3AAFA

Structure of wrn rqc domain bound to double-stranded dna
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
109
structure length
109
Chain Sequence
SWDFGPQAFKLLSAVDILGEKFGIGLPILFLRGSNSQRLADQYRRHSLFGTGKDQTESWWKAFSRQLITEGFLVEVSRYNKFMKICALTKKGRNWLHKANTESQSLILQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Dna binding protein/dna
molecule keywords Werner syndrome ATP-dependent helicase
publication title Structural basis for DNA strand separation by the unconventional winged-helix domain of RecQ helicase WRN
pubmed doi rcsb
source organism Homo sapiens
total genus 35
structure length 109
sequence length 109
chains with identical sequence B
ec nomenclature ec 3.6.4.12: DNA helicase.
pdb deposition date 2009-11-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF09382 RQC RQC domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 3aafA00
3QP6A 5DYMA 2HQRA 3Q9VA 5HLHA 1Z91A 1B1BA 3BROA 1E17A 1I6XA 4KT5C 4ENMA 3F8NA 2VC1A 4YFNF 4ENJA 1XSXA 5IT3A 2WWYA 2QUFA 3BPVA 2DPDA 2Q0OA 2H6BA 3S2WA 4KUMA 1I5ZA 3P9IA 3WG9A 2ETHA 2QYOA 2VBYA 1SMTA 3WU1B 4BNCA 2VOOA 2VXZA 5L3DA 2EFPA 3T8RA 4UHTA 3VOEA 2UXXA 2VN2A 1SFUA 1IUYA 2P8TA 3SZPA 1KGSA 1VTNC 5LGUA 3G3ZA 1ZG5A 2NAZA 4LB5A 1FYMA 3ZMZA 5D5XB 1ZGJA 1FSHA 2R7FA 1BBYA 5DCFA 2GXGA 3F72A 2KJBA 1B6AA 4L9VA 2QZ8A 3L9FA 4HA8A 4EGYA 2DT5A 3GYHX 3E5XA 1SD6A 3GUDA 2XKPA 5D5WB 4HDUA 2PLYA 1KU7A 4IRIA 2H94A 2A3SA 2XAQA 1BN5A 2V1DA 4UVBA 3RPUA 2V9VA 1TQIA 3EUHA 4NB5A 2MH9A 4OMYA 4KFCA 5E20A 2OBPA 3CUOA 1XGOA 1TQMA 1R58A 2CWEA 3M9AA 4ZH4F 1B59A 3FMQA 5HLIA 1I27A 2PN6A 4FX0A 1CF7A 4U7DA 4F7ZA 2XV4S 2JTVA 1BOAA 2ZBKA 5HDGA 4XSZF 1Z05A 3EYYA 1ON2A 3TQNA 5L3CA 1IN8A 3KEOA 2XIGA 3KEQA 4M71A 1BI1A 4ENKA 5FLXK 5CYVA 2YU3A 3F8MA 3V8LA 3F8FA 1D8JA 4RB0A 3HRSA 2YX7A 1K78A 2IJLA 2FOKA 5AONA 3L2CA 4IRGA 2Q8KA 3L7WA 2DQRA 4FX4A 4EM0B 5K5RA 3M1EA 3HSEA 5ERIA 2HKXA 5DCMB 1FP2A 1RI7A 2RKHA 4LGWA 2FSWA 1HSTA 5TRDA 1T38A 1HBXG 3RI4A 1ZAOA 2W84A 3ZMSA 4EV0A 3NEUA 4EM2A 5L3EA 1XSVA 3SQNA 2HYGD 2DK8A 3BWGA 3ELKA 1IN6A 5HLGA 2DI3A 2V1UA 1REPC 5EEHA 1Z1DA 1ZH5A 4RB2C 1BI0A 2STTA 4BHPA 2FXAA 3BJOA 4LMYA 3IHUA 3MFKA 2WC2A 2BYVE 4U0WA 1U2WA 3KCCA 2O8XA 3KP5A 4R1HA 5ILSA 1ZARA 3T1BA 4NHJA 3G73A 1YYVA 1WWXA 1WSUA 2ZFWA 3DP7A 1P2FA 3CJNA 1BJAA 4CYDA 2L4MA 1MJAA 1HXDA 3B73A 3LWFA 1WQ2A 3QAHA 5HS7A 2UZKA 1YS6A 1DP7P 3VEPA 3NRVA 3IWFA 3HOTA 5FLXZ 3K1PA 3KP3A 4CZZA 2QWWA 3P9CA 1ZG3A 2OAZA 2EWNA 4OMZA 1P4WA 3DPTA 5ILVA 1L3LA 2FU4A 1XB4A 1EV7A 1R5GA 3R0AA 5J8FA 1UCRA 3ISPA 2EV0A 2H09A 5LEJA 5CVUA 5KVRA 1LEBA 3TO9A 1FX7A 4Q47A 1G3YA 3MQ0A 2V6CA 3FX3A 2UWMA 4LJZF 2VE8A 1YO5C 4IVNA 1KQ0A 3WTWC 3K0LA 2DBBA 2DPUA 1ZN2A 1IZ1A 4G94A 2ZO4A 5H6RA 3C7JA 5FB2A 1IXRC 1PP7U 4YFKF 2QQ9A 3J81K 2XUBA 4ZYGA 1ZRCA 3JSOA 1USTA 4RGRA 1MDMB 3DFGA 4HBLA 2E1NA 1W7PA 1S3JA 2HYFA 4ENNA 4OIOF 4OU0A 1X3UA 3WU0A 1EH6A 3PFIA 1E2XA 4U0YA 3R6SA 4PDKA 4EM1A 4TV7A 2A6HF 3JTGA 4LK1F 4P55A 5H6QA 3IC7A 3VB2A 5F6FA 3U9GA 2L3DA 1SFXA 4EJWA 4FT8A 5E17F 1Y0UA 2JRTA 1DUXC 4E70A 5ICGA 4BAYA 3F8CA 4G6DA 1H9TA 3ML6A 3OOPA 3WTTC 2FRHA 3WTZA 5DD4A 3H3ZA 5J8CA 2ZCWA 3LAPA 3RYRA 3SHFA 2XASA 4WWCA 3D0SA 4XRFA 5E1XA 2O61A 3F23A 3CUQA 5BQTA 3IRQA 1K7AA 2RV8A 1H0MA 3ABUA 4ASNA 4OIQF 2D1VA 1DPRA 2MLKA 3JSPA 2ESHA 4HF1A 2Y48A 4L0ZB 2DLLA 4YFXF 1G4DA 3QOPA 5HVQC 2PMHA 2OZ6A 3QP5A 5LHGA 4BYYA 4S04A 3WGIA 2P6TA 2GXBA 5HDKA 1AWCA 4Y13A 3M8FA 3GF2A 1XGSA 5DEQA 3LAJA 2E7WA 4OIRF 3FMRA 2YSRA 2A68F 1P92A 3ULQB 3JTHA 2KRFA 5CVVA 3I64A 1RIOH 3QPTA 3SFZA 1YTYA 2RC4A 3O3KA 4I02A 3TDUC 3V4GA 3J80K 1XDSA 1XSDA 1QQIA 1U78A 2BV6A 3GX4X 1UB9A 4N9IA 4MTEA 3O6BB 4RAYA 3W6KB 2K02A 3IKTA 3N97A 2EFNA 2W24A 3KP6A 2ZMEB 3R60A 3JAMK 3R61A 1QBJA 4MQ9F 1XCBA 1UFMA 2QBYA 1ULYA 2A69F 4R79A 5BS6A 3ERED 4NQWA 3LQRA 3BZ6A 1TQPA 1KYZA 3CDHA 4P96A 2X4HA 1YW8A 1RUNA 3GFLA 3WTUC 3MCZA 3H92A 3R4KA 1CF7B 2QM3A 1S7AA 4KMUX 5E8IA 3HHHA 2VBXA 2PMUA 3ABTA 3ZP5A 3K69A 1XMAA 3KP4A 1PDNC 5ILUA 2HZTA 1BI3A 3FXRA 3BP8A 4EMSA 1TNTA 3FMSA 3K2ZA 1R36A 1UHWA 4FHTA 2Z99A 1LJ9A 2JT1A 3I4PA 1HQCA 1F9NA 1QNTA 2V79A 1BC7C 3LA2A 2W57A 3M7GA 4ON0A 2MD5A 3WTYC 4D0PA 1JE8A 2P6SA 5K5OA 4KNYA 1JGSA 4GGGA 1RNLA 3J80Z 4M72A 1JHFA 4UV9A 3H3UA 4WK8F 3EYIA 3D5LA 2GIVA 4I09A 1F1ZA 3VFZA 2ADUA 2HKOA 4I98B 3WTSC 1MZBA 2F2EA 4P9UA 2ELHA 2E1CA 3F22A 2IVMA 2IT0A 3GFJA 3LFKA 1R1TA 4M9ZA 4G7ZF 2OQRA 1HKQA 2VBWA 4IXAA 1MGTA 1HW2A 1HKSA 2QQAA 1ZGAA 3I54A 2IA0A 4LLGF 3GLXA 4RB1A 1F4KA 1ZYRF 2C6YA 1OR7A 1YQAA 5E18F 2OU2A 1BM9A 2FE3A 2L02A 2M8EA 4UVCA 4PGGA 2GQQA 3GZ5A 1O3SA 3DV8A 1TW2A 4KA4A 1P4AA 2IRFG 4N0BA 2LF8A 4WXDA 1W5SA 3GXOA 2PI0A 3QPHA 3ROUA 1IW7F 1PUEE 1KA8A 3SXYA 5FD6A 2FMLA 3ZMVA 4GYIA 4L5IA 1S8NA 4CXFA 4HQEA 2P5KA 2WV0A 3F6OA 3HRMA 2EJRA 3E6CC 1SFEA 4KYWA 1JHHA 2IA1A 3MZYA 5LHIA 4QWQA 1TW3A 2KIMA 2K4JA 4XBFA 5ICFA 5FFXA 4O3MA 2YPRA 4EJUA 1FNNA 2KKOA 2Y75A 4G8XA 1XMKA 4HYEA 3ZMDA 1SAXA 1XCVA 5IT9K 1AOYA 4Q48A 4EQQA 4LG0A 4IF4A 4YIIA 1PP8F 4HLXA 3E6DA 1DDNA 4MTDA 3KZYA 2JZYA 1GXPA 4AIHA 1C0WA 1FBSA 3K1NA 3U2RA 5BPDA 1YIOA 1EH7A 2K7LA 1NHAA 2M87A 4I2OA 4IRHA 3I0TA 2A5YB 3FHZA 1FBQA 3HTSB 3ZPLA 3LA3A 1RUOA 3WE3A 2XAJA 2FNAA 1ZREA 5HDNA 1MD0A 5F1RA 2KIUA 2OA4A 1W7PD 3EDPA 5L3FA 4M9SA 2OD5A 3NQOA 3V7RA 2DO7A 3REOA 2NYXA 1T2KA 1V4RA 1MJ9A 4HX7A 1HSJA 2RDPA 4MEYF 1J59A 4GYGA 3KP2A 4RGSA 1QZZA 1LVAA 4G7OF 2EV6A 1LNWA 2MA3A 2L01A 2P7CB 1G3WA 2VBZA 1V3FA 5DUKA 2J5OA 4ZYDA 1IF1A 4CDGA 3C3WA 2DQLA 2DFIA 3E6MA 5L3GA 2G7UA 4OIPF 3TDZC 4S05A 4Q4ZF 1R1VA 1O57A 5A2QK 5HS9A 4Y17A 3F21A 4H0EA 4A6EA 2HTJA 4M6XA 1OKRA 4XLNF 4UUVA 2NRAC 4P5OA 1LDJA 1U5TA 4L9JA 3RKYA 1XDUA 3L09A 2DW4A 4RGUA 1SMYF 2PG4A 4M9XA 4BHCA 1ZG1A 3KLNA 3QU6A 3O2PE 4WXHA 5D4SA 1TNSA 2YR2A 3BOQA 2VONA 4ZZLA 3KE2A 4U0VA 3CUQB 4A6DA 1K79A 2QENA 3T8TA 3F3XA 2FBHA 4ZYHA 4HF2A 2NNYA 2PQ8A 5CVRA 4K2EA 5DV5A 1FOKA 2F5CA 1B4AA 4P9FA 2PEXA 4ETSA 4A12A 4A2UA 4M73A 1ZLKA 1FYKA 2FBKA 4G9YA 1OMIA 4HLYA 1KYWA 3BPXA 2QQBA 2IPQX 3RDIA 4ESFA 2CSOA 3L00A 1T39A 3ZQ7A 4ZZDA 3RKWA 5LGNA 2G7HA 3BJAA 2DU9A 3FM5A 2YX4A 1KU9A 4IHTA 4GXOA 1ODDA 2P5LC 3BDDA 4JBAA 1S6LA 3TKYA 2FF4A 1S7OA 1L0OC 4WXCA 4YIFA 3MWMA 4KIFA 5ICEA 5LEKA 2VOPA 1SD4A 2DTRA 4L0YB 1KQ8A 3KZZA 2CQKA 4I0AA 1J5YA 3TOBA 5LLQA 2GA1A 2DAOA 4PCQA 2O0YA 3GO5A 2QBYB 2ZNZA 3J81Z 2VT3A 2R7DA 1J2XA 1BIAA 5AIPA 4UV8A 1J75A 2PJPA 5F64A 1GHCA 2BEOA 5CVIA 3I53A 1XGNA 2XKOA 2G9WA 3ZMUA 2PBIA 1TLHB 1ZRDA 1A04A 3I59A 1S29A 1K6OA 1EH8A 3DF8A 5DD8A 4PZJA 5DDGA 5JI6A 1ZHFA 4WX9A 1J7KA 2OQGA 1R23A 3TOAA 2R3SA 4HX4A 4HQMA 5ED4A 1QO0D 4L18B 3RTRA 3F6VA 3EQLF 2ZKZA 1WRJA 2RQPA 1USSA 2MH2A 3DQVC 2ZJ2A 3PQJA 3T5XA 4Y15A 1GXQA 3HIFA 4B8XA 4QLCU 1HKTA 2FQ3A 2NS0A 3R0JA 2EK5A 2AXLA 3ECHA 2B0LA 3DPLC 4A5MA 4AVPA 5D4RA 4IPAA 2FA5A 1OYYA 3HSFA 2HFHA 3RKXA 2HEOA 1YFHA 3OV8A 2F5FA 3HYIA 1O7LA 5D6FA 3WODF 2VT2A 1OYIA 5J6XA 2GA2A 4LLNA 4O6JA 4Z2YA 3MEXA 2O6GE 2LKPA 3P7NA 3V7CA 1YG2A 2HOEA 4UVAA 4MQVA 4U88A 4B09A 1MJBA 2P7VB 2IA2A 1FY7A 1WI9A 2GAUA 2D2WA 4CO8A 2QLZA 3RIRA 4BH9A 4GO1A 2EFQA 4EJOA 2OZUA 1LB2A 4EJTA 2O3FA 2COMA 1D5VA 2EB7A 3K9TA 1P4XA 4MEXF 2ZXJA 1BC8C 1K78B 2MLGA 3GWZA 2HQNA 3FXQA 1LDDA 2Z33A 1R22A 3K1MA 3WGHA 5CVJA 3QRFF 2M45A 2EV5A 1IXCA 2CYYA 2DK5A 2ACJA 3FWEA 2KIFA 3TO7A 2FEZA 2CGPA 2JSCA 4A0YA 5E1WA 2XHKA 2E7XA 5HOOA 3COAC 5JHUA 2TDXA 1BIBA 4IJAA 4G6QA 4KN7X 1P6RA 4OOIA 3V8KA 1LEAA 1FWZA 2ZMEA 3KP7A 3IRRA 2HS5A 4LB6B 2RGVA 5E1ZB 5LBQA 4XLPF 2J5PA 2D1HA 5ICCA 2XVCA 3JAMZ 4U7BA 3CLOA 3T0YA 4BXUA 3B02A 4A5NA 2Z9OA 2HGCA 4WCGA 3GZ6A 1B9MA 3U1DA 1ONVA 3I71A 2Y0MA 4ZYEA 2D45A 4PGHA 1XN7A 4RB3C 4LG0B 5BMZA 1OPCA 1IN4A 4A0ZA 1XD7A 2IP2A 4O5VA 2VODA 3N4MA 5TJJA 3KLOA 1I1GA 2F5DA 4A0XA 2MBFA 4IHSA 1O7FA 3M8EA 3E3VA 2M1BA 3GFIA 1I1SA 4RAZA 3FM3A 5D5UB 1O3QA 3CTAA 1STZA 2AS5F 4L9NA 1Z6RA 3HRTA 5D8LB 2BE5F 3E6BA 3KETA 3RJPA 3Q5FA 2L54A 2STWA 2A07F 4KIGA 3FF5A 4YG2F 3AAFA 4BQAA 1FYLA 4HX8A 2JPBA 5FO5A 1W4MA 1SD7A 4I01A 4N9HA 1SD5A 4HF0A 2F5EA 3CO6C 1TBXA 3IWZA 1Z7UA 1U3EM 1H9GA 2BGCA 2H6CA 2XAFA 2XGXA 3F8BA 2XROA 1LDKB 1CGPA 3HUGA 4DQ2A 3DEUA 5K5QA 3P9KA 4CHUA 3WTVC 1U5TB 2FNPA 2P4WA 4JQFA 1R7JA 3BJ6A 4M74A 2XAGA 4Q5SF 1OYWA 3EETA 5CLSA 2ZNYA 4RGXA 4CICA 2LDUA 1G3TA 1U6GA 3HOSA 3ECOA 3FZVA 5E8GA 2GWRA 2LF7A 3KFWX 5FGMA 1W7PB 5DCMA 4WF2A 2W85A 3C1DA 3GEZA 1HW1A 3TO6A 1QPMA 2HR3A 5DUIA 2NNNA 5LGTA 4R8HA 3W6JB 1TTYA 4HV6A 3DKWA 1YW7A 5LHHA 2M30A 1Z6TA 4GCVA 3VODA 1FPQA 1JXSA 1YLFA 4KIBA 3V8JA 1YS7A 5H20A 5K1YA 5D5VB 1Q1HA 2LSOA 1IXSB 2L4AA 1D3YA 2XRNA 3IKVA 4CGZA 1R1UA 3E5QA 2HDCA 1UHMA 1G6NA 4XSXF 2H27A 1GVJA 5LRRA 5JFRA 4EGZA 4HAMA 5BPIA 2VC0A 4LK0F 2EA4A 4HW0A 3MAJA 1FP1D 3ZMTA 1KU3A 1J9IA 3CO7C 3HRUA 2WTEA 3V7SA 2QVOA 5BOXA 3C18A 4MGRA 2IW5A 4L5JA 2VE9A 5FD5A 1U5TC 5AIQA 1U8RA 2A6EF 3J7AO 5IT9Z 3BY6A 3LA7A 2RVCA 3HSRA 5JR3A 4HV5A 4LFUA 3RPQA 1IAWA 4HDVA 2Z3YA 1WKMA 3LQQA 4LLLA 2HWVA 1D8KA 1R00A 6PAXA 1QGPA 4DNCA 4RS8A 2Z5UA 4AD9A 1MKMA 2CO5A 2CFXA 5CJ9A 4JK1X 3WE2A 1HW5A 1R5HA 4L9TA 2K86A 1IRFA 4KICA 3I59B 4EJVA 5HS8A 3DXJF 4ESBA 4HZFA 5EEGA 5KK1A 1BI2A 3PQKA 4LD5A 3E5UA 2PFBA 1XGMA 4UNOA 2EFOA 1ZRFA 4UXNA 4M6YA 4I7HA 2JPCA 3GW2A 1QZYA 2GZWA 3FXUA 1FT9A 5A2QZ 2K4BA 3HTUA 1FZPB 1F5TA 1IRGA 1T0FA 3ZN1A 1KU2A 1FLIA 2A61A 1W5TA 2MC3A 3LSTA 2Q2EA 4HOBA 2CW0F 3WTXC 3MZHA 4BHBA 4KDPA 3CUQC 2EA2A 4I0BA 1MDMA 1FC3A 4EVIA 1Z9CA 2ESNA 3ZN0A 1FSEA 3HHGA 1ZLJA 2CG4A 2W25A 3TGNA 1J0RA 3JW4A 5D6EA 3SZTA 2M5WA 4KN4X 1T6SA 2K27A 2V1XA 4MHGA 2X0LA 2XAHA 2O03A 3Q9SA 4G7HF 4ESJA 3IL2A 1B9NA 4MNUA 2UXNA 3I5UA 3QU3A 2RNJA 2KJCA 1RZ4A 2FMYA 5FFZA 1O3TA 1FBUA 1DPUA 5LRSA 1KQ9A 4OINF 1G3SA 2ISZA 1YW9A 4AIKA 4AIJA 3I58A 3GFMA 2LNBA 2ISYA 2RN7A 3GVAA 5D8KB 5JVTA 3RYPA 2BBYA 1ON1A 4KMFA 1IN7A 2HTSA 2FBIA 1O3RA 1IN5A 4AWXB 5L3BA 1T98A 1LQ1A 3WGGA 3E97A 2EFWA 2P5VA
chains in the Genus database with same CATH superfamily
2KHMA 1VQKI 4B3AA 3QP6A 3O8GA 2KZVA 5DYMA 2HQRA 3KYCB 3CC4I 3AKZA 2DN0A 1V5FA 3Q9VA 2EINH 2I8DA 5HLHA 1F36A 1BOBA 1Z91A 1B1BA 3BQZA 4BQQA 3BROA 1SC7A 3LOCA 1E17A 2H8RA 1I6XA 4HEA2 2F5VA 2WY8Q 2HOAA 3W6VA 4BBSJ 4XORA 4KT5C 3DTEA 3F8NA 2VC1A 4ENMA 4YFNF 4ENJA 3CCEI 4D7MA 3HGGA 1XSXA 5IT3A 2WWYA 2QUFA 3BPVA 2DPDA 3TMOA 2Q0OA 2F4MB 4BBRJ 2H6BA 1DGRM 2PJRB 4BKXA 1WJ5A 3S2WA 4KUMA 1I5ZA 3P9IA 2WY7Q 2LTPA 4BE0A 3WG9A 2ETHA 3HOWJ 2QYOA 2BZTA 2VBYA 1SMTA 3WU1B 3GMEA 3S14J 4BNCA 2VOOA 2VXZA 5L3DA 2EFPA 2CFOA 3S3MA 1MBJA 1YI2I 1TWAJ 4AU7A 5FKOA 3T8RA 1VQNI 1K7AA 9ANTA 4UHTA 1Z21A 3OOUA 1WPKA 3VOEA 2UXXA 4XR6A 2VN2A 1AA7A 1SFUA 1IUYA 2P8TA 3L2VA 3PUBA 3SZPA 4GDFA 4IEJA 1KGSA 2DMPA 1OCTC 1VTNC 1B8IB 2LY9A 5LGUA 3G3ZA 1ZG5A 1MIJA 3PIPF 2NAZA 4LB5A 5E3OA 2E71A 1FYMA 2W4SA 1TWHJ 1PUFB 3ZMZA 4H4KC 5D5XB 1NH3A 1JGGA 5JVGF 1ZGJA 1FSHA 2R7FA 1BBYA 5DCFA 2GXGA 3F72A 2KJBA 1B6AA 4L9VA 2QZ8A 3L9FA 1X1AA 4HA8A 4EGYA 3IAM2 2DT5A 3GYHX 3E5XA 1SD6A 3GUDA 3OYBA 2M0CA 1VI0A 2XKPA 2WA0A 1JUSA 5D5WB 2LH9A 4HNUA 2H1LA 4HDUA 2PLYA 1KU7A 4IRIA 3U1KA 3PJRA 3FK7A 4E7HA 4IHVA 2H94A 2A3SA 5FLVA 3HL2A 2XAQA 1BN5A 4BXFA 2V1DA 1A36A 4UVBA 2R7SA 3RPUA 2ZJPF 4UUSA 2V9VA 1TQIA 3K10A 2DA2A 4KITB 2VJIA 3EUHA 3D1NI 4NB5A 2MH9A 4OMYA 4KFCA 5E20A 2OBPA 3BG3A 3QODA 3PFYA 1OQYA 3CUOA 1XGOA 2TCTA 1S5LC 1TQMA 2XB0X 2GLOA 1R58A 2CWEA 3BT9A 2NOJB 3M9AA 1WHUA 4ZH4F 3KYLA 1B59A 3FMQA 4F52A 1ETVA 5HLIA 5IY5H 1D0XA 1JT6A 4E6KG 1I27A 4EEFG 2ELJA 2PN6A 2K3FA 2KISA 4FX0A 5EYRA 4A3JJ 2M2EA 4PFOA 1CF7A 4AYBA 4U7DA 3QQAA 4F7ZA 4BE2A 4CCOA 2XV4S 2JTVA 2RNGA 2L7KA 3H5NA 2ZXHA 1I3AA 1BOAA 2ZBKA 2Y69H 4XLFA 5HDGA 3ZQGA 4XSZF 1Z05A 2OV7A 4QIWN 2KIQA 3EYYA 3CF2A 3FXJA 2ZSHB 1ON2A 3TQNA 5L3CA 1IN8A 3KEOA 2IS2A 2MFZA 2A6TA 2HI3A 3DEEA 1TWCJ 2XIGA 3KEQA 4M71A 1BI1A 1OR7C 4ENKA 5CYVA 1UAAA 5FLXK 2YU3A 3F8MA 3K4KA 3V8LA 3F8FA 1P7IA 1O4XA 2CUJA 1D8JA 4RB0A 3VWBA 3HRSA 2YX7A 1K78A 4M3EA 3GTGJ 2IJLA 2FOKA 5AONA 3L2CA 4IRGA 2Q8KA 3AG1H 3L7WA 2DQRA 4FX4A 1ETXA 4EM0B 4B48A 2UUZA 1OLTA 1E3PA 5K5RA 4LOCA 3M1EA 2R4GA 1W36C 3HSEA 5ERIA 3UKGA 2HKXA 5E79C 5DCMB 3KEYA 1FP2A 4JX4A 3CF5F 2XAUA 3K4LA 1RI7A 3HOVJ 2RKHA 4GFBA 4LGWA 2FSWA 1HSTA 5TRDA 1T38A 4XRSG 3JRGA 2CQ7A 1LFUP 2KFDA 1HBXG 3RI4A 1ZAOA 3Q0UA 2W84A 3ZMSA 4EV0A 1IC8A 3NEUA 1D1AA 3DLAA 4EM2A 5L3EA 1XSVA 3BZCA 2F4OB 3SQNA 2HYGD 2X6YA 2DK8A 4RMNA 5J1RA 2QSFX 3BWGA 2DDAA 3ELKA 1FMVA 1IN6A 2LC2A 3HKZA 2IGKA 5HLGA 3GTMJ 2DI3A 4NC7A 1BW5A 2NXNB 2V1UA 1REPC 5EEHA 1Z1DA 2HDDA 1ZH5A 2FOWA 4FCYA 4RB2C 1WH7A 1BI0A 2STTA 4ANJA 4BHPA 2FXAA 3BJOA 4LMYA 3IHUA 3MFKA 2WC2A 1VF9A 2E2IJ 3S15J 3HJEA 1T95A 2B9SA 2BYVE 4U0WA 5J1UA 1U2WA 3KCCA 2O8XA 3KP5A 4M3BA 4R1HA 3RQIA 5ILSA 1WJCA 1ZARA 3T1BA 5GAHJ 4NHJA 1HDPA 3G73A 1YYVA 5F04A 2IS4A 1WWXA 3OL3A 2ZFWA 1WSUA 3K70D 3DP7A 4XLAA 1MMAA 3M07A 1P2FA 3CJNA 4CCJA 1BJAA 4CYDA 2L4MA 4FISA 1CQTA 3A03A 2FJ1A 1MJAA 2W48A 4DBQA 3NWTA 2X6WA 1HXDA 3B73A 2IGMA 4BEHB 3LWFA 2WB1A 1WQ2A 3QAHA 5HS7A 1W0UA 2XPUA 2UZKA 1YS6A 1DP7P 1TT0A 1SVLA 4NC6A 1TC3C 3JREA 2AO9A 3VEPA 3NRVA 2B7EA 3IWFA 5FLXZ 3HOTA 2R5YB 1JKOC 2F6CA 4HG2A 3K1PA 3AG4H 3K4BA 3KP3A 2OJED 4CZZA 2QWWA 3P9CA 3QYEA 1ZG3A 2CQQA 3J7YJ 3PSFA 2OAZA 2WAFA 4IO9F 2BW3A 1UMQA 3ZQHA 2EWNA 1ZGWA 1ETWA 1R71A 3OMYA 1I6HJ 4OMZA 1JKPC 1P4WA 3DPTA 5ILVA 1MH4A 1L3LA 2AQFA 2FU4A 1XB4A 1EV7A 2EZIA 3S8PA 1LE8B 1R5GA 4DIQA 3R0AA 4D7NA 3ABLH 5J8FA 1QA6A 2LBFA 2IBDA 2M3AA 1UCRA 4CCNA 3ISPA 4ZDLA 2EV0A 2H09A 3VYUB 3ZR8X 5LEJA 2HOTA 3DTIA 5CVUA 5FRMA 5KVRA 2R7RA 1LEBA 3TO9A 2GOMA 5IYCJ 3A0BC 3JCUC 2HVRA 1HLVA 4PUSA 1FX7A 2I5UA 2KQRA 4DOZA 3G2BA 1IDZA 4B1RA 2DA4A 1JJ6C 2VKVA 5IP6A 2WV1A 4Q47A 1G3YA 1UELB 2XGDA 3MQ0A 2V6CA 3FX3A 3ZRGA 2UWMA 3PM1A 4LJZF 1YITI 2DA5A 3OIPA 2VE8A 1YO5C 4IVNA 1KQ0A 2BXYA 3WTWC 3OYLA 4MIMA 3K0LA 2X85A 3L2QA 4W1UA 2DBBA 2ME0A 2DPUA 4IQJA 1ZN2A 1IZ1A 1X58A 4G94A 2ZO4A 5H6RA 4HSTA 3C7JA 1N78A 2E2HJ 5FB2A 1IXRC 1PP7U 2Q2EB 4YFKF 2E5ZA 1Y8QB 1D1BA 4BDYA 2HQAA 2QQ9A 3J81K 2LK2A 2XUBA 3HPGA 2A05A 4ZYGA 3JSOA 3OYEA 1ZRCA 1USTA 4RGRA 2B63J 1MDMB 2ZJQF 2VI6A 3DFGA 4HBLA 2E1NA 4NUBA 1W7PA 1S3JA 4CSWA 1V55H 2HYFA 2F4IA 5TISC 4ENNA 4IX7A 2DXIA 2V26A 4OU0A 4OIOF 4J01A 2VKDA 4GRIA 1X3UA 3WU0A 1EH6A 3PFIA 5FJ8J 3CCQI 3A4CA 1E2XA 4U0YA 1H89C 3R6SA 4PDKA 4EM1A 4TV7A 4DYCA 2M34A 3EUKL 5BNGA 2A6HF 3JTGA 2OCCH 4XN0A 2IAIA 3BR3A 1I3QJ 4LK1F 4P55A 5H6QA 4ZYAA 3F0CA 2DMNA 2E1MB 1X3ZB 4HPQA 4BJTA 3CC2I 3IC7A 3VB2A 5F6FA 3U9GA 3RZOJ 1T8IA 2ZXWH 2VQGA 1VFCA 2L3DA 1YOVB 3OYJA 4C2MJ 1SFXA 3LSHA 4EJWA 3PSIA 4FT8A 4NC8A 5E17F 1Y0UA 2JRTA 1DUXC 4A93J 4E70A 3F9KA 5ICGA 4IL6C 4BAYA 1VZ0A 4LG3A 3F8CA 2HXOA 3RZDJ 4G6DA 4B43A 2MSYA 2EZLA 1I50J 1H9TA 3M4OJ 1FOXA 3ML6A 3OOPA 3WTTC 1N75A 2FRHA 2M0MA 3NARA 3WTZA 5DD4A 1X1DA 3H3ZA 4M3DA 4XKWA 5J8CA 2ZCWA 3CMAI 4J19A 1RR8C 1HCRA 3LAPA 1WVRA 3RYRA 3SHFA 2BY3A 4DYRA 4XQFA 2XASA 4WWCA 3O8HA 3D0SA 4XRFA 5E1XA 3H3VK 2NS8A 2OUMA 2IGNA 1ZTRA 2O61A 3F23A 4FE7A 1T0FC 4DYQA 3CUQA 5BQTA 3IRQA 5HLTA 5J1YA 2K40A 4Y4RA 2RV8A 3OS1A 2TRTA 3ABUA 4ASNA 3CMEI 1H0MA 3QYFA 2XF7A 5FKNA 2ID6A 1EJ9A 4Z6YA 5KCMA 3L1PA 4OIQF 3E0JB 4FQGA 3M1CA 3GTPJ 2D1VA 1X19A 4AYBN 4BY7J 1DPRA 2MLKA 1SFOJ 3JSPA 2ESHA 5J4VA 3UR3C 4HF1A 4JOMA 2Y48A 4L0ZB 2DLLA 1B72B 4DGWB 3P5JA 2GXAA 4YFXF 2XSDC 3BR2A 2KMUA 3QOPA 5HVQC 1G4DA 2PMHA 1X1CA 2OZ6A 2XGEA 3QP5A 3HBLA 5LHGA 3H5AA 4BYYA 4S04A 1X4PA 3IUOA 5KAIC 3WGIA 1MNMC 2P6TA 2GXBA 5GAEJ 5HDKA 1AWCA 2NVYJ 3DLLF 2DDBA 5B1AH 4Y13A 1R4MB 3M8FA 2VJJA 1WJAA 3FDYA 3OS2A 3GF2A 2HOSA 1PVEA 1XGSA 5DEQA 2QEXI 3RSNA 3LAJA 1Y1VJ 2E1MC 2L9SA 2E7WA 4OIRF 1FJLA 4EATA 3FMRA 2YSRA 2JVGA 2WAEA 4D9JA 2A68F 2V4JC 3LSJA 4BQOA 2QSHX 1P92A 3EPZA 2KZGA 2HYJA 3ULQB 2HZDA 1OCRH 2CV2A 3IH2A 3JTHA 2KRFA 3GTQJ 5CVVA 3I64A 1RIOH 3QPTA 3MD2A 3SFZA 2ZXIA 1YTYA 3CZ6A 2RC4A 3O3KA 4I02A 3TDUC 3V4GA 2XGCA 3J80K 1XDSA 2AQEA 2Y9ZA 2FUG2 3EUAA 4LIUA 3VPRA 5CKTA 1XSDA 1QQIA 1U78A 1MBFA 3HKZN 2V9KA 2EILH 4XLCA 3ZQIA 2BV6A 5GTIC 1QVTA 1T56A 1XX5A 2GOXB 2XPWA 3OL4A 4OAZA 3GX4X 2CQNA 1UB9A 2XF5A 1H88C 1QZEA 4N9IA 1VQ8I 3FKIJ 4MTEA 3O6BB 4X6AJ 3SEZA 4BXXJ 4RAYA 3OYAA 3SZGA 2LFBA 3W6KB 5M5WJ 2K02A 2Z16A 1ACIA 3IKTA 3N97A 2EFNA 2W24A 4MLOA 3KP6A 1D0ZA 1VQ4I 3S16J 2ZMEB 3R60A 4I99C 3JAMK 1S7EA 3R61A 1QBJA 2K3PA 4MQ9F 5CQGA 1XCBA 1UFMA 4XIDA 3RPUD 3D5RC 2QBYA 1ULYA 1U9OA 2A69F 4R79A 5BS6A 2F48A 2KRCA 3ERED 4UUSB 4HNVA 4G6TB 4NQWA 3LNQA 3LQRA 3FXKA 1ETQA 3BZ6A 3J7ZI 1YRNA 4MFDA 1TQPA 1MMNA 3A01B 1KYZA 3CDHA 1KZHA 4P96A 1NTCA 2X4HA 1YW8A 1RUNA 3GFLA 5C44J 4NNJA 3WTUC 2EQRA 1Z67A 4W97A 3MCZA 3H92A 3BTJA 5IOZA 3R4KA 1CF7B 2WB1N 2QM3A 1S7AA 4KMUX 2LMDA 3GLLA 3SDBA 2HPIA 5E8IA 2VKEA 3H0GJ 1F43A 3HHHA 2VBXA 2PMUA 1XTAA 3ABTA 3NWSA 4A3DJ 3K69A 1XMAA 3ZP5A 2E35A 3KP4A 1X2MA 4D5CA 1ZR4A 1PDNC 3K4MA 5ILUA 1MSEC 1FIAA 1BI3A 2HZTA 1BR1A 3FXRA 2DJIA 3BP8A 2HU9A 4EMSA 5EG0A 2LLKA 1YJ9I 3ZCOA 1TNTA 2A5WA 3FMSA 3K2ZA 1R36A 2D5VA 5TGTA 4A3LJ 1IO2A 1UHWA 2RQQA 4FHTA 2Z99A 1E0EA 3QPSA 2R7WA 1LJ9A 2JT1A 2MG4A 3I4PA 3S1NJ 1HQCA 2XPVA 3LFUA 1DP3A 1FEXA 2CH0A 1F9NA 1QNTA 2V79A 4Y52J 3S1RJ 1BC7C 3LA2A 2W57A 3M7GA 4M6VA 5HODA 1VQPI 4ON0A 1WZ2A 2MD5A 2JUCA 3WTYC 1G2HA 1OCZH 4D0PA 3FKJA 1JE8A 2P6SA 1W5CC 5K5OA 1JTXA 5KHDA 3K4CA 4KNYA 4HNTA 1JGSA 5J3LA 4GGGA 1RNLA 4F91B 3J80Z 4M72A 1JHFA 3CJQB 2EBIA 4UV9A 3H3UA 3BR0A 4WK8F 3EYIA 4ZTFA 3D5LA 2GIVA 4I09A 1F1ZA 3M8JA 3VFZA 4V2GA 3ABKH 2ADUA 1GLNA 2HKOA 4I98B 3WTSC 1MZBA 3AL0B 4BACA 5EZHA 2F2EA 2ZMEC 4P9UA 2ELHA 2E1CA 3F22A 2DMTA 1N77A 1ERDA 2IVMA 2IT0A 3GFJA 3LFKA 4A3BJ 1OJLA 4CYCB 1R1TA 2QCOA 3Q0WA 4M9ZA 1LKXA 1WCMJ 3C2HA 3EUHC 4G7ZF 2OQRA 1HKQA 3QWLA 1VQ9I 2VBWA 4IXAA 1MGTA 1HW2A 3DBLB 3ZQLA 4ZC3A 2GIZA 3H0DA 1ORKA 1HKSA 3CCVI 2QQAA 5B5EC 1ZGAA 3HUGB 5JLXA 4OWRB 1FIPA 3PO3J 3I54A 1EF4A 2IA0A 4LLGF 3OR1C 1Q1VA 2XB5A 2HQ5A 1SAUA 2DA1A 3GLXA 2JWTA 1WI3A 4RB1A 1RPWA 1F4KA 1ZYRF 2DTZA 2BY2A 1OR7A 1YQAA 2C6YA 4E7SA 5E18F 2R7UA 2OU2A 4PFPA 3FXOA 1BM9A 1JKQC 2FE3A 2EIJH 2L02A 3BG9A 3IH3A 4RAGA 4I6ZA 2QQ8A 2M8EA 3S1QJ 4UVCA 4B44A 4PGGA 1DU6A 2GQQA 3GZ5A 2BVMA 3AFHA 3Q3SA 2RREA 3OS0A 2JVHA 1O3SA 3DV8A 1TW2A 2ZC2A 1A6QA 4KA4A 3K7AJ 1GV5A 3ZQQA 1P4AA 2IRFG 2VKHA 5J40A 2JRMA 4N0BA 2LF8A 3I56I 3TEDA 4WXDA 1VQ5I 1W5SA 3HC7A 1VQ6I 1Z3XA 3GXOA 2LD5A 2PI0A 1OISA 3ONQA 1ZR2A 1EA3A 3QPHA 3ROUA 1IW7F 2JJ7A 3CMMA 3K2AA 1HC8A 4YELA 4N4OB 1KA8A 3SXYA 5FD6A 1PUEE 2FMLA 3ZMVA 1DGWY 1TP4A 3BCAA 5F08A 4GYIA 4L5IA 1S8NA 4CXFA 1S72I 1RETA 1AU7A 4HQEA 2P5KA 2WV0A 3F6OA 3HRMA 4Y7NJ 3SDGA 2EJRA 3E6CC 2ZSIB 5HNFA 1SFEA 2M4GA 2LY2A 4KYWA 1JHHA 2IA1A 3MZYA 5LHIA 3AL0C 4QWQA 1TW3A 2R93J 2JMWA 2KIMA 2QKLB 2L9VA 4PJJA 2VASA 2K4JA 2ME6A 1MH3A 4YRVA 5EGOB 4XBFA 4IHYA 5ICFA 5FFXA 1K4TA 3I3LA 2XDVA 4O3MA 2YPRA 4EJUA 1FNNA 2CW8A 2KKOA 2Y75A 4G8XA 2KRHA 2EZKA 2VL8A 4UB8C 1R5ID 1XMKA 4HYEA 5CQEA 2G0EA 3ZMDA 2R0QC 3BG6A 2L9NA 1SAXA 1HF0A 5C4XJ 1XCVA 5IT9K 3DKYA 1AOYA 4Q48A 4EQQA 1OCOH 4IOAF 4LG0A 4IF4A 4YIIA 2KPMA 1P9QC 3DTKA 2BHZA 2K9MA 3OR2C 1PP8F 4HLXA 1V5GA 1DU0A 3E6DA 1DDNA 1PYVA 3OY9A 5DM6F 2WBMA 4MTDA 3KZYA 2JZYA 1GXPA 1BA5A 4AIHA 1C0WA 1FBSA 3K1NA 3U2RA 4CCLA 1YIOA 1EH7A 2K7LA 1NHAA 2M87A 5BPDA 4I2OA 4OAYA 4IRHA 2K85A 3I0TA 2A5YB 3FHZA 2M9HA 3GZNB 2KDZA 1ETOA 3ABMH 4BDZA 1FBQA 4PK4A 3HTSB 3ZPLA 3LA3A 2ECCA 4E7KA 1RUOA 3WE3A 2NVUB 2XAJA 2FNAA 1ZREA 2KP6A 4BUPA 5HDNA 1MD0A 5F1RA 2KIUA 2OA4A 1W7PD 1ETKA 4RBOA 4DW6A 3FBIB 1WGXA 3EDPA 4N4NB 5L3FA 4M9SA 5EJCA 2OD5A 3NQOA 3V7RA 4C9YA 2DO7A 3REOA 2NYXA 1T2KA 2K9NA 2X1CA 1V4RA 1MJ9A 4HX7A 5FKKA 1HSJA 2RDPA 4FETA 2O9LA 3IAS2 4MEYF 1J59A 4GYGA 3KP2A 4RGSA 1IV8A 1QZZA 1LVAA 3HZJA 2EV6A 3KIOA 1LNWA 2MA3A 4G7OF 2E60A 1XG1A 2L01A 1ITYA 2P7CB 1G3WA 5HNHA 2QGUA 1V3FA 2VBZA 4BJ5C 3M3YJ 5DUKA 4Y3OA 2J5OA 4ZYDA 3HOXJ 1IF1A 4IQ4A 4CDGA 4XOPA 3C3WA 4PJNA 3WU2C 2DQLA 2WADA 2DFIA 3E6MA 5L3GA 1JUMA 4NDLA 1U0JA 1T33A 2G7UA 3HPHA 3ZQCA 4BQNA 3S93A 4OIPF 3TDZC 2DA3A 3G1OA 2ZJRF 3FISA 4S05A 1TWFJ 4Q4ZF 1RKTA 2NS7A 1R1VA 1GT0C 5IYDJ 3VSLA 1O57A 5A2QK 5FLMJ 5HS9A 4Y17A 3F21A 4QPOA 4H0EA 2MABA 4A6EA 3H9JA 2HTJA 4M6XA 1OKRA 4XLNF 3JRBA 4UUVA 2NRAC 2EH3A 2KLOA 3CCSI 1IUFA 3DKXA 3DPUA 3PL8A 4P5OA 3DBRB 1LDJA 1U5TA 4L9JA 3HXLA 3RKYA 1XDUA 3TW6A 3L09A 5GP9A 3PNTA 5KAFC 2DW4A 1A6IA 4RDUA 3K70C 1QU3A 4RGUA 4P1WA 3OWTA 2DT6A 1SMYF 2PG4A 4M9XA 3WHBA 4X0GA 4BHCA 2ELKA 4YIRX 1ZG1A 1X2NA 2MC4A 1OCPA 3IV5A 3KLNA 3QU6A 3JRFA 4XMYA 3CD6I 3O2PE 4WXHA 5D4SA 1D1CA 1TNSA 2YR2A 3BOQA 2VONA 5IYBJ 4ZZLA 1X3WB 2X6OA 3KE2A 4U0VA 3A1YA 3CUQB 3S3OA 1FOWA 4A6DA 3L2UA 2LVSA 3OYHA 1MBEA 1K79A 2QENA 1YX3A 3T8TA 1QVUA 1UJ8A 3F3XA 3LMMA 4QSHA 1K83J 2FBHA 4ZYHA 4HF2A 2CUEA 1MNEA 2NNYA 2FQ4A 3S32A 2R5ZB 2PQ8A 5CVRA 3AG3H 1LPQA 4K2EA 5DV5A 1N25A 1FOKA 2F5CA 2PMZA 1B4AA 1IG7A 2K9QA 4P9FA 2X6XA 1FMWA 1GUUA 2PEXA 4ETSA 4A12A 4A2UA 4BY1J 2QKMB 5JHFA 1UZCA 4M73A 1ZLKA 1FYKA 4DBRA 2FBKA 4G9YA 1OMIA 4HLYA 1MMGA 3GTKJ 1KYWA 4UUTA 3BPXA 1SFKA 2QQBA 3AG2H 2IPQX 3RDIA 4ESFA 2CSOA 2PX9A 3L00A 4Y33A 2HVSA 1T39A 3ZQ7A 5K7FA 3HGYA 3GTJJ 4BE1A 1HA8A 3BLYA 4ZZDA 3RKWA 4M3GA 1UG2A 3V42A 3PIOF 5LGNA 4DZJA 3BR6A 2G7HA 3J7AY 3BJAA 2DU9A 1Y39A 3H36A 1T08B 4QTRA 3FM5A 3G6EI 5JLWA 1POGA 2YX4A 1KU9A 4IHTA 4GXOA 1BR4A 4XRSA 1ODDA 2P5LC 3RCOA 3BDDA 4JBAA 5GAGJ 4XOTA 1R9TJ 3MKLA 1S6LA 5H2FC 3TKYA 3QPLA 3DU6A 5IPAA 3CP2A 2O8KA 2FF4A 1S7OA 1L0OC 4WXCA 1BR2A 4YIFA 4XRMA 4G12A 3MWMA 4KIFA 2HXIA 5ICEA 5LEKA 3OYKA 2VOPA 3X2QH 1SD4A 3JRCA 2DTRA 3OYIA 2BVLA 3UNGC 2VPRA 4L0YB 1KQ8A 1WFXA 2Y31A 3KZZA 3MZ8A 3HG9A 2CQKA 3SJMA 4QPQA 4I0AA 1J5YA 3TOBA 3GTLJ 5LLQA 2GA1A 2WAQA 2DAOA 4PCQA 2O0YA 3A02A 2H8WA 3GO5A 4AC0A 2QBYB 2ZNZA 3J81Z 2VT3A 2R7DA 2LYCA 1J2XA 4BS9A 1BIAA 5AIPA 4UV8A 1J75A 5DM7F 1IDYA 4NQWB 5F64A 2BEOA 2PJPA 1GHCA 5CVIA 3KPHA 3I53A 1RESA 1XGNA 2E19A 3HEFA 4S0HB 2HDWA 1YRNB 2XKOA 1RKWA 2G9WA 3ZMUA 2ECBA 2PBIA 1TLHB 1ZRDA 1A04A 2EIKH 2LREA 3I59A 1SVOA 2MD0A 1S29A 1WJDA 3FHNA 1K6OA 1EH8A 4C3HJ 3DF8A 5DD8A 2L9RA 4PZJA 5DDGA 5JI6A 1ZHFA 4WX9A 5EDNA 3CLQA 1J7KA 2OQGA 1R23A 4PJMA 1G59A 4JX6A 3CCYA 2DA7A 3TOAA 2R3SA 4HX4A 4HQMA 4IKFA 2KT0A 2DOFA 2E1OA 5ED4A 1VQOI 4A3KJ 1QO0D 4L18B 3RTRA 1FTTA 3F6VA 3K6GA 3EQLF 2ID3A 2ZKZA 3CJTB 1WRJA 2V9PA 2RQPA 4PJ0C 4U87A 3H5RA 4V2FA 1ENHA 1BW6A 3G1MA 1USSA 2MH2A 5EG0B 1TL8A 4A3EJ 1WJFA 2L0KA 1SEUA 3DQVC 5GPAA 2ZJ2A 3PQJA 3T5XA 4Y15A 3CCMI 3PNVA 5FROA 1GXQA 1MNDA 3H1CA 3HIFA 4B8XA 4JYKA 2UV1A 4QLCU 1HKTA 3PNYA 3CQZJ 1W1WE 2FQ3A 1QPIA 2NS0A 4F93B 3R0JA 2EK5A 1JUPA 2AXLA 4XKBA 3ECHA 2B0LA 3DPLC 4A5MA 4II2A 2VJ4A 2L7FP 4IPAA 4RAFA 4AVPA 5J4YA 5D4RA 2FA5A 5F1JA 5M5YJ 1OYYA 3HSFA 2HFHA 3FK6A 2R7VA 3RKXA 2HEOA 5DTDA 1YFHA 1MW7A 3W2WA 2R7TA 5EEAA 3OV8A 2F5FA 1ZELA 3HYIA 1O7LA 1WH5A 1SANA 5D6FA 3BTCA 3WODF 3FBNB 2P81A 2VT2A 3QYBA 1OYIA 5J6XA 2GA2A 3SYTA 3I55I 1R4NB 1B72A 2DFEA 4LLNA 4JX5A 1OCCH 4M3FA 4O6JA 4Z2YA 3L2WA 3MEXA 4XICA 2CUZA 4ZJZA 2O6GE 2LKPA 3P7NA 3V7CA 3ZXSA 1YE9A 1YG2A 2HOEA 4UVAA 4MQVA 4U88A 4B09A 1MJBA 3CCRI 1HDDC 2P7VB 4UY8I 1UG0A 1Z77A 2IA2A 1FY7A 1Y1WJ 1WI9A 2E5NA 4XLHA 1BL0A 4LITA 3TL4X 2GAUA 2Z1DA 1MMDA 2D2WA 3TBIA 2FD5A 2Y9YA 2JQ7A 3A2KA 4CO8A 2QLZA 2LOOA 3RIRA 4GO1A 4BH9A 2EFQA 2R7ZJ 4EJOA 2OZUA 1LB2A 4EJTA 2O3FA 2COMA 1D5VA 2EB7A 1RC9A 2CRGA 3K9TA 4D1QA 1P4XA 4MEXF 2ZXJA 1R49A 1FTZA 1IRXA 1IV6A 5FKMA 4BL0B 1BC8C 4BU2A 1K78B 2XSJC 2BY1A 2MLGA 3E1SA 3GWZA 2HQNA 2E34A 2O7OA 3FXQA 2COBA 1LDDA 3BR5A 3CDIA 2Z33A 5C4JJ 1AKHA 2FX0A 3VYRB 2YU9J 2VQLA 1R22A 1R6RA 3K1MA 3WGHA 2W7NA 5CVJA 3QRFF 3BQYA 1V54H 2M45A 1W36D 2EV5A 1IXCA 2CYYA 3S1MJ 2DK5A 2QF7A 1XPXA 2ACJA 1NK2P 1QRYA 2DYRH 3FWEA 2M7AA 1V5EA 2KIFA 3TO7A 2FEZA 2CGPA 2JSCA 1APLC 4A0YA 5E1WA 4CCKA 2XHKA 1TT5B 2E7XA 5HOOA 3COAC 5JHUA 4AVZA 1Y6IA 2TDXA 1BIBA 3BTLA 4IJAA 4G6QA 4DZPA 1A5JA 2V1NA 1Z0XA 5B66C 1H8AC 4RM2A 4C30A 4KN7X 1P6RA 2K9LA 2W82A 4OOIA 2X9DA 3V8KA 1LEAA 3BG5A 2W1OA 1FWZA 5B1BH 1JTYA 3CCUI 3ASOH 2DA6A 2KL4A 1TZLA 4ZDOA 2ZMEA 4LIVA 5K7ZA 3OSGA 3KP7A 2CQXA 3IRRA 2MYSA 2HS5A 3L2RA 3S17J 4LB6B 1VNDA 2RGVA 5E1ZB 1Z7LA 1MBGA 5LBQA 4XLPF 2J5PA 2D1HA 2PJRA 5ICCA 4IZZA 2W00A 3CJRB 2XVCA 3ZGKA 2VJ5A 4ITVA 1XC5A 3W2AA 3LL7A 3JAMZ 2Y0SA 2JA8J 4U7BA 3CLOA 3NAUA 3T0YA 3A01A 2LKXA 4BXUA 3CCJI 3B02A 4XKCA 3OIQA 1PJRA 2CV0A 2JA6J 1JI8A 3LSGA 4A5NA 4L5EA 2Z9OA 2HGCA 4WCGA 3GZ6A 1B9MA 4A3IJ 1VQMI 3OSFA 3U1DA 5IP9J 1ONVA 1NK3P 3I71A 2P0WA 2Y0MA 4ZYEA 2D45A 4PGHA 1XN7A 4RB3C 1B8IA 4LG0B 2L5QA 3OYDA 5BMZA 1OPCA 2EIMH 1IN4A 4A0ZA 1XD7A 2IP2A 4O5VA 2GM4A 2VODA 3KZIC 3N4MA 5TJJA 4AM3A 2JA5J 3KYDB 3KLOA 1I1GA 2M7BA 2F5DA 2PMZN 2KDOA 4A0XA 3K4NA 3C2BA 2MBFA 4MFEA 4F92B 1PUFA 4J00A 5F0HA 2RAEA 3CC7I 3TW7A 1RRJA 5M3MJ 3CP8A 4IHSA 4DJAA 1O7FA 3M8EA 3E3VA 2M1BA 1Y8RB 3GFIA 1I1SA 1MBHA 4RAZA 1Z3YA 4E7LA 3FM3A 1MBKA 4AUXA 3PUFA 5D5UB 1O3QA 3MN2A 3CTAA 1STZA 2JA2A 4L9NA 2AS5F 1Z6RA 2Y2ZA 3G71I 2VXDA 3HRTA 3HB9A 4KISA 5D8LB 2BE5F 3E6BA 3KETA 3RJPA 3MKYB 3W2VA 5GTHC 1HOMA 4XL9A 3GTOJ 2BW3B 3TP0A 3Q5FA 5EZGA 2L54A 2K5CA 4RM3A 2OTJI 1LVKA 4CA0A 2DOEA 1JJ8C 2A07F 2STWA 4AIDA 3GCMA 4KIGA 2DOAA 3FF5A 4YG2F 3AAFA 3LSPA 4BQAA 1LUJB 1FYLA 4HX8A 5KNLA 2JPBA 5FO5A 4CZCA 4E7IA 1W4MA 1SD7A 4PSWA 2LBFB 3SEQA 2K9SA 4I01A 3HOYJ 4N9HA 3CDLA 2H1KA 1XS9A 2LP0A 2GBYA 1SD5A 4HF0A 2F5EA 2JN6A 3CO6C 1TBXA 3IWZA 2OPTA 5K7HA 1Z7UA 3I9V2 3DEWA 1U3EM 1H9GA 2BGCA 4XK4A 4CYCA 3BG7A 2H6CA 2XAFA 2JK3A 2XGXA 4RA2A 2R92J 2Y30A 4F55A 3VYTB 3F8BA 2XROA 1OFCX 4CCMA 1LDKB 1CGPA 3HUGA 3FXLA 4B4CA 4DQ2A 3DEUA 5K5QA 3P9KA 4CHUA 1U9NA 2NOGA 3G1LA 3BZKA 3WTVC 1VQ7I 1U5TB 2FNPA 2P4WA 3IH4A 1R7JA 3BJ6A 3LSKA 4JQFA 4B47A 4M74A 2WAQN 2XAGA 4MO7A 4Q5SF 3OYCA 4BJ6C 1OYWA 1TWGJ 2X51A 3EETA 1ZQ3P 5CLSA 1K61A 2ZNYA 3VSKA 4RGXA 4CICA 3S2HJ 2LDUA 1G3TA 1U6GA 1DQUA 3HOSA 1WJEA 3GBGA 3ECOA 3FZVA 2HPMA 5E8GA 2ICWG 2GWRA 2LF7A 3B6CA 1ZK8A 4XKVA 3KFWX 4FE4A 2M8GX 1D5YA 3JRIA 2IS1A 3TP3A 5FGMA 1W7PB 5DCMA 3JR9A 5F0CA 4WF2A 2W85A 3OYFA 4E4HA 3C1DA 3RKQA 3WHCA 3GEZA 3BTIA 5DS9A 1HW1A 2I10A 3JRDA 4ZTJA 3TO6A 1QPMA 3K4JA 2NVTJ 4X1EA 3U21A 2HR3A 5DUIA 2NNNA 5LGTA 4R8HA 3W6JB 1TTYA 1X4OA 2CUFA 4HV6A 3DKWA 1YW7A 1IJWC 3CMYA 5LHHA 2M30A 1Z6TA 4GCVA 1NG6A 3QOEA 3VODA 3CESA 3VYSB 1FPQA 3H9GA 1JXSA 5LFAA 1YLFA 4KIBA 2DODA 3I4MJ 3V8JA 1YS7A 5H20A 5K1YA 4A3FJ 3OYNA 5D5VB 3BR1A 1ETYA 1Q1HA 1FOYA 2LSOA 1IXSB 1JT0A 2JSPA 1YX5A 2L4AA 1D3YA 2XRNA 2ZFUA 3D5SC 2NVQJ 3IKVA 4CGZA 1R1UA 5LD2C 1M1EB 3E5QA 2HDCA 2JA7J 1UHMA 1G6NA 4D5FA 4XSXF 5E3NA 2H27A 1GVJA 1E3OC 5LRRA 2CU7A 5JFRA 5EGOA 4EGZA 1J09A 2MGQA 4HAMA 5F27A 5BPIA 2VC0A 2DYSH 5FKLA 3LSMA 2IXSA 1LFPA 1Y56A 2EA4A 4LK0F 3MVPA 4A69C 4HW0A 3MAJA 3FIWA 1E3HA 2OC6A 3BCBA 1FP1D 3ZMTA 1KU3A 1J9IA 3CO7C 2YS9A 1YJWI 3HRUA 2WTEA 5F0FA 3V7SA 1U8BA 2R7OA 1WJBA 2QVOA 5BOXA 3C18A 4MGRA 2IW5A 1GV2A 4II3A 4L5JA 2VE9A 1I39A 5FD5A 1U5TC 2L7ZA 5AIQA 2A6EF 3LSIA 1U8RA 3J7AO 5IT9Z 2DFFA 3BY6A 3H35A 3LA7A 3S3NA 2RVCA 4CUGA 3SFIA 4BGDA 3HSRA 5JR3A 4HV5A 4LFUA 4NBQA 3RPQA 1IAWA 3ZQFA 4BEHA 4HDVA 3DCFA 1P7JA 1EKEA 2Z3YA 3H9QA 1WKMA 1Y0NA 3HDDA 3MKZA 4RLFA 4ABZA 3LQQA 1A31A 2VUMJ 3KX2A 1G8XA 1SVMA 4LLLA 1BJZA 2HWVA 2R5YA 2L7MP 1D8KA 1GDTA 1VQLI 1R00A 2DFHA 6PAXA 3C2GA 1QGPA 4DNCA 1X1BA 4RS8A 3JRAA 2DT7B 3S2DJ 4ZDPA 3MMYB 4PSXA 3HOZJ 2YUSA 2Z5UA 4AD9A 1MKMA 2CO5A 2CFXA 5CJ9A 4JK1X 3WE2A 1HW5A 2V6EA 1LE8A 2LY1A 1R5HA 4L9TA 2K86A 3ERMA 2HVQA 1YIJI 2DMQA 1IRFA 4KICA 2CV1A 3I59B 2AHQA 4I76A 2HNHA 4IHXA 4EJVA 5HS8A 2CMPA 1A35A 1D0YA 2LRDA 3DXJF 5EEGA 4HZFA 4ESBA 5KK1A 1BI2A 2EPFA 3PQKA 1YJNI 4LD5A 3E5UA 3MKWB 2PFBA 2LKSA 3OYGA 2VQHA 4KJZA 1XGMA 4UNOA 5M5XJ 3DWLE 2VPLA 2EFOA 2BHYA 4C2UA 5EF6A 1ZRFA 2QA4I 4C2TA 1QHGA 4M6YA 4UXNA 1K4SA 5B3SH 4I7HA 1YHQI 2JPCA 3GW2A 1QZYA 2XRLA 3JRHA 2BXZA 2M4KA 4E7ZA 4HRIA 2GZWA 3FXUA 1FT9A 5A2QZ 1X1PA 1MMSA 5CPRB 2K4BA 3HTUA 1FZPB 2O5RA 2Q1ZB 1F5TA 1IRGA 4A3CJ 3IP4B 1T0FA 1IRZA 3ZN1A 1KU2A 5C3EJ 2VLAA 1FLIA 2A61A 5IP7J 2IGOA 5M3FJ 1W5TA 2MC3A 3DBHB 3LSTA 2Q2EA 4HOBA 2CW0F 3WTXC 3MZHA 4BHBA 1MSFC 2VIXA 2Y0SN 3I4NJ 2CS3A 2MW8A 3RQ4A 4KDPA 3CUQC 2EA2A 3BC8A 4I0BA 1NG7A 1MDMA 3OIOA 3CCLI 2CJJA 3Q0VA 5GADJ 1FC3A 4YEJA 3OYMA 4EVIA 1Z9CA 2ESNA 3ZN0A 1FSEA 2X1EA 1LFBA 1S9HA 2XF6A 1ZLJA 3HHGA 2R7QA 2X48A 5GPCA 2CG4A 4CH7A 2W25A 2JUGA 3TGNA 4C3JJ 1J0RA 2NVXJ 1K6YA 2E36A 5E3MA 4A3MJ 5FRNA 3E7LA 2R7XA 3JW4A 2DCEA 2R5ZA 3PO2J 5D6EA 3SZTA 3B6AA 2M5WA 4KN4X 3HM5A 4RLQA 2E2JJ 1T6SA 2K27A 2V1XA 4MHGA 2BY0A 2X0LA 2XAHA 3W3CA 2O03A 2IEKA 4F3QA 4IOCF 5J47A 2LG4A 2Z2SB 3Q9SA 4G7HF 3WG7H 2VQCA 2V7FA 2X1DA 3DU5A 2DMUA 2XC7A 4E7JA 4ESJA 1B9NA 3IL2A 1JKRC 4V19K 4MNUA 2UXNA 3I5UA 3QU3A 2VB6A 4C3IJ 2RNJA 2KJCA 2EZHA 4IHWA 4FASD 4XLEA 1RZ4A 4JP0A 2FMYA 5FFZA 2ZB9A 1O3TA 1FBUA 2QSGX 1DPUA 5LRSA 1KQ9A 4OINF 5IOYA 3G4SI 1G3SA 2LR8A 2IS6A 2BOLA 4KT6A 2ISZA 1GVDA 1YW9A 1ZKGA 4XNFA 1RR7A 4AIKA 4XN3A 3VDXA 3A0HC 1IGNA 2DJNA 4AIJA 2OF7A 4XONA 3I58A 4PJLA 3ZOBA 1W0TA 2CW7A 3GFMA 3ESWB 2L2OA 1QHHD 2LNBA 2ISYA 2RN7A 1AHDP 1UHSA 2OCEA 3GVAA 4FTHA 5D8KB 5JVTA 3LSRA 3RYPA 2BBYA 1KONA 1AKHB 4XM3A 1ON1A 2OTLI 5E3LA 4KMFA 1IN7A 1XMXA 2HTSA 2AXTC 2FBIA 1O3RA 4UB6C 3N05A 3ASNH 2N8GA 1IN5A 4A3GJ 4AWXB 5L3BA 1T98A 1LQ1A 3WGGA 3HOUJ 3E97A 2EFWA 4B3XA 3FXMA 4HSRA 2P5VA
chains in the Genus database with same CATH topology
3QP6A 5DYMA 2HQRA 3Q9VA 5HLHA 1Z91A 1B1BA 3BROA 1E17A 1I6XA 4KT5C 4ENMA 3F8NA 2VC1A 4YFNF 4ENJA 1XSXA 5IT3A 2WWYA 2QUFA 3BPVA 2DPDA 2Q0OA 2H6BA 3S2WA 4KUMA 1I5ZA 3P9IA 3WG9A 2ETHA 2QYOA 2VBYA 1SMTA 3WU1B 4BNCA 2VOOA 2VXZA 5L3DA 2EFPA 3T8RA 4UHTA 3VOEA 2UXXA 2VN2A 1SFUA 1IUYA 2P8TA 3SZPA 1KGSA 1VTNC 5LGUA 3G3ZA 1ZG5A 2NAZA 4LB5A 1FYMA 3ZMZA 5D5XB 1ZGJA 1FSHA 2R7FA 1BBYA 5DCFA 2GXGA 3F72A 2KJBA 1B6AA 4L9VA 2QZ8A 3L9FA 4HA8A 4EGYA 2DT5A 3GYHX 3E5XA 1SD6A 3GUDA 2XKPA 5D5WB 4HDUA 2PLYA 1KU7A 4IRIA 2H94A 2A3SA 2XAQA 1BN5A 2V1DA 4UVBA 3RPUA 2V9VA 1TQIA 3EUHA 4NB5A 2MH9A 4OMYA 4KFCA 5E20A 2OBPA 3CUOA 1XGOA 1TQMA 1R58A 2CWEA 3M9AA 4ZH4F 1B59A 3FMQA 5HLIA 1I27A 2PN6A 4FX0A 1CF7A 4U7DA 4F7ZA 2XV4S 2JTVA 1BOAA 2ZBKA 5HDGA 4XSZF 1Z05A 3EYYA 1ON2A 3TQNA 5L3CA 1IN8A 3KEOA 2XIGA 3KEQA 4M71A 1BI1A 4ENKA 5FLXK 5CYVA 2YU3A 3F8MA 3V8LA 3F8FA 1D8JA 4RB0A 3HRSA 2YX7A 1K78A 2IJLA 2FOKA 5AONA 3L2CA 4IRGA 2Q8KA 3L7WA 2DQRA 4FX4A 4EM0B 5K5RA 3M1EA 3HSEA 5ERIA 2HKXA 5DCMB 1FP2A 1RI7A 2RKHA 4LGWA 2FSWA 1HSTA 5TRDA 1T38A 1HBXG 3RI4A 1ZAOA 2W84A 3ZMSA 4EV0A 3NEUA 4EM2A 5L3EA 1XSVA 3SQNA 2HYGD 2DK8A 3BWGA 3ELKA 1IN6A 5HLGA 2DI3A 2V1UA 1REPC 5EEHA 1Z1DA 1ZH5A 4RB2C 1BI0A 2STTA 4BHPA 2FXAA 3BJOA 4LMYA 3IHUA 3MFKA 2WC2A 2BYVE 4U0WA 1U2WA 3KCCA 2O8XA 3KP5A 4R1HA 5ILSA 1ZARA 3T1BA 4NHJA 3G73A 1YYVA 1WWXA 1WSUA 2ZFWA 3DP7A 1P2FA 3CJNA 1BJAA 4CYDA 2L4MA 1MJAA 1HXDA 3B73A 3LWFA 1WQ2A 3QAHA 5HS7A 2UZKA 1YS6A 1DP7P 3VEPA 3NRVA 3IWFA 3HOTA 5FLXZ 3K1PA 3KP3A 4CZZA 2QWWA 3P9CA 1ZG3A 2OAZA 2EWNA 4OMZA 1P4WA 3DPTA 5ILVA 1L3LA 2FU4A 1XB4A 1EV7A 1R5GA 3R0AA 5J8FA 1UCRA 3ISPA 2EV0A 2H09A 5LEJA 5CVUA 5KVRA 1LEBA 3TO9A 1FX7A 4Q47A 1G3YA 3MQ0A 2V6CA 3FX3A 2UWMA 4LJZF 2VE8A 1YO5C 4IVNA 1KQ0A 3WTWC 3K0LA 2DBBA 2DPUA 1ZN2A 1IZ1A 4G94A 2ZO4A 5H6RA 3C7JA 5FB2A 1IXRC 1PP7U 4YFKF 2QQ9A 3J81K 2XUBA 4ZYGA 1ZRCA 3JSOA 1USTA 4RGRA 1MDMB 3DFGA 4HBLA 2E1NA 1W7PA 1S3JA 2HYFA 4ENNA 4OIOF 4OU0A 1X3UA 3WU0A 1EH6A 3PFIA 1E2XA 4U0YA 3R6SA 4PDKA 4EM1A 4TV7A 2A6HF 3JTGA 4LK1F 4P55A 5H6QA 3IC7A 3VB2A 5F6FA 3U9GA 2L3DA 1SFXA 4EJWA 4FT8A 5E17F 1Y0UA 2JRTA 1DUXC 4E70A 5ICGA 4BAYA 3F8CA 4G6DA 1H9TA 3ML6A 3OOPA 3WTTC 2FRHA 3WTZA 5DD4A 3H3ZA 5J8CA 2ZCWA 3LAPA 3RYRA 3SHFA 2XASA 4WWCA 3D0SA 4XRFA 5E1XA 2O61A 3F23A 3CUQA 5BQTA 3IRQA 1K7AA 2RV8A 1H0MA 3ABUA 4ASNA 4OIQF 2D1VA 1DPRA 2MLKA 3JSPA 2ESHA 4HF1A 2Y48A 4L0ZB 2DLLA 4YFXF 1G4DA 3QOPA 5HVQC 2PMHA 2OZ6A 3QP5A 5LHGA 4BYYA 4S04A 3WGIA 2P6TA 2GXBA 5HDKA 1AWCA 4Y13A 3M8FA 3GF2A 1XGSA 5DEQA 3LAJA 2E7WA 4OIRF 3FMRA 2YSRA 2A68F 1P92A 3ULQB 3JTHA 2KRFA 5CVVA 3I64A 1RIOH 3QPTA 3SFZA 1YTYA 2RC4A 3O3KA 4I02A 3TDUC 3V4GA 3J80K 1XDSA 1XSDA 1QQIA 1U78A 2BV6A 3GX4X 1UB9A 4N9IA 4MTEA 3O6BB 4RAYA 3W6KB 2K02A 3IKTA 3N97A 2EFNA 2W24A 3KP6A 2ZMEB 3R60A 3JAMK 3R61A 1QBJA 4MQ9F 1XCBA 1UFMA 2QBYA 1ULYA 2A69F 4R79A 5BS6A 3ERED 4NQWA 3LQRA 3BZ6A 1TQPA 1KYZA 3CDHA 4P96A 2X4HA 1YW8A 1RUNA 3GFLA 3WTUC 3MCZA 3H92A 3R4KA 1CF7B 2QM3A 1S7AA 4KMUX 5E8IA 3HHHA 2VBXA 2PMUA 3ABTA 3ZP5A 3K69A 1XMAA 3KP4A 1PDNC 5ILUA 2HZTA 1BI3A 3FXRA 3BP8A 4EMSA 1TNTA 3FMSA 3K2ZA 1R36A 1UHWA 4FHTA 2Z99A 1LJ9A 2JT1A 3I4PA 1HQCA 1F9NA 1QNTA 2V79A 1BC7C 3LA2A 2W57A 3M7GA 4ON0A 2MD5A 3WTYC 4D0PA 1JE8A 2P6SA 5K5OA 4KNYA 1JGSA 4GGGA 1RNLA 3J80Z 4M72A 1JHFA 4UV9A 3H3UA 4WK8F 3EYIA 3D5LA 2GIVA 4I09A 1F1ZA 3VFZA 2ADUA 2HKOA 4I98B 3WTSC 1MZBA 2F2EA 4P9UA 2ELHA 2E1CA 3F22A 2IVMA 2IT0A 3GFJA 3LFKA 1R1TA 4M9ZA 4G7ZF 2OQRA 1HKQA 2VBWA 4IXAA 1MGTA 1HW2A 1HKSA 2QQAA 1ZGAA 3I54A 2IA0A 4LLGF 3GLXA 4RB1A 1F4KA 1ZYRF 2C6YA 1OR7A 1YQAA 5E18F 2OU2A 1BM9A 2FE3A 2L02A 2M8EA 4UVCA 4PGGA 2GQQA 3GZ5A 1O3SA 3DV8A 1TW2A 4KA4A 1P4AA 2IRFG 4N0BA 2LF8A 4WXDA 1W5SA 3GXOA 2PI0A 3QPHA 3ROUA 1IW7F 1PUEE 1KA8A 3SXYA 5FD6A 2FMLA 3ZMVA 4GYIA 4L5IA 1S8NA 4CXFA 4HQEA 2P5KA 2WV0A 3F6OA 3HRMA 2EJRA 3E6CC 1SFEA 4KYWA 1JHHA 2IA1A 3MZYA 5LHIA 4QWQA 1TW3A 2KIMA 2K4JA 4XBFA 5ICFA 5FFXA 4O3MA 2YPRA 4EJUA 1FNNA 2KKOA 2Y75A 4G8XA 1XMKA 4HYEA 3ZMDA 1SAXA 1XCVA 5IT9K 1AOYA 4Q48A 4EQQA 4LG0A 4IF4A 4YIIA 1PP8F 4HLXA 3E6DA 1DDNA 4MTDA 3KZYA 2JZYA 1GXPA 4AIHA 1C0WA 1FBSA 3K1NA 3U2RA 5BPDA 1YIOA 1EH7A 2K7LA 1NHAA 2M87A 4I2OA 4IRHA 3I0TA 2A5YB 3FHZA 1FBQA 3HTSB 3ZPLA 3LA3A 1RUOA 3WE3A 2XAJA 2FNAA 1ZREA 5HDNA 1MD0A 5F1RA 2KIUA 2OA4A 1W7PD 3EDPA 5L3FA 4M9SA 2OD5A 3NQOA 3V7RA 2DO7A 3REOA 2NYXA 1T2KA 1V4RA 1MJ9A 4HX7A 1HSJA 2RDPA 4MEYF 1J59A 4GYGA 3KP2A 4RGSA 1QZZA 1LVAA 4G7OF 2EV6A 1LNWA 2MA3A 2L01A 2P7CB 1G3WA 2VBZA 1V3FA 5DUKA 2J5OA 4ZYDA 1IF1A 4CDGA 3C3WA 2DQLA 2DFIA 3E6MA 5L3GA 2G7UA 4OIPF 3TDZC 4S05A 4Q4ZF 1R1VA 1O57A 5A2QK 5HS9A 4Y17A 3F21A 4H0EA 4A6EA 2HTJA 4M6XA 1OKRA 4XLNF 4UUVA 2NRAC 4P5OA 1LDJA 1U5TA 4L9JA 3RKYA 1XDUA 3L09A 2DW4A 4RGUA 1SMYF 2PG4A 4M9XA 4BHCA 1ZG1A 3KLNA 3QU6A 3O2PE 4WXHA 5D4SA 1TNSA 2YR2A 3BOQA 2VONA 4ZZLA 3KE2A 4U0VA 3CUQB 4A6DA 1K79A 2QENA 3T8TA 3F3XA 2FBHA 4ZYHA 4HF2A 2NNYA 2PQ8A 5CVRA 4K2EA 5DV5A 1FOKA 2F5CA 1B4AA 4P9FA 2PEXA 4ETSA 4A12A 4A2UA 4M73A 1ZLKA 1FYKA 2FBKA 4G9YA 1OMIA 4HLYA 1KYWA 3BPXA 2QQBA 2IPQX 3RDIA 4ESFA 2CSOA 3L00A 1T39A 3ZQ7A 4ZZDA 3RKWA 5LGNA 2G7HA 3BJAA 2DU9A 3FM5A 2YX4A 1KU9A 4IHTA 4GXOA 1ODDA 2P5LC 3BDDA 4JBAA 1S6LA 3TKYA 2FF4A 1S7OA 1L0OC 4WXCA 4YIFA 3MWMA 4KIFA 5ICEA 5LEKA 2VOPA 1SD4A 2DTRA 4L0YB 1KQ8A 3KZZA 2CQKA 4I0AA 1J5YA 3TOBA 5LLQA 2GA1A 2DAOA 4PCQA 2O0YA 3GO5A 2QBYB 2ZNZA 3J81Z 2VT3A 2R7DA 1J2XA 1BIAA 5AIPA 4UV8A 1J75A 2PJPA 5F64A 1GHCA 2BEOA 5CVIA 3I53A 1XGNA 2XKOA 2G9WA 3ZMUA 2PBIA 1TLHB 1ZRDA 1A04A 3I59A 1S29A 1K6OA 1EH8A 3DF8A 5DD8A 4PZJA 5DDGA 5JI6A 1ZHFA 4WX9A 1J7KA 2OQGA 1R23A 3TOAA 2R3SA 4HX4A 4HQMA 5ED4A 1QO0D 4L18B 3RTRA 3F6VA 3EQLF 2ZKZA 1WRJA 2RQPA 1USSA 2MH2A 3DQVC 2ZJ2A 3PQJA 3T5XA 4Y15A 1GXQA 3HIFA 4B8XA 4QLCU 1HKTA 2FQ3A 2NS0A 3R0JA 2EK5A 2AXLA 3ECHA 2B0LA 3DPLC 4A5MA 4AVPA 5D4RA 4IPAA 2FA5A 1OYYA 3HSFA 2HFHA 3RKXA 2HEOA 1YFHA 3OV8A 2F5FA 3HYIA 1O7LA 5D6FA 3WODF 2VT2A 1OYIA 5J6XA 2GA2A 4LLNA 4O6JA 4Z2YA 3MEXA 2O6GE 2LKPA 3P7NA 3V7CA 1YG2A 2HOEA 4UVAA 4MQVA 4U88A 4B09A 1MJBA 2P7VB 2IA2A 1FY7A 1WI9A 2GAUA 2D2WA 4CO8A 2QLZA 3RIRA 4BH9A 4GO1A 2EFQA 4EJOA 2OZUA 1LB2A 4EJTA 2O3FA 2COMA 1D5VA 2EB7A 3K9TA 1P4XA 4MEXF 2ZXJA 1BC8C 1K78B 2MLGA 3GWZA 2HQNA 3FXQA 1LDDA 2Z33A 1R22A 3K1MA 3WGHA 5CVJA 3QRFF 2M45A 2EV5A 1IXCA 2CYYA 2DK5A 2ACJA 3FWEA 2KIFA 3TO7A 2FEZA 2CGPA 2JSCA 4A0YA 5E1WA 2XHKA 2E7XA 5HOOA 3COAC 5JHUA 2TDXA 1BIBA 4IJAA 4G6QA 4KN7X 1P6RA 4OOIA 3V8KA 1LEAA 1FWZA 2ZMEA 3KP7A 3IRRA 2HS5A 4LB6B 2RGVA 5E1ZB 5LBQA 4XLPF 2J5PA 2D1HA 5ICCA 2XVCA 3JAMZ 4U7BA 3CLOA 3T0YA 4BXUA 3B02A 4A5NA 2Z9OA 2HGCA 4WCGA 3GZ6A 1B9MA 3U1DA 1ONVA 3I71A 2Y0MA 4ZYEA 2D45A 4PGHA 1XN7A 4RB3C 4LG0B 5BMZA 1OPCA 1IN4A 4A0ZA 1XD7A 2IP2A 4O5VA 2VODA 3N4MA 5TJJA 3KLOA 1I1GA 2F5DA 4A0XA 2MBFA 4IHSA 1O7FA 3M8EA 3E3VA 2M1BA 3GFIA 1I1SA 4RAZA 3FM3A 5D5UB 1O3QA 3CTAA 1STZA 2AS5F 4L9NA 1Z6RA 3HRTA 5D8LB 2BE5F 3E6BA 3KETA 3RJPA 3Q5FA 2L54A 2STWA 2A07F 4KIGA 3FF5A 4YG2F 3AAFA 4BQAA 1FYLA 4HX8A 2JPBA 5FO5A 1W4MA 1SD7A 4I01A 4N9HA 1SD5A 4HF0A 2F5EA 3CO6C 1TBXA 3IWZA 1Z7UA 1U3EM 1H9GA 2BGCA 2H6CA 2XAFA 2XGXA 3F8BA 2XROA 1LDKB 1CGPA 3HUGA 4DQ2A 3DEUA 5K5QA 3P9KA 4CHUA 3WTVC 1U5TB 2FNPA 2P4WA 4JQFA 1R7JA 3BJ6A 4M74A 2XAGA 4Q5SF 1OYWA 3EETA 5CLSA 2ZNYA 4RGXA 4CICA 2LDUA 1G3TA 1U6GA 3HOSA 3ECOA 3FZVA 5E8GA 2GWRA 2LF7A 3KFWX 5FGMA 1W7PB 5DCMA 4WF2A 2W85A 3C1DA 3GEZA 1HW1A 3TO6A 1QPMA 2HR3A 5DUIA 2NNNA 5LGTA 4R8HA 3W6JB 1TTYA 4HV6A 3DKWA 1YW7A 5LHHA 2M30A 1Z6TA 4GCVA 3VODA 1FPQA 1JXSA 1YLFA 4KIBA 3V8JA 1YS7A 5H20A 5K1YA 5D5VB 1Q1HA 2LSOA 1IXSB 2L4AA 1D3YA 2XRNA 3IKVA 4CGZA 1R1UA 3E5QA 2HDCA 1UHMA 1G6NA 4XSXF 2H27A 1GVJA 5LRRA 5JFRA 4EGZA 4HAMA 5BPIA 2VC0A 4LK0F 2EA4A 4HW0A 3MAJA 1FP1D 3ZMTA 1KU3A 1J9IA 3CO7C 3HRUA 2WTEA 3V7SA 2QVOA 5BOXA 3C18A 4MGRA 2IW5A 4L5JA 2VE9A 5FD5A 1U5TC 5AIQA 1U8RA 2A6EF 3J7AO 5IT9Z 3BY6A 3LA7A 2RVCA 3HSRA 5JR3A 4HV5A 4LFUA 3RPQA 1IAWA 4HDVA 2Z3YA 1WKMA 3LQQA 4LLLA 2HWVA 1D8KA 1R00A 6PAXA 1QGPA 4DNCA 4RS8A 2Z5UA 4AD9A 1MKMA 2CO5A 2CFXA 5CJ9A 4JK1X 3WE2A 1HW5A 1R5HA 4L9TA 2K86A 1IRFA 4KICA 3I59B 4EJVA 5HS8A 3DXJF 4ESBA 4HZFA 5EEGA 5KK1A 1BI2A 3PQKA 4LD5A 3E5UA 2PFBA 1XGMA 4UNOA 2EFOA 1ZRFA 4UXNA 4M6YA 4I7HA 2JPCA 3GW2A 1QZYA 2GZWA 3FXUA 1FT9A 5A2QZ 2K4BA 3HTUA 1FZPB 1F5TA 1IRGA 1T0FA 3ZN1A 1KU2A 1FLIA 2A61A 1W5TA 2MC3A 3LSTA 2Q2EA 4HOBA 2CW0F 3WTXC 3MZHA 4BHBA 4KDPA 3CUQC 2EA2A 4I0BA 1MDMA 1FC3A 4EVIA 1Z9CA 2ESNA 3ZN0A 1FSEA 3HHGA 1ZLJA 2CG4A 2W25A 3TGNA 1J0RA 3JW4A 5D6EA 3SZTA 2M5WA 4KN4X 1T6SA 2K27A 2V1XA 4MHGA 2X0LA 2XAHA 2O03A 3Q9SA 4G7HF 4ESJA 3IL2A 1B9NA 4MNUA 2UXNA 3I5UA 3QU3A 2RNJA 2KJCA 1RZ4A 2FMYA 5FFZA 1O3TA 1FBUA 1DPUA 5LRSA 1KQ9A 4OINF 1G3SA 2ISZA 1YW9A 4AIKA 4AIJA 3I58A 3GFMA 2LNBA 2ISYA 2RN7A 3GVAA 5D8KB 5JVTA 3RYPA 2BBYA 1ON1A 4KMFA 1IN7A 2HTSA 2FBIA 1O3RA 1IN5A 4AWXB 5L3BA 1T98A 1LQ1A 3WGGA 3E97A 2EFWA 2P5VA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3QP6 A;  5DYM A;  2HQR A;  3Q9V A;  5HLH A;  1Z91 A;  1B1B A;  3BRO A;  1E17 A;  1I6X A;  4KT5 C;  4ENM A;  3F8N A;  2VC1 A;  4YFN F;  4ENJ A;  1XSX A;  5IT3 A;  2WWY A;  2QUF A;  3BPV A;  2DPD A;  2Q0O A;  2H6B A;  3S2W A;  4KUM A;  1I5Z A;  3P9I A;  3WG9 A;  2ETH A;  2QYO A;  2VBY A;  1SMT A;  3WU1 B;  4BNC A;  2VOO A;  2VXZ A;  5L3D A;  2EFP A;  3T8R A;  4UHT A;  3VOE A;  2UXX A;  2VN2 A;  1SFU A;  1IUY A;  2P8T A;  3SZP A;  1KGS A;  1VTN C;  5LGU A;  3G3Z A;  1ZG5 A;  2NAZ A;  4LB5 A;  1FYM A;  3ZMZ A;  5D5X B;  1ZGJ A;  1FSH A;  2R7F A;  1BBY A;  5DCF A;  2GXG A;  3F72 A;  2KJB A;  1B6A A;  4L9V A;  2QZ8 A;  3L9F A;  4HA8 A;  4EGY A;  2DT5 A;  3GYH X;  3E5X A;  1SD6 A;  3GUD A;  2XKP A;  5D5W B;  4HDU A;  2PLY A;  1KU7 A;  4IRI A;  2H94 A;  2A3S A;  2XAQ A;  1BN5 A;  2V1D A;  4UVB A;  3RPU A;  2V9V A;  1TQI A;  3EUH A;  4NB5 A;  2MH9 A;  4OMY A;  4KFC A;  5E20 A;  2OBP A;  3CUO A;  1XGO A;  1TQM A;  1R58 A;  2CWE A;  3M9A A;  4ZH4 F;  1B59 A;  3FMQ A;  5HLI A;  1I27 A;  2PN6 A;  4FX0 A;  1CF7 A;  4U7D A;  4F7Z A;  2XV4 S;  2JTV A;  1BOA A;  2ZBK A;  5HDG A;  4XSZ F;  1Z05 A;  3EYY A;  1ON2 A;  3TQN A;  5L3C A;  1IN8 A;  3KEO A;  2XIG A;  3KEQ A;  4M71 A;  1BI1 A;  4ENK A;  5FLX K;  5CYV A;  2YU3 A;  3F8M A;  3V8L A;  3F8F A;  1D8J A;  4RB0 A;  3HRS A;  2YX7 A;  1K78 A;  2IJL A;  2FOK A;  5AON A;  3L2C A;  4IRG A;  2Q8K A;  3L7W A;  2DQR A;  4FX4 A;  4EM0 B;  5K5R A;  3M1E A;  3HSE A;  5ERI A;  2HKX A;  5DCM B;  1FP2 A;  1RI7 A;  2RKH A;  4LGW A;  2FSW A;  1HST A;  5TRD A;  1T38 A;  1HBX G;  3RI4 A;  1ZAO A;  2W84 A;  3ZMS A;  4EV0 A;  3NEU A;  4EM2 A;  5L3E A;  1XSV A;  3SQN A;  2HYG D;  2DK8 A;  3BWG A;  3ELK A;  1IN6 A;  5HLG A;  2DI3 A;  2V1U A;  1REP C;  5EEH A;  1Z1D A;  1ZH5 A;  4RB2 C;  1BI0 A;  2STT A;  4BHP A;  2FXA A;  3BJO A;  4LMY A;  3IHU A;  3MFK A;  2WC2 A;  2BYV E;  4U0W A;  1U2W A;  3KCC A;  2O8X A;  3KP5 A;  4R1H A;  5ILS A;  1ZAR A;  3T1B A;  4NHJ A;  3G73 A;  1YYV A;  1WWX A;  1WSU A;  2ZFW A;  3DP7 A;  1P2F A;  3CJN A;  1BJA A;  4CYD A;  2L4M A;  1MJA A;  1HXD A;  3B73 A;  3LWF A;  1WQ2 A;  3QAH A;  5HS7 A;  2UZK A;  1YS6 A;  1DP7 P;  3VEP A;  3NRV A;  3IWF A;  3HOT A;  5FLX Z;  3K1P A;  3KP3 A;  4CZZ A;  2QWW A;  3P9C A;  1ZG3 A;  2OAZ A;  2EWN A;  4OMZ A;  1P4W A;  3DPT A;  5ILV A;  1L3L A;  2FU4 A;  1XB4 A;  1EV7 A;  1R5G A;  3R0A A;  5J8F A;  1UCR A;  3ISP A;  2EV0 A;  2H09 A;  5LEJ A;  5CVU A;  5KVR A;  1LEB A;  3TO9 A;  1FX7 A;  4Q47 A;  1G3Y A;  3MQ0 A;  2V6C A;  3FX3 A;  2UWM A;  4LJZ F;  2VE8 A;  1YO5 C;  4IVN A;  1KQ0 A;  3WTW C;  3K0L A;  2DBB A;  2DPU A;  1ZN2 A;  1IZ1 A;  4G94 A;  2ZO4 A;  5H6R A;  3C7J A;  5FB2 A;  1IXR C;  1PP7 U;  4YFK F;  2QQ9 A;  3J81 K;  2XUB A;  4ZYG A;  1ZRC A;  3JSO A;  1UST A;  4RGR A;  1MDM B;  3DFG A;  4HBL A;  2E1N A;  1W7P A;  1S3J A;  2HYF A;  4ENN A;  4OIO F;  4OU0 A;  1X3U A;  3WU0 A;  1EH6 A;  3PFI A;  1E2X A;  4U0Y A;  3R6S A;  4PDK A;  4EM1 A;  4TV7 A;  2A6H F;  3JTG A;  4LK1 F;  4P55 A;  5H6Q A;  3IC7 A;  3VB2 A;  5F6F A;  3U9G A;  2L3D A;  1SFX A;  4EJW A;  4FT8 A;  5E17 F;  1Y0U A;  2JRT A;  1DUX C;  4E70 A;  5ICG A;  4BAY A;  3F8C A;  4G6D A;  1H9T A;  3ML6 A;  3OOP A;  3WTT C;  2FRH A;  3WTZ A;  5DD4 A;  3H3Z A;  5J8C A;  2ZCW A;  3LAP A;  3RYR A;  3SHF A;  2XAS A;  4WWC A;  3D0S A;  4XRF A;  5E1X A;  2O61 A;  3F23 A;  3CUQ A;  5BQT A;  3IRQ A;  1K7A A;  2RV8 A;  1H0M A;  3ABU A;  4ASN A;  4OIQ F;  2D1V A;  1DPR A;  2MLK A;  3JSP A;  2ESH A;  4HF1 A;  2Y48 A;  4L0Z B;  2DLL A;  4YFX F;  1G4D A;  3QOP A;  5HVQ C;  2PMH A;  2OZ6 A;  3QP5 A;  5LHG A;  4BYY A;  4S04 A;  3WGI A;  2P6T A;  2GXB A;  5HDK A;  1AWC A;  4Y13 A;  3M8F A;  3GF2 A;  1XGS A;  5DEQ A;  3LAJ A;  2E7W A;  4OIR F;  3FMR A;  2YSR A;  2A68 F;  1P92 A;  3ULQ B;  3JTH A;  2KRF A;  5CVV A;  3I64 A;  1RIO H;  3QPT A;  3SFZ A;  1YTY A;  2RC4 A;  3O3K A;  4I02 A;  3TDU C;  3V4G A;  3J80 K;  1XDS A;  1XSD A;  1QQI A;  1U78 A;  2BV6 A;  3GX4 X;  1UB9 A;  4N9I A;  4MTE A;  3O6B B;  4RAY A;  3W6K B;  2K02 A;  3IKT A;  3N97 A;  2EFN A;  2W24 A;  3KP6 A;  2ZME B;  3R60 A;  3JAM K;  3R61 A;  1QBJ A;  4MQ9 F;  1XCB A;  1UFM A;  2QBY A;  1ULY A;  2A69 F;  4R79 A;  5BS6 A;  3ERE D;  4NQW A;  3LQR A;  3BZ6 A;  1TQP A;  1KYZ A;  3CDH A;  4P96 A;  2X4H A;  1YW8 A;  1RUN A;  3GFL A;  3WTU C;  3MCZ A;  3H92 A;  3R4K A;  1CF7 B;  2QM3 A;  1S7A A;  4KMU X;  5E8I A;  3HHH A;  2VBX A;  2PMU A;  3ABT A;  3ZP5 A;  3K69 A;  1XMA A;  3KP4 A;  1PDN C;  5ILU A;  2HZT A;  1BI3 A;  3FXR A;  3BP8 A;  4EMS A;  1TNT A;  3FMS A;  3K2Z A;  1R36 A;  1UHW A;  4FHT A;  2Z99 A;  1LJ9 A;  2JT1 A;  3I4P A;  1HQC A;  1F9N A;  1QNT A;  2V79 A;  1BC7 C;  3LA2 A;  2W57 A;  3M7G A;  4ON0 A;  2MD5 A;  3WTY C;  4D0P A;  1JE8 A;  2P6S A;  5K5O A;  4KNY A;  1JGS A;  4GGG A;  1RNL A;  3J80 Z;  4M72 A;  1JHF A;  4UV9 A;  3H3U A;  4WK8 F;  3EYI A;  3D5L A;  2GIV A;  4I09 A;  1F1Z A;  3VFZ A;  2ADU A;  2HKO A;  4I98 B;  3WTS C;  1MZB A;  2F2E A;  4P9U A;  2ELH A;  2E1C A;  3F22 A;  2IVM A;  2IT0 A;  3GFJ A;  3LFK A;  1R1T A;  4M9Z A;  4G7Z F;  2OQR A;  1HKQ A;  2VBW A;  4IXA A;  1MGT A;  1HW2 A;  1HKS A;  2QQA A;  1ZGA A;  3I54 A;  2IA0 A;  4LLG F;  3GLX A;  4RB1 A;  1F4K A;  1ZYR F;  2C6Y A;  1OR7 A;  1YQA A;  5E18 F;  2OU2 A;  1BM9 A;  2FE3 A;  2L02 A;  2M8E A;  4UVC A;  4PGG A;  2GQQ A;  3GZ5 A;  1O3S A;  3DV8 A;  1TW2 A;  4KA4 A;  1P4A A;  2IRF G;  4N0B A;  2LF8 A;  4WXD A;  1W5S A;  3GXO A;  2PI0 A;  3QPH A;  3ROU A;  1IW7 F;  1PUE E;  1KA8 A;  3SXY A;  5FD6 A;  2FML A;  3ZMV A;  4GYI A;  4L5I A;  1S8N A;  4CXF A;  4HQE A;  2P5K A;  2WV0 A;  3F6O A;  3HRM A;  2EJR A;  3E6C C;  1SFE A;  4KYW A;  1JHH A;  2IA1 A;  3MZY A;  5LHI A;  4QWQ A;  1TW3 A;  2KIM A;  2K4J A;  4XBF A;  5ICF A;  5FFX A;  4O3M A;  2YPR A;  4EJU A;  1FNN A;  2KKO A;  2Y75 A;  4G8X A;  1XMK A;  4HYE A;  3ZMD A;  1SAX A;  1XCV A;  5IT9 K;  1AOY A;  4Q48 A;  4EQQ A;  4LG0 A;  4IF4 A;  4YII A;  1PP8 F;  4HLX A;  3E6D A;  1DDN A;  4MTD A;  3KZY A;  2JZY A;  1GXP A;  4AIH A;  1C0W A;  1FBS A;  3K1N A;  3U2R A;  5BPD A;  1YIO A;  1EH7 A;  2K7L A;  1NHA A;  2M87 A;  4I2O A;  4IRH A;  3I0T A;  2A5Y B;  3FHZ A;  1FBQ A;  3HTS B;  3ZPL A;  3LA3 A;  1RUO A;  3WE3 A;  2XAJ A;  2FNA A;  1ZRE A;  5HDN A;  1MD0 A;  5F1R A;  2KIU A;  2OA4 A;  1W7P D;  3EDP A;  5L3F A;  4M9S A;  2OD5 A;  3NQO A;  3V7R A;  2DO7 A;  3REO A;  2NYX A;  1T2K A;  1V4R A;  1MJ9 A;  4HX7 A;  1HSJ A;  2RDP A;  4MEY F;  1J59 A;  4GYG A;  3KP2 A;  4RGS A;  1QZZ A;  1LVA A;  4G7O F;  2EV6 A;  1LNW A;  2MA3 A;  2L01 A;  2P7C B;  1G3W A;  2VBZ A;  1V3F A;  5DUK A;  2J5O A;  4ZYD A;  1IF1 A;  4CDG A;  3C3W A;  2DQL A;  2DFI A;  3E6M A;  5L3G A;  2G7U A;  4OIP F;  3TDZ C;  4S05 A;  4Q4Z F;  1R1V A;  1O57 A;  5A2Q K;  5HS9 A;  4Y17 A;  3F21 A;  4H0E A;  4A6E A;  2HTJ A;  4M6X A;  1OKR A;  4XLN F;  4UUV A;  2NRA C;  4P5O A;  1LDJ A;  1U5T A;  4L9J A;  3RKY A;  1XDU A;  3L09 A;  2DW4 A;  4RGU A;  1SMY F;  2PG4 A;  4M9X A;  4BHC A;  1ZG1 A;  3KLN A;  3QU6 A;  3O2P E;  4WXH A;  5D4S A;  1TNS A;  2YR2 A;  3BOQ A;  2VON A;  4ZZL A;  3KE2 A;  4U0V A;  3CUQ B;  4A6D A;  1K79 A;  2QEN A;  3T8T A;  3F3X A;  2FBH A;  4ZYH A;  4HF2 A;  2NNY A;  2PQ8 A;  5CVR A;  4K2E A;  5DV5 A;  1FOK A;  2F5C A;  1B4A A;  4P9F A;  2PEX A;  4ETS A;  4A12 A;  4A2U A;  4M73 A;  1ZLK A;  1FYK A;  2FBK A;  4G9Y A;  1OMI A;  4HLY A;  1KYW A;  3BPX A;  2QQB A;  2IPQ X;  3RDI A;  4ESF A;  2CSO A;  3L00 A;  1T39 A;  3ZQ7 A;  4ZZD A;  3RKW A;  5LGN A;  2G7H A;  3BJA A;  2DU9 A;  3FM5 A;  2YX4 A;  1KU9 A;  4IHT A;  4GXO A;  1ODD A;  2P5L C;  3BDD A;  4JBA A;  1S6L A;  3TKY A;  2FF4 A;  1S7O A;  1L0O C;  4WXC A;  4YIF A;  3MWM A;  4KIF A;  5ICE A;  5LEK A;  2VOP A;  1SD4 A;  2DTR A;  4L0Y B;  1KQ8 A;  3KZZ A;  2CQK A;  4I0A A;  1J5Y A;  3TOB A;  5LLQ A;  2GA1 A;  2DAO A;  4PCQ A;  2O0Y A;  3GO5 A;  2QBY B;  2ZNZ A;  3J81 Z;  2VT3 A;  2R7D A;  1J2X A;  1BIA A;  5AIP A;  4UV8 A;  1J75 A;  2PJP A;  5F64 A;  1GHC A;  2BEO A;  5CVI A;  3I53 A;  1XGN A;  2XKO A;  2G9W A;  3ZMU A;  2PBI A;  1TLH B;  1ZRD A;  1A04 A;  3I59 A;  1S29 A;  1K6O A;  1EH8 A;  3DF8 A;  5DD8 A;  4PZJ A;  5DDG A;  5JI6 A;  1ZHF A;  4WX9 A;  1J7K A;  2OQG A;  1R23 A;  3TOA A;  2R3S A;  4HX4 A;  4HQM A;  5ED4 A;  1QO0 D;  4L18 B;  3RTR A;  3F6V A;  3EQL F;  2ZKZ A;  1WRJ A;  2RQP A;  1USS A;  2MH2 A;  3DQV C;  2ZJ2 A;  3PQJ A;  3T5X A;  4Y15 A;  1GXQ A;  3HIF A;  4B8X A;  4QLC U;  1HKT A;  2FQ3 A;  2NS0 A;  3R0J A;  2EK5 A;  2AXL A;  3ECH A;  2B0L A;  3DPL C;  4A5M A;  4AVP A;  5D4R A;  4IPA A;  2FA5 A;  1OYY A;  3HSF A;  2HFH A;  3RKX A;  2HEO A;  1YFH A;  3OV8 A;  2F5F A;  3HYI A;  1O7L A;  5D6F A;  3WOD F;  2VT2 A;  1OYI A;  5J6X A;  2GA2 A;  4LLN A;  4O6J A;  4Z2Y A;  3MEX A;  2O6G E;  2LKP A;  3P7N A;  3V7C A;  1YG2 A;  2HOE A;  4UVA A;  4MQV A;  4U88 A;  4B09 A;  1MJB A;  2P7V B;  2IA2 A;  1FY7 A;  1WI9 A;  2GAU A;  2D2W A;  4CO8 A;  2QLZ A;  3RIR A;  4BH9 A;  4GO1 A;  2EFQ A;  4EJO A;  2OZU A;  1LB2 A;  4EJT A;  2O3F A;  2COM A;  1D5V A;  2EB7 A;  3K9T A;  1P4X A;  4MEX F;  2ZXJ A;  1BC8 C;  1K78 B;  2MLG A;  3GWZ A;  2HQN A;  3FXQ A;  1LDD A;  2Z33 A;  1R22 A;  3K1M A;  3WGH A;  5CVJ A;  3QRF F;  2M45 A;  2EV5 A;  1IXC A;  2CYY A;  2DK5 A;  2ACJ A;  3FWE A;  2KIF A;  3TO7 A;  2FEZ A;  2CGP A;  2JSC A;  4A0Y A;  5E1W A;  2XHK A;  2E7X A;  5HOO A;  3COA C;  5JHU A;  2TDX A;  1BIB A;  4IJA A;  4G6Q A;  4KN7 X;  1P6R A;  4OOI A;  3V8K A;  1LEA A;  1FWZ A;  2ZME A;  3KP7 A;  3IRR A;  2HS5 A;  4LB6 B;  2RGV A;  5E1Z B;  5LBQ A;  4XLP F;  2J5P A;  2D1H A;  5ICC A;  2XVC A;  3JAM Z;  4U7B A;  3CLO A;  3T0Y A;  4BXU A;  3B02 A;  4A5N A;  2Z9O A;  2HGC A;  4WCG A;  3GZ6 A;  1B9M A;  3U1D A;  1ONV A;  3I71 A;  2Y0M A;  4ZYE A;  2D45 A;  4PGH A;  1XN7 A;  4RB3 C;  4LG0 B;  5BMZ A;  1OPC A;  1IN4 A;  4A0Z A;  1XD7 A;  2IP2 A;  4O5V A;  2VOD A;  3N4M A;  5TJJ A;  3KLO A;  1I1G A;  2F5D A;  4A0X A;  2MBF A;  4IHS A;  1O7F A;  3M8E A;  3E3V A;  2M1B A;  3GFI A;  1I1S A;  4RAZ A;  3FM3 A;  5D5U B;  1O3Q A;  3CTA A;  1STZ A;  2AS5 F;  4L9N A;  1Z6R A;  3HRT A;  5D8L B;  2BE5 F;  3E6B A;  3KET A;  3RJP A;  3Q5F A;  2L54 A;  2STW A;  2A07 F;  4KIG A;  3FF5 A;  4YG2 F;  3AAF A;  4BQA A;  1FYL A;  4HX8 A;  2JPB A;  5FO5 A;  1W4M A;  1SD7 A;  4I01 A;  4N9H A;  1SD5 A;  4HF0 A;  2F5E A;  3CO6 C;  1TBX A;  3IWZ A;  1Z7U A;  1U3E M;  1H9G A;  2BGC A;  2H6C A;  2XAF A;  2XGX A;  3F8B A;  2XRO A;  1LDK B;  1CGP A;  3HUG A;  4DQ2 A;  3DEU A;  5K5Q A;  3P9K A;  4CHU A;  3WTV C;  1U5T B;  2FNP A;  2P4W A;  4JQF A;  1R7J A;  3BJ6 A;  4M74 A;  2XAG A;  4Q5S F;  1OYW A;  3EET A;  5CLS A;  2ZNY A;  4RGX A;  4CIC A;  2LDU A;  1G3T A;  1U6G A;  3HOS A;  3ECO A;  3FZV A;  5E8G A;  2GWR A;  2LF7 A;  3KFW X;  5FGM A;  1W7P B;  5DCM A;  4WF2 A;  2W85 A;  3C1D A;  3GEZ A;  1HW1 A;  3TO6 A;  1QPM A;  2HR3 A;  5DUI A;  2NNN A;  5LGT A;  4R8H A;  3W6J B;  1TTY A;  4HV6 A;  3DKW A;  1YW7 A;  5LHH A;  2M30 A;  1Z6T A;  4GCV A;  3VOD A;  1FPQ A;  1JXS A;  1YLF A;  4KIB A;  3V8J A;  1YS7 A;  5H20 A;  5K1Y A;  5D5V B;  1Q1H A;  2LSO A;  1IXS B;  2L4A A;  1D3Y A;  2XRN A;  3IKV A;  4CGZ A;  1R1U A;  3E5Q A;  2HDC A;  1UHM A;  1G6N A;  4XSX F;  2H27 A;  1GVJ A;  5LRR A;  5JFR A;  4EGZ A;  4HAM A;  5BPI A;  2VC0 A;  4LK0 F;  2EA4 A;  4HW0 A;  3MAJ A;  1FP1 D;  3ZMT A;  1KU3 A;  1J9I A;  3CO7 C;  3HRU A;  2WTE A;  3V7S A;  2QVO A;  5BOX A;  3C18 A;  4MGR A;  2IW5 A;  4L5J A;  2VE9 A;  5FD5 A;  1U5T C;  5AIQ A;  1U8R A;  2A6E F;  3J7A O;  5IT9 Z;  3BY6 A;  3LA7 A;  2RVC A;  3HSR A;  5JR3 A;  4HV5 A;  4LFU A;  3RPQ A;  1IAW A;  4HDV A;  2Z3Y A;  1WKM A;  3LQQ A;  4LLL A;  2HWV A;  1D8K A;  1R00 A;  6PAX A;  1QGP A;  4DNC A;  4RS8 A;  2Z5U A;  4AD9 A;  1MKM A;  2CO5 A;  2CFX A;  5CJ9 A;  4JK1 X;  3WE2 A;  1HW5 A;  1R5H A;  4L9T A;  2K86 A;  1IRF A;  4KIC A;  3I59 B;  4EJV A;  5HS8 A;  3DXJ F;  4ESB A;  4HZF A;  5EEG A;  5KK1 A;  1BI2 A;  3PQK A;  4LD5 A;  3E5U A;  2PFB A;  1XGM A;  4UNO A;  2EFO A;  1ZRF A;  4UXN A;  4M6Y A;  4I7H A;  2JPC A;  3GW2 A;  1QZY A;  2GZW A;  3FXU A;  1FT9 A;  5A2Q Z;  2K4B A;  3HTU A;  1FZP B;  1F5T A;  1IRG A;  1T0F A;  3ZN1 A;  1KU2 A;  1FLI A;  2A61 A;  1W5T A;  2MC3 A;  3LST A;  2Q2E A;  4HOB A;  2CW0 F;  3WTX C;  3MZH A;  4BHB A;  4KDP A;  3CUQ C;  2EA2 A;  4I0B A;  1MDM A;  1FC3 A;  4EVI A;  1Z9C A;  2ESN A;  3ZN0 A;  1FSE A;  3HHG A;  1ZLJ A;  2CG4 A;  2W25 A;  3TGN A;  1J0R A;  3JW4 A;  5D6E A;  3SZT A;  2M5W A;  4KN4 X;  1T6S A;  2K27 A;  2V1X A;  4MHG A;  2X0L A;  2XAH A;  2O03 A;  3Q9S A;  4G7H F;  4ESJ A;  3IL2 A;  1B9N A;  4MNU A;  2UXN A;  3I5U A;  3QU3 A;  2RNJ A;  2KJC A;  1RZ4 A;  2FMY A;  5FFZ A;  1O3T A;  1FBU A;  1DPU A;  5LRS A;  1KQ9 A;  4OIN F;  1G3S A;  2ISZ A;  1YW9 A;  4AIK A;  4AIJ A;  3I58 A;  3GFM A;  2LNB A;  2ISY A;  2RN7 A;  3GVA A;  5D8K B;  5JVT A;  3RYP A;  2BBY A;  1ON1 A;  4KMF A;  1IN7 A;  2HTS A;  2FBI A;  1O3R A;  1IN5 A;  4AWX B;  5L3B A;  1T98 A;  1LQ1 A;  3WGG A;  3E97 A;  2EFW A;  2P5V A; 
#chains in the Genus database with same CATH topology
 2KHM A;  1VQK I;  4B3A A;  3QP6 A;  3O8G A;  2KZV A;  5DYM A;  2HQR A;  3KYC B;  3CC4 I;  3AKZ A;  2DN0 A;  1V5F A;  3Q9V A;  2EIN H;  2I8D A;  5HLH A;  1F36 A;  1BOB A;  1Z91 A;  1B1B A;  3BQZ A;  4BQQ A;  3BRO A;  1SC7 A;  3LOC A;  1E17 A;  2H8R A;  1I6X A;  4HEA 2;  2F5V A;  2WY8 Q;  2HOA A;  3W6V A;  4BBS J;  4XOR A;  4KT5 C;  3DTE A;  3F8N A;  2VC1 A;  4ENM A;  4YFN F;  4ENJ A;  3CCE I;  4D7M A;  3HGG A;  1XSX A;  5IT3 A;  2WWY A;  2QUF A;  3BPV A;  2DPD A;  3TMO A;  2Q0O A;  2F4M B;  4BBR J;  2H6B A;  1DGR M;  2PJR B;  4BKX A;  1WJ5 A;  3S2W A;  4KUM A;  1I5Z A;  3P9I A;  2WY7 Q;  2LTP A;  4BE0 A;  3WG9 A;  2ETH A;  3HOW J;  2QYO A;  2BZT A;  2VBY A;  1SMT A;  3WU1 B;  3GME A;  3S14 J;  4BNC A;  2VOO A;  2VXZ A;  5L3D A;  2EFP A;  2CFO A;  3S3M A;  1MBJ A;  1YI2 I;  1TWA J;  4AU7 A;  5FKO A;  3T8R A;  1VQN I;  1K7A A;  9ANT A;  4UHT A;  1Z21 A;  3OOU A;  1WPK A;  3VOE A;  2UXX A;  4XR6 A;  2VN2 A;  1AA7 A;  1SFU A;  1IUY A;  2P8T A;  3L2V A;  3PUB A;  3SZP A;  4GDF A;  4IEJ A;  1KGS A;  2DMP A;  1OCT C;  1VTN C;  1B8I B;  2LY9 A;  5LGU A;  3G3Z A;  1ZG5 A;  1MIJ A;  3PIP F;  2NAZ A;  4LB5 A;  5E3O A;  2E71 A;  1FYM A;  2W4S A;  1TWH J;  1PUF B;  3ZMZ A;  4H4K C;  5D5X B;  1NH3 A;  1JGG A;  5JVG F;  1ZGJ A;  1FSH A;  2R7F A;  1BBY A;  5DCF A;  2GXG A;  3F72 A;  2KJB A;  1B6A A;  4L9V A;  2QZ8 A;  3L9F A;  1X1A A;  4HA8 A;  4EGY A;  3IAM 2;  2DT5 A;  3GYH X;  3E5X A;  1SD6 A;  3GUD A;  3OYB A;  2M0C A;  1VI0 A;  2XKP A;  2WA0 A;  1JUS A;  5D5W B;  2LH9 A;  4HNU A;  2H1L A;  4HDU A;  2PLY A;  1KU7 A;  4IRI A;  3U1K A;  3PJR A;  3FK7 A;  4E7H A;  4IHV A;  2H94 A;  2A3S A;  5FLV A;  3HL2 A;  2XAQ A;  1BN5 A;  4BXF A;  2V1D A;  1A36 A;  4UVB A;  2R7S A;  3RPU A;  2ZJP F;  4UUS A;  2V9V A;  1TQI A;  3K10 A;  2DA2 A;  4KIT B;  2VJI A;  3EUH A;  3D1N I;  4NB5 A;  2MH9 A;  4OMY A;  4KFC A;  5E20 A;  2OBP A;  3BG3 A;  3QOD A;  3PFY A;  1OQY A;  3CUO A;  1XGO A;  2TCT A;  1S5L C;  1TQM A;  2XB0 X;  2GLO A;  1R58 A;  2CWE A;  3BT9 A;  2NOJ B;  3M9A A;  1WHU A;  4ZH4 F;  3KYL A;  1B59 A;  3FMQ A;  4F52 A;  1ETV A;  5HLI A;  5IY5 H;  1D0X A;  1JT6 A;  4E6K G;  1I27 A;  4EEF G;  2ELJ A;  2PN6 A;  2K3F A;  2KIS A;  4FX0 A;  5EYR A;  4A3J J;  2M2E A;  4PFO A;  1CF7 A;  4AYB A;  4U7D A;  3QQA A;  4F7Z A;  4BE2 A;  4CCO A;  2XV4 S;  2JTV A;  2RNG A;  2L7K A;  3H5N A;  2ZXH A;  1I3A A;  1BOA A;  2ZBK A;  2Y69 H;  4XLF A;  5HDG A;  3ZQG A;  4XSZ F;  1Z05 A;  2OV7 A;  4QIW N;  2KIQ A;  3EYY A;  3CF2 A;  3FXJ A;  2ZSH B;  1ON2 A;  3TQN A;  5L3C A;  1IN8 A;  3KEO A;  2IS2 A;  2MFZ A;  2A6T A;  2HI3 A;  3DEE A;  1TWC J;  2XIG A;  3KEQ A;  4M71 A;  1BI1 A;  1OR7 C;  4ENK A;  5CYV A;  1UAA A;  5FLX K;  2YU3 A;  3F8M A;  3K4K A;  3V8L A;  3F8F A;  1P7I A;  1O4X A;  2CUJ A;  1D8J A;  4RB0 A;  3VWB A;  3HRS A;  2YX7 A;  1K78 A;  4M3E A;  3GTG J;  2IJL A;  2FOK A;  5AON A;  3L2C A;  4IRG A;  2Q8K A;  3AG1 H;  3L7W A;  2DQR A;  4FX4 A;  1ETX A;  4EM0 B;  4B48 A;  2UUZ A;  1OLT A;  1E3P A;  5K5R A;  4LOC A;  3M1E A;  2R4G A;  1W36 C;  3HSE A;  5ERI A;  3UKG A;  2HKX A;  5E79 C;  5DCM B;  3KEY A;  1FP2 A;  4JX4 A;  3CF5 F;  2XAU A;  3K4L A;  1RI7 A;  3HOV J;  2RKH A;  4GFB A;  4LGW A;  2FSW A;  1HST A;  5TRD A;  1T38 A;  4XRS G;  3JRG A;  2CQ7 A;  1LFU P;  2KFD A;  1HBX G;  3RI4 A;  1ZAO A;  3Q0U A;  2W84 A;  3ZMS A;  4EV0 A;  1IC8 A;  3NEU A;  1D1A A;  3DLA A;  4EM2 A;  5L3E A;  1XSV A;  3BZC A;  2F4O B;  3SQN A;  2HYG D;  2X6Y A;  2DK8 A;  4RMN A;  5J1R A;  2QSF X;  3BWG A;  2DDA A;  3ELK A;  1FMV A;  1IN6 A;  2LC2 A;  3HKZ A;  2IGK A;  5HLG A;  3GTM J;  2DI3 A;  4NC7 A;  1BW5 A;  2NXN B;  2V1U A;  1REP C;  5EEH A;  1Z1D A;  2HDD A;  1ZH5 A;  2FOW A;  4FCY A;  4RB2 C;  1WH7 A;  1BI0 A;  2STT A;  4ANJ A;  4BHP A;  2FXA A;  3BJO A;  4LMY A;  3IHU A;  3MFK A;  2WC2 A;  1VF9 A;  2E2I J;  3S15 J;  3HJE A;  1T95 A;  2B9S A;  2BYV E;  4U0W A;  5J1U A;  1U2W A;  3KCC A;  2O8X A;  3KP5 A;  4M3B A;  4R1H A;  3RQI A;  5ILS A;  1WJC A;  1ZAR A;  3T1B A;  5GAH J;  4NHJ A;  1HDP A;  3G73 A;  1YYV A;  5F04 A;  2IS4 A;  1WWX A;  3OL3 A;  2ZFW A;  1WSU A;  3K70 D;  3DP7 A;  4XLA A;  1MMA A;  3M07 A;  1P2F A;  3CJN A;  4CCJ A;  1BJA A;  4CYD A;  2L4M A;  4FIS A;  1CQT A;  3A03 A;  2FJ1 A;  1MJA A;  2W48 A;  4DBQ A;  3NWT A;  2X6W A;  1HXD A;  3B73 A;  2IGM A;  4BEH B;  3LWF A;  2WB1 A;  1WQ2 A;  3QAH A;  5HS7 A;  1W0U A;  2XPU A;  2UZK A;  1YS6 A;  1DP7 P;  1TT0 A;  1SVL A;  4NC6 A;  1TC3 C;  3JRE A;  2AO9 A;  3VEP A;  3NRV A;  2B7E A;  3IWF A;  5FLX Z;  3HOT A;  2R5Y B;  1JKO C;  2F6C A;  4HG2 A;  3K1P A;  3AG4 H;  3K4B A;  3KP3 A;  2OJE D;  4CZZ A;  2QWW A;  3P9C A;  3QYE A;  1ZG3 A;  2CQQ A;  3J7Y J;  3PSF A;  2OAZ A;  2WAF A;  4IO9 F;  2BW3 A;  1UMQ A;  3ZQH A;  2EWN A;  1ZGW A;  1ETW A;  1R71 A;  3OMY A;  1I6H J;  4OMZ A;  1JKP C;  1P4W A;  3DPT A;  5ILV A;  1MH4 A;  1L3L A;  2AQF A;  2FU4 A;  1XB4 A;  1EV7 A;  2EZI A;  3S8P A;  1LE8 B;  1R5G A;  4DIQ A;  3R0A A;  4D7N A;  3ABL H;  5J8F A;  1QA6 A;  2LBF A;  2IBD A;  2M3A A;  1UCR A;  4CCN A;  3ISP A;  4ZDL A;  2EV0 A;  2H09 A;  3VYU B;  3ZR8 X;  5LEJ A;  2HOT A;  3DTI A;  5CVU A;  5FRM A;  5KVR A;  2R7R A;  1LEB A;  3TO9 A;  2GOM A;  5IYC J;  3A0B C;  3JCU C;  2HVR A;  1HLV A;  4PUS A;  1FX7 A;  2I5U A;  2KQR A;  4DOZ A;  3G2B A;  1IDZ A;  4B1R A;  2DA4 A;  1JJ6 C;  2VKV A;  5IP6 A;  2WV1 A;  4Q47 A;  1G3Y A;  1UEL B;  2XGD A;  3MQ0 A;  2V6C A;  3FX3 A;  3ZRG A;  2UWM A;  3PM1 A;  4LJZ F;  1YIT I;  2DA5 A;  3OIP A;  2VE8 A;  1YO5 C;  4IVN A;  1KQ0 A;  2BXY A;  3WTW C;  3OYL A;  4MIM A;  3K0L A;  2X85 A;  3L2Q A;  4W1U A;  2DBB A;  2ME0 A;  2DPU A;  4IQJ A;  1ZN2 A;  1IZ1 A;  1X58 A;  4G94 A;  2ZO4 A;  5H6R A;  4HST A;  3C7J A;  1N78 A;  2E2H J;  5FB2 A;  1IXR C;  1PP7 U;  2Q2E B;  4YFK F;  2E5Z A;  1Y8Q B;  1D1B A;  4BDY A;  2HQA A;  2QQ9 A;  3J81 K;  2LK2 A;  2XUB A;  3HPG A;  2A05 A;  4ZYG A;  3JSO A;  3OYE A;  1ZRC A;  1UST A;  4RGR A;  2B63 J;  1MDM B;  2ZJQ F;  2VI6 A;  3DFG A;  4HBL A;  2E1N A;  4NUB A;  1W7P A;  1S3J A;  4CSW A;  1V55 H;  2HYF A;  2F4I A;  5TIS C;  4ENN A;  4IX7 A;  2DXI A;  2V26 A;  4OU0 A;  4OIO F;  4J01 A;  2VKD A;  4GRI A;  1X3U A;  3WU0 A;  1EH6 A;  3PFI A;  5FJ8 J;  3CCQ I;  3A4C A;  1E2X A;  4U0Y A;  1H89 C;  3R6S A;  4PDK A;  4EM1 A;  4TV7 A;  4DYC A;  2M34 A;  3EUK L;  5BNG A;  2A6H F;  3JTG A;  2OCC H;  4XN0 A;  2IAI A;  3BR3 A;  1I3Q J;  4LK1 F;  4P55 A;  5H6Q A;  4ZYA A;  3F0C A;  2DMN A;  2E1M B;  1X3Z B;  4HPQ A;  4BJT A;  3CC2 I;  3IC7 A;  3VB2 A;  5F6F A;  3U9G A;  3RZO J;  1T8I A;  2ZXW H;  2VQG A;  1VFC A;  2L3D A;  1YOV B;  3OYJ A;  4C2M J;  1SFX A;  3LSH A;  4EJW A;  3PSI A;  4FT8 A;  4NC8 A;  5E17 F;  1Y0U A;  2JRT A;  1DUX C;  4A93 J;  4E70 A;  3F9K A;  5ICG A;  4IL6 C;  4BAY A;  1VZ0 A;  4LG3 A;  3F8C A;  2HXO A;  3RZD J;  4G6D A;  4B43 A;  2MSY A;  2EZL A;  1I50 J;  1H9T A;  3M4O J;  1FOX A;  3ML6 A;  3OOP A;  3WTT C;  1N75 A;  2FRH A;  2M0M A;  3NAR A;  3WTZ A;  5DD4 A;  1X1D A;  3H3Z A;  4M3D A;  4XKW A;  5J8C A;  2ZCW A;  3CMA I;  4J19 A;  1RR8 C;  1HCR A;  3LAP A;  1WVR A;  3RYR A;  3SHF A;  2BY3 A;  4DYR A;  4XQF A;  2XAS A;  4WWC A;  3O8H A;  3D0S A;  4XRF A;  5E1X A;  3H3V K;  2NS8 A;  2OUM A;  2IGN A;  1ZTR A;  2O61 A;  3F23 A;  4FE7 A;  1T0F C;  4DYQ A;  3CUQ A;  5BQT A;  3IRQ A;  5HLT A;  5J1Y A;  2K40 A;  4Y4R A;  2RV8 A;  3OS1 A;  2TRT A;  3ABU A;  4ASN A;  3CME I;  1H0M A;  3QYF A;  2XF7 A;  5FKN A;  2ID6 A;  1EJ9 A;  4Z6Y A;  5KCM A;  3L1P A;  4OIQ F;  3E0J B;  4FQG A;  3M1C A;  3GTP J;  2D1V A;  1X19 A;  4AYB N;  4BY7 J;  1DPR A;  2MLK A;  1SFO J;  3JSP A;  2ESH A;  5J4V A;  3UR3 C;  4HF1 A;  4JOM A;  2Y48 A;  4L0Z B;  2DLL A;  1B72 B;  4DGW B;  3P5J A;  2GXA A;  4YFX F;  2XSD C;  3BR2 A;  2KMU A;  3QOP A;  5HVQ C;  1G4D A;  2PMH A;  1X1C A;  2OZ6 A;  2XGE A;  3QP5 A;  3HBL A;  5LHG A;  3H5A A;  4BYY A;  4S04 A;  1X4P A;  3IUO A;  5KAI C;  3WGI A;  1MNM C;  2P6T A;  2GXB A;  5GAE J;  5HDK A;  1AWC A;  2NVY J;  3DLL F;  2DDB A;  5B1A H;  4Y13 A;  1R4M B;  3M8F A;  2VJJ A;  1WJA A;  3FDY A;  3OS2 A;  3GF2 A;  2HOS A;  1PVE A;  1XGS A;  5DEQ A;  2QEX I;  3RSN A;  3LAJ A;  1Y1V J;  2E1M C;  2L9S A;  2E7W A;  4OIR F;  1FJL A;  4EAT A;  3FMR A;  2YSR A;  2JVG A;  2WAE A;  4D9J A;  2A68 F;  2V4J C;  3LSJ A;  4BQO A;  2QSH X;  1P92 A;  3EPZ A;  2KZG A;  2HYJ A;  3ULQ B;  2HZD A;  1OCR H;  2CV2 A;  3IH2 A;  3JTH A;  2KRF A;  3GTQ J;  5CVV A;  3I64 A;  1RIO H;  3QPT A;  3MD2 A;  3SFZ A;  2ZXI A;  1YTY A;  3CZ6 A;  2RC4 A;  3O3K A;  4I02 A;  3TDU C;  3V4G A;  2XGC A;  3J80 K;  1XDS A;  2AQE A;  2Y9Z A;  2FUG 2;  3EUA A;  4LIU A;  3VPR A;  5CKT A;  1XSD A;  1QQI A;  1U78 A;  1MBF A;  3HKZ N;  2V9K A;  2EIL H;  4XLC A;  3ZQI A;  2BV6 A;  5GTI C;  1QVT A;  1T56 A;  1XX5 A;  2GOX B;  2XPW A;  3OL4 A;  4OAZ A;  3GX4 X;  2CQN A;  1UB9 A;  2XF5 A;  1H88 C;  1QZE A;  4N9I A;  1VQ8 I;  3FKI J;  4MTE A;  3O6B B;  4X6A J;  3SEZ A;  4BXX J;  4RAY A;  3OYA A;  3SZG A;  2LFB A;  3W6K B;  5M5W J;  2K02 A;  2Z16 A;  1ACI A;  3IKT A;  3N97 A;  2EFN A;  2W24 A;  4MLO A;  3KP6 A;  1D0Z A;  1VQ4 I;  3S16 J;  2ZME B;  3R60 A;  4I99 C;  3JAM K;  1S7E A;  3R61 A;  1QBJ A;  2K3P A;  4MQ9 F;  5CQG A;  1XCB A;  1UFM A;  4XID A;  3RPU D;  3D5R C;  2QBY A;  1ULY A;  1U9O A;  2A69 F;  4R79 A;  5BS6 A;  2F48 A;  2KRC A;  3ERE D;  4UUS B;  4HNV A;  4G6T B;  4NQW A;  3LNQ A;  3LQR A;  3FXK A;  1ETQ A;  3BZ6 A;  3J7Z I;  1YRN A;  4MFD A;  1TQP A;  1MMN A;  3A01 B;  1KYZ A;  3CDH A;  1KZH A;  4P96 A;  1NTC A;  2X4H A;  1YW8 A;  1RUN A;  3GFL A;  5C44 J;  4NNJ A;  3WTU C;  2EQR A;  1Z67 A;  4W97 A;  3MCZ A;  3H92 A;  3BTJ A;  5IOZ A;  3R4K A;  1CF7 B;  2WB1 N;  2QM3 A;  1S7A A;  4KMU X;  2LMD A;  3GLL A;  3SDB A;  2HPI A;  5E8I A;  2VKE A;  3H0G J;  1F43 A;  3HHH A;  2VBX A;  2PMU A;  1XTA A;  3ABT A;  3NWS A;  4A3D J;  3K69 A;  1XMA A;  3ZP5 A;  2E35 A;  3KP4 A;  1X2M A;  4D5C A;  1ZR4 A;  1PDN C;  3K4M A;  5ILU A;  1MSE C;  1FIA A;  1BI3 A;  2HZT A;  1BR1 A;  3FXR A;  2DJI A;  3BP8 A;  2HU9 A;  4EMS A;  5EG0 A;  2LLK A;  1YJ9 I;  3ZCO A;  1TNT A;  2A5W A;  3FMS A;  3K2Z A;  1R36 A;  2D5V A;  5TGT A;  4A3L J;  1IO2 A;  1UHW A;  2RQQ A;  4FHT A;  2Z99 A;  1E0E A;  3QPS A;  2R7W A;  1LJ9 A;  2JT1 A;  2MG4 A;  3I4P A;  3S1N J;  1HQC A;  2XPV A;  3LFU A;  1DP3 A;  1FEX A;  2CH0 A;  1F9N A;  1QNT A;  2V79 A;  4Y52 J;  3S1R J;  1BC7 C;  3LA2 A;  2W57 A;  3M7G A;  4M6V A;  5HOD A;  1VQP I;  4ON0 A;  1WZ2 A;  2MD5 A;  2JUC A;  3WTY C;  1G2H A;  1OCZ H;  4D0P A;  3FKJ A;  1JE8 A;  2P6S A;  1W5C C;  5K5O A;  1JTX A;  5KHD A;  3K4C A;  4KNY A;  4HNT A;  1JGS A;  5J3L A;  4GGG A;  1RNL A;  4F91 B;  3J80 Z;  4M72 A;  1JHF A;  3CJQ B;  2EBI A;  4UV9 A;  3H3U A;  3BR0 A;  4WK8 F;  3EYI A;  4ZTF A;  3D5L A;  2GIV A;  4I09 A;  1F1Z A;  3M8J A;  3VFZ A;  4V2G A;  3ABK H;  2ADU A;  1GLN A;  2HKO A;  4I98 B;  3WTS C;  1MZB A;  3AL0 B;  4BAC A;  5EZH A;  2F2E A;  2ZME C;  4P9U A;  2ELH A;  2E1C A;  3F22 A;  2DMT A;  1N77 A;  1ERD A;  2IVM A;  2IT0 A;  3GFJ A;  3LFK A;  4A3B J;  1OJL A;  4CYC B;  1R1T A;  2QCO A;  3Q0W A;  4M9Z A;  1LKX A;  1WCM J;  3C2H A;  3EUH C;  4G7Z F;  2OQR A;  1HKQ A;  3QWL A;  1VQ9 I;  2VBW A;  4IXA A;  1MGT A;  1HW2 A;  3DBL B;  3ZQL A;  4ZC3 A;  2GIZ A;  3H0D A;  1ORK A;  1HKS A;  3CCV I;  2QQA A;  5B5E C;  1ZGA A;  3HUG B;  5JLX A;  4OWR B;  1FIP A;  3PO3 J;  3I54 A;  1EF4 A;  2IA0 A;  4LLG F;  3OR1 C;  1Q1V A;  2XB5 A;  2HQ5 A;  1SAU A;  2DA1 A;  3GLX A;  2JWT A;  1WI3 A;  4RB1 A;  1RPW A;  1F4K A;  1ZYR F;  2DTZ A;  2BY2 A;  1OR7 A;  1YQA A;  2C6Y A;  4E7S A;  5E18 F;  2R7U A;  2OU2 A;  4PFP A;  3FXO A;  1BM9 A;  1JKQ C;  2FE3 A;  2EIJ H;  2L02 A;  3BG9 A;  3IH3 A;  4RAG A;  4I6Z A;  2QQ8 A;  2M8E A;  3S1Q J;  4UVC A;  4B44 A;  4PGG A;  1DU6 A;  2GQQ A;  3GZ5 A;  2BVM A;  3AFH A;  3Q3S A;  2RRE A;  3OS0 A;  2JVH A;  1O3S A;  3DV8 A;  1TW2 A;  2ZC2 A;  1A6Q A;  4KA4 A;  3K7A J;  1GV5 A;  3ZQQ A;  1P4A A;  2IRF G;  2VKH A;  5J40 A;  2JRM A;  4N0B A;  2LF8 A;  3I56 I;  3TED A;  4WXD A;  1VQ5 I;  1W5S A;  3HC7 A;  1VQ6 I;  1Z3X A;  3GXO A;  2LD5 A;  2PI0 A;  1OIS A;  3ONQ A;  1ZR2 A;  1EA3 A;  3QPH A;  3ROU A;  1IW7 F;  2JJ7 A;  3CMM A;  3K2A A;  1HC8 A;  4YEL A;  4N4O B;  1KA8 A;  3SXY A;  5FD6 A;  1PUE E;  2FML A;  3ZMV A;  1DGW Y;  1TP4 A;  3BCA A;  5F08 A;  4GYI A;  4L5I A;  1S8N A;  4CXF A;  1S72 I;  1RET A;  1AU7 A;  4HQE A;  2P5K A;  2WV0 A;  3F6O A;  3HRM A;  4Y7N J;  3SDG A;  2EJR A;  3E6C C;  2ZSI B;  5HNF A;  1SFE A;  2M4G A;  2LY2 A;  4KYW A;  1JHH A;  2IA1 A;  3MZY A;  5LHI A;  3AL0 C;  4QWQ A;  1TW3 A;  2R93 J;  2JMW A;  2KIM A;  2QKL B;  2L9V A;  4PJJ A;  2VAS A;  2K4J A;  2ME6 A;  1MH3 A;  4YRV A;  5EGO B;  4XBF A;  4IHY A;  5ICF A;  5FFX A;  1K4T A;  3I3L A;  2XDV A;  4O3M A;  2YPR A;  4EJU A;  1FNN A;  2CW8 A;  2KKO A;  2Y75 A;  4G8X A;  2KRH A;  2EZK A;  2VL8 A;  4UB8 C;  1R5I D;  1XMK A;  4HYE A;  5CQE A;  2G0E A;  3ZMD A;  2R0Q C;  3BG6 A;  2L9N A;  1SAX A;  1HF0 A;  5C4X J;  1XCV A;  5IT9 K;  3DKY A;  1AOY A;  4Q48 A;  4EQQ A;  1OCO H;  4IOA F;  4LG0 A;  4IF4 A;  4YII A;  2KPM A;  1P9Q C;  3DTK A;  2BHZ A;  2K9M A;  3OR2 C;  1PP8 F;  4HLX A;  1V5G A;  1DU0 A;  3E6D A;  1DDN A;  1PYV A;  3OY9 A;  5DM6 F;  2WBM A;  4MTD A;  3KZY A;  2JZY A;  1GXP A;  1BA5 A;  4AIH A;  1C0W A;  1FBS A;  3K1N A;  3U2R A;  4CCL A;  1YIO A;  1EH7 A;  2K7L A;  1NHA A;  2M87 A;  5BPD A;  4I2O A;  4OAY A;  4IRH A;  2K85 A;  3I0T A;  2A5Y B;  3FHZ A;  2M9H A;  3GZN B;  2KDZ A;  1ETO A;  3ABM H;  4BDZ A;  1FBQ A;  4PK4 A;  3HTS B;  3ZPL A;  3LA3 A;  2ECC A;  4E7K A;  1RUO A;  3WE3 A;  2NVU B;  2XAJ A;  2FNA A;  1ZRE A;  2KP6 A;  4BUP A;  5HDN A;  1MD0 A;  5F1R A;  2KIU A;  2OA4 A;  1W7P D;  1ETK A;  4RBO A;  4DW6 A;  3FBI B;  1WGX A;  3EDP A;  4N4N B;  5L3F A;  4M9S A;  5EJC A;  2OD5 A;  3NQO A;  3V7R A;  4C9Y A;  2DO7 A;  3REO A;  2NYX A;  1T2K A;  2K9N A;  2X1C A;  1V4R A;  1MJ9 A;  4HX7 A;  5FKK A;  1HSJ A;  2RDP A;  4FET A;  2O9L A;  3IAS 2;  4MEY F;  1J59 A;  4GYG A;  3KP2 A;  4RGS A;  1IV8 A;  1QZZ A;  1LVA A;  3HZJ A;  2EV6 A;  3KIO A;  1LNW A;  2MA3 A;  4G7O F;  2E60 A;  1XG1 A;  2L01 A;  1ITY A;  2P7C B;  1G3W A;  5HNH A;  2QGU A;  1V3F A;  2VBZ A;  4BJ5 C;  3M3Y J;  5DUK A;  4Y3O A;  2J5O A;  4ZYD A;  3HOX J;  1IF1 A;  4IQ4 A;  4CDG A;  4XOP A;  3C3W A;  4PJN A;  3WU2 C;  2DQL A;  2WAD A;  2DFI A;  3E6M A;  5L3G A;  1JUM A;  4NDL A;  1U0J A;  1T33 A;  2G7U A;  3HPH A;  3ZQC A;  4BQN A;  3S93 A;  4OIP F;  3TDZ C;  2DA3 A;  3G1O A;  2ZJR F;  3FIS A;  4S05 A;  1TWF J;  4Q4Z F;  1RKT A;  2NS7 A;  1R1V A;  1GT0 C;  5IYD J;  3VSL A;  1O57 A;  5A2Q K;  5FLM J;  5HS9 A;  4Y17 A;  3F21 A;  4QPO A;  4H0E A;  2MAB A;  4A6E A;  3H9J A;  2HTJ A;  4M6X A;  1OKR A;  4XLN F;  3JRB A;  4UUV A;  2NRA C;  2EH3 A;  2KLO A;  3CCS I;  1IUF A;  3DKX A;  3DPU A;  3PL8 A;  4P5O A;  3DBR B;  1LDJ A;  1U5T A;  4L9J A;  3HXL A;  3RKY A;  1XDU A;  3TW6 A;  3L09 A;  5GP9 A;  3PNT A;  5KAF C;  2DW4 A;  1A6I A;  4RDU A;  3K70 C;  1QU3 A;  4RGU A;  4P1W A;  3OWT A;  2DT6 A;  1SMY F;  2PG4 A;  4M9X A;  3WHB A;  4X0G A;  4BHC A;  2ELK A;  4YIR X;  1ZG1 A;  1X2N A;  2MC4 A;  1OCP A;  3IV5 A;  3KLN A;  3QU6 A;  3JRF A;  4XMY A;  3CD6 I;  3O2P E;  4WXH A;  5D4S A;  1D1C A;  1TNS A;  2YR2 A;  3BOQ A;  2VON A;  5IYB J;  4ZZL A;  1X3W B;  2X6O A;  3KE2 A;  4U0V A;  3A1Y A;  3CUQ B;  3S3O A;  1FOW A;  4A6D A;  3L2U A;  2LVS A;  3OYH A;  1MBE A;  1K79 A;  2QEN A;  1YX3 A;  3T8T A;  1QVU A;  1UJ8 A;  3F3X A;  3LMM A;  4QSH A;  1K83 J;  2FBH A;  4ZYH A;  4HF2 A;  2CUE A;  1MNE A;  2NNY A;  2FQ4 A;  3S32 A;  2R5Z B;  2PQ8 A;  5CVR A;  3AG3 H;  1LPQ A;  4K2E A;  5DV5 A;  1N25 A;  1FOK A;  2F5C A;  2PMZ A;  1B4A A;  1IG7 A;  2K9Q A;  4P9F A;  2X6X A;  1FMW A;  1GUU A;  2PEX A;  4ETS A;  4A12 A;  4A2U A;  4BY1 J;  2QKM B;  5JHF A;  1UZC A;  4M73 A;  1ZLK A;  1FYK A;  4DBR A;  2FBK A;  4G9Y A;  1OMI A;  4HLY A;  1MMG A;  3GTK J;  1KYW A;  4UUT A;  3BPX A;  1SFK A;  2QQB A;  3AG2 H;  2IPQ X;  3RDI A;  4ESF A;  2CSO A;  2PX9 A;  3L00 A;  4Y33 A;  2HVS A;  1T39 A;  3ZQ7 A;  5K7F A;  3HGY A;  3GTJ J;  4BE1 A;  1HA8 A;  3BLY A;  4ZZD A;  3RKW A;  4M3G A;  1UG2 A;  3V42 A;  3PIO F;  5LGN A;  4DZJ A;  3BR6 A;  2G7H A;  3J7A Y;  3BJA A;  2DU9 A;  1Y39 A;  3H36 A;  1T08 B;  4QTR A;  3FM5 A;  3G6E I;  5JLW A;  1POG A;  2YX4 A;  1KU9 A;  4IHT A;  4GXO A;  1BR4 A;  4XRS A;  1ODD A;  2P5L C;  3RCO A;  3BDD A;  4JBA A;  5GAG J;  4XOT A;  1R9T J;  3MKL A;  1S6L A;  5H2F C;  3TKY A;  3QPL A;  3DU6 A;  5IPA A;  3CP2 A;  2O8K A;  2FF4 A;  1S7O A;  1L0O C;  4WXC A;  1BR2 A;  4YIF A;  4XRM A;  4G12 A;  3MWM A;  4KIF A;  2HXI A;  5ICE A;  5LEK A;  3OYK A;  2VOP A;  3X2Q H;  1SD4 A;  3JRC A;  2DTR A;  3OYI A;  2BVL A;  3UNG C;  2VPR A;  4L0Y B;  1KQ8 A;  1WFX A;  2Y31 A;  3KZZ A;  3MZ8 A;  3HG9 A;  2CQK A;  3SJM A;  4QPQ A;  4I0A A;  1J5Y A;  3TOB A;  3GTL J;  5LLQ A;  2GA1 A;  2WAQ A;  2DAO A;  4PCQ A;  2O0Y A;  3A02 A;  2H8W A;  3GO5 A;  4AC0 A;  2QBY B;  2ZNZ A;  3J81 Z;  2VT3 A;  2R7D A;  2LYC A;  1J2X A;  4BS9 A;  1BIA A;  5AIP A;  4UV8 A;  1J75 A;  5DM7 F;  1IDY A;  4NQW B;  5F64 A;  2BEO A;  2PJP A;  1GHC A;  5CVI A;  3KPH A;  3I53 A;  1RES A;  1XGN A;  2E19 A;  3HEF A;  4S0H B;  2HDW A;  1YRN B;  2XKO A;  1RKW A;  2G9W A;  3ZMU A;  2ECB A;  2PBI A;  1TLH B;  1ZRD A;  1A04 A;  2EIK H;  2LRE A;  3I59 A;  1SVO A;  2MD0 A;  1S29 A;  1WJD A;  3FHN A;  1K6O A;  1EH8 A;  4C3H J;  3DF8 A;  5DD8 A;  2L9R A;  4PZJ A;  5DDG A;  5JI6 A;  1ZHF A;  4WX9 A;  5EDN A;  3CLQ A;  1J7K A;  2OQG A;  1R23 A;  4PJM A;  1G59 A;  4JX6 A;  3CCY A;  2DA7 A;  3TOA A;  2R3S A;  4HX4 A;  4HQM A;  4IKF A;  2KT0 A;  2DOF A;  2E1O A;  5ED4 A;  1VQO I;  4A3K J;  1QO0 D;  4L18 B;  3RTR A;  1FTT A;  3F6V A;  3K6G A;  3EQL F;  2ID3 A;  2ZKZ A;  3CJT B;  1WRJ A;  2V9P A;  2RQP A;  4PJ0 C;  4U87 A;  3H5R A;  4V2F A;  1ENH A;  1BW6 A;  3G1M A;  1USS A;  2MH2 A;  5EG0 B;  1TL8 A;  4A3E J;  1WJF A;  2L0K A;  1SEU A;  3DQV C;  5GPA A;  2ZJ2 A;  3PQJ A;  3T5X A;  4Y15 A;  3CCM I;  3PNV A;  5FRO A;  1GXQ A;  1MND A;  3H1C A;  3HIF A;  4B8X A;  4JYK A;  2UV1 A;  4QLC U;  1HKT A;  3PNY A;  3CQZ J;  1W1W E;  2FQ3 A;  1QPI A;  2NS0 A;  4F93 B;  3R0J A;  2EK5 A;  1JUP A;  2AXL A;  4XKB A;  3ECH A;  2B0L A;  3DPL C;  4A5M A;  4II2 A;  2VJ4 A;  2L7F P;  4IPA A;  4RAF A;  4AVP A;  5J4Y A;  5D4R A;  2FA5 A;  5F1J A;  5M5Y J;  1OYY A;  3HSF A;  2HFH A;  3FK6 A;  2R7V A;  3RKX A;  2HEO A;  5DTD A;  1YFH A;  1MW7 A;  3W2W A;  2R7T A;  5EEA A;  3OV8 A;  2F5F A;  1ZEL A;  3HYI A;  1O7L A;  1WH5 A;  1SAN A;  5D6F A;  3BTC A;  3WOD F;  3FBN B;  2P81 A;  2VT2 A;  3QYB A;  1OYI A;  5J6X A;  2GA2 A;  3SYT A;  3I55 I;  1R4N B;  1B72 A;  2DFE A;  4LLN A;  4JX5 A;  1OCC H;  4M3F A;  4O6J A;  4Z2Y A;  3L2W A;  3MEX A;  4XIC A;  2CUZ A;  4ZJZ A;  2O6G E;  2LKP A;  3P7N A;  3V7C A;  3ZXS A;  1YE9 A;  1YG2 A;  2HOE A;  4UVA A;  4MQV A;  4U88 A;  4B09 A;  1MJB A;  3CCR I;  1HDD C;  2P7V B;  4UY8 I;  1UG0 A;  1Z77 A;  2IA2 A;  1FY7 A;  1Y1W J;  1WI9 A;  2E5N A;  4XLH A;  1BL0 A;  4LIT A;  3TL4 X;  2GAU A;  2Z1D A;  1MMD A;  2D2W A;  3TBI A;  2FD5 A;  2Y9Y A;  2JQ7 A;  3A2K A;  4CO8 A;  2QLZ A;  2LOO A;  3RIR A;  4GO1 A;  4BH9 A;  2EFQ A;  2R7Z J;  4EJO A;  2OZU A;  1LB2 A;  4EJT A;  2O3F A;  2COM A;  1D5V A;  2EB7 A;  1RC9 A;  2CRG A;  3K9T A;  4D1Q A;  1P4X A;  4MEX F;  2ZXJ A;  1R49 A;  1FTZ A;  1IRX A;  1IV6 A;  5FKM A;  4BL0 B;  1BC8 C;  4BU2 A;  1K78 B;  2XSJ C;  2BY1 A;  2MLG A;  3E1S A;  3GWZ A;  2HQN A;  2E34 A;  2O7O A;  3FXQ A;  2COB A;  1LDD A;  3BR5 A;  3CDI A;  2Z33 A;  5C4J J;  1AKH A;  2FX0 A;  3VYR B;  2YU9 J;  2VQL A;  1R22 A;  1R6R A;  3K1M A;  3WGH A;  2W7N A;  5CVJ A;  3QRF F;  3BQY A;  1V54 H;  2M45 A;  1W36 D;  2EV5 A;  1IXC A;  2CYY A;  3S1M J;  2DK5 A;  2QF7 A;  1XPX A;  2ACJ A;  1NK2 P;  1QRY A;  2DYR H;  3FWE A;  2M7A A;  1V5E A;  2KIF A;  3TO7 A;  2FEZ A;  2CGP A;  2JSC A;  1APL C;  4A0Y A;  5E1W A;  4CCK A;  2XHK A;  1TT5 B;  2E7X A;  5HOO A;  3COA C;  5JHU A;  4AVZ A;  1Y6I A;  2TDX A;  1BIB A;  3BTL A;  4IJA A;  4G6Q A;  4DZP A;  1A5J A;  2V1N A;  1Z0X A;  5B66 C;  1H8A C;  4RM2 A;  4C30 A;  4KN7 X;  1P6R A;  2K9L A;  2W82 A;  4OOI A;  2X9D A;  3V8K A;  1LEA A;  3BG5 A;  2W1O A;  1FWZ A;  5B1B H;  1JTY A;  3CCU I;  3ASO H;  2DA6 A;  2KL4 A;  1TZL A;  4ZDO A;  2ZME A;  4LIV A;  5K7Z A;  3OSG A;  3KP7 A;  2CQX A;  3IRR A;  2MYS A;  2HS5 A;  3L2R A;  3S17 J;  4LB6 B;  1VND A;  2RGV A;  5E1Z B;  1Z7L A;  1MBG A;  5LBQ A;  4XLP F;  2J5P A;  2D1H A;  2PJR A;  5ICC A;  4IZZ A;  2W00 A;  3CJR B;  2XVC A;  3ZGK A;  2VJ5 A;  4ITV A;  1XC5 A;  3W2A A;  3LL7 A;  3JAM Z;  2Y0S A;  2JA8 J;  4U7B A;  3CLO A;  3NAU A;  3T0Y A;  3A01 A;  2LKX A;  4BXU A;  3CCJ I;  3B02 A;  4XKC A;  3OIQ A;  1PJR A;  2CV0 A;  2JA6 J;  1JI8 A;  3LSG A;  4A5N A;  4L5E A;  2Z9O A;  2HGC A;  4WCG A;  3GZ6 A;  1B9M A;  4A3I J;  1VQM I;  3OSF A;  3U1D A;  5IP9 J;  1ONV A;  1NK3 P;  3I71 A;  2P0W A;  2Y0M A;  4ZYE A;  2D45 A;  4PGH A;  1XN7 A;  4RB3 C;  1B8I A;  4LG0 B;  2L5Q A;  3OYD A;  5BMZ A;  1OPC A;  2EIM H;  1IN4 A;  4A0Z A;  1XD7 A;  2IP2 A;  4O5V A;  2GM4 A;  2VOD A;  3KZI C;  3N4M A;  5TJJ A;  4AM3 A;  2JA5 J;  3KYD B;  3KLO A;  1I1G A;  2M7B A;  2F5D A;  2PMZ N;  2KDO A;  4A0X A;  3K4N A;  3C2B A;  2MBF A;  4MFE A;  4F92 B;  1PUF A;  4J00 A;  5F0H A;  2RAE A;  3CC7 I;  3TW7 A;  1RRJ A;  5M3M J;  3CP8 A;  4IHS A;  4DJA A;  1O7F A;  3M8E A;  3E3V A;  2M1B A;  1Y8R B;  3GFI A;  1I1S A;  1MBH A;  4RAZ A;  1Z3Y A;  4E7L A;  3FM3 A;  1MBK A;  4AUX A;  3PUF A;  5D5U B;  1O3Q A;  3MN2 A;  3CTA A;  1STZ A;  2JA2 A;  4L9N A;  2AS5 F;  1Z6R A;  2Y2Z A;  3G71 I;  2VXD A;  3HRT A;  3HB9 A;  4KIS A;  5D8L B;  2BE5 F;  3E6B A;  3KET A;  3RJP A;  3MKY B;  3W2V A;  5GTH C;  1HOM A;  4XL9 A;  3GTO J;  2BW3 B;  3TP0 A;  3Q5F A;  5EZG A;  2L54 A;  2K5C A;  4RM3 A;  2OTJ I;  1LVK A;  4CA0 A;  2DOE A;  1JJ8 C;  2A07 F;  2STW A;  4AID A;  3GCM A;  4KIG A;  2DOA A;  3FF5 A;  4YG2 F;  3AAF A;  3LSP A;  4BQA A;  1LUJ B;  1FYL A;  4HX8 A;  5KNL A;  2JPB A;  5FO5 A;  4CZC A;  4E7I A;  1W4M A;  1SD7 A;  4PSW A;  2LBF B;  3SEQ A;  2K9S A;  4I01 A;  3HOY J;  4N9H A;  3CDL A;  2H1K A;  1XS9 A;  2LP0 A;  2GBY A;  1SD5 A;  4HF0 A;  2F5E A;  2JN6 A;  3CO6 C;  1TBX A;  3IWZ A;  2OPT A;  5K7H A;  1Z7U A;  3I9V 2;  3DEW A;  1U3E M;  1H9G A;  2BGC A;  4XK4 A;  4CYC A;  3BG7 A;  2H6C A;  2XAF A;  2JK3 A;  2XGX A;  4RA2 A;  2R92 J;  2Y30 A;  4F55 A;  3VYT B;  3F8B A;  2XRO A;  1OFC X;  4CCM A;  1LDK B;  1CGP A;  3HUG A;  3FXL A;  4B4C A;  4DQ2 A;  3DEU A;  5K5Q A;  3P9K A;  4CHU A;  1U9N A;  2NOG A;  3G1L A;  3BZK A;  3WTV C;  1VQ7 I;  1U5T B;  2FNP A;  2P4W A;  3IH4 A;  1R7J A;  3BJ6 A;  3LSK A;  4JQF A;  4B47 A;  4M74 A;  2WAQ N;  2XAG A;  4MO7 A;  4Q5S F;  3OYC A;  4BJ6 C;  1OYW A;  1TWG J;  2X51 A;  3EET A;  1ZQ3 P;  5CLS A;  1K61 A;  2ZNY A;  3VSK A;  4RGX A;  4CIC A;  3S2H J;  2LDU A;  1G3T A;  1U6G A;  1DQU A;  3HOS A;  1WJE A;  3GBG A;  3ECO A;  3FZV A;  2HPM A;  5E8G A;  2ICW G;  2GWR A;  2LF7 A;  3B6C A;  1ZK8 A;  4XKV A;  3KFW X;  4FE4 A;  2M8G X;  1D5Y A;  3JRI A;  2IS1 A;  3TP3 A;  5FGM A;  1W7P B;  5DCM A;  3JR9 A;  5F0C A;  4WF2 A;  2W85 A;  3OYF A;  4E4H A;  3C1D A;  3RKQ A;  3WHC A;  3GEZ A;  3BTI A;  5DS9 A;  1HW1 A;  2I10 A;  3JRD A;  4ZTJ A;  3TO6 A;  1QPM A;  3K4J A;  2NVT J;  4X1E A;  3U21 A;  2HR3 A;  5DUI A;  2NNN A;  5LGT A;  4R8H A;  3W6J B;  1TTY A;  1X4O A;  2CUF A;  4HV6 A;  3DKW A;  1YW7 A;  1IJW C;  3CMY A;  5LHH A;  2M30 A;  1Z6T A;  4GCV A;  1NG6 A;  3QOE A;  3VOD A;  3CES A;  3VYS B;  1FPQ A;  3H9G A;  1JXS A;  5LFA A;  1YLF A;  4KIB A;  2DOD A;  3I4M J;  3V8J A;  1YS7 A;  5H20 A;  5K1Y A;  4A3F J;  3OYN A;  5D5V B;  3BR1 A;  1ETY A;  1Q1H A;  1FOY A;  2LSO A;  1IXS B;  1JT0 A;  2JSP A;  1YX5 A;  2L4A A;  1D3Y A;  2XRN A;  2ZFU A;  3D5S C;  2NVQ J;  3IKV A;  4CGZ A;  1R1U A;  5LD2 C;  1M1E B;  3E5Q A;  2HDC A;  2JA7 J;  1UHM A;  1G6N A;  4D5F A;  4XSX F;  5E3N A;  2H27 A;  1GVJ A;  1E3O C;  5LRR A;  2CU7 A;  5JFR A;  5EGO A;  4EGZ A;  1J09 A;  2MGQ A;  4HAM A;  5F27 A;  5BPI A;  2VC0 A;  2DYS H;  5FKL A;  3LSM A;  2IXS A;  1LFP A;  1Y56 A;  2EA4 A;  4LK0 F;  3MVP A;  4A69 C;  4HW0 A;  3MAJ A;  3FIW A;  1E3H A;  2OC6 A;  3BCB A;  1FP1 D;  3ZMT A;  1KU3 A;  1J9I A;  3CO7 C;  2YS9 A;  1YJW I;  3HRU A;  2WTE A;  5F0F A;  3V7S A;  1U8B A;  2R7O A;  1WJB A;  2QVO A;  5BOX A;  3C18 A;  4MGR A;  2IW5 A;  1GV2 A;  4II3 A;  4L5J A;  2VE9 A;  1I39 A;  5FD5 A;  1U5T C;  2L7Z A;  5AIQ A;  2A6E F;  3LSI A;  1U8R A;  3J7A O;  5IT9 Z;  2DFF A;  3BY6 A;  3H35 A;  3LA7 A;  3S3N A;  2RVC A;  4CUG A;  3SFI A;  4BGD A;  3HSR A;  5JR3 A;  4HV5 A;  4LFU A;  4NBQ A;  3RPQ A;  1IAW A;  3ZQF A;  4BEH A;  4HDV A;  3DCF A;  1P7J A;  1EKE A;  2Z3Y A;  3H9Q A;  1WKM A;  1Y0N A;  3HDD A;  3MKZ A;  4RLF A;  4ABZ A;  3LQQ A;  1A31 A;  2VUM J;  3KX2 A;  1G8X A;  1SVM A;  4LLL A;  1BJZ A;  2HWV A;  2R5Y A;  2L7M P;  1D8K A;  1GDT A;  1VQL I;  1R00 A;  2DFH A;  6PAX A;  3C2G A;  1QGP A;  4DNC A;  1X1B A;  4RS8 A;  3JRA A;  2DT7 B;  3S2D J;  4ZDP A;  3MMY B;  4PSX A;  3HOZ J;  2YUS A;  2Z5U A;  4AD9 A;  1MKM A;  2CO5 A;  2CFX A;  5CJ9 A;  4JK1 X;  3WE2 A;  1HW5 A;  2V6E A;  1LE8 A;  2LY1 A;  1R5H A;  4L9T A;  2K86 A;  3ERM A;  2HVQ A;  1YIJ I;  2DMQ A;  1IRF A;  4KIC A;  2CV1 A;  3I59 B;  2AHQ A;  4I76 A;  2HNH A;  4IHX A;  4EJV A;  5HS8 A;  2CMP A;  1A35 A;  1D0Y A;  2LRD A;  3DXJ F;  5EEG A;  4HZF A;  4ESB A;  5KK1 A;  1BI2 A;  2EPF A;  3PQK A;  1YJN I;  4LD5 A;  3E5U A;  3MKW B;  2PFB A;  2LKS A;  3OYG A;  2VQH A;  4KJZ A;  1XGM A;  4UNO A;  5M5X J;  3DWL E;  2VPL A;  2EFO A;  2BHY A;  4C2U A;  5EF6 A;  1ZRF A;  2QA4 I;  4C2T A;  1QHG A;  4M6Y A;  4UXN A;  1K4S A;  5B3S H;  4I7H A;  1YHQ I;  2JPC A;  3GW2 A;  1QZY A;  2XRL A;  3JRH A;  2BXZ A;  2M4K A;  4E7Z A;  4HRI A;  2GZW A;  3FXU A;  1FT9 A;  5A2Q Z;  1X1P A;  1MMS A;  5CPR B;  2K4B A;  3HTU A;  1FZP B;  2O5R A;  2Q1Z B;  1F5T A;  1IRG A;  4A3C J;  3IP4 B;  1T0F A;  1IRZ A;  3ZN1 A;  1KU2 A;  5C3E J;  2VLA A;  1FLI A;  2A61 A;  5IP7 J;  2IGO A;  5M3F J;  1W5T A;  2MC3 A;  3DBH B;  3LST A;  2Q2E A;  4HOB A;  2CW0 F;  3WTX C;  3MZH A;  4BHB A;  1MSF C;  2VIX A;  2Y0S N;  3I4N J;  2CS3 A;  2MW8 A;  3RQ4 A;  4KDP A;  3CUQ C;  2EA2 A;  3BC8 A;  4I0B A;  1NG7 A;  1MDM A;  3OIO A;  3CCL I;  2CJJ A;  3Q0V A;  5GAD J;  1FC3 A;  4YEJ A;  3OYM A;  4EVI A;  1Z9C A;  2ESN A;  3ZN0 A;  1FSE A;  2X1E A;  1LFB A;  1S9H A;  2XF6 A;  1ZLJ A;  3HHG A;  2R7Q A;  2X48 A;  5GPC A;  2CG4 A;  4CH7 A;  2W25 A;  2JUG A;  3TGN A;  4C3J J;  1J0R A;  2NVX J;  1K6Y A;  2E36 A;  5E3M A;  4A3M J;  5FRN A;  3E7L A;  2R7X A;  3JW4 A;  2DCE A;  2R5Z A;  3PO2 J;  5D6E A;  3SZT A;  3B6A A;  2M5W A;  4KN4 X;  3HM5 A;  4RLQ A;  2E2J J;  1T6S A;  2K27 A;  2V1X A;  4MHG A;  2BY0 A;  2X0L A;  2XAH A;  3W3C A;  2O03 A;  2IEK A;  4F3Q A;  4IOC F;  5J47 A;  2LG4 A;  2Z2S B;  3Q9S A;  4G7H F;  3WG7 H;  2VQC A;  2V7F A;  2X1D A;  3DU5 A;  2DMU A;  2XC7 A;  4E7J A;  4ESJ A;  1B9N A;  3IL2 A;  1JKR C;  4V19 K;  4MNU A;  2UXN A;  3I5U A;  3QU3 A;  2VB6 A;  4C3I J;  2RNJ A;  2KJC A;  2EZH A;  4IHW A;  4FAS D;  4XLE A;  1RZ4 A;  4JP0 A;  2FMY A;  5FFZ A;  2ZB9 A;  1O3T A;  1FBU A;  2QSG X;  1DPU A;  5LRS A;  1KQ9 A;  4OIN F;  5IOY A;  3G4S I;  1G3S A;  2LR8 A;  2IS6 A;  2BOL A;  4KT6 A;  2ISZ A;  1GVD A;  1YW9 A;  1ZKG A;  4XNF A;  1RR7 A;  4AIK A;  4XN3 A;  3VDX A;  3A0H C;  1IGN A;  2DJN A;  4AIJ A;  2OF7 A;  4XON A;  3I58 A;  4PJL A;  3ZOB A;  1W0T A;  2CW7 A;  3GFM A;  3ESW B;  2L2O A;  1QHH D;  2LNB A;  2ISY A;  2RN7 A;  1AHD P;  1UHS A;  2OCE A;  3GVA A;  4FTH A;  5D8K B;  5JVT A;  3LSR A;  3RYP A;  2BBY A;  1KON A;  1AKH B;  4XM3 A;  1ON1 A;  2OTL I;  5E3L A;  4KMF A;  1IN7 A;  1XMX A;  2HTS A;  2AXT C;  2FBI A;  1O3R A;  4UB6 C;  3N05 A;  3ASN H;  2N8G A;  1IN5 A;  4A3G J;  4AWX B;  5L3B A;  1T98 A;  1LQ1 A;  3WGG A;  3HOU J;  3E97 A;  2EFW A;  4B3X A;  3FXM A;  4HSR A;  2P5V A; 
#chains in the Genus database with same CATH homology
 3QP6 A;  5DYM A;  2HQR A;  3Q9V A;  5HLH A;  1Z91 A;  1B1B A;  3BRO A;  1E17 A;  1I6X A;  4KT5 C;  4ENM A;  3F8N A;  2VC1 A;  4YFN F;  4ENJ A;  1XSX A;  5IT3 A;  2WWY A;  2QUF A;  3BPV A;  2DPD A;  2Q0O A;  2H6B A;  3S2W A;  4KUM A;  1I5Z A;  3P9I A;  3WG9 A;  2ETH A;  2QYO A;  2VBY A;  1SMT A;  3WU1 B;  4BNC A;  2VOO A;  2VXZ A;  5L3D A;  2EFP A;  3T8R A;  4UHT A;  3VOE A;  2UXX A;  2VN2 A;  1SFU A;  1IUY A;  2P8T A;  3SZP A;  1KGS A;  1VTN C;  5LGU A;  3G3Z A;  1ZG5 A;  2NAZ A;  4LB5 A;  1FYM A;  3ZMZ A;  5D5X B;  1ZGJ A;  1FSH A;  2R7F A;  1BBY A;  5DCF A;  2GXG A;  3F72 A;  2KJB A;  1B6A A;  4L9V A;  2QZ8 A;  3L9F A;  4HA8 A;  4EGY A;  2DT5 A;  3GYH X;  3E5X A;  1SD6 A;  3GUD A;  2XKP A;  5D5W B;  4HDU A;  2PLY A;  1KU7 A;  4IRI A;  2H94 A;  2A3S A;  2XAQ A;  1BN5 A;  2V1D A;  4UVB A;  3RPU A;  2V9V A;  1TQI A;  3EUH A;  4NB5 A;  2MH9 A;  4OMY A;  4KFC A;  5E20 A;  2OBP A;  3CUO A;  1XGO A;  1TQM A;  1R58 A;  2CWE A;  3M9A A;  4ZH4 F;  1B59 A;  3FMQ A;  5HLI A;  1I27 A;  2PN6 A;  4FX0 A;  1CF7 A;  4U7D A;  4F7Z A;  2XV4 S;  2JTV A;  1BOA A;  2ZBK A;  5HDG A;  4XSZ F;  1Z05 A;  3EYY A;  1ON2 A;  3TQN A;  5L3C A;  1IN8 A;  3KEO A;  2XIG A;  3KEQ A;  4M71 A;  1BI1 A;  4ENK A;  5FLX K;  5CYV A;  2YU3 A;  3F8M A;  3V8L A;  3F8F A;  1D8J A;  4RB0 A;  3HRS A;  2YX7 A;  1K78 A;  2IJL A;  2FOK A;  5AON A;  3L2C A;  4IRG A;  2Q8K A;  3L7W A;  2DQR A;  4FX4 A;  4EM0 B;  5K5R A;  3M1E A;  3HSE A;  5ERI A;  2HKX A;  5DCM B;  1FP2 A;  1RI7 A;  2RKH A;  4LGW A;  2FSW A;  1HST A;  5TRD A;  1T38 A;  1HBX G;  3RI4 A;  1ZAO A;  2W84 A;  3ZMS A;  4EV0 A;  3NEU A;  4EM2 A;  5L3E A;  1XSV A;  3SQN A;  2HYG D;  2DK8 A;  3BWG A;  3ELK A;  1IN6 A;  5HLG A;  2DI3 A;  2V1U A;  1REP C;  5EEH A;  1Z1D A;  1ZH5 A;  4RB2 C;  1BI0 A;  2STT A;  4BHP A;  2FXA A;  3BJO A;  4LMY A;  3IHU A;  3MFK A;  2WC2 A;  2BYV E;  4U0W A;  1U2W A;  3KCC A;  2O8X A;  3KP5 A;  4R1H A;  5ILS A;  1ZAR A;  3T1B A;  4NHJ A;  3G73 A;  1YYV A;  1WWX A;  1WSU A;  2ZFW A;  3DP7 A;  1P2F A;  3CJN A;  1BJA A;  4CYD A;  2L4M A;  1MJA A;  1HXD A;  3B73 A;  3LWF A;  1WQ2 A;  3QAH A;  5HS7 A;  2UZK A;  1YS6 A;  1DP7 P;  3VEP A;  3NRV A;  3IWF A;  3HOT A;  5FLX Z;  3K1P A;  3KP3 A;  4CZZ A;  2QWW A;  3P9C A;  1ZG3 A;  2OAZ A;  2EWN A;  4OMZ A;  1P4W A;  3DPT A;  5ILV A;  1L3L A;  2FU4 A;  1XB4 A;  1EV7 A;  1R5G A;  3R0A A;  5J8F A;  1UCR A;  3ISP A;  2EV0 A;  2H09 A;  5LEJ A;  5CVU A;  5KVR A;  1LEB A;  3TO9 A;  1FX7 A;  4Q47 A;  1G3Y A;  3MQ0 A;  2V6C A;  3FX3 A;  2UWM A;  4LJZ F;  2VE8 A;  1YO5 C;  4IVN A;  1KQ0 A;  3WTW C;  3K0L A;  2DBB A;  2DPU A;  1ZN2 A;  1IZ1 A;  4G94 A;  2ZO4 A;  5H6R A;  3C7J A;  5FB2 A;  1IXR C;  1PP7 U;  4YFK F;  2QQ9 A;  3J81 K;  2XUB A;  4ZYG A;  1ZRC A;  3JSO A;  1UST A;  4RGR A;  1MDM B;  3DFG A;  4HBL A;  2E1N A;  1W7P A;  1S3J A;  2HYF A;  4ENN A;  4OIO F;  4OU0 A;  1X3U A;  3WU0 A;  1EH6 A;  3PFI A;  1E2X A;  4U0Y A;  3R6S A;  4PDK A;  4EM1 A;  4TV7 A;  2A6H F;  3JTG A;  4LK1 F;  4P55 A;  5H6Q A;  3IC7 A;  3VB2 A;  5F6F A;  3U9G A;  2L3D A;  1SFX A;  4EJW A;  4FT8 A;  5E17 F;  1Y0U A;  2JRT A;  1DUX C;  4E70 A;  5ICG A;  4BAY A;  3F8C A;  4G6D A;  1H9T A;  3ML6 A;  3OOP A;  3WTT C;  2FRH A;  3WTZ A;  5DD4 A;  3H3Z A;  5J8C A;  2ZCW A;  3LAP A;  3RYR A;  3SHF A;  2XAS A;  4WWC A;  3D0S A;  4XRF A;  5E1X A;  2O61 A;  3F23 A;  3CUQ A;  5BQT A;  3IRQ A;  1K7A A;  2RV8 A;  1H0M A;  3ABU A;  4ASN A;  4OIQ F;  2D1V A;  1DPR A;  2MLK A;  3JSP A;  2ESH A;  4HF1 A;  2Y48 A;  4L0Z B;  2DLL A;  4YFX F;  1G4D A;  3QOP A;  5HVQ C;  2PMH A;  2OZ6 A;  3QP5 A;  5LHG A;  4BYY A;  4S04 A;  3WGI A;  2P6T A;  2GXB A;  5HDK A;  1AWC A;  4Y13 A;  3M8F A;  3GF2 A;  1XGS A;  5DEQ A;  3LAJ A;  2E7W A;  4OIR F;  3FMR A;  2YSR A;  2A68 F;  1P92 A;  3ULQ B;  3JTH A;  2KRF A;  5CVV A;  3I64 A;  1RIO H;  3QPT A;  3SFZ A;  1YTY A;  2RC4 A;  3O3K A;  4I02 A;  3TDU C;  3V4G A;  3J80 K;  1XDS A;  1XSD A;  1QQI A;  1U78 A;  2BV6 A;  3GX4 X;  1UB9 A;  4N9I A;  4MTE A;  3O6B B;  4RAY A;  3W6K B;  2K02 A;  3IKT A;  3N97 A;  2EFN A;  2W24 A;  3KP6 A;  2ZME B;  3R60 A;  3JAM K;  3R61 A;  1QBJ A;  4MQ9 F;  1XCB A;  1UFM A;  2QBY A;  1ULY A;  2A69 F;  4R79 A;  5BS6 A;  3ERE D;  4NQW A;  3LQR A;  3BZ6 A;  1TQP A;  1KYZ A;  3CDH A;  4P96 A;  2X4H A;  1YW8 A;  1RUN A;  3GFL A;  3WTU C;  3MCZ A;  3H92 A;  3R4K A;  1CF7 B;  2QM3 A;  1S7A A;  4KMU X;  5E8I A;  3HHH A;  2VBX A;  2PMU A;  3ABT A;  3ZP5 A;  3K69 A;  1XMA A;  3KP4 A;  1PDN C;  5ILU A;  2HZT A;  1BI3 A;  3FXR A;  3BP8 A;  4EMS A;  1TNT A;  3FMS A;  3K2Z A;  1R36 A;  1UHW A;  4FHT A;  2Z99 A;  1LJ9 A;  2JT1 A;  3I4P A;  1HQC A;  1F9N A;  1QNT A;  2V79 A;  1BC7 C;  3LA2 A;  2W57 A;  3M7G A;  4ON0 A;  2MD5 A;  3WTY C;  4D0P A;  1JE8 A;  2P6S A;  5K5O A;  4KNY A;  1JGS A;  4GGG A;  1RNL A;  3J80 Z;  4M72 A;  1JHF A;  4UV9 A;  3H3U A;  4WK8 F;  3EYI A;  3D5L A;  2GIV A;  4I09 A;  1F1Z A;  3VFZ A;  2ADU A;  2HKO A;  4I98 B;  3WTS C;  1MZB A;  2F2E A;  4P9U A;  2ELH A;  2E1C A;  3F22 A;  2IVM A;  2IT0 A;  3GFJ A;  3LFK A;  1R1T A;  4M9Z A;  4G7Z F;  2OQR A;  1HKQ A;  2VBW A;  4IXA A;  1MGT A;  1HW2 A;  1HKS A;  2QQA A;  1ZGA A;  3I54 A;  2IA0 A;  4LLG F;  3GLX A;  4RB1 A;  1F4K A;  1ZYR F;  2C6Y A;  1OR7 A;  1YQA A;  5E18 F;  2OU2 A;  1BM9 A;  2FE3 A;  2L02 A;  2M8E A;  4UVC A;  4PGG A;  2GQQ A;  3GZ5 A;  1O3S A;  3DV8 A;  1TW2 A;  4KA4 A;  1P4A A;  2IRF G;  4N0B A;  2LF8 A;  4WXD A;  1W5S A;  3GXO A;  2PI0 A;  3QPH A;  3ROU A;  1IW7 F;  1PUE E;  1KA8 A;  3SXY A;  5FD6 A;  2FML A;  3ZMV A;  4GYI A;  4L5I A;  1S8N A;  4CXF A;  4HQE A;  2P5K A;  2WV0 A;  3F6O A;  3HRM A;  2EJR A;  3E6C C;  1SFE A;  4KYW A;  1JHH A;  2IA1 A;  3MZY A;  5LHI A;  4QWQ A;  1TW3 A;  2KIM A;  2K4J A;  4XBF A;  5ICF A;  5FFX A;  4O3M A;  2YPR A;  4EJU A;  1FNN A;  2KKO A;  2Y75 A;  4G8X A;  1XMK A;  4HYE A;  3ZMD A;  1SAX A;  1XCV A;  5IT9 K;  1AOY A;  4Q48 A;  4EQQ A;  4LG0 A;  4IF4 A;  4YII A;  1PP8 F;  4HLX A;  3E6D A;  1DDN A;  4MTD A;  3KZY A;  2JZY A;  1GXP A;  4AIH A;  1C0W A;  1FBS A;  3K1N A;  3U2R A;  5BPD A;  1YIO A;  1EH7 A;  2K7L A;  1NHA A;  2M87 A;  4I2O A;  4IRH A;  3I0T A;  2A5Y B;  3FHZ A;  1FBQ A;  3HTS B;  3ZPL A;  3LA3 A;  1RUO A;  3WE3 A;  2XAJ A;  2FNA A;  1ZRE A;  5HDN A;  1MD0 A;  5F1R A;  2KIU A;  2OA4 A;  1W7P D;  3EDP A;  5L3F A;  4M9S A;  2OD5 A;  3NQO A;  3V7R A;  2DO7 A;  3REO A;  2NYX A;  1T2K A;  1V4R A;  1MJ9 A;  4HX7 A;  1HSJ A;  2RDP A;  4MEY F;  1J59 A;  4GYG A;  3KP2 A;  4RGS A;  1QZZ A;  1LVA A;  4G7O F;  2EV6 A;  1LNW A;  2MA3 A;  2L01 A;  2P7C B;  1G3W A;  2VBZ A;  1V3F A;  5DUK A;  2J5O A;  4ZYD A;  1IF1 A;  4CDG A;  3C3W A;  2DQL A;  2DFI A;  3E6M A;  5L3G A;  2G7U A;  4OIP F;  3TDZ C;  4S05 A;  4Q4Z F;  1R1V A;  1O57 A;  5A2Q K;  5HS9 A;  4Y17 A;  3F21 A;  4H0E A;  4A6E A;  2HTJ A;  4M6X A;  1OKR A;  4XLN F;  4UUV A;  2NRA C;  4P5O A;  1LDJ A;  1U5T A;  4L9J A;  3RKY A;  1XDU A;  3L09 A;  2DW4 A;  4RGU A;  1SMY F;  2PG4 A;  4M9X A;  4BHC A;  1ZG1 A;  3KLN A;  3QU6 A;  3O2P E;  4WXH A;  5D4S A;  1TNS A;  2YR2 A;  3BOQ A;  2VON A;  4ZZL A;  3KE2 A;  4U0V A;  3CUQ B;  4A6D A;  1K79 A;  2QEN A;  3T8T A;  3F3X A;  2FBH A;  4ZYH A;  4HF2 A;  2NNY A;  2PQ8 A;  5CVR A;  4K2E A;  5DV5 A;  1FOK A;  2F5C A;  1B4A A;  4P9F A;  2PEX A;  4ETS A;  4A12 A;  4A2U A;  4M73 A;  1ZLK A;  1FYK A;  2FBK A;  4G9Y A;  1OMI A;  4HLY A;  1KYW A;  3BPX A;  2QQB A;  2IPQ X;  3RDI A;  4ESF A;  2CSO A;  3L00 A;  1T39 A;  3ZQ7 A;  4ZZD A;  3RKW A;  5LGN A;  2G7H A;  3BJA A;  2DU9 A;  3FM5 A;  2YX4 A;  1KU9 A;  4IHT A;  4GXO A;  1ODD A;  2P5L C;  3BDD A;  4JBA A;  1S6L A;  3TKY A;  2FF4 A;  1S7O A;  1L0O C;  4WXC A;  4YIF A;  3MWM A;  4KIF A;  5ICE A;  5LEK A;  2VOP A;  1SD4 A;  2DTR A;  4L0Y B;  1KQ8 A;  3KZZ A;  2CQK A;  4I0A A;  1J5Y A;  3TOB A;  5LLQ A;  2GA1 A;  2DAO A;  4PCQ A;  2O0Y A;  3GO5 A;  2QBY B;  2ZNZ A;  3J81 Z;  2VT3 A;  2R7D A;  1J2X A;  1BIA A;  5AIP A;  4UV8 A;  1J75 A;  2PJP A;  5F64 A;  1GHC A;  2BEO A;  5CVI A;  3I53 A;  1XGN A;  2XKO A;  2G9W A;  3ZMU A;  2PBI A;  1TLH B;  1ZRD A;  1A04 A;  3I59 A;  1S29 A;  1K6O A;  1EH8 A;  3DF8 A;  5DD8 A;  4PZJ A;  5DDG A;  5JI6 A;  1ZHF A;  4WX9 A;  1J7K A;  2OQG A;  1R23 A;  3TOA A;  2R3S A;  4HX4 A;  4HQM A;  5ED4 A;  1QO0 D;  4L18 B;  3RTR A;  3F6V A;  3EQL F;  2ZKZ A;  1WRJ A;  2RQP A;  1USS A;  2MH2 A;  3DQV C;  2ZJ2 A;  3PQJ A;  3T5X A;  4Y15 A;  1GXQ A;  3HIF A;  4B8X A;  4QLC U;  1HKT A;  2FQ3 A;  2NS0 A;  3R0J A;  2EK5 A;  2AXL A;  3ECH A;  2B0L A;  3DPL C;  4A5M A;  4AVP A;  5D4R A;  4IPA A;  2FA5 A;  1OYY A;  3HSF A;  2HFH A;  3RKX A;  2HEO A;  1YFH A;  3OV8 A;  2F5F A;  3HYI A;  1O7L A;  5D6F A;  3WOD F;  2VT2 A;  1OYI A;  5J6X A;  2GA2 A;  4LLN A;  4O6J A;  4Z2Y A;  3MEX A;  2O6G E;  2LKP A;  3P7N A;  3V7C A;  1YG2 A;  2HOE A;  4UVA A;  4MQV A;  4U88 A;  4B09 A;  1MJB A;  2P7V B;  2IA2 A;  1FY7 A;  1WI9 A;  2GAU A;  2D2W A;  4CO8 A;  2QLZ A;  3RIR A;  4BH9 A;  4GO1 A;  2EFQ A;  4EJO A;  2OZU A;  1LB2 A;  4EJT A;  2O3F A;  2COM A;  1D5V A;  2EB7 A;  3K9T A;  1P4X A;  4MEX F;  2ZXJ A;  1BC8 C;  1K78 B;  2MLG A;  3GWZ A;  2HQN A;  3FXQ A;  1LDD A;  2Z33 A;  1R22 A;  3K1M A;  3WGH A;  5CVJ A;  3QRF F;  2M45 A;  2EV5 A;  1IXC A;  2CYY A;  2DK5 A;  2ACJ A;  3FWE A;  2KIF A;  3TO7 A;  2FEZ A;  2CGP A;  2JSC A;  4A0Y A;  5E1W A;  2XHK A;  2E7X A;  5HOO A;  3COA C;  5JHU A;  2TDX A;  1BIB A;  4IJA A;  4G6Q A;  4KN7 X;  1P6R A;  4OOI A;  3V8K A;  1LEA A;  1FWZ A;  2ZME A;  3KP7 A;  3IRR A;  2HS5 A;  4LB6 B;  2RGV A;  5E1Z B;  5LBQ A;  4XLP F;  2J5P A;  2D1H A;  5ICC A;  2XVC A;  3JAM Z;  4U7B A;  3CLO A;  3T0Y A;  4BXU A;  3B02 A;  4A5N A;  2Z9O A;  2HGC A;  4WCG A;  3GZ6 A;  1B9M A;  3U1D A;  1ONV A;  3I71 A;  2Y0M A;  4ZYE A;  2D45 A;  4PGH A;  1XN7 A;  4RB3 C;  4LG0 B;  5BMZ A;  1OPC A;  1IN4 A;  4A0Z A;  1XD7 A;  2IP2 A;  4O5V A;  2VOD A;  3N4M A;  5TJJ A;  3KLO A;  1I1G A;  2F5D A;  4A0X A;  2MBF A;  4IHS A;  1O7F A;  3M8E A;  3E3V A;  2M1B A;  3GFI A;  1I1S A;  4RAZ A;  3FM3 A;  5D5U B;  1O3Q A;  3CTA A;  1STZ A;  2AS5 F;  4L9N A;  1Z6R A;  3HRT A;  5D8L B;  2BE5 F;  3E6B A;  3KET A;  3RJP A;  3Q5F A;  2L54 A;  2STW A;  2A07 F;  4KIG A;  3FF5 A;  4YG2 F;  3AAF A;  4BQA A;  1FYL A;  4HX8 A;  2JPB A;  5FO5 A;  1W4M A;  1SD7 A;  4I01 A;  4N9H A;  1SD5 A;  4HF0 A;  2F5E A;  3CO6 C;  1TBX A;  3IWZ A;  1Z7U A;  1U3E M;  1H9G A;  2BGC A;  2H6C A;  2XAF A;  2XGX A;  3F8B A;  2XRO A;  1LDK B;  1CGP A;  3HUG A;  4DQ2 A;  3DEU A;  5K5Q A;  3P9K A;  4CHU A;  3WTV C;  1U5T B;  2FNP A;  2P4W A;  4JQF A;  1R7J A;  3BJ6 A;  4M74 A;  2XAG A;  4Q5S F;  1OYW A;  3EET A;  5CLS A;  2ZNY A;  4RGX A;  4CIC A;  2LDU A;  1G3T A;  1U6G A;  3HOS A;  3ECO A;  3FZV A;  5E8G A;  2GWR A;  2LF7 A;  3KFW X;  5FGM A;  1W7P B;  5DCM A;  4WF2 A;  2W85 A;  3C1D A;  3GEZ A;  1HW1 A;  3TO6 A;  1QPM A;  2HR3 A;  5DUI A;  2NNN A;  5LGT A;  4R8H A;  3W6J B;  1TTY A;  4HV6 A;  3DKW A;  1YW7 A;  5LHH A;  2M30 A;  1Z6T A;  4GCV A;  3VOD A;  1FPQ A;  1JXS A;  1YLF A;  4KIB A;  3V8J A;  1YS7 A;  5H20 A;  5K1Y A;  5D5V B;  1Q1H A;  2LSO A;  1IXS B;  2L4A A;  1D3Y A;  2XRN A;  3IKV A;  4CGZ A;  1R1U A;  3E5Q A;  2HDC A;  1UHM A;  1G6N A;  4XSX F;  2H27 A;  1GVJ A;  5LRR A;  5JFR A;  4EGZ A;  4HAM A;  5BPI A;  2VC0 A;  4LK0 F;  2EA4 A;  4HW0 A;  3MAJ A;  1FP1 D;  3ZMT A;  1KU3 A;  1J9I A;  3CO7 C;  3HRU A;  2WTE A;  3V7S A;  2QVO A;  5BOX A;  3C18 A;  4MGR A;  2IW5 A;  4L5J A;  2VE9 A;  5FD5 A;  1U5T C;  5AIQ A;  1U8R A;  2A6E F;  3J7A O;  5IT9 Z;  3BY6 A;  3LA7 A;  2RVC A;  3HSR A;  5JR3 A;  4HV5 A;  4LFU A;  3RPQ A;  1IAW A;  4HDV A;  2Z3Y A;  1WKM A;  3LQQ A;  4LLL A;  2HWV A;  1D8K A;  1R00 A;  6PAX A;  1QGP A;  4DNC A;  4RS8 A;  2Z5U A;  4AD9 A;  1MKM A;  2CO5 A;  2CFX A;  5CJ9 A;  4JK1 X;  3WE2 A;  1HW5 A;  1R5H A;  4L9T A;  2K86 A;  1IRF A;  4KIC A;  3I59 B;  4EJV A;  5HS8 A;  3DXJ F;  4ESB A;  4HZF A;  5EEG A;  5KK1 A;  1BI2 A;  3PQK A;  4LD5 A;  3E5U A;  2PFB A;  1XGM A;  4UNO A;  2EFO A;  1ZRF A;  4UXN A;  4M6Y A;  4I7H A;  2JPC A;  3GW2 A;  1QZY A;  2GZW A;  3FXU A;  1FT9 A;  5A2Q Z;  2K4B A;  3HTU A;  1FZP B;  1F5T A;  1IRG A;  1T0F A;  3ZN1 A;  1KU2 A;  1FLI A;  2A61 A;  1W5T A;  2MC3 A;  3LST A;  2Q2E A;  4HOB A;  2CW0 F;  3WTX C;  3MZH A;  4BHB A;  4KDP A;  3CUQ C;  2EA2 A;  4I0B A;  1MDM A;  1FC3 A;  4EVI A;  1Z9C A;  2ESN A;  3ZN0 A;  1FSE A;  3HHG A;  1ZLJ A;  2CG4 A;  2W25 A;  3TGN A;  1J0R A;  3JW4 A;  5D6E A;  3SZT A;  2M5W A;  4KN4 X;  1T6S A;  2K27 A;  2V1X A;  4MHG A;  2X0L A;  2XAH A;  2O03 A;  3Q9S A;  4G7H F;  4ESJ A;  3IL2 A;  1B9N A;  4MNU A;  2UXN A;  3I5U A;  3QU3 A;  2RNJ A;  2KJC A;  1RZ4 A;  2FMY A;  5FFZ A;  1O3T A;  1FBU A;  1DPU A;  5LRS A;  1KQ9 A;  4OIN F;  1G3S A;  2ISZ A;  1YW9 A;  4AIK A;  4AIJ A;  3I58 A;  3GFM A;  2LNB A;  2ISY A;  2RN7 A;  3GVA A;  5D8K B;  5JVT A;  3RYP A;  2BBY A;  1ON1 A;  4KMF A;  1IN7 A;  2HTS A;  2FBI A;  1O3R A;  1IN5 A;  4AWX B;  5L3B A;  1T98 A;  1LQ1 A;  3WGG A;  3E97 A;  2EFW A;  2P5V A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...