1OCPA

Solution structure of oct3 pou-homeodomain
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
67
structure length
67
Chain Sequence
METLVQARKRKRTSIENRVRWSLETMFLKCPKPSLQQITHIANQLGLEKDVVRVWFCNRRQKGKRSS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of the Oct-3 POU-Homeodomain in Solution, as Determined by Triple Resonance Heteronuclear Multidimensional NMR Spectroscopy
pubmed rcsb
source organism Mus musculus
molecule tags Dna binding protein
molecule keywords OCT-3
total genus 13
structure length 67
sequence length 67
ec nomenclature
pdb deposition date 1995-02-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00046 Homeodomain Homeodomain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.60 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Homeodomain-like 1ocpA00
4C2MJ 1T56A 5FKNA 1B72A 2R5YA 5EF6A 4JX4A 3BR3A 2KT0A 1QVTA 3PO3J 3G1MA 4IHVA 2JWTA 4DYCA 2GLOA 1U9OA 2M9HA 2WAQN 1IDZA 2DMUA 2N8GA 5BNGA 3I4MJ 1AKHB 2NVXJ 3CCYA 1OFCX 3IH2A 1IV6A 1JT6A 1U8BA 2Y2ZA 2VKVA 4A93J 3H0GJ 3HB9A 4D7MA 1VNDA 1ZR2A 2FD5A 5IP6A 2ME6A 5C4JJ 3JRDA 5IPAA 2JA7J 2MGQA 5F1JA 2CQQA 3S16J 1WH5A 3H3VK 4G12A 3GBGA 1GVDA 4JX6A 3RKQA 5F04A 3JR9A 3Q0WA 2O8KA 1JJ8C 2Y0SN 4IEJA 1IGNA 1WPKA 1BW5A 2M8GX 1ETOA 1MBHA 5FKKA 1AU7A 3IH4A 2R5ZB 1HLVA 1GDTA 2R7ZJ 4JP0A 2CRGA 3HOXJ 4A3GJ 3CQZJ 3Q3SA 2CU7A 5IOYA 4IHYA 5F27A 1HOMA 5FLMJ 5F0FA 2QCOA 4S0HB 2CJJA 1RETA 3G1LA 1WI3A 1JTXA 2E19A 3ZQIA 2JMWA 1IJWC 1PUFA 4A3DJ 2XB5A 4AC0A 4DYQA 1HDPA 3BR5A 1MBKA 1U9NA 5EG0A 1JGGA 1NK2P 2ID6A 3LSRA 3FISA 5J1RA 3S2HJ 2EZLA 5JLWA 4BKXA 2R92J 2DMPA 3S17J 3OIOA 3BQYA 2X9DA 3DCFA 5J1UA 3S14J 3BR2A 3UKGA 5GPAA 1IUFA 2VPRA 2XGCA 1MH4A 4A3KJ 2H1KA 2DJNA 4AUXA 2B63J 3E7LA 1LFBA 5F08A 3SFIA 2R93J 2R5YB 2CUFA 3BR6A 3C2BA 1JKQC 5J1YA 1XS9A 2E2IJ 1ETXA 4X1EA 4D5FA 3HOUJ 4A3IJ 5IP7J 1GT0C 5FKMA 4X6AJ 1FEXA 1R9TJ 1U78A 3GTPJ 2PMZN 1ITYA 2O7OA 2GBYA 1LE8A 2NVTJ 2ECCA 2E2JJ 1TWGJ 2AHQA 4CYCA 5FKLA 2LVSA 4A3LJ 1I3QJ 4EEFG 2LY9A 4FE4A 2M2EA 3HM5A 4D5CA 3RQIA 4FCYA 1WH7A 3JRIA 1UG2A 3TW6A 1DU6A 3I4NJ 5C3EJ 1F43A 2EZKA 4MO7A 3JRHA 1IRZA 1BJZA 3QPLA 4I6ZA 2DA5A 1POGA 2JK3A 3GTKJ 5EGOB 2OF7A 1CQTA 3JRCA 3BT9A 3HGYA 2TRTA 3FKIJ 4A3MJ 3A03A 5EG0B 2DA3A 2XGDA 5M3MJ 1SANA 3A01B 1JKRC 1FJLA 1HF0A 1F36A 1OCPA 1K61A 2YUSA 4XICA 3Q0UA 5FLVA 1H89C 1Y1WJ 1OCTC 2TCTA 9ANTA 3BQZA 1FTTA 2E1OA 3A02A 4RBOA 2DA7A 4FTHA 2D5VA 1P7JA 3HKZN 3Q0VA 4GFBA 4RDUA 1GV2A 2Y9YA 4M3DA 3BR0A 4BXXJ 5C4XJ 1W0UA 5IYBJ 4UUSB 3IH3A 3GTOJ 4XIDA 3IV5A 1MBFA 4A3BJ 5E3NA 3K2AA 4Y7NJ 2GM4A 1TWCJ 1JUPA 4FISA 4MFEA 5E3MA 2L7ZA 1ORKA 1Y1VJ 5FJ8J 2W48A 4NDLA 2ECBA 4V2FA 1AKHA 2X48A 1A6IA 1GUUA 4M3GA 2WV1A 1RKTA 3LSJA 1IDYA 1LE8B 4AYBN 5M5XJ 1ZQ3P 2LD5A 2P81A 5F0HA 1HDDC 2ME0A 5C44J 3S1NJ 2YS9A 3GTJJ 3HGGA 2LKXA 2NVYJ 3ZQGA 3M3YJ 3D1NI 1TC3C 2IEKA 1VI0A 3B6AA 2AO9A 1S7EA 4V2GA 1I6HJ 4W1UA 5FKOA 4JX5A 1UHSA 3HEFA 1BA5A 1G2HA 3ZQCA 1MSEC 1SFOJ 2R5ZA 2HOTA 1BW6A 1A5JA 1JKOC 5EZGA 5IYDJ 1XG1A 1IC8A 4A3FJ 2VI6A 1ZK8A 2K9QA 3FIWA 4BBSJ 3CMYA 5EGOA 5K7HA 2H8RA 3CDLA 2LR8A 5DTDA 1ZKGA 3MKLA 1E3OC 1UMQA 3HDDA 2DMNA 1TWAJ 2EZHA 4XRMA 1MSFC 1Z0XA 2XPVA 2KDZA 1JKPC 2Y9ZA 3QQAA 1PUFB 1YRNA 1ZGWA 1ETKA 2XGEA 3RZDJ 2CQXA 4CYCB 2COBA 1ETYA 5M5YJ 1EF4A 4DW6A 4C3HJ 3TW7A 3OSGA 4C3JJ 4DYRA 1RKWA 2M34A 2I10A 4M3BA 4UUTA 2JN6A 2XSDC 3RZOJ 3BG3A 3BTJA 2HOAA 4IHXA 3F0CA 2K9NA 3BG5A 3LSPA 5HODA 3OSFA 3O8HA 2DA2A 2VUMJ 1DU0A 2LFBA 1JUSA 4IHWA 1MBEA 3BTIA 4M3EA 4A69C 1QPIA 3JRBA 2ZB9A 3LOCA 2G0EA 1OJLA 2NVQJ 2DA4A 1JTYA 3O8GA 3M4OJ 2XPUA 1FIPA 1MBJA 3HOYJ 4QIWN 2X6OA 2XB0X 2HXIA 3W6VA 1VF9A 2WB1N 4HNVA 1XC5A 5DS9A 2EQRA 4LOCA 1MBGA 3ZQFA 1P7IA 5EZHA 1T33A 4BBRJ 4D7NA 2FX0A 1JUMA 3L1PA 4UUSA 3G1OA 3NARA 3S1QJ 3BG9A 4Y52J 4MIMA 3WHCA 2NS7A 2Y31A 5IYCJ 5M3FJ 2MW8A 1W0TA 1MNMC 1H88C 1D5YA 1GV5A 3HOWJ 3ZOBA 2IBDA 1ETWA 1X2MA 2LK2A 1TWFJ 3B6CA 3QPSA 5K7FA 1O4XA 1NTCA 2M0CA 2QF7A 3JRAA 5GPCA 2K9SA 5E3LA 1I50J 3MVPA 2FJ1A 3SDGA 2OPTA 4DZPA 1IG7A 1RR7A 2XPWA 3A01A 4A3EJ 3MN2A 3VPRA 4W97A 1FIAA 3FK7A 3HBLA 1ETQA 5E3OA 1AHDP 4XRSG 5J3LA 5M5WJ 2EH3A 3JRGA 3GTQJ 3TP0A 2EZIA 1WGXA 1QVUA 3ZQHA 1LFUP 4M6VA 2JA5J 4B1RA 3BR1A 5JLXA 2Y30A 2MSYA 2JJ7A 4L5EA 2XRLA 3S15J 3ZQLA 3SJMA 2LP0A 4MLOA 4DZJA 2IAIA 3LNQA 4B3AA 1BL0A 2HDDA 5GP9A 3K7AJ 2DMQA 1QRYA 3TEDA 3HOZJ 1ETVA 2NOGA 1ZR4A 5K7ZA 1B72B 3BTLA 2DN0A 5IOZA 1RPWA 2CUEA 2ELKA 2HXOA 2HI3A 2MG4A 1MH3A 5EYRA 5F0CA 3TP3A 4QTRA 2K40A 3JRFA 2R0QC 1K83J 2ID3A 1ZTRA 1JT0A 2JA6J 2LLKA 3S2DJ 1ENHA 3DEWA 2NS8A 4A3CJ 4QSHA 2EBIA 1VFCA 3BTCA 4J19A 4B4CA 1YRNB 4JYKA 3HOVJ 2DA1A 1FTZA 5EEAA 4M3FA 2L0KA 1Z77A 1RESA 1X58A 2L9RA 2O9LA 2HOSA 4BY7J 1B8IB 1WCMJ 2HYJA 2DTZA 2YU9J 3JREA 2FQ4A 2VKEA 1X2NA 4FE7A 1H8AC 3GTLJ 4C3IJ 3S1RJ 1APLC 1B8IA 4MFDA 3PM1A 1JJ6C 3GTMJ 3OOUA 4I76A 2RAEA 5EDNA 3NAUA 4ABZA 2LTPA 4BY1J 5IP9J 1TWHJ 1HCRA 2DA6A 3FK6A 1Q1VA 2DMTA 4XK4A 2HQ5A 3WHBA 2L7MP 3GTGJ 4XRSA 3LSGA 4A3JJ 2L7FP 3S1MJ 1NK3P 3PO2J 2JA8J 2E2HJ
chains in the Genus database with same CATH superfamily
3BWGA 1T56A 2M4KA 1FWZA 2V79A 2KT0A 2E5ZA 5FLXK 2JWTA 3BY6A 2V9VA 2GLOA 1U9OA 2Z1DA 3LSIA 3RDIA 4BYYA 1PDNC 1O7FA 4Q47A 4XOPA 3LFUA 2H94A 2QYOA 1K4SA 3ASNH 2ZFWA 1HW5A 3CCLI 3TMOA 2KIUA 2ZMEA 1IV6A 1O57A 3TDUC 4OAYA 2HDCA 2LKSA 5TRDA 2Y2ZA 2PI0A 1OLTA 2DOEA 1WRJA 1ZR2A 2R3SA 5DDGA 3O6BB 4UY8I 1NG6A 3G2BA 3T0YA 4BJ6C 3JRDA 2RKHA 1QQIA 3H9JA 3F9KA 2GXAA 1LDKB 2F6CA 4OMYA 2A6TA 3D0SA 2D45A 2CQQA 1S6LA 1WH5A 2ESNA 4IQJA 4G12A 4XLPF 3WU2C 1K7AA 1GVDA 4MTEA 3H5NA 2JVGA 5J47A 2O8KA 3GFJA 3IWFA 1UELB 2EA4A 1BW5A 2FNAA 2M8GX 2M30A 1GDTA 4Q4ZF 3FM5A 2R7ZJ 2CRGA 3WTSC 3HOXJ 2O6GE 3F21A 3CQZJ 2OUMA 1SC7A 1D1AA 3MFKA 3OL3A 2GAUA 4HOBA 4IHYA 4PDKA 1HOMA 1FYLA 5F0FA 4S0HB 1B59A 4MHGA 4O3MA 4L0YB 1U5TC 1OYIA 1USSA 2HOEA 1IAWA 3G1LA 4FT8A 2F5DA 2VODA 2IS1A 2Q0OA 2KQRA 3LA2A 2L4MA 3FMSA 4HX8A 3DP7A 1K6OA 2VKDA 2VE9A 2VASA 5H2FC 2UUZA 3FISA 1BM9A 2BW3A 3AAFA 3BZ6A 2HR3A 3ZQQA 3CO7C 2HKOA 3S2HJ 1A31A 2MABA 3I0TA 4EVIA 3S17J 4LJZF 4RAGA 3WE3A 1ON2A 2X9DA 1QO0D 3S14J 3BG7A 1VZ0A 1BIBA 1IUFA 2P7VB 1MH4A 4AIHA 1QBJA 2YPRA 4C30A 2B63J 2AXTC 1P6RA 4LMYA 2R5YB 3IL2A 3ULQB 1YTYA 5D6FA 3BR6A 2WA0A 3CJTB 1SEUA 4BDYA 4HF1A 3PIPF 5HVQC 1XS9A 2EIJH 2E2IJ 4LK0F 4ZTFA 4D5FA 1R49A 1GT0C 4KA4A 1U78A 1DDNA 2GIVA 2GBYA 2ZMEC 1LE8A 5DCMA 2ECCA 2HWVA 2NVTJ 3KP3A 4AIKA 1IXCA 1NG7A 3L2VA 1BI1A 3GZNB 1Z9CA 1P2FA 2AHQA 1N75A 5FKLA 4I09A 4A3LJ 2O0YA 1R36A 3M8FA 1IXRC 2M2EA 1VQ4I 2BW3B 2Y75A 3SZPA 3IRRA 4L5IA 3JRIA 3TW6A 4XLEA 4RB0A 1W5TA 4MO7A 5D5WB 1LB2A 3ABLH 2JTVA 2KDOA 3JRHA 1MDMA 4I6ZA 2JK3A 5EGOB 2EWNA 3BT9A 5TJJA 4A3MJ 5HDGA 1JI8A 2DA3A 2DT6A 2XGDA 1WKMA 1HBXG 2HNHA 3CCMI 1OCPA 2CW0F 3FM3A 1BC8C 5FLVA 3JTGA 1MKMA 3HUGB 1XSXA 2TCTA 4U88A 4KICA 3ZMDA 4E7KA 4L9NA 1Z3XA 3SEQA 3JAMZ 1Z3YA 1SD6A 1YOVB 1R5GA 2LKPA 4GYIA 1IN5A 4UB8C 3H0DA 1LDDA 3EUHA 4RBOA 4FTHA 4G6DA 2D5VA 1FP1D 1S29A 4WX9A 3H35A 3BR0A 4BXXJ 2M4GA 3C2GA 4HG2A 4MNUA 1Y8QB 4LIVA 1W0UA 2DLLA 5IYBJ 3HRUA 1R22A 1V4RA 2QEXI 4UUSB 4HLYA 1B4AA 3RQ4A 2IGNA 2M8EA 2WV0A 4DIQA 2OBPA 2R7QA 5KAIC 3RKWA 3IRQA 1LKXA 3LWFA 4HPQA 4MFEA 4CICA 4XLNF 1D8KA 1LQ1A 3MQ0A 3E3VA 4FETA 2VE8A 4P96A 2ECBA 2ICWG 1AKHA 1EKEA 1O7LA 1XDSA 3QYFA 2CH0A 3OYCA 2KP6A 5JR3A 2XGXA 4M3GA 4XLAA 5HDNA 3E0JB 3OYDA 5DD8A 1IDYA 2D2WA 3HG9A 4AVPA 2DAOA 2P81A 2AXLA 4HBLA 5F0HA 2YS9A 2NNNA 3L00A 3KFWX 2LF7A 2MBFA 1TC3C 2A69F 1VI0A 3B6AA 1TZLA 2AO9A 1O3QA 3EUKL 1I6HJ 1MJ9A 1ZG1A 1L3LA 4W1UA 1UHSA 4KISA 2ZNYA 1BA5A 1G2HA 1G8XA 3ZQCA 1MSEC 1B1BA 1FT9A 2FEZA 3H5AA 1JKOC 5IYDJ 4IRHA 2VN2A 1MJAA 1X1PA 2V1DA 4A2UA 3LSHA 2M87A 5EGOA 4ENNA 3F8MA 1X1BA 3MZ8A 4RMNA 2H8RA 4QLCU 2NOJB 4EJVA 4NC8A 5D6EA 2QGUA 4E7JA 2EZHA 1D0ZA 3K9TA 2DDAA 3I53A 5LRRA 3SDBA 4XRMA 1Z0XA 2XPVA 3ABTA 4YIIA 3W3CA 2ZNZA 1R4MB 1DPUA 2KHMA 2P5KA 3KYCB 2R7XA 2OU2A 2XGEA 2JT1A 4EM2A 3SQNA 3HL2A 1FOYA 2B7EA 4DNCA 3T1BA 4KITB 2QSHX 2V1NA 3TW7A 2NYXA 1G3SA 4UUTA 2HZTA 2CV0A 1KQ9A 1BBYA 2E5NA 1K79A 3F0CA 2G9WA 3LSPA 1TQPA 2E7WA 4CGZA 2ELHA 4V19K 2K4JA 3A4CA 3RKYA 3E1SA 3WE2A 1ZREA 1MBEA 4KDPA 3IKVA 3BTIA 3VDXA 4A69C 1I1GA 1QPIA 2COMA 4IX7A 3ZGKA 2ZB9A 1HSJA 2DA4A 2K5CA 4ZDOA 4Y15A 2XPUA 1FIPA 2A6EF 3HOYJ 2KRHA 2GOXB 5FFZA 3HRMA 4RM3A 2TDXA 4XONA 3MZHA 2HVSA 1VF9A 2WB1N 4IO9F 4HNVA 1EH7A 1HKSA 2JPCA 3HZJA 1VQNI 2QA4I 2EQRA 1FC3A 3HOSA 4M72A 4CUGA 4D7NA 3IHUA 2FX0A 2MH2A 3TOBA 1F5TA 5LGTA 3L1PA 1RI7A 4Q48A 4PFOA 3ZCOA 4K2EA 3S1QJ 3E5XA 4MIMA 3F8FA 1J2XA 3C2HA 3CLQA 5M3FJ 2A05A 1EV7A 1MNMC 2IXSA 4C9YA 5ILVA 2E36A 5LGNA 2DFFA 3J80Z 1SAXA 4PJ0C 2LK2A 1TWFJ 3B6CA 2V9PA 1BR2A 1NTCA 2QF7A 2VQLA 2K9SA 3BG6A 3V7RA 4MEYF 5E18F 1UCRA 3SDGA 2GZWA 3GEZA 4R8HA 3MCZA 3FXUA 1X3WB 5FLXZ 4HX7A 2VT3A 3FBNB 3GLLA 3C1DA 3PQJA 3JSOA 5H6QA 3VEPA 5HLIA 3HBLA 2VB6A 1ETQA 4ANJA 1VQPI 4WXHA 2E7XA 5IT3A 2DXIA 2H6BA 1E3PA 3DKXA 5CQGA 1WGXA 3H92A 1KZHA 1QVUA 1ULYA 2JA5J 5HLTA 4AIDA 4EGZA 5KVRA 3VSLA 1QHGA 4PGGA 4BGDA 3DKWA 3J80K 1LFPA 4L5EA 2OZ6A 2ZSIB 4BJ5C 4HQMA 1SD7A 1WJAA 2LP0A 2E34A 1YS6A 4MLOA 5BPDA 3L09A 3RJPA 1XPXA 2A61A 3CJRB 3T8TA 2HDDA 1TT0A 3KEOA 2LC2A 2XSJC 4G8XA 2NNYA 1JXSA 3HSEA 1B6AA 3DXJF 4EMSA 4II2A 2O3FA 3HOZJ 3SZTA 5K7ZA 4HDVA 2DN0A 3EQLF 3QPTA 4H0EA 2RN7A 2LY1A 2PN6A 2HXOA 2HI3A 4E7ZA 3FHZA 3CCQI 2IA1A 1IJWC 3K4LA 2R0QC 1F1ZA 2IW5A 1CGPA 2ID3A 2JA6J 1W5SA 1ZLKA 1DQUA 1MMNA 1T6SA 2EBIA 2F48A 1VFCA 1Z7LA 4B4CA 2OC6A 4RLQA 1YIOA 5CVVA 3COAC 4CZCA 1R6RA 4M3FA 4RGUA 2L9RA 3GFLA 1TQIA 4AD9A 1JE8A 3CJQB 2CFXA 5HLHA 2HYJA 3FMRA 3O3KA 4N4NB 1OYYA 3JREA 2KFDA 1W7PD 2RQPA 4FE7A 3HHHA 1H8AC 2RQQA 3VODA 1APLC 3K4NA 4FQGA 4JOMA 5HS7A 4MFDA 5ICCA 3DTKA 3CC2I 3WGIA 1X3UA 1KGSA 1RUOA 4F7ZA 3CUQB 5FFXA 1S7AA 1NH3A 4BQAA 1MNEA 2JRTA 3VYRB 3GTMJ 5EDNA 2ZSHB 2C6YA 2BVLA 4KIGA 5F1RA 1Z05A 2L02A 1I5ZA 4UVCA 2BBYA 3ABMH 4B09A 2LH9A 1TW2A 1SVMA 4RGRA 1ZG5A 3MZYA 4OIPF 1Z21A 1QZEA 4A0YA 2L7MP 3HKZA 3OYIA 3CCJI 1HW1A 3U9GA 3VFZA 3C3WA 1LVAA 5J6XA 3GFMA 2IJLA 1LNWA 5FKNA 3G71I 2R7OA 3CDIA 2W85A 2CG4A 3DLLF 3MMYB 1QVTA 2KRCA 1WJBA 1J7KA 1PVEA 3G1MA 3WTTC 1BN5A 4DYCA 2JUCA 2VC0A 5B1AH 1IF1A 3K6GA 1HA8A 2Z2SB 2N8GA 5K1YA 3T8RA 3LA3A 1IO2A 3R4KA 2OQRA 3VSKA 4DOZA 6PAXA 1I1SA 3F8NA 2KKOA 2CQNA 2HPIA 3I55I 4ENKA 4A93J 1RC9A 3HB9A 4LLGF 4RGXA 1VNDA 2FD5A 5IP6A 2ZJRF 2OCEA 4J00A 2XIGA 1E0EA 1B9NA 4F3QA 3I64A 3L2UA 2R7UA 1ZRCA 2JA7J 1S8NA 3OOPA 5F1JA 3PL8A 2X6WA 5LBQA 3LA7A 3H3VK 4O5VA 3FXOA 2LREA 3PQKA 2LYCA 2PBIA 5EEHA 2HVQA 1MMAA 4P5OA 5F04A 4ZDLA 2UZKA 4IEJA 5LD2C 2DO7A 1Q1HA 1ETOA 2K9LA 1AU7A 2R5ZB 4BACA 4JP0A 1RR8C 3AG3H 3Q3SA 5LEJA 5IOYA 2A07F 2P6SA 1OCRH 2KJCA 2DFEA 2M7AA 4G7HF 2LBFA 5F27A 2M1BA 3E97A 3GCMA 5ICFA 2BYVE 4XBFA 1LEAA 2Z16A 5K5QA 5FLMJ 3HJEA 3SEZA 4PZJA 2CJJA 3OIPA 2MC4A 3OYMA 2DW4A 3FF5A 2CUJA 2XV4S 4U0VA 3R0JA 2YU3A 5DUIA 1Z7UA 1PUFA 3MKZA 3N97A 4A3DJ 2BHZA 4HNUA 1HDPA 4ITVA 3BR5A 4EJWA 2F5FA 1ZRFA 3J7AO 1U9NA 3OMYA 4U0WA 4A5NA 2LOOA 1OCOH 1X1DA 3ROUA 1OR7C 4PUSA 3CP8A 1QA6A 2PLYA 4OIOF 5JLWA 2R92J 1BJAA 2YR2A 1ZHFA 4B8XA 3BQYA 3TO9A 3I4PA 3D5RC 4EQQA 3ABKH 3FX3A 1I27A 4IPAA 1KQ8A 3CLOA 1FBQA 4FASD 4B44A 2DJNA 4XM3A 1NHAA 2VJ5A 2MLGA 2XF6A 2ZC2A 3I9V2 1LFBA 4HX4A 5F08A 3ZMVA 1PUEE 4OIQF 1OCCH 3SFIA 3WODF 4CSWA 3HSFA 3L2CA 1XMAA 2EPFA 4U7BA 3H5RA 3ZXSA 2RV8A 1EH6A 1ETXA 4X1EA 2V6EA 5IP7J 1FEXA 1UJ8A 3HXLA 3GTPJ 1ITYA 2PMZA 1CF7A 2DTRA 3KIOA 3HYIA 4LD5A 1XCBA 3LAPA 1TWGJ 3V8LA 1WSUA 3KCCA 1I3QJ 4IL6C 3NRVA 4GYGA 2LY9A 1H9GA 4RB3C 1WH7A 1YITI 4F92B 5JFRA 4HV6A 2L5QA 1REPC 1KQ0A 2FBHA 3AFHA 5C3EJ 4JBAA 5J4VA 1RZ4A 2EV0A 1POGA 3HGYA 1WJEA 3GLXA 4E70A 2BOLA 2L54A 5D5XB 2BGCA 5M3MJ 4UB6C 1JKRC 2G7UA 5AIPA 2QZ8A 3OYKA 1K61A 2YUSA 2CQ7A 3UNGC 4JK1X 3Q0UA 1PP7U 2WAQA 3RIRA 1H89C 1MD0A 3LQRA 2JA2A 1XN7A 2ZCWA 2HTSA 4UVBA 2O03A 2KRFA 4BAYA 9ANTA 2EV5A 1SD4A 4IHTA 1YW7A 3BPVA 3HKZN 4KUMA 1GV2A 5BPIA 1T08B 4XR6A 4IOAF 4YELA 4NNJA 2QQAA 4NC6A 2L3DA 3RYRA 4GGGA 2ADUA 3BC8A 1D0YA 1MBFA 1ZGAA 4CYDA 1FP2A 3K2AA 1TWCJ 1U5TA 1J9IA 2KIQA 3U1DA 2VXZA 2L9SA 1VQMI 2RVCA 5FJ8J 3CMMA 4NDLA 3DEUA 4V2FA 4RAFA 4IKFA 4ZYHA 2J5OA 2X48A 5E8GA 3OYGA 1GUUA 3LSMA 1TTYA 3K1MA 4ESJA 2WV1A 4EJTA 1T95A 5E1ZB 4AYBN 5M5XJ 3K70D 2P5VA 1WJFA 4E7LA 3HGGA 2NVYJ 1EA3A 1G3YA 2QQ8A 2IEKA 2RC4A 2OA4A 4HRIA 5CVRA 3BJOA 1W5CC 4XORA 1TQMA 4LB5A 3BPXA 3TBIA 1WQ2A 3L7WA 5D8LB 5FKOA 2RREA 2E1NA 1A04A 3K69A 4LFUA 4GCVA 2L7KA 1SFOJ 4M6YA 5LEKA 3WTXC 2MLKA 3QRFF 4PFPA 3BZKA 5CYVA 2CQKA 1T38A 2VOPA 1E17A 3OL4A 5BMZA 3EUAA 1K6YA 2DQRA 4EJOA 2M45A 1KU9A 4BUPA 5ICEA 3KZZA 4D9JA 2R7SA 1FX7A 4RB2C 2XAHA 2LR8A 3H36A 3DPUA 5DTDA 2H09A 1W36D 2KISA 3CUQA 4GO1A 2PJRA 2CMPA 2KDZA 2Y9ZA 3M8JA 4B3XA 2PEXA 3M07A 5E8IA 5JHUA 2STWA 1YRNA 1ETKA 3DBLB 1Y56A 3LFKA 1M1EB 2IS6A 1SFXA 5M5YJ 3I58A 3HIFA 4DW6A 1ZH5A 2LDUA 3OSGA 1O3TA 4DYRA 1RKWA 2M34A 2I10A 3OWTA 4M3BA 2JN6A 1GLNA 2EFPA 2XSDC 2BXZA 1BOBA 3CDHA 3QOPA 1XGMA 4IHXA 1CF7B 3DLAA 2DBBA 4CA0A 4LITA 3S3NA 1OISA 1DU0A 4PGHA 4IXAA 2X4HA 5TGTA 5LGUA 3CMAI 3DU5A 4M3EA 3DTEA 4HSRA 3JRBA 3CO6C 1UG0A 1MW7A 3LOCA 2G0EA 1OJLA 3S32A 2FBIA 5GADJ 3U2RA 3O8GA 2B0LA 1ZLJA 3KX2A 2CW8A 2X6OA 3W6VA 2HXIA 1HKTA 4CDGA 5IY5H 2M7BA 3E5UA 2V6CA 4LOCA 4C2UA 3K0LA 3TQNA 4BQNA 1P7IA 5EZHA 4KMFA 1T33A 4HZFA 3KETA 1IV8A 2JSCA 4IOCF 3ESWB 4UUSA 3H3ZA 3IUOA 3GFIA 4BE0A 2NS0A 2HKXA 4XLFA 2Y31A 3M1EA 5DV5A 4HF0A 2MW8A 2OZUA 3ZPLA 1D5YA 1AOYA 3HOWJ 4EV0A 5J4YA 2EINH 3QPSA 2BY1A 5K7FA 2M0CA 2LNBA 3CCUI 4Y33A 1V5EA 3HUGA 2JQ7A 2K9MA 4HAMA 2QWWA 1I50J 2K27A 2FJ1A 5HNFA 1J59A 1QHHD 2QSGX 4A3EJ 3A01A 4RA2A 3VB2A 5GTIC 4CZZA 3GO5A 1FIAA 3EYIA 4IHSA 4HYEA 4R79A 3K70C 3F8CA 2JRMA 3A2KA 5CPRB 3PNTA 5J3LA 1FBUA 2L01A 5DM6F 2BEOA 3PFYA 3AKZA 3I3LA 3MKWB 2W7NA 5CVUA 4RLFA 3CCEI 4P1WA 4CXFA 5DM7F 1LFUP 2UV1A 4B1RA 5E79C 1EJ9A 1TNSA 5DCMB 3S15J 3ZQLA 5L3FA 4BDZA 4CCJA 4DZJA 2K3FA 4XKBA 4B3AA 1BL0A 1YJWI 2ELJA 2O5RA 2CV1A 5LHGA 5L3EA 1I3AA 3K7AJ 2EB7A 4G9YA 4XNFA 4LLNA 1Y6IA 1QRYA 3KYLA 1W36C 3BTLA 2FMYA 4L9VA 1RPWA 2MC3A 3ABUA 1TT5B 1UZCA 2CUEA 4AM3A 2MG4A 3TP3A 1MH3A 3S1RJ 2LSOA 5H6RA 1K83J 5E1XA 3RPUD 5CLSA 2XDVA 1VQOI 2VQGA 2CFOA 1DGWY 4D0PA 4A3CJ 3BOQA 5JVTA 4I2OA 3QOEA 4II3A 3B02A 4KT6A 4AYBA 2WC2A 2DA1A 5EEAA 4MGRA 4X0GA 2L0KA 3KZIC 2O9LA 3QP6A 2FUG2 3O2PE 4NBQA 2ZJQF 2FQ4A 4ZYEA 1IXSB 4KN4X 1ZGJA 1KU2A 2VBWA 3PM1A 3M8EA 5D4SA 4I76A 2F5VA 2XVCA 1LJ9A 1FY7A 2X1CA 3E6BA 3ECOA 3KP4A 4BY1J 5IP9J 4I0BA 1TWHJ 2BXYA 3ZRGA 2ISZA 1Y0UA 2RGVA 3I5UA 3FK6A 4FHTA 2HQ5A 3OS2A 2K3PA 4L5JA 2A68F 1V5FA 4AU7A 3CCSI 4XRSA 3LSGA 4M71A 1ZRDA 3GTGJ 4A3JJ 2L7FP 3B73A 3OYBA 1NK3P 3CMEI 2JA8J 3IKTA 1YI2I 3R60A 3PSFA 3CCRI 1QNTA 1D1BA 1B72A 3S2WA 1SMYF 1O3SA 4L9JA 3F23A 3BR3A 4XN3A 3R6SA 3C18A 4LG0B 2CW7A 2DODA 2M9HA 3KP7A 2EK5A 2WAQN 2X6XA 1VQ5I 1TLHB 3I4MJ 4M9SA 3TO7A 2E1CA 1AKHB 2FSWA 3CCYA 2NVXJ 1BIAA 1OFCX 1JGSA 2HGCA 2DYRH 1U8BA 1ONVA 3ZMUA 1GVJA 4S05A 1YG2A 1FMVA 4CHUA 1F4KA 3KE2A 3ZQ7A 3OYNA 1OQYA 3VOEA 3X2QH 4UNOA 1EH8A 2MGQA 5B1BH 3WTUC 1N25A 2OTLI 4XKCA 3S16J 1E3HA 2WY8Q 5LRSA 1X3ZB 3M9AA 3FZVA 2R7RA 3JR9A 3Q0WA 1F9NA 2Y0SN 4G7OF 1WPKA 3PJRA 5CVIA 3G3ZA 2ZO4A 1MBHA 5FKKA 3V8JA 2WWYA 4RAZA 4MQVA 3WTYC 5JI6A 4XSXF 5HS9A 4F55A 1R4NB 1Z91A 5FD6A 2PFBA 2X1DA 2DT7B 2FA5A 2JPBA 1J5YA 3CJNA 2QQ9A 2FOKA 4YEJA 3WG7H 3E5QA 1WWXA 3MD2A 2DCEA 2E19A 4E7SA 2JMWA 2DJIA 4BQOA 2OV7A 4CO8A 2P0WA 4AC0A 4DYQA 3ONQA 1KA8A 1YYVA 5EG0A 3RYPA 4HSTA 2Y69H 4F91B 3L2RA 1YIJI 1NK2P 4F93B 3LSRA 5K5OA 4A0XA 2UWMA 2DK5A 1S72I 2XAGA 1HQCA 3PNVA 2BE5F 1TBXA 5J1RA 2EZLA 1IN6A 3FXJA 3LL7A 4P9FA 2XAFA 1YJNI 3N05A 1VQ8I 3R0AA 4XKWA 5HNHA 3DCFA 2GXBA 4ZZDA 1IN7A 1KONA 3BR2A 5L3GA 2VPRA 1Z6TA 4A3KJ 2HYFA 1XGOA 2XF5A 1K4TA 4HF2A 2I5UA 3DKYA 4BU2A 3OYJA 3E7LA 1DP7P 3KP6A 4HW0A 4CCOA 3F3XA 2R93J 2CUFA 4KJZA 2FXAA 1IRXA 3DTIA 4WXDA 3QAHA 2F5EA 1JKQC 5A2QZ 3HOUJ 4A3IJ 1FSEA 2WBMA 3W6KB 4HA8A 4X6AJ 4BHPA 1R9TJ 2PMZN 5E1WA 2QM3A 2LF8A 1HKQA 3NWSA 3AG2H 1XTAA 4QPOA 5CKTA 4EEFG 4P9UA 2E1MB 4FE4A 1KYWA 1UAAA 3RQIA 2CSOA 4XMYA 1X4PA 3CCVI 3I4NJ 5AONA 1ODDA 4A6EA 2IT0A 2X85A 4G6QA 4BEHB 1IRGA 1F43A 4HQEA 1DP3A 2W82A 3WGGA 5A2QK 3DBHB 3NQOA 4KIBA 1BJZA 3QPLA 2DA5A 3GTKJ 3PUBA 2OF7A 3SXYA 5D4RA 1XSVA 2TRTA 3WTVC 4ZYDA 3A03A 3ZMSA 5EG0B 3HHGA 1D5VA 3W2VA 1SANA 1S3JA 3A01B 1HF0A 1J75A 1F36A 3IWZA 5FRMA 4DBRA 4A5MA 2HU9A 4E6KG 1YW9A 4RAYA 5FO5A 3CD6I 3MKYB 2CWEA 3ASOH 3KP2A 1T8IA 3BQZA 1FTTA 2E1OA 3ZMTA 1R00A 1MMSA 2DA7A 1P7JA 2QSFX 3Q0VA 4GFBA 4RDUA 4M3DA 2Y9YA 3DWLE 2JSPA 2VKHA 3GMEA 3EPZA 5C4XJ 2DYSH 4OINF 1G4DA 4LLLA 3IH3A 4NQWA 3Q9VA 4YIFA 4GDFA 2KZVA 1ZELA 4XIDA 3TKYA 3IV5A 2W1OA 3BCBA 2DQLA 2DK8A 4Y7NJ 2GM4A 3K4MA 2Y0SA 2XKPA 5DCFA 1JUPA 2V26A 3VYSB 3A1YA 5L3BA 4HEA2 4FISA 3R61A 1T0FA 1XMKA 2ZMEB 1ORKA 2OQGA 1BI2A 2QVOA 2D1HA 1ZARA 2CYYA 3ML6A 3K2ZA 3LMMA 4L9TA 3FWEA 4NQWB 1AA7A 3J7YJ 3CC4I 2EFQA 4LG0A 3LSJA 2P8TA 2VQCA 1SMTA 2DOAA 1FOKA 1U2WA 3F6VA 4G7ZF 5C44J 4L18B 3S1NJ 3GTJJ 2CUZA 2K7LA 2LKXA 3ZQGA 1YX3A 3D1NI 2I8DA 2XRNA 5HS8A 3JW4A 1P9QC 5ICGA 3OS0A 1S7EA 3RSNA 1FPQA 4A0ZA 4V2GA 4GXOA 2LG4A 4UUVA 2F4OB 1BOAA 3LSKA 4JX5A 4EM0B 2XASA 2R5ZA 2Q2EB 1BW6A 4RS8A 1A5JA 2XKOA 4OAZA 5EZGA 2P5LC 2W84A 2A3SA 4A3FJ 4L0ZB 2VI6A 1FBSA 3GUDA 2K9QA 4BBSJ 5D5VB 2DDBA 3ZP5A 3W2AA 1DPRA 5ED4A 3OYLA 5K7HA 4OMZA 3CDLA 2HTJA 2G7HA 3MKLA 1E3OC 1UMQA 3HDDA 2DMNA 4BEHA 2PJRB 1MSFC 4CH7A 2QBYA 1JKPC 4FX0A 3S93A 5FGMA 3QP5A 1PUFB 1MDMB 1K78B 3H3UA 1B9MA 1XCVA 1G6NA 4AVZA 4GRIA 2Q8KA 1WZ2A 2GOMA 4CCMA 4HNTA 5B3SH 4P55A 1ETYA 3SZGA 2MH9A 3E6DA 3K4BA 1EF4A 2GXGA 1R5HA 3H9GA 3NEUA 3V42A 3WU1B 1WHUA 4C3HJ 1Z67A 4CCNA 2L4AA 4C3JJ 3P7NA 2VOOA 4Y3OA 4U7DA 3G73A 3RZOJ 3G6EI 1XDUA 4S04A 2OAZA 5H20A 4BXFA 2VBXA 4Y4RA 5HODA 2HYGD 2BZTA 3O8HA 2VUMJ 3S3OA 2F4IA 2LFBA 2X1EA 2HPMA 3OS1A 4IHWA 3D5LA 5KK1A 1FLIA 1OMIA 2IVMA 2W25A 4BNCA 1KU3A 2AS5F 1OPCA 1RIOH 3OYEA 3BP8A 3M4OJ 1MBJA 4N0BA 2HZDA 1OR7A 2B9SA 2Z99A 5CQEA 4QIWN 2XB0X 3REOA 1FOWA 1R58A 5DS9A 4J01A 1YFHA 2KPMA 2MFZA 2VONA 5F6FA 2FNPA 4IF4A 2MD5A 4UV9A 1P4WA 4BBRJ 1W7PB 2QBYB 1JUMA 3H1CA 4C2TA 2WB1A 3P5JA 4RGSA 3NARA 2EILH 1XSDA 1ZAOA 4UVAA 1YE9A 5B5EC 1IRFA 1U0JA 2CGPA 2F2EA 3KEYA 4LK1F 1W0TA 1HW2A 2LMDA 2PX9A 1H88C 2PMHA 2M3AA 3ZOBA 1X2MA 4ZYGA 3V8KA 2KMUA 3BJAA 3JRAA 2DT5A 2VPLA 5GPCA 1VQLI 3M1CA 3E6MA 1YHQI 2K85A 2XC7A 2IA0A 2R7TA 2OPTA 2DPDA 2NRAC 3DFGA 3EETA 2PG4A 1ZYRF 2XPWA 4B47A 1SAUA 2WY7Q 4PJNA 1QGPA 1YJ9I 4B48A 1JHHA 4XRSG 1ON1A 2M0MA 3GZ5A 4R1HA 4IRIA 5DYMA 2GIZA 4HV5A 5E17F 2EH3A 1UB9A 3FXLA 3JRGA 3GTQJ 3TP0A 3HSRA 2CV2A 3JSPA 1FNNA 1ZN2A 4OU0A 3ZQHA 4M6VA 3AL0B 2ACJA 1R23A 4Y17A 1XGNA 2KZGA 3PUFA 2Y30A 3DBRB 3HPHA 5KCMA 2BY3A 5JLXA 2JJ7A 3CZ6A 2XRLA 3EYYA 3M7GA 3SJMA 2R4GA 2YX4A 2IAIA 3AL0C 1QZYA 5JHFA 5GP9A 2EFNA 1C0WA 3TEDA 1U6GA 1IN8A 1LUJB 1ZR4A 1B72B 5IOZA 2FU4A 2NAZA 4AIJA 4LG3A 3U1KA 1R1UA 4IJAA 2BY2A 1H0MA 1ZTRA 2LLKA 4LGWA 4ZYAA 3S2DJ 2WAEA 1ENHA 3FXRA 2JZYA 3CP2A 1V5GA 2NS8A 3BZCA 3ERMA 4I99C 2R7DA 3RI4A 2EIMH 2F4MB 3BTCA 4J19A 1YRNB 1ZG3A 1FTZA 2M5WA 3DF8A 4LIUA 1U8RA 3OY9A 1GXQA 2AQEA 4BY7J 1WCMJ 1J09A 2DTZA 2MA3A 4YFKF 2VKEA 5LHHA 2GWRA 2ZXWH 4C3IJ 1B8IA 2V9KA 3V4GA 4ASNA 4G6TB 3V7CA 2CO5A 3DEEA 4M6XA 3C7JA 3DPLC 2O8XA 1Y39A 1R71A 4BE1A 4BQQA 3NAUA 4MEXF 1S7OA 1L0OC 4PK4A 1HC8A 1FSHA 4IQ4A 2DA6A 3S8PA 1U3EM 1Q1VA 3ZN0A 2RNJA 3KLNA 2PQ8A 4XK4A 2OTJI 5FROA 1D1CA 3TOAA 3FDYA 2GQQA 2FE3A 1UHWA 3S1MJ 2HS5A 2E2HJ 4XOTA 2IGOA 4C2MJ 2FQ3A 2R5YA 5EF6A 2O61A 1QPMA 4JX4A 2GA2A 3PO3J 2ZXJA 4IHVA 1YLFA 1XMXA 2EIKH 2QQBA 4ZC3A 4E4HA 4M73A 2W00A 3TGNA 1IDZA 2DMUA 5BNGA 1P4XA 4YIRX 1FZPB 2HQAA 1WJDA 3IH2A 2IA2A 3OR2C 1JT6A 1FMWA 1X19A 2VKVA 2RDPA 3H0GJ 3I54A 2UXXA 4D7MA 3L2WA 3SHFA 3Q9SA 1V55H 4U0YA 5IT9Z 2ME6A 5C4JJ 3OYHA 1MJBA 1VQ7I 5IPAA 3I59A 3V7SA 1TW3A 3IAM2 3F22A 3RKXA 4N4OB 5B66C 1XD7A 2BY0A 2EFWA 1BI0A 1H9TA 3GBGA 4JX6A 3RKQA 1SFUA 3GX4X 2Z9OA 4M74A 2A5YB 4EM1A 1JJ8C 3SFZA 3OV8A 2L9VA 1IGNA 3HRSA 2HQNA 3U21A 5CJ9A 1XB4A 2Q2EA 3IH4A 4I0AA 1HLVA 1P4AA 2MD0A 4Z2YA 4A3GJ 2CU7A 3KZYA 1PYVA 2VBYA 5DUKA 1XX5A 2QCOA 1A6QA 1SVOA 3ISPA 4HDUA 2R7VA 1RETA 4G94A 3IC7A 4YFNF 2J5PA 1WI3A 1JTXA 3BDDA 3ZQIA 4I01A 2ISYA 2Z33A 3UR3C 2ESHA 5KAFC 5L3CA 3FMQA 5LHIA 2XB5A 2VL8A 3I56I 1MBKA 5LFAA 4ENMA 1JGGA 2ID6A 2XF7A 3RPQA 5DEQA 3QPHA 2HEOA 5HOOA 3WTWC 3RTRA 4ETSA 1WFXA 4BKXA 2DMPA 3GYHX 1X1CA 4OWRB 1S5LC 4BHCA 3OIOA 1GHCA 1LVKA 4A12A 3QODA 3KEQA 2V4JC 5J1UA 4IVNA 3CC7I 3UKGA 2K02A 2L9NA 4XRFA 5GPAA 5GTHC 2XGCA 3F6OA 3OYFA 2H1KA 5J8CA 1YX5A 3J81Z 1G3WA 4AUXA 2IS2A 2X51A 4U87A 2KIMA 2XUBA 2AQFA 2F5CA 3C2BA 5KHDA 3QWLA 3P9IA 4RM2A 4NHJA 5J1YA 3S3MA 3P9KA 1G3TA 5FKMA 2H8WA 3OR1C 4KMUX 1J0RA 1OYWA 2O7OA 2A5WA 2XAQA 3Q5FA 2E2JJ 4A6DA 3PIOF 2L2OA 3HTSB 4Z6YA 4CYCA 3IP4B 2LVSA 1R1VA 2FOWA 3I71A 3HM5A 4D5CA 1KU7A 2DU9A 2RNGA 4FCYA 3K1PA 3QYBA 1UG2A 3AG4H 1DU6A 4ZZLA 1I39A 1OKRA 4DBQA 2EZKA 2UXNA 1IRZA 4E7IA 4M9XA 1CQTA 3JRCA 3FKIJ 3WG9A 4XKVA 1YQAA 1VQ9I 5D8KB 1VTNC 1Z1DA 2Y0MA 3FHNA 3J7ZI 2QKMB 1FJLA 1RUNA 2BVMA 2YX7A 2IP2A 3GW2A 3ZMZA 4XICA 2VJ4A 1BI3A 2K86A 1Y1WJ 5HDKA 1OCTC 1MMDA 2ZXHA 1W4MA 1SD5A 2ZJPF 5TISC 1P92A 4BE2A 3QU6A 3A0BC 3A02A 5FD5A 2LBFB 4ZH4F 2BHYA 3KYDB 5LLQA 3JCUC 1QZZA 3ZN1A 2HQRA 1IUYA 5JVGF 1HSTA 3ECHA 2VC1A 1IZ1A 2Z3YA 4QPQA 3OIQA 4XLCA 1SFEA 2QKLB 3GZ6A 4H4KC 3EUHC 2DI3A 5BOXA 4OIRF 3GTOJ 1XGSA 4EATA 4ESFA 2WADA 3HC7A 4O6JA 4WWCA 5E3NA 3DQVC 1BR4A 4A3BJ 3P9CA 1STZA 1W1WE 3TO6A 1YO5C 3I59B 3OYAA 1IW7F 5E3MA 1D8JA 3NWTA 2L7ZA 1V3FA 2LRDA 1Y1VJ 2VT2A 2W48A 2HFHA 3K4JA 3TL4X 4KFCA 4B43A 2OD5A 4ON0A 4PJMA 3CTAA 1A6IA 2ZFUA 1D3YA 1ACIA 1RKTA 2H27A 1GXPA 3DV8A 4MQ9F 1LE8B 3FXKA 1ZQ3P 2LD5A 3FKJA 4NUBA 1LDJA 2ME0A 1HDDC 1LEBA 1MMGA 3M3YJ 1Y8RB 4I98B 1DUXC 3A0HC 4XL9A 2QLZA 4BJTA 2XHKA 4WCGA 3HTUA 4RB1A 4XN0A 1YS7A 2Q1ZB 3HEFA 3MEXA 2HOTA 3N4MA 2IRFG 3CF2A 4ENJA 3E6CC 2ZBKA 4IZZA 2ZKZA 3VYTB 1XG1A 4UXNA 1IC8A 4KYWA 1YW8A 1ZK8A 3CUOA 3W2WA 3FIWA 5K5RA 1VQKI 1E2XA 2LY2A 1RRJA 4PSXA 3CMYA 3FXQA 3RCOA 4ESBA 3WTZA 2WTEA 5ERIA 1ZKGA 2DFHA 2DFIA 4XLHA 4AWXB 1JHFA 1KYZA 1TWAJ 4PCQA 5ILSA 2X0LA 4PJLA 3MAJA 3ERED 3QQAA 2E60A 3T5XA 1T39A 4KIFA 1ZGWA 3F8BA 5IT9K 2FMLA 3RZDJ 2CQXA 3KP5A 4CYCB 2VIXA 4EGYA 2P7CB 2COBA 2KJBA 1PJRA 2STTA 3PSIA 2GA1A 2ZXIA 1A36A 5FB2A 4E7HA 3BJ6A 1Z6RA 5FRNA 4EJUA 2XAUA 4UV8A 1USTA 2W24A 1OCZH 5E20A 3BG3A 3BTJA 5EJCA 2HOAA 4NB5A 4IRGA 2R7WA 2K9NA 3BG5A 3H9QA 3JTHA 5BS6A 3OSFA 2DA2A 1N77A 1JUSA 2W57A 1MGTA 3CUQC 2VJIA 1FYMA 2DPUA 2QENA 1LPQA 2P4WA 2HVRA 3K4KA 2CS3A 1R5ID 2NVQJ 3HPGA 4DQ2A 1JTYA 2VXDA 2R7FA 4OOIA 3W6JB 2D1VA 4BXUA 2V1UA 2KLOA 4YFXF 3K4CA 3CF5F 4XQFA 4F52A 2JUGA 1XC5A 3F72A 3LAJA 4M9ZA 1MBGA 3ZQFA 3MWMA 3PNYA 4BHBA 2VBZA 1S9HA 1AWCA 3WU0A 2DOFA 5ILUA 3K10A 3GWZA 1BC7C 3KPHA 1UHMA 3G1OA 4MTDA 2KIFA 1FOXA 3BG9A 4Y52J 3GVAA 3WHCA 4UHTA 3SYTA 2NS7A 5GAGJ 5IYCJ 3GXOA 2VLAA 1T2KA 5AIQA 2H1LA 2FBKA 4HLXA 5GAEJ 3IAS2 2EJRA 4QWQA 5BQTA 1GV5A 2PMUA 5F64A 5HLGA 3RPUA 2IBDA 2X6YA 3FBIB 1ETWA 4N9IA 2V7FA 3VYUB 4WF2A 1O4XA 3ELKA 1G59A 2IS4A 2ETHA 5E3LA 3ZR8X 3BLYA 2FF4A 4ZDPA 4I02A 3MVPA 1T98A 1I6XA 4FX4A 4DZPA 4PJJA 1IG7A 1T0FC 1TNTA 1RR7A 3G4SI 2NVUB 5GAHJ 1WI9A 1TL8A 2EA2A 3D5SC 4NC7A 1SFKA 3QU3A 3MN2A 3VPRA 5D5UB 1W7PA 3LSTA 4W97A 1Y0NA 3FK7A 2ZJ2A 3J81K 4XSZF 2HDWA 1WJ5A 5E3OA 1AHDP 5M5WJ 4ZTJA 3JAMK 2IPQX 4I7HA 3GF2A 1O3RA 4D1QA 5KNLA 2EZIA 5EEGA 3PFIA 1VQ6I 4Y13A 4Q5SF 2P6TA 1U5TB 3BR1A 4YRVA 2MSYA 1N78A 2OCCH 1BR1A 1WJCA 1QU3A 2H6CA 2YSRA 2Z5UA 1FYKA 3CESA 3LNQA 3L9FA 2BV6A 3BCAA 1DGRM 1RNLA 4JQFA 1TP4A 2DMQA 3BROA 4DJAA 4TV7A 2W4SA 1ETVA 2JVHA 1R1TA 2NOGA 2E35A 1MZBA 4PSWA 2VJJA 2ELKA 5F0CA 5EYRA 3WGHA 4QTRA 3JRFA 2K40A 3FXMA 2EFOA 5CVJA 1JT0A 3DU6A 3K1NA 2Y48A 2VQHA 3J7AY 3DEWA 4LB6B 3EDPA 2OJED 1A35A 4QSHA 3HRTA 2V1XA 3L2QA 2QUFA 1IN4A 1X4OA 4CCKA 1K78A 4JYKA 3HOVJ 1MNDA 2A6HF 2WAFA 1Z77A 1RESA 1X58A 3LQQA 2HOSA 3KLOA 5J8FA 1B8IB 2YU9J 3AG1H 4BS9A 1X2NA 3GTLJ 4WK8F 4YG2F 2XAJA 2E71A 4CCLA 4ZJZA 5J40A 3DPTA 1UFMA 3QYEA 1JJ6C 2IGKA 3OOUA 2RAEA 5DD4A 1HXDA 2EV6A 4ABZA 2LTPA 2MYSA 1PP8F 2KL4A 4WXCA 1R7JA 3VWBA 2FRHA 1HCRA 2IGMA 1V54H 4KNYA 2DMTA 4KN7X 1X1AA 1ERDA 1D0XA 1MIJA 3TDZC 4DGWB 4BL0B 3WHBA 5L3DA 3HOTA 2PJPA 1WVRA 4BH9A 2E1MC 2XROA 4KT5C 1SVLA 4N9HA 3PO2J 2K4BA 2NXNB
chains in the Genus database with same CATH topology
4C2MJ 1T56A 5FKNA 1B72A 2R5YA 5EF6A 4JX4A 3BR3A 2KT0A 1QVTA 3PO3J 3G1MA 4IHVA 2JWTA 4DYCA 2GLOA 1U9OA 2M9HA 2WAQN 1IDZA 2DMUA 2N8GA 5BNGA 3I4MJ 1AKHB 2NVXJ 3CCYA 1OFCX 3IH2A 1IV6A 1JT6A 1U8BA 2Y2ZA 2VKVA 4A93J 3H0GJ 3HB9A 4D7MA 1VNDA 1ZR2A 2FD5A 5IP6A 2ME6A 5C4JJ 3JRDA 5IPAA 2JA7J 2MGQA 5F1JA 2CQQA 3S16J 1WH5A 3H3VK 4G12A 3GBGA 1GVDA 4JX6A 3RKQA 5F04A 3JR9A 3Q0WA 2O8KA 1JJ8C 2Y0SN 4IEJA 1IGNA 1WPKA 1BW5A 2M8GX 1ETOA 1MBHA 5FKKA 1AU7A 3IH4A 2R5ZB 1HLVA 1GDTA 2R7ZJ 4JP0A 2CRGA 3HOXJ 4A3GJ 3CQZJ 3Q3SA 2CU7A 5IOYA 4IHYA 5F27A 1HOMA 5FLMJ 5F0FA 2QCOA 4S0HB 2CJJA 1RETA 3G1LA 1WI3A 1JTXA 2E19A 3ZQIA 2JMWA 1IJWC 1PUFA 4A3DJ 2XB5A 4AC0A 4DYQA 1HDPA 3BR5A 1MBKA 1U9NA 5EG0A 1JGGA 1NK2P 2ID6A 3LSRA 3FISA 5J1RA 3S2HJ 2EZLA 5JLWA 4BKXA 2R92J 2DMPA 3S17J 3OIOA 3BQYA 2X9DA 3DCFA 5J1UA 3S14J 3BR2A 3UKGA 5GPAA 1IUFA 2VPRA 2XGCA 1MH4A 4A3KJ 2H1KA 2DJNA 4AUXA 2B63J 3E7LA 1LFBA 5F08A 3SFIA 2R93J 2R5YB 2CUFA 3BR6A 3C2BA 1JKQC 5J1YA 1XS9A 2E2IJ 1ETXA 4X1EA 4D5FA 3HOUJ 4A3IJ 5IP7J 1GT0C 5FKMA 4X6AJ 1FEXA 1R9TJ 1U78A 3GTPJ 2PMZN 1ITYA 2O7OA 2GBYA 1LE8A 2NVTJ 2ECCA 2E2JJ 1TWGJ 2AHQA 4CYCA 5FKLA 2LVSA 4A3LJ 1I3QJ 4EEFG 2LY9A 4FE4A 2M2EA 3HM5A 4D5CA 3RQIA 4FCYA 1WH7A 3JRIA 1UG2A 3TW6A 1DU6A 3I4NJ 5C3EJ 1F43A 2EZKA 4MO7A 3JRHA 1IRZA 1BJZA 3QPLA 4I6ZA 2DA5A 1POGA 2JK3A 3GTKJ 5EGOB 2OF7A 1CQTA 3JRCA 3BT9A 3HGYA 2TRTA 3FKIJ 4A3MJ 3A03A 5EG0B 2DA3A 2XGDA 5M3MJ 1SANA 3A01B 1JKRC 1FJLA 1HF0A 1F36A 1OCPA 1K61A 2YUSA 4XICA 3Q0UA 5FLVA 1H89C 1Y1WJ 1OCTC 2TCTA 9ANTA 3BQZA 1FTTA 2E1OA 3A02A 4RBOA 2DA7A 4FTHA 2D5VA 1P7JA 3HKZN 3Q0VA 4GFBA 4RDUA 1GV2A 2Y9YA 4M3DA 3BR0A 4BXXJ 5C4XJ 1W0UA 5IYBJ 4UUSB 3IH3A 3GTOJ 4XIDA 3IV5A 1MBFA 4A3BJ 5E3NA 3K2AA 4Y7NJ 2GM4A 1TWCJ 1JUPA 4FISA 4MFEA 5E3MA 2L7ZA 1ORKA 1Y1VJ 5FJ8J 2W48A 4NDLA 2ECBA 4V2FA 1AKHA 2X48A 1A6IA 1GUUA 4M3GA 2WV1A 1RKTA 3LSJA 1IDYA 1LE8B 4AYBN 5M5XJ 1ZQ3P 2LD5A 2P81A 5F0HA 1HDDC 2ME0A 5C44J 3S1NJ 2YS9A 3GTJJ 3HGGA 2LKXA 2NVYJ 3ZQGA 3M3YJ 3D1NI 1TC3C 2IEKA 1VI0A 3B6AA 2AO9A 1S7EA 4V2GA 1I6HJ 4W1UA 5FKOA 4JX5A 1UHSA 3HEFA 1BA5A 1G2HA 3ZQCA 1MSEC 1SFOJ 2R5ZA 2HOTA 1BW6A 1A5JA 1JKOC 5EZGA 5IYDJ 1XG1A 1IC8A 4A3FJ 2VI6A 1ZK8A 2K9QA 3FIWA 4BBSJ 3CMYA 5EGOA 5K7HA 2H8RA 3CDLA 2LR8A 5DTDA 1ZKGA 3MKLA 1E3OC 1UMQA 3HDDA 2DMNA 1TWAJ 2EZHA 4XRMA 1MSFC 1Z0XA 2XPVA 2KDZA 1JKPC 2Y9ZA 3QQAA 1PUFB 1YRNA 1ZGWA 1ETKA 2XGEA 3RZDJ 2CQXA 4CYCB 2COBA 1ETYA 5M5YJ 1EF4A 4DW6A 4C3HJ 3TW7A 3OSGA 4C3JJ 4DYRA 1RKWA 2M34A 2I10A 4M3BA 4UUTA 2JN6A 2XSDC 3RZOJ 3BG3A 3BTJA 2HOAA 4IHXA 3F0CA 2K9NA 3BG5A 3LSPA 5HODA 3OSFA 3O8HA 2DA2A 2VUMJ 1DU0A 2LFBA 1JUSA 4IHWA 1MBEA 3BTIA 4M3EA 4A69C 1QPIA 3JRBA 2ZB9A 3LOCA 2G0EA 1OJLA 2NVQJ 2DA4A 1JTYA 3O8GA 3M4OJ 2XPUA 1FIPA 1MBJA 3HOYJ 4QIWN 2X6OA 2XB0X 2HXIA 3W6VA 1VF9A 2WB1N 4HNVA 1XC5A 5DS9A 2EQRA 4LOCA 1MBGA 3ZQFA 1P7IA 5EZHA 1T33A 4BBRJ 4D7NA 2FX0A 1JUMA 3L1PA 4UUSA 3G1OA 3NARA 3S1QJ 3BG9A 4Y52J 4MIMA 3WHCA 2NS7A 2Y31A 5IYCJ 5M3FJ 2MW8A 1W0TA 1MNMC 1H88C 1D5YA 1GV5A 3HOWJ 3ZOBA 2IBDA 1ETWA 1X2MA 2LK2A 1TWFJ 3B6CA 3QPSA 5K7FA 1O4XA 1NTCA 2M0CA 2QF7A 3JRAA 5GPCA 2K9SA 5E3LA 1I50J 3MVPA 2FJ1A 3SDGA 2OPTA 4DZPA 1IG7A 1RR7A 2XPWA 3A01A 4A3EJ 3MN2A 3VPRA 4W97A 1FIAA 3FK7A 3HBLA 1ETQA 5E3OA 1AHDP 4XRSG 5J3LA 5M5WJ 2EH3A 3JRGA 3GTQJ 3TP0A 2EZIA 1WGXA 1QVUA 3ZQHA 1LFUP 4M6VA 2JA5J 4B1RA 3BR1A 5JLXA 2Y30A 2MSYA 2JJ7A 4L5EA 2XRLA 3S15J 3ZQLA 3SJMA 2LP0A 4MLOA 4DZJA 2IAIA 3LNQA 4B3AA 1BL0A 2HDDA 5GP9A 3K7AJ 2DMQA 1QRYA 3TEDA 3HOZJ 1ETVA 2NOGA 1ZR4A 5K7ZA 1B72B 3BTLA 2DN0A 5IOZA 1RPWA 2CUEA 2ELKA 2HXOA 2HI3A 2MG4A 1MH3A 5EYRA 5F0CA 3TP3A 4QTRA 2K40A 3JRFA 2R0QC 1K83J 2ID3A 1ZTRA 1JT0A 2JA6J 2LLKA 3S2DJ 1ENHA 3DEWA 2NS8A 4A3CJ 4QSHA 2EBIA 1VFCA 3BTCA 4J19A 4B4CA 1YRNB 4JYKA 3HOVJ 2DA1A 1FTZA 5EEAA 4M3FA 2L0KA 1Z77A 1RESA 1X58A 2L9RA 2O9LA 2HOSA 4BY7J 1B8IB 1WCMJ 2HYJA 2DTZA 2YU9J 3JREA 2FQ4A 2VKEA 1X2NA 4FE7A 1H8AC 3GTLJ 4C3IJ 3S1RJ 1APLC 1B8IA 4MFDA 3PM1A 1JJ6C 3GTMJ 3OOUA 4I76A 2RAEA 5EDNA 3NAUA 4ABZA 2LTPA 4BY1J 5IP9J 1TWHJ 1HCRA 2DA6A 3FK6A 1Q1VA 2DMTA 4XK4A 2HQ5A 3WHBA 2L7MP 3GTGJ 4XRSA 3LSGA 4A3JJ 2L7FP 3S1MJ 1NK3P 3PO2J 2JA8J 2E2HJ
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4C2M J;  1T56 A;  5FKN A;  1B72 A;  2R5Y A;  5EF6 A;  4JX4 A;  3BR3 A;  2KT0 A;  1QVT A;  3PO3 J;  3G1M A;  4IHV A;  2JWT A;  4DYC A;  2GLO A;  1U9O A;  2M9H A;  2WAQ N;  1IDZ A;  2DMU A;  2N8G A;  5BNG A;  3I4M J;  1AKH B;  2NVX J;  3CCY A;  1OFC X;  3IH2 A;  1IV6 A;  1JT6 A;  1U8B A;  2Y2Z A;  2VKV A;  4A93 J;  3H0G J;  3HB9 A;  4D7M A;  1VND A;  1ZR2 A;  2FD5 A;  5IP6 A;  2ME6 A;  5C4J J;  3JRD A;  5IPA A;  2JA7 J;  2MGQ A;  5F1J A;  2CQQ A;  3S16 J;  1WH5 A;  3H3V K;  4G12 A;  3GBG A;  1GVD A;  4JX6 A;  3RKQ A;  5F04 A;  3JR9 A;  3Q0W A;  2O8K A;  1JJ8 C;  2Y0S N;  4IEJ A;  1IGN A;  1WPK A;  1BW5 A;  2M8G X;  1ETO A;  1MBH A;  5FKK A;  1AU7 A;  3IH4 A;  2R5Z B;  1HLV A;  1GDT A;  2R7Z J;  4JP0 A;  2CRG A;  3HOX J;  4A3G J;  3CQZ J;  3Q3S A;  2CU7 A;  5IOY A;  4IHY A;  5F27 A;  1HOM A;  5FLM J;  5F0F A;  2QCO A;  4S0H B;  2CJJ A;  1RET A;  3G1L A;  1WI3 A;  1JTX A;  2E19 A;  3ZQI A;  2JMW A;  1IJW C;  1PUF A;  4A3D J;  2XB5 A;  4AC0 A;  4DYQ A;  1HDP A;  3BR5 A;  1MBK A;  1U9N A;  5EG0 A;  1JGG A;  1NK2 P;  2ID6 A;  3LSR A;  3FIS A;  5J1R A;  3S2H J;  2EZL A;  5JLW A;  4BKX A;  2R92 J;  2DMP A;  3S17 J;  3OIO A;  3BQY A;  2X9D A;  3DCF A;  5J1U A;  3S14 J;  3BR2 A;  3UKG A;  5GPA A;  1IUF A;  2VPR A;  2XGC A;  1MH4 A;  4A3K J;  2H1K A;  2DJN A;  4AUX A;  2B63 J;  3E7L A;  1LFB A;  5F08 A;  3SFI A;  2R93 J;  2R5Y B;  2CUF A;  3BR6 A;  3C2B A;  1JKQ C;  5J1Y A;  1XS9 A;  2E2I J;  1ETX A;  4X1E A;  4D5F A;  3HOU J;  4A3I J;  5IP7 J;  1GT0 C;  5FKM A;  4X6A J;  1FEX A;  1R9T J;  1U78 A;  3GTP J;  2PMZ N;  1ITY A;  2O7O A;  2GBY A;  1LE8 A;  2NVT J;  2ECC A;  2E2J J;  1TWG J;  2AHQ A;  4CYC A;  5FKL A;  2LVS A;  4A3L J;  1I3Q J;  4EEF G;  2LY9 A;  4FE4 A;  2M2E A;  3HM5 A;  4D5C A;  3RQI A;  4FCY A;  1WH7 A;  3JRI A;  1UG2 A;  3TW6 A;  1DU6 A;  3I4N J;  5C3E J;  1F43 A;  2EZK A;  4MO7 A;  3JRH A;  1IRZ A;  1BJZ A;  3QPL A;  4I6Z A;  2DA5 A;  1POG A;  2JK3 A;  3GTK J;  5EGO B;  2OF7 A;  1CQT A;  3JRC A;  3BT9 A;  3HGY A;  2TRT A;  3FKI J;  4A3M J;  3A03 A;  5EG0 B;  2DA3 A;  2XGD A;  5M3M J;  1SAN A;  3A01 B;  1JKR C;  1FJL A;  1HF0 A;  1F36 A;  1OCP A;  1K61 A;  2YUS A;  4XIC A;  3Q0U A;  5FLV A;  1H89 C;  1Y1W J;  1OCT C;  2TCT A;  9ANT A;  3BQZ A;  1FTT A;  2E1O A;  3A02 A;  4RBO A;  2DA7 A;  4FTH A;  2D5V A;  1P7J A;  3HKZ N;  3Q0V A;  4GFB A;  4RDU A;  1GV2 A;  2Y9Y A;  4M3D A;  3BR0 A;  4BXX J;  5C4X J;  1W0U A;  5IYB J;  4UUS B;  3IH3 A;  3GTO J;  4XID A;  3IV5 A;  1MBF A;  4A3B J;  5E3N A;  3K2A A;  4Y7N J;  2GM4 A;  1TWC J;  1JUP A;  4FIS A;  4MFE A;  5E3M A;  2L7Z A;  1ORK A;  1Y1V J;  5FJ8 J;  2W48 A;  4NDL A;  2ECB A;  4V2F A;  1AKH A;  2X48 A;  1A6I A;  1GUU A;  4M3G A;  2WV1 A;  1RKT A;  3LSJ A;  1IDY A;  1LE8 B;  4AYB N;  5M5X J;  1ZQ3 P;  2LD5 A;  2P81 A;  5F0H A;  1HDD C;  2ME0 A;  5C44 J;  3S1N J;  2YS9 A;  3GTJ J;  3HGG A;  2LKX A;  2NVY J;  3ZQG A;  3M3Y J;  3D1N I;  1TC3 C;  2IEK A;  1VI0 A;  3B6A A;  2AO9 A;  1S7E A;  4V2G A;  1I6H J;  4W1U A;  5FKO A;  4JX5 A;  1UHS A;  3HEF A;  1BA5 A;  1G2H A;  3ZQC A;  1MSE C;  1SFO J;  2R5Z A;  2HOT A;  1BW6 A;  1A5J A;  1JKO C;  5EZG A;  5IYD J;  1XG1 A;  1IC8 A;  4A3F J;  2VI6 A;  1ZK8 A;  2K9Q A;  3FIW A;  4BBS J;  3CMY A;  5EGO A;  5K7H A;  2H8R A;  3CDL A;  2LR8 A;  5DTD A;  1ZKG A;  3MKL A;  1E3O C;  1UMQ A;  3HDD A;  2DMN A;  1TWA J;  2EZH A;  4XRM A;  1MSF C;  1Z0X A;  2XPV A;  2KDZ A;  1JKP C;  2Y9Z A;  3QQA A;  1PUF B;  1YRN A;  1ZGW A;  1ETK A;  2XGE A;  3RZD J;  2CQX A;  4CYC B;  2COB A;  1ETY A;  5M5Y J;  1EF4 A;  4DW6 A;  4C3H J;  3TW7 A;  3OSG A;  4C3J J;  4DYR A;  1RKW A;  2M34 A;  2I10 A;  4M3B A;  4UUT A;  2JN6 A;  2XSD C;  3RZO J;  3BG3 A;  3BTJ A;  2HOA A;  4IHX A;  3F0C A;  2K9N A;  3BG5 A;  3LSP A;  5HOD A;  3OSF A;  3O8H A;  2DA2 A;  2VUM J;  1DU0 A;  2LFB A;  1JUS A;  4IHW A;  1MBE A;  3BTI A;  4M3E A;  4A69 C;  1QPI A;  3JRB A;  2ZB9 A;  3LOC A;  2G0E A;  1OJL A;  2NVQ J;  2DA4 A;  1JTY A;  3O8G A;  3M4O J;  2XPU A;  1FIP A;  1MBJ A;  3HOY J;  4QIW N;  2X6O A;  2XB0 X;  2HXI A;  3W6V A;  1VF9 A;  2WB1 N;  4HNV A;  1XC5 A;  5DS9 A;  2EQR A;  4LOC A;  1MBG A;  3ZQF A;  1P7I A;  5EZH A;  1T33 A;  4BBR J;  4D7N A;  2FX0 A;  1JUM A;  3L1P A;  4UUS A;  3G1O A;  3NAR A;  3S1Q J;  3BG9 A;  4Y52 J;  4MIM A;  3WHC A;  2NS7 A;  2Y31 A;  5IYC J;  5M3F J;  2MW8 A;  1W0T A;  1MNM C;  1H88 C;  1D5Y A;  1GV5 A;  3HOW J;  3ZOB A;  2IBD A;  1ETW A;  1X2M A;  2LK2 A;  1TWF J;  3B6C A;  3QPS A;  5K7F A;  1O4X A;  1NTC A;  2M0C A;  2QF7 A;  3JRA A;  5GPC A;  2K9S A;  5E3L A;  1I50 J;  3MVP A;  2FJ1 A;  3SDG A;  2OPT A;  4DZP A;  1IG7 A;  1RR7 A;  2XPW A;  3A01 A;  4A3E J;  3MN2 A;  3VPR A;  4W97 A;  1FIA A;  3FK7 A;  3HBL A;  1ETQ A;  5E3O A;  1AHD P;  4XRS G;  5J3L A;  5M5W J;  2EH3 A;  3JRG A;  3GTQ J;  3TP0 A;  2EZI A;  1WGX A;  1QVU A;  3ZQH A;  1LFU P;  4M6V A;  2JA5 J;  4B1R A;  3BR1 A;  5JLX A;  2Y30 A;  2MSY A;  2JJ7 A;  4L5E A;  2XRL A;  3S15 J;  3ZQL A;  3SJM A;  2LP0 A;  4MLO A;  4DZJ A;  2IAI A;  3LNQ A;  4B3A A;  1BL0 A;  2HDD A;  5GP9 A;  3K7A J;  2DMQ A;  1QRY A;  3TED A;  3HOZ J;  1ETV A;  2NOG A;  1ZR4 A;  5K7Z A;  1B72 B;  3BTL A;  2DN0 A;  5IOZ A;  1RPW A;  2CUE A;  2ELK A;  2HXO A;  2HI3 A;  2MG4 A;  1MH3 A;  5EYR A;  5F0C A;  3TP3 A;  4QTR A;  2K40 A;  3JRF A;  2R0Q C;  1K83 J;  2ID3 A;  1ZTR A;  1JT0 A;  2JA6 J;  2LLK A;  3S2D J;  1ENH A;  3DEW A;  2NS8 A;  4A3C J;  4QSH A;  2EBI A;  1VFC A;  3BTC A;  4J19 A;  4B4C A;  1YRN B;  4JYK A;  3HOV J;  2DA1 A;  1FTZ A;  5EEA A;  4M3F A;  2L0K A;  1Z77 A;  1RES A;  1X58 A;  2L9R A;  2O9L A;  2HOS A;  4BY7 J;  1B8I B;  1WCM J;  2HYJ A;  2DTZ A;  2YU9 J;  3JRE A;  2FQ4 A;  2VKE A;  1X2N A;  4FE7 A;  1H8A C;  3GTL J;  4C3I J;  3S1R J;  1APL C;  1B8I A;  4MFD A;  3PM1 A;  1JJ6 C;  3GTM J;  3OOU A;  4I76 A;  2RAE A;  5EDN A;  3NAU A;  4ABZ A;  2LTP A;  4BY1 J;  5IP9 J;  1TWH J;  1HCR A;  2DA6 A;  3FK6 A;  1Q1V A;  2DMT A;  4XK4 A;  2HQ5 A;  3WHB A;  2L7M P;  3GTG J;  4XRS A;  3LSG A;  4A3J J;  2L7F P;  3S1M J;  1NK3 P;  3PO2 J;  2JA8 J;  2E2H J; 
#chains in the Genus database with same CATH topology
 3BWG A;  1T56 A;  2M4K A;  1FWZ A;  2V79 A;  2KT0 A;  2E5Z A;  5FLX K;  2JWT A;  3BY6 A;  2V9V A;  2GLO A;  1U9O A;  2Z1D A;  3LSI A;  3RDI A;  4BYY A;  1PDN C;  1O7F A;  4Q47 A;  4XOP A;  3LFU A;  2H94 A;  2QYO A;  1K4S A;  3ASN H;  2ZFW A;  1HW5 A;  3CCL I;  3TMO A;  2KIU A;  2ZME A;  1IV6 A;  1O57 A;  3TDU C;  4OAY A;  2HDC A;  2LKS A;  5TRD A;  2Y2Z A;  2PI0 A;  1OLT A;  2DOE A;  1WRJ A;  1ZR2 A;  2R3S A;  5DDG A;  3O6B B;  4UY8 I;  1NG6 A;  3G2B A;  3T0Y A;  4BJ6 C;  3JRD A;  2RKH A;  1QQI A;  3H9J A;  3F9K A;  2GXA A;  1LDK B;  2F6C A;  4OMY A;  2A6T A;  3D0S A;  2D45 A;  2CQQ A;  1S6L A;  1WH5 A;  2ESN A;  4IQJ A;  4G12 A;  4XLP F;  3WU2 C;  1K7A A;  1GVD A;  4MTE A;  3H5N A;  2JVG A;  5J47 A;  2O8K A;  3GFJ A;  3IWF A;  1UEL B;  2EA4 A;  1BW5 A;  2FNA A;  2M8G X;  2M30 A;  1GDT A;  4Q4Z F;  3FM5 A;  2R7Z J;  2CRG A;  3WTS C;  3HOX J;  2O6G E;  3F21 A;  3CQZ J;  2OUM A;  1SC7 A;  1D1A A;  3MFK A;  3OL3 A;  2GAU A;  4HOB A;  4IHY A;  4PDK A;  1HOM A;  1FYL A;  5F0F A;  4S0H B;  1B59 A;  4MHG A;  4O3M A;  4L0Y B;  1U5T C;  1OYI A;  1USS A;  2HOE A;  1IAW A;  3G1L A;  4FT8 A;  2F5D A;  2VOD A;  2IS1 A;  2Q0O A;  2KQR A;  3LA2 A;  2L4M A;  3FMS A;  4HX8 A;  3DP7 A;  1K6O A;  2VKD A;  2VE9 A;  2VAS A;  5H2F C;  2UUZ A;  3FIS A;  1BM9 A;  2BW3 A;  3AAF A;  3BZ6 A;  2HR3 A;  3ZQQ A;  3CO7 C;  2HKO A;  3S2H J;  1A31 A;  2MAB A;  3I0T A;  4EVI A;  3S17 J;  4LJZ F;  4RAG A;  3WE3 A;  1ON2 A;  2X9D A;  1QO0 D;  3S14 J;  3BG7 A;  1VZ0 A;  1BIB A;  1IUF A;  2P7V B;  1MH4 A;  4AIH A;  1QBJ A;  2YPR A;  4C30 A;  2B63 J;  2AXT C;  1P6R A;  4LMY A;  2R5Y B;  3IL2 A;  3ULQ B;  1YTY A;  5D6F A;  3BR6 A;  2WA0 A;  3CJT B;  1SEU A;  4BDY A;  4HF1 A;  3PIP F;  5HVQ C;  1XS9 A;  2EIJ H;  2E2I J;  4LK0 F;  4ZTF A;  4D5F A;  1R49 A;  1GT0 C;  4KA4 A;  1U78 A;  1DDN A;  2GIV A;  2GBY A;  2ZME C;  1LE8 A;  5DCM A;  2ECC A;  2HWV A;  2NVT J;  3KP3 A;  4AIK A;  1IXC A;  1NG7 A;  3L2V A;  1BI1 A;  3GZN B;  1Z9C A;  1P2F A;  2AHQ A;  1N75 A;  5FKL A;  4I09 A;  4A3L J;  2O0Y A;  1R36 A;  3M8F A;  1IXR C;  2M2E A;  1VQ4 I;  2BW3 B;  2Y75 A;  3SZP A;  3IRR A;  4L5I A;  3JRI A;  3TW6 A;  4XLE A;  4RB0 A;  1W5T A;  4MO7 A;  5D5W B;  1LB2 A;  3ABL H;  2JTV A;  2KDO A;  3JRH A;  1MDM A;  4I6Z A;  2JK3 A;  5EGO B;  2EWN A;  3BT9 A;  5TJJ A;  4A3M J;  5HDG A;  1JI8 A;  2DA3 A;  2DT6 A;  2XGD A;  1WKM A;  1HBX G;  2HNH A;  3CCM I;  1OCP A;  2CW0 F;  3FM3 A;  1BC8 C;  5FLV A;  3JTG A;  1MKM A;  3HUG B;  1XSX A;  2TCT A;  4U88 A;  4KIC A;  3ZMD A;  4E7K A;  4L9N A;  1Z3X A;  3SEQ A;  3JAM Z;  1Z3Y A;  1SD6 A;  1YOV B;  1R5G A;  2LKP A;  4GYI A;  1IN5 A;  4UB8 C;  3H0D A;  1LDD A;  3EUH A;  4RBO A;  4FTH A;  4G6D A;  2D5V A;  1FP1 D;  1S29 A;  4WX9 A;  3H35 A;  3BR0 A;  4BXX J;  2M4G A;  3C2G A;  4HG2 A;  4MNU A;  1Y8Q B;  4LIV A;  1W0U A;  2DLL A;  5IYB J;  3HRU A;  1R22 A;  1V4R A;  2QEX I;  4UUS B;  4HLY A;  1B4A A;  3RQ4 A;  2IGN A;  2M8E A;  2WV0 A;  4DIQ A;  2OBP A;  2R7Q A;  5KAI C;  3RKW A;  3IRQ A;  1LKX A;  3LWF A;  4HPQ A;  4MFE A;  4CIC A;  4XLN F;  1D8K A;  1LQ1 A;  3MQ0 A;  3E3V A;  4FET A;  2VE8 A;  4P96 A;  2ECB A;  2ICW G;  1AKH A;  1EKE A;  1O7L A;  1XDS A;  3QYF A;  2CH0 A;  3OYC A;  2KP6 A;  5JR3 A;  2XGX A;  4M3G A;  4XLA A;  5HDN A;  3E0J B;  3OYD A;  5DD8 A;  1IDY A;  2D2W A;  3HG9 A;  4AVP A;  2DAO A;  2P81 A;  2AXL A;  4HBL A;  5F0H A;  2YS9 A;  2NNN A;  3L00 A;  3KFW X;  2LF7 A;  2MBF A;  1TC3 C;  2A69 F;  1VI0 A;  3B6A A;  1TZL A;  2AO9 A;  1O3Q A;  3EUK L;  1I6H J;  1MJ9 A;  1ZG1 A;  1L3L A;  4W1U A;  1UHS A;  4KIS A;  2ZNY A;  1BA5 A;  1G2H A;  1G8X A;  3ZQC A;  1MSE C;  1B1B A;  1FT9 A;  2FEZ A;  3H5A A;  1JKO C;  5IYD J;  4IRH A;  2VN2 A;  1MJA A;  1X1P A;  2V1D A;  4A2U A;  3LSH A;  2M87 A;  5EGO A;  4ENN A;  3F8M A;  1X1B A;  3MZ8 A;  4RMN A;  2H8R A;  4QLC U;  2NOJ B;  4EJV A;  4NC8 A;  5D6E A;  2QGU A;  4E7J A;  2EZH A;  1D0Z A;  3K9T A;  2DDA A;  3I53 A;  5LRR A;  3SDB A;  4XRM A;  1Z0X A;  2XPV A;  3ABT A;  4YII A;  3W3C A;  2ZNZ A;  1R4M B;  1DPU A;  2KHM A;  2P5K A;  3KYC B;  2R7X A;  2OU2 A;  2XGE A;  2JT1 A;  4EM2 A;  3SQN A;  3HL2 A;  1FOY A;  2B7E A;  4DNC A;  3T1B A;  4KIT B;  2QSH X;  2V1N A;  3TW7 A;  2NYX A;  1G3S A;  4UUT A;  2HZT A;  2CV0 A;  1KQ9 A;  1BBY A;  2E5N A;  1K79 A;  3F0C A;  2G9W A;  3LSP A;  1TQP A;  2E7W A;  4CGZ A;  2ELH A;  4V19 K;  2K4J A;  3A4C A;  3RKY A;  3E1S A;  3WE2 A;  1ZRE A;  1MBE A;  4KDP A;  3IKV A;  3BTI A;  3VDX A;  4A69 C;  1I1G A;  1QPI A;  2COM A;  4IX7 A;  3ZGK A;  2ZB9 A;  1HSJ A;  2DA4 A;  2K5C A;  4ZDO A;  4Y15 A;  2XPU A;  1FIP A;  2A6E F;  3HOY J;  2KRH A;  2GOX B;  5FFZ A;  3HRM A;  4RM3 A;  2TDX A;  4XON A;  3MZH A;  2HVS A;  1VF9 A;  2WB1 N;  4IO9 F;  4HNV A;  1EH7 A;  1HKS A;  2JPC A;  3HZJ A;  1VQN I;  2QA4 I;  2EQR A;  1FC3 A;  3HOS A;  4M72 A;  4CUG A;  4D7N A;  3IHU A;  2FX0 A;  2MH2 A;  3TOB A;  1F5T A;  5LGT A;  3L1P A;  1RI7 A;  4Q48 A;  4PFO A;  3ZCO A;  4K2E A;  3S1Q J;  3E5X A;  4MIM A;  3F8F A;  1J2X A;  3C2H A;  3CLQ A;  5M3F J;  2A05 A;  1EV7 A;  1MNM C;  2IXS A;  4C9Y A;  5ILV A;  2E36 A;  5LGN A;  2DFF A;  3J80 Z;  1SAX A;  4PJ0 C;  2LK2 A;  1TWF J;  3B6C A;  2V9P A;  1BR2 A;  1NTC A;  2QF7 A;  2VQL A;  2K9S A;  3BG6 A;  3V7R A;  4MEY F;  5E18 F;  1UCR A;  3SDG A;  2GZW A;  3GEZ A;  4R8H A;  3MCZ A;  3FXU A;  1X3W B;  5FLX Z;  4HX7 A;  2VT3 A;  3FBN B;  3GLL A;  3C1D A;  3PQJ A;  3JSO A;  5H6Q A;  3VEP A;  5HLI A;  3HBL A;  2VB6 A;  1ETQ A;  4ANJ A;  1VQP I;  4WXH A;  2E7X A;  5IT3 A;  2DXI A;  2H6B A;  1E3P A;  3DKX A;  5CQG A;  1WGX A;  3H92 A;  1KZH A;  1QVU A;  1ULY A;  2JA5 J;  5HLT A;  4AID A;  4EGZ A;  5KVR A;  3VSL A;  1QHG A;  4PGG A;  4BGD A;  3DKW A;  3J80 K;  1LFP A;  4L5E A;  2OZ6 A;  2ZSI B;  4BJ5 C;  4HQM A;  1SD7 A;  1WJA A;  2LP0 A;  2E34 A;  1YS6 A;  4MLO A;  5BPD A;  3L09 A;  3RJP A;  1XPX A;  2A61 A;  3CJR B;  3T8T A;  2HDD A;  1TT0 A;  3KEO A;  2LC2 A;  2XSJ C;  4G8X A;  2NNY A;  1JXS A;  3HSE A;  1B6A A;  3DXJ F;  4EMS A;  4II2 A;  2O3F A;  3HOZ J;  3SZT A;  5K7Z A;  4HDV A;  2DN0 A;  3EQL F;  3QPT A;  4H0E A;  2RN7 A;  2LY1 A;  2PN6 A;  2HXO A;  2HI3 A;  4E7Z A;  3FHZ A;  3CCQ I;  2IA1 A;  1IJW C;  3K4L A;  2R0Q C;  1F1Z A;  2IW5 A;  1CGP A;  2ID3 A;  2JA6 J;  1W5S A;  1ZLK A;  1DQU A;  1MMN A;  1T6S A;  2EBI A;  2F48 A;  1VFC A;  1Z7L A;  4B4C A;  2OC6 A;  4RLQ A;  1YIO A;  5CVV A;  3COA C;  4CZC A;  1R6R A;  4M3F A;  4RGU A;  2L9R A;  3GFL A;  1TQI A;  4AD9 A;  1JE8 A;  3CJQ B;  2CFX A;  5HLH A;  2HYJ A;  3FMR A;  3O3K A;  4N4N B;  1OYY A;  3JRE A;  2KFD A;  1W7P D;  2RQP A;  4FE7 A;  3HHH A;  1H8A C;  2RQQ A;  3VOD A;  1APL C;  3K4N A;  4FQG A;  4JOM A;  5HS7 A;  4MFD A;  5ICC A;  3DTK A;  3CC2 I;  3WGI A;  1X3U A;  1KGS A;  1RUO A;  4F7Z A;  3CUQ B;  5FFX A;  1S7A A;  1NH3 A;  4BQA A;  1MNE A;  2JRT A;  3VYR B;  3GTM J;  5EDN A;  2ZSH B;  2C6Y A;  2BVL A;  4KIG A;  5F1R A;  1Z05 A;  2L02 A;  1I5Z A;  4UVC A;  2BBY A;  3ABM H;  4B09 A;  2LH9 A;  1TW2 A;  1SVM A;  4RGR A;  1ZG5 A;  3MZY A;  4OIP F;  1Z21 A;  1QZE A;  4A0Y A;  2L7M P;  3HKZ A;  3OYI A;  3CCJ I;  1HW1 A;  3U9G A;  3VFZ A;  3C3W A;  1LVA A;  5J6X A;  3GFM A;  2IJL A;  1LNW A;  5FKN A;  3G71 I;  2R7O A;  3CDI A;  2W85 A;  2CG4 A;  3DLL F;  3MMY B;  1QVT A;  2KRC A;  1WJB A;  1J7K A;  1PVE A;  3G1M A;  3WTT C;  1BN5 A;  4DYC A;  2JUC A;  2VC0 A;  5B1A H;  1IF1 A;  3K6G A;  1HA8 A;  2Z2S B;  2N8G A;  5K1Y A;  3T8R A;  3LA3 A;  1IO2 A;  3R4K A;  2OQR A;  3VSK A;  4DOZ A;  6PAX A;  1I1S A;  3F8N A;  2KKO A;  2CQN A;  2HPI A;  3I55 I;  4ENK A;  4A93 J;  1RC9 A;  3HB9 A;  4LLG F;  4RGX A;  1VND A;  2FD5 A;  5IP6 A;  2ZJR F;  2OCE A;  4J00 A;  2XIG A;  1E0E A;  1B9N A;  4F3Q A;  3I64 A;  3L2U A;  2R7U A;  1ZRC A;  2JA7 J;  1S8N A;  3OOP A;  5F1J A;  3PL8 A;  2X6W A;  5LBQ A;  3LA7 A;  3H3V K;  4O5V A;  3FXO A;  2LRE A;  3PQK A;  2LYC A;  2PBI A;  5EEH A;  2HVQ A;  1MMA A;  4P5O A;  5F04 A;  4ZDL A;  2UZK A;  4IEJ A;  5LD2 C;  2DO7 A;  1Q1H A;  1ETO A;  2K9L A;  1AU7 A;  2R5Z B;  4BAC A;  4JP0 A;  1RR8 C;  3AG3 H;  3Q3S A;  5LEJ A;  5IOY A;  2A07 F;  2P6S A;  1OCR H;  2KJC A;  2DFE A;  2M7A A;  4G7H F;  2LBF A;  5F27 A;  2M1B A;  3E97 A;  3GCM A;  5ICF A;  2BYV E;  4XBF A;  1LEA A;  2Z16 A;  5K5Q A;  5FLM J;  3HJE A;  3SEZ A;  4PZJ A;  2CJJ A;  3OIP A;  2MC4 A;  3OYM A;  2DW4 A;  3FF5 A;  2CUJ A;  2XV4 S;  4U0V A;  3R0J A;  2YU3 A;  5DUI A;  1Z7U A;  1PUF A;  3MKZ A;  3N97 A;  4A3D J;  2BHZ A;  4HNU A;  1HDP A;  4ITV A;  3BR5 A;  4EJW A;  2F5F A;  1ZRF A;  3J7A O;  1U9N A;  3OMY A;  4U0W A;  4A5N A;  2LOO A;  1OCO H;  1X1D A;  3ROU A;  1OR7 C;  4PUS A;  3CP8 A;  1QA6 A;  2PLY A;  4OIO F;  5JLW A;  2R92 J;  1BJA A;  2YR2 A;  1ZHF A;  4B8X A;  3BQY A;  3TO9 A;  3I4P A;  3D5R C;  4EQQ A;  3ABK H;  3FX3 A;  1I27 A;  4IPA A;  1KQ8 A;  3CLO A;  1FBQ A;  4FAS D;  4B44 A;  2DJN A;  4XM3 A;  1NHA A;  2VJ5 A;  2MLG A;  2XF6 A;  2ZC2 A;  3I9V 2;  1LFB A;  4HX4 A;  5F08 A;  3ZMV A;  1PUE E;  4OIQ F;  1OCC H;  3SFI A;  3WOD F;  4CSW A;  3HSF A;  3L2C A;  1XMA A;  2EPF A;  4U7B A;  3H5R A;  3ZXS A;  2RV8 A;  1EH6 A;  1ETX A;  4X1E A;  2V6E A;  5IP7 J;  1FEX A;  1UJ8 A;  3HXL A;  3GTP J;  1ITY A;  2PMZ A;  1CF7 A;  2DTR A;  3KIO A;  3HYI A;  4LD5 A;  1XCB A;  3LAP A;  1TWG J;  3V8L A;  1WSU A;  3KCC A;  1I3Q J;  4IL6 C;  3NRV A;  4GYG A;  2LY9 A;  1H9G A;  4RB3 C;  1WH7 A;  1YIT I;  4F92 B;  5JFR A;  4HV6 A;  2L5Q A;  1REP C;  1KQ0 A;  2FBH A;  3AFH A;  5C3E J;  4JBA A;  5J4V A;  1RZ4 A;  2EV0 A;  1POG A;  3HGY A;  1WJE A;  3GLX A;  4E70 A;  2BOL A;  2L54 A;  5D5X B;  2BGC A;  5M3M J;  4UB6 C;  1JKR C;  2G7U A;  5AIP A;  2QZ8 A;  3OYK A;  1K61 A;  2YUS A;  2CQ7 A;  3UNG C;  4JK1 X;  3Q0U A;  1PP7 U;  2WAQ A;  3RIR A;  1H89 C;  1MD0 A;  3LQR A;  2JA2 A;  1XN7 A;  2ZCW A;  2HTS A;  4UVB A;  2O03 A;  2KRF A;  4BAY A;  9ANT A;  2EV5 A;  1SD4 A;  4IHT A;  1YW7 A;  3BPV A;  3HKZ N;  4KUM A;  1GV2 A;  5BPI A;  1T08 B;  4XR6 A;  4IOA F;  4YEL A;  4NNJ A;  2QQA A;  4NC6 A;  2L3D A;  3RYR A;  4GGG A;  2ADU A;  3BC8 A;  1D0Y A;  1MBF A;  1ZGA A;  4CYD A;  1FP2 A;  3K2A A;  1TWC J;  1U5T A;  1J9I A;  2KIQ A;  3U1D A;  2VXZ A;  2L9S A;  1VQM I;  2RVC A;  5FJ8 J;  3CMM A;  4NDL A;  3DEU A;  4V2F A;  4RAF A;  4IKF A;  4ZYH A;  2J5O A;  2X48 A;  5E8G A;  3OYG A;  1GUU A;  3LSM A;  1TTY A;  3K1M A;  4ESJ A;  2WV1 A;  4EJT A;  1T95 A;  5E1Z B;  4AYB N;  5M5X J;  3K70 D;  2P5V A;  1WJF A;  4E7L A;  3HGG A;  2NVY J;  1EA3 A;  1G3Y A;  2QQ8 A;  2IEK A;  2RC4 A;  2OA4 A;  4HRI A;  5CVR A;  3BJO A;  1W5C C;  4XOR A;  1TQM A;  4LB5 A;  3BPX A;  3TBI A;  1WQ2 A;  3L7W A;  5D8L B;  5FKO A;  2RRE A;  2E1N A;  1A04 A;  3K69 A;  4LFU A;  4GCV A;  2L7K A;  1SFO J;  4M6Y A;  5LEK A;  3WTX C;  2MLK A;  3QRF F;  4PFP A;  3BZK A;  5CYV A;  2CQK A;  1T38 A;  2VOP A;  1E17 A;  3OL4 A;  5BMZ A;  3EUA A;  1K6Y A;  2DQR A;  4EJO A;  2M45 A;  1KU9 A;  4BUP A;  5ICE A;  3KZZ A;  4D9J A;  2R7S A;  1FX7 A;  4RB2 C;  2XAH A;  2LR8 A;  3H36 A;  3DPU A;  5DTD A;  2H09 A;  1W36 D;  2KIS A;  3CUQ A;  4GO1 A;  2PJR A;  2CMP A;  2KDZ A;  2Y9Z A;  3M8J A;  4B3X A;  2PEX A;  3M07 A;  5E8I A;  5JHU A;  2STW A;  1YRN A;  1ETK A;  3DBL B;  1Y56 A;  3LFK A;  1M1E B;  2IS6 A;  1SFX A;  5M5Y J;  3I58 A;  3HIF A;  4DW6 A;  1ZH5 A;  2LDU A;  3OSG A;  1O3T A;  4DYR A;  1RKW A;  2M34 A;  2I10 A;  3OWT A;  4M3B A;  2JN6 A;  1GLN A;  2EFP A;  2XSD C;  2BXZ A;  1BOB A;  3CDH A;  3QOP A;  1XGM A;  4IHX A;  1CF7 B;  3DLA A;  2DBB A;  4CA0 A;  4LIT A;  3S3N A;  1OIS A;  1DU0 A;  4PGH A;  4IXA A;  2X4H A;  5TGT A;  5LGU A;  3CMA I;  3DU5 A;  4M3E A;  3DTE A;  4HSR A;  3JRB A;  3CO6 C;  1UG0 A;  1MW7 A;  3LOC A;  2G0E A;  1OJL A;  3S32 A;  2FBI A;  5GAD J;  3U2R A;  3O8G A;  2B0L A;  1ZLJ A;  3KX2 A;  2CW8 A;  2X6O A;  3W6V A;  2HXI A;  1HKT A;  4CDG A;  5IY5 H;  2M7B A;  3E5U A;  2V6C A;  4LOC A;  4C2U A;  3K0L A;  3TQN A;  4BQN A;  1P7I A;  5EZH A;  4KMF A;  1T33 A;  4HZF A;  3KET A;  1IV8 A;  2JSC A;  4IOC F;  3ESW B;  4UUS A;  3H3Z A;  3IUO A;  3GFI A;  4BE0 A;  2NS0 A;  2HKX A;  4XLF A;  2Y31 A;  3M1E A;  5DV5 A;  4HF0 A;  2MW8 A;  2OZU A;  3ZPL A;  1D5Y A;  1AOY A;  3HOW J;  4EV0 A;  5J4Y A;  2EIN H;  3QPS A;  2BY1 A;  5K7F A;  2M0C A;  2LNB A;  3CCU I;  4Y33 A;  1V5E A;  3HUG A;  2JQ7 A;  2K9M A;  4HAM A;  2QWW A;  1I50 J;  2K27 A;  2FJ1 A;  5HNF A;  1J59 A;  1QHH D;  2QSG X;  4A3E J;  3A01 A;  4RA2 A;  3VB2 A;  5GTI C;  4CZZ A;  3GO5 A;  1FIA A;  3EYI A;  4IHS A;  4HYE A;  4R79 A;  3K70 C;  3F8C A;  2JRM A;  3A2K A;  5CPR B;  3PNT A;  5J3L A;  1FBU A;  2L01 A;  5DM6 F;  2BEO A;  3PFY A;  3AKZ A;  3I3L A;  3MKW B;  2W7N A;  5CVU A;  4RLF A;  3CCE I;  4P1W A;  4CXF A;  5DM7 F;  1LFU P;  2UV1 A;  4B1R A;  5E79 C;  1EJ9 A;  1TNS A;  5DCM B;  3S15 J;  3ZQL A;  5L3F A;  4BDZ A;  4CCJ A;  4DZJ A;  2K3F A;  4XKB A;  4B3A A;  1BL0 A;  1YJW I;  2ELJ A;  2O5R A;  2CV1 A;  5LHG A;  5L3E A;  1I3A A;  3K7A J;  2EB7 A;  4G9Y A;  4XNF A;  4LLN A;  1Y6I A;  1QRY A;  3KYL A;  1W36 C;  3BTL A;  2FMY A;  4L9V A;  1RPW A;  2MC3 A;  3ABU A;  1TT5 B;  1UZC A;  2CUE A;  4AM3 A;  2MG4 A;  3TP3 A;  1MH3 A;  3S1R J;  2LSO A;  5H6R A;  1K83 J;  5E1X A;  3RPU D;  5CLS A;  2XDV A;  1VQO I;  2VQG A;  2CFO A;  1DGW Y;  4D0P A;  4A3C J;  3BOQ A;  5JVT A;  4I2O A;  3QOE A;  4II3 A;  3B02 A;  4KT6 A;  4AYB A;  2WC2 A;  2DA1 A;  5EEA A;  4MGR A;  4X0G A;  2L0K A;  3KZI C;  2O9L A;  3QP6 A;  2FUG 2;  3O2P E;  4NBQ A;  2ZJQ F;  2FQ4 A;  4ZYE A;  1IXS B;  4KN4 X;  1ZGJ A;  1KU2 A;  2VBW A;  3PM1 A;  3M8E A;  5D4S A;  4I76 A;  2F5V A;  2XVC A;  1LJ9 A;  1FY7 A;  2X1C A;  3E6B A;  3ECO A;  3KP4 A;  4BY1 J;  5IP9 J;  4I0B A;  1TWH J;  2BXY A;  3ZRG A;  2ISZ A;  1Y0U A;  2RGV A;  3I5U A;  3FK6 A;  4FHT A;  2HQ5 A;  3OS2 A;  2K3P A;  4L5J A;  2A68 F;  1V5F A;  4AU7 A;  3CCS I;  4XRS A;  3LSG A;  4M71 A;  1ZRD A;  3GTG J;  4A3J J;  2L7F P;  3B73 A;  3OYB A;  1NK3 P;  3CME I;  2JA8 J;  3IKT A;  1YI2 I;  3R60 A;  3PSF A;  3CCR I;  1QNT A;  1D1B A;  1B72 A;  3S2W A;  1SMY F;  1O3S A;  4L9J A;  3F23 A;  3BR3 A;  4XN3 A;  3R6S A;  3C18 A;  4LG0 B;  2CW7 A;  2DOD A;  2M9H A;  3KP7 A;  2EK5 A;  2WAQ N;  2X6X A;  1VQ5 I;  1TLH B;  3I4M J;  4M9S A;  3TO7 A;  2E1C A;  1AKH B;  2FSW A;  3CCY A;  2NVX J;  1BIA A;  1OFC X;  1JGS A;  2HGC A;  2DYR H;  1U8B A;  1ONV A;  3ZMU A;  1GVJ A;  4S05 A;  1YG2 A;  1FMV A;  4CHU A;  1F4K A;  3KE2 A;  3ZQ7 A;  3OYN A;  1OQY A;  3VOE A;  3X2Q H;  4UNO A;  1EH8 A;  2MGQ A;  5B1B H;  3WTU C;  1N25 A;  2OTL I;  4XKC A;  3S16 J;  1E3H A;  2WY8 Q;  5LRS A;  1X3Z B;  3M9A A;  3FZV A;  2R7R A;  3JR9 A;  3Q0W A;  1F9N A;  2Y0S N;  4G7O F;  1WPK A;  3PJR A;  5CVI A;  3G3Z A;  2ZO4 A;  1MBH A;  5FKK A;  3V8J A;  2WWY A;  4RAZ A;  4MQV A;  3WTY C;  5JI6 A;  4XSX F;  5HS9 A;  4F55 A;  1R4N B;  1Z91 A;  5FD6 A;  2PFB A;  2X1D A;  2DT7 B;  2FA5 A;  2JPB A;  1J5Y A;  3CJN A;  2QQ9 A;  2FOK A;  4YEJ A;  3WG7 H;  3E5Q A;  1WWX A;  3MD2 A;  2DCE A;  2E19 A;  4E7S A;  2JMW A;  2DJI A;  4BQO A;  2OV7 A;  4CO8 A;  2P0W A;  4AC0 A;  4DYQ A;  3ONQ A;  1KA8 A;  1YYV A;  5EG0 A;  3RYP A;  4HST A;  2Y69 H;  4F91 B;  3L2R A;  1YIJ I;  1NK2 P;  4F93 B;  3LSR A;  5K5O A;  4A0X A;  2UWM A;  2DK5 A;  1S72 I;  2XAG A;  1HQC A;  3PNV A;  2BE5 F;  1TBX A;  5J1R A;  2EZL A;  1IN6 A;  3FXJ A;  3LL7 A;  4P9F A;  2XAF A;  1YJN I;  3N05 A;  1VQ8 I;  3R0A A;  4XKW A;  5HNH A;  3DCF A;  2GXB A;  4ZZD A;  1IN7 A;  1KON A;  3BR2 A;  5L3G A;  2VPR A;  1Z6T A;  4A3K J;  2HYF A;  1XGO A;  2XF5 A;  1K4T A;  4HF2 A;  2I5U A;  3DKY A;  4BU2 A;  3OYJ A;  3E7L A;  1DP7 P;  3KP6 A;  4HW0 A;  4CCO A;  3F3X A;  2R93 J;  2CUF A;  4KJZ A;  2FXA A;  1IRX A;  3DTI A;  4WXD A;  3QAH A;  2F5E A;  1JKQ C;  5A2Q Z;  3HOU J;  4A3I J;  1FSE A;  2WBM A;  3W6K B;  4HA8 A;  4X6A J;  4BHP A;  1R9T J;  2PMZ N;  5E1W A;  2QM3 A;  2LF8 A;  1HKQ A;  3NWS A;  3AG2 H;  1XTA A;  4QPO A;  5CKT A;  4EEF G;  4P9U A;  2E1M B;  4FE4 A;  1KYW A;  1UAA A;  3RQI A;  2CSO A;  4XMY A;  1X4P A;  3CCV I;  3I4N J;  5AON A;  1ODD A;  4A6E A;  2IT0 A;  2X85 A;  4G6Q A;  4BEH B;  1IRG A;  1F43 A;  4HQE A;  1DP3 A;  2W82 A;  3WGG A;  5A2Q K;  3DBH B;  3NQO A;  4KIB A;  1BJZ A;  3QPL A;  2DA5 A;  3GTK J;  3PUB A;  2OF7 A;  3SXY A;  5D4R A;  1XSV A;  2TRT A;  3WTV C;  4ZYD A;  3A03 A;  3ZMS A;  5EG0 B;  3HHG A;  1D5V A;  3W2V A;  1SAN A;  1S3J A;  3A01 B;  1HF0 A;  1J75 A;  1F36 A;  3IWZ A;  5FRM A;  4DBR A;  4A5M A;  2HU9 A;  4E6K G;  1YW9 A;  4RAY A;  5FO5 A;  3CD6 I;  3MKY B;  2CWE A;  3ASO H;  3KP2 A;  1T8I A;  3BQZ A;  1FTT A;  2E1O A;  3ZMT A;  1R00 A;  1MMS A;  2DA7 A;  1P7J A;  2QSF X;  3Q0V A;  4GFB A;  4RDU A;  4M3D A;  2Y9Y A;  3DWL E;  2JSP A;  2VKH A;  3GME A;  3EPZ A;  5C4X J;  2DYS H;  4OIN F;  1G4D A;  4LLL A;  3IH3 A;  4NQW A;  3Q9V A;  4YIF A;  4GDF A;  2KZV A;  1ZEL A;  4XID A;  3TKY A;  3IV5 A;  2W1O A;  3BCB A;  2DQL A;  2DK8 A;  4Y7N J;  2GM4 A;  3K4M A;  2Y0S A;  2XKP A;  5DCF A;  1JUP A;  2V26 A;  3VYS B;  3A1Y A;  5L3B A;  4HEA 2;  4FIS A;  3R61 A;  1T0F A;  1XMK A;  2ZME B;  1ORK A;  2OQG A;  1BI2 A;  2QVO A;  2D1H A;  1ZAR A;  2CYY A;  3ML6 A;  3K2Z A;  3LMM A;  4L9T A;  3FWE A;  4NQW B;  1AA7 A;  3J7Y J;  3CC4 I;  2EFQ A;  4LG0 A;  3LSJ A;  2P8T A;  2VQC A;  1SMT A;  2DOA A;  1FOK A;  1U2W A;  3F6V A;  4G7Z F;  5C44 J;  4L18 B;  3S1N J;  3GTJ J;  2CUZ A;  2K7L A;  2LKX A;  3ZQG A;  1YX3 A;  3D1N I;  2I8D A;  2XRN A;  5HS8 A;  3JW4 A;  1P9Q C;  5ICG A;  3OS0 A;  1S7E A;  3RSN A;  1FPQ A;  4A0Z A;  4V2G A;  4GXO A;  2LG4 A;  4UUV A;  2F4O B;  1BOA A;  3LSK A;  4JX5 A;  4EM0 B;  2XAS A;  2R5Z A;  2Q2E B;  1BW6 A;  4RS8 A;  1A5J A;  2XKO A;  4OAZ A;  5EZG A;  2P5L C;  2W84 A;  2A3S A;  4A3F J;  4L0Z B;  2VI6 A;  1FBS A;  3GUD A;  2K9Q A;  4BBS J;  5D5V B;  2DDB A;  3ZP5 A;  3W2A A;  1DPR A;  5ED4 A;  3OYL A;  5K7H A;  4OMZ A;  3CDL A;  2HTJ A;  2G7H A;  3MKL A;  1E3O C;  1UMQ A;  3HDD A;  2DMN A;  4BEH A;  2PJR B;  1MSF C;  4CH7 A;  2QBY A;  1JKP C;  4FX0 A;  3S93 A;  5FGM A;  3QP5 A;  1PUF B;  1MDM B;  1K78 B;  3H3U A;  1B9M A;  1XCV A;  1G6N A;  4AVZ A;  4GRI A;  2Q8K A;  1WZ2 A;  2GOM A;  4CCM A;  4HNT A;  5B3S H;  4P55 A;  1ETY A;  3SZG A;  2MH9 A;  3E6D A;  3K4B A;  1EF4 A;  2GXG A;  1R5H A;  3H9G A;  3NEU A;  3V42 A;  3WU1 B;  1WHU A;  4C3H J;  1Z67 A;  4CCN A;  2L4A A;  4C3J J;  3P7N A;  2VOO A;  4Y3O A;  4U7D A;  3G73 A;  3RZO J;  3G6E I;  1XDU A;  4S04 A;  2OAZ A;  5H20 A;  4BXF A;  2VBX A;  4Y4R A;  5HOD A;  2HYG D;  2BZT A;  3O8H A;  2VUM J;  3S3O A;  2F4I A;  2LFB A;  2X1E A;  2HPM A;  3OS1 A;  4IHW A;  3D5L A;  5KK1 A;  1FLI A;  1OMI A;  2IVM A;  2W25 A;  4BNC A;  1KU3 A;  2AS5 F;  1OPC A;  1RIO H;  3OYE A;  3BP8 A;  3M4O J;  1MBJ A;  4N0B A;  2HZD A;  1OR7 A;  2B9S A;  2Z99 A;  5CQE A;  4QIW N;  2XB0 X;  3REO A;  1FOW A;  1R58 A;  5DS9 A;  4J01 A;  1YFH A;  2KPM A;  2MFZ A;  2VON A;  5F6F A;  2FNP A;  4IF4 A;  2MD5 A;  4UV9 A;  1P4W A;  4BBR J;  1W7P B;  2QBY B;  1JUM A;  3H1C A;  4C2T A;  2WB1 A;  3P5J A;  4RGS A;  3NAR A;  2EIL H;  1XSD A;  1ZAO A;  4UVA A;  1YE9 A;  5B5E C;  1IRF A;  1U0J A;  2CGP A;  2F2E A;  3KEY A;  4LK1 F;  1W0T A;  1HW2 A;  2LMD A;  2PX9 A;  1H88 C;  2PMH A;  2M3A A;  3ZOB A;  1X2M A;  4ZYG A;  3V8K A;  2KMU A;  3BJA A;  3JRA A;  2DT5 A;  2VPL A;  5GPC A;  1VQL I;  3M1C A;  3E6M A;  1YHQ I;  2K85 A;  2XC7 A;  2IA0 A;  2R7T A;  2OPT A;  2DPD A;  2NRA C;  3DFG A;  3EET A;  2PG4 A;  1ZYR F;  2XPW A;  4B47 A;  1SAU A;  2WY7 Q;  4PJN A;  1QGP A;  1YJ9 I;  4B48 A;  1JHH A;  4XRS G;  1ON1 A;  2M0M A;  3GZ5 A;  4R1H A;  4IRI A;  5DYM A;  2GIZ A;  4HV5 A;  5E17 F;  2EH3 A;  1UB9 A;  3FXL A;  3JRG A;  3GTQ J;  3TP0 A;  3HSR A;  2CV2 A;  3JSP A;  1FNN A;  1ZN2 A;  4OU0 A;  3ZQH A;  4M6V A;  3AL0 B;  2ACJ A;  1R23 A;  4Y17 A;  1XGN A;  2KZG A;  3PUF A;  2Y30 A;  3DBR B;  3HPH A;  5KCM A;  2BY3 A;  5JLX A;  2JJ7 A;  3CZ6 A;  2XRL A;  3EYY A;  3M7G A;  3SJM A;  2R4G A;  2YX4 A;  2IAI A;  3AL0 C;  1QZY A;  5JHF A;  5GP9 A;  2EFN A;  1C0W A;  3TED A;  1U6G A;  1IN8 A;  1LUJ B;  1ZR4 A;  1B72 B;  5IOZ A;  2FU4 A;  2NAZ A;  4AIJ A;  4LG3 A;  3U1K A;  1R1U A;  4IJA A;  2BY2 A;  1H0M A;  1ZTR A;  2LLK A;  4LGW A;  4ZYA A;  3S2D J;  2WAE A;  1ENH A;  3FXR A;  2JZY A;  3CP2 A;  1V5G A;  2NS8 A;  3BZC A;  3ERM A;  4I99 C;  2R7D A;  3RI4 A;  2EIM H;  2F4M B;  3BTC A;  4J19 A;  1YRN B;  1ZG3 A;  1FTZ A;  2M5W A;  3DF8 A;  4LIU A;  1U8R A;  3OY9 A;  1GXQ A;  2AQE A;  4BY7 J;  1WCM J;  1J09 A;  2DTZ A;  2MA3 A;  4YFK F;  2VKE A;  5LHH A;  2GWR A;  2ZXW H;  4C3I J;  1B8I A;  2V9K A;  3V4G A;  4ASN A;  4G6T B;  3V7C A;  2CO5 A;  3DEE A;  4M6X A;  3C7J A;  3DPL C;  2O8X A;  1Y39 A;  1R71 A;  4BE1 A;  4BQQ A;  3NAU A;  4MEX F;  1S7O A;  1L0O C;  4PK4 A;  1HC8 A;  1FSH A;  4IQ4 A;  2DA6 A;  3S8P A;  1U3E M;  1Q1V A;  3ZN0 A;  2RNJ A;  3KLN A;  2PQ8 A;  4XK4 A;  2OTJ I;  5FRO A;  1D1C A;  3TOA A;  3FDY A;  2GQQ A;  2FE3 A;  1UHW A;  3S1M J;  2HS5 A;  2E2H J;  4XOT A;  2IGO A;  4C2M J;  2FQ3 A;  2R5Y A;  5EF6 A;  2O61 A;  1QPM A;  4JX4 A;  2GA2 A;  3PO3 J;  2ZXJ A;  4IHV A;  1YLF A;  1XMX A;  2EIK H;  2QQB A;  4ZC3 A;  4E4H A;  4M73 A;  2W00 A;  3TGN A;  1IDZ A;  2DMU A;  5BNG A;  1P4X A;  4YIR X;  1FZP B;  2HQA A;  1WJD A;  3IH2 A;  2IA2 A;  3OR2 C;  1JT6 A;  1FMW A;  1X19 A;  2VKV A;  2RDP A;  3H0G J;  3I54 A;  2UXX A;  4D7M A;  3L2W A;  3SHF A;  3Q9S A;  1V55 H;  4U0Y A;  5IT9 Z;  2ME6 A;  5C4J J;  3OYH A;  1MJB A;  1VQ7 I;  5IPA A;  3I59 A;  3V7S A;  1TW3 A;  3IAM 2;  3F22 A;  3RKX A;  4N4O B;  5B66 C;  1XD7 A;  2BY0 A;  2EFW A;  1BI0 A;  1H9T A;  3GBG A;  4JX6 A;  3RKQ A;  1SFU A;  3GX4 X;  2Z9O A;  4M74 A;  2A5Y B;  4EM1 A;  1JJ8 C;  3SFZ A;  3OV8 A;  2L9V A;  1IGN A;  3HRS A;  2HQN A;  3U21 A;  5CJ9 A;  1XB4 A;  2Q2E A;  3IH4 A;  4I0A A;  1HLV A;  1P4A A;  2MD0 A;  4Z2Y A;  4A3G J;  2CU7 A;  3KZY A;  1PYV A;  2VBY A;  5DUK A;  1XX5 A;  2QCO A;  1A6Q A;  1SVO A;  3ISP A;  4HDU A;  2R7V A;  1RET A;  4G94 A;  3IC7 A;  4YFN F;  2J5P A;  1WI3 A;  1JTX A;  3BDD A;  3ZQI A;  4I01 A;  2ISY A;  2Z33 A;  3UR3 C;  2ESH A;  5KAF C;  5L3C A;  3FMQ A;  5LHI A;  2XB5 A;  2VL8 A;  3I56 I;  1MBK A;  5LFA A;  4ENM A;  1JGG A;  2ID6 A;  2XF7 A;  3RPQ A;  5DEQ A;  3QPH A;  2HEO A;  5HOO A;  3WTW C;  3RTR A;  4ETS A;  1WFX A;  4BKX A;  2DMP A;  3GYH X;  1X1C A;  4OWR B;  1S5L C;  4BHC A;  3OIO A;  1GHC A;  1LVK A;  4A12 A;  3QOD A;  3KEQ A;  2V4J C;  5J1U A;  4IVN A;  3CC7 I;  3UKG A;  2K02 A;  2L9N A;  4XRF A;  5GPA A;  5GTH C;  2XGC A;  3F6O A;  3OYF A;  2H1K A;  5J8C A;  1YX5 A;  3J81 Z;  1G3W A;  4AUX A;  2IS2 A;  2X51 A;  4U87 A;  2KIM A;  2XUB A;  2AQF A;  2F5C A;  3C2B A;  5KHD A;  3QWL A;  3P9I A;  4RM2 A;  4NHJ A;  5J1Y A;  3S3M A;  3P9K A;  1G3T A;  5FKM A;  2H8W A;  3OR1 C;  4KMU X;  1J0R A;  1OYW A;  2O7O A;  2A5W A;  2XAQ A;  3Q5F A;  2E2J J;  4A6D A;  3PIO F;  2L2O A;  3HTS B;  4Z6Y A;  4CYC A;  3IP4 B;  2LVS A;  1R1V A;  2FOW A;  3I71 A;  3HM5 A;  4D5C A;  1KU7 A;  2DU9 A;  2RNG A;  4FCY A;  3K1P A;  3QYB A;  1UG2 A;  3AG4 H;  1DU6 A;  4ZZL A;  1I39 A;  1OKR A;  4DBQ A;  2EZK A;  2UXN A;  1IRZ A;  4E7I A;  4M9X A;  1CQT A;  3JRC A;  3FKI J;  3WG9 A;  4XKV A;  1YQA A;  1VQ9 I;  5D8K B;  1VTN C;  1Z1D A;  2Y0M A;  3FHN A;  3J7Z I;  2QKM B;  1FJL A;  1RUN A;  2BVM A;  2YX7 A;  2IP2 A;  3GW2 A;  3ZMZ A;  4XIC A;  2VJ4 A;  1BI3 A;  2K86 A;  1Y1W J;  5HDK A;  1OCT C;  1MMD A;  2ZXH A;  1W4M A;  1SD5 A;  2ZJP F;  5TIS C;  1P92 A;  4BE2 A;  3QU6 A;  3A0B C;  3A02 A;  5FD5 A;  2LBF B;  4ZH4 F;  2BHY A;  3KYD B;  5LLQ A;  3JCU C;  1QZZ A;  3ZN1 A;  2HQR A;  1IUY A;  5JVG F;  1HST A;  3ECH A;  2VC1 A;  1IZ1 A;  2Z3Y A;  4QPQ A;  3OIQ A;  4XLC A;  1SFE A;  2QKL B;  3GZ6 A;  4H4K C;  3EUH C;  2DI3 A;  5BOX A;  4OIR F;  3GTO J;  1XGS A;  4EAT A;  4ESF A;  2WAD A;  3HC7 A;  4O6J A;  4WWC A;  5E3N A;  3DQV C;  1BR4 A;  4A3B J;  3P9C A;  1STZ A;  1W1W E;  3TO6 A;  1YO5 C;  3I59 B;  3OYA A;  1IW7 F;  5E3M A;  1D8J A;  3NWT A;  2L7Z A;  1V3F A;  2LRD A;  1Y1V J;  2VT2 A;  2W48 A;  2HFH A;  3K4J A;  3TL4 X;  4KFC A;  4B43 A;  2OD5 A;  4ON0 A;  4PJM A;  3CTA A;  1A6I A;  2ZFU A;  1D3Y A;  1ACI A;  1RKT A;  2H27 A;  1GXP A;  3DV8 A;  4MQ9 F;  1LE8 B;  3FXK A;  1ZQ3 P;  2LD5 A;  3FKJ A;  4NUB A;  1LDJ A;  2ME0 A;  1HDD C;  1LEB A;  1MMG A;  3M3Y J;  1Y8R B;  4I98 B;  1DUX C;  3A0H C;  4XL9 A;  2QLZ A;  4BJT A;  2XHK A;  4WCG A;  3HTU A;  4RB1 A;  4XN0 A;  1YS7 A;  2Q1Z B;  3HEF A;  3MEX A;  2HOT A;  3N4M A;  2IRF G;  3CF2 A;  4ENJ A;  3E6C C;  2ZBK A;  4IZZ A;  2ZKZ A;  3VYT B;  1XG1 A;  4UXN A;  1IC8 A;  4KYW A;  1YW8 A;  1ZK8 A;  3CUO A;  3W2W A;  3FIW A;  5K5R A;  1VQK I;  1E2X A;  2LY2 A;  1RRJ A;  4PSX A;  3CMY A;  3FXQ A;  3RCO A;  4ESB A;  3WTZ A;  2WTE A;  5ERI A;  1ZKG A;  2DFH A;  2DFI A;  4XLH A;  4AWX B;  1JHF A;  1KYZ A;  1TWA J;  4PCQ A;  5ILS A;  2X0L A;  4PJL A;  3MAJ A;  3ERE D;  3QQA A;  2E60 A;  3T5X A;  1T39 A;  4KIF A;  1ZGW A;  3F8B A;  5IT9 K;  2FML A;  3RZD J;  2CQX A;  3KP5 A;  4CYC B;  2VIX A;  4EGY A;  2P7C B;  2COB A;  2KJB A;  1PJR A;  2STT A;  3PSI A;  2GA1 A;  2ZXI A;  1A36 A;  5FB2 A;  4E7H A;  3BJ6 A;  1Z6R A;  5FRN A;  4EJU A;  2XAU A;  4UV8 A;  1UST A;  2W24 A;  1OCZ H;  5E20 A;  3BG3 A;  3BTJ A;  5EJC A;  2HOA A;  4NB5 A;  4IRG A;  2R7W A;  2K9N A;  3BG5 A;  3H9Q A;  3JTH A;  5BS6 A;  3OSF A;  2DA2 A;  1N77 A;  1JUS A;  2W57 A;  1MGT A;  3CUQ C;  2VJI A;  1FYM A;  2DPU A;  2QEN A;  1LPQ A;  2P4W A;  2HVR A;  3K4K A;  2CS3 A;  1R5I D;  2NVQ J;  3HPG A;  4DQ2 A;  1JTY A;  2VXD A;  2R7F A;  4OOI A;  3W6J B;  2D1V A;  4BXU A;  2V1U A;  2KLO A;  4YFX F;  3K4C A;  3CF5 F;  4XQF A;  4F52 A;  2JUG A;  1XC5 A;  3F72 A;  3LAJ A;  4M9Z A;  1MBG A;  3ZQF A;  3MWM A;  3PNY A;  4BHB A;  2VBZ A;  1S9H A;  1AWC A;  3WU0 A;  2DOF A;  5ILU A;  3K10 A;  3GWZ A;  1BC7 C;  3KPH A;  1UHM A;  3G1O A;  4MTD A;  2KIF A;  1FOX A;  3BG9 A;  4Y52 J;  3GVA A;  3WHC A;  4UHT A;  3SYT A;  2NS7 A;  5GAG J;  5IYC J;  3GXO A;  2VLA A;  1T2K A;  5AIQ A;  2H1L A;  2FBK A;  4HLX A;  5GAE J;  3IAS 2;  2EJR A;  4QWQ A;  5BQT A;  1GV5 A;  2PMU A;  5F64 A;  5HLG A;  3RPU A;  2IBD A;  2X6Y A;  3FBI B;  1ETW A;  4N9I A;  2V7F A;  3VYU B;  4WF2 A;  1O4X A;  3ELK A;  1G59 A;  2IS4 A;  2ETH A;  5E3L A;  3ZR8 X;  3BLY A;  2FF4 A;  4ZDP A;  4I02 A;  3MVP A;  1T98 A;  1I6X A;  4FX4 A;  4DZP A;  4PJJ A;  1IG7 A;  1T0F C;  1TNT A;  1RR7 A;  3G4S I;  2NVU B;  5GAH J;  1WI9 A;  1TL8 A;  2EA2 A;  3D5S C;  4NC7 A;  1SFK A;  3QU3 A;  3MN2 A;  3VPR A;  5D5U B;  1W7P A;  3LST A;  4W97 A;  1Y0N A;  3FK7 A;  2ZJ2 A;  3J81 K;  4XSZ F;  2HDW A;  1WJ5 A;  5E3O A;  1AHD P;  5M5W J;  4ZTJ A;  3JAM K;  2IPQ X;  4I7H A;  3GF2 A;  1O3R A;  4D1Q A;  5KNL A;  2EZI A;  5EEG A;  3PFI A;  1VQ6 I;  4Y13 A;  4Q5S F;  2P6T A;  1U5T B;  3BR1 A;  4YRV A;  2MSY A;  1N78 A;  2OCC H;  1BR1 A;  1WJC A;  1QU3 A;  2H6C A;  2YSR A;  2Z5U A;  1FYK A;  3CES A;  3LNQ A;  3L9F A;  2BV6 A;  3BCA A;  1DGR M;  1RNL A;  4JQF A;  1TP4 A;  2DMQ A;  3BRO A;  4DJA A;  4TV7 A;  2W4S A;  1ETV A;  2JVH A;  1R1T A;  2NOG A;  2E35 A;  1MZB A;  4PSW A;  2VJJ A;  2ELK A;  5F0C A;  5EYR A;  3WGH A;  4QTR A;  3JRF A;  2K40 A;  3FXM A;  2EFO A;  5CVJ A;  1JT0 A;  3DU6 A;  3K1N A;  2Y48 A;  2VQH A;  3J7A Y;  3DEW A;  4LB6 B;  3EDP A;  2OJE D;  1A35 A;  4QSH A;  3HRT A;  2V1X A;  3L2Q A;  2QUF A;  1IN4 A;  1X4O A;  4CCK A;  1K78 A;  4JYK A;  3HOV J;  1MND A;  2A6H F;  2WAF A;  1Z77 A;  1RES A;  1X58 A;  3LQQ A;  2HOS A;  3KLO A;  5J8F A;  1B8I B;  2YU9 J;  3AG1 H;  4BS9 A;  1X2N A;  3GTL J;  4WK8 F;  4YG2 F;  2XAJ A;  2E71 A;  4CCL A;  4ZJZ A;  5J40 A;  3DPT A;  1UFM A;  3QYE A;  1JJ6 C;  2IGK A;  3OOU A;  2RAE A;  5DD4 A;  1HXD A;  2EV6 A;  4ABZ A;  2LTP A;  2MYS A;  1PP8 F;  2KL4 A;  4WXC A;  1R7J A;  3VWB A;  2FRH A;  1HCR A;  2IGM A;  1V54 H;  4KNY A;  2DMT A;  4KN7 X;  1X1A A;  1ERD A;  1D0X A;  1MIJ A;  3TDZ C;  4DGW B;  4BL0 B;  3WHB A;  5L3D A;  3HOT A;  2PJP A;  1WVR A;  4BH9 A;  2E1M C;  2XRO A;  4KT5 C;  1SVL A;  4N9H A;  3PO2 J;  2K4B A;  2NXN B; 
#chains in the Genus database with same CATH homology
 4C2M J;  1T56 A;  5FKN A;  1B72 A;  2R5Y A;  5EF6 A;  4JX4 A;  3BR3 A;  2KT0 A;  1QVT A;  3PO3 J;  3G1M A;  4IHV A;  2JWT A;  4DYC A;  2GLO A;  1U9O A;  2M9H A;  2WAQ N;  1IDZ A;  2DMU A;  2N8G A;  5BNG A;  3I4M J;  1AKH B;  2NVX J;  3CCY A;  1OFC X;  3IH2 A;  1IV6 A;  1JT6 A;  1U8B A;  2Y2Z A;  2VKV A;  4A93 J;  3H0G J;  3HB9 A;  4D7M A;  1VND A;  1ZR2 A;  2FD5 A;  5IP6 A;  2ME6 A;  5C4J J;  3JRD A;  5IPA A;  2JA7 J;  2MGQ A;  5F1J A;  2CQQ A;  3S16 J;  1WH5 A;  3H3V K;  4G12 A;  3GBG A;  1GVD A;  4JX6 A;  3RKQ A;  5F04 A;  3JR9 A;  3Q0W A;  2O8K A;  1JJ8 C;  2Y0S N;  4IEJ A;  1IGN A;  1WPK A;  1BW5 A;  2M8G X;  1ETO A;  1MBH A;  5FKK A;  1AU7 A;  3IH4 A;  2R5Z B;  1HLV A;  1GDT A;  2R7Z J;  4JP0 A;  2CRG A;  3HOX J;  4A3G J;  3CQZ J;  3Q3S A;  2CU7 A;  5IOY A;  4IHY A;  5F27 A;  1HOM A;  5FLM J;  5F0F A;  2QCO A;  4S0H B;  2CJJ A;  1RET A;  3G1L A;  1WI3 A;  1JTX A;  2E19 A;  3ZQI A;  2JMW A;  1IJW C;  1PUF A;  4A3D J;  2XB5 A;  4AC0 A;  4DYQ A;  1HDP A;  3BR5 A;  1MBK A;  1U9N A;  5EG0 A;  1JGG A;  1NK2 P;  2ID6 A;  3LSR A;  3FIS A;  5J1R A;  3S2H J;  2EZL A;  5JLW A;  4BKX A;  2R92 J;  2DMP A;  3S17 J;  3OIO A;  3BQY A;  2X9D A;  3DCF A;  5J1U A;  3S14 J;  3BR2 A;  3UKG A;  5GPA A;  1IUF A;  2VPR A;  2XGC A;  1MH4 A;  4A3K J;  2H1K A;  2DJN A;  4AUX A;  2B63 J;  3E7L A;  1LFB A;  5F08 A;  3SFI A;  2R93 J;  2R5Y B;  2CUF A;  3BR6 A;  3C2B A;  1JKQ C;  5J1Y A;  1XS9 A;  2E2I J;  1ETX A;  4X1E A;  4D5F A;  3HOU J;  4A3I J;  5IP7 J;  1GT0 C;  5FKM A;  4X6A J;  1FEX A;  1R9T J;  1U78 A;  3GTP J;  2PMZ N;  1ITY A;  2O7O A;  2GBY A;  1LE8 A;  2NVT J;  2ECC A;  2E2J J;  1TWG J;  2AHQ A;  4CYC A;  5FKL A;  2LVS A;  4A3L J;  1I3Q J;  4EEF G;  2LY9 A;  4FE4 A;  2M2E A;  3HM5 A;  4D5C A;  3RQI A;  4FCY A;  1WH7 A;  3JRI A;  1UG2 A;  3TW6 A;  1DU6 A;  3I4N J;  5C3E J;  1F43 A;  2EZK A;  4MO7 A;  3JRH A;  1IRZ A;  1BJZ A;  3QPL A;  4I6Z A;  2DA5 A;  1POG A;  2JK3 A;  3GTK J;  5EGO B;  2OF7 A;  1CQT A;  3JRC A;  3BT9 A;  3HGY A;  2TRT A;  3FKI J;  4A3M J;  3A03 A;  5EG0 B;  2DA3 A;  2XGD A;  5M3M J;  1SAN A;  3A01 B;  1JKR C;  1FJL A;  1HF0 A;  1F36 A;  1OCP A;  1K61 A;  2YUS A;  4XIC A;  3Q0U A;  5FLV A;  1H89 C;  1Y1W J;  1OCT C;  2TCT A;  9ANT A;  3BQZ A;  1FTT A;  2E1O A;  3A02 A;  4RBO A;  2DA7 A;  4FTH A;  2D5V A;  1P7J A;  3HKZ N;  3Q0V A;  4GFB A;  4RDU A;  1GV2 A;  2Y9Y A;  4M3D A;  3BR0 A;  4BXX J;  5C4X J;  1W0U A;  5IYB J;  4UUS B;  3IH3 A;  3GTO J;  4XID A;  3IV5 A;  1MBF A;  4A3B J;  5E3N A;  3K2A A;  4Y7N J;  2GM4 A;  1TWC J;  1JUP A;  4FIS A;  4MFE A;  5E3M A;  2L7Z A;  1ORK A;  1Y1V J;  5FJ8 J;  2W48 A;  4NDL A;  2ECB A;  4V2F A;  1AKH A;  2X48 A;  1A6I A;  1GUU A;  4M3G A;  2WV1 A;  1RKT A;  3LSJ A;  1IDY A;  1LE8 B;  4AYB N;  5M5X J;  1ZQ3 P;  2LD5 A;  2P81 A;  5F0H A;  1HDD C;  2ME0 A;  5C44 J;  3S1N J;  2YS9 A;  3GTJ J;  3HGG A;  2LKX A;  2NVY J;  3ZQG A;  3M3Y J;  3D1N I;  1TC3 C;  2IEK A;  1VI0 A;  3B6A A;  2AO9 A;  1S7E A;  4V2G A;  1I6H J;  4W1U A;  5FKO A;  4JX5 A;  1UHS A;  3HEF A;  1BA5 A;  1G2H A;  3ZQC A;  1MSE C;  1SFO J;  2R5Z A;  2HOT A;  1BW6 A;  1A5J A;  1JKO C;  5EZG A;  5IYD J;  1XG1 A;  1IC8 A;  4A3F J;  2VI6 A;  1ZK8 A;  2K9Q A;  3FIW A;  4BBS J;  3CMY A;  5EGO A;  5K7H A;  2H8R A;  3CDL A;  2LR8 A;  5DTD A;  1ZKG A;  3MKL A;  1E3O C;  1UMQ A;  3HDD A;  2DMN A;  1TWA J;  2EZH A;  4XRM A;  1MSF C;  1Z0X A;  2XPV A;  2KDZ A;  1JKP C;  2Y9Z A;  3QQA A;  1PUF B;  1YRN A;  1ZGW A;  1ETK A;  2XGE A;  3RZD J;  2CQX A;  4CYC B;  2COB A;  1ETY A;  5M5Y J;  1EF4 A;  4DW6 A;  4C3H J;  3TW7 A;  3OSG A;  4C3J J;  4DYR A;  1RKW A;  2M34 A;  2I10 A;  4M3B A;  4UUT A;  2JN6 A;  2XSD C;  3RZO J;  3BG3 A;  3BTJ A;  2HOA A;  4IHX A;  3F0C A;  2K9N A;  3BG5 A;  3LSP A;  5HOD A;  3OSF A;  3O8H A;  2DA2 A;  2VUM J;  1DU0 A;  2LFB A;  1JUS A;  4IHW A;  1MBE A;  3BTI A;  4M3E A;  4A69 C;  1QPI A;  3JRB A;  2ZB9 A;  3LOC A;  2G0E A;  1OJL A;  2NVQ J;  2DA4 A;  1JTY A;  3O8G A;  3M4O J;  2XPU A;  1FIP A;  1MBJ A;  3HOY J;  4QIW N;  2X6O A;  2XB0 X;  2HXI A;  3W6V A;  1VF9 A;  2WB1 N;  4HNV A;  1XC5 A;  5DS9 A;  2EQR A;  4LOC A;  1MBG A;  3ZQF A;  1P7I A;  5EZH A;  1T33 A;  4BBR J;  4D7N A;  2FX0 A;  1JUM A;  3L1P A;  4UUS A;  3G1O A;  3NAR A;  3S1Q J;  3BG9 A;  4Y52 J;  4MIM A;  3WHC A;  2NS7 A;  2Y31 A;  5IYC J;  5M3F J;  2MW8 A;  1W0T A;  1MNM C;  1H88 C;  1D5Y A;  1GV5 A;  3HOW J;  3ZOB A;  2IBD A;  1ETW A;  1X2M A;  2LK2 A;  1TWF J;  3B6C A;  3QPS A;  5K7F A;  1O4X A;  1NTC A;  2M0C A;  2QF7 A;  3JRA A;  5GPC A;  2K9S A;  5E3L A;  1I50 J;  3MVP A;  2FJ1 A;  3SDG A;  2OPT A;  4DZP A;  1IG7 A;  1RR7 A;  2XPW A;  3A01 A;  4A3E J;  3MN2 A;  3VPR A;  4W97 A;  1FIA A;  3FK7 A;  3HBL A;  1ETQ A;  5E3O A;  1AHD P;  4XRS G;  5J3L A;  5M5W J;  2EH3 A;  3JRG A;  3GTQ J;  3TP0 A;  2EZI A;  1WGX A;  1QVU A;  3ZQH A;  1LFU P;  4M6V A;  2JA5 J;  4B1R A;  3BR1 A;  5JLX A;  2Y30 A;  2MSY A;  2JJ7 A;  4L5E A;  2XRL A;  3S15 J;  3ZQL A;  3SJM A;  2LP0 A;  4MLO A;  4DZJ A;  2IAI A;  3LNQ A;  4B3A A;  1BL0 A;  2HDD A;  5GP9 A;  3K7A J;  2DMQ A;  1QRY A;  3TED A;  3HOZ J;  1ETV A;  2NOG A;  1ZR4 A;  5K7Z A;  1B72 B;  3BTL A;  2DN0 A;  5IOZ A;  1RPW A;  2CUE A;  2ELK A;  2HXO A;  2HI3 A;  2MG4 A;  1MH3 A;  5EYR A;  5F0C A;  3TP3 A;  4QTR A;  2K40 A;  3JRF A;  2R0Q C;  1K83 J;  2ID3 A;  1ZTR A;  1JT0 A;  2JA6 J;  2LLK A;  3S2D J;  1ENH A;  3DEW A;  2NS8 A;  4A3C J;  4QSH A;  2EBI A;  1VFC A;  3BTC A;  4J19 A;  4B4C A;  1YRN B;  4JYK A;  3HOV J;  2DA1 A;  1FTZ A;  5EEA A;  4M3F A;  2L0K A;  1Z77 A;  1RES A;  1X58 A;  2L9R A;  2O9L A;  2HOS A;  4BY7 J;  1B8I B;  1WCM J;  2HYJ A;  2DTZ A;  2YU9 J;  3JRE A;  2FQ4 A;  2VKE A;  1X2N A;  4FE7 A;  1H8A C;  3GTL J;  4C3I J;  3S1R J;  1APL C;  1B8I A;  4MFD A;  3PM1 A;  1JJ6 C;  3GTM J;  3OOU A;  4I76 A;  2RAE A;  5EDN A;  3NAU A;  4ABZ A;  2LTP A;  4BY1 J;  5IP9 J;  1TWH J;  1HCR A;  2DA6 A;  3FK6 A;  1Q1V A;  2DMT A;  4XK4 A;  2HQ5 A;  3WHB A;  2L7M P;  3GTG J;  4XRS A;  3LSG A;  4A3J J;  2L7F P;  3S1M J;  1NK3 P;  3PO2 J;  2JA8 J;  2E2H J; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...