1OCPA

Solution structure of oct3 pou-homeodomain
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
67
structure length
67
Chain Sequence
b'METLVQARKRKRTSIENRVRWSLETMFLKCPKPSLQQITHIANQLGLEKDVVRVWFCNRRQKGKRSS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords OCT-3
molecule tags Dna binding protein
source organism Mus musculus
publication title Structure of the Oct-3 POU-Homeodomain in Solution, as Determined by Triple Resonance Heteronuclear Multidimensional NMR Spectroscopy
pubmed rcsb
total genus 13
structure length 67
sequence length 67
ec nomenclature
pdb deposition date 1995-02-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00046 Homeodomain Homeodomain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.60 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Homeodomain-like 1ocpA00
5FLVA 2FD5A 4MLOA 3G1LA 2X9DA 3DCFA 3SDGA 2FJ1A 3D1NI 5FKNA 5M5YJ 4DYCA 3SFIA 2HI3A 3JREA 1OCTC 2XRLA 5GPAA 2HDDA 1MH4A 2K9QA 5JLWA 2E1OA 2CUFA 3HOWJ 4D5CA 2MGQA 2Y31A 2M8GX 4AYBN 2M9HA 1X2MA 3SJMA 3S14J 3HOUJ 1TWFJ 2FX0A 1ENHA 3O8HA 2O9LA 4IHXA 5DS9A 5F0CA 4A69C 5FJ8J 2CQXA 5E3OA 4D5FA 1CQTA 5IYDJ 4C3JJ 2JA7J 5J1UA 5IP9J 4CYCA 3JRGA 2PMZN 2NOGA 4M6VA 5E3NA 1IUFA 5BNGA 1XS9A 2TRTA 4JX5A 1BW6A 5GP9A 2EH3A 3HOXJ 5M3FJ 1A5JA 1JUPA 2RAEA 3QPLA 1IRZA 1FTTA 4A3LJ 2ME6A 4A3JJ 4MIMA 3HGYA 3HKZN 2NS8A 3I4NJ 3LSJA 4A3FJ 1OJLA 4A3KJ 2OPTA 2X6OA 3Q3SA 5K7ZA 1TWHJ 2Y2ZA 4X1EA 2NS7A 1IDYA 2XPWA 3OIOA 3JRDA 2NVQJ 3IV5A 2R5YA 4RDUA 3L1PA 3FK7A 1MSFC 2R5ZA 2ZB9A 3HBLA 1B8IA 1YRNB 2R7ZJ 2LLKA 2QF7A 5EGOA 3MN2A 4A93J 1W0TA 1ZQ3P 1HOMA 5IP7J 1BA5A 1HDPA 1WI3A 2LR8A 5IPAA 2LTPA 5IOZA 3CMYA 1Y1VJ 2LK2A 4X6AJ 1PUFA 1B72B 3GTMJ 4FE7A 3B6CA 1WH7A 2NVXJ 2DMNA 1MH3A 4BKXA 4JP0A 2EZLA 4W1UA 4FCYA 2DMTA 2ME0A 1RKWA 1OCPA 3JRFA 3GTGJ 4EEFG 2P81A 5M3MJ 2HQ5A 3CDLA 2ECCA 3G1MA 1XC5A 3PO2J 3BR5A 1P7JA 3S1NJ 2L7FP 4B3AA 2XPUA 3BQYA 5IYCJ 1JUSA 1GUUA 4A3EJ 4UUTA 3GTPJ 2E2HJ 3S15J 3GBGA 2HYJA 2K9NA 2VKEA 1VI0A 1VF9A 1FIAA 4RBOA 2D5VA 2ECBA 2EZHA 3C2BA 2FQ4A 4IHVA 4M3FA 2DA2A 1QVTA 5EEAA 2CQQA 1EF4A 5FKOA 3BG5A 3LSGA 3TP0A 2IAIA 2WB1N 1ITYA 3JRBA 3HDDA 1JTYA 1ETWA 1JGGA 3HM5A 1RESA 3DEWA 5F08A 4M3EA 1LFUP 3ZQLA 3FK6A 1ZR4A 1QPIA 1MNMC 1WCMJ 1ETQA 2GBYA 1LE8A 2E2IJ 1RR7A 3GTKJ 3BTJA 2JA6J 2L7MP 1UHSA 1S7EA 3JR9A 4W97A 1Z77A 2QCOA 3QPSA 1T56A 3BTLA 5IYBJ 5EG0A 2MG4A 5EG0B 4IEJA 2HOSA 2YU9J 1ETXA 1GV2A 1Y1WJ 1AHDP 1P7IA 2XGCA 2XGDA 3BTCA 5K7FA 1ETVA 2L9RA 3BR6A 2TCTA 1WGXA 3HOYJ 1QRYA 2VKVA 2ELKA 4NDLA 1RKTA 4A3CJ 2E2JJ 2DA5A 1MBEA 4HNVA 2ID3A 4I76A 3CCYA 4ABZA 2DA4A 4CYCB 1T33A 2IEKA 1WH5A 2LY9A 4I6ZA 2HXOA 1ORKA 2K40A 1LE8B 1HDDC 5E3MA 5F0FA 2OF7A 1DU0A 2EBIA 1NK2P 3FIWA 2ID6A 3ZQFA 1I50J 2JWTA 2L0KA 2XB5A 1W0UA 3HOZJ 1ZGWA 1FJLA 2K9SA 4C3HJ 4JYKA 3S2DJ 1IG7A 3MVPA 4JX6A 3LOCA 5IP6A 1OFCX 2JK3A 2H1KA 1MSEC 4M3BA 1TC3C 5EGOB 2LP0A 4MO7A 1SFOJ 2W48A 3S16J 1YRNA 1U9NA 5C4XJ 2MW8A 1I6HJ 1JKPC 5F1JA 3WHBA 1X2NA 3FISA 3OSFA 3M4OJ 5M5XJ 1I3QJ 1H89C 4AUXA 2IBDA 4DZPA 1ETKA 1JKRC 5F0HA 2VPRA 2HOAA 2JA8J 1VFCA 3LSRA 4DZJA 1HLVA 1VNDA 3O8GA 3CQZJ 1JKQC 5K7HA 1HCRA 1POGA 2HOTA 2B63J 2NVYJ 4FISA 3Q0UA 5JLXA 4XRSA 1IV6A 3GTQJ 2KT0A 1UMQA 3JRHA 1BJZA 3IH2A 2VUMJ 3S1RJ 2DA7A 3E7LA 3ZQIA 1G2HA 3NAUA 1TWGJ 4QSHA 1E3OC 3OOUA 1B72A 3BG3A 3H3VK 4QIWN 2CUEA 3W6VA 2O7OA 2LFBA 1MBKA 2R5ZB 2DA1A 2NVTJ 5GPCA 4A3IJ 3H0GJ 1QVUA 1X58A 1ZR2A 3BR3A 1FTZA 1IC8A 1XG1A 4DYRA 4XRMA 4Y7NJ 3ZQCA 1U9OA 2DA3A 5FLMJ 4FE4A 3BT9A 3PM1A 3I4MJ 5M5WJ 4B1RA 3FKIJ 2M34A 2GLOA 3K2AA 4V2FA 2JA5J 4C2MJ 5EYRA 1WPKA 2DMPA 1GV5A 2L7ZA 3BR0A 4QTRA 4G12A 2Y9ZA 1K61A 4XRSG 5C4JJ 1UG2A 3JRAA 2XSDC 3GTLJ 4XIDA 1FIPA 2H8RA 1ZKGA 3MKLA 4S0HB 1F43A 2DTZA 2LD5A 4BXXJ 4XICA 3Q0VA 3IH3A 5HODA 5F04A 3M3YJ 4Y52J 1NK3P 1TWCJ 2X48A 5DTDA 1U8BA 1RETA 2N8GA 3A03A 3HGGA 3JRIA 2E19A 3TW6A 3F0CA 3LSPA 1R9TJ 1RPWA 5J3LA 4DW6A 4IHYA 3S2HJ 4XK4A 2JJ7A 3BTIA 5EDNA 3IH4A 2AO9A 5EZGA 1DU6A 1K83J 5FKKA 2CJJA 4LOCA 1GDTA 4M3DA 3TP3A 4D7NA 1D5YA 2Y0SN 3BR2A 2DMQA 5EF6A 2O8KA 5J1YA 2YUSA 1APLC 1GVDA 1JTXA 4B4CA 1TWAJ 3ZQGA 3B6AA 3BG9A 3Q0WA 2XGEA 1JT6A 1AKHB 4A3DJ 3RQIA 2XPVA 2EZIA 4M3GA 5C44J 1BL0A 4V2GA 1LFBA 1JJ6C 4A3MJ 2R0QC 4MFDA 5IOYA 1IGNA 2HXIA 4IHWA 2Y9YA 4C3IJ 2I10A 3K7AJ 4AC0A 1MBFA 2EZKA 4BBRJ 3PO3J 3ZQHA 3S1QJ 3UKGA 2XB0X 5FKLA 5F27A 1GT0C 1SANA 4UUSB 3GTJJ 3OSGA 3S1MJ 2CRGA 3RZDJ 3A02A 4DYQA 3ZOBA 1BW5A 2JMWA 1JKOC 3GTOJ 2AHQA 4A3BJ 5EZHA 4BBSJ 3A01B 2R93J 1Q1VA 3NARA 1B8IB 1JUMA 2EQRA 4BY1J 1F36A 1AKHA 5FKMA 1HF0A 2DJNA 1JJ8C 2R92J 3LNQA 3QQAA 4L5EA 5J1RA 1A6IA 1FEXA 1ETOA 1Z0XA 5C3EJ 1H8AC 1U78A 1ZK8A 5E3LA 2CU7A 2DMUA 2KDZA 1MBGA 1H88C 4D7MA 3RKQA 3JRCA 4UUSA 1NTCA 3HOVJ 4A3GJ 3G1OA 3BR1A 4J19A 2M2EA 4GFBA 1ETYA 4JX4A 2G0EA 3S17J 9ANTA 1MBJA 3A01A 1MBHA 2DN0A 2MSYA 1JT0A 3TW7A 4MFEA 2DA6A 3RZOJ 2VI6A 2Y30A 1IJWC 2JN6A 3TEDA 1AU7A 4BY7J 3HB9A 1ZTRA 3WHCA 2WAQN 2YS9A 2R5YB 4FTHA 3VPRA 1PUFB 3HEFA 1IDZA 2M0CA 2GM4A 2WV1A 1O4XA 2LVSA 2COBA 3BQZA 2LKXA
chains in the Genus database with same CATH superfamily
3OS0A 2FD5A 2BOLA 5DYMA 3D1NI 1S29A 2QM3A 5M5YJ 2HDCA 3VDXA 1SC7A 2EK5A 3MWMA 3CMAI 3FMSA 2HI3A 3RPQA 3IL2A 1Y8QB 2E1OA 2CUFA 3RCOA 5IT9K 1PP7U 4KISA 4RAYA 3WG7H 4D5CA 2OU2A 4AYBN 4BNCA 4EVIA 3WTVC 2LRDA 3IAS2 2XC7A 4FX0A 3CJQB 4HBLA 2O9LA 4XLFA 3OY9A 2DOFA 4IHXA 1LEAA 1TT0A 3K6GA 4UV8A 4CZZA 4P55A 4A69C 1ZG1A 2LY2A 1CQTA 1Y56A 5TRDA 4C3JJ 5J1UA 5ILUA 2LREA 3JRGA 1R5HA 1RUOA 1GVJA 2IVMA 4M6VA 5A2QZ 5FB2A 2KIFA 1GXPA 2LG4A 1IUFA 2XAQA 5BNGA 1XS9A 2IGKA 2TRTA 4JX5A 2JUCA 1C0WA 3HUGA 1IUYA 3E6MA 5D5XB 2RAEA 3D5LA 1PP8F 4WCGA 1T2KA 2ME6A 4A3JJ 4BL0B 1USSA 1IXSB 1FOXA 1MMSA 1OR7A 2V6EA 4RA2A 5FD6A 1LEBA 2X6OA 3DKYA 5GTHC 1TWHJ 2Y2ZA 3ABUA 1HBXG 4CGZA 1QNTA 2IP2A 3GFLA 4A0YA 1HW2A 4Y3OA 2XPWA 1R4MB 4E70A 3JRDA 2NVQJ 3MKYB 1Y0UA 2UV1A 2VC1A 4NUBA 2BYVE 3QRFF 3QWLA 4JK1X 1B8IA 1E2XA 4HSRA 1YRNB 5EGOA 5E8IA 4A93J 4IQJA 4HNUA 1YW9A 4ZTJA 4LFUA 4BEHA 2V1XA 1QQIA 1SD5A 2Y75A 3TBIA 4YFXF 5IP7J 3K70C 2P5KA 2KFDA 3IWFA 1DP7P 1WI3A 1FMWA 4BDYA 4ESJA 3S8PA 3CMYA 1N75A 2R7RA 2E60A 2XASA 4RAFA 1B72B 2UZKA 4FE7A 2L4MA 2TDXA 2XGXA 2DMNA 5H20A 4BKXA 4JP0A 4W1UA 3N97A 1OYYA 1RKWA 2DFHA 4LGWA 4WWCA 2D1VA 5JVGF 2P81A 5EEGA 4AYBA 2HQ5A 2FEZA 1ZHFA 4G7OF 4YIRX 2KIUA 2L9SA 2ECCA 2LOOA 2XAUA 1FSHA 1ZLKA 5HS8A 1R4NB 1LB2A 3SFZA 3H36A 1KZHA 3FZVA 4IPAA 1KQ0A 3OOPA 4XRFA 1IN5A 2E2HJ 3S15J 3GBGA 2VKEA 3MKZA 2FBHA 3RTRA 2B7EA 5E1ZB 4RBOA 5CVVA 2EZHA 3DU6A 1A35A 4Y4RA 1USTA 5EEAA 2CQQA 4OU0A 1W7PD 2OBPA 2BBYA 3LSGA 4EV0A 2WB1N 4EJUA 4ZZLA 5KNLA 3CCVI 1ITYA 5LFAA 2DPDA 3WTUC 1ULYA 2M45A 1ZELA 5DUIA 5F08A 5J4VA 2ZJ2A 3RKXA 1O3SA 3OMYA 2CGPA 1JGSA 2X85A 1XDUA 1MNMC 3ZMDA 4JOMA 4XONA 2P7CB 1WHUA 4IZZA 2JSPA 2J5OA 5J40A 1F4KA 2L7MP 1UHSA 3ABMH 1G3SA 1K6YA 1XSXA 2HZTA 3J80K 1T56A 1Y8RB 4A6EA 3BCAA 4E7HA 2P4WA 4DBRA 4IEJA 1YIJI 1I1GA 2M7AA 1B9NA 3BZCA 1ETXA 4M6YA 4UUVA 1S7OA 3CCEI 5HDKA 5K7FA 2XGDA 2L9RA 3BPXA 1WGXA 4KIGA 1LDJA 1Z67A 5HOOA 1DPRA 3BWGA 3WTZA 3F6OA 1MMGA 3LSKA 2E2JJ 2A6EF 1MBEA 1OYIA 2MA3A 4HNVA 2EFQA 3DFGA 4N9HA 5L3GA 3CMMA 4BJ6C 1T33A 3EPZA 3R61A 2LY9A 4I6ZA 2HXOA 4U88A 4XKWA 1EKEA 3I5UA 3MEXA 1SFUA 1N77A 3K1NA 1UJ8A 4BE2A 1T6SA 3I3LA 2HYFA 2JWTA 1W0UA 3HOZJ 2X1EA 3I59B 3S2DJ 3W2WA 2O03A 4JX6A 2JRTA 3LOCA 1K4SA 5J8CA 1VZ0A 2H1KA 2HU9A 4M3BA 3F21A 5LD2C 4LIVA 1ZRCA 1X3WB 2W48A 1SFXA 3FXLA 2D1HA 4RAGA 3TGNA 1D5VA 2V26A 3BJ6A 5C4XJ 2ZMEB 2VC0A 4PFOA 2X1DA 2MW8A 2HNHA 2R7UA 1JKPC 3WHBA 3OYEA 3IRQA 4HF1A 1I5ZA 3HPGA 4XM3A 3CZ6A 4XN3A 1H89C 1FX7A 4Q47A 3FBIB 1HQCA 3T1BA 3DKXA 5JHUA 2LBFB 4CZCA 4HLYA 5D8LB 2HOAA 1EH8A 2EINH 3FM3A 2BGCA 3MFKA 4XLAA 4ZC3A 4MEYF 4U7BA 1HLVA 3U1DA 3CQZJ 4AU7A 2DT5A 4E7LA 1KU2A 3KPHA 1XCBA 3R4KA 2HOTA 2B63J 2LYCA 4FISA 5JLXA 4XRSA 2K86A 4S04A 2NAZA 2KJBA 2VUMJ 2KL4A 2HFHA 1WJ5A 1X1PA 2KDOA 4IRIA 3E7LA 3ZQIA 4GCVA 4YIIA 3QOEA 3NAUA 1E3OC 3CJNA 4N9IA 2W7NA 3O3KA 4ITVA 5CVJA 3AFHA 3PQJA 5K5RA 1D1AA 2PMHA 4IHTA 3S93A 1XX5A 4H4KC 2VT3A 3E1SA 3KP2A 3CO6C 4GXOA 1MBKA 2FF4A 2DA1A 2R5ZB 2HEOA 4PSWA 3DBRB 1K78B 3CUQA 2B0LA 1S6LA 1X58A 1ZGJA 4M71A 1X4OA 1ZR2A 1UAAA 1FTZA 2M87A 3BDDA 5BQTA 2ZJPF 1CF7A 4HG2A 4L18B 2VJJA 2W57A 3FXKA 1XDSA 5E1WA 1J9IA 5FRMA 3GFMA 3ZN1A 5LLQA 3W2VA 2R7DA 1GHCA 4B1RA 1XPXA 2M34A 2GLOA 2V1DA 4YRVA 5EYRA 2DMPA 1GV5A 2Y9ZA 3KZZA 1BI3A 3H9GA 3V42A 1VQ7I 4OWRB 2R3SA 5ICCA 3KYLA 4ZDLA 3LWFA 3GTLJ 2H8RA 1FIPA 1I6XA 3E3VA 2GQQA 1ZKGA 5LGUA 4CA0A 4S0HB 5CVRA 3H3UA 4BXXJ 2LD5A 2L02A 2NVUB 4E7KA 1H9GA 3RJPA 1IN6A 1NK3P 1TWCJ 2ZJQF 4OIQF 5D6EA 2X48A 3OR2C 1RETA 1D0ZA 5BPDA 1EA3A 1I39A 1YW7A 2E19A 1FSEA 3F0CA 1MMDA 3DPLC 1RPWA 2WB1A 5J3LA 2W82A 3IH4A 2AO9A 1JHHA 3OIQA 2VBYA 4G7ZF 2I8DA 3TP3A 2ZXWH 1R49A 2YR2A 1WJAA 1QZEA 1YS6A 2EV0A 3F8MA 4NC8A 2DXIA 3N05A 2P5LC 2LSOA 1E3HA 3CTAA 4KIFA 2QEXI 4M9ZA 2XKOA 4M9SA 1VQOI 5J6XA 5LGNA 1QGPA 3KEYA 4R8HA 4ZYHA 3BG9A 3Q0WA 2VQHA 4N0BA 2XGEA 4MTDA 1OCCH 3OYBA 1HSTA 3RSNA 2ETHA 2ZNZA 2XPVA 2EZIA 3Q9VA 2VXZA 3KP5A 2ZCWA 4CCLA 4DIQA 2E7XA 3F9KA 3C2GA 3PSFA 3D0SA 4IHWA 4C3IJ 2WADA 4AC0A 1MBFA 1N25A 3HRMA 1U2WA 2W1OA 2CQKA 3S1QJ 3LFUA 2XB0X 2ESHA 1GT0C 4KDPA 2Z99A 1V54H 3GTJJ 3OSGA 3A02A 4BQQA 5F1RA 1J0RA 2LDUA 1BW5A 3ML6A 2JMWA 1JKOC 5EZHA 3K70D 3CESA 3NARA 5B1AH 3O2PE 1AKHA 2DDBA 2M5WA 1IRFA 1PYVA 5FGMA 4R79A 1R7JA 3QQAA 2OCEA 5J1RA 2BY0A 2FMYA 3SYTA 1T8IA 1FEXA 2M0MA 4UVBA 2L9VA 1H9TA 2BY3A 1X1CA 1Z0XA 1Z21A 3R0AA 1ZK8A 4LK1F 2JZYA 1BIBA 1WZ2A 1W5TA 2QKMB 1V5GA 4D7MA 1A31A 3O6BB 1Y6IA 3I56I 3SHFA 5ICFA 3AKZA 1S72I 3K4JA 2KP6A 4B47A 1FOKA 2L54A 2RDPA 2BHZA 2CS3A 4GFBA 5BMZA 2G0EA 3M8FA 3S17J 3G71I 3A01A 1VQ8I 2GOXB 1RR8C 5HS9A 1JT0A 1YFHA 4HQMA 4MHGA 3T8TA 4HYEA 2M4GA 2Y30A 1IJWC 5E17F 4AIDA 2IS2A 3G3ZA 3BJOA 4LK0F 2F48A 1QU3A 4RB1A 4HV6A 3V7RA 4IF4A 2YS9A 2XIGA 3IP4B 3VPRA 2VQLA 1IRGA 1SD7A 2RGVA 3H35A 4RGRA 3IWZA 4HW0A 2E5NA 4C9YA 1AA7A 4L5JA 4HAMA 2COBA 3KP4A 4YEJA 1YW8A 4PDKA 1U3EM 4MLOA 2D45A 2NNNA 5H6RA 1X1DA 3SEQA 1TT5B 3OL4A 2OQGA 2HVRA 3L2QA 1MD0A 2GOMA 4M72A 1IF1A 4XMYA 2OCCH 3WU1B 3EUHA 4YIFA 1P92A 2Q1ZB 2XRLA 2ZFUA 5GPAA 2HDDA 2Z33A 1UZCA 1P2FA 5JLWA 1BI2A 2BZTA 2CG4A 1T98A 1KQ9A 2FOKA 5LHGA 3EYIA 3DTEA 1BM9A 3OYFA 1T0FA 3SJMA 1LNWA 2GIZA 1NG7A 1ENHA 2QVOA 3O8HA 3KZYA 2KLOA 4M9XA 3CDIA 2RQQA 5F0CA 3MD2A 1D1BA 3BJAA 3QU6A 5IYDJ 2JA7J 3RYPA 2DT6A 4UVAA 5DDGA 3IHUA 1OLTA 1ON2A 1ACIA 2PFBA 1BC7C 1MIJA 1S5LC 5CQGA 2W24A 5M3FJ 4UY8I 4IVNA 3HSRA 1IRZA 3GZ6A 4HF0A 5GAGJ 2DYSH 1WFXA 3P7NA 3QYFA 3LSJA 2KRCA 1YJWI 3WGHA 1K78A 2F5DA 2M1BA 2PJPA 2CWEA 1MJAA 2CW0F 2OPTA 3OYCA 4MQVA 2A6TA 2MYSA 4P9FA 3FKJA 1TQIA 4AWXB 4KT6A 2R5YA 1TTYA 3TO7A 4IO9F 3T0YA 1FWZA 2COMA 3JAMZ 4PJMA 1KQ8A 2QF7A 1SAXA 1AWCA 1YITI 3CUQB 1I1SA 3I4PA 1J09A 4FT8A 1BA5A 1XGOA 1HDPA 1YX3A 2ZXHA 2PMUA 3IRRA 3H0DA 3J7AY 5IOZA 1Y1VJ 2LK2A 2GZWA 3I58A 2AXLA 1PUFA 1REPC 4EQQA 5CLSA 2CV1A 3PQKA 3GTMJ 2QKLB 4RAZA 4OAZA 3B6CA 4FQGA 1WH7A 1UELB 2NVXJ 2IS1A 2EZLA 3PIPF 1ZN2A 2ME0A 2RN7A 1LVAA 1OCPA 2DU9A 3ERED 1R71A 3GTGJ 4EEFG 5M3MJ 4M73A 2CV2A 3CDLA 4XQFA 2ISYA 2H94A 2NYXA 4BS9A 3DPTA 3G1MA 1YTYA 2K9MA 2BEOA 2DTRA 2QQ8A 2DDAA 1O7LA 3CF2A 2EFOA 1J59A 2GA1A 3BQYA 5IYCJ 2PLYA 2V79A 5JHFA 1Q1HA 1B4AA 3UR3C 4D0PA 5GAHJ 2CQ7A 2DAOA 2QYOA 3K4LA 3DU5A 2BY1A 1FIAA 2A61A 2P5VA 2OD5A 4I7HA 4XLHA 1MDMB 2ECBA 5LEJA 2VOOA 4V19K 1ZLJA 4M3FA 3SXYA 4YFKF 3BG5A 4DNCA 2HGCA 5LEKA 1SD4A 3GFJA 4UNOA 1VQ6I 2RKHA 4BQOA 2UUZA 3BZ6A 3HM5A 4HX4A 2LC2A 4U0WA 1XCVA 3LA3A 4U87A 3SEZA 4DBQA 4GDFA 3HXLA 2QSGX 1YJ9I 4RB2C 1FBSA 1WI9A 2OZ6A 1WCMJ 5TISC 4BACA 3ZMUA 1RR7A 2H09A 3WE3A 4CXFA 3F23A 1ON1A 3BTJA 1G4DA 3GTKJ 4KN7X 3JR9A 1Z77A 2XAJA 1ZRFA 2IA1A 3QPSA 2MG4A 2HOSA 1R00A 4I02A 3HJEA 2XHKA 2R7TA 2P6TA 3KEOA 2GAUA 3KP3A 4HSTA 2K4JA 3L9FA 1MKMA 2PI0A 4L5IA 4XLCA 4EM0B 1F5TA 1PUEE 2DA5A 2RQPA 2QQAA 4XN0A 1R36A 3VEPA 1SD6A 1WH5A 3R6SA 1ORKA 2K40A 2VKHA 5FFXA 5E3MA 2DI3A 2OF7A 1W7PB 2EBIA 5F0FA 4BJTA 2ID6A 2OC6A 3PNYA 1Z6TA 1QZYA 4GGGA 2HTJA 4N4OB 3J81K 2XB5A 2CW7A 3E97A 1MDMA 3QPHA 1ZGWA 3J81Z 3S1MJ 4XLNF 3B02A 2VBXA 3DQVC 3CDHA 4JYKA 1BC8C 1IG7A 5IP6A 3ASOH 3I64A 6PAXA 1MSEC 4DGWB 4Y15A 3CC2I 3QYEA 2IRFG 1HW1A 5EGOB 1SFOJ 3S16J 1U9NA 2HQRA 4ZH4F 1CF7B 1I6HJ 3NRVA 2XF5A 5CJ9A 4LMYA 1JHFA 3WTYC 5HLIA 2YX4A 3N4MA 2F6CA 1G59A 4KT5C 4RLQA 3COAC 3M4OJ 3OSFA 1FYMA 3AAFA 5M5XJ 1I3QJ 3VSKA 4DZPA 2IXSA 4S05A 5D5WB 3P9CA 4BE1A 4YELA 2KQRA 4KA4A 2JA8J 5H6QA 1VFCA 1DDNA 3TQNA 3NWTA 3O8GA 2ZFWA 2BV6A 2DBBA 4L9JA 1R58A 4LD5A 1NH3A 3TMOA 1P4AA 4QPOA 1POGA 2E7WA 2MH2A 3VWBA 4P96A 2KT0A 3GTQJ 5E20A 1VQ5I 3JTHA 2HR3A 2WBMA 1QA6A 1UHMA 1BJZA 3KIOA 2F4MB 2DW4A 4BEHB 5KCMA 1OQYA 2KRFA 3E5XA 1J2XA 2DA7A 3ERMA 3ZRGA 3OYKA 1TW3A 3FMRA 1TWGJ 1SVMA 1W7PA 1FBUA 5FLXK 4FHTA 2FBKA 4QIWN 3E6DA 5CVUA 1KONA 4WF2A 3HTUA 1KGSA 2CUEA 1SMTA 4EJWA 2O7OA 1OPCA 5DM6F 1YQAA 2LFBA 1SMYF 4XBFA 4NHJA 2M3AA 2XV4S 3CCLI 1YO5C 4XKBA 4XRMA 4Y7NJ 1IV8A 2HPIA 4FE4A 2LF8A 1Z9CA 3BG7A 4EM2A 5FRNA 1PVEA 3I54A 1O3QA 3GF2A 1WJBA 2OAZA 4QTRA 4U0VA 1K61A 1UG2A 4G6TB 2XRNA 1TQPA 3CJRB 4I09A 2BVMA 4Z6YA 1IAWA 3V8KA 2MBFA 2XSDC 4LLNA 2FU4A 1WJEA 2JTVA 3MKLA 1F43A 3K9TA 3M3YJ 3G6EI 1VTNC 5HLGA 5DTDA 1U8BA 4BH9A 3FBNB 3A03A 3HGGA 3JRIA 3PFIA 4Y33A 3TW6A 4B43A 2XROA 2VXDA 2VASA 5DEQA 4IHYA 2JJ7A 2CJJA 3KZIC 5FKKA 1GDTA 4F7ZA 4EJTA 2IA2A 4M3DA 2VL8A 1HC8A 4BJ5C 4Z2YA 2KKOA 2CYYA 2DMQA 3DBLB 3FXUA 5BOXA 1K79A 1CGPA 2YUSA 1S9HA 2FBIA 5D5UB 2VPLA 4OMZA 3LAPA 2KIQA 1GVDA 1JTXA 2IW5A 1B1BA 1JE8A 2KISA 1ZGAA 5ILSA 1IN7A 1FNNA 1X19A 4GRIA 1T39A 4II3A 2A6HF 4UHTA 4AD9A 5CKTA 4A3DJ 3FXQA 3RQIA 3ZGKA 5C44J 1DPUA 4A2UA 1JJ6C 1LUJB 1U5TB 5IOYA 2E71A 3OR1C 3ABLH 3ZN0A 1DGWY 2ICWG 2QUFA 3ZMTA 5K5QA 3ZQHA 3PO3J 2ZXIA 4GO1A 3UKGA 2GXBA 3WU2C 1K6OA 4BXUA 4UUSB 4HX8A 3RZDJ 4PK4A 3K1PA 3IC7A 4BU2A 4C2TA 4UXNA 4PGHA 3ZQ7A 4PJJA 2O0YA 1FZPB 4A3BJ 5JR3A 3RDIA 1OR7C 3LL7A 1WJDA 1Q1VA 3C7JA 4QLCU 3E5UA 3OIPA 1JUMA 2A05A 3RPUD 4FX4A 5IT3A 4BY1J 4YG2F 2HDWA 4CCJA 1TZLA 2R7SA 2IPQX 2NXNB 4L5EA 1J7KA 1K7AA 2O6GE 2O3FA 4IRHA 1ETOA 4HNTA 3KYDB 3PUBA 4ZDPA 3BCBA 1ZG3A 2VB6A 2W84A 5J4YA 3EUKL 3I53A 1S3JA 1ZH5A 4A3GJ 2KZGA 4J19A 1D8JA 5E18F 1ETYA 3D5RC 1GLNA 2X1CA 1TBXA 1XN7A 5DCMB 4MTEA 4CCMA 2X51A 1WQ2A 1OCRH 3W3CA 3TW7A 4MFEA 1QBJA 1SAUA 3RZOJ 4II2A 4RS8A 5DD8A 3CCSI 2JN6A 3TEDA 1D3YA 4I99C 4BY7J 3HOSA 1W4MA 2CSOA 2DLLA 3PFYA 1BR1A 3OV8A 1KU3A 4BE0A 1BJAA 2IGNA 2R5YB 4MEXF 2STWA 1D1CA 2VIXA 4LB6B 1PUFB 3L2UA 2LBFA 2M0CA 2K9LA 2WV1A 2GM4A 2NRAC 3ULQB 4E7ZA 3A0BC 5FLVA 4KUMA 2X9DA 2KPMA 2FJ1A 2X0LA 3SDGA 4FASD 4KICA 2JRMA 4I98B 3ECHA 4BDZA 3ZR8X 4E6KG 5GAEJ 3W2AA 2G9WA 2QA4I 1B6AA 3WODF 2KJCA 4XORA 3SFIA 4YFNF 3X2QH 5LGTA 2VQCA 1OCTC 1MH4A 2K9QA 2DYRH 3QOPA 3GFIA 2IJLA 5KK1A 3T8RA 2Y31A 2M8GX 5DV5A 3R0JA 4UB8C 5HVQC 2O8XA 3S14J 3M1CA 2EA4A 2FX0A 2HKOA 2KHMA 3HOUJ 5CYVA 3W6KB 1BOBA 5FJ8J 2CQXA 5E3OA 1Y0NA 2P7VB 3ABKH 2KRHA 3HC7A 3LQRA 4UB6C 5LRSA 1VQNI 2H6CA 2L5QA 1A6QA 1V4RA 2LKSA 3QPTA 2Q2EB 2P6SA 4E7JA 4XLEA 5HDGA 1AOYA 2BY2A 1E3PA 2X6WA 3LAJA 2MC3A 3DEUA 4ANJA 3E6BA 4HRIA 3TO9A 3PIOF 5GP9A 3PL8A 2EV5A 1NG6A 2FA5A 3HGYA 4CSWA 2NS8A 2ZO4A 4A3FJ 1EV7A 2E34A 4PGGA 1WJFA 5DCFA 1T0FC 1YIOA 2MD0A 5J47A 2RV8A 3Q3SA 5K7ZA 4HOBA 4LLLA 3CLQA 1FT9A 4F52A 2NS7A 2FSWA 1TNSA 1V5EA 3H9QA 2CMPA 3GCMA 1U6GA 3DLLF 3IV5A 3L2CA 4L0YB 1SFKA 3F6VA 3FK7A 3WTWC 3KYCB 1MSFC 4IQ4A 2ZB9A 3DXJF 3ZPLA 1ZQ3P 1SVOA 3VFZA 3H5RA 3S3MA 1G3WA 3RIRA 1HXDA 2JPBA 2LR8A 4ZZDA 5IPAA 2JQ7A 2LTPA 2V9KA 4CO8A 2XDVA 3VB2A 1YG2A 4RGSA 1XD7A 3L7WA 5HS7A 3K69A 3C18A 2Z5UA 4RM3A 1WWXA 3HZJA 1B9MA 5K5OA 3DLAA 4ETSA 1MH3A 2Y48A 4BGDA 2G7UA 2DMTA 2QBYA 3TOBA 4J00A 2CUZA 2K4BA 5KVRA 1UG0A 2AQEA 3FWEA 1YOVB 1O7FA 5D5VB 3OYNA 1OISA 1B59A 3BR5A 1X3ZB 1XGSA 4GYGA 3ROUA 3SZGA 1O3TA 2VOPA 2V1NA 3S1NJ 3QP5A 1DGRM 3PUFA 2L7FP 3KX2A 2XPUA 3GO5A 3F8FA 3KP7A 3JTGA 1JUSA 4X0GA 3DWLE 4A3EJ 1J75A 3GTPJ 1KYWA 2F5CA 3GYHX 3I55I 5ILVA 2HYJA 2QQ9A 1XMXA 2K9NA 1VI0A 2NS0A 1VF9A 4H0EA 2D5VA 5LHIA 1BI0A 1JI8A 3C2BA 2VBWA 1O57A 1PDNC 3TO6A 4BAYA 2DA2A 3FF5A 5DUKA 2HVSA 5CVIA 2CO5A 1FP2A 5FKOA 4DOZA 1A36A 1IN8A 3JRBA 1SVLA 3HDDA 1LJ9A 3M8EA 1ETWA 2XAHA 1HSJA 1RESA 3DEWA 3VSLA 4M3EA 4RGUA 1MNDA 1XGMA 2ELJA 2NNYA 2RVCA 3Q9SA 1LFUP 1LPQA 1UFMA 5HNFA 1PJRA 4XKCA 2RREA 1QPIA 4F92B 1LE8A 1ETQA 2W85A 2E2IJ 1YJNI 1EH7A 4O5VA 2JA6J 1R23A 1QO0D 2DFEA 2E36A 4Q5SF 1ZREA 1TQMA 1XSVA 2QCOA 3QYBA 3BTLA 5DD4A 5FFZA 5IYBJ 2VJIA 4ESFA 5EG0A 2MLKA 4I2OA 2OZUA 2YU9J 1GV2A 5KAFC 3MKWB 2MD5A 4MQ9F 2LF7A 4CCKA 1KU9A 3ELKA 2WAFA 1P7IA 2XGCA 4HDUA 3BTCA 2E1CA 1NHAA 2TCTA 3BR6A 4DQ2A 1I3AA 3KETA 1FOYA 4LITA 1QRYA 4IXAA 2PJRB 4PJNA 2ELKA 3OL3A 3QODA 4NDLA 4BYYA 4A3CJ 1V3FA 3K4MA 3LMMA 4IL6C 2D2WA 1BN5A 4I76A 3M8JA 3CCYA 2DOEA 2DFIA 4ABZA 2DT7B 3H92A 1WRJA 2DO7A 3ZMSA 5B3SH 1HDDC 1LE8B 2HWVA 1DU0A 2EPFA 4WXCA 3FIWA 3ZQFA 1IO2A 3D5SC 2HPMA 3FDYA 1LFPA 4OIOF 1FJLA 2K9SA 1R5GA 2W25A 3ZCOA 2DPUA 1OFCX 3A2KA 1ZARA 1TC3C 2LP0A 4ZJZA 2YX7A 3WTXC 1YRNA 4WXHA 4QWQA 2PJRA 2NOJB 2H1LA 4XLPF 2ESNA 4LLGF 3F3XA 2XSJC 3KLOA 5B66C 3OYHA 2RNJA 3CUOA 3HRTA 1U5TC 3ZP5A 1TLHB 4G6DA 2DCEA 2V6CA 2Q8KA 1JKRC 3CCMI 2VPRA 2X6XA 2EFNA 2HQAA 2AXTC 3LSTA 5L3DA 4DZJA 1VNDA 3F8BA 2HVQA 3J80Z 1IRXA 2K5CA 4WX9A 1UB9A 2MABA 3MQ0A 1VQMI 2NVYJ 5CQEA 3OWTA 4LB5A 3K4KA 1L0OC 3JRHA 3KFWX 2V4JC 4RGXA 5E1XA 3AG3H 3I59A 3IH2A 4I0AA 1KU7A 3H9JA 3PJRA 1V55H 2O61A 5D4RA 1G2HA 2VQGA 2DFFA 4QSHA 5CPRB 2V7FA 1B72A 3BG3A 2J5PA 5L3FA 1QPMA 2Z2SB 3MMYB 1M1EB 3I9V2 4HEA2 3WE2A 1D8KA 5D8KB 2R7QA 2K3PA 5FLXZ 2NVTJ 1QHGA 5GPCA 3I71A 4A3IJ 3K10A 3V4GA 3H0GJ 4P1WA 3BR3A 4OIPF 1IC8A 4OOIA 4DYRA 3DF8A 3OS2A 2ZMEA 4EM1A 3ZQCA 1EJ9A 3HOTA 1U9OA 2F5VA 2ADUA 3LSIA 3GXOA 3BT9A 3PM1A 3I4MJ 2EV6A 5M5WJ 4E7IA 3DKWA 1XMKA 1TW2A 5E8GA 2ZSIB 1WPKA 2CFXA 2DQLA 3DPUA 4XRSG 5C4JJ 4LIUA 2O5RA 2LMDA 2A07F 1X1AA 4XIDA 4GYIA 2VLAA 3JW4A 4XR6A 5GTIC 1P4WA 2DTZA 4JBAA 4XICA 2L2OA 3Q0VA 3JCUC 5GADJ 5F04A 2GWRA 2ELHA 4Y52J 1QZZA 3TKYA 2MFZA 2VJ4A 1A04A 4NBQA 3VYSB 4ASNA 4KFCA 4AVPA 1FYLA 4B8XA 3DBHB 4ZDOA 2DOAA 3LSPA 4DW6A 4XK4A 2FRHA 3BTIA 5EDNA 5L3BA 2M7BA 5K1YA 3L2WA 1DU6A 3K4BA 2AQFA 3ONQA 3IKTA 4LOCA 4MNUA 2V9PA 4BHBA 4EJVA 2X6YA 1D5YA 4KMFA 3T5XA 2JPCA 4Y13A 3P5JA 3W6JB 5J1YA 1APLC 1BOAA 3GVAA 3FXMA 2JA2A 4PSXA 3U1KA 4BHPA 4RB3C 3P9IA 1TWAJ 3FHZA 2WAEA 3C2HA 3WTTC 1AKHB 2OUMA 1FLIA 3BY6A 3IUOA 4B44A 3JSPA 1KA8A 1MMAA 3F8NA 3A1YA 4M3GA 1BL0A 3TDZC 3U2RA 1DQUA 1LFBA 3BP8A 1P4XA 4A3MJ 2R0QC 2DQRA 4LG3A 4XNFA 3VYTB 1IGNA 4P5OA 2VE9A 4OMYA 1G3YA 2I10A 5A2QK 2K3FA 1ZYRF 3BPVA 4PFPA 3ESWB 1S8NA 4EGYA 1RNLA 2RNGA 5F27A 2EIJH 2HYGD 2XVCA 3EQLF 3ZOBA 3GTOJ 2AHQA 2WAQA 2IT0A 3A01B 4CHUA 4E4HA 2ZC2A 4PJLA 2PN6A 2R93J 2K02A 1OCZH 4LG0B 2ZJRF 2FE3A 2OJED 1STZA 4ENJA 1F36A 4I01A 4ESBA 1R1TA 2EILH 4D9JA 2DJNA 2FOWA 3KP6A 1JJ8C 1Z05A 3SZTA 5L3EA 1BR2A 1A6IA 4UV9A 1FBQA 2PMZA 3PNVA 5TGTA 4RM2A 1U78A 3OYLA 3REOA 3OYDA 2KDZA 1MBGA 1SFEA 4ENMA 2W4SA 3S2WA 2GXAA 3F72A 1Z7LA 2Z3YA 3GLLA 4ZYDA 3EUHC 1K4TA 3G1OA 4A5NA 1BI1A 1TNTA 1Z1DA 2M2EA 2CFOA 3CMEI 1W1WE 1KYZA 1OYWA 9ANTA 3HRSA 3G4SI 1MBJA 3E5QA 2EFPA 2DN0A 2MSYA 2WA0A 4K2EA 2DA6A 4RB0A 4A0ZA 1XGNA 3QAHA 2I5UA 4BQAA 1WSUA 1XMAA 1AU7A 3HB9A 2KZVA 1FP1D 1FMVA 3U9GA 2HZDA 2HQNA 4MGRA 3VYUB 4A12A 1R1VA 4ZYEA 1G6NA 2WAQN 1U5TA 4FTHA 5DCMA 2Z1DA 3F8CA 3FXRA 1IDZA 1YX5A 3CLOA 4CCOA 2LKXA 2ZMEC 3U21A 4B3XA 2WWYA 3G1LA 3DCFA 1HKQA 1GXQA 5EEHA 4NQWB 3WTSC 5FKNA 2JSCA 3TDUC 4DYCA 5FO5A 4KJZA 5F6FA 2BW3B 4BHCA 2R7WA 1D0XA 3JREA 3DTKA 2JUGA 1MMNA 4RMNA 1WJCA 1Z3XA 3GUDA 2BE5F 1XB4A 4C30A 1RZ4A 3HOWJ 4HF2A 2WTEA 2MGQA 4HQEA 3GX4X 2M9HA 2F4OB 1IW7F 1R1UA 1X2MA 1YYVA 2XKPA 3GZNB 5LHHA 1TWFJ 3CJTB 3UNGC 3EUAA 1WVRA 4B48A 3G2BA 5DS9A 3Q5FA 1Z91A 2F5FA 2VJ5A 4D5FA 4B09A 3HIFA 4KNYA 5IP9J 4CYCA 1E17A 2PMZN 2NOGA 3GWZA 2IS6A 5D4SA 3S3NA 3BC8A 3MCZA 5E3NA 1I27A 2ZXJA 2IA0A 4ON0A 4OINF 5B5EC 1BW6A 1YHQI 2EH3A 3HOXJ 1A5JA 1JUPA 3QPLA 1FTTA 4A3LJ 3TL4X 4O6JA 3HG9A 4MIMA 3R60A 3HHGA 3HKZN 2YU3A 2P0WA 3FXJA 4XL9A 3I4NJ 3E0JB 2Q0OA 3BZKA 2FUG2 5B1BH 1OJLA 3VOEA 4A3KJ 5L3CA 1OMIA 2H27A 1Z7UA 3HTSB 4X1EA 1N78A 1IDYA 1SEUA 2VT2A 3OIOA 1IXCA 3ASNH 3CCRI 4CYDA 4IX7A 4RDUA 1UHWA 3FHNA 3L1PA 1LQ1A 3HPHA 2R5ZA 3HBLA 4NB5A 2EWNA 3L00A 3G73A 4IOCF 1LDDA 3LFKA 2R7ZJ 2LLKA 5JI6A 4AVZA 1XTAA 3MN2A 5ED4A 3OYAA 1ZRDA 3ZMZA 3CF5F 1W0TA 1HOMA 4ZYAA 5E79C 5J8FA 4RLFA 2STTA 3LSHA 2KIMA 3NWSA 5ICEA 4X6AJ 2LY1A 4F93B 4O3MA 4CICA 1TP4A 1P6RA 1RIOH 4EGZA 5BS6A 1T38A 4DJAA 4FCYA 3MAJA 3JRFA 3RKWA 3RPUA 2GIVA 3DEEA 2CH0A 2Z16A 1BIAA 2VE8A 3K0LA 3IKVA 3VODA 1XC5A 3H3ZA 3J7AO 3PO2J 3RI4A 3CP2A 1P7JA 1IZ1A 3CCQI 2K7LA 1T95A 2OV7A 4B3AA 4G94A 1FOWA 1GUUA 3CC7I 4JQFA 2FXAA 4PJ0C 3CCJI 4UUTA 2JT1A 4AIJA 4G9YA 2VN2A 2LKPA 3QP6A 4A5MA 1YE9A 1WKMA 1F1ZA 1LVKA 5HDNA 2JVGA 2V9VA 2M30A 5IY5H 1J5YA 3H5AA 3S32A 4AIKA 4CUGA 2FQ4A 3V7SA 4IHVA 1XSDA 2ZBKA 4IOAF 1QVTA 2HS5A 2E1MC 3ECOA 1EF4A 3TP0A 2IAIA 4CDGA 3SQNA 3CC4I 4LG0A 1JTYA 4XKVA 1R6RA 4IHSA 1JGGA 3GLXA 3WG9A 2BVLA 3LA2A 3DV8A 3ZQLA 4IKFA 3FK6A 2A69F 3AG1H 3C3WA 1ZR4A 2Q2EA 1HKTA 2GBYA 2OQRA 2G7HA 2A3SA 4F91B 1X3UA 5IT9Z 3GZ5A 1VQ4I 1S7EA 3M7GA 4W97A 2OTJI 1IXRC 2JVHA 2QSFX 4N4NB 4U0YA 3BROA 4I0BA 4Y17A 2HKXA 2A68F 4XOTA 5FD5A 5EG0B 2OTLI 3ZQQA 1Y1WJ 2M4KA 1AHDP 3K4CA 2OA4A 2B9SA 3CO7C 1OKRA 1S7AA 2IGOA 4CH7A 4EATA 1ETVA 4HPQA 2PX9A 2R7FA 3HOYJ 1RUNA 4NC7A 3GW2A 2VKVA 1MZBA 3KEQA 1RKTA 4NC6A 5DM7F 1Z3YA 1ZG5A 2ID3A 2ZSHB 3MZHA 4CYCB 2DA4A 1FY7A 1LDKB 2IEKA 4L0ZB 4ZTFA 4J01A 2R7XA 3SZPA 2K85A 3DTIA 1NK2P 3OYJA 1FPQA 2R7OA 1G8XA 1I50J 2ACJA 2L0KA 4XSZF 4F55A 3HUGB 4C3HJ 3MVPA 3K2ZA 3OYGA 2JK3A 2W00A 2XAGA 2DK5A 4MO7A 4AIHA 1RC9A 2PBIA 2ISZA 2EIKH 5F1JA 2FNPA 3NEUA 3VYRB 1O3RA 2DK8A 1MJBA 2P8TA 1R5ID 3A4CA 3FMQA 3JSOA 1X2NA 1FC3A 4BUPA 1QHHD 3FISA 1MNEA 3GEZA 4AUXA 3V8LA 2QENA 2IBDA 4D1QA 5HLTA 1ETKA 2DJIA 5F0HA 2V1UA 2LH9A 2L4AA 1VQLI 4CCNA 1G3TA 3IAM2 3LSRA 4Q48A 3C1DA 2MLGA 1RRJA 4A0XA 1JKQC 1FYKA 5K7HA 3PNTA 3E6CC 1HCRA 2ZKZA 3TOAA 1BBYA 2YPRA 4NNJA 5AIPA 1UCRA 4Q4ZF 1HKSA 3ZMVA 3OYIA 1IV6A 3A0HC 3Q0UA 3WU0A 1U8RA 2QZ8A 1Z6RA 1UMQA 1X1BA 4A6DA 3HRUA 2E5ZA 2EFWA 1YI2I 1HW5A 3AG2H 3B73A 3S1RJ 2QBYB 3ABTA 2XF7A 2WC2A 4KITB 2EIMH 3BOQA 4WXDA 3OOUA 4F3QA 5ICGA 3S3OA 2PG4A 2GXGA 3WGIA 3H3VK 2QQBA 3K4NA 2H8WA 2H6BA 3W6VA 2UWMA 3NQOA 2AS5F 1VQPI 2CW8A 3OYMA 1YLFA 2EJRA 3AL0B 1U0JA 2BW3A 3LA7A 1QVUA 2IGMA 1XG1A 4OAYA 3V8JA 2L7KA 3HL2A 2VBZA 1T08B 2DA3A 1E0EA 5FLMJ 3KE2A 2BXYA 4NQWA 2WY7Q 4U7DA 1ZAOA 2LNBA 2FMLA 2XF6A 3FKIJ 5ERIA 3K2AA 4V2FA 2JA5J 4ZYGA 2YSRA 3FXOA 5LRRA 4C2MJ 2L7ZA 3BR0A 2VODA 1YS7A 2E1MB 2R4GA 4G12A 3CCUI 3RKYA 3HSEA 2BXZA 4G8XA 2E1NA 2UXXA 2XAFA 4L9VA 3JRAA 2Z9OA 4C2UA 1MW7A 2L01A 4TV7A 1MJ9A 4KIBA 3H1CA 2C6YA 3IH3A 3BLYA 3LQQA 3MZ8A 5HODA 2Y0MA 3CP8A 4EMSA 2QGUA 5F64A 2N8GA 3KLNA 3ISPA 2HOEA 1W5CC 3P9KA 3L2RA 4L9NA 1R9TJ 1IN4A 3HYIA 3S2HJ 2RC4A 3CD6I 4XSXF 2UXNA 5EZGA 1K83J 1H0MA 2FQ3A 1VQ9I 2PEXA 3BG6A 3OS1A 3FX3A 4D7NA 3K1MA 2HTSA 1R22A 1LKXA 2Y0SN 3BR2A 3LSMA 3M07A 3RQ4A 3L09A 5EF6A 2M8EA 2O8KA 1ERDA 2VKDA 2CQNA 2Y0SA 4KN4X 5AONA 2MH9A 4ENKA 4UVCA 5BPIA 4LJZF 4B4CA 3FM5A 1W5SA 2BHYA 3B6AA 3ZQGA 1ONVA 3J7YJ 5H2FC 1EH6A 4L9TA 2PQ8A 4E7SA 2L9NA 1DUXC 1JT6A 3HHHA 2Y69H 5TJJA 3CUQC 4M6XA 4V2GA 2A5WA 2ZNYA 4KYWA 2QLZA 4KMUX 4MFDA 2HXIA 3QU3A 2Y9YA 3K7AJ 2EZKA 2F5EA 3KCCA 4BBRJ 3GMEA 5FKLA 2GA2A 3M1EA 4M74A 5EJCA 1SANA 4QPQA 3J7ZI 2A5YB 1VQKI 2CRGA 4BXFA 1RI7A 1F9NA 3H5NA 4ENNA 4G7HF 1W36D 3EDPA 1TL8A 5AIQA 3F22A 4DYQA 2MC4A 4HDVA 4BBSJ 3HSFA 3MZYA 2DODA 2WV0A 1V5FA 3AL0C 2QSHX 4R1HA 5HNHA 2K27A 3I0TA 4OIRF 4EJOA 2WY8Q 3L2VA 2FNAA 1B8IB 1MGTA 5D6FA 2EQRA 3EYYA 5FKMA 1HF0A 4XOPA 2R92J 3LNQA 2XUBA 4WK8F 1OCOH 1P9QC 2F4IA 5C3EJ 1H8AC 3V7CA 5E3LA 2CU7A 2DMUA 2EA2A 4PZJA 1H88C 4HV5A 4AM3A 5LBQA 3HKZA 1JXSA 4BQNA 3RKQA 4HLXA 2KMUA 3RYRA 3JRCA 5JFRA 1W36C 4UUSA 1NTCA 2CV0A 3HOVJ 3BR1A 4PUSA 4PCQA 4JX4A 5HLHA 2F2EA 3JAMK 5JVTA 3M9AA 2X4HA 4FETA 3EETA 2IS4A 1HA8A 1MBHA 1BR4A 4HX7A 2E35A 3DP7A 1Y39A 5KHDA 2VI6A 4IJAA 1ODDA 3ZXSA 5FROA 4HA8A 4G6QA 1ZTRA 3SDBA 3AG4H 3WGGA 3WHCA 1X4PA 5KAIC 4HZFA 4IRGA 2QWWA 1L3LA 2EB7A 1DP3A 3HEFA 4P9UA 1O4XA 2LVSA 2L3DA 3PSIA 2CUJA 2VONA 1D0YA 3BQZA 2R7VA
chains in the Genus database with same CATH topology
5FLVA 2FD5A 4MLOA 3G1LA 2X9DA 3DCFA 3SDGA 2FJ1A 3D1NI 5FKNA 5M5YJ 4DYCA 3SFIA 2HI3A 3JREA 1OCTC 2XRLA 5GPAA 2HDDA 1MH4A 2K9QA 5JLWA 2E1OA 2CUFA 3HOWJ 4D5CA 2MGQA 2Y31A 2M8GX 4AYBN 2M9HA 1X2MA 3SJMA 3S14J 3HOUJ 1TWFJ 2FX0A 1ENHA 3O8HA 2O9LA 4IHXA 5DS9A 5F0CA 4A69C 5FJ8J 2CQXA 5E3OA 4D5FA 1CQTA 5IYDJ 4C3JJ 2JA7J 5J1UA 5IP9J 4CYCA 3JRGA 2PMZN 2NOGA 4M6VA 5E3NA 1IUFA 5BNGA 1XS9A 2TRTA 4JX5A 1BW6A 5GP9A 2EH3A 3HOXJ 5M3FJ 1A5JA 1JUPA 2RAEA 3QPLA 1IRZA 1FTTA 4A3LJ 2ME6A 4A3JJ 4MIMA 3HGYA 3HKZN 2NS8A 3I4NJ 3LSJA 4A3FJ 1OJLA 4A3KJ 2OPTA 2X6OA 3Q3SA 5K7ZA 1TWHJ 2Y2ZA 4X1EA 2NS7A 1IDYA 2XPWA 3OIOA 3JRDA 2NVQJ 3IV5A 2R5YA 4RDUA 3L1PA 3FK7A 1MSFC 2R5ZA 2ZB9A 3HBLA 1B8IA 1YRNB 2R7ZJ 2LLKA 2QF7A 5EGOA 3MN2A 4A93J 1W0TA 1ZQ3P 1HOMA 5IP7J 1BA5A 1HDPA 1WI3A 2LR8A 5IPAA 2LTPA 5IOZA 3CMYA 1Y1VJ 2LK2A 4X6AJ 1PUFA 1B72B 3GTMJ 4FE7A 3B6CA 1WH7A 2NVXJ 2DMNA 1MH3A 4BKXA 4JP0A 2EZLA 4W1UA 4FCYA 2DMTA 2ME0A 1RKWA 1OCPA 3JRFA 3GTGJ 4EEFG 2P81A 5M3MJ 2HQ5A 3CDLA 2ECCA 3G1MA 1XC5A 3PO2J 3BR5A 1P7JA 3S1NJ 2L7FP 4B3AA 2XPUA 3BQYA 5IYCJ 1JUSA 1GUUA 4A3EJ 4UUTA 3GTPJ 2E2HJ 3S15J 3GBGA 2HYJA 2K9NA 2VKEA 1VI0A 1VF9A 1FIAA 4RBOA 2D5VA 2ECBA 2EZHA 3C2BA 2FQ4A 4IHVA 4M3FA 2DA2A 1QVTA 5EEAA 2CQQA 1EF4A 5FKOA 3BG5A 3LSGA 3TP0A 2IAIA 2WB1N 1ITYA 3JRBA 3HDDA 1JTYA 1ETWA 1JGGA 3HM5A 1RESA 3DEWA 5F08A 4M3EA 1LFUP 3ZQLA 3FK6A 1ZR4A 1QPIA 1MNMC 1WCMJ 1ETQA 2GBYA 1LE8A 2E2IJ 1RR7A 3GTKJ 3BTJA 2JA6J 2L7MP 1UHSA 1S7EA 3JR9A 4W97A 1Z77A 2QCOA 3QPSA 1T56A 3BTLA 5IYBJ 5EG0A 2MG4A 5EG0B 4IEJA 2HOSA 2YU9J 1ETXA 1GV2A 1Y1WJ 1AHDP 1P7IA 2XGCA 2XGDA 3BTCA 5K7FA 1ETVA 2L9RA 3BR6A 2TCTA 1WGXA 3HOYJ 1QRYA 2VKVA 2ELKA 4NDLA 1RKTA 4A3CJ 2E2JJ 2DA5A 1MBEA 4HNVA 2ID3A 4I76A 3CCYA 4ABZA 2DA4A 4CYCB 1T33A 2IEKA 1WH5A 2LY9A 4I6ZA 2HXOA 1ORKA 2K40A 1LE8B 1HDDC 5E3MA 5F0FA 2OF7A 1DU0A 2EBIA 1NK2P 3FIWA 2ID6A 3ZQFA 1I50J 2JWTA 2L0KA 2XB5A 1W0UA 3HOZJ 1ZGWA 1FJLA 2K9SA 4C3HJ 4JYKA 3S2DJ 1IG7A 3MVPA 4JX6A 3LOCA 5IP6A 1OFCX 2JK3A 2H1KA 1MSEC 4M3BA 1TC3C 5EGOB 2LP0A 4MO7A 1SFOJ 2W48A 3S16J 1YRNA 1U9NA 5C4XJ 2MW8A 1I6HJ 1JKPC 5F1JA 3WHBA 1X2NA 3FISA 3OSFA 3M4OJ 5M5XJ 1I3QJ 1H89C 4AUXA 2IBDA 4DZPA 1ETKA 1JKRC 5F0HA 2VPRA 2HOAA 2JA8J 1VFCA 3LSRA 4DZJA 1HLVA 1VNDA 3O8GA 3CQZJ 1JKQC 5K7HA 1HCRA 1POGA 2HOTA 2B63J 2NVYJ 4FISA 3Q0UA 5JLXA 4XRSA 1IV6A 3GTQJ 2KT0A 1UMQA 3JRHA 1BJZA 3IH2A 2VUMJ 3S1RJ 2DA7A 3E7LA 3ZQIA 1G2HA 3NAUA 1TWGJ 4QSHA 1E3OC 3OOUA 1B72A 3BG3A 3H3VK 4QIWN 2CUEA 3W6VA 2O7OA 2LFBA 1MBKA 2R5ZB 2DA1A 2NVTJ 5GPCA 4A3IJ 3H0GJ 1QVUA 1X58A 1ZR2A 3BR3A 1FTZA 1IC8A 1XG1A 4DYRA 4XRMA 4Y7NJ 3ZQCA 1U9OA 2DA3A 5FLMJ 4FE4A 3BT9A 3PM1A 3I4MJ 5M5WJ 4B1RA 3FKIJ 2M34A 2GLOA 3K2AA 4V2FA 2JA5J 4C2MJ 5EYRA 1WPKA 2DMPA 1GV5A 2L7ZA 3BR0A 4QTRA 4G12A 2Y9ZA 1K61A 4XRSG 5C4JJ 1UG2A 3JRAA 2XSDC 3GTLJ 4XIDA 1FIPA 2H8RA 1ZKGA 3MKLA 4S0HB 1F43A 2DTZA 2LD5A 4BXXJ 4XICA 3Q0VA 3IH3A 5HODA 5F04A 3M3YJ 4Y52J 1NK3P 1TWCJ 2X48A 5DTDA 1U8BA 1RETA 2N8GA 3A03A 3HGGA 3JRIA 2E19A 3TW6A 3F0CA 3LSPA 1R9TJ 1RPWA 5J3LA 4DW6A 4IHYA 3S2HJ 4XK4A 2JJ7A 3BTIA 5EDNA 3IH4A 2AO9A 5EZGA 1DU6A 1K83J 5FKKA 2CJJA 4LOCA 1GDTA 4M3DA 3TP3A 4D7NA 1D5YA 2Y0SN 3BR2A 2DMQA 5EF6A 2O8KA 5J1YA 2YUSA 1APLC 1GVDA 1JTXA 4B4CA 1TWAJ 3ZQGA 3B6AA 3BG9A 3Q0WA 2XGEA 1JT6A 1AKHB 4A3DJ 3RQIA 2XPVA 2EZIA 4M3GA 5C44J 1BL0A 4V2GA 1LFBA 1JJ6C 4A3MJ 2R0QC 4MFDA 5IOYA 1IGNA 2HXIA 4IHWA 2Y9YA 4C3IJ 2I10A 3K7AJ 4AC0A 1MBFA 2EZKA 4BBRJ 3PO3J 3ZQHA 3S1QJ 3UKGA 2XB0X 5FKLA 5F27A 1GT0C 1SANA 4UUSB 3GTJJ 3OSGA 3S1MJ 2CRGA 3RZDJ 3A02A 4DYQA 3ZOBA 1BW5A 2JMWA 1JKOC 3GTOJ 2AHQA 4A3BJ 5EZHA 4BBSJ 3A01B 2R93J 1Q1VA 3NARA 1B8IB 1JUMA 2EQRA 4BY1J 1F36A 1AKHA 5FKMA 1HF0A 2DJNA 1JJ8C 2R92J 3LNQA 3QQAA 4L5EA 5J1RA 1A6IA 1FEXA 1ETOA 1Z0XA 5C3EJ 1H8AC 1U78A 1ZK8A 5E3LA 2CU7A 2DMUA 2KDZA 1MBGA 1H88C 4D7MA 3RKQA 3JRCA 4UUSA 1NTCA 3HOVJ 4A3GJ 3G1OA 3BR1A 4J19A 2M2EA 4GFBA 1ETYA 4JX4A 2G0EA 3S17J 9ANTA 1MBJA 3A01A 1MBHA 2DN0A 2MSYA 1JT0A 3TW7A 4MFEA 2DA6A 3RZOJ 2VI6A 2Y30A 1IJWC 2JN6A 3TEDA 1AU7A 4BY7J 3HB9A 1ZTRA 3WHCA 2WAQN 2YS9A 2R5YB 4FTHA 3VPRA 1PUFB 3HEFA 1IDZA 2M0CA 2GM4A 2WV1A 1O4XA 2LVSA 2COBA 3BQZA 2LKXA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5FLV A;  2FD5 A;  4MLO A;  3G1L A;  2X9D A;  3DCF A;  3SDG A;  2FJ1 A;  3D1N I;  5FKN A;  5M5Y J;  4DYC A;  3SFI A;  2HI3 A;  3JRE A;  1OCT C;  2XRL A;  5GPA A;  2HDD A;  1MH4 A;  2K9Q A;  5JLW A;  2E1O A;  2CUF A;  3HOW J;  4D5C A;  2MGQ A;  2Y31 A;  2M8G X;  4AYB N;  2M9H A;  1X2M A;  3SJM A;  3S14 J;  3HOU J;  1TWF J;  2FX0 A;  1ENH A;  3O8H A;  2O9L A;  4IHX A;  5DS9 A;  5F0C A;  4A69 C;  5FJ8 J;  2CQX A;  5E3O A;  4D5F A;  1CQT A;  5IYD J;  4C3J J;  2JA7 J;  5J1U A;  5IP9 J;  4CYC A;  3JRG A;  2PMZ N;  2NOG A;  4M6V A;  5E3N A;  1IUF A;  5BNG A;  1XS9 A;  2TRT A;  4JX5 A;  1BW6 A;  5GP9 A;  2EH3 A;  3HOX J;  5M3F J;  1A5J A;  1JUP A;  2RAE A;  3QPL A;  1IRZ A;  1FTT A;  4A3L J;  2ME6 A;  4A3J J;  4MIM A;  3HGY A;  3HKZ N;  2NS8 A;  3I4N J;  3LSJ A;  4A3F J;  1OJL A;  4A3K J;  2OPT A;  2X6O A;  3Q3S A;  5K7Z A;  1TWH J;  2Y2Z A;  4X1E A;  2NS7 A;  1IDY A;  2XPW A;  3OIO A;  3JRD A;  2NVQ J;  3IV5 A;  2R5Y A;  4RDU A;  3L1P A;  3FK7 A;  1MSF C;  2R5Z A;  2ZB9 A;  3HBL A;  1B8I A;  1YRN B;  2R7Z J;  2LLK A;  2QF7 A;  5EGO A;  3MN2 A;  4A93 J;  1W0T A;  1ZQ3 P;  1HOM A;  5IP7 J;  1BA5 A;  1HDP A;  1WI3 A;  2LR8 A;  5IPA A;  2LTP A;  5IOZ A;  3CMY A;  1Y1V J;  2LK2 A;  4X6A J;  1PUF A;  1B72 B;  3GTM J;  4FE7 A;  3B6C A;  1WH7 A;  2NVX J;  2DMN A;  1MH3 A;  4BKX A;  4JP0 A;  2EZL A;  4W1U A;  4FCY A;  2DMT A;  2ME0 A;  1RKW A;  1OCP A;  3JRF A;  3GTG J;  4EEF G;  2P81 A;  5M3M J;  2HQ5 A;  3CDL A;  2ECC A;  3G1M A;  1XC5 A;  3PO2 J;  3BR5 A;  1P7J A;  3S1N J;  2L7F P;  4B3A A;  2XPU A;  3BQY A;  5IYC J;  1JUS A;  1GUU A;  4A3E J;  4UUT A;  3GTP J;  2E2H J;  3S15 J;  3GBG A;  2HYJ A;  2K9N A;  2VKE A;  1VI0 A;  1VF9 A;  1FIA A;  4RBO A;  2D5V A;  2ECB A;  2EZH A;  3C2B A;  2FQ4 A;  4IHV A;  4M3F A;  2DA2 A;  1QVT A;  5EEA A;  2CQQ A;  1EF4 A;  5FKO A;  3BG5 A;  3LSG A;  3TP0 A;  2IAI A;  2WB1 N;  1ITY A;  3JRB A;  3HDD A;  1JTY A;  1ETW A;  1JGG A;  3HM5 A;  1RES A;  3DEW A;  5F08 A;  4M3E A;  1LFU P;  3ZQL A;  3FK6 A;  1ZR4 A;  1QPI A;  1MNM C;  1WCM J;  1ETQ A;  2GBY A;  1LE8 A;  2E2I J;  1RR7 A;  3GTK J;  3BTJ A;  2JA6 J;  2L7M P;  1UHS A;  1S7E A;  3JR9 A;  4W97 A;  1Z77 A;  2QCO A;  3QPS A;  1T56 A;  3BTL A;  5IYB J;  5EG0 A;  2MG4 A;  5EG0 B;  4IEJ A;  2HOS A;  2YU9 J;  1ETX A;  1GV2 A;  1Y1W J;  1AHD P;  1P7I A;  2XGC A;  2XGD A;  3BTC A;  5K7F A;  1ETV A;  2L9R A;  3BR6 A;  2TCT A;  1WGX A;  3HOY J;  1QRY A;  2VKV A;  2ELK A;  4NDL A;  1RKT A;  4A3C J;  2E2J J;  2DA5 A;  1MBE A;  4HNV A;  2ID3 A;  4I76 A;  3CCY A;  4ABZ A;  2DA4 A;  4CYC B;  1T33 A;  2IEK A;  1WH5 A;  2LY9 A;  4I6Z A;  2HXO A;  1ORK A;  2K40 A;  1LE8 B;  1HDD C;  5E3M A;  5F0F A;  2OF7 A;  1DU0 A;  2EBI A;  1NK2 P;  3FIW A;  2ID6 A;  3ZQF A;  1I50 J;  2JWT A;  2L0K A;  2XB5 A;  1W0U A;  3HOZ J;  1ZGW A;  1FJL A;  2K9S A;  4C3H J;  4JYK A;  3S2D J;  1IG7 A;  3MVP A;  4JX6 A;  3LOC A;  5IP6 A;  1OFC X;  2JK3 A;  2H1K A;  1MSE C;  4M3B A;  1TC3 C;  5EGO B;  2LP0 A;  4MO7 A;  1SFO J;  2W48 A;  3S16 J;  1YRN A;  1U9N A;  5C4X J;  2MW8 A;  1I6H J;  1JKP C;  5F1J A;  3WHB A;  1X2N A;  3FIS A;  3OSF A;  3M4O J;  5M5X J;  1I3Q J;  1H89 C;  4AUX A;  2IBD A;  4DZP A;  1ETK A;  1JKR C;  5F0H A;  2VPR A;  2HOA A;  2JA8 J;  1VFC A;  3LSR A;  4DZJ A;  1HLV A;  1VND A;  3O8G A;  3CQZ J;  1JKQ C;  5K7H A;  1HCR A;  1POG A;  2HOT A;  2B63 J;  2NVY J;  4FIS A;  3Q0U A;  5JLX A;  4XRS A;  1IV6 A;  3GTQ J;  2KT0 A;  1UMQ A;  3JRH A;  1BJZ A;  3IH2 A;  2VUM J;  3S1R J;  2DA7 A;  3E7L A;  3ZQI A;  1G2H A;  3NAU A;  1TWG J;  4QSH A;  1E3O C;  3OOU A;  1B72 A;  3BG3 A;  3H3V K;  4QIW N;  2CUE A;  3W6V A;  2O7O A;  2LFB A;  1MBK A;  2R5Z B;  2DA1 A;  2NVT J;  5GPC A;  4A3I J;  3H0G J;  1QVU A;  1X58 A;  1ZR2 A;  3BR3 A;  1FTZ A;  1IC8 A;  1XG1 A;  4DYR A;  4XRM A;  4Y7N J;  3ZQC A;  1U9O A;  2DA3 A;  5FLM J;  4FE4 A;  3BT9 A;  3PM1 A;  3I4M J;  5M5W J;  4B1R A;  3FKI J;  2M34 A;  2GLO A;  3K2A A;  4V2F A;  2JA5 J;  4C2M J;  5EYR A;  1WPK A;  2DMP A;  1GV5 A;  2L7Z A;  3BR0 A;  4QTR A;  4G12 A;  2Y9Z A;  1K61 A;  4XRS G;  5C4J J;  1UG2 A;  3JRA A;  2XSD C;  3GTL J;  4XID A;  1FIP A;  2H8R A;  1ZKG A;  3MKL A;  4S0H B;  1F43 A;  2DTZ A;  2LD5 A;  4BXX J;  4XIC A;  3Q0V A;  3IH3 A;  5HOD A;  5F04 A;  3M3Y J;  4Y52 J;  1NK3 P;  1TWC J;  2X48 A;  5DTD A;  1U8B A;  1RET A;  2N8G A;  3A03 A;  3HGG A;  3JRI A;  2E19 A;  3TW6 A;  3F0C A;  3LSP A;  1R9T J;  1RPW A;  5J3L A;  4DW6 A;  4IHY A;  3S2H J;  4XK4 A;  2JJ7 A;  3BTI A;  5EDN A;  3IH4 A;  2AO9 A;  5EZG A;  1DU6 A;  1K83 J;  5FKK A;  2CJJ A;  4LOC A;  1GDT A;  4M3D A;  3TP3 A;  4D7N A;  1D5Y A;  2Y0S N;  3BR2 A;  2DMQ A;  5EF6 A;  2O8K A;  5J1Y A;  2YUS A;  1APL C;  1GVD A;  1JTX A;  4B4C A;  1TWA J;  3ZQG A;  3B6A A;  3BG9 A;  3Q0W A;  2XGE A;  1JT6 A;  1AKH B;  4A3D J;  3RQI A;  2XPV A;  2EZI A;  4M3G A;  5C44 J;  1BL0 A;  4V2G A;  1LFB A;  1JJ6 C;  4A3M J;  2R0Q C;  4MFD A;  5IOY A;  1IGN A;  2HXI A;  4IHW A;  2Y9Y A;  4C3I J;  2I10 A;  3K7A J;  4AC0 A;  1MBF A;  2EZK A;  4BBR J;  3PO3 J;  3ZQH A;  3S1Q J;  3UKG A;  2XB0 X;  5FKL A;  5F27 A;  1GT0 C;  1SAN A;  4UUS B;  3GTJ J;  3OSG A;  3S1M J;  2CRG A;  3RZD J;  3A02 A;  4DYQ A;  3ZOB A;  1BW5 A;  2JMW A;  1JKO C;  3GTO J;  2AHQ A;  4A3B J;  5EZH A;  4BBS J;  3A01 B;  2R93 J;  1Q1V A;  3NAR A;  1B8I B;  1JUM A;  2EQR A;  4BY1 J;  1F36 A;  1AKH A;  5FKM A;  1HF0 A;  2DJN A;  1JJ8 C;  2R92 J;  3LNQ A;  3QQA A;  4L5E A;  5J1R A;  1A6I A;  1FEX A;  1ETO A;  1Z0X A;  5C3E J;  1H8A C;  1U78 A;  1ZK8 A;  5E3L A;  2CU7 A;  2DMU A;  2KDZ A;  1MBG A;  1H88 C;  4D7M A;  3RKQ A;  3JRC A;  4UUS A;  1NTC A;  3HOV J;  4A3G J;  3G1O A;  3BR1 A;  4J19 A;  2M2E A;  4GFB A;  1ETY A;  4JX4 A;  2G0E A;  3S17 J;  9ANT A;  1MBJ A;  3A01 A;  1MBH A;  2DN0 A;  2MSY A;  1JT0 A;  3TW7 A;  4MFE A;  2DA6 A;  3RZO J;  2VI6 A;  2Y30 A;  1IJW C;  2JN6 A;  3TED A;  1AU7 A;  4BY7 J;  3HB9 A;  1ZTR A;  3WHC A;  2WAQ N;  2YS9 A;  2R5Y B;  4FTH A;  3VPR A;  1PUF B;  3HEF A;  1IDZ A;  2M0C A;  2GM4 A;  2WV1 A;  1O4X A;  2LVS A;  2COB A;  3BQZ A;  2LKX A; 
#chains in the Genus database with same CATH topology
 3OS0 A;  2FD5 A;  2BOL A;  5DYM A;  3D1N I;  1S29 A;  2QM3 A;  5M5Y J;  2HDC A;  3VDX A;  1SC7 A;  2EK5 A;  3MWM A;  3CMA I;  3FMS A;  2HI3 A;  3RPQ A;  3IL2 A;  1Y8Q B;  2E1O A;  2CUF A;  3RCO A;  5IT9 K;  1PP7 U;  4KIS A;  4RAY A;  3WG7 H;  4D5C A;  2OU2 A;  4AYB N;  4BNC A;  4EVI A;  3WTV C;  2LRD A;  3IAS 2;  2XC7 A;  4FX0 A;  3CJQ B;  4HBL A;  2O9L A;  4XLF A;  3OY9 A;  2DOF A;  4IHX A;  1LEA A;  1TT0 A;  3K6G A;  4UV8 A;  4CZZ A;  4P55 A;  4A69 C;  1ZG1 A;  2LY2 A;  1CQT A;  1Y56 A;  5TRD A;  4C3J J;  5J1U A;  5ILU A;  2LRE A;  3JRG A;  1R5H A;  1RUO A;  1GVJ A;  2IVM A;  4M6V A;  5A2Q Z;  5FB2 A;  2KIF A;  1GXP A;  2LG4 A;  1IUF A;  2XAQ A;  5BNG A;  1XS9 A;  2IGK A;  2TRT A;  4JX5 A;  2JUC A;  1C0W A;  3HUG A;  1IUY A;  3E6M A;  5D5X B;  2RAE A;  3D5L A;  1PP8 F;  4WCG A;  1T2K A;  2ME6 A;  4A3J J;  4BL0 B;  1USS A;  1IXS B;  1FOX A;  1MMS A;  1OR7 A;  2V6E A;  4RA2 A;  5FD6 A;  1LEB A;  2X6O A;  3DKY A;  5GTH C;  1TWH J;  2Y2Z A;  3ABU A;  1HBX G;  4CGZ A;  1QNT A;  2IP2 A;  3GFL A;  4A0Y A;  1HW2 A;  4Y3O A;  2XPW A;  1R4M B;  4E70 A;  3JRD A;  2NVQ J;  3MKY B;  1Y0U A;  2UV1 A;  2VC1 A;  4NUB A;  2BYV E;  3QRF F;  3QWL A;  4JK1 X;  1B8I A;  1E2X A;  4HSR A;  1YRN B;  5EGO A;  5E8I A;  4A93 J;  4IQJ A;  4HNU A;  1YW9 A;  4ZTJ A;  4LFU A;  4BEH A;  2V1X A;  1QQI A;  1SD5 A;  2Y75 A;  3TBI A;  4YFX F;  5IP7 J;  3K70 C;  2P5K A;  2KFD A;  3IWF A;  1DP7 P;  1WI3 A;  1FMW A;  4BDY A;  4ESJ A;  3S8P A;  3CMY A;  1N75 A;  2R7R A;  2E60 A;  2XAS A;  4RAF A;  1B72 B;  2UZK A;  4FE7 A;  2L4M A;  2TDX A;  2XGX A;  2DMN A;  5H20 A;  4BKX A;  4JP0 A;  4W1U A;  3N97 A;  1OYY A;  1RKW A;  2DFH A;  4LGW A;  4WWC A;  2D1V A;  5JVG F;  2P81 A;  5EEG A;  4AYB A;  2HQ5 A;  2FEZ A;  1ZHF A;  4G7O F;  4YIR X;  2KIU A;  2L9S A;  2ECC A;  2LOO A;  2XAU A;  1FSH A;  1ZLK A;  5HS8 A;  1R4N B;  1LB2 A;  3SFZ A;  3H36 A;  1KZH A;  3FZV A;  4IPA A;  1KQ0 A;  3OOP A;  4XRF A;  1IN5 A;  2E2H J;  3S15 J;  3GBG A;  2VKE A;  3MKZ A;  2FBH A;  3RTR A;  2B7E A;  5E1Z B;  4RBO A;  5CVV A;  2EZH A;  3DU6 A;  1A35 A;  4Y4R A;  1UST A;  5EEA A;  2CQQ A;  4OU0 A;  1W7P D;  2OBP A;  2BBY A;  3LSG A;  4EV0 A;  2WB1 N;  4EJU A;  4ZZL A;  5KNL A;  3CCV I;  1ITY A;  5LFA A;  2DPD A;  3WTU C;  1ULY A;  2M45 A;  1ZEL A;  5DUI A;  5F08 A;  5J4V A;  2ZJ2 A;  3RKX A;  1O3S A;  3OMY A;  2CGP A;  1JGS A;  2X85 A;  1XDU A;  1MNM C;  3ZMD A;  4JOM A;  4XON A;  2P7C B;  1WHU A;  4IZZ A;  2JSP A;  2J5O A;  5J40 A;  1F4K A;  2L7M P;  1UHS A;  3ABM H;  1G3S A;  1K6Y A;  1XSX A;  2HZT A;  3J80 K;  1T56 A;  1Y8R B;  4A6E A;  3BCA A;  4E7H A;  2P4W A;  4DBR A;  4IEJ A;  1YIJ I;  1I1G A;  2M7A A;  1B9N A;  3BZC A;  1ETX A;  4M6Y A;  4UUV A;  1S7O A;  3CCE I;  5HDK A;  5K7F A;  2XGD A;  2L9R A;  3BPX A;  1WGX A;  4KIG A;  1LDJ A;  1Z67 A;  5HOO A;  1DPR A;  3BWG A;  3WTZ A;  3F6O A;  1MMG A;  3LSK A;  2E2J J;  2A6E F;  1MBE A;  1OYI A;  2MA3 A;  4HNV A;  2EFQ A;  3DFG A;  4N9H A;  5L3G A;  3CMM A;  4BJ6 C;  1T33 A;  3EPZ A;  3R61 A;  2LY9 A;  4I6Z A;  2HXO A;  4U88 A;  4XKW A;  1EKE A;  3I5U A;  3MEX A;  1SFU A;  1N77 A;  3K1N A;  1UJ8 A;  4BE2 A;  1T6S A;  3I3L A;  2HYF A;  2JWT A;  1W0U A;  3HOZ J;  2X1E A;  3I59 B;  3S2D J;  3W2W A;  2O03 A;  4JX6 A;  2JRT A;  3LOC A;  1K4S A;  5J8C A;  1VZ0 A;  2H1K A;  2HU9 A;  4M3B A;  3F21 A;  5LD2 C;  4LIV A;  1ZRC A;  1X3W B;  2W48 A;  1SFX A;  3FXL A;  2D1H A;  4RAG A;  3TGN A;  1D5V A;  2V26 A;  3BJ6 A;  5C4X J;  2ZME B;  2VC0 A;  4PFO A;  2X1D A;  2MW8 A;  2HNH A;  2R7U A;  1JKP C;  3WHB A;  3OYE A;  3IRQ A;  4HF1 A;  1I5Z A;  3HPG A;  4XM3 A;  3CZ6 A;  4XN3 A;  1H89 C;  1FX7 A;  4Q47 A;  3FBI B;  1HQC A;  3T1B A;  3DKX A;  5JHU A;  2LBF B;  4CZC A;  4HLY A;  5D8L B;  2HOA A;  1EH8 A;  2EIN H;  3FM3 A;  2BGC A;  3MFK A;  4XLA A;  4ZC3 A;  4MEY F;  4U7B A;  1HLV A;  3U1D A;  3CQZ J;  4AU7 A;  2DT5 A;  4E7L A;  1KU2 A;  3KPH A;  1XCB A;  3R4K A;  2HOT A;  2B63 J;  2LYC A;  4FIS A;  5JLX A;  4XRS A;  2K86 A;  4S04 A;  2NAZ A;  2KJB A;  2VUM J;  2KL4 A;  2HFH A;  1WJ5 A;  1X1P A;  2KDO A;  4IRI A;  3E7L A;  3ZQI A;  4GCV A;  4YII A;  3QOE A;  3NAU A;  1E3O C;  3CJN A;  4N9I A;  2W7N A;  3O3K A;  4ITV A;  5CVJ A;  3AFH A;  3PQJ A;  5K5R A;  1D1A A;  2PMH A;  4IHT A;  3S93 A;  1XX5 A;  4H4K C;  2VT3 A;  3E1S A;  3KP2 A;  3CO6 C;  4GXO A;  1MBK A;  2FF4 A;  2DA1 A;  2R5Z B;  2HEO A;  4PSW A;  3DBR B;  1K78 B;  3CUQ A;  2B0L A;  1S6L A;  1X58 A;  1ZGJ A;  4M71 A;  1X4O A;  1ZR2 A;  1UAA A;  1FTZ A;  2M87 A;  3BDD A;  5BQT A;  2ZJP F;  1CF7 A;  4HG2 A;  4L18 B;  2VJJ A;  2W57 A;  3FXK A;  1XDS A;  5E1W A;  1J9I A;  5FRM A;  3GFM A;  3ZN1 A;  5LLQ A;  3W2V A;  2R7D A;  1GHC A;  4B1R A;  1XPX A;  2M34 A;  2GLO A;  2V1D A;  4YRV A;  5EYR A;  2DMP A;  1GV5 A;  2Y9Z A;  3KZZ A;  1BI3 A;  3H9G A;  3V42 A;  1VQ7 I;  4OWR B;  2R3S A;  5ICC A;  3KYL A;  4ZDL A;  3LWF A;  3GTL J;  2H8R A;  1FIP A;  1I6X A;  3E3V A;  2GQQ A;  1ZKG A;  5LGU A;  4CA0 A;  4S0H B;  5CVR A;  3H3U A;  4BXX J;  2LD5 A;  2L02 A;  2NVU B;  4E7K A;  1H9G A;  3RJP A;  1IN6 A;  1NK3 P;  1TWC J;  2ZJQ F;  4OIQ F;  5D6E A;  2X48 A;  3OR2 C;  1RET A;  1D0Z A;  5BPD A;  1EA3 A;  1I39 A;  1YW7 A;  2E19 A;  1FSE A;  3F0C A;  1MMD A;  3DPL C;  1RPW A;  2WB1 A;  5J3L A;  2W82 A;  3IH4 A;  2AO9 A;  1JHH A;  3OIQ A;  2VBY A;  4G7Z F;  2I8D A;  3TP3 A;  2ZXW H;  1R49 A;  2YR2 A;  1WJA A;  1QZE A;  1YS6 A;  2EV0 A;  3F8M A;  4NC8 A;  2DXI A;  3N05 A;  2P5L C;  2LSO A;  1E3H A;  3CTA A;  4KIF A;  2QEX I;  4M9Z A;  2XKO A;  4M9S A;  1VQO I;  5J6X A;  5LGN A;  1QGP A;  3KEY A;  4R8H A;  4ZYH A;  3BG9 A;  3Q0W A;  2VQH A;  4N0B A;  2XGE A;  4MTD A;  1OCC H;  3OYB A;  1HST A;  3RSN A;  2ETH A;  2ZNZ A;  2XPV A;  2EZI A;  3Q9V A;  2VXZ A;  3KP5 A;  2ZCW A;  4CCL A;  4DIQ A;  2E7X A;  3F9K A;  3C2G A;  3PSF A;  3D0S A;  4IHW A;  4C3I J;  2WAD A;  4AC0 A;  1MBF A;  1N25 A;  3HRM A;  1U2W A;  2W1O A;  2CQK A;  3S1Q J;  3LFU A;  2XB0 X;  2ESH A;  1GT0 C;  4KDP A;  2Z99 A;  1V54 H;  3GTJ J;  3OSG A;  3A02 A;  4BQQ A;  5F1R A;  1J0R A;  2LDU A;  1BW5 A;  3ML6 A;  2JMW A;  1JKO C;  5EZH A;  3K70 D;  3CES A;  3NAR A;  5B1A H;  3O2P E;  1AKH A;  2DDB A;  2M5W A;  1IRF A;  1PYV A;  5FGM A;  4R79 A;  1R7J A;  3QQA A;  2OCE A;  5J1R A;  2BY0 A;  2FMY A;  3SYT A;  1T8I A;  1FEX A;  2M0M A;  4UVB A;  2L9V A;  1H9T A;  2BY3 A;  1X1C A;  1Z0X A;  1Z21 A;  3R0A A;  1ZK8 A;  4LK1 F;  2JZY A;  1BIB A;  1WZ2 A;  1W5T A;  2QKM B;  1V5G A;  4D7M A;  1A31 A;  3O6B B;  1Y6I A;  3I56 I;  3SHF A;  5ICF A;  3AKZ A;  1S72 I;  3K4J A;  2KP6 A;  4B47 A;  1FOK A;  2L54 A;  2RDP A;  2BHZ A;  2CS3 A;  4GFB A;  5BMZ A;  2G0E A;  3M8F A;  3S17 J;  3G71 I;  3A01 A;  1VQ8 I;  2GOX B;  1RR8 C;  5HS9 A;  1JT0 A;  1YFH A;  4HQM A;  4MHG A;  3T8T A;  4HYE A;  2M4G A;  2Y30 A;  1IJW C;  5E17 F;  4AID A;  2IS2 A;  3G3Z A;  3BJO A;  4LK0 F;  2F48 A;  1QU3 A;  4RB1 A;  4HV6 A;  3V7R A;  4IF4 A;  2YS9 A;  2XIG A;  3IP4 B;  3VPR A;  2VQL A;  1IRG A;  1SD7 A;  2RGV A;  3H35 A;  4RGR A;  3IWZ A;  4HW0 A;  2E5N A;  4C9Y A;  1AA7 A;  4L5J A;  4HAM A;  2COB A;  3KP4 A;  4YEJ A;  1YW8 A;  4PDK A;  1U3E M;  4MLO A;  2D45 A;  2NNN A;  5H6R A;  1X1D A;  3SEQ A;  1TT5 B;  3OL4 A;  2OQG A;  2HVR A;  3L2Q A;  1MD0 A;  2GOM A;  4M72 A;  1IF1 A;  4XMY A;  2OCC H;  3WU1 B;  3EUH A;  4YIF A;  1P92 A;  2Q1Z B;  2XRL A;  2ZFU A;  5GPA A;  2HDD A;  2Z33 A;  1UZC A;  1P2F A;  5JLW A;  1BI2 A;  2BZT A;  2CG4 A;  1T98 A;  1KQ9 A;  2FOK A;  5LHG A;  3EYI A;  3DTE A;  1BM9 A;  3OYF A;  1T0F A;  3SJM A;  1LNW A;  2GIZ A;  1NG7 A;  1ENH A;  2QVO A;  3O8H A;  3KZY A;  2KLO A;  4M9X A;  3CDI A;  2RQQ A;  5F0C A;  3MD2 A;  1D1B A;  3BJA A;  3QU6 A;  5IYD J;  2JA7 J;  3RYP A;  2DT6 A;  4UVA A;  5DDG A;  3IHU A;  1OLT A;  1ON2 A;  1ACI A;  2PFB A;  1BC7 C;  1MIJ A;  1S5L C;  5CQG A;  2W24 A;  5M3F J;  4UY8 I;  4IVN A;  3HSR A;  1IRZ A;  3GZ6 A;  4HF0 A;  5GAG J;  2DYS H;  1WFX A;  3P7N A;  3QYF A;  3LSJ A;  2KRC A;  1YJW I;  3WGH A;  1K78 A;  2F5D A;  2M1B A;  2PJP A;  2CWE A;  1MJA A;  2CW0 F;  2OPT A;  3OYC A;  4MQV A;  2A6T A;  2MYS A;  4P9F A;  3FKJ A;  1TQI A;  4AWX B;  4KT6 A;  2R5Y A;  1TTY A;  3TO7 A;  4IO9 F;  3T0Y A;  1FWZ A;  2COM A;  3JAM Z;  4PJM A;  1KQ8 A;  2QF7 A;  1SAX A;  1AWC A;  1YIT I;  3CUQ B;  1I1S A;  3I4P A;  1J09 A;  4FT8 A;  1BA5 A;  1XGO A;  1HDP A;  1YX3 A;  2ZXH A;  2PMU A;  3IRR A;  3H0D A;  3J7A Y;  5IOZ A;  1Y1V J;  2LK2 A;  2GZW A;  3I58 A;  2AXL A;  1PUF A;  1REP C;  4EQQ A;  5CLS A;  2CV1 A;  3PQK A;  3GTM J;  2QKL B;  4RAZ A;  4OAZ A;  3B6C A;  4FQG A;  1WH7 A;  1UEL B;  2NVX J;  2IS1 A;  2EZL A;  3PIP F;  1ZN2 A;  2ME0 A;  2RN7 A;  1LVA A;  1OCP A;  2DU9 A;  3ERE D;  1R71 A;  3GTG J;  4EEF G;  5M3M J;  4M73 A;  2CV2 A;  3CDL A;  4XQF A;  2ISY A;  2H94 A;  2NYX A;  4BS9 A;  3DPT A;  3G1M A;  1YTY A;  2K9M A;  2BEO A;  2DTR A;  2QQ8 A;  2DDA A;  1O7L A;  3CF2 A;  2EFO A;  1J59 A;  2GA1 A;  3BQY A;  5IYC J;  2PLY A;  2V79 A;  5JHF A;  1Q1H A;  1B4A A;  3UR3 C;  4D0P A;  5GAH J;  2CQ7 A;  2DAO A;  2QYO A;  3K4L A;  3DU5 A;  2BY1 A;  1FIA A;  2A61 A;  2P5V A;  2OD5 A;  4I7H A;  4XLH A;  1MDM B;  2ECB A;  5LEJ A;  2VOO A;  4V19 K;  1ZLJ A;  4M3F A;  3SXY A;  4YFK F;  3BG5 A;  4DNC A;  2HGC A;  5LEK A;  1SD4 A;  3GFJ A;  4UNO A;  1VQ6 I;  2RKH A;  4BQO A;  2UUZ A;  3BZ6 A;  3HM5 A;  4HX4 A;  2LC2 A;  4U0W A;  1XCV A;  3LA3 A;  4U87 A;  3SEZ A;  4DBQ A;  4GDF A;  3HXL A;  2QSG X;  1YJ9 I;  4RB2 C;  1FBS A;  1WI9 A;  2OZ6 A;  1WCM J;  5TIS C;  4BAC A;  3ZMU A;  1RR7 A;  2H09 A;  3WE3 A;  4CXF A;  3F23 A;  1ON1 A;  3BTJ A;  1G4D A;  3GTK J;  4KN7 X;  3JR9 A;  1Z77 A;  2XAJ A;  1ZRF A;  2IA1 A;  3QPS A;  2MG4 A;  2HOS A;  1R00 A;  4I02 A;  3HJE A;  2XHK A;  2R7T A;  2P6T A;  3KEO A;  2GAU A;  3KP3 A;  4HST A;  2K4J A;  3L9F A;  1MKM A;  2PI0 A;  4L5I A;  4XLC A;  4EM0 B;  1F5T A;  1PUE E;  2DA5 A;  2RQP A;  2QQA A;  4XN0 A;  1R36 A;  3VEP A;  1SD6 A;  1WH5 A;  3R6S A;  1ORK A;  2K40 A;  2VKH A;  5FFX A;  5E3M A;  2DI3 A;  2OF7 A;  1W7P B;  2EBI A;  5F0F A;  4BJT A;  2ID6 A;  2OC6 A;  3PNY A;  1Z6T A;  1QZY A;  4GGG A;  2HTJ A;  4N4O B;  3J81 K;  2XB5 A;  2CW7 A;  3E97 A;  1MDM A;  3QPH A;  1ZGW A;  3J81 Z;  3S1M J;  4XLN F;  3B02 A;  2VBX A;  3DQV C;  3CDH A;  4JYK A;  1BC8 C;  1IG7 A;  5IP6 A;  3ASO H;  3I64 A;  6PAX A;  1MSE C;  4DGW B;  4Y15 A;  3CC2 I;  3QYE A;  2IRF G;  1HW1 A;  5EGO B;  1SFO J;  3S16 J;  1U9N A;  2HQR A;  4ZH4 F;  1CF7 B;  1I6H J;  3NRV A;  2XF5 A;  5CJ9 A;  4LMY A;  1JHF A;  3WTY C;  5HLI A;  2YX4 A;  3N4M A;  2F6C A;  1G59 A;  4KT5 C;  4RLQ A;  3COA C;  3M4O J;  3OSF A;  1FYM A;  3AAF A;  5M5X J;  1I3Q J;  3VSK A;  4DZP A;  2IXS A;  4S05 A;  5D5W B;  3P9C A;  4BE1 A;  4YEL A;  2KQR A;  4KA4 A;  2JA8 J;  5H6Q A;  1VFC A;  1DDN A;  3TQN A;  3NWT A;  3O8G A;  2ZFW A;  2BV6 A;  2DBB A;  4L9J A;  1R58 A;  4LD5 A;  1NH3 A;  3TMO A;  1P4A A;  4QPO A;  1POG A;  2E7W A;  2MH2 A;  3VWB A;  4P96 A;  2KT0 A;  3GTQ J;  5E20 A;  1VQ5 I;  3JTH A;  2HR3 A;  2WBM A;  1QA6 A;  1UHM A;  1BJZ A;  3KIO A;  2F4M B;  2DW4 A;  4BEH B;  5KCM A;  1OQY A;  2KRF A;  3E5X A;  1J2X A;  2DA7 A;  3ERM A;  3ZRG A;  3OYK A;  1TW3 A;  3FMR A;  1TWG J;  1SVM A;  1W7P A;  1FBU A;  5FLX K;  4FHT A;  2FBK A;  4QIW N;  3E6D A;  5CVU A;  1KON A;  4WF2 A;  3HTU A;  1KGS A;  2CUE A;  1SMT A;  4EJW A;  2O7O A;  1OPC A;  5DM6 F;  1YQA A;  2LFB A;  1SMY F;  4XBF A;  4NHJ A;  2M3A A;  2XV4 S;  3CCL I;  1YO5 C;  4XKB A;  4XRM A;  4Y7N J;  1IV8 A;  2HPI A;  4FE4 A;  2LF8 A;  1Z9C A;  3BG7 A;  4EM2 A;  5FRN A;  1PVE A;  3I54 A;  1O3Q A;  3GF2 A;  1WJB A;  2OAZ A;  4QTR A;  4U0V A;  1K61 A;  1UG2 A;  4G6T B;  2XRN A;  1TQP A;  3CJR B;  4I09 A;  2BVM A;  4Z6Y A;  1IAW A;  3V8K A;  2MBF A;  2XSD C;  4LLN A;  2FU4 A;  1WJE A;  2JTV A;  3MKL A;  1F43 A;  3K9T A;  3M3Y J;  3G6E I;  1VTN C;  5HLG A;  5DTD A;  1U8B A;  4BH9 A;  3FBN B;  3A03 A;  3HGG A;  3JRI A;  3PFI A;  4Y33 A;  3TW6 A;  4B43 A;  2XRO A;  2VXD A;  2VAS A;  5DEQ A;  4IHY A;  2JJ7 A;  2CJJ A;  3KZI C;  5FKK A;  1GDT A;  4F7Z A;  4EJT A;  2IA2 A;  4M3D A;  2VL8 A;  1HC8 A;  4BJ5 C;  4Z2Y A;  2KKO A;  2CYY A;  2DMQ A;  3DBL B;  3FXU A;  5BOX A;  1K79 A;  1CGP A;  2YUS A;  1S9H A;  2FBI A;  5D5U B;  2VPL A;  4OMZ A;  3LAP A;  2KIQ A;  1GVD A;  1JTX A;  2IW5 A;  1B1B A;  1JE8 A;  2KIS A;  1ZGA A;  5ILS A;  1IN7 A;  1FNN A;  1X19 A;  4GRI A;  1T39 A;  4II3 A;  2A6H F;  4UHT A;  4AD9 A;  5CKT A;  4A3D J;  3FXQ A;  3RQI A;  3ZGK A;  5C44 J;  1DPU A;  4A2U A;  1JJ6 C;  1LUJ B;  1U5T B;  5IOY A;  2E71 A;  3OR1 C;  3ABL H;  3ZN0 A;  1DGW Y;  2ICW G;  2QUF A;  3ZMT A;  5K5Q A;  3ZQH A;  3PO3 J;  2ZXI A;  4GO1 A;  3UKG A;  2GXB A;  3WU2 C;  1K6O A;  4BXU A;  4UUS B;  4HX8 A;  3RZD J;  4PK4 A;  3K1P A;  3IC7 A;  4BU2 A;  4C2T A;  4UXN A;  4PGH A;  3ZQ7 A;  4PJJ A;  2O0Y A;  1FZP B;  4A3B J;  5JR3 A;  3RDI A;  1OR7 C;  3LL7 A;  1WJD A;  1Q1V A;  3C7J A;  4QLC U;  3E5U A;  3OIP A;  1JUM A;  2A05 A;  3RPU D;  4FX4 A;  5IT3 A;  4BY1 J;  4YG2 F;  2HDW A;  4CCJ A;  1TZL A;  2R7S A;  2IPQ X;  2NXN B;  4L5E A;  1J7K A;  1K7A A;  2O6G E;  2O3F A;  4IRH A;  1ETO A;  4HNT A;  3KYD B;  3PUB A;  4ZDP A;  3BCB A;  1ZG3 A;  2VB6 A;  2W84 A;  5J4Y A;  3EUK L;  3I53 A;  1S3J A;  1ZH5 A;  4A3G J;  2KZG A;  4J19 A;  1D8J A;  5E18 F;  1ETY A;  3D5R C;  1GLN A;  2X1C A;  1TBX A;  1XN7 A;  5DCM B;  4MTE A;  4CCM A;  2X51 A;  1WQ2 A;  1OCR H;  3W3C A;  3TW7 A;  4MFE A;  1QBJ A;  1SAU A;  3RZO J;  4II2 A;  4RS8 A;  5DD8 A;  3CCS I;  2JN6 A;  3TED A;  1D3Y A;  4I99 C;  4BY7 J;  3HOS A;  1W4M A;  2CSO A;  2DLL A;  3PFY A;  1BR1 A;  3OV8 A;  1KU3 A;  4BE0 A;  1BJA A;  2IGN A;  2R5Y B;  4MEX F;  2STW A;  1D1C A;  2VIX A;  4LB6 B;  1PUF B;  3L2U A;  2LBF A;  2M0C A;  2K9L A;  2WV1 A;  2GM4 A;  2NRA C;  3ULQ B;  4E7Z A;  3A0B C;  5FLV A;  4KUM A;  2X9D A;  2KPM A;  2FJ1 A;  2X0L A;  3SDG A;  4FAS D;  4KIC A;  2JRM A;  4I98 B;  3ECH A;  4BDZ A;  3ZR8 X;  4E6K G;  5GAE J;  3W2A A;  2G9W A;  2QA4 I;  1B6A A;  3WOD F;  2KJC A;  4XOR A;  3SFI A;  4YFN F;  3X2Q H;  5LGT A;  2VQC A;  1OCT C;  1MH4 A;  2K9Q A;  2DYR H;  3QOP A;  3GFI A;  2IJL A;  5KK1 A;  3T8R A;  2Y31 A;  2M8G X;  5DV5 A;  3R0J A;  4UB8 C;  5HVQ C;  2O8X A;  3S14 J;  3M1C A;  2EA4 A;  2FX0 A;  2HKO A;  2KHM A;  3HOU J;  5CYV A;  3W6K B;  1BOB A;  5FJ8 J;  2CQX A;  5E3O A;  1Y0N A;  2P7V B;  3ABK H;  2KRH A;  3HC7 A;  3LQR A;  4UB6 C;  5LRS A;  1VQN I;  2H6C A;  2L5Q A;  1A6Q A;  1V4R A;  2LKS A;  3QPT A;  2Q2E B;  2P6S A;  4E7J A;  4XLE A;  5HDG A;  1AOY A;  2BY2 A;  1E3P A;  2X6W A;  3LAJ A;  2MC3 A;  3DEU A;  4ANJ A;  3E6B A;  4HRI A;  3TO9 A;  3PIO F;  5GP9 A;  3PL8 A;  2EV5 A;  1NG6 A;  2FA5 A;  3HGY A;  4CSW A;  2NS8 A;  2ZO4 A;  4A3F J;  1EV7 A;  2E34 A;  4PGG A;  1WJF A;  5DCF A;  1T0F C;  1YIO A;  2MD0 A;  5J47 A;  2RV8 A;  3Q3S A;  5K7Z A;  4HOB A;  4LLL A;  3CLQ A;  1FT9 A;  4F52 A;  2NS7 A;  2FSW A;  1TNS A;  1V5E A;  3H9Q A;  2CMP A;  3GCM A;  1U6G A;  3DLL F;  3IV5 A;  3L2C A;  4L0Y B;  1SFK A;  3F6V A;  3FK7 A;  3WTW C;  3KYC B;  1MSF C;  4IQ4 A;  2ZB9 A;  3DXJ F;  3ZPL A;  1ZQ3 P;  1SVO A;  3VFZ A;  3H5R A;  3S3M A;  1G3W A;  3RIR A;  1HXD A;  2JPB A;  2LR8 A;  4ZZD A;  5IPA A;  2JQ7 A;  2LTP A;  2V9K A;  4CO8 A;  2XDV A;  3VB2 A;  1YG2 A;  4RGS A;  1XD7 A;  3L7W A;  5HS7 A;  3K69 A;  3C18 A;  2Z5U A;  4RM3 A;  1WWX A;  3HZJ A;  1B9M A;  5K5O A;  3DLA A;  4ETS A;  1MH3 A;  2Y48 A;  4BGD A;  2G7U A;  2DMT A;  2QBY A;  3TOB A;  4J00 A;  2CUZ A;  2K4B A;  5KVR A;  1UG0 A;  2AQE A;  3FWE A;  1YOV B;  1O7F A;  5D5V B;  3OYN A;  1OIS A;  1B59 A;  3BR5 A;  1X3Z B;  1XGS A;  4GYG A;  3ROU A;  3SZG A;  1O3T A;  2VOP A;  2V1N A;  3S1N J;  3QP5 A;  1DGR M;  3PUF A;  2L7F P;  3KX2 A;  2XPU A;  3GO5 A;  3F8F A;  3KP7 A;  3JTG A;  1JUS A;  4X0G A;  3DWL E;  4A3E J;  1J75 A;  3GTP J;  1KYW A;  2F5C A;  3GYH X;  3I55 I;  5ILV A;  2HYJ A;  2QQ9 A;  1XMX A;  2K9N A;  1VI0 A;  2NS0 A;  1VF9 A;  4H0E A;  2D5V A;  5LHI A;  1BI0 A;  1JI8 A;  3C2B A;  2VBW A;  1O57 A;  1PDN C;  3TO6 A;  4BAY A;  2DA2 A;  3FF5 A;  5DUK A;  2HVS A;  5CVI A;  2CO5 A;  1FP2 A;  5FKO A;  4DOZ A;  1A36 A;  1IN8 A;  3JRB A;  1SVL A;  3HDD A;  1LJ9 A;  3M8E A;  1ETW A;  2XAH A;  1HSJ A;  1RES A;  3DEW A;  3VSL A;  4M3E A;  4RGU A;  1MND A;  1XGM A;  2ELJ A;  2NNY A;  2RVC A;  3Q9S A;  1LFU P;  1LPQ A;  1UFM A;  5HNF A;  1PJR A;  4XKC A;  2RRE A;  1QPI A;  4F92 B;  1LE8 A;  1ETQ A;  2W85 A;  2E2I J;  1YJN I;  1EH7 A;  4O5V A;  2JA6 J;  1R23 A;  1QO0 D;  2DFE A;  2E36 A;  4Q5S F;  1ZRE A;  1TQM A;  1XSV A;  2QCO A;  3QYB A;  3BTL A;  5DD4 A;  5FFZ A;  5IYB J;  2VJI A;  4ESF A;  5EG0 A;  2MLK A;  4I2O A;  2OZU A;  2YU9 J;  1GV2 A;  5KAF C;  3MKW B;  2MD5 A;  4MQ9 F;  2LF7 A;  4CCK A;  1KU9 A;  3ELK A;  2WAF A;  1P7I A;  2XGC A;  4HDU A;  3BTC A;  2E1C A;  1NHA A;  2TCT A;  3BR6 A;  4DQ2 A;  1I3A A;  3KET A;  1FOY A;  4LIT A;  1QRY A;  4IXA A;  2PJR B;  4PJN A;  2ELK A;  3OL3 A;  3QOD A;  4NDL A;  4BYY A;  4A3C J;  1V3F A;  3K4M A;  3LMM A;  4IL6 C;  2D2W A;  1BN5 A;  4I76 A;  3M8J A;  3CCY A;  2DOE A;  2DFI A;  4ABZ A;  2DT7 B;  3H92 A;  1WRJ A;  2DO7 A;  3ZMS A;  5B3S H;  1HDD C;  1LE8 B;  2HWV A;  1DU0 A;  2EPF A;  4WXC A;  3FIW A;  3ZQF A;  1IO2 A;  3D5S C;  2HPM A;  3FDY A;  1LFP A;  4OIO F;  1FJL A;  2K9S A;  1R5G A;  2W25 A;  3ZCO A;  2DPU A;  1OFC X;  3A2K A;  1ZAR A;  1TC3 C;  2LP0 A;  4ZJZ A;  2YX7 A;  3WTX C;  1YRN A;  4WXH A;  4QWQ A;  2PJR A;  2NOJ B;  2H1L A;  4XLP F;  2ESN A;  4LLG F;  3F3X A;  2XSJ C;  3KLO A;  5B66 C;  3OYH A;  2RNJ A;  3CUO A;  3HRT A;  1U5T C;  3ZP5 A;  1TLH B;  4G6D A;  2DCE A;  2V6C A;  2Q8K A;  1JKR C;  3CCM I;  2VPR A;  2X6X A;  2EFN A;  2HQA A;  2AXT C;  3LST A;  5L3D A;  4DZJ A;  1VND A;  3F8B A;  2HVQ A;  3J80 Z;  1IRX A;  2K5C A;  4WX9 A;  1UB9 A;  2MAB A;  3MQ0 A;  1VQM I;  2NVY J;  5CQE A;  3OWT A;  4LB5 A;  3K4K A;  1L0O C;  3JRH A;  3KFW X;  2V4J C;  4RGX A;  5E1X A;  3AG3 H;  3I59 A;  3IH2 A;  4I0A A;  1KU7 A;  3H9J A;  3PJR A;  1V55 H;  2O61 A;  5D4R A;  1G2H A;  2VQG A;  2DFF A;  4QSH A;  5CPR B;  2V7F A;  1B72 A;  3BG3 A;  2J5P A;  5L3F A;  1QPM A;  2Z2S B;  3MMY B;  1M1E B;  3I9V 2;  4HEA 2;  3WE2 A;  1D8K A;  5D8K B;  2R7Q A;  2K3P A;  5FLX Z;  2NVT J;  1QHG A;  5GPC A;  3I71 A;  4A3I J;  3K10 A;  3V4G A;  3H0G J;  4P1W A;  3BR3 A;  4OIP F;  1IC8 A;  4OOI A;  4DYR A;  3DF8 A;  3OS2 A;  2ZME A;  4EM1 A;  3ZQC A;  1EJ9 A;  3HOT A;  1U9O A;  2F5V A;  2ADU A;  3LSI A;  3GXO A;  3BT9 A;  3PM1 A;  3I4M J;  2EV6 A;  5M5W J;  4E7I A;  3DKW A;  1XMK A;  1TW2 A;  5E8G A;  2ZSI B;  1WPK A;  2CFX A;  2DQL A;  3DPU A;  4XRS G;  5C4J J;  4LIU A;  2O5R A;  2LMD A;  2A07 F;  1X1A A;  4XID A;  4GYI A;  2VLA A;  3JW4 A;  4XR6 A;  5GTI C;  1P4W A;  2DTZ A;  4JBA A;  4XIC A;  2L2O A;  3Q0V A;  3JCU C;  5GAD J;  5F04 A;  2GWR A;  2ELH A;  4Y52 J;  1QZZ A;  3TKY A;  2MFZ A;  2VJ4 A;  1A04 A;  4NBQ A;  3VYS B;  4ASN A;  4KFC A;  4AVP A;  1FYL A;  4B8X A;  3DBH B;  4ZDO A;  2DOA A;  3LSP A;  4DW6 A;  4XK4 A;  2FRH A;  3BTI A;  5EDN A;  5L3B A;  2M7B A;  5K1Y A;  3L2W A;  1DU6 A;  3K4B A;  2AQF A;  3ONQ A;  3IKT A;  4LOC A;  4MNU A;  2V9P A;  4BHB A;  4EJV A;  2X6Y A;  1D5Y A;  4KMF A;  3T5X A;  2JPC A;  4Y13 A;  3P5J A;  3W6J B;  5J1Y A;  1APL C;  1BOA A;  3GVA A;  3FXM A;  2JA2 A;  4PSX A;  3U1K A;  4BHP A;  4RB3 C;  3P9I A;  1TWA J;  3FHZ A;  2WAE A;  3C2H A;  3WTT C;  1AKH B;  2OUM A;  1FLI A;  3BY6 A;  3IUO A;  4B44 A;  3JSP A;  1KA8 A;  1MMA A;  3F8N A;  3A1Y A;  4M3G A;  1BL0 A;  3TDZ C;  3U2R A;  1DQU A;  1LFB A;  3BP8 A;  1P4X A;  4A3M J;  2R0Q C;  2DQR A;  4LG3 A;  4XNF A;  3VYT B;  1IGN A;  4P5O A;  2VE9 A;  4OMY A;  1G3Y A;  2I10 A;  5A2Q K;  2K3F A;  1ZYR F;  3BPV A;  4PFP A;  3ESW B;  1S8N A;  4EGY A;  1RNL A;  2RNG A;  5F27 A;  2EIJ H;  2HYG D;  2XVC A;  3EQL F;  3ZOB A;  3GTO J;  2AHQ A;  2WAQ A;  2IT0 A;  3A01 B;  4CHU A;  4E4H A;  2ZC2 A;  4PJL A;  2PN6 A;  2R93 J;  2K02 A;  1OCZ H;  4LG0 B;  2ZJR F;  2FE3 A;  2OJE D;  1STZ A;  4ENJ A;  1F36 A;  4I01 A;  4ESB A;  1R1T A;  2EIL H;  4D9J A;  2DJN A;  2FOW A;  3KP6 A;  1JJ8 C;  1Z05 A;  3SZT A;  5L3E A;  1BR2 A;  1A6I A;  4UV9 A;  1FBQ A;  2PMZ A;  3PNV A;  5TGT A;  4RM2 A;  1U78 A;  3OYL A;  3REO A;  3OYD A;  2KDZ A;  1MBG A;  1SFE A;  4ENM A;  2W4S A;  3S2W A;  2GXA A;  3F72 A;  1Z7L A;  2Z3Y A;  3GLL A;  4ZYD A;  3EUH C;  1K4T A;  3G1O A;  4A5N A;  1BI1 A;  1TNT A;  1Z1D A;  2M2E A;  2CFO A;  3CME I;  1W1W E;  1KYZ A;  1OYW A;  9ANT A;  3HRS A;  3G4S I;  1MBJ A;  3E5Q A;  2EFP A;  2DN0 A;  2MSY A;  2WA0 A;  4K2E A;  2DA6 A;  4RB0 A;  4A0Z A;  1XGN A;  3QAH A;  2I5U A;  4BQA A;  1WSU A;  1XMA A;  1AU7 A;  3HB9 A;  2KZV A;  1FP1 D;  1FMV A;  3U9G A;  2HZD A;  2HQN A;  4MGR A;  3VYU B;  4A12 A;  1R1V A;  4ZYE A;  1G6N A;  2WAQ N;  1U5T A;  4FTH A;  5DCM A;  2Z1D A;  3F8C A;  3FXR A;  1IDZ A;  1YX5 A;  3CLO A;  4CCO A;  2LKX A;  2ZME C;  3U21 A;  4B3X A;  2WWY A;  3G1L A;  3DCF A;  1HKQ A;  1GXQ A;  5EEH A;  4NQW B;  3WTS C;  5FKN A;  2JSC A;  3TDU C;  4DYC A;  5FO5 A;  4KJZ A;  5F6F A;  2BW3 B;  4BHC A;  2R7W A;  1D0X A;  3JRE A;  3DTK A;  2JUG A;  1MMN A;  4RMN A;  1WJC A;  1Z3X A;  3GUD A;  2BE5 F;  1XB4 A;  4C30 A;  1RZ4 A;  3HOW J;  4HF2 A;  2WTE A;  2MGQ A;  4HQE A;  3GX4 X;  2M9H A;  2F4O B;  1IW7 F;  1R1U A;  1X2M A;  1YYV A;  2XKP A;  3GZN B;  5LHH A;  1TWF J;  3CJT B;  3UNG C;  3EUA A;  1WVR A;  4B48 A;  3G2B A;  5DS9 A;  3Q5F A;  1Z91 A;  2F5F A;  2VJ5 A;  4D5F A;  4B09 A;  3HIF A;  4KNY A;  5IP9 J;  4CYC A;  1E17 A;  2PMZ N;  2NOG A;  3GWZ A;  2IS6 A;  5D4S A;  3S3N A;  3BC8 A;  3MCZ A;  5E3N A;  1I27 A;  2ZXJ A;  2IA0 A;  4ON0 A;  4OIN F;  5B5E C;  1BW6 A;  1YHQ I;  2EH3 A;  3HOX J;  1A5J A;  1JUP A;  3QPL A;  1FTT A;  4A3L J;  3TL4 X;  4O6J A;  3HG9 A;  4MIM A;  3R60 A;  3HHG A;  3HKZ N;  2YU3 A;  2P0W A;  3FXJ A;  4XL9 A;  3I4N J;  3E0J B;  2Q0O A;  3BZK A;  2FUG 2;  5B1B H;  1OJL A;  3VOE A;  4A3K J;  5L3C A;  1OMI A;  2H27 A;  1Z7U A;  3HTS B;  4X1E A;  1N78 A;  1IDY A;  1SEU A;  2VT2 A;  3OIO A;  1IXC A;  3ASN H;  3CCR I;  4CYD A;  4IX7 A;  4RDU A;  1UHW A;  3FHN A;  3L1P A;  1LQ1 A;  3HPH A;  2R5Z A;  3HBL A;  4NB5 A;  2EWN A;  3L00 A;  3G73 A;  4IOC F;  1LDD A;  3LFK A;  2R7Z J;  2LLK A;  5JI6 A;  4AVZ A;  1XTA A;  3MN2 A;  5ED4 A;  3OYA A;  1ZRD A;  3ZMZ A;  3CF5 F;  1W0T A;  1HOM A;  4ZYA A;  5E79 C;  5J8F A;  4RLF A;  2STT A;  3LSH A;  2KIM A;  3NWS A;  5ICE A;  4X6A J;  2LY1 A;  4F93 B;  4O3M A;  4CIC A;  1TP4 A;  1P6R A;  1RIO H;  4EGZ A;  5BS6 A;  1T38 A;  4DJA A;  4FCY A;  3MAJ A;  3JRF A;  3RKW A;  3RPU A;  2GIV A;  3DEE A;  2CH0 A;  2Z16 A;  1BIA A;  2VE8 A;  3K0L A;  3IKV A;  3VOD A;  1XC5 A;  3H3Z A;  3J7A O;  3PO2 J;  3RI4 A;  3CP2 A;  1P7J A;  1IZ1 A;  3CCQ I;  2K7L A;  1T95 A;  2OV7 A;  4B3A A;  4G94 A;  1FOW A;  1GUU A;  3CC7 I;  4JQF A;  2FXA A;  4PJ0 C;  3CCJ I;  4UUT A;  2JT1 A;  4AIJ A;  4G9Y A;  2VN2 A;  2LKP A;  3QP6 A;  4A5M A;  1YE9 A;  1WKM A;  1F1Z A;  1LVK A;  5HDN A;  2JVG A;  2V9V A;  2M30 A;  5IY5 H;  1J5Y A;  3H5A A;  3S32 A;  4AIK A;  4CUG A;  2FQ4 A;  3V7S A;  4IHV A;  1XSD A;  2ZBK A;  4IOA F;  1QVT A;  2HS5 A;  2E1M C;  3ECO A;  1EF4 A;  3TP0 A;  2IAI A;  4CDG A;  3SQN A;  3CC4 I;  4LG0 A;  1JTY A;  4XKV A;  1R6R A;  4IHS A;  1JGG A;  3GLX A;  3WG9 A;  2BVL A;  3LA2 A;  3DV8 A;  3ZQL A;  4IKF A;  3FK6 A;  2A69 F;  3AG1 H;  3C3W A;  1ZR4 A;  2Q2E A;  1HKT A;  2GBY A;  2OQR A;  2G7H A;  2A3S A;  4F91 B;  1X3U A;  5IT9 Z;  3GZ5 A;  1VQ4 I;  1S7E A;  3M7G A;  4W97 A;  2OTJ I;  1IXR C;  2JVH A;  2QSF X;  4N4N B;  4U0Y A;  3BRO A;  4I0B A;  4Y17 A;  2HKX A;  2A68 F;  4XOT A;  5FD5 A;  5EG0 B;  2OTL I;  3ZQQ A;  1Y1W J;  2M4K A;  1AHD P;  3K4C A;  2OA4 A;  2B9S A;  3CO7 C;  1OKR A;  1S7A A;  2IGO A;  4CH7 A;  4EAT A;  1ETV A;  4HPQ A;  2PX9 A;  2R7F A;  3HOY J;  1RUN A;  4NC7 A;  3GW2 A;  2VKV A;  1MZB A;  3KEQ A;  1RKT A;  4NC6 A;  5DM7 F;  1Z3Y A;  1ZG5 A;  2ID3 A;  2ZSH B;  3MZH A;  4CYC B;  2DA4 A;  1FY7 A;  1LDK B;  2IEK A;  4L0Z B;  4ZTF A;  4J01 A;  2R7X A;  3SZP A;  2K85 A;  3DTI A;  1NK2 P;  3OYJ A;  1FPQ A;  2R7O A;  1G8X A;  1I50 J;  2ACJ A;  2L0K A;  4XSZ F;  4F55 A;  3HUG B;  4C3H J;  3MVP A;  3K2Z A;  3OYG A;  2JK3 A;  2W00 A;  2XAG A;  2DK5 A;  4MO7 A;  4AIH A;  1RC9 A;  2PBI A;  2ISZ A;  2EIK H;  5F1J A;  2FNP A;  3NEU A;  3VYR B;  1O3R A;  2DK8 A;  1MJB A;  2P8T A;  1R5I D;  3A4C A;  3FMQ A;  3JSO A;  1X2N A;  1FC3 A;  4BUP A;  1QHH D;  3FIS A;  1MNE A;  3GEZ A;  4AUX A;  3V8L A;  2QEN A;  2IBD A;  4D1Q A;  5HLT A;  1ETK A;  2DJI A;  5F0H A;  2V1U A;  2LH9 A;  2L4A A;  1VQL I;  4CCN A;  1G3T A;  3IAM 2;  3LSR A;  4Q48 A;  3C1D A;  2MLG A;  1RRJ A;  4A0X A;  1JKQ C;  1FYK A;  5K7H A;  3PNT A;  3E6C C;  1HCR A;  2ZKZ A;  3TOA A;  1BBY A;  2YPR A;  4NNJ A;  5AIP A;  1UCR A;  4Q4Z F;  1HKS A;  3ZMV A;  3OYI A;  1IV6 A;  3A0H C;  3Q0U A;  3WU0 A;  1U8R A;  2QZ8 A;  1Z6R A;  1UMQ A;  1X1B A;  4A6D A;  3HRU A;  2E5Z A;  2EFW A;  1YI2 I;  1HW5 A;  3AG2 H;  3B73 A;  3S1R J;  2QBY B;  3ABT A;  2XF7 A;  2WC2 A;  4KIT B;  2EIM H;  3BOQ A;  4WXD A;  3OOU A;  4F3Q A;  5ICG A;  3S3O A;  2PG4 A;  2GXG A;  3WGI A;  3H3V K;  2QQB A;  3K4N A;  2H8W A;  2H6B A;  3W6V A;  2UWM A;  3NQO A;  2AS5 F;  1VQP I;  2CW8 A;  3OYM A;  1YLF A;  2EJR A;  3AL0 B;  1U0J A;  2BW3 A;  3LA7 A;  1QVU A;  2IGM A;  1XG1 A;  4OAY A;  3V8J A;  2L7K A;  3HL2 A;  2VBZ A;  1T08 B;  2DA3 A;  1E0E A;  5FLM J;  3KE2 A;  2BXY A;  4NQW A;  2WY7 Q;  4U7D A;  1ZAO A;  2LNB A;  2FML A;  2XF6 A;  3FKI J;  5ERI A;  3K2A A;  4V2F A;  2JA5 J;  4ZYG A;  2YSR A;  3FXO A;  5LRR A;  4C2M J;  2L7Z A;  3BR0 A;  2VOD A;  1YS7 A;  2E1M B;  2R4G A;  4G12 A;  3CCU I;  3RKY A;  3HSE A;  2BXZ A;  4G8X A;  2E1N A;  2UXX A;  2XAF A;  4L9V A;  3JRA A;  2Z9O A;  4C2U A;  1MW7 A;  2L01 A;  4TV7 A;  1MJ9 A;  4KIB A;  3H1C A;  2C6Y A;  3IH3 A;  3BLY A;  3LQQ A;  3MZ8 A;  5HOD A;  2Y0M A;  3CP8 A;  4EMS A;  2QGU A;  5F64 A;  2N8G A;  3KLN A;  3ISP A;  2HOE A;  1W5C C;  3P9K A;  3L2R A;  4L9N A;  1R9T J;  1IN4 A;  3HYI A;  3S2H J;  2RC4 A;  3CD6 I;  4XSX F;  2UXN A;  5EZG A;  1K83 J;  1H0M A;  2FQ3 A;  1VQ9 I;  2PEX A;  3BG6 A;  3OS1 A;  3FX3 A;  4D7N A;  3K1M A;  2HTS A;  1R22 A;  1LKX A;  2Y0S N;  3BR2 A;  3LSM A;  3M07 A;  3RQ4 A;  3L09 A;  5EF6 A;  2M8E A;  2O8K A;  1ERD A;  2VKD A;  2CQN A;  2Y0S A;  4KN4 X;  5AON A;  2MH9 A;  4ENK A;  4UVC A;  5BPI A;  4LJZ F;  4B4C A;  3FM5 A;  1W5S A;  2BHY A;  3B6A A;  3ZQG A;  1ONV A;  3J7Y J;  5H2F C;  1EH6 A;  4L9T A;  2PQ8 A;  4E7S A;  2L9N A;  1DUX C;  1JT6 A;  3HHH A;  2Y69 H;  5TJJ A;  3CUQ C;  4M6X A;  4V2G A;  2A5W A;  2ZNY A;  4KYW A;  2QLZ A;  4KMU X;  4MFD A;  2HXI A;  3QU3 A;  2Y9Y A;  3K7A J;  2EZK A;  2F5E A;  3KCC A;  4BBR J;  3GME A;  5FKL A;  2GA2 A;  3M1E A;  4M74 A;  5EJC A;  1SAN A;  4QPQ A;  3J7Z I;  2A5Y B;  1VQK I;  2CRG A;  4BXF A;  1RI7 A;  1F9N A;  3H5N A;  4ENN A;  4G7H F;  1W36 D;  3EDP A;  1TL8 A;  5AIQ A;  3F22 A;  4DYQ A;  2MC4 A;  4HDV A;  4BBS J;  3HSF A;  3MZY A;  2DOD A;  2WV0 A;  1V5F A;  3AL0 C;  2QSH X;  4R1H A;  5HNH A;  2K27 A;  3I0T A;  4OIR F;  4EJO A;  2WY8 Q;  3L2V A;  2FNA A;  1B8I B;  1MGT A;  5D6F A;  2EQR A;  3EYY A;  5FKM A;  1HF0 A;  4XOP A;  2R92 J;  3LNQ A;  2XUB A;  4WK8 F;  1OCO H;  1P9Q C;  2F4I A;  5C3E J;  1H8A C;  3V7C A;  5E3L A;  2CU7 A;  2DMU A;  2EA2 A;  4PZJ A;  1H88 C;  4HV5 A;  4AM3 A;  5LBQ A;  3HKZ A;  1JXS A;  4BQN A;  3RKQ A;  4HLX A;  2KMU A;  3RYR A;  3JRC A;  5JFR A;  1W36 C;  4UUS A;  1NTC A;  2CV0 A;  3HOV J;  3BR1 A;  4PUS A;  4PCQ A;  4JX4 A;  5HLH A;  2F2E A;  3JAM K;  5JVT A;  3M9A A;  2X4H A;  4FET A;  3EET A;  2IS4 A;  1HA8 A;  1MBH A;  1BR4 A;  4HX7 A;  2E35 A;  3DP7 A;  1Y39 A;  5KHD A;  2VI6 A;  4IJA A;  1ODD A;  3ZXS A;  5FRO A;  4HA8 A;  4G6Q A;  1ZTR A;  3SDB A;  3AG4 H;  3WGG A;  3WHC A;  1X4P A;  5KAI C;  4HZF A;  4IRG A;  2QWW A;  1L3L A;  2EB7 A;  1DP3 A;  3HEF A;  4P9U A;  1O4X A;  2LVS A;  2L3D A;  3PSI A;  2CUJ A;  2VON A;  1D0Y A;  3BQZ A;  2R7V A; 
#chains in the Genus database with same CATH homology
 5FLV A;  2FD5 A;  4MLO A;  3G1L A;  2X9D A;  3DCF A;  3SDG A;  2FJ1 A;  3D1N I;  5FKN A;  5M5Y J;  4DYC A;  3SFI A;  2HI3 A;  3JRE A;  1OCT C;  2XRL A;  5GPA A;  2HDD A;  1MH4 A;  2K9Q A;  5JLW A;  2E1O A;  2CUF A;  3HOW J;  4D5C A;  2MGQ A;  2Y31 A;  2M8G X;  4AYB N;  2M9H A;  1X2M A;  3SJM A;  3S14 J;  3HOU J;  1TWF J;  2FX0 A;  1ENH A;  3O8H A;  2O9L A;  4IHX A;  5DS9 A;  5F0C A;  4A69 C;  5FJ8 J;  2CQX A;  5E3O A;  4D5F A;  1CQT A;  5IYD J;  4C3J J;  2JA7 J;  5J1U A;  5IP9 J;  4CYC A;  3JRG A;  2PMZ N;  2NOG A;  4M6V A;  5E3N A;  1IUF A;  5BNG A;  1XS9 A;  2TRT A;  4JX5 A;  1BW6 A;  5GP9 A;  2EH3 A;  3HOX J;  5M3F J;  1A5J A;  1JUP A;  2RAE A;  3QPL A;  1IRZ A;  1FTT A;  4A3L J;  2ME6 A;  4A3J J;  4MIM A;  3HGY A;  3HKZ N;  2NS8 A;  3I4N J;  3LSJ A;  4A3F J;  1OJL A;  4A3K J;  2OPT A;  2X6O A;  3Q3S A;  5K7Z A;  1TWH J;  2Y2Z A;  4X1E A;  2NS7 A;  1IDY A;  2XPW A;  3OIO A;  3JRD A;  2NVQ J;  3IV5 A;  2R5Y A;  4RDU A;  3L1P A;  3FK7 A;  1MSF C;  2R5Z A;  2ZB9 A;  3HBL A;  1B8I A;  1YRN B;  2R7Z J;  2LLK A;  2QF7 A;  5EGO A;  3MN2 A;  4A93 J;  1W0T A;  1ZQ3 P;  1HOM A;  5IP7 J;  1BA5 A;  1HDP A;  1WI3 A;  2LR8 A;  5IPA A;  2LTP A;  5IOZ A;  3CMY A;  1Y1V J;  2LK2 A;  4X6A J;  1PUF A;  1B72 B;  3GTM J;  4FE7 A;  3B6C A;  1WH7 A;  2NVX J;  2DMN A;  1MH3 A;  4BKX A;  4JP0 A;  2EZL A;  4W1U A;  4FCY A;  2DMT A;  2ME0 A;  1RKW A;  1OCP A;  3JRF A;  3GTG J;  4EEF G;  2P81 A;  5M3M J;  2HQ5 A;  3CDL A;  2ECC A;  3G1M A;  1XC5 A;  3PO2 J;  3BR5 A;  1P7J A;  3S1N J;  2L7F P;  4B3A A;  2XPU A;  3BQY A;  5IYC J;  1JUS A;  1GUU A;  4A3E J;  4UUT A;  3GTP J;  2E2H J;  3S15 J;  3GBG A;  2HYJ A;  2K9N A;  2VKE A;  1VI0 A;  1VF9 A;  1FIA A;  4RBO A;  2D5V A;  2ECB A;  2EZH A;  3C2B A;  2FQ4 A;  4IHV A;  4M3F A;  2DA2 A;  1QVT A;  5EEA A;  2CQQ A;  1EF4 A;  5FKO A;  3BG5 A;  3LSG A;  3TP0 A;  2IAI A;  2WB1 N;  1ITY A;  3JRB A;  3HDD A;  1JTY A;  1ETW A;  1JGG A;  3HM5 A;  1RES A;  3DEW A;  5F08 A;  4M3E A;  1LFU P;  3ZQL A;  3FK6 A;  1ZR4 A;  1QPI A;  1MNM C;  1WCM J;  1ETQ A;  2GBY A;  1LE8 A;  2E2I J;  1RR7 A;  3GTK J;  3BTJ A;  2JA6 J;  2L7M P;  1UHS A;  1S7E A;  3JR9 A;  4W97 A;  1Z77 A;  2QCO A;  3QPS A;  1T56 A;  3BTL A;  5IYB J;  5EG0 A;  2MG4 A;  5EG0 B;  4IEJ A;  2HOS A;  2YU9 J;  1ETX A;  1GV2 A;  1Y1W J;  1AHD P;  1P7I A;  2XGC A;  2XGD A;  3BTC A;  5K7F A;  1ETV A;  2L9R A;  3BR6 A;  2TCT A;  1WGX A;  3HOY J;  1QRY A;  2VKV A;  2ELK A;  4NDL A;  1RKT A;  4A3C J;  2E2J J;  2DA5 A;  1MBE A;  4HNV A;  2ID3 A;  4I76 A;  3CCY A;  4ABZ A;  2DA4 A;  4CYC B;  1T33 A;  2IEK A;  1WH5 A;  2LY9 A;  4I6Z A;  2HXO A;  1ORK A;  2K40 A;  1LE8 B;  1HDD C;  5E3M A;  5F0F A;  2OF7 A;  1DU0 A;  2EBI A;  1NK2 P;  3FIW A;  2ID6 A;  3ZQF A;  1I50 J;  2JWT A;  2L0K A;  2XB5 A;  1W0U A;  3HOZ J;  1ZGW A;  1FJL A;  2K9S A;  4C3H J;  4JYK A;  3S2D J;  1IG7 A;  3MVP A;  4JX6 A;  3LOC A;  5IP6 A;  1OFC X;  2JK3 A;  2H1K A;  1MSE C;  4M3B A;  1TC3 C;  5EGO B;  2LP0 A;  4MO7 A;  1SFO J;  2W48 A;  3S16 J;  1YRN A;  1U9N A;  5C4X J;  2MW8 A;  1I6H J;  1JKP C;  5F1J A;  3WHB A;  1X2N A;  3FIS A;  3OSF A;  3M4O J;  5M5X J;  1I3Q J;  1H89 C;  4AUX A;  2IBD A;  4DZP A;  1ETK A;  1JKR C;  5F0H A;  2VPR A;  2HOA A;  2JA8 J;  1VFC A;  3LSR A;  4DZJ A;  1HLV A;  1VND A;  3O8G A;  3CQZ J;  1JKQ C;  5K7H A;  1HCR A;  1POG A;  2HOT A;  2B63 J;  2NVY J;  4FIS A;  3Q0U A;  5JLX A;  4XRS A;  1IV6 A;  3GTQ J;  2KT0 A;  1UMQ A;  3JRH A;  1BJZ A;  3IH2 A;  2VUM J;  3S1R J;  2DA7 A;  3E7L A;  3ZQI A;  1G2H A;  3NAU A;  1TWG J;  4QSH A;  1E3O C;  3OOU A;  1B72 A;  3BG3 A;  3H3V K;  4QIW N;  2CUE A;  3W6V A;  2O7O A;  2LFB A;  1MBK A;  2R5Z B;  2DA1 A;  2NVT J;  5GPC A;  4A3I J;  3H0G J;  1QVU A;  1X58 A;  1ZR2 A;  3BR3 A;  1FTZ A;  1IC8 A;  1XG1 A;  4DYR A;  4XRM A;  4Y7N J;  3ZQC A;  1U9O A;  2DA3 A;  5FLM J;  4FE4 A;  3BT9 A;  3PM1 A;  3I4M J;  5M5W J;  4B1R A;  3FKI J;  2M34 A;  2GLO A;  3K2A A;  4V2F A;  2JA5 J;  4C2M J;  5EYR A;  1WPK A;  2DMP A;  1GV5 A;  2L7Z A;  3BR0 A;  4QTR A;  4G12 A;  2Y9Z A;  1K61 A;  4XRS G;  5C4J J;  1UG2 A;  3JRA A;  2XSD C;  3GTL J;  4XID A;  1FIP A;  2H8R A;  1ZKG A;  3MKL A;  4S0H B;  1F43 A;  2DTZ A;  2LD5 A;  4BXX J;  4XIC A;  3Q0V A;  3IH3 A;  5HOD A;  5F04 A;  3M3Y J;  4Y52 J;  1NK3 P;  1TWC J;  2X48 A;  5DTD A;  1U8B A;  1RET A;  2N8G A;  3A03 A;  3HGG A;  3JRI A;  2E19 A;  3TW6 A;  3F0C A;  3LSP A;  1R9T J;  1RPW A;  5J3L A;  4DW6 A;  4IHY A;  3S2H J;  4XK4 A;  2JJ7 A;  3BTI A;  5EDN A;  3IH4 A;  2AO9 A;  5EZG A;  1DU6 A;  1K83 J;  5FKK A;  2CJJ A;  4LOC A;  1GDT A;  4M3D A;  3TP3 A;  4D7N A;  1D5Y A;  2Y0S N;  3BR2 A;  2DMQ A;  5EF6 A;  2O8K A;  5J1Y A;  2YUS A;  1APL C;  1GVD A;  1JTX A;  4B4C A;  1TWA J;  3ZQG A;  3B6A A;  3BG9 A;  3Q0W A;  2XGE A;  1JT6 A;  1AKH B;  4A3D J;  3RQI A;  2XPV A;  2EZI A;  4M3G A;  5C44 J;  1BL0 A;  4V2G A;  1LFB A;  1JJ6 C;  4A3M J;  2R0Q C;  4MFD A;  5IOY A;  1IGN A;  2HXI A;  4IHW A;  2Y9Y A;  4C3I J;  2I10 A;  3K7A J;  4AC0 A;  1MBF A;  2EZK A;  4BBR J;  3PO3 J;  3ZQH A;  3S1Q J;  3UKG A;  2XB0 X;  5FKL A;  5F27 A;  1GT0 C;  1SAN A;  4UUS B;  3GTJ J;  3OSG A;  3S1M J;  2CRG A;  3RZD J;  3A02 A;  4DYQ A;  3ZOB A;  1BW5 A;  2JMW A;  1JKO C;  3GTO J;  2AHQ A;  4A3B J;  5EZH A;  4BBS J;  3A01 B;  2R93 J;  1Q1V A;  3NAR A;  1B8I B;  1JUM A;  2EQR A;  4BY1 J;  1F36 A;  1AKH A;  5FKM A;  1HF0 A;  2DJN A;  1JJ8 C;  2R92 J;  3LNQ A;  3QQA A;  4L5E A;  5J1R A;  1A6I A;  1FEX A;  1ETO A;  1Z0X A;  5C3E J;  1H8A C;  1U78 A;  1ZK8 A;  5E3L A;  2CU7 A;  2DMU A;  2KDZ A;  1MBG A;  1H88 C;  4D7M A;  3RKQ A;  3JRC A;  4UUS A;  1NTC A;  3HOV J;  4A3G J;  3G1O A;  3BR1 A;  4J19 A;  2M2E A;  4GFB A;  1ETY A;  4JX4 A;  2G0E A;  3S17 J;  9ANT A;  1MBJ A;  3A01 A;  1MBH A;  2DN0 A;  2MSY A;  1JT0 A;  3TW7 A;  4MFE A;  2DA6 A;  3RZO J;  2VI6 A;  2Y30 A;  1IJW C;  2JN6 A;  3TED A;  1AU7 A;  4BY7 J;  3HB9 A;  1ZTR A;  3WHC A;  2WAQ N;  2YS9 A;  2R5Y B;  4FTH A;  3VPR A;  1PUF B;  3HEF A;  1IDZ A;  2M0C A;  2GM4 A;  2WV1 A;  1O4X A;  2LVS A;  2COB A;  3BQZ A;  2LKX A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...