2OTJI

13-deoxytedanolide bound to the large subunit of haloarcula marismortui
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
70
structure length
70
Chain Sequence
b'GVPPTAELIKDEAGFETGSGEPQEDFVADLSVDQVKQIAEQKHPDLLSYDLTNAAKEVVGTCTSLGVTIE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords 23S ribosomal RNA
publication title The Structures of Antibiotics Bound to the E Site Region of the 50 S Ribosomal Subunit of Haloarcula marismortui: 13-Deoxytedanolide and Girodazole.
pubmed doi rcsb
molecule tags Ribosome
total genus 13
structure length 70
sequence length 70
ec nomenclature
pdb deposition date 2007-02-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
I PF00298 Ribosomal_L11 Ribosomal protein L11, RNA binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.250 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Ribosomal protein L11, C-terminal domain 2otjI00
1VQKI 1VQ5I 5GAEJ 3CCJI 1FOYA 3CMEI 3CCEI 2E36A 2ZJRF 1VQ9I 3J7YJ 2ZJQF 1YJWI 1FOXA 3CC2I 3CCMI 3CCUI 3PIOF 3CF5F 1YJ9I 1VQ6I 1YIJI 4IOAF 3CJTB 4IOCF 2QEXI 3CC4I 1VQ8I 4IO9F 1YI2I 3I55I 5JVGF 3CCVI 3CCQI 1HC8A 1QA6A 3CD6I 5GAGJ 2E34A 5DM7F 1Y39A 2QA4I 2ZJPF 3PIPF 1ACIA 3CC7I 2FOWA 1VQ4I 1VQLI 2NXNB 2OTLI 4V19K 2K3FA 3J7ZI 3CMAI 5GADJ 3G6EI 1YJNI 1VQ7I 1VQPI 3CCRI 4UY8I 1VQNI 3CCLI 2E35A 1YITI 3G71I 2OTJI 2H8WA 3CCSI 5DM6F 1MMSA 2JQ7A 1FOWA 1YHQI 3I56I 1VQMI 5GAHJ 1S72I 3G4SI 1VQOI 3DLLF
chains in the Genus database with same CATH superfamily
4KN4X 3BTLA 5TISC 1VQKI 3HOZJ 4HF2A 4QLCU 2D2WA 4RB3C 3LSKA 2ZXJA 2HTJA 2MYSA 2HOSA 2NS7A 3LMMA 5E3MA 4CICA 4EGYA 2YU3A 2ZJRF 3ZQFA 1HW2A 2XKOA 3GTQJ 2R3SA 3BZKA 1V5FA 3PO2J 3J80K 2ZCWA 5KK1A 4M9ZA 4BDYA 4MLOA 4DYRA 2PN6A 5CQGA 2W25A 3U21A 2LKXA 2V6CA 1XSVA 5E20A 3ZQGA 2R93J 3PNYA 3OSFA 1MNMC 1R4NB 5D8LB 2K3PA 3E5XA 3KP3A 3Q9SA 3SJMA 4S04A 4F92B 1J2XA 4JP0A 1XG1A 4S0HB 4LG0A 2R7UA 3MEXA 1MNDA 3LQRA 3F8FA 2QGUA 1J7KA 1WJDA 1AWCA 4R8HA 3EUAA 3F9KA 4L9JA 2J5OA 5K5OA 2KRHA 2ZFWA 1XDUA 2AHQA 2ZJPF 2O7OA 4Y17A 3KP6A 4IPAA 3FK7A 3K6GA 4CYCA 1JUMA 1VQLI 3JREA 2FJ1A 3EDPA 3TO7A 3T5XA 3BCBA 2ETHA 1Z3YA 2CUFA 1JJ6C 2HTSA 4ZYDA 3CJQB 2KHMA 5JHFA 2EA2A 3A01B 3TW6A 1BIAA 1XS9A 2X48A 2OCCH 3C18A 2BBYA 5GADJ 2JRMA 3CJNA 2V79A 3EUHC 4P5OA 1U78A 1JGGA 5C3EJ 2OC6A 3HM5A 5CVRA 3V7SA 1VFCA 3CESA 4ESJA 1HLVA 3GFLA 4A3GJ 4CCKA 3PO3J 3S93A 1QVTA 3CCRI 5K7ZA 3GTLJ 4OWRB 2ISYA 1F5TA 5B1BH 2K7LA 1VQNI 1T33A 5L3GA 2AQEA 3GZ5A 1NK2P 1JE8A 1XB4A 5HS9A 1Z0XA 3H9GA 1HW1A 1XGOA 2Z9OA 3P7NA 3SEQA 1G8XA 3J80Z 3HOSA 1XGSA 4XN3A 3V42A 2HVQA 3BQZA 3R60A 2DT6A 2QWWA 3OS2A 3C1DA 1I3QJ 3GUDA 2MD0A 1USTA 2LY2A 3OYFA 3ZRGA 1HBXG 2V6EA 1IF1A 2XC7A 3QRFF 2EBIA 2JRTA 2P81A 4G8XA 2VQLA 2WY8Q 1D1CA 2DTRA 3D0SA 1ETXA 4UUSB 5KCMA 2DA4A 4DOZA 3BP8A 2DQRA 4WXDA 1W7PD 3LSHA 4Q5SF 1SFXA 4F52A 5GAEJ 1BC8C 3IAM2 3HOXJ 3CMEI 4P9UA 2LMDA 1I1GA 1SD5A 4PSWA 2K9SA 3H0GJ 1BR2A 3GFIA 2PG4A 1H89C 3F72A 1OFCX 3MQ0A 3NEUA 3HYIA 1JHHA 1MBKA 2XF5A 4GDFA 1P6RA 1D8JA 3ESWB 1B4AA 5HLGA 5HDKA 3NAUA 2FEZA 1NG6A 5EEGA 4AUXA 3CF5F 3V8JA 2V26A 1R5HA 1I39A 5BPDA 1FYKA 1LFPA 2ECBA 3CLQA 1F9NA 5F27A 3OYKA 3MZHA 4RAFA 3A4CA 3VEPA 1DQUA 4BHPA 2JTVA 3WTVC 2HPMA 1YO5C 4XL9A 1KU2A 4ZDLA 3BTIA 1Q1HA 1TWAJ 3BZCA 2Y30A 5FKMA 2XAFA 4L9NA 3WG7H 4C2MJ 2P5LC 4QPOA 2MH2A 3FXMA 3DBHB 4A3BJ 2RAEA 2CFOA 4OIRF 4BY7J 2HOEA 4M71A 3BR2A 1RNLA 1KA8A 4C2TA 2IP2A 1FNNA 3LA2A 1YFHA 3ZN0A 1MSEC 3KFWX 3GLXA 1AA7A 1WJAA 3SZPA 1TWHJ 2HWVA 2BHZA 4YIIA 3DPTA 4U87A 2FSWA 2UXXA 2Z5UA 3ZMUA 1G3WA 3KP5A 4DBQA 1AKHA 2BW3A 2W7NA 5J1UA 1IN6A 1YE9A 5CPRB 2CRGA 1OQYA 4WK8F 1V4RA 3D5RC 3E97A 4OAZA 4DZPA 3L2VA 3LSRA 4PJ0C 2D1HA 1IGNA 2A61A 3UR3C 1S7OA 2RN7A 4U88A 4AIDA 4B4CA 4KA4A 2ID6A 3KZIC 3HRUA 3K69A 4Y3OA 2XPWA 5J1YA 4RAYA 1OPCA 4QPQA 1QO0D 5EJCA 2GM4A 1MIJA 5JHUA 4FCYA 5E8IA 3HC7A 4G6QA 4N9IA 1WRJA 1OCOH 2JZYA 5CLSA 3F23A 1T8IA 3S15J 3CDIA 1LB2A 2XUBA 3TGNA 2DBBA 2WC2A 5EG0B 1FMWA 3HHGA 3OYNA 1ETOA 2VJJA 3QQAA 2M2EA 2V7FA 1ZGJA 3E6MA 2WAEA 3K0LA 1K4TA 4Y33A 5IYDJ 5J47A 5LHHA 1WGXA 2UWMA 2EH3A 2VBYA 5ILUA 4LIUA 5C4XJ 1V3FA 2DDAA 2RNGA 1OYYA 1FOXA 4XLFA 3FF5A 6PAXA 1GXQA 4PSXA 3DEUA 2DQLA 2QCOA 4IOAF 2ZMEB 2L5QA 1RR7A 2RGVA 4MGRA 1YI2I 1K83J 5F08A 4ZDPA 2VOOA 3QPHA 1UZCA 3QPLA 2XRNA 1T0FA 4A3LJ 1VI0A 2R7RA 1FYLA 1PUFA 3CCYA 2DU9A 5F0FA 2B9SA 3SQNA 2F2EA 2P7CB 3ERMA 1K78B 1WH7A 1ZRDA 2MG4A 3BG7A 3DCFA 2RQQA 3ASOH 2IS6A 3CC7I 3WTUC 3FWEA 1ACIA 1P9QC 4G7HF 4DGWB 1B72B 4G7OF 1ZRFA 1XC5A 4P96A 2YU9J 1CF7B 5ED4A 3LSTA 2IBDA 5D5VB 3S32A 1AOYA 1RESA 1Y1WJ 2A07F 4J01A 4ZZDA 3CUOA 2DFEA 2IGOA 3D5SC 5JLWA 1YIOA 2DT5A 3VFZA 1YJNI 5JVTA 5D4RA 1ZELA 3JRIA 1VQ7I 1I3AA 3KIOA 1P4AA 3QU6A 1W1WE 1U5TC 1APLC 3IP4B 3OYMA 2Y9YA 3FK6A 3TL4X 4BE2A 2G7UA 3BROA 3ELKA 4Y15A 4BY1J 1ENHA 2LVSA 2E35A 2XDVA 4BJTA 2CFXA 2GOMA 2LDUA 3LSMA 4UV9A 4I09A 1S3JA 3MVPA 3OYCA 5HNFA 3R6SA 2F5CA 4BQNA 4HV5A 3A1YA 2NS8A 2MGQA 1O7LA 3M07A 4NDLA 5E1XA 3L1PA 3L2CA 3A02A 1HDPA 2ZC2A 1ULYA 3HSEA 3SXYA 1HOMA 1H8AC 5JFRA 4I0BA 2E2IJ 2ICWG 3QPSA 4KT5C 3BJAA 4ZC3A 4M3GA 1OMIA 1QZZA 3OYGA 5FFXA 3DTKA 5LD2C 2GA1A 1D0XA 3E1SA 3E5QA 4PGHA 3TMOA 1FYMA 1IN5A 4ZJZA 3R4KA 3GTOJ 4NBQA 2VT2A 2H94A 2M4GA 4NC8A 3VYTB 3ABMH 2FNPA 5CYVA 3UNGC 1XMKA 4I0AA 2CH0A 4JX6A 4L9TA 2BGCA 3VYRB 2VB6A 1FX7A 4ABZA 5D4SA 3EPZA 2A69F 1A36A 2A05A 1U5TB 2WV0A 2DDBA 4M3FA 2CQQA 4AIJA 3HTSB 5J8FA 1IV8A 2K27A 2FOKA 3RYRA 3I71A 1QQIA 3CCVI 3QYEA 4Z6YA 3CCQI 2DA2A 2ID3A 3TOAA 3WTYC 4JBAA 4XBFA 3AG4H 3DQVC 1LDDA 4BGDA 1BM9A 2E1NA 2VPLA 4AWXB 1ETYA 3QOEA 2HOAA 5DD8A 1ETQA 5HLTA 1T95A 3WGIA 3N97A 3Q5FA 4BL0B 3C7JA 4F3QA 4LB5A 2VODA 2M1BA 2VC0A 2R7OA 4PGGA 2E5NA 3NWSA 4XONA 3FKIJ 3FM5A 3K4KA 1O4XA 4BHCA 3K1PA 4HDUA 3O2PE 2LY9A 1XGNA 2ACJA 2OZUA 2CQKA 2QQ9A 5EEHA 4GFBA 4B3XA 1YOVB 2KIUA 2W24A 1T2KA 4AD9A 1HKTA 4I6ZA 3NARA 2A68F 1I5ZA 3WTSC 1O3RA 1ZRCA 4IQJA 1P4WA 2PMZN 1X58A 4HLXA 2VJ4A 1KYWA 1Z91A 4HA8A 3OSGA 3GO5A 1Z7UA 2Z16A 1W7PA 2MA3A 1N25A 2FD5A 4IEJA 3PQJA 4CCLA 2XPUA 4OIOF 2HEOA 4IHXA 1TC3C 2NVXJ 2NOGA 3RCOA 2B0LA 2HYFA 2CSOA 2FBHA 4RAZA 3WE2A 2E19A 4AYBA 1M1EB 3FBNB 4UNOA 3Q9VA 5DTDA 4PJJA 3KETA 2LR8A 4JQFA 1QBJA 3V8KA 4D7MA 2EFQA 5HDNA 2DJNA 4EJTA 5TJJA 3WTTC 1TNSA 5K7FA 1XTAA 2XGEA 3DXJF 2X4HA 3I54A 2EV5A 2DA6A 4IL6C 2XRLA 4E7JA 4XKVA 1BW5A 3AG3H 2QSGX 3KEOA 2VT3A 4JK1X 1UFMA 1W4MA 1QNTA 2Z1DA 2HU9A 5HS8A 1R6RA 3TOBA 1P7IA 4YEJA 1K7AA 4AC0A 1MJ9A 3M4OJ 2XAJA 1TWFJ 2QBYB 2XF6A 3B02A 3VWBA 4C3HJ 4B3AA 4OU0A 1FEXA 3R61A 5LEJA 1ZYRF 2EZLA 2EZIA 2IA0A 3KLOA 3W2VA 2UUZA 1Y0UA 1BN5A 2Q8KA 5LLQA 2BYVE 2IA1A 1BI1A 3M1CA 1RKWA 2BEOA 3PFIA 2DODA 3TW7A 1JTXA 2DTZA 3EQLF 4JX4A 3GFJA 3CDLA 3ZMTA 5IT3A 1OYWA 1X1CA 1W0TA 3FISA 4PJLA 1K79A 4A3CJ 2H09A 2O03A 4TV7A 1FZPB 1OCPA 4MEYF 1OISA 3GMEA 1VQ4I 1HA8A 1ON1A 2NXNB 3L2QA 5BOXA 3RZOJ 2JSPA 1S7AA 2MD5A 5E3NA 4ENMA 1GT0C 5EF6A 4BYYA 3CMAI 5E3LA 1UHMA 1QZYA 4DQ2A 4OMYA 1U0JA 4LD5A 3MKWB 2LBFA 3FMRA 2P4WA 2QQ8A 3DPLC 2BHYA 2O8XA 4KICA 3JSOA 2OZ6A 4PDKA 2HDWA 3MZYA 4X6AJ 3BR0A 2R7ZJ 3BG9A 4F93B 4W97A 4UUTA 2EK5A 3P9KA 3H3ZA 3FXUA 5FKKA 3OYLA 3K70C 2H8WA 2QKLB 1U3EM 4PFPA 4N9HA 4I2OA 3HOVJ 3DF8A 1FP2A 2CJJA 2VBWA 2EV0A 1S8NA 2F6CA 2FF4A 1MMAA 4KUMA 1YW7A 4BU2A 1YTYA 1W0UA 3DWLE 2CG4A 5DS9A 1NH3A 2NYXA 1X3UA 5M5WJ 4HZFA 5BMZA 5JR3A 3MKYB 3AG2H 2MBFA 3OMYA 2JJ7A 3JW4A 4LK0F 4MHGA 1IUYA 4XKWA 2LNBA 3ASNH 2Y0SA 3HIFA 3ZQHA 2BE5F 2J5PA 2VKHA 2HQAA 2KFDA 1MBJA 2L2OA 3L9FA 4BBSJ 4Y4RA 4CZZA 2LYCA 4C2UA 3L09A 4KN7X 4CHUA 3HOWJ 3VYSB 2XASA 3H9JA 3OYIA 3DBRB 3S2WA 2XROA 4M6YA 3RPQA 3IRRA 3BJ6A 2R5ZB 1KQ0A 3P9CA 3I59B 1R5ID 3CUQA 4NQWB 2CW0F 2R7VA 3CMMA 3M8EA 1RIOH 1ZGAA 1YJ9I 1R1VA 2M5WA 2UZKA 2HI3A 4BQOA 1E2XA 1MBGA 4A2UA 4CA0A 3CC4I 2PMHA 1TW2A 3WTWC 3H92A 4Y7NJ 4IHYA 4X1EA 5JLXA 3OR2C 3X2QH 4EEFG 1NG7A 1YYVA 4HG2A 3I9V2 5JVGF 4ZH4F 1FSEA 4E7SA 4KITB 3H0DA 5GPAA 4HOBA 1LKXA 2X85A 1BC7C 3SHFA 1U2WA 4XN0A 3KP7A 3VSLA 2K9QA 1EV7A 4KYWA 3C2BA 1NK3P 3I4MJ 3M3YJ 3B6AA 2KIMA 2OD5A 3NWTA 1AHDP 4L5JA 4DW6A 1MMGA 2D1VA 4B1RA 1S5LC 2K3FA 4E7IA 1MBHA 1Z3XA 2FA5A 2QENA 5ILVA 3R0JA 2A3SA 3WGGA 1CGPA 1P2FA 2R4GA 4OINF 3LNQA 1IV6A 3WU1B 2VASA 3SZGA 2NVQJ 4FE7A 3PFYA 1KU7A 1Z6RA 4CZCA 3L00A 2NRAC 2ZKZA 1TBXA 4HX8A 2OBPA 2HFHA 2IA2A 4UXNA 5J6XA 1R00A 4LJZF 3E6BA 1ODDA 3E7LA 4HDVA 3DTIA 2D45A 2IS2A 1SANA 2R92J 1MD0A 1BI0A 5EG0A 3AG1H 3HGGA 2HR3A 3ML6A 4UHTA 4RB2C 1ZR2A 3LA3A 3CCSI 1ZAOA 1Y1VJ 4M74A 1S9HA 2V9KA 2X6YA 5IP9J 3GTPJ 4IJAA 2YUSA 1X1AA 3IH4A 3M9AA 1T6SA 1XPXA 5KVRA 3BT9A 3RJPA 4BJ5C 4CH7A 2IT0A 4ZDOA 3RKWA 3C2GA 2KPMA 1RI7A 2R7FA 2CMPA 5LGTA 4WF2A 1MSFC 2JMWA 4CCMA 2STTA 1Z21A 4RM3A 3E3VA 4PUSA 5IYBJ 2VIXA 3HZJA 1WH5A 3BLYA 3RI4A 3GTKJ 3KE2A 5E1WA 3C3WA 4E7HA 1OCRH 4JYKA 2XHKA 4A12A 3ZGKA 3ONQA 2DFHA 2VC1A 3ZQIA 4ZYGA 2ZJQF 3HHHA 3O6BB 1ITYA 3P9IA 1R22A 4E70A 4EATA 3OOPA 1EJ9A 1T56A 2NNYA 1XD7A 3CCUI 2GLOA 3KEYA 5ICCA 3W2WA 3GTJJ 1ERDA 1SFUA 1YX5A 2MFZA 3O3KA 1V5EA 3W6KB 2Q0OA 3LOCA 2IEKA 2K5CA 2BY3A 3HKZN 2L4MA 1GLNA 2AXTC 5CQEA 4XOTA 3BQYA 4DNCA 2XSDC 5EGOB 5FRNA 4CCJA 4LITA 5M5XJ 2E1CA 1JXSA 1QPMA 2BOLA 4FT8A 5J8CA 2X1DA 3RDIA 5B66C 2VKDA 2O3FA 4A5MA 3BR1A 3PNVA 4RGRA 3FX3A 4RB1A 2E34A 5HNHA 2AQFA 3ABUA 2W57A 1OR7C 1YW9A 4LG3A 4CYDA 3K70D 2FBIA 3Q0WA 2Y0SN 3KCCA 5IYCJ 2KQRA 1G6NA 3CLOA 2ZJ2A 1IG7A 2MLGA 3S17J 1Z05A 2DMNA 3S1MJ 3CQZJ 5FKLA 5FJ8J 2GIVA 3IKTA 1SVMA 1MNEA 3G1OA 2X6WA 1T98A 2WAQA 1DPUA 1F4KA 4R79A 1D5VA 2P5VA 2CV0A 5BNGA 1MH3A 2IVMA 2M45A 4IHVA 4UY8I 3OS0A 5E3OA 2L0KA 3IH3A 4U0WA 3BR5A 2V9PA 1B59A 2E2JJ 3LL7A 1UG2A 2R7SA 3DTEA 3LQQA 1TTYA 1DDNA 2QSHX 2QVOA 4G7ZF 2VUMJ 5CVVA 1MW7A 1YHQI 3TO6A 4IZZA 4ZYHA 1E3PA 1V55H 1WPKA 2ECCA 2Y9ZA 4KIBA 3J7AO 1A5JA 1GHCA 3ZMSA 1BJAA 2EJRA 2Q2EA 3JCUC 3ROUA 3HSFA 4Y52J 4OAYA 3I0TA 4RDUA 1J0RA 4XK4A 3DLLF 1L3LA 2ZMEC 4F55A 1XX5A 4WXCA 1WFXA 3JTHA 1VQ5I 3E6CC 4I7HA 3AFHA 2XB0X 5FD5A 2CO5A 3OYEA 1SMTA 1FOYA 3OWTA 1ZR4A 1G59A 1FTTA 2WADA 2PMUA 3GBGA 2E36A 3H3UA 1VQ9I 2ZNZA 3KYDB 2H8RA 4E6KG 2ESNA 3KP2A 5L3DA 2E60A 2IJLA 4RGXA 2F4IA 1HW5A 3F8CA 4ESFA 4A5NA 3S16J 5CVJA 1FY7A 1UELB 2HXIA 1ZLJA 3QWLA 4LG0B 2M87A 4A0XA 1B8IB 2L9RA 2WAFA 4XLEA 3W3CA 2OPTA 1SAXA 4CCNA 1MDMA 2CV1A 3WU2C 3OYHA 2E7XA 2W48A 1LE8A 2KLOA 1J75A 2X9DA 4XKCA 3SFIA 1D0ZA 1X2NA 2H6BA 4CYCB 2A6HF 2IAIA 1LVKA 4QTRA 3LFKA 3OL3A 2HZDA 1JKOC 5C44J 3BR3A 1BA5A 1I1SA 2LP0A 4MEXF 4BJ6C 4XSXF 2JUCA 4G6TB 4JX5A 1BIBA 4LB6B 2DOEA 1IN8A 1W5CC 2EINH 4LGWA 2VN2A 3MKZA 4DYCA 1WZ2A 5E17F 4O6JA 3OIPA 2ME0A 4CCOA 2VBXA 1B9NA 2L9SA 4G12A 1TZLA 4FX4A 2XSJC 1FWZA 3GYHX 3J7AY 2VPRA 1FTZA 2H1KA 5HS7A 1N75A 2LFBA 3I58A 3G6EI 3VDXA 1S29A 2P6SA 4RMNA 1NHAA 4KFCA 2VONA 4D0PA 3IWZA 2L3DA 4DJAA 2B7EA 2FMLA 2OCEA 5E8GA 2CQ7A 3T1BA 2CUJA 3A2KA 3ZXSA 4GCVA 1R7JA 1YITI 3T8TA 1RR8C 3S3OA 2L02A 2WB1A 3PUBA 2XV4S 2NAZA 5J3LA 5DM6F 5FKOA 4RA2A 1P4XA 3ZQCA 5DCMB 2DOFA 2HVRA 2FRHA 3SFZA 2DFIA 3H3VK 2LY1A 3HOUJ 3FMQA 4AVPA 4KT6A 1Z77A 2W82A 3QAHA 4D5FA 3EUKL 1BJZA 5LHGA 2VQCA 5HDGA 3HJEA 4C3IJ 2PJRB 1S7EA 3KYLA 2KZGA 4C9YA 2PI0A 1V54H 3I53A 2MW8A 2Y2ZA 1HF0A 2QBYA 3TQNA 1MZBA 1H9GA 2M0CA 3JRFA 4UUVA 2Q1ZB 1QVUA 2LOOA 4A93J 4CGZA 2ME6A 4HV6A 4N4NB 3ZP5A 1IRZA 1JUPA 1R1TA 4BEHA 1RETA 4EVIA 4MIMA 4BE0A 3Q0UA 2XGCA 3RQIA 3M7GA 3HUGA 3WHBA 4B44A 5AONA 2HS5A 2KZVA 3CCMI 1R36A 5F1RA 2F5FA 4ENJA 9ANTA 2BXYA 3U2RA 5TRDA 5LEKA 4IO9F 3DP7A 3RTRA 4H4KC 2X1EA 2ZBKA 3TP0A 3F21A 2V1DA 2JPCA 3QOPA 2VE9A 3DV8A 1R58A 3HOTA 3BG5A 3IH2A 4U7BA 1HSJA 2LD5A 4XLCA 2JUGA 3VPRA 2BXZA 2IS1A 1D0YA 1K61A 1X4OA 4L5IA 1A04A 4HSRA 2L4AA 1IRGA 1AKHB 2GZWA 4IVNA 1ZK8A 4HNTA 1BI3A 2KRFA 3A0HC 3BPVA 4XKBA 3RQ4A 3WTZA 3WTXC 1EA3A 1KU3A 3HGYA 5AIQA 2ISZA 2VJ5A 3DU5A 3H36A 1KZHA 5HOOA 5EYRA 5L3FA 3OV8A 2HQ5A 4L5EA 2I5UA 4XRMA 5E1ZB 3RSNA 2DMTA 1ZKGA 2PFBA 4D7NA 2ZXIA 4J00A 2JVHA 1DGRM 2JSCA 2XAGA 5DDGA 1U6GA 2Z33A 5M3FJ 3HRMA 4M9SA 5D5XB 1T0FC 2DT7B 2P5KA 3DPUA 4OMZA 2X1CA 1I6HJ 4I01A 1C0WA 3ABLH 1KONA 1WJFA 4RBOA 2UV1A 5FRMA 5J40A 2KIQA 1PP8F 4CXFA 2K4BA 3JRDA 2YPRA 2F5VA 4J19A 1FOWA 3RZDJ 4U0YA 1VQMI 1UAAA 5GPCA 1IC8A 1HXDA 4G94A 1LFBA 2KKOA 4MTEA 1ZGWA 1WSUA 3F3XA 3FZVA 1BR1A 1UHWA 3HPGA 1IXSB 3I3LA 2DW4A 3PSIA 2JA2A 4HEA2 2DJIA 3CMYA 4RM2A 4NC7A 3LAJA 3ZMDA 4MO7A 2WBMA 2XPVA 3VODA 3BJOA 4HX7A 4M6VA 4GYIA 2VLAA 3K4BA 5K5QA 1DU6A 5ICGA 4A69C 1D3YA 1JT0A 5LFAA 3FM3A 2V1UA 3S2DJ 3CO7C 3HBLA 4HNVA 5LGNA 4P9FA 3LSPA 1D1AA 2LRDA 1E0EA 5JI6A 3AAFA 3HOYJ 1F1ZA 2MC3A 5DD4A 4NB5A 3IV5A 2CGPA 2N8GA 1BOAA 2Z3YA 4B47A 1PUFB 1PVEA 3KEQA 2A5YB 3LA7A 1VF9A 4K2EA 1SC7A 4BS9A 2R7WA 1R1UA 1ONVA 2WB1N 3GX4X 2CQXA 1DPRA 2DA5A 2VXDA 2R7DA 3QP6A 5CJ9A 3H5NA 1KQ8A 4LOCA 2ZXWH 1HC8A 2EFPA 1I50J 2GBYA 2RQPA 1BL0A 3DBLB 1SFKA 3DKXA 1XMXA 4YRVA 2R0QC 2F4MB 2HGCA 1DUXC 2F5DA 1ETVA 4EQQA 4CSWA 3SEZA 4M9XA 3PIPF 2XAQA 3GTMJ 1FOKA 3R0AA 3RYPA 4A3JJ 2FOWA 3KZYA 3I4PA 2W00A 2ZFUA 4PFOA 2XAUA 2EPFA 5B1AH 3BTCA 1UMQA 2CUZA 3DFGA 1REPC 5H2FC 3U1DA 3FMSA 5GP9A 4RAGA 3JAMK 3RKXA 5FROA 5IOYA 1GDTA 2OQGA 2EZKA 2X51A 3L7WA 2VKEA 1OCZH 5FB2A 3GF2A 2LK2A 1FSHA 2HYJA 5K5RA 2X6XA 1XGMA 2ZNYA 1JTYA 5F0CA 3T0YA 1X3WB 3A01A 1UJ8A 5LGUA 4DIQA 4HW0A 3FKJA 4G6DA 1R49A 1EH8A 2KDOA 2WY7Q 3K1NA 2VQGA 4QIWN 4PCQA 2BY2A 4XLAA 2NVUB 1WVRA 2G9WA 1X19A 3QYBA 1ETKA 3BCAA 1L0OC 1WCMJ 2UXNA 2Y0MA 4M73A 2WTEA 3RPUD 3I64A 5L3EA 2M3AA 5H6QA 5E18F 4EGZA 1ZG5A 5FLXK 3A0BC 1VQ6I 3KYCB 2HDCA 1S72I 2EFNA 3HRSA 4HLYA 3L2WA 2DCEA 1R23A 1A35A 2AO9A 1BI2A 3MZ8A 1TQPA 1SD4A 1ZG3A 1NTCA 1T08B 5FGMA 2EB7A 4IHTA 4WCGA 3OIQA 1X1PA 4E7ZA 2ZSIB 3OOUA 1SVLA 1ZHFA 2Y69H 3EYIA 2DAOA 4UUSA 1B1BA 4M3DA 1IDYA 5TGTA 2CW8A 3B6CA 3KZZA 4XICA 4WWCA 2HQRA 3BG3A 4D1QA 4E4HA 4AIKA 2FX0A 2ELHA 5EGOA 1JKQC 1IUFA 2HZTA 3M8FA 1J09A 3E0JB 3JAMZ 3LSGA 3ECHA 3G1LA 1VQ8I 2O9LA 1TP4A 3Q3SA 3EUHA 2F5EA 5BS6A 4HYEA 4EV0A 1LNWA 3AKZA 4CUGA 1D8KA 4I02A 2DMUA 2K9MA 2ESHA 4HAMA 5DYMA 2H1LA 1YG2A 1JKPC 3NRVA 1SEUA 4A3MJ 4G9YA 4I98B 1WWXA 3CP8A 3SZTA 5DM7F 1Y39A 1GVJA 2HVSA 4FE4A 3OYDA 3E5UA 1JKRC 3WU0A 3LAPA 4XORA 2BY0A 2QM3A 4UVCA 1IAWA 4NUBA 3M8JA 4B09A 4HF0A 4A0ZA 1O57A 2EWNA 2HNHA 2GXGA 2HPIA 4M6XA 3ISPA 1R4MB 5FLXZ 2NS0A 2KL4A 4M72A 3K4MA 4AYBN 1W7PB 4XIDA 4A3DJ 1ETWA 4O5VA 2HQNA 1Y56A 3TKYA 3QU3A 4ZYAA 3ZMZA 2E1MC 1K6YA 4D9JA 4Z2YA 3G3ZA 1LDJA 4M3EA 1LEAA 5FLVA 3F8BA 1WQ2A 4F7ZA 4WXHA 2FUG2 2AXLA 2E5ZA 2OQRA 4FETA 1UB9A 3CTAA 4PZJA 1JGSA 2DMQA 5BQTA 1TNTA 3QYFA 2G7HA 2I10A 3M1EA 2OTJI 3GWZA 5B3SH 2BY1A 3TBIA 4V2GA 1OR7A 3PJRA 2PBIA 2P7VB 1Y8QB 1SAUA 4A0YA 4XLNF 1OYIA 2R5YB 3DEEA 4HBLA 1IRFA 4KJZA 2OF7A 1W36C 2P0WA 4XMYA 1JT6A 4RB0A 1XCVA 1UG0A 4MNUA 2M7AA 3IHUA 2CYYA 3CCJI 4BXFA 5LBQA 2HYGD 1SD7A 3RKQA 1B8IA 5D5UB 3GTGJ 3Q0VA 2X6OA 3FIWA 4OOIA 3J7YJ 1D5YA 3QP5A 2PX9A 1YJWI 3S2HJ 1MBFA 2K02A 2COMA 3OY9A 3IL2A 1U8RA 4KNYA 2E1MB 3K4NA 1ZG1A 4UV8A 2EFWA 4I99C 2DFFA 1EKEA 1O3QA 1GV2A 3BTJA 2R7QA 3C2HA 2L7MP 2O8KA 4OIPF 5ICEA 2DOAA 4HF1A 3W6VA 5H20A 1FMVA 3UKGA 3PUFA 3IWFA 3JR9A 1B9MA 1MJBA 1PJRA 4IXAA 5J4VA 4XLPF 4YELA 5D8KB 3JRBA 1PDNC 2ZMEA 2DI3A 2W85A 1HSTA 2MH9A 3ZQ7A 1DGWY 2FBKA 4IRIA 3S14J 2EIJH 2XGDA 3VOEA 4P1WA 1ZLKA 4MTDA 2QA4I 3GFMA 4ESBA 2V1XA 4YIFA 2KIFA 3S3NA 1KQ9A 1YLFA 2F4OB 1TW3A 3HG9A 3IUOA 3L2UA 4IHSA 2LBFB 5LHIA 3HSRA 1TQMA 1U9OA 4IF4A 1EH7A 1SFEA 2OTLI 1IN4A 3CUQC 4GRIA 1K78A 4DBRA 1G4DA 1A6QA 1SMYF 2LF8A 5K1YA 3WODF 1TQIA 2CWEA 4YIRX 5DUKA 4BXUA 1B72A 2ZO4A 2FU4A 4KIFA 2L9NA 2GQQA 2YS9A 1CF7A 1TLHB 4H0EA 1JJ8C 3KPHA 1YW8A 2IS4A 1YRNB 2DXIA 4PJMA 5DCMA 1A31A 2EILH 4LIVA 3CCLI 4BHBA 1HQCA 4HNUA 2PQ8A 4EM1A 5EEAA 2E71A 3V8LA 2EFOA 4YG2F 4EJUA 2C6YA 1I27A 2HXOA 3G71I 2O6GE 4S05A 5IPAA 3HRTA 5L3CA 3FDYA 4CDGA 4L9VA 2JA6J 1FP1D 5FLMJ 2PJRA 4KIGA 5F1JA 2VI6A 5KHDA 4QSHA 1BOBA 5ICFA 5GAHJ 4IX7A 1IRXA 2COBA 4BBRJ 2W1OA 3LSIA 1IXRC 2M9HA 3G4SI 4A3KJ 3WE3A 3KLNA 3H35A 3MKLA 2GOXB 3QPTA 4GYGA 1AU7A 2DPDA 3F6OA 1OKRA 3CUQB 1F43A 1U9NA 1ZN2A 3V4GA 3CCEI 2E2HJ 5E79C 2EQRA 2V4JC 1STZA 2FXAA 4BDZA 4A3FJ 3CC2I 4GXOA 1FIPA 4EM0B 4ON0A 3DEWA 3S1QJ 2ELKA 3HTUA 2DA7A 3H5AA 1IW7F 1KGSA 2KJCA 2WWYA 1FBUA 1F36A 5FFZA 3GCMA 2VOPA 4IQ4A 4EM2A 2V9VA 3MWMA 5IT9K 1RRJA 5EZHA 1K4SA 3G73A 4LK1F 5H6RA 1U5TA 4B48A 1Z6TA 1V5GA 5DUIA 3CD6I 2W4SA 3W2AA 3D5LA 2WA0A 2K9NA 2LTPA 1ON2A 2CW7A 2YX7A 4MFDA 4U0VA 4EMSA 1RUNA 1ZREA 1H9TA 5K7HA 2M4KA 4AM3A 3K4CA 4NNJA 2AS5F 4C3JJ 4LMYA 2RREA 4MFEA 3OS1A 3J7ZI 2O61A 1IDZA 4XOPA 2KRCA 2TDXA 3MN2A 3S8PA 3T8RA 4ANJA 4ZTJA 2HKXA 2BVMA 3F8NA 1JI8A 1D1BA 2K85A 3JRGA 3JRAA 2Z2SB 3RPUA 4AU7A 1R5GA 2JT1A 3CO6C 3OIOA 5KAFC 5HLIA 4BE1A 2CS3A 3PNTA 2LREA 2M8EA 1W36D 3COAC 1OCCH 3QODA 3ZCOA 3FXRA 5IY5H 1HKSA 1IXCA 1CQTA 1MKMA 1I6XA 3TDUC 1FLIA 2DO7A 2KT0A 3K4LA 4OIQF 4ENNA 1H88C 4XRSG 1LJ9A 4HQEA 2QQAA 4FHTA 2GXBA 3I5UA 5B5EC 2LH9A 3BOQA 3BZ6A 2M34A 3I56I 3BWGA 4R1HA 2QUFA 2O5RA 3EETA 1VNDA 1FJLA 2M8GX 3GZNB 2DA1A 3BY6A 2XVCA 1DP7P 2QQBA 2CUEA 3S3MA 2PMZA 4N0BA 1VQOI 2LKPA 2JN6A 4KMFA 2IXSA 5IT9Z 3V7RA 1TWCJ 4L18B 1N78A 1E3HA 1O3SA 3FXKA 4JOMA 5J1RA 4HPQA 4B43A 1W5SA 1XSXA 4ZZLA 5ERIA 2G0EA 2MLKA 3B73A 3VYUB 2OA4A 5HLHA 5LRRA 2W84A 2V1NA 2TRTA 1G3SA 4YFNF 2EIMH 3K4JA 3OYJA 1N77A 3KP4A 1T39A 2XKPA 3S1RJ 5HVQC 4QWQA 3WG9A 3WHCA 3ECOA 3PIOF 2E1OA 2DK5A 3SDBA 1HCRA 1MJAA 4YFKF 3GVAA 2QEXI 4F91B 2OUMA 2QYOA 3I55I 2JA7J 4LLLA 2RVCA 1BBYA 4A3IJ 1LVAA 4AIHA 3CF2A 4O3MA 1Z67A 3K9TA 5F0HA 1ORKA 4BH9A 1QA6A 3FXJA 1G2HA 3GZ6A 1WHUA 2L7KA 2RNJA 4Y13A 2WAQN 3JRHA 2XF7A 3I4NJ 1S6LA 1J5YA 5CVIA 2VE8A 3RIRA 1JUSA 4DYQA 4BAYA 1RPWA 2XB5A 3DLAA 2IRFG 4B8XA 5KNLA 1WJEA 5A2QK 4HRIA 1FIAA 3H1CA 3BC8A 4M3BA 3TDZC 4XRSA 1WI3A 2OJED 2XAHA 3K2AA 1P7JA 5J4YA 2LG4A 4W1UA 2KISA 5D6EA 1X2MA 3O8GA 2LSOA 1BR4A 1YQAA 5LRSA 1YX3A 1MH4A 2QSFX 4D5CA 2VXZA 4KDPA 4RS8A 2DLLA 2JVGA 4NC6A 2DYSH 2EZHA 1GXPA 4UVAA 5CVUA 5L3BA 2L54A 3CJRB 1JHFA 1SVOA 4NHJA 1GVDA 4C30A 1X3ZB 4RLQA 1VQPI 2FMYA 5F04A 4Q47A 3ABKH 2BW3B 3S1NJ 2OU2A 4A6DA 4ASNA 2MABA 4ETSA 2FQ4A 4A6EA 3JTGA 2ADUA 4KMUX 2GIZA 4FISA 4II2A 1QPIA 1QGPA 1R71A 2Q2EB 3HDDA 3K7AJ 2R7TA 5F64A 5ILSA 4DZJA 1MMSA 2OAZA 2Z99A 1YS6A 1PYVA 1OLTA 2XGXA 4MQ9F 3RKYA 1PP7U 2A6EF 1GV5A 2E7WA 2IGMA 3DKWA 3MMYB 5AIPA 2YX4A 3GLLA 3OR1C 3MD2A 4IHWA 3BR6A 1YS7A 3FBIB 4I76A 1X1DA 2BVLA 3BDDA 2DK8A 2FNAA 1QZEA 3WGHA 4ITVA 3CZ6A 1UHSA 1J59A 3EYYA 2HKOA 1TWGJ 2RV8A 1WJ5A 3FXQA 3ZQQA 3N4MA 2IPQX 1OJLA 4IRGA 1KYZA 2DN0A 3TO9A 4YFXF 1SFOJ 2Y75A 1TL8A 1MDMB 2GXAA 2KJBA 5A2QZ 2ZB9A 4LLGF 1QU3A 1LE8B 1VTNC 2M7BA 4UB8C 3N05A 1YIJI 3CJTB 4IOCF 1G3TA 3SDGA 1HKQA 4FTHA 3TEDA 2R5ZA 3H9QA 4UB6C 2STWA 3I59A 3O8HA 4NQWA 3ABTA 5HODA 1IZ1A 2TCTA 1MMDA 2LLKA 1LEBA 3HL2A 3J81K 1Y0NA 5D5WB 1MBEA 2JA8J 2MSYA 5DEQA 5FKNA 5IP6A 5F6FA 1SD6A 4FX0A 4GO1A 3F8MA 2LF7A 1E17A 2I8DA 2FQ3A 2EIKH 3LSJA 2L7ZA 2FE3A 2DYRH 3K2ZA 4AVZA 4L0ZB 3FHNA 2K9LA 2IW5A 2QZ8A 1TT0A 2KDZA 3DU6A 2A6TA 1IO2A 2L9VA 3A03A 5EZGA 2XIGA 2KMUA 5DCFA 2YSRA 3ZOBA 2P6TA 5CKTA 2P8TA 3H5RA 5FO5A 5FD6A 3OYBA 3D1NI 2IGNA 2OV7A 2F48A 2PLYA 2L7FP 2CU7A 3PQKA 1Z1DA 4FQGA 1P92A 3MCZA 3VB2A 4EJVA 2KP6A 1LPQA 1O7FA 1WJBA 4XM3A 3HXLA 2R5YA 4XQFA 4HQMA 5M5YJ 3F6VA 4ENKA 2DPUA 4WX9A 4LLNA 3G1MA 2JWTA 2QKMB 1RC9A 4UVBA 1UCRA 2JQ7A 2VKVA 1EF4A 3IKVA 5KAIC 1LUJB 1IJWC 3GXOA 4IKFA 2ZSHB 3F22A 3HB9A 4PK4A 1A6IA 3BPXA 3V7CA 1Z7LA 1RKTA 5C4JJ 4RLFA 2RKHA 2JK3A 3MAJA 4U7DA 2GAUA 2L01A 2K40A 4RGSA 4BEHB 1POGA 1W5TA 3OL4A 2ZXHA 2BV6A 2RDPA 3J81Z 2JPBA 1XMAA 3ZQLA 3HPHA 3HUGB 3PM1A 1G3YA 1FBQA 1ZQ3P 1KU9A 2O0YA 2QF7A 1E3OC 3VSKA 3E6DA 4LFUA 3ZPLA 3ULQB 1USSA 4MQVA 3ZN1A 2H27A 4E7LA 3AL0C 1ZH5A 1EH6A 2RC4A 4XLHA 1GUUA 3FXOA 1LFUP 1TT5B 3CP2A 5D6FA 1X1BA 4BXXJ 2GA2A 1OCTC 5EDNA 1FC3A 5DV5A 4L0YB 3MFKA 4HSTA 1Y6IA 1QHGA 1DP3A 2EV6A 4EJOA 5GTIC 3U1KA 1LQ1A 2M0MA 1XDSA 2M30A 4Q48A 1Z9CA 4BUPA 4KISA 3NQOA 4BACA 3W6JB 4FASD 3K1MA 2NNNA 2VBZA 2NVTJ 2K4JA 2A5WA 2QLZA 2Y31A 3FHZA 1U8BA 1WKMA 1LDKB 5GAGJ 3GEZA 1T38A 3LWFA 3ZR8X 2ELJA 4ZTFA 4GGGA 2HOTA 3OYAA 4A3EJ 3ZMVA 4XR6A 1RZ4A 2MC4A 2K86A 4BKXA 3HKZA 4V19K 3GW2A 3TP3A 1H0MA 1QRYA 1Q1VA 1YRNA 1J9IA 5GTHC 2DA3A 2DMPA 3F0CA 2BZTA 2YR2A 1DU0A 1WJCA 1O3TA 2LC2A 3L2RA 4IRHA 4HX4A 1FBSA 4II3A 2NVYJ 2NOJB 4ZYEA 3P5JA 1BW6A 2Y48A 3G2BA 1K6OA 3AL0B 2H6CA 3IRQA 4N4OB 1ZTRA 4Q4ZF 3JSPA 3CDHA 1XN7A 3ERED 1WI9A 4RGUA 2PEXA 1XSDA 2LKSA 2B63J 2CQNA 1X4PA 3HEFA 2IGKA 4BQAA 4P55A 1ZARA 4XRFA 5IOZA 1MGTA 4CO8A 5M3MJ 2EA4A 2VQHA 1VZ0A 3KX2A 4X0GA 4BQQA 1FT9A 3SYTA 5BPIA 2R7XA 5IP7J 3FXLA 4PJNA 3REOA 3BG6A 1MMNA 2HDDA 4E7KA 1QHHD 3IAS2 3PL8A 2CV2A 2PJPA 4EJWA 1HDDC 1IN7A 2VL8A 1FPQA 1B6AA 2WV1A 1Y8RB 3U9GA 1R9TJ 1XCBA 3DKYA 3IC7A 2JA5J 4BNCA 2X0LA 2GWRA 3PSFA 3LFUA 4V2FA 4XNFA 2VJIA 1PUEE 4XSZF 1RUOA 3K10A 3JRCA 2D5VA
chains in the Genus database with same CATH topology
1VQKI 1VQ5I 5GAEJ 3CCJI 1FOYA 3CMEI 3CCEI 2E36A 2ZJRF 1VQ9I 3J7YJ 2ZJQF 1YJWI 1FOXA 3CC2I 3CCMI 3CCUI 3PIOF 3CF5F 1YJ9I 1VQ6I 1YIJI 4IOAF 3CJTB 4IOCF 2QEXI 3CC4I 1VQ8I 4IO9F 1YI2I 3I55I 5JVGF 3CCVI 3CCQI 1HC8A 1QA6A 3CD6I 5GAGJ 2E34A 5DM7F 1Y39A 2QA4I 2ZJPF 3PIPF 1ACIA 3CC7I 2FOWA 1VQ4I 1VQLI 2NXNB 2OTLI 4V19K 2K3FA 3J7ZI 3CMAI 5GADJ 3G6EI 1YJNI 1VQ7I 1VQPI 3CCRI 4UY8I 1VQNI 3CCLI 2E35A 1YITI 3G71I 2OTJI 2H8WA 3CCSI 5DM6F 1MMSA 2JQ7A 1FOWA 1YHQI 3I56I 1VQMI 5GAHJ 1S72I 3G4SI 1VQOI 3DLLF
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1VQK I;  1VQ5 I;  5GAE J;  3CCJ I;  1FOY A;  3CME I;  3CCE I;  2E36 A;  2ZJR F;  1VQ9 I;  3J7Y J;  2ZJQ F;  1YJW I;  1FOX A;  3CC2 I;  3CCM I;  3CCU I;  3PIO F;  3CF5 F;  1YJ9 I;  1VQ6 I;  1YIJ I;  4IOA F;  3CJT B;  4IOC F;  2QEX I;  3CC4 I;  1VQ8 I;  4IO9 F;  1YI2 I;  3I55 I;  5JVG F;  3CCV I;  3CCQ I;  1HC8 A;  1QA6 A;  3CD6 I;  5GAG J;  2E34 A;  5DM7 F;  1Y39 A;  2QA4 I;  2ZJP F;  3PIP F;  1ACI A;  3CC7 I;  2FOW A;  1VQ4 I;  1VQL I;  2NXN B;  2OTL I;  4V19 K;  2K3F A;  3J7Z I;  3CMA I;  5GAD J;  3G6E I;  1YJN I;  1VQ7 I;  1VQP I;  3CCR I;  4UY8 I;  1VQN I;  3CCL I;  2E35 A;  1YIT I;  3G71 I;  2OTJ I;  2H8W A;  3CCS I;  5DM6 F;  1MMS A;  2JQ7 A;  1FOW A;  1YHQ I;  3I56 I;  1VQM I;  5GAH J;  1S72 I;  3G4S I;  1VQO I;  3DLL F; 
#chains in the Genus database with same CATH topology
 4KN4 X;  3BTL A;  5TIS C;  1VQK I;  3HOZ J;  4HF2 A;  4QLC U;  2D2W A;  4RB3 C;  3LSK A;  2ZXJ A;  2HTJ A;  2MYS A;  2HOS A;  2NS7 A;  3LMM A;  5E3M A;  4CIC A;  4EGY A;  2YU3 A;  2ZJR F;  3ZQF A;  1HW2 A;  2XKO A;  3GTQ J;  2R3S A;  3BZK A;  1V5F A;  3PO2 J;  3J80 K;  2ZCW A;  5KK1 A;  4M9Z A;  4BDY A;  4MLO A;  4DYR A;  2PN6 A;  5CQG A;  2W25 A;  3U21 A;  2LKX A;  2V6C A;  1XSV A;  5E20 A;  3ZQG A;  2R93 J;  3PNY A;  3OSF A;  1MNM C;  1R4N B;  5D8L B;  2K3P A;  3E5X A;  3KP3 A;  3Q9S A;  3SJM A;  4S04 A;  4F92 B;  1J2X A;  4JP0 A;  1XG1 A;  4S0H B;  4LG0 A;  2R7U A;  3MEX A;  1MND A;  3LQR A;  3F8F A;  2QGU A;  1J7K A;  1WJD A;  1AWC A;  4R8H A;  3EUA A;  3F9K A;  4L9J A;  2J5O A;  5K5O A;  2KRH A;  2ZFW A;  1XDU A;  2AHQ A;  2ZJP F;  2O7O A;  4Y17 A;  3KP6 A;  4IPA A;  3FK7 A;  3K6G A;  4CYC A;  1JUM A;  1VQL I;  3JRE A;  2FJ1 A;  3EDP A;  3TO7 A;  3T5X A;  3BCB A;  2ETH A;  1Z3Y A;  2CUF A;  1JJ6 C;  2HTS A;  4ZYD A;  3CJQ B;  2KHM A;  5JHF A;  2EA2 A;  3A01 B;  3TW6 A;  1BIA A;  1XS9 A;  2X48 A;  2OCC H;  3C18 A;  2BBY A;  5GAD J;  2JRM A;  3CJN A;  2V79 A;  3EUH C;  4P5O A;  1U78 A;  1JGG A;  5C3E J;  2OC6 A;  3HM5 A;  5CVR A;  3V7S A;  1VFC A;  3CES A;  4ESJ A;  1HLV A;  3GFL A;  4A3G J;  4CCK A;  3PO3 J;  3S93 A;  1QVT A;  3CCR I;  5K7Z A;  3GTL J;  4OWR B;  2ISY A;  1F5T A;  5B1B H;  2K7L A;  1VQN I;  1T33 A;  5L3G A;  2AQE A;  3GZ5 A;  1NK2 P;  1JE8 A;  1XB4 A;  5HS9 A;  1Z0X A;  3H9G A;  1HW1 A;  1XGO A;  2Z9O A;  3P7N A;  3SEQ A;  1G8X A;  3J80 Z;  3HOS A;  1XGS A;  4XN3 A;  3V42 A;  2HVQ A;  3BQZ A;  3R60 A;  2DT6 A;  2QWW A;  3OS2 A;  3C1D A;  1I3Q J;  3GUD A;  2MD0 A;  1UST A;  2LY2 A;  3OYF A;  3ZRG A;  1HBX G;  2V6E A;  1IF1 A;  2XC7 A;  3QRF F;  2EBI A;  2JRT A;  2P81 A;  4G8X A;  2VQL A;  2WY8 Q;  1D1C A;  2DTR A;  3D0S A;  1ETX A;  4UUS B;  5KCM A;  2DA4 A;  4DOZ A;  3BP8 A;  2DQR A;  4WXD A;  1W7P D;  3LSH A;  4Q5S F;  1SFX A;  4F52 A;  5GAE J;  1BC8 C;  3IAM 2;  3HOX J;  3CME I;  4P9U A;  2LMD A;  1I1G A;  1SD5 A;  4PSW A;  2K9S A;  3H0G J;  1BR2 A;  3GFI A;  2PG4 A;  1H89 C;  3F72 A;  1OFC X;  3MQ0 A;  3NEU A;  3HYI A;  1JHH A;  1MBK A;  2XF5 A;  4GDF A;  1P6R A;  1D8J A;  3ESW B;  1B4A A;  5HLG A;  5HDK A;  3NAU A;  2FEZ A;  1NG6 A;  5EEG A;  4AUX A;  3CF5 F;  3V8J A;  2V26 A;  1R5H A;  1I39 A;  5BPD A;  1FYK A;  1LFP A;  2ECB A;  3CLQ A;  1F9N A;  5F27 A;  3OYK A;  3MZH A;  4RAF A;  3A4C A;  3VEP A;  1DQU A;  4BHP A;  2JTV A;  3WTV C;  2HPM A;  1YO5 C;  4XL9 A;  1KU2 A;  4ZDL A;  3BTI A;  1Q1H A;  1TWA J;  3BZC A;  2Y30 A;  5FKM A;  2XAF A;  4L9N A;  3WG7 H;  4C2M J;  2P5L C;  4QPO A;  2MH2 A;  3FXM A;  3DBH B;  4A3B J;  2RAE A;  2CFO A;  4OIR F;  4BY7 J;  2HOE A;  4M71 A;  3BR2 A;  1RNL A;  1KA8 A;  4C2T A;  2IP2 A;  1FNN A;  3LA2 A;  1YFH A;  3ZN0 A;  1MSE C;  3KFW X;  3GLX A;  1AA7 A;  1WJA A;  3SZP A;  1TWH J;  2HWV A;  2BHZ A;  4YII A;  3DPT A;  4U87 A;  2FSW A;  2UXX A;  2Z5U A;  3ZMU A;  1G3W A;  3KP5 A;  4DBQ A;  1AKH A;  2BW3 A;  2W7N A;  5J1U A;  1IN6 A;  1YE9 A;  5CPR B;  2CRG A;  1OQY A;  4WK8 F;  1V4R A;  3D5R C;  3E97 A;  4OAZ A;  4DZP A;  3L2V A;  3LSR A;  4PJ0 C;  2D1H A;  1IGN A;  2A61 A;  3UR3 C;  1S7O A;  2RN7 A;  4U88 A;  4AID A;  4B4C A;  4KA4 A;  2ID6 A;  3KZI C;  3HRU A;  3K69 A;  4Y3O A;  2XPW A;  5J1Y A;  4RAY A;  1OPC A;  4QPQ A;  1QO0 D;  5EJC A;  2GM4 A;  1MIJ A;  5JHU A;  4FCY A;  5E8I A;  3HC7 A;  4G6Q A;  4N9I A;  1WRJ A;  1OCO H;  2JZY A;  5CLS A;  3F23 A;  1T8I A;  3S15 J;  3CDI A;  1LB2 A;  2XUB A;  3TGN A;  2DBB A;  2WC2 A;  5EG0 B;  1FMW A;  3HHG A;  3OYN A;  1ETO A;  2VJJ A;  3QQA A;  2M2E A;  2V7F A;  1ZGJ A;  3E6M A;  2WAE A;  3K0L A;  1K4T A;  4Y33 A;  5IYD J;  5J47 A;  5LHH A;  1WGX A;  2UWM A;  2EH3 A;  2VBY A;  5ILU A;  4LIU A;  5C4X J;  1V3F A;  2DDA A;  2RNG A;  1OYY A;  1FOX A;  4XLF A;  3FF5 A;  6PAX A;  1GXQ A;  4PSX A;  3DEU A;  2DQL A;  2QCO A;  4IOA F;  2ZME B;  2L5Q A;  1RR7 A;  2RGV A;  4MGR A;  1YI2 I;  1K83 J;  5F08 A;  4ZDP A;  2VOO A;  3QPH A;  1UZC A;  3QPL A;  2XRN A;  1T0F A;  4A3L J;  1VI0 A;  2R7R A;  1FYL A;  1PUF A;  3CCY A;  2DU9 A;  5F0F A;  2B9S A;  3SQN A;  2F2E A;  2P7C B;  3ERM A;  1K78 B;  1WH7 A;  1ZRD A;  2MG4 A;  3BG7 A;  3DCF A;  2RQQ A;  3ASO H;  2IS6 A;  3CC7 I;  3WTU C;  3FWE A;  1ACI A;  1P9Q C;  4G7H F;  4DGW B;  1B72 B;  4G7O F;  1ZRF A;  1XC5 A;  4P96 A;  2YU9 J;  1CF7 B;  5ED4 A;  3LST A;  2IBD A;  5D5V B;  3S32 A;  1AOY A;  1RES A;  1Y1W J;  2A07 F;  4J01 A;  4ZZD A;  3CUO A;  2DFE A;  2IGO A;  3D5S C;  5JLW A;  1YIO A;  2DT5 A;  3VFZ A;  1YJN I;  5JVT A;  5D4R A;  1ZEL A;  3JRI A;  1VQ7 I;  1I3A A;  3KIO A;  1P4A A;  3QU6 A;  1W1W E;  1U5T C;  1APL C;  3IP4 B;  3OYM A;  2Y9Y A;  3FK6 A;  3TL4 X;  4BE2 A;  2G7U A;  3BRO A;  3ELK A;  4Y15 A;  4BY1 J;  1ENH A;  2LVS A;  2E35 A;  2XDV A;  4BJT A;  2CFX A;  2GOM A;  2LDU A;  3LSM A;  4UV9 A;  4I09 A;  1S3J A;  3MVP A;  3OYC A;  5HNF A;  3R6S A;  2F5C A;  4BQN A;  4HV5 A;  3A1Y A;  2NS8 A;  2MGQ A;  1O7L A;  3M07 A;  4NDL A;  5E1X A;  3L1P A;  3L2C A;  3A02 A;  1HDP A;  2ZC2 A;  1ULY A;  3HSE A;  3SXY A;  1HOM A;  1H8A C;  5JFR A;  4I0B A;  2E2I J;  2ICW G;  3QPS A;  4KT5 C;  3BJA A;  4ZC3 A;  4M3G A;  1OMI A;  1QZZ A;  3OYG A;  5FFX A;  3DTK A;  5LD2 C;  2GA1 A;  1D0X A;  3E1S A;  3E5Q A;  4PGH A;  3TMO A;  1FYM A;  1IN5 A;  4ZJZ A;  3R4K A;  3GTO J;  4NBQ A;  2VT2 A;  2H94 A;  2M4G A;  4NC8 A;  3VYT B;  3ABM H;  2FNP A;  5CYV A;  3UNG C;  1XMK A;  4I0A A;  2CH0 A;  4JX6 A;  4L9T A;  2BGC A;  3VYR B;  2VB6 A;  1FX7 A;  4ABZ A;  5D4S A;  3EPZ A;  2A69 F;  1A36 A;  2A05 A;  1U5T B;  2WV0 A;  2DDB A;  4M3F A;  2CQQ A;  4AIJ A;  3HTS B;  5J8F A;  1IV8 A;  2K27 A;  2FOK A;  3RYR A;  3I71 A;  1QQI A;  3CCV I;  3QYE A;  4Z6Y A;  3CCQ I;  2DA2 A;  2ID3 A;  3TOA A;  3WTY C;  4JBA A;  4XBF A;  3AG4 H;  3DQV C;  1LDD A;  4BGD A;  1BM9 A;  2E1N A;  2VPL A;  4AWX B;  1ETY A;  3QOE A;  2HOA A;  5DD8 A;  1ETQ A;  5HLT A;  1T95 A;  3WGI A;  3N97 A;  3Q5F A;  4BL0 B;  3C7J A;  4F3Q A;  4LB5 A;  2VOD A;  2M1B A;  2VC0 A;  2R7O A;  4PGG A;  2E5N A;  3NWS A;  4XON A;  3FKI J;  3FM5 A;  3K4K A;  1O4X A;  4BHC A;  3K1P A;  4HDU A;  3O2P E;  2LY9 A;  1XGN A;  2ACJ A;  2OZU A;  2CQK A;  2QQ9 A;  5EEH A;  4GFB A;  4B3X A;  1YOV B;  2KIU A;  2W24 A;  1T2K A;  4AD9 A;  1HKT A;  4I6Z A;  3NAR A;  2A68 F;  1I5Z A;  3WTS C;  1O3R A;  1ZRC A;  4IQJ A;  1P4W A;  2PMZ N;  1X58 A;  4HLX A;  2VJ4 A;  1KYW A;  1Z91 A;  4HA8 A;  3OSG A;  3GO5 A;  1Z7U A;  2Z16 A;  1W7P A;  2MA3 A;  1N25 A;  2FD5 A;  4IEJ A;  3PQJ A;  4CCL A;  2XPU A;  4OIO F;  2HEO A;  4IHX A;  1TC3 C;  2NVX J;  2NOG A;  3RCO A;  2B0L A;  2HYF A;  2CSO A;  2FBH A;  4RAZ A;  3WE2 A;  2E19 A;  4AYB A;  1M1E B;  3FBN B;  4UNO A;  3Q9V A;  5DTD A;  4PJJ A;  3KET A;  2LR8 A;  4JQF A;  1QBJ A;  3V8K A;  4D7M A;  2EFQ A;  5HDN A;  2DJN A;  4EJT A;  5TJJ A;  3WTT C;  1TNS A;  5K7F A;  1XTA A;  2XGE A;  3DXJ F;  2X4H A;  3I54 A;  2EV5 A;  2DA6 A;  4IL6 C;  2XRL A;  4E7J A;  4XKV A;  1BW5 A;  3AG3 H;  2QSG X;  3KEO A;  2VT3 A;  4JK1 X;  1UFM A;  1W4M A;  1QNT A;  2Z1D A;  2HU9 A;  5HS8 A;  1R6R A;  3TOB A;  1P7I A;  4YEJ A;  1K7A A;  4AC0 A;  1MJ9 A;  3M4O J;  2XAJ A;  1TWF J;  2QBY B;  2XF6 A;  3B02 A;  3VWB A;  4C3H J;  4B3A A;  4OU0 A;  1FEX A;  3R61 A;  5LEJ A;  1ZYR F;  2EZL A;  2EZI A;  2IA0 A;  3KLO A;  3W2V A;  2UUZ A;  1Y0U A;  1BN5 A;  2Q8K A;  5LLQ A;  2BYV E;  2IA1 A;  1BI1 A;  3M1C A;  1RKW A;  2BEO A;  3PFI A;  2DOD A;  3TW7 A;  1JTX A;  2DTZ A;  3EQL F;  4JX4 A;  3GFJ A;  3CDL A;  3ZMT A;  5IT3 A;  1OYW A;  1X1C A;  1W0T A;  3FIS A;  4PJL A;  1K79 A;  4A3C J;  2H09 A;  2O03 A;  4TV7 A;  1FZP B;  1OCP A;  4MEY F;  1OIS A;  3GME A;  1VQ4 I;  1HA8 A;  1ON1 A;  2NXN B;  3L2Q A;  5BOX A;  3RZO J;  2JSP A;  1S7A A;  2MD5 A;  5E3N A;  4ENM A;  1GT0 C;  5EF6 A;  4BYY A;  3CMA I;  5E3L A;  1UHM A;  1QZY A;  4DQ2 A;  4OMY A;  1U0J A;  4LD5 A;  3MKW B;  2LBF A;  3FMR A;  2P4W A;  2QQ8 A;  3DPL C;  2BHY A;  2O8X A;  4KIC A;  3JSO A;  2OZ6 A;  4PDK A;  2HDW A;  3MZY A;  4X6A J;  3BR0 A;  2R7Z J;  3BG9 A;  4F93 B;  4W97 A;  4UUT A;  2EK5 A;  3P9K A;  3H3Z A;  3FXU A;  5FKK A;  3OYL A;  3K70 C;  2H8W A;  2QKL B;  1U3E M;  4PFP A;  4N9H A;  4I2O A;  3HOV J;  3DF8 A;  1FP2 A;  2CJJ A;  2VBW A;  2EV0 A;  1S8N A;  2F6C A;  2FF4 A;  1MMA A;  4KUM A;  1YW7 A;  4BU2 A;  1YTY A;  1W0U A;  3DWL E;  2CG4 A;  5DS9 A;  1NH3 A;  2NYX A;  1X3U A;  5M5W J;  4HZF A;  5BMZ A;  5JR3 A;  3MKY B;  3AG2 H;  2MBF A;  3OMY A;  2JJ7 A;  3JW4 A;  4LK0 F;  4MHG A;  1IUY A;  4XKW A;  2LNB A;  3ASN H;  2Y0S A;  3HIF A;  3ZQH A;  2BE5 F;  2J5P A;  2VKH A;  2HQA A;  2KFD A;  1MBJ A;  2L2O A;  3L9F A;  4BBS J;  4Y4R A;  4CZZ A;  2LYC A;  4C2U A;  3L09 A;  4KN7 X;  4CHU A;  3HOW J;  3VYS B;  2XAS A;  3H9J A;  3OYI A;  3DBR B;  3S2W A;  2XRO A;  4M6Y A;  3RPQ A;  3IRR A;  3BJ6 A;  2R5Z B;  1KQ0 A;  3P9C A;  3I59 B;  1R5I D;  3CUQ A;  4NQW B;  2CW0 F;  2R7V A;  3CMM A;  3M8E A;  1RIO H;  1ZGA A;  1YJ9 I;  1R1V A;  2M5W A;  2UZK A;  2HI3 A;  4BQO A;  1E2X A;  1MBG A;  4A2U A;  4CA0 A;  3CC4 I;  2PMH A;  1TW2 A;  3WTW C;  3H92 A;  4Y7N J;  4IHY A;  4X1E A;  5JLX A;  3OR2 C;  3X2Q H;  4EEF G;  1NG7 A;  1YYV A;  4HG2 A;  3I9V 2;  5JVG F;  4ZH4 F;  1FSE A;  4E7S A;  4KIT B;  3H0D A;  5GPA A;  4HOB A;  1LKX A;  2X85 A;  1BC7 C;  3SHF A;  1U2W A;  4XN0 A;  3KP7 A;  3VSL A;  2K9Q A;  1EV7 A;  4KYW A;  3C2B A;  1NK3 P;  3I4M J;  3M3Y J;  3B6A A;  2KIM A;  2OD5 A;  3NWT A;  1AHD P;  4L5J A;  4DW6 A;  1MMG A;  2D1V A;  4B1R A;  1S5L C;  2K3F A;  4E7I A;  1MBH A;  1Z3X A;  2FA5 A;  2QEN A;  5ILV A;  3R0J A;  2A3S A;  3WGG A;  1CGP A;  1P2F A;  2R4G A;  4OIN F;  3LNQ A;  1IV6 A;  3WU1 B;  2VAS A;  3SZG A;  2NVQ J;  4FE7 A;  3PFY A;  1KU7 A;  1Z6R A;  4CZC A;  3L00 A;  2NRA C;  2ZKZ A;  1TBX A;  4HX8 A;  2OBP A;  2HFH A;  2IA2 A;  4UXN A;  5J6X A;  1R00 A;  4LJZ F;  3E6B A;  1ODD A;  3E7L A;  4HDV A;  3DTI A;  2D45 A;  2IS2 A;  1SAN A;  2R92 J;  1MD0 A;  1BI0 A;  5EG0 A;  3AG1 H;  3HGG A;  2HR3 A;  3ML6 A;  4UHT A;  4RB2 C;  1ZR2 A;  3LA3 A;  3CCS I;  1ZAO A;  1Y1V J;  4M74 A;  1S9H A;  2V9K A;  2X6Y A;  5IP9 J;  3GTP J;  4IJA A;  2YUS A;  1X1A A;  3IH4 A;  3M9A A;  1T6S A;  1XPX A;  5KVR A;  3BT9 A;  3RJP A;  4BJ5 C;  4CH7 A;  2IT0 A;  4ZDO A;  3RKW A;  3C2G A;  2KPM A;  1RI7 A;  2R7F A;  2CMP A;  5LGT A;  4WF2 A;  1MSF C;  2JMW A;  4CCM A;  2STT A;  1Z21 A;  4RM3 A;  3E3V A;  4PUS A;  5IYB J;  2VIX A;  3HZJ A;  1WH5 A;  3BLY A;  3RI4 A;  3GTK J;  3KE2 A;  5E1W A;  3C3W A;  4E7H A;  1OCR H;  4JYK A;  2XHK A;  4A12 A;  3ZGK A;  3ONQ A;  2DFH A;  2VC1 A;  3ZQI A;  4ZYG A;  2ZJQ F;  3HHH A;  3O6B B;  1ITY A;  3P9I A;  1R22 A;  4E70 A;  4EAT A;  3OOP A;  1EJ9 A;  1T56 A;  2NNY A;  1XD7 A;  3CCU I;  2GLO A;  3KEY A;  5ICC A;  3W2W A;  3GTJ J;  1ERD A;  1SFU A;  1YX5 A;  2MFZ A;  3O3K A;  1V5E A;  3W6K B;  2Q0O A;  3LOC A;  2IEK A;  2K5C A;  2BY3 A;  3HKZ N;  2L4M A;  1GLN A;  2AXT C;  5CQE A;  4XOT A;  3BQY A;  4DNC A;  2XSD C;  5EGO B;  5FRN A;  4CCJ A;  4LIT A;  5M5X J;  2E1C A;  1JXS A;  1QPM A;  2BOL A;  4FT8 A;  5J8C A;  2X1D A;  3RDI A;  5B66 C;  2VKD A;  2O3F A;  4A5M A;  3BR1 A;  3PNV A;  4RGR A;  3FX3 A;  4RB1 A;  2E34 A;  5HNH A;  2AQF A;  3ABU A;  2W57 A;  1OR7 C;  1YW9 A;  4LG3 A;  4CYD A;  3K70 D;  2FBI A;  3Q0W A;  2Y0S N;  3KCC A;  5IYC J;  2KQR A;  1G6N A;  3CLO A;  2ZJ2 A;  1IG7 A;  2MLG A;  3S17 J;  1Z05 A;  2DMN A;  3S1M J;  3CQZ J;  5FKL A;  5FJ8 J;  2GIV A;  3IKT A;  1SVM A;  1MNE A;  3G1O A;  2X6W A;  1T98 A;  2WAQ A;  1DPU A;  1F4K A;  4R79 A;  1D5V A;  2P5V A;  2CV0 A;  5BNG A;  1MH3 A;  2IVM A;  2M45 A;  4IHV A;  4UY8 I;  3OS0 A;  5E3O A;  2L0K A;  3IH3 A;  4U0W A;  3BR5 A;  2V9P A;  1B59 A;  2E2J J;  3LL7 A;  1UG2 A;  2R7S A;  3DTE A;  3LQQ A;  1TTY A;  1DDN A;  2QSH X;  2QVO A;  4G7Z F;  2VUM J;  5CVV A;  1MW7 A;  1YHQ I;  3TO6 A;  4IZZ A;  4ZYH A;  1E3P A;  1V55 H;  1WPK A;  2ECC A;  2Y9Z A;  4KIB A;  3J7A O;  1A5J A;  1GHC A;  3ZMS A;  1BJA A;  2EJR A;  2Q2E A;  3JCU C;  3ROU A;  3HSF A;  4Y52 J;  4OAY A;  3I0T A;  4RDU A;  1J0R A;  4XK4 A;  3DLL F;  1L3L A;  2ZME C;  4F55 A;  1XX5 A;  4WXC A;  1WFX A;  3JTH A;  1VQ5 I;  3E6C C;  4I7H A;  3AFH A;  2XB0 X;  5FD5 A;  2CO5 A;  3OYE A;  1SMT A;  1FOY A;  3OWT A;  1ZR4 A;  1G59 A;  1FTT A;  2WAD A;  2PMU A;  3GBG A;  2E36 A;  3H3U A;  1VQ9 I;  2ZNZ A;  3KYD B;  2H8R A;  4E6K G;  2ESN A;  3KP2 A;  5L3D A;  2E60 A;  2IJL A;  4RGX A;  2F4I A;  1HW5 A;  3F8C A;  4ESF A;  4A5N A;  3S16 J;  5CVJ A;  1FY7 A;  1UEL B;  2HXI A;  1ZLJ A;  3QWL A;  4LG0 B;  2M87 A;  4A0X A;  1B8I B;  2L9R A;  2WAF A;  4XLE A;  3W3C A;  2OPT A;  1SAX A;  4CCN A;  1MDM A;  2CV1 A;  3WU2 C;  3OYH A;  2E7X A;  2W48 A;  1LE8 A;  2KLO A;  1J75 A;  2X9D A;  4XKC A;  3SFI A;  1D0Z A;  1X2N A;  2H6B A;  4CYC B;  2A6H F;  2IAI A;  1LVK A;  4QTR A;  3LFK A;  3OL3 A;  2HZD A;  1JKO C;  5C44 J;  3BR3 A;  1BA5 A;  1I1S A;  2LP0 A;  4MEX F;  4BJ6 C;  4XSX F;  2JUC A;  4G6T B;  4JX5 A;  1BIB A;  4LB6 B;  2DOE A;  1IN8 A;  1W5C C;  2EIN H;  4LGW A;  2VN2 A;  3MKZ A;  4DYC A;  1WZ2 A;  5E17 F;  4O6J A;  3OIP A;  2ME0 A;  4CCO A;  2VBX A;  1B9N A;  2L9S A;  4G12 A;  1TZL A;  4FX4 A;  2XSJ C;  1FWZ A;  3GYH X;  3J7A Y;  2VPR A;  1FTZ A;  2H1K A;  5HS7 A;  1N75 A;  2LFB A;  3I58 A;  3G6E I;  3VDX A;  1S29 A;  2P6S A;  4RMN A;  1NHA A;  4KFC A;  2VON A;  4D0P A;  3IWZ A;  2L3D A;  4DJA A;  2B7E A;  2FML A;  2OCE A;  5E8G A;  2CQ7 A;  3T1B A;  2CUJ A;  3A2K A;  3ZXS A;  4GCV A;  1R7J A;  1YIT I;  3T8T A;  1RR8 C;  3S3O A;  2L02 A;  2WB1 A;  3PUB A;  2XV4 S;  2NAZ A;  5J3L A;  5DM6 F;  5FKO A;  4RA2 A;  1P4X A;  3ZQC A;  5DCM B;  2DOF A;  2HVR A;  2FRH A;  3SFZ A;  2DFI A;  3H3V K;  2LY1 A;  3HOU J;  3FMQ A;  4AVP A;  4KT6 A;  1Z77 A;  2W82 A;  3QAH A;  4D5F A;  3EUK L;  1BJZ A;  5LHG A;  2VQC A;  5HDG A;  3HJE A;  4C3I J;  2PJR B;  1S7E A;  3KYL A;  2KZG A;  4C9Y A;  2PI0 A;  1V54 H;  3I53 A;  2MW8 A;  2Y2Z A;  1HF0 A;  2QBY A;  3TQN A;  1MZB A;  1H9G A;  2M0C A;  3JRF A;  4UUV A;  2Q1Z B;  1QVU A;  2LOO A;  4A93 J;  4CGZ A;  2ME6 A;  4HV6 A;  4N4N B;  3ZP5 A;  1IRZ A;  1JUP A;  1R1T A;  4BEH A;  1RET A;  4EVI A;  4MIM A;  4BE0 A;  3Q0U A;  2XGC A;  3RQI A;  3M7G A;  3HUG A;  3WHB A;  4B44 A;  5AON A;  2HS5 A;  2KZV A;  3CCM I;  1R36 A;  5F1R A;  2F5F A;  4ENJ A;  9ANT A;  2BXY A;  3U2R A;  5TRD A;  5LEK A;  4IO9 F;  3DP7 A;  3RTR A;  4H4K C;  2X1E A;  2ZBK A;  3TP0 A;  3F21 A;  2V1D A;  2JPC A;  3QOP A;  2VE9 A;  3DV8 A;  1R58 A;  3HOT A;  3BG5 A;  3IH2 A;  4U7B A;  1HSJ A;  2LD5 A;  4XLC A;  2JUG A;  3VPR A;  2BXZ A;  2IS1 A;  1D0Y A;  1K61 A;  1X4O A;  4L5I A;  1A04 A;  4HSR A;  2L4A A;  1IRG A;  1AKH B;  2GZW A;  4IVN A;  1ZK8 A;  4HNT A;  1BI3 A;  2KRF A;  3A0H C;  3BPV A;  4XKB A;  3RQ4 A;  3WTZ A;  3WTX C;  1EA3 A;  1KU3 A;  3HGY A;  5AIQ A;  2ISZ A;  2VJ5 A;  3DU5 A;  3H36 A;  1KZH A;  5HOO A;  5EYR A;  5L3F A;  3OV8 A;  2HQ5 A;  4L5E A;  2I5U A;  4XRM A;  5E1Z B;  3RSN A;  2DMT A;  1ZKG A;  2PFB A;  4D7N A;  2ZXI A;  4J00 A;  2JVH A;  1DGR M;  2JSC A;  2XAG A;  5DDG A;  1U6G A;  2Z33 A;  5M3F J;  3HRM A;  4M9S A;  5D5X B;  1T0F C;  2DT7 B;  2P5K A;  3DPU A;  4OMZ A;  2X1C A;  1I6H J;  4I01 A;  1C0W A;  3ABL H;  1KON A;  1WJF A;  4RBO A;  2UV1 A;  5FRM A;  5J40 A;  2KIQ A;  1PP8 F;  4CXF A;  2K4B A;  3JRD A;  2YPR A;  2F5V A;  4J19 A;  1FOW A;  3RZD J;  4U0Y A;  1VQM I;  1UAA A;  5GPC A;  1IC8 A;  1HXD A;  4G94 A;  1LFB A;  2KKO A;  4MTE A;  1ZGW A;  1WSU A;  3F3X A;  3FZV A;  1BR1 A;  1UHW A;  3HPG A;  1IXS B;  3I3L A;  2DW4 A;  3PSI A;  2JA2 A;  4HEA 2;  2DJI A;  3CMY A;  4RM2 A;  4NC7 A;  3LAJ A;  3ZMD A;  4MO7 A;  2WBM A;  2XPV A;  3VOD A;  3BJO A;  4HX7 A;  4M6V A;  4GYI A;  2VLA A;  3K4B A;  5K5Q A;  1DU6 A;  5ICG A;  4A69 C;  1D3Y A;  1JT0 A;  5LFA A;  3FM3 A;  2V1U A;  3S2D J;  3CO7 C;  3HBL A;  4HNV A;  5LGN A;  4P9F A;  3LSP A;  1D1A A;  2LRD A;  1E0E A;  5JI6 A;  3AAF A;  3HOY J;  1F1Z A;  2MC3 A;  5DD4 A;  4NB5 A;  3IV5 A;  2CGP A;  2N8G A;  1BOA A;  2Z3Y A;  4B47 A;  1PUF B;  1PVE A;  3KEQ A;  2A5Y B;  3LA7 A;  1VF9 A;  4K2E A;  1SC7 A;  4BS9 A;  2R7W A;  1R1U A;  1ONV A;  2WB1 N;  3GX4 X;  2CQX A;  1DPR A;  2DA5 A;  2VXD A;  2R7D A;  3QP6 A;  5CJ9 A;  3H5N A;  1KQ8 A;  4LOC A;  2ZXW H;  1HC8 A;  2EFP A;  1I50 J;  2GBY A;  2RQP A;  1BL0 A;  3DBL B;  1SFK A;  3DKX A;  1XMX A;  4YRV A;  2R0Q C;  2F4M B;  2HGC A;  1DUX C;  2F5D A;  1ETV A;  4EQQ A;  4CSW A;  3SEZ A;  4M9X A;  3PIP F;  2XAQ A;  3GTM J;  1FOK A;  3R0A A;  3RYP A;  4A3J J;  2FOW A;  3KZY A;  3I4P A;  2W00 A;  2ZFU A;  4PFO A;  2XAU A;  2EPF A;  5B1A H;  3BTC A;  1UMQ A;  2CUZ A;  3DFG A;  1REP C;  5H2F C;  3U1D A;  3FMS A;  5GP9 A;  4RAG A;  3JAM K;  3RKX A;  5FRO A;  5IOY A;  1GDT A;  2OQG A;  2EZK A;  2X51 A;  3L7W A;  2VKE A;  1OCZ H;  5FB2 A;  3GF2 A;  2LK2 A;  1FSH A;  2HYJ A;  5K5R A;  2X6X A;  1XGM A;  2ZNY A;  1JTY A;  5F0C A;  3T0Y A;  1X3W B;  3A01 A;  1UJ8 A;  5LGU A;  4DIQ A;  4HW0 A;  3FKJ A;  4G6D A;  1R49 A;  1EH8 A;  2KDO A;  2WY7 Q;  3K1N A;  2VQG A;  4QIW N;  4PCQ A;  2BY2 A;  4XLA A;  2NVU B;  1WVR A;  2G9W A;  1X19 A;  3QYB A;  1ETK A;  3BCA A;  1L0O C;  1WCM J;  2UXN A;  2Y0M A;  4M73 A;  2WTE A;  3RPU D;  3I64 A;  5L3E A;  2M3A A;  5H6Q A;  5E18 F;  4EGZ A;  1ZG5 A;  5FLX K;  3A0B C;  1VQ6 I;  3KYC B;  2HDC A;  1S72 I;  2EFN A;  3HRS A;  4HLY A;  3L2W A;  2DCE A;  1R23 A;  1A35 A;  2AO9 A;  1BI2 A;  3MZ8 A;  1TQP A;  1SD4 A;  1ZG3 A;  1NTC A;  1T08 B;  5FGM A;  2EB7 A;  4IHT A;  4WCG A;  3OIQ A;  1X1P A;  4E7Z A;  2ZSI B;  3OOU A;  1SVL A;  1ZHF A;  2Y69 H;  3EYI A;  2DAO A;  4UUS A;  1B1B A;  4M3D A;  1IDY A;  5TGT A;  2CW8 A;  3B6C A;  3KZZ A;  4XIC A;  4WWC A;  2HQR A;  3BG3 A;  4D1Q A;  4E4H A;  4AIK A;  2FX0 A;  2ELH A;  5EGO A;  1JKQ C;  1IUF A;  2HZT A;  3M8F A;  1J09 A;  3E0J B;  3JAM Z;  3LSG A;  3ECH A;  3G1L A;  1VQ8 I;  2O9L A;  1TP4 A;  3Q3S A;  3EUH A;  2F5E A;  5BS6 A;  4HYE A;  4EV0 A;  1LNW A;  3AKZ A;  4CUG A;  1D8K A;  4I02 A;  2DMU A;  2K9M A;  2ESH A;  4HAM A;  5DYM A;  2H1L A;  1YG2 A;  1JKP C;  3NRV A;  1SEU A;  4A3M J;  4G9Y A;  4I98 B;  1WWX A;  3CP8 A;  3SZT A;  5DM7 F;  1Y39 A;  1GVJ A;  2HVS A;  4FE4 A;  3OYD A;  3E5U A;  1JKR C;  3WU0 A;  3LAP A;  4XOR A;  2BY0 A;  2QM3 A;  4UVC A;  1IAW A;  4NUB A;  3M8J A;  4B09 A;  4HF0 A;  4A0Z A;  1O57 A;  2EWN A;  2HNH A;  2GXG A;  2HPI A;  4M6X A;  3ISP A;  1R4M B;  5FLX Z;  2NS0 A;  2KL4 A;  4M72 A;  3K4M A;  4AYB N;  1W7P B;  4XID A;  4A3D J;  1ETW A;  4O5V A;  2HQN A;  1Y56 A;  3TKY A;  3QU3 A;  4ZYA A;  3ZMZ A;  2E1M C;  1K6Y A;  4D9J A;  4Z2Y A;  3G3Z A;  1LDJ A;  4M3E A;  1LEA A;  5FLV A;  3F8B A;  1WQ2 A;  4F7Z A;  4WXH A;  2FUG 2;  2AXL A;  2E5Z A;  2OQR A;  4FET A;  1UB9 A;  3CTA A;  4PZJ A;  1JGS A;  2DMQ A;  5BQT A;  1TNT A;  3QYF A;  2G7H A;  2I10 A;  3M1E A;  2OTJ I;  3GWZ A;  5B3S H;  2BY1 A;  3TBI A;  4V2G A;  1OR7 A;  3PJR A;  2PBI A;  2P7V B;  1Y8Q B;  1SAU A;  4A0Y A;  4XLN F;  1OYI A;  2R5Y B;  3DEE A;  4HBL A;  1IRF A;  4KJZ A;  2OF7 A;  1W36 C;  2P0W A;  4XMY A;  1JT6 A;  4RB0 A;  1XCV A;  1UG0 A;  4MNU A;  2M7A A;  3IHU A;  2CYY A;  3CCJ I;  4BXF A;  5LBQ A;  2HYG D;  1SD7 A;  3RKQ A;  1B8I A;  5D5U B;  3GTG J;  3Q0V A;  2X6O A;  3FIW A;  4OOI A;  3J7Y J;  1D5Y A;  3QP5 A;  2PX9 A;  1YJW I;  3S2H J;  1MBF A;  2K02 A;  2COM A;  3OY9 A;  3IL2 A;  1U8R A;  4KNY A;  2E1M B;  3K4N A;  1ZG1 A;  4UV8 A;  2EFW A;  4I99 C;  2DFF A;  1EKE A;  1O3Q A;  1GV2 A;  3BTJ A;  2R7Q A;  3C2H A;  2L7M P;  2O8K A;  4OIP F;  5ICE A;  2DOA A;  4HF1 A;  3W6V A;  5H20 A;  1FMV A;  3UKG A;  3PUF A;  3IWF A;  3JR9 A;  1B9M A;  1MJB A;  1PJR A;  4IXA A;  5J4V A;  4XLP F;  4YEL A;  5D8K B;  3JRB A;  1PDN C;  2ZME A;  2DI3 A;  2W85 A;  1HST A;  2MH9 A;  3ZQ7 A;  1DGW Y;  2FBK A;  4IRI A;  3S14 J;  2EIJ H;  2XGD A;  3VOE A;  4P1W A;  1ZLK A;  4MTD A;  2QA4 I;  3GFM A;  4ESB A;  2V1X A;  4YIF A;  2KIF A;  3S3N A;  1KQ9 A;  1YLF A;  2F4O B;  1TW3 A;  3HG9 A;  3IUO A;  3L2U A;  4IHS A;  2LBF B;  5LHI A;  3HSR A;  1TQM A;  1U9O A;  4IF4 A;  1EH7 A;  1SFE A;  2OTL I;  1IN4 A;  3CUQ C;  4GRI A;  1K78 A;  4DBR A;  1G4D A;  1A6Q A;  1SMY F;  2LF8 A;  5K1Y A;  3WOD F;  1TQI A;  2CWE A;  4YIR X;  5DUK A;  4BXU A;  1B72 A;  2ZO4 A;  2FU4 A;  4KIF A;  2L9N A;  2GQQ A;  2YS9 A;  1CF7 A;  1TLH B;  4H0E A;  1JJ8 C;  3KPH A;  1YW8 A;  2IS4 A;  1YRN B;  2DXI A;  4PJM A;  5DCM A;  1A31 A;  2EIL H;  4LIV A;  3CCL I;  4BHB A;  1HQC A;  4HNU A;  2PQ8 A;  4EM1 A;  5EEA A;  2E71 A;  3V8L A;  2EFO A;  4YG2 F;  4EJU A;  2C6Y A;  1I27 A;  2HXO A;  3G71 I;  2O6G E;  4S05 A;  5IPA A;  3HRT A;  5L3C A;  3FDY A;  4CDG A;  4L9V A;  2JA6 J;  1FP1 D;  5FLM J;  2PJR A;  4KIG A;  5F1J A;  2VI6 A;  5KHD A;  4QSH A;  1BOB A;  5ICF A;  5GAH J;  4IX7 A;  1IRX A;  2COB A;  4BBR J;  2W1O A;  3LSI A;  1IXR C;  2M9H A;  3G4S I;  4A3K J;  3WE3 A;  3KLN A;  3H35 A;  3MKL A;  2GOX B;  3QPT A;  4GYG A;  1AU7 A;  2DPD A;  3F6O A;  1OKR A;  3CUQ B;  1F43 A;  1U9N A;  1ZN2 A;  3V4G A;  3CCE I;  2E2H J;  5E79 C;  2EQR A;  2V4J C;  1STZ A;  2FXA A;  4BDZ A;  4A3F J;  3CC2 I;  4GXO A;  1FIP A;  4EM0 B;  4ON0 A;  3DEW A;  3S1Q J;  2ELK A;  3HTU A;  2DA7 A;  3H5A A;  1IW7 F;  1KGS A;  2KJC A;  2WWY A;  1FBU A;  1F36 A;  5FFZ A;  3GCM A;  2VOP A;  4IQ4 A;  4EM2 A;  2V9V A;  3MWM A;  5IT9 K;  1RRJ A;  5EZH A;  1K4S A;  3G73 A;  4LK1 F;  5H6R A;  1U5T A;  4B48 A;  1Z6T A;  1V5G A;  5DUI A;  3CD6 I;  2W4S A;  3W2A A;  3D5L A;  2WA0 A;  2K9N A;  2LTP A;  1ON2 A;  2CW7 A;  2YX7 A;  4MFD A;  4U0V A;  4EMS A;  1RUN A;  1ZRE A;  1H9T A;  5K7H A;  2M4K A;  4AM3 A;  3K4C A;  4NNJ A;  2AS5 F;  4C3J J;  4LMY A;  2RRE A;  4MFE A;  3OS1 A;  3J7Z I;  2O61 A;  1IDZ A;  4XOP A;  2KRC A;  2TDX A;  3MN2 A;  3S8P A;  3T8R A;  4ANJ A;  4ZTJ A;  2HKX A;  2BVM A;  3F8N A;  1JI8 A;  1D1B A;  2K85 A;  3JRG A;  3JRA A;  2Z2S B;  3RPU A;  4AU7 A;  1R5G A;  2JT1 A;  3CO6 C;  3OIO A;  5KAF C;  5HLI A;  4BE1 A;  2CS3 A;  3PNT A;  2LRE A;  2M8E A;  1W36 D;  3COA C;  1OCC H;  3QOD A;  3ZCO A;  3FXR A;  5IY5 H;  1HKS A;  1IXC A;  1CQT A;  1MKM A;  1I6X A;  3TDU C;  1FLI A;  2DO7 A;  2KT0 A;  3K4L A;  4OIQ F;  4ENN A;  1H88 C;  4XRS G;  1LJ9 A;  4HQE A;  2QQA A;  4FHT A;  2GXB A;  3I5U A;  5B5E C;  2LH9 A;  3BOQ A;  3BZ6 A;  2M34 A;  3I56 I;  3BWG A;  4R1H A;  2QUF A;  2O5R A;  3EET A;  1VND A;  1FJL A;  2M8G X;  3GZN B;  2DA1 A;  3BY6 A;  2XVC A;  1DP7 P;  2QQB A;  2CUE A;  3S3M A;  2PMZ A;  4N0B A;  1VQO I;  2LKP A;  2JN6 A;  4KMF A;  2IXS A;  5IT9 Z;  3V7R A;  1TWC J;  4L18 B;  1N78 A;  1E3H A;  1O3S A;  3FXK A;  4JOM A;  5J1R A;  4HPQ A;  4B43 A;  1W5S A;  1XSX A;  4ZZL A;  5ERI A;  2G0E A;  2MLK A;  3B73 A;  3VYU B;  2OA4 A;  5HLH A;  5LRR A;  2W84 A;  2V1N A;  2TRT A;  1G3S A;  4YFN F;  2EIM H;  3K4J A;  3OYJ A;  1N77 A;  3KP4 A;  1T39 A;  2XKP A;  3S1R J;  5HVQ C;  4QWQ A;  3WG9 A;  3WHC A;  3ECO A;  3PIO F;  2E1O A;  2DK5 A;  3SDB A;  1HCR A;  1MJA A;  4YFK F;  3GVA A;  2QEX I;  4F91 B;  2OUM A;  2QYO A;  3I55 I;  2JA7 J;  4LLL A;  2RVC A;  1BBY A;  4A3I J;  1LVA A;  4AIH A;  3CF2 A;  4O3M A;  1Z67 A;  3K9T A;  5F0H A;  1ORK A;  4BH9 A;  1QA6 A;  3FXJ A;  1G2H A;  3GZ6 A;  1WHU A;  2L7K A;  2RNJ A;  4Y13 A;  2WAQ N;  3JRH A;  2XF7 A;  3I4N J;  1S6L A;  1J5Y A;  5CVI A;  2VE8 A;  3RIR A;  1JUS A;  4DYQ A;  4BAY A;  1RPW A;  2XB5 A;  3DLA A;  2IRF G;  4B8X A;  5KNL A;  1WJE A;  5A2Q K;  4HRI A;  1FIA A;  3H1C A;  3BC8 A;  4M3B A;  3TDZ C;  4XRS A;  1WI3 A;  2OJE D;  2XAH A;  3K2A A;  1P7J A;  5J4Y A;  2LG4 A;  4W1U A;  2KIS A;  5D6E A;  1X2M A;  3O8G A;  2LSO A;  1BR4 A;  1YQA A;  5LRS A;  1YX3 A;  1MH4 A;  2QSF X;  4D5C A;  2VXZ A;  4KDP A;  4RS8 A;  2DLL A;  2JVG A;  4NC6 A;  2DYS H;  2EZH A;  1GXP A;  4UVA A;  5CVU A;  5L3B A;  2L54 A;  3CJR B;  1JHF A;  1SVO A;  4NHJ A;  1GVD A;  4C30 A;  1X3Z B;  4RLQ A;  1VQP I;  2FMY A;  5F04 A;  4Q47 A;  3ABK H;  2BW3 B;  3S1N J;  2OU2 A;  4A6D A;  4ASN A;  2MAB A;  4ETS A;  2FQ4 A;  4A6E A;  3JTG A;  2ADU A;  4KMU X;  2GIZ A;  4FIS A;  4II2 A;  1QPI A;  1QGP A;  1R71 A;  2Q2E B;  3HDD A;  3K7A J;  2R7T A;  5F64 A;  5ILS A;  4DZJ A;  1MMS A;  2OAZ A;  2Z99 A;  1YS6 A;  1PYV A;  1OLT A;  2XGX A;  4MQ9 F;  3RKY A;  1PP7 U;  2A6E F;  1GV5 A;  2E7W A;  2IGM A;  3DKW A;  3MMY B;  5AIP A;  2YX4 A;  3GLL A;  3OR1 C;  3MD2 A;  4IHW A;  3BR6 A;  1YS7 A;  3FBI B;  4I76 A;  1X1D A;  2BVL A;  3BDD A;  2DK8 A;  2FNA A;  1QZE A;  3WGH A;  4ITV A;  3CZ6 A;  1UHS A;  1J59 A;  3EYY A;  2HKO A;  1TWG J;  2RV8 A;  1WJ5 A;  3FXQ A;  3ZQQ A;  3N4M A;  2IPQ X;  1OJL A;  4IRG A;  1KYZ A;  2DN0 A;  3TO9 A;  4YFX F;  1SFO J;  2Y75 A;  1TL8 A;  1MDM B;  2GXA A;  2KJB A;  5A2Q Z;  2ZB9 A;  4LLG F;  1QU3 A;  1LE8 B;  1VTN C;  2M7B A;  4UB8 C;  3N05 A;  1YIJ I;  3CJT B;  4IOC F;  1G3T A;  3SDG A;  1HKQ A;  4FTH A;  3TED A;  2R5Z A;  3H9Q A;  4UB6 C;  2STW A;  3I59 A;  3O8H A;  4NQW A;  3ABT A;  5HOD A;  1IZ1 A;  2TCT A;  1MMD A;  2LLK A;  1LEB A;  3HL2 A;  3J81 K;  1Y0N A;  5D5W B;  1MBE A;  2JA8 J;  2MSY A;  5DEQ A;  5FKN A;  5IP6 A;  5F6F A;  1SD6 A;  4FX0 A;  4GO1 A;  3F8M A;  2LF7 A;  1E17 A;  2I8D A;  2FQ3 A;  2EIK H;  3LSJ A;  2L7Z A;  2FE3 A;  2DYR H;  3K2Z A;  4AVZ A;  4L0Z B;  3FHN A;  2K9L A;  2IW5 A;  2QZ8 A;  1TT0 A;  2KDZ A;  3DU6 A;  2A6T A;  1IO2 A;  2L9V A;  3A03 A;  5EZG A;  2XIG A;  2KMU A;  5DCF A;  2YSR A;  3ZOB A;  2P6T A;  5CKT A;  2P8T A;  3H5R A;  5FO5 A;  5FD6 A;  3OYB A;  3D1N I;  2IGN A;  2OV7 A;  2F48 A;  2PLY A;  2L7F P;  2CU7 A;  3PQK A;  1Z1D A;  4FQG A;  1P92 A;  3MCZ A;  3VB2 A;  4EJV A;  2KP6 A;  1LPQ A;  1O7F A;  1WJB A;  4XM3 A;  3HXL A;  2R5Y A;  4XQF A;  4HQM A;  5M5Y J;  3F6V A;  4ENK A;  2DPU A;  4WX9 A;  4LLN A;  3G1M A;  2JWT A;  2QKM B;  1RC9 A;  4UVB A;  1UCR A;  2JQ7 A;  2VKV A;  1EF4 A;  3IKV A;  5KAI C;  1LUJ B;  1IJW C;  3GXO A;  4IKF A;  2ZSH B;  3F22 A;  3HB9 A;  4PK4 A;  1A6I A;  3BPX A;  3V7C A;  1Z7L A;  1RKT A;  5C4J J;  4RLF A;  2RKH A;  2JK3 A;  3MAJ A;  4U7D A;  2GAU A;  2L01 A;  2K40 A;  4RGS A;  4BEH B;  1POG A;  1W5T A;  3OL4 A;  2ZXH A;  2BV6 A;  2RDP A;  3J81 Z;  2JPB A;  1XMA A;  3ZQL A;  3HPH A;  3HUG B;  3PM1 A;  1G3Y A;  1FBQ A;  1ZQ3 P;  1KU9 A;  2O0Y A;  2QF7 A;  1E3O C;  3VSK A;  3E6D A;  4LFU A;  3ZPL A;  3ULQ B;  1USS A;  4MQV A;  3ZN1 A;  2H27 A;  4E7L A;  3AL0 C;  1ZH5 A;  1EH6 A;  2RC4 A;  4XLH A;  1GUU A;  3FXO A;  1LFU P;  1TT5 B;  3CP2 A;  5D6F A;  1X1B A;  4BXX J;  2GA2 A;  1OCT C;  5EDN A;  1FC3 A;  5DV5 A;  4L0Y B;  3MFK A;  4HST A;  1Y6I A;  1QHG A;  1DP3 A;  2EV6 A;  4EJO A;  5GTI C;  3U1K A;  1LQ1 A;  2M0M A;  1XDS A;  2M30 A;  4Q48 A;  1Z9C A;  4BUP A;  4KIS A;  3NQO A;  4BAC A;  3W6J B;  4FAS D;  3K1M A;  2NNN A;  2VBZ A;  2NVT J;  2K4J A;  2A5W A;  2QLZ A;  2Y31 A;  3FHZ A;  1U8B A;  1WKM A;  1LDK B;  5GAG J;  3GEZ A;  1T38 A;  3LWF A;  3ZR8 X;  2ELJ A;  4ZTF A;  4GGG A;  2HOT A;  3OYA A;  4A3E J;  3ZMV A;  4XR6 A;  1RZ4 A;  2MC4 A;  2K86 A;  4BKX A;  3HKZ A;  4V19 K;  3GW2 A;  3TP3 A;  1H0M A;  1QRY A;  1Q1V A;  1YRN A;  1J9I A;  5GTH C;  2DA3 A;  2DMP A;  3F0C A;  2BZT A;  2YR2 A;  1DU0 A;  1WJC A;  1O3T A;  2LC2 A;  3L2R A;  4IRH A;  4HX4 A;  1FBS A;  4II3 A;  2NVY J;  2NOJ B;  4ZYE A;  3P5J A;  1BW6 A;  2Y48 A;  3G2B A;  1K6O A;  3AL0 B;  2H6C A;  3IRQ A;  4N4O B;  1ZTR A;  4Q4Z F;  3JSP A;  3CDH A;  1XN7 A;  3ERE D;  1WI9 A;  4RGU A;  2PEX A;  1XSD A;  2LKS A;  2B63 J;  2CQN A;  1X4P A;  3HEF A;  2IGK A;  4BQA A;  4P55 A;  1ZAR A;  4XRF A;  5IOZ A;  1MGT A;  4CO8 A;  5M3M J;  2EA4 A;  2VQH A;  1VZ0 A;  3KX2 A;  4X0G A;  4BQQ A;  1FT9 A;  3SYT A;  5BPI A;  2R7X A;  5IP7 J;  3FXL A;  4PJN A;  3REO A;  3BG6 A;  1MMN A;  2HDD A;  4E7K A;  1QHH D;  3IAS 2;  3PL8 A;  2CV2 A;  2PJP A;  4EJW A;  1HDD C;  1IN7 A;  2VL8 A;  1FPQ A;  1B6A A;  2WV1 A;  1Y8R B;  3U9G A;  1R9T J;  1XCB A;  3DKY A;  3IC7 A;  2JA5 J;  4BNC A;  2X0L A;  2GWR A;  3PSF A;  3LFU A;  4V2F A;  4XNF A;  2VJI A;  1PUE E;  4XSZ F;  1RUO A;  3K10 A;  3JRC A;  2D5V A; 
#chains in the Genus database with same CATH homology
 1VQK I;  1VQ5 I;  5GAE J;  3CCJ I;  1FOY A;  3CME I;  3CCE I;  2E36 A;  2ZJR F;  1VQ9 I;  3J7Y J;  2ZJQ F;  1YJW I;  1FOX A;  3CC2 I;  3CCM I;  3CCU I;  3PIO F;  3CF5 F;  1YJ9 I;  1VQ6 I;  1YIJ I;  4IOA F;  3CJT B;  4IOC F;  2QEX I;  3CC4 I;  1VQ8 I;  4IO9 F;  1YI2 I;  3I55 I;  5JVG F;  3CCV I;  3CCQ I;  1HC8 A;  1QA6 A;  3CD6 I;  5GAG J;  2E34 A;  5DM7 F;  1Y39 A;  2QA4 I;  2ZJP F;  3PIP F;  1ACI A;  3CC7 I;  2FOW A;  1VQ4 I;  1VQL I;  2NXN B;  2OTL I;  4V19 K;  2K3F A;  3J7Z I;  3CMA I;  5GAD J;  3G6E I;  1YJN I;  1VQ7 I;  1VQP I;  3CCR I;  4UY8 I;  1VQN I;  3CCL I;  2E35 A;  1YIT I;  3G71 I;  2OTJ I;  2H8W A;  3CCS I;  5DM6 F;  1MMS A;  2JQ7 A;  1FOW A;  1YHQ I;  3I56 I;  1VQM I;  5GAH J;  1S72 I;  3G4S I;  1VQO I;  3DLL F; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...