1WH7A

Solution structure of homeobox domain of arabidopsis thaliana hypothetical protein f22k18.140
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
80
structure length
80
Chain Sequence
GSSGSSGSNPSSSGGTTKRFRTKFTAEQKEKMLAFAERLGWRIQKHDDVAVEQFCAETGVRRQVLKIWMHNNKNSGPSSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Solution structure of homeobox domain of Arabidopsis thaliana hypothetical protein F22K18.140
rcsb
source organism Arabidopsis thaliana
molecule tags Dna binding protein
molecule keywords ZF-HD homeobox family protein
total genus 13
structure length 80
sequence length 80
ec nomenclature
pdb deposition date 2004-05-28
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.60 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Homeodomain-like 1wh7A01
1U8BA 3SDGA 2X9DA 4EEFG 3HOZJ 2XGDA 3BG9A 3D1NI 2ID3A 5GPAA 1TWCJ 2DMTA 2CRGA 2HOAA 3IV5A 4W97A 4UUTA 1FIAA 5EGOB 2R5YA 4M3EA 3RQIA 3DEWA 1JTYA 2LVSA 1JJ6C 2JA6J 2XB5A 3NARA 2QCOA 1SFOJ 2LFBA 3QPLA 3M4OJ 2EQRA 2R5YB 4XK4A 1TC3C 4JYKA 3A02A 5C3EJ 4BBSJ 1QPIA 4FCYA 2JA8J 1BW5A 1HF0A 3GTKJ 2R0QC 4QIWN 5IYDJ 4AC0A 5EG0B 1SANA 1OFCX 1YRNB 1ENHA 3JRAA 1AU7A 1ZQ3P 2HQ5A 4V2FA 2LD5A 3BTIA 1TWAJ 2Y9ZA 1HDDC 2MGQA 3HOVJ 3GTJJ 3BR0A 1RETA 1ZKGA 1RR7A 4D7MA 2DA6A 2K9SA 3HKZN 5IP9J 3BR6A 4XRMA 1UG2A 1NTCA 2XPUA 3G1OA 3FIWA 3GTLJ 3FISA 2DTZA 5GPCA 1YRNA 3BR5A 1JKPC 1MSFC 5FKLA 3B6AA 1AKHA 1P7JA 4DZJA 3C2BA 2TRTA 2Y30A 2VPRA 2ECBA 4RBOA 5FKNA 4XRSG 3Q0UA 2HDDA 2TCTA 4C3JJ 2WV1A 1Z77A 4A3BJ 1I3QJ 2NVYJ 5F08A 5M5YJ 2NOGA 2NVTJ 3JRHA 2LK2A 3JRIA 5EZHA 2NS7A 3BR3A 2JA5J 1B8IB 5M3FJ 2X6OA 3HB9A 3JRFA 4NDLA 3JR9A 3IH3A 3Q0WA 1X2NA 1JGGA 2NVXJ 2EZHA 2OPTA 1WI3A 9ANTA 5IOZA 1ETXA 1WH7A 4JX5A 2LY9A 4IEJA 4DZPA 1ZTRA 3OSFA 3OSGA 3MVPA 3ZQIA 5M5WJ 3GTPJ 1MBKA 2GM4A 3S1MJ 3MN2A 1WH5A 4FE4A 2Y31A 5M5XJ 5FKKA 2XB0X 5EEAA 4A93J 3S1RJ 1IC8A 1W0TA 1IGNA 3A01B 3HGGA 1VF9A 4BBRJ 3K2AA 4G12A 2QF7A 3LOCA 1MBFA 2CJJA 5EYRA 1HCRA 2I10A 1MH3A 2E2JJ 5IYCJ 4IHVA 4IHWA 4B3AA 4M3GA 5J3LA 1NK3P 1W0UA 2CUFA 1H8AC 4B4CA 3IH4A 5J1RA 1XC5A 1JUMA 1FTTA 1WGXA 1PUFB 3I4NJ 2ELKA 2Y2ZA 1IG7A 5IP7J 1MSEC 1ZK8A 1JT0A 3LSPA 1MBGA 1MBEA 3HOWJ 2MW8A 2LP0A 3GTOJ 2VKVA 4V2GA 2JK3A 4A69C 3ZOBA 1PUFA 5JLXA 1WCMJ 4BKXA 3S2HJ 5DTDA 1POGA 3ZQLA 5F1JA 1LE8B 2O9LA 1DU0A 4JX4A 3JRGA 2ECCA 3TP3A 1BL0A 2N8GA 4M3DA 5EDNA 2IAIA 4M3BA 2HYJA 3W6VA 1IUFA 1ETVA 2XPVA 2NS8A 3IH2A 2DMNA 3S1QJ 2AO9A 2DJNA 3RZDJ 2EZIA 3PO2J 1VFCA 3E7LA 3JRDA 4FE7A 4FTHA 5FLVA 2COBA 1BW6A 4IHYA 4UUSA 1H88C 3LSRA 1JT6A 3BTLA 1R9TJ 5K7HA 2G0EA 3HBLA 2DA1A 3JRCA 1T33A 2DA3A 1I6HJ 3ZQHA 2RAEA 3S2DJ 4DW6A 3BR1A 1O4XA 1GV5A 1TWHJ 3PM1A 3HM5A 2E2HJ 3LNQA 2HXOA 2M34A 3QPSA 5C4XJ 1X58A 3HOXJ 1MBHA 1ZGWA 3O8HA 2LTPA 4D5CA 4BXXJ 2DA5A 2HOSA 2LLKA 5C44J 4QSHA 4X1EA 1XS9A 1GVDA 3A03A 5F04A 4Y52J 1K83J 3GBGA 1U9OA 2D5VA 4AUXA 1JTXA 2DMPA 4D7NA 2L9RA 4A3LJ 2YS9A 2P81A 2EZKA 3BT9A 1HLVA 2L0KA 3BG3A 1IDZA 2CU7A 3SJMA 2XSDC 1Y1WJ 2M9HA 1IDYA 1MNMC 3UKGA 1RKWA 3DCFA 4XICA 3CCYA 1RKTA 4B1RA 1UMQA 4MLOA 3RKQA 1IV6A 2E2IJ 3I4MJ 1UHSA 2FX0A 1Q1VA 2GBYA 1Y1VJ 3B6CA 4W1UA 3HDDA 1FEXA 1AHDP 1HOMA 3OIOA 4UUSB 1OJLA 1ETQA 3GTQJ 4MO7A 5K7ZA 2JWTA 2E19A 4M3FA 3CQZJ 2CQXA 5E3OA 1U78A 3GTGJ 2XGCA 5DS9A 2K9NA 3BQYA 2JA7J 2DMQA 5GP9A 4A3IJ 1ITYA 2EBIA 2XGEA 2K9QA 2ID6A 2L7ZA 3FKIJ 3S17J 2OF7A 2HXIA 3ZQGA 1BJZA 2WAQN 5IOYA 3L1PA 2O8KA 2VUMJ 2CUEA 1VNDA 2R5ZA 2KT0A 1S7EA 1WPKA 2M0CA 2H1KA 1F36A 3MKLA 3Q3SA 3HOUJ 3H0GJ 4X6AJ 1GT0C 3BTJA 1GUUA 5IP6A 2YU9J 5FKOA 5M3MJ 1VI0A 3FK7A 4BY7J 5F0CA 1P7IA 1G2HA 2VI6A 3HOYJ 5HODA 4MFDA 2JN6A 4A3EJ 3WHCA 1LE8A 3HEFA 2W48A 1F43A 1B72B 4BY1J 4RDUA 3TW7A 5EZGA 2E1OA 2FQ4A 5J1UA 2Y9YA 4L5EA 2X48A 1RESA 3CMYA 4CYCA 1LFBA 2CQQA 1LFUP 2B63J 3BR2A 1DU6A 4GFBA 2ME6A 4M6VA 4DYCA 1I50J 2FJ1A 4QTRA 3K7AJ 2KDZA 3FK6A 4JX6A 5BNGA 1JKRC 2NVQJ 3BG5A 1U9NA 1D5YA 1OCPA 5J1YA 4C3HJ 5C4JJ 1RPWA 1AKHB 2L7MP 3O8GA 4J19A 3GTMJ 5FJ8J 1JUPA 2VKEA 1QVTA 2YUSA 3LSJA 5F27A 5IYBJ 4LOCA 1JKQC 1XG1A 4I76A 1Z0XA 3HGYA 2DN0A 5FLMJ 3S16J 5F0HA 3JREA 3BQZA 3OOUA 1IJWC 4FISA 1TWFJ 4XRSA 1GV2A 2ME0A 2O7OA 5K7FA 1H89C 3G1MA 4DYRA 1IRZA 1OCTC 1ETOA 4ABZA 3BTCA 3G1LA 2Y0SN 1BA5A 2HOTA 2FD5A 4C3IJ 1TWGJ 1QRYA 1ETYA 4S0HB 1QVUA 2DA4A 1FJLA 5EG0A 2L7FP 1NK2P 2DMUA 2XPWA 2ZB9A 2HI3A 2R93J 3LSGA 3TP0A 1FIPA 4C2MJ 1EF4A 1T56A 5E3MA 3ZQCA 4MIMA 1GDTA 3M3YJ 3F0CA 3TEDA 3VPRA 1B8IA 5E3LA 1CQTA 2R92J 3CDLA 4DYQA 4CYCB 2EZLA 5FKMA 5EGOA 2IEKA 2LR8A 3NAUA 3ZQFA 3TW6A 5EF6A 5JLWA 4XIDA 4A3JJ 3RZOJ 1B72A 4MFEA 4Y7NJ 3QQAA 3S1NJ 1X2MA 3S15J 3SFIA 3PO3J 3Q0VA 1ETWA 2PMZN 1A5JA 2EH3A 1MH4A 1ZR4A 2K40A 1FTZA 1ORKA 2MG4A 4AYBN 1E3OC 3H3VK 1A6IA 3WHBA 2WB1N 4A3GJ 1JKOC 2GLOA 5IPAA 4I6ZA 1HDPA 2XRLA 1JJ8C 3A01A 3S14J 2DA7A 2IBDA 1K61A 2R7ZJ 1MBJA 4A3DJ 4IHXA 3JRBA 1ETKA 2AHQA 2H8RA 5F0FA 2M8GX 4JP0A 2R5ZB 4A3CJ 4A3KJ 4A3FJ 2DA2A 4A3MJ 2M2EA 2JMWA 2JJ7A 1ZR2A 4D5FA 2LKXA 4HNVA 2MSYA 1APLC 1JUSA 5E3NA
chains in the Genus database with same CATH superfamily
1AA7A 3GO5A 4N0BA 1USTA 4L0ZB 2Q8KA 1FMVA 3BG9A 3D1NI 5B3SH 1UFMA 5LHIA 2QKLB 2CRGA 5DYMA 2V1NA 1T98A 4U0WA 1CGPA 1YW9A 4O5VA 3BWGA 2E5ZA 4M3EA 2VASA 2FF4A 3MZYA 3MEXA 1GXPA 1JTYA 3M07A 2JA6J 5CVJA 2KHMA 4PCQA 4KT6A 3M4OJ 2X0LA 4NQWA 2KISA 1D5VA 2IGKA 3NQOA 5C3EJ 3C3WA 1SVLA 1P4XA 4YRVA 1VQPI 2M0MA 2XF6A 3DEUA 2X1DA 4HW0A 2LBFB 2FBKA 1M1EB 3BY6A 4A5NA 2JA8J 4EM1A 2QQ8A 4JK1X 2Z99A 4DOZA 1ZGJA 1SANA 1OFCX 4RAZA 1XMKA 2KZVA 2W25A 1OCRH 3RKYA 1L3LA 1AU7A 1NHAA 4BHPA 1O7FA 1O57A 4V2FA 4EJUA 4F3QA 2Y9ZA 4RMNA 3WTYC 1HDDC 4CA0A 1ZKGA 1JHHA 2KP6A 2DA6A 5HDGA 4MEYF 4HLYA 1VQ7I 3KP4A 3BDDA 3OYEA 2RV8A 1USSA 1UG2A 1YX3A 2H1LA 3IWZA 2MC4A 5CVRA 4AVZA 3CJNA 2A6HF 1YRNA 1JKPC 2V79A 1MSFC 4A2UA 2QA4I 4MQ9F 2RN7A 3B6AA 4XLNF 4A0YA 1AKHA 3QP5A 1MZBA 3OIQA 3BPXA 2VPRA 4RBOA 2FMLA 2UXNA 2HQRA 3Q0UA 3CC7I 2HDDA 4OU0A 1WZ2A 3AL0B 4C3JJ 3U2RA 1I6XA 2VT3A 3M1EA 3LA3A 3KFWX 1WI9A 3K4CA 3HXLA 4M71A 1WJEA 1D0YA 5K5OA 4AD9A 1T95A 2G7HA 2NOGA 3BLYA 1OCZH 1RZ4A 1Y0UA 2E60A 3T1BA 2L01A 4RM2A 2Z9OA 1IO2A 2JA5J 3DKXA 2MD0A 3PNYA 2HOEA 2R7SA 1LNWA 1D1AA 1SD7A 3KPHA 5L3GA 5HLGA 4GDFA 1SVOA 3W2WA 3JRFA 5DD4A 1X2NA 4YG2F 1XGOA 2NVXJ 4LB5A 2CYYA 2OPTA 1WI3A 1ERDA 1ETXA 4DGWB 5CPRB 1G3YA 1IRXA 2B7EA 2CQ7A 1Z9CA 1W7PD 2FOWA 5BPDA 1MNEA 5HVQC 2DK8A 3ZQQA 1ZARA 1LFPA 4LK0F 3TDUC 4XKCA 1ZG1A 2F4IA 1MBKA 2NNYA 2E71A 5LRRA 2CFXA 2EIJH 3ECHA 3QU6A 3K0LA 4AM3A 5TGTA 1IC8A 5HLIA 4CCKA 2H6BA 2M1BA 1IGNA 1PYVA 4FASD 2VBXA 1TTYA 1O3TA 2ZSIB 1R23A 5IT3A 2ACJA 1G3SA 1MBFA 2CJJA 2V26A 3I3LA 4PUSA 5EYRA 2I10A 1LB2A 1HCRA 1MH3A 2E2JJ 3BROA 1T6SA 3OMYA 4IHVA 2IGOA 5DEQA 4M6XA 2ETHA 1PUEE 3CCSI 1Z7LA 1TQIA 3ZP5A 5E1WA 2VPLA 2CUFA 1U0JA 3FM3A 5J1RA 1FTTA 4CZZA 3DU6A 1WGXA 2HTJA 1WQ2A 2Y2ZA 3PQKA 5IP7J 1ZLJA 4KT5C 3ZR8X 1OYWA 2LP0A 3HZJA 4ON0A 2VKVA 4F92B 4XSZF 3EUHC 5F6FA 1PUFA 2XGXA 2VONA 1W36D 2HOSA 3S2HJ 1HQCA 4F7ZA 4HF2A 2A61A 3ZPLA 1O7LA 3GZ5A 2O9LA 2K3FA 5ILUA 2ECCA 2WAEA 3HTSB 3TP3A 2N8GA 2LSOA 1KQ0A 4M3DA 2R7TA 1G59A 3E97A 2DYRH 4PFOA 2BW3B 1SD5A 2K9MA 3HOSA 3J81Z 3N05A 2KJCA 1ETVA 1T38A 2M8EA 3HG9A 2BV6A 1MNDA 2AO9A 2DJNA 3FXLA 5IT9K 4Y4RA 3OY9A 1XD7A 4BYYA 5FLVA 2E1NA 2IGNA 3EYIA 2COBA 2XUBA 3HSEA 2UZKA 4IZZA 2KIQA 3OYDA 4L0YB 3BTLA 1FPQA 1R9TJ 2OA4A 5FO5A 2DA1A 3PIPF 2DA3A 2NOJB 5FRNA 2DOAA 1ZH5A 2BXZA 1P6RA 5DV5A 3S2DJ 3ECOA 3BR1A 2CV1A 3KYDB 2KPMA 4II3A 1R5HA 3V7RA 4DBQA 2FA5A 3QPSA 1W7PB 1WJ5A 2VQHA 1DDNA 1X58A 2IA2A 1X3WB 3KLNA 3E5XA 1X1DA 5JVTA 2XF5A 3H92A 3M1CA 3HJEA 4FX4A 1LPQA 2CMPA 4KN7X 2XAHA 2DA5A 2L2OA 2ZXIA 2BY1A 2LLKA 1OLTA 1A6QA 3DBLB 4ESBA 5C44J 4U0VA 1G3WA 1GVDA 5IY5H 1ODDA 2KZGA 4ANJA 1K83J 4Y52J 4H0EA 1V5GA 1MMGA 4GRIA 1JTXA 1XSXA 5E79C 3DLAA 4D7NA 2L9RA 1BI3A 3WTUC 3VWBA 2OTJI 4BE0A 1YJ9I 2XASA 3GLLA 5KK1A 2IS1A 2MABA 2BVMA 3BG3A 3DBHB 3OYKA 1U8RA 1Y1WJ 1IDYA 2XC7A 1KU9A 1B59A 2M7BA 3IAS2 3G4SI 1S7OA 1XCBA 3M7GA 1RKTA 2YX7A 5L3CA 4ESJA 4MLOA 1IV6A 2KL4A 1CF7A 3I4MJ 3B73A 3F22A 1Q1VA 4PGHA 5E8IA 2DT6A 3JSPA 2IPQX 3F72A 1NG7A 1EA3A 3OYCA 3F21A 4UUSB 3RIRA 3WGIA 4MO7A 4IPAA 3G2BA 3IUOA 3I9V2 3OOPA 3FHZA 4WK8F 2O6GE 3CQZJ 3R60A 3E3VA 1U78A 4BHBA 4EM2A 3HRMA 2GA1A 3VYUB 5DS9A 2K9NA 4Y15A 1H9TA 4PJNA 2A07F 2CO5A 2CS3A 1ITYA 1R1TA 1E2XA 2L7ZA 2PN6A 1G4DA 3HHHA 1HC8A 1IN7A 2O8KA 1VNDA 2RNGA 3VODA 3C7JA 2R5ZA 1DP3A 2Z5UA 1KONA 1FBQA 3FXRA 2STTA 1FP1D 4RB3C 3ISPA 1UJ8A 3MKLA 2A05A 3E1SA 4YIFA 1FBUA 1BN5A 3CO7C 1GUUA 4BL0B 1T39A 4KJZA 5FKOA 1U2WA 3HOTA 4YFKF 5B5EC 1VI0A 2JZYA 5F0CA 2WWYA 4ENKA 3F3XA 3DKWA 4ZDPA 4MFDA 2JN6A 3CF2A 3CCLI 1J5YA 3QYEA 4XQFA 3HEFA 2W48A 3DF8A 4RDUA 2F5EA 3I59B 3TW7A 3NWSA 5FGMA 3WODF 2X48A 3T0YA 3J7ZI 4CYCA 4Z2YA 2E5NA 2DOEA 1LFUP 2OTLI 2B63J 4HF0A 4AIHA 1B9NA 1XB4A 2IW5A 2W00A 4XN3A 2CW0F 2YU3A 1A36A 2X4HA 3E6CC 3H9JA 2EB7A 5D6EA 1WJBA 2MA3A 3W6JB 1JKRC 3BG5A 1U9NA 3NWTA 5J1YA 1HXDA 3A4CA 2L7MP 1J7KA 3KYCB 4RB2C 1LVKA 3EPZA 4KICA 5KAIC 4KISA 3GTMJ 2YUSA 3LWFA 3LSIA 4A12A 4LOCA 3SZPA 2DFFA 1DP7P 4OAZA 3HGYA 2NRAC 1XMAA 1WKMA 3S16J 4Q48A 1F5TA 3LSMA 3BQZA 3OOUA 4FISA 3LMMA 2LH9A 4XRSA 1GV2A 4MGRA 2HKOA 1V5FA 1MMAA 4LIVA 1HKSA 3G1MA 2CV0A 3KZZA 4YFXF 1IRZA 1EH6A 3K9TA 3L2VA 1ETOA 2WBMA 4ABZA 4AWXB 1Q1HA 4A0ZA 2QGUA 2FD5A 1RC9A 3WGHA 4S05A 4NB5A 3BZKA 1QRYA 2XSJC 1VQ4I 2WB1A 1FJLA 2L9NA 3I5UA 2AS5F 3OYAA 3I53A 2XAGA 4M9SA 3FXUA 2BXYA 2LF8A 4BXUA 4Y3OA 3DTIA 1T56A 3QOEA 1KU3A 3WTXC 2AQFA 2VT2A 3M3YJ 2DO7A 2EFPA 4Y17A 3FF5A 3FBIB 1CQTA 3K4MA 3CMMA 3SEZA 5HS7A 4CYCB 2Y75A 4P55A 3K4NA 1U6GA 4A6EA 4UNOA 2OQGA 5EGOA 3BG7A 5HOOA 5EF6A 3I59A 4A3JJ 3BZ6A 2GOXB 2MH2A 2EIKH 1TW3A 3TO7A 3ZN1A 5K1YA 1I1GA 5F1RA 2W84A 3AFHA 3Q0VA 4BDZA 3HTUA 3GYHX 3DQVC 3SDBA 3VSLA 1ZR4A 1ORKA 2AXLA 2VKDA 3LFKA 4J01A 1YLFA 3H3VK 4A3GJ 2LMDA 4CCJA 2GLOA 1SD4A 2KKOA 2VKHA 2XIGA 5AIQA 3AL0C 1PJRA 3A01A 4BACA 2R7ZJ 1MBJA 2HNHA 1BI2A 2H8RA 2PLYA 5F0FA 1OQYA 2R5ZB 3QYBA 5LD2C 4BU2A 4PSXA 3BJAA 4Z6YA 4NBQA 4BE1A 3K6GA 3IWFA 3MD2A 3E6MA 2P6SA 2MSYA 4RM3A 1JUSA 4E4HA 1BR2A 2X9DA 3KP7A 1R71A 3BPVA 2HPMA 3HOZJ 2MC3A 2VE8A 1RI7A 2ID3A 3BZCA 3CLOA 1TWCJ 2DMTA 2DPUA 3IV5A 3MKWB 2ZJRF 4RLQA 2NAZA 3CJQB 1SFUA 2R5YA 2VBYA 1Y8QB 2X6WA 3DEWA 4C2TA 2H94A 2LVSA 3CCEI 3GWZA 5KCMA 3WE3A 3UNGC 3FMQA 1IN8A 2EQRA 4XLCA 2R5YB 2TDXA 4NHJA 4JYKA 1MJAA 3FXOA 5J4YA 1R5ID 1YQAA 3M9AA 1BOBA 3I54A 1TBXA 4RGSA 4RGXA 2I8DA 3S3NA 1QPIA 2GA2A 3MWMA 4K2EA 4FCYA 2M87A 2Y0MA 3F8MA 3LQRA 2FBIA 3DPTA 2DODA 1ENHA 1IV8A 2RGVA 1N78A 3DTKA 2MGQA 3DKYA 3HOVJ 3G3ZA 1IF1A 3BR0A 1RETA 2ZMEC 1YO5C 3OYJA 1RR7A 2WA0A 3HKZN 2QZ8A 2GOMA 2D2WA 4XRMA 3BJOA 4B44A 2XPUA 4YFNF 4BEHB 2FOKA 4BQNA 2JPCA 3FIWA 4EATA 3GTLJ 4PZJA 3ABTA 3FISA 2DTZA 2HZTA 4LLNA 3RKWA 2P5KA 3BR5A 3REOA 1HBXG 4OINF 1TT0A 4KIGA 3GW2A 2ZXWH 1P7JA 1XSVA 2Q0OA 4CCMA 1Z7UA 2ECBA 4E6KG 4XRSG 2QQBA 1YX5A 2VE9A 2R7WA 1QZEA 2LKSA 4I01A 1O3RA 1OKRA 2MFZA 1Z3YA 1W5TA 3L09A 4HYEA 3RTRA 3DTEA 3GMEA 1MJ9A 2LNBA 5F08A 3ZGKA 4XN0A 4IOCF 3PFIA 3FX3A 4I99C 1XX5A 2PX9A 2WY7Q 4QWQA 3DXJF 5L3DA 1B8IB 5M3FJ 1ON1A 1N75A 3K10A 2D1HA 5GAGJ 5LHGA 3JR9A 1SEUA 3IH3A 3Q0WA 5E17F 2ESNA 3V42A 3T5XA 3ZMTA 1T8IA 4JX5A 2LY9A 4DZPA 1ZTRA 3T8TA 3OSGA 3MVPA 2KRFA 2QSFX 1SD6A 1SC7A 2PMHA 2VXDA 3PUFA 3V4GA 3FXJA 2IS4A 4LLLA 2GM4A 2M4GA 2FQ3A 4G7OF 3S1MJ 5M5XJ 3V7SA 4CHUA 3QOPA 5EEAA 1G6NA 4RGRA 1TZLA 5CLSA 2Z1DA 1OISA 2JSPA 4RLFA 4WF2A 3CCVI 1BI0A 3LQQA 1T08B 3J81K 3HKZA 2VC1A 3FZVA 4CYDA 3DEEA 1BIAA 4XRFA 2L02A 3GFIA 2PQ8A 4CCOA 4CCLA 4IHWA 4N4OB 4OMZA 2W1OA 4B3AA 2FUG2 4M3GA 3FXMA 1ON2A 4X0GA 3CMAI 1SFXA 1Z6RA 4F91B 1JGSA 1W0UA 1NK3P 1VTNC 1I27A 2ZMEB 3AG2H 3E5UA 1P2FA 1GXQA 2K3PA 4E7SA 1IG7A 2JRTA 5DM6F 1JT0A 4HDVA 2ZNYA 3COAC 3LSPA 3TOBA 3PFYA 3HOWJ 1HSJA 3B02A 3WU0A 2MW8A 1DQUA 2Z16A 5BPIA 2C6YA 2LF7A 1WJDA 3WGGA 5JLXA 1WCMJ 5J6XA 4L9JA 3ABUA 4LJZF 4XLHA 1FMWA 5LGTA 3ZQLA 1DU0A 3KP2A 2F4OB 4BJ5C 4YIIA 5EEGA 5EDNA 3ABMH 3GZNB 3U21A 2HYJA 3VFZA 2P5LC 3W6VA 4EJOA 1T0FA 4MNUA 2NS8A 4JBAA 3IH2A 3RZDJ 2EZIA 5ILSA 2E35A 4FE7A 2Y0SA 2IJLA 2BVLA 4UUSA 3K70D 1JT6A 5K7HA 5FRMA 1DGWY 2HQAA 3HBLA 3SHFA 3DLLF 3CCRI 2DTRA 4DW6A 4XLFA 2OV7A 1Y8RB 3S3OA 3H35A 4YEJA 2PJPA 3ABKH 2OZ6A 5CVIA 2YX4A 3MQ0A 3G73A 2X85A 3HM5A 2E2HJ 3LNQA 1X4PA 1PP7U 4B09A 1YS7A 1RNLA 3GUDA 3S8PA 5FROA 4ZYHA 3CO6C 3O8HA 5D4RA 3MKZA 4N9IA 1FP2A 1J59A 2DW4A 3L2UA 3S93A 3WTSC 3ASNH 3RPUA 2B0LA 2V9KA 1UHMA 5D8KB 4FT8A 1S29A 4CH7A 2E1MC 2F48A 4ZTJA 4X1EA 1VQKI 2BY3A 4HEA2 1V5EA 2W57A 2LY2A 2UUZA 1U9OA 3AAFA 3BP8A 2D5VA 3V8KA 4AUXA 1MDMA 4M72A 3E6BA 2X6XA 3KZIC 2P81A 2ZXJA 3KIOA 2L0KA 3QP6A 2CU7A 2XSDC 3PSFA 1MNMC 3CZ6A 1OR7C 4I02A 3DPUA 3CUQB 1D0XA 3DCFA 2YSRA 1XPXA 4MTDA 3LFUA 1LQ1A 4AIDA 2BOLA 1FC3A 3G71I 2XHKA 2FX0A 1XMXA 3MZHA 4XL9A 3I4PA 2DJIA 2IP2A 3H9GA 3OYNA 3KX2A 1QNTA 4HRIA 3TO6A 2AQEA 1X1AA 3L7WA 5E1ZB 4W1UA 4LD5A 3HDDA 1FEXA 1S6LA 3H5NA 3OIOA 4IO9F 1ETQA 4IRHA 4UVAA 3GTQJ 5K7ZA 2X1EA 5FLXK 3UR3C 2UWMA 5LFAA 3G6EI 3O2PE 2K86A 4NC8A 3LL7A 1QGPA 5E3OA 3N97A 5BOXA 4HF1A 4KNYA 3GTGJ 2VOPA 1R7JA 4HAMA 2XGCA 4UUVA 1KU2A 4LG0A 3CUOA 5DCMB 2Y48A 4A3IJ 2EBIA 2XGEA 4UV9A 3S17J 2OF7A 3D5SC 1YI2I 1S72I 2QM3A 2QKMB 3VEPA 1HKQA 4AIJA 2VL8A 3BC8A 3I71A 1RUNA 2VUMJ 1IN4A 4NC7A 2BE5F 2KT0A 2E1MB 1ZRFA 2L4MA 1S7EA 2HU9A 2Y69H 5ICEA 5D5WB 2H1KA 5ILVA 2K7LA 1BC7C 3Q3SA 3HOUJ 3F23A 1GT0C 1R22A 1CF7B 2V9PA 4CGZA 4LFUA 3K2ZA 1DPUA 2MYSA 4KDPA 3GXOA 1S9HA 1T2KA 3FK7A 4LG0B 3M8JA 1P7IA 2V7FA 2VI6A 4BDYA 3HOYJ 5HODA 3Q9SA 4ZZLA 1TL8A 5CQEA 1W5CC 2QBYB 4BY1J 3PL8A 1YJNI 2OCEA 5EZGA 2E1OA 2FQ4A 2Y9YA 3CMYA 1EH8A 1RESA 3RPQA 1FOKA 1WJAA 1ZELA 1K6YA 2M30A 1KA8A 1APLC 2ZC2A 2R7QA 2CWEA 2W4SA 4LITA 3JTGA 1HSTA 4M6VA 4OIQF 1I50J 1FOXA 3OYLA 3P7NA 4IRIA 5KHDA 1D5YA 4ENMA 1OCPA 2DK5A 2HS5A 5LHHA 1W4MA 1WJCA 1YOVB 4XR6A 3TKYA 4U0YA 5C4JJ 4XKVA 3ZN0A 3O8GA 1JUPA 1FSHA 3LSJA 2VC0A 2Z33A 3DFGA 3ZMUA 4G7ZF 3C1DA 5FLMJ 2VIXA 4M9ZA 3OS0A 2BZTA 1ZRCA 5J8FA 1QZZA 2EV5A 2O7OA 1H89C 3J7AO 4XBFA 3FXKA 3F8FA 5E18F 4UB8C 3WG7H 1BR4A 5KNLA 3BTCA 2OU2A 2F2EA 2RNJA 2HOTA 4C3IJ 2P6TA 3SFZA 4OIOF 1TWGJ 2W7NA 2V1XA 2DA4A 5L3EA 3FWEA 1NK2P 2XPWA 3E6DA 4I0AA 3HRTA 4IF4A 3MAJA 1UCRA 3LSGA 4OMYA 4PSWA 1R4MB 2DXIA 3AG3H 2L4AA 3CC2I 2M7AA 5DUIA 1FOYA 1B8IA 2WV0A 1R6RA 5FFZA 2RREA 2NXNB 5E3LA 1L0OC 1ZN2A 4DJAA 3X2QH 2DLLA 3CDLA 3P9KA 5LBQA 2EZLA 1MMSA 5FKMA 2IEKA 2V1DA 2XF7A 3EUAA 3NAUA 3TW6A 3ZQFA 3OYBA 5KAFC 1FT9A 4E7KA 3F6VA 4MFEA 3QQAA 4Q5SF 1X2MA 3O6BB 2OC6A 3SFIA 3FM5A 3PO3J 5D5VB 2K27A 1VQ5I 2EH3A 1MH4A 3R61A 2K40A 4LMYA 1LVAA 1U3EM 2E1CA 4F52A 1N25A 2RQQA 5EEHA 2XAFA 2DDAA 2E7WA 4MTEA 3ZCOA 1HDPA 4I6ZA 4XKBA 1ZG5A 1REPC 1JJ8C 2HVQA 3WG9A 2GXBA 3S14J 1WFXA 3P5JA 2IBDA 4QPOA 3K1MA 1VQ9I 4IHXA 2CQKA 3JRBA 1ETKA 1GHCA 2AHQA 3H3ZA 4E7LA 1A04A 1D8JA 1UHWA 3K1PA 4U88A 1FYKA 1UAAA 2ICWG 2VJJA 4A3CJ 2HQNA 4A3FJ 2D1VA 1P9QC 2KLOA 5D8LB 3KEYA 3ULQB 2J5OA 4HNVA 1R1VA 3KEQA 5E3NA 2ZNZA 1U8BA 4U87A 3CJRB 2XGDA 4RB0A 1K79A 1EV7A 2JVGA 3RI4A 2A3SA 1IN6A 2ZBKA 1X4OA 2LBFA 4RB1A 3O3KA 3CMEI 2HOAA 2Q2EA 4W97A 1FYMA 1HKTA 1GVJA 3T8RA 4CCNA 3QODA 2EJRA 1F4KA 1OR7A 1YE9A 3C2HA 2D45A 3GF2A 4XNFA 4R79A 2FNPA 2I5UA 2QCOA 2LFBA 1SFOJ 1K7AA 2JRMA 5J40A 3TMOA 1FBSA 3QPHA 1Z1DA 3JW4A 3A02A 1Y0NA 4N9HA 2KIUA 2EPFA 4ZDLA 3FHNA 4BBSJ 3GCMA 1MW7A 2PG4A 3H1CA 3HRSA 2ISYA 2P7CB 2ZXHA 1HF0A 3CCMI 5DM7F 3GTKJ 4AC0A 5EG0B 1R4NB 2LOOA 4ZYGA 4GCVA 3IAM2 2FSWA 2V4JC 1YRNB 2DT5A 1ZQ3P 2R7FA 3FDYA 3KE2A 1BOAA 4BEHA 3OYFA 2P4WA 2V1UA 2LD5A 2ZO4A 1G3TA 1KQ9A 3ABLH 4A6DA 1YITI 1VZ0A 4H4KC 2EFOA 3IC7A 4BGDA 2EILH 2HZDA 3KZYA 4EMSA 3QRFF 1D1BA 3L2QA 1OPCA 3GX4X 3G1OA 4XLPF 1MMDA 4HX4A 1FY7A 1QA6A 2CUZA 5TRDA 3K4LA 5GPCA 1BIBA 2BBYA 2DAOA 4WXHA 4DIQA 4M73A 3QU3A 5LGUA 4MQVA 4PJ0C 3HL2A 5CQGA 4KIFA 3KEOA 4DZJA 4V19K 4O3MA 4O6JA 3NRVA 4OIRF 5FKNA 4TV7A 2QVOA 3AKZA 2VJIA 3ERED 2WV1A 1X3UA 1Z77A 3KETA 3D5LA 3HUGB 5GAHJ 1I3QJ 1K6OA 1PP8F 1V55H 4G6TB 1LDJA 2NVTJ 3JRHA 4RA2A 1D3YA 3HUGA 1QO0D 3W3CA 1K78B 2P8TA 3RYRA 3BR3A 2X1CA 3FXQA 3SZTA 5CVVA 4II2A 3FKJA 3H3UA 3EUHA 4BE2A 4NDLA 4DQ2A 2KIFA 3ZXSA 2QSGX 2E36A 2EZHA 9ANTA 5AONA 4OAYA 2JPBA 2VJ4A 5IOZA 1WH7A 1G8XA 3U9GA 4IEJA 2ZFWA 3OSFA 3C2GA 4HLXA 1JXSA 1ZRDA 1WRJA 3ZQIA 4BHCA 5M5WJ 4EGYA 2PBIA 1OYIA 3ZMZA 4ZYEA 1RRJA 1FYLA 4S04A 3MN2A 2VOOA 2HGCA 2XB0X 1R00A 3S1RJ 1OMIA 5HDNA 1D0ZA 1Z91A 2JSCA 3A01B 1LDDA 4XMYA 3HGGA 2HPIA 4ETSA 3HIFA 2R7VA 4G12A 5FD5A 4LLGF 3IL2A 1MD0A 1R58A 2B9SA 4JOMA 2X51A 3L2CA 1Y56A 4EM0B 2STWA 4DBRA 1ACIA 5CVUA 5J3LA 4Q4ZF 4B4CA 3MMYB 1JUMA 2R7RA 3PNTA 4P5OA 2ELKA 3GFMA 4AVPA 3I4NJ 2F5FA 1ZK8A 3VSKA 4EQQA 2HTSA 4WXCA 2CSOA 2YPRA 3GTOJ 2LREA 4V2GA 5LEJA 1RR8C 2ZMEA 4D1QA 4EJTA 2KRCA 1KU7A 1BL0A 1LJ9A 1O3QA 2IAIA 4M3BA 3ELKA 1ZG3A 4EV0A 2ZJ2A 2XPVA 1IXRC 1WJFA 2H09A 3IHUA 1DUXC 2DMNA 3S1QJ 3LSKA 5BS6A 3PO2J 3OS1A 3LA2A 3JRDA 4FTHA 2DFIA 4ZZDA 3DV8A 1N77A 2EFWA 2VLAA 1BW6A 4IHYA 1V4RA 1H88C 4Y33A 3BOQA 2F4MB 2J5PA 2HDWA 3CCJI 1T33A 1I6HJ 3EUKL 2IS6A 2M45A 4C30A 1YS6A 5GAEJ 5ED4A 1GV5A 3IRQA 1TWHJ 3PM1A 4XLEA 2HXOA 5H2FC 5E1XA 3W2VA 5GTIC 4E7JA 2ZCWA 5C4XJ 4M9XA 1FWZA 1XCVA 1ZGWA 1XN7A 2K85A 2LTPA 3JTHA 4D5CA 4BXXJ 3AG1H 1UG0A 3I0TA 2CUJA 3JAMK 1F9NA 2RKHA 2DT7B 4HQMA 3TOAA 5JHUA 2H27A 5F04A 1VQNI 3GBGA 3EQLF 1UZCA 3DU5A 1B1BA 1VQMI 4CXFA 4WCGA 2KFDA 4PJJA 4G94A 1SVMA 2G7UA 1YW8A 3BT9A 1HLVA 1IDZA 1IXSB 1H9GA 1U5TC 3SJMA 4Q47A 3UKGA 1RKWA 1VQLI 5H20A 1NG6A 5CJ9A 1WSUA 3A1YA 1ZLKA 2VODA 3D0SA 3CCYA 1TP4A 2IGMA 3BCBA 4GXOA 1UMQA 5JR3A 4PDKA 2E2IJ 1QHGA 4L18B 4M74A 4ASNA 4NNJA 2MLKA 2DYSH 3H9QA 2GBYA 4I09A 3CP2A 2GIZA 3B6CA 3W6KB 4HX8A 1AHDP 1FSEA 4XORA 1HOMA 2KMUA 2V6EA 1OJLA 1A35A 3RDIA 3Q5FA 2JWTA 2UXXA 3CESA 2E19A 1Z3XA 1TQMA 2QSHX 3J80K 2JA7J 2DMQA 4G8XA 2F6CA 1P92A 4LG3A 4XSXF 4E7ZA 2ID6A 3FKIJ 5CYVA 4LGWA 4XLAA 2HXIA 3LA7A 4HV5A 1BJZA 2WAQN 2P0WA 2OQRA 4ZTFA 5TJJA 3R0JA 4BH9A 2R7UA 5JHFA 1BBYA 4OOIA 1P4AA 2VN2A 3PUBA 5HS9A 2VBWA 4CDGA 4U7DA 2RDPA 4X6AJ 2XAJA 3L00A 4LK1F 1QU3A 1RIOH 5IP6A 1UELB 4QPQA 4R8HA 1ZHFA 4UVCA 1OCCH 3QYFA 5DCMA 5M3MJ 4L5IA 2HFHA 2BW3A 2LY1A 3LSTA 4J00A 1FZPB 1DGRM 2Q1ZB 4L5JA 4A3EJ 4LB6B 3CC4I 3WHCA 1LE8A 4HBLA 5HDKA 3WTWC 1B72B 1XGMA 4HZFA 2A69F 3BJ6A 4BQQA 4XKWA 2L3DA 4IL6C 1HW1A 2BGCA 3F9KA 4EVIA 4HNUA 1HA8A 1IRFA 4BAYA 2YR2A 2R3SA 1DU6A 4ENNA 4GFBA 2GQQA 2H8WA 3RYPA 4BNCA 4XOTA 2IS2A 3K4BA 2XAUA 4QTRA 3K7AJ 2KDZA 3FK6A 4JX6A 3U1DA 5BNGA 2HKXA 4P96A 4RAFA 4C3HJ 3OYIA 2FMYA 2JVHA 5FJ8J 5ICCA 2VKEA 1QVTA 1SMTA 2V9VA 5F27A 3RSNA 1V54H 2MD5A 3K70C 1KQ8A 1Z0XA 1SFKA 4YELA 2DN0A 3ZMVA 3WTTC 2V6CA 2GXAA 3JREA 5GADJ 1YIJI 2IA1A 2CH0A 2ME0A 5ICFA 5K7FA 3J7AY 4DYRA 3OR1C 1OCTC 2PFBA 2GXGA 1XGSA 5A2QK 3RCOA 1FLIA 2KQRA 2Y0SN 5B1AH 2DPDA 1BA5A 3BCAA 3CCQI 4UVBA 1ETYA 4S0HB 4HSTA 1AOYA 1QVUA 4UXNA 4IXAA 2HYGD 3CD6I 3A0HC 5EG0A 2L7FP 4KFCA 5B1BH 3A2KA 2HI3A 1W7PA 3WE2A 3Q9VA 4CUGA 5BQTA 3HSRA 2CW8A 4ZC3A 1EF4A 3J80Z 1R1UA 1TNSA 5KVRA 5E3MA 3F8NA 4MIMA 2OJED 5HLTA 2QUFA 3WTVC 3ZQ7A 2O8XA 4PGGA 3S3MA 2HVSA 1ZAOA 1MDMB 1O3SA 3EYYA 3P9CA 1J0RA 2R92J 4DYQA 1IZ1A 1F1ZA 3H5AA 2QENA 4G9YA 4C9YA 3TGNA 3RZOJ 1OCOH 2A6TA 1E17A 2O61A 3R4KA 2EA2A 2LDUA 3KP6A 3SQNA 3ROUA 4L9TA 1B72A 5K5RA 5TISC 1ETWA 1S5LC 4XOPA 2QYOA 3WTZA 2QLZA 2MG4A 2DOFA 1Z6TA 3SEQA 2G9WA 1E3OC 2DI3A 5IPAA 2XRLA 1A31A 1STZA 2COMA 2O0YA 1WVRA 2DA7A 1K61A 4P9FA 4RS8A 1XDUA 2WY8Q 2JA2A 3VYRB 4JP0A 4GO1A 3DWLE 3GZ6A 5BMZA 2A5YB 2Q2EB 4P9UA 2M2EA 4MEXF 4PFPA 5L3FA 1I5ZA 5J47A 2LKXA 4KMFA 3SDGA 4AYBA 2EA4A 4IJAA 4EEFG 1W5SA 1YW7A 3IKVA 3K4JA 1P4WA 2JUGA 2QEXI 4HQEA 3ZMDA 5HNHA 3H36A 3CLQA 3MKYB 5GPAA 1ZYRF 3GLXA 2RC4A 4PK4A 3WU2C 3VDXA 4UUTA 1FIAA 5EGOB 1LDKB 3RQIA 3HHGA 4RAGA 4Y13A 1JJ6C 1KYWA 2A68F 3LAJA 3CDHA 4KN4X 2XB5A 3LAPA 1KGSA 3NARA 2O5RA 2EWNA 4RGUA 3VYSB 4KMUX 3QPLA 3GEZA 1J75A 3OS2A 1GLNA 4XK4A 1Y39A 1TC3C 2BHYA 3PSIA 4HG2A 5H6QA 1BW5A 2F5VA 1IXCA 4NC6A 4I98B 2R0QC 2R7DA 3CUQC 4QIWN 5IYDJ 4G6QA 3GFJA 1QZYA 4FETA 4I0BA 2QQ9A 3JRAA 4IKFA 2HQ5A 4FX0A 2ESHA 4HX7A 2IRFG 3KP5A 2CW7A 3RKXA 3BTIA 1TWAJ 2E7XA 1TNTA 2CQNA 3P9IA 4KA4A 2ZFUA 2XVCA 3CP8A 3SZGA 1Y6IA 4CICA 3J7YJ 3GTJJ 4D7MA 1FOWA 1LKXA 1R5GA 2K9SA 5IP9J 3ERMA 3BR6A 4I7HA 2P5VA 2PEXA 1NTCA 1QPMA 2ISZA 3BG6A 5LRSA 2GZWA 2K4JA 5FKLA 3CF5F 3CCUI 5DUKA 1LUJB 3KYLA 5E8GA 3C2BA 2TRTA 4IX7A 2XKOA 2Y30A 3H5RA 4A5MA 4IRGA 5HLHA 3ASOH 2TCTA 2FU4A 4E7HA 1B6AA 2X6YA 4B8XA 1D8KA 1Z21A 4A3BJ 5FD6A 2A5WA 3QPTA 5F64A 1K78A 5JVGF 2NVYJ 3OWTA 5M5YJ 2JQ7A 3PQJA 3R0AA 2LK2A 3FMSA 3JRIA 3H0DA 5EZHA 2NS7A 2W82A 3K1NA 1VQOI 1IRGA 2X6OA 3HB9A 3IKTA 2VJ5A 3K4KA 3RJPA 1XSDA 1BJAA 2JTVA 1R49A 1HW5A 1JGGA 5B66C 3CJTB 2R7OA 5L3BA 1Z67A 2W85A 4ZH4F 4BQAA 1X1CA 4C2UA 3TDZC 5GTHC 2DQLA 2OUMA 2RQPA 4HA8A 2OD5A 4OWRB 2LG4A 1T0FC 1S3JA 4NQWB 4UY8I 2JT1A 3GTPJ 5H6RA 1ZGAA 4UHTA 1R36A 1WH5A 3JCUC 4FE4A 2Y31A 5FKKA 3EETA 4XM3A 4B48A 4A93J 4L9VA 1W0TA 3V7CA 1LEAA 1VF9A 3HRUA 4N4NB 4BBRJ 3K2AA 1W1WE 2QF7A 3LOCA 4BS9A 2FNAA 4UV8A 2IVMA 3OYHA 1TW2A 5IYCJ 1K4SA 1ULYA 3TBIA 2MBFA 4PJLA 5LEKA 3HSFA 3U1KA 1H8AC 4OIPF 3IH4A 2XV4S 1XC5A 5DCFA 1PUFB 2R7XA 2FXAA 2K02A 2JUCA 1DPRA 1KZHA 1MSEC 5K5QA 2OAZA 1MBGA 1MBEA 1JHFA 2ADUA 2L7KA 3OV8A 2Z2SB 2JK3A 4A69C 3ZOBA 1C0WA 3MZ8A 1WWXA 2EIMH 4BKXA 5DTDA 1POGA 3LSHA 5F1JA 1LE8B 4JX4A 4UB6C 3JRGA 2NYXA 5EJCA 2VBZA 3CUQA 2ELHA 1TT5B 1XTAA 1EKEA 3OYMA 3DBRB 2L9VA 1MMNA 4ZYAA 1IUFA 1FNNA 2LYCA 2VB6A 4RAYA 4XONA 4F55A 2O3FA 5A2QZ 3JSOA 1VFCA 2LRDA 2XDVA 2BHZA 3E7LA 3ML6A 2EV0A 4IHTA 2F5CA 4A0XA 2EK5A 1BR1A 3LSRA 1ZREA 2K5CA 2G0EA 2IXSA 4BUPA 2DCEA 1SAXA 5D5UB 3JRCA 2HYFA 3I64A 3ZRGA 2OZUA 4GYGA 2WAQA 3S32A 3ZQHA 2RAEA 2LKPA 2PMUA 2WTEA 1I1SA 3QWLA 3V8JA 3KLOA 3F8CA 3MFKA 4KIBA 1O4XA 2BY2A 1E0EA 1BI1A 3V8LA 2LC2A 2K4BA 4KYWA 2M34A 2KIMA 4U7BA 2XRNA 3CDIA 3HOXJ 1MBHA 2L5QA 1Z05A 3M8EA 4ZDOA 4D9JA 4E70A 3F8BA 1XDSA 1X19A 2DFHA 3M8FA 4MHGA 2VQLA 4QSHA 4WXDA 1XS9A 4EJWA 4IHSA 3SYTA 3A03A 2FBHA 1V3FA 4AIKA 4FHTA 3OL3A 2R4GA 4FQGA 3C18A 3KP3A 2DMPA 4A3LJ 2YS9A 2EZKA 5D4SA 2IT0A 2WC2A 2HWVA 5DDGA 2BYVE 3HPGA 2M9HA 2WAFA 3WU1B 4XICA 2M5WA 5D6FA 4CZCA 3GVAA 2GAUA 4B1RA 1AWCA 4WX9A 3RKQA 1UHSA 1QHHD 2DU9A 2NVUB 1J09A 3FBNB 2RVCA 1J2XA 2FRHA 2BEOA 2PI0A 1JI8A 1Y1VJ 2F5DA 1YG2A 3E5QA 4CO8A 4D0PA 5J4VA 1NH3A 4BJTA 1U5TB 2VQCA 1JE8A 1YYVA 1I39A 1IN5A 1ONVA 4M3FA 3OR2C 2NNNA 2CQXA 2PJRB 3I56I 1QBJA 3OIPA 3BQYA 2ELJA 2MLGA 2QQAA 5GP9A 2HEOA 1KYZA 1K4TA 2K9QA 3KCCA 3VYTB 2DBBA 2PMZA 3TO9A 4BQOA 2KRHA 3ZQGA 5J8CA 2L54A 1U5TA 1YIOA 4ITVA 5IOYA 4ZYDA 3L1PA 4GYIA 4GGGA 2EV6A 3HYIA 2CUEA 3PNVA 2BY0A 2MH9A 3ESWB 1WPKA 1B9MA 4M6YA 3OL4A 4DNCA 2M0CA 3DPLC 1F36A 3F6OA 4IOAF 2CFOA 3GFLA 5LLQA 5JFRA 3H0GJ 2P7VB 1FX7A 3BTJA 2FEZA 3EDPA 2CGPA 3IRRA 1PVEA 3R6SA 2YU9J 1VQ6I 1B4AA 1RUOA 1BM9A 3VOEA 4KITB 1S7AA 4BY7J 1EH7A 1LEBA 2EINH 1G2HA 2KJBA 2KDOA 2QWWA 2Z3YA 1D1CA 2L9SA 2PJRA 1F43A 1EJ9A 5ICGA 5J1UA 4L5EA 5FLXZ 2ZSHB 3AG4H 2M4KA 1LFBA 2CQQA 4LIUA 2DDBA 3BR2A 1PDNC 4IQJA 3JAMZ 5DD8A 2UV1A 4NUBA 2ME6A 3ZMSA 1YFHA 4DYCA 3IP4B 4R1HA 3N4MA 1HW2A 2FJ1A 1X1PA 2ZJPF 5HS8A 3L2RA 4IQ4A 5D5XB 2NVQJ 1YTYA 1SFEA 2EFQA 1E3HA 1RPWA 1AKHB 3A0BC 4J19A 3DP7A 5IYBJ 3K69A 4ZJZA 1XG1A 3PIOF 4AU7A 1JKQC 4I76A 3VB2A 2W24A 5F0HA 1IAWA 4I2OA 4PJMA 2DQRA 1IJWC 2FE3A 4F93B 1TWFJ 1YJWI 4ENJA 4BXFA 2HVRA 1SMYF 2O03A 4HSRA 2E34A 5ERIA 1UB9A 2XKPA 3G1LA 2IA0A 4EGZA 5JI6A 1IW7F 1YHQI 4JQFA 2HR3A 2OBPA 1BC8C 3HPHA 3CTAA 4G7HF 2GWRA 2DMUA 2VQGA 2ZB9A 3NEUA 4B43A 3ONQA 2AXTC 1W36C 2OCCH 2XAQA 5FFXA 2M3AA 1WHUA 2XROA 2R93J 2CG4A 3TP0A 1FIPA 4C2MJ 4HV6A 6PAXA 3ZQCA 1GDTA 3F0CA 2VXZA 4HNTA 1MJBA 1XGNA 4EJVA 3TEDA 3VPRA 4ESFA 3I55I 3E0JB 2ZJQF 5IT9Z 4CSWA 2WADA 3D5RC 1MIJA 1QQIA 3RQ4A 3HC7A 4P1WA 2LR8A 4XIDA 5JLWA 1S8NA 3I58A 3SXYA 2QBYA 2DFEA 4Y7NJ 4HOBA 3S1NJ 1I3AA 2HDCA 3S15J 2NS0A 4WWCA 3FMRA 1MKMA 1X3ZB 5LGNA 4E7IA 2ZKZA 2PMZN 1A5JA 3QAHA 1J9IA 1TLHB 5FB2A 1FTZA 4AYBN 4HDUA 3RPUD 3L2WA 3OYGA 1A6IA 3WHBA 2WB1N 1JKOC 1IUYA 1MGTA 4HPQA 2H6CA 3S2WA 4B3XA 1H0MA 1VQ8I 4YIRX 5CKTA 3TQNA 1OYYA 4A3DJ 2K9LA 4G6DA 3TL4X 2A6EF 3PJRA 3W2AA 2M8GX 2EFNA 3L9FA 1SAUA 4BJ6C 1X1BA 4A3KJ 2GIVA 5E20A 2DA2A 5AIPA 1E3PA 4IVNA 4A3MJ 3MCZA 5HNFA 2JMWA 2JJ7A 1ZR2A 4D5FA 4L9NA 4QLCU 4B47A 2CV2A 4KUMA 1TQPA
chains in the Genus database with same CATH topology
1U8BA 3SDGA 2X9DA 4EEFG 3HOZJ 2XGDA 3BG9A 3D1NI 2ID3A 5GPAA 1TWCJ 2DMTA 2CRGA 2HOAA 3IV5A 4W97A 4UUTA 1FIAA 5EGOB 2R5YA 4M3EA 3RQIA 3DEWA 1JTYA 2LVSA 1JJ6C 2JA6J 2XB5A 3NARA 2QCOA 1SFOJ 2LFBA 3QPLA 3M4OJ 2EQRA 2R5YB 4XK4A 1TC3C 4JYKA 3A02A 5C3EJ 4BBSJ 1QPIA 4FCYA 2JA8J 1BW5A 1HF0A 3GTKJ 2R0QC 4QIWN 5IYDJ 4AC0A 5EG0B 1SANA 1OFCX 1YRNB 1ENHA 3JRAA 1AU7A 1ZQ3P 2HQ5A 4V2FA 2LD5A 3BTIA 1TWAJ 2Y9ZA 1HDDC 2MGQA 3HOVJ 3GTJJ 3BR0A 1RETA 1ZKGA 1RR7A 4D7MA 2DA6A 2K9SA 3HKZN 5IP9J 3BR6A 4XRMA 1UG2A 1NTCA 2XPUA 3G1OA 3FIWA 3GTLJ 3FISA 2DTZA 5GPCA 1YRNA 3BR5A 1JKPC 1MSFC 5FKLA 3B6AA 1AKHA 1P7JA 4DZJA 3C2BA 2TRTA 2Y30A 2VPRA 2ECBA 4RBOA 5FKNA 4XRSG 3Q0UA 2HDDA 2TCTA 4C3JJ 2WV1A 1Z77A 4A3BJ 1I3QJ 2NVYJ 5F08A 5M5YJ 2NOGA 2NVTJ 3JRHA 2LK2A 3JRIA 5EZHA 2NS7A 3BR3A 2JA5J 1B8IB 5M3FJ 2X6OA 3HB9A 3JRFA 4NDLA 3JR9A 3IH3A 3Q0WA 1X2NA 1JGGA 2NVXJ 2EZHA 2OPTA 1WI3A 9ANTA 5IOZA 1ETXA 1WH7A 4JX5A 2LY9A 4IEJA 4DZPA 1ZTRA 3OSFA 3OSGA 3MVPA 3ZQIA 5M5WJ 3GTPJ 1MBKA 2GM4A 3S1MJ 3MN2A 1WH5A 4FE4A 2Y31A 5M5XJ 5FKKA 2XB0X 5EEAA 4A93J 3S1RJ 1IC8A 1W0TA 1IGNA 3A01B 3HGGA 1VF9A 4BBRJ 3K2AA 4G12A 2QF7A 3LOCA 1MBFA 2CJJA 5EYRA 1HCRA 2I10A 1MH3A 2E2JJ 5IYCJ 4IHVA 4IHWA 4B3AA 4M3GA 5J3LA 1NK3P 1W0UA 2CUFA 1H8AC 4B4CA 3IH4A 5J1RA 1XC5A 1JUMA 1FTTA 1WGXA 1PUFB 3I4NJ 2ELKA 2Y2ZA 1IG7A 5IP7J 1MSEC 1ZK8A 1JT0A 3LSPA 1MBGA 1MBEA 3HOWJ 2MW8A 2LP0A 3GTOJ 2VKVA 4V2GA 2JK3A 4A69C 3ZOBA 1PUFA 5JLXA 1WCMJ 4BKXA 3S2HJ 5DTDA 1POGA 3ZQLA 5F1JA 1LE8B 2O9LA 1DU0A 4JX4A 3JRGA 2ECCA 3TP3A 1BL0A 2N8GA 4M3DA 5EDNA 2IAIA 4M3BA 2HYJA 3W6VA 1IUFA 1ETVA 2XPVA 2NS8A 3IH2A 2DMNA 3S1QJ 2AO9A 2DJNA 3RZDJ 2EZIA 3PO2J 1VFCA 3E7LA 3JRDA 4FE7A 4FTHA 5FLVA 2COBA 1BW6A 4IHYA 4UUSA 1H88C 3LSRA 1JT6A 3BTLA 1R9TJ 5K7HA 2G0EA 3HBLA 2DA1A 3JRCA 1T33A 2DA3A 1I6HJ 3ZQHA 2RAEA 3S2DJ 4DW6A 3BR1A 1O4XA 1GV5A 1TWHJ 3PM1A 3HM5A 2E2HJ 3LNQA 2HXOA 2M34A 3QPSA 5C4XJ 1X58A 3HOXJ 1MBHA 1ZGWA 3O8HA 2LTPA 4D5CA 4BXXJ 2DA5A 2HOSA 2LLKA 5C44J 4QSHA 4X1EA 1XS9A 1GVDA 3A03A 5F04A 4Y52J 1K83J 3GBGA 1U9OA 2D5VA 4AUXA 1JTXA 2DMPA 4D7NA 2L9RA 4A3LJ 2YS9A 2P81A 2EZKA 3BT9A 1HLVA 2L0KA 3BG3A 1IDZA 2CU7A 3SJMA 2XSDC 1Y1WJ 2M9HA 1IDYA 1MNMC 3UKGA 1RKWA 3DCFA 4XICA 3CCYA 1RKTA 4B1RA 1UMQA 4MLOA 3RKQA 1IV6A 2E2IJ 3I4MJ 1UHSA 2FX0A 1Q1VA 2GBYA 1Y1VJ 3B6CA 4W1UA 3HDDA 1FEXA 1AHDP 1HOMA 3OIOA 4UUSB 1OJLA 1ETQA 3GTQJ 4MO7A 5K7ZA 2JWTA 2E19A 4M3FA 3CQZJ 2CQXA 5E3OA 1U78A 3GTGJ 2XGCA 5DS9A 2K9NA 3BQYA 2JA7J 2DMQA 5GP9A 4A3IJ 1ITYA 2EBIA 2XGEA 2K9QA 2ID6A 2L7ZA 3FKIJ 3S17J 2OF7A 2HXIA 3ZQGA 1BJZA 2WAQN 5IOYA 3L1PA 2O8KA 2VUMJ 2CUEA 1VNDA 2R5ZA 2KT0A 1S7EA 1WPKA 2M0CA 2H1KA 1F36A 3MKLA 3Q3SA 3HOUJ 3H0GJ 4X6AJ 1GT0C 3BTJA 1GUUA 5IP6A 2YU9J 5FKOA 5M3MJ 1VI0A 3FK7A 4BY7J 5F0CA 1P7IA 1G2HA 2VI6A 3HOYJ 5HODA 4MFDA 2JN6A 4A3EJ 3WHCA 1LE8A 3HEFA 2W48A 1F43A 1B72B 4BY1J 4RDUA 3TW7A 5EZGA 2E1OA 2FQ4A 5J1UA 2Y9YA 4L5EA 2X48A 1RESA 3CMYA 4CYCA 1LFBA 2CQQA 1LFUP 2B63J 3BR2A 1DU6A 4GFBA 2ME6A 4M6VA 4DYCA 1I50J 2FJ1A 4QTRA 3K7AJ 2KDZA 3FK6A 4JX6A 5BNGA 1JKRC 2NVQJ 3BG5A 1U9NA 1D5YA 1OCPA 5J1YA 4C3HJ 5C4JJ 1RPWA 1AKHB 2L7MP 3O8GA 4J19A 3GTMJ 5FJ8J 1JUPA 2VKEA 1QVTA 2YUSA 3LSJA 5F27A 5IYBJ 4LOCA 1JKQC 1XG1A 4I76A 1Z0XA 3HGYA 2DN0A 5FLMJ 3S16J 5F0HA 3JREA 3BQZA 3OOUA 1IJWC 4FISA 1TWFJ 4XRSA 1GV2A 2ME0A 2O7OA 5K7FA 1H89C 3G1MA 4DYRA 1IRZA 1OCTC 1ETOA 4ABZA 3BTCA 3G1LA 2Y0SN 1BA5A 2HOTA 2FD5A 4C3IJ 1TWGJ 1QRYA 1ETYA 4S0HB 1QVUA 2DA4A 1FJLA 5EG0A 2L7FP 1NK2P 2DMUA 2XPWA 2ZB9A 2HI3A 2R93J 3LSGA 3TP0A 1FIPA 4C2MJ 1EF4A 1T56A 5E3MA 3ZQCA 4MIMA 1GDTA 3M3YJ 3F0CA 3TEDA 3VPRA 1B8IA 5E3LA 1CQTA 2R92J 3CDLA 4DYQA 4CYCB 2EZLA 5FKMA 5EGOA 2IEKA 2LR8A 3NAUA 3ZQFA 3TW6A 5EF6A 5JLWA 4XIDA 4A3JJ 3RZOJ 1B72A 4MFEA 4Y7NJ 3QQAA 3S1NJ 1X2MA 3S15J 3SFIA 3PO3J 3Q0VA 1ETWA 2PMZN 1A5JA 2EH3A 1MH4A 1ZR4A 2K40A 1FTZA 1ORKA 2MG4A 4AYBN 1E3OC 3H3VK 1A6IA 3WHBA 2WB1N 4A3GJ 1JKOC 2GLOA 5IPAA 4I6ZA 1HDPA 2XRLA 1JJ8C 3A01A 3S14J 2DA7A 2IBDA 1K61A 2R7ZJ 1MBJA 4A3DJ 4IHXA 3JRBA 1ETKA 2AHQA 2H8RA 5F0FA 2M8GX 4JP0A 2R5ZB 4A3CJ 4A3KJ 4A3FJ 2DA2A 4A3MJ 2M2EA 2JMWA 2JJ7A 1ZR2A 4D5FA 2LKXA 4HNVA 2MSYA 1APLC 1JUSA 5E3NA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1U8B A;  3SDG A;  2X9D A;  4EEF G;  3HOZ J;  2XGD A;  3BG9 A;  3D1N I;  2ID3 A;  5GPA A;  1TWC J;  2DMT A;  2CRG A;  2HOA A;  3IV5 A;  4W97 A;  4UUT A;  1FIA A;  5EGO B;  2R5Y A;  4M3E A;  3RQI A;  3DEW A;  1JTY A;  2LVS A;  1JJ6 C;  2JA6 J;  2XB5 A;  3NAR A;  2QCO A;  1SFO J;  2LFB A;  3QPL A;  3M4O J;  2EQR A;  2R5Y B;  4XK4 A;  1TC3 C;  4JYK A;  3A02 A;  5C3E J;  4BBS J;  1QPI A;  4FCY A;  2JA8 J;  1BW5 A;  1HF0 A;  3GTK J;  2R0Q C;  4QIW N;  5IYD J;  4AC0 A;  5EG0 B;  1SAN A;  1OFC X;  1YRN B;  1ENH A;  3JRA A;  1AU7 A;  1ZQ3 P;  2HQ5 A;  4V2F A;  2LD5 A;  3BTI A;  1TWA J;  2Y9Z A;  1HDD C;  2MGQ A;  3HOV J;  3GTJ J;  3BR0 A;  1RET A;  1ZKG A;  1RR7 A;  4D7M A;  2DA6 A;  2K9S A;  3HKZ N;  5IP9 J;  3BR6 A;  4XRM A;  1UG2 A;  1NTC A;  2XPU A;  3G1O A;  3FIW A;  3GTL J;  3FIS A;  2DTZ A;  5GPC A;  1YRN A;  3BR5 A;  1JKP C;  1MSF C;  5FKL A;  3B6A A;  1AKH A;  1P7J A;  4DZJ A;  3C2B A;  2TRT A;  2Y30 A;  2VPR A;  2ECB A;  4RBO A;  5FKN A;  4XRS G;  3Q0U A;  2HDD A;  2TCT A;  4C3J J;  2WV1 A;  1Z77 A;  4A3B J;  1I3Q J;  2NVY J;  5F08 A;  5M5Y J;  2NOG A;  2NVT J;  3JRH A;  2LK2 A;  3JRI A;  5EZH A;  2NS7 A;  3BR3 A;  2JA5 J;  1B8I B;  5M3F J;  2X6O A;  3HB9 A;  3JRF A;  4NDL A;  3JR9 A;  3IH3 A;  3Q0W A;  1X2N A;  1JGG A;  2NVX J;  2EZH A;  2OPT A;  1WI3 A;  9ANT A;  5IOZ A;  1ETX A;  1WH7 A;  4JX5 A;  2LY9 A;  4IEJ A;  4DZP A;  1ZTR A;  3OSF A;  3OSG A;  3MVP A;  3ZQI A;  5M5W J;  3GTP J;  1MBK A;  2GM4 A;  3S1M J;  3MN2 A;  1WH5 A;  4FE4 A;  2Y31 A;  5M5X J;  5FKK A;  2XB0 X;  5EEA A;  4A93 J;  3S1R J;  1IC8 A;  1W0T A;  1IGN A;  3A01 B;  3HGG A;  1VF9 A;  4BBR J;  3K2A A;  4G12 A;  2QF7 A;  3LOC A;  1MBF A;  2CJJ A;  5EYR A;  1HCR A;  2I10 A;  1MH3 A;  2E2J J;  5IYC J;  4IHV A;  4IHW A;  4B3A A;  4M3G A;  5J3L A;  1NK3 P;  1W0U A;  2CUF A;  1H8A C;  4B4C A;  3IH4 A;  5J1R A;  1XC5 A;  1JUM A;  1FTT A;  1WGX A;  1PUF B;  3I4N J;  2ELK A;  2Y2Z A;  1IG7 A;  5IP7 J;  1MSE C;  1ZK8 A;  1JT0 A;  3LSP A;  1MBG A;  1MBE A;  3HOW J;  2MW8 A;  2LP0 A;  3GTO J;  2VKV A;  4V2G A;  2JK3 A;  4A69 C;  3ZOB A;  1PUF A;  5JLX A;  1WCM J;  4BKX A;  3S2H J;  5DTD A;  1POG A;  3ZQL A;  5F1J A;  1LE8 B;  2O9L A;  1DU0 A;  4JX4 A;  3JRG A;  2ECC A;  3TP3 A;  1BL0 A;  2N8G A;  4M3D A;  5EDN A;  2IAI A;  4M3B A;  2HYJ A;  3W6V A;  1IUF A;  1ETV A;  2XPV A;  2NS8 A;  3IH2 A;  2DMN A;  3S1Q J;  2AO9 A;  2DJN A;  3RZD J;  2EZI A;  3PO2 J;  1VFC A;  3E7L A;  3JRD A;  4FE7 A;  4FTH A;  5FLV A;  2COB A;  1BW6 A;  4IHY A;  4UUS A;  1H88 C;  3LSR A;  1JT6 A;  3BTL A;  1R9T J;  5K7H A;  2G0E A;  3HBL A;  2DA1 A;  3JRC A;  1T33 A;  2DA3 A;  1I6H J;  3ZQH A;  2RAE A;  3S2D J;  4DW6 A;  3BR1 A;  1O4X A;  1GV5 A;  1TWH J;  3PM1 A;  3HM5 A;  2E2H J;  3LNQ A;  2HXO A;  2M34 A;  3QPS A;  5C4X J;  1X58 A;  3HOX J;  1MBH A;  1ZGW A;  3O8H A;  2LTP A;  4D5C A;  4BXX J;  2DA5 A;  2HOS A;  2LLK A;  5C44 J;  4QSH A;  4X1E A;  1XS9 A;  1GVD A;  3A03 A;  5F04 A;  4Y52 J;  1K83 J;  3GBG A;  1U9O A;  2D5V A;  4AUX A;  1JTX A;  2DMP A;  4D7N A;  2L9R A;  4A3L J;  2YS9 A;  2P81 A;  2EZK A;  3BT9 A;  1HLV A;  2L0K A;  3BG3 A;  1IDZ A;  2CU7 A;  3SJM A;  2XSD C;  1Y1W J;  2M9H A;  1IDY A;  1MNM C;  3UKG A;  1RKW A;  3DCF A;  4XIC A;  3CCY A;  1RKT A;  4B1R A;  1UMQ A;  4MLO A;  3RKQ A;  1IV6 A;  2E2I J;  3I4M J;  1UHS A;  2FX0 A;  1Q1V A;  2GBY A;  1Y1V J;  3B6C A;  4W1U A;  3HDD A;  1FEX A;  1AHD P;  1HOM A;  3OIO A;  4UUS B;  1OJL A;  1ETQ A;  3GTQ J;  4MO7 A;  5K7Z A;  2JWT A;  2E19 A;  4M3F A;  3CQZ J;  2CQX A;  5E3O A;  1U78 A;  3GTG J;  2XGC A;  5DS9 A;  2K9N A;  3BQY A;  2JA7 J;  2DMQ A;  5GP9 A;  4A3I J;  1ITY A;  2EBI A;  2XGE A;  2K9Q A;  2ID6 A;  2L7Z A;  3FKI J;  3S17 J;  2OF7 A;  2HXI A;  3ZQG A;  1BJZ A;  2WAQ N;  5IOY A;  3L1P A;  2O8K A;  2VUM J;  2CUE A;  1VND A;  2R5Z A;  2KT0 A;  1S7E A;  1WPK A;  2M0C A;  2H1K A;  1F36 A;  3MKL A;  3Q3S A;  3HOU J;  3H0G J;  4X6A J;  1GT0 C;  3BTJ A;  1GUU A;  5IP6 A;  2YU9 J;  5FKO A;  5M3M J;  1VI0 A;  3FK7 A;  4BY7 J;  5F0C A;  1P7I A;  1G2H A;  2VI6 A;  3HOY J;  5HOD A;  4MFD A;  2JN6 A;  4A3E J;  3WHC A;  1LE8 A;  3HEF A;  2W48 A;  1F43 A;  1B72 B;  4BY1 J;  4RDU A;  3TW7 A;  5EZG A;  2E1O A;  2FQ4 A;  5J1U A;  2Y9Y A;  4L5E A;  2X48 A;  1RES A;  3CMY A;  4CYC A;  1LFB A;  2CQQ A;  1LFU P;  2B63 J;  3BR2 A;  1DU6 A;  4GFB A;  2ME6 A;  4M6V A;  4DYC A;  1I50 J;  2FJ1 A;  4QTR A;  3K7A J;  2KDZ A;  3FK6 A;  4JX6 A;  5BNG A;  1JKR C;  2NVQ J;  3BG5 A;  1U9N A;  1D5Y A;  1OCP A;  5J1Y A;  4C3H J;  5C4J J;  1RPW A;  1AKH B;  2L7M P;  3O8G A;  4J19 A;  3GTM J;  5FJ8 J;  1JUP A;  2VKE A;  1QVT A;  2YUS A;  3LSJ A;  5F27 A;  5IYB J;  4LOC A;  1JKQ C;  1XG1 A;  4I76 A;  1Z0X A;  3HGY A;  2DN0 A;  5FLM J;  3S16 J;  5F0H A;  3JRE A;  3BQZ A;  3OOU A;  1IJW C;  4FIS A;  1TWF J;  4XRS A;  1GV2 A;  2ME0 A;  2O7O A;  5K7F A;  1H89 C;  3G1M A;  4DYR A;  1IRZ A;  1OCT C;  1ETO A;  4ABZ A;  3BTC A;  3G1L A;  2Y0S N;  1BA5 A;  2HOT A;  2FD5 A;  4C3I J;  1TWG J;  1QRY A;  1ETY A;  4S0H B;  1QVU A;  2DA4 A;  1FJL A;  5EG0 A;  2L7F P;  1NK2 P;  2DMU A;  2XPW A;  2ZB9 A;  2HI3 A;  2R93 J;  3LSG A;  3TP0 A;  1FIP A;  4C2M J;  1EF4 A;  1T56 A;  5E3M A;  3ZQC A;  4MIM A;  1GDT A;  3M3Y J;  3F0C A;  3TED A;  3VPR A;  1B8I A;  5E3L A;  1CQT A;  2R92 J;  3CDL A;  4DYQ A;  4CYC B;  2EZL A;  5FKM A;  5EGO A;  2IEK A;  2LR8 A;  3NAU A;  3ZQF A;  3TW6 A;  5EF6 A;  5JLW A;  4XID A;  4A3J J;  3RZO J;  1B72 A;  4MFE A;  4Y7N J;  3QQA A;  3S1N J;  1X2M A;  3S15 J;  3SFI A;  3PO3 J;  3Q0V A;  1ETW A;  2PMZ N;  1A5J A;  2EH3 A;  1MH4 A;  1ZR4 A;  2K40 A;  1FTZ A;  1ORK A;  2MG4 A;  4AYB N;  1E3O C;  3H3V K;  1A6I A;  3WHB A;  2WB1 N;  4A3G J;  1JKO C;  2GLO A;  5IPA A;  4I6Z A;  1HDP A;  2XRL A;  1JJ8 C;  3A01 A;  3S14 J;  2DA7 A;  2IBD A;  1K61 A;  2R7Z J;  1MBJ A;  4A3D J;  4IHX A;  3JRB A;  1ETK A;  2AHQ A;  2H8R A;  5F0F A;  2M8G X;  4JP0 A;  2R5Z B;  4A3C J;  4A3K J;  4A3F J;  2DA2 A;  4A3M J;  2M2E A;  2JMW A;  2JJ7 A;  1ZR2 A;  4D5F A;  2LKX A;  4HNV A;  2MSY A;  1APL C;  1JUS A;  5E3N A; 
#chains in the Genus database with same CATH topology
 1AA7 A;  3GO5 A;  4N0B A;  1UST A;  4L0Z B;  2Q8K A;  1FMV A;  3BG9 A;  3D1N I;  5B3S H;  1UFM A;  5LHI A;  2QKL B;  2CRG A;  5DYM A;  2V1N A;  1T98 A;  4U0W A;  1CGP A;  1YW9 A;  4O5V A;  3BWG A;  2E5Z A;  4M3E A;  2VAS A;  2FF4 A;  3MZY A;  3MEX A;  1GXP A;  1JTY A;  3M07 A;  2JA6 J;  5CVJ A;  2KHM A;  4PCQ A;  4KT6 A;  3M4O J;  2X0L A;  4NQW A;  2KIS A;  1D5V A;  2IGK A;  3NQO A;  5C3E J;  3C3W A;  1SVL A;  1P4X A;  4YRV A;  1VQP I;  2M0M A;  2XF6 A;  3DEU A;  2X1D A;  4HW0 A;  2LBF B;  2FBK A;  1M1E B;  3BY6 A;  4A5N A;  2JA8 J;  4EM1 A;  2QQ8 A;  4JK1 X;  2Z99 A;  4DOZ A;  1ZGJ A;  1SAN A;  1OFC X;  4RAZ A;  1XMK A;  2KZV A;  2W25 A;  1OCR H;  3RKY A;  1L3L A;  1AU7 A;  1NHA A;  4BHP A;  1O7F A;  1O57 A;  4V2F A;  4EJU A;  4F3Q A;  2Y9Z A;  4RMN A;  3WTY C;  1HDD C;  4CA0 A;  1ZKG A;  1JHH A;  2KP6 A;  2DA6 A;  5HDG A;  4MEY F;  4HLY A;  1VQ7 I;  3KP4 A;  3BDD A;  3OYE A;  2RV8 A;  1USS A;  1UG2 A;  1YX3 A;  2H1L A;  3IWZ A;  2MC4 A;  5CVR A;  4AVZ A;  3CJN A;  2A6H F;  1YRN A;  1JKP C;  2V79 A;  1MSF C;  4A2U A;  2QA4 I;  4MQ9 F;  2RN7 A;  3B6A A;  4XLN F;  4A0Y A;  1AKH A;  3QP5 A;  1MZB A;  3OIQ A;  3BPX A;  2VPR A;  4RBO A;  2FML A;  2UXN A;  2HQR A;  3Q0U A;  3CC7 I;  2HDD A;  4OU0 A;  1WZ2 A;  3AL0 B;  4C3J J;  3U2R A;  1I6X A;  2VT3 A;  3M1E A;  3LA3 A;  3KFW X;  1WI9 A;  3K4C A;  3HXL A;  4M71 A;  1WJE A;  1D0Y A;  5K5O A;  4AD9 A;  1T95 A;  2G7H A;  2NOG A;  3BLY A;  1OCZ H;  1RZ4 A;  1Y0U A;  2E60 A;  3T1B A;  2L01 A;  4RM2 A;  2Z9O A;  1IO2 A;  2JA5 J;  3DKX A;  2MD0 A;  3PNY A;  2HOE A;  2R7S A;  1LNW A;  1D1A A;  1SD7 A;  3KPH A;  5L3G A;  5HLG A;  4GDF A;  1SVO A;  3W2W A;  3JRF A;  5DD4 A;  1X2N A;  4YG2 F;  1XGO A;  2NVX J;  4LB5 A;  2CYY A;  2OPT A;  1WI3 A;  1ERD A;  1ETX A;  4DGW B;  5CPR B;  1G3Y A;  1IRX A;  2B7E A;  2CQ7 A;  1Z9C A;  1W7P D;  2FOW A;  5BPD A;  1MNE A;  5HVQ C;  2DK8 A;  3ZQQ A;  1ZAR A;  1LFP A;  4LK0 F;  3TDU C;  4XKC A;  1ZG1 A;  2F4I A;  1MBK A;  2NNY A;  2E71 A;  5LRR A;  2CFX A;  2EIJ H;  3ECH A;  3QU6 A;  3K0L A;  4AM3 A;  5TGT A;  1IC8 A;  5HLI A;  4CCK A;  2H6B A;  2M1B A;  1IGN A;  1PYV A;  4FAS D;  2VBX A;  1TTY A;  1O3T A;  2ZSI B;  1R23 A;  5IT3 A;  2ACJ A;  1G3S A;  1MBF A;  2CJJ A;  2V26 A;  3I3L A;  4PUS A;  5EYR A;  2I10 A;  1LB2 A;  1HCR A;  1MH3 A;  2E2J J;  3BRO A;  1T6S A;  3OMY A;  4IHV A;  2IGO A;  5DEQ A;  4M6X A;  2ETH A;  1PUE E;  3CCS I;  1Z7L A;  1TQI A;  3ZP5 A;  5E1W A;  2VPL A;  2CUF A;  1U0J A;  3FM3 A;  5J1R A;  1FTT A;  4CZZ A;  3DU6 A;  1WGX A;  2HTJ A;  1WQ2 A;  2Y2Z A;  3PQK A;  5IP7 J;  1ZLJ A;  4KT5 C;  3ZR8 X;  1OYW A;  2LP0 A;  3HZJ A;  4ON0 A;  2VKV A;  4F92 B;  4XSZ F;  3EUH C;  5F6F A;  1PUF A;  2XGX A;  2VON A;  1W36 D;  2HOS A;  3S2H J;  1HQC A;  4F7Z A;  4HF2 A;  2A61 A;  3ZPL A;  1O7L A;  3GZ5 A;  2O9L A;  2K3F A;  5ILU A;  2ECC A;  2WAE A;  3HTS B;  3TP3 A;  2N8G A;  2LSO A;  1KQ0 A;  4M3D A;  2R7T A;  1G59 A;  3E97 A;  2DYR H;  4PFO A;  2BW3 B;  1SD5 A;  2K9M A;  3HOS A;  3J81 Z;  3N05 A;  2KJC A;  1ETV A;  1T38 A;  2M8E A;  3HG9 A;  2BV6 A;  1MND A;  2AO9 A;  2DJN A;  3FXL A;  5IT9 K;  4Y4R A;  3OY9 A;  1XD7 A;  4BYY A;  5FLV A;  2E1N A;  2IGN A;  3EYI A;  2COB A;  2XUB A;  3HSE A;  2UZK A;  4IZZ A;  2KIQ A;  3OYD A;  4L0Y B;  3BTL A;  1FPQ A;  1R9T J;  2OA4 A;  5FO5 A;  2DA1 A;  3PIP F;  2DA3 A;  2NOJ B;  5FRN A;  2DOA A;  1ZH5 A;  2BXZ A;  1P6R A;  5DV5 A;  3S2D J;  3ECO A;  3BR1 A;  2CV1 A;  3KYD B;  2KPM A;  4II3 A;  1R5H A;  3V7R A;  4DBQ A;  2FA5 A;  3QPS A;  1W7P B;  1WJ5 A;  2VQH A;  1DDN A;  1X58 A;  2IA2 A;  1X3W B;  3KLN A;  3E5X A;  1X1D A;  5JVT A;  2XF5 A;  3H92 A;  3M1C A;  3HJE A;  4FX4 A;  1LPQ A;  2CMP A;  4KN7 X;  2XAH A;  2DA5 A;  2L2O A;  2ZXI A;  2BY1 A;  2LLK A;  1OLT A;  1A6Q A;  3DBL B;  4ESB A;  5C44 J;  4U0V A;  1G3W A;  1GVD A;  5IY5 H;  1ODD A;  2KZG A;  4ANJ A;  1K83 J;  4Y52 J;  4H0E A;  1V5G A;  1MMG A;  4GRI A;  1JTX A;  1XSX A;  5E79 C;  3DLA A;  4D7N A;  2L9R A;  1BI3 A;  3WTU C;  3VWB A;  2OTJ I;  4BE0 A;  1YJ9 I;  2XAS A;  3GLL A;  5KK1 A;  2IS1 A;  2MAB A;  2BVM A;  3BG3 A;  3DBH B;  3OYK A;  1U8R A;  1Y1W J;  1IDY A;  2XC7 A;  1KU9 A;  1B59 A;  2M7B A;  3IAS 2;  3G4S I;  1S7O A;  1XCB A;  3M7G A;  1RKT A;  2YX7 A;  5L3C A;  4ESJ A;  4MLO A;  1IV6 A;  2KL4 A;  1CF7 A;  3I4M J;  3B73 A;  3F22 A;  1Q1V A;  4PGH A;  5E8I A;  2DT6 A;  3JSP A;  2IPQ X;  3F72 A;  1NG7 A;  1EA3 A;  3OYC A;  3F21 A;  4UUS B;  3RIR A;  3WGI A;  4MO7 A;  4IPA A;  3G2B A;  3IUO A;  3I9V 2;  3OOP A;  3FHZ A;  4WK8 F;  2O6G E;  3CQZ J;  3R60 A;  3E3V A;  1U78 A;  4BHB A;  4EM2 A;  3HRM A;  2GA1 A;  3VYU B;  5DS9 A;  2K9N A;  4Y15 A;  1H9T A;  4PJN A;  2A07 F;  2CO5 A;  2CS3 A;  1ITY A;  1R1T A;  1E2X A;  2L7Z A;  2PN6 A;  1G4D A;  3HHH A;  1HC8 A;  1IN7 A;  2O8K A;  1VND A;  2RNG A;  3VOD A;  3C7J A;  2R5Z A;  1DP3 A;  2Z5U A;  1KON A;  1FBQ A;  3FXR A;  2STT A;  1FP1 D;  4RB3 C;  3ISP A;  1UJ8 A;  3MKL A;  2A05 A;  3E1S A;  4YIF A;  1FBU A;  1BN5 A;  3CO7 C;  1GUU A;  4BL0 B;  1T39 A;  4KJZ A;  5FKO A;  1U2W A;  3HOT A;  4YFK F;  5B5E C;  1VI0 A;  2JZY A;  5F0C A;  2WWY A;  4ENK A;  3F3X A;  3DKW A;  4ZDP A;  4MFD A;  2JN6 A;  3CF2 A;  3CCL I;  1J5Y A;  3QYE A;  4XQF A;  3HEF A;  2W48 A;  3DF8 A;  4RDU A;  2F5E A;  3I59 B;  3TW7 A;  3NWS A;  5FGM A;  3WOD F;  2X48 A;  3T0Y A;  3J7Z I;  4CYC A;  4Z2Y A;  2E5N A;  2DOE A;  1LFU P;  2OTL I;  2B63 J;  4HF0 A;  4AIH A;  1B9N A;  1XB4 A;  2IW5 A;  2W00 A;  4XN3 A;  2CW0 F;  2YU3 A;  1A36 A;  2X4H A;  3E6C C;  3H9J A;  2EB7 A;  5D6E A;  1WJB A;  2MA3 A;  3W6J B;  1JKR C;  3BG5 A;  1U9N A;  3NWT A;  5J1Y A;  1HXD A;  3A4C A;  2L7M P;  1J7K A;  3KYC B;  4RB2 C;  1LVK A;  3EPZ A;  4KIC A;  5KAI C;  4KIS A;  3GTM J;  2YUS A;  3LWF A;  3LSI A;  4A12 A;  4LOC A;  3SZP A;  2DFF A;  1DP7 P;  4OAZ A;  3HGY A;  2NRA C;  1XMA A;  1WKM A;  3S16 J;  4Q48 A;  1F5T A;  3LSM A;  3BQZ A;  3OOU A;  4FIS A;  3LMM A;  2LH9 A;  4XRS A;  1GV2 A;  4MGR A;  2HKO A;  1V5F A;  1MMA A;  4LIV A;  1HKS A;  3G1M A;  2CV0 A;  3KZZ A;  4YFX F;  1IRZ A;  1EH6 A;  3K9T A;  3L2V A;  1ETO A;  2WBM A;  4ABZ A;  4AWX B;  1Q1H A;  4A0Z A;  2QGU A;  2FD5 A;  1RC9 A;  3WGH A;  4S05 A;  4NB5 A;  3BZK A;  1QRY A;  2XSJ C;  1VQ4 I;  2WB1 A;  1FJL A;  2L9N A;  3I5U A;  2AS5 F;  3OYA A;  3I53 A;  2XAG A;  4M9S A;  3FXU A;  2BXY A;  2LF8 A;  4BXU A;  4Y3O A;  3DTI A;  1T56 A;  3QOE A;  1KU3 A;  3WTX C;  2AQF A;  2VT2 A;  3M3Y J;  2DO7 A;  2EFP A;  4Y17 A;  3FF5 A;  3FBI B;  1CQT A;  3K4M A;  3CMM A;  3SEZ A;  5HS7 A;  4CYC B;  2Y75 A;  4P55 A;  3K4N A;  1U6G A;  4A6E A;  4UNO A;  2OQG A;  5EGO A;  3BG7 A;  5HOO A;  5EF6 A;  3I59 A;  4A3J J;  3BZ6 A;  2GOX B;  2MH2 A;  2EIK H;  1TW3 A;  3TO7 A;  3ZN1 A;  5K1Y A;  1I1G A;  5F1R A;  2W84 A;  3AFH A;  3Q0V A;  4BDZ A;  3HTU A;  3GYH X;  3DQV C;  3SDB A;  3VSL A;  1ZR4 A;  1ORK A;  2AXL A;  2VKD A;  3LFK A;  4J01 A;  1YLF A;  3H3V K;  4A3G J;  2LMD A;  4CCJ A;  2GLO A;  1SD4 A;  2KKO A;  2VKH A;  2XIG A;  5AIQ A;  3AL0 C;  1PJR A;  3A01 A;  4BAC A;  2R7Z J;  1MBJ A;  2HNH A;  1BI2 A;  2H8R A;  2PLY A;  5F0F A;  1OQY A;  2R5Z B;  3QYB A;  5LD2 C;  4BU2 A;  4PSX A;  3BJA A;  4Z6Y A;  4NBQ A;  4BE1 A;  3K6G A;  3IWF A;  3MD2 A;  3E6M A;  2P6S A;  2MSY A;  4RM3 A;  1JUS A;  4E4H A;  1BR2 A;  2X9D A;  3KP7 A;  1R71 A;  3BPV A;  2HPM A;  3HOZ J;  2MC3 A;  2VE8 A;  1RI7 A;  2ID3 A;  3BZC A;  3CLO A;  1TWC J;  2DMT A;  2DPU A;  3IV5 A;  3MKW B;  2ZJR F;  4RLQ A;  2NAZ A;  3CJQ B;  1SFU A;  2R5Y A;  2VBY A;  1Y8Q B;  2X6W A;  3DEW A;  4C2T A;  2H94 A;  2LVS A;  3CCE I;  3GWZ A;  5KCM A;  3WE3 A;  3UNG C;  3FMQ A;  1IN8 A;  2EQR A;  4XLC A;  2R5Y B;  2TDX A;  4NHJ A;  4JYK A;  1MJA A;  3FXO A;  5J4Y A;  1R5I D;  1YQA A;  3M9A A;  1BOB A;  3I54 A;  1TBX A;  4RGS A;  4RGX A;  2I8D A;  3S3N A;  1QPI A;  2GA2 A;  3MWM A;  4K2E A;  4FCY A;  2M87 A;  2Y0M A;  3F8M A;  3LQR A;  2FBI A;  3DPT A;  2DOD A;  1ENH A;  1IV8 A;  2RGV A;  1N78 A;  3DTK A;  2MGQ A;  3DKY A;  3HOV J;  3G3Z A;  1IF1 A;  3BR0 A;  1RET A;  2ZME C;  1YO5 C;  3OYJ A;  1RR7 A;  2WA0 A;  3HKZ N;  2QZ8 A;  2GOM A;  2D2W A;  4XRM A;  3BJO A;  4B44 A;  2XPU A;  4YFN F;  4BEH B;  2FOK A;  4BQN A;  2JPC A;  3FIW A;  4EAT A;  3GTL J;  4PZJ A;  3ABT A;  3FIS A;  2DTZ A;  2HZT A;  4LLN A;  3RKW A;  2P5K A;  3BR5 A;  3REO A;  1HBX G;  4OIN F;  1TT0 A;  4KIG A;  3GW2 A;  2ZXW H;  1P7J A;  1XSV A;  2Q0O A;  4CCM A;  1Z7U A;  2ECB A;  4E6K G;  4XRS G;  2QQB A;  1YX5 A;  2VE9 A;  2R7W A;  1QZE A;  2LKS A;  4I01 A;  1O3R A;  1OKR A;  2MFZ A;  1Z3Y A;  1W5T A;  3L09 A;  4HYE A;  3RTR A;  3DTE A;  3GME A;  1MJ9 A;  2LNB A;  5F08 A;  3ZGK A;  4XN0 A;  4IOC F;  3PFI A;  3FX3 A;  4I99 C;  1XX5 A;  2PX9 A;  2WY7 Q;  4QWQ A;  3DXJ F;  5L3D A;  1B8I B;  5M3F J;  1ON1 A;  1N75 A;  3K10 A;  2D1H A;  5GAG J;  5LHG A;  3JR9 A;  1SEU A;  3IH3 A;  3Q0W A;  5E17 F;  2ESN A;  3V42 A;  3T5X A;  3ZMT A;  1T8I A;  4JX5 A;  2LY9 A;  4DZP A;  1ZTR A;  3T8T A;  3OSG A;  3MVP A;  2KRF A;  2QSF X;  1SD6 A;  1SC7 A;  2PMH A;  2VXD A;  3PUF A;  3V4G A;  3FXJ A;  2IS4 A;  4LLL A;  2GM4 A;  2M4G A;  2FQ3 A;  4G7O F;  3S1M J;  5M5X J;  3V7S A;  4CHU A;  3QOP A;  5EEA A;  1G6N A;  4RGR A;  1TZL A;  5CLS A;  2Z1D A;  1OIS A;  2JSP A;  4RLF A;  4WF2 A;  3CCV I;  1BI0 A;  3LQQ A;  1T08 B;  3J81 K;  3HKZ A;  2VC1 A;  3FZV A;  4CYD A;  3DEE A;  1BIA A;  4XRF A;  2L02 A;  3GFI A;  2PQ8 A;  4CCO A;  4CCL A;  4IHW A;  4N4O B;  4OMZ A;  2W1O A;  4B3A A;  2FUG 2;  4M3G A;  3FXM A;  1ON2 A;  4X0G A;  3CMA I;  1SFX A;  1Z6R A;  4F91 B;  1JGS A;  1W0U A;  1NK3 P;  1VTN C;  1I27 A;  2ZME B;  3AG2 H;  3E5U A;  1P2F A;  1GXQ A;  2K3P A;  4E7S A;  1IG7 A;  2JRT A;  5DM6 F;  1JT0 A;  4HDV A;  2ZNY A;  3COA C;  3LSP A;  3TOB A;  3PFY A;  3HOW J;  1HSJ A;  3B02 A;  3WU0 A;  2MW8 A;  1DQU A;  2Z16 A;  5BPI A;  2C6Y A;  2LF7 A;  1WJD A;  3WGG A;  5JLX A;  1WCM J;  5J6X A;  4L9J A;  3ABU A;  4LJZ F;  4XLH A;  1FMW A;  5LGT A;  3ZQL A;  1DU0 A;  3KP2 A;  2F4O B;  4BJ5 C;  4YII A;  5EEG A;  5EDN A;  3ABM H;  3GZN B;  3U21 A;  2HYJ A;  3VFZ A;  2P5L C;  3W6V A;  4EJO A;  1T0F A;  4MNU A;  2NS8 A;  4JBA A;  3IH2 A;  3RZD J;  2EZI A;  5ILS A;  2E35 A;  4FE7 A;  2Y0S A;  2IJL A;  2BVL A;  4UUS A;  3K70 D;  1JT6 A;  5K7H A;  5FRM A;  1DGW Y;  2HQA A;  3HBL A;  3SHF A;  3DLL F;  3CCR I;  2DTR A;  4DW6 A;  4XLF A;  2OV7 A;  1Y8R B;  3S3O A;  3H35 A;  4YEJ A;  2PJP A;  3ABK H;  2OZ6 A;  5CVI A;  2YX4 A;  3MQ0 A;  3G73 A;  2X85 A;  3HM5 A;  2E2H J;  3LNQ A;  1X4P A;  1PP7 U;  4B09 A;  1YS7 A;  1RNL A;  3GUD A;  3S8P A;  5FRO A;  4ZYH A;  3CO6 C;  3O8H A;  5D4R A;  3MKZ A;  4N9I A;  1FP2 A;  1J59 A;  2DW4 A;  3L2U A;  3S93 A;  3WTS C;  3ASN H;  3RPU A;  2B0L A;  2V9K A;  1UHM A;  5D8K B;  4FT8 A;  1S29 A;  4CH7 A;  2E1M C;  2F48 A;  4ZTJ A;  4X1E A;  1VQK I;  2BY3 A;  4HEA 2;  1V5E A;  2W57 A;  2LY2 A;  2UUZ A;  1U9O A;  3AAF A;  3BP8 A;  2D5V A;  3V8K A;  4AUX A;  1MDM A;  4M72 A;  3E6B A;  2X6X A;  3KZI C;  2P81 A;  2ZXJ A;  3KIO A;  2L0K A;  3QP6 A;  2CU7 A;  2XSD C;  3PSF A;  1MNM C;  3CZ6 A;  1OR7 C;  4I02 A;  3DPU A;  3CUQ B;  1D0X A;  3DCF A;  2YSR A;  1XPX A;  4MTD A;  3LFU A;  1LQ1 A;  4AID A;  2BOL A;  1FC3 A;  3G71 I;  2XHK A;  2FX0 A;  1XMX A;  3MZH A;  4XL9 A;  3I4P A;  2DJI A;  2IP2 A;  3H9G A;  3OYN A;  3KX2 A;  1QNT A;  4HRI A;  3TO6 A;  2AQE A;  1X1A A;  3L7W A;  5E1Z B;  4W1U A;  4LD5 A;  3HDD A;  1FEX A;  1S6L A;  3H5N A;  3OIO A;  4IO9 F;  1ETQ A;  4IRH A;  4UVA A;  3GTQ J;  5K7Z A;  2X1E A;  5FLX K;  3UR3 C;  2UWM A;  5LFA A;  3G6E I;  3O2P E;  2K86 A;  4NC8 A;  3LL7 A;  1QGP A;  5E3O A;  3N97 A;  5BOX A;  4HF1 A;  4KNY A;  3GTG J;  2VOP A;  1R7J A;  4HAM A;  2XGC A;  4UUV A;  1KU2 A;  4LG0 A;  3CUO A;  5DCM B;  2Y48 A;  4A3I J;  2EBI A;  2XGE A;  4UV9 A;  3S17 J;  2OF7 A;  3D5S C;  1YI2 I;  1S72 I;  2QM3 A;  2QKM B;  3VEP A;  1HKQ A;  4AIJ A;  2VL8 A;  3BC8 A;  3I71 A;  1RUN A;  2VUM J;  1IN4 A;  4NC7 A;  2BE5 F;  2KT0 A;  2E1M B;  1ZRF A;  2L4M A;  1S7E A;  2HU9 A;  2Y69 H;  5ICE A;  5D5W B;  2H1K A;  5ILV A;  2K7L A;  1BC7 C;  3Q3S A;  3HOU J;  3F23 A;  1GT0 C;  1R22 A;  1CF7 B;  2V9P A;  4CGZ A;  4LFU A;  3K2Z A;  1DPU A;  2MYS A;  4KDP A;  3GXO A;  1S9H A;  1T2K A;  3FK7 A;  4LG0 B;  3M8J A;  1P7I A;  2V7F A;  2VI6 A;  4BDY A;  3HOY J;  5HOD A;  3Q9S A;  4ZZL A;  1TL8 A;  5CQE A;  1W5C C;  2QBY B;  4BY1 J;  3PL8 A;  1YJN I;  2OCE A;  5EZG A;  2E1O A;  2FQ4 A;  2Y9Y A;  3CMY A;  1EH8 A;  1RES A;  3RPQ A;  1FOK A;  1WJA A;  1ZEL A;  1K6Y A;  2M30 A;  1KA8 A;  1APL C;  2ZC2 A;  2R7Q A;  2CWE A;  2W4S A;  4LIT A;  3JTG A;  1HST A;  4M6V A;  4OIQ F;  1I50 J;  1FOX A;  3OYL A;  3P7N A;  4IRI A;  5KHD A;  1D5Y A;  4ENM A;  1OCP A;  2DK5 A;  2HS5 A;  5LHH A;  1W4M A;  1WJC A;  1YOV B;  4XR6 A;  3TKY A;  4U0Y A;  5C4J J;  4XKV A;  3ZN0 A;  3O8G A;  1JUP A;  1FSH A;  3LSJ A;  2VC0 A;  2Z33 A;  3DFG A;  3ZMU A;  4G7Z F;  3C1D A;  5FLM J;  2VIX A;  4M9Z A;  3OS0 A;  2BZT A;  1ZRC A;  5J8F A;  1QZZ A;  2EV5 A;  2O7O A;  1H89 C;  3J7A O;  4XBF A;  3FXK A;  3F8F A;  5E18 F;  4UB8 C;  3WG7 H;  1BR4 A;  5KNL A;  3BTC A;  2OU2 A;  2F2E A;  2RNJ A;  2HOT A;  4C3I J;  2P6T A;  3SFZ A;  4OIO F;  1TWG J;  2W7N A;  2V1X A;  2DA4 A;  5L3E A;  3FWE A;  1NK2 P;  2XPW A;  3E6D A;  4I0A A;  3HRT A;  4IF4 A;  3MAJ A;  1UCR A;  3LSG A;  4OMY A;  4PSW A;  1R4M B;  2DXI A;  3AG3 H;  2L4A A;  3CC2 I;  2M7A A;  5DUI A;  1FOY A;  1B8I A;  2WV0 A;  1R6R A;  5FFZ A;  2RRE A;  2NXN B;  5E3L A;  1L0O C;  1ZN2 A;  4DJA A;  3X2Q H;  2DLL A;  3CDL A;  3P9K A;  5LBQ A;  2EZL A;  1MMS A;  5FKM A;  2IEK A;  2V1D A;  2XF7 A;  3EUA A;  3NAU A;  3TW6 A;  3ZQF A;  3OYB A;  5KAF C;  1FT9 A;  4E7K A;  3F6V A;  4MFE A;  3QQA A;  4Q5S F;  1X2M A;  3O6B B;  2OC6 A;  3SFI A;  3FM5 A;  3PO3 J;  5D5V B;  2K27 A;  1VQ5 I;  2EH3 A;  1MH4 A;  3R61 A;  2K40 A;  4LMY A;  1LVA A;  1U3E M;  2E1C A;  4F52 A;  1N25 A;  2RQQ A;  5EEH A;  2XAF A;  2DDA A;  2E7W A;  4MTE A;  3ZCO A;  1HDP A;  4I6Z A;  4XKB A;  1ZG5 A;  1REP C;  1JJ8 C;  2HVQ A;  3WG9 A;  2GXB A;  3S14 J;  1WFX A;  3P5J A;  2IBD A;  4QPO A;  3K1M A;  1VQ9 I;  4IHX A;  2CQK A;  3JRB A;  1ETK A;  1GHC A;  2AHQ A;  3H3Z A;  4E7L A;  1A04 A;  1D8J A;  1UHW A;  3K1P A;  4U88 A;  1FYK A;  1UAA A;  2ICW G;  2VJJ A;  4A3C J;  2HQN A;  4A3F J;  2D1V A;  1P9Q C;  2KLO A;  5D8L B;  3KEY A;  3ULQ B;  2J5O A;  4HNV A;  1R1V A;  3KEQ A;  5E3N A;  2ZNZ A;  1U8B A;  4U87 A;  3CJR B;  2XGD A;  4RB0 A;  1K79 A;  1EV7 A;  2JVG A;  3RI4 A;  2A3S A;  1IN6 A;  2ZBK A;  1X4O A;  2LBF A;  4RB1 A;  3O3K A;  3CME I;  2HOA A;  2Q2E A;  4W97 A;  1FYM A;  1HKT A;  1GVJ A;  3T8R A;  4CCN A;  3QOD A;  2EJR A;  1F4K A;  1OR7 A;  1YE9 A;  3C2H A;  2D45 A;  3GF2 A;  4XNF A;  4R79 A;  2FNP A;  2I5U A;  2QCO A;  2LFB A;  1SFO J;  1K7A A;  2JRM A;  5J40 A;  3TMO A;  1FBS A;  3QPH A;  1Z1D A;  3JW4 A;  3A02 A;  1Y0N A;  4N9H A;  2KIU A;  2EPF A;  4ZDL A;  3FHN A;  4BBS J;  3GCM A;  1MW7 A;  2PG4 A;  3H1C A;  3HRS A;  2ISY A;  2P7C B;  2ZXH A;  1HF0 A;  3CCM I;  5DM7 F;  3GTK J;  4AC0 A;  5EG0 B;  1R4N B;  2LOO A;  4ZYG A;  4GCV A;  3IAM 2;  2FSW A;  2V4J C;  1YRN B;  2DT5 A;  1ZQ3 P;  2R7F A;  3FDY A;  3KE2 A;  1BOA A;  4BEH A;  3OYF A;  2P4W A;  2V1U A;  2LD5 A;  2ZO4 A;  1G3T A;  1KQ9 A;  3ABL H;  4A6D A;  1YIT I;  1VZ0 A;  4H4K C;  2EFO A;  3IC7 A;  4BGD A;  2EIL H;  2HZD A;  3KZY A;  4EMS A;  3QRF F;  1D1B A;  3L2Q A;  1OPC A;  3GX4 X;  3G1O A;  4XLP F;  1MMD A;  4HX4 A;  1FY7 A;  1QA6 A;  2CUZ A;  5TRD A;  3K4L A;  5GPC A;  1BIB A;  2BBY A;  2DAO A;  4WXH A;  4DIQ A;  4M73 A;  3QU3 A;  5LGU A;  4MQV A;  4PJ0 C;  3HL2 A;  5CQG A;  4KIF A;  3KEO A;  4DZJ A;  4V19 K;  4O3M A;  4O6J A;  3NRV A;  4OIR F;  5FKN A;  4TV7 A;  2QVO A;  3AKZ A;  2VJI A;  3ERE D;  2WV1 A;  1X3U A;  1Z77 A;  3KET A;  3D5L A;  3HUG B;  5GAH J;  1I3Q J;  1K6O A;  1PP8 F;  1V55 H;  4G6T B;  1LDJ A;  2NVT J;  3JRH A;  4RA2 A;  1D3Y A;  3HUG A;  1QO0 D;  3W3C A;  1K78 B;  2P8T A;  3RYR A;  3BR3 A;  2X1C A;  3FXQ A;  3SZT A;  5CVV A;  4II2 A;  3FKJ A;  3H3U A;  3EUH A;  4BE2 A;  4NDL A;  4DQ2 A;  2KIF A;  3ZXS A;  2QSG X;  2E36 A;  2EZH A;  9ANT A;  5AON A;  4OAY A;  2JPB A;  2VJ4 A;  5IOZ A;  1WH7 A;  1G8X A;  3U9G A;  4IEJ A;  2ZFW A;  3OSF A;  3C2G A;  4HLX A;  1JXS A;  1ZRD A;  1WRJ A;  3ZQI A;  4BHC A;  5M5W J;  4EGY A;  2PBI A;  1OYI A;  3ZMZ A;  4ZYE A;  1RRJ A;  1FYL A;  4S04 A;  3MN2 A;  2VOO A;  2HGC A;  2XB0 X;  1R00 A;  3S1R J;  1OMI A;  5HDN A;  1D0Z A;  1Z91 A;  2JSC A;  3A01 B;  1LDD A;  4XMY A;  3HGG A;  2HPI A;  4ETS A;  3HIF A;  2R7V A;  4G12 A;  5FD5 A;  4LLG F;  3IL2 A;  1MD0 A;  1R58 A;  2B9S A;  4JOM A;  2X51 A;  3L2C A;  1Y56 A;  4EM0 B;  2STW A;  4DBR A;  1ACI A;  5CVU A;  5J3L A;  4Q4Z F;  4B4C A;  3MMY B;  1JUM A;  2R7R A;  3PNT A;  4P5O A;  2ELK A;  3GFM A;  4AVP A;  3I4N J;  2F5F A;  1ZK8 A;  3VSK A;  4EQQ A;  2HTS A;  4WXC A;  2CSO A;  2YPR A;  3GTO J;  2LRE A;  4V2G A;  5LEJ A;  1RR8 C;  2ZME A;  4D1Q A;  4EJT A;  2KRC A;  1KU7 A;  1BL0 A;  1LJ9 A;  1O3Q A;  2IAI A;  4M3B A;  3ELK A;  1ZG3 A;  4EV0 A;  2ZJ2 A;  2XPV A;  1IXR C;  1WJF A;  2H09 A;  3IHU A;  1DUX C;  2DMN A;  3S1Q J;  3LSK A;  5BS6 A;  3PO2 J;  3OS1 A;  3LA2 A;  3JRD A;  4FTH A;  2DFI A;  4ZZD A;  3DV8 A;  1N77 A;  2EFW A;  2VLA A;  1BW6 A;  4IHY A;  1V4R A;  1H88 C;  4Y33 A;  3BOQ A;  2F4M B;  2J5P A;  2HDW A;  3CCJ I;  1T33 A;  1I6H J;  3EUK L;  2IS6 A;  2M45 A;  4C30 A;  1YS6 A;  5GAE J;  5ED4 A;  1GV5 A;  3IRQ A;  1TWH J;  3PM1 A;  4XLE A;  2HXO A;  5H2F C;  5E1X A;  3W2V A;  5GTI C;  4E7J A;  2ZCW A;  5C4X J;  4M9X A;  1FWZ A;  1XCV A;  1ZGW A;  1XN7 A;  2K85 A;  2LTP A;  3JTH A;  4D5C A;  4BXX J;  3AG1 H;  1UG0 A;  3I0T A;  2CUJ A;  3JAM K;  1F9N A;  2RKH A;  2DT7 B;  4HQM A;  3TOA A;  5JHU A;  2H27 A;  5F04 A;  1VQN I;  3GBG A;  3EQL F;  1UZC A;  3DU5 A;  1B1B A;  1VQM I;  4CXF A;  4WCG A;  2KFD A;  4PJJ A;  4G94 A;  1SVM A;  2G7U A;  1YW8 A;  3BT9 A;  1HLV A;  1IDZ A;  1IXS B;  1H9G A;  1U5T C;  3SJM A;  4Q47 A;  3UKG A;  1RKW A;  1VQL I;  5H20 A;  1NG6 A;  5CJ9 A;  1WSU A;  3A1Y A;  1ZLK A;  2VOD A;  3D0S A;  3CCY A;  1TP4 A;  2IGM A;  3BCB A;  4GXO A;  1UMQ A;  5JR3 A;  4PDK A;  2E2I J;  1QHG A;  4L18 B;  4M74 A;  4ASN A;  4NNJ A;  2MLK A;  2DYS H;  3H9Q A;  2GBY A;  4I09 A;  3CP2 A;  2GIZ A;  3B6C A;  3W6K B;  4HX8 A;  1AHD P;  1FSE A;  4XOR A;  1HOM A;  2KMU A;  2V6E A;  1OJL A;  1A35 A;  3RDI A;  3Q5F A;  2JWT A;  2UXX A;  3CES A;  2E19 A;  1Z3X A;  1TQM A;  2QSH X;  3J80 K;  2JA7 J;  2DMQ A;  4G8X A;  2F6C A;  1P92 A;  4LG3 A;  4XSX F;  4E7Z A;  2ID6 A;  3FKI J;  5CYV A;  4LGW A;  4XLA A;  2HXI A;  3LA7 A;  4HV5 A;  1BJZ A;  2WAQ N;  2P0W A;  2OQR A;  4ZTF A;  5TJJ A;  3R0J A;  4BH9 A;  2R7U A;  5JHF A;  1BBY A;  4OOI A;  1P4A A;  2VN2 A;  3PUB A;  5HS9 A;  2VBW A;  4CDG A;  4U7D A;  2RDP A;  4X6A J;  2XAJ A;  3L00 A;  4LK1 F;  1QU3 A;  1RIO H;  5IP6 A;  1UEL B;  4QPQ A;  4R8H A;  1ZHF A;  4UVC A;  1OCC H;  3QYF A;  5DCM A;  5M3M J;  4L5I A;  2HFH A;  2BW3 A;  2LY1 A;  3LST A;  4J00 A;  1FZP B;  1DGR M;  2Q1Z B;  4L5J A;  4A3E J;  4LB6 B;  3CC4 I;  3WHC A;  1LE8 A;  4HBL A;  5HDK A;  3WTW C;  1B72 B;  1XGM A;  4HZF A;  2A69 F;  3BJ6 A;  4BQQ A;  4XKW A;  2L3D A;  4IL6 C;  1HW1 A;  2BGC A;  3F9K A;  4EVI A;  4HNU A;  1HA8 A;  1IRF A;  4BAY A;  2YR2 A;  2R3S A;  1DU6 A;  4ENN A;  4GFB A;  2GQQ A;  2H8W A;  3RYP A;  4BNC A;  4XOT A;  2IS2 A;  3K4B A;  2XAU A;  4QTR A;  3K7A J;  2KDZ A;  3FK6 A;  4JX6 A;  3U1D A;  5BNG A;  2HKX A;  4P96 A;  4RAF A;  4C3H J;  3OYI A;  2FMY A;  2JVH A;  5FJ8 J;  5ICC A;  2VKE A;  1QVT A;  1SMT A;  2V9V A;  5F27 A;  3RSN A;  1V54 H;  2MD5 A;  3K70 C;  1KQ8 A;  1Z0X A;  1SFK A;  4YEL A;  2DN0 A;  3ZMV A;  3WTT C;  2V6C A;  2GXA A;  3JRE A;  5GAD J;  1YIJ I;  2IA1 A;  2CH0 A;  2ME0 A;  5ICF A;  5K7F A;  3J7A Y;  4DYR A;  3OR1 C;  1OCT C;  2PFB A;  2GXG A;  1XGS A;  5A2Q K;  3RCO A;  1FLI A;  2KQR A;  2Y0S N;  5B1A H;  2DPD A;  1BA5 A;  3BCA A;  3CCQ I;  4UVB A;  1ETY A;  4S0H B;  4HST A;  1AOY A;  1QVU A;  4UXN A;  4IXA A;  2HYG D;  3CD6 I;  3A0H C;  5EG0 A;  2L7F P;  4KFC A;  5B1B H;  3A2K A;  2HI3 A;  1W7P A;  3WE2 A;  3Q9V A;  4CUG A;  5BQT A;  3HSR A;  2CW8 A;  4ZC3 A;  1EF4 A;  3J80 Z;  1R1U A;  1TNS A;  5KVR A;  5E3M A;  3F8N A;  4MIM A;  2OJE D;  5HLT A;  2QUF A;  3WTV C;  3ZQ7 A;  2O8X A;  4PGG A;  3S3M A;  2HVS A;  1ZAO A;  1MDM B;  1O3S A;  3EYY A;  3P9C A;  1J0R A;  2R92 J;  4DYQ A;  1IZ1 A;  1F1Z A;  3H5A A;  2QEN A;  4G9Y A;  4C9Y A;  3TGN A;  3RZO J;  1OCO H;  2A6T A;  1E17 A;  2O61 A;  3R4K A;  2EA2 A;  2LDU A;  3KP6 A;  3SQN A;  3ROU A;  4L9T A;  1B72 A;  5K5R A;  5TIS C;  1ETW A;  1S5L C;  4XOP A;  2QYO A;  3WTZ A;  2QLZ A;  2MG4 A;  2DOF A;  1Z6T A;  3SEQ A;  2G9W A;  1E3O C;  2DI3 A;  5IPA A;  2XRL A;  1A31 A;  1STZ A;  2COM A;  2O0Y A;  1WVR A;  2DA7 A;  1K61 A;  4P9F A;  4RS8 A;  1XDU A;  2WY8 Q;  2JA2 A;  3VYR B;  4JP0 A;  4GO1 A;  3DWL E;  3GZ6 A;  5BMZ A;  2A5Y B;  2Q2E B;  4P9U A;  2M2E A;  4MEX F;  4PFP A;  5L3F A;  1I5Z A;  5J47 A;  2LKX A;  4KMF A;  3SDG A;  4AYB A;  2EA4 A;  4IJA A;  4EEF G;  1W5S A;  1YW7 A;  3IKV A;  3K4J A;  1P4W A;  2JUG A;  2QEX I;  4HQE A;  3ZMD A;  5HNH A;  3H36 A;  3CLQ A;  3MKY B;  5GPA A;  1ZYR F;  3GLX A;  2RC4 A;  4PK4 A;  3WU2 C;  3VDX A;  4UUT A;  1FIA A;  5EGO B;  1LDK B;  3RQI A;  3HHG A;  4RAG A;  4Y13 A;  1JJ6 C;  1KYW A;  2A68 F;  3LAJ A;  3CDH A;  4KN4 X;  2XB5 A;  3LAP A;  1KGS A;  3NAR A;  2O5R A;  2EWN A;  4RGU A;  3VYS B;  4KMU X;  3QPL A;  3GEZ A;  1J75 A;  3OS2 A;  1GLN A;  4XK4 A;  1Y39 A;  1TC3 C;  2BHY A;  3PSI A;  4HG2 A;  5H6Q A;  1BW5 A;  2F5V A;  1IXC A;  4NC6 A;  4I98 B;  2R0Q C;  2R7D A;  3CUQ C;  4QIW N;  5IYD J;  4G6Q A;  3GFJ A;  1QZY A;  4FET A;  4I0B A;  2QQ9 A;  3JRA A;  4IKF A;  2HQ5 A;  4FX0 A;  2ESH A;  4HX7 A;  2IRF G;  3KP5 A;  2CW7 A;  3RKX A;  3BTI A;  1TWA J;  2E7X A;  1TNT A;  2CQN A;  3P9I A;  4KA4 A;  2ZFU A;  2XVC A;  3CP8 A;  3SZG A;  1Y6I A;  4CIC A;  3J7Y J;  3GTJ J;  4D7M A;  1FOW A;  1LKX A;  1R5G A;  2K9S A;  5IP9 J;  3ERM A;  3BR6 A;  4I7H A;  2P5V A;  2PEX A;  1NTC A;  1QPM A;  2ISZ A;  3BG6 A;  5LRS A;  2GZW A;  2K4J A;  5FKL A;  3CF5 F;  3CCU I;  5DUK A;  1LUJ B;  3KYL A;  5E8G A;  3C2B A;  2TRT A;  4IX7 A;  2XKO A;  2Y30 A;  3H5R A;  4A5M A;  4IRG A;  5HLH A;  3ASO H;  2TCT A;  2FU4 A;  4E7H A;  1B6A A;  2X6Y A;  4B8X A;  1D8K A;  1Z21 A;  4A3B J;  5FD6 A;  2A5W A;  3QPT A;  5F64 A;  1K78 A;  5JVG F;  2NVY J;  3OWT A;  5M5Y J;  2JQ7 A;  3PQJ A;  3R0A A;  2LK2 A;  3FMS A;  3JRI A;  3H0D A;  5EZH A;  2NS7 A;  2W82 A;  3K1N A;  1VQO I;  1IRG A;  2X6O A;  3HB9 A;  3IKT A;  2VJ5 A;  3K4K A;  3RJP A;  1XSD A;  1BJA A;  2JTV A;  1R49 A;  1HW5 A;  1JGG A;  5B66 C;  3CJT B;  2R7O A;  5L3B A;  1Z67 A;  2W85 A;  4ZH4 F;  4BQA A;  1X1C A;  4C2U A;  3TDZ C;  5GTH C;  2DQL A;  2OUM A;  2RQP A;  4HA8 A;  2OD5 A;  4OWR B;  2LG4 A;  1T0F C;  1S3J A;  4NQW B;  4UY8 I;  2JT1 A;  3GTP J;  5H6R A;  1ZGA A;  4UHT A;  1R36 A;  1WH5 A;  3JCU C;  4FE4 A;  2Y31 A;  5FKK A;  3EET A;  4XM3 A;  4B48 A;  4A93 J;  4L9V A;  1W0T A;  3V7C A;  1LEA A;  1VF9 A;  3HRU A;  4N4N B;  4BBR J;  3K2A A;  1W1W E;  2QF7 A;  3LOC A;  4BS9 A;  2FNA A;  4UV8 A;  2IVM A;  3OYH A;  1TW2 A;  5IYC J;  1K4S A;  1ULY A;  3TBI A;  2MBF A;  4PJL A;  5LEK A;  3HSF A;  3U1K A;  1H8A C;  4OIP F;  3IH4 A;  2XV4 S;  1XC5 A;  5DCF A;  1PUF B;  2R7X A;  2FXA A;  2K02 A;  2JUC A;  1DPR A;  1KZH A;  1MSE C;  5K5Q A;  2OAZ A;  1MBG A;  1MBE A;  1JHF A;  2ADU A;  2L7K A;  3OV8 A;  2Z2S B;  2JK3 A;  4A69 C;  3ZOB A;  1C0W A;  3MZ8 A;  1WWX A;  2EIM H;  4BKX A;  5DTD A;  1POG A;  3LSH A;  5F1J A;  1LE8 B;  4JX4 A;  4UB6 C;  3JRG A;  2NYX A;  5EJC A;  2VBZ A;  3CUQ A;  2ELH A;  1TT5 B;  1XTA A;  1EKE A;  3OYM A;  3DBR B;  2L9V A;  1MMN A;  4ZYA A;  1IUF A;  1FNN A;  2LYC A;  2VB6 A;  4RAY A;  4XON A;  4F55 A;  2O3F A;  5A2Q Z;  3JSO A;  1VFC A;  2LRD A;  2XDV A;  2BHZ A;  3E7L A;  3ML6 A;  2EV0 A;  4IHT A;  2F5C A;  4A0X A;  2EK5 A;  1BR1 A;  3LSR A;  1ZRE A;  2K5C A;  2G0E A;  2IXS A;  4BUP A;  2DCE A;  1SAX A;  5D5U B;  3JRC A;  2HYF A;  3I64 A;  3ZRG A;  2OZU A;  4GYG A;  2WAQ A;  3S32 A;  3ZQH A;  2RAE A;  2LKP A;  2PMU A;  2WTE A;  1I1S A;  3QWL A;  3V8J A;  3KLO A;  3F8C A;  3MFK A;  4KIB A;  1O4X A;  2BY2 A;  1E0E A;  1BI1 A;  3V8L A;  2LC2 A;  2K4B A;  4KYW A;  2M34 A;  2KIM A;  4U7B A;  2XRN A;  3CDI A;  3HOX J;  1MBH A;  2L5Q A;  1Z05 A;  3M8E A;  4ZDO A;  4D9J A;  4E70 A;  3F8B A;  1XDS A;  1X19 A;  2DFH A;  3M8F A;  4MHG A;  2VQL A;  4QSH A;  4WXD A;  1XS9 A;  4EJW A;  4IHS A;  3SYT A;  3A03 A;  2FBH A;  1V3F A;  4AIK A;  4FHT A;  3OL3 A;  2R4G A;  4FQG A;  3C18 A;  3KP3 A;  2DMP A;  4A3L J;  2YS9 A;  2EZK A;  5D4S A;  2IT0 A;  2WC2 A;  2HWV A;  5DDG A;  2BYV E;  3HPG A;  2M9H A;  2WAF A;  3WU1 B;  4XIC A;  2M5W A;  5D6F A;  4CZC A;  3GVA A;  2GAU A;  4B1R A;  1AWC A;  4WX9 A;  3RKQ A;  1UHS A;  1QHH D;  2DU9 A;  2NVU B;  1J09 A;  3FBN B;  2RVC A;  1J2X A;  2FRH A;  2BEO A;  2PI0 A;  1JI8 A;  1Y1V J;  2F5D A;  1YG2 A;  3E5Q A;  4CO8 A;  4D0P A;  5J4V A;  1NH3 A;  4BJT A;  1U5T B;  2VQC A;  1JE8 A;  1YYV A;  1I39 A;  1IN5 A;  1ONV A;  4M3F A;  3OR2 C;  2NNN A;  2CQX A;  2PJR B;  3I56 I;  1QBJ A;  3OIP A;  3BQY A;  2ELJ A;  2MLG A;  2QQA A;  5GP9 A;  2HEO A;  1KYZ A;  1K4T A;  2K9Q A;  3KCC A;  3VYT B;  2DBB A;  2PMZ A;  3TO9 A;  4BQO A;  2KRH A;  3ZQG A;  5J8C A;  2L54 A;  1U5T A;  1YIO A;  4ITV A;  5IOY A;  4ZYD A;  3L1P A;  4GYI A;  4GGG A;  2EV6 A;  3HYI A;  2CUE A;  3PNV A;  2BY0 A;  2MH9 A;  3ESW B;  1WPK A;  1B9M A;  4M6Y A;  3OL4 A;  4DNC A;  2M0C A;  3DPL C;  1F36 A;  3F6O A;  4IOA F;  2CFO A;  3GFL A;  5LLQ A;  5JFR A;  3H0G J;  2P7V B;  1FX7 A;  3BTJ A;  2FEZ A;  3EDP A;  2CGP A;  3IRR A;  1PVE A;  3R6S A;  2YU9 J;  1VQ6 I;  1B4A A;  1RUO A;  1BM9 A;  3VOE A;  4KIT B;  1S7A A;  4BY7 J;  1EH7 A;  1LEB A;  2EIN H;  1G2H A;  2KJB A;  2KDO A;  2QWW A;  2Z3Y A;  1D1C A;  2L9S A;  2PJR A;  1F43 A;  1EJ9 A;  5ICG A;  5J1U A;  4L5E A;  5FLX Z;  2ZSH B;  3AG4 H;  2M4K A;  1LFB A;  2CQQ A;  4LIU A;  2DDB A;  3BR2 A;  1PDN C;  4IQJ A;  3JAM Z;  5DD8 A;  2UV1 A;  4NUB A;  2ME6 A;  3ZMS A;  1YFH A;  4DYC A;  3IP4 B;  4R1H A;  3N4M A;  1HW2 A;  2FJ1 A;  1X1P A;  2ZJP F;  5HS8 A;  3L2R A;  4IQ4 A;  5D5X B;  2NVQ J;  1YTY A;  1SFE A;  2EFQ A;  1E3H A;  1RPW A;  1AKH B;  3A0B C;  4J19 A;  3DP7 A;  5IYB J;  3K69 A;  4ZJZ A;  1XG1 A;  3PIO F;  4AU7 A;  1JKQ C;  4I76 A;  3VB2 A;  2W24 A;  5F0H A;  1IAW A;  4I2O A;  4PJM A;  2DQR A;  1IJW C;  2FE3 A;  4F93 B;  1TWF J;  1YJW I;  4ENJ A;  4BXF A;  2HVR A;  1SMY F;  2O03 A;  4HSR A;  2E34 A;  5ERI A;  1UB9 A;  2XKP A;  3G1L A;  2IA0 A;  4EGZ A;  5JI6 A;  1IW7 F;  1YHQ I;  4JQF A;  2HR3 A;  2OBP A;  1BC8 C;  3HPH A;  3CTA A;  4G7H F;  2GWR A;  2DMU A;  2VQG A;  2ZB9 A;  3NEU A;  4B43 A;  3ONQ A;  2AXT C;  1W36 C;  2OCC H;  2XAQ A;  5FFX A;  2M3A A;  1WHU A;  2XRO A;  2R93 J;  2CG4 A;  3TP0 A;  1FIP A;  4C2M J;  4HV6 A;  6PAX A;  3ZQC A;  1GDT A;  3F0C A;  2VXZ A;  4HNT A;  1MJB A;  1XGN A;  4EJV A;  3TED A;  3VPR A;  4ESF A;  3I55 I;  3E0J B;  2ZJQ F;  5IT9 Z;  4CSW A;  2WAD A;  3D5R C;  1MIJ A;  1QQI A;  3RQ4 A;  3HC7 A;  4P1W A;  2LR8 A;  4XID A;  5JLW A;  1S8N A;  3I58 A;  3SXY A;  2QBY A;  2DFE A;  4Y7N J;  4HOB A;  3S1N J;  1I3A A;  2HDC A;  3S15 J;  2NS0 A;  4WWC A;  3FMR A;  1MKM A;  1X3Z B;  5LGN A;  4E7I A;  2ZKZ A;  2PMZ N;  1A5J A;  3QAH A;  1J9I A;  1TLH B;  5FB2 A;  1FTZ A;  4AYB N;  4HDU A;  3RPU D;  3L2W A;  3OYG A;  1A6I A;  3WHB A;  2WB1 N;  1JKO C;  1IUY A;  1MGT A;  4HPQ A;  2H6C A;  3S2W A;  4B3X A;  1H0M A;  1VQ8 I;  4YIR X;  5CKT A;  3TQN A;  1OYY A;  4A3D J;  2K9L A;  4G6D A;  3TL4 X;  2A6E F;  3PJR A;  3W2A A;  2M8G X;  2EFN A;  3L9F A;  1SAU A;  4BJ6 C;  1X1B A;  4A3K J;  2GIV A;  5E20 A;  2DA2 A;  5AIP A;  1E3P A;  4IVN A;  4A3M J;  3MCZ A;  5HNF A;  2JMW A;  2JJ7 A;  1ZR2 A;  4D5F A;  4L9N A;  4QLC U;  4B47 A;  2CV2 A;  4KUM A;  1TQP A; 
#chains in the Genus database with same CATH homology
 1U8B A;  3SDG A;  2X9D A;  4EEF G;  3HOZ J;  2XGD A;  3BG9 A;  3D1N I;  2ID3 A;  5GPA A;  1TWC J;  2DMT A;  2CRG A;  2HOA A;  3IV5 A;  4W97 A;  4UUT A;  1FIA A;  5EGO B;  2R5Y A;  4M3E A;  3RQI A;  3DEW A;  1JTY A;  2LVS A;  1JJ6 C;  2JA6 J;  2XB5 A;  3NAR A;  2QCO A;  1SFO J;  2LFB A;  3QPL A;  3M4O J;  2EQR A;  2R5Y B;  4XK4 A;  1TC3 C;  4JYK A;  3A02 A;  5C3E J;  4BBS J;  1QPI A;  4FCY A;  2JA8 J;  1BW5 A;  1HF0 A;  3GTK J;  2R0Q C;  4QIW N;  5IYD J;  4AC0 A;  5EG0 B;  1SAN A;  1OFC X;  1YRN B;  1ENH A;  3JRA A;  1AU7 A;  1ZQ3 P;  2HQ5 A;  4V2F A;  2LD5 A;  3BTI A;  1TWA J;  2Y9Z A;  1HDD C;  2MGQ A;  3HOV J;  3GTJ J;  3BR0 A;  1RET A;  1ZKG A;  1RR7 A;  4D7M A;  2DA6 A;  2K9S A;  3HKZ N;  5IP9 J;  3BR6 A;  4XRM A;  1UG2 A;  1NTC A;  2XPU A;  3G1O A;  3FIW A;  3GTL J;  3FIS A;  2DTZ A;  5GPC A;  1YRN A;  3BR5 A;  1JKP C;  1MSF C;  5FKL A;  3B6A A;  1AKH A;  1P7J A;  4DZJ A;  3C2B A;  2TRT A;  2Y30 A;  2VPR A;  2ECB A;  4RBO A;  5FKN A;  4XRS G;  3Q0U A;  2HDD A;  2TCT A;  4C3J J;  2WV1 A;  1Z77 A;  4A3B J;  1I3Q J;  2NVY J;  5F08 A;  5M5Y J;  2NOG A;  2NVT J;  3JRH A;  2LK2 A;  3JRI A;  5EZH A;  2NS7 A;  3BR3 A;  2JA5 J;  1B8I B;  5M3F J;  2X6O A;  3HB9 A;  3JRF A;  4NDL A;  3JR9 A;  3IH3 A;  3Q0W A;  1X2N A;  1JGG A;  2NVX J;  2EZH A;  2OPT A;  1WI3 A;  9ANT A;  5IOZ A;  1ETX A;  1WH7 A;  4JX5 A;  2LY9 A;  4IEJ A;  4DZP A;  1ZTR A;  3OSF A;  3OSG A;  3MVP A;  3ZQI A;  5M5W J;  3GTP J;  1MBK A;  2GM4 A;  3S1M J;  3MN2 A;  1WH5 A;  4FE4 A;  2Y31 A;  5M5X J;  5FKK A;  2XB0 X;  5EEA A;  4A93 J;  3S1R J;  1IC8 A;  1W0T A;  1IGN A;  3A01 B;  3HGG A;  1VF9 A;  4BBR J;  3K2A A;  4G12 A;  2QF7 A;  3LOC A;  1MBF A;  2CJJ A;  5EYR A;  1HCR A;  2I10 A;  1MH3 A;  2E2J J;  5IYC J;  4IHV A;  4IHW A;  4B3A A;  4M3G A;  5J3L A;  1NK3 P;  1W0U A;  2CUF A;  1H8A C;  4B4C A;  3IH4 A;  5J1R A;  1XC5 A;  1JUM A;  1FTT A;  1WGX A;  1PUF B;  3I4N J;  2ELK A;  2Y2Z A;  1IG7 A;  5IP7 J;  1MSE C;  1ZK8 A;  1JT0 A;  3LSP A;  1MBG A;  1MBE A;  3HOW J;  2MW8 A;  2LP0 A;  3GTO J;  2VKV A;  4V2G A;  2JK3 A;  4A69 C;  3ZOB A;  1PUF A;  5JLX A;  1WCM J;  4BKX A;  3S2H J;  5DTD A;  1POG A;  3ZQL A;  5F1J A;  1LE8 B;  2O9L A;  1DU0 A;  4JX4 A;  3JRG A;  2ECC A;  3TP3 A;  1BL0 A;  2N8G A;  4M3D A;  5EDN A;  2IAI A;  4M3B A;  2HYJ A;  3W6V A;  1IUF A;  1ETV A;  2XPV A;  2NS8 A;  3IH2 A;  2DMN A;  3S1Q J;  2AO9 A;  2DJN A;  3RZD J;  2EZI A;  3PO2 J;  1VFC A;  3E7L A;  3JRD A;  4FE7 A;  4FTH A;  5FLV A;  2COB A;  1BW6 A;  4IHY A;  4UUS A;  1H88 C;  3LSR A;  1JT6 A;  3BTL A;  1R9T J;  5K7H A;  2G0E A;  3HBL A;  2DA1 A;  3JRC A;  1T33 A;  2DA3 A;  1I6H J;  3ZQH A;  2RAE A;  3S2D J;  4DW6 A;  3BR1 A;  1O4X A;  1GV5 A;  1TWH J;  3PM1 A;  3HM5 A;  2E2H J;  3LNQ A;  2HXO A;  2M34 A;  3QPS A;  5C4X J;  1X58 A;  3HOX J;  1MBH A;  1ZGW A;  3O8H A;  2LTP A;  4D5C A;  4BXX J;  2DA5 A;  2HOS A;  2LLK A;  5C44 J;  4QSH A;  4X1E A;  1XS9 A;  1GVD A;  3A03 A;  5F04 A;  4Y52 J;  1K83 J;  3GBG A;  1U9O A;  2D5V A;  4AUX A;  1JTX A;  2DMP A;  4D7N A;  2L9R A;  4A3L J;  2YS9 A;  2P81 A;  2EZK A;  3BT9 A;  1HLV A;  2L0K A;  3BG3 A;  1IDZ A;  2CU7 A;  3SJM A;  2XSD C;  1Y1W J;  2M9H A;  1IDY A;  1MNM C;  3UKG A;  1RKW A;  3DCF A;  4XIC A;  3CCY A;  1RKT A;  4B1R A;  1UMQ A;  4MLO A;  3RKQ A;  1IV6 A;  2E2I J;  3I4M J;  1UHS A;  2FX0 A;  1Q1V A;  2GBY A;  1Y1V J;  3B6C A;  4W1U A;  3HDD A;  1FEX A;  1AHD P;  1HOM A;  3OIO A;  4UUS B;  1OJL A;  1ETQ A;  3GTQ J;  4MO7 A;  5K7Z A;  2JWT A;  2E19 A;  4M3F A;  3CQZ J;  2CQX A;  5E3O A;  1U78 A;  3GTG J;  2XGC A;  5DS9 A;  2K9N A;  3BQY A;  2JA7 J;  2DMQ A;  5GP9 A;  4A3I J;  1ITY A;  2EBI A;  2XGE A;  2K9Q A;  2ID6 A;  2L7Z A;  3FKI J;  3S17 J;  2OF7 A;  2HXI A;  3ZQG A;  1BJZ A;  2WAQ N;  5IOY A;  3L1P A;  2O8K A;  2VUM J;  2CUE A;  1VND A;  2R5Z A;  2KT0 A;  1S7E A;  1WPK A;  2M0C A;  2H1K A;  1F36 A;  3MKL A;  3Q3S A;  3HOU J;  3H0G J;  4X6A J;  1GT0 C;  3BTJ A;  1GUU A;  5IP6 A;  2YU9 J;  5FKO A;  5M3M J;  1VI0 A;  3FK7 A;  4BY7 J;  5F0C A;  1P7I A;  1G2H A;  2VI6 A;  3HOY J;  5HOD A;  4MFD A;  2JN6 A;  4A3E J;  3WHC A;  1LE8 A;  3HEF A;  2W48 A;  1F43 A;  1B72 B;  4BY1 J;  4RDU A;  3TW7 A;  5EZG A;  2E1O A;  2FQ4 A;  5J1U A;  2Y9Y A;  4L5E A;  2X48 A;  1RES A;  3CMY A;  4CYC A;  1LFB A;  2CQQ A;  1LFU P;  2B63 J;  3BR2 A;  1DU6 A;  4GFB A;  2ME6 A;  4M6V A;  4DYC A;  1I50 J;  2FJ1 A;  4QTR A;  3K7A J;  2KDZ A;  3FK6 A;  4JX6 A;  5BNG A;  1JKR C;  2NVQ J;  3BG5 A;  1U9N A;  1D5Y A;  1OCP A;  5J1Y A;  4C3H J;  5C4J J;  1RPW A;  1AKH B;  2L7M P;  3O8G A;  4J19 A;  3GTM J;  5FJ8 J;  1JUP A;  2VKE A;  1QVT A;  2YUS A;  3LSJ A;  5F27 A;  5IYB J;  4LOC A;  1JKQ C;  1XG1 A;  4I76 A;  1Z0X A;  3HGY A;  2DN0 A;  5FLM J;  3S16 J;  5F0H A;  3JRE A;  3BQZ A;  3OOU A;  1IJW C;  4FIS A;  1TWF J;  4XRS A;  1GV2 A;  2ME0 A;  2O7O A;  5K7F A;  1H89 C;  3G1M A;  4DYR A;  1IRZ A;  1OCT C;  1ETO A;  4ABZ A;  3BTC A;  3G1L A;  2Y0S N;  1BA5 A;  2HOT A;  2FD5 A;  4C3I J;  1TWG J;  1QRY A;  1ETY A;  4S0H B;  1QVU A;  2DA4 A;  1FJL A;  5EG0 A;  2L7F P;  1NK2 P;  2DMU A;  2XPW A;  2ZB9 A;  2HI3 A;  2R93 J;  3LSG A;  3TP0 A;  1FIP A;  4C2M J;  1EF4 A;  1T56 A;  5E3M A;  3ZQC A;  4MIM A;  1GDT A;  3M3Y J;  3F0C A;  3TED A;  3VPR A;  1B8I A;  5E3L A;  1CQT A;  2R92 J;  3CDL A;  4DYQ A;  4CYC B;  2EZL A;  5FKM A;  5EGO A;  2IEK A;  2LR8 A;  3NAU A;  3ZQF A;  3TW6 A;  5EF6 A;  5JLW A;  4XID A;  4A3J J;  3RZO J;  1B72 A;  4MFE A;  4Y7N J;  3QQA A;  3S1N J;  1X2M A;  3S15 J;  3SFI A;  3PO3 J;  3Q0V A;  1ETW A;  2PMZ N;  1A5J A;  2EH3 A;  1MH4 A;  1ZR4 A;  2K40 A;  1FTZ A;  1ORK A;  2MG4 A;  4AYB N;  1E3O C;  3H3V K;  1A6I A;  3WHB A;  2WB1 N;  4A3G J;  1JKO C;  2GLO A;  5IPA A;  4I6Z A;  1HDP A;  2XRL A;  1JJ8 C;  3A01 A;  3S14 J;  2DA7 A;  2IBD A;  1K61 A;  2R7Z J;  1MBJ A;  4A3D J;  4IHX A;  3JRB A;  1ETK A;  2AHQ A;  2H8R A;  5F0F A;  2M8G X;  4JP0 A;  2R5Z B;  4A3C J;  4A3K J;  4A3F J;  2DA2 A;  4A3M J;  2M2E A;  2JMW A;  2JJ7 A;  1ZR2 A;  4D5F A;  2LKX A;  4HNV A;  2MSY A;  1APL C;  1JUS A;  5E3N A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...