3AAFA

Structure of wrn rqc domain bound to double-stranded dna
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
109
structure length
109
Chain Sequence
SWDFGPQAFKLLSAVDILGEKFGIGLPILFLRGSNSQRLADQYRRHSLFGTGKDQTESWWKAFSRQLITEGFLVEVSRYNKFMKICALTKKGRNWLHKANTESQSLILQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structural basis for DNA strand separation by the unconventional winged-helix domain of RecQ helicase WRN
pubmed doi rcsb
source organism Homo sapiens
molecule tags Dna binding protein/dna
molecule keywords Werner syndrome ATP-dependent helicase
total genus 35
structure length 109
sequence length 109
chains with identical sequence B
ec nomenclature ec 3.6.4.12: DNA helicase.
pdb deposition date 2009-11-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF09382 RQC RQC domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 3aafA00
1K79A 3U9GA 1K78B 5ICEA 2XAHA 2O0YA 2D1HA 1XDUA 1PP8F 1WRJA 2ZCWA 2VBWA 4LLGF 2PJPA 4PZJA 1OYIA 4UVAA 4R1HA 3P9IA 3K1MA 2HDCA 4DQ2A 3RIRA 3CUQC 4GCVA 1OYYA 1IN5A 3IWZA 1Z05A 2HYGD 2GQQA 1P4WA 1IXRC 2MH2A 3P9KA 2EWNA 1H9GA 5F6FA 3LAPA 1QZZA 1FY7A 1L0OC 2QBYA 4I7HA 4G7HF 1BC7C 5FO5A 1IW7F 1G3TA 2QZ8A 1WSUA 1S7OA 4Q5SF 5FFXA 2OZ6A 1TBXA 3O3KA 3JAMZ 4RB1A 4RGRA 4G7OF 3SQNA 3J81Z 3HRMA 3RDIA 4DNCA 3LA7A 4LGWA 1JHHA 4A2UA 1XGOA 2LF7A 1CF7B 3FF5A 3TOAA 4U7BA 1YO5C 3KP5A 2PMHA 2DBBA 3KP3A 1F5TA 2CYYA 1QO0D 2CQKA 5AONA 1O3TA 4HQEA 2W24A 4ETSA 2GWRA 5JI6A 1K7AA 3JSPA 4HYEA 4M9XA 3EETA 2EFPA 5D4SA 2RVCA 2CWEA 1MD0A 4P96A 3VFZA 4EM1A 3H92A 1I1SA 1GVJA 2Z99A 5KVRA 3SZTA 2LF8A 3MQ0A 3E5QA 3R4KA 1S29A 3NQOA 3RKXA 5D5UB 4PDKA 3QAHA 5D8KB 4KIGA 1R22A 4WCGA 3D0SA 1FPQA 2HTSA 3BDDA 1P4XA 3O6BB 1Y0UA 3TGNA 4G8XA 5CJ9A 1ZG3A 1FX7A 3K69A 3L00A 2Q0OA 1RNLA 3RKWA 1YTYA 2W85A 2HEOA 3F8FA 4EGZA 1R5GA 3QRFF 1XCBA 1R1TA 3MCZA 3V7SA 3BOQA 4LB5A 5L3DA 2UZKA 3CUQB 5FFZA 2Q8KA 4P9UA 4EJOA 3V8JA 4BXUA 3LWFA 3I53A 2FXAA 2XASA 2XUBA 1TW2A 5D6FA 2BBYA 3WGGA 3QU6A 4OIQF 4BH9A 4L0YB 2DPUA 2F5CA 2ISYA 2O61A 5CVJA 3KZYA 2GA1A 2DK8A 2P7VB 3DPTA 4EV0A 4B09A 5L3FA 3M7GA 2V1UA 4TV7A 1S8NA 1HW5A 5DUKA 2FRHA 3O2PE 3DKWA 3WTVC 3WTSC 4HF2A 4RS8A 3ISPA 4BYYA 1UB9A 5DV5A 2DLLA 2P7CB 4CO8A 4ESJA 2DFIA 4LG0A 3KLNA 1E17A 2FBIA 4L0ZB 1IRFA 3BY6A 2A6HF 1FLIA 4ZYHA 3QPTA 3IRQA 3COAC 3CJNA 1TNSA 2IRFG 1HW1A 2BEOA 4KA4A 3CO7C 1USSA 5FLXZ 1JE8A 4G94A 3I54A 5L3GA 3GO5A 2BYVE 4HLXA 1IRGA 2Z33A 2DW4A 1HXDA 5BPIA 1XDSA 3IL2A 4XSZF 2A61A 4WXCA 1XGMA 2PBIA 3M1EA 1QQIA 1I27A 2G7HA 4M73A 4OOIA 4LFUA 2Z9OA 3KEQA 2A69F 5ILVA 3TO6A 2X0LA 4XLNF 1CF7A 2PFBA 2OU2A 3LA2A 3ABTA 3BROA 2IVMA 4JBAA 4ZYDA 2LNBA 3CUQA 4QWQA 4P55A 1LJ9A 2HYFA 2MC3A 1LDKB 4KT5C 2EV6A 3P9CA 4OIPF 5LHIA 2WV0A 3H3UA 4HDUA 3P7NA 5HLGA 2ZMEA 5JVTA 5D8LB 4NB5A 3OOPA 2XAJA 2PMUA 3F8NA 3JTHA 1Z9CA 3R6SA 3AAFA 4YIIA 1SFXA 2QLZA 1W5SA 1PUEE 4OU0A 3FMSA 3V4GA 5D5XB 4O6JA 1I6XA 1BN5A 5EEHA 4LD5A 3KFWX 2IT0A 4ASNA 2K4JA 2XV4S 2H94A 5H6QA 4AD9A 5J6XA 4KUMA 1F9NA 2H27A 2R7FA 2EA4A 3J80Z 3IC7A 1V3FA 4Q4ZF 2CW0F 3WTXC 5LGNA 5AIQA 3BJ6A 3F21A 1CGPA 4EM0B 2P6TA 5FB2A 4M6XA 4U88A 2HZTA 3F6OA 2HFHA 2A68F 2GXGA 1MDMA 3KCCA 2VC1A 2QM3A 1ZG5A 2L02A 5FLXK 1QNTA 1OPCA 3RPQA 4O5VA 1FBUA 5HVQC 1IN4A 3WTUC 3VB2A 1TQPA 1FC3A 5LRRA 2AS5F 4LG0B 2HS5A 3EYIA 1STZA 5JFRA 1P2FA 3Q9SA 3WE2A 3VEPA 2HR3A 3M8EA 4EGYA 4RGSA 4MTDA 3T8RA 3HSRA 3RYRA 3V8KA 2HQNA 1R5HA 1T39A 3KE2A 4IXAA 1YQAA 3SXYA 1B4AA 2IPQX 2H6BA 5E18F 2DT5A 2IA1A 2OAZA 1ZRDA 4HAMA 1E2XA 3KEOA 2R3SA 3E6MA 1K78A 3FM5A 3C1DA 3JAMK 3SHFA 4FX4A 4LLLA 4FX0A 2EFOA 1RUNA 2QVOA 4RAZA 3NRVA 3I0TA 4AVPA 4PCQA 4CGZA 4HF0A 3HIFA 2RQPA 3GZ6A 4HA8A 5HDGA 3MZHA 2ESNA 1J0RA 5A2QK 1QPMA 4KICA 3HOSA 4NQWA 1MZBA 3E97A 3RPUA 1LNWA 2ZFWA 1NHAA 1FBSA 4BQAA 1G6NA 3WGHA 1T38A 1TW3A 4L9JA 5K1YA 2JTVA 1KQ8A 2TDXA 4LMYA 4CXFA 4M9SA 1Z91A 3HHGA 3E3VA 4KN7X 3C7JA 2YU3A 3WGIA 1R1VA 4CZZA 2H09A 1RI7A 4RGXA 2XHKA 4N9HA 3KETA 3LQRA 4G7ZF 2CGPA 3WG9A 4GXOA 3D5LA 4IF4A 1LB2A 1O3RA 4M74A 3K9TA 4KNYA 3WTTC 1QGPA 4A6DA 3GZ5A 4M6YA 3E6CC 1KA8A 1AWCA 4UHTA 1W7PA 1Z6TA 3ZMSA 3V8LA 3MWMA 2P5KA 4A6EA 3G3ZA 2A5YB 3LAJA 3N97A 1FWZA 4RB0A 1J5YA 3BJAA 5BPDA 1OMIA 3TDZC 2A3SA 4EM2A 5E1WA 3ECOA 1MDMB 3C3WA 1XMAA 2MH9A 1SD5A 2FU4A 1BI2A 2XAQA 4CYDA 1XN7A 3F72A 5ICCA 2HKXA 1DPRA 5JR3A 4GGGA 3U2RA 4MEYF 5IT3A 5LEJA 5BMZA 1W5TA 2JPBA 1LEBA 2L01A 1G3YA 3BZ6A 4G6DA 1J75A 4ENKA 2GA2A 2FA5A 3R60A 2M30A 6PAXA 3RJPA 3T8TA 3ZP5A 4M9ZA 1PDNC 1UFMA 2VOOA 4YFXF 4ZYEA 1OYWA 3B73A 5LGTA 4Q47A 1G3WA 5BQTA 5E1XA 1LDDA 1IXCA 4I98B 3DFGA 4M72A 1A04A 3EYYA 1HKQA 1SD4A 3I5UA 5AIPA 1MGTA 1SMTA 1C0WA 1YW9A 3Q9VA 2QQBA 1R1UA 3LSTA 1O7LA 3GWZA 4HV5A 4CDGA 5E20A 4N0BA 1YS6A 4HF1A 4PGHA 1QZYA 4U7DA 3V7CA 4L5JA 1FNNA 5HDNA 3REOA 2RDPA 5BS6A 3MEXA 1LQ1A 2FBHA 2W84A 3GYHX 3RKYA 1TTYA 1USTA 2E7WA 2ZBKA 3LFKA 4AIJA 3FM3A 3JTGA 2HOEA 3JW4A 3CO6C 2VODA 4IHTA 1FBQA 3ZPLA 5FD5A 3J80K 1EH8A 2EFQA 3ZMVA 1S7AA 4WF2A 5F1RA 1AOYA 3GX4X 1HQCA 2DPDA 3M9AA 3ZN0A 2W25A 1KU3A 4EJWA 1GXQA 1UHWA 3I58A 3F8MA 3TOBA 2VOPA 3I59B 2QBYB 2DU9A 2LKPA 1O7FA 2RKHA 2XAFA 2OA4A 1YG2A 2FOKA 4Y17A 3VODA 2JSCA 2FEZA 2WC2A 1VTNC 5CVUA 4A0ZA 5CVIA 1JHFA 1BOAA 3E6BA 1YFHA 4MQVA 1KU7A 1EH7A 2PI0A 1HBXG 1I5ZA 2H6CA 2ELHA 4R79A 1BIAA 4A0XA 1JGSA 2VN2A 3EDPA 1FT9A 1PP7U 3I71A 1RIOH 4IJAA 1ONVA 3FXUA 2JRTA 5HS8A 2P5VA 2L3DA 4GYIA 5D6EA 1Z6RA 4UNOA 1O57A 2IA2A 3BP8A 2MA3A 1Z7UA 4WK8F 5KK1A 2F5EA 2P8TA 1Q1HA 4L9NA 1LEAA 1XSVA 3KP7A 1ON2A 4KFCA 1SD7A 2COMA 1H0MA 2XKPA 3BPVA 2UXXA 3QP6A 3SZPA 4KN4X 5ILUA 1R58A 2CO5A 1WWXA 1J7KA 4MEXF 1U2WA 4ENMA 1ZRCA 2DAOA 4I0AA 3Q5FA 1OKRA 2D2WA 4OMZA 4LLNA 2XROA 4Z2YA 1Z1DA 3FX3A 5CLSA 3LA3A 2BE5F 2FMLA 1FOKA 1J59A 5CYVA 1T98A 5D4RA 1G4DA 2ZNZA 3V7RA 4Y13A 1BI3A 4I01A 2Z5UA 1MJBA 2MLGA 5ICFA 3E5XA 4HDVA 3HTSB 4ZZDA 3I4PA 2QUFA 1ZN2A 2PEXA 3U1DA 4YIFA 5E1ZB 4KIBA 2FNAA 2D45A 1UCRA 4WWCA 2A6EF 4UVBA 5DCMA 5IT9K 4KMUX 5J8CA 3L9FA 5TRDA 2Q2EA 2ZMEB 3HRTA 2O03A 4MNUA 1RZ4A 1REPC 1FP1D 4EJTA 5D5VB 2XAGA 4M71A 1D3YA 4RB2C 2IW5A 1G3SA 3GUDA 3J7AO 5CVVA 3W6JB 1MKMA 4EMSA 2ZKZA 1SAXA 3WODF 3E5UA 1ZREA 4OIRF 2K4BA 2PLYA 1FYKA 4IRHA 4UV8A 5HLIA 4ESBA 1TLHB 2GAUA 1ZYRF 2F5FA 4OIOF 3FMQA 4I09A 2DI3A 4GYGA 2KJCA 3ROUA 2K27A 4HOBA 1XGNA 3OV8A 3GFMA 5H6RA 3HYIA 2MBFA 3ZN1A 2G7UA 2WTEA 2KIMA 3ERED 5HS7A 3ELKA 2ADUA 1P4AA 2VBZA 3TQNA 4U0VA 1F4KA 2CSOA 5DUIA 2JPCA 2DQRA 2G9WA 1J2XA 2C6YA 4HX7A 2XIGA 4ENJA 2GIVA 2DK5A 4ZH4F 1DDNA 3KLOA 3FWEA 1DUXC 5CVRA 3WU1B 1ODDA 3VOEA 4LK0F 2VC0A 3T1BA 2KKOA 4FT8A 5LEKA 3FXQA 4P9FA 3R0JA 4IHSA 1YLFA 1WQ2A 1KU9A 4HX8A 3PQJA 4RB3C 1OR7A 4CICA 2CFXA 4BHBA 3KP6A 2NAZA 4JK1X 3ULQB 1K6OA 2EV5A 1U5TA 5FGMA 3BPXA 1X3UA 2RNJA 4L5IA 1LVAA 3RYPA 3F8BA 3MFKA 1FSEA 4XLPF 1XSXA 1TNTA 1HW2A 3DF8A 3L2CA 1L3LA 4PGGA 4OMYA 4Q48A 2ETHA 1ULYA 5LLQA 3K0LA 5K5OA 3TKYA 4IVNA 2M1BA 4D0PA 1DP7P 4L18B 3T0YA 2M8EA 5DD4A 1IXSB 2MLKA 4CHUA 4BHCA 3F23A 4LB6B 3L09A 3RI4A 3HTUA 1HKSA 3ZQ7A 2PN6A 1IN6A 4S05A 1U78A 3IKVA 2ZJ2A 1B6AA 3BJOA 5FD6A 1B1BA 2Y75A 2HWVA 1ZH5A 1B9MA 2BGCA 3IRRA 2YPRA 1YW7A 1IF1A 2HTJA 5L3EA 2MD5A 2M5WA 4YG2F 2F2EA 2XGXA 5LHGA 1ZG1A 2D1VA 1YW8A 5D5WB 2YX4A 2VXZA 3GVAA 2DQLA 4A12A 3R0AA 4KMFA 3DEUA 1FZPB 3I64A 2RN7A 1R00A 4O3MA 4FHTA 5A2QZ 2FE3A 2STWA 2L54A 3RTRA 4AIHA 1WI9A 4EQQA 1UHMA 2L4MA 5LGUA 3N4MA 1KYZA 2HKOA 1T0FA 5HOOA 2EV0A 3KP2A 1D8JA 1U5TB 5DCMB 2RGVA 2JT1A 2NRAC 4UUVA 3FXRA 4GO1A 4IRIA 1P6RA 4ENNA 1W4MA 3IKTA 4U0WA 2NNNA 2V1DA 3HUGA 2FSWA 4LJZF 3DXJF 1F1ZA 3BWGA 5EEGA 2K7LA 4B8XA 2FF4A 3SFZA 1V4RA 3F8CA 4LK1F 4UVCA 3TDUC 3GFLA 3ZMDA 4H0EA 3TO9A 4AIKA 2Y0MA 1EH6A 4S04A 4G9YA 3EQLF 2DTRA 2QQ9A 4AWXB 5F64A 3DV8A 2OZUA 1U3EM 2HGCA 3KP4A 4WXHA 5L3BA 2FNPA 1H9TA 1KQ0A 3K1PA 2EFNA 4OINF 2VONA 5IT9Z 3F22A 1YS7A 1T2KA 1SD6A 4F7ZA 1HKTA 1ZHFA 3C18A 2E1NA 1R7JA 5DDGA 1ZAOA 1FYLA 2M87A 1IUYA 2YX7A 2OQRA 2VBYA 4L9VA 1FSHA 4HW0A 5J8FA 3M8FA 4HX4A 4IRGA 3MZYA 2P6SA 4RGUA 3DQVC 1DPUA 3S2WA 3GW2A 3IWFA 1J9IA 2RV8A 4XSXF 2GZWA 2NNYA 5JHUA 1EV7A 3WTZA 2EFWA 2CG4A 4G6QA 1BIBA 1BM9A 1IAWA 4R8HA 2Z3YA 2AXLA 5K5RA 1YIOA 1P92A 2P4WA 2O3FA 4BHPA 1SFUA 1ON1A 1IN7A 1BI0A 1TQIA 2DO7A 1BC8C 2L4AA 4A5MA 2P5LC 2B0LA 5L3CA 4KYWA 1FP2A 2IJLA 2XVCA 1SMYF 1S6LA 1U8RA 2Y48A 2NYXA 3JSOA 2K86A 2X4HA 3HRUA 4HZFA 4JQFA 3G73A 3J81K 1XD7A 4ZYGA 1GXPA 4HBLA 4EJVA 2IA0A 3QU3A 2IP2A 1GHCA 1U5TC 5DD8A 1R23A 2OD5A 5TJJA 2R7DA 3WU0A 2E7XA 3ML6A 3B02A 5DCFA 2QQAA 2UWMA 1KU2A 1ZLJA 2QENA 2HQRA 2FQ3A 4NHJA 3GFIA 3GLXA 4P5OA 2BV6A 2M45A 3GXOA 4IPAA 3FHZA 1U6GA 4A0YA 4ON0A 5ED4A 2V1XA 2ZO4A 1XGSA 1FYMA 1WKMA 4KDPA 1ZRFA 5E8GA 5ERIA 3CDHA 2KJBA 1BJAA 3DPLC 4QLCU 5E17F 4YFKF 4UXNA 4HV6A 4N9IA 2E1CA 4EJUA 2K02A 3H3ZA 1IN8A 2VBXA 1KYWA 4A5NA 3CTAA 2V79A 3QPHA 4MQ9F 2F5DA 1XSDA 3GFJA 2EA2A 3F6VA 3R61A 3ABUA 4MGRA 3HHHA 2ESHA 1D5VA 3GF2A 3EUHA 1BBYA 5ICGA 4MTEA 2JZYA 2NS0A 1ZLKA 3DP7A 1ZGJA 2PG4A 5BOXA 1XCVA 2VT2A 5DEQA 4YFNF 2STTA 3PQKA 1R36A 4EVIA 1W7PB 1HSJA 1W7PD 4L9TA 3FMRA 2KRFA 4UV9A 5LHHA 1XB4A 1MJ9A 3CUOA 3ZMZA 4XBFA 2QYOA 4KIFA 2KIUA 2A07F 2YSRA 1I1GA 3K1NA 2KIFA 4ZZLA 1QBJA 4RAYA 5HDKA 3GEZA 3KZZA 4HQMA 2OQGA 3QOPA 3K2ZA 2YR2A 2QWWA 4MHGA 5E8IA 2J5PA 4I0BA 3W6KB 2XKOA 1KGSA 3F3XA 2LDUA 1O3QA 3FZVA 2PQ8A 1ZGAA 2J5OA 2GXBA 1SFEA 5ILSA 2UXNA 1RUOA 4K2EA 3PFIA 2VT3A 5K5QA 2VE8A 2EJRA 1BI1A 5LRSA 3QP5A 2O8XA 3LQQA 1JXSA 3IHUA 2XRNA 4HLYA 1ZARA 2ACJA 2FMYA 5LBQA 1MJAA 2V9VA 3WE3A 4U0YA 3I59A 1B9NA 3ECHA 2OBPA 1XMKA 2W57A 5HLHA 1HSTA 1T6SA 3L7WA 4BNCA 1TQMA 1IZ1A 1B59A 4WX9A 2FBKA 3NEUA 3E6DA 2WWYA 3WTYC 3ZMTA 4ESFA 1KQ9A 2VE9A 2LSOA 5HS9A 3MAJA 4I02A 2O6GE 2ISZA 3HSFA 2EK5A 4BAYA 1S3JA 1O3SA 2RC4A 2ZNYA 4WXDA 3HRSA 1LDJA 1D8KA 3HSEA 3T5XA 4I2OA 4E70A 2ZXJA 3CLOA 1YYVA 3ZMUA 4Y15A 5H20A 3HOTA 4XRFA 5DYMA 3TO7A 2EB7A 3WTWC 2V6CA
chains in the Genus database with same CATH superfamily
1K79A 2KL4A 3U9GA 2XGEA 2K3FA 2DOAA 1K78B 5ICEA 1LFPA 2XAHA 2VXDA 2MD0A 5IP6A 2O0YA 2D1HA 3ZQFA 1XDUA 1PP8F 3LSHA 1WRJA 2EQRA 2ZCWA 2BY3A 2VBWA 5JLXA 4LLGF 4E7LA 2JUGA 2PJPA 4PZJA 1OYIA 4UVAA 4R1HA 3FK7A 3P9IA 3TW7A 3K1MA 2HDCA 2RREA 1MBKA 4DQ2A 4XKVA 3RIRA 2ZXIA 3CUQC 1MBHA 4GCVA 1OYYA 1IN5A 2Y9ZA 1RESA 3IWZA 3S93A 1Z05A 4BQOA 2HYGD 2GQQA 3DKYA 4XKBA 3GTJJ 3I9V2 1P4WA 1IXRC 1V54H 2MH2A 3P9KA 4UUTA 3HZJA 2EWNA 1BR2A 1H9GA 5F6FA 3GBGA 1AKHA 3LAPA 3IP4B 1QZZA 1TWAJ 2TCTA 1IV8A 3ESWB 1FY7A 3S1RJ 5B66C 3CDIA 1L0OC 5M3FJ 2E1OA 2H8RA 5EDNA 2QBYA 2K3PA 2OC6A 3IAS2 4I7HA 4G7HF 1BC7C 3ZCOA 5FO5A 1IW7F 1G3TA 2QZ8A 1W0UA 2Y9YA 4X1EA 5J47A 2L7ZA 5C4JJ 3S17J 4GRIA 3OYEA 3W2WA 2HXOA 1WSUA 1S7OA 2BVMA 3PNTA 4MIMA 4Q5SF 5FFXA 2OZ6A 2AQFA 1TBXA 3O3KA 4IHXA 3JAMZ 4G6TB 3W3CA 2M4KA 2X6OA 4RB1A 4RGRA 4G7OF 2GM4A 3OYLA 1YI2I 3VYSB 3SQNA 2XC7A 3J81Z 3HRMA 3OS2A 3RDIA 1DP3A 2FX0A 3FK6A 2KDOA 4DNCA 3LA7A 4IQJA 4LGWA 3IH4A 1DGRM 1JHHA 4A2UA 3ZQCA 2I8DA 1XGOA 4MFEA 3SDBA 2LF7A 1CF7B 2K9QA 2RNGA 2R7UA 2TRTA 3FF5A 1D5YA 1VZ0A 2DFFA 3TOAA 3K4CA 4U7BA 1YO5C 3KP5A 4C2MJ 2PMHA 2DBBA 4XLHA 4HPQA 2F4OB 4EEFG 2VB6A 3H35A 3KP3A 1WVRA 3ZQIA 4KISA 1F5TA 2CYYA 1QO0D 5FKOA 2CQKA 4F3QA 5AONA 1O3TA 5HODA 4HQEA 2W24A 1U8BA 4ETSA 2GWRA 2K9LA 1I3QJ 5JI6A 3L2RA 1K7AA 3UNGC 4BJ5C 3JSPA 4HYEA 4M9XA 1QHHD 3EETA 2ECCA 4M3EA 2EFPA 5D4SA 2RVCA 2CWEA 1MD0A 4P96A 3VFZA 4EM1A 3MKWB 2Z2SB 3H92A 5GTIC 1MMAA 1MMSA 1I1SA 1GVJA 2Z99A 2M4GA 1TWFJ 4CCLA 3ABLH 5KVRA 4LOCA 3SZTA 1D1BA 2VJJA 2LF8A 2OCEA 4RAGA 2AQEA 1BR4A 3LSJA 3MQ0A 3E5QA 3HKZA 3FXLA 3FBIB 3R4KA 3L2UA 1ITYA 1S29A 3NQOA 1YE9A 3RKXA 5D5UB 4PDKA 3QAHA 5EJCA 5D8KB 4NC6A 3F0CA 3NARA 4XRSG 3FXOA 4KIGA 3JRDA 1R22A 3A0HC 4X6AJ 4WCGA 3D0SA 1FPQA 2HTSA 2KRHA 3BDDA 1P4XA 3O6BB 1Y0UA 3TGNA 4G8XA 5CJ9A 2DMNA 1ZG3A 2A5WA 3OYJA 2GXAA 4HRIA 4A69C 4D7NA 3IH2A 1VQLI 1FX7A 2R7QA 3K69A 3L00A 2Q0OA 1RNLA 3BR3A 3RKWA 1YTYA 2W85A 2HEOA 3OMYA 2Y31A 3F8FA 4BQNA 3DTKA 2M0MA 4EGZA 1R5GA 3AKZA 2I10A 3QRFF 1WHUA 1XCBA 2CMPA 2HYJA 1LPQA 3L1PA 3CCJI 1R1TA 3MCZA 5EG0B 3LL7A 5F08A 4FASD 3V7SA 3BCBA 3BOQA 4LB5A 5L3DA 1VQ8I 2UZKA 3CUQB 5FFZA 3L2VA 2ZXHA 3KZIC 2Q2EB 2Q8KA 4P9UA 4EJOA 2F5VA 4XLAA 3V8JA 3LMMA 4BXUA 3LWFA 3I53A 2FXAA 4IO9F 2MSYA 2XASA 4QIWN 2XUBA 3SDGA 2ID6A 2HVSA 1TW2A 2E1MB 3PJRA 5D6FA 4W97A 2BBYA 3ZR8X 3WGGA 3QU6A 5GP9A 4OIQF 4BH9A 1FIAA 4L0YB 2W48A 2DPUA 2F5CA 4V19K 2ISYA 3DTEA 2O61A 2V6EA 5CVJA 4CA0A 4L5EA 3H36A 3RPUD 3KZYA 2GA1A 2DA6A 2DK8A 2P7VB 4HNUA 1JTYA 3DPTA 4EV0A 4B09A 5L3FA 2JSPA 3M7GA 3PUBA 3A01A 2V1UA 1W1WE 1BL0A 4TV7A 2IS2A 1S8NA 2P81A 1HW5A 5DUKA 5F0CA 1BOBA 2FRHA 3O2PE 3K4BA 3CF5F 3DKWA 2VKVA 1AHDP 1MBGA 3WTVC 1W5CC 3WTSC 4HF2A 4RS8A 3ISPA 1G2HA 4BYYA 3HPGA 4PFOA 1OCZH 5DS9A 1UB9A 1KZHA 2DMPA 5DV5A 2DLLA 3JCUC 2P7CB 2OF7A 1VF9A 2M3AA 4CO8A 2LMDA 4ESJA 2DFIA 3G6EI 1GT0C 1HOMA 2CJJA 2FOWA 4XLFA 4LG0A 3KLNA 1E17A 2FBIA 4L0ZB 1IRFA 3BY6A 2A6HF 2LY9A 4ZDOA 1TT5B 1FLIA 4ZYHA 3QPTA 3IRQA 1GVDA 1MMGA 1QZEA 3COAC 4N4OB 5GADJ 3CJNA 1TNSA 2IRFG 3K7AJ 1HW1A 2BEOA 4KA4A 3CO7C 1X1CA 1USSA 5FLXZ 1JE8A 3RCOA 4G94A 3I54A 4F55A 5L3GA 3DBRB 4M3DA 3GO5A 2F4IA 2M7AA 2BYVE 3SYTA 4HLXA 1IRGA 2DYRH 1DU0A 1ZGWA 3H5AA 4JYKA 2DW4A 3G2BA 3A0BC 2Z33A 1FOXA 1LE8A 1V5EA 1HXDA 5J40A 1TL8A 4A3BJ 4BY7J 5BPIA 2R5YA 1XDSA 3IL2A 4XSZF 5M5YJ 1DQUA 3MZ8A 2NVXJ 2A61A 4WXCA 1XGMA 4XRMA 2B63J 2PBIA 3M1EA 1QQIA 2R7XA 4NC7A 3NWSA 1I27A 2PJRB 2G7HA 3HB9A 5KAFC 2FQ4A 4M73A 5C3EJ 2MG4A 4LFUA 4OOIA 2Z9OA 3OYGA 3KEQA 1VQKI 3HOYJ 1T95A 2BW3B 2HQAA 2IGKA 1T33A 3AG2H 2A69F 2E5NA 5ILVA 3TO6A 1Y0NA 2BY1A 2X0LA 5FKMA 4XLNF 5LFAA 3SFIA 1CF7A 2PFBA 1IC8A 4IHVA 2OU2A 3LA2A 1PUFA 3H3VK 1MH3A 3ABTA 3BROA 4IOAF 3H5NA 2XPWA 2IVMA 4JBAA 2Y2ZA 4ZYDA 3SEQA 1ZKGA 4DJAA 4I6ZA 2LNBA 3CUQA 2KZVA 4QWQA 5DTDA 2ZSHB 2XAUA 1MBFA 4P55A 1MMNA 4FTHA 1LJ9A 1Z67A 2HYFA 2MC3A 4I76A 2NVUB 1LDKB 4D5FA 4KT5C 2EV6A 2HVQA 4A3LJ 3P9CA 4OIPF 1POGA 1IUFA 1TWHJ 4BEHA 5LHIA 2WV0A 3U1KA 3H3UA 5HLGA 3P7NA 4HDUA 2ZMEA 5JVTA 5D8LB 4NB5A 1BR1A 3CD6I 3OOPA 2IBDA 2XAJA 2E1MC 2PMUA 4PSXA 2R5ZB 3F8NA 3FDYA 1K6YA 3JTHA 2EH3A 2KFDA 3J7AY 2R7OA 3DWLE 2KRCA 1Z9CA 3R6SA 3AAFA 4NC8A 4YIIA 1SFXA 2QLZA 2VASA 1W5SA 3H0GJ 1PUEE 4OU0A 3NAUA 1OCRH 5J1RA 2LOOA 3FMSA 3V4GA 3Q0UA 5D5XB 4HNVA 2R5YB 4IL6C 2HOAA 3CESA 1XC5A 4O6JA 1JUSA 1I6XA 4ZDPA 1BN5A 2VPRA 5EEHA 3QPSA 4II3A 4LD5A 3KFWX 3Q3SA 1LFBA 3TP0A 1JJ6C 2IT0A 2EIMH 3S3MA 4ASNA 2KIQA 1R6RA 5E3OA 2K4JA 2XV4S 2H94A 1Y8QB 5H6QA 1S7EA 4AD9A 5J6XA 4KUMA 1VNDA 1F9NA 4Y4RA 3VWBA 2H27A 4D9JA 2R7FA 2IS6A 2EA4A 3J80Z 3DCFA 3IC7A 2AO9A 1RRJA 4IHYA 1V3FA 4Q4ZF 3DBLB 2CW0F 3WTXC 5LGNA 1JT6A 5IP9J 3GTKJ 5AIQA 3BJ6A 3F21A 1APLC 1CGPA 2UUZA 4EM0B 4CH7A 2P6TA 1OCPA 3K4LA 4FETA 5FB2A 1X1BA 4M6XA 1B8IB 4U88A 2VQGA 2XSDC 2HZTA 3I56I 3W6VA 3F6OA 2HFHA 4XORA 4I99C 2A68F 3VDXA 4CCOA 2GXGA 1MDMA 3KCCA 2VC1A 2Y0SN 5IY5H 1P7JA 2QM3A 1ZG5A 1Y1WJ 2VQHA 1TT0A 3VYUB 2L02A 5FLXK 2CS3A 1QNTA 2K9NA 1OPCA 2JVGA 3RPQA 1B72A 4O5VA 3J7ZI 1FBUA 2KHMA 4BQQA 1WH5A 5HVQC 2ICWG 1IN4A 2K40A 3VB2A 3WTUC 1TQPA 3HG9A 1R4NB 2EZLA 4M3FA 3OS0A 1FC3A 5LRRA 2AS5F 2F4MB 4LG0B 2HQ5A 2HS5A 3EYIA 3M3YJ 1STZA 4ZYAA 5JFRA 5EYRA 4A3GJ 1YX5A 1RPWA 1N78A 1ENHA 2E5ZA 1IGNA 1AKHB 1P2FA 5GAHJ 5BNGA 3Q9SA 3WE2A 3VEPA 1S9HA 2HR3A 3M8EA 4EGYA 4RGSA 4MTDA 3T8RA 3HSRA 3RYRA 4A3EJ 4PJJA 3V8KA 1N77A 2M7BA 1X1AA 2HQNA 2LKSA 2CQXA 4BEHB 1EJ9A 5FLVA 1R5HA 1T39A 3KE2A 4IXAA 1A5JA 2E36A 2NS7A 3K4MA 2E2IJ 4G12A 4RMNA 1YQAA 2JUCA 3SXYA 3OY9A 3HXLA 4A3JJ 5M5WJ 3HL2A 1B4AA 2IPQX 3BG7A 2H6BA 5E18F 2DT5A 2IA1A 5K7FA 1O4XA 4A3CJ 2O5RA 2OAZA 4P1WA 3PUFA 2ID3A 1ZRDA 5B5EC 4PJNA 1ETWA 4HAMA 1E2XA 3KEOA 1WJEA 2R3SA 1ZTRA 3E6MA 1K78A 3IH3A 3FM5A 3RZDJ 3C1DA 4F91B 4QPOA 3JAMK 3SHFA 3OYCA 4QSHA 5KCMA 4FX4A 3WHCA 1U9NA 5TGTA 4FX0A 4LLLA 2VLAA 2EFOA 1RUNA 2QVOA 4RAZA 2BHZA 3NRVA 3G4SI 1X3WB 3GTMJ 1FTTA 3I0TA 4AVPA 1XX5A 2CUFA 2CFOA 2L9RA 4PCQA 4CGZA 4HF0A 1HCRA 4NQWB 4QPQA 2R5ZA 3O8GA 3BR2A 3HIFA 2RQPA 4S0HB 1BW5A 1WH7A 4BE2A 3GZ6A 1RKWA 1R49A 1X19A 4HA8A 5HDGA 4DBRA 3MZHA 2IEKA 2ESNA 3MN2A 1J0RA 1DU6A 5A2QK 1NTCA 1QPMA 3ZQHA 4KICA 3E0JB 4IEJA 3HOSA 4NQWA 3H9QA 5B3SH 2LH9A 1MZBA 3E97A 1D0YA 2EZIA 3RPUA 1LNWA 2ZFWA 5K7HA 1NHAA 2DMQA 1YITI 1MBJA 1FBSA 3AG1H 2WB1A 2W82A 4II2A 3CC7I 4BQAA 1G6NA 3WGHA 1T38A 1TW3A 4L9JA 1RC9A 5K1YA 2JTVA 1KQ8A 4IOCF 2TDXA 2X9DA 1NG7A 4LMYA 4CXFA 4M9SA 1Z91A 3HHGA 3JRBA 4F92B 2CV2A 4Y52J 2V4JC 1XS9A 3E3VA 5FROA 4KN7X 3C7JA 2X1EA 2L7MP 1FEXA 2YU3A 4DYQA 3WGIA 2VQLA 3G1LA 1FMWA 4KJZA 1R1VA 4CZZA 2H09A 1OISA 1RI7A 4RGXA 4C2TA 2XHKA 1ETXA 1IDZA 1QRYA 4N9HA 2DJIA 1B72B 4JP0A 3LQRA 3KETA 1M1EB 4BACA 4N4NB 4G7ZF 5IPAA 1V5GA 3PIPF 2CGPA 3DKXA 2LBFA 1ZQ3P 2X51A 3M1CA 4YRVA 5JLWA 3WG9A 4GXOA 5FKLA 3S1QJ 1JKOC 1Y8RB 3GTLJ 3D5LA 4IF4A 2V9PA 3OYFA 1LB2A 1O3RA 4M74A 3K9TA 4KNYA 2H8WA 3WTTC 3BQZA 1QGPA 2XPUA 4A6DA 1U0JA 3GZ5A 4HG2A 4JX4A 4M6YA 3E6CC 1KA8A 1AWCA 3WHBA 4BE0A 1IG7A 3S15J 4M3GA 2IAIA 4UHTA 1W7PA 1Z6TA 1YIJI 3ZMSA 2YU9J 3TL4X 1YHQI 4Z6YA 4DYCA 2E71A 3V8LA 2HVRA 3MWMA 1K4SA 1IO2A 3NWTA 2P5KA 1MNDA 4A6EA 3G3ZA 1TZLA 2LVSA 2Y0SA 2A5YB 1MSEC 3LAJA 4DZPA 3CP2A 3BCAA 3N97A 3OIOA 2HPIA 1FWZA 4RB0A 1J5YA 1MH4A 3UR3C 3BJAA 4IZZA 3HOUJ 5BPDA 1OMIA 3PSIA 2GOXB 2MFZA 2JA6J 1YOVB 1TC3C 1E3OC 4BBSJ 3TDZC 2A3SA 1HDPA 4DOZA 4EM2A 2HXIA 2VKDA 5E1WA 3ECOA 1MDMB 4KITB 3C3WA 3M4OJ 1XMAA 2MH9A 3S1NJ 1SD5A 2FU4A 1BI2A 2XAQA 4CUGA 4C30A 4AYBA 4CYDA 1XN7A 3F72A 2DYSH 3QODA 2HKXA 4AUXA 1DPRA 5ICCA 5JR3A 4GGGA 3U2RA 4E7ZA 4BXFA 4MEYF 2A6TA 5IT3A 1JJ8C 5LEJA 5BMZA 1W5TA 2JPBA 1LEBA 2L01A 2IXSA 3BZ6A 1G3YA 5EGOB 4G6DA 1J75A 3S1MJ 4ENKA 1IRZA 1IJWC 2FA5A 2GA2A 3RQIA 3R60A 3ZOBA 2K9MA 2M30A 3AL0C 1PVEA 1HF0A 2B7EA 6PAXA 3G1MA 3RJPA 3T8TA 3ZP5A 4M9ZA 2R7TA 1PDNC 1UFMA 2VOOA 1QVUA 3CJTB 1IDYA 3FISA 4YFXF 2EIJH 4ZYEA 2LY2A 1OYWA 3B73A 5LGTA 1F43A 4Q47A 2QEXI 2V26A 1G3WA 5BQTA 5E1XA 2RAEA 3FXMA 1N75A 1LDDA 1IXCA 3OYKA 1A31A 3GCMA 4I98B 4CYCA 3DFGA 4M72A 2DOFA 4XLCA 4CCJA 2R0QC 5E79C 1A04A 3EYYA 2OPTA 4D7MA 1HKQA 1JI8A 1SD4A 3I5UA 5AIPA 5TISC 1MGTA 1SMTA 2KT0A 1C0WA 1YW9A 4CZCA 3Q9VA 1ETYA 1UJ8A 3H9GA 2QQBA 1R1UA 3LSTA 2E35A 2L5QA 1O7LA 3GWZA 4HV5A 4CDGA 5E20A 2EINH 4N0BA 1YS6A 4HF1A 4PGHA 5E3NA 1YJ9I 3LSKA 3HBLA 3N05A 1QZYA 2OJED 3K70C 4U7DA 3G1OA 4L5JA 3V7CA 1FNNA 5HDNA 2WBMA 3REOA 2RDPA 1RETA 5BS6A 5EZGA 3KEYA 3MEXA 4JX6A 4BXXJ 1XG1A 1LQ1A 2FBHA 1V55H 2W84A 3C2BA 2NVTJ 3GYHX 5FKNA 5J3LA 1TTYA 3RKYA 1USTA 3ZRGA 2E7WA 2LTPA 2ZBKA 3LFKA 5J1YA 4AIJA 1HC8A 2ECBA 3FM3A 3CMAI 3JTGA 2HOEA 1U9OA 3JW4A 3CO6C 2VODA 4IHTA 1FBQA 3ZPLA 4CYCB 2X1DA 5FD5A 3J80K 3OOUA 1EH8A 2QGUA 2EFQA 4EATA 3ZMVA 1Z21A 1S7AA 4WF2A 4BL0B 5F1RA 4PJLA 3PO3J 3GX4X 1AOYA 1HQCA 2DPDA 4CCMA 3M9AA 4ANJA 3ZN0A 2W25A 1KU3A 4EJWA 2L7FP 3JRGA 2V7FA 1QPIA 1GXQA 1UHWA 2KMUA 3I58A 5J4YA 3LOCA 1VQOI 1PYVA 2LLKA 3F8MA 3TOBA 2VOPA 3CJRB 3CCRI 4BJTA 4DIQA 3MKZA 3I59B 1QHGA 2CU7A 2E2JJ 2QBYB 2DU9A 1GLNA 2LKPA 1O7FA 2DODA 2RKHA 2VL8A 2XAFA 2JWTA 4W1UA 2OA4A 1VQPI 1YG2A 2FOKA 3B6CA 3OSGA 1T8IA 4Y17A 4XNFA 3VODA 2JSCA 2O7OA 2FEZA 2WC2A 1VTNC 3DEEA 5CVUA 4A0ZA 1YJWI 5CVIA 1GUUA 4XIDA 1JHFA 1BOAA 2R4GA 1BJZA 3E6BA 1YFHA 4MQVA 5IYBJ 2E19A 1KU7A 1EH7A 2PI0A 3KIOA 3BQYA 1WZ2A 3OYBA 3QYBA 3H0DA 5F0FA 1E3HA 1HBXG 1I5ZA 2H6CA 2DA5A 2ELHA 4R79A 1TP4A 1BIAA 4A0XA 1BW6A 5IYCJ 3PSFA 1JGSA 2VN2A 1NK2P 4ZTJA 2KDZA 3EDPA 2R93J 2IGOA 5CPRB 1P9QC 1FT9A 1PP7U 1WCMJ 3I71A 1NG6A 5B1BH 1RIOH 3A02A 4IJAA 4C3JJ 1D0XA 2IGNA 3OWTA 2K9SA 1G59A 1X1DA 1PUFB 1ONVA 3FXUA 2JRTA 1Y1VJ 1FOWA 5HS8A 2P5VA 2DA7A 2L3DA 2WV1A 3K4JA 3CCYA 2ZJQF 4GYIA 5D6EA 1D0ZA 1Z6RA 4UNOA 3BC8A 2B9SA 4XL9A 1O57A 1Z7LA 2IA2A 3BP8A 2MA3A 2OCCH 2DXIA 1Z7UA 4WK8F 2HDDA 5GTHC 2DN0A 5KK1A 2V1NA 2F5EA 2P8TA 2VJ4A 1Q1HA 4B47A 1T56A 1JKRC 4XLEA 4L9NA 1LEAA 1XSVA 3KP7A 1ON2A 3G71I 4KFCA 2ZSIB 1SD7A 1OR7C 4IKFA 3S32A 2COMA 1H0MA 2XKPA 2XDVA 4KT6A 3BPVA 2UXXA 3QP6A 1LE8B 2BY2A 4B3AA 3K6GA 3M8JA 4KN4X 3SZPA 5ILUA 1R58A 3PNYA 1A6IA 3CCQI 2CO5A 1WWXA 3BG3A 2I5UA 3HUGB 3PL8A 1VQMI 2CV1A 4GFBA 1J7KA 1ORKA 2JA8J 2V9KA 1U2WA 4MEXF 4ENMA 1ZRCA 2DAOA 4I0AA 4FQGA 3E1SA 3Q5FA 1VFCA 1OKRA 2JVHA 2D2WA 3GMEA 5IOZA 4OMZA 3OS1A 3SJMA 2VJIA 4XKCA 4LLNA 2XROA 5EGOA 3QPLA 1YRNB 4Z2YA 1Z1DA 1A6QA 2ELJA 3FX3A 1KONA 2CW7A 2NXNB 1SFOJ 1I3AA 3OR2C 1HLVA 2KPMA 5CLSA 4C2UA 3LA3A 2GBYA 2BE5F 3V42A 2FMLA 4FE7A 4A3IJ 5FRNA 1FOKA 1J59A 1ETQA 5CYVA 3TW6A 1R4MB 1T98A 2HOTA 5D4RA 1XTAA 1UMQA 1G4DA 2L2OA 3GLLA 1EF4A 2ZNZA 4PUSA 3V7RA 4Y13A 1BI3A 4DBQA 4XQFA 4I01A 4NBQA 4CCNA 1ACIA 2Z5UA 1MJBA 2MLGA 5ICFA 3E5XA 4HDVA 3HTSB 3VSLA 4ZZDA 5M3MJ 4XONA 2MYSA 2BOLA 3I4PA 2QUFA 1SC7A 1MMDA 4X0GA 1ZN2A 3B6AA 2XB0X 1AA7A 2DMTA 4E6KG 2WAQA 2PEXA 2E60A 3S8PA 2ME0A 3OYNA 2JRMA 3OYHA 1ZR4A 4C3IJ 3U1DA 4YIFA 3FKIJ 5E1ZB 4KIBA 2FNAA 4E7KA 2EPFA 2D45A 1UCRA 4WWCA 2XF5A 3QYFA 2WY8Q 3EUHC 2Z16A 2A6EF 4JOMA 4JX5A 1FMVA 1JKQC 4UVBA 1UELB 1MNMC 4BKXA 5DCMA 5IT9K 4KMUX 5J8CA 3CMEI 1ZELA 3L9FA 3M07A 5TRDA 2Q2EA 2ZMEB 3HRTA 2OUMA 2QSHX 3OIQA 3FHNA 1T08B 1UZCA 2O03A 2HOSA 1SVOA 4MNUA 2LBFB 1RZ4A 1REPC 1FP1D 3FXKA 4EJTA 2LR8A 4PK4A 4XICA 5D5VB 2XAGA 3HKZN 4M71A 4HSTA 1D3YA 4RB2C 2IW5A 1G3SA 3GUDA 3J7AO 5CVVA 3W6JB 1MKMA 2JMWA 4EMSA 4YELA 4OAYA 2COBA 2H1LA 2ZKZA 3AG4H 2ME6A 1SAXA 3WODF 3I55I 3E5UA 2AXTC 4MLOA 2PJRA 1WJBA 1ZREA 2JN6A 3CDLA 2MGQA 4OIRF 5FRMA 2K4BA 3MMYB 2WADA 4LIVA 1Y6IA 2NVYJ 2PLYA 1FYKA 5F04A 3GTGJ 4IRHA 4UV8A 5HLIA 1UG2A 4ESBA 4U87A 1TLHB 2BW3A 2GAUA 5JVGF 1ZYRF 5FJ8J 2F5FA 3CF2A 4OIOF 3FMQA 4I09A 2W1OA 2DI3A 1S5LC 4BBRJ 4GYGA 2KJCA 3ROUA 2K27A 4HOBA 3KYLA 3HOVJ 1XGNA 2DA2A 3IUOA 3OV8A 3O8HA 2WB1N 2DA1A 1EA3A 3GFMA 5H6RA 3S3OA 3PIOF 3HYIA 2MBFA 3LFUA 3ZN1A 3K4KA 2G7UA 1W36D 2M2EA 2WTEA 5FLMJ 2KIMA 3ERED 4BDYA 2X1CA 1UG0A 3JRFA 3C2GA 2O9LA 2Z1DA 5HS7A 1S72I 4ITVA 1A35A 3ELKA 2ADUA 1P4AA 2VBZA 3CP8A 3TQNA 4U0VA 2X85A 2MW8A 1F4KA 2DTZA 3JRAA 2CSOA 3H1CA 5DUIA 2JPCA 3CCVI 2DQRA 2G9WA 1MSFC 1J2XA 5GPAA 1R9TJ 2DDAA 2C6YA 4H4KC 1MBEA 3EUAA 1D1CA 4HX7A 2BY0A 2XIGA 4ENJA 3BR5A 2VJ5A 3BG9A 3Q0VA 4C9YA 2GIVA 2DK5A 4ZH4F 1DDNA 4MO7A 4GDFA 3KLOA 3FWEA 3CCSI 1DUXC 5CVRA 2ZXWH 3WU1B 2JA5J 1ODDA 1WGXA 3VOEA 4LK0F 2VC0A 1SAUA 3T1BA 2KKOA 3H9JA 4FT8A 2ZC2A 5CQEA 3FXQA 4P9FA 5LEKA 3R0JA 4IX7A 4IHSA 1YLFA 1WQ2A 1KU9A 4HX8A 3PQJA 4RB3C 2YUSA 1OR7A 2WAFA 4CICA 2CFXA 4BHBA 1Z77A 3KX2A 4D5CA 2EZKA 3KP6A 4NNJA 4HNTA 2NAZA 4JK1X 4BGDA 3GTQJ 3ULQB 3VYRB 4M6VA 1T0FC 1B8IA 3QOEA 1K6OA 2EV5A 3OYIA 3BG6A 3DU6A 1U5TA 2NS8A 5FGMA 3BPXA 1OFCX 1AU7A 5EF6A 2LG4A 1JUMA 2OTJI 2VI6A 1X3UA 2RNJA 4L5IA 1SVLA 2BHYA 2KISA 1LVAA 3RYPA 1FTZA 3K2AA 2GIZA 5E3MA 3F8BA 5C4XJ 1OCOH 1VI0A 3LSMA 3MFKA 1FSEA 4XLPF 1NH3A 1XSXA 3FKJA 1TNTA 2JK3A 1HW2A 1IV6A 3DF8A 3CC4I 3L2CA 1L3LA 3K10A 2ZMEC 3LSIA 1MNEA 1X2NA 4HEA2 1I39A 4PGGA 4OMYA 2Y69H 4Q48A 2ETHA 1ULYA 3WG7H 4F52A 1ETKA 4XMYA 5JHFA 5EEAA 1I6HJ 4ZDLA 1X4OA 3OYDA 5LLQA 3K0LA 5K5OA 1K83J 1MW7A 1HA8A 3HGGA 3CQZJ 5M5XJ 1ETOA 3TKYA 4IVNA 2M1BA 4D0PA 1DP7P 1JGGA 3HC7A 2R7ZJ 4L18B 3BLYA 4XOTA 2M8EA 4PJMA 3D5SC 4Y3OA 3T0YA 4UUSB 5DD4A 1IXSB 2MLKA 4NUBA 1VQ7I 4CHUA 1Y39A 4E4HA 4LG3A 1E3PA 4BHCA 3WU2C 2R92J 3F23A 3OL3A 4LB6B 3L09A 2JA2A 3LSRA 3RI4A 2JA7J 3HTUA 5F1JA 1HKSA 3ZQ7A 2DA4A 2PN6A 1IN6A 1R71A 4ABZA 1FJLA 4S05A 1U78A 3IKVA 1GDTA 2QSGX 3A4CA 2ZJ2A 1B6AA 3BJOA 5FD6A 1SVMA 2Y75A 1B1BA 3CLQA 2A05A 2HWVA 1XPXA 1ZH5A 1B9MA 2BGCA 2LKXA 1MIJA 5J1UA 4DZJA 2W4SA 3HOZJ 3IRRA 1UAAA 2G0EA 2YPRA 3UKGA 5IYDJ 1YW7A 3HEFA 2OV7A 1JKPC 4XRSA 1WJFA 1IF1A 3RSNA 3CCEI 2HTJA 4J19A 4E7HA 1H89C 5FKKA 3I4NJ 1XMXA 2DDBA 5L3EA 2IS1A 4XK4A 2MD5A 2M5WA 4IQ4A 4YG2F 4BS9A 3OYAA 3AFHA 3SZGA 2F2EA 2XGXA 3RQ4A 5LHGA 1ZG1A 2D1VA 1YW8A 5D5WB 2YX4A 2VXZA 3GVAA 1X2MA 1LKXA 2DQLA 4A12A 3R0AA 3I4MJ 4KMFA 1Q1VA 3DEUA 1FZPB 3I64A 4AM3A 4M3BA 2RN7A 3D5RC 2NOJB 1R00A 4O3MA 3ZQQA 4FHTA 5A2QZ 2FE3A 2MABA 2M34A 2STWA 2L54A 9ANTA 4XN3A 1JT0A 3RKQA 3OIPA 3DLLF 5HNHA 3DEWA 2L7KA 3RTRA 4AIHA 1WI9A 4EQQA 2O8KA 1UHMA 2L4MA 4AYBN 5LGUA 1VQ6I 1KYZA 2HKOA 3N4MA 4ZJZA 1T0FA 5HOOA 2EV0A 3KP2A 1D8JA 1U5TB 5DCMB 2RGVA 2JT1A 4A3FJ 5J4VA 2NRAC 4UUVA 3FXRA 2IGMA 4GO1A 3U21A 2QA4I 3A01B 4IRIA 5C44J 1P6RA 4ENNA 1W4MA 3IKTA 4U0WA 2NNNA 2V1DA 3HUGA 3VYTB 2FSWA 3BZCA 2LYCA 3JRCA 4LJZF 2CQQA 3DXJF 1F1ZA 3BWGA 5EEGA 2K7LA 4J01A 2HDWA 2K85A 4B8XA 2FF4A 2L9VA 2VQCA 3BTIA 3SFZA 1V4RA 3JREA 4B48A 3F8CA 4CCKA 5CQGA 4LK1F 4UVCA 4XOPA 3TDUC 4RBOA 4AC0A 2BXYA 2CQ7A 4UY8I 3GFLA 3ZMDA 3ZXSA 4H0EA 3TO9A 3ERMA 4AIKA 1NK3P 2Y0MA 1EH6A 4S04A 4G9YA 3HOXJ 4YEJA 3BTLA 2DJNA 3A2KA 2NVQJ 4A3DJ 3PO2J 3EQLF 2Y30A 2DTRA 2QQ9A 2GLOA 3FIWA 5B1AH 1W0TA 2HNHA 2LRDA 4AWXB 2KLOA 5F64A 2M9HA 2VIXA 3DV8A 4RAFA 4B1RA 4A3KJ 2OZUA 3ONQA 1JUPA 4FE4A 1U3EM 2HGCA 3KP4A 4WXHA 3L2WA 5L3BA 2CH0A 2FNPA 4XKWA 2LP0A 2X6XA 4AVZA 1H9TA 1KQ0A 2N8GA 3EUKL 3K1PA 2VUMJ 2EFNA 4OINF 2XGCA 4BU2A 2VONA 3I3LA 1WJCA 3F9KA 2XPVA 5IT9Z 3F22A 1YS7A 1VQ9I 1T2KA 1SD6A 4F7ZA 1HKTA 2X48A 1ZHFA 1X58A 2LC2A 3C18A 2E1NA 2UV1A 5IP7J 1R7JA 5H2FC 5DDGA 1ZAOA 1H8AC 1FYLA 3DLAA 2M87A 1IUYA 2YX7A 2OQRA 2VBYA 1Z0XA 2DOEA 2MC4A 3OL4A 4L9VA 5F27A 2CV0A 4HW0A 1FSHA 5J8FA 3M8FA 4HX4A 4IRGA 4BJ6C 1X4PA 5GAEJ 3MZYA 2P6SA 4RGUA 3DQVC 1DPUA 4C3HJ 4RDUA 3S2WA 3GW2A 3IWFA 1J9IA 2RV8A 4XSXF 2GZWA 2NNYA 4D1QA 4MFDA 5JHUA 1EV7A 3WTZA 2E2HJ 2EFWA 1P7IA 3JRIA 2CG4A 4G6QA 1BIBA 1BM9A 1WJDA 1R5ID 4PJ0C 4RM3A 1IAWA 4R8HA 5DM7F 2Z3YA 2AXLA 5K5RA 1YIOA 1P92A 2P4WA 3BT9A 2O3FA 4BHPA 2WAQN 3W2VA 1SFUA 1J09A 1ON1A 2PMZA 2DT6A 1IN7A 4OWRB 1BI0A 1TQIA 3OR1C 1IRXA 4NDLA 2DO7A 3Q0WA 5F0HA 1BC8C 2L4AA 4A5MA 2P5LC 2B0LA 2GOMA 2ZJRF 4BE1A 5L3CA 4KYWA 1FP2A 2IJLA 3SEZA 2R7RA 2XVCA 1SMYF 1S6LA 2QCOA 2LD5A 1U8RA 2Y48A 2XF6A 2NYXA 1LUJB 3JSOA 2K86A 1YX3A 2F6CA 2X4HA 5CKTA 3HRUA 4HZFA 4JQFA 3G73A 1TWGJ 1V5FA 4ZTFA 3P5JA 3J81K 1YJNI 1XD7A 4BUPA 4ZYGA 1GXPA 4HBLA 2L0KA 2QF7A 3HM5A 4F93B 3BR0A 4EJVA 4CSWA 2IA0A 2PMZN 3QU3A 2IP2A 4AIDA 2BXZA 3CZ6A 5KHDA 2D5VA 1GHCA 1U5TC 5DD8A 1R23A 2OD5A 5TJJA 2R7DA 4B3XA 5LD2C 3WU0A 2E7XA 3ML6A 3MVPA 1HDDC 4IHWA 3AG3H 3B02A 1H88C 2LY1A 5DCFA 2QKMB 5GAGJ 3CJQB 3ABMH 3X2QH 1LFUP 3ZQGA 3FXJA 2QQAA 2UWMA 3ABKH 3TEDA 1KU2A 1ZLJA 2QENA 1QU3A 4QTRA 2HQRA 2FQ3A 4NHJA 2EBIA 4DW6A 3GFIA 3PM1A 1WI3A 3GLXA 4P5OA 2BV6A 3IAM2 3S16J 3QWLA 2R7VA 2M45A 3IV5A 3QQAA 3GXOA 4IPAA 3FHZA 1OCCH 1U6GA 4A0YA 1VQ4I 2QSFX 4ON0A 2NOGA 5ED4A 2V1XA 2ZO4A 3BTJA 3CMMA 1XGSA 2W7NA 1WKMA 1FYMA 4KDPA 1ZRFA 5E8GA 2L9NA 1I50J 5ERIA 3CDHA 3BTCA 5GPCA 2KJBA 1BJAA 3DPLC 3K70D 4QLCU 2Q1ZB 5E17F 4XR6A 2X6YA 1Z3YA 4V2FA 4YFKF 4UUSA 4UXNA 4HV6A 2K5CA 2QQ8A 2HI3A 4N9IA 2E1CA 4EJUA 2K02A 3H3ZA 3HPHA 1IN8A 4B44A 2VBXA 1KYWA 4A5NA 3CTAA 2V79A 3QPHA 4MQ9F 2F5DA 1XSDA 3BR6A 3GFJA 4UB8C 2BVLA 2XRLA 2EA2A 3A03A 3LSPA 3F6VA 3R61A 1WFXA 2CUJA 1GV5A 1F36A 3ABUA 3BG5A 3HHHA 2KQRA 4MGRA 3KYDB 2ESHA 1D5VA 5HNFA 3GF2A 4B43A 1ZK8A 3EUHA 1BBYA 1YRNA 5ICGA 4LITA 2LFBA 4LIUA 3GTOJ 2DMUA 2ELKA 4MTEA 3BZKA 2JZYA 2NS0A 4Y7NJ 1ZLKA 3DP7A 1ZGJA 2PG4A 1XCVA 2VT2A 5BOXA 3GTPJ 5DEQA 4YFNF 2STTA 3PQKA 1VQNI 1R36A 3OSFA 4E7IA 1FOYA 2LREA 2WAEA 2EILH 3K4NA 4EVIA 1W7PB 5K7ZA 2ZB9A 1HSJA 1W7PD 4L9TA 3FMRA 2KRFA 4FISA 2F48A 1ERDA 4UV9A 5LHHA 1XB4A 1MJ9A 3CUOA 3ZMZA 4XBFA 2CUZA 2QYOA 2QKLB 4KIFA 2KIUA 2L9SA 1ZR2A 4XN0A 1K61A 2A07F 4DYRA 2YSRA 3D1NI 1SFKA 4YIRX 3CCUI 1I1GA 1N25A 3C2HA 3K1NA 2M8GX 3HDDA 4Y33A 2KIFA 3H5RA 2H1KA 2WA0A 3MD2A 3LSGA 2XB5A 1K4TA 4ZZLA 1QBJA 2OTLI 2E34A 4RAYA 2AHQA 2R7WA 4J00A 4BDZA 5HDKA 2JJ7A 3GEZA 3S2DJ 4RA2A 3CMYA 2CUEA 3KZZA 3HGYA 4HQMA 2OQGA 4E7JA 4RLFA 3KYCB 3AL0B 2FD5A 3QOPA 1Y56A 3VSKA 3K2ZA 1OJLA 2RQQA 5DM6F 3TMOA 2JQ7A 3W2AA 2YR2A 3L2QA 2QWWA 2PX9A 1GV2A 4MHGA 4ZC3A 5E8IA 2J5PA 1E0EA 4A93J 4I0BA 3PFYA 3W6KB 3JR9A 2VPLA 2XKOA 2YS9A 3S3NA 4UB6C 1KGSA 3F3XA 5IOYA 2KP6A 3ZGKA 2LDUA 1TWCJ 2HZDA 2BZTA 2ZJPF 1D1AA 1W36C 4DGWB 1O3QA 3GZNB 3FZVA 4OAZA 3ASOH 3RZOJ 4HSRA 3QYEA 3VPRA 2PQ8A 1ZGAA 1WPKA 2J5OA 3DTIA 2GXBA 2XSJC 1SFEA 5ILSA 2UXNA 3LNQA 4K2EA 1RUOA 1OCTC 3PFIA 3E7LA 1RKTA 4PSWA 2P0WA 2VT3A 1X3ZB 2ZFUA 1EKEA 2DFEA 2VE8A 5K5QA 1SEUA 5KAIC 2EJRA 1BI1A 2EZHA 5LRSA 3QP5A 1VQ5I 3DBHB 2W00A 2O8XA 1BA5A 3LQQA 3EPZA 1JXSA 3JRHA 3IHUA 3CCLI 2XRNA 2IS4A 2DFHA 5E3LA 3A1YA 5HLTA 4HLYA 1ZARA 2DA3A 2ACJA 2FMYA 1WJAA 5LBQA 1UHSA 1MJAA 2V9VA 3WE3A 1RR7A 4U0YA 3I59A 1B9NA 4B4CA 1PJRA 3ECHA 2FUG2 2OBPA 4XM3A 1XMKA 2FJ1A 2W57A 3ZQLA 3HOWJ 3TP3A 5HLHA 3CC2I 1HSTA 3KPHA 2DT7B 3ASNH 2CW8A 1T6SA 3TBIA 1ETVA 2M0CA 2XGDA 2WY7Q 3L7WA 2HPMA 4BNCA 1QVTA 1TQMA 1IZ1A 1B59A 4AU7A 4WX9A 2FBKA 3NEUA 2R7SA 3E6DA 2WWYA 2X6WA 3WTYC 3ZMTA 4ESFA 2EIKH 1RR8C 2LK2A 3S2HJ 1KQ9A 2VE9A 1LVKA 1OQYA 5KNLA 2LSOA 3HJEA 4RLQA 3OYMA 3DPUA 5HS9A 3MAJA 4I02A 2O6GE 2DCEA 2ISZA 1FIPA 3HSFA 4RM2A 5EZHA 3CCMI 4FCYA 2CQNA 3S14J 2EK5A 2CRGA 4BAYA 1S3JA 1O3SA 2RC4A 1JTXA 1OLTA 5EG0A 2ZNYA 4WXDA 1CQTA 3DU5A 1DGWY 1G8XA 3HRSA 1LDJA 1D8KA 3HSEA 2HU9A 3J7YJ 3MKLA 3T5XA 2KZGA 4I2OA 4E70A 2ZXJA 3CLOA 1X1PA 1WJ5A 1YYVA 1A36A 4BY1J 3FBNB 1Z3XA 4Y15A 3ZMUA 5H20A 3MKYB 4V2GA 3HOTA 2XF7A 4XRFA 3PNVA 4E7SA 4A3MJ 5DYMA 3TO7A 1SANA 2EB7A 2VKEA 4PFPA 1QA6A 2VKHA 3BR1A 3WTWC 2V6CA
chains in the Genus database with same CATH topology
1K79A 3U9GA 1K78B 5ICEA 2XAHA 2O0YA 2D1HA 1XDUA 1PP8F 1WRJA 2ZCWA 2VBWA 4LLGF 2PJPA 4PZJA 1OYIA 4UVAA 4R1HA 3P9IA 3K1MA 2HDCA 4DQ2A 3RIRA 3CUQC 4GCVA 1OYYA 1IN5A 3IWZA 1Z05A 2HYGD 2GQQA 1P4WA 1IXRC 2MH2A 3P9KA 2EWNA 1H9GA 5F6FA 3LAPA 1QZZA 1FY7A 1L0OC 2QBYA 4I7HA 4G7HF 1BC7C 5FO5A 1IW7F 1G3TA 2QZ8A 1WSUA 1S7OA 4Q5SF 5FFXA 2OZ6A 1TBXA 3O3KA 3JAMZ 4RB1A 4RGRA 4G7OF 3SQNA 3J81Z 3HRMA 3RDIA 4DNCA 3LA7A 4LGWA 1JHHA 4A2UA 1XGOA 2LF7A 1CF7B 3FF5A 3TOAA 4U7BA 1YO5C 3KP5A 2PMHA 2DBBA 3KP3A 1F5TA 2CYYA 1QO0D 2CQKA 5AONA 1O3TA 4HQEA 2W24A 4ETSA 2GWRA 5JI6A 1K7AA 3JSPA 4HYEA 4M9XA 3EETA 2EFPA 5D4SA 2RVCA 2CWEA 1MD0A 4P96A 3VFZA 4EM1A 3H92A 1I1SA 1GVJA 2Z99A 5KVRA 3SZTA 2LF8A 3MQ0A 3E5QA 3R4KA 1S29A 3NQOA 3RKXA 5D5UB 4PDKA 3QAHA 5D8KB 4KIGA 1R22A 4WCGA 3D0SA 1FPQA 2HTSA 3BDDA 1P4XA 3O6BB 1Y0UA 3TGNA 4G8XA 5CJ9A 1ZG3A 1FX7A 3K69A 3L00A 2Q0OA 1RNLA 3RKWA 1YTYA 2W85A 2HEOA 3F8FA 4EGZA 1R5GA 3QRFF 1XCBA 1R1TA 3MCZA 3V7SA 3BOQA 4LB5A 5L3DA 2UZKA 3CUQB 5FFZA 2Q8KA 4P9UA 4EJOA 3V8JA 4BXUA 3LWFA 3I53A 2FXAA 2XASA 2XUBA 1TW2A 5D6FA 2BBYA 3WGGA 3QU6A 4OIQF 4BH9A 4L0YB 2DPUA 2F5CA 2ISYA 2O61A 5CVJA 3KZYA 2GA1A 2DK8A 2P7VB 3DPTA 4EV0A 4B09A 5L3FA 3M7GA 2V1UA 4TV7A 1S8NA 1HW5A 5DUKA 2FRHA 3O2PE 3DKWA 3WTVC 3WTSC 4HF2A 4RS8A 3ISPA 4BYYA 1UB9A 5DV5A 2DLLA 2P7CB 4CO8A 4ESJA 2DFIA 4LG0A 3KLNA 1E17A 2FBIA 4L0ZB 1IRFA 3BY6A 2A6HF 1FLIA 4ZYHA 3QPTA 3IRQA 3COAC 3CJNA 1TNSA 2IRFG 1HW1A 2BEOA 4KA4A 3CO7C 1USSA 5FLXZ 1JE8A 4G94A 3I54A 5L3GA 3GO5A 2BYVE 4HLXA 1IRGA 2Z33A 2DW4A 1HXDA 5BPIA 1XDSA 3IL2A 4XSZF 2A61A 4WXCA 1XGMA 2PBIA 3M1EA 1QQIA 1I27A 2G7HA 4M73A 4OOIA 4LFUA 2Z9OA 3KEQA 2A69F 5ILVA 3TO6A 2X0LA 4XLNF 1CF7A 2PFBA 2OU2A 3LA2A 3ABTA 3BROA 2IVMA 4JBAA 4ZYDA 2LNBA 3CUQA 4QWQA 4P55A 1LJ9A 2HYFA 2MC3A 1LDKB 4KT5C 2EV6A 3P9CA 4OIPF 5LHIA 2WV0A 3H3UA 4HDUA 3P7NA 5HLGA 2ZMEA 5JVTA 5D8LB 4NB5A 3OOPA 2XAJA 2PMUA 3F8NA 3JTHA 1Z9CA 3R6SA 3AAFA 4YIIA 1SFXA 2QLZA 1W5SA 1PUEE 4OU0A 3FMSA 3V4GA 5D5XB 4O6JA 1I6XA 1BN5A 5EEHA 4LD5A 3KFWX 2IT0A 4ASNA 2K4JA 2XV4S 2H94A 5H6QA 4AD9A 5J6XA 4KUMA 1F9NA 2H27A 2R7FA 2EA4A 3J80Z 3IC7A 1V3FA 4Q4ZF 2CW0F 3WTXC 5LGNA 5AIQA 3BJ6A 3F21A 1CGPA 4EM0B 2P6TA 5FB2A 4M6XA 4U88A 2HZTA 3F6OA 2HFHA 2A68F 2GXGA 1MDMA 3KCCA 2VC1A 2QM3A 1ZG5A 2L02A 5FLXK 1QNTA 1OPCA 3RPQA 4O5VA 1FBUA 5HVQC 1IN4A 3WTUC 3VB2A 1TQPA 1FC3A 5LRRA 2AS5F 4LG0B 2HS5A 3EYIA 1STZA 5JFRA 1P2FA 3Q9SA 3WE2A 3VEPA 2HR3A 3M8EA 4EGYA 4RGSA 4MTDA 3T8RA 3HSRA 3RYRA 3V8KA 2HQNA 1R5HA 1T39A 3KE2A 4IXAA 1YQAA 3SXYA 1B4AA 2IPQX 2H6BA 5E18F 2DT5A 2IA1A 2OAZA 1ZRDA 4HAMA 1E2XA 3KEOA 2R3SA 3E6MA 1K78A 3FM5A 3C1DA 3JAMK 3SHFA 4FX4A 4LLLA 4FX0A 2EFOA 1RUNA 2QVOA 4RAZA 3NRVA 3I0TA 4AVPA 4PCQA 4CGZA 4HF0A 3HIFA 2RQPA 3GZ6A 4HA8A 5HDGA 3MZHA 2ESNA 1J0RA 5A2QK 1QPMA 4KICA 3HOSA 4NQWA 1MZBA 3E97A 3RPUA 1LNWA 2ZFWA 1NHAA 1FBSA 4BQAA 1G6NA 3WGHA 1T38A 1TW3A 4L9JA 5K1YA 2JTVA 1KQ8A 2TDXA 4LMYA 4CXFA 4M9SA 1Z91A 3HHGA 3E3VA 4KN7X 3C7JA 2YU3A 3WGIA 1R1VA 4CZZA 2H09A 1RI7A 4RGXA 2XHKA 4N9HA 3KETA 3LQRA 4G7ZF 2CGPA 3WG9A 4GXOA 3D5LA 4IF4A 1LB2A 1O3RA 4M74A 3K9TA 4KNYA 3WTTC 1QGPA 4A6DA 3GZ5A 4M6YA 3E6CC 1KA8A 1AWCA 4UHTA 1W7PA 1Z6TA 3ZMSA 3V8LA 3MWMA 2P5KA 4A6EA 3G3ZA 2A5YB 3LAJA 3N97A 1FWZA 4RB0A 1J5YA 3BJAA 5BPDA 1OMIA 3TDZC 2A3SA 4EM2A 5E1WA 3ECOA 1MDMB 3C3WA 1XMAA 2MH9A 1SD5A 2FU4A 1BI2A 2XAQA 4CYDA 1XN7A 3F72A 5ICCA 2HKXA 1DPRA 5JR3A 4GGGA 3U2RA 4MEYF 5IT3A 5LEJA 5BMZA 1W5TA 2JPBA 1LEBA 2L01A 1G3YA 3BZ6A 4G6DA 1J75A 4ENKA 2GA2A 2FA5A 3R60A 2M30A 6PAXA 3RJPA 3T8TA 3ZP5A 4M9ZA 1PDNC 1UFMA 2VOOA 4YFXF 4ZYEA 1OYWA 3B73A 5LGTA 4Q47A 1G3WA 5BQTA 5E1XA 1LDDA 1IXCA 4I98B 3DFGA 4M72A 1A04A 3EYYA 1HKQA 1SD4A 3I5UA 5AIPA 1MGTA 1SMTA 1C0WA 1YW9A 3Q9VA 2QQBA 1R1UA 3LSTA 1O7LA 3GWZA 4HV5A 4CDGA 5E20A 4N0BA 1YS6A 4HF1A 4PGHA 1QZYA 4U7DA 3V7CA 4L5JA 1FNNA 5HDNA 3REOA 2RDPA 5BS6A 3MEXA 1LQ1A 2FBHA 2W84A 3GYHX 3RKYA 1TTYA 1USTA 2E7WA 2ZBKA 3LFKA 4AIJA 3FM3A 3JTGA 2HOEA 3JW4A 3CO6C 2VODA 4IHTA 1FBQA 3ZPLA 5FD5A 3J80K 1EH8A 2EFQA 3ZMVA 1S7AA 4WF2A 5F1RA 1AOYA 3GX4X 1HQCA 2DPDA 3M9AA 3ZN0A 2W25A 1KU3A 4EJWA 1GXQA 1UHWA 3I58A 3F8MA 3TOBA 2VOPA 3I59B 2QBYB 2DU9A 2LKPA 1O7FA 2RKHA 2XAFA 2OA4A 1YG2A 2FOKA 4Y17A 3VODA 2JSCA 2FEZA 2WC2A 1VTNC 5CVUA 4A0ZA 5CVIA 1JHFA 1BOAA 3E6BA 1YFHA 4MQVA 1KU7A 1EH7A 2PI0A 1HBXG 1I5ZA 2H6CA 2ELHA 4R79A 1BIAA 4A0XA 1JGSA 2VN2A 3EDPA 1FT9A 1PP7U 3I71A 1RIOH 4IJAA 1ONVA 3FXUA 2JRTA 5HS8A 2P5VA 2L3DA 4GYIA 5D6EA 1Z6RA 4UNOA 1O57A 2IA2A 3BP8A 2MA3A 1Z7UA 4WK8F 5KK1A 2F5EA 2P8TA 1Q1HA 4L9NA 1LEAA 1XSVA 3KP7A 1ON2A 4KFCA 1SD7A 2COMA 1H0MA 2XKPA 3BPVA 2UXXA 3QP6A 3SZPA 4KN4X 5ILUA 1R58A 2CO5A 1WWXA 1J7KA 4MEXF 1U2WA 4ENMA 1ZRCA 2DAOA 4I0AA 3Q5FA 1OKRA 2D2WA 4OMZA 4LLNA 2XROA 4Z2YA 1Z1DA 3FX3A 5CLSA 3LA3A 2BE5F 2FMLA 1FOKA 1J59A 5CYVA 1T98A 5D4RA 1G4DA 2ZNZA 3V7RA 4Y13A 1BI3A 4I01A 2Z5UA 1MJBA 2MLGA 5ICFA 3E5XA 4HDVA 3HTSB 4ZZDA 3I4PA 2QUFA 1ZN2A 2PEXA 3U1DA 4YIFA 5E1ZB 4KIBA 2FNAA 2D45A 1UCRA 4WWCA 2A6EF 4UVBA 5DCMA 5IT9K 4KMUX 5J8CA 3L9FA 5TRDA 2Q2EA 2ZMEB 3HRTA 2O03A 4MNUA 1RZ4A 1REPC 1FP1D 4EJTA 5D5VB 2XAGA 4M71A 1D3YA 4RB2C 2IW5A 1G3SA 3GUDA 3J7AO 5CVVA 3W6JB 1MKMA 4EMSA 2ZKZA 1SAXA 3WODF 3E5UA 1ZREA 4OIRF 2K4BA 2PLYA 1FYKA 4IRHA 4UV8A 5HLIA 4ESBA 1TLHB 2GAUA 1ZYRF 2F5FA 4OIOF 3FMQA 4I09A 2DI3A 4GYGA 2KJCA 3ROUA 2K27A 4HOBA 1XGNA 3OV8A 3GFMA 5H6RA 3HYIA 2MBFA 3ZN1A 2G7UA 2WTEA 2KIMA 3ERED 5HS7A 3ELKA 2ADUA 1P4AA 2VBZA 3TQNA 4U0VA 1F4KA 2CSOA 5DUIA 2JPCA 2DQRA 2G9WA 1J2XA 2C6YA 4HX7A 2XIGA 4ENJA 2GIVA 2DK5A 4ZH4F 1DDNA 3KLOA 3FWEA 1DUXC 5CVRA 3WU1B 1ODDA 3VOEA 4LK0F 2VC0A 3T1BA 2KKOA 4FT8A 5LEKA 3FXQA 4P9FA 3R0JA 4IHSA 1YLFA 1WQ2A 1KU9A 4HX8A 3PQJA 4RB3C 1OR7A 4CICA 2CFXA 4BHBA 3KP6A 2NAZA 4JK1X 3ULQB 1K6OA 2EV5A 1U5TA 5FGMA 3BPXA 1X3UA 2RNJA 4L5IA 1LVAA 3RYPA 3F8BA 3MFKA 1FSEA 4XLPF 1XSXA 1TNTA 1HW2A 3DF8A 3L2CA 1L3LA 4PGGA 4OMYA 4Q48A 2ETHA 1ULYA 5LLQA 3K0LA 5K5OA 3TKYA 4IVNA 2M1BA 4D0PA 1DP7P 4L18B 3T0YA 2M8EA 5DD4A 1IXSB 2MLKA 4CHUA 4BHCA 3F23A 4LB6B 3L09A 3RI4A 3HTUA 1HKSA 3ZQ7A 2PN6A 1IN6A 4S05A 1U78A 3IKVA 2ZJ2A 1B6AA 3BJOA 5FD6A 1B1BA 2Y75A 2HWVA 1ZH5A 1B9MA 2BGCA 3IRRA 2YPRA 1YW7A 1IF1A 2HTJA 5L3EA 2MD5A 2M5WA 4YG2F 2F2EA 2XGXA 5LHGA 1ZG1A 2D1VA 1YW8A 5D5WB 2YX4A 2VXZA 3GVAA 2DQLA 4A12A 3R0AA 4KMFA 3DEUA 1FZPB 3I64A 2RN7A 1R00A 4O3MA 4FHTA 5A2QZ 2FE3A 2STWA 2L54A 3RTRA 4AIHA 1WI9A 4EQQA 1UHMA 2L4MA 5LGUA 3N4MA 1KYZA 2HKOA 1T0FA 5HOOA 2EV0A 3KP2A 1D8JA 1U5TB 5DCMB 2RGVA 2JT1A 2NRAC 4UUVA 3FXRA 4GO1A 4IRIA 1P6RA 4ENNA 1W4MA 3IKTA 4U0WA 2NNNA 2V1DA 3HUGA 2FSWA 4LJZF 3DXJF 1F1ZA 3BWGA 5EEGA 2K7LA 4B8XA 2FF4A 3SFZA 1V4RA 3F8CA 4LK1F 4UVCA 3TDUC 3GFLA 3ZMDA 4H0EA 3TO9A 4AIKA 2Y0MA 1EH6A 4S04A 4G9YA 3EQLF 2DTRA 2QQ9A 4AWXB 5F64A 3DV8A 2OZUA 1U3EM 2HGCA 3KP4A 4WXHA 5L3BA 2FNPA 1H9TA 1KQ0A 3K1PA 2EFNA 4OINF 2VONA 5IT9Z 3F22A 1YS7A 1T2KA 1SD6A 4F7ZA 1HKTA 1ZHFA 3C18A 2E1NA 1R7JA 5DDGA 1ZAOA 1FYLA 2M87A 1IUYA 2YX7A 2OQRA 2VBYA 4L9VA 1FSHA 4HW0A 5J8FA 3M8FA 4HX4A 4IRGA 3MZYA 2P6SA 4RGUA 3DQVC 1DPUA 3S2WA 3GW2A 3IWFA 1J9IA 2RV8A 4XSXF 2GZWA 2NNYA 5JHUA 1EV7A 3WTZA 2EFWA 2CG4A 4G6QA 1BIBA 1BM9A 1IAWA 4R8HA 2Z3YA 2AXLA 5K5RA 1YIOA 1P92A 2P4WA 2O3FA 4BHPA 1SFUA 1ON1A 1IN7A 1BI0A 1TQIA 2DO7A 1BC8C 2L4AA 4A5MA 2P5LC 2B0LA 5L3CA 4KYWA 1FP2A 2IJLA 2XVCA 1SMYF 1S6LA 1U8RA 2Y48A 2NYXA 3JSOA 2K86A 2X4HA 3HRUA 4HZFA 4JQFA 3G73A 3J81K 1XD7A 4ZYGA 1GXPA 4HBLA 4EJVA 2IA0A 3QU3A 2IP2A 1GHCA 1U5TC 5DD8A 1R23A 2OD5A 5TJJA 2R7DA 3WU0A 2E7XA 3ML6A 3B02A 5DCFA 2QQAA 2UWMA 1KU2A 1ZLJA 2QENA 2HQRA 2FQ3A 4NHJA 3GFIA 3GLXA 4P5OA 2BV6A 2M45A 3GXOA 4IPAA 3FHZA 1U6GA 4A0YA 4ON0A 5ED4A 2V1XA 2ZO4A 1XGSA 1FYMA 1WKMA 4KDPA 1ZRFA 5E8GA 5ERIA 3CDHA 2KJBA 1BJAA 3DPLC 4QLCU 5E17F 4YFKF 4UXNA 4HV6A 4N9IA 2E1CA 4EJUA 2K02A 3H3ZA 1IN8A 2VBXA 1KYWA 4A5NA 3CTAA 2V79A 3QPHA 4MQ9F 2F5DA 1XSDA 3GFJA 2EA2A 3F6VA 3R61A 3ABUA 4MGRA 3HHHA 2ESHA 1D5VA 3GF2A 3EUHA 1BBYA 5ICGA 4MTEA 2JZYA 2NS0A 1ZLKA 3DP7A 1ZGJA 2PG4A 5BOXA 1XCVA 2VT2A 5DEQA 4YFNF 2STTA 3PQKA 1R36A 4EVIA 1W7PB 1HSJA 1W7PD 4L9TA 3FMRA 2KRFA 4UV9A 5LHHA 1XB4A 1MJ9A 3CUOA 3ZMZA 4XBFA 2QYOA 4KIFA 2KIUA 2A07F 2YSRA 1I1GA 3K1NA 2KIFA 4ZZLA 1QBJA 4RAYA 5HDKA 3GEZA 3KZZA 4HQMA 2OQGA 3QOPA 3K2ZA 2YR2A 2QWWA 4MHGA 5E8IA 2J5PA 4I0BA 3W6KB 2XKOA 1KGSA 3F3XA 2LDUA 1O3QA 3FZVA 2PQ8A 1ZGAA 2J5OA 2GXBA 1SFEA 5ILSA 2UXNA 1RUOA 4K2EA 3PFIA 2VT3A 5K5QA 2VE8A 2EJRA 1BI1A 5LRSA 3QP5A 2O8XA 3LQQA 1JXSA 3IHUA 2XRNA 4HLYA 1ZARA 2ACJA 2FMYA 5LBQA 1MJAA 2V9VA 3WE3A 4U0YA 3I59A 1B9NA 3ECHA 2OBPA 1XMKA 2W57A 5HLHA 1HSTA 1T6SA 3L7WA 4BNCA 1TQMA 1IZ1A 1B59A 4WX9A 2FBKA 3NEUA 3E6DA 2WWYA 3WTYC 3ZMTA 4ESFA 1KQ9A 2VE9A 2LSOA 5HS9A 3MAJA 4I02A 2O6GE 2ISZA 3HSFA 2EK5A 4BAYA 1S3JA 1O3SA 2RC4A 2ZNYA 4WXDA 3HRSA 1LDJA 1D8KA 3HSEA 3T5XA 4I2OA 4E70A 2ZXJA 3CLOA 1YYVA 3ZMUA 4Y15A 5H20A 3HOTA 4XRFA 5DYMA 3TO7A 2EB7A 3WTWC 2V6CA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1K79 A;  3U9G A;  1K78 B;  5ICE A;  2XAH A;  2O0Y A;  2D1H A;  1XDU A;  1PP8 F;  1WRJ A;  2ZCW A;  2VBW A;  4LLG F;  2PJP A;  4PZJ A;  1OYI A;  4UVA A;  4R1H A;  3P9I A;  3K1M A;  2HDC A;  4DQ2 A;  3RIR A;  3CUQ C;  4GCV A;  1OYY A;  1IN5 A;  3IWZ A;  1Z05 A;  2HYG D;  2GQQ A;  1P4W A;  1IXR C;  2MH2 A;  3P9K A;  2EWN A;  1H9G A;  5F6F A;  3LAP A;  1QZZ A;  1FY7 A;  1L0O C;  2QBY A;  4I7H A;  4G7H F;  1BC7 C;  5FO5 A;  1IW7 F;  1G3T A;  2QZ8 A;  1WSU A;  1S7O A;  4Q5S F;  5FFX A;  2OZ6 A;  1TBX A;  3O3K A;  3JAM Z;  4RB1 A;  4RGR A;  4G7O F;  3SQN A;  3J81 Z;  3HRM A;  3RDI A;  4DNC A;  3LA7 A;  4LGW A;  1JHH A;  4A2U A;  1XGO A;  2LF7 A;  1CF7 B;  3FF5 A;  3TOA A;  4U7B A;  1YO5 C;  3KP5 A;  2PMH A;  2DBB A;  3KP3 A;  1F5T A;  2CYY A;  1QO0 D;  2CQK A;  5AON A;  1O3T A;  4HQE A;  2W24 A;  4ETS A;  2GWR A;  5JI6 A;  1K7A A;  3JSP A;  4HYE A;  4M9X A;  3EET A;  2EFP A;  5D4S A;  2RVC A;  2CWE A;  1MD0 A;  4P96 A;  3VFZ A;  4EM1 A;  3H92 A;  1I1S A;  1GVJ A;  2Z99 A;  5KVR A;  3SZT A;  2LF8 A;  3MQ0 A;  3E5Q A;  3R4K A;  1S29 A;  3NQO A;  3RKX A;  5D5U B;  4PDK A;  3QAH A;  5D8K B;  4KIG A;  1R22 A;  4WCG A;  3D0S A;  1FPQ A;  2HTS A;  3BDD A;  1P4X A;  3O6B B;  1Y0U A;  3TGN A;  4G8X A;  5CJ9 A;  1ZG3 A;  1FX7 A;  3K69 A;  3L00 A;  2Q0O A;  1RNL A;  3RKW A;  1YTY A;  2W85 A;  2HEO A;  3F8F A;  4EGZ A;  1R5G A;  3QRF F;  1XCB A;  1R1T A;  3MCZ A;  3V7S A;  3BOQ A;  4LB5 A;  5L3D A;  2UZK A;  3CUQ B;  5FFZ A;  2Q8K A;  4P9U A;  4EJO A;  3V8J A;  4BXU A;  3LWF A;  3I53 A;  2FXA A;  2XAS A;  2XUB A;  1TW2 A;  5D6F A;  2BBY A;  3WGG A;  3QU6 A;  4OIQ F;  4BH9 A;  4L0Y B;  2DPU A;  2F5C A;  2ISY A;  2O61 A;  5CVJ A;  3KZY A;  2GA1 A;  2DK8 A;  2P7V B;  3DPT A;  4EV0 A;  4B09 A;  5L3F A;  3M7G A;  2V1U A;  4TV7 A;  1S8N A;  1HW5 A;  5DUK A;  2FRH A;  3O2P E;  3DKW A;  3WTV C;  3WTS C;  4HF2 A;  4RS8 A;  3ISP A;  4BYY A;  1UB9 A;  5DV5 A;  2DLL A;  2P7C B;  4CO8 A;  4ESJ A;  2DFI A;  4LG0 A;  3KLN A;  1E17 A;  2FBI A;  4L0Z B;  1IRF A;  3BY6 A;  2A6H F;  1FLI A;  4ZYH A;  3QPT A;  3IRQ A;  3COA C;  3CJN A;  1TNS A;  2IRF G;  1HW1 A;  2BEO A;  4KA4 A;  3CO7 C;  1USS A;  5FLX Z;  1JE8 A;  4G94 A;  3I54 A;  5L3G A;  3GO5 A;  2BYV E;  4HLX A;  1IRG A;  2Z33 A;  2DW4 A;  1HXD A;  5BPI A;  1XDS A;  3IL2 A;  4XSZ F;  2A61 A;  4WXC A;  1XGM A;  2PBI A;  3M1E A;  1QQI A;  1I27 A;  2G7H A;  4M73 A;  4OOI A;  4LFU A;  2Z9O A;  3KEQ A;  2A69 F;  5ILV A;  3TO6 A;  2X0L A;  4XLN F;  1CF7 A;  2PFB A;  2OU2 A;  3LA2 A;  3ABT A;  3BRO A;  2IVM A;  4JBA A;  4ZYD A;  2LNB A;  3CUQ A;  4QWQ A;  4P55 A;  1LJ9 A;  2HYF A;  2MC3 A;  1LDK B;  4KT5 C;  2EV6 A;  3P9C A;  4OIP F;  5LHI A;  2WV0 A;  3H3U A;  4HDU A;  3P7N A;  5HLG A;  2ZME A;  5JVT A;  5D8L B;  4NB5 A;  3OOP A;  2XAJ A;  2PMU A;  3F8N A;  3JTH A;  1Z9C A;  3R6S A;  3AAF A;  4YII A;  1SFX A;  2QLZ A;  1W5S A;  1PUE E;  4OU0 A;  3FMS A;  3V4G A;  5D5X B;  4O6J A;  1I6X A;  1BN5 A;  5EEH A;  4LD5 A;  3KFW X;  2IT0 A;  4ASN A;  2K4J A;  2XV4 S;  2H94 A;  5H6Q A;  4AD9 A;  5J6X A;  4KUM A;  1F9N A;  2H27 A;  2R7F A;  2EA4 A;  3J80 Z;  3IC7 A;  1V3F A;  4Q4Z F;  2CW0 F;  3WTX C;  5LGN A;  5AIQ A;  3BJ6 A;  3F21 A;  1CGP A;  4EM0 B;  2P6T A;  5FB2 A;  4M6X A;  4U88 A;  2HZT A;  3F6O A;  2HFH A;  2A68 F;  2GXG A;  1MDM A;  3KCC A;  2VC1 A;  2QM3 A;  1ZG5 A;  2L02 A;  5FLX K;  1QNT A;  1OPC A;  3RPQ A;  4O5V A;  1FBU A;  5HVQ C;  1IN4 A;  3WTU C;  3VB2 A;  1TQP A;  1FC3 A;  5LRR A;  2AS5 F;  4LG0 B;  2HS5 A;  3EYI A;  1STZ A;  5JFR A;  1P2F A;  3Q9S A;  3WE2 A;  3VEP A;  2HR3 A;  3M8E A;  4EGY A;  4RGS A;  4MTD A;  3T8R A;  3HSR A;  3RYR A;  3V8K A;  2HQN A;  1R5H A;  1T39 A;  3KE2 A;  4IXA A;  1YQA A;  3SXY A;  1B4A A;  2IPQ X;  2H6B A;  5E18 F;  2DT5 A;  2IA1 A;  2OAZ A;  1ZRD A;  4HAM A;  1E2X A;  3KEO A;  2R3S A;  3E6M A;  1K78 A;  3FM5 A;  3C1D A;  3JAM K;  3SHF A;  4FX4 A;  4LLL A;  4FX0 A;  2EFO A;  1RUN A;  2QVO A;  4RAZ A;  3NRV A;  3I0T A;  4AVP A;  4PCQ A;  4CGZ A;  4HF0 A;  3HIF A;  2RQP A;  3GZ6 A;  4HA8 A;  5HDG A;  3MZH A;  2ESN A;  1J0R A;  5A2Q K;  1QPM A;  4KIC A;  3HOS A;  4NQW A;  1MZB A;  3E97 A;  3RPU A;  1LNW A;  2ZFW A;  1NHA A;  1FBS A;  4BQA A;  1G6N A;  3WGH A;  1T38 A;  1TW3 A;  4L9J A;  5K1Y A;  2JTV A;  1KQ8 A;  2TDX A;  4LMY A;  4CXF A;  4M9S A;  1Z91 A;  3HHG A;  3E3V A;  4KN7 X;  3C7J A;  2YU3 A;  3WGI A;  1R1V A;  4CZZ A;  2H09 A;  1RI7 A;  4RGX A;  2XHK A;  4N9H A;  3KET A;  3LQR A;  4G7Z F;  2CGP A;  3WG9 A;  4GXO A;  3D5L A;  4IF4 A;  1LB2 A;  1O3R A;  4M74 A;  3K9T A;  4KNY A;  3WTT C;  1QGP A;  4A6D A;  3GZ5 A;  4M6Y A;  3E6C C;  1KA8 A;  1AWC A;  4UHT A;  1W7P A;  1Z6T A;  3ZMS A;  3V8L A;  3MWM A;  2P5K A;  4A6E A;  3G3Z A;  2A5Y B;  3LAJ A;  3N97 A;  1FWZ A;  4RB0 A;  1J5Y A;  3BJA A;  5BPD A;  1OMI A;  3TDZ C;  2A3S A;  4EM2 A;  5E1W A;  3ECO A;  1MDM B;  3C3W A;  1XMA A;  2MH9 A;  1SD5 A;  2FU4 A;  1BI2 A;  2XAQ A;  4CYD A;  1XN7 A;  3F72 A;  5ICC A;  2HKX A;  1DPR A;  5JR3 A;  4GGG A;  3U2R A;  4MEY F;  5IT3 A;  5LEJ A;  5BMZ A;  1W5T A;  2JPB A;  1LEB A;  2L01 A;  1G3Y A;  3BZ6 A;  4G6D A;  1J75 A;  4ENK A;  2GA2 A;  2FA5 A;  3R60 A;  2M30 A;  6PAX A;  3RJP A;  3T8T A;  3ZP5 A;  4M9Z A;  1PDN C;  1UFM A;  2VOO A;  4YFX F;  4ZYE A;  1OYW A;  3B73 A;  5LGT A;  4Q47 A;  1G3W A;  5BQT A;  5E1X A;  1LDD A;  1IXC A;  4I98 B;  3DFG A;  4M72 A;  1A04 A;  3EYY A;  1HKQ A;  1SD4 A;  3I5U A;  5AIP A;  1MGT A;  1SMT A;  1C0W A;  1YW9 A;  3Q9V A;  2QQB A;  1R1U A;  3LST A;  1O7L A;  3GWZ A;  4HV5 A;  4CDG A;  5E20 A;  4N0B A;  1YS6 A;  4HF1 A;  4PGH A;  1QZY A;  4U7D A;  3V7C A;  4L5J A;  1FNN A;  5HDN A;  3REO A;  2RDP A;  5BS6 A;  3MEX A;  1LQ1 A;  2FBH A;  2W84 A;  3GYH X;  3RKY A;  1TTY A;  1UST A;  2E7W A;  2ZBK A;  3LFK A;  4AIJ A;  3FM3 A;  3JTG A;  2HOE A;  3JW4 A;  3CO6 C;  2VOD A;  4IHT A;  1FBQ A;  3ZPL A;  5FD5 A;  3J80 K;  1EH8 A;  2EFQ A;  3ZMV A;  1S7A A;  4WF2 A;  5F1R A;  1AOY A;  3GX4 X;  1HQC A;  2DPD A;  3M9A A;  3ZN0 A;  2W25 A;  1KU3 A;  4EJW A;  1GXQ A;  1UHW A;  3I58 A;  3F8M A;  3TOB A;  2VOP A;  3I59 B;  2QBY B;  2DU9 A;  2LKP A;  1O7F A;  2RKH A;  2XAF A;  2OA4 A;  1YG2 A;  2FOK A;  4Y17 A;  3VOD A;  2JSC A;  2FEZ A;  2WC2 A;  1VTN C;  5CVU A;  4A0Z A;  5CVI A;  1JHF A;  1BOA A;  3E6B A;  1YFH A;  4MQV A;  1KU7 A;  1EH7 A;  2PI0 A;  1HBX G;  1I5Z A;  2H6C A;  2ELH A;  4R79 A;  1BIA A;  4A0X A;  1JGS A;  2VN2 A;  3EDP A;  1FT9 A;  1PP7 U;  3I71 A;  1RIO H;  4IJA A;  1ONV A;  3FXU A;  2JRT A;  5HS8 A;  2P5V A;  2L3D A;  4GYI A;  5D6E A;  1Z6R A;  4UNO A;  1O57 A;  2IA2 A;  3BP8 A;  2MA3 A;  1Z7U A;  4WK8 F;  5KK1 A;  2F5E A;  2P8T A;  1Q1H A;  4L9N A;  1LEA A;  1XSV A;  3KP7 A;  1ON2 A;  4KFC A;  1SD7 A;  2COM A;  1H0M A;  2XKP A;  3BPV A;  2UXX A;  3QP6 A;  3SZP A;  4KN4 X;  5ILU A;  1R58 A;  2CO5 A;  1WWX A;  1J7K A;  4MEX F;  1U2W A;  4ENM A;  1ZRC A;  2DAO A;  4I0A A;  3Q5F A;  1OKR A;  2D2W A;  4OMZ A;  4LLN A;  2XRO A;  4Z2Y A;  1Z1D A;  3FX3 A;  5CLS A;  3LA3 A;  2BE5 F;  2FML A;  1FOK A;  1J59 A;  5CYV A;  1T98 A;  5D4R A;  1G4D A;  2ZNZ A;  3V7R A;  4Y13 A;  1BI3 A;  4I01 A;  2Z5U A;  1MJB A;  2MLG A;  5ICF A;  3E5X A;  4HDV A;  3HTS B;  4ZZD A;  3I4P A;  2QUF A;  1ZN2 A;  2PEX A;  3U1D A;  4YIF A;  5E1Z B;  4KIB A;  2FNA A;  2D45 A;  1UCR A;  4WWC A;  2A6E F;  4UVB A;  5DCM A;  5IT9 K;  4KMU X;  5J8C A;  3L9F A;  5TRD A;  2Q2E A;  2ZME B;  3HRT A;  2O03 A;  4MNU A;  1RZ4 A;  1REP C;  1FP1 D;  4EJT A;  5D5V B;  2XAG A;  4M71 A;  1D3Y A;  4RB2 C;  2IW5 A;  1G3S A;  3GUD A;  3J7A O;  5CVV A;  3W6J B;  1MKM A;  4EMS A;  2ZKZ A;  1SAX A;  3WOD F;  3E5U A;  1ZRE A;  4OIR F;  2K4B A;  2PLY A;  1FYK A;  4IRH A;  4UV8 A;  5HLI A;  4ESB A;  1TLH B;  2GAU A;  1ZYR F;  2F5F A;  4OIO F;  3FMQ A;  4I09 A;  2DI3 A;  4GYG A;  2KJC A;  3ROU A;  2K27 A;  4HOB A;  1XGN A;  3OV8 A;  3GFM A;  5H6R A;  3HYI A;  2MBF A;  3ZN1 A;  2G7U A;  2WTE A;  2KIM A;  3ERE D;  5HS7 A;  3ELK A;  2ADU A;  1P4A A;  2VBZ A;  3TQN A;  4U0V A;  1F4K A;  2CSO A;  5DUI A;  2JPC A;  2DQR A;  2G9W A;  1J2X A;  2C6Y A;  4HX7 A;  2XIG A;  4ENJ A;  2GIV A;  2DK5 A;  4ZH4 F;  1DDN A;  3KLO A;  3FWE A;  1DUX C;  5CVR A;  3WU1 B;  1ODD A;  3VOE A;  4LK0 F;  2VC0 A;  3T1B A;  2KKO A;  4FT8 A;  5LEK A;  3FXQ A;  4P9F A;  3R0J A;  4IHS A;  1YLF A;  1WQ2 A;  1KU9 A;  4HX8 A;  3PQJ A;  4RB3 C;  1OR7 A;  4CIC A;  2CFX A;  4BHB A;  3KP6 A;  2NAZ A;  4JK1 X;  3ULQ B;  1K6O A;  2EV5 A;  1U5T A;  5FGM A;  3BPX A;  1X3U A;  2RNJ A;  4L5I A;  1LVA A;  3RYP A;  3F8B A;  3MFK A;  1FSE A;  4XLP F;  1XSX A;  1TNT A;  1HW2 A;  3DF8 A;  3L2C A;  1L3L A;  4PGG A;  4OMY A;  4Q48 A;  2ETH A;  1ULY A;  5LLQ A;  3K0L A;  5K5O A;  3TKY A;  4IVN A;  2M1B A;  4D0P A;  1DP7 P;  4L18 B;  3T0Y A;  2M8E A;  5DD4 A;  1IXS B;  2MLK A;  4CHU A;  4BHC A;  3F23 A;  4LB6 B;  3L09 A;  3RI4 A;  3HTU A;  1HKS A;  3ZQ7 A;  2PN6 A;  1IN6 A;  4S05 A;  1U78 A;  3IKV A;  2ZJ2 A;  1B6A A;  3BJO A;  5FD6 A;  1B1B A;  2Y75 A;  2HWV A;  1ZH5 A;  1B9M A;  2BGC A;  3IRR A;  2YPR A;  1YW7 A;  1IF1 A;  2HTJ A;  5L3E A;  2MD5 A;  2M5W A;  4YG2 F;  2F2E A;  2XGX A;  5LHG A;  1ZG1 A;  2D1V A;  1YW8 A;  5D5W B;  2YX4 A;  2VXZ A;  3GVA A;  2DQL A;  4A12 A;  3R0A A;  4KMF A;  3DEU A;  1FZP B;  3I64 A;  2RN7 A;  1R00 A;  4O3M A;  4FHT A;  5A2Q Z;  2FE3 A;  2STW A;  2L54 A;  3RTR A;  4AIH A;  1WI9 A;  4EQQ A;  1UHM A;  2L4M A;  5LGU A;  3N4M A;  1KYZ A;  2HKO A;  1T0F A;  5HOO A;  2EV0 A;  3KP2 A;  1D8J A;  1U5T B;  5DCM B;  2RGV A;  2JT1 A;  2NRA C;  4UUV A;  3FXR A;  4GO1 A;  4IRI A;  1P6R A;  4ENN A;  1W4M A;  3IKT A;  4U0W A;  2NNN A;  2V1D A;  3HUG A;  2FSW A;  4LJZ F;  3DXJ F;  1F1Z A;  3BWG A;  5EEG A;  2K7L A;  4B8X A;  2FF4 A;  3SFZ A;  1V4R A;  3F8C A;  4LK1 F;  4UVC A;  3TDU C;  3GFL A;  3ZMD A;  4H0E A;  3TO9 A;  4AIK A;  2Y0M A;  1EH6 A;  4S04 A;  4G9Y A;  3EQL F;  2DTR A;  2QQ9 A;  4AWX B;  5F64 A;  3DV8 A;  2OZU A;  1U3E M;  2HGC A;  3KP4 A;  4WXH A;  5L3B A;  2FNP A;  1H9T A;  1KQ0 A;  3K1P A;  2EFN A;  4OIN F;  2VON A;  5IT9 Z;  3F22 A;  1YS7 A;  1T2K A;  1SD6 A;  4F7Z A;  1HKT A;  1ZHF A;  3C18 A;  2E1N A;  1R7J A;  5DDG A;  1ZAO A;  1FYL A;  2M87 A;  1IUY A;  2YX7 A;  2OQR A;  2VBY A;  4L9V A;  1FSH A;  4HW0 A;  5J8F A;  3M8F A;  4HX4 A;  4IRG A;  3MZY A;  2P6S A;  4RGU A;  3DQV C;  1DPU A;  3S2W A;  3GW2 A;  3IWF A;  1J9I A;  2RV8 A;  4XSX F;  2GZW A;  2NNY A;  5JHU A;  1EV7 A;  3WTZ A;  2EFW A;  2CG4 A;  4G6Q A;  1BIB A;  1BM9 A;  1IAW A;  4R8H A;  2Z3Y A;  2AXL A;  5K5R A;  1YIO A;  1P92 A;  2P4W A;  2O3F A;  4BHP A;  1SFU A;  1ON1 A;  1IN7 A;  1BI0 A;  1TQI A;  2DO7 A;  1BC8 C;  2L4A A;  4A5M A;  2P5L C;  2B0L A;  5L3C A;  4KYW A;  1FP2 A;  2IJL A;  2XVC A;  1SMY F;  1S6L A;  1U8R A;  2Y48 A;  2NYX A;  3JSO A;  2K86 A;  2X4H A;  3HRU A;  4HZF A;  4JQF A;  3G73 A;  3J81 K;  1XD7 A;  4ZYG A;  1GXP A;  4HBL A;  4EJV A;  2IA0 A;  3QU3 A;  2IP2 A;  1GHC A;  1U5T C;  5DD8 A;  1R23 A;  2OD5 A;  5TJJ A;  2R7D A;  3WU0 A;  2E7X A;  3ML6 A;  3B02 A;  5DCF A;  2QQA A;  2UWM A;  1KU2 A;  1ZLJ A;  2QEN A;  2HQR A;  2FQ3 A;  4NHJ A;  3GFI A;  3GLX A;  4P5O A;  2BV6 A;  2M45 A;  3GXO A;  4IPA A;  3FHZ A;  1U6G A;  4A0Y A;  4ON0 A;  5ED4 A;  2V1X A;  2ZO4 A;  1XGS A;  1FYM A;  1WKM A;  4KDP A;  1ZRF A;  5E8G A;  5ERI A;  3CDH A;  2KJB A;  1BJA A;  3DPL C;  4QLC U;  5E17 F;  4YFK F;  4UXN A;  4HV6 A;  4N9I A;  2E1C A;  4EJU A;  2K02 A;  3H3Z A;  1IN8 A;  2VBX A;  1KYW A;  4A5N A;  3CTA A;  2V79 A;  3QPH A;  4MQ9 F;  2F5D A;  1XSD A;  3GFJ A;  2EA2 A;  3F6V A;  3R61 A;  3ABU A;  4MGR A;  3HHH A;  2ESH A;  1D5V A;  3GF2 A;  3EUH A;  1BBY A;  5ICG A;  4MTE A;  2JZY A;  2NS0 A;  1ZLK A;  3DP7 A;  1ZGJ A;  2PG4 A;  5BOX A;  1XCV A;  2VT2 A;  5DEQ A;  4YFN F;  2STT A;  3PQK A;  1R36 A;  4EVI A;  1W7P B;  1HSJ A;  1W7P D;  4L9T A;  3FMR A;  2KRF A;  4UV9 A;  5LHH A;  1XB4 A;  1MJ9 A;  3CUO A;  3ZMZ A;  4XBF A;  2QYO A;  4KIF A;  2KIU A;  2A07 F;  2YSR A;  1I1G A;  3K1N A;  2KIF A;  4ZZL A;  1QBJ A;  4RAY A;  5HDK A;  3GEZ A;  3KZZ A;  4HQM A;  2OQG A;  3QOP A;  3K2Z A;  2YR2 A;  2QWW A;  4MHG A;  5E8I A;  2J5P A;  4I0B A;  3W6K B;  2XKO A;  1KGS A;  3F3X A;  2LDU A;  1O3Q A;  3FZV A;  2PQ8 A;  1ZGA A;  2J5O A;  2GXB A;  1SFE A;  5ILS A;  2UXN A;  1RUO A;  4K2E A;  3PFI A;  2VT3 A;  5K5Q A;  2VE8 A;  2EJR A;  1BI1 A;  5LRS A;  3QP5 A;  2O8X A;  3LQQ A;  1JXS A;  3IHU A;  2XRN A;  4HLY A;  1ZAR A;  2ACJ A;  2FMY A;  5LBQ A;  1MJA A;  2V9V A;  3WE3 A;  4U0Y A;  3I59 A;  1B9N A;  3ECH A;  2OBP A;  1XMK A;  2W57 A;  5HLH A;  1HST A;  1T6S A;  3L7W A;  4BNC A;  1TQM A;  1IZ1 A;  1B59 A;  4WX9 A;  2FBK A;  3NEU A;  3E6D A;  2WWY A;  3WTY C;  3ZMT A;  4ESF A;  1KQ9 A;  2VE9 A;  2LSO A;  5HS9 A;  3MAJ A;  4I02 A;  2O6G E;  2ISZ A;  3HSF A;  2EK5 A;  4BAY A;  1S3J A;  1O3S A;  2RC4 A;  2ZNY A;  4WXD A;  3HRS A;  1LDJ A;  1D8K A;  3HSE A;  3T5X A;  4I2O A;  4E70 A;  2ZXJ A;  3CLO A;  1YYV A;  3ZMU A;  4Y15 A;  5H20 A;  3HOT A;  4XRF A;  5DYM A;  3TO7 A;  2EB7 A;  3WTW C;  2V6C A; 
#chains in the Genus database with same CATH topology
 1K79 A;  2KL4 A;  3U9G A;  2XGE A;  2K3F A;  2DOA A;  1K78 B;  5ICE A;  1LFP A;  2XAH A;  2VXD A;  2MD0 A;  5IP6 A;  2O0Y A;  2D1H A;  3ZQF A;  1XDU A;  1PP8 F;  3LSH A;  1WRJ A;  2EQR A;  2ZCW A;  2BY3 A;  2VBW A;  5JLX A;  4LLG F;  4E7L A;  2JUG A;  2PJP A;  4PZJ A;  1OYI A;  4UVA A;  4R1H A;  3FK7 A;  3P9I A;  3TW7 A;  3K1M A;  2HDC A;  2RRE A;  1MBK A;  4DQ2 A;  4XKV A;  3RIR A;  2ZXI A;  3CUQ C;  1MBH A;  4GCV A;  1OYY A;  1IN5 A;  2Y9Z A;  1RES A;  3IWZ A;  3S93 A;  1Z05 A;  4BQO A;  2HYG D;  2GQQ A;  3DKY A;  4XKB A;  3GTJ J;  3I9V 2;  1P4W A;  1IXR C;  1V54 H;  2MH2 A;  3P9K A;  4UUT A;  3HZJ A;  2EWN A;  1BR2 A;  1H9G A;  5F6F A;  3GBG A;  1AKH A;  3LAP A;  3IP4 B;  1QZZ A;  1TWA J;  2TCT A;  1IV8 A;  3ESW B;  1FY7 A;  3S1R J;  5B66 C;  3CDI A;  1L0O C;  5M3F J;  2E1O A;  2H8R A;  5EDN A;  2QBY A;  2K3P A;  2OC6 A;  3IAS 2;  4I7H A;  4G7H F;  1BC7 C;  3ZCO A;  5FO5 A;  1IW7 F;  1G3T A;  2QZ8 A;  1W0U A;  2Y9Y A;  4X1E A;  5J47 A;  2L7Z A;  5C4J J;  3S17 J;  4GRI A;  3OYE A;  3W2W A;  2HXO A;  1WSU A;  1S7O A;  2BVM A;  3PNT A;  4MIM A;  4Q5S F;  5FFX A;  2OZ6 A;  2AQF A;  1TBX A;  3O3K A;  4IHX A;  3JAM Z;  4G6T B;  3W3C A;  2M4K A;  2X6O A;  4RB1 A;  4RGR A;  4G7O F;  2GM4 A;  3OYL A;  1YI2 I;  3VYS B;  3SQN A;  2XC7 A;  3J81 Z;  3HRM A;  3OS2 A;  3RDI A;  1DP3 A;  2FX0 A;  3FK6 A;  2KDO A;  4DNC A;  3LA7 A;  4IQJ A;  4LGW A;  3IH4 A;  1DGR M;  1JHH A;  4A2U A;  3ZQC A;  2I8D A;  1XGO A;  4MFE A;  3SDB A;  2LF7 A;  1CF7 B;  2K9Q A;  2RNG A;  2R7U A;  2TRT A;  3FF5 A;  1D5Y A;  1VZ0 A;  2DFF A;  3TOA A;  3K4C A;  4U7B A;  1YO5 C;  3KP5 A;  4C2M J;  2PMH A;  2DBB A;  4XLH A;  4HPQ A;  2F4O B;  4EEF G;  2VB6 A;  3H35 A;  3KP3 A;  1WVR A;  3ZQI A;  4KIS A;  1F5T A;  2CYY A;  1QO0 D;  5FKO A;  2CQK A;  4F3Q A;  5AON A;  1O3T A;  5HOD A;  4HQE A;  2W24 A;  1U8B A;  4ETS A;  2GWR A;  2K9L A;  1I3Q J;  5JI6 A;  3L2R A;  1K7A A;  3UNG C;  4BJ5 C;  3JSP A;  4HYE A;  4M9X A;  1QHH D;  3EET A;  2ECC A;  4M3E A;  2EFP A;  5D4S A;  2RVC A;  2CWE A;  1MD0 A;  4P96 A;  3VFZ A;  4EM1 A;  3MKW B;  2Z2S B;  3H92 A;  5GTI C;  1MMA A;  1MMS A;  1I1S A;  1GVJ A;  2Z99 A;  2M4G A;  1TWF J;  4CCL A;  3ABL H;  5KVR A;  4LOC A;  3SZT A;  1D1B A;  2VJJ A;  2LF8 A;  2OCE A;  4RAG A;  2AQE A;  1BR4 A;  3LSJ A;  3MQ0 A;  3E5Q A;  3HKZ A;  3FXL A;  3FBI B;  3R4K A;  3L2U A;  1ITY A;  1S29 A;  3NQO A;  1YE9 A;  3RKX A;  5D5U B;  4PDK A;  3QAH A;  5EJC A;  5D8K B;  4NC6 A;  3F0C A;  3NAR A;  4XRS G;  3FXO A;  4KIG A;  3JRD A;  1R22 A;  3A0H C;  4X6A J;  4WCG A;  3D0S A;  1FPQ A;  2HTS A;  2KRH A;  3BDD A;  1P4X A;  3O6B B;  1Y0U A;  3TGN A;  4G8X A;  5CJ9 A;  2DMN A;  1ZG3 A;  2A5W A;  3OYJ A;  2GXA A;  4HRI A;  4A69 C;  4D7N A;  3IH2 A;  1VQL I;  1FX7 A;  2R7Q A;  3K69 A;  3L00 A;  2Q0O A;  1RNL A;  3BR3 A;  3RKW A;  1YTY A;  2W85 A;  2HEO A;  3OMY A;  2Y31 A;  3F8F A;  4BQN A;  3DTK A;  2M0M A;  4EGZ A;  1R5G A;  3AKZ A;  2I10 A;  3QRF F;  1WHU A;  1XCB A;  2CMP A;  2HYJ A;  1LPQ A;  3L1P A;  3CCJ I;  1R1T A;  3MCZ A;  5EG0 B;  3LL7 A;  5F08 A;  4FAS D;  3V7S A;  3BCB A;  3BOQ A;  4LB5 A;  5L3D A;  1VQ8 I;  2UZK A;  3CUQ B;  5FFZ A;  3L2V A;  2ZXH A;  3KZI C;  2Q2E B;  2Q8K A;  4P9U A;  4EJO A;  2F5V A;  4XLA A;  3V8J A;  3LMM A;  4BXU A;  3LWF A;  3I53 A;  2FXA A;  4IO9 F;  2MSY A;  2XAS A;  4QIW N;  2XUB A;  3SDG A;  2ID6 A;  2HVS A;  1TW2 A;  2E1M B;  3PJR A;  5D6F A;  4W97 A;  2BBY A;  3ZR8 X;  3WGG A;  3QU6 A;  5GP9 A;  4OIQ F;  4BH9 A;  1FIA A;  4L0Y B;  2W48 A;  2DPU A;  2F5C A;  4V19 K;  2ISY A;  3DTE A;  2O61 A;  2V6E A;  5CVJ A;  4CA0 A;  4L5E A;  3H36 A;  3RPU D;  3KZY A;  2GA1 A;  2DA6 A;  2DK8 A;  2P7V B;  4HNU A;  1JTY A;  3DPT A;  4EV0 A;  4B09 A;  5L3F A;  2JSP A;  3M7G A;  3PUB A;  3A01 A;  2V1U A;  1W1W E;  1BL0 A;  4TV7 A;  2IS2 A;  1S8N A;  2P81 A;  1HW5 A;  5DUK A;  5F0C A;  1BOB A;  2FRH A;  3O2P E;  3K4B A;  3CF5 F;  3DKW A;  2VKV A;  1AHD P;  1MBG A;  3WTV C;  1W5C C;  3WTS C;  4HF2 A;  4RS8 A;  3ISP A;  1G2H A;  4BYY A;  3HPG A;  4PFO A;  1OCZ H;  5DS9 A;  1UB9 A;  1KZH A;  2DMP A;  5DV5 A;  2DLL A;  3JCU C;  2P7C B;  2OF7 A;  1VF9 A;  2M3A A;  4CO8 A;  2LMD A;  4ESJ A;  2DFI A;  3G6E I;  1GT0 C;  1HOM A;  2CJJ A;  2FOW A;  4XLF A;  4LG0 A;  3KLN A;  1E17 A;  2FBI A;  4L0Z B;  1IRF A;  3BY6 A;  2A6H F;  2LY9 A;  4ZDO A;  1TT5 B;  1FLI A;  4ZYH A;  3QPT A;  3IRQ A;  1GVD A;  1MMG A;  1QZE A;  3COA C;  4N4O B;  5GAD J;  3CJN A;  1TNS A;  2IRF G;  3K7A J;  1HW1 A;  2BEO A;  4KA4 A;  3CO7 C;  1X1C A;  1USS A;  5FLX Z;  1JE8 A;  3RCO A;  4G94 A;  3I54 A;  4F55 A;  5L3G A;  3DBR B;  4M3D A;  3GO5 A;  2F4I A;  2M7A A;  2BYV E;  3SYT A;  4HLX A;  1IRG A;  2DYR H;  1DU0 A;  1ZGW A;  3H5A A;  4JYK A;  2DW4 A;  3G2B A;  3A0B C;  2Z33 A;  1FOX A;  1LE8 A;  1V5E A;  1HXD A;  5J40 A;  1TL8 A;  4A3B J;  4BY7 J;  5BPI A;  2R5Y A;  1XDS A;  3IL2 A;  4XSZ F;  5M5Y J;  1DQU A;  3MZ8 A;  2NVX J;  2A61 A;  4WXC A;  1XGM A;  4XRM A;  2B63 J;  2PBI A;  3M1E A;  1QQI A;  2R7X A;  4NC7 A;  3NWS A;  1I27 A;  2PJR B;  2G7H A;  3HB9 A;  5KAF C;  2FQ4 A;  4M73 A;  5C3E J;  2MG4 A;  4LFU A;  4OOI A;  2Z9O A;  3OYG A;  3KEQ A;  1VQK I;  3HOY J;  1T95 A;  2BW3 B;  2HQA A;  2IGK A;  1T33 A;  3AG2 H;  2A69 F;  2E5N A;  5ILV A;  3TO6 A;  1Y0N A;  2BY1 A;  2X0L A;  5FKM A;  4XLN F;  5LFA A;  3SFI A;  1CF7 A;  2PFB A;  1IC8 A;  4IHV A;  2OU2 A;  3LA2 A;  1PUF A;  3H3V K;  1MH3 A;  3ABT A;  3BRO A;  4IOA F;  3H5N A;  2XPW A;  2IVM A;  4JBA A;  2Y2Z A;  4ZYD A;  3SEQ A;  1ZKG A;  4DJA A;  4I6Z A;  2LNB A;  3CUQ A;  2KZV A;  4QWQ A;  5DTD A;  2ZSH B;  2XAU A;  1MBF A;  4P55 A;  1MMN A;  4FTH A;  1LJ9 A;  1Z67 A;  2HYF A;  2MC3 A;  4I76 A;  2NVU B;  1LDK B;  4D5F A;  4KT5 C;  2EV6 A;  2HVQ A;  4A3L J;  3P9C A;  4OIP F;  1POG A;  1IUF A;  1TWH J;  4BEH A;  5LHI A;  2WV0 A;  3U1K A;  3H3U A;  5HLG A;  3P7N A;  4HDU A;  2ZME A;  5JVT A;  5D8L B;  4NB5 A;  1BR1 A;  3CD6 I;  3OOP A;  2IBD A;  2XAJ A;  2E1M C;  2PMU A;  4PSX A;  2R5Z B;  3F8N A;  3FDY A;  1K6Y A;  3JTH A;  2EH3 A;  2KFD A;  3J7A Y;  2R7O A;  3DWL E;  2KRC A;  1Z9C A;  3R6S A;  3AAF A;  4NC8 A;  4YII A;  1SFX A;  2QLZ A;  2VAS A;  1W5S A;  3H0G J;  1PUE E;  4OU0 A;  3NAU A;  1OCR H;  5J1R A;  2LOO A;  3FMS A;  3V4G A;  3Q0U A;  5D5X B;  4HNV A;  2R5Y B;  4IL6 C;  2HOA A;  3CES A;  1XC5 A;  4O6J A;  1JUS A;  1I6X A;  4ZDP A;  1BN5 A;  2VPR A;  5EEH A;  3QPS A;  4II3 A;  4LD5 A;  3KFW X;  3Q3S A;  1LFB A;  3TP0 A;  1JJ6 C;  2IT0 A;  2EIM H;  3S3M A;  4ASN A;  2KIQ A;  1R6R A;  5E3O A;  2K4J A;  2XV4 S;  2H94 A;  1Y8Q B;  5H6Q A;  1S7E A;  4AD9 A;  5J6X A;  4KUM A;  1VND A;  1F9N A;  4Y4R A;  3VWB A;  2H27 A;  4D9J A;  2R7F A;  2IS6 A;  2EA4 A;  3J80 Z;  3DCF A;  3IC7 A;  2AO9 A;  1RRJ A;  4IHY A;  1V3F A;  4Q4Z F;  3DBL B;  2CW0 F;  3WTX C;  5LGN A;  1JT6 A;  5IP9 J;  3GTK J;  5AIQ A;  3BJ6 A;  3F21 A;  1APL C;  1CGP A;  2UUZ A;  4EM0 B;  4CH7 A;  2P6T A;  1OCP A;  3K4L A;  4FET A;  5FB2 A;  1X1B A;  4M6X A;  1B8I B;  4U88 A;  2VQG A;  2XSD C;  2HZT A;  3I56 I;  3W6V A;  3F6O A;  2HFH A;  4XOR A;  4I99 C;  2A68 F;  3VDX A;  4CCO A;  2GXG A;  1MDM A;  3KCC A;  2VC1 A;  2Y0S N;  5IY5 H;  1P7J A;  2QM3 A;  1ZG5 A;  1Y1W J;  2VQH A;  1TT0 A;  3VYU B;  2L02 A;  5FLX K;  2CS3 A;  1QNT A;  2K9N A;  1OPC A;  2JVG A;  3RPQ A;  1B72 A;  4O5V A;  3J7Z I;  1FBU A;  2KHM A;  4BQQ A;  1WH5 A;  5HVQ C;  2ICW G;  1IN4 A;  2K40 A;  3VB2 A;  3WTU C;  1TQP A;  3HG9 A;  1R4N B;  2EZL A;  4M3F A;  3OS0 A;  1FC3 A;  5LRR A;  2AS5 F;  2F4M B;  4LG0 B;  2HQ5 A;  2HS5 A;  3EYI A;  3M3Y J;  1STZ A;  4ZYA A;  5JFR A;  5EYR A;  4A3G J;  1YX5 A;  1RPW A;  1N78 A;  1ENH A;  2E5Z A;  1IGN A;  1AKH B;  1P2F A;  5GAH J;  5BNG A;  3Q9S A;  3WE2 A;  3VEP A;  1S9H A;  2HR3 A;  3M8E A;  4EGY A;  4RGS A;  4MTD A;  3T8R A;  3HSR A;  3RYR A;  4A3E J;  4PJJ A;  3V8K A;  1N77 A;  2M7B A;  1X1A A;  2HQN A;  2LKS A;  2CQX A;  4BEH B;  1EJ9 A;  5FLV A;  1R5H A;  1T39 A;  3KE2 A;  4IXA A;  1A5J A;  2E36 A;  2NS7 A;  3K4M A;  2E2I J;  4G12 A;  4RMN A;  1YQA A;  2JUC A;  3SXY A;  3OY9 A;  3HXL A;  4A3J J;  5M5W J;  3HL2 A;  1B4A A;  2IPQ X;  3BG7 A;  2H6B A;  5E18 F;  2DT5 A;  2IA1 A;  5K7F A;  1O4X A;  4A3C J;  2O5R A;  2OAZ A;  4P1W A;  3PUF A;  2ID3 A;  1ZRD A;  5B5E C;  4PJN A;  1ETW A;  4HAM A;  1E2X A;  3KEO A;  1WJE A;  2R3S A;  1ZTR A;  3E6M A;  1K78 A;  3IH3 A;  3FM5 A;  3RZD J;  3C1D A;  4F91 B;  4QPO A;  3JAM K;  3SHF A;  3OYC A;  4QSH A;  5KCM A;  4FX4 A;  3WHC A;  1U9N A;  5TGT A;  4FX0 A;  4LLL A;  2VLA A;  2EFO A;  1RUN A;  2QVO A;  4RAZ A;  2BHZ A;  3NRV A;  3G4S I;  1X3W B;  3GTM J;  1FTT A;  3I0T A;  4AVP A;  1XX5 A;  2CUF A;  2CFO A;  2L9R A;  4PCQ A;  4CGZ A;  4HF0 A;  1HCR A;  4NQW B;  4QPQ A;  2R5Z A;  3O8G A;  3BR2 A;  3HIF A;  2RQP A;  4S0H B;  1BW5 A;  1WH7 A;  4BE2 A;  3GZ6 A;  1RKW A;  1R49 A;  1X19 A;  4HA8 A;  5HDG A;  4DBR A;  3MZH A;  2IEK A;  2ESN A;  3MN2 A;  1J0R A;  1DU6 A;  5A2Q K;  1NTC A;  1QPM A;  3ZQH A;  4KIC A;  3E0J B;  4IEJ A;  3HOS A;  4NQW A;  3H9Q A;  5B3S H;  2LH9 A;  1MZB A;  3E97 A;  1D0Y A;  2EZI A;  3RPU A;  1LNW A;  2ZFW A;  5K7H A;  1NHA A;  2DMQ A;  1YIT I;  1MBJ A;  1FBS A;  3AG1 H;  2WB1 A;  2W82 A;  4II2 A;  3CC7 I;  4BQA A;  1G6N A;  3WGH A;  1T38 A;  1TW3 A;  4L9J A;  1RC9 A;  5K1Y A;  2JTV A;  1KQ8 A;  4IOC F;  2TDX A;  2X9D A;  1NG7 A;  4LMY A;  4CXF A;  4M9S A;  1Z91 A;  3HHG A;  3JRB A;  4F92 B;  2CV2 A;  4Y52 J;  2V4J C;  1XS9 A;  3E3V A;  5FRO A;  4KN7 X;  3C7J A;  2X1E A;  2L7M P;  1FEX A;  2YU3 A;  4DYQ A;  3WGI A;  2VQL A;  3G1L A;  1FMW A;  4KJZ A;  1R1V A;  4CZZ A;  2H09 A;  1OIS A;  1RI7 A;  4RGX A;  4C2T A;  2XHK A;  1ETX A;  1IDZ A;  1QRY A;  4N9H A;  2DJI A;  1B72 B;  4JP0 A;  3LQR A;  3KET A;  1M1E B;  4BAC A;  4N4N B;  4G7Z F;  5IPA A;  1V5G A;  3PIP F;  2CGP A;  3DKX A;  2LBF A;  1ZQ3 P;  2X51 A;  3M1C A;  4YRV A;  5JLW A;  3WG9 A;  4GXO A;  5FKL A;  3S1Q J;  1JKO C;  1Y8R B;  3GTL J;  3D5L A;  4IF4 A;  2V9P A;  3OYF A;  1LB2 A;  1O3R A;  4M74 A;  3K9T A;  4KNY A;  2H8W A;  3WTT C;  3BQZ A;  1QGP A;  2XPU A;  4A6D A;  1U0J A;  3GZ5 A;  4HG2 A;  4JX4 A;  4M6Y A;  3E6C C;  1KA8 A;  1AWC A;  3WHB A;  4BE0 A;  1IG7 A;  3S15 J;  4M3G A;  2IAI A;  4UHT A;  1W7P A;  1Z6T A;  1YIJ I;  3ZMS A;  2YU9 J;  3TL4 X;  1YHQ I;  4Z6Y A;  4DYC A;  2E71 A;  3V8L A;  2HVR A;  3MWM A;  1K4S A;  1IO2 A;  3NWT A;  2P5K A;  1MND A;  4A6E A;  3G3Z A;  1TZL A;  2LVS A;  2Y0S A;  2A5Y B;  1MSE C;  3LAJ A;  4DZP A;  3CP2 A;  3BCA A;  3N97 A;  3OIO A;  2HPI A;  1FWZ A;  4RB0 A;  1J5Y A;  1MH4 A;  3UR3 C;  3BJA A;  4IZZ A;  3HOU J;  5BPD A;  1OMI A;  3PSI A;  2GOX B;  2MFZ A;  2JA6 J;  1YOV B;  1TC3 C;  1E3O C;  4BBS J;  3TDZ C;  2A3S A;  1HDP A;  4DOZ A;  4EM2 A;  2HXI A;  2VKD A;  5E1W A;  3ECO A;  1MDM B;  4KIT B;  3C3W A;  3M4O J;  1XMA A;  2MH9 A;  3S1N J;  1SD5 A;  2FU4 A;  1BI2 A;  2XAQ A;  4CUG A;  4C30 A;  4AYB A;  4CYD A;  1XN7 A;  3F72 A;  2DYS H;  3QOD A;  2HKX A;  4AUX A;  1DPR A;  5ICC A;  5JR3 A;  4GGG A;  3U2R A;  4E7Z A;  4BXF A;  4MEY F;  2A6T A;  5IT3 A;  1JJ8 C;  5LEJ A;  5BMZ A;  1W5T A;  2JPB A;  1LEB A;  2L01 A;  2IXS A;  3BZ6 A;  1G3Y A;  5EGO B;  4G6D A;  1J75 A;  3S1M J;  4ENK A;  1IRZ A;  1IJW C;  2FA5 A;  2GA2 A;  3RQI A;  3R60 A;  3ZOB A;  2K9M A;  2M30 A;  3AL0 C;  1PVE A;  1HF0 A;  2B7E A;  6PAX A;  3G1M A;  3RJP A;  3T8T A;  3ZP5 A;  4M9Z A;  2R7T A;  1PDN C;  1UFM A;  2VOO A;  1QVU A;  3CJT B;  1IDY A;  3FIS A;  4YFX F;  2EIJ H;  4ZYE A;  2LY2 A;  1OYW A;  3B73 A;  5LGT A;  1F43 A;  4Q47 A;  2QEX I;  2V26 A;  1G3W A;  5BQT A;  5E1X A;  2RAE A;  3FXM A;  1N75 A;  1LDD A;  1IXC A;  3OYK A;  1A31 A;  3GCM A;  4I98 B;  4CYC A;  3DFG A;  4M72 A;  2DOF A;  4XLC A;  4CCJ A;  2R0Q C;  5E79 C;  1A04 A;  3EYY A;  2OPT A;  4D7M A;  1HKQ A;  1JI8 A;  1SD4 A;  3I5U A;  5AIP A;  5TIS C;  1MGT A;  1SMT A;  2KT0 A;  1C0W A;  1YW9 A;  4CZC A;  3Q9V A;  1ETY A;  1UJ8 A;  3H9G A;  2QQB A;  1R1U A;  3LST A;  2E35 A;  2L5Q A;  1O7L A;  3GWZ A;  4HV5 A;  4CDG A;  5E20 A;  2EIN H;  4N0B A;  1YS6 A;  4HF1 A;  4PGH A;  5E3N A;  1YJ9 I;  3LSK A;  3HBL A;  3N05 A;  1QZY A;  2OJE D;  3K70 C;  4U7D A;  3G1O A;  4L5J A;  3V7C A;  1FNN A;  5HDN A;  2WBM A;  3REO A;  2RDP A;  1RET A;  5BS6 A;  5EZG A;  3KEY A;  3MEX A;  4JX6 A;  4BXX J;  1XG1 A;  1LQ1 A;  2FBH A;  1V55 H;  2W84 A;  3C2B A;  2NVT J;  3GYH X;  5FKN A;  5J3L A;  1TTY A;  3RKY A;  1UST A;  3ZRG A;  2E7W A;  2LTP A;  2ZBK A;  3LFK A;  5J1Y A;  4AIJ A;  1HC8 A;  2ECB A;  3FM3 A;  3CMA I;  3JTG A;  2HOE A;  1U9O A;  3JW4 A;  3CO6 C;  2VOD A;  4IHT A;  1FBQ A;  3ZPL A;  4CYC B;  2X1D A;  5FD5 A;  3J80 K;  3OOU A;  1EH8 A;  2QGU A;  2EFQ A;  4EAT A;  3ZMV A;  1Z21 A;  1S7A A;  4WF2 A;  4BL0 B;  5F1R A;  4PJL A;  3PO3 J;  3GX4 X;  1AOY A;  1HQC A;  2DPD A;  4CCM A;  3M9A A;  4ANJ A;  3ZN0 A;  2W25 A;  1KU3 A;  4EJW A;  2L7F P;  3JRG A;  2V7F A;  1QPI A;  1GXQ A;  1UHW A;  2KMU A;  3I58 A;  5J4Y A;  3LOC A;  1VQO I;  1PYV A;  2LLK A;  3F8M A;  3TOB A;  2VOP A;  3CJR B;  3CCR I;  4BJT A;  4DIQ A;  3MKZ A;  3I59 B;  1QHG A;  2CU7 A;  2E2J J;  2QBY B;  2DU9 A;  1GLN A;  2LKP A;  1O7F A;  2DOD A;  2RKH A;  2VL8 A;  2XAF A;  2JWT A;  4W1U A;  2OA4 A;  1VQP I;  1YG2 A;  2FOK A;  3B6C A;  3OSG A;  1T8I A;  4Y17 A;  4XNF A;  3VOD A;  2JSC A;  2O7O A;  2FEZ A;  2WC2 A;  1VTN C;  3DEE A;  5CVU A;  4A0Z A;  1YJW I;  5CVI A;  1GUU A;  4XID A;  1JHF A;  1BOA A;  2R4G A;  1BJZ A;  3E6B A;  1YFH A;  4MQV A;  5IYB J;  2E19 A;  1KU7 A;  1EH7 A;  2PI0 A;  3KIO A;  3BQY A;  1WZ2 A;  3OYB A;  3QYB A;  3H0D A;  5F0F A;  1E3H A;  1HBX G;  1I5Z A;  2H6C A;  2DA5 A;  2ELH A;  4R79 A;  1TP4 A;  1BIA A;  4A0X A;  1BW6 A;  5IYC J;  3PSF A;  1JGS A;  2VN2 A;  1NK2 P;  4ZTJ A;  2KDZ A;  3EDP A;  2R93 J;  2IGO A;  5CPR B;  1P9Q C;  1FT9 A;  1PP7 U;  1WCM J;  3I71 A;  1NG6 A;  5B1B H;  1RIO H;  3A02 A;  4IJA A;  4C3J J;  1D0X A;  2IGN A;  3OWT A;  2K9S A;  1G59 A;  1X1D A;  1PUF B;  1ONV A;  3FXU A;  2JRT A;  1Y1V J;  1FOW A;  5HS8 A;  2P5V A;  2DA7 A;  2L3D A;  2WV1 A;  3K4J A;  3CCY A;  2ZJQ F;  4GYI A;  5D6E A;  1D0Z A;  1Z6R A;  4UNO A;  3BC8 A;  2B9S A;  4XL9 A;  1O57 A;  1Z7L A;  2IA2 A;  3BP8 A;  2MA3 A;  2OCC H;  2DXI A;  1Z7U A;  4WK8 F;  2HDD A;  5GTH C;  2DN0 A;  5KK1 A;  2V1N A;  2F5E A;  2P8T A;  2VJ4 A;  1Q1H A;  4B47 A;  1T56 A;  1JKR C;  4XLE A;  4L9N A;  1LEA A;  1XSV A;  3KP7 A;  1ON2 A;  3G71 I;  4KFC A;  2ZSI B;  1SD7 A;  1OR7 C;  4IKF A;  3S32 A;  2COM A;  1H0M A;  2XKP A;  2XDV A;  4KT6 A;  3BPV A;  2UXX A;  3QP6 A;  1LE8 B;  2BY2 A;  4B3A A;  3K6G A;  3M8J A;  4KN4 X;  3SZP A;  5ILU A;  1R58 A;  3PNY A;  1A6I A;  3CCQ I;  2CO5 A;  1WWX A;  3BG3 A;  2I5U A;  3HUG B;  3PL8 A;  1VQM I;  2CV1 A;  4GFB A;  1J7K A;  1ORK A;  2JA8 J;  2V9K A;  1U2W A;  4MEX F;  4ENM A;  1ZRC A;  2DAO A;  4I0A A;  4FQG A;  3E1S A;  3Q5F A;  1VFC A;  1OKR A;  2JVH A;  2D2W A;  3GME A;  5IOZ A;  4OMZ A;  3OS1 A;  3SJM A;  2VJI A;  4XKC A;  4LLN A;  2XRO A;  5EGO A;  3QPL A;  1YRN B;  4Z2Y A;  1Z1D A;  1A6Q A;  2ELJ A;  3FX3 A;  1KON A;  2CW7 A;  2NXN B;  1SFO J;  1I3A A;  3OR2 C;  1HLV A;  2KPM A;  5CLS A;  4C2U A;  3LA3 A;  2GBY A;  2BE5 F;  3V42 A;  2FML A;  4FE7 A;  4A3I J;  5FRN A;  1FOK A;  1J59 A;  1ETQ A;  5CYV A;  3TW6 A;  1R4M B;  1T98 A;  2HOT A;  5D4R A;  1XTA A;  1UMQ A;  1G4D A;  2L2O A;  3GLL A;  1EF4 A;  2ZNZ A;  4PUS A;  3V7R A;  4Y13 A;  1BI3 A;  4DBQ A;  4XQF A;  4I01 A;  4NBQ A;  4CCN A;  1ACI A;  2Z5U A;  1MJB A;  2MLG A;  5ICF A;  3E5X A;  4HDV A;  3HTS B;  3VSL A;  4ZZD A;  5M3M J;  4XON A;  2MYS A;  2BOL A;  3I4P A;  2QUF A;  1SC7 A;  1MMD A;  4X0G A;  1ZN2 A;  3B6A A;  2XB0 X;  1AA7 A;  2DMT A;  4E6K G;  2WAQ A;  2PEX A;  2E60 A;  3S8P A;  2ME0 A;  3OYN A;  2JRM A;  3OYH A;  1ZR4 A;  4C3I J;  3U1D A;  4YIF A;  3FKI J;  5E1Z B;  4KIB A;  2FNA A;  4E7K A;  2EPF A;  2D45 A;  1UCR A;  4WWC A;  2XF5 A;  3QYF A;  2WY8 Q;  3EUH C;  2Z16 A;  2A6E F;  4JOM A;  4JX5 A;  1FMV A;  1JKQ C;  4UVB A;  1UEL B;  1MNM C;  4BKX A;  5DCM A;  5IT9 K;  4KMU X;  5J8C A;  3CME I;  1ZEL A;  3L9F A;  3M07 A;  5TRD A;  2Q2E A;  2ZME B;  3HRT A;  2OUM A;  2QSH X;  3OIQ A;  3FHN A;  1T08 B;  1UZC A;  2O03 A;  2HOS A;  1SVO A;  4MNU A;  2LBF B;  1RZ4 A;  1REP C;  1FP1 D;  3FXK A;  4EJT A;  2LR8 A;  4PK4 A;  4XIC A;  5D5V B;  2XAG A;  3HKZ N;  4M71 A;  4HST A;  1D3Y A;  4RB2 C;  2IW5 A;  1G3S A;  3GUD A;  3J7A O;  5CVV A;  3W6J B;  1MKM A;  2JMW A;  4EMS A;  4YEL A;  4OAY A;  2COB A;  2H1L A;  2ZKZ A;  3AG4 H;  2ME6 A;  1SAX A;  3WOD F;  3I55 I;  3E5U A;  2AXT C;  4MLO A;  2PJR A;  1WJB A;  1ZRE A;  2JN6 A;  3CDL A;  2MGQ A;  4OIR F;  5FRM A;  2K4B A;  3MMY B;  2WAD A;  4LIV A;  1Y6I A;  2NVY J;  2PLY A;  1FYK A;  5F04 A;  3GTG J;  4IRH A;  4UV8 A;  5HLI A;  1UG2 A;  4ESB A;  4U87 A;  1TLH B;  2BW3 A;  2GAU A;  5JVG F;  1ZYR F;  5FJ8 J;  2F5F A;  3CF2 A;  4OIO F;  3FMQ A;  4I09 A;  2W1O A;  2DI3 A;  1S5L C;  4BBR J;  4GYG A;  2KJC A;  3ROU A;  2K27 A;  4HOB A;  3KYL A;  3HOV J;  1XGN A;  2DA2 A;  3IUO A;  3OV8 A;  3O8H A;  2WB1 N;  2DA1 A;  1EA3 A;  3GFM A;  5H6R A;  3S3O A;  3PIO F;  3HYI A;  2MBF A;  3LFU A;  3ZN1 A;  3K4K A;  2G7U A;  1W36 D;  2M2E A;  2WTE A;  5FLM J;  2KIM A;  3ERE D;  4BDY A;  2X1C A;  1UG0 A;  3JRF A;  3C2G A;  2O9L A;  2Z1D A;  5HS7 A;  1S72 I;  4ITV A;  1A35 A;  3ELK A;  2ADU A;  1P4A A;  2VBZ A;  3CP8 A;  3TQN A;  4U0V A;  2X85 A;  2MW8 A;  1F4K A;  2DTZ A;  3JRA A;  2CSO A;  3H1C A;  5DUI A;  2JPC A;  3CCV I;  2DQR A;  2G9W A;  1MSF C;  1J2X A;  5GPA A;  1R9T J;  2DDA A;  2C6Y A;  4H4K C;  1MBE A;  3EUA A;  1D1C A;  4HX7 A;  2BY0 A;  2XIG A;  4ENJ A;  3BR5 A;  2VJ5 A;  3BG9 A;  3Q0V A;  4C9Y A;  2GIV A;  2DK5 A;  4ZH4 F;  1DDN A;  4MO7 A;  4GDF A;  3KLO A;  3FWE A;  3CCS I;  1DUX C;  5CVR A;  2ZXW H;  3WU1 B;  2JA5 J;  1ODD A;  1WGX A;  3VOE A;  4LK0 F;  2VC0 A;  1SAU A;  3T1B A;  2KKO A;  3H9J A;  4FT8 A;  2ZC2 A;  5CQE A;  3FXQ A;  4P9F A;  5LEK A;  3R0J A;  4IX7 A;  4IHS A;  1YLF A;  1WQ2 A;  1KU9 A;  4HX8 A;  3PQJ A;  4RB3 C;  2YUS A;  1OR7 A;  2WAF A;  4CIC A;  2CFX A;  4BHB A;  1Z77 A;  3KX2 A;  4D5C A;  2EZK A;  3KP6 A;  4NNJ A;  4HNT A;  2NAZ A;  4JK1 X;  4BGD A;  3GTQ J;  3ULQ B;  3VYR B;  4M6V A;  1T0F C;  1B8I A;  3QOE A;  1K6O A;  2EV5 A;  3OYI A;  3BG6 A;  3DU6 A;  1U5T A;  2NS8 A;  5FGM A;  3BPX A;  1OFC X;  1AU7 A;  5EF6 A;  2LG4 A;  1JUM A;  2OTJ I;  2VI6 A;  1X3U A;  2RNJ A;  4L5I A;  1SVL A;  2BHY A;  2KIS A;  1LVA A;  3RYP A;  1FTZ A;  3K2A A;  2GIZ A;  5E3M A;  3F8B A;  5C4X J;  1OCO H;  1VI0 A;  3LSM A;  3MFK A;  1FSE A;  4XLP F;  1NH3 A;  1XSX A;  3FKJ A;  1TNT A;  2JK3 A;  1HW2 A;  1IV6 A;  3DF8 A;  3CC4 I;  3L2C A;  1L3L A;  3K10 A;  2ZME C;  3LSI A;  1MNE A;  1X2N A;  4HEA 2;  1I39 A;  4PGG A;  4OMY A;  2Y69 H;  4Q48 A;  2ETH A;  1ULY A;  3WG7 H;  4F52 A;  1ETK A;  4XMY A;  5JHF A;  5EEA A;  1I6H J;  4ZDL A;  1X4O A;  3OYD A;  5LLQ A;  3K0L A;  5K5O A;  1K83 J;  1MW7 A;  1HA8 A;  3HGG A;  3CQZ J;  5M5X J;  1ETO A;  3TKY A;  4IVN A;  2M1B A;  4D0P A;  1DP7 P;  1JGG A;  3HC7 A;  2R7Z J;  4L18 B;  3BLY A;  4XOT A;  2M8E A;  4PJM A;  3D5S C;  4Y3O A;  3T0Y A;  4UUS B;  5DD4 A;  1IXS B;  2MLK A;  4NUB A;  1VQ7 I;  4CHU A;  1Y39 A;  4E4H A;  4LG3 A;  1E3P A;  4BHC A;  3WU2 C;  2R92 J;  3F23 A;  3OL3 A;  4LB6 B;  3L09 A;  2JA2 A;  3LSR A;  3RI4 A;  2JA7 J;  3HTU A;  5F1J A;  1HKS A;  3ZQ7 A;  2DA4 A;  2PN6 A;  1IN6 A;  1R71 A;  4ABZ A;  1FJL A;  4S05 A;  1U78 A;  3IKV A;  1GDT A;  2QSG X;  3A4C A;  2ZJ2 A;  1B6A A;  3BJO A;  5FD6 A;  1SVM A;  2Y75 A;  1B1B A;  3CLQ A;  2A05 A;  2HWV A;  1XPX A;  1ZH5 A;  1B9M A;  2BGC A;  2LKX A;  1MIJ A;  5J1U A;  4DZJ A;  2W4S A;  3HOZ J;  3IRR A;  1UAA A;  2G0E A;  2YPR A;  3UKG A;  5IYD J;  1YW7 A;  3HEF A;  2OV7 A;  1JKP C;  4XRS A;  1WJF A;  1IF1 A;  3RSN A;  3CCE I;  2HTJ A;  4J19 A;  4E7H A;  1H89 C;  5FKK A;  3I4N J;  1XMX A;  2DDB A;  5L3E A;  2IS1 A;  4XK4 A;  2MD5 A;  2M5W A;  4IQ4 A;  4YG2 F;  4BS9 A;  3OYA A;  3AFH A;  3SZG A;  2F2E A;  2XGX A;  3RQ4 A;  5LHG A;  1ZG1 A;  2D1V A;  1YW8 A;  5D5W B;  2YX4 A;  2VXZ A;  3GVA A;  1X2M A;  1LKX A;  2DQL A;  4A12 A;  3R0A A;  3I4M J;  4KMF A;  1Q1V A;  3DEU A;  1FZP B;  3I64 A;  4AM3 A;  4M3B A;  2RN7 A;  3D5R C;  2NOJ B;  1R00 A;  4O3M A;  3ZQQ A;  4FHT A;  5A2Q Z;  2FE3 A;  2MAB A;  2M34 A;  2STW A;  2L54 A;  9ANT A;  4XN3 A;  1JT0 A;  3RKQ A;  3OIP A;  3DLL F;  5HNH A;  3DEW A;  2L7K A;  3RTR A;  4AIH A;  1WI9 A;  4EQQ A;  2O8K A;  1UHM A;  2L4M A;  4AYB N;  5LGU A;  1VQ6 I;  1KYZ A;  2HKO A;  3N4M A;  4ZJZ A;  1T0F A;  5HOO A;  2EV0 A;  3KP2 A;  1D8J A;  1U5T B;  5DCM B;  2RGV A;  2JT1 A;  4A3F J;  5J4V A;  2NRA C;  4UUV A;  3FXR A;  2IGM A;  4GO1 A;  3U21 A;  2QA4 I;  3A01 B;  4IRI A;  5C44 J;  1P6R A;  4ENN A;  1W4M A;  3IKT A;  4U0W A;  2NNN A;  2V1D A;  3HUG A;  3VYT B;  2FSW A;  3BZC A;  2LYC A;  3JRC A;  4LJZ F;  2CQQ A;  3DXJ F;  1F1Z A;  3BWG A;  5EEG A;  2K7L A;  4J01 A;  2HDW A;  2K85 A;  4B8X A;  2FF4 A;  2L9V A;  2VQC A;  3BTI A;  3SFZ A;  1V4R A;  3JRE A;  4B48 A;  3F8C A;  4CCK A;  5CQG A;  4LK1 F;  4UVC A;  4XOP A;  3TDU C;  4RBO A;  4AC0 A;  2BXY A;  2CQ7 A;  4UY8 I;  3GFL A;  3ZMD A;  3ZXS A;  4H0E A;  3TO9 A;  3ERM A;  4AIK A;  1NK3 P;  2Y0M A;  1EH6 A;  4S04 A;  4G9Y A;  3HOX J;  4YEJ A;  3BTL A;  2DJN A;  3A2K A;  2NVQ J;  4A3D J;  3PO2 J;  3EQL F;  2Y30 A;  2DTR A;  2QQ9 A;  2GLO A;  3FIW A;  5B1A H;  1W0T A;  2HNH A;  2LRD A;  4AWX B;  2KLO A;  5F64 A;  2M9H A;  2VIX A;  3DV8 A;  4RAF A;  4B1R A;  4A3K J;  2OZU A;  3ONQ A;  1JUP A;  4FE4 A;  1U3E M;  2HGC A;  3KP4 A;  4WXH A;  3L2W A;  5L3B A;  2CH0 A;  2FNP A;  4XKW A;  2LP0 A;  2X6X A;  4AVZ A;  1H9T A;  1KQ0 A;  2N8G A;  3EUK L;  3K1P A;  2VUM J;  2EFN A;  4OIN F;  2XGC A;  4BU2 A;  2VON A;  3I3L A;  1WJC A;  3F9K A;  2XPV A;  5IT9 Z;  3F22 A;  1YS7 A;  1VQ9 I;  1T2K A;  1SD6 A;  4F7Z A;  1HKT A;  2X48 A;  1ZHF A;  1X58 A;  2LC2 A;  3C18 A;  2E1N A;  2UV1 A;  5IP7 J;  1R7J A;  5H2F C;  5DDG A;  1ZAO A;  1H8A C;  1FYL A;  3DLA A;  2M87 A;  1IUY A;  2YX7 A;  2OQR A;  2VBY A;  1Z0X A;  2DOE A;  2MC4 A;  3OL4 A;  4L9V A;  5F27 A;  2CV0 A;  4HW0 A;  1FSH A;  5J8F A;  3M8F A;  4HX4 A;  4IRG A;  4BJ6 C;  1X4P A;  5GAE J;  3MZY A;  2P6S A;  4RGU A;  3DQV C;  1DPU A;  4C3H J;  4RDU A;  3S2W A;  3GW2 A;  3IWF A;  1J9I A;  2RV8 A;  4XSX F;  2GZW A;  2NNY A;  4D1Q A;  4MFD A;  5JHU A;  1EV7 A;  3WTZ A;  2E2H J;  2EFW A;  1P7I A;  3JRI A;  2CG4 A;  4G6Q A;  1BIB A;  1BM9 A;  1WJD A;  1R5I D;  4PJ0 C;  4RM3 A;  1IAW A;  4R8H A;  5DM7 F;  2Z3Y A;  2AXL A;  5K5R A;  1YIO A;  1P92 A;  2P4W A;  3BT9 A;  2O3F A;  4BHP A;  2WAQ N;  3W2V A;  1SFU A;  1J09 A;  1ON1 A;  2PMZ A;  2DT6 A;  1IN7 A;  4OWR B;  1BI0 A;  1TQI A;  3OR1 C;  1IRX A;  4NDL A;  2DO7 A;  3Q0W A;  5F0H A;  1BC8 C;  2L4A A;  4A5M A;  2P5L C;  2B0L A;  2GOM A;  2ZJR F;  4BE1 A;  5L3C A;  4KYW A;  1FP2 A;  2IJL A;  3SEZ A;  2R7R A;  2XVC A;  1SMY F;  1S6L A;  2QCO A;  2LD5 A;  1U8R A;  2Y48 A;  2XF6 A;  2NYX A;  1LUJ B;  3JSO A;  2K86 A;  1YX3 A;  2F6C A;  2X4H A;  5CKT A;  3HRU A;  4HZF A;  4JQF A;  3G73 A;  1TWG J;  1V5F A;  4ZTF A;  3P5J A;  3J81 K;  1YJN I;  1XD7 A;  4BUP A;  4ZYG A;  1GXP A;  4HBL A;  2L0K A;  2QF7 A;  3HM5 A;  4F93 B;  3BR0 A;  4EJV A;  4CSW A;  2IA0 A;  2PMZ N;  3QU3 A;  2IP2 A;  4AID A;  2BXZ A;  3CZ6 A;  5KHD A;  2D5V A;  1GHC A;  1U5T C;  5DD8 A;  1R23 A;  2OD5 A;  5TJJ A;  2R7D A;  4B3X A;  5LD2 C;  3WU0 A;  2E7X A;  3ML6 A;  3MVP A;  1HDD C;  4IHW A;  3AG3 H;  3B02 A;  1H88 C;  2LY1 A;  5DCF A;  2QKM B;  5GAG J;  3CJQ B;  3ABM H;  3X2Q H;  1LFU P;  3ZQG A;  3FXJ A;  2QQA A;  2UWM A;  3ABK H;  3TED A;  1KU2 A;  1ZLJ A;  2QEN A;  1QU3 A;  4QTR A;  2HQR A;  2FQ3 A;  4NHJ A;  2EBI A;  4DW6 A;  3GFI A;  3PM1 A;  1WI3 A;  3GLX A;  4P5O A;  2BV6 A;  3IAM 2;  3S16 J;  3QWL A;  2R7V A;  2M45 A;  3IV5 A;  3QQA A;  3GXO A;  4IPA A;  3FHZ A;  1OCC H;  1U6G A;  4A0Y A;  1VQ4 I;  2QSF X;  4ON0 A;  2NOG A;  5ED4 A;  2V1X A;  2ZO4 A;  3BTJ A;  3CMM A;  1XGS A;  2W7N A;  1WKM A;  1FYM A;  4KDP A;  1ZRF A;  5E8G A;  2L9N A;  1I50 J;  5ERI A;  3CDH A;  3BTC A;  5GPC A;  2KJB A;  1BJA A;  3DPL C;  3K70 D;  4QLC U;  2Q1Z B;  5E17 F;  4XR6 A;  2X6Y A;  1Z3Y A;  4V2F A;  4YFK F;  4UUS A;  4UXN A;  4HV6 A;  2K5C A;  2QQ8 A;  2HI3 A;  4N9I A;  2E1C A;  4EJU A;  2K02 A;  3H3Z A;  3HPH A;  1IN8 A;  4B44 A;  2VBX A;  1KYW A;  4A5N A;  3CTA A;  2V79 A;  3QPH A;  4MQ9 F;  2F5D A;  1XSD A;  3BR6 A;  3GFJ A;  4UB8 C;  2BVL A;  2XRL A;  2EA2 A;  3A03 A;  3LSP A;  3F6V A;  3R61 A;  1WFX A;  2CUJ A;  1GV5 A;  1F36 A;  3ABU A;  3BG5 A;  3HHH A;  2KQR A;  4MGR A;  3KYD B;  2ESH A;  1D5V A;  5HNF A;  3GF2 A;  4B43 A;  1ZK8 A;  3EUH A;  1BBY A;  1YRN A;  5ICG A;  4LIT A;  2LFB A;  4LIU A;  3GTO J;  2DMU A;  2ELK A;  4MTE A;  3BZK A;  2JZY A;  2NS0 A;  4Y7N J;  1ZLK A;  3DP7 A;  1ZGJ A;  2PG4 A;  1XCV A;  2VT2 A;  5BOX A;  3GTP J;  5DEQ A;  4YFN F;  2STT A;  3PQK A;  1VQN I;  1R36 A;  3OSF A;  4E7I A;  1FOY A;  2LRE A;  2WAE A;  2EIL H;  3K4N A;  4EVI A;  1W7P B;  5K7Z A;  2ZB9 A;  1HSJ A;  1W7P D;  4L9T A;  3FMR A;  2KRF A;  4FIS A;  2F48 A;  1ERD A;  4UV9 A;  5LHH A;  1XB4 A;  1MJ9 A;  3CUO A;  3ZMZ A;  4XBF A;  2CUZ A;  2QYO A;  2QKL B;  4KIF A;  2KIU A;  2L9S A;  1ZR2 A;  4XN0 A;  1K61 A;  2A07 F;  4DYR A;  2YSR A;  3D1N I;  1SFK A;  4YIR X;  3CCU I;  1I1G A;  1N25 A;  3C2H A;  3K1N A;  2M8G X;  3HDD A;  4Y33 A;  2KIF A;  3H5R A;  2H1K A;  2WA0 A;  3MD2 A;  3LSG A;  2XB5 A;  1K4T A;  4ZZL A;  1QBJ A;  2OTL I;  2E34 A;  4RAY A;  2AHQ A;  2R7W A;  4J00 A;  4BDZ A;  5HDK A;  2JJ7 A;  3GEZ A;  3S2D J;  4RA2 A;  3CMY A;  2CUE A;  3KZZ A;  3HGY A;  4HQM A;  2OQG A;  4E7J A;  4RLF A;  3KYC B;  3AL0 B;  2FD5 A;  3QOP A;  1Y56 A;  3VSK A;  3K2Z A;  1OJL A;  2RQQ A;  5DM6 F;  3TMO A;  2JQ7 A;  3W2A A;  2YR2 A;  3L2Q A;  2QWW A;  2PX9 A;  1GV2 A;  4MHG A;  4ZC3 A;  5E8I A;  2J5P A;  1E0E A;  4A93 J;  4I0B A;  3PFY A;  3W6K B;  3JR9 A;  2VPL A;  2XKO A;  2YS9 A;  3S3N A;  4UB6 C;  1KGS A;  3F3X A;  5IOY A;  2KP6 A;  3ZGK A;  2LDU A;  1TWC J;  2HZD A;  2BZT A;  2ZJP F;  1D1A A;  1W36 C;  4DGW B;  1O3Q A;  3GZN B;  3FZV A;  4OAZ A;  3ASO H;  3RZO J;  4HSR A;  3QYE A;  3VPR A;  2PQ8 A;  1ZGA A;  1WPK A;  2J5O A;  3DTI A;  2GXB A;  2XSJ C;  1SFE A;  5ILS A;  2UXN A;  3LNQ A;  4K2E A;  1RUO A;  1OCT C;  3PFI A;  3E7L A;  1RKT A;  4PSW A;  2P0W A;  2VT3 A;  1X3Z B;  2ZFU A;  1EKE A;  2DFE A;  2VE8 A;  5K5Q A;  1SEU A;  5KAI C;  2EJR A;  1BI1 A;  2EZH A;  5LRS A;  3QP5 A;  1VQ5 I;  3DBH B;  2W00 A;  2O8X A;  1BA5 A;  3LQQ A;  3EPZ A;  1JXS A;  3JRH A;  3IHU A;  3CCL I;  2XRN A;  2IS4 A;  2DFH A;  5E3L A;  3A1Y A;  5HLT A;  4HLY A;  1ZAR A;  2DA3 A;  2ACJ A;  2FMY A;  1WJA A;  5LBQ A;  1UHS A;  1MJA A;  2V9V A;  3WE3 A;  1RR7 A;  4U0Y A;  3I59 A;  1B9N A;  4B4C A;  1PJR A;  3ECH A;  2FUG 2;  2OBP A;  4XM3 A;  1XMK A;  2FJ1 A;  2W57 A;  3ZQL A;  3HOW J;  3TP3 A;  5HLH A;  3CC2 I;  1HST A;  3KPH A;  2DT7 B;  3ASN H;  2CW8 A;  1T6S A;  3TBI A;  1ETV A;  2M0C A;  2XGD A;  2WY7 Q;  3L7W A;  2HPM A;  4BNC A;  1QVT A;  1TQM A;  1IZ1 A;  1B59 A;  4AU7 A;  4WX9 A;  2FBK A;  3NEU A;  2R7S A;  3E6D A;  2WWY A;  2X6W A;  3WTY C;  3ZMT A;  4ESF A;  2EIK H;  1RR8 C;  2LK2 A;  3S2H J;  1KQ9 A;  2VE9 A;  1LVK A;  1OQY A;  5KNL A;  2LSO A;  3HJE A;  4RLQ A;  3OYM A;  3DPU A;  5HS9 A;  3MAJ A;  4I02 A;  2O6G E;  2DCE A;  2ISZ A;  1FIP A;  3HSF A;  4RM2 A;  5EZH A;  3CCM I;  4FCY A;  2CQN A;  3S14 J;  2EK5 A;  2CRG A;  4BAY A;  1S3J A;  1O3S A;  2RC4 A;  1JTX A;  1OLT A;  5EG0 A;  2ZNY A;  4WXD A;  1CQT A;  3DU5 A;  1DGW Y;  1G8X A;  3HRS A;  1LDJ A;  1D8K A;  3HSE A;  2HU9 A;  3J7Y J;  3MKL A;  3T5X A;  2KZG A;  4I2O A;  4E70 A;  2ZXJ A;  3CLO A;  1X1P A;  1WJ5 A;  1YYV A;  1A36 A;  4BY1 J;  3FBN B;  1Z3X A;  4Y15 A;  3ZMU A;  5H20 A;  3MKY B;  4V2G A;  3HOT A;  2XF7 A;  4XRF A;  3PNV A;  4E7S A;  4A3M J;  5DYM A;  3TO7 A;  1SAN A;  2EB7 A;  2VKE A;  4PFP A;  1QA6 A;  2VKH A;  3BR1 A;  3WTW C;  2V6C A; 
#chains in the Genus database with same CATH homology
 1K79 A;  3U9G A;  1K78 B;  5ICE A;  2XAH A;  2O0Y A;  2D1H A;  1XDU A;  1PP8 F;  1WRJ A;  2ZCW A;  2VBW A;  4LLG F;  2PJP A;  4PZJ A;  1OYI A;  4UVA A;  4R1H A;  3P9I A;  3K1M A;  2HDC A;  4DQ2 A;  3RIR A;  3CUQ C;  4GCV A;  1OYY A;  1IN5 A;  3IWZ A;  1Z05 A;  2HYG D;  2GQQ A;  1P4W A;  1IXR C;  2MH2 A;  3P9K A;  2EWN A;  1H9G A;  5F6F A;  3LAP A;  1QZZ A;  1FY7 A;  1L0O C;  2QBY A;  4I7H A;  4G7H F;  1BC7 C;  5FO5 A;  1IW7 F;  1G3T A;  2QZ8 A;  1WSU A;  1S7O A;  4Q5S F;  5FFX A;  2OZ6 A;  1TBX A;  3O3K A;  3JAM Z;  4RB1 A;  4RGR A;  4G7O F;  3SQN A;  3J81 Z;  3HRM A;  3RDI A;  4DNC A;  3LA7 A;  4LGW A;  1JHH A;  4A2U A;  1XGO A;  2LF7 A;  1CF7 B;  3FF5 A;  3TOA A;  4U7B A;  1YO5 C;  3KP5 A;  2PMH A;  2DBB A;  3KP3 A;  1F5T A;  2CYY A;  1QO0 D;  2CQK A;  5AON A;  1O3T A;  4HQE A;  2W24 A;  4ETS A;  2GWR A;  5JI6 A;  1K7A A;  3JSP A;  4HYE A;  4M9X A;  3EET A;  2EFP A;  5D4S A;  2RVC A;  2CWE A;  1MD0 A;  4P96 A;  3VFZ A;  4EM1 A;  3H92 A;  1I1S A;  1GVJ A;  2Z99 A;  5KVR A;  3SZT A;  2LF8 A;  3MQ0 A;  3E5Q A;  3R4K A;  1S29 A;  3NQO A;  3RKX A;  5D5U B;  4PDK A;  3QAH A;  5D8K B;  4KIG A;  1R22 A;  4WCG A;  3D0S A;  1FPQ A;  2HTS A;  3BDD A;  1P4X A;  3O6B B;  1Y0U A;  3TGN A;  4G8X A;  5CJ9 A;  1ZG3 A;  1FX7 A;  3K69 A;  3L00 A;  2Q0O A;  1RNL A;  3RKW A;  1YTY A;  2W85 A;  2HEO A;  3F8F A;  4EGZ A;  1R5G A;  3QRF F;  1XCB A;  1R1T A;  3MCZ A;  3V7S A;  3BOQ A;  4LB5 A;  5L3D A;  2UZK A;  3CUQ B;  5FFZ A;  2Q8K A;  4P9U A;  4EJO A;  3V8J A;  4BXU A;  3LWF A;  3I53 A;  2FXA A;  2XAS A;  2XUB A;  1TW2 A;  5D6F A;  2BBY A;  3WGG A;  3QU6 A;  4OIQ F;  4BH9 A;  4L0Y B;  2DPU A;  2F5C A;  2ISY A;  2O61 A;  5CVJ A;  3KZY A;  2GA1 A;  2DK8 A;  2P7V B;  3DPT A;  4EV0 A;  4B09 A;  5L3F A;  3M7G A;  2V1U A;  4TV7 A;  1S8N A;  1HW5 A;  5DUK A;  2FRH A;  3O2P E;  3DKW A;  3WTV C;  3WTS C;  4HF2 A;  4RS8 A;  3ISP A;  4BYY A;  1UB9 A;  5DV5 A;  2DLL A;  2P7C B;  4CO8 A;  4ESJ A;  2DFI A;  4LG0 A;  3KLN A;  1E17 A;  2FBI A;  4L0Z B;  1IRF A;  3BY6 A;  2A6H F;  1FLI A;  4ZYH A;  3QPT A;  3IRQ A;  3COA C;  3CJN A;  1TNS A;  2IRF G;  1HW1 A;  2BEO A;  4KA4 A;  3CO7 C;  1USS A;  5FLX Z;  1JE8 A;  4G94 A;  3I54 A;  5L3G A;  3GO5 A;  2BYV E;  4HLX A;  1IRG A;  2Z33 A;  2DW4 A;  1HXD A;  5BPI A;  1XDS A;  3IL2 A;  4XSZ F;  2A61 A;  4WXC A;  1XGM A;  2PBI A;  3M1E A;  1QQI A;  1I27 A;  2G7H A;  4M73 A;  4OOI A;  4LFU A;  2Z9O A;  3KEQ A;  2A69 F;  5ILV A;  3TO6 A;  2X0L A;  4XLN F;  1CF7 A;  2PFB A;  2OU2 A;  3LA2 A;  3ABT A;  3BRO A;  2IVM A;  4JBA A;  4ZYD A;  2LNB A;  3CUQ A;  4QWQ A;  4P55 A;  1LJ9 A;  2HYF A;  2MC3 A;  1LDK B;  4KT5 C;  2EV6 A;  3P9C A;  4OIP F;  5LHI A;  2WV0 A;  3H3U A;  4HDU A;  3P7N A;  5HLG A;  2ZME A;  5JVT A;  5D8L B;  4NB5 A;  3OOP A;  2XAJ A;  2PMU A;  3F8N A;  3JTH A;  1Z9C A;  3R6S A;  3AAF A;  4YII A;  1SFX A;  2QLZ A;  1W5S A;  1PUE E;  4OU0 A;  3FMS A;  3V4G A;  5D5X B;  4O6J A;  1I6X A;  1BN5 A;  5EEH A;  4LD5 A;  3KFW X;  2IT0 A;  4ASN A;  2K4J A;  2XV4 S;  2H94 A;  5H6Q A;  4AD9 A;  5J6X A;  4KUM A;  1F9N A;  2H27 A;  2R7F A;  2EA4 A;  3J80 Z;  3IC7 A;  1V3F A;  4Q4Z F;  2CW0 F;  3WTX C;  5LGN A;  5AIQ A;  3BJ6 A;  3F21 A;  1CGP A;  4EM0 B;  2P6T A;  5FB2 A;  4M6X A;  4U88 A;  2HZT A;  3F6O A;  2HFH A;  2A68 F;  2GXG A;  1MDM A;  3KCC A;  2VC1 A;  2QM3 A;  1ZG5 A;  2L02 A;  5FLX K;  1QNT A;  1OPC A;  3RPQ A;  4O5V A;  1FBU A;  5HVQ C;  1IN4 A;  3WTU C;  3VB2 A;  1TQP A;  1FC3 A;  5LRR A;  2AS5 F;  4LG0 B;  2HS5 A;  3EYI A;  1STZ A;  5JFR A;  1P2F A;  3Q9S A;  3WE2 A;  3VEP A;  2HR3 A;  3M8E A;  4EGY A;  4RGS A;  4MTD A;  3T8R A;  3HSR A;  3RYR A;  3V8K A;  2HQN A;  1R5H A;  1T39 A;  3KE2 A;  4IXA A;  1YQA A;  3SXY A;  1B4A A;  2IPQ X;  2H6B A;  5E18 F;  2DT5 A;  2IA1 A;  2OAZ A;  1ZRD A;  4HAM A;  1E2X A;  3KEO A;  2R3S A;  3E6M A;  1K78 A;  3FM5 A;  3C1D A;  3JAM K;  3SHF A;  4FX4 A;  4LLL A;  4FX0 A;  2EFO A;  1RUN A;  2QVO A;  4RAZ A;  3NRV A;  3I0T A;  4AVP A;  4PCQ A;  4CGZ A;  4HF0 A;  3HIF A;  2RQP A;  3GZ6 A;  4HA8 A;  5HDG A;  3MZH A;  2ESN A;  1J0R A;  5A2Q K;  1QPM A;  4KIC A;  3HOS A;  4NQW A;  1MZB A;  3E97 A;  3RPU A;  1LNW A;  2ZFW A;  1NHA A;  1FBS A;  4BQA A;  1G6N A;  3WGH A;  1T38 A;  1TW3 A;  4L9J A;  5K1Y A;  2JTV A;  1KQ8 A;  2TDX A;  4LMY A;  4CXF A;  4M9S A;  1Z91 A;  3HHG A;  3E3V A;  4KN7 X;  3C7J A;  2YU3 A;  3WGI A;  1R1V A;  4CZZ A;  2H09 A;  1RI7 A;  4RGX A;  2XHK A;  4N9H A;  3KET A;  3LQR A;  4G7Z F;  2CGP A;  3WG9 A;  4GXO A;  3D5L A;  4IF4 A;  1LB2 A;  1O3R A;  4M74 A;  3K9T A;  4KNY A;  3WTT C;  1QGP A;  4A6D A;  3GZ5 A;  4M6Y A;  3E6C C;  1KA8 A;  1AWC A;  4UHT A;  1W7P A;  1Z6T A;  3ZMS A;  3V8L A;  3MWM A;  2P5K A;  4A6E A;  3G3Z A;  2A5Y B;  3LAJ A;  3N97 A;  1FWZ A;  4RB0 A;  1J5Y A;  3BJA A;  5BPD A;  1OMI A;  3TDZ C;  2A3S A;  4EM2 A;  5E1W A;  3ECO A;  1MDM B;  3C3W A;  1XMA A;  2MH9 A;  1SD5 A;  2FU4 A;  1BI2 A;  2XAQ A;  4CYD A;  1XN7 A;  3F72 A;  5ICC A;  2HKX A;  1DPR A;  5JR3 A;  4GGG A;  3U2R A;  4MEY F;  5IT3 A;  5LEJ A;  5BMZ A;  1W5T A;  2JPB A;  1LEB A;  2L01 A;  1G3Y A;  3BZ6 A;  4G6D A;  1J75 A;  4ENK A;  2GA2 A;  2FA5 A;  3R60 A;  2M30 A;  6PAX A;  3RJP A;  3T8T A;  3ZP5 A;  4M9Z A;  1PDN C;  1UFM A;  2VOO A;  4YFX F;  4ZYE A;  1OYW A;  3B73 A;  5LGT A;  4Q47 A;  1G3W A;  5BQT A;  5E1X A;  1LDD A;  1IXC A;  4I98 B;  3DFG A;  4M72 A;  1A04 A;  3EYY A;  1HKQ A;  1SD4 A;  3I5U A;  5AIP A;  1MGT A;  1SMT A;  1C0W A;  1YW9 A;  3Q9V A;  2QQB A;  1R1U A;  3LST A;  1O7L A;  3GWZ A;  4HV5 A;  4CDG A;  5E20 A;  4N0B A;  1YS6 A;  4HF1 A;  4PGH A;  1QZY A;  4U7D A;  3V7C A;  4L5J A;  1FNN A;  5HDN A;  3REO A;  2RDP A;  5BS6 A;  3MEX A;  1LQ1 A;  2FBH A;  2W84 A;  3GYH X;  3RKY A;  1TTY A;  1UST A;  2E7W A;  2ZBK A;  3LFK A;  4AIJ A;  3FM3 A;  3JTG A;  2HOE A;  3JW4 A;  3CO6 C;  2VOD A;  4IHT A;  1FBQ A;  3ZPL A;  5FD5 A;  3J80 K;  1EH8 A;  2EFQ A;  3ZMV A;  1S7A A;  4WF2 A;  5F1R A;  1AOY A;  3GX4 X;  1HQC A;  2DPD A;  3M9A A;  3ZN0 A;  2W25 A;  1KU3 A;  4EJW A;  1GXQ A;  1UHW A;  3I58 A;  3F8M A;  3TOB A;  2VOP A;  3I59 B;  2QBY B;  2DU9 A;  2LKP A;  1O7F A;  2RKH A;  2XAF A;  2OA4 A;  1YG2 A;  2FOK A;  4Y17 A;  3VOD A;  2JSC A;  2FEZ A;  2WC2 A;  1VTN C;  5CVU A;  4A0Z A;  5CVI A;  1JHF A;  1BOA A;  3E6B A;  1YFH A;  4MQV A;  1KU7 A;  1EH7 A;  2PI0 A;  1HBX G;  1I5Z A;  2H6C A;  2ELH A;  4R79 A;  1BIA A;  4A0X A;  1JGS A;  2VN2 A;  3EDP A;  1FT9 A;  1PP7 U;  3I71 A;  1RIO H;  4IJA A;  1ONV A;  3FXU A;  2JRT A;  5HS8 A;  2P5V A;  2L3D A;  4GYI A;  5D6E A;  1Z6R A;  4UNO A;  1O57 A;  2IA2 A;  3BP8 A;  2MA3 A;  1Z7U A;  4WK8 F;  5KK1 A;  2F5E A;  2P8T A;  1Q1H A;  4L9N A;  1LEA A;  1XSV A;  3KP7 A;  1ON2 A;  4KFC A;  1SD7 A;  2COM A;  1H0M A;  2XKP A;  3BPV A;  2UXX A;  3QP6 A;  3SZP A;  4KN4 X;  5ILU A;  1R58 A;  2CO5 A;  1WWX A;  1J7K A;  4MEX F;  1U2W A;  4ENM A;  1ZRC A;  2DAO A;  4I0A A;  3Q5F A;  1OKR A;  2D2W A;  4OMZ A;  4LLN A;  2XRO A;  4Z2Y A;  1Z1D A;  3FX3 A;  5CLS A;  3LA3 A;  2BE5 F;  2FML A;  1FOK A;  1J59 A;  5CYV A;  1T98 A;  5D4R A;  1G4D A;  2ZNZ A;  3V7R A;  4Y13 A;  1BI3 A;  4I01 A;  2Z5U A;  1MJB A;  2MLG A;  5ICF A;  3E5X A;  4HDV A;  3HTS B;  4ZZD A;  3I4P A;  2QUF A;  1ZN2 A;  2PEX A;  3U1D A;  4YIF A;  5E1Z B;  4KIB A;  2FNA A;  2D45 A;  1UCR A;  4WWC A;  2A6E F;  4UVB A;  5DCM A;  5IT9 K;  4KMU X;  5J8C A;  3L9F A;  5TRD A;  2Q2E A;  2ZME B;  3HRT A;  2O03 A;  4MNU A;  1RZ4 A;  1REP C;  1FP1 D;  4EJT A;  5D5V B;  2XAG A;  4M71 A;  1D3Y A;  4RB2 C;  2IW5 A;  1G3S A;  3GUD A;  3J7A O;  5CVV A;  3W6J B;  1MKM A;  4EMS A;  2ZKZ A;  1SAX A;  3WOD F;  3E5U A;  1ZRE A;  4OIR F;  2K4B A;  2PLY A;  1FYK A;  4IRH A;  4UV8 A;  5HLI A;  4ESB A;  1TLH B;  2GAU A;  1ZYR F;  2F5F A;  4OIO F;  3FMQ A;  4I09 A;  2DI3 A;  4GYG A;  2KJC A;  3ROU A;  2K27 A;  4HOB A;  1XGN A;  3OV8 A;  3GFM A;  5H6R A;  3HYI A;  2MBF A;  3ZN1 A;  2G7U A;  2WTE A;  2KIM A;  3ERE D;  5HS7 A;  3ELK A;  2ADU A;  1P4A A;  2VBZ A;  3TQN A;  4U0V A;  1F4K A;  2CSO A;  5DUI A;  2JPC A;  2DQR A;  2G9W A;  1J2X A;  2C6Y A;  4HX7 A;  2XIG A;  4ENJ A;  2GIV A;  2DK5 A;  4ZH4 F;  1DDN A;  3KLO A;  3FWE A;  1DUX C;  5CVR A;  3WU1 B;  1ODD A;  3VOE A;  4LK0 F;  2VC0 A;  3T1B A;  2KKO A;  4FT8 A;  5LEK A;  3FXQ A;  4P9F A;  3R0J A;  4IHS A;  1YLF A;  1WQ2 A;  1KU9 A;  4HX8 A;  3PQJ A;  4RB3 C;  1OR7 A;  4CIC A;  2CFX A;  4BHB A;  3KP6 A;  2NAZ A;  4JK1 X;  3ULQ B;  1K6O A;  2EV5 A;  1U5T A;  5FGM A;  3BPX A;  1X3U A;  2RNJ A;  4L5I A;  1LVA A;  3RYP A;  3F8B A;  3MFK A;  1FSE A;  4XLP F;  1XSX A;  1TNT A;  1HW2 A;  3DF8 A;  3L2C A;  1L3L A;  4PGG A;  4OMY A;  4Q48 A;  2ETH A;  1ULY A;  5LLQ A;  3K0L A;  5K5O A;  3TKY A;  4IVN A;  2M1B A;  4D0P A;  1DP7 P;  4L18 B;  3T0Y A;  2M8E A;  5DD4 A;  1IXS B;  2MLK A;  4CHU A;  4BHC A;  3F23 A;  4LB6 B;  3L09 A;  3RI4 A;  3HTU A;  1HKS A;  3ZQ7 A;  2PN6 A;  1IN6 A;  4S05 A;  1U78 A;  3IKV A;  2ZJ2 A;  1B6A A;  3BJO A;  5FD6 A;  1B1B A;  2Y75 A;  2HWV A;  1ZH5 A;  1B9M A;  2BGC A;  3IRR A;  2YPR A;  1YW7 A;  1IF1 A;  2HTJ A;  5L3E A;  2MD5 A;  2M5W A;  4YG2 F;  2F2E A;  2XGX A;  5LHG A;  1ZG1 A;  2D1V A;  1YW8 A;  5D5W B;  2YX4 A;  2VXZ A;  3GVA A;  2DQL A;  4A12 A;  3R0A A;  4KMF A;  3DEU A;  1FZP B;  3I64 A;  2RN7 A;  1R00 A;  4O3M A;  4FHT A;  5A2Q Z;  2FE3 A;  2STW A;  2L54 A;  3RTR A;  4AIH A;  1WI9 A;  4EQQ A;  1UHM A;  2L4M A;  5LGU A;  3N4M A;  1KYZ A;  2HKO A;  1T0F A;  5HOO A;  2EV0 A;  3KP2 A;  1D8J A;  1U5T B;  5DCM B;  2RGV A;  2JT1 A;  2NRA C;  4UUV A;  3FXR A;  4GO1 A;  4IRI A;  1P6R A;  4ENN A;  1W4M A;  3IKT A;  4U0W A;  2NNN A;  2V1D A;  3HUG A;  2FSW A;  4LJZ F;  3DXJ F;  1F1Z A;  3BWG A;  5EEG A;  2K7L A;  4B8X A;  2FF4 A;  3SFZ A;  1V4R A;  3F8C A;  4LK1 F;  4UVC A;  3TDU C;  3GFL A;  3ZMD A;  4H0E A;  3TO9 A;  4AIK A;  2Y0M A;  1EH6 A;  4S04 A;  4G9Y A;  3EQL F;  2DTR A;  2QQ9 A;  4AWX B;  5F64 A;  3DV8 A;  2OZU A;  1U3E M;  2HGC A;  3KP4 A;  4WXH A;  5L3B A;  2FNP A;  1H9T A;  1KQ0 A;  3K1P A;  2EFN A;  4OIN F;  2VON A;  5IT9 Z;  3F22 A;  1YS7 A;  1T2K A;  1SD6 A;  4F7Z A;  1HKT A;  1ZHF A;  3C18 A;  2E1N A;  1R7J A;  5DDG A;  1ZAO A;  1FYL A;  2M87 A;  1IUY A;  2YX7 A;  2OQR A;  2VBY A;  4L9V A;  1FSH A;  4HW0 A;  5J8F A;  3M8F A;  4HX4 A;  4IRG A;  3MZY A;  2P6S A;  4RGU A;  3DQV C;  1DPU A;  3S2W A;  3GW2 A;  3IWF A;  1J9I A;  2RV8 A;  4XSX F;  2GZW A;  2NNY A;  5JHU A;  1EV7 A;  3WTZ A;  2EFW A;  2CG4 A;  4G6Q A;  1BIB A;  1BM9 A;  1IAW A;  4R8H A;  2Z3Y A;  2AXL A;  5K5R A;  1YIO A;  1P92 A;  2P4W A;  2O3F A;  4BHP A;  1SFU A;  1ON1 A;  1IN7 A;  1BI0 A;  1TQI A;  2DO7 A;  1BC8 C;  2L4A A;  4A5M A;  2P5L C;  2B0L A;  5L3C A;  4KYW A;  1FP2 A;  2IJL A;  2XVC A;  1SMY F;  1S6L A;  1U8R A;  2Y48 A;  2NYX A;  3JSO A;  2K86 A;  2X4H A;  3HRU A;  4HZF A;  4JQF A;  3G73 A;  3J81 K;  1XD7 A;  4ZYG A;  1GXP A;  4HBL A;  4EJV A;  2IA0 A;  3QU3 A;  2IP2 A;  1GHC A;  1U5T C;  5DD8 A;  1R23 A;  2OD5 A;  5TJJ A;  2R7D A;  3WU0 A;  2E7X A;  3ML6 A;  3B02 A;  5DCF A;  2QQA A;  2UWM A;  1KU2 A;  1ZLJ A;  2QEN A;  2HQR A;  2FQ3 A;  4NHJ A;  3GFI A;  3GLX A;  4P5O A;  2BV6 A;  2M45 A;  3GXO A;  4IPA A;  3FHZ A;  1U6G A;  4A0Y A;  4ON0 A;  5ED4 A;  2V1X A;  2ZO4 A;  1XGS A;  1FYM A;  1WKM A;  4KDP A;  1ZRF A;  5E8G A;  5ERI A;  3CDH A;  2KJB A;  1BJA A;  3DPL C;  4QLC U;  5E17 F;  4YFK F;  4UXN A;  4HV6 A;  4N9I A;  2E1C A;  4EJU A;  2K02 A;  3H3Z A;  1IN8 A;  2VBX A;  1KYW A;  4A5N A;  3CTA A;  2V79 A;  3QPH A;  4MQ9 F;  2F5D A;  1XSD A;  3GFJ A;  2EA2 A;  3F6V A;  3R61 A;  3ABU A;  4MGR A;  3HHH A;  2ESH A;  1D5V A;  3GF2 A;  3EUH A;  1BBY A;  5ICG A;  4MTE A;  2JZY A;  2NS0 A;  1ZLK A;  3DP7 A;  1ZGJ A;  2PG4 A;  5BOX A;  1XCV A;  2VT2 A;  5DEQ A;  4YFN F;  2STT A;  3PQK A;  1R36 A;  4EVI A;  1W7P B;  1HSJ A;  1W7P D;  4L9T A;  3FMR A;  2KRF A;  4UV9 A;  5LHH A;  1XB4 A;  1MJ9 A;  3CUO A;  3ZMZ A;  4XBF A;  2QYO A;  4KIF A;  2KIU A;  2A07 F;  2YSR A;  1I1G A;  3K1N A;  2KIF A;  4ZZL A;  1QBJ A;  4RAY A;  5HDK A;  3GEZ A;  3KZZ A;  4HQM A;  2OQG A;  3QOP A;  3K2Z A;  2YR2 A;  2QWW A;  4MHG A;  5E8I A;  2J5P A;  4I0B A;  3W6K B;  2XKO A;  1KGS A;  3F3X A;  2LDU A;  1O3Q A;  3FZV A;  2PQ8 A;  1ZGA A;  2J5O A;  2GXB A;  1SFE A;  5ILS A;  2UXN A;  1RUO A;  4K2E A;  3PFI A;  2VT3 A;  5K5Q A;  2VE8 A;  2EJR A;  1BI1 A;  5LRS A;  3QP5 A;  2O8X A;  3LQQ A;  1JXS A;  3IHU A;  2XRN A;  4HLY A;  1ZAR A;  2ACJ A;  2FMY A;  5LBQ A;  1MJA A;  2V9V A;  3WE3 A;  4U0Y A;  3I59 A;  1B9N A;  3ECH A;  2OBP A;  1XMK A;  2W57 A;  5HLH A;  1HST A;  1T6S A;  3L7W A;  4BNC A;  1TQM A;  1IZ1 A;  1B59 A;  4WX9 A;  2FBK A;  3NEU A;  3E6D A;  2WWY A;  3WTY C;  3ZMT A;  4ESF A;  1KQ9 A;  2VE9 A;  2LSO A;  5HS9 A;  3MAJ A;  4I02 A;  2O6G E;  2ISZ A;  3HSF A;  2EK5 A;  4BAY A;  1S3J A;  1O3S A;  2RC4 A;  2ZNY A;  4WXD A;  3HRS A;  1LDJ A;  1D8K A;  3HSE A;  3T5X A;  4I2O A;  4E70 A;  2ZXJ A;  3CLO A;  1YYV A;  3ZMU A;  4Y15 A;  5H20 A;  3HOT A;  4XRF A;  5DYM A;  3TO7 A;  2EB7 A;  3WTW C;  2V6C A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...