1SD6A

Crystal structure of native meci at 2.65 a
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
119
structure length
119
Chain Sequence
b'TYEISSAEWEVMNIIWMKKYASANNIIEEIQMQKDWSPKTIRTLITRLYKKGFIDRKKDNKIFQYYSLVEESDIKYKTSKNFINKVYKGGFNSLVLNFVEKEELSQDEIEELRNILNKK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Methicillin resistance regulatory protein mecI
publication title Crystal structures of the BlaI repressor from Staphylococcus aureus and its complex with DNA: insights into transcriptional regulation of the bla and mec operons
pubmed doi rcsb
source organism Staphylococcus aureus
molecule tags Dna binding protein
total genus 37
structure length 119
sequence length 119
chains with identical sequence B
ec nomenclature
pdb deposition date 2004-02-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03965 Penicillinase_R Penicillinase repressor
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 1sd6A01
1.10.4040.10 Mainly Alpha Orthogonal Bundle Penicillinase repressor fold Penicillinase repressor domain 1sd6A02
3IWFA 1FP2A 1Z9CA 2DLLA 1DDNA 2YU3A 1JHFA 4YIIA 3GW2A 4UUVA 2EWNA 2P7VB 5LGTA 1ULYA 1U5TA 1R1TA 5D4RA 3WTUC 2DTRA 1SD4A 5E8GA 2MD5A 2HTSA 4A12A 3HRSA 2JZYA 4OIPF 2ACJA 5HS9A 4KUMA 3REOA 2Q8KA 1AWCA 2LKPA 3I59B 2VOOA 2L4MA 4ZYDA 1LDDA 4R8HA 1PDNC 1Q1HA 1WRJA 3SFZA 1P4AA 1LEAA 2DI3A 2WTEA 1ON2A 1XB4A 3DV8A 3LSTA 1K6OA 2F5CA 2H27A 4KT5C 4JBAA 4H0EA 1YO5C 4OIRF 3ISPA 2VC0A 3FF5A 2PG4A 2XIGA 1EH8A 3KETA 2R7DA 4BXUA 3LAPA 2LNBA 5D8KB 1YFHA 1G3SA 1YIOA 4YG2F 4HW0A 1XSVA 3E6MA 4I7HA 3L7WA 2GXBA 1WWXA 3HTSB 4TV7A 2VXZA 2EFQA 2FMYA 2YSRA 3FWEA 2PQ8A 4HLYA 3BZ6A 2RVCA 4WXHA 3EYYA 1W7PA 4A6EA 3E5QA 1ZGJA 4MQVA 4A5MA 2HOEA 1C0WA 3RIRA 2QUFA 3BP8A 2FA5A 2IJLA 1T6SA 1QZYA 3F6OA 2LDUA 2VE9A 1R22A 3TDUC 2L4AA 3MAJA 2EFPA 4U0WA 5L3GA 2GWRA 2XAFA 4WCGA 1UHWA 1TW3A 4GGGA 4HF1A 2F5FA 5HVQC 1SFUA 4GCVA 3C7JA 2IRFG 3M8EA 4A6DA 2A3SA 3K1MA 1BI3A 3JAMZ 2KIUA 2XAHA 3GFJA 5E1ZB 3DPLC 1G3WA 1IN4A 4WXDA 1XGMA 3M8FA 1TQIA 3I54A 3V7SA 1Z7UA 3KLNA 2L3DA 1U78A 4HX7A 5JVTA 5CVJA 4MEYF 4KIGA 2E7WA 4KIBA 1K7AA 5K1YA 3FM3A 2DQRA 2FEZA 2GIVA 5J8CA 3GFIA 3PQJA 4RB0A 4MEXF 1Y0UA 3HYIA 3L00A 4LK1F 1ZARA 5LLQA 4UNOA 4A0YA 4PZJA 4L9TA 1R36A 2EV5A 3M7GA 3F23A 5A2QK 4CXFA 5AONA 3ECOA 1UFMA 5LRSA 3F8FA 1W7PB 2V6CA 3KE2A 5E1WA 1ZRCA 1REPC 2ESNA 1R5HA 4Z2YA 3HUGA 2P6TA 3KCCA 4UV9A 2CQKA 2XASA 3WG9A 1ZN2A 4K2EA 4P9FA 5FB2A 4AIHA 4EJUA 5AIPA 3U1DA 2Y48A 3EETA 3FHZA 2FQ3A 4E70A 4A0ZA 2R7FA 5DEQA 5D5VB 2Z3YA 4IVNA 3F3XA 1HSJA 1TQMA 3GFLA 4KYWA 1ZLJA 3FXRA 3VOEA 1L0OC 4LB6B 2V9VA 5JHUA 1WI9A 3F8BA 1F5TA 2LSOA 4G7ZF 5KK1A 2NAZA 3RPUA 4KFCA 4B8XA 1S7OA 1YLFA 2IW5A 4ZH4F 4HQEA 1YS7A 1RNLA 1HBXG 1X3UA 2M30A 3E5XA 3QRFF 2VT2A 1LDKB 1WKMA 3I5UA 3LAJA 4KN7X 1IN8A 2OA4A 5D4SA 5DD4A 2ZMEA 2M1BA 2MBFA 2M45A 1IF1A 2HKOA 3ZN0A 2DPUA 1IN5A 5FLXK 5CVVA 2PFBA 2VOPA 3R61A 3E6DA 1R58A 3JSOA 1I27A 2Z9OA 5FGMA 3T8TA 3BWGA 4IHTA 4WWCA 1V3FA 4L18B 2G7HA 4JQFA 1E17A 2MH2A 2ZBKA 3H3ZA 1EV7A 4U88A 5ED4A 5ERIA 2WV0A 4I01A 3TO7A 2HEOA 3RKYA 2E1NA 5H6QA 1MJ9A 5HDGA 3RI4A 3S2WA 1QBJA 1IAWA 4ENJA 1WQ2A 1HW2A 2DBBA 2V1UA 4YIFA 3LWFA 1FBUA 3NQOA 4ZZLA 3I0TA 4F7ZA 2OD5A 2DT5A 1BBYA 4ENMA 2FNPA 5FD5A 3DPTA 1YG2A 1ON1A 1QZZA 3COAC 3ABUA 1ZG3A 1ZRFA 2IP2A 2L54A 3DP7A 3J7AO 4U0YA 2HYFA 1H9GA 2CG4A 2FMLA 3KP5A 1P2FA 4Q4ZF 2K7LA 2FF4A 3V4GA 1BJAA 1BIBA 3MFKA 1MZBA 4CGZA 1R1UA 4LLNA 5FO5A 5L3EA 1USSA 5DYMA 5ICEA 4AD9A 2PN6A 1J0RA 4U0VA 3GVAA 1FT9A 3RPQA 2CO5A 2ESHA 4RB1A 1XCVA 1XDSA 1QO0D 3C1DA 4CZZA 3GLXA 4WX9A 1ZH5A 3CO7C 3GZ6A 2HKXA 4OIOF 4MTDA 2ZXJA 4IRIA 1XSDA 2CWEA 1YW8A 2QQ9A 5BQTA 5J8FA 3CO6C 4HV5A 5E8IA 3SHFA 1JE8A 2OZUA 2DQLA 2ELHA 2PMUA 2V1DA 4PGGA 3L2CA 1MKMA 4FX4A 4BH9A 3V7RA 2HFHA 1D3YA 1EH6A 3WTXC 3KP7A 2EFNA 3I53A 1D8KA 3P9CA 5LRRA 3HRUA 1KQ9A 4ESBA 4LMYA 3K2ZA 2BBYA 4CDGA 1B59A 2DO7A 3J81Z 4RAYA 1PP7U 5JFRA 5ICFA 1Z1DA 2C6YA 1LJ9A 1R23A 3C18A 5LHIA 2VC1A 4GYGA 1D5VA 5H6RA 2A61A 2CSOA 1HXDA 3TGNA 2QBYB 1FBQA 1F9NA 3J80K 2Y75A 5ILUA 1TLHB 5JR3A 2A5YB 3GF2A 1B1BA 2RC4A 3WTZA 1QQIA 1K78A 5BOXA 3KLOA 1I1SA 1H0MA 1ZLKA 2FSWA 3T0YA 3SZPA 3FMQA 2EV0A 1B9MA 5DUIA 3HIFA 1NHAA 1ZG1A 3M1EA 1XSXA 1XGOA 2VONA 2BGCA 5L3FA 4LB5A 1LEBA 1KYWA 3FX3A 2VBXA 2VBYA 3ZMTA 2VODA 4LFUA 2VBZA 2QM3A 3ZMDA 3PFIA 4EJTA 1XDUA 3T8RA 4OIQF 4RGRA 4MHGA 5E20A 4FT8A 2OQRA 4CYDA 4ENNA 3JTHA 1G4DA 3E97A 3SQNA 1WSUA 4O3MA 2F5EA 1SAXA 2HQNA 1XCBA 3GX4X 3DFGA 2A6HF 1U5TC 4HA8A 3IHUA 5BS6A 1BC7C 1T98A 3ECHA 3RKWA 4KMUX 2YR2A 1JHHA 5K5RA 3RJPA 2P5KA 2O0YA 4ENKA 3HTUA 3T1BA 5E1XA 3GWZA 1U5TB 1STZA 4DNCA 1S7AA 1JGSA 3MCZA 3N97A 4GXOA 3IRRA 4OMYA 3PQKA 2GQQA 3LA2A 4M9XA 2ZNYA 4KIFA 5IT9K 1K78B 1ONVA 4PDKA 1YW7A 2JT1A 1TBXA 1IN6A 4LG0A 4MGRA 1YTYA 1GVJA 3HHGA 1ZHFA 2H6BA 1PUEE 1MGTA 4BYYA 5E17F 2M8EA 1KA8A 4Y17A 1RUNA 4O5VA 1VTNC 2CFXA 2W57A 1YQAA 2PMHA 2AXLA 2DK8A 2PBIA 5K5QA 4LD5A 2A07F 2RV8A 1FSHA 4RB2C 3P9IA 5LEJA 3WTSC 1IZ1A 2KKOA 2JPBA 2XKPA 5HLIA 1R5GA 2IPQX 4R1HA 2O03A 3RYRA 1W4MA 4OOIA 4I0BA 1IW7F 3TOAA 2M87A 3LQQA 2ADUA 2HYGD 3HHHA 1Z6RA 4ASNA 4LLGF 2X4HA 1MDMA 4HF2A 3TQNA 4HX4A 3IKVA 2RGVA 3N4MA 2EK5A 2F2EA 1OR7A 4Q5SF 2QVOA 2A69F 1T39A 4O6JA 1QPMA 3I71A 4EQQA 1LVAA 1IUYA 3BDDA 4NQWA 3IRQA 2JPCA 2XAQA 4IJAA 1R7JA 3CTAA 2QYOA 2OBPA 2UZKA 2A68F 3DKWA 1Z05A 4XSZF 2CYYA 1G3TA 1IN7A 3NEUA 4LJZF 1I1GA 4M72A 5F1RA 2D1HA 3BY6A 4L5IA 1FX7A 4Q48A 3TDZC 4KDPA 3QU6A 1U6GA 5D5UB 4M6XA 4LK0F 3FZVA 1R1VA 2FBHA 2JSCA 1PP8F 2ISYA 2YX4A 3SZTA 5FFXA 1F1ZA 2XGXA 4BQAA 2GXGA 5DCMA 1LNWA 3IWZA 1W5SA 5CVUA 3KEQA 4PCQA 1J2XA 4UVBA 4S04A 1P6RA 2HWVA 1MDMB 4BAYA 4NHJA 4L0ZB 2K4BA 4MQ9F 3QOPA 3JTGA 5CYVA 4LLLA 3CUQA 3MZHA 1O7LA 2G7UA 2OZ6A 1LDJA 1KYZA 1Z6TA 2QWWA 4YFKF 1S3JA 2HZTA 5DCFA 2X0LA 2XUBA 5HOOA 3ERED 2P5LC 3CLOA 4L0YB 2GA1A 5E18F 2O61A 3V8KA 5L3CA 1W5TA 1F4KA 3K0LA 5ILSA 4Y13A 1SMTA 4HZFA 4HDVA 4FX0A 4P5OA 3EYIA 2D45A 3DEUA 5K5OA 4N9IA 1QGPA 2IA2A 2CW0F 1HKQA 5ICCA 4EJWA 3RKXA 2LF8A 4HOBA 3R0AA 1U2WA 4XLNF 3F21A 4EJOA 4XSXF 1DPUA 4U7BA 2MLGA 4BNCA 5AIQA 2B0LA 2ZMEB 2ZCWA 3ABTA 3KP3A 3OOPA 1T38A 2XAGA 3HOSA 4RGSA 4EV0A 1FNNA 2LF7A 1SFXA 3E6BA 2YX7A 2TDXA 1BI2A 3BJAA 4UVAA 2F5DA 1J59A 2VN2A 3JAMK 1FP1D 2HTJA 3MZYA 3DQVC 2GAUA 4L5JA 3FXUA 4NB5A 5BMZA 2R3SA 1RI7A 4IRHA 2UXXA 4LGWA 2RN7A 3HRTA 3TO9A 3EUHA 1DP7P 4OMZA 2ZFWA 2KJCA 2P8TA 1SD5A 2E7XA 3C3WA 4RGUA 3ELKA 2P6SA 1FOKA 3WGGA 5ILVA 5DDGA 3IKTA 4KNYA 2ZO4A 3MWMA 1MD0A 3I59A 4M74A 5FD6A 4M9SA 3F8CA 2FE3A 5A2QZ 1DUXC 5CVIA 4B09A 1RIOH 3WGHA 3O2PE 1O3QA 1BI0A 4G7HF 2O6GE 2OQGA 2HQRA 1FC3A 5CLSA 1U8RA 1BI1A 1HW1A 4AVPA 3B02A 3VODA 3ZP5A 5KVRA 5D6EA 2STWA 1S8NA 5F64A 1IRGA 1HQCA 3WGIA 1O3TA 3U9GA 3V8LA 1QNTA 4JK1X 3WTTC 1BM9A 3GYHX 1SMYF 4D0PA 2G9WA 3L9FA 3V7CA 2GA2A 3CDHA 2PJPA 3SXYA 1HKTA 4HLXA 3AAFA 4PGHA 2K27A 2RQPA 4HDUA 4BHCA 2FBKA 3T5XA 4BHBA 2HS5A 2A6EF 3QPHA 4HYEA 5D8LB 3DF8A 1S6LA 2WC2A 2EFWA 1EH7A 1XMAA 1CF7A 1BOAA 2HR3A 5F6FA 3FMSA 1TTYA 3IL2A 2UWMA 3TO6A 2VBWA 2JRTA 4IF4A 3KP4A 5JI6A 2EA4A 3QP6A 1BIAA 3VFZA 2XVCA 3FMRA 1UB9A 1L3LA 4G94A 3ZPLA 3V8JA 2GZWA 3K69A 1GHCA 1OYWA 4ZYHA 1SFEA 4ZZDA 4CO8A 2ZKZA 5FLXZ 1O3SA 2IA0A 2VT3A 2KRFA 1TQPA 3KP6A 1OKRA 2P4WA 3R60A 4UHTA 1DPRA 4R79A 1FBSA 1RUOA 1UHMA 3WTYC 1B9NA 2Q0OA 3E3VA 1FZPB 2ISZA 5J6XA 2FU4A 2DU9A 3WTVC 3F8NA 4G7OF 4EJVA 5ICGA 2NRAC 2K02A 2MLKA 3GEZA 2D2WA 2ETHA 3Q9SA 4RS8A 5HLGA 3G73A 5HS7A 3F72A 3HSRA 2DK5A 4ZYEA 3CJNA 2COMA 4HBLA 4ESJA 2Z99A 4N9HA 4UV8A 3K9TA 2EFOA 4IXAA 1TW2A 1U3EM 2QLZA 1E2XA 3G3ZA 1Z91A 2KIFA 2FRHA 1IXRC 3EQLF 2UXNA 4KN4X 3ULQB 3IC7A 4HV6A 4RGXA 5EEHA 4HF0A 4HQMA 2XV4S 3HRMA 1CF7B 2XKOA 3ZMVA 4P96A 1P4XA 4L9VA 2DAOA 1G6NA 2J5PA 2XHKA 3JSPA 4I09A 1J7KA 3WE2A 3E6CC 5DUKA 1O3RA 2K86A 1RZ4A 1HW5A 1J75A 3VEPA 3M9AA 2QENA 2IVMA 1AOYA 3F6VA 1OMIA 3CUOA 3VB2A 1JXSA 2W24A 3WE3A 2HDCA 2BE5F 4RB3C 4KA4A 3NRVA 4AWXB 2XAJA 1K79A 3ROUA 1V4RA 3KFWX 4A5NA 4HX8A 1UCRA 1SD6A 2EA2A 3FXQA 1SD7A 4YFXF 4RAZA 4Y15A 1KU7A 4XRFA 3BJOA 3KZYA 4A2UA 2BYVE 4M71A 3P9KA 4IRGA 1FY7A 4UVCA 2KIMA 2P7CB 1KQ0A 1ZREA 6PAXA 5IT3A 4EGZA 1J9IA 2Z5UA 1HKSA 1OPCA 2VE8A 3HSEA 1R00A 2BEOA 1FYMA 2RDPA 2NNYA 4BHPA 3QPTA 5TJJA 3WODF 3F8MA 3TKYA 4FHTA 4S05A 3BROA 3ML6A 5HDKA 2XROA 1KU3A 4EM2A 3W6JB 4GYIA 2EB7A 4IPAA 1IXCA 4N0BA 5DD8A 1KU9A 4M9ZA 2FNAA 2RNJA 3K1NA 4XLPF 1B6AA 3GUDA 1HSTA 4CHUA 1T0FA 3MQ0A 4G8XA 1GXQA 4A0XA 2V79A 3I64A 3H92A 2L02A 4P9UA 4LG0B 5D5WB 1H9TA 5HS8A 3J80Z 3BPXA 3JW4A 3J81K 5LEKA 1D8JA 2DW4A 4OINF 4IHSA 2HGCA 4KICA 1A04A 1TNTA 2PEXA 1IXSB 1I5ZA 2CGPA 3U2RA 5L3DA 3KZZA 4WXCA 3Q5FA 4QLCU 3HOTA 1LQ1A 3RYPA 5BPDA 3BPVA 1MJAA 2QZ8A 1FPQA 4P55A 4GO1A 4EM0B 3WTWC 2DPDA 3LQRA 5CVRA 1OYIA 5H20A 4ZYGA 3R4KA 4L9JA 5BPIA 5D6FA 4G9YA 1MJBA 1ODDA 1T2KA 2V1XA 1FYLA 3F22A 3QAHA 1W7PD 2MA3A 2ZNZA 1YYVA 4MNUA 2IA1A 4AIKA 4KMFA 3R6SA 1S29A 1ZG5A 3DXJF 1LB2A 1FWZA 2QQBA 3R0JA 2DFIA 3Q9VA 4ETSA 1YS6A 2JTVA 1XD7A 4G6DA 2QQAA 2M5WA 3KP2A 3I58A 4XBFA 3GFMA 2XRNA 5L3BA 2Z33A 3HSFA 3QP5A 1XMKA 5DV5A 1P4WA 5LHGA 2Q2EA 2KJBA 1XGSA 5EEGA 5LHHA 3MEXA 2P5VA 4M6YA 5D5XB 4MTEA 2NYXA 4ESFA 2BV6A 2EV6A 3FM5A 3O3KA 5LGNA 5IT9Z 2D1VA 2IT0A 4Q47A 1CGPA 3KEOA 1FSEA 4U7DA 2NS0A 3E5UA 4DQ2A 3ZQ7A 3ZN1A 2NNNA 3K1PA 4OU0A 2WWYA 1G3YA 3RTRA 3GXOA 1O57A 2L01A 1B4AA 3LA7A 4YFNF 1GXPA 1OYYA 3WU0A 2ZJ2A 3OV8A 4I0AA 5DCMB 1ZAOA 3LFKA 1BN5A 3CUQC 2QBYA 1ZRDA 1YW9A 4AIJA 2MC3A 3EDPA 4L9NA 3BOQA 2FBIA 2AS5F 1FYKA 1XGNA 1ZGAA 3ZMZA 2FOKA 2PLYA 3BJ6A 4CICA 1TNSA 2W25A 1ZYRF 4G6QA 3CUQB 2J5OA 2K4JA 3TOBA 5HLHA 4I98B 1I6XA 1KU2A 3D5LA 3LA3A 2Y0MA 2H09A 1IRFA 5CJ9A 4QWQA 4EM1A 2W84A 2H94A 3QU3A 2STTA 4WF2A 3RDIA 5LBQA 3P7NA 3WU1B 2PI0A 4I2OA 1FLIA 4I02A 5HDNA 2W85A 1KGSA 1J5YA 2RKHA 3O6BB 2OU2A 3GO5A 1BC8C 3GZ5A 2O8XA 4EGYA 4ON0A 5FFZA 1O7FA 4EVIA 1P92A 4M73A 3D0SA 2FXAA 3ZMUA 1USTA 1KQ8A 3H3UA 3L09A 2E1CA 2MH9A 3B73A 2H6CA 4WK8F 3W6KB 1XN7A 2EJRA 4HAMA 2OAZA 4UXNA 2YPRA 3I4PA 5LGUA 3ZMSA 2O3FA 5TRDA 4EMSA
chains in the Genus database with same CATH superfamily
3IWFA 2ME6A 1FOWA 1FP2A 4FTHA 1Z9CA 2DLLA 1DDNA 2YU3A 1JHFA 4YIIA 1V55H 3GW2A 3H0GJ 2VLAA 2EWNA 4F52A 2W1OA 3BTJA 4UUVA 2P7VB 5LGTA 1ULYA 1U5TA 1IJWC 1R1TA 5D4RA 4UY8I 3WTUC 4RM3A 2DTRA 3AG3H 1ENHA 1B72B 3S1MJ 1P7IA 1SD4A 3JCUC 2MD5A 5E8GA 2R7OA 2HTSA 5BNGA 3HRSA 4A12A 2JZYA 4OIPF 2M3AA 5DM6F 5B3SH 2ACJA 1UMQA 5HS9A 4KUMA 4AUXA 3H5NA 1ETYA 2RAEA 2Q8KA 3REOA 1AWCA 2LKPA 3I59B 1K83J 1X2MA 2VOOA 1J09A 1WHUA 2N8GA 3OYMA 2L4MA 4ZYDA 1LDDA 4AIDA 2CQQA 4R8HA 2MC4A 3DLAA 1PDNC 1JI8A 4D5CA 3KEYA 4J19A 1Q1HA 1WRJA 4IOAF 2QEXI 3SFZA 1WCMJ 3LSKA 5EZHA 5J1YA 1N25A 1P4AA 3LFUA 4A3GJ 1LEAA 2DI3A 2WTEA 3OYNA 1OCCH 2L7KA 1ON2A 4II3A 1I6HJ 1XB4A 3MN2A 1BR2A 3DV8A 5F04A 2OV7A 3LSTA 1FOXA 2CW7A 1K6OA 2ECBA 2F5CA 2H27A 4KT5C 4JBAA 4H0EA 1YO5C 4OIRF 3ISPA 2VC0A 3FF5A 4ZJZA 1X1PA 3M07A 2PG4A 1UG0A 2XIGA 4XRSA 1EH8A 3KETA 2R7DA 1IRZA 5H2FC 2R4GA 3DTIA 4XQFA 4BXUA 3HOZJ 3LAPA 1XPXA 2LNBA 2IXSA 5D8KB 2HPIA 5IY5H 3C2GA 2CQNA 1YFHA 1G3SA 1YIOA 3TMOA 4YG2F 2H8WA 4HW0A 1XSVA 3E6MA 4I7HA 1SC7A 3L7WA 4PUSA 4Y7NJ 5IYBJ 2GXBA 1WWXA 1B8IB 3H1CA 4CYCA 2QF7A 3OYKA 2DMNA 3HTSB 4TV7A 1UG2A 3HC7A 2VXZA 2EFQA 2FMYA 4UUTA 2XC7A 2TRTA 2YSRA 2Y0SA 3RZOJ 3FWEA 1R4NB 2PQ8A 4HLYA 2LK2A 3BZ6A 2RVCA 4WXHA 2CUFA 1TT5B 3EYYA 4KT6A 1W7PA 4ZTFA 4RM2A 5CQGA 4A6EA 1P7JA 3E5QA 4XKVA 1M1EB 1ZGJA 3S2DJ 4MQVA 4A5MA 2DDBA 3CDLA 5IYCJ 2HOEA 1C0WA 3RIRA 2QUFA 3OSGA 2DMQA 3BP8A 2FA5A 2IJLA 5EG0A 3DTKA 3BTCA 2NVQJ 2M7AA 1T6SA 3K70D 1QZYA 3F6OA 4E7HA 2LDUA 2VE9A 9ANTA 2LBFA 1HCRA 2Q1ZB 1Z3XA 1XC5A 1R22A 3TDUC 2L4AA 3MAJA 2HDDA 2EFPA 4U0WA 5L3GA 2GWRA 2IBDA 2XAFA 3OOUA 4P1WA 4WCGA 1YRNA 1UHWA 5GAHJ 1TW3A 3OR2C 4GGGA 1JUMA 4HF1A 5B66C 2F5FA 5HVQC 1SFUA 4A3LJ 5DTDA 4GCVA 3C7JA 3EUAA 2IRFG 3M8EA 2R7QA 4A6DA 5FRMA 2A3SA 1H89C 3K1MA 2NVXJ 4M3DA 1BI3A 2E71A 2KLOA 3JAMZ 3OYDA 1H88C 3I9V2 2KIUA 2XAHA 2EIJH 3WHBA 3GFJA 5E1ZB 3DPLC 1HDPA 1G3WA 1IN4A 4WXDA 1XGMA 2RNGA 3M8FA 1TQIA 5GAEJ 3VDXA 3I54A 3A02A 3V7SA 1Z7UA 1NK3P 1ACIA 4RLFA 3KLNA 2L3DA 3QODA 3ZGKA 3MVPA 3J7AY 1U78A 4HX7A 5JVTA 3A01B 2BY0A 2DFHA 5CVJA 3SFIA 4CCOA 3G71I 2WY7Q 4MEYF 2AXTC 4KIGA 5JLWA 2E7WA 4KIBA 1K7AA 2W82A 2HXOA 1X1AA 5K1YA 5EGOB 2A5WA 2DQRA 3FM3A 2JA8J 1S7EA 2FEZA 3FKIJ 3TW6A 3CESA 2GIVA 3BG5A 2JWTA 5J8CA 3GFIA 1WGXA 2EZHA 3PQJA 4RB0A 4UUSB 4MEXF 1Y0UA 3HYIA 3HJEA 3L00A 4LK1F 1ZARA 4LITA 3CJQB 2CH0A 5LLQA 4UNOA 1QHGA 1SEUA 4CYCB 4A0YA 2X1CA 4PZJA 4L9TA 2D5VA 3ZXSA 1E3HA 3I56I 5J40A 3CCMI 1R36A 2EV5A 3M7GA 2Y9ZA 2M7BA 3F23A 1BJZA 1MIJA 5A2QK 4CXFA 5AONA 2CU7A 3ECOA 1WJFA 1LFBA 2QQ8A 1UFMA 5LRSA 3VPRA 3F8FA 1W7PB 2V6CA 3KE2A 5E1WA 2R7XA 2MABA 3FBIB 1ZRCA 1REPC 2DCEA 3DU6A 2ESNA 1R5HA 1AKHA 4Z2YA 4F91B 4E7LA 3HUGA 2QKLB 5C4JJ 2P6TA 3KCCA 5EG0B 4UV9A 1IRXA 2CQKA 5JVGF 3GZNB 2XASA 3OS2A 2V4JC 4YRVA 2DA5A 3WG9A 1ZN2A 4M6VA 4K2EA 2BY1A 4P9FA 4C9YA 4HNUA 1R6RA 4PJ0C 4AIHA 4C3HJ 5FB2A 1DU6A 1G2HA 4EJUA 3ZQGA 5AIPA 3IAS2 5J47A 3NWTA 3PUFA 3U1DA 2Y48A 3EETA 3FHZA 5M3MJ 2FQ3A 4E70A 2KZVA 4A0ZA 2R7FA 5DEQA 2E2IJ 5D5VB 2Z3YA 4IVNA 1X4OA 3F3XA 1HSJA 1TQMA 2WAFA 2OCEA 2DT7B 1Z21A 3GFLA 1OLTA 4KYWA 1ZLJA 2HVQA 3FXRA 4F3QA 4HNVA 3O8GA 2ZJPF 1S9HA 4ANJA 3VOEA 1GLNA 3C2BA 1L0OC 4LB6B 2V9VA 1GV5A 1IO2A 5JHUA 1WI9A 1R71A 3F8BA 3BR2A 1N77A 4DOZA 1F5TA 3S1QJ 2DMPA 3FHNA 2LSOA 4ZDLA 1DGRM 5KK1A 4G7ZF 3ZQLA 4EATA 2NAZA 3RPUA 4KFCA 3OWTA 4QIWN 4Y33A 3S8PA 4B8XA 1S7OA 1YLFA 2IW5A 4ZH4F 1NG7A 2R5ZA 1YS7A 4HQEA 3PIPF 1WJAA 1RNLA 1TZLA 1X3UA 1HBXG 2M30A 3E5XA 3QRFF 1IGNA 2VT2A 1LDKB 1WKMA 3PNTA 4CH7A 3J7ZI 1ITYA 1D0YA 1MBJA 3CLQA 2IGNA 3ABMH 3I5UA 3LAJA 3OL4A 4KN7X 3QYBA 4OAYA 1IN8A 2OA4A 3TL4X 5DD4A 5D4SA 2LTPA 2M1BA 2ZMEA 2MBFA 3QPSA 2M45A 1T0FC 1IF1A 2HKOA 2ICWG 3Q0WA 2X1DA 4E7KA 3OYGA 3ZN0A 2WADA 2CV2A 2VB6A 3DU5A 1XS9A 2DPUA 2X6WA 2AQEA 1IN5A 5FLXK 4QPOA 5CVVA 1SAUA 3OYIA 4BL0B 2PFBA 4E7JA 3PIOF 2VOPA 3R61A 2F4OB 5GPAA 4XLFA 3TP0A 3E6DA 5EEAA 1R58A 3JSOA 1I27A 2F4MB 1OJLA 2Z9OA 1GUUA 3U1KA 2HQ5A 5FGMA 3LSIA 3T8TA 1ZR4A 3BWGA 1TWHJ 3PO2J 2L9NA 4IHTA 3BCAA 4WWCA 1WJCA 2EQRA 1V3FA 2WAEA 4L18B 2G7HA 4JQFA 1E17A 2MH2A 2VKDA 1UAAA 1MH3A 2ZBKA 3H3ZA 3EPZA 4BXXJ 3BR6A 1EV7A 3CCEI 4U88A 4XKCA 5ERIA 2WV0A 5ED4A 4I01A 3TO7A 2HEOA 1K61A 3RKYA 2WV1A 4I76A 2E1NA 2EPFA 5H6QA 1LE8B 3DBHB 1MJ9A 5HDGA 4CUGA 3RI4A 3S2WA 5J4VA 1QBJA 2NS7A 1IAWA 2L7MP 4ENJA 1VFCA 2E36A 1WQ2A 2K9NA 1DU0A 1YIJI 3TW7A 1HW2A 3J7YJ 2L9VA 3HKZN 2DBBA 4AM3A 4N4OB 2V1UA 4YIFA 4X0GA 1MBKA 3LWFA 1FBUA 3NQOA 1AU7A 3W3CA 3IH3A 3OIOA 4ZZLA 1Y1VJ 5E79C 3CCUI 1JT6A 3I0TA 4F7ZA 1HF0A 3FDYA 2OD5A 2DT5A 1BBYA 2JN6A 4ENMA 2FNPA 5FD5A 3DPTA 1YG2A 1ON1A 1QZZA 3COAC 1W36D 3ABUA 2R5ZB 1JKRC 1ZG3A 5KAIC 1ZRFA 2IP2A 2L54A 4D9JA 3DP7A 4AU7A 3J7AO 4U0YA 2EILH 2HYFA 1H9GA 2CG4A 2IS6A 2XF5A 2FMLA 2NVUB 1WZ2A 3KP5A 1P2FA 4Q4ZF 2LC2A 3PSIA 5LD2C 2GM4A 2VQGA 2K7LA 2FF4A 3V4GA 1BJAA 1U9NA 1BIBA 3MFKA 2O7OA 1MZBA 4CGZA 2DA1A 2IGKA 3L2QA 1R1UA 4LLNA 2L5QA 5KAFC 5FO5A 5L3EA 1USSA 4HSTA 1A35A 2ZJQF 3KYLA 3LSPA 5DYMA 5E3MA 1APLC 5ICEA 5IPAA 4AD9A 5C44J 2PN6A 2FX0A 1J0RA 2X51A 2BY3A 3M3YJ 5GAGJ 4U0VA 3OYBA 2ZSIB 3GVAA 2X6YA 4B47A 2H1KA 1FT9A 3KYCB 4BQOA 3RPQA 2CO5A 3G2BA 3W2WA 1JT0A 1Y6IA 2ESHA 3AG1H 3CF2A 4RB1A 4BE0A 3QYFA 1XCVA 2LY1A 1XDSA 1QO0D 3C1DA 4CZZA 3GLXA 1TWCJ 4WX9A 4DBRA 2XB0X 1ZH5A 1I50J 1KONA 2ZJRF 2ELKA 2M8GX 3CO7C 2LRDA 3GZ6A 3RQ4A 2HKXA 3L2WA 3I3LA 4OIOF 2DTZA 2KP6A 2MFZA 3VYRB 4MTDA 3I4NJ 2ZXJA 2Z1DA 4IRIA 1XSDA 2CWEA 3ABLH 5E3NA 2Q2EB 1IUFA 1FJLA 1YW8A 2QQ9A 2FD5A 4QPQA 5BQTA 5J8FA 3S3NA 3CO6C 4PFOA 4AYBN 1DGWY 4XM3A 4HV5A 2HZDA 3SHFA 5E8IA 1JE8A 3VYUB 2OZUA 4B4CA 4DW6A 4EEFG 4IQ4A 2DQLA 2ELHA 5KNLA 4A3EJ 1YE9A 3ZQQA 1LPQA 1Z67A 2PMUA 2V1DA 4PGGA 2E2JJ 2KL4A 3L2CA 1MKMA 3TBIA 4FX4A 2XGEA 4BH9A 2DYSH 3V7RA 3CZ6A 1NK2P 4M3BA 4IZZA 1LKXA 2HFHA 4BACA 3GMEA 1D3YA 1EH6A 4BEHA 3JRGA 3CCYA 3S1NJ 3WTXC 4ZTJA 3RPUD 3KP7A 3A0HC 2EFNA 3I53A 3AFHA 2JVGA 4BE2A 1DP3A 1ZR2A 2L7ZA 1W1WE 1D8KA 1ZELA 4AC0A 3P9CA 3PSFA 1YJNI 3GTLJ 3MKLA 3HRUA 1KQ9A 5FKNA 5LRRA 4ESBA 3OYAA 4LMYA 3K2ZA 2BBYA 4CDGA 3JRCA 1B59A 2DO7A 3J81Z 4RAYA 1PP7U 3B6CA 5JFRA 5ICFA 1Z1DA 4GFBA 2KMUA 2LLKA 1LJ9A 3K70C 2C6YA 4LIVA 2CQXA 1R23A 3C18A 1EJ9A 2IGOA 2DOEA 5LHIA 2VC1A 3DWLE 2WB1N 4GYGA 3CMYA 1D5VA 5H6RA 2A61A 1QPIA 3CJTB 2CSOA 1A6IA 3ZQFA 1HXDA 5KCMA 3TGNA 2QBYB 4A93J 1FBQA 1F9NA 3J80K 2Y75A 5ILUA 5IP9J 1FMVA 2GOMA 5IOZA 3LSJA 1TLHB 5JR3A 3GTJJ 1W0UA 3FXOA 2A5YB 3GF2A 1B1BA 2RC4A 3ZCOA 3WTZA 1ZQ3P 4OWRB 2KDZA 1E3PA 1QQIA 2ID3A 2V9KA 3FBNB 1K78A 5GP9A 5BOXA 3KLOA 2GLOA 1H0MA 4E7IA 1ZLKA 2FSWA 3T0YA 1I1SA 2LYCA 3JRAA 4CA0A 3IP4B 3SZPA 3FMQA 2VKVA 2F48A 2EV0A 3WHCA 4BBSJ 4A3JJ 1B9MA 4J01A 1S5LC 1BOBA 4F93B 1FOYA 2ZFUA 5DUIA 3HIFA 1NHAA 1ERDA 1ZG1A 3QYEA 3GTPJ 4C30A 3M1EA 1XSXA 4X1EA 1XGOA 2VONA 2FOWA 1MSEC 5CKTA 4IHWA 2BGCA 4PJJA 5L3FA 4LB5A 3SDBA 2JVHA 2E19A 1T56A 3W6VA 1LEBA 4YELA 2KZGA 1KYWA 3FX3A 2VBXA 2XGCA 3ABKH 3BG6A 2VBYA 3M4OJ 3ZMTA 2VODA 4LFUA 2VBZA 2QM3A 3GLLA 3C2HA 3OIPA 3PFIA 5TISC 3ZMDA 3DPUA 4EJTA 1XDUA 3T8RA 4OIQF 3OY9A 1HC8A 4IEJA 4RGRA 1MBEA 4HEA2 4MHGA 4JX4A 5E20A 3RQIA 4IKFA 1JTYA 4FT8A 2OQRA 4CYDA 1QU3A 4ENNA 3JTHA 1X3ZB 1G4DA 4BY7J 1YX5A 2XDVA 3AG2H 3MKWB 3B6AA 3E97A 2M2EA 3SQNA 1WSUA 4O3MA 2F5EA 1SAXA 1WJEA 2HQNA 4FASD 2VJ5A 1XCBA 3GX4X 4X6AJ 3ZQCA 3A03A 2YU9J 5F27A 2QGUA 3DFGA 4JOMA 4ZDPA 1UZCA 2A6HF 1U5TC 1NG6A 4HA8A 2JA2A 3KIOA 3IHUA 1MMDA 4CCNA 1HOMA 3WG7H 3A4CA 5BS6A 4YEJA 2WAQA 1BC7C 3CCJI 3KX2A 1T98A 4PSXA 5LFAA 3ECHA 2RREA 3RKWA 1ZK8A 1ETQA 4KMUX 2YR2A 5EF6A 1JHHA 5E3OA 5K5RA 3K4LA 3RJPA 2P5KA 3OL3A 2O0YA 4ENKA 3HTUA 3SZGA 2WY8Q 2MGQA 1LUJB 3T1BA 1Y0NA 5E1XA 2DODA 3GWZA 3CCRI 1U5TB 3HL2A 1RC9A 2OTJI 1STZA 2KPMA 4DNCA 1YI2I 2R7VA 1S7AA 1JGSA 3MCZA 3N97A 4GXOA 3IRRA 4OMYA 3PQKA 4MIMA 2GQQA 3LA2A 4M9XA 2ZNYA 4KIFA 5IT9K 3Q0VA 1K78B 3IV5A 1ONVA 2BHZA 2MSYA 2X6XA 2CFOA 3BTLA 4PDKA 1YW7A 4DYQA 1JKOC 2GOXB 3G1OA 4F55A 5EJCA 1G59A 2JT1A 1TBXA 1JGGA 1IN6A 2ZXHA 4LG0A 1QRYA 4MGRA 1OCOH 2KISA 1YTYA 1GVJA 3HHGA 1ZHFA 2H6BA 1PUEE 1MGTA 3VWBA 4BYYA 5E17F 5IYDJ 3DEWA 2M8EA 4A69C 5GTIC 3K7AJ 2HVRA 2NXNB 1N75A 4JX5A 1KA8A 2VL8A 4Y17A 5EZGA 4A3IJ 1K4TA 4IHYA 1RUNA 1MMSA 4L5EA 4O5VA 5GPCA 2CJJA 1MMAA 2HNHA 1VTNC 2CFXA 5M5WJ 4I6ZA 4C2TA 3S32A 2OUMA 2OC6A 2IGMA 2W57A 2X48A 1YQAA 2PMHA 2AXLA 1BA5A 4C2UA 2DK8A 5GTHC 2ME0A 2A05A 2K40A 3JRHA 2FJ1A 2PBIA 5K5QA 4BS9A 4LD5A 2A07F 2XSJC 3G4SI 2RV8A 1FSHA 3OYHA 3RKQA 4RB2C 4ITVA 4BUPA 4BKXA 3P9IA 5LEJA 3WTSC 2YUSA 1X4PA 2V6EA 1T33A 1IZ1A 2V9PA 2ZB9A 3HEFA 3HGGA 2KKOA 3JRBA 2JPBA 2XKPA 3S16J 5HLIA 1R5GA 2X1EA 2IPQX 4R1HA 3G6EI 4CZCA 4MLOA 2O03A 2I10A 3RYRA 1XX5A 1UHSA 1W4MA 4OOIA 4I0BA 1IW7F 2K85A 2O8KA 3TOAA 2M87A 3LQQA 2ADUA 2HYGD 2KIQA 1KZHA 3HHHA 1Z6RA 4ASNA 4LLGF 2X4HA 1MDMA 4HF2A 3DLLF 2I5UA 3Q0UA 2IS2A 3TQNA 4HX4A 1WH7A 3IKVA 3NARA 2RGVA 3N4MA 4MO7A 1Z7LA 4M3FA 4BE1A 1MSFC 2EK5A 2F2EA 3K4KA 1VQ5I 1X2NA 1I39A 2FUG2 1OR7A 4Q5SF 3CMEI 2QVOA 2LBFB 2TCTA 2A69F 5IP6A 1T39A 2BY2A 1MBHA 2VASA 4O6JA 1YRNB 5C4XJ 4A3KJ 2GIZA 1SVLA 2VKEA 4BDYA 1QPMA 2X9DA 3X2QH 1NH3A 3CCLI 4BDZA 3K10A 3I71A 1WJDA 2HDWA 4EQQA 2CV1A 1LVAA 2DMUA 4MFEA 1IUYA 3BDDA 4NQWA 3IRQA 2LKSA 2JPCA 2W48A 3KPHA 2XAQA 3FXLA 5FKLA 1R9TJ 4XOTA 4IQJA 4IJAA 4UB6C 1R7JA 3CTAA 2QYOA 2OBPA 2GBYA 3BG9A 2UZKA 2A68F 2ZC2A 4LIUA 4IHVA 3BR3A 3DKWA 3CCQI 1Z05A 4XSZF 2CYYA 2V1NA 2DA3A 4XN3A 3VSLA 3W2VA 1G3TA 4JYKA 2M9HA 1IN7A 3NEUA 4LJZF 1IG7A 4CCMA 1I1GA 4M72A 2H1LA 5F1RA 2D1HA 2Y69H 3BY6A 3MD2A 2WBMA 2Y0SN 3A0BC 2JMWA 3PM1A 4L5IA 1FX7A 4HNTA 4U87A 1ORKA 2G0EA 4Q48A 2LOOA 2EINH 3TDZC 2HU9A 3IH2A 2LFBA 3H0DA 1Q1VA 2K9MA 4KDPA 1RR7A 3QU6A 1A31A 1U6GA 2VUMJ 5D5UB 4M6XA 2FQ4A 4LK0F 3FZVA 1R1VA 2FBHA 2JSCA 3OYCA 4HSRA 1PP8F 3D1NI 2ISYA 2NOJB 1SFKA 2HYJA 1IC8A 2YX4A 3SZTA 5FFXA 1F1ZA 2XGXA 4NC6A 4H4KC 4BQAA 2GXGA 2EZIA 5DCMA 1LNWA 1OR7C 3IWZA 1W5SA 5CVUA 3KEQA 5TGTA 2DFFA 4PCQA 1HA8A 1J2XA 4C2MJ 1U8BA 1T08B 4UVBA 2DJNA 2NOGA 4S04A 1P6RA 5CQEA 2HWVA 1D1CA 3MKYB 1MDMB 3CC4I 2LY2A 4BAYA 4NHJA 4GRIA 3AG4H 4G12A 1IDYA 4YIRX 1AKHB 3HUGB 1RESA 2JQ7A 3PNVA 1YHQI 4RMNA 4L0ZB 2K4BA 4MQ9F 3QOPA 3GCMA 3JTGA 2DFEA 2M0MA 4FQGA 5CYVA 4LLLA 3JRDA 5HODA 1X1CA 3HPHA 3CUQA 1X19A 3MZHA 3QOEA 1LFPA 2UUZA 1O7LA 2EBIA 2G7UA 2OZ6A 4QTRA 4FCYA 2M4GA 1LDJA 2JSPA 1TT0A 1KYZA 3I55I 2R0QC 1Z6TA 2QWWA 2EIKH 3UNGC 1S3JA 2HZTA 1SANA 3ESWB 5DCFA 2X0LA 4YFKF 3ONQA 4B3XA 2XUBA 3BR5A 3BG7A 5HOOA 5C3EJ 3ERED 5FKKA 2P5LC 5B1BH 3CLOA 3TEDA 3CF5F 2GA1A 4L0YB 5B5EC 3F9KA 4I99C 3BQZA 2CMPA 4GDFA 5E18F 4Y52J 2B63J 3GTGJ 2O61A 3S3MA 1YJWI 2XPVA 3V8KA 5L3CA 4E6KG 5F0FA 1W5TA 1F4KA 3K0LA 3MMYB 2VJ4A 2ZMEC 5ILSA 4Y13A 2IAIA 1SMTA 4HZFA 1FEXA 4FE7A 4HDVA 2DA4A 2MD0A 4FX0A 1S72I 4P5OA 3EYIA 2D45A 3DEUA 5K5OA 2X6OA 4N9IA 3WU2C 1O4XA 3OYFA 5GADJ 1WJ5A 4D5FA 1QGPA 4NDLA 2IA2A 2CW0F 5K7FA 2MYSA 2NS8A 3K4CA 1HKQA 1FIAA 1VF9A 4EJWA 5ICCA 1R49A 2VJJA 3RKXA 2LF8A 4HOBA 2JRMA 3R0AA 1D1AA 1U2WA 4XLNF 3F21A 4EJOA 1VQNI 3H36A 4XSXF 2JA6J 1DPUA 4U7BA 2R7RA 2HXIA 1ZGWA 3HOWJ 3BG3A 4DBQA 2MLGA 4BNCA 4NBQA 5AIQA 3S93A 1AHDP 2B0LA 2ZMEB 4XORA 1R5ID 3LSMA 2LREA 2ZCWA 3ABTA 2K5CA 1PJRA 3KP3A 3OOPA 1ETVA 2R7WA 1T38A 2XAGA 4RBOA 3HOSA 4N4NB 4RGSA 1JKQC 4EV0A 3HB9A 1FNNA 5M5XJ 2LF7A 1SFXA 3E6BA 4BBRJ 2YX7A 3FXKA 5DS9A 2TDXA 1W0TA 1BI2A 5FKOA 1MNDA 1PYVA 3BJAA 4UVAA 2F5DA 2E2HJ 4CCLA 2HOSA 4DZJA 3P5JA 1J59A 1TWAJ 2VN2A 5J4YA 3JAMK 1FP1D 4AVZA 2WA0A 2HTJA 3MZYA 3LSRA 3DQVC 5DM7F 2GAUA 4L5JA 2AHQA 3FXUA 4NB5A 5BMZA 2R3SA 1RI7A 1UELB 3PUBA 4IRHA 2UXXA 2LY9A 4LGWA 2RN7A 1VI0A 1B72A 3HRTA 3TO9A 3EUHA 2VIXA 1DP7P 1X58A 4OMZA 2COBA 2ZFWA 2BZTA 2KJCA 1SD5A 2P8TA 2E7XA 3C3WA 4RGUA 2DOAA 3ELKA 2P6SA 1FOKA 3WGGA 1TWFJ 4V19K 4Y3OA 1GVDA 4XRSG 5ILVA 5DDGA 4XOPA 3IKTA 3SEZA 2ZO4A 4ABZA 2F6CA 1Y39A 4KNYA 3MWMA 1MD0A 2DA2A 3I59A 4M74A 5FD6A 4M9SA 3F8CA 2FE3A 5A2QZ 3RZDJ 3CC2I 2O5RA 1VQLI 1DUXC 2M4KA 4G6TB 5CVIA 4B09A 1RIOH 3WGHA 4BGDA 3O2PE 4XLHA 1O3QA 3HM5A 1BI0A 3DCFA 4B48A 1F43A 4G7HF 4XRMA 2O6GE 5KHDA 2OQGA 2HQRA 1FC3A 2YS9A 5CLSA 1U8RA 1FTZA 1BI1A 1HW1A 4AVPA 3B02A 3L1PA 2E34A 4DIQA 3JRFA 3FXMA 2DXIA 3VODA 2JK3A 3ERMA 3ZP5A 1ETKA 5KVRA 5D6EA 5HNFA 5J1UA 2STWA 1S8NA 5F64A 4PJNA 1IRGA 1HQCA 3WGIA 1O3TA 2QSFX 3U9GA 3V8LA 1QNTA 1D5YA 4JK1X 4C3JJ 3WTTC 1BM9A 3GYHX 1SMYF 4D0PA 2G9WA 3PNYA 4B3AA 3L9FA 2W00A 3V7CA 2GA2A 3CDHA 2PJPA 3AL0C 3SXYA 1BW6A 3QWLA 4A3CJ 4BY1J 5JLXA 1HKTA 4HLXA 3EUKL 2PJRA 3AAFA 2VKHA 4PGHA 1B8IA 2ZXIA 2K27A 2BVMA 2L0KA 2RQPA 3IUOA 3KZIC 4HDUA 3LSGA 3LNQA 2B7EA 4BHCA 2FBKA 3T5XA 4XKBA 4BHBA 2HS5A 3V42A 3G1MA 2VPLA 2A6EF 1F36A 3QPHA 2DMTA 1DQUA 1TL8A 5K7HA 4HYEA 5D8LB 2A6TA 1D1BA 3GTQJ 4JX6A 3DF8A 1S6LA 4B44A 1FMWA 2WC2A 2EFWA 1EH7A 1XMAA 5HNHA 3AL0B 1G8XA 3FK6A 3ZQIA 1CF7A 1V5FA 2MW8A 3MKZA 1BOAA 1ETOA 2HR3A 5F6FA 3FMSA 2F4IA 1ZKGA 1TTYA 2KRHA 3IL2A 2VI6A 2UWMA 3TO6A 2VBWA 2JRTA 4IF4A 2ELJA 2HOAA 1JJ6C 3KP4A 5JI6A 2Y30A 2EA4A 3QP6A 3K4NA 1BIAA 4V2GA 3VFZA 2XVCA 3FMRA 1UB9A 2LD5A 1Z3YA 3OS1A 1L3LA 4G94A 3ZPLA 2LMDA 3V8JA 2GZWA 3K69A 1GHCA 1OYWA 4ZYHA 3HG9A 1SFEA 1MBGA 4ZZDA 5J3LA 4CO8A 4ZDOA 2ZKZA 4XK4A 4XLEA 3BQYA 5FLXZ 1O3SA 2VT3A 2IA0A 2KRFA 1TQPA 3KP6A 1OKRA 3OYJA 2PMZA 4CCJA 2P4WA 3R60A 4UHTA 1DPRA 1D0ZA 4R79A 1FBSA 1Z0XA 1RUOA 1UHMA 3BCBA 3WTYC 1B9NA 3JREA 2IS1A 2R5YA 5M3FJ 3K2AA 4BJTA 3H5RA 1VQKI 1YOVB 2Q0OA 3QQAA 5FJ8J 3E3VA 1FZPB 5FKMA 1VZ0A 2ISZA 2BVLA 5J6XA 1MNEA 4PK4A 1I3AA 2FU4A 2DU9A 3HGYA 3VYTB 2CUZA 3WTVC 3F8NA 4G7OF 4HG2A 4EJVA 5ICGA 2NRAC 5FLVA 2R7SA 4BEHB 5F0HA 4IHXA 2K02A 3A01A 2MLKA 3GEZA 4DJAA 2D2WA 3S15J 2K3PA 2R7UA 2ETHA 3K6GA 3Q9SA 4RS8A 5HLGA 3G73A 5EGOA 3DKXA 2EZLA 2L7FP 3CMMA 5HS7A 1NTCA 4J00A 1IDZA 3F72A 3HSRA 2DK5A 4ZYEA 3CJNA 4DZPA 2JUCA 2COMA 1ZTRA 4A3MJ 4HBLA 4UUSA 4OAZA 4ESJA 2Z99A 1OQYA 2PJRB 1MH4A 4N9HA 3H9GA 4UV8A 3K9TA 2EFOA 4IXAA 1TW2A 1U3EM 2I8DA 2QLZA 1E2XA 3G3ZA 1RETA 1XMXA 1Z91A 2KIFA 3ZRGA 2FRHA 3SDGA 1IXRC 3EQLF 2UXNA 3PFYA 4KN4X 3ULQB 3IC7A 2BOLA 4HV6A 1SFOJ 4RGXA 1OCTC 1RPWA 2KT0A 3HXLA 4HF0A 5EEHA 3OS0A 4HPQA 1VQOI 4HQMA 4FE4A 2XV4S 1EKEA 3HRMA 2BXZA 1CF7B 2CV0A 1R4MB 2XKOA 4XICA 5IOYA 3ZMVA 2RQQA 1LVKA 4P96A 1P4XA 4L9VA 3LL7A 4DYRA 2DAOA 1G6NA 2XB5A 2J5PA 2XHKA 4F92B 2W7NA 2QA4I 2XPWA 4W97A 3JSPA 4I09A 1J7KA 3WE2A 2OTLI 3E6CC 5DUKA 1O3RA 2K86A 3H9JA 1RZ4A 1HW5A 1J75A 3VEPA 3M9AA 2K3FA 2QENA 2JJ7A 3M8JA 2X85A 3SJMA 3BZKA 2VJIA 2IVMA 1AOYA 2JA5J 3F6VA 1OMIA 1FTTA 3HOVJ 3CUOA 3K4JA 3VB2A 1JXSA 2JA7J 2W24A 4IL6C 3WE3A 2OCCH 2HDCA 1Y1WJ 2BE5F 4RB3C 4KA4A 3NRVA 4AWXB 2XAJA 1K79A 2M34A 1QVTA 3ZOBA 2LKXA 2VQHA 2E5ZA 3ROUA 1BL0A 3JR9A 1V4RA 3KFWX 2R5YB 3NWSA 4PJLA 4A3FJ 3U21A 2XGDA 4NUBA 4A5NA 4KJZA 1LFUP 4HX8A 3F0CA 1UCRA 1SD6A 2EA2A 2XAUA 3FXQA 3PJRA 3FK7A 3BLYA 1SD7A 4YFXF 4RAZA 2DJIA 4Y15A 1PUFA 4W1UA 2W4SA 1KU7A 4XRFA 1MNMC 2L9RA 4IOCF 3BJOA 3KZYA 1GV2A 1JTXA 2BYVE 4M71A 4A2UA 3S1RJ 3P9KA 1BR1A 4IRGA 1FY7A 2E1MC 2KIMA 4UVCA 2P7CB 1KQ0A 1ZREA 6PAXA 5IT3A 3ASOH 1MMNA 3K4BA 4EGZA 1J9IA 2Z5UA 1HKSA 1OPCA 1X3WB 1WFXA 5IP7J 2VE8A 3HSEA 1R00A 3HKZA 4PFPA 1E0EA 2BEOA 1FYMA 2RDPA 3HPGA 2NNYA 4BHPA 3QPTA 5TJJA 3WODF 2BXYA 3F8MA 3TKYA 4FHTA 4S05A 3PL8A 3BROA 3ML6A 3HDDA 5HDKA 2EIMH 2XROA 1KU3A 3ZR8X 3W6JB 2EH3A 4EM2A 1VQMI 3A1YA 4GYIA 2EB7A 2KRCA 2AO9A 4IPAA 4Y4RA 1YX3A 1IXCA 2E1MB 4N0BA 5DD8A 3UKGA 4B1RA 1KU9A 4M9ZA 2FNAA 2RNJA 1MW7A 3K1NA 1WJBA 3FKJA 1X1BA 3HOUJ 4XLPF 2F5VA 5CPRB 1B6AA 3HOYJ 3GUDA 3CCSI 4FETA 1HSTA 2QSHX 4ZYAA 3L2UA 4CHUA 2HI3A 1T0FA 2XF7A 4XNFA 2PMZN 2M0CA 4XLCA 3D5SC 2LR8A 1POGA 3MQ0A 4G8XA 2K9QA 1MMGA 2K9LA 3L2VA 1GXQA 3UR3C 1HDDC 4A0XA 2VQLA 2V79A 4II2A 3I64A 3H92A 1E3OC 2L02A 1X1DA 1UJ8A 2E1OA 2JUGA 2O9LA 1K6YA 3CP8A 3E7LA 2CW8A 4P9UA 4LG0B 5D5WB 1H9TA 4NNJA 5HS8A 2KQRA 1IV6A 3IAM2 4BXFA 3J80Z 1HLVA 2KDOA 1EA3A 3N05A 3OYEA 1SVMA 1V5GA 2OPTA 3BPXA 1W36C 1VQ4I 3JW4A 1LE8A 5F08A 3FIWA 3J81K 1VNDA 4D1QA 1JJ8C 5LEKA 2CQ7A 2DA7A 3CJRB 2R7ZJ 1D8JA 2DW4A 4OINF 1FIPA 3H35A 3S14J 3S17J 4IHSA 1OISA 3LOCA 3Q3SA 4E7SA 4RA2A 2HGCA 4KICA 1QA6A 4E7ZA 3BC8A 1I3QJ 4XIDA 1A04A 1TNTA 2KHMA 2WAQN 2OF7A 1VQPI 2PEXA 3PO3J 1IXSB 3HBLA 3I4MJ 3OMYA 1I5ZA 4D7MA 2CGPA 3U2RA 2ID6A 5L3DA 1A5JA 1PUFB 3KZZA 4WXCA 1TC3C 3NAUA 3Q5FA 4JP0A 5JHFA 3DKYA 2QSGX 4AYBA 1A36A 1XTAA 4QLCU 4FISA 3HOTA 4PSWA 1ETXA 2LP0A 3AKZA 1LQ1A 3RYPA 1Z77A 5BPDA 5FRNA 3D5RC 3BPVA 1MJAA 3OSFA 1YITI 2QZ8A 4BQNA 4IX7A 1FPQA 3H9QA 4P55A 4GO1A 4EM0B 3WTWC 1XG1A 2DPDA 3LQRA 5CVRA 1OYIA 5H20A 4ZYGA 3R4KA 4L9JA 4HRIA 2L2OA 5BPIA 2DN0A 5D6FA 4G9YA 1MJBA 1ODDA 3JRIA 1T2KA 2NVYJ 2CUJA 2V1XA 1FYLA 1Y8QB 3F22A 1GDTA 3QAHA 2DDAA 3H5AA 4KISA 1W7PD 2MA3A 2ZNZA 4XR6A 2DOFA 1YYVA 3RSNA 4MNUA 2IA1A 1P9QC 1QHHD 4AIKA 1VQ8I 2NVTJ 4KMFA 3R6SA 1S29A 3M1CA 3VSKA 2B9SA 2HVSA 1ZG5A 4BJ5C 3LSHA 2IEKA 3DXJF 1LB2A 1FWZA 2QQBA 3R0JA 2DFIA 2DYRH 3Q9VA 4ETSA 1YS6A 2JTVA 2WB1A 2UV1A 5J1RA 1JKPC 4IO9F 3OYLA 1XD7A 3BTIA 4XLAA 4B43A 3CCVI 1D0XA 3DBLB 2XF6A 4G6DA 2QQAA 4RLQA 2M5WA 3KP2A 3I58A 4NQWB 2R93J 2QKMB 4XBFA 3GFMA 2XRNA 5L3BA 2Z33A 2CUEA 3HSFA 3G1LA 1XMKA 3QP5A 1WH5A 5DV5A 1P4WA 2Z2SB 1RKTA 2Q2EA 5LHGA 2KJBA 1XGSA 5EEGA 5LHHA 3SYTA 3MEXA 2P5VA 3CP2A 5B1AH 3VYSB 4M6YA 5D5XB 4MTEA 5M5YJ 2NYXA 4ESFA 2BV6A 2EV6A 2PX9A 2CRGA 3FM5A 3O3KA 5LGNA 4QSHA 1T95A 1GT0C 5IT9Z 2D1VA 3S2HJ 2IT0A 1WVRA 1YJ9I 3RCOA 3TP3A 3W2AA 2LG4A 4Q47A 1U0JA 1CGPA 2QCOA 3KEOA 1FSEA 4U7DA 4XMYA 2NS0A 3E5UA 1OFCX 1OCRH 4CSWA 1TP4A 4DQ2A 5FROA 3GTMJ 3ZQ7A 3ZN1A 2Y31A 4CCKA 2NNNA 2BW3A 4BU2A 3K1PA 4OU0A 3FISA 2WWYA 3CC7I 1G3YA 1VQ9I 3BR0A 1N78A 4UB8C 2EZKA 4M3EA 3RTRA 3LMMA 1JUSA 3GXOA 1O57A 2E5NA 4DYCA 2L01A 1B4AA 2R7TA 4RDUA 3BT9A 2AQFA 2IS4A 3LA7A 4YFNF 1GXPA 2LH9A 1SVOA 1OYYA 4XKWA 4NC8A 1MBFA 1BR4A 3WU0A 2CS3A 2ZJ2A 3OV8A 4I0AA 4LOCA 4XL9A 3K4MA 3CMAI 5DCMB 1ZAOA 1K4SA 3FXJA 3LFKA 4A3BJ 1BN5A 2XRLA 3CD6I 3CUQC 4E4HA 2QBYA 1VQ6I 1ZRDA 1A6QA 1AA7A 1YW9A 4AIJA 2MC3A 1OCZH 3EDPA 4L9NA 3BOQA 4A3DJ 4NC7A 2E35A 2FBIA 2AS5F 1OCPA 3DEEA 1FYKA 1XGNA 1ZGAA 2L9SA 1RKWA 5K7ZA 5HLTA 1V5EA 3ZMZA 2FOKA 2PLYA 3BJ6A 3L2RA 4CICA 3DTEA 1TNSA 3CDIA 2W25A 2VXDA 1VQ7I 4M3GA 1WPKA 1ZYRF 4G6QA 3OIQA 3CUQB 2J5OA 2K4JA 3TOBA 1PVEA 5HLHA 4RAFA 4I98B 2E60A 1I6XA 1KU2A 2K9SA 2MG4A 3ASNH 3CQZJ 3D5LA 3E0JB 3KYDB 3MZ8A 1H8AC 3O8HA 2LVSA 3LA3A 2Y0MA 4D7NA 2H09A 1IRFA 3IH4A 5CJ9A 3GBGA 3A2KA 4BJ6C 4QWQA 4EM1A 2W84A 2H94A 3QU3A 1RR8C 2STTA 3SEQA 4WF2A 2KFDA 3RDIA 5LBQA 3P7NA 3WU1B 4S0HB 5FLMJ 4KITB 2PI0A 3HZJA 2GXAA 4I2OA 1FLIA 1CQTA 4I02A 2R92J 4LG3A 3ZQHA 5HDNA 4PJMA 2W85A 1KGSA 2Y2ZA 1J5YA 5F0CA 4RAGA 1IV8A 2RKHA 4DGWB 2ZXWH 3DBRB 3O6BB 2VQCA 2OU2A 3OR1C 2V7FA 3GO5A 1BC8C 2Z16A 2OJED 2HQAA 1U9OA 1EF4A 3GZ5A 4MFDA 2O8XA 4EGYA 1TWGJ 2P81A 2HPMA 2DT6A 5EYRA 4ON0A 4ZC3A 1Y56A 5FFZA 1V54H 2V26A 2XSDC 1O7FA 2BW3B 5F1JA 5E3LA 4EVIA 4XN0A 1QVUA 1T8IA 3GTOJ 1P92A 2VPRA 3D0SA 2FXAA 2DA6A 4M73A 1USTA 3ZMUA 1KQ8A 2HOTA 3GTKJ 3H3UA 4Z6YA 3L09A 1JUPA 2E1CA 2MH9A 1RRJA 3B73A 2H6CA 3E1SA 5EDNA 4WK8F 3W6KB 1Y8RB 1XN7A 1ETWA 3BR1A 3EUHC 1WI3A 4BQQA 2EJRA 2ZSHB 1BW5A 2XPUA 4HAMA 4XONA 3HOXJ 2BHYA 2OAZA 2Y9YA 4UXNA 2H8RA 4V2FA 2YPRA 3QPLA 2P0WA 3I4PA 5LGUA 3H3VK 1W5CC 2ECCA 1QZEA 3S3OA 4C3IJ 3ZMSA 2O3FA 5TRDA 3BZCA 4EMSA
chains in the Genus database with same CATH topology
3IWFA 1FP2A 1Z9CA 2DLLA 1DDNA 2YU3A 1JHFA 4YIIA 3GW2A 4UUVA 2EWNA 2P7VB 5LGTA 1ULYA 1U5TA 1R1TA 5D4RA 3WTUC 2DTRA 1SD4A 5E8GA 2MD5A 2HTSA 4A12A 3HRSA 2JZYA 4OIPF 2ACJA 5HS9A 4KUMA 3REOA 2Q8KA 1AWCA 2LKPA 3I59B 2VOOA 2L4MA 4ZYDA 1LDDA 4R8HA 1PDNC 1Q1HA 1WRJA 3SFZA 1P4AA 1LEAA 2DI3A 2WTEA 1ON2A 1XB4A 3DV8A 3LSTA 1K6OA 2F5CA 2H27A 4KT5C 4JBAA 4H0EA 1YO5C 4OIRF 3ISPA 2VC0A 3FF5A 2PG4A 2XIGA 1EH8A 3KETA 2R7DA 4BXUA 3LAPA 2LNBA 5D8KB 1YFHA 1G3SA 1YIOA 4YG2F 4HW0A 1XSVA 3E6MA 4I7HA 3L7WA 2GXBA 1WWXA 3HTSB 4TV7A 2VXZA 2EFQA 2FMYA 2YSRA 3FWEA 2PQ8A 4HLYA 3BZ6A 2RVCA 4WXHA 3EYYA 1W7PA 4A6EA 3E5QA 1ZGJA 4MQVA 4A5MA 2HOEA 1C0WA 3RIRA 2QUFA 3BP8A 2FA5A 2IJLA 1T6SA 1QZYA 3F6OA 2LDUA 2VE9A 1R22A 3TDUC 2L4AA 3MAJA 2EFPA 4U0WA 5L3GA 2GWRA 2XAFA 4WCGA 1UHWA 1TW3A 4GGGA 4HF1A 2F5FA 5HVQC 1SFUA 4GCVA 3C7JA 2IRFG 3M8EA 4A6DA 2A3SA 3K1MA 1BI3A 3JAMZ 2KIUA 2XAHA 3GFJA 5E1ZB 3DPLC 1G3WA 1IN4A 4WXDA 1XGMA 3M8FA 1TQIA 3I54A 3V7SA 1Z7UA 3KLNA 2L3DA 1U78A 4HX7A 5JVTA 5CVJA 4MEYF 4KIGA 2E7WA 4KIBA 1K7AA 5K1YA 3FM3A 2DQRA 2FEZA 2GIVA 5J8CA 3GFIA 3PQJA 4RB0A 4MEXF 1Y0UA 3HYIA 3L00A 4LK1F 1ZARA 5LLQA 4UNOA 4A0YA 4PZJA 4L9TA 1R36A 2EV5A 3M7GA 3F23A 5A2QK 4CXFA 5AONA 3ECOA 1UFMA 5LRSA 3F8FA 1W7PB 2V6CA 3KE2A 5E1WA 1ZRCA 1REPC 2ESNA 1R5HA 4Z2YA 3HUGA 2P6TA 3KCCA 4UV9A 2CQKA 2XASA 3WG9A 1ZN2A 4K2EA 4P9FA 5FB2A 4AIHA 4EJUA 5AIPA 3U1DA 2Y48A 3EETA 3FHZA 2FQ3A 4E70A 4A0ZA 2R7FA 5DEQA 5D5VB 2Z3YA 4IVNA 3F3XA 1HSJA 1TQMA 3GFLA 4KYWA 1ZLJA 3FXRA 3VOEA 1L0OC 4LB6B 2V9VA 5JHUA 1WI9A 3F8BA 1F5TA 2LSOA 4G7ZF 5KK1A 2NAZA 3RPUA 4KFCA 4B8XA 1S7OA 1YLFA 2IW5A 4ZH4F 4HQEA 1YS7A 1RNLA 1HBXG 1X3UA 2M30A 3E5XA 3QRFF 2VT2A 1LDKB 1WKMA 3I5UA 3LAJA 4KN7X 1IN8A 2OA4A 5D4SA 5DD4A 2ZMEA 2M1BA 2MBFA 2M45A 1IF1A 2HKOA 3ZN0A 2DPUA 1IN5A 5FLXK 5CVVA 2PFBA 2VOPA 3R61A 3E6DA 1R58A 3JSOA 1I27A 2Z9OA 5FGMA 3T8TA 3BWGA 4IHTA 4WWCA 1V3FA 4L18B 2G7HA 4JQFA 1E17A 2MH2A 2ZBKA 3H3ZA 1EV7A 4U88A 5ED4A 5ERIA 2WV0A 4I01A 3TO7A 2HEOA 3RKYA 2E1NA 5H6QA 1MJ9A 5HDGA 3RI4A 3S2WA 1QBJA 1IAWA 4ENJA 1WQ2A 1HW2A 2DBBA 2V1UA 4YIFA 3LWFA 1FBUA 3NQOA 4ZZLA 3I0TA 4F7ZA 2OD5A 2DT5A 1BBYA 4ENMA 2FNPA 5FD5A 3DPTA 1YG2A 1ON1A 1QZZA 3COAC 3ABUA 1ZG3A 1ZRFA 2IP2A 2L54A 3DP7A 3J7AO 4U0YA 2HYFA 1H9GA 2CG4A 2FMLA 3KP5A 1P2FA 4Q4ZF 2K7LA 2FF4A 3V4GA 1BJAA 1BIBA 3MFKA 1MZBA 4CGZA 1R1UA 4LLNA 5FO5A 5L3EA 1USSA 5DYMA 5ICEA 4AD9A 2PN6A 1J0RA 4U0VA 3GVAA 1FT9A 3RPQA 2CO5A 2ESHA 4RB1A 1XCVA 1XDSA 1QO0D 3C1DA 4CZZA 3GLXA 4WX9A 1ZH5A 3CO7C 3GZ6A 2HKXA 4OIOF 4MTDA 2ZXJA 4IRIA 1XSDA 2CWEA 1YW8A 2QQ9A 5BQTA 5J8FA 3CO6C 4HV5A 5E8IA 3SHFA 1JE8A 2OZUA 2DQLA 2ELHA 2PMUA 2V1DA 4PGGA 3L2CA 1MKMA 4FX4A 4BH9A 3V7RA 2HFHA 1D3YA 1EH6A 3WTXC 3KP7A 2EFNA 3I53A 1D8KA 3P9CA 5LRRA 3HRUA 1KQ9A 4ESBA 4LMYA 3K2ZA 2BBYA 4CDGA 1B59A 2DO7A 3J81Z 4RAYA 1PP7U 5JFRA 5ICFA 1Z1DA 2C6YA 1LJ9A 1R23A 3C18A 5LHIA 2VC1A 4GYGA 1D5VA 5H6RA 2A61A 2CSOA 1HXDA 3TGNA 2QBYB 1FBQA 1F9NA 3J80K 2Y75A 5ILUA 1TLHB 5JR3A 2A5YB 3GF2A 1B1BA 2RC4A 3WTZA 1QQIA 1K78A 5BOXA 3KLOA 1I1SA 1H0MA 1ZLKA 2FSWA 3T0YA 3SZPA 3FMQA 2EV0A 1B9MA 5DUIA 3HIFA 1NHAA 1ZG1A 3M1EA 1XSXA 1XGOA 2VONA 2BGCA 5L3FA 4LB5A 1LEBA 1KYWA 3FX3A 2VBXA 2VBYA 3ZMTA 2VODA 4LFUA 2VBZA 2QM3A 3ZMDA 3PFIA 4EJTA 1XDUA 3T8RA 4OIQF 4RGRA 4MHGA 5E20A 4FT8A 2OQRA 4CYDA 4ENNA 3JTHA 1G4DA 3E97A 3SQNA 1WSUA 4O3MA 2F5EA 1SAXA 2HQNA 1XCBA 3GX4X 3DFGA 2A6HF 1U5TC 4HA8A 3IHUA 5BS6A 1BC7C 1T98A 3ECHA 3RKWA 4KMUX 2YR2A 1JHHA 5K5RA 3RJPA 2P5KA 2O0YA 4ENKA 3HTUA 3T1BA 5E1XA 3GWZA 1U5TB 1STZA 4DNCA 1S7AA 1JGSA 3MCZA 3N97A 4GXOA 3IRRA 4OMYA 3PQKA 2GQQA 3LA2A 4M9XA 2ZNYA 4KIFA 5IT9K 1K78B 1ONVA 4PDKA 1YW7A 2JT1A 1TBXA 1IN6A 4LG0A 4MGRA 1YTYA 1GVJA 3HHGA 1ZHFA 2H6BA 1PUEE 1MGTA 4BYYA 5E17F 2M8EA 1KA8A 4Y17A 1RUNA 4O5VA 1VTNC 2CFXA 2W57A 1YQAA 2PMHA 2AXLA 2DK8A 2PBIA 5K5QA 4LD5A 2A07F 2RV8A 1FSHA 4RB2C 3P9IA 5LEJA 3WTSC 1IZ1A 2KKOA 2JPBA 2XKPA 5HLIA 1R5GA 2IPQX 4R1HA 2O03A 3RYRA 1W4MA 4OOIA 4I0BA 1IW7F 3TOAA 2M87A 3LQQA 2ADUA 2HYGD 3HHHA 1Z6RA 4ASNA 4LLGF 2X4HA 1MDMA 4HF2A 3TQNA 4HX4A 3IKVA 2RGVA 3N4MA 2EK5A 2F2EA 1OR7A 4Q5SF 2QVOA 2A69F 1T39A 4O6JA 1QPMA 3I71A 4EQQA 1LVAA 1IUYA 3BDDA 4NQWA 3IRQA 2JPCA 2XAQA 4IJAA 1R7JA 3CTAA 2QYOA 2OBPA 2UZKA 2A68F 3DKWA 1Z05A 4XSZF 2CYYA 1G3TA 1IN7A 3NEUA 4LJZF 1I1GA 4M72A 5F1RA 2D1HA 3BY6A 4L5IA 1FX7A 4Q48A 3TDZC 4KDPA 3QU6A 1U6GA 5D5UB 4M6XA 4LK0F 3FZVA 1R1VA 2FBHA 2JSCA 1PP8F 2ISYA 2YX4A 3SZTA 5FFXA 1F1ZA 2XGXA 4BQAA 2GXGA 5DCMA 1LNWA 3IWZA 1W5SA 5CVUA 3KEQA 4PCQA 1J2XA 4UVBA 4S04A 1P6RA 2HWVA 1MDMB 4BAYA 4NHJA 4L0ZB 2K4BA 4MQ9F 3QOPA 3JTGA 5CYVA 4LLLA 3CUQA 3MZHA 1O7LA 2G7UA 2OZ6A 1LDJA 1KYZA 1Z6TA 2QWWA 4YFKF 1S3JA 2HZTA 5DCFA 2X0LA 2XUBA 5HOOA 3ERED 2P5LC 3CLOA 4L0YB 2GA1A 5E18F 2O61A 3V8KA 5L3CA 1W5TA 1F4KA 3K0LA 5ILSA 4Y13A 1SMTA 4HZFA 4HDVA 4FX0A 4P5OA 3EYIA 2D45A 3DEUA 5K5OA 4N9IA 1QGPA 2IA2A 2CW0F 1HKQA 5ICCA 4EJWA 3RKXA 2LF8A 4HOBA 3R0AA 1U2WA 4XLNF 3F21A 4EJOA 4XSXF 1DPUA 4U7BA 2MLGA 4BNCA 5AIQA 2B0LA 2ZMEB 2ZCWA 3ABTA 3KP3A 3OOPA 1T38A 2XAGA 3HOSA 4RGSA 4EV0A 1FNNA 2LF7A 1SFXA 3E6BA 2YX7A 2TDXA 1BI2A 3BJAA 4UVAA 2F5DA 1J59A 2VN2A 3JAMK 1FP1D 2HTJA 3MZYA 3DQVC 2GAUA 4L5JA 3FXUA 4NB5A 5BMZA 2R3SA 1RI7A 4IRHA 2UXXA 4LGWA 2RN7A 3HRTA 3TO9A 3EUHA 1DP7P 4OMZA 2ZFWA 2KJCA 2P8TA 1SD5A 2E7XA 3C3WA 4RGUA 3ELKA 2P6SA 1FOKA 3WGGA 5ILVA 5DDGA 3IKTA 4KNYA 2ZO4A 3MWMA 1MD0A 3I59A 4M74A 5FD6A 4M9SA 3F8CA 2FE3A 5A2QZ 1DUXC 5CVIA 4B09A 1RIOH 3WGHA 3O2PE 1O3QA 1BI0A 4G7HF 2O6GE 2OQGA 2HQRA 1FC3A 5CLSA 1U8RA 1BI1A 1HW1A 4AVPA 3B02A 3VODA 3ZP5A 5KVRA 5D6EA 2STWA 1S8NA 5F64A 1IRGA 1HQCA 3WGIA 1O3TA 3U9GA 3V8LA 1QNTA 4JK1X 3WTTC 1BM9A 3GYHX 1SMYF 4D0PA 2G9WA 3L9FA 3V7CA 2GA2A 3CDHA 2PJPA 3SXYA 1HKTA 4HLXA 3AAFA 4PGHA 2K27A 2RQPA 4HDUA 4BHCA 2FBKA 3T5XA 4BHBA 2HS5A 2A6EF 3QPHA 4HYEA 5D8LB 3DF8A 1S6LA 2WC2A 2EFWA 1EH7A 1XMAA 1CF7A 1BOAA 2HR3A 5F6FA 3FMSA 1TTYA 3IL2A 2UWMA 3TO6A 2VBWA 2JRTA 4IF4A 3KP4A 5JI6A 2EA4A 3QP6A 1BIAA 3VFZA 2XVCA 3FMRA 1UB9A 1L3LA 4G94A 3ZPLA 3V8JA 2GZWA 3K69A 1GHCA 1OYWA 4ZYHA 1SFEA 4ZZDA 4CO8A 2ZKZA 5FLXZ 1O3SA 2IA0A 2VT3A 2KRFA 1TQPA 3KP6A 1OKRA 2P4WA 3R60A 4UHTA 1DPRA 4R79A 1FBSA 1RUOA 1UHMA 3WTYC 1B9NA 2Q0OA 3E3VA 1FZPB 2ISZA 5J6XA 2FU4A 2DU9A 3WTVC 3F8NA 4G7OF 4EJVA 5ICGA 2NRAC 2K02A 2MLKA 3GEZA 2D2WA 2ETHA 3Q9SA 4RS8A 5HLGA 3G73A 5HS7A 3F72A 3HSRA 2DK5A 4ZYEA 3CJNA 2COMA 4HBLA 4ESJA 2Z99A 4N9HA 4UV8A 3K9TA 2EFOA 4IXAA 1TW2A 1U3EM 2QLZA 1E2XA 3G3ZA 1Z91A 2KIFA 2FRHA 1IXRC 3EQLF 2UXNA 4KN4X 3ULQB 3IC7A 4HV6A 4RGXA 5EEHA 4HF0A 4HQMA 2XV4S 3HRMA 1CF7B 2XKOA 3ZMVA 4P96A 1P4XA 4L9VA 2DAOA 1G6NA 2J5PA 2XHKA 3JSPA 4I09A 1J7KA 3WE2A 3E6CC 5DUKA 1O3RA 2K86A 1RZ4A 1HW5A 1J75A 3VEPA 3M9AA 2QENA 2IVMA 1AOYA 3F6VA 1OMIA 3CUOA 3VB2A 1JXSA 2W24A 3WE3A 2HDCA 2BE5F 4RB3C 4KA4A 3NRVA 4AWXB 2XAJA 1K79A 3ROUA 1V4RA 3KFWX 4A5NA 4HX8A 1UCRA 1SD6A 2EA2A 3FXQA 1SD7A 4YFXF 4RAZA 4Y15A 1KU7A 4XRFA 3BJOA 3KZYA 4A2UA 2BYVE 4M71A 3P9KA 4IRGA 1FY7A 4UVCA 2KIMA 2P7CB 1KQ0A 1ZREA 6PAXA 5IT3A 4EGZA 1J9IA 2Z5UA 1HKSA 1OPCA 2VE8A 3HSEA 1R00A 2BEOA 1FYMA 2RDPA 2NNYA 4BHPA 3QPTA 5TJJA 3WODF 3F8MA 3TKYA 4FHTA 4S05A 3BROA 3ML6A 5HDKA 2XROA 1KU3A 4EM2A 3W6JB 4GYIA 2EB7A 4IPAA 1IXCA 4N0BA 5DD8A 1KU9A 4M9ZA 2FNAA 2RNJA 3K1NA 4XLPF 1B6AA 3GUDA 1HSTA 4CHUA 1T0FA 3MQ0A 4G8XA 1GXQA 4A0XA 2V79A 3I64A 3H92A 2L02A 4P9UA 4LG0B 5D5WB 1H9TA 5HS8A 3J80Z 3BPXA 3JW4A 3J81K 5LEKA 1D8JA 2DW4A 4OINF 4IHSA 2HGCA 4KICA 1A04A 1TNTA 2PEXA 1IXSB 1I5ZA 2CGPA 3U2RA 5L3DA 3KZZA 4WXCA 3Q5FA 4QLCU 3HOTA 1LQ1A 3RYPA 5BPDA 3BPVA 1MJAA 2QZ8A 1FPQA 4P55A 4GO1A 4EM0B 3WTWC 2DPDA 3LQRA 5CVRA 1OYIA 5H20A 4ZYGA 3R4KA 4L9JA 5BPIA 5D6FA 4G9YA 1MJBA 1ODDA 1T2KA 2V1XA 1FYLA 3F22A 3QAHA 1W7PD 2MA3A 2ZNZA 1YYVA 4MNUA 2IA1A 4AIKA 4KMFA 3R6SA 1S29A 1ZG5A 3DXJF 1LB2A 1FWZA 2QQBA 3R0JA 2DFIA 3Q9VA 4ETSA 1YS6A 2JTVA 1XD7A 4G6DA 2QQAA 2M5WA 3KP2A 3I58A 4XBFA 3GFMA 2XRNA 5L3BA 2Z33A 3HSFA 3QP5A 1XMKA 5DV5A 1P4WA 5LHGA 2Q2EA 2KJBA 1XGSA 5EEGA 5LHHA 3MEXA 2P5VA 4M6YA 5D5XB 4MTEA 2NYXA 4ESFA 2BV6A 2EV6A 3FM5A 3O3KA 5LGNA 5IT9Z 2D1VA 2IT0A 4Q47A 1CGPA 3KEOA 1FSEA 4U7DA 2NS0A 3E5UA 4DQ2A 3ZQ7A 3ZN1A 2NNNA 3K1PA 4OU0A 2WWYA 1G3YA 3RTRA 3GXOA 1O57A 2L01A 1B4AA 3LA7A 4YFNF 1GXPA 1OYYA 3WU0A 2ZJ2A 3OV8A 4I0AA 5DCMB 1ZAOA 3LFKA 1BN5A 3CUQC 2QBYA 1ZRDA 1YW9A 4AIJA 2MC3A 3EDPA 4L9NA 3BOQA 2FBIA 2AS5F 1FYKA 1XGNA 1ZGAA 3ZMZA 2FOKA 2PLYA 3BJ6A 4CICA 1TNSA 2W25A 1ZYRF 4G6QA 3CUQB 2J5OA 2K4JA 3TOBA 5HLHA 4I98B 1I6XA 1KU2A 3D5LA 3LA3A 2Y0MA 2H09A 1IRFA 5CJ9A 4QWQA 4EM1A 2W84A 2H94A 3QU3A 2STTA 4WF2A 3RDIA 5LBQA 3P7NA 3WU1B 2PI0A 4I2OA 1FLIA 4I02A 5HDNA 2W85A 1KGSA 1J5YA 2RKHA 3O6BB 2OU2A 3GO5A 1BC8C 3GZ5A 2O8XA 4EGYA 4ON0A 5FFZA 1O7FA 4EVIA 1P92A 4M73A 3D0SA 2FXAA 3ZMUA 1USTA 1KQ8A 3H3UA 3L09A 2E1CA 2MH9A 3B73A 2H6CA 4WK8F 3W6KB 1XN7A 2EJRA 4HAMA 2OAZA 4UXNA 2YPRA 3I4PA 5LGUA 3ZMSA 2O3FA 5TRDA 4EMSA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3IWF A;  1FP2 A;  1Z9C A;  2DLL A;  1DDN A;  2YU3 A;  1JHF A;  4YII A;  3GW2 A;  4UUV A;  2EWN A;  2P7V B;  5LGT A;  1ULY A;  1U5T A;  1R1T A;  5D4R A;  3WTU C;  2DTR A;  1SD4 A;  5E8G A;  2MD5 A;  2HTS A;  4A12 A;  3HRS A;  2JZY A;  4OIP F;  2ACJ A;  5HS9 A;  4KUM A;  3REO A;  2Q8K A;  1AWC A;  2LKP A;  3I59 B;  2VOO A;  2L4M A;  4ZYD A;  1LDD A;  4R8H A;  1PDN C;  1Q1H A;  1WRJ A;  3SFZ A;  1P4A A;  1LEA A;  2DI3 A;  2WTE A;  1ON2 A;  1XB4 A;  3DV8 A;  3LST A;  1K6O A;  2F5C A;  2H27 A;  4KT5 C;  4JBA A;  4H0E A;  1YO5 C;  4OIR F;  3ISP A;  2VC0 A;  3FF5 A;  2PG4 A;  2XIG A;  1EH8 A;  3KET A;  2R7D A;  4BXU A;  3LAP A;  2LNB A;  5D8K B;  1YFH A;  1G3S A;  1YIO A;  4YG2 F;  4HW0 A;  1XSV A;  3E6M A;  4I7H A;  3L7W A;  2GXB A;  1WWX A;  3HTS B;  4TV7 A;  2VXZ A;  2EFQ A;  2FMY A;  2YSR A;  3FWE A;  2PQ8 A;  4HLY A;  3BZ6 A;  2RVC A;  4WXH A;  3EYY A;  1W7P A;  4A6E A;  3E5Q A;  1ZGJ A;  4MQV A;  4A5M A;  2HOE A;  1C0W A;  3RIR A;  2QUF A;  3BP8 A;  2FA5 A;  2IJL A;  1T6S A;  1QZY A;  3F6O A;  2LDU A;  2VE9 A;  1R22 A;  3TDU C;  2L4A A;  3MAJ A;  2EFP A;  4U0W A;  5L3G A;  2GWR A;  2XAF A;  4WCG A;  1UHW A;  1TW3 A;  4GGG A;  4HF1 A;  2F5F A;  5HVQ C;  1SFU A;  4GCV A;  3C7J A;  2IRF G;  3M8E A;  4A6D A;  2A3S A;  3K1M A;  1BI3 A;  3JAM Z;  2KIU A;  2XAH A;  3GFJ A;  5E1Z B;  3DPL C;  1G3W A;  1IN4 A;  4WXD A;  1XGM A;  3M8F A;  1TQI A;  3I54 A;  3V7S A;  1Z7U A;  3KLN A;  2L3D A;  1U78 A;  4HX7 A;  5JVT A;  5CVJ A;  4MEY F;  4KIG A;  2E7W A;  4KIB A;  1K7A A;  5K1Y A;  3FM3 A;  2DQR A;  2FEZ A;  2GIV A;  5J8C A;  3GFI A;  3PQJ A;  4RB0 A;  4MEX F;  1Y0U A;  3HYI A;  3L00 A;  4LK1 F;  1ZAR A;  5LLQ A;  4UNO A;  4A0Y A;  4PZJ A;  4L9T A;  1R36 A;  2EV5 A;  3M7G A;  3F23 A;  5A2Q K;  4CXF A;  5AON A;  3ECO A;  1UFM A;  5LRS A;  3F8F A;  1W7P B;  2V6C A;  3KE2 A;  5E1W A;  1ZRC A;  1REP C;  2ESN A;  1R5H A;  4Z2Y A;  3HUG A;  2P6T A;  3KCC A;  4UV9 A;  2CQK A;  2XAS A;  3WG9 A;  1ZN2 A;  4K2E A;  4P9F A;  5FB2 A;  4AIH A;  4EJU A;  5AIP A;  3U1D A;  2Y48 A;  3EET A;  3FHZ A;  2FQ3 A;  4E70 A;  4A0Z A;  2R7F A;  5DEQ A;  5D5V B;  2Z3Y A;  4IVN A;  3F3X A;  1HSJ A;  1TQM A;  3GFL A;  4KYW A;  1ZLJ A;  3FXR A;  3VOE A;  1L0O C;  4LB6 B;  2V9V A;  5JHU A;  1WI9 A;  3F8B A;  1F5T A;  2LSO A;  4G7Z F;  5KK1 A;  2NAZ A;  3RPU A;  4KFC A;  4B8X A;  1S7O A;  1YLF A;  2IW5 A;  4ZH4 F;  4HQE A;  1YS7 A;  1RNL A;  1HBX G;  1X3U A;  2M30 A;  3E5X A;  3QRF F;  2VT2 A;  1LDK B;  1WKM A;  3I5U A;  3LAJ A;  4KN7 X;  1IN8 A;  2OA4 A;  5D4S A;  5DD4 A;  2ZME A;  2M1B A;  2MBF A;  2M45 A;  1IF1 A;  2HKO A;  3ZN0 A;  2DPU A;  1IN5 A;  5FLX K;  5CVV A;  2PFB A;  2VOP A;  3R61 A;  3E6D A;  1R58 A;  3JSO A;  1I27 A;  2Z9O A;  5FGM A;  3T8T A;  3BWG A;  4IHT A;  4WWC A;  1V3F A;  4L18 B;  2G7H A;  4JQF A;  1E17 A;  2MH2 A;  2ZBK A;  3H3Z A;  1EV7 A;  4U88 A;  5ED4 A;  5ERI A;  2WV0 A;  4I01 A;  3TO7 A;  2HEO A;  3RKY A;  2E1N A;  5H6Q A;  1MJ9 A;  5HDG A;  3RI4 A;  3S2W A;  1QBJ A;  1IAW A;  4ENJ A;  1WQ2 A;  1HW2 A;  2DBB A;  2V1U A;  4YIF A;  3LWF A;  1FBU A;  3NQO A;  4ZZL A;  3I0T A;  4F7Z A;  2OD5 A;  2DT5 A;  1BBY A;  4ENM A;  2FNP A;  5FD5 A;  3DPT A;  1YG2 A;  1ON1 A;  1QZZ A;  3COA C;  3ABU A;  1ZG3 A;  1ZRF A;  2IP2 A;  2L54 A;  3DP7 A;  3J7A O;  4U0Y A;  2HYF A;  1H9G A;  2CG4 A;  2FML A;  3KP5 A;  1P2F A;  4Q4Z F;  2K7L A;  2FF4 A;  3V4G A;  1BJA A;  1BIB A;  3MFK A;  1MZB A;  4CGZ A;  1R1U A;  4LLN A;  5FO5 A;  5L3E A;  1USS A;  5DYM A;  5ICE A;  4AD9 A;  2PN6 A;  1J0R A;  4U0V A;  3GVA A;  1FT9 A;  3RPQ A;  2CO5 A;  2ESH A;  4RB1 A;  1XCV A;  1XDS A;  1QO0 D;  3C1D A;  4CZZ A;  3GLX A;  4WX9 A;  1ZH5 A;  3CO7 C;  3GZ6 A;  2HKX A;  4OIO F;  4MTD A;  2ZXJ A;  4IRI A;  1XSD A;  2CWE A;  1YW8 A;  2QQ9 A;  5BQT A;  5J8F A;  3CO6 C;  4HV5 A;  5E8I A;  3SHF A;  1JE8 A;  2OZU A;  2DQL A;  2ELH A;  2PMU A;  2V1D A;  4PGG A;  3L2C A;  1MKM A;  4FX4 A;  4BH9 A;  3V7R A;  2HFH A;  1D3Y A;  1EH6 A;  3WTX C;  3KP7 A;  2EFN A;  3I53 A;  1D8K A;  3P9C A;  5LRR A;  3HRU A;  1KQ9 A;  4ESB A;  4LMY A;  3K2Z A;  2BBY A;  4CDG A;  1B59 A;  2DO7 A;  3J81 Z;  4RAY A;  1PP7 U;  5JFR A;  5ICF A;  1Z1D A;  2C6Y A;  1LJ9 A;  1R23 A;  3C18 A;  5LHI A;  2VC1 A;  4GYG A;  1D5V A;  5H6R A;  2A61 A;  2CSO A;  1HXD A;  3TGN A;  2QBY B;  1FBQ A;  1F9N A;  3J80 K;  2Y75 A;  5ILU A;  1TLH B;  5JR3 A;  2A5Y B;  3GF2 A;  1B1B A;  2RC4 A;  3WTZ A;  1QQI A;  1K78 A;  5BOX A;  3KLO A;  1I1S A;  1H0M A;  1ZLK A;  2FSW A;  3T0Y A;  3SZP A;  3FMQ A;  2EV0 A;  1B9M A;  5DUI A;  3HIF A;  1NHA A;  1ZG1 A;  3M1E A;  1XSX A;  1XGO A;  2VON A;  2BGC A;  5L3F A;  4LB5 A;  1LEB A;  1KYW A;  3FX3 A;  2VBX A;  2VBY A;  3ZMT A;  2VOD A;  4LFU A;  2VBZ A;  2QM3 A;  3ZMD A;  3PFI A;  4EJT A;  1XDU A;  3T8R A;  4OIQ F;  4RGR A;  4MHG A;  5E20 A;  4FT8 A;  2OQR A;  4CYD A;  4ENN A;  3JTH A;  1G4D A;  3E97 A;  3SQN A;  1WSU A;  4O3M A;  2F5E A;  1SAX A;  2HQN A;  1XCB A;  3GX4 X;  3DFG A;  2A6H F;  1U5T C;  4HA8 A;  3IHU A;  5BS6 A;  1BC7 C;  1T98 A;  3ECH A;  3RKW A;  4KMU X;  2YR2 A;  1JHH A;  5K5R A;  3RJP A;  2P5K A;  2O0Y A;  4ENK A;  3HTU A;  3T1B A;  5E1X A;  3GWZ A;  1U5T B;  1STZ A;  4DNC A;  1S7A A;  1JGS A;  3MCZ A;  3N97 A;  4GXO A;  3IRR A;  4OMY A;  3PQK A;  2GQQ A;  3LA2 A;  4M9X A;  2ZNY A;  4KIF A;  5IT9 K;  1K78 B;  1ONV A;  4PDK A;  1YW7 A;  2JT1 A;  1TBX A;  1IN6 A;  4LG0 A;  4MGR A;  1YTY A;  1GVJ A;  3HHG A;  1ZHF A;  2H6B A;  1PUE E;  1MGT A;  4BYY A;  5E17 F;  2M8E A;  1KA8 A;  4Y17 A;  1RUN A;  4O5V A;  1VTN C;  2CFX A;  2W57 A;  1YQA A;  2PMH A;  2AXL A;  2DK8 A;  2PBI A;  5K5Q A;  4LD5 A;  2A07 F;  2RV8 A;  1FSH A;  4RB2 C;  3P9I A;  5LEJ A;  3WTS C;  1IZ1 A;  2KKO A;  2JPB A;  2XKP A;  5HLI A;  1R5G A;  2IPQ X;  4R1H A;  2O03 A;  3RYR A;  1W4M A;  4OOI A;  4I0B A;  1IW7 F;  3TOA A;  2M87 A;  3LQQ A;  2ADU A;  2HYG D;  3HHH A;  1Z6R A;  4ASN A;  4LLG F;  2X4H A;  1MDM A;  4HF2 A;  3TQN A;  4HX4 A;  3IKV A;  2RGV A;  3N4M A;  2EK5 A;  2F2E A;  1OR7 A;  4Q5S F;  2QVO A;  2A69 F;  1T39 A;  4O6J A;  1QPM A;  3I71 A;  4EQQ A;  1LVA A;  1IUY A;  3BDD A;  4NQW A;  3IRQ A;  2JPC A;  2XAQ A;  4IJA A;  1R7J A;  3CTA A;  2QYO A;  2OBP A;  2UZK A;  2A68 F;  3DKW A;  1Z05 A;  4XSZ F;  2CYY A;  1G3T A;  1IN7 A;  3NEU A;  4LJZ F;  1I1G A;  4M72 A;  5F1R A;  2D1H A;  3BY6 A;  4L5I A;  1FX7 A;  4Q48 A;  3TDZ C;  4KDP A;  3QU6 A;  1U6G A;  5D5U B;  4M6X A;  4LK0 F;  3FZV A;  1R1V A;  2FBH A;  2JSC A;  1PP8 F;  2ISY A;  2YX4 A;  3SZT A;  5FFX A;  1F1Z A;  2XGX A;  4BQA A;  2GXG A;  5DCM A;  1LNW A;  3IWZ A;  1W5S A;  5CVU A;  3KEQ A;  4PCQ A;  1J2X A;  4UVB A;  4S04 A;  1P6R A;  2HWV A;  1MDM B;  4BAY A;  4NHJ A;  4L0Z B;  2K4B A;  4MQ9 F;  3QOP A;  3JTG A;  5CYV A;  4LLL A;  3CUQ A;  3MZH A;  1O7L A;  2G7U A;  2OZ6 A;  1LDJ A;  1KYZ A;  1Z6T A;  2QWW A;  4YFK F;  1S3J A;  2HZT A;  5DCF A;  2X0L A;  2XUB A;  5HOO A;  3ERE D;  2P5L C;  3CLO A;  4L0Y B;  2GA1 A;  5E18 F;  2O61 A;  3V8K A;  5L3C A;  1W5T A;  1F4K A;  3K0L A;  5ILS A;  4Y13 A;  1SMT A;  4HZF A;  4HDV A;  4FX0 A;  4P5O A;  3EYI A;  2D45 A;  3DEU A;  5K5O A;  4N9I A;  1QGP A;  2IA2 A;  2CW0 F;  1HKQ A;  5ICC A;  4EJW A;  3RKX A;  2LF8 A;  4HOB A;  3R0A A;  1U2W A;  4XLN F;  3F21 A;  4EJO A;  4XSX F;  1DPU A;  4U7B A;  2MLG A;  4BNC A;  5AIQ A;  2B0L A;  2ZME B;  2ZCW A;  3ABT A;  3KP3 A;  3OOP A;  1T38 A;  2XAG A;  3HOS A;  4RGS A;  4EV0 A;  1FNN A;  2LF7 A;  1SFX A;  3E6B A;  2YX7 A;  2TDX A;  1BI2 A;  3BJA A;  4UVA A;  2F5D A;  1J59 A;  2VN2 A;  3JAM K;  1FP1 D;  2HTJ A;  3MZY A;  3DQV C;  2GAU A;  4L5J A;  3FXU A;  4NB5 A;  5BMZ A;  2R3S A;  1RI7 A;  4IRH A;  2UXX A;  4LGW A;  2RN7 A;  3HRT A;  3TO9 A;  3EUH A;  1DP7 P;  4OMZ A;  2ZFW A;  2KJC A;  2P8T A;  1SD5 A;  2E7X A;  3C3W A;  4RGU A;  3ELK A;  2P6S A;  1FOK A;  3WGG A;  5ILV A;  5DDG A;  3IKT A;  4KNY A;  2ZO4 A;  3MWM A;  1MD0 A;  3I59 A;  4M74 A;  5FD6 A;  4M9S A;  3F8C A;  2FE3 A;  5A2Q Z;  1DUX C;  5CVI A;  4B09 A;  1RIO H;  3WGH A;  3O2P E;  1O3Q A;  1BI0 A;  4G7H F;  2O6G E;  2OQG A;  2HQR A;  1FC3 A;  5CLS A;  1U8R A;  1BI1 A;  1HW1 A;  4AVP A;  3B02 A;  3VOD A;  3ZP5 A;  5KVR A;  5D6E A;  2STW A;  1S8N A;  5F64 A;  1IRG A;  1HQC A;  3WGI A;  1O3T A;  3U9G A;  3V8L A;  1QNT A;  4JK1 X;  3WTT C;  1BM9 A;  3GYH X;  1SMY F;  4D0P A;  2G9W A;  3L9F A;  3V7C A;  2GA2 A;  3CDH A;  2PJP A;  3SXY A;  1HKT A;  4HLX A;  3AAF A;  4PGH A;  2K27 A;  2RQP A;  4HDU A;  4BHC A;  2FBK A;  3T5X A;  4BHB A;  2HS5 A;  2A6E F;  3QPH A;  4HYE A;  5D8L B;  3DF8 A;  1S6L A;  2WC2 A;  2EFW A;  1EH7 A;  1XMA A;  1CF7 A;  1BOA A;  2HR3 A;  5F6F A;  3FMS A;  1TTY A;  3IL2 A;  2UWM A;  3TO6 A;  2VBW A;  2JRT A;  4IF4 A;  3KP4 A;  5JI6 A;  2EA4 A;  3QP6 A;  1BIA A;  3VFZ A;  2XVC A;  3FMR A;  1UB9 A;  1L3L A;  4G94 A;  3ZPL A;  3V8J A;  2GZW A;  3K69 A;  1GHC A;  1OYW A;  4ZYH A;  1SFE A;  4ZZD A;  4CO8 A;  2ZKZ A;  5FLX Z;  1O3S A;  2IA0 A;  2VT3 A;  2KRF A;  1TQP A;  3KP6 A;  1OKR A;  2P4W A;  3R60 A;  4UHT A;  1DPR A;  4R79 A;  1FBS A;  1RUO A;  1UHM A;  3WTY C;  1B9N A;  2Q0O A;  3E3V A;  1FZP B;  2ISZ A;  5J6X A;  2FU4 A;  2DU9 A;  3WTV C;  3F8N A;  4G7O F;  4EJV A;  5ICG A;  2NRA C;  2K02 A;  2MLK A;  3GEZ A;  2D2W A;  2ETH A;  3Q9S A;  4RS8 A;  5HLG A;  3G73 A;  5HS7 A;  3F72 A;  3HSR A;  2DK5 A;  4ZYE A;  3CJN A;  2COM A;  4HBL A;  4ESJ A;  2Z99 A;  4N9H A;  4UV8 A;  3K9T A;  2EFO A;  4IXA A;  1TW2 A;  1U3E M;  2QLZ A;  1E2X A;  3G3Z A;  1Z91 A;  2KIF A;  2FRH A;  1IXR C;  3EQL F;  2UXN A;  4KN4 X;  3ULQ B;  3IC7 A;  4HV6 A;  4RGX A;  5EEH A;  4HF0 A;  4HQM A;  2XV4 S;  3HRM A;  1CF7 B;  2XKO A;  3ZMV A;  4P96 A;  1P4X A;  4L9V A;  2DAO A;  1G6N A;  2J5P A;  2XHK A;  3JSP A;  4I09 A;  1J7K A;  3WE2 A;  3E6C C;  5DUK A;  1O3R A;  2K86 A;  1RZ4 A;  1HW5 A;  1J75 A;  3VEP A;  3M9A A;  2QEN A;  2IVM A;  1AOY A;  3F6V A;  1OMI A;  3CUO A;  3VB2 A;  1JXS A;  2W24 A;  3WE3 A;  2HDC A;  2BE5 F;  4RB3 C;  4KA4 A;  3NRV A;  4AWX B;  2XAJ A;  1K79 A;  3ROU A;  1V4R A;  3KFW X;  4A5N A;  4HX8 A;  1UCR A;  1SD6 A;  2EA2 A;  3FXQ A;  1SD7 A;  4YFX F;  4RAZ A;  4Y15 A;  1KU7 A;  4XRF A;  3BJO A;  3KZY A;  4A2U A;  2BYV E;  4M71 A;  3P9K A;  4IRG A;  1FY7 A;  4UVC A;  2KIM A;  2P7C B;  1KQ0 A;  1ZRE A;  6PAX A;  5IT3 A;  4EGZ A;  1J9I A;  2Z5U A;  1HKS A;  1OPC A;  2VE8 A;  3HSE A;  1R00 A;  2BEO A;  1FYM A;  2RDP A;  2NNY A;  4BHP A;  3QPT A;  5TJJ A;  3WOD F;  3F8M A;  3TKY A;  4FHT A;  4S05 A;  3BRO A;  3ML6 A;  5HDK A;  2XRO A;  1KU3 A;  4EM2 A;  3W6J B;  4GYI A;  2EB7 A;  4IPA A;  1IXC A;  4N0B A;  5DD8 A;  1KU9 A;  4M9Z A;  2FNA A;  2RNJ A;  3K1N A;  4XLP F;  1B6A A;  3GUD A;  1HST A;  4CHU A;  1T0F A;  3MQ0 A;  4G8X A;  1GXQ A;  4A0X A;  2V79 A;  3I64 A;  3H92 A;  2L02 A;  4P9U A;  4LG0 B;  5D5W B;  1H9T A;  5HS8 A;  3J80 Z;  3BPX A;  3JW4 A;  3J81 K;  5LEK A;  1D8J A;  2DW4 A;  4OIN F;  4IHS A;  2HGC A;  4KIC A;  1A04 A;  1TNT A;  2PEX A;  1IXS B;  1I5Z A;  2CGP A;  3U2R A;  5L3D A;  3KZZ A;  4WXC A;  3Q5F A;  4QLC U;  3HOT A;  1LQ1 A;  3RYP A;  5BPD A;  3BPV A;  1MJA A;  2QZ8 A;  1FPQ A;  4P55 A;  4GO1 A;  4EM0 B;  3WTW C;  2DPD A;  3LQR A;  5CVR A;  1OYI A;  5H20 A;  4ZYG A;  3R4K A;  4L9J A;  5BPI A;  5D6F A;  4G9Y A;  1MJB A;  1ODD A;  1T2K A;  2V1X A;  1FYL A;  3F22 A;  3QAH A;  1W7P D;  2MA3 A;  2ZNZ A;  1YYV A;  4MNU A;  2IA1 A;  4AIK A;  4KMF A;  3R6S A;  1S29 A;  1ZG5 A;  3DXJ F;  1LB2 A;  1FWZ A;  2QQB A;  3R0J A;  2DFI A;  3Q9V A;  4ETS A;  1YS6 A;  2JTV A;  1XD7 A;  4G6D A;  2QQA A;  2M5W A;  3KP2 A;  3I58 A;  4XBF A;  3GFM A;  2XRN A;  5L3B A;  2Z33 A;  3HSF A;  3QP5 A;  1XMK A;  5DV5 A;  1P4W A;  5LHG A;  2Q2E A;  2KJB A;  1XGS A;  5EEG A;  5LHH A;  3MEX A;  2P5V A;  4M6Y A;  5D5X B;  4MTE A;  2NYX A;  4ESF A;  2BV6 A;  2EV6 A;  3FM5 A;  3O3K A;  5LGN A;  5IT9 Z;  2D1V A;  2IT0 A;  4Q47 A;  1CGP A;  3KEO A;  1FSE A;  4U7D A;  2NS0 A;  3E5U A;  4DQ2 A;  3ZQ7 A;  3ZN1 A;  2NNN A;  3K1P A;  4OU0 A;  2WWY A;  1G3Y A;  3RTR A;  3GXO A;  1O57 A;  2L01 A;  1B4A A;  3LA7 A;  4YFN F;  1GXP A;  1OYY A;  3WU0 A;  2ZJ2 A;  3OV8 A;  4I0A A;  5DCM B;  1ZAO A;  3LFK A;  1BN5 A;  3CUQ C;  2QBY A;  1ZRD A;  1YW9 A;  4AIJ A;  2MC3 A;  3EDP A;  4L9N A;  3BOQ A;  2FBI A;  2AS5 F;  1FYK A;  1XGN A;  1ZGA A;  3ZMZ A;  2FOK A;  2PLY A;  3BJ6 A;  4CIC A;  1TNS A;  2W25 A;  1ZYR F;  4G6Q A;  3CUQ B;  2J5O A;  2K4J A;  3TOB A;  5HLH A;  4I98 B;  1I6X A;  1KU2 A;  3D5L A;  3LA3 A;  2Y0M A;  2H09 A;  1IRF A;  5CJ9 A;  4QWQ A;  4EM1 A;  2W84 A;  2H94 A;  3QU3 A;  2STT A;  4WF2 A;  3RDI A;  5LBQ A;  3P7N A;  3WU1 B;  2PI0 A;  4I2O A;  1FLI A;  4I02 A;  5HDN A;  2W85 A;  1KGS A;  1J5Y A;  2RKH A;  3O6B B;  2OU2 A;  3GO5 A;  1BC8 C;  3GZ5 A;  2O8X A;  4EGY A;  4ON0 A;  5FFZ A;  1O7F A;  4EVI A;  1P92 A;  4M73 A;  3D0S A;  2FXA A;  3ZMU A;  1UST A;  1KQ8 A;  3H3U A;  3L09 A;  2E1C A;  2MH9 A;  3B73 A;  2H6C A;  4WK8 F;  3W6K B;  1XN7 A;  2EJR A;  4HAM A;  2OAZ A;  4UXN A;  2YPR A;  3I4P A;  5LGU A;  3ZMS A;  2O3F A;  5TRD A;  4EMS A; 
#chains in the Genus database with same CATH topology
 3IWF A;  2ME6 A;  1FOW A;  1FP2 A;  4FTH A;  1Z9C A;  2DLL A;  1DDN A;  2YU3 A;  1JHF A;  4YII A;  1V55 H;  3GW2 A;  3H0G J;  2VLA A;  2EWN A;  4F52 A;  2W1O A;  3BTJ A;  4UUV A;  2P7V B;  5LGT A;  1ULY A;  1U5T A;  1IJW C;  1R1T A;  5D4R A;  4UY8 I;  3WTU C;  4RM3 A;  2DTR A;  3AG3 H;  1ENH A;  1B72 B;  3S1M J;  1P7I A;  1SD4 A;  3JCU C;  2MD5 A;  5E8G A;  2R7O A;  2HTS A;  5BNG A;  3HRS A;  4A12 A;  2JZY A;  4OIP F;  2M3A A;  5DM6 F;  5B3S H;  2ACJ A;  1UMQ A;  5HS9 A;  4KUM A;  4AUX A;  3H5N A;  1ETY A;  2RAE A;  2Q8K A;  3REO A;  1AWC A;  2LKP A;  3I59 B;  1K83 J;  1X2M A;  2VOO A;  1J09 A;  1WHU A;  2N8G A;  3OYM A;  2L4M A;  4ZYD A;  1LDD A;  4AID A;  2CQQ A;  4R8H A;  2MC4 A;  3DLA A;  1PDN C;  1JI8 A;  4D5C A;  3KEY A;  4J19 A;  1Q1H A;  1WRJ A;  4IOA F;  2QEX I;  3SFZ A;  1WCM J;  3LSK A;  5EZH A;  5J1Y A;  1N25 A;  1P4A A;  3LFU A;  4A3G J;  1LEA A;  2DI3 A;  2WTE A;  3OYN A;  1OCC H;  2L7K A;  1ON2 A;  4II3 A;  1I6H J;  1XB4 A;  3MN2 A;  1BR2 A;  3DV8 A;  5F04 A;  2OV7 A;  3LST A;  1FOX A;  2CW7 A;  1K6O A;  2ECB A;  2F5C A;  2H27 A;  4KT5 C;  4JBA A;  4H0E A;  1YO5 C;  4OIR F;  3ISP A;  2VC0 A;  3FF5 A;  4ZJZ A;  1X1P A;  3M07 A;  2PG4 A;  1UG0 A;  2XIG A;  4XRS A;  1EH8 A;  3KET A;  2R7D A;  1IRZ A;  5H2F C;  2R4G A;  3DTI A;  4XQF A;  4BXU A;  3HOZ J;  3LAP A;  1XPX A;  2LNB A;  2IXS A;  5D8K B;  2HPI A;  5IY5 H;  3C2G A;  2CQN A;  1YFH A;  1G3S A;  1YIO A;  3TMO A;  4YG2 F;  2H8W A;  4HW0 A;  1XSV A;  3E6M A;  4I7H A;  1SC7 A;  3L7W A;  4PUS A;  4Y7N J;  5IYB J;  2GXB A;  1WWX A;  1B8I B;  3H1C A;  4CYC A;  2QF7 A;  3OYK A;  2DMN A;  3HTS B;  4TV7 A;  1UG2 A;  3HC7 A;  2VXZ A;  2EFQ A;  2FMY A;  4UUT A;  2XC7 A;  2TRT A;  2YSR A;  2Y0S A;  3RZO J;  3FWE A;  1R4N B;  2PQ8 A;  4HLY A;  2LK2 A;  3BZ6 A;  2RVC A;  4WXH A;  2CUF A;  1TT5 B;  3EYY A;  4KT6 A;  1W7P A;  4ZTF A;  4RM2 A;  5CQG A;  4A6E A;  1P7J A;  3E5Q A;  4XKV A;  1M1E B;  1ZGJ A;  3S2D J;  4MQV A;  4A5M A;  2DDB A;  3CDL A;  5IYC J;  2HOE A;  1C0W A;  3RIR A;  2QUF A;  3OSG A;  2DMQ A;  3BP8 A;  2FA5 A;  2IJL A;  5EG0 A;  3DTK A;  3BTC A;  2NVQ J;  2M7A A;  1T6S A;  3K70 D;  1QZY A;  3F6O A;  4E7H A;  2LDU A;  2VE9 A;  9ANT A;  2LBF A;  1HCR A;  2Q1Z B;  1Z3X A;  1XC5 A;  1R22 A;  3TDU C;  2L4A A;  3MAJ A;  2HDD A;  2EFP A;  4U0W A;  5L3G A;  2GWR A;  2IBD A;  2XAF A;  3OOU A;  4P1W A;  4WCG A;  1YRN A;  1UHW A;  5GAH J;  1TW3 A;  3OR2 C;  4GGG A;  1JUM A;  4HF1 A;  5B66 C;  2F5F A;  5HVQ C;  1SFU A;  4A3L J;  5DTD A;  4GCV A;  3C7J A;  3EUA A;  2IRF G;  3M8E A;  2R7Q A;  4A6D A;  5FRM A;  2A3S A;  1H89 C;  3K1M A;  2NVX J;  4M3D A;  1BI3 A;  2E71 A;  2KLO A;  3JAM Z;  3OYD A;  1H88 C;  3I9V 2;  2KIU A;  2XAH A;  2EIJ H;  3WHB A;  3GFJ A;  5E1Z B;  3DPL C;  1HDP A;  1G3W A;  1IN4 A;  4WXD A;  1XGM A;  2RNG A;  3M8F A;  1TQI A;  5GAE J;  3VDX A;  3I54 A;  3A02 A;  3V7S A;  1Z7U A;  1NK3 P;  1ACI A;  4RLF A;  3KLN A;  2L3D A;  3QOD A;  3ZGK A;  3MVP A;  3J7A Y;  1U78 A;  4HX7 A;  5JVT A;  3A01 B;  2BY0 A;  2DFH A;  5CVJ A;  3SFI A;  4CCO A;  3G71 I;  2WY7 Q;  4MEY F;  2AXT C;  4KIG A;  5JLW A;  2E7W A;  4KIB A;  1K7A A;  2W82 A;  2HXO A;  1X1A A;  5K1Y A;  5EGO B;  2A5W A;  2DQR A;  3FM3 A;  2JA8 J;  1S7E A;  2FEZ A;  3FKI J;  3TW6 A;  3CES A;  2GIV A;  3BG5 A;  2JWT A;  5J8C A;  3GFI A;  1WGX A;  2EZH A;  3PQJ A;  4RB0 A;  4UUS B;  4MEX F;  1Y0U A;  3HYI A;  3HJE A;  3L00 A;  4LK1 F;  1ZAR A;  4LIT A;  3CJQ B;  2CH0 A;  5LLQ A;  4UNO A;  1QHG A;  1SEU A;  4CYC B;  4A0Y A;  2X1C A;  4PZJ A;  4L9T A;  2D5V A;  3ZXS A;  1E3H A;  3I56 I;  5J40 A;  3CCM I;  1R36 A;  2EV5 A;  3M7G A;  2Y9Z A;  2M7B A;  3F23 A;  1BJZ A;  1MIJ A;  5A2Q K;  4CXF A;  5AON A;  2CU7 A;  3ECO A;  1WJF A;  1LFB A;  2QQ8 A;  1UFM A;  5LRS A;  3VPR A;  3F8F A;  1W7P B;  2V6C A;  3KE2 A;  5E1W A;  2R7X A;  2MAB A;  3FBI B;  1ZRC A;  1REP C;  2DCE A;  3DU6 A;  2ESN A;  1R5H A;  1AKH A;  4Z2Y A;  4F91 B;  4E7L A;  3HUG A;  2QKL B;  5C4J J;  2P6T A;  3KCC A;  5EG0 B;  4UV9 A;  1IRX A;  2CQK A;  5JVG F;  3GZN B;  2XAS A;  3OS2 A;  2V4J C;  4YRV A;  2DA5 A;  3WG9 A;  1ZN2 A;  4M6V A;  4K2E A;  2BY1 A;  4P9F A;  4C9Y A;  4HNU A;  1R6R A;  4PJ0 C;  4AIH A;  4C3H J;  5FB2 A;  1DU6 A;  1G2H A;  4EJU A;  3ZQG A;  5AIP A;  3IAS 2;  5J47 A;  3NWT A;  3PUF A;  3U1D A;  2Y48 A;  3EET A;  3FHZ A;  5M3M J;  2FQ3 A;  4E70 A;  2KZV A;  4A0Z A;  2R7F A;  5DEQ A;  2E2I J;  5D5V B;  2Z3Y A;  4IVN A;  1X4O A;  3F3X A;  1HSJ A;  1TQM A;  2WAF A;  2OCE A;  2DT7 B;  1Z21 A;  3GFL A;  1OLT A;  4KYW A;  1ZLJ A;  2HVQ A;  3FXR A;  4F3Q A;  4HNV A;  3O8G A;  2ZJP F;  1S9H A;  4ANJ A;  3VOE A;  1GLN A;  3C2B A;  1L0O C;  4LB6 B;  2V9V A;  1GV5 A;  1IO2 A;  5JHU A;  1WI9 A;  1R71 A;  3F8B A;  3BR2 A;  1N77 A;  4DOZ A;  1F5T A;  3S1Q J;  2DMP A;  3FHN A;  2LSO A;  4ZDL A;  1DGR M;  5KK1 A;  4G7Z F;  3ZQL A;  4EAT A;  2NAZ A;  3RPU A;  4KFC A;  3OWT A;  4QIW N;  4Y33 A;  3S8P A;  4B8X A;  1S7O A;  1YLF A;  2IW5 A;  4ZH4 F;  1NG7 A;  2R5Z A;  1YS7 A;  4HQE A;  3PIP F;  1WJA A;  1RNL A;  1TZL A;  1X3U A;  1HBX G;  2M30 A;  3E5X A;  3QRF F;  1IGN A;  2VT2 A;  1LDK B;  1WKM A;  3PNT A;  4CH7 A;  3J7Z I;  1ITY A;  1D0Y A;  1MBJ A;  3CLQ A;  2IGN A;  3ABM H;  3I5U A;  3LAJ A;  3OL4 A;  4KN7 X;  3QYB A;  4OAY A;  1IN8 A;  2OA4 A;  3TL4 X;  5DD4 A;  5D4S A;  2LTP A;  2M1B A;  2ZME A;  2MBF A;  3QPS A;  2M45 A;  1T0F C;  1IF1 A;  2HKO A;  2ICW G;  3Q0W A;  2X1D A;  4E7K A;  3OYG A;  3ZN0 A;  2WAD A;  2CV2 A;  2VB6 A;  3DU5 A;  1XS9 A;  2DPU A;  2X6W A;  2AQE A;  1IN5 A;  5FLX K;  4QPO A;  5CVV A;  1SAU A;  3OYI A;  4BL0 B;  2PFB A;  4E7J A;  3PIO F;  2VOP A;  3R61 A;  2F4O B;  5GPA A;  4XLF A;  3TP0 A;  3E6D A;  5EEA A;  1R58 A;  3JSO A;  1I27 A;  2F4M B;  1OJL A;  2Z9O A;  1GUU A;  3U1K A;  2HQ5 A;  5FGM A;  3LSI A;  3T8T A;  1ZR4 A;  3BWG A;  1TWH J;  3PO2 J;  2L9N A;  4IHT A;  3BCA A;  4WWC A;  1WJC A;  2EQR A;  1V3F A;  2WAE A;  4L18 B;  2G7H A;  4JQF A;  1E17 A;  2MH2 A;  2VKD A;  1UAA A;  1MH3 A;  2ZBK A;  3H3Z A;  3EPZ A;  4BXX J;  3BR6 A;  1EV7 A;  3CCE I;  4U88 A;  4XKC A;  5ERI A;  2WV0 A;  5ED4 A;  4I01 A;  3TO7 A;  2HEO A;  1K61 A;  3RKY A;  2WV1 A;  4I76 A;  2E1N A;  2EPF A;  5H6Q A;  1LE8 B;  3DBH B;  1MJ9 A;  5HDG A;  4CUG A;  3RI4 A;  3S2W A;  5J4V A;  1QBJ A;  2NS7 A;  1IAW A;  2L7M P;  4ENJ A;  1VFC A;  2E36 A;  1WQ2 A;  2K9N A;  1DU0 A;  1YIJ I;  3TW7 A;  1HW2 A;  3J7Y J;  2L9V A;  3HKZ N;  2DBB A;  4AM3 A;  4N4O B;  2V1U A;  4YIF A;  4X0G A;  1MBK A;  3LWF A;  1FBU A;  3NQO A;  1AU7 A;  3W3C A;  3IH3 A;  3OIO A;  4ZZL A;  1Y1V J;  5E79 C;  3CCU I;  1JT6 A;  3I0T A;  4F7Z A;  1HF0 A;  3FDY A;  2OD5 A;  2DT5 A;  1BBY A;  2JN6 A;  4ENM A;  2FNP A;  5FD5 A;  3DPT A;  1YG2 A;  1ON1 A;  1QZZ A;  3COA C;  1W36 D;  3ABU A;  2R5Z B;  1JKR C;  1ZG3 A;  5KAI C;  1ZRF A;  2IP2 A;  2L54 A;  4D9J A;  3DP7 A;  4AU7 A;  3J7A O;  4U0Y A;  2EIL H;  2HYF A;  1H9G A;  2CG4 A;  2IS6 A;  2XF5 A;  2FML A;  2NVU B;  1WZ2 A;  3KP5 A;  1P2F A;  4Q4Z F;  2LC2 A;  3PSI A;  5LD2 C;  2GM4 A;  2VQG A;  2K7L A;  2FF4 A;  3V4G A;  1BJA A;  1U9N A;  1BIB A;  3MFK A;  2O7O A;  1MZB A;  4CGZ A;  2DA1 A;  2IGK A;  3L2Q A;  1R1U A;  4LLN A;  2L5Q A;  5KAF C;  5FO5 A;  5L3E A;  1USS A;  4HST A;  1A35 A;  2ZJQ F;  3KYL A;  3LSP A;  5DYM A;  5E3M A;  1APL C;  5ICE A;  5IPA A;  4AD9 A;  5C44 J;  2PN6 A;  2FX0 A;  1J0R A;  2X51 A;  2BY3 A;  3M3Y J;  5GAG J;  4U0V A;  3OYB A;  2ZSI B;  3GVA A;  2X6Y A;  4B47 A;  2H1K A;  1FT9 A;  3KYC B;  4BQO A;  3RPQ A;  2CO5 A;  3G2B A;  3W2W A;  1JT0 A;  1Y6I A;  2ESH A;  3AG1 H;  3CF2 A;  4RB1 A;  4BE0 A;  3QYF A;  1XCV A;  2LY1 A;  1XDS A;  1QO0 D;  3C1D A;  4CZZ A;  3GLX A;  1TWC J;  4WX9 A;  4DBR A;  2XB0 X;  1ZH5 A;  1I50 J;  1KON A;  2ZJR F;  2ELK A;  2M8G X;  3CO7 C;  2LRD A;  3GZ6 A;  3RQ4 A;  2HKX A;  3L2W A;  3I3L A;  4OIO F;  2DTZ A;  2KP6 A;  2MFZ A;  3VYR B;  4MTD A;  3I4N J;  2ZXJ A;  2Z1D A;  4IRI A;  1XSD A;  2CWE A;  3ABL H;  5E3N A;  2Q2E B;  1IUF A;  1FJL A;  1YW8 A;  2QQ9 A;  2FD5 A;  4QPQ A;  5BQT A;  5J8F A;  3S3N A;  3CO6 C;  4PFO A;  4AYB N;  1DGW Y;  4XM3 A;  4HV5 A;  2HZD A;  3SHF A;  5E8I A;  1JE8 A;  3VYU B;  2OZU A;  4B4C A;  4DW6 A;  4EEF G;  4IQ4 A;  2DQL A;  2ELH A;  5KNL A;  4A3E J;  1YE9 A;  3ZQQ A;  1LPQ A;  1Z67 A;  2PMU A;  2V1D A;  4PGG A;  2E2J J;  2KL4 A;  3L2C A;  1MKM A;  3TBI A;  4FX4 A;  2XGE A;  4BH9 A;  2DYS H;  3V7R A;  3CZ6 A;  1NK2 P;  4M3B A;  4IZZ A;  1LKX A;  2HFH A;  4BAC A;  3GME A;  1D3Y A;  1EH6 A;  4BEH A;  3JRG A;  3CCY A;  3S1N J;  3WTX C;  4ZTJ A;  3RPU D;  3KP7 A;  3A0H C;  2EFN A;  3I53 A;  3AFH A;  2JVG A;  4BE2 A;  1DP3 A;  1ZR2 A;  2L7Z A;  1W1W E;  1D8K A;  1ZEL A;  4AC0 A;  3P9C A;  3PSF A;  1YJN I;  3GTL J;  3MKL A;  3HRU A;  1KQ9 A;  5FKN A;  5LRR A;  4ESB A;  3OYA A;  4LMY A;  3K2Z A;  2BBY A;  4CDG A;  3JRC A;  1B59 A;  2DO7 A;  3J81 Z;  4RAY A;  1PP7 U;  3B6C A;  5JFR A;  5ICF A;  1Z1D A;  4GFB A;  2KMU A;  2LLK A;  1LJ9 A;  3K70 C;  2C6Y A;  4LIV A;  2CQX A;  1R23 A;  3C18 A;  1EJ9 A;  2IGO A;  2DOE A;  5LHI A;  2VC1 A;  3DWL E;  2WB1 N;  4GYG A;  3CMY A;  1D5V A;  5H6R A;  2A61 A;  1QPI A;  3CJT B;  2CSO A;  1A6I A;  3ZQF A;  1HXD A;  5KCM A;  3TGN A;  2QBY B;  4A93 J;  1FBQ A;  1F9N A;  3J80 K;  2Y75 A;  5ILU A;  5IP9 J;  1FMV A;  2GOM A;  5IOZ A;  3LSJ A;  1TLH B;  5JR3 A;  3GTJ J;  1W0U A;  3FXO A;  2A5Y B;  3GF2 A;  1B1B A;  2RC4 A;  3ZCO A;  3WTZ A;  1ZQ3 P;  4OWR B;  2KDZ A;  1E3P A;  1QQI A;  2ID3 A;  2V9K A;  3FBN B;  1K78 A;  5GP9 A;  5BOX A;  3KLO A;  2GLO A;  1H0M A;  4E7I A;  1ZLK A;  2FSW A;  3T0Y A;  1I1S A;  2LYC A;  3JRA A;  4CA0 A;  3IP4 B;  3SZP A;  3FMQ A;  2VKV A;  2F48 A;  2EV0 A;  3WHC A;  4BBS J;  4A3J J;  1B9M A;  4J01 A;  1S5L C;  1BOB A;  4F93 B;  1FOY A;  2ZFU A;  5DUI A;  3HIF A;  1NHA A;  1ERD A;  1ZG1 A;  3QYE A;  3GTP J;  4C30 A;  3M1E A;  1XSX A;  4X1E A;  1XGO A;  2VON A;  2FOW A;  1MSE C;  5CKT A;  4IHW A;  2BGC A;  4PJJ A;  5L3F A;  4LB5 A;  3SDB A;  2JVH A;  2E19 A;  1T56 A;  3W6V A;  1LEB A;  4YEL A;  2KZG A;  1KYW A;  3FX3 A;  2VBX A;  2XGC A;  3ABK H;  3BG6 A;  2VBY A;  3M4O J;  3ZMT A;  2VOD A;  4LFU A;  2VBZ A;  2QM3 A;  3GLL A;  3C2H A;  3OIP A;  3PFI A;  5TIS C;  3ZMD A;  3DPU A;  4EJT A;  1XDU A;  3T8R A;  4OIQ F;  3OY9 A;  1HC8 A;  4IEJ A;  4RGR A;  1MBE A;  4HEA 2;  4MHG A;  4JX4 A;  5E20 A;  3RQI A;  4IKF A;  1JTY A;  4FT8 A;  2OQR A;  4CYD A;  1QU3 A;  4ENN A;  3JTH A;  1X3Z B;  1G4D A;  4BY7 J;  1YX5 A;  2XDV A;  3AG2 H;  3MKW B;  3B6A A;  3E97 A;  2M2E A;  3SQN A;  1WSU A;  4O3M A;  2F5E A;  1SAX A;  1WJE A;  2HQN A;  4FAS D;  2VJ5 A;  1XCB A;  3GX4 X;  4X6A J;  3ZQC A;  3A03 A;  2YU9 J;  5F27 A;  2QGU A;  3DFG A;  4JOM A;  4ZDP A;  1UZC A;  2A6H F;  1U5T C;  1NG6 A;  4HA8 A;  2JA2 A;  3KIO A;  3IHU A;  1MMD A;  4CCN A;  1HOM A;  3WG7 H;  3A4C A;  5BS6 A;  4YEJ A;  2WAQ A;  1BC7 C;  3CCJ I;  3KX2 A;  1T98 A;  4PSX A;  5LFA A;  3ECH A;  2RRE A;  3RKW A;  1ZK8 A;  1ETQ A;  4KMU X;  2YR2 A;  5EF6 A;  1JHH A;  5E3O A;  5K5R A;  3K4L A;  3RJP A;  2P5K A;  3OL3 A;  2O0Y A;  4ENK A;  3HTU A;  3SZG A;  2WY8 Q;  2MGQ A;  1LUJ B;  3T1B A;  1Y0N A;  5E1X A;  2DOD A;  3GWZ A;  3CCR I;  1U5T B;  3HL2 A;  1RC9 A;  2OTJ I;  1STZ A;  2KPM A;  4DNC A;  1YI2 I;  2R7V A;  1S7A A;  1JGS A;  3MCZ A;  3N97 A;  4GXO A;  3IRR A;  4OMY A;  3PQK A;  4MIM A;  2GQQ A;  3LA2 A;  4M9X A;  2ZNY A;  4KIF A;  5IT9 K;  3Q0V A;  1K78 B;  3IV5 A;  1ONV A;  2BHZ A;  2MSY A;  2X6X A;  2CFO A;  3BTL A;  4PDK A;  1YW7 A;  4DYQ A;  1JKO C;  2GOX B;  3G1O A;  4F55 A;  5EJC A;  1G59 A;  2JT1 A;  1TBX A;  1JGG A;  1IN6 A;  2ZXH A;  4LG0 A;  1QRY A;  4MGR A;  1OCO H;  2KIS A;  1YTY A;  1GVJ A;  3HHG A;  1ZHF A;  2H6B A;  1PUE E;  1MGT A;  3VWB A;  4BYY A;  5E17 F;  5IYD J;  3DEW A;  2M8E A;  4A69 C;  5GTI C;  3K7A J;  2HVR A;  2NXN B;  1N75 A;  4JX5 A;  1KA8 A;  2VL8 A;  4Y17 A;  5EZG A;  4A3I J;  1K4T A;  4IHY A;  1RUN A;  1MMS A;  4L5E A;  4O5V A;  5GPC A;  2CJJ A;  1MMA A;  2HNH A;  1VTN C;  2CFX A;  5M5W J;  4I6Z A;  4C2T A;  3S32 A;  2OUM A;  2OC6 A;  2IGM A;  2W57 A;  2X48 A;  1YQA A;  2PMH A;  2AXL A;  1BA5 A;  4C2U A;  2DK8 A;  5GTH C;  2ME0 A;  2A05 A;  2K40 A;  3JRH A;  2FJ1 A;  2PBI A;  5K5Q A;  4BS9 A;  4LD5 A;  2A07 F;  2XSJ C;  3G4S I;  2RV8 A;  1FSH A;  3OYH A;  3RKQ A;  4RB2 C;  4ITV A;  4BUP A;  4BKX A;  3P9I A;  5LEJ A;  3WTS C;  2YUS A;  1X4P A;  2V6E A;  1T33 A;  1IZ1 A;  2V9P A;  2ZB9 A;  3HEF A;  3HGG A;  2KKO A;  3JRB A;  2JPB A;  2XKP A;  3S16 J;  5HLI A;  1R5G A;  2X1E A;  2IPQ X;  4R1H A;  3G6E I;  4CZC A;  4MLO A;  2O03 A;  2I10 A;  3RYR A;  1XX5 A;  1UHS A;  1W4M A;  4OOI A;  4I0B A;  1IW7 F;  2K85 A;  2O8K A;  3TOA A;  2M87 A;  3LQQ A;  2ADU A;  2HYG D;  2KIQ A;  1KZH A;  3HHH A;  1Z6R A;  4ASN A;  4LLG F;  2X4H A;  1MDM A;  4HF2 A;  3DLL F;  2I5U A;  3Q0U A;  2IS2 A;  3TQN A;  4HX4 A;  1WH7 A;  3IKV A;  3NAR A;  2RGV A;  3N4M A;  4MO7 A;  1Z7L A;  4M3F A;  4BE1 A;  1MSF C;  2EK5 A;  2F2E A;  3K4K A;  1VQ5 I;  1X2N A;  1I39 A;  2FUG 2;  1OR7 A;  4Q5S F;  3CME I;  2QVO A;  2LBF B;  2TCT A;  2A69 F;  5IP6 A;  1T39 A;  2BY2 A;  1MBH A;  2VAS A;  4O6J A;  1YRN B;  5C4X J;  4A3K J;  2GIZ A;  1SVL A;  2VKE A;  4BDY A;  1QPM A;  2X9D A;  3X2Q H;  1NH3 A;  3CCL I;  4BDZ A;  3K10 A;  3I71 A;  1WJD A;  2HDW A;  4EQQ A;  2CV1 A;  1LVA A;  2DMU A;  4MFE A;  1IUY A;  3BDD A;  4NQW A;  3IRQ A;  2LKS A;  2JPC A;  2W48 A;  3KPH A;  2XAQ A;  3FXL A;  5FKL A;  1R9T J;  4XOT A;  4IQJ A;  4IJA A;  4UB6 C;  1R7J A;  3CTA A;  2QYO A;  2OBP A;  2GBY A;  3BG9 A;  2UZK A;  2A68 F;  2ZC2 A;  4LIU A;  4IHV A;  3BR3 A;  3DKW A;  3CCQ I;  1Z05 A;  4XSZ F;  2CYY A;  2V1N A;  2DA3 A;  4XN3 A;  3VSL A;  3W2V A;  1G3T A;  4JYK A;  2M9H A;  1IN7 A;  3NEU A;  4LJZ F;  1IG7 A;  4CCM A;  1I1G A;  4M72 A;  2H1L A;  5F1R A;  2D1H A;  2Y69 H;  3BY6 A;  3MD2 A;  2WBM A;  2Y0S N;  3A0B C;  2JMW A;  3PM1 A;  4L5I A;  1FX7 A;  4HNT A;  4U87 A;  1ORK A;  2G0E A;  4Q48 A;  2LOO A;  2EIN H;  3TDZ C;  2HU9 A;  3IH2 A;  2LFB A;  3H0D A;  1Q1V A;  2K9M A;  4KDP A;  1RR7 A;  3QU6 A;  1A31 A;  1U6G A;  2VUM J;  5D5U B;  4M6X A;  2FQ4 A;  4LK0 F;  3FZV A;  1R1V A;  2FBH A;  2JSC A;  3OYC A;  4HSR A;  1PP8 F;  3D1N I;  2ISY A;  2NOJ B;  1SFK A;  2HYJ A;  1IC8 A;  2YX4 A;  3SZT A;  5FFX A;  1F1Z A;  2XGX A;  4NC6 A;  4H4K C;  4BQA A;  2GXG A;  2EZI A;  5DCM A;  1LNW A;  1OR7 C;  3IWZ A;  1W5S A;  5CVU A;  3KEQ A;  5TGT A;  2DFF A;  4PCQ A;  1HA8 A;  1J2X A;  4C2M J;  1U8B A;  1T08 B;  4UVB A;  2DJN A;  2NOG A;  4S04 A;  1P6R A;  5CQE A;  2HWV A;  1D1C A;  3MKY B;  1MDM B;  3CC4 I;  2LY2 A;  4BAY A;  4NHJ A;  4GRI A;  3AG4 H;  4G12 A;  1IDY A;  4YIR X;  1AKH B;  3HUG B;  1RES A;  2JQ7 A;  3PNV A;  1YHQ I;  4RMN A;  4L0Z B;  2K4B A;  4MQ9 F;  3QOP A;  3GCM A;  3JTG A;  2DFE A;  2M0M A;  4FQG A;  5CYV A;  4LLL A;  3JRD A;  5HOD A;  1X1C A;  3HPH A;  3CUQ A;  1X19 A;  3MZH A;  3QOE A;  1LFP A;  2UUZ A;  1O7L A;  2EBI A;  2G7U A;  2OZ6 A;  4QTR A;  4FCY A;  2M4G A;  1LDJ A;  2JSP A;  1TT0 A;  1KYZ A;  3I55 I;  2R0Q C;  1Z6T A;  2QWW A;  2EIK H;  3UNG C;  1S3J A;  2HZT A;  1SAN A;  3ESW B;  5DCF A;  2X0L A;  4YFK F;  3ONQ A;  4B3X A;  2XUB A;  3BR5 A;  3BG7 A;  5HOO A;  5C3E J;  3ERE D;  5FKK A;  2P5L C;  5B1B H;  3CLO A;  3TED A;  3CF5 F;  2GA1 A;  4L0Y B;  5B5E C;  3F9K A;  4I99 C;  3BQZ A;  2CMP A;  4GDF A;  5E18 F;  4Y52 J;  2B63 J;  3GTG J;  2O61 A;  3S3M A;  1YJW I;  2XPV A;  3V8K A;  5L3C A;  4E6K G;  5F0F A;  1W5T A;  1F4K A;  3K0L A;  3MMY B;  2VJ4 A;  2ZME C;  5ILS A;  4Y13 A;  2IAI A;  1SMT A;  4HZF A;  1FEX A;  4FE7 A;  4HDV A;  2DA4 A;  2MD0 A;  4FX0 A;  1S72 I;  4P5O A;  3EYI A;  2D45 A;  3DEU A;  5K5O A;  2X6O A;  4N9I A;  3WU2 C;  1O4X A;  3OYF A;  5GAD J;  1WJ5 A;  4D5F A;  1QGP A;  4NDL A;  2IA2 A;  2CW0 F;  5K7F A;  2MYS A;  2NS8 A;  3K4C A;  1HKQ A;  1FIA A;  1VF9 A;  4EJW A;  5ICC A;  1R49 A;  2VJJ A;  3RKX A;  2LF8 A;  4HOB A;  2JRM A;  3R0A A;  1D1A A;  1U2W A;  4XLN F;  3F21 A;  4EJO A;  1VQN I;  3H36 A;  4XSX F;  2JA6 J;  1DPU A;  4U7B A;  2R7R A;  2HXI A;  1ZGW A;  3HOW J;  3BG3 A;  4DBQ A;  2MLG A;  4BNC A;  4NBQ A;  5AIQ A;  3S93 A;  1AHD P;  2B0L A;  2ZME B;  4XOR A;  1R5I D;  3LSM A;  2LRE A;  2ZCW A;  3ABT A;  2K5C A;  1PJR A;  3KP3 A;  3OOP A;  1ETV A;  2R7W A;  1T38 A;  2XAG A;  4RBO A;  3HOS A;  4N4N B;  4RGS A;  1JKQ C;  4EV0 A;  3HB9 A;  1FNN A;  5M5X J;  2LF7 A;  1SFX A;  3E6B A;  4BBR J;  2YX7 A;  3FXK A;  5DS9 A;  2TDX A;  1W0T A;  1BI2 A;  5FKO A;  1MND A;  1PYV A;  3BJA A;  4UVA A;  2F5D A;  2E2H J;  4CCL A;  2HOS A;  4DZJ A;  3P5J A;  1J59 A;  1TWA J;  2VN2 A;  5J4Y A;  3JAM K;  1FP1 D;  4AVZ A;  2WA0 A;  2HTJ A;  3MZY A;  3LSR A;  3DQV C;  5DM7 F;  2GAU A;  4L5J A;  2AHQ A;  3FXU A;  4NB5 A;  5BMZ A;  2R3S A;  1RI7 A;  1UEL B;  3PUB A;  4IRH A;  2UXX A;  2LY9 A;  4LGW A;  2RN7 A;  1VI0 A;  1B72 A;  3HRT A;  3TO9 A;  3EUH A;  2VIX A;  1DP7 P;  1X58 A;  4OMZ A;  2COB A;  2ZFW A;  2BZT A;  2KJC A;  1SD5 A;  2P8T A;  2E7X A;  3C3W A;  4RGU A;  2DOA A;  3ELK A;  2P6S A;  1FOK A;  3WGG A;  1TWF J;  4V19 K;  4Y3O A;  1GVD A;  4XRS G;  5ILV A;  5DDG A;  4XOP A;  3IKT A;  3SEZ A;  2ZO4 A;  4ABZ A;  2F6C A;  1Y39 A;  4KNY A;  3MWM A;  1MD0 A;  2DA2 A;  3I59 A;  4M74 A;  5FD6 A;  4M9S A;  3F8C A;  2FE3 A;  5A2Q Z;  3RZD J;  3CC2 I;  2O5R A;  1VQL I;  1DUX C;  2M4K A;  4G6T B;  5CVI A;  4B09 A;  1RIO H;  3WGH A;  4BGD A;  3O2P E;  4XLH A;  1O3Q A;  3HM5 A;  1BI0 A;  3DCF A;  4B48 A;  1F43 A;  4G7H F;  4XRM A;  2O6G E;  5KHD A;  2OQG A;  2HQR A;  1FC3 A;  2YS9 A;  5CLS A;  1U8R A;  1FTZ A;  1BI1 A;  1HW1 A;  4AVP A;  3B02 A;  3L1P A;  2E34 A;  4DIQ A;  3JRF A;  3FXM A;  2DXI A;  3VOD A;  2JK3 A;  3ERM A;  3ZP5 A;  1ETK A;  5KVR A;  5D6E A;  5HNF A;  5J1U A;  2STW A;  1S8N A;  5F64 A;  4PJN A;  1IRG A;  1HQC A;  3WGI A;  1O3T A;  2QSF X;  3U9G A;  3V8L A;  1QNT A;  1D5Y A;  4JK1 X;  4C3J J;  3WTT C;  1BM9 A;  3GYH X;  1SMY F;  4D0P A;  2G9W A;  3PNY A;  4B3A A;  3L9F A;  2W00 A;  3V7C A;  2GA2 A;  3CDH A;  2PJP A;  3AL0 C;  3SXY A;  1BW6 A;  3QWL A;  4A3C J;  4BY1 J;  5JLX A;  1HKT A;  4HLX A;  3EUK L;  2PJR A;  3AAF A;  2VKH A;  4PGH A;  1B8I A;  2ZXI A;  2K27 A;  2BVM A;  2L0K A;  2RQP A;  3IUO A;  3KZI C;  4HDU A;  3LSG A;  3LNQ A;  2B7E A;  4BHC A;  2FBK A;  3T5X A;  4XKB A;  4BHB A;  2HS5 A;  3V42 A;  3G1M A;  2VPL A;  2A6E F;  1F36 A;  3QPH A;  2DMT A;  1DQU A;  1TL8 A;  5K7H A;  4HYE A;  5D8L B;  2A6T A;  1D1B A;  3GTQ J;  4JX6 A;  3DF8 A;  1S6L A;  4B44 A;  1FMW A;  2WC2 A;  2EFW A;  1EH7 A;  1XMA A;  5HNH A;  3AL0 B;  1G8X A;  3FK6 A;  3ZQI A;  1CF7 A;  1V5F A;  2MW8 A;  3MKZ A;  1BOA A;  1ETO A;  2HR3 A;  5F6F A;  3FMS A;  2F4I A;  1ZKG A;  1TTY A;  2KRH A;  3IL2 A;  2VI6 A;  2UWM A;  3TO6 A;  2VBW A;  2JRT A;  4IF4 A;  2ELJ A;  2HOA A;  1JJ6 C;  3KP4 A;  5JI6 A;  2Y30 A;  2EA4 A;  3QP6 A;  3K4N A;  1BIA A;  4V2G A;  3VFZ A;  2XVC A;  3FMR A;  1UB9 A;  2LD5 A;  1Z3Y A;  3OS1 A;  1L3L A;  4G94 A;  3ZPL A;  2LMD A;  3V8J A;  2GZW A;  3K69 A;  1GHC A;  1OYW A;  4ZYH A;  3HG9 A;  1SFE A;  1MBG A;  4ZZD A;  5J3L A;  4CO8 A;  4ZDO A;  2ZKZ A;  4XK4 A;  4XLE A;  3BQY A;  5FLX Z;  1O3S A;  2VT3 A;  2IA0 A;  2KRF A;  1TQP A;  3KP6 A;  1OKR A;  3OYJ A;  2PMZ A;  4CCJ A;  2P4W A;  3R60 A;  4UHT A;  1DPR A;  1D0Z A;  4R79 A;  1FBS A;  1Z0X A;  1RUO A;  1UHM A;  3BCB A;  3WTY C;  1B9N A;  3JRE A;  2IS1 A;  2R5Y A;  5M3F J;  3K2A A;  4BJT A;  3H5R A;  1VQK I;  1YOV B;  2Q0O A;  3QQA A;  5FJ8 J;  3E3V A;  1FZP B;  5FKM A;  1VZ0 A;  2ISZ A;  2BVL A;  5J6X A;  1MNE A;  4PK4 A;  1I3A A;  2FU4 A;  2DU9 A;  3HGY A;  3VYT B;  2CUZ A;  3WTV C;  3F8N A;  4G7O F;  4HG2 A;  4EJV A;  5ICG A;  2NRA C;  5FLV A;  2R7S A;  4BEH B;  5F0H A;  4IHX A;  2K02 A;  3A01 A;  2MLK A;  3GEZ A;  4DJA A;  2D2W A;  3S15 J;  2K3P A;  2R7U A;  2ETH A;  3K6G A;  3Q9S A;  4RS8 A;  5HLG A;  3G73 A;  5EGO A;  3DKX A;  2EZL A;  2L7F P;  3CMM A;  5HS7 A;  1NTC A;  4J00 A;  1IDZ A;  3F72 A;  3HSR A;  2DK5 A;  4ZYE A;  3CJN A;  4DZP A;  2JUC A;  2COM A;  1ZTR A;  4A3M J;  4HBL A;  4UUS A;  4OAZ A;  4ESJ A;  2Z99 A;  1OQY A;  2PJR B;  1MH4 A;  4N9H A;  3H9G A;  4UV8 A;  3K9T A;  2EFO A;  4IXA A;  1TW2 A;  1U3E M;  2I8D A;  2QLZ A;  1E2X A;  3G3Z A;  1RET A;  1XMX A;  1Z91 A;  2KIF A;  3ZRG A;  2FRH A;  3SDG A;  1IXR C;  3EQL F;  2UXN A;  3PFY A;  4KN4 X;  3ULQ B;  3IC7 A;  2BOL A;  4HV6 A;  1SFO J;  4RGX A;  1OCT C;  1RPW A;  2KT0 A;  3HXL A;  4HF0 A;  5EEH A;  3OS0 A;  4HPQ A;  1VQO I;  4HQM A;  4FE4 A;  2XV4 S;  1EKE A;  3HRM A;  2BXZ A;  1CF7 B;  2CV0 A;  1R4M B;  2XKO A;  4XIC A;  5IOY A;  3ZMV A;  2RQQ A;  1LVK A;  4P96 A;  1P4X A;  4L9V A;  3LL7 A;  4DYR A;  2DAO A;  1G6N A;  2XB5 A;  2J5P A;  2XHK A;  4F92 B;  2W7N A;  2QA4 I;  2XPW A;  4W97 A;  3JSP A;  4I09 A;  1J7K A;  3WE2 A;  2OTL I;  3E6C C;  5DUK A;  1O3R A;  2K86 A;  3H9J A;  1RZ4 A;  1HW5 A;  1J75 A;  3VEP A;  3M9A A;  2K3F A;  2QEN A;  2JJ7 A;  3M8J A;  2X85 A;  3SJM A;  3BZK A;  2VJI A;  2IVM A;  1AOY A;  2JA5 J;  3F6V A;  1OMI A;  1FTT A;  3HOV J;  3CUO A;  3K4J A;  3VB2 A;  1JXS A;  2JA7 J;  2W24 A;  4IL6 C;  3WE3 A;  2OCC H;  2HDC A;  1Y1W J;  2BE5 F;  4RB3 C;  4KA4 A;  3NRV A;  4AWX B;  2XAJ A;  1K79 A;  2M34 A;  1QVT A;  3ZOB A;  2LKX A;  2VQH A;  2E5Z A;  3ROU A;  1BL0 A;  3JR9 A;  1V4R A;  3KFW X;  2R5Y B;  3NWS A;  4PJL A;  4A3F J;  3U21 A;  2XGD A;  4NUB A;  4A5N A;  4KJZ A;  1LFU P;  4HX8 A;  3F0C A;  1UCR A;  1SD6 A;  2EA2 A;  2XAU A;  3FXQ A;  3PJR A;  3FK7 A;  3BLY A;  1SD7 A;  4YFX F;  4RAZ A;  2DJI A;  4Y15 A;  1PUF A;  4W1U A;  2W4S A;  1KU7 A;  4XRF A;  1MNM C;  2L9R A;  4IOC F;  3BJO A;  3KZY A;  1GV2 A;  1JTX A;  2BYV E;  4M71 A;  4A2U A;  3S1R J;  3P9K A;  1BR1 A;  4IRG A;  1FY7 A;  2E1M C;  2KIM A;  4UVC A;  2P7C B;  1KQ0 A;  1ZRE A;  6PAX A;  5IT3 A;  3ASO H;  1MMN A;  3K4B A;  4EGZ A;  1J9I A;  2Z5U A;  1HKS A;  1OPC A;  1X3W B;  1WFX A;  5IP7 J;  2VE8 A;  3HSE A;  1R00 A;  3HKZ A;  4PFP A;  1E0E A;  2BEO A;  1FYM A;  2RDP A;  3HPG A;  2NNY A;  4BHP A;  3QPT A;  5TJJ A;  3WOD F;  2BXY A;  3F8M A;  3TKY A;  4FHT A;  4S05 A;  3PL8 A;  3BRO A;  3ML6 A;  3HDD A;  5HDK A;  2EIM H;  2XRO A;  1KU3 A;  3ZR8 X;  3W6J B;  2EH3 A;  4EM2 A;  1VQM I;  3A1Y A;  4GYI A;  2EB7 A;  2KRC A;  2AO9 A;  4IPA A;  4Y4R A;  1YX3 A;  1IXC A;  2E1M B;  4N0B A;  5DD8 A;  3UKG A;  4B1R A;  1KU9 A;  4M9Z A;  2FNA A;  2RNJ A;  1MW7 A;  3K1N A;  1WJB A;  3FKJ A;  1X1B A;  3HOU J;  4XLP F;  2F5V A;  5CPR B;  1B6A A;  3HOY J;  3GUD A;  3CCS I;  4FET A;  1HST A;  2QSH X;  4ZYA A;  3L2U A;  4CHU A;  2HI3 A;  1T0F A;  2XF7 A;  4XNF A;  2PMZ N;  2M0C A;  4XLC A;  3D5S C;  2LR8 A;  1POG A;  3MQ0 A;  4G8X A;  2K9Q A;  1MMG A;  2K9L A;  3L2V A;  1GXQ A;  3UR3 C;  1HDD C;  4A0X A;  2VQL A;  2V79 A;  4II2 A;  3I64 A;  3H92 A;  1E3O C;  2L02 A;  1X1D A;  1UJ8 A;  2E1O A;  2JUG A;  2O9L A;  1K6Y A;  3CP8 A;  3E7L A;  2CW8 A;  4P9U A;  4LG0 B;  5D5W B;  1H9T A;  4NNJ A;  5HS8 A;  2KQR A;  1IV6 A;  3IAM 2;  4BXF A;  3J80 Z;  1HLV A;  2KDO A;  1EA3 A;  3N05 A;  3OYE A;  1SVM A;  1V5G A;  2OPT A;  3BPX A;  1W36 C;  1VQ4 I;  3JW4 A;  1LE8 A;  5F08 A;  3FIW A;  3J81 K;  1VND A;  4D1Q A;  1JJ8 C;  5LEK A;  2CQ7 A;  2DA7 A;  3CJR B;  2R7Z J;  1D8J A;  2DW4 A;  4OIN F;  1FIP A;  3H35 A;  3S14 J;  3S17 J;  4IHS A;  1OIS A;  3LOC A;  3Q3S A;  4E7S A;  4RA2 A;  2HGC A;  4KIC A;  1QA6 A;  4E7Z A;  3BC8 A;  1I3Q J;  4XID A;  1A04 A;  1TNT A;  2KHM A;  2WAQ N;  2OF7 A;  1VQP I;  2PEX A;  3PO3 J;  1IXS B;  3HBL A;  3I4M J;  3OMY A;  1I5Z A;  4D7M A;  2CGP A;  3U2R A;  2ID6 A;  5L3D A;  1A5J A;  1PUF B;  3KZZ A;  4WXC A;  1TC3 C;  3NAU A;  3Q5F A;  4JP0 A;  5JHF A;  3DKY A;  2QSG X;  4AYB A;  1A36 A;  1XTA A;  4QLC U;  4FIS A;  3HOT A;  4PSW A;  1ETX A;  2LP0 A;  3AKZ A;  1LQ1 A;  3RYP A;  1Z77 A;  5BPD A;  5FRN A;  3D5R C;  3BPV A;  1MJA A;  3OSF A;  1YIT I;  2QZ8 A;  4BQN A;  4IX7 A;  1FPQ A;  3H9Q A;  4P55 A;  4GO1 A;  4EM0 B;  3WTW C;  1XG1 A;  2DPD A;  3LQR A;  5CVR A;  1OYI A;  5H20 A;  4ZYG A;  3R4K A;  4L9J A;  4HRI A;  2L2O A;  5BPI A;  2DN0 A;  5D6F A;  4G9Y A;  1MJB A;  1ODD A;  3JRI A;  1T2K A;  2NVY J;  2CUJ A;  2V1X A;  1FYL A;  1Y8Q B;  3F22 A;  1GDT A;  3QAH A;  2DDA A;  3H5A A;  4KIS A;  1W7P D;  2MA3 A;  2ZNZ A;  4XR6 A;  2DOF A;  1YYV A;  3RSN A;  4MNU A;  2IA1 A;  1P9Q C;  1QHH D;  4AIK A;  1VQ8 I;  2NVT J;  4KMF A;  3R6S A;  1S29 A;  3M1C A;  3VSK A;  2B9S A;  2HVS A;  1ZG5 A;  4BJ5 C;  3LSH A;  2IEK A;  3DXJ F;  1LB2 A;  1FWZ A;  2QQB A;  3R0J A;  2DFI A;  2DYR H;  3Q9V A;  4ETS A;  1YS6 A;  2JTV A;  2WB1 A;  2UV1 A;  5J1R A;  1JKP C;  4IO9 F;  3OYL A;  1XD7 A;  3BTI A;  4XLA A;  4B43 A;  3CCV I;  1D0X A;  3DBL B;  2XF6 A;  4G6D A;  2QQA A;  4RLQ A;  2M5W A;  3KP2 A;  3I58 A;  4NQW B;  2R93 J;  2QKM B;  4XBF A;  3GFM A;  2XRN A;  5L3B A;  2Z33 A;  2CUE A;  3HSF A;  3G1L A;  1XMK A;  3QP5 A;  1WH5 A;  5DV5 A;  1P4W A;  2Z2S B;  1RKT A;  2Q2E A;  5LHG A;  2KJB A;  1XGS A;  5EEG A;  5LHH A;  3SYT A;  3MEX A;  2P5V A;  3CP2 A;  5B1A H;  3VYS B;  4M6Y A;  5D5X B;  4MTE A;  5M5Y J;  2NYX A;  4ESF A;  2BV6 A;  2EV6 A;  2PX9 A;  2CRG A;  3FM5 A;  3O3K A;  5LGN A;  4QSH A;  1T95 A;  1GT0 C;  5IT9 Z;  2D1V A;  3S2H J;  2IT0 A;  1WVR A;  1YJ9 I;  3RCO A;  3TP3 A;  3W2A A;  2LG4 A;  4Q47 A;  1U0J A;  1CGP A;  2QCO A;  3KEO A;  1FSE A;  4U7D A;  4XMY A;  2NS0 A;  3E5U A;  1OFC X;  1OCR H;  4CSW A;  1TP4 A;  4DQ2 A;  5FRO A;  3GTM J;  3ZQ7 A;  3ZN1 A;  2Y31 A;  4CCK A;  2NNN A;  2BW3 A;  4BU2 A;  3K1P A;  4OU0 A;  3FIS A;  2WWY A;  3CC7 I;  1G3Y A;  1VQ9 I;  3BR0 A;  1N78 A;  4UB8 C;  2EZK A;  4M3E A;  3RTR A;  3LMM A;  1JUS A;  3GXO A;  1O57 A;  2E5N A;  4DYC A;  2L01 A;  1B4A A;  2R7T A;  4RDU A;  3BT9 A;  2AQF A;  2IS4 A;  3LA7 A;  4YFN F;  1GXP A;  2LH9 A;  1SVO A;  1OYY A;  4XKW A;  4NC8 A;  1MBF A;  1BR4 A;  3WU0 A;  2CS3 A;  2ZJ2 A;  3OV8 A;  4I0A A;  4LOC A;  4XL9 A;  3K4M A;  3CMA I;  5DCM B;  1ZAO A;  1K4S A;  3FXJ A;  3LFK A;  4A3B J;  1BN5 A;  2XRL A;  3CD6 I;  3CUQ C;  4E4H A;  2QBY A;  1VQ6 I;  1ZRD A;  1A6Q A;  1AA7 A;  1YW9 A;  4AIJ A;  2MC3 A;  1OCZ H;  3EDP A;  4L9N A;  3BOQ A;  4A3D J;  4NC7 A;  2E35 A;  2FBI A;  2AS5 F;  1OCP A;  3DEE A;  1FYK A;  1XGN A;  1ZGA A;  2L9S A;  1RKW A;  5K7Z A;  5HLT A;  1V5E A;  3ZMZ A;  2FOK A;  2PLY A;  3BJ6 A;  3L2R A;  4CIC A;  3DTE A;  1TNS A;  3CDI A;  2W25 A;  2VXD A;  1VQ7 I;  4M3G A;  1WPK A;  1ZYR F;  4G6Q A;  3OIQ A;  3CUQ B;  2J5O A;  2K4J A;  3TOB A;  1PVE A;  5HLH A;  4RAF A;  4I98 B;  2E60 A;  1I6X A;  1KU2 A;  2K9S A;  2MG4 A;  3ASN H;  3CQZ J;  3D5L A;  3E0J B;  3KYD B;  3MZ8 A;  1H8A C;  3O8H A;  2LVS A;  3LA3 A;  2Y0M A;  4D7N A;  2H09 A;  1IRF A;  3IH4 A;  5CJ9 A;  3GBG A;  3A2K A;  4BJ6 C;  4QWQ A;  4EM1 A;  2W84 A;  2H94 A;  3QU3 A;  1RR8 C;  2STT A;  3SEQ A;  4WF2 A;  2KFD A;  3RDI A;  5LBQ A;  3P7N A;  3WU1 B;  4S0H B;  5FLM J;  4KIT B;  2PI0 A;  3HZJ A;  2GXA A;  4I2O A;  1FLI A;  1CQT A;  4I02 A;  2R92 J;  4LG3 A;  3ZQH A;  5HDN A;  4PJM A;  2W85 A;  1KGS A;  2Y2Z A;  1J5Y A;  5F0C A;  4RAG A;  1IV8 A;  2RKH A;  4DGW B;  2ZXW H;  3DBR B;  3O6B B;  2VQC A;  2OU2 A;  3OR1 C;  2V7F A;  3GO5 A;  1BC8 C;  2Z16 A;  2OJE D;  2HQA A;  1U9O A;  1EF4 A;  3GZ5 A;  4MFD A;  2O8X A;  4EGY A;  1TWG J;  2P81 A;  2HPM A;  2DT6 A;  5EYR A;  4ON0 A;  4ZC3 A;  1Y56 A;  5FFZ A;  1V54 H;  2V26 A;  2XSD C;  1O7F A;  2BW3 B;  5F1J A;  5E3L A;  4EVI A;  4XN0 A;  1QVU A;  1T8I A;  3GTO J;  1P92 A;  2VPR A;  3D0S A;  2FXA A;  2DA6 A;  4M73 A;  1UST A;  3ZMU A;  1KQ8 A;  2HOT A;  3GTK J;  3H3U A;  4Z6Y A;  3L09 A;  1JUP A;  2E1C A;  2MH9 A;  1RRJ A;  3B73 A;  2H6C A;  3E1S A;  5EDN A;  4WK8 F;  3W6K B;  1Y8R B;  1XN7 A;  1ETW A;  3BR1 A;  3EUH C;  1WI3 A;  4BQQ A;  2EJR A;  2ZSH B;  1BW5 A;  2XPU A;  4HAM A;  4XON A;  3HOX J;  2BHY A;  2OAZ A;  2Y9Y A;  4UXN A;  2H8R A;  4V2F A;  2YPR A;  3QPL A;  2P0W A;  3I4P A;  5LGU A;  3H3V K;  1W5C C;  2ECC A;  1QZE A;  3S3O A;  4C3I J;  3ZMS A;  2O3F A;  5TRD A;  3BZC A;  4EMS A; 
#chains in the Genus database with same CATH homology
 3IWF A;  1FP2 A;  1Z9C A;  2DLL A;  1DDN A;  2YU3 A;  1JHF A;  4YII A;  3GW2 A;  4UUV A;  2EWN A;  2P7V B;  5LGT A;  1ULY A;  1U5T A;  1R1T A;  5D4R A;  3WTU C;  2DTR A;  1SD4 A;  5E8G A;  2MD5 A;  2HTS A;  4A12 A;  3HRS A;  2JZY A;  4OIP F;  2ACJ A;  5HS9 A;  4KUM A;  3REO A;  2Q8K A;  1AWC A;  2LKP A;  3I59 B;  2VOO A;  2L4M A;  4ZYD A;  1LDD A;  4R8H A;  1PDN C;  1Q1H A;  1WRJ A;  3SFZ A;  1P4A A;  1LEA A;  2DI3 A;  2WTE A;  1ON2 A;  1XB4 A;  3DV8 A;  3LST A;  1K6O A;  2F5C A;  2H27 A;  4KT5 C;  4JBA A;  4H0E A;  1YO5 C;  4OIR F;  3ISP A;  2VC0 A;  3FF5 A;  2PG4 A;  2XIG A;  1EH8 A;  3KET A;  2R7D A;  4BXU A;  3LAP A;  2LNB A;  5D8K B;  1YFH A;  1G3S A;  1YIO A;  4YG2 F;  4HW0 A;  1XSV A;  3E6M A;  4I7H A;  3L7W A;  2GXB A;  1WWX A;  3HTS B;  4TV7 A;  2VXZ A;  2EFQ A;  2FMY A;  2YSR A;  3FWE A;  2PQ8 A;  4HLY A;  3BZ6 A;  2RVC A;  4WXH A;  3EYY A;  1W7P A;  4A6E A;  3E5Q A;  1ZGJ A;  4MQV A;  4A5M A;  2HOE A;  1C0W A;  3RIR A;  2QUF A;  3BP8 A;  2FA5 A;  2IJL A;  1T6S A;  1QZY A;  3F6O A;  2LDU A;  2VE9 A;  1R22 A;  3TDU C;  2L4A A;  3MAJ A;  2EFP A;  4U0W A;  5L3G A;  2GWR A;  2XAF A;  4WCG A;  1UHW A;  1TW3 A;  4GGG A;  4HF1 A;  2F5F A;  5HVQ C;  1SFU A;  4GCV A;  3C7J A;  2IRF G;  3M8E A;  4A6D A;  2A3S A;  3K1M A;  1BI3 A;  3JAM Z;  2KIU A;  2XAH A;  3GFJ A;  5E1Z B;  3DPL C;  1G3W A;  1IN4 A;  4WXD A;  1XGM A;  3M8F A;  1TQI A;  3I54 A;  3V7S A;  1Z7U A;  3KLN A;  2L3D A;  1U78 A;  4HX7 A;  5JVT A;  5CVJ A;  4MEY F;  4KIG A;  2E7W A;  4KIB A;  1K7A A;  5K1Y A;  3FM3 A;  2DQR A;  2FEZ A;  2GIV A;  5J8C A;  3GFI A;  3PQJ A;  4RB0 A;  4MEX F;  1Y0U A;  3HYI A;  3L00 A;  4LK1 F;  1ZAR A;  5LLQ A;  4UNO A;  4A0Y A;  4PZJ A;  4L9T A;  1R36 A;  2EV5 A;  3M7G A;  3F23 A;  5A2Q K;  4CXF A;  5AON A;  3ECO A;  1UFM A;  5LRS A;  3F8F A;  1W7P B;  2V6C A;  3KE2 A;  5E1W A;  1ZRC A;  1REP C;  2ESN A;  1R5H A;  4Z2Y A;  3HUG A;  2P6T A;  3KCC A;  4UV9 A;  2CQK A;  2XAS A;  3WG9 A;  1ZN2 A;  4K2E A;  4P9F A;  5FB2 A;  4AIH A;  4EJU A;  5AIP A;  3U1D A;  2Y48 A;  3EET A;  3FHZ A;  2FQ3 A;  4E70 A;  4A0Z A;  2R7F A;  5DEQ A;  5D5V B;  2Z3Y A;  4IVN A;  3F3X A;  1HSJ A;  1TQM A;  3GFL A;  4KYW A;  1ZLJ A;  3FXR A;  3VOE A;  1L0O C;  4LB6 B;  2V9V A;  5JHU A;  1WI9 A;  3F8B A;  1F5T A;  2LSO A;  4G7Z F;  5KK1 A;  2NAZ A;  3RPU A;  4KFC A;  4B8X A;  1S7O A;  1YLF A;  2IW5 A;  4ZH4 F;  4HQE A;  1YS7 A;  1RNL A;  1HBX G;  1X3U A;  2M30 A;  3E5X A;  3QRF F;  2VT2 A;  1LDK B;  1WKM A;  3I5U A;  3LAJ A;  4KN7 X;  1IN8 A;  2OA4 A;  5D4S A;  5DD4 A;  2ZME A;  2M1B A;  2MBF A;  2M45 A;  1IF1 A;  2HKO A;  3ZN0 A;  2DPU A;  1IN5 A;  5FLX K;  5CVV A;  2PFB A;  2VOP A;  3R61 A;  3E6D A;  1R58 A;  3JSO A;  1I27 A;  2Z9O A;  5FGM A;  3T8T A;  3BWG A;  4IHT A;  4WWC A;  1V3F A;  4L18 B;  2G7H A;  4JQF A;  1E17 A;  2MH2 A;  2ZBK A;  3H3Z A;  1EV7 A;  4U88 A;  5ED4 A;  5ERI A;  2WV0 A;  4I01 A;  3TO7 A;  2HEO A;  3RKY A;  2E1N A;  5H6Q A;  1MJ9 A;  5HDG A;  3RI4 A;  3S2W A;  1QBJ A;  1IAW A;  4ENJ A;  1WQ2 A;  1HW2 A;  2DBB A;  2V1U A;  4YIF A;  3LWF A;  1FBU A;  3NQO A;  4ZZL A;  3I0T A;  4F7Z A;  2OD5 A;  2DT5 A;  1BBY A;  4ENM A;  2FNP A;  5FD5 A;  3DPT A;  1YG2 A;  1ON1 A;  1QZZ A;  3COA C;  3ABU A;  1ZG3 A;  1ZRF A;  2IP2 A;  2L54 A;  3DP7 A;  3J7A O;  4U0Y A;  2HYF A;  1H9G A;  2CG4 A;  2FML A;  3KP5 A;  1P2F A;  4Q4Z F;  2K7L A;  2FF4 A;  3V4G A;  1BJA A;  1BIB A;  3MFK A;  1MZB A;  4CGZ A;  1R1U A;  4LLN A;  5FO5 A;  5L3E A;  1USS A;  5DYM A;  5ICE A;  4AD9 A;  2PN6 A;  1J0R A;  4U0V A;  3GVA A;  1FT9 A;  3RPQ A;  2CO5 A;  2ESH A;  4RB1 A;  1XCV A;  1XDS A;  1QO0 D;  3C1D A;  4CZZ A;  3GLX A;  4WX9 A;  1ZH5 A;  3CO7 C;  3GZ6 A;  2HKX A;  4OIO F;  4MTD A;  2ZXJ A;  4IRI A;  1XSD A;  2CWE A;  1YW8 A;  2QQ9 A;  5BQT A;  5J8F A;  3CO6 C;  4HV5 A;  5E8I A;  3SHF A;  1JE8 A;  2OZU A;  2DQL A;  2ELH A;  2PMU A;  2V1D A;  4PGG A;  3L2C A;  1MKM A;  4FX4 A;  4BH9 A;  3V7R A;  2HFH A;  1D3Y A;  1EH6 A;  3WTX C;  3KP7 A;  2EFN A;  3I53 A;  1D8K A;  3P9C A;  5LRR A;  3HRU A;  1KQ9 A;  4ESB A;  4LMY A;  3K2Z A;  2BBY A;  4CDG A;  1B59 A;  2DO7 A;  3J81 Z;  4RAY A;  1PP7 U;  5JFR A;  5ICF A;  1Z1D A;  2C6Y A;  1LJ9 A;  1R23 A;  3C18 A;  5LHI A;  2VC1 A;  4GYG A;  1D5V A;  5H6R A;  2A61 A;  2CSO A;  1HXD A;  3TGN A;  2QBY B;  1FBQ A;  1F9N A;  3J80 K;  2Y75 A;  5ILU A;  1TLH B;  5JR3 A;  2A5Y B;  3GF2 A;  1B1B A;  2RC4 A;  3WTZ A;  1QQI A;  1K78 A;  5BOX A;  3KLO A;  1I1S A;  1H0M A;  1ZLK A;  2FSW A;  3T0Y A;  3SZP A;  3FMQ A;  2EV0 A;  1B9M A;  5DUI A;  3HIF A;  1NHA A;  1ZG1 A;  3M1E A;  1XSX A;  1XGO A;  2VON A;  2BGC A;  5L3F A;  4LB5 A;  1LEB A;  1KYW A;  3FX3 A;  2VBX A;  2VBY A;  3ZMT A;  2VOD A;  4LFU A;  2VBZ A;  2QM3 A;  3ZMD A;  3PFI A;  4EJT A;  1XDU A;  3T8R A;  4OIQ F;  4RGR A;  4MHG A;  5E20 A;  4FT8 A;  2OQR A;  4CYD A;  4ENN A;  3JTH A;  1G4D A;  3E97 A;  3SQN A;  1WSU A;  4O3M A;  2F5E A;  1SAX A;  2HQN A;  1XCB A;  3GX4 X;  3DFG A;  2A6H F;  1U5T C;  4HA8 A;  3IHU A;  5BS6 A;  1BC7 C;  1T98 A;  3ECH A;  3RKW A;  4KMU X;  2YR2 A;  1JHH A;  5K5R A;  3RJP A;  2P5K A;  2O0Y A;  4ENK A;  3HTU A;  3T1B A;  5E1X A;  3GWZ A;  1U5T B;  1STZ A;  4DNC A;  1S7A A;  1JGS A;  3MCZ A;  3N97 A;  4GXO A;  3IRR A;  4OMY A;  3PQK A;  2GQQ A;  3LA2 A;  4M9X A;  2ZNY A;  4KIF A;  5IT9 K;  1K78 B;  1ONV A;  4PDK A;  1YW7 A;  2JT1 A;  1TBX A;  1IN6 A;  4LG0 A;  4MGR A;  1YTY A;  1GVJ A;  3HHG A;  1ZHF A;  2H6B A;  1PUE E;  1MGT A;  4BYY A;  5E17 F;  2M8E A;  1KA8 A;  4Y17 A;  1RUN A;  4O5V A;  1VTN C;  2CFX A;  2W57 A;  1YQA A;  2PMH A;  2AXL A;  2DK8 A;  2PBI A;  5K5Q A;  4LD5 A;  2A07 F;  2RV8 A;  1FSH A;  4RB2 C;  3P9I A;  5LEJ A;  3WTS C;  1IZ1 A;  2KKO A;  2JPB A;  2XKP A;  5HLI A;  1R5G A;  2IPQ X;  4R1H A;  2O03 A;  3RYR A;  1W4M A;  4OOI A;  4I0B A;  1IW7 F;  3TOA A;  2M87 A;  3LQQ A;  2ADU A;  2HYG D;  3HHH A;  1Z6R A;  4ASN A;  4LLG F;  2X4H A;  1MDM A;  4HF2 A;  3TQN A;  4HX4 A;  3IKV A;  2RGV A;  3N4M A;  2EK5 A;  2F2E A;  1OR7 A;  4Q5S F;  2QVO A;  2A69 F;  1T39 A;  4O6J A;  1QPM A;  3I71 A;  4EQQ A;  1LVA A;  1IUY A;  3BDD A;  4NQW A;  3IRQ A;  2JPC A;  2XAQ A;  4IJA A;  1R7J A;  3CTA A;  2QYO A;  2OBP A;  2UZK A;  2A68 F;  3DKW A;  1Z05 A;  4XSZ F;  2CYY A;  1G3T A;  1IN7 A;  3NEU A;  4LJZ F;  1I1G A;  4M72 A;  5F1R A;  2D1H A;  3BY6 A;  4L5I A;  1FX7 A;  4Q48 A;  3TDZ C;  4KDP A;  3QU6 A;  1U6G A;  5D5U B;  4M6X A;  4LK0 F;  3FZV A;  1R1V A;  2FBH A;  2JSC A;  1PP8 F;  2ISY A;  2YX4 A;  3SZT A;  5FFX A;  1F1Z A;  2XGX A;  4BQA A;  2GXG A;  5DCM A;  1LNW A;  3IWZ A;  1W5S A;  5CVU A;  3KEQ A;  4PCQ A;  1J2X A;  4UVB A;  4S04 A;  1P6R A;  2HWV A;  1MDM B;  4BAY A;  4NHJ A;  4L0Z B;  2K4B A;  4MQ9 F;  3QOP A;  3JTG A;  5CYV A;  4LLL A;  3CUQ A;  3MZH A;  1O7L A;  2G7U A;  2OZ6 A;  1LDJ A;  1KYZ A;  1Z6T A;  2QWW A;  4YFK F;  1S3J A;  2HZT A;  5DCF A;  2X0L A;  2XUB A;  5HOO A;  3ERE D;  2P5L C;  3CLO A;  4L0Y B;  2GA1 A;  5E18 F;  2O61 A;  3V8K A;  5L3C A;  1W5T A;  1F4K A;  3K0L A;  5ILS A;  4Y13 A;  1SMT A;  4HZF A;  4HDV A;  4FX0 A;  4P5O A;  3EYI A;  2D45 A;  3DEU A;  5K5O A;  4N9I A;  1QGP A;  2IA2 A;  2CW0 F;  1HKQ A;  5ICC A;  4EJW A;  3RKX A;  2LF8 A;  4HOB A;  3R0A A;  1U2W A;  4XLN F;  3F21 A;  4EJO A;  4XSX F;  1DPU A;  4U7B A;  2MLG A;  4BNC A;  5AIQ A;  2B0L A;  2ZME B;  2ZCW A;  3ABT A;  3KP3 A;  3OOP A;  1T38 A;  2XAG A;  3HOS A;  4RGS A;  4EV0 A;  1FNN A;  2LF7 A;  1SFX A;  3E6B A;  2YX7 A;  2TDX A;  1BI2 A;  3BJA A;  4UVA A;  2F5D A;  1J59 A;  2VN2 A;  3JAM K;  1FP1 D;  2HTJ A;  3MZY A;  3DQV C;  2GAU A;  4L5J A;  3FXU A;  4NB5 A;  5BMZ A;  2R3S A;  1RI7 A;  4IRH A;  2UXX A;  4LGW A;  2RN7 A;  3HRT A;  3TO9 A;  3EUH A;  1DP7 P;  4OMZ A;  2ZFW A;  2KJC A;  2P8T A;  1SD5 A;  2E7X A;  3C3W A;  4RGU A;  3ELK A;  2P6S A;  1FOK A;  3WGG A;  5ILV A;  5DDG A;  3IKT A;  4KNY A;  2ZO4 A;  3MWM A;  1MD0 A;  3I59 A;  4M74 A;  5FD6 A;  4M9S A;  3F8C A;  2FE3 A;  5A2Q Z;  1DUX C;  5CVI A;  4B09 A;  1RIO H;  3WGH A;  3O2P E;  1O3Q A;  1BI0 A;  4G7H F;  2O6G E;  2OQG A;  2HQR A;  1FC3 A;  5CLS A;  1U8R A;  1BI1 A;  1HW1 A;  4AVP A;  3B02 A;  3VOD A;  3ZP5 A;  5KVR A;  5D6E A;  2STW A;  1S8N A;  5F64 A;  1IRG A;  1HQC A;  3WGI A;  1O3T A;  3U9G A;  3V8L A;  1QNT A;  4JK1 X;  3WTT C;  1BM9 A;  3GYH X;  1SMY F;  4D0P A;  2G9W A;  3L9F A;  3V7C A;  2GA2 A;  3CDH A;  2PJP A;  3SXY A;  1HKT A;  4HLX A;  3AAF A;  4PGH A;  2K27 A;  2RQP A;  4HDU A;  4BHC A;  2FBK A;  3T5X A;  4BHB A;  2HS5 A;  2A6E F;  3QPH A;  4HYE A;  5D8L B;  3DF8 A;  1S6L A;  2WC2 A;  2EFW A;  1EH7 A;  1XMA A;  1CF7 A;  1BOA A;  2HR3 A;  5F6F A;  3FMS A;  1TTY A;  3IL2 A;  2UWM A;  3TO6 A;  2VBW A;  2JRT A;  4IF4 A;  3KP4 A;  5JI6 A;  2EA4 A;  3QP6 A;  1BIA A;  3VFZ A;  2XVC A;  3FMR A;  1UB9 A;  1L3L A;  4G94 A;  3ZPL A;  3V8J A;  2GZW A;  3K69 A;  1GHC A;  1OYW A;  4ZYH A;  1SFE A;  4ZZD A;  4CO8 A;  2ZKZ A;  5FLX Z;  1O3S A;  2IA0 A;  2VT3 A;  2KRF A;  1TQP A;  3KP6 A;  1OKR A;  2P4W A;  3R60 A;  4UHT A;  1DPR A;  4R79 A;  1FBS A;  1RUO A;  1UHM A;  3WTY C;  1B9N A;  2Q0O A;  3E3V A;  1FZP B;  2ISZ A;  5J6X A;  2FU4 A;  2DU9 A;  3WTV C;  3F8N A;  4G7O F;  4EJV A;  5ICG A;  2NRA C;  2K02 A;  2MLK A;  3GEZ A;  2D2W A;  2ETH A;  3Q9S A;  4RS8 A;  5HLG A;  3G73 A;  5HS7 A;  3F72 A;  3HSR A;  2DK5 A;  4ZYE A;  3CJN A;  2COM A;  4HBL A;  4ESJ A;  2Z99 A;  4N9H A;  4UV8 A;  3K9T A;  2EFO A;  4IXA A;  1TW2 A;  1U3E M;  2QLZ A;  1E2X A;  3G3Z A;  1Z91 A;  2KIF A;  2FRH A;  1IXR C;  3EQL F;  2UXN A;  4KN4 X;  3ULQ B;  3IC7 A;  4HV6 A;  4RGX A;  5EEH A;  4HF0 A;  4HQM A;  2XV4 S;  3HRM A;  1CF7 B;  2XKO A;  3ZMV A;  4P96 A;  1P4X A;  4L9V A;  2DAO A;  1G6N A;  2J5P A;  2XHK A;  3JSP A;  4I09 A;  1J7K A;  3WE2 A;  3E6C C;  5DUK A;  1O3R A;  2K86 A;  1RZ4 A;  1HW5 A;  1J75 A;  3VEP A;  3M9A A;  2QEN A;  2IVM A;  1AOY A;  3F6V A;  1OMI A;  3CUO A;  3VB2 A;  1JXS A;  2W24 A;  3WE3 A;  2HDC A;  2BE5 F;  4RB3 C;  4KA4 A;  3NRV A;  4AWX B;  2XAJ A;  1K79 A;  3ROU A;  1V4R A;  3KFW X;  4A5N A;  4HX8 A;  1UCR A;  1SD6 A;  2EA2 A;  3FXQ A;  1SD7 A;  4YFX F;  4RAZ A;  4Y15 A;  1KU7 A;  4XRF A;  3BJO A;  3KZY A;  4A2U A;  2BYV E;  4M71 A;  3P9K A;  4IRG A;  1FY7 A;  4UVC A;  2KIM A;  2P7C B;  1KQ0 A;  1ZRE A;  6PAX A;  5IT3 A;  4EGZ A;  1J9I A;  2Z5U A;  1HKS A;  1OPC A;  2VE8 A;  3HSE A;  1R00 A;  2BEO A;  1FYM A;  2RDP A;  2NNY A;  4BHP A;  3QPT A;  5TJJ A;  3WOD F;  3F8M A;  3TKY A;  4FHT A;  4S05 A;  3BRO A;  3ML6 A;  5HDK A;  2XRO A;  1KU3 A;  4EM2 A;  3W6J B;  4GYI A;  2EB7 A;  4IPA A;  1IXC A;  4N0B A;  5DD8 A;  1KU9 A;  4M9Z A;  2FNA A;  2RNJ A;  3K1N A;  4XLP F;  1B6A A;  3GUD A;  1HST A;  4CHU A;  1T0F A;  3MQ0 A;  4G8X A;  1GXQ A;  4A0X A;  2V79 A;  3I64 A;  3H92 A;  2L02 A;  4P9U A;  4LG0 B;  5D5W B;  1H9T A;  5HS8 A;  3J80 Z;  3BPX A;  3JW4 A;  3J81 K;  5LEK A;  1D8J A;  2DW4 A;  4OIN F;  4IHS A;  2HGC A;  4KIC A;  1A04 A;  1TNT A;  2PEX A;  1IXS B;  1I5Z A;  2CGP A;  3U2R A;  5L3D A;  3KZZ A;  4WXC A;  3Q5F A;  4QLC U;  3HOT A;  1LQ1 A;  3RYP A;  5BPD A;  3BPV A;  1MJA A;  2QZ8 A;  1FPQ A;  4P55 A;  4GO1 A;  4EM0 B;  3WTW C;  2DPD A;  3LQR A;  5CVR A;  1OYI A;  5H20 A;  4ZYG A;  3R4K A;  4L9J A;  5BPI A;  5D6F A;  4G9Y A;  1MJB A;  1ODD A;  1T2K A;  2V1X A;  1FYL A;  3F22 A;  3QAH A;  1W7P D;  2MA3 A;  2ZNZ A;  1YYV A;  4MNU A;  2IA1 A;  4AIK A;  4KMF A;  3R6S A;  1S29 A;  1ZG5 A;  3DXJ F;  1LB2 A;  1FWZ A;  2QQB A;  3R0J A;  2DFI A;  3Q9V A;  4ETS A;  1YS6 A;  2JTV A;  1XD7 A;  4G6D A;  2QQA A;  2M5W A;  3KP2 A;  3I58 A;  4XBF A;  3GFM A;  2XRN A;  5L3B A;  2Z33 A;  3HSF A;  3QP5 A;  1XMK A;  5DV5 A;  1P4W A;  5LHG A;  2Q2E A;  2KJB A;  1XGS A;  5EEG A;  5LHH A;  3MEX A;  2P5V A;  4M6Y A;  5D5X B;  4MTE A;  2NYX A;  4ESF A;  2BV6 A;  2EV6 A;  3FM5 A;  3O3K A;  5LGN A;  5IT9 Z;  2D1V A;  2IT0 A;  4Q47 A;  1CGP A;  3KEO A;  1FSE A;  4U7D A;  2NS0 A;  3E5U A;  4DQ2 A;  3ZQ7 A;  3ZN1 A;  2NNN A;  3K1P A;  4OU0 A;  2WWY A;  1G3Y A;  3RTR A;  3GXO A;  1O57 A;  2L01 A;  1B4A A;  3LA7 A;  4YFN F;  1GXP A;  1OYY A;  3WU0 A;  2ZJ2 A;  3OV8 A;  4I0A A;  5DCM B;  1ZAO A;  3LFK A;  1BN5 A;  3CUQ C;  2QBY A;  1ZRD A;  1YW9 A;  4AIJ A;  2MC3 A;  3EDP A;  4L9N A;  3BOQ A;  2FBI A;  2AS5 F;  1FYK A;  1XGN A;  1ZGA A;  3ZMZ A;  2FOK A;  2PLY A;  3BJ6 A;  4CIC A;  1TNS A;  2W25 A;  1ZYR F;  4G6Q A;  3CUQ B;  2J5O A;  2K4J A;  3TOB A;  5HLH A;  4I98 B;  1I6X A;  1KU2 A;  3D5L A;  3LA3 A;  2Y0M A;  2H09 A;  1IRF A;  5CJ9 A;  4QWQ A;  4EM1 A;  2W84 A;  2H94 A;  3QU3 A;  2STT A;  4WF2 A;  3RDI A;  5LBQ A;  3P7N A;  3WU1 B;  2PI0 A;  4I2O A;  1FLI A;  4I02 A;  5HDN A;  2W85 A;  1KGS A;  1J5Y A;  2RKH A;  3O6B B;  2OU2 A;  3GO5 A;  1BC8 C;  3GZ5 A;  2O8X A;  4EGY A;  4ON0 A;  5FFZ A;  1O7F A;  4EVI A;  1P92 A;  4M73 A;  3D0S A;  2FXA A;  3ZMU A;  1UST A;  1KQ8 A;  3H3U A;  3L09 A;  2E1C A;  2MH9 A;  3B73 A;  2H6C A;  4WK8 F;  3W6K B;  1XN7 A;  2EJR A;  4HAM A;  2OAZ A;  4UXN A;  2YPR A;  3I4P A;  5LGU A;  3ZMS A;  2O3F A;  5TRD A;  4EMS A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...