1OCPA

Solution structure of oct3 pou-homeodomain
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
67
structure length
67
Chain Sequence
METLVQARKRKRTSIENRVRWSLETMFLKCPKPSLQQITHIANQLGLEKDVVRVWFCNRRQKGKRSS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of the Oct-3 POU-Homeodomain in Solution, as Determined by Triple Resonance Heteronuclear Multidimensional NMR Spectroscopy
pubmed rcsb
source organism Mus musculus
molecule tags Dna binding protein
molecule keywords OCT-3
total genus 13
structure length 67
sequence length 67
ec nomenclature
pdb deposition date 1995-02-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00046 Homeodomain Homeodomain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.60 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Homeodomain-like 1ocpA00
1IDYA 1O4XA 3ZOBA 5M5YJ 5K7HA 5GPCA 1U78A 2HYJA 4D5CA 4C3JJ 1GT0C 1LE8A 1HF0A 1RKTA 1XG1A 4BBRJ 1Y1WJ 2DA1A 3G1MA 3LSPA 5JLWA 3HOYJ 1FIAA 1TWHJ 2NS8A 1MH3A 2R5ZB 2N8GA 3VPRA 2M8GX 2XRLA 2L7ZA 1RESA 5FKMA 4IHVA 3CDLA 2K9SA 1EF4A 2LK2A 1UHSA 3PO2J 3PO3J 5E3OA 3S1QJ 2MW8A 4XRSA 4QIWN 2OPTA 1JJ6C 4M3GA 1AKHA 1TWCJ 3SJMA 1FTZA 2LVSA 2ID6A 1H88C 1TC3C 3HGGA 5M3FJ 4X1EA 5M5WJ 4IHYA 2R92J 1W0UA 4ABZA 2E2HJ 1ZTRA 4M3EA 3CMYA 2FQ4A 1E3OC 4J19A 4A3LJ 3L1PA 5IPAA 2QCOA 1JGGA 5EZGA 3S1MJ 1NK3P 3I4MJ 4JX5A 2X9DA 1B72A 5DTDA 2AO9A 1BJZA 4M3BA 1FIPA 2ZB9A 1QVTA 4M3FA 1ETQA 4DZJA 3HDDA 2E19A 2G0EA 2XGDA 5GPAA 3S1RJ 1T56A 1YRNB 5J1UA 3JRDA 2XGCA 3GTKJ 2O8KA 3ZQIA 2DMPA 2EQRA 2WV1A 2PMZN 1IDZA 2JN6A 4D7MA 4DZPA 5FKOA 3QPLA 1VFCA 1H8AC 2EH3A 3M3YJ 1U8BA 2LR8A 3IH3A 5F0HA 2M34A 3S14J 2MG4A 3H0GJ 4IHWA 1P7JA 2XPVA 4C2MJ 2HOTA 3MKLA 1ZR2A 1BW5A 3RKQA 2JWTA 3ZQFA 5IYBJ 5EDNA 3TW7A 5M3MJ 2KT0A 1U9NA 1YRNA 2H1KA 2QF7A 2EBIA 3A01A 5FKKA 4BY7J 4AYBN 1D5YA 1OJLA 3DCFA 1QRYA 5EYRA 3RZOJ 3I4NJ 1F36A 2B63J 2JA5J 2EZLA 3NAUA 4D7NA 3FK7A 4G12A 1Q1VA 4EEFG 1FTTA 3HBLA 4AUXA 1B72B 1CQTA 2JA6J 2Y9ZA 1JJ8C 2XB5A 5FLMJ 4M6VA 3W6VA 2HXIA 5F1JA 1BA5A 1JUSA 2LLKA 2NVQJ 2JA7J 1ZQ3P 2L7MP 2DA7A 5J1RA 1UG2A 2HDDA 3S17J 3O8GA 1JTXA 3WHCA 3O8HA 3S2HJ 2W48A 5FKLA 4JX4A 4MLOA 1R9TJ 3IV5A 2DN0A 4BBSJ 3ZQHA 2DMUA 1A5JA 1MBFA 4XK4A 1FEXA 1NK2P 4A3KJ 1IJWC 2L0KA 3HOUJ 2L7FP 5EZHA 4W1UA 3JRGA 4A3IJ 2R5YB 3BT9A 5E3LA 2ME6A 3SFIA 3JREA 4BXXJ 3BR1A 1K61A 3QPSA 3TEDA 2VUMJ 1ETOA 1GV5A 4DW6A 1POGA 2NS7A 3Q0WA 1Z0XA 2CJJA 2VPRA 2JK3A 1ENHA 4DYRA 2X48A 3A01B 3BR2A 2DMQA 3FIWA 4MIMA 1U9OA 1IV6A 3HOVJ 2YUSA 3BG3A 5E3NA 5E3MA 1A6IA 1AHDP 1Z77A 1RPWA 1MBHA 5IP7J 5IP6A 5IYCJ 2EZHA 2HQ5A 2H8RA 1VI0A 3BTCA 3MN2A 3JRIA 5JLXA 4RDUA 4XRMA 2WB1N 3GTGJ 1APLC 5M5XJ 1JKPC 1RKWA 1X2NA 5HODA 2IEKA 3JRHA 3S15J 1MBKA 3FKIJ 4A3MJ 3TP0A 3S1NJ 1ETVA 1WGXA 4FISA 2I10A 1IC8A 1ZK8A 3HEFA 3BTJA 3A03A 3BR5A 3BG5A 4DYCA 2O7OA 5EGOB 5GP9A 4IHXA 4JP0A 5K7FA 3UKGA 1PUFA 3B6CA 3GTLJ 4C3HJ 2EZKA 1OCPA 5IOYA 2ID3A 3HOXJ 1MBGA 3NARA 1JT6A 1MSFC 1K83J 1MH4A 1ZGWA 1GV2A 3JRFA 2D5VA 1IG7A 4A3FJ 4AC0A 2GBYA 5C3EJ 3HGYA 3D1NI 2DMTA 1ETYA 2ELKA 1FJLA 5IOZA 3G1OA 4L5EA 3ZQGA 4V2GA 1I3QJ 2COBA 1AKHB 5F0CA 1NTCA 5F08A 5IYDJ 2VI6A 4QSHA 4UUSB 1WCMJ 4A3EJ 4MFDA 3BQZA 1IUFA 1JKRC 4IEJA 1JUPA 3B6AA 4M3DA 4BY1J 2LKXA 2IAIA 1VNDA 5EEAA 4B3AA 2R5YA 3HKZN 3DEWA 4DYQA 2IBDA 1BW6A 1X58A 4MO7A 4Y7NJ 4QTRA 2R93J 3JRBA 3ZQCA 2E2IJ 4XICA 4A3DJ 2E1OA 1GVDA 4FE4A 1MNMC 1QVUA 1G2HA 2KDZA 1SANA 4NDLA 5F27A 1WI3A 2TRTA 1TWFJ 3RZDJ 1JTYA 3LSGA 4A93J 1JT0A 2VKVA 2Y2ZA 1LFBA 2LFBA 1ORKA 3LSJA 3OIOA 1MBEA 1MBJA 1HDPA 1RETA 2OF7A 3K2AA 2LD5A 2MGQA 4UUTA 5EF6A 2R5ZA 2M2EA 4RBOA 1HLVA 1X2MA 2YS9A 1ZR4A 3PM1A 2R0QC 1HOMA 3C2BA 2DA4A 4JX6A 1IGNA 2EZIA 1LE8B 3TP3A 4V2FA 5FKNA 3BR6A 3GTJJ 2CUFA 3S16J 2P81A 2CQXA 2M0CA 3OOUA 2JA8J 4B1RA 1JUMA 1OCTC 3MVPA 1H89C 2Y30A 4JYKA 3OSGA 3F0CA 4W97A 2NVYJ 2XSDC 5C4XJ 2GM4A 3G1LA 1AU7A 1BL0A 2Y31A 3SDGA 4CYCB 2DA5A 4LOCA 4D5FA 3BQYA 2GLOA 2HOSA 2M9HA 3FK6A 2DTZA 5C44J 1I50J 4A3CJ 1GDTA 2RAEA 2DA6A 2HOAA 2LY9A 2O9LA 3E7LA 5J3LA 1DU6A 1LFUP 2CU7A 4HNVA 3HOWJ 3GTPJ 3JRAA 3HB9A 3Q0VA 2ME0A 3Q0UA 3BTIA 2ECBA 2NVXJ 1TWAJ 1OFCX 3WHBA 3GBGA 3GTMJ 3GTOJ 4BKXA 5DS9A 3JR9A 2DMNA 3CCYA 2HXOA 1ITYA 3BR3A 1GUUA 4A3JJ 3OSFA 1B8IB 1HDDC 5BNGA 9ANTA 3Q3SA 2XPUA 2CUEA 1WH7A 4GFBA 4X6AJ 1I6HJ 2Y0SN 2X6OA 3BR0A 2FX0A 5F04A 1B8IA 1HCRA 2XGEA 5FLVA 3IH2A 2WAQN 4UUSA 4XIDA 1S7EA 1IRZA 3JRCA 2E2JJ 5K7ZA 2CQQA 3QQAA 4I6ZA 5IP9J 4Y52J 3BG9A 1WPKA 2DA2A 3HM5A 2L9RA 5F0FA 4B4CA 1UMQA 1TWGJ 1XS9A 4FE7A 1VF9A 3GTQJ 2VKEA 3FISA 4C3IJ 2Y9YA 3A02A 1JKQC 2K40A 2LP0A 2K9NA 5C4JJ 3LOCA 1Y1VJ 1ETWA 1MSEC 1DU0A 2FD5A 4MFEA 2XB0X 1SFOJ 1XC5A 1WH5A 3LSRA 1QPIA 1ETXA 3CQZJ 1PUFB 2ECCA 3TW6A 4FTHA 5EGOA 1RR7A 3M4OJ 1ZKGA 2HI3A 2TCTA 4S0HB 2NVTJ 1JKOC 4FCYA 3H3VK 2FJ1A 2MSYA 1F43A 3S2DJ 2AHQA 2K9QA 4XRSG 2R7ZJ 2NOGA 4I76A 3RQIA 1W0TA 2XPWA 2CRGA 2YU9J 4A3BJ 1P7IA 4CYCA 1T33A 5EG0B 5EG0A 2JJ7A 5J1YA 4A3GJ 2DJNA 2LTPA 4A69C 3BTLA 3ZQLA 3HOZJ 2DA3A 5FJ8J 3K7AJ 2JMWA 3IH4A 3LNQA 1ETKA
chains in the Genus database with same CATH superfamily
2ZNYA 3DU5A 2KLOA 2CW0F 1R5GA 3O2PE 1F1ZA 1LB2A 1WQ2A 2GXAA 3W2WA 2HYJA 4DOZA 1U5TB 3GX4X 1R49A 1CF7A 2V6CA 2HVRA 3AG4H 1HF0A 1RKTA 1UELB 2KKOA 1ZHFA 4BBRJ 4XM3A 4CICA 4J01A 4UV9A 5JLWA 4CCLA 2O6GE 1TWHJ 1W5CC 2N8GA 3VB2A 1YITI 3CDLA 3ZRGA 4G6DA 1P4XA 2K9SA 3LAPA 5K5RA 1BR1A 4G6QA 3S1QJ 2MW8A 1P92A 1XCVA 2ICWG 2GXGA 2Q2EB 5E1ZB 4E7KA 3MZ8A 1A04A 3AG2H 4ZJZA 3I64A 4D0PA 1I5ZA 3SJMA 1O7FA 2GA2A 4KISA 4ZZLA 2DK8A 2FMYA 2LVSA 2Y0MA 3IKVA 3HGGA 4E6KG 4X1EA 4KA4A 2XASA 1HW5A 3PFYA 4ABZA 1X1AA 1ZTRA 4M3EA 4U7BA 3BC8A 2QKLB 1E3OC 2GIVA 4WWCA 4Q5SF 4P9FA 2LDUA 1A6QA 5IPAA 4B48A 2CFOA 2VL8A 5EZGA 1TTYA 5KAFC 2D45A 3RPUA 3M1CA 4IKFA 5AONA 4GCVA 1HKSA 2VOPA 3FXUA 4RM3A 1BJZA 4YEJA 2ZB9A 1QVTA 2BE5F 4RGUA 4I02A 2QLZA 3DBHB 4KICA 4MEYF 3VYSB 3CJNA 1GHCA 4YRVA 4MQ9F 2O8KA 2FUG2 2IA1A 2WV1A 3F8CA 1IDZA 2OZUA 4PSXA 4E7SA 1YW9A 5FKOA 5JR3A 5H20A 4YFXF 4E7ZA 2LR8A 5F0HA 3VODA 2M34A 2RN7A 2AXTC 4IHWA 4BYYA 3CO6C 1S7AA 1P7JA 3M07A 1IRGA 2K7LA 3DEUA 1UB9A 4I7HA 4BHCA 2PMHA 4CH7A 2Z16A 1BN5A 2Q0OA 2E34A 2JWTA 4Y15A 5IYBJ 1WJEA 2QF7A 2XRNA 3RZOJ 5AIQA 3WTZA 3QPTA 1PDNC 1YI2I 2VJ4A 4F3QA 4YIFA 5CVIA 3HBLA 4AUXA 4KN4X 5EEGA 3U2RA 3VYUB 2J5PA 1YYVA 1CQTA 4PZJA 2Y9ZA 3JAMZ 1AA7A 4PSWA 3LSKA 2V1DA 2DFHA 2XAJA 2NVQJ 2OJED 1S9HA 2L7MP 3KP5A 5GTHC 2HDDA 2BY1A 3HOSA 3OR1C 5FKLA 1FC3A 3SYTA 3SZPA 2NNYA 3D5LA 4F92B 4BBSJ 2LKSA 2DFIA 3RQ4A 4NC8A 3AL0B 4A3KJ 1EH8A 1I3AA 2NVUB 3DPTA 3ONQA 4IJAA 5EZHA 5HS9A 5TISC 2JQ7A 3JRGA 2RKHA 1IXRC 4M73A 4ZYEA 4WXDA 3BT9A 5E3LA 2ME6A 3TOAA 4RLFA 4E7IA 2DAOA 3W6KB 1K61A 1S3JA 1R36A 3I9V2 4EV0A 3WU1B 4KMFA 1XPXA 1ETOA 1VQ5I 1POGA 2Y0SA 5ICGA 1Z0XA 4KDPA 2GZWA 1Z6RA 2W57A 2CJJA 1DDNA 1E17A 1ENHA 2E1MB 4DYRA 1QPMA 1DPRA 4PK4A 4ZDPA 3CJQB 2KL4A 2XC7A 3A01B 1SFUA 4NQWB 3CDHA 4MIMA 1U9OA 3DPUA 3S3NA 4CCMA 1AHDP 1SFEA 3CCRI 3AG3H 4XKBA 1Z77A 5B5EC 1Z7LA 5IP6A 5IYCJ 2HQ5A 2H8RA 3EUKL 1VI0A 2PFBA 3BTCA 1J7KA 4LB6B 4O5VA 5GAGJ 1FZPB 3K4MA 5JLXA 4RDUA 4E4HA 1Z9CA 2WB1N 2VOOA 3ZQ7A 1S7OA 1W36C 1APLC 5M5XJ 1RKWA 2FF4A 5HODA 1VTNC 2DW4A 4UUVA 3FKIJ 3JSPA 4A3MJ 2RVCA 5BQTA 5LGUA 3J80K 4ZDLA 2K85A 2I10A 2CQ7A 1D8KA 3U1KA 2DK5A 3D5RC 2LSOA 2R4GA 2O7OA 3F8FA 4IHXA 2DT5A 3PUFA 4U0WA 3VYTB 2O8XA 2PBIA 3I58A 2E1CA 2ID3A 3KP7A 5DV5A 2LYCA 1MBGA 2XF6A 1YW8A 1K6OA 4CXFA 3OS0A 2CS3A 1HXDA 4LLNA 2DYSH 1IG7A 4A3FJ 2VJJA 3RI4A 1GXPA 2VODA 3HTSB 2RREA 2EK5A 4KFCA 1OCZH 1DUXC 2G7HA 1V5EA 3HZJA 3KP3A 2HTSA 2QEXI 3KX2A 3D1NI 2DMTA 4LB5A 2NAZA 1MJ9A 5GTIC 3G1OA 4L5EA 3ZQGA 1G3TA 2COBA 4BJTA 1SVOA 1TT5B 3GXOA 4OAZA 5F0CA 5DYMA 1UG0A 4OWRB 4XSXF 2FOWA 3OS1A 3MKZA 5IYDJ 3K1MA 2H8WA 4BH9A 1Q1HA 4LK1F 1OKRA 2D1VA 3BQZA 3GUDA 3M8EA 4OMYA 4BE2A 1R4NB 4M3DA 2X4HA 5BOXA 4BY1J 3WTWC 4II3A 4DYQA 2H6BA 2ISYA 1S72I 2Z33A 2LNBA 2IBDA 1B9MA 5TRDA 3L2VA 1GVDA 3L2UA 4HNTA 2QA4I 2KDZA 2L2OA 1PP8F 4PFPA 3DFGA 2VE8A 3OOPA 2K27A 3BZCA 4CYDA 3UR3C 4LITA 1EH7A 5E20A 2Y2ZA 2LFBA 2Q2EA 3AAFA 3OYIA 2XKPA 1P4WA 4AVPA 3LSJA 4ZYGA 3P9KA 3DBRB 1HDPA 4HX8A 5HLHA 3ZN1A 2LD5A 2YSRA 4UUTA 5JHUA 2O03A 1XGNA 3BG6A 3L2QA 2VJIA 5F64A 3I56I 4YIRX 3U21A 5E18F 2BVMA 4PCQA 5FKNA 3CUQC 3C2HA 2GWRA 2PJRA 2E35A 3T5XA 2DT6A 3RSNA 1CF7B 2L54A 5LEJA 3S16J 1KYZA 2HKXA 4HF0A 4MQVA 4B1RA 1JUMA 3MVPA 1KQ9A 3ABUA 1H89C 2QGUA 4G6TB 1A31A 4LG3A 2RQQA 4EJTA 2QBYB 3GEZA 3D0SA 3DQVC 3HUGA 2VT2A 5HOOA 3J7YJ 2XSDC 3OYEA 3LA3A 1MMNA 2KIQA 3G1LA 1LDJA 2O5RA 4CUGA 4HQMA 4LOCA 2VBWA 1KONA 5L3GA 1VZ0A 3WG7H 1TLHB 4A3CJ 3L9FA 3ELKA 4B09A 3DF8A 4DIQA 4XSZF 3E7LA 1YIOA 3DLLF 1LFUP 1H0MA 1BC7C 1IXSB 3HOWJ 3FXOA 1MJBA 5JFRA 5FFZA 2KIUA 3H1CA 4C2TA 4LLGF 2VB6A 5HLIA 2ECBA 3CCLI 2NVXJ 1TWAJ 2X1EA 3VEPA 1MKMA 2ZKZA 3DBLB 1ZRDA 2EFNA 5B1AH 5EJCA 1ITYA 2P7CB 4KT6A 2F4OB 2EWNA 2OQRA 3E1SA 3TKYA 3CCMI 2XPUA 4B8XA 1WH7A 1ZARA 4EVIA 2KPMA 3VFZA 2XGEA 2VQGA 4HPQA 3KZZA 1MIJA 1V5GA 4XIDA 4UUSA 2AXLA 1LUJB 3PQJA 2E2JJ 5K7ZA 3V42A 3QQAA 5IP9J 2VXZA 2VE9A 3DPLC 1WPKA 1J59A 4ENMA 2Y75A 4L9JA 2KDOA 2HVQA 1UZCA 1OCCH 1UMQA 2IT0A 1FT9A 1C0WA 3GTQJ 3OIQA 2X85A 3BG7A 2ZXJA 3G71I 3Q9VA 1GVJA 3HRMA 1Y1VJ 1YQAA 2P7VB 1ETWA 3ASOH 2V1NA 1TQPA 1DU0A 3W2VA 5ICEA 2FD5A 2NXNB 4MFEA 3ROUA 4Y13A 2W00A 2P8TA 5HDNA 3UNGC 3LSRA 3PFIA 3MEXA 1J2XA 3FHZA 3TW6A 4BXUA 5EGOA 4UV8A 3FXLA 4AU7A 2VXDA 1RRJA 4HG2A 1ZKGA 4M72A 4Y17A 4S0HB 2IGOA 4Y33A 5LD2C 5HVQC 2M87A 1OQYA 4FCYA 3KZIC 4L9TA 2FJ1A 3K9TA 3OR2C 1F43A 2K9QA 3BJAA 2A6HF 3FXMA 3M7GA 4XRSG 2R7ZJ 3L7WA 1EA3A 2OV7A 1YS7A 2XPWA 2IW5A 1W0TA 1XN7A 1WJAA 5LFAA 4CO8A 1OYYA 3QYEA 3X2QH 1FWZA 5J1YA 4A3GJ 3LA2A 2E7WA 4PGGA 1D0ZA 3F8MA 5FJ8J 2BW3A 3DTKA 2PG4A 3IH4A 2CSOA 4HRIA 1RUOA 1G4DA 3F9KA 3HKZA 1W7PA 1Z7UA 3E6MA 2IA0A 2E1NA 1T95A 4P9UA 5GPCA 1U78A 3K1NA 3GFMA 5FD5A 2JRMA 1VQOI 2Z99A 3BJOA 1SD7A 3MQ0A 3LSPA 4LIUA 2NOJB 1FIAA 3OWTA 4CCNA 3L00A 1VQPI 2XUBA 3VPRA 2NYXA 3TDUC 2XRLA 3TO7A 4IHVA 1J09A 2BYVE 3E5QA 1X1BA 1IN6A 2M7AA 4RB0A 2LK2A 1QHGA 1UHSA 2XGXA 5CVUA 2WY8Q 4XRSA 3ABLH 3LMMA 1R22A 4QIWN 2OPTA 3NQOA 1GXQA 2FNPA 2BOLA 3KEQA 1RUNA 3KEYA 2ID6A 2X1DA 1H88C 5M3FJ 2R92J 4P5OA 2GQQA 1P6RA 1ZH5A 4F55A 2DXIA 1MMDA 4G7OF 1BI2A 1ONVA 4BEHA 3QWLA 2K3PA 4MNUA 1K6YA 3L1PA 3ERMA 3J81K 3REOA 3PNVA 1JGGA 2Y48A 3S1MJ 2DFEA 1BI3A 3I4MJ 3ULQB 2X6YA 2CG4A 1ZG3A 2F5DA 4XNFA 4D1QA 2BBYA 2DLLA 4BJ5C 2X9DA 5FB2A 1B72A 4IOCF 5LRSA 3U1DA 1QQIA 1QZZA 3GVAA 1ETQA 1ERDA 4WF2A 5K5QA 1K4SA 3GMEA 1T56A 2JPBA 2OQGA 3H9QA 5J1UA 2XGCA 3LSTA 1YRNB 3N97A 3ZQIA 2HWVA 5J40A 2JN6A 4DZPA 4B47A 2TDXA 3QPLA 1PVEA 1R5HA 1YX5A 1VFCA 2EH3A 3KFWX 4LIVA 4L0ZB 3M3YJ 3PIPF 4WXCA 1MMAA 1U8BA 3S14J 2KISA 3FBNB 4E7HA 4B44A 4XLHA 2WAQA 1RR8C 3GLXA 3MKLA 3CLOA 1BW5A 2R7QA 3RKQA 1FLIA 3ZQFA 2IS1A 3EUHC 2HPMA 2KT0A 2H1KA 1S29A 3OYGA 1YFHA 2EBIA 2FXAA 2HR3A 5FKKA 4AYBN 3DCFA 4AIKA 1USSA 3I4NJ 3FXJA 2B63J 5J4YA 3NAUA 4D7NA 1Y56A 4G12A 2FU4A 1FTTA 3QYBA 1B72B 3TGNA 1SD4A 1E3HA 5FLMJ 4FX4A 1SD5A 3W6VA 2QZ8A 2HXIA 3I59B 5F1JA 3EYIA 2JRTA 2LLKA 3FHNA 2JA7J 2ZNZA 4HV5A 1ZQ3P 1MNDA 3V8JA 2DA7A 4ESJA 1MNEA 2MLGA 5J1RA 4RS8A 1UG2A 3S17J 2MH2A 1B6AA 3E5UA 3U9GA 3S2HJ 3ZMVA 3PIOF 4D9JA 2VN2A 1YG2A 1ZRFA 4OMZA 2DN0A 3IV5A 4UVBA 4HAMA 3EUAA 5CKTA 1MBFA 2OAZA 4XK4A 4ETSA 1IJWC 2L0KA 4KIBA 3HOUJ 2HKOA 4HX7A 2YU3A 5HDGA 3GZ6A 3PUBA 4A3IJ 2JPCA 1XMKA 1MMGA 3SQNA 1P2FA 2R5YB 1FYMA 2X1CA 3VDXA 3SFIA 3CC2I 2HZDA 4ZYDA 3JREA 3PJRA 3E97A 5K1YA 3OYAA 3CC4I 2VUMJ 2B7EA 2CW8A 3FM5A 1W7PD 3OYNA 3K70C 4FQGA 5GAHJ 2IP2A 1V54H 4ASNA 3PNYA 3WTVC 3LL7A 3SEQA 1YX3A 2QSFX 1ZLJA 3CCJI 5JI6A 2FQ3A 3OYDA 1K78B 2EFWA 2PX9A 2QYOA 1ZREA 5IP7J 1IRXA 1D8JA 3FWEA 4EATA 2K02A 2LG4A 1U3EM 3LQQA 1F9NA 3QU6A 3ZP5A 1N77A 2ZJQF 4ZH4F 3CMMA 1BR4A 3P7NA 4PJMA 2IEKA 1QU3A 5H6RA 3S15J 1MBKA 4O6JA 1QZEA 3TP0A 4BE0A 3MZYA 1WGXA 2DPDA 4FISA 2XSJC 3DTIA 4GYIA 1ZK8A 3HEFA 4BU2A 2RNGA 5JHFA 3A03A 2BZTA 3BR5A 3BG5A 1XDSA 5GP9A 5KK1A 4AIHA 4JP0A 2FSWA 3JCUC 2LRDA 2K9MA 4C3HJ 2EZKA 1ON2A 4IVNA 5IOYA 2Y69H 3HOXJ 3V7SA 3PL8A 4J00A 3R6SA 3DKWA 5DCMB 3JAMK 1LVAA 1QHHD 2VJ5A 4ITVA 1L0OC 3S32A 3P5JA 1DGRM 1GV2A 1V5FA 2D5VA 1YHQI 1TW2A 3E6BA 2MFZA 1O3SA 4DBRA 3HGYA 3NWSA 1ETYA 2QENA 2ELKA 2ESNA 1U0JA 3IKTA 1LEAA 5IOZA 4EGYA 3FMRA 1EH6A 2CFXA 4TV7A 4V2GA 5D5VB 3OYFA 1AKHB 2OCEA 5FD6A 1NTCA 3MAJA 3HTUA 1WRJA 1KZHA 1YOVB 2V7FA 4UUSB 3NWTA 4MFDA 4I2OA 2BHYA 4YFKF 1JKRC 4UB8C 1JUPA 3B6AA 1FMWA 1VNDA 5EEAA 2R5YA 3HKZN 3DEWA 1RC9A 5DM7F 4JBAA 2FEZA 4LD5A 4MGRA 2R93J 4I01A 3ZQCA 4PJNA 5ICCA 1PUEE 4BQAA 4BHPA 4RB1A 1MNMC 3CCVI 2L5QA 1QVUA 5F27A 1WI3A 2TRTA 3AKZA 3ERED 3J7AY 3K4LA 2XROA 1TP4A 1LFBA 2MYSA 1XSVA 2MLKA 1I39A 2DQLA 2WTEA 2R7TA 2B0LA 2HPIA 3KE2A 3OIOA 1WJCA 3MFKA 1XGSA 1JHFA 3I59A 2MGQA 2BY3A 1V3FA 1QNTA 1WHUA 2QVOA 2R5ZA 2M2EA 1HLVA 3FXKA 1X2MA 1QO0D 4ZDOA 5J8FA 1ZR4A 2QBYA 4G7HF 1W5SA 2R0QC 3QRFF 4KMUX 3C2BA 2DA4A 1N25A 3K69A 5H6QA 1IGNA 4UVCA 3I55I 1O57A 3TP3A 3RTRA 4AIDA 5LLQA 3BPVA 4XKCA 3BR6A 2EFOA 4B43A 3GTJJ 2CUFA 4NB5A 4N9IA 4PGHA 3V7CA 1KYWA 3OOUA 2JA8J 3WU2C 3SFZA 1YJNI 2PJRB 3SXYA 1XCBA 2HVSA 2F6CA 3OSGA 4RAFA 3I0TA 5HS8A 5LGNA 2DTRA 2GOXB 1O3QA 1WFXA 2A07F 4Q4ZF 2GM4A 5KNLA 1OYWA 3CCSI 3I5UA 2OC6A 1SMYF 1T98A 3BQYA 4HQEA 2HOSA 1VQNI 3EYYA 1I50J 2ELJA 3I3LA 1LDDA 2RAEA 3IUOA 1HW2A 1O7LA 2LY9A 2IXSA 1LQ1A 3S2WA 1DU6A 3G2BA 3FMSA 2A68F 3K6GA 2Z5UA 2P5KA 2V9VA 3G4SI 2V9PA 3BZ6A 3JRAA 1O3TA 3EQLF 3HB9A 3Q0VA 3ZMUA 3KEOA 3BTIA 2ME0A 1LNWA 3GBGA 4G7ZF 2IGNA 3ZMTA 3JR9A 2DMNA 2K4BA 2IJLA 3OSFA 1BIBA 3H92A 1B8IB 4I99C 5HNHA 2PI0A 4RMNA 3CJRB 2CQKA 3HSRA 3Q3SA 2ZJPF 1D5VA 2X6OA 1J0RA 3ZN0A 2FX0A 3ASNH 1HCRA 1HW1A 3KP4A 4UY8I 5FLVA 1S6LA 4EJWA 1HKTA 5BMZA 1KQ0A 2X6WA 1IRZA 2AQFA 1FP2A 3JRCA 1T38A 4FETA 1P9QC 2CQQA 4RM2A 2ZO4A 2ACJA 2QQAA 1Z91A 2R7XA 3S3MA 2DA2A 3AFHA 1I27A 3HM5A 5F0FA 3ABKH 4IL6C 3T0YA 2QQBA 4FE7A 1VF9A 2J5OA 3CP2A 2VKEA 4C3IJ 3Q5FA 2K40A 2EJRA 4S04A 5CPRB 5D4SA 4AD9A 1D0YA 4BE1A 1T0FC 2QQ8A 5HLGA 2XB0X 1HSJA 4ESBA 4ZZDA 4HLXA 1CGPA 2E36A 2E5ZA 2F5VA 3S3OA 2ECCA 3BJ6A 3BDDA 3ESWB 1V55H 2HI3A 2TCTA 4KT5C 2NVTJ 1YW7A 1W7PB 3S2DJ 1D3YA 2EV6A 3E6CC 2BXZA 4IXAA 1ZN2A 3ZMSA 3K0LA 2CRGA 2WB1A 2YU9J 2CO5A 3MCZA 4N4OB 2DOEA 2IS4A 4M9SA 2LTPA 2R7FA 4A69C 3BTLA 1IW7F 2F5EA 5ERIA 4IPAA 1E2XA 2DA3A 3TL4X 3CTAA 2X6XA 1WI9A 2WC2A 3ECOA 1TNTA 3H3UA 2VQHA 2KP6A 1O4XA 4RAYA 3ZOBA 5M5YJ 1YTYA 1K78A 5DM6F 4NQWA 2W24A 4FASD 2JA2A 1NH3A 5K7HA 1MMSA 2ZC2A 2L02A 4C3JJ 3O6BB 2F4IA 4HLYA 1KGSA 1LE8A 1B59A 3KYDB 1XG1A 1LVKA 3CF2A 2HQNA 5HDKA 2DA1A 3G1MA 3F3XA 3KZYA 5D5UB 4YG2F 2HDCA 2P5VA 2PQ8A 2NS8A 3ECHA 1MH3A 1N78A 2V9KA 1X19A 1SVLA 5KAIC 3H5AA 3M9AA 4IX7A 1OLTA 1RESA 4XONA 5B66C 1EF4A 2BY0A 3J80Z 5E3OA 3HL2A 1VQ9I 3PO3J 3L09A 2MBFA 3OIPA 2O0YA 2ZXWH 2VONA 1S5LC 2RC4A 4ON0A 2R7RA 4M3GA 2I8DA 1QA6A 4QPQA 1FTZA 3HHGA 3LA7A 3V4GA 3HPGA 4BHBA 4ENJA 1J75A 1TC3C 4IQJA 1IN5A 2E60A 2FA5A 2K4JA 1WJBA 3KCCA 4IHYA 1W0UA 2E2HJ 3CESA 3CMYA 2EB7A 4J19A 4AIJA 4A3LJ 3GCMA 4CZCA 4M74A 4XL9A 2DJIA 1WJ5A 5DCMA 4HEA2 1NK3P 3IL2A 2XAQA 2DBBA 3WE3A 2K9LA 4KJZA 4JX5A 3WTTC 1Z67A 5DTDA 3KYLA 3QYFA 2X51A 5ED4A 1FIPA 1ULYA 4CCKA 3VSLA 2A05A 3HDDA 3L2CA 2G0EA 4HBLA 2XGDA 3S1RJ 4G94A 1FYKA 2RNJA 3DU6A 3JRDA 4A5NA 3ABMH 2CWEA 2EQRA 4UB6C 3OYMA 4D7MA 1H8AC 1QZYA 3OYKA 5AIPA 1ZELA 2PN6A 2M8EA 3WU0A 2MG4A 5DUKA 2PJPA 3GFIA 2BV6A 2XPVA 1TNSA 4EQQA 2HOTA 4MHGA 2IGMA 4LJZF 1ZR2A 2OTJI 1VQ4I 4HOBA 2QM3A 4A0XA 1Z3YA 2HYGD 3JTGA 4JOMA 2ZJRF 5EDNA 3TW7A 2RQPA 2DQRA 2LKPA 3F22A 1IAWA 2HS5A 1YRNA 1FBUA 2UXNA 1ZG1A 1D5YA 1H9TA 4RB2C 1XMAA 1QRYA 2L9SA 3RKXA 3IRQA 2EZLA 2D1HA 1E0EA 3FK7A 4QWQA 2VLAA 1XSXA 1FX7A 4OIPF 4XLEA 2JA6J 2UXXA 4OOIA 4UXNA 1Y8QB 1JJ8C 2XB5A 2W84A 3H5RA 1BOAA 1PP7U 1R00A 3CMEI 2LREA 3RYPA 1LEBA 5K5OA 4HDVA 3IAM2 3K4JA 1UJ8A 2M30A 4A5MA 3WHCA 1JTXA 4BEHB 2HQAA 4EM2A 3H9JA 4IZZA 3LWFA 2V1XA 2W48A 3GFJA 4II2A 2VKHA 3DTEA 2P0WA 1EV7A 1R9TJ 3ZQHA 1FSHA 3OYLA 1NK2P 3EDPA 1TT0A 1WWXA 6PAXA 4OIOF 1IN7A 4KITB 2FBKA 4BAYA 4XLAA 1Y8RB 2L7FP 4A6EA 2M7BA 4W1UA 3OYCA 4ZTFA 3FBIB 2AS5F 4IRIA 2EV5A 1Z3XA 2XKOA 2DYRH 4H4KC 1WJFA 3GF2A 1U2WA 2DO7A 4Q47A 1P4AA 3CC7I 4CCJA 4GRIA 2XAHA 2F2EA 3QODA 5HLTA 2BEOA 1OCRH 2VPRA 2L9VA 2F4MB 3BR2A 3DLAA 2DMQA 3FIWA 1LPQA 1VQKI 1OISA 3BG3A 5E3NA 1T08B 3RDIA 1K4TA 1A6IA 1SAUA 1HQCA 4HZFA 2W25A 1YJWI 1RPWA 1MBHA 3S8PA 1TQIA 2EZHA 3MN2A 3TQNA 3TDZC 4HF2A 2NNNA 3M1EA 3K4CA 4BQNA 1ZRCA 2KJBA 4H0EA 4X0GA 4XRMA 3ZCOA 2HTJA 4YIIA 2W7NA 2BVLA 4GGGA 1JKPC 5LRRA 1X2NA 5D8LB 1HKQA 3S1NJ 5ILSA 3NEUA 5A2QZ 4ZTJA 3GYHX 3BTJA 2JSPA 1L3LA 3CCEI 1LKXA 3MZHA 4DYCA 2XIGA 1NG6A 4UHTA 2YX7A 5EGOB 3R60A 1ODDA 4PFOA 3UKGA 2M4GA 1PUFA 3B6CA 2XV4S 1A36A 1OCPA 2LY1A 2YPRA 3IWZA 1BI0A 4KIGA 4R79A 3NARA 2M45A 4PUSA 3I71A 1JT6A 4R8HA 4N0BA 4XOPA 1WSUA 1K83J 1MH4A 1MDMA 2VBXA 1T6SA 2LC2A 3QP6A 4AC0A 1RNLA 1RZ4A 2GBYA 1NG7A 2ADUA 5C3EJ 4N4NB 2ZXIA 2VT3A 2L01A 4WXHA 3VOEA 2R7SA 3K2ZA 3QOEA 1XSDA 2LF7A 2GIZA 2NS0A 4V19K 3HXLA 3KLOA 4F93B 2KRHA 1XDUA 2FNAA 5F08A 4XQFA 5FLXK 1WCMJ 3WE2A 1R7JA 4IEJA 3TBIA 4CGZA 1D1CA 2ZSIB 2ZBKA 2A6TA 2IVMA 2JVGA 1UFMA 2FBIA 2Z9OA 2JT1A 2H94A 1USTA 1X58A 4MO7A 1Y0NA 3JRBA 3ZMZA 1KU3A 4YFNF 2E2IJ 4A3DJ 4QPOA 2E1OA 1R58A 4FE4A 4O3MA 4IQ4A 1T8IA 1G2HA 1PJRA 2W85A 2STWA 2R7OA 3K10A 1JTYA 3LSGA 4BS9A 2VKVA 5J8CA 3LQRA 3FKJA 1ORKA 2DOAA 4XRFA 3N05A 4JK1X 3C3WA 1MJAA 1MBEA 1MBJA 3CZ6A 3KPHA 1YO5C 5DD8A 2OF7A 2ZMEB 2V26A 2W82A 2FE3A 3MWMA 3QAHA 1X4PA 4XR6A 3I4PA 5H2FC 5EF6A 2LY2A 4RBOA 3BCAA 1R1VA 1HBXG 1IUYA 1G59A 2EFQA 2YS9A 3GZ5A 4GXOA 3E3VA 5FROA 2OCCH 3PM1A 1HOMA 3BZKA 2JUCA 2HDWA 4EJOA 4RLQA 2EZIA 2XDVA 4XN0A 3T1BA 1REPC 1I1SA 1Z6TA 2F5CA 4KN7X 3SEZA 4GYGA 3QPHA 3IP4B 2P81A 2CQXA 2M0CA 1IO2A 3K4BA 5E1WA 2UV1A 2Y30A 4JYKA 1R1TA 2COMA 2WAEA 3F8BA 4KUMA 1SMTA 3TO6A 3F0CA 4W97A 4MEXF 2VBYA 2M4KA 5CQGA 2CV0A 2NVYJ 1IXCA 3KP2A 3SZGA 1YJ9I 5L3FA 5CVRA 3ZMDA 4CDGA 1AU7A 4XLPF 4M6YA 2Y31A 3QP5A 4FHTA 3CF5F 4L5JA 2XAGA 3SDGA 4BUPA 2JZYA 4CYCB 1QBJA 2GLOA 2DTZA 4ZYAA 3RPUD 3T8RA 2MD5A 3OL3A 3FXRA 2M5WA 2HOAA 1G3YA 5J4VA 1OPCA 2ETHA 5J3LA 4U7DA 2NRAC 1D1AA 1B9NA 4OU0A 4HNVA 5LHHA 2GXBA 5E17F 4HW0A 2FBHA 2EIJH 3SHFA 1W36D 1O3RA 3C1DA 5CVJA 2VKDA 3Q0UA 2L7KA 3FDYA 3WHBA 2MH9A 3GTMJ 5BPIA 4KYWA 1Z05A 2EA4A 3GWZA 3EPZA 3HIFA 3BR3A 1Y0UA 4BJ6C 1HDDC 2WWYA 9ANTA 2CUEA 4I09A 1I6HJ 4M71A 1JE8A 2ZCWA 2CQNA 2KIFA 2P6TA 2QKMB 1B8IA 5E1XA 1OR7A 5CVVA 3IH2A 4LG0B 1ACIA 5KHDA 3KYCB 2CV2A 3E0JB 1S7EA 3DV8A 4E70A 2B9SA 3RKYA 3F6VA 4HF1A 3DWLE 4U87A 2OUMA 4I6ZA 5EEHA 1DGWY 1X1CA 3BG9A 1MW7A 2A6EF 1WJDA 2L4AA 1IV8A 1VQMI 4A6DA 5FFXA 2UZKA 2L9RA 5JVGF 1XS9A 3T8TA 1UHMA 4HA8A 2HYFA 1JGSA 2Y9YA 4C9YA 4HSTA 3IAS2 2C6YA 2EPFA 3MD2A 1ZGAA 2K9NA 3WTYC 3LOCA 4NC6A 1LDKB 2K3FA 3H5NA 2VQLA 1T39A 3O3KA 3MKWB 3HUGB 1XC5A 1FBQA 2V79A 1WH5A 3GLLA 3ZQQA 2OA4A 3FMQA 1QPIA 3VWBA 5KVRA 1SVMA 3CUQA 2OD5A 1FSEA 4FTHA 4L9VA 1RR7A 4IRHA 1Z21A 2CMPA 5FGMA 4UNOA 1HC8A 3LSMA 2KQRA 3V8LA 4EMSA 1KU2A 2IPQX 4I76A 4AYBA 3LSHA 1UAAA 3PNTA 2DOFA 1EKEA 4A3BJ 1P7IA 2DU9A 3K4NA 1T33A 5L3EA 4CYCA 2PMUA 4IHTA 5EG0B 4L18B 2JJ7A 2DJNA 3OV8A 2CUZA 2IS2A 2LMDA 3FM3A 3C2GA 2VC1A 3JTHA 2STTA 1SC7A 5L3DA 2EILH 2E7XA 2ZMEC 4RGRA 3BOQA 5B3SH 1IDYA 3V7RA 5BPDA 2QSGX 1G6NA 1XGMA 3OS2A 2XHKA 2HGCA 3HJEA 5FO5A 1OR7C 4NC7A 4K2EA 4XMYA 4D5CA 3OY9A 5LGTA 3HRTA 3C18A 1GT0C 1ZG5A 2KRCA 3PQKA 3PSIA 3ZR8X 1Y1WJ 4NNJA 4U0YA 4ENNA 2WY7Q 4LMYA 1JHHA 3KLNA 5D4RA 4MTDA 1TL8A 3VSKA 2DPUA 5D5WB 1FY7A 3HOYJ 1H9GA 3M8JA 4P1WA 1B1BA 1MGTA 2MA3A 2R7UA 2R5ZB 2FMLA 3BY6A 2M8GX 2ZMEA 3A0BC 1MZBA 2L7ZA 5FKMA 3TOBA 3DKXA 3LAJA 1BR2A 1R4MB 2A5YB 4L0YB 3PO2J 5DEQA 4RGXA 4S05A 2RDPA 2JVHA 1ZAOA 1X3WB 2FRHA 1XD7A 3L2RA 1JJ6C 1U6GA 5L3BA 1AKHA 1TWCJ 3DP7A 2A3SA 4BXFA 2PEXA 2KIMA 5M5WJ 1D0XA 1OMIA 4LGWA 2A5WA 4AWXB 2KZGA 1X1DA 4LG0A 3I53A 2FQ4A 1HSTA 1K7AA 3G73A 4U0VA 1DQUA 3S93A 1VQ6I 3GZNB 4M9ZA 2CH0A 2QCOA 3J7AO 2HZTA 1MD0A 3QU3A 1JXSA 2E71A 4I0BA 2K86A 4XORA 5GADJ 2EIKH 3HSEA 3H3ZA 5D8KB 1IF1A 3IHUA 3FX3A 2P5LC 5E8GA 2AO9A 2HOEA 3C7JA 4HV6A 4M3BA 1R71A 1RI7A 4NHJA 3BWGA 4M3FA 5E79C 3F72A 2EINH 2MC4A 3DEEA 4IO9F 4DZJA 2IS6A 3HOTA 2E19A 1Z1DA 1XMXA 5GPAA 2IA2A 3GTKJ 2DMPA 2FOKA 2W1OA 2PMZN 1F5TA 2UWMA 1G3SA 2GA1A 2V6EA 3B73A 2XF7A 3IH3A 5CLSA 1I6XA 1MDMB 3H0GJ 2XVCA 3WODF 4EGZA 2YR2A 3CCUI 4C2MJ 4OINF 1Y39A 1IRFA 1WVRA 2W4SA 4PDKA 5TGTA 4G9YA 3RCOA 3LSIA 3TMOA 5M3MJ 1VQ7I 4NBQA 1U9NA 1XGOA 3IRRA 3VYRB 2P6SA 3F6OA 1B4AA 4BY7J 1OJLA 2L9NA 4EJUA 5JVTA 3A01A 1T2KA 2IRFG 5EYRA 4I98B 3TO9A 1F36A 1G8XA 2JA5J 3A2KA 4CSWA 4DNCA 3K70D 1FPQA 1Q1VA 4EEFG 1EJ9A 5ILUA 5J6XA 3JSOA 4IHSA 1WKMA 4M6VA 4M6XA 5IY5H 4B3XA 2R7WA 2ZFWA 1BA5A 1JUSA 1PYVA 2WADA 4DJAA 1XB4A 1IN8A 2UUZA 4F52A 3O8GA 2RV8A 3M8FA 3O8HA 2E1MC 2PLYA 2Q1ZB 3CCQI 3HHHA 2BXYA 2PMZA 4JX4A 3E6DA 2HFHA 2AQEA 4MLOA 2LOOA 2DMUA 2QWWA 3BCBA 4CZZA 1A5JA 4Y4RA 4C30A 3CLQA 1FEXA 2OBPA 2HQRA 4BDZA 1BI1A 1UCRA 1XTAA 3F21A 1VQ8I 4RGSA 3OMYA 3H35A 5B1BH 1DP7P 2M1BA 4A12A 2MD0A 2BGCA 2DCEA 3GW2A 4RB3C 3HSFA 1A35A 4BXXJ 3BR1A 2Z3YA 3ABTA 2QQ9A 3QPSA 3RKWA 3TEDA 2E5NA 3KIOA 4DBQA 3H0DA 3H9GA 4BNCA 3W2AA 1GV5A 3F8NA 2KJCA 2KZVA 1BBYA 4KNYA 4DW6A 4U88A 2F5FA 2XAUA 1FBSA 2NS7A 3Q0WA 3WGGA 3CMAI 2WBMA 5LBQA 2JK3A 3R4KA 1AWCA 2X48A 1U5TA 3BPXA 5LHIA 4DGWB 2P4WA 1W5TA 1IV6A 3HOVJ 2YUSA 4ENKA 1X4OA 4WX9A 1G3WA 1BM9A 1X3ZB 3D5SC 3IC7A 5E3MA 1DPUA 2V4JC 4BQQA 2XAFA 4LK0F 5J47A 1T0FA 2LF8A 1JI8A 1SEUA 4QLCU 3CD6I 2M3AA 2G7UA 2H27A 3JRIA 3B02A 1FOXA 3BROA 1V4RA 3CO7C 3PSFA 3GTGJ 3FZVA 1KQ8A 4G8XA 2ESHA 4RAZA 5BS6A 3JRHA 1R23A 1I1GA 3K4KA 2EV0A 1ETVA 2D2WA 3RJPA 3WG9A 4BACA 1BJAA 3WGHA 2R7DA 2LBFB 4BQOA 1IC8A 4ANJA 2ISZA 5HNFA 2H09A 3HRSA 4Q48A 1DP3A 4P96A 1W1WE 3CUQB 3A1YA 3DKYA 5CQEA 2KHMA 5D6FA 5K7FA 3GTLJ 3W3CA 2A69F 3RYRA 2DT7B 4M9XA 1BC8C 3G3ZA 4AVZA 1MSFC 1ZGWA 3HPHA 4BL0B 1SD6A 4HX4A 3JRFA 4JQFA 4C2UA 1ON1A 1J5YA 4XKWA 5DCFA 4F7ZA 1FYLA 5A2QK 1X1PA 5E8IA 2CGPA 1FOYA 4WK8F 3LFUA 2O3FA 2R3SA 1FJLA 4FX0A 1M1EB 3FF5A 2Q8KA 3RIRA 1XX5A 1I3QJ 2V1UA 1W4MA 4XN3A 2QSHX 4HYEA 4XKVA 1TZLA 4YELA 2VI6A 4QSHA 4A3EJ 4WCGA 3OL4A 2MABA 1IUFA 4XBFA 1VQLI 2GAUA 2MC3A 2LKXA 2IAIA 4OIRF 4B3AA 4PJLA 1ZLKA 4ZC3A 4F91B 2HU9A 1KU9A 1BW6A 3AG1H 4Y7NJ 4QTRA 2GOMA 1OYIA 4XICA 1FOKA 2VIXA 5ILVA 3P9IA 3GO5A 1TBXA 1R5ID 2RGVA 4OAYA 3J7ZI 4IF4A 1SANA 4NDLA 2OZ6A 2L4MA 2H1LA 1TWFJ 3RZDJ 4Y3OA 2DDBA 4A93J 1JT0A 5IT9Z 4EJVA 2O61A 2BW3B 3NRVA 1YIJI 2F48A 1NHAA 1RETA 5DUIA 4LLLA 3K2AA 4OIQF 1AOYA 1GLNA 1YE9A 3K1PA 1BOBA 2LH9A 4LFUA 2L3DA 1U5TC 3HYIA 4XOTA 2OTLI 4JX6A 1RIOH 2G9WA 1LE8B 3MKYB 5D5XB 4V2FA 3HRUA 3P9CA 2VASA 1ZGJA 4L9NA 4DQ2A 1FNNA 4KIFA 1OCTC 2ZSHB 3SZTA 1KU7A 3AL0C 2A61A 1E3PA 3E5XA 4RA2A 4A2UA 4CA0A 2WV0A 4E7LA 4A0ZA 5C4XJ 3J81Z 2CV1A 1OCOH 1BL0A 2OU2A 3QOPA 2KRFA 3WGIA 3OYJA 2DA5A 3H36A 4D5FA 2M9HA 3FK6A 1YS6A 5C44J 4L5IA 4Z6YA 4GDFA 4ESFA 3HG9A 4PJJA 4FT8A 1GDTA 2DA6A 2DODA 3BP8A 2HNHA 2Z2SB 3R0AA 2O9LA 4PJ0C 3CDIA 4EM0B 4E7JA 1J9IA 3WTUC 2BHZA 1S8NA 2QUFA 5CYVA 2CU7A 1LFPA 1D1BA 3GTPJ 3I54A 3BLYA 3KETA 1YLFA 2VQCA 3JW4A 4RAGA 5FRNA 1IN4A 1OFCX 5F1RA 3IWFA 3MMYB 4XLNF 5L3CA 3GTOJ 5IT9K 4BKXA 5DS9A 3R0JA 3V8KA 2YX4A 2HXOA 3CCYA 3ZGKA 1GUUA 4N9HA 4A3JJ 2XF5A 5BNGA 1K79A 2WAFA 1R6RA 5GAEJ 2ELHA 1R1UA 4GFBA 4X6AJ 2Y0SN 5F6FA 2VPLA 3EUHA 2DI3A 1UHWA 3BR0A 5F04A 3OYBA 3COAC 1BIAA 2R7VA 2WAQN 3WTXC 4P55A 1TW3A 2ZXHA 4IRGA 2HEOA 4Z2YA 3GFLA 2VBZA 3N4MA 2CW7A 4A0YA 4Y52J 4HSRA 1SFXA 5HS7A 3ZXSA 2ZJ2A 4GO1A 3CJTB 1FMVA 2EIMH 2JTVA 3CP8A 4NUBA 4UVAA 2DDAA 5D6EA 4B4CA 3F23A 1TWGJ 4HNUA 3OYHA 2JUGA 3FISA 3HC7A 3A02A 3ZPLA 1JKQC 2EFPA 5LHGA 2LP0A 4BDYA 3KP6A 4XLFA 3CUOA 5C4JJ 1U8RA 5LEKA 2ZFUA 4I0AA 4MTEA 5DDGA 1MSEC 5ICFA 4XLCA 1ZYRF 1WZ2A 5KCMA 4BGDA 1SFOJ 5TJJA 2CYYA 3ML6A 1ETXA 3G6EI 3CQZJ 5IT3A 1PUFB 3SDBA 2X0LA 1QGPA 4AM3A 3RPQA 2KMUA 2M0MA 3M4OJ 1TQMA 4IOAF 1FOWA 2H6CA 3DXJF 1JKOC 2LBFA 2BY2A 2I5UA 2WA0A 1SAXA 3EETA 5FRMA 2EA2A 1LJ9A 4CHUA 3H3VK 2CUJA 2VC0A 3A0HC 2MSYA 1Y6IA 2KFDA 1IZ1A 5DD4A 2AHQA 3LFKA 1SFKA 2JSCA 1X3UA 2NOGA 4EM1A 3RQIA 2IGKA 5FLXZ 3W6JB 2K5CA 4CCOA 4HDUA 2Z1DA 3A4CA 3Q9SA 4ZYHA 3ISPA 5EG0A 1FP1D 1N75A 5CJ9A 3WTSC 3FXQA 3L2WA 3ZQLA 1F4KA 3HOZJ 3K7AJ 3R61A 1KA8A 2JMWA 1HA8A 4R1HA 1STZA 2DFFA 3LNQA 1ETKA
chains in the Genus database with same CATH topology
1IDYA 1O4XA 3ZOBA 5M5YJ 5K7HA 5GPCA 1U78A 2HYJA 4D5CA 4C3JJ 1GT0C 1LE8A 1HF0A 1RKTA 1XG1A 4BBRJ 1Y1WJ 2DA1A 3G1MA 3LSPA 5JLWA 3HOYJ 1FIAA 1TWHJ 2NS8A 1MH3A 2R5ZB 2N8GA 3VPRA 2M8GX 2XRLA 2L7ZA 1RESA 5FKMA 4IHVA 3CDLA 2K9SA 1EF4A 2LK2A 1UHSA 3PO2J 3PO3J 5E3OA 3S1QJ 2MW8A 4XRSA 4QIWN 2OPTA 1JJ6C 4M3GA 1AKHA 1TWCJ 3SJMA 1FTZA 2LVSA 2ID6A 1H88C 1TC3C 3HGGA 5M3FJ 4X1EA 5M5WJ 4IHYA 2R92J 1W0UA 4ABZA 2E2HJ 1ZTRA 4M3EA 3CMYA 2FQ4A 1E3OC 4J19A 4A3LJ 3L1PA 5IPAA 2QCOA 1JGGA 5EZGA 3S1MJ 1NK3P 3I4MJ 4JX5A 2X9DA 1B72A 5DTDA 2AO9A 1BJZA 4M3BA 1FIPA 2ZB9A 1QVTA 4M3FA 1ETQA 4DZJA 3HDDA 2E19A 2G0EA 2XGDA 5GPAA 3S1RJ 1T56A 1YRNB 5J1UA 3JRDA 2XGCA 3GTKJ 2O8KA 3ZQIA 2DMPA 2EQRA 2WV1A 2PMZN 1IDZA 2JN6A 4D7MA 4DZPA 5FKOA 3QPLA 1VFCA 1H8AC 2EH3A 3M3YJ 1U8BA 2LR8A 3IH3A 5F0HA 2M34A 3S14J 2MG4A 3H0GJ 4IHWA 1P7JA 2XPVA 4C2MJ 2HOTA 3MKLA 1ZR2A 1BW5A 3RKQA 2JWTA 3ZQFA 5IYBJ 5EDNA 3TW7A 5M3MJ 2KT0A 1U9NA 1YRNA 2H1KA 2QF7A 2EBIA 3A01A 5FKKA 4BY7J 4AYBN 1D5YA 1OJLA 3DCFA 1QRYA 5EYRA 3RZOJ 3I4NJ 1F36A 2B63J 2JA5J 2EZLA 3NAUA 4D7NA 3FK7A 4G12A 1Q1VA 4EEFG 1FTTA 3HBLA 4AUXA 1B72B 1CQTA 2JA6J 2Y9ZA 1JJ8C 2XB5A 5FLMJ 4M6VA 3W6VA 2HXIA 5F1JA 1BA5A 1JUSA 2LLKA 2NVQJ 2JA7J 1ZQ3P 2L7MP 2DA7A 5J1RA 1UG2A 2HDDA 3S17J 3O8GA 1JTXA 3WHCA 3O8HA 3S2HJ 2W48A 5FKLA 4JX4A 4MLOA 1R9TJ 3IV5A 2DN0A 4BBSJ 3ZQHA 2DMUA 1A5JA 1MBFA 4XK4A 1FEXA 1NK2P 4A3KJ 1IJWC 2L0KA 3HOUJ 2L7FP 5EZHA 4W1UA 3JRGA 4A3IJ 2R5YB 3BT9A 5E3LA 2ME6A 3SFIA 3JREA 4BXXJ 3BR1A 1K61A 3QPSA 3TEDA 2VUMJ 1ETOA 1GV5A 4DW6A 1POGA 2NS7A 3Q0WA 1Z0XA 2CJJA 2VPRA 2JK3A 1ENHA 4DYRA 2X48A 3A01B 3BR2A 2DMQA 3FIWA 4MIMA 1U9OA 1IV6A 3HOVJ 2YUSA 3BG3A 5E3NA 5E3MA 1A6IA 1AHDP 1Z77A 1RPWA 1MBHA 5IP7J 5IP6A 5IYCJ 2EZHA 2HQ5A 2H8RA 1VI0A 3BTCA 3MN2A 3JRIA 5JLXA 4RDUA 4XRMA 2WB1N 3GTGJ 1APLC 5M5XJ 1JKPC 1RKWA 1X2NA 5HODA 2IEKA 3JRHA 3S15J 1MBKA 3FKIJ 4A3MJ 3TP0A 3S1NJ 1ETVA 1WGXA 4FISA 2I10A 1IC8A 1ZK8A 3HEFA 3BTJA 3A03A 3BR5A 3BG5A 4DYCA 2O7OA 5EGOB 5GP9A 4IHXA 4JP0A 5K7FA 3UKGA 1PUFA 3B6CA 3GTLJ 4C3HJ 2EZKA 1OCPA 5IOYA 2ID3A 3HOXJ 1MBGA 3NARA 1JT6A 1MSFC 1K83J 1MH4A 1ZGWA 1GV2A 3JRFA 2D5VA 1IG7A 4A3FJ 4AC0A 2GBYA 5C3EJ 3HGYA 3D1NI 2DMTA 1ETYA 2ELKA 1FJLA 5IOZA 3G1OA 4L5EA 3ZQGA 4V2GA 1I3QJ 2COBA 1AKHB 5F0CA 1NTCA 5F08A 5IYDJ 2VI6A 4QSHA 4UUSB 1WCMJ 4A3EJ 4MFDA 3BQZA 1IUFA 1JKRC 4IEJA 1JUPA 3B6AA 4M3DA 4BY1J 2LKXA 2IAIA 1VNDA 5EEAA 4B3AA 2R5YA 3HKZN 3DEWA 4DYQA 2IBDA 1BW6A 1X58A 4MO7A 4Y7NJ 4QTRA 2R93J 3JRBA 3ZQCA 2E2IJ 4XICA 4A3DJ 2E1OA 1GVDA 4FE4A 1MNMC 1QVUA 1G2HA 2KDZA 1SANA 4NDLA 5F27A 1WI3A 2TRTA 1TWFJ 3RZDJ 1JTYA 3LSGA 4A93J 1JT0A 2VKVA 2Y2ZA 1LFBA 2LFBA 1ORKA 3LSJA 3OIOA 1MBEA 1MBJA 1HDPA 1RETA 2OF7A 3K2AA 2LD5A 2MGQA 4UUTA 5EF6A 2R5ZA 2M2EA 4RBOA 1HLVA 1X2MA 2YS9A 1ZR4A 3PM1A 2R0QC 1HOMA 3C2BA 2DA4A 4JX6A 1IGNA 2EZIA 1LE8B 3TP3A 4V2FA 5FKNA 3BR6A 3GTJJ 2CUFA 3S16J 2P81A 2CQXA 2M0CA 3OOUA 2JA8J 4B1RA 1JUMA 1OCTC 3MVPA 1H89C 2Y30A 4JYKA 3OSGA 3F0CA 4W97A 2NVYJ 2XSDC 5C4XJ 2GM4A 3G1LA 1AU7A 1BL0A 2Y31A 3SDGA 4CYCB 2DA5A 4LOCA 4D5FA 3BQYA 2GLOA 2HOSA 2M9HA 3FK6A 2DTZA 5C44J 1I50J 4A3CJ 1GDTA 2RAEA 2DA6A 2HOAA 2LY9A 2O9LA 3E7LA 5J3LA 1DU6A 1LFUP 2CU7A 4HNVA 3HOWJ 3GTPJ 3JRAA 3HB9A 3Q0VA 2ME0A 3Q0UA 3BTIA 2ECBA 2NVXJ 1TWAJ 1OFCX 3WHBA 3GBGA 3GTMJ 3GTOJ 4BKXA 5DS9A 3JR9A 2DMNA 3CCYA 2HXOA 1ITYA 3BR3A 1GUUA 4A3JJ 3OSFA 1B8IB 1HDDC 5BNGA 9ANTA 3Q3SA 2XPUA 2CUEA 1WH7A 4GFBA 4X6AJ 1I6HJ 2Y0SN 2X6OA 3BR0A 2FX0A 5F04A 1B8IA 1HCRA 2XGEA 5FLVA 3IH2A 2WAQN 4UUSA 4XIDA 1S7EA 1IRZA 3JRCA 2E2JJ 5K7ZA 2CQQA 3QQAA 4I6ZA 5IP9J 4Y52J 3BG9A 1WPKA 2DA2A 3HM5A 2L9RA 5F0FA 4B4CA 1UMQA 1TWGJ 1XS9A 4FE7A 1VF9A 3GTQJ 2VKEA 3FISA 4C3IJ 2Y9YA 3A02A 1JKQC 2K40A 2LP0A 2K9NA 5C4JJ 3LOCA 1Y1VJ 1ETWA 1MSEC 1DU0A 2FD5A 4MFEA 2XB0X 1SFOJ 1XC5A 1WH5A 3LSRA 1QPIA 1ETXA 3CQZJ 1PUFB 2ECCA 3TW6A 4FTHA 5EGOA 1RR7A 3M4OJ 1ZKGA 2HI3A 2TCTA 4S0HB 2NVTJ 1JKOC 4FCYA 3H3VK 2FJ1A 2MSYA 1F43A 3S2DJ 2AHQA 2K9QA 4XRSG 2R7ZJ 2NOGA 4I76A 3RQIA 1W0TA 2XPWA 2CRGA 2YU9J 4A3BJ 1P7IA 4CYCA 1T33A 5EG0B 5EG0A 2JJ7A 5J1YA 4A3GJ 2DJNA 2LTPA 4A69C 3BTLA 3ZQLA 3HOZJ 2DA3A 5FJ8J 3K7AJ 2JMWA 3IH4A 3LNQA 1ETKA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1IDY A;  1O4X A;  3ZOB A;  5M5Y J;  5K7H A;  5GPC A;  1U78 A;  2HYJ A;  4D5C A;  4C3J J;  1GT0 C;  1LE8 A;  1HF0 A;  1RKT A;  1XG1 A;  4BBR J;  1Y1W J;  2DA1 A;  3G1M A;  3LSP A;  5JLW A;  3HOY J;  1FIA A;  1TWH J;  2NS8 A;  1MH3 A;  2R5Z B;  2N8G A;  3VPR A;  2M8G X;  2XRL A;  2L7Z A;  1RES A;  5FKM A;  4IHV A;  3CDL A;  2K9S A;  1EF4 A;  2LK2 A;  1UHS A;  3PO2 J;  3PO3 J;  5E3O A;  3S1Q J;  2MW8 A;  4XRS A;  4QIW N;  2OPT A;  1JJ6 C;  4M3G A;  1AKH A;  1TWC J;  3SJM A;  1FTZ A;  2LVS A;  2ID6 A;  1H88 C;  1TC3 C;  3HGG A;  5M3F J;  4X1E A;  5M5W J;  4IHY A;  2R92 J;  1W0U A;  4ABZ A;  2E2H J;  1ZTR A;  4M3E A;  3CMY A;  2FQ4 A;  1E3O C;  4J19 A;  4A3L J;  3L1P A;  5IPA A;  2QCO A;  1JGG A;  5EZG A;  3S1M J;  1NK3 P;  3I4M J;  4JX5 A;  2X9D A;  1B72 A;  5DTD A;  2AO9 A;  1BJZ A;  4M3B A;  1FIP A;  2ZB9 A;  1QVT A;  4M3F A;  1ETQ A;  4DZJ A;  3HDD A;  2E19 A;  2G0E A;  2XGD A;  5GPA A;  3S1R J;  1T56 A;  1YRN B;  5J1U A;  3JRD A;  2XGC A;  3GTK J;  2O8K A;  3ZQI A;  2DMP A;  2EQR A;  2WV1 A;  2PMZ N;  1IDZ A;  2JN6 A;  4D7M A;  4DZP A;  5FKO A;  3QPL A;  1VFC A;  1H8A C;  2EH3 A;  3M3Y J;  1U8B A;  2LR8 A;  3IH3 A;  5F0H A;  2M34 A;  3S14 J;  2MG4 A;  3H0G J;  4IHW A;  1P7J A;  2XPV A;  4C2M J;  2HOT A;  3MKL A;  1ZR2 A;  1BW5 A;  3RKQ A;  2JWT A;  3ZQF A;  5IYB J;  5EDN A;  3TW7 A;  5M3M J;  2KT0 A;  1U9N A;  1YRN A;  2H1K A;  2QF7 A;  2EBI A;  3A01 A;  5FKK A;  4BY7 J;  4AYB N;  1D5Y A;  1OJL A;  3DCF A;  1QRY A;  5EYR A;  3RZO J;  3I4N J;  1F36 A;  2B63 J;  2JA5 J;  2EZL A;  3NAU A;  4D7N A;  3FK7 A;  4G12 A;  1Q1V A;  4EEF G;  1FTT A;  3HBL A;  4AUX A;  1B72 B;  1CQT A;  2JA6 J;  2Y9Z A;  1JJ8 C;  2XB5 A;  5FLM J;  4M6V A;  3W6V A;  2HXI A;  5F1J A;  1BA5 A;  1JUS A;  2LLK A;  2NVQ J;  2JA7 J;  1ZQ3 P;  2L7M P;  2DA7 A;  5J1R A;  1UG2 A;  2HDD A;  3S17 J;  3O8G A;  1JTX A;  3WHC A;  3O8H A;  3S2H J;  2W48 A;  5FKL A;  4JX4 A;  4MLO A;  1R9T J;  3IV5 A;  2DN0 A;  4BBS J;  3ZQH A;  2DMU A;  1A5J A;  1MBF A;  4XK4 A;  1FEX A;  1NK2 P;  4A3K J;  1IJW C;  2L0K A;  3HOU J;  2L7F P;  5EZH A;  4W1U A;  3JRG A;  4A3I J;  2R5Y B;  3BT9 A;  5E3L A;  2ME6 A;  3SFI A;  3JRE A;  4BXX J;  3BR1 A;  1K61 A;  3QPS A;  3TED A;  2VUM J;  1ETO A;  1GV5 A;  4DW6 A;  1POG A;  2NS7 A;  3Q0W A;  1Z0X A;  2CJJ A;  2VPR A;  2JK3 A;  1ENH A;  4DYR A;  2X48 A;  3A01 B;  3BR2 A;  2DMQ A;  3FIW A;  4MIM A;  1U9O A;  1IV6 A;  3HOV J;  2YUS A;  3BG3 A;  5E3N A;  5E3M A;  1A6I A;  1AHD P;  1Z77 A;  1RPW A;  1MBH A;  5IP7 J;  5IP6 A;  5IYC J;  2EZH A;  2HQ5 A;  2H8R A;  1VI0 A;  3BTC A;  3MN2 A;  3JRI A;  5JLX A;  4RDU A;  4XRM A;  2WB1 N;  3GTG J;  1APL C;  5M5X J;  1JKP C;  1RKW A;  1X2N A;  5HOD A;  2IEK A;  3JRH A;  3S15 J;  1MBK A;  3FKI J;  4A3M J;  3TP0 A;  3S1N J;  1ETV A;  1WGX A;  4FIS A;  2I10 A;  1IC8 A;  1ZK8 A;  3HEF A;  3BTJ A;  3A03 A;  3BR5 A;  3BG5 A;  4DYC A;  2O7O A;  5EGO B;  5GP9 A;  4IHX A;  4JP0 A;  5K7F A;  3UKG A;  1PUF A;  3B6C A;  3GTL J;  4C3H J;  2EZK A;  1OCP A;  5IOY A;  2ID3 A;  3HOX J;  1MBG A;  3NAR A;  1JT6 A;  1MSF C;  1K83 J;  1MH4 A;  1ZGW A;  1GV2 A;  3JRF A;  2D5V A;  1IG7 A;  4A3F J;  4AC0 A;  2GBY A;  5C3E J;  3HGY A;  3D1N I;  2DMT A;  1ETY A;  2ELK A;  1FJL A;  5IOZ A;  3G1O A;  4L5E A;  3ZQG A;  4V2G A;  1I3Q J;  2COB A;  1AKH B;  5F0C A;  1NTC A;  5F08 A;  5IYD J;  2VI6 A;  4QSH A;  4UUS B;  1WCM J;  4A3E J;  4MFD A;  3BQZ A;  1IUF A;  1JKR C;  4IEJ A;  1JUP A;  3B6A A;  4M3D A;  4BY1 J;  2LKX A;  2IAI A;  1VND A;  5EEA A;  4B3A A;  2R5Y A;  3HKZ N;  3DEW A;  4DYQ A;  2IBD A;  1BW6 A;  1X58 A;  4MO7 A;  4Y7N J;  4QTR A;  2R93 J;  3JRB A;  3ZQC A;  2E2I J;  4XIC A;  4A3D J;  2E1O A;  1GVD A;  4FE4 A;  1MNM C;  1QVU A;  1G2H A;  2KDZ A;  1SAN A;  4NDL A;  5F27 A;  1WI3 A;  2TRT A;  1TWF J;  3RZD J;  1JTY A;  3LSG A;  4A93 J;  1JT0 A;  2VKV A;  2Y2Z A;  1LFB A;  2LFB A;  1ORK A;  3LSJ A;  3OIO A;  1MBE A;  1MBJ A;  1HDP A;  1RET A;  2OF7 A;  3K2A A;  2LD5 A;  2MGQ A;  4UUT A;  5EF6 A;  2R5Z A;  2M2E A;  4RBO A;  1HLV A;  1X2M A;  2YS9 A;  1ZR4 A;  3PM1 A;  2R0Q C;  1HOM A;  3C2B A;  2DA4 A;  4JX6 A;  1IGN A;  2EZI A;  1LE8 B;  3TP3 A;  4V2F A;  5FKN A;  3BR6 A;  3GTJ J;  2CUF A;  3S16 J;  2P81 A;  2CQX A;  2M0C A;  3OOU A;  2JA8 J;  4B1R A;  1JUM A;  1OCT C;  3MVP A;  1H89 C;  2Y30 A;  4JYK A;  3OSG A;  3F0C A;  4W97 A;  2NVY J;  2XSD C;  5C4X J;  2GM4 A;  3G1L A;  1AU7 A;  1BL0 A;  2Y31 A;  3SDG A;  4CYC B;  2DA5 A;  4LOC A;  4D5F A;  3BQY A;  2GLO A;  2HOS A;  2M9H A;  3FK6 A;  2DTZ A;  5C44 J;  1I50 J;  4A3C J;  1GDT A;  2RAE A;  2DA6 A;  2HOA A;  2LY9 A;  2O9L A;  3E7L A;  5J3L A;  1DU6 A;  1LFU P;  2CU7 A;  4HNV A;  3HOW J;  3GTP J;  3JRA A;  3HB9 A;  3Q0V A;  2ME0 A;  3Q0U A;  3BTI A;  2ECB A;  2NVX J;  1TWA J;  1OFC X;  3WHB A;  3GBG A;  3GTM J;  3GTO J;  4BKX A;  5DS9 A;  3JR9 A;  2DMN A;  3CCY A;  2HXO A;  1ITY A;  3BR3 A;  1GUU A;  4A3J J;  3OSF A;  1B8I B;  1HDD C;  5BNG A;  9ANT A;  3Q3S A;  2XPU A;  2CUE A;  1WH7 A;  4GFB A;  4X6A J;  1I6H J;  2Y0S N;  2X6O A;  3BR0 A;  2FX0 A;  5F04 A;  1B8I A;  1HCR A;  2XGE A;  5FLV A;  3IH2 A;  2WAQ N;  4UUS A;  4XID A;  1S7E A;  1IRZ A;  3JRC A;  2E2J J;  5K7Z A;  2CQQ A;  3QQA A;  4I6Z A;  5IP9 J;  4Y52 J;  3BG9 A;  1WPK A;  2DA2 A;  3HM5 A;  2L9R A;  5F0F A;  4B4C A;  1UMQ A;  1TWG J;  1XS9 A;  4FE7 A;  1VF9 A;  3GTQ J;  2VKE A;  3FIS A;  4C3I J;  2Y9Y A;  3A02 A;  1JKQ C;  2K40 A;  2LP0 A;  2K9N A;  5C4J J;  3LOC A;  1Y1V J;  1ETW A;  1MSE C;  1DU0 A;  2FD5 A;  4MFE A;  2XB0 X;  1SFO J;  1XC5 A;  1WH5 A;  3LSR A;  1QPI A;  1ETX A;  3CQZ J;  1PUF B;  2ECC A;  3TW6 A;  4FTH A;  5EGO A;  1RR7 A;  3M4O J;  1ZKG A;  2HI3 A;  2TCT A;  4S0H B;  2NVT J;  1JKO C;  4FCY A;  3H3V K;  2FJ1 A;  2MSY A;  1F43 A;  3S2D J;  2AHQ A;  2K9Q A;  4XRS G;  2R7Z J;  2NOG A;  4I76 A;  3RQI A;  1W0T A;  2XPW A;  2CRG A;  2YU9 J;  4A3B J;  1P7I A;  4CYC A;  1T33 A;  5EG0 B;  5EG0 A;  2JJ7 A;  5J1Y A;  4A3G J;  2DJN A;  2LTP A;  4A69 C;  3BTL A;  3ZQL A;  3HOZ J;  2DA3 A;  5FJ8 J;  3K7A J;  2JMW A;  3IH4 A;  3LNQ A;  1ETK A; 
#chains in the Genus database with same CATH topology
 2ZNY A;  3DU5 A;  2KLO A;  2CW0 F;  1R5G A;  3O2P E;  1F1Z A;  1LB2 A;  1WQ2 A;  2GXA A;  3W2W A;  2HYJ A;  4DOZ A;  1U5T B;  3GX4 X;  1R49 A;  1CF7 A;  2V6C A;  2HVR A;  3AG4 H;  1HF0 A;  1RKT A;  1UEL B;  2KKO A;  1ZHF A;  4BBR J;  4XM3 A;  4CIC A;  4J01 A;  4UV9 A;  5JLW A;  4CCL A;  2O6G E;  1TWH J;  1W5C C;  2N8G A;  3VB2 A;  1YIT I;  3CDL A;  3ZRG A;  4G6D A;  1P4X A;  2K9S A;  3LAP A;  5K5R A;  1BR1 A;  4G6Q A;  3S1Q J;  2MW8 A;  1P92 A;  1XCV A;  2ICW G;  2GXG A;  2Q2E B;  5E1Z B;  4E7K A;  3MZ8 A;  1A04 A;  3AG2 H;  4ZJZ A;  3I64 A;  4D0P A;  1I5Z A;  3SJM A;  1O7F A;  2GA2 A;  4KIS A;  4ZZL A;  2DK8 A;  2FMY A;  2LVS A;  2Y0M A;  3IKV A;  3HGG A;  4E6K G;  4X1E A;  4KA4 A;  2XAS A;  1HW5 A;  3PFY A;  4ABZ A;  1X1A A;  1ZTR A;  4M3E A;  4U7B A;  3BC8 A;  2QKL B;  1E3O C;  2GIV A;  4WWC A;  4Q5S F;  4P9F A;  2LDU A;  1A6Q A;  5IPA A;  4B48 A;  2CFO A;  2VL8 A;  5EZG A;  1TTY A;  5KAF C;  2D45 A;  3RPU A;  3M1C A;  4IKF A;  5AON A;  4GCV A;  1HKS A;  2VOP A;  3FXU A;  4RM3 A;  1BJZ A;  4YEJ A;  2ZB9 A;  1QVT A;  2BE5 F;  4RGU A;  4I02 A;  2QLZ A;  3DBH B;  4KIC A;  4MEY F;  3VYS B;  3CJN A;  1GHC A;  4YRV A;  4MQ9 F;  2O8K A;  2FUG 2;  2IA1 A;  2WV1 A;  3F8C A;  1IDZ A;  2OZU A;  4PSX A;  4E7S A;  1YW9 A;  5FKO A;  5JR3 A;  5H20 A;  4YFX F;  4E7Z A;  2LR8 A;  5F0H A;  3VOD A;  2M34 A;  2RN7 A;  2AXT C;  4IHW A;  4BYY A;  3CO6 C;  1S7A A;  1P7J A;  3M07 A;  1IRG A;  2K7L A;  3DEU A;  1UB9 A;  4I7H A;  4BHC A;  2PMH A;  4CH7 A;  2Z16 A;  1BN5 A;  2Q0O A;  2E34 A;  2JWT A;  4Y15 A;  5IYB J;  1WJE A;  2QF7 A;  2XRN A;  3RZO J;  5AIQ A;  3WTZ A;  3QPT A;  1PDN C;  1YI2 I;  2VJ4 A;  4F3Q A;  4YIF A;  5CVI A;  3HBL A;  4AUX A;  4KN4 X;  5EEG A;  3U2R A;  3VYU B;  2J5P A;  1YYV A;  1CQT A;  4PZJ A;  2Y9Z A;  3JAM Z;  1AA7 A;  4PSW A;  3LSK A;  2V1D A;  2DFH A;  2XAJ A;  2NVQ J;  2OJE D;  1S9H A;  2L7M P;  3KP5 A;  5GTH C;  2HDD A;  2BY1 A;  3HOS A;  3OR1 C;  5FKL A;  1FC3 A;  3SYT A;  3SZP A;  2NNY A;  3D5L A;  4F92 B;  4BBS J;  2LKS A;  2DFI A;  3RQ4 A;  4NC8 A;  3AL0 B;  4A3K J;  1EH8 A;  1I3A A;  2NVU B;  3DPT A;  3ONQ A;  4IJA A;  5EZH A;  5HS9 A;  5TIS C;  2JQ7 A;  3JRG A;  2RKH A;  1IXR C;  4M73 A;  4ZYE A;  4WXD A;  3BT9 A;  5E3L A;  2ME6 A;  3TOA A;  4RLF A;  4E7I A;  2DAO A;  3W6K B;  1K61 A;  1S3J A;  1R36 A;  3I9V 2;  4EV0 A;  3WU1 B;  4KMF A;  1XPX A;  1ETO A;  1VQ5 I;  1POG A;  2Y0S A;  5ICG A;  1Z0X A;  4KDP A;  2GZW A;  1Z6R A;  2W57 A;  2CJJ A;  1DDN A;  1E17 A;  1ENH A;  2E1M B;  4DYR A;  1QPM A;  1DPR A;  4PK4 A;  4ZDP A;  3CJQ B;  2KL4 A;  2XC7 A;  3A01 B;  1SFU A;  4NQW B;  3CDH A;  4MIM A;  1U9O A;  3DPU A;  3S3N A;  4CCM A;  1AHD P;  1SFE A;  3CCR I;  3AG3 H;  4XKB A;  1Z77 A;  5B5E C;  1Z7L A;  5IP6 A;  5IYC J;  2HQ5 A;  2H8R A;  3EUK L;  1VI0 A;  2PFB A;  3BTC A;  1J7K A;  4LB6 B;  4O5V A;  5GAG J;  1FZP B;  3K4M A;  5JLX A;  4RDU A;  4E4H A;  1Z9C A;  2WB1 N;  2VOO A;  3ZQ7 A;  1S7O A;  1W36 C;  1APL C;  5M5X J;  1RKW A;  2FF4 A;  5HOD A;  1VTN C;  2DW4 A;  4UUV A;  3FKI J;  3JSP A;  4A3M J;  2RVC A;  5BQT A;  5LGU A;  3J80 K;  4ZDL A;  2K85 A;  2I10 A;  2CQ7 A;  1D8K A;  3U1K A;  2DK5 A;  3D5R C;  2LSO A;  2R4G A;  2O7O A;  3F8F A;  4IHX A;  2DT5 A;  3PUF A;  4U0W A;  3VYT B;  2O8X A;  2PBI A;  3I58 A;  2E1C A;  2ID3 A;  3KP7 A;  5DV5 A;  2LYC A;  1MBG A;  2XF6 A;  1YW8 A;  1K6O A;  4CXF A;  3OS0 A;  2CS3 A;  1HXD A;  4LLN A;  2DYS H;  1IG7 A;  4A3F J;  2VJJ A;  3RI4 A;  1GXP A;  2VOD A;  3HTS B;  2RRE A;  2EK5 A;  4KFC A;  1OCZ H;  1DUX C;  2G7H A;  1V5E A;  3HZJ A;  3KP3 A;  2HTS A;  2QEX I;  3KX2 A;  3D1N I;  2DMT A;  4LB5 A;  2NAZ A;  1MJ9 A;  5GTI C;  3G1O A;  4L5E A;  3ZQG A;  1G3T A;  2COB A;  4BJT A;  1SVO A;  1TT5 B;  3GXO A;  4OAZ A;  5F0C A;  5DYM A;  1UG0 A;  4OWR B;  4XSX F;  2FOW A;  3OS1 A;  3MKZ A;  5IYD J;  3K1M A;  2H8W A;  4BH9 A;  1Q1H A;  4LK1 F;  1OKR A;  2D1V A;  3BQZ A;  3GUD A;  3M8E A;  4OMY A;  4BE2 A;  1R4N B;  4M3D A;  2X4H A;  5BOX A;  4BY1 J;  3WTW C;  4II3 A;  4DYQ A;  2H6B A;  2ISY A;  1S72 I;  2Z33 A;  2LNB A;  2IBD A;  1B9M A;  5TRD A;  3L2V A;  1GVD A;  3L2U A;  4HNT A;  2QA4 I;  2KDZ A;  2L2O A;  1PP8 F;  4PFP A;  3DFG A;  2VE8 A;  3OOP A;  2K27 A;  3BZC A;  4CYD A;  3UR3 C;  4LIT A;  1EH7 A;  5E20 A;  2Y2Z A;  2LFB A;  2Q2E A;  3AAF A;  3OYI A;  2XKP A;  1P4W A;  4AVP A;  3LSJ A;  4ZYG A;  3P9K A;  3DBR B;  1HDP A;  4HX8 A;  5HLH A;  3ZN1 A;  2LD5 A;  2YSR A;  4UUT A;  5JHU A;  2O03 A;  1XGN A;  3BG6 A;  3L2Q A;  2VJI A;  5F64 A;  3I56 I;  4YIR X;  3U21 A;  5E18 F;  2BVM A;  4PCQ A;  5FKN A;  3CUQ C;  3C2H A;  2GWR A;  2PJR A;  2E35 A;  3T5X A;  2DT6 A;  3RSN A;  1CF7 B;  2L54 A;  5LEJ A;  3S16 J;  1KYZ A;  2HKX A;  4HF0 A;  4MQV A;  4B1R A;  1JUM A;  3MVP A;  1KQ9 A;  3ABU A;  1H89 C;  2QGU A;  4G6T B;  1A31 A;  4LG3 A;  2RQQ A;  4EJT A;  2QBY B;  3GEZ A;  3D0S A;  3DQV C;  3HUG A;  2VT2 A;  5HOO A;  3J7Y J;  2XSD C;  3OYE A;  3LA3 A;  1MMN A;  2KIQ A;  3G1L A;  1LDJ A;  2O5R A;  4CUG A;  4HQM A;  4LOC A;  2VBW A;  1KON A;  5L3G A;  1VZ0 A;  3WG7 H;  1TLH B;  4A3C J;  3L9F A;  3ELK A;  4B09 A;  3DF8 A;  4DIQ A;  4XSZ F;  3E7L A;  1YIO A;  3DLL F;  1LFU P;  1H0M A;  1BC7 C;  1IXS B;  3HOW J;  3FXO A;  1MJB A;  5JFR A;  5FFZ A;  2KIU A;  3H1C A;  4C2T A;  4LLG F;  2VB6 A;  5HLI A;  2ECB A;  3CCL I;  2NVX J;  1TWA J;  2X1E A;  3VEP A;  1MKM A;  2ZKZ A;  3DBL B;  1ZRD A;  2EFN A;  5B1A H;  5EJC A;  1ITY A;  2P7C B;  4KT6 A;  2F4O B;  2EWN A;  2OQR A;  3E1S A;  3TKY A;  3CCM I;  2XPU A;  4B8X A;  1WH7 A;  1ZAR A;  4EVI A;  2KPM A;  3VFZ A;  2XGE A;  2VQG A;  4HPQ A;  3KZZ A;  1MIJ A;  1V5G A;  4XID A;  4UUS A;  2AXL A;  1LUJ B;  3PQJ A;  2E2J J;  5K7Z A;  3V42 A;  3QQA A;  5IP9 J;  2VXZ A;  2VE9 A;  3DPL C;  1WPK A;  1J59 A;  4ENM A;  2Y75 A;  4L9J A;  2KDO A;  2HVQ A;  1UZC A;  1OCC H;  1UMQ A;  2IT0 A;  1FT9 A;  1C0W A;  3GTQ J;  3OIQ A;  2X85 A;  3BG7 A;  2ZXJ A;  3G71 I;  3Q9V A;  1GVJ A;  3HRM A;  1Y1V J;  1YQA A;  2P7V B;  1ETW A;  3ASO H;  2V1N A;  1TQP A;  1DU0 A;  3W2V A;  5ICE A;  2FD5 A;  2NXN B;  4MFE A;  3ROU A;  4Y13 A;  2W00 A;  2P8T A;  5HDN A;  3UNG C;  3LSR A;  3PFI A;  3MEX A;  1J2X A;  3FHZ A;  3TW6 A;  4BXU A;  5EGO A;  4UV8 A;  3FXL A;  4AU7 A;  2VXD A;  1RRJ A;  4HG2 A;  1ZKG A;  4M72 A;  4Y17 A;  4S0H B;  2IGO A;  4Y33 A;  5LD2 C;  5HVQ C;  2M87 A;  1OQY A;  4FCY A;  3KZI C;  4L9T A;  2FJ1 A;  3K9T A;  3OR2 C;  1F43 A;  2K9Q A;  3BJA A;  2A6H F;  3FXM A;  3M7G A;  4XRS G;  2R7Z J;  3L7W A;  1EA3 A;  2OV7 A;  1YS7 A;  2XPW A;  2IW5 A;  1W0T A;  1XN7 A;  1WJA A;  5LFA A;  4CO8 A;  1OYY A;  3QYE A;  3X2Q H;  1FWZ A;  5J1Y A;  4A3G J;  3LA2 A;  2E7W A;  4PGG A;  1D0Z A;  3F8M A;  5FJ8 J;  2BW3 A;  3DTK A;  2PG4 A;  3IH4 A;  2CSO A;  4HRI A;  1RUO A;  1G4D A;  3F9K A;  3HKZ A;  1W7P A;  1Z7U A;  3E6M A;  2IA0 A;  2E1N A;  1T95 A;  4P9U A;  5GPC A;  1U78 A;  3K1N A;  3GFM A;  5FD5 A;  2JRM A;  1VQO I;  2Z99 A;  3BJO A;  1SD7 A;  3MQ0 A;  3LSP A;  4LIU A;  2NOJ B;  1FIA A;  3OWT A;  4CCN A;  3L00 A;  1VQP I;  2XUB A;  3VPR A;  2NYX A;  3TDU C;  2XRL A;  3TO7 A;  4IHV A;  1J09 A;  2BYV E;  3E5Q A;  1X1B A;  1IN6 A;  2M7A A;  4RB0 A;  2LK2 A;  1QHG A;  1UHS A;  2XGX A;  5CVU A;  2WY8 Q;  4XRS A;  3ABL H;  3LMM A;  1R22 A;  4QIW N;  2OPT A;  3NQO A;  1GXQ A;  2FNP A;  2BOL A;  3KEQ A;  1RUN A;  3KEY A;  2ID6 A;  2X1D A;  1H88 C;  5M3F J;  2R92 J;  4P5O A;  2GQQ A;  1P6R A;  1ZH5 A;  4F55 A;  2DXI A;  1MMD A;  4G7O F;  1BI2 A;  1ONV A;  4BEH A;  3QWL A;  2K3P A;  4MNU A;  1K6Y A;  3L1P A;  3ERM A;  3J81 K;  3REO A;  3PNV A;  1JGG A;  2Y48 A;  3S1M J;  2DFE A;  1BI3 A;  3I4M J;  3ULQ B;  2X6Y A;  2CG4 A;  1ZG3 A;  2F5D A;  4XNF A;  4D1Q A;  2BBY A;  2DLL A;  4BJ5 C;  2X9D A;  5FB2 A;  1B72 A;  4IOC F;  5LRS A;  3U1D A;  1QQI A;  1QZZ A;  3GVA A;  1ETQ A;  1ERD A;  4WF2 A;  5K5Q A;  1K4S A;  3GME A;  1T56 A;  2JPB A;  2OQG A;  3H9Q A;  5J1U A;  2XGC A;  3LST A;  1YRN B;  3N97 A;  3ZQI A;  2HWV A;  5J40 A;  2JN6 A;  4DZP A;  4B47 A;  2TDX A;  3QPL A;  1PVE A;  1R5H A;  1YX5 A;  1VFC A;  2EH3 A;  3KFW X;  4LIV A;  4L0Z B;  3M3Y J;  3PIP F;  4WXC A;  1MMA A;  1U8B A;  3S14 J;  2KIS A;  3FBN B;  4E7H A;  4B44 A;  4XLH A;  2WAQ A;  1RR8 C;  3GLX A;  3MKL A;  3CLO A;  1BW5 A;  2R7Q A;  3RKQ A;  1FLI A;  3ZQF A;  2IS1 A;  3EUH C;  2HPM A;  2KT0 A;  2H1K A;  1S29 A;  3OYG A;  1YFH A;  2EBI A;  2FXA A;  2HR3 A;  5FKK A;  4AYB N;  3DCF A;  4AIK A;  1USS A;  3I4N J;  3FXJ A;  2B63 J;  5J4Y A;  3NAU A;  4D7N A;  1Y56 A;  4G12 A;  2FU4 A;  1FTT A;  3QYB A;  1B72 B;  3TGN A;  1SD4 A;  1E3H A;  5FLM J;  4FX4 A;  1SD5 A;  3W6V A;  2QZ8 A;  2HXI A;  3I59 B;  5F1J A;  3EYI A;  2JRT A;  2LLK A;  3FHN A;  2JA7 J;  2ZNZ A;  4HV5 A;  1ZQ3 P;  1MND A;  3V8J A;  2DA7 A;  4ESJ A;  1MNE A;  2MLG A;  5J1R A;  4RS8 A;  1UG2 A;  3S17 J;  2MH2 A;  1B6A A;  3E5U A;  3U9G A;  3S2H J;  3ZMV A;  3PIO F;  4D9J A;  2VN2 A;  1YG2 A;  1ZRF A;  4OMZ A;  2DN0 A;  3IV5 A;  4UVB A;  4HAM A;  3EUA A;  5CKT A;  1MBF A;  2OAZ A;  4XK4 A;  4ETS A;  1IJW C;  2L0K A;  4KIB A;  3HOU J;  2HKO A;  4HX7 A;  2YU3 A;  5HDG A;  3GZ6 A;  3PUB A;  4A3I J;  2JPC A;  1XMK A;  1MMG A;  3SQN A;  1P2F A;  2R5Y B;  1FYM A;  2X1C A;  3VDX A;  3SFI A;  3CC2 I;  2HZD A;  4ZYD A;  3JRE A;  3PJR A;  3E97 A;  5K1Y A;  3OYA A;  3CC4 I;  2VUM J;  2B7E A;  2CW8 A;  3FM5 A;  1W7P D;  3OYN A;  3K70 C;  4FQG A;  5GAH J;  2IP2 A;  1V54 H;  4ASN A;  3PNY A;  3WTV C;  3LL7 A;  3SEQ A;  1YX3 A;  2QSF X;  1ZLJ A;  3CCJ I;  5JI6 A;  2FQ3 A;  3OYD A;  1K78 B;  2EFW A;  2PX9 A;  2QYO A;  1ZRE A;  5IP7 J;  1IRX A;  1D8J A;  3FWE A;  4EAT A;  2K02 A;  2LG4 A;  1U3E M;  3LQQ A;  1F9N A;  3QU6 A;  3ZP5 A;  1N77 A;  2ZJQ F;  4ZH4 F;  3CMM A;  1BR4 A;  3P7N A;  4PJM A;  2IEK A;  1QU3 A;  5H6R A;  3S15 J;  1MBK A;  4O6J A;  1QZE A;  3TP0 A;  4BE0 A;  3MZY A;  1WGX A;  2DPD A;  4FIS A;  2XSJ C;  3DTI A;  4GYI A;  1ZK8 A;  3HEF A;  4BU2 A;  2RNG A;  5JHF A;  3A03 A;  2BZT A;  3BR5 A;  3BG5 A;  1XDS A;  5GP9 A;  5KK1 A;  4AIH A;  4JP0 A;  2FSW A;  3JCU C;  2LRD A;  2K9M A;  4C3H J;  2EZK A;  1ON2 A;  4IVN A;  5IOY A;  2Y69 H;  3HOX J;  3V7S A;  3PL8 A;  4J00 A;  3R6S A;  3DKW A;  5DCM B;  3JAM K;  1LVA A;  1QHH D;  2VJ5 A;  4ITV A;  1L0O C;  3S32 A;  3P5J A;  1DGR M;  1GV2 A;  1V5F A;  2D5V A;  1YHQ I;  1TW2 A;  3E6B A;  2MFZ A;  1O3S A;  4DBR A;  3HGY A;  3NWS A;  1ETY A;  2QEN A;  2ELK A;  2ESN A;  1U0J A;  3IKT A;  1LEA A;  5IOZ A;  4EGY A;  3FMR A;  1EH6 A;  2CFX A;  4TV7 A;  4V2G A;  5D5V B;  3OYF A;  1AKH B;  2OCE A;  5FD6 A;  1NTC A;  3MAJ A;  3HTU A;  1WRJ A;  1KZH A;  1YOV B;  2V7F A;  4UUS B;  3NWT A;  4MFD A;  4I2O A;  2BHY A;  4YFK F;  1JKR C;  4UB8 C;  1JUP A;  3B6A A;  1FMW A;  1VND A;  5EEA A;  2R5Y A;  3HKZ N;  3DEW A;  1RC9 A;  5DM7 F;  4JBA A;  2FEZ A;  4LD5 A;  4MGR A;  2R93 J;  4I01 A;  3ZQC A;  4PJN A;  5ICC A;  1PUE E;  4BQA A;  4BHP A;  4RB1 A;  1MNM C;  3CCV I;  2L5Q A;  1QVU A;  5F27 A;  1WI3 A;  2TRT A;  3AKZ A;  3ERE D;  3J7A Y;  3K4L A;  2XRO A;  1TP4 A;  1LFB A;  2MYS A;  1XSV A;  2MLK A;  1I39 A;  2DQL A;  2WTE A;  2R7T A;  2B0L A;  2HPI A;  3KE2 A;  3OIO A;  1WJC A;  3MFK A;  1XGS A;  1JHF A;  3I59 A;  2MGQ A;  2BY3 A;  1V3F A;  1QNT A;  1WHU A;  2QVO A;  2R5Z A;  2M2E A;  1HLV A;  3FXK A;  1X2M A;  1QO0 D;  4ZDO A;  5J8F A;  1ZR4 A;  2QBY A;  4G7H F;  1W5S A;  2R0Q C;  3QRF F;  4KMU X;  3C2B A;  2DA4 A;  1N25 A;  3K69 A;  5H6Q A;  1IGN A;  4UVC A;  3I55 I;  1O57 A;  3TP3 A;  3RTR A;  4AID A;  5LLQ A;  3BPV A;  4XKC A;  3BR6 A;  2EFO A;  4B43 A;  3GTJ J;  2CUF A;  4NB5 A;  4N9I A;  4PGH A;  3V7C A;  1KYW A;  3OOU A;  2JA8 J;  3WU2 C;  3SFZ A;  1YJN I;  2PJR B;  3SXY A;  1XCB A;  2HVS A;  2F6C A;  3OSG A;  4RAF A;  3I0T A;  5HS8 A;  5LGN A;  2DTR A;  2GOX B;  1O3Q A;  1WFX A;  2A07 F;  4Q4Z F;  2GM4 A;  5KNL A;  1OYW A;  3CCS I;  3I5U A;  2OC6 A;  1SMY F;  1T98 A;  3BQY A;  4HQE A;  2HOS A;  1VQN I;  3EYY A;  1I50 J;  2ELJ A;  3I3L A;  1LDD A;  2RAE A;  3IUO A;  1HW2 A;  1O7L A;  2LY9 A;  2IXS A;  1LQ1 A;  3S2W A;  1DU6 A;  3G2B A;  3FMS A;  2A68 F;  3K6G A;  2Z5U A;  2P5K A;  2V9V A;  3G4S I;  2V9P A;  3BZ6 A;  3JRA A;  1O3T A;  3EQL F;  3HB9 A;  3Q0V A;  3ZMU A;  3KEO A;  3BTI A;  2ME0 A;  1LNW A;  3GBG A;  4G7Z F;  2IGN A;  3ZMT A;  3JR9 A;  2DMN A;  2K4B A;  2IJL A;  3OSF A;  1BIB A;  3H92 A;  1B8I B;  4I99 C;  5HNH A;  2PI0 A;  4RMN A;  3CJR B;  2CQK A;  3HSR A;  3Q3S A;  2ZJP F;  1D5V A;  2X6O A;  1J0R A;  3ZN0 A;  2FX0 A;  3ASN H;  1HCR A;  1HW1 A;  3KP4 A;  4UY8 I;  5FLV A;  1S6L A;  4EJW A;  1HKT A;  5BMZ A;  1KQ0 A;  2X6W A;  1IRZ A;  2AQF A;  1FP2 A;  3JRC A;  1T38 A;  4FET A;  1P9Q C;  2CQQ A;  4RM2 A;  2ZO4 A;  2ACJ A;  2QQA A;  1Z91 A;  2R7X A;  3S3M A;  2DA2 A;  3AFH A;  1I27 A;  3HM5 A;  5F0F A;  3ABK H;  4IL6 C;  3T0Y A;  2QQB A;  4FE7 A;  1VF9 A;  2J5O A;  3CP2 A;  2VKE A;  4C3I J;  3Q5F A;  2K40 A;  2EJR A;  4S04 A;  5CPR B;  5D4S A;  4AD9 A;  1D0Y A;  4BE1 A;  1T0F C;  2QQ8 A;  5HLG A;  2XB0 X;  1HSJ A;  4ESB A;  4ZZD A;  4HLX A;  1CGP A;  2E36 A;  2E5Z A;  2F5V A;  3S3O A;  2ECC A;  3BJ6 A;  3BDD A;  3ESW B;  1V55 H;  2HI3 A;  2TCT A;  4KT5 C;  2NVT J;  1YW7 A;  1W7P B;  3S2D J;  1D3Y A;  2EV6 A;  3E6C C;  2BXZ A;  4IXA A;  1ZN2 A;  3ZMS A;  3K0L A;  2CRG A;  2WB1 A;  2YU9 J;  2CO5 A;  3MCZ A;  4N4O B;  2DOE A;  2IS4 A;  4M9S A;  2LTP A;  2R7F A;  4A69 C;  3BTL A;  1IW7 F;  2F5E A;  5ERI A;  4IPA A;  1E2X A;  2DA3 A;  3TL4 X;  3CTA A;  2X6X A;  1WI9 A;  2WC2 A;  3ECO A;  1TNT A;  3H3U A;  2VQH A;  2KP6 A;  1O4X A;  4RAY A;  3ZOB A;  5M5Y J;  1YTY A;  1K78 A;  5DM6 F;  4NQW A;  2W24 A;  4FAS D;  2JA2 A;  1NH3 A;  5K7H A;  1MMS A;  2ZC2 A;  2L02 A;  4C3J J;  3O6B B;  2F4I A;  4HLY A;  1KGS A;  1LE8 A;  1B59 A;  3KYD B;  1XG1 A;  1LVK A;  3CF2 A;  2HQN A;  5HDK A;  2DA1 A;  3G1M A;  3F3X A;  3KZY A;  5D5U B;  4YG2 F;  2HDC A;  2P5V A;  2PQ8 A;  2NS8 A;  3ECH A;  1MH3 A;  1N78 A;  2V9K A;  1X19 A;  1SVL A;  5KAI C;  3H5A A;  3M9A A;  4IX7 A;  1OLT A;  1RES A;  4XON A;  5B66 C;  1EF4 A;  2BY0 A;  3J80 Z;  5E3O A;  3HL2 A;  1VQ9 I;  3PO3 J;  3L09 A;  2MBF A;  3OIP A;  2O0Y A;  2ZXW H;  2VON A;  1S5L C;  2RC4 A;  4ON0 A;  2R7R A;  4M3G A;  2I8D A;  1QA6 A;  4QPQ A;  1FTZ A;  3HHG A;  3LA7 A;  3V4G A;  3HPG A;  4BHB A;  4ENJ A;  1J75 A;  1TC3 C;  4IQJ A;  1IN5 A;  2E60 A;  2FA5 A;  2K4J A;  1WJB A;  3KCC A;  4IHY A;  1W0U A;  2E2H J;  3CES A;  3CMY A;  2EB7 A;  4J19 A;  4AIJ A;  4A3L J;  3GCM A;  4CZC A;  4M74 A;  4XL9 A;  2DJI A;  1WJ5 A;  5DCM A;  4HEA 2;  1NK3 P;  3IL2 A;  2XAQ A;  2DBB A;  3WE3 A;  2K9L A;  4KJZ A;  4JX5 A;  3WTT C;  1Z67 A;  5DTD A;  3KYL A;  3QYF A;  2X51 A;  5ED4 A;  1FIP A;  1ULY A;  4CCK A;  3VSL A;  2A05 A;  3HDD A;  3L2C A;  2G0E A;  4HBL A;  2XGD A;  3S1R J;  4G94 A;  1FYK A;  2RNJ A;  3DU6 A;  3JRD A;  4A5N A;  3ABM H;  2CWE A;  2EQR A;  4UB6 C;  3OYM A;  4D7M A;  1H8A C;  1QZY A;  3OYK A;  5AIP A;  1ZEL A;  2PN6 A;  2M8E A;  3WU0 A;  2MG4 A;  5DUK A;  2PJP A;  3GFI A;  2BV6 A;  2XPV A;  1TNS A;  4EQQ A;  2HOT A;  4MHG A;  2IGM A;  4LJZ F;  1ZR2 A;  2OTJ I;  1VQ4 I;  4HOB A;  2QM3 A;  4A0X A;  1Z3Y A;  2HYG D;  3JTG A;  4JOM A;  2ZJR F;  5EDN A;  3TW7 A;  2RQP A;  2DQR A;  2LKP A;  3F22 A;  1IAW A;  2HS5 A;  1YRN A;  1FBU A;  2UXN A;  1ZG1 A;  1D5Y A;  1H9T A;  4RB2 C;  1XMA A;  1QRY A;  2L9S A;  3RKX A;  3IRQ A;  2EZL A;  2D1H A;  1E0E A;  3FK7 A;  4QWQ A;  2VLA A;  1XSX A;  1FX7 A;  4OIP F;  4XLE A;  2JA6 J;  2UXX A;  4OOI A;  4UXN A;  1Y8Q B;  1JJ8 C;  2XB5 A;  2W84 A;  3H5R A;  1BOA A;  1PP7 U;  1R00 A;  3CME I;  2LRE A;  3RYP A;  1LEB A;  5K5O A;  4HDV A;  3IAM 2;  3K4J A;  1UJ8 A;  2M30 A;  4A5M A;  3WHC A;  1JTX A;  4BEH B;  2HQA A;  4EM2 A;  3H9J A;  4IZZ A;  3LWF A;  2V1X A;  2W48 A;  3GFJ A;  4II2 A;  2VKH A;  3DTE A;  2P0W A;  1EV7 A;  1R9T J;  3ZQH A;  1FSH A;  3OYL A;  1NK2 P;  3EDP A;  1TT0 A;  1WWX A;  6PAX A;  4OIO F;  1IN7 A;  4KIT B;  2FBK A;  4BAY A;  4XLA A;  1Y8R B;  2L7F P;  4A6E A;  2M7B A;  4W1U A;  3OYC A;  4ZTF A;  3FBI B;  2AS5 F;  4IRI A;  2EV5 A;  1Z3X A;  2XKO A;  2DYR H;  4H4K C;  1WJF A;  3GF2 A;  1U2W A;  2DO7 A;  4Q47 A;  1P4A A;  3CC7 I;  4CCJ A;  4GRI A;  2XAH A;  2F2E A;  3QOD A;  5HLT A;  2BEO A;  1OCR H;  2VPR A;  2L9V A;  2F4M B;  3BR2 A;  3DLA A;  2DMQ A;  3FIW A;  1LPQ A;  1VQK I;  1OIS A;  3BG3 A;  5E3N A;  1T08 B;  3RDI A;  1K4T A;  1A6I A;  1SAU A;  1HQC A;  4HZF A;  2W25 A;  1YJW I;  1RPW A;  1MBH A;  3S8P A;  1TQI A;  2EZH A;  3MN2 A;  3TQN A;  3TDZ C;  4HF2 A;  2NNN A;  3M1E A;  3K4C A;  4BQN A;  1ZRC A;  2KJB A;  4H0E A;  4X0G A;  4XRM A;  3ZCO A;  2HTJ A;  4YII A;  2W7N A;  2BVL A;  4GGG A;  1JKP C;  5LRR A;  1X2N A;  5D8L B;  1HKQ A;  3S1N J;  5ILS A;  3NEU A;  5A2Q Z;  4ZTJ A;  3GYH X;  3BTJ A;  2JSP A;  1L3L A;  3CCE I;  1LKX A;  3MZH A;  4DYC A;  2XIG A;  1NG6 A;  4UHT A;  2YX7 A;  5EGO B;  3R60 A;  1ODD A;  4PFO A;  3UKG A;  2M4G A;  1PUF A;  3B6C A;  2XV4 S;  1A36 A;  1OCP A;  2LY1 A;  2YPR A;  3IWZ A;  1BI0 A;  4KIG A;  4R79 A;  3NAR A;  2M45 A;  4PUS A;  3I71 A;  1JT6 A;  4R8H A;  4N0B A;  4XOP A;  1WSU A;  1K83 J;  1MH4 A;  1MDM A;  2VBX A;  1T6S A;  2LC2 A;  3QP6 A;  4AC0 A;  1RNL A;  1RZ4 A;  2GBY A;  1NG7 A;  2ADU A;  5C3E J;  4N4N B;  2ZXI A;  2VT3 A;  2L01 A;  4WXH A;  3VOE A;  2R7S A;  3K2Z A;  3QOE A;  1XSD A;  2LF7 A;  2GIZ A;  2NS0 A;  4V19 K;  3HXL A;  3KLO A;  4F93 B;  2KRH A;  1XDU A;  2FNA A;  5F08 A;  4XQF A;  5FLX K;  1WCM J;  3WE2 A;  1R7J A;  4IEJ A;  3TBI A;  4CGZ A;  1D1C A;  2ZSI B;  2ZBK A;  2A6T A;  2IVM A;  2JVG A;  1UFM A;  2FBI A;  2Z9O A;  2JT1 A;  2H94 A;  1UST A;  1X58 A;  4MO7 A;  1Y0N A;  3JRB A;  3ZMZ A;  1KU3 A;  4YFN F;  2E2I J;  4A3D J;  4QPO A;  2E1O A;  1R58 A;  4FE4 A;  4O3M A;  4IQ4 A;  1T8I A;  1G2H A;  1PJR A;  2W85 A;  2STW A;  2R7O A;  3K10 A;  1JTY A;  3LSG A;  4BS9 A;  2VKV A;  5J8C A;  3LQR A;  3FKJ A;  1ORK A;  2DOA A;  4XRF A;  3N05 A;  4JK1 X;  3C3W A;  1MJA A;  1MBE A;  1MBJ A;  3CZ6 A;  3KPH A;  1YO5 C;  5DD8 A;  2OF7 A;  2ZME B;  2V26 A;  2W82 A;  2FE3 A;  3MWM A;  3QAH A;  1X4P A;  4XR6 A;  3I4P A;  5H2F C;  5EF6 A;  2LY2 A;  4RBO A;  3BCA A;  1R1V A;  1HBX G;  1IUY A;  1G59 A;  2EFQ A;  2YS9 A;  3GZ5 A;  4GXO A;  3E3V A;  5FRO A;  2OCC H;  3PM1 A;  1HOM A;  3BZK A;  2JUC A;  2HDW A;  4EJO A;  4RLQ A;  2EZI A;  2XDV A;  4XN0 A;  3T1B A;  1REP C;  1I1S A;  1Z6T A;  2F5C A;  4KN7 X;  3SEZ A;  4GYG A;  3QPH A;  3IP4 B;  2P81 A;  2CQX A;  2M0C A;  1IO2 A;  3K4B A;  5E1W A;  2UV1 A;  2Y30 A;  4JYK A;  1R1T A;  2COM A;  2WAE A;  3F8B A;  4KUM A;  1SMT A;  3TO6 A;  3F0C A;  4W97 A;  4MEX F;  2VBY A;  2M4K A;  5CQG A;  2CV0 A;  2NVY J;  1IXC A;  3KP2 A;  3SZG A;  1YJ9 I;  5L3F A;  5CVR A;  3ZMD A;  4CDG A;  1AU7 A;  4XLP F;  4M6Y A;  2Y31 A;  3QP5 A;  4FHT A;  3CF5 F;  4L5J A;  2XAG A;  3SDG A;  4BUP A;  2JZY A;  4CYC B;  1QBJ A;  2GLO A;  2DTZ A;  4ZYA A;  3RPU D;  3T8R A;  2MD5 A;  3OL3 A;  3FXR A;  2M5W A;  2HOA A;  1G3Y A;  5J4V A;  1OPC A;  2ETH A;  5J3L A;  4U7D A;  2NRA C;  1D1A A;  1B9N A;  4OU0 A;  4HNV A;  5LHH A;  2GXB A;  5E17 F;  4HW0 A;  2FBH A;  2EIJ H;  3SHF A;  1W36 D;  1O3R A;  3C1D A;  5CVJ A;  2VKD A;  3Q0U A;  2L7K A;  3FDY A;  3WHB A;  2MH9 A;  3GTM J;  5BPI A;  4KYW A;  1Z05 A;  2EA4 A;  3GWZ A;  3EPZ A;  3HIF A;  3BR3 A;  1Y0U A;  4BJ6 C;  1HDD C;  2WWY A;  9ANT A;  2CUE A;  4I09 A;  1I6H J;  4M71 A;  1JE8 A;  2ZCW A;  2CQN A;  2KIF A;  2P6T A;  2QKM B;  1B8I A;  5E1X A;  1OR7 A;  5CVV A;  3IH2 A;  4LG0 B;  1ACI A;  5KHD A;  3KYC B;  2CV2 A;  3E0J B;  1S7E A;  3DV8 A;  4E70 A;  2B9S A;  3RKY A;  3F6V A;  4HF1 A;  3DWL E;  4U87 A;  2OUM A;  4I6Z A;  5EEH A;  1DGW Y;  1X1C A;  3BG9 A;  1MW7 A;  2A6E F;  1WJD A;  2L4A A;  1IV8 A;  1VQM I;  4A6D A;  5FFX A;  2UZK A;  2L9R A;  5JVG F;  1XS9 A;  3T8T A;  1UHM A;  4HA8 A;  2HYF A;  1JGS A;  2Y9Y A;  4C9Y A;  4HST A;  3IAS 2;  2C6Y A;  2EPF A;  3MD2 A;  1ZGA A;  2K9N A;  3WTY C;  3LOC A;  4NC6 A;  1LDK B;  2K3F A;  3H5N A;  2VQL A;  1T39 A;  3O3K A;  3MKW B;  3HUG B;  1XC5 A;  1FBQ A;  2V79 A;  1WH5 A;  3GLL A;  3ZQQ A;  2OA4 A;  3FMQ A;  1QPI A;  3VWB A;  5KVR A;  1SVM A;  3CUQ A;  2OD5 A;  1FSE A;  4FTH A;  4L9V A;  1RR7 A;  4IRH A;  1Z21 A;  2CMP A;  5FGM A;  4UNO A;  1HC8 A;  3LSM A;  2KQR A;  3V8L A;  4EMS A;  1KU2 A;  2IPQ X;  4I76 A;  4AYB A;  3LSH A;  1UAA A;  3PNT A;  2DOF A;  1EKE A;  4A3B J;  1P7I A;  2DU9 A;  3K4N A;  1T33 A;  5L3E A;  4CYC A;  2PMU A;  4IHT A;  5EG0 B;  4L18 B;  2JJ7 A;  2DJN A;  3OV8 A;  2CUZ A;  2IS2 A;  2LMD A;  3FM3 A;  3C2G A;  2VC1 A;  3JTH A;  2STT A;  1SC7 A;  5L3D A;  2EIL H;  2E7X A;  2ZME C;  4RGR A;  3BOQ A;  5B3S H;  1IDY A;  3V7R A;  5BPD A;  2QSG X;  1G6N A;  1XGM A;  3OS2 A;  2XHK A;  2HGC A;  3HJE A;  5FO5 A;  1OR7 C;  4NC7 A;  4K2E A;  4XMY A;  4D5C A;  3OY9 A;  5LGT A;  3HRT A;  3C18 A;  1GT0 C;  1ZG5 A;  2KRC A;  3PQK A;  3PSI A;  3ZR8 X;  1Y1W J;  4NNJ A;  4U0Y A;  4ENN A;  2WY7 Q;  4LMY A;  1JHH A;  3KLN A;  5D4R A;  4MTD A;  1TL8 A;  3VSK A;  2DPU A;  5D5W B;  1FY7 A;  3HOY J;  1H9G A;  3M8J A;  4P1W A;  1B1B A;  1MGT A;  2MA3 A;  2R7U A;  2R5Z B;  2FML A;  3BY6 A;  2M8G X;  2ZME A;  3A0B C;  1MZB A;  2L7Z A;  5FKM A;  3TOB A;  3DKX A;  3LAJ A;  1BR2 A;  1R4M B;  2A5Y B;  4L0Y B;  3PO2 J;  5DEQ A;  4RGX A;  4S05 A;  2RDP A;  2JVH A;  1ZAO A;  1X3W B;  2FRH A;  1XD7 A;  3L2R A;  1JJ6 C;  1U6G A;  5L3B A;  1AKH A;  1TWC J;  3DP7 A;  2A3S A;  4BXF A;  2PEX A;  2KIM A;  5M5W J;  1D0X A;  1OMI A;  4LGW A;  2A5W A;  4AWX B;  2KZG A;  1X1D A;  4LG0 A;  3I53 A;  2FQ4 A;  1HST A;  1K7A A;  3G73 A;  4U0V A;  1DQU A;  3S93 A;  1VQ6 I;  3GZN B;  4M9Z A;  2CH0 A;  2QCO A;  3J7A O;  2HZT A;  1MD0 A;  3QU3 A;  1JXS A;  2E71 A;  4I0B A;  2K86 A;  4XOR A;  5GAD J;  2EIK H;  3HSE A;  3H3Z A;  5D8K B;  1IF1 A;  3IHU A;  3FX3 A;  2P5L C;  5E8G A;  2AO9 A;  2HOE A;  3C7J A;  4HV6 A;  4M3B A;  1R71 A;  1RI7 A;  4NHJ A;  3BWG A;  4M3F A;  5E79 C;  3F72 A;  2EIN H;  2MC4 A;  3DEE A;  4IO9 F;  4DZJ A;  2IS6 A;  3HOT A;  2E19 A;  1Z1D A;  1XMX A;  5GPA A;  2IA2 A;  3GTK J;  2DMP A;  2FOK A;  2W1O A;  2PMZ N;  1F5T A;  2UWM A;  1G3S A;  2GA1 A;  2V6E A;  3B73 A;  2XF7 A;  3IH3 A;  5CLS A;  1I6X A;  1MDM B;  3H0G J;  2XVC A;  3WOD F;  4EGZ A;  2YR2 A;  3CCU I;  4C2M J;  4OIN F;  1Y39 A;  1IRF A;  1WVR A;  2W4S A;  4PDK A;  5TGT A;  4G9Y A;  3RCO A;  3LSI A;  3TMO A;  5M3M J;  1VQ7 I;  4NBQ A;  1U9N A;  1XGO A;  3IRR A;  3VYR B;  2P6S A;  3F6O A;  1B4A A;  4BY7 J;  1OJL A;  2L9N A;  4EJU A;  5JVT A;  3A01 A;  1T2K A;  2IRF G;  5EYR A;  4I98 B;  3TO9 A;  1F36 A;  1G8X A;  2JA5 J;  3A2K A;  4CSW A;  4DNC A;  3K70 D;  1FPQ A;  1Q1V A;  4EEF G;  1EJ9 A;  5ILU A;  5J6X A;  3JSO A;  4IHS A;  1WKM A;  4M6V A;  4M6X A;  5IY5 H;  4B3X A;  2R7W A;  2ZFW A;  1BA5 A;  1JUS A;  1PYV A;  2WAD A;  4DJA A;  1XB4 A;  1IN8 A;  2UUZ A;  4F52 A;  3O8G A;  2RV8 A;  3M8F A;  3O8H A;  2E1M C;  2PLY A;  2Q1Z B;  3CCQ I;  3HHH A;  2BXY A;  2PMZ A;  4JX4 A;  3E6D A;  2HFH A;  2AQE A;  4MLO A;  2LOO A;  2DMU A;  2QWW A;  3BCB A;  4CZZ A;  1A5J A;  4Y4R A;  4C30 A;  3CLQ A;  1FEX A;  2OBP A;  2HQR A;  4BDZ A;  1BI1 A;  1UCR A;  1XTA A;  3F21 A;  1VQ8 I;  4RGS A;  3OMY A;  3H35 A;  5B1B H;  1DP7 P;  2M1B A;  4A12 A;  2MD0 A;  2BGC A;  2DCE A;  3GW2 A;  4RB3 C;  3HSF A;  1A35 A;  4BXX J;  3BR1 A;  2Z3Y A;  3ABT A;  2QQ9 A;  3QPS A;  3RKW A;  3TED A;  2E5N A;  3KIO A;  4DBQ A;  3H0D A;  3H9G A;  4BNC A;  3W2A A;  1GV5 A;  3F8N A;  2KJC A;  2KZV A;  1BBY A;  4KNY A;  4DW6 A;  4U88 A;  2F5F A;  2XAU A;  1FBS A;  2NS7 A;  3Q0W A;  3WGG A;  3CMA I;  2WBM A;  5LBQ A;  2JK3 A;  3R4K A;  1AWC A;  2X48 A;  1U5T A;  3BPX A;  5LHI A;  4DGW B;  2P4W A;  1W5T A;  1IV6 A;  3HOV J;  2YUS A;  4ENK A;  1X4O A;  4WX9 A;  1G3W A;  1BM9 A;  1X3Z B;  3D5S C;  3IC7 A;  5E3M A;  1DPU A;  2V4J C;  4BQQ A;  2XAF A;  4LK0 F;  5J47 A;  1T0F A;  2LF8 A;  1JI8 A;  1SEU A;  4QLC U;  3CD6 I;  2M3A A;  2G7U A;  2H27 A;  3JRI A;  3B02 A;  1FOX A;  3BRO A;  1V4R A;  3CO7 C;  3PSF A;  3GTG J;  3FZV A;  1KQ8 A;  4G8X A;  2ESH A;  4RAZ A;  5BS6 A;  3JRH A;  1R23 A;  1I1G A;  3K4K A;  2EV0 A;  1ETV A;  2D2W A;  3RJP A;  3WG9 A;  4BAC A;  1BJA A;  3WGH A;  2R7D A;  2LBF B;  4BQO A;  1IC8 A;  4ANJ A;  2ISZ A;  5HNF A;  2H09 A;  3HRS A;  4Q48 A;  1DP3 A;  4P96 A;  1W1W E;  3CUQ B;  3A1Y A;  3DKY A;  5CQE A;  2KHM A;  5D6F A;  5K7F A;  3GTL J;  3W3C A;  2A69 F;  3RYR A;  2DT7 B;  4M9X A;  1BC8 C;  3G3Z A;  4AVZ A;  1MSF C;  1ZGW A;  3HPH A;  4BL0 B;  1SD6 A;  4HX4 A;  3JRF A;  4JQF A;  4C2U A;  1ON1 A;  1J5Y A;  4XKW A;  5DCF A;  4F7Z A;  1FYL A;  5A2Q K;  1X1P A;  5E8I A;  2CGP A;  1FOY A;  4WK8 F;  3LFU A;  2O3F A;  2R3S A;  1FJL A;  4FX0 A;  1M1E B;  3FF5 A;  2Q8K A;  3RIR A;  1XX5 A;  1I3Q J;  2V1U A;  1W4M A;  4XN3 A;  2QSH X;  4HYE A;  4XKV A;  1TZL A;  4YEL A;  2VI6 A;  4QSH A;  4A3E J;  4WCG A;  3OL4 A;  2MAB A;  1IUF A;  4XBF A;  1VQL I;  2GAU A;  2MC3 A;  2LKX A;  2IAI A;  4OIR F;  4B3A A;  4PJL A;  1ZLK A;  4ZC3 A;  4F91 B;  2HU9 A;  1KU9 A;  1BW6 A;  3AG1 H;  4Y7N J;  4QTR A;  2GOM A;  1OYI A;  4XIC A;  1FOK A;  2VIX A;  5ILV A;  3P9I A;  3GO5 A;  1TBX A;  1R5I D;  2RGV A;  4OAY A;  3J7Z I;  4IF4 A;  1SAN A;  4NDL A;  2OZ6 A;  2L4M A;  2H1L A;  1TWF J;  3RZD J;  4Y3O A;  2DDB A;  4A93 J;  1JT0 A;  5IT9 Z;  4EJV A;  2O61 A;  2BW3 B;  3NRV A;  1YIJ I;  2F48 A;  1NHA A;  1RET A;  5DUI A;  4LLL A;  3K2A A;  4OIQ F;  1AOY A;  1GLN A;  1YE9 A;  3K1P A;  1BOB A;  2LH9 A;  4LFU A;  2L3D A;  1U5T C;  3HYI A;  4XOT A;  2OTL I;  4JX6 A;  1RIO H;  2G9W A;  1LE8 B;  3MKY B;  5D5X B;  4V2F A;  3HRU A;  3P9C A;  2VAS A;  1ZGJ A;  4L9N A;  4DQ2 A;  1FNN A;  4KIF A;  1OCT C;  2ZSH B;  3SZT A;  1KU7 A;  3AL0 C;  2A61 A;  1E3P A;  3E5X A;  4RA2 A;  4A2U A;  4CA0 A;  2WV0 A;  4E7L A;  4A0Z A;  5C4X J;  3J81 Z;  2CV1 A;  1OCO H;  1BL0 A;  2OU2 A;  3QOP A;  2KRF A;  3WGI A;  3OYJ A;  2DA5 A;  3H36 A;  4D5F A;  2M9H A;  3FK6 A;  1YS6 A;  5C44 J;  4L5I A;  4Z6Y A;  4GDF A;  4ESF A;  3HG9 A;  4PJJ A;  4FT8 A;  1GDT A;  2DA6 A;  2DOD A;  3BP8 A;  2HNH A;  2Z2S B;  3R0A A;  2O9L A;  4PJ0 C;  3CDI A;  4EM0 B;  4E7J A;  1J9I A;  3WTU C;  2BHZ A;  1S8N A;  2QUF A;  5CYV A;  2CU7 A;  1LFP A;  1D1B A;  3GTP J;  3I54 A;  3BLY A;  3KET A;  1YLF A;  2VQC A;  3JW4 A;  4RAG A;  5FRN A;  1IN4 A;  1OFC X;  5F1R A;  3IWF A;  3MMY B;  4XLN F;  5L3C A;  3GTO J;  5IT9 K;  4BKX A;  5DS9 A;  3R0J A;  3V8K A;  2YX4 A;  2HXO A;  3CCY A;  3ZGK A;  1GUU A;  4N9H A;  4A3J J;  2XF5 A;  5BNG A;  1K79 A;  2WAF A;  1R6R A;  5GAE J;  2ELH A;  1R1U A;  4GFB A;  4X6A J;  2Y0S N;  5F6F A;  2VPL A;  3EUH A;  2DI3 A;  1UHW A;  3BR0 A;  5F04 A;  3OYB A;  3COA C;  1BIA A;  2R7V A;  2WAQ N;  3WTX C;  4P55 A;  1TW3 A;  2ZXH A;  4IRG A;  2HEO A;  4Z2Y A;  3GFL A;  2VBZ A;  3N4M A;  2CW7 A;  4A0Y A;  4Y52 J;  4HSR A;  1SFX A;  5HS7 A;  3ZXS A;  2ZJ2 A;  4GO1 A;  3CJT B;  1FMV A;  2EIM H;  2JTV A;  3CP8 A;  4NUB A;  4UVA A;  2DDA A;  5D6E A;  4B4C A;  3F23 A;  1TWG J;  4HNU A;  3OYH A;  2JUG A;  3FIS A;  3HC7 A;  3A02 A;  3ZPL A;  1JKQ C;  2EFP A;  5LHG A;  2LP0 A;  4BDY A;  3KP6 A;  4XLF A;  3CUO A;  5C4J J;  1U8R A;  5LEK A;  2ZFU A;  4I0A A;  4MTE A;  5DDG A;  1MSE C;  5ICF A;  4XLC A;  1ZYR F;  1WZ2 A;  5KCM A;  4BGD A;  1SFO J;  5TJJ A;  2CYY A;  3ML6 A;  1ETX A;  3G6E I;  3CQZ J;  5IT3 A;  1PUF B;  3SDB A;  2X0L A;  1QGP A;  4AM3 A;  3RPQ A;  2KMU A;  2M0M A;  3M4O J;  1TQM A;  4IOA F;  1FOW A;  2H6C A;  3DXJ F;  1JKO C;  2LBF A;  2BY2 A;  2I5U A;  2WA0 A;  1SAX A;  3EET A;  5FRM A;  2EA2 A;  1LJ9 A;  4CHU A;  3H3V K;  2CUJ A;  2VC0 A;  3A0H C;  2MSY A;  1Y6I A;  2KFD A;  1IZ1 A;  5DD4 A;  2AHQ A;  3LFK A;  1SFK A;  2JSC A;  1X3U A;  2NOG A;  4EM1 A;  3RQI A;  2IGK A;  5FLX Z;  3W6J B;  2K5C A;  4CCO A;  4HDU A;  2Z1D A;  3A4C A;  3Q9S A;  4ZYH A;  3ISP A;  5EG0 A;  1FP1 D;  1N75 A;  5CJ9 A;  3WTS C;  3FXQ A;  3L2W A;  3ZQL A;  1F4K A;  3HOZ J;  3K7A J;  3R61 A;  1KA8 A;  2JMW A;  1HA8 A;  4R1H A;  1STZ A;  2DFF A;  3LNQ A;  1ETK A; 
#chains in the Genus database with same CATH homology
 1IDY A;  1O4X A;  3ZOB A;  5M5Y J;  5K7H A;  5GPC A;  1U78 A;  2HYJ A;  4D5C A;  4C3J J;  1GT0 C;  1LE8 A;  1HF0 A;  1RKT A;  1XG1 A;  4BBR J;  1Y1W J;  2DA1 A;  3G1M A;  3LSP A;  5JLW A;  3HOY J;  1FIA A;  1TWH J;  2NS8 A;  1MH3 A;  2R5Z B;  2N8G A;  3VPR A;  2M8G X;  2XRL A;  2L7Z A;  1RES A;  5FKM A;  4IHV A;  3CDL A;  2K9S A;  1EF4 A;  2LK2 A;  1UHS A;  3PO2 J;  3PO3 J;  5E3O A;  3S1Q J;  2MW8 A;  4XRS A;  4QIW N;  2OPT A;  1JJ6 C;  4M3G A;  1AKH A;  1TWC J;  3SJM A;  1FTZ A;  2LVS A;  2ID6 A;  1H88 C;  1TC3 C;  3HGG A;  5M3F J;  4X1E A;  5M5W J;  4IHY A;  2R92 J;  1W0U A;  4ABZ A;  2E2H J;  1ZTR A;  4M3E A;  3CMY A;  2FQ4 A;  1E3O C;  4J19 A;  4A3L J;  3L1P A;  5IPA A;  2QCO A;  1JGG A;  5EZG A;  3S1M J;  1NK3 P;  3I4M J;  4JX5 A;  2X9D A;  1B72 A;  5DTD A;  2AO9 A;  1BJZ A;  4M3B A;  1FIP A;  2ZB9 A;  1QVT A;  4M3F A;  1ETQ A;  4DZJ A;  3HDD A;  2E19 A;  2G0E A;  2XGD A;  5GPA A;  3S1R J;  1T56 A;  1YRN B;  5J1U A;  3JRD A;  2XGC A;  3GTK J;  2O8K A;  3ZQI A;  2DMP A;  2EQR A;  2WV1 A;  2PMZ N;  1IDZ A;  2JN6 A;  4D7M A;  4DZP A;  5FKO A;  3QPL A;  1VFC A;  1H8A C;  2EH3 A;  3M3Y J;  1U8B A;  2LR8 A;  3IH3 A;  5F0H A;  2M34 A;  3S14 J;  2MG4 A;  3H0G J;  4IHW A;  1P7J A;  2XPV A;  4C2M J;  2HOT A;  3MKL A;  1ZR2 A;  1BW5 A;  3RKQ A;  2JWT A;  3ZQF A;  5IYB J;  5EDN A;  3TW7 A;  5M3M J;  2KT0 A;  1U9N A;  1YRN A;  2H1K A;  2QF7 A;  2EBI A;  3A01 A;  5FKK A;  4BY7 J;  4AYB N;  1D5Y A;  1OJL A;  3DCF A;  1QRY A;  5EYR A;  3RZO J;  3I4N J;  1F36 A;  2B63 J;  2JA5 J;  2EZL A;  3NAU A;  4D7N A;  3FK7 A;  4G12 A;  1Q1V A;  4EEF G;  1FTT A;  3HBL A;  4AUX A;  1B72 B;  1CQT A;  2JA6 J;  2Y9Z A;  1JJ8 C;  2XB5 A;  5FLM J;  4M6V A;  3W6V A;  2HXI A;  5F1J A;  1BA5 A;  1JUS A;  2LLK A;  2NVQ J;  2JA7 J;  1ZQ3 P;  2L7M P;  2DA7 A;  5J1R A;  1UG2 A;  2HDD A;  3S17 J;  3O8G A;  1JTX A;  3WHC A;  3O8H A;  3S2H J;  2W48 A;  5FKL A;  4JX4 A;  4MLO A;  1R9T J;  3IV5 A;  2DN0 A;  4BBS J;  3ZQH A;  2DMU A;  1A5J A;  1MBF A;  4XK4 A;  1FEX A;  1NK2 P;  4A3K J;  1IJW C;  2L0K A;  3HOU J;  2L7F P;  5EZH A;  4W1U A;  3JRG A;  4A3I J;  2R5Y B;  3BT9 A;  5E3L A;  2ME6 A;  3SFI A;  3JRE A;  4BXX J;  3BR1 A;  1K61 A;  3QPS A;  3TED A;  2VUM J;  1ETO A;  1GV5 A;  4DW6 A;  1POG A;  2NS7 A;  3Q0W A;  1Z0X A;  2CJJ A;  2VPR A;  2JK3 A;  1ENH A;  4DYR A;  2X48 A;  3A01 B;  3BR2 A;  2DMQ A;  3FIW A;  4MIM A;  1U9O A;  1IV6 A;  3HOV J;  2YUS A;  3BG3 A;  5E3N A;  5E3M A;  1A6I A;  1AHD P;  1Z77 A;  1RPW A;  1MBH A;  5IP7 J;  5IP6 A;  5IYC J;  2EZH A;  2HQ5 A;  2H8R A;  1VI0 A;  3BTC A;  3MN2 A;  3JRI A;  5JLX A;  4RDU A;  4XRM A;  2WB1 N;  3GTG J;  1APL C;  5M5X J;  1JKP C;  1RKW A;  1X2N A;  5HOD A;  2IEK A;  3JRH A;  3S15 J;  1MBK A;  3FKI J;  4A3M J;  3TP0 A;  3S1N J;  1ETV A;  1WGX A;  4FIS A;  2I10 A;  1IC8 A;  1ZK8 A;  3HEF A;  3BTJ A;  3A03 A;  3BR5 A;  3BG5 A;  4DYC A;  2O7O A;  5EGO B;  5GP9 A;  4IHX A;  4JP0 A;  5K7F A;  3UKG A;  1PUF A;  3B6C A;  3GTL J;  4C3H J;  2EZK A;  1OCP A;  5IOY A;  2ID3 A;  3HOX J;  1MBG A;  3NAR A;  1JT6 A;  1MSF C;  1K83 J;  1MH4 A;  1ZGW A;  1GV2 A;  3JRF A;  2D5V A;  1IG7 A;  4A3F J;  4AC0 A;  2GBY A;  5C3E J;  3HGY A;  3D1N I;  2DMT A;  1ETY A;  2ELK A;  1FJL A;  5IOZ A;  3G1O A;  4L5E A;  3ZQG A;  4V2G A;  1I3Q J;  2COB A;  1AKH B;  5F0C A;  1NTC A;  5F08 A;  5IYD J;  2VI6 A;  4QSH A;  4UUS B;  1WCM J;  4A3E J;  4MFD A;  3BQZ A;  1IUF A;  1JKR C;  4IEJ A;  1JUP A;  3B6A A;  4M3D A;  4BY1 J;  2LKX A;  2IAI A;  1VND A;  5EEA A;  4B3A A;  2R5Y A;  3HKZ N;  3DEW A;  4DYQ A;  2IBD A;  1BW6 A;  1X58 A;  4MO7 A;  4Y7N J;  4QTR A;  2R93 J;  3JRB A;  3ZQC A;  2E2I J;  4XIC A;  4A3D J;  2E1O A;  1GVD A;  4FE4 A;  1MNM C;  1QVU A;  1G2H A;  2KDZ A;  1SAN A;  4NDL A;  5F27 A;  1WI3 A;  2TRT A;  1TWF J;  3RZD J;  1JTY A;  3LSG A;  4A93 J;  1JT0 A;  2VKV A;  2Y2Z A;  1LFB A;  2LFB A;  1ORK A;  3LSJ A;  3OIO A;  1MBE A;  1MBJ A;  1HDP A;  1RET A;  2OF7 A;  3K2A A;  2LD5 A;  2MGQ A;  4UUT A;  5EF6 A;  2R5Z A;  2M2E A;  4RBO A;  1HLV A;  1X2M A;  2YS9 A;  1ZR4 A;  3PM1 A;  2R0Q C;  1HOM A;  3C2B A;  2DA4 A;  4JX6 A;  1IGN A;  2EZI A;  1LE8 B;  3TP3 A;  4V2F A;  5FKN A;  3BR6 A;  3GTJ J;  2CUF A;  3S16 J;  2P81 A;  2CQX A;  2M0C A;  3OOU A;  2JA8 J;  4B1R A;  1JUM A;  1OCT C;  3MVP A;  1H89 C;  2Y30 A;  4JYK A;  3OSG A;  3F0C A;  4W97 A;  2NVY J;  2XSD C;  5C4X J;  2GM4 A;  3G1L A;  1AU7 A;  1BL0 A;  2Y31 A;  3SDG A;  4CYC B;  2DA5 A;  4LOC A;  4D5F A;  3BQY A;  2GLO A;  2HOS A;  2M9H A;  3FK6 A;  2DTZ A;  5C44 J;  1I50 J;  4A3C J;  1GDT A;  2RAE A;  2DA6 A;  2HOA A;  2LY9 A;  2O9L A;  3E7L A;  5J3L A;  1DU6 A;  1LFU P;  2CU7 A;  4HNV A;  3HOW J;  3GTP J;  3JRA A;  3HB9 A;  3Q0V A;  2ME0 A;  3Q0U A;  3BTI A;  2ECB A;  2NVX J;  1TWA J;  1OFC X;  3WHB A;  3GBG A;  3GTM J;  3GTO J;  4BKX A;  5DS9 A;  3JR9 A;  2DMN A;  3CCY A;  2HXO A;  1ITY A;  3BR3 A;  1GUU A;  4A3J J;  3OSF A;  1B8I B;  1HDD C;  5BNG A;  9ANT A;  3Q3S A;  2XPU A;  2CUE A;  1WH7 A;  4GFB A;  4X6A J;  1I6H J;  2Y0S N;  2X6O A;  3BR0 A;  2FX0 A;  5F04 A;  1B8I A;  1HCR A;  2XGE A;  5FLV A;  3IH2 A;  2WAQ N;  4UUS A;  4XID A;  1S7E A;  1IRZ A;  3JRC A;  2E2J J;  5K7Z A;  2CQQ A;  3QQA A;  4I6Z A;  5IP9 J;  4Y52 J;  3BG9 A;  1WPK A;  2DA2 A;  3HM5 A;  2L9R A;  5F0F A;  4B4C A;  1UMQ A;  1TWG J;  1XS9 A;  4FE7 A;  1VF9 A;  3GTQ J;  2VKE A;  3FIS A;  4C3I J;  2Y9Y A;  3A02 A;  1JKQ C;  2K40 A;  2LP0 A;  2K9N A;  5C4J J;  3LOC A;  1Y1V J;  1ETW A;  1MSE C;  1DU0 A;  2FD5 A;  4MFE A;  2XB0 X;  1SFO J;  1XC5 A;  1WH5 A;  3LSR A;  1QPI A;  1ETX A;  3CQZ J;  1PUF B;  2ECC A;  3TW6 A;  4FTH A;  5EGO A;  1RR7 A;  3M4O J;  1ZKG A;  2HI3 A;  2TCT A;  4S0H B;  2NVT J;  1JKO C;  4FCY A;  3H3V K;  2FJ1 A;  2MSY A;  1F43 A;  3S2D J;  2AHQ A;  2K9Q A;  4XRS G;  2R7Z J;  2NOG A;  4I76 A;  3RQI A;  1W0T A;  2XPW A;  2CRG A;  2YU9 J;  4A3B J;  1P7I A;  4CYC A;  1T33 A;  5EG0 B;  5EG0 A;  2JJ7 A;  5J1Y A;  4A3G J;  2DJN A;  2LTP A;  4A69 C;  3BTL A;  3ZQL A;  3HOZ J;  2DA3 A;  5FJ8 J;  3K7A J;  2JMW A;  3IH4 A;  3LNQ A;  1ETK A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...