4ZZDA

Crystal structure of multidrug resistance regulator lmrr bound to riboflavin
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
104
structure length
98
Chain Sequence
PKEMLRAQTNVILLNVLKQGDNYVYGIIKQVKEASNGEMELNEATLYTIFKRLEKDGIISSYWGDRKYYRLTEIGHENMRLAFESWSRVDKIIENLEA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords TRANSCRIPTIONAL REGULATOR, PADR-LIKE FAMILY
publication title Binding of the Lactococcal Drug Dependent Transcriptional Regulator LmrR to Its Ligands and Responsive Promoter Regions.
pubmed doi rcsb
source organism Lactococcus lactis subsp. cremoris mg1363
molecule tags Transcription
total genus 36
structure length 98
sequence length 104
ec nomenclature
pdb deposition date 2015-05-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03551 PadR Transcriptional regulator PadR-like family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 4zzdA00
2QYOA 4Q47A 2BGCA 2J5OA 2KJCA 2D45A 1SFXA 3KCCA 4S05A 2CYYA 1CGPA 1LDKB 3BDDA 4A2UA 1D5VA 1BJAA 1B1BA 2X4HA 4DNCA 3U1DA 2ZO4A 5E8GA 2G7UA 2XIGA 3ZP5A 4L18B 4ENKA 2IA1A 2R7DA 1FYLA 1MDMB 5J8CA 5D6EA 1FC3A 3U2RA 3G73A 1P6RA 4MHGA 4R1HA 5LRRA 2ZBKA 5DD4A 4CICA 1FSHA 2PN6A 3IWFA 4ENMA 4BH9A 4M72A 1U78A 1YIOA 4KIFA 3KP3A 1J9IA 2PQ8A 2V9VA 2FQ3A 3GX4X 1WQ2A 2RDPA 1JGSA 1LNWA 1OYIA 1ZGJA 4MTDA 4ETSA 1BIAA 2M5WA 1YTYA 3WGGA 1LJ9A 1OPCA 1FY7A 2IRFG 3TKYA 5ICCA 1Z7UA 3KEOA 3ABUA 1FBQA 5H6RA 3AAFA 4EV0A 1ULYA 3ISPA 1IZ1A 5LHHA 1W5SA 1E17A 4M6XA 2RVCA 2RQPA 4GXOA 2K86A 3QPTA 3E6MA 5ICFA 1BC7C 4I0BA 3VB2A 2DI3A 2FE3A 1SD5A 2QENA 4XSZF 3I53A 2K27A 2NS0A 4WXHA 3SQNA 5FD5A 1LQ1A 4NHJA 4MGRA 1KQ8A 4LB6B 3CDHA 5F64A 4RB1A 6PAXA 2IA0A 5HS7A 1TQMA 3ZMSA 1XGNA 4NB5A 1P4WA 4A5NA 1EH6A 5HLIA 2DT5A 1O3SA 2KJBA 2F5CA 1ZN2A 2K7LA 2EV0A 1UCRA 4L9NA 2W25A 1EH8A 2DAOA 2VE8A 1R23A 2XV4S 4YG2F 4G7ZF 1ZG3A 3FMRA 3DFGA 4PGGA 2V1XA 4G6DA 3HRSA 3FX3A 3EYIA 2L01A 2CWEA 1U2WA 3IKTA 4RAZA 4LLGF 4RB2C 1STZA 2GA1A 5ICEA 4FX4A 4ESFA 3L00A 2HR3A 2A69F 3FXUA 4HX7A 3KP5A 5FB2A 4CO8A 5TJJA 2HS5A 3TDUC 3DQVC 3ZN0A 2ISYA 1K78B 3GEZA 3J7AO 3GWZA 4H0EA 1FSEA 4U0YA 4UVCA 5FO5A 5E1WA 2P6TA 4ZH4F 3MWMA 1TNTA 1EV7A 2OZUA 4MNUA 2DTRA 4U7BA 3TQNA 1I5ZA 1KQ9A 3DEUA 5AONA 1ZG1A 2FF4A 3I0TA 2M45A 2EWNA 3GO5A 1OYYA 3CUQA 1H0MA 3T8TA 5CJ9A 1ZGAA 4XSXF 2ZCWA 3FZVA 1EH7A 1RNLA 1Y0UA 2RV8A 4LB5A 2TDXA 3RJPA 5FLXK 4RB3C 2YPRA 2NAZA 2EFOA 1XCVA 3FF5A 4YIFA 4RAYA 2VOOA 2CQKA 5FFZA 2D1VA 1CF7B 1KU7A 2YSRA 1YYVA 3E5UA 2XKPA 4KMUX 3D0SA 1JE8A 1SFEA 1Z6RA 1UHMA 4CZZA 4A5MA 3PFIA 2DFIA 5F1RA 2E1CA 4N9IA 3KZZA 2P4WA 1ZARA 2E7WA 2DK5A 1S6LA 1P4AA 4Y15A 3Q9VA 4HBLA 3HHHA 4N0BA 2E7XA 3I54A 1XB4A 4G8XA 2QQBA 4M6YA 5LGUA 1PP7U 2IP2A 4P5OA 4EJTA 3JTGA 3HTUA 5HDKA 2HQRA 4HDVA 2QBYB 5D5VB 2VC1A 4M74A 3P9KA 3J81K 1ZRDA 4EM2A 3J80Z 4RB0A 1FP1D 1Q1HA 2HTJA 3BWGA 2JZYA 2F5DA 5CVRA 3LWFA 1U5TB 2COMA 1QZZA 5D5UB 3WTVC 1RUNA 3HRMA 3K2ZA 2ZNYA 2IW5A 4EJWA 3NEUA 5LLQA 1GHCA 3GZ5A 2PMUA 4ZZLA 1TQIA 4LLLA 3M9AA 4MQVA 5CVJA 2HWVA 5DCMA 3ECOA 4L0YB 3ECHA 4M73A 1SFUA 2P7VB 3R0JA 3CO6C 2MBFA 1GVJA 1ZH5A 4KFCA 3WGHA 4HA8A 1LEAA 1TW3A 3TDZC 4Z2YA 1IN5A 2MLGA 3KETA 2HZTA 4IRHA 5JR3A 2CW0F 1TNSA 4IF4A 4A0ZA 1UB9A 2LF8A 2YR2A 3ZMTA 1BN5A 2EFWA 2D1HA 4A12A 4M71A 5D8KB 3V8KA 1IRGA 2WC2A 4HQEA 5JI6A 3E3VA 1R7JA 3SZTA 2PJPA 2W57A 4P9FA 5HS9A 5ILSA 1DPUA 3FM5A 1YW8A 1K6OA 3RKXA 3J80K 2Z33A 2A6HF 2VXZA 3JAMK 3P9IA 1YW7A 2HYGD 3TO7A 4KN4X 1B4AA 4IXAA 5FFXA 1WI9A 1BI1A 3R60A 2G9WA 4U88A 1KU2A 1Z1DA 1XDUA 1YS7A 2QBYA 5D5WB 1FLIA 1KA8A 3F8MA 2Z9OA 1FNNA 3C18A 1T0FA 3VFZA 1H9GA 4OIRF 3DF8A 2J5PA 2HDCA 3COAC 3JTHA 1P92A 4E70A 3O3KA 2W24A 2Y75A 2FMLA 3WTYC 4IRGA 3F72A 4O6JA 1MD0A 2XAQA 1U5TA 1O3TA 5D6FA 4AIHA 3F3XA 3R0AA 4RGRA 1R58A 2R3SA 1S7AA 2OZ6A 1G3TA 4UNOA 3R4KA 4Q5SF 1C0WA 4YFKF 2VE9A 1J59A 3H92A 4TV7A 3B73A 2ZNZA 3C1DA 4ENNA 4UXNA 2R7FA 1P2FA 3HIFA 1IUYA 4KYWA 3GFJA 3ZMZA 1JXSA 1DP7P 2JTVA 1J0RA 4NQWA 2IVMA 4S04A 4HW0A 2ADUA 2LNBA 3O6BB 4A0XA 5DUIA 3E5XA 2A07F 5CYVA 2GZWA 3KP7A 3HSEA 3PQJA 5ILUA 3CUQC 4OIOF 1YW9A 2FSWA 1O7LA 1Z05A 2BV6A 2IT0A 4XRFA 5LGTA 3MZYA 1SMTA 2L3DA 4HF1A 3TO9A 4M9XA 4I0AA 1J5YA 2L4AA 2NNNA 2V6CA 1I6XA 2YX7A 5JFRA 5JHUA 3LQQA 5FD6A 2X0LA 4ZYEA 3OOPA 3B02A 4U7DA 1NHAA 4I2OA 4GGGA 2DK8A 2HYFA 5KK1A 2Q0OA 3QPHA 4WXDA 3SHFA 1W4MA 4WCGA 2IPQX 2DPUA 2M1BA 4KMFA 5LRSA 2H27A 3LA2A 4N9HA 1R36A 3KP4A 3C7JA 3BJOA 5LEKA 3M1EA 4ZZDA 1FBSA 3RDIA 3ZN1A 3CLOA 1USSA 2OAZA 4HYEA 4BXUA 2Y0MA 4OIQF 2XHKA 2VONA 4LK0F 2EA4A 5IT3A 4EVIA 5FLXZ 3LA7A 1BIBA 4RGXA 4I7HA 2GWRA 2FBKA 3GVAA 1QNTA 2VBYA 3I4PA 2P7CB 3WE3A 3F8CA 4ENJA 1G3SA 3DXJF 4UV8A 4GYGA 3WTTC 4XLPF 2CSOA 3P9CA 2QLZA 4ESBA 4IPAA 4GYIA 1XSDA 2KKOA 4WF2A 3RKYA 3GUDA 5E17F 1LDDA 4PGHA 1KQ0A 1OYWA 2A5YB 4I98B 1FYMA 3CTAA 4OOIA 2NRAC 5K5QA 1HBXG 1IN6A 1R1TA 2H6CA 2CGPA 4EJUA 2KIUA 4BHBA 2MH9A 1R1UA 1MDMA 5L3FA 3F8FA 3J81Z 2CFXA 3K1NA 2HFHA 3K69A 1REPC 3RPUA 1J7KA 1D8KA 2LSOA 3M7GA 4OMZA 4G9YA 2ZMEB 2PG4A 4L5IA 1T98A 1HW2A 1H9TA 2DQRA 3QU3A 1O57A 5LBQA 1U3EM 3R61A 2RKHA 3I5UA 4FT8A 3O2PE 5BPIA 3E6BA 1W7PB 1LVAA 2UXXA 1TTYA 1KU9A 4O3MA 1XMKA 2OA4A 5H20A 2VBWA 5E18F 2AS5F 1L0OC 4GCVA 2XAFA 3ZMDA 3IL2A 1YLFA 5CLSA 3KLNA 3RPQA 4EJVA 4I09A 4WWCA 1TW2A 2EV6A 3IRRA 4YFNF 4HOBA 2KIFA 1SD7A 4G6QA 3I59B 3BP8A 3V8JA 2FNAA 3U9GA 1K79A 2VN2A 1QZYA 2STTA 3WG9A 4EM1A 3F21A 1B6AA 1ZRFA 2FRHA 1RZ4A 3LSTA 1T38A 2JPCA 3I64A 2QWWA 4IVNA 3DV8A 1MZBA 4CYDA 2QUFA 2IA2A 2DW4A 4YIIA 1FT9A 1AOYA 2QQAA 4I02A 1I27A 2A3SA 1WWXA 1S8NA 4LFUA 2E1NA 2GAUA 1BC8C 4IHTA 3V7RA 1FBUA 4CXFA 1RI7A 1IXSB 3FMQA 1DDNA 5DEQA 2ACJA 4LG0B 1QO0D 1KYZA 3JAMZ 5E8IA 4WX9A 1O7FA 4AIKA 4FHTA 5ICGA 2MC3A 1F5TA 2F5EA 1F1ZA 2VOPA 2A61A 1Z91A 1V3FA 5CVIA 2O03A 2MH2A 3F8NA 1IXCA 1K78A 4YFXF 1R5GA 3WU0A 2CO5A 4HAMA 1V4RA 5LHIA 1ONVA 1ON2A 1LB2A 1TLHB 2ZMEA 3LAJA 2ZKZA 2DBBA 1SMYF 5FGMA 3GFIA 2P5VA 3L2CA 4L9VA 3WU1B 1MKMA 1PDNC 2LF7A 4DQ2A 4KNYA 2UZKA 1R1VA 2FU4A 1IXRC 2V1UA 2PMHA 3M8EA 2EB7A 2BEOA 4OIPF 2A6EF 5E1ZB 1FX7A 3RIRA 2OBPA 3MFKA 5J8FA 1B59A 1ZLJA 1RUOA 2WWYA 3LQRA 2ZXJA 2XROA 4BYYA 3MEXA 5BMZA 1ON1A 2GIVA 1MGTA 4G7OF 5HLGA 5DUKA 4MTEA 3I59A 1CF7A 5E1XA 1R22A 5LHGA 4KIBA 1HKTA 4ON0A 4MEYF 3LA3A 1P4XA 4HDUA 2XAJA 4IHSA 2Q8KA 1QPMA 4LGWA 3VEPA 2RNJA 1G6NA 5DV5A 1SD4A 1ZHFA 1QGPA 3RYPA 4LK1F 3GLXA 5DYMA 1OKRA 1E2XA 3T8RA 3KFWX 2LKPA 2Z99A 5K1YA 4WK8F 1IN8A 4R79A 2EFNA 4I01A 4L9TA 1PP8F 2F5FA 2XASA 1K7AA 4JBAA 4D0PA 3KZYA 2Z5UA 1IN7A 3MCZA 3GXOA 5IT9K 3RKWA 2JT1A 4ESJA 1R5HA 5AIPA 2O3FA 3T5XA 3LFKA 4KIGA 2STWA 4K2EA 1ZLKA 1USTA 4UVBA 5EEHA 4UUVA 2BYVE 2XKOA 1JHHA 3K1PA 2NYXA 2OD5A 3F22A 1BI0A 3GYHX 3FHZA 3OV8A 2H94A 2L54A 2P8TA 3P7NA 3I58A 2QVOA 1RIOH 4AIJA 4HV5A 3T0YA 1W5TA 3WGIA 1HSJA 2OQGA 3EUHA 4Y17A 1FWZA 1KYWA 1L3LA 4P96A 1T2KA 4U0VA 2EA2A 1TQPA 2VT3A 5ED4A 5BPDA 3F8BA 3MZHA 3S2WA 4JQFA 4HV6A 5EEGA 3ERED 3L9FA 3KP2A 1FOKA 5F6FA 2H6BA 4WXCA 5D4SA 2DU9A 3ROUA 2GA2A 3LAPA 4EM0B 4HX4A 3SZPA 3ZMVA 4F7ZA 3E6CC 1S7OA 3FXRA 2FNPA 1XGOA 3MAJA 3FXQA 4BHCA 3BOQA 1YG2A 1FYKA 4M9SA 2UWMA 2GQQA 3GFLA 3HRTA 3Q5FA 5E20A 1WKMA 5HLHA 5TRDA 3VOEA 2ZJ2A 4MEXF 5BQTA 2EJRA 3F6OA 4O5VA 4AD9A 4FX0A 2HKOA 4EQQA 2PFBA 3CUQB 3EDPA 4G94A 2P6SA 3SFZA 1XGMA 4EGYA 4CGZA 1KU3A 1F9NA 2O0YA 4A6DA 3BJ6A 3QRFF 1A04A 1IN4A 2RGVA 2V1DA 3QOPA 1AWCA 2EFPA 3QAHA 3TOAA 2P5KA 2DPDA 2EV5A 5HOOA 3H3UA 2QQ9A 3EETA 4L5JA 1S29A 1JHFA 3Q9SA 3JSPA 4B09A 2P5LC 3GW2A 2BBYA 3DKWA 4Y13A 2W85A 3F23A 4RS8A 5AIQA 4LJZF 2PEXA 1IRFA 2XRNA 1MJAA 1FZPB 3FMSA 2IJLA 4UVAA 3JSOA 2DLLA 1IF1A 1O3RA 1W7PD 2QM3A 4U0WA 3V7SA 4UV9A 2HEOA 1MJ9A 1IW7F 4B8XA 2NNYA 2Z3YA 3QP6A 2FOKA 3HUGA 2PI0A 1ZG5A 3TGNA 3K0LA 4BNCA 1KGSA 2MA3A 4L0ZB 3E5QA 1ZAOA 3V8LA 4Q48A 1HSTA 5ERIA 3BPVA 2Y48A 5K5OA 1I1SA 3BJAA 4A6EA 1GXPA 2O8XA 3W6JB 4KDPA 4LLNA 4ASNA 1TBXA 4ZYHA 4PDKA 4BHPA 5DDGA 3BY6A 4CHUA 3GF2A 1T39A 4OU0A 3N4MA 2EK5A 3DPLC 3GFMA 2K4BA 2L02A 5HDNA 4LD5A 5D8LB 1GXQA 3IHUA 4KICA 2PLYA 2KRFA 3RI4A 1DPRA 1OR7A 1BM9A 3FM3A 1XN7A 2K4JA 2VT2A 3KP6A 5DCMB 2HTSA 2ESHA 4BQAA 2MD5A 5L3GA 2O61A 3PQKA 3H3ZA 3IKVA 3NQOA 5HVQC 5HS8A 1OMIA 3SXYA 5L3DA 1O3QA 3CO7C 1WSUA 1XDSA 1F4KA 1YQAA 3N97A 1BOAA 2M87A 3VODA 2YU3A 3HOSA 2M8EA 3HSRA 3L7WA 3ZMUA 3D5LA 3HHGA 4CDGA 5L3EA 2CG4A 1Z9CA 1Z6TA 1YO5C 4KUMA 3C3WA 2JPBA 1I1GA 1R00A 4P9UA 1HXDA 4A0YA 3WTZA 3ZQ7A 5DCFA 4G7HF 1XD7A 4AWXB 1UFMA 2FEZA 2ELHA 2JSCA 1T6SA 4EMSA 2GXBA 2A68F 2ZFWA 4HF2A 2FMYA 1BBYA 4KN7X 2LDUA 1XSXA 1U5TC 5D4RA 3V4GA 3K9TA 3F6VA 3IC7A 1IAWA 2RN7A 3HTSB 2VC0A 5CVUA 2DQLA 3REOA 1UHWA 5BOXA 3BZ6A 5CVVA 1G4DA 2WV0A 2XAHA 1HQCA 2FA5A 2XUBA 1U6GA 4KT5C 1D8JA 5L3CA 5A2QZ 1HW1A 2H09A 2QZ8A 2EFQA 3KEQA 1XGSA 1D3YA 3R6SA 2VODA 3L09A 3M8FA 1QQIA 3T1BA 3HRUA 5IT9Z 2VBZA 2UXNA 5K5RA 1WRJA 1X3UA 2RC4A 4XLNF 2K02A 3K1MA 5J6XA 3BROA 2WTEA 5JVTA 1LDJA 3GZ6A 4MQ9F 1W7PA 1YFHA 3CUOA 1J2XA 1BI3A 2XVCA 4ZYGA 3ELKA 3ULQB 4OMYA 4XBFA 3QU6A 4HF0A 1ZYRF 4LMYA 3WTSC 3BPXA 3IRQA 3V7CA 2MLKA 3CJNA 3WTXC 1ZRCA 4R8HA 4IJAA 5ILVA 2OQRA 4L9JA 1VTNC 1B9NA 1LEBA 3E6DA 1ODDA 4JK1X 3E97A 3DPTA 3W6KB 3MQ0A 1ZREA 2DO7A 3JW4A 1FP2A 1XMAA 1HKSA 2KIMA 2FBIA 4KA4A 1MJBA 4HX8A 1DUXC 2XGXA 5L3BA 1FPQA 3HYIA 4BAYA 2ISZA 2G7HA 5D5XB 3KLOA 1B9MA 3FWEA 3ML6A 4QWQA 3HOTA 3DP7A 3WTUC 2FBHA 4GO1A 2BE5F 2W84A 4Q4ZF 1YS6A 1XCBA 2HGCA 2Q2EA 4PZJA 4OINF 2L4MA 3WTWC 1QBJA 3RYRA 5A2QK 2HKXA 3NRVA 4QLCU 5DD8A 2VBXA 1G3WA 4HLYA 3EYYA 3WODF 1BI2A 4LG0A 1U8RA 2OU2A 2HQNA 5HDGA 1HKQA 5LGNA 3TO6A 4HQMA 1XSVA 1HW5A 1SAXA 3QP5A 2GXGA 1S3JA 4RGSA 3RTRA 3I71A 2FXAA 4M9ZA 3ZPLA 2XAGA 4PCQA 1G3YA 3HSFA 5LEJA 4UHTA 2ESNA 2M30A 4ZYDA 2PBIA 3TOBA 5KVRA 2ETHA 1PUEE 3IWZA 2O6GE 2V79A 4AVPA 4IRIA 4RGUA 4P55A 4HZFA 1SD6A 3KE2A 5H6QA 2D2WA 3EQLF 4HLXA 2AXLA 3ABTA 2F2EA 3WE2A 1J75A 2JRTA 4EGZA 2B0LA 2HOEA 2C6YA 2YX4A 5BS6A 4EJOA 3G3ZA
chains in the Genus database with same CATH superfamily
1HDPA 2KQRA 2QYOA 4HPQA 4Q47A 4HSRA 2BGCA 4F55A 2J5OA 2KJCA 1LFUP 2D45A 1V5FA 2L7MP 3JRFA 5E3LA 1SFXA 2HDWA 3KCCA 4S05A 4V19K 2CYYA 1CGPA 3A0BC 1LDKB 3BDDA 4A2UA 3OYJA 1JGGA 1D5VA 1VQOI 4PJMA 3GMEA 3OIQA 1BJAA 5HODA 1H88C 1B1BA 2X4HA 4DNCA 3U1DA 2ZO4A 5E8GA 2G7UA 1YJWI 5IPAA 2XIGA 2BVLA 4NBQA 3ZP5A 4L18B 2XF7A 2WY7Q 1PVEA 1JJ8C 4ENKA 3J7ZI 3G4SI 2KP6A 1JKQC 2IA1A 4W1UA 3G6EI 1YX3A 3P5JA 2R7DA 5F08A 1MDMB 1FYLA 4M3FA 5J8CA 2KZGA 5D6EA 1FC3A 3U2RA 3G73A 4A3EJ 1P6RA 4M3BA 4MHGA 4R1HA 5LRRA 1FOWA 1WJCA 2ZBKA 3MZ8A 5DD4A 2E1MB 4CICA 1FSHA 2PN6A 2X6YA 3IWFA 4ENMA 3QODA 1Z21A 4B1RA 4M72A 4BH9A 1U78A 1APLC 1YIOA 4KIFA 3KP3A 5B3SH 1J9IA 2PQ8A 2V9VA 1N77A 2FQ3A 3GX4X 1BR2A 2G0EA 1WQ2A 2R93J 2RDPA 3I3LA 4BQQA 1R9TJ 2NVYJ 3W6VA 1JGSA 1LNWA 4BY7J 1OYIA 3I4MJ 1ZGJA 4AYBN 3OYGA 4XRMA 4BQOA 2KDOA 3U1KA 3WG7H 4MTDA 4ETSA 1BIAA 2DT6A 2VQCA 2EINH 4EEFG 2M5WA 2ID3A 1YTYA 3HGGA 3WGGA 3A01A 1LJ9A 1R4MB 2O5RA 1OPCA 4Y7NJ 4JYKA 3IV5A 4NC7A 5F0CA 3CC7I 1FY7A 2IRFG 3TKYA 2H1LA 4E7HA 5ICCA 1Z7UA 3KEOA 1U0JA 3ABUA 3DKXA 2EZHA 1FBQA 1VZ0A 3BCAA 1A36A 3S15J 5EYRA 5H6RA 3AAFA 4EV0A 1ULYA 2BW3B 2GXAA 3ISPA 1IZ1A 5IYDJ 5LHHA 1W5SA 3RQ4A 2X1DA 1E17A 4M6XA 2RVCA 2X6XA 2RQPA 4GXOA 2K86A 3QPTA 3CZ6A 5J3LA 3E6MA 5ICFA 1TL8A 1BC7C 2HU9A 4I0BA 3PUBA 3VB2A 2DI3A 5E3OA 1VQPI 2FE3A 1SD5A 2QENA 4XSZF 4D7MA 2HQAA 3I53A 2K27A 2Y30A 1MMDA 2NS0A 2ZXHA 2IEKA 4PSWA 4WXHA 5FD5A 3SQNA 1LQ1A 4A3BJ 4DW6A 3JRBA 4NHJA 4MGRA 1KQ8A 4FE7A 4LB6B 1NK2P 3CMYA 2CQ7A 3CDHA 5F64A 2DYSH 4RB1A 6PAXA 5EG0B 2Z2SB 2IA0A 5HS7A 1TQMA 3ZMSA 2JQ7A 5FLVA 4XONA 2VASA 2HVSA 2PMZA 1XGNA 3BZCA 1P4WA 3CJTB 4NB5A 4A5NA 3ABLH 1EH6A 3DWLE 2EZLA 5HLIA 2M34A 1GLNA 2DT5A 1O3SA 2KJBA 2F5CA 3ASOH 4QSHA 2E2IJ 1ZN2A 1VQKI 5FKOA 3S93A 3UKGA 2BHYA 4BBSJ 2K7LA 1ETVA 4BU2A 4HNUA 4F92B 1OCRH 2EV0A 3BR0A 3ZXSA 1UCRA 1K6YA 3JRGA 3I9V2 4L9NA 2W25A 1EH8A 2DAOA 3K4KA 4UUSA 2VE8A 1R23A 3VYSB 2XV4S 1YOVB 4YG2F 2HVRA 1Y6IA 1Y8RB 3K4LA 2HI3A 1IDYA 2NVTJ 1ENHA 4G7ZF 2EZIA 3FXLA 1Y39A 1ZG3A 3FMRA 2FQ4A 3DFGA 4PGGA 2ZMEC 2Z16A 2PJRB 2WAFA 2V1XA 4BGDA 4G6DA 3HRSA 3FX3A 3EYIA 2L01A 2MABA 3K4JA 2CWEA 1U2WA 3CESA 1V5EA 2DOFA 2XF5A 3IKTA 4RAZA 4LLGF 2VL8A 2AXTC 4RB2C 1STZA 5GPCA 2GA1A 4RBOA 3SDGA 5ICEA 4FX4A 4ESFA 3L00A 3VYUB 2LR8A 3DKYA 2HR3A 2A69F 3FXUA 1D5YA 1P7IA 4YIRX 3GTKJ 4HRIA 4HX7A 3HOZJ 3FXKA 2R0QC 2LTPA 3KP5A 5FB2A 3TEDA 3MKWB 4RLFA 4A3IJ 3M8JA 4CCJA 1MNMC 2AHQA 4CO8A 5TJJA 1V5GA 3TW7A 2WB1A 2HS5A 4UUTA 3TDUC 3DQVC 1UAAA 3ZN0A 2ISYA 2XB5A 4Z6YA 1K78B 2LG4A 5DM7F 2X1EA 1LE8B 1ZQ3P 1RKWA 3HPGA 3GEZA 1B8IB 1VQ6I 3J7AO 1D1CA 3GWZA 2E60A 2DFHA 4DBRA 4H0EA 1FSEA 1JTYA 1W1WE 2CJJA 4U0YA 1JKRC 1UELB 4UVCA 4XR6A 2DJNA 5FO5A 1PUFB 2W82A 2WAEA 5E1WA 3KZIC 2P6TA 4ZH4F 3MWMA 1TNTA 2JN6A 1FIPA 2DDBA 4E6KG 1EV7A 1J09A 2OZUA 4MNUA 5EDNA 2LRDA 3W2WA 2DTRA 1XMXA 4XN0A 3EPZA 4U7BA 2QSHX 4YELA 3TQNA 1I5ZA 1KQ9A 5HNHA 3BLYA 4IQ4A 3DEUA 4X6AJ 2RNGA 3H5NA 5AONA 1U8BA 4AYBA 2R5ZB 1ZG1A 2FF4A 3I0TA 2M45A 4JP0A 2EWNA 5M5YJ 3GO5A 1OYYA 3AKZA 3CUQA 1H0MA 1U9OA 2R7OA 3T8TA 4ZTFA 1ORKA 5CJ9A 1ZGAA 4KISA 2BW3A 4XSXF 2ZCWA 3FZVA 2DTZA 1EH7A 1RNLA 1DU0A 1Y0UA 2RV8A 4II3A 1E3OC 5JHFA 4LB5A 1W0UA 2TDXA 3RJPA 5FLXK 2K9MA 3IH4A 4RB3C 1FOXA 4BJTA 2W7NA 2YPRA 2NAZA 5DTDA 2KDZA 2HOSA 2XDVA 2EFOA 3DTKA 2MGQA 3DPUA 2MC4A 2O8KA 1XCVA 3FF5A 1X1AA 2XGCA 4YIFA 5IYBJ 4RAYA 2VOOA 1Z7LA 3FBIB 2CQKA 4XLEA 2BVMA 5KHDA 5FFZA 2D1VA 4JX6A 2ZFUA 2KRHA 1CF7B 4F93B 1XS9A 1KU7A 2YSRA 1YYVA 3OYCA 3E5UA 2XKPA 4KMUX 3D0SA 5F0HA 1JE8A 1SFEA 1Z6RA 1VQ9I 1XX5A 1K61A 2HXOA 4KJZA 1UHMA 4CZZA 2VKDA 3G1LA 4A5MA 2O9LA 3PFIA 2DFIA 5F1RA 3Q3SA 4XORA 2E1CA 4N9IA 3KZZA 2P4WA 1JUPA 1ZARA 2I10A 2E7WA 2DK5A 1S6LA 4II2A 2E36A 1P4AA 3X2QH 4Y15A 3Q9VA 4HBLA 3HHHA 2R7RA 2BOLA 4N0BA 2E7XA 3I54A 1XB4A 2VXDA 4G8XA 3WHCA 1W36D 2QQBA 4M6YA 2JVGA 3OSFA 5LGUA 5FRMA 2JA2A 5JLWA 2IP2A 1PP7U 4NDLA 4P5OA 5CPRB 1ZTRA 3MKYB 5F04A 3CC2I 3VYRB 4EJTA 3JTGA 3ZOBA 3HTUA 5HDKA 2PJRA 2HQRA 2IGNA 4HDVA 4V2FA 1BW5A 2VJJA 2QBYB 2Y31A 1Z77A 3LSKA 2VQHA 2VC1A 4M74A 5D5VB 1JJ6C 3P9KA 2IS6A 3J81K 3OS2A 1ZRDA 4BJ5C 4EM2A 3J80Z 1Z0XA 2E71A 1OCTC 1JTXA 2QA4I 1X2MA 3TL4X 1QZEA 4RB0A 3HC7A 1FP1D 1QHGA 1V54H 1IO2A 3BZKA 1MIJA 1Q1HA 5KNLA 2HTJA 3BWGA 3H9JA 2IXSA 1ACIA 2JZYA 3TW6A 1SAUA 2F5DA 4F91B 4B48A 3O8HA 5CVRA 1WI3A 3LWFA 4ZYAA 2DA7A 1U5TB 2COMA 1QZZA 2JWTA 5D5UB 4XLFA 4XK4A 3WTVC 5FRNA 3BR6A 1OJLA 5IOZA 1OCOH 3HRMA 1RUNA 3K2ZA 3K4CA 2L7KA 3S1RJ 2ZNYA 3DU5A 2IW5A 3FK7A 4EJWA 2M4KA 3NEUA 5LLQA 1GHCA 3GZ5A 2XPUA 2PMUA 3SZGA 1PUFA 4ZZLA 5GTHC 1TQIA 1W0TA 4LLLA 2VB6A 3M9AA 3KYLA 4D5CA 4MQVA 5CVJA 2HWVA 4PK4A 5DCMA 3OYKA 2EBIA 1E0EA 3ECOA 5FKKA 4MFDA 1VF9A 1G59A 4L0YB 3ECHA 4M73A 2L9VA 3ZRGA 1HCRA 2D5VA 2JMWA 2ZJPF 1SFUA 2L2OA 2P7VB 3R0JA 3CO6C 2R5ZA 2MBFA 1HDDC 2X1CA 1GVJA 2IBDA 3OL3A 3MMYB 1ZH5A 4KFCA 3WGHA 2X9DA 4HA8A 1Z67A 1LEAA 3RQIA 1SANA 1TW3A 3TDZC 1IJWC 4Z2YA 2L7FP 5C4XJ 3CCVI 1IN5A 4KITB 3FHNA 2IS2A 2MLGA 3S1QJ 3BR3A 3KETA 2HZTA 4IRHA 5IY5H 1X1DA 5JR3A 2CW0F 1TNSA 4DZPA 2DN0A 5EGOB 3DBHB 2WAQA 2R7ZJ 5J1UA 2CUJA 4IF4A 1ZKGA 1ZR4A 3QQAA 4A0ZA 3JREA 1UB9A 2LF8A 2YR2A 3MN2A 3ZMTA 1BN5A 1X19A 2EFWA 2FOWA 4RMNA 3RZDJ 3RKQA 4J01A 4ZJZA 2D1HA 4A12A 1YJ9I 1ETYA 3OR2C 4EATA 2KPMA 4M71A 5D8KB 3HKZA 3K2AA 4KT6A 3V8KA 1IRGA 4AC0A 1WFXA 1XPXA 2GOMA 2CU7A 2WC2A 5JI6A 4HQEA 4GDFA 3E3VA 1R7JA 3EUAA 3SZTA 3CD6I 2PJPA 2W57A 1BOBA 2CUZA 4P9FA 5HS9A 5ILSA 1DPUA 3FM5A 1YW8A 1K6OA 3ESWB 3RKXA 1IDZA 2B63J 4IKFA 2X51A 3CC4I 3QPLA 3J80K 2Z33A 4LITA 2A6HF 2DA4A 1ZK8A 2VXZA 3JAMK 3P9IA 1ETQA 1YW7A 2HYGD 3TO7A 4IOCF 4KN4X 1B4AA 5M5XJ 4IXAA 3OY9A 5FFXA 2OC6A 1I3AA 3UR3C 2TCTA 1FMVA 3H1CA 1WH5A 4IOAF 3ERMA 1WI9A 1BI1A 1X4OA 3R60A 3S3OA 1TP4A 2G9WA 4U88A 3LSPA 1KU2A 2EZKA 1E3PA 1Z1DA 2OCEA 1XDUA 4PJJA 2CUFA 4M3GA 1YS7A 2QBYA 4M3EA 1UZCA 1RESA 1MNDA 5D5WB 1X2NA 2FD5A 1FLIA 1KA8A 2ICWG 2KISA 3F8MA 2Z9OA 1WJ5A 1FNNA 3C18A 1T0FA 3VFZA 1H9GA 3OS1A 5M5WJ 1IGNA 4OIRF 3DF8A 2J5PA 5EJCA 2HDCA 3COAC 1I39A 3JTHA 4C2TA 1P92A 4E70A 1HF0A 3A4CA 3O3KA 2W24A 2Y75A 2FMLA 2F4MB 3WTYC 3GBGA 5B1AH 1X1BA 2COBA 4IRGA 4RA2A 3F72A 4O6JA 2LY2A 3CP2A 4XIDA 1TWFJ 1MD0A 2XAQA 3M4OJ 1U5TA 1O3TA 5D6FA 4OAYA 3OYAA 3G2BA 4AIHA 2IAIA 3CCYA 3F3XA 3R0AA 4M6VA 4RGRA 3K10A 1R58A 2R3SA 3H0DA 2JA5J 1S7AA 2HPIA 2OZ6A 5C3EJ 4AVZA 1G3TA 4UNOA 3ABMH 3HGYA 4A3LJ 3R4KA 3BQYA 3S8PA 2JVHA 4Q5SF 4FTHA 1C0WA 4YFKF 2VE9A 2WBMA 2VLAA 1J59A 4XICA 3H92A 4TV7A 3B73A 5CQEA 4B3XA 3OYDA 2ZNZA 3DLAA 3HZJA 2HNHA 3HOYJ 2K9NA 2CQQA 4PJNA 2MD0A 2R7SA 3C1DA 4ENNA 4UXNA 2R7FA 1P2FA 2TRTA 2GIZA 3HIFA 2WB1N 3CJRB 3FXJA 1IUYA 4KYWA 3TP3A 4Y4RA 2Y2ZA 3GFJA 3ZMZA 2OJED 1JXSA 1DP7P 2DMQA 3LSHA 2JTVA 3HUGB 1J0RA 3DEEA 2NS7A 4NQWA 2IVMA 1OR7C 4E7SA 2P0WA 1DQUA 4S04A 3HOXJ 4HW0A 2ADUA 2LNBA 3GTOJ 3O6BB 4HG2A 3AL0B 1F43A 4C3JJ 5FKLA 4A0XA 4RDUA 5DUIA 3E5XA 3QYEA 2MFZA 1FJLA 2A07F 3K7AJ 4OWRB 2CW7A 3S2HJ 2BY3A 5CYVA 2GZWA 3KP7A 3HSEA 3PQJA 5ILUA 3CUQC 4E7IA 4OIOF 1YW9A 2CH0A 2FSWA 1O7LA 1Z05A 2BV6A 2IT0A 1W5CC 4IO9F 4P1WA 4AIDA 2VPLA 4XRFA 2R92J 1SFOJ 5LGTA 1GT0C 3MZYA 1SMTA 2L3DA 4HF1A 3TO9A 4M9XA 1G8XA 1UJ8A 4I0AA 2K3PA 2I5UA 1J5YA 2L4AA 2NNNA 1DU6A 3SEZA 2V6CA 4LIUA 1I6XA 2YX7A 5JFRA 4FE4A 2KHMA 3OOUA 5JHUA 3LQQA 1IV6A 5FD6A 3A0HC 1R5ID 1WJFA 2X0LA 4ZYEA 3OOPA 3CLQA 3PIOF 3A1YA 3B02A 4U7DA 1NHAA 1TT5B 1NG6A 4I2OA 3CCRI 4GGGA 2DK8A 2HYFA 4RM2A 2Q0OA 3QPHA 5KK1A 1YJNI 4WXDA 3SHFA 1SC7A 2NVXJ 1W4MA 4BDZA 2EIKH 4WCGA 2IPQX 1I50J 4XLHA 4C9YA 2DPUA 2KL4A 4PJ0C 5F1JA 2M1BA 1WPKA 3FXOA 4UB6C 3OR1C 2ZXIA 1X1PA 3BG6A 1QVUA 4KMFA 5LRSA 2H27A 4A3FJ 3LA2A 3H0GJ 1Z3XA 1R36A 4N9HA 2GOXB 2N8GA 2HYJA 3NWSA 1YRNB 3KP4A 2CFOA 3DBRB 3C7JA 3CCQI 3JRCA 3CMAI 4MFEA 1OCZH 2EH3A 3BJOA 4CCOA 3M1EA 1FBSA 3RDIA 4ZZDA 5LEKA 2P81A 3CCSI 3ZN1A 3CLOA 1USSA 4E7LA 2XPVA 2OAZA 2VIXA 4HYEA 4BXUA 2Y0MA 4OIQF 2K40A 2XHKA 2VONA 1D1BA 2OPTA 4LK0F 1ETKA 3C2GA 4NUBA 2EA4A 5IT3A 1FTTA 5E3MA 2HQ5A 1NG7A 3PNTA 1R6RA 2XC7A 1QA6A 3H3VK 4B4CA 4EVIA 5FLXZ 3G71I 3LA7A 1BIBA 4I7HA 4RGXA 2GWRA 2FBKA 2Y9YA 3GVAA 5GAEJ 2BY2A 2ECBA 1QNTA 2VBYA 3I4PA 2P7CB 2R7VA 2XF6A 3OYHA 3WE3A 1MMAA 2K85A 3F8CA 1MSEC 4ENJA 4D9JA 1G3SA 3DXJF 4UV8A 3SYTA 4GYGA 3WTTC 3J7YJ 4XLPF 3JRIA 3PO3J 2OV7A 2CSOA 3P9CA 3K70C 2ZSHB 3VSLA 1EKEA 4BKXA 2QLZA 3JRHA 2AQEA 4D7NA 4ESBA 4IPAA 1XC5A 3F0CA 1ETXA 4GYIA 2YS9A 1A35A 4Y3OA 1XSDA 2KKOA 2JA6J 4CUGA 4WF2A 3RKYA 1YX5A 2R5YB 2GBYA 3GUDA 4JX5A 3GTQJ 5E17F 3MD2A 3ZQQA 1LDDA 4PGHA 1KQ0A 1OYWA 2A5YB 4I98B 1FYMA 3CTAA 3H5RA 4OOIA 1G2HA 3BTLA 2X48A 4BXFA 3KEYA 2NRAC 5K5QA 4FQGA 1HBXG 1R49A 1IN6A 1R1TA 4JX4A 2H6CA 2M7AA 2XSDC 1B72B 2CGPA 2BHZA 5IOYA 2DA2A 2DJIA 4EJUA 2KIUA 4FISA 4BHBA 2MH9A 1R1UA 3ZQGA 1MDMA 3L2RA 2M7BA 4X0GA 5L3FA 3BR5A 1YITI 2XGDA 2DYRH 3F8FA 3BC8A 3J81Z 1Y1WJ 1R4NB 1OQYA 1DGRM 2CFXA 3K1NA 2HFHA 3K69A 1REPC 4FETA 3RPUA 1J7KA 2H1KA 2DMNA 1D8KA 2LSOA 5J40A 3M7GA 4OMZA 4G9YA 4XKVA 1T08B 4C3IJ 2ZMEB 2PG4A 4L5IA 2RAEA 2LY1A 1T98A 1HW2A 1YE9A 2K5CA 3OYMA 1WH7A 2X6OA 4XKBA 1H9TA 2DQRA 3QU3A 1O57A 5LBQA 1U3EM 3R61A 4M3DA 2RKHA 3I5UA 3CCEI 3BR2A 4FT8A 3O2PE 4A3JJ 3LSJA 1I3QJ 5BPIA 1P9QC 3E6BA 1W7PB 1S72I 1LVAA 3PSIA 2UXXA 1TTYA 1KU9A 5GPAA 3BG7A 4O3MA 4NC6A 1XMKA 2OA4A 1RR8C 5H20A 1UMQA 2VBWA 5E18F 2WAQN 3IUOA 2AS5F 1L0OC 4GCVA 2XAFA 4ITVA 2LBFB 1RR7A 3ZMDA 3IL2A 1YLFA 1T8IA 5CLSA 3KLNA 3HDDA 3RPQA 4IHVA 1Z3YA 3ONQA 4EJVA 1SEUA 3AG3H 4I09A 4XLCA 4WWCA 4MIMA 1TW2A 2EV6A 3IRRA 4RM3A 1AHDP 3F9KA 3HKZN 1ETOA 4ZTJA 4YFNF 4HOBA 2KIFA 1SD7A 2OUMA 1N25A 4G6QA 3I59B 1A31A 3BP8A 3CCUI 4XRSG 1YIJI 3V8JA 2FNAA 2WV1A 3U9GA 4CCLA 2DMUA 3LNQA 1K79A 2VN2A 1QZYA 5M3FJ 2W00A 2STTA 2XSJC 3WG9A 3FDYA 3K6GA 3PFYA 4EM1A 5FLMJ 1B6AA 2KRCA 3F21A 1ZRFA 5EG0A 2F4IA 5GTIC 2FRHA 1RZ4A 3GCMA 3LSTA 3OS0A 1T38A 2JA7J 1D0ZA 2K9QA 3BT9A 2CW8A 2JPCA 3I64A 3D5SC 2QWWA 4U87A 4IVNA 1SVMA 3DV8A 1MZBA 5EZGA 1EJ9A 2JUCA 4CYDA 2QUFA 3PNYA 3BG3A 2QF7A 2FJ1A 2IA2A 3HPHA 4XKWA 2DW4A 4YIIA 1FT9A 3GTLJ 1T0FC 4IEJA 3Q0VA 1AOYA 2QQAA 4I02A 1Y8QB 5DM6F 1DP3A 3D5RC 2VUMJ 1I27A 2A3SA 2UUZA 3KPHA 2LK2A 1WWXA 1S8NA 4LFUA 1KONA 4DOZA 4PFOA 2VKVA 2HPMA 3UNGC 2V9PA 3J7AY 2LP0A 3FKJA 2E1NA 2GAUA 1TWGJ 1BC8C 2V6EA 1ZR2A 2R7UA 4IHTA 1HOMA 3V7RA 1FBUA 4CXFA 2K9SA 2R7QA 1RI7A 1IXSB 3FMQA 4A3MJ 1DDNA 5DEQA 3G1MA 2V9KA 3VYTB 4XM3A 2R5YA 5BNGA 1BJZA 1IRXA 2ACJA 4LG0B 3W2AA 1QU3A 1QO0D 1KYZA 4F3QA 1GVDA 3JAMZ 4XL9A 5E8IA 4WX9A 1O7FA 3K4BA 3A2KA 4CYCB 3SFIA 4AIKA 2XB0X 4FHTA 5ICGA 2MC3A 1F5TA 2F5EA 1F1ZA 2M3AA 1OFCX 2VOPA 1TWHJ 2A61A 5J1YA 1LVKA 1V3FA 1Z91A 5CVIA 2O03A 3QWLA 2MH2A 2GM4A 3F8NA 1IXCA 3CCMI 1K78A 4YFXF 1R5GA 1LE8A 4BBRJ 1A5JA 2BXYA 1B8IA 3WU0A 3CDIA 2CO5A 2HZDA 1BA5A 4HAMA 1V4RA 5LHIA 1ONVA 2LMDA 1ON2A 4GFBA 3VWBA 2ZC2A 4X1EA 1LB2A 1TLHB 2ZMEA 4FASD 2VJ4A 1GDTA 3LAJA 2M8GX 1JUSA 3S32A 3ZQIA 2ZKZA 2H8RA 2DBBA 1VQ4I 3JR9A 1SMYF 5FGMA 3ZCOA 3GFIA 2P5VA 3L2CA 4L9VA 3WU1B 1MKMA 3PL8A 1PDNC 2LF7A 4DQ2A 4KNYA 2UZKA 1R1VA 3ZQHA 2FU4A 2QEXI 3CCLI 4B3AA 1IXRC 2V1UA 1MBFA 2EPFA 2PMHA 3M8EA 2EB7A 2BEOA 3HG9A 4OIPF 2A6EF 3LSRA 5IP6A 5E1ZB 4MLOA 3B6CA 1FX7A 3RIRA 1R71A 2OBPA 3MFKA 1MBKA 2LBFA 5J8FA 2NOJB 1B59A 1TZLA 2B9SA 1ZLJA 1LPQA 1RUOA 3S16J 2LYCA 2WWYA 3LQRA 2JA8J 1FTZA 3BCBA 3BG9A 2ZXJA 3AG2H 3TP0A 2E35A 2XROA 4Y52J 4BYYA 2CRGA 2Y0SA 3MEXA 3OL4A 5BMZA 4YRVA 1X3WB 4JOMA 4BEHB 1PYVA 3H36A 1ON1A 2GIVA 1MGTA 1WJDA 4G7OF 5HLGA 5DUKA 4MTEA 3I59A 3IAM2 2ELKA 4CA0A 1CF7A 5E1XA 4G12A 2YUSA 3V42A 3OYBA 4ZC3A 1R22A 1WVRA 5LHGA 4KIBA 2CV2A 2BY1A 1HKTA 5FKMA 3LSGA 2QQ8A 4ON0A 4MEYF 3LA3A 1P4XA 4HDUA 2XAJA 4IHSA 2L0KA 2JRMA 2Q8KA 1QPMA 2A5WA 4LGWA 1S5LC 2RNJA 1G6NA 3VEPA 1RKTA 5DV5A 1SD4A 1JT0A 1ZHFA 1QGPA 4XMYA 3VPRA 3DCFA 3RYPA 4LK1F 1ERDA 3GLXA 2HDDA 2F6CA 2IS4A 3S2DJ 5DYMA 3QOEA 1OKRA 5IP9J 1E2XA 1MSFC 3T8RA 1LFBA 3KFWX 2QSFX 3EUKL 5JVGF 3IH2A 1MBGA 1NTCA 4GRIA 2LKPA 1QHHD 2Z99A 5K1YA 2QSGX 1YI2I 3PUFA 3DTIA 4PJLA 4WK8F 3IP4B 2K9LA 2B7EA 1IN8A 1VQLI 4R79A 2EFNA 4I01A 4L9TA 5LFAA 1K4SA 3CDLA 1PP8F 1VQ7I 2F5FA 1MBHA 2XASA 1OCPA 1K7AA 4JBAA 4D0PA 3I55I 3KZYA 1Y1VJ 2Z5UA 1IN7A 3HBLA 3MCZA 5J47A 4XQFA 3GXOA 5IT9K 3ASNH 1BW6A 3RKWA 2JT1A 5K7HA 4E7ZA 4ESJA 5J4YA 4CYCA 1R5HA 4ZDPA 5AIPA 4DJAA 2R7WA 1TWAJ 2O3FA 3T5XA 2KZVA 3LFKA 4KIGA 2STWA 1YHQI 2R7TA 4K2EA 3SJMA 1ZLKA 3GTMJ 3A02A 4HSTA 1FIAA 1USTA 2HXIA 2DOEA 4UVBA 5EEHA 4UUVA 2BYVE 1KZHA 3MVPA 1DGWY 2XKOA 5GAHJ 1JHHA 3K1PA 2OCCH 3LSMA 2LKSA 3BTJA 2NYXA 2OD5A 4HNTA 3F22A 9ANTA 2L9RA 4ABZA 1AU7A 1BI0A 3LMMA 3GYHX 3FHZA 1P7JA 3OV8A 3CMMA 3CF2A 2H94A 2L54A 2P8TA 3P7NA 3I58A 2QVOA 1POGA 1RIOH 4AM3A 2R7XA 4AIJA 2VJIA 4HV5A 3OYEA 2M0CA 3T0YA 1X4PA 1W5TA 1NH3A 3WGIA 1HSJA 1X58A 1I6HJ 2E1MC 5IYCJ 1RPWA 2PX9A 2OQGA 2RQQA 3EUHA 4Y17A 1T56A 3K4NA 3S1NJ 3N05A 4XN3A 1FWZA 1KYWA 1L3LA 4P96A 1T2KA 2M0MA 2EA2A 1TQPA 2VT3A 4U0VA 5ED4A 4BS9A 5BPDA 2A05A 3BG5A 3F8BA 3GTJJ 3S2WA 3MZHA 2GLOA 4JQFA 4HV6A 4BL0B 3ZGKA 2MYSA 1ETWA 1MBJA 5EEGA 1FMWA 2XGEA 3ERED 3L9FA 3KP2A 2R4GA 4MO7A 5GP9A 3E0JB 1FOKA 2F4OB 2LH9A 1JKPC 5F6FA 2YU9J 1SVLA 4AU7A 2H6BA 5KCMA 1VFCA 1MMSA 2CQNA 3S14J 4WXCA 5D4SA 2CV0A 2DU9A 3OYNA 4B44A 3ROUA 2GA2A 4LG3A 4EM0B 3LAPA 4HX4A 3SZPA 3ZMVA 1ZELA 4F7ZA 3E6CC 1D0YA 2KFDA 3CJQB 5EGOA 4E4HA 3M3YJ 1SVOA 4V2GA 4XRSA 1S7OA 3FXRA 4BEHA 2QGUA 2FNPA 5TISC 4AUXA 1EF4A 2LC2A 2M9HA 1XGOA 4BQNA 3H35A 3MAJA 2Y9ZA 3FXQA 4J19A 4BHCA 3S3NA 3CMEI 5HNFA 1QRYA 1IG7A 5J4VA 3BOQA 1YG2A 1FYKA 4C2UA 4M9SA 3I4NJ 2UWMA 3AG4H 2GQQA 1UG0A 4ZDOA 3GFLA 3HRTA 4DBQA 3OYFA 3Q5FA 2OTLI 1EA3A 5F27A 5H2FC 3L2UA 3H5AA 5E20A 2E5ZA 1WKMA 1MBEA 5HLHA 5TRDA 1MMNA 3VOEA 2ZJ2A 3KYDB 3PSFA 4MEXF 1ZGWA 4A3DJ 1HLVA 3HM5A 3BQZA 5BQTA 1MH3A 2EJRA 4UB8C 3F6OA 5K7ZA 1T95A 3RZOJ 4QTRA 4O5VA 4AD9A 4FX0A 3ABKH 2HKOA 4EQQA 4ANJA 2PFBA 3CUQB 2L7ZA 3EDPA 4G94A 2HOTA 2MG4A 2P6SA 3SFZA 1XGMA 4EGYA 4CGZA 1KU3A 1F9NA 2O0YA 4A6DA 2E2HJ 3BJ6A 3QRFF 1QVTA 2DA3A 4B47A 1A04A 4BY1J 4IQJA 1IN4A 3ZQLA 3S17J 1WJAA 5B5EC 2RGVA 5F0FA 5FKNA 2E5NA 2V1DA 3L1PA 3QOPA 1ITYA 1AWCA 2EFPA 3QAHA 3TOAA 4F52A 3CP8A 2UV1A 2NS8A 2P5KA 2DPDA 2EV5A 4ZDLA 5HOOA 4NC8A 2L9SA 3OWTA 3H3UA 2LKXA 2QQ9A 3NWTA 3VDXA 3EETA 4DYCA 1TWCJ 4L5JA 3K70D 1S29A 1JHFA 3Q9SA 3MKZA 1LKXA 2DMPA 4BACA 4NNJA 3JSPA 4B09A 2E34A 2W48A 2P5LC 3GTGJ 3GW2A 2BBYA 3DKWA 4Y13A 2WA0A 1MNEA 3DTEA 2IGOA 1OISA 4RAFA 2W85A 4W97A 3F23A 4RS8A 4IZZA 2LD5A 5AIQA 1XG1A 2PEXA 4LJZF 2DODA 1IRFA 2XRNA 1MJAA 1FZPB 2X6WA 4G6TB 5JLXA 3FMSA 5J1RA 2X85A 2IJLA 2BY0A 4UVAA 3JSOA 2DLLA 4BE1A 1IF1A 3PNVA 1O3RA 2QKMB 1W7PD 1MW7A 2QM3A 3GLLA 4U0WA 3V7SA 3E1SA 3LL7A 2ELJA 4UV9A 2HEOA 1GV2A 1PJRA 1MJ9A 4CZCA 1RRJA 2BXZA 1IW7F 4B8XA 2ID6A 3OIPA 2NNYA 2Z3YA 4DYRA 1RC9A 3QP6A 2FOKA 4YEJA 4C3HJ 1OCCH 4XOPA 3OSGA 3HUGA 5DS9A 2PI0A 1ZG5A 1BR1A 3TGNA 2ZJQF 3K0LA 4BNCA 2E19A 5TGTA 1KGSA 2ZB9A 3OIOA 2MA3A 4L0ZB 2VI6A 2IGKA 1ZAOA 3E5QA 3V8LA 1VQ8I 2ZXWH 4Q48A 1HSTA 5ERIA 3BPVA 2Y48A 5K5OA 1I1SA 3JRAA 3GZNB 3AFHA 3BJAA 3HOWJ 4A6EA 1GXPA 2DA1A 1JI8A 3FIWA 2EIMH 1A6QA 2F5VA 2NVQJ 2O8XA 3W6JB 3FKIJ 4KDPA 4LLNA 3C2BA 4ASNA 1GV5A 1TBXA 2XPWA 4ZYHA 4PDKA 1S9HA 4BHPA 2KMUA 3BY6A 5DDGA 4CHUA 4IHWA 3GF2A 1T39A 3ZR8X 3BR1A 3HOVJ 4OU0A 3FBNB 5EEAA 3N4MA 3M1CA 4HNVA 1WJBA 2NOGA 3PIPF 2V7FA 1AA7A 2EK5A 3DPLC 3GFMA 2K4BA 2L02A 5HDNA 4LD5A 2E1OA 5KAIC 1GXQA 5D8LB 3IHUA 4KICA 2PLYA 3S1MJ 2KRFA 3RI4A 4IX7A 3K4MA 1DPRA 1OR7A 1BM9A 3FM3A 2Y0SN 1XN7A 2K4JA 2VT2A 3KP6A 5DCMB 2HTSA 3BTCA 2ESHA 3IH3A 4BQAA 4S0HB 2H8WA 2MSYA 2MD5A 3HB9A 2LOOA 2EILH 5L3GA 3D1NI 2O61A 4RLQA 3PQKA 3H3ZA 4XOTA 1FEXA 3IKVA 3NQOA 2V4JC 5HVQC 2ZJRF 1QPIA 5HS8A 1OMIA 3CF5F 3AG1H 2CUEA 2BZTA 2KLOA 5L3DA 3SXYA 3H9GA 1O3QA 2W1OA 3CO7C 1WSUA 1XDSA 5CQGA 1BL0A 3U21A 3HXLA 1F4KA 1YRNA 1YQAA 2Y69H 3Q0UA 3N97A 1BOAA 1Y0NA 4E7KA 2M87A 3VODA 2YU3A 2FUG2 1TT0A 3HOSA 2O7OA 2M8EA 5FJ8J 3ZQFA 5E3NA 3HSRA 2L5QA 1VQMI 3L7WA 1Y56A 3ZMUA 1IUFA 3OYIA 3C2HA 1VQNI 4A3CJ 3D5LA 3HHGA 3O8GA 3WU2C 4CDGA 5L3EA 2CG4A 1Z9CA 1IC8A 1Z6TA 2VPRA 1YO5C 1LFPA 5LD2C 4KUMA 3C3WA 4A3GJ 2JPBA 1H8AC 1I1GA 2VQGA 1GUUA 1R00A 4I99C 1MH4A 2OF7A 4P9UA 1HXDA 4A0YA 3WTZA 1T33A 1AKHB 3ZQ7A 5K7FA 4H4KC 3SEQA 5DCFA 4G7HF 1N78A 3LOCA 1XD7A 4OAZA 4AWXB 5EF6A 2FX0A 1UFMA 2FEZA 2ELHA 5KAFC 3BTIA 2JSCA 1T6SA 3RCOA 2ZSIB 5HLTA 4EMSA 2LLKA 2GXBA 2A68F 1D1AA 3L2QA 5GAGJ 1LUJB 1X3ZB 3HL2A 2ZFWA 2JUGA 1MMGA 4HF2A 2FMYA 1BBYA 4KN7X 2W4SA 2Q2EB 2LDUA 3DEWA 4XKCA 2HVQA 1XSXA 1A6IA 2Q1ZB 1U5TC 5D4RA 1O4XA 3V4GA 3K9TA 4BE0A 2A6TA 3F6VA 3IC7A 1IAWA 1K4TA 4A3KJ 4D5FA 3QYFA 4CH7A 2CQXA 1M1EB 2RN7A 2IGMA 2VC0A 1W36C 5CVUA 2DQLA 3HTSB 1CQTA 1HC8A 3REOA 1B72A 3TMOA 1UHWA 3NAUA 4CCNA 2WY8Q 2CMPA 2VKHA 3Q0WA 5BOXA 4UY8I 3BZ6A 2M4GA 5CVVA 1G4DA 1WZ2A 3L2WA 3QPSA 1JT6A 2ECCA 2WV0A 2XAHA 1HQCA 2FA5A 2XUBA 1U6GA 4KT5C 2LY9A 1XTAA 3EUHC 4L5EA 5L3CA 1D8JA 2V1NA 5A2QZ 1HW1A 2H09A 2QKLB 3VSKA 2QZ8A 2KT0A 4I6ZA 2EFQA 3KEQA 5CKTA 4E7JA 1XGSA 2NVUB 1TC3C 1D3YA 4PFPA 3R6SA 2VODA 3L09A 1D0XA 3M8FA 1QQIA 3T1BA 3HRUA 2VQLA 3OYLA 5IT9Z 1E3HA 2VBZA 2UXNA 5K5RA 1BR4A 3FISA 3OMYA 1WRJA 1X3UA 2RC4A 3KYCB 4XLNF 2K02A 3GTPJ 2V26A 3K1MA 5J6XA 2LVSA 3BROA 2WTEA 5JVTA 1LDJA 4LIVA 3HJEA 3GZ6A 3KIOA 1Q1VA 2KIQA 3W2VA 2DOAA 2E2JJ 4DIQA 4MQ9F 2ME6A 2DFEA 4PUSA 4Y33A 5E79C 4IHXA 1W7PA 1YFHA 3CUOA 2JSPA 3LFUA 1J2XA 1F36A 2EIJH 1BI3A 2XVCA 4ZYGA 3ELKA 3FK6A 3ULQB 4OMYA 3HOUJ 4XBFA 3L2VA 3QU6A 4HF0A 1ZYRF 2JK3A 3A03A 4LMYA 3WTSC 3TBIA 3BPXA 3RSNA 4IL6C 4DZJA 3IRQA 3V7CA 2MLKA 3CJNA 3WTXC 4CSWA 4LOCA 4CCMA 1ZRCA 3JCUC 1RETA 2F48A 4BJ6C 4R8HA 1OLTA 4IJAA 2OQRA 4A69C 4L9JA 3KX2A 2DA5A 4NQWB 5ILVA 1VTNC 1B9NA 1N75A 1X1CA 1LEBA 2MW8A 3E6DA 2AQFA 5C44J 1ODDA 1S7EA 2CS3A 4JK1X 3E97A 2QCOA 5FROA 3DU6A 3DPTA 2CV1A 3W6KB 5C4JJ 2RREA 2DA6A 3MQ0A 1ZREA 2DO7A 2JJ7A 3JW4A 2DMTA 1FP2A 1XMAA 3E7LA 1HKSA 2KIMA 2FBIA 4BE2A 4KA4A 4DYQA 1MJBA 4HX8A 1DUXC 3PJRA 2XGXA 2XAUA 5L3BA 1FPQA 3HYIA 4BAYA 2ISZA 2Z1DA 3S3MA 1IV8A 2ME0A 2G7HA 1IRZA 1WGXA 5D5XB 5IP7J 2XRLA 3KLOA 3SDBA 1AKHA 1B9MA 1SFKA 3FWEA 3I56I 3PO2J 3ML6A 4QWQA 3JRDA 3HOTA 4J00A 3ZQCA 4BXXJ 3A01B 4N4OB 4CCKA 3DP7A 1WHUA 3WTUC 2FBHA 4D1QA 2L9NA 4XNFA 3MKLA 5M3MJ 4GO1A 4PSXA 2BE5F 2W84A 3H9QA 3PM1A 5GADJ 4Q4ZF 2DFFA 1YS6A 1XCBA 1HA8A 2HGCA 3DLLF 5B1BH 2Q2EA 1UG2A 4PZJA 4OINF 2L4MA 3WTWC 4QIWN 1H89C 1JKOC 1QBJA 3RYRA 5A2QK 2HKXA 3NRVA 4QLCU 4BUPA 2VKEA 2LREA 5DD8A 4B43A 2VBXA 1G3WA 4HLYA 3EYYA 3WODF 2DCEA 1BI2A 4LG0A 3M07A 1U8RA 2OU2A 2HQNA 1WJEA 5EZHA 1HKQA 5HDGA 5LGNA 3TO6A 2DXIA 4HQMA 1XSVA 1HW5A 3G1OA 1SAXA 3QP5A 2GXGA 1S3JA 2WADA 4RGSA 3RTRA 3I71A 2PMZN 2FXAA 4M9ZA 4BDYA 4N4NB 4RAGA 2HOAA 3ZPLA 2AO9A 2XAGA 4PCQA 1G3YA 1U9NA 1WCMJ 3HSFA 4C2MJ 5LEJA 2OTJI 4UHTA 2ESNA 2K3FA 2M30A 4ZYDA 2PBIA 3CCJI 2IS1A 1VI0A 4C30A 4DGWB 3HEFA 4FCYA 1NK3P 1K83J 3TOBA 5KVRA 2I8DA 2ETHA 1PUEE 3IWZA 4HEA2 3WHBA 2O6GE 2V79A 3B6AA 2EQRA 3RPUD 1V55H 4AVPA 1FOYA 4RGUA 4IRIA 3NARA 4A93J 3LSIA 4P55A 4HZFA 3AL0C 3DBLB 4IHYA 1SD6A 3KE2A 5H6QA 2DDAA 3FXMA 2NXNB 5B66C 2D2WA 3EQLF 4QPQA 3IAS2 4HLXA 2AXLA 2VJ5A 3ABTA 2F2EA 2DT7B 3WE2A 1JUMA 4UUSB 2JRTA 1J75A 1UHSA 2LFBA 2M2EA 4EGZA 3CQZJ 4QPOA 3QYBA 1VNDA 2B0LA 2HOEA 1VQ5I 4XLAA 2C6YA 3W3CA 2YX4A 5BS6A 4I76A 4EJOA 3G3ZA
chains in the Genus database with same CATH topology
2QYOA 4Q47A 2BGCA 2J5OA 2KJCA 2D45A 1SFXA 3KCCA 4S05A 2CYYA 1CGPA 1LDKB 3BDDA 4A2UA 1D5VA 1BJAA 1B1BA 2X4HA 4DNCA 3U1DA 2ZO4A 5E8GA 2G7UA 2XIGA 3ZP5A 4L18B 4ENKA 2IA1A 2R7DA 1FYLA 1MDMB 5J8CA 5D6EA 1FC3A 3U2RA 3G73A 1P6RA 4MHGA 4R1HA 5LRRA 2ZBKA 5DD4A 4CICA 1FSHA 2PN6A 3IWFA 4ENMA 4BH9A 4M72A 1U78A 1YIOA 4KIFA 3KP3A 1J9IA 2PQ8A 2V9VA 2FQ3A 3GX4X 1WQ2A 2RDPA 1JGSA 1LNWA 1OYIA 1ZGJA 4MTDA 4ETSA 1BIAA 2M5WA 1YTYA 3WGGA 1LJ9A 1OPCA 1FY7A 2IRFG 3TKYA 5ICCA 1Z7UA 3KEOA 3ABUA 1FBQA 5H6RA 3AAFA 4EV0A 1ULYA 3ISPA 1IZ1A 5LHHA 1W5SA 1E17A 4M6XA 2RVCA 2RQPA 4GXOA 2K86A 3QPTA 3E6MA 5ICFA 1BC7C 4I0BA 3VB2A 2DI3A 2FE3A 1SD5A 2QENA 4XSZF 3I53A 2K27A 2NS0A 4WXHA 3SQNA 5FD5A 1LQ1A 4NHJA 4MGRA 1KQ8A 4LB6B 3CDHA 5F64A 4RB1A 6PAXA 2IA0A 5HS7A 1TQMA 3ZMSA 1XGNA 4NB5A 1P4WA 4A5NA 1EH6A 5HLIA 2DT5A 1O3SA 2KJBA 2F5CA 1ZN2A 2K7LA 2EV0A 1UCRA 4L9NA 2W25A 1EH8A 2DAOA 2VE8A 1R23A 2XV4S 4YG2F 4G7ZF 1ZG3A 3FMRA 3DFGA 4PGGA 2V1XA 4G6DA 3HRSA 3FX3A 3EYIA 2L01A 2CWEA 1U2WA 3IKTA 4RAZA 4LLGF 4RB2C 1STZA 2GA1A 5ICEA 4FX4A 4ESFA 3L00A 2HR3A 2A69F 3FXUA 4HX7A 3KP5A 5FB2A 4CO8A 5TJJA 2HS5A 3TDUC 3DQVC 3ZN0A 2ISYA 1K78B 3GEZA 3J7AO 3GWZA 4H0EA 1FSEA 4U0YA 4UVCA 5FO5A 5E1WA 2P6TA 4ZH4F 3MWMA 1TNTA 1EV7A 2OZUA 4MNUA 2DTRA 4U7BA 3TQNA 1I5ZA 1KQ9A 3DEUA 5AONA 1ZG1A 2FF4A 3I0TA 2M45A 2EWNA 3GO5A 1OYYA 3CUQA 1H0MA 3T8TA 5CJ9A 1ZGAA 4XSXF 2ZCWA 3FZVA 1EH7A 1RNLA 1Y0UA 2RV8A 4LB5A 2TDXA 3RJPA 5FLXK 4RB3C 2YPRA 2NAZA 2EFOA 1XCVA 3FF5A 4YIFA 4RAYA 2VOOA 2CQKA 5FFZA 2D1VA 1CF7B 1KU7A 2YSRA 1YYVA 3E5UA 2XKPA 4KMUX 3D0SA 1JE8A 1SFEA 1Z6RA 1UHMA 4CZZA 4A5MA 3PFIA 2DFIA 5F1RA 2E1CA 4N9IA 3KZZA 2P4WA 1ZARA 2E7WA 2DK5A 1S6LA 1P4AA 4Y15A 3Q9VA 4HBLA 3HHHA 4N0BA 2E7XA 3I54A 1XB4A 4G8XA 2QQBA 4M6YA 5LGUA 1PP7U 2IP2A 4P5OA 4EJTA 3JTGA 3HTUA 5HDKA 2HQRA 4HDVA 2QBYB 5D5VB 2VC1A 4M74A 3P9KA 3J81K 1ZRDA 4EM2A 3J80Z 4RB0A 1FP1D 1Q1HA 2HTJA 3BWGA 2JZYA 2F5DA 5CVRA 3LWFA 1U5TB 2COMA 1QZZA 5D5UB 3WTVC 1RUNA 3HRMA 3K2ZA 2ZNYA 2IW5A 4EJWA 3NEUA 5LLQA 1GHCA 3GZ5A 2PMUA 4ZZLA 1TQIA 4LLLA 3M9AA 4MQVA 5CVJA 2HWVA 5DCMA 3ECOA 4L0YB 3ECHA 4M73A 1SFUA 2P7VB 3R0JA 3CO6C 2MBFA 1GVJA 1ZH5A 4KFCA 3WGHA 4HA8A 1LEAA 1TW3A 3TDZC 4Z2YA 1IN5A 2MLGA 3KETA 2HZTA 4IRHA 5JR3A 2CW0F 1TNSA 4IF4A 4A0ZA 1UB9A 2LF8A 2YR2A 3ZMTA 1BN5A 2EFWA 2D1HA 4A12A 4M71A 5D8KB 3V8KA 1IRGA 2WC2A 4HQEA 5JI6A 3E3VA 1R7JA 3SZTA 2PJPA 2W57A 4P9FA 5HS9A 5ILSA 1DPUA 3FM5A 1YW8A 1K6OA 3RKXA 3J80K 2Z33A 2A6HF 2VXZA 3JAMK 3P9IA 1YW7A 2HYGD 3TO7A 4KN4X 1B4AA 4IXAA 5FFXA 1WI9A 1BI1A 3R60A 2G9WA 4U88A 1KU2A 1Z1DA 1XDUA 1YS7A 2QBYA 5D5WB 1FLIA 1KA8A 3F8MA 2Z9OA 1FNNA 3C18A 1T0FA 3VFZA 1H9GA 4OIRF 3DF8A 2J5PA 2HDCA 3COAC 3JTHA 1P92A 4E70A 3O3KA 2W24A 2Y75A 2FMLA 3WTYC 4IRGA 3F72A 4O6JA 1MD0A 2XAQA 1U5TA 1O3TA 5D6FA 4AIHA 3F3XA 3R0AA 4RGRA 1R58A 2R3SA 1S7AA 2OZ6A 1G3TA 4UNOA 3R4KA 4Q5SF 1C0WA 4YFKF 2VE9A 1J59A 3H92A 4TV7A 3B73A 2ZNZA 3C1DA 4ENNA 4UXNA 2R7FA 1P2FA 3HIFA 1IUYA 4KYWA 3GFJA 3ZMZA 1JXSA 1DP7P 2JTVA 1J0RA 4NQWA 2IVMA 4S04A 4HW0A 2ADUA 2LNBA 3O6BB 4A0XA 5DUIA 3E5XA 2A07F 5CYVA 2GZWA 3KP7A 3HSEA 3PQJA 5ILUA 3CUQC 4OIOF 1YW9A 2FSWA 1O7LA 1Z05A 2BV6A 2IT0A 4XRFA 5LGTA 3MZYA 1SMTA 2L3DA 4HF1A 3TO9A 4M9XA 4I0AA 1J5YA 2L4AA 2NNNA 2V6CA 1I6XA 2YX7A 5JFRA 5JHUA 3LQQA 5FD6A 2X0LA 4ZYEA 3OOPA 3B02A 4U7DA 1NHAA 4I2OA 4GGGA 2DK8A 2HYFA 5KK1A 2Q0OA 3QPHA 4WXDA 3SHFA 1W4MA 4WCGA 2IPQX 2DPUA 2M1BA 4KMFA 5LRSA 2H27A 3LA2A 4N9HA 1R36A 3KP4A 3C7JA 3BJOA 5LEKA 3M1EA 4ZZDA 1FBSA 3RDIA 3ZN1A 3CLOA 1USSA 2OAZA 4HYEA 4BXUA 2Y0MA 4OIQF 2XHKA 2VONA 4LK0F 2EA4A 5IT3A 4EVIA 5FLXZ 3LA7A 1BIBA 4RGXA 4I7HA 2GWRA 2FBKA 3GVAA 1QNTA 2VBYA 3I4PA 2P7CB 3WE3A 3F8CA 4ENJA 1G3SA 3DXJF 4UV8A 4GYGA 3WTTC 4XLPF 2CSOA 3P9CA 2QLZA 4ESBA 4IPAA 4GYIA 1XSDA 2KKOA 4WF2A 3RKYA 3GUDA 5E17F 1LDDA 4PGHA 1KQ0A 1OYWA 2A5YB 4I98B 1FYMA 3CTAA 4OOIA 2NRAC 5K5QA 1HBXG 1IN6A 1R1TA 2H6CA 2CGPA 4EJUA 2KIUA 4BHBA 2MH9A 1R1UA 1MDMA 5L3FA 3F8FA 3J81Z 2CFXA 3K1NA 2HFHA 3K69A 1REPC 3RPUA 1J7KA 1D8KA 2LSOA 3M7GA 4OMZA 4G9YA 2ZMEB 2PG4A 4L5IA 1T98A 1HW2A 1H9TA 2DQRA 3QU3A 1O57A 5LBQA 1U3EM 3R61A 2RKHA 3I5UA 4FT8A 3O2PE 5BPIA 3E6BA 1W7PB 1LVAA 2UXXA 1TTYA 1KU9A 4O3MA 1XMKA 2OA4A 5H20A 2VBWA 5E18F 2AS5F 1L0OC 4GCVA 2XAFA 3ZMDA 3IL2A 1YLFA 5CLSA 3KLNA 3RPQA 4EJVA 4I09A 4WWCA 1TW2A 2EV6A 3IRRA 4YFNF 4HOBA 2KIFA 1SD7A 4G6QA 3I59B 3BP8A 3V8JA 2FNAA 3U9GA 1K79A 2VN2A 1QZYA 2STTA 3WG9A 4EM1A 3F21A 1B6AA 1ZRFA 2FRHA 1RZ4A 3LSTA 1T38A 2JPCA 3I64A 2QWWA 4IVNA 3DV8A 1MZBA 4CYDA 2QUFA 2IA2A 2DW4A 4YIIA 1FT9A 1AOYA 2QQAA 4I02A 1I27A 2A3SA 1WWXA 1S8NA 4LFUA 2E1NA 2GAUA 1BC8C 4IHTA 3V7RA 1FBUA 4CXFA 1RI7A 1IXSB 3FMQA 1DDNA 5DEQA 2ACJA 4LG0B 1QO0D 1KYZA 3JAMZ 5E8IA 4WX9A 1O7FA 4AIKA 4FHTA 5ICGA 2MC3A 1F5TA 2F5EA 1F1ZA 2VOPA 2A61A 1Z91A 1V3FA 5CVIA 2O03A 2MH2A 3F8NA 1IXCA 1K78A 4YFXF 1R5GA 3WU0A 2CO5A 4HAMA 1V4RA 5LHIA 1ONVA 1ON2A 1LB2A 1TLHB 2ZMEA 3LAJA 2ZKZA 2DBBA 1SMYF 5FGMA 3GFIA 2P5VA 3L2CA 4L9VA 3WU1B 1MKMA 1PDNC 2LF7A 4DQ2A 4KNYA 2UZKA 1R1VA 2FU4A 1IXRC 2V1UA 2PMHA 3M8EA 2EB7A 2BEOA 4OIPF 2A6EF 5E1ZB 1FX7A 3RIRA 2OBPA 3MFKA 5J8FA 1B59A 1ZLJA 1RUOA 2WWYA 3LQRA 2ZXJA 2XROA 4BYYA 3MEXA 5BMZA 1ON1A 2GIVA 1MGTA 4G7OF 5HLGA 5DUKA 4MTEA 3I59A 1CF7A 5E1XA 1R22A 5LHGA 4KIBA 1HKTA 4ON0A 4MEYF 3LA3A 1P4XA 4HDUA 2XAJA 4IHSA 2Q8KA 1QPMA 4LGWA 3VEPA 2RNJA 1G6NA 5DV5A 1SD4A 1ZHFA 1QGPA 3RYPA 4LK1F 3GLXA 5DYMA 1OKRA 1E2XA 3T8RA 3KFWX 2LKPA 2Z99A 5K1YA 4WK8F 1IN8A 4R79A 2EFNA 4I01A 4L9TA 1PP8F 2F5FA 2XASA 1K7AA 4JBAA 4D0PA 3KZYA 2Z5UA 1IN7A 3MCZA 3GXOA 5IT9K 3RKWA 2JT1A 4ESJA 1R5HA 5AIPA 2O3FA 3T5XA 3LFKA 4KIGA 2STWA 4K2EA 1ZLKA 1USTA 4UVBA 5EEHA 4UUVA 2BYVE 2XKOA 1JHHA 3K1PA 2NYXA 2OD5A 3F22A 1BI0A 3GYHX 3FHZA 3OV8A 2H94A 2L54A 2P8TA 3P7NA 3I58A 2QVOA 1RIOH 4AIJA 4HV5A 3T0YA 1W5TA 3WGIA 1HSJA 2OQGA 3EUHA 4Y17A 1FWZA 1KYWA 1L3LA 4P96A 1T2KA 4U0VA 2EA2A 1TQPA 2VT3A 5ED4A 5BPDA 3F8BA 3MZHA 3S2WA 4JQFA 4HV6A 5EEGA 3ERED 3L9FA 3KP2A 1FOKA 5F6FA 2H6BA 4WXCA 5D4SA 2DU9A 3ROUA 2GA2A 3LAPA 4EM0B 4HX4A 3SZPA 3ZMVA 4F7ZA 3E6CC 1S7OA 3FXRA 2FNPA 1XGOA 3MAJA 3FXQA 4BHCA 3BOQA 1YG2A 1FYKA 4M9SA 2UWMA 2GQQA 3GFLA 3HRTA 3Q5FA 5E20A 1WKMA 5HLHA 5TRDA 3VOEA 2ZJ2A 4MEXF 5BQTA 2EJRA 3F6OA 4O5VA 4AD9A 4FX0A 2HKOA 4EQQA 2PFBA 3CUQB 3EDPA 4G94A 2P6SA 3SFZA 1XGMA 4EGYA 4CGZA 1KU3A 1F9NA 2O0YA 4A6DA 3BJ6A 3QRFF 1A04A 1IN4A 2RGVA 2V1DA 3QOPA 1AWCA 2EFPA 3QAHA 3TOAA 2P5KA 2DPDA 2EV5A 5HOOA 3H3UA 2QQ9A 3EETA 4L5JA 1S29A 1JHFA 3Q9SA 3JSPA 4B09A 2P5LC 3GW2A 2BBYA 3DKWA 4Y13A 2W85A 3F23A 4RS8A 5AIQA 4LJZF 2PEXA 1IRFA 2XRNA 1MJAA 1FZPB 3FMSA 2IJLA 4UVAA 3JSOA 2DLLA 1IF1A 1O3RA 1W7PD 2QM3A 4U0WA 3V7SA 4UV9A 2HEOA 1MJ9A 1IW7F 4B8XA 2NNYA 2Z3YA 3QP6A 2FOKA 3HUGA 2PI0A 1ZG5A 3TGNA 3K0LA 4BNCA 1KGSA 2MA3A 4L0ZB 3E5QA 1ZAOA 3V8LA 4Q48A 1HSTA 5ERIA 3BPVA 2Y48A 5K5OA 1I1SA 3BJAA 4A6EA 1GXPA 2O8XA 3W6JB 4KDPA 4LLNA 4ASNA 1TBXA 4ZYHA 4PDKA 4BHPA 5DDGA 3BY6A 4CHUA 3GF2A 1T39A 4OU0A 3N4MA 2EK5A 3DPLC 3GFMA 2K4BA 2L02A 5HDNA 4LD5A 5D8LB 1GXQA 3IHUA 4KICA 2PLYA 2KRFA 3RI4A 1DPRA 1OR7A 1BM9A 3FM3A 1XN7A 2K4JA 2VT2A 3KP6A 5DCMB 2HTSA 2ESHA 4BQAA 2MD5A 5L3GA 2O61A 3PQKA 3H3ZA 3IKVA 3NQOA 5HVQC 5HS8A 1OMIA 3SXYA 5L3DA 1O3QA 3CO7C 1WSUA 1XDSA 1F4KA 1YQAA 3N97A 1BOAA 2M87A 3VODA 2YU3A 3HOSA 2M8EA 3HSRA 3L7WA 3ZMUA 3D5LA 3HHGA 4CDGA 5L3EA 2CG4A 1Z9CA 1Z6TA 1YO5C 4KUMA 3C3WA 2JPBA 1I1GA 1R00A 4P9UA 1HXDA 4A0YA 3WTZA 3ZQ7A 5DCFA 4G7HF 1XD7A 4AWXB 1UFMA 2FEZA 2ELHA 2JSCA 1T6SA 4EMSA 2GXBA 2A68F 2ZFWA 4HF2A 2FMYA 1BBYA 4KN7X 2LDUA 1XSXA 1U5TC 5D4RA 3V4GA 3K9TA 3F6VA 3IC7A 1IAWA 2RN7A 3HTSB 2VC0A 5CVUA 2DQLA 3REOA 1UHWA 5BOXA 3BZ6A 5CVVA 1G4DA 2WV0A 2XAHA 1HQCA 2FA5A 2XUBA 1U6GA 4KT5C 1D8JA 5L3CA 5A2QZ 1HW1A 2H09A 2QZ8A 2EFQA 3KEQA 1XGSA 1D3YA 3R6SA 2VODA 3L09A 3M8FA 1QQIA 3T1BA 3HRUA 5IT9Z 2VBZA 2UXNA 5K5RA 1WRJA 1X3UA 2RC4A 4XLNF 2K02A 3K1MA 5J6XA 3BROA 2WTEA 5JVTA 1LDJA 3GZ6A 4MQ9F 1W7PA 1YFHA 3CUOA 1J2XA 1BI3A 2XVCA 4ZYGA 3ELKA 3ULQB 4OMYA 4XBFA 3QU6A 4HF0A 1ZYRF 4LMYA 3WTSC 3BPXA 3IRQA 3V7CA 2MLKA 3CJNA 3WTXC 1ZRCA 4R8HA 4IJAA 5ILVA 2OQRA 4L9JA 1VTNC 1B9NA 1LEBA 3E6DA 1ODDA 4JK1X 3E97A 3DPTA 3W6KB 3MQ0A 1ZREA 2DO7A 3JW4A 1FP2A 1XMAA 1HKSA 2KIMA 2FBIA 4KA4A 1MJBA 4HX8A 1DUXC 2XGXA 5L3BA 1FPQA 3HYIA 4BAYA 2ISZA 2G7HA 5D5XB 3KLOA 1B9MA 3FWEA 3ML6A 4QWQA 3HOTA 3DP7A 3WTUC 2FBHA 4GO1A 2BE5F 2W84A 4Q4ZF 1YS6A 1XCBA 2HGCA 2Q2EA 4PZJA 4OINF 2L4MA 3WTWC 1QBJA 3RYRA 5A2QK 2HKXA 3NRVA 4QLCU 5DD8A 2VBXA 1G3WA 4HLYA 3EYYA 3WODF 1BI2A 4LG0A 1U8RA 2OU2A 2HQNA 5HDGA 1HKQA 5LGNA 3TO6A 4HQMA 1XSVA 1HW5A 1SAXA 3QP5A 2GXGA 1S3JA 4RGSA 3RTRA 3I71A 2FXAA 4M9ZA 3ZPLA 2XAGA 4PCQA 1G3YA 3HSFA 5LEJA 4UHTA 2ESNA 2M30A 4ZYDA 2PBIA 3TOBA 5KVRA 2ETHA 1PUEE 3IWZA 2O6GE 2V79A 4AVPA 4IRIA 4RGUA 4P55A 4HZFA 1SD6A 3KE2A 5H6QA 2D2WA 3EQLF 4HLXA 2AXLA 3ABTA 2F2EA 3WE2A 1J75A 2JRTA 4EGZA 2B0LA 2HOEA 2C6YA 2YX4A 5BS6A 4EJOA 3G3ZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2QYO A;  4Q47 A;  2BGC A;  2J5O A;  2KJC A;  2D45 A;  1SFX A;  3KCC A;  4S05 A;  2CYY A;  1CGP A;  1LDK B;  3BDD A;  4A2U A;  1D5V A;  1BJA A;  1B1B A;  2X4H A;  4DNC A;  3U1D A;  2ZO4 A;  5E8G A;  2G7U A;  2XIG A;  3ZP5 A;  4L18 B;  4ENK A;  2IA1 A;  2R7D A;  1FYL A;  1MDM B;  5J8C A;  5D6E A;  1FC3 A;  3U2R A;  3G73 A;  1P6R A;  4MHG A;  4R1H A;  5LRR A;  2ZBK A;  5DD4 A;  4CIC A;  1FSH A;  2PN6 A;  3IWF A;  4ENM A;  4BH9 A;  4M72 A;  1U78 A;  1YIO A;  4KIF A;  3KP3 A;  1J9I A;  2PQ8 A;  2V9V A;  2FQ3 A;  3GX4 X;  1WQ2 A;  2RDP A;  1JGS A;  1LNW A;  1OYI A;  1ZGJ A;  4MTD A;  4ETS A;  1BIA A;  2M5W A;  1YTY A;  3WGG A;  1LJ9 A;  1OPC A;  1FY7 A;  2IRF G;  3TKY A;  5ICC A;  1Z7U A;  3KEO A;  3ABU A;  1FBQ A;  5H6R A;  3AAF A;  4EV0 A;  1ULY A;  3ISP A;  1IZ1 A;  5LHH A;  1W5S A;  1E17 A;  4M6X A;  2RVC A;  2RQP A;  4GXO A;  2K86 A;  3QPT A;  3E6M A;  5ICF A;  1BC7 C;  4I0B A;  3VB2 A;  2DI3 A;  2FE3 A;  1SD5 A;  2QEN A;  4XSZ F;  3I53 A;  2K27 A;  2NS0 A;  4WXH A;  3SQN A;  5FD5 A;  1LQ1 A;  4NHJ A;  4MGR A;  1KQ8 A;  4LB6 B;  3CDH A;  5F64 A;  4RB1 A;  6PAX A;  2IA0 A;  5HS7 A;  1TQM A;  3ZMS A;  1XGN A;  4NB5 A;  1P4W A;  4A5N A;  1EH6 A;  5HLI A;  2DT5 A;  1O3S A;  2KJB A;  2F5C A;  1ZN2 A;  2K7L A;  2EV0 A;  1UCR A;  4L9N A;  2W25 A;  1EH8 A;  2DAO A;  2VE8 A;  1R23 A;  2XV4 S;  4YG2 F;  4G7Z F;  1ZG3 A;  3FMR A;  3DFG A;  4PGG A;  2V1X A;  4G6D A;  3HRS A;  3FX3 A;  3EYI A;  2L01 A;  2CWE A;  1U2W A;  3IKT A;  4RAZ A;  4LLG F;  4RB2 C;  1STZ A;  2GA1 A;  5ICE A;  4FX4 A;  4ESF A;  3L00 A;  2HR3 A;  2A69 F;  3FXU A;  4HX7 A;  3KP5 A;  5FB2 A;  4CO8 A;  5TJJ A;  2HS5 A;  3TDU C;  3DQV C;  3ZN0 A;  2ISY A;  1K78 B;  3GEZ A;  3J7A O;  3GWZ A;  4H0E A;  1FSE A;  4U0Y A;  4UVC A;  5FO5 A;  5E1W A;  2P6T A;  4ZH4 F;  3MWM A;  1TNT A;  1EV7 A;  2OZU A;  4MNU A;  2DTR A;  4U7B A;  3TQN A;  1I5Z A;  1KQ9 A;  3DEU A;  5AON A;  1ZG1 A;  2FF4 A;  3I0T A;  2M45 A;  2EWN A;  3GO5 A;  1OYY A;  3CUQ A;  1H0M A;  3T8T A;  5CJ9 A;  1ZGA A;  4XSX F;  2ZCW A;  3FZV A;  1EH7 A;  1RNL A;  1Y0U A;  2RV8 A;  4LB5 A;  2TDX A;  3RJP A;  5FLX K;  4RB3 C;  2YPR A;  2NAZ A;  2EFO A;  1XCV A;  3FF5 A;  4YIF A;  4RAY A;  2VOO A;  2CQK A;  5FFZ A;  2D1V A;  1CF7 B;  1KU7 A;  2YSR A;  1YYV A;  3E5U A;  2XKP A;  4KMU X;  3D0S A;  1JE8 A;  1SFE A;  1Z6R A;  1UHM A;  4CZZ A;  4A5M A;  3PFI A;  2DFI A;  5F1R A;  2E1C A;  4N9I A;  3KZZ A;  2P4W A;  1ZAR A;  2E7W A;  2DK5 A;  1S6L A;  1P4A A;  4Y15 A;  3Q9V A;  4HBL A;  3HHH A;  4N0B A;  2E7X A;  3I54 A;  1XB4 A;  4G8X A;  2QQB A;  4M6Y A;  5LGU A;  1PP7 U;  2IP2 A;  4P5O A;  4EJT A;  3JTG A;  3HTU A;  5HDK A;  2HQR A;  4HDV A;  2QBY B;  5D5V B;  2VC1 A;  4M74 A;  3P9K A;  3J81 K;  1ZRD A;  4EM2 A;  3J80 Z;  4RB0 A;  1FP1 D;  1Q1H A;  2HTJ A;  3BWG A;  2JZY A;  2F5D A;  5CVR A;  3LWF A;  1U5T B;  2COM A;  1QZZ A;  5D5U B;  3WTV C;  1RUN A;  3HRM A;  3K2Z A;  2ZNY A;  2IW5 A;  4EJW A;  3NEU A;  5LLQ A;  1GHC A;  3GZ5 A;  2PMU A;  4ZZL A;  1TQI A;  4LLL A;  3M9A A;  4MQV A;  5CVJ A;  2HWV A;  5DCM A;  3ECO A;  4L0Y B;  3ECH A;  4M73 A;  1SFU A;  2P7V B;  3R0J A;  3CO6 C;  2MBF A;  1GVJ A;  1ZH5 A;  4KFC A;  3WGH A;  4HA8 A;  1LEA A;  1TW3 A;  3TDZ C;  4Z2Y A;  1IN5 A;  2MLG A;  3KET A;  2HZT A;  4IRH A;  5JR3 A;  2CW0 F;  1TNS A;  4IF4 A;  4A0Z A;  1UB9 A;  2LF8 A;  2YR2 A;  3ZMT A;  1BN5 A;  2EFW A;  2D1H A;  4A12 A;  4M71 A;  5D8K B;  3V8K A;  1IRG A;  2WC2 A;  4HQE A;  5JI6 A;  3E3V A;  1R7J A;  3SZT A;  2PJP A;  2W57 A;  4P9F A;  5HS9 A;  5ILS A;  1DPU A;  3FM5 A;  1YW8 A;  1K6O A;  3RKX A;  3J80 K;  2Z33 A;  2A6H F;  2VXZ A;  3JAM K;  3P9I A;  1YW7 A;  2HYG D;  3TO7 A;  4KN4 X;  1B4A A;  4IXA A;  5FFX A;  1WI9 A;  1BI1 A;  3R60 A;  2G9W A;  4U88 A;  1KU2 A;  1Z1D A;  1XDU A;  1YS7 A;  2QBY A;  5D5W B;  1FLI A;  1KA8 A;  3F8M A;  2Z9O A;  1FNN A;  3C18 A;  1T0F A;  3VFZ A;  1H9G A;  4OIR F;  3DF8 A;  2J5P A;  2HDC A;  3COA C;  3JTH A;  1P92 A;  4E70 A;  3O3K A;  2W24 A;  2Y75 A;  2FML A;  3WTY C;  4IRG A;  3F72 A;  4O6J A;  1MD0 A;  2XAQ A;  1U5T A;  1O3T A;  5D6F A;  4AIH A;  3F3X A;  3R0A A;  4RGR A;  1R58 A;  2R3S A;  1S7A A;  2OZ6 A;  1G3T A;  4UNO A;  3R4K A;  4Q5S F;  1C0W A;  4YFK F;  2VE9 A;  1J59 A;  3H92 A;  4TV7 A;  3B73 A;  2ZNZ A;  3C1D A;  4ENN A;  4UXN A;  2R7F A;  1P2F A;  3HIF A;  1IUY A;  4KYW A;  3GFJ A;  3ZMZ A;  1JXS A;  1DP7 P;  2JTV A;  1J0R A;  4NQW A;  2IVM A;  4S04 A;  4HW0 A;  2ADU A;  2LNB A;  3O6B B;  4A0X A;  5DUI A;  3E5X A;  2A07 F;  5CYV A;  2GZW A;  3KP7 A;  3HSE A;  3PQJ A;  5ILU A;  3CUQ C;  4OIO F;  1YW9 A;  2FSW A;  1O7L A;  1Z05 A;  2BV6 A;  2IT0 A;  4XRF A;  5LGT A;  3MZY A;  1SMT A;  2L3D A;  4HF1 A;  3TO9 A;  4M9X A;  4I0A A;  1J5Y A;  2L4A A;  2NNN A;  2V6C A;  1I6X A;  2YX7 A;  5JFR A;  5JHU A;  3LQQ A;  5FD6 A;  2X0L A;  4ZYE A;  3OOP A;  3B02 A;  4U7D A;  1NHA A;  4I2O A;  4GGG A;  2DK8 A;  2HYF A;  5KK1 A;  2Q0O A;  3QPH A;  4WXD A;  3SHF A;  1W4M A;  4WCG A;  2IPQ X;  2DPU A;  2M1B A;  4KMF A;  5LRS A;  2H27 A;  3LA2 A;  4N9H A;  1R36 A;  3KP4 A;  3C7J A;  3BJO A;  5LEK A;  3M1E A;  4ZZD A;  1FBS A;  3RDI A;  3ZN1 A;  3CLO A;  1USS A;  2OAZ A;  4HYE A;  4BXU A;  2Y0M A;  4OIQ F;  2XHK A;  2VON A;  4LK0 F;  2EA4 A;  5IT3 A;  4EVI A;  5FLX Z;  3LA7 A;  1BIB A;  4RGX A;  4I7H A;  2GWR A;  2FBK A;  3GVA A;  1QNT A;  2VBY A;  3I4P A;  2P7C B;  3WE3 A;  3F8C A;  4ENJ A;  1G3S A;  3DXJ F;  4UV8 A;  4GYG A;  3WTT C;  4XLP F;  2CSO A;  3P9C A;  2QLZ A;  4ESB A;  4IPA A;  4GYI A;  1XSD A;  2KKO A;  4WF2 A;  3RKY A;  3GUD A;  5E17 F;  1LDD A;  4PGH A;  1KQ0 A;  1OYW A;  2A5Y B;  4I98 B;  1FYM A;  3CTA A;  4OOI A;  2NRA C;  5K5Q A;  1HBX G;  1IN6 A;  1R1T A;  2H6C A;  2CGP A;  4EJU A;  2KIU A;  4BHB A;  2MH9 A;  1R1U A;  1MDM A;  5L3F A;  3F8F A;  3J81 Z;  2CFX A;  3K1N A;  2HFH A;  3K69 A;  1REP C;  3RPU A;  1J7K A;  1D8K A;  2LSO A;  3M7G A;  4OMZ A;  4G9Y A;  2ZME B;  2PG4 A;  4L5I A;  1T98 A;  1HW2 A;  1H9T A;  2DQR A;  3QU3 A;  1O57 A;  5LBQ A;  1U3E M;  3R61 A;  2RKH A;  3I5U A;  4FT8 A;  3O2P E;  5BPI A;  3E6B A;  1W7P B;  1LVA A;  2UXX A;  1TTY A;  1KU9 A;  4O3M A;  1XMK A;  2OA4 A;  5H20 A;  2VBW A;  5E18 F;  2AS5 F;  1L0O C;  4GCV A;  2XAF A;  3ZMD A;  3IL2 A;  1YLF A;  5CLS A;  3KLN A;  3RPQ A;  4EJV A;  4I09 A;  4WWC A;  1TW2 A;  2EV6 A;  3IRR A;  4YFN F;  4HOB A;  2KIF A;  1SD7 A;  4G6Q A;  3I59 B;  3BP8 A;  3V8J A;  2FNA A;  3U9G A;  1K79 A;  2VN2 A;  1QZY A;  2STT A;  3WG9 A;  4EM1 A;  3F21 A;  1B6A A;  1ZRF A;  2FRH A;  1RZ4 A;  3LST A;  1T38 A;  2JPC A;  3I64 A;  2QWW A;  4IVN A;  3DV8 A;  1MZB A;  4CYD A;  2QUF A;  2IA2 A;  2DW4 A;  4YII A;  1FT9 A;  1AOY A;  2QQA A;  4I02 A;  1I27 A;  2A3S A;  1WWX A;  1S8N A;  4LFU A;  2E1N A;  2GAU A;  1BC8 C;  4IHT A;  3V7R A;  1FBU A;  4CXF A;  1RI7 A;  1IXS B;  3FMQ A;  1DDN A;  5DEQ A;  2ACJ A;  4LG0 B;  1QO0 D;  1KYZ A;  3JAM Z;  5E8I A;  4WX9 A;  1O7F A;  4AIK A;  4FHT A;  5ICG A;  2MC3 A;  1F5T A;  2F5E A;  1F1Z A;  2VOP A;  2A61 A;  1Z91 A;  1V3F A;  5CVI A;  2O03 A;  2MH2 A;  3F8N A;  1IXC A;  1K78 A;  4YFX F;  1R5G A;  3WU0 A;  2CO5 A;  4HAM A;  1V4R A;  5LHI A;  1ONV A;  1ON2 A;  1LB2 A;  1TLH B;  2ZME A;  3LAJ A;  2ZKZ A;  2DBB A;  1SMY F;  5FGM A;  3GFI A;  2P5V A;  3L2C A;  4L9V A;  3WU1 B;  1MKM A;  1PDN C;  2LF7 A;  4DQ2 A;  4KNY A;  2UZK A;  1R1V A;  2FU4 A;  1IXR C;  2V1U A;  2PMH A;  3M8E A;  2EB7 A;  2BEO A;  4OIP F;  2A6E F;  5E1Z B;  1FX7 A;  3RIR A;  2OBP A;  3MFK A;  5J8F A;  1B59 A;  1ZLJ A;  1RUO A;  2WWY A;  3LQR A;  2ZXJ A;  2XRO A;  4BYY A;  3MEX A;  5BMZ A;  1ON1 A;  2GIV A;  1MGT A;  4G7O F;  5HLG A;  5DUK A;  4MTE A;  3I59 A;  1CF7 A;  5E1X A;  1R22 A;  5LHG A;  4KIB A;  1HKT A;  4ON0 A;  4MEY F;  3LA3 A;  1P4X A;  4HDU A;  2XAJ A;  4IHS A;  2Q8K A;  1QPM A;  4LGW A;  3VEP A;  2RNJ A;  1G6N A;  5DV5 A;  1SD4 A;  1ZHF A;  1QGP A;  3RYP A;  4LK1 F;  3GLX A;  5DYM A;  1OKR A;  1E2X A;  3T8R A;  3KFW X;  2LKP A;  2Z99 A;  5K1Y A;  4WK8 F;  1IN8 A;  4R79 A;  2EFN A;  4I01 A;  4L9T A;  1PP8 F;  2F5F A;  2XAS A;  1K7A A;  4JBA A;  4D0P A;  3KZY A;  2Z5U A;  1IN7 A;  3MCZ A;  3GXO A;  5IT9 K;  3RKW A;  2JT1 A;  4ESJ A;  1R5H A;  5AIP A;  2O3F A;  3T5X A;  3LFK A;  4KIG A;  2STW A;  4K2E A;  1ZLK A;  1UST A;  4UVB A;  5EEH A;  4UUV A;  2BYV E;  2XKO A;  1JHH A;  3K1P A;  2NYX A;  2OD5 A;  3F22 A;  1BI0 A;  3GYH X;  3FHZ A;  3OV8 A;  2H94 A;  2L54 A;  2P8T A;  3P7N A;  3I58 A;  2QVO A;  1RIO H;  4AIJ A;  4HV5 A;  3T0Y A;  1W5T A;  3WGI A;  1HSJ A;  2OQG A;  3EUH A;  4Y17 A;  1FWZ A;  1KYW A;  1L3L A;  4P96 A;  1T2K A;  4U0V A;  2EA2 A;  1TQP A;  2VT3 A;  5ED4 A;  5BPD A;  3F8B A;  3MZH A;  3S2W A;  4JQF A;  4HV6 A;  5EEG A;  3ERE D;  3L9F A;  3KP2 A;  1FOK A;  5F6F A;  2H6B A;  4WXC A;  5D4S A;  2DU9 A;  3ROU A;  2GA2 A;  3LAP A;  4EM0 B;  4HX4 A;  3SZP A;  3ZMV A;  4F7Z A;  3E6C C;  1S7O A;  3FXR A;  2FNP A;  1XGO A;  3MAJ A;  3FXQ A;  4BHC A;  3BOQ A;  1YG2 A;  1FYK A;  4M9S A;  2UWM A;  2GQQ A;  3GFL A;  3HRT A;  3Q5F A;  5E20 A;  1WKM A;  5HLH A;  5TRD A;  3VOE A;  2ZJ2 A;  4MEX F;  5BQT A;  2EJR A;  3F6O A;  4O5V A;  4AD9 A;  4FX0 A;  2HKO A;  4EQQ A;  2PFB A;  3CUQ B;  3EDP A;  4G94 A;  2P6S A;  3SFZ A;  1XGM A;  4EGY A;  4CGZ A;  1KU3 A;  1F9N A;  2O0Y A;  4A6D A;  3BJ6 A;  3QRF F;  1A04 A;  1IN4 A;  2RGV A;  2V1D A;  3QOP A;  1AWC A;  2EFP A;  3QAH A;  3TOA A;  2P5K A;  2DPD A;  2EV5 A;  5HOO A;  3H3U A;  2QQ9 A;  3EET A;  4L5J A;  1S29 A;  1JHF A;  3Q9S A;  3JSP A;  4B09 A;  2P5L C;  3GW2 A;  2BBY A;  3DKW A;  4Y13 A;  2W85 A;  3F23 A;  4RS8 A;  5AIQ A;  4LJZ F;  2PEX A;  1IRF A;  2XRN A;  1MJA A;  1FZP B;  3FMS A;  2IJL A;  4UVA A;  3JSO A;  2DLL A;  1IF1 A;  1O3R A;  1W7P D;  2QM3 A;  4U0W A;  3V7S A;  4UV9 A;  2HEO A;  1MJ9 A;  1IW7 F;  4B8X A;  2NNY A;  2Z3Y A;  3QP6 A;  2FOK A;  3HUG A;  2PI0 A;  1ZG5 A;  3TGN A;  3K0L A;  4BNC A;  1KGS A;  2MA3 A;  4L0Z B;  3E5Q A;  1ZAO A;  3V8L A;  4Q48 A;  1HST A;  5ERI A;  3BPV A;  2Y48 A;  5K5O A;  1I1S A;  3BJA A;  4A6E A;  1GXP A;  2O8X A;  3W6J B;  4KDP A;  4LLN A;  4ASN A;  1TBX A;  4ZYH A;  4PDK A;  4BHP A;  5DDG A;  3BY6 A;  4CHU A;  3GF2 A;  1T39 A;  4OU0 A;  3N4M A;  2EK5 A;  3DPL C;  3GFM A;  2K4B A;  2L02 A;  5HDN A;  4LD5 A;  5D8L B;  1GXQ A;  3IHU A;  4KIC A;  2PLY A;  2KRF A;  3RI4 A;  1DPR A;  1OR7 A;  1BM9 A;  3FM3 A;  1XN7 A;  2K4J A;  2VT2 A;  3KP6 A;  5DCM B;  2HTS A;  2ESH A;  4BQA A;  2MD5 A;  5L3G A;  2O61 A;  3PQK A;  3H3Z A;  3IKV A;  3NQO A;  5HVQ C;  5HS8 A;  1OMI A;  3SXY A;  5L3D A;  1O3Q A;  3CO7 C;  1WSU A;  1XDS A;  1F4K A;  1YQA A;  3N97 A;  1BOA A;  2M87 A;  3VOD A;  2YU3 A;  3HOS A;  2M8E A;  3HSR A;  3L7W A;  3ZMU A;  3D5L A;  3HHG A;  4CDG A;  5L3E A;  2CG4 A;  1Z9C A;  1Z6T A;  1YO5 C;  4KUM A;  3C3W A;  2JPB A;  1I1G A;  1R00 A;  4P9U A;  1HXD A;  4A0Y A;  3WTZ A;  3ZQ7 A;  5DCF A;  4G7H F;  1XD7 A;  4AWX B;  1UFM A;  2FEZ A;  2ELH A;  2JSC A;  1T6S A;  4EMS A;  2GXB A;  2A68 F;  2ZFW A;  4HF2 A;  2FMY A;  1BBY A;  4KN7 X;  2LDU A;  1XSX A;  1U5T C;  5D4R A;  3V4G A;  3K9T A;  3F6V A;  3IC7 A;  1IAW A;  2RN7 A;  3HTS B;  2VC0 A;  5CVU A;  2DQL A;  3REO A;  1UHW A;  5BOX A;  3BZ6 A;  5CVV A;  1G4D A;  2WV0 A;  2XAH A;  1HQC A;  2FA5 A;  2XUB A;  1U6G A;  4KT5 C;  1D8J A;  5L3C A;  5A2Q Z;  1HW1 A;  2H09 A;  2QZ8 A;  2EFQ A;  3KEQ A;  1XGS A;  1D3Y A;  3R6S A;  2VOD A;  3L09 A;  3M8F A;  1QQI A;  3T1B A;  3HRU A;  5IT9 Z;  2VBZ A;  2UXN A;  5K5R A;  1WRJ A;  1X3U A;  2RC4 A;  4XLN F;  2K02 A;  3K1M A;  5J6X A;  3BRO A;  2WTE A;  5JVT A;  1LDJ A;  3GZ6 A;  4MQ9 F;  1W7P A;  1YFH A;  3CUO A;  1J2X A;  1BI3 A;  2XVC A;  4ZYG A;  3ELK A;  3ULQ B;  4OMY A;  4XBF A;  3QU6 A;  4HF0 A;  1ZYR F;  4LMY A;  3WTS C;  3BPX A;  3IRQ A;  3V7C A;  2MLK A;  3CJN A;  3WTX C;  1ZRC A;  4R8H A;  4IJA A;  5ILV A;  2OQR A;  4L9J A;  1VTN C;  1B9N A;  1LEB A;  3E6D A;  1ODD A;  4JK1 X;  3E97 A;  3DPT A;  3W6K B;  3MQ0 A;  1ZRE A;  2DO7 A;  3JW4 A;  1FP2 A;  1XMA A;  1HKS A;  2KIM A;  2FBI A;  4KA4 A;  1MJB A;  4HX8 A;  1DUX C;  2XGX A;  5L3B A;  1FPQ A;  3HYI A;  4BAY A;  2ISZ A;  2G7H A;  5D5X B;  3KLO A;  1B9M A;  3FWE A;  3ML6 A;  4QWQ A;  3HOT A;  3DP7 A;  3WTU C;  2FBH A;  4GO1 A;  2BE5 F;  2W84 A;  4Q4Z F;  1YS6 A;  1XCB A;  2HGC A;  2Q2E A;  4PZJ A;  4OIN F;  2L4M A;  3WTW C;  1QBJ A;  3RYR A;  5A2Q K;  2HKX A;  3NRV A;  4QLC U;  5DD8 A;  2VBX A;  1G3W A;  4HLY A;  3EYY A;  3WOD F;  1BI2 A;  4LG0 A;  1U8R A;  2OU2 A;  2HQN A;  5HDG A;  1HKQ A;  5LGN A;  3TO6 A;  4HQM A;  1XSV A;  1HW5 A;  1SAX A;  3QP5 A;  2GXG A;  1S3J A;  4RGS A;  3RTR A;  3I71 A;  2FXA A;  4M9Z A;  3ZPL A;  2XAG A;  4PCQ A;  1G3Y A;  3HSF A;  5LEJ A;  4UHT A;  2ESN A;  2M30 A;  4ZYD A;  2PBI A;  3TOB A;  5KVR A;  2ETH A;  1PUE E;  3IWZ A;  2O6G E;  2V79 A;  4AVP A;  4IRI A;  4RGU A;  4P55 A;  4HZF A;  1SD6 A;  3KE2 A;  5H6Q A;  2D2W A;  3EQL F;  4HLX A;  2AXL A;  3ABT A;  2F2E A;  3WE2 A;  1J75 A;  2JRT A;  4EGZ A;  2B0L A;  2HOE A;  2C6Y A;  2YX4 A;  5BS6 A;  4EJO A;  3G3Z A; 
#chains in the Genus database with same CATH topology
 1HDP A;  2KQR A;  2QYO A;  4HPQ A;  4Q47 A;  4HSR A;  2BGC A;  4F55 A;  2J5O A;  2KJC A;  1LFU P;  2D45 A;  1V5F A;  2L7M P;  3JRF A;  5E3L A;  1SFX A;  2HDW A;  3KCC A;  4S05 A;  4V19 K;  2CYY A;  1CGP A;  3A0B C;  1LDK B;  3BDD A;  4A2U A;  3OYJ A;  1JGG A;  1D5V A;  1VQO I;  4PJM A;  3GME A;  3OIQ A;  1BJA A;  5HOD A;  1H88 C;  1B1B A;  2X4H A;  4DNC A;  3U1D A;  2ZO4 A;  5E8G A;  2G7U A;  1YJW I;  5IPA A;  2XIG A;  2BVL A;  4NBQ A;  3ZP5 A;  4L18 B;  2XF7 A;  2WY7 Q;  1PVE A;  1JJ8 C;  4ENK A;  3J7Z I;  3G4S I;  2KP6 A;  1JKQ C;  2IA1 A;  4W1U A;  3G6E I;  1YX3 A;  3P5J A;  2R7D A;  5F08 A;  1MDM B;  1FYL A;  4M3F A;  5J8C A;  2KZG A;  5D6E A;  1FC3 A;  3U2R A;  3G73 A;  4A3E J;  1P6R A;  4M3B A;  4MHG A;  4R1H A;  5LRR A;  1FOW A;  1WJC A;  2ZBK A;  3MZ8 A;  5DD4 A;  2E1M B;  4CIC A;  1FSH A;  2PN6 A;  2X6Y A;  3IWF A;  4ENM A;  3QOD A;  1Z21 A;  4B1R A;  4M72 A;  4BH9 A;  1U78 A;  1APL C;  1YIO A;  4KIF A;  3KP3 A;  5B3S H;  1J9I A;  2PQ8 A;  2V9V A;  1N77 A;  2FQ3 A;  3GX4 X;  1BR2 A;  2G0E A;  1WQ2 A;  2R93 J;  2RDP A;  3I3L A;  4BQQ A;  1R9T J;  2NVY J;  3W6V A;  1JGS A;  1LNW A;  4BY7 J;  1OYI A;  3I4M J;  1ZGJ A;  4AYB N;  3OYG A;  4XRM A;  4BQO A;  2KDO A;  3U1K A;  3WG7 H;  4MTD A;  4ETS A;  1BIA A;  2DT6 A;  2VQC A;  2EIN H;  4EEF G;  2M5W A;  2ID3 A;  1YTY A;  3HGG A;  3WGG A;  3A01 A;  1LJ9 A;  1R4M B;  2O5R A;  1OPC A;  4Y7N J;  4JYK A;  3IV5 A;  4NC7 A;  5F0C A;  3CC7 I;  1FY7 A;  2IRF G;  3TKY A;  2H1L A;  4E7H A;  5ICC A;  1Z7U A;  3KEO A;  1U0J A;  3ABU A;  3DKX A;  2EZH A;  1FBQ A;  1VZ0 A;  3BCA A;  1A36 A;  3S15 J;  5EYR A;  5H6R A;  3AAF A;  4EV0 A;  1ULY A;  2BW3 B;  2GXA A;  3ISP A;  1IZ1 A;  5IYD J;  5LHH A;  1W5S A;  3RQ4 A;  2X1D A;  1E17 A;  4M6X A;  2RVC A;  2X6X A;  2RQP A;  4GXO A;  2K86 A;  3QPT A;  3CZ6 A;  5J3L A;  3E6M A;  5ICF A;  1TL8 A;  1BC7 C;  2HU9 A;  4I0B A;  3PUB A;  3VB2 A;  2DI3 A;  5E3O A;  1VQP I;  2FE3 A;  1SD5 A;  2QEN A;  4XSZ F;  4D7M A;  2HQA A;  3I53 A;  2K27 A;  2Y30 A;  1MMD A;  2NS0 A;  2ZXH A;  2IEK A;  4PSW A;  4WXH A;  5FD5 A;  3SQN A;  1LQ1 A;  4A3B J;  4DW6 A;  3JRB A;  4NHJ A;  4MGR A;  1KQ8 A;  4FE7 A;  4LB6 B;  1NK2 P;  3CMY A;  2CQ7 A;  3CDH A;  5F64 A;  2DYS H;  4RB1 A;  6PAX A;  5EG0 B;  2Z2S B;  2IA0 A;  5HS7 A;  1TQM A;  3ZMS A;  2JQ7 A;  5FLV A;  4XON A;  2VAS A;  2HVS A;  2PMZ A;  1XGN A;  3BZC A;  1P4W A;  3CJT B;  4NB5 A;  4A5N A;  3ABL H;  1EH6 A;  3DWL E;  2EZL A;  5HLI A;  2M34 A;  1GLN A;  2DT5 A;  1O3S A;  2KJB A;  2F5C A;  3ASO H;  4QSH A;  2E2I J;  1ZN2 A;  1VQK I;  5FKO A;  3S93 A;  3UKG A;  2BHY A;  4BBS J;  2K7L A;  1ETV A;  4BU2 A;  4HNU A;  4F92 B;  1OCR H;  2EV0 A;  3BR0 A;  3ZXS A;  1UCR A;  1K6Y A;  3JRG A;  3I9V 2;  4L9N A;  2W25 A;  1EH8 A;  2DAO A;  3K4K A;  4UUS A;  2VE8 A;  1R23 A;  3VYS B;  2XV4 S;  1YOV B;  4YG2 F;  2HVR A;  1Y6I A;  1Y8R B;  3K4L A;  2HI3 A;  1IDY A;  2NVT J;  1ENH A;  4G7Z F;  2EZI A;  3FXL A;  1Y39 A;  1ZG3 A;  3FMR A;  2FQ4 A;  3DFG A;  4PGG A;  2ZME C;  2Z16 A;  2PJR B;  2WAF A;  2V1X A;  4BGD A;  4G6D A;  3HRS A;  3FX3 A;  3EYI A;  2L01 A;  2MAB A;  3K4J A;  2CWE A;  1U2W A;  3CES A;  1V5E A;  2DOF A;  2XF5 A;  3IKT A;  4RAZ A;  4LLG F;  2VL8 A;  2AXT C;  4RB2 C;  1STZ A;  5GPC A;  2GA1 A;  4RBO A;  3SDG A;  5ICE A;  4FX4 A;  4ESF A;  3L00 A;  3VYU B;  2LR8 A;  3DKY A;  2HR3 A;  2A69 F;  3FXU A;  1D5Y A;  1P7I A;  4YIR X;  3GTK J;  4HRI A;  4HX7 A;  3HOZ J;  3FXK A;  2R0Q C;  2LTP A;  3KP5 A;  5FB2 A;  3TED A;  3MKW B;  4RLF A;  4A3I J;  3M8J A;  4CCJ A;  1MNM C;  2AHQ A;  4CO8 A;  5TJJ A;  1V5G A;  3TW7 A;  2WB1 A;  2HS5 A;  4UUT A;  3TDU C;  3DQV C;  1UAA A;  3ZN0 A;  2ISY A;  2XB5 A;  4Z6Y A;  1K78 B;  2LG4 A;  5DM7 F;  2X1E A;  1LE8 B;  1ZQ3 P;  1RKW A;  3HPG A;  3GEZ A;  1B8I B;  1VQ6 I;  3J7A O;  1D1C A;  3GWZ A;  2E60 A;  2DFH A;  4DBR A;  4H0E A;  1FSE A;  1JTY A;  1W1W E;  2CJJ A;  4U0Y A;  1JKR C;  1UEL B;  4UVC A;  4XR6 A;  2DJN A;  5FO5 A;  1PUF B;  2W82 A;  2WAE A;  5E1W A;  3KZI C;  2P6T A;  4ZH4 F;  3MWM A;  1TNT A;  2JN6 A;  1FIP A;  2DDB A;  4E6K G;  1EV7 A;  1J09 A;  2OZU A;  4MNU A;  5EDN A;  2LRD A;  3W2W A;  2DTR A;  1XMX A;  4XN0 A;  3EPZ A;  4U7B A;  2QSH X;  4YEL A;  3TQN A;  1I5Z A;  1KQ9 A;  5HNH A;  3BLY A;  4IQ4 A;  3DEU A;  4X6A J;  2RNG A;  3H5N A;  5AON A;  1U8B A;  4AYB A;  2R5Z B;  1ZG1 A;  2FF4 A;  3I0T A;  2M45 A;  4JP0 A;  2EWN A;  5M5Y J;  3GO5 A;  1OYY A;  3AKZ A;  3CUQ A;  1H0M A;  1U9O A;  2R7O A;  3T8T A;  4ZTF A;  1ORK A;  5CJ9 A;  1ZGA A;  4KIS A;  2BW3 A;  4XSX F;  2ZCW A;  3FZV A;  2DTZ A;  1EH7 A;  1RNL A;  1DU0 A;  1Y0U A;  2RV8 A;  4II3 A;  1E3O C;  5JHF A;  4LB5 A;  1W0U A;  2TDX A;  3RJP A;  5FLX K;  2K9M A;  3IH4 A;  4RB3 C;  1FOX A;  4BJT A;  2W7N A;  2YPR A;  2NAZ A;  5DTD A;  2KDZ A;  2HOS A;  2XDV A;  2EFO A;  3DTK A;  2MGQ A;  3DPU A;  2MC4 A;  2O8K A;  1XCV A;  3FF5 A;  1X1A A;  2XGC A;  4YIF A;  5IYB J;  4RAY A;  2VOO A;  1Z7L A;  3FBI B;  2CQK A;  4XLE A;  2BVM A;  5KHD A;  5FFZ A;  2D1V A;  4JX6 A;  2ZFU A;  2KRH A;  1CF7 B;  4F93 B;  1XS9 A;  1KU7 A;  2YSR A;  1YYV A;  3OYC A;  3E5U A;  2XKP A;  4KMU X;  3D0S A;  5F0H A;  1JE8 A;  1SFE A;  1Z6R A;  1VQ9 I;  1XX5 A;  1K61 A;  2HXO A;  4KJZ A;  1UHM A;  4CZZ A;  2VKD A;  3G1L A;  4A5M A;  2O9L A;  3PFI A;  2DFI A;  5F1R A;  3Q3S A;  4XOR A;  2E1C A;  4N9I A;  3KZZ A;  2P4W A;  1JUP A;  1ZAR A;  2I10 A;  2E7W A;  2DK5 A;  1S6L A;  4II2 A;  2E36 A;  1P4A A;  3X2Q H;  4Y15 A;  3Q9V A;  4HBL A;  3HHH A;  2R7R A;  2BOL A;  4N0B A;  2E7X A;  3I54 A;  1XB4 A;  2VXD A;  4G8X A;  3WHC A;  1W36 D;  2QQB A;  4M6Y A;  2JVG A;  3OSF A;  5LGU A;  5FRM A;  2JA2 A;  5JLW A;  2IP2 A;  1PP7 U;  4NDL A;  4P5O A;  5CPR B;  1ZTR A;  3MKY B;  5F04 A;  3CC2 I;  3VYR B;  4EJT A;  3JTG A;  3ZOB A;  3HTU A;  5HDK A;  2PJR A;  2HQR A;  2IGN A;  4HDV A;  4V2F A;  1BW5 A;  2VJJ A;  2QBY B;  2Y31 A;  1Z77 A;  3LSK A;  2VQH A;  2VC1 A;  4M74 A;  5D5V B;  1JJ6 C;  3P9K A;  2IS6 A;  3J81 K;  3OS2 A;  1ZRD A;  4BJ5 C;  4EM2 A;  3J80 Z;  1Z0X A;  2E71 A;  1OCT C;  1JTX A;  2QA4 I;  1X2M A;  3TL4 X;  1QZE A;  4RB0 A;  3HC7 A;  1FP1 D;  1QHG A;  1V54 H;  1IO2 A;  3BZK A;  1MIJ A;  1Q1H A;  5KNL A;  2HTJ A;  3BWG A;  3H9J A;  2IXS A;  1ACI A;  2JZY A;  3TW6 A;  1SAU A;  2F5D A;  4F91 B;  4B48 A;  3O8H A;  5CVR A;  1WI3 A;  3LWF A;  4ZYA A;  2DA7 A;  1U5T B;  2COM A;  1QZZ A;  2JWT A;  5D5U B;  4XLF A;  4XK4 A;  3WTV C;  5FRN A;  3BR6 A;  1OJL A;  5IOZ A;  1OCO H;  3HRM A;  1RUN A;  3K2Z A;  3K4C A;  2L7K A;  3S1R J;  2ZNY A;  3DU5 A;  2IW5 A;  3FK7 A;  4EJW A;  2M4K A;  3NEU A;  5LLQ A;  1GHC A;  3GZ5 A;  2XPU A;  2PMU A;  3SZG A;  1PUF A;  4ZZL A;  5GTH C;  1TQI A;  1W0T A;  4LLL A;  2VB6 A;  3M9A A;  3KYL A;  4D5C A;  4MQV A;  5CVJ A;  2HWV A;  4PK4 A;  5DCM A;  3OYK A;  2EBI A;  1E0E A;  3ECO A;  5FKK A;  4MFD A;  1VF9 A;  1G59 A;  4L0Y B;  3ECH A;  4M73 A;  2L9V A;  3ZRG A;  1HCR A;  2D5V A;  2JMW A;  2ZJP F;  1SFU A;  2L2O A;  2P7V B;  3R0J A;  3CO6 C;  2R5Z A;  2MBF A;  1HDD C;  2X1C A;  1GVJ A;  2IBD A;  3OL3 A;  3MMY B;  1ZH5 A;  4KFC A;  3WGH A;  2X9D A;  4HA8 A;  1Z67 A;  1LEA A;  3RQI A;  1SAN A;  1TW3 A;  3TDZ C;  1IJW C;  4Z2Y A;  2L7F P;  5C4X J;  3CCV I;  1IN5 A;  4KIT B;  3FHN A;  2IS2 A;  2MLG A;  3S1Q J;  3BR3 A;  3KET A;  2HZT A;  4IRH A;  5IY5 H;  1X1D A;  5JR3 A;  2CW0 F;  1TNS A;  4DZP A;  2DN0 A;  5EGO B;  3DBH B;  2WAQ A;  2R7Z J;  5J1U A;  2CUJ A;  4IF4 A;  1ZKG A;  1ZR4 A;  3QQA A;  4A0Z A;  3JRE A;  1UB9 A;  2LF8 A;  2YR2 A;  3MN2 A;  3ZMT A;  1BN5 A;  1X19 A;  2EFW A;  2FOW A;  4RMN A;  3RZD J;  3RKQ A;  4J01 A;  4ZJZ A;  2D1H A;  4A12 A;  1YJ9 I;  1ETY A;  3OR2 C;  4EAT A;  2KPM A;  4M71 A;  5D8K B;  3HKZ A;  3K2A A;  4KT6 A;  3V8K A;  1IRG A;  4AC0 A;  1WFX A;  1XPX A;  2GOM A;  2CU7 A;  2WC2 A;  5JI6 A;  4HQE A;  4GDF A;  3E3V A;  1R7J A;  3EUA A;  3SZT A;  3CD6 I;  2PJP A;  2W57 A;  1BOB A;  2CUZ A;  4P9F A;  5HS9 A;  5ILS A;  1DPU A;  3FM5 A;  1YW8 A;  1K6O A;  3ESW B;  3RKX A;  1IDZ A;  2B63 J;  4IKF A;  2X51 A;  3CC4 I;  3QPL A;  3J80 K;  2Z33 A;  4LIT A;  2A6H F;  2DA4 A;  1ZK8 A;  2VXZ A;  3JAM K;  3P9I A;  1ETQ A;  1YW7 A;  2HYG D;  3TO7 A;  4IOC F;  4KN4 X;  1B4A A;  5M5X J;  4IXA A;  3OY9 A;  5FFX A;  2OC6 A;  1I3A A;  3UR3 C;  2TCT A;  1FMV A;  3H1C A;  1WH5 A;  4IOA F;  3ERM A;  1WI9 A;  1BI1 A;  1X4O A;  3R60 A;  3S3O A;  1TP4 A;  2G9W A;  4U88 A;  3LSP A;  1KU2 A;  2EZK A;  1E3P A;  1Z1D A;  2OCE A;  1XDU A;  4PJJ A;  2CUF A;  4M3G A;  1YS7 A;  2QBY A;  4M3E A;  1UZC A;  1RES A;  1MND A;  5D5W B;  1X2N A;  2FD5 A;  1FLI A;  1KA8 A;  2ICW G;  2KIS A;  3F8M A;  2Z9O A;  1WJ5 A;  1FNN A;  3C18 A;  1T0F A;  3VFZ A;  1H9G A;  3OS1 A;  5M5W J;  1IGN A;  4OIR F;  3DF8 A;  2J5P A;  5EJC A;  2HDC A;  3COA C;  1I39 A;  3JTH A;  4C2T A;  1P92 A;  4E70 A;  1HF0 A;  3A4C A;  3O3K A;  2W24 A;  2Y75 A;  2FML A;  2F4M B;  3WTY C;  3GBG A;  5B1A H;  1X1B A;  2COB A;  4IRG A;  4RA2 A;  3F72 A;  4O6J A;  2LY2 A;  3CP2 A;  4XID A;  1TWF J;  1MD0 A;  2XAQ A;  3M4O J;  1U5T A;  1O3T A;  5D6F A;  4OAY A;  3OYA A;  3G2B A;  4AIH A;  2IAI A;  3CCY A;  3F3X A;  3R0A A;  4M6V A;  4RGR A;  3K10 A;  1R58 A;  2R3S A;  3H0D A;  2JA5 J;  1S7A A;  2HPI A;  2OZ6 A;  5C3E J;  4AVZ A;  1G3T A;  4UNO A;  3ABM H;  3HGY A;  4A3L J;  3R4K A;  3BQY A;  3S8P A;  2JVH A;  4Q5S F;  4FTH A;  1C0W A;  4YFK F;  2VE9 A;  2WBM A;  2VLA A;  1J59 A;  4XIC A;  3H92 A;  4TV7 A;  3B73 A;  5CQE A;  4B3X A;  3OYD A;  2ZNZ A;  3DLA A;  3HZJ A;  2HNH A;  3HOY J;  2K9N A;  2CQQ A;  4PJN A;  2MD0 A;  2R7S A;  3C1D A;  4ENN A;  4UXN A;  2R7F A;  1P2F A;  2TRT A;  2GIZ A;  3HIF A;  2WB1 N;  3CJR B;  3FXJ A;  1IUY A;  4KYW A;  3TP3 A;  4Y4R A;  2Y2Z A;  3GFJ A;  3ZMZ A;  2OJE D;  1JXS A;  1DP7 P;  2DMQ A;  3LSH A;  2JTV A;  3HUG B;  1J0R A;  3DEE A;  2NS7 A;  4NQW A;  2IVM A;  1OR7 C;  4E7S A;  2P0W A;  1DQU A;  4S04 A;  3HOX J;  4HW0 A;  2ADU A;  2LNB A;  3GTO J;  3O6B B;  4HG2 A;  3AL0 B;  1F43 A;  4C3J J;  5FKL A;  4A0X A;  4RDU A;  5DUI A;  3E5X A;  3QYE A;  2MFZ A;  1FJL A;  2A07 F;  3K7A J;  4OWR B;  2CW7 A;  3S2H J;  2BY3 A;  5CYV A;  2GZW A;  3KP7 A;  3HSE A;  3PQJ A;  5ILU A;  3CUQ C;  4E7I A;  4OIO F;  1YW9 A;  2CH0 A;  2FSW A;  1O7L A;  1Z05 A;  2BV6 A;  2IT0 A;  1W5C C;  4IO9 F;  4P1W A;  4AID A;  2VPL A;  4XRF A;  2R92 J;  1SFO J;  5LGT A;  1GT0 C;  3MZY A;  1SMT A;  2L3D A;  4HF1 A;  3TO9 A;  4M9X A;  1G8X A;  1UJ8 A;  4I0A A;  2K3P A;  2I5U A;  1J5Y A;  2L4A A;  2NNN A;  1DU6 A;  3SEZ A;  2V6C A;  4LIU A;  1I6X A;  2YX7 A;  5JFR A;  4FE4 A;  2KHM A;  3OOU A;  5JHU A;  3LQQ A;  1IV6 A;  5FD6 A;  3A0H C;  1R5I D;  1WJF A;  2X0L A;  4ZYE A;  3OOP A;  3CLQ A;  3PIO F;  3A1Y A;  3B02 A;  4U7D A;  1NHA A;  1TT5 B;  1NG6 A;  4I2O A;  3CCR I;  4GGG A;  2DK8 A;  2HYF A;  4RM2 A;  2Q0O A;  3QPH A;  5KK1 A;  1YJN I;  4WXD A;  3SHF A;  1SC7 A;  2NVX J;  1W4M A;  4BDZ A;  2EIK H;  4WCG A;  2IPQ X;  1I50 J;  4XLH A;  4C9Y A;  2DPU A;  2KL4 A;  4PJ0 C;  5F1J A;  2M1B A;  1WPK A;  3FXO A;  4UB6 C;  3OR1 C;  2ZXI A;  1X1P A;  3BG6 A;  1QVU A;  4KMF A;  5LRS A;  2H27 A;  4A3F J;  3LA2 A;  3H0G J;  1Z3X A;  1R36 A;  4N9H A;  2GOX B;  2N8G A;  2HYJ A;  3NWS A;  1YRN B;  3KP4 A;  2CFO A;  3DBR B;  3C7J A;  3CCQ I;  3JRC A;  3CMA I;  4MFE A;  1OCZ H;  2EH3 A;  3BJO A;  4CCO A;  3M1E A;  1FBS A;  3RDI A;  4ZZD A;  5LEK A;  2P81 A;  3CCS I;  3ZN1 A;  3CLO A;  1USS A;  4E7L A;  2XPV A;  2OAZ A;  2VIX A;  4HYE A;  4BXU A;  2Y0M A;  4OIQ F;  2K40 A;  2XHK A;  2VON A;  1D1B A;  2OPT A;  4LK0 F;  1ETK A;  3C2G A;  4NUB A;  2EA4 A;  5IT3 A;  1FTT A;  5E3M A;  2HQ5 A;  1NG7 A;  3PNT A;  1R6R A;  2XC7 A;  1QA6 A;  3H3V K;  4B4C A;  4EVI A;  5FLX Z;  3G71 I;  3LA7 A;  1BIB A;  4I7H A;  4RGX A;  2GWR A;  2FBK A;  2Y9Y A;  3GVA A;  5GAE J;  2BY2 A;  2ECB A;  1QNT A;  2VBY A;  3I4P A;  2P7C B;  2R7V A;  2XF6 A;  3OYH A;  3WE3 A;  1MMA A;  2K85 A;  3F8C A;  1MSE C;  4ENJ A;  4D9J A;  1G3S A;  3DXJ F;  4UV8 A;  3SYT A;  4GYG A;  3WTT C;  3J7Y J;  4XLP F;  3JRI A;  3PO3 J;  2OV7 A;  2CSO A;  3P9C A;  3K70 C;  2ZSH B;  3VSL A;  1EKE A;  4BKX A;  2QLZ A;  3JRH A;  2AQE A;  4D7N A;  4ESB A;  4IPA A;  1XC5 A;  3F0C A;  1ETX A;  4GYI A;  2YS9 A;  1A35 A;  4Y3O A;  1XSD A;  2KKO A;  2JA6 J;  4CUG A;  4WF2 A;  3RKY A;  1YX5 A;  2R5Y B;  2GBY A;  3GUD A;  4JX5 A;  3GTQ J;  5E17 F;  3MD2 A;  3ZQQ A;  1LDD A;  4PGH A;  1KQ0 A;  1OYW A;  2A5Y B;  4I98 B;  1FYM A;  3CTA A;  3H5R A;  4OOI A;  1G2H A;  3BTL A;  2X48 A;  4BXF A;  3KEY A;  2NRA C;  5K5Q A;  4FQG A;  1HBX G;  1R49 A;  1IN6 A;  1R1T A;  4JX4 A;  2H6C A;  2M7A A;  2XSD C;  1B72 B;  2CGP A;  2BHZ A;  5IOY A;  2DA2 A;  2DJI A;  4EJU A;  2KIU A;  4FIS A;  4BHB A;  2MH9 A;  1R1U A;  3ZQG A;  1MDM A;  3L2R A;  2M7B A;  4X0G A;  5L3F A;  3BR5 A;  1YIT I;  2XGD A;  2DYR H;  3F8F A;  3BC8 A;  3J81 Z;  1Y1W J;  1R4N B;  1OQY A;  1DGR M;  2CFX A;  3K1N A;  2HFH A;  3K69 A;  1REP C;  4FET A;  3RPU A;  1J7K A;  2H1K A;  2DMN A;  1D8K A;  2LSO A;  5J40 A;  3M7G A;  4OMZ A;  4G9Y A;  4XKV A;  1T08 B;  4C3I J;  2ZME B;  2PG4 A;  4L5I A;  2RAE A;  2LY1 A;  1T98 A;  1HW2 A;  1YE9 A;  2K5C A;  3OYM A;  1WH7 A;  2X6O A;  4XKB A;  1H9T A;  2DQR A;  3QU3 A;  1O57 A;  5LBQ A;  1U3E M;  3R61 A;  4M3D A;  2RKH A;  3I5U A;  3CCE I;  3BR2 A;  4FT8 A;  3O2P E;  4A3J J;  3LSJ A;  1I3Q J;  5BPI A;  1P9Q C;  3E6B A;  1W7P B;  1S72 I;  1LVA A;  3PSI A;  2UXX A;  1TTY A;  1KU9 A;  5GPA A;  3BG7 A;  4O3M A;  4NC6 A;  1XMK A;  2OA4 A;  1RR8 C;  5H20 A;  1UMQ A;  2VBW A;  5E18 F;  2WAQ N;  3IUO A;  2AS5 F;  1L0O C;  4GCV A;  2XAF A;  4ITV A;  2LBF B;  1RR7 A;  3ZMD A;  3IL2 A;  1YLF A;  1T8I A;  5CLS A;  3KLN A;  3HDD A;  3RPQ A;  4IHV A;  1Z3Y A;  3ONQ A;  4EJV A;  1SEU A;  3AG3 H;  4I09 A;  4XLC A;  4WWC A;  4MIM A;  1TW2 A;  2EV6 A;  3IRR A;  4RM3 A;  1AHD P;  3F9K A;  3HKZ N;  1ETO A;  4ZTJ A;  4YFN F;  4HOB A;  2KIF A;  1SD7 A;  2OUM A;  1N25 A;  4G6Q A;  3I59 B;  1A31 A;  3BP8 A;  3CCU I;  4XRS G;  1YIJ I;  3V8J A;  2FNA A;  2WV1 A;  3U9G A;  4CCL A;  2DMU A;  3LNQ A;  1K79 A;  2VN2 A;  1QZY A;  5M3F J;  2W00 A;  2STT A;  2XSJ C;  3WG9 A;  3FDY A;  3K6G A;  3PFY A;  4EM1 A;  5FLM J;  1B6A A;  2KRC A;  3F21 A;  1ZRF A;  5EG0 A;  2F4I A;  5GTI C;  2FRH A;  1RZ4 A;  3GCM A;  3LST A;  3OS0 A;  1T38 A;  2JA7 J;  1D0Z A;  2K9Q A;  3BT9 A;  2CW8 A;  2JPC A;  3I64 A;  3D5S C;  2QWW A;  4U87 A;  4IVN A;  1SVM A;  3DV8 A;  1MZB A;  5EZG A;  1EJ9 A;  2JUC A;  4CYD A;  2QUF A;  3PNY A;  3BG3 A;  2QF7 A;  2FJ1 A;  2IA2 A;  3HPH A;  4XKW A;  2DW4 A;  4YII A;  1FT9 A;  3GTL J;  1T0F C;  4IEJ A;  3Q0V A;  1AOY A;  2QQA A;  4I02 A;  1Y8Q B;  5DM6 F;  1DP3 A;  3D5R C;  2VUM J;  1I27 A;  2A3S A;  2UUZ A;  3KPH A;  2LK2 A;  1WWX A;  1S8N A;  4LFU A;  1KON A;  4DOZ A;  4PFO A;  2VKV A;  2HPM A;  3UNG C;  2V9P A;  3J7A Y;  2LP0 A;  3FKJ A;  2E1N A;  2GAU A;  1TWG J;  1BC8 C;  2V6E A;  1ZR2 A;  2R7U A;  4IHT A;  1HOM A;  3V7R A;  1FBU A;  4CXF A;  2K9S A;  2R7Q A;  1RI7 A;  1IXS B;  3FMQ A;  4A3M J;  1DDN A;  5DEQ A;  3G1M A;  2V9K A;  3VYT B;  4XM3 A;  2R5Y A;  5BNG A;  1BJZ A;  1IRX A;  2ACJ A;  4LG0 B;  3W2A A;  1QU3 A;  1QO0 D;  1KYZ A;  4F3Q A;  1GVD A;  3JAM Z;  4XL9 A;  5E8I A;  4WX9 A;  1O7F A;  3K4B A;  3A2K A;  4CYC B;  3SFI A;  4AIK A;  2XB0 X;  4FHT A;  5ICG A;  2MC3 A;  1F5T A;  2F5E A;  1F1Z A;  2M3A A;  1OFC X;  2VOP A;  1TWH J;  2A61 A;  5J1Y A;  1LVK A;  1V3F A;  1Z91 A;  5CVI A;  2O03 A;  3QWL A;  2MH2 A;  2GM4 A;  3F8N A;  1IXC A;  3CCM I;  1K78 A;  4YFX F;  1R5G A;  1LE8 A;  4BBR J;  1A5J A;  2BXY A;  1B8I A;  3WU0 A;  3CDI A;  2CO5 A;  2HZD A;  1BA5 A;  4HAM A;  1V4R A;  5LHI A;  1ONV A;  2LMD A;  1ON2 A;  4GFB A;  3VWB A;  2ZC2 A;  4X1E A;  1LB2 A;  1TLH B;  2ZME A;  4FAS D;  2VJ4 A;  1GDT A;  3LAJ A;  2M8G X;  1JUS A;  3S32 A;  3ZQI A;  2ZKZ A;  2H8R A;  2DBB A;  1VQ4 I;  3JR9 A;  1SMY F;  5FGM A;  3ZCO A;  3GFI A;  2P5V A;  3L2C A;  4L9V A;  3WU1 B;  1MKM A;  3PL8 A;  1PDN C;  2LF7 A;  4DQ2 A;  4KNY A;  2UZK A;  1R1V A;  3ZQH A;  2FU4 A;  2QEX I;  3CCL I;  4B3A A;  1IXR C;  2V1U A;  1MBF A;  2EPF A;  2PMH A;  3M8E A;  2EB7 A;  2BEO A;  3HG9 A;  4OIP F;  2A6E F;  3LSR A;  5IP6 A;  5E1Z B;  4MLO A;  3B6C A;  1FX7 A;  3RIR A;  1R71 A;  2OBP A;  3MFK A;  1MBK A;  2LBF A;  5J8F A;  2NOJ B;  1B59 A;  1TZL A;  2B9S A;  1ZLJ A;  1LPQ A;  1RUO A;  3S16 J;  2LYC A;  2WWY A;  3LQR A;  2JA8 J;  1FTZ A;  3BCB A;  3BG9 A;  2ZXJ A;  3AG2 H;  3TP0 A;  2E35 A;  2XRO A;  4Y52 J;  4BYY A;  2CRG A;  2Y0S A;  3MEX A;  3OL4 A;  5BMZ A;  4YRV A;  1X3W B;  4JOM A;  4BEH B;  1PYV A;  3H36 A;  1ON1 A;  2GIV A;  1MGT A;  1WJD A;  4G7O F;  5HLG A;  5DUK A;  4MTE A;  3I59 A;  3IAM 2;  2ELK A;  4CA0 A;  1CF7 A;  5E1X A;  4G12 A;  2YUS A;  3V42 A;  3OYB A;  4ZC3 A;  1R22 A;  1WVR A;  5LHG A;  4KIB A;  2CV2 A;  2BY1 A;  1HKT A;  5FKM A;  3LSG A;  2QQ8 A;  4ON0 A;  4MEY F;  3LA3 A;  1P4X A;  4HDU A;  2XAJ A;  4IHS A;  2L0K A;  2JRM A;  2Q8K A;  1QPM A;  2A5W A;  4LGW A;  1S5L C;  2RNJ A;  1G6N A;  3VEP A;  1RKT A;  5DV5 A;  1SD4 A;  1JT0 A;  1ZHF A;  1QGP A;  4XMY A;  3VPR A;  3DCF A;  3RYP A;  4LK1 F;  1ERD A;  3GLX A;  2HDD A;  2F6C A;  2IS4 A;  3S2D J;  5DYM A;  3QOE A;  1OKR A;  5IP9 J;  1E2X A;  1MSF C;  3T8R A;  1LFB A;  3KFW X;  2QSF X;  3EUK L;  5JVG F;  3IH2 A;  1MBG A;  1NTC A;  4GRI A;  2LKP A;  1QHH D;  2Z99 A;  5K1Y A;  2QSG X;  1YI2 I;  3PUF A;  3DTI A;  4PJL A;  4WK8 F;  3IP4 B;  2K9L A;  2B7E A;  1IN8 A;  1VQL I;  4R79 A;  2EFN A;  4I01 A;  4L9T A;  5LFA A;  1K4S A;  3CDL A;  1PP8 F;  1VQ7 I;  2F5F A;  1MBH A;  2XAS A;  1OCP A;  1K7A A;  4JBA A;  4D0P A;  3I55 I;  3KZY A;  1Y1V J;  2Z5U A;  1IN7 A;  3HBL A;  3MCZ A;  5J47 A;  4XQF A;  3GXO A;  5IT9 K;  3ASN H;  1BW6 A;  3RKW A;  2JT1 A;  5K7H A;  4E7Z A;  4ESJ A;  5J4Y A;  4CYC A;  1R5H A;  4ZDP A;  5AIP A;  4DJA A;  2R7W A;  1TWA J;  2O3F A;  3T5X A;  2KZV A;  3LFK A;  4KIG A;  2STW A;  1YHQ I;  2R7T A;  4K2E A;  3SJM A;  1ZLK A;  3GTM J;  3A02 A;  4HST A;  1FIA A;  1UST A;  2HXI A;  2DOE A;  4UVB A;  5EEH A;  4UUV A;  2BYV E;  1KZH A;  3MVP A;  1DGW Y;  2XKO A;  5GAH J;  1JHH A;  3K1P A;  2OCC H;  3LSM A;  2LKS A;  3BTJ A;  2NYX A;  2OD5 A;  4HNT A;  3F22 A;  9ANT A;  2L9R A;  4ABZ A;  1AU7 A;  1BI0 A;  3LMM A;  3GYH X;  3FHZ A;  1P7J A;  3OV8 A;  3CMM A;  3CF2 A;  2H94 A;  2L54 A;  2P8T A;  3P7N A;  3I58 A;  2QVO A;  1POG A;  1RIO H;  4AM3 A;  2R7X A;  4AIJ A;  2VJI A;  4HV5 A;  3OYE A;  2M0C A;  3T0Y A;  1X4P A;  1W5T A;  1NH3 A;  3WGI A;  1HSJ A;  1X58 A;  1I6H J;  2E1M C;  5IYC J;  1RPW A;  2PX9 A;  2OQG A;  2RQQ A;  3EUH A;  4Y17 A;  1T56 A;  3K4N A;  3S1N J;  3N05 A;  4XN3 A;  1FWZ A;  1KYW A;  1L3L A;  4P96 A;  1T2K A;  2M0M A;  2EA2 A;  1TQP A;  2VT3 A;  4U0V A;  5ED4 A;  4BS9 A;  5BPD A;  2A05 A;  3BG5 A;  3F8B A;  3GTJ J;  3S2W A;  3MZH A;  2GLO A;  4JQF A;  4HV6 A;  4BL0 B;  3ZGK A;  2MYS A;  1ETW A;  1MBJ A;  5EEG A;  1FMW A;  2XGE A;  3ERE D;  3L9F A;  3KP2 A;  2R4G A;  4MO7 A;  5GP9 A;  3E0J B;  1FOK A;  2F4O B;  2LH9 A;  1JKP C;  5F6F A;  2YU9 J;  1SVL A;  4AU7 A;  2H6B A;  5KCM A;  1VFC A;  1MMS A;  2CQN A;  3S14 J;  4WXC A;  5D4S A;  2CV0 A;  2DU9 A;  3OYN A;  4B44 A;  3ROU A;  2GA2 A;  4LG3 A;  4EM0 B;  3LAP A;  4HX4 A;  3SZP A;  3ZMV A;  1ZEL A;  4F7Z A;  3E6C C;  1D0Y A;  2KFD A;  3CJQ B;  5EGO A;  4E4H A;  3M3Y J;  1SVO A;  4V2G A;  4XRS A;  1S7O A;  3FXR A;  4BEH A;  2QGU A;  2FNP A;  5TIS C;  4AUX A;  1EF4 A;  2LC2 A;  2M9H A;  1XGO A;  4BQN A;  3H35 A;  3MAJ A;  2Y9Z A;  3FXQ A;  4J19 A;  4BHC A;  3S3N A;  3CME I;  5HNF A;  1QRY A;  1IG7 A;  5J4V A;  3BOQ A;  1YG2 A;  1FYK A;  4C2U A;  4M9S A;  3I4N J;  2UWM A;  3AG4 H;  2GQQ A;  1UG0 A;  4ZDO A;  3GFL A;  3HRT A;  4DBQ A;  3OYF A;  3Q5F A;  2OTL I;  1EA3 A;  5F27 A;  5H2F C;  3L2U A;  3H5A A;  5E20 A;  2E5Z A;  1WKM A;  1MBE A;  5HLH A;  5TRD A;  1MMN A;  3VOE A;  2ZJ2 A;  3KYD B;  3PSF A;  4MEX F;  1ZGW A;  4A3D J;  1HLV A;  3HM5 A;  3BQZ A;  5BQT A;  1MH3 A;  2EJR A;  4UB8 C;  3F6O A;  5K7Z A;  1T95 A;  3RZO J;  4QTR A;  4O5V A;  4AD9 A;  4FX0 A;  3ABK H;  2HKO A;  4EQQ A;  4ANJ A;  2PFB A;  3CUQ B;  2L7Z A;  3EDP A;  4G94 A;  2HOT A;  2MG4 A;  2P6S A;  3SFZ A;  1XGM A;  4EGY A;  4CGZ A;  1KU3 A;  1F9N A;  2O0Y A;  4A6D A;  2E2H J;  3BJ6 A;  3QRF F;  1QVT A;  2DA3 A;  4B47 A;  1A04 A;  4BY1 J;  4IQJ A;  1IN4 A;  3ZQL A;  3S17 J;  1WJA A;  5B5E C;  2RGV A;  5F0F A;  5FKN A;  2E5N A;  2V1D A;  3L1P A;  3QOP A;  1ITY A;  1AWC A;  2EFP A;  3QAH A;  3TOA A;  4F52 A;  3CP8 A;  2UV1 A;  2NS8 A;  2P5K A;  2DPD A;  2EV5 A;  4ZDL A;  5HOO A;  4NC8 A;  2L9S A;  3OWT A;  3H3U A;  2LKX A;  2QQ9 A;  3NWT A;  3VDX A;  3EET A;  4DYC A;  1TWC J;  4L5J A;  3K70 D;  1S29 A;  1JHF A;  3Q9S A;  3MKZ A;  1LKX A;  2DMP A;  4BAC A;  4NNJ A;  3JSP A;  4B09 A;  2E34 A;  2W48 A;  2P5L C;  3GTG J;  3GW2 A;  2BBY A;  3DKW A;  4Y13 A;  2WA0 A;  1MNE A;  3DTE A;  2IGO A;  1OIS A;  4RAF A;  2W85 A;  4W97 A;  3F23 A;  4RS8 A;  4IZZ A;  2LD5 A;  5AIQ A;  1XG1 A;  2PEX A;  4LJZ F;  2DOD A;  1IRF A;  2XRN A;  1MJA A;  1FZP B;  2X6W A;  4G6T B;  5JLX A;  3FMS A;  5J1R A;  2X85 A;  2IJL A;  2BY0 A;  4UVA A;  3JSO A;  2DLL A;  4BE1 A;  1IF1 A;  3PNV A;  1O3R A;  2QKM B;  1W7P D;  1MW7 A;  2QM3 A;  3GLL A;  4U0W A;  3V7S A;  3E1S A;  3LL7 A;  2ELJ A;  4UV9 A;  2HEO A;  1GV2 A;  1PJR A;  1MJ9 A;  4CZC A;  1RRJ A;  2BXZ A;  1IW7 F;  4B8X A;  2ID6 A;  3OIP A;  2NNY A;  2Z3Y A;  4DYR A;  1RC9 A;  3QP6 A;  2FOK A;  4YEJ A;  4C3H J;  1OCC H;  4XOP A;  3OSG A;  3HUG A;  5DS9 A;  2PI0 A;  1ZG5 A;  1BR1 A;  3TGN A;  2ZJQ F;  3K0L A;  4BNC A;  2E19 A;  5TGT A;  1KGS A;  2ZB9 A;  3OIO A;  2MA3 A;  4L0Z B;  2VI6 A;  2IGK A;  1ZAO A;  3E5Q A;  3V8L A;  1VQ8 I;  2ZXW H;  4Q48 A;  1HST A;  5ERI A;  3BPV A;  2Y48 A;  5K5O A;  1I1S A;  3JRA A;  3GZN B;  3AFH A;  3BJA A;  3HOW J;  4A6E A;  1GXP A;  2DA1 A;  1JI8 A;  3FIW A;  2EIM H;  1A6Q A;  2F5V A;  2NVQ J;  2O8X A;  3W6J B;  3FKI J;  4KDP A;  4LLN A;  3C2B A;  4ASN A;  1GV5 A;  1TBX A;  2XPW A;  4ZYH A;  4PDK A;  1S9H A;  4BHP A;  2KMU A;  3BY6 A;  5DDG A;  4CHU A;  4IHW A;  3GF2 A;  1T39 A;  3ZR8 X;  3BR1 A;  3HOV J;  4OU0 A;  3FBN B;  5EEA A;  3N4M A;  3M1C A;  4HNV A;  1WJB A;  2NOG A;  3PIP F;  2V7F A;  1AA7 A;  2EK5 A;  3DPL C;  3GFM A;  2K4B A;  2L02 A;  5HDN A;  4LD5 A;  2E1O A;  5KAI C;  1GXQ A;  5D8L B;  3IHU A;  4KIC A;  2PLY A;  3S1M J;  2KRF A;  3RI4 A;  4IX7 A;  3K4M A;  1DPR A;  1OR7 A;  1BM9 A;  3FM3 A;  2Y0S N;  1XN7 A;  2K4J A;  2VT2 A;  3KP6 A;  5DCM B;  2HTS A;  3BTC A;  2ESH A;  3IH3 A;  4BQA A;  4S0H B;  2H8W A;  2MSY A;  2MD5 A;  3HB9 A;  2LOO A;  2EIL H;  5L3G A;  3D1N I;  2O61 A;  4RLQ A;  3PQK A;  3H3Z A;  4XOT A;  1FEX A;  3IKV A;  3NQO A;  2V4J C;  5HVQ C;  2ZJR F;  1QPI A;  5HS8 A;  1OMI A;  3CF5 F;  3AG1 H;  2CUE A;  2BZT A;  2KLO A;  5L3D A;  3SXY A;  3H9G A;  1O3Q A;  2W1O A;  3CO7 C;  1WSU A;  1XDS A;  5CQG A;  1BL0 A;  3U21 A;  3HXL A;  1F4K A;  1YRN A;  1YQA A;  2Y69 H;  3Q0U A;  3N97 A;  1BOA A;  1Y0N A;  4E7K A;  2M87 A;  3VOD A;  2YU3 A;  2FUG 2;  1TT0 A;  3HOS A;  2O7O A;  2M8E A;  5FJ8 J;  3ZQF A;  5E3N A;  3HSR A;  2L5Q A;  1VQM I;  3L7W A;  1Y56 A;  3ZMU A;  1IUF A;  3OYI A;  3C2H A;  1VQN I;  4A3C J;  3D5L A;  3HHG A;  3O8G A;  3WU2 C;  4CDG A;  5L3E A;  2CG4 A;  1Z9C A;  1IC8 A;  1Z6T A;  2VPR A;  1YO5 C;  1LFP A;  5LD2 C;  4KUM A;  3C3W A;  4A3G J;  2JPB A;  1H8A C;  1I1G A;  2VQG A;  1GUU A;  1R00 A;  4I99 C;  1MH4 A;  2OF7 A;  4P9U A;  1HXD A;  4A0Y A;  3WTZ A;  1T33 A;  1AKH B;  3ZQ7 A;  5K7F A;  4H4K C;  3SEQ A;  5DCF A;  4G7H F;  1N78 A;  3LOC A;  1XD7 A;  4OAZ A;  4AWX B;  5EF6 A;  2FX0 A;  1UFM A;  2FEZ A;  2ELH A;  5KAF C;  3BTI A;  2JSC A;  1T6S A;  3RCO A;  2ZSI B;  5HLT A;  4EMS A;  2LLK A;  2GXB A;  2A68 F;  1D1A A;  3L2Q A;  5GAG J;  1LUJ B;  1X3Z B;  3HL2 A;  2ZFW A;  2JUG A;  1MMG A;  4HF2 A;  2FMY A;  1BBY A;  4KN7 X;  2W4S A;  2Q2E B;  2LDU A;  3DEW A;  4XKC A;  2HVQ A;  1XSX A;  1A6I A;  2Q1Z B;  1U5T C;  5D4R A;  1O4X A;  3V4G A;  3K9T A;  4BE0 A;  2A6T A;  3F6V A;  3IC7 A;  1IAW A;  1K4T A;  4A3K J;  4D5F A;  3QYF A;  4CH7 A;  2CQX A;  1M1E B;  2RN7 A;  2IGM A;  2VC0 A;  1W36 C;  5CVU A;  2DQL A;  3HTS B;  1CQT A;  1HC8 A;  3REO A;  1B72 A;  3TMO A;  1UHW A;  3NAU A;  4CCN A;  2WY8 Q;  2CMP A;  2VKH A;  3Q0W A;  5BOX A;  4UY8 I;  3BZ6 A;  2M4G A;  5CVV A;  1G4D A;  1WZ2 A;  3L2W A;  3QPS A;  1JT6 A;  2ECC A;  2WV0 A;  2XAH A;  1HQC A;  2FA5 A;  2XUB A;  1U6G A;  4KT5 C;  2LY9 A;  1XTA A;  3EUH C;  4L5E A;  5L3C A;  1D8J A;  2V1N A;  5A2Q Z;  1HW1 A;  2H09 A;  2QKL B;  3VSK A;  2QZ8 A;  2KT0 A;  4I6Z A;  2EFQ A;  3KEQ A;  5CKT A;  4E7J A;  1XGS A;  2NVU B;  1TC3 C;  1D3Y A;  4PFP A;  3R6S A;  2VOD A;  3L09 A;  1D0X A;  3M8F A;  1QQI A;  3T1B A;  3HRU A;  2VQL A;  3OYL A;  5IT9 Z;  1E3H A;  2VBZ A;  2UXN A;  5K5R A;  1BR4 A;  3FIS A;  3OMY A;  1WRJ A;  1X3U A;  2RC4 A;  3KYC B;  4XLN F;  2K02 A;  3GTP J;  2V26 A;  3K1M A;  5J6X A;  2LVS A;  3BRO A;  2WTE A;  5JVT A;  1LDJ A;  4LIV A;  3HJE A;  3GZ6 A;  3KIO A;  1Q1V A;  2KIQ A;  3W2V A;  2DOA A;  2E2J J;  4DIQ A;  4MQ9 F;  2ME6 A;  2DFE A;  4PUS A;  4Y33 A;  5E79 C;  4IHX A;  1W7P A;  1YFH A;  3CUO A;  2JSP A;  3LFU A;  1J2X A;  1F36 A;  2EIJ H;  1BI3 A;  2XVC A;  4ZYG A;  3ELK A;  3FK6 A;  3ULQ B;  4OMY A;  3HOU J;  4XBF A;  3L2V A;  3QU6 A;  4HF0 A;  1ZYR F;  2JK3 A;  3A03 A;  4LMY A;  3WTS C;  3TBI A;  3BPX A;  3RSN A;  4IL6 C;  4DZJ A;  3IRQ A;  3V7C A;  2MLK A;  3CJN A;  3WTX C;  4CSW A;  4LOC A;  4CCM A;  1ZRC A;  3JCU C;  1RET A;  2F48 A;  4BJ6 C;  4R8H A;  1OLT A;  4IJA A;  2OQR A;  4A69 C;  4L9J A;  3KX2 A;  2DA5 A;  4NQW B;  5ILV A;  1VTN C;  1B9N A;  1N75 A;  1X1C A;  1LEB A;  2MW8 A;  3E6D A;  2AQF A;  5C44 J;  1ODD A;  1S7E A;  2CS3 A;  4JK1 X;  3E97 A;  2QCO A;  5FRO A;  3DU6 A;  3DPT A;  2CV1 A;  3W6K B;  5C4J J;  2RRE A;  2DA6 A;  3MQ0 A;  1ZRE A;  2DO7 A;  2JJ7 A;  3JW4 A;  2DMT A;  1FP2 A;  1XMA A;  3E7L A;  1HKS A;  2KIM A;  2FBI A;  4BE2 A;  4KA4 A;  4DYQ A;  1MJB A;  4HX8 A;  1DUX C;  3PJR A;  2XGX A;  2XAU A;  5L3B A;  1FPQ A;  3HYI A;  4BAY A;  2ISZ A;  2Z1D A;  3S3M A;  1IV8 A;  2ME0 A;  2G7H A;  1IRZ A;  1WGX A;  5D5X B;  5IP7 J;  2XRL A;  3KLO A;  3SDB A;  1AKH A;  1B9M A;  1SFK A;  3FWE A;  3I56 I;  3PO2 J;  3ML6 A;  4QWQ A;  3JRD A;  3HOT A;  4J00 A;  3ZQC A;  4BXX J;  3A01 B;  4N4O B;  4CCK A;  3DP7 A;  1WHU A;  3WTU C;  2FBH A;  4D1Q A;  2L9N A;  4XNF A;  3MKL A;  5M3M J;  4GO1 A;  4PSX A;  2BE5 F;  2W84 A;  3H9Q A;  3PM1 A;  5GAD J;  4Q4Z F;  2DFF A;  1YS6 A;  1XCB A;  1HA8 A;  2HGC A;  3DLL F;  5B1B H;  2Q2E A;  1UG2 A;  4PZJ A;  4OIN F;  2L4M A;  3WTW C;  4QIW N;  1H89 C;  1JKO C;  1QBJ A;  3RYR A;  5A2Q K;  2HKX A;  3NRV A;  4QLC U;  4BUP A;  2VKE A;  2LRE A;  5DD8 A;  4B43 A;  2VBX A;  1G3W A;  4HLY A;  3EYY A;  3WOD F;  2DCE A;  1BI2 A;  4LG0 A;  3M07 A;  1U8R A;  2OU2 A;  2HQN A;  1WJE A;  5EZH A;  1HKQ A;  5HDG A;  5LGN A;  3TO6 A;  2DXI A;  4HQM A;  1XSV A;  1HW5 A;  3G1O A;  1SAX A;  3QP5 A;  2GXG A;  1S3J A;  2WAD A;  4RGS A;  3RTR A;  3I71 A;  2PMZ N;  2FXA A;  4M9Z A;  4BDY A;  4N4N B;  4RAG A;  2HOA A;  3ZPL A;  2AO9 A;  2XAG A;  4PCQ A;  1G3Y A;  1U9N A;  1WCM J;  3HSF A;  4C2M J;  5LEJ A;  2OTJ I;  4UHT A;  2ESN A;  2K3F A;  2M30 A;  4ZYD A;  2PBI A;  3CCJ I;  2IS1 A;  1VI0 A;  4C30 A;  4DGW B;  3HEF A;  4FCY A;  1NK3 P;  1K83 J;  3TOB A;  5KVR A;  2I8D A;  2ETH A;  1PUE E;  3IWZ A;  4HEA 2;  3WHB A;  2O6G E;  2V79 A;  3B6A A;  2EQR A;  3RPU D;  1V55 H;  4AVP A;  1FOY A;  4RGU A;  4IRI A;  3NAR A;  4A93 J;  3LSI A;  4P55 A;  4HZF A;  3AL0 C;  3DBL B;  4IHY A;  1SD6 A;  3KE2 A;  5H6Q A;  2DDA A;  3FXM A;  2NXN B;  5B66 C;  2D2W A;  3EQL F;  4QPQ A;  3IAS 2;  4HLX A;  2AXL A;  2VJ5 A;  3ABT A;  2F2E A;  2DT7 B;  3WE2 A;  1JUM A;  4UUS B;  2JRT A;  1J75 A;  1UHS A;  2LFB A;  2M2E A;  4EGZ A;  3CQZ J;  4QPO A;  3QYB A;  1VND A;  2B0L A;  2HOE A;  1VQ5 I;  4XLA A;  2C6Y A;  3W3C A;  2YX4 A;  5BS6 A;  4I76 A;  4EJO A;  3G3Z A; 
#chains in the Genus database with same CATH homology
 2QYO A;  4Q47 A;  2BGC A;  2J5O A;  2KJC A;  2D45 A;  1SFX A;  3KCC A;  4S05 A;  2CYY A;  1CGP A;  1LDK B;  3BDD A;  4A2U A;  1D5V A;  1BJA A;  1B1B A;  2X4H A;  4DNC A;  3U1D A;  2ZO4 A;  5E8G A;  2G7U A;  2XIG A;  3ZP5 A;  4L18 B;  4ENK A;  2IA1 A;  2R7D A;  1FYL A;  1MDM B;  5J8C A;  5D6E A;  1FC3 A;  3U2R A;  3G73 A;  1P6R A;  4MHG A;  4R1H A;  5LRR A;  2ZBK A;  5DD4 A;  4CIC A;  1FSH A;  2PN6 A;  3IWF A;  4ENM A;  4BH9 A;  4M72 A;  1U78 A;  1YIO A;  4KIF A;  3KP3 A;  1J9I A;  2PQ8 A;  2V9V A;  2FQ3 A;  3GX4 X;  1WQ2 A;  2RDP A;  1JGS A;  1LNW A;  1OYI A;  1ZGJ A;  4MTD A;  4ETS A;  1BIA A;  2M5W A;  1YTY A;  3WGG A;  1LJ9 A;  1OPC A;  1FY7 A;  2IRF G;  3TKY A;  5ICC A;  1Z7U A;  3KEO A;  3ABU A;  1FBQ A;  5H6R A;  3AAF A;  4EV0 A;  1ULY A;  3ISP A;  1IZ1 A;  5LHH A;  1W5S A;  1E17 A;  4M6X A;  2RVC A;  2RQP A;  4GXO A;  2K86 A;  3QPT A;  3E6M A;  5ICF A;  1BC7 C;  4I0B A;  3VB2 A;  2DI3 A;  2FE3 A;  1SD5 A;  2QEN A;  4XSZ F;  3I53 A;  2K27 A;  2NS0 A;  4WXH A;  3SQN A;  5FD5 A;  1LQ1 A;  4NHJ A;  4MGR A;  1KQ8 A;  4LB6 B;  3CDH A;  5F64 A;  4RB1 A;  6PAX A;  2IA0 A;  5HS7 A;  1TQM A;  3ZMS A;  1XGN A;  4NB5 A;  1P4W A;  4A5N A;  1EH6 A;  5HLI A;  2DT5 A;  1O3S A;  2KJB A;  2F5C A;  1ZN2 A;  2K7L A;  2EV0 A;  1UCR A;  4L9N A;  2W25 A;  1EH8 A;  2DAO A;  2VE8 A;  1R23 A;  2XV4 S;  4YG2 F;  4G7Z F;  1ZG3 A;  3FMR A;  3DFG A;  4PGG A;  2V1X A;  4G6D A;  3HRS A;  3FX3 A;  3EYI A;  2L01 A;  2CWE A;  1U2W A;  3IKT A;  4RAZ A;  4LLG F;  4RB2 C;  1STZ A;  2GA1 A;  5ICE A;  4FX4 A;  4ESF A;  3L00 A;  2HR3 A;  2A69 F;  3FXU A;  4HX7 A;  3KP5 A;  5FB2 A;  4CO8 A;  5TJJ A;  2HS5 A;  3TDU C;  3DQV C;  3ZN0 A;  2ISY A;  1K78 B;  3GEZ A;  3J7A O;  3GWZ A;  4H0E A;  1FSE A;  4U0Y A;  4UVC A;  5FO5 A;  5E1W A;  2P6T A;  4ZH4 F;  3MWM A;  1TNT A;  1EV7 A;  2OZU A;  4MNU A;  2DTR A;  4U7B A;  3TQN A;  1I5Z A;  1KQ9 A;  3DEU A;  5AON A;  1ZG1 A;  2FF4 A;  3I0T A;  2M45 A;  2EWN A;  3GO5 A;  1OYY A;  3CUQ A;  1H0M A;  3T8T A;  5CJ9 A;  1ZGA A;  4XSX F;  2ZCW A;  3FZV A;  1EH7 A;  1RNL A;  1Y0U A;  2RV8 A;  4LB5 A;  2TDX A;  3RJP A;  5FLX K;  4RB3 C;  2YPR A;  2NAZ A;  2EFO A;  1XCV A;  3FF5 A;  4YIF A;  4RAY A;  2VOO A;  2CQK A;  5FFZ A;  2D1V A;  1CF7 B;  1KU7 A;  2YSR A;  1YYV A;  3E5U A;  2XKP A;  4KMU X;  3D0S A;  1JE8 A;  1SFE A;  1Z6R A;  1UHM A;  4CZZ A;  4A5M A;  3PFI A;  2DFI A;  5F1R A;  2E1C A;  4N9I A;  3KZZ A;  2P4W A;  1ZAR A;  2E7W A;  2DK5 A;  1S6L A;  1P4A A;  4Y15 A;  3Q9V A;  4HBL A;  3HHH A;  4N0B A;  2E7X A;  3I54 A;  1XB4 A;  4G8X A;  2QQB A;  4M6Y A;  5LGU A;  1PP7 U;  2IP2 A;  4P5O A;  4EJT A;  3JTG A;  3HTU A;  5HDK A;  2HQR A;  4HDV A;  2QBY B;  5D5V B;  2VC1 A;  4M74 A;  3P9K A;  3J81 K;  1ZRD A;  4EM2 A;  3J80 Z;  4RB0 A;  1FP1 D;  1Q1H A;  2HTJ A;  3BWG A;  2JZY A;  2F5D A;  5CVR A;  3LWF A;  1U5T B;  2COM A;  1QZZ A;  5D5U B;  3WTV C;  1RUN A;  3HRM A;  3K2Z A;  2ZNY A;  2IW5 A;  4EJW A;  3NEU A;  5LLQ A;  1GHC A;  3GZ5 A;  2PMU A;  4ZZL A;  1TQI A;  4LLL A;  3M9A A;  4MQV A;  5CVJ A;  2HWV A;  5DCM A;  3ECO A;  4L0Y B;  3ECH A;  4M73 A;  1SFU A;  2P7V B;  3R0J A;  3CO6 C;  2MBF A;  1GVJ A;  1ZH5 A;  4KFC A;  3WGH A;  4HA8 A;  1LEA A;  1TW3 A;  3TDZ C;  4Z2Y A;  1IN5 A;  2MLG A;  3KET A;  2HZT A;  4IRH A;  5JR3 A;  2CW0 F;  1TNS A;  4IF4 A;  4A0Z A;  1UB9 A;  2LF8 A;  2YR2 A;  3ZMT A;  1BN5 A;  2EFW A;  2D1H A;  4A12 A;  4M71 A;  5D8K B;  3V8K A;  1IRG A;  2WC2 A;  4HQE A;  5JI6 A;  3E3V A;  1R7J A;  3SZT A;  2PJP A;  2W57 A;  4P9F A;  5HS9 A;  5ILS A;  1DPU A;  3FM5 A;  1YW8 A;  1K6O A;  3RKX A;  3J80 K;  2Z33 A;  2A6H F;  2VXZ A;  3JAM K;  3P9I A;  1YW7 A;  2HYG D;  3TO7 A;  4KN4 X;  1B4A A;  4IXA A;  5FFX A;  1WI9 A;  1BI1 A;  3R60 A;  2G9W A;  4U88 A;  1KU2 A;  1Z1D A;  1XDU A;  1YS7 A;  2QBY A;  5D5W B;  1FLI A;  1KA8 A;  3F8M A;  2Z9O A;  1FNN A;  3C18 A;  1T0F A;  3VFZ A;  1H9G A;  4OIR F;  3DF8 A;  2J5P A;  2HDC A;  3COA C;  3JTH A;  1P92 A;  4E70 A;  3O3K A;  2W24 A;  2Y75 A;  2FML A;  3WTY C;  4IRG A;  3F72 A;  4O6J A;  1MD0 A;  2XAQ A;  1U5T A;  1O3T A;  5D6F A;  4AIH A;  3F3X A;  3R0A A;  4RGR A;  1R58 A;  2R3S A;  1S7A A;  2OZ6 A;  1G3T A;  4UNO A;  3R4K A;  4Q5S F;  1C0W A;  4YFK F;  2VE9 A;  1J59 A;  3H92 A;  4TV7 A;  3B73 A;  2ZNZ A;  3C1D A;  4ENN A;  4UXN A;  2R7F A;  1P2F A;  3HIF A;  1IUY A;  4KYW A;  3GFJ A;  3ZMZ A;  1JXS A;  1DP7 P;  2JTV A;  1J0R A;  4NQW A;  2IVM A;  4S04 A;  4HW0 A;  2ADU A;  2LNB A;  3O6B B;  4A0X A;  5DUI A;  3E5X A;  2A07 F;  5CYV A;  2GZW A;  3KP7 A;  3HSE A;  3PQJ A;  5ILU A;  3CUQ C;  4OIO F;  1YW9 A;  2FSW A;  1O7L A;  1Z05 A;  2BV6 A;  2IT0 A;  4XRF A;  5LGT A;  3MZY A;  1SMT A;  2L3D A;  4HF1 A;  3TO9 A;  4M9X A;  4I0A A;  1J5Y A;  2L4A A;  2NNN A;  2V6C A;  1I6X A;  2YX7 A;  5JFR A;  5JHU A;  3LQQ A;  5FD6 A;  2X0L A;  4ZYE A;  3OOP A;  3B02 A;  4U7D A;  1NHA A;  4I2O A;  4GGG A;  2DK8 A;  2HYF A;  5KK1 A;  2Q0O A;  3QPH A;  4WXD A;  3SHF A;  1W4M A;  4WCG A;  2IPQ X;  2DPU A;  2M1B A;  4KMF A;  5LRS A;  2H27 A;  3LA2 A;  4N9H A;  1R36 A;  3KP4 A;  3C7J A;  3BJO A;  5LEK A;  3M1E A;  4ZZD A;  1FBS A;  3RDI A;  3ZN1 A;  3CLO A;  1USS A;  2OAZ A;  4HYE A;  4BXU A;  2Y0M A;  4OIQ F;  2XHK A;  2VON A;  4LK0 F;  2EA4 A;  5IT3 A;  4EVI A;  5FLX Z;  3LA7 A;  1BIB A;  4RGX A;  4I7H A;  2GWR A;  2FBK A;  3GVA A;  1QNT A;  2VBY A;  3I4P A;  2P7C B;  3WE3 A;  3F8C A;  4ENJ A;  1G3S A;  3DXJ F;  4UV8 A;  4GYG A;  3WTT C;  4XLP F;  2CSO A;  3P9C A;  2QLZ A;  4ESB A;  4IPA A;  4GYI A;  1XSD A;  2KKO A;  4WF2 A;  3RKY A;  3GUD A;  5E17 F;  1LDD A;  4PGH A;  1KQ0 A;  1OYW A;  2A5Y B;  4I98 B;  1FYM A;  3CTA A;  4OOI A;  2NRA C;  5K5Q A;  1HBX G;  1IN6 A;  1R1T A;  2H6C A;  2CGP A;  4EJU A;  2KIU A;  4BHB A;  2MH9 A;  1R1U A;  1MDM A;  5L3F A;  3F8F A;  3J81 Z;  2CFX A;  3K1N A;  2HFH A;  3K69 A;  1REP C;  3RPU A;  1J7K A;  1D8K A;  2LSO A;  3M7G A;  4OMZ A;  4G9Y A;  2ZME B;  2PG4 A;  4L5I A;  1T98 A;  1HW2 A;  1H9T A;  2DQR A;  3QU3 A;  1O57 A;  5LBQ A;  1U3E M;  3R61 A;  2RKH A;  3I5U A;  4FT8 A;  3O2P E;  5BPI A;  3E6B A;  1W7P B;  1LVA A;  2UXX A;  1TTY A;  1KU9 A;  4O3M A;  1XMK A;  2OA4 A;  5H20 A;  2VBW A;  5E18 F;  2AS5 F;  1L0O C;  4GCV A;  2XAF A;  3ZMD A;  3IL2 A;  1YLF A;  5CLS A;  3KLN A;  3RPQ A;  4EJV A;  4I09 A;  4WWC A;  1TW2 A;  2EV6 A;  3IRR A;  4YFN F;  4HOB A;  2KIF A;  1SD7 A;  4G6Q A;  3I59 B;  3BP8 A;  3V8J A;  2FNA A;  3U9G A;  1K79 A;  2VN2 A;  1QZY A;  2STT A;  3WG9 A;  4EM1 A;  3F21 A;  1B6A A;  1ZRF A;  2FRH A;  1RZ4 A;  3LST A;  1T38 A;  2JPC A;  3I64 A;  2QWW A;  4IVN A;  3DV8 A;  1MZB A;  4CYD A;  2QUF A;  2IA2 A;  2DW4 A;  4YII A;  1FT9 A;  1AOY A;  2QQA A;  4I02 A;  1I27 A;  2A3S A;  1WWX A;  1S8N A;  4LFU A;  2E1N A;  2GAU A;  1BC8 C;  4IHT A;  3V7R A;  1FBU A;  4CXF A;  1RI7 A;  1IXS B;  3FMQ A;  1DDN A;  5DEQ A;  2ACJ A;  4LG0 B;  1QO0 D;  1KYZ A;  3JAM Z;  5E8I A;  4WX9 A;  1O7F A;  4AIK A;  4FHT A;  5ICG A;  2MC3 A;  1F5T A;  2F5E A;  1F1Z A;  2VOP A;  2A61 A;  1Z91 A;  1V3F A;  5CVI A;  2O03 A;  2MH2 A;  3F8N A;  1IXC A;  1K78 A;  4YFX F;  1R5G A;  3WU0 A;  2CO5 A;  4HAM A;  1V4R A;  5LHI A;  1ONV A;  1ON2 A;  1LB2 A;  1TLH B;  2ZME A;  3LAJ A;  2ZKZ A;  2DBB A;  1SMY F;  5FGM A;  3GFI A;  2P5V A;  3L2C A;  4L9V A;  3WU1 B;  1MKM A;  1PDN C;  2LF7 A;  4DQ2 A;  4KNY A;  2UZK A;  1R1V A;  2FU4 A;  1IXR C;  2V1U A;  2PMH A;  3M8E A;  2EB7 A;  2BEO A;  4OIP F;  2A6E F;  5E1Z B;  1FX7 A;  3RIR A;  2OBP A;  3MFK A;  5J8F A;  1B59 A;  1ZLJ A;  1RUO A;  2WWY A;  3LQR A;  2ZXJ A;  2XRO A;  4BYY A;  3MEX A;  5BMZ A;  1ON1 A;  2GIV A;  1MGT A;  4G7O F;  5HLG A;  5DUK A;  4MTE A;  3I59 A;  1CF7 A;  5E1X A;  1R22 A;  5LHG A;  4KIB A;  1HKT A;  4ON0 A;  4MEY F;  3LA3 A;  1P4X A;  4HDU A;  2XAJ A;  4IHS A;  2Q8K A;  1QPM A;  4LGW A;  3VEP A;  2RNJ A;  1G6N A;  5DV5 A;  1SD4 A;  1ZHF A;  1QGP A;  3RYP A;  4LK1 F;  3GLX A;  5DYM A;  1OKR A;  1E2X A;  3T8R A;  3KFW X;  2LKP A;  2Z99 A;  5K1Y A;  4WK8 F;  1IN8 A;  4R79 A;  2EFN A;  4I01 A;  4L9T A;  1PP8 F;  2F5F A;  2XAS A;  1K7A A;  4JBA A;  4D0P A;  3KZY A;  2Z5U A;  1IN7 A;  3MCZ A;  3GXO A;  5IT9 K;  3RKW A;  2JT1 A;  4ESJ A;  1R5H A;  5AIP A;  2O3F A;  3T5X A;  3LFK A;  4KIG A;  2STW A;  4K2E A;  1ZLK A;  1UST A;  4UVB A;  5EEH A;  4UUV A;  2BYV E;  2XKO A;  1JHH A;  3K1P A;  2NYX A;  2OD5 A;  3F22 A;  1BI0 A;  3GYH X;  3FHZ A;  3OV8 A;  2H94 A;  2L54 A;  2P8T A;  3P7N A;  3I58 A;  2QVO A;  1RIO H;  4AIJ A;  4HV5 A;  3T0Y A;  1W5T A;  3WGI A;  1HSJ A;  2OQG A;  3EUH A;  4Y17 A;  1FWZ A;  1KYW A;  1L3L A;  4P96 A;  1T2K A;  4U0V A;  2EA2 A;  1TQP A;  2VT3 A;  5ED4 A;  5BPD A;  3F8B A;  3MZH A;  3S2W A;  4JQF A;  4HV6 A;  5EEG A;  3ERE D;  3L9F A;  3KP2 A;  1FOK A;  5F6F A;  2H6B A;  4WXC A;  5D4S A;  2DU9 A;  3ROU A;  2GA2 A;  3LAP A;  4EM0 B;  4HX4 A;  3SZP A;  3ZMV A;  4F7Z A;  3E6C C;  1S7O A;  3FXR A;  2FNP A;  1XGO A;  3MAJ A;  3FXQ A;  4BHC A;  3BOQ A;  1YG2 A;  1FYK A;  4M9S A;  2UWM A;  2GQQ A;  3GFL A;  3HRT A;  3Q5F A;  5E20 A;  1WKM A;  5HLH A;  5TRD A;  3VOE A;  2ZJ2 A;  4MEX F;  5BQT A;  2EJR A;  3F6O A;  4O5V A;  4AD9 A;  4FX0 A;  2HKO A;  4EQQ A;  2PFB A;  3CUQ B;  3EDP A;  4G94 A;  2P6S A;  3SFZ A;  1XGM A;  4EGY A;  4CGZ A;  1KU3 A;  1F9N A;  2O0Y A;  4A6D A;  3BJ6 A;  3QRF F;  1A04 A;  1IN4 A;  2RGV A;  2V1D A;  3QOP A;  1AWC A;  2EFP A;  3QAH A;  3TOA A;  2P5K A;  2DPD A;  2EV5 A;  5HOO A;  3H3U A;  2QQ9 A;  3EET A;  4L5J A;  1S29 A;  1JHF A;  3Q9S A;  3JSP A;  4B09 A;  2P5L C;  3GW2 A;  2BBY A;  3DKW A;  4Y13 A;  2W85 A;  3F23 A;  4RS8 A;  5AIQ A;  4LJZ F;  2PEX A;  1IRF A;  2XRN A;  1MJA A;  1FZP B;  3FMS A;  2IJL A;  4UVA A;  3JSO A;  2DLL A;  1IF1 A;  1O3R A;  1W7P D;  2QM3 A;  4U0W A;  3V7S A;  4UV9 A;  2HEO A;  1MJ9 A;  1IW7 F;  4B8X A;  2NNY A;  2Z3Y A;  3QP6 A;  2FOK A;  3HUG A;  2PI0 A;  1ZG5 A;  3TGN A;  3K0L A;  4BNC A;  1KGS A;  2MA3 A;  4L0Z B;  3E5Q A;  1ZAO A;  3V8L A;  4Q48 A;  1HST A;  5ERI A;  3BPV A;  2Y48 A;  5K5O A;  1I1S A;  3BJA A;  4A6E A;  1GXP A;  2O8X A;  3W6J B;  4KDP A;  4LLN A;  4ASN A;  1TBX A;  4ZYH A;  4PDK A;  4BHP A;  5DDG A;  3BY6 A;  4CHU A;  3GF2 A;  1T39 A;  4OU0 A;  3N4M A;  2EK5 A;  3DPL C;  3GFM A;  2K4B A;  2L02 A;  5HDN A;  4LD5 A;  5D8L B;  1GXQ A;  3IHU A;  4KIC A;  2PLY A;  2KRF A;  3RI4 A;  1DPR A;  1OR7 A;  1BM9 A;  3FM3 A;  1XN7 A;  2K4J A;  2VT2 A;  3KP6 A;  5DCM B;  2HTS A;  2ESH A;  4BQA A;  2MD5 A;  5L3G A;  2O61 A;  3PQK A;  3H3Z A;  3IKV A;  3NQO A;  5HVQ C;  5HS8 A;  1OMI A;  3SXY A;  5L3D A;  1O3Q A;  3CO7 C;  1WSU A;  1XDS A;  1F4K A;  1YQA A;  3N97 A;  1BOA A;  2M87 A;  3VOD A;  2YU3 A;  3HOS A;  2M8E A;  3HSR A;  3L7W A;  3ZMU A;  3D5L A;  3HHG A;  4CDG A;  5L3E A;  2CG4 A;  1Z9C A;  1Z6T A;  1YO5 C;  4KUM A;  3C3W A;  2JPB A;  1I1G A;  1R00 A;  4P9U A;  1HXD A;  4A0Y A;  3WTZ A;  3ZQ7 A;  5DCF A;  4G7H F;  1XD7 A;  4AWX B;  1UFM A;  2FEZ A;  2ELH A;  2JSC A;  1T6S A;  4EMS A;  2GXB A;  2A68 F;  2ZFW A;  4HF2 A;  2FMY A;  1BBY A;  4KN7 X;  2LDU A;  1XSX A;  1U5T C;  5D4R A;  3V4G A;  3K9T A;  3F6V A;  3IC7 A;  1IAW A;  2RN7 A;  3HTS B;  2VC0 A;  5CVU A;  2DQL A;  3REO A;  1UHW A;  5BOX A;  3BZ6 A;  5CVV A;  1G4D A;  2WV0 A;  2XAH A;  1HQC A;  2FA5 A;  2XUB A;  1U6G A;  4KT5 C;  1D8J A;  5L3C A;  5A2Q Z;  1HW1 A;  2H09 A;  2QZ8 A;  2EFQ A;  3KEQ A;  1XGS A;  1D3Y A;  3R6S A;  2VOD A;  3L09 A;  3M8F A;  1QQI A;  3T1B A;  3HRU A;  5IT9 Z;  2VBZ A;  2UXN A;  5K5R A;  1WRJ A;  1X3U A;  2RC4 A;  4XLN F;  2K02 A;  3K1M A;  5J6X A;  3BRO A;  2WTE A;  5JVT A;  1LDJ A;  3GZ6 A;  4MQ9 F;  1W7P A;  1YFH A;  3CUO A;  1J2X A;  1BI3 A;  2XVC A;  4ZYG A;  3ELK A;  3ULQ B;  4OMY A;  4XBF A;  3QU6 A;  4HF0 A;  1ZYR F;  4LMY A;  3WTS C;  3BPX A;  3IRQ A;  3V7C A;  2MLK A;  3CJN A;  3WTX C;  1ZRC A;  4R8H A;  4IJA A;  5ILV A;  2OQR A;  4L9J A;  1VTN C;  1B9N A;  1LEB A;  3E6D A;  1ODD A;  4JK1 X;  3E97 A;  3DPT A;  3W6K B;  3MQ0 A;  1ZRE A;  2DO7 A;  3JW4 A;  1FP2 A;  1XMA A;  1HKS A;  2KIM A;  2FBI A;  4KA4 A;  1MJB A;  4HX8 A;  1DUX C;  2XGX A;  5L3B A;  1FPQ A;  3HYI A;  4BAY A;  2ISZ A;  2G7H A;  5D5X B;  3KLO A;  1B9M A;  3FWE A;  3ML6 A;  4QWQ A;  3HOT A;  3DP7 A;  3WTU C;  2FBH A;  4GO1 A;  2BE5 F;  2W84 A;  4Q4Z F;  1YS6 A;  1XCB A;  2HGC A;  2Q2E A;  4PZJ A;  4OIN F;  2L4M A;  3WTW C;  1QBJ A;  3RYR A;  5A2Q K;  2HKX A;  3NRV A;  4QLC U;  5DD8 A;  2VBX A;  1G3W A;  4HLY A;  3EYY A;  3WOD F;  1BI2 A;  4LG0 A;  1U8R A;  2OU2 A;  2HQN A;  5HDG A;  1HKQ A;  5LGN A;  3TO6 A;  4HQM A;  1XSV A;  1HW5 A;  1SAX A;  3QP5 A;  2GXG A;  1S3J A;  4RGS A;  3RTR A;  3I71 A;  2FXA A;  4M9Z A;  3ZPL A;  2XAG A;  4PCQ A;  1G3Y A;  3HSF A;  5LEJ A;  4UHT A;  2ESN A;  2M30 A;  4ZYD A;  2PBI A;  3TOB A;  5KVR A;  2ETH A;  1PUE E;  3IWZ A;  2O6G E;  2V79 A;  4AVP A;  4IRI A;  4RGU A;  4P55 A;  4HZF A;  1SD6 A;  3KE2 A;  5H6Q A;  2D2W A;  3EQL F;  4HLX A;  2AXL A;  3ABT A;  2F2E A;  3WE2 A;  1J75 A;  2JRT A;  4EGZ A;  2B0L A;  2HOE A;  2C6Y A;  2YX4 A;  5BS6 A;  4EJO A;  3G3Z A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...