2OTJI

13-deoxytedanolide bound to the large subunit of haloarcula marismortui
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
70
structure length
70
Chain Sequence
GVPPTAELIKDEAGFETGSGEPQEDFVADLSVDQVKQIAEQKHPDLLSYDLTNAAKEVVGTCTSLGVTIE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title The Structures of Antibiotics Bound to the E Site Region of the 50 S Ribosomal Subunit of Haloarcula marismortui: 13-Deoxytedanolide and Girodazole.
pubmed doi rcsb
molecule tags Ribosome
molecule keywords 23S ribosomal RNA
total genus 13
structure length 70
sequence length 70
ec nomenclature
pdb deposition date 2007-02-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
I PF00298 Ribosomal_L11 Ribosomal protein L11, RNA binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.250 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Ribosomal protein L11, C-terminal domain 2otjI00
3CD6I 1VQ4I 3J7YJ 2NXNB 4IOCF 5GADJ 1VQMI 3CJTB 3CCQI 5JVGF 1YJ9I 1S72I 1YJWI 1VQ7I 1FOWA 2E35A 3CC2I 4IO9F 3G6EI 3CC7I 2FOWA 5DM6F 5GAHJ 1ACIA 1FOXA 3CCLI 3CC4I 1YIJI 1Y39A 1HC8A 2E34A 3CMEI 3CMAI 1YHQI 3CCJI 2JQ7A 3G71I 3CCMI 2H8WA 2ZJRF 3J7ZI 1QA6A 1YI2I 2OTJI 3CCEI 1VQLI 4IOAF 3CCRI 2QA4I 3CF5F 3I56I 5GAEJ 1VQOI 1VQKI 3PIOF 2QEXI 3CCUI 3CCVI 1VQ5I 4UY8I 2K3FA 3DLLF 1VQ6I 5GAGJ 1FOYA 3I55I 2ZJPF 1YITI 1YJNI 3G4SI 3CCSI 1VQ9I 2ZJQF 2E36A 1VQ8I 1VQNI 1VQPI 4V19K 3PIPF 1MMSA 2OTLI 5DM7F
chains in the Genus database with same CATH superfamily
2L7ZA 2F5FA 3QYBA 1WI3A 2KJCA 5GTHC 2LSOA 4W1UA 2ECCA 5J47A 1MMGA 3F8NA 4LIVA 5EGOA 3DBRB 4LJZF 2O9LA 3BCBA 1T0FC 4I0AA 2XV4S 1OKRA 4GYIA 1EKEA 1ZG5A 3ZXSA 4ZZLA 2V9PA 1AKHB 1SFXA 1X2NA 4FT8A 4ZYGA 2IW5A 3OL3A 4M3GA 4BHCA 1FC3A 1GV5A 5H6RA 1H0MA 2EFPA 1RETA 2CV2A 2NXNB 1VQMI 3TDZC 2FSWA 1W5CC 2JSCA 3TMOA 1Y0NA 5F27A 1I3QJ 3SYTA 2ZKZA 2M4KA 5F1JA 4XMYA 3OIOA 2EA4A 3JRIA 1BI3A 4IEJA 2CO5A 4M3FA 4WWCA 2IGOA 3CUQC 4M9XA 4NC6A 2EA2A 3DPLC 3KFWX 4S0HB 3JRAA 1ZN2A 1BN5A 5J4VA 2ZXWH 5ILVA 1J9IA 3OYAA 1VQ8I 2GXGA 2DTZA 2G9WA 2I5UA 3WTWC 3KYCB 2H09A 1SFOJ 5M3MJ 2NVXJ 3T8RA 2F48A 1Z3XA 2DK8A 3CCYA 4EATA 4BH9A 1MJBA 2EPFA 1J09A 3BG7A 2OD5A 2JUCA 4QIWN 2L2OA 5HLGA 2D2WA 4PDKA 1WPKA 1DPUA 2JQ7A 3A01B 4CA0A 1JHFA 1RI7A 3FM3A 3RKWA 4I76A 1U8RA 3LOCA 3ZMUA 4Q47A 1YYVA 4B3AA 3ROUA 4LITA 3CCVI 5L3FA 2P8TA 1U5TB 2WADA 2X6XA 2F5EA 3HSEA 1O57A 2YX4A 4LD5A 4PGHA 3QOPA 5F0FA 5TISC 2PFBA 5GPCA 1W0TA 2WWYA 1BC8C 4XBFA 2VQGA 4KN4X 2ETHA 1GLNA 1FNNA 4PJLA 2IA1A 5EZHA 4BS9A 3WTZA 5E3LA 4B4CA 3GTPJ 2R7DA 2OQRA 2HVRA 4HBLA 4FTHA 2P0WA 1EH7A 1V54H 2UXNA 1WJ5A 2FMYA 1YRNB 2R7QA 3E5QA 3OS0A 3NEUA 4RGXA 1FYMA 4BHPA 3FXOA 2NS7A 2FBIA 4WF2A 5JHFA 2OTLI 1AU7A 3FXQA 4XLNF 1B8IA 3OS2A 1FBSA 3V8LA 3A0BC 5LFAA 3AAFA 4EJUA 3CC7I 2WY7Q 1XX5A 1ZTRA 2DN0A 3SDBA 1U9OA 1FEXA 2GM4A 1YIJI 5E1ZB 2A6TA 4G6QA 4XRMA 2MA3A 1DP3A 2K9MA 1F1ZA 4IX7A 1K78B 1N75A 1S7AA 5EEAA 1S5LC 1UZCA 4MTDA 1XMAA 4L18B 4M3DA 3TGNA 4E7KA 5TGTA 4QSHA 1SMYF 4II2A 4HDUA 2MW8A 1BBYA 3DP7A 1GDTA 3JSPA 4Q4ZF 5C4JJ 2YUSA 1A36A 3MEXA 3KP6A 1EV7A 4BJ5C 5L3GA 5E17F 3HOVJ 5LD2C 2DT7B 3VODA 3LSTA 2QF7A 2H8RA 3E6DA 3RZOJ 2X9DA 4CCNA 4A12A 3SDGA 3DEUA 1V5GA 2X51A 3EUHA 4UUVA 2BVLA 1Z6TA 1KA8A 4A69C 3S1MJ 2WV0A 3W3CA 4YIIA 4OAZA 5D4RA 4XLPF 3BOQA 3DV8A 2G0EA 3VEPA 3LNQA 3FBIB 2ZMEB 1G3TA 3V7RA 3EUHC 3PFIA 3CP8A 3PNTA 2EZLA 3EUKL 2AHQA 2JJ7A 4A3FJ 2UUZA 5EF6A 2X1CA 1FYLA 5HDNA 4AIJA 3BTLA 4U0YA 2CW8A 3BZKA 4BBRJ 1APLC 2DDBA 4HNTA 1X2MA 3MCZA 1YJNI 2GBYA 3JRGA 1TQMA 2BV6A 1I6HJ 5HS7A 1MMSA 1FP2A 4LMYA 1OMIA 2K27A 2CYYA 2HGCA 3M8JA 5EEHA 4DW6A 2A05A 3F8CA 5FKMA 1KU2A 4ABZA 4V2GA 4P9FA 2PQ8A 4HW0A 3SZGA 1SANA 2KPMA 3H36A 4YEJA 1UHSA 2MD0A 4LB6B 5L3DA 2PJRB 3ISPA 1YQAA 5GPAA 1KYWA 1P4WA 1ZGWA 2I10A 4HX4A 3BWGA 2R5YB 2PN6A 4C2MJ 3D1NI 2M1BA 3CJRB 3DEEA 4YIRX 5DD4A 3GZ6A 4AVZA 1WJAA 1WVRA 1TW2A 2C6YA 1YJ9I 1B59A 1IN7A 4G94A 3E6BA 3BJOA 1XS9A 3KIOA 4F3QA 4HLYA 1VTNC 1ZR4A 1G3WA 3H35A 1DP7P 3L9FA 3QOEA 4OOIA 1W36D 2LY2A 1RRJA 3E5UA 3I54A 2LR8A 2M34A 3QPHA 1G3YA 3QYFA 2R92J 5HDKA 2Q1ZB 4FE7A 4K2EA 2O8KA 4MGRA 5JHUA 3O8GA 4LB5A 2FA5A 4V19K 3GTGJ 2NOJB 3H1CA 2VJIA 3JREA 5K7ZA 3RYRA 2OUMA 2DMPA 4IRHA 2HZDA 2ICWG 4AIDA 2KIQA 4Y13A 3DPUA 2DMUA 2ZNZA 3OS1A 2ZMEA 1IG7A 2VOOA 1K83J 3FXRA 3OYLA 2EJRA 1XGSA 3ZQLA 2DAOA 5J1YA 4HV5A 4X0GA 2L9NA 3JTHA 3F72A 4RGRA 2KZVA 3K70D 1YOVB 1I3AA 2FJ1A 1R9TJ 2P5KA 2DFEA 4MLOA 4UB6C 4CYCB 3RKYA 1MMDA 1YJWI 2DBBA 3RQIA 2YU9J 3KZZA 4B09A 1ACIA 4MTEA 1X1PA 2DK5A 3MKLA 1B9NA 3HRTA 3MKYB 2QYOA 2QWWA 2FBHA 4BQOA 3Q9VA 2PLYA 1XN7A 1SMTA 4G6TB 2L5QA 3OSFA 1IRXA 1TWHJ 2ELKA 4IOCF 4D1QA 1USTA 1D1AA 1QPIA 2HYGD 3FMRA 2CV0A 4GRIA 2WAEA 4OIPF 1R4MB 4M3EA 5DM6F 4C3HJ 3VYSB 3X2QH 1WJCA 3K4JA 4XNFA 2EFQA 3R6SA 1QNTA 1Z67A 2E5ZA 4ENKA 4BJ6C 3RCOA 2MABA 1LPQA 4OAYA 1JT6A 3VYRB 4UUSA 5D8KB 3L1PA 4GYGA 1JXSA 3RPUA 4E7IA 2JPBA 3I55I 1YW8A 4KIGA 1LDJA 3S1RJ 1Y39A 2V7FA 2EIKH 2W25A 1CF7A 3LQQA 1XB4A 1QVUA 4IO9F 3SJMA 3VYUB 1JJ6C 2L0KA 3BJ6A 2HYJA 3H9QA 4M9SA 1B1BA 3LMMA 3RQ4A 2E2JJ 4KIBA 2QLZA 1AWCA 4I02A 3HL2A 4DNCA 1RKTA 1H89C 3H3ZA 3E5XA 1X4PA 1BM9A 4G9YA 4DBQA 5CVJA 3E1SA 4KUMA 5AIQA 2DFHA 3WU2C 1L3LA 4A3JJ 2HU9A 1RNLA 5D5UB 1LE8B 1VFCA 3IWZA 5CQGA 4ZZDA 2YU3A 1OISA 1UG2A 3DEWA 3OYDA 3CF2A 4G7ZF 5KK1A 2R7SA 5D6EA 2QZ8A 3L09A 3FKIJ 4AVPA 2CWEA 3EDPA 4O5VA 1XSXA 2XAHA 4RB2C 2M8EA 2O8XA 1JT0A 1X1DA 3K1PA 3PFYA 4QPOA 4EEFG 3KP7A 2VE9A 3S2DJ 5EZGA 2VLAA 3S2HJ 2EB7A 4U87A 2RDPA 5LGTA 1A31A 3CDHA 3OOUA 2RV8A 2XPVA 4H4KC 1JKPC 1UAAA 4A6EA 3I53A 3W6VA 2PMZA 3Q0VA 5CYVA 3S1NJ 3WE3A 2RGVA 1F5TA 4Y4RA 1V4RA 3M07A 1P9QC 1EH8A 3I64A 1YW7A 4CSWA 2ZJRF 1W0UA 2O5RA 2R3SA 4AYBA 4L0ZB 3HJEA 4IHWA 2PBIA 1AOYA 4FHTA 2UV1A 1OYYA 4HQMA 4Y15A 2EFWA 1T6SA 4RS8A 2PMUA 3KYDB 3PQKA 1R6RA 3ERMA 3K9TA 2E1MB 1R5HA 5EJCA 5FKKA 3ZQ7A 4XN0A 2EBIA 2VQHA 2JWTA 3GF2A 5DYMA 3ZMDA 1Z0XA 3GZ5A 5HVQC 3OWTA 1GHCA 3E6CC 4B44A 1Y1WJ 2KT0A 1S6LA 3GEZA 2CQ7A 3C2HA 5F0HA 1R5ID 2CW7A 2V4JC 1YHQI 4ZTJA 2R5ZA 1XD7A 5E1XA 2A68F 3GTQJ 3K2ZA 1NG7A 3PL8A 2IJLA 4JYKA 5E8IA 4QLCU 3K69A 2FUG2 2MYSA 2OBPA 3HEFA 3LFKA 2CRGA 4UV9A 3COAC 2ZJQF 1JHHA 1BC7C 4PJNA 1KZHA 3FX3A 1UHWA 2F4OB 2DJIA 5IP6A 3OIPA 4RGUA 2XKPA 2W85A 1R36A 4NQWA 1T33A 2E7WA 5E8GA 5HOOA 3OOPA 2HFHA 1ZARA 2HQAA 5BNGA 3UKGA 1ETXA 4IHVA 2QKMB 4OIRF 3WGIA 2EFNA 3AG1H 2XPWA 2AS5F 2XGEA 2X1DA 1RC9A 2LY9A 5CVUA 4CYDA 3KETA 3BG5A 1QGPA 4XKWA 1XCBA 2FOKA 4PZJA 2K3FA 3GLXA 2NS0A 1SD5A 3G4SI 4WXDA 5F1RA 5J6XA 1EF4A 1QU3A 3TO6A 1YLFA 2I8DA 3BR3A 4N0BA 2GXBA 2CFOA 2GIVA 3ONQA 2VJ4A 2HZTA 2VOPA 4AD9A 3VSLA 1S7OA 1HKQA 1IF1A 5FO5A 1O7LA 3LSJA 4FX0A 3F3XA 1XMKA 4G7OF 2WB1A 3BTCA 1TNTA 4UUSB 1GVDA 2HR3A 5F6FA 3S3MA 2OF7A 3PM1A 2GXAA 2E60A 4I09A 5LEKA 4G7HF 1JUPA 1W5SA 4Q48A 2ACJA 1OCZH 3CO6C 1F43A 3K7AJ 1H9TA 3Q3SA 4CHUA 3MMYB 2IXSA 4HNUA 2EV0A 4HRIA 1MBFA 4DOZA 5JR3A 2ME6A 2QVOA 1P6RA 2HPMA 1HC8A 1ENHA 4BQQA 1FX7A 4C9YA 4XM3A 2CU7A 2VT2A 4YFKF 4DQ2A 1K4TA 3ZMZA 3OYGA 3DKYA 1W7PD 2F4IA 1I6XA 2ID3A 4HNVA 1O3RA 4L9JA 1ZYRF 2DI3A 2DQLA 2LP0A 3Q9SA 2FRHA 2HDWA 1X1BA 1GUUA 2DCEA 2M8GX 1X4OA 5EYRA 5L3BA 4A3DJ 3BJAA 3PSFA 3AKZA 1DUXC 3CMEI 2LMDA 2XDVA 2CUFA 1UJ8A 1ZELA 2LY1A 3G71I 2MC4A 3KX2A 5CLSA 3W6JB 4XKCA 4XRFA 4YELA 3T8TA 3L2CA 3V7CA 1OCRH 3J7AY 2ESNA 5CPRB 1IN8A 4ZJZA 1R00A 5LLQA 1ETYA 1N25A 1D1BA 3V8KA 3HUGB 3ZN1A 2DA3A 3BPVA 3BP8A 3CP2A 1FTTA 2IVMA 3MAJA 2EH3A 2X4HA 3WHCA 3VWBA 2ME0A 4KMUX 1PP7U 1IUFA 2DA4A 4Y17A 2IS1A 1FMWA 2F5VA 2NVUB 4BU2A 2KFDA 3OSGA 3QPLA 2EIMH 2OC6A 3HXLA 4Y7NJ 3WTXC 1E3HA 2H6BA 3RSNA 3VYTB 3JW4A 5A2QK 4J00A 2JA6J 4XLHA 2DO7A 1PDNC 3CZ6A 5GP9A 4BEHB 4ON0A 1TQIA 4E6KG 1HDPA 2PEXA 2AQFA 2VJ5A 1REPC 5KHDA 1RIOH 4UVCA 2A69F 2R0QC 4XQFA 4MHGA 4L9NA 4OU0A 3BCAA 1MNEA 1DPRA 1OCOH 4BKXA 1D0XA 1YO5C 1EJ9A 4X1EA 3HSRA 3L2WA 4CO8A 5IOZA 2EZKA 2OQGA 1BR1A 4F7ZA 1U8BA 2LKXA 4F92B 1R7JA 1Y6IA 2BYVE 1R1TA 3DKWA 3K1MA 2VBYA 2VL8A 4JX4A 4MQVA 2BW3B 5ICEA 2K85A 3ZMTA 3S17J 2RQPA 1MJAA 3UR3C 1G2HA 1XGMA 1W5TA 2RNGA 3ZQHA 3HOTA 1XTAA 4PJJA 5GAHJ 3FIWA 3QAHA 3EYYA 1Y0UA 2B9SA 1GVJA 1X1CA 4B43A 5C44J 3S3OA 2E19A 4RMNA 1H88C 4EM2A 4NC8A 3I56I 2R5YA 4Y52J 4MIMA 1B72A 2LTPA 3GCMA 4I7HA 2FXAA 5B1AH 1LQ1A 4BXUA 3OYMA 4C2TA 1H9GA 1IRGA 2MLGA 3OIQA 2ZXHA 2VKVA 2KHMA 3WODF 1U5TC 1FOKA 1PJRA 4I98B 4Z6YA 3IRRA 5CKTA 3FF5A 4IRIA 3E7LA 4H0EA 2QGUA 2M4GA 4BQAA 4ASNA 2W4SA 3W6KB 3AG2H 3JR9A 2IS6A 3G1MA 1HQCA 5B1BH 1U3EM 3CCRI 2XIGA 3EETA 3F8BA 2RAEA 2Z2SB 2HWVA 1HCRA 3ZMSA 1IZ1A 2VXDA 3PSIA 3WG7H 2X6YA 1YTYA 1PUFB 1D5YA 3O8HA 1FBUA 3FHNA 3BTIA 5EDNA 4M6VA 1Y8QB 2WAQA 5LHIA 1BW5A 2NVTJ 1X3WB 4HLXA 2MLKA 2M0MA 3GMEA 2H6CA 4LG3A 2CJJA 2CS3A 4N4OB 5FKOA 3ZOBA 1TZLA 3HTSB 4LG0A 1HW1A 1WFXA 3GFIA 3WTTC 3V4GA 3DWLE 4ANJA 4C3JJ 3M9AA 4F91B 2M87A 5D5WB 1PUEE 3AG4H 3HGYA 4GXOA 4NC7A 4ESJA 2BZTA 1WH5A 1R49A 5E18F 3PUBA 4EMSA 2J5OA 3ZQQA 2OCEA 2A07F 3TQNA 5D5VB 5JVGF 3HGGA 1B4AA 2DODA 3V42A 1XPXA 4A3BJ 3WTYC 1HA8A 1SVOA 5HDGA 1ONVA 1I50J 3BR1A 2L7FP 3TO7A 2TCTA 4FX4A 4G8XA 4FISA 4FE4A 1R1VA 3IRQA 1OQYA 5E3NA 2HKXA 4MO7A 5FD5A 1UELB 3K4KA 4CICA 2JA8J 4BQNA 1Y56A 3I4PA 1OFCX 3LSMA 5FRNA 2MG4A 1S3JA 2V9VA 1HBXG 1HSTA 3D0SA 1FOYA 3UNGC 1MMAA 4RDUA 4ZTFA 1MDMA 2DA6A 2OZ6A 2BVMA 1ZR2A 2RNJA 1VQ4I 2GIZA 1G8XA 3RKQA 3WGHA 3P9CA 3ECOA 2VN2A 1BW6A 1FPQA 2L3DA 2MFZA 1LNWA 2V9KA 2DDAA 2R7WA 4HDVA 4M9ZA 1JE8A 4YRVA 1W36C 5EGOB 3J80Z 2EIJH 3MFKA 3SEQA 1TL8A 1MBGA 2DU9A 4NHJA 3LSHA 1X3UA 4XKBA 3IV5A 1ODDA 1YRNA 4I0BA 2QSHX 1FWZA 4RM2A 4DZJA 2CV1A 4XONA 3H0DA 3L2QA 2O6GE 1YS6A 3M1EA 1D5VA 3H5RA 2VASA 3K4BA 3DF8A 1MNMC 3TO9A 4EJTA 2A6EF 5BMZA 4AUXA 3FXUA 1U0JA 3C1DA 2NRAC 2V6EA 3FDYA 2Y48A 3G2BA 2L54A 2XASA 5KCMA 1UB9A 1FZPB 4AYBN 4HOBA 1RR7A 4D5CA 2HI3A 1L0OC 2VKHA 2OTJI 4AIHA 2HS5A 3HRSA 2L7KA 2L7MP 3DTIA 3QYEA 1BR2A 5GAGJ 3EQLF 2MH9A 2XPUA 3BC8A 5JVTA 3FHZA 2MGQA 1TTYA 3BZCA 2BW3A 3W2WA 3TL4X 2Z1DA 3ZCOA 1JI8A 3LA2A 5IYCJ 2COBA 4L5IA 4DGWB 4DJAA 2HOAA 2WY8Q 1LE8A 2IT0A 2XAJA 2BHZA 2WAFA 4LLLA 2Y0SN 1AKHA 3IH2A 2QA4I 3RTRA 2IA2A 3ABTA 4PGGA 3CCUI 5DS9A 1IN5A 4BDZA 2CG4A 2VT3A 1QO0D 2XSJC 3Q0UA 3H3VK 1BJZA 1V5EA 4DIQA 2KIUA 2M30A 3L2UA 4XSXF 3ECHA 1BIBA 4EGYA 3CUOA 1OCPA 2VC0A 1Y8RB 3PUFA 4CGZA 2ZJ2A 3NAUA 2ZMEC 1P7JA 2ZSIB 2D5VA 4D9JA 4A3GJ 2HDDA 2M0CA 3PO3J 4ENJA 2XF7A 4A0ZA 4UVAA 5HLIA 4G12A 2HEOA 1QZEA 2JVHA 2DFIA 3R0AA 3G3ZA 3WTUC 1I27A 1ERDA 1ZGAA 2BXYA 3HKZN 3L2VA 4LFUA 3LA3A 4HF0A 1XGOA 2X48A 4A2UA 4A3CJ 2V1DA 1P92A 1KQ0A 3TW7A 2DOEA 2W1OA 3PNYA 3C18A 5M5WJ 3VSKA 3OR1C 4BE2A 4HSRA 4RM3A 4P5OA 1HOMA 3CDIA 3DBLB 1A04A 1O3SA 2ECBA 2R7VA 3GYHX 4KNYA 3BR0A 4WCGA 2NAZA 2XB0X 5D6FA 4BY7J 1SFKA 2KIFA 3AL0B 2HPIA 2JVGA 3DLAA 1K6YA 3K70C 3K1NA 1ZG3A 2HOEA 2JK3A 2X85A 3ASNH 3OYEA 2ZFWA 5ILSA 5EG0A 1P4AA 3CJTB 4HF1A 1T08B 3J7AO 1IV8A 1Y1VJ 1MH4A 3I59B 4BXFA 5K1YA 3REOA 1XSDA 2LRDA 1S7EA 2O0YA 1TWFJ 2GOXB 1U6GA 2X6WA 3LSPA 2X6OA 3R0JA 3TP3A 2OV7A 4B3XA 4I99C 4WXHA 2CH0A 2HTJA 2FMLA 5ED4A 4A3LJ 5H20A 3W2AA 3GW2A 5EEGA 3O2PE 2EWNA 5JI6A 1JGSA 3KZYA 3ULQB 2V26A 1TP4A 3P9KA 1HSJA 2JTVA 4U0VA 2JZYA 4AIKA 3L00A 3RPQA 2DYRH 4JX5A 1Z3YA 2W48A 1SD7A 3TW6A 1U9NA 1EA3A 3C7JA 2FNPA 2WB1N 3CCEI 1F9NA 1FSHA 5FB2A 1F36A 3C2BA 4RB3C 4MNUA 2V1UA 2QEXI 2K9QA 5IT9Z 2VQCA 3OV8A 1G59A 4HX8A 1BI0A 4IQJA 3GFMA 2HXOA 2XRLA 1PYVA 4O6JA 2IS2A 1IRZA 4RB0A 4IQ4A 4RAYA 5TRDA 4WXCA 1PVEA 5J4YA 1T98A 4BDYA 5E20A 2H1KA 2P5VA 4RAFA 4P96A 2DJNA 4DYCA 3BZ6A 4NNJA 1OYIA 2VQLA 1RZ4A 1IDYA 2CQKA 3CD6I 4B8XA 2PG4A 2ZFUA 4GDFA 1J7KA 2M7AA 3AFHA 3NWSA 4M72A 3DQVC 3BROA 2CUZA 5FJ8J 5CQEA 1TWGJ 3BTJA 1MIJA 1MMNA 3B6AA 5E1WA 4EM0B 4KN7X 5DEQA 3HOSA 5DCMB 3F6OA 1MD0A 3HBLA 5HLTA 2NVYJ 2KRHA 4JP0A 2FX0A 2VXZA 5FD6A 1AA7A 2QENA 3WU0A 5L3EA 2R7OA 1IO2A 3LFUA 1YG2A 1SD4A 2HVQA 3JAMZ 5FLVA 4I2OA 1XC5A 1WJFA 1JUMA 2E71A 3RI4A 1SC7A 1PUFA 4XLFA 3HB9A 2YR2A 2UZKA 1XCVA 3D5RC 2PMHA 4D7MA 3SHFA 1ETKA 1V55H 1ZK8A 3NQOA 5JLWA 1TT0A 3D5SC 1J0RA 1SAUA 1LUJB 4IZZA 2BOLA 3FISA 3BY6A 3F8MA 4KT6A 4M71A 1IC8A 4IXAA 1FMVA 2ZC2A 4XK4A 1MJ9A 2QSFX 5LEJA 4JX6A 3OYFA 2L4AA 2R7UA 2K5CA 1K78A 1OLTA 3LSIA 3NRVA 3ZGKA 3M1CA 4YFXF 2H1LA 3OYBA 5FFZA 4GFBA 3MZHA 1TT5B 1R23A 1IUYA 3FXMA 2CMPA 1W1WE 2HQNA 4LGWA 2ELHA 4RLFA 2CFXA 3JCUC 4BUPA 4S04A 2E36A 3BQYA 3FMQA 4N9IA 3GTOJ 3CMYA 1RR8C 2DTRA 4OMYA 1E3OC 2WBMA 3LA7A 4XL9A 1BOBA 2NOGA 1FJLA 3OYCA 4HAMA 2ZO4A 5HS9A 2DPDA 5K7FA 1YFHA 1V5FA 5DDGA 2P7VB 4PJMA 3KYLA 1OR7C 5FLMJ 3GFLA 3VOEA 4HPQA 5B5EC 3BR5A 1YI2I 2QUFA 1JKQC 3R61A 1Z05A 2O7OA 2Q8KA 2QCOA 1ZREA 1SVLA 2ZJPF 1VQ9I 5F64A 1BIAA 4JOMA 2E1OA 4C3IJ 1ZG1A 2PJPA 2Y31A 2DW4A 1QRYA 2HOTA 1LDKB 1IJWC 3ZRGA 4ITVA 5LGNA 5IT3A 3DCFA 2DMNA 3CCLI 3OYHA 1D0YA 3HDDA 2LF7A 4TV7A 5LRRA 3LQRA 4UVBA 2Y0MA 2Z33A 3ZQCA 1YIOA 2DLLA 1MZBA 1QHHD 2TRTA 5AIPA 5ERIA 4IHXA 2IPQX 2J5PA 4E7JA 1HKSA 1MGTA 1R5GA 3H5NA 4BE0A 2QSGX 3WU1B 4OIOF 1MDMB 2P6TA 3S2WA 2JA7J 4DBRA 1TWCJ 3SZPA 2EILH 4ESFA 4BBSJ 2JRTA 3HSFA 2V6CA 3RJPA 2MSYA 3IAM2 1J2XA 2HXIA 4LIUA 3IKTA 1SEUA 1ZRFA 1ON1A 4ENNA 2JA5J 2R5ZB 4WK8F 5IYDJ 4BNCA 3FXJA 4RA2A 3DTEA 2DA2A 3CO7C 3ELKA 3ML6A 4ETSA 5L3CA 3DLLF 2XVCA 4LK0F 2EK5A 1BOAA 4RLQA 4XRSG 4BYYA 3M7GA 1KU9A 1OCTC 1R1UA 2PI0A 4J01A 5F04A 2F5CA 5IP9J 4HQEA 1GXPA 1WJDA 2VE8A 2VUMJ 4PUSA 4PFPA 1TWAJ 3RPUD 3HM5A 3KEYA 3JRBA 2VI6A 4ESBA 4L9VA 1HLVA 2XROA 4KIFA 3M3YJ 1FT9A 3HOZJ 2IEKA 2DOFA 1MNDA 3U1KA 1LKXA 3L2RA 1IN6A 1BJAA 4E4HA 4CZZA 4CYCA 2E2HJ 2K4BA 5IYBJ 1B8IB 3RZDJ 5IPAA 1WQ2A 2X1EA 1VQ7I 3CC2I 1N78A 3CJNA 5DUKA 3B02A 3QRFF 1B9MA 3U1DA 5LHHA 3MD2A 2P7CB 4HG2A 4XN3A 2LFBA 1ETQA 3E3VA 4BJTA 2XAGA 1ZKGA 1NTCA 1JJ8C 2K02A 3OYNA 2W82A 4C30A 3W2VA 3S3NA 3JRHA 1SFEA 1ULYA 3FK6A 2H27A 1LB2A 1VQ5I 2DT5A 4D0PA 1S8NA 1Z6RA 1QVTA 2R7RA 3NARA 4FQGA 1WHUA 2VPLA 2VB6A 3DBHB 5FROA 4RBOA 1D8JA 6PAXA 3GUDA 1VI0A 2XB5A 1FOXA 1LVAA 1RPWA 9ANTA 1T56A 3MVPA 3KEOA 2LD5A 1K61A 5F0CA 1YX5A 2W00A 1WSUA 1ZGJA 2K9NA 2VPRA 3A1YA 1QA6A 4XR6A 3ERED 3A2KA 5HS8A 4MQ9F 1U78A 3RDIA 3HPHA 4XIDA 1NK3P 1EH6A 2DA7A 3CMMA 1DGRM 1T95A 1VNDA 1MKMA 5DCFA 4P1WA 4CH7A 1GV2A 2K40A 4E7LA 5BPDA 5A2QZ 2KQRA 4GCVA 3GTJJ 4NDLA 4QTRA 3GTLJ 1JGGA 5FLXZ 3KZIC 4PSWA 5ICCA 1K4SA 2L9SA 4XRSA 3GBGA 1Z7UA 1ITYA 1J5YA 4CZCA 5HODA 2LBFB 1ZQ3P 4HF2A 4R8HA 3ESWB 5K7HA 2NNNA 2WA0A 3WHBA 3F23A 4E7HA 3FBNB 1LJ9A 1FYKA 4EVIA 2Q0OA 2E35A 2LKSA 2A5YB 4WX9A 4XLAA 1Z91A 1YE9A 2R7ZJ 2GOMA 4EJOA 1ETOA 2L9RA 4M74A 5D5XB 1R22A 1QZZA 2HYFA 1NHAA 2OPTA 4KISA 3BG9A 4A0YA 2DQRA 1WZ2A 1USSA 5IT9K 1KONA 5CVVA 1JTXA 2KRCA 3TP0A 4IVNA 5ILUA 3F8FA 2QQ9A 2Z9OA 2LOOA 3CLQA 2ZCWA 2JPCA 4L5JA 4A5MA 2K9LA 3SFZA 4YG2F 3QWLA 1NH3A 1HKTA 5DUIA 1DGWY 1I1GA 1H8AC 1CF7B 3QU3A 2NVQJ 2Z16A 2GAUA 4FETA 2K4JA 1QBJA 2XHKA 2RN7A 3A0HC 4PJ0C 2ISYA 2NYXA 5K5RA 2W24A 2VKEA 4XLEA 3JRFA 2IGMA 1YW9A 2Y9YA 3KLNA 1STZA 1Z9CA 3JRDA 2M45A 5B66C 2EFOA 1ZHFA 2L02A 3AL0C 1J59A 4Y3OA 2STWA 2K9SA 2HVSA 2RQQA 3M8FA 3V7SA 1VQPI 4KMFA 5M5YJ 2IRFG 4IHYA 3GO5A 4NQWB 3G6EI 3F9KA 3S16J 1TW3A 3H9JA 3D5LA 4YFNF 4HV6A 4HZFA 1UCRA 4KDPA 4HX7A 1R4NB 3JTGA 2YS9A 5LGUA 1FP1D 4ZYHA 4PSXA 4II3A 2LKPA 3P5JA 3ZR8X 2B7EA 2R7FA 5LHGA 1A6QA 1MBHA 3K4NA 4U7DA 4A93J 4DYRA 2WTEA 1A35A 4R79A 1YITI 1HXDA 3FM5A 2LYCA 5E3OA 1TBXA 3I58A 3EUAA 2HQRA 2L01A 3TOBA 3CLOA 3RYPA 2Y2ZA 2CUEA 1S29A 1W7PB 3OL4A 4U88A 3I5UA 3N4MA 2DA5A 2EV5A 2OZUA 2KISA 2VONA 2XUBA 2GLOA 1KQ8A 3ZPLA 3MKZA 4C2UA 3S32A 1A6IA 5D8LB 4KICA 1SD6A 1LEBA 1KGSA 4MFEA 3M4OJ 2BY1A 1NG6A 2XAUA 3K4MA 3S93A 2LBFA 1Z7LA 4XKVA 1VQKI 1OPCA 2XRNA 4QPQA 4RAGA 4AM3A 3ZMVA 4F55A 3S8PA 4M6XA 3DU6A 3IL2A 4BHBA 4BXXJ 3IUOA 3ZP5A 2VBWA 1LEAA 3I3LA 3TOAA 1RUOA 5J1RA 1BL0A 2CQNA 2KDZA 1TLHB 3ABLH 4LLGF 2RREA 3F22A 4F52A 2R93J 4UXNA 1DQUA 2H94A 1YX3A 3JRCA 2M2EA 2IAIA 1O3TA 4A3EJ 1RUNA 2ZXJA 1KQ9A 4XOTA 2G7HA 2DPUA 1BR4A 2DMTA 3BQZA 3GVAA 5BPIA 2X0LA 5FRMA 2JA2A 2NS8A 2OAZA 1BA5A 1X1AA 3CCJI 1G6NA 1IGNA 1KYZA 2FU4A 2MH2A 3VFZA 4OIQF 2N8GA 1T8IA 1LFPA 2FQ3A 1E3PA 1ZLJA 4KA4A 4S05A 3PIPF 3LL7A 5IOYA 1B6AA 1UG0A 5DM7F 1UHMA 1QZYA 1POGA 4F93B 5H6QA 2ZB9A 2WV1A 3CDLA 4O3MA 1O4XA 3MQ0A 3CQZJ 3A4CA 5IY5H 1I39A 1BI2A 1K79A 2V1XA 4LLNA 2GZWA 1D3YA 1RESA 1HW2A 2FNAA 2F2EA 2FEZA 2XF5A 3H92A 3OY9A 3F0CA 3FWEA 4CDGA 5FKNA 2OA4A 3FK7A 4A3KJ 5ICFA 2IA0A 2O03A 2A6HF 5J1UA 2MC3A 1D1CA 1XDUA 3DTKA 3VDXA 5KAFC 4NBQA 5TJJA 2E2IJ 3HOUJ 3P9IA 3OR2C 4DZPA 2HKOA 3FZVA 1T39A 1V3FA 1C0WA 4ZYEA 4LG0B 1FTZA 5KVRA 3KE2A 1RKWA 5FKLA 2DFFA 4ZH4F 3KEQA 2XGCA 3KPHA 3JAMK 2E1MC 3QU6A 1E2XA 4YIFA 4M6YA 2CSOA 4AU7A 4EM1A 2F5DA 3HYIA 1VZ0A 2JMWA 2OCCH 3T0YA 1QHGA 2BEOA 1MBEA 3V8JA 3BT9A 3KP3A 3K6GA 2M3AA 2LH9A 2DOAA 4OWRB 4V2FA 2EV6A 1YS7A 2VC1A 3BR2A 1ORKA 2DXIA 3CTAA 4JBAA 1IXSB 3B73A 3GXOA 2XKOA 4U7BA 1X3ZB 3QODA 1K6OA 3CMAI 2LDUA 3S15J 3KP2A 2AXTC 3GWZA 4B48A 1WH7A 4BY1J 1ZLKA 5CVRA 4OMZA 1VQLI 4GO1A 1MBKA 5J8FA 3IKVA 3E97A 2L4MA 2Y69H 3ZN0A 3TEDA 1TNSA 2YSRA 2KZGA 3DXJF 3QPTA 1ZH5A 3EYIA 3MZ8A 1P4XA 4AWXB 2Y9ZA 2FOWA 2RC4A 1T2KA 3O6BB 3OMYA 3IWFA 5HNHA 2EZHA 1FSEA 2LVSA 5LRSA 3PNVA 2OU2A 2KIMA 3SFIA 1X58A 3SZTA 3I4MJ 1WRJA 2E5NA 3PO2J 3I9V2 1WJEA 3E0JB 3IH3A 2GA1A 2V1NA 5FGMA 4AC0A 2ELJA 3PQJA 2QQ8A 4IRGA 3N97A 4EGZA 3KP5A 1WWXA 5CVIA 1JUSA 2RKHA 3SEZA 2KKOA 2LC2A 5C3EJ 3HOYJ 2BY2A 2LF8A 2VJJA 4N4NB 5DV5A 2H8WA 2KMUA 4XOPA 4RB1A 1HF0A 2W57A 2Z5UA 2VKDA 3VB2A 4ZC3A 5GAEJ 4BAYA 2QM3A 2KRFA 4LK1F 5C4XJ 3ABMH 1FLIA 3CUQB 3K10A 1X19A 1FIPA 3RKXA 4E7ZA 3J7YJ 3N05A 3ZQFA 5FLXK 2AXLA 3WG9A 4A3MJ 2ZBKA 3DPTA 3GFJA 3BG6A 2ISZA 2DT6A 1QPMA 4MFDA 2OJED 2WC2A 1R71A 2LREA 2E34A 2QBYA 1XGNA 1J75A 4BE1A 2FQ4A 3R60A 2GQQA 2UXXA 5KNLA 3CCMI 4PK4A 1O7FA 1WKMA 3DKXA 3GTMJ 2COMA 3C3WA 3FXLA 1UFMA 4PFOA 3HRMA 3MN2A 3K2AA 4R1HA 3LAJA 1G3SA 1S9HA 2FD5A 2B63J 5H2FC 4IKFA 3H3UA 2F6CA 2JUGA 1IRFA 3HHHA 1LDDA 1BI1A 4CUGA 4FASD 1XDSA 2P5LC 1IDZA 2AQEA 1HW5A 3KCCA 1Z77A 4HA8A 3MKWB 3JSOA 3S14J 2LK2A 3E6MA 5DCMA 4EQQA 1LFBA 1Z1DA 2DA1A 3DU5A 4G6DA 1OCCH 3WGGA 1M1EB 3GZNB 3WE2A 5DTDA 1I5ZA 4IOAF 2HOSA 5J3LA 4BGDA 5K5QA 2XSDC 1IV6A 3IC7A 4L0YB 1KU3A 2Y0SA 5JFRA 4CCJA 3IAS2 5F08A 1PP8F 1O3QA 4ZYDA 4M73A 3HOWJ 4U0WA 2CGPA 2VBZA 4I01A 4KFCA 3LSGA 3I0TA 3CC4I 4XICA 5BQTA 2LLKA 3K0LA 4FCYA 1R58A 1XG1A 2K86A 3QPSA 4QWQA 3QP5A 4N9HA 1OR7A 3RIRA 2A3SA 2ID6A 4MEXF 2RVCA 1ZRCA 1B72B 2NNYA 1GT0C 3F6VA 4UB8C 2Y30A 3GX4X 3U21A 4UUTA 1Q1VA 1MSFC 4P55A 5EG0B 5M3FJ 4ZDLA 3FMSA 5GADJ 3T5XA 1FOWA 1XSVA 2CW0F 3I71A 3HKZA 1HDDC 4CCLA 1Q1HA 5HNFA 2R4GA 3SQNA 2A5WA 2PX9A 3HRUA 2PJRA 3IH4A 1CQTA 2XF6A 1ZAOA 4IF4A 2FBKA 2IS4A 4DYQA 3PIOF 4PCQA 4BACA 3TBIA 1WI9A 2KDOA 3CCSI 1LVKA 2BGCA 3J81K 2JT1A 4ZDOA 2Z3YA 3A03A 2BXZA 3CCQI 2YX7A 3LSRA 1SFUA 4XORA 2ADUA 4M3BA 2LG4A 2ZXIA 1P7IA 2KP6A 3HHGA 1ON2A 3CESA 4W97A 4Y33A 5CJ9A 5B3SH 3S1QJ 2A61A 4XLCA 2XAQA 1E17A 3G1LA 4IL6C 1D8KA 2GWRA 3F21A 1JKOC 3KLOA 5GTIC 2QBYB 3TKYA 2DYSH 5ICGA 2R7XA 3C2GA 5J8CA 2VODA 2M7BA 3J7ZI 2L9VA 3EPZA 2ESHA 3FKJA 4HYEA 1KU7A 3ABKH 3GTKJ 1JTYA 2QKLB 3R4KA 4D5FA 1T0FA 1W4MA 1D0ZA 4BEHA 2W84A 2Q2EB 5D4SA 3U9GA 4A5NA 3QP6A 4Q5SF 4EJVA 1N77A 4KJZA 1XMXA 1T38A 4D7NA 1AHDP 3ZQGA 3HOXJ 1E0EA 1WCMJ 1IW7F 2MD5A 2E1NA 3K4CA 2HQ5A 5HLHA 2LNBA 2V79A 4JK1X 3KP4A 4IJAA 2XGXA 2YPRA 2R7TA 4UHTA 4NUBA 2FE3A 3FXKA 3QQAA 1IN4A 4HEA2 2M5WA 3WTVC 5IP7J 5BOXA 1LFUP 2O3FA 1P2FA 3L7WA 5E79C 3CUQA 2Q2EA 3LAPA 4I6ZA 1S72I 2W7NA 3BLYA 2GA2A 1MBJA 4IPAA 2P81A 2IGKA 1IAWA 2BBYA 2BY0A 4MEYF 3BDDA 4A3IJ 3HC7A 2FF4A 3J81Z 3Q5FA 1IXCA 2WAQN 5J40A 5M5XJ 3HG9A 2JSPA 2Y75A 5AONA 1IXRC 2KJBA 2XGDA 4X6AJ 1WJBA 3TDUC 1G4DA 4IHTA 1JKRC 1FBQA 3DFGA 4A6DA 3CJQB 3HIFA 4UY8I 3ABUA 2DMQA 2P6SA 2K3PA 4OINF 3BPXA 4KT5C 3PJRA 2ZSHB 4BL0B 1K7AA 3K4LA 1UMQA 2BHYA 5FFXA 4CXFA 4RAZA 3AG3H 4CCOA 5BS6A 1NK2P 1MW7A 1Z21A 1TQPA 2HNHA 2D1HA 1ETWA 4GGGA 1FY7A 2F4MB 2TDXA 2O61A 4EJWA 2EZIA 2QQAA 3Q0WA 2XAFA 4RGSA 2BE5F 1MSEC 1QQIA 2QQBA 4XSZF 3HPGA 2IGNA 1OYWA 2JN6A 2EQRA 3OYIA 4P9UA 2UWMA 2Z99A 2HTSA 3O3KA 5JLXA 1TC3C 4NB5A 1VQ6I 2E7XA 2D1VA 1ETVA 3H9GA 3HZJA 1VQNI 1U5TA 3BR6A 2CUJA 4EV0A 3H5AA 3HTUA 3IHUA 3LSKA 4A0XA 3A02A 1GXQA 2BY3A 2CQQA 3MZYA 4LOCA 2B0LA 2CQXA 4L5EA 2VBXA 2E1CA 3I4NJ 3OYKA 2STTA 1WGXA 2VIXA 3SXYA 2KL4A 3H0GJ 3GLLA 4JQFA 3ZQIA 2M9HA 4IHSA 4CCMA 3U2RA 4ZYAA 5KAIC 5E3MA 1DDNA 2XC7A 3B6CA 4UV8A 4ENMA 3M8EA 1FIAA 4Z2YA 4J19A 2P4WA 4HSTA 4B47A 2IP2A 4B1RA 1U2WA 3BG3A 3OYJA 3ASOH 4E70A 5DD8A 1W7PA 2K7LA 2IBDA 1F4KA 3LWFA 3IP4B 1DU0A 3I59A 3HUGA 2HDCA 2EINH 3G1OA 3T1BA 3VPRA 2AO9A 3NWTA 4ZDPA 4UNOA 2PMZN 1VF9A 2ZNYA 1OJLA 4E7SA 1DU6A 2D45A 3A01A 3WTSC 1A5JA 2MBFA 3P7NA 1MH3A 2G7UA 5LBQA 3CF5F 1SAXA 2JRMA 5K5OA 1VQOI 1CGPA 1SVMA 1ZRDA 4KYWA 4KITB 2KLOA 4L9TA 3G73A 3MWMA 1I1SA 4CCKA 3J80K
chains in the Genus database with same CATH topology
3CD6I 1VQ4I 3J7YJ 2NXNB 4IOCF 5GADJ 1VQMI 3CJTB 3CCQI 5JVGF 1YJ9I 1S72I 1YJWI 1VQ7I 1FOWA 2E35A 3CC2I 4IO9F 3G6EI 3CC7I 2FOWA 5DM6F 5GAHJ 1ACIA 1FOXA 3CCLI 3CC4I 1YIJI 1Y39A 1HC8A 2E34A 3CMEI 3CMAI 1YHQI 3CCJI 2JQ7A 3G71I 3CCMI 2H8WA 2ZJRF 3J7ZI 1QA6A 1YI2I 2OTJI 3CCEI 1VQLI 4IOAF 3CCRI 2QA4I 3CF5F 3I56I 5GAEJ 1VQOI 1VQKI 3PIOF 2QEXI 3CCUI 3CCVI 1VQ5I 4UY8I 2K3FA 3DLLF 1VQ6I 5GAGJ 1FOYA 3I55I 2ZJPF 1YITI 1YJNI 3G4SI 3CCSI 1VQ9I 2ZJQF 2E36A 1VQ8I 1VQNI 1VQPI 4V19K 3PIPF 1MMSA 2OTLI 5DM7F
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3CD6 I;  1VQ4 I;  3J7Y J;  2NXN B;  4IOC F;  5GAD J;  1VQM I;  3CJT B;  3CCQ I;  5JVG F;  1YJ9 I;  1S72 I;  1YJW I;  1VQ7 I;  1FOW A;  2E35 A;  3CC2 I;  4IO9 F;  3G6E I;  3CC7 I;  2FOW A;  5DM6 F;  5GAH J;  1ACI A;  1FOX A;  3CCL I;  3CC4 I;  1YIJ I;  1Y39 A;  1HC8 A;  2E34 A;  3CME I;  3CMA I;  1YHQ I;  3CCJ I;  2JQ7 A;  3G71 I;  3CCM I;  2H8W A;  2ZJR F;  3J7Z I;  1QA6 A;  1YI2 I;  2OTJ I;  3CCE I;  1VQL I;  4IOA F;  3CCR I;  2QA4 I;  3CF5 F;  3I56 I;  5GAE J;  1VQO I;  1VQK I;  3PIO F;  2QEX I;  3CCU I;  3CCV I;  1VQ5 I;  4UY8 I;  2K3F A;  3DLL F;  1VQ6 I;  5GAG J;  1FOY A;  3I55 I;  2ZJP F;  1YIT I;  1YJN I;  3G4S I;  3CCS I;  1VQ9 I;  2ZJQ F;  2E36 A;  1VQ8 I;  1VQN I;  1VQP I;  4V19 K;  3PIP F;  1MMS A;  2OTL I;  5DM7 F; 
#chains in the Genus database with same CATH topology
 2L7Z A;  2F5F A;  3QYB A;  1WI3 A;  2KJC A;  5GTH C;  2LSO A;  4W1U A;  2ECC A;  5J47 A;  1MMG A;  3F8N A;  4LIV A;  5EGO A;  3DBR B;  4LJZ F;  2O9L A;  3BCB A;  1T0F C;  4I0A A;  2XV4 S;  1OKR A;  4GYI A;  1EKE A;  1ZG5 A;  3ZXS A;  4ZZL A;  2V9P A;  1AKH B;  1SFX A;  1X2N A;  4FT8 A;  4ZYG A;  2IW5 A;  3OL3 A;  4M3G A;  4BHC A;  1FC3 A;  1GV5 A;  5H6R A;  1H0M A;  2EFP A;  1RET A;  2CV2 A;  2NXN B;  1VQM I;  3TDZ C;  2FSW A;  1W5C C;  2JSC A;  3TMO A;  1Y0N A;  5F27 A;  1I3Q J;  3SYT A;  2ZKZ A;  2M4K A;  5F1J A;  4XMY A;  3OIO A;  2EA4 A;  3JRI A;  1BI3 A;  4IEJ A;  2CO5 A;  4M3F A;  4WWC A;  2IGO A;  3CUQ C;  4M9X A;  4NC6 A;  2EA2 A;  3DPL C;  3KFW X;  4S0H B;  3JRA A;  1ZN2 A;  1BN5 A;  5J4V A;  2ZXW H;  5ILV A;  1J9I A;  3OYA A;  1VQ8 I;  2GXG A;  2DTZ A;  2G9W A;  2I5U A;  3WTW C;  3KYC B;  2H09 A;  1SFO J;  5M3M J;  2NVX J;  3T8R A;  2F48 A;  1Z3X A;  2DK8 A;  3CCY A;  4EAT A;  4BH9 A;  1MJB A;  2EPF A;  1J09 A;  3BG7 A;  2OD5 A;  2JUC A;  4QIW N;  2L2O A;  5HLG A;  2D2W A;  4PDK A;  1WPK A;  1DPU A;  2JQ7 A;  3A01 B;  4CA0 A;  1JHF A;  1RI7 A;  3FM3 A;  3RKW A;  4I76 A;  1U8R A;  3LOC A;  3ZMU A;  4Q47 A;  1YYV A;  4B3A A;  3ROU A;  4LIT A;  3CCV I;  5L3F A;  2P8T A;  1U5T B;  2WAD A;  2X6X A;  2F5E A;  3HSE A;  1O57 A;  2YX4 A;  4LD5 A;  4PGH A;  3QOP A;  5F0F A;  5TIS C;  2PFB A;  5GPC A;  1W0T A;  2WWY A;  1BC8 C;  4XBF A;  2VQG A;  4KN4 X;  2ETH A;  1GLN A;  1FNN A;  4PJL A;  2IA1 A;  5EZH A;  4BS9 A;  3WTZ A;  5E3L A;  4B4C A;  3GTP J;  2R7D A;  2OQR A;  2HVR A;  4HBL A;  4FTH A;  2P0W A;  1EH7 A;  1V54 H;  2UXN A;  1WJ5 A;  2FMY A;  1YRN B;  2R7Q A;  3E5Q A;  3OS0 A;  3NEU A;  4RGX A;  1FYM A;  4BHP A;  3FXO A;  2NS7 A;  2FBI A;  4WF2 A;  5JHF A;  2OTL I;  1AU7 A;  3FXQ A;  4XLN F;  1B8I A;  3OS2 A;  1FBS A;  3V8L A;  3A0B C;  5LFA A;  3AAF A;  4EJU A;  3CC7 I;  2WY7 Q;  1XX5 A;  1ZTR A;  2DN0 A;  3SDB A;  1U9O A;  1FEX A;  2GM4 A;  1YIJ I;  5E1Z B;  2A6T A;  4G6Q A;  4XRM A;  2MA3 A;  1DP3 A;  2K9M A;  1F1Z A;  4IX7 A;  1K78 B;  1N75 A;  1S7A A;  5EEA A;  1S5L C;  1UZC A;  4MTD A;  1XMA A;  4L18 B;  4M3D A;  3TGN A;  4E7K A;  5TGT A;  4QSH A;  1SMY F;  4II2 A;  4HDU A;  2MW8 A;  1BBY A;  3DP7 A;  1GDT A;  3JSP A;  4Q4Z F;  5C4J J;  2YUS A;  1A36 A;  3MEX A;  3KP6 A;  1EV7 A;  4BJ5 C;  5L3G A;  5E17 F;  3HOV J;  5LD2 C;  2DT7 B;  3VOD A;  3LST A;  2QF7 A;  2H8R A;  3E6D A;  3RZO J;  2X9D A;  4CCN A;  4A12 A;  3SDG A;  3DEU A;  1V5G A;  2X51 A;  3EUH A;  4UUV A;  2BVL A;  1Z6T A;  1KA8 A;  4A69 C;  3S1M J;  2WV0 A;  3W3C A;  4YII A;  4OAZ A;  5D4R A;  4XLP F;  3BOQ A;  3DV8 A;  2G0E A;  3VEP A;  3LNQ A;  3FBI B;  2ZME B;  1G3T A;  3V7R A;  3EUH C;  3PFI A;  3CP8 A;  3PNT A;  2EZL A;  3EUK L;  2AHQ A;  2JJ7 A;  4A3F J;  2UUZ A;  5EF6 A;  2X1C A;  1FYL A;  5HDN A;  4AIJ A;  3BTL A;  4U0Y A;  2CW8 A;  3BZK A;  4BBR J;  1APL C;  2DDB A;  4HNT A;  1X2M A;  3MCZ A;  1YJN I;  2GBY A;  3JRG A;  1TQM A;  2BV6 A;  1I6H J;  5HS7 A;  1MMS A;  1FP2 A;  4LMY A;  1OMI A;  2K27 A;  2CYY A;  2HGC A;  3M8J A;  5EEH A;  4DW6 A;  2A05 A;  3F8C A;  5FKM A;  1KU2 A;  4ABZ A;  4V2G A;  4P9F A;  2PQ8 A;  4HW0 A;  3SZG A;  1SAN A;  2KPM A;  3H36 A;  4YEJ A;  1UHS A;  2MD0 A;  4LB6 B;  5L3D A;  2PJR B;  3ISP A;  1YQA A;  5GPA A;  1KYW A;  1P4W A;  1ZGW A;  2I10 A;  4HX4 A;  3BWG A;  2R5Y B;  2PN6 A;  4C2M J;  3D1N I;  2M1B A;  3CJR B;  3DEE A;  4YIR X;  5DD4 A;  3GZ6 A;  4AVZ A;  1WJA A;  1WVR A;  1TW2 A;  2C6Y A;  1YJ9 I;  1B59 A;  1IN7 A;  4G94 A;  3E6B A;  3BJO A;  1XS9 A;  3KIO A;  4F3Q A;  4HLY A;  1VTN C;  1ZR4 A;  1G3W A;  3H35 A;  1DP7 P;  3L9F A;  3QOE A;  4OOI A;  1W36 D;  2LY2 A;  1RRJ A;  3E5U A;  3I54 A;  2LR8 A;  2M34 A;  3QPH A;  1G3Y A;  3QYF A;  2R92 J;  5HDK A;  2Q1Z B;  4FE7 A;  4K2E A;  2O8K A;  4MGR A;  5JHU A;  3O8G A;  4LB5 A;  2FA5 A;  4V19 K;  3GTG J;  2NOJ B;  3H1C A;  2VJI A;  3JRE A;  5K7Z A;  3RYR A;  2OUM A;  2DMP A;  4IRH A;  2HZD A;  2ICW G;  4AID A;  2KIQ A;  4Y13 A;  3DPU A;  2DMU A;  2ZNZ A;  3OS1 A;  2ZME A;  1IG7 A;  2VOO A;  1K83 J;  3FXR A;  3OYL A;  2EJR A;  1XGS A;  3ZQL A;  2DAO A;  5J1Y A;  4HV5 A;  4X0G A;  2L9N A;  3JTH A;  3F72 A;  4RGR A;  2KZV A;  3K70 D;  1YOV B;  1I3A A;  2FJ1 A;  1R9T J;  2P5K A;  2DFE A;  4MLO A;  4UB6 C;  4CYC B;  3RKY A;  1MMD A;  1YJW I;  2DBB A;  3RQI A;  2YU9 J;  3KZZ A;  4B09 A;  1ACI A;  4MTE A;  1X1P A;  2DK5 A;  3MKL A;  1B9N A;  3HRT A;  3MKY B;  2QYO A;  2QWW A;  2FBH A;  4BQO A;  3Q9V A;  2PLY A;  1XN7 A;  1SMT A;  4G6T B;  2L5Q A;  3OSF A;  1IRX A;  1TWH J;  2ELK A;  4IOC F;  4D1Q A;  1UST A;  1D1A A;  1QPI A;  2HYG D;  3FMR A;  2CV0 A;  4GRI A;  2WAE A;  4OIP F;  1R4M B;  4M3E A;  5DM6 F;  4C3H J;  3VYS B;  3X2Q H;  1WJC A;  3K4J A;  4XNF A;  2EFQ A;  3R6S A;  1QNT A;  1Z67 A;  2E5Z A;  4ENK A;  4BJ6 C;  3RCO A;  2MAB A;  1LPQ A;  4OAY A;  1JT6 A;  3VYR B;  4UUS A;  5D8K B;  3L1P A;  4GYG A;  1JXS A;  3RPU A;  4E7I A;  2JPB A;  3I55 I;  1YW8 A;  4KIG A;  1LDJ A;  3S1R J;  1Y39 A;  2V7F A;  2EIK H;  2W25 A;  1CF7 A;  3LQQ A;  1XB4 A;  1QVU A;  4IO9 F;  3SJM A;  3VYU B;  1JJ6 C;  2L0K A;  3BJ6 A;  2HYJ A;  3H9Q A;  4M9S A;  1B1B A;  3LMM A;  3RQ4 A;  2E2J J;  4KIB A;  2QLZ A;  1AWC A;  4I02 A;  3HL2 A;  4DNC A;  1RKT A;  1H89 C;  3H3Z A;  3E5X A;  1X4P A;  1BM9 A;  4G9Y A;  4DBQ A;  5CVJ A;  3E1S A;  4KUM A;  5AIQ A;  2DFH A;  3WU2 C;  1L3L A;  4A3J J;  2HU9 A;  1RNL A;  5D5U B;  1LE8 B;  1VFC A;  3IWZ A;  5CQG A;  4ZZD A;  2YU3 A;  1OIS A;  1UG2 A;  3DEW A;  3OYD A;  3CF2 A;  4G7Z F;  5KK1 A;  2R7S A;  5D6E A;  2QZ8 A;  3L09 A;  3FKI J;  4AVP A;  2CWE A;  3EDP A;  4O5V A;  1XSX A;  2XAH A;  4RB2 C;  2M8E A;  2O8X A;  1JT0 A;  1X1D A;  3K1P A;  3PFY A;  4QPO A;  4EEF G;  3KP7 A;  2VE9 A;  3S2D J;  5EZG A;  2VLA A;  3S2H J;  2EB7 A;  4U87 A;  2RDP A;  5LGT A;  1A31 A;  3CDH A;  3OOU A;  2RV8 A;  2XPV A;  4H4K C;  1JKP C;  1UAA A;  4A6E A;  3I53 A;  3W6V A;  2PMZ A;  3Q0V A;  5CYV A;  3S1N J;  3WE3 A;  2RGV A;  1F5T A;  4Y4R A;  1V4R A;  3M07 A;  1P9Q C;  1EH8 A;  3I64 A;  1YW7 A;  4CSW A;  2ZJR F;  1W0U A;  2O5R A;  2R3S A;  4AYB A;  4L0Z B;  3HJE A;  4IHW A;  2PBI A;  1AOY A;  4FHT A;  2UV1 A;  1OYY A;  4HQM A;  4Y15 A;  2EFW A;  1T6S A;  4RS8 A;  2PMU A;  3KYD B;  3PQK A;  1R6R A;  3ERM A;  3K9T A;  2E1M B;  1R5H A;  5EJC A;  5FKK A;  3ZQ7 A;  4XN0 A;  2EBI A;  2VQH A;  2JWT A;  3GF2 A;  5DYM A;  3ZMD A;  1Z0X A;  3GZ5 A;  5HVQ C;  3OWT A;  1GHC A;  3E6C C;  4B44 A;  1Y1W J;  2KT0 A;  1S6L A;  3GEZ A;  2CQ7 A;  3C2H A;  5F0H A;  1R5I D;  2CW7 A;  2V4J C;  1YHQ I;  4ZTJ A;  2R5Z A;  1XD7 A;  5E1X A;  2A68 F;  3GTQ J;  3K2Z A;  1NG7 A;  3PL8 A;  2IJL A;  4JYK A;  5E8I A;  4QLC U;  3K69 A;  2FUG 2;  2MYS A;  2OBP A;  3HEF A;  3LFK A;  2CRG A;  4UV9 A;  3COA C;  2ZJQ F;  1JHH A;  1BC7 C;  4PJN A;  1KZH A;  3FX3 A;  1UHW A;  2F4O B;  2DJI A;  5IP6 A;  3OIP A;  4RGU A;  2XKP A;  2W85 A;  1R36 A;  4NQW A;  1T33 A;  2E7W A;  5E8G A;  5HOO A;  3OOP A;  2HFH A;  1ZAR A;  2HQA A;  5BNG A;  3UKG A;  1ETX A;  4IHV A;  2QKM B;  4OIR F;  3WGI A;  2EFN A;  3AG1 H;  2XPW A;  2AS5 F;  2XGE A;  2X1D A;  1RC9 A;  2LY9 A;  5CVU A;  4CYD A;  3KET A;  3BG5 A;  1QGP A;  4XKW A;  1XCB A;  2FOK A;  4PZJ A;  2K3F A;  3GLX A;  2NS0 A;  1SD5 A;  3G4S I;  4WXD A;  5F1R A;  5J6X A;  1EF4 A;  1QU3 A;  3TO6 A;  1YLF A;  2I8D A;  3BR3 A;  4N0B A;  2GXB A;  2CFO A;  2GIV A;  3ONQ A;  2VJ4 A;  2HZT A;  2VOP A;  4AD9 A;  3VSL A;  1S7O A;  1HKQ A;  1IF1 A;  5FO5 A;  1O7L A;  3LSJ A;  4FX0 A;  3F3X A;  1XMK A;  4G7O F;  2WB1 A;  3BTC A;  1TNT A;  4UUS B;  1GVD A;  2HR3 A;  5F6F A;  3S3M A;  2OF7 A;  3PM1 A;  2GXA A;  2E60 A;  4I09 A;  5LEK A;  4G7H F;  1JUP A;  1W5S A;  4Q48 A;  2ACJ A;  1OCZ H;  3CO6 C;  1F43 A;  3K7A J;  1H9T A;  3Q3S A;  4CHU A;  3MMY B;  2IXS A;  4HNU A;  2EV0 A;  4HRI A;  1MBF A;  4DOZ A;  5JR3 A;  2ME6 A;  2QVO A;  1P6R A;  2HPM A;  1HC8 A;  1ENH A;  4BQQ A;  1FX7 A;  4C9Y A;  4XM3 A;  2CU7 A;  2VT2 A;  4YFK F;  4DQ2 A;  1K4T A;  3ZMZ A;  3OYG A;  3DKY A;  1W7P D;  2F4I A;  1I6X A;  2ID3 A;  4HNV A;  1O3R A;  4L9J A;  1ZYR F;  2DI3 A;  2DQL A;  2LP0 A;  3Q9S A;  2FRH A;  2HDW A;  1X1B A;  1GUU A;  2DCE A;  2M8G X;  1X4O A;  5EYR A;  5L3B A;  4A3D J;  3BJA A;  3PSF A;  3AKZ A;  1DUX C;  3CME I;  2LMD A;  2XDV A;  2CUF A;  1UJ8 A;  1ZEL A;  2LY1 A;  3G71 I;  2MC4 A;  3KX2 A;  5CLS A;  3W6J B;  4XKC A;  4XRF A;  4YEL A;  3T8T A;  3L2C A;  3V7C A;  1OCR H;  3J7A Y;  2ESN A;  5CPR B;  1IN8 A;  4ZJZ A;  1R00 A;  5LLQ A;  1ETY A;  1N25 A;  1D1B A;  3V8K A;  3HUG B;  3ZN1 A;  2DA3 A;  3BPV A;  3BP8 A;  3CP2 A;  1FTT A;  2IVM A;  3MAJ A;  2EH3 A;  2X4H A;  3WHC A;  3VWB A;  2ME0 A;  4KMU X;  1PP7 U;  1IUF A;  2DA4 A;  4Y17 A;  2IS1 A;  1FMW A;  2F5V A;  2NVU B;  4BU2 A;  2KFD A;  3OSG A;  3QPL A;  2EIM H;  2OC6 A;  3HXL A;  4Y7N J;  3WTX C;  1E3H A;  2H6B A;  3RSN A;  3VYT B;  3JW4 A;  5A2Q K;  4J00 A;  2JA6 J;  4XLH A;  2DO7 A;  1PDN C;  3CZ6 A;  5GP9 A;  4BEH B;  4ON0 A;  1TQI A;  4E6K G;  1HDP A;  2PEX A;  2AQF A;  2VJ5 A;  1REP C;  5KHD A;  1RIO H;  4UVC A;  2A69 F;  2R0Q C;  4XQF A;  4MHG A;  4L9N A;  4OU0 A;  3BCA A;  1MNE A;  1DPR A;  1OCO H;  4BKX A;  1D0X A;  1YO5 C;  1EJ9 A;  4X1E A;  3HSR A;  3L2W A;  4CO8 A;  5IOZ A;  2EZK A;  2OQG A;  1BR1 A;  4F7Z A;  1U8B A;  2LKX A;  4F92 B;  1R7J A;  1Y6I A;  2BYV E;  1R1T A;  3DKW A;  3K1M A;  2VBY A;  2VL8 A;  4JX4 A;  4MQV A;  2BW3 B;  5ICE A;  2K85 A;  3ZMT A;  3S17 J;  2RQP A;  1MJA A;  3UR3 C;  1G2H A;  1XGM A;  1W5T A;  2RNG A;  3ZQH A;  3HOT A;  1XTA A;  4PJJ A;  5GAH J;  3FIW A;  3QAH A;  3EYY A;  1Y0U A;  2B9S A;  1GVJ A;  1X1C A;  4B43 A;  5C44 J;  3S3O A;  2E19 A;  4RMN A;  1H88 C;  4EM2 A;  4NC8 A;  3I56 I;  2R5Y A;  4Y52 J;  4MIM A;  1B72 A;  2LTP A;  3GCM A;  4I7H A;  2FXA A;  5B1A H;  1LQ1 A;  4BXU A;  3OYM A;  4C2T A;  1H9G A;  1IRG A;  2MLG A;  3OIQ A;  2ZXH A;  2VKV A;  2KHM A;  3WOD F;  1U5T C;  1FOK A;  1PJR A;  4I98 B;  4Z6Y A;  3IRR A;  5CKT A;  3FF5 A;  4IRI A;  3E7L A;  4H0E A;  2QGU A;  2M4G A;  4BQA A;  4ASN A;  2W4S A;  3W6K B;  3AG2 H;  3JR9 A;  2IS6 A;  3G1M A;  1HQC A;  5B1B H;  1U3E M;  3CCR I;  2XIG A;  3EET A;  3F8B A;  2RAE A;  2Z2S B;  2HWV A;  1HCR A;  3ZMS A;  1IZ1 A;  2VXD A;  3PSI A;  3WG7 H;  2X6Y A;  1YTY A;  1PUF B;  1D5Y A;  3O8H A;  1FBU A;  3FHN A;  3BTI A;  5EDN A;  4M6V A;  1Y8Q B;  2WAQ A;  5LHI A;  1BW5 A;  2NVT J;  1X3W B;  4HLX A;  2MLK A;  2M0M A;  3GME A;  2H6C A;  4LG3 A;  2CJJ A;  2CS3 A;  4N4O B;  5FKO A;  3ZOB A;  1TZL A;  3HTS B;  4LG0 A;  1HW1 A;  1WFX A;  3GFI A;  3WTT C;  3V4G A;  3DWL E;  4ANJ A;  4C3J J;  3M9A A;  4F91 B;  2M87 A;  5D5W B;  1PUE E;  3AG4 H;  3HGY A;  4GXO A;  4NC7 A;  4ESJ A;  2BZT A;  1WH5 A;  1R49 A;  5E18 F;  3PUB A;  4EMS A;  2J5O A;  3ZQQ A;  2OCE A;  2A07 F;  3TQN A;  5D5V B;  5JVG F;  3HGG A;  1B4A A;  2DOD A;  3V42 A;  1XPX A;  4A3B J;  3WTY C;  1HA8 A;  1SVO A;  5HDG A;  1ONV A;  1I50 J;  3BR1 A;  2L7F P;  3TO7 A;  2TCT A;  4FX4 A;  4G8X A;  4FIS A;  4FE4 A;  1R1V A;  3IRQ A;  1OQY A;  5E3N A;  2HKX A;  4MO7 A;  5FD5 A;  1UEL B;  3K4K A;  4CIC A;  2JA8 J;  4BQN A;  1Y56 A;  3I4P A;  1OFC X;  3LSM A;  5FRN A;  2MG4 A;  1S3J A;  2V9V A;  1HBX G;  1HST A;  3D0S A;  1FOY A;  3UNG C;  1MMA A;  4RDU A;  4ZTF A;  1MDM A;  2DA6 A;  2OZ6 A;  2BVM A;  1ZR2 A;  2RNJ A;  1VQ4 I;  2GIZ A;  1G8X A;  3RKQ A;  3WGH A;  3P9C A;  3ECO A;  2VN2 A;  1BW6 A;  1FPQ A;  2L3D A;  2MFZ A;  1LNW A;  2V9K A;  2DDA A;  2R7W A;  4HDV A;  4M9Z A;  1JE8 A;  4YRV A;  1W36 C;  5EGO B;  3J80 Z;  2EIJ H;  3MFK A;  3SEQ A;  1TL8 A;  1MBG A;  2DU9 A;  4NHJ A;  3LSH A;  1X3U A;  4XKB A;  3IV5 A;  1ODD A;  1YRN A;  4I0B A;  2QSH X;  1FWZ A;  4RM2 A;  4DZJ A;  2CV1 A;  4XON A;  3H0D A;  3L2Q A;  2O6G E;  1YS6 A;  3M1E A;  1D5V A;  3H5R A;  2VAS A;  3K4B A;  3DF8 A;  1MNM C;  3TO9 A;  4EJT A;  2A6E F;  5BMZ A;  4AUX A;  3FXU A;  1U0J A;  3C1D A;  2NRA C;  2V6E A;  3FDY A;  2Y48 A;  3G2B A;  2L54 A;  2XAS A;  5KCM A;  1UB9 A;  1FZP B;  4AYB N;  4HOB A;  1RR7 A;  4D5C A;  2HI3 A;  1L0O C;  2VKH A;  2OTJ I;  4AIH A;  2HS5 A;  3HRS A;  2L7K A;  2L7M P;  3DTI A;  3QYE A;  1BR2 A;  5GAG J;  3EQL F;  2MH9 A;  2XPU A;  3BC8 A;  5JVT A;  3FHZ A;  2MGQ A;  1TTY A;  3BZC A;  2BW3 A;  3W2W A;  3TL4 X;  2Z1D A;  3ZCO A;  1JI8 A;  3LA2 A;  5IYC J;  2COB A;  4L5I A;  4DGW B;  4DJA A;  2HOA A;  2WY8 Q;  1LE8 A;  2IT0 A;  2XAJ A;  2BHZ A;  2WAF A;  4LLL A;  2Y0S N;  1AKH A;  3IH2 A;  2QA4 I;  3RTR A;  2IA2 A;  3ABT A;  4PGG A;  3CCU I;  5DS9 A;  1IN5 A;  4BDZ A;  2CG4 A;  2VT3 A;  1QO0 D;  2XSJ C;  3Q0U A;  3H3V K;  1BJZ A;  1V5E A;  4DIQ A;  2KIU A;  2M30 A;  3L2U A;  4XSX F;  3ECH A;  1BIB A;  4EGY A;  3CUO A;  1OCP A;  2VC0 A;  1Y8R B;  3PUF A;  4CGZ A;  2ZJ2 A;  3NAU A;  2ZME C;  1P7J A;  2ZSI B;  2D5V A;  4D9J A;  4A3G J;  2HDD A;  2M0C A;  3PO3 J;  4ENJ A;  2XF7 A;  4A0Z A;  4UVA A;  5HLI A;  4G12 A;  2HEO A;  1QZE A;  2JVH A;  2DFI A;  3R0A A;  3G3Z A;  3WTU C;  1I27 A;  1ERD A;  1ZGA A;  2BXY A;  3HKZ N;  3L2V A;  4LFU A;  3LA3 A;  4HF0 A;  1XGO A;  2X48 A;  4A2U A;  4A3C J;  2V1D A;  1P92 A;  1KQ0 A;  3TW7 A;  2DOE A;  2W1O A;  3PNY A;  3C18 A;  5M5W J;  3VSK A;  3OR1 C;  4BE2 A;  4HSR A;  4RM3 A;  4P5O A;  1HOM A;  3CDI A;  3DBL B;  1A04 A;  1O3S A;  2ECB A;  2R7V A;  3GYH X;  4KNY A;  3BR0 A;  4WCG A;  2NAZ A;  2XB0 X;  5D6F A;  4BY7 J;  1SFK A;  2KIF A;  3AL0 B;  2HPI A;  2JVG A;  3DLA A;  1K6Y A;  3K70 C;  3K1N A;  1ZG3 A;  2HOE A;  2JK3 A;  2X85 A;  3ASN H;  3OYE A;  2ZFW A;  5ILS A;  5EG0 A;  1P4A A;  3CJT B;  4HF1 A;  1T08 B;  3J7A O;  1IV8 A;  1Y1V J;  1MH4 A;  3I59 B;  4BXF A;  5K1Y A;  3REO A;  1XSD A;  2LRD A;  1S7E A;  2O0Y A;  1TWF J;  2GOX B;  1U6G A;  2X6W A;  3LSP A;  2X6O A;  3R0J A;  3TP3 A;  2OV7 A;  4B3X A;  4I99 C;  4WXH A;  2CH0 A;  2HTJ A;  2FML A;  5ED4 A;  4A3L J;  5H20 A;  3W2A A;  3GW2 A;  5EEG A;  3O2P E;  2EWN A;  5JI6 A;  1JGS A;  3KZY A;  3ULQ B;  2V26 A;  1TP4 A;  3P9K A;  1HSJ A;  2JTV A;  4U0V A;  2JZY A;  4AIK A;  3L00 A;  3RPQ A;  2DYR H;  4JX5 A;  1Z3Y A;  2W48 A;  1SD7 A;  3TW6 A;  1U9N A;  1EA3 A;  3C7J A;  2FNP A;  2WB1 N;  3CCE I;  1F9N A;  1FSH A;  5FB2 A;  1F36 A;  3C2B A;  4RB3 C;  4MNU A;  2V1U A;  2QEX I;  2K9Q A;  5IT9 Z;  2VQC A;  3OV8 A;  1G59 A;  4HX8 A;  1BI0 A;  4IQJ A;  3GFM A;  2HXO A;  2XRL A;  1PYV A;  4O6J A;  2IS2 A;  1IRZ A;  4RB0 A;  4IQ4 A;  4RAY A;  5TRD A;  4WXC A;  1PVE A;  5J4Y A;  1T98 A;  4BDY A;  5E20 A;  2H1K A;  2P5V A;  4RAF A;  4P96 A;  2DJN A;  4DYC A;  3BZ6 A;  4NNJ A;  1OYI A;  2VQL A;  1RZ4 A;  1IDY A;  2CQK A;  3CD6 I;  4B8X A;  2PG4 A;  2ZFU A;  4GDF A;  1J7K A;  2M7A A;  3AFH A;  3NWS A;  4M72 A;  3DQV C;  3BRO A;  2CUZ A;  5FJ8 J;  5CQE A;  1TWG J;  3BTJ A;  1MIJ A;  1MMN A;  3B6A A;  5E1W A;  4EM0 B;  4KN7 X;  5DEQ A;  3HOS A;  5DCM B;  3F6O A;  1MD0 A;  3HBL A;  5HLT A;  2NVY J;  2KRH A;  4JP0 A;  2FX0 A;  2VXZ A;  5FD6 A;  1AA7 A;  2QEN A;  3WU0 A;  5L3E A;  2R7O A;  1IO2 A;  3LFU A;  1YG2 A;  1SD4 A;  2HVQ A;  3JAM Z;  5FLV A;  4I2O A;  1XC5 A;  1WJF A;  1JUM A;  2E71 A;  3RI4 A;  1SC7 A;  1PUF A;  4XLF A;  3HB9 A;  2YR2 A;  2UZK A;  1XCV A;  3D5R C;  2PMH A;  4D7M A;  3SHF A;  1ETK A;  1V55 H;  1ZK8 A;  3NQO A;  5JLW A;  1TT0 A;  3D5S C;  1J0R A;  1SAU A;  1LUJ B;  4IZZ A;  2BOL A;  3FIS A;  3BY6 A;  3F8M A;  4KT6 A;  4M71 A;  1IC8 A;  4IXA A;  1FMV A;  2ZC2 A;  4XK4 A;  1MJ9 A;  2QSF X;  5LEJ A;  4JX6 A;  3OYF A;  2L4A A;  2R7U A;  2K5C A;  1K78 A;  1OLT A;  3LSI A;  3NRV A;  3ZGK A;  3M1C A;  4YFX F;  2H1L A;  3OYB A;  5FFZ A;  4GFB A;  3MZH A;  1TT5 B;  1R23 A;  1IUY A;  3FXM A;  2CMP A;  1W1W E;  2HQN A;  4LGW A;  2ELH A;  4RLF A;  2CFX A;  3JCU C;  4BUP A;  4S04 A;  2E36 A;  3BQY A;  3FMQ A;  4N9I A;  3GTO J;  3CMY A;  1RR8 C;  2DTR A;  4OMY A;  1E3O C;  2WBM A;  3LA7 A;  4XL9 A;  1BOB A;  2NOG A;  1FJL A;  3OYC A;  4HAM A;  2ZO4 A;  5HS9 A;  2DPD A;  5K7F A;  1YFH A;  1V5F A;  5DDG A;  2P7V B;  4PJM A;  3KYL A;  1OR7 C;  5FLM J;  3GFL A;  3VOE A;  4HPQ A;  5B5E C;  3BR5 A;  1YI2 I;  2QUF A;  1JKQ C;  3R61 A;  1Z05 A;  2O7O A;  2Q8K A;  2QCO A;  1ZRE A;  1SVL A;  2ZJP F;  1VQ9 I;  5F64 A;  1BIA A;  4JOM A;  2E1O A;  4C3I J;  1ZG1 A;  2PJP A;  2Y31 A;  2DW4 A;  1QRY A;  2HOT A;  1LDK B;  1IJW C;  3ZRG A;  4ITV A;  5LGN A;  5IT3 A;  3DCF A;  2DMN A;  3CCL I;  3OYH A;  1D0Y A;  3HDD A;  2LF7 A;  4TV7 A;  5LRR A;  3LQR A;  4UVB A;  2Y0M A;  2Z33 A;  3ZQC A;  1YIO A;  2DLL A;  1MZB A;  1QHH D;  2TRT A;  5AIP A;  5ERI A;  4IHX A;  2IPQ X;  2J5P A;  4E7J A;  1HKS A;  1MGT A;  1R5G A;  3H5N A;  4BE0 A;  2QSG X;  3WU1 B;  4OIO F;  1MDM B;  2P6T A;  3S2W A;  2JA7 J;  4DBR A;  1TWC J;  3SZP A;  2EIL H;  4ESF A;  4BBS J;  2JRT A;  3HSF A;  2V6C A;  3RJP A;  2MSY A;  3IAM 2;  1J2X A;  2HXI A;  4LIU A;  3IKT A;  1SEU A;  1ZRF A;  1ON1 A;  4ENN A;  2JA5 J;  2R5Z B;  4WK8 F;  5IYD J;  4BNC A;  3FXJ A;  4RA2 A;  3DTE A;  2DA2 A;  3CO7 C;  3ELK A;  3ML6 A;  4ETS A;  5L3C A;  3DLL F;  2XVC A;  4LK0 F;  2EK5 A;  1BOA A;  4RLQ A;  4XRS G;  4BYY A;  3M7G A;  1KU9 A;  1OCT C;  1R1U A;  2PI0 A;  4J01 A;  5F04 A;  2F5C A;  5IP9 J;  4HQE A;  1GXP A;  1WJD A;  2VE8 A;  2VUM J;  4PUS A;  4PFP A;  1TWA J;  3RPU D;  3HM5 A;  3KEY A;  3JRB A;  2VI6 A;  4ESB A;  4L9V A;  1HLV A;  2XRO A;  4KIF A;  3M3Y J;  1FT9 A;  3HOZ J;  2IEK A;  2DOF A;  1MND A;  3U1K A;  1LKX A;  3L2R A;  1IN6 A;  1BJA A;  4E4H A;  4CZZ A;  4CYC A;  2E2H J;  2K4B A;  5IYB J;  1B8I B;  3RZD J;  5IPA A;  1WQ2 A;  2X1E A;  1VQ7 I;  3CC2 I;  1N78 A;  3CJN A;  5DUK A;  3B02 A;  3QRF F;  1B9M A;  3U1D A;  5LHH A;  3MD2 A;  2P7C B;  4HG2 A;  4XN3 A;  2LFB A;  1ETQ A;  3E3V A;  4BJT A;  2XAG A;  1ZKG A;  1NTC A;  1JJ8 C;  2K02 A;  3OYN A;  2W82 A;  4C30 A;  3W2V A;  3S3N A;  3JRH A;  1SFE A;  1ULY A;  3FK6 A;  2H27 A;  1LB2 A;  1VQ5 I;  2DT5 A;  4D0P A;  1S8N A;  1Z6R A;  1QVT A;  2R7R A;  3NAR A;  4FQG A;  1WHU A;  2VPL A;  2VB6 A;  3DBH B;  5FRO A;  4RBO A;  1D8J A;  6PAX A;  3GUD A;  1VI0 A;  2XB5 A;  1FOX A;  1LVA A;  1RPW A;  9ANT A;  1T56 A;  3MVP A;  3KEO A;  2LD5 A;  1K61 A;  5F0C A;  1YX5 A;  2W00 A;  1WSU A;  1ZGJ A;  2K9N A;  2VPR A;  3A1Y A;  1QA6 A;  4XR6 A;  3ERE D;  3A2K A;  5HS8 A;  4MQ9 F;  1U78 A;  3RDI A;  3HPH A;  4XID A;  1NK3 P;  1EH6 A;  2DA7 A;  3CMM A;  1DGR M;  1T95 A;  1VND A;  1MKM A;  5DCF A;  4P1W A;  4CH7 A;  1GV2 A;  2K40 A;  4E7L A;  5BPD A;  5A2Q Z;  2KQR A;  4GCV A;  3GTJ J;  4NDL A;  4QTR A;  3GTL J;  1JGG A;  5FLX Z;  3KZI C;  4PSW A;  5ICC A;  1K4S A;  2L9S A;  4XRS A;  3GBG A;  1Z7U A;  1ITY A;  1J5Y A;  4CZC A;  5HOD A;  2LBF B;  1ZQ3 P;  4HF2 A;  4R8H A;  3ESW B;  5K7H A;  2NNN A;  2WA0 A;  3WHB A;  3F23 A;  4E7H A;  3FBN B;  1LJ9 A;  1FYK A;  4EVI A;  2Q0O A;  2E35 A;  2LKS A;  2A5Y B;  4WX9 A;  4XLA A;  1Z91 A;  1YE9 A;  2R7Z J;  2GOM A;  4EJO A;  1ETO A;  2L9R A;  4M74 A;  5D5X B;  1R22 A;  1QZZ A;  2HYF A;  1NHA A;  2OPT A;  4KIS A;  3BG9 A;  4A0Y A;  2DQR A;  1WZ2 A;  1USS A;  5IT9 K;  1KON A;  5CVV A;  1JTX A;  2KRC A;  3TP0 A;  4IVN A;  5ILU A;  3F8F A;  2QQ9 A;  2Z9O A;  2LOO A;  3CLQ A;  2ZCW A;  2JPC A;  4L5J A;  4A5M A;  2K9L A;  3SFZ A;  4YG2 F;  3QWL A;  1NH3 A;  1HKT A;  5DUI A;  1DGW Y;  1I1G A;  1H8A C;  1CF7 B;  3QU3 A;  2NVQ J;  2Z16 A;  2GAU A;  4FET A;  2K4J A;  1QBJ A;  2XHK A;  2RN7 A;  3A0H C;  4PJ0 C;  2ISY A;  2NYX A;  5K5R A;  2W24 A;  2VKE A;  4XLE A;  3JRF A;  2IGM A;  1YW9 A;  2Y9Y A;  3KLN A;  1STZ A;  1Z9C A;  3JRD A;  2M45 A;  5B66 C;  2EFO A;  1ZHF A;  2L02 A;  3AL0 C;  1J59 A;  4Y3O A;  2STW A;  2K9S A;  2HVS A;  2RQQ A;  3M8F A;  3V7S A;  1VQP I;  4KMF A;  5M5Y J;  2IRF G;  4IHY A;  3GO5 A;  4NQW B;  3G6E I;  3F9K A;  3S16 J;  1TW3 A;  3H9J A;  3D5L A;  4YFN F;  4HV6 A;  4HZF A;  1UCR A;  4KDP A;  4HX7 A;  1R4N B;  3JTG A;  2YS9 A;  5LGU A;  1FP1 D;  4ZYH A;  4PSX A;  4II3 A;  2LKP A;  3P5J A;  3ZR8 X;  2B7E A;  2R7F A;  5LHG A;  1A6Q A;  1MBH A;  3K4N A;  4U7D A;  4A93 J;  4DYR A;  2WTE A;  1A35 A;  4R79 A;  1YIT I;  1HXD A;  3FM5 A;  2LYC A;  5E3O A;  1TBX A;  3I58 A;  3EUA A;  2HQR A;  2L01 A;  3TOB A;  3CLO A;  3RYP A;  2Y2Z A;  2CUE A;  1S29 A;  1W7P B;  3OL4 A;  4U88 A;  3I5U A;  3N4M A;  2DA5 A;  2EV5 A;  2OZU A;  2KIS A;  2VON A;  2XUB A;  2GLO A;  1KQ8 A;  3ZPL A;  3MKZ A;  4C2U A;  3S32 A;  1A6I A;  5D8L B;  4KIC A;  1SD6 A;  1LEB A;  1KGS A;  4MFE A;  3M4O J;  2BY1 A;  1NG6 A;  2XAU A;  3K4M A;  3S93 A;  2LBF A;  1Z7L A;  4XKV A;  1VQK I;  1OPC A;  2XRN A;  4QPQ A;  4RAG A;  4AM3 A;  3ZMV A;  4F55 A;  3S8P A;  4M6X A;  3DU6 A;  3IL2 A;  4BHB A;  4BXX J;  3IUO A;  3ZP5 A;  2VBW A;  1LEA A;  3I3L A;  3TOA A;  1RUO A;  5J1R A;  1BL0 A;  2CQN A;  2KDZ A;  1TLH B;  3ABL H;  4LLG F;  2RRE A;  3F22 A;  4F52 A;  2R93 J;  4UXN A;  1DQU A;  2H94 A;  1YX3 A;  3JRC A;  2M2E A;  2IAI A;  1O3T A;  4A3E J;  1RUN A;  2ZXJ A;  1KQ9 A;  4XOT A;  2G7H A;  2DPU A;  1BR4 A;  2DMT A;  3BQZ A;  3GVA A;  5BPI A;  2X0L A;  5FRM A;  2JA2 A;  2NS8 A;  2OAZ A;  1BA5 A;  1X1A A;  3CCJ I;  1G6N A;  1IGN A;  1KYZ A;  2FU4 A;  2MH2 A;  3VFZ A;  4OIQ F;  2N8G A;  1T8I A;  1LFP A;  2FQ3 A;  1E3P A;  1ZLJ A;  4KA4 A;  4S05 A;  3PIP F;  3LL7 A;  5IOY A;  1B6A A;  1UG0 A;  5DM7 F;  1UHM A;  1QZY A;  1POG A;  4F93 B;  5H6Q A;  2ZB9 A;  2WV1 A;  3CDL A;  4O3M A;  1O4X A;  3MQ0 A;  3CQZ J;  3A4C A;  5IY5 H;  1I39 A;  1BI2 A;  1K79 A;  2V1X A;  4LLN A;  2GZW A;  1D3Y A;  1RES A;  1HW2 A;  2FNA A;  2F2E A;  2FEZ A;  2XF5 A;  3H92 A;  3OY9 A;  3F0C A;  3FWE A;  4CDG A;  5FKN A;  2OA4 A;  3FK7 A;  4A3K J;  5ICF A;  2IA0 A;  2O03 A;  2A6H F;  5J1U A;  2MC3 A;  1D1C A;  1XDU A;  3DTK A;  3VDX A;  5KAF C;  4NBQ A;  5TJJ A;  2E2I J;  3HOU J;  3P9I A;  3OR2 C;  4DZP A;  2HKO A;  3FZV A;  1T39 A;  1V3F A;  1C0W A;  4ZYE A;  4LG0 B;  1FTZ A;  5KVR A;  3KE2 A;  1RKW A;  5FKL A;  2DFF A;  4ZH4 F;  3KEQ A;  2XGC A;  3KPH A;  3JAM K;  2E1M C;  3QU6 A;  1E2X A;  4YIF A;  4M6Y A;  2CSO A;  4AU7 A;  4EM1 A;  2F5D A;  3HYI A;  1VZ0 A;  2JMW A;  2OCC H;  3T0Y A;  1QHG A;  2BEO A;  1MBE A;  3V8J A;  3BT9 A;  3KP3 A;  3K6G A;  2M3A A;  2LH9 A;  2DOA A;  4OWR B;  4V2F A;  2EV6 A;  1YS7 A;  2VC1 A;  3BR2 A;  1ORK A;  2DXI A;  3CTA A;  4JBA A;  1IXS B;  3B73 A;  3GXO A;  2XKO A;  4U7B A;  1X3Z B;  3QOD A;  1K6O A;  3CMA I;  2LDU A;  3S15 J;  3KP2 A;  2AXT C;  3GWZ A;  4B48 A;  1WH7 A;  4BY1 J;  1ZLK A;  5CVR A;  4OMZ A;  1VQL I;  4GO1 A;  1MBK A;  5J8F A;  3IKV A;  3E97 A;  2L4M A;  2Y69 H;  3ZN0 A;  3TED A;  1TNS A;  2YSR A;  2KZG A;  3DXJ F;  3QPT A;  1ZH5 A;  3EYI A;  3MZ8 A;  1P4X A;  4AWX B;  2Y9Z A;  2FOW A;  2RC4 A;  1T2K A;  3O6B B;  3OMY A;  3IWF A;  5HNH A;  2EZH A;  1FSE A;  2LVS A;  5LRS A;  3PNV A;  2OU2 A;  2KIM A;  3SFI A;  1X58 A;  3SZT A;  3I4M J;  1WRJ A;  2E5N A;  3PO2 J;  3I9V 2;  1WJE A;  3E0J B;  3IH3 A;  2GA1 A;  2V1N A;  5FGM A;  4AC0 A;  2ELJ A;  3PQJ A;  2QQ8 A;  4IRG A;  3N97 A;  4EGZ A;  3KP5 A;  1WWX A;  5CVI A;  1JUS A;  2RKH A;  3SEZ A;  2KKO A;  2LC2 A;  5C3E J;  3HOY J;  2BY2 A;  2LF8 A;  2VJJ A;  4N4N B;  5DV5 A;  2H8W A;  2KMU A;  4XOP A;  4RB1 A;  1HF0 A;  2W57 A;  2Z5U A;  2VKD A;  3VB2 A;  4ZC3 A;  5GAE J;  4BAY A;  2QM3 A;  2KRF A;  4LK1 F;  5C4X J;  3ABM H;  1FLI A;  3CUQ B;  3K10 A;  1X19 A;  1FIP A;  3RKX A;  4E7Z A;  3J7Y J;  3N05 A;  3ZQF A;  5FLX K;  2AXL A;  3WG9 A;  4A3M J;  2ZBK A;  3DPT A;  3GFJ A;  3BG6 A;  2ISZ A;  2DT6 A;  1QPM A;  4MFD A;  2OJE D;  2WC2 A;  1R71 A;  2LRE A;  2E34 A;  2QBY A;  1XGN A;  1J75 A;  4BE1 A;  2FQ4 A;  3R60 A;  2GQQ A;  2UXX A;  5KNL A;  3CCM I;  4PK4 A;  1O7F A;  1WKM A;  3DKX A;  3GTM J;  2COM A;  3C3W A;  3FXL A;  1UFM A;  4PFO A;  3HRM A;  3MN2 A;  3K2A A;  4R1H A;  3LAJ A;  1G3S A;  1S9H A;  2FD5 A;  2B63 J;  5H2F C;  4IKF A;  3H3U A;  2F6C A;  2JUG A;  1IRF A;  3HHH A;  1LDD A;  1BI1 A;  4CUG A;  4FAS D;  1XDS A;  2P5L C;  1IDZ A;  2AQE A;  1HW5 A;  3KCC A;  1Z77 A;  4HA8 A;  3MKW B;  3JSO A;  3S14 J;  2LK2 A;  3E6M A;  5DCM A;  4EQQ A;  1LFB A;  1Z1D A;  2DA1 A;  3DU5 A;  4G6D A;  1OCC H;  3WGG A;  1M1E B;  3GZN B;  3WE2 A;  5DTD A;  1I5Z A;  4IOA F;  2HOS A;  5J3L A;  4BGD A;  5K5Q A;  2XSD C;  1IV6 A;  3IC7 A;  4L0Y B;  1KU3 A;  2Y0S A;  5JFR A;  4CCJ A;  3IAS 2;  5F08 A;  1PP8 F;  1O3Q A;  4ZYD A;  4M73 A;  3HOW J;  4U0W A;  2CGP A;  2VBZ A;  4I01 A;  4KFC A;  3LSG A;  3I0T A;  3CC4 I;  4XIC A;  5BQT A;  2LLK A;  3K0L A;  4FCY A;  1R58 A;  1XG1 A;  2K86 A;  3QPS A;  4QWQ A;  3QP5 A;  4N9H A;  1OR7 A;  3RIR A;  2A3S A;  2ID6 A;  4MEX F;  2RVC A;  1ZRC A;  1B72 B;  2NNY A;  1GT0 C;  3F6V A;  4UB8 C;  2Y30 A;  3GX4 X;  3U21 A;  4UUT A;  1Q1V A;  1MSF C;  4P55 A;  5EG0 B;  5M3F J;  4ZDL A;  3FMS A;  5GAD J;  3T5X A;  1FOW A;  1XSV A;  2CW0 F;  3I71 A;  3HKZ A;  1HDD C;  4CCL A;  1Q1H A;  5HNF A;  2R4G A;  3SQN A;  2A5W A;  2PX9 A;  3HRU A;  2PJR A;  3IH4 A;  1CQT A;  2XF6 A;  1ZAO A;  4IF4 A;  2FBK A;  2IS4 A;  4DYQ A;  3PIO F;  4PCQ A;  4BAC A;  3TBI A;  1WI9 A;  2KDO A;  3CCS I;  1LVK A;  2BGC A;  3J81 K;  2JT1 A;  4ZDO A;  2Z3Y A;  3A03 A;  2BXZ A;  3CCQ I;  2YX7 A;  3LSR A;  1SFU A;  4XOR A;  2ADU A;  4M3B A;  2LG4 A;  2ZXI A;  1P7I A;  2KP6 A;  3HHG A;  1ON2 A;  3CES A;  4W97 A;  4Y33 A;  5CJ9 A;  5B3S H;  3S1Q J;  2A61 A;  4XLC A;  2XAQ A;  1E17 A;  3G1L A;  4IL6 C;  1D8K A;  2GWR A;  3F21 A;  1JKO C;  3KLO A;  5GTI C;  2QBY B;  3TKY A;  2DYS H;  5ICG A;  2R7X A;  3C2G A;  5J8C A;  2VOD A;  2M7B A;  3J7Z I;  2L9V A;  3EPZ A;  2ESH A;  3FKJ A;  4HYE A;  1KU7 A;  3ABK H;  3GTK J;  1JTY A;  2QKL B;  3R4K A;  4D5F A;  1T0F A;  1W4M A;  1D0Z A;  4BEH A;  2W84 A;  2Q2E B;  5D4S A;  3U9G A;  4A5N A;  3QP6 A;  4Q5S F;  4EJV A;  1N77 A;  4KJZ A;  1XMX A;  1T38 A;  4D7N A;  1AHD P;  3ZQG A;  3HOX J;  1E0E A;  1WCM J;  1IW7 F;  2MD5 A;  2E1N A;  3K4C A;  2HQ5 A;  5HLH A;  2LNB A;  2V79 A;  4JK1 X;  3KP4 A;  4IJA A;  2XGX A;  2YPR A;  2R7T A;  4UHT A;  4NUB A;  2FE3 A;  3FXK A;  3QQA A;  1IN4 A;  4HEA 2;  2M5W A;  3WTV C;  5IP7 J;  5BOX A;  1LFU P;  2O3F A;  1P2F A;  3L7W A;  5E79 C;  3CUQ A;  2Q2E A;  3LAP A;  4I6Z A;  1S72 I;  2W7N A;  3BLY A;  2GA2 A;  1MBJ A;  4IPA A;  2P81 A;  2IGK A;  1IAW A;  2BBY A;  2BY0 A;  4MEY F;  3BDD A;  4A3I J;  3HC7 A;  2FF4 A;  3J81 Z;  3Q5F A;  1IXC A;  2WAQ N;  5J40 A;  5M5X J;  3HG9 A;  2JSP A;  2Y75 A;  5AON A;  1IXR C;  2KJB A;  2XGD A;  4X6A J;  1WJB A;  3TDU C;  1G4D A;  4IHT A;  1JKR C;  1FBQ A;  3DFG A;  4A6D A;  3CJQ B;  3HIF A;  4UY8 I;  3ABU A;  2DMQ A;  2P6S A;  2K3P A;  4OIN F;  3BPX A;  4KT5 C;  3PJR A;  2ZSH B;  4BL0 B;  1K7A A;  3K4L A;  1UMQ A;  2BHY A;  5FFX A;  4CXF A;  4RAZ A;  3AG3 H;  4CCO A;  5BS6 A;  1NK2 P;  1MW7 A;  1Z21 A;  1TQP A;  2HNH A;  2D1H A;  1ETW A;  4GGG A;  1FY7 A;  2F4M B;  2TDX A;  2O61 A;  4EJW A;  2EZI A;  2QQA A;  3Q0W A;  2XAF A;  4RGS A;  2BE5 F;  1MSE C;  1QQI A;  2QQB A;  4XSZ F;  3HPG A;  2IGN A;  1OYW A;  2JN6 A;  2EQR A;  3OYI A;  4P9U A;  2UWM A;  2Z99 A;  2HTS A;  3O3K A;  5JLX A;  1TC3 C;  4NB5 A;  1VQ6 I;  2E7X A;  2D1V A;  1ETV A;  3H9G A;  3HZJ A;  1VQN I;  1U5T A;  3BR6 A;  2CUJ A;  4EV0 A;  3H5A A;  3HTU A;  3IHU A;  3LSK A;  4A0X A;  3A02 A;  1GXQ A;  2BY3 A;  2CQQ A;  3MZY A;  4LOC A;  2B0L A;  2CQX A;  4L5E A;  2VBX A;  2E1C A;  3I4N J;  3OYK A;  2STT A;  1WGX A;  2VIX A;  3SXY A;  2KL4 A;  3H0G J;  3GLL A;  4JQF A;  3ZQI A;  2M9H A;  4IHS A;  4CCM A;  3U2R A;  4ZYA A;  5KAI C;  5E3M A;  1DDN A;  2XC7 A;  3B6C A;  4UV8 A;  4ENM A;  3M8E A;  1FIA A;  4Z2Y A;  4J19 A;  2P4W A;  4HST A;  4B47 A;  2IP2 A;  4B1R A;  1U2W A;  3BG3 A;  3OYJ A;  3ASO H;  4E70 A;  5DD8 A;  1W7P A;  2K7L A;  2IBD A;  1F4K A;  3LWF A;  3IP4 B;  1DU0 A;  3I59 A;  3HUG A;  2HDC A;  2EIN H;  3G1O A;  3T1B A;  3VPR A;  2AO9 A;  3NWT A;  4ZDP A;  4UNO A;  2PMZ N;  1VF9 A;  2ZNY A;  1OJL A;  4E7S A;  1DU6 A;  2D45 A;  3A01 A;  3WTS C;  1A5J A;  2MBF A;  3P7N A;  1MH3 A;  2G7U A;  5LBQ A;  3CF5 F;  1SAX A;  2JRM A;  5K5O A;  1VQO I;  1CGP A;  1SVM A;  1ZRD A;  4KYW A;  4KIT B;  2KLO A;  4L9T A;  3G73 A;  3MWM A;  1I1S A;  4CCK A;  3J80 K; 
#chains in the Genus database with same CATH homology
 3CD6 I;  1VQ4 I;  3J7Y J;  2NXN B;  4IOC F;  5GAD J;  1VQM I;  3CJT B;  3CCQ I;  5JVG F;  1YJ9 I;  1S72 I;  1YJW I;  1VQ7 I;  1FOW A;  2E35 A;  3CC2 I;  4IO9 F;  3G6E I;  3CC7 I;  2FOW A;  5DM6 F;  5GAH J;  1ACI A;  1FOX A;  3CCL I;  3CC4 I;  1YIJ I;  1Y39 A;  1HC8 A;  2E34 A;  3CME I;  3CMA I;  1YHQ I;  3CCJ I;  2JQ7 A;  3G71 I;  3CCM I;  2H8W A;  2ZJR F;  3J7Z I;  1QA6 A;  1YI2 I;  2OTJ I;  3CCE I;  1VQL I;  4IOA F;  3CCR I;  2QA4 I;  3CF5 F;  3I56 I;  5GAE J;  1VQO I;  1VQK I;  3PIO F;  2QEX I;  3CCU I;  3CCV I;  1VQ5 I;  4UY8 I;  2K3F A;  3DLL F;  1VQ6 I;  5GAG J;  1FOY A;  3I55 I;  2ZJP F;  1YIT I;  1YJN I;  3G4S I;  3CCS I;  1VQ9 I;  2ZJQ F;  2E36 A;  1VQ8 I;  1VQN I;  1VQP I;  4V19 K;  3PIP F;  1MMS A;  2OTL I;  5DM7 F; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...