1SD6A

Crystal structure of native meci at 2.65 a
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
119
structure length
119
Chain Sequence
TYEISSAEWEVMNIIWMKKYASANNIIEEIQMQKDWSPKTIRTLITRLYKKGFIDRKKDNKIFQYYSLVEESDIKYKTSKNFINKVYKGGFNSLVLNFVEKEELSQDEIEELRNILNKK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structures of the BlaI repressor from Staphylococcus aureus and its complex with DNA: insights into transcriptional regulation of the bla and mec operons
pubmed doi rcsb
source organism Staphylococcus aureus
molecule tags Dna binding protein
molecule keywords Methicillin resistance regulatory protein mecI
total genus 37
structure length 119
sequence length 119
chains with identical sequence B
ec nomenclature
pdb deposition date 2004-02-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03965 Penicillinase_R Penicillinase repressor
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 1sd6A01
1.10.4040.10 Mainly Alpha Orthogonal Bundle Penicillinase repressor fold Penicillinase repressor domain 1sd6A02
1USTA 2Z9OA 2XAGA 3SXYA 1T6SA 2J5PA 4XSZF 3P9IA 3JSOA 1Z7UA 4K2EA 1TTYA 4ESFA 3GFMA 5CVRA 2E1NA 3E6MA 3GYHX 2ELHA 2LSOA 2FEZA 4NB5A 4Y15A 1TNSA 2STWA 3D5LA 3GWZA 4MTDA 4HDUA 5BPDA 6PAXA 2W24A 3HYIA 5L3EA 4L9NA 2M87A 3WTUC 2LF8A 2Z5UA 5HDGA 2OZ6A 4UNOA 2H27A 4O5VA 1ZARA 1W7PA 5TRDA 2W85A 4CO8A 4HF2A 3P9CA 4IJAA 4PGGA 2A07F 5D4RA 2NYXA 5D4SA 4FX0A 3T8RA 2KRFA 4LGWA 2JPCA 1U3EM 5ERIA 2K7LA 4UVBA 3ZP5A 4PGHA 1MGTA 3OOPA 5DEQA 2YX4A 4L9VA 3SFZA 3ZMDA 3GFLA 3L09A 2A68F 2PMHA 1G4DA 4A6EA 4OIPF 2P5LC 4A0YA 1REPC 4RGSA 4CGZA 2J5OA 4BHCA 4WK8F 5F64A 4TV7A 1ZN2A 2QLZA 3LQRA 4G7OF 4R8HA 2HFHA 1T98A 2MH2A 1FT9A 2O8XA 1AOYA 4EVIA 2RQPA 1FC3A 3QAHA 2HKXA 3E3VA 2MD5A 3V8LA 1HW2A 1RZ4A 3C18A 3FXUA 2BE5F 5J6XA 1S7AA 2QWWA 2NRAC 3HTSB 1R36A 2QVOA 4MQVA 1HSTA 1XGOA 4RGXA 4WWCA 3G3ZA 4M74A 2XV4S 5HDNA 3QOPA 2GAUA 4QWQA 4XLNF 3CUQC 3U9GA 1KU9A 2EV5A 5DV5A 4HW0A 5HVQC 2DQRA 1W4MA 3L9FA 1ONVA 3HSEA 4IXAA 3ERED 3L00A 1J0RA 4GYGA 2PFBA 3FMRA 3REOA 1G3SA 1Y0UA 1ZYRF 2QM3A 2DAOA 2KJBA 1TW3A 1J59A 2GA1A 1U8RA 5LRRA 1HKQA 3ZMSA 2K4BA 1F9NA 2GXBA 1O3RA 3COAC 5IT9K 2GIVA 3WGHA 4Q48A 2F5DA 2DK8A 1OR7A 4HQEA 2Z33A 3HRSA 2HZTA 4BQAA 1TLHB 4AIKA 5JI6A 1S29A 3CLOA 5E1WA 1TQIA 2K4JA 2ISZA 2VT3A 1HW1A 2XASA 4AIHA 4LJZF 1FBSA 3HOTA 1OKRA 4CICA 1FP2A 1IN6A 3ABTA 3EUHA 3Q9VA 3TO9A 4ZZDA 4KN7X 2MLKA 3DXJF 4LB5A 2HQNA 5DUKA 1OPCA 4OIOF 1BBYA 4KIBA 1CF7B 1YO5C 4KDPA 5DUIA 3PQKA 2DBBA 3F8NA 3EYYA 4DNCA 4ASNA 1J2XA 1XGMA 3MWMA 3R61A 4B09A 1ZREA 2PLYA 2CG4A 1T2KA 1K78A 2CWEA 5D5XB 1ODDA 3RKYA 4MEYF 2ZFWA 2ZXJA 2ZMEA 3I71A 4RB3C 1I27A 4MHGA 4H0EA 3V8KA 3HRUA 3ELKA 1IF1A 4S04A 4N9IA 3RDIA 4GXOA 5H20A 4PDKA 4M6XA 2DFIA 1QQIA 1WKMA 4EQQA 1JHHA 1BI0A 3DV8A 2RKHA 2FA5A 4G6DA 3WTZA 2F5FA 3N97A 1ZLKA 1TW2A 5L3FA 2P6SA 4HDVA 3KP4A 3EDPA 1IN8A 4YIIA 2V6CA 2XKPA 3GFIA 3GEZA 5LLQA 1ZG5A 1ZAOA 1FY7A 1F1ZA 3TOAA 1T39A 2ISYA 4E70A 1JHFA 1R5HA 1HW5A 2PEXA 2FOKA 4ENNA 2OZUA 1SD7A 2FU4A 3BJOA 3IKVA 2ESHA 3E5XA 1R5GA 4AIJA 1WRJA 3GO5A 3LWFA 2VN2A 5CVUA 5KVRA 1XCBA 4U0WA 2JT1A 3BJAA 2D1VA 2QBYA 2IA2A 4OMYA 4YFKF 4OMZA 4F7ZA 1FZPB 3ZMUA 2XROA 3K9TA 3I53A 4M6YA 3LAPA 2XKOA 2E7WA 1CGPA 1HQCA 3IKTA 2AS5F 1G3YA 5LEJA 2VONA 2X0LA 1XSDA 3J7AO 2EV6A 4LG0A 4IF4A 5E1XA 3KLOA 3K2ZA 5DCMA 4RS8A 2UXNA 1XB4A 3KP6A 3W6KB 1D8JA 3I54A 1KQ9A 4RAZA 1SAXA 1GVJA 3JTGA 1IAWA 1ZRFA 1MD0A 3ROUA 4HX7A 4S05A 2V79A 4KT5C 2P7VB 4OINF 5LEKA 3S2WA 3HHHA 1T0FA 4Q47A 2IRFG 2VC0A 4AD9A 4R79A 2M1BA 3H92A 4HYEA 5D5UB 1YW7A 5D8KB 3B73A 5JR3A 2HTSA 4R1HA 3DQVC 1XMAA 3PFIA 3T1BA 1R58A 1X3UA 2CO5A 4BNCA 1KQ0A 1U5TC 2A69F 1I1GA 5JHUA 1B4AA 1QPMA 2A61A 4ENKA 3RPQA 4L0YB 3GW2A 3I59A 3R4KA 3I5UA 3F23A 3BWGA 2ZCWA 5H6QA 2Y75A 3J80Z 4A5MA 3CUQB 2LKPA 3T0YA 1OYIA 1OYWA 2EFQA 3I0TA 1EH7A 4N0BA 2F2EA 5EEHA 2PN6A 3WTTC 4LD5A 2QYOA 2H09A 1J7KA 3VOEA 3JAMK 1D8KA 2CGPA 3HRTA 3C3WA 3GLXA 3TO6A 1UHMA 2EV0A 2ZNYA 1KU3A 4G6QA 5ICGA 1C0WA 4IHSA 1F4KA 1LB2A 4U0VA 3M9AA 1LQ1A 4CDGA 3V7SA 5DDGA 5TJJA 3WODF 2DK5A 1XN7A 2VC1A 1H0MA 2A3SA 2VBYA 4A12A 3DPTA 2Z99A 1MZBA 1BI3A 4FT8A 4UVAA 5FB2A 3FX3A 3RJPA 3I64A 3N4MA 2MC3A 3I58A 5D5WB 1YYVA 1B1BA 5BPIA 1ZG1A 5D6EA 5CVIA 4ZYDA 2YSRA 3IWZA 2RGVA 4YFNF 3RTRA 2RVCA 2MA3A 2R7FA 4LB6B 2DPDA 3ZMTA 1W5SA 2JSCA 3ZMZA 1LDDA 5K5OA 3KP7A 2FE3A 3J81Z 2K86A 3LQQA 3LA3A 4MGRA 1ZRDA 1LDKB 3JSPA 2YX7A 5ED4A 5FFXA 1IN5A 2IT0A 4ZZLA 1DDNA 2OQRA 4HBLA 1XGNA 2E7XA 1SFUA 3T8TA 3E6BA 4M9SA 4A0XA 2QQ9A 5K5RA 1YW8A 4CHUA 2WV0A 2JRTA 2XGXA 4I02A 2HWVA 4RGRA 5CJ9A 1XGSA 3V7CA 4P96A 2YU3A 3K69A 2V9VA 4CZZA 3P9KA 5LHIA 1Z9CA 2VOOA 3IWFA 4FHTA 4ESJA 2FXAA 1FYMA 1GHCA 2XRNA 4BAYA 1LEBA 3HOSA 5E17F 2ZNZA 3R6SA 1IXCA 2M30A 4G7HF 5HLHA 3TGNA 3QRFF 2FMYA 2TDXA 4PZJA 3ZPLA 2VT2A 2L01A 3FMSA 1BOAA 2A6HF 4RB0A 1ZG3A 5E1ZB 5HOOA 3RKWA 1J75A 3KZYA 1GXPA 3GFJA 2D2WA 1O7FA 5L3CA 5CVJA 3IRQA 1Z05A 1KQ8A 3F8CA 1W5TA 4EM0B 1U6GA 3EQLF 4CYDA 3ISPA 2LNBA 2G7HA 1BI1A 1JE8A 4UHTA 4GGGA 4AWXB 4HQMA 1B9NA 3HTUA 4ZYEA 1TQMA 4ZYHA 3RI4A 1PDNC 1OMIA 1YS7A 3KCCA 3VODA 4HZFA 1RNLA 1P4AA 4HV5A 1SD6A 5FLXK 1G3WA 3Q5FA 5K1YA 1PUEE 1U2WA 3T5XA 1QNTA 3QP5A 3FHZA 4LLGF 4A2UA 2ETHA 2QUFA 4KYWA 3V4GA 3V7RA 1P4WA 4P9UA 4BYYA 3BDDA 1XCVA 3SHFA 2W25A 5HLGA 3R0AA 3I59B 3ZMVA 5FGMA 1I1SA 2L4AA 2F5EA 1BIBA 3GF2A 2Q8KA 4ETSA 1B6AA 1HSJA 3SZTA 1P2FA 4A5NA 1XSVA 5DCMB 2DT5A 4HF0A 4WCGA 1P4XA 1BIAA 3DF8A 1LDJA 2BEOA 1O57A 3MFKA 3NEUA 2O0YA 3J81K 2PG4A 5ILVA 2Z3YA 4KICA 4UVCA 3TQNA 3FXQA 1BI2A 3K1PA 2HOEA 2ZKZA 2BBYA 1MJAA 1IRGA 5BS6A 2CW0F 3NQOA 2D45A 1RIOH 3KP5A 1FYKA 2RDPA 3L7WA 4HX4A 1XSXA 2DO7A 2PMUA 4KIFA 1VTNC 3CUOA 2HGCA 5CYVA 4WX9A 1I6XA 3IL2A 2P6TA 4I7HA 1FPQA 4Q4ZF 4JK1X 1FLIA 2HYGD 1Z6TA 1DPUA 2EJRA 2CFXA 3HRMA 2KIMA 2FSWA 2ZBKA 4RAYA 2A5YB 5ILUA 2NS0A 1CF7A 4Y13A 2PBIA 2OU2A 5ICCA 4EJWA 2H94A 1SD5A 5EEGA 1D3YA 4NHJA 1SFXA 1ZRCA 2FF4A 5J8FA 2FNPA 1DP7P 1U5TB 2Y48A 3EYIA 2HR3A 5FFZA 3V8JA 3IRRA 2K27A 5AIQA 3P7NA 5AONA 1STZA 3KFWX 2UXXA 4FX4A 4DQ2A 1KU7A 4M73A 3MQ0A 1FP1D 2KKOA 4OU0A 4XRFA 3TKYA 2BV6A 3OV8A 1D5VA 1FBUA 2Q0OA 3GVAA 5DD8A 2GWRA 2MBFA 1RUOA 5HS8A 4OOIA 4HLXA 1UHWA 4EGYA 3LFKA 2A6EF 2IJLA 3ECOA 3F8MA 3GXOA 1QZZA 2P7CB 1S6LA 1TNTA 2IA0A 5DD4A 3BOQA 2GQQA 4G9YA 4IHTA 4LFUA 2JTVA 4PCQA 3K0LA 2DU9A 1FOKA 4BH9A 2HKOA 4M9ZA 1K6OA 4A6DA 1GXQA 5IT9Z 3RPUA 1AWCA 3FWEA 4GYIA 1SMTA 5E8IA 1UFMA 5LHHA 4MNUA 2WC2A 2STTA 1FBQA 3F3XA 3E5UA 4KN4X 3WTYC 1LVAA 1R1VA 3MZHA 2QENA 1R23A 2BYVE 3VFZA 4L5IA 4EGZA 2NNYA 2M8EA 1FWZA 2H6BA 2IA1A 5HS9A 4QLCU 3CUQA 2VBZA 4L9JA 1ZLJA 2EFNA 2O3FA 2IVMA 1SD4A 2YPRA 1TQPA 4MQ9F 4Z2YA 4KA4A 1S3JA 4AVPA 4ESBA 3DP7A 3WGIA 4RGUA 1ZH5A 4YG2F 4IRHA 5H6RA 3G73A 3R60A 3MCZA 2BGCA 1RI7A 4LLNA 1L0OC 2YR2A 3GX4X 4EM2A 3TO7A 2VBWA 1U78A 5FD5A 2HEOA 5DCFA 4KMFA 2CQKA 5BQTA 1Q1HA 1S8NA 4LMYA 5FLXZ 4YIFA 2P5VA 2L54A 3BZ6A 1MDMB 3WTXC 2D1HA 3HHGA 3Q9SA 3C7JA 3TDUC 1XDSA 3K1NA 4I98B 3LSTA 4N9HA 1LNWA 2IW5A 2EB7A 3NRVA 2P5KA 4BXUA 3CO6C 1IRFA 3KP2A 3CJNA 2IPQX 4OIQF 2UZKA 2HS5A 3RKXA 4MTEA 1FSEA 2M45A 2FQ3A 4O6JA 4LK0F 3GZ5A 5FD6A 2VOPA 3DEUA 3ULQB 2COMA 2XAFA 3JTHA 3WU0A 3H3UA 1YG2A 1G3TA 2ZMEB 1WSUA 4KIGA 2VE9A 1RUNA 2Q2EA 1YLFA 3DPLC 4B8XA 1ON2A 2WTEA 4EM1A 3SZPA 1H9TA 5BMZA 5D6FA 2RN7A 4HAMA 4CXFA 1KGSA 3W6JB 2FBKA 2Y0MA 2W84A 3BPXA 3M8EA 4UV9A 2VE8A 4HF1A 2JPBA 1FSHA 2EA4A 3HUGA 1A04A 1YQAA 2XHKA 2EK5A 2KIUA 3O3KA 3FXRA 3GZ6A 4HLYA 1B59A 4RB2C 1ON1A 2DLLA 2CSOA 3SQNA 3ABUA 2EWNA 1G6NA 2B0LA 4HX8A 2OBPA 4WF2A 3ZN0A 4IPAA 1IXSB 5E8GA 1DPRA 2HYFA 2HDCA 2UWMA 4M71A 2V1XA 2P8TA 1XDUA 4KNYA 4D0PA 2EFWA 3FF5A 2KJCA 3WTSC 3CDHA 1IN7A 4WXHA 4ENMA 1EH8A 2ESNA 3M1EA 3ZN1A 5ILSA 4GO1A 3F6OA 4IVNA 4U0YA 4ZYGA 5D5VB 2QQAA 4EJTA 1R22A 4HA8A 3WU1B 4P9FA 4EMSA 5ICEA 1EH6A 4A0ZA 3QP6A 1UCRA 4UV8A 3KZZA 3WGGA 4ON0A 4MEXF 2FNAA 4G7ZF 2FMLA 4UUVA 1L3LA 1KA8A 2DPUA 4I0AA 4M72A 1QBJA 1OYYA 3PQJA 2X4HA 3E6DA 2RV8A 2P4WA 5CLSA 5IT3A 3IHUA 1P92A 3F72A 2O6GE 3C1DA 3DFGA 2DW4A 3TOBA 1W7PB 1YS6A 1JGSA 3KEOA 5AIPA 3E6CC 2XAJA 5LBQA 3QPTA 2JZYA 3KP3A 1FNNA 1K7AA 3FMQA 2V1DA 4I0BA 2ACJA 2XIGA 2ADUA 1HKSA 3AAFA 5J8CA 1QGPA 2W57A 2QBYB 4L9TA 3F21A 2WWYA 3R0JA 3VEPA 5K5QA 1S7OA 3ZQ7A 4I2OA 4P5OA 3JAMZ 2QQBA 1Z1DA 3BY6A 3HSRA 3O6BB 3D0SA 4LLLA 4WXDA 2NNNA 2PI0A 5LGUA 5LHGA 3BP8A 3WTWC 5DYMA 2MLGA 3WE3A 4LG0B 2O03A 2OD5A 1ZHFA 5LRSA 2NAZA 2XVCA 1KYZA 1BJAA 4YFXF 4KUMA 5F6FA 5KK1A 4JBAA 4G94A 2F5CA 3J80K 1WI9A 3IC7A 1W7PD 1FX7A 1E17A 1JXSA 3KLNA 2EFPA 3U2RA 5A2QK 2HQRA 1USSA 1HBXG 3KETA 5L3GA 1MJ9A 1FYLA 4OIRF 4GCVA 4L18B 1Z91A 1TBXA 2R7DA 2VODA 3B02A 1O3QA 1K79A 5ICFA 3F8FA 1IZ1A 5FO5A 2XAHA 4P55A 2G9WA 4U7BA 2C6YA 5E20A 3VB2A 2GA2A 1I5ZA 2LDUA 1YIOA 3BROA 4KFCA 3GUDA 3ML6A 1QO0D 4ENJA 4BHPA 4EJVA 2XUBA 2QZ8A 5HS7A 5JFRA 1KU2A 1O7LA 2OA4A 1J9IA 3I4PA 2O61A 4L0ZB 3MAJA 4NQWA 2R3SA 1H9GA 1LJ9A 2L3DA 2E1CA 5E18F 2M5WA 2KIFA 1SFEA 3F22A 3O2PE 3LA7A 3BPVA 3RYPA 2CYYA 1ZGAA 1B9MA 4WXCA 2PJPA 4I01A 1HXDA 2H6CA 1E2XA 2ZO4A 4U7DA 2VBXA 4RB1A 2DI3A 2EA2A 3ECHA 4O3MA 1KYWA 5CVVA 3JW4A 3U1DA 1BC8C 1QZYA 3F8BA 2OQGA 5HLIA 1V4RA 4IRGA 1R1TA 4I09A 2VXZA 1SMYF 2RC4A 3F6VA 3QU6A 1LEAA 1IUYA 1Z6RA 4Y17A 3RYRA 3FZVA 3QU3A 1IXRC 1U5TA 4U88A 2GZWA 2EFOA 4EJUA 2HTJA 1ZGJA 1V3FA 1P6RA 2GXGA 1R1UA 1R00A 1HKTA 1R7JA 3FM5A 2FBHA 4JQFA 3E97A 3WG9A 2G7UA 3FM3A 2V1UA 1NHAA 4G8XA 3KEQA 1YFHA 3QPHA 2FRHA 5HDKA 1O3TA 2FBIA 4XLPF 4LK1F 1O3SA 2ZJ2A 1BM9A 3TDZC 2L02A 4BHBA 3M8FA 4HOBA 5F1RA 3LAJA 3L2CA 4L5JA 3WTVC 2PQ8A 4IRIA 1WWXA 2L4MA 3HIFA 1ULYA 1BC7C 3MEXA 1YW9A 4XSXF 5D8LB 2RNJA 2XAQA 4Q5SF 3K1MA 4UXNA 3M7GA 2K02A 3CTAA 4HV6A 1MDMA 5LGTA 2IP2A 3E5QA 5A2QZ 4XBFA 1F5TA 2MH9A 3HSFA 5LGNA 3H3ZA 4M9XA 1EV7A 1PP8F 5L3DA 2LF7A 3WE2A 2OAZA 1IN4A 3BJ6A 1YTYA 1J5YA 4ZH4F 3MZYA 3LA2A 1PP7U 1DUXC 2AXLA 2DTRA 2DQLA 1BN5A 5BOXA 1IW7F 1K78B 1UB9A 3EETA 1T38A 4EJOA 5L3BA 5JVTA 1XMKA 1WQ2A 3KE2A 1MJBA 1MKMA 1XD7A 4EV0A 3DKWA 3CO7C 4KMUX 3RIRA
chains in the Genus database with same CATH superfamily
1ETYA 4BXXJ 1USTA 4B44A 4BQOA 4LG3A 2Z9OA 2FQ4A 2XAGA 4X1EA 5C4JJ 1X4PA 4MFEA 1OR7C 2O9LA 3M1CA 3SXYA 1T6SA 1HF0A 2ZXWH 2J5PA 2JSPA 4XLAA 4XSZF 3P9IA 4CSWA 3JSOA 1WVRA 1X3ZB 3IAS2 1Z7UA 4K2EA 1TTYA 4RM3A 2XRLA 4ESFA 3GFMA 2LY2A 3BZKA 5CVRA 2E1NA 2R7RA 1OCPA 3E6MA 2ELHA 2LSOA 2FEZA 3LSKA 3LSIA 4NB5A 4Y15A 2V9PA 1TNSA 1N77A 2STWA 3D5LA 3GWZA 1U8BA 4MTDA 2DOFA 4HDUA 2AXTC 5BPDA 1UAAA 6PAXA 1D1CA 2LBFB 3SYTA 2W24A 3DPUA 3HYIA 1R9TJ 5L3EA 3VYTB 4L9NA 2I10A 2M87A 3A2KA 1MNMC 2Y30A 3WTUC 2LF8A 2Z5UA 5M3FJ 5HDGA 2OZ6A 5TGTA 4UNOA 3GTLJ 1JKOC 3EUKL 4XKCA 2H27A 3FBNB 4O5VA 1ZARA 1W7PA 2W7NA 5LD2C 1T8IA 1MW7A 2I8DA 5TRDA 4MFDA 2W85A 3H9QA 4CO8A 4HF2A 3P9CA 4KITB 2KFDA 4IJAA 4PGGA 3H0DA 2A07F 3OIQA 2NYXA 4PFPA 5D4SA 1OCRH 4FX0A 5D4RA 3SFIA 3T8RA 2KRFA 4LGWA 2JPCA 5ERIA 1U3EM 2PMZN 3A02A 2K7LA 4UVBA 3ZP5A 4PGHA 3BZCA 1G8XA 1X1BA 5J40A 1VI0A 2W4SA 1MGTA 3OOPA 2EZLA 2VIXA 1ZKGA 5DEQA 2YX4A 4L9VA 4HG2A 3KPHA 3SFZA 3ZMDA 3GFLA 3L09A 2A68F 2Z1DA 4XICA 2PMHA 1G4DA 2R5ZB 4A6EA 4OIPF 2MYSA 2P5LC 4A0YA 1REPC 1D0YA 1F36A 1ZTRA 2MFZA 4RGSA 1RKWA 2J5OA 3HBLA 4CGZA 3FXLA 4BHCA 4UUSB 4WK8F 5F64A 2KHMA 4TV7A 2L0KA 1ZN2A 2QLZA 1LFUP 1WI3A 3LQRA 4G7OF 2XGDA 4R8HA 2HFHA 1T98A 5EG0B 4E7JA 2MH2A 1FT9A 5F0FA 2E35A 1B72A 2O8XA 1W1WE 5GTIC 1AOYA 4AU7A 4XKVA 2DA6A 4EVIA 2RQPA 2LD5A 2R93J 4AC0A 1FC3A 3QAHA 4NC8A 2HKXA 4LIVA 4PSWA 3DLAA 3H5AA 3E3VA 4XLCA 1V5EA 1X3WB 2MD5A 3V8LA 1VNDA 4CZCA 1HW2A 1RZ4A 3C18A 3ASNH 3D5RC 4EATA 3FXUA 2BE5F 2F5VA 2COBA 5J6XA 1ZGWA 1S7AA 3C2BA 3CMMA 1NK2P 2QWWA 3OS2A 5E79C 2AO9A 4CYCA 5EDNA 1ITYA 3PSIA 3GTOJ 3PNYA 2L2OA 2NRAC 3HTSB 3OYFA 1R36A 2QVOA 3ONQA 4MQVA 1HSTA 1XGOA 4RGXA 2ZJRF 3I9V2 2MC4A 4II2A 4D5CA 4HNUA 4WWCA 3BTJA 3G3ZA 3CCQI 3ZQCA 4M74A 2XV4S 5HDNA 3QOPA 2GAUA 4QWQA 4XLNF 3GBGA 2DODA 2LVSA 3FKIJ 2GBYA 2LBFA 4ZTFA 3TP3A 5E3OA 1B8IA 3CC7I 2BXZA 3CUQC 4B4CA 3U9GA 2DOAA 1YIJI 1KU9A 2LTPA 3GTPJ 2EV5A 5DV5A 3IP4B 2VKDA 5IP6A 3OR2C 2NVQJ 4HW0A 5HVQC 2DQRA 1WJ5A 1W4MA 4BGDA 3IUOA 4BEHA 3L9FA 1ONVA 2DMPA 4HSTA 1A5JA 3HSEA 2A6TA 4IXAA 3ERED 3S1MJ 3L00A 3BG9A 3PNTA 1J0RA 2FD5A 2PFBA 3FMRA 4GYGA 3JRHA 3REOA 1G3SA 3HM5A 3LNQA 1Y0UA 1ZYRF 2QM3A 1E3OC 2DAOA 2KJBA 1Y0NA 1TW3A 4M3FA 3JRGA 1J59A 2GA1A 1U8RA 1FJLA 5LRRA 3MD2A 1HKQA 3ZMSA 2K4BA 1F9NA 3OY9A 4BACA 2EINH 2HU9A 2GXBA 1O3RA 4RLQA 3COAC 3IH2A 2DYSH 5IT9K 2GIVA 3GTQJ 5EEAA 3WGHA 4Q48A 1E3PA 2F5DA 4BQNA 2JUGA 3CCJI 1VQOI 5E3LA 5FKLA 3DTIA 2DK8A 1OR7A 1JTXA 1NG7A 4HQEA 2Z33A 3OOUA 3HRSA 2IXSA 2HZTA 2VASA 2OF7A 1TLHB 3CCVI 2IGKA 5JI6A 4AIKA 4BQAA 2IAIA 1WHUA 3RCOA 1S29A 5KCMA 1WJEA 3CLOA 5E1WA 2K40A 1TQIA 4FQGA 4HRIA 4JX4A 2K4JA 3UNGC 4F91B 5FKKA 3MN2A 5IP9J 2K9SA 2ISZA 2VT3A 1MMSA 3H0GJ 1HW1A 2XASA 1TC3C 1QPIA 2VQCA 4AIHA 2ZXIA 4LJZF 1FBSA 3HOTA 2CV0A 1OKRA 4CICA 1FP2A 2OPTA 5FRNA 2KMUA 1IN6A 3ABTA 4D1QA 5IPAA 3HKZN 2DA3A 3EUHA 4AYBA 3CLQA 2IS4A 2ZFUA 3D5SC 3Q9VA 3TO9A 4ZZDA 1TZLA 3L2UA 4KN7X 3A1YA 3FBIB 2MLKA 4BY1J 2VKHA 3DXJF 4LB5A 2HQNA 4RLFA 3C2HA 2VI6A 5DUKA 1OPCA 1T0FC 3B6CA 5FLVA 4OIOF 1BBYA 2B63J 4KIBA 1CF7B 3LSPA 1YO5C 4KDPA 5DUIA 3PQKA 2DBBA 4JOMA 5FROA 3F8NA 3K4KA 3EYYA 4HEA2 4DNCA 2HDDA 4ASNA 1J2XA 4RAFA 2CQNA 1XGMA 3MWMA 3R61A 4B09A 1ZREA 2PLYA 1GV2A 2CG4A 2JVGA 1T2KA 1K78A 2CWEA 3FK7A 5D5XB 1ODDA 1LUJB 1DU6A 3RKYA 4MEYF 2ZFWA 2ZXJA 2ZMEA 3UKGA 2DMUA 3OWTA 1R4NB 4A3GJ 1XX5A 1W36C 2V7FA 4PUSA 3I71A 3VYUB 4RB3C 4GDFA 1I27A 4MHGA 3I4MJ 4H0EA 3V8KA 3HRUA 3ELKA 1YJWI 3WHBA 1IF1A 4S04A 4N9IA 4F3QA 1APLC 2R7XA 2EPFA 4XR6A 3RDIA 1YJ9I 4GXOA 3N05A 4U87A 4XQFA 3K4MA 3S3NA 3OIPA 1X2NA 1OCTC 2HNHA 4D7MA 5H20A 1ENHA 4PDKA 4M6XA 2CV2A 2DFIA 1QQIA 1WKMA 4EQQA 1JHHA 1TP4A 3LSJA 4W1UA 1BI0A 4IHVA 3DV8A 2RKHA 2L7KA 2FA5A 4G6DA 3OYDA 3WTZA 2ECCA 2F5FA 4CCOA 2E2JJ 3PIOF 2WAFA 3N97A 5GTHC 1ZLKA 4XNFA 1TW2A 1SVOA 5L3FA 4M6VA 2P6SA 4ITVA 3CF5F 3S2DJ 4V2GA 3ZQGA 4HDVA 4NC6A 3KP4A 2E36A 3EDPA 1IN8A 3O8GA 2QSHX 2BHYA 4YIIA 2V6CA 3F9KA 2H1LA 2XKPA 3GFIA 1IUFA 3GEZA 5LLQA 4FE7A 3ABKH 1ZG5A 1ZAOA 1FY7A 4V19K 1F1ZA 3TOAA 1T39A 5KNLA 2ISYA 4E70A 1JHFA 1R5HA 1HW5A 2PEXA 3AKZA 2XB5A 2LY1A 2GM4A 2FOKA 4ENNA 2OZUA 3H35A 1SD7A 2FU4A 2NOJB 3BJOA 3J7ZI 1JKQC 2VQLA 1NG6A 4XRMA 1GLNA 1IV6A 3IKVA 3M4OJ 2ESHA 4IOCF 3FIWA 1D1BA 3E5XA 3IH4A 3OYBA 4BDZA 2CH0A 1R5GA 1WRJA 4AIJA 3GO5A 3LWFA 2VN2A 5CVUA 1V5FA 5KVRA 4QSHA 3S1QJ 1BJZA 1Y1VJ 1TWCJ 3MKLA 1IJWC 4A3KJ 1XCBA 4U0WA 2JT1A 4BUPA 3BT9A 3BJAA 1ETQA 2D1VA 2QBYA 2ECBA 2XDVA 2IA2A 1XC5A 4F7ZA 4YFKF 4OMZA 4OMYA 1MMDA 2V9KA 1FZPB 3ZMUA 2XROA 3K9TA 1VQ8I 3HDDA 1IV8A 3I53A 3H9GA 4M6YA 3LAPA 2XKOA 2F4OB 2E7WA 1CGPA 4ZDOA 1HQCA 2EIMH 3IKTA 2AS5F 1G3YA 4ZTJA 5LEJA 1EJ9A 2X0LA 1XSDA 2VONA 2R7VA 2VPRA 3J7AO 1UZCA 2EV6A 4IZZA 1S9HA 4IF4A 4LG0A 5E1XA 3M8JA 3KLOA 3K2ZA 3C2GA 5DCMA 4RS8A 1X58A 1K6YA 2UXNA 1XB4A 2K5CA 3KP6A 3LL7A 3VSKA 4XMYA 3W6KB 1D8JA 3I54A 2XF7A 1KQ9A 2AQFA 2VQHA 4RAZA 2ZB9A 1SAXA 3QYFA 1AKHA 1GVJA 1UJ8A 2WB1A 3HZJA 3MZ8A 4FISA 4IEJA 3I4NJ 3JTGA 1IAWA 4JX6A 1ZRFA 1MD0A 3ROUA 3VSLA 4HX7A 3OIOA 1GT0C 4S05A 2V79A 4KT5C 1FIPA 3CCYA 1IC8A 3HPGA 3TEDA 2P7VB 2ME6A 4OINF 2F4IA 1GDTA 5LEKA 3S2WA 3J7AY 2JMWA 3GMEA 3HHHA 1MH4A 2DJNA 1T0FA 2HQ5A 4Q47A 2IRFG 2VC0A 1V54H 2KP6A 4AD9A 2M4GA 4HSRA 4R79A 4A3CJ 4PJJA 2XF6A 4ANJA 1N75A 5B3SH 4F92B 2M1BA 3H92A 1Y1WJ 5CKTA 4HYEA 4MLOA 5D5UB 1YW7A 5D8KB 3B73A 5JR3A 2HTSA 3OYHA 2R0QC 3OS1A 4E7HA 4XORA 2EIJH 4R1HA 1PVEA 2XB0X 3DQVC 1XMAA 3GCMA 3MKYB 4IL6C 1X4OA 1ZQ3P 3S14J 3PFIA 3T1BA 1WZ2A 5F08A 3CCMI 1VQLI 1R58A 1NH3A 1X3UA 2CO5A 1T33A 2X1EA 4BNCA 1KQ0A 1U5TC 2WB1N 3SDBA 5IP7J 2A69F 4M3GA 1XTAA 5K7FA 1I1GA 5JHUA 1B4AA 1QPMA 2A61A 4ENKA 3RPQA 1X1AA 4L0YB 3GW2A 2MABA 1MMNA 3I59A 3R4KA 2R7ZJ 2ID3A 1DQUA 2XPWA 3I5UA 2DDAA 3F23A 2JUCA 3BWGA 2DOEA 2ZCWA 1VQMI 2HPMA 3ZR8X 4FETA 5H6QA 3CMYA 4V2FA 2Y75A 3J80Z 4A5MA 3CUQB 2LKPA 4XLHA 3T0YA 1FIAA 1OYIA 1OYWA 1WH5A 2EFQA 2ELKA 3I0TA 2R5YB 1CQTA 3H5RA 1EH7A 4N0BA 1TWAJ 3CD6I 2F2EA 5EEHA 3KYDB 2PN6A 1YI2I 3WTTC 2EIKH 3G1LA 4J00A 4LD5A 2QYOA 2H09A 1J7KA 3VOEA 3JAMK 3L1PA 3CCRI 1VQ4I 1OISA 1D8KA 2CW7A 3K10A 5FJ8J 4JP0A 2CGPA 3F0CA 4RDUA 3HRTA 4BBRJ 3OSGA 3C3WA 3LSHA 1ERDA 3GLXA 2UV1A 3TO6A 2CW8A 1UHMA 2NS8A 2EV0A 2ZNYA 1KU3A 4G6QA 1GV5A 2M4KA 5ICGA 4UUTA 3S15J 1C0WA 3OYEA 3DKXA 4IHSA 3K4JA 4HNTA 1F4KA 1LB2A 4U0VA 4C2MJ 3M9AA 1LQ1A 4CDGA 3V7SA 4AVZA 3K4BA 5DDGA 5TJJA 2ZSIB 2VB6A 3WODF 2DK5A 1XN7A 3G2BA 2VC1A 1H0MA 2A3SA 2VBYA 1UG2A 5TISC 4A12A 2MD0A 3DPTA 4II3A 5IY5H 4IKFA 3CDIA 3KYCB 3PUFA 2Z99A 3BR3A 1RPWA 1MZBA 2OUMA 1BI3A 1IRZA 2X6XA 4OWRB 1Y8QB 5J4YA 3GTMJ 4YELA 4FT8A 4UVAA 3G6EI 3FXKA 4BJ5C 2ID6A 5FB2A 3FX3A 5M5YJ 3RJPA 3I64A 3N4MA 2MC3A 3I58A 5D5WB 1MNDA 3CCSI 1YYVA 1B1BA 3HOZJ 4IO9F 3OYIA 2WADA 1YITI 5BPIA 1ZG1A 5D6EA 4I6ZA 5CVIA 4ZYDA 1YX5A 2EH3A 2RNGA 2YSRA 3DU5A 3IWZA 2KLOA 5JLXA 2Y31A 1LPQA 1BA5A 4NUBA 4KISA 2QF7A 1IDZA 3BTLA 3HB9A 2HVSA 1UG0A 2RGVA 4YFNF 4C2TA 3RTRA 2PJRA 2VQGA 1VFCA 1JGGA 2RVCA 2MA3A 4A3LJ 2R7FA 3O8HA 4CCKA 4LB6B 1IRXA 3AL0C 2DPDA 1RETA 2DCEA 3ZMTA 1W5SA 4B47A 2JSCA 3OL3A 3ZMZA 1DGWY 3ZQIA 1LDDA 3LSGA 5K5OA 1HOMA 2LLKA 3CJRB 2M9HA 4C2UA 5EF6A 3KP7A 2TRTA 1FOYA 2DMNA 2FE3A 3ASOH 4E7LA 3J81Z 2JWTA 1S72I 2DMQA 2K86A 3LQQA 3LA3A 3U21A 4MGRA 1ZRDA 1LDKB 5HNHA 3JSPA 1MMAA 2YX7A 3MVPA 2TCTA 3DBLB 5ED4A 5FFXA 1IN5A 2IT0A 4ZZLA 1DDNA 2OQRA 4HBLA 4DYRA 2HI3A 1HLVA 4YEJA 2EQRA 1XGNA 5DTDA 1WJBA 2E7XA 3BG7A 2OV7A 1SFUA 4Y33A 2IGOA 5EYRA 3E6BA 2LRDA 4M9SA 5KAIC 3RSNA 3T8TA 5FKMA 3TW6A 4A0XA 4M3DA 3DCFA 2QQ9A 3EPZA 3LOCA 4XN3A 5K5RA 5J4VA 1YW8A 3LSMA 2KPMA 4CHUA 3HKZA 2M7BA 2WV0A 2QSGX 2BZTA 2JRTA 2XGXA 3K4LA 3W2AA 3L2VA 3NWSA 1MNEA 3A4CA 4I02A 2HWVA 4L5EA 3HPHA 4RGRA 3K4CA 5CJ9A 1MBEA 1XGSA 3V7CA 4P96A 1NK3P 3HOUJ 1Z7LA 2YU3A 2LY9A 3K69A 3ERMA 2V9VA 4CZZA 3P9KA 5LHIA 4XL9A 1Z9CA 2VOOA 1P7JA 4E4HA 3IWFA 1Y6IA 4FHTA 5JLWA 3K7AJ 4B48A 4ESJA 2FXAA 2OTJI 1FYMA 1QVTA 1GHCA 2XRNA 4XN0A 5J3LA 4BAYA 2F48A 1LEBA 3HOSA 4EEFG 5E17F 2I5UA 2ZNZA 3L2WA 2OJED 2AHQA 1OCCH 3S2HJ 3R6SA 3TL4X 3RQ4A 2KISA 1QHGA 1IXCA 1U9NA 2M30A 4DZPA 4G7HF 3BR2A 4A3EJ 2M7AA 5HLHA 1K4TA 2AQEA 3TGNA 2IS6A 3QRFF 2FMYA 2TDXA 4PZJA 3ZPLA 2VT2A 3PO2J 2DFFA 3HOWJ 2L01A 3FMSA 1BOAA 2A6HF 1WH7A 4RB0A 1ZG3A 2JA2A 3HJEA 1A36A 2O5RA 3UR3C 3DKYA 5E1ZB 3BR0A 5HOOA 3RKWA 3ZXSA 1J75A 2HQAA 3KZYA 1FTZA 3JRFA 2CU7A 3PNVA 5BNGA 1GXPA 3GFJA 5M5WJ 2H8RA 5IYDJ 2D2WA 1TWFJ 1O7FA 5L3CA 1MBKA 5CVJA 4AM3A 2ELJA 3IRQA 1Z05A 2F4MB 5IYCJ 2Y0SN 1ETVA 1BR1A 4A3DJ 1KQ8A 3F8CA 2WV1A 3I56I 1T08B 1W5TA 4EM0B 1U6GA 3ZQFA 3EQLF 4BJ6C 2BY1A 4CYDA 3ISPA 2LNBA 2BY3A 2G7HA 1BI1A 2Y9YA 4MIMA 4C3IJ 1B72B 2RAEA 1DGRM 1E3HA 1JE8A 4UHTA 4GGGA 3RQIA 4HQMA 4AWXB 1B9NA 3HTUA 2O8KA 4ZYEA 1TQMA 2XSDC 4ZYHA 3RI4A 1PDNC 2KDOA 1OMIA 5HLTA 4Y4RA 1YS7A 3KCCA 3VODA 4DZJA 4HZFA 1VZ0A 1RNLA 1J09A 2W82A 1P4AA 4HV5A 1SD6A 3G1MA 5FLXK 1G3WA 2HVQA 2KRCA 1F43A 3Q5FA 3QOEA 5K1YA 1PUEE 1I3QJ 1U2WA 3T5XA 1QNTA 3QP5A 4A2UA 4LLGF 3FHZA 4A93J 2ETHA 2QUFA 1K4SA 4KYWA 3V4GA 1HA8A 2EBIA 3V7RA 1R4MB 2BHZA 3W2VA 3SEZA 1P4WA 4P9UA 4BYYA 3BDDA 1XCVA 3SHFA 4NDLA 3HUGB 2W25A 4D5FA 5HLGA 1X2MA 2V6EA 2NVTJ 3R0AA 3OR1C 3I59B 2ME0A 2XGCA 5FGMA 3ZMVA 2JRMA 4IOAF 1I1SA 2L4AA 2YS9A 5FKOA 3NARA 2F5EA 1BIBA 3KX2A 1JT0A 2KT0A 3GF2A 3CZ6A 2HZDA 2Q8KA 4ETSA 1B6AA 1HSJA 3CMEI 2P81A 3MMYB 4M3EA 3SZTA 1EF4A 1P2FA 3HOVJ 4A5NA 1XSVA 2LP0A 5DCMB 3ZQQA 4BEHB 2FOWA 3IAM2 3OYGA 2DT5A 3JRAA 4HF0A 1JT6A 5F27A 4WCGA 1P4XA 4UY8I 3CJQB 3VWBA 1BIAA 3DF8A 1LDJA 2ICWG 3TP0A 2BEOA 2CQ7A 2QEXI 1O57A 3DBRB 3MFKA 2HXOA 4A69C 1P9QC 3NEUA 2E60A 1EKEA 2O0YA 1FOWA 3J81K 3CF2A 1WFXA 2PG4A 5ILVA 1IGNA 1VQ9I 2Z3YA 1M1EB 3H1CA 3JCUC 2H1KA 2E34A 5J47A 2L9VA 1FEXA 4KICA 4UVCA 3TQNA 3FXQA 2BXYA 3ABLH 3W3CA 1OLTA 1BI2A 3K1PA 2HOEA 4E7IA 4A3IJ 2ZKZA 2BBYA 1MJAA 4A3JJ 4Y52J 1IRGA 1PJRA 2ZXHA 5BS6A 4XOTA 2CW0F 2K9NA 3OYJA 3NQOA 4A3FJ 2D45A 4KT6A 1U9OA 2E1MC 1RIOH 3KP5A 3DTKA 4ZJZA 2RDPA 1FYKA 3L7WA 4HX4A 1XSXA 2VJ5A 4B3XA 1GVDA 1YHQI 3S16J 2DO7A 2PMUA 3PM1A 4KIFA 3CC2I 2BW3A 1VTNC 3CUOA 3OYKA 2DT7B 1ETXA 2HGCA 5CYVA 1I3AA 3A03A 4WX9A 1K83J 1I6XA 3B6AA 3ZQLA 3HC7A 2X1CA 2WAEA 5J1YA 2IGNA 3IL2A 1WGXA 3HOYJ 2P6TA 4I7HA 1JJ6C 2NVYJ 1FPQA 4X6AJ 4Q4ZF 4JK1X 1FLIA 2HYGD 1Z6TA 2QA4I 1DPUA 2EJRA 2B7EA 2CFXA 2X85A 3BQZA 2JJ7A 3FXOA 2DTZA 4FE4A 4MO7A 4PJLA 1H89C 3HRMA 2KIMA 2VPLA 2FSWA 2ZBKA 4BBSJ 5CQGA 4RAYA 3KZIC 2M8GX 2A5YB 5ILUA 4AUXA 2NS0A 4XONA 1CF7A 4Y13A 2PBIA 4QPQA 3CESA 2OU2A 2QSFX 2VKVA 5ICCA 1W36D 4C30A 4EJWA 2H94A 1SD5A 1TT5B 5EEGA 1D3YA 4NHJA 1SFXA 1ZRCA 2FF4A 2LK2A 1AA7A 5J8FA 2FNPA 1JUMA 2Y69H 1DP7P 1YRNB 2NS7A 2GLOA 5LFAA 1U5TB 1WJFA 2Y48A 3EYIA 2LMDA 2HR3A 5FFZA 5E3NA 3V8JA 3H36A 3IRRA 2K27A 5AIQA 3P7NA 5AONA 1D5YA 3PO3J 1STZA 4CH7A 4RMNA 3KFWX 1YRNA 2P0WA 3NAUA 2UXXA 4KJZA 4FX4A 1RRJA 4DQ2A 1KU7A 4M73A 2DA2A 3MQ0A 1FP1D 2KKOA 2HVRA 4C9YA 1MH3A 4OU0A 3CP8A 4XRFA 2BOLA 3TKYA 2CFOA 2DN0A 2BV6A 2X6WA 3OV8A 1D5VA 3BG3A 4DBQA 2K9QA 1YE9A 1JKRC 3DU6A 1OQYA 1FBUA 2A5WA 3FK6A 2Q0OA 3GVAA 5DD8A 2GWRA 2DMTA 2MBFA 4PJ0C 3HOXJ 1MMGA 1RUOA 5HS8A 4OOIA 5M3MJ 2G0EA 3DWLE 4LIUA 3ZGKA 1Z21A 1UHWA 4HLXA 4EGYA 4BE0A 3LFKA 2A6EF 2IJLA 2PX9A 3ECOA 3F8MA 4GFBA 5GAHJ 3CQZJ 2X51A 2K3FA 3GXOA 4PJNA 5FLMJ 1O4XA 4BE2A 1QZZA 3QYEA 2P7CB 1S6LA 2KZVA 1TNTA 2IA0A 1YJNI 2M34A 5DD4A 3DEWA 1X19A 5F0CA 3BOQA 2GQQA 4G9YA 5JHFA 4IHTA 4LFUA 2JTVA 2CUZA 3AG4H 4PCQA 3K0LA 4G12A 1OCZH 2DU9A 1FOKA 2VXDA 3E0JB 4BH9A 2HKOA 4M9ZA 1MSEC 1K6OA 4A6DA 1QZEA 1GXQA 3E7LA 5IT9Z 3RPUA 1AWCA 1DU0A 4C3JJ 3FWEA 1ZR2A 5IOZA 4GYIA 1SMTA 5E8IA 3RZOJ 1QA6A 1UFMA 3HGGA 5LHHA 4MNUA 2WC2A 2STTA 1FBQA 1N25A 3E5UA 3F3XA 4KN4X 1LVAA 1R1VA 4X0GA 3WTYC 3MZHA 2QENA 2BY0A 1R23A 2BYVE 3VFZA 2K3PA 4L5IA 1BOBA 2FX0A 3DEEA 1SVMA 4EGZA 4CCJA 2NNYA 2M8EA 1A31A 1FWZA 2H6BA 2W1OA 3HEFA 3LMMA 3RKQA 2IA1A 2LREA 5HS9A 2K85A 1ZELA 4QLCU 3CUQA 2VBZA 4DGWB 2L7FP 4L9JA 4Y3OA 2W00A 1MBGA 1ZLJA 2EFNA 2XAUA 2XGEA 2O3FA 2WA0A 2E5NA 2R5YA 2IVMA 2X48A 2MW8A 3V42A 2MGQA 3CCEI 4DW6A 4HNVA 1SD4A 2YPRA 1TQPA 3OS0A 4MQ9F 4Z2YA 5H2FC 4KA4A 1S3JA 4AVPA 5F1JA 2GOXB 1SVLA 1OFCX 1WCMJ 3BR5A 4NNJA 4ESBA 1Y8RB 1V5GA 4BKXA 1AU7A 3DP7A 3FKJA 3WGIA 1LE8B 4RGUA 3HL2A 2JQ7A 2V26A 5GP9A 4IQJA 1ZH5A 1BR2A 4PSXA 5KHDA 4YG2F 2LKSA 2IS1A 3ZRGA 3WU2C 2CS3A 4IRHA 1A35A 3VYRB 1LE8A 2FJ1A 5H6RA 4XIDA 1V55H 3G73A 3R60A 3MCZA 2VLAA 4CCNA 1W0TA 2BGCA 3ESWB 1RI7A 4E7SA 4LLNA 3CJTB 4XRSA 3LFUA 1L0OC 2YR2A 3GX4X 4BE1A 2HYJA 5J1RA 4AYBN 4EM2A 5B5EC 3TO7A 4AIDA 2VBWA 1U78A 2KL4A 5FD5A 3U1KA 2HEOA 5DCFA 2QQ8A 3FXMA 4CCLA 4KMFA 3QPLA 2CQKA 2KRHA 5BQTA 1Q1HA 1S8NA 4LMYA 5FLXZ 4YIFA 3OSFA 2P5VA 2OC6A 2L54A 1H88C 3BZ6A 2NVXJ 2A05A 1MDMB 2QGUA 3GTJJ 1HCRA 3WTXC 2D1HA 2ZC2A 3HHGA 2JN6A 1LFPA 3SDGA 3Q9SA 3Q0UA 3C7JA 3TDUC 2DFHA 3J7YJ 3MKWB 1XDSA 3K1NA 2R7WA 4I98B 1BW5A 3AFHA 3LSTA 4N9HA 1B8IB 4NC7A 2V4JC 3S1NJ 1LNWA 2IW5A 2EB7A 1WJAA 5GPAA 4BU2A 3NRVA 2P5KA 4BXUA 2JA8J 3CO6C 1IRFA 3KP2A 4ABZA 3CJNA 2IPQX 2JK3A 5C3EJ 4OIQF 2UZKA 2HS5A 1TWGJ 3RKXA 4MTEA 1AHDP 1FSEA 2M45A 2FQ3A 3K4NA 2E71A 3M07A 4O6JA 5GPCA 3M3YJ 2R7OA 5EZHA 3PUBA 3GZ5A 4LK0F 5FD6A 2VOPA 3DEUA 1PUFA 3ULQB 1QRYA 3WG7H 3RZDJ 1I50J 2COMA 2DFEA 2XAFA 3BCBA 3QODA 5CQEA 3JTHA 3W6VA 3WU0A 3QWLA 4NBQA 2GXAA 2XSJC 1FTTA 3H3UA 1YG2A 3P5JA 1G3TA 1RKTA 1AKHB 1R49A 2ZMEB 1HDPA 1VF9A 3I55I 1ETWA 1WSUA 3H5NA 3KYLA 4KIGA 2VE9A 1D0XA 1Z0XA 4F52A 1RUNA 2BVMA 2Q2EA 3L2QA 3BLYA 1YLFA 3DPLC 1GUUA 4FTHA 4B8XA 1ON2A 2WTEA 4EM1A 3SZPA 3DTEA 1H9TA 2X9DA 2LR8A 5BMZA 5D6FA 1EA3A 2RN7A 4HAMA 1T56A 3S1RJ 4FASD 2K9MA 4CXFA 4HPQA 1KGSA 3W6JB 2FBKA 4FCYA 2JA6J 2Y0MA 4QTRA 2R7SA 2CV1A 3IV5A 2W84A 4IQ4A 3BPXA 3M8EA 4UV9A 2VE8A 4BXFA 4HF1A 3QYBA 5B66C 1I6HJ 1LVKA 2JPBA 1FSHA 3PIPF 3PSFA 2EA4A 3CDLA 3HUGA 2QKMB 1MBFA 1POGA 1UMQA 1A04A 1YQAA 4JYKA 1JKPC 1SEUA 2XHKA 2EK5A 2L7MP 2KIUA 4DOZA 5HODA 3O3KA 3I3LA 2D5VA 3FXRA 1TL8A 1BR4A 2XPVA 3GZ6A 1YX3A 4HLYA 1B59A 3BTCA 4RBOA 2RQQA 4DIQA 4RB2C 3CCLI 1BL0A 1ON1A 3GTGJ 2DLLA 3OYAA 4IHWA 2CSOA 3SQNA 2HOSA 3ABUA 2X6OA 4XM3A 2EWNA 1H8AC 1Z3YA 1G6NA 1W5CC 2B0LA 4HX8A 4DYQA 5EGOB 4S0HB 4Z6YA 1ZK8A 4W97A 1XG1A 2OBPA 4WF2A 1SFKA 2CUJA 3ZN0A 4IPAA 1IXSB 1X1PA 5E8GA 2IBDA 1DPRA 2GOMA 4XLEA 2HYFA 1R6RA 1D1AA 2HDCA 3Q3SA 1WJCA 2UWMA 4M71A 3ABMH 2JA5J 2V1XA 2P8TA 3EUAA 3OYCA 1XDUA 2L7ZA 2E5ZA 1UHSA 4KNYA 1G59A 2CQXA 2M3AA 4D0PA 2EFWA 3FF5A 2M0MA 5DM7F 2KJCA 3WTSC 3CDHA 1IN7A 2Y0SA 1VQNI 4WXHA 4ENMA 1EH8A 2ESNA 3M1EA 4RM2A 3ZN1A 4Y7NJ 2LYCA 2VUMJ 5ILSA 4GO1A 2EZIA 9ANTA 1PUFB 2N8GA 3F6OA 4IVNA 4U0YA 4UB6C 4ZYGA 5D5VB 1ORKA 2QQAA 3VYSB 1R22A 4EJTA 4HA8A 3WU1B 4P9FA 4EMSA 4BJTA 5ICEA 1HC8A 2V1NA 1EH6A 3PJRA 2BVLA 4A0ZA 3AG1H 1I39A 3S3OA 1ACIA 3QP6A 1UCRA 4E6KG 5B1AH 2X6YA 1JI8A 4UV8A 3KZZA 3WGGA 4D7NA 4H4KC 3K2AA 4ON0A 4MEXF 1KZHA 2FNAA 4E7KA 4G7ZF 2FMLA 5CPRB 2GIZA 4UUVA 1L3LA 1KA8A 1RC9A 2DPUA 4I0AA 4M72A 1QBJA 1OYYA 3PQJA 2X4HA 2R4GA 3E6DA 4PFOA 2RV8A 2Q1ZB 2P4WA 5KAFC 2OCCH 5CLSA 3X2QH 3IHUA 5IT3A 1P92A 3F72A 3S32A 2O6GE 3C1DA 3DFGA 2K9LA 4YIRX 3W2WA 4BQQA 5F0HA 2DW4A 2JVHA 4DJAA 3TOBA 1W7PB 1YS6A 1JGSA 3KEOA 2NXNB 5AIPA 4UB8C 3E6CC 2XAJA 5LBQA 3QPTA 3JRIA 1Z67A 2JZYA 3KP3A 1FNNA 1JTYA 1K7AA 1MIJA 3FMQA 3KIOA 2V1DA 4I0BA 4BS9A 4D9JA 2XC7A 2ACJA 2XIGA 4RAGA 2ADUA 2PMZA 2VKEA 1VQ5I 1HKSA 2L9SA 3AAFA 3A01A 4I76A 5J8CA 1QGPA 3S8PA 2W57A 2QBYB 4L9TA 3F21A 2WWYA 3Q0VA 5EZGA 3R0JA 4RA2A 3VEPA 5K5QA 1S7OA 5F04A 4F55A 4C3HJ 3ZQ7A 4G6TB 4I2OA 2YUSA 2NVUB 4P5OA 3HXLA 3JAMZ 3AG3H 1Z77A 1R5ID 2QQBA 1Z1DA 3ZQHA 4ZC3A 3BY6A 3HSRA 3O6BB 3D0SA 4LLLA 4WXDA 2NNNA 5FKNA 3CCUI 2PI0A 5LGUA 2ZSHB 3PL8A 4JX5A 5LHGA 3NWTA 3BP8A 3WTWC 1QU3A 1MBHA 5DYMA 4B1RA 3JR9A 2Q2EB 2LG4A 2MLGA 2B9SA 3WE3A 4LG0B 2DA4A 4PJMA 1FMVA 1WPKA 1SANA 3SZGA 2O03A 4BY7J 2OD5A 2EILH 1ZHFA 1TT0A 2DT6A 4XKWA 5LRSA 2NAZA 2R7TA 2XVCA 2YU9J 1KYZA 2ZMEC 1BJAA 4YFXF 4KUMA 5F6FA 2ZJPF 1T95A 3GLLA 3OYMA 5KK1A 1TWHJ 4JBAA 2HDWA 4G94A 2F5CA 2Z2SB 3CMAI 1VQ6I 1RESA 4DBRA 4LOCA 3J80K 1WI9A 3KEYA 3IC7A 2XF5A 4IHYA 1W7PD 1FX7A 1E17A 2JA7J 2CQQA 1IDYA 1JXSA 3KLNA 2H8WA 3PFYA 3Q0WA 3DLLF 4CA0A 2EZKA 1DP3A 4QPOA 1YOVB 5GAEJ 1R71A 2NOGA 2EFPA 3U2RA 5A2QK 2DDBA 2HQRA 3OYNA 1USSA 1HBXG 3KETA 2F6CA 1NTCA 5L3GA 2MSYA 1MJ9A 2HPIA 1FYLA 4OIRF 3AL0B 1W0UA 2DJIA 4GCVA 4L18B 2DXIA 3FXJA 1A6QA 3GYHX 1X1CA 1Z91A 3OL4A 2R7UA 5IYBJ 2DA7A 2M2EA 3FHNA 1TBXA 2R7DA 1ZR4A 2CRGA 2VODA 2L9NA 1LFBA 3DBHB 2PJRB 3B02A 1O3QA 1QVUA 5ICFA 1K79A 3F8FA 1IZ1A 5FO5A 2IEKA 2L9RA 2XAHA 4P55A 4XLFA 2G9WA 3VDXA 1HDDC 4U7BA 2DA1A 2C6YA 5E20A 3VB2A 2GA2A 5C4XJ 4I99C 3S3MA 1IO2A 1Q1VA 1I5ZA 2LDUA 1YIOA 3TW7A 1X1DA 3BROA 1N78A 3K70C 5K7HA 2VJIA 3GUDA 3ML6A 4KFCA 1QO0D 4XK4A 4ENJA 4BHPA 2VL8A 3ZCOA 4EJVA 2KZGA 2L5QA 2LOOA 3SJMA 2XUBA 3EUHC 5IOYA 1JUPA 2CJJA 2WAQA 2QZ8A 5HS7A 5JFRA 4J01A 1KU2A 1MBJA 1O7LA 2W48A 3A0HC 5E3MA 1U0JA 3AG2H 4DYCA 2OA4A 1MSFC 1J9IA 5DM6F 3CP2A 3I4PA 4CCMA 2O61A 2KDZA 4L0ZB 3MAJA 4NQWA 2R3SA 1H9GA 1LJ9A 1QHHD 2L3DA 2IGMA 4QIWN 2E1CA 4UUSA 2CUEA 4GRIA 2M5WA 5E18F 3OYLA 3HGYA 2IS2A 2KIFA 1SFEA 3G71I 3F22A 3CC4I 3O2PE 1SFOJ 5B1BH 1Z3XA 4OAZA 3LA7A 1RR8C 5M5XJ 3BPVA 3RYPA 2LKXA 4A3MJ 2VJJA 3BR6A 2CYYA 3D1NI 3QPSA 1ZGAA 1B9MA 2LC2A 1P7IA 4J19A 2R7QA 4WXCA 2E2IJ 2PJPA 5EG0A 4M3BA 3RPUD 4I01A 1HXDA 1PYVA 2H6CA 4B3AA 1E2XA 2ZO4A 1JJ8C 1ETOA 4U7DA 3MKZA 2VBXA 2WBMA 2R92J 1E0EA 4RB1A 2EZHA 2DI3A 2EA2A 1VQ7I 3ECHA 4O3MA 3H3VK 2E1MB 3K6GA 1KYWA 5CVVA 4LITA 3S93A 2E19A 3JW4A 3U1DA 4B43A 4PK4A 2LFBA 4P1WA 1BC8C 3G1OA 2HXIA 1QZYA 1OCOH 3F8BA 1LKXA 2OQGA 3QQAA 5HLIA 1V4RA 3WHCA 3OMYA 4IRGA 1S5LC 1R1TA 4ZDLA 5DS9A 3A01B 4I09A 2WAQN 2VXZA 1SMYF 2XPUA 2RC4A 2BY2A 1S7EA 3F6VA 3QU6A 1LEAA 1IUYA 1Z6RA 4E7ZA 4Y17A 2KIQA 3RYRA 3FZVA 3QU3A 3K70D 1ETKA 1IXRC 3H9JA 1U5TA 4U88A 2GZWA 2EFOA 4EJUA 2QKLB 2HTJA 5GAGJ 1ZGJA 2WY8Q 1V3FA 3BR1A 3GTKJ 1G2HA 3SEQA 1P6RA 2GXGA 3TBIA 2MG4A 4YRVA 1R1UA 1BW6A 1R00A 1HKTA 1R7JA 3BG5A 5J1UA 1XMXA 3FM5A 4XRSG 2VJ4A 2FBHA 3JRCA 5EJCA 3FDYA 4JQFA 1KONA 3JRDA 3E97A 3WG9A 1A6IA 3ZOBA 2G7UA 3FM3A 2V1UA 2DYRH 1UELB 2RREA 2Y2ZA 1NHAA 3BCAA 1D0ZA 3KEQA 4G8XA 4BDYA 2HOAA 1YFHA 1WJDA 3HG9A 3QPHA 2FRHA 1FMWA 5HDKA 3G4SI 2FBIA 4IX7A 4XLPF 1O3TA 3FISA 4LK1F 1O3SA 1VQPI 4N4NB 2ZJ2A 1BM9A 3TDZC 3BTIA 2QCOA 2Z16A 2L02A 4XOPA 4BHBA 2CUFA 3M8FA 4HOBA 5F1RA 4NQWB 1SAUA 2E1OA 3A0BC 3BG6A 3LAJA 3JREA 5JVGF 3L2CA 1Y56A 2BW3B 4L5JA 3L2RA 4BL0B 2CMPA 1VQKI 2O7OA 2KQRA 3WTVC 2PQ8A 1XPXA 2X1DA 4IRIA 1WWXA 5K7ZA 1SC7A 3JRBA 2L4MA 2FUG2 3HIFA 4CYCB 1XS9A 1ULYA 1BC7C 3BC8A 3MEXA 4CUGA 3BQYA 4A3BJ 1YW9A 4XSXF 4ZYAA 2E2HJ 5HNFA 5D8LB 2RNJA 2XAQA 4Q5SF 2DA5A 3K1MA 1JUSA 4UXNA 3M7GA 4N4OB 4F93B 1RR7A 2K02A 3CTAA 4HV6A 1MDMA 4ZDPA 1OJLA 5FRMA 5LGTA 2IP2A 2HOTA 5C44J 3E5QA 5A2QZ 3LSRA 3GZNB 4XBFA 1F5TA 2OCEA 3HSFA 2MH9A 5LGNA 3H3ZA 4M9XA 1EV7A 1PP8F 5L3DA 2LF7A 3WE2A 2OAZA 1IN4A 3BJ6A 1FOXA 4XKBA 1YTYA 1J5YA 4ZH4F 2M0CA 3MZYA 1K61A 3LA2A 5GADJ 1PP7U 2WY7Q 1DUXC 2AXLA 2DTRA 3S17J 2DQLA 3TMOA 1BN5A 3IH3A 5BOXA 1IW7F 2UUZA 1K78B 2ZJQF 4OAYA 5EGOA 1UB9A 3EETA 1T38A 4IHXA 4EJOA 2Y9ZA 5L3BA 2LH9A 5JVTA 1XMKA 1WQ2A 2R5ZA 1Y39A 2OTLI 3KE2A 1MJBA 3E1SA 1MKMA 1IG7A 1XD7A 4EV0A 3DKWA 3VPRA 3CO7C 4KMUX 3RIRA
chains in the Genus database with same CATH topology
1USTA 2Z9OA 2XAGA 3SXYA 1T6SA 2J5PA 4XSZF 3P9IA 3JSOA 1Z7UA 4K2EA 1TTYA 4ESFA 3GFMA 5CVRA 2E1NA 3E6MA 3GYHX 2ELHA 2LSOA 2FEZA 4NB5A 4Y15A 1TNSA 2STWA 3D5LA 3GWZA 4MTDA 4HDUA 5BPDA 6PAXA 2W24A 3HYIA 5L3EA 4L9NA 2M87A 3WTUC 2LF8A 2Z5UA 5HDGA 2OZ6A 4UNOA 2H27A 4O5VA 1ZARA 1W7PA 5TRDA 2W85A 4CO8A 4HF2A 3P9CA 4IJAA 4PGGA 2A07F 5D4RA 2NYXA 5D4SA 4FX0A 3T8RA 2KRFA 4LGWA 2JPCA 1U3EM 5ERIA 2K7LA 4UVBA 3ZP5A 4PGHA 1MGTA 3OOPA 5DEQA 2YX4A 4L9VA 3SFZA 3ZMDA 3GFLA 3L09A 2A68F 2PMHA 1G4DA 4A6EA 4OIPF 2P5LC 4A0YA 1REPC 4RGSA 4CGZA 2J5OA 4BHCA 4WK8F 5F64A 4TV7A 1ZN2A 2QLZA 3LQRA 4G7OF 4R8HA 2HFHA 1T98A 2MH2A 1FT9A 2O8XA 1AOYA 4EVIA 2RQPA 1FC3A 3QAHA 2HKXA 3E3VA 2MD5A 3V8LA 1HW2A 1RZ4A 3C18A 3FXUA 2BE5F 5J6XA 1S7AA 2QWWA 2NRAC 3HTSB 1R36A 2QVOA 4MQVA 1HSTA 1XGOA 4RGXA 4WWCA 3G3ZA 4M74A 2XV4S 5HDNA 3QOPA 2GAUA 4QWQA 4XLNF 3CUQC 3U9GA 1KU9A 2EV5A 5DV5A 4HW0A 5HVQC 2DQRA 1W4MA 3L9FA 1ONVA 3HSEA 4IXAA 3ERED 3L00A 1J0RA 4GYGA 2PFBA 3FMRA 3REOA 1G3SA 1Y0UA 1ZYRF 2QM3A 2DAOA 2KJBA 1TW3A 1J59A 2GA1A 1U8RA 5LRRA 1HKQA 3ZMSA 2K4BA 1F9NA 2GXBA 1O3RA 3COAC 5IT9K 2GIVA 3WGHA 4Q48A 2F5DA 2DK8A 1OR7A 4HQEA 2Z33A 3HRSA 2HZTA 4BQAA 1TLHB 4AIKA 5JI6A 1S29A 3CLOA 5E1WA 1TQIA 2K4JA 2ISZA 2VT3A 1HW1A 2XASA 4AIHA 4LJZF 1FBSA 3HOTA 1OKRA 4CICA 1FP2A 1IN6A 3ABTA 3EUHA 3Q9VA 3TO9A 4ZZDA 4KN7X 2MLKA 3DXJF 4LB5A 2HQNA 5DUKA 1OPCA 4OIOF 1BBYA 4KIBA 1CF7B 1YO5C 4KDPA 5DUIA 3PQKA 2DBBA 3F8NA 3EYYA 4DNCA 4ASNA 1J2XA 1XGMA 3MWMA 3R61A 4B09A 1ZREA 2PLYA 2CG4A 1T2KA 1K78A 2CWEA 5D5XB 1ODDA 3RKYA 4MEYF 2ZFWA 2ZXJA 2ZMEA 3I71A 4RB3C 1I27A 4MHGA 4H0EA 3V8KA 3HRUA 3ELKA 1IF1A 4S04A 4N9IA 3RDIA 4GXOA 5H20A 4PDKA 4M6XA 2DFIA 1QQIA 1WKMA 4EQQA 1JHHA 1BI0A 3DV8A 2RKHA 2FA5A 4G6DA 3WTZA 2F5FA 3N97A 1ZLKA 1TW2A 5L3FA 2P6SA 4HDVA 3KP4A 3EDPA 1IN8A 4YIIA 2V6CA 2XKPA 3GFIA 3GEZA 5LLQA 1ZG5A 1ZAOA 1FY7A 1F1ZA 3TOAA 1T39A 2ISYA 4E70A 1JHFA 1R5HA 1HW5A 2PEXA 2FOKA 4ENNA 2OZUA 1SD7A 2FU4A 3BJOA 3IKVA 2ESHA 3E5XA 1R5GA 4AIJA 1WRJA 3GO5A 3LWFA 2VN2A 5CVUA 5KVRA 1XCBA 4U0WA 2JT1A 3BJAA 2D1VA 2QBYA 2IA2A 4OMYA 4YFKF 4OMZA 4F7ZA 1FZPB 3ZMUA 2XROA 3K9TA 3I53A 4M6YA 3LAPA 2XKOA 2E7WA 1CGPA 1HQCA 3IKTA 2AS5F 1G3YA 5LEJA 2VONA 2X0LA 1XSDA 3J7AO 2EV6A 4LG0A 4IF4A 5E1XA 3KLOA 3K2ZA 5DCMA 4RS8A 2UXNA 1XB4A 3KP6A 3W6KB 1D8JA 3I54A 1KQ9A 4RAZA 1SAXA 1GVJA 3JTGA 1IAWA 1ZRFA 1MD0A 3ROUA 4HX7A 4S05A 2V79A 4KT5C 2P7VB 4OINF 5LEKA 3S2WA 3HHHA 1T0FA 4Q47A 2IRFG 2VC0A 4AD9A 4R79A 2M1BA 3H92A 4HYEA 5D5UB 1YW7A 5D8KB 3B73A 5JR3A 2HTSA 4R1HA 3DQVC 1XMAA 3PFIA 3T1BA 1R58A 1X3UA 2CO5A 4BNCA 1KQ0A 1U5TC 2A69F 1I1GA 5JHUA 1B4AA 1QPMA 2A61A 4ENKA 3RPQA 4L0YB 3GW2A 3I59A 3R4KA 3I5UA 3F23A 3BWGA 2ZCWA 5H6QA 2Y75A 3J80Z 4A5MA 3CUQB 2LKPA 3T0YA 1OYIA 1OYWA 2EFQA 3I0TA 1EH7A 4N0BA 2F2EA 5EEHA 2PN6A 3WTTC 4LD5A 2QYOA 2H09A 1J7KA 3VOEA 3JAMK 1D8KA 2CGPA 3HRTA 3C3WA 3GLXA 3TO6A 1UHMA 2EV0A 2ZNYA 1KU3A 4G6QA 5ICGA 1C0WA 4IHSA 1F4KA 1LB2A 4U0VA 3M9AA 1LQ1A 4CDGA 3V7SA 5DDGA 5TJJA 3WODF 2DK5A 1XN7A 2VC1A 1H0MA 2A3SA 2VBYA 4A12A 3DPTA 2Z99A 1MZBA 1BI3A 4FT8A 4UVAA 5FB2A 3FX3A 3RJPA 3I64A 3N4MA 2MC3A 3I58A 5D5WB 1YYVA 1B1BA 5BPIA 1ZG1A 5D6EA 5CVIA 4ZYDA 2YSRA 3IWZA 2RGVA 4YFNF 3RTRA 2RVCA 2MA3A 2R7FA 4LB6B 2DPDA 3ZMTA 1W5SA 2JSCA 3ZMZA 1LDDA 5K5OA 3KP7A 2FE3A 3J81Z 2K86A 3LQQA 3LA3A 4MGRA 1ZRDA 1LDKB 3JSPA 2YX7A 5ED4A 5FFXA 1IN5A 2IT0A 4ZZLA 1DDNA 2OQRA 4HBLA 1XGNA 2E7XA 1SFUA 3T8TA 3E6BA 4M9SA 4A0XA 2QQ9A 5K5RA 1YW8A 4CHUA 2WV0A 2JRTA 2XGXA 4I02A 2HWVA 4RGRA 5CJ9A 1XGSA 3V7CA 4P96A 2YU3A 3K69A 2V9VA 4CZZA 3P9KA 5LHIA 1Z9CA 2VOOA 3IWFA 4FHTA 4ESJA 2FXAA 1FYMA 1GHCA 2XRNA 4BAYA 1LEBA 3HOSA 5E17F 2ZNZA 3R6SA 1IXCA 2M30A 4G7HF 5HLHA 3TGNA 3QRFF 2FMYA 2TDXA 4PZJA 3ZPLA 2VT2A 2L01A 3FMSA 1BOAA 2A6HF 4RB0A 1ZG3A 5E1ZB 5HOOA 3RKWA 1J75A 3KZYA 1GXPA 3GFJA 2D2WA 1O7FA 5L3CA 5CVJA 3IRQA 1Z05A 1KQ8A 3F8CA 1W5TA 4EM0B 1U6GA 3EQLF 4CYDA 3ISPA 2LNBA 2G7HA 1BI1A 1JE8A 4UHTA 4GGGA 4AWXB 4HQMA 1B9NA 3HTUA 4ZYEA 1TQMA 4ZYHA 3RI4A 1PDNC 1OMIA 1YS7A 3KCCA 3VODA 4HZFA 1RNLA 1P4AA 4HV5A 1SD6A 5FLXK 1G3WA 3Q5FA 5K1YA 1PUEE 1U2WA 3T5XA 1QNTA 3QP5A 3FHZA 4LLGF 4A2UA 2ETHA 2QUFA 4KYWA 3V4GA 3V7RA 1P4WA 4P9UA 4BYYA 3BDDA 1XCVA 3SHFA 2W25A 5HLGA 3R0AA 3I59B 3ZMVA 5FGMA 1I1SA 2L4AA 2F5EA 1BIBA 3GF2A 2Q8KA 4ETSA 1B6AA 1HSJA 3SZTA 1P2FA 4A5NA 1XSVA 5DCMB 2DT5A 4HF0A 4WCGA 1P4XA 1BIAA 3DF8A 1LDJA 2BEOA 1O57A 3MFKA 3NEUA 2O0YA 3J81K 2PG4A 5ILVA 2Z3YA 4KICA 4UVCA 3TQNA 3FXQA 1BI2A 3K1PA 2HOEA 2ZKZA 2BBYA 1MJAA 1IRGA 5BS6A 2CW0F 3NQOA 2D45A 1RIOH 3KP5A 1FYKA 2RDPA 3L7WA 4HX4A 1XSXA 2DO7A 2PMUA 4KIFA 1VTNC 3CUOA 2HGCA 5CYVA 4WX9A 1I6XA 3IL2A 2P6TA 4I7HA 1FPQA 4Q4ZF 4JK1X 1FLIA 2HYGD 1Z6TA 1DPUA 2EJRA 2CFXA 3HRMA 2KIMA 2FSWA 2ZBKA 4RAYA 2A5YB 5ILUA 2NS0A 1CF7A 4Y13A 2PBIA 2OU2A 5ICCA 4EJWA 2H94A 1SD5A 5EEGA 1D3YA 4NHJA 1SFXA 1ZRCA 2FF4A 5J8FA 2FNPA 1DP7P 1U5TB 2Y48A 3EYIA 2HR3A 5FFZA 3V8JA 3IRRA 2K27A 5AIQA 3P7NA 5AONA 1STZA 3KFWX 2UXXA 4FX4A 4DQ2A 1KU7A 4M73A 3MQ0A 1FP1D 2KKOA 4OU0A 4XRFA 3TKYA 2BV6A 3OV8A 1D5VA 1FBUA 2Q0OA 3GVAA 5DD8A 2GWRA 2MBFA 1RUOA 5HS8A 4OOIA 4HLXA 1UHWA 4EGYA 3LFKA 2A6EF 2IJLA 3ECOA 3F8MA 3GXOA 1QZZA 2P7CB 1S6LA 1TNTA 2IA0A 5DD4A 3BOQA 2GQQA 4G9YA 4IHTA 4LFUA 2JTVA 4PCQA 3K0LA 2DU9A 1FOKA 4BH9A 2HKOA 4M9ZA 1K6OA 4A6DA 1GXQA 5IT9Z 3RPUA 1AWCA 3FWEA 4GYIA 1SMTA 5E8IA 1UFMA 5LHHA 4MNUA 2WC2A 2STTA 1FBQA 3F3XA 3E5UA 4KN4X 3WTYC 1LVAA 1R1VA 3MZHA 2QENA 1R23A 2BYVE 3VFZA 4L5IA 4EGZA 2NNYA 2M8EA 1FWZA 2H6BA 2IA1A 5HS9A 4QLCU 3CUQA 2VBZA 4L9JA 1ZLJA 2EFNA 2O3FA 2IVMA 1SD4A 2YPRA 1TQPA 4MQ9F 4Z2YA 4KA4A 1S3JA 4AVPA 4ESBA 3DP7A 3WGIA 4RGUA 1ZH5A 4YG2F 4IRHA 5H6RA 3G73A 3R60A 3MCZA 2BGCA 1RI7A 4LLNA 1L0OC 2YR2A 3GX4X 4EM2A 3TO7A 2VBWA 1U78A 5FD5A 2HEOA 5DCFA 4KMFA 2CQKA 5BQTA 1Q1HA 1S8NA 4LMYA 5FLXZ 4YIFA 2P5VA 2L54A 3BZ6A 1MDMB 3WTXC 2D1HA 3HHGA 3Q9SA 3C7JA 3TDUC 1XDSA 3K1NA 4I98B 3LSTA 4N9HA 1LNWA 2IW5A 2EB7A 3NRVA 2P5KA 4BXUA 3CO6C 1IRFA 3KP2A 3CJNA 2IPQX 4OIQF 2UZKA 2HS5A 3RKXA 4MTEA 1FSEA 2M45A 2FQ3A 4O6JA 4LK0F 3GZ5A 5FD6A 2VOPA 3DEUA 3ULQB 2COMA 2XAFA 3JTHA 3WU0A 3H3UA 1YG2A 1G3TA 2ZMEB 1WSUA 4KIGA 2VE9A 1RUNA 2Q2EA 1YLFA 3DPLC 4B8XA 1ON2A 2WTEA 4EM1A 3SZPA 1H9TA 5BMZA 5D6FA 2RN7A 4HAMA 4CXFA 1KGSA 3W6JB 2FBKA 2Y0MA 2W84A 3BPXA 3M8EA 4UV9A 2VE8A 4HF1A 2JPBA 1FSHA 2EA4A 3HUGA 1A04A 1YQAA 2XHKA 2EK5A 2KIUA 3O3KA 3FXRA 3GZ6A 4HLYA 1B59A 4RB2C 1ON1A 2DLLA 2CSOA 3SQNA 3ABUA 2EWNA 1G6NA 2B0LA 4HX8A 2OBPA 4WF2A 3ZN0A 4IPAA 1IXSB 5E8GA 1DPRA 2HYFA 2HDCA 2UWMA 4M71A 2V1XA 2P8TA 1XDUA 4KNYA 4D0PA 2EFWA 3FF5A 2KJCA 3WTSC 3CDHA 1IN7A 4WXHA 4ENMA 1EH8A 2ESNA 3M1EA 3ZN1A 5ILSA 4GO1A 3F6OA 4IVNA 4U0YA 4ZYGA 5D5VB 2QQAA 4EJTA 1R22A 4HA8A 3WU1B 4P9FA 4EMSA 5ICEA 1EH6A 4A0ZA 3QP6A 1UCRA 4UV8A 3KZZA 3WGGA 4ON0A 4MEXF 2FNAA 4G7ZF 2FMLA 4UUVA 1L3LA 1KA8A 2DPUA 4I0AA 4M72A 1QBJA 1OYYA 3PQJA 2X4HA 3E6DA 2RV8A 2P4WA 5CLSA 5IT3A 3IHUA 1P92A 3F72A 2O6GE 3C1DA 3DFGA 2DW4A 3TOBA 1W7PB 1YS6A 1JGSA 3KEOA 5AIPA 3E6CC 2XAJA 5LBQA 3QPTA 2JZYA 3KP3A 1FNNA 1K7AA 3FMQA 2V1DA 4I0BA 2ACJA 2XIGA 2ADUA 1HKSA 3AAFA 5J8CA 1QGPA 2W57A 2QBYB 4L9TA 3F21A 2WWYA 3R0JA 3VEPA 5K5QA 1S7OA 3ZQ7A 4I2OA 4P5OA 3JAMZ 2QQBA 1Z1DA 3BY6A 3HSRA 3O6BB 3D0SA 4LLLA 4WXDA 2NNNA 2PI0A 5LGUA 5LHGA 3BP8A 3WTWC 5DYMA 2MLGA 3WE3A 4LG0B 2O03A 2OD5A 1ZHFA 5LRSA 2NAZA 2XVCA 1KYZA 1BJAA 4YFXF 4KUMA 5F6FA 5KK1A 4JBAA 4G94A 2F5CA 3J80K 1WI9A 3IC7A 1W7PD 1FX7A 1E17A 1JXSA 3KLNA 2EFPA 3U2RA 5A2QK 2HQRA 1USSA 1HBXG 3KETA 5L3GA 1MJ9A 1FYLA 4OIRF 4GCVA 4L18B 1Z91A 1TBXA 2R7DA 2VODA 3B02A 1O3QA 1K79A 5ICFA 3F8FA 1IZ1A 5FO5A 2XAHA 4P55A 2G9WA 4U7BA 2C6YA 5E20A 3VB2A 2GA2A 1I5ZA 2LDUA 1YIOA 3BROA 4KFCA 3GUDA 3ML6A 1QO0D 4ENJA 4BHPA 4EJVA 2XUBA 2QZ8A 5HS7A 5JFRA 1KU2A 1O7LA 2OA4A 1J9IA 3I4PA 2O61A 4L0ZB 3MAJA 4NQWA 2R3SA 1H9GA 1LJ9A 2L3DA 2E1CA 5E18F 2M5WA 2KIFA 1SFEA 3F22A 3O2PE 3LA7A 3BPVA 3RYPA 2CYYA 1ZGAA 1B9MA 4WXCA 2PJPA 4I01A 1HXDA 2H6CA 1E2XA 2ZO4A 4U7DA 2VBXA 4RB1A 2DI3A 2EA2A 3ECHA 4O3MA 1KYWA 5CVVA 3JW4A 3U1DA 1BC8C 1QZYA 3F8BA 2OQGA 5HLIA 1V4RA 4IRGA 1R1TA 4I09A 2VXZA 1SMYF 2RC4A 3F6VA 3QU6A 1LEAA 1IUYA 1Z6RA 4Y17A 3RYRA 3FZVA 3QU3A 1IXRC 1U5TA 4U88A 2GZWA 2EFOA 4EJUA 2HTJA 1ZGJA 1V3FA 1P6RA 2GXGA 1R1UA 1R00A 1HKTA 1R7JA 3FM5A 2FBHA 4JQFA 3E97A 3WG9A 2G7UA 3FM3A 2V1UA 1NHAA 4G8XA 3KEQA 1YFHA 3QPHA 2FRHA 5HDKA 1O3TA 2FBIA 4XLPF 4LK1F 1O3SA 2ZJ2A 1BM9A 3TDZC 2L02A 4BHBA 3M8FA 4HOBA 5F1RA 3LAJA 3L2CA 4L5JA 3WTVC 2PQ8A 4IRIA 1WWXA 2L4MA 3HIFA 1ULYA 1BC7C 3MEXA 1YW9A 4XSXF 5D8LB 2RNJA 2XAQA 4Q5SF 3K1MA 4UXNA 3M7GA 2K02A 3CTAA 4HV6A 1MDMA 5LGTA 2IP2A 3E5QA 5A2QZ 4XBFA 1F5TA 2MH9A 3HSFA 5LGNA 3H3ZA 4M9XA 1EV7A 1PP8F 5L3DA 2LF7A 3WE2A 2OAZA 1IN4A 3BJ6A 1YTYA 1J5YA 4ZH4F 3MZYA 3LA2A 1PP7U 1DUXC 2AXLA 2DTRA 2DQLA 1BN5A 5BOXA 1IW7F 1K78B 1UB9A 3EETA 1T38A 4EJOA 5L3BA 5JVTA 1XMKA 1WQ2A 3KE2A 1MJBA 1MKMA 1XD7A 4EV0A 3DKWA 3CO7C 4KMUX 3RIRA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1UST A;  2Z9O A;  2XAG A;  3SXY A;  1T6S A;  2J5P A;  4XSZ F;  3P9I A;  3JSO A;  1Z7U A;  4K2E A;  1TTY A;  4ESF A;  3GFM A;  5CVR A;  2E1N A;  3E6M A;  3GYH X;  2ELH A;  2LSO A;  2FEZ A;  4NB5 A;  4Y15 A;  1TNS A;  2STW A;  3D5L A;  3GWZ A;  4MTD A;  4HDU A;  5BPD A;  6PAX A;  2W24 A;  3HYI A;  5L3E A;  4L9N A;  2M87 A;  3WTU C;  2LF8 A;  2Z5U A;  5HDG A;  2OZ6 A;  4UNO A;  2H27 A;  4O5V A;  1ZAR A;  1W7P A;  5TRD A;  2W85 A;  4CO8 A;  4HF2 A;  3P9C A;  4IJA A;  4PGG A;  2A07 F;  5D4R A;  2NYX A;  5D4S A;  4FX0 A;  3T8R A;  2KRF A;  4LGW A;  2JPC A;  1U3E M;  5ERI A;  2K7L A;  4UVB A;  3ZP5 A;  4PGH A;  1MGT A;  3OOP A;  5DEQ A;  2YX4 A;  4L9V A;  3SFZ A;  3ZMD A;  3GFL A;  3L09 A;  2A68 F;  2PMH A;  1G4D A;  4A6E A;  4OIP F;  2P5L C;  4A0Y A;  1REP C;  4RGS A;  4CGZ A;  2J5O A;  4BHC A;  4WK8 F;  5F64 A;  4TV7 A;  1ZN2 A;  2QLZ A;  3LQR A;  4G7O F;  4R8H A;  2HFH A;  1T98 A;  2MH2 A;  1FT9 A;  2O8X A;  1AOY A;  4EVI A;  2RQP A;  1FC3 A;  3QAH A;  2HKX A;  3E3V A;  2MD5 A;  3V8L A;  1HW2 A;  1RZ4 A;  3C18 A;  3FXU A;  2BE5 F;  5J6X A;  1S7A A;  2QWW A;  2NRA C;  3HTS B;  1R36 A;  2QVO A;  4MQV A;  1HST A;  1XGO A;  4RGX A;  4WWC A;  3G3Z A;  4M74 A;  2XV4 S;  5HDN A;  3QOP A;  2GAU A;  4QWQ A;  4XLN F;  3CUQ C;  3U9G A;  1KU9 A;  2EV5 A;  5DV5 A;  4HW0 A;  5HVQ C;  2DQR A;  1W4M A;  3L9F A;  1ONV A;  3HSE A;  4IXA A;  3ERE D;  3L00 A;  1J0R A;  4GYG A;  2PFB A;  3FMR A;  3REO A;  1G3S A;  1Y0U A;  1ZYR F;  2QM3 A;  2DAO A;  2KJB A;  1TW3 A;  1J59 A;  2GA1 A;  1U8R A;  5LRR A;  1HKQ A;  3ZMS A;  2K4B A;  1F9N A;  2GXB A;  1O3R A;  3COA C;  5IT9 K;  2GIV A;  3WGH A;  4Q48 A;  2F5D A;  2DK8 A;  1OR7 A;  4HQE A;  2Z33 A;  3HRS A;  2HZT A;  4BQA A;  1TLH B;  4AIK A;  5JI6 A;  1S29 A;  3CLO A;  5E1W A;  1TQI A;  2K4J A;  2ISZ A;  2VT3 A;  1HW1 A;  2XAS A;  4AIH A;  4LJZ F;  1FBS A;  3HOT A;  1OKR A;  4CIC A;  1FP2 A;  1IN6 A;  3ABT A;  3EUH A;  3Q9V A;  3TO9 A;  4ZZD A;  4KN7 X;  2MLK A;  3DXJ F;  4LB5 A;  2HQN A;  5DUK A;  1OPC A;  4OIO F;  1BBY A;  4KIB A;  1CF7 B;  1YO5 C;  4KDP A;  5DUI A;  3PQK A;  2DBB A;  3F8N A;  3EYY A;  4DNC A;  4ASN A;  1J2X A;  1XGM A;  3MWM A;  3R61 A;  4B09 A;  1ZRE A;  2PLY A;  2CG4 A;  1T2K A;  1K78 A;  2CWE A;  5D5X B;  1ODD A;  3RKY A;  4MEY F;  2ZFW A;  2ZXJ A;  2ZME A;  3I71 A;  4RB3 C;  1I27 A;  4MHG A;  4H0E A;  3V8K A;  3HRU A;  3ELK A;  1IF1 A;  4S04 A;  4N9I A;  3RDI A;  4GXO A;  5H20 A;  4PDK A;  4M6X A;  2DFI A;  1QQI A;  1WKM A;  4EQQ A;  1JHH A;  1BI0 A;  3DV8 A;  2RKH A;  2FA5 A;  4G6D A;  3WTZ A;  2F5F A;  3N97 A;  1ZLK A;  1TW2 A;  5L3F A;  2P6S A;  4HDV A;  3KP4 A;  3EDP A;  1IN8 A;  4YII A;  2V6C A;  2XKP A;  3GFI A;  3GEZ A;  5LLQ A;  1ZG5 A;  1ZAO A;  1FY7 A;  1F1Z A;  3TOA A;  1T39 A;  2ISY A;  4E70 A;  1JHF A;  1R5H A;  1HW5 A;  2PEX A;  2FOK A;  4ENN A;  2OZU A;  1SD7 A;  2FU4 A;  3BJO A;  3IKV A;  2ESH A;  3E5X A;  1R5G A;  4AIJ A;  1WRJ A;  3GO5 A;  3LWF A;  2VN2 A;  5CVU A;  5KVR A;  1XCB A;  4U0W A;  2JT1 A;  3BJA A;  2D1V A;  2QBY A;  2IA2 A;  4OMY A;  4YFK F;  4OMZ A;  4F7Z A;  1FZP B;  3ZMU A;  2XRO A;  3K9T A;  3I53 A;  4M6Y A;  3LAP A;  2XKO A;  2E7W A;  1CGP A;  1HQC A;  3IKT A;  2AS5 F;  1G3Y A;  5LEJ A;  2VON A;  2X0L A;  1XSD A;  3J7A O;  2EV6 A;  4LG0 A;  4IF4 A;  5E1X A;  3KLO A;  3K2Z A;  5DCM A;  4RS8 A;  2UXN A;  1XB4 A;  3KP6 A;  3W6K B;  1D8J A;  3I54 A;  1KQ9 A;  4RAZ A;  1SAX A;  1GVJ A;  3JTG A;  1IAW A;  1ZRF A;  1MD0 A;  3ROU A;  4HX7 A;  4S05 A;  2V79 A;  4KT5 C;  2P7V B;  4OIN F;  5LEK A;  3S2W A;  3HHH A;  1T0F A;  4Q47 A;  2IRF G;  2VC0 A;  4AD9 A;  4R79 A;  2M1B A;  3H92 A;  4HYE A;  5D5U B;  1YW7 A;  5D8K B;  3B73 A;  5JR3 A;  2HTS A;  4R1H A;  3DQV C;  1XMA A;  3PFI A;  3T1B A;  1R58 A;  1X3U A;  2CO5 A;  4BNC A;  1KQ0 A;  1U5T C;  2A69 F;  1I1G A;  5JHU A;  1B4A A;  1QPM A;  2A61 A;  4ENK A;  3RPQ A;  4L0Y B;  3GW2 A;  3I59 A;  3R4K A;  3I5U A;  3F23 A;  3BWG A;  2ZCW A;  5H6Q A;  2Y75 A;  3J80 Z;  4A5M A;  3CUQ B;  2LKP A;  3T0Y A;  1OYI A;  1OYW A;  2EFQ A;  3I0T A;  1EH7 A;  4N0B A;  2F2E A;  5EEH A;  2PN6 A;  3WTT C;  4LD5 A;  2QYO A;  2H09 A;  1J7K A;  3VOE A;  3JAM K;  1D8K A;  2CGP A;  3HRT A;  3C3W A;  3GLX A;  3TO6 A;  1UHM A;  2EV0 A;  2ZNY A;  1KU3 A;  4G6Q A;  5ICG A;  1C0W A;  4IHS A;  1F4K A;  1LB2 A;  4U0V A;  3M9A A;  1LQ1 A;  4CDG A;  3V7S A;  5DDG A;  5TJJ A;  3WOD F;  2DK5 A;  1XN7 A;  2VC1 A;  1H0M A;  2A3S A;  2VBY A;  4A12 A;  3DPT A;  2Z99 A;  1MZB A;  1BI3 A;  4FT8 A;  4UVA A;  5FB2 A;  3FX3 A;  3RJP A;  3I64 A;  3N4M A;  2MC3 A;  3I58 A;  5D5W B;  1YYV A;  1B1B A;  5BPI A;  1ZG1 A;  5D6E A;  5CVI A;  4ZYD A;  2YSR A;  3IWZ A;  2RGV A;  4YFN F;  3RTR A;  2RVC A;  2MA3 A;  2R7F A;  4LB6 B;  2DPD A;  3ZMT A;  1W5S A;  2JSC A;  3ZMZ A;  1LDD A;  5K5O A;  3KP7 A;  2FE3 A;  3J81 Z;  2K86 A;  3LQQ A;  3LA3 A;  4MGR A;  1ZRD A;  1LDK B;  3JSP A;  2YX7 A;  5ED4 A;  5FFX A;  1IN5 A;  2IT0 A;  4ZZL A;  1DDN A;  2OQR A;  4HBL A;  1XGN A;  2E7X A;  1SFU A;  3T8T A;  3E6B A;  4M9S A;  4A0X A;  2QQ9 A;  5K5R A;  1YW8 A;  4CHU A;  2WV0 A;  2JRT A;  2XGX A;  4I02 A;  2HWV A;  4RGR A;  5CJ9 A;  1XGS A;  3V7C A;  4P96 A;  2YU3 A;  3K69 A;  2V9V A;  4CZZ A;  3P9K A;  5LHI A;  1Z9C A;  2VOO A;  3IWF A;  4FHT A;  4ESJ A;  2FXA A;  1FYM A;  1GHC A;  2XRN A;  4BAY A;  1LEB A;  3HOS A;  5E17 F;  2ZNZ A;  3R6S A;  1IXC A;  2M30 A;  4G7H F;  5HLH A;  3TGN A;  3QRF F;  2FMY A;  2TDX A;  4PZJ A;  3ZPL A;  2VT2 A;  2L01 A;  3FMS A;  1BOA A;  2A6H F;  4RB0 A;  1ZG3 A;  5E1Z B;  5HOO A;  3RKW A;  1J75 A;  3KZY A;  1GXP A;  3GFJ A;  2D2W A;  1O7F A;  5L3C A;  5CVJ A;  3IRQ A;  1Z05 A;  1KQ8 A;  3F8C A;  1W5T A;  4EM0 B;  1U6G A;  3EQL F;  4CYD A;  3ISP A;  2LNB A;  2G7H A;  1BI1 A;  1JE8 A;  4UHT A;  4GGG A;  4AWX B;  4HQM A;  1B9N A;  3HTU A;  4ZYE A;  1TQM A;  4ZYH A;  3RI4 A;  1PDN C;  1OMI A;  1YS7 A;  3KCC A;  3VOD A;  4HZF A;  1RNL A;  1P4A A;  4HV5 A;  1SD6 A;  5FLX K;  1G3W A;  3Q5F A;  5K1Y A;  1PUE E;  1U2W A;  3T5X A;  1QNT A;  3QP5 A;  3FHZ A;  4LLG F;  4A2U A;  2ETH A;  2QUF A;  4KYW A;  3V4G A;  3V7R A;  1P4W A;  4P9U A;  4BYY A;  3BDD A;  1XCV A;  3SHF A;  2W25 A;  5HLG A;  3R0A A;  3I59 B;  3ZMV A;  5FGM A;  1I1S A;  2L4A A;  2F5E A;  1BIB A;  3GF2 A;  2Q8K A;  4ETS A;  1B6A A;  1HSJ A;  3SZT A;  1P2F A;  4A5N A;  1XSV A;  5DCM B;  2DT5 A;  4HF0 A;  4WCG A;  1P4X A;  1BIA A;  3DF8 A;  1LDJ A;  2BEO A;  1O57 A;  3MFK A;  3NEU A;  2O0Y A;  3J81 K;  2PG4 A;  5ILV A;  2Z3Y A;  4KIC A;  4UVC A;  3TQN A;  3FXQ A;  1BI2 A;  3K1P A;  2HOE A;  2ZKZ A;  2BBY A;  1MJA A;  1IRG A;  5BS6 A;  2CW0 F;  3NQO A;  2D45 A;  1RIO H;  3KP5 A;  1FYK A;  2RDP A;  3L7W A;  4HX4 A;  1XSX A;  2DO7 A;  2PMU A;  4KIF A;  1VTN C;  3CUO A;  2HGC A;  5CYV A;  4WX9 A;  1I6X A;  3IL2 A;  2P6T A;  4I7H A;  1FPQ A;  4Q4Z F;  4JK1 X;  1FLI A;  2HYG D;  1Z6T A;  1DPU A;  2EJR A;  2CFX A;  3HRM A;  2KIM A;  2FSW A;  2ZBK A;  4RAY A;  2A5Y B;  5ILU A;  2NS0 A;  1CF7 A;  4Y13 A;  2PBI A;  2OU2 A;  5ICC A;  4EJW A;  2H94 A;  1SD5 A;  5EEG A;  1D3Y A;  4NHJ A;  1SFX A;  1ZRC A;  2FF4 A;  5J8F A;  2FNP A;  1DP7 P;  1U5T B;  2Y48 A;  3EYI A;  2HR3 A;  5FFZ A;  3V8J A;  3IRR A;  2K27 A;  5AIQ A;  3P7N A;  5AON A;  1STZ A;  3KFW X;  2UXX A;  4FX4 A;  4DQ2 A;  1KU7 A;  4M73 A;  3MQ0 A;  1FP1 D;  2KKO A;  4OU0 A;  4XRF A;  3TKY A;  2BV6 A;  3OV8 A;  1D5V A;  1FBU A;  2Q0O A;  3GVA A;  5DD8 A;  2GWR A;  2MBF A;  1RUO A;  5HS8 A;  4OOI A;  4HLX A;  1UHW A;  4EGY A;  3LFK A;  2A6E F;  2IJL A;  3ECO A;  3F8M A;  3GXO A;  1QZZ A;  2P7C B;  1S6L A;  1TNT A;  2IA0 A;  5DD4 A;  3BOQ A;  2GQQ A;  4G9Y A;  4IHT A;  4LFU A;  2JTV A;  4PCQ A;  3K0L A;  2DU9 A;  1FOK A;  4BH9 A;  2HKO A;  4M9Z A;  1K6O A;  4A6D A;  1GXQ A;  5IT9 Z;  3RPU A;  1AWC A;  3FWE A;  4GYI A;  1SMT A;  5E8I A;  1UFM A;  5LHH A;  4MNU A;  2WC2 A;  2STT A;  1FBQ A;  3F3X A;  3E5U A;  4KN4 X;  3WTY C;  1LVA A;  1R1V A;  3MZH A;  2QEN A;  1R23 A;  2BYV E;  3VFZ A;  4L5I A;  4EGZ A;  2NNY A;  2M8E A;  1FWZ A;  2H6B A;  2IA1 A;  5HS9 A;  4QLC U;  3CUQ A;  2VBZ A;  4L9J A;  1ZLJ A;  2EFN A;  2O3F A;  2IVM A;  1SD4 A;  2YPR A;  1TQP A;  4MQ9 F;  4Z2Y A;  4KA4 A;  1S3J A;  4AVP A;  4ESB A;  3DP7 A;  3WGI A;  4RGU A;  1ZH5 A;  4YG2 F;  4IRH A;  5H6R A;  3G73 A;  3R60 A;  3MCZ A;  2BGC A;  1RI7 A;  4LLN A;  1L0O C;  2YR2 A;  3GX4 X;  4EM2 A;  3TO7 A;  2VBW A;  1U78 A;  5FD5 A;  2HEO A;  5DCF A;  4KMF A;  2CQK A;  5BQT A;  1Q1H A;  1S8N A;  4LMY A;  5FLX Z;  4YIF A;  2P5V A;  2L54 A;  3BZ6 A;  1MDM B;  3WTX C;  2D1H A;  3HHG A;  3Q9S A;  3C7J A;  3TDU C;  1XDS A;  3K1N A;  4I98 B;  3LST A;  4N9H A;  1LNW A;  2IW5 A;  2EB7 A;  3NRV A;  2P5K A;  4BXU A;  3CO6 C;  1IRF A;  3KP2 A;  3CJN A;  2IPQ X;  4OIQ F;  2UZK A;  2HS5 A;  3RKX A;  4MTE A;  1FSE A;  2M45 A;  2FQ3 A;  4O6J A;  4LK0 F;  3GZ5 A;  5FD6 A;  2VOP A;  3DEU A;  3ULQ B;  2COM A;  2XAF A;  3JTH A;  3WU0 A;  3H3U A;  1YG2 A;  1G3T A;  2ZME B;  1WSU A;  4KIG A;  2VE9 A;  1RUN A;  2Q2E A;  1YLF A;  3DPL C;  4B8X A;  1ON2 A;  2WTE A;  4EM1 A;  3SZP A;  1H9T A;  5BMZ A;  5D6F A;  2RN7 A;  4HAM A;  4CXF A;  1KGS A;  3W6J B;  2FBK A;  2Y0M A;  2W84 A;  3BPX A;  3M8E A;  4UV9 A;  2VE8 A;  4HF1 A;  2JPB A;  1FSH A;  2EA4 A;  3HUG A;  1A04 A;  1YQA A;  2XHK A;  2EK5 A;  2KIU A;  3O3K A;  3FXR A;  3GZ6 A;  4HLY A;  1B59 A;  4RB2 C;  1ON1 A;  2DLL A;  2CSO A;  3SQN A;  3ABU A;  2EWN A;  1G6N A;  2B0L A;  4HX8 A;  2OBP A;  4WF2 A;  3ZN0 A;  4IPA A;  1IXS B;  5E8G A;  1DPR A;  2HYF A;  2HDC A;  2UWM A;  4M71 A;  2V1X A;  2P8T A;  1XDU A;  4KNY A;  4D0P A;  2EFW A;  3FF5 A;  2KJC A;  3WTS C;  3CDH A;  1IN7 A;  4WXH A;  4ENM A;  1EH8 A;  2ESN A;  3M1E A;  3ZN1 A;  5ILS A;  4GO1 A;  3F6O A;  4IVN A;  4U0Y A;  4ZYG A;  5D5V B;  2QQA A;  4EJT A;  1R22 A;  4HA8 A;  3WU1 B;  4P9F A;  4EMS A;  5ICE A;  1EH6 A;  4A0Z A;  3QP6 A;  1UCR A;  4UV8 A;  3KZZ A;  3WGG A;  4ON0 A;  4MEX F;  2FNA A;  4G7Z F;  2FML A;  4UUV A;  1L3L A;  1KA8 A;  2DPU A;  4I0A A;  4M72 A;  1QBJ A;  1OYY A;  3PQJ A;  2X4H A;  3E6D A;  2RV8 A;  2P4W A;  5CLS A;  5IT3 A;  3IHU A;  1P92 A;  3F72 A;  2O6G E;  3C1D A;  3DFG A;  2DW4 A;  3TOB A;  1W7P B;  1YS6 A;  1JGS A;  3KEO A;  5AIP A;  3E6C C;  2XAJ A;  5LBQ A;  3QPT A;  2JZY A;  3KP3 A;  1FNN A;  1K7A A;  3FMQ A;  2V1D A;  4I0B A;  2ACJ A;  2XIG A;  2ADU A;  1HKS A;  3AAF A;  5J8C A;  1QGP A;  2W57 A;  2QBY B;  4L9T A;  3F21 A;  2WWY A;  3R0J A;  3VEP A;  5K5Q A;  1S7O A;  3ZQ7 A;  4I2O A;  4P5O A;  3JAM Z;  2QQB A;  1Z1D A;  3BY6 A;  3HSR A;  3O6B B;  3D0S A;  4LLL A;  4WXD A;  2NNN A;  2PI0 A;  5LGU A;  5LHG A;  3BP8 A;  3WTW C;  5DYM A;  2MLG A;  3WE3 A;  4LG0 B;  2O03 A;  2OD5 A;  1ZHF A;  5LRS A;  2NAZ A;  2XVC A;  1KYZ A;  1BJA A;  4YFX F;  4KUM A;  5F6F A;  5KK1 A;  4JBA A;  4G94 A;  2F5C A;  3J80 K;  1WI9 A;  3IC7 A;  1W7P D;  1FX7 A;  1E17 A;  1JXS A;  3KLN A;  2EFP A;  3U2R A;  5A2Q K;  2HQR A;  1USS A;  1HBX G;  3KET A;  5L3G A;  1MJ9 A;  1FYL A;  4OIR F;  4GCV A;  4L18 B;  1Z91 A;  1TBX A;  2R7D A;  2VOD A;  3B02 A;  1O3Q A;  1K79 A;  5ICF A;  3F8F A;  1IZ1 A;  5FO5 A;  2XAH A;  4P55 A;  2G9W A;  4U7B A;  2C6Y A;  5E20 A;  3VB2 A;  2GA2 A;  1I5Z A;  2LDU A;  1YIO A;  3BRO A;  4KFC A;  3GUD A;  3ML6 A;  1QO0 D;  4ENJ A;  4BHP A;  4EJV A;  2XUB A;  2QZ8 A;  5HS7 A;  5JFR A;  1KU2 A;  1O7L A;  2OA4 A;  1J9I A;  3I4P A;  2O61 A;  4L0Z B;  3MAJ A;  4NQW A;  2R3S A;  1H9G A;  1LJ9 A;  2L3D A;  2E1C A;  5E18 F;  2M5W A;  2KIF A;  1SFE A;  3F22 A;  3O2P E;  3LA7 A;  3BPV A;  3RYP A;  2CYY A;  1ZGA A;  1B9M A;  4WXC A;  2PJP A;  4I01 A;  1HXD A;  2H6C A;  1E2X A;  2ZO4 A;  4U7D A;  2VBX A;  4RB1 A;  2DI3 A;  2EA2 A;  3ECH A;  4O3M A;  1KYW A;  5CVV A;  3JW4 A;  3U1D A;  1BC8 C;  1QZY A;  3F8B A;  2OQG A;  5HLI A;  1V4R A;  4IRG A;  1R1T A;  4I09 A;  2VXZ A;  1SMY F;  2RC4 A;  3F6V A;  3QU6 A;  1LEA A;  1IUY A;  1Z6R A;  4Y17 A;  3RYR A;  3FZV A;  3QU3 A;  1IXR C;  1U5T A;  4U88 A;  2GZW A;  2EFO A;  4EJU A;  2HTJ A;  1ZGJ A;  1V3F A;  1P6R A;  2GXG A;  1R1U A;  1R00 A;  1HKT A;  1R7J A;  3FM5 A;  2FBH A;  4JQF A;  3E97 A;  3WG9 A;  2G7U A;  3FM3 A;  2V1U A;  1NHA A;  4G8X A;  3KEQ A;  1YFH A;  3QPH A;  2FRH A;  5HDK A;  1O3T A;  2FBI A;  4XLP F;  4LK1 F;  1O3S A;  2ZJ2 A;  1BM9 A;  3TDZ C;  2L02 A;  4BHB A;  3M8F A;  4HOB A;  5F1R A;  3LAJ A;  3L2C A;  4L5J A;  3WTV C;  2PQ8 A;  4IRI A;  1WWX A;  2L4M A;  3HIF A;  1ULY A;  1BC7 C;  3MEX A;  1YW9 A;  4XSX F;  5D8L B;  2RNJ A;  2XAQ A;  4Q5S F;  3K1M A;  4UXN A;  3M7G A;  2K02 A;  3CTA A;  4HV6 A;  1MDM A;  5LGT A;  2IP2 A;  3E5Q A;  5A2Q Z;  4XBF A;  1F5T A;  2MH9 A;  3HSF A;  5LGN A;  3H3Z A;  4M9X A;  1EV7 A;  1PP8 F;  5L3D A;  2LF7 A;  3WE2 A;  2OAZ A;  1IN4 A;  3BJ6 A;  1YTY A;  1J5Y A;  4ZH4 F;  3MZY A;  3LA2 A;  1PP7 U;  1DUX C;  2AXL A;  2DTR A;  2DQL A;  1BN5 A;  5BOX A;  1IW7 F;  1K78 B;  1UB9 A;  3EET A;  1T38 A;  4EJO A;  5L3B A;  5JVT A;  1XMK A;  1WQ2 A;  3KE2 A;  1MJB A;  1MKM A;  1XD7 A;  4EV0 A;  3DKW A;  3CO7 C;  4KMU X;  3RIR A; 
#chains in the Genus database with same CATH topology
 1ETY A;  4BXX J;  1UST A;  4B44 A;  4BQO A;  4LG3 A;  2Z9O A;  2FQ4 A;  2XAG A;  4X1E A;  5C4J J;  1X4P A;  4MFE A;  1OR7 C;  2O9L A;  3M1C A;  3SXY A;  1T6S A;  1HF0 A;  2ZXW H;  2J5P A;  2JSP A;  4XLA A;  4XSZ F;  3P9I A;  4CSW A;  3JSO A;  1WVR A;  1X3Z B;  3IAS 2;  1Z7U A;  4K2E A;  1TTY A;  4RM3 A;  2XRL A;  4ESF A;  3GFM A;  2LY2 A;  3BZK A;  5CVR A;  2E1N A;  2R7R A;  1OCP A;  3E6M A;  2ELH A;  2LSO A;  2FEZ A;  3LSK A;  3LSI A;  4NB5 A;  4Y15 A;  2V9P A;  1TNS A;  1N77 A;  2STW A;  3D5L A;  3GWZ A;  1U8B A;  4MTD A;  2DOF A;  4HDU A;  2AXT C;  5BPD A;  1UAA A;  6PAX A;  1D1C A;  2LBF B;  3SYT A;  2W24 A;  3DPU A;  3HYI A;  1R9T J;  5L3E A;  3VYT B;  4L9N A;  2I10 A;  2M87 A;  3A2K A;  1MNM C;  2Y30 A;  3WTU C;  2LF8 A;  2Z5U A;  5M3F J;  5HDG A;  2OZ6 A;  5TGT A;  4UNO A;  3GTL J;  1JKO C;  3EUK L;  4XKC A;  2H27 A;  3FBN B;  4O5V A;  1ZAR A;  1W7P A;  2W7N A;  5LD2 C;  1T8I A;  1MW7 A;  2I8D A;  5TRD A;  4MFD A;  2W85 A;  3H9Q A;  4CO8 A;  4HF2 A;  3P9C A;  4KIT B;  2KFD A;  4IJA A;  4PGG A;  3H0D A;  2A07 F;  3OIQ A;  2NYX A;  4PFP A;  5D4S A;  1OCR H;  4FX0 A;  5D4R A;  3SFI A;  3T8R A;  2KRF A;  4LGW A;  2JPC A;  5ERI A;  1U3E M;  2PMZ N;  3A02 A;  2K7L A;  4UVB A;  3ZP5 A;  4PGH A;  3BZC A;  1G8X A;  1X1B A;  5J40 A;  1VI0 A;  2W4S A;  1MGT A;  3OOP A;  2EZL A;  2VIX A;  1ZKG A;  5DEQ A;  2YX4 A;  4L9V A;  4HG2 A;  3KPH A;  3SFZ A;  3ZMD A;  3GFL A;  3L09 A;  2A68 F;  2Z1D A;  4XIC A;  2PMH A;  1G4D A;  2R5Z B;  4A6E A;  4OIP F;  2MYS A;  2P5L C;  4A0Y A;  1REP C;  1D0Y A;  1F36 A;  1ZTR A;  2MFZ A;  4RGS A;  1RKW A;  2J5O A;  3HBL A;  4CGZ A;  3FXL A;  4BHC A;  4UUS B;  4WK8 F;  5F64 A;  2KHM A;  4TV7 A;  2L0K A;  1ZN2 A;  2QLZ A;  1LFU P;  1WI3 A;  3LQR A;  4G7O F;  2XGD A;  4R8H A;  2HFH A;  1T98 A;  5EG0 B;  4E7J A;  2MH2 A;  1FT9 A;  5F0F A;  2E35 A;  1B72 A;  2O8X A;  1W1W E;  5GTI C;  1AOY A;  4AU7 A;  4XKV A;  2DA6 A;  4EVI A;  2RQP A;  2LD5 A;  2R93 J;  4AC0 A;  1FC3 A;  3QAH A;  4NC8 A;  2HKX A;  4LIV A;  4PSW A;  3DLA A;  3H5A A;  3E3V A;  4XLC A;  1V5E A;  1X3W B;  2MD5 A;  3V8L A;  1VND A;  4CZC A;  1HW2 A;  1RZ4 A;  3C18 A;  3ASN H;  3D5R C;  4EAT A;  3FXU A;  2BE5 F;  2F5V A;  2COB A;  5J6X A;  1ZGW A;  1S7A A;  3C2B A;  3CMM A;  1NK2 P;  2QWW A;  3OS2 A;  5E79 C;  2AO9 A;  4CYC A;  5EDN A;  1ITY A;  3PSI A;  3GTO J;  3PNY A;  2L2O A;  2NRA C;  3HTS B;  3OYF A;  1R36 A;  2QVO A;  3ONQ A;  4MQV A;  1HST A;  1XGO A;  4RGX A;  2ZJR F;  3I9V 2;  2MC4 A;  4II2 A;  4D5C A;  4HNU A;  4WWC A;  3BTJ A;  3G3Z A;  3CCQ I;  3ZQC A;  4M74 A;  2XV4 S;  5HDN A;  3QOP A;  2GAU A;  4QWQ A;  4XLN F;  3GBG A;  2DOD A;  2LVS A;  3FKI J;  2GBY A;  2LBF A;  4ZTF A;  3TP3 A;  5E3O A;  1B8I A;  3CC7 I;  2BXZ A;  3CUQ C;  4B4C A;  3U9G A;  2DOA A;  1YIJ I;  1KU9 A;  2LTP A;  3GTP J;  2EV5 A;  5DV5 A;  3IP4 B;  2VKD A;  5IP6 A;  3OR2 C;  2NVQ J;  4HW0 A;  5HVQ C;  2DQR A;  1WJ5 A;  1W4M A;  4BGD A;  3IUO A;  4BEH A;  3L9F A;  1ONV A;  2DMP A;  4HST A;  1A5J A;  3HSE A;  2A6T A;  4IXA A;  3ERE D;  3S1M J;  3L00 A;  3BG9 A;  3PNT A;  1J0R A;  2FD5 A;  2PFB A;  3FMR A;  4GYG A;  3JRH A;  3REO A;  1G3S A;  3HM5 A;  3LNQ A;  1Y0U A;  1ZYR F;  2QM3 A;  1E3O C;  2DAO A;  2KJB A;  1Y0N A;  1TW3 A;  4M3F A;  3JRG A;  1J59 A;  2GA1 A;  1U8R A;  1FJL A;  5LRR A;  3MD2 A;  1HKQ A;  3ZMS A;  2K4B A;  1F9N A;  3OY9 A;  4BAC A;  2EIN H;  2HU9 A;  2GXB A;  1O3R A;  4RLQ A;  3COA C;  3IH2 A;  2DYS H;  5IT9 K;  2GIV A;  3GTQ J;  5EEA A;  3WGH A;  4Q48 A;  1E3P A;  2F5D A;  4BQN A;  2JUG A;  3CCJ I;  1VQO I;  5E3L A;  5FKL A;  3DTI A;  2DK8 A;  1OR7 A;  1JTX A;  1NG7 A;  4HQE A;  2Z33 A;  3OOU A;  3HRS A;  2IXS A;  2HZT A;  2VAS A;  2OF7 A;  1TLH B;  3CCV I;  2IGK A;  5JI6 A;  4AIK A;  4BQA A;  2IAI A;  1WHU A;  3RCO A;  1S29 A;  5KCM A;  1WJE A;  3CLO A;  5E1W A;  2K40 A;  1TQI A;  4FQG A;  4HRI A;  4JX4 A;  2K4J A;  3UNG C;  4F91 B;  5FKK A;  3MN2 A;  5IP9 J;  2K9S A;  2ISZ A;  2VT3 A;  1MMS A;  3H0G J;  1HW1 A;  2XAS A;  1TC3 C;  1QPI A;  2VQC A;  4AIH A;  2ZXI A;  4LJZ F;  1FBS A;  3HOT A;  2CV0 A;  1OKR A;  4CIC A;  1FP2 A;  2OPT A;  5FRN A;  2KMU A;  1IN6 A;  3ABT A;  4D1Q A;  5IPA A;  3HKZ N;  2DA3 A;  3EUH A;  4AYB A;  3CLQ A;  2IS4 A;  2ZFU A;  3D5S C;  3Q9V A;  3TO9 A;  4ZZD A;  1TZL A;  3L2U A;  4KN7 X;  3A1Y A;  3FBI B;  2MLK A;  4BY1 J;  2VKH A;  3DXJ F;  4LB5 A;  2HQN A;  4RLF A;  3C2H A;  2VI6 A;  5DUK A;  1OPC A;  1T0F C;  3B6C A;  5FLV A;  4OIO F;  1BBY A;  2B63 J;  4KIB A;  1CF7 B;  3LSP A;  1YO5 C;  4KDP A;  5DUI A;  3PQK A;  2DBB A;  4JOM A;  5FRO A;  3F8N A;  3K4K A;  3EYY A;  4HEA 2;  4DNC A;  2HDD A;  4ASN A;  1J2X A;  4RAF A;  2CQN A;  1XGM A;  3MWM A;  3R61 A;  4B09 A;  1ZRE A;  2PLY A;  1GV2 A;  2CG4 A;  2JVG A;  1T2K A;  1K78 A;  2CWE A;  3FK7 A;  5D5X B;  1ODD A;  1LUJ B;  1DU6 A;  3RKY A;  4MEY F;  2ZFW A;  2ZXJ A;  2ZME A;  3UKG A;  2DMU A;  3OWT A;  1R4N B;  4A3G J;  1XX5 A;  1W36 C;  2V7F A;  4PUS A;  3I71 A;  3VYU B;  4RB3 C;  4GDF A;  1I27 A;  4MHG A;  3I4M J;  4H0E A;  3V8K A;  3HRU A;  3ELK A;  1YJW I;  3WHB A;  1IF1 A;  4S04 A;  4N9I A;  4F3Q A;  1APL C;  2R7X A;  2EPF A;  4XR6 A;  3RDI A;  1YJ9 I;  4GXO A;  3N05 A;  4U87 A;  4XQF A;  3K4M A;  3S3N A;  3OIP A;  1X2N A;  1OCT C;  2HNH A;  4D7M A;  5H20 A;  1ENH A;  4PDK A;  4M6X A;  2CV2 A;  2DFI A;  1QQI A;  1WKM A;  4EQQ A;  1JHH A;  1TP4 A;  3LSJ A;  4W1U A;  1BI0 A;  4IHV A;  3DV8 A;  2RKH A;  2L7K A;  2FA5 A;  4G6D A;  3OYD A;  3WTZ A;  2ECC A;  2F5F A;  4CCO A;  2E2J J;  3PIO F;  2WAF A;  3N97 A;  5GTH C;  1ZLK A;  4XNF A;  1TW2 A;  1SVO A;  5L3F A;  4M6V A;  2P6S A;  4ITV A;  3CF5 F;  3S2D J;  4V2G A;  3ZQG A;  4HDV A;  4NC6 A;  3KP4 A;  2E36 A;  3EDP A;  1IN8 A;  3O8G A;  2QSH X;  2BHY A;  4YII A;  2V6C A;  3F9K A;  2H1L A;  2XKP A;  3GFI A;  1IUF A;  3GEZ A;  5LLQ A;  4FE7 A;  3ABK H;  1ZG5 A;  1ZAO A;  1FY7 A;  4V19 K;  1F1Z A;  3TOA A;  1T39 A;  5KNL A;  2ISY A;  4E70 A;  1JHF A;  1R5H A;  1HW5 A;  2PEX A;  3AKZ A;  2XB5 A;  2LY1 A;  2GM4 A;  2FOK A;  4ENN A;  2OZU A;  3H35 A;  1SD7 A;  2FU4 A;  2NOJ B;  3BJO A;  3J7Z I;  1JKQ C;  2VQL A;  1NG6 A;  4XRM A;  1GLN A;  1IV6 A;  3IKV A;  3M4O J;  2ESH A;  4IOC F;  3FIW A;  1D1B A;  3E5X A;  3IH4 A;  3OYB A;  4BDZ A;  2CH0 A;  1R5G A;  1WRJ A;  4AIJ A;  3GO5 A;  3LWF A;  2VN2 A;  5CVU A;  1V5F A;  5KVR A;  4QSH A;  3S1Q J;  1BJZ A;  1Y1V J;  1TWC J;  3MKL A;  1IJW C;  4A3K J;  1XCB A;  4U0W A;  2JT1 A;  4BUP A;  3BT9 A;  3BJA A;  1ETQ A;  2D1V A;  2QBY A;  2ECB A;  2XDV A;  2IA2 A;  1XC5 A;  4F7Z A;  4YFK F;  4OMZ A;  4OMY A;  1MMD A;  2V9K A;  1FZP B;  3ZMU A;  2XRO A;  3K9T A;  1VQ8 I;  3HDD A;  1IV8 A;  3I53 A;  3H9G A;  4M6Y A;  3LAP A;  2XKO A;  2F4O B;  2E7W A;  1CGP A;  4ZDO A;  1HQC A;  2EIM H;  3IKT A;  2AS5 F;  1G3Y A;  4ZTJ A;  5LEJ A;  1EJ9 A;  2X0L A;  1XSD A;  2VON A;  2R7V A;  2VPR A;  3J7A O;  1UZC A;  2EV6 A;  4IZZ A;  1S9H A;  4IF4 A;  4LG0 A;  5E1X A;  3M8J A;  3KLO A;  3K2Z A;  3C2G A;  5DCM A;  4RS8 A;  1X58 A;  1K6Y A;  2UXN A;  1XB4 A;  2K5C A;  3KP6 A;  3LL7 A;  3VSK A;  4XMY A;  3W6K B;  1D8J A;  3I54 A;  2XF7 A;  1KQ9 A;  2AQF A;  2VQH A;  4RAZ A;  2ZB9 A;  1SAX A;  3QYF A;  1AKH A;  1GVJ A;  1UJ8 A;  2WB1 A;  3HZJ A;  3MZ8 A;  4FIS A;  4IEJ A;  3I4N J;  3JTG A;  1IAW A;  4JX6 A;  1ZRF A;  1MD0 A;  3ROU A;  3VSL A;  4HX7 A;  3OIO A;  1GT0 C;  4S05 A;  2V79 A;  4KT5 C;  1FIP A;  3CCY A;  1IC8 A;  3HPG A;  3TED A;  2P7V B;  2ME6 A;  4OIN F;  2F4I A;  1GDT A;  5LEK A;  3S2W A;  3J7A Y;  2JMW A;  3GME A;  3HHH A;  1MH4 A;  2DJN A;  1T0F A;  2HQ5 A;  4Q47 A;  2IRF G;  2VC0 A;  1V54 H;  2KP6 A;  4AD9 A;  2M4G A;  4HSR A;  4R79 A;  4A3C J;  4PJJ A;  2XF6 A;  4ANJ A;  1N75 A;  5B3S H;  4F92 B;  2M1B A;  3H92 A;  1Y1W J;  5CKT A;  4HYE A;  4MLO A;  5D5U B;  1YW7 A;  5D8K B;  3B73 A;  5JR3 A;  2HTS A;  3OYH A;  2R0Q C;  3OS1 A;  4E7H A;  4XOR A;  2EIJ H;  4R1H A;  1PVE A;  2XB0 X;  3DQV C;  1XMA A;  3GCM A;  3MKY B;  4IL6 C;  1X4O A;  1ZQ3 P;  3S14 J;  3PFI A;  3T1B A;  1WZ2 A;  5F08 A;  3CCM I;  1VQL I;  1R58 A;  1NH3 A;  1X3U A;  2CO5 A;  1T33 A;  2X1E A;  4BNC A;  1KQ0 A;  1U5T C;  2WB1 N;  3SDB A;  5IP7 J;  2A69 F;  4M3G A;  1XTA A;  5K7F A;  1I1G A;  5JHU A;  1B4A A;  1QPM A;  2A61 A;  4ENK A;  3RPQ A;  1X1A A;  4L0Y B;  3GW2 A;  2MAB A;  1MMN A;  3I59 A;  3R4K A;  2R7Z J;  2ID3 A;  1DQU A;  2XPW A;  3I5U A;  2DDA A;  3F23 A;  2JUC A;  3BWG A;  2DOE A;  2ZCW A;  1VQM I;  2HPM A;  3ZR8 X;  4FET A;  5H6Q A;  3CMY A;  4V2F A;  2Y75 A;  3J80 Z;  4A5M A;  3CUQ B;  2LKP A;  4XLH A;  3T0Y A;  1FIA A;  1OYI A;  1OYW A;  1WH5 A;  2EFQ A;  2ELK A;  3I0T A;  2R5Y B;  1CQT A;  3H5R A;  1EH7 A;  4N0B A;  1TWA J;  3CD6 I;  2F2E A;  5EEH A;  3KYD B;  2PN6 A;  1YI2 I;  3WTT C;  2EIK H;  3G1L A;  4J00 A;  4LD5 A;  2QYO A;  2H09 A;  1J7K A;  3VOE A;  3JAM K;  3L1P A;  3CCR I;  1VQ4 I;  1OIS A;  1D8K A;  2CW7 A;  3K10 A;  5FJ8 J;  4JP0 A;  2CGP A;  3F0C A;  4RDU A;  3HRT A;  4BBR J;  3OSG A;  3C3W A;  3LSH A;  1ERD A;  3GLX A;  2UV1 A;  3TO6 A;  2CW8 A;  1UHM A;  2NS8 A;  2EV0 A;  2ZNY A;  1KU3 A;  4G6Q A;  1GV5 A;  2M4K A;  5ICG A;  4UUT A;  3S15 J;  1C0W A;  3OYE A;  3DKX A;  4IHS A;  3K4J A;  4HNT A;  1F4K A;  1LB2 A;  4U0V A;  4C2M J;  3M9A A;  1LQ1 A;  4CDG A;  3V7S A;  4AVZ A;  3K4B A;  5DDG A;  5TJJ A;  2ZSI B;  2VB6 A;  3WOD F;  2DK5 A;  1XN7 A;  3G2B A;  2VC1 A;  1H0M A;  2A3S A;  2VBY A;  1UG2 A;  5TIS C;  4A12 A;  2MD0 A;  3DPT A;  4II3 A;  5IY5 H;  4IKF A;  3CDI A;  3KYC B;  3PUF A;  2Z99 A;  3BR3 A;  1RPW A;  1MZB A;  2OUM A;  1BI3 A;  1IRZ A;  2X6X A;  4OWR B;  1Y8Q B;  5J4Y A;  3GTM J;  4YEL A;  4FT8 A;  4UVA A;  3G6E I;  3FXK A;  4BJ5 C;  2ID6 A;  5FB2 A;  3FX3 A;  5M5Y J;  3RJP A;  3I64 A;  3N4M A;  2MC3 A;  3I58 A;  5D5W B;  1MND A;  3CCS I;  1YYV A;  1B1B A;  3HOZ J;  4IO9 F;  3OYI A;  2WAD A;  1YIT I;  5BPI A;  1ZG1 A;  5D6E A;  4I6Z A;  5CVI A;  4ZYD A;  1YX5 A;  2EH3 A;  2RNG A;  2YSR A;  3DU5 A;  3IWZ A;  2KLO A;  5JLX A;  2Y31 A;  1LPQ A;  1BA5 A;  4NUB A;  4KIS A;  2QF7 A;  1IDZ A;  3BTL A;  3HB9 A;  2HVS A;  1UG0 A;  2RGV A;  4YFN F;  4C2T A;  3RTR A;  2PJR A;  2VQG A;  1VFC A;  1JGG A;  2RVC A;  2MA3 A;  4A3L J;  2R7F A;  3O8H A;  4CCK A;  4LB6 B;  1IRX A;  3AL0 C;  2DPD A;  1RET A;  2DCE A;  3ZMT A;  1W5S A;  4B47 A;  2JSC A;  3OL3 A;  3ZMZ A;  1DGW Y;  3ZQI A;  1LDD A;  3LSG A;  5K5O A;  1HOM A;  2LLK A;  3CJR B;  2M9H A;  4C2U A;  5EF6 A;  3KP7 A;  2TRT A;  1FOY A;  2DMN A;  2FE3 A;  3ASO H;  4E7L A;  3J81 Z;  2JWT A;  1S72 I;  2DMQ A;  2K86 A;  3LQQ A;  3LA3 A;  3U21 A;  4MGR A;  1ZRD A;  1LDK B;  5HNH A;  3JSP A;  1MMA A;  2YX7 A;  3MVP A;  2TCT A;  3DBL B;  5ED4 A;  5FFX A;  1IN5 A;  2IT0 A;  4ZZL A;  1DDN A;  2OQR A;  4HBL A;  4DYR A;  2HI3 A;  1HLV A;  4YEJ A;  2EQR A;  1XGN A;  5DTD A;  1WJB A;  2E7X A;  3BG7 A;  2OV7 A;  1SFU A;  4Y33 A;  2IGO A;  5EYR A;  3E6B A;  2LRD A;  4M9S A;  5KAI C;  3RSN A;  3T8T A;  5FKM A;  3TW6 A;  4A0X A;  4M3D A;  3DCF A;  2QQ9 A;  3EPZ A;  3LOC A;  4XN3 A;  5K5R A;  5J4V A;  1YW8 A;  3LSM A;  2KPM A;  4CHU A;  3HKZ A;  2M7B A;  2WV0 A;  2QSG X;  2BZT A;  2JRT A;  2XGX A;  3K4L A;  3W2A A;  3L2V A;  3NWS A;  1MNE A;  3A4C A;  4I02 A;  2HWV A;  4L5E A;  3HPH A;  4RGR A;  3K4C A;  5CJ9 A;  1MBE A;  1XGS A;  3V7C A;  4P96 A;  1NK3 P;  3HOU J;  1Z7L A;  2YU3 A;  2LY9 A;  3K69 A;  3ERM A;  2V9V A;  4CZZ A;  3P9K A;  5LHI A;  4XL9 A;  1Z9C A;  2VOO A;  1P7J A;  4E4H A;  3IWF A;  1Y6I A;  4FHT A;  5JLW A;  3K7A J;  4B48 A;  4ESJ A;  2FXA A;  2OTJ I;  1FYM A;  1QVT A;  1GHC A;  2XRN A;  4XN0 A;  5J3L A;  4BAY A;  2F48 A;  1LEB A;  3HOS A;  4EEF G;  5E17 F;  2I5U A;  2ZNZ A;  3L2W A;  2OJE D;  2AHQ A;  1OCC H;  3S2H J;  3R6S A;  3TL4 X;  3RQ4 A;  2KIS A;  1QHG A;  1IXC A;  1U9N A;  2M30 A;  4DZP A;  4G7H F;  3BR2 A;  4A3E J;  2M7A A;  5HLH A;  1K4T A;  2AQE A;  3TGN A;  2IS6 A;  3QRF F;  2FMY A;  2TDX A;  4PZJ A;  3ZPL A;  2VT2 A;  3PO2 J;  2DFF A;  3HOW J;  2L01 A;  3FMS A;  1BOA A;  2A6H F;  1WH7 A;  4RB0 A;  1ZG3 A;  2JA2 A;  3HJE A;  1A36 A;  2O5R A;  3UR3 C;  3DKY A;  5E1Z B;  3BR0 A;  5HOO A;  3RKW A;  3ZXS A;  1J75 A;  2HQA A;  3KZY A;  1FTZ A;  3JRF A;  2CU7 A;  3PNV A;  5BNG A;  1GXP A;  3GFJ A;  5M5W J;  2H8R A;  5IYD J;  2D2W A;  1TWF J;  1O7F A;  5L3C A;  1MBK A;  5CVJ A;  4AM3 A;  2ELJ A;  3IRQ A;  1Z05 A;  2F4M B;  5IYC J;  2Y0S N;  1ETV A;  1BR1 A;  4A3D J;  1KQ8 A;  3F8C A;  2WV1 A;  3I56 I;  1T08 B;  1W5T A;  4EM0 B;  1U6G A;  3ZQF A;  3EQL F;  4BJ6 C;  2BY1 A;  4CYD A;  3ISP A;  2LNB A;  2BY3 A;  2G7H A;  1BI1 A;  2Y9Y A;  4MIM A;  4C3I J;  1B72 B;  2RAE A;  1DGR M;  1E3H A;  1JE8 A;  4UHT A;  4GGG A;  3RQI A;  4HQM A;  4AWX B;  1B9N A;  3HTU A;  2O8K A;  4ZYE A;  1TQM A;  2XSD C;  4ZYH A;  3RI4 A;  1PDN C;  2KDO A;  1OMI A;  5HLT A;  4Y4R A;  1YS7 A;  3KCC A;  3VOD A;  4DZJ A;  4HZF A;  1VZ0 A;  1RNL A;  1J09 A;  2W82 A;  1P4A A;  4HV5 A;  1SD6 A;  3G1M A;  5FLX K;  1G3W A;  2HVQ A;  2KRC A;  1F43 A;  3Q5F A;  3QOE A;  5K1Y A;  1PUE E;  1I3Q J;  1U2W A;  3T5X A;  1QNT A;  3QP5 A;  4A2U A;  4LLG F;  3FHZ A;  4A93 J;  2ETH A;  2QUF A;  1K4S A;  4KYW A;  3V4G A;  1HA8 A;  2EBI A;  3V7R A;  1R4M B;  2BHZ A;  3W2V A;  3SEZ A;  1P4W A;  4P9U A;  4BYY A;  3BDD A;  1XCV A;  3SHF A;  4NDL A;  3HUG B;  2W25 A;  4D5F A;  5HLG A;  1X2M A;  2V6E A;  2NVT J;  3R0A A;  3OR1 C;  3I59 B;  2ME0 A;  2XGC A;  5FGM A;  3ZMV A;  2JRM A;  4IOA F;  1I1S A;  2L4A A;  2YS9 A;  5FKO A;  3NAR A;  2F5E A;  1BIB A;  3KX2 A;  1JT0 A;  2KT0 A;  3GF2 A;  3CZ6 A;  2HZD A;  2Q8K A;  4ETS A;  1B6A A;  1HSJ A;  3CME I;  2P81 A;  3MMY B;  4M3E A;  3SZT A;  1EF4 A;  1P2F A;  3HOV J;  4A5N A;  1XSV A;  2LP0 A;  5DCM B;  3ZQQ A;  4BEH B;  2FOW A;  3IAM 2;  3OYG A;  2DT5 A;  3JRA A;  4HF0 A;  1JT6 A;  5F27 A;  4WCG A;  1P4X A;  4UY8 I;  3CJQ B;  3VWB A;  1BIA A;  3DF8 A;  1LDJ A;  2ICW G;  3TP0 A;  2BEO A;  2CQ7 A;  2QEX I;  1O57 A;  3DBR B;  3MFK A;  2HXO A;  4A69 C;  1P9Q C;  3NEU A;  2E60 A;  1EKE A;  2O0Y A;  1FOW A;  3J81 K;  3CF2 A;  1WFX A;  2PG4 A;  5ILV A;  1IGN A;  1VQ9 I;  2Z3Y A;  1M1E B;  3H1C A;  3JCU C;  2H1K A;  2E34 A;  5J47 A;  2L9V A;  1FEX A;  4KIC A;  4UVC A;  3TQN A;  3FXQ A;  2BXY A;  3ABL H;  3W3C A;  1OLT A;  1BI2 A;  3K1P A;  2HOE A;  4E7I A;  4A3I J;  2ZKZ A;  2BBY A;  1MJA A;  4A3J J;  4Y52 J;  1IRG A;  1PJR A;  2ZXH A;  5BS6 A;  4XOT A;  2CW0 F;  2K9N A;  3OYJ A;  3NQO A;  4A3F J;  2D45 A;  4KT6 A;  1U9O A;  2E1M C;  1RIO H;  3KP5 A;  3DTK A;  4ZJZ A;  2RDP A;  1FYK A;  3L7W A;  4HX4 A;  1XSX A;  2VJ5 A;  4B3X A;  1GVD A;  1YHQ I;  3S16 J;  2DO7 A;  2PMU A;  3PM1 A;  4KIF A;  3CC2 I;  2BW3 A;  1VTN C;  3CUO A;  3OYK A;  2DT7 B;  1ETX A;  2HGC A;  5CYV A;  1I3A A;  3A03 A;  4WX9 A;  1K83 J;  1I6X A;  3B6A A;  3ZQL A;  3HC7 A;  2X1C A;  2WAE A;  5J1Y A;  2IGN A;  3IL2 A;  1WGX A;  3HOY J;  2P6T A;  4I7H A;  1JJ6 C;  2NVY J;  1FPQ A;  4X6A J;  4Q4Z F;  4JK1 X;  1FLI A;  2HYG D;  1Z6T A;  2QA4 I;  1DPU A;  2EJR A;  2B7E A;  2CFX A;  2X85 A;  3BQZ A;  2JJ7 A;  3FXO A;  2DTZ A;  4FE4 A;  4MO7 A;  4PJL A;  1H89 C;  3HRM A;  2KIM A;  2VPL A;  2FSW A;  2ZBK A;  4BBS J;  5CQG A;  4RAY A;  3KZI C;  2M8G X;  2A5Y B;  5ILU A;  4AUX A;  2NS0 A;  4XON A;  1CF7 A;  4Y13 A;  2PBI A;  4QPQ A;  3CES A;  2OU2 A;  2QSF X;  2VKV A;  5ICC A;  1W36 D;  4C30 A;  4EJW A;  2H94 A;  1SD5 A;  1TT5 B;  5EEG A;  1D3Y A;  4NHJ A;  1SFX A;  1ZRC A;  2FF4 A;  2LK2 A;  1AA7 A;  5J8F A;  2FNP A;  1JUM A;  2Y69 H;  1DP7 P;  1YRN B;  2NS7 A;  2GLO A;  5LFA A;  1U5T B;  1WJF A;  2Y48 A;  3EYI A;  2LMD A;  2HR3 A;  5FFZ A;  5E3N A;  3V8J A;  3H36 A;  3IRR A;  2K27 A;  5AIQ A;  3P7N A;  5AON A;  1D5Y A;  3PO3 J;  1STZ A;  4CH7 A;  4RMN A;  3KFW X;  1YRN A;  2P0W A;  3NAU A;  2UXX A;  4KJZ A;  4FX4 A;  1RRJ A;  4DQ2 A;  1KU7 A;  4M73 A;  2DA2 A;  3MQ0 A;  1FP1 D;  2KKO A;  2HVR A;  4C9Y A;  1MH3 A;  4OU0 A;  3CP8 A;  4XRF A;  2BOL A;  3TKY A;  2CFO A;  2DN0 A;  2BV6 A;  2X6W A;  3OV8 A;  1D5V A;  3BG3 A;  4DBQ A;  2K9Q A;  1YE9 A;  1JKR C;  3DU6 A;  1OQY A;  1FBU A;  2A5W A;  3FK6 A;  2Q0O A;  3GVA A;  5DD8 A;  2GWR A;  2DMT A;  2MBF A;  4PJ0 C;  3HOX J;  1MMG A;  1RUO A;  5HS8 A;  4OOI A;  5M3M J;  2G0E A;  3DWL E;  4LIU A;  3ZGK A;  1Z21 A;  1UHW A;  4HLX A;  4EGY A;  4BE0 A;  3LFK A;  2A6E F;  2IJL A;  2PX9 A;  3ECO A;  3F8M A;  4GFB A;  5GAH J;  3CQZ J;  2X51 A;  2K3F A;  3GXO A;  4PJN A;  5FLM J;  1O4X A;  4BE2 A;  1QZZ A;  3QYE A;  2P7C B;  1S6L A;  2KZV A;  1TNT A;  2IA0 A;  1YJN I;  2M34 A;  5DD4 A;  3DEW A;  1X19 A;  5F0C A;  3BOQ A;  2GQQ A;  4G9Y A;  5JHF A;  4IHT A;  4LFU A;  2JTV A;  2CUZ A;  3AG4 H;  4PCQ A;  3K0L A;  4G12 A;  1OCZ H;  2DU9 A;  1FOK A;  2VXD A;  3E0J B;  4BH9 A;  2HKO A;  4M9Z A;  1MSE C;  1K6O A;  4A6D A;  1QZE A;  1GXQ A;  3E7L A;  5IT9 Z;  3RPU A;  1AWC A;  1DU0 A;  4C3J J;  3FWE A;  1ZR2 A;  5IOZ A;  4GYI A;  1SMT A;  5E8I A;  3RZO J;  1QA6 A;  1UFM A;  3HGG A;  5LHH A;  4MNU A;  2WC2 A;  2STT A;  1FBQ A;  1N25 A;  3E5U A;  3F3X A;  4KN4 X;  1LVA A;  1R1V A;  4X0G A;  3WTY C;  3MZH A;  2QEN A;  2BY0 A;  1R23 A;  2BYV E;  3VFZ A;  2K3P A;  4L5I A;  1BOB A;  2FX0 A;  3DEE A;  1SVM A;  4EGZ A;  4CCJ A;  2NNY A;  2M8E A;  1A31 A;  1FWZ A;  2H6B A;  2W1O A;  3HEF A;  3LMM A;  3RKQ A;  2IA1 A;  2LRE A;  5HS9 A;  2K85 A;  1ZEL A;  4QLC U;  3CUQ A;  2VBZ A;  4DGW B;  2L7F P;  4L9J A;  4Y3O A;  2W00 A;  1MBG A;  1ZLJ A;  2EFN A;  2XAU A;  2XGE A;  2O3F A;  2WA0 A;  2E5N A;  2R5Y A;  2IVM A;  2X48 A;  2MW8 A;  3V42 A;  2MGQ A;  3CCE I;  4DW6 A;  4HNV A;  1SD4 A;  2YPR A;  1TQP A;  3OS0 A;  4MQ9 F;  4Z2Y A;  5H2F C;  4KA4 A;  1S3J A;  4AVP A;  5F1J A;  2GOX B;  1SVL A;  1OFC X;  1WCM J;  3BR5 A;  4NNJ A;  4ESB A;  1Y8R B;  1V5G A;  4BKX A;  1AU7 A;  3DP7 A;  3FKJ A;  3WGI A;  1LE8 B;  4RGU A;  3HL2 A;  2JQ7 A;  2V26 A;  5GP9 A;  4IQJ A;  1ZH5 A;  1BR2 A;  4PSX A;  5KHD A;  4YG2 F;  2LKS A;  2IS1 A;  3ZRG A;  3WU2 C;  2CS3 A;  4IRH A;  1A35 A;  3VYR B;  1LE8 A;  2FJ1 A;  5H6R A;  4XID A;  1V55 H;  3G73 A;  3R60 A;  3MCZ A;  2VLA A;  4CCN A;  1W0T A;  2BGC A;  3ESW B;  1RI7 A;  4E7S A;  4LLN A;  3CJT B;  4XRS A;  3LFU A;  1L0O C;  2YR2 A;  3GX4 X;  4BE1 A;  2HYJ A;  5J1R A;  4AYB N;  4EM2 A;  5B5E C;  3TO7 A;  4AID A;  2VBW A;  1U78 A;  2KL4 A;  5FD5 A;  3U1K A;  2HEO A;  5DCF A;  2QQ8 A;  3FXM A;  4CCL A;  4KMF A;  3QPL A;  2CQK A;  2KRH A;  5BQT A;  1Q1H A;  1S8N A;  4LMY A;  5FLX Z;  4YIF A;  3OSF A;  2P5V A;  2OC6 A;  2L54 A;  1H88 C;  3BZ6 A;  2NVX J;  2A05 A;  1MDM B;  2QGU A;  3GTJ J;  1HCR A;  3WTX C;  2D1H A;  2ZC2 A;  3HHG A;  2JN6 A;  1LFP A;  3SDG A;  3Q9S A;  3Q0U A;  3C7J A;  3TDU C;  2DFH A;  3J7Y J;  3MKW B;  1XDS A;  3K1N A;  2R7W A;  4I98 B;  1BW5 A;  3AFH A;  3LST A;  4N9H A;  1B8I B;  4NC7 A;  2V4J C;  3S1N J;  1LNW A;  2IW5 A;  2EB7 A;  1WJA A;  5GPA A;  4BU2 A;  3NRV A;  2P5K A;  4BXU A;  2JA8 J;  3CO6 C;  1IRF A;  3KP2 A;  4ABZ A;  3CJN A;  2IPQ X;  2JK3 A;  5C3E J;  4OIQ F;  2UZK A;  2HS5 A;  1TWG J;  3RKX A;  4MTE A;  1AHD P;  1FSE A;  2M45 A;  2FQ3 A;  3K4N A;  2E71 A;  3M07 A;  4O6J A;  5GPC A;  3M3Y J;  2R7O A;  5EZH A;  3PUB A;  3GZ5 A;  4LK0 F;  5FD6 A;  2VOP A;  3DEU A;  1PUF A;  3ULQ B;  1QRY A;  3WG7 H;  3RZD J;  1I50 J;  2COM A;  2DFE A;  2XAF A;  3BCB A;  3QOD A;  5CQE A;  3JTH A;  3W6V A;  3WU0 A;  3QWL A;  4NBQ A;  2GXA A;  2XSJ C;  1FTT A;  3H3U A;  1YG2 A;  3P5J A;  1G3T A;  1RKT A;  1AKH B;  1R49 A;  2ZME B;  1HDP A;  1VF9 A;  3I55 I;  1ETW A;  1WSU A;  3H5N A;  3KYL A;  4KIG A;  2VE9 A;  1D0X A;  1Z0X A;  4F52 A;  1RUN A;  2BVM A;  2Q2E A;  3L2Q A;  3BLY A;  1YLF A;  3DPL C;  1GUU A;  4FTH A;  4B8X A;  1ON2 A;  2WTE A;  4EM1 A;  3SZP A;  3DTE A;  1H9T A;  2X9D A;  2LR8 A;  5BMZ A;  5D6F A;  1EA3 A;  2RN7 A;  4HAM A;  1T56 A;  3S1R J;  4FAS D;  2K9M A;  4CXF A;  4HPQ A;  1KGS A;  3W6J B;  2FBK A;  4FCY A;  2JA6 J;  2Y0M A;  4QTR A;  2R7S A;  2CV1 A;  3IV5 A;  2W84 A;  4IQ4 A;  3BPX A;  3M8E A;  4UV9 A;  2VE8 A;  4BXF A;  4HF1 A;  3QYB A;  5B66 C;  1I6H J;  1LVK A;  2JPB A;  1FSH A;  3PIP F;  3PSF A;  2EA4 A;  3CDL A;  3HUG A;  2QKM B;  1MBF A;  1POG A;  1UMQ A;  1A04 A;  1YQA A;  4JYK A;  1JKP C;  1SEU A;  2XHK A;  2EK5 A;  2L7M P;  2KIU A;  4DOZ A;  5HOD A;  3O3K A;  3I3L A;  2D5V A;  3FXR A;  1TL8 A;  1BR4 A;  2XPV A;  3GZ6 A;  1YX3 A;  4HLY A;  1B59 A;  3BTC A;  4RBO A;  2RQQ A;  4DIQ A;  4RB2 C;  3CCL I;  1BL0 A;  1ON1 A;  3GTG J;  2DLL A;  3OYA A;  4IHW A;  2CSO A;  3SQN A;  2HOS A;  3ABU A;  2X6O A;  4XM3 A;  2EWN A;  1H8A C;  1Z3Y A;  1G6N A;  1W5C C;  2B0L A;  4HX8 A;  4DYQ A;  5EGO B;  4S0H B;  4Z6Y A;  1ZK8 A;  4W97 A;  1XG1 A;  2OBP A;  4WF2 A;  1SFK A;  2CUJ A;  3ZN0 A;  4IPA A;  1IXS B;  1X1P A;  5E8G A;  2IBD A;  1DPR A;  2GOM A;  4XLE A;  2HYF A;  1R6R A;  1D1A A;  2HDC A;  3Q3S A;  1WJC A;  2UWM A;  4M71 A;  3ABM H;  2JA5 J;  2V1X A;  2P8T A;  3EUA A;  3OYC A;  1XDU A;  2L7Z A;  2E5Z A;  1UHS A;  4KNY A;  1G59 A;  2CQX A;  2M3A A;  4D0P A;  2EFW A;  3FF5 A;  2M0M A;  5DM7 F;  2KJC A;  3WTS C;  3CDH A;  1IN7 A;  2Y0S A;  1VQN I;  4WXH A;  4ENM A;  1EH8 A;  2ESN A;  3M1E A;  4RM2 A;  3ZN1 A;  4Y7N J;  2LYC A;  2VUM J;  5ILS A;  4GO1 A;  2EZI A;  9ANT A;  1PUF B;  2N8G A;  3F6O A;  4IVN A;  4U0Y A;  4UB6 C;  4ZYG A;  5D5V B;  1ORK A;  2QQA A;  3VYS B;  1R22 A;  4EJT A;  4HA8 A;  3WU1 B;  4P9F A;  4EMS A;  4BJT A;  5ICE A;  1HC8 A;  2V1N A;  1EH6 A;  3PJR A;  2BVL A;  4A0Z A;  3AG1 H;  1I39 A;  3S3O A;  1ACI A;  3QP6 A;  1UCR A;  4E6K G;  5B1A H;  2X6Y A;  1JI8 A;  4UV8 A;  3KZZ A;  3WGG A;  4D7N A;  4H4K C;  3K2A A;  4ON0 A;  4MEX F;  1KZH A;  2FNA A;  4E7K A;  4G7Z F;  2FML A;  5CPR B;  2GIZ A;  4UUV A;  1L3L A;  1KA8 A;  1RC9 A;  2DPU A;  4I0A A;  4M72 A;  1QBJ A;  1OYY A;  3PQJ A;  2X4H A;  2R4G A;  3E6D A;  4PFO A;  2RV8 A;  2Q1Z B;  2P4W A;  5KAF C;  2OCC H;  5CLS A;  3X2Q H;  3IHU A;  5IT3 A;  1P92 A;  3F72 A;  3S32 A;  2O6G E;  3C1D A;  3DFG A;  2K9L A;  4YIR X;  3W2W A;  4BQQ A;  5F0H A;  2DW4 A;  2JVH A;  4DJA A;  3TOB A;  1W7P B;  1YS6 A;  1JGS A;  3KEO A;  2NXN B;  5AIP A;  4UB8 C;  3E6C C;  2XAJ A;  5LBQ A;  3QPT A;  3JRI A;  1Z67 A;  2JZY A;  3KP3 A;  1FNN A;  1JTY A;  1K7A A;  1MIJ A;  3FMQ A;  3KIO A;  2V1D A;  4I0B A;  4BS9 A;  4D9J A;  2XC7 A;  2ACJ A;  2XIG A;  4RAG A;  2ADU A;  2PMZ A;  2VKE A;  1VQ5 I;  1HKS A;  2L9S A;  3AAF A;  3A01 A;  4I76 A;  5J8C A;  1QGP A;  3S8P A;  2W57 A;  2QBY B;  4L9T A;  3F21 A;  2WWY A;  3Q0V A;  5EZG A;  3R0J A;  4RA2 A;  3VEP A;  5K5Q A;  1S7O A;  5F04 A;  4F55 A;  4C3H J;  3ZQ7 A;  4G6T B;  4I2O A;  2YUS A;  2NVU B;  4P5O A;  3HXL A;  3JAM Z;  3AG3 H;  1Z77 A;  1R5I D;  2QQB A;  1Z1D A;  3ZQH A;  4ZC3 A;  3BY6 A;  3HSR A;  3O6B B;  3D0S A;  4LLL A;  4WXD A;  2NNN A;  5FKN A;  3CCU I;  2PI0 A;  5LGU A;  2ZSH B;  3PL8 A;  4JX5 A;  5LHG A;  3NWT A;  3BP8 A;  3WTW C;  1QU3 A;  1MBH A;  5DYM A;  4B1R A;  3JR9 A;  2Q2E B;  2LG4 A;  2MLG A;  2B9S A;  3WE3 A;  4LG0 B;  2DA4 A;  4PJM A;  1FMV A;  1WPK A;  1SAN A;  3SZG A;  2O03 A;  4BY7 J;  2OD5 A;  2EIL H;  1ZHF A;  1TT0 A;  2DT6 A;  4XKW A;  5LRS A;  2NAZ A;  2R7T A;  2XVC A;  2YU9 J;  1KYZ A;  2ZME C;  1BJA A;  4YFX F;  4KUM A;  5F6F A;  2ZJP F;  1T95 A;  3GLL A;  3OYM A;  5KK1 A;  1TWH J;  4JBA A;  2HDW A;  4G94 A;  2F5C A;  2Z2S B;  3CMA I;  1VQ6 I;  1RES A;  4DBR A;  4LOC A;  3J80 K;  1WI9 A;  3KEY A;  3IC7 A;  2XF5 A;  4IHY A;  1W7P D;  1FX7 A;  1E17 A;  2JA7 J;  2CQQ A;  1IDY A;  1JXS A;  3KLN A;  2H8W A;  3PFY A;  3Q0W A;  3DLL F;  4CA0 A;  2EZK A;  1DP3 A;  4QPO A;  1YOV B;  5GAE J;  1R71 A;  2NOG A;  2EFP A;  3U2R A;  5A2Q K;  2DDB A;  2HQR A;  3OYN A;  1USS A;  1HBX G;  3KET A;  2F6C A;  1NTC A;  5L3G A;  2MSY A;  1MJ9 A;  2HPI A;  1FYL A;  4OIR F;  3AL0 B;  1W0U A;  2DJI A;  4GCV A;  4L18 B;  2DXI A;  3FXJ A;  1A6Q A;  3GYH X;  1X1C A;  1Z91 A;  3OL4 A;  2R7U A;  5IYB J;  2DA7 A;  2M2E A;  3FHN A;  1TBX A;  2R7D A;  1ZR4 A;  2CRG A;  2VOD A;  2L9N A;  1LFB A;  3DBH B;  2PJR B;  3B02 A;  1O3Q A;  1QVU A;  5ICF A;  1K79 A;  3F8F A;  1IZ1 A;  5FO5 A;  2IEK A;  2L9R A;  2XAH A;  4P55 A;  4XLF A;  2G9W A;  3VDX A;  1HDD C;  4U7B A;  2DA1 A;  2C6Y A;  5E20 A;  3VB2 A;  2GA2 A;  5C4X J;  4I99 C;  3S3M A;  1IO2 A;  1Q1V A;  1I5Z A;  2LDU A;  1YIO A;  3TW7 A;  1X1D A;  3BRO A;  1N78 A;  3K70 C;  5K7H A;  2VJI A;  3GUD A;  3ML6 A;  4KFC A;  1QO0 D;  4XK4 A;  4ENJ A;  4BHP A;  2VL8 A;  3ZCO A;  4EJV A;  2KZG A;  2L5Q A;  2LOO A;  3SJM A;  2XUB A;  3EUH C;  5IOY A;  1JUP A;  2CJJ A;  2WAQ A;  2QZ8 A;  5HS7 A;  5JFR A;  4J01 A;  1KU2 A;  1MBJ A;  1O7L A;  2W48 A;  3A0H C;  5E3M A;  1U0J A;  3AG2 H;  4DYC A;  2OA4 A;  1MSF C;  1J9I A;  5DM6 F;  3CP2 A;  3I4P A;  4CCM A;  2O61 A;  2KDZ A;  4L0Z B;  3MAJ A;  4NQW A;  2R3S A;  1H9G A;  1LJ9 A;  1QHH D;  2L3D A;  2IGM A;  4QIW N;  2E1C A;  4UUS A;  2CUE A;  4GRI A;  2M5W A;  5E18 F;  3OYL A;  3HGY A;  2IS2 A;  2KIF A;  1SFE A;  3G71 I;  3F22 A;  3CC4 I;  3O2P E;  1SFO J;  5B1B H;  1Z3X A;  4OAZ A;  3LA7 A;  1RR8 C;  5M5X J;  3BPV A;  3RYP A;  2LKX A;  4A3M J;  2VJJ A;  3BR6 A;  2CYY A;  3D1N I;  3QPS A;  1ZGA A;  1B9M A;  2LC2 A;  1P7I A;  4J19 A;  2R7Q A;  4WXC A;  2E2I J;  2PJP A;  5EG0 A;  4M3B A;  3RPU D;  4I01 A;  1HXD A;  1PYV A;  2H6C A;  4B3A A;  1E2X A;  2ZO4 A;  1JJ8 C;  1ETO A;  4U7D A;  3MKZ A;  2VBX A;  2WBM A;  2R92 J;  1E0E A;  4RB1 A;  2EZH A;  2DI3 A;  2EA2 A;  1VQ7 I;  3ECH A;  4O3M A;  3H3V K;  2E1M B;  3K6G A;  1KYW A;  5CVV A;  4LIT A;  3S93 A;  2E19 A;  3JW4 A;  3U1D A;  4B43 A;  4PK4 A;  2LFB A;  4P1W A;  1BC8 C;  3G1O A;  2HXI A;  1QZY A;  1OCO H;  3F8B A;  1LKX A;  2OQG A;  3QQA A;  5HLI A;  1V4R A;  3WHC A;  3OMY A;  4IRG A;  1S5L C;  1R1T A;  4ZDL A;  5DS9 A;  3A01 B;  4I09 A;  2WAQ N;  2VXZ A;  1SMY F;  2XPU A;  2RC4 A;  2BY2 A;  1S7E A;  3F6V A;  3QU6 A;  1LEA A;  1IUY A;  1Z6R A;  4E7Z A;  4Y17 A;  2KIQ A;  3RYR A;  3FZV A;  3QU3 A;  3K70 D;  1ETK A;  1IXR C;  3H9J A;  1U5T A;  4U88 A;  2GZW A;  2EFO A;  4EJU A;  2QKL B;  2HTJ A;  5GAG J;  1ZGJ A;  2WY8 Q;  1V3F A;  3BR1 A;  3GTK J;  1G2H A;  3SEQ A;  1P6R A;  2GXG A;  3TBI A;  2MG4 A;  4YRV A;  1R1U A;  1BW6 A;  1R00 A;  1HKT A;  1R7J A;  3BG5 A;  5J1U A;  1XMX A;  3FM5 A;  4XRS G;  2VJ4 A;  2FBH A;  3JRC A;  5EJC A;  3FDY A;  4JQF A;  1KON A;  3JRD A;  3E97 A;  3WG9 A;  1A6I A;  3ZOB A;  2G7U A;  3FM3 A;  2V1U A;  2DYR H;  1UEL B;  2RRE A;  2Y2Z A;  1NHA A;  3BCA A;  1D0Z A;  3KEQ A;  4G8X A;  4BDY A;  2HOA A;  1YFH A;  1WJD A;  3HG9 A;  3QPH A;  2FRH A;  1FMW A;  5HDK A;  3G4S I;  2FBI A;  4IX7 A;  4XLP F;  1O3T A;  3FIS A;  4LK1 F;  1O3S A;  1VQP I;  4N4N B;  2ZJ2 A;  1BM9 A;  3TDZ C;  3BTI A;  2QCO A;  2Z16 A;  2L02 A;  4XOP A;  4BHB A;  2CUF A;  3M8F A;  4HOB A;  5F1R A;  4NQW B;  1SAU A;  2E1O A;  3A0B C;  3BG6 A;  3LAJ A;  3JRE A;  5JVG F;  3L2C A;  1Y56 A;  2BW3 B;  4L5J A;  3L2R A;  4BL0 B;  2CMP A;  1VQK I;  2O7O A;  2KQR A;  3WTV C;  2PQ8 A;  1XPX A;  2X1D A;  4IRI A;  1WWX A;  5K7Z A;  1SC7 A;  3JRB A;  2L4M A;  2FUG 2;  3HIF A;  4CYC B;  1XS9 A;  1ULY A;  1BC7 C;  3BC8 A;  3MEX A;  4CUG A;  3BQY A;  4A3B J;  1YW9 A;  4XSX F;  4ZYA A;  2E2H J;  5HNF A;  5D8L B;  2RNJ A;  2XAQ A;  4Q5S F;  2DA5 A;  3K1M A;  1JUS A;  4UXN A;  3M7G A;  4N4O B;  4F93 B;  1RR7 A;  2K02 A;  3CTA A;  4HV6 A;  1MDM A;  4ZDP A;  1OJL A;  5FRM A;  5LGT A;  2IP2 A;  2HOT A;  5C44 J;  3E5Q A;  5A2Q Z;  3LSR A;  3GZN B;  4XBF A;  1F5T A;  2OCE A;  3HSF A;  2MH9 A;  5LGN A;  3H3Z A;  4M9X A;  1EV7 A;  1PP8 F;  5L3D A;  2LF7 A;  3WE2 A;  2OAZ A;  1IN4 A;  3BJ6 A;  1FOX A;  4XKB A;  1YTY A;  1J5Y A;  4ZH4 F;  2M0C A;  3MZY A;  1K61 A;  3LA2 A;  5GAD J;  1PP7 U;  2WY7 Q;  1DUX C;  2AXL A;  2DTR A;  3S17 J;  2DQL A;  3TMO A;  1BN5 A;  3IH3 A;  5BOX A;  1IW7 F;  2UUZ A;  1K78 B;  2ZJQ F;  4OAY A;  5EGO A;  1UB9 A;  3EET A;  1T38 A;  4IHX A;  4EJO A;  2Y9Z A;  5L3B A;  2LH9 A;  5JVT A;  1XMK A;  1WQ2 A;  2R5Z A;  1Y39 A;  2OTL I;  3KE2 A;  1MJB A;  3E1S A;  1MKM A;  1IG7 A;  1XD7 A;  4EV0 A;  3DKW A;  3VPR A;  3CO7 C;  4KMU X;  3RIR A; 
#chains in the Genus database with same CATH homology
 1UST A;  2Z9O A;  2XAG A;  3SXY A;  1T6S A;  2J5P A;  4XSZ F;  3P9I A;  3JSO A;  1Z7U A;  4K2E A;  1TTY A;  4ESF A;  3GFM A;  5CVR A;  2E1N A;  3E6M A;  3GYH X;  2ELH A;  2LSO A;  2FEZ A;  4NB5 A;  4Y15 A;  1TNS A;  2STW A;  3D5L A;  3GWZ A;  4MTD A;  4HDU A;  5BPD A;  6PAX A;  2W24 A;  3HYI A;  5L3E A;  4L9N A;  2M87 A;  3WTU C;  2LF8 A;  2Z5U A;  5HDG A;  2OZ6 A;  4UNO A;  2H27 A;  4O5V A;  1ZAR A;  1W7P A;  5TRD A;  2W85 A;  4CO8 A;  4HF2 A;  3P9C A;  4IJA A;  4PGG A;  2A07 F;  5D4R A;  2NYX A;  5D4S A;  4FX0 A;  3T8R A;  2KRF A;  4LGW A;  2JPC A;  1U3E M;  5ERI A;  2K7L A;  4UVB A;  3ZP5 A;  4PGH A;  1MGT A;  3OOP A;  5DEQ A;  2YX4 A;  4L9V A;  3SFZ A;  3ZMD A;  3GFL A;  3L09 A;  2A68 F;  2PMH A;  1G4D A;  4A6E A;  4OIP F;  2P5L C;  4A0Y A;  1REP C;  4RGS A;  4CGZ A;  2J5O A;  4BHC A;  4WK8 F;  5F64 A;  4TV7 A;  1ZN2 A;  2QLZ A;  3LQR A;  4G7O F;  4R8H A;  2HFH A;  1T98 A;  2MH2 A;  1FT9 A;  2O8X A;  1AOY A;  4EVI A;  2RQP A;  1FC3 A;  3QAH A;  2HKX A;  3E3V A;  2MD5 A;  3V8L A;  1HW2 A;  1RZ4 A;  3C18 A;  3FXU A;  2BE5 F;  5J6X A;  1S7A A;  2QWW A;  2NRA C;  3HTS B;  1R36 A;  2QVO A;  4MQV A;  1HST A;  1XGO A;  4RGX A;  4WWC A;  3G3Z A;  4M74 A;  2XV4 S;  5HDN A;  3QOP A;  2GAU A;  4QWQ A;  4XLN F;  3CUQ C;  3U9G A;  1KU9 A;  2EV5 A;  5DV5 A;  4HW0 A;  5HVQ C;  2DQR A;  1W4M A;  3L9F A;  1ONV A;  3HSE A;  4IXA A;  3ERE D;  3L00 A;  1J0R A;  4GYG A;  2PFB A;  3FMR A;  3REO A;  1G3S A;  1Y0U A;  1ZYR F;  2QM3 A;  2DAO A;  2KJB A;  1TW3 A;  1J59 A;  2GA1 A;  1U8R A;  5LRR A;  1HKQ A;  3ZMS A;  2K4B A;  1F9N A;  2GXB A;  1O3R A;  3COA C;  5IT9 K;  2GIV A;  3WGH A;  4Q48 A;  2F5D A;  2DK8 A;  1OR7 A;  4HQE A;  2Z33 A;  3HRS A;  2HZT A;  4BQA A;  1TLH B;  4AIK A;  5JI6 A;  1S29 A;  3CLO A;  5E1W A;  1TQI A;  2K4J A;  2ISZ A;  2VT3 A;  1HW1 A;  2XAS A;  4AIH A;  4LJZ F;  1FBS A;  3HOT A;  1OKR A;  4CIC A;  1FP2 A;  1IN6 A;  3ABT A;  3EUH A;  3Q9V A;  3TO9 A;  4ZZD A;  4KN7 X;  2MLK A;  3DXJ F;  4LB5 A;  2HQN A;  5DUK A;  1OPC A;  4OIO F;  1BBY A;  4KIB A;  1CF7 B;  1YO5 C;  4KDP A;  5DUI A;  3PQK A;  2DBB A;  3F8N A;  3EYY A;  4DNC A;  4ASN A;  1J2X A;  1XGM A;  3MWM A;  3R61 A;  4B09 A;  1ZRE A;  2PLY A;  2CG4 A;  1T2K A;  1K78 A;  2CWE A;  5D5X B;  1ODD A;  3RKY A;  4MEY F;  2ZFW A;  2ZXJ A;  2ZME A;  3I71 A;  4RB3 C;  1I27 A;  4MHG A;  4H0E A;  3V8K A;  3HRU A;  3ELK A;  1IF1 A;  4S04 A;  4N9I A;  3RDI A;  4GXO A;  5H20 A;  4PDK A;  4M6X A;  2DFI A;  1QQI A;  1WKM A;  4EQQ A;  1JHH A;  1BI0 A;  3DV8 A;  2RKH A;  2FA5 A;  4G6D A;  3WTZ A;  2F5F A;  3N97 A;  1ZLK A;  1TW2 A;  5L3F A;  2P6S A;  4HDV A;  3KP4 A;  3EDP A;  1IN8 A;  4YII A;  2V6C A;  2XKP A;  3GFI A;  3GEZ A;  5LLQ A;  1ZG5 A;  1ZAO A;  1FY7 A;  1F1Z A;  3TOA A;  1T39 A;  2ISY A;  4E70 A;  1JHF A;  1R5H A;  1HW5 A;  2PEX A;  2FOK A;  4ENN A;  2OZU A;  1SD7 A;  2FU4 A;  3BJO A;  3IKV A;  2ESH A;  3E5X A;  1R5G A;  4AIJ A;  1WRJ A;  3GO5 A;  3LWF A;  2VN2 A;  5CVU A;  5KVR A;  1XCB A;  4U0W A;  2JT1 A;  3BJA A;  2D1V A;  2QBY A;  2IA2 A;  4OMY A;  4YFK F;  4OMZ A;  4F7Z A;  1FZP B;  3ZMU A;  2XRO A;  3K9T A;  3I53 A;  4M6Y A;  3LAP A;  2XKO A;  2E7W A;  1CGP A;  1HQC A;  3IKT A;  2AS5 F;  1G3Y A;  5LEJ A;  2VON A;  2X0L A;  1XSD A;  3J7A O;  2EV6 A;  4LG0 A;  4IF4 A;  5E1X A;  3KLO A;  3K2Z A;  5DCM A;  4RS8 A;  2UXN A;  1XB4 A;  3KP6 A;  3W6K B;  1D8J A;  3I54 A;  1KQ9 A;  4RAZ A;  1SAX A;  1GVJ A;  3JTG A;  1IAW A;  1ZRF A;  1MD0 A;  3ROU A;  4HX7 A;  4S05 A;  2V79 A;  4KT5 C;  2P7V B;  4OIN F;  5LEK A;  3S2W A;  3HHH A;  1T0F A;  4Q47 A;  2IRF G;  2VC0 A;  4AD9 A;  4R79 A;  2M1B A;  3H92 A;  4HYE A;  5D5U B;  1YW7 A;  5D8K B;  3B73 A;  5JR3 A;  2HTS A;  4R1H A;  3DQV C;  1XMA A;  3PFI A;  3T1B A;  1R58 A;  1X3U A;  2CO5 A;  4BNC A;  1KQ0 A;  1U5T C;  2A69 F;  1I1G A;  5JHU A;  1B4A A;  1QPM A;  2A61 A;  4ENK A;  3RPQ A;  4L0Y B;  3GW2 A;  3I59 A;  3R4K A;  3I5U A;  3F23 A;  3BWG A;  2ZCW A;  5H6Q A;  2Y75 A;  3J80 Z;  4A5M A;  3CUQ B;  2LKP A;  3T0Y A;  1OYI A;  1OYW A;  2EFQ A;  3I0T A;  1EH7 A;  4N0B A;  2F2E A;  5EEH A;  2PN6 A;  3WTT C;  4LD5 A;  2QYO A;  2H09 A;  1J7K A;  3VOE A;  3JAM K;  1D8K A;  2CGP A;  3HRT A;  3C3W A;  3GLX A;  3TO6 A;  1UHM A;  2EV0 A;  2ZNY A;  1KU3 A;  4G6Q A;  5ICG A;  1C0W A;  4IHS A;  1F4K A;  1LB2 A;  4U0V A;  3M9A A;  1LQ1 A;  4CDG A;  3V7S A;  5DDG A;  5TJJ A;  3WOD F;  2DK5 A;  1XN7 A;  2VC1 A;  1H0M A;  2A3S A;  2VBY A;  4A12 A;  3DPT A;  2Z99 A;  1MZB A;  1BI3 A;  4FT8 A;  4UVA A;  5FB2 A;  3FX3 A;  3RJP A;  3I64 A;  3N4M A;  2MC3 A;  3I58 A;  5D5W B;  1YYV A;  1B1B A;  5BPI A;  1ZG1 A;  5D6E A;  5CVI A;  4ZYD A;  2YSR A;  3IWZ A;  2RGV A;  4YFN F;  3RTR A;  2RVC A;  2MA3 A;  2R7F A;  4LB6 B;  2DPD A;  3ZMT A;  1W5S A;  2JSC A;  3ZMZ A;  1LDD A;  5K5O A;  3KP7 A;  2FE3 A;  3J81 Z;  2K86 A;  3LQQ A;  3LA3 A;  4MGR A;  1ZRD A;  1LDK B;  3JSP A;  2YX7 A;  5ED4 A;  5FFX A;  1IN5 A;  2IT0 A;  4ZZL A;  1DDN A;  2OQR A;  4HBL A;  1XGN A;  2E7X A;  1SFU A;  3T8T A;  3E6B A;  4M9S A;  4A0X A;  2QQ9 A;  5K5R A;  1YW8 A;  4CHU A;  2WV0 A;  2JRT A;  2XGX A;  4I02 A;  2HWV A;  4RGR A;  5CJ9 A;  1XGS A;  3V7C A;  4P96 A;  2YU3 A;  3K69 A;  2V9V A;  4CZZ A;  3P9K A;  5LHI A;  1Z9C A;  2VOO A;  3IWF A;  4FHT A;  4ESJ A;  2FXA A;  1FYM A;  1GHC A;  2XRN A;  4BAY A;  1LEB A;  3HOS A;  5E17 F;  2ZNZ A;  3R6S A;  1IXC A;  2M30 A;  4G7H F;  5HLH A;  3TGN A;  3QRF F;  2FMY A;  2TDX A;  4PZJ A;  3ZPL A;  2VT2 A;  2L01 A;  3FMS A;  1BOA A;  2A6H F;  4RB0 A;  1ZG3 A;  5E1Z B;  5HOO A;  3RKW A;  1J75 A;  3KZY A;  1GXP A;  3GFJ A;  2D2W A;  1O7F A;  5L3C A;  5CVJ A;  3IRQ A;  1Z05 A;  1KQ8 A;  3F8C A;  1W5T A;  4EM0 B;  1U6G A;  3EQL F;  4CYD A;  3ISP A;  2LNB A;  2G7H A;  1BI1 A;  1JE8 A;  4UHT A;  4GGG A;  4AWX B;  4HQM A;  1B9N A;  3HTU A;  4ZYE A;  1TQM A;  4ZYH A;  3RI4 A;  1PDN C;  1OMI A;  1YS7 A;  3KCC A;  3VOD A;  4HZF A;  1RNL A;  1P4A A;  4HV5 A;  1SD6 A;  5FLX K;  1G3W A;  3Q5F A;  5K1Y A;  1PUE E;  1U2W A;  3T5X A;  1QNT A;  3QP5 A;  3FHZ A;  4LLG F;  4A2U A;  2ETH A;  2QUF A;  4KYW A;  3V4G A;  3V7R A;  1P4W A;  4P9U A;  4BYY A;  3BDD A;  1XCV A;  3SHF A;  2W25 A;  5HLG A;  3R0A A;  3I59 B;  3ZMV A;  5FGM A;  1I1S A;  2L4A A;  2F5E A;  1BIB A;  3GF2 A;  2Q8K A;  4ETS A;  1B6A A;  1HSJ A;  3SZT A;  1P2F A;  4A5N A;  1XSV A;  5DCM B;  2DT5 A;  4HF0 A;  4WCG A;  1P4X A;  1BIA A;  3DF8 A;  1LDJ A;  2BEO A;  1O57 A;  3MFK A;  3NEU A;  2O0Y A;  3J81 K;  2PG4 A;  5ILV A;  2Z3Y A;  4KIC A;  4UVC A;  3TQN A;  3FXQ A;  1BI2 A;  3K1P A;  2HOE A;  2ZKZ A;  2BBY A;  1MJA A;  1IRG A;  5BS6 A;  2CW0 F;  3NQO A;  2D45 A;  1RIO H;  3KP5 A;  1FYK A;  2RDP A;  3L7W A;  4HX4 A;  1XSX A;  2DO7 A;  2PMU A;  4KIF A;  1VTN C;  3CUO A;  2HGC A;  5CYV A;  4WX9 A;  1I6X A;  3IL2 A;  2P6T A;  4I7H A;  1FPQ A;  4Q4Z F;  4JK1 X;  1FLI A;  2HYG D;  1Z6T A;  1DPU A;  2EJR A;  2CFX A;  3HRM A;  2KIM A;  2FSW A;  2ZBK A;  4RAY A;  2A5Y B;  5ILU A;  2NS0 A;  1CF7 A;  4Y13 A;  2PBI A;  2OU2 A;  5ICC A;  4EJW A;  2H94 A;  1SD5 A;  5EEG A;  1D3Y A;  4NHJ A;  1SFX A;  1ZRC A;  2FF4 A;  5J8F A;  2FNP A;  1DP7 P;  1U5T B;  2Y48 A;  3EYI A;  2HR3 A;  5FFZ A;  3V8J A;  3IRR A;  2K27 A;  5AIQ A;  3P7N A;  5AON A;  1STZ A;  3KFW X;  2UXX A;  4FX4 A;  4DQ2 A;  1KU7 A;  4M73 A;  3MQ0 A;  1FP1 D;  2KKO A;  4OU0 A;  4XRF A;  3TKY A;  2BV6 A;  3OV8 A;  1D5V A;  1FBU A;  2Q0O A;  3GVA A;  5DD8 A;  2GWR A;  2MBF A;  1RUO A;  5HS8 A;  4OOI A;  4HLX A;  1UHW A;  4EGY A;  3LFK A;  2A6E F;  2IJL A;  3ECO A;  3F8M A;  3GXO A;  1QZZ A;  2P7C B;  1S6L A;  1TNT A;  2IA0 A;  5DD4 A;  3BOQ A;  2GQQ A;  4G9Y A;  4IHT A;  4LFU A;  2JTV A;  4PCQ A;  3K0L A;  2DU9 A;  1FOK A;  4BH9 A;  2HKO A;  4M9Z A;  1K6O A;  4A6D A;  1GXQ A;  5IT9 Z;  3RPU A;  1AWC A;  3FWE A;  4GYI A;  1SMT A;  5E8I A;  1UFM A;  5LHH A;  4MNU A;  2WC2 A;  2STT A;  1FBQ A;  3F3X A;  3E5U A;  4KN4 X;  3WTY C;  1LVA A;  1R1V A;  3MZH A;  2QEN A;  1R23 A;  2BYV E;  3VFZ A;  4L5I A;  4EGZ A;  2NNY A;  2M8E A;  1FWZ A;  2H6B A;  2IA1 A;  5HS9 A;  4QLC U;  3CUQ A;  2VBZ A;  4L9J A;  1ZLJ A;  2EFN A;  2O3F A;  2IVM A;  1SD4 A;  2YPR A;  1TQP A;  4MQ9 F;  4Z2Y A;  4KA4 A;  1S3J A;  4AVP A;  4ESB A;  3DP7 A;  3WGI A;  4RGU A;  1ZH5 A;  4YG2 F;  4IRH A;  5H6R A;  3G73 A;  3R60 A;  3MCZ A;  2BGC A;  1RI7 A;  4LLN A;  1L0O C;  2YR2 A;  3GX4 X;  4EM2 A;  3TO7 A;  2VBW A;  1U78 A;  5FD5 A;  2HEO A;  5DCF A;  4KMF A;  2CQK A;  5BQT A;  1Q1H A;  1S8N A;  4LMY A;  5FLX Z;  4YIF A;  2P5V A;  2L54 A;  3BZ6 A;  1MDM B;  3WTX C;  2D1H A;  3HHG A;  3Q9S A;  3C7J A;  3TDU C;  1XDS A;  3K1N A;  4I98 B;  3LST A;  4N9H A;  1LNW A;  2IW5 A;  2EB7 A;  3NRV A;  2P5K A;  4BXU A;  3CO6 C;  1IRF A;  3KP2 A;  3CJN A;  2IPQ X;  4OIQ F;  2UZK A;  2HS5 A;  3RKX A;  4MTE A;  1FSE A;  2M45 A;  2FQ3 A;  4O6J A;  4LK0 F;  3GZ5 A;  5FD6 A;  2VOP A;  3DEU A;  3ULQ B;  2COM A;  2XAF A;  3JTH A;  3WU0 A;  3H3U A;  1YG2 A;  1G3T A;  2ZME B;  1WSU A;  4KIG A;  2VE9 A;  1RUN A;  2Q2E A;  1YLF A;  3DPL C;  4B8X A;  1ON2 A;  2WTE A;  4EM1 A;  3SZP A;  1H9T A;  5BMZ A;  5D6F A;  2RN7 A;  4HAM A;  4CXF A;  1KGS A;  3W6J B;  2FBK A;  2Y0M A;  2W84 A;  3BPX A;  3M8E A;  4UV9 A;  2VE8 A;  4HF1 A;  2JPB A;  1FSH A;  2EA4 A;  3HUG A;  1A04 A;  1YQA A;  2XHK A;  2EK5 A;  2KIU A;  3O3K A;  3FXR A;  3GZ6 A;  4HLY A;  1B59 A;  4RB2 C;  1ON1 A;  2DLL A;  2CSO A;  3SQN A;  3ABU A;  2EWN A;  1G6N A;  2B0L A;  4HX8 A;  2OBP A;  4WF2 A;  3ZN0 A;  4IPA A;  1IXS B;  5E8G A;  1DPR A;  2HYF A;  2HDC A;  2UWM A;  4M71 A;  2V1X A;  2P8T A;  1XDU A;  4KNY A;  4D0P A;  2EFW A;  3FF5 A;  2KJC A;  3WTS C;  3CDH A;  1IN7 A;  4WXH A;  4ENM A;  1EH8 A;  2ESN A;  3M1E A;  3ZN1 A;  5ILS A;  4GO1 A;  3F6O A;  4IVN A;  4U0Y A;  4ZYG A;  5D5V B;  2QQA A;  4EJT A;  1R22 A;  4HA8 A;  3WU1 B;  4P9F A;  4EMS A;  5ICE A;  1EH6 A;  4A0Z A;  3QP6 A;  1UCR A;  4UV8 A;  3KZZ A;  3WGG A;  4ON0 A;  4MEX F;  2FNA A;  4G7Z F;  2FML A;  4UUV A;  1L3L A;  1KA8 A;  2DPU A;  4I0A A;  4M72 A;  1QBJ A;  1OYY A;  3PQJ A;  2X4H A;  3E6D A;  2RV8 A;  2P4W A;  5CLS A;  5IT3 A;  3IHU A;  1P92 A;  3F72 A;  2O6G E;  3C1D A;  3DFG A;  2DW4 A;  3TOB A;  1W7P B;  1YS6 A;  1JGS A;  3KEO A;  5AIP A;  3E6C C;  2XAJ A;  5LBQ A;  3QPT A;  2JZY A;  3KP3 A;  1FNN A;  1K7A A;  3FMQ A;  2V1D A;  4I0B A;  2ACJ A;  2XIG A;  2ADU A;  1HKS A;  3AAF A;  5J8C A;  1QGP A;  2W57 A;  2QBY B;  4L9T A;  3F21 A;  2WWY A;  3R0J A;  3VEP A;  5K5Q A;  1S7O A;  3ZQ7 A;  4I2O A;  4P5O A;  3JAM Z;  2QQB A;  1Z1D A;  3BY6 A;  3HSR A;  3O6B B;  3D0S A;  4LLL A;  4WXD A;  2NNN A;  2PI0 A;  5LGU A;  5LHG A;  3BP8 A;  3WTW C;  5DYM A;  2MLG A;  3WE3 A;  4LG0 B;  2O03 A;  2OD5 A;  1ZHF A;  5LRS A;  2NAZ A;  2XVC A;  1KYZ A;  1BJA A;  4YFX F;  4KUM A;  5F6F A;  5KK1 A;  4JBA A;  4G94 A;  2F5C A;  3J80 K;  1WI9 A;  3IC7 A;  1W7P D;  1FX7 A;  1E17 A;  1JXS A;  3KLN A;  2EFP A;  3U2R A;  5A2Q K;  2HQR A;  1USS A;  1HBX G;  3KET A;  5L3G A;  1MJ9 A;  1FYL A;  4OIR F;  4GCV A;  4L18 B;  1Z91 A;  1TBX A;  2R7D A;  2VOD A;  3B02 A;  1O3Q A;  1K79 A;  5ICF A;  3F8F A;  1IZ1 A;  5FO5 A;  2XAH A;  4P55 A;  2G9W A;  4U7B A;  2C6Y A;  5E20 A;  3VB2 A;  2GA2 A;  1I5Z A;  2LDU A;  1YIO A;  3BRO A;  4KFC A;  3GUD A;  3ML6 A;  1QO0 D;  4ENJ A;  4BHP A;  4EJV A;  2XUB A;  2QZ8 A;  5HS7 A;  5JFR A;  1KU2 A;  1O7L A;  2OA4 A;  1J9I A;  3I4P A;  2O61 A;  4L0Z B;  3MAJ A;  4NQW A;  2R3S A;  1H9G A;  1LJ9 A;  2L3D A;  2E1C A;  5E18 F;  2M5W A;  2KIF A;  1SFE A;  3F22 A;  3O2P E;  3LA7 A;  3BPV A;  3RYP A;  2CYY A;  1ZGA A;  1B9M A;  4WXC A;  2PJP A;  4I01 A;  1HXD A;  2H6C A;  1E2X A;  2ZO4 A;  4U7D A;  2VBX A;  4RB1 A;  2DI3 A;  2EA2 A;  3ECH A;  4O3M A;  1KYW A;  5CVV A;  3JW4 A;  3U1D A;  1BC8 C;  1QZY A;  3F8B A;  2OQG A;  5HLI A;  1V4R A;  4IRG A;  1R1T A;  4I09 A;  2VXZ A;  1SMY F;  2RC4 A;  3F6V A;  3QU6 A;  1LEA A;  1IUY A;  1Z6R A;  4Y17 A;  3RYR A;  3FZV A;  3QU3 A;  1IXR C;  1U5T A;  4U88 A;  2GZW A;  2EFO A;  4EJU A;  2HTJ A;  1ZGJ A;  1V3F A;  1P6R A;  2GXG A;  1R1U A;  1R00 A;  1HKT A;  1R7J A;  3FM5 A;  2FBH A;  4JQF A;  3E97 A;  3WG9 A;  2G7U A;  3FM3 A;  2V1U A;  1NHA A;  4G8X A;  3KEQ A;  1YFH A;  3QPH A;  2FRH A;  5HDK A;  1O3T A;  2FBI A;  4XLP F;  4LK1 F;  1O3S A;  2ZJ2 A;  1BM9 A;  3TDZ C;  2L02 A;  4BHB A;  3M8F A;  4HOB A;  5F1R A;  3LAJ A;  3L2C A;  4L5J A;  3WTV C;  2PQ8 A;  4IRI A;  1WWX A;  2L4M A;  3HIF A;  1ULY A;  1BC7 C;  3MEX A;  1YW9 A;  4XSX F;  5D8L B;  2RNJ A;  2XAQ A;  4Q5S F;  3K1M A;  4UXN A;  3M7G A;  2K02 A;  3CTA A;  4HV6 A;  1MDM A;  5LGT A;  2IP2 A;  3E5Q A;  5A2Q Z;  4XBF A;  1F5T A;  2MH9 A;  3HSF A;  5LGN A;  3H3Z A;  4M9X A;  1EV7 A;  1PP8 F;  5L3D A;  2LF7 A;  3WE2 A;  2OAZ A;  1IN4 A;  3BJ6 A;  1YTY A;  1J5Y A;  4ZH4 F;  3MZY A;  3LA2 A;  1PP7 U;  1DUX C;  2AXL A;  2DTR A;  2DQL A;  1BN5 A;  5BOX A;  1IW7 F;  1K78 B;  1UB9 A;  3EET A;  1T38 A;  4EJO A;  5L3B A;  5JVT A;  1XMK A;  1WQ2 A;  3KE2 A;  1MJB A;  1MKM A;  1XD7 A;  4EV0 A;  3DKW A;  3CO7 C;  4KMU X;  3RIR A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...