2IJLA

The structure of a putative mode from agrobacterium tumefaciens.
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
116
structure length
110
Chain Sequence
KRLPLKPVLRIDFPPGERLGHGKVELMQLIAETGSISAAGRAMDMSYRRAWLLVDALNHMFRQPVICSQRGAALTVFGAELLERYRGMEERMNEALREDIDWLEANRNPQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transcription
molecule keywords Molybdenum-binding transcriptional repressor
publication title The structure of a putative ModE from Agrobacterium tumefaciens.
rcsb
source organism Agrobacterium tumefaciens str.
total genus 32
structure length 110
sequence length 116
chains with identical sequence B
ec nomenclature
pdb deposition date 2006-09-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00126 HTH_1 Bacterial regulatory helix-turn-helix protein, lysR family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 2ijlA00
1B9NA 3WGHA 2ZFWA 4UUVA 2XKOA 3L7WA 3I5UA 1AWCA 4P9FA 5D8LB 1B9MA 4L18B 4UNOA 5L3FA 1E17A 1Z9CA 1GHCA 2M5WA 3FXQA 1YIOA 2V1UA 4GYGA 5E1XA 3KZYA 1U5TC 2KJBA 4M72A 5CYVA 3BJ6A 1TTYA 1HSJA 4G6DA 4IHTA 3ZMZA 3F72A 1XGOA 1MDMA 4G7HF 3DQVC 1MKMA 2QQBA 2XV4S 4M6YA 3ECHA 2BEOA 5KVRA 3KP6A 4M6XA 1R1UA 1FYKA 2HKXA 4WF2A 2GAUA 3V8LA 3K1PA 1P4WA 2KJCA 3GYHX 5DV5A 3CO6C 5D5UB 1YQAA 3SQNA 4L9VA 1IN6A 1UB9A 2L54A 3CLOA 4ZH4F 3DEUA 2XVCA 4M71A 3I58A 3I0TA 4ENKA 5LEJA 3E3VA 3HOSA 3ZMDA 1UHMA 4YFNF 3BWGA 1LDKB 2XROA 1UFMA 5AONA 3ERED 1J9IA 1ZREA 1YO5C 1ODDA 3KLNA 1O57A 3WE3A 1XSDA 5FFZA 3WTTC 3DXJF 2WC2A 4GGGA 4CXFA 4NQWA 4IJAA 1OPCA 1G3TA 4Y17A 1SD4A 2A69F 5LHIA 2QYOA 2G7HA 4PDKA 5KK1A 3WGGA 5LBQA 2FOKA 3I53A 1YW8A 3WU1B 3QP5A 2EV0A 1U6GA 1W5SA 1XGNA 3AAFA 4UV9A 3WGIA 1T6SA 3JAMZ 2LF8A 1U5TB 4BQAA 3HRMA 5HS8A 1XCVA 3SHFA 4WXDA 3F3XA 3HHGA 2FBHA 5D8KB 3FMRA 2CO5A 3F6VA 1U8RA 1PDNC 3C3WA 2IW5A 1K6OA 1UHWA 4ENNA 2FF4A 3ULQB 4AIHA 2O0YA 2XAQA 5E1WA 2M87A 3VB2A 2BBYA 3CO7C 3J7AO 1F4KA 2RKHA 1MJ9A 1ZGAA 1TW3A 5BMZA 1T0FA 5ERIA 3RKYA 3BJOA 4EM0B 4HDUA 1WSUA 4Y13A 2UXXA 1HXDA 2DTRA 3HSEA 1XSXA 1SAXA 4MEXF 5HLGA 1SMYF 3EETA 1RUOA 3P7NA 2YR2A 1R36A 5LRSA 1ZLJA 5J6XA 1QQIA 5HOOA 2HKOA 2A5YB 2RV8A 1PP7U 2QVOA 4DQ2A 4Q48A 1R22A 4RB3C 1ZARA 3CJNA 1F1ZA 2L01A 2DQLA 1FYLA 3GFIA 5F64A 3HTSB 3BPVA 1EH7A 1SFXA 4P96A 4LLGF 3I59A 4R1HA 3WE2A 4MNUA 1IAWA 1K79A 2CQKA 2OA4A 1HKSA 1QZZA 3E5XA 3DPTA 4L5JA 2A07F 5DCFA 4MTEA 3CTAA 3K1MA 2F5CA 2JSCA 4BYYA 1FP1D 4UVAA 3ABUA 1HSTA 2QM3A 1QGPA 4KNYA 2R3SA 2HYGD 1FPQA 3K69A 4GYIA 5LGNA 5E1ZB 3LAJA 3LWFA 4ENJA 4ON0A 3M8FA 1FT9A 2J5PA 2P5LC 3D0SA 3R60A 2Q0OA 1JHHA 4CO8A 1S29A 3GXOA 2E1NA 6PAXA 2PLYA 2H94A 5LHHA 2LKPA 2F5FA 2ZKZA 1ZG3A 1ZAOA 3E6MA 1Z6RA 1P4XA 2GIVA 5ILVA 1GXQA 1FC3A 2ZMEA 1BIAA 2P5VA 3U9GA 2HEOA 2XRNA 5BQTA 4RGUA 2ZXJA 2PEXA 1IXSB 5TJJA 2ISZA 5HDNA 2IA1A 3VODA 5IT3A 2JPCA 2ISYA 4OIOF 5HVQC 3U1DA 2OZUA 4OIPF 1KQ9A 2VOPA 2FSWA 1FNNA 2VBZA 4BNCA 1DP7P 2ZCWA 5HDKA 4HDVA 1J2XA 3CUQA 1E2XA 2BV6A 1G6NA 1BI2A 2NNYA 1ZG5A 2MC3A 3KP5A 3V8KA 3WTUC 4OOIA 2EA4A 4D0PA 1BI1A 2MBFA 4MQVA 3ZMVA 4ESFA 3TOBA 2IA0A 5CVJA 3NQOA 4N9IA 2ACJA 5EEGA 3KEQA 1FBQA 1R58A 4Y15A 5LEKA 5FGMA 4KMUX 2O03A 3E6BA 1IUYA 4KMFA 3L00A 1HW5A 4IVNA 2QWWA 5L3DA 4KN4X 4O5VA 3ZN1A 4KT5C 5FD6A 2Z9OA 4RGXA 4HV6A 3U2RA 2EV6A 1B6AA 1G3WA 1Z91A 4UXNA 2IA2A 1ZHFA 3WTSC 1JHFA 2D2WA 2ADUA 2XHKA 4EGYA 5K5RA 1BI0A 4KYWA 1W7PD 5FLXK 4NHJA 2HDCA 2ESNA 3FM3A 3P9IA 1TNSA 1SFEA 1D3YA 1FBUA 3T5XA 2UZKA 4KUMA 3CUQC 4N0BA 4JK1X 2V9VA 1K7AA 1H9GA 3HIFA 3ZMTA 2ZJ2A 2E1CA 1YG2A 2WTEA 1IN5A 3H3ZA 1Y0UA 2EFPA 1KYWA 4BHCA 3DP7A 4Q47A 1TBXA 3F23A 4XLNF 1MD0A 5L3CA 2EFWA 1J75A 1NHAA 4I98B 2EV5A 1XSVA 1U2WA 5D5XB 2M8EA 4KIFA 4HQEA 2YSRA 3GWZA 2ESHA 2WWYA 4P5OA 4HZFA 2OZ6A 2XAFA 2GA1A 3I64A 1OYWA 4CGZA 2QQAA 3CDHA 2HTJA 3EYYA 4ASNA 4P55A 3GW2A 2O61A 5JVTA 2ZMEB 5HLIA 1IF1A 2VBYA 2JZYA 2MD5A 4U88A 1MJAA 4KICA 1WQ2A 3EQLF 4GCVA 1J0RA 2QENA 1HKTA 2L4MA 2PMUA 1KU7A 5FFXA 4ESBA 1XCBA 3GZ6A 4M9SA 3K9TA 4G8XA 2JTVA 4Q4ZF 1WRJA 2A6HF 4GO1A 4L9TA 3ROUA 3ZPLA 2YX4A 4PCQA 3DKWA 3CUQB 2D1VA 2Z5UA 2H09A 2DPUA 2P5KA 4EV0A 1KA8A 3R0JA 4BXUA 3KCCA 4ESJA 1BOAA 2P7VB 1O3SA 4OINF 2IT0A 2M45A 5LGTA 2A6EF 1XGMA 2STTA 2L4AA 4IRIA 3SFZA 2WV0A 5TRDA 2VT3A 4LGWA 1W7PB 5DDGA 2JRTA 2BE5F 5H20A 3RPQA 1BC8C 5D5WB 1YLFA 3COAC 4RB0A 4PGHA 1SD7A 2HFHA 4HX4A 4CHUA 5FLXZ 1K78B 5E18F 1SD6A 4L0ZB 3CUOA 3IHUA 4WCGA 3JTHA 3K0LA 3E5QA 1ZLKA 2OBPA 4L0YB 5ICGA 1FBSA 2IRFG 2PN6A 1PP8F 5CVUA 2H6BA 4I09A 4OMZA 1I27A 2HWVA 4KN7X 3MZHA 4HX7A 1HQCA 3WTWC 5HDGA 1JE8A 2DK8A 4ZZLA 1TQIA 2P6SA 1TQMA 1YS6A 2IPQX 1BN5A 4LK1F 3BJAA 1BIBA 1T39A 3P9KA 4RGRA 4HV5A 5BS6A 4G7OF 1CF7A 4UHTA 1S7AA 1IXCA 2YX7A 1XMKA 2VC0A 1VTNC 2NYXA 3RPUA 3E6DA 4CZZA 3T1BA 4R79A 1ZGJA 2K02A 4HLXA 1SMTA 3QU3A 2DT5A 5E17F 1Z6TA 4RAYA 5H6RA 5K5OA 4IF4A 5JFRA 4A6EA 2ZO4A 1IN4A 2XASA 5ILUA 4U0WA 2FE3A 4KA4A 2KKOA 3MWMA 3TO6A 1ONVA 1RZ4A 3FF5A 1DDNA 2M30A 1SFUA 1YS7A 3VEPA 3WTZA 2UXNA 2RN7A 1RUNA 2FQ3A 1PUEE 2FMLA 3B73A 3QAHA 5LLQA 1DPRA 2DBBA 4ZYGA 4CDGA 3I4PA 1J59A 4G94A 2K4BA 5DUKA 4H0EA 2PQ8A 1XN7A 2O3FA 3K2ZA 2W57A 1H0MA 2AS5F 3QU6A 1ZN2A 2HOEA 4WXCA 1OYYA 5J8CA 2FNAA 1YFHA 4U0YA 2QBYA 1KQ0A 5D6EA 4AVPA 3IRQA 3KETA 3EUHA 3KP4A 1XB4A 3TDUC 1MGTA 3GFJA 1BI3A 2OQRA 2XAJA 4M9ZA 4ZYHA 3MFKA 1MDMB 3LFKA 2V6CA 1IXRC 4U0VA 3GEZA 4XRFA 1JXSA 2M1BA 1ON1A 5A2QK 3Q9SA 1MZBA 4HAMA 1ZH5A 3R0AA 3KEOA 3Q5FA 4ENMA 1FOKA 1LJ9A 2HZTA 3LAPA 1ZRCA 2K86A 5LHGA 3KZZA 3J81K 2GQQA 2B0LA 2V1XA 2GXBA 2DAOA 3FWEA 3IWZA 3P9CA 4PGGA 2R7DA 2ETHA 2AXLA 5J8FA 3C7JA 1JGSA 1RNLA 3J80K 4B8XA 1HW2A 2Q2EA 2W84A 2HR3A 1ZRFA 3OOPA 4LK0F 3HYIA 1KU9A 3KFWX 2OD5A 1FYMA 2EFNA 1R5GA 3FX3A 2RQPA 2XAGA 4LFUA 2HYFA 4A6DA 2Z99A 1I1GA 3JSPA 5K5QA 2QQ9A 1G3SA 3K1NA 3KE2A 1STZA 4P9UA 1O3RA 1J7KA 2O8XA 3KLOA 2L02A 3F8NA 2ZNYA 3GUDA 5BPDA 4HLYA 2IVMA 1XMAA 3N97A 4A0YA 1EV7A 3IWFA 2EFOA 1KU3A 2MLKA 4MHGA 2RNJA 5JR3A 5JI6A 4I01A 4PZJA 5IT9K 2MA3A 2QUFA 4FX4A 3M7GA 5CVIA 2GZWA 5K1YA 4AIJA 5CVVA 2CW0F 3MEXA 4YG2F 4L5IA 1FZPB 4LB5A 3QRFF 3E6CC 1HW1A 2LSOA 1I5ZA 4N9HA 5FD5A 5DYMA 3V7SA 1TNTA 2FU4A 4MTDA 4K2EA 4WWCA 3GLXA 4WX9A 2COMA 3BPXA 4EJOA 2FMYA 4RB1A 3L2CA 1ON2A 4Z2YA 3G3ZA 5L3EA 3LQRA 4HBLA 2E7XA 4IRGA 2A68F 4RS8A 3HRSA 3GFMA 4I2OA 2XGXA 5JHUA 3RDIA 2FXAA 4UVCA 3BROA 4HQMA 2Z3YA 1B59A 3MAJA 1QBJA 2X0LA 5EEHA 4MGRA 1U3EM 3LA2A 2W85A 5A2QZ 4EVIA 3R6SA 3RYPA 4YIIA 4GXOA 1R1VA 4A0ZA 3KP3A 2FA5A 2QBYB 3N4MA 2H6CA 2OU2A 2CYYA 5HLHA 4I02A 4B09A 1W5TA 3DF8A 3DPLC 3QOPA 3I59B 4OIRF 2EJRA 3D5LA 3FZVA 5ICCA 2L3DA 3BY6A 2Z33A 4CYDA 4EM1A 2X4HA 3NEUA 2LNBA 2Y75A 2RC4A 1LEBA 4XSZF 5D4SA 2P4WA 4I0AA 2W24A 3J80Z 3T8TA 3H3UA 4IXAA 3I71A 3SXYA 1H9TA 1O3QA 4I0BA 4L9NA 1U5TA 1BM9A 3HHHA 3ECOA 2A3SA 4XBFA 5H6QA 4LJZF 4E70A 4R8HA 4EJVA 3RKWA 2VE9A 4UVBA 4M9XA 2BGCA 1USSA 4A2UA 2V79A 5E20A 4UV8A 1Z7UA 3ZQ7A 5DD4A 1P6RA 1Z05A 4LB6B 3HTUA 1KGSA 1O7FA 2NS0A 3VOEA 1OMIA 2Y0MA 4A5NA 3E5UA 3ZN0A 2DQRA 3GO5A 1LDJA 5IT9Z 3V8JA 2HS5A 3F22A 1G4DA 3WU0A 2STWA 3PQJA 3T8RA 5E8IA 3C1DA 2H27A 5BOXA 3ML6A 1P92A 3Q9VA 3W6JB 3RKXA 1FP2A 3HRTA 4WK8F 4RGSA 3M8EA 1TLHB 5BPIA 3HOTA 3G73A 1AOYA 1U78A 4RB2C 1XDUA 5AIPA 3F21A 4FX0A 4EJWA 2G9WA 3DV8A 4MEYF 2RVCA 2PG4A 2F5EA 4A0XA 1CGPA 2VONA 2ZNZA 3RJPA 2VE8A 3ZMUA 4EGZA 1O7LA 2EA2A 3S2WA 2VOOA 2YPRA 3FM5A 3F8BA 3B02A 3MCZA 2MLGA 1DUXC 2C6YA 4ZYEA 5DCMA 1LNWA 1FX7A 3HRUA 3IC7A 2RDPA 1J5YA 1QNTA 2RGVA 4AD9A 2PFBA 1KQ8A 1FSHA 3M9AA 4HOBA 1YYVA 1UCRA 4AWXB 2DPDA 5CJ9A 2Q8KA 2DLLA 4HA8A 3RTRA 1BJAA 2DW4A 2CFXA 1T98A 2Y48A 3WTVC 3HSFA 2FBKA 1D8JA 3O6BB 4QWQA 4XLPF 4LG0A 5DD8A 3V4GA 3MQ0A 1O3TA 1Q1HA 4O3MA 2LDUA 2FBIA 3TDZC 4O6JA 3W6KB 3F8CA 2F5DA 2DU9A 4G7ZF 5F1RA 3TGNA 3RYRA 3GF2A 4F7ZA 2W25A 3GX4X 3TOAA 2O6GE 3LSTA 2QZ8A 5ICEA 3LA7A 1P2FA 3GVAA 3L09A 1FLIA 3JSOA 4LMYA 3I54A 4LLLA 1YW9A 3FMSA 5D5VB 3OV8A 2D1HA 1LDDA 2NNNA 3WTYC 3IKTA 3RI4A 3FXRA 4HX8A 2BYVE 1S7OA 1F5TA 4BHPA 3BDDA 1ZG1A 3DFGA 3MZYA 2QLZA 4FT8A 5ILSA 3R61A 4BH9A 4WXHA 1S3JA 4IHSA 3V7CA 5CLSA 5ICFA 2E7WA 3ABTA 3HUGA 1R00A 5CVRA 1YTYA 1KYZA 3BP8A 3REOA 3QPTA 4OMYA 3M1EA 1T2KA 3ZP5A 4QLCU 4BHBA 1WI9A 2K27A 4HF1A 4G9YA 3LA3A 3EYIA 1EH8A 2IJLA 4HW0A 4ZYDA 1A04A 2G7UA 1B1BA 4S05A 3VFZA 2IP2A 2XIGA 3C18A 1S8NA 5F6FA 1ULYA 1LEAA 2YU3A 5DEQA 2GWRA 1FWZA 3TO9A 1V3FA 5ED4A 5D6FA 3IRRA 2HQRA 2GXGA 2UWMA 3KP2A 3F6OA 2HTSA 4AIKA 1DPUA 3ZMSA 3O3KA 4OIQF 1FY7A 3IL2A 1RI7A 2PBIA 5HS9A 2KRFA 2JT1A 2R7FA 1XGSA 1WWXA 1REPC 3FXUA 1X3UA 5DCMB 4ZZDA 1I6XA 4Q5SF 2PMHA 5DUIA 1USTA 2EB7A 2EK5A 1FSEA 3SZTA 2PJPA 1MJBA 2NRAC 4EMSA 5LGUA 2DK5A 4FHTA 4LLNA 3O2PE 2EWNA 1IZ1A 1F9NA 2HQNA 3GZ5A 2PI0A 4KFCA 2MH2A 3TKYA 1BBYA 3RIRA 3F8MA 2VBWA 4U7BA 1TQPA 1RIOH 1KU2A 2XUBA 2TDXA 2GA2A 4LG0B 2OQGA 1GXPA 4CICA 1IN8A 3T0YA 4M73A 1IN7A 5LRRA 1YW7A 1S6LA 2VN2A 1CF7B 4HF0A 3ISPA 1B4AA 3H92A 1OKRA 4G6QA 3IKVA 2P7CB 3BZ6A 1QO0D 4KIBA 2V1DA 1HKQA 2CGPA 1XD7A 4TV7A 5HS7A 2K7LA 2F2EA 4KIGA 4L9JA 1BC7C 2KIFA 4A5MA 3PQKA 2MH9A 1LB2A 3TO7A 1QZYA 4EJUA 3PFIA 4YFKF 2VBXA 1W7PA 5D4RA 2VC1A 1HBXG 1W4MA 1Z1DA 5FO5A 2K4JA 1V4RA 4IPAA 1QPMA 1R23A 2VT2A 2P6TA 3TQNA 2LF7A 2DI3A 2JPBA 1XDSA 2OAZA 2FEZA 4XSXF 1K78A 2XKPA 4YIFA 3EDPA 3JTGA 4S04A 4IRHA 2ZBKA 1GVJA 1IRGA 2XAHA 1T38A 3R4KA 4I7HA 2A61A 3J81Z 4HF2A 3LQQA 4HYEA 2FRHA 3FHZA 1ZRDA 1D5VA 2FNPA 1SD5A 1WKMA 1R1TA 3GFLA 1R7JA 3JW4A 5L3GA 2D45A 1L3LA 4EJTA 2KIUA 1IRFA 3E97A 1IW7F 4A12A 2CG4A 1P4AA 4JBAA 3NRVA 1R5HA 4U7DA 1L0OC 5AIQA 2ELHA 2CWEA 3WG9A 4JQFA 4EM2A 4YFXF 1OYIA 3L9FA 2HGCA 4NB5A 3ELKA 4DNCA 2J5OA 3QP6A 3WODF 2VXZA 4LD5A 1TW2A 3JAMK 1ZYRF 2EFQA 2P8TA 1I1SA 5E8GA 1D8KA 5FB2A 3WTXC 2DO7A 1C0WA 3FMQA 4KDPA 4EQQA 4OU0A 3SZPA 2NAZA 1OR7A 4MQ9F 2DFIA 3QPHA 1LVAA 1EH6A 3HSRA 4M74A 3BOQA 3F8FA 5L3BA 4ETSA 3V7RA 4BAYA 2CSOA 3KP7A 2VODA 1G3YA 4RAZA 2KIMA 1LQ1A
chains in the Genus database with same CATH superfamily
2M4GA 2WADA 1B9NA 4AVZA 3WGHA 2M3AA 2ZFWA 4CCNA 4BE0A 2PX9A 4UUVA 2XKOA 3L7WA 3I5UA 3J7AY 1AWCA 5K7FA 4P9FA 5D8LB 1B9MA 3AG2H 4L18B 4UNOA 5L3FA 1E17A 1Z9CA 1GHCA 2M5WA 3FXQA 4DBQA 4A3LJ 3QYEA 2FOWA 3H9GA 1YIOA 1WCMJ 4GYGA 4N4OB 5E1XA 5M3FJ 1VI0A 2V1UA 3JCUC 1U5TC 2KJBA 3KZYA 4M72A 2LVSA 4XRMA 5CYVA 3BJ6A 1OISA 1TTYA 1HSJA 4BDYA 4G6DA 4IHTA 3ZMZA 2HVSA 3F72A 1XGOA 5J1YA 1MDMA 4XOTA 4G7HF 1JKOC 1V55H 3DQVC 5B1AH 2WAEA 1MKMA 3H35A 2QQBA 4J01A 2XV4S 4M6YA 3ECHA 1DGRM 2R5ZA 1JI8A 2BEOA 5KVRA 3KP6A 2XPVA 1UAAA 4BJ6C 3FK7A 4M6XA 1VQ4I 2RNGA 3A2KA 1R1UA 1TWFJ 2EIJH 1FYKA 1VQ6I 2HKXA 4WF2A 1NK2P 2GAUA 3V8LA 1P7IA 1P4WA 3K1PA 2O8KA 2KJCA 5C4JJ 3GYHX 1MBEA 4HNVA 5DV5A 5HODA 5EJCA 4HRIA 4DBRA 3CO6C 4Y4RA 5D5UB 1U9NA 1YQAA 3SQNA 4L9VA 2V6EA 2Y9ZA 1IN6A 1UB9A 2L54A 4L5EA 3CLOA 1RR7A 4ZH4F 4XN3A 3QWLA 3WHCA 3DEUA 4XORA 1X1BA 2K9NA 2XVCA 2ZXHA 4N4NB 5M5YJ 4M71A 3I58A 2JRMA 3I0TA 4ENKA 5LEJA 3E3VA 3HOSA 3ZMDA 1UHMA 4YFNF 3BWGA 1LDKB 3FHNA 2XROA 3I4NJ 1NG6A 1UFMA 5AONA 3ERED 1J9IA 4JYKA 1ZREA 1YO5C 1ODDA 1LE8A 1R4MB 1O57A 3KLNA 3WE3A 1XSDA 3MKWB 2MD0A 5FFZA 3WTTC 3DXJF 2HOAA 1HA8A 2E71A 1FIPA 4PSWA 3FXMA 3OY9A 2WC2A 4GGGA 4CXFA 4NQWA 4IJAA 1W0TA 1YRNB 2Y0SA 3H5NA 3VPRA 4A3FJ 1OPCA 1G3TA 4Y17A 1SD4A 3S8PA 2I8DA 2A69F 2AXTC 5LHIA 2BY0A 1VQLI 3BG7A 2QYOA 2HOSA 2G7HA 4PDKA 5KK1A 3WGGA 5LBQA 2FOKA 1PUFA 3I53A 1YW8A 3WU1B 3QP5A 2EV0A 2E2HJ 1U6GA 3CCEI 1R49A 2DA4A 1W5SA 1XGNA 3AAFA 4UV9A 2OCCH 2LLKA 3WGIA 1YHQI 1OFCX 3CESA 1T6SA 5FJ8J 3JAMZ 2LF8A 4BBSJ 1U5TB 4BQAA 3HRMA 5HS8A 1XPXA 1XCVA 4XMYA 2LKSA 3HBLA 3SHFA 3H5RA 1A6QA 4D7NA 4WXDA 1W1WE 3F3XA 3HHGA 2FBHA 5D8KB 3FMRA 4XLFA 2CO5A 3F6VA 3D1NI 1U8RA 4DW6A 2X1DA 2ME0A 2VQHA 3IAS2 3DCFA 2E19A 1XMXA 1PDNC 3C3WA 3LSRA 2IW5A 1K6OA 1UHWA 4ENNA 2XGDA 2PJRB 2FF4A 3ULQB 4AIHA 3W3CA 2O0YA 2XAQA 2W48A 5E1WA 2M87A 3VB2A 2BBYA 2LREA 3CO7C 4CSWA 3J7AO 5FROA 2KPMA 1F4KA 2RKHA 1AHDP 3AL0C 1MJ9A 1ZGAA 3JRDA 3J7ZI 5FKLA 5FRMA 1TW3A 5BMZA 2HYJA 3GCMA 1T0FA 2FX0A 4II3A 2DMQA 5ERIA 3RKYA 3BJOA 4EM0B 1BA5A 4HDUA 2BVMA 1WSUA 4Y13A 2UXXA 2ZXWH 2AO9A 1HXDA 2DTRA 2DT7B 3HSEA 1XSXA 2QQ8A 4B43A 4CCJA 1SAXA 4MEXF 1VF9A 5HLGA 5IYCJ 1YX3A 2O5RA 1SMYF 3CMEI 3EETA 4E7IA 3ABLH 3HGYA 1RUOA 3P7NA 4BXFA 1OCTC 2EH3A 1U0JA 2YR2A 5FKNA 4FE4A 1R36A 5LRSA 1ZLJA 5J6XA 1QQIA 3S2DJ 5HOOA 2HKOA 1FEXA 2A5YB 3K7AJ 1TWHJ 2RV8A 3FXLA 1PP7U 2QVOA 4DQ2A 4Q48A 1R22A 4RB3C 2E2IJ 5TISC 1YX5A 1ZARA 2L7KA 3CJNA 1F1ZA 1HF0A 1Z3YA 2L01A 4RA2A 5J40A 2DQLA 3HPGA 1FYLA 1MBJA 3FBIB 2ZXIA 2L0KA 4CH7A 2WV1A 1B8IA 4PFPA 4CCOA 3GFIA 1WH7A 5F64A 3HTSB 3BPVA 1EH7A 2EQRA 1SFXA 4HSRA 4P96A 4LLGF 1ACIA 3S2HJ 3I59A 4R1HA 3QYBA 3WE2A 2VKVA 4MNUA 1Y56A 5IOYA 3TP3A 2DFFA 1IAWA 1WJCA 1K79A 2CQKA 1MH4A 2OA4A 1HKSA 2IEKA 1QZZA 3E5XA 3DPTA 3GTQJ 4L5JA 4QPOA 2A07F 5DCFA 3DWLE 4XR6A 4MTEA 4ANJA 3CTAA 4BS9A 3K1MA 2F5CA 2JSCA 4D5CA 1TC3C 4BYYA 5M3MJ 3OSFA 5F08A 1FP1D 4UVAA 2NOJB 2LH9A 3ABUA 1HSTA 2OCEA 1AA7A 2QM3A 1QGPA 2WB1A 3HG9A 4MO7A 1SC7A 3FBNB 2CV0A 4KNYA 2R3SA 2VKEA 3QPSA 1Q1VA 2LP0A 2UUZA 4B3AA 4GFBA 2HYGD 2O7OA 1FPQA 3K69A 4IQ4A 4A3EJ 4GYIA 4BY7J 5LGNA 2QSFX 5E1ZB 3LAJA 2DT6A 3LWFA 4ENJA 3OR2C 5GAEJ 4RM3A 4ON0A 3M8FA 4CYCB 3CCUI 1FT9A 1MIJA 2Z1DA 3M8JA 3TL4X 4D5FA 2J5PA 2P5LC 3D0SA 3R60A 4PJJA 4S0HB 2Q0OA 1JHHA 4CO8A 1S29A 5EEAA 3GXOA 2E1NA 2OPTA 6PAXA 1RR8C 2PLYA 2H94A 5LHHA 2LKPA 2ZSHB 2F5FA 1Z77A 3AL0B 3HJEA 1OQYA 2NXNB 2ZKZA 1ZG3A 2R93J 3L2WA 1ZAOA 1GV5A 3E6MA 3SYTA 1HDPA 3BR1A 1LE8B 1H8AC 2ZJRF 3K4CA 1Z6RA 1OJLA 2HI3A 1P4XA 2GIVA 5ILVA 1GXQA 2KLOA 1MSFC 1FC3A 5JLXA 2ZMEA 2M0MA 5E3LA 1BIAA 2P5VA 3O8HA 3I3LA 5HNFA 1JKPC 3U9GA 1Y39A 2HEOA 3WG7H 4YIRX 1D0YA 2XRNA 5BQTA 4X0GA 3ZQGA 3OIOA 4RGUA 5F1JA 4HNUA 2ZXJA 2PEXA 1IXSB 2BVLA 1FOWA 5TJJA 2ISZA 3H9QA 3W2VA 5HDNA 4GDFA 2IA1A 3VODA 4XRSA 5IT3A 2ZJQF 2JPCA 2ISYA 4OIOF 3M3YJ 5HVQC 2Y31A 4KISA 2DN0A 2JA7J 3U1DA 2IGOA 2KDOA 3SDBA 2DODA 2OZUA 4OIPF 1PUFB 3JRAA 4B44A 1KQ9A 1Z0XA 1JGGA 2VOPA 2FSWA 1FNNA 2VBZA 4BNCA 4DGWB 4BL0B 1DP7P 2ZCWA 5HDKA 2ID6A 4HDVA 1J2XA 3IH2A 2VIXA 4HG2A 3JR9A 3CUQA 1E2XA 2BV6A 1G6NA 1BI2A 2KZGA 3VYTB 2NNYA 1ZG5A 3OIQA 2MC3A 3KP5A 1QZEA 3V8KA 3GTJJ 3RKQA 3ZRGA 3WTUC 3DPUA 2L7MP 2IXSA 4BU2A 4PUSA 1OCRH 4OOIA 2EA4A 2H1LA 2AQEA 4II2A 1EF4A 1S5LC 4D0PA 1BI1A 2Q1ZB 1D1BA 2MBFA 1Y6IA 4MQVA 3ZMVA 4ESFA 3TOBA 2IA0A 3S3OA 1IG7A 5CVJA 2D5VA 2XB5A 1WJAA 3HB9A 3NQOA 4N9IA 5E3MA 2ACJA 4KT6A 2DYRH 1ETKA 5EEGA 5F0FA 2IS1A 3KEQA 1POGA 4F3QA 2VQGA 2JQ7A 4HNTA 3MVPA 1WJFA 3PO2J 1FBQA 1R58A 4Y15A 5LEKA 1BW5A 5FGMA 4KMUX 3OMYA 2O03A 4UY8I 3LMMA 1GLNA 2JVGA 4DIQA 3E6BA 3C2HA 1IUYA 4G6TB 2L9VA 2ZSIB 1VQMI 4KMFA 4ITVA 3TW6A 5TGTA 2ZMEC 3L00A 1HW5A 1YE9A 4UB8C 4IVNA 2QWWA 5L3DA 4KN4X 4O5VA 3ZN1A 2LG4A 2IGMA 4KT5C 5FD6A 3TP0A 3WHBA 5EGOB 2Z9OA 4RGXA 4HV6A 5F04A 1BR1A 1ETYA 3CF2A 2X1CA 1F43A 3MKYB 5E3NA 1Y1WJ 2M9HA 3OYGA 3U2RA 1FOYA 1MMNA 2EV6A 3PIPF 1R71A 1B6AA 1G3WA 1Z91A 4UXNA 2IA2A 1ZHFA 3WTSC 1JHFA 2D2WA 1A35A 3O8GA 5F27A 2ADUA 3H3VK 4DOZA 3D5SC 2XHKA 4EGYA 4Y3OA 3CCYA 5K5RA 4IX7A 4Z6YA 1BI0A 1A31A 4KYWA 1W7PD 2OUMA 5FLXK 1T56A 4NHJA 1MNEA 2ESNA 3FM3A 3P9IA 2HDCA 2XPWA 2K85A 1TNSA 3H9JA 1W5CC 1SAUA 1SFEA 1D3YA 1FBUA 3T5XA 2IBDA 2UZKA 4KUMA 3CUQC 5GPAA 4N0BA 4JK1X 2V9VA 2L9SA 2XRLA 3VSKA 1KZHA 1K7AA 1GT0C 1NTCA 1H9GA 1I3QJ 3HIFA 1WGXA 2BOLA 3ZMTA 3OYHA 2ZJ2A 2QSHX 4C9YA 4F55A 1SFOJ 3NAUA 4H4KC 3DLLF 4J19A 1YG2A 2WTEA 2E1CA 3UNGC 1IN5A 3OIPA 1U9OA 3H3ZA 4IL6C 2E1MC 2GOMA 3HZJA 2BY1A 1Y0UA 2EFPA 3PFYA 2WY8Q 1KYWA 2EINH 4BHCA 3DP7A 4E7KA 2JVHA 5EF6A 2CV2A 4Q47A 1TBXA 4NC6A 1VQKI 3HOZJ 3F23A 1V54H 2DYSH 4ZTFA 2VJ5A 2Y0SN 4IZZA 4XLNF 1WJDA 3FKJA 5GADJ 1MD0A 5L3CA 4XLHA 4V2FA 2EFWA 1J75A 2R5YA 1NHAA 3DBLB 4I98B 5EYRA 2EV5A 2RAEA 3CMYA 2V1NA 1XSVA 1U2WA 3K4BA 5D5XB 1NH3A 2M8EA 4KIFA 4CCLA 2L9RA 3ZR8X 4BQOA 2EIMH 4HQEA 3CCSI 1Z67A 4G12A 3GLLA 4DZPA 2YSRA 2K3PA 1JKQC 3GWZA 2DA7A 2ESHA 2WWYA 4P5OA 5CQGA 1JJ6C 4HZFA 2OZ6A 2XAFA 2R7OA 2GA1A 2WBMA 3I64A 3RQIA 1OYWA 5FRNA 2VPLA 1A6IA 4CGZA 4EEFG 3PSFA 5C4XJ 2QQAA 3HKZA 4RAFA 3CDHA 4YEJA 2HTJA 1FMVA 3ASOH 3EYYA 3BR5A 2MW8A 4ASNA 3SDGA 1K61A 4P55A 3GW2A 1ENHA 3PSIA 2O61A 5JVTA 1T95A 3CCLI 2ZMEB 4B1RA 5HLIA 1IF1A 2VBYA 4UB6C 1YI2I 2JZYA 2MD5A 4U88A 1MJAA 2VLAA 1QVUA 4KICA 4FCYA 1WQ2A 3DKXA 2F4IA 3EQLF 4GCVA 1J0RA 1UJ8A 3LSKA 2QENA 1HKTA 1RPWA 1MBFA 3A1YA 2L4MA 2PMUA 4Y7NJ 3DEWA 3LFUA 2ME6A 1KU7A 5FFXA 2CH0A 4ESBA 1XCBA 3K4JA 3GZ6A 3CJTB 4M9SA 3JRCA 4A3IJ 2KMUA 2MG4A 3BTIA 3K9TA 2QKMB 4G8XA 4UUSB 2VKDA 1FMWA 1Y0NA 2M7AA 2JTVA 4Q4ZF 1WRJA 2A6HF 4GO1A 4L9TA 3ROUA 2DDBA 3S32A 3ZPLA 3IH4A 1ZGWA 1EJ9A 3RSNA 2YX4A 4PCQA 3DKWA 2R7SA 3CUQB 2D1VA 2Z5UA 3ZQIA 2H09A 3CCJI 2DPUA 3AG1H 2P5KA 2ECCA 4EV0A 3CF5F 1DU6A 1E3HA 1KA8A 3TEDA 1ETVA 3HEFA 3R0JA 2JA6J 4BXUA 3KCCA 4JP0A 4ESJA 1BOAA 1K6YA 4JX4A 2P7VB 3W2AA 1O3SA 4RLFA 4OINF 2IT0A 5HLTA 1RESA 3U1KA 2M45A 4LG3A 5LGTA 3SEQA 5J1RA 2A6EF 1Z21A 1XGMA 4XM3A 2M7BA 2XSDC 2KQRA 2E1MB 2STTA 2L4AA 4IRIA 2KL4A 2NVUB 2DJNA 3HOWJ 4AC0A 2BW3A 1VNDA 3SFZA 4XIDA 4FASD 2WV0A 5DTDA 5TRDA 1TP4A 4ZJZA 5LD2C 1WI3A 1Y1VJ 2VT3A 4LGWA 5FKOA 3HOUJ 1W7PB 2K3FA 1W36D 5J1UA 2A05A 5DDGA 1N78A 2EZLA 1VQPI 2NS8A 2JRTA 2BE5F 5H20A 3A4CA 3RPQA 1BL0A 1BC8C 5D5WB 1OR7C 3GTMJ 3VYRB 4QSHA 4V19K 1YLFA 1TWGJ 4XLCA 4RB0A 3COAC 3NWSA 1H88C 5CPRB 2V9KA 4PGHA 1SD7A 2HFHA 4HX4A 4CHUA 3HXLA 2E5ZA 4PFOA 5FLXZ 1K78B 5KAIC 1YITI 5E18F 1SD6A 4L0ZB 3CUOA 3IHUA 4WCGA 3JTHA 3K0LA 3E5QA 1ZLKA 1K4SA 2F4OB 2OBPA 3N05A 4L0YB 2JA5J 3EPZA 2WB1N 3OYJA 5ICGA 1FBSA 4OWRB 2CW7A 1Y8RB 2IRFG 2PN6A 4U87A 1PP8F 3Q0WA 5CVUA 2H6BA 4I09A 4OMZA 2LK2A 4LIUA 3A02A 1I27A 3DU6A 2IGKA 1W36C 4A93J 2HWVA 3MZ8A 4C2UA 4V2GA 3BCBA 2F5VA 4KN7X 3MZHA 3HOVJ 1LKXA 1MBGA 3OL4A 2NVYJ 4HX7A 4BE1A 3VDXA 1TL8A 1HQCA 3WTWC 5HDGA 3K4NA 2DK8A 1JE8A 1JTYA 3OYKA 4LIVA 4ZZLA 1ERDA 1TQIA 3ERMA 2P6SA 4XKCA 1VQOI 1TQMA 1YS6A 2IPQX 1BN5A 3KZIC 4LK1F 1RRJA 3KYCB 3BJAA 2LTPA 1BIBA 2JA2A 1T39A 1G59A 3P9KA 4RGRA 4HV5A 4AU7A 3OS0A 5BS6A 3FXOA 4G7OF 4BEHA 1IRZA 2K40A 2DFHA 1CF7A 4UHTA 1S7AA 1IXCA 1WHUA 2YX7A 3HM5A 4KJZA 1XMKA 2VC0A 1VTNC 3K10A 1D0XA 2NYXA 3RPUA 2LKXA 3E6DA 4CZZA 3T1BA 4R79A 5EG0A 4D9JA 1ZGJA 2K02A 4HLXA 1SMTA 3PIOF 5GAHJ 3QU3A 2HU9A 2DT5A 5E17F 5F0CA 1Z6TA 4RAYA 4C2MJ 5H6RA 5K5OA 4IF4A 5JFRA 4A6EA 2ZO4A 1QPIA 4BDZA 1IN4A 2XASA 3K4MA 4BQQA 4U0WA 5ILUA 3LSJA 2FE3A 4KA4A 2KKOA 1G8XA 1MBHA 1I50J 3MWMA 1ONVA 3TO6A 1RZ4A 1AKHB 3FF5A 1DDNA 2M30A 3OYMA 1MSEC 1SFUA 1YS7A 3ABKH 1HOMA 3VEPA 3WTZA 2UXNA 2RN7A 1RUNA 3BR2A 4PJ0C 1IV8A 2FQ3A 4C2TA 2ECBA 2LY2A 1PUEE 4A3BJ 2FMLA 1WJEA 1X2NA 3B73A 2MSYA 4M3EA 3BQZA 1UZCA 3QAHA 3S3MA 4UUTA 4DYCA 5LLQA 2FJ1A 2YUSA 3Q0VA 2DA3A 1LVKA 2G0EA 1DPRA 2V4JC 2DBBA 2IGNA 3K70D 5B66C 4ZYGA 1XTAA 1X58A 3PNYA 3BR0A 4CDGA 2LD5A 3S17J 3I4PA 1J59A 4G94A 2K4BA 2NVQJ 3A01B 5DUKA 2GLOA 4H0EA 3CDLA 2PQ8A 1X1PA 2A5WA 2OF7A 1XN7A 1K4TA 2O3FA 3PNVA 3DU5A 3K2ZA 2JJ7A 2W57A 1H0MA 4B3XA 2AS5F 4XK4A 3QU6A 1APLC 3W6VA 2F6CA 1ZN2A 2HOEA 2LC2A 4WXCA 1OYYA 4JOMA 1B72A 5J8CA 2FNAA 1YFHA 3CD6I 2XC7A 2E60A 3ONQA 4U0YA 2QBYA 1JUSA 1KQ0A 1IDYA 3K70C 5D6EA 4AVPA 3IRQA 3KETA 3CCMI 4HPQA 3EUHA 3KP4A 1XB4A 3TDUC 1MGTA 3GFJA 2YU9J 1BI3A 2OQRA 2XAJA 4M9ZA 4ZYHA 1I39A 3MFKA 1MDMB 3LFKA 2V6CA 5F0HA 2CRGA 1RKWA 1IXRC 4U0VA 3GEZA 4XRFA 3S16J 1JXSA 2R5ZB 1U8BA 2M1BA 1ON1A 3IAM2 2CJJA 3U21A 5A2QK 3IP4B 3Q9SA 4DYQA 4KITB 1MZBA 4HAMA 1OCOH 4RM2A 3OYDA 1ZKGA 1ZH5A 1ZELA 3R0AA 2M4KA 3PL8A 3KEOA 3Q5FA 2VASA 5IYBJ 4XLAA 4C3HJ 4ENMA 1FOKA 1LJ9A 2HZTA 4J00A 5B1BH 3S1QJ 2R7XA 1P7JA 3G1LA 2TRTA 4X6AJ 3LAPA 5GTHC 4I6ZA 1ZRCA 3CP8A 2BXZA 3L2VA 2K86A 5LHGA 3OWTA 3KZZA 1T0FC 2KIQA 2CQXA 3J81K 1DQUA 2GQQA 2B0LA 3G1MA 1TZLA 5DM6F 2V1XA 2GXBA 2DAOA 3FWEA 4A69C 3IWZA 3P9CA 4PGGA 3S14J 2R7DA 1TWAJ 2ETHA 1QVTA 2WAQA 2AXLA 1GV2A 5J8FA 1YOVB 2IAIA 3C7JA 1VQ9I 1JGSA 3QODA 1RNLA 3J80K 4FE7A 4B8XA 2JUGA 1HW2A 2Q2EA 2W84A 2HR3A 4BACA 1ZRFA 2CV1A 2R0QC 2V7FA 3F9KA 1FTTA 3OOPA 4LK0F 2FQ4A 1O4XA 3HYIA 4AYBA 1KU9A 3KFWX 1WVRA 2RREA 1I3AA 2OD5A 5IPAA 3FISA 3ZOBA 1FYMA 4XKWA 3DTEA 2EFNA 1R5GA 2IS4A 2E1OA 1JJ8C 3FX3A 4E7SA 2R7VA 4NQWB 2RQPA 2X6WA 2XAGA 4LFUA 1QHGA 2HYFA 4A6DA 2Z99A 1I1GA 3OYBA 3JSPA 2M34A 4RDUA 5K5QA 2QQ9A 4IHVA 1PYVA 1G3SA 3ZQLA 1V5EA 2CUEA 3K1NA 3KE2A 1STZA 4B48A 5E3OA 3VYSB 4P9UA 4LOCA 1J7KA 2O8XA 3KLOA 5FKKA 5K7HA 1O3RA 2GM4A 1FOXA 1R6RA 3KYDB 4C3IJ 2MYSA 2ZJPF 2L02A 3F8NA 1QA6A 1S7EA 4XQFA 2ZNYA 3GUDA 5BPDA 4HLYA 2IVMA 1E3PA 1XMAA 1ZTRA 3N97A 4A0YA 1EV7A 2R92J 3IWFA 2EFOA 2QCOA 3PM1A 3KIOA 2OTLI 1KU3A 2MLKA 4MHGA 3BZKA 3HKZN 2RNJA 5JR3A 5JI6A 3H0DA 1X1AA 4I01A 2E2JJ 2NVTJ 1NG7A 4PZJA 1OCZH 4XNFA 5IT9K 3LOCA 3NARA 2MA3A 2QUFA 5C3EJ 4FX4A 3M7GA 5CVIA 5EG0B 3TBIA 2GZWA 4C30A 5K1YA 4AIJA 2PMZN 5CVVA 2OJED 2CW0F 3NWTA 3RZDJ 3DBRB 1SVOA 3SJMA 3MEXA 4YG2F 4L5IA 4NC8A 3CCRI 1FZPB 1IO2A 4EATA 4LB5A 3QRFF 5DM7F 3L1PA 3L2RA 1ZQ3P 2VJIA 4M6VA 4A3CJ 1YJ9I 3E6CC 3E7LA 3SEZA 1VQ8I 3OYIA 1IRXA 1HW1A 2DDAA 3AFHA 2E34A 3QOEA 2DXIA 2A6TA 2L5QA 2LSOA 3P5JA 2YS9A 1XG1A 1I5ZA 4N9HA 5FD5A 1R4NB 2LMDA 1LFBA 3LSIA 1IDZA 3HOXJ 5DYMA 3V7SA 1TNTA 2FU4A 4MTDA 4K2EA 4WWCA 2CUZA 4Y33A 4YRVA 3GLXA 3OYEA 2HQ5A 4WX9A 4AUXA 3CJQB 4E7JA 2FUG2 2COMA 3BPXA 4BBRJ 3FXJA 3JRFA 2BHYA 4EJOA 2FMYA 2W82A 4RB1A 4OAZA 3L2CA 3DKYA 1ON2A 4Z2YA 2DFEA 3G3ZA 5L3EA 3LQRA 3BG5A 4HBLA 1JUPA 2E7XA 4PJMA 4IRGA 3LNQA 2A68F 4RS8A 2CUJA 3HRSA 3GFMA 3I4MJ 1RETA 1EKEA 3H5AA 3S93A 1VQ5I 2XGXA 4I2OA 5JHUA 4Y52J 3IH3A 2BY3A 1HLVA 2E35A 2ZFUA 3BR6A 4FISA 3RDIA 2FXAA 1JT0A 4UVCA 3BROA 3IUOA 4JX5A 4HQMA 1F36A 1B59A 2Z3YA 4QPQA 5KCMA 3MAJA 1QBJA 2X0LA 5EEHA 4MGRA 1ZR2A 1U3EM 3LA2A 2W85A 2XF5A 2XDVA 5A2QZ 5EDNA 1ETQA 4M3BA 4EVIA 3R6SA 4E7LA 3RYPA 1G2HA 2B63J 4YIIA 1TWCJ 4GXOA 1MNMC 1R5ID 1R1VA 2JK3A 4A0ZA 3KP3A 1B72B 3M1CA 1B8IB 2FA5A 3CMAI 1X4PA 2QBYB 2WY7Q 2R7RA 3N4MA 3I9V2 2H6CA 3PJRA 2OU2A 2CYYA 5HLHA 4I02A 4B09A 1E3OC 1W5TA 3DF8A 3DPLC 1HDDC 3QOPA 3I59B 2NVXJ 4OIRF 2HXIA 2K9LA 1OCCH 2EJRA 3D5LA 1BR2A 3FZVA 5ICCA 2L3DA 3G2BA 4MFDA 4M3FA 3BY6A 2GIZA 1DGWY 2Z33A 5GP9A 2BXYA 4CYDA 3CCVI 4EM1A 2X4HA 3NEUA 2LNBA 2NS7A 2Y75A 1GUUA 3H1CA 2RC4A 1LEBA 2Y9YA 5IYDJ 3VYUB 4XN0A 4XSZF 2DA6A 2LBFA 5D4SA 2X6XA 3K2AA 2P4WA 4I0AA 2W24A 2LY9A 3OSGA 1G3YA 3J80Z 3CJRB 1A36A 2JWTA 2HDDA 3T8TA 3H3UA 4IXAA 3I71A 4NBQA 2X1EA 3SXYA 5E79C 1O3QA 1H9TA 4I0BA 2MFZA 2KRHA 4L9NA 1U5TA 3G4SI 1S9HA 3SZGA 1BM9A 3HHHA 3Q3SA 3ECOA 3GTKJ 2A3SA 2QGUA 4XBFA 2KHMA 5H6QA 4LJZF 3LSPA 4E70A 4R8HA 3DTIA 2DMPA 2DTZA 1MMSA 4EJVA 3RKWA 2VE9A 1X19A 4UVBA 1P9QC 5C44J 3GTGJ 1JUMA 4ZDPA 4XOPA 4B47A 3MN2A 1SANA 4M9XA 2BGCA 3BCAA 1USSA 4A2UA 2HXOA 2PJRA 2V79A 3ZQCA 5E20A 4UV8A 3EUKL 1Z7UA 2Q2EB 3ZQ7A 2X9DA 4XLEA 5DD4A 2XGCA 1P6RA 3A0HC 1Z05A 4LB6B 3BTCA 1KGSA 3HTUA 1O7FA 3BR3A 4IHXA 1ZR4A 2NS0A 3VOEA 1OMIA 1WZ2A 3CC7I 1BOBA 3HC7A 2PMZA 2EPFA 4FQGA 3GTOJ 2MGQA 2Y0MA 3K4KA 4A5NA 3E5UA 4A3GJ 2X48A 3ZN0A 2DQRA 3GO5A 1LDJA 5IT9Z 3V8JA 3MKLA 2HS5A 2KFDA 3F22A 1D5YA 3WU0A 2X6YA 1G4DA 3PQJA 3T8RA 3BLYA 4NUBA 2STWA 2DMUA 3GTLJ 1JTXA 5E8IA 3C1DA 2H27A 5BOXA 3ML6A 4FETA 1P92A 5EZHA 2VPRA 4IOAF 1GDTA 4NC7A 1X3ZB 2HVQA 3Q9VA 3W6JB 3ZCOA 3FK6A 3RKXA 1FP2A 3DEEA 3HRTA 4BUPA 4WK8F 4RGSA 2UV1A 3M8EA 1LFUP 9ANTA 1TLHB 5KNLA 2X85A 4PJLA 1MMAA 3IV5A 5BPIA 3HOTA 2Y69H 3G73A 1UMQA 2Z2SB 1VFCA 1AOYA 4M3DA 3ZQHA 4PK4A 1U78A 3KEYA 5IP7J 4RB2C 1XDUA 1D0ZA 5AIPA 4FX0A 2XF6A 4EJWA 3F21A 3UKGA 2G9WA 3DV8A 2EBIA 4MEYF 2RVCA 2PG4A 2F5EA 3LSMA 4DJAA 2XPUA 4A0XA 4RLQA 1IGNA 1QHHD 2OC6A 1CGPA 2VONA 2DJIA 2ZNZA 4XKBA 3RJPA 3OYLA 2MABA 3Q0UA 2VE8A 1WPKA 2W1OA 3ZMUA 4EGZA 3AKZA 4E7ZA 3BT9A 1O7LA 2EA2A 3S2WA 5M5XJ 2VOOA 2YPRA 3FM5A 4C3JJ 3F8BA 3B02A 2ELJA 3MCZA 1IV6A 3H36A 2MLGA 4X1EA 2LRDA 1DUXC 2C6YA 4ZYEA 5DCMA 1LNWA 1FX7A 2OV7A 3I55I 3HRUA 4A3JJ 3IC7A 3ASNH 1XX5A 4CYCA 2RDPA 1OLTA 1J5YA 1QNTA 2RGVA 4BE2A 5GAGJ 4AD9A 2PFBA 1KQ8A 5KAFC 1X2MA 2R7UA 4A3MJ 4RAGA 1RKTA 3CP2A 1FSHA 3JRGA 3M9AA 4I76A 5LFAA 2CQQA 4HOBA 1YYVA 1UCRA 2HVRA 4AWXB 2DPDA 1YIJI 3CLQA 1M1EB 5CJ9A 1LPQA 2Q8KA 2WA0A 3BG3A 2DLLA 4HA8A 3RTRA 1BJAA 2DW4A 2L2OA 1J09A 2F48A 1UG0A 3K4LA 2CFXA 1LUJB 1T98A 2Y48A 2QKLB 3WTVC 1MW7A 3HSFA 3H0GJ 2FBKA 2HQAA 3BTLA 1D8JA 1ORKA 3O6BB 4QWQA 4XLPF 4LG0A 5DD8A 3V4GA 3MQ0A 1IC8A 1O3TA 2WAQN 1Q1HA 4O3MA 2V26A 2LDUA 4RBOA 2FBIA 3TDZC 4O6JA 3M4OJ 2DCEA 1TT5B 1ITYA 3W6KB 3F8CA 2F5DA 2R7QA 2I5UA 3G71I 1XC5A 3HGGA 4DZJA 2DU9A 2P81A 5KHDA 4G7ZF 5F1RA 3TGNA 2BZTA 2COBA 3RYRA 2QSGX 3GF2A 1PJRA 5JLWA 4AYBN 4F7ZA 3V42A 2W25A 2M0CA 1IUFA 3GX4X 1T08B 3TOAA 4IO9F 1X1CA 2LBFB 3L2QA 2O6GE 4ZDOA 2KRCA 3LSTA 2QZ8A 5ICEA 3LA7A 1P2FA 3A0BC 3GVAA 2CMPA 3L09A 1V5FA 2XGEA 1FLIA 3JSOA 4LMYA 3ESWB 1N25A 2LR8A 2Z16A 3HOYJ 3I54A 5J4YA 4LLLA 1T8IA 1UHSA 2Y2ZA 2VKHA 3BTJA 1YW9A 2R5YB 4AM3A 3FMSA 2B9SA 5D5VB 3B6CA 3OV8A 2D1HA 2DA1A 1LDDA 3G6EI 4W97A 2NNNA 3WTYC 3IKTA 2B7EA 2DMTA 3RI4A 3FXRA 2O9LA 3OL3A 5CQEA 4HX8A 2BYVE 1S7OA 2VJ4A 3QYFA 3MMYB 1F5TA 4BHPA 3BDDA 2CUFA 4NDLA 1ZG1A 3DFGA 1AU7A 2CS3A 4XRSG 3AG4H 3MZYA 1DU0A 2QLZA 3F0CA 2M2EA 4FT8A 5ILSA 3R61A 4CCKA 3RPUD 2M8GX 4BH9A 4ZYAA 3ZQFA 5GPCA 4WXHA 4BGDA 1S3JA 2K5CA 4LITA 4IHSA 5FLVA 1X1DA 3V7CA 5CLSA 2IS2A 5ICFA 2E7WA 3ABTA 3HUGA 1R00A 5CVRA 1YTYA 3S3NA 2R7WA 4CZCA 1KYZA 3BP8A 2CFOA 3REOA 3QPTA 4IKFA 1ETOA 1I6HJ 3BZCA 3TMOA 4OMYA 3M1EA 3RZOJ 1T2KA 3ZP5A 2IS6A 1WH5A 4QLCU 4BHBA 2W4SA 5EGOA 2DOEA 2X6OA 4QTRA 5IY5H 1WI9A 2K27A 2QEXI 1Y8QB 2EIKH 1GVDA 2GXAA 4HF1A 4G9YA 4XL9A 4E7HA 3LA3A 3EYIA 4XONA 1EH8A 4RMNA 2NOGA 2VI6A 4ZTJA 2IJLA 1OCPA 3BG6A 3CZ6A 4F52A 1JT6A 2EZHA 4HW0A 4ZYDA 1A04A 2G7UA 1B1BA 4IQJA 4S05A 3VFZA 2VB6A 2IP2A 1DP3A 2XIGA 3C18A 2TCTA 3SFIA 1S8NA 5F6FA 4MIMA 2BHZA 1ULYA 2YU3A 1LEAA 2CQ7A 1MBKA 3GTPJ 5DEQA 2GWRA 3ZQQA 1S72I 1BR4A 1FWZA 4JX6A 5B5EC 3TO9A 2OTJI 1V3FA 5ED4A 5HNHA 2QA4I 5D6FA 3IRRA 2HQRA 2LYCA 2GXGA 2UWMA 3KP2A 1ZK8A 4GRIA 4I99C 1NK3P 3F6OA 2HTSA 4AIKA 2BW3B 1ETXA 2K9MA 3ZMSA 1DPUA 3O3KA 4OIQF 1FY7A 3IL2A 1RI7A 3WU2C 4E4HA 2PBIA 1A5JA 5HS9A 1VZ0A 2KRFA 2JT1A 1VQ7I 2R7FA 1UELB 2H8RA 3K6GA 4MFEA 1XGSA 1WWXA 4DYRA 5M5WJ 1K83J 4MLOA 3LL7A 3FXUA 1X3UA 1REPC 5DCMB 4ZZDA 2DMNA 5IP9J 1MNDA 3OYFA 3JRHA 2JA8J 2HNHA 2R7TA 2ICWG 1Z3XA 1I6XA 2CU7A 3W2WA 4HSTA 2ID3A 3RQ4A 2PMHA 4Q5SF 2DA2A 4ZDLA 1BW6A 5DUIA 3CMMA 1USTA 2EB7A 1TT0A 2EK5A 1FSEA 2CW8A 1WJBA 3SZTA 3OYAA 2PJPA 1MJBA 2NRAC 4F91B 4EMSA 5LGUA 2DK5A 2F4MB 3MD2A 4FHTA 4LLNA 5IP6A 3D5RC 3O2PE 2EWNA 1IZ1A 1F9NA 2HQNA 1PVEA 2HOTA 4XICA 3GZ5A 2PI0A 2RQQA 2GOXB 4M3GA 3OOUA 1MMDA 1FIAA 4KFCA 2HPIA 2MH2A 3DBHB 3TKYA 3S1MJ 1BBYA 3RIRA 3F8MA 4CUGA 2VBWA 4U7BA 1TQPA 1RIOH 4IHWA 2EZIA 2JUCA 2AQFA 3CCQI 5CKTA 5B3SH 2WAFA 1KU2A 3C2GA 2XUBA 2TDXA 3EUHC 2I10A 2GA2A 3I56I 4YELA 3JREA 3FDYA 4LG0B 1SVLA 2OQGA 4CICA 1GXPA 3S15J 1VQNI 4IOCF 1IN8A 2HPMA 1FTZA 5BNGA 3UR3C 2W7NA 3T0YA 1CQTA 2P0WA 4M73A 4BJTA 4A3KJ 4IEJA 1IN7A 3FKIJ 5LRRA 3KYLA 4BEHB 2KISA 5GTIC 1YW7A 2JSPA 1S6LA 3EUAA 2VN2A 1CF7B 5DS9A 1QU3A 1HCRA 4IHYA 4HF0A 3ISPA 1B4AA 5FKMA 3GBGA 3H92A 1OKRA 4G6QA 3IKVA 1IJWC 1JKRC 5JHFA 3KX2A 1MH3A 2P7CB 3BZ6A 1QO0D 4UUSA 3J7YJ 2XSJC 3E1SA 3CDIA 1EA3A 3E0JB 1WFXA 4KIBA 5IOZA 1SEUA 2V1DA 2KP6A 4BKXA 2W00A 3OR1C 3HDDA 1HKQA 1Z7LA 2CGPA 1XD7A 3DTKA 5H2FC 4TV7A 1X4OA 5HS7A 3VWBA 2K7LA 2F2EA 3BQYA 4KIGA 4L9JA 1UG2A 1BC7C 2KIFA 2K9QA 4A5MA 3OS1A 4BXXJ 3GMEA 3PQKA 2MH9A 1X3WB 2VQLA 3KPHA 1LB2A 2E5NA 3TO7A 4BY1J 3OYCA 1BJZA 1QZYA 2JN6A 2KT0A 4EJUA 2VJJA 4ABZA 2QF7A 2HZDA 3PFIA 4YFKF 3FIWA 2VBXA 2ZC2A 1W7PA 4NNJA 3TW7A 5D4RA 2VC1A 3C2BA 1QRYA 3FXKA 1HBXG 2E36A 1W4MA 1Z1DA 2ELKA 4D1QA 3A03A 2KZVA 5FO5A 2K4JA 2AHQA 1V4RA 3OYNA 4IPAA 3HPHA 1QPMA 1R23A 2VT2A 2P6TA 3TQNA 2K9SA 2LF7A 2VUMJ 2DI3A 1V5GA 2JPBA 2LY1A 3HUGB 1XDSA 2OAZA 4HEA2 2FEZA 2R7ZJ 4XSXF 1K78A 2XKPA 1LFPA 4YIFA 3ZGKA 3EDPA 1MMGA 3JTGA 4S04A 4IRHA 2ZB9A 2ZBKA 1GVJA 1IRGA 1D1AA 2XAHA 4XKVA 1T38A 1HC8A 2DA5A 5J47A 3R4KA 4I7HA 3QQAA 5J3LA 1ETWA 1WJ5A 1YJNI 4BJ5C 1KONA 5JVGF 4FTHA 2VQCA 1R9TJ 1YRNA 2BY2A 5J4VA 2A61A 3J81Z 2GBYA 4HF2A 3LQQA 3CQZJ 4HYEA 2FRHA 3FHZA 4ZC3A 2N8GA 1ZRDA 1E0EA 1D5VA 2FNPA 1SD5A 4PSXA 4P1WA 4B4CA 1WKMA 2JMWA 1XS9A 3HL2A 1R1TA 2L9NA 3GFLA 4W1UA 4F93B 4F92B 1R7JA 1SFKA 1D1CA 1SVMA 3JW4A 5L3GA 3BC8A 2D45A 1L3LA 4AIDA 2DOAA 4OAYA 1N77A 1RC9A 4EJTA 2KIUA 1IRFA 3QPLA 3E97A 3L2UA 1IW7F 4A12A 2H8WA 3LSHA 2CG4A 1P4AA 4JBAA 3NRVA 1R5HA 3M07A 4U7DA 2L7FP 3CC2I 1L0OC 4D7MA 3PNTA 5AIQA 5FLMJ 2V9PA 2HDWA 2ELHA 2DOFA 2CWEA 3WG9A 2FD5A 4JQFA 4EM2A 2X51A 4YFXF 5K7ZA 1YJWI 1OYIA 2R4GA 1T33A 3S1RJ 3L9FA 2HGCA 2XB0X 3OS2A 2EZKA 4NB5A 2LFBA 3ELKA 1AKHA 4DNCA 2J5OA 3ZXSA 3QP6A 2H1KA 3WODF 2VXZA 3VSLA 3PUBA 4LD5A 1TW2A 3JAMK 3CC4I 3LSGA 1ZYRF 3ABMH 2EFQA 3PO3J 3DLAA 2P8TA 1I1SA 5E8GA 1D8KA 5FB2A 3WTXC 2DO7A 1C0WA 3FMQA 3PUFA 1W0UA 4KDPA 4CCMA 2Y30A 4EQQA 3JRBA 2VL8A 4OU0A 3SZPA 2NAZA 1FJLA 4PJNA 1OR7A 4MQ9F 2DFIA 3B6AA 4QIWN 3QPHA 1LVAA 2CQNA 2XF7A 1EH6A 2XAUA 3HSRA 2KDZA 3S1NJ 4CA0A 4M74A 3RCOA 3X2QH 3MKZA 3BOQA 3F8FA 4E6KG 2EILH 3BG9A 2MC4A 5EZGA 4ETSA 5L3BA 3A01A 2L7ZA 3G1OA 3V7RA 3JRIA 3GZNB 1N75A 4BAYA 4A3DJ 2CSOA 1H89C 2VXDA 3KP7A 2VODA 4BQNA 3AG3H 2LOOA 4RAZA 2KIMA 1LQ1A
chains in the Genus database with same CATH topology
1B9NA 3WGHA 2ZFWA 4UUVA 2XKOA 3L7WA 3I5UA 1AWCA 4P9FA 5D8LB 1B9MA 4L18B 4UNOA 5L3FA 1E17A 1Z9CA 1GHCA 2M5WA 3FXQA 1YIOA 2V1UA 4GYGA 5E1XA 3KZYA 1U5TC 2KJBA 4M72A 5CYVA 3BJ6A 1TTYA 1HSJA 4G6DA 4IHTA 3ZMZA 3F72A 1XGOA 1MDMA 4G7HF 3DQVC 1MKMA 2QQBA 2XV4S 4M6YA 3ECHA 2BEOA 5KVRA 3KP6A 4M6XA 1R1UA 1FYKA 2HKXA 4WF2A 2GAUA 3V8LA 3K1PA 1P4WA 2KJCA 3GYHX 5DV5A 3CO6C 5D5UB 1YQAA 3SQNA 4L9VA 1IN6A 1UB9A 2L54A 3CLOA 4ZH4F 3DEUA 2XVCA 4M71A 3I58A 3I0TA 4ENKA 5LEJA 3E3VA 3HOSA 3ZMDA 1UHMA 4YFNF 3BWGA 1LDKB 2XROA 1UFMA 5AONA 3ERED 1J9IA 1ZREA 1YO5C 1ODDA 3KLNA 1O57A 3WE3A 1XSDA 5FFZA 3WTTC 3DXJF 2WC2A 4GGGA 4CXFA 4NQWA 4IJAA 1OPCA 1G3TA 4Y17A 1SD4A 2A69F 5LHIA 2QYOA 2G7HA 4PDKA 5KK1A 3WGGA 5LBQA 2FOKA 3I53A 1YW8A 3WU1B 3QP5A 2EV0A 1U6GA 1W5SA 1XGNA 3AAFA 4UV9A 3WGIA 1T6SA 3JAMZ 2LF8A 1U5TB 4BQAA 3HRMA 5HS8A 1XCVA 3SHFA 4WXDA 3F3XA 3HHGA 2FBHA 5D8KB 3FMRA 2CO5A 3F6VA 1U8RA 1PDNC 3C3WA 2IW5A 1K6OA 1UHWA 4ENNA 2FF4A 3ULQB 4AIHA 2O0YA 2XAQA 5E1WA 2M87A 3VB2A 2BBYA 3CO7C 3J7AO 1F4KA 2RKHA 1MJ9A 1ZGAA 1TW3A 5BMZA 1T0FA 5ERIA 3RKYA 3BJOA 4EM0B 4HDUA 1WSUA 4Y13A 2UXXA 1HXDA 2DTRA 3HSEA 1XSXA 1SAXA 4MEXF 5HLGA 1SMYF 3EETA 1RUOA 3P7NA 2YR2A 1R36A 5LRSA 1ZLJA 5J6XA 1QQIA 5HOOA 2HKOA 2A5YB 2RV8A 1PP7U 2QVOA 4DQ2A 4Q48A 1R22A 4RB3C 1ZARA 3CJNA 1F1ZA 2L01A 2DQLA 1FYLA 3GFIA 5F64A 3HTSB 3BPVA 1EH7A 1SFXA 4P96A 4LLGF 3I59A 4R1HA 3WE2A 4MNUA 1IAWA 1K79A 2CQKA 2OA4A 1HKSA 1QZZA 3E5XA 3DPTA 4L5JA 2A07F 5DCFA 4MTEA 3CTAA 3K1MA 2F5CA 2JSCA 4BYYA 1FP1D 4UVAA 3ABUA 1HSTA 2QM3A 1QGPA 4KNYA 2R3SA 2HYGD 1FPQA 3K69A 4GYIA 5LGNA 5E1ZB 3LAJA 3LWFA 4ENJA 4ON0A 3M8FA 1FT9A 2J5PA 2P5LC 3D0SA 3R60A 2Q0OA 1JHHA 4CO8A 1S29A 3GXOA 2E1NA 6PAXA 2PLYA 2H94A 5LHHA 2LKPA 2F5FA 2ZKZA 1ZG3A 1ZAOA 3E6MA 1Z6RA 1P4XA 2GIVA 5ILVA 1GXQA 1FC3A 2ZMEA 1BIAA 2P5VA 3U9GA 2HEOA 2XRNA 5BQTA 4RGUA 2ZXJA 2PEXA 1IXSB 5TJJA 2ISZA 5HDNA 2IA1A 3VODA 5IT3A 2JPCA 2ISYA 4OIOF 5HVQC 3U1DA 2OZUA 4OIPF 1KQ9A 2VOPA 2FSWA 1FNNA 2VBZA 4BNCA 1DP7P 2ZCWA 5HDKA 4HDVA 1J2XA 3CUQA 1E2XA 2BV6A 1G6NA 1BI2A 2NNYA 1ZG5A 2MC3A 3KP5A 3V8KA 3WTUC 4OOIA 2EA4A 4D0PA 1BI1A 2MBFA 4MQVA 3ZMVA 4ESFA 3TOBA 2IA0A 5CVJA 3NQOA 4N9IA 2ACJA 5EEGA 3KEQA 1FBQA 1R58A 4Y15A 5LEKA 5FGMA 4KMUX 2O03A 3E6BA 1IUYA 4KMFA 3L00A 1HW5A 4IVNA 2QWWA 5L3DA 4KN4X 4O5VA 3ZN1A 4KT5C 5FD6A 2Z9OA 4RGXA 4HV6A 3U2RA 2EV6A 1B6AA 1G3WA 1Z91A 4UXNA 2IA2A 1ZHFA 3WTSC 1JHFA 2D2WA 2ADUA 2XHKA 4EGYA 5K5RA 1BI0A 4KYWA 1W7PD 5FLXK 4NHJA 2HDCA 2ESNA 3FM3A 3P9IA 1TNSA 1SFEA 1D3YA 1FBUA 3T5XA 2UZKA 4KUMA 3CUQC 4N0BA 4JK1X 2V9VA 1K7AA 1H9GA 3HIFA 3ZMTA 2ZJ2A 2E1CA 1YG2A 2WTEA 1IN5A 3H3ZA 1Y0UA 2EFPA 1KYWA 4BHCA 3DP7A 4Q47A 1TBXA 3F23A 4XLNF 1MD0A 5L3CA 2EFWA 1J75A 1NHAA 4I98B 2EV5A 1XSVA 1U2WA 5D5XB 2M8EA 4KIFA 4HQEA 2YSRA 3GWZA 2ESHA 2WWYA 4P5OA 4HZFA 2OZ6A 2XAFA 2GA1A 3I64A 1OYWA 4CGZA 2QQAA 3CDHA 2HTJA 3EYYA 4ASNA 4P55A 3GW2A 2O61A 5JVTA 2ZMEB 5HLIA 1IF1A 2VBYA 2JZYA 2MD5A 4U88A 1MJAA 4KICA 1WQ2A 3EQLF 4GCVA 1J0RA 2QENA 1HKTA 2L4MA 2PMUA 1KU7A 5FFXA 4ESBA 1XCBA 3GZ6A 4M9SA 3K9TA 4G8XA 2JTVA 4Q4ZF 1WRJA 2A6HF 4GO1A 4L9TA 3ROUA 3ZPLA 2YX4A 4PCQA 3DKWA 3CUQB 2D1VA 2Z5UA 2H09A 2DPUA 2P5KA 4EV0A 1KA8A 3R0JA 4BXUA 3KCCA 4ESJA 1BOAA 2P7VB 1O3SA 4OINF 2IT0A 2M45A 5LGTA 2A6EF 1XGMA 2STTA 2L4AA 4IRIA 3SFZA 2WV0A 5TRDA 2VT3A 4LGWA 1W7PB 5DDGA 2JRTA 2BE5F 5H20A 3RPQA 1BC8C 5D5WB 1YLFA 3COAC 4RB0A 4PGHA 1SD7A 2HFHA 4HX4A 4CHUA 5FLXZ 1K78B 5E18F 1SD6A 4L0ZB 3CUOA 3IHUA 4WCGA 3JTHA 3K0LA 3E5QA 1ZLKA 2OBPA 4L0YB 5ICGA 1FBSA 2IRFG 2PN6A 1PP8F 5CVUA 2H6BA 4I09A 4OMZA 1I27A 2HWVA 4KN7X 3MZHA 4HX7A 1HQCA 3WTWC 5HDGA 1JE8A 2DK8A 4ZZLA 1TQIA 2P6SA 1TQMA 1YS6A 2IPQX 1BN5A 4LK1F 3BJAA 1BIBA 1T39A 3P9KA 4RGRA 4HV5A 5BS6A 4G7OF 1CF7A 4UHTA 1S7AA 1IXCA 2YX7A 1XMKA 2VC0A 1VTNC 2NYXA 3RPUA 3E6DA 4CZZA 3T1BA 4R79A 1ZGJA 2K02A 4HLXA 1SMTA 3QU3A 2DT5A 5E17F 1Z6TA 4RAYA 5H6RA 5K5OA 4IF4A 5JFRA 4A6EA 2ZO4A 1IN4A 2XASA 5ILUA 4U0WA 2FE3A 4KA4A 2KKOA 3MWMA 3TO6A 1ONVA 1RZ4A 3FF5A 1DDNA 2M30A 1SFUA 1YS7A 3VEPA 3WTZA 2UXNA 2RN7A 1RUNA 2FQ3A 1PUEE 2FMLA 3B73A 3QAHA 5LLQA 1DPRA 2DBBA 4ZYGA 4CDGA 3I4PA 1J59A 4G94A 2K4BA 5DUKA 4H0EA 2PQ8A 1XN7A 2O3FA 3K2ZA 2W57A 1H0MA 2AS5F 3QU6A 1ZN2A 2HOEA 4WXCA 1OYYA 5J8CA 2FNAA 1YFHA 4U0YA 2QBYA 1KQ0A 5D6EA 4AVPA 3IRQA 3KETA 3EUHA 3KP4A 1XB4A 3TDUC 1MGTA 3GFJA 1BI3A 2OQRA 2XAJA 4M9ZA 4ZYHA 3MFKA 1MDMB 3LFKA 2V6CA 1IXRC 4U0VA 3GEZA 4XRFA 1JXSA 2M1BA 1ON1A 5A2QK 3Q9SA 1MZBA 4HAMA 1ZH5A 3R0AA 3KEOA 3Q5FA 4ENMA 1FOKA 1LJ9A 2HZTA 3LAPA 1ZRCA 2K86A 5LHGA 3KZZA 3J81K 2GQQA 2B0LA 2V1XA 2GXBA 2DAOA 3FWEA 3IWZA 3P9CA 4PGGA 2R7DA 2ETHA 2AXLA 5J8FA 3C7JA 1JGSA 1RNLA 3J80K 4B8XA 1HW2A 2Q2EA 2W84A 2HR3A 1ZRFA 3OOPA 4LK0F 3HYIA 1KU9A 3KFWX 2OD5A 1FYMA 2EFNA 1R5GA 3FX3A 2RQPA 2XAGA 4LFUA 2HYFA 4A6DA 2Z99A 1I1GA 3JSPA 5K5QA 2QQ9A 1G3SA 3K1NA 3KE2A 1STZA 4P9UA 1O3RA 1J7KA 2O8XA 3KLOA 2L02A 3F8NA 2ZNYA 3GUDA 5BPDA 4HLYA 2IVMA 1XMAA 3N97A 4A0YA 1EV7A 3IWFA 2EFOA 1KU3A 2MLKA 4MHGA 2RNJA 5JR3A 5JI6A 4I01A 4PZJA 5IT9K 2MA3A 2QUFA 4FX4A 3M7GA 5CVIA 2GZWA 5K1YA 4AIJA 5CVVA 2CW0F 3MEXA 4YG2F 4L5IA 1FZPB 4LB5A 3QRFF 3E6CC 1HW1A 2LSOA 1I5ZA 4N9HA 5FD5A 5DYMA 3V7SA 1TNTA 2FU4A 4MTDA 4K2EA 4WWCA 3GLXA 4WX9A 2COMA 3BPXA 4EJOA 2FMYA 4RB1A 3L2CA 1ON2A 4Z2YA 3G3ZA 5L3EA 3LQRA 4HBLA 2E7XA 4IRGA 2A68F 4RS8A 3HRSA 3GFMA 4I2OA 2XGXA 5JHUA 3RDIA 2FXAA 4UVCA 3BROA 4HQMA 2Z3YA 1B59A 3MAJA 1QBJA 2X0LA 5EEHA 4MGRA 1U3EM 3LA2A 2W85A 5A2QZ 4EVIA 3R6SA 3RYPA 4YIIA 4GXOA 1R1VA 4A0ZA 3KP3A 2FA5A 2QBYB 3N4MA 2H6CA 2OU2A 2CYYA 5HLHA 4I02A 4B09A 1W5TA 3DF8A 3DPLC 3QOPA 3I59B 4OIRF 2EJRA 3D5LA 3FZVA 5ICCA 2L3DA 3BY6A 2Z33A 4CYDA 4EM1A 2X4HA 3NEUA 2LNBA 2Y75A 2RC4A 1LEBA 4XSZF 5D4SA 2P4WA 4I0AA 2W24A 3J80Z 3T8TA 3H3UA 4IXAA 3I71A 3SXYA 1H9TA 1O3QA 4I0BA 4L9NA 1U5TA 1BM9A 3HHHA 3ECOA 2A3SA 4XBFA 5H6QA 4LJZF 4E70A 4R8HA 4EJVA 3RKWA 2VE9A 4UVBA 4M9XA 2BGCA 1USSA 4A2UA 2V79A 5E20A 4UV8A 1Z7UA 3ZQ7A 5DD4A 1P6RA 1Z05A 4LB6B 3HTUA 1KGSA 1O7FA 2NS0A 3VOEA 1OMIA 2Y0MA 4A5NA 3E5UA 3ZN0A 2DQRA 3GO5A 1LDJA 5IT9Z 3V8JA 2HS5A 3F22A 1G4DA 3WU0A 2STWA 3PQJA 3T8RA 5E8IA 3C1DA 2H27A 5BOXA 3ML6A 1P92A 3Q9VA 3W6JB 3RKXA 1FP2A 3HRTA 4WK8F 4RGSA 3M8EA 1TLHB 5BPIA 3HOTA 3G73A 1AOYA 1U78A 4RB2C 1XDUA 5AIPA 3F21A 4FX0A 4EJWA 2G9WA 3DV8A 4MEYF 2RVCA 2PG4A 2F5EA 4A0XA 1CGPA 2VONA 2ZNZA 3RJPA 2VE8A 3ZMUA 4EGZA 1O7LA 2EA2A 3S2WA 2VOOA 2YPRA 3FM5A 3F8BA 3B02A 3MCZA 2MLGA 1DUXC 2C6YA 4ZYEA 5DCMA 1LNWA 1FX7A 3HRUA 3IC7A 2RDPA 1J5YA 1QNTA 2RGVA 4AD9A 2PFBA 1KQ8A 1FSHA 3M9AA 4HOBA 1YYVA 1UCRA 4AWXB 2DPDA 5CJ9A 2Q8KA 2DLLA 4HA8A 3RTRA 1BJAA 2DW4A 2CFXA 1T98A 2Y48A 3WTVC 3HSFA 2FBKA 1D8JA 3O6BB 4QWQA 4XLPF 4LG0A 5DD8A 3V4GA 3MQ0A 1O3TA 1Q1HA 4O3MA 2LDUA 2FBIA 3TDZC 4O6JA 3W6KB 3F8CA 2F5DA 2DU9A 4G7ZF 5F1RA 3TGNA 3RYRA 3GF2A 4F7ZA 2W25A 3GX4X 3TOAA 2O6GE 3LSTA 2QZ8A 5ICEA 3LA7A 1P2FA 3GVAA 3L09A 1FLIA 3JSOA 4LMYA 3I54A 4LLLA 1YW9A 3FMSA 5D5VB 3OV8A 2D1HA 1LDDA 2NNNA 3WTYC 3IKTA 3RI4A 3FXRA 4HX8A 2BYVE 1S7OA 1F5TA 4BHPA 3BDDA 1ZG1A 3DFGA 3MZYA 2QLZA 4FT8A 5ILSA 3R61A 4BH9A 4WXHA 1S3JA 4IHSA 3V7CA 5CLSA 5ICFA 2E7WA 3ABTA 3HUGA 1R00A 5CVRA 1YTYA 1KYZA 3BP8A 3REOA 3QPTA 4OMYA 3M1EA 1T2KA 3ZP5A 4QLCU 4BHBA 1WI9A 2K27A 4HF1A 4G9YA 3LA3A 3EYIA 1EH8A 2IJLA 4HW0A 4ZYDA 1A04A 2G7UA 1B1BA 4S05A 3VFZA 2IP2A 2XIGA 3C18A 1S8NA 5F6FA 1ULYA 1LEAA 2YU3A 5DEQA 2GWRA 1FWZA 3TO9A 1V3FA 5ED4A 5D6FA 3IRRA 2HQRA 2GXGA 2UWMA 3KP2A 3F6OA 2HTSA 4AIKA 1DPUA 3ZMSA 3O3KA 4OIQF 1FY7A 3IL2A 1RI7A 2PBIA 5HS9A 2KRFA 2JT1A 2R7FA 1XGSA 1WWXA 1REPC 3FXUA 1X3UA 5DCMB 4ZZDA 1I6XA 4Q5SF 2PMHA 5DUIA 1USTA 2EB7A 2EK5A 1FSEA 3SZTA 2PJPA 1MJBA 2NRAC 4EMSA 5LGUA 2DK5A 4FHTA 4LLNA 3O2PE 2EWNA 1IZ1A 1F9NA 2HQNA 3GZ5A 2PI0A 4KFCA 2MH2A 3TKYA 1BBYA 3RIRA 3F8MA 2VBWA 4U7BA 1TQPA 1RIOH 1KU2A 2XUBA 2TDXA 2GA2A 4LG0B 2OQGA 1GXPA 4CICA 1IN8A 3T0YA 4M73A 1IN7A 5LRRA 1YW7A 1S6LA 2VN2A 1CF7B 4HF0A 3ISPA 1B4AA 3H92A 1OKRA 4G6QA 3IKVA 2P7CB 3BZ6A 1QO0D 4KIBA 2V1DA 1HKQA 2CGPA 1XD7A 4TV7A 5HS7A 2K7LA 2F2EA 4KIGA 4L9JA 1BC7C 2KIFA 4A5MA 3PQKA 2MH9A 1LB2A 3TO7A 1QZYA 4EJUA 3PFIA 4YFKF 2VBXA 1W7PA 5D4RA 2VC1A 1HBXG 1W4MA 1Z1DA 5FO5A 2K4JA 1V4RA 4IPAA 1QPMA 1R23A 2VT2A 2P6TA 3TQNA 2LF7A 2DI3A 2JPBA 1XDSA 2OAZA 2FEZA 4XSXF 1K78A 2XKPA 4YIFA 3EDPA 3JTGA 4S04A 4IRHA 2ZBKA 1GVJA 1IRGA 2XAHA 1T38A 3R4KA 4I7HA 2A61A 3J81Z 4HF2A 3LQQA 4HYEA 2FRHA 3FHZA 1ZRDA 1D5VA 2FNPA 1SD5A 1WKMA 1R1TA 3GFLA 1R7JA 3JW4A 5L3GA 2D45A 1L3LA 4EJTA 2KIUA 1IRFA 3E97A 1IW7F 4A12A 2CG4A 1P4AA 4JBAA 3NRVA 1R5HA 4U7DA 1L0OC 5AIQA 2ELHA 2CWEA 3WG9A 4JQFA 4EM2A 4YFXF 1OYIA 3L9FA 2HGCA 4NB5A 3ELKA 4DNCA 2J5OA 3QP6A 3WODF 2VXZA 4LD5A 1TW2A 3JAMK 1ZYRF 2EFQA 2P8TA 1I1SA 5E8GA 1D8KA 5FB2A 3WTXC 2DO7A 1C0WA 3FMQA 4KDPA 4EQQA 4OU0A 3SZPA 2NAZA 1OR7A 4MQ9F 2DFIA 3QPHA 1LVAA 1EH6A 3HSRA 4M74A 3BOQA 3F8FA 5L3BA 4ETSA 3V7RA 4BAYA 2CSOA 3KP7A 2VODA 1G3YA 4RAZA 2KIMA 1LQ1A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1B9N A;  3WGH A;  2ZFW A;  4UUV A;  2XKO A;  3L7W A;  3I5U A;  1AWC A;  4P9F A;  5D8L B;  1B9M A;  4L18 B;  4UNO A;  5L3F A;  1E17 A;  1Z9C A;  1GHC A;  2M5W A;  3FXQ A;  1YIO A;  2V1U A;  4GYG A;  5E1X A;  3KZY A;  1U5T C;  2KJB A;  4M72 A;  5CYV A;  3BJ6 A;  1TTY A;  1HSJ A;  4G6D A;  4IHT A;  3ZMZ A;  3F72 A;  1XGO A;  1MDM A;  4G7H F;  3DQV C;  1MKM A;  2QQB A;  2XV4 S;  4M6Y A;  3ECH A;  2BEO A;  5KVR A;  3KP6 A;  4M6X A;  1R1U A;  1FYK A;  2HKX A;  4WF2 A;  2GAU A;  3V8L A;  3K1P A;  1P4W A;  2KJC A;  3GYH X;  5DV5 A;  3CO6 C;  5D5U B;  1YQA A;  3SQN A;  4L9V A;  1IN6 A;  1UB9 A;  2L54 A;  3CLO A;  4ZH4 F;  3DEU A;  2XVC A;  4M71 A;  3I58 A;  3I0T A;  4ENK A;  5LEJ A;  3E3V A;  3HOS A;  3ZMD A;  1UHM A;  4YFN F;  3BWG A;  1LDK B;  2XRO A;  1UFM A;  5AON A;  3ERE D;  1J9I A;  1ZRE A;  1YO5 C;  1ODD A;  3KLN A;  1O57 A;  3WE3 A;  1XSD A;  5FFZ A;  3WTT C;  3DXJ F;  2WC2 A;  4GGG A;  4CXF A;  4NQW A;  4IJA A;  1OPC A;  1G3T A;  4Y17 A;  1SD4 A;  2A69 F;  5LHI A;  2QYO A;  2G7H A;  4PDK A;  5KK1 A;  3WGG A;  5LBQ A;  2FOK A;  3I53 A;  1YW8 A;  3WU1 B;  3QP5 A;  2EV0 A;  1U6G A;  1W5S A;  1XGN A;  3AAF A;  4UV9 A;  3WGI A;  1T6S A;  3JAM Z;  2LF8 A;  1U5T B;  4BQA A;  3HRM A;  5HS8 A;  1XCV A;  3SHF A;  4WXD A;  3F3X A;  3HHG A;  2FBH A;  5D8K B;  3FMR A;  2CO5 A;  3F6V A;  1U8R A;  1PDN C;  3C3W A;  2IW5 A;  1K6O A;  1UHW A;  4ENN A;  2FF4 A;  3ULQ B;  4AIH A;  2O0Y A;  2XAQ A;  5E1W A;  2M87 A;  3VB2 A;  2BBY A;  3CO7 C;  3J7A O;  1F4K A;  2RKH A;  1MJ9 A;  1ZGA A;  1TW3 A;  5BMZ A;  1T0F A;  5ERI A;  3RKY A;  3BJO A;  4EM0 B;  4HDU A;  1WSU A;  4Y13 A;  2UXX A;  1HXD A;  2DTR A;  3HSE A;  1XSX A;  1SAX A;  4MEX F;  5HLG A;  1SMY F;  3EET A;  1RUO A;  3P7N A;  2YR2 A;  1R36 A;  5LRS A;  1ZLJ A;  5J6X A;  1QQI A;  5HOO A;  2HKO A;  2A5Y B;  2RV8 A;  1PP7 U;  2QVO A;  4DQ2 A;  4Q48 A;  1R22 A;  4RB3 C;  1ZAR A;  3CJN A;  1F1Z A;  2L01 A;  2DQL A;  1FYL A;  3GFI A;  5F64 A;  3HTS B;  3BPV A;  1EH7 A;  1SFX A;  4P96 A;  4LLG F;  3I59 A;  4R1H A;  3WE2 A;  4MNU A;  1IAW A;  1K79 A;  2CQK A;  2OA4 A;  1HKS A;  1QZZ A;  3E5X A;  3DPT A;  4L5J A;  2A07 F;  5DCF A;  4MTE A;  3CTA A;  3K1M A;  2F5C A;  2JSC A;  4BYY A;  1FP1 D;  4UVA A;  3ABU A;  1HST A;  2QM3 A;  1QGP A;  4KNY A;  2R3S A;  2HYG D;  1FPQ A;  3K69 A;  4GYI A;  5LGN A;  5E1Z B;  3LAJ A;  3LWF A;  4ENJ A;  4ON0 A;  3M8F A;  1FT9 A;  2J5P A;  2P5L C;  3D0S A;  3R60 A;  2Q0O A;  1JHH A;  4CO8 A;  1S29 A;  3GXO A;  2E1N A;  6PAX A;  2PLY A;  2H94 A;  5LHH A;  2LKP A;  2F5F A;  2ZKZ A;  1ZG3 A;  1ZAO A;  3E6M A;  1Z6R A;  1P4X A;  2GIV A;  5ILV A;  1GXQ A;  1FC3 A;  2ZME A;  1BIA A;  2P5V A;  3U9G A;  2HEO A;  2XRN A;  5BQT A;  4RGU A;  2ZXJ A;  2PEX A;  1IXS B;  5TJJ A;  2ISZ A;  5HDN A;  2IA1 A;  3VOD A;  5IT3 A;  2JPC A;  2ISY A;  4OIO F;  5HVQ C;  3U1D A;  2OZU A;  4OIP F;  1KQ9 A;  2VOP A;  2FSW A;  1FNN A;  2VBZ A;  4BNC A;  1DP7 P;  2ZCW A;  5HDK A;  4HDV A;  1J2X A;  3CUQ A;  1E2X A;  2BV6 A;  1G6N A;  1BI2 A;  2NNY A;  1ZG5 A;  2MC3 A;  3KP5 A;  3V8K A;  3WTU C;  4OOI A;  2EA4 A;  4D0P A;  1BI1 A;  2MBF A;  4MQV A;  3ZMV A;  4ESF A;  3TOB A;  2IA0 A;  5CVJ A;  3NQO A;  4N9I A;  2ACJ A;  5EEG A;  3KEQ A;  1FBQ A;  1R58 A;  4Y15 A;  5LEK A;  5FGM A;  4KMU X;  2O03 A;  3E6B A;  1IUY A;  4KMF A;  3L00 A;  1HW5 A;  4IVN A;  2QWW A;  5L3D A;  4KN4 X;  4O5V A;  3ZN1 A;  4KT5 C;  5FD6 A;  2Z9O A;  4RGX A;  4HV6 A;  3U2R A;  2EV6 A;  1B6A A;  1G3W A;  1Z91 A;  4UXN A;  2IA2 A;  1ZHF A;  3WTS C;  1JHF A;  2D2W A;  2ADU A;  2XHK A;  4EGY A;  5K5R A;  1BI0 A;  4KYW A;  1W7P D;  5FLX K;  4NHJ A;  2HDC A;  2ESN A;  3FM3 A;  3P9I A;  1TNS A;  1SFE A;  1D3Y A;  1FBU A;  3T5X A;  2UZK A;  4KUM A;  3CUQ C;  4N0B A;  4JK1 X;  2V9V A;  1K7A A;  1H9G A;  3HIF A;  3ZMT A;  2ZJ2 A;  2E1C A;  1YG2 A;  2WTE A;  1IN5 A;  3H3Z A;  1Y0U A;  2EFP A;  1KYW A;  4BHC A;  3DP7 A;  4Q47 A;  1TBX A;  3F23 A;  4XLN F;  1MD0 A;  5L3C A;  2EFW A;  1J75 A;  1NHA A;  4I98 B;  2EV5 A;  1XSV A;  1U2W A;  5D5X B;  2M8E A;  4KIF A;  4HQE A;  2YSR A;  3GWZ A;  2ESH A;  2WWY A;  4P5O A;  4HZF A;  2OZ6 A;  2XAF A;  2GA1 A;  3I64 A;  1OYW A;  4CGZ A;  2QQA A;  3CDH A;  2HTJ A;  3EYY A;  4ASN A;  4P55 A;  3GW2 A;  2O61 A;  5JVT A;  2ZME B;  5HLI A;  1IF1 A;  2VBY A;  2JZY A;  2MD5 A;  4U88 A;  1MJA A;  4KIC A;  1WQ2 A;  3EQL F;  4GCV A;  1J0R A;  2QEN A;  1HKT A;  2L4M A;  2PMU A;  1KU7 A;  5FFX A;  4ESB A;  1XCB A;  3GZ6 A;  4M9S A;  3K9T A;  4G8X A;  2JTV A;  4Q4Z F;  1WRJ A;  2A6H F;  4GO1 A;  4L9T A;  3ROU A;  3ZPL A;  2YX4 A;  4PCQ A;  3DKW A;  3CUQ B;  2D1V A;  2Z5U A;  2H09 A;  2DPU A;  2P5K A;  4EV0 A;  1KA8 A;  3R0J A;  4BXU A;  3KCC A;  4ESJ A;  1BOA A;  2P7V B;  1O3S A;  4OIN F;  2IT0 A;  2M45 A;  5LGT A;  2A6E F;  1XGM A;  2STT A;  2L4A A;  4IRI A;  3SFZ A;  2WV0 A;  5TRD A;  2VT3 A;  4LGW A;  1W7P B;  5DDG A;  2JRT A;  2BE5 F;  5H20 A;  3RPQ A;  1BC8 C;  5D5W B;  1YLF A;  3COA C;  4RB0 A;  4PGH A;  1SD7 A;  2HFH A;  4HX4 A;  4CHU A;  5FLX Z;  1K78 B;  5E18 F;  1SD6 A;  4L0Z B;  3CUO A;  3IHU A;  4WCG A;  3JTH A;  3K0L A;  3E5Q A;  1ZLK A;  2OBP A;  4L0Y B;  5ICG A;  1FBS A;  2IRF G;  2PN6 A;  1PP8 F;  5CVU A;  2H6B A;  4I09 A;  4OMZ A;  1I27 A;  2HWV A;  4KN7 X;  3MZH A;  4HX7 A;  1HQC A;  3WTW C;  5HDG A;  1JE8 A;  2DK8 A;  4ZZL A;  1TQI A;  2P6S A;  1TQM A;  1YS6 A;  2IPQ X;  1BN5 A;  4LK1 F;  3BJA A;  1BIB A;  1T39 A;  3P9K A;  4RGR A;  4HV5 A;  5BS6 A;  4G7O F;  1CF7 A;  4UHT A;  1S7A A;  1IXC A;  2YX7 A;  1XMK A;  2VC0 A;  1VTN C;  2NYX A;  3RPU A;  3E6D A;  4CZZ A;  3T1B A;  4R79 A;  1ZGJ A;  2K02 A;  4HLX A;  1SMT A;  3QU3 A;  2DT5 A;  5E17 F;  1Z6T A;  4RAY A;  5H6R A;  5K5O A;  4IF4 A;  5JFR A;  4A6E A;  2ZO4 A;  1IN4 A;  2XAS A;  5ILU A;  4U0W A;  2FE3 A;  4KA4 A;  2KKO A;  3MWM A;  3TO6 A;  1ONV A;  1RZ4 A;  3FF5 A;  1DDN A;  2M30 A;  1SFU A;  1YS7 A;  3VEP A;  3WTZ A;  2UXN A;  2RN7 A;  1RUN A;  2FQ3 A;  1PUE E;  2FML A;  3B73 A;  3QAH A;  5LLQ A;  1DPR A;  2DBB A;  4ZYG A;  4CDG A;  3I4P A;  1J59 A;  4G94 A;  2K4B A;  5DUK A;  4H0E A;  2PQ8 A;  1XN7 A;  2O3F A;  3K2Z A;  2W57 A;  1H0M A;  2AS5 F;  3QU6 A;  1ZN2 A;  2HOE A;  4WXC A;  1OYY A;  5J8C A;  2FNA A;  1YFH A;  4U0Y A;  2QBY A;  1KQ0 A;  5D6E A;  4AVP A;  3IRQ A;  3KET A;  3EUH A;  3KP4 A;  1XB4 A;  3TDU C;  1MGT A;  3GFJ A;  1BI3 A;  2OQR A;  2XAJ A;  4M9Z A;  4ZYH A;  3MFK A;  1MDM B;  3LFK A;  2V6C A;  1IXR C;  4U0V A;  3GEZ A;  4XRF A;  1JXS A;  2M1B A;  1ON1 A;  5A2Q K;  3Q9S A;  1MZB A;  4HAM A;  1ZH5 A;  3R0A A;  3KEO A;  3Q5F A;  4ENM A;  1FOK A;  1LJ9 A;  2HZT A;  3LAP A;  1ZRC A;  2K86 A;  5LHG A;  3KZZ A;  3J81 K;  2GQQ A;  2B0L A;  2V1X A;  2GXB A;  2DAO A;  3FWE A;  3IWZ A;  3P9C A;  4PGG A;  2R7D A;  2ETH A;  2AXL A;  5J8F A;  3C7J A;  1JGS A;  1RNL A;  3J80 K;  4B8X A;  1HW2 A;  2Q2E A;  2W84 A;  2HR3 A;  1ZRF A;  3OOP A;  4LK0 F;  3HYI A;  1KU9 A;  3KFW X;  2OD5 A;  1FYM A;  2EFN A;  1R5G A;  3FX3 A;  2RQP A;  2XAG A;  4LFU A;  2HYF A;  4A6D A;  2Z99 A;  1I1G A;  3JSP A;  5K5Q A;  2QQ9 A;  1G3S A;  3K1N A;  3KE2 A;  1STZ A;  4P9U A;  1O3R A;  1J7K A;  2O8X A;  3KLO A;  2L02 A;  3F8N A;  2ZNY A;  3GUD A;  5BPD A;  4HLY A;  2IVM A;  1XMA A;  3N97 A;  4A0Y A;  1EV7 A;  3IWF A;  2EFO A;  1KU3 A;  2MLK A;  4MHG A;  2RNJ A;  5JR3 A;  5JI6 A;  4I01 A;  4PZJ A;  5IT9 K;  2MA3 A;  2QUF A;  4FX4 A;  3M7G A;  5CVI A;  2GZW A;  5K1Y A;  4AIJ A;  5CVV A;  2CW0 F;  3MEX A;  4YG2 F;  4L5I A;  1FZP B;  4LB5 A;  3QRF F;  3E6C C;  1HW1 A;  2LSO A;  1I5Z A;  4N9H A;  5FD5 A;  5DYM A;  3V7S A;  1TNT A;  2FU4 A;  4MTD A;  4K2E A;  4WWC A;  3GLX A;  4WX9 A;  2COM A;  3BPX A;  4EJO A;  2FMY A;  4RB1 A;  3L2C A;  1ON2 A;  4Z2Y A;  3G3Z A;  5L3E A;  3LQR A;  4HBL A;  2E7X A;  4IRG A;  2A68 F;  4RS8 A;  3HRS A;  3GFM A;  4I2O A;  2XGX A;  5JHU A;  3RDI A;  2FXA A;  4UVC A;  3BRO A;  4HQM A;  2Z3Y A;  1B59 A;  3MAJ A;  1QBJ A;  2X0L A;  5EEH A;  4MGR A;  1U3E M;  3LA2 A;  2W85 A;  5A2Q Z;  4EVI A;  3R6S A;  3RYP A;  4YII A;  4GXO A;  1R1V A;  4A0Z A;  3KP3 A;  2FA5 A;  2QBY B;  3N4M A;  2H6C A;  2OU2 A;  2CYY A;  5HLH A;  4I02 A;  4B09 A;  1W5T A;  3DF8 A;  3DPL C;  3QOP A;  3I59 B;  4OIR F;  2EJR A;  3D5L A;  3FZV A;  5ICC A;  2L3D A;  3BY6 A;  2Z33 A;  4CYD A;  4EM1 A;  2X4H A;  3NEU A;  2LNB A;  2Y75 A;  2RC4 A;  1LEB A;  4XSZ F;  5D4S A;  2P4W A;  4I0A A;  2W24 A;  3J80 Z;  3T8T A;  3H3U A;  4IXA A;  3I71 A;  3SXY A;  1H9T A;  1O3Q A;  4I0B A;  4L9N A;  1U5T A;  1BM9 A;  3HHH A;  3ECO A;  2A3S A;  4XBF A;  5H6Q A;  4LJZ F;  4E70 A;  4R8H A;  4EJV A;  3RKW A;  2VE9 A;  4UVB A;  4M9X A;  2BGC A;  1USS A;  4A2U A;  2V79 A;  5E20 A;  4UV8 A;  1Z7U A;  3ZQ7 A;  5DD4 A;  1P6R A;  1Z05 A;  4LB6 B;  3HTU A;  1KGS A;  1O7F A;  2NS0 A;  3VOE A;  1OMI A;  2Y0M A;  4A5N A;  3E5U A;  3ZN0 A;  2DQR A;  3GO5 A;  1LDJ A;  5IT9 Z;  3V8J A;  2HS5 A;  3F22 A;  1G4D A;  3WU0 A;  2STW A;  3PQJ A;  3T8R A;  5E8I A;  3C1D A;  2H27 A;  5BOX A;  3ML6 A;  1P92 A;  3Q9V A;  3W6J B;  3RKX A;  1FP2 A;  3HRT A;  4WK8 F;  4RGS A;  3M8E A;  1TLH B;  5BPI A;  3HOT A;  3G73 A;  1AOY A;  1U78 A;  4RB2 C;  1XDU A;  5AIP A;  3F21 A;  4FX0 A;  4EJW A;  2G9W A;  3DV8 A;  4MEY F;  2RVC A;  2PG4 A;  2F5E A;  4A0X A;  1CGP A;  2VON A;  2ZNZ A;  3RJP A;  2VE8 A;  3ZMU A;  4EGZ A;  1O7L A;  2EA2 A;  3S2W A;  2VOO A;  2YPR A;  3FM5 A;  3F8B A;  3B02 A;  3MCZ A;  2MLG A;  1DUX C;  2C6Y A;  4ZYE A;  5DCM A;  1LNW A;  1FX7 A;  3HRU A;  3IC7 A;  2RDP A;  1J5Y A;  1QNT A;  2RGV A;  4AD9 A;  2PFB A;  1KQ8 A;  1FSH A;  3M9A A;  4HOB A;  1YYV A;  1UCR A;  4AWX B;  2DPD A;  5CJ9 A;  2Q8K A;  2DLL A;  4HA8 A;  3RTR A;  1BJA A;  2DW4 A;  2CFX A;  1T98 A;  2Y48 A;  3WTV C;  3HSF A;  2FBK A;  1D8J A;  3O6B B;  4QWQ A;  4XLP F;  4LG0 A;  5DD8 A;  3V4G A;  3MQ0 A;  1O3T A;  1Q1H A;  4O3M A;  2LDU A;  2FBI A;  3TDZ C;  4O6J A;  3W6K B;  3F8C A;  2F5D A;  2DU9 A;  4G7Z F;  5F1R A;  3TGN A;  3RYR A;  3GF2 A;  4F7Z A;  2W25 A;  3GX4 X;  3TOA A;  2O6G E;  3LST A;  2QZ8 A;  5ICE A;  3LA7 A;  1P2F A;  3GVA A;  3L09 A;  1FLI A;  3JSO A;  4LMY A;  3I54 A;  4LLL A;  1YW9 A;  3FMS A;  5D5V B;  3OV8 A;  2D1H A;  1LDD A;  2NNN A;  3WTY C;  3IKT A;  3RI4 A;  3FXR A;  4HX8 A;  2BYV E;  1S7O A;  1F5T A;  4BHP A;  3BDD A;  1ZG1 A;  3DFG A;  3MZY A;  2QLZ A;  4FT8 A;  5ILS A;  3R61 A;  4BH9 A;  4WXH A;  1S3J A;  4IHS A;  3V7C A;  5CLS A;  5ICF A;  2E7W A;  3ABT A;  3HUG A;  1R00 A;  5CVR A;  1YTY A;  1KYZ A;  3BP8 A;  3REO A;  3QPT A;  4OMY A;  3M1E A;  1T2K A;  3ZP5 A;  4QLC U;  4BHB A;  1WI9 A;  2K27 A;  4HF1 A;  4G9Y A;  3LA3 A;  3EYI A;  1EH8 A;  2IJL A;  4HW0 A;  4ZYD A;  1A04 A;  2G7U A;  1B1B A;  4S05 A;  3VFZ A;  2IP2 A;  2XIG A;  3C18 A;  1S8N A;  5F6F A;  1ULY A;  1LEA A;  2YU3 A;  5DEQ A;  2GWR A;  1FWZ A;  3TO9 A;  1V3F A;  5ED4 A;  5D6F A;  3IRR A;  2HQR A;  2GXG A;  2UWM A;  3KP2 A;  3F6O A;  2HTS A;  4AIK A;  1DPU A;  3ZMS A;  3O3K A;  4OIQ F;  1FY7 A;  3IL2 A;  1RI7 A;  2PBI A;  5HS9 A;  2KRF A;  2JT1 A;  2R7F A;  1XGS A;  1WWX A;  1REP C;  3FXU A;  1X3U A;  5DCM B;  4ZZD A;  1I6X A;  4Q5S F;  2PMH A;  5DUI A;  1UST A;  2EB7 A;  2EK5 A;  1FSE A;  3SZT A;  2PJP A;  1MJB A;  2NRA C;  4EMS A;  5LGU A;  2DK5 A;  4FHT A;  4LLN A;  3O2P E;  2EWN A;  1IZ1 A;  1F9N A;  2HQN A;  3GZ5 A;  2PI0 A;  4KFC A;  2MH2 A;  3TKY A;  1BBY A;  3RIR A;  3F8M A;  2VBW A;  4U7B A;  1TQP A;  1RIO H;  1KU2 A;  2XUB A;  2TDX A;  2GA2 A;  4LG0 B;  2OQG A;  1GXP A;  4CIC A;  1IN8 A;  3T0Y A;  4M73 A;  1IN7 A;  5LRR A;  1YW7 A;  1S6L A;  2VN2 A;  1CF7 B;  4HF0 A;  3ISP A;  1B4A A;  3H92 A;  1OKR A;  4G6Q A;  3IKV A;  2P7C B;  3BZ6 A;  1QO0 D;  4KIB A;  2V1D A;  1HKQ A;  2CGP A;  1XD7 A;  4TV7 A;  5HS7 A;  2K7L A;  2F2E A;  4KIG A;  4L9J A;  1BC7 C;  2KIF A;  4A5M A;  3PQK A;  2MH9 A;  1LB2 A;  3TO7 A;  1QZY A;  4EJU A;  3PFI A;  4YFK F;  2VBX A;  1W7P A;  5D4R A;  2VC1 A;  1HBX G;  1W4M A;  1Z1D A;  5FO5 A;  2K4J A;  1V4R A;  4IPA A;  1QPM A;  1R23 A;  2VT2 A;  2P6T A;  3TQN A;  2LF7 A;  2DI3 A;  2JPB A;  1XDS A;  2OAZ A;  2FEZ A;  4XSX F;  1K78 A;  2XKP A;  4YIF A;  3EDP A;  3JTG A;  4S04 A;  4IRH A;  2ZBK A;  1GVJ A;  1IRG A;  2XAH A;  1T38 A;  3R4K A;  4I7H A;  2A61 A;  3J81 Z;  4HF2 A;  3LQQ A;  4HYE A;  2FRH A;  3FHZ A;  1ZRD A;  1D5V A;  2FNP A;  1SD5 A;  1WKM A;  1R1T A;  3GFL A;  1R7J A;  3JW4 A;  5L3G A;  2D45 A;  1L3L A;  4EJT A;  2KIU A;  1IRF A;  3E97 A;  1IW7 F;  4A12 A;  2CG4 A;  1P4A A;  4JBA A;  3NRV A;  1R5H A;  4U7D A;  1L0O C;  5AIQ A;  2ELH A;  2CWE A;  3WG9 A;  4JQF A;  4EM2 A;  4YFX F;  1OYI A;  3L9F A;  2HGC A;  4NB5 A;  3ELK A;  4DNC A;  2J5O A;  3QP6 A;  3WOD F;  2VXZ A;  4LD5 A;  1TW2 A;  3JAM K;  1ZYR F;  2EFQ A;  2P8T A;  1I1S A;  5E8G A;  1D8K A;  5FB2 A;  3WTX C;  2DO7 A;  1C0W A;  3FMQ A;  4KDP A;  4EQQ A;  4OU0 A;  3SZP A;  2NAZ A;  1OR7 A;  4MQ9 F;  2DFI A;  3QPH A;  1LVA A;  1EH6 A;  3HSR A;  4M74 A;  3BOQ A;  3F8F A;  5L3B A;  4ETS A;  3V7R A;  4BAY A;  2CSO A;  3KP7 A;  2VOD A;  1G3Y A;  4RAZ A;  2KIM A;  1LQ1 A; 
#chains in the Genus database with same CATH topology
 2M4G A;  2WAD A;  1B9N A;  4AVZ A;  3WGH A;  2M3A A;  2ZFW A;  4CCN A;  4BE0 A;  2PX9 A;  4UUV A;  2XKO A;  3L7W A;  3I5U A;  3J7A Y;  1AWC A;  5K7F A;  4P9F A;  5D8L B;  1B9M A;  3AG2 H;  4L18 B;  4UNO A;  5L3F A;  1E17 A;  1Z9C A;  1GHC A;  2M5W A;  3FXQ A;  4DBQ A;  4A3L J;  3QYE A;  2FOW A;  3H9G A;  1YIO A;  1WCM J;  4GYG A;  4N4O B;  5E1X A;  5M3F J;  1VI0 A;  2V1U A;  3JCU C;  1U5T C;  2KJB A;  3KZY A;  4M72 A;  2LVS A;  4XRM A;  5CYV A;  3BJ6 A;  1OIS A;  1TTY A;  1HSJ A;  4BDY A;  4G6D A;  4IHT A;  3ZMZ A;  2HVS A;  3F72 A;  1XGO A;  5J1Y A;  1MDM A;  4XOT A;  4G7H F;  1JKO C;  1V55 H;  3DQV C;  5B1A H;  2WAE A;  1MKM A;  3H35 A;  2QQB A;  4J01 A;  2XV4 S;  4M6Y A;  3ECH A;  1DGR M;  2R5Z A;  1JI8 A;  2BEO A;  5KVR A;  3KP6 A;  2XPV A;  1UAA A;  4BJ6 C;  3FK7 A;  4M6X A;  1VQ4 I;  2RNG A;  3A2K A;  1R1U A;  1TWF J;  2EIJ H;  1FYK A;  1VQ6 I;  2HKX A;  4WF2 A;  1NK2 P;  2GAU A;  3V8L A;  1P7I A;  1P4W A;  3K1P A;  2O8K A;  2KJC A;  5C4J J;  3GYH X;  1MBE A;  4HNV A;  5DV5 A;  5HOD A;  5EJC A;  4HRI A;  4DBR A;  3CO6 C;  4Y4R A;  5D5U B;  1U9N A;  1YQA A;  3SQN A;  4L9V A;  2V6E A;  2Y9Z A;  1IN6 A;  1UB9 A;  2L54 A;  4L5E A;  3CLO A;  1RR7 A;  4ZH4 F;  4XN3 A;  3QWL A;  3WHC A;  3DEU A;  4XOR A;  1X1B A;  2K9N A;  2XVC A;  2ZXH A;  4N4N B;  5M5Y J;  4M71 A;  3I58 A;  2JRM A;  3I0T A;  4ENK A;  5LEJ A;  3E3V A;  3HOS A;  3ZMD A;  1UHM A;  4YFN F;  3BWG A;  1LDK B;  3FHN A;  2XRO A;  3I4N J;  1NG6 A;  1UFM A;  5AON A;  3ERE D;  1J9I A;  4JYK A;  1ZRE A;  1YO5 C;  1ODD A;  1LE8 A;  1R4M B;  1O57 A;  3KLN A;  3WE3 A;  1XSD A;  3MKW B;  2MD0 A;  5FFZ A;  3WTT C;  3DXJ F;  2HOA A;  1HA8 A;  2E71 A;  1FIP A;  4PSW A;  3FXM A;  3OY9 A;  2WC2 A;  4GGG A;  4CXF A;  4NQW A;  4IJA A;  1W0T A;  1YRN B;  2Y0S A;  3H5N A;  3VPR A;  4A3F J;  1OPC A;  1G3T A;  4Y17 A;  1SD4 A;  3S8P A;  2I8D A;  2A69 F;  2AXT C;  5LHI A;  2BY0 A;  1VQL I;  3BG7 A;  2QYO A;  2HOS A;  2G7H A;  4PDK A;  5KK1 A;  3WGG A;  5LBQ A;  2FOK A;  1PUF A;  3I53 A;  1YW8 A;  3WU1 B;  3QP5 A;  2EV0 A;  2E2H J;  1U6G A;  3CCE I;  1R49 A;  2DA4 A;  1W5S A;  1XGN A;  3AAF A;  4UV9 A;  2OCC H;  2LLK A;  3WGI A;  1YHQ I;  1OFC X;  3CES A;  1T6S A;  5FJ8 J;  3JAM Z;  2LF8 A;  4BBS J;  1U5T B;  4BQA A;  3HRM A;  5HS8 A;  1XPX A;  1XCV A;  4XMY A;  2LKS A;  3HBL A;  3SHF A;  3H5R A;  1A6Q A;  4D7N A;  4WXD A;  1W1W E;  3F3X A;  3HHG A;  2FBH A;  5D8K B;  3FMR A;  4XLF A;  2CO5 A;  3F6V A;  3D1N I;  1U8R A;  4DW6 A;  2X1D A;  2ME0 A;  2VQH A;  3IAS 2;  3DCF A;  2E19 A;  1XMX A;  1PDN C;  3C3W A;  3LSR A;  2IW5 A;  1K6O A;  1UHW A;  4ENN A;  2XGD A;  2PJR B;  2FF4 A;  3ULQ B;  4AIH A;  3W3C A;  2O0Y A;  2XAQ A;  2W48 A;  5E1W A;  2M87 A;  3VB2 A;  2BBY A;  2LRE A;  3CO7 C;  4CSW A;  3J7A O;  5FRO A;  2KPM A;  1F4K A;  2RKH A;  1AHD P;  3AL0 C;  1MJ9 A;  1ZGA A;  3JRD A;  3J7Z I;  5FKL A;  5FRM A;  1TW3 A;  5BMZ A;  2HYJ A;  3GCM A;  1T0F A;  2FX0 A;  4II3 A;  2DMQ A;  5ERI A;  3RKY A;  3BJO A;  4EM0 B;  1BA5 A;  4HDU A;  2BVM A;  1WSU A;  4Y13 A;  2UXX A;  2ZXW H;  2AO9 A;  1HXD A;  2DTR A;  2DT7 B;  3HSE A;  1XSX A;  2QQ8 A;  4B43 A;  4CCJ A;  1SAX A;  4MEX F;  1VF9 A;  5HLG A;  5IYC J;  1YX3 A;  2O5R A;  1SMY F;  3CME I;  3EET A;  4E7I A;  3ABL H;  3HGY A;  1RUO A;  3P7N A;  4BXF A;  1OCT C;  2EH3 A;  1U0J A;  2YR2 A;  5FKN A;  4FE4 A;  1R36 A;  5LRS A;  1ZLJ A;  5J6X A;  1QQI A;  3S2D J;  5HOO A;  2HKO A;  1FEX A;  2A5Y B;  3K7A J;  1TWH J;  2RV8 A;  3FXL A;  1PP7 U;  2QVO A;  4DQ2 A;  4Q48 A;  1R22 A;  4RB3 C;  2E2I J;  5TIS C;  1YX5 A;  1ZAR A;  2L7K A;  3CJN A;  1F1Z A;  1HF0 A;  1Z3Y A;  2L01 A;  4RA2 A;  5J40 A;  2DQL A;  3HPG A;  1FYL A;  1MBJ A;  3FBI B;  2ZXI A;  2L0K A;  4CH7 A;  2WV1 A;  1B8I A;  4PFP A;  4CCO A;  3GFI A;  1WH7 A;  5F64 A;  3HTS B;  3BPV A;  1EH7 A;  2EQR A;  1SFX A;  4HSR A;  4P96 A;  4LLG F;  1ACI A;  3S2H J;  3I59 A;  4R1H A;  3QYB A;  3WE2 A;  2VKV A;  4MNU A;  1Y56 A;  5IOY A;  3TP3 A;  2DFF A;  1IAW A;  1WJC A;  1K79 A;  2CQK A;  1MH4 A;  2OA4 A;  1HKS A;  2IEK A;  1QZZ A;  3E5X A;  3DPT A;  3GTQ J;  4L5J A;  4QPO A;  2A07 F;  5DCF A;  3DWL E;  4XR6 A;  4MTE A;  4ANJ A;  3CTA A;  4BS9 A;  3K1M A;  2F5C A;  2JSC A;  4D5C A;  1TC3 C;  4BYY A;  5M3M J;  3OSF A;  5F08 A;  1FP1 D;  4UVA A;  2NOJ B;  2LH9 A;  3ABU A;  1HST A;  2OCE A;  1AA7 A;  2QM3 A;  1QGP A;  2WB1 A;  3HG9 A;  4MO7 A;  1SC7 A;  3FBN B;  2CV0 A;  4KNY A;  2R3S A;  2VKE A;  3QPS A;  1Q1V A;  2LP0 A;  2UUZ A;  4B3A A;  4GFB A;  2HYG D;  2O7O A;  1FPQ A;  3K69 A;  4IQ4 A;  4A3E J;  4GYI A;  4BY7 J;  5LGN A;  2QSF X;  5E1Z B;  3LAJ A;  2DT6 A;  3LWF A;  4ENJ A;  3OR2 C;  5GAE J;  4RM3 A;  4ON0 A;  3M8F A;  4CYC B;  3CCU I;  1FT9 A;  1MIJ A;  2Z1D A;  3M8J A;  3TL4 X;  4D5F A;  2J5P A;  2P5L C;  3D0S A;  3R60 A;  4PJJ A;  4S0H B;  2Q0O A;  1JHH A;  4CO8 A;  1S29 A;  5EEA A;  3GXO A;  2E1N A;  2OPT A;  6PAX A;  1RR8 C;  2PLY A;  2H94 A;  5LHH A;  2LKP A;  2ZSH B;  2F5F A;  1Z77 A;  3AL0 B;  3HJE A;  1OQY A;  2NXN B;  2ZKZ A;  1ZG3 A;  2R93 J;  3L2W A;  1ZAO A;  1GV5 A;  3E6M A;  3SYT A;  1HDP A;  3BR1 A;  1LE8 B;  1H8A C;  2ZJR F;  3K4C A;  1Z6R A;  1OJL A;  2HI3 A;  1P4X A;  2GIV A;  5ILV A;  1GXQ A;  2KLO A;  1MSF C;  1FC3 A;  5JLX A;  2ZME A;  2M0M A;  5E3L A;  1BIA A;  2P5V A;  3O8H A;  3I3L A;  5HNF A;  1JKP C;  3U9G A;  1Y39 A;  2HEO A;  3WG7 H;  4YIR X;  1D0Y A;  2XRN A;  5BQT A;  4X0G A;  3ZQG A;  3OIO A;  4RGU A;  5F1J A;  4HNU A;  2ZXJ A;  2PEX A;  1IXS B;  2BVL A;  1FOW A;  5TJJ A;  2ISZ A;  3H9Q A;  3W2V A;  5HDN A;  4GDF A;  2IA1 A;  3VOD A;  4XRS A;  5IT3 A;  2ZJQ F;  2JPC A;  2ISY A;  4OIO F;  3M3Y J;  5HVQ C;  2Y31 A;  4KIS A;  2DN0 A;  2JA7 J;  3U1D A;  2IGO A;  2KDO A;  3SDB A;  2DOD A;  2OZU A;  4OIP F;  1PUF B;  3JRA A;  4B44 A;  1KQ9 A;  1Z0X A;  1JGG A;  2VOP A;  2FSW A;  1FNN A;  2VBZ A;  4BNC A;  4DGW B;  4BL0 B;  1DP7 P;  2ZCW A;  5HDK A;  2ID6 A;  4HDV A;  1J2X A;  3IH2 A;  2VIX A;  4HG2 A;  3JR9 A;  3CUQ A;  1E2X A;  2BV6 A;  1G6N A;  1BI2 A;  2KZG A;  3VYT B;  2NNY A;  1ZG5 A;  3OIQ A;  2MC3 A;  3KP5 A;  1QZE A;  3V8K A;  3GTJ J;  3RKQ A;  3ZRG A;  3WTU C;  3DPU A;  2L7M P;  2IXS A;  4BU2 A;  4PUS A;  1OCR H;  4OOI A;  2EA4 A;  2H1L A;  2AQE A;  4II2 A;  1EF4 A;  1S5L C;  4D0P A;  1BI1 A;  2Q1Z B;  1D1B A;  2MBF A;  1Y6I A;  4MQV A;  3ZMV A;  4ESF A;  3TOB A;  2IA0 A;  3S3O A;  1IG7 A;  5CVJ A;  2D5V A;  2XB5 A;  1WJA A;  3HB9 A;  3NQO A;  4N9I A;  5E3M A;  2ACJ A;  4KT6 A;  2DYR H;  1ETK A;  5EEG A;  5F0F A;  2IS1 A;  3KEQ A;  1POG A;  4F3Q A;  2VQG A;  2JQ7 A;  4HNT A;  3MVP A;  1WJF A;  3PO2 J;  1FBQ A;  1R58 A;  4Y15 A;  5LEK A;  1BW5 A;  5FGM A;  4KMU X;  3OMY A;  2O03 A;  4UY8 I;  3LMM A;  1GLN A;  2JVG A;  4DIQ A;  3E6B A;  3C2H A;  1IUY A;  4G6T B;  2L9V A;  2ZSI B;  1VQM I;  4KMF A;  4ITV A;  3TW6 A;  5TGT A;  2ZME C;  3L00 A;  1HW5 A;  1YE9 A;  4UB8 C;  4IVN A;  2QWW A;  5L3D A;  4KN4 X;  4O5V A;  3ZN1 A;  2LG4 A;  2IGM A;  4KT5 C;  5FD6 A;  3TP0 A;  3WHB A;  5EGO B;  2Z9O A;  4RGX A;  4HV6 A;  5F04 A;  1BR1 A;  1ETY A;  3CF2 A;  2X1C A;  1F43 A;  3MKY B;  5E3N A;  1Y1W J;  2M9H A;  3OYG A;  3U2R A;  1FOY A;  1MMN A;  2EV6 A;  3PIP F;  1R71 A;  1B6A A;  1G3W A;  1Z91 A;  4UXN A;  2IA2 A;  1ZHF A;  3WTS C;  1JHF A;  2D2W A;  1A35 A;  3O8G A;  5F27 A;  2ADU A;  3H3V K;  4DOZ A;  3D5S C;  2XHK A;  4EGY A;  4Y3O A;  3CCY A;  5K5R A;  4IX7 A;  4Z6Y A;  1BI0 A;  1A31 A;  4KYW A;  1W7P D;  2OUM A;  5FLX K;  1T56 A;  4NHJ A;  1MNE A;  2ESN A;  3FM3 A;  3P9I A;  2HDC A;  2XPW A;  2K85 A;  1TNS A;  3H9J A;  1W5C C;  1SAU A;  1SFE A;  1D3Y A;  1FBU A;  3T5X A;  2IBD A;  2UZK A;  4KUM A;  3CUQ C;  5GPA A;  4N0B A;  4JK1 X;  2V9V A;  2L9S A;  2XRL A;  3VSK A;  1KZH A;  1K7A A;  1GT0 C;  1NTC A;  1H9G A;  1I3Q J;  3HIF A;  1WGX A;  2BOL A;  3ZMT A;  3OYH A;  2ZJ2 A;  2QSH X;  4C9Y A;  4F55 A;  1SFO J;  3NAU A;  4H4K C;  3DLL F;  4J19 A;  1YG2 A;  2WTE A;  2E1C A;  3UNG C;  1IN5 A;  3OIP A;  1U9O A;  3H3Z A;  4IL6 C;  2E1M C;  2GOM A;  3HZJ A;  2BY1 A;  1Y0U A;  2EFP A;  3PFY A;  2WY8 Q;  1KYW A;  2EIN H;  4BHC A;  3DP7 A;  4E7K A;  2JVH A;  5EF6 A;  2CV2 A;  4Q47 A;  1TBX A;  4NC6 A;  1VQK I;  3HOZ J;  3F23 A;  1V54 H;  2DYS H;  4ZTF A;  2VJ5 A;  2Y0S N;  4IZZ A;  4XLN F;  1WJD A;  3FKJ A;  5GAD J;  1MD0 A;  5L3C A;  4XLH A;  4V2F A;  2EFW A;  1J75 A;  2R5Y A;  1NHA A;  3DBL B;  4I98 B;  5EYR A;  2EV5 A;  2RAE A;  3CMY A;  2V1N A;  1XSV A;  1U2W A;  3K4B A;  5D5X B;  1NH3 A;  2M8E A;  4KIF A;  4CCL A;  2L9R A;  3ZR8 X;  4BQO A;  2EIM H;  4HQE A;  3CCS I;  1Z67 A;  4G12 A;  3GLL A;  4DZP A;  2YSR A;  2K3P A;  1JKQ C;  3GWZ A;  2DA7 A;  2ESH A;  2WWY A;  4P5O A;  5CQG A;  1JJ6 C;  4HZF A;  2OZ6 A;  2XAF A;  2R7O A;  2GA1 A;  2WBM A;  3I64 A;  3RQI A;  1OYW A;  5FRN A;  2VPL A;  1A6I A;  4CGZ A;  4EEF G;  3PSF A;  5C4X J;  2QQA A;  3HKZ A;  4RAF A;  3CDH A;  4YEJ A;  2HTJ A;  1FMV A;  3ASO H;  3EYY A;  3BR5 A;  2MW8 A;  4ASN A;  3SDG A;  1K61 A;  4P55 A;  3GW2 A;  1ENH A;  3PSI A;  2O61 A;  5JVT A;  1T95 A;  3CCL I;  2ZME B;  4B1R A;  5HLI A;  1IF1 A;  2VBY A;  4UB6 C;  1YI2 I;  2JZY A;  2MD5 A;  4U88 A;  1MJA A;  2VLA A;  1QVU A;  4KIC A;  4FCY A;  1WQ2 A;  3DKX A;  2F4I A;  3EQL F;  4GCV A;  1J0R A;  1UJ8 A;  3LSK A;  2QEN A;  1HKT A;  1RPW A;  1MBF A;  3A1Y A;  2L4M A;  2PMU A;  4Y7N J;  3DEW A;  3LFU A;  2ME6 A;  1KU7 A;  5FFX A;  2CH0 A;  4ESB A;  1XCB A;  3K4J A;  3GZ6 A;  3CJT B;  4M9S A;  3JRC A;  4A3I J;  2KMU A;  2MG4 A;  3BTI A;  3K9T A;  2QKM B;  4G8X A;  4UUS B;  2VKD A;  1FMW A;  1Y0N A;  2M7A A;  2JTV A;  4Q4Z F;  1WRJ A;  2A6H F;  4GO1 A;  4L9T A;  3ROU A;  2DDB A;  3S32 A;  3ZPL A;  3IH4 A;  1ZGW A;  1EJ9 A;  3RSN A;  2YX4 A;  4PCQ A;  3DKW A;  2R7S A;  3CUQ B;  2D1V A;  2Z5U A;  3ZQI A;  2H09 A;  3CCJ I;  2DPU A;  3AG1 H;  2P5K A;  2ECC A;  4EV0 A;  3CF5 F;  1DU6 A;  1E3H A;  1KA8 A;  3TED A;  1ETV A;  3HEF A;  3R0J A;  2JA6 J;  4BXU A;  3KCC A;  4JP0 A;  4ESJ A;  1BOA A;  1K6Y A;  4JX4 A;  2P7V B;  3W2A A;  1O3S A;  4RLF A;  4OIN F;  2IT0 A;  5HLT A;  1RES A;  3U1K A;  2M45 A;  4LG3 A;  5LGT A;  3SEQ A;  5J1R A;  2A6E F;  1Z21 A;  1XGM A;  4XM3 A;  2M7B A;  2XSD C;  2KQR A;  2E1M B;  2STT A;  2L4A A;  4IRI A;  2KL4 A;  2NVU B;  2DJN A;  3HOW J;  4AC0 A;  2BW3 A;  1VND A;  3SFZ A;  4XID A;  4FAS D;  2WV0 A;  5DTD A;  5TRD A;  1TP4 A;  4ZJZ A;  5LD2 C;  1WI3 A;  1Y1V J;  2VT3 A;  4LGW A;  5FKO A;  3HOU J;  1W7P B;  2K3F A;  1W36 D;  5J1U A;  2A05 A;  5DDG A;  1N78 A;  2EZL A;  1VQP I;  2NS8 A;  2JRT A;  2BE5 F;  5H20 A;  3A4C A;  3RPQ A;  1BL0 A;  1BC8 C;  5D5W B;  1OR7 C;  3GTM J;  3VYR B;  4QSH A;  4V19 K;  1YLF A;  1TWG J;  4XLC A;  4RB0 A;  3COA C;  3NWS A;  1H88 C;  5CPR B;  2V9K A;  4PGH A;  1SD7 A;  2HFH A;  4HX4 A;  4CHU A;  3HXL A;  2E5Z A;  4PFO A;  5FLX Z;  1K78 B;  5KAI C;  1YIT I;  5E18 F;  1SD6 A;  4L0Z B;  3CUO A;  3IHU A;  4WCG A;  3JTH A;  3K0L A;  3E5Q A;  1ZLK A;  1K4S A;  2F4O B;  2OBP A;  3N05 A;  4L0Y B;  2JA5 J;  3EPZ A;  2WB1 N;  3OYJ A;  5ICG A;  1FBS A;  4OWR B;  2CW7 A;  1Y8R B;  2IRF G;  2PN6 A;  4U87 A;  1PP8 F;  3Q0W A;  5CVU A;  2H6B A;  4I09 A;  4OMZ A;  2LK2 A;  4LIU A;  3A02 A;  1I27 A;  3DU6 A;  2IGK A;  1W36 C;  4A93 J;  2HWV A;  3MZ8 A;  4C2U A;  4V2G A;  3BCB A;  2F5V A;  4KN7 X;  3MZH A;  3HOV J;  1LKX A;  1MBG A;  3OL4 A;  2NVY J;  4HX7 A;  4BE1 A;  3VDX A;  1TL8 A;  1HQC A;  3WTW C;  5HDG A;  3K4N A;  2DK8 A;  1JE8 A;  1JTY A;  3OYK A;  4LIV A;  4ZZL A;  1ERD A;  1TQI A;  3ERM A;  2P6S A;  4XKC A;  1VQO I;  1TQM A;  1YS6 A;  2IPQ X;  1BN5 A;  3KZI C;  4LK1 F;  1RRJ A;  3KYC B;  3BJA A;  2LTP A;  1BIB A;  2JA2 A;  1T39 A;  1G59 A;  3P9K A;  4RGR A;  4HV5 A;  4AU7 A;  3OS0 A;  5BS6 A;  3FXO A;  4G7O F;  4BEH A;  1IRZ A;  2K40 A;  2DFH A;  1CF7 A;  4UHT A;  1S7A A;  1IXC A;  1WHU A;  2YX7 A;  3HM5 A;  4KJZ A;  1XMK A;  2VC0 A;  1VTN C;  3K10 A;  1D0X A;  2NYX A;  3RPU A;  2LKX A;  3E6D A;  4CZZ A;  3T1B A;  4R79 A;  5EG0 A;  4D9J A;  1ZGJ A;  2K02 A;  4HLX A;  1SMT A;  3PIO F;  5GAH J;  3QU3 A;  2HU9 A;  2DT5 A;  5E17 F;  5F0C A;  1Z6T A;  4RAY A;  4C2M J;  5H6R A;  5K5O A;  4IF4 A;  5JFR A;  4A6E A;  2ZO4 A;  1QPI A;  4BDZ A;  1IN4 A;  2XAS A;  3K4M A;  4BQQ A;  4U0W A;  5ILU A;  3LSJ A;  2FE3 A;  4KA4 A;  2KKO A;  1G8X A;  1MBH A;  1I50 J;  3MWM A;  1ONV A;  3TO6 A;  1RZ4 A;  1AKH B;  3FF5 A;  1DDN A;  2M30 A;  3OYM A;  1MSE C;  1SFU A;  1YS7 A;  3ABK H;  1HOM A;  3VEP A;  3WTZ A;  2UXN A;  2RN7 A;  1RUN A;  3BR2 A;  4PJ0 C;  1IV8 A;  2FQ3 A;  4C2T A;  2ECB A;  2LY2 A;  1PUE E;  4A3B J;  2FML A;  1WJE A;  1X2N A;  3B73 A;  2MSY A;  4M3E A;  3BQZ A;  1UZC A;  3QAH A;  3S3M A;  4UUT A;  4DYC A;  5LLQ A;  2FJ1 A;  2YUS A;  3Q0V A;  2DA3 A;  1LVK A;  2G0E A;  1DPR A;  2V4J C;  2DBB A;  2IGN A;  3K70 D;  5B66 C;  4ZYG A;  1XTA A;  1X58 A;  3PNY A;  3BR0 A;  4CDG A;  2LD5 A;  3S17 J;  3I4P A;  1J59 A;  4G94 A;  2K4B A;  2NVQ J;  3A01 B;  5DUK A;  2GLO A;  4H0E A;  3CDL A;  2PQ8 A;  1X1P A;  2A5W A;  2OF7 A;  1XN7 A;  1K4T A;  2O3F A;  3PNV A;  3DU5 A;  3K2Z A;  2JJ7 A;  2W57 A;  1H0M A;  4B3X A;  2AS5 F;  4XK4 A;  3QU6 A;  1APL C;  3W6V A;  2F6C A;  1ZN2 A;  2HOE A;  2LC2 A;  4WXC A;  1OYY A;  4JOM A;  1B72 A;  5J8C A;  2FNA A;  1YFH A;  3CD6 I;  2XC7 A;  2E60 A;  3ONQ A;  4U0Y A;  2QBY A;  1JUS A;  1KQ0 A;  1IDY A;  3K70 C;  5D6E A;  4AVP A;  3IRQ A;  3KET A;  3CCM I;  4HPQ A;  3EUH A;  3KP4 A;  1XB4 A;  3TDU C;  1MGT A;  3GFJ A;  2YU9 J;  1BI3 A;  2OQR A;  2XAJ A;  4M9Z A;  4ZYH A;  1I39 A;  3MFK A;  1MDM B;  3LFK A;  2V6C A;  5F0H A;  2CRG A;  1RKW A;  1IXR C;  4U0V A;  3GEZ A;  4XRF A;  3S16 J;  1JXS A;  2R5Z B;  1U8B A;  2M1B A;  1ON1 A;  3IAM 2;  2CJJ A;  3U21 A;  5A2Q K;  3IP4 B;  3Q9S A;  4DYQ A;  4KIT B;  1MZB A;  4HAM A;  1OCO H;  4RM2 A;  3OYD A;  1ZKG A;  1ZH5 A;  1ZEL A;  3R0A A;  2M4K A;  3PL8 A;  3KEO A;  3Q5F A;  2VAS A;  5IYB J;  4XLA A;  4C3H J;  4ENM A;  1FOK A;  1LJ9 A;  2HZT A;  4J00 A;  5B1B H;  3S1Q J;  2R7X A;  1P7J A;  3G1L A;  2TRT A;  4X6A J;  3LAP A;  5GTH C;  4I6Z A;  1ZRC A;  3CP8 A;  2BXZ A;  3L2V A;  2K86 A;  5LHG A;  3OWT A;  3KZZ A;  1T0F C;  2KIQ A;  2CQX A;  3J81 K;  1DQU A;  2GQQ A;  2B0L A;  3G1M A;  1TZL A;  5DM6 F;  2V1X A;  2GXB A;  2DAO A;  3FWE A;  4A69 C;  3IWZ A;  3P9C A;  4PGG A;  3S14 J;  2R7D A;  1TWA J;  2ETH A;  1QVT A;  2WAQ A;  2AXL A;  1GV2 A;  5J8F A;  1YOV B;  2IAI A;  3C7J A;  1VQ9 I;  1JGS A;  3QOD A;  1RNL A;  3J80 K;  4FE7 A;  4B8X A;  2JUG A;  1HW2 A;  2Q2E A;  2W84 A;  2HR3 A;  4BAC A;  1ZRF A;  2CV1 A;  2R0Q C;  2V7F A;  3F9K A;  1FTT A;  3OOP A;  4LK0 F;  2FQ4 A;  1O4X A;  3HYI A;  4AYB A;  1KU9 A;  3KFW X;  1WVR A;  2RRE A;  1I3A A;  2OD5 A;  5IPA A;  3FIS A;  3ZOB A;  1FYM A;  4XKW A;  3DTE A;  2EFN A;  1R5G A;  2IS4 A;  2E1O A;  1JJ8 C;  3FX3 A;  4E7S A;  2R7V A;  4NQW B;  2RQP A;  2X6W A;  2XAG A;  4LFU A;  1QHG A;  2HYF A;  4A6D A;  2Z99 A;  1I1G A;  3OYB A;  3JSP A;  2M34 A;  4RDU A;  5K5Q A;  2QQ9 A;  4IHV A;  1PYV A;  1G3S A;  3ZQL A;  1V5E A;  2CUE A;  3K1N A;  3KE2 A;  1STZ A;  4B48 A;  5E3O A;  3VYS B;  4P9U A;  4LOC A;  1J7K A;  2O8X A;  3KLO A;  5FKK A;  5K7H A;  1O3R A;  2GM4 A;  1FOX A;  1R6R A;  3KYD B;  4C3I J;  2MYS A;  2ZJP F;  2L02 A;  3F8N A;  1QA6 A;  1S7E A;  4XQF A;  2ZNY A;  3GUD A;  5BPD A;  4HLY A;  2IVM A;  1E3P A;  1XMA A;  1ZTR A;  3N97 A;  4A0Y A;  1EV7 A;  2R92 J;  3IWF A;  2EFO A;  2QCO A;  3PM1 A;  3KIO A;  2OTL I;  1KU3 A;  2MLK A;  4MHG A;  3BZK A;  3HKZ N;  2RNJ A;  5JR3 A;  5JI6 A;  3H0D A;  1X1A A;  4I01 A;  2E2J J;  2NVT J;  1NG7 A;  4PZJ A;  1OCZ H;  4XNF A;  5IT9 K;  3LOC A;  3NAR A;  2MA3 A;  2QUF A;  5C3E J;  4FX4 A;  3M7G A;  5CVI A;  5EG0 B;  3TBI A;  2GZW A;  4C30 A;  5K1Y A;  4AIJ A;  2PMZ N;  5CVV A;  2OJE D;  2CW0 F;  3NWT A;  3RZD J;  3DBR B;  1SVO A;  3SJM A;  3MEX A;  4YG2 F;  4L5I A;  4NC8 A;  3CCR I;  1FZP B;  1IO2 A;  4EAT A;  4LB5 A;  3QRF F;  5DM7 F;  3L1P A;  3L2R A;  1ZQ3 P;  2VJI A;  4M6V A;  4A3C J;  1YJ9 I;  3E6C C;  3E7L A;  3SEZ A;  1VQ8 I;  3OYI A;  1IRX A;  1HW1 A;  2DDA A;  3AFH A;  2E34 A;  3QOE A;  2DXI A;  2A6T A;  2L5Q A;  2LSO A;  3P5J A;  2YS9 A;  1XG1 A;  1I5Z A;  4N9H A;  5FD5 A;  1R4N B;  2LMD A;  1LFB A;  3LSI A;  1IDZ A;  3HOX J;  5DYM A;  3V7S A;  1TNT A;  2FU4 A;  4MTD A;  4K2E A;  4WWC A;  2CUZ A;  4Y33 A;  4YRV A;  3GLX A;  3OYE A;  2HQ5 A;  4WX9 A;  4AUX A;  3CJQ B;  4E7J A;  2FUG 2;  2COM A;  3BPX A;  4BBR J;  3FXJ A;  3JRF A;  2BHY A;  4EJO A;  2FMY A;  2W82 A;  4RB1 A;  4OAZ A;  3L2C A;  3DKY A;  1ON2 A;  4Z2Y A;  2DFE A;  3G3Z A;  5L3E A;  3LQR A;  3BG5 A;  4HBL A;  1JUP A;  2E7X A;  4PJM A;  4IRG A;  3LNQ A;  2A68 F;  4RS8 A;  2CUJ A;  3HRS A;  3GFM A;  3I4M J;  1RET A;  1EKE A;  3H5A A;  3S93 A;  1VQ5 I;  2XGX A;  4I2O A;  5JHU A;  4Y52 J;  3IH3 A;  2BY3 A;  1HLV A;  2E35 A;  2ZFU A;  3BR6 A;  4FIS A;  3RDI A;  2FXA A;  1JT0 A;  4UVC A;  3BRO A;  3IUO A;  4JX5 A;  4HQM A;  1F36 A;  1B59 A;  2Z3Y A;  4QPQ A;  5KCM A;  3MAJ A;  1QBJ A;  2X0L A;  5EEH A;  4MGR A;  1ZR2 A;  1U3E M;  3LA2 A;  2W85 A;  2XF5 A;  2XDV A;  5A2Q Z;  5EDN A;  1ETQ A;  4M3B A;  4EVI A;  3R6S A;  4E7L A;  3RYP A;  1G2H A;  2B63 J;  4YII A;  1TWC J;  4GXO A;  1MNM C;  1R5I D;  1R1V A;  2JK3 A;  4A0Z A;  3KP3 A;  1B72 B;  3M1C A;  1B8I B;  2FA5 A;  3CMA I;  1X4P A;  2QBY B;  2WY7 Q;  2R7R A;  3N4M A;  3I9V 2;  2H6C A;  3PJR A;  2OU2 A;  2CYY A;  5HLH A;  4I02 A;  4B09 A;  1E3O C;  1W5T A;  3DF8 A;  3DPL C;  1HDD C;  3QOP A;  3I59 B;  2NVX J;  4OIR F;  2HXI A;  2K9L A;  1OCC H;  2EJR A;  3D5L A;  1BR2 A;  3FZV A;  5ICC A;  2L3D A;  3G2B A;  4MFD A;  4M3F A;  3BY6 A;  2GIZ A;  1DGW Y;  2Z33 A;  5GP9 A;  2BXY A;  4CYD A;  3CCV I;  4EM1 A;  2X4H A;  3NEU A;  2LNB A;  2NS7 A;  2Y75 A;  1GUU A;  3H1C A;  2RC4 A;  1LEB A;  2Y9Y A;  5IYD J;  3VYU B;  4XN0 A;  4XSZ F;  2DA6 A;  2LBF A;  5D4S A;  2X6X A;  3K2A A;  2P4W A;  4I0A A;  2W24 A;  2LY9 A;  3OSG A;  1G3Y A;  3J80 Z;  3CJR B;  1A36 A;  2JWT A;  2HDD A;  3T8T A;  3H3U A;  4IXA A;  3I71 A;  4NBQ A;  2X1E A;  3SXY A;  5E79 C;  1O3Q A;  1H9T A;  4I0B A;  2MFZ A;  2KRH A;  4L9N A;  1U5T A;  3G4S I;  1S9H A;  3SZG A;  1BM9 A;  3HHH A;  3Q3S A;  3ECO A;  3GTK J;  2A3S A;  2QGU A;  4XBF A;  2KHM A;  5H6Q A;  4LJZ F;  3LSP A;  4E70 A;  4R8H A;  3DTI A;  2DMP A;  2DTZ A;  1MMS A;  4EJV A;  3RKW A;  2VE9 A;  1X19 A;  4UVB A;  1P9Q C;  5C44 J;  3GTG J;  1JUM A;  4ZDP A;  4XOP A;  4B47 A;  3MN2 A;  1SAN A;  4M9X A;  2BGC A;  3BCA A;  1USS A;  4A2U A;  2HXO A;  2PJR A;  2V79 A;  3ZQC A;  5E20 A;  4UV8 A;  3EUK L;  1Z7U A;  2Q2E B;  3ZQ7 A;  2X9D A;  4XLE A;  5DD4 A;  2XGC A;  1P6R A;  3A0H C;  1Z05 A;  4LB6 B;  3BTC A;  1KGS A;  3HTU A;  1O7F A;  3BR3 A;  4IHX A;  1ZR4 A;  2NS0 A;  3VOE A;  1OMI A;  1WZ2 A;  3CC7 I;  1BOB A;  3HC7 A;  2PMZ A;  2EPF A;  4FQG A;  3GTO J;  2MGQ A;  2Y0M A;  3K4K A;  4A5N A;  3E5U A;  4A3G J;  2X48 A;  3ZN0 A;  2DQR A;  3GO5 A;  1LDJ A;  5IT9 Z;  3V8J A;  3MKL A;  2HS5 A;  2KFD A;  3F22 A;  1D5Y A;  3WU0 A;  2X6Y A;  1G4D A;  3PQJ A;  3T8R A;  3BLY A;  4NUB A;  2STW A;  2DMU A;  3GTL J;  1JTX A;  5E8I A;  3C1D A;  2H27 A;  5BOX A;  3ML6 A;  4FET A;  1P92 A;  5EZH A;  2VPR A;  4IOA F;  1GDT A;  4NC7 A;  1X3Z B;  2HVQ A;  3Q9V A;  3W6J B;  3ZCO A;  3FK6 A;  3RKX A;  1FP2 A;  3DEE A;  3HRT A;  4BUP A;  4WK8 F;  4RGS A;  2UV1 A;  3M8E A;  1LFU P;  9ANT A;  1TLH B;  5KNL A;  2X85 A;  4PJL A;  1MMA A;  3IV5 A;  5BPI A;  3HOT A;  2Y69 H;  3G73 A;  1UMQ A;  2Z2S B;  1VFC A;  1AOY A;  4M3D A;  3ZQH A;  4PK4 A;  1U78 A;  3KEY A;  5IP7 J;  4RB2 C;  1XDU A;  1D0Z A;  5AIP A;  4FX0 A;  2XF6 A;  4EJW A;  3F21 A;  3UKG A;  2G9W A;  3DV8 A;  2EBI A;  4MEY F;  2RVC A;  2PG4 A;  2F5E A;  3LSM A;  4DJA A;  2XPU A;  4A0X A;  4RLQ A;  1IGN A;  1QHH D;  2OC6 A;  1CGP A;  2VON A;  2DJI A;  2ZNZ A;  4XKB A;  3RJP A;  3OYL A;  2MAB A;  3Q0U A;  2VE8 A;  1WPK A;  2W1O A;  3ZMU A;  4EGZ A;  3AKZ A;  4E7Z A;  3BT9 A;  1O7L A;  2EA2 A;  3S2W A;  5M5X J;  2VOO A;  2YPR A;  3FM5 A;  4C3J J;  3F8B A;  3B02 A;  2ELJ A;  3MCZ A;  1IV6 A;  3H36 A;  2MLG A;  4X1E A;  2LRD A;  1DUX C;  2C6Y A;  4ZYE A;  5DCM A;  1LNW A;  1FX7 A;  2OV7 A;  3I55 I;  3HRU A;  4A3J J;  3IC7 A;  3ASN H;  1XX5 A;  4CYC A;  2RDP A;  1OLT A;  1J5Y A;  1QNT A;  2RGV A;  4BE2 A;  5GAG J;  4AD9 A;  2PFB A;  1KQ8 A;  5KAF C;  1X2M A;  2R7U A;  4A3M J;  4RAG A;  1RKT A;  3CP2 A;  1FSH A;  3JRG A;  3M9A A;  4I76 A;  5LFA A;  2CQQ A;  4HOB A;  1YYV A;  1UCR A;  2HVR A;  4AWX B;  2DPD A;  1YIJ I;  3CLQ A;  1M1E B;  5CJ9 A;  1LPQ A;  2Q8K A;  2WA0 A;  3BG3 A;  2DLL A;  4HA8 A;  3RTR A;  1BJA A;  2DW4 A;  2L2O A;  1J09 A;  2F48 A;  1UG0 A;  3K4L A;  2CFX A;  1LUJ B;  1T98 A;  2Y48 A;  2QKL B;  3WTV C;  1MW7 A;  3HSF A;  3H0G J;  2FBK A;  2HQA A;  3BTL A;  1D8J A;  1ORK A;  3O6B B;  4QWQ A;  4XLP F;  4LG0 A;  5DD8 A;  3V4G A;  3MQ0 A;  1IC8 A;  1O3T A;  2WAQ N;  1Q1H A;  4O3M A;  2V26 A;  2LDU A;  4RBO A;  2FBI A;  3TDZ C;  4O6J A;  3M4O J;  2DCE A;  1TT5 B;  1ITY A;  3W6K B;  3F8C A;  2F5D A;  2R7Q A;  2I5U A;  3G71 I;  1XC5 A;  3HGG A;  4DZJ A;  2DU9 A;  2P81 A;  5KHD A;  4G7Z F;  5F1R A;  3TGN A;  2BZT A;  2COB A;  3RYR A;  2QSG X;  3GF2 A;  1PJR A;  5JLW A;  4AYB N;  4F7Z A;  3V42 A;  2W25 A;  2M0C A;  1IUF A;  3GX4 X;  1T08 B;  3TOA A;  4IO9 F;  1X1C A;  2LBF B;  3L2Q A;  2O6G E;  4ZDO A;  2KRC A;  3LST A;  2QZ8 A;  5ICE A;  3LA7 A;  1P2F A;  3A0B C;  3GVA A;  2CMP A;  3L09 A;  1V5F A;  2XGE A;  1FLI A;  3JSO A;  4LMY A;  3ESW B;  1N25 A;  2LR8 A;  2Z16 A;  3HOY J;  3I54 A;  5J4Y A;  4LLL A;  1T8I A;  1UHS A;  2Y2Z A;  2VKH A;  3BTJ A;  1YW9 A;  2R5Y B;  4AM3 A;  3FMS A;  2B9S A;  5D5V B;  3B6C A;  3OV8 A;  2D1H A;  2DA1 A;  1LDD A;  3G6E I;  4W97 A;  2NNN A;  3WTY C;  3IKT A;  2B7E A;  2DMT A;  3RI4 A;  3FXR A;  2O9L A;  3OL3 A;  5CQE A;  4HX8 A;  2BYV E;  1S7O A;  2VJ4 A;  3QYF A;  3MMY B;  1F5T A;  4BHP A;  3BDD A;  2CUF A;  4NDL A;  1ZG1 A;  3DFG A;  1AU7 A;  2CS3 A;  4XRS G;  3AG4 H;  3MZY A;  1DU0 A;  2QLZ A;  3F0C A;  2M2E A;  4FT8 A;  5ILS A;  3R61 A;  4CCK A;  3RPU D;  2M8G X;  4BH9 A;  4ZYA A;  3ZQF A;  5GPC A;  4WXH A;  4BGD A;  1S3J A;  2K5C A;  4LIT A;  4IHS A;  5FLV A;  1X1D A;  3V7C A;  5CLS A;  2IS2 A;  5ICF A;  2E7W A;  3ABT A;  3HUG A;  1R00 A;  5CVR A;  1YTY A;  3S3N A;  2R7W A;  4CZC A;  1KYZ A;  3BP8 A;  2CFO A;  3REO A;  3QPT A;  4IKF A;  1ETO A;  1I6H J;  3BZC A;  3TMO A;  4OMY A;  3M1E A;  3RZO J;  1T2K A;  3ZP5 A;  2IS6 A;  1WH5 A;  4QLC U;  4BHB A;  2W4S A;  5EGO A;  2DOE A;  2X6O A;  4QTR A;  5IY5 H;  1WI9 A;  2K27 A;  2QEX I;  1Y8Q B;  2EIK H;  1GVD A;  2GXA A;  4HF1 A;  4G9Y A;  4XL9 A;  4E7H A;  3LA3 A;  3EYI A;  4XON A;  1EH8 A;  4RMN A;  2NOG A;  2VI6 A;  4ZTJ A;  2IJL A;  1OCP A;  3BG6 A;  3CZ6 A;  4F52 A;  1JT6 A;  2EZH A;  4HW0 A;  4ZYD A;  1A04 A;  2G7U A;  1B1B A;  4IQJ A;  4S05 A;  3VFZ A;  2VB6 A;  2IP2 A;  1DP3 A;  2XIG A;  3C18 A;  2TCT A;  3SFI A;  1S8N A;  5F6F A;  4MIM A;  2BHZ A;  1ULY A;  2YU3 A;  1LEA A;  2CQ7 A;  1MBK A;  3GTP J;  5DEQ A;  2GWR A;  3ZQQ A;  1S72 I;  1BR4 A;  1FWZ A;  4JX6 A;  5B5E C;  3TO9 A;  2OTJ I;  1V3F A;  5ED4 A;  5HNH A;  2QA4 I;  5D6F A;  3IRR A;  2HQR A;  2LYC A;  2GXG A;  2UWM A;  3KP2 A;  1ZK8 A;  4GRI A;  4I99 C;  1NK3 P;  3F6O A;  2HTS A;  4AIK A;  2BW3 B;  1ETX A;  2K9M A;  3ZMS A;  1DPU A;  3O3K A;  4OIQ F;  1FY7 A;  3IL2 A;  1RI7 A;  3WU2 C;  4E4H A;  2PBI A;  1A5J A;  5HS9 A;  1VZ0 A;  2KRF A;  2JT1 A;  1VQ7 I;  2R7F A;  1UEL B;  2H8R A;  3K6G A;  4MFE A;  1XGS A;  1WWX A;  4DYR A;  5M5W J;  1K83 J;  4MLO A;  3LL7 A;  3FXU A;  1X3U A;  1REP C;  5DCM B;  4ZZD A;  2DMN A;  5IP9 J;  1MND A;  3OYF A;  3JRH A;  2JA8 J;  2HNH A;  2R7T A;  2ICW G;  1Z3X A;  1I6X A;  2CU7 A;  3W2W A;  4HST A;  2ID3 A;  3RQ4 A;  2PMH A;  4Q5S F;  2DA2 A;  4ZDL A;  1BW6 A;  5DUI A;  3CMM A;  1UST A;  2EB7 A;  1TT0 A;  2EK5 A;  1FSE A;  2CW8 A;  1WJB A;  3SZT A;  3OYA A;  2PJP A;  1MJB A;  2NRA C;  4F91 B;  4EMS A;  5LGU A;  2DK5 A;  2F4M B;  3MD2 A;  4FHT A;  4LLN A;  5IP6 A;  3D5R C;  3O2P E;  2EWN A;  1IZ1 A;  1F9N A;  2HQN A;  1PVE A;  2HOT A;  4XIC A;  3GZ5 A;  2PI0 A;  2RQQ A;  2GOX B;  4M3G A;  3OOU A;  1MMD A;  1FIA A;  4KFC A;  2HPI A;  2MH2 A;  3DBH B;  3TKY A;  3S1M J;  1BBY A;  3RIR A;  3F8M A;  4CUG A;  2VBW A;  4U7B A;  1TQP A;  1RIO H;  4IHW A;  2EZI A;  2JUC A;  2AQF A;  3CCQ I;  5CKT A;  5B3S H;  2WAF A;  1KU2 A;  3C2G A;  2XUB A;  2TDX A;  3EUH C;  2I10 A;  2GA2 A;  3I56 I;  4YEL A;  3JRE A;  3FDY A;  4LG0 B;  1SVL A;  2OQG A;  4CIC A;  1GXP A;  3S15 J;  1VQN I;  4IOC F;  1IN8 A;  2HPM A;  1FTZ A;  5BNG A;  3UR3 C;  2W7N A;  3T0Y A;  1CQT A;  2P0W A;  4M73 A;  4BJT A;  4A3K J;  4IEJ A;  1IN7 A;  3FKI J;  5LRR A;  3KYL A;  4BEH B;  2KIS A;  5GTI C;  1YW7 A;  2JSP A;  1S6L A;  3EUA A;  2VN2 A;  1CF7 B;  5DS9 A;  1QU3 A;  1HCR A;  4IHY A;  4HF0 A;  3ISP A;  1B4A A;  5FKM A;  3GBG A;  3H92 A;  1OKR A;  4G6Q A;  3IKV A;  1IJW C;  1JKR C;  5JHF A;  3KX2 A;  1MH3 A;  2P7C B;  3BZ6 A;  1QO0 D;  4UUS A;  3J7Y J;  2XSJ C;  3E1S A;  3CDI A;  1EA3 A;  3E0J B;  1WFX A;  4KIB A;  5IOZ A;  1SEU A;  2V1D A;  2KP6 A;  4BKX A;  2W00 A;  3OR1 C;  3HDD A;  1HKQ A;  1Z7L A;  2CGP A;  1XD7 A;  3DTK A;  5H2F C;  4TV7 A;  1X4O A;  5HS7 A;  3VWB A;  2K7L A;  2F2E A;  3BQY A;  4KIG A;  4L9J A;  1UG2 A;  1BC7 C;  2KIF A;  2K9Q A;  4A5M A;  3OS1 A;  4BXX J;  3GME A;  3PQK A;  2MH9 A;  1X3W B;  2VQL A;  3KPH A;  1LB2 A;  2E5N A;  3TO7 A;  4BY1 J;  3OYC A;  1BJZ A;  1QZY A;  2JN6 A;  2KT0 A;  4EJU A;  2VJJ A;  4ABZ A;  2QF7 A;  2HZD A;  3PFI A;  4YFK F;  3FIW A;  2VBX A;  2ZC2 A;  1W7P A;  4NNJ A;  3TW7 A;  5D4R A;  2VC1 A;  3C2B A;  1QRY A;  3FXK A;  1HBX G;  2E36 A;  1W4M A;  1Z1D A;  2ELK A;  4D1Q A;  3A03 A;  2KZV A;  5FO5 A;  2K4J A;  2AHQ A;  1V4R A;  3OYN A;  4IPA A;  3HPH A;  1QPM A;  1R23 A;  2VT2 A;  2P6T A;  3TQN A;  2K9S A;  2LF7 A;  2VUM J;  2DI3 A;  1V5G A;  2JPB A;  2LY1 A;  3HUG B;  1XDS A;  2OAZ A;  4HEA 2;  2FEZ A;  2R7Z J;  4XSX F;  1K78 A;  2XKP A;  1LFP A;  4YIF A;  3ZGK A;  3EDP A;  1MMG A;  3JTG A;  4S04 A;  4IRH A;  2ZB9 A;  2ZBK A;  1GVJ A;  1IRG A;  1D1A A;  2XAH A;  4XKV A;  1T38 A;  1HC8 A;  2DA5 A;  5J47 A;  3R4K A;  4I7H A;  3QQA A;  5J3L A;  1ETW A;  1WJ5 A;  1YJN I;  4BJ5 C;  1KON A;  5JVG F;  4FTH A;  2VQC A;  1R9T J;  1YRN A;  2BY2 A;  5J4V A;  2A61 A;  3J81 Z;  2GBY A;  4HF2 A;  3LQQ A;  3CQZ J;  4HYE A;  2FRH A;  3FHZ A;  4ZC3 A;  2N8G A;  1ZRD A;  1E0E A;  1D5V A;  2FNP A;  1SD5 A;  4PSX A;  4P1W A;  4B4C A;  1WKM A;  2JMW A;  1XS9 A;  3HL2 A;  1R1T A;  2L9N A;  3GFL A;  4W1U A;  4F93 B;  4F92 B;  1R7J A;  1SFK A;  1D1C A;  1SVM A;  3JW4 A;  5L3G A;  3BC8 A;  2D45 A;  1L3L A;  4AID A;  2DOA A;  4OAY A;  1N77 A;  1RC9 A;  4EJT A;  2KIU A;  1IRF A;  3QPL A;  3E97 A;  3L2U A;  1IW7 F;  4A12 A;  2H8W A;  3LSH A;  2CG4 A;  1P4A A;  4JBA A;  3NRV A;  1R5H A;  3M07 A;  4U7D A;  2L7F P;  3CC2 I;  1L0O C;  4D7M A;  3PNT A;  5AIQ A;  5FLM J;  2V9P A;  2HDW A;  2ELH A;  2DOF A;  2CWE A;  3WG9 A;  2FD5 A;  4JQF A;  4EM2 A;  2X51 A;  4YFX F;  5K7Z A;  1YJW I;  1OYI A;  2R4G A;  1T33 A;  3S1R J;  3L9F A;  2HGC A;  2XB0 X;  3OS2 A;  2EZK A;  4NB5 A;  2LFB A;  3ELK A;  1AKH A;  4DNC A;  2J5O A;  3ZXS A;  3QP6 A;  2H1K A;  3WOD F;  2VXZ A;  3VSL A;  3PUB A;  4LD5 A;  1TW2 A;  3JAM K;  3CC4 I;  3LSG A;  1ZYR F;  3ABM H;  2EFQ A;  3PO3 J;  3DLA A;  2P8T A;  1I1S A;  5E8G A;  1D8K A;  5FB2 A;  3WTX C;  2DO7 A;  1C0W A;  3FMQ A;  3PUF A;  1W0U A;  4KDP A;  4CCM A;  2Y30 A;  4EQQ A;  3JRB A;  2VL8 A;  4OU0 A;  3SZP A;  2NAZ A;  1FJL A;  4PJN A;  1OR7 A;  4MQ9 F;  2DFI A;  3B6A A;  4QIW N;  3QPH A;  1LVA A;  2CQN A;  2XF7 A;  1EH6 A;  2XAU A;  3HSR A;  2KDZ A;  3S1N J;  4CA0 A;  4M74 A;  3RCO A;  3X2Q H;  3MKZ A;  3BOQ A;  3F8F A;  4E6K G;  2EIL H;  3BG9 A;  2MC4 A;  5EZG A;  4ETS A;  5L3B A;  3A01 A;  2L7Z A;  3G1O A;  3V7R A;  3JRI A;  3GZN B;  1N75 A;  4BAY A;  4A3D J;  2CSO A;  1H89 C;  2VXD A;  3KP7 A;  2VOD A;  4BQN A;  3AG3 H;  2LOO A;  4RAZ A;  2KIM A;  1LQ1 A; 
#chains in the Genus database with same CATH homology
 1B9N A;  3WGH A;  2ZFW A;  4UUV A;  2XKO A;  3L7W A;  3I5U A;  1AWC A;  4P9F A;  5D8L B;  1B9M A;  4L18 B;  4UNO A;  5L3F A;  1E17 A;  1Z9C A;  1GHC A;  2M5W A;  3FXQ A;  1YIO A;  2V1U A;  4GYG A;  5E1X A;  3KZY A;  1U5T C;  2KJB A;  4M72 A;  5CYV A;  3BJ6 A;  1TTY A;  1HSJ A;  4G6D A;  4IHT A;  3ZMZ A;  3F72 A;  1XGO A;  1MDM A;  4G7H F;  3DQV C;  1MKM A;  2QQB A;  2XV4 S;  4M6Y A;  3ECH A;  2BEO A;  5KVR A;  3KP6 A;  4M6X A;  1R1U A;  1FYK A;  2HKX A;  4WF2 A;  2GAU A;  3V8L A;  3K1P A;  1P4W A;  2KJC A;  3GYH X;  5DV5 A;  3CO6 C;  5D5U B;  1YQA A;  3SQN A;  4L9V A;  1IN6 A;  1UB9 A;  2L54 A;  3CLO A;  4ZH4 F;  3DEU A;  2XVC A;  4M71 A;  3I58 A;  3I0T A;  4ENK A;  5LEJ A;  3E3V A;  3HOS A;  3ZMD A;  1UHM A;  4YFN F;  3BWG A;  1LDK B;  2XRO A;  1UFM A;  5AON A;  3ERE D;  1J9I A;  1ZRE A;  1YO5 C;  1ODD A;  3KLN A;  1O57 A;  3WE3 A;  1XSD A;  5FFZ A;  3WTT C;  3DXJ F;  2WC2 A;  4GGG A;  4CXF A;  4NQW A;  4IJA A;  1OPC A;  1G3T A;  4Y17 A;  1SD4 A;  2A69 F;  5LHI A;  2QYO A;  2G7H A;  4PDK A;  5KK1 A;  3WGG A;  5LBQ A;  2FOK A;  3I53 A;  1YW8 A;  3WU1 B;  3QP5 A;  2EV0 A;  1U6G A;  1W5S A;  1XGN A;  3AAF A;  4UV9 A;  3WGI A;  1T6S A;  3JAM Z;  2LF8 A;  1U5T B;  4BQA A;  3HRM A;  5HS8 A;  1XCV A;  3SHF A;  4WXD A;  3F3X A;  3HHG A;  2FBH A;  5D8K B;  3FMR A;  2CO5 A;  3F6V A;  1U8R A;  1PDN C;  3C3W A;  2IW5 A;  1K6O A;  1UHW A;  4ENN A;  2FF4 A;  3ULQ B;  4AIH A;  2O0Y A;  2XAQ A;  5E1W A;  2M87 A;  3VB2 A;  2BBY A;  3CO7 C;  3J7A O;  1F4K A;  2RKH A;  1MJ9 A;  1ZGA A;  1TW3 A;  5BMZ A;  1T0F A;  5ERI A;  3RKY A;  3BJO A;  4EM0 B;  4HDU A;  1WSU A;  4Y13 A;  2UXX A;  1HXD A;  2DTR A;  3HSE A;  1XSX A;  1SAX A;  4MEX F;  5HLG A;  1SMY F;  3EET A;  1RUO A;  3P7N A;  2YR2 A;  1R36 A;  5LRS A;  1ZLJ A;  5J6X A;  1QQI A;  5HOO A;  2HKO A;  2A5Y B;  2RV8 A;  1PP7 U;  2QVO A;  4DQ2 A;  4Q48 A;  1R22 A;  4RB3 C;  1ZAR A;  3CJN A;  1F1Z A;  2L01 A;  2DQL A;  1FYL A;  3GFI A;  5F64 A;  3HTS B;  3BPV A;  1EH7 A;  1SFX A;  4P96 A;  4LLG F;  3I59 A;  4R1H A;  3WE2 A;  4MNU A;  1IAW A;  1K79 A;  2CQK A;  2OA4 A;  1HKS A;  1QZZ A;  3E5X A;  3DPT A;  4L5J A;  2A07 F;  5DCF A;  4MTE A;  3CTA A;  3K1M A;  2F5C A;  2JSC A;  4BYY A;  1FP1 D;  4UVA A;  3ABU A;  1HST A;  2QM3 A;  1QGP A;  4KNY A;  2R3S A;  2HYG D;  1FPQ A;  3K69 A;  4GYI A;  5LGN A;  5E1Z B;  3LAJ A;  3LWF A;  4ENJ A;  4ON0 A;  3M8F A;  1FT9 A;  2J5P A;  2P5L C;  3D0S A;  3R60 A;  2Q0O A;  1JHH A;  4CO8 A;  1S29 A;  3GXO A;  2E1N A;  6PAX A;  2PLY A;  2H94 A;  5LHH A;  2LKP A;  2F5F A;  2ZKZ A;  1ZG3 A;  1ZAO A;  3E6M A;  1Z6R A;  1P4X A;  2GIV A;  5ILV A;  1GXQ A;  1FC3 A;  2ZME A;  1BIA A;  2P5V A;  3U9G A;  2HEO A;  2XRN A;  5BQT A;  4RGU A;  2ZXJ A;  2PEX A;  1IXS B;  5TJJ A;  2ISZ A;  5HDN A;  2IA1 A;  3VOD A;  5IT3 A;  2JPC A;  2ISY A;  4OIO F;  5HVQ C;  3U1D A;  2OZU A;  4OIP F;  1KQ9 A;  2VOP A;  2FSW A;  1FNN A;  2VBZ A;  4BNC A;  1DP7 P;  2ZCW A;  5HDK A;  4HDV A;  1J2X A;  3CUQ A;  1E2X A;  2BV6 A;  1G6N A;  1BI2 A;  2NNY A;  1ZG5 A;  2MC3 A;  3KP5 A;  3V8K A;  3WTU C;  4OOI A;  2EA4 A;  4D0P A;  1BI1 A;  2MBF A;  4MQV A;  3ZMV A;  4ESF A;  3TOB A;  2IA0 A;  5CVJ A;  3NQO A;  4N9I A;  2ACJ A;  5EEG A;  3KEQ A;  1FBQ A;  1R58 A;  4Y15 A;  5LEK A;  5FGM A;  4KMU X;  2O03 A;  3E6B A;  1IUY A;  4KMF A;  3L00 A;  1HW5 A;  4IVN A;  2QWW A;  5L3D A;  4KN4 X;  4O5V A;  3ZN1 A;  4KT5 C;  5FD6 A;  2Z9O A;  4RGX A;  4HV6 A;  3U2R A;  2EV6 A;  1B6A A;  1G3W A;  1Z91 A;  4UXN A;  2IA2 A;  1ZHF A;  3WTS C;  1JHF A;  2D2W A;  2ADU A;  2XHK A;  4EGY A;  5K5R A;  1BI0 A;  4KYW A;  1W7P D;  5FLX K;  4NHJ A;  2HDC A;  2ESN A;  3FM3 A;  3P9I A;  1TNS A;  1SFE A;  1D3Y A;  1FBU A;  3T5X A;  2UZK A;  4KUM A;  3CUQ C;  4N0B A;  4JK1 X;  2V9V A;  1K7A A;  1H9G A;  3HIF A;  3ZMT A;  2ZJ2 A;  2E1C A;  1YG2 A;  2WTE A;  1IN5 A;  3H3Z A;  1Y0U A;  2EFP A;  1KYW A;  4BHC A;  3DP7 A;  4Q47 A;  1TBX A;  3F23 A;  4XLN F;  1MD0 A;  5L3C A;  2EFW A;  1J75 A;  1NHA A;  4I98 B;  2EV5 A;  1XSV A;  1U2W A;  5D5X B;  2M8E A;  4KIF A;  4HQE A;  2YSR A;  3GWZ A;  2ESH A;  2WWY A;  4P5O A;  4HZF A;  2OZ6 A;  2XAF A;  2GA1 A;  3I64 A;  1OYW A;  4CGZ A;  2QQA A;  3CDH A;  2HTJ A;  3EYY A;  4ASN A;  4P55 A;  3GW2 A;  2O61 A;  5JVT A;  2ZME B;  5HLI A;  1IF1 A;  2VBY A;  2JZY A;  2MD5 A;  4U88 A;  1MJA A;  4KIC A;  1WQ2 A;  3EQL F;  4GCV A;  1J0R A;  2QEN A;  1HKT A;  2L4M A;  2PMU A;  1KU7 A;  5FFX A;  4ESB A;  1XCB A;  3GZ6 A;  4M9S A;  3K9T A;  4G8X A;  2JTV A;  4Q4Z F;  1WRJ A;  2A6H F;  4GO1 A;  4L9T A;  3ROU A;  3ZPL A;  2YX4 A;  4PCQ A;  3DKW A;  3CUQ B;  2D1V A;  2Z5U A;  2H09 A;  2DPU A;  2P5K A;  4EV0 A;  1KA8 A;  3R0J A;  4BXU A;  3KCC A;  4ESJ A;  1BOA A;  2P7V B;  1O3S A;  4OIN F;  2IT0 A;  2M45 A;  5LGT A;  2A6E F;  1XGM A;  2STT A;  2L4A A;  4IRI A;  3SFZ A;  2WV0 A;  5TRD A;  2VT3 A;  4LGW A;  1W7P B;  5DDG A;  2JRT A;  2BE5 F;  5H20 A;  3RPQ A;  1BC8 C;  5D5W B;  1YLF A;  3COA C;  4RB0 A;  4PGH A;  1SD7 A;  2HFH A;  4HX4 A;  4CHU A;  5FLX Z;  1K78 B;  5E18 F;  1SD6 A;  4L0Z B;  3CUO A;  3IHU A;  4WCG A;  3JTH A;  3K0L A;  3E5Q A;  1ZLK A;  2OBP A;  4L0Y B;  5ICG A;  1FBS A;  2IRF G;  2PN6 A;  1PP8 F;  5CVU A;  2H6B A;  4I09 A;  4OMZ A;  1I27 A;  2HWV A;  4KN7 X;  3MZH A;  4HX7 A;  1HQC A;  3WTW C;  5HDG A;  1JE8 A;  2DK8 A;  4ZZL A;  1TQI A;  2P6S A;  1TQM A;  1YS6 A;  2IPQ X;  1BN5 A;  4LK1 F;  3BJA A;  1BIB A;  1T39 A;  3P9K A;  4RGR A;  4HV5 A;  5BS6 A;  4G7O F;  1CF7 A;  4UHT A;  1S7A A;  1IXC A;  2YX7 A;  1XMK A;  2VC0 A;  1VTN C;  2NYX A;  3RPU A;  3E6D A;  4CZZ A;  3T1B A;  4R79 A;  1ZGJ A;  2K02 A;  4HLX A;  1SMT A;  3QU3 A;  2DT5 A;  5E17 F;  1Z6T A;  4RAY A;  5H6R A;  5K5O A;  4IF4 A;  5JFR A;  4A6E A;  2ZO4 A;  1IN4 A;  2XAS A;  5ILU A;  4U0W A;  2FE3 A;  4KA4 A;  2KKO A;  3MWM A;  3TO6 A;  1ONV A;  1RZ4 A;  3FF5 A;  1DDN A;  2M30 A;  1SFU A;  1YS7 A;  3VEP A;  3WTZ A;  2UXN A;  2RN7 A;  1RUN A;  2FQ3 A;  1PUE E;  2FML A;  3B73 A;  3QAH A;  5LLQ A;  1DPR A;  2DBB A;  4ZYG A;  4CDG A;  3I4P A;  1J59 A;  4G94 A;  2K4B A;  5DUK A;  4H0E A;  2PQ8 A;  1XN7 A;  2O3F A;  3K2Z A;  2W57 A;  1H0M A;  2AS5 F;  3QU6 A;  1ZN2 A;  2HOE A;  4WXC A;  1OYY A;  5J8C A;  2FNA A;  1YFH A;  4U0Y A;  2QBY A;  1KQ0 A;  5D6E A;  4AVP A;  3IRQ A;  3KET A;  3EUH A;  3KP4 A;  1XB4 A;  3TDU C;  1MGT A;  3GFJ A;  1BI3 A;  2OQR A;  2XAJ A;  4M9Z A;  4ZYH A;  3MFK A;  1MDM B;  3LFK A;  2V6C A;  1IXR C;  4U0V A;  3GEZ A;  4XRF A;  1JXS A;  2M1B A;  1ON1 A;  5A2Q K;  3Q9S A;  1MZB A;  4HAM A;  1ZH5 A;  3R0A A;  3KEO A;  3Q5F A;  4ENM A;  1FOK A;  1LJ9 A;  2HZT A;  3LAP A;  1ZRC A;  2K86 A;  5LHG A;  3KZZ A;  3J81 K;  2GQQ A;  2B0L A;  2V1X A;  2GXB A;  2DAO A;  3FWE A;  3IWZ A;  3P9C A;  4PGG A;  2R7D A;  2ETH A;  2AXL A;  5J8F A;  3C7J A;  1JGS A;  1RNL A;  3J80 K;  4B8X A;  1HW2 A;  2Q2E A;  2W84 A;  2HR3 A;  1ZRF A;  3OOP A;  4LK0 F;  3HYI A;  1KU9 A;  3KFW X;  2OD5 A;  1FYM A;  2EFN A;  1R5G A;  3FX3 A;  2RQP A;  2XAG A;  4LFU A;  2HYF A;  4A6D A;  2Z99 A;  1I1G A;  3JSP A;  5K5Q A;  2QQ9 A;  1G3S A;  3K1N A;  3KE2 A;  1STZ A;  4P9U A;  1O3R A;  1J7K A;  2O8X A;  3KLO A;  2L02 A;  3F8N A;  2ZNY A;  3GUD A;  5BPD A;  4HLY A;  2IVM A;  1XMA A;  3N97 A;  4A0Y A;  1EV7 A;  3IWF A;  2EFO A;  1KU3 A;  2MLK A;  4MHG A;  2RNJ A;  5JR3 A;  5JI6 A;  4I01 A;  4PZJ A;  5IT9 K;  2MA3 A;  2QUF A;  4FX4 A;  3M7G A;  5CVI A;  2GZW A;  5K1Y A;  4AIJ A;  5CVV A;  2CW0 F;  3MEX A;  4YG2 F;  4L5I A;  1FZP B;  4LB5 A;  3QRF F;  3E6C C;  1HW1 A;  2LSO A;  1I5Z A;  4N9H A;  5FD5 A;  5DYM A;  3V7S A;  1TNT A;  2FU4 A;  4MTD A;  4K2E A;  4WWC A;  3GLX A;  4WX9 A;  2COM A;  3BPX A;  4EJO A;  2FMY A;  4RB1 A;  3L2C A;  1ON2 A;  4Z2Y A;  3G3Z A;  5L3E A;  3LQR A;  4HBL A;  2E7X A;  4IRG A;  2A68 F;  4RS8 A;  3HRS A;  3GFM A;  4I2O A;  2XGX A;  5JHU A;  3RDI A;  2FXA A;  4UVC A;  3BRO A;  4HQM A;  2Z3Y A;  1B59 A;  3MAJ A;  1QBJ A;  2X0L A;  5EEH A;  4MGR A;  1U3E M;  3LA2 A;  2W85 A;  5A2Q Z;  4EVI A;  3R6S A;  3RYP A;  4YII A;  4GXO A;  1R1V A;  4A0Z A;  3KP3 A;  2FA5 A;  2QBY B;  3N4M A;  2H6C A;  2OU2 A;  2CYY A;  5HLH A;  4I02 A;  4B09 A;  1W5T A;  3DF8 A;  3DPL C;  3QOP A;  3I59 B;  4OIR F;  2EJR A;  3D5L A;  3FZV A;  5ICC A;  2L3D A;  3BY6 A;  2Z33 A;  4CYD A;  4EM1 A;  2X4H A;  3NEU A;  2LNB A;  2Y75 A;  2RC4 A;  1LEB A;  4XSZ F;  5D4S A;  2P4W A;  4I0A A;  2W24 A;  3J80 Z;  3T8T A;  3H3U A;  4IXA A;  3I71 A;  3SXY A;  1H9T A;  1O3Q A;  4I0B A;  4L9N A;  1U5T A;  1BM9 A;  3HHH A;  3ECO A;  2A3S A;  4XBF A;  5H6Q A;  4LJZ F;  4E70 A;  4R8H A;  4EJV A;  3RKW A;  2VE9 A;  4UVB A;  4M9X A;  2BGC A;  1USS A;  4A2U A;  2V79 A;  5E20 A;  4UV8 A;  1Z7U A;  3ZQ7 A;  5DD4 A;  1P6R A;  1Z05 A;  4LB6 B;  3HTU A;  1KGS A;  1O7F A;  2NS0 A;  3VOE A;  1OMI A;  2Y0M A;  4A5N A;  3E5U A;  3ZN0 A;  2DQR A;  3GO5 A;  1LDJ A;  5IT9 Z;  3V8J A;  2HS5 A;  3F22 A;  1G4D A;  3WU0 A;  2STW A;  3PQJ A;  3T8R A;  5E8I A;  3C1D A;  2H27 A;  5BOX A;  3ML6 A;  1P92 A;  3Q9V A;  3W6J B;  3RKX A;  1FP2 A;  3HRT A;  4WK8 F;  4RGS A;  3M8E A;  1TLH B;  5BPI A;  3HOT A;  3G73 A;  1AOY A;  1U78 A;  4RB2 C;  1XDU A;  5AIP A;  3F21 A;  4FX0 A;  4EJW A;  2G9W A;  3DV8 A;  4MEY F;  2RVC A;  2PG4 A;  2F5E A;  4A0X A;  1CGP A;  2VON A;  2ZNZ A;  3RJP A;  2VE8 A;  3ZMU A;  4EGZ A;  1O7L A;  2EA2 A;  3S2W A;  2VOO A;  2YPR A;  3FM5 A;  3F8B A;  3B02 A;  3MCZ A;  2MLG A;  1DUX C;  2C6Y A;  4ZYE A;  5DCM A;  1LNW A;  1FX7 A;  3HRU A;  3IC7 A;  2RDP A;  1J5Y A;  1QNT A;  2RGV A;  4AD9 A;  2PFB A;  1KQ8 A;  1FSH A;  3M9A A;  4HOB A;  1YYV A;  1UCR A;  4AWX B;  2DPD A;  5CJ9 A;  2Q8K A;  2DLL A;  4HA8 A;  3RTR A;  1BJA A;  2DW4 A;  2CFX A;  1T98 A;  2Y48 A;  3WTV C;  3HSF A;  2FBK A;  1D8J A;  3O6B B;  4QWQ A;  4XLP F;  4LG0 A;  5DD8 A;  3V4G A;  3MQ0 A;  1O3T A;  1Q1H A;  4O3M A;  2LDU A;  2FBI A;  3TDZ C;  4O6J A;  3W6K B;  3F8C A;  2F5D A;  2DU9 A;  4G7Z F;  5F1R A;  3TGN A;  3RYR A;  3GF2 A;  4F7Z A;  2W25 A;  3GX4 X;  3TOA A;  2O6G E;  3LST A;  2QZ8 A;  5ICE A;  3LA7 A;  1P2F A;  3GVA A;  3L09 A;  1FLI A;  3JSO A;  4LMY A;  3I54 A;  4LLL A;  1YW9 A;  3FMS A;  5D5V B;  3OV8 A;  2D1H A;  1LDD A;  2NNN A;  3WTY C;  3IKT A;  3RI4 A;  3FXR A;  4HX8 A;  2BYV E;  1S7O A;  1F5T A;  4BHP A;  3BDD A;  1ZG1 A;  3DFG A;  3MZY A;  2QLZ A;  4FT8 A;  5ILS A;  3R61 A;  4BH9 A;  4WXH A;  1S3J A;  4IHS A;  3V7C A;  5CLS A;  5ICF A;  2E7W A;  3ABT A;  3HUG A;  1R00 A;  5CVR A;  1YTY A;  1KYZ A;  3BP8 A;  3REO A;  3QPT A;  4OMY A;  3M1E A;  1T2K A;  3ZP5 A;  4QLC U;  4BHB A;  1WI9 A;  2K27 A;  4HF1 A;  4G9Y A;  3LA3 A;  3EYI A;  1EH8 A;  2IJL A;  4HW0 A;  4ZYD A;  1A04 A;  2G7U A;  1B1B A;  4S05 A;  3VFZ A;  2IP2 A;  2XIG A;  3C18 A;  1S8N A;  5F6F A;  1ULY A;  1LEA A;  2YU3 A;  5DEQ A;  2GWR A;  1FWZ A;  3TO9 A;  1V3F A;  5ED4 A;  5D6F A;  3IRR A;  2HQR A;  2GXG A;  2UWM A;  3KP2 A;  3F6O A;  2HTS A;  4AIK A;  1DPU A;  3ZMS A;  3O3K A;  4OIQ F;  1FY7 A;  3IL2 A;  1RI7 A;  2PBI A;  5HS9 A;  2KRF A;  2JT1 A;  2R7F A;  1XGS A;  1WWX A;  1REP C;  3FXU A;  1X3U A;  5DCM B;  4ZZD A;  1I6X A;  4Q5S F;  2PMH A;  5DUI A;  1UST A;  2EB7 A;  2EK5 A;  1FSE A;  3SZT A;  2PJP A;  1MJB A;  2NRA C;  4EMS A;  5LGU A;  2DK5 A;  4FHT A;  4LLN A;  3O2P E;  2EWN A;  1IZ1 A;  1F9N A;  2HQN A;  3GZ5 A;  2PI0 A;  4KFC A;  2MH2 A;  3TKY A;  1BBY A;  3RIR A;  3F8M A;  2VBW A;  4U7B A;  1TQP A;  1RIO H;  1KU2 A;  2XUB A;  2TDX A;  2GA2 A;  4LG0 B;  2OQG A;  1GXP A;  4CIC A;  1IN8 A;  3T0Y A;  4M73 A;  1IN7 A;  5LRR A;  1YW7 A;  1S6L A;  2VN2 A;  1CF7 B;  4HF0 A;  3ISP A;  1B4A A;  3H92 A;  1OKR A;  4G6Q A;  3IKV A;  2P7C B;  3BZ6 A;  1QO0 D;  4KIB A;  2V1D A;  1HKQ A;  2CGP A;  1XD7 A;  4TV7 A;  5HS7 A;  2K7L A;  2F2E A;  4KIG A;  4L9J A;  1BC7 C;  2KIF A;  4A5M A;  3PQK A;  2MH9 A;  1LB2 A;  3TO7 A;  1QZY A;  4EJU A;  3PFI A;  4YFK F;  2VBX A;  1W7P A;  5D4R A;  2VC1 A;  1HBX G;  1W4M A;  1Z1D A;  5FO5 A;  2K4J A;  1V4R A;  4IPA A;  1QPM A;  1R23 A;  2VT2 A;  2P6T A;  3TQN A;  2LF7 A;  2DI3 A;  2JPB A;  1XDS A;  2OAZ A;  2FEZ A;  4XSX F;  1K78 A;  2XKP A;  4YIF A;  3EDP A;  3JTG A;  4S04 A;  4IRH A;  2ZBK A;  1GVJ A;  1IRG A;  2XAH A;  1T38 A;  3R4K A;  4I7H A;  2A61 A;  3J81 Z;  4HF2 A;  3LQQ A;  4HYE A;  2FRH A;  3FHZ A;  1ZRD A;  1D5V A;  2FNP A;  1SD5 A;  1WKM A;  1R1T A;  3GFL A;  1R7J A;  3JW4 A;  5L3G A;  2D45 A;  1L3L A;  4EJT A;  2KIU A;  1IRF A;  3E97 A;  1IW7 F;  4A12 A;  2CG4 A;  1P4A A;  4JBA A;  3NRV A;  1R5H A;  4U7D A;  1L0O C;  5AIQ A;  2ELH A;  2CWE A;  3WG9 A;  4JQF A;  4EM2 A;  4YFX F;  1OYI A;  3L9F A;  2HGC A;  4NB5 A;  3ELK A;  4DNC A;  2J5O A;  3QP6 A;  3WOD F;  2VXZ A;  4LD5 A;  1TW2 A;  3JAM K;  1ZYR F;  2EFQ A;  2P8T A;  1I1S A;  5E8G A;  1D8K A;  5FB2 A;  3WTX C;  2DO7 A;  1C0W A;  3FMQ A;  4KDP A;  4EQQ A;  4OU0 A;  3SZP A;  2NAZ A;  1OR7 A;  4MQ9 F;  2DFI A;  3QPH A;  1LVA A;  1EH6 A;  3HSR A;  4M74 A;  3BOQ A;  3F8F A;  5L3B A;  4ETS A;  3V7R A;  4BAY A;  2CSO A;  3KP7 A;  2VOD A;  1G3Y A;  4RAZ A;  2KIM A;  1LQ1 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...