1WH7A

Solution structure of homeobox domain of arabidopsis thaliana hypothetical protein f22k18.140
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
80
structure length
80
Chain Sequence
GSSGSSGSNPSSSGGTTKRFRTKFTAEQKEKMLAFAERLGWRIQKHDDVAVEQFCAETGVRRQVLKIWMHNNKNSGPSSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ZF-HD homeobox family protein
publication title Solution structure of homeobox domain of Arabidopsis thaliana hypothetical protein F22K18.140
rcsb
source organism Arabidopsis thaliana
molecule tags Dna binding protein
total genus 13
structure length 80
sequence length 80
ec nomenclature
pdb deposition date 2004-05-28
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.60 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Homeodomain-like 1wh7A01
3SJMA 1IDZA 2M8GX 2ME0A 5F0CA 3Q0UA 2R92J 3GTGJ 1S7EA 2XPUA 4A3KJ 1AHDP 2HOSA 5FKOA 2P81A 4BXXJ 4A3GJ 3JRDA 5JLWA 2VKEA 1WCMJ 1H89C 3O8GA 1TWFJ 1VI0A 4FISA 1GVDA 1OFCX 1YRNA 4A3IJ 1TWGJ 2YUSA 4CYCB 2DMNA 3G1LA 3IV5A 3TEDA 2LFBA 4DW6A 2WAQN 2VPRA 3FKIJ 1GV5A 4AUXA 1HCRA 5EF6A 1NK3P 2PMZN 2VUMJ 1VF9A 4IHWA 4W1UA 2HOTA 1RR7A 1G2HA 4D5CA 1YRNB 4IEJA 3NAUA 1PUFA 2VKVA 2N8GA 2JA7J 3G1MA 4B1RA 5K7FA 1TC3C 2X6OA 3A02A 1EF4A 1U9OA 3B6AA 5J1UA 4BKXA 3GTJJ 4A3FJ 1U8BA 2JK3A 3LSRA 1JUMA 1BJZA 2LR8A 4JX5A 1ETVA 4QIWN 2B63J 2EBIA 1JKPC 3JRHA 3JR9A 1OCPA 1Z77A 3H0GJ 1PUFB 1ZGWA 1ZR2A 3GTPJ 2HQ5A 2L0KA 2QCOA 3S16J 4M3EA 2XGEA 5IYCJ 1K83J 3HKZN 2CQQA 5K7ZA 3GTQJ 3QPSA 3QPLA 4EEFG 1SANA 4A3MJ 3TP0A 3S1MJ 4BY1J 2DMQA 3RZOJ 3GBGA 2XPWA 3RZDJ 2M34A 3HOWJ 1TWCJ 1XG1A 2R0QC 4LOCA 4DYRA 3S1NJ 4BBSJ 3PO2J 1QRYA 4AC0A 1FIPA 3JRGA 2M9HA 2Y30A 2JA5J 3S17J 4C3JJ 1U78A 2WB1N 1O4XA 3MN2A 2YU9J 2JN6A 4JX4A 3FK6A 2EZIA 4GFBA 1RPWA 1JKRC 1MBJA 2M0CA 4MFEA 2X48A 4C3IJ 4FE7A 4DZPA 3ZQCA 5M3MJ 1POGA 1IGNA 3FK7A 2GBYA 1R9TJ 1FTZA 1VFCA 3BQYA 3BTIA 3O8HA 5HODA 2W48A 2IEKA 1JJ6C 2G0EA 3GTMJ 2K9NA 2JMWA 5IP9J 2L9RA 4Y52J 3BR6A 5C44J 1JKQC 4I6ZA 1IJWC 1ETXA 3ZOBA 1APLC 1JTXA 4A3LJ 5F0HA 5K7HA 1BA5A 3GTOJ 5EDNA 1OCTC 2O7OA 2DA3A 1ORKA 2NVYJ 2DA2A 4FCYA 4L5EA 5JLXA 1HF0A 2DMUA 4C3HJ 1JT0A 2I10A 5E3LA 3UKGA 1ETOA 1ZK8A 3OIOA 2O9LA 4JP0A 2ELKA 2E1OA 4C2MJ 5FKKA 2R7ZJ 3ZQLA 3Q0WA 1FTTA 3NARA 1I6HJ 1HDPA 2AO9A 2GLOA 2DA4A 3FIWA 1BW5A 4A3JJ 2R5ZA 5FKMA 1RETA 5M5YJ 2JWTA 1JJ8C 1DU6A 2MSYA 5C3EJ 1MBKA 4V2FA 2WV1A 1T56A 2CJJA 4X6AJ 3GTLJ 1BL0A 3CCYA 3BR0A 4B3AA 1CQTA 5EZGA 5F04A 4ABZA 5EZHA 2L7MP 5IPAA 2Y2ZA 3JRCA 2CQXA 3OOUA 1JUPA 3HOZJ 5J3LA 1IRZA 3ZQFA 2R5ZB 5J1RA 1RKWA 3BG5A 3TW6A 5E3OA 1B72A 3SFIA 4IHYA 2JJ7A 2CUFA 3SDGA 1JKOC 2LK2A 4JYKA 1X2NA 1GV2A 2ID6A 3M4OJ 1P7IA 1I3QJ 2AHQA 1BW6A 1HOMA 2HXIA 4UUSA 2GM4A 1JUSA 5M3FJ 1MBEA 4I76A 4HNVA 1AU7A 3QQAA 1NK2P 3S15J 2ID3A 1ENHA 2TRTA 1RKTA 1LE8A 1XC5A 3S2DJ 3I4MJ 2QF7A 1B72B 2NS8A 2H8RA 3BR1A 3BR5A 2Y0SN 4A3EJ 2LTPA 3HB9A 3MKLA 5EGOA 3HOVJ 2EH3A 1TWAJ 3H3VK 2K9SA 4UUTA 3A01A 1E3OC 4UUSB 1MH4A 4IHXA 5DS9A 5FLMJ 1FJLA 1TWHJ 3PM1A 1MBGA 3GTKJ 3HOXJ 1LE8B 4M3GA 4QTRA 4DYCA 2EZLA 3WHCA 2D5VA 2LKXA 2EZHA 2KT0A 4DYQA 1UMQA 1GT0C 4XK4A 4MIMA 1XS9A 2Y31A 1HDDC 2NVXJ 2FJ1A 5EGOB 1NTCA 2LD5A 1LFUP 4M6VA 3A01B 1JT6A 2HI3A 4FTHA 1WI3A 3E7LA 5DTDA 5F27A 4JX6A 3LOCA 1X58A 2LVSA 2M2EA 2H1KA 1D5YA 3D1NI 2K9QA 3OSFA 4BY7J 3HM5A 4M3BA 5M5XJ 1IDYA 5FKLA 3LNQA 5C4XJ 2E19A 2E2JJ 1U9NA 2E2HJ 3LSJA 4AYBN 2K40A 2RAEA 3BQZA 2HYJA 3DCFA 4RBOA 3TW7A 2LY9A 1F36A 4B4CA 1H8AC 2OF7A 1A6IA 3BTCA 3ZQIA 3OSGA 4QSHA 2ME6A 2IAIA 1MNMC 2L7ZA 3TP3A 2E2IJ 2NVTJ 2HXOA 3BT9A 5F0FA 3Q0VA 3RKQA 1OJLA 4A93J 4Y7NJ 5IOYA 1MH3A 1ETYA 4W97A 2DA6A 4S0HB 2HOAA 3PO3J 5C4JJ 2DN0A 2HDDA 1K61A 4D5FA 5EG0A 1IC8A 5GPAA 1IUFA 1DU0A 3BG3A 1ETQA 3G1OA 4X1EA 1LFBA 5E3NA 1GUUA 3JRFA 1QPIA 2DA5A 3JREA 2YS9A 1Z0XA 2FD5A 2CU7A 3ZQGA 2COBA 1QVUA 2Y9ZA 1B8IA 1X2MA 5IOZA 2JA8J 2ECBA 2MG4A 3HOYJ 1ZTRA 3LSPA 1I50J 1ZQ3P 1W0UA 5FJ8J 5EG0B 1T33A 4J19A 4A69C 3HBLA 1UHSA 4D7NA 5GPCA 3JRIA 3K7AJ 2MW8A 2DTZA 3S1QJ 3FISA 1GDTA 2EQRA 4MO7A 1B8IB 2XPVA 5BNGA 3RQIA 5EYRA 1MSEC 4NDLA 3IH3A 2VI6A 3Q3SA 3HGYA 1SFOJ 1IV6A 1MBFA 3BTLA 4XRSA 3HDDA 3S2HJ 3IH2A 2FQ4A 1FEXA 5FLVA 1ZR4A 2O8KA 4FE4A 4DZJA 1WH5A 4XICA 3CDLA 3BG9A 3CMYA 1JTYA 2XB5A 1AKHA 1VNDA 2MGQA 4XRSG 1ZKGA 4RDUA 4M3FA 3C2BA 3WHBA 3ZQHA 3S14J 5IYBJ 4D7MA 3DEWA 5IP6A 4V2GA 2LP0A 2XB0X 1A5JA 4A3DJ 1FIAA 4XRMA 2CUEA 1P7JA 2XGDA 3W6VA 2EZKA 2DMPA 2FX0A 4M3DA 3L1PA 3BTJA 3JRBA 3MVPA 5GP9A 5F08A 2X9DA 4MLOA 1AKHB 1UG2A 1WGXA 9ANTA 2JA6J 2NVQJ 1ETWA 2IBDA 3F0CA 5E3MA 5IYDJ 2Y9YA 1W0TA 3B6CA 2R5YA 4A3CJ 3HOUJ 2KDZA 5J1YA 2R93J 1Y1WJ 1Y1VJ 1MBHA 2NOGA 3I4NJ 5EEAA 1QVTA 1ITYA 4G12A 5IP7J 4IHVA 2LLKA 3S1RJ 3IH4A 2TCTA 3BR3A 1IG7A 2DA7A 2ECCA 3HGGA 2XRLA 4MFDA 2CRGA 3VPRA 2OPTA 5M5WJ 3K2AA 2R5YB 4XIDA 2DJNA 5FKNA 1MSFC 3BR2A 3A03A 3JRAA 5F1JA 2XSDC 1F43A 1RESA 1WH7A 3LSGA 2XGCA 1H88C 1HLVA 2DMTA 4BBRJ 2DA1A 1ETKA 2NS7A 1Q1VA 2ZB9A 3CQZJ 1JGGA 3M3YJ 1WPKA 3HEFA 2L7FP 4CYCA 4A3BJ
chains in the Genus database with same CATH superfamily
1U0JA 1W4MA 4R79A 3KIOA 5DUIA 2BHYA 1K6OA 2VOPA 2VPLA 1AHDP 3CDHA 1USTA 3VOEA 4KJZA 2CS3A 3JRDA 5JLWA 2PN6A 2XAHA 4KMUX 1RUNA 1W36C 4UB8C 3J7ZI 3GZNB 4XLAA 4E7SA 2YSRA 3JAMZ 1K78B 4C2TA 4CSWA 2YUSA 3ZQQA 3L7WA 3G1LA 3IV5A 1OKRA 2WAQN 2V6CA 2VPRA 3V4GA 4AUXA 3MMYB 4PFPA 2R7DA 2B7EA 3CCEI 2PMZN 1VF9A 1T98A 4XLHA 2B0LA 1HW1A 3HTSB 2K7LA 1G2HA 1QQIA 2MBFA 4RGXA 1PUFA 2P6SA 3EQLF 4A5NA 1OCOH 4B8XA 3E5XA 1TC3C 1XSXA 2RQPA 3DU6A 1X19A 3KP4A 3I4PA 2VE8A 4B48A 2MD5A 2HDWA 3K4LA 2X85A 2K4JA 1T0FC 1R5GA 2MABA 4U87A 3NQOA 1UZCA 2P7VB 1SFXA 1BJZA 2XRNA 4JQFA 3H3UA 4HV6A 1YTYA 1K4TA 2KIMA 2IP2A 1JKPC 2KRCA 3JRHA 4EM1A 1ZGWA 1ZR2A 1QZZA 1I3AA 3MEXA 2L0KA 1UB9A 1X4PA 4AIKA 4FX4A 4YIFA 4XLCA 4BXFA 3HKZN 1GLNA 3DKXA 4ZYAA 2IT0A 3K4KA 2XAQA 3WG9A 3IWZA 4X0GA 1OYYA 3OYFA 2JRMA 2KFDA 3QPLA 3VSKA 4MHGA 4LLNA 4BY1J 2K27A 2XVCA 1PJRA 2DCEA 3DWLE 4A6EA 4CA0A 3FXQA 2M34A 1SEUA 2L9NA 1KU3A 3HIFA 4DYRA 3S1NJ 4BBSJ 2WTEA 2X4HA 4HPQA 1ZLKA 4F91B 5J4YA 3S3MA 2F5FA 1JGSA 4PJMA 2M9HA 1ZRCA 2M87A 3ELKA 3TL4X 3T5XA 1O4XA 3NEUA 1X1DA 3MN2A 3OIPA 2VJ4A 2JN6A 5HLIA 4JX4A 3MWMA 1WJ5A 2ISZA 1RPWA 2BYVE 3PIOF 3TOBA 1MBJA 1SD7A 2C6YA 4HQEA 2PMUA 4FE7A 3I59B 3I9V2 3FK7A 4KISA 3S3NA 2VT2A 1R9TJ 1FPQA 1FTZA 4WXDA 4BU2A 4CICA 1OMIA 4A0ZA 5D8KB 4Z2YA 5LEJA 5IP9J 5CKTA 2L9RA 2ZJ2A 3EYYA 3WU1B 4Y52J 3BR6A 2EV6A 4RB1A 1WJAA 3RKWA 3K70D 4UY8I 1TQIA 2P4WA 2ZCWA 1ETXA 1Z91A 1APLC 2G9WA 5F0HA 5K7HA 4HZFA 1XSDA 4FETA 2WY7Q 3KX2A 1R1TA 1OR7A 3F21A 2DA3A 4BEHB 5GAEJ 4NUBA 2DMUA 1N77A 1EH8A 5D5WB 3H5AA 2DK5A 2STWA 1KQ8A 2PFBA 2Z3YA 2E1OA 5FKKA 2OCCH 4IO9F 3FXUA 2IGKA 3RCOA 5D4RA 2BXYA 3HL2A 3WTSC 3LAPA 4IF4A 4GCVA 3KP7A 4D9JA 1J59A 3CLOA 2GAUA 4BQOA 3BJ6A 3FIWA 4HNTA 3HOTA 3G71I 1M1EB 3WE3A 1VTNC 2HR3A 2V1NA 5EJCA 3LA7A 4DJAA 2V79A 4OWRB 2CUZA 2A6TA 5M5YJ 1DU6A 4M9XA 1QBJA 3RPQA 5BQTA 2QKMB 1O3TA 5C3EJ 3BCAA 4CDGA 1T56A 1W5CC 2BZTA 3B02A 3E97A 4B3AA 4EV0A 5H2FC 1CQTA 2XF7A 1O3SA 2OQGA 1SFKA 2OU2A 4ANJA 2Y2ZA 4AVZA 1W7PA 3QWLA 3ZQFA 2R5ZB 2QM3A 1RKWA 3TW6A 3IRRA 4BDYA 4M74A 3FXJA 3SFIA 4IHYA 2PI0A 2JJ7A 2CUFA 3TDZC 1D1BA 1V4RA 5HDNA 1X2NA 1GV2A 2ID6A 3K4BA 1WJDA 1I3QJ 4HLXA 4G94A 1WJEA 2DFIA 4UUSA 1TT5B 4BQNA 1UHMA 5CVRA 1RIOH 4BNCA 1B59A 3N97A 1ZG3A 2A6EF 2KDOA 2OAZA 2CGPA 1NK2P 1ENHA 1O7FA 1RKTA 2QWWA 3S2DJ 2DOFA 1TLHB 2QF7A 3ZP5A 1B72B 4M73A 2NS8A 2Q2EB 3BR5A 2E1NA 3ERMA 1Y6IA 3ZRGA 3ABKH 3MKLA 1WJBA 4CUGA 5J6XA 5EGOA 3HOVJ 2P0WA 5LRSA 1RI7A 1NH3A 3H3VK 4UUTA 1E3OC 1IN7A 3PQJA 1MH4A 2DO7A 4AD9A 3JTHA 4ZH4F 5FLMJ 1FJLA 2PJPA 3MAJA 4II3A 3GTKJ 1HKQA 1LE8B 4II2A 1VZ0A 2JT1A 2FMYA 4RM3A 2FRHA 2OCEA 4DYCA 4QTRA 3F8NA 1VQ7I 2GXGA 1YLFA 3OYLA 3GX4X 3H0DA 2HOEA 4DYQA 2Y0SA 2P8TA 2ACJA 4XK4A 3R0JA 4CHUA 4V19K 2NVXJ 2KKOA 1YITI 2FJ1A 2KRHA 4PGGA 3NWSA 2LD5A 4PJNA 3CUQA 4UVAA 4YELA 1WSUA 1WI3A 1D1AA 5DTDA 5F27A 3J7YJ 3SDBA 1P92A 4Y33A 4LFUA 3LOCA 4B47A 4YFXF 3S3OA 3HRUA 2R7QA 3D1NI 5CVVA 1Z7UA 3OSFA 4BY7J 1LFPA 3HM5A 1DQUA 3LNQA 1P4WA 3M8JA 2E2JJ 2WC2A 2BGCA 2PBIA 1MKMA 1AA7A 2O8XA 2RN7A 3DCFA 2IS4A 4XN3A 2G7HA 2KP6A 2V1XA 3WGHA 2OJED 2XIGA 2OF7A 5E1XA 2YU3A 1H8AC 3GF2A 4LB5A 4HX4A 1A6IA 2IS6A 3ZQIA 1HSTA 3BJAA 2X51A 2K5CA 3L2CA 2EK5A 2XKOA 2BY3A 2LF7A 2NYXA 3RKQA 1FYLA 1S5LC 2WAEA 3LSKA 2E35A 2DW4A 1MNDA 4W97A 3I64A 2LBFB 5GAHJ 2DA6A 2PG4A 3I54A 4EJOA 1KGSA 4ENMA 3OR2C 5LRRA 2Z1DA 3JCUC 2BBYA 4N9IA 5F1RA 3W2WA 1IC8A 5GPAA 2BW3A 1A6QA 3RKYA 1TP4A 3HOSA 5J8FA 5BMZA 1LFBA 5E3NA 4L5IA 2JRTA 3KLOA 2DA5A 3JREA 5TISC 1XGNA 4S05A 1Z0XA 2WY8Q 1X1CA 1DPRA 4HF2A 1XN7A 1J0RA 2COBA 2Y9ZA 1X2MA 2MG4A 2XKPA 5E20A 1ZTRA 3LSPA 1SMYF 5CLSA 2CFOA 1W0UA 2W57A 5FJ8J 2L2OA 5EG0B 1T33A 2HVQA 4J19A 4A69C 1UJ8A 2BY0A 4D7NA 1A35A 2D2WA 2OZUA 3ZGKA 2CV1A 1HKSA 2JZYA 4ZJZA 5D5VB 3IL2A 2CQKA 3K7AJ 1MDMA 1EJ9A 3FXLA 4ZTFA 3S1QJ 3A0BC 2M8EA 2QVOA 2RC4A 3FISA 5LHGA 3WTXC 4MO7A 2XPVA 3RQIA 2IGMA 4E7HA 1MSEC 4NDLA 4FASD 3VYUB 1TQPA 3RDIA 4I2OA 4NC8A 5EEHA 3FHNA 3V8KA 5BS6A 4HSTA 1XDSA 4G6DA 1PP7U 4RM2A 2QQ9A 4Q48A 1FEXA 2ADUA 1H9TA 4FE4A 1FP2A 3H92A 4DZJA 1XDUA 1Z7LA 4XR6A 1DGWY 1XGOA 4UXNA 3JTGA 1R00A 4B09A 1VNDA 3WG7H 4XRSG 5LFAA 3KZIC 1BOBA 1QPMA 3ZMSA 4BL0B 2ZXWH 2GWRA 3DEWA 4D7MA 5IP6A 2MD0A 4MNUA 5KAIC 2XGDA 4MEXF 4M3DA 4TV7A 4U0YA 4H4KC 3WGGA 1ZHFA 1EH6A 2M4GA 3CP2A 4ZYGA 1O3QA 1HBXG 3F8FA 4ZZDA 5D4SA 1BR4A 4EJTA 2MFZA 2ZJRF 2FF4A 1WGXA 4LB6B 9ANTA 1R4MB 2VBYA 4FQGA 3ZMZA 1P4AA 5J4VA 5JVTA 2ETHA 4LD5A 5E3MA 2V9PA 2W25A 1VQKI 1Y1VJ 1MBHA 2XHKA 3HHHA 2DDBA 3I4NJ 3K69A 1FT9A 3VYTB 3J80K 3BZKA 3RIRA 1T38A 2W00A 2TCTA 2R4GA 3CCSI 1IG7A 2DA7A 5HLGA 2JVGA 1WKMA 2L3DA 2E5ZA 4ITVA 2XRLA 2IS2A 1K6YA 2EFQA 1R58A 1LJ9A 1PVEA 3E3VA 4HRIA 2R5YB 5JR3A 2QGUA 3GW2A 5F1JA 3GXOA 2XSDC 3A0HC 5LHIA 2QSHX 2A5WA 1XMAA 2NNNA 4YG2F 3FBNB 1S72I 2NS7A 4KDPA 2LF8A 4KMFA 3K1NA 1QHHD 4XNFA 5E8IA 3M3YJ 5H6RA 2HDCA 2CV0A 1EV7A 4JBAA 1MD0A 3OS2A 2JTVA 2VXZA 2ME0A 4E7LA 3E5QA 3Q0UA 2EA2A 4QWQA 1IRGA 1S7EA 2D1VA 4A3KJ 3T8TA 1U8RA 4HDUA 5FKOA 5L3DA 2VKEA 1WCMJ 3O8GA 2DI3A 1TWFJ 1FSEA 4ESJA 4GGGA 3ABUA 1ZYRF 2B9SA 1YRNA 4EJUA 4EQQA 2RKHA 4CYCB 2DMNA 2F4IA 1I27A 3OYEA 1ZG5A 1H0MA 1G3TA 3CCJI 1UELB 3CP8A 1R36A 4DW6A 2P5KA 3U1DA 2AQFA 1EKEA 1GV5A 2V4JC 3IC7A 3OWTA 1O3RA 1L3LA 2Z99A 3HRMA 4HEA2 1YFHA 2HOTA 1RR7A 2F5VA 1KONA 3U21A 5CQEA 2PLYA 3A4CA 4EJWA 2VKVA 2HFHA 1XGMA 2JA7J 2MLGA 4BJ5C 4KUMA 2J5OA 2OUMA 2OTLI 4RAGA 3ULQB 1Z3XA 1EF4A 2HKOA 2PMZA 4M9SA 3QYFA 1ULYA 1G3YA 2KHMA 1OCRH 2CQNA 1JUMA 2A5YB 2W4SA 3MZYA 5FD6A 2LR8A 1ETVA 1BI2A 2JSPA 5DM7F 1V54H 1UFMA 3AKZA 4EGZA 1QO0D 2XGEA 1WI9A 1X1PA 3EUHC 3LWFA 5CJ9A 5TRDA 2V9VA 1E0EA 2EIMH 3WTZA 1YQAA 4OAZA 3WU2C 2CH0A 2F5DA 1TNSA 4B3XA 4CZCA 2GQQA 1UG0A 1SANA 2A3SA 4A3MJ 3TP0A 1IW7F 3L00A 4XLPF 2XPWA 4KN7X 3RZDJ 3HOWJ 4QPQA 3C18A 4BE2A 4LOCA 3M1EA 3I5UA 4NQWB 4CO8A 2KPMA 2F4MB 2LH9A 4N9HA 1KU9A 1P6RA 1DP7P 3F8MA 3R61A 3PO2J 4HDVA 4YEJA 3FMRA 4JOMA 4XN0A 4AC0A 2LY1A 4KIFA 2JA5J 4G9YA 3A2KA 3S17J 1YS7A 1OPCA 2ZMEA 3F9KA 1U78A 1Y8QB 2WB1N 3ASOH 3S2WA 3E6CC 3V7RA 1BI1A 2YU9J 2QUFA 2DODA 2ZBKA 2IA1A 2DFEA 3FK6A 2X6WA 2VODA 4GFBA 1WFXA 3QRFF 2M0CA 3E6MA 2EPFA 3RJPA 1X3UA 1P2FA 4RAFA 4XMYA 2GBYA 5K5QA 4O3MA 1W5TA 3RKXA 4IVNA 2W48A 2IEKA 1JJ6C 4KYWA 2G0EA 4BHPA 1DDNA 2O5RA 4BUPA 2GA1A 3GTMJ 2JMWA 3PNVA 4OINF 4J01A 3TO9A 2G7UA 4M6YA 3WU0A 2X6XA 5C44J 1JKQC 4O6JA 2VL8A 1TL8A 1K4SA 2V1DA 1JTXA 2R7WA 1XTAA 1BA5A 3D5SC 2HPIA 1PUEE 5EDNA 3BZ6A 1RC9A 4EATA 2Z16A 3OS1A 3W2VA 3K4MA 4FCYA 5A2QZ 1DUXC 1ZLJA 5JLXA 2R7FA 4C3HJ 4UHTA 2HKXA 2I10A 2M7BA 4BS9A 2QZ8A 1ETOA 2O9LA 2FEZA 2V26A 3EYIA 4RB2C 3CF5F 4L9JA 3W6KB 4CCLA 3ZQLA 3HUGA 2FQ3A 1JXSA 3TQNA 1PDNC 2GLOA 2E7WA 4A3JJ 1RETA 4OMZA 4IL6C 4OIQF 1JJ8C 1ZRDA 2MSYA 4Y4RA 1MBKA 2WV1A 2EFWA 3OYDA 1D1CA 3CCYA 3GUDA 4AIHA 2F4OB 1FOXA 5F04A 4ABZA 5EZHA 3D5LA 2VE9A 1T08B 2L7MP 3TBIA 5IPAA 2F2EA 4PJLA 3OYJA 3OOUA 3HOZJ 4HSRA 2LYCA 3BG5A 3HZJA 3CLQA 3LQRA 4YFKF 2RVCA 2OTJI 4JYKA 1IXRC 3KP6A 2E71A 5KVRA 1IZ1A 2R7VA 1PP8F 2HNHA 3DXJF 1VQ8I 3BG6A 2HXIA 2ICWG 1FZPB 1Z3YA 3N05A 4HYEA 5M3FJ 2XGXA 4HNVA 1AU7A 2E1CA 3S15J 1V5EA 2TRTA 1XMXA 1LPQA 3I4MJ 2L5QA 3CF2A 3C1DA 4RGSA 3SFZA 2H8RA 1SMTA 3LSMA 4PDKA 1REPC 3CJQB 2JSCA 3DV8A 4XBFA 1VQ6I 5LEKA 2FU4A 2LTPA 3HB9A 4A3EJ 4CGZA 3ECOA 4J00A 3SEZA 4OAYA 1ZG1A 5DS9A 3K6GA 1Y0UA 4FHTA 1SD4A 3VYSB 1MBGA 5E1ZB 3KP3A 4FX0A 3HOXJ 2FSWA 4BGDA 4U0VA 1S9HA 2QA4I 2EFPA 1G6NA 4F7ZA 2EZHA 2KT0A 3T8RA 2V7FA 5HS9A 1UMQA 3B73A 1XS9A 2DT5A 2NS0A 3GLXA 4Y15A 4UUVA 1NTCA 3L09A 4HAMA 2M1BA 4ZDPA 1VQ5I 5CVJA 3A01B 2QEXI 2R3SA 3Q9SA 4FTHA 4PSWA 3WE2A 5HNFA 4JX6A 1SAXA 2LVSA 2H1KA 1D8KA 3O6BB 3SZGA 3GCMA 1OISA 3Q9VA 2K9MA 5FROA 4BE0A 1F5TA 3HPHA 4EMSA 2E5NA 5FKLA 4R8HA 2VBZA 2ESHA 3DPTA 4AYBN 3F23A 1T95A 5E17F 1X3WB 4G7HF 3CJTB 4HF0A 1Y8RB 1JHHA 4IQ4A 3BQZA 2HYJA 2LY9A 2LC2A 1F36A 3LL7A 4CCJA 2Q8KA 2OV7A 3L2UA 4IOCF 1O57A 2KJCA 5KCMA 3TP3A 1MNMC 2NNYA 4KT5C 3L2QA 3H5RA 4C9YA 3BJOA 2D45A 2HXOA 3ONQA 2QSGX 3C7JA 5F0FA 2V9KA 1FSHA 3KZYA 2EIKH 4MQVA 1FOKA 1J9IA 4LIUA 1MW7A 3KEQA 3L2RA 3J81K 4E70A 2OD5A 4IZZA 4RAYA 3WTTC 3HRSA 1VQNI 4E7ZA 3DTEA 2IA2A 2DN0A 1S29A 2DPUA 2ISYA 4D5FA 1LEBA 1GHCA 4N0BA 4XOTA 3G1OA 3CO6C 2M4KA 4X1EA 1MMAA 1X1BA 4Y3OA 1DPUA 1GUUA 3P5JA 3RPUD 2VASA 3RYPA 2YS9A 3G2BA 3UR3C 3GWZA 5DCMA 3ZQGA 2AS5F 5B1AH 1B8IA 3HOYJ 3W6JB 3CDIA 2MH2A 1HC8A 5K5RA 4O5VA 3R6SA 2AXLA 2AXTC 3OYMA 1I6XA 3MCZA 5B66C 4F92B 2ESNA 2QBYB 1I1SA 3QOPA 2MW8A 1BM9A 2D1HA 1CF7A 2VLAA 1STZA 3AG4H 3R0AA 3FHZA 2W82A 3M9AA 5EYRA 4KA4A 2WADA 4XRFA 2RREA 2DTRA 1TW2A 2DU9A 3DTIA 3F8BA 3Q3SA 3HGYA 3PQKA 4PCQA 4UVBA 4UNOA 1OLTA 1MBFA 1S6LA 3FM3A 4WWCA 2DFFA 2F48A 4GDFA 3S2HJ 1YJWI 3IRQA 4WX9A 4D0PA 3KEOA 3I56I 3I0TA 1WJCA 3W2AA 2FNAA 1IF1A 1BN5A 1JTYA 2FMLA 1AKHA 3MKYB 3J81Z 4M3FA 2ZSIB 1TW3A 1YW9A 3S14J 2W1OA 4M9ZA 3GYHX 1LKXA 2KMUA 5DUKA 4XSZF 3DP7A 3AG1H 4CXFA 2R7TA 2IPQX 2KZVA 3H9GA 3PNYA 1FBUA 3H9QA 3TMOA 2EZKA 4C30A 3LSTA 1JE8A 1IAWA 4EJVA 5DDGA 1ONVA 3HYIA 3JRBA 3MKZA 4XKVA 4WK8F 4MLOA 4HNUA 1RUOA 4HG2A 4Q5SF 2JUCA 4LK0F 4RGRA 3HPGA 1P4XA 2BE5F 1DP3A 2JA6J 1U6GA 4PZJA 1R6RA 3VDXA 2NVQJ 1Z6RA 1YJ9I 1U5TC 4G7OF 4R1HA 3CC2I 1YYVA 3MFKA 4A3CJ 2K4BA 2DPDA 2PJRB 2R93J 2NOGA 1SC7A 3BP8A 1ITYA 2A6HF 3EUKL 3WTWC 1ZH5A 2GOXB 2LLKA 3S1RJ 2VJIA 3IH4A 2RGVA 2WA0A 2DBBA 5CQGA 2VB6A 2QQBA 1U5TB 4I99C 3HGGA 2OBPA 2E36A 1BI0A 3ZMTA 2P5LC 5FLXK 4F93B 2HWVA 1WWXA 4BQQA 2E1MC 4WXCA 1A36A 2R7UA 3OOPA 3G3ZA 2GXBA 4IQJA 2STTA 3BR2A 5J8CA 3A03A 3JRAA 1HA8A 1B9MA 1RESA 3LSGA 2IJLA 3FF5A 3X2QH 1S8NA 1NG7A 2GXAA 2VC0A 1H88C 1D0YA 2A05A 1FX7A 2UV1A 1ETKA 2E1MB 1Q1VA 2IS1A 2VQCA 4HW0A 2O61A 3CQZJ 3QU6A 3BY6A 3NWTA 1X3ZB 2WWYA 3ERED 1K78A 1JGGA 4U7BA 1WZ2A 2KISA 2M5WA 3HJEA 1Z9CA 1L0OC 3COAC 1GXPA 3SJMA 1U2WA 3C2GA 2M8GX 2Q1ZB 2M30A 4A0XA 2R92J 2FNPA 3OYCA 2XPUA 3SEQA 4OU0A 2P81A 3GFJA 2KRFA 4A3GJ 1XB4A 2HQNA 1H89C 2PEXA 4LG0B 2P7CB 4I01A 1NG6A 4FISA 1GVDA 3V8LA 4A3IJ 3DBRB 5DV5A 3CCMI 2V6EA 5LLQA 3DTKA 4KFCA 2LY2A 4EM2A 4IPAA 4ASNA 1VQ4I 4IXAA 1HSJA 3C2HA 2IRFG 3TEDA 3MQ0A 2LFBA 1K79A 3GLLA 4I98B 1YG2A 3FKIJ 2DQRA 5EF6A 1R1UA 2ZSHB 4HA8A 2VUMJ 4IHWA 1N25A 2EV0A 2K85A 5B5EC 2LMDA 3IHUA 5HDKA 3U9GA 1MJBA 4OOIA 5FLXZ 2E34A 3NAUA 3VFZA 4E7JA 3CMMA 3PFYA 3ZR8X 3G1MA 4B1RA 1FMWA 2EILH 4L18B 2K02A 2X6OA 1T0FA 3R4KA 1U9OA 3B6AA 1HW2A 3FXRA 2Y75A 3K9TA 3RTRA 5J1UA 4BKXA 2ZKZA 1FWZA 1O7LA 4ESFA 4P9UA 4A3FJ 2X0LA 2Z5UA 1U8BA 4KNYA 1QGPA 2TDXA 3RI4A 1P9QC 3TOAA 1IO2A 1TTYA 4F52A 1WRJA 2HPMA 2OA4A 1R5ID 3OS0A 3LSIA 3JR9A 1NHAA 1OCPA 2WBMA 3H0GJ 1PUFB 3G4SI 2HQ5A 2I8DA 3S16J 2RDPA 2W24A 3OL4A 4NHJA 1Y39A 5IYCJ 3CJNA 2ZC2A 1VQPI 4UV8A 2H8WA 4OIPF 2CQQA 5K7ZA 3GTQJ 2XAUA 5HS7A 4AVPA 5HLTA 3PJRA 2H6CA 3I71A 3FWEA 3P7NA 4XL9A 3CUOA 3S1MJ 4F3QA 1RRJA 5FRNA 4Q47A 1TWCJ 4A6DA 1XG1A 3KYLA 4UV9A 4RAZA 2E7XA 3REOA 2XAFA 4NC7A 3I59A 2L4AA 2LOOA 3P9CA 5KK1A 3ZN0A 1KQ9A 3V8JA 2F5EA 3IUOA 5FGMA 1LDJA 1XX5A 2Y30A 2K3FA 1IN5A 4E6KG 1QZYA 5D6FA 2MH9A 3PIPF 2IA0A 4ON0A 3OYNA 1ON2A 3L2WA 4DBRA 1MGTA 2YPRA 3ECHA 2EZIA 4D1QA 2HS5A 4PSXA 4MFEA 1R7JA 3AFHA 2X48A 2FOKA 4MTDA 4C3IJ 3DLLF 3ZQCA 1CGPA 1IGNA 1POGA 2HYGD 5E8GA 4BEHA 3BQYA 5HODA 1N78A 1TNTA 2WB1A 2W84A 1BBYA 3K4JA 2QSFX 2IGOA 2VC1A 1PYVA 3BPVA 5AIQA 1T6SA 5ICEA 1XSVA 2BY2A 2Z33A 3S93A 4G7ZF 3OMYA 4I6ZA 5GTIC 2LDUA 3BWGA 3FDYA 4A3LJ 2L01A 1FBQA 3ZMDA 2NAZA 4HOBA 2QQ8A 2VQLA 3GTOJ 3RQ4A 5LHHA 1ORKA 2DA2A 4XLEA 4Q4ZF 4L5JA 3IKTA 4HF1A 4L5EA 6PAXA 1OR7C 3KE2A 3F6VA 3VWBA 5E3LA 5L3EA 3QPTA 4JP0A 5CYVA 2MC4A 4IRGA 4ZDOA 4BHBA 4C2MJ 2R7ZJ 5TJJA 3H35A 2A61A 1KA8A 3GFLA 5GTHC 1FTTA 4BYYA 3BG7A 1HDPA 1MMNA 4XKCA 5E18F 2DA4A 3CMAI 1BW5A 2R5ZA 1J2XA 4G6QA 3QODA 5F6FA 4P5OA 3J80Z 3LFUA 4A0YA 4WCGA 3DKWA 5L3FA 4V2FA 2L54A 2CJJA 4LITA 4X6AJ 3GTLJ 1BL0A 1U3EM 1IN4A 3BR0A 5FD5A 1EH7A 3DQVC 5B1BH 1YE9A 3E0JB 3AAFA 3KLNA 3KP5A 3KYCB 3T0YA 5D8LB 2CQXA 1YOVB 3CO7C 1IRZA 2O6GE 3OYBA 1MJ9A 1B72A 3MZHA 3AG3H 4I02A 2Q2EA 3DEEA 4LGWA 3SDGA 2M3AA 3T1BA 3ZMUA 4ZZLA 2CW7A 2LK2A 3HXLA 4I09A 3M4OJ 2HGCA 4JK1X 1FNNA 2M45A 1P7IA 1HKTA 2AHQA 1BW6A 5IT9K 1HOMA 1EA3A 2LNBA 1Z6TA 3NRVA 3QU3A 1JUSA 1DGRM 1MBEA 2M7AA 3QQAA 1JI8A 1BI3A 1W7PB 5D6EA 1LE8A 1XC5A 3F3XA 5JI6A 4IRHA 1V5GA 1FP1D 1B1BA 3BR1A 3TO7A 5JVGF 4AWXB 2MC3A 4KITB 2EFOA 4IHSA 3SQNA 1J5YA 5ILVA 1Z67A 4BAYA 3PUBA 4UUSB 4M71A 4IHXA 3BPXA 1F1ZA 5DCFA 3O2PE 4BHCA 1TWHJ 3PM1A 3LSHA 4DIQA 1MNEA 1GXQA 1R49A 3WHCA 3D5RC 2R7OA 2LKXA 2QKLB 5FFXA 3M1CA 2EWNA 1GT0C 4MIMA 2Y31A 3JW4A 1HDDC 3KFWX 4HBLA 5EGOB 1AWCA 4P9FA 2DAOA 1XMKA 1D0ZA 4YRVA 1JT6A 3CESA 3L2VA 4E7IA 4ESBA 2FBIA 1YX5A 3E7LA 1LB2A 3CUQC 4GYGA 1X58A 3LA3A 4AIDA 2M2EA 3RPUA 1D5YA 2QYOA 1MMGA 5M5XJ 1E3PA 4MEYF 3K10A 2E2HJ 3LSJA 3CCQI 2K3PA 2K40A 2K86A 5IT3A 2LBFA 1JHFA 3DBHB 2KJBA 3CUQB 5H6QA 4EVIA 2EJRA 4OIOF 1ERDA 3MKWB 3CD6I 2IW5A 4B4CA 1I1GA 4GRIA 1VQ9I 3TO6A 2ME6A 1VQOI 2IAIA 2L7ZA 2E2IJ 1HW5A 2NVTJ 4RB0A 2KIQA 3BT9A 5L3CA 2ZJQF 3CC4I 1ZELA 4AYBA 1OJLA 2ELHA 1XCVA 3PFIA 4A93J 3K4CA 4Y7NJ 5IOYA 1N75A 5JHUA 2Z9OA 1ETYA 1W5SA 3EETA 5L3BA 3AG2H 2NXNB 2MA3A 4S0HB 1X4OA 2HOAA 5DM6F 1X1AA 2QQAA 3I55I 2CV2A 2DT7B 4P96A 1K61A 5EG0A 2ZFUA 2EV5A 3BG3A 3CMEI 1DU0A 2IXSA 3U1KA 2GIVA 3SYTA 1J75A 2X1DA 3ASNH 1SD5A 4XQFA 1GVJA 3CCLI 2FD5A 2VQHA 3DBLB 5ED4A 1QVUA 4HV5A 2ECBA 2COMA 3PSIA 4L0YB 1ZQ3P 1FBSA 2UXNA 2BW3B 1A04A 1YX3A 3IP4B 4S04A 4L9VA 5ICGA 1UHSA 1SAUA 4P1WA 4RA2A 4ENNA 2KQRA 4B44A 3ABTA 1V55H 2BOLA 4XSXF 4LG3A 1D0XA 4L9NA 2DQLA 2DTZA 3HG9A 4ZC3A 4GXOA 3CCUI 1D5VA 1GDTA 4B43A 4U0WA 4LLGF 4CCKA 4L9TA 3BDDA 2ZO4A 1MMSA 4XM3A 1IV6A 3ABMH 3BTLA 4M72A 1QZEA 3RYRA 3HDDA 1BIBA 2HZDA 1OYWA 1BR1A 2E60A 1ZR4A 1G4DA 3ML6A 1BR2A 3CDLA 1MDMB 3BG9A 2EIJH 2WV0A 1Q1HA 3CMYA 1TQMA 2MGQA 3ESWB 2OC6A 1ZKGA 1WJFA 5GADJ 3C2BA 4DBQA 3AL0C 3QYBA 3VYRB 4V2GA 2VT3A 2HZTA 3FKJA 3D0SA 1HXDA 4HX8A 4PJ0C 1A5JA 4A3DJ 4XRMA 1YHQI 3IKVA 1V3FA 1P7JA 2GA2A 1RZ4A 2FX0A 2HVSA 3OYHA 2L9VA 3BTJA 1SD6A 2HQAA 4CCOA 5GP9A 3AL0B 2DJIA 2LKPA 1MJAA 4XLNF 2LG4A 2ZJPF 1G3SA 3LAJA 1LVAA 5DYMA 1LEAA 2UXXA 3QP6A 4BXUA 4MGRA 4LMYA 1VQMI 2HEOA 1ETWA 2IBDA 3KCCA 3V7CA 3L9FA 3QPHA 4KIBA 2R5YA 3WODF 1SFUA 3ABLH 3HOUJ 3A1YA 3KYDB 2DLLA 4CYDA 4G8XA 1QVTA 5ILSA 5IP7J 4IHVA 2VKDA 3OY9A 3OYAA 1LDKB 3VODA 3BR3A 4KIGA 2F6CA 5F64A 3W3CA 2XC7A 4IOAF 1S7AA 1FYMA 2L02A 2ZXJA 4HX7A 2CRGA 2RV8A 1SFEA 4IHTA 4ETSA 2OPTA 4LLLA 3DPUA 4OMYA 2JPBA 3LA2A 1MSFC 4YIRX 1YJNI 3HHGA 1F43A 1BOAA 1WH7A 4I0BA 4PGHA 1C0WA 2IGNA 2XGCA 1B6AA 2GOMA 2YR2A 2DMTA 2DA1A 5TGTA 3DKYA 1LNWA 1SVOA 4KICA 4BE1A 1WPKA 2DOEA 1G59A 1S3JA 2L7FP 3F8CA 3E1SA 3HEFA 3I58A 3PSFA 3VB2A 4CYCA 1QHGA 4E7KA 5ERIA 1I39A 1IDZA 3GMEA 4LIVA 4ZYHA 4U7DA 2VOOA 5F0CA 4LK1F 1WHUA 2FXAA 3GTGJ 5DD8A 1T2KA 2HOSA 2XSJC 4BXXJ 1R71A 1TT0A 4EM0B 1IUYA 5HS8A 2EFNA 5BPIA 5DEQA 1VI0A 4I0AA 5BPDA 2XAGA 1YI2I 1OFCX 2VXDA 1IN6A 1TWGJ 5LBQA 1T39A 5GAGJ 5HVQC 2FBKA 1FMVA 1XPXA 4RS8A 1HCRA 3J7AY 3DEUA 1NK3P 1F9NA 3ZCOA 2VJ5A 1ZGAA 1KU7A 4W1UA 2A69F 3SHFA 2UWMA 3QOEA 1KYWA 2ZNZA 3KPHA 4OIRF 4D5CA 4IEJA 1YRNB 3JSPA 1D3YA 3LMMA 2UUZA 2L4MA 4M6XA 3H3ZA 2N8GA 2F5CA 3Q5FA 5K7FA 1KU2A 1ZRFA 3A02A 2BHZA 2ZNYA 3PUFA 5HNHA 3GTJJ 2EINH 4XONA 2JK3A 3IAM2 5KHDA 3LSRA 4XKWA 3QAHA 4JX5A 2R7XA 2XV4S 4QIWN 2B63J 2EBIA 4BDZA 3EUHA 1Z77A 4PK4A 3SZTA 3VEPA 3WTVC 3GTPJ 3C3WA 3R60A 2QCOA 4NQWA 4M3EA 4PFOA 3IWFA 2AQEA 2V1UA 1K83J 3SZPA 3V42A 4ZYEA 4GYIA 1W1WE 3QPSA 1IXSB 4EEFG 2DFHA 4E4HA 1AOYA 2DMQA 3RZOJ 2HU9A 1XCBA 3GBGA 2ZXHA 3DFGA 3K70C 2GIZA 3E6DA 2CWEA 2CW8A 2R0QC 4NNJA 3KETA 3MZ8A 3S8PA 3CJRB 2H09A 1R5HA 3JSOA 1QU3A 3GFMA 1QRYA 2DOAA 1FIPA 3HSFA 3JRGA 4BH9A 3WTYC 1FC3A 3S32A 2M0MA 3ZQ7A 4C3JJ 1ON1A 2CSOA 1B9NA 2ZMEC 5LD2C 3GZ5A 3OL3A 5H20A 3K1PA 3QYEA 1JKRC 1MMDA 3FXMA 2VBWA 2X1EA 4DZPA 5M3MJ 3ZN1A 1WQ2A 4BJ6C 1VFCA 4GO1A 3BTIA 3O8HA 4C2UA 4PUSA 1J09A 3GVAA 4RMNA 2FA5A 2ZMEB 2K9NA 4RGUA 4A12A 4I7HA 2OZ6A 4RLQA 1ZARA 2BVLA 1LVKA 2VJJA 3EPZA 1TZLA 2FBHA 3CCRI 3LQQA 3ZOBA 1IJWC 2YX7A 4IKFA 4ENKA 1OCTC 1ZGJA 1Z21A 1FOWA 2W85A 2O7OA 5ILUA 2NVYJ 3U2RA 1G8XA 3BZCA 3F22A 3F72A 2JA2A 5AONA 1HF0A 1E17A 1JT0A 1OYIA 3FX3A 3UKGA 4QLCU 1ZK8A 2VKHA 3OIOA 5FO5A 2ELKA 4DOZA 1K7AA 3DF8A 2NOJB 2L7KA 2FUG2 3Q0WA 4ZDLA 2RNGA 3TGNA 1SVMA 3NARA 1I6HJ 2AO9A 4DQ2A 1VQLI 3GZ6A 4DNCA 3M8EA 2DDAA 2CG4A 5FKMA 4YIIA 4KT6A 2JWTA 2XASA 5KNLA 4P55A 3KZZA 2HVRA 4F55A 2LKSA 2CO5A 2H6BA 3E5UA 1OCCH 3K4NA 5EZGA 2CUJA 2DYSH 3FMSA 3HUGB 2VONA 3P9KA 4NBQA 1IXCA 1B4AA 3TDUC 3JRCA 4CCNA 1JUPA 5J3LA 2NVUB 5J1RA 5E3OA 2HTSA 2VIXA 1Y0NA 1JKOC 2XROA 4BACA 2FOWA 2LREA 3FZVA 4G6TB 1Y56A 5HDGA 2I5UA 1KYZA 2VN2A 2GM4A 1E2XA 2R7RA 3K1MA 4L0ZB 4MTEA 4I76A 1R4NB 2ID3A 1IRXA 2ELJA 5JHFA 1FOYA 3I53A 3H5NA 4XKBA 1UHWA 1XGSA 3K0LA 1MZBA 2Y0SN 5E1WA 4ZYDA 1T8IA 2H27A 2EH3A 1TWAJ 3QP5A 3BLYA 2K9SA 3A01A 3CC7I 1YS6A 3PNTA 3FXKA 4AM3A 4M3GA 1BIAA 2EZLA 4Y17A 2BEOA 2RQQA 4U88A 1BJAA 2D5VA 5FRMA 2DXIA 3OYIA 2UZKA 1YIOA 1RNLA 1W7PD 1F4KA 1Z1DA 3CTAA 3DPLC 2P5VA 2Y0MA 1FY7A 5FB2A 5K5OA 1LFUP 1D8JA 2ZFWA 5J40A 4A5MA 4M6VA 2HI3A 3FBIB 4Y13A 5D5UB 1FYKA 5D5XB 1BC7C 2WAFA 1HQCA 4NB5A 4WF2A 1ZREA 2Y48A 2CFXA 1A31A 1R1VA 2K9QA 4KN4X 4M3BA 5FFZA 1IDYA 1WVRA 5C4XJ 4RLFA 2E19A 4AU7A 1U9NA 2FE3A 3OYKA 4HQMA 5AIPA 2O3FA 2Z2SB 4N4OB 2RAEA 5E79C 2GZWA 4RBOA 3TW7A 3HRTA 2VBXA 1QNTA 5J47A 3J7AO 1USSA 4BQAA 2DT6A 2PMHA 2X6YA 3BTCA 3H1CA 4QSHA 5HLHA 3OSGA 1LQ1A 2HQRA 2J5PA 2XUBA 4NC6A 1RR8C 1ZAOA 2XAJA 2X1CA 1TBXA 1YW7A 3IAS2 4LJZF 2BY1A 1MIJA 5DD4A 3Q0VA 3RSNA 2DK8A 4QPOA 3M07A 3OR1C 1MH3A 4UB6C 3H36A 2HYFA 4XOPA 2K9LA 3PO3J 5CVUA 2XF5A 3I3LA 3M7GA 4BJTA 5C4JJ 2HDDA 4XORA 4IJAA 1IUFA 2BVMA 1ETQA 3BOQA 2KZGA 2O03A 3ISPA 5LGTA 1LUJB 2QBYA 5B3SH 3JRFA 1QPIA 1ZN2A 4H0EA 3MD2A 1R23A 2CU7A 2XF6A 2R7SA 4HLYA 5IOZA 3G6EI 2JA8J 5CVIA 2HTJA 3M8FA 1I50J 3VSLA 3OYGA 3TKYA 3O3KA 3GO5A 2JQ7A 4FT8A 1J7KA 4ENJA 3FXOA 2ZXIA 2JPCA 5ICFA 3SXYA 3ZMVA 3HBLA 5JFRA 2W7NA 3BC8A 1SVLA 4RB3C 5GPCA 3JRIA 1KQ0A 4ZTJA 3OIQA 2A68F 2JUGA 4CCMA 5DCMB 2EQRA 2BXZA 1B8IB 5BNGA 2QLZA 3BCBA 2Q0OA 3IH3A 5BOXA 1BC8C 2VI6A 2LRDA 2OQRA 3ROUA 2WAQA 1SFOJ 4XRSA 1Z05A 2VQGA 1R22A 2YX4A 1H9GA 1S7OA 2CW0F 5KAFC 5L3GA 3IH2A 2FQ4A 5FLVA 1YW8A 2O8KA 1LDDA 1OCZH 1WH5A 4XICA 1KZHA 3GEZA 5LGNA 1CF7B 3EDPA 1UCRA 5CPRB 5K1YA 2XB5A 3E6BA 4CH7A 4RDUA 3UNGC 1W36D 3WHBA 3F6OA 3ZQHA 3HTUA 1E3HA 3V7SA 2KLOA 3ZXSA 5IYBJ 2PQ8A 5LGUA 2BV6A 2LP0A 2XB0X 2Y69H 3G73A 1FIAA 4DGWB 4AIJA 2CUEA 3DU5A 4WXHA 2PJRA 3KP2A 3W6VA 3K2ZA 2DMPA 3L1PA 2CQ7A 5A2QK 3OV8A 3MVPA 5F08A 2X9DA 1AKHB 3FMQA 2P6TA 1FLIA 1UG2A 4XLFA 1U5TA 1V5FA 3JAMK 3HSEA 5EEGA 2MLKA 3F0CA 3KEYA 5IYDJ 2Y9YA 3N4MA 1W0TA 3B6CA 4PJJA 3ZPLA 3HKZA 2KDZA 5J1YA 4MQ9F 1Y1WJ 1QA6A 2IVMA 3FM5A 3DLAA 5EEAA 1ACIA 4G12A 2JVHA 2LSOA 1OQYA 3P9IA 3CZ6A 2O0YA 3HC7A 3LFKA 2EB7A 2KIUA 3GFIA 5HOOA 1YO5C 5IT9Z 4UVCA 2L9SA 2XDVA 2ECCA 4K2EA 3WTUC 4MFDA 1I5ZA 3VPRA 3H9JA 2CYYA 1XD7A 5M5WJ 3K2AA 2PX9A 1IN8A 2QENA 3EUAA 4XIDA 4A2UA 2DYRH 2DJNA 4EGYA 5FKNA 2RNJA 5ICCA 1ODDA 2H94A 4Z6YA 3CCVI 1IRFA 2H1LA 2EA4A 4N4NB 2NRAC 2MYSA 2CMPA 2KL4A 4IX7A 1HLVA 1UAAA 4BBRJ 4LG0A 1IV8A 2A07F 2ZB9A 1G3WA 2KIFA 4CZZA 3PL8A 4YFNF 3WGIA 3HSRA 5IY5H 4A3BJ 1YIJI 3BROA 4IRIA
chains in the Genus database with same CATH topology
3SJMA 1IDZA 2M8GX 2ME0A 5F0CA 3Q0UA 2R92J 3GTGJ 1S7EA 2XPUA 4A3KJ 1AHDP 2HOSA 5FKOA 2P81A 4BXXJ 4A3GJ 3JRDA 5JLWA 2VKEA 1WCMJ 1H89C 3O8GA 1TWFJ 1VI0A 4FISA 1GVDA 1OFCX 1YRNA 4A3IJ 1TWGJ 2YUSA 4CYCB 2DMNA 3G1LA 3IV5A 3TEDA 2LFBA 4DW6A 2WAQN 2VPRA 3FKIJ 1GV5A 4AUXA 1HCRA 5EF6A 1NK3P 2PMZN 2VUMJ 1VF9A 4IHWA 4W1UA 2HOTA 1RR7A 1G2HA 4D5CA 1YRNB 4IEJA 3NAUA 1PUFA 2VKVA 2N8GA 2JA7J 3G1MA 4B1RA 5K7FA 1TC3C 2X6OA 3A02A 1EF4A 1U9OA 3B6AA 5J1UA 4BKXA 3GTJJ 4A3FJ 1U8BA 2JK3A 3LSRA 1JUMA 1BJZA 2LR8A 4JX5A 1ETVA 4QIWN 2B63J 2EBIA 1JKPC 3JRHA 3JR9A 1OCPA 1Z77A 3H0GJ 1PUFB 1ZGWA 1ZR2A 3GTPJ 2HQ5A 2L0KA 2QCOA 3S16J 4M3EA 2XGEA 5IYCJ 1K83J 3HKZN 2CQQA 5K7ZA 3GTQJ 3QPSA 3QPLA 4EEFG 1SANA 4A3MJ 3TP0A 3S1MJ 4BY1J 2DMQA 3RZOJ 3GBGA 2XPWA 3RZDJ 2M34A 3HOWJ 1TWCJ 1XG1A 2R0QC 4LOCA 4DYRA 3S1NJ 4BBSJ 3PO2J 1QRYA 4AC0A 1FIPA 3JRGA 2M9HA 2Y30A 2JA5J 3S17J 4C3JJ 1U78A 2WB1N 1O4XA 3MN2A 2YU9J 2JN6A 4JX4A 3FK6A 2EZIA 4GFBA 1RPWA 1JKRC 1MBJA 2M0CA 4MFEA 2X48A 4C3IJ 4FE7A 4DZPA 3ZQCA 5M3MJ 1POGA 1IGNA 3FK7A 2GBYA 1R9TJ 1FTZA 1VFCA 3BQYA 3BTIA 3O8HA 5HODA 2W48A 2IEKA 1JJ6C 2G0EA 3GTMJ 2K9NA 2JMWA 5IP9J 2L9RA 4Y52J 3BR6A 5C44J 1JKQC 4I6ZA 1IJWC 1ETXA 3ZOBA 1APLC 1JTXA 4A3LJ 5F0HA 5K7HA 1BA5A 3GTOJ 5EDNA 1OCTC 2O7OA 2DA3A 1ORKA 2NVYJ 2DA2A 4FCYA 4L5EA 5JLXA 1HF0A 2DMUA 4C3HJ 1JT0A 2I10A 5E3LA 3UKGA 1ETOA 1ZK8A 3OIOA 2O9LA 4JP0A 2ELKA 2E1OA 4C2MJ 5FKKA 2R7ZJ 3ZQLA 3Q0WA 1FTTA 3NARA 1I6HJ 1HDPA 2AO9A 2GLOA 2DA4A 3FIWA 1BW5A 4A3JJ 2R5ZA 5FKMA 1RETA 5M5YJ 2JWTA 1JJ8C 1DU6A 2MSYA 5C3EJ 1MBKA 4V2FA 2WV1A 1T56A 2CJJA 4X6AJ 3GTLJ 1BL0A 3CCYA 3BR0A 4B3AA 1CQTA 5EZGA 5F04A 4ABZA 5EZHA 2L7MP 5IPAA 2Y2ZA 3JRCA 2CQXA 3OOUA 1JUPA 3HOZJ 5J3LA 1IRZA 3ZQFA 2R5ZB 5J1RA 1RKWA 3BG5A 3TW6A 5E3OA 1B72A 3SFIA 4IHYA 2JJ7A 2CUFA 3SDGA 1JKOC 2LK2A 4JYKA 1X2NA 1GV2A 2ID6A 3M4OJ 1P7IA 1I3QJ 2AHQA 1BW6A 1HOMA 2HXIA 4UUSA 2GM4A 1JUSA 5M3FJ 1MBEA 4I76A 4HNVA 1AU7A 3QQAA 1NK2P 3S15J 2ID3A 1ENHA 2TRTA 1RKTA 1LE8A 1XC5A 3S2DJ 3I4MJ 2QF7A 1B72B 2NS8A 2H8RA 3BR1A 3BR5A 2Y0SN 4A3EJ 2LTPA 3HB9A 3MKLA 5EGOA 3HOVJ 2EH3A 1TWAJ 3H3VK 2K9SA 4UUTA 3A01A 1E3OC 4UUSB 1MH4A 4IHXA 5DS9A 5FLMJ 1FJLA 1TWHJ 3PM1A 1MBGA 3GTKJ 3HOXJ 1LE8B 4M3GA 4QTRA 4DYCA 2EZLA 3WHCA 2D5VA 2LKXA 2EZHA 2KT0A 4DYQA 1UMQA 1GT0C 4XK4A 4MIMA 1XS9A 2Y31A 1HDDC 2NVXJ 2FJ1A 5EGOB 1NTCA 2LD5A 1LFUP 4M6VA 3A01B 1JT6A 2HI3A 4FTHA 1WI3A 3E7LA 5DTDA 5F27A 4JX6A 3LOCA 1X58A 2LVSA 2M2EA 2H1KA 1D5YA 3D1NI 2K9QA 3OSFA 4BY7J 3HM5A 4M3BA 5M5XJ 1IDYA 5FKLA 3LNQA 5C4XJ 2E19A 2E2JJ 1U9NA 2E2HJ 3LSJA 4AYBN 2K40A 2RAEA 3BQZA 2HYJA 3DCFA 4RBOA 3TW7A 2LY9A 1F36A 4B4CA 1H8AC 2OF7A 1A6IA 3BTCA 3ZQIA 3OSGA 4QSHA 2ME6A 2IAIA 1MNMC 2L7ZA 3TP3A 2E2IJ 2NVTJ 2HXOA 3BT9A 5F0FA 3Q0VA 3RKQA 1OJLA 4A93J 4Y7NJ 5IOYA 1MH3A 1ETYA 4W97A 2DA6A 4S0HB 2HOAA 3PO3J 5C4JJ 2DN0A 2HDDA 1K61A 4D5FA 5EG0A 1IC8A 5GPAA 1IUFA 1DU0A 3BG3A 1ETQA 3G1OA 4X1EA 1LFBA 5E3NA 1GUUA 3JRFA 1QPIA 2DA5A 3JREA 2YS9A 1Z0XA 2FD5A 2CU7A 3ZQGA 2COBA 1QVUA 2Y9ZA 1B8IA 1X2MA 5IOZA 2JA8J 2ECBA 2MG4A 3HOYJ 1ZTRA 3LSPA 1I50J 1ZQ3P 1W0UA 5FJ8J 5EG0B 1T33A 4J19A 4A69C 3HBLA 1UHSA 4D7NA 5GPCA 3JRIA 3K7AJ 2MW8A 2DTZA 3S1QJ 3FISA 1GDTA 2EQRA 4MO7A 1B8IB 2XPVA 5BNGA 3RQIA 5EYRA 1MSEC 4NDLA 3IH3A 2VI6A 3Q3SA 3HGYA 1SFOJ 1IV6A 1MBFA 3BTLA 4XRSA 3HDDA 3S2HJ 3IH2A 2FQ4A 1FEXA 5FLVA 1ZR4A 2O8KA 4FE4A 4DZJA 1WH5A 4XICA 3CDLA 3BG9A 3CMYA 1JTYA 2XB5A 1AKHA 1VNDA 2MGQA 4XRSG 1ZKGA 4RDUA 4M3FA 3C2BA 3WHBA 3ZQHA 3S14J 5IYBJ 4D7MA 3DEWA 5IP6A 4V2GA 2LP0A 2XB0X 1A5JA 4A3DJ 1FIAA 4XRMA 2CUEA 1P7JA 2XGDA 3W6VA 2EZKA 2DMPA 2FX0A 4M3DA 3L1PA 3BTJA 3JRBA 3MVPA 5GP9A 5F08A 2X9DA 4MLOA 1AKHB 1UG2A 1WGXA 9ANTA 2JA6J 2NVQJ 1ETWA 2IBDA 3F0CA 5E3MA 5IYDJ 2Y9YA 1W0TA 3B6CA 2R5YA 4A3CJ 3HOUJ 2KDZA 5J1YA 2R93J 1Y1WJ 1Y1VJ 1MBHA 2NOGA 3I4NJ 5EEAA 1QVTA 1ITYA 4G12A 5IP7J 4IHVA 2LLKA 3S1RJ 3IH4A 2TCTA 3BR3A 1IG7A 2DA7A 2ECCA 3HGGA 2XRLA 4MFDA 2CRGA 3VPRA 2OPTA 5M5WJ 3K2AA 2R5YB 4XIDA 2DJNA 5FKNA 1MSFC 3BR2A 3A03A 3JRAA 5F1JA 2XSDC 1F43A 1RESA 1WH7A 3LSGA 2XGCA 1H88C 1HLVA 2DMTA 4BBRJ 2DA1A 1ETKA 2NS7A 1Q1VA 2ZB9A 3CQZJ 1JGGA 3M3YJ 1WPKA 3HEFA 2L7FP 4CYCA 4A3BJ
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3SJM A;  1IDZ A;  2M8G X;  2ME0 A;  5F0C A;  3Q0U A;  2R92 J;  3GTG J;  1S7E A;  2XPU A;  4A3K J;  1AHD P;  2HOS A;  5FKO A;  2P81 A;  4BXX J;  4A3G J;  3JRD A;  5JLW A;  2VKE A;  1WCM J;  1H89 C;  3O8G A;  1TWF J;  1VI0 A;  4FIS A;  1GVD A;  1OFC X;  1YRN A;  4A3I J;  1TWG J;  2YUS A;  4CYC B;  2DMN A;  3G1L A;  3IV5 A;  3TED A;  2LFB A;  4DW6 A;  2WAQ N;  2VPR A;  3FKI J;  1GV5 A;  4AUX A;  1HCR A;  5EF6 A;  1NK3 P;  2PMZ N;  2VUM J;  1VF9 A;  4IHW A;  4W1U A;  2HOT A;  1RR7 A;  1G2H A;  4D5C A;  1YRN B;  4IEJ A;  3NAU A;  1PUF A;  2VKV A;  2N8G A;  2JA7 J;  3G1M A;  4B1R A;  5K7F A;  1TC3 C;  2X6O A;  3A02 A;  1EF4 A;  1U9O A;  3B6A A;  5J1U A;  4BKX A;  3GTJ J;  4A3F J;  1U8B A;  2JK3 A;  3LSR A;  1JUM A;  1BJZ A;  2LR8 A;  4JX5 A;  1ETV A;  4QIW N;  2B63 J;  2EBI A;  1JKP C;  3JRH A;  3JR9 A;  1OCP A;  1Z77 A;  3H0G J;  1PUF B;  1ZGW A;  1ZR2 A;  3GTP J;  2HQ5 A;  2L0K A;  2QCO A;  3S16 J;  4M3E A;  2XGE A;  5IYC J;  1K83 J;  3HKZ N;  2CQQ A;  5K7Z A;  3GTQ J;  3QPS A;  3QPL A;  4EEF G;  1SAN A;  4A3M J;  3TP0 A;  3S1M J;  4BY1 J;  2DMQ A;  3RZO J;  3GBG A;  2XPW A;  3RZD J;  2M34 A;  3HOW J;  1TWC J;  1XG1 A;  2R0Q C;  4LOC A;  4DYR A;  3S1N J;  4BBS J;  3PO2 J;  1QRY A;  4AC0 A;  1FIP A;  3JRG A;  2M9H A;  2Y30 A;  2JA5 J;  3S17 J;  4C3J J;  1U78 A;  2WB1 N;  1O4X A;  3MN2 A;  2YU9 J;  2JN6 A;  4JX4 A;  3FK6 A;  2EZI A;  4GFB A;  1RPW A;  1JKR C;  1MBJ A;  2M0C A;  4MFE A;  2X48 A;  4C3I J;  4FE7 A;  4DZP A;  3ZQC A;  5M3M J;  1POG A;  1IGN A;  3FK7 A;  2GBY A;  1R9T J;  1FTZ A;  1VFC A;  3BQY A;  3BTI A;  3O8H A;  5HOD A;  2W48 A;  2IEK A;  1JJ6 C;  2G0E A;  3GTM J;  2K9N A;  2JMW A;  5IP9 J;  2L9R A;  4Y52 J;  3BR6 A;  5C44 J;  1JKQ C;  4I6Z A;  1IJW C;  1ETX A;  3ZOB A;  1APL C;  1JTX A;  4A3L J;  5F0H A;  5K7H A;  1BA5 A;  3GTO J;  5EDN A;  1OCT C;  2O7O A;  2DA3 A;  1ORK A;  2NVY J;  2DA2 A;  4FCY A;  4L5E A;  5JLX A;  1HF0 A;  2DMU A;  4C3H J;  1JT0 A;  2I10 A;  5E3L A;  3UKG A;  1ETO A;  1ZK8 A;  3OIO A;  2O9L A;  4JP0 A;  2ELK A;  2E1O A;  4C2M J;  5FKK A;  2R7Z J;  3ZQL A;  3Q0W A;  1FTT A;  3NAR A;  1I6H J;  1HDP A;  2AO9 A;  2GLO A;  2DA4 A;  3FIW A;  1BW5 A;  4A3J J;  2R5Z A;  5FKM A;  1RET A;  5M5Y J;  2JWT A;  1JJ8 C;  1DU6 A;  2MSY A;  5C3E J;  1MBK A;  4V2F A;  2WV1 A;  1T56 A;  2CJJ A;  4X6A J;  3GTL J;  1BL0 A;  3CCY A;  3BR0 A;  4B3A A;  1CQT A;  5EZG A;  5F04 A;  4ABZ A;  5EZH A;  2L7M P;  5IPA A;  2Y2Z A;  3JRC A;  2CQX A;  3OOU A;  1JUP A;  3HOZ J;  5J3L A;  1IRZ A;  3ZQF A;  2R5Z B;  5J1R A;  1RKW A;  3BG5 A;  3TW6 A;  5E3O A;  1B72 A;  3SFI A;  4IHY A;  2JJ7 A;  2CUF A;  3SDG A;  1JKO C;  2LK2 A;  4JYK A;  1X2N A;  1GV2 A;  2ID6 A;  3M4O J;  1P7I A;  1I3Q J;  2AHQ A;  1BW6 A;  1HOM A;  2HXI A;  4UUS A;  2GM4 A;  1JUS A;  5M3F J;  1MBE A;  4I76 A;  4HNV A;  1AU7 A;  3QQA A;  1NK2 P;  3S15 J;  2ID3 A;  1ENH A;  2TRT A;  1RKT A;  1LE8 A;  1XC5 A;  3S2D J;  3I4M J;  2QF7 A;  1B72 B;  2NS8 A;  2H8R A;  3BR1 A;  3BR5 A;  2Y0S N;  4A3E J;  2LTP A;  3HB9 A;  3MKL A;  5EGO A;  3HOV J;  2EH3 A;  1TWA J;  3H3V K;  2K9S A;  4UUT A;  3A01 A;  1E3O C;  4UUS B;  1MH4 A;  4IHX A;  5DS9 A;  5FLM J;  1FJL A;  1TWH J;  3PM1 A;  1MBG A;  3GTK J;  3HOX J;  1LE8 B;  4M3G A;  4QTR A;  4DYC A;  2EZL A;  3WHC A;  2D5V A;  2LKX A;  2EZH A;  2KT0 A;  4DYQ A;  1UMQ A;  1GT0 C;  4XK4 A;  4MIM A;  1XS9 A;  2Y31 A;  1HDD C;  2NVX J;  2FJ1 A;  5EGO B;  1NTC A;  2LD5 A;  1LFU P;  4M6V A;  3A01 B;  1JT6 A;  2HI3 A;  4FTH A;  1WI3 A;  3E7L A;  5DTD A;  5F27 A;  4JX6 A;  3LOC A;  1X58 A;  2LVS A;  2M2E A;  2H1K A;  1D5Y A;  3D1N I;  2K9Q A;  3OSF A;  4BY7 J;  3HM5 A;  4M3B A;  5M5X J;  1IDY A;  5FKL A;  3LNQ A;  5C4X J;  2E19 A;  2E2J J;  1U9N A;  2E2H J;  3LSJ A;  4AYB N;  2K40 A;  2RAE A;  3BQZ A;  2HYJ A;  3DCF A;  4RBO A;  3TW7 A;  2LY9 A;  1F36 A;  4B4C A;  1H8A C;  2OF7 A;  1A6I A;  3BTC A;  3ZQI A;  3OSG A;  4QSH A;  2ME6 A;  2IAI A;  1MNM C;  2L7Z A;  3TP3 A;  2E2I J;  2NVT J;  2HXO A;  3BT9 A;  5F0F A;  3Q0V A;  3RKQ A;  1OJL A;  4A93 J;  4Y7N J;  5IOY A;  1MH3 A;  1ETY A;  4W97 A;  2DA6 A;  4S0H B;  2HOA A;  3PO3 J;  5C4J J;  2DN0 A;  2HDD A;  1K61 A;  4D5F A;  5EG0 A;  1IC8 A;  5GPA A;  1IUF A;  1DU0 A;  3BG3 A;  1ETQ A;  3G1O A;  4X1E A;  1LFB A;  5E3N A;  1GUU A;  3JRF A;  1QPI A;  2DA5 A;  3JRE A;  2YS9 A;  1Z0X A;  2FD5 A;  2CU7 A;  3ZQG A;  2COB A;  1QVU A;  2Y9Z A;  1B8I A;  1X2M A;  5IOZ A;  2JA8 J;  2ECB A;  2MG4 A;  3HOY J;  1ZTR A;  3LSP A;  1I50 J;  1ZQ3 P;  1W0U A;  5FJ8 J;  5EG0 B;  1T33 A;  4J19 A;  4A69 C;  3HBL A;  1UHS A;  4D7N A;  5GPC A;  3JRI A;  3K7A J;  2MW8 A;  2DTZ A;  3S1Q J;  3FIS A;  1GDT A;  2EQR A;  4MO7 A;  1B8I B;  2XPV A;  5BNG A;  3RQI A;  5EYR A;  1MSE C;  4NDL A;  3IH3 A;  2VI6 A;  3Q3S A;  3HGY A;  1SFO J;  1IV6 A;  1MBF A;  3BTL A;  4XRS A;  3HDD A;  3S2H J;  3IH2 A;  2FQ4 A;  1FEX A;  5FLV A;  1ZR4 A;  2O8K A;  4FE4 A;  4DZJ A;  1WH5 A;  4XIC A;  3CDL A;  3BG9 A;  3CMY A;  1JTY A;  2XB5 A;  1AKH A;  1VND A;  2MGQ A;  4XRS G;  1ZKG A;  4RDU A;  4M3F A;  3C2B A;  3WHB A;  3ZQH A;  3S14 J;  5IYB J;  4D7M A;  3DEW A;  5IP6 A;  4V2G A;  2LP0 A;  2XB0 X;  1A5J A;  4A3D J;  1FIA A;  4XRM A;  2CUE A;  1P7J A;  2XGD A;  3W6V A;  2EZK A;  2DMP A;  2FX0 A;  4M3D A;  3L1P A;  3BTJ A;  3JRB A;  3MVP A;  5GP9 A;  5F08 A;  2X9D A;  4MLO A;  1AKH B;  1UG2 A;  1WGX A;  9ANT A;  2JA6 J;  2NVQ J;  1ETW A;  2IBD A;  3F0C A;  5E3M A;  5IYD J;  2Y9Y A;  1W0T A;  3B6C A;  2R5Y A;  4A3C J;  3HOU J;  2KDZ A;  5J1Y A;  2R93 J;  1Y1W J;  1Y1V J;  1MBH A;  2NOG A;  3I4N J;  5EEA A;  1QVT A;  1ITY A;  4G12 A;  5IP7 J;  4IHV A;  2LLK A;  3S1R J;  3IH4 A;  2TCT A;  3BR3 A;  1IG7 A;  2DA7 A;  2ECC A;  3HGG A;  2XRL A;  4MFD A;  2CRG A;  3VPR A;  2OPT A;  5M5W J;  3K2A A;  2R5Y B;  4XID A;  2DJN A;  5FKN A;  1MSF C;  3BR2 A;  3A03 A;  3JRA A;  5F1J A;  2XSD C;  1F43 A;  1RES A;  1WH7 A;  3LSG A;  2XGC A;  1H88 C;  1HLV A;  2DMT A;  4BBR J;  2DA1 A;  1ETK A;  2NS7 A;  1Q1V A;  2ZB9 A;  3CQZ J;  1JGG A;  3M3Y J;  1WPK A;  3HEF A;  2L7F P;  4CYC A;  4A3B J; 
#chains in the Genus database with same CATH topology
 1U0J A;  1W4M A;  4R79 A;  3KIO A;  5DUI A;  2BHY A;  1K6O A;  2VOP A;  2VPL A;  1AHD P;  3CDH A;  1UST A;  3VOE A;  4KJZ A;  2CS3 A;  3JRD A;  5JLW A;  2PN6 A;  2XAH A;  4KMU X;  1RUN A;  1W36 C;  4UB8 C;  3J7Z I;  3GZN B;  4XLA A;  4E7S A;  2YSR A;  3JAM Z;  1K78 B;  4C2T A;  4CSW A;  2YUS A;  3ZQQ A;  3L7W A;  3G1L A;  3IV5 A;  1OKR A;  2WAQ N;  2V6C A;  2VPR A;  3V4G A;  4AUX A;  3MMY B;  4PFP A;  2R7D A;  2B7E A;  3CCE I;  2PMZ N;  1VF9 A;  1T98 A;  4XLH A;  2B0L A;  1HW1 A;  3HTS B;  2K7L A;  1G2H A;  1QQI A;  2MBF A;  4RGX A;  1PUF A;  2P6S A;  3EQL F;  4A5N A;  1OCO H;  4B8X A;  3E5X A;  1TC3 C;  1XSX A;  2RQP A;  3DU6 A;  1X19 A;  3KP4 A;  3I4P A;  2VE8 A;  4B48 A;  2MD5 A;  2HDW A;  3K4L A;  2X85 A;  2K4J A;  1T0F C;  1R5G A;  2MAB A;  4U87 A;  3NQO A;  1UZC A;  2P7V B;  1SFX A;  1BJZ A;  2XRN A;  4JQF A;  3H3U A;  4HV6 A;  1YTY A;  1K4T A;  2KIM A;  2IP2 A;  1JKP C;  2KRC A;  3JRH A;  4EM1 A;  1ZGW A;  1ZR2 A;  1QZZ A;  1I3A A;  3MEX A;  2L0K A;  1UB9 A;  1X4P A;  4AIK A;  4FX4 A;  4YIF A;  4XLC A;  4BXF A;  3HKZ N;  1GLN A;  3DKX A;  4ZYA A;  2IT0 A;  3K4K A;  2XAQ A;  3WG9 A;  3IWZ A;  4X0G A;  1OYY A;  3OYF A;  2JRM A;  2KFD A;  3QPL A;  3VSK A;  4MHG A;  4LLN A;  4BY1 J;  2K27 A;  2XVC A;  1PJR A;  2DCE A;  3DWL E;  4A6E A;  4CA0 A;  3FXQ A;  2M34 A;  1SEU A;  2L9N A;  1KU3 A;  3HIF A;  4DYR A;  3S1N J;  4BBS J;  2WTE A;  2X4H A;  4HPQ A;  1ZLK A;  4F91 B;  5J4Y A;  3S3M A;  2F5F A;  1JGS A;  4PJM A;  2M9H A;  1ZRC A;  2M87 A;  3ELK A;  3TL4 X;  3T5X A;  1O4X A;  3NEU A;  1X1D A;  3MN2 A;  3OIP A;  2VJ4 A;  2JN6 A;  5HLI A;  4JX4 A;  3MWM A;  1WJ5 A;  2ISZ A;  1RPW A;  2BYV E;  3PIO F;  3TOB A;  1MBJ A;  1SD7 A;  2C6Y A;  4HQE A;  2PMU A;  4FE7 A;  3I59 B;  3I9V 2;  3FK7 A;  4KIS A;  3S3N A;  2VT2 A;  1R9T J;  1FPQ A;  1FTZ A;  4WXD A;  4BU2 A;  4CIC A;  1OMI A;  4A0Z A;  5D8K B;  4Z2Y A;  5LEJ A;  5IP9 J;  5CKT A;  2L9R A;  2ZJ2 A;  3EYY A;  3WU1 B;  4Y52 J;  3BR6 A;  2EV6 A;  4RB1 A;  1WJA A;  3RKW A;  3K70 D;  4UY8 I;  1TQI A;  2P4W A;  2ZCW A;  1ETX A;  1Z91 A;  1APL C;  2G9W A;  5F0H A;  5K7H A;  4HZF A;  1XSD A;  4FET A;  2WY7 Q;  3KX2 A;  1R1T A;  1OR7 A;  3F21 A;  2DA3 A;  4BEH B;  5GAE J;  4NUB A;  2DMU A;  1N77 A;  1EH8 A;  5D5W B;  3H5A A;  2DK5 A;  2STW A;  1KQ8 A;  2PFB A;  2Z3Y A;  2E1O A;  5FKK A;  2OCC H;  4IO9 F;  3FXU A;  2IGK A;  3RCO A;  5D4R A;  2BXY A;  3HL2 A;  3WTS C;  3LAP A;  4IF4 A;  4GCV A;  3KP7 A;  4D9J A;  1J59 A;  3CLO A;  2GAU A;  4BQO A;  3BJ6 A;  3FIW A;  4HNT A;  3HOT A;  3G71 I;  1M1E B;  3WE3 A;  1VTN C;  2HR3 A;  2V1N A;  5EJC A;  3LA7 A;  4DJA A;  2V79 A;  4OWR B;  2CUZ A;  2A6T A;  5M5Y J;  1DU6 A;  4M9X A;  1QBJ A;  3RPQ A;  5BQT A;  2QKM B;  1O3T A;  5C3E J;  3BCA A;  4CDG A;  1T56 A;  1W5C C;  2BZT A;  3B02 A;  3E97 A;  4B3A A;  4EV0 A;  5H2F C;  1CQT A;  2XF7 A;  1O3S A;  2OQG A;  1SFK A;  2OU2 A;  4ANJ A;  2Y2Z A;  4AVZ A;  1W7P A;  3QWL A;  3ZQF A;  2R5Z B;  2QM3 A;  1RKW A;  3TW6 A;  3IRR A;  4BDY A;  4M74 A;  3FXJ A;  3SFI A;  4IHY A;  2PI0 A;  2JJ7 A;  2CUF A;  3TDZ C;  1D1B A;  1V4R A;  5HDN A;  1X2N A;  1GV2 A;  2ID6 A;  3K4B A;  1WJD A;  1I3Q J;  4HLX A;  4G94 A;  1WJE A;  2DFI A;  4UUS A;  1TT5 B;  4BQN A;  1UHM A;  5CVR A;  1RIO H;  4BNC A;  1B59 A;  3N97 A;  1ZG3 A;  2A6E F;  2KDO A;  2OAZ A;  2CGP A;  1NK2 P;  1ENH A;  1O7F A;  1RKT A;  2QWW A;  3S2D J;  2DOF A;  1TLH B;  2QF7 A;  3ZP5 A;  1B72 B;  4M73 A;  2NS8 A;  2Q2E B;  3BR5 A;  2E1N A;  3ERM A;  1Y6I A;  3ZRG A;  3ABK H;  3MKL A;  1WJB A;  4CUG A;  5J6X A;  5EGO A;  3HOV J;  2P0W A;  5LRS A;  1RI7 A;  1NH3 A;  3H3V K;  4UUT A;  1E3O C;  1IN7 A;  3PQJ A;  1MH4 A;  2DO7 A;  4AD9 A;  3JTH A;  4ZH4 F;  5FLM J;  1FJL A;  2PJP A;  3MAJ A;  4II3 A;  3GTK J;  1HKQ A;  1LE8 B;  4II2 A;  1VZ0 A;  2JT1 A;  2FMY A;  4RM3 A;  2FRH A;  2OCE A;  4DYC A;  4QTR A;  3F8N A;  1VQ7 I;  2GXG A;  1YLF A;  3OYL A;  3GX4 X;  3H0D A;  2HOE A;  4DYQ A;  2Y0S A;  2P8T A;  2ACJ A;  4XK4 A;  3R0J A;  4CHU A;  4V19 K;  2NVX J;  2KKO A;  1YIT I;  2FJ1 A;  2KRH A;  4PGG A;  3NWS A;  2LD5 A;  4PJN A;  3CUQ A;  4UVA A;  4YEL A;  1WSU A;  1WI3 A;  1D1A A;  5DTD A;  5F27 A;  3J7Y J;  3SDB A;  1P92 A;  4Y33 A;  4LFU A;  3LOC A;  4B47 A;  4YFX F;  3S3O A;  3HRU A;  2R7Q A;  3D1N I;  5CVV A;  1Z7U A;  3OSF A;  4BY7 J;  1LFP A;  3HM5 A;  1DQU A;  3LNQ A;  1P4W A;  3M8J A;  2E2J J;  2WC2 A;  2BGC A;  2PBI A;  1MKM A;  1AA7 A;  2O8X A;  2RN7 A;  3DCF A;  2IS4 A;  4XN3 A;  2G7H A;  2KP6 A;  2V1X A;  3WGH A;  2OJE D;  2XIG A;  2OF7 A;  5E1X A;  2YU3 A;  1H8A C;  3GF2 A;  4LB5 A;  4HX4 A;  1A6I A;  2IS6 A;  3ZQI A;  1HST A;  3BJA A;  2X51 A;  2K5C A;  3L2C A;  2EK5 A;  2XKO A;  2BY3 A;  2LF7 A;  2NYX A;  3RKQ A;  1FYL A;  1S5L C;  2WAE A;  3LSK A;  2E35 A;  2DW4 A;  1MND A;  4W97 A;  3I64 A;  2LBF B;  5GAH J;  2DA6 A;  2PG4 A;  3I54 A;  4EJO A;  1KGS A;  4ENM A;  3OR2 C;  5LRR A;  2Z1D A;  3JCU C;  2BBY A;  4N9I A;  5F1R A;  3W2W A;  1IC8 A;  5GPA A;  2BW3 A;  1A6Q A;  3RKY A;  1TP4 A;  3HOS A;  5J8F A;  5BMZ A;  1LFB A;  5E3N A;  4L5I A;  2JRT A;  3KLO A;  2DA5 A;  3JRE A;  5TIS C;  1XGN A;  4S05 A;  1Z0X A;  2WY8 Q;  1X1C A;  1DPR A;  4HF2 A;  1XN7 A;  1J0R A;  2COB A;  2Y9Z A;  1X2M A;  2MG4 A;  2XKP A;  5E20 A;  1ZTR A;  3LSP A;  1SMY F;  5CLS A;  2CFO A;  1W0U A;  2W57 A;  5FJ8 J;  2L2O A;  5EG0 B;  1T33 A;  2HVQ A;  4J19 A;  4A69 C;  1UJ8 A;  2BY0 A;  4D7N A;  1A35 A;  2D2W A;  2OZU A;  3ZGK A;  2CV1 A;  1HKS A;  2JZY A;  4ZJZ A;  5D5V B;  3IL2 A;  2CQK A;  3K7A J;  1MDM A;  1EJ9 A;  3FXL A;  4ZTF A;  3S1Q J;  3A0B C;  2M8E A;  2QVO A;  2RC4 A;  3FIS A;  5LHG A;  3WTX C;  4MO7 A;  2XPV A;  3RQI A;  2IGM A;  4E7H A;  1MSE C;  4NDL A;  4FAS D;  3VYU B;  1TQP A;  3RDI A;  4I2O A;  4NC8 A;  5EEH A;  3FHN A;  3V8K A;  5BS6 A;  4HST A;  1XDS A;  4G6D A;  1PP7 U;  4RM2 A;  2QQ9 A;  4Q48 A;  1FEX A;  2ADU A;  1H9T A;  4FE4 A;  1FP2 A;  3H92 A;  4DZJ A;  1XDU A;  1Z7L A;  4XR6 A;  1DGW Y;  1XGO A;  4UXN A;  3JTG A;  1R00 A;  4B09 A;  1VND A;  3WG7 H;  4XRS G;  5LFA A;  3KZI C;  1BOB A;  1QPM A;  3ZMS A;  4BL0 B;  2ZXW H;  2GWR A;  3DEW A;  4D7M A;  5IP6 A;  2MD0 A;  4MNU A;  5KAI C;  2XGD A;  4MEX F;  4M3D A;  4TV7 A;  4U0Y A;  4H4K C;  3WGG A;  1ZHF A;  1EH6 A;  2M4G A;  3CP2 A;  4ZYG A;  1O3Q A;  1HBX G;  3F8F A;  4ZZD A;  5D4S A;  1BR4 A;  4EJT A;  2MFZ A;  2ZJR F;  2FF4 A;  1WGX A;  4LB6 B;  9ANT A;  1R4M B;  2VBY A;  4FQG A;  3ZMZ A;  1P4A A;  5J4V A;  5JVT A;  2ETH A;  4LD5 A;  5E3M A;  2V9P A;  2W25 A;  1VQK I;  1Y1V J;  1MBH A;  2XHK A;  3HHH A;  2DDB A;  3I4N J;  3K69 A;  1FT9 A;  3VYT B;  3J80 K;  3BZK A;  3RIR A;  1T38 A;  2W00 A;  2TCT A;  2R4G A;  3CCS I;  1IG7 A;  2DA7 A;  5HLG A;  2JVG A;  1WKM A;  2L3D A;  2E5Z A;  4ITV A;  2XRL A;  2IS2 A;  1K6Y A;  2EFQ A;  1R58 A;  1LJ9 A;  1PVE A;  3E3V A;  4HRI A;  2R5Y B;  5JR3 A;  2QGU A;  3GW2 A;  5F1J A;  3GXO A;  2XSD C;  3A0H C;  5LHI A;  2QSH X;  2A5W A;  1XMA A;  2NNN A;  4YG2 F;  3FBN B;  1S72 I;  2NS7 A;  4KDP A;  2LF8 A;  4KMF A;  3K1N A;  1QHH D;  4XNF A;  5E8I A;  3M3Y J;  5H6R A;  2HDC A;  2CV0 A;  1EV7 A;  4JBA A;  1MD0 A;  3OS2 A;  2JTV A;  2VXZ A;  2ME0 A;  4E7L A;  3E5Q A;  3Q0U A;  2EA2 A;  4QWQ A;  1IRG A;  1S7E A;  2D1V A;  4A3K J;  3T8T A;  1U8R A;  4HDU A;  5FKO A;  5L3D A;  2VKE A;  1WCM J;  3O8G A;  2DI3 A;  1TWF J;  1FSE A;  4ESJ A;  4GGG A;  3ABU A;  1ZYR F;  2B9S A;  1YRN A;  4EJU A;  4EQQ A;  2RKH A;  4CYC B;  2DMN A;  2F4I A;  1I27 A;  3OYE A;  1ZG5 A;  1H0M A;  1G3T A;  3CCJ I;  1UEL B;  3CP8 A;  1R36 A;  4DW6 A;  2P5K A;  3U1D A;  2AQF A;  1EKE A;  1GV5 A;  2V4J C;  3IC7 A;  3OWT A;  1O3R A;  1L3L A;  2Z99 A;  3HRM A;  4HEA 2;  1YFH A;  2HOT A;  1RR7 A;  2F5V A;  1KON A;  3U21 A;  5CQE A;  2PLY A;  3A4C A;  4EJW A;  2VKV A;  2HFH A;  1XGM A;  2JA7 J;  2MLG A;  4BJ5 C;  4KUM A;  2J5O A;  2OUM A;  2OTL I;  4RAG A;  3ULQ B;  1Z3X A;  1EF4 A;  2HKO A;  2PMZ A;  4M9S A;  3QYF A;  1ULY A;  1G3Y A;  2KHM A;  1OCR H;  2CQN A;  1JUM A;  2A5Y B;  2W4S A;  3MZY A;  5FD6 A;  2LR8 A;  1ETV A;  1BI2 A;  2JSP A;  5DM7 F;  1V54 H;  1UFM A;  3AKZ A;  4EGZ A;  1QO0 D;  2XGE A;  1WI9 A;  1X1P A;  3EUH C;  3LWF A;  5CJ9 A;  5TRD A;  2V9V A;  1E0E A;  2EIM H;  3WTZ A;  1YQA A;  4OAZ A;  3WU2 C;  2CH0 A;  2F5D A;  1TNS A;  4B3X A;  4CZC A;  2GQQ A;  1UG0 A;  1SAN A;  2A3S A;  4A3M J;  3TP0 A;  1IW7 F;  3L00 A;  4XLP F;  2XPW A;  4KN7 X;  3RZD J;  3HOW J;  4QPQ A;  3C18 A;  4BE2 A;  4LOC A;  3M1E A;  3I5U A;  4NQW B;  4CO8 A;  2KPM A;  2F4M B;  2LH9 A;  4N9H A;  1KU9 A;  1P6R A;  1DP7 P;  3F8M A;  3R61 A;  3PO2 J;  4HDV A;  4YEJ A;  3FMR A;  4JOM A;  4XN0 A;  4AC0 A;  2LY1 A;  4KIF A;  2JA5 J;  4G9Y A;  3A2K A;  3S17 J;  1YS7 A;  1OPC A;  2ZME A;  3F9K A;  1U78 A;  1Y8Q B;  2WB1 N;  3ASO H;  3S2W A;  3E6C C;  3V7R A;  1BI1 A;  2YU9 J;  2QUF A;  2DOD A;  2ZBK A;  2IA1 A;  2DFE A;  3FK6 A;  2X6W A;  2VOD A;  4GFB A;  1WFX A;  3QRF F;  2M0C A;  3E6M A;  2EPF A;  3RJP A;  1X3U A;  1P2F A;  4RAF A;  4XMY A;  2GBY A;  5K5Q A;  4O3M A;  1W5T A;  3RKX A;  4IVN A;  2W48 A;  2IEK A;  1JJ6 C;  4KYW A;  2G0E A;  4BHP A;  1DDN A;  2O5R A;  4BUP A;  2GA1 A;  3GTM J;  2JMW A;  3PNV A;  4OIN F;  4J01 A;  3TO9 A;  2G7U A;  4M6Y A;  3WU0 A;  2X6X A;  5C44 J;  1JKQ C;  4O6J A;  2VL8 A;  1TL8 A;  1K4S A;  2V1D A;  1JTX A;  2R7W A;  1XTA A;  1BA5 A;  3D5S C;  2HPI A;  1PUE E;  5EDN A;  3BZ6 A;  1RC9 A;  4EAT A;  2Z16 A;  3OS1 A;  3W2V A;  3K4M A;  4FCY A;  5A2Q Z;  1DUX C;  1ZLJ A;  5JLX A;  2R7F A;  4C3H J;  4UHT A;  2HKX A;  2I10 A;  2M7B A;  4BS9 A;  2QZ8 A;  1ETO A;  2O9L A;  2FEZ A;  2V26 A;  3EYI A;  4RB2 C;  3CF5 F;  4L9J A;  3W6K B;  4CCL A;  3ZQL A;  3HUG A;  2FQ3 A;  1JXS A;  3TQN A;  1PDN C;  2GLO A;  2E7W A;  4A3J J;  1RET A;  4OMZ A;  4IL6 C;  4OIQ F;  1JJ8 C;  1ZRD A;  2MSY A;  4Y4R A;  1MBK A;  2WV1 A;  2EFW A;  3OYD A;  1D1C A;  3CCY A;  3GUD A;  4AIH A;  2F4O B;  1FOX A;  5F04 A;  4ABZ A;  5EZH A;  3D5L A;  2VE9 A;  1T08 B;  2L7M P;  3TBI A;  5IPA A;  2F2E A;  4PJL A;  3OYJ A;  3OOU A;  3HOZ J;  4HSR A;  2LYC A;  3BG5 A;  3HZJ A;  3CLQ A;  3LQR A;  4YFK F;  2RVC A;  2OTJ I;  4JYK A;  1IXR C;  3KP6 A;  2E71 A;  5KVR A;  1IZ1 A;  2R7V A;  1PP8 F;  2HNH A;  3DXJ F;  1VQ8 I;  3BG6 A;  2HXI A;  2ICW G;  1FZP B;  1Z3Y A;  3N05 A;  4HYE A;  5M3F J;  2XGX A;  4HNV A;  1AU7 A;  2E1C A;  3S15 J;  1V5E A;  2TRT A;  1XMX A;  1LPQ A;  3I4M J;  2L5Q A;  3CF2 A;  3C1D A;  4RGS A;  3SFZ A;  2H8R A;  1SMT A;  3LSM A;  4PDK A;  1REP C;  3CJQ B;  2JSC A;  3DV8 A;  4XBF A;  1VQ6 I;  5LEK A;  2FU4 A;  2LTP A;  3HB9 A;  4A3E J;  4CGZ A;  3ECO A;  4J00 A;  3SEZ A;  4OAY A;  1ZG1 A;  5DS9 A;  3K6G A;  1Y0U A;  4FHT A;  1SD4 A;  3VYS B;  1MBG A;  5E1Z B;  3KP3 A;  4FX0 A;  3HOX J;  2FSW A;  4BGD A;  4U0V A;  1S9H A;  2QA4 I;  2EFP A;  1G6N A;  4F7Z A;  2EZH A;  2KT0 A;  3T8R A;  2V7F A;  5HS9 A;  1UMQ A;  3B73 A;  1XS9 A;  2DT5 A;  2NS0 A;  3GLX A;  4Y15 A;  4UUV A;  1NTC A;  3L09 A;  4HAM A;  2M1B A;  4ZDP A;  1VQ5 I;  5CVJ A;  3A01 B;  2QEX I;  2R3S A;  3Q9S A;  4FTH A;  4PSW A;  3WE2 A;  5HNF A;  4JX6 A;  1SAX A;  2LVS A;  2H1K A;  1D8K A;  3O6B B;  3SZG A;  3GCM A;  1OIS A;  3Q9V A;  2K9M A;  5FRO A;  4BE0 A;  1F5T A;  3HPH A;  4EMS A;  2E5N A;  5FKL A;  4R8H A;  2VBZ A;  2ESH A;  3DPT A;  4AYB N;  3F23 A;  1T95 A;  5E17 F;  1X3W B;  4G7H F;  3CJT B;  4HF0 A;  1Y8R B;  1JHH A;  4IQ4 A;  3BQZ A;  2HYJ A;  2LY9 A;  2LC2 A;  1F36 A;  3LL7 A;  4CCJ A;  2Q8K A;  2OV7 A;  3L2U A;  4IOC F;  1O57 A;  2KJC A;  5KCM A;  3TP3 A;  1MNM C;  2NNY A;  4KT5 C;  3L2Q A;  3H5R A;  4C9Y A;  3BJO A;  2D45 A;  2HXO A;  3ONQ A;  2QSG X;  3C7J A;  5F0F A;  2V9K A;  1FSH A;  3KZY A;  2EIK H;  4MQV A;  1FOK A;  1J9I A;  4LIU A;  1MW7 A;  3KEQ A;  3L2R A;  3J81 K;  4E70 A;  2OD5 A;  4IZZ A;  4RAY A;  3WTT C;  3HRS A;  1VQN I;  4E7Z A;  3DTE A;  2IA2 A;  2DN0 A;  1S29 A;  2DPU A;  2ISY A;  4D5F A;  1LEB A;  1GHC A;  4N0B A;  4XOT A;  3G1O A;  3CO6 C;  2M4K A;  4X1E A;  1MMA A;  1X1B A;  4Y3O A;  1DPU A;  1GUU A;  3P5J A;  3RPU D;  2VAS A;  3RYP A;  2YS9 A;  3G2B A;  3UR3 C;  3GWZ A;  5DCM A;  3ZQG A;  2AS5 F;  5B1A H;  1B8I A;  3HOY J;  3W6J B;  3CDI A;  2MH2 A;  1HC8 A;  5K5R A;  4O5V A;  3R6S A;  2AXL A;  2AXT C;  3OYM A;  1I6X A;  3MCZ A;  5B66 C;  4F92 B;  2ESN A;  2QBY B;  1I1S A;  3QOP A;  2MW8 A;  1BM9 A;  2D1H A;  1CF7 A;  2VLA A;  1STZ A;  3AG4 H;  3R0A A;  3FHZ A;  2W82 A;  3M9A A;  5EYR A;  4KA4 A;  2WAD A;  4XRF A;  2RRE A;  2DTR A;  1TW2 A;  2DU9 A;  3DTI A;  3F8B A;  3Q3S A;  3HGY A;  3PQK A;  4PCQ A;  4UVB A;  4UNO A;  1OLT A;  1MBF A;  1S6L A;  3FM3 A;  4WWC A;  2DFF A;  2F48 A;  4GDF A;  3S2H J;  1YJW I;  3IRQ A;  4WX9 A;  4D0P A;  3KEO A;  3I56 I;  3I0T A;  1WJC A;  3W2A A;  2FNA A;  1IF1 A;  1BN5 A;  1JTY A;  2FML A;  1AKH A;  3MKY B;  3J81 Z;  4M3F A;  2ZSI B;  1TW3 A;  1YW9 A;  3S14 J;  2W1O A;  4M9Z A;  3GYH X;  1LKX A;  2KMU A;  5DUK A;  4XSZ F;  3DP7 A;  3AG1 H;  4CXF A;  2R7T A;  2IPQ X;  2KZV A;  3H9G A;  3PNY A;  1FBU A;  3H9Q A;  3TMO A;  2EZK A;  4C30 A;  3LST A;  1JE8 A;  1IAW A;  4EJV A;  5DDG A;  1ONV A;  3HYI A;  3JRB A;  3MKZ A;  4XKV A;  4WK8 F;  4MLO A;  4HNU A;  1RUO A;  4HG2 A;  4Q5S F;  2JUC A;  4LK0 F;  4RGR A;  3HPG A;  1P4X A;  2BE5 F;  1DP3 A;  2JA6 J;  1U6G A;  4PZJ A;  1R6R A;  3VDX A;  2NVQ J;  1Z6R A;  1YJ9 I;  1U5T C;  4G7O F;  4R1H A;  3CC2 I;  1YYV A;  3MFK A;  4A3C J;  2K4B A;  2DPD A;  2PJR B;  2R93 J;  2NOG A;  1SC7 A;  3BP8 A;  1ITY A;  2A6H F;  3EUK L;  3WTW C;  1ZH5 A;  2GOX B;  2LLK A;  3S1R J;  2VJI A;  3IH4 A;  2RGV A;  2WA0 A;  2DBB A;  5CQG A;  2VB6 A;  2QQB A;  1U5T B;  4I99 C;  3HGG A;  2OBP A;  2E36 A;  1BI0 A;  3ZMT A;  2P5L C;  5FLX K;  4F93 B;  2HWV A;  1WWX A;  4BQQ A;  2E1M C;  4WXC A;  1A36 A;  2R7U A;  3OOP A;  3G3Z A;  2GXB A;  4IQJ A;  2STT A;  3BR2 A;  5J8C A;  3A03 A;  3JRA A;  1HA8 A;  1B9M A;  1RES A;  3LSG A;  2IJL A;  3FF5 A;  3X2Q H;  1S8N A;  1NG7 A;  2GXA A;  2VC0 A;  1H88 C;  1D0Y A;  2A05 A;  1FX7 A;  2UV1 A;  1ETK A;  2E1M B;  1Q1V A;  2IS1 A;  2VQC A;  4HW0 A;  2O61 A;  3CQZ J;  3QU6 A;  3BY6 A;  3NWT A;  1X3Z B;  2WWY A;  3ERE D;  1K78 A;  1JGG A;  4U7B A;  1WZ2 A;  2KIS A;  2M5W A;  3HJE A;  1Z9C A;  1L0O C;  3COA C;  1GXP A;  3SJM A;  1U2W A;  3C2G A;  2M8G X;  2Q1Z B;  2M30 A;  4A0X A;  2R92 J;  2FNP A;  3OYC A;  2XPU A;  3SEQ A;  4OU0 A;  2P81 A;  3GFJ A;  2KRF A;  4A3G J;  1XB4 A;  2HQN A;  1H89 C;  2PEX A;  4LG0 B;  2P7C B;  4I01 A;  1NG6 A;  4FIS A;  1GVD A;  3V8L A;  4A3I J;  3DBR B;  5DV5 A;  3CCM I;  2V6E A;  5LLQ A;  3DTK A;  4KFC A;  2LY2 A;  4EM2 A;  4IPA A;  4ASN A;  1VQ4 I;  4IXA A;  1HSJ A;  3C2H A;  2IRF G;  3TED A;  3MQ0 A;  2LFB A;  1K79 A;  3GLL A;  4I98 B;  1YG2 A;  3FKI J;  2DQR A;  5EF6 A;  1R1U A;  2ZSH B;  4HA8 A;  2VUM J;  4IHW A;  1N25 A;  2EV0 A;  2K85 A;  5B5E C;  2LMD A;  3IHU A;  5HDK A;  3U9G A;  1MJB A;  4OOI A;  5FLX Z;  2E34 A;  3NAU A;  3VFZ A;  4E7J A;  3CMM A;  3PFY A;  3ZR8 X;  3G1M A;  4B1R A;  1FMW A;  2EIL H;  4L18 B;  2K02 A;  2X6O A;  1T0F A;  3R4K A;  1U9O A;  3B6A A;  1HW2 A;  3FXR A;  2Y75 A;  3K9T A;  3RTR A;  5J1U A;  4BKX A;  2ZKZ A;  1FWZ A;  1O7L A;  4ESF A;  4P9U A;  4A3F J;  2X0L A;  2Z5U A;  1U8B A;  4KNY A;  1QGP A;  2TDX A;  3RI4 A;  1P9Q C;  3TOA A;  1IO2 A;  1TTY A;  4F52 A;  1WRJ A;  2HPM A;  2OA4 A;  1R5I D;  3OS0 A;  3LSI A;  3JR9 A;  1NHA A;  1OCP A;  2WBM A;  3H0G J;  1PUF B;  3G4S I;  2HQ5 A;  2I8D A;  3S16 J;  2RDP A;  2W24 A;  3OL4 A;  4NHJ A;  1Y39 A;  5IYC J;  3CJN A;  2ZC2 A;  1VQP I;  4UV8 A;  2H8W A;  4OIP F;  2CQQ A;  5K7Z A;  3GTQ J;  2XAU A;  5HS7 A;  4AVP A;  5HLT A;  3PJR A;  2H6C A;  3I71 A;  3FWE A;  3P7N A;  4XL9 A;  3CUO A;  3S1M J;  4F3Q A;  1RRJ A;  5FRN A;  4Q47 A;  1TWC J;  4A6D A;  1XG1 A;  3KYL A;  4UV9 A;  4RAZ A;  2E7X A;  3REO A;  2XAF A;  4NC7 A;  3I59 A;  2L4A A;  2LOO A;  3P9C A;  5KK1 A;  3ZN0 A;  1KQ9 A;  3V8J A;  2F5E A;  3IUO A;  5FGM A;  1LDJ A;  1XX5 A;  2Y30 A;  2K3F A;  1IN5 A;  4E6K G;  1QZY A;  5D6F A;  2MH9 A;  3PIP F;  2IA0 A;  4ON0 A;  3OYN A;  1ON2 A;  3L2W A;  4DBR A;  1MGT A;  2YPR A;  3ECH A;  2EZI A;  4D1Q A;  2HS5 A;  4PSX A;  4MFE A;  1R7J A;  3AFH A;  2X48 A;  2FOK A;  4MTD A;  4C3I J;  3DLL F;  3ZQC A;  1CGP A;  1IGN A;  1POG A;  2HYG D;  5E8G A;  4BEH A;  3BQY A;  5HOD A;  1N78 A;  1TNT A;  2WB1 A;  2W84 A;  1BBY A;  3K4J A;  2QSF X;  2IGO A;  2VC1 A;  1PYV A;  3BPV A;  5AIQ A;  1T6S A;  5ICE A;  1XSV A;  2BY2 A;  2Z33 A;  3S93 A;  4G7Z F;  3OMY A;  4I6Z A;  5GTI C;  2LDU A;  3BWG A;  3FDY A;  4A3L J;  2L01 A;  1FBQ A;  3ZMD A;  2NAZ A;  4HOB A;  2QQ8 A;  2VQL A;  3GTO J;  3RQ4 A;  5LHH A;  1ORK A;  2DA2 A;  4XLE A;  4Q4Z F;  4L5J A;  3IKT A;  4HF1 A;  4L5E A;  6PAX A;  1OR7 C;  3KE2 A;  3F6V A;  3VWB A;  5E3L A;  5L3E A;  3QPT A;  4JP0 A;  5CYV A;  2MC4 A;  4IRG A;  4ZDO A;  4BHB A;  4C2M J;  2R7Z J;  5TJJ A;  3H35 A;  2A61 A;  1KA8 A;  3GFL A;  5GTH C;  1FTT A;  4BYY A;  3BG7 A;  1HDP A;  1MMN A;  4XKC A;  5E18 F;  2DA4 A;  3CMA I;  1BW5 A;  2R5Z A;  1J2X A;  4G6Q A;  3QOD A;  5F6F A;  4P5O A;  3J80 Z;  3LFU A;  4A0Y A;  4WCG A;  3DKW A;  5L3F A;  4V2F A;  2L54 A;  2CJJ A;  4LIT A;  4X6A J;  3GTL J;  1BL0 A;  1U3E M;  1IN4 A;  3BR0 A;  5FD5 A;  1EH7 A;  3DQV C;  5B1B H;  1YE9 A;  3E0J B;  3AAF A;  3KLN A;  3KP5 A;  3KYC B;  3T0Y A;  5D8L B;  2CQX A;  1YOV B;  3CO7 C;  1IRZ A;  2O6G E;  3OYB A;  1MJ9 A;  1B72 A;  3MZH A;  3AG3 H;  4I02 A;  2Q2E A;  3DEE A;  4LGW A;  3SDG A;  2M3A A;  3T1B A;  3ZMU A;  4ZZL A;  2CW7 A;  2LK2 A;  3HXL A;  4I09 A;  3M4O J;  2HGC A;  4JK1 X;  1FNN A;  2M45 A;  1P7I A;  1HKT A;  2AHQ A;  1BW6 A;  5IT9 K;  1HOM A;  1EA3 A;  2LNB A;  1Z6T A;  3NRV A;  3QU3 A;  1JUS A;  1DGR M;  1MBE A;  2M7A A;  3QQA A;  1JI8 A;  1BI3 A;  1W7P B;  5D6E A;  1LE8 A;  1XC5 A;  3F3X A;  5JI6 A;  4IRH A;  1V5G A;  1FP1 D;  1B1B A;  3BR1 A;  3TO7 A;  5JVG F;  4AWX B;  2MC3 A;  4KIT B;  2EFO A;  4IHS A;  3SQN A;  1J5Y A;  5ILV A;  1Z67 A;  4BAY A;  3PUB A;  4UUS B;  4M71 A;  4IHX A;  3BPX A;  1F1Z A;  5DCF A;  3O2P E;  4BHC A;  1TWH J;  3PM1 A;  3LSH A;  4DIQ A;  1MNE A;  1GXQ A;  1R49 A;  3WHC A;  3D5R C;  2R7O A;  2LKX A;  2QKL B;  5FFX A;  3M1C A;  2EWN A;  1GT0 C;  4MIM A;  2Y31 A;  3JW4 A;  1HDD C;  3KFW X;  4HBL A;  5EGO B;  1AWC A;  4P9F A;  2DAO A;  1XMK A;  1D0Z A;  4YRV A;  1JT6 A;  3CES A;  3L2V A;  4E7I A;  4ESB A;  2FBI A;  1YX5 A;  3E7L A;  1LB2 A;  3CUQ C;  4GYG A;  1X58 A;  3LA3 A;  4AID A;  2M2E A;  3RPU A;  1D5Y A;  2QYO A;  1MMG A;  5M5X J;  1E3P A;  4MEY F;  3K10 A;  2E2H J;  3LSJ A;  3CCQ I;  2K3P A;  2K40 A;  2K86 A;  5IT3 A;  2LBF A;  1JHF A;  3DBH B;  2KJB A;  3CUQ B;  5H6Q A;  4EVI A;  2EJR A;  4OIO F;  1ERD A;  3MKW B;  3CD6 I;  2IW5 A;  4B4C A;  1I1G A;  4GRI A;  1VQ9 I;  3TO6 A;  2ME6 A;  1VQO I;  2IAI A;  2L7Z A;  2E2I J;  1HW5 A;  2NVT J;  4RB0 A;  2KIQ A;  3BT9 A;  5L3C A;  2ZJQ F;  3CC4 I;  1ZEL A;  4AYB A;  1OJL A;  2ELH A;  1XCV A;  3PFI A;  4A93 J;  3K4C A;  4Y7N J;  5IOY A;  1N75 A;  5JHU A;  2Z9O A;  1ETY A;  1W5S A;  3EET A;  5L3B A;  3AG2 H;  2NXN B;  2MA3 A;  4S0H B;  1X4O A;  2HOA A;  5DM6 F;  1X1A A;  2QQA A;  3I55 I;  2CV2 A;  2DT7 B;  4P96 A;  1K61 A;  5EG0 A;  2ZFU A;  2EV5 A;  3BG3 A;  3CME I;  1DU0 A;  2IXS A;  3U1K A;  2GIV A;  3SYT A;  1J75 A;  2X1D A;  3ASN H;  1SD5 A;  4XQF A;  1GVJ A;  3CCL I;  2FD5 A;  2VQH A;  3DBL B;  5ED4 A;  1QVU A;  4HV5 A;  2ECB A;  2COM A;  3PSI A;  4L0Y B;  1ZQ3 P;  1FBS A;  2UXN A;  2BW3 B;  1A04 A;  1YX3 A;  3IP4 B;  4S04 A;  4L9V A;  5ICG A;  1UHS A;  1SAU A;  4P1W A;  4RA2 A;  4ENN A;  2KQR A;  4B44 A;  3ABT A;  1V55 H;  2BOL A;  4XSX F;  4LG3 A;  1D0X A;  4L9N A;  2DQL A;  2DTZ A;  3HG9 A;  4ZC3 A;  4GXO A;  3CCU I;  1D5V A;  1GDT A;  4B43 A;  4U0W A;  4LLG F;  4CCK A;  4L9T A;  3BDD A;  2ZO4 A;  1MMS A;  4XM3 A;  1IV6 A;  3ABM H;  3BTL A;  4M72 A;  1QZE A;  3RYR A;  3HDD A;  1BIB A;  2HZD A;  1OYW A;  1BR1 A;  2E60 A;  1ZR4 A;  1G4D A;  3ML6 A;  1BR2 A;  3CDL A;  1MDM B;  3BG9 A;  2EIJ H;  2WV0 A;  1Q1H A;  3CMY A;  1TQM A;  2MGQ A;  3ESW B;  2OC6 A;  1ZKG A;  1WJF A;  5GAD J;  3C2B A;  4DBQ A;  3AL0 C;  3QYB A;  3VYR B;  4V2G A;  2VT3 A;  2HZT A;  3FKJ A;  3D0S A;  1HXD A;  4HX8 A;  4PJ0 C;  1A5J A;  4A3D J;  4XRM A;  1YHQ I;  3IKV A;  1V3F A;  1P7J A;  2GA2 A;  1RZ4 A;  2FX0 A;  2HVS A;  3OYH A;  2L9V A;  3BTJ A;  1SD6 A;  2HQA A;  4CCO A;  5GP9 A;  3AL0 B;  2DJI A;  2LKP A;  1MJA A;  4XLN F;  2LG4 A;  2ZJP F;  1G3S A;  3LAJ A;  1LVA A;  5DYM A;  1LEA A;  2UXX A;  3QP6 A;  4BXU A;  4MGR A;  4LMY A;  1VQM I;  2HEO A;  1ETW A;  2IBD A;  3KCC A;  3V7C A;  3L9F A;  3QPH A;  4KIB A;  2R5Y A;  3WOD F;  1SFU A;  3ABL H;  3HOU J;  3A1Y A;  3KYD B;  2DLL A;  4CYD A;  4G8X A;  1QVT A;  5ILS A;  5IP7 J;  4IHV A;  2VKD A;  3OY9 A;  3OYA A;  1LDK B;  3VOD A;  3BR3 A;  4KIG A;  2F6C A;  5F64 A;  3W3C A;  2XC7 A;  4IOA F;  1S7A A;  1FYM A;  2L02 A;  2ZXJ A;  4HX7 A;  2CRG A;  2RV8 A;  1SFE A;  4IHT A;  4ETS A;  2OPT A;  4LLL A;  3DPU A;  4OMY A;  2JPB A;  3LA2 A;  1MSF C;  4YIR X;  1YJN I;  3HHG A;  1F43 A;  1BOA A;  1WH7 A;  4I0B A;  4PGH A;  1C0W A;  2IGN A;  2XGC A;  1B6A A;  2GOM A;  2YR2 A;  2DMT A;  2DA1 A;  5TGT A;  3DKY A;  1LNW A;  1SVO A;  4KIC A;  4BE1 A;  1WPK A;  2DOE A;  1G59 A;  1S3J A;  2L7F P;  3F8C A;  3E1S A;  3HEF A;  3I58 A;  3PSF A;  3VB2 A;  4CYC A;  1QHG A;  4E7K A;  5ERI A;  1I39 A;  1IDZ A;  3GME A;  4LIV A;  4ZYH A;  4U7D A;  2VOO A;  5F0C A;  4LK1 F;  1WHU A;  2FXA A;  3GTG J;  5DD8 A;  1T2K A;  2HOS A;  2XSJ C;  4BXX J;  1R71 A;  1TT0 A;  4EM0 B;  1IUY A;  5HS8 A;  2EFN A;  5BPI A;  5DEQ A;  1VI0 A;  4I0A A;  5BPD A;  2XAG A;  1YI2 I;  1OFC X;  2VXD A;  1IN6 A;  1TWG J;  5LBQ A;  1T39 A;  5GAG J;  5HVQ C;  2FBK A;  1FMV A;  1XPX A;  4RS8 A;  1HCR A;  3J7A Y;  3DEU A;  1NK3 P;  1F9N A;  3ZCO A;  2VJ5 A;  1ZGA A;  1KU7 A;  4W1U A;  2A69 F;  3SHF A;  2UWM A;  3QOE A;  1KYW A;  2ZNZ A;  3KPH A;  4OIR F;  4D5C A;  4IEJ A;  1YRN B;  3JSP A;  1D3Y A;  3LMM A;  2UUZ A;  2L4M A;  4M6X A;  3H3Z A;  2N8G A;  2F5C A;  3Q5F A;  5K7F A;  1KU2 A;  1ZRF A;  3A02 A;  2BHZ A;  2ZNY A;  3PUF A;  5HNH A;  3GTJ J;  2EIN H;  4XON A;  2JK3 A;  3IAM 2;  5KHD A;  3LSR A;  4XKW A;  3QAH A;  4JX5 A;  2R7X A;  2XV4 S;  4QIW N;  2B63 J;  2EBI A;  4BDZ A;  3EUH A;  1Z77 A;  4PK4 A;  3SZT A;  3VEP A;  3WTV C;  3GTP J;  3C3W A;  3R60 A;  2QCO A;  4NQW A;  4M3E A;  4PFO A;  3IWF A;  2AQE A;  2V1U A;  1K83 J;  3SZP A;  3V42 A;  4ZYE A;  4GYI A;  1W1W E;  3QPS A;  1IXS B;  4EEF G;  2DFH A;  4E4H A;  1AOY A;  2DMQ A;  3RZO J;  2HU9 A;  1XCB A;  3GBG A;  2ZXH A;  3DFG A;  3K70 C;  2GIZ A;  3E6D A;  2CWE A;  2CW8 A;  2R0Q C;  4NNJ A;  3KET A;  3MZ8 A;  3S8P A;  3CJR B;  2H09 A;  1R5H A;  3JSO A;  1QU3 A;  3GFM A;  1QRY A;  2DOA A;  1FIP A;  3HSF A;  3JRG A;  4BH9 A;  3WTY C;  1FC3 A;  3S32 A;  2M0M A;  3ZQ7 A;  4C3J J;  1ON1 A;  2CSO A;  1B9N A;  2ZME C;  5LD2 C;  3GZ5 A;  3OL3 A;  5H20 A;  3K1P A;  3QYE A;  1JKR C;  1MMD A;  3FXM A;  2VBW A;  2X1E A;  4DZP A;  5M3M J;  3ZN1 A;  1WQ2 A;  4BJ6 C;  1VFC A;  4GO1 A;  3BTI A;  3O8H A;  4C2U A;  4PUS A;  1J09 A;  3GVA A;  4RMN A;  2FA5 A;  2ZME B;  2K9N A;  4RGU A;  4A12 A;  4I7H A;  2OZ6 A;  4RLQ A;  1ZAR A;  2BVL A;  1LVK A;  2VJJ A;  3EPZ A;  1TZL A;  2FBH A;  3CCR I;  3LQQ A;  3ZOB A;  1IJW C;  2YX7 A;  4IKF A;  4ENK A;  1OCT C;  1ZGJ A;  1Z21 A;  1FOW A;  2W85 A;  2O7O A;  5ILU A;  2NVY J;  3U2R A;  1G8X A;  3BZC A;  3F22 A;  3F72 A;  2JA2 A;  5AON A;  1HF0 A;  1E17 A;  1JT0 A;  1OYI A;  3FX3 A;  3UKG A;  4QLC U;  1ZK8 A;  2VKH A;  3OIO A;  5FO5 A;  2ELK A;  4DOZ A;  1K7A A;  3DF8 A;  2NOJ B;  2L7K A;  2FUG 2;  3Q0W A;  4ZDL A;  2RNG A;  3TGN A;  1SVM A;  3NAR A;  1I6H J;  2AO9 A;  4DQ2 A;  1VQL I;  3GZ6 A;  4DNC A;  3M8E A;  2DDA A;  2CG4 A;  5FKM A;  4YII A;  4KT6 A;  2JWT A;  2XAS A;  5KNL A;  4P55 A;  3KZZ A;  2HVR A;  4F55 A;  2LKS A;  2CO5 A;  2H6B A;  3E5U A;  1OCC H;  3K4N A;  5EZG A;  2CUJ A;  2DYS H;  3FMS A;  3HUG B;  2VON A;  3P9K A;  4NBQ A;  1IXC A;  1B4A A;  3TDU C;  3JRC A;  4CCN A;  1JUP A;  5J3L A;  2NVU B;  5J1R A;  5E3O A;  2HTS A;  2VIX A;  1Y0N A;  1JKO C;  2XRO A;  4BAC A;  2FOW A;  2LRE A;  3FZV A;  4G6T B;  1Y56 A;  5HDG A;  2I5U A;  1KYZ A;  2VN2 A;  2GM4 A;  1E2X A;  2R7R A;  3K1M A;  4L0Z B;  4MTE A;  4I76 A;  1R4N B;  2ID3 A;  1IRX A;  2ELJ A;  5JHF A;  1FOY A;  3I53 A;  3H5N A;  4XKB A;  1UHW A;  1XGS A;  3K0L A;  1MZB A;  2Y0S N;  5E1W A;  4ZYD A;  1T8I A;  2H27 A;  2EH3 A;  1TWA J;  3QP5 A;  3BLY A;  2K9S A;  3A01 A;  3CC7 I;  1YS6 A;  3PNT A;  3FXK A;  4AM3 A;  4M3G A;  1BIA A;  2EZL A;  4Y17 A;  2BEO A;  2RQQ A;  4U88 A;  1BJA A;  2D5V A;  5FRM A;  2DXI A;  3OYI A;  2UZK A;  1YIO A;  1RNL A;  1W7P D;  1F4K A;  1Z1D A;  3CTA A;  3DPL C;  2P5V A;  2Y0M A;  1FY7 A;  5FB2 A;  5K5O A;  1LFU P;  1D8J A;  2ZFW A;  5J40 A;  4A5M A;  4M6V A;  2HI3 A;  3FBI B;  4Y13 A;  5D5U B;  1FYK A;  5D5X B;  1BC7 C;  2WAF A;  1HQC A;  4NB5 A;  4WF2 A;  1ZRE A;  2Y48 A;  2CFX A;  1A31 A;  1R1V A;  2K9Q A;  4KN4 X;  4M3B A;  5FFZ A;  1IDY A;  1WVR A;  5C4X J;  4RLF A;  2E19 A;  4AU7 A;  1U9N A;  2FE3 A;  3OYK A;  4HQM A;  5AIP A;  2O3F A;  2Z2S B;  4N4O B;  2RAE A;  5E79 C;  2GZW A;  4RBO A;  3TW7 A;  3HRT A;  2VBX A;  1QNT A;  5J47 A;  3J7A O;  1USS A;  4BQA A;  2DT6 A;  2PMH A;  2X6Y A;  3BTC A;  3H1C A;  4QSH A;  5HLH A;  3OSG A;  1LQ1 A;  2HQR A;  2J5P A;  2XUB A;  4NC6 A;  1RR8 C;  1ZAO A;  2XAJ A;  2X1C A;  1TBX A;  1YW7 A;  3IAS 2;  4LJZ F;  2BY1 A;  1MIJ A;  5DD4 A;  3Q0V A;  3RSN A;  2DK8 A;  4QPO A;  3M07 A;  3OR1 C;  1MH3 A;  4UB6 C;  3H36 A;  2HYF A;  4XOP A;  2K9L A;  3PO3 J;  5CVU A;  2XF5 A;  3I3L A;  3M7G A;  4BJT A;  5C4J J;  2HDD A;  4XOR A;  4IJA A;  1IUF A;  2BVM A;  1ETQ A;  3BOQ A;  2KZG A;  2O03 A;  3ISP A;  5LGT A;  1LUJ B;  2QBY A;  5B3S H;  3JRF A;  1QPI A;  1ZN2 A;  4H0E A;  3MD2 A;  1R23 A;  2CU7 A;  2XF6 A;  2R7S A;  4HLY A;  5IOZ A;  3G6E I;  2JA8 J;  5CVI A;  2HTJ A;  3M8F A;  1I50 J;  3VSL A;  3OYG A;  3TKY A;  3O3K A;  3GO5 A;  2JQ7 A;  4FT8 A;  1J7K A;  4ENJ A;  3FXO A;  2ZXI A;  2JPC A;  5ICF A;  3SXY A;  3ZMV A;  3HBL A;  5JFR A;  2W7N A;  3BC8 A;  1SVL A;  4RB3 C;  5GPC A;  3JRI A;  1KQ0 A;  4ZTJ A;  3OIQ A;  2A68 F;  2JUG A;  4CCM A;  5DCM B;  2EQR A;  2BXZ A;  1B8I B;  5BNG A;  2QLZ A;  3BCB A;  2Q0O A;  3IH3 A;  5BOX A;  1BC8 C;  2VI6 A;  2LRD A;  2OQR A;  3ROU A;  2WAQ A;  1SFO J;  4XRS A;  1Z05 A;  2VQG A;  1R22 A;  2YX4 A;  1H9G A;  1S7O A;  2CW0 F;  5KAF C;  5L3G A;  3IH2 A;  2FQ4 A;  5FLV A;  1YW8 A;  2O8K A;  1LDD A;  1OCZ H;  1WH5 A;  4XIC A;  1KZH A;  3GEZ A;  5LGN A;  1CF7 B;  3EDP A;  1UCR A;  5CPR B;  5K1Y A;  2XB5 A;  3E6B A;  4CH7 A;  4RDU A;  3UNG C;  1W36 D;  3WHB A;  3F6O A;  3ZQH A;  3HTU A;  1E3H A;  3V7S A;  2KLO A;  3ZXS A;  5IYB J;  2PQ8 A;  5LGU A;  2BV6 A;  2LP0 A;  2XB0 X;  2Y69 H;  3G73 A;  1FIA A;  4DGW B;  4AIJ A;  2CUE A;  3DU5 A;  4WXH A;  2PJR A;  3KP2 A;  3W6V A;  3K2Z A;  2DMP A;  3L1P A;  2CQ7 A;  5A2Q K;  3OV8 A;  3MVP A;  5F08 A;  2X9D A;  1AKH B;  3FMQ A;  2P6T A;  1FLI A;  1UG2 A;  4XLF A;  1U5T A;  1V5F A;  3JAM K;  3HSE A;  5EEG A;  2MLK A;  3F0C A;  3KEY A;  5IYD J;  2Y9Y A;  3N4M A;  1W0T A;  3B6C A;  4PJJ A;  3ZPL A;  3HKZ A;  2KDZ A;  5J1Y A;  4MQ9 F;  1Y1W J;  1QA6 A;  2IVM A;  3FM5 A;  3DLA A;  5EEA A;  1ACI A;  4G12 A;  2JVH A;  2LSO A;  1OQY A;  3P9I A;  3CZ6 A;  2O0Y A;  3HC7 A;  3LFK A;  2EB7 A;  2KIU A;  3GFI A;  5HOO A;  1YO5 C;  5IT9 Z;  4UVC A;  2L9S A;  2XDV A;  2ECC A;  4K2E A;  3WTU C;  4MFD A;  1I5Z A;  3VPR A;  3H9J A;  2CYY A;  1XD7 A;  5M5W J;  3K2A A;  2PX9 A;  1IN8 A;  2QEN A;  3EUA A;  4XID A;  4A2U A;  2DYR H;  2DJN A;  4EGY A;  5FKN A;  2RNJ A;  5ICC A;  1ODD A;  2H94 A;  4Z6Y A;  3CCV I;  1IRF A;  2H1L A;  2EA4 A;  4N4N B;  2NRA C;  2MYS A;  2CMP A;  2KL4 A;  4IX7 A;  1HLV A;  1UAA A;  4BBR J;  4LG0 A;  1IV8 A;  2A07 F;  2ZB9 A;  1G3W A;  2KIF A;  4CZZ A;  3PL8 A;  4YFN F;  3WGI A;  3HSR A;  5IY5 H;  4A3B J;  1YIJ I;  3BRO A;  4IRI A; 
#chains in the Genus database with same CATH homology
 3SJM A;  1IDZ A;  2M8G X;  2ME0 A;  5F0C A;  3Q0U A;  2R92 J;  3GTG J;  1S7E A;  2XPU A;  4A3K J;  1AHD P;  2HOS A;  5FKO A;  2P81 A;  4BXX J;  4A3G J;  3JRD A;  5JLW A;  2VKE A;  1WCM J;  1H89 C;  3O8G A;  1TWF J;  1VI0 A;  4FIS A;  1GVD A;  1OFC X;  1YRN A;  4A3I J;  1TWG J;  2YUS A;  4CYC B;  2DMN A;  3G1L A;  3IV5 A;  3TED A;  2LFB A;  4DW6 A;  2WAQ N;  2VPR A;  3FKI J;  1GV5 A;  4AUX A;  1HCR A;  5EF6 A;  1NK3 P;  2PMZ N;  2VUM J;  1VF9 A;  4IHW A;  4W1U A;  2HOT A;  1RR7 A;  1G2H A;  4D5C A;  1YRN B;  4IEJ A;  3NAU A;  1PUF A;  2VKV A;  2N8G A;  2JA7 J;  3G1M A;  4B1R A;  5K7F A;  1TC3 C;  2X6O A;  3A02 A;  1EF4 A;  1U9O A;  3B6A A;  5J1U A;  4BKX A;  3GTJ J;  4A3F J;  1U8B A;  2JK3 A;  3LSR A;  1JUM A;  1BJZ A;  2LR8 A;  4JX5 A;  1ETV A;  4QIW N;  2B63 J;  2EBI A;  1JKP C;  3JRH A;  3JR9 A;  1OCP A;  1Z77 A;  3H0G J;  1PUF B;  1ZGW A;  1ZR2 A;  3GTP J;  2HQ5 A;  2L0K A;  2QCO A;  3S16 J;  4M3E A;  2XGE A;  5IYC J;  1K83 J;  3HKZ N;  2CQQ A;  5K7Z A;  3GTQ J;  3QPS A;  3QPL A;  4EEF G;  1SAN A;  4A3M J;  3TP0 A;  3S1M J;  4BY1 J;  2DMQ A;  3RZO J;  3GBG A;  2XPW A;  3RZD J;  2M34 A;  3HOW J;  1TWC J;  1XG1 A;  2R0Q C;  4LOC A;  4DYR A;  3S1N J;  4BBS J;  3PO2 J;  1QRY A;  4AC0 A;  1FIP A;  3JRG A;  2M9H A;  2Y30 A;  2JA5 J;  3S17 J;  4C3J J;  1U78 A;  2WB1 N;  1O4X A;  3MN2 A;  2YU9 J;  2JN6 A;  4JX4 A;  3FK6 A;  2EZI A;  4GFB A;  1RPW A;  1JKR C;  1MBJ A;  2M0C A;  4MFE A;  2X48 A;  4C3I J;  4FE7 A;  4DZP A;  3ZQC A;  5M3M J;  1POG A;  1IGN A;  3FK7 A;  2GBY A;  1R9T J;  1FTZ A;  1VFC A;  3BQY A;  3BTI A;  3O8H A;  5HOD A;  2W48 A;  2IEK A;  1JJ6 C;  2G0E A;  3GTM J;  2K9N A;  2JMW A;  5IP9 J;  2L9R A;  4Y52 J;  3BR6 A;  5C44 J;  1JKQ C;  4I6Z A;  1IJW C;  1ETX A;  3ZOB A;  1APL C;  1JTX A;  4A3L J;  5F0H A;  5K7H A;  1BA5 A;  3GTO J;  5EDN A;  1OCT C;  2O7O A;  2DA3 A;  1ORK A;  2NVY J;  2DA2 A;  4FCY A;  4L5E A;  5JLX A;  1HF0 A;  2DMU A;  4C3H J;  1JT0 A;  2I10 A;  5E3L A;  3UKG A;  1ETO A;  1ZK8 A;  3OIO A;  2O9L A;  4JP0 A;  2ELK A;  2E1O A;  4C2M J;  5FKK A;  2R7Z J;  3ZQL A;  3Q0W A;  1FTT A;  3NAR A;  1I6H J;  1HDP A;  2AO9 A;  2GLO A;  2DA4 A;  3FIW A;  1BW5 A;  4A3J J;  2R5Z A;  5FKM A;  1RET A;  5M5Y J;  2JWT A;  1JJ8 C;  1DU6 A;  2MSY A;  5C3E J;  1MBK A;  4V2F A;  2WV1 A;  1T56 A;  2CJJ A;  4X6A J;  3GTL J;  1BL0 A;  3CCY A;  3BR0 A;  4B3A A;  1CQT A;  5EZG A;  5F04 A;  4ABZ A;  5EZH A;  2L7M P;  5IPA A;  2Y2Z A;  3JRC A;  2CQX A;  3OOU A;  1JUP A;  3HOZ J;  5J3L A;  1IRZ A;  3ZQF A;  2R5Z B;  5J1R A;  1RKW A;  3BG5 A;  3TW6 A;  5E3O A;  1B72 A;  3SFI A;  4IHY A;  2JJ7 A;  2CUF A;  3SDG A;  1JKO C;  2LK2 A;  4JYK A;  1X2N A;  1GV2 A;  2ID6 A;  3M4O J;  1P7I A;  1I3Q J;  2AHQ A;  1BW6 A;  1HOM A;  2HXI A;  4UUS A;  2GM4 A;  1JUS A;  5M3F J;  1MBE A;  4I76 A;  4HNV A;  1AU7 A;  3QQA A;  1NK2 P;  3S15 J;  2ID3 A;  1ENH A;  2TRT A;  1RKT A;  1LE8 A;  1XC5 A;  3S2D J;  3I4M J;  2QF7 A;  1B72 B;  2NS8 A;  2H8R A;  3BR1 A;  3BR5 A;  2Y0S N;  4A3E J;  2LTP A;  3HB9 A;  3MKL A;  5EGO A;  3HOV J;  2EH3 A;  1TWA J;  3H3V K;  2K9S A;  4UUT A;  3A01 A;  1E3O C;  4UUS B;  1MH4 A;  4IHX A;  5DS9 A;  5FLM J;  1FJL A;  1TWH J;  3PM1 A;  1MBG A;  3GTK J;  3HOX J;  1LE8 B;  4M3G A;  4QTR A;  4DYC A;  2EZL A;  3WHC A;  2D5V A;  2LKX A;  2EZH A;  2KT0 A;  4DYQ A;  1UMQ A;  1GT0 C;  4XK4 A;  4MIM A;  1XS9 A;  2Y31 A;  1HDD C;  2NVX J;  2FJ1 A;  5EGO B;  1NTC A;  2LD5 A;  1LFU P;  4M6V A;  3A01 B;  1JT6 A;  2HI3 A;  4FTH A;  1WI3 A;  3E7L A;  5DTD A;  5F27 A;  4JX6 A;  3LOC A;  1X58 A;  2LVS A;  2M2E A;  2H1K A;  1D5Y A;  3D1N I;  2K9Q A;  3OSF A;  4BY7 J;  3HM5 A;  4M3B A;  5M5X J;  1IDY A;  5FKL A;  3LNQ A;  5C4X J;  2E19 A;  2E2J J;  1U9N A;  2E2H J;  3LSJ A;  4AYB N;  2K40 A;  2RAE A;  3BQZ A;  2HYJ A;  3DCF A;  4RBO A;  3TW7 A;  2LY9 A;  1F36 A;  4B4C A;  1H8A C;  2OF7 A;  1A6I A;  3BTC A;  3ZQI A;  3OSG A;  4QSH A;  2ME6 A;  2IAI A;  1MNM C;  2L7Z A;  3TP3 A;  2E2I J;  2NVT J;  2HXO A;  3BT9 A;  5F0F A;  3Q0V A;  3RKQ A;  1OJL A;  4A93 J;  4Y7N J;  5IOY A;  1MH3 A;  1ETY A;  4W97 A;  2DA6 A;  4S0H B;  2HOA A;  3PO3 J;  5C4J J;  2DN0 A;  2HDD A;  1K61 A;  4D5F A;  5EG0 A;  1IC8 A;  5GPA A;  1IUF A;  1DU0 A;  3BG3 A;  1ETQ A;  3G1O A;  4X1E A;  1LFB A;  5E3N A;  1GUU A;  3JRF A;  1QPI A;  2DA5 A;  3JRE A;  2YS9 A;  1Z0X A;  2FD5 A;  2CU7 A;  3ZQG A;  2COB A;  1QVU A;  2Y9Z A;  1B8I A;  1X2M A;  5IOZ A;  2JA8 J;  2ECB A;  2MG4 A;  3HOY J;  1ZTR A;  3LSP A;  1I50 J;  1ZQ3 P;  1W0U A;  5FJ8 J;  5EG0 B;  1T33 A;  4J19 A;  4A69 C;  3HBL A;  1UHS A;  4D7N A;  5GPC A;  3JRI A;  3K7A J;  2MW8 A;  2DTZ A;  3S1Q J;  3FIS A;  1GDT A;  2EQR A;  4MO7 A;  1B8I B;  2XPV A;  5BNG A;  3RQI A;  5EYR A;  1MSE C;  4NDL A;  3IH3 A;  2VI6 A;  3Q3S A;  3HGY A;  1SFO J;  1IV6 A;  1MBF A;  3BTL A;  4XRS A;  3HDD A;  3S2H J;  3IH2 A;  2FQ4 A;  1FEX A;  5FLV A;  1ZR4 A;  2O8K A;  4FE4 A;  4DZJ A;  1WH5 A;  4XIC A;  3CDL A;  3BG9 A;  3CMY A;  1JTY A;  2XB5 A;  1AKH A;  1VND A;  2MGQ A;  4XRS G;  1ZKG A;  4RDU A;  4M3F A;  3C2B A;  3WHB A;  3ZQH A;  3S14 J;  5IYB J;  4D7M A;  3DEW A;  5IP6 A;  4V2G A;  2LP0 A;  2XB0 X;  1A5J A;  4A3D J;  1FIA A;  4XRM A;  2CUE A;  1P7J A;  2XGD A;  3W6V A;  2EZK A;  2DMP A;  2FX0 A;  4M3D A;  3L1P A;  3BTJ A;  3JRB A;  3MVP A;  5GP9 A;  5F08 A;  2X9D A;  4MLO A;  1AKH B;  1UG2 A;  1WGX A;  9ANT A;  2JA6 J;  2NVQ J;  1ETW A;  2IBD A;  3F0C A;  5E3M A;  5IYD J;  2Y9Y A;  1W0T A;  3B6C A;  2R5Y A;  4A3C J;  3HOU J;  2KDZ A;  5J1Y A;  2R93 J;  1Y1W J;  1Y1V J;  1MBH A;  2NOG A;  3I4N J;  5EEA A;  1QVT A;  1ITY A;  4G12 A;  5IP7 J;  4IHV A;  2LLK A;  3S1R J;  3IH4 A;  2TCT A;  3BR3 A;  1IG7 A;  2DA7 A;  2ECC A;  3HGG A;  2XRL A;  4MFD A;  2CRG A;  3VPR A;  2OPT A;  5M5W J;  3K2A A;  2R5Y B;  4XID A;  2DJN A;  5FKN A;  1MSF C;  3BR2 A;  3A03 A;  3JRA A;  5F1J A;  2XSD C;  1F43 A;  1RES A;  1WH7 A;  3LSG A;  2XGC A;  1H88 C;  1HLV A;  2DMT A;  4BBR J;  2DA1 A;  1ETK A;  2NS7 A;  1Q1V A;  2ZB9 A;  3CQZ J;  1JGG A;  3M3Y J;  1WPK A;  3HEF A;  2L7F P;  4CYC A;  4A3B J; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...