1SD6A

Crystal structure of native meci at 2.65 a
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
119
structure length
119
Chain Sequence
TYEISSAEWEVMNIIWMKKYASANNIIEEIQMQKDWSPKTIRTLITRLYKKGFIDRKKDNKIFQYYSLVEESDIKYKTSKNFINKVYKGGFNSLVLNFVEKEELSQDEIEELRNILNKK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Dna binding protein
molecule keywords Methicillin resistance regulatory protein mecI
publication title Crystal structures of the BlaI repressor from Staphylococcus aureus and its complex with DNA: insights into transcriptional regulation of the bla and mec operons
pubmed doi rcsb
source organism Staphylococcus aureus
total genus 37
structure length 119
sequence length 119
chains with identical sequence B
ec nomenclature
pdb deposition date 2004-02-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03965 Penicillinase_R Penicillinase repressor
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 1sd6A01
1.10.4040.10 Mainly Alpha Orthogonal Bundle Penicillinase repressor fold Penicillinase repressor domain 1sd6A02
2MD5A 1ZGJA 3SFZA 2UXNA 3CUQC 4P9UA 5E8GA 5CVJA 4UHTA 4KN7X 4L9NA 4O5VA 1O7LA 3I71A 1XMKA 2HQRA 1IZ1A 4G7HF 5FFXA 2EFQA 1T38A 1YW9A 3MZHA 1A04A 5JHUA 2HYGD 3GWZA 5ICFA 5DD4A 3E5XA 3O3KA 3ZMVA 5ED4A 2K4BA 2KJBA 1MJ9A 1Z7UA 2MH2A 4I09A 2STWA 2IA2A 5A2QZ 2VE9A 2EFNA 1B4AA 2YR2A 5LGNA 5IT9Z 2RNJA 3F21A 4G8XA 3WE3A 2XASA 2V1DA 4OIRF 2MH9A 2DQLA 4N0BA 1MJAA 3PQJA 3S2WA 3E3VA 2H6CA 3ZMZA 1P4XA 2IPQX 4EMSA 2R3SA 3ML6A 3EUHA 3IC7A 5L3BA 1HKTA 1YLFA 1QGPA 1YQAA 2FXAA 1UFMA 6PAXA 2NNYA 3JAMK 1D8JA 2EK5A 2CFXA 5HS7A 3BDDA 2L4AA 3HOSA 3TO7A 2Q8KA 2HZTA 3KP2A 3L00A 2CGPA 2O8XA 1MJBA 2RN7A 1O3RA 1GHCA 2X0LA 3QPTA 2FRHA 4BHCA 2WTEA 2IJLA 2MC3A 1BIAA 2M8EA 1J9IA 3V7RA 4S05A 2WWYA 1O7FA 4UVAA 1G4DA 4EJOA 1DPRA 4M6YA 3CTAA 1CF7A 2J5OA 1LVAA 3G73A 3J81K 3DXJF 4RAYA 3RKXA 2QBYA 3IRRA 2ZBKA 2K7LA 1QNTA 1EH6A 1P2FA 4OMYA 1IN4A 3BOQA 2RDPA 1FT9A 3ZMSA 5TJJA 2O6GE 3E6CC 2FBIA 1E2XA 3ZMTA 1J5YA 3ULQB 1YW7A 2LF8A 2DU9A 5AIQA 2F2EA 1G3SA 1K6OA 2W24A 2W85A 4KIBA 5H6QA 4HQMA 4G6DA 2QQAA 1TNSA 1LDDA 2EA2A 4FHTA 1BM9A 1FP1D 4ZYDA 1QZYA 2HTSA 4XSZF 1HQCA 3GW2A 3H3UA 4HAMA 1XD7A 3WTSC 2GIVA 3RPUA 3BROA 1P4AA 2ZKZA 1RUOA 2XAHA 4WXHA 2B0LA 4L5JA 3HYIA 2O3FA 3GX4X 1O3SA 1I6XA 5D5XB 1OYYA 4L5IA 4M9ZA 1J2XA 4KYWA 4LJZF 3ISPA 4RB2C 3E97A 2P8TA 3RKYA 4ON0A 4HQEA 2CWEA 2DK5A 5LRSA 2IA0A 2RGVA 2VONA 2LDUA 4YIFA 4UVBA 3ZMDA 4KMFA 1R1VA 2E1CA 2UZKA 5IT3A 3CUOA 1BIBA 4M9XA 2HYFA 1FSHA 1ZRDA 2V1UA 2NS0A 3M1EA 2PI0A 1I1SA 1RIOH 1TQMA 4P9FA 1BC8C 3TQNA 3DKWA 2P7VB 3WTUC 1IXSB 2FF4A 2XV4S 1R00A 2L4MA 1HKSA 1MDMA 1O57A 1OYWA 2DFIA 3DV8A 2VN2A 2DK8A 2VT2A 2W84A 5E8IA 3LQRA 1ZGAA 2FBKA 3CJNA 3K69A 2HFHA 4LG0B 1Z6RA 2DTRA 2D1VA 2ZO4A 3EETA 3H92A 4ENKA 3C18A 2LNBA 4IHTA 2H09A 2IP2A 2Z99A 4Q47A 1WKMA 2KIFA 1QQIA 1DP7P 4ENNA 1RZ4A 3WU1B 1REPC 3HHGA 1USTA 2O0YA 1ZARA 1U6GA 2ESNA 3I5UA 1BI2A 1BI0A 5BQTA 3FM3A 3ZN1A 4ESJA 2DAOA 3D0SA 4BXUA 1J59A 3KETA 4HF1A 5DYMA 2K4JA 1XSVA 4AVPA 3FF5A 5LHHA 2COMA 2W25A 2OQRA 5D5WB 4YIIA 2VOOA 5LGUA 4U7BA 3CUQA 5DUKA 4G9YA 1W7PD 4HYEA 3BP8A 3ZPLA 1L0OC 2EB7A 5D4SA 3ZP5A 4NQWA 2DQRA 3GFMA 3EYIA 1IN7A 3GFLA 1XMAA 1EV7A 4BH9A 2L54A 1YTYA 1U5TC 3E5UA 4A0XA 4WXDA 3SXYA 2EJRA 1P4WA 4KFCA 3JTHA 1XGMA 3IRQA 2ISZA 3W6KB 1XSDA 2P6TA 3R4KA 1R1TA 2PFBA 2CYYA 2QVOA 4L18B 1STZA 3JTGA 2M45A 1I1GA 3T8RA 3WGIA 4JBAA 3K2ZA 2RV8A 1YS6A 3RPQA 3Q9VA 2QZ8A 3FMQA 2MLGA 4HDVA 2Z9OA 5DUIA 1MDMB 2HGCA 5FLXZ 3IWZA 4HA8A 3T0YA 4HX8A 1KQ9A 4KNYA 1ZREA 2PEXA 2PN6A 4P96A 3PFIA 1T98A 4FX0A 4I0AA 2XAQA 4U0VA 4WF2A 1IXCA 3HIFA 1X3UA 4IRGA 1XGOA 1UCRA 4JQFA 1T39A 2IW5A 4JK1X 1R1UA 3I59A 1KQ0A 4Q5SF 3KZYA 3WGGA 1S8NA 2GA1A 2P7CB 2ESHA 1IF1A 3FXUA 1QO0D 2D45A 4ETSA 5E1XA 4MGRA 5D6FA 3QPHA 5FD5A 4GXOA 2JTVA 1J7KA 3TOAA 1TTYA 1OKRA 4I2OA 1ZHFA 4ESFA 5LEKA 4PZJA 3F23A 1ON1A 1P92A 5D4RA 3RIRA 2ZMEA 4LGWA 2GXGA 1QZZA 3DFGA 4Q48A 3MAJA 2UWMA 3HSRA 2FOKA 1KYWA 4N9HA 5J8FA 1ZH5A 3SZTA 4RGXA 1ULYA 2XAFA 4U7DA 3FXQA 2CW0F 3F6OA 1RI7A 1Y0UA 3FZVA 4L0ZB 1SMYF 2BBYA 3DP7A 3HSEA 1YIOA 5LHGA 3KP6A 1WI9A 3F3XA 4LK1F 4TV7A 2A3SA 1HXDA 2HTJA 2TDXA 4EJUA 3QRFF 3U1DA 3HTUA 5HDGA 3O6BB 1YYVA 1UB9A 1ZG1A 2EFWA 1HW1A 1RNLA 5F6FA 2XKPA 2E7WA 1ZYRF 3NEUA 2Y75A 2DBBA 2FA5A 1R58A 3V4GA 1AWCA 2RC4A 2Y48A 2OU2A 1DDNA 4LB5A 1JGSA 1Z9CA 3HRSA 4I02A 2ZJ2A 1SD6A 1OYIA 1J75A 2V1XA 3TO9A 4EGZA 1T0FA 3BWGA 4LLLA 1V4RA 2QENA 1ZG3A 3GFIA 5EEHA 1SFEA 2V79A 2CSOA 2GA2A 3T5XA 5D5VB 4GGGA 1WSUA 1V3FA 4BHBA 4F7ZA 1XN7A 2HOEA 5CVVA 4DQ2A 1R5HA 2XROA 5D8KB 1S7AA 4ENJA 3ZQ7A 1F1ZA 4AD9A 3TO6A 4OIOF 3HHHA 3VFZA 3ZMUA 1BBYA 5DCFA 1FY7A 1XSXA 4O3MA 2OBPA 3BY6A 2KRFA 2F5CA 3HRMA 3SHFA 4EJTA 4KIGA 5D8LB 2JPCA 2ISYA 4DNCA 5F64A 1G3YA 3F22A 3ROUA 1W5SA 2ZMEB 2DPUA 3N97A 5HLIA 2AS5F 1W4MA 1ZRFA 3KP7A 1JHHA 4HBLA 3TKYA 2BV6A 2F5DA 5LRRA 4KT5C 1C0WA 2JRTA 3EQLF 4OIQF 4IRIA 5LHIA 4FX4A 2QWWA 4RB3C 3O2PE 3RI4A 1LQ1A 1B9MA 5D6EA 1IRFA 1LNWA 2GWRA 3MEXA 1ZLJA 2M1BA 3F8CA 2KJCA 3LA7A 1D8KA 4ASNA 3MCZA 3IHUA 4RGUA 4EM2A 4A0YA 2VBXA 5K1YA 3J80Z 4U0WA 2HQNA 5EEGA 1MZBA 5K5OA 2A61A 1KQ8A 3WE2A 2P6SA 2DLLA 2LKPA 4GYGA 2V6CA 3M7GA 1IUYA 1XB4A 2IT0A 3F8BA 3M8FA 4A5NA 3SQNA 2FQ3A 1HW5A 3QU3A 1LEBA 1HBXG 4PGGA 4WXCA 4OOIA 4M73A 2FBHA 1LB2A 2H27A 5FO5A 4HX4A 3IKVA 1U78A 2HR3A 2OA4A 4KN4X 4M74A 4WK8F 1DUXC 1VTNC 4IPAA 4HX7A 4M6XA 1I5ZA 1R22A 2L02A 3DF8A 2QQBA 5E18F 3IL2A 5ILSA 1U5TA 1XDSA 1JHFA 5DD8A 2E7XA 3C7JA 1K78A 3JSOA 5K5QA 3E6MA 4IJAA 1I27A 3VOEA 2MBFA 5HVQC 3KEQA 5DCMA 2VBYA 3REOA 5A2QK 1UHWA 4XSXF 3FXRA 1EH8A 1H0MA 4EM1A 3B02A 1YW8A 1FLIA 3MFKA 1LEAA 1IAWA 3HRTA 2ZFWA 2YSRA 1SD5A 4U88A 2BEOA 2EFOA 1ZAOA 2G9WA 4RS8A 5ICGA 3V8LA 1CF7B 2CO5A 3L9FA 2NAZA 3TGNA 2Z3YA 2QBYB 2A6HF 2A68F 1JXSA 4XRFA 3WODF 2NRAC 4YFXF 2YPRA 3B73A 3GLXA 1LJ9A 4L9TA 3DQVC 4UNOA 2MA3A 3KFWX 1PDNC 2WC2A 4ZZLA 2FNAA 1O3QA 1GXQA 2NYXA 1PP8F 3RYRA 1QBJA 3ECOA 4A0ZA 2IA1A 4A6EA 2EV5A 4IHSA 2JPBA 3KP3A 2XKOA 2VOPA 1FX7A 2KKOA 4YFNF 5HLHA 4G7ZF 1JE8A 1HSTA 3HOTA 2D1HA 2ACJA 3LWFA 3RJPA 1Z6TA 2VODA 3E6DA 1Z05A 3K1PA 3U9GA 4UXNA 2G7HA 5CVRA 1Z1DA 5ERIA 2OQGA 5HLGA 3E5QA 2L3DA 1CGPA 4MEXF 4ZYHA 3KP4A 1XCVA 1GXPA 5H6RA 2JSCA 3KLOA 4NHJA 3LAPA 4MTDA 2YX4A 5E20A 5BS6A 2DO7A 4CGZA 1R36A 2ZXJA 2VT3A 3T1BA 1KU7A 1WRJA 2OZ6A 3OOPA 3JAMZ 2PQ8A 4EQQA 4S04A 2QYOA 4MQVA 3L7WA 3QAHA 1KYZA 2FE3A 3WTWC 1B6AA 1TLHB 3CDHA 4PCQA 4ZH4F 3KZZA 1S6LA 3OV8A 1TQIA 3ECHA 4LFUA 1KU3A 3FWEA 4XLNF 4OU0A 1U5TB 5KK1A 2F5EA 4HDUA 4G6QA 2YU3A 4IVNA 5L3FA 1SFUA 5BPIA 4IXAA 3GVAA 3FX3A 1F9NA 2D2WA 2C6YA 5LBQA 5KVRA 5DEQA 4EV0A 4HF0A 1BN5A 1TQPA 4EM0B 4Y15A 2UXXA 3K0LA 2OZUA 5ILVA 1SD7A 4AIKA 5L3DA 1FWZA 3J81Z 4HLXA 2HS5A 2R7DA 3ELKA 3COAC 2G7UA 3P9CA 2GQQA 2X4HA 2VE8A 5LLQA 5JI6A 4HV6A 4M9SA 1ON2A 4HOBA 4N9IA 3W6JB 1AOYA 1UHMA 4FT8A 3L2CA 4XBFA 1OMIA 2Y0MA 4OMZA 2PJPA 4EJWA 5CJ9A 3LA3A 2O61A 3GYHX 5J8CA 1FBSA 2EWNA 4GYIA 4CO8A 3QU6A 2DW4A 3K9TA 2R7FA 1FZPB 4MHGA 1R23A 1P6RA 4H0EA 2P5LC 4HZFA 2XRNA 4A5MA 2PBIA 2YX7A 2M5WA 4L9JA 4M71A 4B8XA 3R0JA 4MEYF 4Y13A 2Q0OA 2IVMA 4LLNA 4O6JA 4AIHA 2ZCWA 2W57A 1IN8A 1BOAA 2GXBA 3DPLC 1U3EM 3TDZC 2RVCA 4A6DA 5HS9A 4EJVA 4OINF 2QUFA 5ILUA 1FBQA 3KLNA 2HKXA 3ZN0A 3CUQB 2GAUA 5FFZA 1L3LA 1LDJA 3RTRA 3EYYA 1S3JA 1KU9A 4HV5A 1XCBA 4B09A 1S29A 2XIGA 3V8JA 4RGRA 4QWQA 4KICA 4G7OF 3QP6A 2ZNZA 1WWXA 1SMTA 3Q5FA 2ELHA 2Z5UA 3K1MA 3FMRA 2HDCA 2P4WA 1IRGA 4MQ9F 4MNUA 3VEPA 3LAJA 4RGSA 4L0YB 1Q1HA 2FMYA 2E1NA 4WWCA 3PQKA 2FSWA 1XDUA 4PDKA 1U8RA 2JZYA 1IN6A 3F8FA 3FM5A 4LD5A 1TW3A 3BPXA 1TNTA 3NRVA 1FBUA 2QQ9A 3HSFA 4GO1A 5AONA 2AXLA 2GZWA 4IF4A 5FB2A 2FEZA 3J7AO 1WQ2A 3KE2A 4KDPA 5J6XA 2DI3A 1PUEE 3I64A 1SAXA 4ENMA 3KCCA 4LMYA 2CG4A 4CZZA 1YG2A 4AWXB 2Z33A 1KGSA 1B59A 2FMLA 3CLOA 3GFJA 1T2KA 1ZN2A 5E1ZB 3I59B 3GO5A 1FC3A 2O03A 3HTSB 5K5RA 4MTEA 3GUDA 1IN5A 4EGYA 2PLYA 3ABUA 4UUVA 3I58A 3V8KA 1YS7A 5L3GA 1XGNA 5BPDA 1K7AA 1J0RA 1USSA 3C3WA 2A6EF 3R6SA 3VODA 1XGSA 2MLKA 5LEJA 3HUGA 4KA4A 3L09A 3DPTA 3QP5A 3VB2A 1ODDA 4LG0A 3RYPA 5TRDA 1ZLKA 4P5OA 2K02A 3U2RA 5DDGA 2KIMA 5FLXK 4BQAA 2JT1A 2P5KA 2M30A 3FMSA 3WTVC 1W7PA 2K86A 4UVCA 4UV8A 5AIPA 3CO7C 4YG2F 4G94A 3LSTA 3GF2A 5CVUA 3WU0A 4U0YA 3MZYA 3P7NA 2LF7A 5F1RA 1K79A 3P9IA 2EV0A 2BGCA 1G3WA 2ADUA 5BMZA 1IW7F 2K27A 3IWFA 3HRUA 2HKOA 3N4MA 2F5FA 2ZNYA 4A12A 2VBWA 3GZ6A 4Q4ZF 4HW0A 2BYVE 4AIJA 1B1BA 3V7CA 4EVIA 1FOKA 3E6BA 4R79A 3TDUC 3ERED 1FYKA 1F5TA 2NNNA 3K1NA 3I4PA 4NB5A 1MKMA 5E1WA 1BJAA 3KEOA 2L01A 2QM3A 5ICEA 4CYDA 2XVCA 1FYMA 2EV6A 2A5YB 5JR3A 3F72A 1O3TA 2STTA 2QLZA 4LK0F 2XGXA 1W5TA 4Z2YA 4D0PA 4HF2A 1R5GA 2P5VA 5IT9K 5L3CA 4GCVA 3NQOA 1ONVA 5BOXA 4ZYGA 3GXOA 2XAJA 1OPCA 5FD6A 2ETHA 1ZG5A 3WTXC 2OAZA 1KU2A 2M87A 5E17F 1E17A 2VC1A 3GEZA 1QPMA 1OR7A 4RB1A 1R7JA 1SD4A 4CDGA 1EH7A 2HWVA 1HW2A 4BAYA 1BI1A 1RUNA 5D5UB 3AAFA 3BJOA 3MWMA 3LFKA 1GVJA 1NHAA 1W7PB 5CLSA 1FP2A 3V7SA 3JW4A 3F8NA 4IRHA 1G3TA 5DV5A 4BHPA 1H9GA 3R61A 4E70A 1BC7C 4L9VA 1D5VA 2A07F 4RB0A 5LGTA 2FNPA 3IKTA 4HLYA 1D3YA 3LQQA 3R60A 5HDKA 5JVTA 2EFPA 4CHUA 4BYYA 5HOOA 1TW2A 2KIUA 3BJAA 1S7OA 3F8MA 3WTZA 4OIPF 3I53A 3LA2A 4YFKF 1F4KA 4KIFA 2EA4A 3ABTA 4QLCU 1FYLA 3D5LA 5H20A 3WG9A 2DT5A 5FGMA 3WTTC 3M8EA 2BE5F 4CICA 5ICCA 1SFXA 2A69F 3WGHA 2RQPA 3CO6C 3BPVA 1KA8A 4ESBA 2VBZA 4WX9A 2XAGA 2WV0A 3EDPA 2DPDA 1LDKB 5CVIA 2XUBA 3SZPA 1HKQA 4K2EA 1K78B 4M72A 1BI3A 3DEUA 4P55A 2XHKA 4XLPF 4RAZA 4BNCA 1DPUA 4LB6B 1FNNA 5DCMB 3P9KA 5HS8A 1H9TA 3T8TA 1Z91A 3RKWA 3J80K 2J5PA 3M9AA 4R1HA 3RDIA 5L3EA 4I7HA 3C1DA 1U2WA 2IRFG 3H3ZA 1MGTA 4KMUX 1HSJA 5CYVA 2CQKA 4UV9A 4I0BA 1B9NA 2H6BA 3I54A 1MD0A 2RKHA 3Q9SA 1IXRC 2Q2EA 3R0AA 1FSEA 1PP7U 2LSOA 1ZRCA 2PMUA 4LLGF 1YFHA 3QOPA 2FU4A 2PG4A 4Y17A 1FPQA 5JFRA 4CXFA 3MQ0A 2VXZA 2V9VA 4ZYEA 3GZ5A 3BJ6A 1TBXA 1G6NA 3BZ6A 5HDNA 4ZZDA 4KUMA 2HEOA 4I01A 4A2UA 2OD5A 1YO5C 2VC0A 3G3ZA 4WCGA 3JSPA 3F6VA 3KP5A 4R8HA 2H94A 1T6SA 3WTYC 3TOBA 2PMHA 3I0TA 4PGHA 3FHZA 4I98B
chains in the Genus database with same CATH superfamily
2MD5A 1ZGJA 3SFZA 2UXNA 3JRBA 4AUXA 3CUQC 3KEYA 4P9UA 5E8GA 1R6RA 1IDYA 1MIJA 2X6YA 2GLOA 5CVJA 3B6CA 4Y4RA 1IC8A 1K61A 4UHTA 2HXIA 4KN7X 3H9QA 4L9NA 3ZGKA 3OYFA 3EUKL 3ASOH 3IAM2 3A01B 4O5VA 1O7LA 3I71A 2LBFB 1XMKA 2HQRA 2E1OA 3FXMA 1NTCA 4PJJA 1IZ1A 4G7HF 1W0TA 4I6ZA 2YU9J 5FFXA 2Y9ZA 3LSJA 4BL0B 3G71I 1FOYA 2EFQA 1T38A 1YW9A 3MZHA 1A04A 5JHUA 2HYGD 3GWZA 3IH2A 1Z67A 5ICFA 5DD4A 2ZXIA 2XGCA 4FE7A 2VL8A 3E5XA 3O3KA 3ZMVA 5ED4A 1VQPI 2K4BA 1UG0A 2KJBA 1MJ9A 5E3MA 1Z7UA 2MH2A 2VB6A 4I09A 2LKSA 4X0GA 2STWA 1Z21A 2IA2A 5A2QZ 2VE9A 2EFNA 1I3QJ 3OSGA 1IGNA 1B4AA 5LD2C 2YR2A 2H1KA 5LGNA 5IT9Z 1X1PA 4V2GA 2RNJA 3W2WA 1PUFB 2E35A 3CP8A 1SVLA 3MD2A 1ETQA 1Y6IA 4A3DJ 3F21A 4G8XA 3WE3A 2DMTA 2XASA 2QEXI 2X48A 2DXIA 2DFHA 1JTXA 2RNGA 2OF7A 3O8GA 2V1DA 2EIKH 4BJTA 2X6OA 4OIRF 2UUZA 3X2QH 1AU7A 2MH9A 2DQLA 2ZXHA 4ZTFA 4N0BA 2ECCA 3G1MA 1MJAA 5C44J 4RM2A 3A02A 1FJLA 3PQJA 3S2WA 3E3VA 2HYJA 5H2FC 2H6CA 3VWBA 3FISA 3ZMZA 1P4XA 2LP0A 2IPQX 4EMSA 2BY1A 2R3SA 3SYTA 4FISA 2Y2ZA 2I5UA 3ML6A 3EUHA 3IC7A 1A6IA 5L3BA 1HKTA 1YLFA 1QGPA 1YQAA 3HOXJ 2FXAA 2F48A 2QGUA 3CF5F 2EZIA 2DA4A 2IS4A 1YJWI 1UFMA 3JRHA 6PAXA 2NNYA 3JAMK 2Q2EB 3NAUA 3DEEA 4NC6A 1D8JA 2EK5A 2CFXA 1W1WE 3BDDA 5HS7A 2X51A 4J01A 2L4AA 2WY7Q 3K4LA 1JT0A 3HOSA 1OISA 3FKJA 1UELB 3G2BA 3ZQLA 1GT0C 3TO7A 2GOMA 2VASA 1CQTA 2Q8KA 2HZTA 3KP2A 3ZQIA 1V55H 4A93J 3L00A 2CV0A 2F4OB 3BCBA 3OSFA 1VNDA 2CGPA 2O8XA 1MJBA 2RN7A 1O3RA 4DIQA 1GHCA 1ZR2A 3GTGJ 1TL8A 3LSIA 2EBIA 2X0LA 3QPTA 2FRHA 1NG7A 4BE0A 2PJRB 4BHCA 2CW8A 4CCKA 2WTEA 1DQUA 1J09A 2HI3A 3M07A 3SDGA 2IJLA 2MC3A 2XDVA 1BIAA 3I4MJ 2M8EA 2FUG2 1MH3A 1J9IA 3V7RA 3VYUB 4S05A 2WWYA 1O7FA 4UVAA 1G4DA 1JUSA 3S2HJ 4EJOA 1DPRA 4M6YA 2ZMEC 3CTAA 1CF7A 3GTOJ 2VI6A 1D0XA 2J5OA 2JUCA 3WG7H 5M5WJ 1VQ6I 1LVAA 1UAAA 3G73A 1RPWA 2F5VA 2ZSHB 3J81K 2E5ZA 3CLQA 3DXJF 4RAYA 3RKXA 2QBYA 3IRRA 2ZBKA 2K7LA 4PSWA 4DW6A 1QNTA 2ECBA 1EH6A 1P2FA 4OMYA 3ZR8X 1X3ZB 1IN4A 5TGTA 4UUSA 3BOQA 2RDPA 1FT9A 3ZMSA 4BY1J 4M3FA 5TJJA 2O6GE 3E6CC 1XTAA 2FBIA 3GTKJ 1FIPA 1E2XA 3ZMTA 1J5YA 3ULQB 1YJ9I 1K4TA 2GXAA 1YW7A 2LF8A 2DU9A 1RKTA 4A3CJ 2X1DA 5BNGA 5AIQA 2F2EA 1G3SA 4II2A 2W24A 2W85A 1K6OA 4KIBA 2FX0A 4J19A 4B43A 3S8PA 3OS0A 1W5CC 5H6QA 3KYLA 3RZDJ 4HQMA 3CCLI 1K83J 4G6DA 2QQAA 1TNSA 1JKPC 2MC4A 1LDDA 2EA2A 4FHTA 1BM9A 1FP1D 2PMZN 2LOOA 1RKWA 4ZYDA 3OYNA 1QZYA 3K4BA 2HTSA 3AKZA 4XSZF 1HQCA 3GW2A 5HLTA 5GAGJ 3H3UA 1UHSA 3FIWA 4HAMA 5GADJ 3FBNB 1XD7A 3WTSC 2GIVA 3ASNH 3QYBA 3BROA 3RPUA 1P4AA 3GTQJ 1X2MA 2ZKZA 4LOCA 3H9JA 1RUOA 2CFOA 2DJNA 2XAHA 3QWLA 4WXHA 2B0LA 4L5JA 3HYIA 2O3FA 2BXYA 2R7SA 2M2EA 3GX4X 1O3SA 2HVRA 1I6XA 1QVTA 5D5XB 1OYYA 4YRVA 4L5IA 4M9ZA 2KFDA 3FDYA 2M8GX 1NK3P 1J2XA 5IYCJ 2BW3A 3DLAA 4KYWA 4LJZF 3ISPA 4ZJZA 4UB8C 2CH0A 4RB2C 3CCMI 3E97A 2P8TA 4BEHA 3RKYA 4ON0A 4B44A 4HQEA 2CWEA 3BR5A 3FXKA 2DK5A 5LRSA 2IA0A 2RGVA 2VONA 2LDUA 3OYKA 4YIFA 1T0FC 4UVBA 2CS3A 3ZMDA 2TCTA 4KMFA 1R1VA 2AQEA 2OTLI 2E1CA 2UZKA 2LYCA 3CCYA 2HDWA 5IT3A 1WGXA 1ERDA 3CUOA 5F04A 1BIBA 3VYTB 4DYQA 4M9XA 2HYFA 2Y31A 1FSHA 1ZRDA 1JUPA 2V1UA 1BR2A 2NS0A 3M1EA 4S0HB 2PI0A 1I1SA 1RIOH 4OWRB 1TQMA 2R0QC 2NS7A 2L0KA 3CCRI 4P9FA 1BC8C 1DU6A 3TQNA 5FKKA 2M7BA 3DKWA 2P7VB 1LPQA 3AL0B 3WTUC 3S32A 2DT7B 1GVDA 3BC8A 1IXSB 1X4OA 2EH3A 1SANA 3DTEA 2L2OA 3G1OA 2FF4A 2XPWA 5LFAA 4PFOA 2XV4S 1JGGA 1R00A 2L4MA 4DBRA 1VQ5I 4YELA 1W36C 2KISA 3BG7A 1HKSA 1MDMA 1O57A 1OYWA 2DFIA 3DV8A 2VN2A 4RA2A 1GV5A 2DK8A 2VT2A 4PK4A 2R7RA 1HA8A 2W84A 4BUPA 5E8IA 3HUGB 3LQRA 3Q0UA 1ZGAA 1JKRC 2FBKA 2VKHA 3ABMH 3CJNA 3K69A 2HFHA 4LG0B 1Z6RA 2DTRA 4RDUA 2XC7A 2D1VA 5GTIC 4E7JA 3DTKA 3BLYA 1HDDC 1WJFA 2K9MA 2ZO4A 1YITI 1HLVA 3IUOA 5GP9A 1LFUP 1ETKA 3EETA 3CCUI 3H92A 4ENKA 1YI2I 3DWLE 1VQMI 3GMEA 3C18A 2DA3A 2HQAA 2E1MB 4UUSB 1HDPA 5E3LA 2LNBA 3C2BA 2H09A 4IHTA 4XRSG 2IP2A 2Z99A 2R7WA 4Q47A 3OL3A 2OUMA 2BZTA 1WKMA 2KIFA 3H9GA 1QQIA 4B3XA 4M3DA 3VSKA 1DP7P 4ENNA 1RZ4A 3WU1B 1REPC 2LY9A 1ZR4A 4XRMA 1D0ZA 3HHGA 1USTA 2JUGA 2O0YA 4BJ5C 1B8IB 1ZARA 2IS6A 1YJNI 3OYCA 1JJ6C 1U6GA 4RLFA 2E34A 2ESNA 5GPCA 4XK4A 3I5UA 2DA5A 2M34A 3CDIA 1BI2A 2L7KA 1BI0A 2BVMA 5BQTA 4F3QA 4E7KA 3FM3A 4XLFA 2Z16A 3VSLA 1ZQ3P 1E3OC 3ZN1A 1TP4A 2VJIA 3D5RC 5J40A 3JRFA 4ESJA 2DAOA 3D0SA 4BXUA 3PIOF 2KL4A 3QYEA 2BXZA 1WCMJ 1J59A 2OTJI 3KETA 4HF1A 1E0EA 5DYMA 2K4JA 1XSVA 2K9QA 4AVPA 4XM3A 1Y8QB 1D5YA 4M6VA 1LE8B 3FF5A 5LHHA 2XGDA 2COMA 1BJZA 1Z0XA 2W25A 3K10A 2IGOA 2OQRA 5D5WB 1U9OA 4YIIA 2VOOA 2XRLA 5LGUA 2EZLA 4U7BA 3S1MJ 1SAUA 3CUQA 5DUKA 4G9YA 1W7PD 3OYGA 4HYEA 3BP8A 3ZPLA 1L0OC 2EB7A 5D4SA 3ZP5A 4NQWA 2GOXB 5FRMA 4UB6C 5B1BH 2DQRA 1WI3A 2KT0A 4W1UA 3MKLA 3GFMA 2DODA 3EYIA 3HPGA 1IN7A 3GFLA 1XMAA 1HF0A 1RETA 4BS9A 1I6HJ 3S3NA 1EV7A 4BH9A 2L54A 2BHZA 1YTYA 1U5TC 2VQGA 4FETA 3E5UA 4A0XA 3HKZN 4WXDA 1WJEA 3OYJA 1JKOC 3HL2A 3SXYA 2EJRA 1R4NB 1P4WA 2BY0A 3DTIA 3JTHA 1VQ4I 4KFCA 1XGMA 3IRQA 3OYIA 2XSDC 4A69C 2ISZA 1N77A 3W6KB 5K7FA 1AKHA 1XSDA 2P6TA 4NC8A 2OC6A 1FEXA 5F0CA 3SEQA 3R4KA 2RAEA 1X3WB 1R1TA 4AYBN 2PFBA 3PJRA 2CYYA 2QVOA 4L18B 1STZA 3JTGA 1LFBA 4KISA 4XKVA 4CYCA 2QQ8A 2LTPA 3WHCA 1IJWC 2I10A 2M45A 1I1GA 3T8RA 3WGIA 4JBAA 3K2ZA 3CP2A 4KJZA 1OCCH 2RV8A 3E0JB 3LMMA 1YS6A 3HPHA 3RPQA 3Q9VA 3NARA 5IP7J 3MKZA 3OMYA 4LITA 3J7ZI 2QZ8A 3FMQA 5EG0B 2MLGA 5FLMJ 1IUFA 3PUFA 4HDVA 5IOYA 2Z9OA 1Y56A 5DUIA 1MDMB 3HB9A 1TC3C 2HGCA 5FLXZ 1NK2P 3H36A 2HNHA 2LVSA 3ESWB 3HXLA 3IWZA 3OIQA 4HA8A 3T0YA 3S3MA 4HX8A 2XSJC 2M3AA 1KQ9A 2QSFX 4N4OB 2HPMA 2YUSA 4KNYA 1KZHA 1OCZH 1ZREA 2PEXA 1V5GA 2PN6A 4P96A 3PFIA 1T98A 4FX0A 4IL6C 2M0MA 4DZPA 1SFKA 2CQQA 3KPHA 3DBRB 4I0AA 3ABLH 3I55I 2XAQA 4U0VA 4WF2A 1IXCA 3IV5A 1V5FA 3HIFA 3PSFA 1X3UA 4IRGA 4EATA 1XGOA 2F4MB 1UCRA 4JQFA 1T39A 2GBYA 2IW5A 2JA2A 4JK1X 1R1UA 1WJAA 3I59A 3K4KA 1KQ0A 2E71A 4Q5SF 2LFBA 3KZYA 3WGGA 5CKTA 1S8NA 2GA1A 1MW7A 2P7CB 3CMYA 2E19A 2ESHA 1IF1A 2JJ7A 4RBOA 3FXUA 4XOTA 1QO0D 2D45A 4ETSA 2A5WA 5E1XA 4MGRA 1PYVA 3ERMA 5D6FA 3QPHA 5FD5A 5J1RA 4GXOA 2JTVA 3JR9A 1J7KA 3TOAA 2Z2SB 4A3KJ 1TTYA 2CJJA 1BR4A 4YEJA 2G0EA 3DU5A 1OKRA 2L9NA 4DYCA 5EJCA 4I2OA 1ZHFA 4ESFA 3F0CA 5LEKA 3L2WA 1W0UA 1I50J 4PZJA 3F23A 1ON1A 1P92A 1Y1VJ 4NNJA 4AVZA 1ZTRA 4XLAA 5EDNA 3S2DJ 4D5CA 5D4RA 2W82A 3RIRA 2ZMEA 3CMMA 4XR6A 4LGWA 2GXGA 3HOWJ 1QZZA 3DFGA 2R7OA 4Q48A 3MAJA 2UWMA 1MMAA 3HSRA 2FOKA 2VPLA 3GCMA 5FJ8J 1WJBA 3CC7I 2R7QA 1KYWA 4N9HA 4ZDPA 5J8FA 1ZH5A 3SZTA 4BBSJ 4RGXA 1ULYA 2XAFA 4U7DA 3FXQA 2CW0F 3F6OA 3O8HA 4B4CA 4HNTA 1RI7A 1Y0UA 3FZVA 4L0ZB 2B63J 1SMYF 2BBYA 3DP7A 1E3PA 3HSEA 3DLLF 1YIOA 4XN3A 2LG4A 1ENHA 3H0GJ 4Z6YA 5LHGA 5EZGA 3JCUC 4XKBA 3KP6A 5HNHA 1YE9A 1U0JA 2PX9A 1WI9A 4QPQA 4IOCF 3F3XA 4LK1F 4TV7A 3FKIJ 2ZSIB 2A3SA 3RKQA 1HXDA 2W00A 4C3JJ 5K7HA 2HTJA 3A0HC 1BL0A 2TDXA 3OYMA 3CC2I 4EJUA 3QODA 1FOXA 1MNMC 2CV1A 4Y52J 3QRFF 1AKHB 1BW6A 4ITVA 2EIMH 3U1DA 3HTUA 5HDGA 3O6BB 3I56I 3CZ6A 4Y3OA 1YYVA 4RLQA 1P9QC 1UB9A 1ZG1A 5EZHA 4E4HA 4C30A 2EFWA 4CYCB 1HW1A 1RNLA 5F6FA 2XKPA 3LL7A 4D1QA 4QPOA 2E7WA 1ZYRF 3NEUA 4C2MJ 2MYSA 2GM4A 2Y75A 2ZC2A 1YRNA 2DBBA 2FA5A 1R58A 3V4GA 4AM3A 1TWGJ 3TL4X 5F0FA 1S9HA 1AWCA 2K3FA 2E2IJ 2RC4A 2EILH 1RRJA 5GTHC 2Y48A 3ZCOA 4F92B 3GTLJ 2OU2A 1DDNA 4LB5A 1VFCA 1JGSA 4HSRA 3MVPA 4HG2A 5DS9A 1Z9CA 3HOUJ 3DBLB 1HCRA 4DZJA 4IOAF 3HRSA 5FLVA 2CQXA 4I02A 1MH4A 2ZJ2A 1SD6A 3HG9A 1JI8A 1OYIA 1JUMA 1J75A 2D5VA 3QPLA 2V1XA 2X9DA 3TO9A 5M5YJ 5CPRB 4LIUA 4EGZA 1T0FA 3BWGA 4LLLA 1V4RA 2QENA 1RESA 1ZG3A 3G1LA 5M3FJ 5EEHA 3GFIA 5IYDJ 3RQIA 1SFEA 2L7FP 2V79A 4FQGA 5KNLA 2JK3A 2CSOA 2GA2A 3T5XA 1WPKA 5D5VB 2W4SA 4GGGA 1WSUA 2AHQA 5M3MJ 3QPSA 1V3FA 4BHBA 4F7ZA 2R93J 1XN7A 3A0BC 2HOEA 2TRTA 2DJIA 3L2RA 5CVVA 3BT9A 4DQ2A 1R5HA 4RM3A 2XROA 1X1BA 5D8KB 5JHFA 1S7AA 2NXNB 4E6KG 2CUFA 3ZQ7A 4ENJA 3OYAA 1F1ZA 4AD9A 1MMNA 3TO6A 2PMZA 4OIOF 3HHHA 3VFZA 3ZMUA 2N8GA 1APLC 5M5XJ 3VDXA 1BBYA 3LSKA 5DCFA 1FY7A 1XSXA 3QQAA 3PO2J 4O3MA 2OBPA 5DM7F 3BY6A 2KRFA 1X2NA 2OCCH 5DM6F 1A5JA 2F5CA 2LREA 3HRMA 3SHFA 4EJTA 2JA6J 3J7AY 4IZZA 5C4JJ 3GBGA 2OV7A 4KIGA 4IKFA 3QYFA 5D8LB 2JPCA 2ISYA 4DNCA 1R9TJ 4N4NB 5F64A 1G3YA 3ZRGA 3F22A 4QTRA 2COBA 3ROUA 4D7NA 4HSTA 2L7MP 4B1RA 3TP0A 1W5SA 3LOCA 2ZMEB 3DKXA 3UNGC 2DPUA 1Z3YA 2CQNA 3N97A 5HLIA 5J1YA 2AS5F 1W4MA 1ZRFA 2L9RA 3KP7A 3EPZA 1VF9A 3KZIC 4GRIA 3S15J 1JHHA 4HBLA 3TKYA 5IY5H 2BV6A 5IOZA 3GTMJ 2F5DA 5LRRA 4KT5C 1C0WA 2JRTA 2Z1DA 3EQLF 4MO7A 2P0WA 4OIQF 2DDBA 4IRIA 5B5EC 3BCAA 1D0YA 2DA2A 5LHIA 2ZJRF 4FX4A 2QWWA 4RB3C 2EZHA 2OCEA 3O2PE 5B1AH 3RI4A 1LQ1A 4A3BJ 3BR0A 1B9MA 3S14J 1A6QA 2FD5A 2VUMJ 5D6EA 5IPAA 1IRFA 2XF5A 1OCPA 1LNWA 2JVGA 1I39A 2GWRA 3MEXA 1ZK8A 3Q0WA 1ZLJA 3BZCA 3U1KA 2WV1A 1QPIA 2M1BA 3F8CA 2KJCA 3LA7A 4RAGA 4B48A 4QSHA 1D8KA 4F91B 4ASNA 3MCZA 3IHUA 4RGUA 4EM2A 4IHXA 4A0YA 2VBXA 5K1YA 3J80Z 4U0WA 1R4MB 4DJAA 2HQNA 5EEGA 4II3A 4CCLA 1MZBA 5K5OA 2A61A 2VXDA 1KQ8A 4BY7J 3WE2A 1HOMA 2P6SA 2DLLA 2JMWA 2LKPA 1R49A 4GYGA 3SZGA 2V6CA 2K9NA 3M7GA 3PNTA 3F9KA 1IUYA 1XB4A 2IT0A 3F8BA 3M8FA 4A5NA 3SQNA 2FQ3A 1HW5A 3QU3A 1LEBA 1HBXG 4PGGA 3CQZJ 4WXCA 1BR1A 1DP3A 2EQRA 4XQFA 3DPUA 4OOIA 4ZYAA 4M73A 2FBHA 1LB2A 2H27A 5FO5A 4XN0A 4HX4A 3A1YA 3IKVA 1U78A 3H3VK 2HR3A 2WADA 2OA4A 4KN4X 3S16J 4FASD 4M74A 4WK8F 1DUXC 2JA5J 3G4SI 3VYRB 1VTNC 3OIOA 2LY1A 4IPAA 1H8AC 4HX7A 4M6XA 1I5ZA 1R22A 2L02A 3DF8A 1VQLI 2QQBA 5E18F 3IL2A 1SFOJ 4GDFA 5ILSA 4AIDA 1B72A 1SVOA 3MKYB 2KZGA 2K85A 1U5TA 3S3OA 1XDSA 4E7IA 1JHFA 2E2JJ 2E7XA 5DD8A 2R7ZJ 2DOFA 3C7JA 2KP6A 1K78A 1XC5A 3SFIA 1T08B 1Z77A 3JSOA 5K5QA 3E6MA 4IJAA 1I27A 2AQFA 4BKXA 3VOEA 4ZDLA 1N75A 4E7LA 5IP6A 2MBFA 5HVQC 1Z7LA 3KEQA 2VBYA 5DCMA 4A3MJ 3REOA 5A2QK 2V1NA 1UHWA 4XSXF 3HC7A 3FXRA 1EH8A 3S1RJ 4W97A 1H0MA 4EM1A 4F55A 3B02A 1YW8A 4F52A 1FLIA 5GPAA 3CF2A 3MFKA 4I76A 1LEAA 1IAWA 3K2AA 3HRTA 2DN0A 2ZFWA 2YSRA 2CUEA 3ZOBA 2IEKA 4DOZA 1SD5A 1QRYA 4U88A 1QU3A 1P7IA 4GFBA 1ETWA 2BEOA 2EFOA 1ZAOA 2G9WA 4RS8A 3V8LA 5ICGA 1CF7B 1U8BA 4BDYA 1SVMA 2KMUA 2CO5A 3L9FA 1QHGA 2NAZA 3G6EI 3TGNA 1S7EA 3PSIA 2Z3YA 4MIMA 2QBYB 2A6HF 2DMUA 4IHVA 2A68F 1JXSA 4XRFA 3WODF 2NRAC 2DOAA 1Z3XA 2P81A 3AFHA 3A4CA 4YFXF 4XKCA 2YPRA 2X6XA 3H35A 2DT6A 3B73A 3GLXA 1LJ9A 3HKZA 4L9TA 3DQVC 4C2UA 4U87A 2R7VA 4UNOA 2MA3A 3KFWX 2VJ5A 3CJTB 1WJDA 1PDNC 1Y39A 2WC2A 4ZZLA 3CCSI 2FNAA 1O3QA 3KYDB 1GXQA 3S1NJ 2WAQN 2NYXA 1PP8F 3RZOJ 3RYRA 3OYLA 1QBJA 3ECOA 4PJMA 4A0ZA 2IA1A 1IRXA 4HPQA 4A6EA 2EV5A 4IHSA 2JPBA 1VZ0A 2A6TA 3KP3A 2XKOA 2K9LA 3WHBA 1T95A 4CCMA 1UZCA 2VOPA 2XPVA 1FX7A 2H1LA 2KKOA 4FE4A 2LR8A 4PJLA 4AYBA 4YFNF 5HLHA 3NWTA 4G7ZF 1JE8A 2BOLA 4Y33A 1HSTA 3HOTA 1VQ8I 1VQKI 2JSPA 2XF7A 1G8XA 1YHQI 2D1HA 2ACJA 3CC4I 2DDAA 3LWFA 3LSHA 5IP9J 2WAFA 3PO3J 3RJPA 1A31A 1Z6TA 1YOVB 3ZQGA 2KDZA 2VODA 3B6AA 5JLWA 4IQJA 4FTHA 1IV6A 3E6DA 2WB1N 1WFXA 3C2HA 2WBMA 3CCVI 5EF6A 1Z05A 3K1PA 3W6VA 2E5NA 3U9GA 4UXNA 1X1DA 2G7HA 3BG9A 5CVRA 2NVYJ 1Z1DA 3OWTA 2R5YA 5CQEA 5ERIA 2DMPA 2ELKA 2OQGA 5HNFA 2QF7A 1MSFC 5HLGA 3E5QA 2QSGX 4E7SA 4X1EA 4PSXA 2L3DA 1CGPA 4MEXF 4ZYHA 3KP4A 1XCVA 2ID6A 2K9SA 1GXPA 5H6RA 2JSCA 3CMEI 3KLOA 4NHJA 2X1EA 3CJQB 3GZNB 3LAPA 4MTDA 2YX4A 5E20A 2HZDA 2ZFUA 5BS6A 1VQ9I 3SJMA 2DO7A 2BW3B 3OR1C 2XB0X 4CGZA 2K5CA 1R36A 2ZXJA 2VT3A 1IV8A 1WJ5A 2Q1ZB 3T1BA 3DCFA 4BEHB 1KU7A 1WRJA 2OZ6A 3BTLA 2X6WA 3OOPA 3W2VA 5E3NA 2CRGA 3JAMZ 4D5FA 1TWHJ 2XAUA 2PQ8A 4EQQA 5B3SH 1MMGA 4S04A 1OQYA 1WVRA 2QYOA 4MQVA 2VJJA 3L7WA 3QAHA 2EINH 1KYZA 1YX5A 2FE3A 4JOMA 3TW6A 5F0HA 3WTWC 2VQCA 3M4OJ 1B6AA 1TLHB 3CDHA 4PCQA 4ZH4F 2JA7J 3KZZA 1S6LA 2LKXA 3OV8A 4X6AJ 4XLHA 1TQIA 3ECHA 3MZ8A 1KU3A 3FWEA 4LFUA 4IHYA 1DU0A 1B72B 2BVLA 4XLNF 2R4GA 4V19K 4BE2A 1WZ2A 4OU0A 1U5TB 3CDLA 4LIVA 5KK1A 2VQHA 1YIJI 2OPTA 2MW8A 2F5EA 4HDUA 1XS9A 4G6QA 3S17J 1MNEA 3M3YJ 2YU3A 4IVNA 1LVKA 5L3FA 1PUFA 3MKWB 2IAIA 3BR3A 5GAEJ 1SFUA 3FBIB 3FK7A 2DMNA 3JRGA 4XL9A 5BPIA 2ME6A 4IXAA 3GVAA 1H89C 4JYKA 3FX3A 4M3GA 1F9NA 2D2WA 2ZJPF 1OCTC 2C6YA 1OJLA 5LBQA 2MGQA 1MBHA 5KVRA 5DEQA 4EV0A 3EUAA 4HF0A 4BXXJ 4XLCA 1BN5A 2CQ7A 1ORKA 1TQPA 4PUSA 4YIRX 1RR7A 1VQ7I 2NS8A 4EM0B 4Y15A 2UXXA 3K0LA 4HEA2 3IH3A 1IRZA 2OZUA 1OFCX 4RMNA 5ILVA 1SD7A 2VLAA 4AIKA 4BBRJ 5L3DA 1TZLA 1FIAA 1FWZA 3J81Z 4NBQA 4HLXA 2HS5A 2R7DA 2NOGA 3BG3A 3ELKA 3COAC 2G7UA 3BR2A 3PM1A 1GLNA 4CH7A 1OR7C 2R5ZA 1ETXA 1M1EB 4A3LJ 3P9CA 5IYBJ 2R7TA 2GQQA 2X4HA 2VE8A 3DEWA 1TWAJ 5LLQA 5JI6A 4HV6A 4M9SA 4A3FJ 1ON2A 3IP4B 1MBFA 4HRIA 4HOBA 1P7JA 4N9IA 2I8DA 5C4XJ 2XGEA 3W6JB 1AOYA 4OAZA 1UHMA 4FT8A 1UG2A 4KT6A 3L2CA 4XBFA 1N25A 3L2QA 1OMIA 2Y0MA 3ZQCA 2HOSA 4OMZA 2QSHX 3K6GA 2L9SA 2PJPA 2CV2A 4EJWA 5CJ9A 1X58A 2DTZA 3LA3A 3J7YJ 2HDDA 2O61A 3GYHX 5J8CA 1FBSA 2EWNA 4GYIA 1TWFJ 4CO8A 2XPUA 3QU6A 3ZQQA 2IS2A 2DW4A 3K9TA 4B47A 2E2HJ 1QA6A 2NVQJ 2R7FA 1FZPB 4MHGA 2B9SA 3KIOA 4XICA 3IH4A 1R23A 3JREA 1P6RA 4H0EA 2HPIA 4NC7A 2P5LC 2DA1A 3A03A 4HZFA 1EKEA 5J4YA 5J4VA 2XRNA 3L1PA 4A5MA 2PBIA 2YX7A 2R7UA 2M5WA 4L9JA 4M71A 3ZXSA 4B8XA 3R0JA 4MEYF 3HGYA 4Y13A 3D5SC 2Q0OA 3M8JA 3JRDA 2IVMA 4LLNA 4O6JA 4AIHA 1XX5A 2PJRA 4BU2A 5C3EJ 2RREA 2ZCWA 1E3HA 2W57A 1IN8A 1BOAA 2GXBA 2O5RA 3DPLC 3MN2A 1MBGA 4F93B 1U3EM 1JTYA 4G6TB 1F36A 3TDZC 2W48A 1AHDP 2DOEA 1S5LC 1MNDA 3BR1A 2RVCA 4A6DA 1TWCJ 5HS9A 4EJVA 4OINF 1Y1WJ 1QVUA 2QUFA 5ILUA 2KHMA 9ANTA 1FBQA 3K70D 3KLNA 2HKXA 3ZN0A 4RAFA 4PJ0C 2M9HA 3K4NA 3CUQB 2GAUA 5FFZA 1L3LA 1LDJA 3RTRA 3L2UA 2IBDA 3EYYA 4UUTA 4NQWB 1S3JA 2DA6A 3LSRA 5KCMA 3LSGA 2FQ4A 1KU9A 4HV5A 1XCBA 4OAYA 2JN6A 2XB5A 3RQ4A 4B09A 1PVEA 1S29A 2XIGA 3V8JA 4RGRA 5KHDA 4QWQA 4KICA 4G7OF 3QP6A 3DU6A 1JT6A 2ZNZA 1WWXA 1SMTA 3Q5FA 2ELHA 3BTIA 2NVTJ 2Z5UA 3K1MA 3FMRA 2HDCA 2P4WA 3BQYA 3K4JA 2NVUB 1SEUA 1IRGA 4MQ9F 4MNUA 2VJ4A 1FOWA 3VEPA 1FTTA 3LAJA 4RGSA 1O4XA 4L0YB 1Q1HA 2FMYA 2M0CA 2E1NA 4WWCA 3PQKA 4XKWA 2FSWA 1XDUA 4J00A 4PDKA 1U8RA 3U21A 2JZYA 2QKLB 1MMDA 1BA5A 5FKOA 1IN6A 4BQOA 3F8FA 3Q0VA 2M7AA 3AG3H 3FM5A 4G12A 4BACA 4LD5A 1TW3A 3BPXA 4CZCA 1TNTA 2HXOA 3NRVA 1FBUA 2QQ9A 3HSFA 2VKEA 4GO1A 2ZXWH 5AONA 2V9KA 2HOTA 2AXLA 2GZWA 4MLOA 3GTJJ 1D1BA 2Y0SN 4IF4A 5FB2A 1IDZA 3CD6I 2QKMB 1GV2A 5KAFC 2FEZA 4LG3A 4C9YA 3J7AO 1ZKGA 3VYSB 1WQ2A 3KE2A 5F27A 4KDPA 2JA8J 2WY8Q 4IO9F 2V7FA 5DTDA 3RCOA 2ZB9A 5J6XA 2AXTC 2KZVA 5K7ZA 3I4NJ 2DI3A 4M3BA 1PUEE 2R5ZB 3I64A 2HQ5A 3IAS2 4QIWN 1SAXA 3KCCA 4ENMA 2E36A 4LMYA 2CG4A 4CZZA 4NDLA 1YG2A 5E79C 3BQZA 1ETOA 3P5JA 2V4JC 2VKDA 4C3IJ 3CMAI 3HOYJ 5FKMA 5JLXA 4AWXB 4CCJA 5J47A 3D1NI 2DCEA 3OYBA 2XF6A 2Z33A 5HODA 3S1QJ 1KGSA 1B59A 2FMLA 3CLOA 3GFJA 2O7OA 3HBLA 2DFFA 1T2KA 2H8RA 2ME0A 1ZN2A 4IHWA 5E1ZB 3I59B 3GO5A 2OJED 3HEFA 1FC3A 2O03A 3OL4A 3K7AJ 3HTSB 5FKLA 5K5RA 4MTEA 1ITYA 2KQRA 3GUDA 1IN5A 2KLOA 4EGYA 2PLYA 3ABUA 4UUVA 2NOJB 1K6YA 2JQ7A 1VQOI 3N05A 3LFUA 4CSWA 3OYDA 3ABKH 3I58A 4ZTJA 3JRIA 3V8KA 1G59A 1YS7A 2V9PA 5L3GA 3JRCA 1XGNA 2ELJA 3HM5A 5BPDA 2MSYA 4Y7NJ 1K7AA 1J0RA 1USSA 3C3WA 2A6EF 2X1CA 3R6SA 3VODA 4BQQA 1XGSA 4MFEA 1X19A 2MLKA 2RQQA 5LEJA 1S72I 3HUGA 4PFPA 4KA4A 3BR6A 3L09A 2Y69H 3DPTA 5FROA 4BE1A 3QP5A 3VB2A 1ODDA 2YS9A 3FHNA 4LG0A 4BGDA 2CMPA 3RYPA 5TRDA 4KITB 1ZLKA 4P5OA 2K02A 3U2RA 5DDGA 2KIMA 2CW7A 5FKNA 4DYRA 3E1SA 2E60A 5FLXK 4CUGA 4BQAA 2JT1A 2P5KA 2M30A 4NUBA 3H5NA 3FMSA 3WTVC 1W7PA 3CJRB 2K86A 4UVCA 3V42A 2CU7A 4XLEA 1T33A 4UV8A 5AIPA 4BXFA 3H5RA 3CO7C 2DA7A 4YG2F 2LLKA 4G94A 3LSTA 3GF2A 5CVUA 1A36A 3WU0A 3NWSA 3HOVJ 1EA3A 1K4SA 4U0YA 1ZGWA 3MZYA 2O8KA 4BDZA 1B8IA 3A2KA 3P7NA 2LF7A 5F1RA 2KRCA 2LD5A 1K79A 3P9IA 4L5EA 2EV0A 1Y0NA 4D9JA 2KDOA 1PJRA 1KONA 2BGCA 5KAIC 1G3WA 2ADUA 5BMZA 1IW7F 2LK2A 2O9LA 2K27A 1NG6A 3BTJA 5GAHJ 3IWFA 3L2VA 3HRUA 2HKOA 1T56A 3N4MA 1LFPA 2F5FA 1NH3A 3S93A 1ETYA 2ZNYA 1X1AA 4A12A 2VBWA 5EGOA 3GZ6A 1EF4A 4H4KC 1BW5A 4Q4ZF 1F43A 1LE8A 2LC2A 4HW0A 3AG2H 2BYVE 2LY2A 4AIJA 1B1BA 3V7CA 1MBKA 4EVIA 1YRNB 4MFDA 1FOKA 2L7ZA 3E6BA 4R79A 1VQNI 3EUHC 4XONA 3TDUC 3TP3A 3ERED 1FYKA 1F5TA 4IQ4A 2FOWA 3E7LA 3BZKA 1A35A 2JWTA 3PNVA 2NNNA 1POGA 3K1NA 3W3CA 3I4PA 4FCYA 4NB5A 2VPRA 1VI0A 1AA7A 4XNFA 1JKQC 1MKMA 5E1WA 1BJAA 1V54H 3MMYB 3KEOA 2L01A 3H1CA 3TEDA 2WAQA 2QM3A 4HNUA 3ZQFA 4C2TA 3DKYA 3BTCA 5ICEA 1JJ8C 4CYDA 2B7EA 2XVCA 3PUBA 1WJCA 3AL0C 1FYMA 3C2GA 4XMYA 2EV6A 2A5YB 5JR3A 3F72A 1O3TA 2STTA 4IX7A 1TT0A 4BQNA 2QLZA 3LSMA 4LK0F 2XGXA 1W5TA 4Z2YA 1XMXA 4CCNA 4D0PA 3Q3SA 4HF2A 1R5GA 1BOBA 2P5VA 5IT9K 5L3CA 2WB1A 3NQOA 4GCVA 1ONVA 2NVXJ 3SEZA 5BOXA 1MBJA 4ZYGA 3LNQA 2LH9A 3GXOA 4P1WA 1DGWY 2XAJA 1OPCA 5FD6A 2ETHA 2IGNA 5EG0A 1ZG5A 3SDBA 3WTXC 2V6EA 2AO9A 2OAZA 1KU2A 3OS2A 1UJ8A 2EPFA 3AG1H 2M87A 1OCOH 2ICWG 5E17F 3TBIA 4UY8I 1E17A 2EIJH 2VC1A 1WH5A 3GEZA 4C3HJ 1QPMA 4JP0A 3FXOA 2ID3A 2VKVA 1IG7A 1OR7A 5F08A 4RB1A 1R7JA 1I3AA 3FXLA 1SD4A 2V26A 1EH7A 4CDGA 1RR8C 2HWVA 4E7HA 2E1MC 2EZKA 1HW2A 3ZQHA 4A3EJ 4BAYA 3PNYA 1H88C 1BI1A 1RUNA 1GUUA 5D5UB 1LUJB 3AAFA 3BJOA 4B3AA 3H5AA 3MWMA 3LFKA 4ZDOA 1GVJA 3I3LA 1NHAA 1W7PB 5CQGA 3CCEI 5CLSA 3PL8A 2R7XA 1FMVA 1FP2A 3V7SA 2DYSH 3JW4A 3F8NA 4IRHA 1G3TA 5DV5A 5E3OA 4BHPA 1ETVA 2W1OA 5TISC 1H9GA 3R61A 4ZC3A 4E70A 4EEFG 4L9VA 2ZJQF 1BC7C 1D5VA 2A07F 4RB0A 5LGTA 3OOUA 2FNPA 4ANJA 3IKTA 4HLYA 2WAEA 1D3YA 3LQQA 5J3LA 3R60A 5HDKA 1W36D 4V2FA 4M3EA 5JVTA 1LKXA 2LRDA 4A3IJ 2MG4A 2CUJA 2EFPA 2W7NA 3VPRA 3FXJA 4CHUA 4BYYA 5HOOA 2DFEA 4PJNA 2WA0A 5B66C 2HU9A 1TW2A 2KIUA 3BJAA 1OLTA 4XOPA 2Y30A 1S7OA 3H0DA 3F8MA 5EGOB 5JVGF 3WTZA 4OIPF 4I99C 3I53A 1OCRH 3LA2A 4YFKF 1ACIA 1F4KA 4KIFA 2L5QA 2EA4A 2KRHA 3ABTA 3A01A 4DGWB 4QLCU 3OYEA 4A3GJ 1FYLA 3D5LA 2UV1A 3OR2C 2LBFA 2K40A 1IO2A 5H20A 3ONQA 3WG9A 2DT5A 5FGMA 3QOEA 2K3PA 3WTTC 2BY3A 3M8EA 5EYRA 2BE5F 4CICA 5ICCA 4XORA 1MBEA 2BHYA 1SFXA 2A69F 3GLLA 3WGHA 2RQPA 5J1UA 1X1CA 1U9NA 3CO6C 3BPVA 2X85A 1KA8A 1WHUA 1V5EA 3JRAA 3CESA 4ESBA 2VBZA 4WX9A 2KPMA 2KIQA 2XAGA 2WV0A 3EDPA 3OIPA 2DPDA 1LDKB 5CVIA 2QCOA 2XUBA 3SZPA 1HKQA 2A05A 3HJEA 3I9V2 2VIXA 4K2EA 1K78B 2IGKA 4M72A 1BI3A 3DEUA 1R71A 4P55A 2XHKA 2H8WA 4XLPF 3RPUD 2QA4I 1ZELA 4RAZA 2Y9YA 4BNCA 3BG5A 1N78A 3K4MA 4BJ6C 2R92J 4CCOA 2IS1A 1DPUA 4HNVA 1QZEA 4LB6B 1FNNA 5DCMB 3W2AA 3P9KA 2CUZA 5HS8A 3AG4H 2MD0A 1H9TA 1DGRM 1Q1VA 4D7MA 1SC7A 4JX6A 3T8TA 1Z91A 3RKWA 3J80K 2J5PA 5F1JA 2M4GA 3M9AA 4R1HA 2HVQA 1GDTA 3RDIA 1XG1A 5L3EA 4I7HA 3CCJI 3C1DA 1U2WA 4ABZA 4JX5A 2IRFG 4CA0A 3OY9A 2FJ1A 3PIPF 3H3ZA 1MGTA 3PFYA 3UR3C 4XRSA 4AU7A 4KMUX 1HSJA 5CYVA 2CQKA 4UV9A 1T8IA 2VQLA 2LMDA 4I0BA 2HVSA 4DBQA 1EJ9A 1UMQA 2MABA 1B9NA 2H6BA 3I54A 1RC9A 3OS1A 3HGGA 3K70C 1MD0A 2RKHA 2JRMA 3Q9SA 1IXRC 2L9VA 2Q2EA 3DBHB 1G2HA 3R0AA 1FSEA 1PP7U 2IGMA 2LSOA 4E7ZA 1ZRCA 3FK6A 2PMUA 1WH7A 1D1CA 1MMSA 4LLGF 1X4PA 3LSPA 1YFHA 1TT5B 3QOPA 2FU4A 1HC8A 2PG4A 4Y17A 1FPQA 2HOAA 5JFRA 3HZJA 3MQ0A 4CXFA 4XIDA 1FTZA 2VXZA 2V9VA 4ZYEA 2F6CA 2JVHA 3GZ5A 1FMWA 3BJ6A 1TBXA 3RSNA 1G6NA 3BZ6A 5HDNA 2M4KA 3TMOA 4AC0A 3CCQI 4ZZDA 4KUMA 3UKGA 2HEOA 4I01A 4A2UA 2OD5A 2GIZA 1YO5C 2MFZA 2VC0A 2DYRH 3KX2A 3HDDA 1R5ID 3G3ZA 1XPXA 5FRNA 4WCGA 2F4IA 2IXSA 3GTPJ 1D1AA 3OYHA 4IEJA 3JSPA 3F6VA 1Y8RB 4A3JJ 2BY2A 1QHHD 3WU2C 3KP5A 4JX4A 4R8HA 2H94A 1T6SA 5EEAA 3WTYC 2Y0SA 3TW7A 3K4CA 3TOBA 3HOZJ 2PMHA 3I0TA 3M1CA 2DMQA 2R5YB 1YX3A 3KYCB 3BG6A 4PGHA 3FHZA 1MSEC 4I98B
chains in the Genus database with same CATH topology
2MD5A 1ZGJA 3SFZA 2UXNA 3CUQC 4P9UA 5E8GA 5CVJA 4UHTA 4KN7X 4L9NA 4O5VA 1O7LA 3I71A 1XMKA 2HQRA 1IZ1A 4G7HF 5FFXA 2EFQA 1T38A 1YW9A 3MZHA 1A04A 5JHUA 2HYGD 3GWZA 5ICFA 5DD4A 3E5XA 3O3KA 3ZMVA 5ED4A 2K4BA 2KJBA 1MJ9A 1Z7UA 2MH2A 4I09A 2STWA 2IA2A 5A2QZ 2VE9A 2EFNA 1B4AA 2YR2A 5LGNA 5IT9Z 2RNJA 3F21A 4G8XA 3WE3A 2XASA 2V1DA 4OIRF 2MH9A 2DQLA 4N0BA 1MJAA 3PQJA 3S2WA 3E3VA 2H6CA 3ZMZA 1P4XA 2IPQX 4EMSA 2R3SA 3ML6A 3EUHA 3IC7A 5L3BA 1HKTA 1YLFA 1QGPA 1YQAA 2FXAA 1UFMA 6PAXA 2NNYA 3JAMK 1D8JA 2EK5A 2CFXA 5HS7A 3BDDA 2L4AA 3HOSA 3TO7A 2Q8KA 2HZTA 3KP2A 3L00A 2CGPA 2O8XA 1MJBA 2RN7A 1O3RA 1GHCA 2X0LA 3QPTA 2FRHA 4BHCA 2WTEA 2IJLA 2MC3A 1BIAA 2M8EA 1J9IA 3V7RA 4S05A 2WWYA 1O7FA 4UVAA 1G4DA 4EJOA 1DPRA 4M6YA 3CTAA 1CF7A 2J5OA 1LVAA 3G73A 3J81K 3DXJF 4RAYA 3RKXA 2QBYA 3IRRA 2ZBKA 2K7LA 1QNTA 1EH6A 1P2FA 4OMYA 1IN4A 3BOQA 2RDPA 1FT9A 3ZMSA 5TJJA 2O6GE 3E6CC 2FBIA 1E2XA 3ZMTA 1J5YA 3ULQB 1YW7A 2LF8A 2DU9A 5AIQA 2F2EA 1G3SA 1K6OA 2W24A 2W85A 4KIBA 5H6QA 4HQMA 4G6DA 2QQAA 1TNSA 1LDDA 2EA2A 4FHTA 1BM9A 1FP1D 4ZYDA 1QZYA 2HTSA 4XSZF 1HQCA 3GW2A 3H3UA 4HAMA 1XD7A 3WTSC 2GIVA 3RPUA 3BROA 1P4AA 2ZKZA 1RUOA 2XAHA 4WXHA 2B0LA 4L5JA 3HYIA 2O3FA 3GX4X 1O3SA 1I6XA 5D5XB 1OYYA 4L5IA 4M9ZA 1J2XA 4KYWA 4LJZF 3ISPA 4RB2C 3E97A 2P8TA 3RKYA 4ON0A 4HQEA 2CWEA 2DK5A 5LRSA 2IA0A 2RGVA 2VONA 2LDUA 4YIFA 4UVBA 3ZMDA 4KMFA 1R1VA 2E1CA 2UZKA 5IT3A 3CUOA 1BIBA 4M9XA 2HYFA 1FSHA 1ZRDA 2V1UA 2NS0A 3M1EA 2PI0A 1I1SA 1RIOH 1TQMA 4P9FA 1BC8C 3TQNA 3DKWA 2P7VB 3WTUC 1IXSB 2FF4A 2XV4S 1R00A 2L4MA 1HKSA 1MDMA 1O57A 1OYWA 2DFIA 3DV8A 2VN2A 2DK8A 2VT2A 2W84A 5E8IA 3LQRA 1ZGAA 2FBKA 3CJNA 3K69A 2HFHA 4LG0B 1Z6RA 2DTRA 2D1VA 2ZO4A 3EETA 3H92A 4ENKA 3C18A 2LNBA 4IHTA 2H09A 2IP2A 2Z99A 4Q47A 1WKMA 2KIFA 1QQIA 1DP7P 4ENNA 1RZ4A 3WU1B 1REPC 3HHGA 1USTA 2O0YA 1ZARA 1U6GA 2ESNA 3I5UA 1BI2A 1BI0A 5BQTA 3FM3A 3ZN1A 4ESJA 2DAOA 3D0SA 4BXUA 1J59A 3KETA 4HF1A 5DYMA 2K4JA 1XSVA 4AVPA 3FF5A 5LHHA 2COMA 2W25A 2OQRA 5D5WB 4YIIA 2VOOA 5LGUA 4U7BA 3CUQA 5DUKA 4G9YA 1W7PD 4HYEA 3BP8A 3ZPLA 1L0OC 2EB7A 5D4SA 3ZP5A 4NQWA 2DQRA 3GFMA 3EYIA 1IN7A 3GFLA 1XMAA 1EV7A 4BH9A 2L54A 1YTYA 1U5TC 3E5UA 4A0XA 4WXDA 3SXYA 2EJRA 1P4WA 4KFCA 3JTHA 1XGMA 3IRQA 2ISZA 3W6KB 1XSDA 2P6TA 3R4KA 1R1TA 2PFBA 2CYYA 2QVOA 4L18B 1STZA 3JTGA 2M45A 1I1GA 3T8RA 3WGIA 4JBAA 3K2ZA 2RV8A 1YS6A 3RPQA 3Q9VA 2QZ8A 3FMQA 2MLGA 4HDVA 2Z9OA 5DUIA 1MDMB 2HGCA 5FLXZ 3IWZA 4HA8A 3T0YA 4HX8A 1KQ9A 4KNYA 1ZREA 2PEXA 2PN6A 4P96A 3PFIA 1T98A 4FX0A 4I0AA 2XAQA 4U0VA 4WF2A 1IXCA 3HIFA 1X3UA 4IRGA 1XGOA 1UCRA 4JQFA 1T39A 2IW5A 4JK1X 1R1UA 3I59A 1KQ0A 4Q5SF 3KZYA 3WGGA 1S8NA 2GA1A 2P7CB 2ESHA 1IF1A 3FXUA 1QO0D 2D45A 4ETSA 5E1XA 4MGRA 5D6FA 3QPHA 5FD5A 4GXOA 2JTVA 1J7KA 3TOAA 1TTYA 1OKRA 4I2OA 1ZHFA 4ESFA 5LEKA 4PZJA 3F23A 1ON1A 1P92A 5D4RA 3RIRA 2ZMEA 4LGWA 2GXGA 1QZZA 3DFGA 4Q48A 3MAJA 2UWMA 3HSRA 2FOKA 1KYWA 4N9HA 5J8FA 1ZH5A 3SZTA 4RGXA 1ULYA 2XAFA 4U7DA 3FXQA 2CW0F 3F6OA 1RI7A 1Y0UA 3FZVA 4L0ZB 1SMYF 2BBYA 3DP7A 3HSEA 1YIOA 5LHGA 3KP6A 1WI9A 3F3XA 4LK1F 4TV7A 2A3SA 1HXDA 2HTJA 2TDXA 4EJUA 3QRFF 3U1DA 3HTUA 5HDGA 3O6BB 1YYVA 1UB9A 1ZG1A 2EFWA 1HW1A 1RNLA 5F6FA 2XKPA 2E7WA 1ZYRF 3NEUA 2Y75A 2DBBA 2FA5A 1R58A 3V4GA 1AWCA 2RC4A 2Y48A 2OU2A 1DDNA 4LB5A 1JGSA 1Z9CA 3HRSA 4I02A 2ZJ2A 1SD6A 1OYIA 1J75A 2V1XA 3TO9A 4EGZA 1T0FA 3BWGA 4LLLA 1V4RA 2QENA 1ZG3A 3GFIA 5EEHA 1SFEA 2V79A 2CSOA 2GA2A 3T5XA 5D5VB 4GGGA 1WSUA 1V3FA 4BHBA 4F7ZA 1XN7A 2HOEA 5CVVA 4DQ2A 1R5HA 2XROA 5D8KB 1S7AA 4ENJA 3ZQ7A 1F1ZA 4AD9A 3TO6A 4OIOF 3HHHA 3VFZA 3ZMUA 1BBYA 5DCFA 1FY7A 1XSXA 4O3MA 2OBPA 3BY6A 2KRFA 2F5CA 3HRMA 3SHFA 4EJTA 4KIGA 5D8LB 2JPCA 2ISYA 4DNCA 5F64A 1G3YA 3F22A 3ROUA 1W5SA 2ZMEB 2DPUA 3N97A 5HLIA 2AS5F 1W4MA 1ZRFA 3KP7A 1JHHA 4HBLA 3TKYA 2BV6A 2F5DA 5LRRA 4KT5C 1C0WA 2JRTA 3EQLF 4OIQF 4IRIA 5LHIA 4FX4A 2QWWA 4RB3C 3O2PE 3RI4A 1LQ1A 1B9MA 5D6EA 1IRFA 1LNWA 2GWRA 3MEXA 1ZLJA 2M1BA 3F8CA 2KJCA 3LA7A 1D8KA 4ASNA 3MCZA 3IHUA 4RGUA 4EM2A 4A0YA 2VBXA 5K1YA 3J80Z 4U0WA 2HQNA 5EEGA 1MZBA 5K5OA 2A61A 1KQ8A 3WE2A 2P6SA 2DLLA 2LKPA 4GYGA 2V6CA 3M7GA 1IUYA 1XB4A 2IT0A 3F8BA 3M8FA 4A5NA 3SQNA 2FQ3A 1HW5A 3QU3A 1LEBA 1HBXG 4PGGA 4WXCA 4OOIA 4M73A 2FBHA 1LB2A 2H27A 5FO5A 4HX4A 3IKVA 1U78A 2HR3A 2OA4A 4KN4X 4M74A 4WK8F 1DUXC 1VTNC 4IPAA 4HX7A 4M6XA 1I5ZA 1R22A 2L02A 3DF8A 2QQBA 5E18F 3IL2A 5ILSA 1U5TA 1XDSA 1JHFA 5DD8A 2E7XA 3C7JA 1K78A 3JSOA 5K5QA 3E6MA 4IJAA 1I27A 3VOEA 2MBFA 5HVQC 3KEQA 5DCMA 2VBYA 3REOA 5A2QK 1UHWA 4XSXF 3FXRA 1EH8A 1H0MA 4EM1A 3B02A 1YW8A 1FLIA 3MFKA 1LEAA 1IAWA 3HRTA 2ZFWA 2YSRA 1SD5A 4U88A 2BEOA 2EFOA 1ZAOA 2G9WA 4RS8A 5ICGA 3V8LA 1CF7B 2CO5A 3L9FA 2NAZA 3TGNA 2Z3YA 2QBYB 2A6HF 2A68F 1JXSA 4XRFA 3WODF 2NRAC 4YFXF 2YPRA 3B73A 3GLXA 1LJ9A 4L9TA 3DQVC 4UNOA 2MA3A 3KFWX 1PDNC 2WC2A 4ZZLA 2FNAA 1O3QA 1GXQA 2NYXA 1PP8F 3RYRA 1QBJA 3ECOA 4A0ZA 2IA1A 4A6EA 2EV5A 4IHSA 2JPBA 3KP3A 2XKOA 2VOPA 1FX7A 2KKOA 4YFNF 5HLHA 4G7ZF 1JE8A 1HSTA 3HOTA 2D1HA 2ACJA 3LWFA 3RJPA 1Z6TA 2VODA 3E6DA 1Z05A 3K1PA 3U9GA 4UXNA 2G7HA 5CVRA 1Z1DA 5ERIA 2OQGA 5HLGA 3E5QA 2L3DA 1CGPA 4MEXF 4ZYHA 3KP4A 1XCVA 1GXPA 5H6RA 2JSCA 3KLOA 4NHJA 3LAPA 4MTDA 2YX4A 5E20A 5BS6A 2DO7A 4CGZA 1R36A 2ZXJA 2VT3A 3T1BA 1KU7A 1WRJA 2OZ6A 3OOPA 3JAMZ 2PQ8A 4EQQA 4S04A 2QYOA 4MQVA 3L7WA 3QAHA 1KYZA 2FE3A 3WTWC 1B6AA 1TLHB 3CDHA 4PCQA 4ZH4F 3KZZA 1S6LA 3OV8A 1TQIA 3ECHA 4LFUA 1KU3A 3FWEA 4XLNF 4OU0A 1U5TB 5KK1A 2F5EA 4HDUA 4G6QA 2YU3A 4IVNA 5L3FA 1SFUA 5BPIA 4IXAA 3GVAA 3FX3A 1F9NA 2D2WA 2C6YA 5LBQA 5KVRA 5DEQA 4EV0A 4HF0A 1BN5A 1TQPA 4EM0B 4Y15A 2UXXA 3K0LA 2OZUA 5ILVA 1SD7A 4AIKA 5L3DA 1FWZA 3J81Z 4HLXA 2HS5A 2R7DA 3ELKA 3COAC 2G7UA 3P9CA 2GQQA 2X4HA 2VE8A 5LLQA 5JI6A 4HV6A 4M9SA 1ON2A 4HOBA 4N9IA 3W6JB 1AOYA 1UHMA 4FT8A 3L2CA 4XBFA 1OMIA 2Y0MA 4OMZA 2PJPA 4EJWA 5CJ9A 3LA3A 2O61A 3GYHX 5J8CA 1FBSA 2EWNA 4GYIA 4CO8A 3QU6A 2DW4A 3K9TA 2R7FA 1FZPB 4MHGA 1R23A 1P6RA 4H0EA 2P5LC 4HZFA 2XRNA 4A5MA 2PBIA 2YX7A 2M5WA 4L9JA 4M71A 4B8XA 3R0JA 4MEYF 4Y13A 2Q0OA 2IVMA 4LLNA 4O6JA 4AIHA 2ZCWA 2W57A 1IN8A 1BOAA 2GXBA 3DPLC 1U3EM 3TDZC 2RVCA 4A6DA 5HS9A 4EJVA 4OINF 2QUFA 5ILUA 1FBQA 3KLNA 2HKXA 3ZN0A 3CUQB 2GAUA 5FFZA 1L3LA 1LDJA 3RTRA 3EYYA 1S3JA 1KU9A 4HV5A 1XCBA 4B09A 1S29A 2XIGA 3V8JA 4RGRA 4QWQA 4KICA 4G7OF 3QP6A 2ZNZA 1WWXA 1SMTA 3Q5FA 2ELHA 2Z5UA 3K1MA 3FMRA 2HDCA 2P4WA 1IRGA 4MQ9F 4MNUA 3VEPA 3LAJA 4RGSA 4L0YB 1Q1HA 2FMYA 2E1NA 4WWCA 3PQKA 2FSWA 1XDUA 4PDKA 1U8RA 2JZYA 1IN6A 3F8FA 3FM5A 4LD5A 1TW3A 3BPXA 1TNTA 3NRVA 1FBUA 2QQ9A 3HSFA 4GO1A 5AONA 2AXLA 2GZWA 4IF4A 5FB2A 2FEZA 3J7AO 1WQ2A 3KE2A 4KDPA 5J6XA 2DI3A 1PUEE 3I64A 1SAXA 4ENMA 3KCCA 4LMYA 2CG4A 4CZZA 1YG2A 4AWXB 2Z33A 1KGSA 1B59A 2FMLA 3CLOA 3GFJA 1T2KA 1ZN2A 5E1ZB 3I59B 3GO5A 1FC3A 2O03A 3HTSB 5K5RA 4MTEA 3GUDA 1IN5A 4EGYA 2PLYA 3ABUA 4UUVA 3I58A 3V8KA 1YS7A 5L3GA 1XGNA 5BPDA 1K7AA 1J0RA 1USSA 3C3WA 2A6EF 3R6SA 3VODA 1XGSA 2MLKA 5LEJA 3HUGA 4KA4A 3L09A 3DPTA 3QP5A 3VB2A 1ODDA 4LG0A 3RYPA 5TRDA 1ZLKA 4P5OA 2K02A 3U2RA 5DDGA 2KIMA 5FLXK 4BQAA 2JT1A 2P5KA 2M30A 3FMSA 3WTVC 1W7PA 2K86A 4UVCA 4UV8A 5AIPA 3CO7C 4YG2F 4G94A 3LSTA 3GF2A 5CVUA 3WU0A 4U0YA 3MZYA 3P7NA 2LF7A 5F1RA 1K79A 3P9IA 2EV0A 2BGCA 1G3WA 2ADUA 5BMZA 1IW7F 2K27A 3IWFA 3HRUA 2HKOA 3N4MA 2F5FA 2ZNYA 4A12A 2VBWA 3GZ6A 4Q4ZF 4HW0A 2BYVE 4AIJA 1B1BA 3V7CA 4EVIA 1FOKA 3E6BA 4R79A 3TDUC 3ERED 1FYKA 1F5TA 2NNNA 3K1NA 3I4PA 4NB5A 1MKMA 5E1WA 1BJAA 3KEOA 2L01A 2QM3A 5ICEA 4CYDA 2XVCA 1FYMA 2EV6A 2A5YB 5JR3A 3F72A 1O3TA 2STTA 2QLZA 4LK0F 2XGXA 1W5TA 4Z2YA 4D0PA 4HF2A 1R5GA 2P5VA 5IT9K 5L3CA 4GCVA 3NQOA 1ONVA 5BOXA 4ZYGA 3GXOA 2XAJA 1OPCA 5FD6A 2ETHA 1ZG5A 3WTXC 2OAZA 1KU2A 2M87A 5E17F 1E17A 2VC1A 3GEZA 1QPMA 1OR7A 4RB1A 1R7JA 1SD4A 4CDGA 1EH7A 2HWVA 1HW2A 4BAYA 1BI1A 1RUNA 5D5UB 3AAFA 3BJOA 3MWMA 3LFKA 1GVJA 1NHAA 1W7PB 5CLSA 1FP2A 3V7SA 3JW4A 3F8NA 4IRHA 1G3TA 5DV5A 4BHPA 1H9GA 3R61A 4E70A 1BC7C 4L9VA 1D5VA 2A07F 4RB0A 5LGTA 2FNPA 3IKTA 4HLYA 1D3YA 3LQQA 3R60A 5HDKA 5JVTA 2EFPA 4CHUA 4BYYA 5HOOA 1TW2A 2KIUA 3BJAA 1S7OA 3F8MA 3WTZA 4OIPF 3I53A 3LA2A 4YFKF 1F4KA 4KIFA 2EA4A 3ABTA 4QLCU 1FYLA 3D5LA 5H20A 3WG9A 2DT5A 5FGMA 3WTTC 3M8EA 2BE5F 4CICA 5ICCA 1SFXA 2A69F 3WGHA 2RQPA 3CO6C 3BPVA 1KA8A 4ESBA 2VBZA 4WX9A 2XAGA 2WV0A 3EDPA 2DPDA 1LDKB 5CVIA 2XUBA 3SZPA 1HKQA 4K2EA 1K78B 4M72A 1BI3A 3DEUA 4P55A 2XHKA 4XLPF 4RAZA 4BNCA 1DPUA 4LB6B 1FNNA 5DCMB 3P9KA 5HS8A 1H9TA 3T8TA 1Z91A 3RKWA 3J80K 2J5PA 3M9AA 4R1HA 3RDIA 5L3EA 4I7HA 3C1DA 1U2WA 2IRFG 3H3ZA 1MGTA 4KMUX 1HSJA 5CYVA 2CQKA 4UV9A 4I0BA 1B9NA 2H6BA 3I54A 1MD0A 2RKHA 3Q9SA 1IXRC 2Q2EA 3R0AA 1FSEA 1PP7U 2LSOA 1ZRCA 2PMUA 4LLGF 1YFHA 3QOPA 2FU4A 2PG4A 4Y17A 1FPQA 5JFRA 4CXFA 3MQ0A 2VXZA 2V9VA 4ZYEA 3GZ5A 3BJ6A 1TBXA 1G6NA 3BZ6A 5HDNA 4ZZDA 4KUMA 2HEOA 4I01A 4A2UA 2OD5A 1YO5C 2VC0A 3G3ZA 4WCGA 3JSPA 3F6VA 3KP5A 4R8HA 2H94A 1T6SA 3WTYC 3TOBA 2PMHA 3I0TA 4PGHA 3FHZA 4I98B
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2MD5 A;  1ZGJ A;  3SFZ A;  2UXN A;  3CUQ C;  4P9U A;  5E8G A;  5CVJ A;  4UHT A;  4KN7 X;  4L9N A;  4O5V A;  1O7L A;  3I71 A;  1XMK A;  2HQR A;  1IZ1 A;  4G7H F;  5FFX A;  2EFQ A;  1T38 A;  1YW9 A;  3MZH A;  1A04 A;  5JHU A;  2HYG D;  3GWZ A;  5ICF A;  5DD4 A;  3E5X A;  3O3K A;  3ZMV A;  5ED4 A;  2K4B A;  2KJB A;  1MJ9 A;  1Z7U A;  2MH2 A;  4I09 A;  2STW A;  2IA2 A;  5A2Q Z;  2VE9 A;  2EFN A;  1B4A A;  2YR2 A;  5LGN A;  5IT9 Z;  2RNJ A;  3F21 A;  4G8X A;  3WE3 A;  2XAS A;  2V1D A;  4OIR F;  2MH9 A;  2DQL A;  4N0B A;  1MJA A;  3PQJ A;  3S2W A;  3E3V A;  2H6C A;  3ZMZ A;  1P4X A;  2IPQ X;  4EMS A;  2R3S A;  3ML6 A;  3EUH A;  3IC7 A;  5L3B A;  1HKT A;  1YLF A;  1QGP A;  1YQA A;  2FXA A;  1UFM A;  6PAX A;  2NNY A;  3JAM K;  1D8J A;  2EK5 A;  2CFX A;  5HS7 A;  3BDD A;  2L4A A;  3HOS A;  3TO7 A;  2Q8K A;  2HZT A;  3KP2 A;  3L00 A;  2CGP A;  2O8X A;  1MJB A;  2RN7 A;  1O3R A;  1GHC A;  2X0L A;  3QPT A;  2FRH A;  4BHC A;  2WTE A;  2IJL A;  2MC3 A;  1BIA A;  2M8E A;  1J9I A;  3V7R A;  4S05 A;  2WWY A;  1O7F A;  4UVA A;  1G4D A;  4EJO A;  1DPR A;  4M6Y A;  3CTA A;  1CF7 A;  2J5O A;  1LVA A;  3G73 A;  3J81 K;  3DXJ F;  4RAY A;  3RKX A;  2QBY A;  3IRR A;  2ZBK A;  2K7L A;  1QNT A;  1EH6 A;  1P2F A;  4OMY A;  1IN4 A;  3BOQ A;  2RDP A;  1FT9 A;  3ZMS A;  5TJJ A;  2O6G E;  3E6C C;  2FBI A;  1E2X A;  3ZMT A;  1J5Y A;  3ULQ B;  1YW7 A;  2LF8 A;  2DU9 A;  5AIQ A;  2F2E A;  1G3S A;  1K6O A;  2W24 A;  2W85 A;  4KIB A;  5H6Q A;  4HQM A;  4G6D A;  2QQA A;  1TNS A;  1LDD A;  2EA2 A;  4FHT A;  1BM9 A;  1FP1 D;  4ZYD A;  1QZY A;  2HTS A;  4XSZ F;  1HQC A;  3GW2 A;  3H3U A;  4HAM A;  1XD7 A;  3WTS C;  2GIV A;  3RPU A;  3BRO A;  1P4A A;  2ZKZ A;  1RUO A;  2XAH A;  4WXH A;  2B0L A;  4L5J A;  3HYI A;  2O3F A;  3GX4 X;  1O3S A;  1I6X A;  5D5X B;  1OYY A;  4L5I A;  4M9Z A;  1J2X A;  4KYW A;  4LJZ F;  3ISP A;  4RB2 C;  3E97 A;  2P8T A;  3RKY A;  4ON0 A;  4HQE A;  2CWE A;  2DK5 A;  5LRS A;  2IA0 A;  2RGV A;  2VON A;  2LDU A;  4YIF A;  4UVB A;  3ZMD A;  4KMF A;  1R1V A;  2E1C A;  2UZK A;  5IT3 A;  3CUO A;  1BIB A;  4M9X A;  2HYF A;  1FSH A;  1ZRD A;  2V1U A;  2NS0 A;  3M1E A;  2PI0 A;  1I1S A;  1RIO H;  1TQM A;  4P9F A;  1BC8 C;  3TQN A;  3DKW A;  2P7V B;  3WTU C;  1IXS B;  2FF4 A;  2XV4 S;  1R00 A;  2L4M A;  1HKS A;  1MDM A;  1O57 A;  1OYW A;  2DFI A;  3DV8 A;  2VN2 A;  2DK8 A;  2VT2 A;  2W84 A;  5E8I A;  3LQR A;  1ZGA A;  2FBK A;  3CJN A;  3K69 A;  2HFH A;  4LG0 B;  1Z6R A;  2DTR A;  2D1V A;  2ZO4 A;  3EET A;  3H92 A;  4ENK A;  3C18 A;  2LNB A;  4IHT A;  2H09 A;  2IP2 A;  2Z99 A;  4Q47 A;  1WKM A;  2KIF A;  1QQI A;  1DP7 P;  4ENN A;  1RZ4 A;  3WU1 B;  1REP C;  3HHG A;  1UST A;  2O0Y A;  1ZAR A;  1U6G A;  2ESN A;  3I5U A;  1BI2 A;  1BI0 A;  5BQT A;  3FM3 A;  3ZN1 A;  4ESJ A;  2DAO A;  3D0S A;  4BXU A;  1J59 A;  3KET A;  4HF1 A;  5DYM A;  2K4J A;  1XSV A;  4AVP A;  3FF5 A;  5LHH A;  2COM A;  2W25 A;  2OQR A;  5D5W B;  4YII A;  2VOO A;  5LGU A;  4U7B A;  3CUQ A;  5DUK A;  4G9Y A;  1W7P D;  4HYE A;  3BP8 A;  3ZPL A;  1L0O C;  2EB7 A;  5D4S A;  3ZP5 A;  4NQW A;  2DQR A;  3GFM A;  3EYI A;  1IN7 A;  3GFL A;  1XMA A;  1EV7 A;  4BH9 A;  2L54 A;  1YTY A;  1U5T C;  3E5U A;  4A0X A;  4WXD A;  3SXY A;  2EJR A;  1P4W A;  4KFC A;  3JTH A;  1XGM A;  3IRQ A;  2ISZ A;  3W6K B;  1XSD A;  2P6T A;  3R4K A;  1R1T A;  2PFB A;  2CYY A;  2QVO A;  4L18 B;  1STZ A;  3JTG A;  2M45 A;  1I1G A;  3T8R A;  3WGI A;  4JBA A;  3K2Z A;  2RV8 A;  1YS6 A;  3RPQ A;  3Q9V A;  2QZ8 A;  3FMQ A;  2MLG A;  4HDV A;  2Z9O A;  5DUI A;  1MDM B;  2HGC A;  5FLX Z;  3IWZ A;  4HA8 A;  3T0Y A;  4HX8 A;  1KQ9 A;  4KNY A;  1ZRE A;  2PEX A;  2PN6 A;  4P96 A;  3PFI A;  1T98 A;  4FX0 A;  4I0A A;  2XAQ A;  4U0V A;  4WF2 A;  1IXC A;  3HIF A;  1X3U A;  4IRG A;  1XGO A;  1UCR A;  4JQF A;  1T39 A;  2IW5 A;  4JK1 X;  1R1U A;  3I59 A;  1KQ0 A;  4Q5S F;  3KZY A;  3WGG A;  1S8N A;  2GA1 A;  2P7C B;  2ESH A;  1IF1 A;  3FXU A;  1QO0 D;  2D45 A;  4ETS A;  5E1X A;  4MGR A;  5D6F A;  3QPH A;  5FD5 A;  4GXO A;  2JTV A;  1J7K A;  3TOA A;  1TTY A;  1OKR A;  4I2O A;  1ZHF A;  4ESF A;  5LEK A;  4PZJ A;  3F23 A;  1ON1 A;  1P92 A;  5D4R A;  3RIR A;  2ZME A;  4LGW A;  2GXG A;  1QZZ A;  3DFG A;  4Q48 A;  3MAJ A;  2UWM A;  3HSR A;  2FOK A;  1KYW A;  4N9H A;  5J8F A;  1ZH5 A;  3SZT A;  4RGX A;  1ULY A;  2XAF A;  4U7D A;  3FXQ A;  2CW0 F;  3F6O A;  1RI7 A;  1Y0U A;  3FZV A;  4L0Z B;  1SMY F;  2BBY A;  3DP7 A;  3HSE A;  1YIO A;  5LHG A;  3KP6 A;  1WI9 A;  3F3X A;  4LK1 F;  4TV7 A;  2A3S A;  1HXD A;  2HTJ A;  2TDX A;  4EJU A;  3QRF F;  3U1D A;  3HTU A;  5HDG A;  3O6B B;  1YYV A;  1UB9 A;  1ZG1 A;  2EFW A;  1HW1 A;  1RNL A;  5F6F A;  2XKP A;  2E7W A;  1ZYR F;  3NEU A;  2Y75 A;  2DBB A;  2FA5 A;  1R58 A;  3V4G A;  1AWC A;  2RC4 A;  2Y48 A;  2OU2 A;  1DDN A;  4LB5 A;  1JGS A;  1Z9C A;  3HRS A;  4I02 A;  2ZJ2 A;  1SD6 A;  1OYI A;  1J75 A;  2V1X A;  3TO9 A;  4EGZ A;  1T0F A;  3BWG A;  4LLL A;  1V4R A;  2QEN A;  1ZG3 A;  3GFI A;  5EEH A;  1SFE A;  2V79 A;  2CSO A;  2GA2 A;  3T5X A;  5D5V B;  4GGG A;  1WSU A;  1V3F A;  4BHB A;  4F7Z A;  1XN7 A;  2HOE A;  5CVV A;  4DQ2 A;  1R5H A;  2XRO A;  5D8K B;  1S7A A;  4ENJ A;  3ZQ7 A;  1F1Z A;  4AD9 A;  3TO6 A;  4OIO F;  3HHH A;  3VFZ A;  3ZMU A;  1BBY A;  5DCF A;  1FY7 A;  1XSX A;  4O3M A;  2OBP A;  3BY6 A;  2KRF A;  2F5C A;  3HRM A;  3SHF A;  4EJT A;  4KIG A;  5D8L B;  2JPC A;  2ISY A;  4DNC A;  5F64 A;  1G3Y A;  3F22 A;  3ROU A;  1W5S A;  2ZME B;  2DPU A;  3N97 A;  5HLI A;  2AS5 F;  1W4M A;  1ZRF A;  3KP7 A;  1JHH A;  4HBL A;  3TKY A;  2BV6 A;  2F5D A;  5LRR A;  4KT5 C;  1C0W A;  2JRT A;  3EQL F;  4OIQ F;  4IRI A;  5LHI A;  4FX4 A;  2QWW A;  4RB3 C;  3O2P E;  3RI4 A;  1LQ1 A;  1B9M A;  5D6E A;  1IRF A;  1LNW A;  2GWR A;  3MEX A;  1ZLJ A;  2M1B A;  3F8C A;  2KJC A;  3LA7 A;  1D8K A;  4ASN A;  3MCZ A;  3IHU A;  4RGU A;  4EM2 A;  4A0Y A;  2VBX A;  5K1Y A;  3J80 Z;  4U0W A;  2HQN A;  5EEG A;  1MZB A;  5K5O A;  2A61 A;  1KQ8 A;  3WE2 A;  2P6S A;  2DLL A;  2LKP A;  4GYG A;  2V6C A;  3M7G A;  1IUY A;  1XB4 A;  2IT0 A;  3F8B A;  3M8F A;  4A5N A;  3SQN A;  2FQ3 A;  1HW5 A;  3QU3 A;  1LEB A;  1HBX G;  4PGG A;  4WXC A;  4OOI A;  4M73 A;  2FBH A;  1LB2 A;  2H27 A;  5FO5 A;  4HX4 A;  3IKV A;  1U78 A;  2HR3 A;  2OA4 A;  4KN4 X;  4M74 A;  4WK8 F;  1DUX C;  1VTN C;  4IPA A;  4HX7 A;  4M6X A;  1I5Z A;  1R22 A;  2L02 A;  3DF8 A;  2QQB A;  5E18 F;  3IL2 A;  5ILS A;  1U5T A;  1XDS A;  1JHF A;  5DD8 A;  2E7X A;  3C7J A;  1K78 A;  3JSO A;  5K5Q A;  3E6M A;  4IJA A;  1I27 A;  3VOE A;  2MBF A;  5HVQ C;  3KEQ A;  5DCM A;  2VBY A;  3REO A;  5A2Q K;  1UHW A;  4XSX F;  3FXR A;  1EH8 A;  1H0M A;  4EM1 A;  3B02 A;  1YW8 A;  1FLI A;  3MFK A;  1LEA A;  1IAW A;  3HRT A;  2ZFW A;  2YSR A;  1SD5 A;  4U88 A;  2BEO A;  2EFO A;  1ZAO A;  2G9W A;  4RS8 A;  5ICG A;  3V8L A;  1CF7 B;  2CO5 A;  3L9F A;  2NAZ A;  3TGN A;  2Z3Y A;  2QBY B;  2A6H F;  2A68 F;  1JXS A;  4XRF A;  3WOD F;  2NRA C;  4YFX F;  2YPR A;  3B73 A;  3GLX A;  1LJ9 A;  4L9T A;  3DQV C;  4UNO A;  2MA3 A;  3KFW X;  1PDN C;  2WC2 A;  4ZZL A;  2FNA A;  1O3Q A;  1GXQ A;  2NYX A;  1PP8 F;  3RYR A;  1QBJ A;  3ECO A;  4A0Z A;  2IA1 A;  4A6E A;  2EV5 A;  4IHS A;  2JPB A;  3KP3 A;  2XKO A;  2VOP A;  1FX7 A;  2KKO A;  4YFN F;  5HLH A;  4G7Z F;  1JE8 A;  1HST A;  3HOT A;  2D1H A;  2ACJ A;  3LWF A;  3RJP A;  1Z6T A;  2VOD A;  3E6D A;  1Z05 A;  3K1P A;  3U9G A;  4UXN A;  2G7H A;  5CVR A;  1Z1D A;  5ERI A;  2OQG A;  5HLG A;  3E5Q A;  2L3D A;  1CGP A;  4MEX F;  4ZYH A;  3KP4 A;  1XCV A;  1GXP A;  5H6R A;  2JSC A;  3KLO A;  4NHJ A;  3LAP A;  4MTD A;  2YX4 A;  5E20 A;  5BS6 A;  2DO7 A;  4CGZ A;  1R36 A;  2ZXJ A;  2VT3 A;  3T1B A;  1KU7 A;  1WRJ A;  2OZ6 A;  3OOP A;  3JAM Z;  2PQ8 A;  4EQQ A;  4S04 A;  2QYO A;  4MQV A;  3L7W A;  3QAH A;  1KYZ A;  2FE3 A;  3WTW C;  1B6A A;  1TLH B;  3CDH A;  4PCQ A;  4ZH4 F;  3KZZ A;  1S6L A;  3OV8 A;  1TQI A;  3ECH A;  4LFU A;  1KU3 A;  3FWE A;  4XLN F;  4OU0 A;  1U5T B;  5KK1 A;  2F5E A;  4HDU A;  4G6Q A;  2YU3 A;  4IVN A;  5L3F A;  1SFU A;  5BPI A;  4IXA A;  3GVA A;  3FX3 A;  1F9N A;  2D2W A;  2C6Y A;  5LBQ A;  5KVR A;  5DEQ A;  4EV0 A;  4HF0 A;  1BN5 A;  1TQP A;  4EM0 B;  4Y15 A;  2UXX A;  3K0L A;  2OZU A;  5ILV A;  1SD7 A;  4AIK A;  5L3D A;  1FWZ A;  3J81 Z;  4HLX A;  2HS5 A;  2R7D A;  3ELK A;  3COA C;  2G7U A;  3P9C A;  2GQQ A;  2X4H A;  2VE8 A;  5LLQ A;  5JI6 A;  4HV6 A;  4M9S A;  1ON2 A;  4HOB A;  4N9I A;  3W6J B;  1AOY A;  1UHM A;  4FT8 A;  3L2C A;  4XBF A;  1OMI A;  2Y0M A;  4OMZ A;  2PJP A;  4EJW A;  5CJ9 A;  3LA3 A;  2O61 A;  3GYH X;  5J8C A;  1FBS A;  2EWN A;  4GYI A;  4CO8 A;  3QU6 A;  2DW4 A;  3K9T A;  2R7F A;  1FZP B;  4MHG A;  1R23 A;  1P6R A;  4H0E A;  2P5L C;  4HZF A;  2XRN A;  4A5M A;  2PBI A;  2YX7 A;  2M5W A;  4L9J A;  4M71 A;  4B8X A;  3R0J A;  4MEY F;  4Y13 A;  2Q0O A;  2IVM A;  4LLN A;  4O6J A;  4AIH A;  2ZCW A;  2W57 A;  1IN8 A;  1BOA A;  2GXB A;  3DPL C;  1U3E M;  3TDZ C;  2RVC A;  4A6D A;  5HS9 A;  4EJV A;  4OIN F;  2QUF A;  5ILU A;  1FBQ A;  3KLN A;  2HKX A;  3ZN0 A;  3CUQ B;  2GAU A;  5FFZ A;  1L3L A;  1LDJ A;  3RTR A;  3EYY A;  1S3J A;  1KU9 A;  4HV5 A;  1XCB A;  4B09 A;  1S29 A;  2XIG A;  3V8J A;  4RGR A;  4QWQ A;  4KIC A;  4G7O F;  3QP6 A;  2ZNZ A;  1WWX A;  1SMT A;  3Q5F A;  2ELH A;  2Z5U A;  3K1M A;  3FMR A;  2HDC A;  2P4W A;  1IRG A;  4MQ9 F;  4MNU A;  3VEP A;  3LAJ A;  4RGS A;  4L0Y B;  1Q1H A;  2FMY A;  2E1N A;  4WWC A;  3PQK A;  2FSW A;  1XDU A;  4PDK A;  1U8R A;  2JZY A;  1IN6 A;  3F8F A;  3FM5 A;  4LD5 A;  1TW3 A;  3BPX A;  1TNT A;  3NRV A;  1FBU A;  2QQ9 A;  3HSF A;  4GO1 A;  5AON A;  2AXL A;  2GZW A;  4IF4 A;  5FB2 A;  2FEZ A;  3J7A O;  1WQ2 A;  3KE2 A;  4KDP A;  5J6X A;  2DI3 A;  1PUE E;  3I64 A;  1SAX A;  4ENM A;  3KCC A;  4LMY A;  2CG4 A;  4CZZ A;  1YG2 A;  4AWX B;  2Z33 A;  1KGS A;  1B59 A;  2FML A;  3CLO A;  3GFJ A;  1T2K A;  1ZN2 A;  5E1Z B;  3I59 B;  3GO5 A;  1FC3 A;  2O03 A;  3HTS B;  5K5R A;  4MTE A;  3GUD A;  1IN5 A;  4EGY A;  2PLY A;  3ABU A;  4UUV A;  3I58 A;  3V8K A;  1YS7 A;  5L3G A;  1XGN A;  5BPD A;  1K7A A;  1J0R A;  1USS A;  3C3W A;  2A6E F;  3R6S A;  3VOD A;  1XGS A;  2MLK A;  5LEJ A;  3HUG A;  4KA4 A;  3L09 A;  3DPT A;  3QP5 A;  3VB2 A;  1ODD A;  4LG0 A;  3RYP A;  5TRD A;  1ZLK A;  4P5O A;  2K02 A;  3U2R A;  5DDG A;  2KIM A;  5FLX K;  4BQA A;  2JT1 A;  2P5K A;  2M30 A;  3FMS A;  3WTV C;  1W7P A;  2K86 A;  4UVC A;  4UV8 A;  5AIP A;  3CO7 C;  4YG2 F;  4G94 A;  3LST A;  3GF2 A;  5CVU A;  3WU0 A;  4U0Y A;  3MZY A;  3P7N A;  2LF7 A;  5F1R A;  1K79 A;  3P9I A;  2EV0 A;  2BGC A;  1G3W A;  2ADU A;  5BMZ A;  1IW7 F;  2K27 A;  3IWF A;  3HRU A;  2HKO A;  3N4M A;  2F5F A;  2ZNY A;  4A12 A;  2VBW A;  3GZ6 A;  4Q4Z F;  4HW0 A;  2BYV E;  4AIJ A;  1B1B A;  3V7C A;  4EVI A;  1FOK A;  3E6B A;  4R79 A;  3TDU C;  3ERE D;  1FYK A;  1F5T A;  2NNN A;  3K1N A;  3I4P A;  4NB5 A;  1MKM A;  5E1W A;  1BJA A;  3KEO A;  2L01 A;  2QM3 A;  5ICE A;  4CYD A;  2XVC A;  1FYM A;  2EV6 A;  2A5Y B;  5JR3 A;  3F72 A;  1O3T A;  2STT A;  2QLZ A;  4LK0 F;  2XGX A;  1W5T A;  4Z2Y A;  4D0P A;  4HF2 A;  1R5G A;  2P5V A;  5IT9 K;  5L3C A;  4GCV A;  3NQO A;  1ONV A;  5BOX A;  4ZYG A;  3GXO A;  2XAJ A;  1OPC A;  5FD6 A;  2ETH A;  1ZG5 A;  3WTX C;  2OAZ A;  1KU2 A;  2M87 A;  5E17 F;  1E17 A;  2VC1 A;  3GEZ A;  1QPM A;  1OR7 A;  4RB1 A;  1R7J A;  1SD4 A;  4CDG A;  1EH7 A;  2HWV A;  1HW2 A;  4BAY A;  1BI1 A;  1RUN A;  5D5U B;  3AAF A;  3BJO A;  3MWM A;  3LFK A;  1GVJ A;  1NHA A;  1W7P B;  5CLS A;  1FP2 A;  3V7S A;  3JW4 A;  3F8N A;  4IRH A;  1G3T A;  5DV5 A;  4BHP A;  1H9G A;  3R61 A;  4E70 A;  1BC7 C;  4L9V A;  1D5V A;  2A07 F;  4RB0 A;  5LGT A;  2FNP A;  3IKT A;  4HLY A;  1D3Y A;  3LQQ A;  3R60 A;  5HDK A;  5JVT A;  2EFP A;  4CHU A;  4BYY A;  5HOO A;  1TW2 A;  2KIU A;  3BJA A;  1S7O A;  3F8M A;  3WTZ A;  4OIP F;  3I53 A;  3LA2 A;  4YFK F;  1F4K A;  4KIF A;  2EA4 A;  3ABT A;  4QLC U;  1FYL A;  3D5L A;  5H20 A;  3WG9 A;  2DT5 A;  5FGM A;  3WTT C;  3M8E A;  2BE5 F;  4CIC A;  5ICC A;  1SFX A;  2A69 F;  3WGH A;  2RQP A;  3CO6 C;  3BPV A;  1KA8 A;  4ESB A;  2VBZ A;  4WX9 A;  2XAG A;  2WV0 A;  3EDP A;  2DPD A;  1LDK B;  5CVI A;  2XUB A;  3SZP A;  1HKQ A;  4K2E A;  1K78 B;  4M72 A;  1BI3 A;  3DEU A;  4P55 A;  2XHK A;  4XLP F;  4RAZ A;  4BNC A;  1DPU A;  4LB6 B;  1FNN A;  5DCM B;  3P9K A;  5HS8 A;  1H9T A;  3T8T A;  1Z91 A;  3RKW A;  3J80 K;  2J5P A;  3M9A A;  4R1H A;  3RDI A;  5L3E A;  4I7H A;  3C1D A;  1U2W A;  2IRF G;  3H3Z A;  1MGT A;  4KMU X;  1HSJ A;  5CYV A;  2CQK A;  4UV9 A;  4I0B A;  1B9N A;  2H6B A;  3I54 A;  1MD0 A;  2RKH A;  3Q9S A;  1IXR C;  2Q2E A;  3R0A A;  1FSE A;  1PP7 U;  2LSO A;  1ZRC A;  2PMU A;  4LLG F;  1YFH A;  3QOP A;  2FU4 A;  2PG4 A;  4Y17 A;  1FPQ A;  5JFR A;  4CXF A;  3MQ0 A;  2VXZ A;  2V9V A;  4ZYE A;  3GZ5 A;  3BJ6 A;  1TBX A;  1G6N A;  3BZ6 A;  5HDN A;  4ZZD A;  4KUM A;  2HEO A;  4I01 A;  4A2U A;  2OD5 A;  1YO5 C;  2VC0 A;  3G3Z A;  4WCG A;  3JSP A;  3F6V A;  3KP5 A;  4R8H A;  2H94 A;  1T6S A;  3WTY C;  3TOB A;  2PMH A;  3I0T A;  4PGH A;  3FHZ A;  4I98 B; 
#chains in the Genus database with same CATH topology
 2MD5 A;  1ZGJ A;  3SFZ A;  2UXN A;  3JRB A;  4AUX A;  3CUQ C;  3KEY A;  4P9U A;  5E8G A;  1R6R A;  1IDY A;  1MIJ A;  2X6Y A;  2GLO A;  5CVJ A;  3B6C A;  4Y4R A;  1IC8 A;  1K61 A;  4UHT A;  2HXI A;  4KN7 X;  3H9Q A;  4L9N A;  3ZGK A;  3OYF A;  3EUK L;  3ASO H;  3IAM 2;  3A01 B;  4O5V A;  1O7L A;  3I71 A;  2LBF B;  1XMK A;  2HQR A;  2E1O A;  3FXM A;  1NTC A;  4PJJ A;  1IZ1 A;  4G7H F;  1W0T A;  4I6Z A;  2YU9 J;  5FFX A;  2Y9Z A;  3LSJ A;  4BL0 B;  3G71 I;  1FOY A;  2EFQ A;  1T38 A;  1YW9 A;  3MZH A;  1A04 A;  5JHU A;  2HYG D;  3GWZ A;  3IH2 A;  1Z67 A;  5ICF A;  5DD4 A;  2ZXI A;  2XGC A;  4FE7 A;  2VL8 A;  3E5X A;  3O3K A;  3ZMV A;  5ED4 A;  1VQP I;  2K4B A;  1UG0 A;  2KJB A;  1MJ9 A;  5E3M A;  1Z7U A;  2MH2 A;  2VB6 A;  4I09 A;  2LKS A;  4X0G A;  2STW A;  1Z21 A;  2IA2 A;  5A2Q Z;  2VE9 A;  2EFN A;  1I3Q J;  3OSG A;  1IGN A;  1B4A A;  5LD2 C;  2YR2 A;  2H1K A;  5LGN A;  5IT9 Z;  1X1P A;  4V2G A;  2RNJ A;  3W2W A;  1PUF B;  2E35 A;  3CP8 A;  1SVL A;  3MD2 A;  1ETQ A;  1Y6I A;  4A3D J;  3F21 A;  4G8X A;  3WE3 A;  2DMT A;  2XAS A;  2QEX I;  2X48 A;  2DXI A;  2DFH A;  1JTX A;  2RNG A;  2OF7 A;  3O8G A;  2V1D A;  2EIK H;  4BJT A;  2X6O A;  4OIR F;  2UUZ A;  3X2Q H;  1AU7 A;  2MH9 A;  2DQL A;  2ZXH A;  4ZTF A;  4N0B A;  2ECC A;  3G1M A;  1MJA A;  5C44 J;  4RM2 A;  3A02 A;  1FJL A;  3PQJ A;  3S2W A;  3E3V A;  2HYJ A;  5H2F C;  2H6C A;  3VWB A;  3FIS A;  3ZMZ A;  1P4X A;  2LP0 A;  2IPQ X;  4EMS A;  2BY1 A;  2R3S A;  3SYT A;  4FIS A;  2Y2Z A;  2I5U A;  3ML6 A;  3EUH A;  3IC7 A;  1A6I A;  5L3B A;  1HKT A;  1YLF A;  1QGP A;  1YQA A;  3HOX J;  2FXA A;  2F48 A;  2QGU A;  3CF5 F;  2EZI A;  2DA4 A;  2IS4 A;  1YJW I;  1UFM A;  3JRH A;  6PAX A;  2NNY A;  3JAM K;  2Q2E B;  3NAU A;  3DEE A;  4NC6 A;  1D8J A;  2EK5 A;  2CFX A;  1W1W E;  3BDD A;  5HS7 A;  2X51 A;  4J01 A;  2L4A A;  2WY7 Q;  3K4L A;  1JT0 A;  3HOS A;  1OIS A;  3FKJ A;  1UEL B;  3G2B A;  3ZQL A;  1GT0 C;  3TO7 A;  2GOM A;  2VAS A;  1CQT A;  2Q8K A;  2HZT A;  3KP2 A;  3ZQI A;  1V55 H;  4A93 J;  3L00 A;  2CV0 A;  2F4O B;  3BCB A;  3OSF A;  1VND A;  2CGP A;  2O8X A;  1MJB A;  2RN7 A;  1O3R A;  4DIQ A;  1GHC A;  1ZR2 A;  3GTG J;  1TL8 A;  3LSI A;  2EBI A;  2X0L A;  3QPT A;  2FRH A;  1NG7 A;  4BE0 A;  2PJR B;  4BHC A;  2CW8 A;  4CCK A;  2WTE A;  1DQU A;  1J09 A;  2HI3 A;  3M07 A;  3SDG A;  2IJL A;  2MC3 A;  2XDV A;  1BIA A;  3I4M J;  2M8E A;  2FUG 2;  1MH3 A;  1J9I A;  3V7R A;  3VYU B;  4S05 A;  2WWY A;  1O7F A;  4UVA A;  1G4D A;  1JUS A;  3S2H J;  4EJO A;  1DPR A;  4M6Y A;  2ZME C;  3CTA A;  1CF7 A;  3GTO J;  2VI6 A;  1D0X A;  2J5O A;  2JUC A;  3WG7 H;  5M5W J;  1VQ6 I;  1LVA A;  1UAA A;  3G73 A;  1RPW A;  2F5V A;  2ZSH B;  3J81 K;  2E5Z A;  3CLQ A;  3DXJ F;  4RAY A;  3RKX A;  2QBY A;  3IRR A;  2ZBK A;  2K7L A;  4PSW A;  4DW6 A;  1QNT A;  2ECB A;  1EH6 A;  1P2F A;  4OMY A;  3ZR8 X;  1X3Z B;  1IN4 A;  5TGT A;  4UUS A;  3BOQ A;  2RDP A;  1FT9 A;  3ZMS A;  4BY1 J;  4M3F A;  5TJJ A;  2O6G E;  3E6C C;  1XTA A;  2FBI A;  3GTK J;  1FIP A;  1E2X A;  3ZMT A;  1J5Y A;  3ULQ B;  1YJ9 I;  1K4T A;  2GXA A;  1YW7 A;  2LF8 A;  2DU9 A;  1RKT A;  4A3C J;  2X1D A;  5BNG A;  5AIQ A;  2F2E A;  1G3S A;  4II2 A;  2W24 A;  2W85 A;  1K6O A;  4KIB A;  2FX0 A;  4J19 A;  4B43 A;  3S8P A;  3OS0 A;  1W5C C;  5H6Q A;  3KYL A;  3RZD J;  4HQM A;  3CCL I;  1K83 J;  4G6D A;  2QQA A;  1TNS A;  1JKP C;  2MC4 A;  1LDD A;  2EA2 A;  4FHT A;  1BM9 A;  1FP1 D;  2PMZ N;  2LOO A;  1RKW A;  4ZYD A;  3OYN A;  1QZY A;  3K4B A;  2HTS A;  3AKZ A;  4XSZ F;  1HQC A;  3GW2 A;  5HLT A;  5GAG J;  3H3U A;  1UHS A;  3FIW A;  4HAM A;  5GAD J;  3FBN B;  1XD7 A;  3WTS C;  2GIV A;  3ASN H;  3QYB A;  3BRO A;  3RPU A;  1P4A A;  3GTQ J;  1X2M A;  2ZKZ A;  4LOC A;  3H9J A;  1RUO A;  2CFO A;  2DJN A;  2XAH A;  3QWL A;  4WXH A;  2B0L A;  4L5J A;  3HYI A;  2O3F A;  2BXY A;  2R7S A;  2M2E A;  3GX4 X;  1O3S A;  2HVR A;  1I6X A;  1QVT A;  5D5X B;  1OYY A;  4YRV A;  4L5I A;  4M9Z A;  2KFD A;  3FDY A;  2M8G X;  1NK3 P;  1J2X A;  5IYC J;  2BW3 A;  3DLA A;  4KYW A;  4LJZ F;  3ISP A;  4ZJZ A;  4UB8 C;  2CH0 A;  4RB2 C;  3CCM I;  3E97 A;  2P8T A;  4BEH A;  3RKY A;  4ON0 A;  4B44 A;  4HQE A;  2CWE A;  3BR5 A;  3FXK A;  2DK5 A;  5LRS A;  2IA0 A;  2RGV A;  2VON A;  2LDU A;  3OYK A;  4YIF A;  1T0F C;  4UVB A;  2CS3 A;  3ZMD A;  2TCT A;  4KMF A;  1R1V A;  2AQE A;  2OTL I;  2E1C A;  2UZK A;  2LYC A;  3CCY A;  2HDW A;  5IT3 A;  1WGX A;  1ERD A;  3CUO A;  5F04 A;  1BIB A;  3VYT B;  4DYQ A;  4M9X A;  2HYF A;  2Y31 A;  1FSH A;  1ZRD A;  1JUP A;  2V1U A;  1BR2 A;  2NS0 A;  3M1E A;  4S0H B;  2PI0 A;  1I1S A;  1RIO H;  4OWR B;  1TQM A;  2R0Q C;  2NS7 A;  2L0K A;  3CCR I;  4P9F A;  1BC8 C;  1DU6 A;  3TQN A;  5FKK A;  2M7B A;  3DKW A;  2P7V B;  1LPQ A;  3AL0 B;  3WTU C;  3S32 A;  2DT7 B;  1GVD A;  3BC8 A;  1IXS B;  1X4O A;  2EH3 A;  1SAN A;  3DTE A;  2L2O A;  3G1O A;  2FF4 A;  2XPW A;  5LFA A;  4PFO A;  2XV4 S;  1JGG A;  1R00 A;  2L4M A;  4DBR A;  1VQ5 I;  4YEL A;  1W36 C;  2KIS A;  3BG7 A;  1HKS A;  1MDM A;  1O57 A;  1OYW A;  2DFI A;  3DV8 A;  2VN2 A;  4RA2 A;  1GV5 A;  2DK8 A;  2VT2 A;  4PK4 A;  2R7R A;  1HA8 A;  2W84 A;  4BUP A;  5E8I A;  3HUG B;  3LQR A;  3Q0U A;  1ZGA A;  1JKR C;  2FBK A;  2VKH A;  3ABM H;  3CJN A;  3K69 A;  2HFH A;  4LG0 B;  1Z6R A;  2DTR A;  4RDU A;  2XC7 A;  2D1V A;  5GTI C;  4E7J A;  3DTK A;  3BLY A;  1HDD C;  1WJF A;  2K9M A;  2ZO4 A;  1YIT I;  1HLV A;  3IUO A;  5GP9 A;  1LFU P;  1ETK A;  3EET A;  3CCU I;  3H92 A;  4ENK A;  1YI2 I;  3DWL E;  1VQM I;  3GME A;  3C18 A;  2DA3 A;  2HQA A;  2E1M B;  4UUS B;  1HDP A;  5E3L A;  2LNB A;  3C2B A;  2H09 A;  4IHT A;  4XRS G;  2IP2 A;  2Z99 A;  2R7W A;  4Q47 A;  3OL3 A;  2OUM A;  2BZT A;  1WKM A;  2KIF A;  3H9G A;  1QQI A;  4B3X A;  4M3D A;  3VSK A;  1DP7 P;  4ENN A;  1RZ4 A;  3WU1 B;  1REP C;  2LY9 A;  1ZR4 A;  4XRM A;  1D0Z A;  3HHG A;  1UST A;  2JUG A;  2O0Y A;  4BJ5 C;  1B8I B;  1ZAR A;  2IS6 A;  1YJN I;  3OYC A;  1JJ6 C;  1U6G A;  4RLF A;  2E34 A;  2ESN A;  5GPC A;  4XK4 A;  3I5U A;  2DA5 A;  2M34 A;  3CDI A;  1BI2 A;  2L7K A;  1BI0 A;  2BVM A;  5BQT A;  4F3Q A;  4E7K A;  3FM3 A;  4XLF A;  2Z16 A;  3VSL A;  1ZQ3 P;  1E3O C;  3ZN1 A;  1TP4 A;  2VJI A;  3D5R C;  5J40 A;  3JRF A;  4ESJ A;  2DAO A;  3D0S A;  4BXU A;  3PIO F;  2KL4 A;  3QYE A;  2BXZ A;  1WCM J;  1J59 A;  2OTJ I;  3KET A;  4HF1 A;  1E0E A;  5DYM A;  2K4J A;  1XSV A;  2K9Q A;  4AVP A;  4XM3 A;  1Y8Q B;  1D5Y A;  4M6V A;  1LE8 B;  3FF5 A;  5LHH A;  2XGD A;  2COM A;  1BJZ A;  1Z0X A;  2W25 A;  3K10 A;  2IGO A;  2OQR A;  5D5W B;  1U9O A;  4YII A;  2VOO A;  2XRL A;  5LGU A;  2EZL A;  4U7B A;  3S1M J;  1SAU A;  3CUQ A;  5DUK A;  4G9Y A;  1W7P D;  3OYG A;  4HYE A;  3BP8 A;  3ZPL A;  1L0O C;  2EB7 A;  5D4S A;  3ZP5 A;  4NQW A;  2GOX B;  5FRM A;  4UB6 C;  5B1B H;  2DQR A;  1WI3 A;  2KT0 A;  4W1U A;  3MKL A;  3GFM A;  2DOD A;  3EYI A;  3HPG A;  1IN7 A;  3GFL A;  1XMA A;  1HF0 A;  1RET A;  4BS9 A;  1I6H J;  3S3N A;  1EV7 A;  4BH9 A;  2L54 A;  2BHZ A;  1YTY A;  1U5T C;  2VQG A;  4FET A;  3E5U A;  4A0X A;  3HKZ N;  4WXD A;  1WJE A;  3OYJ A;  1JKO C;  3HL2 A;  3SXY A;  2EJR A;  1R4N B;  1P4W A;  2BY0 A;  3DTI A;  3JTH A;  1VQ4 I;  4KFC A;  1XGM A;  3IRQ A;  3OYI A;  2XSD C;  4A69 C;  2ISZ A;  1N77 A;  3W6K B;  5K7F A;  1AKH A;  1XSD A;  2P6T A;  4NC8 A;  2OC6 A;  1FEX A;  5F0C A;  3SEQ A;  3R4K A;  2RAE A;  1X3W B;  1R1T A;  4AYB N;  2PFB A;  3PJR A;  2CYY A;  2QVO A;  4L18 B;  1STZ A;  3JTG A;  1LFB A;  4KIS A;  4XKV A;  4CYC A;  2QQ8 A;  2LTP A;  3WHC A;  1IJW C;  2I10 A;  2M45 A;  1I1G A;  3T8R A;  3WGI A;  4JBA A;  3K2Z A;  3CP2 A;  4KJZ A;  1OCC H;  2RV8 A;  3E0J B;  3LMM A;  1YS6 A;  3HPH A;  3RPQ A;  3Q9V A;  3NAR A;  5IP7 J;  3MKZ A;  3OMY A;  4LIT A;  3J7Z I;  2QZ8 A;  3FMQ A;  5EG0 B;  2MLG A;  5FLM J;  1IUF A;  3PUF A;  4HDV A;  5IOY A;  2Z9O A;  1Y56 A;  5DUI A;  1MDM B;  3HB9 A;  1TC3 C;  2HGC A;  5FLX Z;  1NK2 P;  3H36 A;  2HNH A;  2LVS A;  3ESW B;  3HXL A;  3IWZ A;  3OIQ A;  4HA8 A;  3T0Y A;  3S3M A;  4HX8 A;  2XSJ C;  2M3A A;  1KQ9 A;  2QSF X;  4N4O B;  2HPM A;  2YUS A;  4KNY A;  1KZH A;  1OCZ H;  1ZRE A;  2PEX A;  1V5G A;  2PN6 A;  4P96 A;  3PFI A;  1T98 A;  4FX0 A;  4IL6 C;  2M0M A;  4DZP A;  1SFK A;  2CQQ A;  3KPH A;  3DBR B;  4I0A A;  3ABL H;  3I55 I;  2XAQ A;  4U0V A;  4WF2 A;  1IXC A;  3IV5 A;  1V5F A;  3HIF A;  3PSF A;  1X3U A;  4IRG A;  4EAT A;  1XGO A;  2F4M B;  1UCR A;  4JQF A;  1T39 A;  2GBY A;  2IW5 A;  2JA2 A;  4JK1 X;  1R1U A;  1WJA A;  3I59 A;  3K4K A;  1KQ0 A;  2E71 A;  4Q5S F;  2LFB A;  3KZY A;  3WGG A;  5CKT A;  1S8N A;  2GA1 A;  1MW7 A;  2P7C B;  3CMY A;  2E19 A;  2ESH A;  1IF1 A;  2JJ7 A;  4RBO A;  3FXU A;  4XOT A;  1QO0 D;  2D45 A;  4ETS A;  2A5W A;  5E1X A;  4MGR A;  1PYV A;  3ERM A;  5D6F A;  3QPH A;  5FD5 A;  5J1R A;  4GXO A;  2JTV A;  3JR9 A;  1J7K A;  3TOA A;  2Z2S B;  4A3K J;  1TTY A;  2CJJ A;  1BR4 A;  4YEJ A;  2G0E A;  3DU5 A;  1OKR A;  2L9N A;  4DYC A;  5EJC A;  4I2O A;  1ZHF A;  4ESF A;  3F0C A;  5LEK A;  3L2W A;  1W0U A;  1I50 J;  4PZJ A;  3F23 A;  1ON1 A;  1P92 A;  1Y1V J;  4NNJ A;  4AVZ A;  1ZTR A;  4XLA A;  5EDN A;  3S2D J;  4D5C A;  5D4R A;  2W82 A;  3RIR A;  2ZME A;  3CMM A;  4XR6 A;  4LGW A;  2GXG A;  3HOW J;  1QZZ A;  3DFG A;  2R7O A;  4Q48 A;  3MAJ A;  2UWM A;  1MMA A;  3HSR A;  2FOK A;  2VPL A;  3GCM A;  5FJ8 J;  1WJB A;  3CC7 I;  2R7Q A;  1KYW A;  4N9H A;  4ZDP A;  5J8F A;  1ZH5 A;  3SZT A;  4BBS J;  4RGX A;  1ULY A;  2XAF A;  4U7D A;  3FXQ A;  2CW0 F;  3F6O A;  3O8H A;  4B4C A;  4HNT A;  1RI7 A;  1Y0U A;  3FZV A;  4L0Z B;  2B63 J;  1SMY F;  2BBY A;  3DP7 A;  1E3P A;  3HSE A;  3DLL F;  1YIO A;  4XN3 A;  2LG4 A;  1ENH A;  3H0G J;  4Z6Y A;  5LHG A;  5EZG A;  3JCU C;  4XKB A;  3KP6 A;  5HNH A;  1YE9 A;  1U0J A;  2PX9 A;  1WI9 A;  4QPQ A;  4IOC F;  3F3X A;  4LK1 F;  4TV7 A;  3FKI J;  2ZSI B;  2A3S A;  3RKQ A;  1HXD A;  2W00 A;  4C3J J;  5K7H A;  2HTJ A;  3A0H C;  1BL0 A;  2TDX A;  3OYM A;  3CC2 I;  4EJU A;  3QOD A;  1FOX A;  1MNM C;  2CV1 A;  4Y52 J;  3QRF F;  1AKH B;  1BW6 A;  4ITV A;  2EIM H;  3U1D A;  3HTU A;  5HDG A;  3O6B B;  3I56 I;  3CZ6 A;  4Y3O A;  1YYV A;  4RLQ A;  1P9Q C;  1UB9 A;  1ZG1 A;  5EZH A;  4E4H A;  4C30 A;  2EFW A;  4CYC B;  1HW1 A;  1RNL A;  5F6F A;  2XKP A;  3LL7 A;  4D1Q A;  4QPO A;  2E7W A;  1ZYR F;  3NEU A;  4C2M J;  2MYS A;  2GM4 A;  2Y75 A;  2ZC2 A;  1YRN A;  2DBB A;  2FA5 A;  1R58 A;  3V4G A;  4AM3 A;  1TWG J;  3TL4 X;  5F0F A;  1S9H A;  1AWC A;  2K3F A;  2E2I J;  2RC4 A;  2EIL H;  1RRJ A;  5GTH C;  2Y48 A;  3ZCO A;  4F92 B;  3GTL J;  2OU2 A;  1DDN A;  4LB5 A;  1VFC A;  1JGS A;  4HSR A;  3MVP A;  4HG2 A;  5DS9 A;  1Z9C A;  3HOU J;  3DBL B;  1HCR A;  4DZJ A;  4IOA F;  3HRS A;  5FLV A;  2CQX A;  4I02 A;  1MH4 A;  2ZJ2 A;  1SD6 A;  3HG9 A;  1JI8 A;  1OYI A;  1JUM A;  1J75 A;  2D5V A;  3QPL A;  2V1X A;  2X9D A;  3TO9 A;  5M5Y J;  5CPR B;  4LIU A;  4EGZ A;  1T0F A;  3BWG A;  4LLL A;  1V4R A;  2QEN A;  1RES A;  1ZG3 A;  3G1L A;  5M3F J;  5EEH A;  3GFI A;  5IYD J;  3RQI A;  1SFE A;  2L7F P;  2V79 A;  4FQG A;  5KNL A;  2JK3 A;  2CSO A;  2GA2 A;  3T5X A;  1WPK A;  5D5V B;  2W4S A;  4GGG A;  1WSU A;  2AHQ A;  5M3M J;  3QPS A;  1V3F A;  4BHB A;  4F7Z A;  2R93 J;  1XN7 A;  3A0B C;  2HOE A;  2TRT A;  2DJI A;  3L2R A;  5CVV A;  3BT9 A;  4DQ2 A;  1R5H A;  4RM3 A;  2XRO A;  1X1B A;  5D8K B;  5JHF A;  1S7A A;  2NXN B;  4E6K G;  2CUF A;  3ZQ7 A;  4ENJ A;  3OYA A;  1F1Z A;  4AD9 A;  1MMN A;  3TO6 A;  2PMZ A;  4OIO F;  3HHH A;  3VFZ A;  3ZMU A;  2N8G A;  1APL C;  5M5X J;  3VDX A;  1BBY A;  3LSK A;  5DCF A;  1FY7 A;  1XSX A;  3QQA A;  3PO2 J;  4O3M A;  2OBP A;  5DM7 F;  3BY6 A;  2KRF A;  1X2N A;  2OCC H;  5DM6 F;  1A5J A;  2F5C A;  2LRE A;  3HRM A;  3SHF A;  4EJT A;  2JA6 J;  3J7A Y;  4IZZ A;  5C4J J;  3GBG A;  2OV7 A;  4KIG A;  4IKF A;  3QYF A;  5D8L B;  2JPC A;  2ISY A;  4DNC A;  1R9T J;  4N4N B;  5F64 A;  1G3Y A;  3ZRG A;  3F22 A;  4QTR A;  2COB A;  3ROU A;  4D7N A;  4HST A;  2L7M P;  4B1R A;  3TP0 A;  1W5S A;  3LOC A;  2ZME B;  3DKX A;  3UNG C;  2DPU A;  1Z3Y A;  2CQN A;  3N97 A;  5HLI A;  5J1Y A;  2AS5 F;  1W4M A;  1ZRF A;  2L9R A;  3KP7 A;  3EPZ A;  1VF9 A;  3KZI C;  4GRI A;  3S15 J;  1JHH A;  4HBL A;  3TKY A;  5IY5 H;  2BV6 A;  5IOZ A;  3GTM J;  2F5D A;  5LRR A;  4KT5 C;  1C0W A;  2JRT A;  2Z1D A;  3EQL F;  4MO7 A;  2P0W A;  4OIQ F;  2DDB A;  4IRI A;  5B5E C;  3BCA A;  1D0Y A;  2DA2 A;  5LHI A;  2ZJR F;  4FX4 A;  2QWW A;  4RB3 C;  2EZH A;  2OCE A;  3O2P E;  5B1A H;  3RI4 A;  1LQ1 A;  4A3B J;  3BR0 A;  1B9M A;  3S14 J;  1A6Q A;  2FD5 A;  2VUM J;  5D6E A;  5IPA A;  1IRF A;  2XF5 A;  1OCP A;  1LNW A;  2JVG A;  1I39 A;  2GWR A;  3MEX A;  1ZK8 A;  3Q0W A;  1ZLJ A;  3BZC A;  3U1K A;  2WV1 A;  1QPI A;  2M1B A;  3F8C A;  2KJC A;  3LA7 A;  4RAG A;  4B48 A;  4QSH A;  1D8K A;  4F91 B;  4ASN A;  3MCZ A;  3IHU A;  4RGU A;  4EM2 A;  4IHX A;  4A0Y A;  2VBX A;  5K1Y A;  3J80 Z;  4U0W A;  1R4M B;  4DJA A;  2HQN A;  5EEG A;  4II3 A;  4CCL A;  1MZB A;  5K5O A;  2A61 A;  2VXD A;  1KQ8 A;  4BY7 J;  3WE2 A;  1HOM A;  2P6S A;  2DLL A;  2JMW A;  2LKP A;  1R49 A;  4GYG A;  3SZG A;  2V6C A;  2K9N A;  3M7G A;  3PNT A;  3F9K A;  1IUY A;  1XB4 A;  2IT0 A;  3F8B A;  3M8F A;  4A5N A;  3SQN A;  2FQ3 A;  1HW5 A;  3QU3 A;  1LEB A;  1HBX G;  4PGG A;  3CQZ J;  4WXC A;  1BR1 A;  1DP3 A;  2EQR A;  4XQF A;  3DPU A;  4OOI A;  4ZYA A;  4M73 A;  2FBH A;  1LB2 A;  2H27 A;  5FO5 A;  4XN0 A;  4HX4 A;  3A1Y A;  3IKV A;  1U78 A;  3H3V K;  2HR3 A;  2WAD A;  2OA4 A;  4KN4 X;  3S16 J;  4FAS D;  4M74 A;  4WK8 F;  1DUX C;  2JA5 J;  3G4S I;  3VYR B;  1VTN C;  3OIO A;  2LY1 A;  4IPA A;  1H8A C;  4HX7 A;  4M6X A;  1I5Z A;  1R22 A;  2L02 A;  3DF8 A;  1VQL I;  2QQB A;  5E18 F;  3IL2 A;  1SFO J;  4GDF A;  5ILS A;  4AID A;  1B72 A;  1SVO A;  3MKY B;  2KZG A;  2K85 A;  1U5T A;  3S3O A;  1XDS A;  4E7I A;  1JHF A;  2E2J J;  2E7X A;  5DD8 A;  2R7Z J;  2DOF A;  3C7J A;  2KP6 A;  1K78 A;  1XC5 A;  3SFI A;  1T08 B;  1Z77 A;  3JSO A;  5K5Q A;  3E6M A;  4IJA A;  1I27 A;  2AQF A;  4BKX A;  3VOE A;  4ZDL A;  1N75 A;  4E7L A;  5IP6 A;  2MBF A;  5HVQ C;  1Z7L A;  3KEQ A;  2VBY A;  5DCM A;  4A3M J;  3REO A;  5A2Q K;  2V1N A;  1UHW A;  4XSX F;  3HC7 A;  3FXR A;  1EH8 A;  3S1R J;  4W97 A;  1H0M A;  4EM1 A;  4F55 A;  3B02 A;  1YW8 A;  4F52 A;  1FLI A;  5GPA A;  3CF2 A;  3MFK A;  4I76 A;  1LEA A;  1IAW A;  3K2A A;  3HRT A;  2DN0 A;  2ZFW A;  2YSR A;  2CUE A;  3ZOB A;  2IEK A;  4DOZ A;  1SD5 A;  1QRY A;  4U88 A;  1QU3 A;  1P7I A;  4GFB A;  1ETW A;  2BEO A;  2EFO A;  1ZAO A;  2G9W A;  4RS8 A;  3V8L A;  5ICG A;  1CF7 B;  1U8B A;  4BDY A;  1SVM A;  2KMU A;  2CO5 A;  3L9F A;  1QHG A;  2NAZ A;  3G6E I;  3TGN A;  1S7E A;  3PSI A;  2Z3Y A;  4MIM A;  2QBY B;  2A6H F;  2DMU A;  4IHV A;  2A68 F;  1JXS A;  4XRF A;  3WOD F;  2NRA C;  2DOA A;  1Z3X A;  2P81 A;  3AFH A;  3A4C A;  4YFX F;  4XKC A;  2YPR A;  2X6X A;  3H35 A;  2DT6 A;  3B73 A;  3GLX A;  1LJ9 A;  3HKZ A;  4L9T A;  3DQV C;  4C2U A;  4U87 A;  2R7V A;  4UNO A;  2MA3 A;  3KFW X;  2VJ5 A;  3CJT B;  1WJD A;  1PDN C;  1Y39 A;  2WC2 A;  4ZZL A;  3CCS I;  2FNA A;  1O3Q A;  3KYD B;  1GXQ A;  3S1N J;  2WAQ N;  2NYX A;  1PP8 F;  3RZO J;  3RYR A;  3OYL A;  1QBJ A;  3ECO A;  4PJM A;  4A0Z A;  2IA1 A;  1IRX A;  4HPQ A;  4A6E A;  2EV5 A;  4IHS A;  2JPB A;  1VZ0 A;  2A6T A;  3KP3 A;  2XKO A;  2K9L A;  3WHB A;  1T95 A;  4CCM A;  1UZC A;  2VOP A;  2XPV A;  1FX7 A;  2H1L A;  2KKO A;  4FE4 A;  2LR8 A;  4PJL A;  4AYB A;  4YFN F;  5HLH A;  3NWT A;  4G7Z F;  1JE8 A;  2BOL A;  4Y33 A;  1HST A;  3HOT A;  1VQ8 I;  1VQK I;  2JSP A;  2XF7 A;  1G8X A;  1YHQ I;  2D1H A;  2ACJ A;  3CC4 I;  2DDA A;  3LWF A;  3LSH A;  5IP9 J;  2WAF A;  3PO3 J;  3RJP A;  1A31 A;  1Z6T A;  1YOV B;  3ZQG A;  2KDZ A;  2VOD A;  3B6A A;  5JLW A;  4IQJ A;  4FTH A;  1IV6 A;  3E6D A;  2WB1 N;  1WFX A;  3C2H A;  2WBM A;  3CCV I;  5EF6 A;  1Z05 A;  3K1P A;  3W6V A;  2E5N A;  3U9G A;  4UXN A;  1X1D A;  2G7H A;  3BG9 A;  5CVR A;  2NVY J;  1Z1D A;  3OWT A;  2R5Y A;  5CQE A;  5ERI A;  2DMP A;  2ELK A;  2OQG A;  5HNF A;  2QF7 A;  1MSF C;  5HLG A;  3E5Q A;  2QSG X;  4E7S A;  4X1E A;  4PSX A;  2L3D A;  1CGP A;  4MEX F;  4ZYH A;  3KP4 A;  1XCV A;  2ID6 A;  2K9S A;  1GXP A;  5H6R A;  2JSC A;  3CME I;  3KLO A;  4NHJ A;  2X1E A;  3CJQ B;  3GZN B;  3LAP A;  4MTD A;  2YX4 A;  5E20 A;  2HZD A;  2ZFU A;  5BS6 A;  1VQ9 I;  3SJM A;  2DO7 A;  2BW3 B;  3OR1 C;  2XB0 X;  4CGZ A;  2K5C A;  1R36 A;  2ZXJ A;  2VT3 A;  1IV8 A;  1WJ5 A;  2Q1Z B;  3T1B A;  3DCF A;  4BEH B;  1KU7 A;  1WRJ A;  2OZ6 A;  3BTL A;  2X6W A;  3OOP A;  3W2V A;  5E3N A;  2CRG A;  3JAM Z;  4D5F A;  1TWH J;  2XAU A;  2PQ8 A;  4EQQ A;  5B3S H;  1MMG A;  4S04 A;  1OQY A;  1WVR A;  2QYO A;  4MQV A;  2VJJ A;  3L7W A;  3QAH A;  2EIN H;  1KYZ A;  1YX5 A;  2FE3 A;  4JOM A;  3TW6 A;  5F0H A;  3WTW C;  2VQC A;  3M4O J;  1B6A A;  1TLH B;  3CDH A;  4PCQ A;  4ZH4 F;  2JA7 J;  3KZZ A;  1S6L A;  2LKX A;  3OV8 A;  4X6A J;  4XLH A;  1TQI A;  3ECH A;  3MZ8 A;  1KU3 A;  3FWE A;  4LFU A;  4IHY A;  1DU0 A;  1B72 B;  2BVL A;  4XLN F;  2R4G A;  4V19 K;  4BE2 A;  1WZ2 A;  4OU0 A;  1U5T B;  3CDL A;  4LIV A;  5KK1 A;  2VQH A;  1YIJ I;  2OPT A;  2MW8 A;  2F5E A;  4HDU A;  1XS9 A;  4G6Q A;  3S17 J;  1MNE A;  3M3Y J;  2YU3 A;  4IVN A;  1LVK A;  5L3F A;  1PUF A;  3MKW B;  2IAI A;  3BR3 A;  5GAE J;  1SFU A;  3FBI B;  3FK7 A;  2DMN A;  3JRG A;  4XL9 A;  5BPI A;  2ME6 A;  4IXA A;  3GVA A;  1H89 C;  4JYK A;  3FX3 A;  4M3G A;  1F9N A;  2D2W A;  2ZJP F;  1OCT C;  2C6Y A;  1OJL A;  5LBQ A;  2MGQ A;  1MBH A;  5KVR A;  5DEQ A;  4EV0 A;  3EUA A;  4HF0 A;  4BXX J;  4XLC A;  1BN5 A;  2CQ7 A;  1ORK A;  1TQP A;  4PUS A;  4YIR X;  1RR7 A;  1VQ7 I;  2NS8 A;  4EM0 B;  4Y15 A;  2UXX A;  3K0L A;  4HEA 2;  3IH3 A;  1IRZ A;  2OZU A;  1OFC X;  4RMN A;  5ILV A;  1SD7 A;  2VLA A;  4AIK A;  4BBR J;  5L3D A;  1TZL A;  1FIA A;  1FWZ A;  3J81 Z;  4NBQ A;  4HLX A;  2HS5 A;  2R7D A;  2NOG A;  3BG3 A;  3ELK A;  3COA C;  2G7U A;  3BR2 A;  3PM1 A;  1GLN A;  4CH7 A;  1OR7 C;  2R5Z A;  1ETX A;  1M1E B;  4A3L J;  3P9C A;  5IYB J;  2R7T A;  2GQQ A;  2X4H A;  2VE8 A;  3DEW A;  1TWA J;  5LLQ A;  5JI6 A;  4HV6 A;  4M9S A;  4A3F J;  1ON2 A;  3IP4 B;  1MBF A;  4HRI A;  4HOB A;  1P7J A;  4N9I A;  2I8D A;  5C4X J;  2XGE A;  3W6J B;  1AOY A;  4OAZ A;  1UHM A;  4FT8 A;  1UG2 A;  4KT6 A;  3L2C A;  4XBF A;  1N25 A;  3L2Q A;  1OMI A;  2Y0M A;  3ZQC A;  2HOS A;  4OMZ A;  2QSH X;  3K6G A;  2L9S A;  2PJP A;  2CV2 A;  4EJW A;  5CJ9 A;  1X58 A;  2DTZ A;  3LA3 A;  3J7Y J;  2HDD A;  2O61 A;  3GYH X;  5J8C A;  1FBS A;  2EWN A;  4GYI A;  1TWF J;  4CO8 A;  2XPU A;  3QU6 A;  3ZQQ A;  2IS2 A;  2DW4 A;  3K9T A;  4B47 A;  2E2H J;  1QA6 A;  2NVQ J;  2R7F A;  1FZP B;  4MHG A;  2B9S A;  3KIO A;  4XIC A;  3IH4 A;  1R23 A;  3JRE A;  1P6R A;  4H0E A;  2HPI A;  4NC7 A;  2P5L C;  2DA1 A;  3A03 A;  4HZF A;  1EKE A;  5J4Y A;  5J4V A;  2XRN A;  3L1P A;  4A5M A;  2PBI A;  2YX7 A;  2R7U A;  2M5W A;  4L9J A;  4M71 A;  3ZXS A;  4B8X A;  3R0J A;  4MEY F;  3HGY A;  4Y13 A;  3D5S C;  2Q0O A;  3M8J A;  3JRD A;  2IVM A;  4LLN A;  4O6J A;  4AIH A;  1XX5 A;  2PJR A;  4BU2 A;  5C3E J;  2RRE A;  2ZCW A;  1E3H A;  2W57 A;  1IN8 A;  1BOA A;  2GXB A;  2O5R A;  3DPL C;  3MN2 A;  1MBG A;  4F93 B;  1U3E M;  1JTY A;  4G6T B;  1F36 A;  3TDZ C;  2W48 A;  1AHD P;  2DOE A;  1S5L C;  1MND A;  3BR1 A;  2RVC A;  4A6D A;  1TWC J;  5HS9 A;  4EJV A;  4OIN F;  1Y1W J;  1QVU A;  2QUF A;  5ILU A;  2KHM A;  9ANT A;  1FBQ A;  3K70 D;  3KLN A;  2HKX A;  3ZN0 A;  4RAF A;  4PJ0 C;  2M9H A;  3K4N A;  3CUQ B;  2GAU A;  5FFZ A;  1L3L A;  1LDJ A;  3RTR A;  3L2U A;  2IBD A;  3EYY A;  4UUT A;  4NQW B;  1S3J A;  2DA6 A;  3LSR A;  5KCM A;  3LSG A;  2FQ4 A;  1KU9 A;  4HV5 A;  1XCB A;  4OAY A;  2JN6 A;  2XB5 A;  3RQ4 A;  4B09 A;  1PVE A;  1S29 A;  2XIG A;  3V8J A;  4RGR A;  5KHD A;  4QWQ A;  4KIC A;  4G7O F;  3QP6 A;  3DU6 A;  1JT6 A;  2ZNZ A;  1WWX A;  1SMT A;  3Q5F A;  2ELH A;  3BTI A;  2NVT J;  2Z5U A;  3K1M A;  3FMR A;  2HDC A;  2P4W A;  3BQY A;  3K4J A;  2NVU B;  1SEU A;  1IRG A;  4MQ9 F;  4MNU A;  2VJ4 A;  1FOW A;  3VEP A;  1FTT A;  3LAJ A;  4RGS A;  1O4X A;  4L0Y B;  1Q1H A;  2FMY A;  2M0C A;  2E1N A;  4WWC A;  3PQK A;  4XKW A;  2FSW A;  1XDU A;  4J00 A;  4PDK A;  1U8R A;  3U21 A;  2JZY A;  2QKL B;  1MMD A;  1BA5 A;  5FKO A;  1IN6 A;  4BQO A;  3F8F A;  3Q0V A;  2M7A A;  3AG3 H;  3FM5 A;  4G12 A;  4BAC A;  4LD5 A;  1TW3 A;  3BPX A;  4CZC A;  1TNT A;  2HXO A;  3NRV A;  1FBU A;  2QQ9 A;  3HSF A;  2VKE A;  4GO1 A;  2ZXW H;  5AON A;  2V9K A;  2HOT A;  2AXL A;  2GZW A;  4MLO A;  3GTJ J;  1D1B A;  2Y0S N;  4IF4 A;  5FB2 A;  1IDZ A;  3CD6 I;  2QKM B;  1GV2 A;  5KAF C;  2FEZ A;  4LG3 A;  4C9Y A;  3J7A O;  1ZKG A;  3VYS B;  1WQ2 A;  3KE2 A;  5F27 A;  4KDP A;  2JA8 J;  2WY8 Q;  4IO9 F;  2V7F A;  5DTD A;  3RCO A;  2ZB9 A;  5J6X A;  2AXT C;  2KZV A;  5K7Z A;  3I4N J;  2DI3 A;  4M3B A;  1PUE E;  2R5Z B;  3I64 A;  2HQ5 A;  3IAS 2;  4QIW N;  1SAX A;  3KCC A;  4ENM A;  2E36 A;  4LMY A;  2CG4 A;  4CZZ A;  4NDL A;  1YG2 A;  5E79 C;  3BQZ A;  1ETO A;  3P5J A;  2V4J C;  2VKD A;  4C3I J;  3CMA I;  3HOY J;  5FKM A;  5JLX A;  4AWX B;  4CCJ A;  5J47 A;  3D1N I;  2DCE A;  3OYB A;  2XF6 A;  2Z33 A;  5HOD A;  3S1Q J;  1KGS A;  1B59 A;  2FML A;  3CLO A;  3GFJ A;  2O7O A;  3HBL A;  2DFF A;  1T2K A;  2H8R A;  2ME0 A;  1ZN2 A;  4IHW A;  5E1Z B;  3I59 B;  3GO5 A;  2OJE D;  3HEF A;  1FC3 A;  2O03 A;  3OL4 A;  3K7A J;  3HTS B;  5FKL A;  5K5R A;  4MTE A;  1ITY A;  2KQR A;  3GUD A;  1IN5 A;  2KLO A;  4EGY A;  2PLY A;  3ABU A;  4UUV A;  2NOJ B;  1K6Y A;  2JQ7 A;  1VQO I;  3N05 A;  3LFU A;  4CSW A;  3OYD A;  3ABK H;  3I58 A;  4ZTJ A;  3JRI A;  3V8K A;  1G59 A;  1YS7 A;  2V9P A;  5L3G A;  3JRC A;  1XGN A;  2ELJ A;  3HM5 A;  5BPD A;  2MSY A;  4Y7N J;  1K7A A;  1J0R A;  1USS A;  3C3W A;  2A6E F;  2X1C A;  3R6S A;  3VOD A;  4BQQ A;  1XGS A;  4MFE A;  1X19 A;  2MLK A;  2RQQ A;  5LEJ A;  1S72 I;  3HUG A;  4PFP A;  4KA4 A;  3BR6 A;  3L09 A;  2Y69 H;  3DPT A;  5FRO A;  4BE1 A;  3QP5 A;  3VB2 A;  1ODD A;  2YS9 A;  3FHN A;  4LG0 A;  4BGD A;  2CMP A;  3RYP A;  5TRD A;  4KIT B;  1ZLK A;  4P5O A;  2K02 A;  3U2R A;  5DDG A;  2KIM A;  2CW7 A;  5FKN A;  4DYR A;  3E1S A;  2E60 A;  5FLX K;  4CUG A;  4BQA A;  2JT1 A;  2P5K A;  2M30 A;  4NUB A;  3H5N A;  3FMS A;  3WTV C;  1W7P A;  3CJR B;  2K86 A;  4UVC A;  3V42 A;  2CU7 A;  4XLE A;  1T33 A;  4UV8 A;  5AIP A;  4BXF A;  3H5R A;  3CO7 C;  2DA7 A;  4YG2 F;  2LLK A;  4G94 A;  3LST A;  3GF2 A;  5CVU A;  1A36 A;  3WU0 A;  3NWS A;  3HOV J;  1EA3 A;  1K4S A;  4U0Y A;  1ZGW A;  3MZY A;  2O8K A;  4BDZ A;  1B8I A;  3A2K A;  3P7N A;  2LF7 A;  5F1R A;  2KRC A;  2LD5 A;  1K79 A;  3P9I A;  4L5E A;  2EV0 A;  1Y0N A;  4D9J A;  2KDO A;  1PJR A;  1KON A;  2BGC A;  5KAI C;  1G3W A;  2ADU A;  5BMZ A;  1IW7 F;  2LK2 A;  2O9L A;  2K27 A;  1NG6 A;  3BTJ A;  5GAH J;  3IWF A;  3L2V A;  3HRU A;  2HKO A;  1T56 A;  3N4M A;  1LFP A;  2F5F A;  1NH3 A;  3S93 A;  1ETY A;  2ZNY A;  1X1A A;  4A12 A;  2VBW A;  5EGO A;  3GZ6 A;  1EF4 A;  4H4K C;  1BW5 A;  4Q4Z F;  1F43 A;  1LE8 A;  2LC2 A;  4HW0 A;  3AG2 H;  2BYV E;  2LY2 A;  4AIJ A;  1B1B A;  3V7C A;  1MBK A;  4EVI A;  1YRN B;  4MFD A;  1FOK A;  2L7Z A;  3E6B A;  4R79 A;  1VQN I;  3EUH C;  4XON A;  3TDU C;  3TP3 A;  3ERE D;  1FYK A;  1F5T A;  4IQ4 A;  2FOW A;  3E7L A;  3BZK A;  1A35 A;  2JWT A;  3PNV A;  2NNN A;  1POG A;  3K1N A;  3W3C A;  3I4P A;  4FCY A;  4NB5 A;  2VPR A;  1VI0 A;  1AA7 A;  4XNF A;  1JKQ C;  1MKM A;  5E1W A;  1BJA A;  1V54 H;  3MMY B;  3KEO A;  2L01 A;  3H1C A;  3TED A;  2WAQ A;  2QM3 A;  4HNU A;  3ZQF A;  4C2T A;  3DKY A;  3BTC A;  5ICE A;  1JJ8 C;  4CYD A;  2B7E A;  2XVC A;  3PUB A;  1WJC A;  3AL0 C;  1FYM A;  3C2G A;  4XMY A;  2EV6 A;  2A5Y B;  5JR3 A;  3F72 A;  1O3T A;  2STT A;  4IX7 A;  1TT0 A;  4BQN A;  2QLZ A;  3LSM A;  4LK0 F;  2XGX A;  1W5T A;  4Z2Y A;  1XMX A;  4CCN A;  4D0P A;  3Q3S A;  4HF2 A;  1R5G A;  1BOB A;  2P5V A;  5IT9 K;  5L3C A;  2WB1 A;  3NQO A;  4GCV A;  1ONV A;  2NVX J;  3SEZ A;  5BOX A;  1MBJ A;  4ZYG A;  3LNQ A;  2LH9 A;  3GXO A;  4P1W A;  1DGW Y;  2XAJ A;  1OPC A;  5FD6 A;  2ETH A;  2IGN A;  5EG0 A;  1ZG5 A;  3SDB A;  3WTX C;  2V6E A;  2AO9 A;  2OAZ A;  1KU2 A;  3OS2 A;  1UJ8 A;  2EPF A;  3AG1 H;  2M87 A;  1OCO H;  2ICW G;  5E17 F;  3TBI A;  4UY8 I;  1E17 A;  2EIJ H;  2VC1 A;  1WH5 A;  3GEZ A;  4C3H J;  1QPM A;  4JP0 A;  3FXO A;  2ID3 A;  2VKV A;  1IG7 A;  1OR7 A;  5F08 A;  4RB1 A;  1R7J A;  1I3A A;  3FXL A;  1SD4 A;  2V26 A;  1EH7 A;  4CDG A;  1RR8 C;  2HWV A;  4E7H A;  2E1M C;  2EZK A;  1HW2 A;  3ZQH A;  4A3E J;  4BAY A;  3PNY A;  1H88 C;  1BI1 A;  1RUN A;  1GUU A;  5D5U B;  1LUJ B;  3AAF A;  3BJO A;  4B3A A;  3H5A A;  3MWM A;  3LFK A;  4ZDO A;  1GVJ A;  3I3L A;  1NHA A;  1W7P B;  5CQG A;  3CCE I;  5CLS A;  3PL8 A;  2R7X A;  1FMV A;  1FP2 A;  3V7S A;  2DYS H;  3JW4 A;  3F8N A;  4IRH A;  1G3T A;  5DV5 A;  5E3O A;  4BHP A;  1ETV A;  2W1O A;  5TIS C;  1H9G A;  3R61 A;  4ZC3 A;  4E70 A;  4EEF G;  4L9V A;  2ZJQ F;  1BC7 C;  1D5V A;  2A07 F;  4RB0 A;  5LGT A;  3OOU A;  2FNP A;  4ANJ A;  3IKT A;  4HLY A;  2WAE A;  1D3Y A;  3LQQ A;  5J3L A;  3R60 A;  5HDK A;  1W36 D;  4V2F A;  4M3E A;  5JVT A;  1LKX A;  2LRD A;  4A3I J;  2MG4 A;  2CUJ A;  2EFP A;  2W7N A;  3VPR A;  3FXJ A;  4CHU A;  4BYY A;  5HOO A;  2DFE A;  4PJN A;  2WA0 A;  5B66 C;  2HU9 A;  1TW2 A;  2KIU A;  3BJA A;  1OLT A;  4XOP A;  2Y30 A;  1S7O A;  3H0D A;  3F8M A;  5EGO B;  5JVG F;  3WTZ A;  4OIP F;  4I99 C;  3I53 A;  1OCR H;  3LA2 A;  4YFK F;  1ACI A;  1F4K A;  4KIF A;  2L5Q A;  2EA4 A;  2KRH A;  3ABT A;  3A01 A;  4DGW B;  4QLC U;  3OYE A;  4A3G J;  1FYL A;  3D5L A;  2UV1 A;  3OR2 C;  2LBF A;  2K40 A;  1IO2 A;  5H20 A;  3ONQ A;  3WG9 A;  2DT5 A;  5FGM A;  3QOE A;  2K3P A;  3WTT C;  2BY3 A;  3M8E A;  5EYR A;  2BE5 F;  4CIC A;  5ICC A;  4XOR A;  1MBE A;  2BHY A;  1SFX A;  2A69 F;  3GLL A;  3WGH A;  2RQP A;  5J1U A;  1X1C A;  1U9N A;  3CO6 C;  3BPV A;  2X85 A;  1KA8 A;  1WHU A;  1V5E A;  3JRA A;  3CES A;  4ESB A;  2VBZ A;  4WX9 A;  2KPM A;  2KIQ A;  2XAG A;  2WV0 A;  3EDP A;  3OIP A;  2DPD A;  1LDK B;  5CVI A;  2QCO A;  2XUB A;  3SZP A;  1HKQ A;  2A05 A;  3HJE A;  3I9V 2;  2VIX A;  4K2E A;  1K78 B;  2IGK A;  4M72 A;  1BI3 A;  3DEU A;  1R71 A;  4P55 A;  2XHK A;  2H8W A;  4XLP F;  3RPU D;  2QA4 I;  1ZEL A;  4RAZ A;  2Y9Y A;  4BNC A;  3BG5 A;  1N78 A;  3K4M A;  4BJ6 C;  2R92 J;  4CCO A;  2IS1 A;  1DPU A;  4HNV A;  1QZE A;  4LB6 B;  1FNN A;  5DCM B;  3W2A A;  3P9K A;  2CUZ A;  5HS8 A;  3AG4 H;  2MD0 A;  1H9T A;  1DGR M;  1Q1V A;  4D7M A;  1SC7 A;  4JX6 A;  3T8T A;  1Z91 A;  3RKW A;  3J80 K;  2J5P A;  5F1J A;  2M4G A;  3M9A A;  4R1H A;  2HVQ A;  1GDT A;  3RDI A;  1XG1 A;  5L3E A;  4I7H A;  3CCJ I;  3C1D A;  1U2W A;  4ABZ A;  4JX5 A;  2IRF G;  4CA0 A;  3OY9 A;  2FJ1 A;  3PIP F;  3H3Z A;  1MGT A;  3PFY A;  3UR3 C;  4XRS A;  4AU7 A;  4KMU X;  1HSJ A;  5CYV A;  2CQK A;  4UV9 A;  1T8I A;  2VQL A;  2LMD A;  4I0B A;  2HVS A;  4DBQ A;  1EJ9 A;  1UMQ A;  2MAB A;  1B9N A;  2H6B A;  3I54 A;  1RC9 A;  3OS1 A;  3HGG A;  3K70 C;  1MD0 A;  2RKH A;  2JRM A;  3Q9S A;  1IXR C;  2L9V A;  2Q2E A;  3DBH B;  1G2H A;  3R0A A;  1FSE A;  1PP7 U;  2IGM A;  2LSO A;  4E7Z A;  1ZRC A;  3FK6 A;  2PMU A;  1WH7 A;  1D1C A;  1MMS A;  4LLG F;  1X4P A;  3LSP A;  1YFH A;  1TT5 B;  3QOP A;  2FU4 A;  1HC8 A;  2PG4 A;  4Y17 A;  1FPQ A;  2HOA A;  5JFR A;  3HZJ A;  3MQ0 A;  4CXF A;  4XID A;  1FTZ A;  2VXZ A;  2V9V A;  4ZYE A;  2F6C A;  2JVH A;  3GZ5 A;  1FMW A;  3BJ6 A;  1TBX A;  3RSN A;  1G6N A;  3BZ6 A;  5HDN A;  2M4K A;  3TMO A;  4AC0 A;  3CCQ I;  4ZZD A;  4KUM A;  3UKG A;  2HEO A;  4I01 A;  4A2U A;  2OD5 A;  2GIZ A;  1YO5 C;  2MFZ A;  2VC0 A;  2DYR H;  3KX2 A;  3HDD A;  1R5I D;  3G3Z A;  1XPX A;  5FRN A;  4WCG A;  2F4I A;  2IXS A;  3GTP J;  1D1A A;  3OYH A;  4IEJ A;  3JSP A;  3F6V A;  1Y8R B;  4A3J J;  2BY2 A;  1QHH D;  3WU2 C;  3KP5 A;  4JX4 A;  4R8H A;  2H94 A;  1T6S A;  5EEA A;  3WTY C;  2Y0S A;  3TW7 A;  3K4C A;  3TOB A;  3HOZ J;  2PMH A;  3I0T A;  3M1C A;  2DMQ A;  2R5Y B;  1YX3 A;  3KYC B;  3BG6 A;  4PGH A;  3FHZ A;  1MSE C;  4I98 B; 
#chains in the Genus database with same CATH homology
 2MD5 A;  1ZGJ A;  3SFZ A;  2UXN A;  3CUQ C;  4P9U A;  5E8G A;  5CVJ A;  4UHT A;  4KN7 X;  4L9N A;  4O5V A;  1O7L A;  3I71 A;  1XMK A;  2HQR A;  1IZ1 A;  4G7H F;  5FFX A;  2EFQ A;  1T38 A;  1YW9 A;  3MZH A;  1A04 A;  5JHU A;  2HYG D;  3GWZ A;  5ICF A;  5DD4 A;  3E5X A;  3O3K A;  3ZMV A;  5ED4 A;  2K4B A;  2KJB A;  1MJ9 A;  1Z7U A;  2MH2 A;  4I09 A;  2STW A;  2IA2 A;  5A2Q Z;  2VE9 A;  2EFN A;  1B4A A;  2YR2 A;  5LGN A;  5IT9 Z;  2RNJ A;  3F21 A;  4G8X A;  3WE3 A;  2XAS A;  2V1D A;  4OIR F;  2MH9 A;  2DQL A;  4N0B A;  1MJA A;  3PQJ A;  3S2W A;  3E3V A;  2H6C A;  3ZMZ A;  1P4X A;  2IPQ X;  4EMS A;  2R3S A;  3ML6 A;  3EUH A;  3IC7 A;  5L3B A;  1HKT A;  1YLF A;  1QGP A;  1YQA A;  2FXA A;  1UFM A;  6PAX A;  2NNY A;  3JAM K;  1D8J A;  2EK5 A;  2CFX A;  5HS7 A;  3BDD A;  2L4A A;  3HOS A;  3TO7 A;  2Q8K A;  2HZT A;  3KP2 A;  3L00 A;  2CGP A;  2O8X A;  1MJB A;  2RN7 A;  1O3R A;  1GHC A;  2X0L A;  3QPT A;  2FRH A;  4BHC A;  2WTE A;  2IJL A;  2MC3 A;  1BIA A;  2M8E A;  1J9I A;  3V7R A;  4S05 A;  2WWY A;  1O7F A;  4UVA A;  1G4D A;  4EJO A;  1DPR A;  4M6Y A;  3CTA A;  1CF7 A;  2J5O A;  1LVA A;  3G73 A;  3J81 K;  3DXJ F;  4RAY A;  3RKX A;  2QBY A;  3IRR A;  2ZBK A;  2K7L A;  1QNT A;  1EH6 A;  1P2F A;  4OMY A;  1IN4 A;  3BOQ A;  2RDP A;  1FT9 A;  3ZMS A;  5TJJ A;  2O6G E;  3E6C C;  2FBI A;  1E2X A;  3ZMT A;  1J5Y A;  3ULQ B;  1YW7 A;  2LF8 A;  2DU9 A;  5AIQ A;  2F2E A;  1G3S A;  1K6O A;  2W24 A;  2W85 A;  4KIB A;  5H6Q A;  4HQM A;  4G6D A;  2QQA A;  1TNS A;  1LDD A;  2EA2 A;  4FHT A;  1BM9 A;  1FP1 D;  4ZYD A;  1QZY A;  2HTS A;  4XSZ F;  1HQC A;  3GW2 A;  3H3U A;  4HAM A;  1XD7 A;  3WTS C;  2GIV A;  3RPU A;  3BRO A;  1P4A A;  2ZKZ A;  1RUO A;  2XAH A;  4WXH A;  2B0L A;  4L5J A;  3HYI A;  2O3F A;  3GX4 X;  1O3S A;  1I6X A;  5D5X B;  1OYY A;  4L5I A;  4M9Z A;  1J2X A;  4KYW A;  4LJZ F;  3ISP A;  4RB2 C;  3E97 A;  2P8T A;  3RKY A;  4ON0 A;  4HQE A;  2CWE A;  2DK5 A;  5LRS A;  2IA0 A;  2RGV A;  2VON A;  2LDU A;  4YIF A;  4UVB A;  3ZMD A;  4KMF A;  1R1V A;  2E1C A;  2UZK A;  5IT3 A;  3CUO A;  1BIB A;  4M9X A;  2HYF A;  1FSH A;  1ZRD A;  2V1U A;  2NS0 A;  3M1E A;  2PI0 A;  1I1S A;  1RIO H;  1TQM A;  4P9F A;  1BC8 C;  3TQN A;  3DKW A;  2P7V B;  3WTU C;  1IXS B;  2FF4 A;  2XV4 S;  1R00 A;  2L4M A;  1HKS A;  1MDM A;  1O57 A;  1OYW A;  2DFI A;  3DV8 A;  2VN2 A;  2DK8 A;  2VT2 A;  2W84 A;  5E8I A;  3LQR A;  1ZGA A;  2FBK A;  3CJN A;  3K69 A;  2HFH A;  4LG0 B;  1Z6R A;  2DTR A;  2D1V A;  2ZO4 A;  3EET A;  3H92 A;  4ENK A;  3C18 A;  2LNB A;  4IHT A;  2H09 A;  2IP2 A;  2Z99 A;  4Q47 A;  1WKM A;  2KIF A;  1QQI A;  1DP7 P;  4ENN A;  1RZ4 A;  3WU1 B;  1REP C;  3HHG A;  1UST A;  2O0Y A;  1ZAR A;  1U6G A;  2ESN A;  3I5U A;  1BI2 A;  1BI0 A;  5BQT A;  3FM3 A;  3ZN1 A;  4ESJ A;  2DAO A;  3D0S A;  4BXU A;  1J59 A;  3KET A;  4HF1 A;  5DYM A;  2K4J A;  1XSV A;  4AVP A;  3FF5 A;  5LHH A;  2COM A;  2W25 A;  2OQR A;  5D5W B;  4YII A;  2VOO A;  5LGU A;  4U7B A;  3CUQ A;  5DUK A;  4G9Y A;  1W7P D;  4HYE A;  3BP8 A;  3ZPL A;  1L0O C;  2EB7 A;  5D4S A;  3ZP5 A;  4NQW A;  2DQR A;  3GFM A;  3EYI A;  1IN7 A;  3GFL A;  1XMA A;  1EV7 A;  4BH9 A;  2L54 A;  1YTY A;  1U5T C;  3E5U A;  4A0X A;  4WXD A;  3SXY A;  2EJR A;  1P4W A;  4KFC A;  3JTH A;  1XGM A;  3IRQ A;  2ISZ A;  3W6K B;  1XSD A;  2P6T A;  3R4K A;  1R1T A;  2PFB A;  2CYY A;  2QVO A;  4L18 B;  1STZ A;  3JTG A;  2M45 A;  1I1G A;  3T8R A;  3WGI A;  4JBA A;  3K2Z A;  2RV8 A;  1YS6 A;  3RPQ A;  3Q9V A;  2QZ8 A;  3FMQ A;  2MLG A;  4HDV A;  2Z9O A;  5DUI A;  1MDM B;  2HGC A;  5FLX Z;  3IWZ A;  4HA8 A;  3T0Y A;  4HX8 A;  1KQ9 A;  4KNY A;  1ZRE A;  2PEX A;  2PN6 A;  4P96 A;  3PFI A;  1T98 A;  4FX0 A;  4I0A A;  2XAQ A;  4U0V A;  4WF2 A;  1IXC A;  3HIF A;  1X3U A;  4IRG A;  1XGO A;  1UCR A;  4JQF A;  1T39 A;  2IW5 A;  4JK1 X;  1R1U A;  3I59 A;  1KQ0 A;  4Q5S F;  3KZY A;  3WGG A;  1S8N A;  2GA1 A;  2P7C B;  2ESH A;  1IF1 A;  3FXU A;  1QO0 D;  2D45 A;  4ETS A;  5E1X A;  4MGR A;  5D6F A;  3QPH A;  5FD5 A;  4GXO A;  2JTV A;  1J7K A;  3TOA A;  1TTY A;  1OKR A;  4I2O A;  1ZHF A;  4ESF A;  5LEK A;  4PZJ A;  3F23 A;  1ON1 A;  1P92 A;  5D4R A;  3RIR A;  2ZME A;  4LGW A;  2GXG A;  1QZZ A;  3DFG A;  4Q48 A;  3MAJ A;  2UWM A;  3HSR A;  2FOK A;  1KYW A;  4N9H A;  5J8F A;  1ZH5 A;  3SZT A;  4RGX A;  1ULY A;  2XAF A;  4U7D A;  3FXQ A;  2CW0 F;  3F6O A;  1RI7 A;  1Y0U A;  3FZV A;  4L0Z B;  1SMY F;  2BBY A;  3DP7 A;  3HSE A;  1YIO A;  5LHG A;  3KP6 A;  1WI9 A;  3F3X A;  4LK1 F;  4TV7 A;  2A3S A;  1HXD A;  2HTJ A;  2TDX A;  4EJU A;  3QRF F;  3U1D A;  3HTU A;  5HDG A;  3O6B B;  1YYV A;  1UB9 A;  1ZG1 A;  2EFW A;  1HW1 A;  1RNL A;  5F6F A;  2XKP A;  2E7W A;  1ZYR F;  3NEU A;  2Y75 A;  2DBB A;  2FA5 A;  1R58 A;  3V4G A;  1AWC A;  2RC4 A;  2Y48 A;  2OU2 A;  1DDN A;  4LB5 A;  1JGS A;  1Z9C A;  3HRS A;  4I02 A;  2ZJ2 A;  1SD6 A;  1OYI A;  1J75 A;  2V1X A;  3TO9 A;  4EGZ A;  1T0F A;  3BWG A;  4LLL A;  1V4R A;  2QEN A;  1ZG3 A;  3GFI A;  5EEH A;  1SFE A;  2V79 A;  2CSO A;  2GA2 A;  3T5X A;  5D5V B;  4GGG A;  1WSU A;  1V3F A;  4BHB A;  4F7Z A;  1XN7 A;  2HOE A;  5CVV A;  4DQ2 A;  1R5H A;  2XRO A;  5D8K B;  1S7A A;  4ENJ A;  3ZQ7 A;  1F1Z A;  4AD9 A;  3TO6 A;  4OIO F;  3HHH A;  3VFZ A;  3ZMU A;  1BBY A;  5DCF A;  1FY7 A;  1XSX A;  4O3M A;  2OBP A;  3BY6 A;  2KRF A;  2F5C A;  3HRM A;  3SHF A;  4EJT A;  4KIG A;  5D8L B;  2JPC A;  2ISY A;  4DNC A;  5F64 A;  1G3Y A;  3F22 A;  3ROU A;  1W5S A;  2ZME B;  2DPU A;  3N97 A;  5HLI A;  2AS5 F;  1W4M A;  1ZRF A;  3KP7 A;  1JHH A;  4HBL A;  3TKY A;  2BV6 A;  2F5D A;  5LRR A;  4KT5 C;  1C0W A;  2JRT A;  3EQL F;  4OIQ F;  4IRI A;  5LHI A;  4FX4 A;  2QWW A;  4RB3 C;  3O2P E;  3RI4 A;  1LQ1 A;  1B9M A;  5D6E A;  1IRF A;  1LNW A;  2GWR A;  3MEX A;  1ZLJ A;  2M1B A;  3F8C A;  2KJC A;  3LA7 A;  1D8K A;  4ASN A;  3MCZ A;  3IHU A;  4RGU A;  4EM2 A;  4A0Y A;  2VBX A;  5K1Y A;  3J80 Z;  4U0W A;  2HQN A;  5EEG A;  1MZB A;  5K5O A;  2A61 A;  1KQ8 A;  3WE2 A;  2P6S A;  2DLL A;  2LKP A;  4GYG A;  2V6C A;  3M7G A;  1IUY A;  1XB4 A;  2IT0 A;  3F8B A;  3M8F A;  4A5N A;  3SQN A;  2FQ3 A;  1HW5 A;  3QU3 A;  1LEB A;  1HBX G;  4PGG A;  4WXC A;  4OOI A;  4M73 A;  2FBH A;  1LB2 A;  2H27 A;  5FO5 A;  4HX4 A;  3IKV A;  1U78 A;  2HR3 A;  2OA4 A;  4KN4 X;  4M74 A;  4WK8 F;  1DUX C;  1VTN C;  4IPA A;  4HX7 A;  4M6X A;  1I5Z A;  1R22 A;  2L02 A;  3DF8 A;  2QQB A;  5E18 F;  3IL2 A;  5ILS A;  1U5T A;  1XDS A;  1JHF A;  5DD8 A;  2E7X A;  3C7J A;  1K78 A;  3JSO A;  5K5Q A;  3E6M A;  4IJA A;  1I27 A;  3VOE A;  2MBF A;  5HVQ C;  3KEQ A;  5DCM A;  2VBY A;  3REO A;  5A2Q K;  1UHW A;  4XSX F;  3FXR A;  1EH8 A;  1H0M A;  4EM1 A;  3B02 A;  1YW8 A;  1FLI A;  3MFK A;  1LEA A;  1IAW A;  3HRT A;  2ZFW A;  2YSR A;  1SD5 A;  4U88 A;  2BEO A;  2EFO A;  1ZAO A;  2G9W A;  4RS8 A;  5ICG A;  3V8L A;  1CF7 B;  2CO5 A;  3L9F A;  2NAZ A;  3TGN A;  2Z3Y A;  2QBY B;  2A6H F;  2A68 F;  1JXS A;  4XRF A;  3WOD F;  2NRA C;  4YFX F;  2YPR A;  3B73 A;  3GLX A;  1LJ9 A;  4L9T A;  3DQV C;  4UNO A;  2MA3 A;  3KFW X;  1PDN C;  2WC2 A;  4ZZL A;  2FNA A;  1O3Q A;  1GXQ A;  2NYX A;  1PP8 F;  3RYR A;  1QBJ A;  3ECO A;  4A0Z A;  2IA1 A;  4A6E A;  2EV5 A;  4IHS A;  2JPB A;  3KP3 A;  2XKO A;  2VOP A;  1FX7 A;  2KKO A;  4YFN F;  5HLH A;  4G7Z F;  1JE8 A;  1HST A;  3HOT A;  2D1H A;  2ACJ A;  3LWF A;  3RJP A;  1Z6T A;  2VOD A;  3E6D A;  1Z05 A;  3K1P A;  3U9G A;  4UXN A;  2G7H A;  5CVR A;  1Z1D A;  5ERI A;  2OQG A;  5HLG A;  3E5Q A;  2L3D A;  1CGP A;  4MEX F;  4ZYH A;  3KP4 A;  1XCV A;  1GXP A;  5H6R A;  2JSC A;  3KLO A;  4NHJ A;  3LAP A;  4MTD A;  2YX4 A;  5E20 A;  5BS6 A;  2DO7 A;  4CGZ A;  1R36 A;  2ZXJ A;  2VT3 A;  3T1B A;  1KU7 A;  1WRJ A;  2OZ6 A;  3OOP A;  3JAM Z;  2PQ8 A;  4EQQ A;  4S04 A;  2QYO A;  4MQV A;  3L7W A;  3QAH A;  1KYZ A;  2FE3 A;  3WTW C;  1B6A A;  1TLH B;  3CDH A;  4PCQ A;  4ZH4 F;  3KZZ A;  1S6L A;  3OV8 A;  1TQI A;  3ECH A;  4LFU A;  1KU3 A;  3FWE A;  4XLN F;  4OU0 A;  1U5T B;  5KK1 A;  2F5E A;  4HDU A;  4G6Q A;  2YU3 A;  4IVN A;  5L3F A;  1SFU A;  5BPI A;  4IXA A;  3GVA A;  3FX3 A;  1F9N A;  2D2W A;  2C6Y A;  5LBQ A;  5KVR A;  5DEQ A;  4EV0 A;  4HF0 A;  1BN5 A;  1TQP A;  4EM0 B;  4Y15 A;  2UXX A;  3K0L A;  2OZU A;  5ILV A;  1SD7 A;  4AIK A;  5L3D A;  1FWZ A;  3J81 Z;  4HLX A;  2HS5 A;  2R7D A;  3ELK A;  3COA C;  2G7U A;  3P9C A;  2GQQ A;  2X4H A;  2VE8 A;  5LLQ A;  5JI6 A;  4HV6 A;  4M9S A;  1ON2 A;  4HOB A;  4N9I A;  3W6J B;  1AOY A;  1UHM A;  4FT8 A;  3L2C A;  4XBF A;  1OMI A;  2Y0M A;  4OMZ A;  2PJP A;  4EJW A;  5CJ9 A;  3LA3 A;  2O61 A;  3GYH X;  5J8C A;  1FBS A;  2EWN A;  4GYI A;  4CO8 A;  3QU6 A;  2DW4 A;  3K9T A;  2R7F A;  1FZP B;  4MHG A;  1R23 A;  1P6R A;  4H0E A;  2P5L C;  4HZF A;  2XRN A;  4A5M A;  2PBI A;  2YX7 A;  2M5W A;  4L9J A;  4M71 A;  4B8X A;  3R0J A;  4MEY F;  4Y13 A;  2Q0O A;  2IVM A;  4LLN A;  4O6J A;  4AIH A;  2ZCW A;  2W57 A;  1IN8 A;  1BOA A;  2GXB A;  3DPL C;  1U3E M;  3TDZ C;  2RVC A;  4A6D A;  5HS9 A;  4EJV A;  4OIN F;  2QUF A;  5ILU A;  1FBQ A;  3KLN A;  2HKX A;  3ZN0 A;  3CUQ B;  2GAU A;  5FFZ A;  1L3L A;  1LDJ A;  3RTR A;  3EYY A;  1S3J A;  1KU9 A;  4HV5 A;  1XCB A;  4B09 A;  1S29 A;  2XIG A;  3V8J A;  4RGR A;  4QWQ A;  4KIC A;  4G7O F;  3QP6 A;  2ZNZ A;  1WWX A;  1SMT A;  3Q5F A;  2ELH A;  2Z5U A;  3K1M A;  3FMR A;  2HDC A;  2P4W A;  1IRG A;  4MQ9 F;  4MNU A;  3VEP A;  3LAJ A;  4RGS A;  4L0Y B;  1Q1H A;  2FMY A;  2E1N A;  4WWC A;  3PQK A;  2FSW A;  1XDU A;  4PDK A;  1U8R A;  2JZY A;  1IN6 A;  3F8F A;  3FM5 A;  4LD5 A;  1TW3 A;  3BPX A;  1TNT A;  3NRV A;  1FBU A;  2QQ9 A;  3HSF A;  4GO1 A;  5AON A;  2AXL A;  2GZW A;  4IF4 A;  5FB2 A;  2FEZ A;  3J7A O;  1WQ2 A;  3KE2 A;  4KDP A;  5J6X A;  2DI3 A;  1PUE E;  3I64 A;  1SAX A;  4ENM A;  3KCC A;  4LMY A;  2CG4 A;  4CZZ A;  1YG2 A;  4AWX B;  2Z33 A;  1KGS A;  1B59 A;  2FML A;  3CLO A;  3GFJ A;  1T2K A;  1ZN2 A;  5E1Z B;  3I59 B;  3GO5 A;  1FC3 A;  2O03 A;  3HTS B;  5K5R A;  4MTE A;  3GUD A;  1IN5 A;  4EGY A;  2PLY A;  3ABU A;  4UUV A;  3I58 A;  3V8K A;  1YS7 A;  5L3G A;  1XGN A;  5BPD A;  1K7A A;  1J0R A;  1USS A;  3C3W A;  2A6E F;  3R6S A;  3VOD A;  1XGS A;  2MLK A;  5LEJ A;  3HUG A;  4KA4 A;  3L09 A;  3DPT A;  3QP5 A;  3VB2 A;  1ODD A;  4LG0 A;  3RYP A;  5TRD A;  1ZLK A;  4P5O A;  2K02 A;  3U2R A;  5DDG A;  2KIM A;  5FLX K;  4BQA A;  2JT1 A;  2P5K A;  2M30 A;  3FMS A;  3WTV C;  1W7P A;  2K86 A;  4UVC A;  4UV8 A;  5AIP A;  3CO7 C;  4YG2 F;  4G94 A;  3LST A;  3GF2 A;  5CVU A;  3WU0 A;  4U0Y A;  3MZY A;  3P7N A;  2LF7 A;  5F1R A;  1K79 A;  3P9I A;  2EV0 A;  2BGC A;  1G3W A;  2ADU A;  5BMZ A;  1IW7 F;  2K27 A;  3IWF A;  3HRU A;  2HKO A;  3N4M A;  2F5F A;  2ZNY A;  4A12 A;  2VBW A;  3GZ6 A;  4Q4Z F;  4HW0 A;  2BYV E;  4AIJ A;  1B1B A;  3V7C A;  4EVI A;  1FOK A;  3E6B A;  4R79 A;  3TDU C;  3ERE D;  1FYK A;  1F5T A;  2NNN A;  3K1N A;  3I4P A;  4NB5 A;  1MKM A;  5E1W A;  1BJA A;  3KEO A;  2L01 A;  2QM3 A;  5ICE A;  4CYD A;  2XVC A;  1FYM A;  2EV6 A;  2A5Y B;  5JR3 A;  3F72 A;  1O3T A;  2STT A;  2QLZ A;  4LK0 F;  2XGX A;  1W5T A;  4Z2Y A;  4D0P A;  4HF2 A;  1R5G A;  2P5V A;  5IT9 K;  5L3C A;  4GCV A;  3NQO A;  1ONV A;  5BOX A;  4ZYG A;  3GXO A;  2XAJ A;  1OPC A;  5FD6 A;  2ETH A;  1ZG5 A;  3WTX C;  2OAZ A;  1KU2 A;  2M87 A;  5E17 F;  1E17 A;  2VC1 A;  3GEZ A;  1QPM A;  1OR7 A;  4RB1 A;  1R7J A;  1SD4 A;  4CDG A;  1EH7 A;  2HWV A;  1HW2 A;  4BAY A;  1BI1 A;  1RUN A;  5D5U B;  3AAF A;  3BJO A;  3MWM A;  3LFK A;  1GVJ A;  1NHA A;  1W7P B;  5CLS A;  1FP2 A;  3V7S A;  3JW4 A;  3F8N A;  4IRH A;  1G3T A;  5DV5 A;  4BHP A;  1H9G A;  3R61 A;  4E70 A;  1BC7 C;  4L9V A;  1D5V A;  2A07 F;  4RB0 A;  5LGT A;  2FNP A;  3IKT A;  4HLY A;  1D3Y A;  3LQQ A;  3R60 A;  5HDK A;  5JVT A;  2EFP A;  4CHU A;  4BYY A;  5HOO A;  1TW2 A;  2KIU A;  3BJA A;  1S7O A;  3F8M A;  3WTZ A;  4OIP F;  3I53 A;  3LA2 A;  4YFK F;  1F4K A;  4KIF A;  2EA4 A;  3ABT A;  4QLC U;  1FYL A;  3D5L A;  5H20 A;  3WG9 A;  2DT5 A;  5FGM A;  3WTT C;  3M8E A;  2BE5 F;  4CIC A;  5ICC A;  1SFX A;  2A69 F;  3WGH A;  2RQP A;  3CO6 C;  3BPV A;  1KA8 A;  4ESB A;  2VBZ A;  4WX9 A;  2XAG A;  2WV0 A;  3EDP A;  2DPD A;  1LDK B;  5CVI A;  2XUB A;  3SZP A;  1HKQ A;  4K2E A;  1K78 B;  4M72 A;  1BI3 A;  3DEU A;  4P55 A;  2XHK A;  4XLP F;  4RAZ A;  4BNC A;  1DPU A;  4LB6 B;  1FNN A;  5DCM B;  3P9K A;  5HS8 A;  1H9T A;  3T8T A;  1Z91 A;  3RKW A;  3J80 K;  2J5P A;  3M9A A;  4R1H A;  3RDI A;  5L3E A;  4I7H A;  3C1D A;  1U2W A;  2IRF G;  3H3Z A;  1MGT A;  4KMU X;  1HSJ A;  5CYV A;  2CQK A;  4UV9 A;  4I0B A;  1B9N A;  2H6B A;  3I54 A;  1MD0 A;  2RKH A;  3Q9S A;  1IXR C;  2Q2E A;  3R0A A;  1FSE A;  1PP7 U;  2LSO A;  1ZRC A;  2PMU A;  4LLG F;  1YFH A;  3QOP A;  2FU4 A;  2PG4 A;  4Y17 A;  1FPQ A;  5JFR A;  4CXF A;  3MQ0 A;  2VXZ A;  2V9V A;  4ZYE A;  3GZ5 A;  3BJ6 A;  1TBX A;  1G6N A;  3BZ6 A;  5HDN A;  4ZZD A;  4KUM A;  2HEO A;  4I01 A;  4A2U A;  2OD5 A;  1YO5 C;  2VC0 A;  3G3Z A;  4WCG A;  3JSP A;  3F6V A;  3KP5 A;  4R8H A;  2H94 A;  1T6S A;  3WTY C;  3TOB A;  2PMH A;  3I0T A;  4PGH A;  3FHZ A;  4I98 B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...