1WH7A

Solution structure of homeobox domain of arabidopsis thaliana hypothetical protein f22k18.140
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
80
structure length
80
Chain Sequence
GSSGSSGSNPSSSGGTTKRFRTKFTAEQKEKMLAFAERLGWRIQKHDDVAVEQFCAETGVRRQVLKIWMHNNKNSGPSSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Dna binding protein
molecule keywords ZF-HD homeobox family protein
publication title Solution structure of homeobox domain of Arabidopsis thaliana hypothetical protein F22K18.140
rcsb
source organism Arabidopsis thaliana
total genus 13
structure length 80
sequence length 80
ec nomenclature
pdb deposition date 2004-05-28
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.60 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Homeodomain-like 1wh7A01
4IHWA 2WB1N 2K40A 3OOUA 3JR9A 4NDLA 1DU0A 3L1PA 1GV5A 1F36A 4M3GA 3HOWJ 1MSEC 1U9NA 4IHVA 3FISA 4A3FJ 4A3MJ 1MBEA 1CQTA 4UUSA 3QQAA 1TWGJ 1FIPA 2LLKA 2ME0A 2Y9ZA 1WI3A 4A3KJ 5IP6A 1FTZA 4S0HB 2HOSA 2XRLA 1BA5A 2B63J 5K7ZA 5IYCJ 1D5YA 2R92J 2IBDA 3QPSA 1JKPC 1JJ8C 4IHYA 1PUFA 2P81A 3H0GJ 2ME6A 1TWAJ 4BKXA 2JN6A 3JRAA 3BQZA 2EZHA 4DYQA 1OCTC 1LFUP 1XC5A 2MW8A 3HBLA 3SFIA 4X1EA 4A3GJ 5EF6A 4A69C 1HF0A 2EH3A 1MH3A 1Y1VJ 3ZQLA 1MSFC 1U8BA 2R5ZA 3H3VK 2OF7A 4MIMA 4GFBA 5GP9A 3HOYJ 1ZQ3P 4JYKA 4G12A 1WGXA 2DA4A 1R9TJ 4D5FA 3HB9A 1H8AC 4UUTA 4BY1J 1I6HJ 2JA7J 4QSHA 3A01B 1FEXA 2D5VA 2JA6J 1JUPA 2ECBA 4C3IJ 5EGOA 2R0QC 3OSGA 1IUFA 3RQIA 2QCOA 4UUSB 3K2AA 4LOCA 2YUSA 5IOYA 2NS8A 2XPVA 2XB0X 1K61A 1K83J 3HOZJ 1ETOA 3HDDA 3A02A 4XRMA 5EZHA 4C3JJ 2X6OA 1NK3P 1JTXA 3F0CA 1EF4A 5K7FA 1TWFJ 2XB5A 2M2EA 2HQ5A 4DZPA 4V2FA 2M0CA 2R7ZJ 2MSYA 3FK6A 1RR7A 1HLVA 2VPRA 1UMQA 9ANTA 2VKEA 3BG9A 4I6ZA 1OCPA 2HI3A 4ABZA 1HOMA 3ZQHA 1JUSA 3B6CA 5F0HA 4J19A 3RZOJ 3K7AJ 2DA1A 3S1QJ 1DU6A 3GTKJ 3Q0VA 2R5ZB 3TP0A 3S2DJ 1WPKA 2TCTA 5DTDA 4JP0A 4FISA 3LNQA 1RKWA 3G1OA 4DYCA 2JA8J 2NOGA 5FKOA 3GBGA 2YU9J 2FJ1A 4DW6A 4A3LJ 1IDYA 2VI6A 3S15J 3IH2A 2DMTA 3GTJJ 3CCYA 1UG2A 2DA2A 1ETQA 4MO7A 3BR5A 5IOZA 1RKTA 1U9OA 3HKZN 1B72A 5EGOB 1MNMC 2K9SA 2MGQA 1BL0A 1UHSA 3O8HA 5F0FA 4B4CA 2KT0A 1ZR4A 2H8RA 2XPUA 5FKKA 1JKOC 1ETXA 3BR1A 2MG4A 5DS9A 1VNDA 3FKIJ 1T33A 3BR0A 3A01A 3M4OJ 2Y0SN 3G1MA 4AYBN 3B6AA 3QPLA 2LKXA 5C4JJ 2GM4A 1GVDA 3ZQFA 3HEFA 2LY9A 2XSDC 1Z0XA 3PO2J 3ZQCA 2M9HA 1GV2A 2FQ4A 5FJ8J 2O9LA 4HNVA 1APLC 1MH4A 1QRYA 3MN2A 3BG3A 1U78A 1B8IB 3JRDA 3E7LA 1MBHA 4C2MJ 2COBA 2XGDA 1ETKA 2EZKA 3MVPA 2LTPA 2K9QA 4W97A 3OSFA 4M3BA 5JLWA 4IHXA 4FCYA 2CRGA 5J1YA 2CUFA 3CMYA 1XG1A 3GTOJ 1JKRC 3GTLJ 2CU7A 3JRGA 2L9RA 1B72B 2HDDA 1X58A 2FD5A 4X6AJ 2R5YB 1T56A 1OJLA 3RZDJ 4M3FA 2Y31A 1VF9A 3BR6A 1JT0A 3CQZJ 2NVTJ 1GT0C 3PO3J 1F43A 3G1LA 2H1KA 1IDZA 5C44J 2G0EA 3BQYA 2LK2A 5F08A 3GTQJ 4A3CJ 2L7FP 2ECCA 4FE4A 2DMUA 2DN0A 4C3HJ 4XRSG 1NTCA 2NVQJ 1ENHA 3ZOBA 2O8KA 2CJJA 3GTMJ 2CQQA 4RBOA 5GPCA 3NARA 1AHDP 5C3EJ 2LVSA 3Q0WA 4DYRA 1RETA 4EEFG 1S7EA 1ITYA 2HXIA 2M34A 1W0TA 2CQXA 4I76A 3BTCA 3BTIA 5IP9J 4M3EA 5EYRA 2HOTA 3TW7A 1TWCJ 4A3JJ 2KDZA 1P7JA 1A6IA 2NS7A 4A3IJ 3TW6A 5F27A 1IJWC 3HGYA 1JJ6C 3IH3A 3JRBA 1JKQC 1FIAA 4D5CA 2IEKA 1VFCA 3BT9A 5E3OA 5EG0B 3I4NJ 1RPWA 2E1OA 4JX6A 1B8IA 4JX5A 5M5XJ 1ZKGA 2ID3A 2EBIA 4B3AA 3BR2A 4JX4A 4AUXA 2L7ZA 2M8GX 1BW6A 3D1NI 5F1JA 3HM5A 2DA5A 1H89C 5FKLA 4DZJA 1W0UA 1G2HA 4XIDA 1A5JA 3RKQA 2ELKA 1BW5A 1O4XA 2DMPA 4MFEA 2VUMJ 2EZIA 2R5YA 2LP0A 1IGNA 5F0CA 5M3FJ 3FIWA 2E2HJ 3A03A 4L5EA 5BNGA 4AC0A 2RAEA 3CDLA 1H88C 5HODA 2HYJA 4BY7J 2JWTA 3MKLA 3S1NJ 3JRHA 1ETYA 3S1RJ 3VPRA 1P7IA 1WCMJ 1YRNA 4FE7A 2O7OA 3IH4A 3HOVJ 5EZGA 3SDGA 5IYBJ 1IV6A 2ZB9A 2CUEA 1TWHJ 2DJNA 1JTYA 1WH5A 3OIOA 4V2GA 1Z77A 5J1UA 1HDDC 5E3NA 1XS9A 3GTPJ 1ZTRA 5FKNA 4A3DJ 1ORKA 3S1MJ 2L0KA 3ZQIA 2WAQN 2AHQA 2DA6A 2DTZA 5M3MJ 1Q1VA 3JRIA 1LFBA 3TP3A 4XICA 4A3BJ 4CYCB 4Y7NJ 4FTHA 5FLVA 5J3LA 1RESA 1JT6A 3LSJA 5EDNA 2E19A 2K9NA 5EG0A 1IRZA 1MBKA 2JJ7A 2JK3A 1AKHA 1FTTA 1QVUA 1QVTA 4D7NA 1I3QJ 2WV1A 3PM1A 3S16J 1OFCX 2FX0A 1TC3C 4BBRJ 2TRTA 2LR8A 3S14J 4A93J 5F04A 2LFBA 1QPIA 5C4XJ 1ZR2A 3IV5A 5GPAA 1POGA 4D7MA 2X48A 3HOUJ 3Q0UA 4M3DA 2N8GA 1SFOJ 2Y2ZA 1YRNB 1ZK8A 5IPAA 2W48A 1GDTA 4A3EJ 3WHCA 4W1UA 5M5YJ 1HDPA 2AO9A 1IC8A 5M5WJ 3C2BA 4XRSA 3BTJA 3HGGA 1AU7A 2JA5J 2DMQA 1GUUA 3W6VA 2NVYJ 3BTLA 4XK4A 4QTRA 1ETVA 4QIWN 1JUMA 1MBJA 2ID6A 1LE8A 4Y52J 3LOCA 1SANA 1MBGA 1HCRA 1E3OC 3TEDA 1ETWA 3LSPA 5JLXA 1FJLA 2XPWA 1X2MA 4RDUA 3BR3A 3SJMA 2QF7A 2GLOA 4B1RA 3LSGA 1AKHB 4BBSJ 2XGCA 2LD5A 1PUFB 2JMWA 2DA3A 1JGGA 4MLOA 3FK7A 2DA7A 3WHBA 5IYDJ 3NAUA 2Y9YA 4CYCA 4IEJA 2NVXJ 2GBYA 3HOXJ 2HOAA 3JREA 5E3MA 2OPTA 1Y1WJ 2E2JJ 2X9DA 5FKMA 3DEWA 5K7HA 2IAIA 2I10A 2E2IJ 4BXXJ 3M3YJ 5E3LA 3LSRA 1VI0A 3BG5A 4MFDA 1MBFA 3ZQGA 3Q3SA 3I4MJ 5EEAA 2VKVA 1WH7A 1ZGWA 2L7MP 1I50J 2R93J 3S17J 2XGEA 3DCFA 3GTGJ 2YS9A 3O8GA 1NK2P 1BJZA 3JRFA 2Y30A 4M6VA 3UKGA 1LE8B 2DMNA 5IP7J 5FLMJ 5J1RA 3S2HJ 2EZLA 2HXOA 2PMZN 1X2NA 2EQRA 3JRCA 1IG7A
chains in the Genus database with same CATH superfamily
4UY8I 4IHWA 2L02A 2WB1N 3OYIA 3OOUA 1OCZH 4NDLA 4P5OA 2Z33A 3L1PA 1XB4A 1F36A 2UV1A 4M3GA 1T39A 5DUIA 1U9NA 2DLLA 2CV0A 2XHKA 3I9V2 3FISA 3GFLA 1X1CA 4CCMA 4HLYA 2LF8A 3LSHA 1XPXA 2GXAA 3TDZC 2BGCA 2UXNA 2VT2A 2X4HA 5HDNA 4GRIA 1WI3A 2JRTA 5IP6A 1FTZA 4S0HB 4LG0A 2HOSA 3R4KA 2R7UA 2K85A 2BV6A 2X6YA 2B63J 3BOQA 2VODA 1D5YA 3RSNA 3HOSA 1HSTA 2DFFA 2XF6A 3WTZA 1T98A 5E1WA 1PUFA 2ZXJA 2BE5F 2CW8A 1FY7A 1S9HA 2W24A 1QBJA 2JN6A 4KT5C 3BQZA 1OCTC 3MMYB 5KNLA 2MW8A 1IV8A 5HVQC 2AXTC 3MD2A 4KDPA 2MA3A 4A3GJ 4I7HA 1W7PB 1MNEA 1S3JA 4C9YA 1MSFC 5HLGA 1U8BA 1U8RA 2DBBA 4QPOA 4L9VA 4MIMA 1BC8C 4XLEA 1TT5B 2EV6A 4FX0A 3U9GA 2QGUA 1UB9A 4D5FA 3ABUA 2LF7A 4BY1J 2LDUA 1FSHA 1IRFA 2DDBA 4XLNF 4OWRB 4CSWA 2D5VA 2JA6J 1LDDA 4LLGF 1V5EA 2NRAC 3LA2A 3BDDA 5EGOA 3DKYA 3OSGA 3RQIA 2QCOA 4CYDA 2DT6A 4PJNA 5FGMA 4B3XA 2C6YA 2H09A 4YRVA 2XB0X 1CGPA 1Y0UA 4JBAA 1BIBA 2OCEA 2P7VB 3HSEA 1I6XA 3E6CC 3OWTA 1DGRM 5LEJA 4OAYA 4X0GA 3PNVA 5LHIA 1ON2A 1P2FA 3JAMK 2YU3A 1R7JA 4BE0A 2R7DA 3BG7A 3SHFA 5K7FA 2M2EA 1G3SA 3ML6A 1YJ9I 4BHBA 2R7ZJ 2PMHA 5DM6F 2XVCA 1RR7A 1UZCA 2K3FA 3F3XA 1HOMA 2W4SA 4KNYA 1JUSA 1YQAA 4A12A 1BJAA 3QU6A 1K4TA 5FRNA 4Y4RA 2B7EA 3TP0A 4F52A 1WPKA 2XV4S 2TCTA 4RM3A 2M30A 2VJ5A 3SYTA 3S2DJ 4RAFA 3V8KA 4J01A 2Q0OA 1LFPA 3GYHX 4BJ6C 2QA4I 2YU9J 2GIZA 5CJ9A 4A3LJ 2VI6A 3W3CA 2PJPA 1E0EA 5BOXA 2UXXA 3QYEA 3ZMSA 3GO5A 4ZJZA 4RM2A 3E6DA 3T1BA 2IS2A 3KYCB 4LFUA 4EATA 1UHSA 3O8HA 4F7ZA 2QEXI 1YFHA 2WY7Q 4NQWA 3CESA 5ICFA 3IRRA 1YG2A 1RIOH 3R0JA 2DPDA 2ZXWH 1JKOC 3K2ZA 3E5XA 2NNYA 3BR1A 3F22A 3IP4B 4FQGA 3RCOA 4BE2A 4HX4A 2I5UA 2IT0A 3VB2A 2Y0SN 2QVOA 3CCEI 2MABA 3CUQA 4XONA 4IO9F 2A61A 3LL7A 4KJZA 1XMKA 3HEFA 2XSDC 2GXGA 1OPCA 2Q8KA 2LY1A 5FO5A 4MEYF 2CS3A 2M9HA 1T0FA 2K4JA 2HFHA 4HNVA 4UB6C 2H6BA 4L0YB 3MKZA 3LQRA 1USTA 1IXSB 1MBHA 2KRHA 4ZYHA 2XGDA 1EH8A 2HYFA 4AIDA 3LFUA 1RUOA 3K4LA 3MVPA 2IS4A 4Y17A 3D5LA 1LDKB 1A31A 2K9QA 2F5VA 4G9YA 3MWMA 3HSFA 5J1YA 3S3MA 4HV6A 3CMYA 1D0YA 4G6DA 4E7IA 4OMYA 1V3FA 2HZDA 3PFYA 3PQKA 2E34A 1FLIA 3JRGA 2Z99A 5DV5A 5IT9Z 2KQRA 4PFPA 1Z6RA 1KU9A 1X58A 4G7HF 4X6AJ 4LJZF 1OJLA 1UAAA 2K9LA 2XUBA 2RN7A 4E4HA 3J80K 3COAC 2QQ8A 1RUNA 3LWFA 3JW4A 2DAOA 1O7FA 5F08A 3GTQJ 4IVNA 1BIAA 4L5IA 5DCMA 4A0YA 5IT3A 4LLLA 2F48A 3ASNH 3MKWB 1TNTA 2QWWA 2VQCA 2JQ7A 2CQQA 2V6CA 2BHYA 1AHDP 1X3ZB 3SZTA 2VC0A 3QYBA 3H3UA 4EMSA 1S7EA 1SVLA 1ITYA 2HXIA 2K4BA 4P9FA 2EFNA 4PCQA 1LB2A 3AL0B 4IZZA 4BEHB 3OYAA 3BTCA 4YFNF 2DW4A 3T8RA 1Z9CA 4M3EA 1D5VA 3IUOA 2XAFA 3TW7A 2FOWA 4RMNA 2PMUA 1A6IA 3BLYA 1W4MA 1O57A 1XGMA 3F9KA 4A3IJ 4KIGA 1HKQA 2LBFA 2ADUA 5D4RA 3IH3A 4UHTA 2PMZA 4JOMA 1RPWA 1N77A 5LHHA 3I54A 1FPQA 2ID3A 2MD0A 2GOXB 3NWSA 2EBIA 3TL4X 2GA1A 4B3AA 4JX4A 4YFKF 3GZ5A 4IPAA 2M8GX 2W57A 3HUGA 3HM5A 5KCMA 1NH3A 2ZXHA 1Z3XA 4XRFA 4EGZA 4ZZDA 2O61A 5TJJA 4DZJA 1W0UA 2V1DA 3FHNA 4HPQA 4XKWA 3U1KA 2ELKA 3SDBA 1R4NB 5FFZA 5AIPA 1W36D 2DQRA 2DMPA 3M8JA 4KYWA 2R5YA 2LP0A 2R7FA 4PDKA 3GX4X 4ETSA 4C2TA 3F6OA 1WJDA 1OCOH 1RI7A 2P4WA 3RQ4A 3WG9A 1FYMA 4NB5A 3NQOA 1STZA 1S29A 4L5EA 3QWLA 3VODA 2XIGA 2XAHA 1H88C 1GXQA 4BY7J 3WU2C 2VQLA 5J8CA 1KU7A 1LEAA 4LK0F 2PEXA 3VPRA 2GAUA 4FE7A 4BHCA 2O7OA 2MYSA 3T5XA 3HOVJ 4EJOA 5IYBJ 3WODF 4E6KG 2DYRH 5L3GA 1MMSA 2LC2A 3OR1C 2KMUA 1TWHJ 1JTYA 2HDCA 1WH5A 4WWCA 2DODA 2F5DA 3NRVA 4II3A 4V2GA 4AD9A 4N4OB 2W00A 1T08B 5E3NA 5FKNA 2W85A 4A3DJ 4XORA 1KA8A 1W7PD 2MH2A 4L9TA 3ZQIA 3IHUA 4HF1A 2IW5A 4LGWA 5M3MJ 5LD2C 3G6EI 1LFBA 2EIJH 3NWTA 4UV9A 1U0JA 1VQOI 4A3BJ 3FXQA 4CYCB 1A6QA 4Y7NJ 3HJEA 3G73A 4FTHA 1O3RA 3KIOA 3LSJA 1IUYA 1QPMA 3OYMA 1MBKA 1KZHA 4BU2A 2BY1A 2W7NA 2JK3A 2RNJA 1AKHA 5EEGA 3LSTA 4D7NA 2P7CB 2X6XA 1I3QJ 2WV1A 3S16J 1PP8F 2TRTA 2EFPA 2LR8A 2BVMA 3S14J 5F04A 2LFBA 3F8CA 4P96A 1YLFA 3IV5A 3CJTB 3F8BA 1B4AA 4D0PA 1YYVA 3GWZA 2XROA 4D7MA 2V9KA 3V8LA 1FX7A 4M3DA 4MTEA 3ESWB 2GQQA 2M45A 1VQLI 3F6VA 3CTAA 3FBNB 5M5YJ 1HDPA 2MBFA 1XSVA 5CKTA 3C2BA 3FZVA 3RJPA 1VQMI 1I39A 5FB2A 5E8GA 3I0TA 2IXSA 2ZBKA 3ZXSA 3PNTA 1AU7A 1ZRCA 1R00A 2A5YB 2I8DA 2DMQA 4HG2A 3FMQA 3KLNA 4M6YA 3L2QA 3K4NA 2M1BA 3HKZA 3KEQA 2G7UA 4B47A 3MKYB 2WV0A 2ZMEA 3O3KA 4L18B 4RB2C 1FT9A 2VQGA 2W25A 4CXFA 1R1TA 4FHTA 5JLXA 1FJLA 3OYBA 5JFRA 2CQKA 3BR3A 1J2XA 3TKYA 2PFBA 1BR1A 5F6FA 2R7QA 4YIIA 4BBSJ 2HZTA 2JPCA 1ACIA 4ITVA 1MJ9A 1PUFB 1WJBA 1TW3A 3AAFA 2DA3A 3CP8A 3WHBA 2EPFA 4LLNA 3ZRGA 3G4SI 4KA4A 1X1BA 1XMXA 1G3TA 2Y9YA 4M6XA 3LMMA 3EYIA 5KK1A 4KIFA 2NVXJ 4R8HA 5H6QA 3CO7C 1N75A 1TQIA 3JREA 1R36A 4M73A 2OPTA 3DTKA 2NNNA 1HQCA 4ZDLA 2XRNA 5HS8A 2E71A 5B66C 3FM5A 1KONA 2ZJRF 3VDXA 2CQNA 4ZYEA 1FNNA 2Z16A 2E2IJ 3CDIA 3L9FA 4BXXJ 4FETA 3IRQA 2DPUA 3T0YA 3LSRA 3WU1B 2XKPA 3ZQGA 3WTSC 2HS5A 5EEAA 1WH7A 3KP2A 1I50J 2E1MB 2XF5A 1R49A 1FZPB 4KFCA 3DU5A 3TO7A 3GTGJ 1MNDA 2LH9A 2R7VA 3FXMA 2YS9A 3FMRA 3O8GA 3OIQA 1N25A 3JRFA 3HXLA 4M6VA 3UKGA 4II2A 2DMNA 4PFOA 1OKRA 2FBHA 2JPBA 3R61A 5J1RA 4A2UA 2VL8A 3RYPA 1RNLA 1X2NA 2EQRA 4EJUA 4IQ4A 2DK5A 1LDJA 4PZJA 4QWQA 4CZCA 3JR9A 1GLNA 2FMYA 3RPUD 1EJ9A 4IHVA 3FDYA 4A3MJ 4ZYGA 2STTA 2VBWA 3DBHB 4RLFA 1DP7P 4DJAA 3H1CA 1FIPA 4UVCA 4B48A 2ME0A 3PJRA 2V1NA 4RB3C 3DEEA 2WTEA 4DBRA 1ZRDA 4CCKA 2YSRA 1EH6A 2BY2A 2HVQA 4Z6YA 1UG0A 1YW7A 3MQ0A 3RKWA 5IYCJ 4WX9A 2IBDA 3K0LA 2BZTA 1JJ8C 4HAMA 1WJFA 4HA8A 5ILUA 3H9QA 3DPUA 2DOAA 3WTYC 5LFAA 2EILH 1TWAJ 3HOTA 4E7SA 2EZHA 2KPMA 1S5LC 2VN2A 2XAQA 2M7AA 5ILVA 3I4PA 4XSZF 3SFIA 2HKXA 4GO1A 4WXDA 4BAYA 2QSHX 1E3HA 5H20A 1SD5A 4ZTJA 4F92B 1VTNC 4DBQA 2R5ZA 2F5EA 3LAPA 4U7DA 2DOEA 1MKMA 2HNHA 2ISYA 4QLCU 5LRSA 1LPQA 2QSGX 1H9GA 1RC9A 3FKJA 3K1PA 4G12A 4GXOA 1F1ZA 2OU2A 4NNJA 3CCRI 2OTJI 3KEOA 3BY6A 1YTYA 3O2PE 2IA2A 1I6HJ 2DT5A 2E5ZA 2PQ8A 5HNHA 2LMDA 3KP6A 1A36A 3QYFA 4C3IJ 2UZKA 3OYNA 2P5LC 1IUFA 2WA0A 4UUSB 5GAGJ 4I02A 5IOYA 2RREA 2YUSA 1D0ZA 2NS8A 2XPVA 3HDDA 2XGXA 4XOTA 5TISC 4XNFA 4RGXA 5EZHA 4R79A 2X6OA 3M7GA 3UR3C 4BQNA 1KYWA 2B9SA 4IF4A 4BDZA 1H9TA 1QA6A 1R71A 1K78A 3ZMVA 3JAMZ 1Z21A 1V5GA 2LOOA 4V2FA 5K5QA 3WE3A 2L2OA 1S8NA 2K3PA 4KN7X 2VKEA 1I27A 4CCOA 1OCPA 3KETA 1QGPA 1XDSA 3RKYA 4J19A 1P4WA 2BXZA 1J7KA 3P9IA 5LHGA 1BI2A 1DU6A 3ECHA 1FBUA 3LSIA 5D8LB 5E18F 1WJAA 1RKWA 2EFOA 1V4RA 1X1PA 3JTGA 3N97A 2ZKZA 2JA8J 2CV1A 5FKOA 4MNUA 4XBFA 4PGHA 4IOAF 2F5FA 2FJ1A 4IL6C 1WHUA 2DK8A 1O7LA 2DMTA 1S7OA 1SMYF 1UG2A 3CZ6A 2X1EA 1OMIA 3IWFA 2ACJA 1S6LA 2F4OB 2LG4A 2OCCH 4UUVA 1PDNC 3CF5F 2K9SA 1BL0A 4G6TB 4IHTA 1V5FA 1SVMA 2EJRA 2KZVA 1Q1HA 2F4MB 3AG4H 1IXRC 4ENKA 5FKKA 1ETXA 1D1BA 1X19A 1CF7A 5FFXA 1B6AA 3FKIJ 2LYCA 1T33A 3S32A 5B5EC 1SEUA 3A01A 3M4OJ 4H4KC 3I64A 2XDVA 3BZKA 4AYBN 1IRGA 4KICA 2LKXA 2KFDA 2CFXA 1ZGAA 3ZQFA 2AXLA 2OC6A 1Z0XA 5CPRB 3PO2J 1U6GA 3I56I 1XGSA 1TZLA 3ZQCA 3WTXC 1LEBA 3SEQA 1PP7U 1VQ4I 2FQ4A 3V7RA 2Z3YA 1MH4A 1TQMA 2OBPA 2L9VA 3OY9A 3BG3A 2F6CA 2MC3A 4HQEA 1U78A 2DJIA 3ECOA 5JHUA 2KJCA 1JE8A 4XLCA 2PJRA 1ETKA 1NG6A 3OYLA 5JLWA 4EVIA 1E3PA 1XG1A 4Q4ZF 2QBYA 5CVIA 2JZYA 4BQOA 3GTOJ 4FT8A 4LK1F 1UFMA 5JR3A 4XLFA 2ICWG 2P8TA 1BR4A 2LNBA 3ULQB 1UCRA 2DFHA 2Q2EA 4RLQA 3DU6A 1TLHB 1B72B 3HHGA 2FD5A 4KISA 4HW0A 2R5YB 3CMEI 1G3YA 4ENNA 3MZYA 3CLQA 4XSXF 1R58A 3SFZA 3CQZJ 4BL0B 1Z6TA 1GT0C 1EKEA 1F43A 3J80Z 2H1KA 4E7ZA 1IDZA 2XAGA 2JTVA 1ZREA 3KP5A 1HBXG 1FC3A 3P9KA 3QOPA 3DFGA 1MZBA 2OQGA 2FF4A 3KZIC 4Q47A 3BG6A 3CMMA 3GTMJ 2AS5F 3NARA 4MQVA 5D6EA 4DYRA 2CSOA 1LQ1A 1KU3A 1FOKA 3AL0C 1BI0A 1OYIA 3O6BB 4HEA2 2HKOA 2IA0A 3BTIA 5IY5H 3LAJA 6PAXA 5IP9J 4G8XA 1WZ2A 1J59A 4BQAA 3DV8A 2HOTA 1U2WA 3A4CA 3B73A 2KDZA 2ZJ2A 3I3LA 2V7FA 3TW6A 5B1BH 1JKQC 3DKWA 2IEKA 4H0EA 1VFCA 5BPDA 2E60A 2R7OA 3BJOA 3QAHA 2OZ6A 2KISA 4BGDA 2E1OA 3TDUC 2WAFA 3AFHA 4V19K 5J47A 4ANJA 4LB6B 5M5XJ 2OAZA 3OR2C 3LSKA 2L9NA 3ASOH 1HXDA 2L7ZA 3H9JA 3KLOA 3D1NI 3VEPA 3ZN0A 1XDUA 1P92A 3I59A 2DA5A 3TO6A 5FKLA 1G2HA 2MLGA 3H35A 4XIDA 3OS0A 4HDVA 3C7JA 3RKQA 3CCMI 5L3BA 1MW7A 4WCGA 1WJ5A 5DD8A 1OQYA 4OINF 1IGNA 3J81K 1J5YA 2L7KA 2OJED 3FIWA 3N4MA 5K5RA 2WC2A 5BNGA 3V4GA 1OYWA 1O3SA 3D5RC 4AM3A 2EIMH 3CDLA 2QQ9A 3MKLA 1X1DA 2KKOA 3K69A 5HS9A 2PN6A 3JRHA 4EJTA 4WXHA 4NC7A 2HU9A 3S3NA 1WCMJ 4M74A 3HG9A 1F4KA 1R5HA 2V79A 2W1OA 1L3LA 3CC2I 1DUXC 2YPRA 1XGOA 2ZMEB 4CZZA 2V26A 5E20A 2ZB9A 3VWBA 2CUEA 3BZ6A 3RIRA 3S93A 2VQHA 4BACA 3QPHA 2PI0A 3OIOA 2H27A 3HC7A 2DOFA 4HOBA 2FE3A 4XQFA 3D5SC 1FSEA 4YIRX 1HDDC 1H0MA 3BZCA 1IAWA 3S1MJ 2L0KA 4IXAA 2R7WA 2AHQA 2DA6A 1QNTA 2DTZA 1G8XA 5FD5A 3KP7A 1SC7A 2BY0A 3WGHA 1D1AA 5E8IA 1QQIA 4CA0A 2MLKA 2LY2A 3GXOA 2VJ4A 3FXUA 1WJEA 1RZ4A 3M8EA 5FLVA 2BOLA 2QQAA 1JT6A 1GXPA 1PUEE 2E19A 1IRZA 1KQ9A 1QHGA 1TP4A 3FF5A 1LUJB 1QVUA 1QVTA 4IHSA 1GVJA 1BBYA 2W84A 1IXCA 2R4GA 1SVOA 3IKTA 2FX0A 2OA4A 4A93J 1QPIA 4I09A 5H2FC 2VLAA 5TGTA 3K4JA 1POGA 3CF2A 3H92A 4XMYA 2Y69H 3FX3A 4LIUA 5E1XA 3Q0UA 1A35A 1KGSA 2WADA 1YRNB 2M5WA 2LRDA 2W48A 1G3WA 2MH9A 1GDTA 1ZGJA 1R1VA 2VJIA 4A3EJ 2D1VA 3E6MA 4W1UA 1HKSA 1ZN2A 2LREA 4XR6A 2AO9A 1SFEA 4IKFA 2BXYA 3ABMH 1KYZA 2HPMA 2K27A 2X1CA 2V1UA 1FOYA 1WVRA 3BTJA 2FBKA 1ZELA 1K6OA 2V4JC 2JA5J 4B8XA 2QKLB 1YS6A 1FBQA 2CFOA 3BTLA 1ETVA 3BJ6A 1JUMA 2EWNA 4QIWN 1LE8A 3ZGKA 2NXNB 2HWVA 2MFZA 4EJWA 2JRMA 2JSPA 1ETWA 3M1CA 3CCVI 4RA2A 3TEDA 2DCEA 4EQQA 1X2MA 4RDUA 3SJMA 5FRMA 2X6WA 1QO0D 1FBSA 1S7AA 2XGCA 5L3CA 3TBIA 1LJ9A 3FK7A 3CCUI 2DA7A 4GCVA 3VOEA 5IYDJ 1VQ8I 2BEOA 3K1NA 2ZJQF 2K86A 5DDGA 3WGIA 4HNTA 3FBIB 2ZXIA 2GBYA 3SXYA 5E3MA 5JVGF 1IO2A 4I2OA 1JHFA 4I0AA 4BYYA 1R6RA 4BQQA 2I10A 1OCCH 4PGGA 1K79A 2VPLA 4BUPA 3V42A 1R5ID 4BJTA 3U1DA 2HTSA 3MFKA 4XOPA 1TT0A 5CVUA 1MBFA 2CW7A 5D5XB 1ZGWA 1VQ6I 1I5ZA 2E1MC 3BP8A 2R93J 1W7PA 2XGEA 3DCFA 3P5JA 1U5TB 4KMUX 3WG7H 1TNSA 5FLMJ 3GUDA 1GHCA 1F9NA 1NHAA 3P7NA 3OYGA 5BPIA 3DWLE 2J5OA 2O0YA 2PMZN 3JRCA 1HW1A 3EQLF 1IG7A 4LIVA 4U0VA 3W2VA 2K40A 5HDGA 5A2QZ 3W2AA 1GV5A 1MMDA 3HOWJ 3VYTB 2FOKA 1IN7A 3WU0A 4A3FJ 1MBEA 1K78B 3EUKL 3QQAA 1TWGJ 4EM2A 1YI2I 1WI9A 4YG2F 4TV7A 2M4GA 1BA5A 1HW5A 5FLXK 1XGNA 4U87A 4AVZA 3ZN1A 3OYFA 2R92J 5L3FA 1U3EM 3QPSA 1JKPC 1AA7A 3GFMA 3HPGA 4NHJA 3QP5A 4OIPF 1YITI 4BKXA 5GTHC 4BDYA 4DYQA 4PK4A 1Z1DA 5J6XA 4O5VA 3HBLA 2FEZA 1E17A 2LKPA 5GADJ 3BPXA 5DD4A 2DU9A 4X1EA 5EF6A 2X0LA 4NC6A 1IN5A 2IRFG 5E17F 5DUKA 3RKXA 2JVHA 1B59A 3H3VK 3ONQA 2OF7A 2VONA 3L2RA 3HOYJ 2RQQA 1ZQ3P 1T2KA 4D9JA 3LFKA 4Z2YA 2JA2A 3S2WA 2DA4A 3GFIA 1CF7B 1R9TJ 3HB9A 2L54A 4UUTA 3PUFA 4QSHA 2ETHA 3A01B 2ZNZA 1FYLA 4ESJA 3QRFF 3I5UA 2UWMA 1VQ9I 2DI3A 3ZR8X 2R0QC 3R60A 2VJJA 3K2AA 4LOCA 3K9TA 2EFWA 2VC1A 2QZ8A 1K61A 3HOZJ 3DF8A 3ABLH 4AU7A 4LG0B 1TL8A 4HSTA 2XF7A 4GGGA 3PFIA 3Q9SA 3ZP5A 4KIBA 2M3AA 3F0CA 2VB6A 2H8WA 1TWFJ 4N9IA 3ZCOA 5L3EA 2M0CA 1VZ0A 3FHZA 1MMAA 1UMQA 5GAHJ 3BG9A 4LD5A 4M9XA 2HI3A 3FXJA 5CQEA 3ZQHA 4HF2A 5F0HA 3RZOJ 3K7AJ 2DA1A 1XD7A 4MQ9F 3Q0VA 1JXSA 3TOAA 1VQNI 1R4MB 4JP0A 5J40A 3E0JB 1Z91A 4XKVA 2OQRA 2TDXA 3KX2A 4ESFA 1UJ8A 3OL3A 3GBGA 5D5UB 1IDYA 1ERDA 3GTJJ 3CCYA 5CYVA 1ETQA 3ZMUA 3S3OA 3RPUA 2LKSA 3BR5A 2VT3A 3OIPA 1RKTA 4A0XA 2AQEA 2K5CA 4O3MA 3HKZN 1XTAA 3AG2H 5EGOB 4LB5A 3K6GA 5F0FA 2OZUA 3GW2A 4B4CA 5JI6A 1ZR4A 4Y13A 3TMOA 1IF1A 2H8RA 4AIJA 3W2WA 1QZEA 5HLIA 2Z1DA 5A2QK 1WJCA 3ZMDA 2HOEA 3GLLA 2VOPA 2EIKH 1E2XA 3C3WA 1YOVB 2EFQA 4CUGA 3QPLA 2BHZA 5C4JJ 2GM4A 2HYGD 4IJAA 4FASD 3K4MA 3BCBA 3R6SA 2Z5UA 1GV2A 4OAZA 1APLC 4KITB 5HDKA 5BMZA 2WY8Q 3PIOF 2ESHA 2STWA 4BEHA 2A6EF 3KZYA 3QPTA 3JRDA 1R22A 3HL2A 1MJAA 2COBA 4G94A 1XCBA 2EZKA 4WK8F 2LTPA 4CHUA 2IS1A 4W97A 4U0YA 3I58A 1REPC 4IHXA 4FCYA 3CUOA 2CRGA 2CUFA 1RR8C 1JKRC 4HRIA 1LVKA 2CU7A 1BOBA 2A6TA 3DTIA 1ONVA 4IOCF 1ZYRF 5EJCA 3OOPA 3OYCA 3AG3H 1T56A 3RZDJ 4HNUA 2VE9A 4NQWB 1Z3YA 2E36A 1VF9A 3BR6A 1JT0A 1UHWA 2HVSA 2QLZA 2NVTJ 2JT1A 3PO3J 1T8IA 2QYOA 3G1LA 4ENJA 3REOA 3BQYA 4PJJA 1MIJA 1TW2A 1MD0A 4A3CJ 2X51A 2L7FP 3CUQB 2DMUA 3M8FA 2DN0A 4FE4A 4C3HJ 1UELB 4XRSG 3RPQA 4GDFA 4HV5A 1DP3A 4XLAA 2FRHA 2Z9OA 4CCNA 2RNGA 4HX8A 1NTCA 2NVQJ 2ZCWA 3KE2A 5GTIC 2O8KA 2CMPA 1OR7C 4RBOA 5GPCA 3HYIA 3FM3A 5C3EJ 3Q0WA 2KDOA 3AKZA 2QQBA 5CLSA 2ZC2A 3TO9A 3K4KA 2M34A 2DYSH 1W0TA 2CQXA 2IGOA 1EA3A 2DO7A 2GZWA 4I99C 1VQPI 2IS6A 1UHMA 5EYRA 5D8KB 1HW2A 3EUHC 4A3JJ 1ZARA 1P7JA 1BOAA 1R1UA 3VYRB 1J09A 4RGUA 4U88A 5F27A 3TOBA 3HGYA 1Y6IA 3JRBA 1B1BA 1OLTA 3FXKA 2OTLI 2XAUA 3X2QH 5E3OA 4JX6A 3DP7A 1B8IA 3RTRA 1YX3A 4JX5A 3OL4A 1ZRFA 4JK1X 1OISA 3L09A 2K02A 3E5UA 4B09A 2A68F 1BW6A 3MEXA 4N9HA 5F1JA 2WAQA 2GXBA 5DM7F 4ZH4F 3ROUA 1F5TA 4HZFA 2J5PA 1A5JA 2NOJB 2E7XA 1XSXA 2AQFA 1ZHFA 2L5QA 3OS2A 5J8FA 1O4XA 5DCMB 4MFEA 1SMTA 4P9UA 2NAZA 4OIRF 2EZIA 3PNYA 4NC8A 1EV7A 2WBMA 4IRGA 5F0CA 3W6JB 1ZLJA 5M3FJ 4YEJA 3J81Z 3BWGA 2FUG2 2GA2A 3J7YJ 5H6RA 2PLYA 4BS9A 3C1DA 1V55H 4UB8C 3MZ8A 2HYJA 2NS0A 2HEOA 1DGWY 3SQNA 2NYXA 2MC4A 3PSIA 1ETYA 3ELKA 1RRJA 1P7IA 3FXLA 1YJWI 3BC8A 3IH4A 5F64A 3JSOA 1O3QA 1VQ5I 1YIOA 2ELHA 2ZMEC 5JVTA 1IV6A 3JCUC 2LBFB 1QHHD 2RVCA 1IRXA 3V7SA 1QZYA 2DJNA 4L9JA 5D5WB 2W82A 2EK5A 3D0SA 4BJ5C 1Z77A 5J1UA 3MZHA 3S8PA 2H6CA 3GLXA 5ILSA 3WE2A 1R23A 3F8FA 4F93B 2FMLA 1BI3A 2WAQN 2E1NA 2JUGA 3HUGB 2BBYA 4R1HA 3QU3A 3TP3A 3H9GA 4PJLA 4XICA 3UNGC 3JTHA 3W6KB 5J3LA 1RESA 4A5MA 2RDPA 3OYEA 5EG0A 4IRIA 2K9NA 2P5KA 4RAYA 3TGNA 4IQJA 1AOYA 3IL2A 1MDMA 2JJ7A 4M9SA 5CVVA 3LA7A 4FX4A 3CCLI 4M71A 4KT6A 1OFCX 2KIMA 3K10A 2QSFX 1J0RA 4UVBA 1HA8A 3BROA 1XMAA 4AVPA 5J4YA 1ZG5A 4EGYA 1ZR2A 4C30A 2O8XA 2M7BA 1I1GA 1YW8A 3HOUJ 4ZZLA 4PUSA 2CUZA 1KQ8A 1ZK8A 5E1ZB 2L3DA 5IPAA 2XAJA 2KIQA 5HNFA 4MEXF 3NEUA 2KLOA 2V9VA 3WHCA 3RI4A 3HRUA 4QPQA 4BH9A 5BQTA 1HSJA 5M5WJ 4XKBA 4JQFA 3EUAA 1D8JA 3HIFA 2VOOA 1JI8A 1JHHA 3VFZA 4I0BA 1T38A 4F3QA 2CWEA 4O6JA 5K5OA 1EH7A 5ICEA 1D0XA 3W6VA 1YIJI 2FU4A 1MBJA 2L01A 3E97A 4A0ZA 1ZLKA 1MBGA 2BYVE 2F2EA 3T8TA 2G7HA 2EINH 4NUBA 1X3WB 2E5NA 4N4NB 4PJMA 3I71A 3TQNA 2XPWA 4D1QA 3ZMTA 2CYYA 1IZ1A 2XSJC 2QF7A 1MGTA 3U2RA 2GLOA 2XASA 4U0WA 4OIQF 3LSGA 1AKHB 1SD6A 3ZQ7A 2Y0SA 1QZZA 1KU2A 2ELJA 2KRFA 2RV8A 5CQGA 2EA2A 2LD5A 3PSFA 5AIQA 4YFXF 5DCFA 4MLOA 2KRCA 1TQPA 1O3TA 3DTEA 3LSMA 4WXCA 4HX7A 4UNOA 4PSXA 1K4SA 5LGNA 2G9WA 3HOXJ 1SAXA 1W1WE 2EV5A 5FKMA 3DEWA 2Y75A 2IAIA 3OYDA 4XLPF 3ERED 4L0ZB 3OYHA 2V1XA 1D1CA 2BW3A 4F55A 2F4IA 1IW7F 4E70A 2R3SA 3M3YJ 4OIOF 5E3LA 1VI0A 3BG5A 3I4MJ 3Q3SA 2VKVA 2L7MP 2RC4A 3BPVA 4ZDOA 3GEZA 1U5TC 1B9NA 1NK2P 2IPQX 1BJZA 2ZNYA 3RYRA 1A04A 3G71I 1M1EB 3PL8A 1P4AA 3S2HJ 4PSWA 5AONA 2EA4A 2PG4A 1YHQI 1ZG1A 3ABTA 4L5JA 4E7KA 2XKOA 1DU0A 5K1YA 3ERMA 4BHPA 3E5QA 1MSEC 5B3SH 4KMFA 5LGTA 3H3ZA 2HDWA 2VBXA 1P6RA 3CJRB 1CQTA 5DEQA 3DQVC 4UUSA 2LLKA 3K70C 2Y9ZA 4A3KJ 2A05A 3BCAA 2CH0A 2XRLA 2P0WA 3CMAI 3J7AO 5ERIA 3VYSB 5K7ZA 2JUCA 3CO6C 1JGSA 3K1MA 5FLXZ 3HTSB 4AIKA 3A2KA 3DLAA 4IHYA 3GZ6A 2Q1ZB 3KFWX 3GFJA 2P81A 3H0GJ 2ME6A 2FXAA 1OYYA 3FXOA 2M4KA 4ASNA 3JRAA 1LFUP 1XC5A 3SEZA 3CCJI 5HOOA 4MHGA 1VQKI 1ZG3A 2DQLA 2KP6A 3CLOA 3DKXA 2OD5A 2A3SA 1HC8A 1BM9A 4A69C 1HF0A 2EH3A 1Y8QB 1MH3A 3F21A 1Y1VJ 3ZQLA 3K4CA 2DTRA 4UXNA 4Y3OA 4B43A 2XC7A 2CUJA 4OOIA 2K9MA 4GFBA 5GP9A 3CCQI 4JYKA 5CVRA 1WGXA 2M0MA 1ULYA 1P9QC 1C0WA 2IVMA 4XN0A 3HSRA 5EEHA 1H8AC 4N0BA 2JA7J 3VSKA 3CJNA 1YE9A 1FEXA 1JUPA 2ECBA 4S04A 3SZGA 2L9SA 4E7LA 1D8KA 4NBQA 3H5AA 3ZMZA 1FMVA 1K83J 1ETOA 2HVRA 2ESNA 3A02A 3F72A 4XRMA 4C3JJ 2HTJA 1NK3P 2P6SA 1JTXA 2HR3A 3QOEA 4DOZA 4CO8A 4K2EA 4ENMA 5ICCA 2MD5A 1EF4A 3DPLC 2KIFA 2XB5A 1FOWA 5ED4A 2HQ5A 4DZPA 3G2BA 2JSCA 1DPUA 2ZSHB 3M07A 3SZPA 2MSYA 2F5CA 2RQPA 3A0HC 3FK6A 1Y0NA 1HLVA 2VPRA 4WF2A 9ANTA 1FP1D 3HHHA 4I98B 4XM3A 4ABZA 3HTUA 4I6ZA 3DLLF 4P55A 3B6CA 2KIUA 3BJAA 5HS7A 2R7RA 1X1AA 4P1WA 3IWZA 3S1QJ 4E7JA 3GTKJ 1J9IA 2R5ZB 5CVJA 2QM3A 5DTDA 1WFXA 4FISA 3LNQA 3JSPA 2DFIA 3G1OA 4DYCA 2PBIA 2NOGA 2HGCA 2VBYA 2YR2A 4DW6A 2A6HF 3S15J 1Z67A 1SAUA 3IH2A 3OYKA 1R5GA 3R0AA 2WWYA 2DA2A 5J4VA 4MO7A 3CDHA 2K7LA 1FOXA 3OS1A 5IOZA 3FMSA 3QP6A 1U9OA 3C2GA 2IGMA 1ODDA 1B72A 4OMZA 4PJ0C 1MNMC 2M87A 2MGQA 4I01A 5TRDA 2QUFA 3ISPA 2KT0A 4LMYA 4BE1A 1Z05A 2JVGA 2XPUA 1LVAA 4F91B 4HYEA 3V8JA 3J7ZI 5F1RA 4BNCA 2MG4A 5DS9A 4B44A 1VNDA 5LRRA 5D6FA 3M1EA 3BR0A 5LLQA 1Y8RB 1SFXA 3G1MA 2VBZA 3B6AA 3B02A 3DPTA 2FSWA 2FNPA 3OYJA 3C18A 1GVDA 2GWRA 1TBXA 2LY9A 4Q48A 1YW9A 3KYDB 3PQJA 4GYIA 1OR7A 1X4OA 2ZFUA 3ABKH 3F23A 2HQAA 3E3VA 5FJ8J 2O9LA 1IN6A 2R7TA 3GVAA 1QRYA 3I53A 1W5TA 3MN2A 3MAJA 2GIVA 1B8IB 2V9PA 2O6GE 3M9AA 3E7LA 4C2MJ 4AWXB 4EJVA 2D1HA 2A69F 2NVUB 3E6BA 3EUHA 1NG7A 2VIXA 3OSFA 4M3BA 1Y56A 4L9NA 2YX7A 2OUMA 4A5NA 3GTLJ 5IT9K 3F8NA 3HRSA 3GF2A 4YELA 2KZGA 2CW0F 2L9RA 2H1LA 2HDDA 3LA3A 4RS8A 3CCSI 2P5VA 4Q5SF 4M3FA 1MMNA 2Y31A 3OV8A 4RAGA 1LKXA 5KAIC 4HBLA 3G3ZA 4G7OF 5C44J 2G0EA 2KJBA 4G6QA 4RGSA 1XN7A 2LK2A 1P4XA 2ECCA 3CUQC 4YIFA 1FYKA 2VXDA 4ZDPA 1ENHA 3ZOBA 2CJJA 3QODA 1D3YA 3KZZA 2LVSA 4ZYDA 1T0FC 1RETA 1PJRA 4XLHA 2HPIA 4EEFG 2D2WA 3VYUB 3IC7A 3P9CA 2UUZA 4I76A 2OV7A 2HQNA 4C2UA 3GCMA 4XL9A 3ZQQA 4ZC3A 3LQQA 3V7CA 2PJRB 2KL4A 2DT7B 4KN4X 1TWCJ 2Y48A 3H0DA 2IA1A 3L2WA 2NS7A 1WWXA 5LBQA 2VKDA 1WSUA 1BI1A 2QBYB 1IJWC 4CICA 3FWEA 1JJ6C 1FIAA 4D5CA 4RAZA 2Q2EB 2BVLA 3H5RA 3BT9A 1QU3A 5EG0B 2FNAA 1TTYA 4CCLA 1YJNI 3I4NJ 1MDMB 2M8EA 3OMYA 1ZKGA 4RB0A 3N05A 4DIQA 3BR2A 4AUXA 1HKTA 5D5VB 3H36A 4MTDA 4EV0A 5KAFC 1WKMA 2R7SA 1H89C 2FBIA 4IRHA 1BW5A 1WQ2A 2O5RA 5LGUA 1ON1A 2VUMJ 2A5WA 3EETA 1K7AA 1KQ0A 2VKHA 1BR2A 2X1DA 4LG3A 2E2HJ 3IAM2 3A03A 1B9MA 1J75A 4XN3A 3CJQB 4AC0A 1N78A 2RAEA 3HZJA 5KHDA 3DBRB 2CQ7A 5HODA 1IN8A 2ZFWA 2JWTA 3K4BA 5HLTA 3S1NJ 2QENA 3CC4I 2DXIA 3S1RJ 3WGGA 1YRNA 3PIPF 4ON0A 5E79C 5EZGA 3SDGA 4DNCA 3PUBA 1SD7A 2VE8A 5FD6A 2IGKA 3Q9VA 2EB7A 1FP2A 2VXZA 4E7HA 1W36C 1I3AA 1T6SA 1SFKA 1G4DA 2EV0A 5D4SA 3ZPLA 1PVEA 4EM1A 2FQ3A 1ZTRA 1XS9A 2A07F 3GTPJ 5LEKA 2HQRA 4CH7A 2ZO4A 3KPHA 2IGNA 1DDNA 1ORKA 4UVAA 5GAEJ 1WRJA 2P6TA 4KUMA 2KHMA 2CO5A 4HSRA 3KCCA 4DGWB 1Q1VA 4ZYAA 3JRIA 1SD4A 3I59B 2DDAA 1YO5C 2Z2SB 2X85A 5EDNA 2LSOA 3J7AY 4HF0A 5HLHA 2E35A 4M9ZA 1FTTA 5FROA 1G6NA 3F8MA 3HRMA 3PM1A 3L2UA 1TC3C 2IP2A 4BBRJ 4DQ2A 5ICGA 2BW3B 3H5NA 2VASA 5C4XJ 3VSLA 3DBLB 2RGVA 3KEYA 3HRTA 5GPAA 3RDIA 1AWCA 4BXFA 1Z7UA 1X4PA 2B0LA 1L0OC 2X48A 4A6DA 2WAEA 1XCVA 2BY3A 1MMGA 2L4MA 2N8GA 1SFOJ 1Z7LA 2Y2ZA 3GZNB 2V6EA 4AIHA 4G7ZF 1YS7A 1S72I 3WTWC 1MJBA 3CD6I 4U7BA 4ESBA 2CG4A 4HLXA 3E1SA 1IC8A 1OCRH 2YX4A 2E7WA 3EPZA 2D45A 3DXJF 3KP3A 4CDGA 2CGPA 4XRSA 4RB1A 4IX7A 2ISZA 3HGGA 3MCZA 1U5TA 3FXRA 3DEUA 1GUUA 5BS6A 4BXUA 2NVYJ 2COMA 3AG1H 4XK4A 4Y33A 4QTRA 2ID6A 3I55I 5DYMA 4Y52J 2FA5A 1SANA 3LOCA 4CCJA 1HCRA 1FWZA 1E3OC 2H94A 3LSPA 4J00A 3WTVC 4ZTFA 1I1SA 2GOMA 2IJLA 2WB1A 1X3UA 3C2HA 4B1RA 1XSDA 2PX9A 4M72A 1ZAOA 3WTTC 3L2CA 4AYBA 4GYGA 2JMWA 1V54H 4RGRA 1XX5A 2DFEA 5JHFA 1JGGA 1W5SA 4HDUA 1ZH5A 3A0BC 4XKCA 4OU0A 3EDPA 3NAUA 1T95A 1BC7C 4CYCA 4IEJA 1VQ7I 2CV2A 3CP2A 3A1YA 2E1CA 5KVRA 4MGRA 1BN5A 4Y15A 3Q5FA 3IAS2 3L7WA 2ZJPF 4EM0B 3L00A 1DQUA 1W5CC 2HOAA 3EYYA 1Y1WJ 2E2JJ 4HQMA 2X9DA 2R7XA 5K7HA 2RKHA 2O03A 1DPRA 2O3FA 3U21A 3HPHA 3GMEA 1USSA 4LITA 4MFDA 1PYVA 4S05A 3K70D 5L3DA 3IKVA 3WTUC 1YX5A 3S17J 4UV8A 4A6EA 5B1AH 1IN4A 1G59A 2Y30A 1LNWA 1Y39A 1LE8B 5IP7J 2ZSIB 3KP4A 2L4AA 3L2VA 2EZLA 2HXOA 1FMWA 4CGZA 2QKMB 1SFUA 1K6YA 2Y0MA 3CC7I 3KYLA
chains in the Genus database with same CATH topology
4IHWA 2WB1N 2K40A 3OOUA 3JR9A 4NDLA 1DU0A 3L1PA 1GV5A 1F36A 4M3GA 3HOWJ 1MSEC 1U9NA 4IHVA 3FISA 4A3FJ 4A3MJ 1MBEA 1CQTA 4UUSA 3QQAA 1TWGJ 1FIPA 2LLKA 2ME0A 2Y9ZA 1WI3A 4A3KJ 5IP6A 1FTZA 4S0HB 2HOSA 2XRLA 1BA5A 2B63J 5K7ZA 5IYCJ 1D5YA 2R92J 2IBDA 3QPSA 1JKPC 1JJ8C 4IHYA 1PUFA 2P81A 3H0GJ 2ME6A 1TWAJ 4BKXA 2JN6A 3JRAA 3BQZA 2EZHA 4DYQA 1OCTC 1LFUP 1XC5A 2MW8A 3HBLA 3SFIA 4X1EA 4A3GJ 5EF6A 4A69C 1HF0A 2EH3A 1MH3A 1Y1VJ 3ZQLA 1MSFC 1U8BA 2R5ZA 3H3VK 2OF7A 4MIMA 4GFBA 5GP9A 3HOYJ 1ZQ3P 4JYKA 4G12A 1WGXA 2DA4A 1R9TJ 4D5FA 3HB9A 1H8AC 4UUTA 4BY1J 1I6HJ 2JA7J 4QSHA 3A01B 1FEXA 2D5VA 2JA6J 1JUPA 2ECBA 4C3IJ 5EGOA 2R0QC 3OSGA 1IUFA 3RQIA 2QCOA 4UUSB 3K2AA 4LOCA 2YUSA 5IOYA 2NS8A 2XPVA 2XB0X 1K61A 1K83J 3HOZJ 1ETOA 3HDDA 3A02A 4XRMA 5EZHA 4C3JJ 2X6OA 1NK3P 1JTXA 3F0CA 1EF4A 5K7FA 1TWFJ 2XB5A 2M2EA 2HQ5A 4DZPA 4V2FA 2M0CA 2R7ZJ 2MSYA 3FK6A 1RR7A 1HLVA 2VPRA 1UMQA 9ANTA 2VKEA 3BG9A 4I6ZA 1OCPA 2HI3A 4ABZA 1HOMA 3ZQHA 1JUSA 3B6CA 5F0HA 4J19A 3RZOJ 3K7AJ 2DA1A 3S1QJ 1DU6A 3GTKJ 3Q0VA 2R5ZB 3TP0A 3S2DJ 1WPKA 2TCTA 5DTDA 4JP0A 4FISA 3LNQA 1RKWA 3G1OA 4DYCA 2JA8J 2NOGA 5FKOA 3GBGA 2YU9J 2FJ1A 4DW6A 4A3LJ 1IDYA 2VI6A 3S15J 3IH2A 2DMTA 3GTJJ 3CCYA 1UG2A 2DA2A 1ETQA 4MO7A 3BR5A 5IOZA 1RKTA 1U9OA 3HKZN 1B72A 5EGOB 1MNMC 2K9SA 2MGQA 1BL0A 1UHSA 3O8HA 5F0FA 4B4CA 2KT0A 1ZR4A 2H8RA 2XPUA 5FKKA 1JKOC 1ETXA 3BR1A 2MG4A 5DS9A 1VNDA 3FKIJ 1T33A 3BR0A 3A01A 3M4OJ 2Y0SN 3G1MA 4AYBN 3B6AA 3QPLA 2LKXA 5C4JJ 2GM4A 1GVDA 3ZQFA 3HEFA 2LY9A 2XSDC 1Z0XA 3PO2J 3ZQCA 2M9HA 1GV2A 2FQ4A 5FJ8J 2O9LA 4HNVA 1APLC 1MH4A 1QRYA 3MN2A 3BG3A 1U78A 1B8IB 3JRDA 3E7LA 1MBHA 4C2MJ 2COBA 2XGDA 1ETKA 2EZKA 3MVPA 2LTPA 2K9QA 4W97A 3OSFA 4M3BA 5JLWA 4IHXA 4FCYA 2CRGA 5J1YA 2CUFA 3CMYA 1XG1A 3GTOJ 1JKRC 3GTLJ 2CU7A 3JRGA 2L9RA 1B72B 2HDDA 1X58A 2FD5A 4X6AJ 2R5YB 1T56A 1OJLA 3RZDJ 4M3FA 2Y31A 1VF9A 3BR6A 1JT0A 3CQZJ 2NVTJ 1GT0C 3PO3J 1F43A 3G1LA 2H1KA 1IDZA 5C44J 2G0EA 3BQYA 2LK2A 5F08A 3GTQJ 4A3CJ 2L7FP 2ECCA 4FE4A 2DMUA 2DN0A 4C3HJ 4XRSG 1NTCA 2NVQJ 1ENHA 3ZOBA 2O8KA 2CJJA 3GTMJ 2CQQA 4RBOA 5GPCA 3NARA 1AHDP 5C3EJ 2LVSA 3Q0WA 4DYRA 1RETA 4EEFG 1S7EA 1ITYA 2HXIA 2M34A 1W0TA 2CQXA 4I76A 3BTCA 3BTIA 5IP9J 4M3EA 5EYRA 2HOTA 3TW7A 1TWCJ 4A3JJ 2KDZA 1P7JA 1A6IA 2NS7A 4A3IJ 3TW6A 5F27A 1IJWC 3HGYA 1JJ6C 3IH3A 3JRBA 1JKQC 1FIAA 4D5CA 2IEKA 1VFCA 3BT9A 5E3OA 5EG0B 3I4NJ 1RPWA 2E1OA 4JX6A 1B8IA 4JX5A 5M5XJ 1ZKGA 2ID3A 2EBIA 4B3AA 3BR2A 4JX4A 4AUXA 2L7ZA 2M8GX 1BW6A 3D1NI 5F1JA 3HM5A 2DA5A 1H89C 5FKLA 4DZJA 1W0UA 1G2HA 4XIDA 1A5JA 3RKQA 2ELKA 1BW5A 1O4XA 2DMPA 4MFEA 2VUMJ 2EZIA 2R5YA 2LP0A 1IGNA 5F0CA 5M3FJ 3FIWA 2E2HJ 3A03A 4L5EA 5BNGA 4AC0A 2RAEA 3CDLA 1H88C 5HODA 2HYJA 4BY7J 2JWTA 3MKLA 3S1NJ 3JRHA 1ETYA 3S1RJ 3VPRA 1P7IA 1WCMJ 1YRNA 4FE7A 2O7OA 3IH4A 3HOVJ 5EZGA 3SDGA 5IYBJ 1IV6A 2ZB9A 2CUEA 1TWHJ 2DJNA 1JTYA 1WH5A 3OIOA 4V2GA 1Z77A 5J1UA 1HDDC 5E3NA 1XS9A 3GTPJ 1ZTRA 5FKNA 4A3DJ 1ORKA 3S1MJ 2L0KA 3ZQIA 2WAQN 2AHQA 2DA6A 2DTZA 5M3MJ 1Q1VA 3JRIA 1LFBA 3TP3A 4XICA 4A3BJ 4CYCB 4Y7NJ 4FTHA 5FLVA 5J3LA 1RESA 1JT6A 3LSJA 5EDNA 2E19A 2K9NA 5EG0A 1IRZA 1MBKA 2JJ7A 2JK3A 1AKHA 1FTTA 1QVUA 1QVTA 4D7NA 1I3QJ 2WV1A 3PM1A 3S16J 1OFCX 2FX0A 1TC3C 4BBRJ 2TRTA 2LR8A 3S14J 4A93J 5F04A 2LFBA 1QPIA 5C4XJ 1ZR2A 3IV5A 5GPAA 1POGA 4D7MA 2X48A 3HOUJ 3Q0UA 4M3DA 2N8GA 1SFOJ 2Y2ZA 1YRNB 1ZK8A 5IPAA 2W48A 1GDTA 4A3EJ 3WHCA 4W1UA 5M5YJ 1HDPA 2AO9A 1IC8A 5M5WJ 3C2BA 4XRSA 3BTJA 3HGGA 1AU7A 2JA5J 2DMQA 1GUUA 3W6VA 2NVYJ 3BTLA 4XK4A 4QTRA 1ETVA 4QIWN 1JUMA 1MBJA 2ID6A 1LE8A 4Y52J 3LOCA 1SANA 1MBGA 1HCRA 1E3OC 3TEDA 1ETWA 3LSPA 5JLXA 1FJLA 2XPWA 1X2MA 4RDUA 3BR3A 3SJMA 2QF7A 2GLOA 4B1RA 3LSGA 1AKHB 4BBSJ 2XGCA 2LD5A 1PUFB 2JMWA 2DA3A 1JGGA 4MLOA 3FK7A 2DA7A 3WHBA 5IYDJ 3NAUA 2Y9YA 4CYCA 4IEJA 2NVXJ 2GBYA 3HOXJ 2HOAA 3JREA 5E3MA 2OPTA 1Y1WJ 2E2JJ 2X9DA 5FKMA 3DEWA 5K7HA 2IAIA 2I10A 2E2IJ 4BXXJ 3M3YJ 5E3LA 3LSRA 1VI0A 3BG5A 4MFDA 1MBFA 3ZQGA 3Q3SA 3I4MJ 5EEAA 2VKVA 1WH7A 1ZGWA 2L7MP 1I50J 2R93J 3S17J 2XGEA 3DCFA 3GTGJ 2YS9A 3O8GA 1NK2P 1BJZA 3JRFA 2Y30A 4M6VA 3UKGA 1LE8B 2DMNA 5IP7J 5FLMJ 5J1RA 3S2HJ 2EZLA 2HXOA 2PMZN 1X2NA 2EQRA 3JRCA 1IG7A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4IHW A;  2WB1 N;  2K40 A;  3OOU A;  3JR9 A;  4NDL A;  1DU0 A;  3L1P A;  1GV5 A;  1F36 A;  4M3G A;  3HOW J;  1MSE C;  1U9N A;  4IHV A;  3FIS A;  4A3F J;  4A3M J;  1MBE A;  1CQT A;  4UUS A;  3QQA A;  1TWG J;  1FIP A;  2LLK A;  2ME0 A;  2Y9Z A;  1WI3 A;  4A3K J;  5IP6 A;  1FTZ A;  4S0H B;  2HOS A;  2XRL A;  1BA5 A;  2B63 J;  5K7Z A;  5IYC J;  1D5Y A;  2R92 J;  2IBD A;  3QPS A;  1JKP C;  1JJ8 C;  4IHY A;  1PUF A;  2P81 A;  3H0G J;  2ME6 A;  1TWA J;  4BKX A;  2JN6 A;  3JRA A;  3BQZ A;  2EZH A;  4DYQ A;  1OCT C;  1LFU P;  1XC5 A;  2MW8 A;  3HBL A;  3SFI A;  4X1E A;  4A3G J;  5EF6 A;  4A69 C;  1HF0 A;  2EH3 A;  1MH3 A;  1Y1V J;  3ZQL A;  1MSF C;  1U8B A;  2R5Z A;  3H3V K;  2OF7 A;  4MIM A;  4GFB A;  5GP9 A;  3HOY J;  1ZQ3 P;  4JYK A;  4G12 A;  1WGX A;  2DA4 A;  1R9T J;  4D5F A;  3HB9 A;  1H8A C;  4UUT A;  4BY1 J;  1I6H J;  2JA7 J;  4QSH A;  3A01 B;  1FEX A;  2D5V A;  2JA6 J;  1JUP A;  2ECB A;  4C3I J;  5EGO A;  2R0Q C;  3OSG A;  1IUF A;  3RQI A;  2QCO A;  4UUS B;  3K2A A;  4LOC A;  2YUS A;  5IOY A;  2NS8 A;  2XPV A;  2XB0 X;  1K61 A;  1K83 J;  3HOZ J;  1ETO A;  3HDD A;  3A02 A;  4XRM A;  5EZH A;  4C3J J;  2X6O A;  1NK3 P;  1JTX A;  3F0C A;  1EF4 A;  5K7F A;  1TWF J;  2XB5 A;  2M2E A;  2HQ5 A;  4DZP A;  4V2F A;  2M0C A;  2R7Z J;  2MSY A;  3FK6 A;  1RR7 A;  1HLV A;  2VPR A;  1UMQ A;  9ANT A;  2VKE A;  3BG9 A;  4I6Z A;  1OCP A;  2HI3 A;  4ABZ A;  1HOM A;  3ZQH A;  1JUS A;  3B6C A;  5F0H A;  4J19 A;  3RZO J;  3K7A J;  2DA1 A;  3S1Q J;  1DU6 A;  3GTK J;  3Q0V A;  2R5Z B;  3TP0 A;  3S2D J;  1WPK A;  2TCT A;  5DTD A;  4JP0 A;  4FIS A;  3LNQ A;  1RKW A;  3G1O A;  4DYC A;  2JA8 J;  2NOG A;  5FKO A;  3GBG A;  2YU9 J;  2FJ1 A;  4DW6 A;  4A3L J;  1IDY A;  2VI6 A;  3S15 J;  3IH2 A;  2DMT A;  3GTJ J;  3CCY A;  1UG2 A;  2DA2 A;  1ETQ A;  4MO7 A;  3BR5 A;  5IOZ A;  1RKT A;  1U9O A;  3HKZ N;  1B72 A;  5EGO B;  1MNM C;  2K9S A;  2MGQ A;  1BL0 A;  1UHS A;  3O8H A;  5F0F A;  4B4C A;  2KT0 A;  1ZR4 A;  2H8R A;  2XPU A;  5FKK A;  1JKO C;  1ETX A;  3BR1 A;  2MG4 A;  5DS9 A;  1VND A;  3FKI J;  1T33 A;  3BR0 A;  3A01 A;  3M4O J;  2Y0S N;  3G1M A;  4AYB N;  3B6A A;  3QPL A;  2LKX A;  5C4J J;  2GM4 A;  1GVD A;  3ZQF A;  3HEF A;  2LY9 A;  2XSD C;  1Z0X A;  3PO2 J;  3ZQC A;  2M9H A;  1GV2 A;  2FQ4 A;  5FJ8 J;  2O9L A;  4HNV A;  1APL C;  1MH4 A;  1QRY A;  3MN2 A;  3BG3 A;  1U78 A;  1B8I B;  3JRD A;  3E7L A;  1MBH A;  4C2M J;  2COB A;  2XGD A;  1ETK A;  2EZK A;  3MVP A;  2LTP A;  2K9Q A;  4W97 A;  3OSF A;  4M3B A;  5JLW A;  4IHX A;  4FCY A;  2CRG A;  5J1Y A;  2CUF A;  3CMY A;  1XG1 A;  3GTO J;  1JKR C;  3GTL J;  2CU7 A;  3JRG A;  2L9R A;  1B72 B;  2HDD A;  1X58 A;  2FD5 A;  4X6A J;  2R5Y B;  1T56 A;  1OJL A;  3RZD J;  4M3F A;  2Y31 A;  1VF9 A;  3BR6 A;  1JT0 A;  3CQZ J;  2NVT J;  1GT0 C;  3PO3 J;  1F43 A;  3G1L A;  2H1K A;  1IDZ A;  5C44 J;  2G0E A;  3BQY A;  2LK2 A;  5F08 A;  3GTQ J;  4A3C J;  2L7F P;  2ECC A;  4FE4 A;  2DMU A;  2DN0 A;  4C3H J;  4XRS G;  1NTC A;  2NVQ J;  1ENH A;  3ZOB A;  2O8K A;  2CJJ A;  3GTM J;  2CQQ A;  4RBO A;  5GPC A;  3NAR A;  1AHD P;  5C3E J;  2LVS A;  3Q0W A;  4DYR A;  1RET A;  4EEF G;  1S7E A;  1ITY A;  2HXI A;  2M34 A;  1W0T A;  2CQX A;  4I76 A;  3BTC A;  3BTI A;  5IP9 J;  4M3E A;  5EYR A;  2HOT A;  3TW7 A;  1TWC J;  4A3J J;  2KDZ A;  1P7J A;  1A6I A;  2NS7 A;  4A3I J;  3TW6 A;  5F27 A;  1IJW C;  3HGY A;  1JJ6 C;  3IH3 A;  3JRB A;  1JKQ C;  1FIA A;  4D5C A;  2IEK A;  1VFC A;  3BT9 A;  5E3O A;  5EG0 B;  3I4N J;  1RPW A;  2E1O A;  4JX6 A;  1B8I A;  4JX5 A;  5M5X J;  1ZKG A;  2ID3 A;  2EBI A;  4B3A A;  3BR2 A;  4JX4 A;  4AUX A;  2L7Z A;  2M8G X;  1BW6 A;  3D1N I;  5F1J A;  3HM5 A;  2DA5 A;  1H89 C;  5FKL A;  4DZJ A;  1W0U A;  1G2H A;  4XID A;  1A5J A;  3RKQ A;  2ELK A;  1BW5 A;  1O4X A;  2DMP A;  4MFE A;  2VUM J;  2EZI A;  2R5Y A;  2LP0 A;  1IGN A;  5F0C A;  5M3F J;  3FIW A;  2E2H J;  3A03 A;  4L5E A;  5BNG A;  4AC0 A;  2RAE A;  3CDL A;  1H88 C;  5HOD A;  2HYJ A;  4BY7 J;  2JWT A;  3MKL A;  3S1N J;  3JRH A;  1ETY A;  3S1R J;  3VPR A;  1P7I A;  1WCM J;  1YRN A;  4FE7 A;  2O7O A;  3IH4 A;  3HOV J;  5EZG A;  3SDG A;  5IYB J;  1IV6 A;  2ZB9 A;  2CUE A;  1TWH J;  2DJN A;  1JTY A;  1WH5 A;  3OIO A;  4V2G A;  1Z77 A;  5J1U A;  1HDD C;  5E3N A;  1XS9 A;  3GTP J;  1ZTR A;  5FKN A;  4A3D J;  1ORK A;  3S1M J;  2L0K A;  3ZQI A;  2WAQ N;  2AHQ A;  2DA6 A;  2DTZ A;  5M3M J;  1Q1V A;  3JRI A;  1LFB A;  3TP3 A;  4XIC A;  4A3B J;  4CYC B;  4Y7N J;  4FTH A;  5FLV A;  5J3L A;  1RES A;  1JT6 A;  3LSJ A;  5EDN A;  2E19 A;  2K9N A;  5EG0 A;  1IRZ A;  1MBK A;  2JJ7 A;  2JK3 A;  1AKH A;  1FTT A;  1QVU A;  1QVT A;  4D7N A;  1I3Q J;  2WV1 A;  3PM1 A;  3S16 J;  1OFC X;  2FX0 A;  1TC3 C;  4BBR J;  2TRT A;  2LR8 A;  3S14 J;  4A93 J;  5F04 A;  2LFB A;  1QPI A;  5C4X J;  1ZR2 A;  3IV5 A;  5GPA A;  1POG A;  4D7M A;  2X48 A;  3HOU J;  3Q0U A;  4M3D A;  2N8G A;  1SFO J;  2Y2Z A;  1YRN B;  1ZK8 A;  5IPA A;  2W48 A;  1GDT A;  4A3E J;  3WHC A;  4W1U A;  5M5Y J;  1HDP A;  2AO9 A;  1IC8 A;  5M5W J;  3C2B A;  4XRS A;  3BTJ A;  3HGG A;  1AU7 A;  2JA5 J;  2DMQ A;  1GUU A;  3W6V A;  2NVY J;  3BTL A;  4XK4 A;  4QTR A;  1ETV A;  4QIW N;  1JUM A;  1MBJ A;  2ID6 A;  1LE8 A;  4Y52 J;  3LOC A;  1SAN A;  1MBG A;  1HCR A;  1E3O C;  3TED A;  1ETW A;  3LSP A;  5JLX A;  1FJL A;  2XPW A;  1X2M A;  4RDU A;  3BR3 A;  3SJM A;  2QF7 A;  2GLO A;  4B1R A;  3LSG A;  1AKH B;  4BBS J;  2XGC A;  2LD5 A;  1PUF B;  2JMW A;  2DA3 A;  1JGG A;  4MLO A;  3FK7 A;  2DA7 A;  3WHB A;  5IYD J;  3NAU A;  2Y9Y A;  4CYC A;  4IEJ A;  2NVX J;  2GBY A;  3HOX J;  2HOA A;  3JRE A;  5E3M A;  2OPT A;  1Y1W J;  2E2J J;  2X9D A;  5FKM A;  3DEW A;  5K7H A;  2IAI A;  2I10 A;  2E2I J;  4BXX J;  3M3Y J;  5E3L A;  3LSR A;  1VI0 A;  3BG5 A;  4MFD A;  1MBF A;  3ZQG A;  3Q3S A;  3I4M J;  5EEA A;  2VKV A;  1WH7 A;  1ZGW A;  2L7M P;  1I50 J;  2R93 J;  3S17 J;  2XGE A;  3DCF A;  3GTG J;  2YS9 A;  3O8G A;  1NK2 P;  1BJZ A;  3JRF A;  2Y30 A;  4M6V A;  3UKG A;  1LE8 B;  2DMN A;  5IP7 J;  5FLM J;  5J1R A;  3S2H J;  2EZL A;  2HXO A;  2PMZ N;  1X2N A;  2EQR A;  3JRC A;  1IG7 A; 
#chains in the Genus database with same CATH topology
 4UY8 I;  4IHW A;  2L02 A;  2WB1 N;  3OYI A;  3OOU A;  1OCZ H;  4NDL A;  4P5O A;  2Z33 A;  3L1P A;  1XB4 A;  1F36 A;  2UV1 A;  4M3G A;  1T39 A;  5DUI A;  1U9N A;  2DLL A;  2CV0 A;  2XHK A;  3I9V 2;  3FIS A;  3GFL A;  1X1C A;  4CCM A;  4HLY A;  2LF8 A;  3LSH A;  1XPX A;  2GXA A;  3TDZ C;  2BGC A;  2UXN A;  2VT2 A;  2X4H A;  5HDN A;  4GRI A;  1WI3 A;  2JRT A;  5IP6 A;  1FTZ A;  4S0H B;  4LG0 A;  2HOS A;  3R4K A;  2R7U A;  2K85 A;  2BV6 A;  2X6Y A;  2B63 J;  3BOQ A;  2VOD A;  1D5Y A;  3RSN A;  3HOS A;  1HST A;  2DFF A;  2XF6 A;  3WTZ A;  1T98 A;  5E1W A;  1PUF A;  2ZXJ A;  2BE5 F;  2CW8 A;  1FY7 A;  1S9H A;  2W24 A;  1QBJ A;  2JN6 A;  4KT5 C;  3BQZ A;  1OCT C;  3MMY B;  5KNL A;  2MW8 A;  1IV8 A;  5HVQ C;  2AXT C;  3MD2 A;  4KDP A;  2MA3 A;  4A3G J;  4I7H A;  1W7P B;  1MNE A;  1S3J A;  4C9Y A;  1MSF C;  5HLG A;  1U8B A;  1U8R A;  2DBB A;  4QPO A;  4L9V A;  4MIM A;  1BC8 C;  4XLE A;  1TT5 B;  2EV6 A;  4FX0 A;  3U9G A;  2QGU A;  1UB9 A;  4D5F A;  3ABU A;  2LF7 A;  4BY1 J;  2LDU A;  1FSH A;  1IRF A;  2DDB A;  4XLN F;  4OWR B;  4CSW A;  2D5V A;  2JA6 J;  1LDD A;  4LLG F;  1V5E A;  2NRA C;  3LA2 A;  3BDD A;  5EGO A;  3DKY A;  3OSG A;  3RQI A;  2QCO A;  4CYD A;  2DT6 A;  4PJN A;  5FGM A;  4B3X A;  2C6Y A;  2H09 A;  4YRV A;  2XB0 X;  1CGP A;  1Y0U A;  4JBA A;  1BIB A;  2OCE A;  2P7V B;  3HSE A;  1I6X A;  3E6C C;  3OWT A;  1DGR M;  5LEJ A;  4OAY A;  4X0G A;  3PNV A;  5LHI A;  1ON2 A;  1P2F A;  3JAM K;  2YU3 A;  1R7J A;  4BE0 A;  2R7D A;  3BG7 A;  3SHF A;  5K7F A;  2M2E A;  1G3S A;  3ML6 A;  1YJ9 I;  4BHB A;  2R7Z J;  2PMH A;  5DM6 F;  2XVC A;  1RR7 A;  1UZC A;  2K3F A;  3F3X A;  1HOM A;  2W4S A;  4KNY A;  1JUS A;  1YQA A;  4A12 A;  1BJA A;  3QU6 A;  1K4T A;  5FRN A;  4Y4R A;  2B7E A;  3TP0 A;  4F52 A;  1WPK A;  2XV4 S;  2TCT A;  4RM3 A;  2M30 A;  2VJ5 A;  3SYT A;  3S2D J;  4RAF A;  3V8K A;  4J01 A;  2Q0O A;  1LFP A;  3GYH X;  4BJ6 C;  2QA4 I;  2YU9 J;  2GIZ A;  5CJ9 A;  4A3L J;  2VI6 A;  3W3C A;  2PJP A;  1E0E A;  5BOX A;  2UXX A;  3QYE A;  3ZMS A;  3GO5 A;  4ZJZ A;  4RM2 A;  3E6D A;  3T1B A;  2IS2 A;  3KYC B;  4LFU A;  4EAT A;  1UHS A;  3O8H A;  4F7Z A;  2QEX I;  1YFH A;  2WY7 Q;  4NQW A;  3CES A;  5ICF A;  3IRR A;  1YG2 A;  1RIO H;  3R0J A;  2DPD A;  2ZXW H;  1JKO C;  3K2Z A;  3E5X A;  2NNY A;  3BR1 A;  3F22 A;  3IP4 B;  4FQG A;  3RCO A;  4BE2 A;  4HX4 A;  2I5U A;  2IT0 A;  3VB2 A;  2Y0S N;  2QVO A;  3CCE I;  2MAB A;  3CUQ A;  4XON A;  4IO9 F;  2A61 A;  3LL7 A;  4KJZ A;  1XMK A;  3HEF A;  2XSD C;  2GXG A;  1OPC A;  2Q8K A;  2LY1 A;  5FO5 A;  4MEY F;  2CS3 A;  2M9H A;  1T0F A;  2K4J A;  2HFH A;  4HNV A;  4UB6 C;  2H6B A;  4L0Y B;  3MKZ A;  3LQR A;  1UST A;  1IXS B;  1MBH A;  2KRH A;  4ZYH A;  2XGD A;  1EH8 A;  2HYF A;  4AID A;  3LFU A;  1RUO A;  3K4L A;  3MVP A;  2IS4 A;  4Y17 A;  3D5L A;  1LDK B;  1A31 A;  2K9Q A;  2F5V A;  4G9Y A;  3MWM A;  3HSF A;  5J1Y A;  3S3M A;  4HV6 A;  3CMY A;  1D0Y A;  4G6D A;  4E7I A;  4OMY A;  1V3F A;  2HZD A;  3PFY A;  3PQK A;  2E34 A;  1FLI A;  3JRG A;  2Z99 A;  5DV5 A;  5IT9 Z;  2KQR A;  4PFP A;  1Z6R A;  1KU9 A;  1X58 A;  4G7H F;  4X6A J;  4LJZ F;  1OJL A;  1UAA A;  2K9L A;  2XUB A;  2RN7 A;  4E4H A;  3J80 K;  3COA C;  2QQ8 A;  1RUN A;  3LWF A;  3JW4 A;  2DAO A;  1O7F A;  5F08 A;  3GTQ J;  4IVN A;  1BIA A;  4L5I A;  5DCM A;  4A0Y A;  5IT3 A;  4LLL A;  2F48 A;  3ASN H;  3MKW B;  1TNT A;  2QWW A;  2VQC A;  2JQ7 A;  2CQQ A;  2V6C A;  2BHY A;  1AHD P;  1X3Z B;  3SZT A;  2VC0 A;  3QYB A;  3H3U A;  4EMS A;  1S7E A;  1SVL A;  1ITY A;  2HXI A;  2K4B A;  4P9F A;  2EFN A;  4PCQ A;  1LB2 A;  3AL0 B;  4IZZ A;  4BEH B;  3OYA A;  3BTC A;  4YFN F;  2DW4 A;  3T8R A;  1Z9C A;  4M3E A;  1D5V A;  3IUO A;  2XAF A;  3TW7 A;  2FOW A;  4RMN A;  2PMU A;  1A6I A;  3BLY A;  1W4M A;  1O57 A;  1XGM A;  3F9K A;  4A3I J;  4KIG A;  1HKQ A;  2LBF A;  2ADU A;  5D4R A;  3IH3 A;  4UHT A;  2PMZ A;  4JOM A;  1RPW A;  1N77 A;  5LHH A;  3I54 A;  1FPQ A;  2ID3 A;  2MD0 A;  2GOX B;  3NWS A;  2EBI A;  3TL4 X;  2GA1 A;  4B3A A;  4JX4 A;  4YFK F;  3GZ5 A;  4IPA A;  2M8G X;  2W57 A;  3HUG A;  3HM5 A;  5KCM A;  1NH3 A;  2ZXH A;  1Z3X A;  4XRF A;  4EGZ A;  4ZZD A;  2O61 A;  5TJJ A;  4DZJ A;  1W0U A;  2V1D A;  3FHN A;  4HPQ A;  4XKW A;  3U1K A;  2ELK A;  3SDB A;  1R4N B;  5FFZ A;  5AIP A;  1W36 D;  2DQR A;  2DMP A;  3M8J A;  4KYW A;  2R5Y A;  2LP0 A;  2R7F A;  4PDK A;  3GX4 X;  4ETS A;  4C2T A;  3F6O A;  1WJD A;  1OCO H;  1RI7 A;  2P4W A;  3RQ4 A;  3WG9 A;  1FYM A;  4NB5 A;  3NQO A;  1STZ A;  1S29 A;  4L5E A;  3QWL A;  3VOD A;  2XIG A;  2XAH A;  1H88 C;  1GXQ A;  4BY7 J;  3WU2 C;  2VQL A;  5J8C A;  1KU7 A;  1LEA A;  4LK0 F;  2PEX A;  3VPR A;  2GAU A;  4FE7 A;  4BHC A;  2O7O A;  2MYS A;  3T5X A;  3HOV J;  4EJO A;  5IYB J;  3WOD F;  4E6K G;  2DYR H;  5L3G A;  1MMS A;  2LC2 A;  3OR1 C;  2KMU A;  1TWH J;  1JTY A;  2HDC A;  1WH5 A;  4WWC A;  2DOD A;  2F5D A;  3NRV A;  4II3 A;  4V2G A;  4AD9 A;  4N4O B;  2W00 A;  1T08 B;  5E3N A;  5FKN A;  2W85 A;  4A3D J;  4XOR A;  1KA8 A;  1W7P D;  2MH2 A;  4L9T A;  3ZQI A;  3IHU A;  4HF1 A;  2IW5 A;  4LGW A;  5M3M J;  5LD2 C;  3G6E I;  1LFB A;  2EIJ H;  3NWT A;  4UV9 A;  1U0J A;  1VQO I;  4A3B J;  3FXQ A;  4CYC B;  1A6Q A;  4Y7N J;  3HJE A;  3G73 A;  4FTH A;  1O3R A;  3KIO A;  3LSJ A;  1IUY A;  1QPM A;  3OYM A;  1MBK A;  1KZH A;  4BU2 A;  2BY1 A;  2W7N A;  2JK3 A;  2RNJ A;  1AKH A;  5EEG A;  3LST A;  4D7N A;  2P7C B;  2X6X A;  1I3Q J;  2WV1 A;  3S16 J;  1PP8 F;  2TRT A;  2EFP A;  2LR8 A;  2BVM A;  3S14 J;  5F04 A;  2LFB A;  3F8C A;  4P96 A;  1YLF A;  3IV5 A;  3CJT B;  3F8B A;  1B4A A;  4D0P A;  1YYV A;  3GWZ A;  2XRO A;  4D7M A;  2V9K A;  3V8L A;  1FX7 A;  4M3D A;  4MTE A;  3ESW B;  2GQQ A;  2M45 A;  1VQL I;  3F6V A;  3CTA A;  3FBN B;  5M5Y J;  1HDP A;  2MBF A;  1XSV A;  5CKT A;  3C2B A;  3FZV A;  3RJP A;  1VQM I;  1I39 A;  5FB2 A;  5E8G A;  3I0T A;  2IXS A;  2ZBK A;  3ZXS A;  3PNT A;  1AU7 A;  1ZRC A;  1R00 A;  2A5Y B;  2I8D A;  2DMQ A;  4HG2 A;  3FMQ A;  3KLN A;  4M6Y A;  3L2Q A;  3K4N A;  2M1B A;  3HKZ A;  3KEQ A;  2G7U A;  4B47 A;  3MKY B;  2WV0 A;  2ZME A;  3O3K A;  4L18 B;  4RB2 C;  1FT9 A;  2VQG A;  2W25 A;  4CXF A;  1R1T A;  4FHT A;  5JLX A;  1FJL A;  3OYB A;  5JFR A;  2CQK A;  3BR3 A;  1J2X A;  3TKY A;  2PFB A;  1BR1 A;  5F6F A;  2R7Q A;  4YII A;  4BBS J;  2HZT A;  2JPC A;  1ACI A;  4ITV A;  1MJ9 A;  1PUF B;  1WJB A;  1TW3 A;  3AAF A;  2DA3 A;  3CP8 A;  3WHB A;  2EPF A;  4LLN A;  3ZRG A;  3G4S I;  4KA4 A;  1X1B A;  1XMX A;  1G3T A;  2Y9Y A;  4M6X A;  3LMM A;  3EYI A;  5KK1 A;  4KIF A;  2NVX J;  4R8H A;  5H6Q A;  3CO7 C;  1N75 A;  1TQI A;  3JRE A;  1R36 A;  4M73 A;  2OPT A;  3DTK A;  2NNN A;  1HQC A;  4ZDL A;  2XRN A;  5HS8 A;  2E71 A;  5B66 C;  3FM5 A;  1KON A;  2ZJR F;  3VDX A;  2CQN A;  4ZYE A;  1FNN A;  2Z16 A;  2E2I J;  3CDI A;  3L9F A;  4BXX J;  4FET A;  3IRQ A;  2DPU A;  3T0Y A;  3LSR A;  3WU1 B;  2XKP A;  3ZQG A;  3WTS C;  2HS5 A;  5EEA A;  1WH7 A;  3KP2 A;  1I50 J;  2E1M B;  2XF5 A;  1R49 A;  1FZP B;  4KFC A;  3DU5 A;  3TO7 A;  3GTG J;  1MND A;  2LH9 A;  2R7V A;  3FXM A;  2YS9 A;  3FMR A;  3O8G A;  3OIQ A;  1N25 A;  3JRF A;  3HXL A;  4M6V A;  3UKG A;  4II2 A;  2DMN A;  4PFO A;  1OKR A;  2FBH A;  2JPB A;  3R61 A;  5J1R A;  4A2U A;  2VL8 A;  3RYP A;  1RNL A;  1X2N A;  2EQR A;  4EJU A;  4IQ4 A;  2DK5 A;  1LDJ A;  4PZJ A;  4QWQ A;  4CZC A;  3JR9 A;  1GLN A;  2FMY A;  3RPU D;  1EJ9 A;  4IHV A;  3FDY A;  4A3M J;  4ZYG A;  2STT A;  2VBW A;  3DBH B;  4RLF A;  1DP7 P;  4DJA A;  3H1C A;  1FIP A;  4UVC A;  4B48 A;  2ME0 A;  3PJR A;  2V1N A;  4RB3 C;  3DEE A;  2WTE A;  4DBR A;  1ZRD A;  4CCK A;  2YSR A;  1EH6 A;  2BY2 A;  2HVQ A;  4Z6Y A;  1UG0 A;  1YW7 A;  3MQ0 A;  3RKW A;  5IYC J;  4WX9 A;  2IBD A;  3K0L A;  2BZT A;  1JJ8 C;  4HAM A;  1WJF A;  4HA8 A;  5ILU A;  3H9Q A;  3DPU A;  2DOA A;  3WTY C;  5LFA A;  2EIL H;  1TWA J;  3HOT A;  4E7S A;  2EZH A;  2KPM A;  1S5L C;  2VN2 A;  2XAQ A;  2M7A A;  5ILV A;  3I4P A;  4XSZ F;  3SFI A;  2HKX A;  4GO1 A;  4WXD A;  4BAY A;  2QSH X;  1E3H A;  5H20 A;  1SD5 A;  4ZTJ A;  4F92 B;  1VTN C;  4DBQ A;  2R5Z A;  2F5E A;  3LAP A;  4U7D A;  2DOE A;  1MKM A;  2HNH A;  2ISY A;  4QLC U;  5LRS A;  1LPQ A;  2QSG X;  1H9G A;  1RC9 A;  3FKJ A;  3K1P A;  4G12 A;  4GXO A;  1F1Z A;  2OU2 A;  4NNJ A;  3CCR I;  2OTJ I;  3KEO A;  3BY6 A;  1YTY A;  3O2P E;  2IA2 A;  1I6H J;  2DT5 A;  2E5Z A;  2PQ8 A;  5HNH A;  2LMD A;  3KP6 A;  1A36 A;  3QYF A;  4C3I J;  2UZK A;  3OYN A;  2P5L C;  1IUF A;  2WA0 A;  4UUS B;  5GAG J;  4I02 A;  5IOY A;  2RRE A;  2YUS A;  1D0Z A;  2NS8 A;  2XPV A;  3HDD A;  2XGX A;  4XOT A;  5TIS C;  4XNF A;  4RGX A;  5EZH A;  4R79 A;  2X6O A;  3M7G A;  3UR3 C;  4BQN A;  1KYW A;  2B9S A;  4IF4 A;  4BDZ A;  1H9T A;  1QA6 A;  1R71 A;  1K78 A;  3ZMV A;  3JAM Z;  1Z21 A;  1V5G A;  2LOO A;  4V2F A;  5K5Q A;  3WE3 A;  2L2O A;  1S8N A;  2K3P A;  4KN7 X;  2VKE A;  1I27 A;  4CCO A;  1OCP A;  3KET A;  1QGP A;  1XDS A;  3RKY A;  4J19 A;  1P4W A;  2BXZ A;  1J7K A;  3P9I A;  5LHG A;  1BI2 A;  1DU6 A;  3ECH A;  1FBU A;  3LSI A;  5D8L B;  5E18 F;  1WJA A;  1RKW A;  2EFO A;  1V4R A;  1X1P A;  3JTG A;  3N97 A;  2ZKZ A;  2JA8 J;  2CV1 A;  5FKO A;  4MNU A;  4XBF A;  4PGH A;  4IOA F;  2F5F A;  2FJ1 A;  4IL6 C;  1WHU A;  2DK8 A;  1O7L A;  2DMT A;  1S7O A;  1SMY F;  1UG2 A;  3CZ6 A;  2X1E A;  1OMI A;  3IWF A;  2ACJ A;  1S6L A;  2F4O B;  2LG4 A;  2OCC H;  4UUV A;  1PDN C;  3CF5 F;  2K9S A;  1BL0 A;  4G6T B;  4IHT A;  1V5F A;  1SVM A;  2EJR A;  2KZV A;  1Q1H A;  2F4M B;  3AG4 H;  1IXR C;  4ENK A;  5FKK A;  1ETX A;  1D1B A;  1X19 A;  1CF7 A;  5FFX A;  1B6A A;  3FKI J;  2LYC A;  1T33 A;  3S32 A;  5B5E C;  1SEU A;  3A01 A;  3M4O J;  4H4K C;  3I64 A;  2XDV A;  3BZK A;  4AYB N;  1IRG A;  4KIC A;  2LKX A;  2KFD A;  2CFX A;  1ZGA A;  3ZQF A;  2AXL A;  2OC6 A;  1Z0X A;  5CPR B;  3PO2 J;  1U6G A;  3I56 I;  1XGS A;  1TZL A;  3ZQC A;  3WTX C;  1LEB A;  3SEQ A;  1PP7 U;  1VQ4 I;  2FQ4 A;  3V7R A;  2Z3Y A;  1MH4 A;  1TQM A;  2OBP A;  2L9V A;  3OY9 A;  3BG3 A;  2F6C A;  2MC3 A;  4HQE A;  1U78 A;  2DJI A;  3ECO A;  5JHU A;  2KJC A;  1JE8 A;  4XLC A;  2PJR A;  1ETK A;  1NG6 A;  3OYL A;  5JLW A;  4EVI A;  1E3P A;  1XG1 A;  4Q4Z F;  2QBY A;  5CVI A;  2JZY A;  4BQO A;  3GTO J;  4FT8 A;  4LK1 F;  1UFM A;  5JR3 A;  4XLF A;  2ICW G;  2P8T A;  1BR4 A;  2LNB A;  3ULQ B;  1UCR A;  2DFH A;  2Q2E A;  4RLQ A;  3DU6 A;  1TLH B;  1B72 B;  3HHG A;  2FD5 A;  4KIS A;  4HW0 A;  2R5Y B;  3CME I;  1G3Y A;  4ENN A;  3MZY A;  3CLQ A;  4XSX F;  1R58 A;  3SFZ A;  3CQZ J;  4BL0 B;  1Z6T A;  1GT0 C;  1EKE A;  1F43 A;  3J80 Z;  2H1K A;  4E7Z A;  1IDZ A;  2XAG A;  2JTV A;  1ZRE A;  3KP5 A;  1HBX G;  1FC3 A;  3P9K A;  3QOP A;  3DFG A;  1MZB A;  2OQG A;  2FF4 A;  3KZI C;  4Q47 A;  3BG6 A;  3CMM A;  3GTM J;  2AS5 F;  3NAR A;  4MQV A;  5D6E A;  4DYR A;  2CSO A;  1LQ1 A;  1KU3 A;  1FOK A;  3AL0 C;  1BI0 A;  1OYI A;  3O6B B;  4HEA 2;  2HKO A;  2IA0 A;  3BTI A;  5IY5 H;  3LAJ A;  6PAX A;  5IP9 J;  4G8X A;  1WZ2 A;  1J59 A;  4BQA A;  3DV8 A;  2HOT A;  1U2W A;  3A4C A;  3B73 A;  2KDZ A;  2ZJ2 A;  3I3L A;  2V7F A;  3TW6 A;  5B1B H;  1JKQ C;  3DKW A;  2IEK A;  4H0E A;  1VFC A;  5BPD A;  2E60 A;  2R7O A;  3BJO A;  3QAH A;  2OZ6 A;  2KIS A;  4BGD A;  2E1O A;  3TDU C;  2WAF A;  3AFH A;  4V19 K;  5J47 A;  4ANJ A;  4LB6 B;  5M5X J;  2OAZ A;  3OR2 C;  3LSK A;  2L9N A;  3ASO H;  1HXD A;  2L7Z A;  3H9J A;  3KLO A;  3D1N I;  3VEP A;  3ZN0 A;  1XDU A;  1P92 A;  3I59 A;  2DA5 A;  3TO6 A;  5FKL A;  1G2H A;  2MLG A;  3H35 A;  4XID A;  3OS0 A;  4HDV A;  3C7J A;  3RKQ A;  3CCM I;  5L3B A;  1MW7 A;  4WCG A;  1WJ5 A;  5DD8 A;  1OQY A;  4OIN F;  1IGN A;  3J81 K;  1J5Y A;  2L7K A;  2OJE D;  3FIW A;  3N4M A;  5K5R A;  2WC2 A;  5BNG A;  3V4G A;  1OYW A;  1O3S A;  3D5R C;  4AM3 A;  2EIM H;  3CDL A;  2QQ9 A;  3MKL A;  1X1D A;  2KKO A;  3K69 A;  5HS9 A;  2PN6 A;  3JRH A;  4EJT A;  4WXH A;  4NC7 A;  2HU9 A;  3S3N A;  1WCM J;  4M74 A;  3HG9 A;  1F4K A;  1R5H A;  2V79 A;  2W1O A;  1L3L A;  3CC2 I;  1DUX C;  2YPR A;  1XGO A;  2ZME B;  4CZZ A;  2V26 A;  5E20 A;  2ZB9 A;  3VWB A;  2CUE A;  3BZ6 A;  3RIR A;  3S93 A;  2VQH A;  4BAC A;  3QPH A;  2PI0 A;  3OIO A;  2H27 A;  3HC7 A;  2DOF A;  4HOB A;  2FE3 A;  4XQF A;  3D5S C;  1FSE A;  4YIR X;  1HDD C;  1H0M A;  3BZC A;  1IAW A;  3S1M J;  2L0K A;  4IXA A;  2R7W A;  2AHQ A;  2DA6 A;  1QNT A;  2DTZ A;  1G8X A;  5FD5 A;  3KP7 A;  1SC7 A;  2BY0 A;  3WGH A;  1D1A A;  5E8I A;  1QQI A;  4CA0 A;  2MLK A;  2LY2 A;  3GXO A;  2VJ4 A;  3FXU A;  1WJE A;  1RZ4 A;  3M8E A;  5FLV A;  2BOL A;  2QQA A;  1JT6 A;  1GXP A;  1PUE E;  2E19 A;  1IRZ A;  1KQ9 A;  1QHG A;  1TP4 A;  3FF5 A;  1LUJ B;  1QVU A;  1QVT A;  4IHS A;  1GVJ A;  1BBY A;  2W84 A;  1IXC A;  2R4G A;  1SVO A;  3IKT A;  2FX0 A;  2OA4 A;  4A93 J;  1QPI A;  4I09 A;  5H2F C;  2VLA A;  5TGT A;  3K4J A;  1POG A;  3CF2 A;  3H92 A;  4XMY A;  2Y69 H;  3FX3 A;  4LIU A;  5E1X A;  3Q0U A;  1A35 A;  1KGS A;  2WAD A;  1YRN B;  2M5W A;  2LRD A;  2W48 A;  1G3W A;  2MH9 A;  1GDT A;  1ZGJ A;  1R1V A;  2VJI A;  4A3E J;  2D1V A;  3E6M A;  4W1U A;  1HKS A;  1ZN2 A;  2LRE A;  4XR6 A;  2AO9 A;  1SFE A;  4IKF A;  2BXY A;  3ABM H;  1KYZ A;  2HPM A;  2K27 A;  2X1C A;  2V1U A;  1FOY A;  1WVR A;  3BTJ A;  2FBK A;  1ZEL A;  1K6O A;  2V4J C;  2JA5 J;  4B8X A;  2QKL B;  1YS6 A;  1FBQ A;  2CFO A;  3BTL A;  1ETV A;  3BJ6 A;  1JUM A;  2EWN A;  4QIW N;  1LE8 A;  3ZGK A;  2NXN B;  2HWV A;  2MFZ A;  4EJW A;  2JRM A;  2JSP A;  1ETW A;  3M1C A;  3CCV I;  4RA2 A;  3TED A;  2DCE A;  4EQQ A;  1X2M A;  4RDU A;  3SJM A;  5FRM A;  2X6W A;  1QO0 D;  1FBS A;  1S7A A;  2XGC A;  5L3C A;  3TBI A;  1LJ9 A;  3FK7 A;  3CCU I;  2DA7 A;  4GCV A;  3VOE A;  5IYD J;  1VQ8 I;  2BEO A;  3K1N A;  2ZJQ F;  2K86 A;  5DDG A;  3WGI A;  4HNT A;  3FBI B;  2ZXI A;  2GBY A;  3SXY A;  5E3M A;  5JVG F;  1IO2 A;  4I2O A;  1JHF A;  4I0A A;  4BYY A;  1R6R A;  4BQQ A;  2I10 A;  1OCC H;  4PGG A;  1K79 A;  2VPL A;  4BUP A;  3V42 A;  1R5I D;  4BJT A;  3U1D A;  2HTS A;  3MFK A;  4XOP A;  1TT0 A;  5CVU A;  1MBF A;  2CW7 A;  5D5X B;  1ZGW A;  1VQ6 I;  1I5Z A;  2E1M C;  3BP8 A;  2R93 J;  1W7P A;  2XGE A;  3DCF A;  3P5J A;  1U5T B;  4KMU X;  3WG7 H;  1TNS A;  5FLM J;  3GUD A;  1GHC A;  1F9N A;  1NHA A;  3P7N A;  3OYG A;  5BPI A;  3DWL E;  2J5O A;  2O0Y A;  2PMZ N;  3JRC A;  1HW1 A;  3EQL F;  1IG7 A;  4LIV A;  4U0V A;  3W2V A;  2K40 A;  5HDG A;  5A2Q Z;  3W2A A;  1GV5 A;  1MMD A;  3HOW J;  3VYT B;  2FOK A;  1IN7 A;  3WU0 A;  4A3F J;  1MBE A;  1K78 B;  3EUK L;  3QQA A;  1TWG J;  4EM2 A;  1YI2 I;  1WI9 A;  4YG2 F;  4TV7 A;  2M4G A;  1BA5 A;  1HW5 A;  5FLX K;  1XGN A;  4U87 A;  4AVZ A;  3ZN1 A;  3OYF A;  2R92 J;  5L3F A;  1U3E M;  3QPS A;  1JKP C;  1AA7 A;  3GFM A;  3HPG A;  4NHJ A;  3QP5 A;  4OIP F;  1YIT I;  4BKX A;  5GTH C;  4BDY A;  4DYQ A;  4PK4 A;  1Z1D A;  5J6X A;  4O5V A;  3HBL A;  2FEZ A;  1E17 A;  2LKP A;  5GAD J;  3BPX A;  5DD4 A;  2DU9 A;  4X1E A;  5EF6 A;  2X0L A;  4NC6 A;  1IN5 A;  2IRF G;  5E17 F;  5DUK A;  3RKX A;  2JVH A;  1B59 A;  3H3V K;  3ONQ A;  2OF7 A;  2VON A;  3L2R A;  3HOY J;  2RQQ A;  1ZQ3 P;  1T2K A;  4D9J A;  3LFK A;  4Z2Y A;  2JA2 A;  3S2W A;  2DA4 A;  3GFI A;  1CF7 B;  1R9T J;  3HB9 A;  2L54 A;  4UUT A;  3PUF A;  4QSH A;  2ETH A;  3A01 B;  2ZNZ A;  1FYL A;  4ESJ A;  3QRF F;  3I5U A;  2UWM A;  1VQ9 I;  2DI3 A;  3ZR8 X;  2R0Q C;  3R60 A;  2VJJ A;  3K2A A;  4LOC A;  3K9T A;  2EFW A;  2VC1 A;  2QZ8 A;  1K61 A;  3HOZ J;  3DF8 A;  3ABL H;  4AU7 A;  4LG0 B;  1TL8 A;  4HST A;  2XF7 A;  4GGG A;  3PFI A;  3Q9S A;  3ZP5 A;  4KIB A;  2M3A A;  3F0C A;  2VB6 A;  2H8W A;  1TWF J;  4N9I A;  3ZCO A;  5L3E A;  2M0C A;  1VZ0 A;  3FHZ A;  1MMA A;  1UMQ A;  5GAH J;  3BG9 A;  4LD5 A;  4M9X A;  2HI3 A;  3FXJ A;  5CQE A;  3ZQH A;  4HF2 A;  5F0H A;  3RZO J;  3K7A J;  2DA1 A;  1XD7 A;  4MQ9 F;  3Q0V A;  1JXS A;  3TOA A;  1VQN I;  1R4M B;  4JP0 A;  5J40 A;  3E0J B;  1Z91 A;  4XKV A;  2OQR A;  2TDX A;  3KX2 A;  4ESF A;  1UJ8 A;  3OL3 A;  3GBG A;  5D5U B;  1IDY A;  1ERD A;  3GTJ J;  3CCY A;  5CYV A;  1ETQ A;  3ZMU A;  3S3O A;  3RPU A;  2LKS A;  3BR5 A;  2VT3 A;  3OIP A;  1RKT A;  4A0X A;  2AQE A;  2K5C A;  4O3M A;  3HKZ N;  1XTA A;  3AG2 H;  5EGO B;  4LB5 A;  3K6G A;  5F0F A;  2OZU A;  3GW2 A;  4B4C A;  5JI6 A;  1ZR4 A;  4Y13 A;  3TMO A;  1IF1 A;  2H8R A;  4AIJ A;  3W2W A;  1QZE A;  5HLI A;  2Z1D A;  5A2Q K;  1WJC A;  3ZMD A;  2HOE A;  3GLL A;  2VOP A;  2EIK H;  1E2X A;  3C3W A;  1YOV B;  2EFQ A;  4CUG A;  3QPL A;  2BHZ A;  5C4J J;  2GM4 A;  2HYG D;  4IJA A;  4FAS D;  3K4M A;  3BCB A;  3R6S A;  2Z5U A;  1GV2 A;  4OAZ A;  1APL C;  4KIT B;  5HDK A;  5BMZ A;  2WY8 Q;  3PIO F;  2ESH A;  2STW A;  4BEH A;  2A6E F;  3KZY A;  3QPT A;  3JRD A;  1R22 A;  3HL2 A;  1MJA A;  2COB A;  4G94 A;  1XCB A;  2EZK A;  4WK8 F;  2LTP A;  4CHU A;  2IS1 A;  4W97 A;  4U0Y A;  3I58 A;  1REP C;  4IHX A;  4FCY A;  3CUO A;  2CRG A;  2CUF A;  1RR8 C;  1JKR C;  4HRI A;  1LVK A;  2CU7 A;  1BOB A;  2A6T A;  3DTI A;  1ONV A;  4IOC F;  1ZYR F;  5EJC A;  3OOP A;  3OYC A;  3AG3 H;  1T56 A;  3RZD J;  4HNU A;  2VE9 A;  4NQW B;  1Z3Y A;  2E36 A;  1VF9 A;  3BR6 A;  1JT0 A;  1UHW A;  2HVS A;  2QLZ A;  2NVT J;  2JT1 A;  3PO3 J;  1T8I A;  2QYO A;  3G1L A;  4ENJ A;  3REO A;  3BQY A;  4PJJ A;  1MIJ A;  1TW2 A;  1MD0 A;  4A3C J;  2X51 A;  2L7F P;  3CUQ B;  2DMU A;  3M8F A;  2DN0 A;  4FE4 A;  4C3H J;  1UEL B;  4XRS G;  3RPQ A;  4GDF A;  4HV5 A;  1DP3 A;  4XLA A;  2FRH A;  2Z9O A;  4CCN A;  2RNG A;  4HX8 A;  1NTC A;  2NVQ J;  2ZCW A;  3KE2 A;  5GTI C;  2O8K A;  2CMP A;  1OR7 C;  4RBO A;  5GPC A;  3HYI A;  3FM3 A;  5C3E J;  3Q0W A;  2KDO A;  3AKZ A;  2QQB A;  5CLS A;  2ZC2 A;  3TO9 A;  3K4K A;  2M34 A;  2DYS H;  1W0T A;  2CQX A;  2IGO A;  1EA3 A;  2DO7 A;  2GZW A;  4I99 C;  1VQP I;  2IS6 A;  1UHM A;  5EYR A;  5D8K B;  1HW2 A;  3EUH C;  4A3J J;  1ZAR A;  1P7J A;  1BOA A;  1R1U A;  3VYR B;  1J09 A;  4RGU A;  4U88 A;  5F27 A;  3TOB A;  3HGY A;  1Y6I A;  3JRB A;  1B1B A;  1OLT A;  3FXK A;  2OTL I;  2XAU A;  3X2Q H;  5E3O A;  4JX6 A;  3DP7 A;  1B8I A;  3RTR A;  1YX3 A;  4JX5 A;  3OL4 A;  1ZRF A;  4JK1 X;  1OIS A;  3L09 A;  2K02 A;  3E5U A;  4B09 A;  2A68 F;  1BW6 A;  3MEX A;  4N9H A;  5F1J A;  2WAQ A;  2GXB A;  5DM7 F;  4ZH4 F;  3ROU A;  1F5T A;  4HZF A;  2J5P A;  1A5J A;  2NOJ B;  2E7X A;  1XSX A;  2AQF A;  1ZHF A;  2L5Q A;  3OS2 A;  5J8F A;  1O4X A;  5DCM B;  4MFE A;  1SMT A;  4P9U A;  2NAZ A;  4OIR F;  2EZI A;  3PNY A;  4NC8 A;  1EV7 A;  2WBM A;  4IRG A;  5F0C A;  3W6J B;  1ZLJ A;  5M3F J;  4YEJ A;  3J81 Z;  3BWG A;  2FUG 2;  2GA2 A;  3J7Y J;  5H6R A;  2PLY A;  4BS9 A;  3C1D A;  1V55 H;  4UB8 C;  3MZ8 A;  2HYJ A;  2NS0 A;  2HEO A;  1DGW Y;  3SQN A;  2NYX A;  2MC4 A;  3PSI A;  1ETY A;  3ELK A;  1RRJ A;  1P7I A;  3FXL A;  1YJW I;  3BC8 A;  3IH4 A;  5F64 A;  3JSO A;  1O3Q A;  1VQ5 I;  1YIO A;  2ELH A;  2ZME C;  5JVT A;  1IV6 A;  3JCU C;  2LBF B;  1QHH D;  2RVC A;  1IRX A;  3V7S A;  1QZY A;  2DJN A;  4L9J A;  5D5W B;  2W82 A;  2EK5 A;  3D0S A;  4BJ5 C;  1Z77 A;  5J1U A;  3MZH A;  3S8P A;  2H6C A;  3GLX A;  5ILS A;  3WE2 A;  1R23 A;  3F8F A;  4F93 B;  2FML A;  1BI3 A;  2WAQ N;  2E1N A;  2JUG A;  3HUG B;  2BBY A;  4R1H A;  3QU3 A;  3TP3 A;  3H9G A;  4PJL A;  4XIC A;  3UNG C;  3JTH A;  3W6K B;  5J3L A;  1RES A;  4A5M A;  2RDP A;  3OYE A;  5EG0 A;  4IRI A;  2K9N A;  2P5K A;  4RAY A;  3TGN A;  4IQJ A;  1AOY A;  3IL2 A;  1MDM A;  2JJ7 A;  4M9S A;  5CVV A;  3LA7 A;  4FX4 A;  3CCL I;  4M71 A;  4KT6 A;  1OFC X;  2KIM A;  3K10 A;  2QSF X;  1J0R A;  4UVB A;  1HA8 A;  3BRO A;  1XMA A;  4AVP A;  5J4Y A;  1ZG5 A;  4EGY A;  1ZR2 A;  4C30 A;  2O8X A;  2M7B A;  1I1G A;  1YW8 A;  3HOU J;  4ZZL A;  4PUS A;  2CUZ A;  1KQ8 A;  1ZK8 A;  5E1Z B;  2L3D A;  5IPA A;  2XAJ A;  2KIQ A;  5HNF A;  4MEX F;  3NEU A;  2KLO A;  2V9V A;  3WHC A;  3RI4 A;  3HRU A;  4QPQ A;  4BH9 A;  5BQT A;  1HSJ A;  5M5W J;  4XKB A;  4JQF A;  3EUA A;  1D8J A;  3HIF A;  2VOO A;  1JI8 A;  1JHH A;  3VFZ A;  4I0B A;  1T38 A;  4F3Q A;  2CWE A;  4O6J A;  5K5O A;  1EH7 A;  5ICE A;  1D0X A;  3W6V A;  1YIJ I;  2FU4 A;  1MBJ A;  2L01 A;  3E97 A;  4A0Z A;  1ZLK A;  1MBG A;  2BYV E;  2F2E A;  3T8T A;  2G7H A;  2EIN H;  4NUB A;  1X3W B;  2E5N A;  4N4N B;  4PJM A;  3I71 A;  3TQN A;  2XPW A;  4D1Q A;  3ZMT A;  2CYY A;  1IZ1 A;  2XSJ C;  2QF7 A;  1MGT A;  3U2R A;  2GLO A;  2XAS A;  4U0W A;  4OIQ F;  3LSG A;  1AKH B;  1SD6 A;  3ZQ7 A;  2Y0S A;  1QZZ A;  1KU2 A;  2ELJ A;  2KRF A;  2RV8 A;  5CQG A;  2EA2 A;  2LD5 A;  3PSF A;  5AIQ A;  4YFX F;  5DCF A;  4MLO A;  2KRC A;  1TQP A;  1O3T A;  3DTE A;  3LSM A;  4WXC A;  4HX7 A;  4UNO A;  4PSX A;  1K4S A;  5LGN A;  2G9W A;  3HOX J;  1SAX A;  1W1W E;  2EV5 A;  5FKM A;  3DEW A;  2Y75 A;  2IAI A;  3OYD A;  4XLP F;  3ERE D;  4L0Z B;  3OYH A;  2V1X A;  1D1C A;  2BW3 A;  4F55 A;  2F4I A;  1IW7 F;  4E70 A;  2R3S A;  3M3Y J;  4OIO F;  5E3L A;  1VI0 A;  3BG5 A;  3I4M J;  3Q3S A;  2VKV A;  2L7M P;  2RC4 A;  3BPV A;  4ZDO A;  3GEZ A;  1U5T C;  1B9N A;  1NK2 P;  2IPQ X;  1BJZ A;  2ZNY A;  3RYR A;  1A04 A;  3G71 I;  1M1E B;  3PL8 A;  1P4A A;  3S2H J;  4PSW A;  5AON A;  2EA4 A;  2PG4 A;  1YHQ I;  1ZG1 A;  3ABT A;  4L5J A;  4E7K A;  2XKO A;  1DU0 A;  5K1Y A;  3ERM A;  4BHP A;  3E5Q A;  1MSE C;  5B3S H;  4KMF A;  5LGT A;  3H3Z A;  2HDW A;  2VBX A;  1P6R A;  3CJR B;  1CQT A;  5DEQ A;  3DQV C;  4UUS A;  2LLK A;  3K70 C;  2Y9Z A;  4A3K J;  2A05 A;  3BCA A;  2CH0 A;  2XRL A;  2P0W A;  3CMA I;  3J7A O;  5ERI A;  3VYS B;  5K7Z A;  2JUC A;  3CO6 C;  1JGS A;  3K1M A;  5FLX Z;  3HTS B;  4AIK A;  3A2K A;  3DLA A;  4IHY A;  3GZ6 A;  2Q1Z B;  3KFW X;  3GFJ A;  2P81 A;  3H0G J;  2ME6 A;  2FXA A;  1OYY A;  3FXO A;  2M4K A;  4ASN A;  3JRA A;  1LFU P;  1XC5 A;  3SEZ A;  3CCJ I;  5HOO A;  4MHG A;  1VQK I;  1ZG3 A;  2DQL A;  2KP6 A;  3CLO A;  3DKX A;  2OD5 A;  2A3S A;  1HC8 A;  1BM9 A;  4A69 C;  1HF0 A;  2EH3 A;  1Y8Q B;  1MH3 A;  3F21 A;  1Y1V J;  3ZQL A;  3K4C A;  2DTR A;  4UXN A;  4Y3O A;  4B43 A;  2XC7 A;  2CUJ A;  4OOI A;  2K9M A;  4GFB A;  5GP9 A;  3CCQ I;  4JYK A;  5CVR A;  1WGX A;  2M0M A;  1ULY A;  1P9Q C;  1C0W A;  2IVM A;  4XN0 A;  3HSR A;  5EEH A;  1H8A C;  4N0B A;  2JA7 J;  3VSK A;  3CJN A;  1YE9 A;  1FEX A;  1JUP A;  2ECB A;  4S04 A;  3SZG A;  2L9S A;  4E7L A;  1D8K A;  4NBQ A;  3H5A A;  3ZMZ A;  1FMV A;  1K83 J;  1ETO A;  2HVR A;  2ESN A;  3A02 A;  3F72 A;  4XRM A;  4C3J J;  2HTJ A;  1NK3 P;  2P6S A;  1JTX A;  2HR3 A;  3QOE A;  4DOZ A;  4CO8 A;  4K2E A;  4ENM A;  5ICC A;  2MD5 A;  1EF4 A;  3DPL C;  2KIF A;  2XB5 A;  1FOW A;  5ED4 A;  2HQ5 A;  4DZP A;  3G2B A;  2JSC A;  1DPU A;  2ZSH B;  3M07 A;  3SZP A;  2MSY A;  2F5C A;  2RQP A;  3A0H C;  3FK6 A;  1Y0N A;  1HLV A;  2VPR A;  4WF2 A;  9ANT A;  1FP1 D;  3HHH A;  4I98 B;  4XM3 A;  4ABZ A;  3HTU A;  4I6Z A;  3DLL F;  4P55 A;  3B6C A;  2KIU A;  3BJA A;  5HS7 A;  2R7R A;  1X1A A;  4P1W A;  3IWZ A;  3S1Q J;  4E7J A;  3GTK J;  1J9I A;  2R5Z B;  5CVJ A;  2QM3 A;  5DTD A;  1WFX A;  4FIS A;  3LNQ A;  3JSP A;  2DFI A;  3G1O A;  4DYC A;  2PBI A;  2NOG A;  2HGC A;  2VBY A;  2YR2 A;  4DW6 A;  2A6H F;  3S15 J;  1Z67 A;  1SAU A;  3IH2 A;  3OYK A;  1R5G A;  3R0A A;  2WWY A;  2DA2 A;  5J4V A;  4MO7 A;  3CDH A;  2K7L A;  1FOX A;  3OS1 A;  5IOZ A;  3FMS A;  3QP6 A;  1U9O A;  3C2G A;  2IGM A;  1ODD A;  1B72 A;  4OMZ A;  4PJ0 C;  1MNM C;  2M87 A;  2MGQ A;  4I01 A;  5TRD A;  2QUF A;  3ISP A;  2KT0 A;  4LMY A;  4BE1 A;  1Z05 A;  2JVG A;  2XPU A;  1LVA A;  4F91 B;  4HYE A;  3V8J A;  3J7Z I;  5F1R A;  4BNC A;  2MG4 A;  5DS9 A;  4B44 A;  1VND A;  5LRR A;  5D6F A;  3M1E A;  3BR0 A;  5LLQ A;  1Y8R B;  1SFX A;  3G1M A;  2VBZ A;  3B6A A;  3B02 A;  3DPT A;  2FSW A;  2FNP A;  3OYJ A;  3C18 A;  1GVD A;  2GWR A;  1TBX A;  2LY9 A;  4Q48 A;  1YW9 A;  3KYD B;  3PQJ A;  4GYI A;  1OR7 A;  1X4O A;  2ZFU A;  3ABK H;  3F23 A;  2HQA A;  3E3V A;  5FJ8 J;  2O9L A;  1IN6 A;  2R7T A;  3GVA A;  1QRY A;  3I53 A;  1W5T A;  3MN2 A;  3MAJ A;  2GIV A;  1B8I B;  2V9P A;  2O6G E;  3M9A A;  3E7L A;  4C2M J;  4AWX B;  4EJV A;  2D1H A;  2A69 F;  2NVU B;  3E6B A;  3EUH A;  1NG7 A;  2VIX A;  3OSF A;  4M3B A;  1Y56 A;  4L9N A;  2YX7 A;  2OUM A;  4A5N A;  3GTL J;  5IT9 K;  3F8N A;  3HRS A;  3GF2 A;  4YEL A;  2KZG A;  2CW0 F;  2L9R A;  2H1L A;  2HDD A;  3LA3 A;  4RS8 A;  3CCS I;  2P5V A;  4Q5S F;  4M3F A;  1MMN A;  2Y31 A;  3OV8 A;  4RAG A;  1LKX A;  5KAI C;  4HBL A;  3G3Z A;  4G7O F;  5C44 J;  2G0E A;  2KJB A;  4G6Q A;  4RGS A;  1XN7 A;  2LK2 A;  1P4X A;  2ECC A;  3CUQ C;  4YIF A;  1FYK A;  2VXD A;  4ZDP A;  1ENH A;  3ZOB A;  2CJJ A;  3QOD A;  1D3Y A;  3KZZ A;  2LVS A;  4ZYD A;  1T0F C;  1RET A;  1PJR A;  4XLH A;  2HPI A;  4EEF G;  2D2W A;  3VYU B;  3IC7 A;  3P9C A;  2UUZ A;  4I76 A;  2OV7 A;  2HQN A;  4C2U A;  3GCM A;  4XL9 A;  3ZQQ A;  4ZC3 A;  3LQQ A;  3V7C A;  2PJR B;  2KL4 A;  2DT7 B;  4KN4 X;  1TWC J;  2Y48 A;  3H0D A;  2IA1 A;  3L2W A;  2NS7 A;  1WWX A;  5LBQ A;  2VKD A;  1WSU A;  1BI1 A;  2QBY B;  1IJW C;  4CIC A;  3FWE A;  1JJ6 C;  1FIA A;  4D5C A;  4RAZ A;  2Q2E B;  2BVL A;  3H5R A;  3BT9 A;  1QU3 A;  5EG0 B;  2FNA A;  1TTY A;  4CCL A;  1YJN I;  3I4N J;  1MDM B;  2M8E A;  3OMY A;  1ZKG A;  4RB0 A;  3N05 A;  4DIQ A;  3BR2 A;  4AUX A;  1HKT A;  5D5V B;  3H36 A;  4MTD A;  4EV0 A;  5KAF C;  1WKM A;  2R7S A;  1H89 C;  2FBI A;  4IRH A;  1BW5 A;  1WQ2 A;  2O5R A;  5LGU A;  1ON1 A;  2VUM J;  2A5W A;  3EET A;  1K7A A;  1KQ0 A;  2VKH A;  1BR2 A;  2X1D A;  4LG3 A;  2E2H J;  3IAM 2;  3A03 A;  1B9M A;  1J75 A;  4XN3 A;  3CJQ B;  4AC0 A;  1N78 A;  2RAE A;  3HZJ A;  5KHD A;  3DBR B;  2CQ7 A;  5HOD A;  1IN8 A;  2ZFW A;  2JWT A;  3K4B A;  5HLT A;  3S1N J;  2QEN A;  3CC4 I;  2DXI A;  3S1R J;  3WGG A;  1YRN A;  3PIP F;  4ON0 A;  5E79 C;  5EZG A;  3SDG A;  4DNC A;  3PUB A;  1SD7 A;  2VE8 A;  5FD6 A;  2IGK A;  3Q9V A;  2EB7 A;  1FP2 A;  2VXZ A;  4E7H A;  1W36 C;  1I3A A;  1T6S A;  1SFK A;  1G4D A;  2EV0 A;  5D4S A;  3ZPL A;  1PVE A;  4EM1 A;  2FQ3 A;  1ZTR A;  1XS9 A;  2A07 F;  3GTP J;  5LEK A;  2HQR A;  4CH7 A;  2ZO4 A;  3KPH A;  2IGN A;  1DDN A;  1ORK A;  4UVA A;  5GAE J;  1WRJ A;  2P6T A;  4KUM A;  2KHM A;  2CO5 A;  4HSR A;  3KCC A;  4DGW B;  1Q1V A;  4ZYA A;  3JRI A;  1SD4 A;  3I59 B;  2DDA A;  1YO5 C;  2Z2S B;  2X85 A;  5EDN A;  2LSO A;  3J7A Y;  4HF0 A;  5HLH A;  2E35 A;  4M9Z A;  1FTT A;  5FRO A;  1G6N A;  3F8M A;  3HRM A;  3PM1 A;  3L2U A;  1TC3 C;  2IP2 A;  4BBR J;  4DQ2 A;  5ICG A;  2BW3 B;  3H5N A;  2VAS A;  5C4X J;  3VSL A;  3DBL B;  2RGV A;  3KEY A;  3HRT A;  5GPA A;  3RDI A;  1AWC A;  4BXF A;  1Z7U A;  1X4P A;  2B0L A;  1L0O C;  2X48 A;  4A6D A;  2WAE A;  1XCV A;  2BY3 A;  1MMG A;  2L4M A;  2N8G A;  1SFO J;  1Z7L A;  2Y2Z A;  3GZN B;  2V6E A;  4AIH A;  4G7Z F;  1YS7 A;  1S72 I;  3WTW C;  1MJB A;  3CD6 I;  4U7B A;  4ESB A;  2CG4 A;  4HLX A;  3E1S A;  1IC8 A;  1OCR H;  2YX4 A;  2E7W A;  3EPZ A;  2D45 A;  3DXJ F;  3KP3 A;  4CDG A;  2CGP A;  4XRS A;  4RB1 A;  4IX7 A;  2ISZ A;  3HGG A;  3MCZ A;  1U5T A;  3FXR A;  3DEU A;  1GUU A;  5BS6 A;  4BXU A;  2NVY J;  2COM A;  3AG1 H;  4XK4 A;  4Y33 A;  4QTR A;  2ID6 A;  3I55 I;  5DYM A;  4Y52 J;  2FA5 A;  1SAN A;  3LOC A;  4CCJ A;  1HCR A;  1FWZ A;  1E3O C;  2H94 A;  3LSP A;  4J00 A;  3WTV C;  4ZTF A;  1I1S A;  2GOM A;  2IJL A;  2WB1 A;  1X3U A;  3C2H A;  4B1R A;  1XSD A;  2PX9 A;  4M72 A;  1ZAO A;  3WTT C;  3L2C A;  4AYB A;  4GYG A;  2JMW A;  1V54 H;  4RGR A;  1XX5 A;  2DFE A;  5JHF A;  1JGG A;  1W5S A;  4HDU A;  1ZH5 A;  3A0B C;  4XKC A;  4OU0 A;  3EDP A;  3NAU A;  1T95 A;  1BC7 C;  4CYC A;  4IEJ A;  1VQ7 I;  2CV2 A;  3CP2 A;  3A1Y A;  2E1C A;  5KVR A;  4MGR A;  1BN5 A;  4Y15 A;  3Q5F A;  3IAS 2;  3L7W A;  2ZJP F;  4EM0 B;  3L00 A;  1DQU A;  1W5C C;  2HOA A;  3EYY A;  1Y1W J;  2E2J J;  4HQM A;  2X9D A;  2R7X A;  5K7H A;  2RKH A;  2O03 A;  1DPR A;  2O3F A;  3U21 A;  3HPH A;  3GME A;  1USS A;  4LIT A;  4MFD A;  1PYV A;  4S05 A;  3K70 D;  5L3D A;  3IKV A;  3WTU C;  1YX5 A;  3S17 J;  4UV8 A;  4A6E A;  5B1A H;  1IN4 A;  1G59 A;  2Y30 A;  1LNW A;  1Y39 A;  1LE8 B;  5IP7 J;  2ZSI B;  3KP4 A;  2L4A A;  3L2V A;  2EZL A;  2HXO A;  1FMW A;  4CGZ A;  2QKM B;  1SFU A;  1K6Y A;  2Y0M A;  3CC7 I;  3KYL A; 
#chains in the Genus database with same CATH homology
 4IHW A;  2WB1 N;  2K40 A;  3OOU A;  3JR9 A;  4NDL A;  1DU0 A;  3L1P A;  1GV5 A;  1F36 A;  4M3G A;  3HOW J;  1MSE C;  1U9N A;  4IHV A;  3FIS A;  4A3F J;  4A3M J;  1MBE A;  1CQT A;  4UUS A;  3QQA A;  1TWG J;  1FIP A;  2LLK A;  2ME0 A;  2Y9Z A;  1WI3 A;  4A3K J;  5IP6 A;  1FTZ A;  4S0H B;  2HOS A;  2XRL A;  1BA5 A;  2B63 J;  5K7Z A;  5IYC J;  1D5Y A;  2R92 J;  2IBD A;  3QPS A;  1JKP C;  1JJ8 C;  4IHY A;  1PUF A;  2P81 A;  3H0G J;  2ME6 A;  1TWA J;  4BKX A;  2JN6 A;  3JRA A;  3BQZ A;  2EZH A;  4DYQ A;  1OCT C;  1LFU P;  1XC5 A;  2MW8 A;  3HBL A;  3SFI A;  4X1E A;  4A3G J;  5EF6 A;  4A69 C;  1HF0 A;  2EH3 A;  1MH3 A;  1Y1V J;  3ZQL A;  1MSF C;  1U8B A;  2R5Z A;  3H3V K;  2OF7 A;  4MIM A;  4GFB A;  5GP9 A;  3HOY J;  1ZQ3 P;  4JYK A;  4G12 A;  1WGX A;  2DA4 A;  1R9T J;  4D5F A;  3HB9 A;  1H8A C;  4UUT A;  4BY1 J;  1I6H J;  2JA7 J;  4QSH A;  3A01 B;  1FEX A;  2D5V A;  2JA6 J;  1JUP A;  2ECB A;  4C3I J;  5EGO A;  2R0Q C;  3OSG A;  1IUF A;  3RQI A;  2QCO A;  4UUS B;  3K2A A;  4LOC A;  2YUS A;  5IOY A;  2NS8 A;  2XPV A;  2XB0 X;  1K61 A;  1K83 J;  3HOZ J;  1ETO A;  3HDD A;  3A02 A;  4XRM A;  5EZH A;  4C3J J;  2X6O A;  1NK3 P;  1JTX A;  3F0C A;  1EF4 A;  5K7F A;  1TWF J;  2XB5 A;  2M2E A;  2HQ5 A;  4DZP A;  4V2F A;  2M0C A;  2R7Z J;  2MSY A;  3FK6 A;  1RR7 A;  1HLV A;  2VPR A;  1UMQ A;  9ANT A;  2VKE A;  3BG9 A;  4I6Z A;  1OCP A;  2HI3 A;  4ABZ A;  1HOM A;  3ZQH A;  1JUS A;  3B6C A;  5F0H A;  4J19 A;  3RZO J;  3K7A J;  2DA1 A;  3S1Q J;  1DU6 A;  3GTK J;  3Q0V A;  2R5Z B;  3TP0 A;  3S2D J;  1WPK A;  2TCT A;  5DTD A;  4JP0 A;  4FIS A;  3LNQ A;  1RKW A;  3G1O A;  4DYC A;  2JA8 J;  2NOG A;  5FKO A;  3GBG A;  2YU9 J;  2FJ1 A;  4DW6 A;  4A3L J;  1IDY A;  2VI6 A;  3S15 J;  3IH2 A;  2DMT A;  3GTJ J;  3CCY A;  1UG2 A;  2DA2 A;  1ETQ A;  4MO7 A;  3BR5 A;  5IOZ A;  1RKT A;  1U9O A;  3HKZ N;  1B72 A;  5EGO B;  1MNM C;  2K9S A;  2MGQ A;  1BL0 A;  1UHS A;  3O8H A;  5F0F A;  4B4C A;  2KT0 A;  1ZR4 A;  2H8R A;  2XPU A;  5FKK A;  1JKO C;  1ETX A;  3BR1 A;  2MG4 A;  5DS9 A;  1VND A;  3FKI J;  1T33 A;  3BR0 A;  3A01 A;  3M4O J;  2Y0S N;  3G1M A;  4AYB N;  3B6A A;  3QPL A;  2LKX A;  5C4J J;  2GM4 A;  1GVD A;  3ZQF A;  3HEF A;  2LY9 A;  2XSD C;  1Z0X A;  3PO2 J;  3ZQC A;  2M9H A;  1GV2 A;  2FQ4 A;  5FJ8 J;  2O9L A;  4HNV A;  1APL C;  1MH4 A;  1QRY A;  3MN2 A;  3BG3 A;  1U78 A;  1B8I B;  3JRD A;  3E7L A;  1MBH A;  4C2M J;  2COB A;  2XGD A;  1ETK A;  2EZK A;  3MVP A;  2LTP A;  2K9Q A;  4W97 A;  3OSF A;  4M3B A;  5JLW A;  4IHX A;  4FCY A;  2CRG A;  5J1Y A;  2CUF A;  3CMY A;  1XG1 A;  3GTO J;  1JKR C;  3GTL J;  2CU7 A;  3JRG A;  2L9R A;  1B72 B;  2HDD A;  1X58 A;  2FD5 A;  4X6A J;  2R5Y B;  1T56 A;  1OJL A;  3RZD J;  4M3F A;  2Y31 A;  1VF9 A;  3BR6 A;  1JT0 A;  3CQZ J;  2NVT J;  1GT0 C;  3PO3 J;  1F43 A;  3G1L A;  2H1K A;  1IDZ A;  5C44 J;  2G0E A;  3BQY A;  2LK2 A;  5F08 A;  3GTQ J;  4A3C J;  2L7F P;  2ECC A;  4FE4 A;  2DMU A;  2DN0 A;  4C3H J;  4XRS G;  1NTC A;  2NVQ J;  1ENH A;  3ZOB A;  2O8K A;  2CJJ A;  3GTM J;  2CQQ A;  4RBO A;  5GPC A;  3NAR A;  1AHD P;  5C3E J;  2LVS A;  3Q0W A;  4DYR A;  1RET A;  4EEF G;  1S7E A;  1ITY A;  2HXI A;  2M34 A;  1W0T A;  2CQX A;  4I76 A;  3BTC A;  3BTI A;  5IP9 J;  4M3E A;  5EYR A;  2HOT A;  3TW7 A;  1TWC J;  4A3J J;  2KDZ A;  1P7J A;  1A6I A;  2NS7 A;  4A3I J;  3TW6 A;  5F27 A;  1IJW C;  3HGY A;  1JJ6 C;  3IH3 A;  3JRB A;  1JKQ C;  1FIA A;  4D5C A;  2IEK A;  1VFC A;  3BT9 A;  5E3O A;  5EG0 B;  3I4N J;  1RPW A;  2E1O A;  4JX6 A;  1B8I A;  4JX5 A;  5M5X J;  1ZKG A;  2ID3 A;  2EBI A;  4B3A A;  3BR2 A;  4JX4 A;  4AUX A;  2L7Z A;  2M8G X;  1BW6 A;  3D1N I;  5F1J A;  3HM5 A;  2DA5 A;  1H89 C;  5FKL A;  4DZJ A;  1W0U A;  1G2H A;  4XID A;  1A5J A;  3RKQ A;  2ELK A;  1BW5 A;  1O4X A;  2DMP A;  4MFE A;  2VUM J;  2EZI A;  2R5Y A;  2LP0 A;  1IGN A;  5F0C A;  5M3F J;  3FIW A;  2E2H J;  3A03 A;  4L5E A;  5BNG A;  4AC0 A;  2RAE A;  3CDL A;  1H88 C;  5HOD A;  2HYJ A;  4BY7 J;  2JWT A;  3MKL A;  3S1N J;  3JRH A;  1ETY A;  3S1R J;  3VPR A;  1P7I A;  1WCM J;  1YRN A;  4FE7 A;  2O7O A;  3IH4 A;  3HOV J;  5EZG A;  3SDG A;  5IYB J;  1IV6 A;  2ZB9 A;  2CUE A;  1TWH J;  2DJN A;  1JTY A;  1WH5 A;  3OIO A;  4V2G A;  1Z77 A;  5J1U A;  1HDD C;  5E3N A;  1XS9 A;  3GTP J;  1ZTR A;  5FKN A;  4A3D J;  1ORK A;  3S1M J;  2L0K A;  3ZQI A;  2WAQ N;  2AHQ A;  2DA6 A;  2DTZ A;  5M3M J;  1Q1V A;  3JRI A;  1LFB A;  3TP3 A;  4XIC A;  4A3B J;  4CYC B;  4Y7N J;  4FTH A;  5FLV A;  5J3L A;  1RES A;  1JT6 A;  3LSJ A;  5EDN A;  2E19 A;  2K9N A;  5EG0 A;  1IRZ A;  1MBK A;  2JJ7 A;  2JK3 A;  1AKH A;  1FTT A;  1QVU A;  1QVT A;  4D7N A;  1I3Q J;  2WV1 A;  3PM1 A;  3S16 J;  1OFC X;  2FX0 A;  1TC3 C;  4BBR J;  2TRT A;  2LR8 A;  3S14 J;  4A93 J;  5F04 A;  2LFB A;  1QPI A;  5C4X J;  1ZR2 A;  3IV5 A;  5GPA A;  1POG A;  4D7M A;  2X48 A;  3HOU J;  3Q0U A;  4M3D A;  2N8G A;  1SFO J;  2Y2Z A;  1YRN B;  1ZK8 A;  5IPA A;  2W48 A;  1GDT A;  4A3E J;  3WHC A;  4W1U A;  5M5Y J;  1HDP A;  2AO9 A;  1IC8 A;  5M5W J;  3C2B A;  4XRS A;  3BTJ A;  3HGG A;  1AU7 A;  2JA5 J;  2DMQ A;  1GUU A;  3W6V A;  2NVY J;  3BTL A;  4XK4 A;  4QTR A;  1ETV A;  4QIW N;  1JUM A;  1MBJ A;  2ID6 A;  1LE8 A;  4Y52 J;  3LOC A;  1SAN A;  1MBG A;  1HCR A;  1E3O C;  3TED A;  1ETW A;  3LSP A;  5JLX A;  1FJL A;  2XPW A;  1X2M A;  4RDU A;  3BR3 A;  3SJM A;  2QF7 A;  2GLO A;  4B1R A;  3LSG A;  1AKH B;  4BBS J;  2XGC A;  2LD5 A;  1PUF B;  2JMW A;  2DA3 A;  1JGG A;  4MLO A;  3FK7 A;  2DA7 A;  3WHB A;  5IYD J;  3NAU A;  2Y9Y A;  4CYC A;  4IEJ A;  2NVX J;  2GBY A;  3HOX J;  2HOA A;  3JRE A;  5E3M A;  2OPT A;  1Y1W J;  2E2J J;  2X9D A;  5FKM A;  3DEW A;  5K7H A;  2IAI A;  2I10 A;  2E2I J;  4BXX J;  3M3Y J;  5E3L A;  3LSR A;  1VI0 A;  3BG5 A;  4MFD A;  1MBF A;  3ZQG A;  3Q3S A;  3I4M J;  5EEA A;  2VKV A;  1WH7 A;  1ZGW A;  2L7M P;  1I50 J;  2R93 J;  3S17 J;  2XGE A;  3DCF A;  3GTG J;  2YS9 A;  3O8G A;  1NK2 P;  1BJZ A;  3JRF A;  2Y30 A;  4M6V A;  3UKG A;  1LE8 B;  2DMN A;  5IP7 J;  5FLM J;  5J1R A;  3S2H J;  2EZL A;  2HXO A;  2PMZ N;  1X2N A;  2EQR A;  3JRC A;  1IG7 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...