3AAFA

Structure of wrn rqc domain bound to double-stranded dna
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
109
structure length
109
Chain Sequence
SWDFGPQAFKLLSAVDILGEKFGIGLPILFLRGSNSQRLADQYRRHSLFGTGKDQTESWWKAFSRQLITEGFLVEVSRYNKFMKICALTKKGRNWLHKANTESQSLILQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structural basis for DNA strand separation by the unconventional winged-helix domain of RecQ helicase WRN
pubmed doi rcsb
source organism Homo sapiens
molecule tags Dna binding protein/dna
molecule keywords Werner syndrome ATP-dependent helicase
total genus 35
structure length 109
sequence length 109
chains with identical sequence B
ec nomenclature ec 3.6.4.12: DNA helicase.
pdb deposition date 2009-11-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF09382 RQC RQC domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 3aafA00
1XGMA 1BJAA 5TJJA 3WTVC 2XIGA 3C3WA 4O5VA 4UXNA 2LDUA 5LRSA 4LK1F 2CG4A 1F5TA 2FBKA 1G3SA 2DO7A 2KJCA 2MBFA 3KETA 5FFXA 2GAUA 3F72A 1B9NA 5E1ZB 3F8MA 3GXOA 4N9IA 2ZMEB 1TNTA 4ZYEA 1LNWA 1TW3A 2HZTA 1ZH5A 4HX7A 3GZ5A 3KEOA 1F4KA 1PDNC 2RN7A 4U0VA 1LJ9A 5TRDA 1U2WA 2ACJA 2PN6A 4M9SA 4HW0A 3IWFA 3MEXA 5L3EA 4CGZA 2F2EA 3ECHA 3IRRA 4AVPA 1XSDA 2M1BA 2EA2A 3R0AA 2YU3A 3W6KB 1HW5A 2P4WA 3BZ6A 2DFIA 1O3RA 1S3JA 3Q9VA 3ISPA 2ZFWA 4KT5C 1U8RA 4UV8A 2DW4A 3HIFA 2QVOA 3IHUA 4WCGA 2FMLA 5D5VB 2OD5A 2NAZA 1H9TA 3K2ZA 1FBSA 1EH6A 4IRGA 1EH7A 4MEYF 2IP2A 4IHSA 4RB0A 3LAJA 3FWEA 5HVQC 3ERED 4R8HA 1P6RA 4FX4A 1U3EM 1DPRA 4U88A 1BC7C 2H6BA 2RQPA 3HRUA 4ZZDA 2K86A 4IXAA 1IN5A 2YX7A 3KP5A 2R3SA 3JSOA 4OOIA 1K6OA 2BYVE 1J0RA 4L18B 3T0YA 4RGRA 2LSOA 4IJAA 1FPQA 2COMA 4WXHA 5FLXZ 3TO7A 4HX4A 1SMYF 1GXQA 4DNCA 5DCFA 1IW7F 3MWMA 4G8XA 3JTGA 1FWZA 3F8BA 2PLYA 3I58A 4JBAA 4CZZA 4Z2YA 2O8XA 2XRNA 2E7XA 2FOKA 3BJAA 2DPDA 1IF1A 4OIPF 3B02A 1JHHA 3QP5A 3WGGA 1K78A 2RNJA 3HYIA 4U0WA 1H9GA 3U2RA 4KFCA 4WK8F 3VB2A 5HS8A 3N4MA 2XAQA 2QZ8A 4PDKA 5JFRA 2H27A 3RKYA 3Q5FA 2O61A 3BOQA 4MQ9F 4PGHA 1RI7A 3WTYC 2O6GE 2XAHA 1QGPA 2L3DA 2PG4A 3VODA 3I54A 1WSUA 2HS5A 1J5YA 4KIBA 1HKQA 1BC8C 1YG2A 4AIKA 3BP8A 4HX8A 2K4BA 3LSTA 3QP6A 4LMYA 3ULQB 2LF7A 2ZNZA 4JQFA 5DCMB 2A68F 5HLGA 3LWFA 2STWA 3LA3A 1IRFA 2NNYA 5BMZA 1YIOA 2XHKA 4RGUA 1LVAA 2RC4A 2JT1A 3PQKA 3CLOA 2ISYA 1O7FA 2ZXJA 3TKYA 4B8XA 1XSVA 2UXXA 3KZYA 2EJRA 5LLQA 3KE2A 4UHTA 3H3UA 5ICGA 1B6AA 5K5QA 1SFEA 4EJOA 1PP7U 1ZG3A 3GFIA 1UFMA 2ETHA 2GZWA 4O3MA 2HKOA 2IJLA 4HA8A 2G7UA 3KFWX 3QPHA 4F7ZA 1YW7A 2ESHA 1PP8F 4N9HA 2JTVA 1TBXA 2ZJ2A 4HOBA 1ZGJA 2G7HA 2A69F 3P7NA 4HYEA 3HUGA 5CJ9A 3ML6A 4LGWA 4MQVA 1SFXA 2PJPA 3V7SA 2XGXA 5ED4A 3TOAA 4YG2F 3HTSB 1BBYA 2HGCA 3K9TA 1BI3A 3S2WA 3SXYA 3ECOA 2WWYA 3SFZA 3LQRA 4PGGA 1QO0D 3F8CA 2F5DA 2RGVA 2P7VB 4KDPA 2VC0A 5ICCA 2DPUA 2XUBA 4G9YA 3L00A 2WV0A 4PCQA 2A61A 4P55A 5J6XA 1I1SA 3C7JA 2E1CA 2DAOA 5CLSA 1BOAA 3NEUA 3IWZA 2W85A 3TQNA 5BQTA 2V1UA 1BIAA 4R1HA 4RAZA 4WF2A 1ZRFA 3KLNA 5D8KB 1RZ4A 2V9VA 3LA7A 3I0TA 1IUYA 2V1DA 3E5QA 2G9WA 2FXAA 3HSFA 4ZH4F 3EQLF 3E6DA 5KVRA 1FP1D 1JHFA 3O2PE 4EMSA 5ERIA 1R23A 1HW1A 2M87A 2WTEA 2ZNYA 2YPRA 2QENA 3ZMVA 4QLCU 5ILVA 5A2QZ 1P4AA 1R1TA 4OU0A 2FNAA 4HQMA 2PMHA 1BIBA 2Q0OA 4L9NA 4LD5A 1RNLA 3HTUA 4P9UA 2L4MA 3TOBA 4E70A 2LF8A 2HEOA 3MZHA 3QOPA 1XGSA 4ESBA 4IF4A 1T39A 3KP4A 2P8TA 1Y0UA 2CWEA 3P9CA 4PZJA 2AXLA 5E1WA 3AAFA 3R6SA 1R1UA 3FMRA 3K1MA 3EETA 3WU0A 2CSOA 4M9XA 4RAYA 2V6CA 4BQAA 2W24A 3MQ0A 3PQJA 1UB9A 4IRIA 5LEJA 4YFXF 1FLIA 5E8IA 1R58A 2K02A 1IN6A 4A0ZA 5K1YA 1WKMA 2EFQA 1IXSB 3U1DA 4G6DA 4CYDA 3FX3A 3I53A 5LGUA 3QPTA 1IN8A 1XSXA 4Y13A 4G6QA 3P9KA 3F23A 4A0XA 2KIUA 1RUOA 2CO5A 4K2EA 1D5VA 1FY7A 2Y48A 1FNNA 4FX0A 1TQPA 1BI0A 1AOYA 4ASNA 4L0ZB 3K1PA 1D3YA 1W7PB 2IA1A 1YLFA 1Z91A 2EB7A 3TDUC 1LDKB 2QLZA 5CVIA 1XMKA 4HDUA 2EFWA 4U7BA 4EVIA 4MNUA 1SD6A 2NNNA 4U7DA 2IW5A 4BXUA 3GZ6A 3EYYA 1QNTA 3RYPA 4I01A 1B1BA 2PBIA 1WWXA 2DTRA 3BJOA 1ZLKA 4A0YA 5D8LB 2H6CA 5F1RA 4HBLA 2H09A 4M6YA 5EEGA 3WTWC 1FC3A 1JGSA 4B09A 3MFKA 4A5NA 4G7HF 5AONA 3C1DA 3VOEA 3GO5A 2NRAC 3O6BB 2D45A 1T0FA 1LEBA 4A6EA 4ESJA 4HLYA 1Q1HA 2RV8A 2D1HA 4OMYA 1QQIA 4XSXF 1D8JA 2CYYA 1QZYA 2ZMEA 2GXBA 5HLHA 1P92A 3BWGA 1DDNA 4XRFA 2HQRA 1L3LA 2HQNA 1WQ2A 1Z9CA 2V1XA 3FXUA 4HF2A 1CF7A 4KYWA 1NHAA 3C18A 3FF5A 1WI9A 1J9IA 4YIIA 3HOTA 1ON2A 3TO9A 3DXJF 4L0YB 4A6DA 3U9GA 4XBFA 3H92A 3E5UA 2P6TA 3NRVA 4G7OF 2K4JA 2FU4A 1YQAA 1ZG1A 1S6LA 2LKPA 1ZREA 3RYRA 4M71A 3BROA 2O3FA 4AIJA 3RDIA 4Q4ZF 4HZFA 1Z6RA 2F5EA 3WTTC 3QRFF 2RKHA 2JPCA 2DI3A 2GXGA 2ZBKA 4Y15A 5FO5A 1MZBA 3E6MA 5DD4A 3QAHA 2E7WA 4ENJA 2QWWA 5DUIA 2UWMA 2ZKZA 1ZAOA 3OV8A 4LLGF 5BS6A 3FXRA 2HDCA 2EV0A 4IVNA 1BN5A 2VBYA 5HLIA 2XAFA 1KQ9A 4HV5A 4WXCA 5F6FA 3G3ZA 1CF7B 3F3XA 2VT2A 2IT0A 5AIPA 1FX7A 3GYHX 1FOKA 4I0BA 2HOEA 3M8EA 4L5IA 3HSEA 2DQLA 2ADUA 5JI6A 3JAMZ 4CICA 2JPBA 4LB6B 3KP2A 2GA1A 2EV5A 1B4AA 3LFKA 1S7OA 3R4KA 5D4RA 3O3KA 1R1VA 3ZMUA 4I02A 2OQGA 3TDZC 3F8FA 4I98B 5D6FA 1GXPA 2VE8A 4CO8A 1P4XA 5J8FA 3ZMZA 4GCVA 3I5UA 3FMQA 2DQRA 2MC3A 1QPMA 4RB2C 5EEHA 4R79A 1K79A 3HOSA 1HBXG 3WE2A 3R60A 3IC7A 2O03A 1XD7A 1TLHB 2IRFG 1Z6TA 2R7DA 2EV6A 4LB5A 2BEOA 2PEXA 2VBXA 5HS9A 5ILSA 3Q9SA 3D0SA 1OKRA 2PMUA 2HYGD 3MAJA 2MLGA 1IZ1A 2GIVA 1SFUA 1O7LA 3BPVA 4HF1A 1KQ0A 2MD5A 4OINF 3NQOA 2CGPA 2Z3YA 5E1XA 1W7PD 1J59A 3F21A 1X3UA 4DQ2A 2FRHA 4NHJA 3KCCA 2VOOA 2YR2A 3V7RA 5FD6A 3PFIA 2IVMA 1O3QA 4A2UA 1MGTA 2ZCWA 1REPC 2R7FA 4EJUA 3FMSA 1SAXA 2FBHA 2K7LA 3M9AA 4U0YA 4OIQF 4Y17A 4KNYA 4HQEA 3GUDA 2VOPA 4UVBA 2C6YA 4KIFA 4ZYDA 4Q48A 5LHIA 2PQ8A 1T6SA 1ZRCA 1XCVA 3BPXA 3E6CC 1TQMA 4KA4A 4I2OA 3D5LA 3LA2A 1HKSA 3T1BA 2KJBA 1R36A 1J7KA 1LB2A 4KN4X 4GGGA 1OR7A 1ZYRF 3F22A 1G4DA 1Z7UA 1YTYA 5DCMA 5K5RA 2DLLA 3DFGA 3DV8A 4HV6A 1RIOH 1FSEA 1MDMA 2DU9A 2FMYA 5JR3A 2XKOA 1ONVA 1T38A 5HDNA 4Q47A 1C0WA 1L0OC 1OYWA 5D5XB 3GLXA 5DYMA 1DP7P 2J5PA 2UZKA 1XMAA 2QBYB 1T2KA 1F9NA 4MTEA 1S8NA 2V79A 1MDMB 2Y0MA 1LQ1A 5LGTA 1WRJA 1LDDA 1QBJA 4EM1A 4EV0A 2A5YB 1E2XA 2TDXA 2STTA 1HQCA 3GFJA 5BOXA 3V8LA 1IN4A 1VTNC 1HSTA 3V8KA 3E3VA 1D8KA 3J81K 2IA2A 4RB3C 1USTA 2W84A 3ZP5A 3WE3A 1H0MA 3IKTA 3I59A 2FSWA 4LK0F 4BNCA 1W4MA 5HOOA 4MHGA 4EGZA 3FZVA 1G3YA 1ZHFA 3SQNA 3KEQA 3REOA 4A5MA 2GWRA 3K1NA 5J8CA 1FYMA 4BHPA 1I27A 2DK5A 1ZG5A 1SD5A 4WXDA 3GW2A 4YFNF 2JSCA 3TO6A 2FEZA 4KICA 1OYYA 5FFZA 1UHMA 2M5WA 1AWCA 2GA2A 4P96A 3GFLA 5E8GA 3ZMTA 3DPLC 2EK5A 1I6XA 4CXFA 1R7JA 3CO6C 4OMZA 4M6XA 2OZ6A 3I71A 2A3SA 5IT3A 3CUOA 1MJBA 5DV5A 1USSA 1HKTA 2ZO4A 4GXOA 4EJVA 5FGMA 4IRHA 2P6SA 3ZQ7A 3MZYA 1PUEE 1MD0A 3FM3A 1R5GA 4M73A 1SD4A 1I1GA 1KU9A 3LQQA 5CVRA 5JHUA 2Q8KA 3CTAA 3ZMDA 4XSZF 1W5SA 2MA3A 1JE8A 2LNBA 5IT9Z 2KIMA 3F6VA 1HW2A 3I4PA 1J75A 4WX9A 1UCRA 2PI0A 2EWNA 4ON0A 2L54A 5BPDA 2X0LA 5L3GA 5BPIA 2QBYA 2BGCA 3B73A 1XDSA 1W7PA 3EDPA 2Y75A 4RB1A 2Z9OA 2K27A 3ROUA 3ZN1A 3KZZA 4WWCA 1XDUA 3HRSA 2HR3A 3COAC 2MH9A 2OAZA 4ESFA 1GHCA 1EH8A 1ZN2A 3M7GA 2VXZA 4G7ZF 5DD8A 2FQ3A 1OPCA 5L3DA 5JVTA 4LG0A 3WODF 4AWXB 3GWZA 4NB5A 4ZYGA 2VT3A 3L2CA 2VC1A 2E1NA 1I5ZA 1UHWA 2OU2A 1ULYA 1SMTA 2KKOA 4GYIA 5HS7A 4CHUA 2D1VA 2VE9A 2QM3A 1FT9A 1LEAA 3RTRA 3CUQB 5FB2A 5L3CA 4I7HA 3F8NA 3G73A 2HFHA 1F1ZA 1FBUA 3M8FA 5DDGA 4ENNA 2DBBA 4ENKA 1IRGA 3ZPLA 1KQ8A 3ABTA 3EUHA 5LBQA 3K0LA 4LLLA 2KRFA 5AIQA 4ZZLA 1U5TC 6PAXA 4HF0A 1SD7A 3JTHA 1ZRDA 4IPAA 2NS0A 1R22A 3DEUA 3R0JA 1O3SA 3CUQA 2QUFA 2VBZA 5ILUA 1BI1A 2RDPA 3WTUC 2Z99A 5CYVA 1KGSA 3BDDA 3ELKA 1KYZA 1S29A 5DUKA 2A6HF 4I09A 1STZA 3ZMSA 3V7CA 2HKXA 4KN7X 5LRRA 4O6JA 1OYIA 3W6JB 4UNOA 2QQAA 2IA0A 3CUQC 2CQKA 2FBIA 3RKXA 4RS8A 1XGNA 4EJWA 4BYYA 4GYGA 1G3WA 2H94A 3BJ6A 4CDGA 4HLXA 2VODA 2M45A 1KU2A 2Z5UA 3CDHA 4LLNA 3GVAA 3J7AO 5A2QK 3DKWA 2QQBA 1QZZA 1YS6A 4MEXF 4AIHA 3KLOA 2JZYA 1IXCA 2FNPA 3L7WA 4M72A 3SZTA 3SHFA 2OBPA 4BAYA 1IXRC 3EYIA 3SZPA 1BM9A 2XAGA 2HYFA 2OA4A 2P5LC 4P9FA 3DPTA 4XLNF 2L02A 2L01A 4BHCA 1YYVA 3DQVC 4YFKF 5FLXK 4L5JA 1XB4A 2EA4A 1U5TA 5LGNA 4IHTA 2P7CB 2ELHA 5HDGA 4LJZF 2F5CA 1K7AA 5ICFA 1TNSA 2ESNA 3JW4A 4ETSA 4KMUX 5H6RA 4MTDA 3RKWA 2RVCA 3E6BA 3WGIA 3FM5A 2Z33A 4OIRF 1P4WA 4S04A 1OMIA 1U6GA 1S7AA 4M9ZA 4I0AA 2BV6A 2KIFA 3DF8A 1EV7A 4L9JA 4XLPF 3E97A 2YX4A 2EFOA 2OQRA 4L9TA 3H3ZA 2P5VA 2CFXA 4GO1A 2PFBA 5CVVA 3QU6A 5CVUA 2A07F 2XAJA 2X4HA 4NQWA 4S05A 1O57A 3L9FA 1ZLJA 1V3FA 1HXDA 3JSPA 5E18F 1V4RA 2FA5A 5LHHA 2DK8A 2VN2A 4UV9A 1FYLA 4UUVA 3J80K 1CGPA 3R61A 1FZPB 4RGSA 3KP6A 1TW2A 4BHBA 3GEZA 1G6NA 3I59B 3T8RA 2QQ9A 5L3BA 2ISZA 3J80Z 5D6EA 1FP2A 5CVJA 1JXSA 4EM0B 3LAPA 2Q2EA 3TGNA 5K5OA 4H0EA 3GFMA 4JK1X 3DP7A 5DEQA 2DT5A 3OOPA 3E5XA 2M8EA 1MKMA 1J2XA 5LEKA 2WC2A 3CO7C 3GX4X 3VFZA 5F64A 1K78B 4M74A 3P9IA 3ZN0A 1U5TB 1KA8A 1E17A 2W25A 1FYKA 4EJTA 4G94A 1O3TA 3I64A 5E20A 1TTYA 2BBYA 3JAMK 2P5KA 1A04A 3KP7A 4LG0B 4D0PA 2CW0F 2VONA 3RPUA 2W57A 2XVCA 2XKPA 5H20A 5ICEA 1R00A 5KK1A 3J81Z 2A6EF 1YW8A 3HRMA 5FD5A 5E17F 4FHTA 2BE5F 1DUXC 3KP3A 3WG9A 3WU1B 3WTZA 3RIRA 1G3TA 4MGRA 4UVCA 5HDKA 1ZGAA 3CJNA 1KU7A 3ABUA 3WGHA 4A12A 4QWQA 1U78A 3WTSC 3HHHA 2YSRA 4KMFA 2MLKA 2NYXA 3V4GA 1ODDA 4P5OA 3IL2A 1P2FA 2IPQX 1DPUA 5D5UB 3K69A 2MH2A 1KU3A 1TQIA 4HAMA 2UXNA 1FBQA 3FXQA 4EGYA 3IRQA 3VEPA 2AS5F 1B59A 2M30A 3RPQA 1XGOA 4LFUA 2HTJA 2VBWA 3HRTA 3T8TA 3IKVA 5D4SA 1MJAA 3N97A 2XV4S 4N0BA 2XASA 3MCZA 3T5XA 4YIFA 1HSJA 2FF4A 5D5WB 5LHGA 1RUNA 1YFHA 2QYOA 1YO5C 2EFPA 1Z1DA 1XCBA 2J5OA 1BI2A 4AD9A 5L3FA 1Z05A 4RGXA 4HDVA 4Q5SF 4KIGA 2XROA 5H6QA 3V8JA 2GQQA 1R5HA 2F5FA 3HSRA 1KYWA 4EQQA 4BH9A 2O0YA 1GVJA 4L9VA 4UVAA 1YW9A 3WTXC 1ON1A 3L09A 5IT9K 4OIOF 2JRTA 1XN7A 2HWVA 1MJ9A 2HTSA 1IAWA 1ZARA 4ZYHA 4TV7A 3HHGA 4ENMA 4FT8A 2B0LA 4KUMA 1IN7A 1FSHA 4EM2A 1B9MA 3RI4A 2D2WA 3BY6A 3GF2A 1W5TA 2EFNA 2L4AA 3FHZA 3QU3A 1LDJA 3F6OA 1YS7A 2FE3A 3M1EA 1T98A 2OZUA 3RJPA
chains in the Genus database with same CATH superfamily
1XGMA 4NNJA 5F0FA 2BY2A 3A4CA 1BJAA 1YJNI 1NH3A 5TJJA 3D5RC 2DYRH 3WTVC 2XIGA 3C3WA 3CCRI 3LFUA 4O5VA 4UXNA 2LDUA 1G2HA 5LRSA 4LK1F 2WAFA 2CG4A 3UNGC 1F5TA 1LE8A 3D1NI 3I56I 3RZOJ 2FBKA 2LTPA 1G3SA 1ETXA 2DO7A 2KJCA 3CC7I 2O9LA 2MBFA 2R7QA 3KETA 5FFXA 1V5FA 2GAUA 2DA6A 4CCLA 2Z1DA 2R5ZB 4BDZA 3F72A 1B9NA 5E1ZB 2CV2A 3F8MA 2BY1A 2CH0A 3GXOA 4W1UA 4N9IA 2ZMEB 2HOAA 1TNTA 4ZYEA 1R71A 1Y6IA 3S3NA 1LNWA 1TW3A 2GIZA 2HZTA 1ZH5A 3I9V2 5EEAA 1RR7A 4HX7A 3GZ5A 3KEOA 1MBEA 2EINH 2ICWG 3A02A 1F4KA 5B66C 1PDNC 4IHXA 1X2MA 4XL9A 2RN7A 3CJQB 4U0VA 1LJ9A 1MW7A 1Z0XA 5TRDA 3ZCOA 5GADJ 1WJFA 1U2WA 4M3EA 2CU7A 2R5YA 3DLLF 4UB8C 4X1EA 2IGNA 2ACJA 4XNFA 2PN6A 4M9SA 3CDIA 2K40A 4CYCA 3HPGA 4HW0A 4C3JJ 4B43A 3IWFA 5IP7J 1AKHB 3MEXA 3M3YJ 3IH4A 3K10A 5L3EA 1WCMJ 4XN3A 4CGZA 3OYCA 2F2EA 3ECHA 3IRRA 4M3FA 3ZQGA 4AVPA 2LC2A 1XSDA 2M1BA 2EA2A 3R0AA 4N4OB 1HDPA 2YU3A 3W6KB 1HW5A 2P4WA 3BZ6A 1N78A 4KITB 2GOXB 3FXJA 2DFIA 5HLTA 3E1SA 1O3RA 1S3JA 1WFXA 4LIVA 3Q9VA 1SVLA 3ISPA 2ZFWA 4CCOA 1I39A 4KT5C 3CCJI 1U8RA 4UV8A 2DW4A 3HIFA 2HVRA 1BW6A 2WBMA 1DGWY 2QVOA 3IHUA 2DA5A 2K9NA 4WCGA 3OYEA 4GFBA 2FMLA 4FASD 2DMUA 4PJNA 1A36A 2XSJC 2ZXHA 5D5VB 2OD5A 4XM3A 2ZJPF 2NAZA 1H9TA 3H5NA 3Q0UA 3K2ZA 3CP2A 1KZHA 1FBSA 2HU9A 1DQUA 2W82A 1EH6A 4IRGA 3VYTB 1EH7A 1S72I 1GDTA 1I50J 4MEYF 2IP2A 4IHSA 3VSLA 3HKZA 4RB0A 3GTMJ 3LAJA 3FWEA 3ONQA 2JA6J 5HVQC 3ERED 3KEYA 4BEHB 1T0FC 4OWRB 2E2JJ 4R8HA 1P6RA 1BR1A 1MNDA 3IV5A 1Z67A 1OCPA 1D1AA 4FX4A 1U3EM 1DPRA 3PL8A 2ECCA 4U88A 5F0CA 1BC7C 2H6BA 2RQPA 3HRUA 4ZZDA 2HNHA 2K86A 3JRCA 4IXAA 1IN5A 2YX7A 3KP5A 3BR5A 2R3SA 3JSOA 2XF7A 4OOIA 2M34A 3RQ4A 2Z16A 3O8HA 4KT6A 5DTDA 4XLFA 1K6OA 3OIOA 4LITA 2BYVE 1J0RA 4L18B 3T0YA 4RGRA 3PNTA 4PK4A 2LSOA 3ZQHA 3HOUJ 4IJAA 3W6VA 3EPZA 3HOXJ 1FPQA 2COMA 4HEA2 3K4BA 4MFEA 4WXHA 3G1OA 5FLXZ 3TO7A 4KISA 4HX4A 2HVQA 1SMYF 1GXQA 2LD5A 3Q0VA 4CCJA 4DNCA 2XB0X 3C2GA 3I4MJ 5DCFA 5FROA 1R4NB 3CMYA 1IW7F 2UUZA 3MWMA 5DM6F 4G8XA 3JTGA 1FWZA 2LP0A 3F8BA 2PLYA 3FIWA 2F48A 5E3MA 3I58A 4BJ5C 4J01A 3K4CA 4BY7J 1OFCX 5FJ8J 4JBAA 4CZZA 4Z2YA 4G6TB 2IXSA 5J3LA 2O8XA 2XRNA 2E7XA 2FOKA 4HNVA 2OTLI 3BJAA 2DPDA 1IF1A 3BG9A 4OIPF 3B02A 1JHHA 3QP5A 3WGGA 1K78A 2RNJA 3HYIA 1FIPA 2BXZA 4U0WA 3BG5A 1H9GA 2MG4A 2JJ7A 3OS1A 3U2RA 3JRIA 4KFCA 3BQYA 1D5YA 3CCSI 3QWLA 1VQ5I 4M6VA 4WK8F 3VB2A 4P1WA 1QA6A 2K3PA 1OCRH 5HS8A 1SEUA 5M5WJ 3N4MA 2XAQA 2QZ8A 5EZGA 1AA7A 3TEDA 4PDKA 1P7JA 2CQNA 5JFRA 3PIPF 3AL0C 2MYSA 4EEFG 3FK6A 2H27A 4XRMA 3RKYA 3OYFA 3Q5FA 2O61A 3BOQA 4MQ9F 4PGHA 1R5ID 1RI7A 3D5SC 1YIJI 1FOXA 3WTYC 1VF9A 1NK2P 1A6IA 2O6GE 2XAHA 2DA4A 1QGPA 2L3DA 4CYCB 4AM3A 1K83J 4BBRJ 2PG4A 3VODA 3I54A 2DXIA 1WSUA 2HS5A 1J5YA 4KIBA 1HKQA 2M7BA 1BC8C 4HPQA 1YG2A 1B72A 4AIKA 1PUFA 3PUFA 3VPRA 2DODA 3BP8A 4HX8A 2K4BA 3LSTA 2E35A 1TP4A 3QP6A 1G59A 2Z2SB 1SFKA 3FKJA 1SVMA 2E71A 2XPWA 1XMXA 1QZEA 4LMYA 3VYSB 3ULQB 3BTCA 3F9KA 4B48A 2LF7A 2ZXIA 2ZNZA 4JQFA 5DCMB 2A68F 1XPXA 5HLGA 3LWFA 2STWA 3LA3A 2BW3B 4F55A 1IRFA 1GV2A 2F4OB 1YIOA 2WB1N 2XHKA 2MW8A 4RGUA 3EUKL 2NNYA 2QKMB 1LVAA 2RC4A 5CPRB 4V19K 2JT1A 3PQKA 4BQQA 3CLOA 1I6HJ 3J7YJ 2ISYA 5FKKA 1O7FA 2KZGA 1IGNA 4A3JJ 2ZXJA 5C4JJ 3TKYA 1QU3A 4B8XA 1XSVA 4ZDOA 3S1NJ 2UXXA 5M3MJ 3TW6A 3KZYA 2JA5J 1KONA 2EJRA 5LLQA 3KE2A 4UHTA 3FK7A 2BW3A 4JX6A 3H3UA 4W97A 2PMZA 4DYRA 5E3NA 5ICGA 1FMWA 4I76A 2F6CA 1B6AA 5K5QA 1SFEA 4BU2A 4EJOA 3OWTA 1PP7U 5KAFC 1ZG3A 3GFIA 1VI0A 2XGDA 2VKDA 3CCVI 1UFMA 2ETHA 4AC0A 2GZWA 4O3MA 2HKOA 3DTIA 2IJLA 4BQNA 2H8RA 3GTGJ 4HA8A 3G1MA 2G7UA 3KFWX 3U1KA 3QPHA 4F7ZA 5JVGF 4RBOA 1W1WE 1YW7A 3HB9A 2ESHA 4AU7A 1PP8F 5IYBJ 4N9HA 2ZC2A 2JTVA 1TBXA 2M4KA 2ZJ2A 2H1LA 4HOBA 3RCOA 4F93B 1EKEA 1ZGJA 2G7HA 2K9SA 3RQIA 4E4HA 4XICA 2A69F 3P7NA 2DFFA 4HYEA 3HUGA 5CJ9A 3CJRB 3ML6A 2QQ8A 4LGWA 3HDDA 4MQVA 1SFXA 2KP6A 1AKHA 1VQ9I 2PJPA 4RAGA 3V7SA 2O8KA 3L2WA 2DJNA 2XGXA 1MBKA 2LYCA 2KRHA 3TOAA 1TT5B 3GZNB 4YG2F 5ED4A 3HTSB 1BBYA 4A3MJ 2V26A 2HGCA 1X4PA 3K9TA 2ZJQF 3MZ8A 5F0HA 1BI3A 1MSFC 3S2WA 3SXYA 3ECOA 2WWYA 4DZJA 3SFZA 1VQPI 3LQRA 4PGGA 5J1UA 1QO0D 3F8CA 1IRZA 3Q0WA 2F5DA 1HCRA 4DYCA 2RGVA 2P7VB 3P5JA 1YRNA 2A6TA 3S2DJ 4QIWN 2VL8A 4KDPA 2VC0A 5ICCA 4Y33A 2XUBA 2DPUA 1Y8RB 2HZDA 4G9YA 3L00A 1TWAJ 5EG0B 1HA8A 2VUMJ 3CLQA 4CZCA 2WV0A 3QPSA 4C2MJ 2I10A 4PCQA 3RKQA 2JA8J 2A61A 4P55A 1UHSA 5J6XA 1I1SA 3C7JA 2E1CA 2DAOA 5CLSA 1YITI 3OL3A 1BOAA 3NEUA 2LKSA 3LSJA 3IWZA 2W85A 3TQNA 5BQTA 2V1UA 3FKIJ 1BIAA 3H9GA 4R1HA 4RAZA 3OYNA 4WF2A 3S14J 1ZRFA 3KLNA 5D8KB 1RZ4A 2V9VA 3LA7A 1PYVA 4JYKA 4FETA 2VQCA 3QQAA 3I0TA 1IUYA 2DA3A 2E1MB 2V1DA 3E5QA 1K4TA 2G9WA 1Y1WJ 5IP6A 2FXAA 3IP4B 3HSFA 4ZH4F 3EUAA 3EQLF 2XF6A 5LD2C 3E6DA 1OR7C 2LY1A 2OJED 5KVRA 3TMOA 4BE2A 3HC7A 1FP1D 1JHFA 2CW8A 3O2PE 4EMSA 5ERIA 1R23A 3H35A 1HW1A 2M87A 2WTEA 1DU0A 3LL7A 2WAQN 4M3DA 2JA2A 3OYLA 2ZNYA 2HPIA 2YPRA 3MKWB 1JKOC 1ETKA 2QENA 1IRGA 3ZMVA 4QLCU 5ILVA 5A2QZ 4E7KA 1P4AA 3RPUD 1R1TA 3HKZN 4OU0A 2FNAA 4HQMA 4CSWA 2HXOA 2PMHA 2LG4A 4HG2A 3OYDA 1JUPA 1BIBA 2Q0OA 2X6OA 4L9NA 4LD5A 3SEZA 1RNLA 3LSPA 2A05A 4B3XA 4BKXA 3HTUA 4XKWA 4P9UA 2L4MA 3W3CA 3TOBA 3OYGA 3LSRA 1IDZA 4E70A 2LF8A 2HEOA 3MZHA 4UUSB 2O7OA 3QOPA 1I3AA 1XGSA 2VLAA 4ESBA 1S9HA 2W1OA 4IF4A 1T39A 3OY9A 3KP4A 2LVSA 2P8TA 1Y0UA 4NDLA 3WHCA 2NVQJ 2CWEA 2E1OA 3P9CA 4PZJA 3SEQA 2AXLA 5E1WA 3DCFA 3AAFA 3R6SA 3W2VA 2BY3A 4RA2A 1R1UA 3FMRA 3K1MA 1IRXA 3EETA 4JX4A 3WU0A 2CSOA 5J4VA 4M9XA 4RAYA 3HJEA 1POGA 1ZR4A 2BY0A 2V6CA 4BQAA 4DW6A 3K6GA 1S7EA 2W24A 2GLOA 3MQ0A 3BTLA 1UB9A 3PQJA 3OYAA 3DU5A 1BW5A 4IRIA 5LEJA 4C2TA 1X1AA 4YFXF 3OYHA 1FLIA 5E8IA 2GOMA 2K3FA 2QSGX 1R58A 2K02A 2VIXA 2AQEA 4ZDPA 1IN6A 2XRLA 4A0ZA 1JI8A 5K1YA 3ABMH 1BA5A 1WKMA 2K9LA 2EFQA 1IXSB 2DN0A 3U1DA 4G6DA 3WG7H 4CYDA 3FX3A 4J19A 3I53A 5LGUA 3L2UA 3QPTA 1IN8A 1XSXA 4Y13A 5JHFA 4G6QA 1AU7A 1ZKGA 2DOAA 3P9KA 4X0GA 4E6KG 4A0XA 3F23A 2KIUA 5BNGA 1RUOA 1TT0A 2CO5A 4K2EA 4PFPA 1JGGA 1D5VA 1OLTA 1PUFB 4PJJA 1FY7A 2Y48A 4XRSA 1FNNA 4FX0A 3DU6A 1TQPA 1BJZA 1YX3A 5K7FA 1BI0A 1YOVB 5F1JA 3CCLI 2R7UA 1AOYA 1RESA 3A1YA 4ASNA 2E1MC 2WADA 4L0ZB 5GAGJ 3LOCA 3K1PA 1D3YA 1W7PB 2IA1A 1YLFA 1Z91A 2EB7A 2F5VA 2L7MP 4BJ6C 2DMTA 3CCQI 3TDUC 2CQQA 1LDKB 2QLZA 3HL2A 5CVIA 1XMKA 1T33A 4RLFA 2COBA 2LFBA 3LSHA 4D7NA 2R4GA 2W4SA 4BGDA 4HDUA 3BT9A 2EFWA 2RNGA 4U7BA 4EVIA 4MNUA 1ETVA 1SD6A 2NNNA 4U7DA 4BE1A 2KZVA 3BZCA 2IW5A 4BXUA 3GZ6A 4D5CA 4M3GA 4MFDA 3EYYA 4FCYA 1QNTA 2DT6A 3RYPA 4I01A 3V42A 5B3SH 4IQJA 1B1BA 2PBIA 1WWXA 3HG9A 3RZDJ 5EGOB 4RM2A 4Y7NJ 2DTRA 2X6WA 2Y9YA 1YE9A 3H0GJ 3CD6I 2AXTC 3GLLA 3BJOA 1ZLKA 2M9HA 4A0YA 2RQQA 2VKHA 5D8LB 1LUJB 2H6CA 2XF5A 5F1RA 3H3VK 2W00A 1Q1VA 4HBLA 4QSHA 2L5QA 2H09A 1SANA 2E34A 2M2EA 2LY2A 1ZK8A 4M6YA 2KHMA 5EEGA 3WTWC 1VQKI 1FC3A 2EZHA 2VJ5A 5F04A 1V55H 3S17J 1JGSA 2HPMA 4HSRA 3E7LA 4ZYAA 2BXYA 4B09A 5EGOA 4A5NA 3MFKA 2BHZA 3GTPJ 4G7HF 5AONA 3BR6A 3C1DA 3VOEA 3BG6A 3GO5A 4XORA 2HXIA 2NRAC 1E3PA 3O6BB 3BCBA 2L9VA 2D45A 1T0FA 3LMMA 3M8JA 1LEBA 4A6EA 4ESJA 1V54H 1E3OC 3K4JA 1PVEA 4HLYA 1MSEC 3A01B 1Q1HA 2RV8A 2D1HA 4OMYA 1QQIA 1Y0NA 4XSXF 1D8JA 1YI2I 4CCMA 4RMNA 2CYYA 1QZYA 2ZMEA 3JRBA 1Z3XA 2E5ZA 3GTLJ 2GXBA 4XRSG 5HLHA 1P92A 2LBFB 3BWGA 1DDNA 2IS2A 2L0KA 2OC6A 4XRFA 2HQRA 1L3LA 3KYCB 2HQNA 1WQ2A 3SYTA 1ZR2A 4IEJA 1Z9CA 1Y1VJ 2V1XA 4BACA 3FXUA 4HF2A 1RKTA 1CF7A 4KYWA 3Q3SA 3X2QH 3DBRB 3K4LA 4NQWB 1NHAA 2LOOA 3C18A 3FF5A 2DOEA 1WH5A 3BG3A 5B5EC 3DEEA 1U8BA 3L2QA 2Y0SN 1B72B 1WI9A 5J4YA 1J9IA 4YIIA 4AUXA 3HOTA 1ON2A 2ZMEC 3H9QA 1LE8B 1A5JA 2VJIA 4B47A 3TO9A 3DXJF 1IUFA 4L0YB 4A6DA 2JVGA 3U9GA 3MKZA 4XBFA 3H92A 4ZTJA 3E5UA 1T95A 3KPHA 4F92B 2P6TA 1FTTA 4DYQA 3NRVA 3A0BC 3E0JB 4G7OF 2K4JA 2FU4A 4IL6C 2DMQA 3PNVA 4UB6C 4B4CA 1JT6A 5FKOA 1YQAA 4IOCF 3JRHA 1ZG1A 5GP9A 2JMWA 2WAEA 1Y39A 1S6LA 4A3LJ 3A01A 2LKPA 2DOFA 1ZREA 3RYRA 4M71A 3JCUC 4DZPA 5JLXA 3BROA 2O3FA 4DBQA 4AIJA 1WJEA 2HOTA 3RDIA 1UAAA 3PO2J 4Y52J 3CC2I 2R7OA 5IPAA 4Q4ZF 4HZFA 3HOYJ 4F91B 3BR1A 1Z6RA 3L1PA 2HI3A 2F5EA 3WTTC 3QRFF 3FBIB 2RKHA 3AG4H 4DJAA 1X1CA 1RETA 2DI3A 2JPCA 2GXGA 2ZBKA 3QYFA 2W48A 4Y15A 5FO5A 1H8AC 1MZBA 3G1LA 3E6MA 1SVOA 5DD4A 1WJCA 3QAHA 2E7WA 4DOZA 4ENJA 1F36A 3OYBA 2HQ5A 5TGTA 5HNHA 3NAUA 1EJ9A 2QWWA 3OSGA 5DUIA 3F0CA 4ZDLA 2UWMA 2ZKZA 3CCMI 4ZTFA 1ZAOA 3OYIA 3OV8A 3IAS2 4LLGF 3BR0A 4C9YA 2JRMA 2X1EA 4V2FA 4A3IJ 2L9NA 5BS6A 3FXRA 5GPCA 3FXKA 2N8GA 2HDCA 2EV0A 4IVNA 2K85A 1BN5A 2VBYA 2ZFUA 5HLIA 2XAFA 1JKQC 3TL4X 1KQ9A 2OUMA 4HV5A 2EILH 4WXCA 5F6FA 3G3ZA 1CF7B 3CCYA 3F3XA 2DYSH 2VT2A 3NWTA 1ZQ3P 5AIPA 2IT0A 1FX7A 1MBJA 3GYHX 1FOKA 4I0BA 2HOEA 1T08B 3M8EA 4L5IA 3HSEA 2DQLA 2ADUA 5KCMA 2ELJA 3H1CA 5JI6A 3JAMZ 3I3LA 4CICA 2JPBA 1LVKA 3CJTB 4LB6B 3KP2A 2GA1A 2EV5A 3QYEA 2VI6A 4E7LA 1B4AA 1H88C 3WU2C 3ZGKA 3LFKA 1S7OA 3BTIA 1N77A 1QVTA 3R4KA 5D4RA 3OMYA 4XLHA 3HZJA 3O3KA 1R1VA 1MBHA 3ZMUA 4I02A 4E7ZA 1MMAA 1JKPC 2OQGA 3TDZC 5EJCA 4BEHA 3F8FA 2JA7J 5CKTA 4A3KJ 1QRYA 2XGEA 2QCOA 1OISA 4I98B 1EA3A 5D6FA 4CUGA 3DKYA 1GXPA 2I5UA 2VE8A 2ID3A 2NVXJ 4CO8A 4DGWB 1P4XA 2TCTA 5EG0A 5J8FA 3M07A 1B8IB 4B1RA 2JUCA 3ZMZA 2LREA 4GCVA 2VPLA 2Y2ZA 3I5UA 3HPHA 3FMQA 2FUG2 5EDNA 2DQRA 2MC3A 3K4KA 1QPMA 1YHQI 4RB2C 2XPVA 5EEHA 4R79A 1K79A 1FTZA 3HOSA 2DA2A 1HBXG 3ZOBA 4Y3OA 3WE2A 2VB6A 2VKEA 2DT7B 3R60A 2QEXI 3BCAA 3OR1C 3IC7A 1R6RA 3LSMA 4DIQA 2O03A 1IG7A 4IO9F 1XD7A 3S93A 4F52A 1TLHB 1TWCJ 4DBRA 4A3EJ 2IRFG 1Z6TA 2R7DA 4XOPA 2EV6A 2M0MA 2IS1A 2K9MA 3CESA 3ZR8X 2V6EA 4LB5A 5LFAA 4A3FJ 2BEOA 2H1KA 1BL0A 2PEXA 2VBXA 1ORKA 2L9SA 5HS9A 2CFOA 3IAM2 4E7JA 5ILSA 3Q9SA 3D0SA 3CP8A 3GTOJ 2EIKH 3KIOA 1OKRA 2YU9J 2PMUA 2HYGD 3MAJA 3AG3H 4E7SA 4XONA 2MLGA 3CC4I 4MLOA 3S1QJ 1IZ1A 4UUTA 5EYRA 2GIVA 3H5RA 1SFUA 1O7LA 1G8XA 1YX5A 3BPVA 4HF1A 1KQ0A 2MD5A 2EIJH 5J40A 4OINF 3NQOA 2CGPA 2Z3YA 4AVZA 1TWGJ 5E1XA 1W7PD 1Z3YA 1J59A 2E36A 3F21A 2HYJA 1X3UA 4JOMA 4DQ2A 2FRHA 4NHJA 3KCCA 2VOOA 1ETYA 2YR2A 3QOEA 2CUZA 3V7RA 5FD6A 4ABZA 3PFIA 2IVMA 2DMPA 4A2UA 1MGTA 2ZCWA 1WPKA 1O3QA 2R7FA 1REPC 4EJUA 2B63J 4N4NB 3FMSA 1SAXA 3S3MA 3BG7A 1D0XA 2FBHA 2XC7A 2K7LA 3AFHA 3M9AA 1WJBA 2GXAA 3W2WA 4XKCA 2CV1A 4U0YA 1SAUA 4OIQF 4Y17A 1FEXA 2BVMA 5KAIC 3PNYA 4PFOA 1BOBA 4C3IJ 4KNYA 5FRMA 4HQEA 3GUDA 1YJWI 1D1CA 2VOPA 4II2A 4UVBA 2C6YA 2QSHX 4PSWA 3GTJJ 4KIFA 1VQ6I 4ZYDA 2QSFX 4Q48A 5LHIA 2PQ8A 1T6SA 1V5EA 1XCVA 1ZRCA 3VDXA 1DP3A 3ZRGA 1E0EA 3BPXA 1IV8A 3E6CC 5H2FC 1A31A 1TQMA 4KA4A 1HOMA 4XN0A 1LKXA 4I2OA 5EZHA 3D5LA 2EIMH 3LA2A 3FDYA 1D0ZA 1HKSA 2FD5A 3T1BA 2B7EA 1FOWA 2LY9A 2IS4A 1OCZH 2KJBA 4YIRX 1GVDA 3MVPA 1R36A 1J7KA 4MIMA 4XQFA 2HDWA 1LB2A 4KN4X 2DJIA 4GGGA 1XTAA 3FHNA 1OR7A 1ZYRF 1TZLA 3F22A 5CQGA 2A5WA 2BZTA 2M7AA 3HGGA 1G4DA 1Z7UA 3ABKH 3IUOA 5DCMA 1YTYA 1LFUP 2QA4I 5K5RA 2KQRA 2ZSHB 2DLLA 1UZCA 2KPMA 3DFGA 3DV8A 4HV6A 2Q1ZB 2FOWA 1RIOH 2ELKA 1FSEA 1MDMA 2L9RA 2DU9A 2FMYA 5JR3A 1APLC 4OAZA 2VXDA 2XKOA 1ONVA 2HQAA 3J7ZI 1T38A 2CUEA 1N25A 4Y4RA 3ZQQA 5HDNA 4Q47A 1C0WA 3JRDA 1L0OC 1OYWA 5D5XB 3GLXA 2RREA 5DYMA 1DP7P 1OCOH 2J5PA 2UZKA 4F3QA 1XMAA 2QBYB 5FLVA 2DMNA 1T2KA 3CQZJ 2QF7A 1WVRA 1F9NA 4MTEA 5HNFA 1VNDA 5F08A 3OL4A 1S8NA 1WJ5A 2V79A 1MDMB 3G2BA 2Y0MA 4C3HJ 1W36C 3S16J 1LQ1A 5LGTA 1NG7A 1WRJA 2E60A 1LDDA 2IAIA 3SFIA 1SC7A 1QBJA 3S8PA 3HEFA 4EM1A 4FQGA 4KJZA 1X4OA 4EV0A 2A5YB 1E2XA 2TDXA 2STTA 3CMAI 1HC8A 1HQCA 3GFJA 1W5CC 4PJMA 5BOXA 3EUHC 3V8LA 4IHYA 1IN4A 3HXLA 1B8IA 1VTNC 1HSTA 1W36D 2IS6A 3V8KA 3E3VA 1D8KA 2EZKA 3J81K 3GTKJ 2IA2A 2HVSA 2FX0A 4RB3C 3TP0A 1USTA 1A6QA 2PJRB 1QHHD 2W84A 5E3LA 3ZP5A 4FTHA 3WE3A 3BC8A 2B9SA 3A2KA 2LRDA 1H0MA 3L2RA 3IKTA 3I59A 2Y30A 3HGYA 3ZQLA 2FSWA 2VQGA 2R0QC 4LK0F 4BNCA 1GLNA 1W4MA 5HOOA 3G6EI 3HOZJ 3K70C 3FBNB 1JTXA 4MHGA 4EGZA 5K7HA 5KHDA 1D1BA 3FZVA 5FRNA 1V5GA 1P7IA 1G3YA 1ZHFA 3HM5A 2R7TA 2DA7A 3OOUA 3SQNA 2JK3A 2IGKA 2HDDA 4E7HA 4CCKA 5IY5H 3KEQA 2X85A 4HSTA 3REOA 4A5MA 2GWRA 3DLAA 3K1NA 4HNTA 2E2HJ 1ACIA 5J8CA 1FYMA 4BHPA 1I27A 4GDFA 1TWFJ 2DK5A 2H8WA 3SDGA 1ZG5A 1SD5A 2VKVA 4WXDA 2JUGA 1WJAA 3FISA 3GW2A 4YFNF 2JSCA 3TO6A 2FEZA 4KICA 1OYYA 2WV1A 5FFZA 1UHMA 2X6YA 2KISA 2M5WA 3ERMA 1AWCA 2GA2A 4P96A 2NS8A 1ZTRA 2LMDA 3GFLA 4NC6A 2G0EA 2K5CA 3HUGB 4D5FA 4XK4A 2KT0A 5E8GA 3ZMTA 3MKYB 3DPLC 2IBDA 2EK5A 2LR8A 4BXFA 1I6XA 2R5ZA 1D0YA 1WI3A 2ME6A 4CXFA 1GV5A 1R7JA 3CO6C 4OMZA 2LBFA 4M6XA 2L7FP 2OZ6A 2A3SA 3I71A 5IT3A 1BR2A 3CUOA 2AQFA 1MJBA 5DV5A 1USSA 1HKTA 4S0HB 2ZO4A 2Y69H 4GXOA 5FKMA 4EJVA 3QPLA 4A3CJ 2WY8Q 4FISA 1PJRA 5FGMA 1RRJA 1TL8A 4A3DJ 5KNLA 5IYDJ 4IRHA 5J1YA 2P6SA 3DBHB 3ZQ7A 3MZYA 1IJWC 1PUEE 1MD0A 3FM3A 1MMDA 1R5GA 4M73A 3A03A 1SD4A 1I1GA 1KU9A 3CZ6A 3H5AA 3LQQA 3AG1H 5E79C 4XLEA 5CVRA 3ESWB 3C2BA 5JHUA 2Q8KA 5M5XJ 3CTAA 4I99C 4XSZF 3ZMDA 5GTIC 1W0UA 1NK3P 1W5SA 2MA3A 1JE8A 2LNBA 5IT9Z 2KIMA 2EBIA 1EF4A 2NS7A 3F6VA 1HW2A 2MGQA 2E5NA 3I4PA 1J75A 3L2VA 3ZQIA 2Y9ZA 5IP9J 4J00A 2JVHA 2Y31A 1GT0C 3OS0A 4WX9A 1ETWA 1UCRA 2PI0A 1MH3A 2AHQA 2EWNA 2CUFA 2RAEA 3IH2A 4JX5A 4ON0A 5DM7F 2EH3A 1R49A 1IC8A 2L54A 3OIPA 5BPDA 2X0LA 5L3GA 5BPIA 2QBYA 2QKLB 2BGCA 3ZQFA 3B73A 2EZIA 2WA0A 1XDSA 1W7PA 3KYLA 3EDPA 3CMMA 2Y75A 2X9DA 4RB1A 2Z9OA 3S2HJ 2K27A 4ANJA 3ROUA 4YEJA 3ZN1A 3KZZA 4FE7A 4BUPA 3ZQCA 4WWCA 2DFEA 1N75A 1XDUA 2GBYA 2V9KA 3HRSA 3S1MJ 3B6AA 2GM4A 3UR3C 2CQ7A 3DWLE 2HR3A 3COAC 1VZ0A 1RPWA 2MH9A 4PSXA 3CMEI 1VQLI 2OAZA 1X19A 4ESFA 2L7KA 1GHCA 1EH8A 3AL0B 1ZN2A 3M7GA 2VXZA 4G7ZF 2M4GA 2NVUB 5E3OA 5DD8A 5CQEA 2JWTA 2FQ3A 4GRIA 1OPCA 5L3DA 1X1DA 1E3HA 5JVTA 2XAUA 4LG0A 3WODF 2XGCA 2KFDA 4AWXB 2M0CA 4Z6YA 1TC3C 3GWZA 4NB5A 4BJTA 2VT3A 3TP3A 4ZYGA 3L2CA 3CF2A 3DEWA 2VC1A 2E1NA 3PO3J 1I5ZA 1UHWA 2OU2A 1ULYA 1SMTA 2KKOA 1NTCA 4GYIA 5HS7A 4CHUA 2D1VA 2VE9A 4AIDA 2QM3A 1FT9A 4L5EA 1LEAA 3OR2C 3RTRA 3CUQB 5FB2A 3H36A 5L3CA 1O4XA 4I7HA 3K2AA 2MFZA 2E2IJ 1IO2A 3F8NA 1RC9A 4YRVA 3OYJA 1K4SA 3G73A 2HFHA 4JP0A 2FJ1A 1F1ZA 1FBUA 3BZKA 3M8FA 5DDGA 4A69C 2DBBA 4ZC3A 4LG3A 1OCCH 4ENNA 4ENKA 3GMEA 1AHDP 2PX9A 3ZPLA 3ABTA 3EUHA 1KQ8A 2CW7A 5LBQA 3K0LA 4D1QA 2KRCA 3K4MA 4LLLA 2KRFA 1RKWA 2IGOA 4A93J 3SJMA 5AIQA 3M1CA 4X6AJ 2KIQA 4ZZLA 2V9PA 1U5TC 6PAXA 4HF0A 1SD7A 1X1BA 2WY7Q 3PIOF 3JTHA 4D9JA 3G4SI 1ZRDA 4IPAA 2NS0A 1R22A 2M8GX 1MMGA 3DEUA 3R0JA 1O3SA 3CUQA 1JUSA 2QUFA 2ZSIB 2VBZA 3H9JA 5ILUA 4UY8I 1BI1A 2RDPA 5GPAA 3WTUC 1XG1A 2Z99A 5CYVA 3WHBA 1KGSA 3C2HA 4NC7A 3S15J 5C44J 3BLYA 1SFOJ 3BDDA 4BY1J 2CS3A 1WH7A 3ELKA 4CA0A 1KYZA 4QPOA 2QGUA 1S29A 2VJ4A 5DUKA 2R7WA 4AYBN 1Y56A 1W0TA 2A6HF 2CUJA 4I09A 1TWHJ 1STZA 3TBIA 3ZMSA 2JSPA 1MMSA 1LPQA 3V7CA 2R7VA 2HKXA 4KN7X 5LRRA 4O6JA 1OYIA 3W6JB 4UNOA 2QQAA 2IA0A 3CUQC 2CQKA 2FBIA 3PUBA 3RKXA 4RS8A 1XGNA 4EJWA 4BYYA 3G71I 2AO9A 3OS2A 5IOYA 1K61A 2VQLA 1G3WA 2H94A 4GYGA 3JRAA 2I8DA 3BJ6A 4PJLA 4CDGA 3S32A 4HLXA 3FXMA 2VODA 3I4NJ 2M45A 1KU2A 1MIJA 4RDUA 2Z5UA 3ZXSA 3CDHA 5C4XJ 4BE0A 4LLNA 3GVAA 2XSDC 3J7AO 5A2QK 3DKWA 4U87A 2QQBA 1LFPA 1OJLA 1QZZA 1YS6A 4MEXF 5J47A 3OIQA 2KL4A 4AIHA 3KLOA 2IGMA 3PSFA 2JZYA 2OPTA 1IXCA 2FNPA 3L7WA 4M72A 3SZGA 3SZTA 4ZJZA 3SHFA 1JTYA 2OBPA 5M5YJ 4IZZA 2EPFA 5K7ZA 4XKBA 1IXRC 4BAYA 1IV6A 3EYIA 3SZPA 3VWBA 1BM9A 1XX5A 4XLAA 2XAGA 2HYFA 1DU6A 2OA4A 3VYRB 2P5LC 2R92J 4P9FA 1XC5A 3DPTA 2NVYJ 4IOAF 4XLNF 2L02A 2L01A 3QYBA 1VQ7I 4QTRA 2LLKA 4BHCA 1YYVA 3DQVC 4YFKF 3NARA 5FLXK 3PFYA 1XB4A 4L5JA 2NVTJ 3JRFA 2CV0A 2EA4A 1U5TA 5LGNA 4IHTA 2P7CB 1JT0A 2ELHA 2P0WA 5HDGA 4LJZF 1Z77A 2W7NA 2F5CA 1K7AA 1U9OA 3PJRA 3HOWJ 4XOTA 1FJLA 5ICFA 4BBSJ 1TNSA 1UELB 2ESNA 3JW4A 2YUSA 4B44A 2EQRA 4ETSA 3UKGA 5GAHJ 4KMUX 1YJ9I 3HBLA 1XS9A 5H6RA 1QPIA 4MTDA 3RKWA 2NOJB 2V7FA 5M3FJ 1I3QJ 3H0DA 2RVCA 4C2UA 1FMVA 2OV7A 2P81A 3DTEA 3VSKA 3E6BA 5F27A 4CH7A 3JRGA 2KLOA 1U0JA 2XDVA 5C3EJ 3WGIA 3FM5A 2X1CA 1YRNB 2Z33A 4OIRF 1P4WA 3ASOH 4S04A 2O5RA 1OMIA 2MC4A 1U6GA 2BVLA 2TRTA 1S7AA 2EZLA 4M9ZA 1F43A 4I0AA 2BV6A 2KIFA 3DF8A 1EV7A 4L9JA 3LSGA 4XLPF 2CQXA 2WB1A 3E97A 1X1PA 2YX4A 2EFOA 1UG2A 2OQRA 1JJ8C 4L9TA 3H3ZA 4PJ0C 2P5VA 1U9NA 2WAQA 1X3ZB 2CFXA 3PM1A 4GO1A 2PFBA 5CVVA 2YS9A 3QU6A 5CVUA 2A07F 3M4OJ 2XAJA 2X4HA 4NQWA 4S05A 2DCEA 4G12A 3GTQJ 1O57A 3L9FA 1ZLJA 1V3FA 1HXDA 3JSPA 2JQ7A 1OQYA 1ENHA 4NBQA 2V4JC 4BS9A 5E18F 1X3WB 2E19A 1V4RA 5FKNA 2FA5A 1DGRM 1MH4A 3MMYB 5LHHA 2DK8A 2VN2A 2CRGA 4FE4A 1BR4A 4UV9A 1FYLA 2KMUA 4UUVA 3J80K 4NC8A 1CGPA 3R61A 1Z21A 1HF0A 1FZPB 1FOYA 4RGSA 1MNEA 2XB5A 3TW7A 1Z7LA 2JN6A 4BXXJ 3DKXA 4XKVA 3K70D 2R7XA 3KP6A 3KYDB 1TW2A 3BR3A 4QPQA 4BHBA 3GEZA 1G6NA 3I59B 3T8RA 2QQ9A 5L3BA 2ISZA 3J80Z 1GUUA 1FP2A 4V2GA 5D6EA 5CVJA 5HODA 1VQ8I 1VQOI 2VASA 3K4NA 1JXSA 4EM0B 3LAPA 1X2NA 2Q2EA 2ID6A 3SDBA 3TGNA 5K5OA 2BOLA 4H0EA 2DTZA 3GFMA 4JK1X 3DP7A 5DEQA 2DT5A 5B1BH 3OOPA 2KDOA 5TISC 4BL0B 3E5XA 1FIAA 3OYMA 2M8EA 1MKMA 1J2XA 4ITVA 5LEKA 1JUMA 2WC2A 3CO7C 4XIDA 3VYUB 2D5VA 3GX4X 3HOVJ 3VFZA 5F64A 1K78B 4M74A 4HNUA 3P9IA 3ZN0A 1U5TB 1HLVA 1KA8A 1E17A 2LKXA 3ABLH 2DA1A 2Y0SA 2DFHA 2W25A 2KDZA 1FYKA 3FXOA 4EJTA 4G94A 1O3TA 2Q2EB 2UV1A 5JLWA 1ZGWA 3GBGA 5EF6A 3I64A 1H89C 4A3GJ 3QODA 5E20A 4UUSA 1J09A 1A35A 1TTYA 2BBYA 2NXNB 3JAMK 3KZIC 1CQTA 2P5KA 4C30A 1A04A 2ECBA 3KP7A 4LG0B 1R4MB 4IHVA 2HOSA 2OCEA 4D0PA 3JR9A 1R9TJ 2CW0F 3B6CA 2VONA 1MMNA 3RPUA 4IHWA 2W57A 2XVCA 2XKPA 3RSNA 3LSIA 5H20A 5ICEA 3LSKA 1R00A 5KK1A 4A3BJ 1MBFA 3J81Z 2A6EF 1YW8A 3HRMA 4RAFA 2CMPA 2MSYA 5FD5A 4RLQA 5E17F 2DDAA 4FHTA 4CCNA 2BE5F 1DUXC 2K9QA 3KP3A 3BR2A 3KX2A 4H4KC 3WG9A 1WGXA 2IEKA 4XMYA 4HRIA 1MBGA 2F4MB 3WU1B 3WTZA 1VQ4I 1UMQA 3RIRA 1G3TA 3OSFA 3BTJA 4MGRA 3DTKA 4UVCA 1UJ8A 5HDKA 1ZGAA 1MNMC 3CJNA 1KU7A 2VQHA 3ABUA 1JJ6C 1WHUA 3LNQA 3WGHA 3S1RJ 4A12A 4QWQA 1VQMI 4IKFA 4D7MA 1U78A 3WTSC 3HHHA 4M3BA 1Y8QB 2F4IA 2YSRA 1P9QC 2OTJI 4KMFA 2X48A 2MLKA 4OAYA 3CCEI 2NYXA 1LFBA 3V4GA 4YELA 1ODDA 4P5OA 3IL2A 1S5LC 1WZ2A 1P2FA 1QVUA 2IPQX 3U21A 1DPUA 5DS9A 5D5UB 3K69A 2MH2A 4EATA 3AKZA 1KU3A 1TQIA 2VJJA 4LOCA 3PSIA 5FKLA 4HAMA 2UXNA 1FBQA 3FXQA 5IYCJ 1JKRC 3AG2H 4EGYA 3IRQA 3VEPA 2AS5F 1B59A 3N05A 1M1EB 2ZB9A 4PUSA 2M30A 1VFCA 1HDDC 4RM3A 3RPQA 4B3AA 1XGOA 4LFUA 3CCUI 1ERDA 2HTJA 2R7RA 2VBWA 1T8IA 4NUBA 1ETOA 3HRTA 2PJRA 3T8TA 3IKVA 5D4SA 1MJAA 3N97A 2XV4S 3K7AJ 4N0BA 4E7IA 2R93J 2XASA 3MCZA 3T5XA 4YIFA 1HSJA 2FF4A 1RR8C 5D5WB 5LHGA 1RUNA 3MKLA 5GTHC 1YFHA 2QYOA 1YO5C 2EFPA 1Z1DA 1XCBA 2J5OA 1BI2A 2ME0A 1WJDA 2LK2A 1Z05A 4AD9A 3MN2A 4RGXA 5L3FA 4HDVA 4Q5SF 4KIGA 2XROA 5H6QA 3V8JA 2GQQA 1R5HA 2R5YB 2F5FA 2PMZN 3HSRA 1KYWA 1X58A 2L7ZA 4EQQA 2MD0A 2R7ZJ 4BH9A 2O0YA 1GVJA 4L9VA 1VQNI 4UVAA 3GCMA 1YW9A 2NOGA 3I55I 4II3A 3JREA 3WTXC 3DBLB 1ITYA 4IQ4A 1ON1A 4AYBA 2XPUA 2ZXWH 3L09A 5FLMJ 5IT9K 4OIOF 1UG0A 5BMZA 2BHYA 2OF7A 2X1DA 3IH3A 2JRTA 1XN7A 2HWVA 2M3AA 1MJ9A 1K6YA 3ASNH 1QHGA 2HTSA 1IAWA 1IDYA 3J7AY 3W2AA 4I6ZA 4XR6A 9ANTA 3S3OA 3DPUA 4BDYA 1ZARA 5IOZA 4ZYHA 5B1AH 4TV7A 3NWSA 1NG6A 2MABA 3HHGA 2X51A 4ENMA 4FT8A 2R7SA 4IX7A 2B0LA 2LH9A 4KUMA 1IN7A 2V1NA 1FSHA 3MD2A 4EM2A 4MO7A 1B9MA 2OCCH 4BQOA 3RI4A 1OCTC 2D2WA 3BY6A 3GF2A 1W5TA 5J1RA 2L2OA 2ZJRF 2EFNA 2L4AA 3FHZA 2CJJA 1ZELA 2X6XA 3QU3A 1LDJA 2FQ4A 3OYKA 3F6OA 3BQZA 5GAEJ 1T56A 3A0HC 3CF5F 4LIUA 4XLCA 2VPRA 1YS7A 2FE3A 3M1EA 1T98A 2DDBA 2OZUA 1ETQA 3RJPA 3CDLA 3FXLA 3O8GA
chains in the Genus database with same CATH topology
1XGMA 1BJAA 5TJJA 3WTVC 2XIGA 3C3WA 4O5VA 4UXNA 2LDUA 5LRSA 4LK1F 2CG4A 1F5TA 2FBKA 1G3SA 2DO7A 2KJCA 2MBFA 3KETA 5FFXA 2GAUA 3F72A 1B9NA 5E1ZB 3F8MA 3GXOA 4N9IA 2ZMEB 1TNTA 4ZYEA 1LNWA 1TW3A 2HZTA 1ZH5A 4HX7A 3GZ5A 3KEOA 1F4KA 1PDNC 2RN7A 4U0VA 1LJ9A 5TRDA 1U2WA 2ACJA 2PN6A 4M9SA 4HW0A 3IWFA 3MEXA 5L3EA 4CGZA 2F2EA 3ECHA 3IRRA 4AVPA 1XSDA 2M1BA 2EA2A 3R0AA 2YU3A 3W6KB 1HW5A 2P4WA 3BZ6A 2DFIA 1O3RA 1S3JA 3Q9VA 3ISPA 2ZFWA 4KT5C 1U8RA 4UV8A 2DW4A 3HIFA 2QVOA 3IHUA 4WCGA 2FMLA 5D5VB 2OD5A 2NAZA 1H9TA 3K2ZA 1FBSA 1EH6A 4IRGA 1EH7A 4MEYF 2IP2A 4IHSA 4RB0A 3LAJA 3FWEA 5HVQC 3ERED 4R8HA 1P6RA 4FX4A 1U3EM 1DPRA 4U88A 1BC7C 2H6BA 2RQPA 3HRUA 4ZZDA 2K86A 4IXAA 1IN5A 2YX7A 3KP5A 2R3SA 3JSOA 4OOIA 1K6OA 2BYVE 1J0RA 4L18B 3T0YA 4RGRA 2LSOA 4IJAA 1FPQA 2COMA 4WXHA 5FLXZ 3TO7A 4HX4A 1SMYF 1GXQA 4DNCA 5DCFA 1IW7F 3MWMA 4G8XA 3JTGA 1FWZA 3F8BA 2PLYA 3I58A 4JBAA 4CZZA 4Z2YA 2O8XA 2XRNA 2E7XA 2FOKA 3BJAA 2DPDA 1IF1A 4OIPF 3B02A 1JHHA 3QP5A 3WGGA 1K78A 2RNJA 3HYIA 4U0WA 1H9GA 3U2RA 4KFCA 4WK8F 3VB2A 5HS8A 3N4MA 2XAQA 2QZ8A 4PDKA 5JFRA 2H27A 3RKYA 3Q5FA 2O61A 3BOQA 4MQ9F 4PGHA 1RI7A 3WTYC 2O6GE 2XAHA 1QGPA 2L3DA 2PG4A 3VODA 3I54A 1WSUA 2HS5A 1J5YA 4KIBA 1HKQA 1BC8C 1YG2A 4AIKA 3BP8A 4HX8A 2K4BA 3LSTA 3QP6A 4LMYA 3ULQB 2LF7A 2ZNZA 4JQFA 5DCMB 2A68F 5HLGA 3LWFA 2STWA 3LA3A 1IRFA 2NNYA 5BMZA 1YIOA 2XHKA 4RGUA 1LVAA 2RC4A 2JT1A 3PQKA 3CLOA 2ISYA 1O7FA 2ZXJA 3TKYA 4B8XA 1XSVA 2UXXA 3KZYA 2EJRA 5LLQA 3KE2A 4UHTA 3H3UA 5ICGA 1B6AA 5K5QA 1SFEA 4EJOA 1PP7U 1ZG3A 3GFIA 1UFMA 2ETHA 2GZWA 4O3MA 2HKOA 2IJLA 4HA8A 2G7UA 3KFWX 3QPHA 4F7ZA 1YW7A 2ESHA 1PP8F 4N9HA 2JTVA 1TBXA 2ZJ2A 4HOBA 1ZGJA 2G7HA 2A69F 3P7NA 4HYEA 3HUGA 5CJ9A 3ML6A 4LGWA 4MQVA 1SFXA 2PJPA 3V7SA 2XGXA 5ED4A 3TOAA 4YG2F 3HTSB 1BBYA 2HGCA 3K9TA 1BI3A 3S2WA 3SXYA 3ECOA 2WWYA 3SFZA 3LQRA 4PGGA 1QO0D 3F8CA 2F5DA 2RGVA 2P7VB 4KDPA 2VC0A 5ICCA 2DPUA 2XUBA 4G9YA 3L00A 2WV0A 4PCQA 2A61A 4P55A 5J6XA 1I1SA 3C7JA 2E1CA 2DAOA 5CLSA 1BOAA 3NEUA 3IWZA 2W85A 3TQNA 5BQTA 2V1UA 1BIAA 4R1HA 4RAZA 4WF2A 1ZRFA 3KLNA 5D8KB 1RZ4A 2V9VA 3LA7A 3I0TA 1IUYA 2V1DA 3E5QA 2G9WA 2FXAA 3HSFA 4ZH4F 3EQLF 3E6DA 5KVRA 1FP1D 1JHFA 3O2PE 4EMSA 5ERIA 1R23A 1HW1A 2M87A 2WTEA 2ZNYA 2YPRA 2QENA 3ZMVA 4QLCU 5ILVA 5A2QZ 1P4AA 1R1TA 4OU0A 2FNAA 4HQMA 2PMHA 1BIBA 2Q0OA 4L9NA 4LD5A 1RNLA 3HTUA 4P9UA 2L4MA 3TOBA 4E70A 2LF8A 2HEOA 3MZHA 3QOPA 1XGSA 4ESBA 4IF4A 1T39A 3KP4A 2P8TA 1Y0UA 2CWEA 3P9CA 4PZJA 2AXLA 5E1WA 3AAFA 3R6SA 1R1UA 3FMRA 3K1MA 3EETA 3WU0A 2CSOA 4M9XA 4RAYA 2V6CA 4BQAA 2W24A 3MQ0A 3PQJA 1UB9A 4IRIA 5LEJA 4YFXF 1FLIA 5E8IA 1R58A 2K02A 1IN6A 4A0ZA 5K1YA 1WKMA 2EFQA 1IXSB 3U1DA 4G6DA 4CYDA 3FX3A 3I53A 5LGUA 3QPTA 1IN8A 1XSXA 4Y13A 4G6QA 3P9KA 3F23A 4A0XA 2KIUA 1RUOA 2CO5A 4K2EA 1D5VA 1FY7A 2Y48A 1FNNA 4FX0A 1TQPA 1BI0A 1AOYA 4ASNA 4L0ZB 3K1PA 1D3YA 1W7PB 2IA1A 1YLFA 1Z91A 2EB7A 3TDUC 1LDKB 2QLZA 5CVIA 1XMKA 4HDUA 2EFWA 4U7BA 4EVIA 4MNUA 1SD6A 2NNNA 4U7DA 2IW5A 4BXUA 3GZ6A 3EYYA 1QNTA 3RYPA 4I01A 1B1BA 2PBIA 1WWXA 2DTRA 3BJOA 1ZLKA 4A0YA 5D8LB 2H6CA 5F1RA 4HBLA 2H09A 4M6YA 5EEGA 3WTWC 1FC3A 1JGSA 4B09A 3MFKA 4A5NA 4G7HF 5AONA 3C1DA 3VOEA 3GO5A 2NRAC 3O6BB 2D45A 1T0FA 1LEBA 4A6EA 4ESJA 4HLYA 1Q1HA 2RV8A 2D1HA 4OMYA 1QQIA 4XSXF 1D8JA 2CYYA 1QZYA 2ZMEA 2GXBA 5HLHA 1P92A 3BWGA 1DDNA 4XRFA 2HQRA 1L3LA 2HQNA 1WQ2A 1Z9CA 2V1XA 3FXUA 4HF2A 1CF7A 4KYWA 1NHAA 3C18A 3FF5A 1WI9A 1J9IA 4YIIA 3HOTA 1ON2A 3TO9A 3DXJF 4L0YB 4A6DA 3U9GA 4XBFA 3H92A 3E5UA 2P6TA 3NRVA 4G7OF 2K4JA 2FU4A 1YQAA 1ZG1A 1S6LA 2LKPA 1ZREA 3RYRA 4M71A 3BROA 2O3FA 4AIJA 3RDIA 4Q4ZF 4HZFA 1Z6RA 2F5EA 3WTTC 3QRFF 2RKHA 2JPCA 2DI3A 2GXGA 2ZBKA 4Y15A 5FO5A 1MZBA 3E6MA 5DD4A 3QAHA 2E7WA 4ENJA 2QWWA 5DUIA 2UWMA 2ZKZA 1ZAOA 3OV8A 4LLGF 5BS6A 3FXRA 2HDCA 2EV0A 4IVNA 1BN5A 2VBYA 5HLIA 2XAFA 1KQ9A 4HV5A 4WXCA 5F6FA 3G3ZA 1CF7B 3F3XA 2VT2A 2IT0A 5AIPA 1FX7A 3GYHX 1FOKA 4I0BA 2HOEA 3M8EA 4L5IA 3HSEA 2DQLA 2ADUA 5JI6A 3JAMZ 4CICA 2JPBA 4LB6B 3KP2A 2GA1A 2EV5A 1B4AA 3LFKA 1S7OA 3R4KA 5D4RA 3O3KA 1R1VA 3ZMUA 4I02A 2OQGA 3TDZC 3F8FA 4I98B 5D6FA 1GXPA 2VE8A 4CO8A 1P4XA 5J8FA 3ZMZA 4GCVA 3I5UA 3FMQA 2DQRA 2MC3A 1QPMA 4RB2C 5EEHA 4R79A 1K79A 3HOSA 1HBXG 3WE2A 3R60A 3IC7A 2O03A 1XD7A 1TLHB 2IRFG 1Z6TA 2R7DA 2EV6A 4LB5A 2BEOA 2PEXA 2VBXA 5HS9A 5ILSA 3Q9SA 3D0SA 1OKRA 2PMUA 2HYGD 3MAJA 2MLGA 1IZ1A 2GIVA 1SFUA 1O7LA 3BPVA 4HF1A 1KQ0A 2MD5A 4OINF 3NQOA 2CGPA 2Z3YA 5E1XA 1W7PD 1J59A 3F21A 1X3UA 4DQ2A 2FRHA 4NHJA 3KCCA 2VOOA 2YR2A 3V7RA 5FD6A 3PFIA 2IVMA 1O3QA 4A2UA 1MGTA 2ZCWA 1REPC 2R7FA 4EJUA 3FMSA 1SAXA 2FBHA 2K7LA 3M9AA 4U0YA 4OIQF 4Y17A 4KNYA 4HQEA 3GUDA 2VOPA 4UVBA 2C6YA 4KIFA 4ZYDA 4Q48A 5LHIA 2PQ8A 1T6SA 1ZRCA 1XCVA 3BPXA 3E6CC 1TQMA 4KA4A 4I2OA 3D5LA 3LA2A 1HKSA 3T1BA 2KJBA 1R36A 1J7KA 1LB2A 4KN4X 4GGGA 1OR7A 1ZYRF 3F22A 1G4DA 1Z7UA 1YTYA 5DCMA 5K5RA 2DLLA 3DFGA 3DV8A 4HV6A 1RIOH 1FSEA 1MDMA 2DU9A 2FMYA 5JR3A 2XKOA 1ONVA 1T38A 5HDNA 4Q47A 1C0WA 1L0OC 1OYWA 5D5XB 3GLXA 5DYMA 1DP7P 2J5PA 2UZKA 1XMAA 2QBYB 1T2KA 1F9NA 4MTEA 1S8NA 2V79A 1MDMB 2Y0MA 1LQ1A 5LGTA 1WRJA 1LDDA 1QBJA 4EM1A 4EV0A 2A5YB 1E2XA 2TDXA 2STTA 1HQCA 3GFJA 5BOXA 3V8LA 1IN4A 1VTNC 1HSTA 3V8KA 3E3VA 1D8KA 3J81K 2IA2A 4RB3C 1USTA 2W84A 3ZP5A 3WE3A 1H0MA 3IKTA 3I59A 2FSWA 4LK0F 4BNCA 1W4MA 5HOOA 4MHGA 4EGZA 3FZVA 1G3YA 1ZHFA 3SQNA 3KEQA 3REOA 4A5MA 2GWRA 3K1NA 5J8CA 1FYMA 4BHPA 1I27A 2DK5A 1ZG5A 1SD5A 4WXDA 3GW2A 4YFNF 2JSCA 3TO6A 2FEZA 4KICA 1OYYA 5FFZA 1UHMA 2M5WA 1AWCA 2GA2A 4P96A 3GFLA 5E8GA 3ZMTA 3DPLC 2EK5A 1I6XA 4CXFA 1R7JA 3CO6C 4OMZA 4M6XA 2OZ6A 3I71A 2A3SA 5IT3A 3CUOA 1MJBA 5DV5A 1USSA 1HKTA 2ZO4A 4GXOA 4EJVA 5FGMA 4IRHA 2P6SA 3ZQ7A 3MZYA 1PUEE 1MD0A 3FM3A 1R5GA 4M73A 1SD4A 1I1GA 1KU9A 3LQQA 5CVRA 5JHUA 2Q8KA 3CTAA 3ZMDA 4XSZF 1W5SA 2MA3A 1JE8A 2LNBA 5IT9Z 2KIMA 3F6VA 1HW2A 3I4PA 1J75A 4WX9A 1UCRA 2PI0A 2EWNA 4ON0A 2L54A 5BPDA 2X0LA 5L3GA 5BPIA 2QBYA 2BGCA 3B73A 1XDSA 1W7PA 3EDPA 2Y75A 4RB1A 2Z9OA 2K27A 3ROUA 3ZN1A 3KZZA 4WWCA 1XDUA 3HRSA 2HR3A 3COAC 2MH9A 2OAZA 4ESFA 1GHCA 1EH8A 1ZN2A 3M7GA 2VXZA 4G7ZF 5DD8A 2FQ3A 1OPCA 5L3DA 5JVTA 4LG0A 3WODF 4AWXB 3GWZA 4NB5A 4ZYGA 2VT3A 3L2CA 2VC1A 2E1NA 1I5ZA 1UHWA 2OU2A 1ULYA 1SMTA 2KKOA 4GYIA 5HS7A 4CHUA 2D1VA 2VE9A 2QM3A 1FT9A 1LEAA 3RTRA 3CUQB 5FB2A 5L3CA 4I7HA 3F8NA 3G73A 2HFHA 1F1ZA 1FBUA 3M8FA 5DDGA 4ENNA 2DBBA 4ENKA 1IRGA 3ZPLA 1KQ8A 3ABTA 3EUHA 5LBQA 3K0LA 4LLLA 2KRFA 5AIQA 4ZZLA 1U5TC 6PAXA 4HF0A 1SD7A 3JTHA 1ZRDA 4IPAA 2NS0A 1R22A 3DEUA 3R0JA 1O3SA 3CUQA 2QUFA 2VBZA 5ILUA 1BI1A 2RDPA 3WTUC 2Z99A 5CYVA 1KGSA 3BDDA 3ELKA 1KYZA 1S29A 5DUKA 2A6HF 4I09A 1STZA 3ZMSA 3V7CA 2HKXA 4KN7X 5LRRA 4O6JA 1OYIA 3W6JB 4UNOA 2QQAA 2IA0A 3CUQC 2CQKA 2FBIA 3RKXA 4RS8A 1XGNA 4EJWA 4BYYA 4GYGA 1G3WA 2H94A 3BJ6A 4CDGA 4HLXA 2VODA 2M45A 1KU2A 2Z5UA 3CDHA 4LLNA 3GVAA 3J7AO 5A2QK 3DKWA 2QQBA 1QZZA 1YS6A 4MEXF 4AIHA 3KLOA 2JZYA 1IXCA 2FNPA 3L7WA 4M72A 3SZTA 3SHFA 2OBPA 4BAYA 1IXRC 3EYIA 3SZPA 1BM9A 2XAGA 2HYFA 2OA4A 2P5LC 4P9FA 3DPTA 4XLNF 2L02A 2L01A 4BHCA 1YYVA 3DQVC 4YFKF 5FLXK 4L5JA 1XB4A 2EA4A 1U5TA 5LGNA 4IHTA 2P7CB 2ELHA 5HDGA 4LJZF 2F5CA 1K7AA 5ICFA 1TNSA 2ESNA 3JW4A 4ETSA 4KMUX 5H6RA 4MTDA 3RKWA 2RVCA 3E6BA 3WGIA 3FM5A 2Z33A 4OIRF 1P4WA 4S04A 1OMIA 1U6GA 1S7AA 4M9ZA 4I0AA 2BV6A 2KIFA 3DF8A 1EV7A 4L9JA 4XLPF 3E97A 2YX4A 2EFOA 2OQRA 4L9TA 3H3ZA 2P5VA 2CFXA 4GO1A 2PFBA 5CVVA 3QU6A 5CVUA 2A07F 2XAJA 2X4HA 4NQWA 4S05A 1O57A 3L9FA 1ZLJA 1V3FA 1HXDA 3JSPA 5E18F 1V4RA 2FA5A 5LHHA 2DK8A 2VN2A 4UV9A 1FYLA 4UUVA 3J80K 1CGPA 3R61A 1FZPB 4RGSA 3KP6A 1TW2A 4BHBA 3GEZA 1G6NA 3I59B 3T8RA 2QQ9A 5L3BA 2ISZA 3J80Z 5D6EA 1FP2A 5CVJA 1JXSA 4EM0B 3LAPA 2Q2EA 3TGNA 5K5OA 4H0EA 3GFMA 4JK1X 3DP7A 5DEQA 2DT5A 3OOPA 3E5XA 2M8EA 1MKMA 1J2XA 5LEKA 2WC2A 3CO7C 3GX4X 3VFZA 5F64A 1K78B 4M74A 3P9IA 3ZN0A 1U5TB 1KA8A 1E17A 2W25A 1FYKA 4EJTA 4G94A 1O3TA 3I64A 5E20A 1TTYA 2BBYA 3JAMK 2P5KA 1A04A 3KP7A 4LG0B 4D0PA 2CW0F 2VONA 3RPUA 2W57A 2XVCA 2XKPA 5H20A 5ICEA 1R00A 5KK1A 3J81Z 2A6EF 1YW8A 3HRMA 5FD5A 5E17F 4FHTA 2BE5F 1DUXC 3KP3A 3WG9A 3WU1B 3WTZA 3RIRA 1G3TA 4MGRA 4UVCA 5HDKA 1ZGAA 3CJNA 1KU7A 3ABUA 3WGHA 4A12A 4QWQA 1U78A 3WTSC 3HHHA 2YSRA 4KMFA 2MLKA 2NYXA 3V4GA 1ODDA 4P5OA 3IL2A 1P2FA 2IPQX 1DPUA 5D5UB 3K69A 2MH2A 1KU3A 1TQIA 4HAMA 2UXNA 1FBQA 3FXQA 4EGYA 3IRQA 3VEPA 2AS5F 1B59A 2M30A 3RPQA 1XGOA 4LFUA 2HTJA 2VBWA 3HRTA 3T8TA 3IKVA 5D4SA 1MJAA 3N97A 2XV4S 4N0BA 2XASA 3MCZA 3T5XA 4YIFA 1HSJA 2FF4A 5D5WB 5LHGA 1RUNA 1YFHA 2QYOA 1YO5C 2EFPA 1Z1DA 1XCBA 2J5OA 1BI2A 4AD9A 5L3FA 1Z05A 4RGXA 4HDVA 4Q5SF 4KIGA 2XROA 5H6QA 3V8JA 2GQQA 1R5HA 2F5FA 3HSRA 1KYWA 4EQQA 4BH9A 2O0YA 1GVJA 4L9VA 4UVAA 1YW9A 3WTXC 1ON1A 3L09A 5IT9K 4OIOF 2JRTA 1XN7A 2HWVA 1MJ9A 2HTSA 1IAWA 1ZARA 4ZYHA 4TV7A 3HHGA 4ENMA 4FT8A 2B0LA 4KUMA 1IN7A 1FSHA 4EM2A 1B9MA 3RI4A 2D2WA 3BY6A 3GF2A 1W5TA 2EFNA 2L4AA 3FHZA 3QU3A 1LDJA 3F6OA 1YS7A 2FE3A 3M1EA 1T98A 2OZUA 3RJPA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1XGM A;  1BJA A;  5TJJ A;  3WTV C;  2XIG A;  3C3W A;  4O5V A;  4UXN A;  2LDU A;  5LRS A;  4LK1 F;  2CG4 A;  1F5T A;  2FBK A;  1G3S A;  2DO7 A;  2KJC A;  2MBF A;  3KET A;  5FFX A;  2GAU A;  3F72 A;  1B9N A;  5E1Z B;  3F8M A;  3GXO A;  4N9I A;  2ZME B;  1TNT A;  4ZYE A;  1LNW A;  1TW3 A;  2HZT A;  1ZH5 A;  4HX7 A;  3GZ5 A;  3KEO A;  1F4K A;  1PDN C;  2RN7 A;  4U0V A;  1LJ9 A;  5TRD A;  1U2W A;  2ACJ A;  2PN6 A;  4M9S A;  4HW0 A;  3IWF A;  3MEX A;  5L3E A;  4CGZ A;  2F2E A;  3ECH A;  3IRR A;  4AVP A;  1XSD A;  2M1B A;  2EA2 A;  3R0A A;  2YU3 A;  3W6K B;  1HW5 A;  2P4W A;  3BZ6 A;  2DFI A;  1O3R A;  1S3J A;  3Q9V A;  3ISP A;  2ZFW A;  4KT5 C;  1U8R A;  4UV8 A;  2DW4 A;  3HIF A;  2QVO A;  3IHU A;  4WCG A;  2FML A;  5D5V B;  2OD5 A;  2NAZ A;  1H9T A;  3K2Z A;  1FBS A;  1EH6 A;  4IRG A;  1EH7 A;  4MEY F;  2IP2 A;  4IHS A;  4RB0 A;  3LAJ A;  3FWE A;  5HVQ C;  3ERE D;  4R8H A;  1P6R A;  4FX4 A;  1U3E M;  1DPR A;  4U88 A;  1BC7 C;  2H6B A;  2RQP A;  3HRU A;  4ZZD A;  2K86 A;  4IXA A;  1IN5 A;  2YX7 A;  3KP5 A;  2R3S A;  3JSO A;  4OOI A;  1K6O A;  2BYV E;  1J0R A;  4L18 B;  3T0Y A;  4RGR A;  2LSO A;  4IJA A;  1FPQ A;  2COM A;  4WXH A;  5FLX Z;  3TO7 A;  4HX4 A;  1SMY F;  1GXQ A;  4DNC A;  5DCF A;  1IW7 F;  3MWM A;  4G8X A;  3JTG A;  1FWZ A;  3F8B A;  2PLY A;  3I58 A;  4JBA A;  4CZZ A;  4Z2Y A;  2O8X A;  2XRN A;  2E7X A;  2FOK A;  3BJA A;  2DPD A;  1IF1 A;  4OIP F;  3B02 A;  1JHH A;  3QP5 A;  3WGG A;  1K78 A;  2RNJ A;  3HYI A;  4U0W A;  1H9G A;  3U2R A;  4KFC A;  4WK8 F;  3VB2 A;  5HS8 A;  3N4M A;  2XAQ A;  2QZ8 A;  4PDK A;  5JFR A;  2H27 A;  3RKY A;  3Q5F A;  2O61 A;  3BOQ A;  4MQ9 F;  4PGH A;  1RI7 A;  3WTY C;  2O6G E;  2XAH A;  1QGP A;  2L3D A;  2PG4 A;  3VOD A;  3I54 A;  1WSU A;  2HS5 A;  1J5Y A;  4KIB A;  1HKQ A;  1BC8 C;  1YG2 A;  4AIK A;  3BP8 A;  4HX8 A;  2K4B A;  3LST A;  3QP6 A;  4LMY A;  3ULQ B;  2LF7 A;  2ZNZ A;  4JQF A;  5DCM B;  2A68 F;  5HLG A;  3LWF A;  2STW A;  3LA3 A;  1IRF A;  2NNY A;  5BMZ A;  1YIO A;  2XHK A;  4RGU A;  1LVA A;  2RC4 A;  2JT1 A;  3PQK A;  3CLO A;  2ISY A;  1O7F A;  2ZXJ A;  3TKY A;  4B8X A;  1XSV A;  2UXX A;  3KZY A;  2EJR A;  5LLQ A;  3KE2 A;  4UHT A;  3H3U A;  5ICG A;  1B6A A;  5K5Q A;  1SFE A;  4EJO A;  1PP7 U;  1ZG3 A;  3GFI A;  1UFM A;  2ETH A;  2GZW A;  4O3M A;  2HKO A;  2IJL A;  4HA8 A;  2G7U A;  3KFW X;  3QPH A;  4F7Z A;  1YW7 A;  2ESH A;  1PP8 F;  4N9H A;  2JTV A;  1TBX A;  2ZJ2 A;  4HOB A;  1ZGJ A;  2G7H A;  2A69 F;  3P7N A;  4HYE A;  3HUG A;  5CJ9 A;  3ML6 A;  4LGW A;  4MQV A;  1SFX A;  2PJP A;  3V7S A;  2XGX A;  5ED4 A;  3TOA A;  4YG2 F;  3HTS B;  1BBY A;  2HGC A;  3K9T A;  1BI3 A;  3S2W A;  3SXY A;  3ECO A;  2WWY A;  3SFZ A;  3LQR A;  4PGG A;  1QO0 D;  3F8C A;  2F5D A;  2RGV A;  2P7V B;  4KDP A;  2VC0 A;  5ICC A;  2DPU A;  2XUB A;  4G9Y A;  3L00 A;  2WV0 A;  4PCQ A;  2A61 A;  4P55 A;  5J6X A;  1I1S A;  3C7J A;  2E1C A;  2DAO A;  5CLS A;  1BOA A;  3NEU A;  3IWZ A;  2W85 A;  3TQN A;  5BQT A;  2V1U A;  1BIA A;  4R1H A;  4RAZ A;  4WF2 A;  1ZRF A;  3KLN A;  5D8K B;  1RZ4 A;  2V9V A;  3LA7 A;  3I0T A;  1IUY A;  2V1D A;  3E5Q A;  2G9W A;  2FXA A;  3HSF A;  4ZH4 F;  3EQL F;  3E6D A;  5KVR A;  1FP1 D;  1JHF A;  3O2P E;  4EMS A;  5ERI A;  1R23 A;  1HW1 A;  2M87 A;  2WTE A;  2ZNY A;  2YPR A;  2QEN A;  3ZMV A;  4QLC U;  5ILV A;  5A2Q Z;  1P4A A;  1R1T A;  4OU0 A;  2FNA A;  4HQM A;  2PMH A;  1BIB A;  2Q0O A;  4L9N A;  4LD5 A;  1RNL A;  3HTU A;  4P9U A;  2L4M A;  3TOB A;  4E70 A;  2LF8 A;  2HEO A;  3MZH A;  3QOP A;  1XGS A;  4ESB A;  4IF4 A;  1T39 A;  3KP4 A;  2P8T A;  1Y0U A;  2CWE A;  3P9C A;  4PZJ A;  2AXL A;  5E1W A;  3AAF A;  3R6S A;  1R1U A;  3FMR A;  3K1M A;  3EET A;  3WU0 A;  2CSO A;  4M9X A;  4RAY A;  2V6C A;  4BQA A;  2W24 A;  3MQ0 A;  3PQJ A;  1UB9 A;  4IRI A;  5LEJ A;  4YFX F;  1FLI A;  5E8I A;  1R58 A;  2K02 A;  1IN6 A;  4A0Z A;  5K1Y A;  1WKM A;  2EFQ A;  1IXS B;  3U1D A;  4G6D A;  4CYD A;  3FX3 A;  3I53 A;  5LGU A;  3QPT A;  1IN8 A;  1XSX A;  4Y13 A;  4G6Q A;  3P9K A;  3F23 A;  4A0X A;  2KIU A;  1RUO A;  2CO5 A;  4K2E A;  1D5V A;  1FY7 A;  2Y48 A;  1FNN A;  4FX0 A;  1TQP A;  1BI0 A;  1AOY A;  4ASN A;  4L0Z B;  3K1P A;  1D3Y A;  1W7P B;  2IA1 A;  1YLF A;  1Z91 A;  2EB7 A;  3TDU C;  1LDK B;  2QLZ A;  5CVI A;  1XMK A;  4HDU A;  2EFW A;  4U7B A;  4EVI A;  4MNU A;  1SD6 A;  2NNN A;  4U7D A;  2IW5 A;  4BXU A;  3GZ6 A;  3EYY A;  1QNT A;  3RYP A;  4I01 A;  1B1B A;  2PBI A;  1WWX A;  2DTR A;  3BJO A;  1ZLK A;  4A0Y A;  5D8L B;  2H6C A;  5F1R A;  4HBL A;  2H09 A;  4M6Y A;  5EEG A;  3WTW C;  1FC3 A;  1JGS A;  4B09 A;  3MFK A;  4A5N A;  4G7H F;  5AON A;  3C1D A;  3VOE A;  3GO5 A;  2NRA C;  3O6B B;  2D45 A;  1T0F A;  1LEB A;  4A6E A;  4ESJ A;  4HLY A;  1Q1H A;  2RV8 A;  2D1H A;  4OMY A;  1QQI A;  4XSX F;  1D8J A;  2CYY A;  1QZY A;  2ZME A;  2GXB A;  5HLH A;  1P92 A;  3BWG A;  1DDN A;  4XRF A;  2HQR A;  1L3L A;  2HQN A;  1WQ2 A;  1Z9C A;  2V1X A;  3FXU A;  4HF2 A;  1CF7 A;  4KYW A;  1NHA A;  3C18 A;  3FF5 A;  1WI9 A;  1J9I A;  4YII A;  3HOT A;  1ON2 A;  3TO9 A;  3DXJ F;  4L0Y B;  4A6D A;  3U9G A;  4XBF A;  3H92 A;  3E5U A;  2P6T A;  3NRV A;  4G7O F;  2K4J A;  2FU4 A;  1YQA A;  1ZG1 A;  1S6L A;  2LKP A;  1ZRE A;  3RYR A;  4M71 A;  3BRO A;  2O3F A;  4AIJ A;  3RDI A;  4Q4Z F;  4HZF A;  1Z6R A;  2F5E A;  3WTT C;  3QRF F;  2RKH A;  2JPC A;  2DI3 A;  2GXG A;  2ZBK A;  4Y15 A;  5FO5 A;  1MZB A;  3E6M A;  5DD4 A;  3QAH A;  2E7W A;  4ENJ A;  2QWW A;  5DUI A;  2UWM A;  2ZKZ A;  1ZAO A;  3OV8 A;  4LLG F;  5BS6 A;  3FXR A;  2HDC A;  2EV0 A;  4IVN A;  1BN5 A;  2VBY A;  5HLI A;  2XAF A;  1KQ9 A;  4HV5 A;  4WXC A;  5F6F A;  3G3Z A;  1CF7 B;  3F3X A;  2VT2 A;  2IT0 A;  5AIP A;  1FX7 A;  3GYH X;  1FOK A;  4I0B A;  2HOE A;  3M8E A;  4L5I A;  3HSE A;  2DQL A;  2ADU A;  5JI6 A;  3JAM Z;  4CIC A;  2JPB A;  4LB6 B;  3KP2 A;  2GA1 A;  2EV5 A;  1B4A A;  3LFK A;  1S7O A;  3R4K A;  5D4R A;  3O3K A;  1R1V A;  3ZMU A;  4I02 A;  2OQG A;  3TDZ C;  3F8F A;  4I98 B;  5D6F A;  1GXP A;  2VE8 A;  4CO8 A;  1P4X A;  5J8F A;  3ZMZ A;  4GCV A;  3I5U A;  3FMQ A;  2DQR A;  2MC3 A;  1QPM A;  4RB2 C;  5EEH A;  4R79 A;  1K79 A;  3HOS A;  1HBX G;  3WE2 A;  3R60 A;  3IC7 A;  2O03 A;  1XD7 A;  1TLH B;  2IRF G;  1Z6T A;  2R7D A;  2EV6 A;  4LB5 A;  2BEO A;  2PEX A;  2VBX A;  5HS9 A;  5ILS A;  3Q9S A;  3D0S A;  1OKR A;  2PMU A;  2HYG D;  3MAJ A;  2MLG A;  1IZ1 A;  2GIV A;  1SFU A;  1O7L A;  3BPV A;  4HF1 A;  1KQ0 A;  2MD5 A;  4OIN F;  3NQO A;  2CGP A;  2Z3Y A;  5E1X A;  1W7P D;  1J59 A;  3F21 A;  1X3U A;  4DQ2 A;  2FRH A;  4NHJ A;  3KCC A;  2VOO A;  2YR2 A;  3V7R A;  5FD6 A;  3PFI A;  2IVM A;  1O3Q A;  4A2U A;  1MGT A;  2ZCW A;  1REP C;  2R7F A;  4EJU A;  3FMS A;  1SAX A;  2FBH A;  2K7L A;  3M9A A;  4U0Y A;  4OIQ F;  4Y17 A;  4KNY A;  4HQE A;  3GUD A;  2VOP A;  4UVB A;  2C6Y A;  4KIF A;  4ZYD A;  4Q48 A;  5LHI A;  2PQ8 A;  1T6S A;  1ZRC A;  1XCV A;  3BPX A;  3E6C C;  1TQM A;  4KA4 A;  4I2O A;  3D5L A;  3LA2 A;  1HKS A;  3T1B A;  2KJB A;  1R36 A;  1J7K A;  1LB2 A;  4KN4 X;  4GGG A;  1OR7 A;  1ZYR F;  3F22 A;  1G4D A;  1Z7U A;  1YTY A;  5DCM A;  5K5R A;  2DLL A;  3DFG A;  3DV8 A;  4HV6 A;  1RIO H;  1FSE A;  1MDM A;  2DU9 A;  2FMY A;  5JR3 A;  2XKO A;  1ONV A;  1T38 A;  5HDN A;  4Q47 A;  1C0W A;  1L0O C;  1OYW A;  5D5X B;  3GLX A;  5DYM A;  1DP7 P;  2J5P A;  2UZK A;  1XMA A;  2QBY B;  1T2K A;  1F9N A;  4MTE A;  1S8N A;  2V79 A;  1MDM B;  2Y0M A;  1LQ1 A;  5LGT A;  1WRJ A;  1LDD A;  1QBJ A;  4EM1 A;  4EV0 A;  2A5Y B;  1E2X A;  2TDX A;  2STT A;  1HQC A;  3GFJ A;  5BOX A;  3V8L A;  1IN4 A;  1VTN C;  1HST A;  3V8K A;  3E3V A;  1D8K A;  3J81 K;  2IA2 A;  4RB3 C;  1UST A;  2W84 A;  3ZP5 A;  3WE3 A;  1H0M A;  3IKT A;  3I59 A;  2FSW A;  4LK0 F;  4BNC A;  1W4M A;  5HOO A;  4MHG A;  4EGZ A;  3FZV A;  1G3Y A;  1ZHF A;  3SQN A;  3KEQ A;  3REO A;  4A5M A;  2GWR A;  3K1N A;  5J8C A;  1FYM A;  4BHP A;  1I27 A;  2DK5 A;  1ZG5 A;  1SD5 A;  4WXD A;  3GW2 A;  4YFN F;  2JSC A;  3TO6 A;  2FEZ A;  4KIC A;  1OYY A;  5FFZ A;  1UHM A;  2M5W A;  1AWC A;  2GA2 A;  4P96 A;  3GFL A;  5E8G A;  3ZMT A;  3DPL C;  2EK5 A;  1I6X A;  4CXF A;  1R7J A;  3CO6 C;  4OMZ A;  4M6X A;  2OZ6 A;  3I71 A;  2A3S A;  5IT3 A;  3CUO A;  1MJB A;  5DV5 A;  1USS A;  1HKT A;  2ZO4 A;  4GXO A;  4EJV A;  5FGM A;  4IRH A;  2P6S A;  3ZQ7 A;  3MZY A;  1PUE E;  1MD0 A;  3FM3 A;  1R5G A;  4M73 A;  1SD4 A;  1I1G A;  1KU9 A;  3LQQ A;  5CVR A;  5JHU A;  2Q8K A;  3CTA A;  3ZMD A;  4XSZ F;  1W5S A;  2MA3 A;  1JE8 A;  2LNB A;  5IT9 Z;  2KIM A;  3F6V A;  1HW2 A;  3I4P A;  1J75 A;  4WX9 A;  1UCR A;  2PI0 A;  2EWN A;  4ON0 A;  2L54 A;  5BPD A;  2X0L A;  5L3G A;  5BPI A;  2QBY A;  2BGC A;  3B73 A;  1XDS A;  1W7P A;  3EDP A;  2Y75 A;  4RB1 A;  2Z9O A;  2K27 A;  3ROU A;  3ZN1 A;  3KZZ A;  4WWC A;  1XDU A;  3HRS A;  2HR3 A;  3COA C;  2MH9 A;  2OAZ A;  4ESF A;  1GHC A;  1EH8 A;  1ZN2 A;  3M7G A;  2VXZ A;  4G7Z F;  5DD8 A;  2FQ3 A;  1OPC A;  5L3D A;  5JVT A;  4LG0 A;  3WOD F;  4AWX B;  3GWZ A;  4NB5 A;  4ZYG A;  2VT3 A;  3L2C A;  2VC1 A;  2E1N A;  1I5Z A;  1UHW A;  2OU2 A;  1ULY A;  1SMT A;  2KKO A;  4GYI A;  5HS7 A;  4CHU A;  2D1V A;  2VE9 A;  2QM3 A;  1FT9 A;  1LEA A;  3RTR A;  3CUQ B;  5FB2 A;  5L3C A;  4I7H A;  3F8N A;  3G73 A;  2HFH A;  1F1Z A;  1FBU A;  3M8F A;  5DDG A;  4ENN A;  2DBB A;  4ENK A;  1IRG A;  3ZPL A;  1KQ8 A;  3ABT A;  3EUH A;  5LBQ A;  3K0L A;  4LLL A;  2KRF A;  5AIQ A;  4ZZL A;  1U5T C;  6PAX A;  4HF0 A;  1SD7 A;  3JTH A;  1ZRD A;  4IPA A;  2NS0 A;  1R22 A;  3DEU A;  3R0J A;  1O3S A;  3CUQ A;  2QUF A;  2VBZ A;  5ILU A;  1BI1 A;  2RDP A;  3WTU C;  2Z99 A;  5CYV A;  1KGS A;  3BDD A;  3ELK A;  1KYZ A;  1S29 A;  5DUK A;  2A6H F;  4I09 A;  1STZ A;  3ZMS A;  3V7C A;  2HKX A;  4KN7 X;  5LRR A;  4O6J A;  1OYI A;  3W6J B;  4UNO A;  2QQA A;  2IA0 A;  3CUQ C;  2CQK A;  2FBI A;  3RKX A;  4RS8 A;  1XGN A;  4EJW A;  4BYY A;  4GYG A;  1G3W A;  2H94 A;  3BJ6 A;  4CDG A;  4HLX A;  2VOD A;  2M45 A;  1KU2 A;  2Z5U A;  3CDH A;  4LLN A;  3GVA A;  3J7A O;  5A2Q K;  3DKW A;  2QQB A;  1QZZ A;  1YS6 A;  4MEX F;  4AIH A;  3KLO A;  2JZY A;  1IXC A;  2FNP A;  3L7W A;  4M72 A;  3SZT A;  3SHF A;  2OBP A;  4BAY A;  1IXR C;  3EYI A;  3SZP A;  1BM9 A;  2XAG A;  2HYF A;  2OA4 A;  2P5L C;  4P9F A;  3DPT A;  4XLN F;  2L02 A;  2L01 A;  4BHC A;  1YYV A;  3DQV C;  4YFK F;  5FLX K;  4L5J A;  1XB4 A;  2EA4 A;  1U5T A;  5LGN A;  4IHT A;  2P7C B;  2ELH A;  5HDG A;  4LJZ F;  2F5C A;  1K7A A;  5ICF A;  1TNS A;  2ESN A;  3JW4 A;  4ETS A;  4KMU X;  5H6R A;  4MTD A;  3RKW A;  2RVC A;  3E6B A;  3WGI A;  3FM5 A;  2Z33 A;  4OIR F;  1P4W A;  4S04 A;  1OMI A;  1U6G A;  1S7A A;  4M9Z A;  4I0A A;  2BV6 A;  2KIF A;  3DF8 A;  1EV7 A;  4L9J A;  4XLP F;  3E97 A;  2YX4 A;  2EFO A;  2OQR A;  4L9T A;  3H3Z A;  2P5V A;  2CFX A;  4GO1 A;  2PFB A;  5CVV A;  3QU6 A;  5CVU A;  2A07 F;  2XAJ A;  2X4H A;  4NQW A;  4S05 A;  1O57 A;  3L9F A;  1ZLJ A;  1V3F A;  1HXD A;  3JSP A;  5E18 F;  1V4R A;  2FA5 A;  5LHH A;  2DK8 A;  2VN2 A;  4UV9 A;  1FYL A;  4UUV A;  3J80 K;  1CGP A;  3R61 A;  1FZP B;  4RGS A;  3KP6 A;  1TW2 A;  4BHB A;  3GEZ A;  1G6N A;  3I59 B;  3T8R A;  2QQ9 A;  5L3B A;  2ISZ A;  3J80 Z;  5D6E A;  1FP2 A;  5CVJ A;  1JXS A;  4EM0 B;  3LAP A;  2Q2E A;  3TGN A;  5K5O A;  4H0E A;  3GFM A;  4JK1 X;  3DP7 A;  5DEQ A;  2DT5 A;  3OOP A;  3E5X A;  2M8E A;  1MKM A;  1J2X A;  5LEK A;  2WC2 A;  3CO7 C;  3GX4 X;  3VFZ A;  5F64 A;  1K78 B;  4M74 A;  3P9I A;  3ZN0 A;  1U5T B;  1KA8 A;  1E17 A;  2W25 A;  1FYK A;  4EJT A;  4G94 A;  1O3T A;  3I64 A;  5E20 A;  1TTY A;  2BBY A;  3JAM K;  2P5K A;  1A04 A;  3KP7 A;  4LG0 B;  4D0P A;  2CW0 F;  2VON A;  3RPU A;  2W57 A;  2XVC A;  2XKP A;  5H20 A;  5ICE A;  1R00 A;  5KK1 A;  3J81 Z;  2A6E F;  1YW8 A;  3HRM A;  5FD5 A;  5E17 F;  4FHT A;  2BE5 F;  1DUX C;  3KP3 A;  3WG9 A;  3WU1 B;  3WTZ A;  3RIR A;  1G3T A;  4MGR A;  4UVC A;  5HDK A;  1ZGA A;  3CJN A;  1KU7 A;  3ABU A;  3WGH A;  4A12 A;  4QWQ A;  1U78 A;  3WTS C;  3HHH A;  2YSR A;  4KMF A;  2MLK A;  2NYX A;  3V4G A;  1ODD A;  4P5O A;  3IL2 A;  1P2F A;  2IPQ X;  1DPU A;  5D5U B;  3K69 A;  2MH2 A;  1KU3 A;  1TQI A;  4HAM A;  2UXN A;  1FBQ A;  3FXQ A;  4EGY A;  3IRQ A;  3VEP A;  2AS5 F;  1B59 A;  2M30 A;  3RPQ A;  1XGO A;  4LFU A;  2HTJ A;  2VBW A;  3HRT A;  3T8T A;  3IKV A;  5D4S A;  1MJA A;  3N97 A;  2XV4 S;  4N0B A;  2XAS A;  3MCZ A;  3T5X A;  4YIF A;  1HSJ A;  2FF4 A;  5D5W B;  5LHG A;  1RUN A;  1YFH A;  2QYO A;  1YO5 C;  2EFP A;  1Z1D A;  1XCB A;  2J5O A;  1BI2 A;  4AD9 A;  5L3F A;  1Z05 A;  4RGX A;  4HDV A;  4Q5S F;  4KIG A;  2XRO A;  5H6Q A;  3V8J A;  2GQQ A;  1R5H A;  2F5F A;  3HSR A;  1KYW A;  4EQQ A;  4BH9 A;  2O0Y A;  1GVJ A;  4L9V A;  4UVA A;  1YW9 A;  3WTX C;  1ON1 A;  3L09 A;  5IT9 K;  4OIO F;  2JRT A;  1XN7 A;  2HWV A;  1MJ9 A;  2HTS A;  1IAW A;  1ZAR A;  4ZYH A;  4TV7 A;  3HHG A;  4ENM A;  4FT8 A;  2B0L A;  4KUM A;  1IN7 A;  1FSH A;  4EM2 A;  1B9M A;  3RI4 A;  2D2W A;  3BY6 A;  3GF2 A;  1W5T A;  2EFN A;  2L4A A;  3FHZ A;  3QU3 A;  1LDJ A;  3F6O A;  1YS7 A;  2FE3 A;  3M1E A;  1T98 A;  2OZU A;  3RJP A; 
#chains in the Genus database with same CATH topology
 1XGM A;  4NNJ A;  5F0F A;  2BY2 A;  3A4C A;  1BJA A;  1YJN I;  1NH3 A;  5TJJ A;  3D5R C;  2DYR H;  3WTV C;  2XIG A;  3C3W A;  3CCR I;  3LFU A;  4O5V A;  4UXN A;  2LDU A;  1G2H A;  5LRS A;  4LK1 F;  2WAF A;  2CG4 A;  3UNG C;  1F5T A;  1LE8 A;  3D1N I;  3I56 I;  3RZO J;  2FBK A;  2LTP A;  1G3S A;  1ETX A;  2DO7 A;  2KJC A;  3CC7 I;  2O9L A;  2MBF A;  2R7Q A;  3KET A;  5FFX A;  1V5F A;  2GAU A;  2DA6 A;  4CCL A;  2Z1D A;  2R5Z B;  4BDZ A;  3F72 A;  1B9N A;  5E1Z B;  2CV2 A;  3F8M A;  2BY1 A;  2CH0 A;  3GXO A;  4W1U A;  4N9I A;  2ZME B;  2HOA A;  1TNT A;  4ZYE A;  1R71 A;  1Y6I A;  3S3N A;  1LNW A;  1TW3 A;  2GIZ A;  2HZT A;  1ZH5 A;  3I9V 2;  5EEA A;  1RR7 A;  4HX7 A;  3GZ5 A;  3KEO A;  1MBE A;  2EIN H;  2ICW G;  3A02 A;  1F4K A;  5B66 C;  1PDN C;  4IHX A;  1X2M A;  4XL9 A;  2RN7 A;  3CJQ B;  4U0V A;  1LJ9 A;  1MW7 A;  1Z0X A;  5TRD A;  3ZCO A;  5GAD J;  1WJF A;  1U2W A;  4M3E A;  2CU7 A;  2R5Y A;  3DLL F;  4UB8 C;  4X1E A;  2IGN A;  2ACJ A;  4XNF A;  2PN6 A;  4M9S A;  3CDI A;  2K40 A;  4CYC A;  3HPG A;  4HW0 A;  4C3J J;  4B43 A;  3IWF A;  5IP7 J;  1AKH B;  3MEX A;  3M3Y J;  3IH4 A;  3K10 A;  5L3E A;  1WCM J;  4XN3 A;  4CGZ A;  3OYC A;  2F2E A;  3ECH A;  3IRR A;  4M3F A;  3ZQG A;  4AVP A;  2LC2 A;  1XSD A;  2M1B A;  2EA2 A;  3R0A A;  4N4O B;  1HDP A;  2YU3 A;  3W6K B;  1HW5 A;  2P4W A;  3BZ6 A;  1N78 A;  4KIT B;  2GOX B;  3FXJ A;  2DFI A;  5HLT A;  3E1S A;  1O3R A;  1S3J A;  1WFX A;  4LIV A;  3Q9V A;  1SVL A;  3ISP A;  2ZFW A;  4CCO A;  1I39 A;  4KT5 C;  3CCJ I;  1U8R A;  4UV8 A;  2DW4 A;  3HIF A;  2HVR A;  1BW6 A;  2WBM A;  1DGW Y;  2QVO A;  3IHU A;  2DA5 A;  2K9N A;  4WCG A;  3OYE A;  4GFB A;  2FML A;  4FAS D;  2DMU A;  4PJN A;  1A36 A;  2XSJ C;  2ZXH A;  5D5V B;  2OD5 A;  4XM3 A;  2ZJP F;  2NAZ A;  1H9T A;  3H5N A;  3Q0U A;  3K2Z A;  3CP2 A;  1KZH A;  1FBS A;  2HU9 A;  1DQU A;  2W82 A;  1EH6 A;  4IRG A;  3VYT B;  1EH7 A;  1S72 I;  1GDT A;  1I50 J;  4MEY F;  2IP2 A;  4IHS A;  3VSL A;  3HKZ A;  4RB0 A;  3GTM J;  3LAJ A;  3FWE A;  3ONQ A;  2JA6 J;  5HVQ C;  3ERE D;  3KEY A;  4BEH B;  1T0F C;  4OWR B;  2E2J J;  4R8H A;  1P6R A;  1BR1 A;  1MND A;  3IV5 A;  1Z67 A;  1OCP A;  1D1A A;  4FX4 A;  1U3E M;  1DPR A;  3PL8 A;  2ECC A;  4U88 A;  5F0C A;  1BC7 C;  2H6B A;  2RQP A;  3HRU A;  4ZZD A;  2HNH A;  2K86 A;  3JRC A;  4IXA A;  1IN5 A;  2YX7 A;  3KP5 A;  3BR5 A;  2R3S A;  3JSO A;  2XF7 A;  4OOI A;  2M34 A;  3RQ4 A;  2Z16 A;  3O8H A;  4KT6 A;  5DTD A;  4XLF A;  1K6O A;  3OIO A;  4LIT A;  2BYV E;  1J0R A;  4L18 B;  3T0Y A;  4RGR A;  3PNT A;  4PK4 A;  2LSO A;  3ZQH A;  3HOU J;  4IJA A;  3W6V A;  3EPZ A;  3HOX J;  1FPQ A;  2COM A;  4HEA 2;  3K4B A;  4MFE A;  4WXH A;  3G1O A;  5FLX Z;  3TO7 A;  4KIS A;  4HX4 A;  2HVQ A;  1SMY F;  1GXQ A;  2LD5 A;  3Q0V A;  4CCJ A;  4DNC A;  2XB0 X;  3C2G A;  3I4M J;  5DCF A;  5FRO A;  1R4N B;  3CMY A;  1IW7 F;  2UUZ A;  3MWM A;  5DM6 F;  4G8X A;  3JTG A;  1FWZ A;  2LP0 A;  3F8B A;  2PLY A;  3FIW A;  2F48 A;  5E3M A;  3I58 A;  4BJ5 C;  4J01 A;  3K4C A;  4BY7 J;  1OFC X;  5FJ8 J;  4JBA A;  4CZZ A;  4Z2Y A;  4G6T B;  2IXS A;  5J3L A;  2O8X A;  2XRN A;  2E7X A;  2FOK A;  4HNV A;  2OTL I;  3BJA A;  2DPD A;  1IF1 A;  3BG9 A;  4OIP F;  3B02 A;  1JHH A;  3QP5 A;  3WGG A;  1K78 A;  2RNJ A;  3HYI A;  1FIP A;  2BXZ A;  4U0W A;  3BG5 A;  1H9G A;  2MG4 A;  2JJ7 A;  3OS1 A;  3U2R A;  3JRI A;  4KFC A;  3BQY A;  1D5Y A;  3CCS I;  3QWL A;  1VQ5 I;  4M6V A;  4WK8 F;  3VB2 A;  4P1W A;  1QA6 A;  2K3P A;  1OCR H;  5HS8 A;  1SEU A;  5M5W J;  3N4M A;  2XAQ A;  2QZ8 A;  5EZG A;  1AA7 A;  3TED A;  4PDK A;  1P7J A;  2CQN A;  5JFR A;  3PIP F;  3AL0 C;  2MYS A;  4EEF G;  3FK6 A;  2H27 A;  4XRM A;  3RKY A;  3OYF A;  3Q5F A;  2O61 A;  3BOQ A;  4MQ9 F;  4PGH A;  1R5I D;  1RI7 A;  3D5S C;  1YIJ I;  1FOX A;  3WTY C;  1VF9 A;  1NK2 P;  1A6I A;  2O6G E;  2XAH A;  2DA4 A;  1QGP A;  2L3D A;  4CYC B;  4AM3 A;  1K83 J;  4BBR J;  2PG4 A;  3VOD A;  3I54 A;  2DXI A;  1WSU A;  2HS5 A;  1J5Y A;  4KIB A;  1HKQ A;  2M7B A;  1BC8 C;  4HPQ A;  1YG2 A;  1B72 A;  4AIK A;  1PUF A;  3PUF A;  3VPR A;  2DOD A;  3BP8 A;  4HX8 A;  2K4B A;  3LST A;  2E35 A;  1TP4 A;  3QP6 A;  1G59 A;  2Z2S B;  1SFK A;  3FKJ A;  1SVM A;  2E71 A;  2XPW A;  1XMX A;  1QZE A;  4LMY A;  3VYS B;  3ULQ B;  3BTC A;  3F9K A;  4B48 A;  2LF7 A;  2ZXI A;  2ZNZ A;  4JQF A;  5DCM B;  2A68 F;  1XPX A;  5HLG A;  3LWF A;  2STW A;  3LA3 A;  2BW3 B;  4F55 A;  1IRF A;  1GV2 A;  2F4O B;  1YIO A;  2WB1 N;  2XHK A;  2MW8 A;  4RGU A;  3EUK L;  2NNY A;  2QKM B;  1LVA A;  2RC4 A;  5CPR B;  4V19 K;  2JT1 A;  3PQK A;  4BQQ A;  3CLO A;  1I6H J;  3J7Y J;  2ISY A;  5FKK A;  1O7F A;  2KZG A;  1IGN A;  4A3J J;  2ZXJ A;  5C4J J;  3TKY A;  1QU3 A;  4B8X A;  1XSV A;  4ZDO A;  3S1N J;  2UXX A;  5M3M J;  3TW6 A;  3KZY A;  2JA5 J;  1KON A;  2EJR A;  5LLQ A;  3KE2 A;  4UHT A;  3FK7 A;  2BW3 A;  4JX6 A;  3H3U A;  4W97 A;  2PMZ A;  4DYR A;  5E3N A;  5ICG A;  1FMW A;  4I76 A;  2F6C A;  1B6A A;  5K5Q A;  1SFE A;  4BU2 A;  4EJO A;  3OWT A;  1PP7 U;  5KAF C;  1ZG3 A;  3GFI A;  1VI0 A;  2XGD A;  2VKD A;  3CCV I;  1UFM A;  2ETH A;  4AC0 A;  2GZW A;  4O3M A;  2HKO A;  3DTI A;  2IJL A;  4BQN A;  2H8R A;  3GTG J;  4HA8 A;  3G1M A;  2G7U A;  3KFW X;  3U1K A;  3QPH A;  4F7Z A;  5JVG F;  4RBO A;  1W1W E;  1YW7 A;  3HB9 A;  2ESH A;  4AU7 A;  1PP8 F;  5IYB J;  4N9H A;  2ZC2 A;  2JTV A;  1TBX A;  2M4K A;  2ZJ2 A;  2H1L A;  4HOB A;  3RCO A;  4F93 B;  1EKE A;  1ZGJ A;  2G7H A;  2K9S A;  3RQI A;  4E4H A;  4XIC A;  2A69 F;  3P7N A;  2DFF A;  4HYE A;  3HUG A;  5CJ9 A;  3CJR B;  3ML6 A;  2QQ8 A;  4LGW A;  3HDD A;  4MQV A;  1SFX A;  2KP6 A;  1AKH A;  1VQ9 I;  2PJP A;  4RAG A;  3V7S A;  2O8K A;  3L2W A;  2DJN A;  2XGX A;  1MBK A;  2LYC A;  2KRH A;  3TOA A;  1TT5 B;  3GZN B;  4YG2 F;  5ED4 A;  3HTS B;  1BBY A;  4A3M J;  2V26 A;  2HGC A;  1X4P A;  3K9T A;  2ZJQ F;  3MZ8 A;  5F0H A;  1BI3 A;  1MSF C;  3S2W A;  3SXY A;  3ECO A;  2WWY A;  4DZJ A;  3SFZ A;  1VQP I;  3LQR A;  4PGG A;  5J1U A;  1QO0 D;  3F8C A;  1IRZ A;  3Q0W A;  2F5D A;  1HCR A;  4DYC A;  2RGV A;  2P7V B;  3P5J A;  1YRN A;  2A6T A;  3S2D J;  4QIW N;  2VL8 A;  4KDP A;  2VC0 A;  5ICC A;  4Y33 A;  2XUB A;  2DPU A;  1Y8R B;  2HZD A;  4G9Y A;  3L00 A;  1TWA J;  5EG0 B;  1HA8 A;  2VUM J;  3CLQ A;  4CZC A;  2WV0 A;  3QPS A;  4C2M J;  2I10 A;  4PCQ A;  3RKQ A;  2JA8 J;  2A61 A;  4P55 A;  1UHS A;  5J6X A;  1I1S A;  3C7J A;  2E1C A;  2DAO A;  5CLS A;  1YIT I;  3OL3 A;  1BOA A;  3NEU A;  2LKS A;  3LSJ A;  3IWZ A;  2W85 A;  3TQN A;  5BQT A;  2V1U A;  3FKI J;  1BIA A;  3H9G A;  4R1H A;  4RAZ A;  3OYN A;  4WF2 A;  3S14 J;  1ZRF A;  3KLN A;  5D8K B;  1RZ4 A;  2V9V A;  3LA7 A;  1PYV A;  4JYK A;  4FET A;  2VQC A;  3QQA A;  3I0T A;  1IUY A;  2DA3 A;  2E1M B;  2V1D A;  3E5Q A;  1K4T A;  2G9W A;  1Y1W J;  5IP6 A;  2FXA A;  3IP4 B;  3HSF A;  4ZH4 F;  3EUA A;  3EQL F;  2XF6 A;  5LD2 C;  3E6D A;  1OR7 C;  2LY1 A;  2OJE D;  5KVR A;  3TMO A;  4BE2 A;  3HC7 A;  1FP1 D;  1JHF A;  2CW8 A;  3O2P E;  4EMS A;  5ERI A;  1R23 A;  3H35 A;  1HW1 A;  2M87 A;  2WTE A;  1DU0 A;  3LL7 A;  2WAQ N;  4M3D A;  2JA2 A;  3OYL A;  2ZNY A;  2HPI A;  2YPR A;  3MKW B;  1JKO C;  1ETK A;  2QEN A;  1IRG A;  3ZMV A;  4QLC U;  5ILV A;  5A2Q Z;  4E7K A;  1P4A A;  3RPU D;  1R1T A;  3HKZ N;  4OU0 A;  2FNA A;  4HQM A;  4CSW A;  2HXO A;  2PMH A;  2LG4 A;  4HG2 A;  3OYD A;  1JUP A;  1BIB A;  2Q0O A;  2X6O A;  4L9N A;  4LD5 A;  3SEZ A;  1RNL A;  3LSP A;  2A05 A;  4B3X A;  4BKX A;  3HTU A;  4XKW A;  4P9U A;  2L4M A;  3W3C A;  3TOB A;  3OYG A;  3LSR A;  1IDZ A;  4E70 A;  2LF8 A;  2HEO A;  3MZH A;  4UUS B;  2O7O A;  3QOP A;  1I3A A;  1XGS A;  2VLA A;  4ESB A;  1S9H A;  2W1O A;  4IF4 A;  1T39 A;  3OY9 A;  3KP4 A;  2LVS A;  2P8T A;  1Y0U A;  4NDL A;  3WHC A;  2NVQ J;  2CWE A;  2E1O A;  3P9C A;  4PZJ A;  3SEQ A;  2AXL A;  5E1W A;  3DCF A;  3AAF A;  3R6S A;  3W2V A;  2BY3 A;  4RA2 A;  1R1U A;  3FMR A;  3K1M A;  1IRX A;  3EET A;  4JX4 A;  3WU0 A;  2CSO A;  5J4V A;  4M9X A;  4RAY A;  3HJE A;  1POG A;  1ZR4 A;  2BY0 A;  2V6C A;  4BQA A;  4DW6 A;  3K6G A;  1S7E A;  2W24 A;  2GLO A;  3MQ0 A;  3BTL A;  1UB9 A;  3PQJ A;  3OYA A;  3DU5 A;  1BW5 A;  4IRI A;  5LEJ A;  4C2T A;  1X1A A;  4YFX F;  3OYH A;  1FLI A;  5E8I A;  2GOM A;  2K3F A;  2QSG X;  1R58 A;  2K02 A;  2VIX A;  2AQE A;  4ZDP A;  1IN6 A;  2XRL A;  4A0Z A;  1JI8 A;  5K1Y A;  3ABM H;  1BA5 A;  1WKM A;  2K9L A;  2EFQ A;  1IXS B;  2DN0 A;  3U1D A;  4G6D A;  3WG7 H;  4CYD A;  3FX3 A;  4J19 A;  3I53 A;  5LGU A;  3L2U A;  3QPT A;  1IN8 A;  1XSX A;  4Y13 A;  5JHF A;  4G6Q A;  1AU7 A;  1ZKG A;  2DOA A;  3P9K A;  4X0G A;  4E6K G;  4A0X A;  3F23 A;  2KIU A;  5BNG A;  1RUO A;  1TT0 A;  2CO5 A;  4K2E A;  4PFP A;  1JGG A;  1D5V A;  1OLT A;  1PUF B;  4PJJ A;  1FY7 A;  2Y48 A;  4XRS A;  1FNN A;  4FX0 A;  3DU6 A;  1TQP A;  1BJZ A;  1YX3 A;  5K7F A;  1BI0 A;  1YOV B;  5F1J A;  3CCL I;  2R7U A;  1AOY A;  1RES A;  3A1Y A;  4ASN A;  2E1M C;  2WAD A;  4L0Z B;  5GAG J;  3LOC A;  3K1P A;  1D3Y A;  1W7P B;  2IA1 A;  1YLF A;  1Z91 A;  2EB7 A;  2F5V A;  2L7M P;  4BJ6 C;  2DMT A;  3CCQ I;  3TDU C;  2CQQ A;  1LDK B;  2QLZ A;  3HL2 A;  5CVI A;  1XMK A;  1T33 A;  4RLF A;  2COB A;  2LFB A;  3LSH A;  4D7N A;  2R4G A;  2W4S A;  4BGD A;  4HDU A;  3BT9 A;  2EFW A;  2RNG A;  4U7B A;  4EVI A;  4MNU A;  1ETV A;  1SD6 A;  2NNN A;  4U7D A;  4BE1 A;  2KZV A;  3BZC A;  2IW5 A;  4BXU A;  3GZ6 A;  4D5C A;  4M3G A;  4MFD A;  3EYY A;  4FCY A;  1QNT A;  2DT6 A;  3RYP A;  4I01 A;  3V42 A;  5B3S H;  4IQJ A;  1B1B A;  2PBI A;  1WWX A;  3HG9 A;  3RZD J;  5EGO B;  4RM2 A;  4Y7N J;  2DTR A;  2X6W A;  2Y9Y A;  1YE9 A;  3H0G J;  3CD6 I;  2AXT C;  3GLL A;  3BJO A;  1ZLK A;  2M9H A;  4A0Y A;  2RQQ A;  2VKH A;  5D8L B;  1LUJ B;  2H6C A;  2XF5 A;  5F1R A;  3H3V K;  2W00 A;  1Q1V A;  4HBL A;  4QSH A;  2L5Q A;  2H09 A;  1SAN A;  2E34 A;  2M2E A;  2LY2 A;  1ZK8 A;  4M6Y A;  2KHM A;  5EEG A;  3WTW C;  1VQK I;  1FC3 A;  2EZH A;  2VJ5 A;  5F04 A;  1V55 H;  3S17 J;  1JGS A;  2HPM A;  4HSR A;  3E7L A;  4ZYA A;  2BXY A;  4B09 A;  5EGO A;  4A5N A;  3MFK A;  2BHZ A;  3GTP J;  4G7H F;  5AON A;  3BR6 A;  3C1D A;  3VOE A;  3BG6 A;  3GO5 A;  4XOR A;  2HXI A;  2NRA C;  1E3P A;  3O6B B;  3BCB A;  2L9V A;  2D45 A;  1T0F A;  3LMM A;  3M8J A;  1LEB A;  4A6E A;  4ESJ A;  1V54 H;  1E3O C;  3K4J A;  1PVE A;  4HLY A;  1MSE C;  3A01 B;  1Q1H A;  2RV8 A;  2D1H A;  4OMY A;  1QQI A;  1Y0N A;  4XSX F;  1D8J A;  1YI2 I;  4CCM A;  4RMN A;  2CYY A;  1QZY A;  2ZME A;  3JRB A;  1Z3X A;  2E5Z A;  3GTL J;  2GXB A;  4XRS G;  5HLH A;  1P92 A;  2LBF B;  3BWG A;  1DDN A;  2IS2 A;  2L0K A;  2OC6 A;  4XRF A;  2HQR A;  1L3L A;  3KYC B;  2HQN A;  1WQ2 A;  3SYT A;  1ZR2 A;  4IEJ A;  1Z9C A;  1Y1V J;  2V1X A;  4BAC A;  3FXU A;  4HF2 A;  1RKT A;  1CF7 A;  4KYW A;  3Q3S A;  3X2Q H;  3DBR B;  3K4L A;  4NQW B;  1NHA A;  2LOO A;  3C18 A;  3FF5 A;  2DOE A;  1WH5 A;  3BG3 A;  5B5E C;  3DEE A;  1U8B A;  3L2Q A;  2Y0S N;  1B72 B;  1WI9 A;  5J4Y A;  1J9I A;  4YII A;  4AUX A;  3HOT A;  1ON2 A;  2ZME C;  3H9Q A;  1LE8 B;  1A5J A;  2VJI A;  4B47 A;  3TO9 A;  3DXJ F;  1IUF A;  4L0Y B;  4A6D A;  2JVG A;  3U9G A;  3MKZ A;  4XBF A;  3H92 A;  4ZTJ A;  3E5U A;  1T95 A;  3KPH A;  4F92 B;  2P6T A;  1FTT A;  4DYQ A;  3NRV A;  3A0B C;  3E0J B;  4G7O F;  2K4J A;  2FU4 A;  4IL6 C;  2DMQ A;  3PNV A;  4UB6 C;  4B4C A;  1JT6 A;  5FKO A;  1YQA A;  4IOC F;  3JRH A;  1ZG1 A;  5GP9 A;  2JMW A;  2WAE A;  1Y39 A;  1S6L A;  4A3L J;  3A01 A;  2LKP A;  2DOF A;  1ZRE A;  3RYR A;  4M71 A;  3JCU C;  4DZP A;  5JLX A;  3BRO A;  2O3F A;  4DBQ A;  4AIJ A;  1WJE A;  2HOT A;  3RDI A;  1UAA A;  3PO2 J;  4Y52 J;  3CC2 I;  2R7O A;  5IPA A;  4Q4Z F;  4HZF A;  3HOY J;  4F91 B;  3BR1 A;  1Z6R A;  3L1P A;  2HI3 A;  2F5E A;  3WTT C;  3QRF F;  3FBI B;  2RKH A;  3AG4 H;  4DJA A;  1X1C A;  1RET A;  2DI3 A;  2JPC A;  2GXG A;  2ZBK A;  3QYF A;  2W48 A;  4Y15 A;  5FO5 A;  1H8A C;  1MZB A;  3G1L A;  3E6M A;  1SVO A;  5DD4 A;  1WJC A;  3QAH A;  2E7W A;  4DOZ A;  4ENJ A;  1F36 A;  3OYB A;  2HQ5 A;  5TGT A;  5HNH A;  3NAU A;  1EJ9 A;  2QWW A;  3OSG A;  5DUI A;  3F0C A;  4ZDL A;  2UWM A;  2ZKZ A;  3CCM I;  4ZTF A;  1ZAO A;  3OYI A;  3OV8 A;  3IAS 2;  4LLG F;  3BR0 A;  4C9Y A;  2JRM A;  2X1E A;  4V2F A;  4A3I J;  2L9N A;  5BS6 A;  3FXR A;  5GPC A;  3FXK A;  2N8G A;  2HDC A;  2EV0 A;  4IVN A;  2K85 A;  1BN5 A;  2VBY A;  2ZFU A;  5HLI A;  2XAF A;  1JKQ C;  3TL4 X;  1KQ9 A;  2OUM A;  4HV5 A;  2EIL H;  4WXC A;  5F6F A;  3G3Z A;  1CF7 B;  3CCY A;  3F3X A;  2DYS H;  2VT2 A;  3NWT A;  1ZQ3 P;  5AIP A;  2IT0 A;  1FX7 A;  1MBJ A;  3GYH X;  1FOK A;  4I0B A;  2HOE A;  1T08 B;  3M8E A;  4L5I A;  3HSE A;  2DQL A;  2ADU A;  5KCM A;  2ELJ A;  3H1C A;  5JI6 A;  3JAM Z;  3I3L A;  4CIC A;  2JPB A;  1LVK A;  3CJT B;  4LB6 B;  3KP2 A;  2GA1 A;  2EV5 A;  3QYE A;  2VI6 A;  4E7L A;  1B4A A;  1H88 C;  3WU2 C;  3ZGK A;  3LFK A;  1S7O A;  3BTI A;  1N77 A;  1QVT A;  3R4K A;  5D4R A;  3OMY A;  4XLH A;  3HZJ A;  3O3K A;  1R1V A;  1MBH A;  3ZMU A;  4I02 A;  4E7Z A;  1MMA A;  1JKP C;  2OQG A;  3TDZ C;  5EJC A;  4BEH A;  3F8F A;  2JA7 J;  5CKT A;  4A3K J;  1QRY A;  2XGE A;  2QCO A;  1OIS A;  4I98 B;  1EA3 A;  5D6F A;  4CUG A;  3DKY A;  1GXP A;  2I5U A;  2VE8 A;  2ID3 A;  2NVX J;  4CO8 A;  4DGW B;  1P4X A;  2TCT A;  5EG0 A;  5J8F A;  3M07 A;  1B8I B;  4B1R A;  2JUC A;  3ZMZ A;  2LRE A;  4GCV A;  2VPL A;  2Y2Z A;  3I5U A;  3HPH A;  3FMQ A;  2FUG 2;  5EDN A;  2DQR A;  2MC3 A;  3K4K A;  1QPM A;  1YHQ I;  4RB2 C;  2XPV A;  5EEH A;  4R79 A;  1K79 A;  1FTZ A;  3HOS A;  2DA2 A;  1HBX G;  3ZOB A;  4Y3O A;  3WE2 A;  2VB6 A;  2VKE A;  2DT7 B;  3R60 A;  2QEX I;  3BCA A;  3OR1 C;  3IC7 A;  1R6R A;  3LSM A;  4DIQ A;  2O03 A;  1IG7 A;  4IO9 F;  1XD7 A;  3S93 A;  4F52 A;  1TLH B;  1TWC J;  4DBR A;  4A3E J;  2IRF G;  1Z6T A;  2R7D A;  4XOP A;  2EV6 A;  2M0M A;  2IS1 A;  2K9M A;  3CES A;  3ZR8 X;  2V6E A;  4LB5 A;  5LFA A;  4A3F J;  2BEO A;  2H1K A;  1BL0 A;  2PEX A;  2VBX A;  1ORK A;  2L9S A;  5HS9 A;  2CFO A;  3IAM 2;  4E7J A;  5ILS A;  3Q9S A;  3D0S A;  3CP8 A;  3GTO J;  2EIK H;  3KIO A;  1OKR A;  2YU9 J;  2PMU A;  2HYG D;  3MAJ A;  3AG3 H;  4E7S A;  4XON A;  2MLG A;  3CC4 I;  4MLO A;  3S1Q J;  1IZ1 A;  4UUT A;  5EYR A;  2GIV A;  3H5R A;  1SFU A;  1O7L A;  1G8X A;  1YX5 A;  3BPV A;  4HF1 A;  1KQ0 A;  2MD5 A;  2EIJ H;  5J40 A;  4OIN F;  3NQO A;  2CGP A;  2Z3Y A;  4AVZ A;  1TWG J;  5E1X A;  1W7P D;  1Z3Y A;  1J59 A;  2E36 A;  3F21 A;  2HYJ A;  1X3U A;  4JOM A;  4DQ2 A;  2FRH A;  4NHJ A;  3KCC A;  2VOO A;  1ETY A;  2YR2 A;  3QOE A;  2CUZ A;  3V7R A;  5FD6 A;  4ABZ A;  3PFI A;  2IVM A;  2DMP A;  4A2U A;  1MGT A;  2ZCW A;  1WPK A;  1O3Q A;  2R7F A;  1REP C;  4EJU A;  2B63 J;  4N4N B;  3FMS A;  1SAX A;  3S3M A;  3BG7 A;  1D0X A;  2FBH A;  2XC7 A;  2K7L A;  3AFH A;  3M9A A;  1WJB A;  2GXA A;  3W2W A;  4XKC A;  2CV1 A;  4U0Y A;  1SAU A;  4OIQ F;  4Y17 A;  1FEX A;  2BVM A;  5KAI C;  3PNY A;  4PFO A;  1BOB A;  4C3I J;  4KNY A;  5FRM A;  4HQE A;  3GUD A;  1YJW I;  1D1C A;  2VOP A;  4II2 A;  4UVB A;  2C6Y A;  2QSH X;  4PSW A;  3GTJ J;  4KIF A;  1VQ6 I;  4ZYD A;  2QSF X;  4Q48 A;  5LHI A;  2PQ8 A;  1T6S A;  1V5E A;  1XCV A;  1ZRC A;  3VDX A;  1DP3 A;  3ZRG A;  1E0E A;  3BPX A;  1IV8 A;  3E6C C;  5H2F C;  1A31 A;  1TQM A;  4KA4 A;  1HOM A;  4XN0 A;  1LKX A;  4I2O A;  5EZH A;  3D5L A;  2EIM H;  3LA2 A;  3FDY A;  1D0Z A;  1HKS A;  2FD5 A;  3T1B A;  2B7E A;  1FOW A;  2LY9 A;  2IS4 A;  1OCZ H;  2KJB A;  4YIR X;  1GVD A;  3MVP A;  1R36 A;  1J7K A;  4MIM A;  4XQF A;  2HDW A;  1LB2 A;  4KN4 X;  2DJI A;  4GGG A;  1XTA A;  3FHN A;  1OR7 A;  1ZYR F;  1TZL A;  3F22 A;  5CQG A;  2A5W A;  2BZT A;  2M7A A;  3HGG A;  1G4D A;  1Z7U A;  3ABK H;  3IUO A;  5DCM A;  1YTY A;  1LFU P;  2QA4 I;  5K5R A;  2KQR A;  2ZSH B;  2DLL A;  1UZC A;  2KPM A;  3DFG A;  3DV8 A;  4HV6 A;  2Q1Z B;  2FOW A;  1RIO H;  2ELK A;  1FSE A;  1MDM A;  2L9R A;  2DU9 A;  2FMY A;  5JR3 A;  1APL C;  4OAZ A;  2VXD A;  2XKO A;  1ONV A;  2HQA A;  3J7Z I;  1T38 A;  2CUE A;  1N25 A;  4Y4R A;  3ZQQ A;  5HDN A;  4Q47 A;  1C0W A;  3JRD A;  1L0O C;  1OYW A;  5D5X B;  3GLX A;  2RRE A;  5DYM A;  1DP7 P;  1OCO H;  2J5P A;  2UZK A;  4F3Q A;  1XMA A;  2QBY B;  5FLV A;  2DMN A;  1T2K A;  3CQZ J;  2QF7 A;  1WVR A;  1F9N A;  4MTE A;  5HNF A;  1VND A;  5F08 A;  3OL4 A;  1S8N A;  1WJ5 A;  2V79 A;  1MDM B;  3G2B A;  2Y0M A;  4C3H J;  1W36 C;  3S16 J;  1LQ1 A;  5LGT A;  1NG7 A;  1WRJ A;  2E60 A;  1LDD A;  2IAI A;  3SFI A;  1SC7 A;  1QBJ A;  3S8P A;  3HEF A;  4EM1 A;  4FQG A;  4KJZ A;  1X4O A;  4EV0 A;  2A5Y B;  1E2X A;  2TDX A;  2STT A;  3CMA I;  1HC8 A;  1HQC A;  3GFJ A;  1W5C C;  4PJM A;  5BOX A;  3EUH C;  3V8L A;  4IHY A;  1IN4 A;  3HXL A;  1B8I A;  1VTN C;  1HST A;  1W36 D;  2IS6 A;  3V8K A;  3E3V A;  1D8K A;  2EZK A;  3J81 K;  3GTK J;  2IA2 A;  2HVS A;  2FX0 A;  4RB3 C;  3TP0 A;  1UST A;  1A6Q A;  2PJR B;  1QHH D;  2W84 A;  5E3L A;  3ZP5 A;  4FTH A;  3WE3 A;  3BC8 A;  2B9S A;  3A2K A;  2LRD A;  1H0M A;  3L2R A;  3IKT A;  3I59 A;  2Y30 A;  3HGY A;  3ZQL A;  2FSW A;  2VQG A;  2R0Q C;  4LK0 F;  4BNC A;  1GLN A;  1W4M A;  5HOO A;  3G6E I;  3HOZ J;  3K70 C;  3FBN B;  1JTX A;  4MHG A;  4EGZ A;  5K7H A;  5KHD A;  1D1B A;  3FZV A;  5FRN A;  1V5G A;  1P7I A;  1G3Y A;  1ZHF A;  3HM5 A;  2R7T A;  2DA7 A;  3OOU A;  3SQN A;  2JK3 A;  2IGK A;  2HDD A;  4E7H A;  4CCK A;  5IY5 H;  3KEQ A;  2X85 A;  4HST A;  3REO A;  4A5M A;  2GWR A;  3DLA A;  3K1N A;  4HNT A;  2E2H J;  1ACI A;  5J8C A;  1FYM A;  4BHP A;  1I27 A;  4GDF A;  1TWF J;  2DK5 A;  2H8W A;  3SDG A;  1ZG5 A;  1SD5 A;  2VKV A;  4WXD A;  2JUG A;  1WJA A;  3FIS A;  3GW2 A;  4YFN F;  2JSC A;  3TO6 A;  2FEZ A;  4KIC A;  1OYY A;  2WV1 A;  5FFZ A;  1UHM A;  2X6Y A;  2KIS A;  2M5W A;  3ERM A;  1AWC A;  2GA2 A;  4P96 A;  2NS8 A;  1ZTR A;  2LMD A;  3GFL A;  4NC6 A;  2G0E A;  2K5C A;  3HUG B;  4D5F A;  4XK4 A;  2KT0 A;  5E8G A;  3ZMT A;  3MKY B;  3DPL C;  2IBD A;  2EK5 A;  2LR8 A;  4BXF A;  1I6X A;  2R5Z A;  1D0Y A;  1WI3 A;  2ME6 A;  4CXF A;  1GV5 A;  1R7J A;  3CO6 C;  4OMZ A;  2LBF A;  4M6X A;  2L7F P;  2OZ6 A;  2A3S A;  3I71 A;  5IT3 A;  1BR2 A;  3CUO A;  2AQF A;  1MJB A;  5DV5 A;  1USS A;  1HKT A;  4S0H B;  2ZO4 A;  2Y69 H;  4GXO A;  5FKM A;  4EJV A;  3QPL A;  4A3C J;  2WY8 Q;  4FIS A;  1PJR A;  5FGM A;  1RRJ A;  1TL8 A;  4A3D J;  5KNL A;  5IYD J;  4IRH A;  5J1Y A;  2P6S A;  3DBH B;  3ZQ7 A;  3MZY A;  1IJW C;  1PUE E;  1MD0 A;  3FM3 A;  1MMD A;  1R5G A;  4M73 A;  3A03 A;  1SD4 A;  1I1G A;  1KU9 A;  3CZ6 A;  3H5A A;  3LQQ A;  3AG1 H;  5E79 C;  4XLE A;  5CVR A;  3ESW B;  3C2B A;  5JHU A;  2Q8K A;  5M5X J;  3CTA A;  4I99 C;  4XSZ F;  3ZMD A;  5GTI C;  1W0U A;  1NK3 P;  1W5S A;  2MA3 A;  1JE8 A;  2LNB A;  5IT9 Z;  2KIM A;  2EBI A;  1EF4 A;  2NS7 A;  3F6V A;  1HW2 A;  2MGQ A;  2E5N A;  3I4P A;  1J75 A;  3L2V A;  3ZQI A;  2Y9Z A;  5IP9 J;  4J00 A;  2JVH A;  2Y31 A;  1GT0 C;  3OS0 A;  4WX9 A;  1ETW A;  1UCR A;  2PI0 A;  1MH3 A;  2AHQ A;  2EWN A;  2CUF A;  2RAE A;  3IH2 A;  4JX5 A;  4ON0 A;  5DM7 F;  2EH3 A;  1R49 A;  1IC8 A;  2L54 A;  3OIP A;  5BPD A;  2X0L A;  5L3G A;  5BPI A;  2QBY A;  2QKL B;  2BGC A;  3ZQF A;  3B73 A;  2EZI A;  2WA0 A;  1XDS A;  1W7P A;  3KYL A;  3EDP A;  3CMM A;  2Y75 A;  2X9D A;  4RB1 A;  2Z9O A;  3S2H J;  2K27 A;  4ANJ A;  3ROU A;  4YEJ A;  3ZN1 A;  3KZZ A;  4FE7 A;  4BUP A;  3ZQC A;  4WWC A;  2DFE A;  1N75 A;  1XDU A;  2GBY A;  2V9K A;  3HRS A;  3S1M J;  3B6A A;  2GM4 A;  3UR3 C;  2CQ7 A;  3DWL E;  2HR3 A;  3COA C;  1VZ0 A;  1RPW A;  2MH9 A;  4PSX A;  3CME I;  1VQL I;  2OAZ A;  1X19 A;  4ESF A;  2L7K A;  1GHC A;  1EH8 A;  3AL0 B;  1ZN2 A;  3M7G A;  2VXZ A;  4G7Z F;  2M4G A;  2NVU B;  5E3O A;  5DD8 A;  5CQE A;  2JWT A;  2FQ3 A;  4GRI A;  1OPC A;  5L3D A;  1X1D A;  1E3H A;  5JVT A;  2XAU A;  4LG0 A;  3WOD F;  2XGC A;  2KFD A;  4AWX B;  2M0C A;  4Z6Y A;  1TC3 C;  3GWZ A;  4NB5 A;  4BJT A;  2VT3 A;  3TP3 A;  4ZYG A;  3L2C A;  3CF2 A;  3DEW A;  2VC1 A;  2E1N A;  3PO3 J;  1I5Z A;  1UHW A;  2OU2 A;  1ULY A;  1SMT A;  2KKO A;  1NTC A;  4GYI A;  5HS7 A;  4CHU A;  2D1V A;  2VE9 A;  4AID A;  2QM3 A;  1FT9 A;  4L5E A;  1LEA A;  3OR2 C;  3RTR A;  3CUQ B;  5FB2 A;  3H36 A;  5L3C A;  1O4X A;  4I7H A;  3K2A A;  2MFZ A;  2E2I J;  1IO2 A;  3F8N A;  1RC9 A;  4YRV A;  3OYJ A;  1K4S A;  3G73 A;  2HFH A;  4JP0 A;  2FJ1 A;  1F1Z A;  1FBU A;  3BZK A;  3M8F A;  5DDG A;  4A69 C;  2DBB A;  4ZC3 A;  4LG3 A;  1OCC H;  4ENN A;  4ENK A;  3GME A;  1AHD P;  2PX9 A;  3ZPL A;  3ABT A;  3EUH A;  1KQ8 A;  2CW7 A;  5LBQ A;  3K0L A;  4D1Q A;  2KRC A;  3K4M A;  4LLL A;  2KRF A;  1RKW A;  2IGO A;  4A93 J;  3SJM A;  5AIQ A;  3M1C A;  4X6A J;  2KIQ A;  4ZZL A;  2V9P A;  1U5T C;  6PAX A;  4HF0 A;  1SD7 A;  1X1B A;  2WY7 Q;  3PIO F;  3JTH A;  4D9J A;  3G4S I;  1ZRD A;  4IPA A;  2NS0 A;  1R22 A;  2M8G X;  1MMG A;  3DEU A;  3R0J A;  1O3S A;  3CUQ A;  1JUS A;  2QUF A;  2ZSI B;  2VBZ A;  3H9J A;  5ILU A;  4UY8 I;  1BI1 A;  2RDP A;  5GPA A;  3WTU C;  1XG1 A;  2Z99 A;  5CYV A;  3WHB A;  1KGS A;  3C2H A;  4NC7 A;  3S15 J;  5C44 J;  3BLY A;  1SFO J;  3BDD A;  4BY1 J;  2CS3 A;  1WH7 A;  3ELK A;  4CA0 A;  1KYZ A;  4QPO A;  2QGU A;  1S29 A;  2VJ4 A;  5DUK A;  2R7W A;  4AYB N;  1Y56 A;  1W0T A;  2A6H F;  2CUJ A;  4I09 A;  1TWH J;  1STZ A;  3TBI A;  3ZMS A;  2JSP A;  1MMS A;  1LPQ A;  3V7C A;  2R7V A;  2HKX A;  4KN7 X;  5LRR A;  4O6J A;  1OYI A;  3W6J B;  4UNO A;  2QQA A;  2IA0 A;  3CUQ C;  2CQK A;  2FBI A;  3PUB A;  3RKX A;  4RS8 A;  1XGN A;  4EJW A;  4BYY A;  3G71 I;  2AO9 A;  3OS2 A;  5IOY A;  1K61 A;  2VQL A;  1G3W A;  2H94 A;  4GYG A;  3JRA A;  2I8D A;  3BJ6 A;  4PJL A;  4CDG A;  3S32 A;  4HLX A;  3FXM A;  2VOD A;  3I4N J;  2M45 A;  1KU2 A;  1MIJ A;  4RDU A;  2Z5U A;  3ZXS A;  3CDH A;  5C4X J;  4BE0 A;  4LLN A;  3GVA A;  2XSD C;  3J7A O;  5A2Q K;  3DKW A;  4U87 A;  2QQB A;  1LFP A;  1OJL A;  1QZZ A;  1YS6 A;  4MEX F;  5J47 A;  3OIQ A;  2KL4 A;  4AIH A;  3KLO A;  2IGM A;  3PSF A;  2JZY A;  2OPT A;  1IXC A;  2FNP A;  3L7W A;  4M72 A;  3SZG A;  3SZT A;  4ZJZ A;  3SHF A;  1JTY A;  2OBP A;  5M5Y J;  4IZZ A;  2EPF A;  5K7Z A;  4XKB A;  1IXR C;  4BAY A;  1IV6 A;  3EYI A;  3SZP A;  3VWB A;  1BM9 A;  1XX5 A;  4XLA A;  2XAG A;  2HYF A;  1DU6 A;  2OA4 A;  3VYR B;  2P5L C;  2R92 J;  4P9F A;  1XC5 A;  3DPT A;  2NVY J;  4IOA F;  4XLN F;  2L02 A;  2L01 A;  3QYB A;  1VQ7 I;  4QTR A;  2LLK A;  4BHC A;  1YYV A;  3DQV C;  4YFK F;  3NAR A;  5FLX K;  3PFY A;  1XB4 A;  4L5J A;  2NVT J;  3JRF A;  2CV0 A;  2EA4 A;  1U5T A;  5LGN A;  4IHT A;  2P7C B;  1JT0 A;  2ELH A;  2P0W A;  5HDG A;  4LJZ F;  1Z77 A;  2W7N A;  2F5C A;  1K7A A;  1U9O A;  3PJR A;  3HOW J;  4XOT A;  1FJL A;  5ICF A;  4BBS J;  1TNS A;  1UEL B;  2ESN A;  3JW4 A;  2YUS A;  4B44 A;  2EQR A;  4ETS A;  3UKG A;  5GAH J;  4KMU X;  1YJ9 I;  3HBL A;  1XS9 A;  5H6R A;  1QPI A;  4MTD A;  3RKW A;  2NOJ B;  2V7F A;  5M3F J;  1I3Q J;  3H0D A;  2RVC A;  4C2U A;  1FMV A;  2OV7 A;  2P81 A;  3DTE A;  3VSK A;  3E6B A;  5F27 A;  4CH7 A;  3JRG A;  2KLO A;  1U0J A;  2XDV A;  5C3E J;  3WGI A;  3FM5 A;  2X1C A;  1YRN B;  2Z33 A;  4OIR F;  1P4W A;  3ASO H;  4S04 A;  2O5R A;  1OMI A;  2MC4 A;  1U6G A;  2BVL A;  2TRT A;  1S7A A;  2EZL A;  4M9Z A;  1F43 A;  4I0A A;  2BV6 A;  2KIF A;  3DF8 A;  1EV7 A;  4L9J A;  3LSG A;  4XLP F;  2CQX A;  2WB1 A;  3E97 A;  1X1P A;  2YX4 A;  2EFO A;  1UG2 A;  2OQR A;  1JJ8 C;  4L9T A;  3H3Z A;  4PJ0 C;  2P5V A;  1U9N A;  2WAQ A;  1X3Z B;  2CFX A;  3PM1 A;  4GO1 A;  2PFB A;  5CVV A;  2YS9 A;  3QU6 A;  5CVU A;  2A07 F;  3M4O J;  2XAJ A;  2X4H A;  4NQW A;  4S05 A;  2DCE A;  4G12 A;  3GTQ J;  1O57 A;  3L9F A;  1ZLJ A;  1V3F A;  1HXD A;  3JSP A;  2JQ7 A;  1OQY A;  1ENH A;  4NBQ A;  2V4J C;  4BS9 A;  5E18 F;  1X3W B;  2E19 A;  1V4R A;  5FKN A;  2FA5 A;  1DGR M;  1MH4 A;  3MMY B;  5LHH A;  2DK8 A;  2VN2 A;  2CRG A;  4FE4 A;  1BR4 A;  4UV9 A;  1FYL A;  2KMU A;  4UUV A;  3J80 K;  4NC8 A;  1CGP A;  3R61 A;  1Z21 A;  1HF0 A;  1FZP B;  1FOY A;  4RGS A;  1MNE A;  2XB5 A;  3TW7 A;  1Z7L A;  2JN6 A;  4BXX J;  3DKX A;  4XKV A;  3K70 D;  2R7X A;  3KP6 A;  3KYD B;  1TW2 A;  3BR3 A;  4QPQ A;  4BHB A;  3GEZ A;  1G6N A;  3I59 B;  3T8R A;  2QQ9 A;  5L3B A;  2ISZ A;  3J80 Z;  1GUU A;  1FP2 A;  4V2G A;  5D6E A;  5CVJ A;  5HOD A;  1VQ8 I;  1VQO I;  2VAS A;  3K4N A;  1JXS A;  4EM0 B;  3LAP A;  1X2N A;  2Q2E A;  2ID6 A;  3SDB A;  3TGN A;  5K5O A;  2BOL A;  4H0E A;  2DTZ A;  3GFM A;  4JK1 X;  3DP7 A;  5DEQ A;  2DT5 A;  5B1B H;  3OOP A;  2KDO A;  5TIS C;  4BL0 B;  3E5X A;  1FIA A;  3OYM A;  2M8E A;  1MKM A;  1J2X A;  4ITV A;  5LEK A;  1JUM A;  2WC2 A;  3CO7 C;  4XID A;  3VYU B;  2D5V A;  3GX4 X;  3HOV J;  3VFZ A;  5F64 A;  1K78 B;  4M74 A;  4HNU A;  3P9I A;  3ZN0 A;  1U5T B;  1HLV A;  1KA8 A;  1E17 A;  2LKX A;  3ABL H;  2DA1 A;  2Y0S A;  2DFH A;  2W25 A;  2KDZ A;  1FYK A;  3FXO A;  4EJT A;  4G94 A;  1O3T A;  2Q2E B;  2UV1 A;  5JLW A;  1ZGW A;  3GBG A;  5EF6 A;  3I64 A;  1H89 C;  4A3G J;  3QOD A;  5E20 A;  4UUS A;  1J09 A;  1A35 A;  1TTY A;  2BBY A;  2NXN B;  3JAM K;  3KZI C;  1CQT A;  2P5K A;  4C30 A;  1A04 A;  2ECB A;  3KP7 A;  4LG0 B;  1R4M B;  4IHV A;  2HOS A;  2OCE A;  4D0P A;  3JR9 A;  1R9T J;  2CW0 F;  3B6C A;  2VON A;  1MMN A;  3RPU A;  4IHW A;  2W57 A;  2XVC A;  2XKP A;  3RSN A;  3LSI A;  5H20 A;  5ICE A;  3LSK A;  1R00 A;  5KK1 A;  4A3B J;  1MBF A;  3J81 Z;  2A6E F;  1YW8 A;  3HRM A;  4RAF A;  2CMP A;  2MSY A;  5FD5 A;  4RLQ A;  5E17 F;  2DDA A;  4FHT A;  4CCN A;  2BE5 F;  1DUX C;  2K9Q A;  3KP3 A;  3BR2 A;  3KX2 A;  4H4K C;  3WG9 A;  1WGX A;  2IEK A;  4XMY A;  4HRI A;  1MBG A;  2F4M B;  3WU1 B;  3WTZ A;  1VQ4 I;  1UMQ A;  3RIR A;  1G3T A;  3OSF A;  3BTJ A;  4MGR A;  3DTK A;  4UVC A;  1UJ8 A;  5HDK A;  1ZGA A;  1MNM C;  3CJN A;  1KU7 A;  2VQH A;  3ABU A;  1JJ6 C;  1WHU A;  3LNQ A;  3WGH A;  3S1R J;  4A12 A;  4QWQ A;  1VQM I;  4IKF A;  4D7M A;  1U78 A;  3WTS C;  3HHH A;  4M3B A;  1Y8Q B;  2F4I A;  2YSR A;  1P9Q C;  2OTJ I;  4KMF A;  2X48 A;  2MLK A;  4OAY A;  3CCE I;  2NYX A;  1LFB A;  3V4G A;  4YEL A;  1ODD A;  4P5O A;  3IL2 A;  1S5L C;  1WZ2 A;  1P2F A;  1QVU A;  2IPQ X;  3U21 A;  1DPU A;  5DS9 A;  5D5U B;  3K69 A;  2MH2 A;  4EAT A;  3AKZ A;  1KU3 A;  1TQI A;  2VJJ A;  4LOC A;  3PSI A;  5FKL A;  4HAM A;  2UXN A;  1FBQ A;  3FXQ A;  5IYC J;  1JKR C;  3AG2 H;  4EGY A;  3IRQ A;  3VEP A;  2AS5 F;  1B59 A;  3N05 A;  1M1E B;  2ZB9 A;  4PUS A;  2M30 A;  1VFC A;  1HDD C;  4RM3 A;  3RPQ A;  4B3A A;  1XGO A;  4LFU A;  3CCU I;  1ERD A;  2HTJ A;  2R7R A;  2VBW A;  1T8I A;  4NUB A;  1ETO A;  3HRT A;  2PJR A;  3T8T A;  3IKV A;  5D4S A;  1MJA A;  3N97 A;  2XV4 S;  3K7A J;  4N0B A;  4E7I A;  2R93 J;  2XAS A;  3MCZ A;  3T5X A;  4YIF A;  1HSJ A;  2FF4 A;  1RR8 C;  5D5W B;  5LHG A;  1RUN A;  3MKL A;  5GTH C;  1YFH A;  2QYO A;  1YO5 C;  2EFP A;  1Z1D A;  1XCB A;  2J5O A;  1BI2 A;  2ME0 A;  1WJD A;  2LK2 A;  1Z05 A;  4AD9 A;  3MN2 A;  4RGX A;  5L3F A;  4HDV A;  4Q5S F;  4KIG A;  2XRO A;  5H6Q A;  3V8J A;  2GQQ A;  1R5H A;  2R5Y B;  2F5F A;  2PMZ N;  3HSR A;  1KYW A;  1X58 A;  2L7Z A;  4EQQ A;  2MD0 A;  2R7Z J;  4BH9 A;  2O0Y A;  1GVJ A;  4L9V A;  1VQN I;  4UVA A;  3GCM A;  1YW9 A;  2NOG A;  3I55 I;  4II3 A;  3JRE A;  3WTX C;  3DBL B;  1ITY A;  4IQ4 A;  1ON1 A;  4AYB A;  2XPU A;  2ZXW H;  3L09 A;  5FLM J;  5IT9 K;  4OIO F;  1UG0 A;  5BMZ A;  2BHY A;  2OF7 A;  2X1D A;  3IH3 A;  2JRT A;  1XN7 A;  2HWV A;  2M3A A;  1MJ9 A;  1K6Y A;  3ASN H;  1QHG A;  2HTS A;  1IAW A;  1IDY A;  3J7A Y;  3W2A A;  4I6Z A;  4XR6 A;  9ANT A;  3S3O A;  3DPU A;  4BDY A;  1ZAR A;  5IOZ A;  4ZYH A;  5B1A H;  4TV7 A;  3NWS A;  1NG6 A;  2MAB A;  3HHG A;  2X51 A;  4ENM A;  4FT8 A;  2R7S A;  4IX7 A;  2B0L A;  2LH9 A;  4KUM A;  1IN7 A;  2V1N A;  1FSH A;  3MD2 A;  4EM2 A;  4MO7 A;  1B9M A;  2OCC H;  4BQO A;  3RI4 A;  1OCT C;  2D2W A;  3BY6 A;  3GF2 A;  1W5T A;  5J1R A;  2L2O A;  2ZJR F;  2EFN A;  2L4A A;  3FHZ A;  2CJJ A;  1ZEL A;  2X6X A;  3QU3 A;  1LDJ A;  2FQ4 A;  3OYK A;  3F6O A;  3BQZ A;  5GAE J;  1T56 A;  3A0H C;  3CF5 F;  4LIU A;  4XLC A;  2VPR A;  1YS7 A;  2FE3 A;  3M1E A;  1T98 A;  2DDB A;  2OZU A;  1ETQ A;  3RJP A;  3CDL A;  3FXL A;  3O8G A; 
#chains in the Genus database with same CATH homology
 1XGM A;  1BJA A;  5TJJ A;  3WTV C;  2XIG A;  3C3W A;  4O5V A;  4UXN A;  2LDU A;  5LRS A;  4LK1 F;  2CG4 A;  1F5T A;  2FBK A;  1G3S A;  2DO7 A;  2KJC A;  2MBF A;  3KET A;  5FFX A;  2GAU A;  3F72 A;  1B9N A;  5E1Z B;  3F8M A;  3GXO A;  4N9I A;  2ZME B;  1TNT A;  4ZYE A;  1LNW A;  1TW3 A;  2HZT A;  1ZH5 A;  4HX7 A;  3GZ5 A;  3KEO A;  1F4K A;  1PDN C;  2RN7 A;  4U0V A;  1LJ9 A;  5TRD A;  1U2W A;  2ACJ A;  2PN6 A;  4M9S A;  4HW0 A;  3IWF A;  3MEX A;  5L3E A;  4CGZ A;  2F2E A;  3ECH A;  3IRR A;  4AVP A;  1XSD A;  2M1B A;  2EA2 A;  3R0A A;  2YU3 A;  3W6K B;  1HW5 A;  2P4W A;  3BZ6 A;  2DFI A;  1O3R A;  1S3J A;  3Q9V A;  3ISP A;  2ZFW A;  4KT5 C;  1U8R A;  4UV8 A;  2DW4 A;  3HIF A;  2QVO A;  3IHU A;  4WCG A;  2FML A;  5D5V B;  2OD5 A;  2NAZ A;  1H9T A;  3K2Z A;  1FBS A;  1EH6 A;  4IRG A;  1EH7 A;  4MEY F;  2IP2 A;  4IHS A;  4RB0 A;  3LAJ A;  3FWE A;  5HVQ C;  3ERE D;  4R8H A;  1P6R A;  4FX4 A;  1U3E M;  1DPR A;  4U88 A;  1BC7 C;  2H6B A;  2RQP A;  3HRU A;  4ZZD A;  2K86 A;  4IXA A;  1IN5 A;  2YX7 A;  3KP5 A;  2R3S A;  3JSO A;  4OOI A;  1K6O A;  2BYV E;  1J0R A;  4L18 B;  3T0Y A;  4RGR A;  2LSO A;  4IJA A;  1FPQ A;  2COM A;  4WXH A;  5FLX Z;  3TO7 A;  4HX4 A;  1SMY F;  1GXQ A;  4DNC A;  5DCF A;  1IW7 F;  3MWM A;  4G8X A;  3JTG A;  1FWZ A;  3F8B A;  2PLY A;  3I58 A;  4JBA A;  4CZZ A;  4Z2Y A;  2O8X A;  2XRN A;  2E7X A;  2FOK A;  3BJA A;  2DPD A;  1IF1 A;  4OIP F;  3B02 A;  1JHH A;  3QP5 A;  3WGG A;  1K78 A;  2RNJ A;  3HYI A;  4U0W A;  1H9G A;  3U2R A;  4KFC A;  4WK8 F;  3VB2 A;  5HS8 A;  3N4M A;  2XAQ A;  2QZ8 A;  4PDK A;  5JFR A;  2H27 A;  3RKY A;  3Q5F A;  2O61 A;  3BOQ A;  4MQ9 F;  4PGH A;  1RI7 A;  3WTY C;  2O6G E;  2XAH A;  1QGP A;  2L3D A;  2PG4 A;  3VOD A;  3I54 A;  1WSU A;  2HS5 A;  1J5Y A;  4KIB A;  1HKQ A;  1BC8 C;  1YG2 A;  4AIK A;  3BP8 A;  4HX8 A;  2K4B A;  3LST A;  3QP6 A;  4LMY A;  3ULQ B;  2LF7 A;  2ZNZ A;  4JQF A;  5DCM B;  2A68 F;  5HLG A;  3LWF A;  2STW A;  3LA3 A;  1IRF A;  2NNY A;  5BMZ A;  1YIO A;  2XHK A;  4RGU A;  1LVA A;  2RC4 A;  2JT1 A;  3PQK A;  3CLO A;  2ISY A;  1O7F A;  2ZXJ A;  3TKY A;  4B8X A;  1XSV A;  2UXX A;  3KZY A;  2EJR A;  5LLQ A;  3KE2 A;  4UHT A;  3H3U A;  5ICG A;  1B6A A;  5K5Q A;  1SFE A;  4EJO A;  1PP7 U;  1ZG3 A;  3GFI A;  1UFM A;  2ETH A;  2GZW A;  4O3M A;  2HKO A;  2IJL A;  4HA8 A;  2G7U A;  3KFW X;  3QPH A;  4F7Z A;  1YW7 A;  2ESH A;  1PP8 F;  4N9H A;  2JTV A;  1TBX A;  2ZJ2 A;  4HOB A;  1ZGJ A;  2G7H A;  2A69 F;  3P7N A;  4HYE A;  3HUG A;  5CJ9 A;  3ML6 A;  4LGW A;  4MQV A;  1SFX A;  2PJP A;  3V7S A;  2XGX A;  5ED4 A;  3TOA A;  4YG2 F;  3HTS B;  1BBY A;  2HGC A;  3K9T A;  1BI3 A;  3S2W A;  3SXY A;  3ECO A;  2WWY A;  3SFZ A;  3LQR A;  4PGG A;  1QO0 D;  3F8C A;  2F5D A;  2RGV A;  2P7V B;  4KDP A;  2VC0 A;  5ICC A;  2DPU A;  2XUB A;  4G9Y A;  3L00 A;  2WV0 A;  4PCQ A;  2A61 A;  4P55 A;  5J6X A;  1I1S A;  3C7J A;  2E1C A;  2DAO A;  5CLS A;  1BOA A;  3NEU A;  3IWZ A;  2W85 A;  3TQN A;  5BQT A;  2V1U A;  1BIA A;  4R1H A;  4RAZ A;  4WF2 A;  1ZRF A;  3KLN A;  5D8K B;  1RZ4 A;  2V9V A;  3LA7 A;  3I0T A;  1IUY A;  2V1D A;  3E5Q A;  2G9W A;  2FXA A;  3HSF A;  4ZH4 F;  3EQL F;  3E6D A;  5KVR A;  1FP1 D;  1JHF A;  3O2P E;  4EMS A;  5ERI A;  1R23 A;  1HW1 A;  2M87 A;  2WTE A;  2ZNY A;  2YPR A;  2QEN A;  3ZMV A;  4QLC U;  5ILV A;  5A2Q Z;  1P4A A;  1R1T A;  4OU0 A;  2FNA A;  4HQM A;  2PMH A;  1BIB A;  2Q0O A;  4L9N A;  4LD5 A;  1RNL A;  3HTU A;  4P9U A;  2L4M A;  3TOB A;  4E70 A;  2LF8 A;  2HEO A;  3MZH A;  3QOP A;  1XGS A;  4ESB A;  4IF4 A;  1T39 A;  3KP4 A;  2P8T A;  1Y0U A;  2CWE A;  3P9C A;  4PZJ A;  2AXL A;  5E1W A;  3AAF A;  3R6S A;  1R1U A;  3FMR A;  3K1M A;  3EET A;  3WU0 A;  2CSO A;  4M9X A;  4RAY A;  2V6C A;  4BQA A;  2W24 A;  3MQ0 A;  3PQJ A;  1UB9 A;  4IRI A;  5LEJ A;  4YFX F;  1FLI A;  5E8I A;  1R58 A;  2K02 A;  1IN6 A;  4A0Z A;  5K1Y A;  1WKM A;  2EFQ A;  1IXS B;  3U1D A;  4G6D A;  4CYD A;  3FX3 A;  3I53 A;  5LGU A;  3QPT A;  1IN8 A;  1XSX A;  4Y13 A;  4G6Q A;  3P9K A;  3F23 A;  4A0X A;  2KIU A;  1RUO A;  2CO5 A;  4K2E A;  1D5V A;  1FY7 A;  2Y48 A;  1FNN A;  4FX0 A;  1TQP A;  1BI0 A;  1AOY A;  4ASN A;  4L0Z B;  3K1P A;  1D3Y A;  1W7P B;  2IA1 A;  1YLF A;  1Z91 A;  2EB7 A;  3TDU C;  1LDK B;  2QLZ A;  5CVI A;  1XMK A;  4HDU A;  2EFW A;  4U7B A;  4EVI A;  4MNU A;  1SD6 A;  2NNN A;  4U7D A;  2IW5 A;  4BXU A;  3GZ6 A;  3EYY A;  1QNT A;  3RYP A;  4I01 A;  1B1B A;  2PBI A;  1WWX A;  2DTR A;  3BJO A;  1ZLK A;  4A0Y A;  5D8L B;  2H6C A;  5F1R A;  4HBL A;  2H09 A;  4M6Y A;  5EEG A;  3WTW C;  1FC3 A;  1JGS A;  4B09 A;  3MFK A;  4A5N A;  4G7H F;  5AON A;  3C1D A;  3VOE A;  3GO5 A;  2NRA C;  3O6B B;  2D45 A;  1T0F A;  1LEB A;  4A6E A;  4ESJ A;  4HLY A;  1Q1H A;  2RV8 A;  2D1H A;  4OMY A;  1QQI A;  4XSX F;  1D8J A;  2CYY A;  1QZY A;  2ZME A;  2GXB A;  5HLH A;  1P92 A;  3BWG A;  1DDN A;  4XRF A;  2HQR A;  1L3L A;  2HQN A;  1WQ2 A;  1Z9C A;  2V1X A;  3FXU A;  4HF2 A;  1CF7 A;  4KYW A;  1NHA A;  3C18 A;  3FF5 A;  1WI9 A;  1J9I A;  4YII A;  3HOT A;  1ON2 A;  3TO9 A;  3DXJ F;  4L0Y B;  4A6D A;  3U9G A;  4XBF A;  3H92 A;  3E5U A;  2P6T A;  3NRV A;  4G7O F;  2K4J A;  2FU4 A;  1YQA A;  1ZG1 A;  1S6L A;  2LKP A;  1ZRE A;  3RYR A;  4M71 A;  3BRO A;  2O3F A;  4AIJ A;  3RDI A;  4Q4Z F;  4HZF A;  1Z6R A;  2F5E A;  3WTT C;  3QRF F;  2RKH A;  2JPC A;  2DI3 A;  2GXG A;  2ZBK A;  4Y15 A;  5FO5 A;  1MZB A;  3E6M A;  5DD4 A;  3QAH A;  2E7W A;  4ENJ A;  2QWW A;  5DUI A;  2UWM A;  2ZKZ A;  1ZAO A;  3OV8 A;  4LLG F;  5BS6 A;  3FXR A;  2HDC A;  2EV0 A;  4IVN A;  1BN5 A;  2VBY A;  5HLI A;  2XAF A;  1KQ9 A;  4HV5 A;  4WXC A;  5F6F A;  3G3Z A;  1CF7 B;  3F3X A;  2VT2 A;  2IT0 A;  5AIP A;  1FX7 A;  3GYH X;  1FOK A;  4I0B A;  2HOE A;  3M8E A;  4L5I A;  3HSE A;  2DQL A;  2ADU A;  5JI6 A;  3JAM Z;  4CIC A;  2JPB A;  4LB6 B;  3KP2 A;  2GA1 A;  2EV5 A;  1B4A A;  3LFK A;  1S7O A;  3R4K A;  5D4R A;  3O3K A;  1R1V A;  3ZMU A;  4I02 A;  2OQG A;  3TDZ C;  3F8F A;  4I98 B;  5D6F A;  1GXP A;  2VE8 A;  4CO8 A;  1P4X A;  5J8F A;  3ZMZ A;  4GCV A;  3I5U A;  3FMQ A;  2DQR A;  2MC3 A;  1QPM A;  4RB2 C;  5EEH A;  4R79 A;  1K79 A;  3HOS A;  1HBX G;  3WE2 A;  3R60 A;  3IC7 A;  2O03 A;  1XD7 A;  1TLH B;  2IRF G;  1Z6T A;  2R7D A;  2EV6 A;  4LB5 A;  2BEO A;  2PEX A;  2VBX A;  5HS9 A;  5ILS A;  3Q9S A;  3D0S A;  1OKR A;  2PMU A;  2HYG D;  3MAJ A;  2MLG A;  1IZ1 A;  2GIV A;  1SFU A;  1O7L A;  3BPV A;  4HF1 A;  1KQ0 A;  2MD5 A;  4OIN F;  3NQO A;  2CGP A;  2Z3Y A;  5E1X A;  1W7P D;  1J59 A;  3F21 A;  1X3U A;  4DQ2 A;  2FRH A;  4NHJ A;  3KCC A;  2VOO A;  2YR2 A;  3V7R A;  5FD6 A;  3PFI A;  2IVM A;  1O3Q A;  4A2U A;  1MGT A;  2ZCW A;  1REP C;  2R7F A;  4EJU A;  3FMS A;  1SAX A;  2FBH A;  2K7L A;  3M9A A;  4U0Y A;  4OIQ F;  4Y17 A;  4KNY A;  4HQE A;  3GUD A;  2VOP A;  4UVB A;  2C6Y A;  4KIF A;  4ZYD A;  4Q48 A;  5LHI A;  2PQ8 A;  1T6S A;  1ZRC A;  1XCV A;  3BPX A;  3E6C C;  1TQM A;  4KA4 A;  4I2O A;  3D5L A;  3LA2 A;  1HKS A;  3T1B A;  2KJB A;  1R36 A;  1J7K A;  1LB2 A;  4KN4 X;  4GGG A;  1OR7 A;  1ZYR F;  3F22 A;  1G4D A;  1Z7U A;  1YTY A;  5DCM A;  5K5R A;  2DLL A;  3DFG A;  3DV8 A;  4HV6 A;  1RIO H;  1FSE A;  1MDM A;  2DU9 A;  2FMY A;  5JR3 A;  2XKO A;  1ONV A;  1T38 A;  5HDN A;  4Q47 A;  1C0W A;  1L0O C;  1OYW A;  5D5X B;  3GLX A;  5DYM A;  1DP7 P;  2J5P A;  2UZK A;  1XMA A;  2QBY B;  1T2K A;  1F9N A;  4MTE A;  1S8N A;  2V79 A;  1MDM B;  2Y0M A;  1LQ1 A;  5LGT A;  1WRJ A;  1LDD A;  1QBJ A;  4EM1 A;  4EV0 A;  2A5Y B;  1E2X A;  2TDX A;  2STT A;  1HQC A;  3GFJ A;  5BOX A;  3V8L A;  1IN4 A;  1VTN C;  1HST A;  3V8K A;  3E3V A;  1D8K A;  3J81 K;  2IA2 A;  4RB3 C;  1UST A;  2W84 A;  3ZP5 A;  3WE3 A;  1H0M A;  3IKT A;  3I59 A;  2FSW A;  4LK0 F;  4BNC A;  1W4M A;  5HOO A;  4MHG A;  4EGZ A;  3FZV A;  1G3Y A;  1ZHF A;  3SQN A;  3KEQ A;  3REO A;  4A5M A;  2GWR A;  3K1N A;  5J8C A;  1FYM A;  4BHP A;  1I27 A;  2DK5 A;  1ZG5 A;  1SD5 A;  4WXD A;  3GW2 A;  4YFN F;  2JSC A;  3TO6 A;  2FEZ A;  4KIC A;  1OYY A;  5FFZ A;  1UHM A;  2M5W A;  1AWC A;  2GA2 A;  4P96 A;  3GFL A;  5E8G A;  3ZMT A;  3DPL C;  2EK5 A;  1I6X A;  4CXF A;  1R7J A;  3CO6 C;  4OMZ A;  4M6X A;  2OZ6 A;  3I71 A;  2A3S A;  5IT3 A;  3CUO A;  1MJB A;  5DV5 A;  1USS A;  1HKT A;  2ZO4 A;  4GXO A;  4EJV A;  5FGM A;  4IRH A;  2P6S A;  3ZQ7 A;  3MZY A;  1PUE E;  1MD0 A;  3FM3 A;  1R5G A;  4M73 A;  1SD4 A;  1I1G A;  1KU9 A;  3LQQ A;  5CVR A;  5JHU A;  2Q8K A;  3CTA A;  3ZMD A;  4XSZ F;  1W5S A;  2MA3 A;  1JE8 A;  2LNB A;  5IT9 Z;  2KIM A;  3F6V A;  1HW2 A;  3I4P A;  1J75 A;  4WX9 A;  1UCR A;  2PI0 A;  2EWN A;  4ON0 A;  2L54 A;  5BPD A;  2X0L A;  5L3G A;  5BPI A;  2QBY A;  2BGC A;  3B73 A;  1XDS A;  1W7P A;  3EDP A;  2Y75 A;  4RB1 A;  2Z9O A;  2K27 A;  3ROU A;  3ZN1 A;  3KZZ A;  4WWC A;  1XDU A;  3HRS A;  2HR3 A;  3COA C;  2MH9 A;  2OAZ A;  4ESF A;  1GHC A;  1EH8 A;  1ZN2 A;  3M7G A;  2VXZ A;  4G7Z F;  5DD8 A;  2FQ3 A;  1OPC A;  5L3D A;  5JVT A;  4LG0 A;  3WOD F;  4AWX B;  3GWZ A;  4NB5 A;  4ZYG A;  2VT3 A;  3L2C A;  2VC1 A;  2E1N A;  1I5Z A;  1UHW A;  2OU2 A;  1ULY A;  1SMT A;  2KKO A;  4GYI A;  5HS7 A;  4CHU A;  2D1V A;  2VE9 A;  2QM3 A;  1FT9 A;  1LEA A;  3RTR A;  3CUQ B;  5FB2 A;  5L3C A;  4I7H A;  3F8N A;  3G73 A;  2HFH A;  1F1Z A;  1FBU A;  3M8F A;  5DDG A;  4ENN A;  2DBB A;  4ENK A;  1IRG A;  3ZPL A;  1KQ8 A;  3ABT A;  3EUH A;  5LBQ A;  3K0L A;  4LLL A;  2KRF A;  5AIQ A;  4ZZL A;  1U5T C;  6PAX A;  4HF0 A;  1SD7 A;  3JTH A;  1ZRD A;  4IPA A;  2NS0 A;  1R22 A;  3DEU A;  3R0J A;  1O3S A;  3CUQ A;  2QUF A;  2VBZ A;  5ILU A;  1BI1 A;  2RDP A;  3WTU C;  2Z99 A;  5CYV A;  1KGS A;  3BDD A;  3ELK A;  1KYZ A;  1S29 A;  5DUK A;  2A6H F;  4I09 A;  1STZ A;  3ZMS A;  3V7C A;  2HKX A;  4KN7 X;  5LRR A;  4O6J A;  1OYI A;  3W6J B;  4UNO A;  2QQA A;  2IA0 A;  3CUQ C;  2CQK A;  2FBI A;  3RKX A;  4RS8 A;  1XGN A;  4EJW A;  4BYY A;  4GYG A;  1G3W A;  2H94 A;  3BJ6 A;  4CDG A;  4HLX A;  2VOD A;  2M45 A;  1KU2 A;  2Z5U A;  3CDH A;  4LLN A;  3GVA A;  3J7A O;  5A2Q K;  3DKW A;  2QQB A;  1QZZ A;  1YS6 A;  4MEX F;  4AIH A;  3KLO A;  2JZY A;  1IXC A;  2FNP A;  3L7W A;  4M72 A;  3SZT A;  3SHF A;  2OBP A;  4BAY A;  1IXR C;  3EYI A;  3SZP A;  1BM9 A;  2XAG A;  2HYF A;  2OA4 A;  2P5L C;  4P9F A;  3DPT A;  4XLN F;  2L02 A;  2L01 A;  4BHC A;  1YYV A;  3DQV C;  4YFK F;  5FLX K;  4L5J A;  1XB4 A;  2EA4 A;  1U5T A;  5LGN A;  4IHT A;  2P7C B;  2ELH A;  5HDG A;  4LJZ F;  2F5C A;  1K7A A;  5ICF A;  1TNS A;  2ESN A;  3JW4 A;  4ETS A;  4KMU X;  5H6R A;  4MTD A;  3RKW A;  2RVC A;  3E6B A;  3WGI A;  3FM5 A;  2Z33 A;  4OIR F;  1P4W A;  4S04 A;  1OMI A;  1U6G A;  1S7A A;  4M9Z A;  4I0A A;  2BV6 A;  2KIF A;  3DF8 A;  1EV7 A;  4L9J A;  4XLP F;  3E97 A;  2YX4 A;  2EFO A;  2OQR A;  4L9T A;  3H3Z A;  2P5V A;  2CFX A;  4GO1 A;  2PFB A;  5CVV A;  3QU6 A;  5CVU A;  2A07 F;  2XAJ A;  2X4H A;  4NQW A;  4S05 A;  1O57 A;  3L9F A;  1ZLJ A;  1V3F A;  1HXD A;  3JSP A;  5E18 F;  1V4R A;  2FA5 A;  5LHH A;  2DK8 A;  2VN2 A;  4UV9 A;  1FYL A;  4UUV A;  3J80 K;  1CGP A;  3R61 A;  1FZP B;  4RGS A;  3KP6 A;  1TW2 A;  4BHB A;  3GEZ A;  1G6N A;  3I59 B;  3T8R A;  2QQ9 A;  5L3B A;  2ISZ A;  3J80 Z;  5D6E A;  1FP2 A;  5CVJ A;  1JXS A;  4EM0 B;  3LAP A;  2Q2E A;  3TGN A;  5K5O A;  4H0E A;  3GFM A;  4JK1 X;  3DP7 A;  5DEQ A;  2DT5 A;  3OOP A;  3E5X A;  2M8E A;  1MKM A;  1J2X A;  5LEK A;  2WC2 A;  3CO7 C;  3GX4 X;  3VFZ A;  5F64 A;  1K78 B;  4M74 A;  3P9I A;  3ZN0 A;  1U5T B;  1KA8 A;  1E17 A;  2W25 A;  1FYK A;  4EJT A;  4G94 A;  1O3T A;  3I64 A;  5E20 A;  1TTY A;  2BBY A;  3JAM K;  2P5K A;  1A04 A;  3KP7 A;  4LG0 B;  4D0P A;  2CW0 F;  2VON A;  3RPU A;  2W57 A;  2XVC A;  2XKP A;  5H20 A;  5ICE A;  1R00 A;  5KK1 A;  3J81 Z;  2A6E F;  1YW8 A;  3HRM A;  5FD5 A;  5E17 F;  4FHT A;  2BE5 F;  1DUX C;  3KP3 A;  3WG9 A;  3WU1 B;  3WTZ A;  3RIR A;  1G3T A;  4MGR A;  4UVC A;  5HDK A;  1ZGA A;  3CJN A;  1KU7 A;  3ABU A;  3WGH A;  4A12 A;  4QWQ A;  1U78 A;  3WTS C;  3HHH A;  2YSR A;  4KMF A;  2MLK A;  2NYX A;  3V4G A;  1ODD A;  4P5O A;  3IL2 A;  1P2F A;  2IPQ X;  1DPU A;  5D5U B;  3K69 A;  2MH2 A;  1KU3 A;  1TQI A;  4HAM A;  2UXN A;  1FBQ A;  3FXQ A;  4EGY A;  3IRQ A;  3VEP A;  2AS5 F;  1B59 A;  2M30 A;  3RPQ A;  1XGO A;  4LFU A;  2HTJ A;  2VBW A;  3HRT A;  3T8T A;  3IKV A;  5D4S A;  1MJA A;  3N97 A;  2XV4 S;  4N0B A;  2XAS A;  3MCZ A;  3T5X A;  4YIF A;  1HSJ A;  2FF4 A;  5D5W B;  5LHG A;  1RUN A;  1YFH A;  2QYO A;  1YO5 C;  2EFP A;  1Z1D A;  1XCB A;  2J5O A;  1BI2 A;  4AD9 A;  5L3F A;  1Z05 A;  4RGX A;  4HDV A;  4Q5S F;  4KIG A;  2XRO A;  5H6Q A;  3V8J A;  2GQQ A;  1R5H A;  2F5F A;  3HSR A;  1KYW A;  4EQQ A;  4BH9 A;  2O0Y A;  1GVJ A;  4L9V A;  4UVA A;  1YW9 A;  3WTX C;  1ON1 A;  3L09 A;  5IT9 K;  4OIO F;  2JRT A;  1XN7 A;  2HWV A;  1MJ9 A;  2HTS A;  1IAW A;  1ZAR A;  4ZYH A;  4TV7 A;  3HHG A;  4ENM A;  4FT8 A;  2B0L A;  4KUM A;  1IN7 A;  1FSH A;  4EM2 A;  1B9M A;  3RI4 A;  2D2W A;  3BY6 A;  3GF2 A;  1W5T A;  2EFN A;  2L4A A;  3FHZ A;  3QU3 A;  1LDJ A;  3F6O A;  1YS7 A;  2FE3 A;  3M1E A;  1T98 A;  2OZU A;  3RJP A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...