1OCPA

Solution structure of oct3 pou-homeodomain
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
67
structure length
67
Chain Sequence
METLVQARKRKRTSIENRVRWSLETMFLKCPKPSLQQITHIANQLGLEKDVVRVWFCNRRQKGKRSS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords OCT-3
publication title Structure of the Oct-3 POU-Homeodomain in Solution, as Determined by Triple Resonance Heteronuclear Multidimensional NMR Spectroscopy
pubmed rcsb
source organism Mus musculus
molecule tags Dna binding protein
total genus 13
structure length 67
sequence length 67
ec nomenclature
pdb deposition date 1995-02-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00046 Homeodomain Homeodomain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.60 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Homeodomain-like 1ocpA00
2AO9A 4AYBN 2CUEA 5J3LA 3LSRA 2D5VA 5IP7J 3HM5A 2R5ZB 1IUFA 1OJLA 2R5ZA 5FKKA 1XG1A 1ETXA 2DA1A 2JWTA 4V2GA 2VI6A 5IOYA 4C3HJ 1MBFA 4W97A 2R7ZJ 1APLC 4DZPA 2EZHA 2HOSA 5F08A 4J19A 1FIAA 4DZJA 2NVTJ 2EH3A 1BA5A 1MNMC 4L5EA 3TW7A 1W0TA 3GTKJ 2PMZN 4ABZA 2LD5A 5E3NA 3LSPA 2OPTA 2YUSA 1A6IA 2TCTA 3JRIA 1ETOA 4A3MJ 1GDTA 3MN2A 5E3OA 3ZQFA 1HF0A 1JTXA 1QPIA 3K7AJ 2R5YA 1RESA 2XGEA 1O4XA 3FK7A 4XK4A 3HGYA 3FIWA 5EZHA 1U9OA 3UKGA 2E19A 4A3IJ 3S14J 1HDPA 5DS9A 3LOCA 5M5YJ 5C4XJ 4GFBA 2H1KA 3W6VA 1QVUA 1ORKA 2CJJA 2LFBA 1AU7A 2E1OA 1TWCJ 2HXIA 3HEFA 2DTZA 1TC3C 3S1QJ 3RZDJ 2X48A 1WH7A 1MSFC 3A03A 3HOXJ 3QQAA 1D5YA 2X9DA 1TWGJ 4UUSB 4UUSA 1IG7A 1U9NA 2NS8A 1FIPA 2YS9A 2GM4A 3NAUA 2JA5J 2DA3A 1H88C 5BNGA 3JRHA 1PUFB 3OSGA 3C2BA 1RKWA 2Y9YA 2M2EA 4BBRJ 3CMYA 5JLXA 1GV5A 4HNVA 5F04A 1IC8A 3GTQJ 4XRMA 3B6AA 3GBGA 3BR3A 5IP6A 2XPWA 1ZR2A 3G1LA 2WAQN 3JRAA 2NVQJ 1ZK8A 2FD5A 1K61A 5IYBJ 2N8GA 4M6VA 2LTPA 2LKXA 5EEAA 5J1UA 1NK3P 2ME0A 2O7OA 4A3KJ 1JTYA 2JA6J 2LP0A 3MVPA 3LSJA 4MLOA 1TWAJ 1JT6A 3Q0UA 3BTCA 4X6AJ 2KDZA 1GT0C 3A02A 2R0QC 3CDLA 2DA6A 3MKLA 1B8IB 2M0CA 1B8IA 3S2HJ 1Z0XA 2Y2ZA 1XS9A 5HODA 2P81A 2H8RA 2M9HA 3BG3A 1GV2A 1MBEA 2EZLA 1RPWA 1T56A 5K7ZA 2VUMJ 2DMTA 9ANTA 4LOCA 2L7ZA 1LE8B 4DW6A 1LE8A 2OF7A 5GP9A 3OIOA 1OCPA 3HDDA 1QRYA 3BT9A 3FISA 5F0FA 1E3OC 1ZKGA 3D1NI 4IHWA 1GUUA 5JLWA 4A3JJ 3PO2J 1ITYA 3WHCA 3ZOBA 4D5FA 5EGOB 1WGXA 5E3MA 5EGOA 1NTCA 1BW6A 2JMWA 3BR1A 3BTLA 2XSDC 1U8BA 1X2NA 2MG4A 4DYRA 5C4JJ 4FISA 3GTGJ 1ZR4A 2G0EA 2KT0A 2NS7A 5FLVA 1F43A 1TWHJ 4CYCB 4CYCA 1SFOJ 4BXXJ 4MFEA 2ECBA 3ZQGA 4JX6A 4BY7J 5IYDJ 2MSYA 2MW8A 2XPVA 1JKQC 2CRGA 5FLMJ 2QF7A 3JRDA 1W0UA 2FQ4A 4A3BJ 4C3IJ 5F27A 3NARA 1G2HA 2ME6A 2HOAA 3LNQA 1QVTA 3BR2A 1IDYA 1JKRC 1S7EA 1YRNB 1FTTA 4QIWN 2HXOA 5EYRA 5GPAA 3FK6A 3HOWJ 3BR5A 5E3LA 2AHQA 2XB0X 2LVSA 4I76A 2W48A 1SANA 1I6HJ 1RKTA 1ZQ3P 1LFUP 1Y1WJ 3IH3A 4UUTA 2XRLA 2COBA 3RKQA 4M3GA 2NOGA 1JUMA 5GPCA 3S17J 4D5CA 1ZGWA 3RZOJ 5IOZA 1IJWC 1HLVA 1DU6A 2HOTA 3K2AA 5IYCJ 1IRZA 5FKNA 4I6ZA 5IPAA 1MH4A 4A93J 2HDDA 3HOUJ 2L7FP 3HKZN 3BTIA 2L9RA 1R9TJ 3TW6A 1PUFA 3SDGA 1Q1VA 1XC5A 1VI0A 2CQQA 4JX5A 3JR9A 5EDNA 4FCYA 3BQYA 1ETQA 3O8GA 1JJ8C 2DA4A 3Q0VA 2K9SA 1T33A 2JK3A 3SFIA 1FEXA 4B4CA 2XB5A 1NK2P 3HGGA 1F36A 1A5JA 5K7FA 2DA5A 1MBHA 4QSHA 1RETA 3RQIA 3ZQIA 2E2JJ 1UMQA 3OSFA 2FJ1A 3DEWA 4MO7A 1AKHB 3PM1A 4RBOA 3M4OJ 1FTZA 5M5WJ 1WH5A 4IHYA 1IV6A 5DTDA 1B72B 1Z77A 1B72A 1ENHA 3S16J 3S1RJ 3G1OA 1Y1VJ 2JA7J 3VPRA 2DMQA 3IV5A 5M3MJ 5F0HA 3S1NJ 4AC0A 3H0GJ 2ID6A 5FKLA 2E2HJ 5EZGA 3JREA 4XRSG 3ZQLA 1RR7A 4FE7A 3L1PA 4M3FA 2MGQA 4M3BA 3TP0A 2DMUA 4FE4A 1BL0A 2ECCA 1WCMJ 3IH2A 4BBSJ 3M3YJ 3GTOJ 2LLKA 1HCRA 2K9NA 1OCTC 4BY1J 3HOVJ 4A3GJ 1VF9A 4BKXA 3BR0A 1JUSA 2ZB9A 2X6OA 4JX4A 2JJ7A 4A69C 3QPSA 3CQZJ 3BTJA 5M3FJ 2NVXJ 1OFCX 3BG9A 4A3FJ 3TEDA 2DMPA 3GTPJ 2R93J 2LK2A 3BR6A 1IGNA 1HDDC 4D7MA 2Y31A 2O9LA 4Y7NJ 3H3VK 2JA8J 3ZQCA 4D7NA 2EQRA 5M5XJ 1MH3A 1IDZA 4XRSA 2L7MP 2LR8A 5C44J 1JGGA 1K83J 3Q3SA 1MBJA 1BJZA 2ID3A 2B63J 2WV1A 3OOUA 1TWFJ 2O8KA 3HOYJ 2XGCA 1H89C 4MIMA 4JP0A 2Y0SN 1YRNA 3A01B 3A01A 2NVYJ 2HQ5A 5F1JA 1U78A 5K7HA 4V2FA 1JKOC 2HYJA 4IEJA 2WB1N 2DA2A 2DMNA 5IP9J 1ETYA 4FTHA 3HBLA 2R5YB 1MSEC 2IAIA 5J1RA 3BG5A 2DA7A 4A3CJ 3S2DJ 3IH4A 3ZQHA 1LFBA 1WPKA 5FJ8J 2JN6A 3JRCA 2CU7A 3GTJJ 3S1MJ 4A3DJ 1POGA 5FKOA 1P7IA 2VPRA 1CQTA 2IEKA 3PO3J 2M8GX 1JUPA 3QPLA 4NDLA 3FKIJ 4QTRA 3TP3A 2DJNA 2VKVA 1UHSA 1I50J 3E7LA 3JRBA 3B6CA 2CUFA 5C3EJ 5EF6A 1HOMA 1JJ6C 4B3AA 1AHDP 1UG2A 2HI3A 5J1YA 4A3EJ 3O8HA 1AKHA 2XPUA 4AUXA 1WI3A 2GBYA 1ETKA 1ETVA 4MFDA 4IHVA 3HOZJ 4X1EA 3JRGA 1X58A 3SJMA 4A3LJ 3CCYA 1I3QJ 2LY9A 2XGDA 1ZTRA 2EZKA 2Y9ZA 2QCOA 1DU0A 3JRFA 2E2IJ 3DCFA 4C2MJ 2GLOA 3I4MJ 1JKPC 2I10A 4W1UA 1GVDA 1P7JA 1ETWA 3Q0WA 4M3DA 4B1RA 3LSGA 3I4NJ 2TRTA 3BQZA 3F0CA 4DYQA 5EG0B 5EG0A 1FJLA 5FKMA 3S15J 3WHBA 1VNDA 2DN0A 1VFCA 1X2MA 1BW5A 1H8AC 4Y52J 2CQXA 4XICA 2EZIA 4EEFG 4RDUA 2YU9J 2K40A 2Y30A 4JYKA 4S0HB 3GTLJ 3HB9A 2L0KA 2M34A 5F0CA 2EBIA 2R92J 2FX0A 1MBGA 4DYCA 2VKEA 3GTMJ 2RAEA 1MBKA 4IHXA 1EF4A 2K9QA 4C3JJ 4M3EA 2IBDA 1JT0A 3G1MA 4XIDA 2ELKA 4G12A
chains in the Genus database with same CATH superfamily
1ZRCA 4AYBN 2OJED 3VFZA 2R5ZB 2UUZA 2QSHX 3VODA 2VI6A 3Q9SA 2IJLA 4B48A 2M4GA 4ZZLA 3BG6A 3R6SA 3BP8A 3HUGB 2GIVA 2VBWA 2IRFG 1T0FA 4IOCF 1J59A 4CCNA 2NS0A 4L9TA 3M9AA 2HKXA 4KYWA 3FXUA 4M72A 3LA7A 3BZ6A 3B73A 3TW7A 1P9QC 1ON2A 2GA2A 4EM2A 1FOXA 2AQFA 2LY2A 2PMZN 4AYBA 3E6MA 4E7HA 1RUOA 3LSPA 2OPTA 1O3TA 3KZYA 3JRIA 1YX5A 4DGWB 1P4XA 3VOEA 4PFOA 3BJOA 2XAUA 4CUGA 1WZ2A 1LDDA 3GFMA 2EFOA 2RN7A 2R5YA 2NNYA 1XTAA 1Z7LA 2P5KA 3HGYA 5EZHA 2VT2A 3TMOA 2E19A 2M7AA 2I5UA 3VEPA 2KFDA 3LA3A 2QM3A 3F8FA 1HDPA 4QWQA 4CXFA 4KFCA 1DP7P 2HVQA 3ABKH 5J40A 4M73A 5C4XJ 3T0YA 2H1KA 5ILVA 3W2WA 1QVUA 3KP5A 2WB1A 2E1OA 2A07F 4IX7A 2HXIA 3WTUC 4AD9A 5B1BH 1G3WA 1R1VA 4GYIA 2BY0A 1N77A 1BR1A 1OR7C 2FE3A 4HRIA 1HBXG 2X9DA 5KHDA 4UUSA 2F5DA 5LHIA 2GM4A 1X3UA 1FLIA 1H88C 2KKOA 2YPRA 3D0SA 3C2BA 3CUOA 1OYWA 2Y9YA 4LB5A 2ZSIB 4BBRJ 3CMYA 2JQ7A 2O0YA 5JLXA 1XSXA 1WQ2A 2P7VB 4ZH4F 5F04A 3GTQJ 5J8FA 4XRMA 3GX4X 1PP8F 2IA1A 4KIBA 1ZR2A 2IVMA 2HYGD 4GXOA 2WAQN 2WA0A 1R4MB 1ZK8A 1K61A 5IYBJ 1HSTA 3OMYA 4IRGA 2H09A 2BVMA 2QUFA 2ZJ2A 3HXLA 2D1HA 3ZMVA 4DBRA 4DQ2A 3J81Z 2LKXA 5J1UA 2FEZA 2O7OA 1MJBA 2JA6J 2KZVA 4WX9A 4MLOA 2Z5UA 2R7TA 2E60A 2BOLA 3BJAA 4CHUA 1J7KA 2KDZA 1BC8C 3NRVA 2DT6A 2P6TA 2L9VA 3A02A 3M7GA 2R0QC 1R1UA 1MJ9A 1J0RA 2E5ZA 1LDKB 1D1CA 1WWXA 5FB2A 3HJEA 2H8RA 3RTRA 2WAQA 3BG3A 2OCEA 2VQGA 3CLQA 2VUMJ 1BJAA 4FETA 4LOCA 1LE8B 4LITA 4C2TA 2K27A 3VYTB 3DPLC 5GP9A 3N97A 1OCPA 3T8TA 1BN5A 5F0FA 2R7SA 3RQ4A 1ITYA 4LK1F 3ZOBA 1WGXA 3IC7A 3GVAA 2KL4A 4JK1X 3BTLA 3CUQC 2XSDC 5EJCA 5C4JJ 1LUJB 4LMYA 4P55A 3TO9A 1F1ZA 4HSRA 4ENKA 4Q48A 5HS8A 4AIDA 1MMGA 2MD5A 3WGGA 1F43A 1WI9A 3K4BA 3DQVC 1SFOJ 4UVCA 1Y56A 3N05A 1PUEE 5JHFA 4F3QA 4XNFA 2ECBA 3ZQGA 4RLQA 4ESBA 1LNWA 3GZ6A 3RYRA 3MWMA 4YIIA 3SYTA 3ABUA 1R4NB 2K9LA 1ZGJA 3ECHA 5FLMJ 2QF7A 3RIRA 3QODA 1W0UA 2PJRB 3HC7A 4QPQA 3NARA 2QBYB 3J81K 4G7HF 5DCMA 1QQIA 2HGCA 3I56I 4ZYGA 4HQEA 2X0LA 1MDMA 3ZN0A 5GADJ 1XSDA 3OYMA 3CMAI 1FP1D 3E0JB 4YFNF 1VQ5I 1JHFA 3F8CA 1WVRA 5H20A 1ZAOA 3RKXA 2P8TA 3WTSC 2A6HF 2VOPA 3CO6C 5F6FA 3HOWJ 2OV7A 1LVAA 5E1ZB 2LVSA 2Y0MA 3FM3A 1RKTA 2B9SA 3WG7H 1K79A 1Y1WJ 1R00A 2MLGA 3RKQA 3HG9A 4G6TB 3OYDA 2E36A 3HSEA 1V5FA 2J5PA 4D5CA 1HLVA 2YX4A 3FXRA 4D0PA 5IYCJ 2OCCH 2M5WA 3WU1B 3AG4H 4LG0A 1MH4A 4YIFA 4PSXA 1J75A 4A93J 4YFXF 3K4JA 5D5WB 5JHUA 1R9TJ 1IXCA 3TW6A 3D5RC 2X4HA 4PFPA 4QLCU 4IL6C 1Q1VA 1VI0A 5L3CA 2EV5A 1KQ8A 2VQCA 3BQYA 2CQ7A 2CW8A 2ZNYA 1JJ8C 2DA4A 2HNHA 2JK3A 4RB1A 1LB2A 4IHSA 3DU6A 1NK2P 2OQRA 1X1BA 1F36A 3HTSB 1A5JA 3CUQB 1MBHA 4IXAA 4RB3C 3H3ZA 2DQLA 1J5YA 4MO7A 2ZMEA 2H27A 1DPRA 1RZ4A 1SAUA 3PM1A 3M4OJ 3JSPA 4P9FA 2PJPA 3ONQA 1NG7A 2XF5A 2LH9A 2V1NA 1IV6A 5DTDA 1YFHA 1B72B 1Z77A 3S1RJ 1N78A 3K70C 3S3NA 1ONVA 2QZ8A 1X3ZB 3FDYA 3S1NJ 5KK1A 3H0GJ 1T39A 3H0DA 2ZSHB 2BVLA 3ZQQA 3ZQLA 3LFUA 1EJ9A 3CLOA 2F4MB 2UZKA 3KP3A 3H5AA 4MGRA 4M3FA 4M71A 3IRQA 3F8BA 1WJBA 2IA0A 3KP4A 5E17F 2DMUA 2DDBA 3A0BC 2QKMB 1WCMJ 4EJUA 2XAHA 4BBSJ 4UNOA 2L02A 2VT3A 1W7PA 3F72A 3OV8A 1B59A 1BI2A 3GTOJ 3DV8A 3CCUI 5FROA 1Z67A 1FBQA 3F8NA 4KT6A 3ROUA 1UFMA 3KE2A 4UY8I 5D8LB 2BY3A 2L9NA 2FF4A 3CO7C 2ACJA 5TJJA 2LKPA 3VSLA 1HW2A 4AM3A 2JJ7A 2VE8A 4A69C 1SEUA 2FRHA 1OCRH 3QPSA 4XN0A 2V9PA 3BCAA 3BTJA 4LJZF 1OCCH 3RCOA 3U21A 2IGOA 5GAGJ 4HX4A 4PJ0C 1XMKA 4BYYA 4R79A 3BG9A 2JTVA 5FD6A 3OYCA 4A3FJ 1XGMA 1XB4A 4M6YA 4M74A 1IGNA 4Q47A 1HDDC 2Y69H 3L2CA 2O9LA 2E71A 2IS6A 4WF2A 4D7NA 2X6XA 3QOEA 3ZQ7A 2PLYA 4RLFA 3GFJA 4YELA 2J5OA 3DFGA 1GXQA 2ZC2A 5DV5A 2VQLA 4AIHA 5H6RA 4ZTJA 3OL3A 1JGGA 3QOPA 1BI1A 2A05A 1A36A 2IS4A 4R8HA 3JAMZ 3D5SC 2V4JC 1Y6IA 1UELB 3WE3A 3ISPA 2HQ5A 3D5LA 4V2FA 5FLXZ 3KPHA 1JKOC 2VB6A 4PJJA 2AXTC 1FMWA 5HS7A 2CH0A 3QP5A 4BQAA 1ETYA 2JPBA 4ETSA 1FP2A 4FTHA 1I1SA 1TT5B 1TTYA 3H9JA 3UNGC 5DDGA 2QQBA 2K86A 1PJRA 2R5YB 2FXAA 2WBMA 3OIPA 4ZTFA 4I99C 2F2EA 5E1WA 3ZMDA 4KNYA 1U5TC 3S2DJ 1LFBA 3W6JB 5KAIC 5FJ8J 3JRCA 5CVJA 4UHTA 5D8KB 1POGA 1GXPA 5E20A 3CMEI 3MFKA 1P7IA 1R58A 4HOBA 2M8GX 4EATA 3BDDA 4FHTA 5CJ9A 4PGHA 1MMNA 1W5CC 3TP3A 4LK0F 2Z2SB 2DJNA 3VYSB 1BC7C 1SVLA 1WJAA 2MFZA 3LL7A 4D9JA 4HX7A 2MA3A 4BH9A 1JXSA 2KRHA 2FOKA 2GIZA 3B6CA 3SZPA 2CUFA 2DPUA 1WJCA 2H6CA 1RUNA 1JJ6C 4B3AA 3IWFA 4HG2A 5K5RA 5JVTA 1X4PA 3ZGKA 3J80K 4WXCA 1SMTA 2GBYA 1ETKA 3CF2A 3E5QA 1VQKI 3MEXA 4CH7A 3JRGA 3SJMA 4O5VA 2GZWA 3O6BB 3F8MA 2KMUA 3TDUC 2EZKA 3AL0C 3I58A 3BLYA 2OBPA 3EUHC 2E2IJ 4C2MJ 2XRNA 1T95A 2EFNA 1N25A 4LIUA 4A0ZA 1QBJA 3CF5F 1Y8QB 3GFLA 2A5WA 1W1WE 5FLXK 3CZ6A 1NHAA 1R71A 3WHBA 2XHKA 1BW5A 5LGNA 1H8AC 4XICA 2HQNA 4LD5A 4JYKA 2M34A 4BAYA 3KIOA 4DYCA 2K3PA 4CA0A 3GTMJ 2RAEA 1PYVA 5HDNA 2K9QA 2DOEA 4NQWB 3OYEA 4PZJA 2WADA 2IBDA 4NB5A 4XIDA 3JRDA 2ZBKA 2ELKA 3RI4A 1I3QJ 3KYDB 2AO9A 2XF6A 2CUEA 1U5TB 2D5VA 4UV9A 2HVRA 1OYYA 1Y39A 1IUFA 1W7PD 2Z33A 2DU9A 4HDVA 4L0YB 2DA1A 2LMDA 3ZCOA 1R49A 1O7FA 5ICCA 5DUIA 1ZN2A 3G4SI 3VYUB 2NYXA 2ZMEC 3R60A 4W97A 1KYZA 2DQRA 2R7WA 4DZPA 2V26A 2EZHA 1X1CA 4KMUX 1MGTA 3BG7A 2CUJA 4IZZA 4FT8A 2LBFB 2W7NA 2NVTJ 2EH3A 2XAQA 2ZXWH 1BA5A 4RGRA 3MQ0A 3P9KA 1W0TA 4EJOA 3QPHA 1S3JA 3VYRB 4U0YA 5BMZA 4HF2A 3GUDA 4A3MJ 1GDTA 2QYOA 4RAFA 2HDCA 1BR4A 1ZH5A 2JVGA 2LC2A 3ZQFA 2IA2A 2OA4A 1HF0A 5D6FA 1JTXA 3M07A 3ZMTA 4BQQA 1QPIA 1U3EM 1GVJA 5K1YA 1O3RA 1RESA 1HKTA 3FK7A 1MDMB 4XK4A 3QU3A 3JTHA 1MMSA 3UKGA 3F6VA 4KT5C 5D5UB 4A3IJ 3AL0B 1WJ5A 3S14J 1V54H 3C2GA 3EETA 1MZBA 1TZLA 2Y0SA 4HQMA 3N4MA 3RKYA 3VWBA 4GFBA 3W6VA 2VN2A 3S3MA 1IF1A 3TGNA 1H0MA 1TC3C 2QGUA 1GHCA 5A2QZ 3L2RA 2X48A 1WH7A 1MSFC 2NXNB 4WK8F 3CCLI 3A03A 4LG3A 3NEUA 2JPCA 1KU7A 1IG7A 1Y0NA 2EA4A 2G9WA 2NS8A 5DM6F 2YS9A 4KN4X 2JA5J 2DA3A 4P9UA 5BNGA 2YR2A 3PSFA 5ILUA 1RKWA 3I5UA 1NG6A 3FWEA 1IC8A 2NAZA 2XPWA 3DBHB 4WCGA 2CV1A 4GCVA 1HW1A 1FBSA 4U0VA 4L9VA 2NVQJ 2LSOA 2FD5A 1EA3A 1IN7A 1SD6A 5HLHA 4RMNA 2HZDA 2KIUA 2VKHA 5EEAA 2ZJRF 5FD5A 1SMYF 3T8RA 2ZMEB 2DO7A 1JTYA 4D1QA 3MVPA 3LSJA 3CC4I 2JRTA 2JVHA 3IAM2 5LHGA 4IO9F 2K3FA 4OIPF 1STZA 2Q2EA 3EUAA 3CDLA 2VL8A 1R23A 2VC0A 3CJTB 1B8IA 2VQHA 1O7LA 3PIOF 1SFKA 1KU9A 2DTRA 3W2AA 5L3DA 2D45A 2NNNA 4QPOA 1B9NA 2MH9A 4DW6A 2DJIA 3WODF 2BXYA 3DPTA 1KONA 3HDDA 1BR2A 4AIJA 1E3OC 2R7FA 4IHWA 1ZKGA 4A3JJ 2MC3A 3WHCA 5J8CA 3FXKA 5EGOA 3FBIB 3ZRGA 1NTCA 3M8FA 4NUBA 3FMQA 1MKMA 4G6DA 2JMWA 3BR1A 3RKWA 5A2QK 1U8BA 1X2NA 3M1CA 3ZMZA 2V1DA 3V8KA 3WTVC 1ZR4A 2KT0A 1IN6A 4HX8A 3TDZC 4CYCB 1MJAA 1HA8A 3A4CA 4IRHA 1Z21A 2VJJA 3HTUA 2W24A 4JX6A 4BY7J 3GXOA 3TO6A 5IYDJ 4BE1A 1JKQC 2Z9OA 4IJAA 1VTNC 4A3BJ 1YX3A 3H36A 1EH8A 5F27A 2G7HA 3F21A 1VQ9I 2VODA 1XGSA 3CESA 2YU3A 2ME6A 3FKJA 2HVSA 3KETA 2W82A 3FZVA 3WGHA 3RJPA 1IDYA 3BCBA 1S7EA 4L9NA 1KZHA 1TQIA 2L4AA 1FTTA 2FNPA 4QIWN 2XIGA 5EYRA 4ZYAA 4Y13A 2CWEA 3BR5A 4XOPA 5E3LA 1JI8A 4MQVA 2AHQA 2PMZA 3EPZA 4I76A 4IQ4A 2QVOA 1I6HJ 3CDIA 1ZQ3P 3EQLF 4BDYA 2XRLA 2ZCWA 2COBA 1RC9A 2NOGA 3LQQA 3P9IA 1JUMA 3EYIA 3OYNA 1W5SA 4HSTA 3E97A 1IJWC 2JA2A 3K2AA 4I6ZA 2PEXA 2D1VA 4IHTA 1YS7A 2BE5F 2IGMA 1MIJA 3L00A 2QENA 1YQAA 3BTIA 3LSKA 4M6XA 1LEBA 4ZDPA 4J00A 1XD7A 2CQQA 3MD2A 4BXFA 4FCYA 3KZIC 3ZR8X 3TOBA 3PSIA 4OOIA 1E17A 3IP4B 4UB6C 1TL8A 2K9SA 2DT7B 1ZYRF 3R0JA 2IT0A 2F4OB 3SZTA 1T2KA 3G6EI 1FYLA 5E8GA 2DPDA 1ZG5A 2FJ1A 5DUKA 2A6TA 3DEWA 4RBOA 3PNVA 4BJ6C 4HV6A 5M5WJ 1WH5A 3DF8A 1IUYA 4MEXF 3C1DA 4PDKA 4F7ZA 2WC2A 3CCMI 1CGPA 1ENHA 2L9SA 4L5JA 3SXYA 2O3FA 4MEYF 4XKBA 2UWMA 3OR2C 2DMQA 3IWZA 1G59A 2Q0OA 5F0HA 5M3MJ 3BPVA 4HDUA 3ECOA 4F91B 4K2EA 4XRSG 3JTGA 5D4SA 5D5VB 3CP8A 1PVEA 1R1TA 3SHFA 1S6LA 3DBLB 2B7EA 4LLNA 2DOAA 3LAJA 3MZYA 3HRSA 4J01A 3GZNB 2XAJA 2MBFA 4PSWA 2ECCA 2DDAA 5D5XB 2HEOA 1TBXA 2EWNA 3M3YJ 2X1EA 3H1CA 5E8IA 3OYFA 3OWTA 1XGOA 3H3UA 2E7XA 4BY1J 1RNLA 3AG3H 1IXSB 4A6DA 2STWA 1VF9A 2RC4A 5GTIC 3MKYB 3BR0A 5LBQA 1JUSA 2ZB9A 1U2WA 1USTA 1X19A 4DIQA 4XLPF 1XDUA 4JX4A 2RDPA 1TW3A 1FWZA 3IUOA 1LKXA 3AG2H 3ERMA 4L0ZB 5M3FJ 3GMEA 3DP7A 2C6YA 3GFIA 3TEDA 1UG0A 1YE9A 2GQQA 3CCJI 1RIOH 3CCQI 4ESJA 1YIJI 2ISZA 4ZZDA 5HNFA 2EA2A 5ICGA 4F55A 2EQRA 1KQ9A 5M5XJ 1MH3A 4XM3A 1USSA 2KHMA 4HYEA 2L7MP 2LNBA 3DLAA 5C44J 1XCBA 5J4YA 2OC6A 3DBRB 5HDGA 3E3VA 1BJZA 2RQPA 4PJMA 2B63J 2L7KA 5K5OA 4MIMA 2JRMA 4G8XA 1JHHA 1P4AA 3I64A 5IY5H 2A61A 2PI0A 1YRNA 3T1BA 3A01A 5B5EC 5F1JA 3OYKA 1U6GA 3IRRA 2M0MA 4XL9A 4II2A 2IS1A 2K9MA 3GW2A 1A04A 3FMSA 3LSIA 1BM9A 3HYIA 2KIMA 3F6OA 2GOMA 1MSEC 1BOBA 2IAIA 1RI7A 4L18B 1J09A 2DA7A 4B43A 2D2WA 1WRJA 1WPKA 1SVOA 2Y75A 3RYPA 2VJ4A 3GF2A 1OYIA 4BJTA 4PK4A 1TP4A 3WU2C 2E34A 5FKOA 4WXDA 2CV2A 3HOTA 1T0FC 3CDHA 4X0GA 1B1BA 1JUPA 3SQNA 3K69A 2IGKA 4UB8C 2GA1A 4RB2C 2AS5F 1OCZH 4XLCA 4XRFA 3HSFA 1S7OA 2NVUB 2DI3A 1I1GA 1UHSA 4KUMA 5L3GA 2IPQX 3JRBA 3PL8A 1W36D 2L01A 2RQQA 5FRNA 5C3EJ 1HOMA 4MHGA 3KX2A 1XN7A 4A3EJ 2HI3A 4EV0A 3O8HA 3AG1H 1AKHA 2XPUA 3G71I 2X6YA 4Q5SF 4ENNA 3OY9A 4MFDA 4IHVA 3HOZJ 3R61A 2Z1DA 2CFOA 3JW4A 3I55I 1S8NA 1H9TA 1W5TA 2K02A 2ZFUA 5TISC 2EB7A 2DFHA 5ILSA 4UV8A 1EH6A 1DU0A 4OAYA 4ZYDA 3I4MJ 3SFZA 1JKPC 2H1LA 1GVDA 1DPUA 2EJRA 3Q0WA 4ON0A 3I4NJ 4KN7X 1Z3XA 4WXHA 2PMHA 5EG0A 3E6BA 5GAEJ 3CCRI 3OYAA 2Q2EB 1VNDA 1X2MA 2BGCA 3ABTA 3VSKA 1O3SA 3QYFA 3W3CA 3CCVI 3L09A 2DODA 2CS3A 1K78A 2BW3B 2RNGA 2X6WA 4XQFA 2FUG2 2EZIA 2YU9J 2K40A 3CD6I 2M3AA 4PUSA 4B09A 1TNTA 2L0KA 3HB9A 3KP2A 4ZDOA 5F0CA 2EBIA 2CGPA 1MBGA 2PN6A 2BY1A 2W25A 3E5UA 1MBKA 1OMIA 3C7JA 4I01A 4R1HA 1EF4A 4RAYA 3F22A 4M3EA 2CW0F 1BIBA 3TBIA 1JT0A 1VQLI 1DGRM 2QSFX 4G12A 4E6KG 5IP7J 3F23A 2R5ZA 2LF8A 1XG1A 2JWTA 5ED4A 1S7AA 1BOAA 4C3HJ 3OYHA 2R7ZJ 2WY8Q 3KLNA 4OIOF 2WV0A 4KJZA 5F08A 3ESWB 1EH7A 1XGNA 2RV8A 5LEKA 4BE2A 1ZARA 4ZC3A 1UJ8A 4N4OB 1B9MA 4J19A 1FIAA 1A31A 2X51A 1R36A 1K4SA 2F4IA 2P4WA 4ABZA 2O61A 3I71A 2B0LA 2L2OA 2YUSA 3ML6A 3CC2I 1BBYA 1SAXA 3M1EA 1JE8A 2WAEA 3UR3C 5JFRA 1FC3A 2L4MA 4EJVA 3FM5A 1Z9CA 1UZCA 2VXDA 3K7AJ 4HV5A 2QQAA 3FIWA 4BHPA 1U9OA 1XDSA 4E7LA 2KIQA 3K4CA 4Y3OA 2FSWA 1XPXA 1IZ1A 4GGGA 2E1CA 3ZMSA 4EM0B 1LFPA 2CJJA 1ORKA 2LFBA 2WTEA 3LFKA 4A5MA 1AU7A 5HS9A 4XLNF 3JSOA 1V55H 3NWSA 1XMAA 3S1QJ 3RPUD 3RZDJ 3HPGA 2V79A 3HOXJ 3QQAA 4KICA 3TL4X 3RPQA 1J9IA 4UUSB 3BWGA 3K10A 1U9NA 1V3FA 1FIPA 2R7VA 3NAUA 5L3EA 4BS9A 5L3BA 4FQGA 3JRHA 3DKYA 2VJ5A 4FX4A 4KIGA 3ZP5A 2M2EA 3L9FA 4ENJA 2ICWG 2PG4A 3DXJF 3HHHA 4NBQA 4HNVA 2KRFA 1R5HA 3B6AA 2PFBA 2LRDA 2VC1A 5GAHJ 2R4GA 1HW5A 4G94A 4Y15A 3DWLE 3JRAA 2N8GA 5HDKA 2CO5A 2LTPA 4ESFA 2BEOA 3JAMK 1H9GA 1GLNA 2A68F 2VOOA 1NK3P 3V7CA 4MNUA 4OAZA 2A5YB 1CF7A 4EVIA 2LP0A 4A5NA 1HKSA 1TWAJ 1D0ZA 2GOXB 2HDWA 3DEEA 3BTCA 2W57A 4X6AJ 4GDFA 2CFXA 4HF1A 2W00A 3FXQA 2DA6A 5CVVA 2XVCA 3K6GA 3QU6A 4S05A 3S2HJ 2Y2ZA 1I3AA 4GYGA 2P81A 1Z3YA 3LWFA 2EK5A 2M9HA 1GV2A 3FXOA 3KP7A 3DEUA 1T56A 4XSZF 2MH2A 3H5RA 1V5GA 2DMTA 5K7ZA 9ANTA 1SFEA 2KJBA 3DLLF 4OIRF 1LE8A 4ITVA 3LMMA 4JQFA 1YIOA 3OIOA 2DOFA 4XN3A 4LGWA 3BT9A 2ZFWA 1FBUA 1E3HA 1Z91A 1GUUA 2BZTA 2ZXHA 3PO2J 3PNTA 4PCQA 1QA6A 1YG2A 3I3LA 3FXJA 1BW6A 4N0BA 3A0HC 1E3PA 3NWTA 4I09A 1U0JA 4DYRA 2M30A 2XGXA 5KAFC 3DTEA 3RSNA 1QZYA 4H4KC 2V9KA 3GTGJ 2NS7A 3I4PA 5FLVA 2ZXJA 3WE2A 2P0WA 4HZFA 2CSOA 4BXXJ 1BI0A 5KNLA 3KFWX 5DEQA 4HEA2 2MW8A 4F92B 3RDIA 5EEGA 1OR7A 3SZGA 3J7AY 5CQEA 2CRGA 2P7CB 2FQ4A 2JSCA 1L0OC 3U1KA 3L2WA 1X3WB 2QBYA 1DDNA 1G2HA 5DCMB 2CQNA 3HZJA 2JUGA 2QLZA 1QVTA 3K9TA 3BR2A 4BEHA 4F93B 4XMYA 1FNNA 1Y0UA 3LSHA 4L5IA 3WTYC 1ON1A 1YRNB 1S29A 3FXMA 4KIFA 5CVIA 2V7FA 2HXOA 2QSGX 3V7SA 1D5VA 3MCZA 2FBIA 3GLXA 2CW7A 2XB0X 4XSXF 4OIQF 3K4LA 2GXBA 2HU9A 2K5CA 3HIFA 2MABA 1I27A 3IH3A 2M7BA 1MMDA 2XASA 4CYDA 2F5FA 4N4NB 1DU6A 1IV8A 2HOTA 2KPMA 1F5TA 5DD8A 1IRZA 5FKNA 4F52A 2GXGA 1LQ1A 4LG0B 4B8XA 1KGSA 4CCMA 1AA7A 4M9ZA 2L7FP 3HKZN 3DTKA 5LEJA 3BOQA 1YS6A 1PUFA 1QNTA 2DBBA 3AKZA 2Q8KA 4JX5A 5J6XA 3DPUA 5EDNA 1K4TA 5CQGA 1XMXA 5H6QA 4RGSA 3OYBA 3O8GA 3AAFA 2HZTA 1WSUA 1V5EA 3E6CC 3Q0VA 5KCMA 4I2OA 3ULQB 1FEXA 3M8EA 3QYBA 4B4CA 2FBKA 2XB5A 3MZHA 2DA5A 2X1DA 3CUQA 4IF4A 4HNUA 3HPHA 1MW7A 4AIKA 4QSHA 1RETA 3RQIA 2BV6A 3ELKA 1UMQA 4EJWA 3REOA 1FX7A 3CCEI 1AKHB 3WTWC 1DGWY 5DM7F 2FMLA 4BACA 1LVKA 4O3MA 1B72A 3S16J 2PX9A 4OWRB 3G1OA 1WHUA 2K7LA 3MKZA 2OTLI 3VPRA 1YI2I 1LJ9A 4AC0A 1D3YA 3HRTA 2E2HJ 5JR3A 1RR7A 3JCUC 4FE7A 1YJWI 2R7DA 3SEZA 2NOJB 4RM2A 3QRFF 1C0WA 4XBFA 4IOAF 1HSJA 4IQJA 2HPIA 4IRIA 1ZGAA 3P5JA 3ZN1A 2MGQA 3TO7A 3QPTA 3S2WA 3TP0A 4FE4A 1RRJA 3IH2A 2NRAC 1W7PB 2QQ9A 3DKWA 2KQRA 3K4NA 1FZPB 1BIAA 2VKDA 4IPAA 1HCRA 3CMMA 3WGIA 3E6DA 1S5LC 2R7RA 2K9NA 1OCTC 2HOEA 3BJ6A 2Z16A 3PUFA 3IL2A 5B1AH 4BKXA 5IT9Z 1IN8A 2QQ8A 4Z2YA 3FMRA 5AIQA 2DLLA 2H6BA 1SC7A 2HKOA 2K4BA 4BE0A 1FOKA 5ICFA 1OFCX 1YTYA 2V1XA 1B4AA 3GTPJ 2DMPA 1HC8A 2L54A 1F9NA 2LK2A 3BR6A 1V4RA 4CCLA 1TW2A 2FNAA 4D7MA 3ASNH 2P6SA 4Y7NJ 1SFUA 2M87A 3ZQCA 2JA8J 3H3VK 1G6NA 3LQRA 1IDZA 3MMYB 4H0EA 2CUZA 1X1AA 4XRSA 1G3TA 1P6RA 1FSEA 1T98A 1K83J 2FU4A 3Q3SA 1MBJA 1X1PA 4ZYHA 2M4KA 1B6AA 2ID3A 3OS0A 3OOUA 2BHYA 1LPQA 1L3LA 2ADUA 1QHHD 2QA4I 1KA8A 2XGCA 4U88A 4A6EA 3HOYJ 1H89C 3VB2A 4B47A 3U2RA 5HNHA 3U1DA 5K5QA 1WKMA 3L7WA 1YJ9I 5HOOA 4E7SA 3OS2A 1IN4A 1ZRFA 1TLHB 1X1DA 1QZEA 4ZDLA 1OPCA 2EV6A 5FGMA 2WB1N 1D1BA 2DA2A 5GTHC 4P1WA 5IP9J 1LDJA 2XV4S 2CMPA 2GWRA 4RGUA 5ERIA 5CYVA 2HFHA 3HBLA 4KDPA 2IW5A 4E7KA 1SD7A 2AQEA 2I8DA 1HXDA 1LEAA 1UHWA 5J1RA 2VE9A 5BS6A 1K6YA 5JVGF 4A3CJ 3K2ZA 2KP6A 2FOWA 2E1MC 2JN6A 2Z99A 5HLTA 1FYMA 2XC7A 2CU7A 3GTJJ 2LDUA 4O6JA 3FF5A 4HBLA 4A3DJ 3GWZA 3H9GA 1N75A 3OS1A 3TOAA 4Y4RA 1CQTA 2OU2A 1P2FA 3PO3J 3J7AO 5HLGA 2OUMA 3QYEA 5BPDA 1TQPA 2XROA 5IT9K 5B3SH 4QTRA 2YSRA 2R3SA 2ZJQF 2F6CA 1D1AA 3GCMA 3H35A 3P7NA 3H92A 4B3XA 2RVCA 4RS8A 4HPQA 1I50J 3E7LA 3FXLA 4MTEA 3L2VA 3A1YA 3QAHA 5FO5A 1IN5A 2DAOA 2VBYA 1S9HA 4Q4ZF 5EF6A 2UV1A 3U9GA 1HKQA 1AHDP 1UG2A 3ZMUA 5J1YA 1ZREA 2GXAA 1ZG1A 4AUXA 3OYIA 1WI3A 5D6EA 2WAFA 2O5RA 1K6OA 1AWCA 3C18A 2M8EA 1ETVA 1WFXA 3I59A 2UXXA 4X1EA 2R7UA 1X58A 1ZG3A 4WWCA 4V19K 2Y48A 2F48A 4U7BA 2XGDA 4I98B 1ZTRA 3BY6A 3R0AA 2PMUA 2QCOA 1KQ0A 2GLOA 5E18F 5E1XA 4ANJA 1CF7B 4EMSA 1VQ4I 3OL4A 1ETWA 3COAC 1PP7U 2W4SA 4B1RA 4XLFA 3B02A 3BQZA 2LY1A 3F0CA 4DYQA 1FJLA 3BROA 5FKMA 3GEZA 2WWYA 3W2VA 4P5OA 4CDGA 2LF7A 2LKSA 3DTIA 3E5XA 2O6GE 2KRCA 2HYFA 4E7JA 1OLTA 2V6CA 5JI6A 3KZZA 2Y30A 4FASD 5E79C 2F5VA 2L5QA 4HNTA 4G7ZF 5J47A 1TT0A 1Z6RA 2FX0A 2ZNZA 2VKEA 2HWVA 3S8PA 4IHXA 1DP3A 4BNCA 4NQWA 4XKWA 4C3JJ 1YW8A 2HQRA 4ZJZA 4KMFA 3G1MA 5EEHA 1ACIA 4G7OF 5J3LA 3LSRA 1U5TA 4PJNA 3CJQB 3HM5A 1OJLA 5FKKA 4BDZA 1ETXA 2E1MB 3OR1C 2KIFA 4V2GA 4XOTA 2A6EF 1Y8RB 5F64A 2V9VA 2E5NA 3C2HA 4C9YA 5IOYA 1MBFA 1ZLKA 1Z1DA 2STTA 2V1UA 1YW7A 4CCOA 4ZYEA 1APLC 1YJNI 2HOSA 2ZKZA 2BYVE 2LBFA 4XKCA 4OINF 2Q1ZB 4MTDA 4DZJA 1VQ8I 1MNMC 4L5EA 1RR8C 1QO0D 3HOSA 3CC7I 3GTKJ 2LD5A 5E3NA 1A6IA 2TCTA 3GZ5A 4GRIA 1ETOA 4I0BA 4EGYA 3MN2A 1VQPI 5E3OA 1XCVA 2ZO4A 3RPUA 2OAZA 1FT9A 1VZ0A 2OD5A 3J7YJ 4BEHB 1JGSA 5LFAA 4XLHA 1ZRDA 2O03A 2MYSA 3CJNA 3HRMA 2XGEA 4BQNA 1O4XA 2RREA 4A12A 5LGUA 2ELJA 2FQ3A 2LG4A 2DK5A 4RA2A 1E0EA 2W84A 5DS9A 3EUHA 4XR6A 5CPRB 5CLSA 4BU2A 3LOCA 4Z6YA 5M5YJ 4ENMA 3OYJA 2LYCA 2QKLB 1QPMA 4U87A 1S72I 3E1SA 5LLQA 1TWCJ 3QWLA 2PBIA 3HEFA 4KITB 5HLIA 4E7ZA 2DTZA 3LSMA 2COMA 4E70A 2DYSH 1W4MA 2ESHA 3L2QA 2QEXI 1WJEA 1D5YA 4B44A 2RGVA 3OOPA 1TWGJ 2E35A 3K70D 3O2PE 3H5NA 4A0XA 1PDNC 3HRUA 4HLXA 4NC7A 4CSWA 4IKFA 2AXLA 1PUFB 3OSGA 4DBQA 1I39A 2HQAA 4U0WA 1WJDA 1GV5A 1WJFA 3EDPA 4CCJA 1FY7A 2A69F 3GBGA 1Z6TA 3BR3A 5IP6A 4CO8A 1T8IA 3G1LA 4KISA 3X2QH 4XKVA 4M6VA 1D0YA 4G9YA 2ME0A 5CKTA 3WU0A 3I53A 2JT1A 3FHNA 1ZELA 4A3KJ 1MNDA 4XORA 2R7QA 1JT6A 1I5ZA 3Q0UA 4G6QA 4A2UA 5TRDA 3V4GA 1YYVA 4CZZA 1GT0C 1W36C 3J7ZI 1MNEA 4U7DA 2X1CA 3GLLA 2K85A 3BC8A 3MKLA 1B8IB 2M0CA 3MKWB 1Z0XA 1XS9A 1I6XA 5HODA 2HR3A 3TQNA 3ZPLA 1BI3A 1MBEA 2EZLA 1R6RA 1RPWA 4NNJA 3H9QA 4II3A 2P5LC 1SFXA 1IW7F 2F5EA 2L7ZA 3R4KA 2OZ6A 2OF7A 1Q1HA 3IKTA 4ASNA 3GYHX 1QRYA 3V8JA 3FISA 3D1NI 2DK8A 4LB6B 1EV7A 4CZCA 5JLWA 1XX5A 3HSRA 2KDOA 4D5FA 5EGOB 5E3MA 2EV0A 3LA2A 3F3XA 1X4OA 3WG9A 1ULYA 2E7WA 2EPFA 1TQMA 2MG4A 2HPMA 4YG2F 4YRVA 4N9HA 4FISA 1T6SA 2G0EA 4RB0A 3HUGA 5LRRA 1M1EB 4BJ5C 4KA4A 1TWHJ 2CV0A 4CYCA 4TV7A 4MFEA 1DUXC 4C30A 1SD4A 3HL2A 4S04A 2CG4A 2MSYA 2XPVA 3I9V2 3K1NA 1YITI 2DFIA 2JSPA 4LLLA 4BHCA 3J80Z 4C3IJ 3BZCA 2VONA 2XAGA 1FOYA 4PGGA 2OZUA 5LRSA 5DCFA 2HOAA 1MD0A 4I7HA 4P96A 3LNQA 1EKEA 2MC4A 2DXIA 6PAXA 3Q9VA 3T5XA 5FRMA 2MLKA 3IHUA 3G2BA 3F9KA 2EFQA 1JKRC 1T38A 3OYGA 4BUPA 3ASOH 3LSTA 1J2XA 2G7UA 1FYKA 4C2UA 4CCKA 2FBHA 2EFPA 2BHZA 2WY7Q 1REPC 2VBZA 3O3KA 2EILH 3TKYA 1VQMI 5GPAA 1YW9A 3FK6A 1OKRA 4EM1A 1A35A 4EQQA 2KISA 5CVRA 2W48A 4AWXB 4HW0A 1SANA 4NHJA 4AU7A 1LFUP 1G3SA 4UUTA 2L3DA 1FOWA 4M3GA 4CICA 1NH3A 2F5CA 5GPCA 4AVPA 2DT5A 2KZGA 1ZGWA 3S17J 5IOZA 5AIPA 1FPQA 3RZOJ 5LGTA 2BXZA 3WTTC 5CVUA 5IPAA 3SDBA 3PQJA 1G3YA 4NC8A 3FX3A 2HDDA 3A2KA 3HOUJ 2DYRH 2L9RA 3MZ8A 3P9CA 3ZXSA 3HHGA 1E2XA 3SDGA 3DU5A 2K4JA 1XC5A 3JR9A 1ODDA 2XDVA 4RM3A 1F4KA 1UCRA 4XLAA 1R22A 1ETQA 2IP2A 3LAPA 2KLOA 5LHHA 1T33A 3SFIA 4OMYA 1Z05A 3HGGA 5BQTA 5IT3A 5K7FA 4EGZA 1U8RA 4EJTA 3MAJA 4YFKF 1A6QA 1D8JA 2E2JJ 3ZQIA 3OSFA 1IRGA 3ABLH 2GAUA 2EIKH 2XKOA 4Y33A 4UUVA 1FTZA 3K1PA 4IHYA 1P4WA 2RNJA 3OIQA 3CCSI 2VJIA 2IGNA 3I59B 1Y1VJ 2JA7J 5ICEA 2OQGA 5D4RA 3IV5A 2LREA 2ID6A 5FKLA 3L2UA 3DKXA 4HF0A 3S32A 5B66C 5EZGA 3JREA 4YIRX 3CTAA 3G73A 2VLAA 4HLYA 1IXRC 1AOYA 2ETHA 3L1PA 4LIVA 3IKVA 5F1RA 1O57A 3K4MA 1OCOH 1R5GA 4M3BA 4NC6A 4UVBA 1YO5C 3S93A 2EIMH 3WTZA 2YX7A 3V42A 3BPXA 1BL0A 1SD5A 2LLKA 2VBXA 3FBNB 3WTXC 2M1BA 3G3ZA 4BL0B 5J4VA 4XONA 4OMZA 4UXNA 3M8JA 3FHZA 2W1OA 3HOVJ 4A3GJ 2FMYA 2MD0A 5DD4A 1G4DA 2ZXIA 2HTJA 1QU3A 4FX0A 4CGZA 2X6OA 2TDXA 2XF7A 1G8XA 3PJRA 5KVRA 4LLGF 3CQZJ 3KCCA 4DOZA 5FFZA 2NVXJ 3S3OA 4BXUA 1YHQI 1VQ7I 1IRXA 3SEQA 2R93J 2JZYA 2PQ8A 4Y17A 2UXNA 1IRFA 2Y31A 2CQKA 2JUCA 2VIXA 3KYLA 4PJLA 1YLFA 2DW4A 2PJRA 1D0XA 2ELHA 2CYYA 3KYCB 4HA8A 5L3FA 2LR8A 2HTSA 3V8LA 2ZJPF 1SVMA 3QP6A 3K4KA 2DCEA 2ISYA 5BPIA 2WV1A 1R5ID 1TWFJ 2XAFA 2O8KA 4BGDA 2IXSA 2LOOA 1UB9A 4DJAA 4JP0A 2Y0SN 1D8KA 4AVZA 3A01B 1O3QA 2NVYJ 1U78A 1OISA 1QHGA 5K7HA 2HYJA 3PUBA 4IEJA 2DMNA 2RKHA 2XSJC 4E4HA 2R7OA 5H2FC 1QZZA 4RAGA 1MMAA 3CP2A 1DQUA 1VQ6I 2EIJH 4XLEA 3BG5A 3PIPF 1OQYA 3AFHA 4M9SA 3IH4A 3ZQHA 1Z7UA 2VPLA 5LD2C 3ABMH 4UVAA 1ERDA 3S1MJ 3KP6A 2VPRA 5TGTA 2IEKA 1R7JA 4BHBA 1UHMA 1T08B 2E1NA 3QPLA 2EINH 5DYMA 4NDLA 3FKIJ 1TNSA 4A0YA 5FFXA 2VKVA 2XUBA 2H94A 3Q5FA 5BOXA 2O8XA 2KJCA 2DFFA 2ESNA 4BQOA 2R7XA 2M45A 3PFYA 2VASA 3KLOA 5HVQC 1FMVA 1K7AA 2OTJI 3CJRB 4RAZA 1IAWA 2X85A 3I0TA 1YOVB 4DNCA 3ERED 2Z3YA 3HKZA 5AONA 2A3SA 2DFEA 3OYLA 3BZKA 2BBYA 1QGPA 3PFIA 2VXZA 3KEYA 3VDXA 3KEOA 4L9JA 4A3LJ 3CCYA 3EYYA 3W6KB 2LY9A 1VQNI 1ZHFA 3V7RA 2Y9ZA 3JRFA 3DCFA 2H8WA 3NQOA 3IAS2 1IO2A 1HQCA 3PNYA 1KYWA 4I0AA 3C3WA 4IVNA 4I02A 2I10A 1KU2A 3KEQA 4W1UA 2EFWA 1UAAA 1P7JA 2FA5A 2BY2A 4M3DA 3LSGA 1FSHA 2TRTA 4GO1A 4OU0A 1P92A 5EG0B 4M9XA 1VQOI 2W85A 3S15J 2V6EA 1ZLJA 3K0LA 1VFCA 2DN0A 2P5VA 3K1MA 2QWWA 4Y52J 1XSVA 4RGXA 3I54A 2CQXA 1K78B 3GO5A 4LFUA 2BW3A 4EEFG 4RDUA 4HAMA 4S0HB 3GTLJ 4YEJA 4E7IA 2R92J 1KU3A 4JBAA 4N9IA 3EUKL 2HS5A 2IS2A 4JOMA 4MQ9F 2XKPA 3PQKA
chains in the Genus database with same CATH topology
2AO9A 4AYBN 2CUEA 5J3LA 3LSRA 2D5VA 5IP7J 3HM5A 2R5ZB 1IUFA 1OJLA 2R5ZA 5FKKA 1XG1A 1ETXA 2DA1A 2JWTA 4V2GA 2VI6A 5IOYA 4C3HJ 1MBFA 4W97A 2R7ZJ 1APLC 4DZPA 2EZHA 2HOSA 5F08A 4J19A 1FIAA 4DZJA 2NVTJ 2EH3A 1BA5A 1MNMC 4L5EA 3TW7A 1W0TA 3GTKJ 2PMZN 4ABZA 2LD5A 5E3NA 3LSPA 2OPTA 2YUSA 1A6IA 2TCTA 3JRIA 1ETOA 4A3MJ 1GDTA 3MN2A 5E3OA 3ZQFA 1HF0A 1JTXA 1QPIA 3K7AJ 2R5YA 1RESA 2XGEA 1O4XA 3FK7A 4XK4A 3HGYA 3FIWA 5EZHA 1U9OA 3UKGA 2E19A 4A3IJ 3S14J 1HDPA 5DS9A 3LOCA 5M5YJ 5C4XJ 4GFBA 2H1KA 3W6VA 1QVUA 1ORKA 2CJJA 2LFBA 1AU7A 2E1OA 1TWCJ 2HXIA 3HEFA 2DTZA 1TC3C 3S1QJ 3RZDJ 2X48A 1WH7A 1MSFC 3A03A 3HOXJ 3QQAA 1D5YA 2X9DA 1TWGJ 4UUSB 4UUSA 1IG7A 1U9NA 2NS8A 1FIPA 2YS9A 2GM4A 3NAUA 2JA5J 2DA3A 1H88C 5BNGA 3JRHA 1PUFB 3OSGA 3C2BA 1RKWA 2Y9YA 2M2EA 4BBRJ 3CMYA 5JLXA 1GV5A 4HNVA 5F04A 1IC8A 3GTQJ 4XRMA 3B6AA 3GBGA 3BR3A 5IP6A 2XPWA 1ZR2A 3G1LA 2WAQN 3JRAA 2NVQJ 1ZK8A 2FD5A 1K61A 5IYBJ 2N8GA 4M6VA 2LTPA 2LKXA 5EEAA 5J1UA 1NK3P 2ME0A 2O7OA 4A3KJ 1JTYA 2JA6J 2LP0A 3MVPA 3LSJA 4MLOA 1TWAJ 1JT6A 3Q0UA 3BTCA 4X6AJ 2KDZA 1GT0C 3A02A 2R0QC 3CDLA 2DA6A 3MKLA 1B8IB 2M0CA 1B8IA 3S2HJ 1Z0XA 2Y2ZA 1XS9A 5HODA 2P81A 2H8RA 2M9HA 3BG3A 1GV2A 1MBEA 2EZLA 1RPWA 1T56A 5K7ZA 2VUMJ 2DMTA 9ANTA 4LOCA 2L7ZA 1LE8B 4DW6A 1LE8A 2OF7A 5GP9A 3OIOA 1OCPA 3HDDA 1QRYA 3BT9A 3FISA 5F0FA 1E3OC 1ZKGA 3D1NI 4IHWA 1GUUA 5JLWA 4A3JJ 3PO2J 1ITYA 3WHCA 3ZOBA 4D5FA 5EGOB 1WGXA 5E3MA 5EGOA 1NTCA 1BW6A 2JMWA 3BR1A 3BTLA 2XSDC 1U8BA 1X2NA 2MG4A 4DYRA 5C4JJ 4FISA 3GTGJ 1ZR4A 2G0EA 2KT0A 2NS7A 5FLVA 1F43A 1TWHJ 4CYCB 4CYCA 1SFOJ 4BXXJ 4MFEA 2ECBA 3ZQGA 4JX6A 4BY7J 5IYDJ 2MSYA 2MW8A 2XPVA 1JKQC 2CRGA 5FLMJ 2QF7A 3JRDA 1W0UA 2FQ4A 4A3BJ 4C3IJ 5F27A 3NARA 1G2HA 2ME6A 2HOAA 3LNQA 1QVTA 3BR2A 1IDYA 1JKRC 1S7EA 1YRNB 1FTTA 4QIWN 2HXOA 5EYRA 5GPAA 3FK6A 3HOWJ 3BR5A 5E3LA 2AHQA 2XB0X 2LVSA 4I76A 2W48A 1SANA 1I6HJ 1RKTA 1ZQ3P 1LFUP 1Y1WJ 3IH3A 4UUTA 2XRLA 2COBA 3RKQA 4M3GA 2NOGA 1JUMA 5GPCA 3S17J 4D5CA 1ZGWA 3RZOJ 5IOZA 1IJWC 1HLVA 1DU6A 2HOTA 3K2AA 5IYCJ 1IRZA 5FKNA 4I6ZA 5IPAA 1MH4A 4A93J 2HDDA 3HOUJ 2L7FP 3HKZN 3BTIA 2L9RA 1R9TJ 3TW6A 1PUFA 3SDGA 1Q1VA 1XC5A 1VI0A 2CQQA 4JX5A 3JR9A 5EDNA 4FCYA 3BQYA 1ETQA 3O8GA 1JJ8C 2DA4A 3Q0VA 2K9SA 1T33A 2JK3A 3SFIA 1FEXA 4B4CA 2XB5A 1NK2P 3HGGA 1F36A 1A5JA 5K7FA 2DA5A 1MBHA 4QSHA 1RETA 3RQIA 3ZQIA 2E2JJ 1UMQA 3OSFA 2FJ1A 3DEWA 4MO7A 1AKHB 3PM1A 4RBOA 3M4OJ 1FTZA 5M5WJ 1WH5A 4IHYA 1IV6A 5DTDA 1B72B 1Z77A 1B72A 1ENHA 3S16J 3S1RJ 3G1OA 1Y1VJ 2JA7J 3VPRA 2DMQA 3IV5A 5M3MJ 5F0HA 3S1NJ 4AC0A 3H0GJ 2ID6A 5FKLA 2E2HJ 5EZGA 3JREA 4XRSG 3ZQLA 1RR7A 4FE7A 3L1PA 4M3FA 2MGQA 4M3BA 3TP0A 2DMUA 4FE4A 1BL0A 2ECCA 1WCMJ 3IH2A 4BBSJ 3M3YJ 3GTOJ 2LLKA 1HCRA 2K9NA 1OCTC 4BY1J 3HOVJ 4A3GJ 1VF9A 4BKXA 3BR0A 1JUSA 2ZB9A 2X6OA 4JX4A 2JJ7A 4A69C 3QPSA 3CQZJ 3BTJA 5M3FJ 2NVXJ 1OFCX 3BG9A 4A3FJ 3TEDA 2DMPA 3GTPJ 2R93J 2LK2A 3BR6A 1IGNA 1HDDC 4D7MA 2Y31A 2O9LA 4Y7NJ 3H3VK 2JA8J 3ZQCA 4D7NA 2EQRA 5M5XJ 1MH3A 1IDZA 4XRSA 2L7MP 2LR8A 5C44J 1JGGA 1K83J 3Q3SA 1MBJA 1BJZA 2ID3A 2B63J 2WV1A 3OOUA 1TWFJ 2O8KA 3HOYJ 2XGCA 1H89C 4MIMA 4JP0A 2Y0SN 1YRNA 3A01B 3A01A 2NVYJ 2HQ5A 5F1JA 1U78A 5K7HA 4V2FA 1JKOC 2HYJA 4IEJA 2WB1N 2DA2A 2DMNA 5IP9J 1ETYA 4FTHA 3HBLA 2R5YB 1MSEC 2IAIA 5J1RA 3BG5A 2DA7A 4A3CJ 3S2DJ 3IH4A 3ZQHA 1LFBA 1WPKA 5FJ8J 2JN6A 3JRCA 2CU7A 3GTJJ 3S1MJ 4A3DJ 1POGA 5FKOA 1P7IA 2VPRA 1CQTA 2IEKA 3PO3J 2M8GX 1JUPA 3QPLA 4NDLA 3FKIJ 4QTRA 3TP3A 2DJNA 2VKVA 1UHSA 1I50J 3E7LA 3JRBA 3B6CA 2CUFA 5C3EJ 5EF6A 1HOMA 1JJ6C 4B3AA 1AHDP 1UG2A 2HI3A 5J1YA 4A3EJ 3O8HA 1AKHA 2XPUA 4AUXA 1WI3A 2GBYA 1ETKA 1ETVA 4MFDA 4IHVA 3HOZJ 4X1EA 3JRGA 1X58A 3SJMA 4A3LJ 3CCYA 1I3QJ 2LY9A 2XGDA 1ZTRA 2EZKA 2Y9ZA 2QCOA 1DU0A 3JRFA 2E2IJ 3DCFA 4C2MJ 2GLOA 3I4MJ 1JKPC 2I10A 4W1UA 1GVDA 1P7JA 1ETWA 3Q0WA 4M3DA 4B1RA 3LSGA 3I4NJ 2TRTA 3BQZA 3F0CA 4DYQA 5EG0B 5EG0A 1FJLA 5FKMA 3S15J 3WHBA 1VNDA 2DN0A 1VFCA 1X2MA 1BW5A 1H8AC 4Y52J 2CQXA 4XICA 2EZIA 4EEFG 4RDUA 2YU9J 2K40A 2Y30A 4JYKA 4S0HB 3GTLJ 3HB9A 2L0KA 2M34A 5F0CA 2EBIA 2R92J 2FX0A 1MBGA 4DYCA 2VKEA 3GTMJ 2RAEA 1MBKA 4IHXA 1EF4A 2K9QA 4C3JJ 4M3EA 2IBDA 1JT0A 3G1MA 4XIDA 2ELKA 4G12A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2AO9 A;  4AYB N;  2CUE A;  5J3L A;  3LSR A;  2D5V A;  5IP7 J;  3HM5 A;  2R5Z B;  1IUF A;  1OJL A;  2R5Z A;  5FKK A;  1XG1 A;  1ETX A;  2DA1 A;  2JWT A;  4V2G A;  2VI6 A;  5IOY A;  4C3H J;  1MBF A;  4W97 A;  2R7Z J;  1APL C;  4DZP A;  2EZH A;  2HOS A;  5F08 A;  4J19 A;  1FIA A;  4DZJ A;  2NVT J;  2EH3 A;  1BA5 A;  1MNM C;  4L5E A;  3TW7 A;  1W0T A;  3GTK J;  2PMZ N;  4ABZ A;  2LD5 A;  5E3N A;  3LSP A;  2OPT A;  2YUS A;  1A6I A;  2TCT A;  3JRI A;  1ETO A;  4A3M J;  1GDT A;  3MN2 A;  5E3O A;  3ZQF A;  1HF0 A;  1JTX A;  1QPI A;  3K7A J;  2R5Y A;  1RES A;  2XGE A;  1O4X A;  3FK7 A;  4XK4 A;  3HGY A;  3FIW A;  5EZH A;  1U9O A;  3UKG A;  2E19 A;  4A3I J;  3S14 J;  1HDP A;  5DS9 A;  3LOC A;  5M5Y J;  5C4X J;  4GFB A;  2H1K A;  3W6V A;  1QVU A;  1ORK A;  2CJJ A;  2LFB A;  1AU7 A;  2E1O A;  1TWC J;  2HXI A;  3HEF A;  2DTZ A;  1TC3 C;  3S1Q J;  3RZD J;  2X48 A;  1WH7 A;  1MSF C;  3A03 A;  3HOX J;  3QQA A;  1D5Y A;  2X9D A;  1TWG J;  4UUS B;  4UUS A;  1IG7 A;  1U9N A;  2NS8 A;  1FIP A;  2YS9 A;  2GM4 A;  3NAU A;  2JA5 J;  2DA3 A;  1H88 C;  5BNG A;  3JRH A;  1PUF B;  3OSG A;  3C2B A;  1RKW A;  2Y9Y A;  2M2E A;  4BBR J;  3CMY A;  5JLX A;  1GV5 A;  4HNV A;  5F04 A;  1IC8 A;  3GTQ J;  4XRM A;  3B6A A;  3GBG A;  3BR3 A;  5IP6 A;  2XPW A;  1ZR2 A;  3G1L A;  2WAQ N;  3JRA A;  2NVQ J;  1ZK8 A;  2FD5 A;  1K61 A;  5IYB J;  2N8G A;  4M6V A;  2LTP A;  2LKX A;  5EEA A;  5J1U A;  1NK3 P;  2ME0 A;  2O7O A;  4A3K J;  1JTY A;  2JA6 J;  2LP0 A;  3MVP A;  3LSJ A;  4MLO A;  1TWA J;  1JT6 A;  3Q0U A;  3BTC A;  4X6A J;  2KDZ A;  1GT0 C;  3A02 A;  2R0Q C;  3CDL A;  2DA6 A;  3MKL A;  1B8I B;  2M0C A;  1B8I A;  3S2H J;  1Z0X A;  2Y2Z A;  1XS9 A;  5HOD A;  2P81 A;  2H8R A;  2M9H A;  3BG3 A;  1GV2 A;  1MBE A;  2EZL A;  1RPW A;  1T56 A;  5K7Z A;  2VUM J;  2DMT A;  9ANT A;  4LOC A;  2L7Z A;  1LE8 B;  4DW6 A;  1LE8 A;  2OF7 A;  5GP9 A;  3OIO A;  1OCP A;  3HDD A;  1QRY A;  3BT9 A;  3FIS A;  5F0F A;  1E3O C;  1ZKG A;  3D1N I;  4IHW A;  1GUU A;  5JLW A;  4A3J J;  3PO2 J;  1ITY A;  3WHC A;  3ZOB A;  4D5F A;  5EGO B;  1WGX A;  5E3M A;  5EGO A;  1NTC A;  1BW6 A;  2JMW A;  3BR1 A;  3BTL A;  2XSD C;  1U8B A;  1X2N A;  2MG4 A;  4DYR A;  5C4J J;  4FIS A;  3GTG J;  1ZR4 A;  2G0E A;  2KT0 A;  2NS7 A;  5FLV A;  1F43 A;  1TWH J;  4CYC B;  4CYC A;  1SFO J;  4BXX J;  4MFE A;  2ECB A;  3ZQG A;  4JX6 A;  4BY7 J;  5IYD J;  2MSY A;  2MW8 A;  2XPV A;  1JKQ C;  2CRG A;  5FLM J;  2QF7 A;  3JRD A;  1W0U A;  2FQ4 A;  4A3B J;  4C3I J;  5F27 A;  3NAR A;  1G2H A;  2ME6 A;  2HOA A;  3LNQ A;  1QVT A;  3BR2 A;  1IDY A;  1JKR C;  1S7E A;  1YRN B;  1FTT A;  4QIW N;  2HXO A;  5EYR A;  5GPA A;  3FK6 A;  3HOW J;  3BR5 A;  5E3L A;  2AHQ A;  2XB0 X;  2LVS A;  4I76 A;  2W48 A;  1SAN A;  1I6H J;  1RKT A;  1ZQ3 P;  1LFU P;  1Y1W J;  3IH3 A;  4UUT A;  2XRL A;  2COB A;  3RKQ A;  4M3G A;  2NOG A;  1JUM A;  5GPC A;  3S17 J;  4D5C A;  1ZGW A;  3RZO J;  5IOZ A;  1IJW C;  1HLV A;  1DU6 A;  2HOT A;  3K2A A;  5IYC J;  1IRZ A;  5FKN A;  4I6Z A;  5IPA A;  1MH4 A;  4A93 J;  2HDD A;  3HOU J;  2L7F P;  3HKZ N;  3BTI A;  2L9R A;  1R9T J;  3TW6 A;  1PUF A;  3SDG A;  1Q1V A;  1XC5 A;  1VI0 A;  2CQQ A;  4JX5 A;  3JR9 A;  5EDN A;  4FCY A;  3BQY A;  1ETQ A;  3O8G A;  1JJ8 C;  2DA4 A;  3Q0V A;  2K9S A;  1T33 A;  2JK3 A;  3SFI A;  1FEX A;  4B4C A;  2XB5 A;  1NK2 P;  3HGG A;  1F36 A;  1A5J A;  5K7F A;  2DA5 A;  1MBH A;  4QSH A;  1RET A;  3RQI A;  3ZQI A;  2E2J J;  1UMQ A;  3OSF A;  2FJ1 A;  3DEW A;  4MO7 A;  1AKH B;  3PM1 A;  4RBO A;  3M4O J;  1FTZ A;  5M5W J;  1WH5 A;  4IHY A;  1IV6 A;  5DTD A;  1B72 B;  1Z77 A;  1B72 A;  1ENH A;  3S16 J;  3S1R J;  3G1O A;  1Y1V J;  2JA7 J;  3VPR A;  2DMQ A;  3IV5 A;  5M3M J;  5F0H A;  3S1N J;  4AC0 A;  3H0G J;  2ID6 A;  5FKL A;  2E2H J;  5EZG A;  3JRE A;  4XRS G;  3ZQL A;  1RR7 A;  4FE7 A;  3L1P A;  4M3F A;  2MGQ A;  4M3B A;  3TP0 A;  2DMU A;  4FE4 A;  1BL0 A;  2ECC A;  1WCM J;  3IH2 A;  4BBS J;  3M3Y J;  3GTO J;  2LLK A;  1HCR A;  2K9N A;  1OCT C;  4BY1 J;  3HOV J;  4A3G J;  1VF9 A;  4BKX A;  3BR0 A;  1JUS A;  2ZB9 A;  2X6O A;  4JX4 A;  2JJ7 A;  4A69 C;  3QPS A;  3CQZ J;  3BTJ A;  5M3F J;  2NVX J;  1OFC X;  3BG9 A;  4A3F J;  3TED A;  2DMP A;  3GTP J;  2R93 J;  2LK2 A;  3BR6 A;  1IGN A;  1HDD C;  4D7M A;  2Y31 A;  2O9L A;  4Y7N J;  3H3V K;  2JA8 J;  3ZQC A;  4D7N A;  2EQR A;  5M5X J;  1MH3 A;  1IDZ A;  4XRS A;  2L7M P;  2LR8 A;  5C44 J;  1JGG A;  1K83 J;  3Q3S A;  1MBJ A;  1BJZ A;  2ID3 A;  2B63 J;  2WV1 A;  3OOU A;  1TWF J;  2O8K A;  3HOY J;  2XGC A;  1H89 C;  4MIM A;  4JP0 A;  2Y0S N;  1YRN A;  3A01 B;  3A01 A;  2NVY J;  2HQ5 A;  5F1J A;  1U78 A;  5K7H A;  4V2F A;  1JKO C;  2HYJ A;  4IEJ A;  2WB1 N;  2DA2 A;  2DMN A;  5IP9 J;  1ETY A;  4FTH A;  3HBL A;  2R5Y B;  1MSE C;  2IAI A;  5J1R A;  3BG5 A;  2DA7 A;  4A3C J;  3S2D J;  3IH4 A;  3ZQH A;  1LFB A;  1WPK A;  5FJ8 J;  2JN6 A;  3JRC A;  2CU7 A;  3GTJ J;  3S1M J;  4A3D J;  1POG A;  5FKO A;  1P7I A;  2VPR A;  1CQT A;  2IEK A;  3PO3 J;  2M8G X;  1JUP A;  3QPL A;  4NDL A;  3FKI J;  4QTR A;  3TP3 A;  2DJN A;  2VKV A;  1UHS A;  1I50 J;  3E7L A;  3JRB A;  3B6C A;  2CUF A;  5C3E J;  5EF6 A;  1HOM A;  1JJ6 C;  4B3A A;  1AHD P;  1UG2 A;  2HI3 A;  5J1Y A;  4A3E J;  3O8H A;  1AKH A;  2XPU A;  4AUX A;  1WI3 A;  2GBY A;  1ETK A;  1ETV A;  4MFD A;  4IHV A;  3HOZ J;  4X1E A;  3JRG A;  1X58 A;  3SJM A;  4A3L J;  3CCY A;  1I3Q J;  2LY9 A;  2XGD A;  1ZTR A;  2EZK A;  2Y9Z A;  2QCO A;  1DU0 A;  3JRF A;  2E2I J;  3DCF A;  4C2M J;  2GLO A;  3I4M J;  1JKP C;  2I10 A;  4W1U A;  1GVD A;  1P7J A;  1ETW A;  3Q0W A;  4M3D A;  4B1R A;  3LSG A;  3I4N J;  2TRT A;  3BQZ A;  3F0C A;  4DYQ A;  5EG0 B;  5EG0 A;  1FJL A;  5FKM A;  3S15 J;  3WHB A;  1VND A;  2DN0 A;  1VFC A;  1X2M A;  1BW5 A;  1H8A C;  4Y52 J;  2CQX A;  4XIC A;  2EZI A;  4EEF G;  4RDU A;  2YU9 J;  2K40 A;  2Y30 A;  4JYK A;  4S0H B;  3GTL J;  3HB9 A;  2L0K A;  2M34 A;  5F0C A;  2EBI A;  2R92 J;  2FX0 A;  1MBG A;  4DYC A;  2VKE A;  3GTM J;  2RAE A;  1MBK A;  4IHX A;  1EF4 A;  2K9Q A;  4C3J J;  4M3E A;  2IBD A;  1JT0 A;  3G1M A;  4XID A;  2ELK A;  4G12 A; 
#chains in the Genus database with same CATH topology
 1ZRC A;  4AYB N;  2OJE D;  3VFZ A;  2R5Z B;  2UUZ A;  2QSH X;  3VOD A;  2VI6 A;  3Q9S A;  2IJL A;  4B48 A;  2M4G A;  4ZZL A;  3BG6 A;  3R6S A;  3BP8 A;  3HUG B;  2GIV A;  2VBW A;  2IRF G;  1T0F A;  4IOC F;  1J59 A;  4CCN A;  2NS0 A;  4L9T A;  3M9A A;  2HKX A;  4KYW A;  3FXU A;  4M72 A;  3LA7 A;  3BZ6 A;  3B73 A;  3TW7 A;  1P9Q C;  1ON2 A;  2GA2 A;  4EM2 A;  1FOX A;  2AQF A;  2LY2 A;  2PMZ N;  4AYB A;  3E6M A;  4E7H A;  1RUO A;  3LSP A;  2OPT A;  1O3T A;  3KZY A;  3JRI A;  1YX5 A;  4DGW B;  1P4X A;  3VOE A;  4PFO A;  3BJO A;  2XAU A;  4CUG A;  1WZ2 A;  1LDD A;  3GFM A;  2EFO A;  2RN7 A;  2R5Y A;  2NNY A;  1XTA A;  1Z7L A;  2P5K A;  3HGY A;  5EZH A;  2VT2 A;  3TMO A;  2E19 A;  2M7A A;  2I5U A;  3VEP A;  2KFD A;  3LA3 A;  2QM3 A;  3F8F A;  1HDP A;  4QWQ A;  4CXF A;  4KFC A;  1DP7 P;  2HVQ A;  3ABK H;  5J40 A;  4M73 A;  5C4X J;  3T0Y A;  2H1K A;  5ILV A;  3W2W A;  1QVU A;  3KP5 A;  2WB1 A;  2E1O A;  2A07 F;  4IX7 A;  2HXI A;  3WTU C;  4AD9 A;  5B1B H;  1G3W A;  1R1V A;  4GYI A;  2BY0 A;  1N77 A;  1BR1 A;  1OR7 C;  2FE3 A;  4HRI A;  1HBX G;  2X9D A;  5KHD A;  4UUS A;  2F5D A;  5LHI A;  2GM4 A;  1X3U A;  1FLI A;  1H88 C;  2KKO A;  2YPR A;  3D0S A;  3C2B A;  3CUO A;  1OYW A;  2Y9Y A;  4LB5 A;  2ZSI B;  4BBR J;  3CMY A;  2JQ7 A;  2O0Y A;  5JLX A;  1XSX A;  1WQ2 A;  2P7V B;  4ZH4 F;  5F04 A;  3GTQ J;  5J8F A;  4XRM A;  3GX4 X;  1PP8 F;  2IA1 A;  4KIB A;  1ZR2 A;  2IVM A;  2HYG D;  4GXO A;  2WAQ N;  2WA0 A;  1R4M B;  1ZK8 A;  1K61 A;  5IYB J;  1HST A;  3OMY A;  4IRG A;  2H09 A;  2BVM A;  2QUF A;  2ZJ2 A;  3HXL A;  2D1H A;  3ZMV A;  4DBR A;  4DQ2 A;  3J81 Z;  2LKX A;  5J1U A;  2FEZ A;  2O7O A;  1MJB A;  2JA6 J;  2KZV A;  4WX9 A;  4MLO A;  2Z5U A;  2R7T A;  2E60 A;  2BOL A;  3BJA A;  4CHU A;  1J7K A;  2KDZ A;  1BC8 C;  3NRV A;  2DT6 A;  2P6T A;  2L9V A;  3A02 A;  3M7G A;  2R0Q C;  1R1U A;  1MJ9 A;  1J0R A;  2E5Z A;  1LDK B;  1D1C A;  1WWX A;  5FB2 A;  3HJE A;  2H8R A;  3RTR A;  2WAQ A;  3BG3 A;  2OCE A;  2VQG A;  3CLQ A;  2VUM J;  1BJA A;  4FET A;  4LOC A;  1LE8 B;  4LIT A;  4C2T A;  2K27 A;  3VYT B;  3DPL C;  5GP9 A;  3N97 A;  1OCP A;  3T8T A;  1BN5 A;  5F0F A;  2R7S A;  3RQ4 A;  1ITY A;  4LK1 F;  3ZOB A;  1WGX A;  3IC7 A;  3GVA A;  2KL4 A;  4JK1 X;  3BTL A;  3CUQ C;  2XSD C;  5EJC A;  5C4J J;  1LUJ B;  4LMY A;  4P55 A;  3TO9 A;  1F1Z A;  4HSR A;  4ENK A;  4Q48 A;  5HS8 A;  4AID A;  1MMG A;  2MD5 A;  3WGG A;  1F43 A;  1WI9 A;  3K4B A;  3DQV C;  1SFO J;  4UVC A;  1Y56 A;  3N05 A;  1PUE E;  5JHF A;  4F3Q A;  4XNF A;  2ECB A;  3ZQG A;  4RLQ A;  4ESB A;  1LNW A;  3GZ6 A;  3RYR A;  3MWM A;  4YII A;  3SYT A;  3ABU A;  1R4N B;  2K9L A;  1ZGJ A;  3ECH A;  5FLM J;  2QF7 A;  3RIR A;  3QOD A;  1W0U A;  2PJR B;  3HC7 A;  4QPQ A;  3NAR A;  2QBY B;  3J81 K;  4G7H F;  5DCM A;  1QQI A;  2HGC A;  3I56 I;  4ZYG A;  4HQE A;  2X0L A;  1MDM A;  3ZN0 A;  5GAD J;  1XSD A;  3OYM A;  3CMA I;  1FP1 D;  3E0J B;  4YFN F;  1VQ5 I;  1JHF A;  3F8C A;  1WVR A;  5H20 A;  1ZAO A;  3RKX A;  2P8T A;  3WTS C;  2A6H F;  2VOP A;  3CO6 C;  5F6F A;  3HOW J;  2OV7 A;  1LVA A;  5E1Z B;  2LVS A;  2Y0M A;  3FM3 A;  1RKT A;  2B9S A;  3WG7 H;  1K79 A;  1Y1W J;  1R00 A;  2MLG A;  3RKQ A;  3HG9 A;  4G6T B;  3OYD A;  2E36 A;  3HSE A;  1V5F A;  2J5P A;  4D5C A;  1HLV A;  2YX4 A;  3FXR A;  4D0P A;  5IYC J;  2OCC H;  2M5W A;  3WU1 B;  3AG4 H;  4LG0 A;  1MH4 A;  4YIF A;  4PSX A;  1J75 A;  4A93 J;  4YFX F;  3K4J A;  5D5W B;  5JHU A;  1R9T J;  1IXC A;  3TW6 A;  3D5R C;  2X4H A;  4PFP A;  4QLC U;  4IL6 C;  1Q1V A;  1VI0 A;  5L3C A;  2EV5 A;  1KQ8 A;  2VQC A;  3BQY A;  2CQ7 A;  2CW8 A;  2ZNY A;  1JJ8 C;  2DA4 A;  2HNH A;  2JK3 A;  4RB1 A;  1LB2 A;  4IHS A;  3DU6 A;  1NK2 P;  2OQR A;  1X1B A;  1F36 A;  3HTS B;  1A5J A;  3CUQ B;  1MBH A;  4IXA A;  4RB3 C;  3H3Z A;  2DQL A;  1J5Y A;  4MO7 A;  2ZME A;  2H27 A;  1DPR A;  1RZ4 A;  1SAU A;  3PM1 A;  3M4O J;  3JSP A;  4P9F A;  2PJP A;  3ONQ A;  1NG7 A;  2XF5 A;  2LH9 A;  2V1N A;  1IV6 A;  5DTD A;  1YFH A;  1B72 B;  1Z77 A;  3S1R J;  1N78 A;  3K70 C;  3S3N A;  1ONV A;  2QZ8 A;  1X3Z B;  3FDY A;  3S1N J;  5KK1 A;  3H0G J;  1T39 A;  3H0D A;  2ZSH B;  2BVL A;  3ZQQ A;  3ZQL A;  3LFU A;  1EJ9 A;  3CLO A;  2F4M B;  2UZK A;  3KP3 A;  3H5A A;  4MGR A;  4M3F A;  4M71 A;  3IRQ A;  3F8B A;  1WJB A;  2IA0 A;  3KP4 A;  5E17 F;  2DMU A;  2DDB A;  3A0B C;  2QKM B;  1WCM J;  4EJU A;  2XAH A;  4BBS J;  4UNO A;  2L02 A;  2VT3 A;  1W7P A;  3F72 A;  3OV8 A;  1B59 A;  1BI2 A;  3GTO J;  3DV8 A;  3CCU I;  5FRO A;  1Z67 A;  1FBQ A;  3F8N A;  4KT6 A;  3ROU A;  1UFM A;  3KE2 A;  4UY8 I;  5D8L B;  2BY3 A;  2L9N A;  2FF4 A;  3CO7 C;  2ACJ A;  5TJJ A;  2LKP A;  3VSL A;  1HW2 A;  4AM3 A;  2JJ7 A;  2VE8 A;  4A69 C;  1SEU A;  2FRH A;  1OCR H;  3QPS A;  4XN0 A;  2V9P A;  3BCA A;  3BTJ A;  4LJZ F;  1OCC H;  3RCO A;  3U21 A;  2IGO A;  5GAG J;  4HX4 A;  4PJ0 C;  1XMK A;  4BYY A;  4R79 A;  3BG9 A;  2JTV A;  5FD6 A;  3OYC A;  4A3F J;  1XGM A;  1XB4 A;  4M6Y A;  4M74 A;  1IGN A;  4Q47 A;  1HDD C;  2Y69 H;  3L2C A;  2O9L A;  2E71 A;  2IS6 A;  4WF2 A;  4D7N A;  2X6X A;  3QOE A;  3ZQ7 A;  2PLY A;  4RLF A;  3GFJ A;  4YEL A;  2J5O A;  3DFG A;  1GXQ A;  2ZC2 A;  5DV5 A;  2VQL A;  4AIH A;  5H6R A;  4ZTJ A;  3OL3 A;  1JGG A;  3QOP A;  1BI1 A;  2A05 A;  1A36 A;  2IS4 A;  4R8H A;  3JAM Z;  3D5S C;  2V4J C;  1Y6I A;  1UEL B;  3WE3 A;  3ISP A;  2HQ5 A;  3D5L A;  4V2F A;  5FLX Z;  3KPH A;  1JKO C;  2VB6 A;  4PJJ A;  2AXT C;  1FMW A;  5HS7 A;  2CH0 A;  3QP5 A;  4BQA A;  1ETY A;  2JPB A;  4ETS A;  1FP2 A;  4FTH A;  1I1S A;  1TT5 B;  1TTY A;  3H9J A;  3UNG C;  5DDG A;  2QQB A;  2K86 A;  1PJR A;  2R5Y B;  2FXA A;  2WBM A;  3OIP A;  4ZTF A;  4I99 C;  2F2E A;  5E1W A;  3ZMD A;  4KNY A;  1U5T C;  3S2D J;  1LFB A;  3W6J B;  5KAI C;  5FJ8 J;  3JRC A;  5CVJ A;  4UHT A;  5D8K B;  1POG A;  1GXP A;  5E20 A;  3CME I;  3MFK A;  1P7I A;  1R58 A;  4HOB A;  2M8G X;  4EAT A;  3BDD A;  4FHT A;  5CJ9 A;  4PGH A;  1MMN A;  1W5C C;  3TP3 A;  4LK0 F;  2Z2S B;  2DJN A;  3VYS B;  1BC7 C;  1SVL A;  1WJA A;  2MFZ A;  3LL7 A;  4D9J A;  4HX7 A;  2MA3 A;  4BH9 A;  1JXS A;  2KRH A;  2FOK A;  2GIZ A;  3B6C A;  3SZP A;  2CUF A;  2DPU A;  1WJC A;  2H6C A;  1RUN A;  1JJ6 C;  4B3A A;  3IWF A;  4HG2 A;  5K5R A;  5JVT A;  1X4P A;  3ZGK A;  3J80 K;  4WXC A;  1SMT A;  2GBY A;  1ETK A;  3CF2 A;  3E5Q A;  1VQK I;  3MEX A;  4CH7 A;  3JRG A;  3SJM A;  4O5V A;  2GZW A;  3O6B B;  3F8M A;  2KMU A;  3TDU C;  2EZK A;  3AL0 C;  3I58 A;  3BLY A;  2OBP A;  3EUH C;  2E2I J;  4C2M J;  2XRN A;  1T95 A;  2EFN A;  1N25 A;  4LIU A;  4A0Z A;  1QBJ A;  3CF5 F;  1Y8Q B;  3GFL A;  2A5W A;  1W1W E;  5FLX K;  3CZ6 A;  1NHA A;  1R71 A;  3WHB A;  2XHK A;  1BW5 A;  5LGN A;  1H8A C;  4XIC A;  2HQN A;  4LD5 A;  4JYK A;  2M34 A;  4BAY A;  3KIO A;  4DYC A;  2K3P A;  4CA0 A;  3GTM J;  2RAE A;  1PYV A;  5HDN A;  2K9Q A;  2DOE A;  4NQW B;  3OYE A;  4PZJ A;  2WAD A;  2IBD A;  4NB5 A;  4XID A;  3JRD A;  2ZBK A;  2ELK A;  3RI4 A;  1I3Q J;  3KYD B;  2AO9 A;  2XF6 A;  2CUE A;  1U5T B;  2D5V A;  4UV9 A;  2HVR A;  1OYY A;  1Y39 A;  1IUF A;  1W7P D;  2Z33 A;  2DU9 A;  4HDV A;  4L0Y B;  2DA1 A;  2LMD A;  3ZCO A;  1R49 A;  1O7F A;  5ICC A;  5DUI A;  1ZN2 A;  3G4S I;  3VYU B;  2NYX A;  2ZME C;  3R60 A;  4W97 A;  1KYZ A;  2DQR A;  2R7W A;  4DZP A;  2V26 A;  2EZH A;  1X1C A;  4KMU X;  1MGT A;  3BG7 A;  2CUJ A;  4IZZ A;  4FT8 A;  2LBF B;  2W7N A;  2NVT J;  2EH3 A;  2XAQ A;  2ZXW H;  1BA5 A;  4RGR A;  3MQ0 A;  3P9K A;  1W0T A;  4EJO A;  3QPH A;  1S3J A;  3VYR B;  4U0Y A;  5BMZ A;  4HF2 A;  3GUD A;  4A3M J;  1GDT A;  2QYO A;  4RAF A;  2HDC A;  1BR4 A;  1ZH5 A;  2JVG A;  2LC2 A;  3ZQF A;  2IA2 A;  2OA4 A;  1HF0 A;  5D6F A;  1JTX A;  3M07 A;  3ZMT A;  4BQQ A;  1QPI A;  1U3E M;  1GVJ A;  5K1Y A;  1O3R A;  1RES A;  1HKT A;  3FK7 A;  1MDM B;  4XK4 A;  3QU3 A;  3JTH A;  1MMS A;  3UKG A;  3F6V A;  4KT5 C;  5D5U B;  4A3I J;  3AL0 B;  1WJ5 A;  3S14 J;  1V54 H;  3C2G A;  3EET A;  1MZB A;  1TZL A;  2Y0S A;  4HQM A;  3N4M A;  3RKY A;  3VWB A;  4GFB A;  3W6V A;  2VN2 A;  3S3M A;  1IF1 A;  3TGN A;  1H0M A;  1TC3 C;  2QGU A;  1GHC A;  5A2Q Z;  3L2R A;  2X48 A;  1WH7 A;  1MSF C;  2NXN B;  4WK8 F;  3CCL I;  3A03 A;  4LG3 A;  3NEU A;  2JPC A;  1KU7 A;  1IG7 A;  1Y0N A;  2EA4 A;  2G9W A;  2NS8 A;  5DM6 F;  2YS9 A;  4KN4 X;  2JA5 J;  2DA3 A;  4P9U A;  5BNG A;  2YR2 A;  3PSF A;  5ILU A;  1RKW A;  3I5U A;  1NG6 A;  3FWE A;  1IC8 A;  2NAZ A;  2XPW A;  3DBH B;  4WCG A;  2CV1 A;  4GCV A;  1HW1 A;  1FBS A;  4U0V A;  4L9V A;  2NVQ J;  2LSO A;  2FD5 A;  1EA3 A;  1IN7 A;  1SD6 A;  5HLH A;  4RMN A;  2HZD A;  2KIU A;  2VKH A;  5EEA A;  2ZJR F;  5FD5 A;  1SMY F;  3T8R A;  2ZME B;  2DO7 A;  1JTY A;  4D1Q A;  3MVP A;  3LSJ A;  3CC4 I;  2JRT A;  2JVH A;  3IAM 2;  5LHG A;  4IO9 F;  2K3F A;  4OIP F;  1STZ A;  2Q2E A;  3EUA A;  3CDL A;  2VL8 A;  1R23 A;  2VC0 A;  3CJT B;  1B8I A;  2VQH A;  1O7L A;  3PIO F;  1SFK A;  1KU9 A;  2DTR A;  3W2A A;  5L3D A;  2D45 A;  2NNN A;  4QPO A;  1B9N A;  2MH9 A;  4DW6 A;  2DJI A;  3WOD F;  2BXY A;  3DPT A;  1KON A;  3HDD A;  1BR2 A;  4AIJ A;  1E3O C;  2R7F A;  4IHW A;  1ZKG A;  4A3J J;  2MC3 A;  3WHC A;  5J8C A;  3FXK A;  5EGO A;  3FBI B;  3ZRG A;  1NTC A;  3M8F A;  4NUB A;  3FMQ A;  1MKM A;  4G6D A;  2JMW A;  3BR1 A;  3RKW A;  5A2Q K;  1U8B A;  1X2N A;  3M1C A;  3ZMZ A;  2V1D A;  3V8K A;  3WTV C;  1ZR4 A;  2KT0 A;  1IN6 A;  4HX8 A;  3TDZ C;  4CYC B;  1MJA A;  1HA8 A;  3A4C A;  4IRH A;  1Z21 A;  2VJJ A;  3HTU A;  2W24 A;  4JX6 A;  4BY7 J;  3GXO A;  3TO6 A;  5IYD J;  4BE1 A;  1JKQ C;  2Z9O A;  4IJA A;  1VTN C;  4A3B J;  1YX3 A;  3H36 A;  1EH8 A;  5F27 A;  2G7H A;  3F21 A;  1VQ9 I;  2VOD A;  1XGS A;  3CES A;  2YU3 A;  2ME6 A;  3FKJ A;  2HVS A;  3KET A;  2W82 A;  3FZV A;  3WGH A;  3RJP A;  1IDY A;  3BCB A;  1S7E A;  4L9N A;  1KZH A;  1TQI A;  2L4A A;  1FTT A;  2FNP A;  4QIW N;  2XIG A;  5EYR A;  4ZYA A;  4Y13 A;  2CWE A;  3BR5 A;  4XOP A;  5E3L A;  1JI8 A;  4MQV A;  2AHQ A;  2PMZ A;  3EPZ A;  4I76 A;  4IQ4 A;  2QVO A;  1I6H J;  3CDI A;  1ZQ3 P;  3EQL F;  4BDY A;  2XRL A;  2ZCW A;  2COB A;  1RC9 A;  2NOG A;  3LQQ A;  3P9I A;  1JUM A;  3EYI A;  3OYN A;  1W5S A;  4HST A;  3E97 A;  1IJW C;  2JA2 A;  3K2A A;  4I6Z A;  2PEX A;  2D1V A;  4IHT A;  1YS7 A;  2BE5 F;  2IGM A;  1MIJ A;  3L00 A;  2QEN A;  1YQA A;  3BTI A;  3LSK A;  4M6X A;  1LEB A;  4ZDP A;  4J00 A;  1XD7 A;  2CQQ A;  3MD2 A;  4BXF A;  4FCY A;  3KZI C;  3ZR8 X;  3TOB A;  3PSI A;  4OOI A;  1E17 A;  3IP4 B;  4UB6 C;  1TL8 A;  2K9S A;  2DT7 B;  1ZYR F;  3R0J A;  2IT0 A;  2F4O B;  3SZT A;  1T2K A;  3G6E I;  1FYL A;  5E8G A;  2DPD A;  1ZG5 A;  2FJ1 A;  5DUK A;  2A6T A;  3DEW A;  4RBO A;  3PNV A;  4BJ6 C;  4HV6 A;  5M5W J;  1WH5 A;  3DF8 A;  1IUY A;  4MEX F;  3C1D A;  4PDK A;  4F7Z A;  2WC2 A;  3CCM I;  1CGP A;  1ENH A;  2L9S A;  4L5J A;  3SXY A;  2O3F A;  4MEY F;  4XKB A;  2UWM A;  3OR2 C;  2DMQ A;  3IWZ A;  1G59 A;  2Q0O A;  5F0H A;  5M3M J;  3BPV A;  4HDU A;  3ECO A;  4F91 B;  4K2E A;  4XRS G;  3JTG A;  5D4S A;  5D5V B;  3CP8 A;  1PVE A;  1R1T A;  3SHF A;  1S6L A;  3DBL B;  2B7E A;  4LLN A;  2DOA A;  3LAJ A;  3MZY A;  3HRS A;  4J01 A;  3GZN B;  2XAJ A;  2MBF A;  4PSW A;  2ECC A;  2DDA A;  5D5X B;  2HEO A;  1TBX A;  2EWN A;  3M3Y J;  2X1E A;  3H1C A;  5E8I A;  3OYF A;  3OWT A;  1XGO A;  3H3U A;  2E7X A;  4BY1 J;  1RNL A;  3AG3 H;  1IXS B;  4A6D A;  2STW A;  1VF9 A;  2RC4 A;  5GTI C;  3MKY B;  3BR0 A;  5LBQ A;  1JUS A;  2ZB9 A;  1U2W A;  1UST A;  1X19 A;  4DIQ A;  4XLP F;  1XDU A;  4JX4 A;  2RDP A;  1TW3 A;  1FWZ A;  3IUO A;  1LKX A;  3AG2 H;  3ERM A;  4L0Z B;  5M3F J;  3GME A;  3DP7 A;  2C6Y A;  3GFI A;  3TED A;  1UG0 A;  1YE9 A;  2GQQ A;  3CCJ I;  1RIO H;  3CCQ I;  4ESJ A;  1YIJ I;  2ISZ A;  4ZZD A;  5HNF A;  2EA2 A;  5ICG A;  4F55 A;  2EQR A;  1KQ9 A;  5M5X J;  1MH3 A;  4XM3 A;  1USS A;  2KHM A;  4HYE A;  2L7M P;  2LNB A;  3DLA A;  5C44 J;  1XCB A;  5J4Y A;  2OC6 A;  3DBR B;  5HDG A;  3E3V A;  1BJZ A;  2RQP A;  4PJM A;  2B63 J;  2L7K A;  5K5O A;  4MIM A;  2JRM A;  4G8X A;  1JHH A;  1P4A A;  3I64 A;  5IY5 H;  2A61 A;  2PI0 A;  1YRN A;  3T1B A;  3A01 A;  5B5E C;  5F1J A;  3OYK A;  1U6G A;  3IRR A;  2M0M A;  4XL9 A;  4II2 A;  2IS1 A;  2K9M A;  3GW2 A;  1A04 A;  3FMS A;  3LSI A;  1BM9 A;  3HYI A;  2KIM A;  3F6O A;  2GOM A;  1MSE C;  1BOB A;  2IAI A;  1RI7 A;  4L18 B;  1J09 A;  2DA7 A;  4B43 A;  2D2W A;  1WRJ A;  1WPK A;  1SVO A;  2Y75 A;  3RYP A;  2VJ4 A;  3GF2 A;  1OYI A;  4BJT A;  4PK4 A;  1TP4 A;  3WU2 C;  2E34 A;  5FKO A;  4WXD A;  2CV2 A;  3HOT A;  1T0F C;  3CDH A;  4X0G A;  1B1B A;  1JUP A;  3SQN A;  3K69 A;  2IGK A;  4UB8 C;  2GA1 A;  4RB2 C;  2AS5 F;  1OCZ H;  4XLC A;  4XRF A;  3HSF A;  1S7O A;  2NVU B;  2DI3 A;  1I1G A;  1UHS A;  4KUM A;  5L3G A;  2IPQ X;  3JRB A;  3PL8 A;  1W36 D;  2L01 A;  2RQQ A;  5FRN A;  5C3E J;  1HOM A;  4MHG A;  3KX2 A;  1XN7 A;  4A3E J;  2HI3 A;  4EV0 A;  3O8H A;  3AG1 H;  1AKH A;  2XPU A;  3G71 I;  2X6Y A;  4Q5S F;  4ENN A;  3OY9 A;  4MFD A;  4IHV A;  3HOZ J;  3R61 A;  2Z1D A;  2CFO A;  3JW4 A;  3I55 I;  1S8N A;  1H9T A;  1W5T A;  2K02 A;  2ZFU A;  5TIS C;  2EB7 A;  2DFH A;  5ILS A;  4UV8 A;  1EH6 A;  1DU0 A;  4OAY A;  4ZYD A;  3I4M J;  3SFZ A;  1JKP C;  2H1L A;  1GVD A;  1DPU A;  2EJR A;  3Q0W A;  4ON0 A;  3I4N J;  4KN7 X;  1Z3X A;  4WXH A;  2PMH A;  5EG0 A;  3E6B A;  5GAE J;  3CCR I;  3OYA A;  2Q2E B;  1VND A;  1X2M A;  2BGC A;  3ABT A;  3VSK A;  1O3S A;  3QYF A;  3W3C A;  3CCV I;  3L09 A;  2DOD A;  2CS3 A;  1K78 A;  2BW3 B;  2RNG A;  2X6W A;  4XQF A;  2FUG 2;  2EZI A;  2YU9 J;  2K40 A;  3CD6 I;  2M3A A;  4PUS A;  4B09 A;  1TNT A;  2L0K A;  3HB9 A;  3KP2 A;  4ZDO A;  5F0C A;  2EBI A;  2CGP A;  1MBG A;  2PN6 A;  2BY1 A;  2W25 A;  3E5U A;  1MBK A;  1OMI A;  3C7J A;  4I01 A;  4R1H A;  1EF4 A;  4RAY A;  3F22 A;  4M3E A;  2CW0 F;  1BIB A;  3TBI A;  1JT0 A;  1VQL I;  1DGR M;  2QSF X;  4G12 A;  4E6K G;  5IP7 J;  3F23 A;  2R5Z A;  2LF8 A;  1XG1 A;  2JWT A;  5ED4 A;  1S7A A;  1BOA A;  4C3H J;  3OYH A;  2R7Z J;  2WY8 Q;  3KLN A;  4OIO F;  2WV0 A;  4KJZ A;  5F08 A;  3ESW B;  1EH7 A;  1XGN A;  2RV8 A;  5LEK A;  4BE2 A;  1ZAR A;  4ZC3 A;  1UJ8 A;  4N4O B;  1B9M A;  4J19 A;  1FIA A;  1A31 A;  2X51 A;  1R36 A;  1K4S A;  2F4I A;  2P4W A;  4ABZ A;  2O61 A;  3I71 A;  2B0L A;  2L2O A;  2YUS A;  3ML6 A;  3CC2 I;  1BBY A;  1SAX A;  3M1E A;  1JE8 A;  2WAE A;  3UR3 C;  5JFR A;  1FC3 A;  2L4M A;  4EJV A;  3FM5 A;  1Z9C A;  1UZC A;  2VXD A;  3K7A J;  4HV5 A;  2QQA A;  3FIW A;  4BHP A;  1U9O A;  1XDS A;  4E7L A;  2KIQ A;  3K4C A;  4Y3O A;  2FSW A;  1XPX A;  1IZ1 A;  4GGG A;  2E1C A;  3ZMS A;  4EM0 B;  1LFP A;  2CJJ A;  1ORK A;  2LFB A;  2WTE A;  3LFK A;  4A5M A;  1AU7 A;  5HS9 A;  4XLN F;  3JSO A;  1V55 H;  3NWS A;  1XMA A;  3S1Q J;  3RPU D;  3RZD J;  3HPG A;  2V79 A;  3HOX J;  3QQA A;  4KIC A;  3TL4 X;  3RPQ A;  1J9I A;  4UUS B;  3BWG A;  3K10 A;  1U9N A;  1V3F A;  1FIP A;  2R7V A;  3NAU A;  5L3E A;  4BS9 A;  5L3B A;  4FQG A;  3JRH A;  3DKY A;  2VJ5 A;  4FX4 A;  4KIG A;  3ZP5 A;  2M2E A;  3L9F A;  4ENJ A;  2ICW G;  2PG4 A;  3DXJ F;  3HHH A;  4NBQ A;  4HNV A;  2KRF A;  1R5H A;  3B6A A;  2PFB A;  2LRD A;  2VC1 A;  5GAH J;  2R4G A;  1HW5 A;  4G94 A;  4Y15 A;  3DWL E;  3JRA A;  2N8G A;  5HDK A;  2CO5 A;  2LTP A;  4ESF A;  2BEO A;  3JAM K;  1H9G A;  1GLN A;  2A68 F;  2VOO A;  1NK3 P;  3V7C A;  4MNU A;  4OAZ A;  2A5Y B;  1CF7 A;  4EVI A;  2LP0 A;  4A5N A;  1HKS A;  1TWA J;  1D0Z A;  2GOX B;  2HDW A;  3DEE A;  3BTC A;  2W57 A;  4X6A J;  4GDF A;  2CFX A;  4HF1 A;  2W00 A;  3FXQ A;  2DA6 A;  5CVV A;  2XVC A;  3K6G A;  3QU6 A;  4S05 A;  3S2H J;  2Y2Z A;  1I3A A;  4GYG A;  2P81 A;  1Z3Y A;  3LWF A;  2EK5 A;  2M9H A;  1GV2 A;  3FXO A;  3KP7 A;  3DEU A;  1T56 A;  4XSZ F;  2MH2 A;  3H5R A;  1V5G A;  2DMT A;  5K7Z A;  9ANT A;  1SFE A;  2KJB A;  3DLL F;  4OIR F;  1LE8 A;  4ITV A;  3LMM A;  4JQF A;  1YIO A;  3OIO A;  2DOF A;  4XN3 A;  4LGW A;  3BT9 A;  2ZFW A;  1FBU A;  1E3H A;  1Z91 A;  1GUU A;  2BZT A;  2ZXH A;  3PO2 J;  3PNT A;  4PCQ A;  1QA6 A;  1YG2 A;  3I3L A;  3FXJ A;  1BW6 A;  4N0B A;  3A0H C;  1E3P A;  3NWT A;  4I09 A;  1U0J A;  4DYR A;  2M30 A;  2XGX A;  5KAF C;  3DTE A;  3RSN A;  1QZY A;  4H4K C;  2V9K A;  3GTG J;  2NS7 A;  3I4P A;  5FLV A;  2ZXJ A;  3WE2 A;  2P0W A;  4HZF A;  2CSO A;  4BXX J;  1BI0 A;  5KNL A;  3KFW X;  5DEQ A;  4HEA 2;  2MW8 A;  4F92 B;  3RDI A;  5EEG A;  1OR7 A;  3SZG A;  3J7A Y;  5CQE A;  2CRG A;  2P7C B;  2FQ4 A;  2JSC A;  1L0O C;  3U1K A;  3L2W A;  1X3W B;  2QBY A;  1DDN A;  1G2H A;  5DCM B;  2CQN A;  3HZJ A;  2JUG A;  2QLZ A;  1QVT A;  3K9T A;  3BR2 A;  4BEH A;  4F93 B;  4XMY A;  1FNN A;  1Y0U A;  3LSH A;  4L5I A;  3WTY C;  1ON1 A;  1YRN B;  1S29 A;  3FXM A;  4KIF A;  5CVI A;  2V7F A;  2HXO A;  2QSG X;  3V7S A;  1D5V A;  3MCZ A;  2FBI A;  3GLX A;  2CW7 A;  2XB0 X;  4XSX F;  4OIQ F;  3K4L A;  2GXB A;  2HU9 A;  2K5C A;  3HIF A;  2MAB A;  1I27 A;  3IH3 A;  2M7B A;  1MMD A;  2XAS A;  4CYD A;  2F5F A;  4N4N B;  1DU6 A;  1IV8 A;  2HOT A;  2KPM A;  1F5T A;  5DD8 A;  1IRZ A;  5FKN A;  4F52 A;  2GXG A;  1LQ1 A;  4LG0 B;  4B8X A;  1KGS A;  4CCM A;  1AA7 A;  4M9Z A;  2L7F P;  3HKZ N;  3DTK A;  5LEJ A;  3BOQ A;  1YS6 A;  1PUF A;  1QNT A;  2DBB A;  3AKZ A;  2Q8K A;  4JX5 A;  5J6X A;  3DPU A;  5EDN A;  1K4T A;  5CQG A;  1XMX A;  5H6Q A;  4RGS A;  3OYB A;  3O8G A;  3AAF A;  2HZT A;  1WSU A;  1V5E A;  3E6C C;  3Q0V A;  5KCM A;  4I2O A;  3ULQ B;  1FEX A;  3M8E A;  3QYB A;  4B4C A;  2FBK A;  2XB5 A;  3MZH A;  2DA5 A;  2X1D A;  3CUQ A;  4IF4 A;  4HNU A;  3HPH A;  1MW7 A;  4AIK A;  4QSH A;  1RET A;  3RQI A;  2BV6 A;  3ELK A;  1UMQ A;  4EJW A;  3REO A;  1FX7 A;  3CCE I;  1AKH B;  3WTW C;  1DGW Y;  5DM7 F;  2FML A;  4BAC A;  1LVK A;  4O3M A;  1B72 A;  3S16 J;  2PX9 A;  4OWR B;  3G1O A;  1WHU A;  2K7L A;  3MKZ A;  2OTL I;  3VPR A;  1YI2 I;  1LJ9 A;  4AC0 A;  1D3Y A;  3HRT A;  2E2H J;  5JR3 A;  1RR7 A;  3JCU C;  4FE7 A;  1YJW I;  2R7D A;  3SEZ A;  2NOJ B;  4RM2 A;  3QRF F;  1C0W A;  4XBF A;  4IOA F;  1HSJ A;  4IQJ A;  2HPI A;  4IRI A;  1ZGA A;  3P5J A;  3ZN1 A;  2MGQ A;  3TO7 A;  3QPT A;  3S2W A;  3TP0 A;  4FE4 A;  1RRJ A;  3IH2 A;  2NRA C;  1W7P B;  2QQ9 A;  3DKW A;  2KQR A;  3K4N A;  1FZP B;  1BIA A;  2VKD A;  4IPA A;  1HCR A;  3CMM A;  3WGI A;  3E6D A;  1S5L C;  2R7R A;  2K9N A;  1OCT C;  2HOE A;  3BJ6 A;  2Z16 A;  3PUF A;  3IL2 A;  5B1A H;  4BKX A;  5IT9 Z;  1IN8 A;  2QQ8 A;  4Z2Y A;  3FMR A;  5AIQ A;  2DLL A;  2H6B A;  1SC7 A;  2HKO A;  2K4B A;  4BE0 A;  1FOK A;  5ICF A;  1OFC X;  1YTY A;  2V1X A;  1B4A A;  3GTP J;  2DMP A;  1HC8 A;  2L54 A;  1F9N A;  2LK2 A;  3BR6 A;  1V4R A;  4CCL A;  1TW2 A;  2FNA A;  4D7M A;  3ASN H;  2P6S A;  4Y7N J;  1SFU A;  2M87 A;  3ZQC A;  2JA8 J;  3H3V K;  1G6N A;  3LQR A;  1IDZ A;  3MMY B;  4H0E A;  2CUZ A;  1X1A A;  4XRS A;  1G3T A;  1P6R A;  1FSE A;  1T98 A;  1K83 J;  2FU4 A;  3Q3S A;  1MBJ A;  1X1P A;  4ZYH A;  2M4K A;  1B6A A;  2ID3 A;  3OS0 A;  3OOU A;  2BHY A;  1LPQ A;  1L3L A;  2ADU A;  1QHH D;  2QA4 I;  1KA8 A;  2XGC A;  4U88 A;  4A6E A;  3HOY J;  1H89 C;  3VB2 A;  4B47 A;  3U2R A;  5HNH A;  3U1D A;  5K5Q A;  1WKM A;  3L7W A;  1YJ9 I;  5HOO A;  4E7S A;  3OS2 A;  1IN4 A;  1ZRF A;  1TLH B;  1X1D A;  1QZE A;  4ZDL A;  1OPC A;  2EV6 A;  5FGM A;  2WB1 N;  1D1B A;  2DA2 A;  5GTH C;  4P1W A;  5IP9 J;  1LDJ A;  2XV4 S;  2CMP A;  2GWR A;  4RGU A;  5ERI A;  5CYV A;  2HFH A;  3HBL A;  4KDP A;  2IW5 A;  4E7K A;  1SD7 A;  2AQE A;  2I8D A;  1HXD A;  1LEA A;  1UHW A;  5J1R A;  2VE9 A;  5BS6 A;  1K6Y A;  5JVG F;  4A3C J;  3K2Z A;  2KP6 A;  2FOW A;  2E1M C;  2JN6 A;  2Z99 A;  5HLT A;  1FYM A;  2XC7 A;  2CU7 A;  3GTJ J;  2LDU A;  4O6J A;  3FF5 A;  4HBL A;  4A3D J;  3GWZ A;  3H9G A;  1N75 A;  3OS1 A;  3TOA A;  4Y4R A;  1CQT A;  2OU2 A;  1P2F A;  3PO3 J;  3J7A O;  5HLG A;  2OUM A;  3QYE A;  5BPD A;  1TQP A;  2XRO A;  5IT9 K;  5B3S H;  4QTR A;  2YSR A;  2R3S A;  2ZJQ F;  2F6C A;  1D1A A;  3GCM A;  3H35 A;  3P7N A;  3H92 A;  4B3X A;  2RVC A;  4RS8 A;  4HPQ A;  1I50 J;  3E7L A;  3FXL A;  4MTE A;  3L2V A;  3A1Y A;  3QAH A;  5FO5 A;  1IN5 A;  2DAO A;  2VBY A;  1S9H A;  4Q4Z F;  5EF6 A;  2UV1 A;  3U9G A;  1HKQ A;  1AHD P;  1UG2 A;  3ZMU A;  5J1Y A;  1ZRE A;  2GXA A;  1ZG1 A;  4AUX A;  3OYI A;  1WI3 A;  5D6E A;  2WAF A;  2O5R A;  1K6O A;  1AWC A;  3C18 A;  2M8E A;  1ETV A;  1WFX A;  3I59 A;  2UXX A;  4X1E A;  2R7U A;  1X58 A;  1ZG3 A;  4WWC A;  4V19 K;  2Y48 A;  2F48 A;  4U7B A;  2XGD A;  4I98 B;  1ZTR A;  3BY6 A;  3R0A A;  2PMU A;  2QCO A;  1KQ0 A;  2GLO A;  5E18 F;  5E1X A;  4ANJ A;  1CF7 B;  4EMS A;  1VQ4 I;  3OL4 A;  1ETW A;  3COA C;  1PP7 U;  2W4S A;  4B1R A;  4XLF A;  3B02 A;  3BQZ A;  2LY1 A;  3F0C A;  4DYQ A;  1FJL A;  3BRO A;  5FKM A;  3GEZ A;  2WWY A;  3W2V A;  4P5O A;  4CDG A;  2LF7 A;  2LKS A;  3DTI A;  3E5X A;  2O6G E;  2KRC A;  2HYF A;  4E7J A;  1OLT A;  2V6C A;  5JI6 A;  3KZZ A;  2Y30 A;  4FAS D;  5E79 C;  2F5V A;  2L5Q A;  4HNT A;  4G7Z F;  5J47 A;  1TT0 A;  1Z6R A;  2FX0 A;  2ZNZ A;  2VKE A;  2HWV A;  3S8P A;  4IHX A;  1DP3 A;  4BNC A;  4NQW A;  4XKW A;  4C3J J;  1YW8 A;  2HQR A;  4ZJZ A;  4KMF A;  3G1M A;  5EEH A;  1ACI A;  4G7O F;  5J3L A;  3LSR A;  1U5T A;  4PJN A;  3CJQ B;  3HM5 A;  1OJL A;  5FKK A;  4BDZ A;  1ETX A;  2E1M B;  3OR1 C;  2KIF A;  4V2G A;  4XOT A;  2A6E F;  1Y8R B;  5F64 A;  2V9V A;  2E5N A;  3C2H A;  4C9Y A;  5IOY A;  1MBF A;  1ZLK A;  1Z1D A;  2STT A;  2V1U A;  1YW7 A;  4CCO A;  4ZYE A;  1APL C;  1YJN I;  2HOS A;  2ZKZ A;  2BYV E;  2LBF A;  4XKC A;  4OIN F;  2Q1Z B;  4MTD A;  4DZJ A;  1VQ8 I;  1MNM C;  4L5E A;  1RR8 C;  1QO0 D;  3HOS A;  3CC7 I;  3GTK J;  2LD5 A;  5E3N A;  1A6I A;  2TCT A;  3GZ5 A;  4GRI A;  1ETO A;  4I0B A;  4EGY A;  3MN2 A;  1VQP I;  5E3O A;  1XCV A;  2ZO4 A;  3RPU A;  2OAZ A;  1FT9 A;  1VZ0 A;  2OD5 A;  3J7Y J;  4BEH B;  1JGS A;  5LFA A;  4XLH A;  1ZRD A;  2O03 A;  2MYS A;  3CJN A;  3HRM A;  2XGE A;  4BQN A;  1O4X A;  2RRE A;  4A12 A;  5LGU A;  2ELJ A;  2FQ3 A;  2LG4 A;  2DK5 A;  4RA2 A;  1E0E A;  2W84 A;  5DS9 A;  3EUH A;  4XR6 A;  5CPR B;  5CLS A;  4BU2 A;  3LOC A;  4Z6Y A;  5M5Y J;  4ENM A;  3OYJ A;  2LYC A;  2QKL B;  1QPM A;  4U87 A;  1S72 I;  3E1S A;  5LLQ A;  1TWC J;  3QWL A;  2PBI A;  3HEF A;  4KIT B;  5HLI A;  4E7Z A;  2DTZ A;  3LSM A;  2COM A;  4E70 A;  2DYS H;  1W4M A;  2ESH A;  3L2Q A;  2QEX I;  1WJE A;  1D5Y A;  4B44 A;  2RGV A;  3OOP A;  1TWG J;  2E35 A;  3K70 D;  3O2P E;  3H5N A;  4A0X A;  1PDN C;  3HRU A;  4HLX A;  4NC7 A;  4CSW A;  4IKF A;  2AXL A;  1PUF B;  3OSG A;  4DBQ A;  1I39 A;  2HQA A;  4U0W A;  1WJD A;  1GV5 A;  1WJF A;  3EDP A;  4CCJ A;  1FY7 A;  2A69 F;  3GBG A;  1Z6T A;  3BR3 A;  5IP6 A;  4CO8 A;  1T8I A;  3G1L A;  4KIS A;  3X2Q H;  4XKV A;  4M6V A;  1D0Y A;  4G9Y A;  2ME0 A;  5CKT A;  3WU0 A;  3I53 A;  2JT1 A;  3FHN A;  1ZEL A;  4A3K J;  1MND A;  4XOR A;  2R7Q A;  1JT6 A;  1I5Z A;  3Q0U A;  4G6Q A;  4A2U A;  5TRD A;  3V4G A;  1YYV A;  4CZZ A;  1GT0 C;  1W36 C;  3J7Z I;  1MNE A;  4U7D A;  2X1C A;  3GLL A;  2K85 A;  3BC8 A;  3MKL A;  1B8I B;  2M0C A;  3MKW B;  1Z0X A;  1XS9 A;  1I6X A;  5HOD A;  2HR3 A;  3TQN A;  3ZPL A;  1BI3 A;  1MBE A;  2EZL A;  1R6R A;  1RPW A;  4NNJ A;  3H9Q A;  4II3 A;  2P5L C;  1SFX A;  1IW7 F;  2F5E A;  2L7Z A;  3R4K A;  2OZ6 A;  2OF7 A;  1Q1H A;  3IKT A;  4ASN A;  3GYH X;  1QRY A;  3V8J A;  3FIS A;  3D1N I;  2DK8 A;  4LB6 B;  1EV7 A;  4CZC A;  5JLW A;  1XX5 A;  3HSR A;  2KDO A;  4D5F A;  5EGO B;  5E3M A;  2EV0 A;  3LA2 A;  3F3X A;  1X4O A;  3WG9 A;  1ULY A;  2E7W A;  2EPF A;  1TQM A;  2MG4 A;  2HPM A;  4YG2 F;  4YRV A;  4N9H A;  4FIS A;  1T6S A;  2G0E A;  4RB0 A;  3HUG A;  5LRR A;  1M1E B;  4BJ5 C;  4KA4 A;  1TWH J;  2CV0 A;  4CYC A;  4TV7 A;  4MFE A;  1DUX C;  4C30 A;  1SD4 A;  3HL2 A;  4S04 A;  2CG4 A;  2MSY A;  2XPV A;  3I9V 2;  3K1N A;  1YIT I;  2DFI A;  2JSP A;  4LLL A;  4BHC A;  3J80 Z;  4C3I J;  3BZC A;  2VON A;  2XAG A;  1FOY A;  4PGG A;  2OZU A;  5LRS A;  5DCF A;  2HOA A;  1MD0 A;  4I7H A;  4P96 A;  3LNQ A;  1EKE A;  2MC4 A;  2DXI A;  6PAX A;  3Q9V A;  3T5X A;  5FRM A;  2MLK A;  3IHU A;  3G2B A;  3F9K A;  2EFQ A;  1JKR C;  1T38 A;  3OYG A;  4BUP A;  3ASO H;  3LST A;  1J2X A;  2G7U A;  1FYK A;  4C2U A;  4CCK A;  2FBH A;  2EFP A;  2BHZ A;  2WY7 Q;  1REP C;  2VBZ A;  3O3K A;  2EIL H;  3TKY A;  1VQM I;  5GPA A;  1YW9 A;  3FK6 A;  1OKR A;  4EM1 A;  1A35 A;  4EQQ A;  2KIS A;  5CVR A;  2W48 A;  4AWX B;  4HW0 A;  1SAN A;  4NHJ A;  4AU7 A;  1LFU P;  1G3S A;  4UUT A;  2L3D A;  1FOW A;  4M3G A;  4CIC A;  1NH3 A;  2F5C A;  5GPC A;  4AVP A;  2DT5 A;  2KZG A;  1ZGW A;  3S17 J;  5IOZ A;  5AIP A;  1FPQ A;  3RZO J;  5LGT A;  2BXZ A;  3WTT C;  5CVU A;  5IPA A;  3SDB A;  3PQJ A;  1G3Y A;  4NC8 A;  3FX3 A;  2HDD A;  3A2K A;  3HOU J;  2DYR H;  2L9R A;  3MZ8 A;  3P9C A;  3ZXS A;  3HHG A;  1E2X A;  3SDG A;  3DU5 A;  2K4J A;  1XC5 A;  3JR9 A;  1ODD A;  2XDV A;  4RM3 A;  1F4K A;  1UCR A;  4XLA A;  1R22 A;  1ETQ A;  2IP2 A;  3LAP A;  2KLO A;  5LHH A;  1T33 A;  3SFI A;  4OMY A;  1Z05 A;  3HGG A;  5BQT A;  5IT3 A;  5K7F A;  4EGZ A;  1U8R A;  4EJT A;  3MAJ A;  4YFK F;  1A6Q A;  1D8J A;  2E2J J;  3ZQI A;  3OSF A;  1IRG A;  3ABL H;  2GAU A;  2EIK H;  2XKO A;  4Y33 A;  4UUV A;  1FTZ A;  3K1P A;  4IHY A;  1P4W A;  2RNJ A;  3OIQ A;  3CCS I;  2VJI A;  2IGN A;  3I59 B;  1Y1V J;  2JA7 J;  5ICE A;  2OQG A;  5D4R A;  3IV5 A;  2LRE A;  2ID6 A;  5FKL A;  3L2U A;  3DKX A;  4HF0 A;  3S32 A;  5B66 C;  5EZG A;  3JRE A;  4YIR X;  3CTA A;  3G73 A;  2VLA A;  4HLY A;  1IXR C;  1AOY A;  2ETH A;  3L1P A;  4LIV A;  3IKV A;  5F1R A;  1O57 A;  3K4M A;  1OCO H;  1R5G A;  4M3B A;  4NC6 A;  4UVB A;  1YO5 C;  3S93 A;  2EIM H;  3WTZ A;  2YX7 A;  3V42 A;  3BPX A;  1BL0 A;  1SD5 A;  2LLK A;  2VBX A;  3FBN B;  3WTX C;  2M1B A;  3G3Z A;  4BL0 B;  5J4V A;  4XON A;  4OMZ A;  4UXN A;  3M8J A;  3FHZ A;  2W1O A;  3HOV J;  4A3G J;  2FMY A;  2MD0 A;  5DD4 A;  1G4D A;  2ZXI A;  2HTJ A;  1QU3 A;  4FX0 A;  4CGZ A;  2X6O A;  2TDX A;  2XF7 A;  1G8X A;  3PJR A;  5KVR A;  4LLG F;  3CQZ J;  3KCC A;  4DOZ A;  5FFZ A;  2NVX J;  3S3O A;  4BXU A;  1YHQ I;  1VQ7 I;  1IRX A;  3SEQ A;  2R93 J;  2JZY A;  2PQ8 A;  4Y17 A;  2UXN A;  1IRF A;  2Y31 A;  2CQK A;  2JUC A;  2VIX A;  3KYL A;  4PJL A;  1YLF A;  2DW4 A;  2PJR A;  1D0X A;  2ELH A;  2CYY A;  3KYC B;  4HA8 A;  5L3F A;  2LR8 A;  2HTS A;  3V8L A;  2ZJP F;  1SVM A;  3QP6 A;  3K4K A;  2DCE A;  2ISY A;  5BPI A;  2WV1 A;  1R5I D;  1TWF J;  2XAF A;  2O8K A;  4BGD A;  2IXS A;  2LOO A;  1UB9 A;  4DJA A;  4JP0 A;  2Y0S N;  1D8K A;  4AVZ A;  3A01 B;  1O3Q A;  2NVY J;  1U78 A;  1OIS A;  1QHG A;  5K7H A;  2HYJ A;  3PUB A;  4IEJ A;  2DMN A;  2RKH A;  2XSJ C;  4E4H A;  2R7O A;  5H2F C;  1QZZ A;  4RAG A;  1MMA A;  3CP2 A;  1DQU A;  1VQ6 I;  2EIJ H;  4XLE A;  3BG5 A;  3PIP F;  1OQY A;  3AFH A;  4M9S A;  3IH4 A;  3ZQH A;  1Z7U A;  2VPL A;  5LD2 C;  3ABM H;  4UVA A;  1ERD A;  3S1M J;  3KP6 A;  2VPR A;  5TGT A;  2IEK A;  1R7J A;  4BHB A;  1UHM A;  1T08 B;  2E1N A;  3QPL A;  2EIN H;  5DYM A;  4NDL A;  3FKI J;  1TNS A;  4A0Y A;  5FFX A;  2VKV A;  2XUB A;  2H94 A;  3Q5F A;  5BOX A;  2O8X A;  2KJC A;  2DFF A;  2ESN A;  4BQO A;  2R7X A;  2M45 A;  3PFY A;  2VAS A;  3KLO A;  5HVQ C;  1FMV A;  1K7A A;  2OTJ I;  3CJR B;  4RAZ A;  1IAW A;  2X85 A;  3I0T A;  1YOV B;  4DNC A;  3ERE D;  2Z3Y A;  3HKZ A;  5AON A;  2A3S A;  2DFE A;  3OYL A;  3BZK A;  2BBY A;  1QGP A;  3PFI A;  2VXZ A;  3KEY A;  3VDX A;  3KEO A;  4L9J A;  4A3L J;  3CCY A;  3EYY A;  3W6K B;  2LY9 A;  1VQN I;  1ZHF A;  3V7R A;  2Y9Z A;  3JRF A;  3DCF A;  2H8W A;  3NQO A;  3IAS 2;  1IO2 A;  1HQC A;  3PNY A;  1KYW A;  4I0A A;  3C3W A;  4IVN A;  4I02 A;  2I10 A;  1KU2 A;  3KEQ A;  4W1U A;  2EFW A;  1UAA A;  1P7J A;  2FA5 A;  2BY2 A;  4M3D A;  3LSG A;  1FSH A;  2TRT A;  4GO1 A;  4OU0 A;  1P92 A;  5EG0 B;  4M9X A;  1VQO I;  2W85 A;  3S15 J;  2V6E A;  1ZLJ A;  3K0L A;  1VFC A;  2DN0 A;  2P5V A;  3K1M A;  2QWW A;  4Y52 J;  1XSV A;  4RGX A;  3I54 A;  2CQX A;  1K78 B;  3GO5 A;  4LFU A;  2BW3 A;  4EEF G;  4RDU A;  4HAM A;  4S0H B;  3GTL J;  4YEJ A;  4E7I A;  2R92 J;  1KU3 A;  4JBA A;  4N9I A;  3EUK L;  2HS5 A;  2IS2 A;  4JOM A;  4MQ9 F;  2XKP A;  3PQK A; 
#chains in the Genus database with same CATH homology
 2AO9 A;  4AYB N;  2CUE A;  5J3L A;  3LSR A;  2D5V A;  5IP7 J;  3HM5 A;  2R5Z B;  1IUF A;  1OJL A;  2R5Z A;  5FKK A;  1XG1 A;  1ETX A;  2DA1 A;  2JWT A;  4V2G A;  2VI6 A;  5IOY A;  4C3H J;  1MBF A;  4W97 A;  2R7Z J;  1APL C;  4DZP A;  2EZH A;  2HOS A;  5F08 A;  4J19 A;  1FIA A;  4DZJ A;  2NVT J;  2EH3 A;  1BA5 A;  1MNM C;  4L5E A;  3TW7 A;  1W0T A;  3GTK J;  2PMZ N;  4ABZ A;  2LD5 A;  5E3N A;  3LSP A;  2OPT A;  2YUS A;  1A6I A;  2TCT A;  3JRI A;  1ETO A;  4A3M J;  1GDT A;  3MN2 A;  5E3O A;  3ZQF A;  1HF0 A;  1JTX A;  1QPI A;  3K7A J;  2R5Y A;  1RES A;  2XGE A;  1O4X A;  3FK7 A;  4XK4 A;  3HGY A;  3FIW A;  5EZH A;  1U9O A;  3UKG A;  2E19 A;  4A3I J;  3S14 J;  1HDP A;  5DS9 A;  3LOC A;  5M5Y J;  5C4X J;  4GFB A;  2H1K A;  3W6V A;  1QVU A;  1ORK A;  2CJJ A;  2LFB A;  1AU7 A;  2E1O A;  1TWC J;  2HXI A;  3HEF A;  2DTZ A;  1TC3 C;  3S1Q J;  3RZD J;  2X48 A;  1WH7 A;  1MSF C;  3A03 A;  3HOX J;  3QQA A;  1D5Y A;  2X9D A;  1TWG J;  4UUS B;  4UUS A;  1IG7 A;  1U9N A;  2NS8 A;  1FIP A;  2YS9 A;  2GM4 A;  3NAU A;  2JA5 J;  2DA3 A;  1H88 C;  5BNG A;  3JRH A;  1PUF B;  3OSG A;  3C2B A;  1RKW A;  2Y9Y A;  2M2E A;  4BBR J;  3CMY A;  5JLX A;  1GV5 A;  4HNV A;  5F04 A;  1IC8 A;  3GTQ J;  4XRM A;  3B6A A;  3GBG A;  3BR3 A;  5IP6 A;  2XPW A;  1ZR2 A;  3G1L A;  2WAQ N;  3JRA A;  2NVQ J;  1ZK8 A;  2FD5 A;  1K61 A;  5IYB J;  2N8G A;  4M6V A;  2LTP A;  2LKX A;  5EEA A;  5J1U A;  1NK3 P;  2ME0 A;  2O7O A;  4A3K J;  1JTY A;  2JA6 J;  2LP0 A;  3MVP A;  3LSJ A;  4MLO A;  1TWA J;  1JT6 A;  3Q0U A;  3BTC A;  4X6A J;  2KDZ A;  1GT0 C;  3A02 A;  2R0Q C;  3CDL A;  2DA6 A;  3MKL A;  1B8I B;  2M0C A;  1B8I A;  3S2H J;  1Z0X A;  2Y2Z A;  1XS9 A;  5HOD A;  2P81 A;  2H8R A;  2M9H A;  3BG3 A;  1GV2 A;  1MBE A;  2EZL A;  1RPW A;  1T56 A;  5K7Z A;  2VUM J;  2DMT A;  9ANT A;  4LOC A;  2L7Z A;  1LE8 B;  4DW6 A;  1LE8 A;  2OF7 A;  5GP9 A;  3OIO A;  1OCP A;  3HDD A;  1QRY A;  3BT9 A;  3FIS A;  5F0F A;  1E3O C;  1ZKG A;  3D1N I;  4IHW A;  1GUU A;  5JLW A;  4A3J J;  3PO2 J;  1ITY A;  3WHC A;  3ZOB A;  4D5F A;  5EGO B;  1WGX A;  5E3M A;  5EGO A;  1NTC A;  1BW6 A;  2JMW A;  3BR1 A;  3BTL A;  2XSD C;  1U8B A;  1X2N A;  2MG4 A;  4DYR A;  5C4J J;  4FIS A;  3GTG J;  1ZR4 A;  2G0E A;  2KT0 A;  2NS7 A;  5FLV A;  1F43 A;  1TWH J;  4CYC B;  4CYC A;  1SFO J;  4BXX J;  4MFE A;  2ECB A;  3ZQG A;  4JX6 A;  4BY7 J;  5IYD J;  2MSY A;  2MW8 A;  2XPV A;  1JKQ C;  2CRG A;  5FLM J;  2QF7 A;  3JRD A;  1W0U A;  2FQ4 A;  4A3B J;  4C3I J;  5F27 A;  3NAR A;  1G2H A;  2ME6 A;  2HOA A;  3LNQ A;  1QVT A;  3BR2 A;  1IDY A;  1JKR C;  1S7E A;  1YRN B;  1FTT A;  4QIW N;  2HXO A;  5EYR A;  5GPA A;  3FK6 A;  3HOW J;  3BR5 A;  5E3L A;  2AHQ A;  2XB0 X;  2LVS A;  4I76 A;  2W48 A;  1SAN A;  1I6H J;  1RKT A;  1ZQ3 P;  1LFU P;  1Y1W J;  3IH3 A;  4UUT A;  2XRL A;  2COB A;  3RKQ A;  4M3G A;  2NOG A;  1JUM A;  5GPC A;  3S17 J;  4D5C A;  1ZGW A;  3RZO J;  5IOZ A;  1IJW C;  1HLV A;  1DU6 A;  2HOT A;  3K2A A;  5IYC J;  1IRZ A;  5FKN A;  4I6Z A;  5IPA A;  1MH4 A;  4A93 J;  2HDD A;  3HOU J;  2L7F P;  3HKZ N;  3BTI A;  2L9R A;  1R9T J;  3TW6 A;  1PUF A;  3SDG A;  1Q1V A;  1XC5 A;  1VI0 A;  2CQQ A;  4JX5 A;  3JR9 A;  5EDN A;  4FCY A;  3BQY A;  1ETQ A;  3O8G A;  1JJ8 C;  2DA4 A;  3Q0V A;  2K9S A;  1T33 A;  2JK3 A;  3SFI A;  1FEX A;  4B4C A;  2XB5 A;  1NK2 P;  3HGG A;  1F36 A;  1A5J A;  5K7F A;  2DA5 A;  1MBH A;  4QSH A;  1RET A;  3RQI A;  3ZQI A;  2E2J J;  1UMQ A;  3OSF A;  2FJ1 A;  3DEW A;  4MO7 A;  1AKH B;  3PM1 A;  4RBO A;  3M4O J;  1FTZ A;  5M5W J;  1WH5 A;  4IHY A;  1IV6 A;  5DTD A;  1B72 B;  1Z77 A;  1B72 A;  1ENH A;  3S16 J;  3S1R J;  3G1O A;  1Y1V J;  2JA7 J;  3VPR A;  2DMQ A;  3IV5 A;  5M3M J;  5F0H A;  3S1N J;  4AC0 A;  3H0G J;  2ID6 A;  5FKL A;  2E2H J;  5EZG A;  3JRE A;  4XRS G;  3ZQL A;  1RR7 A;  4FE7 A;  3L1P A;  4M3F A;  2MGQ A;  4M3B A;  3TP0 A;  2DMU A;  4FE4 A;  1BL0 A;  2ECC A;  1WCM J;  3IH2 A;  4BBS J;  3M3Y J;  3GTO J;  2LLK A;  1HCR A;  2K9N A;  1OCT C;  4BY1 J;  3HOV J;  4A3G J;  1VF9 A;  4BKX A;  3BR0 A;  1JUS A;  2ZB9 A;  2X6O A;  4JX4 A;  2JJ7 A;  4A69 C;  3QPS A;  3CQZ J;  3BTJ A;  5M3F J;  2NVX J;  1OFC X;  3BG9 A;  4A3F J;  3TED A;  2DMP A;  3GTP J;  2R93 J;  2LK2 A;  3BR6 A;  1IGN A;  1HDD C;  4D7M A;  2Y31 A;  2O9L A;  4Y7N J;  3H3V K;  2JA8 J;  3ZQC A;  4D7N A;  2EQR A;  5M5X J;  1MH3 A;  1IDZ A;  4XRS A;  2L7M P;  2LR8 A;  5C44 J;  1JGG A;  1K83 J;  3Q3S A;  1MBJ A;  1BJZ A;  2ID3 A;  2B63 J;  2WV1 A;  3OOU A;  1TWF J;  2O8K A;  3HOY J;  2XGC A;  1H89 C;  4MIM A;  4JP0 A;  2Y0S N;  1YRN A;  3A01 B;  3A01 A;  2NVY J;  2HQ5 A;  5F1J A;  1U78 A;  5K7H A;  4V2F A;  1JKO C;  2HYJ A;  4IEJ A;  2WB1 N;  2DA2 A;  2DMN A;  5IP9 J;  1ETY A;  4FTH A;  3HBL A;  2R5Y B;  1MSE C;  2IAI A;  5J1R A;  3BG5 A;  2DA7 A;  4A3C J;  3S2D J;  3IH4 A;  3ZQH A;  1LFB A;  1WPK A;  5FJ8 J;  2JN6 A;  3JRC A;  2CU7 A;  3GTJ J;  3S1M J;  4A3D J;  1POG A;  5FKO A;  1P7I A;  2VPR A;  1CQT A;  2IEK A;  3PO3 J;  2M8G X;  1JUP A;  3QPL A;  4NDL A;  3FKI J;  4QTR A;  3TP3 A;  2DJN A;  2VKV A;  1UHS A;  1I50 J;  3E7L A;  3JRB A;  3B6C A;  2CUF A;  5C3E J;  5EF6 A;  1HOM A;  1JJ6 C;  4B3A A;  1AHD P;  1UG2 A;  2HI3 A;  5J1Y A;  4A3E J;  3O8H A;  1AKH A;  2XPU A;  4AUX A;  1WI3 A;  2GBY A;  1ETK A;  1ETV A;  4MFD A;  4IHV A;  3HOZ J;  4X1E A;  3JRG A;  1X58 A;  3SJM A;  4A3L J;  3CCY A;  1I3Q J;  2LY9 A;  2XGD A;  1ZTR A;  2EZK A;  2Y9Z A;  2QCO A;  1DU0 A;  3JRF A;  2E2I J;  3DCF A;  4C2M J;  2GLO A;  3I4M J;  1JKP C;  2I10 A;  4W1U A;  1GVD A;  1P7J A;  1ETW A;  3Q0W A;  4M3D A;  4B1R A;  3LSG A;  3I4N J;  2TRT A;  3BQZ A;  3F0C A;  4DYQ A;  5EG0 B;  5EG0 A;  1FJL A;  5FKM A;  3S15 J;  3WHB A;  1VND A;  2DN0 A;  1VFC A;  1X2M A;  1BW5 A;  1H8A C;  4Y52 J;  2CQX A;  4XIC A;  2EZI A;  4EEF G;  4RDU A;  2YU9 J;  2K40 A;  2Y30 A;  4JYK A;  4S0H B;  3GTL J;  3HB9 A;  2L0K A;  2M34 A;  5F0C A;  2EBI A;  2R92 J;  2FX0 A;  1MBG A;  4DYC A;  2VKE A;  3GTM J;  2RAE A;  1MBK A;  4IHX A;  1EF4 A;  2K9Q A;  4C3J J;  4M3E A;  2IBD A;  1JT0 A;  3G1M A;  4XID A;  2ELK A;  4G12 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...