  2A6H F;  4OU0 A;  1T0F A;  2HEO A;  2VBY A;  4PCQ A;  4IHT A;  4HA8 A;  2Y75 A;  1MJ9 A;  2FA5 A;  2VOD A;  3BJO A;  2ELH A;  1JE8 A;  2XKO A;  3D5L A;  3KEQ A;  1I5Z A;  1BIA A;  3I59 A;  4D0P A;  3E5X A;  2HKO A;  4R1H A;  2DPD A;  3SFZ A;  3WU0 A;  2QQB A;  2QEN A;  4L0Z B;  4G8X A;  4Y15 A;  4HF0 A;  1R5H A;  4YFK F;  1OYW A;  3DQV C;  3ZMU A;  3M1E A;  3TQN A;  1O3Q A;  1FNN A;  1JXS A;  4EVI A;  1NHA A;  2HR3 A;  3T0Y A;  1AWC A;  1BC7 C;  4R8H A;  5HS9 A;  1HST A;  2W25 A;  3G3Z A;  2DQR A;  4IVN A;  5D6E A;  1YW7 A;  3HRM A;  2V1X A;  2PLY A;  3N4M A;  2IA0 A;  2DFI A;  1T98 A;  2JT1 A;  4AIJ A;  2IRF G;  3JAM Z;  5BPD A;  4O6J A;  1BBY A;  4XBF A;  2QM3 A;  2W24 A;  1ZGA A;  2FOK A;  2O6G E;  2XRN A;  1YLF A;  1XB4 A;  5JFR A;  1UHM A;  1OYY A;  2YSR A;  3TDZ C;  2EFW A;  2MH2 A;  3DP7 A;  1D3Y A;  3K1N A;  1USS A;  2WV0 A;  5J6X A;  4ZYG A;  2DQL A;  1UCR A;  4KMU X;  1SFX A;  3L9F A;  4U0V A;  2MLK A;  4I02 A;  1WRJ A;  2W57 A;  4FX0 A;  4L5I A;  1WI9 A;  2MC3 A;  4K2E A;  3R60 A;  4KIB A;  3ABU A;  1LDK B;  2GA1 A;  5HS7 A;  1ZH5 A;  4PGG A;  3ZQ7 A;  3GYH X;  2PG4 A;  3HIF A;  4XLN F;  5E1Z B;  3E6C C;  1W7P A;  1FX7 A;  1F9N A;  5E1W A;  4BQA A;  4M73 A;  2EFN A;  2KIF A;  2EWN A;  5L3F A;  4U0W A;  2VON A;  4HX8 A;  5CVJ A;  3GX4 X;  4CXF A;  3ROU A;  4EJW A;  5DYM A;  4ENN A;  5ERI A;  2R7D A;  5HDK A;  1FOK A;  1YTY A;  2XAF A;  1J0R A;  4MEX F;  2ISY A;  1IXR C;  4IHS A;  1YYV A;  1CF7 B;  3HOT A;  2DBB A;  4LG0 A;  3O3K A;  1I1S A;  4Y13 A;  5CVR A;  5ICG A;  5BMZ A;  2V79 A;  1S8N A;  2FMY A;  2ZME B;  3KZY A;  1IF1 A;  3TKY A;  2IW5 A;  2Q8K A;  3WTV C;  3WGH A;  3C1D A;  2AXL A;  1FP2 A;  3ZPL A;  3K0L A;  4ESB A;  2XGX A;  5E8I A;  1XSX A;  1XCB A;  2ZKZ A;  1GHC A;  2JTV A;  5D4S A;  2V6C A;  4LGW A;  3KLN A;  5FB2 A;  1WWX A;  3I58 A;  1EH6 A;  2EV0 A;  3FZV A;  3IWZ A;  2XHK A;  1ZRC A;  3RKX A;  3CTA A;  3I71 A;  2J5P A;  2ZJ2 A;  3BPV A;  5F1R A;  2FEZ A;  1LVA A;  3QPT A;  2G9W A;  2L02 A;  5FO5 A;  2MD5 A;  4CHU A;  4RGR A;  3F8B A;  1FPQ A;  1ZG3 A;  4WCG A;  2EA4 A;  3BOQ A;  3WGI A;  1TNT A;  2B0L A;  3E3V A;  2O61 A;  1MD0 A;  5ICE A;  3WTT C;  2LF7 A;  3BWG A;  2PBI A;  4AWX B;  4EM0 B;  2BE5 F;  3EYI A;  4I0B A;  3F22 A;  3FM3 A;  2KJB A;  4KDP A;  3KLO A;  4ENM A;  4XRF A;  1B9M A;  5J8C A;  4HLX A;  4ZZL A;  5DDG A;  2JPC A;  1TTY A;  5CLS A;  1X3U A;  5TJJ A;  2DO7 A;  5E1X A;  3EDP A;  4UUV A;  5E18 F;  2K7L A;  1RUO A;  1ZN2 A;  4WF2 A;  3JAM K;  3DV8 A;  2DPU A;  3J7A O;  4RS8 A;  2CO5 A;  3T8T A;  2V1D A;  2Y0M A;  5FLX K;  2EFP A;  5DEQ A;  4RB0 A;  3KFW X;  3T1B A;  1YW9 A;  3C18 A;  5JVT A;  1R1U A;  3M8F A;  2FF4 A;  4A0X A;  3HTU A;  4JK1 X;  5JR3 A;  5CVV A;  1FYM A;  3L7W A;  3DXJ F;  2IP2 A;  4CO8 A;  2MH9 A;  2VT3 A;  3HSE A;  4M72 A;  1GXQ A;  2DLL A;  4M71 A;  3AAF A;  1SD4 A;  3ECO A;  4HV6 A;  2STW A;  4P96 A;  1SD7 A;  1Z91 A;  3BPX A;  4HZF A;  4L9N A;  5EEH A;  1Z6R A;  2M87 A;  2LNB A;  4DQ2 A;  4RB1 A;  1U78 A;  3JTG A;  4PDK A;  2CQK A;  4P5O A;  3KCC A;  1ZLJ A;  4CGZ A;  1HKQ A;  3R61 A;  1PUE E;  3E6D A;  2Q0O A;  3RDI A;  4LLL A;  3QU6 A;  1T39 A;  1KU7 A;  3CUO A;  2ZNY A;  4KMF A;  3SXY A;  5DCM B;  5LHI A;  3F8F A;  2WWY A;  2K27 A;  4UXN A;  3F8M A;  4HF1 A;  5HS8 A;  2P8T A;  4G9Y A;  2RKH A;  1G3Y A;  1HSJ A;  3ZN0 A;  4G6Q A;  2ACJ A;  4BHP A;  2XAQ A;  2Z5U A;  3BZ6 A;  3GZ5 A;  1U5T B;  3T5X A;  3ECH A;  1KA8 A;  3F8N A;  2HZT A;  1ZHF A;  3K2Z A;  3I5U A;  1P2F A;  1JGS A;  3WG9 A;  4S05 A;  3RJP A;  1R5G A;  4OIQ F;  2IT0 A;  1YFH A;  4BAY A;  3LAP A;  5DCF A;  2OU2 A;  5E8G A;  1TQP A;  3MAJ A;  1P6R A;  2VOO A;  5LGU A;  3LQR A;  4N9H A;  1LDJ A;  3HHH A;  3F6O A;  3PFI A;  4MGR A;  4KIG A;  1XGS A;  4EV0 A;  4WK8 F;  4H0E A;  3IL2 A;  1OR7 A;  3WE3 A;  2VE8 A;  3GW2 A;  3P9C A;  5H6R A;  2DAO A;  2ZXJ A;  4KFC A;  3S2W A;  5BOX A;  5ILS A;  5L3D A;  2QQA A;  3FXR A;  2YX4 A;  1STZ A;  4L0Y B;  1MZB A;  1QZZ A;  3WTX C;  2RC4 A;  4GCV A;  3WOD F;  2VC0 A;  3E5Q A;  3KP5 A;  1K6O A;  1Z9C A;  1S3J A;  3HRS A;  2A61 A;  3Q9V A;  1YS6 A;  3ZMZ A;  2L54 A;  1XMK A;  1QPM A;  3DPL C;  2FBI A;  3CUQ B;  5FGM A;  4IRG A;  3HTS B;  1S7O A;  4HBL A;  5FFZ A;  1FZP B;  2KJC A;  1RUN A;  2F5C A;  5F64 A;  2VBX A;  3KP7 A;  3WTW C;  3P9K A;  1QQI A;  3DPT A;  1JHH A;  3M7G A;  3MWM A;  4LK0 F;  1P4X A;  3FHZ A;  2H27 A;  2PN6 A;  1BI2 A;  2OZU A;  1QBJ A;  3WU1 B;  1HW1 A;  2F2E A;  1W5T A;  2LF8 A;  1XDU A;  2G7H A;  3CLO A;  1FC3 A;  1V4R A;  1R00 A;  1UB9 A;  4A2U A;  1CF7 A;  1SAX A;  4RGX A;  2EFQ A;  1MKM A;  1REP C;  5L3G A;  1XD7 A;  2O3F A;  3SHF A;  4KT5 C;  3MEX A;  2MLG A;  1MDM A;  3U1D A;  3H92 A;  1UFM A;  3ZN1 A;  1XGM A;  3LA3 A;  5AIQ A;  1B4A A;  4P55 A;  2UZK A;  2P7C B;  2Z9O A;  1U2W A;  4BHB A;  4CIC A;  2EFO A;  4AD9 A;  3WTU C;  3K1M A;  1B59 A;  2HQR A;  4A0Y A;  2COM A;  1O3T A;  1G3W A;  2UWM A;  4M9S A;  4FX4 A;  5FLX Z;  4U7D A; 
#chains in the Genus database with same CATH topology
 3BG6 A;  4JX6 A;  1OR7 C;  3A2K A;  4NQW B;  2DK8 A;  3U1K A;  3H0D A;  1JKR C;  4E6K G;  1VQP I;  2MBF A;  1X4O A;  2R5Y B;  1JKP C;  1SD5 A;  4IQ4 A;  2L7K A;  3MQ0 A;  1Y39 A;  1FLI A;  1PYV A;  2OQG A;  1I39 A;  3W2V A;  3F9K A;  2O9L A;  4KNY A;  1RKW A;  5DV5 A;  3W6K B;  1L0O C;  2W4S A;  3HKZ A;  4PJJ A;  4D1Q A;  3MFK A;  4KT6 A;  5F08 A;  3IRR A;  4O3M A;  4NUB A;  2GZW A;  3PSI A;  4BXU A;  4LMY A;  2F5F A;  1J2X A;  3PO2 J;  3DTI A;  1IW7 F;  3JRA A;  1ZRF A;  1Y1V J;  1IN7 A;  2TDX A;  3TL4 X;  1F1Z A;  3E6B A;  1LKX A;  3PSF A;  3SZT A;  1S5L C;  4JYK A;  3F21 A;  1LFB A;  5LHG A;  2JVG A;  3Q9S A;  2K4J A;  1XSV A;  3ZMT A;  1ZYR F;  2CUJ A;  1S7E A;  1Y56 A;  4PK4 A;  2JJ7 A;  1W1W E;  3BTL A;  4IHY A;  1Y8R B;  5J1U A;  2V6E A;  4HF2 A;  2PQ8 A;  5CKT A;  3L2U A;  2H1L A;  1SAN A;  2JZY A;  5HVQ C;  4RBO A;  1HC8 A;  1H0M A;  3H9J A;  4A3G J;  3DU6 A;  3H35 A;  1KGS A;  4Y4R A;  3OWT A;  1JTX A;  1VF9 A;  4AM3 A;  1FBQ A;  4N0B A;  2KKO A;  3I64 A;  4NHJ A;  5FRN A;  3FIS A;  3SFI A;  4F92 B;  1AA7 A;  2LVS A;  2PMU A;  3G4S I;  1LJ9 A;  4M3B A;  2D1V A;  4M6Y A;  3VB2 A;  2DMT A;  3FHN A;  1H9T A;  2K9Q A;  2R7Q A;  2M0C A;  1A31 A;  2X51 A;  2DXI A;  5CVU A;  4BAC A;  4L5J A;  3ELK A;  5CPR B;  2BY0 A;  4WWC A;  1KYW A;  2ZBK A;  1YX3 A;  2HKX A;  3NEU A;  3ZXS A;  1QU3 A;  4AYB A;  3RSN A;  3BZK A;  5F0C A;  4M74 A;  2IGO A;  4ZJZ A;  3I4P A;  5D8L B;  2FQ3 A;  3DKX A;  1IV6 A;  2AHQ A;  2HWV A;  2HQA A;  5F0F A;  4N4N B;  3ULQ B;  4UUS B;  2HOT A;  1N78 A;  3MZH A;  4LK1 F;  4G6D A;  2ELK A;  2IEK A;  1XG1 A;  1KZH A;  1RET A;  3OSF A;  4I98 B;  4HST A;  4BHC A;  3I56 I;  3KYL A;  3Q5F A;  4OAY A;  3ZQG A;  2VE9 A;  2E19 A;  2Q2E A;  3OOP A;  1VQ7 I;  4I0A A;  2CGP A;  3FBN B;  4ESF A;  2ZXI A;  2ZFW A;  2DOE A;  2V26 A;  4UNO A;  5D4R A;  4EAT A;  2BOL A;  2OUM A;  4XLF A;  3HRU A;  2H1K A;  5K5R A;  3A03 A;  2DYS H;  3EUA A;  3DPU A;  5C4J J;  5BNG A;  1X1P A;  3FK6 A;  1A04 A;  1TQM A;  3L2Q A;  4AC0 A;  4Q47 A;  4OMZ A;  2L0K A;  5H20 A;  4PJL A;  3S17 J;  3R0A A;  4IQJ A;  4B3A A;  3HOZ J;  3PJR A;  3OL3 A;  3LQQ A;  1VQ6 I;  5K7Z A;  4HQM A;  5E17 F;  3RKW A;  1YIO A;  3EYY A;  1O7L A;  3K4N A;  3FK7 A;  1W36 C;  2QF7 A;  2FJ1 A;  2XUB A;  4CCN A;  4L9T A;  1KU9 A;  5L3C A;  2LLK A;  2ESH A;  4MHG A;  5D8K B;  1K78 A;  2G7U A;  4EJO A;  2RGV A;  1ONV A;  4BGD A;  1NK3 P;  5CQG A;  3IKV A;  2O0Y A;  4UHT A;  4D5C A;  2BY3 A;  3GFM A;  5A2Q Z;  1POG A;  2M45 A;  4S04 A;  3S1R J;  5HLG A;  1ZLK A;  3OYA A;  1MBJ A;  1FOW A;  2NS0 A;  1D1A A;  2PEX A;  3KYD B;  1BJA A;  1YOV B;  3BTI A;  1WQ2 A;  5J1Y A;  3E0J B;  5DD8 A;  1IN6 A;  2JK3 A;  2OC6 A;  1BC8 C;  3KEY A;  1UG0 A;  5KAI C;  4PFP A;  2Z3Y A;  5FFX A;  4WXC A;  3GO5 A;  1W0U A;  2DMU A;  1U3E M;  1EV7 A;  1VQK I;  1UST A;  3ZRG A;  2NYX A;  5F1J A;  2VPR A;  3FXO A;  4BYY A;  1IRF A;  3E1S A;  5LRS A;  1TW3 A;  2Z33 A;  2Y9Z A;  4IRH A;  4MEY F;  4AID A;  2ESN A;  1EKE A;  5EJC A;  3ZQQ A;  1JHF A;  1UAA A;  1DPR A;  3K70 C;  2RQP A;  2F6C A;  4A0Z A;  3CO7 C;  1RRJ A;  2EZK A;  2CSO A;  3R4K A;  3CD6 I;  3K1P A;  4ASN A;  1J59 A;  4P9U A;  2Y30 A;  1WCM J;  3GVA A;  4IZZ A;  5HOD A;  1S7A A;  3V7S A;  5FJ8 J;  4IHX A;  4MNU A;  4YEJ A;  1Z77 A;  4G7O F;  3V8K A;  5IP7 J;  4NC7 A;  4HNV A;  1TL8 A;  3DU5 A;  1U8R A;  2OTL I;  2XVC A;  3BP8 A;  4ZTJ A;  2EK5 A;  3HSF A;  1SFK A;  1YRN A;  1VQ4 I;  2L7M P;  4D5F A;  2DMQ A;  2BEO A;  2MYS A;  3LAJ A;  2R5Z A;  2LD5 A;  1M1E B;  3OV8 A;  5EZG A;  3CJR B;  3FXU A;  2E2H J;  1KU3 A;  2WC2 A;  3DF8 A;  2ADU A;  3ISP A;  4HDU A;  2FBH A;  1FBS A;  1I1G A;  1BL0 A;  2KQR A;  4IJA A;  3RPQ A;  2AS5 F;  5GPA A;  2NAZ A;  1J7K A;  3FWE A;  3BJA A;  1ZK8 A;  4AIK A;  3IHU A;  2GXB A;  3PUB A;  5E79 C;  1BOA A;  1W7P B;  1DP7 P;  3ZCO A;  1HQC A;  6PAX A;  3OIP A;  1FYL A;  1BN5 A;  2OD5 A;  3ZQC A;  1PP8 F;  2K86 A;  4LJZ F;  4YEL A;  1GDT A;  5K7F A;  1QZY A;  2A69 F;  2E7W A;  2H8R A;  3TO9 A;  1D1C A;  2RQQ A;  3F8C A;  2NRA C;  3MKW B;  2QEX I;  2ELJ A;  2M5W A;  2RAE A;  3J7Y J;  2LBF A;  3BCB A;  4FHT A;  1D5Y A;  3EET A;  3VOE A;  3S15 J;  2GA2 A;  2E1N A;  2QBY B;  4L9J A;  2JN6 A;  2OAZ A;  2MC4 A;  4S0H B;  1JGG A;  2HDD A;  4GO1 A;  4ZYD A;  1V3F A;  2HTJ A;  1ETK A;  2CH0 A;  5HOO A;  2EIK H;  2F5E A;  4MTD A;  5EF6 A;  2XRO A;  3M1C A;  2GAU A;  3UKG A;  5CVI A;  2ZSI B;  2O03 A;  3HUG A;  4G7Z F;  1YO5 C;  5LEJ A;  5D5W B;  4QPO A;  2CFO A;  1APL C;  4XSX F;  2EIN H;  3CUQ A;  3V7R A;  3DFG A;  2XV4 S;  2GBY A;  4UUT A;  1XCV A;  4CZC A;  2JSP A;  3BT9 A;  3HYI A;  5DTD A;  3ERE D;  4BXX J;  1XX5 A;  3JRC A;  1IUF A;  3RKQ A;  1N77 A;  2XPV A;  3ZGK A;  2D1H A;  1JT0 A;  4ENK A;  1S29 A;  1O3R A;  2DA3 A;  2KDZ A;  2A68 F;  3CQZ J;  4HNT A;  1SMT A;  2V4J C;  3A0H C;  3LL7 A;  3W6J B;  4F7Z A;  1J5Y A;  2J5O A;  2BW3 B;  2QSF X;  2OF7 A;  2M7A A;  1Z7U A;  2VC1 A;  3X2Q H;  2K3P A;  2UXN A;  3QRF F;  5FRO A;  3HOY J;  1F5T A;  4H4K C;  4P9F A;  4XOT A;  3HB9 A;  1OCO H;  1V5E A;  4KN4 X;  2CG4 A;  4RGS A;  1S72 I;  1NH3 A;  3M3Y J;  2LRD A;  2FRH A;  4HG2 A;  3J81 K;  2VJI A;  1UHW A;  2MAB A;  2IGK A;  4XN0 A;  4XL9 A;  5IOZ A;  1KQ0 A;  1AU7 A;  1IZ1 A;  2KZV A;  3ML6 A;  2CU7 A;  2IS6 A;  1VZ0 A;  2KRC A;  1MSE C;  2DFF A;  2LY1 A;  3NWT A;  4W97 A;  4IOA F;  3DTE A;  3E7L A;  1ON2 A;  2X6O A;  4M9Z A;  3VEP A;  2IVM A;  2FOW A;  1EF4 A;  2LDU A;  2YPR A;  3OY9 A;  1IRZ A;  3C7J A;  1Z3Y A;  5J8F A;  1CGP A;  1WSU A;  4HX7 A;  2ISZ A;  2R7U A;  2EB7 A;  9ANT A;  5LGT A;  3OYF A;  3ZMV A;  4JX5 A;  2OZ6 A;  4C2U A;  1FBU A;  3E97 A;  2JA8 J;  3SDG A;  1PP7 U;  2OA4 A;  3REO A;  3WG7 H;  3J80 Z;  2XAG A;  1P92 A;  5BS6 A;  3TDU C;  3AKZ A;  5GAD J;  5LRR A;  3RQI A;  2CFX A;  2D45 A;  2FE3 A;  3PNT A;  1BW5 A;  4MFD A;  5HNH A;  1G4D A;  4WXD A;  3Q0U A;  3KP6 A;  3I0T A;  5TGT A;  3RTR A;  3RIR A;  4U0Y A;  4NB5 A;  2HOE A;  2VN2 A;  2TCT A;  2CQ7 A;  5K5Q A;  3L2W A;  4BS9 A;  3GWZ A;  2P7V B;  1WVR A;  4A3D J;  2CQN A;  3RPU A;  1LE8 A;  1R4N B;  2P5V A;  3W6V A;  3JRH A;  2DN0 A;  1RZ4 A;  1Y0N A;  2L2O A;  3KX2 A;  3RYP A;  1FT9 A;  4FQG A;  3H9Q A;  2P6S A;  1GXP A;  3LST A;  4GRI A;  3PFY A;  3HGY A;  1H8A C;  4KA4 A;  5JHU A;  3JRI A;  1LDD A;  1R23 A;  1S6L A;  2QYO A;  4NQW A;  5A2Q K;  1Z3X A;  2OCC H;  3QYB A;  4UY8 I;  2F5D A;  3G2B A;  3QP5 A;  4FET A;  5HDN A;  2FML A;  3GTL J;  4QWQ A;  3HOS A;  1BR4 A;  2P5L C;  4AVP A;  1GLN A;  3UR3 C;  4ENJ A;  2JQ7 A;  1T08 B;  3GTG J;  1DU6 A;  2Q1Z B;  5HDG A;  2RNJ A;  2O8X A;  4IOC F;  2ZXH A;  4HRI A;  2EBI A;  3LSI A;  4EJU A;  3LSR A;  2NVT J;  3H3Z A;  4OIN F;  4BH9 A;  2VXZ A;  3B02 A;  3G6E I;  2RV8 A;  2QKL B;  4XLP F;  2DA5 A;  3FF5 A;  5KK1 A;  1JI8 A;  3CCL I;  5LD2 C;  1OPC A;  3K4C A;  3ZMD A;  3L2V A;  1IJW C;  4PJM A;  4A3E J;  2WY8 Q;  1DP3 A;  1R7J A;  2KRF A;  3HRT A;  3PQK A;  2IPQ X;  1IUY A;  2HQN A;  4MTE A;  3WHC A;  4BQO A;  3CCQ I;  2Z16 A;  1IN5 A;  2WV1 A;  4B1R A;  1U9O A;  5IP9 J;  3OYH A;  3JSO A;  2VIX A;  3N05 A;  5AIP A;  3CUQ C;  1R1T A;  3CMY A;  1ETQ A;  2EJR A;  3WE2 A;  1IXS B;  1T2K A;  1GVJ A;  2IXS A;  3COA C;  3IRQ A;  2WY7 Q;  1TT0 A;  3I54 A;  3ZQH A;  4A5M A;  2FQ4 A;  2GIZ A;  2P4W A;  3FMQ A;  2CS3 A;  3IH2 A;  3TO6 A;  1GUU A;  2IJL A;  2LSO A;  3VWB A;  4UVA A;  3L2C A;  4GDF A;  1B1B A;  3LWF A;  1K79 A;  1I6H J;  2M1B A;  3PUF A;  2PFB A;  2V1U A;  2DK5 A;  3W3C A;  1VFC A;  2CWE A;  1BR2 A;  2QWW A;  3G1L A;  3OOU A;  4J01 A;  2P5K A;  3QOP A;  1P4A A;  2DI3 A;  2LR8 A;  3MKZ A;  3U21 A;  5EEG A;  4FAS D;  3G73 A;  1DGR M;  1XMX A;  2P0W A;  2QZ8 A;  4A6D A;  2E5N A;  4M6X A;  2YX7 A;  1UEL B;  4B8X A;  2CW0 F;  2K40 A;  5BQT A;  1QNT A;  5DUI A;  2JUC A;  4KIC A;  2XGE A;  2LOO A;  3CJN A;  2XKP A;  1Q1H A;  2ZC2 A;  4RAG A;  2HYF A;  4YII A;  2R92 J;  2CYY A;  2BBY A;  2ETH A;  2VJ5 A;  2Z99 A;  4M3F A;  4N4O B;  4UUS A;  1FSH A;  2W85 A;  3BG7 A;  1D0Y A;  4RGU A;  3GFI A;  4A3I J;  2BZT A;  4B09 A;  3LSK A;  5F04 A;  3GUD A;  5K1Y A;  1BI0 A;  2H8W A;  2V1N A;  3M9A A;  3CDH A;  4U7B A;  2WA0 A;  3VFZ A;  3HG9 A;  2ZME A;  3NQO A;  1SEU A;  2OQR A;  1QHG A;  1B9N A;  3GF2 A;  1GV5 A;  1Q1V A;  1F4K A;  1MGT A;  2E60 A;  4B48 A;  4EMS A;  2VBZ A;  4HV5 A;  1L3L A;  1RR8 C;  4LD5 A;  3V4G A;  5FD5 A;  2MG4 A;  2GXG A;  1RR7 A;  2M9H A;  4BUP A;  4UVC A;  1Z6T A;  1VTN C;  3R6S A;  3WTY C;  2EA2 A;  2DW4 A;  3CMA I;  5TIS C;  5DD4 A;  3BR1 A;  2FUG 2;  5H6Q A;  4RAY A;  3HXL A;  5DUK A;  3ONQ A;  2A5Y B;  1OIS A;  2KIQ A;  3BTJ A;  3U2R A;  2L01 A;  1SMY F;  3EQL F;  3MKL A;  3RKY A;  4Q5S F;  3SYT A;  3TGN A;  2KIU A;  3IH4 A;  3N97 A;  2ZO4 A;  1O57 A;  2KT0 A;  1D8K A;  2BVM A;  4KUM A;  3V7C A;  1ULY A;  5EG0 B;  2HS5 A;  2XF5 A;  2VUM J;  1TP4 A;  2Y69 H;  5LEK A;  1N75 A;  1IDZ A;  3C2B A;  3M4O J;  3ERM A;  1TBX A;  2VKE A;  3QPH A;  2W48 A;  2VLA A;  5ICF A;  5D5X B;  3GXO A;  2C6Y A;  1IC8 A;  4PJ0 C;  1OCR H;  3SQN A;  5M5Y J;  2WAE A;  2JWT A;  2X6W A;  2XAJ A;  3V8L A;  2NXN B;  1R5I D;  1ITY A;  2PJR A;  1JT6 A;  2UXX A;  4F91 B;  3MCZ A;  4YG2 F;  3VOD A;  1OFC X;  2PMZ A;  2L4M A;  1I27 A;  2VQH A;  1PUF A;  3HOW J;  1Z05 A;  3MZY A;  5EZH A;  3L09 A;  3JRD A;  2WB1 N;  3SZP A;  2YR2 A;  1FTZ A;  2XF6 A;  4Z6Y A;  2IAI A;  1FYK A;  4HOB A;  3QYE A;  3Q3S A;  3TOB A;  2QUF A;  4HAM A;  2Y0S A;  2GLO A;  4HQE A;  4GYI A;  2CUE A;  4PJN A;  2BYV E;  4CH7 A;  3EUH A;  5GPC A;  1AKH B;  1KON A;  3AL0 C;  2QGU A;  3OYE A;  3BR3 A;  2FBK A;  4GXO A;  4J00 A;  1Y0U A;  2CQQ A;  4XID A;  5IT9 K;  1SFE A;  4XM3 A;  2HYG D;  3J80 K;  2XAS A;  2EZI A;  4FTH A;  1ZTR A;  3B73 A;  2DYR H;  5KNL A;  3TW7 A;  2EH3 A;  3GLX A;  3KYC B;  4NC6 A;  1H9G A;  2NOG A;  2ID3 A;  5DS9 A;  1BM9 A;  2HDC A;  2JSC A;  2XIG A;  1XDS A;  4ZC3 A;  4C2M J;  4L18 B;  3HDD A;  2EPF A;  5L3B A;  1EH8 A;  3S93 A;  1LNW A;  3GEZ A;  2VB6 A;  4BNC A;  1T56 A;  4DYQ A;  3GBG A;  1RNL A;  4CDG A;  2B7E A;  2M8G X;  1A35 A;  1TC3 C;  2E1C A;  4R79 A;  4AYB N;  1X1A A;  4LFU A;  4I01 A;  5CYV A;  3RYR A;  5M3M J;  4Y17 A;  1W4M A;  3HZJ A;  3W2W A;  1K7A A;  2STT A;  3BDD A;  3KET A;  2A07 F;  1OYI A;  5D5U B;  3J81 Z;  4X1E A;  3LOC A;  5GP9 A;  4UV8 A;  2ECC A;  3KE2 A;  3LSJ A;  2EIM H;  2ZXW H;  2CUZ A;  1DPU A;  3OIQ A;  1QZE A;  2XSJ C;  4M9X A;  2CUF A;  2NNN A;  3QP6 A;  3OYI A;  3S1Q J;  3D5S C;  3O6B B;  3U9G A;  1FMV A;  3DBR B;  3LA7 A;  4KIF A;  4HLY A;  2MD0 A;  4QTR A;  2L5Q A;  3BZC A;  2VOP A;  1YW8 A;  4FE7 A;  3HOV J;  2QBY A;  2F48 A;  4O5V A;  4CCJ A;  2R7S A;  2BY1 A;  5FKK A;  5L3E A;  3ZR8 X;  3TO7 A;  5LBQ A;  3OYL A;  1AHD P;  1T6S A;  1D8J A;  1W7P D;  2OV7 A;  3ZQI A;  3GTP J;  3CMM A;  1YG2 A;  3DKW A;  1O3S A;  1DGW Y;  3F3X A;  2R3S A;  4W1U A;  5E20 A;  1E17 A;  3OL4 A;  2DMN A;  3S1N J;  1VND A;  2L9N A;  3A0B C;  4A12 A;  2NVU B;  3KEO A;  2K02 A;  4N9I A;  3W2A A;  1TWA J;  3J7A Y;  2UUZ A;  1HXD A;  3I59 B;  1XN7 A;  1T38 A;  3KP4 A;  4IHV A;  2ZME C;  4XOP A;  2NNY A;  2E2I J;  2DMP A;  4DNC A;  3PL8 A;  1MBG A;  5FD6 A;  2R7O A;  2HNH A;  1U0J A;  3JTH A;  2ZB9 A;  3FM5 A;  2L9S A;  3HHG A;  3BR0 A;  2XC7 A;  1WFX A;  2V9K A;  1LEA A;  5IY5 H;  2LK2 A;  2GIV A;  1MW7 A;  3BR2 A;  4JBA A;  3JRF A;  3CME I;  3D5R C;  3NWS A;  1MDM B;  4MLO A;  2EV5 A;  5FKM A;  1ZAR A;  3F23 A;  3KIO A;  1UJ8 A;  4EM2 A;  2QQ9 A;  3K2A A;  1IXC A;  4CCK A;  2GOM A;  2VQC A;  1WH7 A;  1TWC J;  2JPB A;  4NBQ A;  2FU4 A;  2PMH A;  2K4B A;  2X1C A;  3QQA A;  3SDB A;  4ZDO A;  5IT3 A;  5KVR A;  1LVK A;  1SD6 A;  4OIR F;  1LQ1 A;  2LC2 A;  2QVO A;  1O7F A;  1T33 A;  4RAZ A;  5DCM A;  2VKV A;  1TNS A;  2V7F A;  1SVM A;  2L4A A;  1G3S A;  2JRT A;  3IAS 2;  2Y9Y A;  5J4V A;  1BIB A;  2R7T A;  2TRT A;  3QYF A;  1OMI A;  4D9J A;  3K4K A;  2DTR A;  3HC7 A;  5ILU A;  3NAU A;  2RVC A;  3UNG C;  2BHY A;  4X0G A;  3BC8 A;  3BRO A;  3AFH A;  5D5V B;  3A4C A;  3DEU A;  5EGO A;  4LLN A;  1U5T A;  4EJT A;  4OIP F;  5LHH A;  2JVH A;  3NRV A;  3H5N A;  5HLI A;  4BL0 B;  1AOY A;  1QRY A;  3OSG A;  1VQL I;  1NTC A;  3FXL A;  1JTY A;  4AVZ A;  1ON1 A;  2JUG A;  2HDW A;  2K85 A;  2XF7 A;  2GQQ A;  1DDN A;  1Z67 A;  3EUH C;  3CO6 C;  1BA5 A;  2VT2 A;  4E7H A;  2A3S A;  1B8I A;  4ZYE A;  3PQJ A;  2DDA A;  4EGZ A;  3D0S A;  3GFJ A;  2HVQ A;  2M30 A;  3C3W A;  4L9V A;  1D0X A;  2AQE A;  3O2P E;  3KP3 A;  2QQ8 A;  2IA1 A;  3KZZ A;  2M4K A;  2RDP A;  4LB6 B;  4TV7 A;  4BY7 J;  4DBQ A;  3E6M A;  2YU3 A;  4I7H A;  3S32 A;  1XMA A;  3E5U A;  2Y31 A;  2KZG A;  2V9V A;  1ZG1 A;  5K5O A;  3K6G A;  1WH5 A;  4UVB A;  1OQY A;  2NS7 A;  2X9D A;  1V55 H;  3QAH A;  4E70 A;  5JI6 A;  1QGP A;  2R7F A;  3K4M A;  3JCU C;  2H94 A;  3CCR I;  4OAZ A;  4KIT B;  1C0W A;  1HCR A;  4ON0 A;  4D7M A;  1A6I A;  2O5R A;  1IRG A;  1J09 A;  3WTS C;  4F55 A;  4I2O A;  4LB5 A;  4XK4 A;  4U88 A;  4PSX A;  2X48 A;  2H09 A;  1IRX A;  3GCM A;  2W82 A;  3LA2 A;  1W0T A;  2FNA A;  5E3N A;  3QU3 A;  1HKT A;  2QSG X;  1HKS A;  3K69 A;  5ED4 A;  3V8J A;  2CV1 A;  1PJR A;  4B44 A;  5IPA A;  1I3Q J;  2WTE A;  5E3L A;  3IKT A;  2PJP A;  2LMD A;  2X0L A;  4RB2 C;  5ILV A;  1G2H A;  1LEB A;  4HYE A;  1D1B A;  2Y2Z A;  4IL6 C;  1Z0X A;  1YQA A;  1J75 A;  1ZG5 A;  1HW2 A;  1RI7 A;  2DU9 A;  1G6N A;  2E7X A;  3ABL H;  4UV9 A;  1I6X A;  3H3U A;  4IRI A;  2K9N A;  4XSZ F;  2FXA A;  5LGN A;  3ZMS A;  2HYJ A;  1EH7 A;  5FKN A;  1KQ8 A;  2EZL A;  4DIQ A;  4LG0 B;  4IXA A;  4ETS A;  3M8J A;  1R58 A;  1R22 A;  1FEX A;  2MGQ A;  2ZCW A;  3QPS A;  4HW0 A;  5J47 A;  1Z1D A;  1FWZ A;  4RLF A;  1XPX A;  4DOZ A;  4E7L A;  1P7J A;  4ZTF A;  4F3Q A;  1MND A;  1K83 J;  4BE1 A;  1FY7 A;  2BXZ A;  1HA8 A;  3OYN A;  1VQO I;  1X1C A;  1UZC A;  2D2W A;  2H6B A;  2RN7 A;  1T95 A;  2E1M B;  2IGN A;  5M5X J;  4DYR A;  3ZP5 A;  4Y3O A;  1FP1 D;  2L3D A;  3MN2 A;  3HSR A;  3VYT B;  2EIL H;  2FSW A;  3DCF A;  4X6A J;  1V54 H;  2ZJQ F;  4JQF A;  3K9T A;  4WX9 A;  3L1P A;  5E3M A;  3CLQ A;  2R93 J;  4MFE A;  1OKR A;  3R0J A;  2IS4 A;  5LLQ A;  5J1R A;  2HFH A;  2WAQ A;  3LFK A;  5BPI A;  3WTZ A;  3BY6 A;  3VYU B;  1IN8 A;  3TOA A;  1B72 A;  2Y48 A;  2H6C A;  3OYM A;  3OYC A;  2E1O A;  2K9L A;  4ZH4 F;  3JRE A;  4OOI A;  4RMN A;  1K78 B;  3I4M J;  3BJ6 A;  2IS2 A;  4WXH A;  2IA2 A;  4MQ9 F;  5AON A;  1QO0 D;  4PZJ A;  3K4L A;  5D6F A;  1R9T J;  4OIO F;  3JW4 A;  1U6G A;  4BU2 A;  3KP2 A;  3IH3 A;  3PO3 J;  1TLH B;  4DYC A;  1ZRE A;  2OTJ I;  3OMY A;  2OPT A;  4HX4 A;  1BI3 A;  4CYD A;  3RI4 A;  5IT9 Z;  4RLQ A;  3HM5 A;  1D5V A;  1G3T A;  1U5T C;  3JSP A;  1EJ9 A;  1K6Y A;  4IPA A;  1MJB A;  3FMS A;  2LP0 A;  4EGY A;  4Q4Z F;  4KJZ A;  1KU2 A;  4YFX F;  1TQI A;  2FD5 A;  3FX3 A;  2E35 A;  3IC7 A;  3QWL A;  4A6E A;  4XRS G;  2VJJ A;  4LLG F;  2COB A;  4RA2 A;  4FT8 A;  1B6A A;  1BI1 A;  2NOJ B;  4E7K A;  5HLT A;  2KIM A;  4C3H J;  3O8G A;  3CF5 F;  5GTI C;  3F6V A;  4G7H F;  2LKP A;  2ZNZ A;  1XSD A;  1KYZ A;  4GYG A;  4BQN A;  1F43 A;  2P6T A;  4YIF A;  1LB2 A;  3WHB A;  4EJV A;  4BJ5 C;  2GWR A;  4YIR X;  3I53 A;  2HTS A;  1E2X A;  3LSH A;  3F0C A;  2A6E F;  1ODD A;  2XPU A;  1IN4 A;  1J9I A;  4D7N A;  1OCT C;  2Z1D A;  3F72 A;  5CJ9 A;  1TW2 A;  1HBX G;  1HW5 A;  3CCJ I;  4II3 A;  2X4H A;  5EG0 A;  1I3A A;  1JKQ C;  1ZAO A;  3WGG A;  3IWF A;  3GZ6 A;  3LMM A;  4E7I A;  1UHS A;  2AO9 A;  3GZN B;  4EM1 A;  5IYC J;  2OBP A;  1KQ9 A;  3DEE A;  1IAW A;  3CC7 I;  3MZ8 A;  4A69 C;  3A01 B;  3K10 A;  2E5Z A;  1PDN C;  4V19 K;  4ZDP A;  1R36 A;  2R7V A;  1YRN B;  1R1V A;  1XGO A;  2R5Z B;  3LSM A;  2R5Y A;  3T8R A;  4CZZ A;  1DUX C;  1SFU A;  1FSE A;  4EQQ A;  4JX4 A;  4DGW B;  4I09 A;  1P4W A;  2XB0 X;  4AIH A;  2BGC A;  2PI0 A;  4ZYH A;  2QLZ A;  3GFL A;  5DM6 F;  4I6Z A;  2DFH A;  4RB3 C;  3CCE I;  3IUO A;  3P7N A;  1EA3 A;  4XKW A;  4CCL A;  3L00 A;  3CP2 A;  4A5N A;  4I99 C;  3CP8 A;  2EV6 A;  3EUK L;  2BV6 A;  2CW8 A;  2G0E A;  2M8E A;  4Z2Y A;  2R7R A;  3PNV A;  4G94 A;  2FNP A;  2JA5 J;  2VBW A;  4PGH A;  4GGG A;  2LBF B;  3OS1 A;  4HDV A;  3GTK J;  1ZGJ A;  1Y1W J;  4E4H A;  3FIW A;  4HEA 2;  4KIS A;  1YS7 A;  2NVY J;  3DKY A;  5F6F A;  2XPW A;  4IF4 A;  4YFN F;  4NNJ A;  4C2T A;  2LH9 A;  3H36 A;  3HPG A;  4V2F A;  2M0M A;  3I4N J;  4ZYA A;  1VQ5 I;  2LG4 A;  3FMR A;  4F93 B;  2MA3 A;  3P9I A;  3HUG B;  5E3O A;  3BQZ A;  1RIO H;  3ABT A;  5ICC A;  2HGC A;  4ESJ A;  1LUJ B;  1W5S A;  4M3E A;  4AUX A;  3H3V K;  1HF0 A;  5B5E C;  2XAH A;  4Q48 A;  4CYC B;  4KYW A;  4NDL A;  3FXQ A;  5TRD A;  2GOX B;  2VL8 A;  1WJC A;  2W84 A;  1E3O C;  3DLL F;  4KN7 X;  4BEH B;  2DT5 A;  1XGN A;  4ZZD A;  1ZRD A;  3M8E A;  4MQV A;  1D0Z A;  1MJA A;  3BQY A;  3FBI B;  2M7B A;  5HLH A;  1WKM A;  2L7F P;  4QLC U;  1WZ2 A;  4XN3 A;  3J7Z I;  4A3M J;  1SAU A;  3CDL A;  2A6H F;  4OMY A;  3H1C A;  1MMN A;  4B43 A;  3JRG A;  4OU0 A;  1T0F A;  2NVQ J;  1MMD A;  5JLW A;  2HEO A;  2VBY A;  1TWG J;  4PCQ A;  4IHT A;  1X19 A;  2DA7 A;  3CCY A;  2Y75 A;  3C2H A;  4HA8 A;  1MJ9 A;  2FA5 A;  1P7I A;  2VOD A;  3BJO A;  2ELH A;  1JE8 A;  2XKO A;  1E3P A;  3D5L A;  3OR2 C;  4UB6 C;  4E7J A;  3KEQ A;  1I5Z A;  1BIA A;  5JLX A;  3TED A;  3I59 A;  1G59 A;  1U9N A;  4D0P A;  3E5X A;  2HKO A;  4QPQ A;  4R1H A;  4A3K J;  3KZI C;  2DPD A;  1WJ5 A;  2CMP A;  3OYJ A;  1MIJ A;  3SFZ A;  3WU0 A;  3BR6 A;  2QQB A;  2QEN A;  5FKO A;  4L0Z B;  2OJE D;  4G8X A;  4Y15 A;  4HF0 A;  1R5H A;  4YFK F;  1OYW A;  3H0G J;  1BR1 A;  3DQV C;  3ZMU A;  3M1E A;  3I55 I;  1YJ9 I;  2LY9 A;  3TQN A;  4A3B J;  1O3Q A;  2X1E A;  2VKD A;  1FNN A;  2HI3 A;  3CES A;  1JXS A;  3B6A A;  4V2G A;  4A3J J;  4EVI A;  1NHA A;  2HR3 A;  3T0Y A;  1AWC A;  2RNG A;  4R8H A;  4XIC A;  1BC7 C;  1ZQ3 P;  2K9S A;  4B4C A;  5HS9 A;  1HST A;  4RM2 A;  2W25 A;  3G3Z A;  3GTQ J;  2DQR A;  4C9Y A;  5B3S H;  4IVN A;  2M2E A;  5D6E A;  1YW7 A;  3OS0 A;  3HOX J;  3HRM A;  2V1X A;  1FOY A;  1GV2 A;  2PLY A;  2DOA A;  3N4M A;  1SFO J;  1MMG A;  3LNQ A;  2E36 A;  4ZDL A;  3L2R A;  2IA0 A;  4XKV A;  2DFI A;  4BQQ A;  3HKZ N;  1T98 A;  2VJ4 A;  1LE8 B;  2HXI A;  1G8X A;  2JT1 A;  4AIJ A;  3AG4 H;  5IYD J;  2IRF G;  3JAM Z;  1MMS A;  3GTM J;  5BPD A;  4O6J A;  1BBY A;  5LFA A;  3CCS I;  3BLY A;  2QM3 A;  4XBF A;  4J19 A;  2LFB A;  3P5J A;  2W24 A;  1ZGA A;  4YRV A;  3S16 J;  4CUG A;  3BG5 A;  2IGM A;  2FOK A;  1XTA A;  1W36 D;  2O6G E;  2XRN A;  3GME A;  1YLF A;  2I5U A;  2JRM A;  1XB4 A;  4IKF A;  5JFR A;  1UHM A;  1OYY A;  2LRE A;  2CQX A;  3VPR A;  3K4J A;  2YSR A;  2KPM A;  1TWH J;  3TDZ C;  2EFW A;  2NVX J;  2MH2 A;  2DA1 A;  3DP7 A;  3H9G A;  4MIM A;  1D3Y A;  2CW7 A;  3AG2 H;  4RAF A;  4IX7 A;  1FTT A;  3K1N A;  1USS A;  2HZD A;  1BW6 A;  4HSR A;  5M5W J;  3DBH B;  2LY2 A;  2QCO A;  2WV0 A;  5J6X A;  4ZYG A;  1VI0 A;  1U8B A;  2DQL A;  1OCP A;  2F4I A;  1UCR A;  3G1M A;  4QIW N;  4M3D A;  4KMU X;  1SFX A;  1V5F A;  3L9F A;  4U0V A;  2XB5 A;  2MLK A;  4I02 A;  2MW8 A;  3OYK A;  4BKX A;  1WRJ A;  2W57 A;  3KPH A;  4FX0 A;  2DA4 A;  3O8H A;  1WI9 A;  4L5I A;  3ZQF A;  5B66 C;  3AL0 B;  2MC3 A;  4K2E A;  3R60 A;  1WI3 A;  4KIB A;  3ABU A;  1ETO A;  1LDK B;  2WB1 A;  4BJ6 C;  2GA1 A;  5HS7 A;  3QOD A;  1ZH5 A;  2VI6 A;  4PGG A;  2K5C A;  3ZQ7 A;  3GYH X;  2K3F A;  2PG4 A;  3HIF A;  4XLN F;  3WU2 C;  5E1Z B;  3BG3 A;  2WBM A;  1LFP A;  3E6C C;  3RCO A;  3K70 D;  2A6T A;  2HOS A;  3ABM H;  2M4G A;  3HOU J;  2DFE A;  1W7P A;  1A36 A;  1MBH A;  1FX7 A;  1F9N A;  5E1W A;  1N25 A;  4M73 A;  2EFN A;  2HQ5 A;  2GM4 A;  4BQA A;  4BBS J;  2KIF A;  1WJA A;  4LG3 A;  2EWN A;  5L3F A;  4U0W A;  3CZ6 A;  4II2 A;  2VON A;  4HX8 A;  1BOB A;  3A1Y A;  5CVJ A;  3GX4 X;  2XDV A;  2IS1 A;  4CCM A;  1DU0 A;  1NG6 A;  3EPZ A;  4CXF A;  2M3A A;  1T0F C;  3ROU A;  4LIT A;  1X3W B;  4EJW A;  5DYM A;  5KHD A;  4ENN A;  5ERI A;  1WPK A;  2QA4 I;  1WJF A;  2R7D A;  1A6Q A;  1JUS A;  5HDK A;  2ME6 A;  3VYS B;  2ID6 A;  2X6X A;  3CC4 I;  1FOK A;  1YTY A;  4IO9 F;  2XAF A;  3S2D J;  1J0R A;  4MEX F;  4XRS A;  2XAU A;  1QA6 A;  1I50 J;  2ISY A;  4DZP A;  1IXR C;  1MNM C;  4BJT A;  4IHS A;  1YYV A;  1CF7 B;  5J4Y A;  3HOT A;  2DBB A;  3LSP A;  5B1B H;  1E0E A;  3PIO F;  2MSY A;  4LG0 A;  3O3K A;  3FKI J;  4MO7 A;  2HVS A;  1OCZ H;  2ZSH B;  4XNF A;  2HOA A;  1IGN A;  3S3M A;  1I1S A;  4DZJ A;  4Y13 A;  5CVR A;  4DJA A;  5ICG A;  5BMZ A;  1WJE A;  2LYC A;  1IV8 A;  2V79 A;  1X2M A;  1S8N A;  2L9V A;  1YIJ I;  3VYR B;  1ZEL A;  5FLV A;  2DTZ A;  4CSW A;  4FCY A;  1HDP A;  2FMY A;  5GAH J;  2ZME B;  1ETX A;  3KZY A;  1IF1 A;  3TKY A;  5JVG F;  2W7N A;  3QPL A;  2IW5 A;  1RES A;  3S2H J;  1OCC H;  2BW3 A;  2DCE A;  2Q8K A;  2ME0 A;  3WTV C;  1R49 A;  1CQT A;  4DBR A;  2F4M B;  3WGH A;  3C1D A;  2KHM A;  2AXL A;  3S14 J;  1FP2 A;  5F0H A;  3K0L A;  3ZPL A;  4ESB A;  2XGX A;  5E8I A;  1XSX A;  4P1W A;  1XCB A;  3GLL A;  4QSH A;  3JR9 A;  2KL4 A;  2ZKZ A;  4JP0 A;  1GHC A;  3HBL A;  1TT5 B;  2JTV A;  3TMO A;  5D4S A;  3BTC A;  2V6C A;  4F52 A;  4BDZ A;  4LGW A;  3KLN A;  2PX9 A;  1HOM A;  2X85 A;  4A93 J;  5FB2 A;  1WWX A;  1V5G A;  4JOM A;  4XKB A;  5GAE J;  3I58 A;  1SC7 A;  3OR1 C;  1EH6 A;  1ZGW A;  2EV0 A;  1ERD A;  2YUS A;  3FZV A;  1X3Z B;  2XHK A;  3IWZ A;  4BDY A;  1ZRC A;  1YJW I;  3RKX A;  3CTA A;  3I71 A;  2J5P A;  2LTP A;  2ZJ2 A;  3BPV A;  5F1R A;  1QPI A;  1MBF A;  2FEZ A;  4Y7N J;  3DWL E;  1LVA A;  4IHW A;  3QPT A;  2G9W A;  3QOE A;  2L02 A;  1R6R A;  3V42 A;  5FO5 A;  3IP4 B;  4OWR B;  2MD5 A;  4CHU A;  3FKJ A;  1QVU A;  2ICW G;  4RGR A;  3F8B A;  3DTK A;  5K7H A;  2PJR B;  1IDY A;  3CC2 I;  5C44 J;  1FPQ A;  1ZG3 A;  4WCG A;  2EA4 A;  3BOQ A;  3WGI A;  2QKM B;  1TNT A;  1PUF B;  4C30 A;  3TW6 A;  3RZO J;  4DW6 A;  1O4X A;  2B0L A;  2AXT C;  3SEQ A;  3E3V A;  1JUM A;  1MD0 A;  3I3L A;  2O61 A;  2XGD A;  5ICE A;  3HL2 A;  2VQG A;  5CQE A;  3WTT C;  1FOX A;  2WAD A;  4AU7 A;  2LF7 A;  1RC9 A;  2M34 A;  2PBI A;  3BWG A;  4AWX B;  2JA2 A;  1MSF C;  2F5V A;  3H5R A;  5KCM A;  4C3I J;  4EM0 B;  2BE5 F;  2R7W A;  1Z21 A;  1RPW A;  3EYI A;  5HNF A;  4B47 A;  4A3F J;  1LFU P;  2UV1 A;  4I0B A;  3I9V 2;  3F22 A;  3FM3 A;  2KJB A;  4KDP A;  2VKH A;  3KLO A;  3A01 A;  3BR5 A;  2HU9 A;  3CJT B;  4ENM A;  3MMY B;  4XRF A;  1B9M A;  1LPQ A;  2DJN A;  5J8C A;  4FE4 A;  4HLX A;  4ZZL A;  2KIS A;  3H5A A;  5DDG A;  2JPC A;  1TTY A;  2ECB A;  1MH4 A;  5CLS A;  1YIT I;  1X3U A;  1Y6I A;  5C4X J;  4PUS A;  5TJJ A;  2DO7 A;  3AG3 H;  5E1X A;  1X1D A;  2KMU A;  3M07 A;  3EDP A;  4UUV A;  3OYD A;  2FX0 A;  5E18 F;  2K7L A;  4U87 A;  1RUO A;  1ZN2 A;  1WJD A;  4WF2 A;  3JAM K;  3DV8 A;  4ANJ A;  2DPU A;  3J7A O;  3ZOB A;  5FRM A;  4RS8 A;  2CO5 A;  3T8T A;  4CCO A;  2V1D A;  2Y0M A;  1DQU A;  3HJE A;  5FLX K;  2EFP A;  5DEQ A;  4RB0 A;  3KFW X;  3TP0 A;  2HPM A;  3T1B A;  1YW9 A;  4L5E A;  5IOY A;  3C18 A;  5JVT A;  2DT7 B;  1R1U A;  3M8F A;  1ZR4 A;  2FF4 A;  1PVE A;  2LKX A;  3FDY A;  2DDB A;  1YJN I;  4A0X A;  3S1M J;  2OCE A;  5KAF C;  3HTU A;  1YE9 A;  5F27 A;  2XSD C;  2X1D A;  2R7Z J;  4XMY A;  4XQF A;  2VAS A;  1A5J A;  4JK1 X;  4A3C J;  5C3E J;  5JR3 A;  1YX5 A;  5CVV A;  2N8G A;  1FYM A;  4IEJ A;  3L7W A;  2Q2E B;  1W5C C;  3DXJ F;  4BE0 A;  5EYR A;  5IP6 A;  2IP2 A;  4CO8 A;  2WAQ N;  2MH9 A;  2E1M C;  2VT3 A;  4CYC A;  3HSE A;  4M72 A;  1GXQ A;  2DLL A;  4M71 A;  3AAF A;  1ETV A;  1SD4 A;  3ECO A;  4BEH A;  4HV6 A;  2STW A;  2DA6 A;  4P96 A;  1SD7 A;  1Z91 A;  3BPX A;  2L7Z A;  4HZF A;  4L9N A;  5EEH A;  1Z6R A;  2M87 A;  2V9P A;  1HLV A;  1JJ8 C;  3CJQ B;  2LNB A;  4DQ2 A;  1Y8Q B;  4RB1 A;  1U78 A;  2BVL A;  3JTG A;  4PDK A;  2CQK A;  2E2J J;  4P5O A;  3KCC A;  3SEZ A;  2HXO A;  3VSL A;  1ZLJ A;  4CGZ A;  1HKQ A;  3R61 A;  2D5V A;  1XC5 A;  2MFZ A;  3RQ4 A;  1PUE E;  3E6D A;  2Q0O A;  3RDI A;  4LLL A;  3QU6 A;  1T39 A;  1KU7 A;  3CUO A;  2CV2 A;  2ZNY A;  4KMF A;  2CRG A;  2NS8 A;  3TBI A;  2EIJ H;  3SXY A;  5DCM B;  1R71 A;  5LHI A;  3LSG A;  3F8F A;  2WWY A;  4UB8 C;  3ZQL A;  2K27 A;  1ETY A;  4I76 A;  4UXN A;  2P81 A;  1IO2 A;  3F8M A;  4XLH A;  3ASN H;  5GAG J;  4LIU A;  3K7A J;  4HF1 A;  5HS8 A;  2P8T A;  3DBL B;  2ZJP F;  3VSK A;  4G9Y A;  2RKH A;  1G3Y A;  1HSJ A;  3S3O A;  4FIS A;  3ZN0 A;  4G6Q A;  2ACJ A;  4Y33 A;  4BHP A;  1JUP A;  2XAQ A;  1WGX A;  2Z5U A;  3BZ6 A;  3GZ5 A;  1X58 A;  4XLC A;  5EGO B;  1U5T B;  3PNY A;  3GTJ J;  3T5X A;  1Z7L A;  3ECH A;  1KA8 A;  3HGG A;  1GVD A;  3F8N A;  4A3L J;  3FXK A;  2HZT A;  3CCM I;  1ZHF A;  1OJL A;  3K2Z A;  3I5U A;  1P2F A;  3SZG A;  1JGS A;  3WG9 A;  3CCV I;  1SVO A;  3VDX A;  4S05 A;  1X1B A;  3RJP A;  1JJ6 C;  5H2F C;  1B8I B;  1ORK A;  1R5G A;  4OIQ F;  2IT0 A;  3CDI A;  2JA6 J;  1YFH A;  3JRB A;  4BBR J;  4BAY A;  3LAP A;  4LIV A;  5DCF A;  4B3X A;  1FJL A;  2OU2 A;  5GTH C;  5FKL A;  3BCA A;  3ABK H;  3D1N I;  4M3G A;  1K4S A;  2WAF A;  5E8G A;  1TQP A;  3MAJ A;  4HNU A;  1P9Q C;  4XKC A;  1UMQ A;  1P6R A;  2KRH A;  5LGU A;  1HDD C;  2VOO A;  3LQR A;  1FIP A;  4N9H A;  3SJM A;  1LDJ A;  2KFD A;  3C2G A;  2BY2 A;  3HHH A;  3F6O A;  3PFI A;  4MGR A;  2DOF A;  4KIG A;  1XGS A;  2XRL A;  4EV0 A;  1SVL A;  4WK8 F;  4H0E A;  1H89 C;  4G6T B;  1E3H A;  3IL2 A;  5J40 A;  1OR7 A;  1YI2 I;  3PM1 A;  4LOC A;  3WE3 A;  2VE8 A;  3GW2 A;  1RKT A;  4E7S A;  3P9C A;  5H6R A;  2B9S A;  2DAO A;  2ZXJ A;  2RRE A;  2F4O B;  3RPU D;  1K4T A;  4ABZ A;  1AKH A;  4KFC A;  3S2W A;  5BOX A;  2Z2S B;  5ILS A;  3Q0V A;  3MKY B;  5L3D A;  2QQA A;  3FXR A;  3BG9 A;  2KP6 A;  2XGC A;  2ZJR F;  1T8I A;  2YX4 A;  2BHZ A;  4EEF G;  3B6C A;  1STZ A;  1FIA A;  2IBD A;  4L0Y B;  1ZKG A;  1MZB A;  2O7O A;  1H88 C;  1QZZ A;  1VQ8 I;  2VXD A;  1R4M B;  1ZR2 A;  1JKO C;  3WTX C;  1K61 A;  1NK2 P;  1X4P A;  2RC4 A;  4GCV A;  3WOD F;  2ZFU A;  2VC0 A;  3E5Q A;  3KP5 A;  1K6O A;  2CJJ A;  4XOR A;  1Z9C A;  3CCU I;  3TP3 A;  1S3J A;  1WJB A;  2E71 A;  5B1A H;  3A02 A;  3HRS A;  1UG2 A;  2A61 A;  2B63 J;  2VPL A;  3Q9V A;  1YS6 A;  3ZMZ A;  4XR6 A;  2L54 A;  1XMK A;  3DEW A;  1QPM A;  3DPL C;  2FBI A;  4ITV A;  3CUQ B;  3NAR A;  1S9H A;  5FGM A;  4IRG A;  3HTS B;  1XS9 A;  4Y52 J;  1S7O A;  4HBL A;  5FFZ A;  1FZP B;  1ACI A;  1QVT A;  4XLE A;  1MBE A;  3OS2 A;  2KJC A;  2YS9 A;  4XLA A;  4RDU A;  1RUN A;  2F5C A;  2KLO A;  5F64 A;  3S8P A;  2GXA A;  2VBX A;  2VQL A;  1MMA A;  4HPQ A;  3HEF A;  2O8K A;  3KP7 A;  2DT6 A;  3WTW C;  2QSH X;  4BE2 A;  2W00 A;  3P9K A;  1QQI A;  3DPT A;  3OYB A;  1JHH A;  2CV0 A;  4G12 A;  3M7G A;  3MWM A;  4LK0 F;  3Q0W A;  1P4X A;  4PFO A;  3FHZ A;  2H27 A;  2PN6 A;  1BI2 A;  5IYB J;  2OZU A;  2KDO A;  1QBJ A;  3WU1 B;  4E7Z A;  1HW1 A;  2F2E A;  1W5T A;  1YHQ I;  1TZL A;  2LF8 A;  1XDU A;  1WHU A;  2G7H A;  3CLO A;  1FMW A;  2JA7 J;  1FC3 A;  1V4R A;  1R00 A;  1UB9 A;  4A2U A;  2R7X A;  3G71 I;  2DJI A;  1CF7 A;  5J3L A;  3FXM A;  1TWF J;  2YU9 J;  1B72 B;  2JMW A;  1MBK A;  3GTO J;  4BY1 J;  1SAX A;  4RGX A;  1VQ9 I;  2EFQ A;  3ASO H;  1MKM A;  2DOD A;  1REP C;  5L3G A;  1GT0 C;  3FXJ A;  4NC8 A;  1NG7 A;  1MNE A;  1XD7 A;  4BXF A;  1X2N A;  1IG7 A;  2K9M A;  2AQF A;  2EQR A;  1VQM I;  2O3F A;  4PSW A;  2I10 A;  3SHF A;  4KT5 C;  2A05 A;  5FLM J;  5EEA A;  2I8D A;  3MEX A;  2R4G A;  1QHH D;  4RM3 A;  3PIP F;  2HVR A;  2MLG A;  3K4B A;  3HPH A;  1MDM A;  2A5W A;  1ETW A;  2X6Y A;  4M6V A;  3U1D A;  4GFB A;  2DA2 A;  5DM7 F;  3AG1 H;  1F36 A;  3IV5 A;  3H92 A;  1UFM A;  3ZN1 A;  2EZH A;  5M3F J;  4XRM A;  1XGM A;  1MH3 A;  3LA3 A;  5AIQ A;  2HPI A;  1OLT A;  1B4A A;  4P55 A;  3MVP A;  2PMZ N;  3OYG A;  2R0Q C;  3CF2 A;  2UZK A;  2E34 A;  1ENH A;  2P7C B;  2Z9O A;  1U2W A;  2W1O A;  4CA0 A;  3S3N A;  2BXY A;  3MD2 A;  4BHB A;  3OIO A;  4CIC A;  2EFO A;  4AD9 A;  3WTU C;  3LFU A;  2Y0S N;  3K1M A;  1B59 A;  3IAM 2;  2HQR A;  1VQN I;  4A0Y A;  2COM A;  1O3T A;  1G3W A;  5EDN A;  2UWM A;  2L9R A;  4M9S A;  4FX4 A;  4C3J J;  5FLX Z;  3DLA A;  4U7D A;  5JHF A;  4XON A;  3RZD J;  3ESW B;  3G1O A;  2LKS A;  1BJZ A; 
#chains in the Genus database with same CATH homology
 2DK8 A;  2MBF A;  1SD5 A;  3MQ0 A;  1FLI A;  2OQG A;  4KNY A;  5DV5 A;  3W6K B;  1L0O C;  3MFK A;  3IRR A;  4O3M A;  2GZW A;  4BXU A;  4LMY A;  2F5F A;  1J2X A;  1IW7 F;  1ZRF A;  1IN7 A;  2TDX A;  1F1Z A;  3E6B A;  3SZT A;  3F21 A;  5LHG A;  3Q9S A;  2K4J A;  1XSV A;  3ZMT A;  1ZYR F;  4HF2 A;  2PQ8 A;  2JZY A;  5HVQ C;  1H0M A;  1KGS A;  1FBQ A;  4N0B A;  2KKO A;  3I64 A;  4NHJ A;  2PMU A;  1LJ9 A;  2D1V A;  4M6Y A;  3VB2 A;  1H9T A;  5CVU A;  4L5J A;  3ELK A;  4WWC A;  1KYW A;  2ZBK A;  3NEU A;  2HKX A;  4M74 A;  3I4P A;  5D8L B;  2FQ3 A;  2HWV A;  3ULQ B;  3MZH A;  4LK1 F;  4G6D A;  4I98 B;  4BHC A;  3Q5F A;  2VE9 A;  2Q2E A;  3OOP A;  4I0A A;  2CGP A;  4ESF A;  2ZFW A;  4UNO A;  5D4R A;  3HRU A;  5K5R A;  1A04 A;  1TQM A;  4Q47 A;  4OMZ A;  5H20 A;  3R0A A;  3LQQ A;  5E17 F;  4HQM A;  3RKW A;  1YIO A;  3EYY A;  1O7L A;  2XUB A;  4L9T A;  1KU9 A;  5L3C A;  2ESH A;  4MHG A;  5D8K B;  1K78 A;  2G7U A;  4EJO A;  2RGV A;  1ONV A;  3IKV A;  2O0Y A;  4UHT A;  3GFM A;  5A2Q Z;  2M45 A;  4S04 A;  5HLG A;  1ZLK A;  2NS0 A;  2PEX A;  1BJA A;  1WQ2 A;  5DD8 A;  1IN6 A;  1BC8 C;  5FFX A;  2Z3Y A;  4WXC A;  3GO5 A;  1U3E M;  1EV7 A;  1UST A;  2NYX A;  4BYY A;  1IRF A;  5LRS A;  1TW3 A;  2Z33 A;  4IRH A;  4MEY F;  2ESN A;  1JHF A;  1DPR A;  2RQP A;  4A0Z A;  3CO7 C;  2CSO A;  3R4K A;  3K1P A;  4ASN A;  1J59 A;  4P9U A;  3GVA A;  1S7A A;  3V7S A;  4MNU A;  4G7O F;  3V8K A;  1U8R A;  2XVC A;  3BP8 A;  2EK5 A;  3HSF A;  2BEO A;  3LAJ A;  3OV8 A;  3FXU A;  1KU3 A;  2WC2 A;  3DF8 A;  2ADU A;  3ISP A;  4HDU A;  2FBH A;  1FBS A;  1I1G A;  4IJA A;  3RPQ A;  2AS5 F;  2NAZ A;  1J7K A;  3FWE A;  3BJA A;  4AIK A;  3IHU A;  2GXB A;  1BOA A;  1W7P B;  1DP7 P;  6PAX A;  1HQC A;  1FYL A;  1BN5 A;  2OD5 A;  1PP8 F;  2K86 A;  4LJZ F;  1QZY A;  2A69 F;  2E7W A;  3TO9 A;  3F8C A;  2NRA C;  2M5W A;  4FHT A;  3EET A;  3VOE A;  2GA2 A;  2E1N A;  2QBY B;  4L9J A;  2OAZ A;  4GO1 A;  4ZYD A;  1V3F A;  2HTJ A;  5HOO A;  2F5E A;  4MTD A;  2XRO A;  2GAU A;  5CVI A;  2O03 A;  3HUG A;  4G7Z F;  1YO5 C;  5LEJ A;  5D5W B;  4XSX F;  3CUQ A;  3V7R A;  3DFG A;  2XV4 S;  1XCV A;  3HYI A;  3ERE D;  2D1H A;  4ENK A;  1S29 A;  1O3R A;  2A68 F;  1SMT A;  3W6J B;  4F7Z A;  1J5Y A;  2J5O A;  1Z7U A;  2VC1 A;  3QRF F;  2UXN A;  1F5T A;  4P9F A;  4KN4 X;  2CG4 A;  4RGS A;  2FRH A;  3J81 K;  1UHW A;  1KQ0 A;  1IZ1 A;  3ML6 A;  3VEP A;  1ON2 A;  4M9Z A;  2IVM A;  2LDU A;  2YPR A;  3C7J A;  1CGP A;  5J8F A;  1WSU A;  4HX7 A;  2ISZ A;  2EB7 A;  5LGT A;  3ZMV A;  2OZ6 A;  1FBU A;  3E97 A;  1PP7 U;  2OA4 A;  3REO A;  3J80 Z;  2XAG A;  1P92 A;  5BS6 A;  3TDU C;  5LRR A;  2CFX A;  2D45 A;  2FE3 A;  1G4D A;  4WXD A;  3KP6 A;  3I0T A;  3RTR A;  3RIR A;  4U0Y A;  4NB5 A;  2HOE A;  2VN2 A;  5K5Q A;  3GWZ A;  2P7V B;  3RPU A;  2P5V A;  1RZ4 A;  3RYP A;  1FT9 A;  2P6S A;  1GXP A;  3LST A;  4KA4 A;  5JHU A;  1LDD A;  1R23 A;  1S6L A;  2QYO A;  4NQW A;  5A2Q K;  2F5D A;  3QP5 A;  5HDN A;  2FML A;  4QWQ A;  3HOS A;  2P5L C;  4AVP A;  4ENJ A;  5HDG A;  2RNJ A;  2O8X A;  4EJU A;  3H3Z A;  4OIN F;  4BH9 A;  2VXZ A;  3B02 A;  2RV8 A;  4XLP F;  3FF5 A;  5KK1 A;  1OPC A;  3ZMD A;  1R7J A;  2KRF A;  3HRT A;  3PQK A;  2IPQ X;  1IUY A;  2HQN A;  4MTE A;  1IN5 A;  3JSO A;  5AIP A;  3CUQ C;  1R1T A;  3WE2 A;  2EJR A;  1IXS B;  1T2K A;  1GVJ A;  3COA C;  3IRQ A;  3I54 A;  4A5M A;  2P4W A;  3FMQ A;  3TO6 A;  2IJL A;  2LSO A;  4UVA A;  3L2C A;  1B1B A;  3LWF A;  1K79 A;  2M1B A;  2PFB A;  2V1U A;  2DK5 A;  2CWE A;  2QWW A;  2P5K A;  3QOP A;  1P4A A;  2DI3 A;  5EEG A;  3G73 A;  2QZ8 A;  4A6D A;  4M6X A;  2YX7 A;  4B8X A;  2CW0 F;  5BQT A;  1QNT A;  5DUI A;  4KIC A;  3CJN A;  2XKP A;  1Q1H A;  2HYF A;  4YII A;  2CYY A;  2BBY A;  2ETH A;  2Z99 A;  1FSH A;  2W85 A;  4RGU A;  3GFI A;  4B09 A;  3GUD A;  5K1Y A;  1BI0 A;  3M9A A;  3CDH A;  4U7B A;  3VFZ A;  3NQO A;  2ZME A;  2OQR A;  1B9N A;  3GF2 A;  1F4K A;  1MGT A;  4EMS A;  2VBZ A;  4HV5 A;  1L3L A;  4LD5 A;  3V4G A;  5FD5 A;  2GXG A;  4UVC A;  1Z6T A;  1VTN C;  3R6S A;  3WTY C;  2EA2 A;  2DW4 A;  5DD4 A;  5H6Q A;  4RAY A;  5DUK A;  2A5Y B;  3U2R A;  2L01 A;  1SMY F;  3EQL F;  3RKY A;  4Q5S F;  3TGN A;  2KIU A;  3N97 A;  2ZO4 A;  1O57 A;  1D8K A;  4KUM A;  3V7C A;  1ULY A;  2HS5 A;  5LEK A;  1TBX A;  3QPH A;  5ICF A;  5D5X B;  3GXO A;  2C6Y A;  3SQN A;  3V8L A;  2XAJ A;  2UXX A;  3MCZ A;  4YG2 F;  3VOD A;  2L4M A;  1I27 A;  1Z05 A;  3MZY A;  3L09 A;  3SZP A;  2YR2 A;  1FYK A;  4HOB A;  3TOB A;  2QUF A;  4HAM A;  4HQE A;  4GYI A;  2BYV E;  3EUH A;  2FBK A;  4GXO A;  1Y0U A;  5IT9 K;  1SFE A;  2HYG D;  3J80 K;  2XAS A;  3B73 A;  3GLX A;  1H9G A;  1BM9 A;  2HDC A;  2JSC A;  2XIG A;  1XDS A;  4L18 B;  5L3B A;  1EH8 A;  1LNW A;  3GEZ A;  4BNC A;  1RNL A;  4CDG A;  2E1C A;  4R79 A;  4LFU A;  4I01 A;  5CYV A;  3RYR A;  1K7A A;  4Y17 A;  1W4M A;  2STT A;  3BDD A;  3KET A;  2A07 F;  1OYI A;  5D5U B;  3J81 Z;  4UV8 A;  3KE2 A;  1DPU A;  4M9X A;  2NNN A;  3QP6 A;  3O6B B;  3U9G A;  3LA7 A;  4KIF A;  4HLY A;  2VOP A;  1YW8 A;  2QBY A;  4O5V A;  5L3E A;  3TO7 A;  5LBQ A;  1T6S A;  1D8J A;  1W7P D;  1YG2 A;  3DKW A;  1O3S A;  3F3X A;  5E20 A;  2R3S A;  1E17 A;  4A12 A;  3KEO A;  2K02 A;  4N9I A;  1HXD A;  3I59 B;  1XN7 A;  1T38 A;  3KP4 A;  2NNY A;  4DNC A;  5FD6 A;  3JTH A;  3FM5 A;  3HHG A;  1LEA A;  2GIV A;  4JBA A;  1MDM B;  3F23 A;  2EV5 A;  1ZAR A;  4EM2 A;  2QQ9 A;  1IXC A;  2JPB A;  2FU4 A;  2PMH A;  2K4B A;  5IT3 A;  5KVR A;  1SD6 A;  4OIR F;  1LQ1 A;  2QVO A;  4RAZ A;  1O7F A;  5DCM A;  1TNS A;  2L4A A;  1G3S A;  2JRT A;  1BIB A;  1OMI A;  2DTR A;  5ILU A;  2RVC A;  3BRO A;  5D5V B;  3DEU A;  4OIP F;  4LLN A;  1U5T A;  4EJT A;  5LHH A;  3NRV A;  5HLI A;  1AOY A;  1ON1 A;  2GQQ A;  1DDN A;  3CO6 C;  2VT2 A;  2A3S A;  4ZYE A;  3PQJ A;  4EGZ A;  3D0S A;  3GFJ A;  3C3W A;  2M30 A;  4L9V A;  3O2P E;  3KP3 A;  2IA1 A;  3KZZ A;  2RDP A;  4LB6 B;  4TV7 A;  3E6M A;  2YU3 A;  4I7H A;  1XMA A;  3E5U A;  2V9V A;  1ZG1 A;  5K5O A;  4UVB A;  3QAH A;  4E70 A;  5JI6 A;  1QGP A;  2R7F A;  2H94 A;  1C0W A;  4ON0 A;  1IRG A;  3WTS C;  4I2O A;  4LB5 A;  4U88 A;  2H09 A;  3LA2 A;  2FNA A;  3QU3 A;  1HKT A;  1HKS A;  3K69 A;  5ED4 A;  3V8J A;  2WTE A;  3IKT A;  2PJP A;  2X0L A;  4RB2 C;  5ILV A;  1LEB A;  4HYE A;  1YQA A;  1J75 A;  1ZG5 A;  1HW2 A;  1RI7 A;  2DU9 A;  1G6N A;  2E7X A;  4UV9 A;  1I6X A;  3H3U A;  4IRI A;  4XSZ F;  2FXA A;  5LGN A;  3ZMS A;  1EH7 A;  1KQ8 A;  4LG0 B;  4IXA A;  4ETS A;  1R58 A;  1R22 A;  2ZCW A;  4HW0 A;  1Z1D A;  1FWZ A;  1FY7 A;  2D2W A;  2H6B A;  2RN7 A;  3ZP5 A;  1FP1 D;  2L3D A;  3HSR A;  2FSW A;  4JQF A;  3K9T A;  4WX9 A;  1OKR A;  3R0J A;  5LLQ A;  2HFH A;  3LFK A;  5BPI A;  3WTZ A;  3BY6 A;  1IN8 A;  3TOA A;  2Y48 A;  2H6C A;  4ZH4 F;  4OOI A;  1K78 B;  3BJ6 A;  4WXH A;  2IA2 A;  4MQ9 F;  5AON A;  1QO0 D;  4PZJ A;  5D6F A;  4OIO F;  3JW4 A;  1U6G A;  3KP2 A;  1TLH B;  1ZRE A;  4CYD A;  4HX4 A;  1BI3 A;  3RI4 A;  5IT9 Z;  1D5V A;  1G3T A;  1U5T C;  3JSP A;  4IPA A;  1MJB A;  3FMS A;  4EGY A;  4Q4Z F;  1KU2 A;  4YFX F;  1TQI A;  3FX3 A;  3IC7 A;  4A6E A;  4LLG F;  4FT8 A;  1B6A A;  1BI1 A;  2KIM A;  4G7H F;  3F6V A;  2LKP A;  2ZNZ A;  1XSD A;  1KYZ A;  4GYG A;  2P6T A;  4YIF A;  1LB2 A;  4EJV A;  2GWR A;  3I53 A;  2HTS A;  1E2X A;  2A6E F;  1ODD A;  1IN4 A;  1J9I A;  3F72 A;  5CJ9 A;  1TW2 A;  1HBX G;  1HW5 A;  2X4H A;  1ZAO A;  3WGG A;  3IWF A;  3GZ6 A;  4EM1 A;  2OBP A;  1KQ9 A;  1IAW A;  1PDN C;  1R36 A;  1R1V A;  1XGO A;  3T8R A;  4CZZ A;  1DUX C;  1SFU A;  1FSE A;  4EQQ A;  4I09 A;  1P4W A;  4AIH A;  2BGC A;  2PI0 A;  4ZYH A;  2QLZ A;  3GFL A;  4RB3 C;  3P7N A;  3L00 A;  4A5N A;  2EV6 A;  2BV6 A;  2M8E A;  4Z2Y A;  4G94 A;  2FNP A;  2VBW A;  4PGH A;  4GGG A;  4HDV A;  1ZGJ A;  1YS7 A;  5F6F A;  4IF4 A;  4YFN F;  3FMR A;  2MA3 A;  3P9I A;  1RIO H;  3ABT A;  5ICC A;  2HGC A;  4ESJ A;  1W5S A;  2XAH A;  4Q48 A;  4KYW A;  3FXQ A;  5TRD A;  2W84 A;  4KN7 X;  2DT5 A;  1XGN A;  4ZZD A;  1ZRD A;  3M8E A;  4MQV A;  1MJA A;  5HLH A;  1WKM A;  4QLC U;  4OMY A;  2A6H F;  4OU0 A;  1T0F A;  2HEO A;  2VBY A;  4PCQ A;  4IHT A;  4HA8 A;  2Y75 A;  1MJ9 A;  2FA5 A;  2VOD A;  3BJO A;  2ELH A;  1JE8 A;  2XKO A;  3D5L A;  3KEQ A;  1I5Z A;  1BIA A;  3I59 A;  4D0P A;  3E5X A;  2HKO A;  4R1H A;  2DPD A;  3SFZ A;  3WU0 A;  2QQB A;  2QEN A;  4L0Z B;  4G8X A;  4Y15 A;  4HF0 A;  1R5H A;  4YFK F;  1OYW A;  3DQV C;  3ZMU A;  3M1E A;  3TQN A;  1O3Q A;  1FNN A;  1JXS A;  4EVI A;  1NHA A;  2HR3 A;  3T0Y A;  1AWC A;  1BC7 C;  4R8H A;  5HS9 A;  1HST A;  2W25 A;  3G3Z A;  2DQR A;  4IVN A;  5D6E A;  1YW7 A;  3HRM A;  2V1X A;  2PLY A;  3N4M A;  2IA0 A;  2DFI A;  1T98 A;  2JT1 A;  4AIJ A;  2IRF G;  3JAM Z;  5BPD A;  4O6J A;  1BBY A;  4XBF A;  2QM3 A;  2W24 A;  1ZGA A;  2FOK A;  2O6G E;  2XRN A;  1YLF A;  1XB4 A;  5JFR A;  1UHM A;  1OYY A;  2YSR A;  3TDZ C;  2EFW A;  2MH2 A;  3DP7 A;  1D3Y A;  3K1N A;  1USS A;  2WV0 A;  5J6X A;  4ZYG A;  2DQL A;  1UCR A;  4KMU X;  1SFX A;  3L9F A;  4U0V A;  2MLK A;  4I02 A;  1WRJ A;  2W57 A;  4FX0 A;  4L5I A;  1WI9 A;  2MC3 A;  4K2E A;  3R60 A;  4KIB A;  3ABU A;  1LDK B;  2GA1 A;  5HS7 A;  1ZH5 A;  4PGG A;  3ZQ7 A;  3GYH X;  2PG4 A;  3HIF A;  4XLN F;  5E1Z B;  3E6C C;  1W7P A;  1FX7 A;  1F9N A;  5E1W A;  4BQA A;  4M73 A;  2EFN A;  2KIF A;  2EWN A;  5L3F A;  4U0W A;  2VON A;  4HX8 A;  5CVJ A;  3GX4 X;  4CXF A;  3ROU A;  4EJW A;  5DYM A;  4ENN A;  5ERI A;  2R7D A;  5HDK A;  1FOK A;  1YTY A;  2XAF A;  1J0R A;  4MEX F;  2ISY A;  1IXR C;  4IHS A;  1YYV A;  1CF7 B;  3HOT A;  2DBB A;  4LG0 A;  3O3K A;  1I1S A;  4Y13 A;  5CVR A;  5ICG A;  5BMZ A;  2V79 A;  1S8N A;  2FMY A;  2ZME B;  3KZY A;  1IF1 A;  3TKY A;  2IW5 A;  2Q8K A;  3WTV C;  3WGH A;  3C1D A;  2AXL A;  1FP2 A;  3ZPL A;  3K0L A;  4ESB A;  2XGX A;  5E8I A;  1XSX A;  1XCB A;  2ZKZ A;  1GHC A;  2JTV A;  5D4S A;  2V6C A;  4LGW A;  3KLN A;  5FB2 A;  1WWX A;  3I58 A;  1EH6 A;  2EV0 A;  3FZV A;  3IWZ A;  2XHK A;  1ZRC A;  3RKX A;  3CTA A;  3I71 A;  2J5P A;  2ZJ2 A;  3BPV A;  5F1R A;  2FEZ A;  1LVA A;  3QPT A;  2G9W A;  2L02 A;  5FO5 A;  2MD5 A;  4CHU A;  4RGR A;  3F8B A;  1FPQ A;  1ZG3 A;  4WCG A;  2EA4 A;  3BOQ A;  3WGI A;  1TNT A;  2B0L A;  3E3V A;  2O61 A;  1MD0 A;  5ICE A;  3WTT C;  2LF7 A;  3BWG A;  2PBI A;  4AWX B;  4EM0 B;  2BE5 F;  3EYI A;  4I0B A;  3F22 A;  3FM3 A;  2KJB A;  4KDP A;  3KLO A;  4ENM A;  4XRF A;  1B9M A;  5J8C A;  4HLX A;  4ZZL A;  5DDG A;  2JPC A;  1TTY A;  5CLS A;  1X3U A;  5TJJ A;  2DO7 A;  5E1X A;  3EDP A;  4UUV A;  5E18 F;  2K7L A;  1RUO A;  1ZN2 A;  4WF2 A;  3JAM K;  3DV8 A;  2DPU A;  3J7A O;  4RS8 A;  2CO5 A;  3T8T A;  2V1D A;  2Y0M A;  5FLX K;  2EFP A;  5DEQ A;  4RB0 A;  3KFW X;  3T1B A;  1YW9 A;  3C18 A;  5JVT A;  1R1U A;  3M8F A;  2FF4 A;  4A0X A;  3HTU A;  4JK1 X;  5JR3 A;  5CVV A;  1FYM A;  3L7W A;  3DXJ F;  2IP2 A;  4CO8 A;  2MH9 A;  2VT3 A;  3HSE A;  4M72 A;  1GXQ A;  2DLL A;  4M71 A;  3AAF A;  1SD4 A;  3ECO A;  4HV6 A;  2STW A;  4P96 A;  1SD7 A;  1Z91 A;  3BPX A;  4HZF A;  4L9N A;  5EEH A;  1Z6R A;  2M87 A;  2LNB A;  4DQ2 A;  4RB1 A;  1U78 A;  3JTG A;  4PDK A;  2CQK A;  4P5O A;  3KCC A;  1ZLJ A;  4CGZ A;  1HKQ A;  3R61 A;  1PUE E;  3E6D A;  2Q0O A;  3RDI A;  4LLL A;  3QU6 A;  1T39 A;  1KU7 A;  3CUO A;  2ZNY A;  4KMF A;  3SXY A;  5DCM B;  5LHI A;  3F8F A;  2WWY A;  2K27 A;  4UXN A;  3F8M A;  4HF1 A;  5HS8 A;  2P8T A;  4G9Y A;  2RKH A;  1G3Y A;  1HSJ A;  3ZN0 A;  4G6Q A;  2ACJ A;  4BHP A;  2XAQ A;  2Z5U A;  3BZ6 A;  3GZ5 A;  1U5T B;  3T5X A;  3ECH A;  1KA8 A;  3F8N A;  2HZT A;  1ZHF A;  3K2Z A;  3I5U A;  1P2F A;  1JGS A;  3WG9 A;  4S05 A;  3RJP A;  1R5G A;  4OIQ F;  2IT0 A;  1YFH A;  4BAY A;  3LAP A;  5DCF A;  2OU2 A;  5E8G A;  1TQP A;  3MAJ A;  1P6R A;  2VOO A;  5LGU A;  3LQR A;  4N9H A;  1LDJ A;  3HHH A;  3F6O A;  3PFI A;  4MGR A;  4KIG A;  1XGS A;  4EV0 A;  4WK8 F;  4H0E A;  3IL2 A;  1OR7 A;  3WE3 A;  2VE8 A;  3GW2 A;  3P9C A;  5H6R A;  2DAO A;  2ZXJ A;  4KFC A;  3S2W A;  5BOX A;  5ILS A;  5L3D A;  2QQA A;  3FXR A;  2YX4 A;  1STZ A;  4L0Y B;  1MZB A;  1QZZ A;  3WTX C;  2RC4 A;  4GCV A;  3WOD F;  2VC0 A;  3E5Q A;  3KP5 A;  1K6O A;  1Z9C A;  1S3J A;  3HRS A;  2A61 A;  3Q9V A;  1YS6 A;  3ZMZ A;  2L54 A;  1XMK A;  1QPM A;  3DPL C;  2FBI A;  3CUQ B;  5FGM A;  4IRG A;  3HTS B;  1S7O A;  4HBL A;  5FFZ A;  1FZP B;  2KJC A;  1RUN A;  2F5C A;  5F64 A;  2VBX A;  3KP7 A;  3WTW C;  3P9K A;  1QQI A;  3DPT A;  1JHH A;  3M7G A;  3MWM A;  4LK0 F;  1P4X A;  3FHZ A;  2H27 A;  2PN6 A;  1BI2 A;  2OZU A;  1QBJ A;  3WU1 B;  1HW1 A;  2F2E A;  1W5T A;  2LF8 A;  1XDU A;  2G7H A;  3CLO A;  1FC3 A;  1V4R A;  1R00 A;  1UB9 A;  4A2U A;  1CF7 A;  1SAX A;  4RGX A;  2EFQ A;  1MKM A;  1REP C;  5L3G A;  1XD7 A;  2O3F A;  3SHF A;  4KT5 C;  3MEX A;  2MLG A;  1MDM A;  3U1D A;  3H92 A;  1UFM A;  3ZN1 A;  1XGM A;  3LA3 A;  5AIQ A;  1B4A A;  4P55 A;  2UZK A;  2P7C B;  2Z9O A;  1U2W A;  4BHB A;  4CIC A;  2EFO A;  4AD9 A;  3WTU C;  3K1M A;  1B59 A;  2HQR A;  4A0Y A;  2COM A;  1O3T A;  1G3W A;  2UWM A;  4M9S A;  4FX4 A;  5FLX Z;  4U7D A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...