1WH7A

Solution structure of homeobox domain of arabidopsis thaliana hypothetical protein f22k18.140
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
80
structure length
80
Chain Sequence
b'GSSGSSGSNPSSSGGTTKRFRTKFTAEQKEKMLAFAERLGWRIQKHDDVAVEQFCAETGVRRQVLKIWMHNNKNSGPSSG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ZF-HD homeobox family protein
publication title Solution structure of homeobox domain of Arabidopsis thaliana hypothetical protein F22K18.140
rcsb
source organism Arabidopsis thaliana
molecule tags Dna binding protein
total genus 13
structure length 80
sequence length 80
ec nomenclature
pdb deposition date 2004-05-28
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.60 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Homeodomain-like 1wh7A01
2AO9A 1F36A 5K7FA 5DS9A 2JMWA 1MSFC 2EQRA 1MBHA 1JKPC 3HDDA 2DA7A 3H0GJ 5HODA 4XRSA 4A3CJ 3D1NI 4X6AJ 2NS7A 1UMQA 3MKLA 4A3MJ 1JUSA 2LTPA 3BR1A 1Q1VA 5GP9A 1A6IA 3I4NJ 2EZHA 5C44J 1X58A 2DTZA 3RQIA 5E3NA 1VI0A 2E2JJ 4BBSJ 3HOVJ 1IDYA 4CYCA 1Y1WJ 2XGCA 1T33A 3A01B 1W0UA 2NVXJ 4GFBA 1IRZA 3LSRA 3QPSA 2HYJA 4G12A 1RETA 5IYCJ 4HNVA 2EH3A 1K83J 5EEAA 3IV5A 5JLXA 1ETOA 2CQXA 1AKHB 1NTCA 1VFCA 1IDZA 3RZDJ 3ZQGA 5EGOA 2LP0A 5GPCA 3LSPA 2XRLA 3BR3A 2O8KA 4EEFG 4RDUA 3A01A 2DA5A 1HCRA 4A3BJ 4D7MA 2ECBA 3CCYA 1RESA 2DJNA 2TRTA 3JRCA 2M9HA 4JX4A 3F0CA 4QTRA 1RPWA 2R5YB 4A3JJ 2JA8J 5F27A 1P7JA 2JWTA 3FKIJ 4QSHA 1S7EA 3BT9A 2KT0A 1APLC 1TC3C 2ID6A 2JK3A 3BG3A 4A3GJ 5F0FA 2DA1A 3A02A 1ZGWA 4D7NA 3HB9A 5FKNA 2W48A 3NARA 1MH4A 2QF7A 2DMNA 2Y31A 5EF6A 1ZKGA 5E3OA 2IAIA 5DTDA 3IH4A 2L7ZA 3HKZN 4V2FA 2XPWA 3DCFA 3GTJJ 2HXOA 2D5VA 2LY9A 3SDGA 2JA5J 1P7IA 1RR7A 1JKRC 1JGGA 1POGA 3HGYA 3BR6A 1MBGA 3A03A 2LD5A 4M3EA 2LK2A 3UKGA 2X48A 3CMYA 3PO2J 3ZQIA 2QCOA 4DYQA 1MNMC 4JX6A 4DZPA 3TP3A 2LVSA 5EZGA 3LSGA 3JRHA 1WH7A 1GUUA 2LFBA 5FLVA 3E7LA 1GV5A 1MBEA 4NDLA 4XK4A 4BY1J 1Y1VJ 2AHQA 2O7OA 4A3DJ 2LLKA 1GV2A 2XGEA 3GTMJ 3HOZJ 1VF9A 2Y2ZA 3TEDA 3Q3SA 1PUFB 4RBOA 3S1MJ 1AU7A 1WGXA 5J1RA 3GTPJ 3FK7A 1TWFJ 2GM4A 2VKVA 1MH3A 2EBIA 4A3KJ 4DZJA 1MBFA 1AHDP 1JUMA 2ME6A 2MW8A 1TWGJ 4CYCB 2DN0A 4C3IJ 4UUSA 1IC8A 2MG4A 2L0KA 4A3FJ 3SJMA 4DW6A 2O9LA 3GTGJ 4A3EJ 3W6VA 5J1YA 1PUFA 2HXIA 2EZKA 3BTCA 2R0QC 3ZQFA 1R9TJ 2IEKA 1MSEC 2R92J 1B8IB 5EGOB 3HEFA 3S15J 5C4XJ 1H88C 2XPVA 1MBJA 4I76A 4A3IJ 2JN6A 1LE8A 1XC5A 2Y0SN 1ZQ3P 1OFCX 2DMTA 1YRNB 4C2MJ 5F04A 4A69C 3O8GA 3JRDA 1GDTA 2X9DA 4B3AA 1E3OC 1HDPA 1B8IA 3PM1A 2ZB9A 3JRAA 4X1EA 1K61A 5IYBJ 2Y30A 3ZQCA 1DU6A 1U9NA 4A3LJ 2K40A 4W1UA 3MVPA 2OPTA 3BTLA 4JYKA 1CQTA 3ZQHA 1QVUA 5M5YJ 3I4MJ 2FX0A 4M6VA 1YRNA 3OSGA 3TP0A 2H1KA 1IG7A 1Z77A 2DMPA 2B63J 2HOSA 2JA6J 4Y7NJ 3S14J 2JA7J 5F1JA 3HBLA 5FKLA 4XRSG 2K9NA 1BW6A 3HM5A 1JKQC 1IJWC 3BR0A 1MBKA 3TW7A 2YS9A 2HOTA 4M3GA 1U78A 2PMZN 4ABZA 3Q0WA 4IHVA 1I3QJ 2ID3A 1I6HJ 3WHCA 2DA2A 4AC0A 4BKXA 5EG0B 3SFIA 1W0TA 5IYDJ 5M5WJ 3QQAA 3TW6A 5C3EJ 3G1OA 1JTYA 1JT6A 1OCTC 4FE7A 2CUFA 3HOWJ 2YU9J 2WB1N 2XB0X 2CRGA 3S1RJ 3JRIA 3WHBA 2I10A 3OOUA 4FISA 3LNQA 1U9OA 1X2MA 1FJLA 5IOYA 1B72A 3FK6A 5EG0A 2DA4A 2NOGA 1FEXA 2L9RA 1QVTA 3JRGA 2IBDA 3LSJA 2HQ5A 1JKOC 1BA5A 1F43A 4M3BA 4DYCA 4AUXA 4B1RA 5F0HA 5GPAA 4UUSB 3G1MA 4I6ZA 1BJZA 1X2NA 2LR8A 2CQQA 5C4JJ 1ETVA 3K2AA 4JX5A 4MFEA 1OCPA 3JREA 2HDDA 1LFUP 3FISA 3S2DJ 3IH3A 2VPRA 3L1PA 3S16J 3O8HA 4C3HJ 4M3DA 1LE8B 1JT0A 3B6CA 4D5CA 2MGQA 3BTJA 2FJ1A 2L7FP 4FE4A 3RKQA 1ETWA 1ZK8A 2ME0A 3GTKJ 2R93J 3GBGA 1JUPA 1FIAA 4JP0A 1GT0C 3S1NJ 1Z0XA 5F08A 3BQYA 1TWAJ 1TWCJ 1ETXA 1QPIA 3ZOBA 2Y9YA 4B4CA 2R5ZB 4UUTA 5FJ8J 2M0CA 2HOAA 1RKWA 5FKKA 2H8RA 4FTHA 3BR5A 1ETYA 1RKTA 3RZOJ 1WCMJ 3BR2A 4BY7J 2X6OA 4IEJA 2CJJA 5IP9J 3H3VK 1T56A 2XGDA 4W97A 2GLOA 1JTXA 2NVQJ 1VNDA 1WPKA 1TWHJ 2FQ4A 2M34A 3FIWA 5JLWA 4S0HB 3MN2A 2R5ZA 5M3FJ 3C2BA 3GTOJ 2DMQA 1LFBA 3S17J 1H89C 1IV6A 1HLVA 2K9QA 2DA3A 3BTIA 3LOCA 2JJ7A 4BBRJ 1WI3A 2XSDC 1DU0A 2Y9ZA 3HOYJ 5F0CA 1BW5A 2M8GX 2EZIA 1D5YA 2NVYJ 1QRYA 1ZR4A 1A5JA 2DA6A 2XB5A 2VUMJ 3HOUJ 2E1OA 2EZLA 3VPRA 3JRFA 1FIPA 2DMUA 3NAUA 9ANTA 5BNGA 5IPAA 4AYBN 2P81A 1OJLA 4M3FA 5EDNA 1EF4A 4BXXJ 4IHWA 1GVDA 3BG5A 5FKMA 2CU7A 1B72B 4XICA 3S1QJ 3ZQLA 1XG1A 1AKHA 3JRBA 5J3LA 3HGGA 4MFDA 4D5FA 4DYRA 5E3LA 1ZR2A 3Q0VA 3S2HJ 4C3JJ 1FTZA 4MLOA 1ITYA 2WV1A 2OF7A 3CDLA 5K7HA 2MSYA 5EZHA 3GTLJ 1BL0A 3M4OJ 2HI3A 3IH2A 5IP7J 5IOZA 2RAEA 2YUSA 2L7MP 3B6AA 4V2GA 4XIDA 2GBYA 1ETKA 2R5YA 3CQZJ 2TCTA 1SANA 5FKOA 3BQZA 1NK3P 4MIMA 5J1UA 1JJ8C 1ORKA 1HOMA 3M3YJ 3Q0UA 2CUEA 2NS8A 3BG9A 2G0EA 2M2EA 1SFOJ 5M3MJ 3K7AJ 1HDDC 2ELKA 1NK2P 5IP6A 5EYRA 2COBA 4QIWN 1ENHA 1UG2A 3OIOA 4XRMA 2VI6A 4A93J 4Y52J 3OSFA 3GTQJ 1ZTRA 2XPUA 1XS9A 2E19A 5FLMJ 1H8AC 3DEWA 2E2HJ 5M5XJ 4IHXA 4J19A 3QPLA 1G2HA 5E3MA 2KDZA 1ETQA 1HF0A 4L5EA 3HOXJ 4MO7A 3G1LA 3JR9A 2R7ZJ 1JJ6C 1O4XA 1IUFA 2K9SA 2FD5A 4LOCA 2WAQN 3PO3J 4FCYA 2E2IJ 1FTTA 1UHSA 1WH5A 1IGNA 1I50J 5K7ZA 2NVTJ 1U8BA 2ECCA 4IHYA 2N8GA 2VKEA 2LKXA
chains in the Genus database with same CATH superfamily
3W2WA 1Z6TA 4CSWA 2RDPA 2E7XA 4LK0F 3HSFA 3MWMA 3DU6A 2EQRA 1LDDA 4ENKA 1JKPC 1G4DA 1AOYA 1KYZA 4H0EA 4EJVA 4E7IA 4GO1A 3D1NI 2NS7A 3BJAA 4B44A 1ON2A 3MKLA 3CCSI 1JUSA 3BR1A 5GP9A 1LEAA 3I3LA 5C44J 4FX0A 3KPHA 3RQIA 5E3NA 1ZG1A 3R0JA 4BGDA 3L2VA 1ZN2A 2HS5A 3KZZA 4XM3A 3BJ6A 1IDYA 1T33A 3A01B 4GFBA 1IRZA 2K4BA 5E8IA 3F8CA 1SFKA 4BAYA 1O7LA 5EEGA 2L2OA 1WFXA 1AKHB 2NRAC 1NTCA 2X1CA 3GZNB 2BZTA 1S3JA 2ETHA 2IRFG 3VSKA 2K02A 4RB3C 3OYHA 5GPCA 4IF4A 2PFBA 3F6OA 3IWFA 5ILSA 5HNHA 1HCRA 2DA5A 3JTGA 3V7CA 1JHFA 5J6XA 4BE1A 5D6EA 3CCYA 4J01A 1S5LC 1R1TA 2DQRA 3K2ZA 2L5QA 4LD5A 4QTRA 2IGMA 1YS7A 2XUBA 5F27A 3HHHA 1T8IA 2QVOA 2VC0A 3OYIA 3H1CA 1S7EA 4EVIA 3EUAA 3KP7A 3PIPF 1TC3C 4A3GJ 2LNBA 3I9V2 3JSOA 4ESBA 3A02A 3KP4A 3M07A 1K78A 1FSHA 1BI2A 3CZ6A 4O6JA 3ZMSA 1QNTA 1MH4A 4N9HA 4NQWB 3HTSB 2DMNA 2JUCA 1QO0D 2B9SA 2Y31A 2XASA 2D1HA 2RREA 4UV8A 3IH4A 2IP2A 4UV9A 2HXOA 2LY9A 4ZJZA 3SDGA 2JA5J 1I1SA 1P6RA 3VODA 1DP7P 1KU7A 2F4OB 4U0WA 4M3EA 1T98A 3ZQ7A 3CJRB 4P5OA 2H6CA 4E6KG 2MA3A 3PO2J 2F2EA 2PI0A 2F5EA 2W00A 2F6CA 1F9NA 3ABMH 1ZG5A 4DYQA 2FSWA 5ICFA 1QZEA 3PNYA 4R79A 1X1CA 5L3CA 2Z16A 1WH7A 4E7LA 3BDDA 1B4AA 4K2EA 1U5TA 3KLNA 4P55A 4XK4A 4KN4X 3KFWX 2QUFA 1Y1VJ 1YW7A 2O7OA 1YIJI 4KMUX 3GTMJ 4E4HA 3KP6A 2HPMA 4EM2A 2IVMA 3S1MJ 1UELB 3KEOA 1MMNA 4LG3A 2O6GE 2L9SA 2VKHA 1MH3A 1DUXC 1H0MA 4GXOA 1JE8A 1B1BA 5E1XA 2L3DA 3CC2I 2BY0A 2F4MB 4LB5A 2RQQA 4C3IJ 4UUSA 1HW1A 3WTSC 4A3FJ 1G3SA 3LFUA 5BQTA 4HV5A 3VWBA 1FP1D 3ABTA 4BXFA 2Y0SA 4TV7A 1PUFA 4HZFA 4BEHB 2NVUB 1R7JA 2V9VA 1EJ9A 3S93A 2HXIA 1ERDA 1Z05A 1G8XA 5HDKA 2VL8A 1DQUA 3JW4A 4HDVA 5AIQA 2XPVA 4EJOA 3AG2H 3BZKA 1XPXA 3LAPA 3BOQA 2CGPA 3KEQA 2VE9A 3WTZA 2HKXA 4DBRA 1LE8A 1LFPA 2EV5A 2LYCA 1FBSA 5GAEJ 4YFNF 1D0YA 3CO7C 4EV0A 3FDYA 3L2RA 3QYFA 2A61A 3O8GA 4BQOA 2UXXA 1IXRC 2OTJI 2KIMA 4GGGA 2E5NA 4G6DA 1K61A 2L7KA 4B09A 2DPDA 2NNYA 4OIOF 3ZQCA 4XORA 3ZN0A 2K40A 2OPTA 1JHHA 5IT3A 4KDPA 1CQTA 4A0XA 3ZQHA 1ZH5A 3CCEI 1QVUA 2K7LA 3P7NA 4PK4A 3CDIA 3V8JA 1V5EA 2VQCA 2XIGA 5DEQA 4M6VA 1YRNA 1IG7A 2DMPA 3RI4A 1TQIA 2D1VA 3S14J 3E6DA 2LKPA 2HFHA 4UXNA 3D0SA 5F1JA 4XKBA 3HBLA 4U7BA 1BM9A 3ZMUA 3SYTA 4XKCA 3OYMA 5JVGF 2LOOA 2WB1A 2OCEA 3IWZA 3F22A 4BQAA 3Q0WA 1XN7A 4IHVA 1I3QJ 2QZ8A 1V3FA 1IUYA 5HS9A 4N4OB 1IN5A 1P4AA 2DA2A 3G2BA 3R4KA 5ILUA 4EATA 4ITVA 1WHUA 5HLIA 3SEQA 3EETA 4AC0A 5LHHA 1BI0A 5C3EJ 1OCTC 1JTYA 2JPCA 2CUZA 3HOWJ 4CCJA 4I7HA 1K4TA 3DEEA 4C2UA 3S1RJ 2P5VA 1W36C 3OOUA 4FISA 2OUMA 3OYBA 1X2MA 3AL0B 2M7BA 3GYHX 5EG0A 3QYEA 1FEXA 2NAZA 3D5LA 3I0TA 4DNCA 2E36A 2IBDA 3LSJA 5TISC 3K9TA 1T95A 4N4NB 3L2QA 1SEUA 3H36A 3NRVA 3ELKA 2DTRA 3TDUC 3HJEA 5GPAA 3CD6I 3F6VA 4ZDOA 3IAM2 2XHKA 4XN0A 1Z67A 3PL8A 2A69F 3WTXC 3GO5A 2CQQA 5C4JJ 1FC3A 3K2AA 4JX5A 3W6JB 3K69A 2W84A 3F9KA 5TJJA 3LA3A 2KZGA 2BW3A 3ZMTA 1L3LA 4IL6C 1BIBA 2IA1A 2HQRA 3IH3A 4MTDA 1XMAA 3CDHA 3HUGB 3O8HA 3V42A 1WZ2A 3IUOA 4M3DA 3ZMVA 1C0WA 1KU2A 3T8RA 3EDPA 3NQOA 2L7FP 2ESNA 4FE4A 2ZXHA 3T0YA 3OYEA 1TLHB 2RNGA 3LSMA 2M1BA 3QP6A 1SVMA 1B9MA 2CMPA 2PX9A 3GTKJ 2R93J 3K0LA 5HDGA 1FIAA 5HS7A 2Z3YA 2X51A 4G94A 2ZSHB 4I98B 2R5ZB 1OCOH 2DYSH 3F21A 3KETA 5L3GA 5ILVA 3I5UA 3BR5A 1LDKB 1XMKA 3BR2A 4BY7J 2Y0MA 2IXSA 2CJJA 1X1DA 4YIIA 2DCEA 2V1NA 3KE2A 3AL0C 3K70C 3H3VK 1T56A 4XSXF 4EGZA 4I0AA 1WJFA 3I64A 1VNDA 2JVHA 2M34A 1IV8A 4IOAF 3PQKA 4RA2A 3GTOJ 2QQBA 1LFBA 2HYGD 3ESWB 3C18A 4Z2YA 4N9IA 4Y17A 2K9QA 2O5RA 3BTIA 4KIFA 3QAHA 5HNFA 4HX7A 1QBJA 3WE2A 2KP6A 3BZ6A 2XSDC 1OLTA 2IGOA 1BW5A 2EZIA 1V5FA 1ON1A 2FXAA 3ASOH 3E3VA 2W25A 5JFRA 3OYJA 3M8EA 1ZR4A 5AIPA 3K4BA 2H1LA 3DPLC 2XB5A 2R4GA 2VUMJ 1NG6A 2PEXA 5D8LB 1T08B 1R00A 2E1OA 3VPRA 3O2PE 3JRFA 4M6YA 5LGUA 1QZYA 4U7DA 1P9QC 2A5WA 3R61A 4PJJA 3KYDB 1TZLA 4M3FA 4X0GA 2XV4S 1GVDA 4XICA 2JRTA 1LJ9A 3ZQLA 3RPQA 4PGHA 5J3LA 3HZJA 2LF7A 4ON0A 4C3JJ 2ISYA 1J59A 1FTZA 2DJIA 5H2FC 4NC7A 3RSNA 1VZ0A 2L9NA 3CDLA 2KKOA 3BG7A 3DBHB 4KUMA 1D0ZA 1A36A 5K7HA 2MSYA 3F23A 1VQMI 1ZGAA 3IH2A 2KRCA 2EWNA 2M3AA 2RAEA 3QU6A 1OISA 3HHGA 4EM0B 4PJNA 3OIPA 2FMYA 2GBYA 4PUSA 2JVGA 2R5YA 2JZYA 3QYBA 2FUG2 2TCTA 2OJED 5E1ZB 2XAFA 5DUIA 4LB6B 2ZC2A 2OC6A 1UJ8A 3F8BA 5FKOA 1J2XA 2EA4A 2QGUA 2QBYA 1TBXA 1NK3P 5FLXZ 5CLSA 5J1UA 5KCMA 4F52A 2A3SA 3OS1A 3FM5A 1YS6A 3M3YJ 1XCBA 1X3WB 1YLFA 3OY9A 2NS8A 2G0EA 1HW5A 2M2EA 4HLXA 3CMEI 4JQFA 4ZTJA 4A5MA 5IP6A 2QENA 3KLOA 2COBA 1PJRA 1FZPB 4A93J 2BBYA 4XONA 3OSFA 3WTYC 1FMVA 4I0BA 1MMGA 2JTVA 2XPUA 2HQAA 1XS9A 4Q5SF 5FLMJ 2E2HJ 1KA8A 4IHXA 1UB9A 2BY2A 1V54H 1Q1HA 3Q5FA 3JR9A 1RC9A 1JJ6C 3L09A 4LOCA 3ABKH 1V55H 1W5CC 2VBYA 2UUZA 2WAQN 3U2RA 2OAZA 3PO3J 5IT9K 1WH5A 1WJAA 2M8EA 4PFPA 4IRHA 1FLIA 4XLAA 1CGPA 1MD0A 3TOAA 3CUQA 5LRSA 3HL2A 2VKEA 2OCCH 2LKXA 5KHDA 1IXSB 2AO9A 2FEZA 3HSRA 4Z6YA 5K7FA 2F4IA 3BC8A 2JMWA 4QLCU 3I59A 3S32A 3HDDA 1MBHA 1XGMA 2DA7A 5HODA 4X6AJ 3QPTA 1YW8A 2HZDA 2R7WA 2OD5A 1UMQA 3CLQA 1I27A 3VYSB 1Q1VA 1OYWA 1A6IA 2EZHA 1SAUA 1LUJB 1XMXA 2OQRA 2RKHA 1JI8A 1VI0A 1MZBA 2E2JJ 4BBSJ 3HOVJ 1R1UA 2E71A 3DV8A 3H5AA 4GYGA 4YRVA 1Y1WJ 1W0UA 2NVXJ 3ZGKA 2R7RA 2BY3A 1T0FA 2V4JC 4HNVA 2EH3A 3WU2C 4XKWA 5EEAA 3IV5A 4F7ZA 2LDUA 5JLXA 1Y8RB 3CCMI 4IPAA 4IKFA 1VFCA 5HOOA 1MJ9A 1USTA 3IRRA 4D0PA 3RZDJ 2LP0A 1SVLA 2XRLA 3BWGA 4ZYAA 5DCMA 2OZUA 2MBFA 5EEHA 2K27A 2QKMB 5FROA 3V8LA 4IVNA 3HYIA 4A3BJ 2DT6A 1N78A 2X0LA 3J81K 4BH9A 1MNEA 3FWEA 2NYXA 1Y6IA 2CH0A 6PAXA 2IS1A 3ZMZA 3F0CA 5FFZA 2ZFUA 1W7PA 2M4GA 5K5RA 3SQNA 3TL4X 2CFXA 4UY8I 1PP8F 1XGSA 1WVRA 2F5FA 2KT0A 2UWMA 2JK3A 3BG3A 1PYVA 1R5ID 3VDXA 1U8RA 5F0FA 1J7KA 2DA1A 4XLPF 2HU9A 3L2WA 3HB9A 5FKNA 2DOFA 1UCRA 5J47A 3CCQI 2B7EA 3L00A 1HC8A 3GF2A 4KIBA 2BEOA 2ELHA 1ZKGA 5EF6A 2DODA 3OYAA 2FU4A 2IAIA 5DTDA 2RQPA 5FLXK 1OKRA 4RB2C 4V2FA 1W7PD 1ZELA 5KVRA 2D5VA 1OMIA 2EIJH 4HBLA 5L3DA 3RPUA 2M4KA 3BR6A 4ZYDA 1MBGA 2YSRA 4CCKA 4L18B 1R5GA 2VPLA 1SAXA 3UKGA 3K4MA 4P1WA 4CUGA 2X48A 3VFZA 3CMYA 2KZVA 1ACIA 1MNMC 2KRFA 1LEBA 4JX6A 3TP3A 3WE3A 2LBFB 4LMYA 1P4WA 2HVQA 2Q2EA 1IO2A 3L7WA 2P0WA 3LSGA 4RGRA 2VT3A 1TQPA 5FLVA 3E7LA 1G3TA 1GV5A 3RIRA 1ZREA 4BY1J 1BIAA 4A3DJ 4MHGA 1GV2A 1TQMA 2XGEA 2ZO4A 2IPQX 4HDUA 5HDNA 3DTKA 3TEDA 3A2KA 1PUFB 4RBOA 3MCZA 3K4LA 4AWXB 1I6XA 3GTPJ 1B9NA 1KQ9A 4ENMA 3P9IA 3ULQB 3K4JA 4HRIA 1AHDP 1JUMA 2ME6A 1WJCA 2MW8A 3ML6A 4CYCB 4RB0A 4YFKF 1T39A 3C7JA 3OL3A 2FA5A 4WXDA 2K3FA 4B3XA 4DW6A 1BC7C 2EK5A 4HQEA 4PDKA 4D9JA 4ZTFA 2WAEA 2R0QC 3SZTA 1FOXA 3KYLA 1MSEC 2R92J 5FFXA 5EGOB 2MD0A 1WJ5A 4Y15A 4KN7X 3LA7A 3BCBA 1D1CA 4RMNA 3TQNA 1FOWA 1XC5A 5LD2C 2Y0SN 2P7VB 2DMTA 1YRNB 4A69C 2DBBA 2AXLA 3WTVC 4B3AA 4G7OF 1HDPA 4BXUA 1B8IA 2ZB9A 1QA6A 3JRAA 1R1VA 3P5JA 3TO9A 1DU6A 2HZTA 1W5SA 4W1UA 3PJRA 3MD2A 2EINH 2HGCA 1IF1A 2MABA 1A31A 4M6XA 4OWRB 3ZPLA 3IRQA 2H1KA 2A5YB 3HRMA 2KMUA 2HOSA 2A6EF 2LC2A 2P5KA 4DJAA 1OYIA 2FMLA 4CXFA 3FKJA 4XRSG 3HOSA 4HG2A 3V7RA 2LREA 1JKQC 3WG7H 2GWRA 2MC4A 1Z1DA 1MBKA 3TW7A 2HOTA 4OAYA 3G4SI 1Y39A 4XRFA 1I6HJ 1YQAA 2BVLA 4JOMA 1UHMA 4XLCA 3G73A 2VOPA 2V1XA 2IS6A 4BKXA 5EG0B 2E7WA 2PJRB 5M5WJ 1YIOA 1JT6A 4FE7A 3PIOF 1NG7A 5ICGA 2YU9J 1LB2A 1E3PA 2CFOA 1GHCA 2ZXJA 2I8DA 2WB1N 4U0YA 5D5UB 2GOXB 3WHBA 3DXJF 3AG4H 5JVTA 4WCGA 2I10A 4I2OA 1FYLA 1FJLA 5IOYA 1B72A 3GLXA 1TNSA 1F5TA 2CUJA 1HSTA 3GVAA 1YE9A 3HOTA 3GFIA 1MIJA 1TP4A 2ELJA 4GRIA 2H8WA 2R7TA 4XBFA 1QVTA 4RGSA 4LK1F 3JRGA 3U9GA 3PFIA 3V8KA 3LA2A 2BW3B 4BQNA 3IKTA 2XF7A 5A2QK 2PG4A 2V79A 1V5GA 4M3BA 5HLTA 4M71A 2EFOA 3DF8A 5F0HA 1I39A 1FBUA 1A04A 3RQ4A 3H9JA 2Q8KA 4RB1A 4I6ZA 3U1KA 1KGSA 5JI6A 3CP2A 1E17A 2G9WA 2HEOA 2RV8A 1S6LA 4CICA 3GFMA 1ETVA 5J40A 3H35A 2HVRA 2NS0A 3JREA 2AQFA 4RM3A 2ACJA 1YW9A 1LFUP 2HDDA 4WXHA 3QOPA 1J09A 3IHUA 5LHIA 3HPHA 2WWYA 2F48A 3L1PA 2VBWA 1YOVB 2KL4A 2R7SA 1T2KA 1JT0A 4A12A 3K1PA 3QRFF 4D5CA 3HRTA 1EH6A 3GFJA 3DKWA 3IP4B 2R7OA 1ETWA 3CJTB 2EJRA 1LDJA 4KFCA 5KNLA 3OV8A 2WY7Q 2XKPA 3S1NJ 1TWAJ 4B4CA 2EB7A 1RRJA 1GVJA 4R1HA 5FJ8J 1YX3A 3M9AA 4ANJA 4P96A 3CCLI 5BPIA 2CV2A 1ETYA 1RKTA 3DKYA 1Y0NA 3SXYA 3RZOJ 2X6OA 4IEJA 3MKYB 1BOBA 3GEZA 1R4MB 4C2TA 4M9SA 2CWEA 1TW3A 2G7UA 3J7AY 5K5OA 1J5YA 3MZYA 4W97A 4GCVA 1JTXA 2NVQJ 1TWHJ 1BJAA 4S0HB 1ZGJA 1BBYA 4KA4A 3JTHA 2R7VA 4Y13A 1R4NB 1H89C 2DA3A 3C2GA 4RGXA 4AYBA 3LAJA 1O3TA 1WI3A 3PQJA 3WODF 2R7XA 4A0YA 3HOYJ 1MMAA 3AG1H 3AAFA 1K79A 2NVYJ 3DBRB 3I58A 2LSOA 2O03A 5HVQC 2OBPA 2UV1A 3H3UA 1J9IA 4S04A 2DT7B 1FIPA 1YTYA 2W7NA 3NAUA 1PDNC 3W2AA 3EYIA 9ANTA 3J80Z 1U2WA 2PN6A 1IN8A 2P81A 1G59A 2VQHA 4E7SA 4MEXF 2DLLA 1F4KA 2IGNA 2CU7A 1HKTA 2DQLA 2PBIA 1AKHA 3FHNA 3HGGA 3DKXA 3FXQA 4D5FA 4DYRA 2LG4A 2VJ5A 3TO7A 2D45A 2IT0A 1XD7A 2K5CA 2STWA 3S2HJ 3REOA 4HSTA 2QQ9A 3GUDA 4MLOA 2GIVA 2WV1A 5LBQA 3J7AO 5EZHA 1IXCA 4AIHA 1R36A 2DDBA 2HI3A 5F64A 3U1DA 1BL0A 2ICWG 4XR6A 5IOZA 5D4SA 3DQVC 1OYYA 3MQ0A 5CVUA 2O3FA 4L9VA 4XIDA 2KJCA 4BACA 1ETKA 2OV7A 3H3ZA 4DGWB 5DDGA 5J8CA 1K4SA 1OQYA 4HLYA 2W85A 2P5LC 2JQ7A 1EV7A 2HTJA 4PSXA 3S3MA 1HKQA 4RAZA 5HLHA 3GZ6A 1VQ9I 2RGVA 3RKWA 5J8FA 3FBNB 5KAIC 5ICEA 1ORKA 4PCQA 5GTHC 3DTEA 3D5RC 4IX7A 1MMSA 5E18F 2HQNA 2MH2A 4NQWA 3A4CA 3DLLF 1SFOJ 5M3MJ 4PFOA 4MQVA 2ELKA 4HEA2 2QLZA 4KNYA 5EYRA 4G6QA 3MMYB 3H9QA 1U6GA 4RAFA 3OIOA 2VI6A 4B48A 1IW7F 4I99C 5DD4A 4FASD 1LQ1A 4AVZA 5CPRB 1H8AC 2KDOA 3DEWA 1QHHD 5E3MA 1G3YA 1KQ0A 3I59B 2GXAA 3TBIA 1Z3XA 1VQ5I 1O4XA 1IUFA 1H9GA 2K9SA 4M9XA 2XAHA 1OCZH 3OWTA 4AVPA 5K7ZA 1PP7U 1P92A 2CW7A 4IQJA 3R6SA 2JSPA 4G6TB 4WF2A 4KIGA 5IT9Z 2H27A 2V6CA 1LPQA 4R8HA 4YEJA 1F36A 2KIUA 4AIKA 1Z7LA 1MSFC 2DU9A 5KAFC 4A3CJ 5LRRA 1ZRDA 3I4NJ 2VLAA 3OS2A 2DTZA 2NXNB 3F72A 2PLYA 3ZP5A 1AA7A 4RM2A 3GLLA 4DBQA 1ZAOA 3VYRB 2UZKA 1ODDA 4P9UA 4P9FA 4F55A 2EFNA 3LWFA 3H9GA 3QPSA 4G12A 4XKVA 3K4CA 3TKYA 2VASA 5IYCJ 1K83J 3FMSA 4ZZDA 4KJZA 3X2QH 3E0JB 1ETOA 1KQ8A 3PNVA 1W7PB 2IS4A 2PJPA 4N0BA 1WJDA 1IDZA 4ESJA 2VONA 4H4KC 3J80K 4L5IA 4FQGA 2XGXA 2VT2A 3LSPA 2O8KA 1ZHFA 4EEFG 1SD6A 3PNTA 2HDCA 4D7MA 3CUQC 2YX4A 1FBQA 2TRTA 4BE0A 2XAJA 3JRCA 2M9HA 2CQNA 4I01A 4JX4A 3GFLA 4KT5C 2ZJQF 4NHJA 1RPWA 2M5WA 4GYIA 4ZDPA 1A35A 2VN2A 2E34A 3J81Z 2JA8J 5FO5A 1O57A 1I3AA 4L9NA 4LJZF 3HKZA 4QSHA 4BHCA 4CA0A 3BT9A 3JSPA 4A0ZA 5TRDA 2ID6A 1WI9A 2Z99A 2B0LA 4WWCA 4AD9A 4KITB 3KP3A 2BHZA 2FNPA 3FXJA 4U0VA 2CSOA 5TGTA 1QU3A 1X1BA 5ERIA 1WJBA 4XOTA 4BHPA 3A1YA 3OYFA 2J5PA 3I54A 1T0FC 3A0BC 4ENJA 1D8JA 3CESA 2WAFA 4LFUA 1DDNA 4ETSA 2F5DA 2XPWA 4D1QA 3GTJJ 4BL0B 4HAMA 4HX8A 3N97A 1JKRC 3OYNA 1POGA 3HGYA 2LD5A 1U0JA 1IAWA 1ZRCA 2E35A 2V9KA 3LSKA 2KFDA 4FETA 4OU0A 5CQGA 4EJWA 2W82A 5DM7F 2LRDA 3ZQIA 4ZYGA 1O7FA 3ABLH 1Z6RA 1CF7B 5LLQA 5DCFA 3JRHA 1J0RA 2LFBA 4YG2F 2PMHA 2ISZA 4HF1A 3K6GA 1VQ8I 2YX7A 2GZWA 1VTNC 1VQ4I 2R7DA 3MFKA 2E1CA 3JCUC 1TT5B 2Y2ZA 1Y0UA 4HOBA 4XSZF 2ZXWH 3Q3SA 4WK8F 4L5JA 5J1RA 3WGHA 1TWFJ 4ZYHA 2GM4A 2VKVA 4A3KJ 1W5TA 2CO5A 1MBFA 1XCVA 3ABUA 4IHTA 4XL9A 2CQKA 3H5RA 1TWGJ 2ZMEA 1F1ZA 2DN0A 3S2WA 3RDIA 1FWZA 3NWSA 2MG4A 3VYTB 1IC8A 1DP3A 2L0KA 3SJMA 2X1DA 4EJUA 5H6QA 2O9LA 2ZKZA 4A3EJ 2XAUA 4EGYA 1J75A 3W6VA 1K6OA 3CMMA 2BYVE 4DQ2A 3BPXA 2EZKA 2ZJ2A 3BTCA 5F6FA 3ZQFA 3FHZA 2IEKA 4HW0A 3TMOA 2ZJRF 3G71I 1B8IB 1FSEA 5FGMA 3HEFA 1NH3A 4I76A 2GQQA 3VYUB 4OIQF 5E79C 4PJ0C 4XLFA 1ZQ3P 3SDBA 1YJNI 3ERED 2XAGA 3ZMDA 2IJLA 1BR4A 2CV0A 2QQAA 1KYWA 5F04A 3JRDA 2J5OA 2X9DA 3DBLB 4XLNF 2VXZA 1V4RA 3EUHA 4BDZA 3MKZA 3PM1A 1FY7A 5DUKA 2XKOA 5IYBJ 2Y30A 4DIQA 1FOKA 4CHUA 5B1AH 1JGSA 1KZHA 5D5VB 1K78B 2WTEA 1QHGA 2L01A 4JYKA 2PMZA 1I5ZA 3CCJI 1WRJA 1RIOH 4O5VA 1GXQA 1YJ9I 2GXBA 3QWLA 2IS2A 3I4MJ 1IN7A 2GOMA 2K86A 1QQIA 3S8PA 4CZZA 1IRGA 4Y7NJ 1EH7A 4L0YB 2K9NA 1BW6A 2TDXA 5D5XB 4WX9A 2GAUA 1IJWC 3BR0A 2IA2A 3A0HC 1HKSA 2W24A 3F3XA 1E2XA 2YS9A 4IQ4A 3QP5A 4BJ6C 1R23A 1U78A 4ABZA 1HA8A 2D2WA 4CDGA 3WHCA 1YG2A 1X4PA 3FM3A 3HXLA 2W1OA 1O3SA 1LKXA 2KRHA 2BXYA 3SFIA 1VQ7I 1UG0A 2F5VA 4XNFA 3TW6A 2EFPA 5J4YA 4Q47A 2DFFA 1TT0A 4HF0A 2XC7A 2AQEA 3W3CA 1FYMA 2M7AA 2VQLA 5AONA 2I5UA 1U5TB 2XB0X 3V4GA 3RYPA 2CRGA 4LITA 3JRIA 1S7AA 1WKMA 2G7HA 3VB2A 3JAMK 1RI7A 4UUVA 1U9OA 2MFZA 1HBXG 1OCCH 4M73A 4MEYF 3FK6A 4NUBA 3CJQB 2DA4A 2NOGA 2Z5UA 2DT5A 2L9RA 2O0YA 3CCVI 3ZXSA 3MZ8A 1S7OA 3IL2A 4CCNA 2DDAA 4Y3OA 1JKOC 2H6BA 2E5ZA 2EIMH 4QPQA 1F43A 3HIFA 3FXOA 4DYCA 2O8XA 3K4NA 4B1RA 3K4KA 2QSFX 5FD6A 1S29A 3RPUD 4UUSB 2VOOA 1R71A 1GLNA 2WY8Q 5A2QZ 2L4AA 1N77A 4MQ9F 2FF4A 1BJZA 1X2NA 3CCUI 1I1GA 2JSCA 2R3SA 3R60A 2X6XA 2WBMA 3HG9A 5E20A 4LLGF 2AXTC 3ONQA 5CJ9A 1OCPA 2WC2A 1R5HA 5D8KB 3FISA 3PSIA 3NEUA 4ENNA 2VPRA 2WA0A 3WTWC 3S16J 4LIVA 4C9YA 4G9YA 3COAC 4I02A 4C3HJ 1LE8B 4AM3A 4BS9A 2BXZA 3HTUA 2MGQA 3BTJA 4ZDLA 2FJ1A 1FPQA 2XSJC 3LSTA 4M72A 2KQRA 1ZK8A 3LMMA 2ME0A 5DYMA 1RUOA 2DO7A 4HV6A 3GBGA 1JUPA 5LGTA 2VB6A 1R6RA 2R7FA 3EQLF 2JPBA 2EFQA 3BQYA 1QPIA 3ZOBA 1PVEA 2Y9YA 1D5VA 4UUTA 3ZR8X 2M0CA 2COMA 2HOAA 3LFKA 5K5QA 1RKWA 2WADA 3SFZA 2H8RA 4HQMA 5LFAA 4NC8A 3FF5A 3OL4A 1U5TC 3K1NA 4G8XA 3FZVA 5CVVA 1WCMJ 1IRXA 2QKLB 3CLOA 3TGNA 1T6SA 5IP9J 3ZCOA 4AIJA 1BR1A 3KP2A 5HLGA 1Z3YA 1MJAA 2YU3A 4MGRA 1WPKA 2FQ4A 4A2UA 1RUNA 3MN2A 3S17J 4DOZA 1FT9A 2X85A 2YR2A 4OIRF 3SZPA 1XDUA 2GXGA 3LOCA 1OPCA 1SC7A 1YYVA 3F8MA 2RNJA 1USSA 1DU0A 2DK5A 2IA0A 2M8GX 4ZZLA 4UNOA 4PJLA 3CUOA 3GCMA 5BMZA 4OIPF 3KIOA 3OR1C 5K1YA 1A5JA 3QODA 4S05A 4CCOA 1Z7UA 2EZLA 3PUBA 3WGIA 1HW2A 5BNGA 3BROA 5IPAA 4AYBN 2FBHA 1IN4A 3RTRA 1N25A 2QYOA 1OJLA 3MEXA 3MZHA 2BVMA 4BXXJ 1PUEE 5FKMA 4XLHA 4XOPA 3S1QJ 4RLQA 1XG1A 2ZSIB 1SFUA 1OR7A 3KZIC 3JRBA 1YO5C 2H94A 1RNLA 3ASNH 4IXAA 1ZR2A 4LIUA 2HR3A 1B59A 3SEZA 3HSEA 1YITI 3B73A 2VODA 3OYKA 1ITYA 2OF7A 3WG9A 3FXKA 3M4OJ 4UHTA 1X3UA 4Q48A 4BJTA 3KP5A 3GX4X 2YUSA 4O3MA 5CVIA 4BUPA 4V2GA 1A6QA 1ZYRF 4QWQA 4Q4ZF 3LSHA 2PQ8A 3CQZJ 3C2HA 4L9JA 2HVSA 2HWVA 2M45A 1FP2A 3LSIA 4LG0A 2VJJA 1FMWA 2Z1DA 2BOLA 3ECHA 5LEJA 3ECOA 2FE3A 1JJ8C 1XDSA 2L54A 1HOMA 4UB6C 4YELA 3DFGA 2CUEA 2HTSA 4IJAA 4GDFA 5FRMA 1VQ6I 3BG9A 2KLOA 4ZYEA 3H0DA 3K7AJ 5FB2A 1HDDC 1NK2P 3CP8A 2P7CB 2ZXIA 2E1MB 1ENHA 1SMYF 1FNNA 2V26A 3SZGA 4XRMA 4HF2A 2ESHA 5CYVA 3AKZA 3GTQJ 2V6EA 4NC6A 2EILH 4F93B 5M5XJ 4RAYA 2Z33A 5JHUA 4J19A 2O61A 2CW0F 3OIQA 2KDZA 4II2A 4L5EA 5F1RA 2FD5A 3LQQA 2STTA 4B8XA 4FCYA 1EKEA 2E2IJ 4KYWA 4BDYA 1I50J 2HYFA 2LBFA 3LQRA 2VJIA 2NVTJ 5H20A 1RR8C 1BC8C 1U8BA 3BY6A 2ECCA 5LHGA 4IHYA 4LLNA 1IN6A 4HPQA 1G3WA 3E5UA 5B5EC 3O3KA 2P6TA 2LH9A 1FYKA 4BQQA 5IY5H 3L2CA 5DS9A 3QU3A 3OYCA 4L9TA 4KMFA 2M87A 2Q0OA 2YPRA 1MDMA 2BGCA 3H0GJ 1X1PA 4XRSA 1S9HA 4A5NA 5B66C 1TTYA 3O6BB 3E97A 4II3A 3WU0A 4E7ZA 2FQ3A 2DK8A 1R22A 5CVJA 4A3MJ 2LTPA 5D4RA 3DPTA 3GZ5A 1X58A 5LEKA 5L3EA 1MW7A 1VQOI 2KHMA 1KU9A 4CYCA 2XGCA 1GXPA 1MNDA 3LSRA 2E60A 5FRNA 2HYJA 1RETA 2MH9A 2ZFWA 3BP8A 3ISPA 4IRIA 3I56I 2F5CA 2CQXA 4J00A 3BCAA 2RVCA 4HX4A 2DW4A 1HXDA 1XSVA 3ZQGA 3BLYA 5EGOA 2VE8A 3BR3A 1VQPI 2E1MC 1YHQI 4UB8C 4RDUA 3A01A 1WSUA 4OAZA 1G6NA 4FX4A 3CC4I 4BU2A 1XX5A 1K6YA 2ECBA 2K9LA 2QM3A 3TOBA 3ZQQA 1RESA 2DJNA 1W1WE 5DV5A 4WXCA 3MAJA 2FRHA 2R5YB 4NNJA 1LVKA 2QWWA 4A3JJ 1P7JA 3K10A 3CC7I 2DOEA 4KICA 2JWTA 2LY1A 3FKIJ 2V1UA 2VQGA 4EJTA 2XF6A 1APLC 2QBYB 3E6BA 2UXNA 1ZGWA 4D7NA 5D6FA 2FBIA 2GIZA 3T5XA 1DPUA 3C3WA 2W48A 3GMEA 3NARA 2OTLI 5E17F 4CCMA 2QF7A 4KISA 2JRMA 2EIKH 2XF5A 5E3OA 1X3ZB 2LF8A 3EUKL 2NNNA 1Z9CA 2L7ZA 3HKZN 3DCFA 1SMTA 2KJBA 1VQLI 5BPDA 2FOWA 2ZCWA 4HA8A 2DXIA 2X4HA 1P7IA 1RR7A 3GW2A 1JGGA 3HRUA 1SD5A 3S3NA 3A03A 3E1SA 3FXLA 3CCRI 1XSXA 4MNUA 2LK2A 3RCOA 4BHBA 2XVCA 3Q9SA 3E5XA 2QCOA 3M1CA 5DM6F 1KU3A 2KPMA 3UNGC 4DZPA 2PJRA 1HSJA 1VQKI 2LVSA 4AIDA 5EZGA 3OYGA 1GUUA 2A6HF 2HOEA 3CUQB 3S3OA 4OOIA 3TDZC 3FXRA 1KONA 1MBEA 2ZMEB 3FXMA 4NDLA 4PJMA 4HYEA 1E0EA 2JUGA 2VC1A 3G6EI 4PGGA 2AHQA 3DLAA 2LLKA 3HRSA 4IHSA 1XB4A 2R7UA 2VBZA 2X6YA 2HNHA 2P8TA 2DFHA 3HOZJ 1VF9A 4LLLA 3CO6C 3J7YJ 2CQ7A 1BOAA 3WTTC 1AU7A 1WGXA 1TL8A 4ESFA 4BE2A 1NHAA 5EJCA 2QQ8A 3FK7A 2EBIA 5CKTA 4DZJA 1OCRH 2A05A 2HKOA 3BG6A 1ZLJA 2W4SA 4E7JA 2V7FA 4L0ZB 1SD4A 4YIFA 3P9KA 4XLEA 2P4WA 4NBQA 5GAGJ 2BE5F 3GTGJ 3L9FA 3TO6A 5J1YA 1FX7A 1H9TA 1WJEA 1UZCA 2V9PA 3GXOA 1R9TJ 3AFHA 1B6AA 1DGRM 1Y8QB 4EM1A 1E3HA 3PUFA 3CMAI 2WV0A 3S15J 5C4XJ 1H88C 1MBJA 2DOAA 4IZZA 3DU5A 4ZH4F 1R58A 5DCMB 4HNUA 4A3IJ 2BV6A 2JN6A 2RN7A 4FT8A 3M7GA 1QPMA 5HS8A 2EFWA 3FMQA 2MYSA 2DFEA 2VJ4A 4E70A 4BEHA 1OFCX 2K85A 4FHTA 4C2MJ 3M1EA 1GDTA 3FMRA 3IKVA 3VOEA 1E3OC 2A07F 3RJPA 3ZN1A 5CVRA 3F8FA 4X1EA 4IOCF 3PFYA 4OINF 3KCCA 1U9NA 2MLKA 1AWCA 1LNWA 4A3LJ 3MVPA 2EV0A 1STZA 3BTLA 3R0AA 2X6WA 3KX2A 2Z2SB 4B43A 2ZMEC 4CO8A 4A6DA 2M30A 5M5YJ 2FX0A 3V7SA 3OSGA 4Y4RA 3TP0A 3WU1B 1Z77A 4EMSA 2Y75A 2CS3A 2MC3A 2ZJPF 1VQNI 3CJNA 2B63J 2JA6J 2JA7J 4UVBA 2VBXA 2DFIA 3W6KB 4E7KA 5DD8A 5FKLA 3HM5A 1XTAA 3DPUA 4RLFA 3LL7A 2XDVA 2LKSA 3N05A 1XSDA 3W2VA 3B02A 3U21A 1D0XA 2QEXI 1FOYA 4M3GA 1MGTA 4C30A 3J7ZI 2PMZN 2JT1A 2P6SA 3DP7A 2E1NA 3CF2A 4PSWA 1W36D 3D5SC 3SHFA 3MKWB 2ID3A 2H09A 5E1WA 1D1BA 1XGOA 3RKXA 3BZCA 4OMYA 4XQFA 1W0TA 5JR3A 5IYDJ 1D3YA 3M8FA 3QQAA 4I09A 1P2FA 3G1OA 3HC7A 1Z21A 2VIXA 1REPC 3GWZA 2KIFA 2Q2EB 3OMYA 3E6MA 2CUFA 3G3ZA 2BY1A 2OQGA 4G7HF 4F3QA 3WTUC 1SVOA 4V19K 2XRNA 4U88A 2ZBKA 2A6TA 3EUHC 5H6RA 2Y48A 1T38A 3L2UA 4MTEA 4UVAA 3LNQA 3KYCB 3KEYA 4QPOA 5BS6A 2EV6A 2VKDA 2M0MA 2CYYA 3FX3A 3JAMZ 3KZYA 4KT6A 4XN3A 1M1EB 1S72I 1RZ4A 2HQ5A 1BA5A 4HNTA 1BI3A 2DAOA 4AUXA 1YX5A 3G1MA 3BPVA 4NB5A 3I53A 1Z91A 4A6EA 4EQQA 1YJWI 3QPHA 2ZNZA 1UFMA 2IW5A 2BHYA 5LGNA 3RKYA 1D8KA 2DYRH 2LR8A 5GADJ 4MFEA 1S8NA 3VSLA 2L9VA 3EPZA 2QSGX 1MKMA 3S2DJ 1W4MA 2AS5F 1TW2A 2EA2A 2Z9OA 5ED4A 4CCLA 1UHWA 2LY2A 3ROUA 3OS0A 3I55I 4AU7A 3B6CA 1MMDA 2MD5A 3H92A 5E8GA 1K7AA 3ZRGA 2KISA 3RKQA 1ZLKA 4IRGA 4JBAA 3K70D 3E6CC 1SFXA 2NOJB 1YI2I 4BNCA 4F92B 2C6YA 1MJBA 1DPRA 1SFEA 2GA1A 4JP0A 4U87A 5B3SH 3CF5F 1GT0C 2A68F 1Z0XA 5F08A 1TWCJ 1ETXA 1ZARA 4LGWA 1EA3A 1Y56A 5D5WB 5ICCA 4E7HA 3HUGA 2GA2A 3Q9VA 1ULYA 5FKKA 2OZ6A 4FTHA 2XAQA 4UVCA 4JK1X 1UAAA 2K3PA 1EH8A 1O3RA 5BOXA 5L3BA 1X19A 2QSHX 2XGDA 2GLOA 4RAGA 2PMUA 1QGPA 3F8NA 3FIWA 4PZJA 5JLWA 2R5ZA 5M3FJ 1BN5A 3C2BA 3QOEA 4M9ZA 2DMQA 3WGGA 1QZZA 1WQ2A 1IV6A 2DI3A 1YFHA 1HLVA 2HPIA 2VXDA 2JJ7A 4BBRJ 2Y69H 2Y9ZA 5F0CA 1D5YA 4RS8A 3N4MA 1LVAA 5GTIC 1QRYA 1L0OC 1HQCA 1JXSA 2X1EA 5FD5A 2DA6A 4G7ZF 4CGZA 3HOUJ 4CYDA 1TNTA 3K1MA 2MLGA 4RGUA 3IAS2 2DMUA 4F91B 3EYYA 3FXUA 1XGNA 2CG4A 2V1DA 5JHFA 2XROA 3P9CA 2L4MA 5EDNA 1EF4A 4IHWA 3BG5A 1B72B 2CV1A 4MFDA 5E3LA 3Q0VA 1SD7A 4LG0B 3T8TA 3VEPA 4YIRX 3HPGA 5J4VA 3RYRA 1X1AA 3IC7A 2EPFA 2IGKA 2QA4I 3GTLJ 3NWTA 5IP7J 5L3FA 2FNAA 2L02A 3OR2C 2L7MP 3B6AA 2RC4A 1IRFA 4XMYA 1O3QA 1N75A 4CZCA 3PSFA 3E5QA 4B47A 1P4XA 1SANA 2DPUA 1D1AA 2K9MA 2LMDA 4CH7A 4ASNA 1BR2A 2R7QA 4YFXF 3DEUA 3I71A 4HSRA 3BQZA 3T1BA 4Y33A 4MIMA 1ZRFA 1BI1A 2JA2A 5KK1A 3Q0UA 3DWLE 1ONVA 4M74A 1ZG3A 1U3EM 4BJ5C 2OU2A 2WAQA 4ZC3A 5B1BH 3CTAA 4QIWN 2ZNYA 3H5NA 1UG2A 2KIQA 2Q1ZB 4Y52J 3DTIA 2FOKA 1ZTRA 2ADUA 1OR7C 5GAHJ 5CQEA 2E19A 2W57A 1R49A 4BYYA 3I4PA 1G2HA 3QPLA 3BJOA 3OYLA 1ETQA 2K4JA 4IO9F 1HF0A 3UR3C 3HOXJ 4MO7A 3G1LA 2R7ZJ 1MDMB 3AG3H 2OA4A 1IZ1A 1WWXA 3M8JA 1FTTA 1UHSA 4OMZA 2FBKA 3OOPA 1IGNA 2HDWA 3OYDA 3ERMA 3FBIB 1CF7A 3C1DA 2CW8A 2N8GA 1DGWY 1X4OA
chains in the Genus database with same CATH topology
2AO9A 1F36A 5K7FA 5DS9A 2JMWA 1MSFC 2EQRA 1MBHA 1JKPC 3HDDA 2DA7A 3H0GJ 5HODA 4XRSA 4A3CJ 3D1NI 4X6AJ 2NS7A 1UMQA 3MKLA 4A3MJ 1JUSA 2LTPA 3BR1A 1Q1VA 5GP9A 1A6IA 3I4NJ 2EZHA 5C44J 1X58A 2DTZA 3RQIA 5E3NA 1VI0A 2E2JJ 4BBSJ 3HOVJ 1IDYA 4CYCA 1Y1WJ 2XGCA 1T33A 3A01B 1W0UA 2NVXJ 4GFBA 1IRZA 3LSRA 3QPSA 2HYJA 4G12A 1RETA 5IYCJ 4HNVA 2EH3A 1K83J 5EEAA 3IV5A 5JLXA 1ETOA 2CQXA 1AKHB 1NTCA 1VFCA 1IDZA 3RZDJ 3ZQGA 5EGOA 2LP0A 5GPCA 3LSPA 2XRLA 3BR3A 2O8KA 4EEFG 4RDUA 3A01A 2DA5A 1HCRA 4A3BJ 4D7MA 2ECBA 3CCYA 1RESA 2DJNA 2TRTA 3JRCA 2M9HA 4JX4A 3F0CA 4QTRA 1RPWA 2R5YB 4A3JJ 2JA8J 5F27A 1P7JA 2JWTA 3FKIJ 4QSHA 1S7EA 3BT9A 2KT0A 1APLC 1TC3C 2ID6A 2JK3A 3BG3A 4A3GJ 5F0FA 2DA1A 3A02A 1ZGWA 4D7NA 3HB9A 5FKNA 2W48A 3NARA 1MH4A 2QF7A 2DMNA 2Y31A 5EF6A 1ZKGA 5E3OA 2IAIA 5DTDA 3IH4A 2L7ZA 3HKZN 4V2FA 2XPWA 3DCFA 3GTJJ 2HXOA 2D5VA 2LY9A 3SDGA 2JA5J 1P7IA 1RR7A 1JKRC 1JGGA 1POGA 3HGYA 3BR6A 1MBGA 3A03A 2LD5A 4M3EA 2LK2A 3UKGA 2X48A 3CMYA 3PO2J 3ZQIA 2QCOA 4DYQA 1MNMC 4JX6A 4DZPA 3TP3A 2LVSA 5EZGA 3LSGA 3JRHA 1WH7A 1GUUA 2LFBA 5FLVA 3E7LA 1GV5A 1MBEA 4NDLA 4XK4A 4BY1J 1Y1VJ 2AHQA 2O7OA 4A3DJ 2LLKA 1GV2A 2XGEA 3GTMJ 3HOZJ 1VF9A 2Y2ZA 3TEDA 3Q3SA 1PUFB 4RBOA 3S1MJ 1AU7A 1WGXA 5J1RA 3GTPJ 3FK7A 1TWFJ 2GM4A 2VKVA 1MH3A 2EBIA 4A3KJ 4DZJA 1MBFA 1AHDP 1JUMA 2ME6A 2MW8A 1TWGJ 4CYCB 2DN0A 4C3IJ 4UUSA 1IC8A 2MG4A 2L0KA 4A3FJ 3SJMA 4DW6A 2O9LA 3GTGJ 4A3EJ 3W6VA 5J1YA 1PUFA 2HXIA 2EZKA 3BTCA 2R0QC 3ZQFA 1R9TJ 2IEKA 1MSEC 2R92J 1B8IB 5EGOB 3HEFA 3S15J 5C4XJ 1H88C 2XPVA 1MBJA 4I76A 4A3IJ 2JN6A 1LE8A 1XC5A 2Y0SN 1ZQ3P 1OFCX 2DMTA 1YRNB 4C2MJ 5F04A 4A69C 3O8GA 3JRDA 1GDTA 2X9DA 4B3AA 1E3OC 1HDPA 1B8IA 3PM1A 2ZB9A 3JRAA 4X1EA 1K61A 5IYBJ 2Y30A 3ZQCA 1DU6A 1U9NA 4A3LJ 2K40A 4W1UA 3MVPA 2OPTA 3BTLA 4JYKA 1CQTA 3ZQHA 1QVUA 5M5YJ 3I4MJ 2FX0A 4M6VA 1YRNA 3OSGA 3TP0A 2H1KA 1IG7A 1Z77A 2DMPA 2B63J 2HOSA 2JA6J 4Y7NJ 3S14J 2JA7J 5F1JA 3HBLA 5FKLA 4XRSG 2K9NA 1BW6A 3HM5A 1JKQC 1IJWC 3BR0A 1MBKA 3TW7A 2YS9A 2HOTA 4M3GA 1U78A 2PMZN 4ABZA 3Q0WA 4IHVA 1I3QJ 2ID3A 1I6HJ 3WHCA 2DA2A 4AC0A 4BKXA 5EG0B 3SFIA 1W0TA 5IYDJ 5M5WJ 3QQAA 3TW6A 5C3EJ 3G1OA 1JTYA 1JT6A 1OCTC 4FE7A 2CUFA 3HOWJ 2YU9J 2WB1N 2XB0X 2CRGA 3S1RJ 3JRIA 3WHBA 2I10A 3OOUA 4FISA 3LNQA 1U9OA 1X2MA 1FJLA 5IOYA 1B72A 3FK6A 5EG0A 2DA4A 2NOGA 1FEXA 2L9RA 1QVTA 3JRGA 2IBDA 3LSJA 2HQ5A 1JKOC 1BA5A 1F43A 4M3BA 4DYCA 4AUXA 4B1RA 5F0HA 5GPAA 4UUSB 3G1MA 4I6ZA 1BJZA 1X2NA 2LR8A 2CQQA 5C4JJ 1ETVA 3K2AA 4JX5A 4MFEA 1OCPA 3JREA 2HDDA 1LFUP 3FISA 3S2DJ 3IH3A 2VPRA 3L1PA 3S16J 3O8HA 4C3HJ 4M3DA 1LE8B 1JT0A 3B6CA 4D5CA 2MGQA 3BTJA 2FJ1A 2L7FP 4FE4A 3RKQA 1ETWA 1ZK8A 2ME0A 3GTKJ 2R93J 3GBGA 1JUPA 1FIAA 4JP0A 1GT0C 3S1NJ 1Z0XA 5F08A 3BQYA 1TWAJ 1TWCJ 1ETXA 1QPIA 3ZOBA 2Y9YA 4B4CA 2R5ZB 4UUTA 5FJ8J 2M0CA 2HOAA 1RKWA 5FKKA 2H8RA 4FTHA 3BR5A 1ETYA 1RKTA 3RZOJ 1WCMJ 3BR2A 4BY7J 2X6OA 4IEJA 2CJJA 5IP9J 3H3VK 1T56A 2XGDA 4W97A 2GLOA 1JTXA 2NVQJ 1VNDA 1WPKA 1TWHJ 2FQ4A 2M34A 3FIWA 5JLWA 4S0HB 3MN2A 2R5ZA 5M3FJ 3C2BA 3GTOJ 2DMQA 1LFBA 3S17J 1H89C 1IV6A 1HLVA 2K9QA 2DA3A 3BTIA 3LOCA 2JJ7A 4BBRJ 1WI3A 2XSDC 1DU0A 2Y9ZA 3HOYJ 5F0CA 1BW5A 2M8GX 2EZIA 1D5YA 2NVYJ 1QRYA 1ZR4A 1A5JA 2DA6A 2XB5A 2VUMJ 3HOUJ 2E1OA 2EZLA 3VPRA 3JRFA 1FIPA 2DMUA 3NAUA 9ANTA 5BNGA 5IPAA 4AYBN 2P81A 1OJLA 4M3FA 5EDNA 1EF4A 4BXXJ 4IHWA 1GVDA 3BG5A 5FKMA 2CU7A 1B72B 4XICA 3S1QJ 3ZQLA 1XG1A 1AKHA 3JRBA 5J3LA 3HGGA 4MFDA 4D5FA 4DYRA 5E3LA 1ZR2A 3Q0VA 3S2HJ 4C3JJ 1FTZA 4MLOA 1ITYA 2WV1A 2OF7A 3CDLA 5K7HA 2MSYA 5EZHA 3GTLJ 1BL0A 3M4OJ 2HI3A 3IH2A 5IP7J 5IOZA 2RAEA 2YUSA 2L7MP 3B6AA 4V2GA 4XIDA 2GBYA 1ETKA 2R5YA 3CQZJ 2TCTA 1SANA 5FKOA 3BQZA 1NK3P 4MIMA 5J1UA 1JJ8C 1ORKA 1HOMA 3M3YJ 3Q0UA 2CUEA 2NS8A 3BG9A 2G0EA 2M2EA 1SFOJ 5M3MJ 3K7AJ 1HDDC 2ELKA 1NK2P 5IP6A 5EYRA 2COBA 4QIWN 1ENHA 1UG2A 3OIOA 4XRMA 2VI6A 4A93J 4Y52J 3OSFA 3GTQJ 1ZTRA 2XPUA 1XS9A 2E19A 5FLMJ 1H8AC 3DEWA 2E2HJ 5M5XJ 4IHXA 4J19A 3QPLA 1G2HA 5E3MA 2KDZA 1ETQA 1HF0A 4L5EA 3HOXJ 4MO7A 3G1LA 3JR9A 2R7ZJ 1JJ6C 1O4XA 1IUFA 2K9SA 2FD5A 4LOCA 2WAQN 3PO3J 4FCYA 2E2IJ 1FTTA 1UHSA 1WH5A 1IGNA 1I50J 5K7ZA 2NVTJ 1U8BA 2ECCA 4IHYA 2N8GA 2VKEA 2LKXA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2AO9 A;  1F36 A;  5K7F A;  5DS9 A;  2JMW A;  1MSF C;  2EQR A;  1MBH A;  1JKP C;  3HDD A;  2DA7 A;  3H0G J;  5HOD A;  4XRS A;  4A3C J;  3D1N I;  4X6A J;  2NS7 A;  1UMQ A;  3MKL A;  4A3M J;  1JUS A;  2LTP A;  3BR1 A;  1Q1V A;  5GP9 A;  1A6I A;  3I4N J;  2EZH A;  5C44 J;  1X58 A;  2DTZ A;  3RQI A;  5E3N A;  1VI0 A;  2E2J J;  4BBS J;  3HOV J;  1IDY A;  4CYC A;  1Y1W J;  2XGC A;  1T33 A;  3A01 B;  1W0U A;  2NVX J;  4GFB A;  1IRZ A;  3LSR A;  3QPS A;  2HYJ A;  4G12 A;  1RET A;  5IYC J;  4HNV A;  2EH3 A;  1K83 J;  5EEA A;  3IV5 A;  5JLX A;  1ETO A;  2CQX A;  1AKH B;  1NTC A;  1VFC A;  1IDZ A;  3RZD J;  3ZQG A;  5EGO A;  2LP0 A;  5GPC A;  3LSP A;  2XRL A;  3BR3 A;  2O8K A;  4EEF G;  4RDU A;  3A01 A;  2DA5 A;  1HCR A;  4A3B J;  4D7M A;  2ECB A;  3CCY A;  1RES A;  2DJN A;  2TRT A;  3JRC A;  2M9H A;  4JX4 A;  3F0C A;  4QTR A;  1RPW A;  2R5Y B;  4A3J J;  2JA8 J;  5F27 A;  1P7J A;  2JWT A;  3FKI J;  4QSH A;  1S7E A;  3BT9 A;  2KT0 A;  1APL C;  1TC3 C;  2ID6 A;  2JK3 A;  3BG3 A;  4A3G J;  5F0F A;  2DA1 A;  3A02 A;  1ZGW A;  4D7N A;  3HB9 A;  5FKN A;  2W48 A;  3NAR A;  1MH4 A;  2QF7 A;  2DMN A;  2Y31 A;  5EF6 A;  1ZKG A;  5E3O A;  2IAI A;  5DTD A;  3IH4 A;  2L7Z A;  3HKZ N;  4V2F A;  2XPW A;  3DCF A;  3GTJ J;  2HXO A;  2D5V A;  2LY9 A;  3SDG A;  2JA5 J;  1P7I A;  1RR7 A;  1JKR C;  1JGG A;  1POG A;  3HGY A;  3BR6 A;  1MBG A;  3A03 A;  2LD5 A;  4M3E A;  2LK2 A;  3UKG A;  2X48 A;  3CMY A;  3PO2 J;  3ZQI A;  2QCO A;  4DYQ A;  1MNM C;  4JX6 A;  4DZP A;  3TP3 A;  2LVS A;  5EZG A;  3LSG A;  3JRH A;  1WH7 A;  1GUU A;  2LFB A;  5FLV A;  3E7L A;  1GV5 A;  1MBE A;  4NDL A;  4XK4 A;  4BY1 J;  1Y1V J;  2AHQ A;  2O7O A;  4A3D J;  2LLK A;  1GV2 A;  2XGE A;  3GTM J;  3HOZ J;  1VF9 A;  2Y2Z A;  3TED A;  3Q3S A;  1PUF B;  4RBO A;  3S1M J;  1AU7 A;  1WGX A;  5J1R A;  3GTP J;  3FK7 A;  1TWF J;  2GM4 A;  2VKV A;  1MH3 A;  2EBI A;  4A3K J;  4DZJ A;  1MBF A;  1AHD P;  1JUM A;  2ME6 A;  2MW8 A;  1TWG J;  4CYC B;  2DN0 A;  4C3I J;  4UUS A;  1IC8 A;  2MG4 A;  2L0K A;  4A3F J;  3SJM A;  4DW6 A;  2O9L A;  3GTG J;  4A3E J;  3W6V A;  5J1Y A;  1PUF A;  2HXI A;  2EZK A;  3BTC A;  2R0Q C;  3ZQF A;  1R9T J;  2IEK A;  1MSE C;  2R92 J;  1B8I B;  5EGO B;  3HEF A;  3S15 J;  5C4X J;  1H88 C;  2XPV A;  1MBJ A;  4I76 A;  4A3I J;  2JN6 A;  1LE8 A;  1XC5 A;  2Y0S N;  1ZQ3 P;  1OFC X;  2DMT A;  1YRN B;  4C2M J;  5F04 A;  4A69 C;  3O8G A;  3JRD A;  1GDT A;  2X9D A;  4B3A A;  1E3O C;  1HDP A;  1B8I A;  3PM1 A;  2ZB9 A;  3JRA A;  4X1E A;  1K61 A;  5IYB J;  2Y30 A;  3ZQC A;  1DU6 A;  1U9N A;  4A3L J;  2K40 A;  4W1U A;  3MVP A;  2OPT A;  3BTL A;  4JYK A;  1CQT A;  3ZQH A;  1QVU A;  5M5Y J;  3I4M J;  2FX0 A;  4M6V A;  1YRN A;  3OSG A;  3TP0 A;  2H1K A;  1IG7 A;  1Z77 A;  2DMP A;  2B63 J;  2HOS A;  2JA6 J;  4Y7N J;  3S14 J;  2JA7 J;  5F1J A;  3HBL A;  5FKL A;  4XRS G;  2K9N A;  1BW6 A;  3HM5 A;  1JKQ C;  1IJW C;  3BR0 A;  1MBK A;  3TW7 A;  2YS9 A;  2HOT A;  4M3G A;  1U78 A;  2PMZ N;  4ABZ A;  3Q0W A;  4IHV A;  1I3Q J;  2ID3 A;  1I6H J;  3WHC A;  2DA2 A;  4AC0 A;  4BKX A;  5EG0 B;  3SFI A;  1W0T A;  5IYD J;  5M5W J;  3QQA A;  3TW6 A;  5C3E J;  3G1O A;  1JTY A;  1JT6 A;  1OCT C;  4FE7 A;  2CUF A;  3HOW J;  2YU9 J;  2WB1 N;  2XB0 X;  2CRG A;  3S1R J;  3JRI A;  3WHB A;  2I10 A;  3OOU A;  4FIS A;  3LNQ A;  1U9O A;  1X2M A;  1FJL A;  5IOY A;  1B72 A;  3FK6 A;  5EG0 A;  2DA4 A;  2NOG A;  1FEX A;  2L9R A;  1QVT A;  3JRG A;  2IBD A;  3LSJ A;  2HQ5 A;  1JKO C;  1BA5 A;  1F43 A;  4M3B A;  4DYC A;  4AUX A;  4B1R A;  5F0H A;  5GPA A;  4UUS B;  3G1M A;  4I6Z A;  1BJZ A;  1X2N A;  2LR8 A;  2CQQ A;  5C4J J;  1ETV A;  3K2A A;  4JX5 A;  4MFE A;  1OCP A;  3JRE A;  2HDD A;  1LFU P;  3FIS A;  3S2D J;  3IH3 A;  2VPR A;  3L1P A;  3S16 J;  3O8H A;  4C3H J;  4M3D A;  1LE8 B;  1JT0 A;  3B6C A;  4D5C A;  2MGQ A;  3BTJ A;  2FJ1 A;  2L7F P;  4FE4 A;  3RKQ A;  1ETW A;  1ZK8 A;  2ME0 A;  3GTK J;  2R93 J;  3GBG A;  1JUP A;  1FIA A;  4JP0 A;  1GT0 C;  3S1N J;  1Z0X A;  5F08 A;  3BQY A;  1TWA J;  1TWC J;  1ETX A;  1QPI A;  3ZOB A;  2Y9Y A;  4B4C A;  2R5Z B;  4UUT A;  5FJ8 J;  2M0C A;  2HOA A;  1RKW A;  5FKK A;  2H8R A;  4FTH A;  3BR5 A;  1ETY A;  1RKT A;  3RZO J;  1WCM J;  3BR2 A;  4BY7 J;  2X6O A;  4IEJ A;  2CJJ A;  5IP9 J;  3H3V K;  1T56 A;  2XGD A;  4W97 A;  2GLO A;  1JTX A;  2NVQ J;  1VND A;  1WPK A;  1TWH J;  2FQ4 A;  2M34 A;  3FIW A;  5JLW A;  4S0H B;  3MN2 A;  2R5Z A;  5M3F J;  3C2B A;  3GTO J;  2DMQ A;  1LFB A;  3S17 J;  1H89 C;  1IV6 A;  1HLV A;  2K9Q A;  2DA3 A;  3BTI A;  3LOC A;  2JJ7 A;  4BBR J;  1WI3 A;  2XSD C;  1DU0 A;  2Y9Z A;  3HOY J;  5F0C A;  1BW5 A;  2M8G X;  2EZI A;  1D5Y A;  2NVY J;  1QRY A;  1ZR4 A;  1A5J A;  2DA6 A;  2XB5 A;  2VUM J;  3HOU J;  2E1O A;  2EZL A;  3VPR A;  3JRF A;  1FIP A;  2DMU A;  3NAU A;  9ANT A;  5BNG A;  5IPA A;  4AYB N;  2P81 A;  1OJL A;  4M3F A;  5EDN A;  1EF4 A;  4BXX J;  4IHW A;  1GVD A;  3BG5 A;  5FKM A;  2CU7 A;  1B72 B;  4XIC A;  3S1Q J;  3ZQL A;  1XG1 A;  1AKH A;  3JRB A;  5J3L A;  3HGG A;  4MFD A;  4D5F A;  4DYR A;  5E3L A;  1ZR2 A;  3Q0V A;  3S2H J;  4C3J J;  1FTZ A;  4MLO A;  1ITY A;  2WV1 A;  2OF7 A;  3CDL A;  5K7H A;  2MSY A;  5EZH A;  3GTL J;  1BL0 A;  3M4O J;  2HI3 A;  3IH2 A;  5IP7 J;  5IOZ A;  2RAE A;  2YUS A;  2L7M P;  3B6A A;  4V2G A;  4XID A;  2GBY A;  1ETK A;  2R5Y A;  3CQZ J;  2TCT A;  1SAN A;  5FKO A;  3BQZ A;  1NK3 P;  4MIM A;  5J1U A;  1JJ8 C;  1ORK A;  1HOM A;  3M3Y J;  3Q0U A;  2CUE A;  2NS8 A;  3BG9 A;  2G0E A;  2M2E A;  1SFO J;  5M3M J;  3K7A J;  1HDD C;  2ELK A;  1NK2 P;  5IP6 A;  5EYR A;  2COB A;  4QIW N;  1ENH A;  1UG2 A;  3OIO A;  4XRM A;  2VI6 A;  4A93 J;  4Y52 J;  3OSF A;  3GTQ J;  1ZTR A;  2XPU A;  1XS9 A;  2E19 A;  5FLM J;  1H8A C;  3DEW A;  2E2H J;  5M5X J;  4IHX A;  4J19 A;  3QPL A;  1G2H A;  5E3M A;  2KDZ A;  1ETQ A;  1HF0 A;  4L5E A;  3HOX J;  4MO7 A;  3G1L A;  3JR9 A;  2R7Z J;  1JJ6 C;  1O4X A;  1IUF A;  2K9S A;  2FD5 A;  4LOC A;  2WAQ N;  3PO3 J;  4FCY A;  2E2I J;  1FTT A;  1UHS A;  1WH5 A;  1IGN A;  1I50 J;  5K7Z A;  2NVT J;  1U8B A;  2ECC A;  4IHY A;  2N8G A;  2VKE A;  2LKX A; 
#chains in the Genus database with same CATH topology
 3W2W A;  1Z6T A;  4CSW A;  2RDP A;  2E7X A;  4LK0 F;  3HSF A;  3MWM A;  3DU6 A;  2EQR A;  1LDD A;  4ENK A;  1JKP C;  1G4D A;  1AOY A;  1KYZ A;  4H0E A;  4EJV A;  4E7I A;  4GO1 A;  3D1N I;  2NS7 A;  3BJA A;  4B44 A;  1ON2 A;  3MKL A;  3CCS I;  1JUS A;  3BR1 A;  5GP9 A;  1LEA A;  3I3L A;  5C44 J;  4FX0 A;  3KPH A;  3RQI A;  5E3N A;  1ZG1 A;  3R0J A;  4BGD A;  3L2V A;  1ZN2 A;  2HS5 A;  3KZZ A;  4XM3 A;  3BJ6 A;  1IDY A;  1T33 A;  3A01 B;  4GFB A;  1IRZ A;  2K4B A;  5E8I A;  3F8C A;  1SFK A;  4BAY A;  1O7L A;  5EEG A;  2L2O A;  1WFX A;  1AKH B;  2NRA C;  1NTC A;  2X1C A;  3GZN B;  2BZT A;  1S3J A;  2ETH A;  2IRF G;  3VSK A;  2K02 A;  4RB3 C;  3OYH A;  5GPC A;  4IF4 A;  2PFB A;  3F6O A;  3IWF A;  5ILS A;  5HNH A;  1HCR A;  2DA5 A;  3JTG A;  3V7C A;  1JHF A;  5J6X A;  4BE1 A;  5D6E A;  3CCY A;  4J01 A;  1S5L C;  1R1T A;  2DQR A;  3K2Z A;  2L5Q A;  4LD5 A;  4QTR A;  2IGM A;  1YS7 A;  2XUB A;  5F27 A;  3HHH A;  1T8I A;  2QVO A;  2VC0 A;  3OYI A;  3H1C A;  1S7E A;  4EVI A;  3EUA A;  3KP7 A;  3PIP F;  1TC3 C;  4A3G J;  2LNB A;  3I9V 2;  3JSO A;  4ESB A;  3A02 A;  3KP4 A;  3M07 A;  1K78 A;  1FSH A;  1BI2 A;  3CZ6 A;  4O6J A;  3ZMS A;  1QNT A;  1MH4 A;  4N9H A;  4NQW B;  3HTS B;  2DMN A;  2JUC A;  1QO0 D;  2B9S A;  2Y31 A;  2XAS A;  2D1H A;  2RRE A;  4UV8 A;  3IH4 A;  2IP2 A;  4UV9 A;  2HXO A;  2LY9 A;  4ZJZ A;  3SDG A;  2JA5 J;  1I1S A;  1P6R A;  3VOD A;  1DP7 P;  1KU7 A;  2F4O B;  4U0W A;  4M3E A;  1T98 A;  3ZQ7 A;  3CJR B;  4P5O A;  2H6C A;  4E6K G;  2MA3 A;  3PO2 J;  2F2E A;  2PI0 A;  2F5E A;  2W00 A;  2F6C A;  1F9N A;  3ABM H;  1ZG5 A;  4DYQ A;  2FSW A;  5ICF A;  1QZE A;  3PNY A;  4R79 A;  1X1C A;  5L3C A;  2Z16 A;  1WH7 A;  4E7L A;  3BDD A;  1B4A A;  4K2E A;  1U5T A;  3KLN A;  4P55 A;  4XK4 A;  4KN4 X;  3KFW X;  2QUF A;  1Y1V J;  1YW7 A;  2O7O A;  1YIJ I;  4KMU X;  3GTM J;  4E4H A;  3KP6 A;  2HPM A;  4EM2 A;  2IVM A;  3S1M J;  1UEL B;  3KEO A;  1MMN A;  4LG3 A;  2O6G E;  2L9S A;  2VKH A;  1MH3 A;  1DUX C;  1H0M A;  4GXO A;  1JE8 A;  1B1B A;  5E1X A;  2L3D A;  3CC2 I;  2BY0 A;  2F4M B;  4LB5 A;  2RQQ A;  4C3I J;  4UUS A;  1HW1 A;  3WTS C;  4A3F J;  1G3S A;  3LFU A;  5BQT A;  4HV5 A;  3VWB A;  1FP1 D;  3ABT A;  4BXF A;  2Y0S A;  4TV7 A;  1PUF A;  4HZF A;  4BEH B;  2NVU B;  1R7J A;  2V9V A;  1EJ9 A;  3S93 A;  2HXI A;  1ERD A;  1Z05 A;  1G8X A;  5HDK A;  2VL8 A;  1DQU A;  3JW4 A;  4HDV A;  5AIQ A;  2XPV A;  4EJO A;  3AG2 H;  3BZK A;  1XPX A;  3LAP A;  3BOQ A;  2CGP A;  3KEQ A;  2VE9 A;  3WTZ A;  2HKX A;  4DBR A;  1LE8 A;  1LFP A;  2EV5 A;  2LYC A;  1FBS A;  5GAE J;  4YFN F;  1D0Y A;  3CO7 C;  4EV0 A;  3FDY A;  3L2R A;  3QYF A;  2A61 A;  3O8G A;  4BQO A;  2UXX A;  1IXR C;  2OTJ I;  2KIM A;  4GGG A;  2E5N A;  4G6D A;  1K61 A;  2L7K A;  4B09 A;  2DPD A;  2NNY A;  4OIO F;  3ZQC A;  4XOR A;  3ZN0 A;  2K40 A;  2OPT A;  1JHH A;  5IT3 A;  4KDP A;  1CQT A;  4A0X A;  3ZQH A;  1ZH5 A;  3CCE I;  1QVU A;  2K7L A;  3P7N A;  4PK4 A;  3CDI A;  3V8J A;  1V5E A;  2VQC A;  2XIG A;  5DEQ A;  4M6V A;  1YRN A;  1IG7 A;  2DMP A;  3RI4 A;  1TQI A;  2D1V A;  3S14 J;  3E6D A;  2LKP A;  2HFH A;  4UXN A;  3D0S A;  5F1J A;  4XKB A;  3HBL A;  4U7B A;  1BM9 A;  3ZMU A;  3SYT A;  4XKC A;  3OYM A;  5JVG F;  2LOO A;  2WB1 A;  2OCE A;  3IWZ A;  3F22 A;  4BQA A;  3Q0W A;  1XN7 A;  4IHV A;  1I3Q J;  2QZ8 A;  1V3F A;  1IUY A;  5HS9 A;  4N4O B;  1IN5 A;  1P4A A;  2DA2 A;  3G2B A;  3R4K A;  5ILU A;  4EAT A;  4ITV A;  1WHU A;  5HLI A;  3SEQ A;  3EET A;  4AC0 A;  5LHH A;  1BI0 A;  5C3E J;  1OCT C;  1JTY A;  2JPC A;  2CUZ A;  3HOW J;  4CCJ A;  4I7H A;  1K4T A;  3DEE A;  4C2U A;  3S1R J;  2P5V A;  1W36 C;  3OOU A;  4FIS A;  2OUM A;  3OYB A;  1X2M A;  3AL0 B;  2M7B A;  3GYH X;  5EG0 A;  3QYE A;  1FEX A;  2NAZ A;  3D5L A;  3I0T A;  4DNC A;  2E36 A;  2IBD A;  3LSJ A;  5TIS C;  3K9T A;  1T95 A;  4N4N B;  3L2Q A;  1SEU A;  3H36 A;  3NRV A;  3ELK A;  2DTR A;  3TDU C;  3HJE A;  5GPA A;  3CD6 I;  3F6V A;  4ZDO A;  3IAM 2;  2XHK A;  4XN0 A;  1Z67 A;  3PL8 A;  2A69 F;  3WTX C;  3GO5 A;  2CQQ A;  5C4J J;  1FC3 A;  3K2A A;  4JX5 A;  3W6J B;  3K69 A;  2W84 A;  3F9K A;  5TJJ A;  3LA3 A;  2KZG A;  2BW3 A;  3ZMT A;  1L3L A;  4IL6 C;  1BIB A;  2IA1 A;  2HQR A;  3IH3 A;  4MTD A;  1XMA A;  3CDH A;  3HUG B;  3O8H A;  3V42 A;  1WZ2 A;  3IUO A;  4M3D A;  3ZMV A;  1C0W A;  1KU2 A;  3T8R A;  3EDP A;  3NQO A;  2L7F P;  2ESN A;  4FE4 A;  2ZXH A;  3T0Y A;  3OYE A;  1TLH B;  2RNG A;  3LSM A;  2M1B A;  3QP6 A;  1SVM A;  1B9M A;  2CMP A;  2PX9 A;  3GTK J;  2R93 J;  3K0L A;  5HDG A;  1FIA A;  5HS7 A;  2Z3Y A;  2X51 A;  4G94 A;  2ZSH B;  4I98 B;  2R5Z B;  1OCO H;  2DYS H;  3F21 A;  3KET A;  5L3G A;  5ILV A;  3I5U A;  3BR5 A;  1LDK B;  1XMK A;  3BR2 A;  4BY7 J;  2Y0M A;  2IXS A;  2CJJ A;  1X1D A;  4YII A;  2DCE A;  2V1N A;  3KE2 A;  3AL0 C;  3K70 C;  3H3V K;  1T56 A;  4XSX F;  4EGZ A;  4I0A A;  1WJF A;  3I64 A;  1VND A;  2JVH A;  2M34 A;  1IV8 A;  4IOA F;  3PQK A;  4RA2 A;  3GTO J;  2QQB A;  1LFB A;  2HYG D;  3ESW B;  3C18 A;  4Z2Y A;  4N9I A;  4Y17 A;  2K9Q A;  2O5R A;  3BTI A;  4KIF A;  3QAH A;  5HNF A;  4HX7 A;  1QBJ A;  3WE2 A;  2KP6 A;  3BZ6 A;  2XSD C;  1OLT A;  2IGO A;  1BW5 A;  2EZI A;  1V5F A;  1ON1 A;  2FXA A;  3ASO H;  3E3V A;  2W25 A;  5JFR A;  3OYJ A;  3M8E A;  1ZR4 A;  5AIP A;  3K4B A;  2H1L A;  3DPL C;  2XB5 A;  2R4G A;  2VUM J;  1NG6 A;  2PEX A;  5D8L B;  1T08 B;  1R00 A;  2E1O A;  3VPR A;  3O2P E;  3JRF A;  4M6Y A;  5LGU A;  1QZY A;  4U7D A;  1P9Q C;  2A5W A;  3R61 A;  4PJJ A;  3KYD B;  1TZL A;  4M3F A;  4X0G A;  2XV4 S;  1GVD A;  4XIC A;  2JRT A;  1LJ9 A;  3ZQL A;  3RPQ A;  4PGH A;  5J3L A;  3HZJ A;  2LF7 A;  4ON0 A;  4C3J J;  2ISY A;  1J59 A;  1FTZ A;  2DJI A;  5H2F C;  4NC7 A;  3RSN A;  1VZ0 A;  2L9N A;  3CDL A;  2KKO A;  3BG7 A;  3DBH B;  4KUM A;  1D0Z A;  1A36 A;  5K7H A;  2MSY A;  3F23 A;  1VQM I;  1ZGA A;  3IH2 A;  2KRC A;  2EWN A;  2M3A A;  2RAE A;  3QU6 A;  1OIS A;  3HHG A;  4EM0 B;  4PJN A;  3OIP A;  2FMY A;  2GBY A;  4PUS A;  2JVG A;  2R5Y A;  2JZY A;  3QYB A;  2FUG 2;  2TCT A;  2OJE D;  5E1Z B;  2XAF A;  5DUI A;  4LB6 B;  2ZC2 A;  2OC6 A;  1UJ8 A;  3F8B A;  5FKO A;  1J2X A;  2EA4 A;  2QGU A;  2QBY A;  1TBX A;  1NK3 P;  5FLX Z;  5CLS A;  5J1U A;  5KCM A;  4F52 A;  2A3S A;  3OS1 A;  3FM5 A;  1YS6 A;  3M3Y J;  1XCB A;  1X3W B;  1YLF A;  3OY9 A;  2NS8 A;  2G0E A;  1HW5 A;  2M2E A;  4HLX A;  3CME I;  4JQF A;  4ZTJ A;  4A5M A;  5IP6 A;  2QEN A;  3KLO A;  2COB A;  1PJR A;  1FZP B;  4A93 J;  2BBY A;  4XON A;  3OSF A;  3WTY C;  1FMV A;  4I0B A;  1MMG A;  2JTV A;  2XPU A;  2HQA A;  1XS9 A;  4Q5S F;  5FLM J;  2E2H J;  1KA8 A;  4IHX A;  1UB9 A;  2BY2 A;  1V54 H;  1Q1H A;  3Q5F A;  3JR9 A;  1RC9 A;  1JJ6 C;  3L09 A;  4LOC A;  3ABK H;  1V55 H;  1W5C C;  2VBY A;  2UUZ A;  2WAQ N;  3U2R A;  2OAZ A;  3PO3 J;  5IT9 K;  1WH5 A;  1WJA A;  2M8E A;  4PFP A;  4IRH A;  1FLI A;  4XLA A;  1CGP A;  1MD0 A;  3TOA A;  3CUQ A;  5LRS A;  3HL2 A;  2VKE A;  2OCC H;  2LKX A;  5KHD A;  1IXS B;  2AO9 A;  2FEZ A;  3HSR A;  4Z6Y A;  5K7F A;  2F4I A;  3BC8 A;  2JMW A;  4QLC U;  3I59 A;  3S32 A;  3HDD A;  1MBH A;  1XGM A;  2DA7 A;  5HOD A;  4X6A J;  3QPT A;  1YW8 A;  2HZD A;  2R7W A;  2OD5 A;  1UMQ A;  3CLQ A;  1I27 A;  3VYS B;  1Q1V A;  1OYW A;  1A6I A;  2EZH A;  1SAU A;  1LUJ B;  1XMX A;  2OQR A;  2RKH A;  1JI8 A;  1VI0 A;  1MZB A;  2E2J J;  4BBS J;  3HOV J;  1R1U A;  2E71 A;  3DV8 A;  3H5A A;  4GYG A;  4YRV A;  1Y1W J;  1W0U A;  2NVX J;  3ZGK A;  2R7R A;  2BY3 A;  1T0F A;  2V4J C;  4HNV A;  2EH3 A;  3WU2 C;  4XKW A;  5EEA A;  3IV5 A;  4F7Z A;  2LDU A;  5JLX A;  1Y8R B;  3CCM I;  4IPA A;  4IKF A;  1VFC A;  5HOO A;  1MJ9 A;  1UST A;  3IRR A;  4D0P A;  3RZD J;  2LP0 A;  1SVL A;  2XRL A;  3BWG A;  4ZYA A;  5DCM A;  2OZU A;  2MBF A;  5EEH A;  2K27 A;  2QKM B;  5FRO A;  3V8L A;  4IVN A;  3HYI A;  4A3B J;  2DT6 A;  1N78 A;  2X0L A;  3J81 K;  4BH9 A;  1MNE A;  3FWE A;  2NYX A;  1Y6I A;  2CH0 A;  6PAX A;  2IS1 A;  3ZMZ A;  3F0C A;  5FFZ A;  2ZFU A;  1W7P A;  2M4G A;  5K5R A;  3SQN A;  3TL4 X;  2CFX A;  4UY8 I;  1PP8 F;  1XGS A;  1WVR A;  2F5F A;  2KT0 A;  2UWM A;  2JK3 A;  3BG3 A;  1PYV A;  1R5I D;  3VDX A;  1U8R A;  5F0F A;  1J7K A;  2DA1 A;  4XLP F;  2HU9 A;  3L2W A;  3HB9 A;  5FKN A;  2DOF A;  1UCR A;  5J47 A;  3CCQ I;  2B7E A;  3L00 A;  1HC8 A;  3GF2 A;  4KIB A;  2BEO A;  2ELH A;  1ZKG A;  5EF6 A;  2DOD A;  3OYA A;  2FU4 A;  2IAI A;  5DTD A;  2RQP A;  5FLX K;  1OKR A;  4RB2 C;  4V2F A;  1W7P D;  1ZEL A;  5KVR A;  2D5V A;  1OMI A;  2EIJ H;  4HBL A;  5L3D A;  3RPU A;  2M4K A;  3BR6 A;  4ZYD A;  1MBG A;  2YSR A;  4CCK A;  4L18 B;  1R5G A;  2VPL A;  1SAX A;  3UKG A;  3K4M A;  4P1W A;  4CUG A;  2X48 A;  3VFZ A;  3CMY A;  2KZV A;  1ACI A;  1MNM C;  2KRF A;  1LEB A;  4JX6 A;  3TP3 A;  3WE3 A;  2LBF B;  4LMY A;  1P4W A;  2HVQ A;  2Q2E A;  1IO2 A;  3L7W A;  2P0W A;  3LSG A;  4RGR A;  2VT3 A;  1TQP A;  5FLV A;  3E7L A;  1G3T A;  1GV5 A;  3RIR A;  1ZRE A;  4BY1 J;  1BIA A;  4A3D J;  4MHG A;  1GV2 A;  1TQM A;  2XGE A;  2ZO4 A;  2IPQ X;  4HDU A;  5HDN A;  3DTK A;  3TED A;  3A2K A;  1PUF B;  4RBO A;  3MCZ A;  3K4L A;  4AWX B;  1I6X A;  3GTP J;  1B9N A;  1KQ9 A;  4ENM A;  3P9I A;  3ULQ B;  3K4J A;  4HRI A;  1AHD P;  1JUM A;  2ME6 A;  1WJC A;  2MW8 A;  3ML6 A;  4CYC B;  4RB0 A;  4YFK F;  1T39 A;  3C7J A;  3OL3 A;  2FA5 A;  4WXD A;  2K3F A;  4B3X A;  4DW6 A;  1BC7 C;  2EK5 A;  4HQE A;  4PDK A;  4D9J A;  4ZTF A;  2WAE A;  2R0Q C;  3SZT A;  1FOX A;  3KYL A;  1MSE C;  2R92 J;  5FFX A;  5EGO B;  2MD0 A;  1WJ5 A;  4Y15 A;  4KN7 X;  3LA7 A;  3BCB A;  1D1C A;  4RMN A;  3TQN A;  1FOW A;  1XC5 A;  5LD2 C;  2Y0S N;  2P7V B;  2DMT A;  1YRN B;  4A69 C;  2DBB A;  2AXL A;  3WTV C;  4B3A A;  4G7O F;  1HDP A;  4BXU A;  1B8I A;  2ZB9 A;  1QA6 A;  3JRA A;  1R1V A;  3P5J A;  3TO9 A;  1DU6 A;  2HZT A;  1W5S A;  4W1U A;  3PJR A;  3MD2 A;  2EIN H;  2HGC A;  1IF1 A;  2MAB A;  1A31 A;  4M6X A;  4OWR B;  3ZPL A;  3IRQ A;  2H1K A;  2A5Y B;  3HRM A;  2KMU A;  2HOS A;  2A6E F;  2LC2 A;  2P5K A;  4DJA A;  1OYI A;  2FML A;  4CXF A;  3FKJ A;  4XRS G;  3HOS A;  4HG2 A;  3V7R A;  2LRE A;  1JKQ C;  3WG7 H;  2GWR A;  2MC4 A;  1Z1D A;  1MBK A;  3TW7 A;  2HOT A;  4OAY A;  3G4S I;  1Y39 A;  4XRF A;  1I6H J;  1YQA A;  2BVL A;  4JOM A;  1UHM A;  4XLC A;  3G73 A;  2VOP A;  2V1X A;  2IS6 A;  4BKX A;  5EG0 B;  2E7W A;  2PJR B;  5M5W J;  1YIO A;  1JT6 A;  4FE7 A;  3PIO F;  1NG7 A;  5ICG A;  2YU9 J;  1LB2 A;  1E3P A;  2CFO A;  1GHC A;  2ZXJ A;  2I8D A;  2WB1 N;  4U0Y A;  5D5U B;  2GOX B;  3WHB A;  3DXJ F;  3AG4 H;  5JVT A;  4WCG A;  2I10 A;  4I2O A;  1FYL A;  1FJL A;  5IOY A;  1B72 A;  3GLX A;  1TNS A;  1F5T A;  2CUJ A;  1HST A;  3GVA A;  1YE9 A;  3HOT A;  3GFI A;  1MIJ A;  1TP4 A;  2ELJ A;  4GRI A;  2H8W A;  2R7T A;  4XBF A;  1QVT A;  4RGS A;  4LK1 F;  3JRG A;  3U9G A;  3PFI A;  3V8K A;  3LA2 A;  2BW3 B;  4BQN A;  3IKT A;  2XF7 A;  5A2Q K;  2PG4 A;  2V79 A;  1V5G A;  4M3B A;  5HLT A;  4M71 A;  2EFO A;  3DF8 A;  5F0H A;  1I39 A;  1FBU A;  1A04 A;  3RQ4 A;  3H9J A;  2Q8K A;  4RB1 A;  4I6Z A;  3U1K A;  1KGS A;  5JI6 A;  3CP2 A;  1E17 A;  2G9W A;  2HEO A;  2RV8 A;  1S6L A;  4CIC A;  3GFM A;  1ETV A;  5J40 A;  3H35 A;  2HVR A;  2NS0 A;  3JRE A;  2AQF A;  4RM3 A;  2ACJ A;  1YW9 A;  1LFU P;  2HDD A;  4WXH A;  3QOP A;  1J09 A;  3IHU A;  5LHI A;  3HPH A;  2WWY A;  2F48 A;  3L1P A;  2VBW A;  1YOV B;  2KL4 A;  2R7S A;  1T2K A;  1JT0 A;  4A12 A;  3K1P A;  3QRF F;  4D5C A;  3HRT A;  1EH6 A;  3GFJ A;  3DKW A;  3IP4 B;  2R7O A;  1ETW A;  3CJT B;  2EJR A;  1LDJ A;  4KFC A;  5KNL A;  3OV8 A;  2WY7 Q;  2XKP A;  3S1N J;  1TWA J;  4B4C A;  2EB7 A;  1RRJ A;  1GVJ A;  4R1H A;  5FJ8 J;  1YX3 A;  3M9A A;  4ANJ A;  4P96 A;  3CCL I;  5BPI A;  2CV2 A;  1ETY A;  1RKT A;  3DKY A;  1Y0N A;  3SXY A;  3RZO J;  2X6O A;  4IEJ A;  3MKY B;  1BOB A;  3GEZ A;  1R4M B;  4C2T A;  4M9S A;  2CWE A;  1TW3 A;  2G7U A;  3J7A Y;  5K5O A;  1J5Y A;  3MZY A;  4W97 A;  4GCV A;  1JTX A;  2NVQ J;  1TWH J;  1BJA A;  4S0H B;  1ZGJ A;  1BBY A;  4KA4 A;  3JTH A;  2R7V A;  4Y13 A;  1R4N B;  1H89 C;  2DA3 A;  3C2G A;  4RGX A;  4AYB A;  3LAJ A;  1O3T A;  1WI3 A;  3PQJ A;  3WOD F;  2R7X A;  4A0Y A;  3HOY J;  1MMA A;  3AG1 H;  3AAF A;  1K79 A;  2NVY J;  3DBR B;  3I58 A;  2LSO A;  2O03 A;  5HVQ C;  2OBP A;  2UV1 A;  3H3U A;  1J9I A;  4S04 A;  2DT7 B;  1FIP A;  1YTY A;  2W7N A;  3NAU A;  1PDN C;  3W2A A;  3EYI A;  9ANT A;  3J80 Z;  1U2W A;  2PN6 A;  1IN8 A;  2P81 A;  1G59 A;  2VQH A;  4E7S A;  4MEX F;  2DLL A;  1F4K A;  2IGN A;  2CU7 A;  1HKT A;  2DQL A;  2PBI A;  1AKH A;  3FHN A;  3HGG A;  3DKX A;  3FXQ A;  4D5F A;  4DYR A;  2LG4 A;  2VJ5 A;  3TO7 A;  2D45 A;  2IT0 A;  1XD7 A;  2K5C A;  2STW A;  3S2H J;  3REO A;  4HST A;  2QQ9 A;  3GUD A;  4MLO A;  2GIV A;  2WV1 A;  5LBQ A;  3J7A O;  5EZH A;  1IXC A;  4AIH A;  1R36 A;  2DDB A;  2HI3 A;  5F64 A;  3U1D A;  1BL0 A;  2ICW G;  4XR6 A;  5IOZ A;  5D4S A;  3DQV C;  1OYY A;  3MQ0 A;  5CVU A;  2O3F A;  4L9V A;  4XID A;  2KJC A;  4BAC A;  1ETK A;  2OV7 A;  3H3Z A;  4DGW B;  5DDG A;  5J8C A;  1K4S A;  1OQY A;  4HLY A;  2W85 A;  2P5L C;  2JQ7 A;  1EV7 A;  2HTJ A;  4PSX A;  3S3M A;  1HKQ A;  4RAZ A;  5HLH A;  3GZ6 A;  1VQ9 I;  2RGV A;  3RKW A;  5J8F A;  3FBN B;  5KAI C;  5ICE A;  1ORK A;  4PCQ A;  5GTH C;  3DTE A;  3D5R C;  4IX7 A;  1MMS A;  5E18 F;  2HQN A;  2MH2 A;  4NQW A;  3A4C A;  3DLL F;  1SFO J;  5M3M J;  4PFO A;  4MQV A;  2ELK A;  4HEA 2;  2QLZ A;  4KNY A;  5EYR A;  4G6Q A;  3MMY B;  3H9Q A;  1U6G A;  4RAF A;  3OIO A;  2VI6 A;  4B48 A;  1IW7 F;  4I99 C;  5DD4 A;  4FAS D;  1LQ1 A;  4AVZ A;  5CPR B;  1H8A C;  2KDO A;  3DEW A;  1QHH D;  5E3M A;  1G3Y A;  1KQ0 A;  3I59 B;  2GXA A;  3TBI A;  1Z3X A;  1VQ5 I;  1O4X A;  1IUF A;  1H9G A;  2K9S A;  4M9X A;  2XAH A;  1OCZ H;  3OWT A;  4AVP A;  5K7Z A;  1PP7 U;  1P92 A;  2CW7 A;  4IQJ A;  3R6S A;  2JSP A;  4G6T B;  4WF2 A;  4KIG A;  5IT9 Z;  2H27 A;  2V6C A;  1LPQ A;  4R8H A;  4YEJ A;  1F36 A;  2KIU A;  4AIK A;  1Z7L A;  1MSF C;  2DU9 A;  5KAF C;  4A3C J;  5LRR A;  1ZRD A;  3I4N J;  2VLA A;  3OS2 A;  2DTZ A;  2NXN B;  3F72 A;  2PLY A;  3ZP5 A;  1AA7 A;  4RM2 A;  3GLL A;  4DBQ A;  1ZAO A;  3VYR B;  2UZK A;  1ODD A;  4P9U A;  4P9F A;  4F55 A;  2EFN A;  3LWF A;  3H9G A;  3QPS A;  4G12 A;  4XKV A;  3K4C A;  3TKY A;  2VAS A;  5IYC J;  1K83 J;  3FMS A;  4ZZD A;  4KJZ A;  3X2Q H;  3E0J B;  1ETO A;  1KQ8 A;  3PNV A;  1W7P B;  2IS4 A;  2PJP A;  4N0B A;  1WJD A;  1IDZ A;  4ESJ A;  2VON A;  4H4K C;  3J80 K;  4L5I A;  4FQG A;  2XGX A;  2VT2 A;  3LSP A;  2O8K A;  1ZHF A;  4EEF G;  1SD6 A;  3PNT A;  2HDC A;  4D7M A;  3CUQ C;  2YX4 A;  1FBQ A;  2TRT A;  4BE0 A;  2XAJ A;  3JRC A;  2M9H A;  2CQN A;  4I01 A;  4JX4 A;  3GFL A;  4KT5 C;  2ZJQ F;  4NHJ A;  1RPW A;  2M5W A;  4GYI A;  4ZDP A;  1A35 A;  2VN2 A;  2E34 A;  3J81 Z;  2JA8 J;  5FO5 A;  1O57 A;  1I3A A;  4L9N A;  4LJZ F;  3HKZ A;  4QSH A;  4BHC A;  4CA0 A;  3BT9 A;  3JSP A;  4A0Z A;  5TRD A;  2ID6 A;  1WI9 A;  2Z99 A;  2B0L A;  4WWC A;  4AD9 A;  4KIT B;  3KP3 A;  2BHZ A;  2FNP A;  3FXJ A;  4U0V A;  2CSO A;  5TGT A;  1QU3 A;  1X1B A;  5ERI A;  1WJB A;  4XOT A;  4BHP A;  3A1Y A;  3OYF A;  2J5P A;  3I54 A;  1T0F C;  3A0B C;  4ENJ A;  1D8J A;  3CES A;  2WAF A;  4LFU A;  1DDN A;  4ETS A;  2F5D A;  2XPW A;  4D1Q A;  3GTJ J;  4BL0 B;  4HAM A;  4HX8 A;  3N97 A;  1JKR C;  3OYN A;  1POG A;  3HGY A;  2LD5 A;  1U0J A;  1IAW A;  1ZRC A;  2E35 A;  2V9K A;  3LSK A;  2KFD A;  4FET A;  4OU0 A;  5CQG A;  4EJW A;  2W82 A;  5DM7 F;  2LRD A;  3ZQI A;  4ZYG A;  1O7F A;  3ABL H;  1Z6R A;  1CF7 B;  5LLQ A;  5DCF A;  3JRH A;  1J0R A;  2LFB A;  4YG2 F;  2PMH A;  2ISZ A;  4HF1 A;  3K6G A;  1VQ8 I;  2YX7 A;  2GZW A;  1VTN C;  1VQ4 I;  2R7D A;  3MFK A;  2E1C A;  3JCU C;  1TT5 B;  2Y2Z A;  1Y0U A;  4HOB A;  4XSZ F;  2ZXW H;  3Q3S A;  4WK8 F;  4L5J A;  5J1R A;  3WGH A;  1TWF J;  4ZYH A;  2GM4 A;  2VKV A;  4A3K J;  1W5T A;  2CO5 A;  1MBF A;  1XCV A;  3ABU A;  4IHT A;  4XL9 A;  2CQK A;  3H5R A;  1TWG J;  2ZME A;  1F1Z A;  2DN0 A;  3S2W A;  3RDI A;  1FWZ A;  3NWS A;  2MG4 A;  3VYT B;  1IC8 A;  1DP3 A;  2L0K A;  3SJM A;  2X1D A;  4EJU A;  5H6Q A;  2O9L A;  2ZKZ A;  4A3E J;  2XAU A;  4EGY A;  1J75 A;  3W6V A;  1K6O A;  3CMM A;  2BYV E;  4DQ2 A;  3BPX A;  2EZK A;  2ZJ2 A;  3BTC A;  5F6F A;  3ZQF A;  3FHZ A;  2IEK A;  4HW0 A;  3TMO A;  2ZJR F;  3G71 I;  1B8I B;  1FSE A;  5FGM A;  3HEF A;  1NH3 A;  4I76 A;  2GQQ A;  3VYU B;  4OIQ F;  5E79 C;  4PJ0 C;  4XLF A;  1ZQ3 P;  3SDB A;  1YJN I;  3ERE D;  2XAG A;  3ZMD A;  2IJL A;  1BR4 A;  2CV0 A;  2QQA A;  1KYW A;  5F04 A;  3JRD A;  2J5O A;  2X9D A;  3DBL B;  4XLN F;  2VXZ A;  1V4R A;  3EUH A;  4BDZ A;  3MKZ A;  3PM1 A;  1FY7 A;  5DUK A;  2XKO A;  5IYB J;  2Y30 A;  4DIQ A;  1FOK A;  4CHU A;  5B1A H;  1JGS A;  1KZH A;  5D5V B;  1K78 B;  2WTE A;  1QHG A;  2L01 A;  4JYK A;  2PMZ A;  1I5Z A;  3CCJ I;  1WRJ A;  1RIO H;  4O5V A;  1GXQ A;  1YJ9 I;  2GXB A;  3QWL A;  2IS2 A;  3I4M J;  1IN7 A;  2GOM A;  2K86 A;  1QQI A;  3S8P A;  4CZZ A;  1IRG A;  4Y7N J;  1EH7 A;  4L0Y B;  2K9N A;  1BW6 A;  2TDX A;  5D5X B;  4WX9 A;  2GAU A;  1IJW C;  3BR0 A;  2IA2 A;  3A0H C;  1HKS A;  2W24 A;  3F3X A;  1E2X A;  2YS9 A;  4IQ4 A;  3QP5 A;  4BJ6 C;  1R23 A;  1U78 A;  4ABZ A;  1HA8 A;  2D2W A;  4CDG A;  3WHC A;  1YG2 A;  1X4P A;  3FM3 A;  3HXL A;  2W1O A;  1O3S A;  1LKX A;  2KRH A;  2BXY A;  3SFI A;  1VQ7 I;  1UG0 A;  2F5V A;  4XNF A;  3TW6 A;  2EFP A;  5J4Y A;  4Q47 A;  2DFF A;  1TT0 A;  4HF0 A;  2XC7 A;  2AQE A;  3W3C A;  1FYM A;  2M7A A;  2VQL A;  5AON A;  2I5U A;  1U5T B;  2XB0 X;  3V4G A;  3RYP A;  2CRG A;  4LIT A;  3JRI A;  1S7A A;  1WKM A;  2G7H A;  3VB2 A;  3JAM K;  1RI7 A;  4UUV A;  1U9O A;  2MFZ A;  1HBX G;  1OCC H;  4M73 A;  4MEY F;  3FK6 A;  4NUB A;  3CJQ B;  2DA4 A;  2NOG A;  2Z5U A;  2DT5 A;  2L9R A;  2O0Y A;  3CCV I;  3ZXS A;  3MZ8 A;  1S7O A;  3IL2 A;  4CCN A;  2DDA A;  4Y3O A;  1JKO C;  2H6B A;  2E5Z A;  2EIM H;  4QPQ A;  1F43 A;  3HIF A;  3FXO A;  4DYC A;  2O8X A;  3K4N A;  4B1R A;  3K4K A;  2QSF X;  5FD6 A;  1S29 A;  3RPU D;  4UUS B;  2VOO A;  1R71 A;  1GLN A;  2WY8 Q;  5A2Q Z;  2L4A A;  1N77 A;  4MQ9 F;  2FF4 A;  1BJZ A;  1X2N A;  3CCU I;  1I1G A;  2JSC A;  2R3S A;  3R60 A;  2X6X A;  2WBM A;  3HG9 A;  5E20 A;  4LLG F;  2AXT C;  3ONQ A;  5CJ9 A;  1OCP A;  2WC2 A;  1R5H A;  5D8K B;  3FIS A;  3PSI A;  3NEU A;  4ENN A;  2VPR A;  2WA0 A;  3WTW C;  3S16 J;  4LIV A;  4C9Y A;  4G9Y A;  3COA C;  4I02 A;  4C3H J;  1LE8 B;  4AM3 A;  4BS9 A;  2BXZ A;  3HTU A;  2MGQ A;  3BTJ A;  4ZDL A;  2FJ1 A;  1FPQ A;  2XSJ C;  3LST A;  4M72 A;  2KQR A;  1ZK8 A;  3LMM A;  2ME0 A;  5DYM A;  1RUO A;  2DO7 A;  4HV6 A;  3GBG A;  1JUP A;  5LGT A;  2VB6 A;  1R6R A;  2R7F A;  3EQL F;  2JPB A;  2EFQ A;  3BQY A;  1QPI A;  3ZOB A;  1PVE A;  2Y9Y A;  1D5V A;  4UUT A;  3ZR8 X;  2M0C A;  2COM A;  2HOA A;  3LFK A;  5K5Q A;  1RKW A;  2WAD A;  3SFZ A;  2H8R A;  4HQM A;  5LFA A;  4NC8 A;  3FF5 A;  3OL4 A;  1U5T C;  3K1N A;  4G8X A;  3FZV A;  5CVV A;  1WCM J;  1IRX A;  2QKL B;  3CLO A;  3TGN A;  1T6S A;  5IP9 J;  3ZCO A;  4AIJ A;  1BR1 A;  3KP2 A;  5HLG A;  1Z3Y A;  1MJA A;  2YU3 A;  4MGR A;  1WPK A;  2FQ4 A;  4A2U A;  1RUN A;  3MN2 A;  3S17 J;  4DOZ A;  1FT9 A;  2X85 A;  2YR2 A;  4OIR F;  3SZP A;  1XDU A;  2GXG A;  3LOC A;  1OPC A;  1SC7 A;  1YYV A;  3F8M A;  2RNJ A;  1USS A;  1DU0 A;  2DK5 A;  2IA0 A;  2M8G X;  4ZZL A;  4UNO A;  4PJL A;  3CUO A;  3GCM A;  5BMZ A;  4OIP F;  3KIO A;  3OR1 C;  5K1Y A;  1A5J A;  3QOD A;  4S05 A;  4CCO A;  1Z7U A;  2EZL A;  3PUB A;  3WGI A;  1HW2 A;  5BNG A;  3BRO A;  5IPA A;  4AYB N;  2FBH A;  1IN4 A;  3RTR A;  1N25 A;  2QYO A;  1OJL A;  3MEX A;  3MZH A;  2BVM A;  4BXX J;  1PUE E;  5FKM A;  4XLH A;  4XOP A;  3S1Q J;  4RLQ A;  1XG1 A;  2ZSI B;  1SFU A;  1OR7 A;  3KZI C;  3JRB A;  1YO5 C;  2H94 A;  1RNL A;  3ASN H;  4IXA A;  1ZR2 A;  4LIU A;  2HR3 A;  1B59 A;  3SEZ A;  3HSE A;  1YIT I;  3B73 A;  2VOD A;  3OYK A;  1ITY A;  2OF7 A;  3WG9 A;  3FXK A;  3M4O J;  4UHT A;  1X3U A;  4Q48 A;  4BJT A;  3KP5 A;  3GX4 X;  2YUS A;  4O3M A;  5CVI A;  4BUP A;  4V2G A;  1A6Q A;  1ZYR F;  4QWQ A;  4Q4Z F;  3LSH A;  2PQ8 A;  3CQZ J;  3C2H A;  4L9J A;  2HVS A;  2HWV A;  2M45 A;  1FP2 A;  3LSI A;  4LG0 A;  2VJJ A;  1FMW A;  2Z1D A;  2BOL A;  3ECH A;  5LEJ A;  3ECO A;  2FE3 A;  1JJ8 C;  1XDS A;  2L54 A;  1HOM A;  4UB6 C;  4YEL A;  3DFG A;  2CUE A;  2HTS A;  4IJA A;  4GDF A;  5FRM A;  1VQ6 I;  3BG9 A;  2KLO A;  4ZYE A;  3H0D A;  3K7A J;  5FB2 A;  1HDD C;  1NK2 P;  3CP8 A;  2P7C B;  2ZXI A;  2E1M B;  1ENH A;  1SMY F;  1FNN A;  2V26 A;  3SZG A;  4XRM A;  4HF2 A;  2ESH A;  5CYV A;  3AKZ A;  3GTQ J;  2V6E A;  4NC6 A;  2EIL H;  4F93 B;  5M5X J;  4RAY A;  2Z33 A;  5JHU A;  4J19 A;  2O61 A;  2CW0 F;  3OIQ A;  2KDZ A;  4II2 A;  4L5E A;  5F1R A;  2FD5 A;  3LQQ A;  2STT A;  4B8X A;  4FCY A;  1EKE A;  2E2I J;  4KYW A;  4BDY A;  1I50 J;  2HYF A;  2LBF A;  3LQR A;  2VJI A;  2NVT J;  5H20 A;  1RR8 C;  1BC8 C;  1U8B A;  3BY6 A;  2ECC A;  5LHG A;  4IHY A;  4LLN A;  1IN6 A;  4HPQ A;  1G3W A;  3E5U A;  5B5E C;  3O3K A;  2P6T A;  2LH9 A;  1FYK A;  4BQQ A;  5IY5 H;  3L2C A;  5DS9 A;  3QU3 A;  3OYC A;  4L9T A;  4KMF A;  2M87 A;  2Q0O A;  2YPR A;  1MDM A;  2BGC A;  3H0G J;  1X1P A;  4XRS A;  1S9H A;  4A5N A;  5B66 C;  1TTY A;  3O6B B;  3E97 A;  4II3 A;  3WU0 A;  4E7Z A;  2FQ3 A;  2DK8 A;  1R22 A;  5CVJ A;  4A3M J;  2LTP A;  5D4R A;  3DPT A;  3GZ5 A;  1X58 A;  5LEK A;  5L3E A;  1MW7 A;  1VQO I;  2KHM A;  1KU9 A;  4CYC A;  2XGC A;  1GXP A;  1MND A;  3LSR A;  2E60 A;  5FRN A;  2HYJ A;  1RET A;  2MH9 A;  2ZFW A;  3BP8 A;  3ISP A;  4IRI A;  3I56 I;  2F5C A;  2CQX A;  4J00 A;  3BCA A;  2RVC A;  4HX4 A;  2DW4 A;  1HXD A;  1XSV A;  3ZQG A;  3BLY A;  5EGO A;  2VE8 A;  3BR3 A;  1VQP I;  2E1M C;  1YHQ I;  4UB8 C;  4RDU A;  3A01 A;  1WSU A;  4OAZ A;  1G6N A;  4FX4 A;  3CC4 I;  4BU2 A;  1XX5 A;  1K6Y A;  2ECB A;  2K9L A;  2QM3 A;  3TOB A;  3ZQQ A;  1RES A;  2DJN A;  1W1W E;  5DV5 A;  4WXC A;  3MAJ A;  2FRH A;  2R5Y B;  4NNJ A;  1LVK A;  2QWW A;  4A3J J;  1P7J A;  3K10 A;  3CC7 I;  2DOE A;  4KIC A;  2JWT A;  2LY1 A;  3FKI J;  2V1U A;  2VQG A;  4EJT A;  2XF6 A;  1APL C;  2QBY B;  3E6B A;  2UXN A;  1ZGW A;  4D7N A;  5D6F A;  2FBI A;  2GIZ A;  3T5X A;  1DPU A;  3C3W A;  2W48 A;  3GME A;  3NAR A;  2OTL I;  5E17 F;  4CCM A;  2QF7 A;  4KIS A;  2JRM A;  2EIK H;  2XF5 A;  5E3O A;  1X3Z B;  2LF8 A;  3EUK L;  2NNN A;  1Z9C A;  2L7Z A;  3HKZ N;  3DCF A;  1SMT A;  2KJB A;  1VQL I;  5BPD A;  2FOW A;  2ZCW A;  4HA8 A;  2DXI A;  2X4H A;  1P7I A;  1RR7 A;  3GW2 A;  1JGG A;  3HRU A;  1SD5 A;  3S3N A;  3A03 A;  3E1S A;  3FXL A;  3CCR I;  1XSX A;  4MNU A;  2LK2 A;  3RCO A;  4BHB A;  2XVC A;  3Q9S A;  3E5X A;  2QCO A;  3M1C A;  5DM6 F;  1KU3 A;  2KPM A;  3UNG C;  4DZP A;  2PJR A;  1HSJ A;  1VQK I;  2LVS A;  4AID A;  5EZG A;  3OYG A;  1GUU A;  2A6H F;  2HOE A;  3CUQ B;  3S3O A;  4OOI A;  3TDZ C;  3FXR A;  1KON A;  1MBE A;  2ZME B;  3FXM A;  4NDL A;  4PJM A;  4HYE A;  1E0E A;  2JUG A;  2VC1 A;  3G6E I;  4PGG A;  2AHQ A;  3DLA A;  2LLK A;  3HRS A;  4IHS A;  1XB4 A;  2R7U A;  2VBZ A;  2X6Y A;  2HNH A;  2P8T A;  2DFH A;  3HOZ J;  1VF9 A;  4LLL A;  3CO6 C;  3J7Y J;  2CQ7 A;  1BOA A;  3WTT C;  1AU7 A;  1WGX A;  1TL8 A;  4ESF A;  4BE2 A;  1NHA A;  5EJC A;  2QQ8 A;  3FK7 A;  2EBI A;  5CKT A;  4DZJ A;  1OCR H;  2A05 A;  2HKO A;  3BG6 A;  1ZLJ A;  2W4S A;  4E7J A;  2V7F A;  4L0Z B;  1SD4 A;  4YIF A;  3P9K A;  4XLE A;  2P4W A;  4NBQ A;  5GAG J;  2BE5 F;  3GTG J;  3L9F A;  3TO6 A;  5J1Y A;  1FX7 A;  1H9T A;  1WJE A;  1UZC A;  2V9P A;  3GXO A;  1R9T J;  3AFH A;  1B6A A;  1DGR M;  1Y8Q B;  4EM1 A;  1E3H A;  3PUF A;  3CMA I;  2WV0 A;  3S15 J;  5C4X J;  1H88 C;  1MBJ A;  2DOA A;  4IZZ A;  3DU5 A;  4ZH4 F;  1R58 A;  5DCM B;  4HNU A;  4A3I J;  2BV6 A;  2JN6 A;  2RN7 A;  4FT8 A;  3M7G A;  1QPM A;  5HS8 A;  2EFW A;  3FMQ A;  2MYS A;  2DFE A;  2VJ4 A;  4E70 A;  4BEH A;  1OFC X;  2K85 A;  4FHT A;  4C2M J;  3M1E A;  1GDT A;  3FMR A;  3IKV A;  3VOE A;  1E3O C;  2A07 F;  3RJP A;  3ZN1 A;  5CVR A;  3F8F A;  4X1E A;  4IOC F;  3PFY A;  4OIN F;  3KCC A;  1U9N A;  2MLK A;  1AWC A;  1LNW A;  4A3L J;  3MVP A;  2EV0 A;  1STZ A;  3BTL A;  3R0A A;  2X6W A;  3KX2 A;  2Z2S B;  4B43 A;  2ZME C;  4CO8 A;  4A6D A;  2M30 A;  5M5Y J;  2FX0 A;  3V7S A;  3OSG A;  4Y4R A;  3TP0 A;  3WU1 B;  1Z77 A;  4EMS A;  2Y75 A;  2CS3 A;  2MC3 A;  2ZJP F;  1VQN I;  3CJN A;  2B63 J;  2JA6 J;  2JA7 J;  4UVB A;  2VBX A;  2DFI A;  3W6K B;  4E7K A;  5DD8 A;  5FKL A;  3HM5 A;  1XTA A;  3DPU A;  4RLF A;  3LL7 A;  2XDV A;  2LKS A;  3N05 A;  1XSD A;  3W2V A;  3B02 A;  3U21 A;  1D0X A;  2QEX I;  1FOY A;  4M3G A;  1MGT A;  4C30 A;  3J7Z I;  2PMZ N;  2JT1 A;  2P6S A;  3DP7 A;  2E1N A;  3CF2 A;  4PSW A;  1W36 D;  3D5S C;  3SHF A;  3MKW B;  2ID3 A;  2H09 A;  5E1W A;  1D1B A;  1XGO A;  3RKX A;  3BZC A;  4OMY A;  4XQF A;  1W0T A;  5JR3 A;  5IYD J;  1D3Y A;  3M8F A;  3QQA A;  4I09 A;  1P2F A;  3G1O A;  3HC7 A;  1Z21 A;  2VIX A;  1REP C;  3GWZ A;  2KIF A;  2Q2E B;  3OMY A;  3E6M A;  2CUF A;  3G3Z A;  2BY1 A;  2OQG A;  4G7H F;  4F3Q A;  3WTU C;  1SVO A;  4V19 K;  2XRN A;  4U88 A;  2ZBK A;  2A6T A;  3EUH C;  5H6R A;  2Y48 A;  1T38 A;  3L2U A;  4MTE A;  4UVA A;  3LNQ A;  3KYC B;  3KEY A;  4QPO A;  5BS6 A;  2EV6 A;  2VKD A;  2M0M A;  2CYY A;  3FX3 A;  3JAM Z;  3KZY A;  4KT6 A;  4XN3 A;  1M1E B;  1S72 I;  1RZ4 A;  2HQ5 A;  1BA5 A;  4HNT A;  1BI3 A;  2DAO A;  4AUX A;  1YX5 A;  3G1M A;  3BPV A;  4NB5 A;  3I53 A;  1Z91 A;  4A6E A;  4EQQ A;  1YJW I;  3QPH A;  2ZNZ A;  1UFM A;  2IW5 A;  2BHY A;  5LGN A;  3RKY A;  1D8K A;  2DYR H;  2LR8 A;  5GAD J;  4MFE A;  1S8N A;  3VSL A;  2L9V A;  3EPZ A;  2QSG X;  1MKM A;  3S2D J;  1W4M A;  2AS5 F;  1TW2 A;  2EA2 A;  2Z9O A;  5ED4 A;  4CCL A;  1UHW A;  2LY2 A;  3ROU A;  3OS0 A;  3I55 I;  4AU7 A;  3B6C A;  1MMD A;  2MD5 A;  3H92 A;  5E8G A;  1K7A A;  3ZRG A;  2KIS A;  3RKQ A;  1ZLK A;  4IRG A;  4JBA A;  3K70 D;  3E6C C;  1SFX A;  2NOJ B;  1YI2 I;  4BNC A;  4F92 B;  2C6Y A;  1MJB A;  1DPR A;  1SFE A;  2GA1 A;  4JP0 A;  4U87 A;  5B3S H;  3CF5 F;  1GT0 C;  2A68 F;  1Z0X A;  5F08 A;  1TWC J;  1ETX A;  1ZAR A;  4LGW A;  1EA3 A;  1Y56 A;  5D5W B;  5ICC A;  4E7H A;  3HUG A;  2GA2 A;  3Q9V A;  1ULY A;  5FKK A;  2OZ6 A;  4FTH A;  2XAQ A;  4UVC A;  4JK1 X;  1UAA A;  2K3P A;  1EH8 A;  1O3R A;  5BOX A;  5L3B A;  1X19 A;  2QSH X;  2XGD A;  2GLO A;  4RAG A;  2PMU A;  1QGP A;  3F8N A;  3FIW A;  4PZJ A;  5JLW A;  2R5Z A;  5M3F J;  1BN5 A;  3C2B A;  3QOE A;  4M9Z A;  2DMQ A;  3WGG A;  1QZZ A;  1WQ2 A;  1IV6 A;  2DI3 A;  1YFH A;  1HLV A;  2HPI A;  2VXD A;  2JJ7 A;  4BBR J;  2Y69 H;  2Y9Z A;  5F0C A;  1D5Y A;  4RS8 A;  3N4M A;  1LVA A;  5GTI C;  1QRY A;  1L0O C;  1HQC A;  1JXS A;  2X1E A;  5FD5 A;  2DA6 A;  4G7Z F;  4CGZ A;  3HOU J;  4CYD A;  1TNT A;  3K1M A;  2MLG A;  4RGU A;  3IAS 2;  2DMU A;  4F91 B;  3EYY A;  3FXU A;  1XGN A;  2CG4 A;  2V1D A;  5JHF A;  2XRO A;  3P9C A;  2L4M A;  5EDN A;  1EF4 A;  4IHW A;  3BG5 A;  1B72 B;  2CV1 A;  4MFD A;  5E3L A;  3Q0V A;  1SD7 A;  4LG0 B;  3T8T A;  3VEP A;  4YIR X;  3HPG A;  5J4V A;  3RYR A;  1X1A A;  3IC7 A;  2EPF A;  2IGK A;  2QA4 I;  3GTL J;  3NWT A;  5IP7 J;  5L3F A;  2FNA A;  2L02 A;  3OR2 C;  2L7M P;  3B6A A;  2RC4 A;  1IRF A;  4XMY A;  1O3Q A;  1N75 A;  4CZC A;  3PSF A;  3E5Q A;  4B47 A;  1P4X A;  1SAN A;  2DPU A;  1D1A A;  2K9M A;  2LMD A;  4CH7 A;  4ASN A;  1BR2 A;  2R7Q A;  4YFX F;  3DEU A;  3I71 A;  4HSR A;  3BQZ A;  3T1B A;  4Y33 A;  4MIM A;  1ZRF A;  1BI1 A;  2JA2 A;  5KK1 A;  3Q0U A;  3DWL E;  1ONV A;  4M74 A;  1ZG3 A;  1U3E M;  4BJ5 C;  2OU2 A;  2WAQ A;  4ZC3 A;  5B1B H;  3CTA A;  4QIW N;  2ZNY A;  3H5N A;  1UG2 A;  2KIQ A;  2Q1Z B;  4Y52 J;  3DTI A;  2FOK A;  1ZTR A;  2ADU A;  1OR7 C;  5GAH J;  5CQE A;  2E19 A;  2W57 A;  1R49 A;  4BYY A;  3I4P A;  1G2H A;  3QPL A;  3BJO A;  3OYL A;  1ETQ A;  2K4J A;  4IO9 F;  1HF0 A;  3UR3 C;  3HOX J;  4MO7 A;  3G1L A;  2R7Z J;  1MDM B;  3AG3 H;  2OA4 A;  1IZ1 A;  1WWX A;  3M8J A;  1FTT A;  1UHS A;  4OMZ A;  2FBK A;  3OOP A;  1IGN A;  2HDW A;  3OYD A;  3ERM A;  3FBI B;  1CF7 A;  3C1D A;  2CW8 A;  2N8G A;  1DGW Y;  1X4O A; 
#chains in the Genus database with same CATH homology
 2AO9 A;  1F36 A;  5K7F A;  5DS9 A;  2JMW A;  1MSF C;  2EQR A;  1MBH A;  1JKP C;  3HDD A;  2DA7 A;  3H0G J;  5HOD A;  4XRS A;  4A3C J;  3D1N I;  4X6A J;  2NS7 A;  1UMQ A;  3MKL A;  4A3M J;  1JUS A;  2LTP A;  3BR1 A;  1Q1V A;  5GP9 A;  1A6I A;  3I4N J;  2EZH A;  5C44 J;  1X58 A;  2DTZ A;  3RQI A;  5E3N A;  1VI0 A;  2E2J J;  4BBS J;  3HOV J;  1IDY A;  4CYC A;  1Y1W J;  2XGC A;  1T33 A;  3A01 B;  1W0U A;  2NVX J;  4GFB A;  1IRZ A;  3LSR A;  3QPS A;  2HYJ A;  4G12 A;  1RET A;  5IYC J;  4HNV A;  2EH3 A;  1K83 J;  5EEA A;  3IV5 A;  5JLX A;  1ETO A;  2CQX A;  1AKH B;  1NTC A;  1VFC A;  1IDZ A;  3RZD J;  3ZQG A;  5EGO A;  2LP0 A;  5GPC A;  3LSP A;  2XRL A;  3BR3 A;  2O8K A;  4EEF G;  4RDU A;  3A01 A;  2DA5 A;  1HCR A;  4A3B J;  4D7M A;  2ECB A;  3CCY A;  1RES A;  2DJN A;  2TRT A;  3JRC A;  2M9H A;  4JX4 A;  3F0C A;  4QTR A;  1RPW A;  2R5Y B;  4A3J J;  2JA8 J;  5F27 A;  1P7J A;  2JWT A;  3FKI J;  4QSH A;  1S7E A;  3BT9 A;  2KT0 A;  1APL C;  1TC3 C;  2ID6 A;  2JK3 A;  3BG3 A;  4A3G J;  5F0F A;  2DA1 A;  3A02 A;  1ZGW A;  4D7N A;  3HB9 A;  5FKN A;  2W48 A;  3NAR A;  1MH4 A;  2QF7 A;  2DMN A;  2Y31 A;  5EF6 A;  1ZKG A;  5E3O A;  2IAI A;  5DTD A;  3IH4 A;  2L7Z A;  3HKZ N;  4V2F A;  2XPW A;  3DCF A;  3GTJ J;  2HXO A;  2D5V A;  2LY9 A;  3SDG A;  2JA5 J;  1P7I A;  1RR7 A;  1JKR C;  1JGG A;  1POG A;  3HGY A;  3BR6 A;  1MBG A;  3A03 A;  2LD5 A;  4M3E A;  2LK2 A;  3UKG A;  2X48 A;  3CMY A;  3PO2 J;  3ZQI A;  2QCO A;  4DYQ A;  1MNM C;  4JX6 A;  4DZP A;  3TP3 A;  2LVS A;  5EZG A;  3LSG A;  3JRH A;  1WH7 A;  1GUU A;  2LFB A;  5FLV A;  3E7L A;  1GV5 A;  1MBE A;  4NDL A;  4XK4 A;  4BY1 J;  1Y1V J;  2AHQ A;  2O7O A;  4A3D J;  2LLK A;  1GV2 A;  2XGE A;  3GTM J;  3HOZ J;  1VF9 A;  2Y2Z A;  3TED A;  3Q3S A;  1PUF B;  4RBO A;  3S1M J;  1AU7 A;  1WGX A;  5J1R A;  3GTP J;  3FK7 A;  1TWF J;  2GM4 A;  2VKV A;  1MH3 A;  2EBI A;  4A3K J;  4DZJ A;  1MBF A;  1AHD P;  1JUM A;  2ME6 A;  2MW8 A;  1TWG J;  4CYC B;  2DN0 A;  4C3I J;  4UUS A;  1IC8 A;  2MG4 A;  2L0K A;  4A3F J;  3SJM A;  4DW6 A;  2O9L A;  3GTG J;  4A3E J;  3W6V A;  5J1Y A;  1PUF A;  2HXI A;  2EZK A;  3BTC A;  2R0Q C;  3ZQF A;  1R9T J;  2IEK A;  1MSE C;  2R92 J;  1B8I B;  5EGO B;  3HEF A;  3S15 J;  5C4X J;  1H88 C;  2XPV A;  1MBJ A;  4I76 A;  4A3I J;  2JN6 A;  1LE8 A;  1XC5 A;  2Y0S N;  1ZQ3 P;  1OFC X;  2DMT A;  1YRN B;  4C2M J;  5F04 A;  4A69 C;  3O8G A;  3JRD A;  1GDT A;  2X9D A;  4B3A A;  1E3O C;  1HDP A;  1B8I A;  3PM1 A;  2ZB9 A;  3JRA A;  4X1E A;  1K61 A;  5IYB J;  2Y30 A;  3ZQC A;  1DU6 A;  1U9N A;  4A3L J;  2K40 A;  4W1U A;  3MVP A;  2OPT A;  3BTL A;  4JYK A;  1CQT A;  3ZQH A;  1QVU A;  5M5Y J;  3I4M J;  2FX0 A;  4M6V A;  1YRN A;  3OSG A;  3TP0 A;  2H1K A;  1IG7 A;  1Z77 A;  2DMP A;  2B63 J;  2HOS A;  2JA6 J;  4Y7N J;  3S14 J;  2JA7 J;  5F1J A;  3HBL A;  5FKL A;  4XRS G;  2K9N A;  1BW6 A;  3HM5 A;  1JKQ C;  1IJW C;  3BR0 A;  1MBK A;  3TW7 A;  2YS9 A;  2HOT A;  4M3G A;  1U78 A;  2PMZ N;  4ABZ A;  3Q0W A;  4IHV A;  1I3Q J;  2ID3 A;  1I6H J;  3WHC A;  2DA2 A;  4AC0 A;  4BKX A;  5EG0 B;  3SFI A;  1W0T A;  5IYD J;  5M5W J;  3QQA A;  3TW6 A;  5C3E J;  3G1O A;  1JTY A;  1JT6 A;  1OCT C;  4FE7 A;  2CUF A;  3HOW J;  2YU9 J;  2WB1 N;  2XB0 X;  2CRG A;  3S1R J;  3JRI A;  3WHB A;  2I10 A;  3OOU A;  4FIS A;  3LNQ A;  1U9O A;  1X2M A;  1FJL A;  5IOY A;  1B72 A;  3FK6 A;  5EG0 A;  2DA4 A;  2NOG A;  1FEX A;  2L9R A;  1QVT A;  3JRG A;  2IBD A;  3LSJ A;  2HQ5 A;  1JKO C;  1BA5 A;  1F43 A;  4M3B A;  4DYC A;  4AUX A;  4B1R A;  5F0H A;  5GPA A;  4UUS B;  3G1M A;  4I6Z A;  1BJZ A;  1X2N A;  2LR8 A;  2CQQ A;  5C4J J;  1ETV A;  3K2A A;  4JX5 A;  4MFE A;  1OCP A;  3JRE A;  2HDD A;  1LFU P;  3FIS A;  3S2D J;  3IH3 A;  2VPR A;  3L1P A;  3S16 J;  3O8H A;  4C3H J;  4M3D A;  1LE8 B;  1JT0 A;  3B6C A;  4D5C A;  2MGQ A;  3BTJ A;  2FJ1 A;  2L7F P;  4FE4 A;  3RKQ A;  1ETW A;  1ZK8 A;  2ME0 A;  3GTK J;  2R93 J;  3GBG A;  1JUP A;  1FIA A;  4JP0 A;  1GT0 C;  3S1N J;  1Z0X A;  5F08 A;  3BQY A;  1TWA J;  1TWC J;  1ETX A;  1QPI A;  3ZOB A;  2Y9Y A;  4B4C A;  2R5Z B;  4UUT A;  5FJ8 J;  2M0C A;  2HOA A;  1RKW A;  5FKK A;  2H8R A;  4FTH A;  3BR5 A;  1ETY A;  1RKT A;  3RZO J;  1WCM J;  3BR2 A;  4BY7 J;  2X6O A;  4IEJ A;  2CJJ A;  5IP9 J;  3H3V K;  1T56 A;  2XGD A;  4W97 A;  2GLO A;  1JTX A;  2NVQ J;  1VND A;  1WPK A;  1TWH J;  2FQ4 A;  2M34 A;  3FIW A;  5JLW A;  4S0H B;  3MN2 A;  2R5Z A;  5M3F J;  3C2B A;  3GTO J;  2DMQ A;  1LFB A;  3S17 J;  1H89 C;  1IV6 A;  1HLV A;  2K9Q A;  2DA3 A;  3BTI A;  3LOC A;  2JJ7 A;  4BBR J;  1WI3 A;  2XSD C;  1DU0 A;  2Y9Z A;  3HOY J;  5F0C A;  1BW5 A;  2M8G X;  2EZI A;  1D5Y A;  2NVY J;  1QRY A;  1ZR4 A;  1A5J A;  2DA6 A;  2XB5 A;  2VUM J;  3HOU J;  2E1O A;  2EZL A;  3VPR A;  3JRF A;  1FIP A;  2DMU A;  3NAU A;  9ANT A;  5BNG A;  5IPA A;  4AYB N;  2P81 A;  1OJL A;  4M3F A;  5EDN A;  1EF4 A;  4BXX J;  4IHW A;  1GVD A;  3BG5 A;  5FKM A;  2CU7 A;  1B72 B;  4XIC A;  3S1Q J;  3ZQL A;  1XG1 A;  1AKH A;  3JRB A;  5J3L A;  3HGG A;  4MFD A;  4D5F A;  4DYR A;  5E3L A;  1ZR2 A;  3Q0V A;  3S2H J;  4C3J J;  1FTZ A;  4MLO A;  1ITY A;  2WV1 A;  2OF7 A;  3CDL A;  5K7H A;  2MSY A;  5EZH A;  3GTL J;  1BL0 A;  3M4O J;  2HI3 A;  3IH2 A;  5IP7 J;  5IOZ A;  2RAE A;  2YUS A;  2L7M P;  3B6A A;  4V2G A;  4XID A;  2GBY A;  1ETK A;  2R5Y A;  3CQZ J;  2TCT A;  1SAN A;  5FKO A;  3BQZ A;  1NK3 P;  4MIM A;  5J1U A;  1JJ8 C;  1ORK A;  1HOM A;  3M3Y J;  3Q0U A;  2CUE A;  2NS8 A;  3BG9 A;  2G0E A;  2M2E A;  1SFO J;  5M3M J;  3K7A J;  1HDD C;  2ELK A;  1NK2 P;  5IP6 A;  5EYR A;  2COB A;  4QIW N;  1ENH A;  1UG2 A;  3OIO A;  4XRM A;  2VI6 A;  4A93 J;  4Y52 J;  3OSF A;  3GTQ J;  1ZTR A;  2XPU A;  1XS9 A;  2E19 A;  5FLM J;  1H8A C;  3DEW A;  2E2H J;  5M5X J;  4IHX A;  4J19 A;  3QPL A;  1G2H A;  5E3M A;  2KDZ A;  1ETQ A;  1HF0 A;  4L5E A;  3HOX J;  4MO7 A;  3G1L A;  3JR9 A;  2R7Z J;  1JJ6 C;  1O4X A;  1IUF A;  2K9S A;  2FD5 A;  4LOC A;  2WAQ N;  3PO3 J;  4FCY A;  2E2I J;  1FTT A;  1UHS A;  1WH5 A;  1IGN A;  1I50 J;  5K7Z A;  2NVT J;  1U8B A;  2ECC A;  4IHY A;  2N8G A;  2VKE A;  2LKX A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...