2IJLA

The structure of a putative mode from agrobacterium tumefaciens.
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
116
structure length
110
Chain Sequence
KRLPLKPVLRIDFPPGERLGHGKVELMQLIAETGSISAAGRAMDMSYRRAWLLVDALNHMFRQPVICSQRGAALTVFGAELLERYRGMEERMNEALREDIDWLEANRNPQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The structure of a putative ModE from Agrobacterium tumefaciens.
rcsb
source organism Agrobacterium tumefaciens str.
molecule tags Transcription
molecule keywords Molybdenum-binding transcriptional repressor
total genus 32
structure length 110
sequence length 116
chains with identical sequence B
ec nomenclature
pdb deposition date 2006-09-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00126 HTH_1 Bacterial regulatory helix-turn-helix protein, lysR family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 2ijlA00
5DCMB 3DKWA 4HQEA 1Z6TA 4FX0A 2QQBA 2W24A 1Z9CA 2R7FA 4MEXF 1FZPB 4B09A 1IN5A 2OA4A 2V79A 3KP7A 2ZMEB 1ZN2A 2IT0A 2IPQX 1J0RA 2GWRA 2HWVA 4MGRA 3VEPA 3T8TA 3U1DA 4IVNA 3HSEA 3JSPA 2QENA 1RUOA 4M73A 2ESHA 4ENNA 4GO1A 3T1BA 3PQJA 1O3TA 1BJAA 2CQKA 3P9CA 4EGZA 2A69F 1RUNA 3R0JA 1J5YA 2IA0A 1G3SA 2W25A 3I54A 1DPRA 1TQMA 3L9FA 1F5TA 3TKYA 3E3VA 2JZYA 2R3SA 1PP8F 4HZFA 4AIHA 1YS6A 3JSOA 2P7CB 3BP8A 2CW0F 1WQ2A 4K2EA 5F6FA 3K1MA 3DPLC 2LF8A 1A04A 4RB2C 1PP7U 3TDZC 2QLZA 3C18A 5JR3A 2XGXA 1Z91A 1EH8A 4EMSA 3NQOA 2DAOA 4MNUA 1V4RA 3KP3A 4BHPA 2HGCA 4G7HF 2DU9A 5DYMA 2CFXA 3FMSA 3F8BA 1FYMA 1IAWA 4ENJA 1JHHA 3LAPA 5DD8A 2Z5UA 3VB2A 5E8GA 5HLIA 5KK1A 4L9VA 1HXDA 3ZMVA 5BPDA 3DP7A 2K27A 4FHTA 1T38A 5FB2A 2YSRA 1IN4A 3MFKA 4EVIA 1IXRC 5DDGA 3KE2A 3KEOA 3ZMUA 2M45A 1GVJA 1U78A 1BI1A 5H20A 2FBIA 1G6NA 2MLGA 3ZPLA 3R0AA 3CUOA 1L3LA 2JPCA 2NYXA 5HDGA 4EM2A 3C3WA 3NEUA 3B02A 2K4BA 5EEGA 1LB2A 3IRRA 4CYDA 1XCVA 3WE2A 4IRGA 4ETSA 1K6OA 4CZZA 2FE3A 3GFLA 2EFWA 3WU1B 4LD5A 2XROA 3M8FA 2K86A 1W7PB 3I71A 2P5VA 3RIRA 1FY7A 4WXCA 2HKOA 1O7FA 1X3UA 4LG0B 3WTSC 4HW0A 2DTRA 1S7AA 4EQQA 2GQQA 1KU3A 1KGSA 1ZRFA 4ESBA 3T0YA 2VC0A 5ICCA 1W7PD 5DUKA 3JAMZ 1U5TB 1O3QA 5JFRA 2DPUA 4A5NA 4KMFA 2JT1A 2BYVE 5LHGA 4HA8A 5LRSA 2NNNA 4L18B 1QPMA 4ZZLA 1R1VA 1BC7C 3E5QA 5LEKA 3BPVA 2VN2A 3HTSB 4MTEA 5D5VB 2LDUA 4LGWA 1IN8A 4F7ZA 1ZGJA 2EV5A 5IT9K 4A6DA 4ZZDA 3RTRA 1R00A 5ICEA 5LHIA 2IA1A 1Y0UA 1KU2A 1YTYA 1K78A 5D8KB 3GZ5A 1IRGA 1U6GA 4NB5A 2KIFA 2Y75A 2H6BA 2KJBA 2HQNA 2OZ6A 3QU3A 4LG0A 3L7WA 3Q9SA 1MDMA 1Q1HA 3JTHA 5ED4A 1B4AA 3LFKA 3GFIA 2XKOA 4KYWA 2UWMA 3LAJA 4HV6A 2UXXA 1HKTA 2VT3A 2YU3A 3IHUA 4WK8F 1YO5C 1F4KA 3KP5A 2L02A 3W6JB 2NNYA 4LFUA 2KIUA 1F1ZA 3GVAA 2FSWA 1BOAA 4CGZA 2Q0OA 2G7HA 3HTUA 2E7XA 3WTUC 1FC3A 4AVPA 2O3FA 5TJJA 3ZMTA 5CVIA 5CYVA 5DV5A 2ZFWA 3OV8A 3TO6A 4RS8A 3MQ0A 5LBQA 3SZTA 3KLNA 4P96A 4HDVA 4Q47A 1DUXC 5HS7A 2Z33A 1USSA 4ZYDA 1E17A 1KU9A 3I64A 2IW5A 4S04A 5D6FA 3QPHA 1P4AA 1Z1DA 3CO6C 3HUGA 2LF7A 1G3YA 2V9VA 2ELHA 4OINF 4JK1X 1ODDA 5BMZA 2M5WA 1B1BA 2VBYA 4ESJA 2VODA 4HF0A 4U88A 3QU6A 1PDNC 1E2XA 4UV8A 5DD4A 2EB7A 3BWGA 1P92A 1W4MA 1D5VA 2QUFA 4WXDA 3EYIA 2G9WA 2DW4A 4KICA 1S7OA 1J59A 2OU2A 4RB0A 3P7NA 3R6SA 5ILSA 3GW2A 4H0EA 1IUYA 4LJZF 1XB4A 3FMQA 3RPUA 4L0YB 3IKTA 4YFKF 2YX4A 3DQVC 1HSTA 3E5UA 3LQRA 2X0LA 2EFQA 2P7VB 3E6BA 1OR7A 1HW5A 3TOBA 1D3YA 3HHHA 2V1DA 3TGNA 1SMTA 2VBXA 3C1DA 3O6BB 4GCVA 1LEAA 4O5VA 5LGUA 1O3SA 3HRTA 5D4SA 4RGRA 4XSZF 2RN7A 3F23A 2KIMA 4KT5C 3TQNA 3MZYA 4G9YA 4WX9A 5FLXZ 1ULYA 2OZUA 3W6KB 1H0MA 1MJ9A 1KQ8A 4M6XA 4KMUX 3BY6A 2VOOA 1USTA 3HYIA 2V6CA 4LK1F 4OMYA 4ASNA 3N97A 3FHZA 2A68F 3GX4X 2K02A 4P55A 4IHTA 2PI0A 3O2PE 4BXUA 3I5UA 4B8XA 4PDKA 3DXJF 4YIFA 2NRAC 2FNAA 4TV7A 4R1HA 3K0LA 2LNBA 3IL2A 4BNCA 1SFUA 5CVRA 3ZP5A 1ZARA 4BHBA 4R79A 2HQRA 1YW7A 3J7AO 2IVMA 5K1YA 1ZHFA 1MGTA 4DNCA 1CF7B 3KFWX 2IJLA 3ELKA 2D45A 2FMYA 5J6XA 4MTDA 3NRVA 2MC3A 2F5FA 3V8KA 4N9IA 2VE9A 1U5TC 4AWXB 3TDUC 2FOKA 3IWZA 1FBQA 2H09A 3RPQA 2OQGA 2BEOA 1LEBA 5D5WB 3J81Z 2STTA 4OU0A 1R22A 3HOTA 2XAHA 2ISZA 2EA2A 1FX7A 1YLFA 4ENKA 4A0YA 1REPC 4D0PA 3R60A 2R7DA 5JHUA 1XGNA 2DO7A 3ZMDA 2KKOA 2STWA 3U9GA 2K7LA 3DEUA 2EFNA 1T0FA 1ZG3A 4YFNF 1DPUA 1SD6A 4YG2F 3WTWC 2C6YA 3ABUA 5DCFA 3K1NA 2A6EF 1HSJA 3F72A 3VOEA 2A6HF 1R58A 3I59B 1FLIA 1U3EM 2ADUA 2J5PA 4BHCA 4I09A 3IWFA 1WKMA 3BROA 5AIQA 2ZKZA 3K9TA 4XSXF 2XHKA 3GEZA 2PLYA 4PCQA 4HF2A 4M71A 3WU0A 1YG2A 4UHTA 1U5TA 4M6YA 3G73A 3HRMA 3IKVA 2O6GE 3KEQA 4EM1A 1WSUA 4EJVA 1YIOA 1P4WA 1F9NA 5K5QA 3HRSA 1I27A 2E1CA 1K79A 4A0XA 2HYFA 4IHSA 4GGGA 3H3UA 2O8XA 2M30A 2GZWA 4KN7X 2Q2EA 3R61A 3GFMA 2BE5F 1W5TA 4HBLA 5HS8A 2ZO4A 2EV0A 2FXAA 3ZN0A 1IW7F 2ETHA 5E20A 1FT9A 3F22A 2EFOA 3WE3A 5ILUA 2G7UA 3I58A 2FMLA 1Z7UA 2BBYA 4LB6B 1BI2A 2VT2A 3JW4A 4OIPF 4IXAA 4M72A 3FXQA 2DQLA 2P4WA 2CO5A 3L09A 6PAXA 4MEYF 3WTTC 1D8KA 4M9ZA 4U0YA 5L3BA 2Y48A 4JQFA 4O6JA 3JAMK 3F6VA 1HKSA 1GXQA 1SFXA 3VODA 2RNJA 4L9TA 5HLHA 2JSCA 2HKXA 1O57A 1HBXG 3KP6A 2PQ8A 4HYEA 4M9XA 3GYHX 2L3DA 2FNPA 5BQTA 2EFPA 3Q5FA 2ZCWA 5LHHA 5FGMA 1SD4A 4UNOA 2ZNYA 2VOPA 1KQ9A 2HR3A 5ICGA 1OPCA 2EWNA 4O3MA 2HTJA 4BAYA 2Y0MA 3KZZA 3CO7C 4I2OA 2F5CA 5J8CA 5DUIA 4BH9A 4KIFA 1FP2A 1LVAA 1OYYA 1MZBA 2XAJA 3WGIA 1IXSB 2RV8A 5CVJA 4L9JA 4Z2YA 3LA2A 1GHCA 2FRHA 4XLPF 2DFIA 1QNTA 1S8NA 4HLYA 2UXNA 2F2EA 5AIPA 2M1BA 1QZYA 3FXUA 2LKPA 2KRFA 3ROUA 2JPBA 2ZMEA 3P9IA 4GXOA 3PFIA 2RDPA 2GAUA 4FX4A 4GYIA 2MA3A 3GUDA 5F1RA 2V1UA 2ACJA 3K69A 3FXRA 3BJOA 4CXFA 4Q48A 3IRQA 2COMA 4CDGA 4NHJA 4HF1A 1D8JA 1B9NA 3L00A 2NS0A 2B0LA 2VBWA 1EH7A 4UVAA 4R8HA 3FWEA 3JTGA 3V7RA 1GXPA 4HX4A 2DLLA 2QVOA 2TDXA 2D2WA 3ECOA 3T8RA 2QQAA 3SQNA 1S29A 1ZGAA 4HAMA 2A61A 2Z99A 3ISPA 2FEZA 3G3ZA 1H9TA 4OIQF 3Q9VA 1YYVA 1KU7A 4OMZA 1HW2A 3BOQA 5LGTA 3AAFA 3J80Z 2HTSA 5K5RA 2OBPA 3ECHA 2AXLA 4WF2A 3WTZA 5AONA 2GXGA 3BZ6A 1XMKA 3E6MA 1FOKA 1O7LA 4LB5A 1AWCA 3HOSA 1J9IA 3GZ6A 3N4MA 1FNNA 2ZNZA 4ENMA 3D0SA 4QLCU 4A6EA 4XBFA 1FPQA 4MQVA 3EYYA 5E18F 2HYGD 4A12A 2RKHA 5H6RA 1YS7A 1B9MA 3LA7A 2PJPA 2PN6A 1MJAA 2AS5F 2ISYA 5BPIA 3RKWA 4AD9A 2O03A 2O0YA 2RGVA 3K1PA 4RGUA 2MH9A 1BM9A 3FMRA 2XUBA 2XAGA 1TBXA 1S6LA 1QO0D 4HX8A 1FBSA 2HEOA 3LQQA 4RGSA 3EDPA 2XVCA 5E17F 3MEXA 1SFEA 4L0ZB 3COAC 2H27A 2L4MA 3F8NA 5DCMA 4LLNA 1FP1D 1JXSA 2EA4A 2DQRA 5CLSA 1IF1A 4M74A 1VTNC 5A2QZ 5D6EA 1LQ1A 5FO5A 1TNSA 2CWEA 3E5XA 2IRFG 1DP7P 1BN5A 2E1NA 4JBAA 1UFMA 3V8LA 3WTVC 1T6SA 5HVQC 2W85A 3ERED 4KIBA 5TRDA 1IN7A 3I4PA 1ZRCA 2EJRA 3RYRA 3M9AA 3DF8A 1FBUA 2L01A 4HDUA 2XASA 3V7CA 1NHAA 2RQPA 4AIJA 4UVCA 4YFXF 3C7JA 3QP6A 3TO7A 2H6CA 4UV9A 4ZYGA 2PG4A 1ZAOA 2V1XA 1UHMA 4RAZA 5JVTA 2GA1A 1R5GA 1LNWA 4HQMA 4KUMA 2NAZA 2XIGA 3BPXA 3CUQC 1QGPA 2QYOA 1AOYA 2A5YB 5L3EA 4I0BA 4P9UA 3ZQ7A 3ZN1A 2A07F 1XGOA 1MKMA 1W5SA 2RVCA 5LGNA 1R7JA 4FT8A 4WWCA 1BC8C 3J81K 1YW9A 1PUEE 1Z6RA 1TNTA 1J7KA 3RI4A 3CLOA 4EJWA 1SD5A 3M8EA 4E70A 1SMYF 3MZHA 2ESNA 1HW1A 4Y13A 1K78B 3ZMZA 2QQ9A 4ZH4F 2M87A 3QOPA 4KNYA 2K4JA 5JI6A 3V4GA 1LDDA 3QPTA 2XAFA 3WTYC 1JE8A 2F5EA 4RB3C 1OYIA 1MDMB 2EK5A 3H3ZA 4U7BA 1I1SA 4CO8A 2IA2A 1R23A 1XSXA 1B59A 3I53A 3EQLF 2HOEA 5CVUA 5HLGA 4DQ2A 3PQKA 3IC7A 3M1EA 3KP4A 4CICA 2A3SA 2YX7A 1BIAA 1XD7A 4XRFA 1P4XA 1TQPA 1FWZA 5L3GA 5IT9Z 2HFHA 2W84A 1G3WA 3D5LA 4MQ9F 3QRFF 1S3JA 2P6SA 4L9NA 1CGPA 2DT5A 1LJ9A 4MHGA 1G4DA 2L4AA 2QBYA 1OYWA 2LSOA 3I59A 2P5LC 3GLXA 5D8LB 1RIOH 1OMIA 4S05A 3DPTA 1P2FA 3KCCA 3EUHA 1BI0A 3SHFA 1YW8A 2VBZA 1JGSA 4L5IA 4Q5SF 4KA4A 4G6QA 4P9FA 2H94A 2PBIA 1XCBA 3FX3A 3RKXA 1H9GA 2EV6A 5ERIA 4I7HA 1YFHA 5FFZA 3LA3A 1IN6A 2W57A 1TW2A 3E97A 3HSRA 4AIKA 4PZJA 2UZKA 1RI7A 1BI3A 5E1WA 4HOBA 4I02A 2P6TA 1TQIA 1IZ1A 3QAHA 4G7OF 1KYWA 5ILVA 3U2RA 2HS5A 2FU4A 5L3CA 4WCGA 1WI9A 3F8CA 3RDIA 1CF7A 2P8TA 3HHGA 2MBFA 3ML6A 3KZYA 2QZ8A 3CUQA 4G94A 4PGHA 4LLLA 1XN7A 5FD6A 4L5JA 1FYKA 3DV8A 3ULQB 3KLOA 3QP5A 3R4KA 4KDPA 5E1ZB 1XMAA 2MLKA 4A2UA 2WTEA 4KIGA 3RJPA 1QQIA 2BGCA 2VONA 4HLXA 5F64A 1R36A 1ZLKA 3O3KA 1XSVA 1QBJA 1MD0A 2MD5A 3V7SA 1OKRA 1JHFA 4G8XA 2ZJ2A 2O61A 3SFZA 1ZH5A 1T39A 2IP2A 2HDCA 2FA5A 3REOA 1XDSA 1TW3A 4UUVA 1ON2A 1FSHA 3CJNA 4U0VA 2J5OA 1ZYRF 5CJ9A 2DPDA 4EV0A 4BQAA 3TO9A 3FZVA 2Z3YA 1Z05A 3OOPA 2D1VA 4NQWA 4ESFA 2XKPA 1R5HA 4ON0A 4LLGF 1EV7A 3CTAA 5H6QA 1V3FA 5FLXK 1XDUA 3FM3A 4KN4X 1U2WA 2GXBA 4N0BA 1TTYA 1T2KA 5E8IA 4ZYHA 4G6DA 2JTVA 2L54A 4IJAA 2BV6A 5LEJA 1HKQA 2XRNA 4OIRF 3GF2A 5D5XB 3J80K 3F8MA 1C0WA 4I01A 3S2WA 1K7AA 4I0AA 2DK8A 5EEHA 4RGXA 5L3DA 4UXNA 2YPRA 5HDKA 2Q8KA 3EETA 1B6AA 3WODF 4A0ZA 2FQ3A 4LMYA 2ZXJA 3FM5A 3RKYA 2GIVA 3F6OA 4UVBA 3ABTA 4Y15A 1UHWA 3H92A 3I0TA 2OD5A 2ZBKA 1ZG1A 2OQRA 4OOIA 2DI3A 1HQCA 3K2ZA 3B73A 3P9KA 1RZ4A 1KQ0A 1P6RA 3E6DA 5DEQA 4PGGA 1TLHB 4U7DA 4IPAA 3BJAA 2PMHA 3WGHA 1ZRDA 4EM0B 2MH2A 4CHUA 5HOOA 2QBYB 1XSDA 3LWFA 1BIBA 4I98B 3HSFA 2VC1A 3ZMSA 3T5XA 2CSOA 5HDNA 1DDNA 5FFXA 2RC4A 3F21A 2FF4A 3MAJA 3F8FA 1FSEA 5J8FA 3M7GA 2CG4A 5A2QK 1J75A 2CGPA 4KFCA 4A5MA 1R1UA 5FD5A 2DBBA 5LLQA 5LRRA 2QM3A 3VFZA 1J2XA 1U8RA 4YIIA 3CDHA 2PMUA 2Z9OA 2P5KA 3GO5A 1XGMA 5D5UB 5K5OA 1EH6A 1I1GA 3GFJA 1KA8A 4QWQA 3DFGA 4M9SA 2PFBA 4N9HA 1I5ZA 3SZPA 1MJBA 1W7PA 1BBYA 2PEXA 4EJOA 5ICFA 5L3FA 4IRIA 3E6CC 1IXCA 1L0OC 2WWYA 2CYYA 2FBKA 1QZZA 2XV4S 3TOAA 1ZREA 3KP2A 2X4HA 1ZLJA 3L2CA 4HX7A 2D1HA 1G3TA 3SXYA 5BOXA 2WC2A 4HV5A 4RAYA 1WRJA 5CVVA 2E7WA 3MCZA 4U0WA 3LSTA 1KYZA 1YQAA 2FBHA 2VXZA 1FYLA 1R1TA 4GYGA 3GXOA 4Q4ZF 3RYPA 3F3XA 1LDJA 4OIOF 4RB1A 2KJCA 4Y17A 2GA2A 4P5OA 1T98A 5HS9A 4BYYA 4IRHA 5D4RA 4XLNF 3BJ6A 3WGGA 1SAXA 4ZYEA 2QWWA 1RNLA 5KVRA 5IT3A 1LDKB 1STZA 1O3RA 2XAQA 1IRFA 2F5DA 2OAZA 3CUQB 2WV0A 4EGYA 2HZTA 1SD7A 4LK0F 1ON1A 3HRUA 3KETA 5BS6A 2M8EA 4IF4A 1WWXA 4G7ZF 1UCRA 3HIFA 1UB9A 2DK5A 3V8JA 1I6XA 3FF5A 4EJUA 4EJTA 3BDDA 2YR2A 4WXHA 3WTXC 1ONVA 3GWZA 3MWMA 1XGSA 1ZG5A 3WG9A 2JRTA 5E1XA 2VE8A
chains in the Genus database with same CATH superfamily
4E7JA 3CQZJ 1WJAA 3LSHA 1ETYA 3FXOA 5DCMB 2BOLA 3DKWA 2L9RA 4HQEA 3LNQA 1Z6TA 4FX0A 3EUHC 2QQBA 2ZXWH 5EZGA 3PIOF 2W24A 3IAS2 1Z9CA 3Q3SA 2R7FA 4MEXF 1FZPB 1WZ2A 2R92J 4B09A 1KONA 1IN5A 2OA4A 2QSFX 2LBFA 2CQXA 3G1MA 2V79A 3KP7A 3OIPA 2ZMEB 4BBRJ 1ZN2A 2IT0A 4E7SA 2IPQX 2X6YA 3PNTA 1J0RA 2GWRA 2HWVA 4MGRA 3VEPA 2QKLB 3MKYB 3T8TA 3U1DA 4IVNA 2XGDA 2VL8A 3HSEA 3JSPA 2QENA 1N77A 3K4CA 3BQYA 1RUOA 4M73A 2ESHA 5H2FC 4ENNA 5B1BH 3PIPF 4GO1A 3T1BA 3PQJA 1O3TA 1BJAA 2CQKA 4AIDA 3P9CA 4HEA2 4EGZA 2A69F 4AYBA 3ZRGA 2M3AA 1RUNA 3R0JA 3GTQJ 1T33A 2EILH 3J7YJ 1J5YA 2IA0A 2VB6A 2CRGA 1G3SA 2O5RA 2W25A 2R7UA 2BY2A 3I54A 1QHHD 1DPRA 1OQYA 1TQMA 3L9FA 3GBGA 1F5TA 3TKYA 3E3VA 2JZYA 2R3SA 1PP8F 4HZFA 5EGOB 4AIHA 5M3MJ 1YS6A 3JSOA 2P7CB 4BL0B 1PYVA 3BP8A 3HGYA 2CW0F 1WQ2A 1SANA 4K2EA 1B8IB 3ESWB 5F6FA 3OYLA 2LFBA 3A01B 3K1MA 3DPLC 2LF8A 1E3OC 1A04A 5IYDJ 4RB2C 1PP7U 3TDZC 3FK6A 2QLZA 3SJMA 5B66C 4XORA 3C18A 5JR3A 4QTRA 2XGXA 4RA2A 1Z91A 1EH8A 4EMSA 3NQOA 1TWGJ 2DAOA 3OYJA 1HF0A 3HOUJ 4MNUA 1MMGA 2L7MP 1V4RA 3KP3A 4BHPA 2HGCA 2XC7A 4XOTA 4G7HF 2DU9A 5IOYA 5DYMA 5GADJ 2CFXA 3FMSA 5EF6A 2LY9A 4ZTJA 3F8BA 1FYMA 3GMEA 1IAWA 4ENJA 1JHHA 3LAPA 5DD8A 2Z5UA 3VB2A 5E8GA 2JWTA 5HLIA 2QKMB 4IL6C 4QPQA 3TP3A 1OJLA 5KK1A 1MMNA 4C2UA 4L9VA 1IDYA 3BR5A 2MC4A 2IBDA 3ZQIA 1HXDA 3W3CA 3ZMVA 4BJTA 5BPDA 3DP7A 1HDPA 2K27A 1MBHA 4CCOA 4A3FJ 4FHTA 2X6OA 1T38A 5FB2A 2YSRA 1IN4A 2BZTA 1TWFJ 1QVTA 3MFKA 5J1RA 3M3YJ 4EVIA 1IXRC 2DMNA 3K4LA 3DU5A 3PFYA 3KE2A 5DDGA 3KEOA 2JMWA 3BG9A 3ZMUA 5B3SH 2M45A 1GVJA 2DOFA 1U78A 4HNTA 1BI1A 5H20A 2FBIA 3G1OA 5FKNA 2V26A 1ZELA 2WAEA 3D1NI 1G6NA 2MLGA 3ZPLA 3R0AA 4XOPA 1XTAA 3CUOA 2OC6A 2JPCA 2NYXA 1L3LA 2WAFA 5HDGA 3FISA 4EM2A 3C3WA 3NEUA 3P5JA 3OYGA 3B02A 3OR2C 2IXSA 2GBYA 2HQ5A 1JKOC 2K4BA 2QF7A 5EEGA 2L2OA 1WJFA 5FLVA 2HQAA 1MSEC 3H5RA 1LB2A 1TT5B 3CMMA 3MKWB 3IRRA 4CYDA 1XCVA 3WE2A 4IRGA 3MN2A 2IEKA 5JLWA 2ZJRF 2WAQA 1GLNA 3LOCA 3BG5A 4ETSA 1LE8B 1Y8QB 2A5WA 4CZZA 1K6OA 2FE3A 3GFLA 2EFWA 3WU1B 4LD5A 2XROA 3M8FA 2K86A 1W7PB 3I71A 2NOGA 2P5VA 4HG2A 3RIRA 1FY7A 1QRYA 4WXCA 2HKOA 4C9YA 3U21A 3JRCA 1HC8A 1O7FA 1X3UA 4FE4A 4LG0B 3WTSC 4HW0A 2DTRA 4XL9A 1S7AA 4EQQA 3IAM2 2JVHA 2GQQA 1KU3A 4XMYA 1KGSA 1VQKI 1ZRFA 4ESBA 2E60A 4CYCB 3T0YA 4QSHA 2VC0A 5ICCA 1W7PD 3LMMA 3O8GA 3OL3A 4PFOA 2LC2A 4BXFA 4D5FA 3CCYA 5DUKA 3JAMZ 1U5TB 2QSGX 1WHUA 2DT6A 1O3QA 4PK4A 5JFRA 2BXYA 2DPUA 2Z2SB 1MMSA 4A5NA 3E1SA 4KMFA 3MMYB 2JQ7A 2JT1A 2BYVE 3BTIA 5LHGA 4HA8A 5LRSA 3F9KA 3ASNH 5K7ZA 1HDDC 2GXAA 4HRIA 2NNNA 4L18B 1QPMA 4N4NB 4ZZLA 1R1VA 2E36A 1BC7C 3A4CA 2VKHA 3E5QA 5LEKA 3BPVA 2VN2A 3G4SI 3HTSB 1JUPA 3RQ4A 2RREA 1AU7A 4MTEA 4UUSB 5C3EJ 5D5VB 2LDUA 4ZJZA 4LGWA 1IN8A 4J00A 1W36C 4F7ZA 3WHCA 3JRGA 1N75A 5J40A 5GTHC 1ZGJA 3H1CA 2EV5A 3O8HA 5IT9K 1E3HA 1N78A 4A6DA 4ZZDA 3RTRA 4XQFA 1POGA 1R00A 2BY3A 5ICEA 5LHIA 2NS7A 3SEQA 2IA1A 2X85A 1Y0UA 1KU2A 1YTYA 5B5EC 2BXZA 4IZZA 1K78A 3TEDA 5D8KB 1JKPC 3GZ5A 1IRGA 1U6GA 4NB5A 2KIFA 2PJRA 2Y75A 2Z16A 3TW6A 4IHYA 2H6BA 4XIDA 2KJBA 2HQNA 3GCMA 2OZ6A 2QSHX 4CCKA 3QU3A 4LG0A 3L7WA 5DTDA 4F3QA 1R49A 1ERDA 3Q9SA 1MDMA 2ZFUA 1VQOI 3H0GJ 4CYCA 1Q1HA 3JTHA 4GRIA 5ED4A 3HGGA 1B4AA 3G71I 3E0JB 2CUZA 3LFKA 3GFIA 2XKOA 3KEYA 4KYWA 2ZXHA 1SFOJ 1TC3C 2A6TA 2UWMA 3LAJA 4HV6A 2UXXA 1RETA 1HKTA 2VT3A 1QHGA 2YU3A 3IHUA 4PSXA 3JR9A 4WK8F 1YO5C 1ZK8A 1F4KA 3KP5A 4M3FA 4PJLA 4DYQA 2L02A 2Q2EB 3W6JB 2NNYA 4LFUA 3CMYA 2KIUA 1F1ZA 3GVAA 2FSWA 4W97A 1BOAA 4I76A 4CGZA 2Q0OA 1LVKA 2G7HA 3HTUA 1A6QA 2E7XA 2PMZN 3CMAI 3WTUC 1FC3A 4AVPA 2O3FA 5TJJA 4E7IA 3ZMTA 1ZGWA 3FXLA 4IEJA 2UV1A 2BW3B 2B7EA 5CVIA 5CYVA 2WA0A 5DV5A 3SDGA 1D0XA 2ZFWA 3OV8A 2ZSHB 3TO6A 1DP3A 4ABZA 2NVQJ 4RS8A 5K7HA 3F0CA 2M34A 4FISA 5EYRA 1BR4A 3MQ0A 1HA8A 1XC5A 1WI3A 5LBQA 5F1JA 3SZTA 2GOMA 3KLNA 4P96A 5J1YA 4GFBA 4I6ZA 3VYTB 4HDVA 4Q47A 4FETA 1DUXC 3S17J 5HS7A 2Z33A 1USSA 4ZYDA 2R7TA 1E17A 3G1LA 1KU9A 3I64A 2IW5A 1IC8A 4S04A 3GZNB 4YEJA 5D6FA 3QPHA 1P4AA 1Z1DA 2F6CA 2NXNB 3BG7A 3CO6C 3HUGA 2DA4A 2LF7A 3RCOA 1G3YA 2V9VA 2ELHA 3OYDA 4OINF 4JK1X 1ODDA 5BMZA 4A3JJ 2M5WA 1B1BA 4B44A 2VBYA 5E3LA 4ESJA 2F5VA 2MFZA 2WB1N 4HF0A 2VODA 5E3OA 4U88A 3QU6A 5EDNA 1X2MA 1PDNC 4XR6A 4V2FA 1E2XA 4UV8A 5DD4A 4IX7A 2CFOA 2EB7A 3BWGA 1P92A 4RLQA 3BZCA 2HDDA 1W4MA 1FOXA 2DFFA 4E7LA 1D5VA 2QUFA 4QPOA 4WXDA 5HODA 2L7ZA 1UAAA 3EYIA 2G9WA 2R7VA 1MH3A 3S1NJ 3WG7H 3J7ZI 2DW4A 4KICA 1S7OA 1J59A 1A36A 2OU2A 3HOXJ 2F4IA 3Q0VA 3QWLA 4RB0A 3P7NA 3R6SA 5CQEA 2VQCA 5ILSA 3GW2A 2W4SA 4H0EA 1IUYA 4LJZF 1XB4A 3FMQA 3RPUA 4L0YB 3IKTA 2NVTJ 4YFKF 2YX4A 2A05A 3DQVC 2H8RA 1WFXA 1HSTA 3E5UA 3LQRA 2X0LA 2YUSA 2MSYA 1VQ6I 2EFQA 2K9NA 2P7VB 4NC7A 2MG4A 3CF2A 5GPCA 3E6BA 2EZHA 1OR7A 1FJLA 4C3IJ 1HW5A 3TOBA 3VPRA 1D3YA 2YS9A 4PJNA 2I5UA 1XMXA 3HHHA 1IO2A 4NUBA 1JTXA 5FKMA 1FOYA 2V1DA 3TGNA 2F4MB 1SMTA 5IPAA 2VBXA 3C1DA 3O6BB 2Z1DA 4UY8I 4GCVA 1LEAA 3S3OA 1MH4A 1G2HA 2E5NA 4O5VA 3CD6I 5LGUA 5IP6A 1O3SA 2LKXA 1CQTA 3HRTA 5D4SA 2IGMA 1SVOA 4RGRA 2M7BA 4XSZF 4CCMA 3AG2H 2RN7A 3F23A 2KIMA 4KT5C 3H0DA 3LSGA 3TQNA 3MZYA 4G9YA 1HLVA 4WX9A 3ZQQA 5FLXZ 1ULYA 4CUGA 2OZUA 3OS2A 3W6KB 5F0HA 4A3DJ 1H0MA 1MJ9A 2JRMA 2QA4I 1KQ8A 3IH3A 4M6XA 2ELJA 3AFHA 4KMUX 3BY6A 1N25A 2LBFB 1HCRA 4CZCA 2VOOA 1TWCJ 1USTA 1VQ9I 1RR8C 3HYIA 2V6CA 4LK1F 3HBLA 4OMYA 1IGNA 2LVSA 2E2IJ 4ASNA 3N97A 3FHZA 1Y1WJ 2E71A 1D1CA 1FIAA 2K9SA 2JVGA 5J3LA 4E4HA 2A68F 3Q0WA 3GX4X 2K02A 4P55A 4IHTA 4KITB 2CUJA 2PI0A 2M2EA 2KQRA 3O2PE 4BXUA 1OCCH 3I5UA 5F08A 2NVUB 4B8XA 2XSDC 4PDKA 3I55I 4AC0A 4E7KA 3DXJF 2EPFA 4YIFA 2NRAC 2FNAA 4BS9A 3ZQHA 2D5VA 4TV7A 2FD5A 4R1HA 3K0LA 2LNBA 3IL2A 4BNCA 1S72I 2GIZA 3QPLA 1SFUA 5CVRA 3BZKA 2ZMEC 3ZP5A 1ZARA 2IS2A 4BHBA 2XDVA 4D9JA 2R5ZA 4RAGA 4R79A 3CCEI 2HQRA 4M3GA 1R4NB 1YW7A 4BQQA 3FKIJ 1X1PA 3OSGA 1P7IA 1X19A 4XN3A 3J7AO 2IVMA 5K1YA 2OV7A 1ZHFA 5CKTA 1MGTA 2JN6A 4DNCA 3HB9A 1CF7B 3KFWX 5C4JJ 3I4NJ 2IJLA 3TBIA 2IS6A 3ELKA 2D45A 1VQ8I 2FMYA 2HXOA 2XGCA 5J6XA 4MTDA 3NRVA 3RZOJ 1V55H 2MC3A 2F5FA 4EEFG 1BL0A 2VIXA 3V8KA 1A5JA 4ITVA 2BY0A 4N9IA 2VE9A 1U5TC 4AWXB 3TDUC 3SYTA 2FOKA 3IWZA 3W2WA 5KCMA 1NH3A 2E2HJ 3ZOBA 1FBQA 2H09A 3RPQA 2EIJH 2OQGA 1E0EA 2BEOA 3LSKA 2WAQN 5M5XJ 4KISA 1LEBA 5D5WB 4PJ0C 3J81Z 1YI2I 2STTA 4OU0A 1R22A 2EIMH 3HOTA 2W82A 2XAHA 2ISZA 5FROA 4FE7A 2FOWA 2EA2A 5LD2C 2GOXB 4J19A 4C30A 4A3BJ 1FX7A 1YLFA 4ENKA 4A0YA 1REPC 4D0PA 3R60A 2R7DA 5JHUA 3W2AA 1MMDA 4ZYAA 3MVPA 1XGNA 3AG3H 2M0CA 2DO7A 3PNVA 2EQRA 3PUFA 3FKJA 3H9GA 3ZMDA 2KKOA 2V1NA 4XLCA 3U9GA 2STWA 2K7LA 3DEUA 3L2WA 1FMWA 2L0KA 3HEFA 3OSFA 2XB5A 1Z3YA 2EFNA 5EJCA 1T0FA 1ZG3A 2HVQA 4YFNF 1DPUA 1U0JA 1SD6A 3FIWA 3OYIA 4YG2F 1XPXA 3WTWC 4LOCA 2C6YA 2RQQA 1UZCA 2CQ7A 2LY1A 3S1QJ 3ABUA 1NK3P 1WJCA 3CCLI 5E3NA 5DCFA 3K1NA 2GLOA 3VSKA 2A6EF 2CMPA 1HSJA 3F72A 3VOEA 5M3FJ 4P1WA 3HDDA 4DBQA 2A6HF 1R58A 2Y69H 3I59B 2K85A 1FLIA 4A3LJ 1U3EM 2ADUA 4A3MJ 3GTPJ 3K7AJ 2J5PA 4BHCA 2CV0A 2LR8A 1MBFA 4ZC3A 1UHSA 4M3DA 2P0WA 4I09A 3IWFA 2DCEA 2DT7B 4BU2A 1WKMA 3BROA 5AIQA 2ZKZA 1YX3A 2ECCA 3K9TA 4XSXF 2XHKA 3OS0A 3CJQB 2VPLA 1Y0NA 4BE1A 2FX0A 5GPAA 2RNGA 3GEZA 2PLYA 2VKDA 4PCQA 4HF2A 1FMVA 4A93J 1IV6A 4BJ5C 4M71A 3DWLE 2KHMA 3WU0A 1YG2A 3JRFA 4UHTA 2ME6A 1U5TA 3HOWJ 1QVUA 4M6YA 3G73A 3HRMA 1IUFA 3IKVA 3VYRB 3HL2A 1AKHA 2O6GE 4BACA 3KEQA 4EM1A 3RSNA 1WSUA 4EJVA 1YIOA 3OYNA 1P4WA 1F9NA 2KFDA 5JHFA 5K5QA 3HRSA 1I27A 2E1CA 3H5AA 1LPQA 4IHXA 1K79A 1T56A 4A0XA 4M6VA 2HYFA 3L2UA 4IHSA 4GGGA 3VWBA 1R4MB 3H3UA 2MD0A 2O8XA 2M30A 3K70D 3JRDA 3DKYA 2GZWA 2X51A 2VQLA 4KN7X 2Q2EA 4B48A 3IH2A 3R61A 4XN0A 1LFBA 3GFMA 2BE5F 1W5TA 3DU6A 4A3KJ 4HBLA 1RESA 3OYMA 5HS8A 4H4KC 4XK4A 2ZO4A 4PFPA 1ZR4A 4YELA 2EV0A 2LH9A 4XRSA 2FXAA 3ZN0A 4KT6A 1IW7F 1W0TA 2ETHA 3VSLA 3IP4B 5E20A 1FT9A 1S9HA 2L7KA 3F22A 1EF4A 2EFOA 4QIWN 3WE3A 5ILUA 2V9KA 2G7UA 3I58A 2FMLA 2TCTA 1X3ZB 1Z7UA 1X4OA 2BBYA 4DYRA 4LB6B 1JI8A 2VJ4A 1BI2A 1ZQ3P 2VT2A 4F92B 2XPWA 3JW4A 4OIPF 3HKZN 3AL0C 2AXTC 4IXAA 4M72A 2YU9J 3FXQA 1Z77A 4GDFA 2DQLA 2P4WA 2CO5A 3L09A 6PAXA 4MEYF 2ZSIB 1MSFC 3WTTC 1D8KA 4M9ZA 4CA0A 3GTKJ 4U0YA 3NWSA 5L3BA 2Y48A 2AHQA 4JQFA 4O6JA 1U8BA 3D5RC 3F6VA 3JAMK 1Y1VJ 1Z3XA 1HKSA 1GXQA 1SFXA 2KZVA 4HSRA 4DYCA 3CCRI 2EINH 3VODA 3KYLA 2RNJA 3RKQA 2KLOA 4L9TA 5HLHA 2JSCA 3DLLF 2HKXA 4A69C 1O57A 2CW8A 1HBXG 1IRXA 3KP6A 3BCAA 2PQ8A 4HYEA 4FTHA 4M9XA 3GYHX 2OTLI 3W2VA 2H1KA 4A3GJ 2L3DA 2FNPA 3PSFA 4UUSA 5BQTA 2EFPA 3Q5FA 2ZCWA 3DBLB 3OYEA 3CC2I 3WU2C 2CW7A 4XICA 2K5CA 4XLEA 2VJIA 5LHHA 5FGMA 2BHZA 4Y7NJ 1A35A 1SD4A 4NC8A 2IGKA 2E5ZA 1T0FC 2CU7A 2TRTA 4UNOA 2LRDA 2ZNYA 2DFHA 3HKZA 2VOPA 1KQ9A 5EG0B 1ACIA 2HR3A 5ICGA 1OPCA 2EWNA 3LSMA 4BAYA 2HTJA 3A0BC 1YHQI 2Y0MA 4O3MA 3KZZA 3CO7C 1PUFA 4I2OA 2F5CA 2JK3A 5J8CA 5DUIA 3L1PA 4BH9A 3I4MJ 4BKXA 2KMUA 2FUG2 5JVGF 4KIFA 9ANTA 1FP2A 1LVAA 1OYYA 2LD5A 3D5SC 1MZBA 2XAJA 4X0GA 4XKWA 1OLTA 2DOEA 4D7MA 4OWRB 2V7FA 1WCMJ 2PMZA 3U1KA 3WGIA 1IXSB 1X4PA 2CQQA 2RV8A 5CVJA 4L9JA 4Z2YA 3BG6A 3LA2A 1YE9A 3NAUA 4B47A 1GHCA 4DBRA 2FRHA 1APLC 3PL8A 4XLPF 3DBHB 1TL8A 2DN0A 3DTKA 1X58A 2BVLA 1NG6A 3CF5F 2KP6A 4RBOA 3CDIA 2DFIA 3BLYA 1QNTA 2DODA 2M0MA 2UXNA 1S8NA 1D0YA 1Z67A 2QCOA 2F2EA 4PUSA 4HLYA 1G59A 3GTGJ 1UG0A 2LK2A 1QA6A 4F52A 5AIPA 3FXJA 2M1BA 2LOOA 4C2MJ 2W48A 3I3LA 1QZYA 3FXUA 3I9V2 2LKPA 3EUAA 2KRFA 3ROUA 2JPBA 2ZMEA 1JKRC 3P9IA 4GXOA 4JX6A 1JJ8C 3PFIA 3OYHA 2RDPA 2E2JJ 2GAUA 3DEEA 3OYFA 3RPUD 3CCQI 3OY9A 4FX4A 3PNYA 4GYIA 1GV5A 2MA3A 3GUDA 5JLXA 5F1RA 4V19K 2V1UA 2ACJA 3K69A 3FXRA 3BJOA 1O4XA 4CXFA 4Q48A 4E7ZA 3HM5A 3IRQA 4C2TA 2COMA 4CDGA 5J4VA 2XB0X 4NHJA 2FQ4A 3RQIA 4HF1A 1D8JA 1B9NA 3L00A 2NS0A 1TWHJ 1ZKGA 2B0LA 1ZR2A 1IG7A 2VBWA 1EH7A 2DOAA 4UVAA 4R8HA 3SDBA 4RDUA 3FWEA 3JTGA 1YRNA 2DA6A 1U9OA 4MFDA 3V7RA 1BJZA 3FXMA 4BDYA 1YJNI 1GXPA 4HX4A 4JYKA 4MIMA 2DLLA 4UUTA 2QVOA 1WPKA 2TDXA 2D2WA 3ECOA 3T8RA 2KPMA 2O7OA 2QQAA 3SQNA 1S29A 1ZGAA 2G0EA 4HAMA 2A61A 2Z99A 3ISPA 2DMTA 2FEZA 3G3ZA 2R7WA 1H9TA 4OIQF 1DU0A 2JSPA 3Q9VA 1YYVA 1KU7A 1ITYA 2Y31A 3HJEA 4X6AJ 4OMZA 1HW2A 3BOQA 5LGTA 2P81A 3AAFA 3AG1H 1K83J 2HTSA 3J80Z 3S2HJ 5K5RA 3CC7I 1JUMA 2OBPA 3ECHA 3SZGA 2AXLA 2IAIA 4WF2A 3L2QA 2WBMA 2O8KA 3WTZA 5AONA 2JA6J 2GXGA 4YRVA 3BZ6A 2XPVA 1XMKA 2WY7Q 3E6MA 1FOWA 3VYUB 3CCJI 3ZQFA 1FOKA 1O7LA 5M5YJ 4XM3A 1EKEA 1S5LC 4LB5A 1OR7C 1AWCA 3HOSA 1J9IA 5HNHA 3GZ6A 3N4MA 1FNNA 1Y56A 2ZNZA 4ENMA 2V6EA 3D0SA 4QLCU 4A6EA 4XBFA 5FKOA 1FPQA 4BGDA 4MQVA 3EYYA 5E18F 2HXIA 2HYGD 4A12A 1K61A 2RKHA 5H6RA 1YS7A 3ABKH 3AL0B 3BTJA 2BY1A 1B9MA 1KZHA 3LA7A 2PJPA 2ELKA 2PN6A 1MJAA 1WVRA 1IV8A 2AS5F 1OISA 2ISYA 1T08B 5BPIA 2ZC2A 3RKWA 4AD9A 3I56I 3DCFA 2O03A 2O0YA 2RGVA 3K1PA 1DQUA 2OCEA 1OCZH 3DLAA 2LLKA 4RGUA 3ZQGA 2MH9A 4Z6YA 2OJED 2MYSA 1BM9A 3FMRA 1X1AA 3K4NA 1W0UA 2EBIA 4BJ6C 2XUBA 3H35A 2XAGA 3S93A 1GT0C 1TBXA 1S6LA 4B4CA 1EA3A 1A31A 1QO0D 3BTLA 4HX8A 4NBQA 1B72A 1FBSA 2HEOA 2HNHA 3LQQA 4RGSA 2L9NA 3EDPA 2XVCA 5CPRB 5E17F 3N05A 3MEXA 1SFEA 4L0ZB 3COAC 2H27A 4IOCF 2L4MA 3S32A 3A1YA 3F8NA 1I39A 3ERMA 5DCMA 1XG1A 1RR7A 4XLHA 4LLNA 1FP1D 2OTJI 1JXSA 2EA4A 2DQRA 5CLSA 3V42A 5K7FA 4RMNA 4X1EA 1IF1A 4M74A 1QU3A 4BEHB 1VTNC 5A2QZ 4MLOA 2ZXIA 5D6EA 5C44J 4BY7J 1LQ1A 3K4MA 1YOVB 3DEWA 2HVRA 5FO5A 3OIOA 1XX5A 1TNSA 2CWEA 4D7NA 3S14J 3B6AA 2VJJA 1BR1A 3E5XA 2IRFG 2OUMA 1DP7P 1BN5A 2EH3A 2E1NA 1JGGA 3CP2A 4JBAA 1UFMA 3V8LA 3BT9A 3L2RA 3WTVC 1T6SA 2JA2A 5HVQC 2W85A 3MKLA 3ERED 4KIBA 5TRDA 1IN7A 2HPIA 3GLLA 3I4PA 1ZRCA 3CZ6A 4HSTA 4M3EA 2EJRA 5J47A 2R5YA 2VQGA 2LG4A 3RYRA 4AM3A 4RLFA 3M9AA 1H8AC 3DF8A 1FBUA 1ORKA 2L01A 2BW3A 3QOEA 2R7RA 3C2HA 4HDUA 3JRIA 4BXXJ 3TW7A 5E79C 1VF9A 2XASA 4LIVA 3V7CA 4A3IJ 5F0FA 1NHAA 2LKSA 2RQPA 4AIJA 3DKXA 4UVCA 4Y3OA 4YFXF 3C7JA 3QP6A 4FQGA 3CMEI 3TO7A 2H6CA 4UV9A 4ZYGA 1FIPA 2PG4A 3ZGKA 4HPQA 1DGWY 4JP0A 3MKZA 1ZAOA 2V1XA 2F4OB 1UHMA 4RAZA 5JVTA 3LFUA 2R4GA 2GA1A 1R5GA 3DBRB 1DU6A 2WADA 1LNWA 4HQMA 1PVEA 4KUMA 5GAEJ 2NAZA 4IOAF 2FJ1A 2XIGA 2I8DA 3CLQA 2R93J 3HZJA 4PJJA 1R6RA 1IDZA 2R7OA 2K3FA 1W36D 3BPXA 1SVLA 3CUQC 5LFAA 1QGPA 1NG7A 2QYOA 4RM3A 3BR6A 1JJ6C 2A5YB 5L3EA 4I0BA 1V5EA 1I6HJ 1AOYA 3NARA 1PJRA 5DM6F 4P9UA 3K10A 3ZQ7A 3ZN1A 2NVXJ 1W1WE 2A07F 1XGOA 1MKMA 3QYFA 1W5SA 4F55A 2RVCA 5LGNA 1R7JA 4FT8A 4WWCA 2K40A 3OYAA 1BC8C 3J81K 2W00A 3OYCA 1VZ0A 1YW9A 4L5EA 4ANJA 3W6VA 2JA8J 4V2GA 1VQNI 1ETOA 1PUEE 1Z6RA 3BR3A 2I10A 1TNTA 2HI3A 3KX2A 1J7KA 3RI4A 3QYEA 3CLOA 1EJ9A 4EJWA 2X9DA 1SD5A 1HOMA 3M8EA 3OIQA 3LSJA 3HOVJ 4E7HA 1RC9A 4E70A 1SMYF 3MZHA 2E35A 2VPRA 4XKBA 4OAZA 1RKWA 1YIJI 2ESNA 3TL4X 1UG2A 2Y0SN 4XRSG 1HW1A 3GTJJ 4BQNA 4Y13A 1K78B 4IKFA 3FBNB 3ZMZA 2QQ9A 4ZH4F 2M87A 3QOPA 4W1UA 4KNYA 2K4JA 5JI6A 3V4GA 1LDDA 3QPTA 2VKVA 1MNDA 2XAFA 2WY8Q 3WTYC 1JE8A 3MD2A 4A3EJ 3S16J 2F5EA 2KIQA 3S3MA 2F48A 4RB3C 1OYIA 1MDMB 2R5ZB 1D1BA 2O9LA 2EK5A 3H3ZA 2KL4A 1YX5A 4U7BA 4CO8A 2IA2A 3HG9A 1ZTRA 4BBSJ 3CJRB 1I1SA 1K6YA 1R23A 2DA1A 3A0HC 1XSXA 1B59A 3I53A 1ENHA 2VASA 4D1QA 3EQLF 2HOEA 2Y9ZA 5CVUA 4S0HB 3K2AA 5HLGA 1T8IA 4DQ2A 1AKHB 3PQKA 3IC7A 3S2DJ 2HYJA 3M1EA 3KP4A 4CICA 4FASD 5J1UA 2A3SA 2YX7A 2ECBA 1BIAA 1OCTC 1FEXA 1X2NA 3UNGC 1XD7A 4XRFA 1P4XA 1TQPA 1FWZA 5L3GA 3RZDJ 5IT9Z 2HFHA 2W84A 5F0CA 1MMAA 1G3WA 4A3CJ 2AQEA 3D5LA 2W7NA 4MQ9F 5FJ8J 3QRFF 1S3JA 3A01A 2P6SA 4L9NA 1CGPA 2DT5A 1BW5A 2QGUA 5EZHA 1LJ9A 4MHGA 1G4DA 2LP0A 2CS3A 1MBKA 2R5YB 2L4AA 2QBYA 1OYWA 2LSOA 4BUPA 2NS8A 1I50J 3I59A 2DMPA 4C3JJ 1P9QC 1VNDA 2COBA 2P5LC 5KAIC 3GLXA 2X1EA 5D8LB 5M5WJ 4BEHA 3HOYJ 2DYSH 1RIOH 2MABA 1OMIA 2LYCA 3B6CA 4S05A 3DPTA 4XNFA 1WJEA 1VFCA 1P2FA 2AO9A 3KCCA 3EUHA 2KRCA 3G6EI 1BI0A 3SHFA 2V9PA 3A2KA 1WH5A 2QQ8A 1YW8A 2VBZA 2K3PA 1JGSA 4RAFA 4L5IA 1MW7A 1LFUP 2X6XA 3OL4A 4Q5SF 4KA4A 2X48A 2IS4A 1JUSA 1MIJA 3K4KA 4G6QA 4P9FA 4Y33A 2H94A 2PBIA 5GAGJ 3GTMJ 5GP9A 1XCBA 3G2BA 4YIRX 3FX3A 4AUXA 1B8IA 2DXIA 3RKXA 1H9GA 2EV6A 4LIUA 5ERIA 3IH4A 3AG4H 1F36A 4I7HA 2ZB9A 1YFHA 5FFZA 3LA3A 2QEXI 1IN6A 2XGEA 1JT0A 1NTCA 2W57A 2VLAA 1GV2A 1TW2A 3ABLH 2Q1ZB 3E97A 1OCRH 1S7EA 3HSRA 2RAEA 4AIKA 4U87A 2JUCA 4PZJA 2UZKA 1GDTA 2CUFA 1RI7A 1BI3A 3L2VA 3BG3A 5E1WA 2CUEA 4HOBA 3GTOJ 4I02A 2Y0SA 2P6TA 1TQIA 1V5GA 1IZ1A 1W5CC 3S15J 3QAHA 4UB8C 4G7OF 1KYWA 3JREA 2DA2A 4B43A 5ILVA 2HVSA 2ID3A 3U2RA 3E7LA 2HS5A 2FU4A 3IUOA 5L3CA 4WCGA 1H89C 2XAUA 1WI9A 3F8CA 3RDIA 1CF7A 2P8TA 3HHGA 1U9NA 2MBFA 3ML6A 3KZYA 3KYDB 2DJIA 4MO7A 1X1BA 2QZ8A 5FLMJ 3CUQA 4DZPA 3WHBA 3VYSB 5F27A 2DA7A 3H9QA 4G94A 3JRHA 3MZ8A 4PGHA 4LLLA 4M3BA 1WGXA 3ZQCA 1P7JA 3M4OJ 1D1AA 3FXKA 4EATA 1XN7A 3JRBA 1D0ZA 5FD6A 1TP4A 4L5JA 3DTIA 5C4XJ 1MBEA 4F93B 1FYKA 1Z21A 4IO9F 1RRJA 3DV8A 4DW6A 3QODA 3ULQB 4II3A 2N8GA 5J4YA 3KLOA 3QP5A 3R4KA 2DJNA 4CCLA 1ETXA 4KDPA 1IRZA 1R71A 1RPWA 4XRMA 1QZEA 5CQGA 2L5QA 2V4JC 2KRHA 2KT0A 2DA3A 3LSPA 2NVYJ 5E1ZB 4BE2A 1WJBA 1XMAA 2MLKA 3CP8A 4CSWA 5EEAA 3KZIC 2R0QC 4Y4RA 2IGOA 4A2UA 5IP9J 4FCYA 3BR1A 4ZTFA 2WTEA 4KIGA 1RKTA 3RJPA 1QQIA 3S8PA 2BGCA 3JCUC 4XLAA 2VONA 4HLXA 5F64A 1R36A 2E34A 1ZLKA 3O3KA 4D5CA 1XSVA 1QBJA 2E1MC 5IYBJ 4XONA 2VJ5A 4ZDOA 4DZJA 1ETKA 2OF7A 1MD0A 2VXDA 2BVMA 1A6IA 4IQ4A 2MD5A 3V7SA 1OKRA 1JHFA 3DPUA 4G8XA 3K4BA 1B72B 2AQFA 1MNEA 2ZJ2A 3CC4I 2O61A 1OCOH 2KZGA 3SFZA 1ZH5A 1T39A 1R5ID 2IP2A 1T95A 3H5NA 1BW6A 2FA5A 3OOUA 3REOA 3UR3C 4BQOA 2HDCA 3H3VK 1FTZA 1XDSA 2LY2A 3CCUI 2K9QA 1TW3A 2X6WA 4UUVA 1YJ9I 2DTZA 1ON2A 3M8JA 3OYBA 3PO2J 2JA5J 4BE0A 3CJNA 2ZJQF 1FSHA 4LITA 4U0VA 2J5OA 3C2BA 1OCPA 2B9SA 1ZYRF 4AYBN 3CCMI 2L7FP 4G6TB 1BR2A 5CJ9A 2CQNA 2CH0A 2DPDA 1QPIA 4EV0A 4BQAA 3PSIA 3TO9A 3FZVA 2DMQA 2Z3YA 1Z05A 4JX4A 1F43A 1UELB 2HPMA 3OOPA 2D1VA 4NQWA 3ZQLA 4ESFA 2XKPA 1R5HA 4ON0A 4LLGF 3NWTA 1EV7A 1WJDA 3CTAA 3M1CA 2HOAA 5H6QA 2ICWG 1V3FA 5FLXK 4B3XA 4II2A 1VQPI 3SEZA 1XDUA 3FM3A 4KN4X 3PM1A 3A02A 3HUGB 1U2WA 4DIQA 5KHDA 3PO3J 3GTLJ 1VI0A 4UB6C 2GXBA 1LFPA 1TTYA 1Y8RB 3OWTA 4N0BA 2DDBA 3FDYA 1UJ8A 4MFEA 4CCNA 1T2KA 5E8IA 3HPHA 4ZYHA 4G6DA 3ABMH 2JTVA 3CCVI 1WJ5A 2L54A 3K4JA 5GTIC 4IJAA 1LUJB 2BV6A 4I99C 1HKQA 5LEJA 2XRNA 1JT6A 4OIRF 2DDAA 3GF2A 3VDXA 5D5XB 1MNMC 3J80K 3F8MA 1C0WA 1PUFB 1D5YA 1Y6IA 4C3HJ 3H36A 2HOTA 2CV2A 4I01A 3S2WA 1K7AA 4I0AA 2DK8A 5EEHA 3BR0A 4RGXA 5L3DA 4UXNA 2M9HA 3HPGA 1YRNB 2YPRA 1VQ5I 5HDKA 3QQAA 4XLFA 2XRLA 2R7XA 5GAHJ 1MBJA 2Q8KA 4ZDPA 1ETVA 1MBGA 2ME0A 3EETA 1B6AA 3SFIA 2L9VA 1TZLA 3KPHA 4JOMA 3WODF 4CH7A 4A0ZA 1BA5A 2FQ3A 4J01A 4LMYA 2ZXJA 3FM5A 3J7AY 1G8XA 4BDZA 1R9TJ 2L9SA 1X1DA 4N4OB 1VQLI 2B63J 3RKYA 2GIVA 2K9MA 3F6OA 4UVBA 3ABTA 4Y15A 1UHWA 3BTCA 3H92A 3I0TA 2OD5A 1K4TA 2JUGA 5KNLA 1BOBA 2CJJA 4DGWB 3HOZJ 2HDWA 2ZBKA 4NDLA 1ZG1A 2OQRA 4OOIA 2DI3A 3OMYA 2E19A 1HQCA 3CCSI 5TISC 1DGRM 2XSJC 4IHVA 1TWAJ 3K70C 3K2ZA 2EZIA 3B73A 5FRMA 1LKXA 2ZJPF 3P9KA 1RZ4A 1KQ0A 2LREA 1P6RA 3E6DA 5DEQA 1GUUA 1H88C 4PGGA 2EZKA 3KIOA 1SVMA 1TLHB 1JKQC 4U7DA 4IPAA 1OFCX 1TT0A 2WB1A 2E1MB 3BJAA 2PMHA 1UMQA 5HNFA 2K9LA 3WGHA 1ZRDA 1V54H 1Q1VA 2JJ7A 5IYCJ 4EM0B 2MH2A 4CHUA 2ID6A 5HOOA 2QBYB 1XSDA 3LWFA 1BIBA 4I98B 3HSFA 2VC1A 4IQJA 3ZMSA 3T5XA 2PJRB 2CSOA 2VKEA 3BQZA 2EZLA 2KISA 2LTPA 3TMOA 1VQMI 5HDNA 1DDNA 4BY1J 3FHNA 5FFXA 2RC4A 3F21A 2FF4A 3MAJA 4CCJA 3F8FA 1FSEA 2M4GA 3M7GA 5J8FA 2CG4A 3H9JA 5A2QK 5IOZA 1SEUA 1J75A 5FKLA 2CGPA 2R7QA 5EG0A 2E1OA 4KFCA 2Y30A 4AU7A 3HXLA 4A5MA 2HU9A 4HNUA 1R1UA 3QYBA 1VQ7I 5FD5A 5F04A 2DBBA 5LLQA 3LSIA 2EIKH 1X3WB 5LRRA 2QM3A 3IV5A 3VFZA 3ASOH 1J09A 2MW8A 2DA5A 2OCCH 1J2XA 4AVZA 3EUKL 4YIIA 1U8RA 3CDHA 4RM2A 2HOSA 2PMUA 4HNVA 2Z9OA 1AA7A 3AKZA 3GO5A 2P5KA 3JRAA 1XGMA 1I3AA 3S3NA 5D5UB 2CV1A 5K5OA 1EH6A 1I1GA 3FBIB 3GFJA 4PJMA 2M8GX 2JA7J 1KA8A 2H8WA 3DFGA 4QWQA 1SAUA 4M9SA 1YITI 5IP7J 4OAYA 2X1CA 2H1LA 2PFBA 3LL7A 4N9HA 3PUBA 3DTEA 1I5ZA 3SZPA 2W1OA 1MJBA 1W7PA 1BBYA 2PEXA 1XS9A 2GM4A 2DFEA 4EJOA 5ICFA 2WV1A 5L3FA 4IRIA 3E6CC 1IXCA 1I3QJ 3EPZA 1LE8A 3KYCB 3PJRA 4JX5A 4B1RA 1L0OC 2WWYA 2CYYA 5BNGA 3K6GA 4XKCA 2X1DA 2FBKA 1QZZA 1AHDP 2PX9A 3ZR8X 2XV4S 3TOAA 2XF5A 3KP2A 2X4HA 1ZREA 1ZLJA 3L2CA 4HX7A 2D1HA 3OYKA 1GVDA 3QPSA 4F91B 1G3TA 2R7ZJ 1V5FA 3TP0A 3SXYA 2M7AA 5BOXA 2WC2A 3LSRA 4HV5A 4RAYA 1WRJA 2VI6A 2OPTA 2DYRH 5CVVA 2NOJB 4NNJA 3X2QH 4B3AA 1E3PA 2KDOA 2E7WA 5KAFC 2DMUA 3CDLA 3MCZA 4U0WA 3LSTA 2LMDA 1KYZA 1YQAA 2FBHA 2VXZA 3CESA 3Q0UA 3A03A 4NC6A 5FRNA 1FYLA 1R1TA 4GYGA 3GXOA 4Q4ZF 4PSWA 3RYPA 3F3XA 1LDJA 2HZDA 3BC8A 5FKKA 2MGQA 4OIOF 2Y2ZA 4RB1A 2KJCA 4Y17A 3S1MJ 2VUMJ 2GA2A 1FTTA 4P5OA 1T98A 5HS9A 4BYYA 1JTYA 4IRHA 4G12A 2BHYA 5D4RA 5HLTA 4XLNF 5DS9A 2XF7A 3BJ6A 3WGGA 1Y39A 1SAXA 4ZYEA 2XF6A 3UKGA 2QWWA 2UUZA 3OS1A 1RNLA 5KVRA 5IT3A 1IJWC 2R7SA 1LDKB 4E6KG 4KJZA 2M4KA 1STZA 4DOZA 1O3RA 2XAQA 2IS1A 5IY5H 2IGNA 1IRFA 2KDZA 2F5DA 3CUQB 3BCBA 2OAZA 2WV0A 4EGYA 1YJWI 1SC7A 1Z7LA 2HZTA 4XKVA 1SD7A 3M07A 3ZCOA 2Y9YA 4LK0F 5E3MA 1ON1A 3HRUA 3FK7A 3KETA 3S1RJ 1VQ4I 5BS6A 2M8EA 4IF4A 1SFKA 1X1CA 1ETWA 1WWXA 1Z0XA 4G7ZF 1WH7A 1UCRA 3HIFA 5TGTA 1UB9A 3BR2A 2DK5A 3V8JA 3ZXSA 1I6XA 3FF5A 1K4SA 4IHWA 4EJUA 4EJTA 3BDDA 3C2GA 2YR2A 3CJTB 4WXHA 3WTXC 2XPUA 1ONVA 3GWZA 4LG3A 4ZDLA 3OR1C 3MWMA 1XGSA 1ZG5A 4DJAA 3WG9A 2JRTA 4Y52J 5DM7F 2VQHA 4NQWB 5E1XA 5B1AH 3ONQA 3HC7A 1NK2P 2VE8A 1ETQA 5EGOA 1M1EB
chains in the Genus database with same CATH topology
5DCMB 3DKWA 4HQEA 1Z6TA 4FX0A 2QQBA 2W24A 1Z9CA 2R7FA 4MEXF 1FZPB 4B09A 1IN5A 2OA4A 2V79A 3KP7A 2ZMEB 1ZN2A 2IT0A 2IPQX 1J0RA 2GWRA 2HWVA 4MGRA 3VEPA 3T8TA 3U1DA 4IVNA 3HSEA 3JSPA 2QENA 1RUOA 4M73A 2ESHA 4ENNA 4GO1A 3T1BA 3PQJA 1O3TA 1BJAA 2CQKA 3P9CA 4EGZA 2A69F 1RUNA 3R0JA 1J5YA 2IA0A 1G3SA 2W25A 3I54A 1DPRA 1TQMA 3L9FA 1F5TA 3TKYA 3E3VA 2JZYA 2R3SA 1PP8F 4HZFA 4AIHA 1YS6A 3JSOA 2P7CB 3BP8A 2CW0F 1WQ2A 4K2EA 5F6FA 3K1MA 3DPLC 2LF8A 1A04A 4RB2C 1PP7U 3TDZC 2QLZA 3C18A 5JR3A 2XGXA 1Z91A 1EH8A 4EMSA 3NQOA 2DAOA 4MNUA 1V4RA 3KP3A 4BHPA 2HGCA 4G7HF 2DU9A 5DYMA 2CFXA 3FMSA 3F8BA 1FYMA 1IAWA 4ENJA 1JHHA 3LAPA 5DD8A 2Z5UA 3VB2A 5E8GA 5HLIA 5KK1A 4L9VA 1HXDA 3ZMVA 5BPDA 3DP7A 2K27A 4FHTA 1T38A 5FB2A 2YSRA 1IN4A 3MFKA 4EVIA 1IXRC 5DDGA 3KE2A 3KEOA 3ZMUA 2M45A 1GVJA 1U78A 1BI1A 5H20A 2FBIA 1G6NA 2MLGA 3ZPLA 3R0AA 3CUOA 1L3LA 2JPCA 2NYXA 5HDGA 4EM2A 3C3WA 3NEUA 3B02A 2K4BA 5EEGA 1LB2A 3IRRA 4CYDA 1XCVA 3WE2A 4IRGA 4ETSA 1K6OA 4CZZA 2FE3A 3GFLA 2EFWA 3WU1B 4LD5A 2XROA 3M8FA 2K86A 1W7PB 3I71A 2P5VA 3RIRA 1FY7A 4WXCA 2HKOA 1O7FA 1X3UA 4LG0B 3WTSC 4HW0A 2DTRA 1S7AA 4EQQA 2GQQA 1KU3A 1KGSA 1ZRFA 4ESBA 3T0YA 2VC0A 5ICCA 1W7PD 5DUKA 3JAMZ 1U5TB 1O3QA 5JFRA 2DPUA 4A5NA 4KMFA 2JT1A 2BYVE 5LHGA 4HA8A 5LRSA 2NNNA 4L18B 1QPMA 4ZZLA 1R1VA 1BC7C 3E5QA 5LEKA 3BPVA 2VN2A 3HTSB 4MTEA 5D5VB 2LDUA 4LGWA 1IN8A 4F7ZA 1ZGJA 2EV5A 5IT9K 4A6DA 4ZZDA 3RTRA 1R00A 5ICEA 5LHIA 2IA1A 1Y0UA 1KU2A 1YTYA 1K78A 5D8KB 3GZ5A 1IRGA 1U6GA 4NB5A 2KIFA 2Y75A 2H6BA 2KJBA 2HQNA 2OZ6A 3QU3A 4LG0A 3L7WA 3Q9SA 1MDMA 1Q1HA 3JTHA 5ED4A 1B4AA 3LFKA 3GFIA 2XKOA 4KYWA 2UWMA 3LAJA 4HV6A 2UXXA 1HKTA 2VT3A 2YU3A 3IHUA 4WK8F 1YO5C 1F4KA 3KP5A 2L02A 3W6JB 2NNYA 4LFUA 2KIUA 1F1ZA 3GVAA 2FSWA 1BOAA 4CGZA 2Q0OA 2G7HA 3HTUA 2E7XA 3WTUC 1FC3A 4AVPA 2O3FA 5TJJA 3ZMTA 5CVIA 5CYVA 5DV5A 2ZFWA 3OV8A 3TO6A 4RS8A 3MQ0A 5LBQA 3SZTA 3KLNA 4P96A 4HDVA 4Q47A 1DUXC 5HS7A 2Z33A 1USSA 4ZYDA 1E17A 1KU9A 3I64A 2IW5A 4S04A 5D6FA 3QPHA 1P4AA 1Z1DA 3CO6C 3HUGA 2LF7A 1G3YA 2V9VA 2ELHA 4OINF 4JK1X 1ODDA 5BMZA 2M5WA 1B1BA 2VBYA 4ESJA 2VODA 4HF0A 4U88A 3QU6A 1PDNC 1E2XA 4UV8A 5DD4A 2EB7A 3BWGA 1P92A 1W4MA 1D5VA 2QUFA 4WXDA 3EYIA 2G9WA 2DW4A 4KICA 1S7OA 1J59A 2OU2A 4RB0A 3P7NA 3R6SA 5ILSA 3GW2A 4H0EA 1IUYA 4LJZF 1XB4A 3FMQA 3RPUA 4L0YB 3IKTA 4YFKF 2YX4A 3DQVC 1HSTA 3E5UA 3LQRA 2X0LA 2EFQA 2P7VB 3E6BA 1OR7A 1HW5A 3TOBA 1D3YA 3HHHA 2V1DA 3TGNA 1SMTA 2VBXA 3C1DA 3O6BB 4GCVA 1LEAA 4O5VA 5LGUA 1O3SA 3HRTA 5D4SA 4RGRA 4XSZF 2RN7A 3F23A 2KIMA 4KT5C 3TQNA 3MZYA 4G9YA 4WX9A 5FLXZ 1ULYA 2OZUA 3W6KB 1H0MA 1MJ9A 1KQ8A 4M6XA 4KMUX 3BY6A 2VOOA 1USTA 3HYIA 2V6CA 4LK1F 4OMYA 4ASNA 3N97A 3FHZA 2A68F 3GX4X 2K02A 4P55A 4IHTA 2PI0A 3O2PE 4BXUA 3I5UA 4B8XA 4PDKA 3DXJF 4YIFA 2NRAC 2FNAA 4TV7A 4R1HA 3K0LA 2LNBA 3IL2A 4BNCA 1SFUA 5CVRA 3ZP5A 1ZARA 4BHBA 4R79A 2HQRA 1YW7A 3J7AO 2IVMA 5K1YA 1ZHFA 1MGTA 4DNCA 1CF7B 3KFWX 2IJLA 3ELKA 2D45A 2FMYA 5J6XA 4MTDA 3NRVA 2MC3A 2F5FA 3V8KA 4N9IA 2VE9A 1U5TC 4AWXB 3TDUC 2FOKA 3IWZA 1FBQA 2H09A 3RPQA 2OQGA 2BEOA 1LEBA 5D5WB 3J81Z 2STTA 4OU0A 1R22A 3HOTA 2XAHA 2ISZA 2EA2A 1FX7A 1YLFA 4ENKA 4A0YA 1REPC 4D0PA 3R60A 2R7DA 5JHUA 1XGNA 2DO7A 3ZMDA 2KKOA 2STWA 3U9GA 2K7LA 3DEUA 2EFNA 1T0FA 1ZG3A 4YFNF 1DPUA 1SD6A 4YG2F 3WTWC 2C6YA 3ABUA 5DCFA 3K1NA 2A6EF 1HSJA 3F72A 3VOEA 2A6HF 1R58A 3I59B 1FLIA 1U3EM 2ADUA 2J5PA 4BHCA 4I09A 3IWFA 1WKMA 3BROA 5AIQA 2ZKZA 3K9TA 4XSXF 2XHKA 3GEZA 2PLYA 4PCQA 4HF2A 4M71A 3WU0A 1YG2A 4UHTA 1U5TA 4M6YA 3G73A 3HRMA 3IKVA 2O6GE 3KEQA 4EM1A 1WSUA 4EJVA 1YIOA 1P4WA 1F9NA 5K5QA 3HRSA 1I27A 2E1CA 1K79A 4A0XA 2HYFA 4IHSA 4GGGA 3H3UA 2O8XA 2M30A 2GZWA 4KN7X 2Q2EA 3R61A 3GFMA 2BE5F 1W5TA 4HBLA 5HS8A 2ZO4A 2EV0A 2FXAA 3ZN0A 1IW7F 2ETHA 5E20A 1FT9A 3F22A 2EFOA 3WE3A 5ILUA 2G7UA 3I58A 2FMLA 1Z7UA 2BBYA 4LB6B 1BI2A 2VT2A 3JW4A 4OIPF 4IXAA 4M72A 3FXQA 2DQLA 2P4WA 2CO5A 3L09A 6PAXA 4MEYF 3WTTC 1D8KA 4M9ZA 4U0YA 5L3BA 2Y48A 4JQFA 4O6JA 3JAMK 3F6VA 1HKSA 1GXQA 1SFXA 3VODA 2RNJA 4L9TA 5HLHA 2JSCA 2HKXA 1O57A 1HBXG 3KP6A 2PQ8A 4HYEA 4M9XA 3GYHX 2L3DA 2FNPA 5BQTA 2EFPA 3Q5FA 2ZCWA 5LHHA 5FGMA 1SD4A 4UNOA 2ZNYA 2VOPA 1KQ9A 2HR3A 5ICGA 1OPCA 2EWNA 4O3MA 2HTJA 4BAYA 2Y0MA 3KZZA 3CO7C 4I2OA 2F5CA 5J8CA 5DUIA 4BH9A 4KIFA 1FP2A 1LVAA 1OYYA 1MZBA 2XAJA 3WGIA 1IXSB 2RV8A 5CVJA 4L9JA 4Z2YA 3LA2A 1GHCA 2FRHA 4XLPF 2DFIA 1QNTA 1S8NA 4HLYA 2UXNA 2F2EA 5AIPA 2M1BA 1QZYA 3FXUA 2LKPA 2KRFA 3ROUA 2JPBA 2ZMEA 3P9IA 4GXOA 3PFIA 2RDPA 2GAUA 4FX4A 4GYIA 2MA3A 3GUDA 5F1RA 2V1UA 2ACJA 3K69A 3FXRA 3BJOA 4CXFA 4Q48A 3IRQA 2COMA 4CDGA 4NHJA 4HF1A 1D8JA 1B9NA 3L00A 2NS0A 2B0LA 2VBWA 1EH7A 4UVAA 4R8HA 3FWEA 3JTGA 3V7RA 1GXPA 4HX4A 2DLLA 2QVOA 2TDXA 2D2WA 3ECOA 3T8RA 2QQAA 3SQNA 1S29A 1ZGAA 4HAMA 2A61A 2Z99A 3ISPA 2FEZA 3G3ZA 1H9TA 4OIQF 3Q9VA 1YYVA 1KU7A 4OMZA 1HW2A 3BOQA 5LGTA 3AAFA 3J80Z 2HTSA 5K5RA 2OBPA 3ECHA 2AXLA 4WF2A 3WTZA 5AONA 2GXGA 3BZ6A 1XMKA 3E6MA 1FOKA 1O7LA 4LB5A 1AWCA 3HOSA 1J9IA 3GZ6A 3N4MA 1FNNA 2ZNZA 4ENMA 3D0SA 4QLCU 4A6EA 4XBFA 1FPQA 4MQVA 3EYYA 5E18F 2HYGD 4A12A 2RKHA 5H6RA 1YS7A 1B9MA 3LA7A 2PJPA 2PN6A 1MJAA 2AS5F 2ISYA 5BPIA 3RKWA 4AD9A 2O03A 2O0YA 2RGVA 3K1PA 4RGUA 2MH9A 1BM9A 3FMRA 2XUBA 2XAGA 1TBXA 1S6LA 1QO0D 4HX8A 1FBSA 2HEOA 3LQQA 4RGSA 3EDPA 2XVCA 5E17F 3MEXA 1SFEA 4L0ZB 3COAC 2H27A 2L4MA 3F8NA 5DCMA 4LLNA 1FP1D 1JXSA 2EA4A 2DQRA 5CLSA 1IF1A 4M74A 1VTNC 5A2QZ 5D6EA 1LQ1A 5FO5A 1TNSA 2CWEA 3E5XA 2IRFG 1DP7P 1BN5A 2E1NA 4JBAA 1UFMA 3V8LA 3WTVC 1T6SA 5HVQC 2W85A 3ERED 4KIBA 5TRDA 1IN7A 3I4PA 1ZRCA 2EJRA 3RYRA 3M9AA 3DF8A 1FBUA 2L01A 4HDUA 2XASA 3V7CA 1NHAA 2RQPA 4AIJA 4UVCA 4YFXF 3C7JA 3QP6A 3TO7A 2H6CA 4UV9A 4ZYGA 2PG4A 1ZAOA 2V1XA 1UHMA 4RAZA 5JVTA 2GA1A 1R5GA 1LNWA 4HQMA 4KUMA 2NAZA 2XIGA 3BPXA 3CUQC 1QGPA 2QYOA 1AOYA 2A5YB 5L3EA 4I0BA 4P9UA 3ZQ7A 3ZN1A 2A07F 1XGOA 1MKMA 1W5SA 2RVCA 5LGNA 1R7JA 4FT8A 4WWCA 1BC8C 3J81K 1YW9A 1PUEE 1Z6RA 1TNTA 1J7KA 3RI4A 3CLOA 4EJWA 1SD5A 3M8EA 4E70A 1SMYF 3MZHA 2ESNA 1HW1A 4Y13A 1K78B 3ZMZA 2QQ9A 4ZH4F 2M87A 3QOPA 4KNYA 2K4JA 5JI6A 3V4GA 1LDDA 3QPTA 2XAFA 3WTYC 1JE8A 2F5EA 4RB3C 1OYIA 1MDMB 2EK5A 3H3ZA 4U7BA 1I1SA 4CO8A 2IA2A 1R23A 1XSXA 1B59A 3I53A 3EQLF 2HOEA 5CVUA 5HLGA 4DQ2A 3PQKA 3IC7A 3M1EA 3KP4A 4CICA 2A3SA 2YX7A 1BIAA 1XD7A 4XRFA 1P4XA 1TQPA 1FWZA 5L3GA 5IT9Z 2HFHA 2W84A 1G3WA 3D5LA 4MQ9F 3QRFF 1S3JA 2P6SA 4L9NA 1CGPA 2DT5A 1LJ9A 4MHGA 1G4DA 2L4AA 2QBYA 1OYWA 2LSOA 3I59A 2P5LC 3GLXA 5D8LB 1RIOH 1OMIA 4S05A 3DPTA 1P2FA 3KCCA 3EUHA 1BI0A 3SHFA 1YW8A 2VBZA 1JGSA 4L5IA 4Q5SF 4KA4A 4G6QA 4P9FA 2H94A 2PBIA 1XCBA 3FX3A 3RKXA 1H9GA 2EV6A 5ERIA 4I7HA 1YFHA 5FFZA 3LA3A 1IN6A 2W57A 1TW2A 3E97A 3HSRA 4AIKA 4PZJA 2UZKA 1RI7A 1BI3A 5E1WA 4HOBA 4I02A 2P6TA 1TQIA 1IZ1A 3QAHA 4G7OF 1KYWA 5ILVA 3U2RA 2HS5A 2FU4A 5L3CA 4WCGA 1WI9A 3F8CA 3RDIA 1CF7A 2P8TA 3HHGA 2MBFA 3ML6A 3KZYA 2QZ8A 3CUQA 4G94A 4PGHA 4LLLA 1XN7A 5FD6A 4L5JA 1FYKA 3DV8A 3ULQB 3KLOA 3QP5A 3R4KA 4KDPA 5E1ZB 1XMAA 2MLKA 4A2UA 2WTEA 4KIGA 3RJPA 1QQIA 2BGCA 2VONA 4HLXA 5F64A 1R36A 1ZLKA 3O3KA 1XSVA 1QBJA 1MD0A 2MD5A 3V7SA 1OKRA 1JHFA 4G8XA 2ZJ2A 2O61A 3SFZA 1ZH5A 1T39A 2IP2A 2HDCA 2FA5A 3REOA 1XDSA 1TW3A 4UUVA 1ON2A 1FSHA 3CJNA 4U0VA 2J5OA 1ZYRF 5CJ9A 2DPDA 4EV0A 4BQAA 3TO9A 3FZVA 2Z3YA 1Z05A 3OOPA 2D1VA 4NQWA 4ESFA 2XKPA 1R5HA 4ON0A 4LLGF 1EV7A 3CTAA 5H6QA 1V3FA 5FLXK 1XDUA 3FM3A 4KN4X 1U2WA 2GXBA 4N0BA 1TTYA 1T2KA 5E8IA 4ZYHA 4G6DA 2JTVA 2L54A 4IJAA 2BV6A 5LEJA 1HKQA 2XRNA 4OIRF 3GF2A 5D5XB 3J80K 3F8MA 1C0WA 4I01A 3S2WA 1K7AA 4I0AA 2DK8A 5EEHA 4RGXA 5L3DA 4UXNA 2YPRA 5HDKA 2Q8KA 3EETA 1B6AA 3WODF 4A0ZA 2FQ3A 4LMYA 2ZXJA 3FM5A 3RKYA 2GIVA 3F6OA 4UVBA 3ABTA 4Y15A 1UHWA 3H92A 3I0TA 2OD5A 2ZBKA 1ZG1A 2OQRA 4OOIA 2DI3A 1HQCA 3K2ZA 3B73A 3P9KA 1RZ4A 1KQ0A 1P6RA 3E6DA 5DEQA 4PGGA 1TLHB 4U7DA 4IPAA 3BJAA 2PMHA 3WGHA 1ZRDA 4EM0B 2MH2A 4CHUA 5HOOA 2QBYB 1XSDA 3LWFA 1BIBA 4I98B 3HSFA 2VC1A 3ZMSA 3T5XA 2CSOA 5HDNA 1DDNA 5FFXA 2RC4A 3F21A 2FF4A 3MAJA 3F8FA 1FSEA 5J8FA 3M7GA 2CG4A 5A2QK 1J75A 2CGPA 4KFCA 4A5MA 1R1UA 5FD5A 2DBBA 5LLQA 5LRRA 2QM3A 3VFZA 1J2XA 1U8RA 4YIIA 3CDHA 2PMUA 2Z9OA 2P5KA 3GO5A 1XGMA 5D5UB 5K5OA 1EH6A 1I1GA 3GFJA 1KA8A 4QWQA 3DFGA 4M9SA 2PFBA 4N9HA 1I5ZA 3SZPA 1MJBA 1W7PA 1BBYA 2PEXA 4EJOA 5ICFA 5L3FA 4IRIA 3E6CC 1IXCA 1L0OC 2WWYA 2CYYA 2FBKA 1QZZA 2XV4S 3TOAA 1ZREA 3KP2A 2X4HA 1ZLJA 3L2CA 4HX7A 2D1HA 1G3TA 3SXYA 5BOXA 2WC2A 4HV5A 4RAYA 1WRJA 5CVVA 2E7WA 3MCZA 4U0WA 3LSTA 1KYZA 1YQAA 2FBHA 2VXZA 1FYLA 1R1TA 4GYGA 3GXOA 4Q4ZF 3RYPA 3F3XA 1LDJA 4OIOF 4RB1A 2KJCA 4Y17A 2GA2A 4P5OA 1T98A 5HS9A 4BYYA 4IRHA 5D4RA 4XLNF 3BJ6A 3WGGA 1SAXA 4ZYEA 2QWWA 1RNLA 5KVRA 5IT3A 1LDKB 1STZA 1O3RA 2XAQA 1IRFA 2F5DA 2OAZA 3CUQB 2WV0A 4EGYA 2HZTA 1SD7A 4LK0F 1ON1A 3HRUA 3KETA 5BS6A 2M8EA 4IF4A 1WWXA 4G7ZF 1UCRA 3HIFA 1UB9A 2DK5A 3V8JA 1I6XA 3FF5A 4EJUA 4EJTA 3BDDA 2YR2A 4WXHA 3WTXC 1ONVA 3GWZA 3MWMA 1XGSA 1ZG5A 3WG9A 2JRTA 5E1XA 2VE8A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5DCM B;  3DKW A;  4HQE A;  1Z6T A;  4FX0 A;  2QQB A;  2W24 A;  1Z9C A;  2R7F A;  4MEX F;  1FZP B;  4B09 A;  1IN5 A;  2OA4 A;  2V79 A;  3KP7 A;  2ZME B;  1ZN2 A;  2IT0 A;  2IPQ X;  1J0R A;  2GWR A;  2HWV A;  4MGR A;  3VEP A;  3T8T A;  3U1D A;  4IVN A;  3HSE A;  3JSP A;  2QEN A;  1RUO A;  4M73 A;  2ESH A;  4ENN A;  4GO1 A;  3T1B A;  3PQJ A;  1O3T A;  1BJA A;  2CQK A;  3P9C A;  4EGZ A;  2A69 F;  1RUN A;  3R0J A;  1J5Y A;  2IA0 A;  1G3S A;  2W25 A;  3I54 A;  1DPR A;  1TQM A;  3L9F A;  1F5T A;  3TKY A;  3E3V A;  2JZY A;  2R3S A;  1PP8 F;  4HZF A;  4AIH A;  1YS6 A;  3JSO A;  2P7C B;  3BP8 A;  2CW0 F;  1WQ2 A;  4K2E A;  5F6F A;  3K1M A;  3DPL C;  2LF8 A;  1A04 A;  4RB2 C;  1PP7 U;  3TDZ C;  2QLZ A;  3C18 A;  5JR3 A;  2XGX A;  1Z91 A;  1EH8 A;  4EMS A;  3NQO A;  2DAO A;  4MNU A;  1V4R A;  3KP3 A;  4BHP A;  2HGC A;  4G7H F;  2DU9 A;  5DYM A;  2CFX A;  3FMS A;  3F8B A;  1FYM A;  1IAW A;  4ENJ A;  1JHH A;  3LAP A;  5DD8 A;  2Z5U A;  3VB2 A;  5E8G A;  5HLI A;  5KK1 A;  4L9V A;  1HXD A;  3ZMV A;  5BPD A;  3DP7 A;  2K27 A;  4FHT A;  1T38 A;  5FB2 A;  2YSR A;  1IN4 A;  3MFK A;  4EVI A;  1IXR C;  5DDG A;  3KE2 A;  3KEO A;  3ZMU A;  2M45 A;  1GVJ A;  1U78 A;  1BI1 A;  5H20 A;  2FBI A;  1G6N A;  2MLG A;  3ZPL A;  3R0A A;  3CUO A;  1L3L A;  2JPC A;  2NYX A;  5HDG A;  4EM2 A;  3C3W A;  3NEU A;  3B02 A;  2K4B A;  5EEG A;  1LB2 A;  3IRR A;  4CYD A;  1XCV A;  3WE2 A;  4IRG A;  4ETS A;  1K6O A;  4CZZ A;  2FE3 A;  3GFL A;  2EFW A;  3WU1 B;  4LD5 A;  2XRO A;  3M8F A;  2K86 A;  1W7P B;  3I71 A;  2P5V A;  3RIR A;  1FY7 A;  4WXC A;  2HKO A;  1O7F A;  1X3U A;  4LG0 B;  3WTS C;  4HW0 A;  2DTR A;  1S7A A;  4EQQ A;  2GQQ A;  1KU3 A;  1KGS A;  1ZRF A;  4ESB A;  3T0Y A;  2VC0 A;  5ICC A;  1W7P D;  5DUK A;  3JAM Z;  1U5T B;  1O3Q A;  5JFR A;  2DPU A;  4A5N A;  4KMF A;  2JT1 A;  2BYV E;  5LHG A;  4HA8 A;  5LRS A;  2NNN A;  4L18 B;  1QPM A;  4ZZL A;  1R1V A;  1BC7 C;  3E5Q A;  5LEK A;  3BPV A;  2VN2 A;  3HTS B;  4MTE A;  5D5V B;  2LDU A;  4LGW A;  1IN8 A;  4F7Z A;  1ZGJ A;  2EV5 A;  5IT9 K;  4A6D A;  4ZZD A;  3RTR A;  1R00 A;  5ICE A;  5LHI A;  2IA1 A;  1Y0U A;  1KU2 A;  1YTY A;  1K78 A;  5D8K B;  3GZ5 A;  1IRG A;  1U6G A;  4NB5 A;  2KIF A;  2Y75 A;  2H6B A;  2KJB A;  2HQN A;  2OZ6 A;  3QU3 A;  4LG0 A;  3L7W A;  3Q9S A;  1MDM A;  1Q1H A;  3JTH A;  5ED4 A;  1B4A A;  3LFK A;  3GFI A;  2XKO A;  4KYW A;  2UWM A;  3LAJ A;  4HV6 A;  2UXX A;  1HKT A;  2VT3 A;  2YU3 A;  3IHU A;  4WK8 F;  1YO5 C;  1F4K A;  3KP5 A;  2L02 A;  3W6J B;  2NNY A;  4LFU A;  2KIU A;  1F1Z A;  3GVA A;  2FSW A;  1BOA A;  4CGZ A;  2Q0O A;  2G7H A;  3HTU A;  2E7X A;  3WTU C;  1FC3 A;  4AVP A;  2O3F A;  5TJJ A;  3ZMT A;  5CVI A;  5CYV A;  5DV5 A;  2ZFW A;  3OV8 A;  3TO6 A;  4RS8 A;  3MQ0 A;  5LBQ A;  3SZT A;  3KLN A;  4P96 A;  4HDV A;  4Q47 A;  1DUX C;  5HS7 A;  2Z33 A;  1USS A;  4ZYD A;  1E17 A;  1KU9 A;  3I64 A;  2IW5 A;  4S04 A;  5D6F A;  3QPH A;  1P4A A;  1Z1D A;  3CO6 C;  3HUG A;  2LF7 A;  1G3Y A;  2V9V A;  2ELH A;  4OIN F;  4JK1 X;  1ODD A;  5BMZ A;  2M5W A;  1B1B A;  2VBY A;  4ESJ A;  2VOD A;  4HF0 A;  4U88 A;  3QU6 A;  1PDN C;  1E2X A;  4UV8 A;  5DD4 A;  2EB7 A;  3BWG A;  1P92 A;  1W4M A;  1D5V A;  2QUF A;  4WXD A;  3EYI A;  2G9W A;  2DW4 A;  4KIC A;  1S7O A;  1J59 A;  2OU2 A;  4RB0 A;  3P7N A;  3R6S A;  5ILS A;  3GW2 A;  4H0E A;  1IUY A;  4LJZ F;  1XB4 A;  3FMQ A;  3RPU A;  4L0Y B;  3IKT A;  4YFK F;  2YX4 A;  3DQV C;  1HST A;  3E5U A;  3LQR A;  2X0L A;  2EFQ A;  2P7V B;  3E6B A;  1OR7 A;  1HW5 A;  3TOB A;  1D3Y A;  3HHH A;  2V1D A;  3TGN A;  1SMT A;  2VBX A;  3C1D A;  3O6B B;  4GCV A;  1LEA A;  4O5V A;  5LGU A;  1O3S A;  3HRT A;  5D4S A;  4RGR A;  4XSZ F;  2RN7 A;  3F23 A;  2KIM A;  4KT5 C;  3TQN A;  3MZY A;  4G9Y A;  4WX9 A;  5FLX Z;  1ULY A;  2OZU A;  3W6K B;  1H0M A;  1MJ9 A;  1KQ8 A;  4M6X A;  4KMU X;  3BY6 A;  2VOO A;  1UST A;  3HYI A;  2V6C A;  4LK1 F;  4OMY A;  4ASN A;  3N97 A;  3FHZ A;  2A68 F;  3GX4 X;  2K02 A;  4P55 A;  4IHT A;  2PI0 A;  3O2P E;  4BXU A;  3I5U A;  4B8X A;  4PDK A;  3DXJ F;  4YIF A;  2NRA C;  2FNA A;  4TV7 A;  4R1H A;  3K0L A;  2LNB A;  3IL2 A;  4BNC A;  1SFU A;  5CVR A;  3ZP5 A;  1ZAR A;  4BHB A;  4R79 A;  2HQR A;  1YW7 A;  3J7A O;  2IVM A;  5K1Y A;  1ZHF A;  1MGT A;  4DNC A;  1CF7 B;  3KFW X;  2IJL A;  3ELK A;  2D45 A;  2FMY A;  5J6X A;  4MTD A;  3NRV A;  2MC3 A;  2F5F A;  3V8K A;  4N9I A;  2VE9 A;  1U5T C;  4AWX B;  3TDU C;  2FOK A;  3IWZ A;  1FBQ A;  2H09 A;  3RPQ A;  2OQG A;  2BEO A;  1LEB A;  5D5W B;  3J81 Z;  2STT A;  4OU0 A;  1R22 A;  3HOT A;  2XAH A;  2ISZ A;  2EA2 A;  1FX7 A;  1YLF A;  4ENK A;  4A0Y A;  1REP C;  4D0P A;  3R60 A;  2R7D A;  5JHU A;  1XGN A;  2DO7 A;  3ZMD A;  2KKO A;  2STW A;  3U9G A;  2K7L A;  3DEU A;  2EFN A;  1T0F A;  1ZG3 A;  4YFN F;  1DPU A;  1SD6 A;  4YG2 F;  3WTW C;  2C6Y A;  3ABU A;  5DCF A;  3K1N A;  2A6E F;  1HSJ A;  3F72 A;  3VOE A;  2A6H F;  1R58 A;  3I59 B;  1FLI A;  1U3E M;  2ADU A;  2J5P A;  4BHC A;  4I09 A;  3IWF A;  1WKM A;  3BRO A;  5AIQ A;  2ZKZ A;  3K9T A;  4XSX F;  2XHK A;  3GEZ A;  2PLY A;  4PCQ A;  4HF2 A;  4M71 A;  3WU0 A;  1YG2 A;  4UHT A;  1U5T A;  4M6Y A;  3G73 A;  3HRM A;  3IKV A;  2O6G E;  3KEQ A;  4EM1 A;  1WSU A;  4EJV A;  1YIO A;  1P4W A;  1F9N A;  5K5Q A;  3HRS A;  1I27 A;  2E1C A;  1K79 A;  4A0X A;  2HYF A;  4IHS A;  4GGG A;  3H3U A;  2O8X A;  2M30 A;  2GZW A;  4KN7 X;  2Q2E A;  3R61 A;  3GFM A;  2BE5 F;  1W5T A;  4HBL A;  5HS8 A;  2ZO4 A;  2EV0 A;  2FXA A;  3ZN0 A;  1IW7 F;  2ETH A;  5E20 A;  1FT9 A;  3F22 A;  2EFO A;  3WE3 A;  5ILU A;  2G7U A;  3I58 A;  2FML A;  1Z7U A;  2BBY A;  4LB6 B;  1BI2 A;  2VT2 A;  3JW4 A;  4OIP F;  4IXA A;  4M72 A;  3FXQ A;  2DQL A;  2P4W A;  2CO5 A;  3L09 A;  6PAX A;  4MEY F;  3WTT C;  1D8K A;  4M9Z A;  4U0Y A;  5L3B A;  2Y48 A;  4JQF A;  4O6J A;  3JAM K;  3F6V A;  1HKS A;  1GXQ A;  1SFX A;  3VOD A;  2RNJ A;  4L9T A;  5HLH A;  2JSC A;  2HKX A;  1O57 A;  1HBX G;  3KP6 A;  2PQ8 A;  4HYE A;  4M9X A;  3GYH X;  2L3D A;  2FNP A;  5BQT A;  2EFP A;  3Q5F A;  2ZCW A;  5LHH A;  5FGM A;  1SD4 A;  4UNO A;  2ZNY A;  2VOP A;  1KQ9 A;  2HR3 A;  5ICG A;  1OPC A;  2EWN A;  4O3M A;  2HTJ A;  4BAY A;  2Y0M A;  3KZZ A;  3CO7 C;  4I2O A;  2F5C A;  5J8C A;  5DUI A;  4BH9 A;  4KIF A;  1FP2 A;  1LVA A;  1OYY A;  1MZB A;  2XAJ A;  3WGI A;  1IXS B;  2RV8 A;  5CVJ A;  4L9J A;  4Z2Y A;  3LA2 A;  1GHC A;  2FRH A;  4XLP F;  2DFI A;  1QNT A;  1S8N A;  4HLY A;  2UXN A;  2F2E A;  5AIP A;  2M1B A;  1QZY A;  3FXU A;  2LKP A;  2KRF A;  3ROU A;  2JPB A;  2ZME A;  3P9I A;  4GXO A;  3PFI A;  2RDP A;  2GAU A;  4FX4 A;  4GYI A;  2MA3 A;  3GUD A;  5F1R A;  2V1U A;  2ACJ A;  3K69 A;  3FXR A;  3BJO A;  4CXF A;  4Q48 A;  3IRQ A;  2COM A;  4CDG A;  4NHJ A;  4HF1 A;  1D8J A;  1B9N A;  3L00 A;  2NS0 A;  2B0L A;  2VBW A;  1EH7 A;  4UVA A;  4R8H A;  3FWE A;  3JTG A;  3V7R A;  1GXP A;  4HX4 A;  2DLL A;  2QVO A;  2TDX A;  2D2W A;  3ECO A;  3T8R A;  2QQA A;  3SQN A;  1S29 A;  1ZGA A;  4HAM A;  2A61 A;  2Z99 A;  3ISP A;  2FEZ A;  3G3Z A;  1H9T A;  4OIQ F;  3Q9V A;  1YYV A;  1KU7 A;  4OMZ A;  1HW2 A;  3BOQ A;  5LGT A;  3AAF A;  3J80 Z;  2HTS A;  5K5R A;  2OBP A;  3ECH A;  2AXL A;  4WF2 A;  3WTZ A;  5AON A;  2GXG A;  3BZ6 A;  1XMK A;  3E6M A;  1FOK A;  1O7L A;  4LB5 A;  1AWC A;  3HOS A;  1J9I A;  3GZ6 A;  3N4M A;  1FNN A;  2ZNZ A;  4ENM A;  3D0S A;  4QLC U;  4A6E A;  4XBF A;  1FPQ A;  4MQV A;  3EYY A;  5E18 F;  2HYG D;  4A12 A;  2RKH A;  5H6R A;  1YS7 A;  1B9M A;  3LA7 A;  2PJP A;  2PN6 A;  1MJA A;  2AS5 F;  2ISY A;  5BPI A;  3RKW A;  4AD9 A;  2O03 A;  2O0Y A;  2RGV A;  3K1P A;  4RGU A;  2MH9 A;  1BM9 A;  3FMR A;  2XUB A;  2XAG A;  1TBX A;  1S6L A;  1QO0 D;  4HX8 A;  1FBS A;  2HEO A;  3LQQ A;  4RGS A;  3EDP A;  2XVC A;  5E17 F;  3MEX A;  1SFE A;  4L0Z B;  3COA C;  2H27 A;  2L4M A;  3F8N A;  5DCM A;  4LLN A;  1FP1 D;  1JXS A;  2EA4 A;  2DQR A;  5CLS A;  1IF1 A;  4M74 A;  1VTN C;  5A2Q Z;  5D6E A;  1LQ1 A;  5FO5 A;  1TNS A;  2CWE A;  3E5X A;  2IRF G;  1DP7 P;  1BN5 A;  2E1N A;  4JBA A;  1UFM A;  3V8L A;  3WTV C;  1T6S A;  5HVQ C;  2W85 A;  3ERE D;  4KIB A;  5TRD A;  1IN7 A;  3I4P A;  1ZRC A;  2EJR A;  3RYR A;  3M9A A;  3DF8 A;  1FBU A;  2L01 A;  4HDU A;  2XAS A;  3V7C A;  1NHA A;  2RQP A;  4AIJ A;  4UVC A;  4YFX F;  3C7J A;  3QP6 A;  3TO7 A;  2H6C A;  4UV9 A;  4ZYG A;  2PG4 A;  1ZAO A;  2V1X A;  1UHM A;  4RAZ A;  5JVT A;  2GA1 A;  1R5G A;  1LNW A;  4HQM A;  4KUM A;  2NAZ A;  2XIG A;  3BPX A;  3CUQ C;  1QGP A;  2QYO A;  1AOY A;  2A5Y B;  5L3E A;  4I0B A;  4P9U A;  3ZQ7 A;  3ZN1 A;  2A07 F;  1XGO A;  1MKM A;  1W5S A;  2RVC A;  5LGN A;  1R7J A;  4FT8 A;  4WWC A;  1BC8 C;  3J81 K;  1YW9 A;  1PUE E;  1Z6R A;  1TNT A;  1J7K A;  3RI4 A;  3CLO A;  4EJW A;  1SD5 A;  3M8E A;  4E70 A;  1SMY F;  3MZH A;  2ESN A;  1HW1 A;  4Y13 A;  1K78 B;  3ZMZ A;  2QQ9 A;  4ZH4 F;  2M87 A;  3QOP A;  4KNY A;  2K4J A;  5JI6 A;  3V4G A;  1LDD A;  3QPT A;  2XAF A;  3WTY C;  1JE8 A;  2F5E A;  4RB3 C;  1OYI A;  1MDM B;  2EK5 A;  3H3Z A;  4U7B A;  1I1S A;  4CO8 A;  2IA2 A;  1R23 A;  1XSX A;  1B59 A;  3I53 A;  3EQL F;  2HOE A;  5CVU A;  5HLG A;  4DQ2 A;  3PQK A;  3IC7 A;  3M1E A;  3KP4 A;  4CIC A;  2A3S A;  2YX7 A;  1BIA A;  1XD7 A;  4XRF A;  1P4X A;  1TQP A;  1FWZ A;  5L3G A;  5IT9 Z;  2HFH A;  2W84 A;  1G3W A;  3D5L A;  4MQ9 F;  3QRF F;  1S3J A;  2P6S A;  4L9N A;  1CGP A;  2DT5 A;  1LJ9 A;  4MHG A;  1G4D A;  2L4A A;  2QBY A;  1OYW A;  2LSO A;  3I59 A;  2P5L C;  3GLX A;  5D8L B;  1RIO H;  1OMI A;  4S05 A;  3DPT A;  1P2F A;  3KCC A;  3EUH A;  1BI0 A;  3SHF A;  1YW8 A;  2VBZ A;  1JGS A;  4L5I A;  4Q5S F;  4KA4 A;  4G6Q A;  4P9F A;  2H94 A;  2PBI A;  1XCB A;  3FX3 A;  3RKX A;  1H9G A;  2EV6 A;  5ERI A;  4I7H A;  1YFH A;  5FFZ A;  3LA3 A;  1IN6 A;  2W57 A;  1TW2 A;  3E97 A;  3HSR A;  4AIK A;  4PZJ A;  2UZK A;  1RI7 A;  1BI3 A;  5E1W A;  4HOB A;  4I02 A;  2P6T A;  1TQI A;  1IZ1 A;  3QAH A;  4G7O F;  1KYW A;  5ILV A;  3U2R A;  2HS5 A;  2FU4 A;  5L3C A;  4WCG A;  1WI9 A;  3F8C A;  3RDI A;  1CF7 A;  2P8T A;  3HHG A;  2MBF A;  3ML6 A;  3KZY A;  2QZ8 A;  3CUQ A;  4G94 A;  4PGH A;  4LLL A;  1XN7 A;  5FD6 A;  4L5J A;  1FYK A;  3DV8 A;  3ULQ B;  3KLO A;  3QP5 A;  3R4K A;  4KDP A;  5E1Z B;  1XMA A;  2MLK A;  4A2U A;  2WTE A;  4KIG A;  3RJP A;  1QQI A;  2BGC A;  2VON A;  4HLX A;  5F64 A;  1R36 A;  1ZLK A;  3O3K A;  1XSV A;  1QBJ A;  1MD0 A;  2MD5 A;  3V7S A;  1OKR A;  1JHF A;  4G8X A;  2ZJ2 A;  2O61 A;  3SFZ A;  1ZH5 A;  1T39 A;  2IP2 A;  2HDC A;  2FA5 A;  3REO A;  1XDS A;  1TW3 A;  4UUV A;  1ON2 A;  1FSH A;  3CJN A;  4U0V A;  2J5O A;  1ZYR F;  5CJ9 A;  2DPD A;  4EV0 A;  4BQA A;  3TO9 A;  3FZV A;  2Z3Y A;  1Z05 A;  3OOP A;  2D1V A;  4NQW A;  4ESF A;  2XKP A;  1R5H A;  4ON0 A;  4LLG F;  1EV7 A;  3CTA A;  5H6Q A;  1V3F A;  5FLX K;  1XDU A;  3FM3 A;  4KN4 X;  1U2W A;  2GXB A;  4N0B A;  1TTY A;  1T2K A;  5E8I A;  4ZYH A;  4G6D A;  2JTV A;  2L54 A;  4IJA A;  2BV6 A;  5LEJ A;  1HKQ A;  2XRN A;  4OIR F;  3GF2 A;  5D5X B;  3J80 K;  3F8M A;  1C0W A;  4I01 A;  3S2W A;  1K7A A;  4I0A A;  2DK8 A;  5EEH A;  4RGX A;  5L3D A;  4UXN A;  2YPR A;  5HDK A;  2Q8K A;  3EET A;  1B6A A;  3WOD F;  4A0Z A;  2FQ3 A;  4LMY A;  2ZXJ A;  3FM5 A;  3RKY A;  2GIV A;  3F6O A;  4UVB A;  3ABT A;  4Y15 A;  1UHW A;  3H92 A;  3I0T A;  2OD5 A;  2ZBK A;  1ZG1 A;  2OQR A;  4OOI A;  2DI3 A;  1HQC A;  3K2Z A;  3B73 A;  3P9K A;  1RZ4 A;  1KQ0 A;  1P6R A;  3E6D A;  5DEQ A;  4PGG A;  1TLH B;  4U7D A;  4IPA A;  3BJA A;  2PMH A;  3WGH A;  1ZRD A;  4EM0 B;  2MH2 A;  4CHU A;  5HOO A;  2QBY B;  1XSD A;  3LWF A;  1BIB A;  4I98 B;  3HSF A;  2VC1 A;  3ZMS A;  3T5X A;  2CSO A;  5HDN A;  1DDN A;  5FFX A;  2RC4 A;  3F21 A;  2FF4 A;  3MAJ A;  3F8F A;  1FSE A;  5J8F A;  3M7G A;  2CG4 A;  5A2Q K;  1J75 A;  2CGP A;  4KFC A;  4A5M A;  1R1U A;  5FD5 A;  2DBB A;  5LLQ A;  5LRR A;  2QM3 A;  3VFZ A;  1J2X A;  1U8R A;  4YII A;  3CDH A;  2PMU A;  2Z9O A;  2P5K A;  3GO5 A;  1XGM A;  5D5U B;  5K5O A;  1EH6 A;  1I1G A;  3GFJ A;  1KA8 A;  4QWQ A;  3DFG A;  4M9S A;  2PFB A;  4N9H A;  1I5Z A;  3SZP A;  1MJB A;  1W7P A;  1BBY A;  2PEX A;  4EJO A;  5ICF A;  5L3F A;  4IRI A;  3E6C C;  1IXC A;  1L0O C;  2WWY A;  2CYY A;  2FBK A;  1QZZ A;  2XV4 S;  3TOA A;  1ZRE A;  3KP2 A;  2X4H A;  1ZLJ A;  3L2C A;  4HX7 A;  2D1H A;  1G3T A;  3SXY A;  5BOX A;  2WC2 A;  4HV5 A;  4RAY A;  1WRJ A;  5CVV A;  2E7W A;  3MCZ A;  4U0W A;  3LST A;  1KYZ A;  1YQA A;  2FBH A;  2VXZ A;  1FYL A;  1R1T A;  4GYG A;  3GXO A;  4Q4Z F;  3RYP A;  3F3X A;  1LDJ A;  4OIO F;  4RB1 A;  2KJC A;  4Y17 A;  2GA2 A;  4P5O A;  1T98 A;  5HS9 A;  4BYY A;  4IRH A;  5D4R A;  4XLN F;  3BJ6 A;  3WGG A;  1SAX A;  4ZYE A;  2QWW A;  1RNL A;  5KVR A;  5IT3 A;  1LDK B;  1STZ A;  1O3R A;  2XAQ A;  1IRF A;  2F5D A;  2OAZ A;  3CUQ B;  2WV0 A;  4EGY A;  2HZT A;  1SD7 A;  4LK0 F;  1ON1 A;  3HRU A;  3KET A;  5BS6 A;  2M8E A;  4IF4 A;  1WWX A;  4G7Z F;  1UCR A;  3HIF A;  1UB9 A;  2DK5 A;  3V8J A;  1I6X A;  3FF5 A;  4EJU A;  4EJT A;  3BDD A;  2YR2 A;  4WXH A;  3WTX C;  1ONV A;  3GWZ A;  3MWM A;  1XGS A;  1ZG5 A;  3WG9 A;  2JRT A;  5E1X A;  2VE8 A; 
#chains in the Genus database with same CATH topology
 4E7J A;  3CQZ J;  1WJA A;  3LSH A;  1ETY A;  3FXO A;  5DCM B;  2BOL A;  3DKW A;  2L9R A;  4HQE A;  3LNQ A;  1Z6T A;  4FX0 A;  3EUH C;  2QQB A;  2ZXW H;  5EZG A;  3PIO F;  2W24 A;  3IAS 2;  1Z9C A;  3Q3S A;  2R7F A;  4MEX F;  1FZP B;  1WZ2 A;  2R92 J;  4B09 A;  1KON A;  1IN5 A;  2OA4 A;  2QSF X;  2LBF A;  2CQX A;  3G1M A;  2V79 A;  3KP7 A;  3OIP A;  2ZME B;  4BBR J;  1ZN2 A;  2IT0 A;  4E7S A;  2IPQ X;  2X6Y A;  3PNT A;  1J0R A;  2GWR A;  2HWV A;  4MGR A;  3VEP A;  2QKL B;  3MKY B;  3T8T A;  3U1D A;  4IVN A;  2XGD A;  2VL8 A;  3HSE A;  3JSP A;  2QEN A;  1N77 A;  3K4C A;  3BQY A;  1RUO A;  4M73 A;  2ESH A;  5H2F C;  4ENN A;  5B1B H;  3PIP F;  4GO1 A;  3T1B A;  3PQJ A;  1O3T A;  1BJA A;  2CQK A;  4AID A;  3P9C A;  4HEA 2;  4EGZ A;  2A69 F;  4AYB A;  3ZRG A;  2M3A A;  1RUN A;  3R0J A;  3GTQ J;  1T33 A;  2EIL H;  3J7Y J;  1J5Y A;  2IA0 A;  2VB6 A;  2CRG A;  1G3S A;  2O5R A;  2W25 A;  2R7U A;  2BY2 A;  3I54 A;  1QHH D;  1DPR A;  1OQY A;  1TQM A;  3L9F A;  3GBG A;  1F5T A;  3TKY A;  3E3V A;  2JZY A;  2R3S A;  1PP8 F;  4HZF A;  5EGO B;  4AIH A;  5M3M J;  1YS6 A;  3JSO A;  2P7C B;  4BL0 B;  1PYV A;  3BP8 A;  3HGY A;  2CW0 F;  1WQ2 A;  1SAN A;  4K2E A;  1B8I B;  3ESW B;  5F6F A;  3OYL A;  2LFB A;  3A01 B;  3K1M A;  3DPL C;  2LF8 A;  1E3O C;  1A04 A;  5IYD J;  4RB2 C;  1PP7 U;  3TDZ C;  3FK6 A;  2QLZ A;  3SJM A;  5B66 C;  4XOR A;  3C18 A;  5JR3 A;  4QTR A;  2XGX A;  4RA2 A;  1Z91 A;  1EH8 A;  4EMS A;  3NQO A;  1TWG J;  2DAO A;  3OYJ A;  1HF0 A;  3HOU J;  4MNU A;  1MMG A;  2L7M P;  1V4R A;  3KP3 A;  4BHP A;  2HGC A;  2XC7 A;  4XOT A;  4G7H F;  2DU9 A;  5IOY A;  5DYM A;  5GAD J;  2CFX A;  3FMS A;  5EF6 A;  2LY9 A;  4ZTJ A;  3F8B A;  1FYM A;  3GME A;  1IAW A;  4ENJ A;  1JHH A;  3LAP A;  5DD8 A;  2Z5U A;  3VB2 A;  5E8G A;  2JWT A;  5HLI A;  2QKM B;  4IL6 C;  4QPQ A;  3TP3 A;  1OJL A;  5KK1 A;  1MMN A;  4C2U A;  4L9V A;  1IDY A;  3BR5 A;  2MC4 A;  2IBD A;  3ZQI A;  1HXD A;  3W3C A;  3ZMV A;  4BJT A;  5BPD A;  3DP7 A;  1HDP A;  2K27 A;  1MBH A;  4CCO A;  4A3F J;  4FHT A;  2X6O A;  1T38 A;  5FB2 A;  2YSR A;  1IN4 A;  2BZT A;  1TWF J;  1QVT A;  3MFK A;  5J1R A;  3M3Y J;  4EVI A;  1IXR C;  2DMN A;  3K4L A;  3DU5 A;  3PFY A;  3KE2 A;  5DDG A;  3KEO A;  2JMW A;  3BG9 A;  3ZMU A;  5B3S H;  2M45 A;  1GVJ A;  2DOF A;  1U78 A;  4HNT A;  1BI1 A;  5H20 A;  2FBI A;  3G1O A;  5FKN A;  2V26 A;  1ZEL A;  2WAE A;  3D1N I;  1G6N A;  2MLG A;  3ZPL A;  3R0A A;  4XOP A;  1XTA A;  3CUO A;  2OC6 A;  2JPC A;  2NYX A;  1L3L A;  2WAF A;  5HDG A;  3FIS A;  4EM2 A;  3C3W A;  3NEU A;  3P5J A;  3OYG A;  3B02 A;  3OR2 C;  2IXS A;  2GBY A;  2HQ5 A;  1JKO C;  2K4B A;  2QF7 A;  5EEG A;  2L2O A;  1WJF A;  5FLV A;  2HQA A;  1MSE C;  3H5R A;  1LB2 A;  1TT5 B;  3CMM A;  3MKW B;  3IRR A;  4CYD A;  1XCV A;  3WE2 A;  4IRG A;  3MN2 A;  2IEK A;  5JLW A;  2ZJR F;  2WAQ A;  1GLN A;  3LOC A;  3BG5 A;  4ETS A;  1LE8 B;  1Y8Q B;  2A5W A;  4CZZ A;  1K6O A;  2FE3 A;  3GFL A;  2EFW A;  3WU1 B;  4LD5 A;  2XRO A;  3M8F A;  2K86 A;  1W7P B;  3I71 A;  2NOG A;  2P5V A;  4HG2 A;  3RIR A;  1FY7 A;  1QRY A;  4WXC A;  2HKO A;  4C9Y A;  3U21 A;  3JRC A;  1HC8 A;  1O7F A;  1X3U A;  4FE4 A;  4LG0 B;  3WTS C;  4HW0 A;  2DTR A;  4XL9 A;  1S7A A;  4EQQ A;  3IAM 2;  2JVH A;  2GQQ A;  1KU3 A;  4XMY A;  1KGS A;  1VQK I;  1ZRF A;  4ESB A;  2E60 A;  4CYC B;  3T0Y A;  4QSH A;  2VC0 A;  5ICC A;  1W7P D;  3LMM A;  3O8G A;  3OL3 A;  4PFO A;  2LC2 A;  4BXF A;  4D5F A;  3CCY A;  5DUK A;  3JAM Z;  1U5T B;  2QSG X;  1WHU A;  2DT6 A;  1O3Q A;  4PK4 A;  5JFR A;  2BXY A;  2DPU A;  2Z2S B;  1MMS A;  4A5N A;  3E1S A;  4KMF A;  3MMY B;  2JQ7 A;  2JT1 A;  2BYV E;  3BTI A;  5LHG A;  4HA8 A;  5LRS A;  3F9K A;  3ASN H;  5K7Z A;  1HDD C;  2GXA A;  4HRI A;  2NNN A;  4L18 B;  1QPM A;  4N4N B;  4ZZL A;  1R1V A;  2E36 A;  1BC7 C;  3A4C A;  2VKH A;  3E5Q A;  5LEK A;  3BPV A;  2VN2 A;  3G4S I;  3HTS B;  1JUP A;  3RQ4 A;  2RRE A;  1AU7 A;  4MTE A;  4UUS B;  5C3E J;  5D5V B;  2LDU A;  4ZJZ A;  4LGW A;  1IN8 A;  4J00 A;  1W36 C;  4F7Z A;  3WHC A;  3JRG A;  1N75 A;  5J40 A;  5GTH C;  1ZGJ A;  3H1C A;  2EV5 A;  3O8H A;  5IT9 K;  1E3H A;  1N78 A;  4A6D A;  4ZZD A;  3RTR A;  4XQF A;  1POG A;  1R00 A;  2BY3 A;  5ICE A;  5LHI A;  2NS7 A;  3SEQ A;  2IA1 A;  2X85 A;  1Y0U A;  1KU2 A;  1YTY A;  5B5E C;  2BXZ A;  4IZZ A;  1K78 A;  3TED A;  5D8K B;  1JKP C;  3GZ5 A;  1IRG A;  1U6G A;  4NB5 A;  2KIF A;  2PJR A;  2Y75 A;  2Z16 A;  3TW6 A;  4IHY A;  2H6B A;  4XID A;  2KJB A;  2HQN A;  3GCM A;  2OZ6 A;  2QSH X;  4CCK A;  3QU3 A;  4LG0 A;  3L7W A;  5DTD A;  4F3Q A;  1R49 A;  1ERD A;  3Q9S A;  1MDM A;  2ZFU A;  1VQO I;  3H0G J;  4CYC A;  1Q1H A;  3JTH A;  4GRI A;  5ED4 A;  3HGG A;  1B4A A;  3G71 I;  3E0J B;  2CUZ A;  3LFK A;  3GFI A;  2XKO A;  3KEY A;  4KYW A;  2ZXH A;  1SFO J;  1TC3 C;  2A6T A;  2UWM A;  3LAJ A;  4HV6 A;  2UXX A;  1RET A;  1HKT A;  2VT3 A;  1QHG A;  2YU3 A;  3IHU A;  4PSX A;  3JR9 A;  4WK8 F;  1YO5 C;  1ZK8 A;  1F4K A;  3KP5 A;  4M3F A;  4PJL A;  4DYQ A;  2L02 A;  2Q2E B;  3W6J B;  2NNY A;  4LFU A;  3CMY A;  2KIU A;  1F1Z A;  3GVA A;  2FSW A;  4W97 A;  1BOA A;  4I76 A;  4CGZ A;  2Q0O A;  1LVK A;  2G7H A;  3HTU A;  1A6Q A;  2E7X A;  2PMZ N;  3CMA I;  3WTU C;  1FC3 A;  4AVP A;  2O3F A;  5TJJ A;  4E7I A;  3ZMT A;  1ZGW A;  3FXL A;  4IEJ A;  2UV1 A;  2BW3 B;  2B7E A;  5CVI A;  5CYV A;  2WA0 A;  5DV5 A;  3SDG A;  1D0X A;  2ZFW A;  3OV8 A;  2ZSH B;  3TO6 A;  1DP3 A;  4ABZ A;  2NVQ J;  4RS8 A;  5K7H A;  3F0C A;  2M34 A;  4FIS A;  5EYR A;  1BR4 A;  3MQ0 A;  1HA8 A;  1XC5 A;  1WI3 A;  5LBQ A;  5F1J A;  3SZT A;  2GOM A;  3KLN A;  4P96 A;  5J1Y A;  4GFB A;  4I6Z A;  3VYT B;  4HDV A;  4Q47 A;  4FET A;  1DUX C;  3S17 J;  5HS7 A;  2Z33 A;  1USS A;  4ZYD A;  2R7T A;  1E17 A;  3G1L A;  1KU9 A;  3I64 A;  2IW5 A;  1IC8 A;  4S04 A;  3GZN B;  4YEJ A;  5D6F A;  3QPH A;  1P4A A;  1Z1D A;  2F6C A;  2NXN B;  3BG7 A;  3CO6 C;  3HUG A;  2DA4 A;  2LF7 A;  3RCO A;  1G3Y A;  2V9V A;  2ELH A;  3OYD A;  4OIN F;  4JK1 X;  1ODD A;  5BMZ A;  4A3J J;  2M5W A;  1B1B A;  4B44 A;  2VBY A;  5E3L A;  4ESJ A;  2F5V A;  2MFZ A;  2WB1 N;  4HF0 A;  2VOD A;  5E3O A;  4U88 A;  3QU6 A;  5EDN A;  1X2M A;  1PDN C;  4XR6 A;  4V2F A;  1E2X A;  4UV8 A;  5DD4 A;  4IX7 A;  2CFO A;  2EB7 A;  3BWG A;  1P92 A;  4RLQ A;  3BZC A;  2HDD A;  1W4M A;  1FOX A;  2DFF A;  4E7L A;  1D5V A;  2QUF A;  4QPO A;  4WXD A;  5HOD A;  2L7Z A;  1UAA A;  3EYI A;  2G9W A;  2R7V A;  1MH3 A;  3S1N J;  3WG7 H;  3J7Z I;  2DW4 A;  4KIC A;  1S7O A;  1J59 A;  1A36 A;  2OU2 A;  3HOX J;  2F4I A;  3Q0V A;  3QWL A;  4RB0 A;  3P7N A;  3R6S A;  5CQE A;  2VQC A;  5ILS A;  3GW2 A;  2W4S A;  4H0E A;  1IUY A;  4LJZ F;  1XB4 A;  3FMQ A;  3RPU A;  4L0Y B;  3IKT A;  2NVT J;  4YFK F;  2YX4 A;  2A05 A;  3DQV C;  2H8R A;  1WFX A;  1HST A;  3E5U A;  3LQR A;  2X0L A;  2YUS A;  2MSY A;  1VQ6 I;  2EFQ A;  2K9N A;  2P7V B;  4NC7 A;  2MG4 A;  3CF2 A;  5GPC A;  3E6B A;  2EZH A;  1OR7 A;  1FJL A;  4C3I J;  1HW5 A;  3TOB A;  3VPR A;  1D3Y A;  2YS9 A;  4PJN A;  2I5U A;  1XMX A;  3HHH A;  1IO2 A;  4NUB A;  1JTX A;  5FKM A;  1FOY A;  2V1D A;  3TGN A;  2F4M B;  1SMT A;  5IPA A;  2VBX A;  3C1D A;  3O6B B;  2Z1D A;  4UY8 I;  4GCV A;  1LEA A;  3S3O A;  1MH4 A;  1G2H A;  2E5N A;  4O5V A;  3CD6 I;  5LGU A;  5IP6 A;  1O3S A;  2LKX A;  1CQT A;  3HRT A;  5D4S A;  2IGM A;  1SVO A;  4RGR A;  2M7B A;  4XSZ F;  4CCM A;  3AG2 H;  2RN7 A;  3F23 A;  2KIM A;  4KT5 C;  3H0D A;  3LSG A;  3TQN A;  3MZY A;  4G9Y A;  1HLV A;  4WX9 A;  3ZQQ A;  5FLX Z;  1ULY A;  4CUG A;  2OZU A;  3OS2 A;  3W6K B;  5F0H A;  4A3D J;  1H0M A;  1MJ9 A;  2JRM A;  2QA4 I;  1KQ8 A;  3IH3 A;  4M6X A;  2ELJ A;  3AFH A;  4KMU X;  3BY6 A;  1N25 A;  2LBF B;  1HCR A;  4CZC A;  2VOO A;  1TWC J;  1UST A;  1VQ9 I;  1RR8 C;  3HYI A;  2V6C A;  4LK1 F;  3HBL A;  4OMY A;  1IGN A;  2LVS A;  2E2I J;  4ASN A;  3N97 A;  3FHZ A;  1Y1W J;  2E71 A;  1D1C A;  1FIA A;  2K9S A;  2JVG A;  5J3L A;  4E4H A;  2A68 F;  3Q0W A;  3GX4 X;  2K02 A;  4P55 A;  4IHT A;  4KIT B;  2CUJ A;  2PI0 A;  2M2E A;  2KQR A;  3O2P E;  4BXU A;  1OCC H;  3I5U A;  5F08 A;  2NVU B;  4B8X A;  2XSD C;  4PDK A;  3I55 I;  4AC0 A;  4E7K A;  3DXJ F;  2EPF A;  4YIF A;  2NRA C;  2FNA A;  4BS9 A;  3ZQH A;  2D5V A;  4TV7 A;  2FD5 A;  4R1H A;  3K0L A;  2LNB A;  3IL2 A;  4BNC A;  1S72 I;  2GIZ A;  3QPL A;  1SFU A;  5CVR A;  3BZK A;  2ZME C;  3ZP5 A;  1ZAR A;  2IS2 A;  4BHB A;  2XDV A;  4D9J A;  2R5Z A;  4RAG A;  4R79 A;  3CCE I;  2HQR A;  4M3G A;  1R4N B;  1YW7 A;  4BQQ A;  3FKI J;  1X1P A;  3OSG A;  1P7I A;  1X19 A;  4XN3 A;  3J7A O;  2IVM A;  5K1Y A;  2OV7 A;  1ZHF A;  5CKT A;  1MGT A;  2JN6 A;  4DNC A;  3HB9 A;  1CF7 B;  3KFW X;  5C4J J;  3I4N J;  2IJL A;  3TBI A;  2IS6 A;  3ELK A;  2D45 A;  1VQ8 I;  2FMY A;  2HXO A;  2XGC A;  5J6X A;  4MTD A;  3NRV A;  3RZO J;  1V55 H;  2MC3 A;  2F5F A;  4EEF G;  1BL0 A;  2VIX A;  3V8K A;  1A5J A;  4ITV A;  2BY0 A;  4N9I A;  2VE9 A;  1U5T C;  4AWX B;  3TDU C;  3SYT A;  2FOK A;  3IWZ A;  3W2W A;  5KCM A;  1NH3 A;  2E2H J;  3ZOB A;  1FBQ A;  2H09 A;  3RPQ A;  2EIJ H;  2OQG A;  1E0E A;  2BEO A;  3LSK A;  2WAQ N;  5M5X J;  4KIS A;  1LEB A;  5D5W B;  4PJ0 C;  3J81 Z;  1YI2 I;  2STT A;  4OU0 A;  1R22 A;  2EIM H;  3HOT A;  2W82 A;  2XAH A;  2ISZ A;  5FRO A;  4FE7 A;  2FOW A;  2EA2 A;  5LD2 C;  2GOX B;  4J19 A;  4C30 A;  4A3B J;  1FX7 A;  1YLF A;  4ENK A;  4A0Y A;  1REP C;  4D0P A;  3R60 A;  2R7D A;  5JHU A;  3W2A A;  1MMD A;  4ZYA A;  3MVP A;  1XGN A;  3AG3 H;  2M0C A;  2DO7 A;  3PNV A;  2EQR A;  3PUF A;  3FKJ A;  3H9G A;  3ZMD A;  2KKO A;  2V1N A;  4XLC A;  3U9G A;  2STW A;  2K7L A;  3DEU A;  3L2W A;  1FMW A;  2L0K A;  3HEF A;  3OSF A;  2XB5 A;  1Z3Y A;  2EFN A;  5EJC A;  1T0F A;  1ZG3 A;  2HVQ A;  4YFN F;  1DPU A;  1U0J A;  1SD6 A;  3FIW A;  3OYI A;  4YG2 F;  1XPX A;  3WTW C;  4LOC A;  2C6Y A;  2RQQ A;  1UZC A;  2CQ7 A;  2LY1 A;  3S1Q J;  3ABU A;  1NK3 P;  1WJC A;  3CCL I;  5E3N A;  5DCF A;  3K1N A;  2GLO A;  3VSK A;  2A6E F;  2CMP A;  1HSJ A;  3F72 A;  3VOE A;  5M3F J;  4P1W A;  3HDD A;  4DBQ A;  2A6H F;  1R58 A;  2Y69 H;  3I59 B;  2K85 A;  1FLI A;  4A3L J;  1U3E M;  2ADU A;  4A3M J;  3GTP J;  3K7A J;  2J5P A;  4BHC A;  2CV0 A;  2LR8 A;  1MBF A;  4ZC3 A;  1UHS A;  4M3D A;  2P0W A;  4I09 A;  3IWF A;  2DCE A;  2DT7 B;  4BU2 A;  1WKM A;  3BRO A;  5AIQ A;  2ZKZ A;  1YX3 A;  2ECC A;  3K9T A;  4XSX F;  2XHK A;  3OS0 A;  3CJQ B;  2VPL A;  1Y0N A;  4BE1 A;  2FX0 A;  5GPA A;  2RNG A;  3GEZ A;  2PLY A;  2VKD A;  4PCQ A;  4HF2 A;  1FMV A;  4A93 J;  1IV6 A;  4BJ5 C;  4M71 A;  3DWL E;  2KHM A;  3WU0 A;  1YG2 A;  3JRF A;  4UHT A;  2ME6 A;  1U5T A;  3HOW J;  1QVU A;  4M6Y A;  3G73 A;  3HRM A;  1IUF A;  3IKV A;  3VYR B;  3HL2 A;  1AKH A;  2O6G E;  4BAC A;  3KEQ A;  4EM1 A;  3RSN A;  1WSU A;  4EJV A;  1YIO A;  3OYN A;  1P4W A;  1F9N A;  2KFD A;  5JHF A;  5K5Q A;  3HRS A;  1I27 A;  2E1C A;  3H5A A;  1LPQ A;  4IHX A;  1K79 A;  1T56 A;  4A0X A;  4M6V A;  2HYF A;  3L2U A;  4IHS A;  4GGG A;  3VWB A;  1R4M B;  3H3U A;  2MD0 A;  2O8X A;  2M30 A;  3K70 D;  3JRD A;  3DKY A;  2GZW A;  2X51 A;  2VQL A;  4KN7 X;  2Q2E A;  4B48 A;  3IH2 A;  3R61 A;  4XN0 A;  1LFB A;  3GFM A;  2BE5 F;  1W5T A;  3DU6 A;  4A3K J;  4HBL A;  1RES A;  3OYM A;  5HS8 A;  4H4K C;  4XK4 A;  2ZO4 A;  4PFP A;  1ZR4 A;  4YEL A;  2EV0 A;  2LH9 A;  4XRS A;  2FXA A;  3ZN0 A;  4KT6 A;  1IW7 F;  1W0T A;  2ETH A;  3VSL A;  3IP4 B;  5E20 A;  1FT9 A;  1S9H A;  2L7K A;  3F22 A;  1EF4 A;  2EFO A;  4QIW N;  3WE3 A;  5ILU A;  2V9K A;  2G7U A;  3I58 A;  2FML A;  2TCT A;  1X3Z B;  1Z7U A;  1X4O A;  2BBY A;  4DYR A;  4LB6 B;  1JI8 A;  2VJ4 A;  1BI2 A;  1ZQ3 P;  2VT2 A;  4F92 B;  2XPW A;  3JW4 A;  4OIP F;  3HKZ N;  3AL0 C;  2AXT C;  4IXA A;  4M72 A;  2YU9 J;  3FXQ A;  1Z77 A;  4GDF A;  2DQL A;  2P4W A;  2CO5 A;  3L09 A;  6PAX A;  4MEY F;  2ZSI B;  1MSF C;  3WTT C;  1D8K A;  4M9Z A;  4CA0 A;  3GTK J;  4U0Y A;  3NWS A;  5L3B A;  2Y48 A;  2AHQ A;  4JQF A;  4O6J A;  1U8B A;  3D5R C;  3F6V A;  3JAM K;  1Y1V J;  1Z3X A;  1HKS A;  1GXQ A;  1SFX A;  2KZV A;  4HSR A;  4DYC A;  3CCR I;  2EIN H;  3VOD A;  3KYL A;  2RNJ A;  3RKQ A;  2KLO A;  4L9T A;  5HLH A;  2JSC A;  3DLL F;  2HKX A;  4A69 C;  1O57 A;  2CW8 A;  1HBX G;  1IRX A;  3KP6 A;  3BCA A;  2PQ8 A;  4HYE A;  4FTH A;  4M9X A;  3GYH X;  2OTL I;  3W2V A;  2H1K A;  4A3G J;  2L3D A;  2FNP A;  3PSF A;  4UUS A;  5BQT A;  2EFP A;  3Q5F A;  2ZCW A;  3DBL B;  3OYE A;  3CC2 I;  3WU2 C;  2CW7 A;  4XIC A;  2K5C A;  4XLE A;  2VJI A;  5LHH A;  5FGM A;  2BHZ A;  4Y7N J;  1A35 A;  1SD4 A;  4NC8 A;  2IGK A;  2E5Z A;  1T0F C;  2CU7 A;  2TRT A;  4UNO A;  2LRD A;  2ZNY A;  2DFH A;  3HKZ A;  2VOP A;  1KQ9 A;  5EG0 B;  1ACI A;  2HR3 A;  5ICG A;  1OPC A;  2EWN A;  3LSM A;  4BAY A;  2HTJ A;  3A0B C;  1YHQ I;  2Y0M A;  4O3M A;  3KZZ A;  3CO7 C;  1PUF A;  4I2O A;  2F5C A;  2JK3 A;  5J8C A;  5DUI A;  3L1P A;  4BH9 A;  3I4M J;  4BKX A;  2KMU A;  2FUG 2;  5JVG F;  4KIF A;  9ANT A;  1FP2 A;  1LVA A;  1OYY A;  2LD5 A;  3D5S C;  1MZB A;  2XAJ A;  4X0G A;  4XKW A;  1OLT A;  2DOE A;  4D7M A;  4OWR B;  2V7F A;  1WCM J;  2PMZ A;  3U1K A;  3WGI A;  1IXS B;  1X4P A;  2CQQ A;  2RV8 A;  5CVJ A;  4L9J A;  4Z2Y A;  3BG6 A;  3LA2 A;  1YE9 A;  3NAU A;  4B47 A;  1GHC A;  4DBR A;  2FRH A;  1APL C;  3PL8 A;  4XLP F;  3DBH B;  1TL8 A;  2DN0 A;  3DTK A;  1X58 A;  2BVL A;  1NG6 A;  3CF5 F;  2KP6 A;  4RBO A;  3CDI A;  2DFI A;  3BLY A;  1QNT A;  2DOD A;  2M0M A;  2UXN A;  1S8N A;  1D0Y A;  1Z67 A;  2QCO A;  2F2E A;  4PUS A;  4HLY A;  1G59 A;  3GTG J;  1UG0 A;  2LK2 A;  1QA6 A;  4F52 A;  5AIP A;  3FXJ A;  2M1B A;  2LOO A;  4C2M J;  2W48 A;  3I3L A;  1QZY A;  3FXU A;  3I9V 2;  2LKP A;  3EUA A;  2KRF A;  3ROU A;  2JPB A;  2ZME A;  1JKR C;  3P9I A;  4GXO A;  4JX6 A;  1JJ8 C;  3PFI A;  3OYH A;  2RDP A;  2E2J J;  2GAU A;  3DEE A;  3OYF A;  3RPU D;  3CCQ I;  3OY9 A;  4FX4 A;  3PNY A;  4GYI A;  1GV5 A;  2MA3 A;  3GUD A;  5JLX A;  5F1R A;  4V19 K;  2V1U A;  2ACJ A;  3K69 A;  3FXR A;  3BJO A;  1O4X A;  4CXF A;  4Q48 A;  4E7Z A;  3HM5 A;  3IRQ A;  4C2T A;  2COM A;  4CDG A;  5J4V A;  2XB0 X;  4NHJ A;  2FQ4 A;  3RQI A;  4HF1 A;  1D8J A;  1B9N A;  3L00 A;  2NS0 A;  1TWH J;  1ZKG A;  2B0L A;  1ZR2 A;  1IG7 A;  2VBW A;  1EH7 A;  2DOA A;  4UVA A;  4R8H A;  3SDB A;  4RDU A;  3FWE A;  3JTG A;  1YRN A;  2DA6 A;  1U9O A;  4MFD A;  3V7R A;  1BJZ A;  3FXM A;  4BDY A;  1YJN I;  1GXP A;  4HX4 A;  4JYK A;  4MIM A;  2DLL A;  4UUT A;  2QVO A;  1WPK A;  2TDX A;  2D2W A;  3ECO A;  3T8R A;  2KPM A;  2O7O A;  2QQA A;  3SQN A;  1S29 A;  1ZGA A;  2G0E A;  4HAM A;  2A61 A;  2Z99 A;  3ISP A;  2DMT A;  2FEZ A;  3G3Z A;  2R7W A;  1H9T A;  4OIQ F;  1DU0 A;  2JSP A;  3Q9V A;  1YYV A;  1KU7 A;  1ITY A;  2Y31 A;  3HJE A;  4X6A J;  4OMZ A;  1HW2 A;  3BOQ A;  5LGT A;  2P81 A;  3AAF A;  3AG1 H;  1K83 J;  2HTS A;  3J80 Z;  3S2H J;  5K5R A;  3CC7 I;  1JUM A;  2OBP A;  3ECH A;  3SZG A;  2AXL A;  2IAI A;  4WF2 A;  3L2Q A;  2WBM A;  2O8K A;  3WTZ A;  5AON A;  2JA6 J;  2GXG A;  4YRV A;  3BZ6 A;  2XPV A;  1XMK A;  2WY7 Q;  3E6M A;  1FOW A;  3VYU B;  3CCJ I;  3ZQF A;  1FOK A;  1O7L A;  5M5Y J;  4XM3 A;  1EKE A;  1S5L C;  4LB5 A;  1OR7 C;  1AWC A;  3HOS A;  1J9I A;  5HNH A;  3GZ6 A;  3N4M A;  1FNN A;  1Y56 A;  2ZNZ A;  4ENM A;  2V6E A;  3D0S A;  4QLC U;  4A6E A;  4XBF A;  5FKO A;  1FPQ A;  4BGD A;  4MQV A;  3EYY A;  5E18 F;  2HXI A;  2HYG D;  4A12 A;  1K61 A;  2RKH A;  5H6R A;  1YS7 A;  3ABK H;  3AL0 B;  3BTJ A;  2BY1 A;  1B9M A;  1KZH A;  3LA7 A;  2PJP A;  2ELK A;  2PN6 A;  1MJA A;  1WVR A;  1IV8 A;  2AS5 F;  1OIS A;  2ISY A;  1T08 B;  5BPI A;  2ZC2 A;  3RKW A;  4AD9 A;  3I56 I;  3DCF A;  2O03 A;  2O0Y A;  2RGV A;  3K1P A;  1DQU A;  2OCE A;  1OCZ H;  3DLA A;  2LLK A;  4RGU A;  3ZQG A;  2MH9 A;  4Z6Y A;  2OJE D;  2MYS A;  1BM9 A;  3FMR A;  1X1A A;  3K4N A;  1W0U A;  2EBI A;  4BJ6 C;  2XUB A;  3H35 A;  2XAG A;  3S93 A;  1GT0 C;  1TBX A;  1S6L A;  4B4C A;  1EA3 A;  1A31 A;  1QO0 D;  3BTL A;  4HX8 A;  4NBQ A;  1B72 A;  1FBS A;  2HEO A;  2HNH A;  3LQQ A;  4RGS A;  2L9N A;  3EDP A;  2XVC A;  5CPR B;  5E17 F;  3N05 A;  3MEX A;  1SFE A;  4L0Z B;  3COA C;  2H27 A;  4IOC F;  2L4M A;  3S32 A;  3A1Y A;  3F8N A;  1I39 A;  3ERM A;  5DCM A;  1XG1 A;  1RR7 A;  4XLH A;  4LLN A;  1FP1 D;  2OTJ I;  1JXS A;  2EA4 A;  2DQR A;  5CLS A;  3V42 A;  5K7F A;  4RMN A;  4X1E A;  1IF1 A;  4M74 A;  1QU3 A;  4BEH B;  1VTN C;  5A2Q Z;  4MLO A;  2ZXI A;  5D6E A;  5C44 J;  4BY7 J;  1LQ1 A;  3K4M A;  1YOV B;  3DEW A;  2HVR A;  5FO5 A;  3OIO A;  1XX5 A;  1TNS A;  2CWE A;  4D7N A;  3S14 J;  3B6A A;  2VJJ A;  1BR1 A;  3E5X A;  2IRF G;  2OUM A;  1DP7 P;  1BN5 A;  2EH3 A;  2E1N A;  1JGG A;  3CP2 A;  4JBA A;  1UFM A;  3V8L A;  3BT9 A;  3L2R A;  3WTV C;  1T6S A;  2JA2 A;  5HVQ C;  2W85 A;  3MKL A;  3ERE D;  4KIB A;  5TRD A;  1IN7 A;  2HPI A;  3GLL A;  3I4P A;  1ZRC A;  3CZ6 A;  4HST A;  4M3E A;  2EJR A;  5J47 A;  2R5Y A;  2VQG A;  2LG4 A;  3RYR A;  4AM3 A;  4RLF A;  3M9A A;  1H8A C;  3DF8 A;  1FBU A;  1ORK A;  2L01 A;  2BW3 A;  3QOE A;  2R7R A;  3C2H A;  4HDU A;  3JRI A;  4BXX J;  3TW7 A;  5E79 C;  1VF9 A;  2XAS A;  4LIV A;  3V7C A;  4A3I J;  5F0F A;  1NHA A;  2LKS A;  2RQP A;  4AIJ A;  3DKX A;  4UVC A;  4Y3O A;  4YFX F;  3C7J A;  3QP6 A;  4FQG A;  3CME I;  3TO7 A;  2H6C A;  4UV9 A;  4ZYG A;  1FIP A;  2PG4 A;  3ZGK A;  4HPQ A;  1DGW Y;  4JP0 A;  3MKZ A;  1ZAO A;  2V1X A;  2F4O B;  1UHM A;  4RAZ A;  5JVT A;  3LFU A;  2R4G A;  2GA1 A;  1R5G A;  3DBR B;  1DU6 A;  2WAD A;  1LNW A;  4HQM A;  1PVE A;  4KUM A;  5GAE J;  2NAZ A;  4IOA F;  2FJ1 A;  2XIG A;  2I8D A;  3CLQ A;  2R93 J;  3HZJ A;  4PJJ A;  1R6R A;  1IDZ A;  2R7O A;  2K3F A;  1W36 D;  3BPX A;  1SVL A;  3CUQ C;  5LFA A;  1QGP A;  1NG7 A;  2QYO A;  4RM3 A;  3BR6 A;  1JJ6 C;  2A5Y B;  5L3E A;  4I0B A;  1V5E A;  1I6H J;  1AOY A;  3NAR A;  1PJR A;  5DM6 F;  4P9U A;  3K10 A;  3ZQ7 A;  3ZN1 A;  2NVX J;  1W1W E;  2A07 F;  1XGO A;  1MKM A;  3QYF A;  1W5S A;  4F55 A;  2RVC A;  5LGN A;  1R7J A;  4FT8 A;  4WWC A;  2K40 A;  3OYA A;  1BC8 C;  3J81 K;  2W00 A;  3OYC A;  1VZ0 A;  1YW9 A;  4L5E A;  4ANJ A;  3W6V A;  2JA8 J;  4V2G A;  1VQN I;  1ETO A;  1PUE E;  1Z6R A;  3BR3 A;  2I10 A;  1TNT A;  2HI3 A;  3KX2 A;  1J7K A;  3RI4 A;  3QYE A;  3CLO A;  1EJ9 A;  4EJW A;  2X9D A;  1SD5 A;  1HOM A;  3M8E A;  3OIQ A;  3LSJ A;  3HOV J;  4E7H A;  1RC9 A;  4E70 A;  1SMY F;  3MZH A;  2E35 A;  2VPR A;  4XKB A;  4OAZ A;  1RKW A;  1YIJ I;  2ESN A;  3TL4 X;  1UG2 A;  2Y0S N;  4XRS G;  1HW1 A;  3GTJ J;  4BQN A;  4Y13 A;  1K78 B;  4IKF A;  3FBN B;  3ZMZ A;  2QQ9 A;  4ZH4 F;  2M87 A;  3QOP A;  4W1U A;  4KNY A;  2K4J A;  5JI6 A;  3V4G A;  1LDD A;  3QPT A;  2VKV A;  1MND A;  2XAF A;  2WY8 Q;  3WTY C;  1JE8 A;  3MD2 A;  4A3E J;  3S16 J;  2F5E A;  2KIQ A;  3S3M A;  2F48 A;  4RB3 C;  1OYI A;  1MDM B;  2R5Z B;  1D1B A;  2O9L A;  2EK5 A;  3H3Z A;  2KL4 A;  1YX5 A;  4U7B A;  4CO8 A;  2IA2 A;  3HG9 A;  1ZTR A;  4BBS J;  3CJR B;  1I1S A;  1K6Y A;  1R23 A;  2DA1 A;  3A0H C;  1XSX A;  1B59 A;  3I53 A;  1ENH A;  2VAS A;  4D1Q A;  3EQL F;  2HOE A;  2Y9Z A;  5CVU A;  4S0H B;  3K2A A;  5HLG A;  1T8I A;  4DQ2 A;  1AKH B;  3PQK A;  3IC7 A;  3S2D J;  2HYJ A;  3M1E A;  3KP4 A;  4CIC A;  4FAS D;  5J1U A;  2A3S A;  2YX7 A;  2ECB A;  1BIA A;  1OCT C;  1FEX A;  1X2N A;  3UNG C;  1XD7 A;  4XRF A;  1P4X A;  1TQP A;  1FWZ A;  5L3G A;  3RZD J;  5IT9 Z;  2HFH A;  2W84 A;  5F0C A;  1MMA A;  1G3W A;  4A3C J;  2AQE A;  3D5L A;  2W7N A;  4MQ9 F;  5FJ8 J;  3QRF F;  1S3J A;  3A01 A;  2P6S A;  4L9N A;  1CGP A;  2DT5 A;  1BW5 A;  2QGU A;  5EZH A;  1LJ9 A;  4MHG A;  1G4D A;  2LP0 A;  2CS3 A;  1MBK A;  2R5Y B;  2L4A A;  2QBY A;  1OYW A;  2LSO A;  4BUP A;  2NS8 A;  1I50 J;  3I59 A;  2DMP A;  4C3J J;  1P9Q C;  1VND A;  2COB A;  2P5L C;  5KAI C;  3GLX A;  2X1E A;  5D8L B;  5M5W J;  4BEH A;  3HOY J;  2DYS H;  1RIO H;  2MAB A;  1OMI A;  2LYC A;  3B6C A;  4S05 A;  3DPT A;  4XNF A;  1WJE A;  1VFC A;  1P2F A;  2AO9 A;  3KCC A;  3EUH A;  2KRC A;  3G6E I;  1BI0 A;  3SHF A;  2V9P A;  3A2K A;  1WH5 A;  2QQ8 A;  1YW8 A;  2VBZ A;  2K3P A;  1JGS A;  4RAF A;  4L5I A;  1MW7 A;  1LFU P;  2X6X A;  3OL4 A;  4Q5S F;  4KA4 A;  2X48 A;  2IS4 A;  1JUS A;  1MIJ A;  3K4K A;  4G6Q A;  4P9F A;  4Y33 A;  2H94 A;  2PBI A;  5GAG J;  3GTM J;  5GP9 A;  1XCB A;  3G2B A;  4YIR X;  3FX3 A;  4AUX A;  1B8I A;  2DXI A;  3RKX A;  1H9G A;  2EV6 A;  4LIU A;  5ERI A;  3IH4 A;  3AG4 H;  1F36 A;  4I7H A;  2ZB9 A;  1YFH A;  5FFZ A;  3LA3 A;  2QEX I;  1IN6 A;  2XGE A;  1JT0 A;  1NTC A;  2W57 A;  2VLA A;  1GV2 A;  1TW2 A;  3ABL H;  2Q1Z B;  3E97 A;  1OCR H;  1S7E A;  3HSR A;  2RAE A;  4AIK A;  4U87 A;  2JUC A;  4PZJ A;  2UZK A;  1GDT A;  2CUF A;  1RI7 A;  1BI3 A;  3L2V A;  3BG3 A;  5E1W A;  2CUE A;  4HOB A;  3GTO J;  4I02 A;  2Y0S A;  2P6T A;  1TQI A;  1V5G A;  1IZ1 A;  1W5C C;  3S15 J;  3QAH A;  4UB8 C;  4G7O F;  1KYW A;  3JRE A;  2DA2 A;  4B43 A;  5ILV A;  2HVS A;  2ID3 A;  3U2R A;  3E7L A;  2HS5 A;  2FU4 A;  3IUO A;  5L3C A;  4WCG A;  1H89 C;  2XAU A;  1WI9 A;  3F8C A;  3RDI A;  1CF7 A;  2P8T A;  3HHG A;  1U9N A;  2MBF A;  3ML6 A;  3KZY A;  3KYD B;  2DJI A;  4MO7 A;  1X1B A;  2QZ8 A;  5FLM J;  3CUQ A;  4DZP A;  3WHB A;  3VYS B;  5F27 A;  2DA7 A;  3H9Q A;  4G94 A;  3JRH A;  3MZ8 A;  4PGH A;  4LLL A;  4M3B A;  1WGX A;  3ZQC A;  1P7J A;  3M4O J;  1D1A A;  3FXK A;  4EAT A;  1XN7 A;  3JRB A;  1D0Z A;  5FD6 A;  1TP4 A;  4L5J A;  3DTI A;  5C4X J;  1MBE A;  4F93 B;  1FYK A;  1Z21 A;  4IO9 F;  1RRJ A;  3DV8 A;  4DW6 A;  3QOD A;  3ULQ B;  4II3 A;  2N8G A;  5J4Y A;  3KLO A;  3QP5 A;  3R4K A;  2DJN A;  4CCL A;  1ETX A;  4KDP A;  1IRZ A;  1R71 A;  1RPW A;  4XRM A;  1QZE A;  5CQG A;  2L5Q A;  2V4J C;  2KRH A;  2KT0 A;  2DA3 A;  3LSP A;  2NVY J;  5E1Z B;  4BE2 A;  1WJB A;  1XMA A;  2MLK A;  3CP8 A;  4CSW A;  5EEA A;  3KZI C;  2R0Q C;  4Y4R A;  2IGO A;  4A2U A;  5IP9 J;  4FCY A;  3BR1 A;  4ZTF A;  2WTE A;  4KIG A;  1RKT A;  3RJP A;  1QQI A;  3S8P A;  2BGC A;  3JCU C;  4XLA A;  2VON A;  4HLX A;  5F64 A;  1R36 A;  2E34 A;  1ZLK A;  3O3K A;  4D5C A;  1XSV A;  1QBJ A;  2E1M C;  5IYB J;  4XON A;  2VJ5 A;  4ZDO A;  4DZJ A;  1ETK A;  2OF7 A;  1MD0 A;  2VXD A;  2BVM A;  1A6I A;  4IQ4 A;  2MD5 A;  3V7S A;  1OKR A;  1JHF A;  3DPU A;  4G8X A;  3K4B A;  1B72 B;  2AQF A;  1MNE A;  2ZJ2 A;  3CC4 I;  2O61 A;  1OCO H;  2KZG A;  3SFZ A;  1ZH5 A;  1T39 A;  1R5I D;  2IP2 A;  1T95 A;  3H5N A;  1BW6 A;  2FA5 A;  3OOU A;  3REO A;  3UR3 C;  4BQO A;  2HDC A;  3H3V K;  1FTZ A;  1XDS A;  2LY2 A;  3CCU I;  2K9Q A;  1TW3 A;  2X6W A;  4UUV A;  1YJ9 I;  2DTZ A;  1ON2 A;  3M8J A;  3OYB A;  3PO2 J;  2JA5 J;  4BE0 A;  3CJN A;  2ZJQ F;  1FSH A;  4LIT A;  4U0V A;  2J5O A;  3C2B A;  1OCP A;  2B9S A;  1ZYR F;  4AYB N;  3CCM I;  2L7F P;  4G6T B;  1BR2 A;  5CJ9 A;  2CQN A;  2CH0 A;  2DPD A;  1QPI A;  4EV0 A;  4BQA A;  3PSI A;  3TO9 A;  3FZV A;  2DMQ A;  2Z3Y A;  1Z05 A;  4JX4 A;  1F43 A;  1UEL B;  2HPM A;  3OOP A;  2D1V A;  4NQW A;  3ZQL A;  4ESF A;  2XKP A;  1R5H A;  4ON0 A;  4LLG F;  3NWT A;  1EV7 A;  1WJD A;  3CTA A;  3M1C A;  2HOA A;  5H6Q A;  2ICW G;  1V3F A;  5FLX K;  4B3X A;  4II2 A;  1VQP I;  3SEZ A;  1XDU A;  3FM3 A;  4KN4 X;  3PM1 A;  3A02 A;  3HUG B;  1U2W A;  4DIQ A;  5KHD A;  3PO3 J;  3GTL J;  1VI0 A;  4UB6 C;  2GXB A;  1LFP A;  1TTY A;  1Y8R B;  3OWT A;  4N0B A;  2DDB A;  3FDY A;  1UJ8 A;  4MFE A;  4CCN A;  1T2K A;  5E8I A;  3HPH A;  4ZYH A;  4G6D A;  3ABM H;  2JTV A;  3CCV I;  1WJ5 A;  2L54 A;  3K4J A;  5GTI C;  4IJA A;  1LUJ B;  2BV6 A;  4I99 C;  1HKQ A;  5LEJ A;  2XRN A;  1JT6 A;  4OIR F;  2DDA A;  3GF2 A;  3VDX A;  5D5X B;  1MNM C;  3J80 K;  3F8M A;  1C0W A;  1PUF B;  1D5Y A;  1Y6I A;  4C3H J;  3H36 A;  2HOT A;  2CV2 A;  4I01 A;  3S2W A;  1K7A A;  4I0A A;  2DK8 A;  5EEH A;  3BR0 A;  4RGX A;  5L3D A;  4UXN A;  2M9H A;  3HPG A;  1YRN B;  2YPR A;  1VQ5 I;  5HDK A;  3QQA A;  4XLF A;  2XRL A;  2R7X A;  5GAH J;  1MBJ A;  2Q8K A;  4ZDP A;  1ETV A;  1MBG A;  2ME0 A;  3EET A;  1B6A A;  3SFI A;  2L9V A;  1TZL A;  3KPH A;  4JOM A;  3WOD F;  4CH7 A;  4A0Z A;  1BA5 A;  2FQ3 A;  4J01 A;  4LMY A;  2ZXJ A;  3FM5 A;  3J7A Y;  1G8X A;  4BDZ A;  1R9T J;  2L9S A;  1X1D A;  4N4O B;  1VQL I;  2B63 J;  3RKY A;  2GIV A;  2K9M A;  3F6O A;  4UVB A;  3ABT A;  4Y15 A;  1UHW A;  3BTC A;  3H92 A;  3I0T A;  2OD5 A;  1K4T A;  2JUG A;  5KNL A;  1BOB A;  2CJJ A;  4DGW B;  3HOZ J;  2HDW A;  2ZBK A;  4NDL A;  1ZG1 A;  2OQR A;  4OOI A;  2DI3 A;  3OMY A;  2E19 A;  1HQC A;  3CCS I;  5TIS C;  1DGR M;  2XSJ C;  4IHV A;  1TWA J;  3K70 C;  3K2Z A;  2EZI A;  3B73 A;  5FRM A;  1LKX A;  2ZJP F;  3P9K A;  1RZ4 A;  1KQ0 A;  2LRE A;  1P6R A;  3E6D A;  5DEQ A;  1GUU A;  1H88 C;  4PGG A;  2EZK A;  3KIO A;  1SVM A;  1TLH B;  1JKQ C;  4U7D A;  4IPA A;  1OFC X;  1TT0 A;  2WB1 A;  2E1M B;  3BJA A;  2PMH A;  1UMQ A;  5HNF A;  2K9L A;  3WGH A;  1ZRD A;  1V54 H;  1Q1V A;  2JJ7 A;  5IYC J;  4EM0 B;  2MH2 A;  4CHU A;  2ID6 A;  5HOO A;  2QBY B;  1XSD A;  3LWF A;  1BIB A;  4I98 B;  3HSF A;  2VC1 A;  4IQJ A;  3ZMS A;  3T5X A;  2PJR B;  2CSO A;  2VKE A;  3BQZ A;  2EZL A;  2KIS A;  2LTP A;  3TMO A;  1VQM I;  5HDN A;  1DDN A;  4BY1 J;  3FHN A;  5FFX A;  2RC4 A;  3F21 A;  2FF4 A;  3MAJ A;  4CCJ A;  3F8F A;  1FSE A;  2M4G A;  3M7G A;  5J8F A;  2CG4 A;  3H9J A;  5A2Q K;  5IOZ A;  1SEU A;  1J75 A;  5FKL A;  2CGP A;  2R7Q A;  5EG0 A;  2E1O A;  4KFC A;  2Y30 A;  4AU7 A;  3HXL A;  4A5M A;  2HU9 A;  4HNU A;  1R1U A;  3QYB A;  1VQ7 I;  5FD5 A;  5F04 A;  2DBB A;  5LLQ A;  3LSI A;  2EIK H;  1X3W B;  5LRR A;  2QM3 A;  3IV5 A;  3VFZ A;  3ASO H;  1J09 A;  2MW8 A;  2DA5 A;  2OCC H;  1J2X A;  4AVZ A;  3EUK L;  4YII A;  1U8R A;  3CDH A;  4RM2 A;  2HOS A;  2PMU A;  4HNV A;  2Z9O A;  1AA7 A;  3AKZ A;  3GO5 A;  2P5K A;  3JRA A;  1XGM A;  1I3A A;  3S3N A;  5D5U B;  2CV1 A;  5K5O A;  1EH6 A;  1I1G A;  3FBI B;  3GFJ A;  4PJM A;  2M8G X;  2JA7 J;  1KA8 A;  2H8W A;  3DFG A;  4QWQ A;  1SAU A;  4M9S A;  1YIT I;  5IP7 J;  4OAY A;  2X1C A;  2H1L A;  2PFB A;  3LL7 A;  4N9H A;  3PUB A;  3DTE A;  1I5Z A;  3SZP A;  2W1O A;  1MJB A;  1W7P A;  1BBY A;  2PEX A;  1XS9 A;  2GM4 A;  2DFE A;  4EJO A;  5ICF A;  2WV1 A;  5L3F A;  4IRI A;  3E6C C;  1IXC A;  1I3Q J;  3EPZ A;  1LE8 A;  3KYC B;  3PJR A;  4JX5 A;  4B1R A;  1L0O C;  2WWY A;  2CYY A;  5BNG A;  3K6G A;  4XKC A;  2X1D A;  2FBK A;  1QZZ A;  1AHD P;  2PX9 A;  3ZR8 X;  2XV4 S;  3TOA A;  2XF5 A;  3KP2 A;  2X4H A;  1ZRE A;  1ZLJ A;  3L2C A;  4HX7 A;  2D1H A;  3OYK A;  1GVD A;  3QPS A;  4F91 B;  1G3T A;  2R7Z J;  1V5F A;  3TP0 A;  3SXY A;  2M7A A;  5BOX A;  2WC2 A;  3LSR A;  4HV5 A;  4RAY A;  1WRJ A;  2VI6 A;  2OPT A;  2DYR H;  5CVV A;  2NOJ B;  4NNJ A;  3X2Q H;  4B3A A;  1E3P A;  2KDO A;  2E7W A;  5KAF C;  2DMU A;  3CDL A;  3MCZ A;  4U0W A;  3LST A;  2LMD A;  1KYZ A;  1YQA A;  2FBH A;  2VXZ A;  3CES A;  3Q0U A;  3A03 A;  4NC6 A;  5FRN A;  1FYL A;  1R1T A;  4GYG A;  3GXO A;  4Q4Z F;  4PSW A;  3RYP A;  3F3X A;  1LDJ A;  2HZD A;  3BC8 A;  5FKK A;  2MGQ A;  4OIO F;  2Y2Z A;  4RB1 A;  2KJC A;  4Y17 A;  3S1M J;  2VUM J;  2GA2 A;  1FTT A;  4P5O A;  1T98 A;  5HS9 A;  4BYY A;  1JTY A;  4IRH A;  4G12 A;  2BHY A;  5D4R A;  5HLT A;  4XLN F;  5DS9 A;  2XF7 A;  3BJ6 A;  3WGG A;  1Y39 A;  1SAX A;  4ZYE A;  2XF6 A;  3UKG A;  2QWW A;  2UUZ A;  3OS1 A;  1RNL A;  5KVR A;  5IT3 A;  1IJW C;  2R7S A;  1LDK B;  4E6K G;  4KJZ A;  2M4K A;  1STZ A;  4DOZ A;  1O3R A;  2XAQ A;  2IS1 A;  5IY5 H;  2IGN A;  1IRF A;  2KDZ A;  2F5D A;  3CUQ B;  3BCB A;  2OAZ A;  2WV0 A;  4EGY A;  1YJW I;  1SC7 A;  1Z7L A;  2HZT A;  4XKV A;  1SD7 A;  3M07 A;  3ZCO A;  2Y9Y A;  4LK0 F;  5E3M A;  1ON1 A;  3HRU A;  3FK7 A;  3KET A;  3S1R J;  1VQ4 I;  5BS6 A;  2M8E A;  4IF4 A;  1SFK A;  1X1C A;  1ETW A;  1WWX A;  1Z0X A;  4G7Z F;  1WH7 A;  1UCR A;  3HIF A;  5TGT A;  1UB9 A;  3BR2 A;  2DK5 A;  3V8J A;  3ZXS A;  1I6X A;  3FF5 A;  1K4S A;  4IHW A;  4EJU A;  4EJT A;  3BDD A;  3C2G A;  2YR2 A;  3CJT B;  4WXH A;  3WTX C;  2XPU A;  1ONV A;  3GWZ A;  4LG3 A;  4ZDL A;  3OR1 C;  3MWM A;  1XGS A;  1ZG5 A;  4DJA A;  3WG9 A;  2JRT A;  4Y52 J;  5DM7 F;  2VQH A;  4NQW B;  5E1X A;  5B1A H;  3ONQ A;  3HC7 A;  1NK2 P;  2VE8 A;  1ETQ A;  5EGO A;  1M1E B; 
#chains in the Genus database with same CATH homology
 5DCM B;  3DKW A;  4HQE A;  1Z6T A;  4FX0 A;  2QQB A;  2W24 A;  1Z9C A;  2R7F A;  4MEX F;  1FZP B;  4B09 A;  1IN5 A;  2OA4 A;  2V79 A;  3KP7 A;  2ZME B;  1ZN2 A;  2IT0 A;  2IPQ X;  1J0R A;  2GWR A;  2HWV A;  4MGR A;  3VEP A;  3T8T A;  3U1D A;  4IVN A;  3HSE A;  3JSP A;  2QEN A;  1RUO A;  4M73 A;  2ESH A;  4ENN A;  4GO1 A;  3T1B A;  3PQJ A;  1O3T A;  1BJA A;  2CQK A;  3P9C A;  4EGZ A;  2A69 F;  1RUN A;  3R0J A;  1J5Y A;  2IA0 A;  1G3S A;  2W25 A;  3I54 A;  1DPR A;  1TQM A;  3L9F A;  1F5T A;  3TKY A;  3E3V A;  2JZY A;  2R3S A;  1PP8 F;  4HZF A;  4AIH A;  1YS6 A;  3JSO A;  2P7C B;  3BP8 A;  2CW0 F;  1WQ2 A;  4K2E A;  5F6F A;  3K1M A;  3DPL C;  2LF8 A;  1A04 A;  4RB2 C;  1PP7 U;  3TDZ C;  2QLZ A;  3C18 A;  5JR3 A;  2XGX A;  1Z91 A;  1EH8 A;  4EMS A;  3NQO A;  2DAO A;  4MNU A;  1V4R A;  3KP3 A;  4BHP A;  2HGC A;  4G7H F;  2DU9 A;  5DYM A;  2CFX A;  3FMS A;  3F8B A;  1FYM A;  1IAW A;  4ENJ A;  1JHH A;  3LAP A;  5DD8 A;  2Z5U A;  3VB2 A;  5E8G A;  5HLI A;  5KK1 A;  4L9V A;  1HXD A;  3ZMV A;  5BPD A;  3DP7 A;  2K27 A;  4FHT A;  1T38 A;  5FB2 A;  2YSR A;  1IN4 A;  3MFK A;  4EVI A;  1IXR C;  5DDG A;  3KE2 A;  3KEO A;  3ZMU A;  2M45 A;  1GVJ A;  1U78 A;  1BI1 A;  5H20 A;  2FBI A;  1G6N A;  2MLG A;  3ZPL A;  3R0A A;  3CUO A;  1L3L A;  2JPC A;  2NYX A;  5HDG A;  4EM2 A;  3C3W A;  3NEU A;  3B02 A;  2K4B A;  5EEG A;  1LB2 A;  3IRR A;  4CYD A;  1XCV A;  3WE2 A;  4IRG A;  4ETS A;  1K6O A;  4CZZ A;  2FE3 A;  3GFL A;  2EFW A;  3WU1 B;  4LD5 A;  2XRO A;  3M8F A;  2K86 A;  1W7P B;  3I71 A;  2P5V A;  3RIR A;  1FY7 A;  4WXC A;  2HKO A;  1O7F A;  1X3U A;  4LG0 B;  3WTS C;  4HW0 A;  2DTR A;  1S7A A;  4EQQ A;  2GQQ A;  1KU3 A;  1KGS A;  1ZRF A;  4ESB A;  3T0Y A;  2VC0 A;  5ICC A;  1W7P D;  5DUK A;  3JAM Z;  1U5T B;  1O3Q A;  5JFR A;  2DPU A;  4A5N A;  4KMF A;  2JT1 A;  2BYV E;  5LHG A;  4HA8 A;  5LRS A;  2NNN A;  4L18 B;  1QPM A;  4ZZL A;  1R1V A;  1BC7 C;  3E5Q A;  5LEK A;  3BPV A;  2VN2 A;  3HTS B;  4MTE A;  5D5V B;  2LDU A;  4LGW A;  1IN8 A;  4F7Z A;  1ZGJ A;  2EV5 A;  5IT9 K;  4A6D A;  4ZZD A;  3RTR A;  1R00 A;  5ICE A;  5LHI A;  2IA1 A;  1Y0U A;  1KU2 A;  1YTY A;  1K78 A;  5D8K B;  3GZ5 A;  1IRG A;  1U6G A;  4NB5 A;  2KIF A;  2Y75 A;  2H6B A;  2KJB A;  2HQN A;  2OZ6 A;  3QU3 A;  4LG0 A;  3L7W A;  3Q9S A;  1MDM A;  1Q1H A;  3JTH A;  5ED4 A;  1B4A A;  3LFK A;  3GFI A;  2XKO A;  4KYW A;  2UWM A;  3LAJ A;  4HV6 A;  2UXX A;  1HKT A;  2VT3 A;  2YU3 A;  3IHU A;  4WK8 F;  1YO5 C;  1F4K A;  3KP5 A;  2L02 A;  3W6J B;  2NNY A;  4LFU A;  2KIU A;  1F1Z A;  3GVA A;  2FSW A;  1BOA A;  4CGZ A;  2Q0O A;  2G7H A;  3HTU A;  2E7X A;  3WTU C;  1FC3 A;  4AVP A;  2O3F A;  5TJJ A;  3ZMT A;  5CVI A;  5CYV A;  5DV5 A;  2ZFW A;  3OV8 A;  3TO6 A;  4RS8 A;  3MQ0 A;  5LBQ A;  3SZT A;  3KLN A;  4P96 A;  4HDV A;  4Q47 A;  1DUX C;  5HS7 A;  2Z33 A;  1USS A;  4ZYD A;  1E17 A;  1KU9 A;  3I64 A;  2IW5 A;  4S04 A;  5D6F A;  3QPH A;  1P4A A;  1Z1D A;  3CO6 C;  3HUG A;  2LF7 A;  1G3Y A;  2V9V A;  2ELH A;  4OIN F;  4JK1 X;  1ODD A;  5BMZ A;  2M5W A;  1B1B A;  2VBY A;  4ESJ A;  2VOD A;  4HF0 A;  4U88 A;  3QU6 A;  1PDN C;  1E2X A;  4UV8 A;  5DD4 A;  2EB7 A;  3BWG A;  1P92 A;  1W4M A;  1D5V A;  2QUF A;  4WXD A;  3EYI A;  2G9W A;  2DW4 A;  4KIC A;  1S7O A;  1J59 A;  2OU2 A;  4RB0 A;  3P7N A;  3R6S A;  5ILS A;  3GW2 A;  4H0E A;  1IUY A;  4LJZ F;  1XB4 A;  3FMQ A;  3RPU A;  4L0Y B;  3IKT A;  4YFK F;  2YX4 A;  3DQV C;  1HST A;  3E5U A;  3LQR A;  2X0L A;  2EFQ A;  2P7V B;  3E6B A;  1OR7 A;  1HW5 A;  3TOB A;  1D3Y A;  3HHH A;  2V1D A;  3TGN A;  1SMT A;  2VBX A;  3C1D A;  3O6B B;  4GCV A;  1LEA A;  4O5V A;  5LGU A;  1O3S A;  3HRT A;  5D4S A;  4RGR A;  4XSZ F;  2RN7 A;  3F23 A;  2KIM A;  4KT5 C;  3TQN A;  3MZY A;  4G9Y A;  4WX9 A;  5FLX Z;  1ULY A;  2OZU A;  3W6K B;  1H0M A;  1MJ9 A;  1KQ8 A;  4M6X A;  4KMU X;  3BY6 A;  2VOO A;  1UST A;  3HYI A;  2V6C A;  4LK1 F;  4OMY A;  4ASN A;  3N97 A;  3FHZ A;  2A68 F;  3GX4 X;  2K02 A;  4P55 A;  4IHT A;  2PI0 A;  3O2P E;  4BXU A;  3I5U A;  4B8X A;  4PDK A;  3DXJ F;  4YIF A;  2NRA C;  2FNA A;  4TV7 A;  4R1H A;  3K0L A;  2LNB A;  3IL2 A;  4BNC A;  1SFU A;  5CVR A;  3ZP5 A;  1ZAR A;  4BHB A;  4R79 A;  2HQR A;  1YW7 A;  3J7A O;  2IVM A;  5K1Y A;  1ZHF A;  1MGT A;  4DNC A;  1CF7 B;  3KFW X;  2IJL A;  3ELK A;  2D45 A;  2FMY A;  5J6X A;  4MTD A;  3NRV A;  2MC3 A;  2F5F A;  3V8K A;  4N9I A;  2VE9 A;  1U5T C;  4AWX B;  3TDU C;  2FOK A;  3IWZ A;  1FBQ A;  2H09 A;  3RPQ A;  2OQG A;  2BEO A;  1LEB A;  5D5W B;  3J81 Z;  2STT A;  4OU0 A;  1R22 A;  3HOT A;  2XAH A;  2ISZ A;  2EA2 A;  1FX7 A;  1YLF A;  4ENK A;  4A0Y A;  1REP C;  4D0P A;  3R60 A;  2R7D A;  5JHU A;  1XGN A;  2DO7 A;  3ZMD A;  2KKO A;  2STW A;  3U9G A;  2K7L A;  3DEU A;  2EFN A;  1T0F A;  1ZG3 A;  4YFN F;  1DPU A;  1SD6 A;  4YG2 F;  3WTW C;  2C6Y A;  3ABU A;  5DCF A;  3K1N A;  2A6E F;  1HSJ A;  3F72 A;  3VOE A;  2A6H F;  1R58 A;  3I59 B;  1FLI A;  1U3E M;  2ADU A;  2J5P A;  4BHC A;  4I09 A;  3IWF A;  1WKM A;  3BRO A;  5AIQ A;  2ZKZ A;  3K9T A;  4XSX F;  2XHK A;  3GEZ A;  2PLY A;  4PCQ A;  4HF2 A;  4M71 A;  3WU0 A;  1YG2 A;  4UHT A;  1U5T A;  4M6Y A;  3G73 A;  3HRM A;  3IKV A;  2O6G E;  3KEQ A;  4EM1 A;  1WSU A;  4EJV A;  1YIO A;  1P4W A;  1F9N A;  5K5Q A;  3HRS A;  1I27 A;  2E1C A;  1K79 A;  4A0X A;  2HYF A;  4IHS A;  4GGG A;  3H3U A;  2O8X A;  2M30 A;  2GZW A;  4KN7 X;  2Q2E A;  3R61 A;  3GFM A;  2BE5 F;  1W5T A;  4HBL A;  5HS8 A;  2ZO4 A;  2EV0 A;  2FXA A;  3ZN0 A;  1IW7 F;  2ETH A;  5E20 A;  1FT9 A;  3F22 A;  2EFO A;  3WE3 A;  5ILU A;  2G7U A;  3I58 A;  2FML A;  1Z7U A;  2BBY A;  4LB6 B;  1BI2 A;  2VT2 A;  3JW4 A;  4OIP F;  4IXA A;  4M72 A;  3FXQ A;  2DQL A;  2P4W A;  2CO5 A;  3L09 A;  6PAX A;  4MEY F;  3WTT C;  1D8K A;  4M9Z A;  4U0Y A;  5L3B A;  2Y48 A;  4JQF A;  4O6J A;  3JAM K;  3F6V A;  1HKS A;  1GXQ A;  1SFX A;  3VOD A;  2RNJ A;  4L9T A;  5HLH A;  2JSC A;  2HKX A;  1O57 A;  1HBX G;  3KP6 A;  2PQ8 A;  4HYE A;  4M9X A;  3GYH X;  2L3D A;  2FNP A;  5BQT A;  2EFP A;  3Q5F A;  2ZCW A;  5LHH A;  5FGM A;  1SD4 A;  4UNO A;  2ZNY A;  2VOP A;  1KQ9 A;  2HR3 A;  5ICG A;  1OPC A;  2EWN A;  4O3M A;  2HTJ A;  4BAY A;  2Y0M A;  3KZZ A;  3CO7 C;  4I2O A;  2F5C A;  5J8C A;  5DUI A;  4BH9 A;  4KIF A;  1FP2 A;  1LVA A;  1OYY A;  1MZB A;  2XAJ A;  3WGI A;  1IXS B;  2RV8 A;  5CVJ A;  4L9J A;  4Z2Y A;  3LA2 A;  1GHC A;  2FRH A;  4XLP F;  2DFI A;  1QNT A;  1S8N A;  4HLY A;  2UXN A;  2F2E A;  5AIP A;  2M1B A;  1QZY A;  3FXU A;  2LKP A;  2KRF A;  3ROU A;  2JPB A;  2ZME A;  3P9I A;  4GXO A;  3PFI A;  2RDP A;  2GAU A;  4FX4 A;  4GYI A;  2MA3 A;  3GUD A;  5F1R A;  2V1U A;  2ACJ A;  3K69 A;  3FXR A;  3BJO A;  4CXF A;  4Q48 A;  3IRQ A;  2COM A;  4CDG A;  4NHJ A;  4HF1 A;  1D8J A;  1B9N A;  3L00 A;  2NS0 A;  2B0L A;  2VBW A;  1EH7 A;  4UVA A;  4R8H A;  3FWE A;  3JTG A;  3V7R A;  1GXP A;  4HX4 A;  2DLL A;  2QVO A;  2TDX A;  2D2W A;  3ECO A;  3T8R A;  2QQA A;  3SQN A;  1S29 A;  1ZGA A;  4HAM A;  2A61 A;  2Z99 A;  3ISP A;  2FEZ A;  3G3Z A;  1H9T A;  4OIQ F;  3Q9V A;  1YYV A;  1KU7 A;  4OMZ A;  1HW2 A;  3BOQ A;  5LGT A;  3AAF A;  3J80 Z;  2HTS A;  5K5R A;  2OBP A;  3ECH A;  2AXL A;  4WF2 A;  3WTZ A;  5AON A;  2GXG A;  3BZ6 A;  1XMK A;  3E6M A;  1FOK A;  1O7L A;  4LB5 A;  1AWC A;  3HOS A;  1J9I A;  3GZ6 A;  3N4M A;  1FNN A;  2ZNZ A;  4ENM A;  3D0S A;  4QLC U;  4A6E A;  4XBF A;  1FPQ A;  4MQV A;  3EYY A;  5E18 F;  2HYG D;  4A12 A;  2RKH A;  5H6R A;  1YS7 A;  1B9M A;  3LA7 A;  2PJP A;  2PN6 A;  1MJA A;  2AS5 F;  2ISY A;  5BPI A;  3RKW A;  4AD9 A;  2O03 A;  2O0Y A;  2RGV A;  3K1P A;  4RGU A;  2MH9 A;  1BM9 A;  3FMR A;  2XUB A;  2XAG A;  1TBX A;  1S6L A;  1QO0 D;  4HX8 A;  1FBS A;  2HEO A;  3LQQ A;  4RGS A;  3EDP A;  2XVC A;  5E17 F;  3MEX A;  1SFE A;  4L0Z B;  3COA C;  2H27 A;  2L4M A;  3F8N A;  5DCM A;  4LLN A;  1FP1 D;  1JXS A;  2EA4 A;  2DQR A;  5CLS A;  1IF1 A;  4M74 A;  1VTN C;  5A2Q Z;  5D6E A;  1LQ1 A;  5FO5 A;  1TNS A;  2CWE A;  3E5X A;  2IRF G;  1DP7 P;  1BN5 A;  2E1N A;  4JBA A;  1UFM A;  3V8L A;  3WTV C;  1T6S A;  5HVQ C;  2W85 A;  3ERE D;  4KIB A;  5TRD A;  1IN7 A;  3I4P A;  1ZRC A;  2EJR A;  3RYR A;  3M9A A;  3DF8 A;  1FBU A;  2L01 A;  4HDU A;  2XAS A;  3V7C A;  1NHA A;  2RQP A;  4AIJ A;  4UVC A;  4YFX F;  3C7J A;  3QP6 A;  3TO7 A;  2H6C A;  4UV9 A;  4ZYG A;  2PG4 A;  1ZAO A;  2V1X A;  1UHM A;  4RAZ A;  5JVT A;  2GA1 A;  1R5G A;  1LNW A;  4HQM A;  4KUM A;  2NAZ A;  2XIG A;  3BPX A;  3CUQ C;  1QGP A;  2QYO A;  1AOY A;  2A5Y B;  5L3E A;  4I0B A;  4P9U A;  3ZQ7 A;  3ZN1 A;  2A07 F;  1XGO A;  1MKM A;  1W5S A;  2RVC A;  5LGN A;  1R7J A;  4FT8 A;  4WWC A;  1BC8 C;  3J81 K;  1YW9 A;  1PUE E;  1Z6R A;  1TNT A;  1J7K A;  3RI4 A;  3CLO A;  4EJW A;  1SD5 A;  3M8E A;  4E70 A;  1SMY F;  3MZH A;  2ESN A;  1HW1 A;  4Y13 A;  1K78 B;  3ZMZ A;  2QQ9 A;  4ZH4 F;  2M87 A;  3QOP A;  4KNY A;  2K4J A;  5JI6 A;  3V4G A;  1LDD A;  3QPT A;  2XAF A;  3WTY C;  1JE8 A;  2F5E A;  4RB3 C;  1OYI A;  1MDM B;  2EK5 A;  3H3Z A;  4U7B A;  1I1S A;  4CO8 A;  2IA2 A;  1R23 A;  1XSX A;  1B59 A;  3I53 A;  3EQL F;  2HOE A;  5CVU A;  5HLG A;  4DQ2 A;  3PQK A;  3IC7 A;  3M1E A;  3KP4 A;  4CIC A;  2A3S A;  2YX7 A;  1BIA A;  1XD7 A;  4XRF A;  1P4X A;  1TQP A;  1FWZ A;  5L3G A;  5IT9 Z;  2HFH A;  2W84 A;  1G3W A;  3D5L A;  4MQ9 F;  3QRF F;  1S3J A;  2P6S A;  4L9N A;  1CGP A;  2DT5 A;  1LJ9 A;  4MHG A;  1G4D A;  2L4A A;  2QBY A;  1OYW A;  2LSO A;  3I59 A;  2P5L C;  3GLX A;  5D8L B;  1RIO H;  1OMI A;  4S05 A;  3DPT A;  1P2F A;  3KCC A;  3EUH A;  1BI0 A;  3SHF A;  1YW8 A;  2VBZ A;  1JGS A;  4L5I A;  4Q5S F;  4KA4 A;  4G6Q A;  4P9F A;  2H94 A;  2PBI A;  1XCB A;  3FX3 A;  3RKX A;  1H9G A;  2EV6 A;  5ERI A;  4I7H A;  1YFH A;  5FFZ A;  3LA3 A;  1IN6 A;  2W57 A;  1TW2 A;  3E97 A;  3HSR A;  4AIK A;  4PZJ A;  2UZK A;  1RI7 A;  1BI3 A;  5E1W A;  4HOB A;  4I02 A;  2P6T A;  1TQI A;  1IZ1 A;  3QAH A;  4G7O F;  1KYW A;  5ILV A;  3U2R A;  2HS5 A;  2FU4 A;  5L3C A;  4WCG A;  1WI9 A;  3F8C A;  3RDI A;  1CF7 A;  2P8T A;  3HHG A;  2MBF A;  3ML6 A;  3KZY A;  2QZ8 A;  3CUQ A;  4G94 A;  4PGH A;  4LLL A;  1XN7 A;  5FD6 A;  4L5J A;  1FYK A;  3DV8 A;  3ULQ B;  3KLO A;  3QP5 A;  3R4K A;  4KDP A;  5E1Z B;  1XMA A;  2MLK A;  4A2U A;  2WTE A;  4KIG A;  3RJP A;  1QQI A;  2BGC A;  2VON A;  4HLX A;  5F64 A;  1R36 A;  1ZLK A;  3O3K A;  1XSV A;  1QBJ A;  1MD0 A;  2MD5 A;  3V7S A;  1OKR A;  1JHF A;  4G8X A;  2ZJ2 A;  2O61 A;  3SFZ A;  1ZH5 A;  1T39 A;  2IP2 A;  2HDC A;  2FA5 A;  3REO A;  1XDS A;  1TW3 A;  4UUV A;  1ON2 A;  1FSH A;  3CJN A;  4U0V A;  2J5O A;  1ZYR F;  5CJ9 A;  2DPD A;  4EV0 A;  4BQA A;  3TO9 A;  3FZV A;  2Z3Y A;  1Z05 A;  3OOP A;  2D1V A;  4NQW A;  4ESF A;  2XKP A;  1R5H A;  4ON0 A;  4LLG F;  1EV7 A;  3CTA A;  5H6Q A;  1V3F A;  5FLX K;  1XDU A;  3FM3 A;  4KN4 X;  1U2W A;  2GXB A;  4N0B A;  1TTY A;  1T2K A;  5E8I A;  4ZYH A;  4G6D A;  2JTV A;  2L54 A;  4IJA A;  2BV6 A;  5LEJ A;  1HKQ A;  2XRN A;  4OIR F;  3GF2 A;  5D5X B;  3J80 K;  3F8M A;  1C0W A;  4I01 A;  3S2W A;  1K7A A;  4I0A A;  2DK8 A;  5EEH A;  4RGX A;  5L3D A;  4UXN A;  2YPR A;  5HDK A;  2Q8K A;  3EET A;  1B6A A;  3WOD F;  4A0Z A;  2FQ3 A;  4LMY A;  2ZXJ A;  3FM5 A;  3RKY A;  2GIV A;  3F6O A;  4UVB A;  3ABT A;  4Y15 A;  1UHW A;  3H92 A;  3I0T A;  2OD5 A;  2ZBK A;  1ZG1 A;  2OQR A;  4OOI A;  2DI3 A;  1HQC A;  3K2Z A;  3B73 A;  3P9K A;  1RZ4 A;  1KQ0 A;  1P6R A;  3E6D A;  5DEQ A;  4PGG A;  1TLH B;  4U7D A;  4IPA A;  3BJA A;  2PMH A;  3WGH A;  1ZRD A;  4EM0 B;  2MH2 A;  4CHU A;  5HOO A;  2QBY B;  1XSD A;  3LWF A;  1BIB A;  4I98 B;  3HSF A;  2VC1 A;  3ZMS A;  3T5X A;  2CSO A;  5HDN A;  1DDN A;  5FFX A;  2RC4 A;  3F21 A;  2FF4 A;  3MAJ A;  3F8F A;  1FSE A;  5J8F A;  3M7G A;  2CG4 A;  5A2Q K;  1J75 A;  2CGP A;  4KFC A;  4A5M A;  1R1U A;  5FD5 A;  2DBB A;  5LLQ A;  5LRR A;  2QM3 A;  3VFZ A;  1J2X A;  1U8R A;  4YII A;  3CDH A;  2PMU A;  2Z9O A;  2P5K A;  3GO5 A;  1XGM A;  5D5U B;  5K5O A;  1EH6 A;  1I1G A;  3GFJ A;  1KA8 A;  4QWQ A;  3DFG A;  4M9S A;  2PFB A;  4N9H A;  1I5Z A;  3SZP A;  1MJB A;  1W7P A;  1BBY A;  2PEX A;  4EJO A;  5ICF A;  5L3F A;  4IRI A;  3E6C C;  1IXC A;  1L0O C;  2WWY A;  2CYY A;  2FBK A;  1QZZ A;  2XV4 S;  3TOA A;  1ZRE A;  3KP2 A;  2X4H A;  1ZLJ A;  3L2C A;  4HX7 A;  2D1H A;  1G3T A;  3SXY A;  5BOX A;  2WC2 A;  4HV5 A;  4RAY A;  1WRJ A;  5CVV A;  2E7W A;  3MCZ A;  4U0W A;  3LST A;  1KYZ A;  1YQA A;  2FBH A;  2VXZ A;  1FYL A;  1R1T A;  4GYG A;  3GXO A;  4Q4Z F;  3RYP A;  3F3X A;  1LDJ A;  4OIO F;  4RB1 A;  2KJC A;  4Y17 A;  2GA2 A;  4P5O A;  1T98 A;  5HS9 A;  4BYY A;  4IRH A;  5D4R A;  4XLN F;  3BJ6 A;  3WGG A;  1SAX A;  4ZYE A;  2QWW A;  1RNL A;  5KVR A;  5IT3 A;  1LDK B;  1STZ A;  1O3R A;  2XAQ A;  1IRF A;  2F5D A;  2OAZ A;  3CUQ B;  2WV0 A;  4EGY A;  2HZT A;  1SD7 A;  4LK0 F;  1ON1 A;  3HRU A;  3KET A;  5BS6 A;  2M8E A;  4IF4 A;  1WWX A;  4G7Z F;  1UCR A;  3HIF A;  1UB9 A;  2DK5 A;  3V8J A;  1I6X A;  3FF5 A;  4EJU A;  4EJT A;  3BDD A;  2YR2 A;  4WXH A;  3WTX C;  1ONV A;  3GWZ A;  3MWM A;  1XGS A;  1ZG5 A;  3WG9 A;  2JRT A;  5E1X A;  2VE8 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...