1OCPA

Solution structure of oct3 pou-homeodomain
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
67
structure length
67
Chain Sequence
b'METLVQARKRKRTSIENRVRWSLETMFLKCPKPSLQQITHIANQLGLEKDVVRVWFCNRRQKGKRSS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords OCT-3
publication title Structure of the Oct-3 POU-Homeodomain in Solution, as Determined by Triple Resonance Heteronuclear Multidimensional NMR Spectroscopy
pubmed rcsb
source organism Mus musculus
molecule tags Dna binding protein
total genus 13
structure length 67
sequence length 67
ec nomenclature
pdb deposition date 1995-02-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00046 Homeodomain Homeodomain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.60 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Homeodomain-like 1ocpA00
1JTYA 1FIPA 1IJWC 4B1RA 3ZQCA 4C3JJ 2AHQA 2CU7A 2EH3A 5C44J 4FISA 2XGDA 2LLKA 3GTKJ 4X1EA 1H8AC 4LOCA 5FLMJ 1VFCA 4I76A 1D5YA 5M3FJ 3QPLA 5EZGA 4A3JJ 3L1PA 2R5ZA 2N8GA 2M34A 4AYBN 1B72A 3LSRA 3ZQIA 4BBRJ 1JKOC 2YU9J 2R7ZJ 2IAIA 3BT9A 4UUSB 2HDDA 4XICA 3H0GJ 2K40A 5HODA 2Y9ZA 4XRSA 1JJ8C 1ZTRA 1ZR4A 3A03A 3S1RJ 1DU0A 4MFDA 1B8IB 3JRIA 1YRNA 2Y9YA 5J1RA 2DA2A 4JP0A 4CYCA 4M3BA 1P7JA 2LY9A 1NK3P 3HOYJ 3O8GA 2CJJA 4Y52J 9ANTA 2JA6J 1JJ6C 2M2EA 3HOVJ 1UG2A 2LR8A 1TWHJ 1JKRC 2VKVA 4AC0A 1ENHA 1PUFA 2EZIA 4QSHA 1FTTA 1OCTC 2JMWA 1W0TA 3M4OJ 1SANA 3I4MJ 4DYQA 4DZPA 1IRZA 4Y7NJ 4W1UA 3JREA 3D1NI 4L5EA 1AHDP 1LFBA 4HNVA 1GV5A 5K7FA 3GTOJ 2EZLA 3BG9A 5JLXA 1NK2P 2FD5A 3GTGJ 4MIMA 2CQQA 4JX4A 2ECCA 2X9DA 4W97A 2CUEA 2VI6A 1K61A 2XB5A 2ME0A 2H8RA 2HOAA 2DA1A 2W48A 3S17J 1H88C 3DEWA 1POGA 2QF7A 1I3QJ 4M3EA 4V2GA 3HOUJ 5FJ8J 1WI3A 3FISA 5E3MA 3MVPA 5EYRA 3H3VK 2HOSA 4A3CJ 3E7LA 4XRSG 2ECBA 4UUTA 5FKNA 3MKLA 5EGOB 3FIWA 3JRAA 1MSEC 1K83J 2EZKA 5IPAA 1TWCJ 3DCFA 3ZOBA 2K9QA 2DA5A 4C3IJ 1T56A 4J19A 3BQYA 3GTPJ 4A3GJ 1SFOJ 1Y1WJ 3BR2A 2G0EA 3GBGA 5EEAA 1AKHB 4M3GA 3BR1A 3MN2A 1ZKGA 1BJZA 2E19A 1VI0A 1HF0A 1Q1VA 4I6ZA 3S2HJ 4GFBA 4JX6A 1WH5A 2JWTA 2QCOA 3A01B 1ZQ3P 4B3AA 5DS9A 1LE8B 2MW8A 4DYCA 4A93J 3LSGA 5F08A 1ETKA 3CMYA 2EQRA 3BR0A 1CQTA 3BTCA 1W0UA 4D5CA 5IYDJ 5M3MJ 3K2AA 3S1MJ 4IHYA 4BXXJ 3SDGA 3WHCA 3ZQGA 1XS9A 2LTPA 2L7ZA 3G1MA 2LKXA 1HDPA 4BKXA 2XGCA 2HYJA 5GP9A 1RETA 2DA6A 5M5XJ 1FEXA 2YS9A 2H1KA 2ID6A 1HLVA 2JN6A 2WB1N 5E3OA 4DZJA 3HM5A 1I6HJ 1ORKA 5C4XJ 2R5ZB 2E2HJ 2CQXA 1UMQA 3JRCA 3GTJJ 1B72B 3BG5A 1GUUA 3QQAA 2Y30A 3BG3A 1IV6A 4JYKA 5GPCA 2NS7A 2TCTA 1MBHA 3CQZJ 4C3HJ 1MNMC 1JUPA 2JA8J 2DMQA 3OSGA 1FJLA 1JGGA 4FCYA 1YRNB 2DMUA 4A3BJ 1Z77A 4XK4A 1MBEA 2OPTA 5EZHA 3NARA 4CYCB 4UUSA 3JRDA 3PO3J 5IP7J 3S14J 3BTJA 3HBLA 2KDZA 5F27A 1B8IA 2D5VA 1X2MA 1ZGWA 3BR3A 4M3FA 4A3MJ 5IP9J 4X6AJ 1UHSA 2M9HA 3C2BA 5EG0A 5JLWA 2DTZA 5DTDA 1PUFB 5IP6A 3TP3A 3RQIA 3RKQA 3S15J 2DA4A 3HGYA 3TW7A 5BNGA 3O8HA 1Z0XA 4D7MA 5C3EJ 1BW6A 1MSFC 1ETYA 1ZR2A 1WH7A 1JT0A 1MBGA 2HQ5A 5IYBJ 1E3OC 3K7AJ 3JR9A 5E3LA 2CRGA 2R5YA 2VPRA 2LD5A 1TWGJ 3S1QJ 3NAUA 3BTIA 2L9RA 3G1LA 1ETXA 1A5JA 1LFUP 2NOGA 2AO9A 3IH4A 3TP0A 4C2MJ 3SFIA 4AUXA 1Y1VJ 2MG4A 2E1OA 2HXOA 2LFBA 2RAEA 5J3LA 3BTLA 3JRHA 4BY7J 2O9LA 5IOYA 2ID3A 5F1JA 1QVTA 1HDDC 3UKGA 2VUMJ 2NVQJ 1JKQC 4XIDA 4IHXA 3HB9A 2L7MP 3JRBA 1ETQA 5EDNA 4IHVA 1VNDA 2KT0A 3BR6A 2P81A 3RZOJ 2JA7J 4DW6A 2DN0A 2DA3A 5F0HA 5E3NA 1JKPC 2EBIA 1H89C 2R92J 2M8GX 1QPIA 2L7FP 3G1OA 5F04A 1F43A 2XSDC 2JA5J 4IHWA 1RKTA 1AU7A 2Y2ZA 2HI3A 2JJ7A 5GPAA 2ME6A 3GTLJ 2NVTJ 2L0KA 5J1UA 3QPSA 4A3IJ 1JT6A 1MBKA 2WAQN 1IDZA 3B6AA 3M3YJ 2X48A 3BQZA 3OIOA 1QVUA 3Q0WA 1GV2A 2NVYJ 5EF6A 1XG1A 4NDLA 1EF4A 1ETWA 2HXIA 2WV1A 3OSFA 3TW6A 3I4NJ 4G12A 2EZHA 2TRTA 2PMZN 1TWFJ 5F0CA 4BY1J 1FTZA 3F0CA 2GBYA 1MH3A 1IGNA 1JUSA 1JUMA 1FIAA 2MSYA 4DYRA 2O7OA 1G2HA 3ZQFA 3SJMA 3Q0VA 5FKKA 4QTRA 1MBFA 4V2FA 1RKWA 1BW5A 2R93J 1WPKA 1A6IA 3LSPA 3RZDJ 2FQ4A 1R9TJ 1BL0A 3TEDA 4BBSJ 3WHBA 2O8KA 2XPVA 1I50J 3HKZN 2NVXJ 3GTMJ 2DMNA 1ZK8A 1BA5A 2I10A 1DU6A 1MBJA 1TWAJ 3GTQJ 2COBA 1RR7A 1OJLA 1JTXA 5M5WJ 3ZQLA 2VKEA 1X2NA 3FK7A 2NS8A 3HOXJ 4A3FJ 2DMTA 5J1YA 4A3EJ 3LNQA 4D5FA 3IV5A 2Y0SN 1IC8A 5FKLA 1WCMJ 2HOTA 2XPWA 5FKMA 4MLOA 1X58A 5EG0B 2XPUA 4D7NA 1HCRA 1HOMA 2OF7A 4A3DJ 3FKIJ 4M3DA 3CCYA 2ELKA 2YUSA 4M6VA 1GDTA 2K9NA 1WGXA 2DMPA 1U9OA 2XGEA 4A3LJ 1VF9A 2XRLA 2XB0X 2CUFA 4FTHA 2IBDA 1GT0C 1ETOA 1ITYA 2R5YB 3S16J 1OCPA 1APLC 2E2IJ 1F36A 4XRMA 2DA7A 2LP0A 2ZB9A 3FK6A 3S1NJ 3W6VA 1S7EA 2K9SA 1QRYA 2X6OA 3HGGA 2E2JJ 2DJNA 4B4CA 3PO2J 2FX0A 5FKOA 4FE4A 4S0HB 3A02A 3PM1A 2JK3A 2MGQA 3CDLA 3IH2A 3JRFA 3VPRA 5IOZA 1IUFA 3IH3A 5K7HA 1GVDA 4MO7A 2IEKA 3ZQHA 1NTCA 4FE7A 2LVSA 5EGOA 4A69C 5K7ZA 2FJ1A 2Y31A 3JRGA 2R0QC 2GLOA 5FLVA 3HOZJ 4RDUA 5F0FA 2M0CA 1RPWA 1MH4A 4RBOA 1TC3C 1OFCX 1RESA 1AKHA 5M5YJ 3B6CA 3HEFA 1U8BA 1IG7A 1T33A 3OOUA 5IYCJ 4EEFG 1U9NA 1IDYA 1O4XA 3BR5A 3LOCA 2B63J 1XC5A 3A01A 2LK2A 4ABZA 3Q0UA 3Q3SA 1U78A 4IEJA 1LE8A 2GM4A 4MFEA 1P7IA 4JX5A 4A3KJ 4QIWN 3LSJA 3S2DJ 1ETVA 5C4JJ 3HOWJ 3HDDA
chains in the Genus database with same CATH superfamily
1OCOH 3ZMUA 4CDGA 4DOZA 4HLXA 2RC4A 1VZ0A 1IN5A 4B1RA 1IRXA 2AHQA 5C44J 2LC2A 2YU3A 4YIIA 3L2RA 1EH6A 3K0LA 3DEEA 2CQKA 5FD6A 3WTUC 3GTKJ 5JFRA 1GHCA 4LOCA 1VFCA 3WU0A 5J8FA 3QPLA 5EZGA 5DDGA 3V42A 2IW5A 5ICFA 4IQ4A 1R22A 1YW9A 2N8GA 1Z67A 4AYBN 1B72A 2VQGA 4R8HA 4D9JA 3DP7A 3C1DA 4XLFA 4BBRJ 4AVZA 3HRSA 4CCNA 3NEUA 2IAIA 3BT9A 5BOXA 3M1CA 4FHTA 4KMUX 5JHFA 5HODA 1P4AA 1XDUA 2OV7A 2ZSHB 1ZTRA 4M6XA 4UB8C 1X1CA 3CJRB 4XRSA 4J00A 3S1RJ 1T0FC 1Z7LA 2E7WA 1IUYA 3E6DA 3F6OA 1XSVA 2DA2A 1R6RA 1R00A 1HW1A 2V1DA 2R7OA 1X3WB 2F48A 1P7JA 1SAXA 3RPQA 1RUOA 3HUGB 3HOYJ 3O8GA 4UVAA 2QBYB 3DBLB 1YX5A 4Y13A 4XN0A 9ANTA 2JA6J 3MWMA 5HS8A 3ZCOA 5A2QK 2M2EA 1JKRC 3K6GA 2Y75A 3J7YJ 3RKYA 3F3XA 3IAM2 2VE8A 2X6WA 1OCTC 3LWFA 1LJ9A 3CC4I 4BJTA 2M0MA 4DYQA 1WJ5A 1IRZA 3JREA 5KCMA 2ZKZA 4KT5C 5K7FA 3I71A 1VQ9I 2Q1ZB 1K79A 3EYIA 1NK2P 2EV0A 2FD5A 3BJOA 4FQGA 3X2QH 2CV0A 1FOWA 3J80Z 1FMWA 2CUZA 1ODDA 1TTYA 1IZ1A 3QAHA 4HDUA 3HJEA 2FE3A 3WGHA 3PIPF 2VL8A 4W97A 3HOSA 3ABKH 1QBJA 2FBHA 2KIUA 2H8RA 2EINH 2ELHA 4M3EA 3HOUJ 1O57A 3LQRA 3H3VK 5EYRA 4ENNA 3BLYA 1USSA 2HOSA 3K2ZA 2V9KA 4RGUA 3E7LA 4XNFA 2PI0A 2ECBA 2P5KA 2LMDA 4PGHA 4LIUA 3JRAA 4BE0A 3OYIA 3N4MA 2ZXJA 1UCRA 2K9QA 2OAZA 4F52A 5IT9Z 4G7OF 1T56A 5LEKA 2XAFA 3S8PA 1P9QC 3TQNA 5KVRA 1P2FA 3AFHA 4HSTA 3D5RC 1W7PA 2G0EA 5EEAA 5FROA 4L0ZB 4DBRA 3BR1A 3M7GA 3MN2A 4CCOA 3K70D 2LNBA 2CYYA 4M6YA 1HKSA 3P9IA 1G59A 2XAUA 5D8KB 3ZMTA 1ON1A 2NAZA 2GOXB 2KJBA 3GO5A 5JR3A 1R1UA 1LE8B 5ILUA 4DYCA 3BDDA 4ZDLA 2AQEA 3DKWA 2E1MC 2O0YA 4KN7X 3BTCA 2H09A 4B3XA 1XSDA 2XGXA 3L09A 2ZJRF 3DKXA 4RLFA 3OS0A 1VQKI 1DPRA 2JT1A 3FX3A 2ZC2A 1YJNI 3G1MA 2FMLA 2LKXA 5HDGA 3IUOA 2P4WA 2COMA 1MJ9A 3QRFF 1GXQA 1T98A 4BKXA 4GYIA 4YELA 5GP9A 2HQAA 4XR6A 1RETA 2R3SA 3W6JB 2CGPA 1B6AA 2DA6A 5M5XJ 2Q8KA 1LVKA 3WGGA 4F3QA 1REPC 3WE3A 2VASA 2DDBA 4TV7A 2H94A 1D1BA 3J7AY 1G3TA 5C4XJ 4N4OB 3H3UA 5CQEA 2E2HJ 1S8NA 3JTGA 2EFWA 2FOKA 2IGOA 1B72B 1GUUA 2KRHA 3ABLH 1DPUA 1UG0A 4JYKA 2HEOA 2NS7A 5FLXK 3OR1C 1MNMC 4C9YA 1SFKA 3OYJA 5CVUA 4BNCA 1R1TA 3H9JA 3ZGKA 3OSGA 3S3OA 1FJLA 1B9NA 4Q5SF 3GLLA 1Z77A 1MBEA 3RYPA 2A05A 4OOIA 3NARA 3KPHA 1B59A 2HVQA 2FF4A 3SXYA 4BJ6C 5J8CA 2VBXA 1YTYA 4G6QA 2CWEA 2GQQA 2A3SA 2X1CA 5F27A 2H8WA 1ZAOA 1ZREA 1QZEA 1VQ8I 4XORA 1UHSA 2M9HA 3C2BA 3VDXA 5JLWA 4JOMA 2DTZA 3PSFA 5EG0A 2B0LA 3ZQQA 1RZ4A 3WTXC 3Q5FA 2EIJH 1I3AA 4U7BA 2HYFA 1XX5A 2Z5UA 5D4RA 3T8RA 4LIVA 1BOBA 2FRHA 1ONVA 4IJAA 2GOMA 4E7JA 1MSFC 3U1KA 1ZR2A 1IRGA 1RNLA 1MBGA 2HQ5A 3ZQ7A 4C30A 2ZNZA 2VT3A 1MW7A 1X1DA 3JR9A 2R5YA 2Z33A 2VPRA 2LD5A 1TWGJ 3S1QJ 1CGPA 3RPUD 1J9IA 2HTSA 2PG4A 3G1LA 2F4OB 5B1BH 2HR3A 2NOGA 2AO9A 2M5WA 2PJRA 2V26A 3SFIA 2QYOA 3H5NA 3ZXSA 4AUXA 5FRNA 2E1OA 2K85A 1N77A 4II2A 3F23A 1BN5A 3DFGA 4RM3A 2CFOA 3KP7A 3LMMA 5F1JA 1P92A 2P5LC 2WTEA 3OL3A 4A0ZA 2EFPA 2LH9A 3KYLA 4XIDA 4AWXB 3HB9A 2YSRA 3EPZA 3HPGA 1BOAA 3D5LA 2WAEA 4E7KA 3GVAA 5CVJA 4DW6A 1W7PB 2MH9A 1X1PA 1JKPC 3KP3A 4G6TB 2C6YA 3I64A 2DT5A 2V1NA 1BJAA 3G1OA 1GVJA 3BP8A 3GFJA 1RKTA 2HI3A 3WTTC 2ME6A 4QPOA 4L9VA 4FT8A 3K4MA 4V19K 4A3IJ 1T2KA 3VSLA 3RJPA 2WAQN 4ENMA 4HNTA 1I6XA 2NVYJ 4BACA 4B47A 1OYYA 1ETWA 2HXIA 3OYEA 3H1CA 3H5RA 2CO5A 2EZHA 3OWTA 5E20A 5KHDA 4IKFA 1TWFJ 4KISA 1J5YA 2STTA 3RTRA 1MH3A 4A5MA 3LSHA 1JUMA 3HC7A 3K4BA 3EDPA 1UAAA 3ZMZA 4U0WA 2UZKA 3AL0B 3IP4B 2KPMA 3ZQFA 1IXCA 3SJMA 2QSFX 5FKKA 2JPCA 3CO6C 1DGRM 2V7FA 2QM3A 4V2FA 3E3VA 2W84A 3KEOA 1YYVA 3QYEA 4CSWA 5CVRA 1GLNA 1W5TA 4G8XA 3WHBA 4BYYA 5B1AH 2KZGA 4BJ5C 4BDZA 2D45A 1FYMA 2NVXJ 5FB2A 4IXAA 4G94A 3DLAA 3R61A 2F5VA 2I10A 4P96A 4D1QA 5DUKA 3DPTA 1Z6TA 2DK5A 4ZDPA 1H9TA 4E7LA 2XC7A 2HPIA 4AIHA 3CZ6A 3A4CA 2VJIA 3ZQLA 4CICA 5AIQA 2M45A 3SHFA 2XAQA 3FK7A 4LLGF 3HHGA 3HKZA 4A3FJ 2IGKA 3E1SA 5J1YA 1ERDA 1W5SA 2BXZA 4D5FA 1X1BA 3IV5A 1E3PA 4OU0A 2B9SA 4EV0A 2L9NA 4E6KG 4JQFA 1IC8A 1WCMJ 1LDDA 4E7IA 5EG0B 3DU5A 2F4MB 3I54A 4D7NA 1HCRA 2VLAA 2OF7A 1O3SA 2DT7B 2DI3A 2M4KA 3KP5A 4M3DA 2ELKA 3I0TA 4M6VA 3OYMA 1ACIA 2OC6A 4GRIA 1YS6A 4ZZDA 1WGXA 2DMPA 3R4KA 4AU7A 1VF9A 5HS7A 1F5TA 2XAJA 1GT0C 3M8FA 2Y0SA 4RLQA 3HL2A 3F9KA 1MMAA 2YX4A 2R5YB 3ABTA 3CC7I 4IX7A 1TT5B 3CCMI 1R49A 3IKVA 2VKHA 1FBQA 3O2PE 1F36A 1D0ZA 3KE2A 4XKVA 3L00A 1VQ6I 2LG4A 3FK6A 2PJRB 3W6VA 1S7EA 1Z21A 3F6VA 2IXSA 5DD4A 4XKWA 3V8JA 1N25A 4G7ZF 4HF1A 4MTDA 4LJZF 2FX0A 4U87A 3WU2C 3T8TA 1T6SA 4WK8F 3CCUI 4UVCA 2ESHA 1IUFA 2ESNA 2OZ6A 4BUPA 2OTLI 1U8RA 2MD5A 5EGOA 3DTKA 3WODF 4IVNA 4AIJA 3QU3A 4HAMA 2P6SA 1P4WA 1RRJA 3N05A 1IW7F 5FLVA 2DYRH 3WTVC 5F0FA 5L3GA 2M0CA 2V79A 3KX2A 3PUBA 3GF2A 4B43A 4P9UA 4RAFA 1IRFA 1OFCX 2HPMA 3IHUA 5JHUA 2ZBKA 3CUQC 1IXSB 4I98B 1IG7A 2HZTA 2CG4A 1U9NA 3S93A 5FFXA 4CCLA 4BQAA 3H36A 1TQIA 4EM1A 2WV0A 1XC5A 2DOAA 4RGRA 4ABZA 4YFXF 3ABUA 5DD8A 3LSTA 3Q0UA 3I56I 5JVTA 3GZ5A 1IF1A 5D6FA 4A3KJ 3S2DJ 3LSJA 2OUMA 1JTYA 5EJCA 3GLXA 2O5RA 5ICEA 3ZQCA 2QUFA 4P1WA 1YIOA 5LGUA 3ASNH 5B3SH 3G73A 2JPBA 3HSEA 2M4GA 4PSXA 3ISPA 4UV8A 5JI6A 2V6CA 5LFAA 2LLKA 3VYSB 2BEOA 4HV6A 1R58A 1S5LC 4PGGA 4OINF 2KKOA 4IO9F 1A6QA 2LOOA 4RAGA 3WTSC 4L9JA 4Q4ZF 2QSHX 2QVOA 2OQGA 2R5ZA 5HNFA 1X3UA 2DU9A 3IKTA 4X0GA 3FBNB 3L2CA 2V1XA 1IN8A 1JKOC 2NNNA 4A2UA 1R23A 1XTAA 4BHPA 4DBQA 5TISC 3MAJA 1XMXA 2EPFA 5L3EA 2Y9ZA 4HV5A 4OMYA 1Z1DA 1ZR4A 3A03A 1FYKA 2DPUA 1OQYA 1DU0A 1BIBA 1B8IB 4M72A 2WB1A 3F21A 1HKQA 3C7JA 5K1YA 3JRIA 1YRNA 3MKWB 5J1RA 5ICGA 5ED4A 1KU9A 3KYCB 5LGTA 1T0FA 3CP2A 1FY7A 3QU6A 4LK0F 1JJ6C 3RYRA 2DO7A 1UG2A 3RI4A 1ENHA 1NH3A 2EZIA 2A69F 4QSHA 2IP2A 1FTTA 1OR7C 1W0TA 3M4OJ 4DZPA 3FMRA 4Y7NJ 1VTNC 4HG2A 1DQUA 1XPXA 4IRHA 1LFBA 3GTOJ 2EZLA 2FBKA 4OIRF 3L2VA 2X6YA 2XROA 2VXDA 2CQQA 4BAYA 2QENA 4OAZA 2ECCA 1EH8A 2VI6A 1TBXA 1ON2A 2DAOA 1K61A 3COAC 4E4HA 3J81K 1UFMA 1LVAA 4DNCA 3OL4A 1POGA 4GCVA 4ON0A 3LA2A 4A0YA 1YIJI 1WI3A 4WWCA 1JHFA 1FX7A 1A36A 2CS3A 2M87A 1UHMA 4L0YB 5LD2C 2JUGA 5TRDA 4XRSG 5HDNA 4UUTA 1RC9A 5D8LB 4GO1A 2VC1A 2QQ9A 3JSPA 5EGOB 3FIWA 1RR8C 1NHAA 1K83J 4OIPF 4I02A 1V3FA 3DCFA 5LHIA 1LQ1A 4RB0A 3W6KB 2BVLA 2HVRA 3BQYA 4MHGA 1O3TA 1R4MB 4ZJZA 3ROUA 3BR2A 3I55I 1K6YA 2FUG2 4WXHA 4M3GA 1BJZA 2QKMB 3CESA 4EJOA 2KRCA 2CFXA 2DTRA 1Q1VA 2EIMH 2OCCH 4PFOA 2DOEA 3IC7A 3V4GA 3B73A 3E97A 1S9HA 3KLOA 1G3WA 5DS9A 2MW8A 1YI2I 1QA6A 4A93J 3JTHA 3LSGA 4XSXF 5F08A 3RQ4A 4CCMA 2IJLA 2EQRA 1CQTA 2D2WA 3TL4X 2W85A 3QOPA 2E5NA 1QHGA 5IYDJ 4BQNA 3K2AA 3S1MJ 4IHYA 1X4PA 4S05A 1D5VA 2NVUB 1P4XA 2R7VA 5D5XB 1PJRA 1HXDA 2GAUA 1A04A 2KJCA 3HXLA 2X0LA 1MMGA 3LQQA 3WE2A 3A2KA 1RIOH 4BE1A 2H1KA 1HLVA 3UR3C 1XGNA 2XASA 2JN6A 1EKEA 1EH7A 4CUGA 3PSIA 3HM5A 4DZJA 3MEXA 2M7AA 1B9MA 3MKZA 4LGWA 2LYCA 2R5ZB 2OTJI 2IA0A 2VN2A 3GTJJ 1FP2A 1XMKA 1E0EA 4BH9A 2Y30A 2STWA 4C2UA 2ELJA 4CH7A 3J80K 2TCTA 1MBHA 3ML6A 3HZJA 1D3YA 4E7SA 3S32A 4ZYGA 1YE9A 3GFMA 2BXYA 3K4JA 2EA4A 2L2OA 2A5YB 2Z16A 3V7CA 4FCYA 1YRNB 4A3BJ 1N75A 1H9GA 1QQIA 4M9XA 4UUSA 3PO3J 4IF4A 1J0RA 3S14J 2ZXHA 3H3ZA 3HBLA 4G6DA 2VOPA 2K4BA 3MMYB 4X6AJ 5GTIC 3EUHA 3TMOA 2I5UA 2RQPA 1Y6IA 1PP8F 1U3EM 4A6DA 2LREA 5IT9K 4NQWA 2PQ8A 3V8LA 4EM2A 2DA4A 2XF5A 2MFZA 3HPHA 1ZLKA 5BNGA 2RKHA 3CCSI 2JVHA 1W1WE 1BW6A 3I9V2 1P6RA 1PVEA 3FXKA 2A61A 1JT0A 1KONA 4E7HA 3DXJF 3ECOA 5IYBJ 3GFLA 2OU2A 2FOWA 2XDVA 3K7AJ 5HS9A 4ZYEA 5E3LA 4F93B 2AQFA 1TQMA 1K4TA 2NOJB 3CCLI 1XGSA 4IHTA 2L9SA 2DK8A 1SAUA 2MG4A 1DDNA 2LFBA 4IQJA 2WBMA 3F8BA 1G4DA 2O9LA 1NG6A 2XF6A 4BGDA 5IOYA 1K7AA 1OYWA 5F1RA 2M8EA 4KA4A 1QNTA 2VKDA 4XKCA 1PYVA 4IOCF 2EV6A 1OMIA 1Z91A 2L7MP 3FF5A 3U1DA 1ETQA 3JRBA 3BR6A 1MJBA 4S04A 3ZN0A 5A2QZ 2H6BA 2ZJ2A 1H89C 3KEQA 2O61A 2HKOA 2M8GX 5CYVA 1SVLA 3DTEA 1F43A 1IXRC 4H0EA 4EATA 2L4MA 2IS6A 2Y2ZA 4RGSA 3PQJA 2XKPA 1OCZH 3DU6A 1KQ8A 2QGUA 2HU9A 2B7EA 5AIPA 2L0KA 3QPSA 3PFIA 4PJLA 4EGYA 1MBKA 1VQPI 1WJDA 1IDZA 3HRUA 3JAMZ 4FX0A 3M3YJ 1QVUA 5EF6A 1XG1A 2ZXIA 3A1YA 2E1MB 3GW2A 4UV9A 3TW6A 4G7HF 5E8GA 2FSWA 3DF8A 3BCAA 4G12A 2TRTA 3T1BA 5B66C 2HVSA 5F0CA 4IOAF 3NWTA 1FTZA 3RSNA 2F5FA 1T39A 3MZYA 4PDKA 4RMNA 2MBFA 2R7WA 3DLLF 1FC3A 3E5QA 3Q0VA 1FSEA 3OIPA 2WC2A 2A6TA 2ISZA 1BW5A 3LSPA 3RZDJ 1O3QA 1BL0A 1FOXA 4J01A 3U9GA 1HBXG 4BBSJ 2P6TA 4CXFA 2PMZA 4YFKF 3HKZN 2XIGA 2E60A 3IWFA 3SDBA 1ZK8A 2IGMA 4RGXA 3ZMDA 3M1EA 5K5RA 1R71A 2JA2A 1DU6A 3O3KA 2M3AA 4KMFA 4E70A 2YR2A 5KNLA 3MQ0A 3WGIA 3CO7C 4A12A 1RR7A 2E71A 1JTXA 2UV1A 3D0SA 2ZMEA 2CH0A 2VBZA 2VXZA 3ONQA 5M5WJ 1X2NA 1L3LA 3HSRA 2NS8A 2DMTA 4XL9A 1L0OC 3LNQA 1S7OA 4OIOF 2Y0SN 4BHBA 3HTUA 5FKMA 1X58A 4AYBA 2BE5F 2W7NA 3K4NA 1Y8RB 4PJNA 4WXDA 4NQWB 2WAFA 1U6GA 3W2VA 2YUSA 2UUZA 4ENKA 4OWRB 1SMYF 4HSRA 4MQVA 1Z05A 2KP6A 1HW2A 1U9OA 2CQNA 3BZ6A 3CMEI 2XGEA 4LK1F 2JSPA 1TNTA 1WI9A 2Y48A 1ITYA 2XB0X 1STZA 4XMYA 4RAYA 4NB5A 2DW4A 3BCBA 5H2FC 2CW8A 4BE2A 4I99C 4YFNF 2IA1A 3SZGA 2E2IJ 1EJ9A 1Z7UA 3C18A 2VB6A 1XMAA 5LRRA 4R1HA 3FMQA 4BDYA 1TL8A 3PO2J 3ZRGA 2VPLA 1BIAA 3GX4X 4XLNF 5FKOA 5GAGJ 3H9GA 4S0HB 2WA0A 2JK3A 2VBWA 4JBAA 3JRFA 3VPRA 2XUBA 2P5VA 5K7HA 2XF7A 5DV5A 1R5ID 2IEKA 1NTCA 4XRFA 3OS2A 2LVSA 1ZRCA 1R1VA 1WJBA 4KT6A 2FJ1A 4LB6B 5L3CA 3CDIA 3JRGA 2R0QC 2GLOA 3E6MA 4GDFA 2JRMA 1V55H 5HLHA 3QWLA 4M71A 2O6GE 4LMYA 1BC8C 3HIFA 3AKZA 2ZCWA 3MFKA 4ZYAA 2H27A 2ZSIB 4RS8A 3VB2A 5LEJA 5IYCJ 2K02A 2MYSA 4HPQA 2EILH 3I58A 2XHKA 3LA7A 1Y56A 4EJVA 3ZMVA 5D5WB 3LOCA 2WWYA 3A01A 3L9FA 3PNVA 4N9HA 4NC7A 2ETHA 1KGSA 1FMVA 3VOEA 2CQ7A 4JX5A 4QIWN 3HOWJ 3PUFA 3OOPA 1YJ9I 1IJWC 3AAFA 4U7DA 3BJ6A 4ZDOA 2BHYA 4C3JJ 2CU7A 3CP8A 2QLZA 1TT0A 5BMZA 1F4KA 1MNDA 2DDAA 4FISA 1HKTA 4ETSA 4ZYDA 4X1EA 1AOYA 1CF7A 1FBUA 1H8AC 5M3FJ 5CKTA 3ZP5A 2VC0A 4ENJA 3L1PA 4EMSA 2EFNA 1D1CA 1T08B 1X4OA 1U2WA 3U2RA 2AXLA 2HKXA 4E7ZA 1U5TA 2V9PA 1F1ZA 1EA3A 3LSRA 2QA4I 4ZTFA 2QQ8A 2YU9J 3E5XA 4KIGA 1XSXA 1IV8A 1OLTA 3H0GJ 2ZMEB 5ILSA 3A0BC 2M30A 4MFDA 5HOOA 1QPMA 2L3DA 3R6SA 4CCJA 5CQGA 2JVGA 2Y9YA 5GTHC 2E7XA 4JP0A 1IN7A 1HQCA 2IA2A 4M3BA 2RNJA 1W5CC 1VQ7I 2VOOA 5EEGA 2IPQX 3E0JB 2P7CB 2CJJA 4Y52J 2IVMA 3CCRI 1KU7A 3LL7A 4AVPA 4ZTJA 2HOEA 3DEUA 2ZJPF 2EIKH 4KYWA 2LR8A 1TWHJ 4MGRA 4AC0A 2KMUA 4U0VA 2MA3A 1PUFA 2VJJA 2UXNA 1HSTA 1BC7C 1SANA 4O5VA 2E34A 1VQLI 3I4MJ 4W1UA 2FXAA 1HW5A 4L5EA 1AHDP 1LDJA 1GV5A 1U0JA 1VQOI 3BG9A 4KFCA 2X85A 3GTGJ 4MIMA 4BEHA 3EQLF 2PMUA 3ASOH 2X9DA 2CUJA 2CUEA 3FXOA 2ME0A 3LSMA 1XGMA 2DA1A 2G9WA 3C2HA 2W48A 1H88C 1I27A 2DQRA 2NYXA 3DEWA 3P9CA 2CV2A 1PDNC 5GADJ 1I3QJ 5JVGF 4V2GA 1EV7A 3LFKA 2A6EF 2W1OA 1XB4A 3CJTB 3OIQA 3ECHA 3SEZA 1A35A 2QKLB 2QQAA 3H9QA 3O6BB 3MKYB 1QU3A 2EV5A 3C2GA 1MSEC 2EZKA 2OJED 4H4KC 1TWCJ 2I8DA 2DA5A 4C3IJ 3GTPJ 1C0WA 1ZH5A 1MNEA 4GYGA 1K4SA 4A3GJ 4AIKA 4M74A 2DFIA 2A6HF 4R79A 2CV1A 2BY3A 3GBGA 2MABA 5LGNA 4HZFA 1W7PD 1ZKGA 2F5CA 2P7VB 3G4SI 3N97A 2BHZA 2DODA 2E19A 4UUVA 2ACJA 3K1PA 1HF0A 2DFEA 4ZC3A 1YITI 1BR2A 2Q2EA 2QWWA 3ERED 3RDIA 2L54A 4JX6A 2JWTA 3EETA 1R5GA 3A01B 2EK5A 3LAPA 2XRNA 4B3AA 1ULYA 3OYAA 1ETKA 1WJFA 2OA4A 3HHHA 3VYTB 3CMYA 3BR0A 3J7ZI 1W0UA 4M9ZA 4HX7A 2NS0A 1TW2A 3QODA 1FNNA 2XAHA 1ZELA 5L3DA 3WHCA 3ZQGA 4BXXJ 2X1EA 2L7ZA 2M1BA 3GZ6A 1DP3A 1YX3A 3R60A 4XN3A 3WG9A 5L3BA 1R5HA 3SYTA 3VFZA 3P9KA 1TQPA 4M9SA 2XAGA 1FWZA 1XD7A 4EJWA 3WTYC 4KIFA 3ZR8X 1YHQI 2KL4A 4F91B 1B1BA 1FEXA 1CF7B 1LNWA 3AG2H 4PZJA 2LSOA 5E3OA 4RB3C 5D5UB 4HOBA 4U0YA 2H6CA 2GZWA 1ZYRF 4OIQF 1A31A 1UHWA 2WAQA 1I6HJ 2KISA 2R7RA 4HF2A 2PBIA 1ZGAA 2DYSH 1O3RA 1UMQA 3IRQA 1U5TB 1BR1A 2MLGA 2G7HA 3BG3A 3AG4H 2JUCA 5J4YA 1X3ZB 5DM7F 4O6JA 3CQZJ 3NRVA 5HLIA 4C3HJ 4EQQA 4XQFA 3VWBA 1T8IA 4XLCA 1JUPA 4A0XA 1JI8A 2JA8J 3QYBA 2DMQA 1JGGA 4XLAA 1WWXA 4B8XA 3QP6A 4XK4A 2OPTA 3JRDA 3HRMA 3RIRA 3RKWA 3LAJA 3TBIA 4I7HA 1Y0NA 2KDZA 2XKOA 3K4CA 3PFYA 2D5VA 3GUDA 3BR3A 4UB6C 2K4JA 4A3MJ 4FASD 4LG0A 5IP9J 2VE9A 1MJAA 3KP4A 4G9YA 3SQNA 5DTDA 2LY2A 2RQQA 2L9VA 1PUFB 1LB2A 5IP6A 2IT0A 3TP3A 3RQIA 2IS2A 2ZJQF 2XSJC 3TO9A 3HGYA 4FX4A 4UHTA 1K6OA 2GXBA 4MEXF 1Z0XA 4D7MA 5C3EJ 4CZZA 2HZDA 4ESFA 1UJ8A 4Q48A 1MIJA 1WH7A 3HRTA 3L2UA 5J4VA 3BG7A 2R7DA 4BEHB 1E3OC 3OR2C 2PJPA 2CRGA 3RPUA 3AG1H 4NNJA 4PUSA 2BOLA 5E1WA 3NAUA 2AXTC 2CW0F 2L9RA 3CUOA 5FFZA 1A5JA 1SFEA 4Y15A 1LFUP 3TP0A 4HBLA 5IY5H 2GXAA 3UNGC 5BQTA 1V5EA 1Y1VJ 2HXOA 3OMYA 5J3LA 3BTLA 4BY7J 1J7KA 2KQRA 4WX9A 2R7TA 2ID3A 2F2EA 5L3FA 1E3HA 2O03A 1SD7A 3AG3H 1Z9CA 4I2OA 1QVTA 5J40A 3L2WA 2J5OA 2VUMJ 1UZCA 2K7LA 2DOFA 1OISA 1SFUA 2R7XA 4XBFA 3FHZA 4IHXA 3KP2A 3E5UA 1QHHD 2KLOA 2JQ7A 2PLYA 2JRTA 2KT0A 1VQ5I 3F22A 3DKYA 3RZOJ 2JA7J 2DN0A 1SC7A 2DA3A 5F0HA 5HDKA 5E3NA 3DWLE 2BV6A 1ZLJA 2MC4A 3PL8A 3CCJI 4GGGA 1QPIA 5F04A 5F64A 2DFFA 5TGTA 2XSDC 1IAWA 2JA5J 1BI2A 5FO5A 5GAHJ 1J09A 3FHNA 2PN6A 1SEUA 1AU7A 2V6EA 2Q2EB 5E17F 2D1VA 4DGWB 2E5ZA 3G2BA 5GPAA 3TO6A 5BPIA 1USTA 4LLNA 3GTLJ 2AS5F 5AONA 3T0YA 3QP5A 3CCQI 4EJUA 3GWZA 4CO8A 1XCVA 2WADA 1JT6A 2LBFA 4AIDA 1MZBA 1T95A 4I0BA 5KAFC 3B6AA 2HFHA 3NQOA 2X48A 2RVCA 3BQZA 3FXRA 4OMZA 1GV2A 4RM2A 4NDLA 1YW8A 2WV1A 3CLOA 3HSFA 3OSFA 3F8NA 3H92A 1M1EB 4B44A 3T5XA 2PMZN 1XN7A 3V8KA 5LRSA 3WU1B 4BY1J 3F0CA 3CTAA 1S29A 2GBYA 3EUKL 3Q9SA 1IGNA 3QOEA 1I1GA 1KYZA 1FIAA 2RNGA 2MSYA 2FBIA 2O7OA 2CW7A 2LF8A 4PFPA 4BXUA 4QTRA 2QSGX 1ZGJA 1OCCH 1BI0A 1RKWA 3F72A 2BBYA 1WPKA 1A6IA 4KUMA 3GZNB 4M73A 3FMSA 2BZTA 1AA7A 3FXJA 1Z3XA 3GTMJ 3VODA 2DMNA 2MC3A 3BY6A 3FXQA 3TDUC 2LF7A 3TGNA 5K5QA 5J47A 4BHCA 1MBJA 1TZLA 2W25A 3S2WA 2W82A 1D8JA 1OJLA 1W36C 1RI7A 3F8MA 1FZPB 2VKEA 2RREA 4UY8I 2RV8A 3HOXJ 2Y0MA 2FNPA 5ICCA 2K3PA 1V54H 2LRDA 4Q47A 5E18F 1S3JA 4P9FA 4PJMA 5FKLA 2XPWA 2HOTA 4IHSA 4LG0B 4MLOA 3BROA 2XPUA 3JCUC 4HRIA 3DPUA 3KZYA 2BY0A 1HOMA 4A3DJ 3BPXA 3FKIJ 3CCYA 3JW4A 4N4NB 4FETA 3REOA 5DYMA 5E1ZB 5LBQA 4ESBA 5CPRB 1TLHB 2K3FA 2HDWA 3SZTA 2XRLA 1G3SA 2CUFA 2ZFUA 2IBDA 2RN7A 1ETOA 5KAIC 4FTHA 4BS9A 1FPQA 4A6EA 3OYKA 2X4HA 2EFOA 4IZZA 3S16J 2IRFG 1APLC 4B09A 3TKYA 2VODA 3MD2A 1MGTA 4XRMA 2DA7A 2LP0A 2ZB9A 2HGCA 3P7NA 3S1NJ 2RDPA 2BW3A 3FKJA 2X6OA 1G8XA 3HGGA 3I4PA 3MZHA 2ICWG 4L18B 1IN4A 4B4CA 4CZCA 3G3ZA 3QPHA 2E1CA 3VYUB 3F8FA 5HLGA 3JAMK 4QLCU 3A02A 3K4LA 2MGQA 3CDLA 1I39A 2M7BA 3V7SA 3ZMSA 3IH3A 5FGMA 3BG6A 2BGCA 2FMYA 4MO7A 1LEBA 4WXCA 5H6QA 3ZQHA 4FE7A 5KK1A 4XLPF 2QQBA 5K7ZA 3SFZA 1PP7U 3QPTA 3CDHA 1BM9A 1SMTA 4I0AA 2F5EA 4I09A 1E17A 3IL2A 2A68F 1WKMA 1MH4A 5HLTA 2L02A 4WCGA 4RBOA 4NBQA 3OYCA 3HTSB 2Y69H 1AKHA 1TW3A 5M5YJ 4L5JA 2Z3YA 4MQ9F 3OYNA 3B6CA 3ULQB 3HEFA 1YOVB 1T33A 2JSCA 4BL0B 2IS1A 2KIMA 4EEFG 1IDYA 2GA2A 3OYDA 2DQLA 2IGNA 2YPRA 5GAEJ 4CHUA 2B63J 4MTEA 4DJAA 3OS1A 2LBFB 1OPCA 3FM5A 2GM4A 4DQ2A 1P7IA 2KIQA 3WTZA 1ETVA 5E79C 2P0WA 4XLHA 2VQCA 4YIRX 1FIPA 4HNUA 4KICA 3I5UA 2R4GA 2EH3A 1I5ZA 3TOBA 4UVBA 2A5WA 4LITA 3PJRA 2XGDA 5J6XA 3FWEA 3CCEI 1LDKB 5FLMJ 2VT2A 4I76A 2JTVA 1D5YA 3M07A 1Y8QB 1DP7P 3MCZA 3KZIC 1YS7A 4BXFA 2HDCA 4A3JJ 3MZ8A 4WF2A 2ZO4A 2JZYA 5FRMA 5EEHA 1MMSA 2W24A 2FA5A 4P55A 1XCBA 2OCEA 3GXOA 2M34A 1JGSA 3KIOA 5DCFA 2R7UA 2V1UA 3CC2I 3ZQIA 2A07F 4D0PA 1FLIA 2R7ZJ 2KFDA 1D0YA 1ZRDA 5ERIA 4UUSB 1WJCA 1LEAA 1Z6RA 2HDDA 4XICA 3I3LA 2K40A 3DQVC 2NNYA 1JJ8C 3LSKA 3A0HC 1X1AA 1RUNA 6PAXA 4MNUA 3M9AA 1WSUA 1FOKA 4CYCA 1W36D 3BZKA 4XLEA 4ANJA 3M8EA 2LY9A 3LA3A 1YO5C 1LUJB 3CJNA 3CLQA 3EUHC 1NK3P 4XKBA 1X19A 3CMMA 3RKXA 1R4NB 4PJJA 1FBSA 5D6EA 3R0JA 1WVRA 3OYGA 5D4SA 1Q1HA 3HOVJ 2VKVA 5CVVA 4L5IA 2JMWA 3H5AA 4Y33A 3FM3A 1MDMA 3D1NI 4HNVA 3BC8A 4CYDA 4NUBA 3DPLC 3DTIA 3I59A 5JLXA 2O3FA 5CVIA 1E2XA 5FLXZ 4Y4RA 1BBYA 3PNYA 4JX4A 4HX8A 2GIVA 1MKMA 2EWNA 2BW3B 2XB5A 1V4RA 4JK1X 2HOAA 2K9LA 2LY1A 3S17J 3R0AA 1KA8A 1R7JA 2QF7A 3EYYA 2W57A 5FJ8J 1QZYA 3E6CC 2CSOA 3FISA 3MVPA 5E3MA 3F8CA 3BOQA 1FSHA 4RA2A 4A5NA 2OQRA 3FBIB 4YG2F 4A3CJ 1JXSA 5FKNA 4XONA 3MKLA 4HQMA 4PJ0C 1VQ4I 3OY9A 1ZRFA 1XDSA 4B48A 5IPAA 3WTWC 2HQNA 3KETA 1ZARA 1UELB 4PK4A 3ZOBA 1WHUA 4J19A 1KU3A 2LKSA 2P8TA 3LSIA 1H0MA 2YX7A 1SD6A 1SVOA 3M8JA 3CCVI 1Y1WJ 1SFOJ 1JE8A 3K1NA 1AKHB 3OV8A 1YJWI 4IL6C 3E6BA 1KU2A 2HWVA 4BQQA 2L4AA 1VI0A 3U21A 1KQ9A 4I6ZA 3S2HJ 3HG9A 3CUQA 5LLQA 4GFBA 1OKRA 1WH5A 2QCOA 1GXPA 1ZQ3P 2GWRA 4IRGA 3TDZC 4OAYA 2ISYA 1ZG3A 1SFXA 4D5CA 4UNOA 5M3MJ 2WY8Q 2DLLA 3WG7H 1FP1D 3SDGA 4LD5A 1XS9A 2LTPA 3Q9VA 3AL0C 1HDPA 2XGCA 4LG3A 2HS5A 3OYBA 2HYJA 2VBYA 3S3NA 3KP6A 4RB2C 2F4IA 1WQ2A 1QZZA 2YS9A 2ID6A 1LFPA 2PX9A 3KFWX 2WB1N 4EJTA 2E35A 1ZHFA 4KN4X 2K5CA 3W2WA 1Y39A 1ORKA 2CQXA 3JRCA 3BPVA 4BU2A 3J7AO 3SEQA 3BG5A 3QQAA 1K78A 1V5GA 1ZN2A 1IV6A 5CJ9A 2VJ4A 5GPCA 1MMDA 2MLKA 1YLFA 3BWGA 4K2EA 2MD0A 2W4SA 2PMHA 2ZMEC 5TJJA 4HQEA 3ERMA 5DCMA 4Z6YA 4ESJA 2PEXA 1YQAA 1AWCA 2DMUA 5E1XA 2FQ3A 2EA2A 5ILVA 5EZHA 4F7ZA 4CYCB 3W2AA 4YRVA 1WJAA 2H1LA 4IRIA 5IP7J 3L2QA 3BTJA 2OD5A 4KDPA 1B8IA 1D8KA 3H35A 5DUIA 1X2MA 3OYHA 1ZGWA 1T38A 4M3FA 1Y0UA 1D1AA 2EJRA 3DBHB 2E1NA 3GEZA 3PIOF 5CLSA 1R36A 4CGZA 3RKQA 3S15J 2UWMA 3KLNA 3TW7A 1MDMB 3O8HA 1DGWY 5FD5A 3K9TA 3I59B 1OR7A 1ETYA 3RCOA 1JHHA 2PFBA 2CMPA 1KZHA 2G7UA 4CA0A 2DCEA 4L9TA 5F6FA 2X6XA 2VONA 2DPDA 1S6LA 1MMNA 2MH2A 4I01A 2X51A 2QZ8A 3QYFA 2KDOA 3BTIA 4P5OA 1J2XA 4IPAA 2DBBA 1ETXA 3B02A 1S7AA 4PCQA 3IH4A 4II3A 1KYWA 4C2MJ 4GXOA 4XSZF 2Z99A 1IO2A 2Z1DA 2RAEA 2LDUA 3JRHA 4QPQA 2BY2A 3IWZA 1W4MA 4F55A 2LKPA 3K69A 4HYEA 2L5QA 3K1MA 4PSWA 4AD9A 3UKGA 1J75A 1HDDC 1WJEA 3IAS2 2NVQJ 1OYIA 1JKQC 2KHMA 3S3MA 2OBPA 1HSJA 2FNAA 5EDNA 4IHVA 1VNDA 4KNYA 1TNSA 1MD0A 4U88A 2P81A 5H20A 3W3CA 4CCKA 3L7WA 2HYGD 1FOYA 2WY7Q 2XVCA 2EBIA 4MEYF 3KZZA 2R92J 3FXMA 4HW0A 2L7FP 3CJQB 4ITVA 1VQMI 4RB1A 4DIQA 3IRRA 4C2TA 4IHWA 1J59A 5DEQA 3CUQB 1ZG5A 2KZVA 2EFQA 2DFHA 2HQRA 3KCCA 5K5OA 2DT6A 2JJ7A 2XV4S 2EB7A 1YW7A 4LFUA 1ZG1A 2NVTJ 5J1UA 4EGZA 4ZZLA 3SZPA 1B4AA 2K86A 1UB9A 1LKXA 2E36A 1LPQA 1D0XA 3GFIA 1QO0D 3OIOA 3Q0WA 4KJZA 3G71I 3CMAI 1EF4A 2K9MA 3TO7A 3LFUA 3I4NJ 2BY1A 1DUXC 3ESWB 4N9IA 1BI1A 3ABMH 2GA1A 4NC8A 3K4KA 1JUSA 2KIFA 3BJAA 3OYFA 5BS6A 4ZYHA 4DYRA 1G2HA 4Y17A 2HNHA 1MBFA 2V9VA 1BI3A 2IS4A 1FT9A 2BVMA 1R9TJ 2R93J 2FQ4A 3C3WA 1G3YA 3TEDA 2VJ5A 1U5TC 2O8KA 2XPVA 4RAZA 3H0DA 1K78B 1I50J 3P5JA 1YG2A 3HOTA 4HLYA 2RGVA 3GCMA 5DM6F 1BA5A 3G6EI 2OZUA 5E8IA 4Y3OA 1TWAJ 3GTQJ 5DCMB 2COBA 3K10A 4KITB 2L01A 3KEYA 4NHJA 3BZCA 2W00A 1N78A 2R7QA 2DXIA 2F5DA 4UXNA 4HEA2 5LHHA 4A3EJ 3GMEA 3VEPA 3PQKA 2ADUA 3JSOA 1WZ2A 3DBRB 1SVMA 2Z9OA 3KYDB 4YIFA 1O7LA 3HUGA 4NC6A 4BQOA 4EM0B 1BR4A 1QGPA 1WRJA 2ZNYA 5IT3A 2QBYA 4EVIA 1GDTA 2K9NA 2ZXWH 5LHGA 3HYIA 4L9NA 5H6RA 1SD5A 2V4JC 1G6NA 4A3LJ 1SD4A 4XM3A 2R7SA 1WFXA 3GYHX 4N0BA 3VYRB 1HA8A 5D5VB 1FYLA 1OCPA 3V7RA 2NXNB 3ELKA 4LLLA 2K9SA 1QRYA 2VIXA 2K27A 4YEJA 2E2JJ 2DJNA 4HX4A 4HDVA 1F9NA 1YFHA 4FE4A 3CF2A 1I1SA 3FZVA 3PM1A 5HNHA 1IN6A 2HTJA 4AM3A 3IH2A 4O3MA 2TDXA 3FDYA 5IOZA 1GVDA 4QWQA 2UXXA 4LB5A 3I53A 4ZH4F 2QEXI 1Z3YA 2VQHA 2R7FA 4A69C 1O7FA 4XOTA 2Y31A 2KRFA 4Z2YA 3DV8A 3K70C 5HVQC 4HF0A 2F6CA 3HOZJ 4RDUA 1OCRH 3VSKA 2J5PA 1RPWA 2VQLA 3EUAA 1PUEE 2ZFWA 1TP4A 1TC3C 1RESA 3NWSA 2GXGA 2DJIA 3OYLA 2Z2SB 3CF5F 1VQNI 4HA8A 1HC8A 2FEZA 2FU4A 3PNTA 1U8BA 2BYVE 3OOUA 4ASNA 2GIZA 5B5EC 1O4XA 1XGOA 3ZN1A 4F92B 3J81Z 3CD6I 3BR5A 1V5FA 3FXUA 1S72I 1NG7A 2O8XA 2LK2A 3D5SC 3Q3SA 1U78A 4IEJA 3FXLA 1LE8A 2D1HA 4MFEA 3TOAA 1KQ0A 2L7KA 2X1DA 2Q0OA 4KIBA 4XOPA 3ZPLA 5C4JJ 5BPDA 2NRAC 3HDDA
chains in the Genus database with same CATH topology
1JTYA 1FIPA 1IJWC 4B1RA 3ZQCA 4C3JJ 2AHQA 2CU7A 2EH3A 5C44J 4FISA 2XGDA 2LLKA 3GTKJ 4X1EA 1H8AC 4LOCA 5FLMJ 1VFCA 4I76A 1D5YA 5M3FJ 3QPLA 5EZGA 4A3JJ 3L1PA 2R5ZA 2N8GA 2M34A 4AYBN 1B72A 3LSRA 3ZQIA 4BBRJ 1JKOC 2YU9J 2R7ZJ 2IAIA 3BT9A 4UUSB 2HDDA 4XICA 3H0GJ 2K40A 5HODA 2Y9ZA 4XRSA 1JJ8C 1ZTRA 1ZR4A 3A03A 3S1RJ 1DU0A 4MFDA 1B8IB 3JRIA 1YRNA 2Y9YA 5J1RA 2DA2A 4JP0A 4CYCA 4M3BA 1P7JA 2LY9A 1NK3P 3HOYJ 3O8GA 2CJJA 4Y52J 9ANTA 2JA6J 1JJ6C 2M2EA 3HOVJ 1UG2A 2LR8A 1TWHJ 1JKRC 2VKVA 4AC0A 1ENHA 1PUFA 2EZIA 4QSHA 1FTTA 1OCTC 2JMWA 1W0TA 3M4OJ 1SANA 3I4MJ 4DYQA 4DZPA 1IRZA 4Y7NJ 4W1UA 3JREA 3D1NI 4L5EA 1AHDP 1LFBA 4HNVA 1GV5A 5K7FA 3GTOJ 2EZLA 3BG9A 5JLXA 1NK2P 2FD5A 3GTGJ 4MIMA 2CQQA 4JX4A 2ECCA 2X9DA 4W97A 2CUEA 2VI6A 1K61A 2XB5A 2ME0A 2H8RA 2HOAA 2DA1A 2W48A 3S17J 1H88C 3DEWA 1POGA 2QF7A 1I3QJ 4M3EA 4V2GA 3HOUJ 5FJ8J 1WI3A 3FISA 5E3MA 3MVPA 5EYRA 3H3VK 2HOSA 4A3CJ 3E7LA 4XRSG 2ECBA 4UUTA 5FKNA 3MKLA 5EGOB 3FIWA 3JRAA 1MSEC 1K83J 2EZKA 5IPAA 1TWCJ 3DCFA 3ZOBA 2K9QA 2DA5A 4C3IJ 1T56A 4J19A 3BQYA 3GTPJ 4A3GJ 1SFOJ 1Y1WJ 3BR2A 2G0EA 3GBGA 5EEAA 1AKHB 4M3GA 3BR1A 3MN2A 1ZKGA 1BJZA 2E19A 1VI0A 1HF0A 1Q1VA 4I6ZA 3S2HJ 4GFBA 4JX6A 1WH5A 2JWTA 2QCOA 3A01B 1ZQ3P 4B3AA 5DS9A 1LE8B 2MW8A 4DYCA 4A93J 3LSGA 5F08A 1ETKA 3CMYA 2EQRA 3BR0A 1CQTA 3BTCA 1W0UA 4D5CA 5IYDJ 5M3MJ 3K2AA 3S1MJ 4IHYA 4BXXJ 3SDGA 3WHCA 3ZQGA 1XS9A 2LTPA 2L7ZA 3G1MA 2LKXA 1HDPA 4BKXA 2XGCA 2HYJA 5GP9A 1RETA 2DA6A 5M5XJ 1FEXA 2YS9A 2H1KA 2ID6A 1HLVA 2JN6A 2WB1N 5E3OA 4DZJA 3HM5A 1I6HJ 1ORKA 5C4XJ 2R5ZB 2E2HJ 2CQXA 1UMQA 3JRCA 3GTJJ 1B72B 3BG5A 1GUUA 3QQAA 2Y30A 3BG3A 1IV6A 4JYKA 5GPCA 2NS7A 2TCTA 1MBHA 3CQZJ 4C3HJ 1MNMC 1JUPA 2JA8J 2DMQA 3OSGA 1FJLA 1JGGA 4FCYA 1YRNB 2DMUA 4A3BJ 1Z77A 4XK4A 1MBEA 2OPTA 5EZHA 3NARA 4CYCB 4UUSA 3JRDA 3PO3J 5IP7J 3S14J 3BTJA 3HBLA 2KDZA 5F27A 1B8IA 2D5VA 1X2MA 1ZGWA 3BR3A 4M3FA 4A3MJ 5IP9J 4X6AJ 1UHSA 2M9HA 3C2BA 5EG0A 5JLWA 2DTZA 5DTDA 1PUFB 5IP6A 3TP3A 3RQIA 3RKQA 3S15J 2DA4A 3HGYA 3TW7A 5BNGA 3O8HA 1Z0XA 4D7MA 5C3EJ 1BW6A 1MSFC 1ETYA 1ZR2A 1WH7A 1JT0A 1MBGA 2HQ5A 5IYBJ 1E3OC 3K7AJ 3JR9A 5E3LA 2CRGA 2R5YA 2VPRA 2LD5A 1TWGJ 3S1QJ 3NAUA 3BTIA 2L9RA 3G1LA 1ETXA 1A5JA 1LFUP 2NOGA 2AO9A 3IH4A 3TP0A 4C2MJ 3SFIA 4AUXA 1Y1VJ 2MG4A 2E1OA 2HXOA 2LFBA 2RAEA 5J3LA 3BTLA 3JRHA 4BY7J 2O9LA 5IOYA 2ID3A 5F1JA 1QVTA 1HDDC 3UKGA 2VUMJ 2NVQJ 1JKQC 4XIDA 4IHXA 3HB9A 2L7MP 3JRBA 1ETQA 5EDNA 4IHVA 1VNDA 2KT0A 3BR6A 2P81A 3RZOJ 2JA7J 4DW6A 2DN0A 2DA3A 5F0HA 5E3NA 1JKPC 2EBIA 1H89C 2R92J 2M8GX 1QPIA 2L7FP 3G1OA 5F04A 1F43A 2XSDC 2JA5J 4IHWA 1RKTA 1AU7A 2Y2ZA 2HI3A 2JJ7A 5GPAA 2ME6A 3GTLJ 2NVTJ 2L0KA 5J1UA 3QPSA 4A3IJ 1JT6A 1MBKA 2WAQN 1IDZA 3B6AA 3M3YJ 2X48A 3BQZA 3OIOA 1QVUA 3Q0WA 1GV2A 2NVYJ 5EF6A 1XG1A 4NDLA 1EF4A 1ETWA 2HXIA 2WV1A 3OSFA 3TW6A 3I4NJ 4G12A 2EZHA 2TRTA 2PMZN 1TWFJ 5F0CA 4BY1J 1FTZA 3F0CA 2GBYA 1MH3A 1IGNA 1JUSA 1JUMA 1FIAA 2MSYA 4DYRA 2O7OA 1G2HA 3ZQFA 3SJMA 3Q0VA 5FKKA 4QTRA 1MBFA 4V2FA 1RKWA 1BW5A 2R93J 1WPKA 1A6IA 3LSPA 3RZDJ 2FQ4A 1R9TJ 1BL0A 3TEDA 4BBSJ 3WHBA 2O8KA 2XPVA 1I50J 3HKZN 2NVXJ 3GTMJ 2DMNA 1ZK8A 1BA5A 2I10A 1DU6A 1MBJA 1TWAJ 3GTQJ 2COBA 1RR7A 1OJLA 1JTXA 5M5WJ 3ZQLA 2VKEA 1X2NA 3FK7A 2NS8A 3HOXJ 4A3FJ 2DMTA 5J1YA 4A3EJ 3LNQA 4D5FA 3IV5A 2Y0SN 1IC8A 5FKLA 1WCMJ 2HOTA 2XPWA 5FKMA 4MLOA 1X58A 5EG0B 2XPUA 4D7NA 1HCRA 1HOMA 2OF7A 4A3DJ 3FKIJ 4M3DA 3CCYA 2ELKA 2YUSA 4M6VA 1GDTA 2K9NA 1WGXA 2DMPA 1U9OA 2XGEA 4A3LJ 1VF9A 2XRLA 2XB0X 2CUFA 4FTHA 2IBDA 1GT0C 1ETOA 1ITYA 2R5YB 3S16J 1OCPA 1APLC 2E2IJ 1F36A 4XRMA 2DA7A 2LP0A 2ZB9A 3FK6A 3S1NJ 3W6VA 1S7EA 2K9SA 1QRYA 2X6OA 3HGGA 2E2JJ 2DJNA 4B4CA 3PO2J 2FX0A 5FKOA 4FE4A 4S0HB 3A02A 3PM1A 2JK3A 2MGQA 3CDLA 3IH2A 3JRFA 3VPRA 5IOZA 1IUFA 3IH3A 5K7HA 1GVDA 4MO7A 2IEKA 3ZQHA 1NTCA 4FE7A 2LVSA 5EGOA 4A69C 5K7ZA 2FJ1A 2Y31A 3JRGA 2R0QC 2GLOA 5FLVA 3HOZJ 4RDUA 5F0FA 2M0CA 1RPWA 1MH4A 4RBOA 1TC3C 1OFCX 1RESA 1AKHA 5M5YJ 3B6CA 3HEFA 1U8BA 1IG7A 1T33A 3OOUA 5IYCJ 4EEFG 1U9NA 1IDYA 1O4XA 3BR5A 3LOCA 2B63J 1XC5A 3A01A 2LK2A 4ABZA 3Q0UA 3Q3SA 1U78A 4IEJA 1LE8A 2GM4A 4MFEA 1P7IA 4JX5A 4A3KJ 4QIWN 3LSJA 3S2DJ 1ETVA 5C4JJ 3HOWJ 3HDDA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1JTY A;  1FIP A;  1IJW C;  4B1R A;  3ZQC A;  4C3J J;  2AHQ A;  2CU7 A;  2EH3 A;  5C44 J;  4FIS A;  2XGD A;  2LLK A;  3GTK J;  4X1E A;  1H8A C;  4LOC A;  5FLM J;  1VFC A;  4I76 A;  1D5Y A;  5M3F J;  3QPL A;  5EZG A;  4A3J J;  3L1P A;  2R5Z A;  2N8G A;  2M34 A;  4AYB N;  1B72 A;  3LSR A;  3ZQI A;  4BBR J;  1JKO C;  2YU9 J;  2R7Z J;  2IAI A;  3BT9 A;  4UUS B;  2HDD A;  4XIC A;  3H0G J;  2K40 A;  5HOD A;  2Y9Z A;  4XRS A;  1JJ8 C;  1ZTR A;  1ZR4 A;  3A03 A;  3S1R J;  1DU0 A;  4MFD A;  1B8I B;  3JRI A;  1YRN A;  2Y9Y A;  5J1R A;  2DA2 A;  4JP0 A;  4CYC A;  4M3B A;  1P7J A;  2LY9 A;  1NK3 P;  3HOY J;  3O8G A;  2CJJ A;  4Y52 J;  9ANT A;  2JA6 J;  1JJ6 C;  2M2E A;  3HOV J;  1UG2 A;  2LR8 A;  1TWH J;  1JKR C;  2VKV A;  4AC0 A;  1ENH A;  1PUF A;  2EZI A;  4QSH A;  1FTT A;  1OCT C;  2JMW A;  1W0T A;  3M4O J;  1SAN A;  3I4M J;  4DYQ A;  4DZP A;  1IRZ A;  4Y7N J;  4W1U A;  3JRE A;  3D1N I;  4L5E A;  1AHD P;  1LFB A;  4HNV A;  1GV5 A;  5K7F A;  3GTO J;  2EZL A;  3BG9 A;  5JLX A;  1NK2 P;  2FD5 A;  3GTG J;  4MIM A;  2CQQ A;  4JX4 A;  2ECC A;  2X9D A;  4W97 A;  2CUE A;  2VI6 A;  1K61 A;  2XB5 A;  2ME0 A;  2H8R A;  2HOA A;  2DA1 A;  2W48 A;  3S17 J;  1H88 C;  3DEW A;  1POG A;  2QF7 A;  1I3Q J;  4M3E A;  4V2G A;  3HOU J;  5FJ8 J;  1WI3 A;  3FIS A;  5E3M A;  3MVP A;  5EYR A;  3H3V K;  2HOS A;  4A3C J;  3E7L A;  4XRS G;  2ECB A;  4UUT A;  5FKN A;  3MKL A;  5EGO B;  3FIW A;  3JRA A;  1MSE C;  1K83 J;  2EZK A;  5IPA A;  1TWC J;  3DCF A;  3ZOB A;  2K9Q A;  2DA5 A;  4C3I J;  1T56 A;  4J19 A;  3BQY A;  3GTP J;  4A3G J;  1SFO J;  1Y1W J;  3BR2 A;  2G0E A;  3GBG A;  5EEA A;  1AKH B;  4M3G A;  3BR1 A;  3MN2 A;  1ZKG A;  1BJZ A;  2E19 A;  1VI0 A;  1HF0 A;  1Q1V A;  4I6Z A;  3S2H J;  4GFB A;  4JX6 A;  1WH5 A;  2JWT A;  2QCO A;  3A01 B;  1ZQ3 P;  4B3A A;  5DS9 A;  1LE8 B;  2MW8 A;  4DYC A;  4A93 J;  3LSG A;  5F08 A;  1ETK A;  3CMY A;  2EQR A;  3BR0 A;  1CQT A;  3BTC A;  1W0U A;  4D5C A;  5IYD J;  5M3M J;  3K2A A;  3S1M J;  4IHY A;  4BXX J;  3SDG A;  3WHC A;  3ZQG A;  1XS9 A;  2LTP A;  2L7Z A;  3G1M A;  2LKX A;  1HDP A;  4BKX A;  2XGC A;  2HYJ A;  5GP9 A;  1RET A;  2DA6 A;  5M5X J;  1FEX A;  2YS9 A;  2H1K A;  2ID6 A;  1HLV A;  2JN6 A;  2WB1 N;  5E3O A;  4DZJ A;  3HM5 A;  1I6H J;  1ORK A;  5C4X J;  2R5Z B;  2E2H J;  2CQX A;  1UMQ A;  3JRC A;  3GTJ J;  1B72 B;  3BG5 A;  1GUU A;  3QQA A;  2Y30 A;  3BG3 A;  1IV6 A;  4JYK A;  5GPC A;  2NS7 A;  2TCT A;  1MBH A;  3CQZ J;  4C3H J;  1MNM C;  1JUP A;  2JA8 J;  2DMQ A;  3OSG A;  1FJL A;  1JGG A;  4FCY A;  1YRN B;  2DMU A;  4A3B J;  1Z77 A;  4XK4 A;  1MBE A;  2OPT A;  5EZH A;  3NAR A;  4CYC B;  4UUS A;  3JRD A;  3PO3 J;  5IP7 J;  3S14 J;  3BTJ A;  3HBL A;  2KDZ A;  5F27 A;  1B8I A;  2D5V A;  1X2M A;  1ZGW A;  3BR3 A;  4M3F A;  4A3M J;  5IP9 J;  4X6A J;  1UHS A;  2M9H A;  3C2B A;  5EG0 A;  5JLW A;  2DTZ A;  5DTD A;  1PUF B;  5IP6 A;  3TP3 A;  3RQI A;  3RKQ A;  3S15 J;  2DA4 A;  3HGY A;  3TW7 A;  5BNG A;  3O8H A;  1Z0X A;  4D7M A;  5C3E J;  1BW6 A;  1MSF C;  1ETY A;  1ZR2 A;  1WH7 A;  1JT0 A;  1MBG A;  2HQ5 A;  5IYB J;  1E3O C;  3K7A J;  3JR9 A;  5E3L A;  2CRG A;  2R5Y A;  2VPR A;  2LD5 A;  1TWG J;  3S1Q J;  3NAU A;  3BTI A;  2L9R A;  3G1L A;  1ETX A;  1A5J A;  1LFU P;  2NOG A;  2AO9 A;  3IH4 A;  3TP0 A;  4C2M J;  3SFI A;  4AUX A;  1Y1V J;  2MG4 A;  2E1O A;  2HXO A;  2LFB A;  2RAE A;  5J3L A;  3BTL A;  3JRH A;  4BY7 J;  2O9L A;  5IOY A;  2ID3 A;  5F1J A;  1QVT A;  1HDD C;  3UKG A;  2VUM J;  2NVQ J;  1JKQ C;  4XID A;  4IHX A;  3HB9 A;  2L7M P;  3JRB A;  1ETQ A;  5EDN A;  4IHV A;  1VND A;  2KT0 A;  3BR6 A;  2P81 A;  3RZO J;  2JA7 J;  4DW6 A;  2DN0 A;  2DA3 A;  5F0H A;  5E3N A;  1JKP C;  2EBI A;  1H89 C;  2R92 J;  2M8G X;  1QPI A;  2L7F P;  3G1O A;  5F04 A;  1F43 A;  2XSD C;  2JA5 J;  4IHW A;  1RKT A;  1AU7 A;  2Y2Z A;  2HI3 A;  2JJ7 A;  5GPA A;  2ME6 A;  3GTL J;  2NVT J;  2L0K A;  5J1U A;  3QPS A;  4A3I J;  1JT6 A;  1MBK A;  2WAQ N;  1IDZ A;  3B6A A;  3M3Y J;  2X48 A;  3BQZ A;  3OIO A;  1QVU A;  3Q0W A;  1GV2 A;  2NVY J;  5EF6 A;  1XG1 A;  4NDL A;  1EF4 A;  1ETW A;  2HXI A;  2WV1 A;  3OSF A;  3TW6 A;  3I4N J;  4G12 A;  2EZH A;  2TRT A;  2PMZ N;  1TWF J;  5F0C A;  4BY1 J;  1FTZ A;  3F0C A;  2GBY A;  1MH3 A;  1IGN A;  1JUS A;  1JUM A;  1FIA A;  2MSY A;  4DYR A;  2O7O A;  1G2H A;  3ZQF A;  3SJM A;  3Q0V A;  5FKK A;  4QTR A;  1MBF A;  4V2F A;  1RKW A;  1BW5 A;  2R93 J;  1WPK A;  1A6I A;  3LSP A;  3RZD J;  2FQ4 A;  1R9T J;  1BL0 A;  3TED A;  4BBS J;  3WHB A;  2O8K A;  2XPV A;  1I50 J;  3HKZ N;  2NVX J;  3GTM J;  2DMN A;  1ZK8 A;  1BA5 A;  2I10 A;  1DU6 A;  1MBJ A;  1TWA J;  3GTQ J;  2COB A;  1RR7 A;  1OJL A;  1JTX A;  5M5W J;  3ZQL A;  2VKE A;  1X2N A;  3FK7 A;  2NS8 A;  3HOX J;  4A3F J;  2DMT A;  5J1Y A;  4A3E J;  3LNQ A;  4D5F A;  3IV5 A;  2Y0S N;  1IC8 A;  5FKL A;  1WCM J;  2HOT A;  2XPW A;  5FKM A;  4MLO A;  1X58 A;  5EG0 B;  2XPU A;  4D7N A;  1HCR A;  1HOM A;  2OF7 A;  4A3D J;  3FKI J;  4M3D A;  3CCY A;  2ELK A;  2YUS A;  4M6V A;  1GDT A;  2K9N A;  1WGX A;  2DMP A;  1U9O A;  2XGE A;  4A3L J;  1VF9 A;  2XRL A;  2XB0 X;  2CUF A;  4FTH A;  2IBD A;  1GT0 C;  1ETO A;  1ITY A;  2R5Y B;  3S16 J;  1OCP A;  1APL C;  2E2I J;  1F36 A;  4XRM A;  2DA7 A;  2LP0 A;  2ZB9 A;  3FK6 A;  3S1N J;  3W6V A;  1S7E A;  2K9S A;  1QRY A;  2X6O A;  3HGG A;  2E2J J;  2DJN A;  4B4C A;  3PO2 J;  2FX0 A;  5FKO A;  4FE4 A;  4S0H B;  3A02 A;  3PM1 A;  2JK3 A;  2MGQ A;  3CDL A;  3IH2 A;  3JRF A;  3VPR A;  5IOZ A;  1IUF A;  3IH3 A;  5K7H A;  1GVD A;  4MO7 A;  2IEK A;  3ZQH A;  1NTC A;  4FE7 A;  2LVS A;  5EGO A;  4A69 C;  5K7Z A;  2FJ1 A;  2Y31 A;  3JRG A;  2R0Q C;  2GLO A;  5FLV A;  3HOZ J;  4RDU A;  5F0F A;  2M0C A;  1RPW A;  1MH4 A;  4RBO A;  1TC3 C;  1OFC X;  1RES A;  1AKH A;  5M5Y J;  3B6C A;  3HEF A;  1U8B A;  1IG7 A;  1T33 A;  3OOU A;  5IYC J;  4EEF G;  1U9N A;  1IDY A;  1O4X A;  3BR5 A;  3LOC A;  2B63 J;  1XC5 A;  3A01 A;  2LK2 A;  4ABZ A;  3Q0U A;  3Q3S A;  1U78 A;  4IEJ A;  1LE8 A;  2GM4 A;  4MFE A;  1P7I A;  4JX5 A;  4A3K J;  4QIW N;  3LSJ A;  3S2D J;  1ETV A;  5C4J J;  3HOW J;  3HDD A; 
#chains in the Genus database with same CATH topology
 1OCO H;  3ZMU A;  4CDG A;  4DOZ A;  4HLX A;  2RC4 A;  1VZ0 A;  1IN5 A;  4B1R A;  1IRX A;  2AHQ A;  5C44 J;  2LC2 A;  2YU3 A;  4YII A;  3L2R A;  1EH6 A;  3K0L A;  3DEE A;  2CQK A;  5FD6 A;  3WTU C;  3GTK J;  5JFR A;  1GHC A;  4LOC A;  1VFC A;  3WU0 A;  5J8F A;  3QPL A;  5EZG A;  5DDG A;  3V42 A;  2IW5 A;  5ICF A;  4IQ4 A;  1R22 A;  1YW9 A;  2N8G A;  1Z67 A;  4AYB N;  1B72 A;  2VQG A;  4R8H A;  4D9J A;  3DP7 A;  3C1D A;  4XLF A;  4BBR J;  4AVZ A;  3HRS A;  4CCN A;  3NEU A;  2IAI A;  3BT9 A;  5BOX A;  3M1C A;  4FHT A;  4KMU X;  5JHF A;  5HOD A;  1P4A A;  1XDU A;  2OV7 A;  2ZSH B;  1ZTR A;  4M6X A;  4UB8 C;  1X1C A;  3CJR B;  4XRS A;  4J00 A;  3S1R J;  1T0F C;  1Z7L A;  2E7W A;  1IUY A;  3E6D A;  3F6O A;  1XSV A;  2DA2 A;  1R6R A;  1R00 A;  1HW1 A;  2V1D A;  2R7O A;  1X3W B;  2F48 A;  1P7J A;  1SAX A;  3RPQ A;  1RUO A;  3HUG B;  3HOY J;  3O8G A;  4UVA A;  2QBY B;  3DBL B;  1YX5 A;  4Y13 A;  4XN0 A;  9ANT A;  2JA6 J;  3MWM A;  5HS8 A;  3ZCO A;  5A2Q K;  2M2E A;  1JKR C;  3K6G A;  2Y75 A;  3J7Y J;  3RKY A;  3F3X A;  3IAM 2;  2VE8 A;  2X6W A;  1OCT C;  3LWF A;  1LJ9 A;  3CC4 I;  4BJT A;  2M0M A;  4DYQ A;  1WJ5 A;  1IRZ A;  3JRE A;  5KCM A;  2ZKZ A;  4KT5 C;  5K7F A;  3I71 A;  1VQ9 I;  2Q1Z B;  1K79 A;  3EYI A;  1NK2 P;  2EV0 A;  2FD5 A;  3BJO A;  4FQG A;  3X2Q H;  2CV0 A;  1FOW A;  3J80 Z;  1FMW A;  2CUZ A;  1ODD A;  1TTY A;  1IZ1 A;  3QAH A;  4HDU A;  3HJE A;  2FE3 A;  3WGH A;  3PIP F;  2VL8 A;  4W97 A;  3HOS A;  3ABK H;  1QBJ A;  2FBH A;  2KIU A;  2H8R A;  2EIN H;  2ELH A;  4M3E A;  3HOU J;  1O57 A;  3LQR A;  3H3V K;  5EYR A;  4ENN A;  3BLY A;  1USS A;  2HOS A;  3K2Z A;  2V9K A;  4RGU A;  3E7L A;  4XNF A;  2PI0 A;  2ECB A;  2P5K A;  2LMD A;  4PGH A;  4LIU A;  3JRA A;  4BE0 A;  3OYI A;  3N4M A;  2ZXJ A;  1UCR A;  2K9Q A;  2OAZ A;  4F52 A;  5IT9 Z;  4G7O F;  1T56 A;  5LEK A;  2XAF A;  3S8P A;  1P9Q C;  3TQN A;  5KVR A;  1P2F A;  3AFH A;  4HST A;  3D5R C;  1W7P A;  2G0E A;  5EEA A;  5FRO A;  4L0Z B;  4DBR A;  3BR1 A;  3M7G A;  3MN2 A;  4CCO A;  3K70 D;  2LNB A;  2CYY A;  4M6Y A;  1HKS A;  3P9I A;  1G59 A;  2XAU A;  5D8K B;  3ZMT A;  1ON1 A;  2NAZ A;  2GOX B;  2KJB A;  3GO5 A;  5JR3 A;  1R1U A;  1LE8 B;  5ILU A;  4DYC A;  3BDD A;  4ZDL A;  2AQE A;  3DKW A;  2E1M C;  2O0Y A;  4KN7 X;  3BTC A;  2H09 A;  4B3X A;  1XSD A;  2XGX A;  3L09 A;  2ZJR F;  3DKX A;  4RLF A;  3OS0 A;  1VQK I;  1DPR A;  2JT1 A;  3FX3 A;  2ZC2 A;  1YJN I;  3G1M A;  2FML A;  2LKX A;  5HDG A;  3IUO A;  2P4W A;  2COM A;  1MJ9 A;  3QRF F;  1GXQ A;  1T98 A;  4BKX A;  4GYI A;  4YEL A;  5GP9 A;  2HQA A;  4XR6 A;  1RET A;  2R3S A;  3W6J B;  2CGP A;  1B6A A;  2DA6 A;  5M5X J;  2Q8K A;  1LVK A;  3WGG A;  4F3Q A;  1REP C;  3WE3 A;  2VAS A;  2DDB A;  4TV7 A;  2H94 A;  1D1B A;  3J7A Y;  1G3T A;  5C4X J;  4N4O B;  3H3U A;  5CQE A;  2E2H J;  1S8N A;  3JTG A;  2EFW A;  2FOK A;  2IGO A;  1B72 B;  1GUU A;  2KRH A;  3ABL H;  1DPU A;  1UG0 A;  4JYK A;  2HEO A;  2NS7 A;  5FLX K;  3OR1 C;  1MNM C;  4C9Y A;  1SFK A;  3OYJ A;  5CVU A;  4BNC A;  1R1T A;  3H9J A;  3ZGK A;  3OSG A;  3S3O A;  1FJL A;  1B9N A;  4Q5S F;  3GLL A;  1Z77 A;  1MBE A;  3RYP A;  2A05 A;  4OOI A;  3NAR A;  3KPH A;  1B59 A;  2HVQ A;  2FF4 A;  3SXY A;  4BJ6 C;  5J8C A;  2VBX A;  1YTY A;  4G6Q A;  2CWE A;  2GQQ A;  2A3S A;  2X1C A;  5F27 A;  2H8W A;  1ZAO A;  1ZRE A;  1QZE A;  1VQ8 I;  4XOR A;  1UHS A;  2M9H A;  3C2B A;  3VDX A;  5JLW A;  4JOM A;  2DTZ A;  3PSF A;  5EG0 A;  2B0L A;  3ZQQ A;  1RZ4 A;  3WTX C;  3Q5F A;  2EIJ H;  1I3A A;  4U7B A;  2HYF A;  1XX5 A;  2Z5U A;  5D4R A;  3T8R A;  4LIV A;  1BOB A;  2FRH A;  1ONV A;  4IJA A;  2GOM A;  4E7J A;  1MSF C;  3U1K A;  1ZR2 A;  1IRG A;  1RNL A;  1MBG A;  2HQ5 A;  3ZQ7 A;  4C30 A;  2ZNZ A;  2VT3 A;  1MW7 A;  1X1D A;  3JR9 A;  2R5Y A;  2Z33 A;  2VPR A;  2LD5 A;  1TWG J;  3S1Q J;  1CGP A;  3RPU D;  1J9I A;  2HTS A;  2PG4 A;  3G1L A;  2F4O B;  5B1B H;  2HR3 A;  2NOG A;  2AO9 A;  2M5W A;  2PJR A;  2V26 A;  3SFI A;  2QYO A;  3H5N A;  3ZXS A;  4AUX A;  5FRN A;  2E1O A;  2K85 A;  1N77 A;  4II2 A;  3F23 A;  1BN5 A;  3DFG A;  4RM3 A;  2CFO A;  3KP7 A;  3LMM A;  5F1J A;  1P92 A;  2P5L C;  2WTE A;  3OL3 A;  4A0Z A;  2EFP A;  2LH9 A;  3KYL A;  4XID A;  4AWX B;  3HB9 A;  2YSR A;  3EPZ A;  3HPG A;  1BOA A;  3D5L A;  2WAE A;  4E7K A;  3GVA A;  5CVJ A;  4DW6 A;  1W7P B;  2MH9 A;  1X1P A;  1JKP C;  3KP3 A;  4G6T B;  2C6Y A;  3I64 A;  2DT5 A;  2V1N A;  1BJA A;  3G1O A;  1GVJ A;  3BP8 A;  3GFJ A;  1RKT A;  2HI3 A;  3WTT C;  2ME6 A;  4QPO A;  4L9V A;  4FT8 A;  3K4M A;  4V19 K;  4A3I J;  1T2K A;  3VSL A;  3RJP A;  2WAQ N;  4ENM A;  4HNT A;  1I6X A;  2NVY J;  4BAC A;  4B47 A;  1OYY A;  1ETW A;  2HXI A;  3OYE A;  3H1C A;  3H5R A;  2CO5 A;  2EZH A;  3OWT A;  5E20 A;  5KHD A;  4IKF A;  1TWF J;  4KIS A;  1J5Y A;  2STT A;  3RTR A;  1MH3 A;  4A5M A;  3LSH A;  1JUM A;  3HC7 A;  3K4B A;  3EDP A;  1UAA A;  3ZMZ A;  4U0W A;  2UZK A;  3AL0 B;  3IP4 B;  2KPM A;  3ZQF A;  1IXC A;  3SJM A;  2QSF X;  5FKK A;  2JPC A;  3CO6 C;  1DGR M;  2V7F A;  2QM3 A;  4V2F A;  3E3V A;  2W84 A;  3KEO A;  1YYV A;  3QYE A;  4CSW A;  5CVR A;  1GLN A;  1W5T A;  4G8X A;  3WHB A;  4BYY A;  5B1A H;  2KZG A;  4BJ5 C;  4BDZ A;  2D45 A;  1FYM A;  2NVX J;  5FB2 A;  4IXA A;  4G94 A;  3DLA A;  3R61 A;  2F5V A;  2I10 A;  4P96 A;  4D1Q A;  5DUK A;  3DPT A;  1Z6T A;  2DK5 A;  4ZDP A;  1H9T A;  4E7L A;  2XC7 A;  2HPI A;  4AIH A;  3CZ6 A;  3A4C A;  2VJI A;  3ZQL A;  4CIC A;  5AIQ A;  2M45 A;  3SHF A;  2XAQ A;  3FK7 A;  4LLG F;  3HHG A;  3HKZ A;  4A3F J;  2IGK A;  3E1S A;  5J1Y A;  1ERD A;  1W5S A;  2BXZ A;  4D5F A;  1X1B A;  3IV5 A;  1E3P A;  4OU0 A;  2B9S A;  4EV0 A;  2L9N A;  4E6K G;  4JQF A;  1IC8 A;  1WCM J;  1LDD A;  4E7I A;  5EG0 B;  3DU5 A;  2F4M B;  3I54 A;  4D7N A;  1HCR A;  2VLA A;  2OF7 A;  1O3S A;  2DT7 B;  2DI3 A;  2M4K A;  3KP5 A;  4M3D A;  2ELK A;  3I0T A;  4M6V A;  3OYM A;  1ACI A;  2OC6 A;  4GRI A;  1YS6 A;  4ZZD A;  1WGX A;  2DMP A;  3R4K A;  4AU7 A;  1VF9 A;  5HS7 A;  1F5T A;  2XAJ A;  1GT0 C;  3M8F A;  2Y0S A;  4RLQ A;  3HL2 A;  3F9K A;  1MMA A;  2YX4 A;  2R5Y B;  3ABT A;  3CC7 I;  4IX7 A;  1TT5 B;  3CCM I;  1R49 A;  3IKV A;  2VKH A;  1FBQ A;  3O2P E;  1F36 A;  1D0Z A;  3KE2 A;  4XKV A;  3L00 A;  1VQ6 I;  2LG4 A;  3FK6 A;  2PJR B;  3W6V A;  1S7E A;  1Z21 A;  3F6V A;  2IXS A;  5DD4 A;  4XKW A;  3V8J A;  1N25 A;  4G7Z F;  4HF1 A;  4MTD A;  4LJZ F;  2FX0 A;  4U87 A;  3WU2 C;  3T8T A;  1T6S A;  4WK8 F;  3CCU I;  4UVC A;  2ESH A;  1IUF A;  2ESN A;  2OZ6 A;  4BUP A;  2OTL I;  1U8R A;  2MD5 A;  5EGO A;  3DTK A;  3WOD F;  4IVN A;  4AIJ A;  3QU3 A;  4HAM A;  2P6S A;  1P4W A;  1RRJ A;  3N05 A;  1IW7 F;  5FLV A;  2DYR H;  3WTV C;  5F0F A;  5L3G A;  2M0C A;  2V79 A;  3KX2 A;  3PUB A;  3GF2 A;  4B43 A;  4P9U A;  4RAF A;  1IRF A;  1OFC X;  2HPM A;  3IHU A;  5JHU A;  2ZBK A;  3CUQ C;  1IXS B;  4I98 B;  1IG7 A;  2HZT A;  2CG4 A;  1U9N A;  3S93 A;  5FFX A;  4CCL A;  4BQA A;  3H36 A;  1TQI A;  4EM1 A;  2WV0 A;  1XC5 A;  2DOA A;  4RGR A;  4ABZ A;  4YFX F;  3ABU A;  5DD8 A;  3LST A;  3Q0U A;  3I56 I;  5JVT A;  3GZ5 A;  1IF1 A;  5D6F A;  4A3K J;  3S2D J;  3LSJ A;  2OUM A;  1JTY A;  5EJC A;  3GLX A;  2O5R A;  5ICE A;  3ZQC A;  2QUF A;  4P1W A;  1YIO A;  5LGU A;  3ASN H;  5B3S H;  3G73 A;  2JPB A;  3HSE A;  2M4G A;  4PSX A;  3ISP A;  4UV8 A;  5JI6 A;  2V6C A;  5LFA A;  2LLK A;  3VYS B;  2BEO A;  4HV6 A;  1R58 A;  1S5L C;  4PGG A;  4OIN F;  2KKO A;  4IO9 F;  1A6Q A;  2LOO A;  4RAG A;  3WTS C;  4L9J A;  4Q4Z F;  2QSH X;  2QVO A;  2OQG A;  2R5Z A;  5HNF A;  1X3U A;  2DU9 A;  3IKT A;  4X0G A;  3FBN B;  3L2C A;  2V1X A;  1IN8 A;  1JKO C;  2NNN A;  4A2U A;  1R23 A;  1XTA A;  4BHP A;  4DBQ A;  5TIS C;  3MAJ A;  1XMX A;  2EPF A;  5L3E A;  2Y9Z A;  4HV5 A;  4OMY A;  1Z1D A;  1ZR4 A;  3A03 A;  1FYK A;  2DPU A;  1OQY A;  1DU0 A;  1BIB A;  1B8I B;  4M72 A;  2WB1 A;  3F21 A;  1HKQ A;  3C7J A;  5K1Y A;  3JRI A;  1YRN A;  3MKW B;  5J1R A;  5ICG A;  5ED4 A;  1KU9 A;  3KYC B;  5LGT A;  1T0F A;  3CP2 A;  1FY7 A;  3QU6 A;  4LK0 F;  1JJ6 C;  3RYR A;  2DO7 A;  1UG2 A;  3RI4 A;  1ENH A;  1NH3 A;  2EZI A;  2A69 F;  4QSH A;  2IP2 A;  1FTT A;  1OR7 C;  1W0T A;  3M4O J;  4DZP A;  3FMR A;  4Y7N J;  1VTN C;  4HG2 A;  1DQU A;  1XPX A;  4IRH A;  1LFB A;  3GTO J;  2EZL A;  2FBK A;  4OIR F;  3L2V A;  2X6Y A;  2XRO A;  2VXD A;  2CQQ A;  4BAY A;  2QEN A;  4OAZ A;  2ECC A;  1EH8 A;  2VI6 A;  1TBX A;  1ON2 A;  2DAO A;  1K61 A;  3COA C;  4E4H A;  3J81 K;  1UFM A;  1LVA A;  4DNC A;  3OL4 A;  1POG A;  4GCV A;  4ON0 A;  3LA2 A;  4A0Y A;  1YIJ I;  1WI3 A;  4WWC A;  1JHF A;  1FX7 A;  1A36 A;  2CS3 A;  2M87 A;  1UHM A;  4L0Y B;  5LD2 C;  2JUG A;  5TRD A;  4XRS G;  5HDN A;  4UUT A;  1RC9 A;  5D8L B;  4GO1 A;  2VC1 A;  2QQ9 A;  3JSP A;  5EGO B;  3FIW A;  1RR8 C;  1NHA A;  1K83 J;  4OIP F;  4I02 A;  1V3F A;  3DCF A;  5LHI A;  1LQ1 A;  4RB0 A;  3W6K B;  2BVL A;  2HVR A;  3BQY A;  4MHG A;  1O3T A;  1R4M B;  4ZJZ A;  3ROU A;  3BR2 A;  3I55 I;  1K6Y A;  2FUG 2;  4WXH A;  4M3G A;  1BJZ A;  2QKM B;  3CES A;  4EJO A;  2KRC A;  2CFX A;  2DTR A;  1Q1V A;  2EIM H;  2OCC H;  4PFO A;  2DOE A;  3IC7 A;  3V4G A;  3B73 A;  3E97 A;  1S9H A;  3KLO A;  1G3W A;  5DS9 A;  2MW8 A;  1YI2 I;  1QA6 A;  4A93 J;  3JTH A;  3LSG A;  4XSX F;  5F08 A;  3RQ4 A;  4CCM A;  2IJL A;  2EQR A;  1CQT A;  2D2W A;  3TL4 X;  2W85 A;  3QOP A;  2E5N A;  1QHG A;  5IYD J;  4BQN A;  3K2A A;  3S1M J;  4IHY A;  1X4P A;  4S05 A;  1D5V A;  2NVU B;  1P4X A;  2R7V A;  5D5X B;  1PJR A;  1HXD A;  2GAU A;  1A04 A;  2KJC A;  3HXL A;  2X0L A;  1MMG A;  3LQQ A;  3WE2 A;  3A2K A;  1RIO H;  4BE1 A;  2H1K A;  1HLV A;  3UR3 C;  1XGN A;  2XAS A;  2JN6 A;  1EKE A;  1EH7 A;  4CUG A;  3PSI A;  3HM5 A;  4DZJ A;  3MEX A;  2M7A A;  1B9M A;  3MKZ A;  4LGW A;  2LYC A;  2R5Z B;  2OTJ I;  2IA0 A;  2VN2 A;  3GTJ J;  1FP2 A;  1XMK A;  1E0E A;  4BH9 A;  2Y30 A;  2STW A;  4C2U A;  2ELJ A;  4CH7 A;  3J80 K;  2TCT A;  1MBH A;  3ML6 A;  3HZJ A;  1D3Y A;  4E7S A;  3S32 A;  4ZYG A;  1YE9 A;  3GFM A;  2BXY A;  3K4J A;  2EA4 A;  2L2O A;  2A5Y B;  2Z16 A;  3V7C A;  4FCY A;  1YRN B;  4A3B J;  1N75 A;  1H9G A;  1QQI A;  4M9X A;  4UUS A;  3PO3 J;  4IF4 A;  1J0R A;  3S14 J;  2ZXH A;  3H3Z A;  3HBL A;  4G6D A;  2VOP A;  2K4B A;  3MMY B;  4X6A J;  5GTI C;  3EUH A;  3TMO A;  2I5U A;  2RQP A;  1Y6I A;  1PP8 F;  1U3E M;  4A6D A;  2LRE A;  5IT9 K;  4NQW A;  2PQ8 A;  3V8L A;  4EM2 A;  2DA4 A;  2XF5 A;  2MFZ A;  3HPH A;  1ZLK A;  5BNG A;  2RKH A;  3CCS I;  2JVH A;  1W1W E;  1BW6 A;  3I9V 2;  1P6R A;  1PVE A;  3FXK A;  2A61 A;  1JT0 A;  1KON A;  4E7H A;  3DXJ F;  3ECO A;  5IYB J;  3GFL A;  2OU2 A;  2FOW A;  2XDV A;  3K7A J;  5HS9 A;  4ZYE A;  5E3L A;  4F93 B;  2AQF A;  1TQM A;  1K4T A;  2NOJ B;  3CCL I;  1XGS A;  4IHT A;  2L9S A;  2DK8 A;  1SAU A;  2MG4 A;  1DDN A;  2LFB A;  4IQJ A;  2WBM A;  3F8B A;  1G4D A;  2O9L A;  1NG6 A;  2XF6 A;  4BGD A;  5IOY A;  1K7A A;  1OYW A;  5F1R A;  2M8E A;  4KA4 A;  1QNT A;  2VKD A;  4XKC A;  1PYV A;  4IOC F;  2EV6 A;  1OMI A;  1Z91 A;  2L7M P;  3FF5 A;  3U1D A;  1ETQ A;  3JRB A;  3BR6 A;  1MJB A;  4S04 A;  3ZN0 A;  5A2Q Z;  2H6B A;  2ZJ2 A;  1H89 C;  3KEQ A;  2O61 A;  2HKO A;  2M8G X;  5CYV A;  1SVL A;  3DTE A;  1F43 A;  1IXR C;  4H0E A;  4EAT A;  2L4M A;  2IS6 A;  2Y2Z A;  4RGS A;  3PQJ A;  2XKP A;  1OCZ H;  3DU6 A;  1KQ8 A;  2QGU A;  2HU9 A;  2B7E A;  5AIP A;  2L0K A;  3QPS A;  3PFI A;  4PJL A;  4EGY A;  1MBK A;  1VQP I;  1WJD A;  1IDZ A;  3HRU A;  3JAM Z;  4FX0 A;  3M3Y J;  1QVU A;  5EF6 A;  1XG1 A;  2ZXI A;  3A1Y A;  2E1M B;  3GW2 A;  4UV9 A;  3TW6 A;  4G7H F;  5E8G A;  2FSW A;  3DF8 A;  3BCA A;  4G12 A;  2TRT A;  3T1B A;  5B66 C;  2HVS A;  5F0C A;  4IOA F;  3NWT A;  1FTZ A;  3RSN A;  2F5F A;  1T39 A;  3MZY A;  4PDK A;  4RMN A;  2MBF A;  2R7W A;  3DLL F;  1FC3 A;  3E5Q A;  3Q0V A;  1FSE A;  3OIP A;  2WC2 A;  2A6T A;  2ISZ A;  1BW5 A;  3LSP A;  3RZD J;  1O3Q A;  1BL0 A;  1FOX A;  4J01 A;  3U9G A;  1HBX G;  4BBS J;  2P6T A;  4CXF A;  2PMZ A;  4YFK F;  3HKZ N;  2XIG A;  2E60 A;  3IWF A;  3SDB A;  1ZK8 A;  2IGM A;  4RGX A;  3ZMD A;  3M1E A;  5K5R A;  1R71 A;  2JA2 A;  1DU6 A;  3O3K A;  2M3A A;  4KMF A;  4E70 A;  2YR2 A;  5KNL A;  3MQ0 A;  3WGI A;  3CO7 C;  4A12 A;  1RR7 A;  2E71 A;  1JTX A;  2UV1 A;  3D0S A;  2ZME A;  2CH0 A;  2VBZ A;  2VXZ A;  3ONQ A;  5M5W J;  1X2N A;  1L3L A;  3HSR A;  2NS8 A;  2DMT A;  4XL9 A;  1L0O C;  3LNQ A;  1S7O A;  4OIO F;  2Y0S N;  4BHB A;  3HTU A;  5FKM A;  1X58 A;  4AYB A;  2BE5 F;  2W7N A;  3K4N A;  1Y8R B;  4PJN A;  4WXD A;  4NQW B;  2WAF A;  1U6G A;  3W2V A;  2YUS A;  2UUZ A;  4ENK A;  4OWR B;  1SMY F;  4HSR A;  4MQV A;  1Z05 A;  2KP6 A;  1HW2 A;  1U9O A;  2CQN A;  3BZ6 A;  3CME I;  2XGE A;  4LK1 F;  2JSP A;  1TNT A;  1WI9 A;  2Y48 A;  1ITY A;  2XB0 X;  1STZ A;  4XMY A;  4RAY A;  4NB5 A;  2DW4 A;  3BCB A;  5H2F C;  2CW8 A;  4BE2 A;  4I99 C;  4YFN F;  2IA1 A;  3SZG A;  2E2I J;  1EJ9 A;  1Z7U A;  3C18 A;  2VB6 A;  1XMA A;  5LRR A;  4R1H A;  3FMQ A;  4BDY A;  1TL8 A;  3PO2 J;  3ZRG A;  2VPL A;  1BIA A;  3GX4 X;  4XLN F;  5FKO A;  5GAG J;  3H9G A;  4S0H B;  2WA0 A;  2JK3 A;  2VBW A;  4JBA A;  3JRF A;  3VPR A;  2XUB A;  2P5V A;  5K7H A;  2XF7 A;  5DV5 A;  1R5I D;  2IEK A;  1NTC A;  4XRF A;  3OS2 A;  2LVS A;  1ZRC A;  1R1V A;  1WJB A;  4KT6 A;  2FJ1 A;  4LB6 B;  5L3C A;  3CDI A;  3JRG A;  2R0Q C;  2GLO A;  3E6M A;  4GDF A;  2JRM A;  1V55 H;  5HLH A;  3QWL A;  4M71 A;  2O6G E;  4LMY A;  1BC8 C;  3HIF A;  3AKZ A;  2ZCW A;  3MFK A;  4ZYA A;  2H27 A;  2ZSI B;  4RS8 A;  3VB2 A;  5LEJ A;  5IYC J;  2K02 A;  2MYS A;  4HPQ A;  2EIL H;  3I58 A;  2XHK A;  3LA7 A;  1Y56 A;  4EJV A;  3ZMV A;  5D5W B;  3LOC A;  2WWY A;  3A01 A;  3L9F A;  3PNV A;  4N9H A;  4NC7 A;  2ETH A;  1KGS A;  1FMV A;  3VOE A;  2CQ7 A;  4JX5 A;  4QIW N;  3HOW J;  3PUF A;  3OOP A;  1YJ9 I;  1IJW C;  3AAF A;  4U7D A;  3BJ6 A;  4ZDO A;  2BHY A;  4C3J J;  2CU7 A;  3CP8 A;  2QLZ A;  1TT0 A;  5BMZ A;  1F4K A;  1MND A;  2DDA A;  4FIS A;  1HKT A;  4ETS A;  4ZYD A;  4X1E A;  1AOY A;  1CF7 A;  1FBU A;  1H8A C;  5M3F J;  5CKT A;  3ZP5 A;  2VC0 A;  4ENJ A;  3L1P A;  4EMS A;  2EFN A;  1D1C A;  1T08 B;  1X4O A;  1U2W A;  3U2R A;  2AXL A;  2HKX A;  4E7Z A;  1U5T A;  2V9P A;  1F1Z A;  1EA3 A;  3LSR A;  2QA4 I;  4ZTF A;  2QQ8 A;  2YU9 J;  3E5X A;  4KIG A;  1XSX A;  1IV8 A;  1OLT A;  3H0G J;  2ZME B;  5ILS A;  3A0B C;  2M30 A;  4MFD A;  5HOO A;  1QPM A;  2L3D A;  3R6S A;  4CCJ A;  5CQG A;  2JVG A;  2Y9Y A;  5GTH C;  2E7X A;  4JP0 A;  1IN7 A;  1HQC A;  2IA2 A;  4M3B A;  2RNJ A;  1W5C C;  1VQ7 I;  2VOO A;  5EEG A;  2IPQ X;  3E0J B;  2P7C B;  2CJJ A;  4Y52 J;  2IVM A;  3CCR I;  1KU7 A;  3LL7 A;  4AVP A;  4ZTJ A;  2HOE A;  3DEU A;  2ZJP F;  2EIK H;  4KYW A;  2LR8 A;  1TWH J;  4MGR A;  4AC0 A;  2KMU A;  4U0V A;  2MA3 A;  1PUF A;  2VJJ A;  2UXN A;  1HST A;  1BC7 C;  1SAN A;  4O5V A;  2E34 A;  1VQL I;  3I4M J;  4W1U A;  2FXA A;  1HW5 A;  4L5E A;  1AHD P;  1LDJ A;  1GV5 A;  1U0J A;  1VQO I;  3BG9 A;  4KFC A;  2X85 A;  3GTG J;  4MIM A;  4BEH A;  3EQL F;  2PMU A;  3ASO H;  2X9D A;  2CUJ A;  2CUE A;  3FXO A;  2ME0 A;  3LSM A;  1XGM A;  2DA1 A;  2G9W A;  3C2H A;  2W48 A;  1H88 C;  1I27 A;  2DQR A;  2NYX A;  3DEW A;  3P9C A;  2CV2 A;  1PDN C;  5GAD J;  1I3Q J;  5JVG F;  4V2G A;  1EV7 A;  3LFK A;  2A6E F;  2W1O A;  1XB4 A;  3CJT B;  3OIQ A;  3ECH A;  3SEZ A;  1A35 A;  2QKL B;  2QQA A;  3H9Q A;  3O6B B;  3MKY B;  1QU3 A;  2EV5 A;  3C2G A;  1MSE C;  2EZK A;  2OJE D;  4H4K C;  1TWC J;  2I8D A;  2DA5 A;  4C3I J;  3GTP J;  1C0W A;  1ZH5 A;  1MNE A;  4GYG A;  1K4S A;  4A3G J;  4AIK A;  4M74 A;  2DFI A;  2A6H F;  4R79 A;  2CV1 A;  2BY3 A;  3GBG A;  2MAB A;  5LGN A;  4HZF A;  1W7P D;  1ZKG A;  2F5C A;  2P7V B;  3G4S I;  3N97 A;  2BHZ A;  2DOD A;  2E19 A;  4UUV A;  2ACJ A;  3K1P A;  1HF0 A;  2DFE A;  4ZC3 A;  1YIT I;  1BR2 A;  2Q2E A;  2QWW A;  3ERE D;  3RDI A;  2L54 A;  4JX6 A;  2JWT A;  3EET A;  1R5G A;  3A01 B;  2EK5 A;  3LAP A;  2XRN A;  4B3A A;  1ULY A;  3OYA A;  1ETK A;  1WJF A;  2OA4 A;  3HHH A;  3VYT B;  3CMY A;  3BR0 A;  3J7Z I;  1W0U A;  4M9Z A;  4HX7 A;  2NS0 A;  1TW2 A;  3QOD A;  1FNN A;  2XAH A;  1ZEL A;  5L3D A;  3WHC A;  3ZQG A;  4BXX J;  2X1E A;  2L7Z A;  2M1B A;  3GZ6 A;  1DP3 A;  1YX3 A;  3R60 A;  4XN3 A;  3WG9 A;  5L3B A;  1R5H A;  3SYT A;  3VFZ A;  3P9K A;  1TQP A;  4M9S A;  2XAG A;  1FWZ A;  1XD7 A;  4EJW A;  3WTY C;  4KIF A;  3ZR8 X;  1YHQ I;  2KL4 A;  4F91 B;  1B1B A;  1FEX A;  1CF7 B;  1LNW A;  3AG2 H;  4PZJ A;  2LSO A;  5E3O A;  4RB3 C;  5D5U B;  4HOB A;  4U0Y A;  2H6C A;  2GZW A;  1ZYR F;  4OIQ F;  1A31 A;  1UHW A;  2WAQ A;  1I6H J;  2KIS A;  2R7R A;  4HF2 A;  2PBI A;  1ZGA A;  2DYS H;  1O3R A;  1UMQ A;  3IRQ A;  1U5T B;  1BR1 A;  2MLG A;  2G7H A;  3BG3 A;  3AG4 H;  2JUC A;  5J4Y A;  1X3Z B;  5DM7 F;  4O6J A;  3CQZ J;  3NRV A;  5HLI A;  4C3H J;  4EQQ A;  4XQF A;  3VWB A;  1T8I A;  4XLC A;  1JUP A;  4A0X A;  1JI8 A;  2JA8 J;  3QYB A;  2DMQ A;  1JGG A;  4XLA A;  1WWX A;  4B8X A;  3QP6 A;  4XK4 A;  2OPT A;  3JRD A;  3HRM A;  3RIR A;  3RKW A;  3LAJ A;  3TBI A;  4I7H A;  1Y0N A;  2KDZ A;  2XKO A;  3K4C A;  3PFY A;  2D5V A;  3GUD A;  3BR3 A;  4UB6 C;  2K4J A;  4A3M J;  4FAS D;  4LG0 A;  5IP9 J;  2VE9 A;  1MJA A;  3KP4 A;  4G9Y A;  3SQN A;  5DTD A;  2LY2 A;  2RQQ A;  2L9V A;  1PUF B;  1LB2 A;  5IP6 A;  2IT0 A;  3TP3 A;  3RQI A;  2IS2 A;  2ZJQ F;  2XSJ C;  3TO9 A;  3HGY A;  4FX4 A;  4UHT A;  1K6O A;  2GXB A;  4MEX F;  1Z0X A;  4D7M A;  5C3E J;  4CZZ A;  2HZD A;  4ESF A;  1UJ8 A;  4Q48 A;  1MIJ A;  1WH7 A;  3HRT A;  3L2U A;  5J4V A;  3BG7 A;  2R7D A;  4BEH B;  1E3O C;  3OR2 C;  2PJP A;  2CRG A;  3RPU A;  3AG1 H;  4NNJ A;  4PUS A;  2BOL A;  5E1W A;  3NAU A;  2AXT C;  2CW0 F;  2L9R A;  3CUO A;  5FFZ A;  1A5J A;  1SFE A;  4Y15 A;  1LFU P;  3TP0 A;  4HBL A;  5IY5 H;  2GXA A;  3UNG C;  5BQT A;  1V5E A;  1Y1V J;  2HXO A;  3OMY A;  5J3L A;  3BTL A;  4BY7 J;  1J7K A;  2KQR A;  4WX9 A;  2R7T A;  2ID3 A;  2F2E A;  5L3F A;  1E3H A;  2O03 A;  1SD7 A;  3AG3 H;  1Z9C A;  4I2O A;  1QVT A;  5J40 A;  3L2W A;  2J5O A;  2VUM J;  1UZC A;  2K7L A;  2DOF A;  1OIS A;  1SFU A;  2R7X A;  4XBF A;  3FHZ A;  4IHX A;  3KP2 A;  3E5U A;  1QHH D;  2KLO A;  2JQ7 A;  2PLY A;  2JRT A;  2KT0 A;  1VQ5 I;  3F22 A;  3DKY A;  3RZO J;  2JA7 J;  2DN0 A;  1SC7 A;  2DA3 A;  5F0H A;  5HDK A;  5E3N A;  3DWL E;  2BV6 A;  1ZLJ A;  2MC4 A;  3PL8 A;  3CCJ I;  4GGG A;  1QPI A;  5F04 A;  5F64 A;  2DFF A;  5TGT A;  2XSD C;  1IAW A;  2JA5 J;  1BI2 A;  5FO5 A;  5GAH J;  1J09 A;  3FHN A;  2PN6 A;  1SEU A;  1AU7 A;  2V6E A;  2Q2E B;  5E17 F;  2D1V A;  4DGW B;  2E5Z A;  3G2B A;  5GPA A;  3TO6 A;  5BPI A;  1UST A;  4LLN A;  3GTL J;  2AS5 F;  5AON A;  3T0Y A;  3QP5 A;  3CCQ I;  4EJU A;  3GWZ A;  4CO8 A;  1XCV A;  2WAD A;  1JT6 A;  2LBF A;  4AID A;  1MZB A;  1T95 A;  4I0B A;  5KAF C;  3B6A A;  2HFH A;  3NQO A;  2X48 A;  2RVC A;  3BQZ A;  3FXR A;  4OMZ A;  1GV2 A;  4RM2 A;  4NDL A;  1YW8 A;  2WV1 A;  3CLO A;  3HSF A;  3OSF A;  3F8N A;  3H92 A;  1M1E B;  4B44 A;  3T5X A;  2PMZ N;  1XN7 A;  3V8K A;  5LRS A;  3WU1 B;  4BY1 J;  3F0C A;  3CTA A;  1S29 A;  2GBY A;  3EUK L;  3Q9S A;  1IGN A;  3QOE A;  1I1G A;  1KYZ A;  1FIA A;  2RNG A;  2MSY A;  2FBI A;  2O7O A;  2CW7 A;  2LF8 A;  4PFP A;  4BXU A;  4QTR A;  2QSG X;  1ZGJ A;  1OCC H;  1BI0 A;  1RKW A;  3F72 A;  2BBY A;  1WPK A;  1A6I A;  4KUM A;  3GZN B;  4M73 A;  3FMS A;  2BZT A;  1AA7 A;  3FXJ A;  1Z3X A;  3GTM J;  3VOD A;  2DMN A;  2MC3 A;  3BY6 A;  3FXQ A;  3TDU C;  2LF7 A;  3TGN A;  5K5Q A;  5J47 A;  4BHC A;  1MBJ A;  1TZL A;  2W25 A;  3S2W A;  2W82 A;  1D8J A;  1OJL A;  1W36 C;  1RI7 A;  3F8M A;  1FZP B;  2VKE A;  2RRE A;  4UY8 I;  2RV8 A;  3HOX J;  2Y0M A;  2FNP A;  5ICC A;  2K3P A;  1V54 H;  2LRD A;  4Q47 A;  5E18 F;  1S3J A;  4P9F A;  4PJM A;  5FKL A;  2XPW A;  2HOT A;  4IHS A;  4LG0 B;  4MLO A;  3BRO A;  2XPU A;  3JCU C;  4HRI A;  3DPU A;  3KZY A;  2BY0 A;  1HOM A;  4A3D J;  3BPX A;  3FKI J;  3CCY A;  3JW4 A;  4N4N B;  4FET A;  3REO A;  5DYM A;  5E1Z B;  5LBQ A;  4ESB A;  5CPR B;  1TLH B;  2K3F A;  2HDW A;  3SZT A;  2XRL A;  1G3S A;  2CUF A;  2ZFU A;  2IBD A;  2RN7 A;  1ETO A;  5KAI C;  4FTH A;  4BS9 A;  1FPQ A;  4A6E A;  3OYK A;  2X4H A;  2EFO A;  4IZZ A;  3S16 J;  2IRF G;  1APL C;  4B09 A;  3TKY A;  2VOD A;  3MD2 A;  1MGT A;  4XRM A;  2DA7 A;  2LP0 A;  2ZB9 A;  2HGC A;  3P7N A;  3S1N J;  2RDP A;  2BW3 A;  3FKJ A;  2X6O A;  1G8X A;  3HGG A;  3I4P A;  3MZH A;  2ICW G;  4L18 B;  1IN4 A;  4B4C A;  4CZC A;  3G3Z A;  3QPH A;  2E1C A;  3VYU B;  3F8F A;  5HLG A;  3JAM K;  4QLC U;  3A02 A;  3K4L A;  2MGQ A;  3CDL A;  1I39 A;  2M7B A;  3V7S A;  3ZMS A;  3IH3 A;  5FGM A;  3BG6 A;  2BGC A;  2FMY A;  4MO7 A;  1LEB A;  4WXC A;  5H6Q A;  3ZQH A;  4FE7 A;  5KK1 A;  4XLP F;  2QQB A;  5K7Z A;  3SFZ A;  1PP7 U;  3QPT A;  3CDH A;  1BM9 A;  1SMT A;  4I0A A;  2F5E A;  4I09 A;  1E17 A;  3IL2 A;  2A68 F;  1WKM A;  1MH4 A;  5HLT A;  2L02 A;  4WCG A;  4RBO A;  4NBQ A;  3OYC A;  3HTS B;  2Y69 H;  1AKH A;  1TW3 A;  5M5Y J;  4L5J A;  2Z3Y A;  4MQ9 F;  3OYN A;  3B6C A;  3ULQ B;  3HEF A;  1YOV B;  1T33 A;  2JSC A;  4BL0 B;  2IS1 A;  2KIM A;  4EEF G;  1IDY A;  2GA2 A;  3OYD A;  2DQL A;  2IGN A;  2YPR A;  5GAE J;  4CHU A;  2B63 J;  4MTE A;  4DJA A;  3OS1 A;  2LBF B;  1OPC A;  3FM5 A;  2GM4 A;  4DQ2 A;  1P7I A;  2KIQ A;  3WTZ A;  1ETV A;  5E79 C;  2P0W A;  4XLH A;  2VQC A;  4YIR X;  1FIP A;  4HNU A;  4KIC A;  3I5U A;  2R4G A;  2EH3 A;  1I5Z A;  3TOB A;  4UVB A;  2A5W A;  4LIT A;  3PJR A;  2XGD A;  5J6X A;  3FWE A;  3CCE I;  1LDK B;  5FLM J;  2VT2 A;  4I76 A;  2JTV A;  1D5Y A;  3M07 A;  1Y8Q B;  1DP7 P;  3MCZ A;  3KZI C;  1YS7 A;  4BXF A;  2HDC A;  4A3J J;  3MZ8 A;  4WF2 A;  2ZO4 A;  2JZY A;  5FRM A;  5EEH A;  1MMS A;  2W24 A;  2FA5 A;  4P55 A;  1XCB A;  2OCE A;  3GXO A;  2M34 A;  1JGS A;  3KIO A;  5DCF A;  2R7U A;  2V1U A;  3CC2 I;  3ZQI A;  2A07 F;  4D0P A;  1FLI A;  2R7Z J;  2KFD A;  1D0Y A;  1ZRD A;  5ERI A;  4UUS B;  1WJC A;  1LEA A;  1Z6R A;  2HDD A;  4XIC A;  3I3L A;  2K40 A;  3DQV C;  2NNY A;  1JJ8 C;  3LSK A;  3A0H C;  1X1A A;  1RUN A;  6PAX A;  4MNU A;  3M9A A;  1WSU A;  1FOK A;  4CYC A;  1W36 D;  3BZK A;  4XLE A;  4ANJ A;  3M8E A;  2LY9 A;  3LA3 A;  1YO5 C;  1LUJ B;  3CJN A;  3CLQ A;  3EUH C;  1NK3 P;  4XKB A;  1X19 A;  3CMM A;  3RKX A;  1R4N B;  4PJJ A;  1FBS A;  5D6E A;  3R0J A;  1WVR A;  3OYG A;  5D4S A;  1Q1H A;  3HOV J;  2VKV A;  5CVV A;  4L5I A;  2JMW A;  3H5A A;  4Y33 A;  3FM3 A;  1MDM A;  3D1N I;  4HNV A;  3BC8 A;  4CYD A;  4NUB A;  3DPL C;  3DTI A;  3I59 A;  5JLX A;  2O3F A;  5CVI A;  1E2X A;  5FLX Z;  4Y4R A;  1BBY A;  3PNY A;  4JX4 A;  4HX8 A;  2GIV A;  1MKM A;  2EWN A;  2BW3 B;  2XB5 A;  1V4R A;  4JK1 X;  2HOA A;  2K9L A;  2LY1 A;  3S17 J;  3R0A A;  1KA8 A;  1R7J A;  2QF7 A;  3EYY A;  2W57 A;  5FJ8 J;  1QZY A;  3E6C C;  2CSO A;  3FIS A;  3MVP A;  5E3M A;  3F8C A;  3BOQ A;  1FSH A;  4RA2 A;  4A5N A;  2OQR A;  3FBI B;  4YG2 F;  4A3C J;  1JXS A;  5FKN A;  4XON A;  3MKL A;  4HQM A;  4PJ0 C;  1VQ4 I;  3OY9 A;  1ZRF A;  1XDS A;  4B48 A;  5IPA A;  3WTW C;  2HQN A;  3KET A;  1ZAR A;  1UEL B;  4PK4 A;  3ZOB A;  1WHU A;  4J19 A;  1KU3 A;  2LKS A;  2P8T A;  3LSI A;  1H0M A;  2YX7 A;  1SD6 A;  1SVO A;  3M8J A;  3CCV I;  1Y1W J;  1SFO J;  1JE8 A;  3K1N A;  1AKH B;  3OV8 A;  1YJW I;  4IL6 C;  3E6B A;  1KU2 A;  2HWV A;  4BQQ A;  2L4A A;  1VI0 A;  3U21 A;  1KQ9 A;  4I6Z A;  3S2H J;  3HG9 A;  3CUQ A;  5LLQ A;  4GFB A;  1OKR A;  1WH5 A;  2QCO A;  1GXP A;  1ZQ3 P;  2GWR A;  4IRG A;  3TDZ C;  4OAY A;  2ISY A;  1ZG3 A;  1SFX A;  4D5C A;  4UNO A;  5M3M J;  2WY8 Q;  2DLL A;  3WG7 H;  1FP1 D;  3SDG A;  4LD5 A;  1XS9 A;  2LTP A;  3Q9V A;  3AL0 C;  1HDP A;  2XGC A;  4LG3 A;  2HS5 A;  3OYB A;  2HYJ A;  2VBY A;  3S3N A;  3KP6 A;  4RB2 C;  2F4I A;  1WQ2 A;  1QZZ A;  2YS9 A;  2ID6 A;  1LFP A;  2PX9 A;  3KFW X;  2WB1 N;  4EJT A;  2E35 A;  1ZHF A;  4KN4 X;  2K5C A;  3W2W A;  1Y39 A;  1ORK A;  2CQX A;  3JRC A;  3BPV A;  4BU2 A;  3J7A O;  3SEQ A;  3BG5 A;  3QQA A;  1K78 A;  1V5G A;  1ZN2 A;  1IV6 A;  5CJ9 A;  2VJ4 A;  5GPC A;  1MMD A;  2MLK A;  1YLF A;  3BWG A;  4K2E A;  2MD0 A;  2W4S A;  2PMH A;  2ZME C;  5TJJ A;  4HQE A;  3ERM A;  5DCM A;  4Z6Y A;  4ESJ A;  2PEX A;  1YQA A;  1AWC A;  2DMU A;  5E1X A;  2FQ3 A;  2EA2 A;  5ILV A;  5EZH A;  4F7Z A;  4CYC B;  3W2A A;  4YRV A;  1WJA A;  2H1L A;  4IRI A;  5IP7 J;  3L2Q A;  3BTJ A;  2OD5 A;  4KDP A;  1B8I A;  1D8K A;  3H35 A;  5DUI A;  1X2M A;  3OYH A;  1ZGW A;  1T38 A;  4M3F A;  1Y0U A;  1D1A A;  2EJR A;  3DBH B;  2E1N A;  3GEZ A;  3PIO F;  5CLS A;  1R36 A;  4CGZ A;  3RKQ A;  3S15 J;  2UWM A;  3KLN A;  3TW7 A;  1MDM B;  3O8H A;  1DGW Y;  5FD5 A;  3K9T A;  3I59 B;  1OR7 A;  1ETY A;  3RCO A;  1JHH A;  2PFB A;  2CMP A;  1KZH A;  2G7U A;  4CA0 A;  2DCE A;  4L9T A;  5F6F A;  2X6X A;  2VON A;  2DPD A;  1S6L A;  1MMN A;  2MH2 A;  4I01 A;  2X51 A;  2QZ8 A;  3QYF A;  2KDO A;  3BTI A;  4P5O A;  1J2X A;  4IPA A;  2DBB A;  1ETX A;  3B02 A;  1S7A A;  4PCQ A;  3IH4 A;  4II3 A;  1KYW A;  4C2M J;  4GXO A;  4XSZ F;  2Z99 A;  1IO2 A;  2Z1D A;  2RAE A;  2LDU A;  3JRH A;  4QPQ A;  2BY2 A;  3IWZ A;  1W4M A;  4F55 A;  2LKP A;  3K69 A;  4HYE A;  2L5Q A;  3K1M A;  4PSW A;  4AD9 A;  3UKG A;  1J75 A;  1HDD C;  1WJE A;  3IAS 2;  2NVQ J;  1OYI A;  1JKQ C;  2KHM A;  3S3M A;  2OBP A;  1HSJ A;  2FNA A;  5EDN A;  4IHV A;  1VND A;  4KNY A;  1TNS A;  1MD0 A;  4U88 A;  2P81 A;  5H20 A;  3W3C A;  4CCK A;  3L7W A;  2HYG D;  1FOY A;  2WY7 Q;  2XVC A;  2EBI A;  4MEY F;  3KZZ A;  2R92 J;  3FXM A;  4HW0 A;  2L7F P;  3CJQ B;  4ITV A;  1VQM I;  4RB1 A;  4DIQ A;  3IRR A;  4C2T A;  4IHW A;  1J59 A;  5DEQ A;  3CUQ B;  1ZG5 A;  2KZV A;  2EFQ A;  2DFH A;  2HQR A;  3KCC A;  5K5O A;  2DT6 A;  2JJ7 A;  2XV4 S;  2EB7 A;  1YW7 A;  4LFU A;  1ZG1 A;  2NVT J;  5J1U A;  4EGZ A;  4ZZL A;  3SZP A;  1B4A A;  2K86 A;  1UB9 A;  1LKX A;  2E36 A;  1LPQ A;  1D0X A;  3GFI A;  1QO0 D;  3OIO A;  3Q0W A;  4KJZ A;  3G71 I;  3CMA I;  1EF4 A;  2K9M A;  3TO7 A;  3LFU A;  3I4N J;  2BY1 A;  1DUX C;  3ESW B;  4N9I A;  1BI1 A;  3ABM H;  2GA1 A;  4NC8 A;  3K4K A;  1JUS A;  2KIF A;  3BJA A;  3OYF A;  5BS6 A;  4ZYH A;  4DYR A;  1G2H A;  4Y17 A;  2HNH A;  1MBF A;  2V9V A;  1BI3 A;  2IS4 A;  1FT9 A;  2BVM A;  1R9T J;  2R93 J;  2FQ4 A;  3C3W A;  1G3Y A;  3TED A;  2VJ5 A;  1U5T C;  2O8K A;  2XPV A;  4RAZ A;  3H0D A;  1K78 B;  1I50 J;  3P5J A;  1YG2 A;  3HOT A;  4HLY A;  2RGV A;  3GCM A;  5DM6 F;  1BA5 A;  3G6E I;  2OZU A;  5E8I A;  4Y3O A;  1TWA J;  3GTQ J;  5DCM B;  2COB A;  3K10 A;  4KIT B;  2L01 A;  3KEY A;  4NHJ A;  3BZC A;  2W00 A;  1N78 A;  2R7Q A;  2DXI A;  2F5D A;  4UXN A;  4HEA 2;  5LHH A;  4A3E J;  3GME A;  3VEP A;  3PQK A;  2ADU A;  3JSO A;  1WZ2 A;  3DBR B;  1SVM A;  2Z9O A;  3KYD B;  4YIF A;  1O7L A;  3HUG A;  4NC6 A;  4BQO A;  4EM0 B;  1BR4 A;  1QGP A;  1WRJ A;  2ZNY A;  5IT3 A;  2QBY A;  4EVI A;  1GDT A;  2K9N A;  2ZXW H;  5LHG A;  3HYI A;  4L9N A;  5H6R A;  1SD5 A;  2V4J C;  1G6N A;  4A3L J;  1SD4 A;  4XM3 A;  2R7S A;  1WFX A;  3GYH X;  4N0B A;  3VYR B;  1HA8 A;  5D5V B;  1FYL A;  1OCP A;  3V7R A;  2NXN B;  3ELK A;  4LLL A;  2K9S A;  1QRY A;  2VIX A;  2K27 A;  4YEJ A;  2E2J J;  2DJN A;  4HX4 A;  4HDV A;  1F9N A;  1YFH A;  4FE4 A;  3CF2 A;  1I1S A;  3FZV A;  3PM1 A;  5HNH A;  1IN6 A;  2HTJ A;  4AM3 A;  3IH2 A;  4O3M A;  2TDX A;  3FDY A;  5IOZ A;  1GVD A;  4QWQ A;  2UXX A;  4LB5 A;  3I53 A;  4ZH4 F;  2QEX I;  1Z3Y A;  2VQH A;  2R7F A;  4A69 C;  1O7F A;  4XOT A;  2Y31 A;  2KRF A;  4Z2Y A;  3DV8 A;  3K70 C;  5HVQ C;  4HF0 A;  2F6C A;  3HOZ J;  4RDU A;  1OCR H;  3VSK A;  2J5P A;  1RPW A;  2VQL A;  3EUA A;  1PUE E;  2ZFW A;  1TP4 A;  1TC3 C;  1RES A;  3NWS A;  2GXG A;  2DJI A;  3OYL A;  2Z2S B;  3CF5 F;  1VQN I;  4HA8 A;  1HC8 A;  2FEZ A;  2FU4 A;  3PNT A;  1U8B A;  2BYV E;  3OOU A;  4ASN A;  2GIZ A;  5B5E C;  1O4X A;  1XGO A;  3ZN1 A;  4F92 B;  3J81 Z;  3CD6 I;  3BR5 A;  1V5F A;  3FXU A;  1S72 I;  1NG7 A;  2O8X A;  2LK2 A;  3D5S C;  3Q3S A;  1U78 A;  4IEJ A;  3FXL A;  1LE8 A;  2D1H A;  4MFE A;  3TOA A;  1KQ0 A;  2L7K A;  2X1D A;  2Q0O A;  4KIB A;  4XOP A;  3ZPL A;  5C4J J;  5BPD A;  2NRA C;  3HDD A; 
#chains in the Genus database with same CATH homology
 1JTY A;  1FIP A;  1IJW C;  4B1R A;  3ZQC A;  4C3J J;  2AHQ A;  2CU7 A;  2EH3 A;  5C44 J;  4FIS A;  2XGD A;  2LLK A;  3GTK J;  4X1E A;  1H8A C;  4LOC A;  5FLM J;  1VFC A;  4I76 A;  1D5Y A;  5M3F J;  3QPL A;  5EZG A;  4A3J J;  3L1P A;  2R5Z A;  2N8G A;  2M34 A;  4AYB N;  1B72 A;  3LSR A;  3ZQI A;  4BBR J;  1JKO C;  2YU9 J;  2R7Z J;  2IAI A;  3BT9 A;  4UUS B;  2HDD A;  4XIC A;  3H0G J;  2K40 A;  5HOD A;  2Y9Z A;  4XRS A;  1JJ8 C;  1ZTR A;  1ZR4 A;  3A03 A;  3S1R J;  1DU0 A;  4MFD A;  1B8I B;  3JRI A;  1YRN A;  2Y9Y A;  5J1R A;  2DA2 A;  4JP0 A;  4CYC A;  4M3B A;  1P7J A;  2LY9 A;  1NK3 P;  3HOY J;  3O8G A;  2CJJ A;  4Y52 J;  9ANT A;  2JA6 J;  1JJ6 C;  2M2E A;  3HOV J;  1UG2 A;  2LR8 A;  1TWH J;  1JKR C;  2VKV A;  4AC0 A;  1ENH A;  1PUF A;  2EZI A;  4QSH A;  1FTT A;  1OCT C;  2JMW A;  1W0T A;  3M4O J;  1SAN A;  3I4M J;  4DYQ A;  4DZP A;  1IRZ A;  4Y7N J;  4W1U A;  3JRE A;  3D1N I;  4L5E A;  1AHD P;  1LFB A;  4HNV A;  1GV5 A;  5K7F A;  3GTO J;  2EZL A;  3BG9 A;  5JLX A;  1NK2 P;  2FD5 A;  3GTG J;  4MIM A;  2CQQ A;  4JX4 A;  2ECC A;  2X9D A;  4W97 A;  2CUE A;  2VI6 A;  1K61 A;  2XB5 A;  2ME0 A;  2H8R A;  2HOA A;  2DA1 A;  2W48 A;  3S17 J;  1H88 C;  3DEW A;  1POG A;  2QF7 A;  1I3Q J;  4M3E A;  4V2G A;  3HOU J;  5FJ8 J;  1WI3 A;  3FIS A;  5E3M A;  3MVP A;  5EYR A;  3H3V K;  2HOS A;  4A3C J;  3E7L A;  4XRS G;  2ECB A;  4UUT A;  5FKN A;  3MKL A;  5EGO B;  3FIW A;  3JRA A;  1MSE C;  1K83 J;  2EZK A;  5IPA A;  1TWC J;  3DCF A;  3ZOB A;  2K9Q A;  2DA5 A;  4C3I J;  1T56 A;  4J19 A;  3BQY A;  3GTP J;  4A3G J;  1SFO J;  1Y1W J;  3BR2 A;  2G0E A;  3GBG A;  5EEA A;  1AKH B;  4M3G A;  3BR1 A;  3MN2 A;  1ZKG A;  1BJZ A;  2E19 A;  1VI0 A;  1HF0 A;  1Q1V A;  4I6Z A;  3S2H J;  4GFB A;  4JX6 A;  1WH5 A;  2JWT A;  2QCO A;  3A01 B;  1ZQ3 P;  4B3A A;  5DS9 A;  1LE8 B;  2MW8 A;  4DYC A;  4A93 J;  3LSG A;  5F08 A;  1ETK A;  3CMY A;  2EQR A;  3BR0 A;  1CQT A;  3BTC A;  1W0U A;  4D5C A;  5IYD J;  5M3M J;  3K2A A;  3S1M J;  4IHY A;  4BXX J;  3SDG A;  3WHC A;  3ZQG A;  1XS9 A;  2LTP A;  2L7Z A;  3G1M A;  2LKX A;  1HDP A;  4BKX A;  2XGC A;  2HYJ A;  5GP9 A;  1RET A;  2DA6 A;  5M5X J;  1FEX A;  2YS9 A;  2H1K A;  2ID6 A;  1HLV A;  2JN6 A;  2WB1 N;  5E3O A;  4DZJ A;  3HM5 A;  1I6H J;  1ORK A;  5C4X J;  2R5Z B;  2E2H J;  2CQX A;  1UMQ A;  3JRC A;  3GTJ J;  1B72 B;  3BG5 A;  1GUU A;  3QQA A;  2Y30 A;  3BG3 A;  1IV6 A;  4JYK A;  5GPC A;  2NS7 A;  2TCT A;  1MBH A;  3CQZ J;  4C3H J;  1MNM C;  1JUP A;  2JA8 J;  2DMQ A;  3OSG A;  1FJL A;  1JGG A;  4FCY A;  1YRN B;  2DMU A;  4A3B J;  1Z77 A;  4XK4 A;  1MBE A;  2OPT A;  5EZH A;  3NAR A;  4CYC B;  4UUS A;  3JRD A;  3PO3 J;  5IP7 J;  3S14 J;  3BTJ A;  3HBL A;  2KDZ A;  5F27 A;  1B8I A;  2D5V A;  1X2M A;  1ZGW A;  3BR3 A;  4M3F A;  4A3M J;  5IP9 J;  4X6A J;  1UHS A;  2M9H A;  3C2B A;  5EG0 A;  5JLW A;  2DTZ A;  5DTD A;  1PUF B;  5IP6 A;  3TP3 A;  3RQI A;  3RKQ A;  3S15 J;  2DA4 A;  3HGY A;  3TW7 A;  5BNG A;  3O8H A;  1Z0X A;  4D7M A;  5C3E J;  1BW6 A;  1MSF C;  1ETY A;  1ZR2 A;  1WH7 A;  1JT0 A;  1MBG A;  2HQ5 A;  5IYB J;  1E3O C;  3K7A J;  3JR9 A;  5E3L A;  2CRG A;  2R5Y A;  2VPR A;  2LD5 A;  1TWG J;  3S1Q J;  3NAU A;  3BTI A;  2L9R A;  3G1L A;  1ETX A;  1A5J A;  1LFU P;  2NOG A;  2AO9 A;  3IH4 A;  3TP0 A;  4C2M J;  3SFI A;  4AUX A;  1Y1V J;  2MG4 A;  2E1O A;  2HXO A;  2LFB A;  2RAE A;  5J3L A;  3BTL A;  3JRH A;  4BY7 J;  2O9L A;  5IOY A;  2ID3 A;  5F1J A;  1QVT A;  1HDD C;  3UKG A;  2VUM J;  2NVQ J;  1JKQ C;  4XID A;  4IHX A;  3HB9 A;  2L7M P;  3JRB A;  1ETQ A;  5EDN A;  4IHV A;  1VND A;  2KT0 A;  3BR6 A;  2P81 A;  3RZO J;  2JA7 J;  4DW6 A;  2DN0 A;  2DA3 A;  5F0H A;  5E3N A;  1JKP C;  2EBI A;  1H89 C;  2R92 J;  2M8G X;  1QPI A;  2L7F P;  3G1O A;  5F04 A;  1F43 A;  2XSD C;  2JA5 J;  4IHW A;  1RKT A;  1AU7 A;  2Y2Z A;  2HI3 A;  2JJ7 A;  5GPA A;  2ME6 A;  3GTL J;  2NVT J;  2L0K A;  5J1U A;  3QPS A;  4A3I J;  1JT6 A;  1MBK A;  2WAQ N;  1IDZ A;  3B6A A;  3M3Y J;  2X48 A;  3BQZ A;  3OIO A;  1QVU A;  3Q0W A;  1GV2 A;  2NVY J;  5EF6 A;  1XG1 A;  4NDL A;  1EF4 A;  1ETW A;  2HXI A;  2WV1 A;  3OSF A;  3TW6 A;  3I4N J;  4G12 A;  2EZH A;  2TRT A;  2PMZ N;  1TWF J;  5F0C A;  4BY1 J;  1FTZ A;  3F0C A;  2GBY A;  1MH3 A;  1IGN A;  1JUS A;  1JUM A;  1FIA A;  2MSY A;  4DYR A;  2O7O A;  1G2H A;  3ZQF A;  3SJM A;  3Q0V A;  5FKK A;  4QTR A;  1MBF A;  4V2F A;  1RKW A;  1BW5 A;  2R93 J;  1WPK A;  1A6I A;  3LSP A;  3RZD J;  2FQ4 A;  1R9T J;  1BL0 A;  3TED A;  4BBS J;  3WHB A;  2O8K A;  2XPV A;  1I50 J;  3HKZ N;  2NVX J;  3GTM J;  2DMN A;  1ZK8 A;  1BA5 A;  2I10 A;  1DU6 A;  1MBJ A;  1TWA J;  3GTQ J;  2COB A;  1RR7 A;  1OJL A;  1JTX A;  5M5W J;  3ZQL A;  2VKE A;  1X2N A;  3FK7 A;  2NS8 A;  3HOX J;  4A3F J;  2DMT A;  5J1Y A;  4A3E J;  3LNQ A;  4D5F A;  3IV5 A;  2Y0S N;  1IC8 A;  5FKL A;  1WCM J;  2HOT A;  2XPW A;  5FKM A;  4MLO A;  1X58 A;  5EG0 B;  2XPU A;  4D7N A;  1HCR A;  1HOM A;  2OF7 A;  4A3D J;  3FKI J;  4M3D A;  3CCY A;  2ELK A;  2YUS A;  4M6V A;  1GDT A;  2K9N A;  1WGX A;  2DMP A;  1U9O A;  2XGE A;  4A3L J;  1VF9 A;  2XRL A;  2XB0 X;  2CUF A;  4FTH A;  2IBD A;  1GT0 C;  1ETO A;  1ITY A;  2R5Y B;  3S16 J;  1OCP A;  1APL C;  2E2I J;  1F36 A;  4XRM A;  2DA7 A;  2LP0 A;  2ZB9 A;  3FK6 A;  3S1N J;  3W6V A;  1S7E A;  2K9S A;  1QRY A;  2X6O A;  3HGG A;  2E2J J;  2DJN A;  4B4C A;  3PO2 J;  2FX0 A;  5FKO A;  4FE4 A;  4S0H B;  3A02 A;  3PM1 A;  2JK3 A;  2MGQ A;  3CDL A;  3IH2 A;  3JRF A;  3VPR A;  5IOZ A;  1IUF A;  3IH3 A;  5K7H A;  1GVD A;  4MO7 A;  2IEK A;  3ZQH A;  1NTC A;  4FE7 A;  2LVS A;  5EGO A;  4A69 C;  5K7Z A;  2FJ1 A;  2Y31 A;  3JRG A;  2R0Q C;  2GLO A;  5FLV A;  3HOZ J;  4RDU A;  5F0F A;  2M0C A;  1RPW A;  1MH4 A;  4RBO A;  1TC3 C;  1OFC X;  1RES A;  1AKH A;  5M5Y J;  3B6C A;  3HEF A;  1U8B A;  1IG7 A;  1T33 A;  3OOU A;  5IYC J;  4EEF G;  1U9N A;  1IDY A;  1O4X A;  3BR5 A;  3LOC A;  2B63 J;  1XC5 A;  3A01 A;  2LK2 A;  4ABZ A;  3Q0U A;  3Q3S A;  1U78 A;  4IEJ A;  1LE8 A;  2GM4 A;  4MFE A;  1P7I A;  4JX5 A;  4A3K J;  4QIW N;  3LSJ A;  3S2D J;  1ETV A;  5C4J J;  3HOW J;  3HDD A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...