2OTJI

13-deoxytedanolide bound to the large subunit of haloarcula marismortui
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
70
structure length
70
Chain Sequence
GVPPTAELIKDEAGFETGSGEPQEDFVADLSVDQVKQIAEQKHPDLLSYDLTNAAKEVVGTCTSLGVTIE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Ribosome
molecule keywords 23S ribosomal RNA
publication title The Structures of Antibiotics Bound to the E Site Region of the 50 S Ribosomal Subunit of Haloarcula marismortui: 13-Deoxytedanolide and Girodazole.
pubmed doi rcsb
total genus 13
structure length 70
sequence length 70
ec nomenclature
pdb deposition date 2007-02-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
I PF00298 Ribosomal_L11 Ribosomal protein L11, RNA binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.250 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Ribosomal protein L11, C-terminal domain 2otjI00
3CCJI 2QA4I 3CMEI 4UY8I 2FOWA 1VQ9I 2QEXI 3CC2I 3CCQI 3I56I 2NXNB 3I55I 1Y39A 2E36A 2JQ7A 1VQPI 4V19K 3CCMI 3CC4I 2OTJI 3PIOF 2H8WA 5GAEJ 3CCRI 1S72I 3CCEI 3CF5F 1YI2I 3PIPF 3G71I 1YJNI 1YJWI 1QA6A 3CD6I 1YIJI 3CC7I 2E35A 3CMAI 1VQOI 3DLLF 5DM7F 4IO9F 5DM6F 5GAGJ 1VQMI 5GADJ 3G4SI 3CCLI 1VQLI 3CCSI 3CJTB 2ZJQF 2ZJRF 5GAHJ 1YHQI 3CCUI 2K3FA 1YITI 1FOWA 1VQ7I 1VQKI 2ZJPF 4IOCF 5JVGF 1VQNI 1MMSA 1FOYA 3G6EI 2E34A 1FOXA 1YJ9I 1VQ5I 3J7YJ 3J7ZI 1VQ8I 1ACIA 2OTLI 1HC8A 3CCVI 1VQ4I 1VQ6I 4IOAF
chains in the Genus database with same CATH superfamily
1W36D 2DMNA 4UY8I 4C3HJ 2VJ5A 3MQ0A 5FO5A 3E6MA 3HG9A 1IUYA 3GTJJ 1ETOA 3J7AO 3LQRA 2HQAA 3WGGA 3OYMA 4A6DA 2LNBA 2O0YA 3QP6A 2VE9A 2EJRA 3HPGA 2HVSA 2H09A 1J9IA 1XGOA 4WCGA 1YTYA 1IGNA 4LG0A 4XMYA 4O5VA 1U5TC 3DU5A 2ZFWA 2HDDA 4Z6YA 3ABKH 3NAUA 1TW2A 4F52A 4MQ9F 2OU2A 3FISA 3EUKL 3BR1A 4HYEA 2XSJC 1ZELA 2EINH 1FBSA 1P7JA 3IAS2 2K9QA 2P8TA 2JN6A 3F23A 2K9MA 2JSPA 3O6BB 3SDGA 2K9LA 3D5SC 4BACA 4JX6A 2PMZN 2X6OA 2X4HA 3WG7H 2FD5A 2E71A 3LL7A 2A61A 4C3IJ 2RV8A 1JI8A 1T08B 1FIPA 4F7ZA 3K1PA 1FP1D 2VT3A 1KGSA 1XGMA 2F6CA 4M6VA 1SVLA 4CCLA 2HDWA 1VQMI 5IP9J 1BI1A 2RDPA 2DYRH 2RKHA 2A69F 3TOAA 4G9YA 3IRRA 1DQUA 1HXDA 2LD5A 3DF8A 1GXPA 3T8TA 3FK6A 2VC1A 1W36C 5J8FA 4B47A 3COAC 2Z9OA 4Z2YA 1OCZH 3EUHA 1RIOH 3DBRB 1EJ9A 5M5WJ 1DPUA 3FF5A 3HGYA 3VFZA 2Z3YA 1OCTC 3BP8A 3HOVJ 1WJEA 3IH3A 2VOPA 1P92A 1D0YA 1Q1VA 2JJ7A 2M3AA 5J1UA 2ZJPF 1T98A 1LQ1A 4RDUA 1SFEA 1I3AA 2VQGA 1QZEA 1V55H 4RS8A 1K6YA 2LYCA 1KZHA 2F5DA 2Q8KA 4X0GA 3B73A 3WTUC 3OYKA 3G73A 4EV0A 4Q5SF 1FOXA 4AIKA 2M4KA 4MEXF 2LFBA 2VOOA 1MH3A 3G1MA 4CYDA 3RKWA 3TDUC 5CJ9A 4XRMA 5GPAA 1OFCX 3BPXA 1I3QJ 3H3UA 2NNYA 3KFWX 4G7ZF 2ZKZA 1AU7A 4XQFA 4UUVA 1JTXA 1D8KA 1UCRA 2EFPA 1ZKGA 4PCQA 5KK1A 3T1BA 1XD7A 4DYRA 5J4YA 3DV8A 3QAHA 3I59A 2LOOA 2GXGA 5LLQA 4AYBN 5JLWA 2LY2A 3BZ6A 2X1EA 2RVCA 2VE8A 3U1KA 2ZXIA 3F8MA 1S3JA 2XUBA 4HLXA 3CCQI 4IKFA 3MKLA 4AYBA 4RGSA 1Y1WJ 2AXLA 3JRCA 1FBUA 1QGPA 1CGPA 1QVTA 3M3YJ 3AFHA 3GZNB 4XKBA 5C3EJ 2DFIA 2P81A 2I8DA 2BW3A 3BJAA 1HLVA 1KONA 3CCRI 4QWQA 4GRIA 1MNEA 5E3OA 3DPTA 1QQIA 5H6QA 2R3SA 4M3GA 4HV6A 1Y1VJ 4D7MA 3ECOA 2Z5UA 1Z3YA 3HB9A 2XPUA 4M3DA 3WODF 2KHMA 2VL8A 5A2QK 2VASA 2CUZA 4EVIA 3FXLA 2X85A 2I5UA 4NBQA 3MVPA 3H5NA 3GO5A 2OZUA 2K4BA 2RQPA 3ZQQA 1HW1A 5D4SA 5EEGA 5HNHA 4GYGA 4NC6A 2W84A 3S93A 5JHUA 4RB1A 2Q2EB 4CZZA 1V54H 5AIPA 2R7ZJ 2XDVA 1R5HA 5F6FA 2JT1A 2QCOA 3OL3A 1RUOA 4U87A 3RPQA 2ESNA 3TEDA 2ZJQF 1W5SA 4OMZA 4CO8A 4ESBA 2P7CB 2H27A 3WTVC 4ZDOA 2DPUA 2UXNA 1WKMA 2X6YA 3FXJA 1O57A 3OY9A 2V7FA 4W97A 3O3KA 4EJTA 3V8JA 2M2EA 3DU6A 1ENHA 2HYJA 4A0YA 5FKKA 3C3WA 4IRHA 3U1DA 2XROA 3OOPA 4WXCA 2K9SA 4XSZF 3V8LA 5F1RA 2XASA 4CA0A 3G6EI 2NOGA 1E3HA 2X6WA 1MIJA 1PJRA 2XAUA 3CESA 4YFNF 4Y52J 4MTEA 4Y33A 1ZR4A 4RM3A 3K7AJ 1U8BA 4HNTA 2ADUA 1ETKA 3TL4X 1SFOJ 1R36A 1R6RA 1W5CC 5HDKA 1TT5B 2DMTA 4AM3A 1OISA 3E0JB 4IOAF 3BTCA 3ONQA 5DCMB 2VJIA 4JBAA 1GXQA 2QF7A 3I3LA 4D7NA 4V2FA 1NG7A 3RZDJ 5IP7J 1BOBA 1FMWA 4L9NA 1XB4A 2DODA 3BR2A 5LHIA 2X1DA 3QP5A 4Y17A 1IUFA 4HLYA 2VN2A 3TKYA 3HZJA 1Y39A 4IVNA 4DIQA 4HQMA 2PJPA 2R7DA 2Y2ZA 1QPIA 5FD6A 2BVMA 2BBYA 3QOPA 4KICA 4HDUA 2DOAA 3R0JA 2NVQJ 2ZXWH 1R22A 4OIPF 3LA3A 4WK8F 2IW5A 2QWWA 3F8FA 4J19A 2MBFA 3E5QA 3FXUA 2BZTA 5ILUA 3QYEA 2P4WA 1WH5A 4NQWB 2HKXA 1ZH5A 3VB2A 1W7PD 2QENA 3BPVA 2MA3A 1P4XA 2JWTA 2IRFG 1QZYA 4BH9A 3REOA 2A68F 2HOSA 2DFFA 4XLEA 1TC3C 5C4JJ 5CPRB 1L3LA 2JTVA 3VYSB 2Z1DA 1LDJA 4OU0A 4HF2A 5FLXK 3ABLH 2M1BA 2DFEA 1WGXA 4S05A 2LKPA 3SZPA 2X51A 3WTZA 3L2WA 4FX0A 3QQAA 4Q48A 3JW4A 3K6GA 2WAQN 4OMYA 4M3EA 4M3FA 3PFIA 3C2GA 1T0FC 4Y4RA 2QBYB 3S14J 1XSVA 4BXXJ 2CQKA 1SVMA 3KP6A 2FBHA 2QQ8A 4JK1X 4E7KA 2DOFA 2FOKA 2WAQA 4Y7NJ 3DBLB 5F1JA 4BS9A 1NTCA 2EZKA 2H6BA 3ABUA 1P6RA 2EWNA 4L0YB 4EM2A 2XGXA 5ILVA 5JI6A 1YITI 1FOWA 3ZGKA 3BOQA 4LK0F 1MMAA 4A0XA 2O3FA 1VQKI 1MD0A 1YE9A 4ZDPA 4ZZDA 3VWBA 2OUMA 5FGMA 3CLQA 2QQAA 4JX5A 2LY1A 5LEJA 1XGSA 4FE4A 4XKCA 2E1OA 1MNDA 1SMTA 3FBIB 2KDOA 3UR3C 4F93B 5FRNA 1DU6A 1EH6A 1H89C 1IRFA 2MSYA 3CF2A 3H3ZA 4FQGA 4A69C 3HKZA 3CDLA 2IAIA 5K5QA 2JVGA 1X1PA 1BR2A 1IDZA 3MCZA 4XKWA 4BUPA 2F5EA 3OOUA 5LFAA 5BQTA 3DP7A 3KPHA 4U7BA 4UUSB 3H9GA 4MQVA 2FQ3A 4BQAA 5E3NA 2HU9A 3EYYA 2F48A 2FF4A 3GW2A 4JOMA 5DEQA 3GTQJ 2B63J 1A35A 1BW6A 1W5TA 4HPQA 3HM5A 3GF2A 3QODA 1U9NA 3R61A 3LA7A 3OR2C 4YRVA 1TLHB 1X2MA 2CW0F 3ABMH 2IA0A 1G3YA 4G12A 1KA8A 1SD5A 4UUTA 3IH4A 2IA2A 2L5QA 2XHKA 2OJED 3QWLA 5F0HA 3CCEI 1UHSA 4N4OB 2FQ4A 3BJOA 4QTRA 1A04A 5HS9A 2Y9YA 3DKXA 3FDYA 3ZMUA 1YW8A 1EH8A 3BR6A 5DYMA 4BYYA 4M9XA 2DN0A 1KU2A 2Q2EA 2VKDA 2CQXA 1IC8A 2IP2A 3C2HA 3BCBA 1X3WB 3E5UA 9ANTA 3LAJA 2ACJA 3E6DA 2O8KA 3WGIA 3K4MA 4N9IA 4JX4A 4IO9F 3S1QJ 2E2IJ 4OIRF 4FX4A 1MMDA 3PNYA 2OD5A 2K40A 2GXBA 5BS6A 1S7EA 2LC2A 1ETVA 4I98B 4MHGA 1QNTA 3WE3A 2DFHA 5HS8A 2MH2A 3GBGA 4BQQA 1ZQ3P 1JHFA 2GAUA 4XOPA 2TRTA 4H4KC 1SEUA 2XPVA 3SZTA 1R1UA 5TISC 2H1LA 3LMMA 3PFYA 4ZYAA 2K3FA 2J5PA 2D45A 2OC6A 5JVTA 5H6RA 2B9SA 1SANA 4NDLA 3HOZJ 1GT0C 2DJIA 1R1VA 4UHTA 2JA8J 2IGNA 2EZIA 4GXOA 5DCMA 4I7HA 3P9IA 1MMSA 1YFHA 1ETWA 4A5MA 2L4AA 5GPCA 4FASD 1WJ5A 2HI3A 3KP7A 4HX4A 3KP4A 4ZYEA 3PO2J 2DA6A 4BQNA 4BU2A 2UV1A 1H8AC 3BR3A 4RAZA 2XF6A 1HC8A 4HA8A 4A3GJ 1VQ4I 4EM0B 4MLOA 4DOZA 3HOUJ 2YX7A 4O6JA 3PL8A 1Z91A 4A5NA 2CRGA 2HPMA 3GFLA 4G6QA 1O3RA 1KU9A 4KIGA 1T2KA 2HZDA 3DEEA 2O03A 2DA3A 2XVCA 3I58A 5GTHC 4HRIA 2DI3A 3X2QH 1BW5A 2KJCA 2PG4A 2PX9A 2XGDA 2CQ7A 4IRIA 2CO5A 4NQWA 2G9WA 2V6CA 2QGUA 1FJLA 3KX2A 2FNPA 2E36A 4ABZA 3MFKA 4EM1A 3CJRB 4E7SA 4B48A 2DPDA 3SYTA 5ICCA 2H8WA 1BI3A 1G6NA 2XB5A 2R7UA 3F22A 1TBXA 1H9GA 1ETXA 3J7AY 3CF5F 3IL2A 4KISA 3GMEA 2P0WA 3BZCA 3WTSC 3U2RA 2Z16A 1MJBA 1YX3A 2IJLA 2A5YB 3H0GJ 3CP8A 2QBYA 1E2XA 2AO9A 4GCVA 3VYRB 1HKSA 1LVKA 2DOEA 5IOZA 4HW0A 3BY6A 1TW3A 2OPTA 3HBLA 3QPHA 3OS1A 1U9OA 3TP0A 2CH0A 3G1LA 3D5RC 1WRJA 1BBYA 3QOEA 5LRRA 1DP7P 5GAGJ 3M4OJ 3LSTA 5D6EA 5FLMJ 2KJBA 2F4MB 5EDNA 2L9SA 2WB1A 3BTIA 1YW9A 2MGQA 3G4SI 3HOWJ 3Q9VA 4N9HA 1IJWC 3G2BA 2EZHA 2KDZA 5BPIA 2STTA 1MJ9A 2KIFA 4DYQA 2R5ZB 2V9VA 2E7WA 2CUEA 1OCPA 2Z2SB 4LG3A 1UMQA 3TBIA 5E3MA 2EFWA 4CCOA 1USTA 2XAGA 1ZGAA 3S2HJ 2UUZA 4EMSA 5H20A 3IV5A 1WSUA 5J1YA 5E3LA 2CMPA 2R7VA 1MMGA 2QM3A 4RLFA 1UHWA 1U2WA 3DWLE 2ZJ2A 4XLPF 1EV7A 5ICGA 4XLFA 2ICWG 3SQNA 4YEJA 5IYBJ 1MBGA 2ZB9A 4HSRA 2MFZA 1LDKB 1N25A 1NH3A 2N8GA 2E60A 1FC3A 1XMAA 4MTDA 2HWVA 3I4PA 2O8XA 2WADA 2VLAA 2HFHA 4L5EA 1LFPA 2DT7B 3CCYA 2PMHA 2F5CA 3IKTA 2JRTA 4XSXF 1T6SA 1FWZA 1Z9CA 2F5FA 3CMYA 2QA4I 2KISA 2FOWA 1U78A 4BL0B 1HOMA 3S1MJ 2CWEA 3FWEA 1LPQA 2GA1A 4JYKA 1LVAA 1X1AA 2G7HA 1H88C 2KLOA 2VUMJ 3KEOA 4MFEA 1YYVA 2ZC2A 4CDGA 3K2ZA 2W57A 4C2MJ 1BOAA 1N78A 4MFDA 4ZYDA 1DGWY 3A0HC 4ZTJA 3CCMI 3DCFA 2FNAA 1U6GA 1X4OA 4LLGF 4C9YA 4KT6A 4J01A 5AIQA 5EEHA 1LEAA 4KMUX 3PNTA 1S6LA 4PJJA 2MYSA 1JXSA 1ZLJA 1XC5A 3IAM2 1IO2A 2DMPA 3V42A 4A3LJ 1OMIA 3CP2A 1IDYA 1K83J 2ETHA 2VBWA 3Q0WA 4M6XA 2Z33A 1D1CA 1YW7A 3JRFA 1X1DA 1POGA 5EYRA 1F36A 3T0YA 5JR3A 4JQFA 3ZMVA 3EPZA 1J09A 2E5ZA 3RI4A 3L9FA 3W2WA 3FIWA 1A6QA 3VEPA 4CUGA 4F55A 3F72A 2K9NA 1SFUA 4PSWA 3OR1C 3NQOA 2O6GE 5A2QZ 4NUBA 1OYYA 3IH2A 5HVQC 1T0FA 5E20A 1UELB 2EIKH 4TV7A 2E1MB 1B4AA 3RKQA 1G3SA 3JSPA 1JE8A 2BV6A 3B02A 4B3XA 2VPLA 3LNQA 4XIDA 2MC3A 1YHQI 4HNUA 4NB5A 1OR7C 3O8HA 1RETA 3JR9A 1I27A 3BROA 4A3JJ 4BEHB 2ID3A 4BDYA 3P9CA 4KITB 2ZXHA 5BPDA 1R5ID 2STWA 5J47A 2XAQA 3QU3A 2IVMA 5JVGF 4E70A 4U0VA 1PP7U 4KFCA 4ANJA 3OYNA 1JUSA 4XM3A 2Y69H 2OBPA 4PGGA 3C7JA 2L9VA 5EJCA 5HDGA 3FM5A 1RUNA 2QKLB 4HOBA 5KHDA 1QVUA 2LLKA 3ECHA 4BE0A 5K7ZA 4EGZA 1IG7A 2B0LA 4PFOA 2NAZA 1MGTA 3GZ5A 3F6OA 3CLOA 3PNVA 3GTKJ 4ZYGA 1MH4A 1FPQA 3OWTA 3K69A 5JLXA 1TQPA 3VYUB 1FSHA 3AAFA 3ML6A 3ZOBA 3WGHA 1FEXA 1STZA 3LSHA 4FETA 3L2UA 1ZK8A 4PUSA 3ERED 1GVJA 1B72B 3KETA 1PUFA 2ZCWA 3C18A 3EUAA 4XICA 3I55I 3GTGJ 4LOCA 1R00A 1VQPI 2R7SA 2MG4A 2DQLA 5C4XJ 3CO6C 2OTJI 3RKYA 4FE7A 2LK2A 3HOXJ 3PJRA 2F2EA 1ZHFA 2DA7A 4YIRX 3PQJA 2DT5A 3TDZC 1FTTA 3FXKA 4UNOA 3LSGA 2E19A 3F8BA 5CVJA 4EGYA 2PMUA 1TL8A 2UZKA 3CD6I 3S32A 3H3VK 2D1HA 3L1PA 1IW7F 4IPAA 1XMKA 2R5ZA 1JGGA 2IS6A 3DLLF 1FOKA 3OYGA 2W25A 2CGPA 4IRGA 3RYPA 2ID6A 2RNGA 3OYJA 4R8HA 5CLSA 2VQCA 4F91B 2KPMA 3ZMTA 3H0DA 2P6SA 3UNGC 5CVVA 2OCEA 5KVRA 5FLVA 2IGOA 3ZN1A 4X1EA 2K86A 2HEOA 3TO9A 5GADJ 5DUKA 1MNMC 3S16J 5LBQA 3LOCA 1VQLI 1IN5A 3HSEA 4ESFA 1WCMJ 3OYBA 2KIUA 2Z99A 5FLXZ 2WV1A 3OL4A 1ZGJA 1OCRH 3VDXA 3LFUA 3S8PA 2L02A 2OAZA 3RSNA 1MBJA 3W2AA 1XGNA 3FMRA 3N97A 1X4PA 2R5YB 3AG4H 2YX4A 3D5LA 3FZVA 3J80K 4C30A 5HLTA 4P55A 2MD0A 4NNJA 4IOCF 3S2WA 3KP5A 4ASNA 3HHGA 5HS7A 1VF9A 4LD5A 4P96A 5H2FC 3N4MA 2M4GA 1ORKA 3G3ZA 4IHWA 3FXQA 2E34A 4RLQA 2HKOA 2HTSA 2M8EA 5E1WA 5DTDA 1W0TA 1IXSB 2EIMH 4DNCA 2IS2A 5ILSA 2RGVA 1CF7A 2PLYA 2JMWA 2OTLI 3IWZA 2QQBA 4HAMA 1MMNA 3F0CA 1AKHB 1LB2A 2NVXJ 3E6BA 3K70C 5M3FJ 1DDNA 1MBEA 2BHYA 2L2OA 2LF8A 4YELA 3KP2A 2RC4A 4IQ4A 4CZCA 3BLYA 1SD4A 2QZ8A 1LJ9A 1WJAA 2L01A 4YG2F 2KRCA 3L09A 2O7OA 2P7VB 2QEXI 3BR5A 2M0MA 4Y3OA 5LGTA 2P5LC 1ON2A 3BDDA 1HSTA 3GLXA 1FP2A 4B4CA 1GLNA 4LIVA 4EATA 1XCBA 2JQ7A 1RKTA 1HA8A 3DQVC 2NVYJ 2DAOA 2YS9A 5CVRA 2GOXB 3OMYA 2WV0A 3K1MA 1QZZA 2VQHA 4PZJA 1FNNA 4LIUA 3IKVA 2FBKA 4L9JA 2VJ4A 4KDPA 2EFQA 2G0EA 4L5JA 3FM3A 4E7HA 2CV0A 5EEAA 1DUXC 3ESWB 2CV2A 4CCNA 2JUCA 4QPOA 3JSOA 1Y8RB 2E7XA 3M9AA 1O7FA 3G1OA 1N77A 4PJ0C 4DZJA 4Q4ZF 3FX3A 1WPKA 1R7JA 4LFUA 3JRHA 5C44J 2CQQA 5L3DA 1QU3A 2NVUB 1REPC 1X2NA 2XRLA 1IN6A 2VBYA 4P5OA 3MKYB 3ROUA 1AOYA 1DGRM 4PJLA 2VB6A 3VSKA 2IT0A 2M87A 4AU7A 4QIWN 1UG2A 3GVAA 3WU1B 3HIFA 3Q5FA 4BEHA 1JUMA 2P5VA 3HRSA 1PYVA 4L9VA 3ULQB 2NVTJ 1JUPA 2PQ8A 2BY2A 4XN0A 3TMOA 3PSFA 3DBHB 3F21A 3CMMA 3HDDA 1W4MA 2X0LA 4CHUA 4N0BA 3HTUA 1BC8C 3SEQA 3WTWC 1Y56A 2JRMA 5E8GA 4WX9A 3DEUA 4QPQA 1FT9A 3M7GA 4L18B 2M8GX 3KEQA 2GZWA 2I10A 4D5FA 4GGGA 1D5VA 2GQQA 2VKHA 1TNSA 2ELJA 1OJLA 2VIXA 5FD5A 1MSEC 3S3MA 4LB5A 1OQYA 2LBFB 1TNTA 3C2BA 3HSFA 2HPIA 3I0TA 3HOTA 2JZYA 4O3MA 2XAHA 3ASOH 1VQ5I 3TGNA 2MLGA 2DA1A 3A03A 3E3VA 4KN7X 2QSGX 1VZ0A 2HXIA 5AONA 4X6AJ 2DDAA 1B72A 2MD5A 1ZG3A 3H9QA 3NWSA 5CYVA 2Q0OA 4BY1J 4G7HF 1YS7A 1ZREA 4B09A 2DBBA 1IRZA 2IXSA 2LVSA 3D0SA 3NEUA 4G7OF 2JA7J 4BHBA 2FRHA 2Y48A 5K7FA 1SAUA 3GFMA 3HKZN 1S7AA 2HOTA 2FJ1A 2FSWA 2CFXA 1A5JA 1SVOA 5D8KB 1WHUA 2PEXA 3L2RA 2FE3A 3R60A 2ZMEC 3ZN0A 3KP3A 1IRXA 2AHQA 2WBMA 4HNVA 4ZYHA 3FXMA 4IXAA 4BY7J 2W48A 4HF1A 1GVDA 2L7KA 1PUEE 2R7FA 1ITYA 3T8RA 4BJ5C 2HYGD 1YJWI 3KYDB 4DYCA 5IOYA 3V4GA 3Q0VA 3M1EA 3CJNA 3IUOA 1W1WE 1HF0A 3HYIA 4YIIA 1PDNC 2QUFA 2YUSA 4LB6B 5KAFC 5ICEA 3CUOA 3RJPA 5HLGA 3ZQ7A 4KUMA 1HDPA 3IC7A 4B3AA 4PK4A 4CXFA 1R9TJ 5BOXA 1F9NA 3HOYJ 1KQ8A 1Y0UA 1A6IA 2R5YA 3I4NJ 5KCMA 3DXJF 1TT0A 1D1AA 1DU0A 2K85A 1BJZA 2VC0A 3KZIC 5LHGA 4XRSA 1D5YA 2LY9A 3KEYA 3ISPA 3OYIA 5IT3A 3LSKA 4U0YA 3M8JA 2NOJB 2JUGA 1OR7A 1WWXA 1TQIA 2ZJRF 3HEFA 2VODA 5FFZA 3WU2C 3A2KA 4HX7A 3TQNA 5EGOA 4ENNA 3PO3J 4ZDLA 1MJAA 1B8IA 1VI0A 4IF4A 3KZZA 1AKHA 1APLC 3A01B 4E7LA 4CCMA 4CCJA 1AA7A 1R4MB 3FHNA 2H1KA 3DPLC 3A0BC 2ZSHB 4FHTA 3ZR8X 3A02A 3GUDA 2NRAC 2ZSIB 1P4WA 4M9ZA 3BG3A 2KFDA 2MLKA 3J7ZI 1XCVA 2QVOA 5GTIC 2V1UA 1JT6A 1YRNB 2AQEA 4N4NB 1O3TA 2H94A 3ZMZA 3QPSA 2DA5A 3M8EA 2CUFA 3CUQC 3IWFA 3I4MJ 3L2CA 2D2WA 3L2QA 1J0RA 3P7NA 4AIJA 1MW7A 3E97A 1HSJA 1QO0D 3K4BA 3OSGA 1MKMA 3Q0UA 1ZRFA 1Z6TA 5CQEA 4ZTFA 1ONVA 4PJNA 5L3CA 1MBFA 3LSPA 1P2FA 5K5RA 2W00A 2FMYA 3EDPA 5CVIA 4P9UA 2ECCA 2HQRA 4HF0A 4RM2A 5DD4A 1Z0XA 1SFKA 2M9HA 3K0LA 2EB7A 5ICFA 2LG4A 2NS7A 3WHCA 1WJBA 1WFXA 2CQNA 1U3EM 6PAXA 2W24A 3DKWA 2ZO4A 4RGXA 2QSHX 5HODA 5LEKA 3HSRA 1OYIA 3CDHA 5GAEJ 4M9SA 3S15J 2F4IA 3AG1H 1FSEA 4EJWA 2OA4A 1WI9A 2IBDA 5LGUA 4I09A 2Y0MA 2NS8A 4ETSA 3GTMJ 1H9TA 1JTYA 3OV8A 4BE1A 1V4RA 2A05A 2ZMEB 3F6VA 2PFBA 4XOTA 2BVLA 2KMUA 4AVZA 3JAMK 2DO7A 1UHMA 3DFGA 1XMXA 2HYFA 5F0CA 2DYSH 3OYFA 1IF1A 1TZLA 2EZLA 2L7ZA 3U21A 2OZ6A 1MSFC 4CICA 2XPWA 2QQ9A 4HV5A 5FROA 2A6HF 5DM7F 3OYLA 3VOEA 4E6KG 1E3OC 4OIOF 1B9MA 4ON0A 3OYHA 3RIRA 1R1TA 1X58A 1BM9A 1FLIA 2QLZA 4F92B 1PUFB 3CCLI 2A6EF 1J75A 1MZBA 2LBFA 2X6XA 2OCCH 2BY1A 2DK5A 1L0OC 2DMQA 3GFJA 4WXDA 2XIGA 3BTJA 3C1DA 1W7PB 4H0EA 3S1RJ 3TOBA 2E1MC 1JKPC 3O2PE 3M8FA 5J3LA 3MMYB 4FISA 4XORA 5B1AH 3AL0C 2DA4A 2KL4A 1ERDA 1D3YA 1K78B 3WTTC 5FFXA 3GFIA 3I54A 3V8KA 2IS1A 4UV9A 1JHHA 3I53A 2WB1N 2XV4S 3QPTA 4CSWA 1A31A 3F3XA 2LTPA 1VQNI 3AG3H 2BY3A 1LKXA 4FTHA 3ZP5A 1KYWA 2EK5A 4BE2A 2CSOA 3DTIA 4B1RA 3MZHA 1RR8C 3MEXA 2LMDA 4BAYA 4D0PA 2XSDC 3I64A 3QYBA 4LJZF 2Y31A 2TCTA 3WTYC 4JP0A 3LA2A 2CV1A 5K1YA 1XX5A 1KYZA 2KRHA 2ZNZA 2CJJA 4XKVA 4KJZA 1ZYRF 1QHGA 1XDSA 4HX8A 1K4TA 4IL6C 2JSCA 3BZKA 3KZYA 2KZVA 1DPRA 4KA4A 3HRUA 4DBRA 1TWFJ 2W1OA 3QRFF 1R71A 1R58A 3J81K 1ETQA 3RCOA 3CC2I 1O7LA 1LFUP 5B66C 3CUQB 4DGWB 1B9NA 3DPUA 4UVAA 1Z05A 3MZYA 3HL2A 2EV5A 5K5OA 1K6OA 3FKJA 1X19A 4I01A 3AKZA 5E79C 2EFNA 2Y9ZA 4XLCA 1QHHD 4I02A 1T95A 4HG2A 2E2JJ 1MDMB 1HCRA 3LAPA 3HUGA 2VBXA 3GXOA 3QYFA 5D4RA 4DQ2A 1YJNI 1R5GA 4G8XA 1CF7B 4FT8A 2P6TA 2G7UA 5EG0B 3PSIA 3R4KA 4FCYA 4XL9A 4R1HA 5F0FA 3CC7I 5GP9A 1G8XA 3OS0A 2BXZA 4KNYA 2XKOA 2R7QA 1WJCA 1Z6RA 2WA0A 4YFKF 2CW8A 3SHFA 5TJJA 3W6JB 4KIFA 3K4LA 5FKOA 4AD9A 1Z67A 5DUIA 1J59A 1SMYF 4IEJA 3D1NI 4G6TB 1O3QA 3RQIA 3W2VA 4BBSJ 2BYVE 4U7DA 4LGWA 3SEZA 3BG9A 2E5NA 2XB0X 2EQRA 3TP3A 1GV5A 5L3EA 2BHZA 3A01A 3VPRA 4OOIA 2L4MA 3KE2A 4EQQA 2FUG2 5JHFA 1LDDA 1EKEA 5B5EC 1NK2P 2VI6A 3A1YA 3CTAA 1G3WA 1YRNA 2R0QC 3ELKA 3RDIA 4ENJA 2ECBA 2EA4A 4P9FA 2XAFA 3OS2A 4E7ZA 4AIDA 3U9GA 3K9TA 1JJ6C 2ME0A 3ASNH 4K2EA 2KKOA 3BG5A 2E2HJ 2QKMB 3J80Z 3AL0B 1EH7A 4F3QA 4ZC3A 1XSDA 1F43A 4A3CJ 1JT0A 1XG1A 4XRFA 2ISYA 1ZR2A 2DW4A 1G59A 5DCFA 2M7AA 1FIAA 2VKEA 5DV5A 2R7RA 4A6EA 4C3JJ 2HDCA 4XLNF 2WAEA 5IT9K 1HBXG 3CCJI 3Q3SA 3JREA 1KU7A 2CUJA 3KIOA 4HQEA 4L5IA 2VXDA 3OYCA 5D5XB 1FYLA 4W1UA 3R6SA 2WAFA 2LR8A 2X1CA 5JFRA 1BJAA 4G6DA 1HKQA 4RAYA 3MKWB 3HPHA 1T8IA 4M3BA 4RGRA 3I56I 4IHYA 2ZMEA 4L9TA 1RESA 4RAGA 2ZBKA 4UV8A 3P5JA 3V7RA 3FXOA 2C6YA 2PMZA 1WQ2A 1UZCA 3MD2A 4DW6A 1YIOA 4LK1F 5LHHA 1IXCA 4KIBA 1K7AA 3SFIA 5J6XA 3ABTA 1IAWA 4A12A 3BG6A 4D1QA 1UJ8A 3DTKA 4MO7A 4NC7A 3GYHX 3OYDA 3UKGA 1AWCA 3PIPF 2GXAA 1AHDP 2M0CA 1XN7A 4OWRB 3TO6A 1ZTRA 3FK7A 1YIJI 1Z7UA 4M73A 3RPUA 1J5YA 5FJ8J 1Z21A 3LSMA 2E35A 3JRAA 3CMAI 1JKRC 4OAYA 4YIFA 2V79A 4ENMA 3ERMA 3DTEA 4BHPA 1I1SA 1S29A 2VPRA 3CDIA 1W7PA 4RB3C 3JCUC 2DQRA 3M07A 3TW7A 2LH9A 4MEYF 3S1NJ 2DXIA 1K78A 2XGEA 3FBNB 1U0JA 2ZFUA 3K4KA 3K70D 1RR7A 1CQTA 3P9KA 2LKSA 1OYWA 1Y6IA 3GX4X 3R0AA 1TTYA 3PUBA 3KCCA 3CJTB 4XLHA 3FHZA 5HDNA 4GO1A 4ZJZA 2NYXA 2AQFA 3NARA 4IHVA 4EJVA 1FY7A 2CU7A 1S9HA 2GBYA 1X3ZB 2R7WA 3JRGA 4AIHA 2L7MP 2K27A 3KYCB 5M3MJ 3Q9SA 4RAFA 3SZGA 3OYAA 1ETYA 2R4GA 4J00A 2K7LA 2LP0A 2L9NA 1K61A 4MNUA 1P9QC 3I71A 5BNGA 4LITA 3SJMA 1ZARA 2D1VA 5TRDA 1JKOC 1P4AA 5CKTA 5E17F 2EV0A 3DEWA 2FU4A 2WY7Q 3BQZA 2V4JC 1LEBA 3A4CA 3LQQA 3NRVA 1VFCA 1BA5A 3F8CA 1IN4A 2ELKA 3WTXC 3CUQA 2OQGA 1SFXA 2OQRA 4MIMA 4NC8A 5E18F 4I2OA 4NHJA 1J7KA 4GFBA 1X3UA 2QSFX 4B44A 5L3FA 2LDUA 2JVHA 4L0ZB 3PQKA 2R7XA 1GV2A 3S3OA 4A2UA 2GM4A 2TDXA 1FX7A 2COBA 1MDMA 1IV6A 1BR1A 2A07F 5EGOB 1UB9A 1I6HJ 1U5TB 1LNWA 4WF2A 2BY0A 3HOSA 4V2GA 1B8IB 2IGMA 4CCKA 4A3KJ 4RMNA 5EG0A 1RI7A 4XK4A 2K3PA 4IZZA 2ESHA 2VBZA 2FA5A 3ZQGA 4AUXA 1K4SA 3B6AA 5K7HA 2LKXA 1HDDC 3OSFA 1S72I 1Z1DA 3T5XA 2HR3A 1GUUA 2ZNYA 1S8NA 3RQ4A 3IRQA 4A3MJ 2DK8A 5E1XA 1ODDA 3CQZJ 1LFBA 2OF7A 5J40A 1QA6A 2V9KA 5B1BH 4I76A 3K2AA 3WE2A 2EIJH 3MN2A 5LGNA 3BWGA 1HKTA 3V7SA 4HSTA 4IQJA 1D0ZA 3S2DJ 1RNLA 5D5WB 1LE8A 1XSXA 1E17A 4D9JA 2L0KA 5EZHA 2DCEA 4IHSA 4BJTA 1U8RA 3W6VA 2HNHA 3ZMDA 2PN6A 4IHXA 2PJRA 3EYIA 3ZQHA 4A3DJ 3F8NA 3OIPA 1FYMA 2UXXA 3GCMA 5HNFA 1IN8A 3OIOA 2V1NA 2M7BA 3CCSI 2YU9J 1RPWA 2W4SA 2KZGA 2JPCA 2KRFA 2EFOA 2GWRA 2JA2A 5J8CA 4PSXA 5E1ZB 2DU9A 2ME6A 3JRBA 2AS5F 1SD7A 1YG2A 3S3NA 2XC7A 1T39A 1OPCA 2WWYA 4UB8C 3E7LA 2XF5A 2V6EA 1PP8F 2BGCA 3JTHA 3N05A 1B1BA 4BGDA 4E7JA 2V1XA 3ZPLA 3S17J 1I50J 2HOEA 3KYLA 3BT9A 2BE5F 1T38A 1VTNC 2JPBA 3LSIA 5DS9A 2IGKA 2VKVA 3GEZA 4BQOA 2M30A 4RBOA 1SD6A 2GLOA 3PUFA 1HW2A 1F4KA 1ACIA 2W82A 2YU3A 2EILH 3BTLA 2M34A 3CCVI 2J5OA 1UAAA 1D8JA 1RRJA 5E8IA 4QLCU 4Y15A 2KP6A 1OKRA 3K4JA 2ELHA 4C2TA 3AG2H 2GOMA 3QPLA 3RPUD 4LMYA 3CMEI 2V1DA 3IHUA 2DT6A 3K4CA 4ESJA 2AXTC 2F4OB 3TW6A 2EA2A 1UG0A 1V5GA 3BCAA 3HC7A 4XRSG 3ZRGA 3WHBA 2VT2A 1N75A 2EH3A 4A3FJ 2LF7A 4P1WA 3VSLA 5DDGA 3GTOJ 1RZ4A 4UVBA 3LWFA 1IXRC 3BR0A 2Y75A 3CO7C 4A3EJ 1KQ0A 3RYRA 5EZGA 1Y8QB 1YQAA 2NXNB 3EQLF 2ZXJA 2Q1ZB 2F5VA 4A0ZA 3TO7A 2EPFA 2JK3A 3M1CA 4HEA2 2QYOA 3L2VA 2VONA 1BC7C 4DBQA 1Z3XA 2KQRA 3MAJA 4XR6A 3RKXA 5HOOA 1C0WA 1V5EA 3MWMA 1QBJA 3RZOJ 5F04A 3DLAA 1GHCA 1XTAA 2XAJA 3OIQA 5D6FA 1J2XA 5F08A 5D8LB 5DM6F 1XS9A 2HTJA 2V26A 5CQGA 1WZ2A 4HZFA 1TWCJ 3EETA 4II2A 3JAMZ 5HLHA 4XN3A 1XPXA 1XDUA 4LLNA 5LD2C 3WU0A 4ZZLA 2XKPA 5TGTA 3O8GA 2DJNA 1R4NB 2ISZA 4PDKA 4RA2A 3ZXSA 3WG9A 1G4DA 3I5UA 2CYYA 3JRDA 4CH7A 3GTPJ 4E7IA 5HLIA 3CCUI 3SFZA 3JTGA 3EUHC 2MC4A 1FBQA 4BXUA 1BL0A 5L3GA 4BHCA 5FKMA 3ZQLA 3BJ6A 2IEKA 3H5RA 3SXYA 2O9LA 1TP4A 3K4NA 1NG6A 3HUGB 1WJDA 2RNJA 1V3FA 3VYTB 2H6CA 1YS6A 1FTZA 1YJ9I 1ULYA 2BOLA 4IJAA 1ZRCA 1I6XA 1M1EB 3E6CC 1TQMA 3MKZA 1E3PA 5BMZA 4ITVA 2FBIA 1S7OA 4BNCA 2O5RA 1U5TA 4UXNA 1VQ6I 4I6ZA 1H0MA 1SAXA 4CYCB 2UWMA 4KT5C 1ZN2A 5J4VA 3KLOA 4XONA 2KT0A 1ZG5A 1VQ9I 3ZQIA 3LSJA 2VQLA 2DA2A 4ENKA 3ZMSA 4BDZA 2L9RA 3E5XA 3GTLJ 5FB2A 1F1ZA 4OIQF 4I0AA 1K79A 5FRMA 5IYCJ 1ZG1A 3V7CA 1RKWA 1TWAJ 5ERIA 3K10A 1D0XA 2YSRA 1HW5A 1X1BA 4V19K 2H8RA 3FXRA 2A6TA 1USSA 3VODA 3DKYA 3J81Z 1Z7LA 2HQ5A 3PIOF 2JA6J 2HOAA 1IZ1A 1JGSA 1WH7A 4Q47A 2RN7A 1YOVB 4D5CA 1YI2I 2B7EA 1I39A 2RREA 2IPQX 3G71I 3E1SA 1ZAOA 4A3IJ 2K5CA 4WWCA 2O61A 4XBFA 1WI3A 3MZ8A 2DDBA 3FMQA 4LG0B 4KYWA 2IS4A 1R23A 1VQOI 3HRTA 3H35A 4S0HB 2HXOA 5B3SH 1UFMA 4Y13A 2E1CA 1B59A 1P7IA 2XGCA 1F5TA 2LRDA 1Y0NA 1KU3A 5IYDJ 4YFXF 2KIQA 3I9V2 3HTSB 2NNNA 1G3TA 2A5WA 3W6KB 4LLLA 3B6CA 4OINF 2DLLA 1EA3A 1OCOH 1VNDA 2Y30A 4RB0A 1BIBA 3H5AA 4RB2C 1BI0A 1PVEA 1OLTA 2L3DA 2MABA 1ZGWA 2K02A 2CFOA 4BJ6C 4II3A 5GAHJ 2A3SA 4BXFA 3HRMA 1HQCA 4HBLA 4IHTA 2DTZA 2K4JA 1BR4A 3H1CA 1V5FA 4PGHA 4UVCA 4IX7A 3HGGA 4R79A 1LUJB 4C2UA 1VQ7I 2HVRA 1TWHJ 1BIAA 2X9DA 1G2HA 2FXAA 1DP3A 1FOYA 1KQ9A 5DD8A 3GZ6A 4DZPA 5IP6A 4EJOA 1VQ8I 4QSHA 3JRIA 2HZTA 2OV7A 2XRNA 4M74A 2L54A 4RGUA 1S5LC 2X48A 5IPAA 2VJJA 4HDVA 3LSRA 1YO5C 3BG7A 1NK3P 4M72A 4GDFA 1YLFA 3QU6A 2HQNA 2LSOA 1I1GA 1NHAA 1Q1HA 2EV6A 2M45A 3RTRA 1IRGA 1QRYA 3H36A 4GYIA 5FKLA 3W3CA 3SDBA 4EEFG 2DTRA 1BI2A 2HGCA 2D5VA 3CZ6A 5IT9Z 3PM1A 3FKIJ 2Y0SN 3ZQCA 5KAIC 4OAZA 2GIVA 5LRSA 2HVQA 5CVUA 2R92J 3CC4I 2Y0SA 4CGZA 3LFKA 1OCCH 4A3BJ 5L3BA 2VXZA 3I59B 5EF6A 4EJUA 2E1NA 3H9JA 1MBHA 4KMFA 1FYKA 5F27A 4A93J 3HXLA 2IA1A 3KLNA 4I99C 2CS3A 2CW7A 2HS5A 4PFPA 3K1NA 4E4HA 2WTEA 3F9KA 1FZPB 4DJAA 2BEOA 3BC8A 3IP4B 4AVPA 2R93J 4M6YA 1ON1A 4AC0A 1ZLKA 2BW3B 2GIZA 4XLAA 1O3SA 2COMA 5KNLA 1A36A 2MH9A 1T33A 1D1BA 2NS0A 1QPMA 2YPRA 2FX0A 1GDTA 3L7WA 1R49A 4PJMA 2FEZA 3ZCOA 4S04A 1RC9A 1MBKA 1Z77A 4MGRA 4KN4X 2W7NA 1E0EA 4UUSA 3H92A 2BXYA 4G94A 1W0UA 3GWZA 4XNFA 1ZRDA 2RQQA 2P5KA 1JKQC 4U0WA 2PI0A 1X1CA 2CG4A 2LREA 5IY5H 2M5WA 1SC7A 2L7FP 1FMVA 3GLLA 5D5VB 3ZQFA 2PBIA 5D5UB 2R7TA 1IN7A 2MW8A 3FMSA 2DMUA 4BBRJ 1WJFA 2EBIA 1YX5A 1BN5A 4WXHA 4CYCA 4I0BA 4BKXA 2XF7A 4B8XA 5J1RA 4M71A 1I5ZA 1O4XA 1IV8A 2GA2A 5FKNA 3HHHA 2V9PA 3L00A 4AWXB 3J7YJ 5M5XJ 2FMLA 5F64A 1T56A 2WC2A 4ZH4F 1LE8B 5ED4A 1EF4A 1TWGJ 3NWTA 1B6AA 4B43A 3OYEA 1JJ8C 2W85A 2RAEA 2R7OA 2KIMA 2WY8Q 3CJQB 1WVRA 4UB6C 2YR2A 3HJEA 4U88A 2JA5J 5M5YJ 3BQYA 2PJRB
chains in the Genus database with same CATH topology
3CCJI 2QA4I 3CMEI 4UY8I 2FOWA 1VQ9I 2QEXI 3CC2I 3CCQI 3I56I 2NXNB 3I55I 1Y39A 2E36A 2JQ7A 1VQPI 4V19K 3CCMI 3CC4I 2OTJI 3PIOF 2H8WA 5GAEJ 3CCRI 1S72I 3CCEI 3CF5F 1YI2I 3PIPF 3G71I 1YJNI 1YJWI 1QA6A 3CD6I 1YIJI 3CC7I 2E35A 3CMAI 1VQOI 3DLLF 5DM7F 4IO9F 5DM6F 5GAGJ 1VQMI 5GADJ 3G4SI 3CCLI 1VQLI 3CCSI 3CJTB 2ZJQF 2ZJRF 5GAHJ 1YHQI 3CCUI 2K3FA 1YITI 1FOWA 1VQ7I 1VQKI 2ZJPF 4IOCF 5JVGF 1VQNI 1MMSA 1FOYA 3G6EI 2E34A 1FOXA 1YJ9I 1VQ5I 3J7YJ 3J7ZI 1VQ8I 1ACIA 2OTLI 1HC8A 3CCVI 1VQ4I 1VQ6I 4IOAF
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3CCJ I;  2QA4 I;  3CME I;  4UY8 I;  2FOW A;  1VQ9 I;  2QEX I;  3CC2 I;  3CCQ I;  3I56 I;  2NXN B;  3I55 I;  1Y39 A;  2E36 A;  2JQ7 A;  1VQP I;  4V19 K;  3CCM I;  3CC4 I;  2OTJ I;  3PIO F;  2H8W A;  5GAE J;  3CCR I;  1S72 I;  3CCE I;  3CF5 F;  1YI2 I;  3PIP F;  3G71 I;  1YJN I;  1YJW I;  1QA6 A;  3CD6 I;  1YIJ I;  3CC7 I;  2E35 A;  3CMA I;  1VQO I;  3DLL F;  5DM7 F;  4IO9 F;  5DM6 F;  5GAG J;  1VQM I;  5GAD J;  3G4S I;  3CCL I;  1VQL I;  3CCS I;  3CJT B;  2ZJQ F;  2ZJR F;  5GAH J;  1YHQ I;  3CCU I;  2K3F A;  1YIT I;  1FOW A;  1VQ7 I;  1VQK I;  2ZJP F;  4IOC F;  5JVG F;  1VQN I;  1MMS A;  1FOY A;  3G6E I;  2E34 A;  1FOX A;  1YJ9 I;  1VQ5 I;  3J7Y J;  3J7Z I;  1VQ8 I;  1ACI A;  2OTL I;  1HC8 A;  3CCV I;  1VQ4 I;  1VQ6 I;  4IOA F; 
#chains in the Genus database with same CATH topology
 1W36 D;  2DMN A;  4UY8 I;  4C3H J;  2VJ5 A;  3MQ0 A;  5FO5 A;  3E6M A;  3HG9 A;  1IUY A;  3GTJ J;  1ETO A;  3J7A O;  3LQR A;  2HQA A;  3WGG A;  3OYM A;  4A6D A;  2LNB A;  2O0Y A;  3QP6 A;  2VE9 A;  2EJR A;  3HPG A;  2HVS A;  2H09 A;  1J9I A;  1XGO A;  4WCG A;  1YTY A;  1IGN A;  4LG0 A;  4XMY A;  4O5V A;  1U5T C;  3DU5 A;  2ZFW A;  2HDD A;  4Z6Y A;  3ABK H;  3NAU A;  1TW2 A;  4F52 A;  4MQ9 F;  2OU2 A;  3FIS A;  3EUK L;  3BR1 A;  4HYE A;  2XSJ C;  1ZEL A;  2EIN H;  1FBS A;  1P7J A;  3IAS 2;  2K9Q A;  2P8T A;  2JN6 A;  3F23 A;  2K9M A;  2JSP A;  3O6B B;  3SDG A;  2K9L A;  3D5S C;  4BAC A;  4JX6 A;  2PMZ N;  2X6O A;  2X4H A;  3WG7 H;  2FD5 A;  2E71 A;  3LL7 A;  2A61 A;  4C3I J;  2RV8 A;  1JI8 A;  1T08 B;  1FIP A;  4F7Z A;  3K1P A;  1FP1 D;  2VT3 A;  1KGS A;  1XGM A;  2F6C A;  4M6V A;  1SVL A;  4CCL A;  2HDW A;  1VQM I;  5IP9 J;  1BI1 A;  2RDP A;  2DYR H;  2RKH A;  2A69 F;  3TOA A;  4G9Y A;  3IRR A;  1DQU A;  1HXD A;  2LD5 A;  3DF8 A;  1GXP A;  3T8T A;  3FK6 A;  2VC1 A;  1W36 C;  5J8F A;  4B47 A;  3COA C;  2Z9O A;  4Z2Y A;  1OCZ H;  3EUH A;  1RIO H;  3DBR B;  1EJ9 A;  5M5W J;  1DPU A;  3FF5 A;  3HGY A;  3VFZ A;  2Z3Y A;  1OCT C;  3BP8 A;  3HOV J;  1WJE A;  3IH3 A;  2VOP A;  1P92 A;  1D0Y A;  1Q1V A;  2JJ7 A;  2M3A A;  5J1U A;  2ZJP F;  1T98 A;  1LQ1 A;  4RDU A;  1SFE A;  1I3A A;  2VQG A;  1QZE A;  1V55 H;  4RS8 A;  1K6Y A;  2LYC A;  1KZH A;  2F5D A;  2Q8K A;  4X0G A;  3B73 A;  3WTU C;  3OYK A;  3G73 A;  4EV0 A;  4Q5S F;  1FOX A;  4AIK A;  2M4K A;  4MEX F;  2LFB A;  2VOO A;  1MH3 A;  3G1M A;  4CYD A;  3RKW A;  3TDU C;  5CJ9 A;  4XRM A;  5GPA A;  1OFC X;  3BPX A;  1I3Q J;  3H3U A;  2NNY A;  3KFW X;  4G7Z F;  2ZKZ A;  1AU7 A;  4XQF A;  4UUV A;  1JTX A;  1D8K A;  1UCR A;  2EFP A;  1ZKG A;  4PCQ A;  5KK1 A;  3T1B A;  1XD7 A;  4DYR A;  5J4Y A;  3DV8 A;  3QAH A;  3I59 A;  2LOO A;  2GXG A;  5LLQ A;  4AYB N;  5JLW A;  2LY2 A;  3BZ6 A;  2X1E A;  2RVC A;  2VE8 A;  3U1K A;  2ZXI A;  3F8M A;  1S3J A;  2XUB A;  4HLX A;  3CCQ I;  4IKF A;  3MKL A;  4AYB A;  4RGS A;  1Y1W J;  2AXL A;  3JRC A;  1FBU A;  1QGP A;  1CGP A;  1QVT A;  3M3Y J;  3AFH A;  3GZN B;  4XKB A;  5C3E J;  2DFI A;  2P81 A;  2I8D A;  2BW3 A;  3BJA A;  1HLV A;  1KON A;  3CCR I;  4QWQ A;  4GRI A;  1MNE A;  5E3O A;  3DPT A;  1QQI A;  5H6Q A;  2R3S A;  4M3G A;  4HV6 A;  1Y1V J;  4D7M A;  3ECO A;  2Z5U A;  1Z3Y A;  3HB9 A;  2XPU A;  4M3D A;  3WOD F;  2KHM A;  2VL8 A;  5A2Q K;  2VAS A;  2CUZ A;  4EVI A;  3FXL A;  2X85 A;  2I5U A;  4NBQ A;  3MVP A;  3H5N A;  3GO5 A;  2OZU A;  2K4B A;  2RQP A;  3ZQQ A;  1HW1 A;  5D4S A;  5EEG A;  5HNH A;  4GYG A;  4NC6 A;  2W84 A;  3S93 A;  5JHU A;  4RB1 A;  2Q2E B;  4CZZ A;  1V54 H;  5AIP A;  2R7Z J;  2XDV A;  1R5H A;  5F6F A;  2JT1 A;  2QCO A;  3OL3 A;  1RUO A;  4U87 A;  3RPQ A;  2ESN A;  3TED A;  2ZJQ F;  1W5S A;  4OMZ A;  4CO8 A;  4ESB A;  2P7C B;  2H27 A;  3WTV C;  4ZDO A;  2DPU A;  2UXN A;  1WKM A;  2X6Y A;  3FXJ A;  1O57 A;  3OY9 A;  2V7F A;  4W97 A;  3O3K A;  4EJT A;  3V8J A;  2M2E A;  3DU6 A;  1ENH A;  2HYJ A;  4A0Y A;  5FKK A;  3C3W A;  4IRH A;  3U1D A;  2XRO A;  3OOP A;  4WXC A;  2K9S A;  4XSZ F;  3V8L A;  5F1R A;  2XAS A;  4CA0 A;  3G6E I;  2NOG A;  1E3H A;  2X6W A;  1MIJ A;  1PJR A;  2XAU A;  3CES A;  4YFN F;  4Y52 J;  4MTE A;  4Y33 A;  1ZR4 A;  4RM3 A;  3K7A J;  1U8B A;  4HNT A;  2ADU A;  1ETK A;  3TL4 X;  1SFO J;  1R36 A;  1R6R A;  1W5C C;  5HDK A;  1TT5 B;  2DMT A;  4AM3 A;  1OIS A;  3E0J B;  4IOA F;  3BTC A;  3ONQ A;  5DCM B;  2VJI A;  4JBA A;  1GXQ A;  2QF7 A;  3I3L A;  4D7N A;  4V2F A;  1NG7 A;  3RZD J;  5IP7 J;  1BOB A;  1FMW A;  4L9N A;  1XB4 A;  2DOD A;  3BR2 A;  5LHI A;  2X1D A;  3QP5 A;  4Y17 A;  1IUF A;  4HLY A;  2VN2 A;  3TKY A;  3HZJ A;  1Y39 A;  4IVN A;  4DIQ A;  4HQM A;  2PJP A;  2R7D A;  2Y2Z A;  1QPI A;  5FD6 A;  2BVM A;  2BBY A;  3QOP A;  4KIC A;  4HDU A;  2DOA A;  3R0J A;  2NVQ J;  2ZXW H;  1R22 A;  4OIP F;  3LA3 A;  4WK8 F;  2IW5 A;  2QWW A;  3F8F A;  4J19 A;  2MBF A;  3E5Q A;  3FXU A;  2BZT A;  5ILU A;  3QYE A;  2P4W A;  1WH5 A;  4NQW B;  2HKX A;  1ZH5 A;  3VB2 A;  1W7P D;  2QEN A;  3BPV A;  2MA3 A;  1P4X A;  2JWT A;  2IRF G;  1QZY A;  4BH9 A;  3REO A;  2A68 F;  2HOS A;  2DFF A;  4XLE A;  1TC3 C;  5C4J J;  5CPR B;  1L3L A;  2JTV A;  3VYS B;  2Z1D A;  1LDJ A;  4OU0 A;  4HF2 A;  5FLX K;  3ABL H;  2M1B A;  2DFE A;  1WGX A;  4S05 A;  2LKP A;  3SZP A;  2X51 A;  3WTZ A;  3L2W A;  4FX0 A;  3QQA A;  4Q48 A;  3JW4 A;  3K6G A;  2WAQ N;  4OMY A;  4M3E A;  4M3F A;  3PFI A;  3C2G A;  1T0F C;  4Y4R A;  2QBY B;  3S14 J;  1XSV A;  4BXX J;  2CQK A;  1SVM A;  3KP6 A;  2FBH A;  2QQ8 A;  4JK1 X;  4E7K A;  2DOF A;  2FOK A;  2WAQ A;  4Y7N J;  3DBL B;  5F1J A;  4BS9 A;  1NTC A;  2EZK A;  2H6B A;  3ABU A;  1P6R A;  2EWN A;  4L0Y B;  4EM2 A;  2XGX A;  5ILV A;  5JI6 A;  1YIT I;  1FOW A;  3ZGK A;  3BOQ A;  4LK0 F;  1MMA A;  4A0X A;  2O3F A;  1VQK I;  1MD0 A;  1YE9 A;  4ZDP A;  4ZZD A;  3VWB A;  2OUM A;  5FGM A;  3CLQ A;  2QQA A;  4JX5 A;  2LY1 A;  5LEJ A;  1XGS A;  4FE4 A;  4XKC A;  2E1O A;  1MND A;  1SMT A;  3FBI B;  2KDO A;  3UR3 C;  4F93 B;  5FRN A;  1DU6 A;  1EH6 A;  1H89 C;  1IRF A;  2MSY A;  3CF2 A;  3H3Z A;  4FQG A;  4A69 C;  3HKZ A;  3CDL A;  2IAI A;  5K5Q A;  2JVG A;  1X1P A;  1BR2 A;  1IDZ A;  3MCZ A;  4XKW A;  4BUP A;  2F5E A;  3OOU A;  5LFA A;  5BQT A;  3DP7 A;  3KPH A;  4U7B A;  4UUS B;  3H9G A;  4MQV A;  2FQ3 A;  4BQA A;  5E3N A;  2HU9 A;  3EYY A;  2F48 A;  2FF4 A;  3GW2 A;  4JOM A;  5DEQ A;  3GTQ J;  2B63 J;  1A35 A;  1BW6 A;  1W5T A;  4HPQ A;  3HM5 A;  3GF2 A;  3QOD A;  1U9N A;  3R61 A;  3LA7 A;  3OR2 C;  4YRV A;  1TLH B;  1X2M A;  2CW0 F;  3ABM H;  2IA0 A;  1G3Y A;  4G12 A;  1KA8 A;  1SD5 A;  4UUT A;  3IH4 A;  2IA2 A;  2L5Q A;  2XHK A;  2OJE D;  3QWL A;  5F0H A;  3CCE I;  1UHS A;  4N4O B;  2FQ4 A;  3BJO A;  4QTR A;  1A04 A;  5HS9 A;  2Y9Y A;  3DKX A;  3FDY A;  3ZMU A;  1YW8 A;  1EH8 A;  3BR6 A;  5DYM A;  4BYY A;  4M9X A;  2DN0 A;  1KU2 A;  2Q2E A;  2VKD A;  2CQX A;  1IC8 A;  2IP2 A;  3C2H A;  3BCB A;  1X3W B;  3E5U A;  9ANT A;  3LAJ A;  2ACJ A;  3E6D A;  2O8K A;  3WGI A;  3K4M A;  4N9I A;  4JX4 A;  4IO9 F;  3S1Q J;  2E2I J;  4OIR F;  4FX4 A;  1MMD A;  3PNY A;  2OD5 A;  2K40 A;  2GXB A;  5BS6 A;  1S7E A;  2LC2 A;  1ETV A;  4I98 B;  4MHG A;  1QNT A;  3WE3 A;  2DFH A;  5HS8 A;  2MH2 A;  3GBG A;  4BQQ A;  1ZQ3 P;  1JHF A;  2GAU A;  4XOP A;  2TRT A;  4H4K C;  1SEU A;  2XPV A;  3SZT A;  1R1U A;  5TIS C;  2H1L A;  3LMM A;  3PFY A;  4ZYA A;  2K3F A;  2J5P A;  2D45 A;  2OC6 A;  5JVT A;  5H6R A;  2B9S A;  1SAN A;  4NDL A;  3HOZ J;  1GT0 C;  2DJI A;  1R1V A;  4UHT A;  2JA8 J;  2IGN A;  2EZI A;  4GXO A;  5DCM A;  4I7H A;  3P9I A;  1MMS A;  1YFH A;  1ETW A;  4A5M A;  2L4A A;  5GPC A;  4FAS D;  1WJ5 A;  2HI3 A;  3KP7 A;  4HX4 A;  3KP4 A;  4ZYE A;  3PO2 J;  2DA6 A;  4BQN A;  4BU2 A;  2UV1 A;  1H8A C;  3BR3 A;  4RAZ A;  2XF6 A;  1HC8 A;  4HA8 A;  4A3G J;  1VQ4 I;  4EM0 B;  4MLO A;  4DOZ A;  3HOU J;  2YX7 A;  4O6J A;  3PL8 A;  1Z91 A;  4A5N A;  2CRG A;  2HPM A;  3GFL A;  4G6Q A;  1O3R A;  1KU9 A;  4KIG A;  1T2K A;  2HZD A;  3DEE A;  2O03 A;  2DA3 A;  2XVC A;  3I58 A;  5GTH C;  4HRI A;  2DI3 A;  3X2Q H;  1BW5 A;  2KJC A;  2PG4 A;  2PX9 A;  2XGD A;  2CQ7 A;  4IRI A;  2CO5 A;  4NQW A;  2G9W A;  2V6C A;  2QGU A;  1FJL A;  3KX2 A;  2FNP A;  2E36 A;  4ABZ A;  3MFK A;  4EM1 A;  3CJR B;  4E7S A;  4B48 A;  2DPD A;  3SYT A;  5ICC A;  2H8W A;  1BI3 A;  1G6N A;  2XB5 A;  2R7U A;  3F22 A;  1TBX A;  1H9G A;  1ETX A;  3J7A Y;  3CF5 F;  3IL2 A;  4KIS A;  3GME A;  2P0W A;  3BZC A;  3WTS C;  3U2R A;  2Z16 A;  1MJB A;  1YX3 A;  2IJL A;  2A5Y B;  3H0G J;  3CP8 A;  2QBY A;  1E2X A;  2AO9 A;  4GCV A;  3VYR B;  1HKS A;  1LVK A;  2DOE A;  5IOZ A;  4HW0 A;  3BY6 A;  1TW3 A;  2OPT A;  3HBL A;  3QPH A;  3OS1 A;  1U9O A;  3TP0 A;  2CH0 A;  3G1L A;  3D5R C;  1WRJ A;  1BBY A;  3QOE A;  5LRR A;  1DP7 P;  5GAG J;  3M4O J;  3LST A;  5D6E A;  5FLM J;  2KJB A;  2F4M B;  5EDN A;  2L9S A;  2WB1 A;  3BTI A;  1YW9 A;  2MGQ A;  3G4S I;  3HOW J;  3Q9V A;  4N9H A;  1IJW C;  3G2B A;  2EZH A;  2KDZ A;  5BPI A;  2STT A;  1MJ9 A;  2KIF A;  4DYQ A;  2R5Z B;  2V9V A;  2E7W A;  2CUE A;  1OCP A;  2Z2S B;  4LG3 A;  1UMQ A;  3TBI A;  5E3M A;  2EFW A;  4CCO A;  1UST A;  2XAG A;  1ZGA A;  3S2H J;  2UUZ A;  4EMS A;  5H20 A;  3IV5 A;  1WSU A;  5J1Y A;  5E3L A;  2CMP A;  2R7V A;  1MMG A;  2QM3 A;  4RLF A;  1UHW A;  1U2W A;  3DWL E;  2ZJ2 A;  4XLP F;  1EV7 A;  5ICG A;  4XLF A;  2ICW G;  3SQN A;  4YEJ A;  5IYB J;  1MBG A;  2ZB9 A;  4HSR A;  2MFZ A;  1LDK B;  1N25 A;  1NH3 A;  2N8G A;  2E60 A;  1FC3 A;  1XMA A;  4MTD A;  2HWV A;  3I4P A;  2O8X A;  2WAD A;  2VLA A;  2HFH A;  4L5E A;  1LFP A;  2DT7 B;  3CCY A;  2PMH A;  2F5C A;  3IKT A;  2JRT A;  4XSX F;  1T6S A;  1FWZ A;  1Z9C A;  2F5F A;  3CMY A;  2QA4 I;  2KIS A;  2FOW A;  1U78 A;  4BL0 B;  1HOM A;  3S1M J;  2CWE A;  3FWE A;  1LPQ A;  2GA1 A;  4JYK A;  1LVA A;  1X1A A;  2G7H A;  1H88 C;  2KLO A;  2VUM J;  3KEO A;  4MFE A;  1YYV A;  2ZC2 A;  4CDG A;  3K2Z A;  2W57 A;  4C2M J;  1BOA A;  1N78 A;  4MFD A;  4ZYD A;  1DGW Y;  3A0H C;  4ZTJ A;  3CCM I;  3DCF A;  2FNA A;  1U6G A;  1X4O A;  4LLG F;  4C9Y A;  4KT6 A;  4J01 A;  5AIQ A;  5EEH A;  1LEA A;  4KMU X;  3PNT A;  1S6L A;  4PJJ A;  2MYS A;  1JXS A;  1ZLJ A;  1XC5 A;  3IAM 2;  1IO2 A;  2DMP A;  3V42 A;  4A3L J;  1OMI A;  3CP2 A;  1IDY A;  1K83 J;  2ETH A;  2VBW A;  3Q0W A;  4M6X A;  2Z33 A;  1D1C A;  1YW7 A;  3JRF A;  1X1D A;  1POG A;  5EYR A;  1F36 A;  3T0Y A;  5JR3 A;  4JQF A;  3ZMV A;  3EPZ A;  1J09 A;  2E5Z A;  3RI4 A;  3L9F A;  3W2W A;  3FIW A;  1A6Q A;  3VEP A;  4CUG A;  4F55 A;  3F72 A;  2K9N A;  1SFU A;  4PSW A;  3OR1 C;  3NQO A;  2O6G E;  5A2Q Z;  4NUB A;  1OYY A;  3IH2 A;  5HVQ C;  1T0F A;  5E20 A;  1UEL B;  2EIK H;  4TV7 A;  2E1M B;  1B4A A;  3RKQ A;  1G3S A;  3JSP A;  1JE8 A;  2BV6 A;  3B02 A;  4B3X A;  2VPL A;  3LNQ A;  4XID A;  2MC3 A;  1YHQ I;  4HNU A;  4NB5 A;  1OR7 C;  3O8H A;  1RET A;  3JR9 A;  1I27 A;  3BRO A;  4A3J J;  4BEH B;  2ID3 A;  4BDY A;  3P9C A;  4KIT B;  2ZXH A;  5BPD A;  1R5I D;  2STW A;  5J47 A;  2XAQ A;  3QU3 A;  2IVM A;  5JVG F;  4E70 A;  4U0V A;  1PP7 U;  4KFC A;  4ANJ A;  3OYN A;  1JUS A;  4XM3 A;  2Y69 H;  2OBP A;  4PGG A;  3C7J A;  2L9V A;  5EJC A;  5HDG A;  3FM5 A;  1RUN A;  2QKL B;  4HOB A;  5KHD A;  1QVU A;  2LLK A;  3ECH A;  4BE0 A;  5K7Z A;  4EGZ A;  1IG7 A;  2B0L A;  4PFO A;  2NAZ A;  1MGT A;  3GZ5 A;  3F6O A;  3CLO A;  3PNV A;  3GTK J;  4ZYG A;  1MH4 A;  1FPQ A;  3OWT A;  3K69 A;  5JLX A;  1TQP A;  3VYU B;  1FSH A;  3AAF A;  3ML6 A;  3ZOB A;  3WGH A;  1FEX A;  1STZ A;  3LSH A;  4FET A;  3L2U A;  1ZK8 A;  4PUS A;  3ERE D;  1GVJ A;  1B72 B;  3KET A;  1PUF A;  2ZCW A;  3C18 A;  3EUA A;  4XIC A;  3I55 I;  3GTG J;  4LOC A;  1R00 A;  1VQP I;  2R7S A;  2MG4 A;  2DQL A;  5C4X J;  3CO6 C;  2OTJ I;  3RKY A;  4FE7 A;  2LK2 A;  3HOX J;  3PJR A;  2F2E A;  1ZHF A;  2DA7 A;  4YIR X;  3PQJ A;  2DT5 A;  3TDZ C;  1FTT A;  3FXK A;  4UNO A;  3LSG A;  2E19 A;  3F8B A;  5CVJ A;  4EGY A;  2PMU A;  1TL8 A;  2UZK A;  3CD6 I;  3S32 A;  3H3V K;  2D1H A;  3L1P A;  1IW7 F;  4IPA A;  1XMK A;  2R5Z A;  1JGG A;  2IS6 A;  3DLL F;  1FOK A;  3OYG A;  2W25 A;  2CGP A;  4IRG A;  3RYP A;  2ID6 A;  2RNG A;  3OYJ A;  4R8H A;  5CLS A;  2VQC A;  4F91 B;  2KPM A;  3ZMT A;  3H0D A;  2P6S A;  3UNG C;  5CVV A;  2OCE A;  5KVR A;  5FLV A;  2IGO A;  3ZN1 A;  4X1E A;  2K86 A;  2HEO A;  3TO9 A;  5GAD J;  5DUK A;  1MNM C;  3S16 J;  5LBQ A;  3LOC A;  1VQL I;  1IN5 A;  3HSE A;  4ESF A;  1WCM J;  3OYB A;  2KIU A;  2Z99 A;  5FLX Z;  2WV1 A;  3OL4 A;  1ZGJ A;  1OCR H;  3VDX A;  3LFU A;  3S8P A;  2L02 A;  2OAZ A;  3RSN A;  1MBJ A;  3W2A A;  1XGN A;  3FMR A;  3N97 A;  1X4P A;  2R5Y B;  3AG4 H;  2YX4 A;  3D5L A;  3FZV A;  3J80 K;  4C30 A;  5HLT A;  4P55 A;  2MD0 A;  4NNJ A;  4IOC F;  3S2W A;  3KP5 A;  4ASN A;  3HHG A;  5HS7 A;  1VF9 A;  4LD5 A;  4P96 A;  5H2F C;  3N4M A;  2M4G A;  1ORK A;  3G3Z A;  4IHW A;  3FXQ A;  2E34 A;  4RLQ A;  2HKO A;  2HTS A;  2M8E A;  5E1W A;  5DTD A;  1W0T A;  1IXS B;  2EIM H;  4DNC A;  2IS2 A;  5ILS A;  2RGV A;  1CF7 A;  2PLY A;  2JMW A;  2OTL I;  3IWZ A;  2QQB A;  4HAM A;  1MMN A;  3F0C A;  1AKH B;  1LB2 A;  2NVX J;  3E6B A;  3K70 C;  5M3F J;  1DDN A;  1MBE A;  2BHY A;  2L2O A;  2LF8 A;  4YEL A;  3KP2 A;  2RC4 A;  4IQ4 A;  4CZC A;  3BLY A;  1SD4 A;  2QZ8 A;  1LJ9 A;  1WJA A;  2L01 A;  4YG2 F;  2KRC A;  3L09 A;  2O7O A;  2P7V B;  2QEX I;  3BR5 A;  2M0M A;  4Y3O A;  5LGT A;  2P5L C;  1ON2 A;  3BDD A;  1HST A;  3GLX A;  1FP2 A;  4B4C A;  1GLN A;  4LIV A;  4EAT A;  1XCB A;  2JQ7 A;  1RKT A;  1HA8 A;  3DQV C;  2NVY J;  2DAO A;  2YS9 A;  5CVR A;  2GOX B;  3OMY A;  2WV0 A;  3K1M A;  1QZZ A;  2VQH A;  4PZJ A;  1FNN A;  4LIU A;  3IKV A;  2FBK A;  4L9J A;  2VJ4 A;  4KDP A;  2EFQ A;  2G0E A;  4L5J A;  3FM3 A;  4E7H A;  2CV0 A;  5EEA A;  1DUX C;  3ESW B;  2CV2 A;  4CCN A;  2JUC A;  4QPO A;  3JSO A;  1Y8R B;  2E7X A;  3M9A A;  1O7F A;  3G1O A;  1N77 A;  4PJ0 C;  4DZJ A;  4Q4Z F;  3FX3 A;  1WPK A;  1R7J A;  4LFU A;  3JRH A;  5C44 J;  2CQQ A;  5L3D A;  1QU3 A;  2NVU B;  1REP C;  1X2N A;  2XRL A;  1IN6 A;  2VBY A;  4P5O A;  3MKY B;  3ROU A;  1AOY A;  1DGR M;  4PJL A;  2VB6 A;  3VSK A;  2IT0 A;  2M87 A;  4AU7 A;  4QIW N;  1UG2 A;  3GVA A;  3WU1 B;  3HIF A;  3Q5F A;  4BEH A;  1JUM A;  2P5V A;  3HRS A;  1PYV A;  4L9V A;  3ULQ B;  2NVT J;  1JUP A;  2PQ8 A;  2BY2 A;  4XN0 A;  3TMO A;  3PSF A;  3DBH B;  3F21 A;  3CMM A;  3HDD A;  1W4M A;  2X0L A;  4CHU A;  4N0B A;  3HTU A;  1BC8 C;  3SEQ A;  3WTW C;  1Y56 A;  2JRM A;  5E8G A;  4WX9 A;  3DEU A;  4QPQ A;  1FT9 A;  3M7G A;  4L18 B;  2M8G X;  3KEQ A;  2GZW A;  2I10 A;  4D5F A;  4GGG A;  1D5V A;  2GQQ A;  2VKH A;  1TNS A;  2ELJ A;  1OJL A;  2VIX A;  5FD5 A;  1MSE C;  3S3M A;  4LB5 A;  1OQY A;  2LBF B;  1TNT A;  3C2B A;  3HSF A;  2HPI A;  3I0T A;  3HOT A;  2JZY A;  4O3M A;  2XAH A;  3ASO H;  1VQ5 I;  3TGN A;  2MLG A;  2DA1 A;  3A03 A;  3E3V A;  4KN7 X;  2QSG X;  1VZ0 A;  2HXI A;  5AON A;  4X6A J;  2DDA A;  1B72 A;  2MD5 A;  1ZG3 A;  3H9Q A;  3NWS A;  5CYV A;  2Q0O A;  4BY1 J;  4G7H F;  1YS7 A;  1ZRE A;  4B09 A;  2DBB A;  1IRZ A;  2IXS A;  2LVS A;  3D0S A;  3NEU A;  4G7O F;  2JA7 J;  4BHB A;  2FRH A;  2Y48 A;  5K7F A;  1SAU A;  3GFM A;  3HKZ N;  1S7A A;  2HOT A;  2FJ1 A;  2FSW A;  2CFX A;  1A5J A;  1SVO A;  5D8K B;  1WHU A;  2PEX A;  3L2R A;  2FE3 A;  3R60 A;  2ZME C;  3ZN0 A;  3KP3 A;  1IRX A;  2AHQ A;  2WBM A;  4HNV A;  4ZYH A;  3FXM A;  4IXA A;  4BY7 J;  2W48 A;  4HF1 A;  1GVD A;  2L7K A;  1PUE E;  2R7F A;  1ITY A;  3T8R A;  4BJ5 C;  2HYG D;  1YJW I;  3KYD B;  4DYC A;  5IOY A;  3V4G A;  3Q0V A;  3M1E A;  3CJN A;  3IUO A;  1W1W E;  1HF0 A;  3HYI A;  4YII A;  1PDN C;  2QUF A;  2YUS A;  4LB6 B;  5KAF C;  5ICE A;  3CUO A;  3RJP A;  5HLG A;  3ZQ7 A;  4KUM A;  1HDP A;  3IC7 A;  4B3A A;  4PK4 A;  4CXF A;  1R9T J;  5BOX A;  1F9N A;  3HOY J;  1KQ8 A;  1Y0U A;  1A6I A;  2R5Y A;  3I4N J;  5KCM A;  3DXJ F;  1TT0 A;  1D1A A;  1DU0 A;  2K85 A;  1BJZ A;  2VC0 A;  3KZI C;  5LHG A;  4XRS A;  1D5Y A;  2LY9 A;  3KEY A;  3ISP A;  3OYI A;  5IT3 A;  3LSK A;  4U0Y A;  3M8J A;  2NOJ B;  2JUG A;  1OR7 A;  1WWX A;  1TQI A;  2ZJR F;  3HEF A;  2VOD A;  5FFZ A;  3WU2 C;  3A2K A;  4HX7 A;  3TQN A;  5EGO A;  4ENN A;  3PO3 J;  4ZDL A;  1MJA A;  1B8I A;  1VI0 A;  4IF4 A;  3KZZ A;  1AKH A;  1APL C;  3A01 B;  4E7L A;  4CCM A;  4CCJ A;  1AA7 A;  1R4M B;  3FHN A;  2H1K A;  3DPL C;  3A0B C;  2ZSH B;  4FHT A;  3ZR8 X;  3A02 A;  3GUD A;  2NRA C;  2ZSI B;  1P4W A;  4M9Z A;  3BG3 A;  2KFD A;  2MLK A;  3J7Z I;  1XCV A;  2QVO A;  5GTI C;  2V1U A;  1JT6 A;  1YRN B;  2AQE A;  4N4N B;  1O3T A;  2H94 A;  3ZMZ A;  3QPS A;  2DA5 A;  3M8E A;  2CUF A;  3CUQ C;  3IWF A;  3I4M J;  3L2C A;  2D2W A;  3L2Q A;  1J0R A;  3P7N A;  4AIJ A;  1MW7 A;  3E97 A;  1HSJ A;  1QO0 D;  3K4B A;  3OSG A;  1MKM A;  3Q0U A;  1ZRF A;  1Z6T A;  5CQE A;  4ZTF A;  1ONV A;  4PJN A;  5L3C A;  1MBF A;  3LSP A;  1P2F A;  5K5R A;  2W00 A;  2FMY A;  3EDP A;  5CVI A;  4P9U A;  2ECC A;  2HQR A;  4HF0 A;  4RM2 A;  5DD4 A;  1Z0X A;  1SFK A;  2M9H A;  3K0L A;  2EB7 A;  5ICF A;  2LG4 A;  2NS7 A;  3WHC A;  1WJB A;  1WFX A;  2CQN A;  1U3E M;  6PAX A;  2W24 A;  3DKW A;  2ZO4 A;  4RGX A;  2QSH X;  5HOD A;  5LEK A;  3HSR A;  1OYI A;  3CDH A;  5GAE J;  4M9S A;  3S15 J;  2F4I A;  3AG1 H;  1FSE A;  4EJW A;  2OA4 A;  1WI9 A;  2IBD A;  5LGU A;  4I09 A;  2Y0M A;  2NS8 A;  4ETS A;  3GTM J;  1H9T A;  1JTY A;  3OV8 A;  4BE1 A;  1V4R A;  2A05 A;  2ZME B;  3F6V A;  2PFB A;  4XOT A;  2BVL A;  2KMU A;  4AVZ A;  3JAM K;  2DO7 A;  1UHM A;  3DFG A;  1XMX A;  2HYF A;  5F0C A;  2DYS H;  3OYF A;  1IF1 A;  1TZL A;  2EZL A;  2L7Z A;  3U21 A;  2OZ6 A;  1MSF C;  4CIC A;  2XPW A;  2QQ9 A;  4HV5 A;  5FRO A;  2A6H F;  5DM7 F;  3OYL A;  3VOE A;  4E6K G;  1E3O C;  4OIO F;  1B9M A;  4ON0 A;  3OYH A;  3RIR A;  1R1T A;  1X58 A;  1BM9 A;  1FLI A;  2QLZ A;  4F92 B;  1PUF B;  3CCL I;  2A6E F;  1J75 A;  1MZB A;  2LBF A;  2X6X A;  2OCC H;  2BY1 A;  2DK5 A;  1L0O C;  2DMQ A;  3GFJ A;  4WXD A;  2XIG A;  3BTJ A;  3C1D A;  1W7P B;  4H0E A;  3S1R J;  3TOB A;  2E1M C;  1JKP C;  3O2P E;  3M8F A;  5J3L A;  3MMY B;  4FIS A;  4XOR A;  5B1A H;  3AL0 C;  2DA4 A;  2KL4 A;  1ERD A;  1D3Y A;  1K78 B;  3WTT C;  5FFX A;  3GFI A;  3I54 A;  3V8K A;  2IS1 A;  4UV9 A;  1JHH A;  3I53 A;  2WB1 N;  2XV4 S;  3QPT A;  4CSW A;  1A31 A;  3F3X A;  2LTP A;  1VQN I;  3AG3 H;  2BY3 A;  1LKX A;  4FTH A;  3ZP5 A;  1KYW A;  2EK5 A;  4BE2 A;  2CSO A;  3DTI A;  4B1R A;  3MZH A;  1RR8 C;  3MEX A;  2LMD A;  4BAY A;  4D0P A;  2XSD C;  3I64 A;  3QYB A;  4LJZ F;  2Y31 A;  2TCT A;  3WTY C;  4JP0 A;  3LA2 A;  2CV1 A;  5K1Y A;  1XX5 A;  1KYZ A;  2KRH A;  2ZNZ A;  2CJJ A;  4XKV A;  4KJZ A;  1ZYR F;  1QHG A;  1XDS A;  4HX8 A;  1K4T A;  4IL6 C;  2JSC A;  3BZK A;  3KZY A;  2KZV A;  1DPR A;  4KA4 A;  3HRU A;  4DBR A;  1TWF J;  2W1O A;  3QRF F;  1R71 A;  1R58 A;  3J81 K;  1ETQ A;  3RCO A;  3CC2 I;  1O7L A;  1LFU P;  5B66 C;  3CUQ B;  4DGW B;  1B9N A;  3DPU A;  4UVA A;  1Z05 A;  3MZY A;  3HL2 A;  2EV5 A;  5K5O A;  1K6O A;  3FKJ A;  1X19 A;  4I01 A;  3AKZ A;  5E79 C;  2EFN A;  2Y9Z A;  4XLC A;  1QHH D;  4I02 A;  1T95 A;  4HG2 A;  2E2J J;  1MDM B;  1HCR A;  3LAP A;  3HUG A;  2VBX A;  3GXO A;  3QYF A;  5D4R A;  4DQ2 A;  1YJN I;  1R5G A;  4G8X A;  1CF7 B;  4FT8 A;  2P6T A;  2G7U A;  5EG0 B;  3PSI A;  3R4K A;  4FCY A;  4XL9 A;  4R1H A;  5F0F A;  3CC7 I;  5GP9 A;  1G8X A;  3OS0 A;  2BXZ A;  4KNY A;  2XKO A;  2R7Q A;  1WJC A;  1Z6R A;  2WA0 A;  4YFK F;  2CW8 A;  3SHF A;  5TJJ A;  3W6J B;  4KIF A;  3K4L A;  5FKO A;  4AD9 A;  1Z67 A;  5DUI A;  1J59 A;  1SMY F;  4IEJ A;  3D1N I;  4G6T B;  1O3Q A;  3RQI A;  3W2V A;  4BBS J;  2BYV E;  4U7D A;  4LGW A;  3SEZ A;  3BG9 A;  2E5N A;  2XB0 X;  2EQR A;  3TP3 A;  1GV5 A;  5L3E A;  2BHZ A;  3A01 A;  3VPR A;  4OOI A;  2L4M A;  3KE2 A;  4EQQ A;  2FUG 2;  5JHF A;  1LDD A;  1EKE A;  5B5E C;  1NK2 P;  2VI6 A;  3A1Y A;  3CTA A;  1G3W A;  1YRN A;  2R0Q C;  3ELK A;  3RDI A;  4ENJ A;  2ECB A;  2EA4 A;  4P9F A;  2XAF A;  3OS2 A;  4E7Z A;  4AID A;  3U9G A;  3K9T A;  1JJ6 C;  2ME0 A;  3ASN H;  4K2E A;  2KKO A;  3BG5 A;  2E2H J;  2QKM B;  3J80 Z;  3AL0 B;  1EH7 A;  4F3Q A;  4ZC3 A;  1XSD A;  1F43 A;  4A3C J;  1JT0 A;  1XG1 A;  4XRF A;  2ISY A;  1ZR2 A;  2DW4 A;  1G59 A;  5DCF A;  2M7A A;  1FIA A;  2VKE A;  5DV5 A;  2R7R A;  4A6E A;  4C3J J;  2HDC A;  4XLN F;  2WAE A;  5IT9 K;  1HBX G;  3CCJ I;  3Q3S A;  3JRE A;  1KU7 A;  2CUJ A;  3KIO A;  4HQE A;  4L5I A;  2VXD A;  3OYC A;  5D5X B;  1FYL A;  4W1U A;  3R6S A;  2WAF A;  2LR8 A;  2X1C A;  5JFR A;  1BJA A;  4G6D A;  1HKQ A;  4RAY A;  3MKW B;  3HPH A;  1T8I A;  4M3B A;  4RGR A;  3I56 I;  4IHY A;  2ZME A;  4L9T A;  1RES A;  4RAG A;  2ZBK A;  4UV8 A;  3P5J A;  3V7R A;  3FXO A;  2C6Y A;  2PMZ A;  1WQ2 A;  1UZC A;  3MD2 A;  4DW6 A;  1YIO A;  4LK1 F;  5LHH A;  1IXC A;  4KIB A;  1K7A A;  3SFI A;  5J6X A;  3ABT A;  1IAW A;  4A12 A;  3BG6 A;  4D1Q A;  1UJ8 A;  3DTK A;  4MO7 A;  4NC7 A;  3GYH X;  3OYD A;  3UKG A;  1AWC A;  3PIP F;  2GXA A;  1AHD P;  2M0C A;  1XN7 A;  4OWR B;  3TO6 A;  1ZTR A;  3FK7 A;  1YIJ I;  1Z7U A;  4M73 A;  3RPU A;  1J5Y A;  5FJ8 J;  1Z21 A;  3LSM A;  2E35 A;  3JRA A;  3CMA I;  1JKR C;  4OAY A;  4YIF A;  2V79 A;  4ENM A;  3ERM A;  3DTE A;  4BHP A;  1I1S A;  1S29 A;  2VPR A;  3CDI A;  1W7P A;  4RB3 C;  3JCU C;  2DQR A;  3M07 A;  3TW7 A;  2LH9 A;  4MEY F;  3S1N J;  2DXI A;  1K78 A;  2XGE A;  3FBN B;  1U0J A;  2ZFU A;  3K4K A;  3K70 D;  1RR7 A;  1CQT A;  3P9K A;  2LKS A;  1OYW A;  1Y6I A;  3GX4 X;  3R0A A;  1TTY A;  3PUB A;  3KCC A;  3CJT B;  4XLH A;  3FHZ A;  5HDN A;  4GO1 A;  4ZJZ A;  2NYX A;  2AQF A;  3NAR A;  4IHV A;  4EJV A;  1FY7 A;  2CU7 A;  1S9H A;  2GBY A;  1X3Z B;  2R7W A;  3JRG A;  4AIH A;  2L7M P;  2K27 A;  3KYC B;  5M3M J;  3Q9S A;  4RAF A;  3SZG A;  3OYA A;  1ETY A;  2R4G A;  4J00 A;  2K7L A;  2LP0 A;  2L9N A;  1K61 A;  4MNU A;  1P9Q C;  3I71 A;  5BNG A;  4LIT A;  3SJM A;  1ZAR A;  2D1V A;  5TRD A;  1JKO C;  1P4A A;  5CKT A;  5E17 F;  2EV0 A;  3DEW A;  2FU4 A;  2WY7 Q;  3BQZ A;  2V4J C;  1LEB A;  3A4C A;  3LQQ A;  3NRV A;  1VFC A;  1BA5 A;  3F8C A;  1IN4 A;  2ELK A;  3WTX C;  3CUQ A;  2OQG A;  1SFX A;  2OQR A;  4MIM A;  4NC8 A;  5E18 F;  4I2O A;  4NHJ A;  1J7K A;  4GFB A;  1X3U A;  2QSF X;  4B44 A;  5L3F A;  2LDU A;  2JVH A;  4L0Z B;  3PQK A;  2R7X A;  1GV2 A;  3S3O A;  4A2U A;  2GM4 A;  2TDX A;  1FX7 A;  2COB A;  1MDM A;  1IV6 A;  1BR1 A;  2A07 F;  5EGO B;  1UB9 A;  1I6H J;  1U5T B;  1LNW A;  4WF2 A;  2BY0 A;  3HOS A;  4V2G A;  1B8I B;  2IGM A;  4CCK A;  4A3K J;  4RMN A;  5EG0 A;  1RI7 A;  4XK4 A;  2K3P A;  4IZZ A;  2ESH A;  2VBZ A;  2FA5 A;  3ZQG A;  4AUX A;  1K4S A;  3B6A A;  5K7H A;  2LKX A;  1HDD C;  3OSF A;  1S72 I;  1Z1D A;  3T5X A;  2HR3 A;  1GUU A;  2ZNY A;  1S8N A;  3RQ4 A;  3IRQ A;  4A3M J;  2DK8 A;  5E1X A;  1ODD A;  3CQZ J;  1LFB A;  2OF7 A;  5J40 A;  1QA6 A;  2V9K A;  5B1B H;  4I76 A;  3K2A A;  3WE2 A;  2EIJ H;  3MN2 A;  5LGN A;  3BWG A;  1HKT A;  3V7S A;  4HST A;  4IQJ A;  1D0Z A;  3S2D J;  1RNL A;  5D5W B;  1LE8 A;  1XSX A;  1E17 A;  4D9J A;  2L0K A;  5EZH A;  2DCE A;  4IHS A;  4BJT A;  1U8R A;  3W6V A;  2HNH A;  3ZMD A;  2PN6 A;  4IHX A;  2PJR A;  3EYI A;  3ZQH A;  4A3D J;  3F8N A;  3OIP A;  1FYM A;  2UXX A;  3GCM A;  5HNF A;  1IN8 A;  3OIO A;  2V1N A;  2M7B A;  3CCS I;  2YU9 J;  1RPW A;  2W4S A;  2KZG A;  2JPC A;  2KRF A;  2EFO A;  2GWR A;  2JA2 A;  5J8C A;  4PSX A;  5E1Z B;  2DU9 A;  2ME6 A;  3JRB A;  2AS5 F;  1SD7 A;  1YG2 A;  3S3N A;  2XC7 A;  1T39 A;  1OPC A;  2WWY A;  4UB8 C;  3E7L A;  2XF5 A;  2V6E A;  1PP8 F;  2BGC A;  3JTH A;  3N05 A;  1B1B A;  4BGD A;  4E7J A;  2V1X A;  3ZPL A;  3S17 J;  1I50 J;  2HOE A;  3KYL A;  3BT9 A;  2BE5 F;  1T38 A;  1VTN C;  2JPB A;  3LSI A;  5DS9 A;  2IGK A;  2VKV A;  3GEZ A;  4BQO A;  2M30 A;  4RBO A;  1SD6 A;  2GLO A;  3PUF A;  1HW2 A;  1F4K A;  1ACI A;  2W82 A;  2YU3 A;  2EIL H;  3BTL A;  2M34 A;  3CCV I;  2J5O A;  1UAA A;  1D8J A;  1RRJ A;  5E8I A;  4QLC U;  4Y15 A;  2KP6 A;  1OKR A;  3K4J A;  2ELH A;  4C2T A;  3AG2 H;  2GOM A;  3QPL A;  3RPU D;  4LMY A;  3CME I;  2V1D A;  3IHU A;  2DT6 A;  3K4C A;  4ESJ A;  2AXT C;  2F4O B;  3TW6 A;  2EA2 A;  1UG0 A;  1V5G A;  3BCA A;  3HC7 A;  4XRS G;  3ZRG A;  3WHB A;  2VT2 A;  1N75 A;  2EH3 A;  4A3F J;  2LF7 A;  4P1W A;  3VSL A;  5DDG A;  3GTO J;  1RZ4 A;  4UVB A;  3LWF A;  1IXR C;  3BR0 A;  2Y75 A;  3CO7 C;  4A3E J;  1KQ0 A;  3RYR A;  5EZG A;  1Y8Q B;  1YQA A;  2NXN B;  3EQL F;  2ZXJ A;  2Q1Z B;  2F5V A;  4A0Z A;  3TO7 A;  2EPF A;  2JK3 A;  3M1C A;  4HEA 2;  2QYO A;  3L2V A;  2VON A;  1BC7 C;  4DBQ A;  1Z3X A;  2KQR A;  3MAJ A;  4XR6 A;  3RKX A;  5HOO A;  1C0W A;  1V5E A;  3MWM A;  1QBJ A;  3RZO J;  5F04 A;  3DLA A;  1GHC A;  1XTA A;  2XAJ A;  3OIQ A;  5D6F A;  1J2X A;  5F08 A;  5D8L B;  5DM6 F;  1XS9 A;  2HTJ A;  2V26 A;  5CQG A;  1WZ2 A;  4HZF A;  1TWC J;  3EET A;  4II2 A;  3JAM Z;  5HLH A;  4XN3 A;  1XPX A;  1XDU A;  4LLN A;  5LD2 C;  3WU0 A;  4ZZL A;  2XKP A;  5TGT A;  3O8G A;  2DJN A;  1R4N B;  2ISZ A;  4PDK A;  4RA2 A;  3ZXS A;  3WG9 A;  1G4D A;  3I5U A;  2CYY A;  3JRD A;  4CH7 A;  3GTP J;  4E7I A;  5HLI A;  3CCU I;  3SFZ A;  3JTG A;  3EUH C;  2MC4 A;  1FBQ A;  4BXU A;  1BL0 A;  5L3G A;  4BHC A;  5FKM A;  3ZQL A;  3BJ6 A;  2IEK A;  3H5R A;  3SXY A;  2O9L A;  1TP4 A;  3K4N A;  1NG6 A;  3HUG B;  1WJD A;  2RNJ A;  1V3F A;  3VYT B;  2H6C A;  1YS6 A;  1FTZ A;  1YJ9 I;  1ULY A;  2BOL A;  4IJA A;  1ZRC A;  1I6X A;  1M1E B;  3E6C C;  1TQM A;  3MKZ A;  1E3P A;  5BMZ A;  4ITV A;  2FBI A;  1S7O A;  4BNC A;  2O5R A;  1U5T A;  4UXN A;  1VQ6 I;  4I6Z A;  1H0M A;  1SAX A;  4CYC B;  2UWM A;  4KT5 C;  1ZN2 A;  5J4V A;  3KLO A;  4XON A;  2KT0 A;  1ZG5 A;  1VQ9 I;  3ZQI A;  3LSJ A;  2VQL A;  2DA2 A;  4ENK A;  3ZMS A;  4BDZ A;  2L9R A;  3E5X A;  3GTL J;  5FB2 A;  1F1Z A;  4OIQ F;  4I0A A;  1K79 A;  5FRM A;  5IYC J;  1ZG1 A;  3V7C A;  1RKW A;  1TWA J;  5ERI A;  3K10 A;  1D0X A;  2YSR A;  1HW5 A;  1X1B A;  4V19 K;  2H8R A;  3FXR A;  2A6T A;  1USS A;  3VOD A;  3DKY A;  3J81 Z;  1Z7L A;  2HQ5 A;  3PIO F;  2JA6 J;  2HOA A;  1IZ1 A;  1JGS A;  1WH7 A;  4Q47 A;  2RN7 A;  1YOV B;  4D5C A;  1YI2 I;  2B7E A;  1I39 A;  2RRE A;  2IPQ X;  3G71 I;  3E1S A;  1ZAO A;  4A3I J;  2K5C A;  4WWC A;  2O61 A;  4XBF A;  1WI3 A;  3MZ8 A;  2DDB A;  3FMQ A;  4LG0 B;  4KYW A;  2IS4 A;  1R23 A;  1VQO I;  3HRT A;  3H35 A;  4S0H B;  2HXO A;  5B3S H;  1UFM A;  4Y13 A;  2E1C A;  1B59 A;  1P7I A;  2XGC A;  1F5T A;  2LRD A;  1Y0N A;  1KU3 A;  5IYD J;  4YFX F;  2KIQ A;  3I9V 2;  3HTS B;  2NNN A;  1G3T A;  2A5W A;  3W6K B;  4LLL A;  3B6C A;  4OIN F;  2DLL A;  1EA3 A;  1OCO H;  1VND A;  2Y30 A;  4RB0 A;  1BIB A;  3H5A A;  4RB2 C;  1BI0 A;  1PVE A;  1OLT A;  2L3D A;  2MAB A;  1ZGW A;  2K02 A;  2CFO A;  4BJ6 C;  4II3 A;  5GAH J;  2A3S A;  4BXF A;  3HRM A;  1HQC A;  4HBL A;  4IHT A;  2DTZ A;  2K4J A;  1BR4 A;  3H1C A;  1V5F A;  4PGH A;  4UVC A;  4IX7 A;  3HGG A;  4R79 A;  1LUJ B;  4C2U A;  1VQ7 I;  2HVR A;  1TWH J;  1BIA A;  2X9D A;  1G2H A;  2FXA A;  1DP3 A;  1FOY A;  1KQ9 A;  5DD8 A;  3GZ6 A;  4DZP A;  5IP6 A;  4EJO A;  1VQ8 I;  4QSH A;  3JRI A;  2HZT A;  2OV7 A;  2XRN A;  4M74 A;  2L54 A;  4RGU A;  1S5L C;  2X48 A;  5IPA A;  2VJJ A;  4HDV A;  3LSR A;  1YO5 C;  3BG7 A;  1NK3 P;  4M72 A;  4GDF A;  1YLF A;  3QU6 A;  2HQN A;  2LSO A;  1I1G A;  1NHA A;  1Q1H A;  2EV6 A;  2M45 A;  3RTR A;  1IRG A;  1QRY A;  3H36 A;  4GYI A;  5FKL A;  3W3C A;  3SDB A;  4EEF G;  2DTR A;  1BI2 A;  2HGC A;  2D5V A;  3CZ6 A;  5IT9 Z;  3PM1 A;  3FKI J;  2Y0S N;  3ZQC A;  5KAI C;  4OAZ A;  2GIV A;  5LRS A;  2HVQ A;  5CVU A;  2R92 J;  3CC4 I;  2Y0S A;  4CGZ A;  3LFK A;  1OCC H;  4A3B J;  5L3B A;  2VXZ A;  3I59 B;  5EF6 A;  4EJU A;  2E1N A;  3H9J A;  1MBH A;  4KMF A;  1FYK A;  5F27 A;  4A93 J;  3HXL A;  2IA1 A;  3KLN A;  4I99 C;  2CS3 A;  2CW7 A;  2HS5 A;  4PFP A;  3K1N A;  4E4H A;  2WTE A;  3F9K A;  1FZP B;  4DJA A;  2BEO A;  3BC8 A;  3IP4 B;  4AVP A;  2R93 J;  4M6Y A;  1ON1 A;  4AC0 A;  1ZLK A;  2BW3 B;  2GIZ A;  4XLA A;  1O3S A;  2COM A;  5KNL A;  1A36 A;  2MH9 A;  1T33 A;  1D1B A;  2NS0 A;  1QPM A;  2YPR A;  2FX0 A;  1GDT A;  3L7W A;  1R49 A;  4PJM A;  2FEZ A;  3ZCO A;  4S04 A;  1RC9 A;  1MBK A;  1Z77 A;  4MGR A;  4KN4 X;  2W7N A;  1E0E A;  4UUS A;  3H92 A;  2BXY A;  4G94 A;  1W0U A;  3GWZ A;  4XNF A;  1ZRD A;  2RQQ A;  2P5K A;  1JKQ C;  4U0W A;  2PI0 A;  1X1C A;  2CG4 A;  2LRE A;  5IY5 H;  2M5W A;  1SC7 A;  2L7F P;  1FMV A;  3GLL A;  5D5V B;  3ZQF A;  2PBI A;  5D5U B;  2R7T A;  1IN7 A;  2MW8 A;  3FMS A;  2DMU A;  4BBR J;  1WJF A;  2EBI A;  1YX5 A;  1BN5 A;  4WXH A;  4CYC A;  4I0B A;  4BKX A;  2XF7 A;  4B8X A;  5J1R A;  4M71 A;  1I5Z A;  1O4X A;  1IV8 A;  2GA2 A;  5FKN A;  3HHH A;  2V9P A;  3L00 A;  4AWX B;  3J7Y J;  5M5X J;  2FML A;  5F64 A;  1T56 A;  2WC2 A;  4ZH4 F;  1LE8 B;  5ED4 A;  1EF4 A;  1TWG J;  3NWT A;  1B6A A;  4B43 A;  3OYE A;  1JJ8 C;  2W85 A;  2RAE A;  2R7O A;  2KIM A;  2WY8 Q;  3CJQ B;  1WVR A;  4UB6 C;  2YR2 A;  3HJE A;  4U88 A;  2JA5 J;  5M5Y J;  3BQY A;  2PJR B; 
#chains in the Genus database with same CATH homology
 3CCJ I;  2QA4 I;  3CME I;  4UY8 I;  2FOW A;  1VQ9 I;  2QEX I;  3CC2 I;  3CCQ I;  3I56 I;  2NXN B;  3I55 I;  1Y39 A;  2E36 A;  2JQ7 A;  1VQP I;  4V19 K;  3CCM I;  3CC4 I;  2OTJ I;  3PIO F;  2H8W A;  5GAE J;  3CCR I;  1S72 I;  3CCE I;  3CF5 F;  1YI2 I;  3PIP F;  3G71 I;  1YJN I;  1YJW I;  1QA6 A;  3CD6 I;  1YIJ I;  3CC7 I;  2E35 A;  3CMA I;  1VQO I;  3DLL F;  5DM7 F;  4IO9 F;  5DM6 F;  5GAG J;  1VQM I;  5GAD J;  3G4S I;  3CCL I;  1VQL I;  3CCS I;  3CJT B;  2ZJQ F;  2ZJR F;  5GAH J;  1YHQ I;  3CCU I;  2K3F A;  1YIT I;  1FOW A;  1VQ7 I;  1VQK I;  2ZJP F;  4IOC F;  5JVG F;  1VQN I;  1MMS A;  1FOY A;  3G6E I;  2E34 A;  1FOX A;  1YJ9 I;  1VQ5 I;  3J7Y J;  3J7Z I;  1VQ8 I;  1ACI A;  2OTL I;  1HC8 A;  3CCV I;  1VQ4 I;  1VQ6 I;  4IOA F; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...