1SD6A

Crystal structure of native meci at 2.65 a
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
119
structure length
119
Chain Sequence
TYEISSAEWEVMNIIWMKKYASANNIIEEIQMQKDWSPKTIRTLITRLYKKGFIDRKKDNKIFQYYSLVEESDIKYKTSKNFINKVYKGGFNSLVLNFVEKEELSQDEIEELRNILNKK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Methicillin resistance regulatory protein mecI
publication title Crystal structures of the BlaI repressor from Staphylococcus aureus and its complex with DNA: insights into transcriptional regulation of the bla and mec operons
pubmed doi rcsb
source organism Staphylococcus aureus
molecule tags Dna binding protein
total genus 37
structure length 119
sequence length 119
chains with identical sequence B
ec nomenclature
pdb deposition date 2004-02-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03965 Penicillinase_R Penicillinase repressor
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 1sd6A01
1.10.4040.10 Mainly Alpha Orthogonal Bundle Penicillinase repressor fold Penicillinase repressor domain 1sd6A02
2XVCA 4RGXA 3C3WA 1YW8A 3K0LA 1I1SA 4RGSA 2P4WA 2E7XA 4G94A 3M7GA 1KGSA 5DCFA 1KU9A 4UHTA 2IVMA 2QUFA 2OA4A 2EFPA 3K69A 3HSRA 5CLSA 1Z6RA 4UXNA 2HR3A 2M1BA 2O61A 2FSWA 1K79A 2KIFA 1OYYA 5L3CA 4HF2A 5BQTA 4RS8A 1QNTA 4EMSA 3CO6C 1XN7A 3SHFA 4HV5A 2V1UA 3N97A 4I0AA 3I59B 3V8LA 2HFHA 2DK5A 3J7AO 4PGHA 5L3GA 2STTA 2K86A 4HLYA 5CVRA 4IHTA 1HKSA 4RGRA 2LDUA 2EFNA 2IP2A 1IXCA 2BYVE 3GZ5A 5BPIA 1Z7UA 1TBXA 1QBJA 3T1BA 5D4SA 3F8FA 3F8CA 1UHMA 3ISPA 4KN4X 2XAJA 1G3SA 1BBYA 4HAMA 5CVUA 4CHUA 2GA1A 1DDNA 2CYYA 4OINF 4PGGA 2VOOA 4GYGA 5HDNA 3TOBA 1ZLJA 4O5VA 5TJJA 5ICCA 2CFXA 3JSOA 3I58A 3GEZA 1C0WA 1SFUA 4LJZF 4N9HA 5A2QZ 1ZARA 1W5SA 2YU3A 3ZMDA 3DEUA 1PP7U 2MD5A 3WTVC 2PJPA 5AIPA 5LHIA 2H6CA 2FQ3A 2KIUA 1XSXA 3E5XA 4BHPA 4QLCU 3KEQA 3WG9A 1P4WA 1K6OA 3R0JA 3E6DA 1J2XA 4OIQF 2G7UA 2FBIA 3GZ6A 3ABUA 3DPLC 1KQ8A 2W84A 3ELKA 1R58A 4HF1A 1R1TA 2DI3A 4I7HA 5L3DA 4U0YA 4L9JA 2AS5F 1XDUA 3O3KA 3L2CA 3ML6A 1BOAA 2F2EA 1OYIA 4EM0B 4RGUA 1FX7A 1U2WA 2GXGA 3E6BA 4IPAA 1FPQA 5EEGA 2PMHA 3WE3A 3SZTA 2ZJ2A 2Y48A 2DQLA 2GZWA 3MEXA 2ZO4A 3QOPA 4Q47A 1J7KA 4KDPA 2CSOA 1KYWA 3RKWA 1H0MA 4RAZA 3WTYC 2QQAA 1D8JA 4BYYA 4KUMA 3L09A 2Z33A 1ZREA 5D5XB 1SD4A 3KP7A 3PQJA 2JT1A 2HQRA 3EETA 1OYWA 2EJRA 4BNCA 3HYIA 2OQRA 1BN5A 3NRVA 1FYKA 4CYDA 4R1HA 3FXQA 3M8EA 2DPUA 3JAMZ 4RB1A 2O6GE 2L3DA 5DDGA 1JE8A 3COAC 4OIPF 4L5IA 3HOSA 1HW2A 1BIBA 4Y13A 5TRDA 4HYEA 3N4MA 3ZMUA 4KIGA 4ZYEA 1ZGAA 4LK1F 2V1XA 4M74A 3GFMA 3CUQA 5IT3A 5LEJA 1O3SA 2KKOA 5LGTA 5J6XA 4R8HA 4L9TA 3K2ZA 1MKMA 2JPBA 3CJNA 3NQOA 2QZ8A 2ZNYA 3C18A 3FMSA 2QYOA 4Q4ZF 3J80K 2FEZA 2ZXJA 2OD5A 5E18F 4DNCA 2O0YA 1SD7A 2OAZA 4KIFA 4YG2F 1F1ZA 1FC3A 3KLOA 2V9VA 4HA8A 3FWEA 2O03A 2Q0OA 3HUGA 4HOBA 3HSFA 4PDKA 1P92A 2W85A 1UB9A 1R5HA 3HRTA 4O3MA 2RV8A 4M9XA 2A69F 5ILVA 3V8JA 3Q9VA 4U88A 3WTTC 3GLXA 2F5CA 4G7HF 2FF4A 5HLGA 4B8XA 1P4XA 1JHFA 3PFIA 1L3LA 2KIMA 1XGSA 2QBYB 1RUNA 2R3SA 4LG0A 3E6MA 1GHCA 2IRFG 2RN7A 4UV9A 1F5TA 2VT2A 3RTRA 1BIAA 3HOTA 1O3RA 1YS6A 5CVIA 3KEOA 4DQ2A 1IN7A 4IF4A 1IN6A 1ZG3A 3I54A 2XAQA 2OQGA 1GXPA 5FLXK 2HZTA 3QPHA 4HW0A 4L18B 3WU1B 3GFLA 1UFMA 4MQ9F 5HDKA 3FM3A 1TNSA 2Y75A 2BEOA 1YQAA 2MBFA 4ENKA 4YIFA 1YW9A 1SFXA 3MZYA 4I2OA 1LEAA 3F72A 2YR2A 3IL2A 3FM5A 5FO5A 1ZRFA 2XGXA 2P5VA 1IN4A 1EH7A 5LHHA 1STZA 3QP5A 1IZ1A 1CF7B 4UUVA 1FYMA 5ED4A 4BAYA 3F22A 1F4KA 3P9IA 2B0LA 3WU0A 2OU2A 2FE3A 1KYZA 4LLGF 1FNNA 2DT5A 4WWCA 1XCVA 5JFRA 2VBXA 2VC0A 3ECOA 1B9MA 3LQQA 3BJOA 2E1CA 3ZN1A 3PQKA 5EEHA 3E6CC 5D6FA 4P5OA 4MGRA 2R7DA 2G7HA 3TDUC 4G9YA 1FBUA 3FX3A 4F7ZA 2K4BA 1YTYA 1R5GA 3RPUA 5DCMB 1O57A 1ZG1A 4L9NA 4HX4A 1R1VA 4IRGA 2DU9A 4I0BA 1SMYF 1QQIA 3HTUA 3KZZA 2VONA 3TO7A 2PG4A 4KT5C 1HSJA 3ERED 3E97A 1MDMA 3H3UA 2DBBA 1KU7A 3CUQC 4HV6A 3IRQA 3V7SA 5J8CA 3L00A 4L5JA 4EVIA 3ZPLA 3I0TA 1XB4A 1BC7C 1R23A 3S2WA 5HLIA 4ENMA 1A04A 2HGCA 2A3SA 1XSDA 4ENJA 2EWNA 2UXXA 1I27A 4Z2YA 3TGNA 4QWQA 1TTYA 4NB5A 3IKVA 4AD9A 5E8IA 5LGUA 2MA3A 2XROA 3BOQA 4RB0A 3G3ZA 3K1MA 1LNWA 3U9GA 2WWYA 1T38A 5HS7A 2HEOA 1QZZA 4AIKA 2VODA 3KZYA 3TDZC 2HKOA 2MLGA 2VE9A 4CZZA 2RGVA 2STWA 3O6BB 4L9VA 1HW1A 3MCZA 4S05A 2DK8A 1U78A 1TW3A 5DEQA 3VB2A 1YLFA 2HWVA 1D8KA 2UXNA 1MJBA 2P6TA 1RIOH 3B73A 2FMYA 2DW4A 1ZGJA 2COMA 4AIHA 1V3FA 1FBSA 3TOAA 1YIOA 2TDXA 1KU2A 3ZMVA 3D5LA 5KK1A 4GYIA 1FLIA 4GO1A 1TW2A 1BI0A 4L0ZB 1LDDA 1ZN2A 4EGZA 3JW4A 4KYWA 4EV0A 4O6JA 1XCBA 3LA3A 3CLOA 1FWZA 1B4AA 1S3JA 2QQBA 1W7PA 4XSZF 2QENA 2WC2A 2QWWA 4G7ZF 2FU4A 3WE2A 3GVAA 3BROA 2A6HF 2FNAA 4G6DA 2NNNA 1I1GA 5D4RA 1KQ9A 4RAYA 1XGOA 2IPQX 1BM9A 3WTUC 3GUDA 2VE8A 1IRGA 4OMZA 3LWFA 1MD0A 2HTSA 3NEUA 2JZYA 1LEBA 2MC3A 3DQVC 4WXCA 2XKPA 2YX7A 5E1ZB 2EFOA 4LLLA 2F5FA 3HHHA 3OV8A 4PCQA 4YFNF 1G3TA 2W57A 3E3VA 1ON2A 2KJCA 2GQQA 2L4MA 3RI4A 1WKMA 4UVCA 4FX0A 3IWZA 2XKOA 5D5VB 2ISYA 1LVAA 2MH2A 1J75A 1IF1A 1REPC 2UWMA 1U5TC 3GXOA 4RB3C 4K2EA 3GFJA 3TQNA 4S04A 4RB2C 3K9TA 1S29A 2A6EF 1EH8A 2PQ8A 2L01A 1ONVA 5LHGA 2F5EA 2FA5A 3LAPA 1G4DA 3OOPA 3LA7A 4HZFA 2Q8KA 4LB6B 3D0SA 4U0VA 3RJPA 4JK1X 3GX4X 1LB2A 4M73A 4KIBA 2RNJA 1WI9A 3TKYA 1PP8F 3MAJA 2OBPA 4P9FA 2Z5UA 3BJAA 3WTWC 5CJ9A 2FBHA 1D3YA 3DKWA 2A5YB 3WGHA 2LNBA 1BC8C 4P55A 2ACJA 2BBYA 1RI7A 4XLPF 1HSTA 4MHGA 1MGTA 3T8RA 3VFZA 3KP2A 2OZ6A 2DFIA 2W24A 5CYVA 4HBLA 5ILSA 3J81K 4HQEA 1OR7A 5H6QA 4A0ZA 3C7JA 2EV6A 3RPQA 1DPRA 5BMZA 3QU6A 4I09A 2K27A 4LLNA 1J0RA 1T2KA 3V7CA 2PBIA 1MZBA 3E5QA 4M9SA 1R22A 4LMYA 3KETA 2D1VA 1YFHA 3JTHA 5HLHA 2RC4A 4A5NA 2KJBA 1ZYRF 1O7LA 2PLYA 1JGSA 3RYPA 4A6DA 4IJAA 1SD5A 3CUQB 5FB2A 1IXSB 3FMRA 3HHGA 3L7WA 2O8XA 4KMFA 3F8BA 5FFZA 1NHAA 4G7OF 3JSPA 4ZZDA 2H94A 1B6AA 1T98A 1YYVA 2HTJA 4G6QA 1BI2A 1FSEA 2KRFA 4NQWA 2M87A 2OZUA 1OMIA 5HDGA 4UVAA 4XSXF 4EJOA 2H09A 3T0YA 4JBAA 1H9TA 5LRRA 2M8EA 4EJVA 3IKTA 4HDUA 2ZNZA 5E1WA 2P5KA 4MTEA 4WXHA 3KFWX 3ECHA 3IWFA 5BOXA 4EJUA 2DLLA 1JXSA 1P4AA 2ELHA 1ZLKA 3F6VA 3KP4A 2HS5A 4KICA 4BHCA 4Y17A 3K1PA 4ZYHA 1LQ1A 4ZYDA 4XLNF 2VT3A 2O3FA 3I64A 2NRAC 3QAHA 4EM2A 3HIFA 4LFUA 1G3YA 3TO6A 3O2PE 2EFQA 6PAXA 2CG4A 5BPDA 3SQNA 1R36A 5K1YA 5L3EA 1WRJA 2F5DA 3T5XA 1DUXC 1K78A 3BP8A 4LG0B 2E7WA 1G6NA 5LLQA 4TV7A 4I02A 4CICA 2PMUA 1HW5A 2R7FA 4HDVA 2EA2A 1FOKA 1XMAA 2P7VB 2ADUA 2ZMEA 5H6RA 5IT9K 4M71A 3V8KA 1X3UA 3RYRA 4D0PA 2PN6A 2P6SA 3BJ6A 1U3EM 4CXFA 4YFKF 4MNUA 4GGGA 1SAXA 4KNYA 2XASA 3DFGA 3IHUA 3R61A 5HVQC 1IAWA 5A2QK 1W7PD 3M8FA 4ESFA 2FOKA 1W5TA 4M72A 3WTSC 1Y0UA 2FMLA 4A6EA 4AWXB 3CUOA 2FRHA 1XMKA 2VOPA 4LD5A 3BZ6A 1PDNC 1U5TA 1BI1A 1DPUA 2XHKA 1KQ0A 1O3TA 1ON1A 2BV6A 3WODF 5J8FA 1P2FA 3F6OA 2C6YA 5ILUA 4IRHA 4HX7A 2EB7A 4Q5SF 5LRSA 2D1HA 2NYXA 2Z99A 5BS6A 5ICEA 1S8NA 1FSHA 3IRRA 3SXYA 5K5RA 1TQIA 4JQFA 4HQMA 4FT8A 5DD4A 5E1XA 1ZAOA 3GF2A 2NAZA 3T8TA 3ABTA 1E2XA 1LJ9A 2K4JA 2M30A 2EV5A 2DO7A 3CDHA 5JI6A 3J80Z 1QGPA 3U1DA 3R60A 5D5UB 1G3WA 5H20A 1MDMB 2HDCA 2Z3YA 3FMQA 3LAJA 3HTSB 4KMUX 1QO0D 1T0FA 4IXAA 1U8RA 1XSVA 2EFWA 4UNOA 2L4AA 2VXZA 3I53A 4OU0A 3I5UA 1LDKB 4A2UA 1U6GA 1QZYA 3WTXC 3GYHX 1HBXG 1WQ2A 1WWXA 1UHWA 3L9FA 3I59A 2FNPA 2LF8A 3I71A 2ZBKA 1XD7A 1B59A 1QPMA 1PUEE 3JAMK 3EUHA 1FZPB 2VBYA 1T39A 4EJWA 1RNLA 3MQ0A 4YFXF 2P8TA 3BPVA 1XGMA 2DPDA 3WGGA 3H3ZA 3CO7C 5CVVA 3Q9SA 1S6LA 2HOEA 3R6SA 3R4KA 2GWRA 1HQCA 2G9WA 2YPRA 2HYFA 4U7BA 3KCCA 3B02A 3SZPA 3V4GA 4ESJA 5FD5A 1CGPA 5CVJA 2CO5A 3H92A 2JTVA 3M1EA 2XAFA 3VEPA 1YO5C 2QM3A 3EYIA 1YW7A 5FLXZ 3GW2A 2NS0A 5LEKA 5E8GA 3DF8A 3F3XA 3LQRA 1GXQA 2GXBA 4LB5A 3QP6A 4ESBA 4OMYA 1IN8A 3ZQ7A 4ENNA 4Q48A 2Q2EA 5E20A 4WXDA 5IT9Z 1FBQA 4A0XA 2MH9A 4WK8F 5KVRA 2IA0A 4HF0A 4E70A 2ZFWA 2RQPA 3R0AA 4N9IA 4EM1A 3FHZA 2RDPA 3HRUA 1W7PB 4EGYA 4I98B 4ON0A 1J5YA 2EK5A 2EV0A 1J59A 3LFKA 2DAOA 3DP7A 4WX9A 1Z6TA 3C1DA 3F8NA 4I01A 5ICFA 4H0EA 5DYMA 4BHBA 4P9UA 1SMTA 1LDJA 3BDDA 2H6BA 2V6CA 2JSCA 3F21A 1FYLA 1F9NA 2QQ9A 2XRNA 1B9NA 2A68F 1I5ZA 5F64A 2WV0A 3V7RA 4XRFA 4U7DA 1JHHA 1IRFA 3BY6A 1YG2A 4ETSA 3FXRA 4GCVA 4FX4A 5E17F 4A12A 4YIIA 4MEYF 2X0LA 3VOEA 4PZJA 4XBFA 3F23A 1SD6A 5FD6A 3EYYA 4CO8A 5ICGA 2VN2A 4EQQA 2A07F 4OIOF 2V79A 1UCRA 1ZRCA 2ZCWA 1ODDA 2EA4A 3K1NA 3HRMA 1R1UA 4G8XA 4P96A 2HYGD 4EJTA 2GIVA 4LK0F 1E17A 3JTGA 1OPCA 2IT0A 4AIJA 2UZKA 3DXJF 3ULQB 3HRSA 1FY7A 1YS7A 5JVTA 2D2WA 2ETHA 3EDPA 1HKTA 1Z05A 3VODA 4AVPA 1ZHFA 5AONA 1TLHB 1HKQA 3IC7A 1IUYA 1DP7P 3SFZA 4M6XA 4Y15A 1MJAA 3F8MA 5JR3A 1EH6A 2IA1A 4N0BA 4NHJA 1FP1D 3QRFF 5AIQA 2DQRA 3AAFA 1FT9A 3HSEA 3M9AA 4M6YA 1P6RA 2XIGA 2L02A 3LSTA 1VTNC 1EV7A 2ESNA 1TNTA 1H9GA 2VBZA 1ZG5A 1FP2A 1IN5A 2H27A 2FXAA 3TO9A 4B09A 3KLNA 2FBKA 1D5VA 1R00A 3WGIA 4MTDA 3GO5A 2ISZA 5FGMA 3ZMSA 2PFBA 2QBYA 2MLKA 4OIRF 3FXUA 5LGNA 1USSA 2QVOA 4CGZA 5F6FA 4HX8A 3ZP5A 4BXUA 2L54A 3QU3A 1GVJA 2ESHA 2VBWA 3MFKA 3GWZA 2WTEA 2CW0F 4MEXF 3LA2A 4R79A 4UVBA 4KA4A 2IA2A 4WCGA 2VC1A 1XGNA 4BQAA 3QPTA 3WTZA 2W25A 5D5WB 2E1NA 1WSUA 1Q1HA 4WF2A 3RDIA 2LF7A 3P9KA 1T6SA 1L0OC 3RIRA 4OOIA 5HOOA 3KP5A 5HS9A 2AXLA 4L0YB 2QLZA 3EQLF 1CF7A 2K02A 1SFEA 2JRTA 3CTAA 5L3FA 3MWMA 4KN7X 2Z9OA 4IVNA 2BGCA 1KA8A 2V1DA 2IJLA 2YX4A 3W6KB 2K7LA 2XAGA 3RKXA 1K7AA 1V4RA 3KE2A 1TQPA 2HQNA 4HLXA 1B1BA 4KFCA 5ERIA 3KP3A 1O7FA 2CWEA 5DV5A 3KP6A 1KU3A 5DUKA 1K78B 2PI0A 4ZZLA 5DCMA 3ROUA 5L3BA 3BPXA 3P9CA 4LGWA 2GA2A 2GAUA 1XDSA 1MJ9A 4MQVA 4U0WA 4A0YA 2M5WA 1Z1DA 2X4HA 2ZMEB 2YSRA 4UV8A 1IW7F 4BH9A 3RKYA 1I6XA 2XV4S 1W4MA 2J5OA 2CGPA 1J9IA 5DUIA 1ZRDA 1OKRA 2CQKA 4A5MA 3ZMTA 1TQMA 4ASNA 1Z9CA 2M45A 3W6JB 2P7CB 3DPTA 1RUOA 2NNYA 2P5LC 2ZKZA 5K5OA 1O3QA 3FZVA 3ZN0A 5D8LB 3J81Z 1S7AA 5HS8A 2JPCA 4ZYGA 5D8KB 3GFIA 3MZHA 2XAHA 5K5QA 2RKHA 4FHTA 1AOYA 3U2RA 1Z91A 1BJAA 2DTRA 2J5PA 5LBQA 4ZH4F 1HXDA 3FF5A 1BI3A 2IW5A 4GXOA 5FFXA 3P7NA 3I4PA 2BE5F 5D6EA 1U5TB 1ULYA 4CDGA 1IXRC 5JHUA 2LSOA 5DD8A 1RZ4A 2HKXA 5F1RA 2RVCA 1USTA 4IHSA 1ZH5A 2D45A 3Q5FA 2XUBA 1AWCA 4M9ZA 2A61A 3ZMZA 3DV8A 2PEXA 3REOA 1S7OA 3BWGA 2LKPA 4IRIA 1R7JA 2Y0MA 3E5UA 3G73A
chains in the Genus database with same CATH superfamily
1X1BA 2XVCA 4RGXA 3C3WA 4E7JA 1YW8A 3BG7A 3RKQA 1MBJA 2X6XA 3K0LA 1I1SA 4RGSA 2P4WA 2XAUA 2E7XA 1OISA 4G94A 3M7GA 1KGSA 4AIDA 5DCFA 2MD0A 5CQEA 1KU9A 1GVDA 4UHTA 1RPWA 2IVMA 2QUFA 2OA4A 1NTCA 2EFPA 3K69A 3HSRA 2F4MB 5CLSA 1Z6RA 4UXNA 3GLLA 2HR3A 1OCZH 2M1BA 4FCYA 3ASNH 2O61A 2FSWA 3H0DA 1K79A 2KIFA 3BTLA 1OYYA 3CJRB 2L0KA 2VXDA 5L3CA 2IGMA 4HF2A 5BQTA 4A3GJ 4RS8A 4GFBA 3H3VK 1QNTA 2I8DA 4EMSA 1XN7A 3SHFA 3CO6C 2VUMJ 4HV5A 1R4NB 3OR2C 2V1UA 3IAS2 3N97A 1IG7A 4I0AA 3VYTB 3OYLA 4BY1J 3I59B 1K61A 3V8LA 1QHHD 2HFHA 3H0GJ 2DK5A 3J7AO 3GTKJ 4PGHA 3FBNB 3M4OJ 2HVQA 5L3GA 2STTA 2K86A 2LC2A 4HLYA 4A3IJ 5CVRA 4IHTA 1HKSA 3ERMA 4XKBA 2O5RA 4RGRA 2LDUA 1QVTA 2EFNA 2IP2A 4XN0A 3VYRB 1YI2I 1IXCA 2QQ8A 3SEZA 4FISA 4RM3A 3HC7A 2BYVE 3GZ5A 1ACIA 5BPIA 1Z7UA 2ICWG 2B63J 1TBXA 1QBJA 3T1BA 5D4SA 3F8FA 1Y8QB 3MZ8A 3HDDA 2Q1ZB 5CPRB 3BR5A 4A3JJ 3F8CA 1UHMA 1D0ZA 2DT6A 1IRZA 3ISPA 4KN4X 2XAJA 4MFDA 2M7BA 1G3SA 1BBYA 4HAMA 5CVUA 4B1RA 2M8GX 4A3KJ 4CHUA 2GA1A 1DDNA 1TC3C 2CYYA 3FXMA 4OINF 3C2BA 2KQRA 4PGGA 2VOOA 4GYGA 3TL4X 5HDNA 4A3BJ 3TOBA 5IY5H 3LFUA 1K4SA 1WH7A 1NK3P 1S7EA 2CFOA 1ZLJA 2WBMA 2M9HA 4O5VA 4A3CJ 1A5JA 2IS4A 2MFZA 1Y8RB 3BG3A 5TJJA 5LD2C 3PNYA 4IEJA 5KAFC 5ICCA 4FE7A 2CFXA 3P5JA 3I58A 5KCMA 3JSOA 1MH4A 3I9V2 1FOWA 4C3IJ 3GEZA 4UY8I 3CLQA 3MN2A 1C0WA 1SFUA 2RQQA 4LJZF 4N9HA 5KNLA 5A2QZ 4D7MA 1SEUA 1ZARA 4F52A 2GBYA 2WAEA 5B3SH 1W5SA 2YU3A 3IUOA 3ZMDA 3HPHA 1LPQA 3DEUA 1PP7U 1HC8A 4PJJA 2Q2EB 2MD5A 3WTVC 2H8WA 1H88C 2PJPA 3S2DJ 5AIPA 5LHIA 3Q3SA 1WVRA 2H6CA 3M1CA 2FQ3A 1E3PA 2XPVA 2KIUA 3FIWA 2AXTC 1XSXA 4DBRA 2IGNA 3E5XA 5FLVA 1RESA 1ETWA 4BHPA 4QLCU 3KEQA 3WG9A 4D5CA 2VKEA 3OIPA 1P4WA 1K6OA 2E1OA 1W0TA 2X6OA 3R0JA 3E6DA 1J2XA 4FTHA 2GM4A 4OIQF 3FXOA 2G7UA 3PNVA 1ENHA 3CQZJ 2FBIA 2FQ4A 2HXOA 3GZ6A 2TCTA 3DWLE 3ABUA 2BY1A 3DPLC 1AU7A 2W84A 1KQ8A 3ELKA 5IPAA 4ZYAA 3SZGA 1R58A 5DM6F 4D7NA 4HF1A 1R1TA 2DYRH 3AL0B 2MGQA 2KRCA 2DI3A 2K85A 4I7HA 5EZGA 5L3DA 3S32A 4A3LJ 4U0YA 4L9JA 1JUMA 4B47A 2AS5F 4BQNA 3HPGA 1XDUA 3O3KA 2ID6A 1K83J 3L2CA 2PX9A 3ML6A 1BOAA 2CUZA 2VB6A 2F2EA 1OYIA 4EM0B 2F5VA 4RGUA 1FX7A 1DP3A 1U2WA 1H8AC 1UELB 2GXGA 2QSHX 4F92B 3E6BA 4IPAA 1FPQA 1TZLA 5EEGA 3PO2J 2PMHA 3WE3A 4E4HA 4B44A 3SZTA 2LKSA 2EIKH 2ZJ2A 2Y48A 5FKNA 3DBHB 2DQLA 2GZWA 2XF5A 1W0UA 3HKZN 2ZO4A 3BR6A 2E71A 3MEXA 3QOPA 4H4KC 4Q47A 2F4OB 2XC7A 5CKTA 1J7KA 1A6IA 4KDPA 3GTGJ 1DQUA 3K4JA 2CSOA 1KYWA 1RKTA 5IOYA 3RKWA 1H0MA 4RAZA 3WTYC 2UUZA 2QQAA 1WJAA 1D8JA 3MVPA 4BYYA 2QA4I 4KUMA 2FJ1A 3L09A 2ME6A 4RMNA 4NC8A 2R7QA 2Z33A 2E2IJ 1T95A 3CMEI 4CCNA 1ZREA 3K4BA 5D5XB 1UMQA 1SD4A 3BG5A 3AG3H 1LE8B 2ZB9A 3ABLH 1WCMJ 3KP7A 3KYCB 3PQJA 2JT1A 4JX6A 3I4NJ 3LSHA 2HU9A 2HQRA 5J4VA 3HL2A 3EETA 1OYWA 2EJRA 3TP0A 1E3OC 4OAYA 4BNCA 3HYIA 2OQRA 1BN5A 4B3AA 3NRVA 2Y0SN 1FYKA 2QF7A 4W97A 3GTLJ 4CYDA 2P81A 3OYNA 4U87A 4R1HA 2MW8A 3FXQA 3M8EA 1V54H 4PFPA 2DPUA 5LFAA 3LSMA 1ZELA 3JAMZ 4RB1A 2O6GE 1ETOA 2L3DA 5DDGA 1JE8A 4CYCA 3COAC 4C2TA 4DZJA 2X6YA 4OIPF 2NS7A 2LP0A 4L5IA 3HOSA 1X3ZB 1HW2A 2ELJA 3CP2A 1W36C 1WHUA 2X6WA 4BACA 1BIBA 4Y13A 5TRDA 1S72I 4CCLA 4HYEA 3IAM2 3ZMUA 3N4MA 4NBQA 2V4JC 2B9SA 4KIGA 4ZYEA 2K9QA 4BXFA 4AVZA 1ZGAA 4LK1F 2V1XA 1MBHA 3GFMA 4M74A 3LSJA 3CUQA 5IT3A 5LEJA 2VKDA 1O3SA 2WB1A 2KKOA 1B72A 5LGTA 5J6XA 3SEQA 2HPIA 1TP4A 4R8HA 4L9TA 3DU6A 2V7FA 1UAAA 2V9KA 3A0BC 4XL9A 3VDXA 3K2ZA 5EG0B 2LMDA 1MKMA 4M3FA 1VQ4I 4B4CA 2JPBA 4JYKA 1KZHA 1IJWC 3CJNA 2GLOA 2CQNA 1APLC 3DEWA 3NQOA 3DTEA 4FQGA 2M4GA 2QZ8A 2ZNYA 3C18A 3FMSA 3LSGA 2QYOA 4Q4ZF 1NK2P 1N25A 4XK4A 3J80K 2FEZA 2ZXJA 2R7OA 2OD5A 4DYRA 5E18F 3S1QJ 2X1CA 4JX4A 4DNCA 2R7UA 2O0YA 1SD7A 2L2OA 4BEHA 3H1CA 2OAZA 2JMWA 4KIFA 1GV2A 4ABZA 3E7LA 4YG2F 4CCOA 1F1ZA 3HJEA 1FC3A 1YX5A 3KLOA 2V9VA 3IH4A 4HA8A 4RAGA 2PMZA 4HNTA 4ZTJA 3FWEA 2O03A 2Q0OA 1RRJA 3DCFA 3HUGA 1YIJI 4HOBA 1SAUA 3HSFA 1V5FA 4A93J 4PDKA 1I50J 1P92A 2W85A 1UB9A 3FKIJ 1R5HA 3HRTA 4O3MA 2RV8A 4M9XA 2A69F 5ILVA 4E7HA 3QYBA 3V8JA 3CC2I 3ABKH 3DKYA 3CMAI 3S1RJ 4BDYA 3Q9VA 4P1WA 4U88A 3WTTC 2CV2A 1OLTA 5FROA 3GLXA 2F5CA 2WY8Q 4G7HF 5TGTA 2KZVA 2ZXWH 2FF4A 4PJNA 2H1LA 4BDZA 5C3EJ 5HLGA 4B8XA 2EBIA 1P4XA 2DCEA 3JRAA 1JHFA 4D5FA 2JSPA 3PFIA 1L3LA 3OSGA 2KIMA 2CRGA 1XGSA 4KJZA 2QBYB 1T56A 1RUNA 2R3SA 4LG0A 4RM2A 2O8KA 1P7JA 3E6MA 1GHCA 1OQYA 4IQJA 2IRFG 2QSGX 2RN7A 4CSWA 3CCUI 4UV9A 1F5TA 2VT2A 1JJ8C 2KHMA 3RTRA 1TWGJ 1BIAA 3HOTA 1O3RA 1YS6A 5CVIA 4XICA 2F6CA 3KEOA 3IH2A 4DQ2A 2MABA 2R7VA 1IN7A 1IO2A 5K7ZA 1E3HA 4IF4A 1IN6A 1ZG3A 3I54A 1Y1WJ 2XAQA 2R0QC 2OQGA 3E0JB 1GXPA 5FLXK 2HZTA 1U0JA 3QPHA 3HXLA 3CJQB 4FE4A 4HW0A 4L18B 2OJED 5EJCA 3WU1B 3GFLA 1G2HA 1UFMA 2DMQA 4MQ9F 5HDKA 1WI3A 3FM3A 2ZXHA 1TNSA 4AM3A 1MMDA 2Y75A 1YHQI 2BEOA 1YQAA 2MBFA 4ENKA 4YIFA 2ZJQF 1YW9A 1SFXA 3MZYA 2R5ZA 4I2OA 1LEAA 3F72A 3BCBA 2QSFX 2YR2A 3IL2A 3FM5A 5FO5A 4XOPA 1ZRFA 3CF5F 2XGXA 3OYMA 3FXKA 2P5VA 3NARA 1TL8A 1GT0C 1IN4A 1EH7A 3OWTA 3PNTA 5LHHA 1STZA 3QP5A 1BOBA 1IZ1A 1CF7B 4UUVA 1FYMA 5ED4A 1X1AA 3LSIA 3ZOBA 2E34A 4BAYA 4F3QA 2V1NA 3F22A 4XMYA 2ZC2A 1O4XA 3P9IA 1F4KA 2B0LA 2LY9A 3GBGA 2H8RA 2JQ7A 1R5ID 3WU0A 2OU2A 2FE3A 1KYZA 4LLGF 2HOSA 2BXZA 1FNNA 2CW7A 2DT5A 1YITI 2X1DA 4WWCA 5KHDA 1XCVA 5JFRA 2VBXA 2VC0A 3RCOA 3ECOA 1B9MA 3LQQA 2MYSA 3BJOA 2E1CA 3ZN1A 2EZHA 3G2BA 3PQKA 4PFOA 1IV8A 3C2HA 5EEHA 3E6CC 5D6FA 4P5OA 4MGRA 1VNDA 2R7DA 2G7HA 3TDUC 4G9YA 1FBUA 3FX3A 4F7ZA 5B1BH 2QEXI 3EUAA 2K4BA 2LRDA 1YTYA 1R5GA 1QU3A 3RPUA 5DCMB 1O57A 3TP3A 2VQHA 1ZG1A 4L9NA 4HX4A 1R1VA 4XIDA 4IRGA 2DU9A 4I0BA 1SMYF 1QQIA 3HTUA 3KZZA 4C30A 4XLHA 2VONA 3BG9A 4RA2A 3TO7A 2BVLA 2PG4A 4KT5C 1HSJA 3ERED 3E97A 5E3OA 4E7SA 5F1JA 1MDMA 3H3UA 2R93J 2DBBA 2P0WA 1UG0A 1KU7A 2LVSA 5GAGJ 3CUQC 3HB9A 4HV6A 3IRQA 5DS9A 3V7SA 5J8CA 1R6RA 3L00A 4L5JA 2UV1A 1A31A 3A01A 2XRLA 1QVUA 4EVIA 2K9MA 2KDZA 3ZPLA 2BOLA 3I0TA 1Y0NA 1XB4A 1BC7C 1R23A 3UKGA 3S2WA 5HLIA 4ENMA 3GTOJ 1A04A 2HGCA 1N77A 3CCVI 2A3SA 3TW7A 4CZCA 1XSDA 1LUJB 4ENJA 4AU7A 4XKCA 2EWNA 3CCMI 2UXXA 2KT0A 1I27A 1T08B 4Z2YA 3TGNA 3QPLA 2K3PA 3GTQJ 2LY2A 1BR2A 4Y7NJ 4XRMA 2DMNA 4QWQA 3K70C 2K9SA 2XSDC 3K4MA 1TTYA 3OR1C 4NB5A 1Y39A 3IKVA 4AD9A 5E8IA 2R7ZJ 5LGUA 3G6EI 2MA3A 2XROA 5B5EC 1D1BA 3BOQA 3FXLA 1N75A 2HI3A 3G3ZA 4RB0A 4IHYA 3K1MA 4XNFA 1D1CA 2DTZA 4HPQA 1LNWA 1H89C 3CC4I 3U9GA 2WWYA 1T38A 2XF7A 3CJTB 5HS7A 2LG4A 2HEOA 1QZZA 1WPKA 4AIKA 2VODA 4IQ4A 3CF2A 3DKXA 3TEDA 1OCCH 1SVLA 2K9NA 3KZYA 3PSFA 3TDZC 2HKOA 1DU6A 3DTKA 4BU2A 1Z7LA 2K9LA 3DBRB 1YX3A 2MLGA 2VASA 3MKLA 3D5RC 1DGRM 4CZZA 2M0CA 2VE9A 3HM5A 3CDLA 2RGVA 4PJLA 3DBLB 3KPHA 2STWA 3O6BB 4L9VA 1X1PA 1MSEC 1HW1A 5FKMA 3MCZA 4S05A 1LFUP 1PVEA 2DK8A 1R9TJ 1U78A 3H5NA 1TW3A 5DEQA 5IP9J 1NG6A 3VB2A 1V55H 1YLFA 1VQMI 3HEFA 2HWVA 4BUPA 1D8KA 1MMAA 2UXNA 1MJBA 2P6TA 3PJRA 1EF4A 3Q0VA 2V6EA 1V5GA 1RIOH 3G1OA 1RKWA 4V19K 3B73A 2FMYA 3GZNB 2DW4A 3CP8A 1ZGJA 2COMA 3MKYB 3M07A 1V3FA 1FBSA 1ORKA 4AIHA 3TOAA 2VPRA 1Y56A 3DU5A 4DYQA 2L7KA 1JTYA 1YIOA 2TDXA 1MBEA 1JKRC 2E1MC 5FRNA 1KU2A 3ZMVA 3D5LA 1YRNA 3SJMA 4NNJA 5KK1A 1Z21A 4BXXJ 4D1QA 4GYIA 1FLIA 3LSKA 2L9SA 1W5CC 4GO1A 2ZSHB 2NVTJ 1TW2A 1IGNA 4II3A 4AYBA 1BI0A 2Y9ZA 4L0ZB 1LDDA 1ZN2A 4EGZA 4ZJZA 2DMTA 3JW4A 4KYWA 4EV0A 4O6JA 1XCBA 1NG7A 3LA3A 3AG1H 1Z3XA 5BNGA 2B7EA 3CLOA 3QPSA 1FWZA 5B1AH 1B4AA 1VFCA 1S3JA 2VKHA 3PSIA 1G8XA 2QQBA 1W7PA 4XSZF 2QENA 2M2EA 2WC2A 2QWWA 4G7ZF 2FU4A 2LREA 3WE2A 3GVAA 3BROA 2A6HF 2FNAA 2CQQA 4G6DA 2CMPA 2NNNA 3OIQA 1YJNI 2EZLA 1I1GA 2BXYA 3LSRA 5D4RA 2GOXB 1KQ9A 4RAYA 2BW3A 2HQ5A 2DDAA 3FHNA 5IP6A 2ZMEC 1JKQC 1XGOA 2OF7A 2DOEA 2Y31A 3BTIA 1P7IA 2K3FA 3TMOA 2IPQX 2YS9A 1BM9A 4M3BA 2DMPA 1MMGA 2EIJH 2XPUA 1MH3A 3WTUC 1HA8A 3GTPJ 3GUDA 2VE8A 2MSYA 3K70D 2IEKA 1IRGA 3TBIA 4OMZA 3LWFA 1MD0A 2HTSA 3NEUA 2NVYJ 2JZYA 1LEBA 2MC3A 3DQVC 4WXCA 2XKPA 2YX7A 5E1ZB 2EFOA 4LLLA 2F5FA 4IHWA 3F0CA 1D0XA 3HHHA 3OV8A 1FOYA 2L9RA 2HPMA 2VQGA 2WAFA 3JRBA 2JUCA 1R49A 2BVMA 4PCQA 5GTIC 5F27A 2WB1N 4M3GA 4YFNF 1NH3A 1G3TA 2W57A 3E3VA 1ON2A 3ABMH 2HOTA 2Y9YA 2KJCA 2GQQA 2ECBA 1YJWI 2G0EA 2L4MA 2OTJI 3RI4A 3OL4A 2DMUA 1A36A 4C3HJ 4RDUA 1WKMA 4UVCA 3FK6A 4FX0A 4YELA 2GOMA 3IWZA 2XKOA 1IC8A 3H5AA 1MBGA 3JCUC 5D5VB 2ISYA 1LVAA 2MH2A 2HNHA 1J75A 1IF1A 1REPC 2UWMA 4Y52J 1WJBA 1U5TC 4RLQA 1HOMA 3GXOA 2FD5A 4K2EA 3GFJA 4PSXA 3TQNA 4S04A 4RB2C 5DM7F 4RB3C 3K9TA 3CCYA 1FMVA 2IBDA 1S29A 2A6EF 3MKZA 5FKOA 1EH8A 3ONQA 5M3FJ 1MIJA 2PQ8A 2L01A 1ONVA 5LHGA 4DOZA 3ZQLA 5IYDJ 3DEEA 4QSHA 2DODA 2F5EA 4DJAA 2PMZN 2FA5A 3LAPA 1G4DA 2VLAA 3OSFA 3PIOF 2IS2A 1BJZA 3A4CA 3OOPA 1Z77A 4LIUA 1X19A 2XB0X 3LA7A 4HZFA 2HDDA 4C2MJ 2Q8KA 4LB6B 3D0SA 2JWTA 2XB5A 4XM3A 3VYUB 2CUEA 2CV0A 2LFBA 4U0VA 1SANA 3RJPA 4JK1X 4F93B 1VQ7I 3GX4X 1LB2A 1BA5A 4M73A 4E7KA 1X4PA 4KIBA 3IH3A 2JUGA 4IL6C 2RNJA 1WI9A 2BHZA 3PUFA 3L1PA 1Z67A 3TKYA 4XQFA 1PP8F 3MAJA 4KT6A 2OBPA 4P9FA 2Z5UA 3G71I 4E6KG 1E0EA 2LH9A 3O8HA 2DA6A 3BJAA 3WTWC 3EPZA 2GIZA 3S8PA 5CJ9A 2Z2SB 2FBHA 4NC7A 1D3YA 3DKWA 3KEYA 5HODA 1FEXA 5GPCA 2A5YB 1K4TA 3WGHA 5IP7J 2R7RA 3X2QH 4BS9A 3BT9A 2LNBA 1XPXA 3A0HC 1Y1VJ 1BC8C 5EZHA 2KLOA 4P55A 2ACJA 2K5CA 4IOCF 2BBYA 5E3MA 1B8IA 1RI7A 4XLPF 3CCRI 1HSTA 4MHGA 3RZOJ 1MGTA 1OFCX 9ANTA 1MMSA 2GXAA 1FTZA 3T8RA 3VFZA 4F55A 2CUJA 3BTCA 1VQKI 3KP2A 3E1SA 2OZ6A 2NOGA 2DFIA 3BG6A 2W24A 5CYVA 2XGEA 1VQPI 4HBLA 5ILSA 3J81K 1ZK8A 5FRMA 4HQEA 1OR7A 4XRSG 5H6QA 2JRMA 1ZTRA 4A0ZA 3C7JA 2EV6A 2F4IA 3RPQA 1BR4A 1DPRA 2MC4A 3MMYB 5BMZA 3QU6A 4I09A 2K27A 3J7AY 1JTXA 4LLNA 1J0RA 2NVUB 1POGA 1Z3YA 4L5EA 4A69C 2ECCA 3JRHA 2KFDA 1T2KA 3V7CA 2PBIA 4XRSA 5M5XJ 1PUFA 1VQ8I 3BR1A 4CYCB 2OCEA 1JUPA 1MZBA 3E5QA 4M9SA 1R22A 4LMYA 3KETA 1IV6A 1MNDA 1MW7A 1CQTA 3RPUD 3K7AJ 3H36A 2D1VA 1YFHA 3HGGA 3HOWJ 3IP4B 3JTHA 5HLHA 2RC4A 4A5NA 2KJBA 1ZYRF 1O7LA 2PLYA 5GP9A 1JGSA 4A3EJ 3IV5A 1GLNA 3RYPA 3BR2A 4XLAA 1PYVA 2HXIA 4A6DA 4IJAA 4XN3A 3W2AA 1SD5A 2VQLA 3CUQB 5FB2A 1B72B 1IXSB 3FMRA 3HHGA 2JA8J 3L7WA 4BBRJ 2O8XA 2FOWA 4KMFA 3F8BA 5FFZA 1NHAA 4G7OF 3L2QA 2D5VA 4UUSA 2W48A 3JSPA 2ZFUA 4ZZDA 2DFFA 2H94A 1B6AA 1T98A 2EH3A 1ZKGA 2O9LA 1YYVA 2HTJA 2HVSA 2R7SA 4G6QA 1BI2A 2DJIA 1F36A 1FSEA 1JUSA 2KRFA 4EEFG 1GDTA 4NQWA 2M87A 2OZUA 4IOAF 1OMIA 5HDGA 4C2UA 4UVAA 2X9DA 3GTJJ 2FX0A 4BY7J 2BHYA 2YUSA 1YOVB 2EINH 1IUFA 2F48A 4XSXF 4EJOA 2H09A 2NS8A 3T0YA 1OCPA 3BQYA 4BEHB 1WGXA 4JBAA 4LOCA 4ITVA 3HOVJ 1H9TA 4I76A 5LRRA 2M8EA 4DBQA 2CJJA 4EJVA 3IKTA 4HDUA 1GUUA 3C2GA 1SFOJ 2ZNZA 3PO3J 5K7FA 5E1WA 3FBIB 2P5KA 1MNEA 1X2MA 4WXHA 4MTEA 5H2FC 2HQAA 1PJRA 2QCOA 3KFWX 1JKPC 3HUGB 3ECHA 3W2VA 2LBFA 3ZQIA 3IWFA 3PL8A 5BOXA 3HOYJ 4EJUA 2DLLA 1JXSA 1ZR4A 1P4AA 2ELHA 1ZLKA 2EPFA 3F6VA 3KP4A 3AL0C 2A05A 2HS5A 2AO9A 1Y6IA 4A3DJ 4KICA 4BHCA 4Y17A 2ELKA 5EGOA 3H9GA 3K1PA 4ZYHA 1LQ1A 2RNGA 2IAIA 1HCRA 3CMYA 4KITB 1QHGA 4ZYDA 4XLNF 3QQAA 2VT3A 2O3FA 3I64A 1WZ2A 2NRAC 2Y30A 3QAHA 3BTJA 1W36D 4EM2A 3HOXJ 3SDGA 3K4LA 3EUKL 2NVXJ 4Y3OA 3HIFA 4MO7A 4C3JJ 2XGDA 4LFUA 3PM1A 1G3YA 3TO6A 4E7IA 3QWLA 3O2PE 2EFQA 3S1NJ 6PAXA 2CG4A 1UHSA 3SQNA 5BPDA 1R36A 2M34A 5M3MJ 5K1YA 5L3EA 1WRJA 2F5DA 3T5XA 4ZDPA 1DUXC 1VQLI 4YEJA 1VQOI 1K78A 3BP8A 4Y4RA 4LG0B 2E7WA 1G6NA 3BC8A 5LLQA 4TV7A 3GCMA 3H9QA 2E2HJ 4I02A 4CICA 2PMUA 1R4MB 1KONA 1JGGA 1HW5A 2R7FA 1XG1A 1RR7A 2E1MB 4HDVA 2EA2A 1FOKA 1XMAA 2Y2ZA 2P7VB 2ADUA 2ZMEA 5H6RA 4ANJA 5IT9K 4M71A 2ZSIB 3V8KA 3L2VA 1X3UA 3RYRA 4D0PA 2PN6A 2P6SA 2JJ7A 1TWCJ 1MNMC 3BJ6A 3ASOH 5GTHC 1U3EM 4CXFA 4YFKF 2DA5A 2R5YA 2XDVA 4MNUA 3KYLA 2JA6J 3AG4H 1ZR2A 4JOMA 4CUGA 4GGGA 1S9HA 2EZKA 1SAXA 4KNYA 4I6ZA 3SFIA 3VSLA 2XASA 4XORA 2OC6A 3DFGA 3IHUA 3R61A 4A3MJ 5HVQC 1IAWA 1VZ0A 2JVHA 5A2QK 5KAIC 1W7PD 3M8FA 1DU0A 2R7TA 4ESFA 2FOKA 4DYCA 3OYGA 1W5TA 4M72A 4QIWN 5EF6A 3WTSC 2R5ZB 1Y0UA 3OYFA 2DYSH 2FMLA 4A6EA 1JJ6C 4AWXB 3FKJA 2XGCA 2V9PA 3CUOA 2FRHA 4N4NB 1XMKA 5IYBJ 2R4GA 4J19A 4LD5A 2VOPA 3OYAA 1WFXA 4CA0A 1BL0A 1SFKA 2BY0A 2XF6A 5FJ8J 3BZ6A 1PDNC 1U5TA 1ERDA 2ME0A 3PIPF 1ZQ3P 1BI1A 1DPUA 1YE9A 2XHKA 5EYRA 2VL8A 1KQ0A 5CQGA 4AYBN 1O3TA 1ON1A 2BV6A 2IXSA 3HG9A 2R7WA 3OOUA 2WA0A 4LITA 3WODF 5J8FA 3WU2C 4BE2A 1P2FA 3F6OA 2C6YA 5ILUA 1OR7C 1WJDA 4IRHA 2ZJPF 5M5WJ 4HX7A 4E7LA 2EB7A 2XSJC 3ZRGA 4Q5SF 5LRSA 3J7YJ 2D1HA 4XLCA 4RAFA 2NYXA 2Z99A 5BS6A 3OL3A 5ICEA 1S8NA 5JHFA 2VJJA 1AKHA 3IRRA 3SXYA 1FSHA 5K5RA 1TQIA 2CW8A 4JQFA 1X1CA 4HQMA 4FT8A 5DD4A 5E1XA 1ZAOA 3GF2A 1QPIA 2NAZA 2ZJRF 3T8TA 5FKKA 4B3XA 3ABTA 1E2XA 1LJ9A 5J1YA 4DZPA 5C4JJ 2K4JA 2AHQA 2M30A 4UB8C 2EV5A 2DO7A 1FIPA 3CDHA 1QRYA 3ZQQA 5JI6A 2E35A 1AHDP 3FXJA 3J80Z 1QGPA 3CCLI 3U1DA 4BL0B 4CCKA 2CUFA 2COBA 3R60A 4BE1A 5D5UB 2IS6A 1G3WA 5H20A 1MDMB 2HDCA 4B48A 2Z3YA 3FMQA 3LAJA 3HTSB 1AA7A 4KMUX 4C9YA 1QO0D 2DFHA 1T0FA 2NOJB 4IXAA 2L9VA 1U8RA 3HOZJ 1XC5A 1ETQA 1XSVA 2ZXIA 2EFWA 3S3OA 1JI8A 2FUG2 4UNOA 1D1AA 2L4AA 1SVOA 2VXZA 3I53A 3A01B 1XMXA 4OAZA 2WV1A 4OU0A 3I5UA 3NWTA 1LDKB 4A2UA 1AKHB 1RR8C 1U6GA 1QZYA 4MLOA 3VSKA 1XS9A 4KISA 2LK2A 4HSTA 3WTXC 3GYHX 1FOXA 1HBXG 2EIMH 4IKFA 1U9OA 3WG7H 1WQ2A 1WWXA 1UHWA 2E5ZA 3L9FA 3I59A 4XR6A 3TW6A 2FNPA 1X4OA 2LF8A 2AQFA 3DLAA 2M7AA 3I71A 3H5RA 2ZBKA 4MIMA 2DN0A 1XD7A 1B59A 4BJ6C 1QPMA 2BY2A 2DJNA 2R7XA 1PUEE 3JAMK 3EUHA 4QPQA 3FK7A 1FZPB 2LLKA 3K4KA 2VBYA 2W4SA 2QKMB 1Q1VA 1T39A 4EJWA 3V42A 4J01A 3D1NI 3J7ZI 3JREA 4CCJA 1RNLA 3MQ0A 4OWRB 4YFXF 2KMUA 2JA5J 2P8TA 3ZQHA 2KDOA 3BPVA 1XGMA 2HOAA 2DPDA 2KL4A 3WGGA 5GADJ 3H3ZA 3G4SI 5JVGF 3I3LA 4DW6A 3CO7C 2W00A 5CVVA 3Q9SA 4JP0A 4II2A 1S6LA 2HOEA 3OS2A 1JT6A 3HGYA 2L5QA 3R6SA 3GMEA 3R4KA 2GWRA 2LOOA 1HQCA 2G9WA 2YPRA 2HYFA 4U7BA 3KCCA 3G1LA 3K2AA 1ETVA 4XKWA 5M5YJ 4F91B 3CMMA 3B02A 2OTLI 3SZPA 3V4GA 4ESJA 5FD5A 1CGPA 3DPUA 3BZKA 2E36A 5CVJA 2CO5A 3AFHA 3H92A 2EILH 2JTVA 3M1EA 2XAFA 3OY9A 4X1EA 3PFYA 3VEPA 1YO5C 2QM3A 1UJ8A 3EYIA 1YW7A 1OJLA 5FLXZ 3ZQCA 2R92J 3GW2A 3I56I 1QZEA 2NS0A 5LEKA 5E8GA 3I4MJ 3DF8A 3F3XA 3I55I 1IDYA 1V5EA 3LQRA 1GXQA 2GXBA 2A5WA 4LB5A 5IYCJ 4IHVA 5JLWA 4HRIA 3QP6A 4ESBA 1LKXA 3JRIA 1MBFA 4OMYA 1IN8A 3ZQ7A 2OUMA 2DOAA 4ENNA 1N78A 1X2NA 1YRNB 1I39A 3BQZA 3L2UA 2W82A 4Q48A 2Q2EA 1TWAJ 5E20A 4WXDA 5IT9Z 2JA2A 3A2KA 1FBQA 3VYSB 5C44J 3OIOA 3S3MA 4A0XA 3BLYA 2MH9A 2OV7A 1FTTA 4WK8F 5KVRA 1VQ9I 2IA0A 4HF0A 4E70A 4D9JA 1I3QJ 2ZFWA 4BJTA 2RQPA 2KPMA 3NAUA 2HYJA 1VQNI 3R0AA 1WJFA 4N9IA 4EM1A 3FHZA 2RDPA 4XLFA 3OYKA 3HRUA 3S3NA 1W7PB 4CH7A 4EGYA 2X1EA 4I98B 4PK4A 1EA3A 4ON0A 2JK3A 2LYCA 1J5YA 2V26A 3FISA 3M8JA 1HLVA 2EK5A 2EV0A 1J59A 3LFKA 3H35A 2DAOA 2YU9J 3DP7A 2VI6A 1Z6TA 4WX9A 3C1DA 3F8NA 1OCRH 1W1WE 4I01A 5ICFA 4H0EA 5DYMA 2BW3B 3CC7I 4BHBA 2MG4A 1D5YA 4W1UA 1M1EB 3LL7A 4P9UA 5FLMJ 5F0CA 2KIQA 1SMTA 1LDJA 3BDDA 2H6BA 2V6CA 3BCAA 4XLEA 5F08A 2JSCA 3F21A 1FYLA 1F9NA 2VJ5A 4IZZA 3Q0WA 2QQ9A 3CD6I 2XRNA 1B9NA 1U9NA 2A68F 2I5UA 3FDYA 1I5ZA 5F64A 1BW6A 2W7NA 2WV0A 1IDZA 3V7RA 4XRFA 2OCCH 2VJIA 4U7DA 1JHHA 1IRFA 3BY6A 2XPWA 1YG2A 3BR0A 4ETSA 3W6VA 2DA4A 4BBSJ 3FXRA 4GCVA 4FX4A 5E17F 1A35A 4A12A 5J40A 2DDBA 1IRXA 2DA2A 4YIIA 4HG2A 4Z6YA 4GDFA 2DA7A 5IOZA 4G6TB 2X0LA 2X85A 4MEYF 2OPTA 3M3YJ 3VOEA 2VQCA 4PZJA 3UR3C 4XBFA 3F23A 1SD6A 1TT0A 3CESA 4BJ5C 3KZIC 4UB6C 3F9KA 5FD6A 1LE8A 3EYYA 3S93A 3K4CA 4CO8A 5B66C 5ICGA 3U21A 2VN2A 2N8GA 4EQQA 3OS0A 2CQ7A 5E3LA 2A07F 1GV5A 4OIOF 2V79A 1UCRA 5FKLA 1ZRCA 1ITYA 2ZCWA 1ODDA 2EA4A 3K1NA 1ZGWA 2L7MP 4LIVA 4X0GA 1T8IA 3HRMA 4HNUA 1R1UA 4G8XA 1T33A 1FMWA 4P96A 2HYGD 3CCJI 4EJTA 2GIVA 3QODA 4LK0F 1T0FC 2E60A 3S17J 1E17A 1TWHJ 5EDNA 3ZR8X 2W1OA 3JTGA 2K40A 4X6AJ 3Q0UA 2EQRA 4V2FA 1OPCA 1X58A 4XOTA 2IT0A 3OMYA 1WH5A 2CU7A 4J00A 4AIJA 2UZKA 3AG2H 3DXJF 3ULQB 3HRSA 1FY7A 1P9QC 3B6AA 1YS7A 2QGUA 4NC6A 5JVTA 2HVRA 3OYCA 2D2WA 2VKVA 1UG2A 2ETHA 3EDPA 3KYDB 4YRVA 3D5SC 2BY3A 2CH0A 1HKTA 4LG3A 1Z05A 3VODA 4BKXA 5E79C 2IS1A 4AVPA 3HZJA 1ZHFA 1HDDC 4ZC3A 5EG0A 3OYHA 5AONA 1JT0A 3B6CA 1TLHB 2HDWA 1HKQA 1WJ5A 3EUHC 3IC7A 3QOEA 1IUYA 1DP7P 5C4XJ 2LR8A 1XTAA 3SFZA 1X1DA 2KRHA 4M6XA 4Y15A 1MJAA 1RC9A 2CS3A 2KP6A 3CCEI 5F0HA 3F8MA 3ZCOA 1HF0A 5JR3A 2VIXA 3L2RA 5EEAA 1EH6A 2IA1A 1R71A 3BR3A 2DA3A 1MSFC 4BE0A 2E2JJ 3K4NA 4N0BA 4NHJA 1B8IB 3U1KA 1LVKA 3S2HJ 1FP1D 3QRFF 3DTIA 3CZ6A 4RBOA 5AIQA 3OYJA 2DQRA 3AAFA 1TT5B 1FT9A 3HSEA 3M9AA 1K6YA 2IGKA 4M6YA 4BQOA 1P6RA 3ZQGA 2XIGA 2L02A 3OYBA 4CCMA 3A1YA 3LSTA 5TISC 2HZDA 1VTNC 4IO9F 3ZGKA 1ETXA 1EV7A 2ESNA 1TNTA 4UUTA 2NXNB 1H9GA 3H9JA 3SDBA 3RQIA 2KISA 2VBZA 2Z16A 1ZG5A 5GPAA 3OYIA 1FP2A 1IN5A 2H27A 2FXAA 2DFEA 1MBKA 5HNFA 3S15J 1XX5A 4N4OB 3TO9A 4B09A 5J4YA 3KLNA 3VWBA 1EJ9A 2NVQJ 2FBKA 2DXIA 1D5VA 4QTRA 1R00A 3WGIA 4MTDA 1PUFB 2LTPA 2LKXA 1FJLA 1UZCA 2I10A 3GO5A 4EATA 4V2GA 5FGMA 3ZMSA 2ISZA 2PFBA 2QBYA 2MLKA 4OIRF 3FXUA 4QPOA 3MKWB 1OCOH 5K7HA 5LGNA 4M6VA 4PJMA 3JRDA 1USSA 2WADA 2QVOA 4BQQA 1VQ6I 4AC0A 4CGZA 5F6FA 1YJ9I 4HX8A 3ZP5A 3HKZA 4BXUA 3LNQA 2L54A 3QU3A 1BW5A 1GVJA 2ESHA 2VBWA 3WHCA 3MFKA 3GWZA 2WTEA 2IGOA 4NUBA 4UUSB 3JRFA 1JKOC 2CW0F 4MEXF 1TWFJ 4ZTFA 3LA2A 2X48A 4R79A 3RSNA 4UVBA 3AKZA 4KA4A 3HOUJ 2IA2A 4NQWB 2M0MA 4WCGA 3JR9A 2VC1A 1XGNA 2X51A 4BQAA 3CCQI 2DOFA 2Z1DA 4PUSA 3QPTA 2Y0SA 4Y33A 2BZTA 4I99C 3WTZA 2W25A 4FASD 2TRTA 5D5WB 2EZIA 4RLFA 2E1NA 5HLTA 1WSUA 1Q1HA 4WF2A 3QYEA 4B43A 3RDIA 3RZDJ 4NDLA 3RQ4A 2LF7A 3P9KA 3PUBA 3CCSI 2RAEA 1T6SA 2O7OA 2LBFB 1L0OC 5GAEJ 3RIRA 1MMNA 4OOIA 5F0FA 4XONA 5HOOA 3KP5A 5HS9A 3W2WA 1QA6A 3W3CA 1D0YA 2AXLA 4L0YB 3HBLA 2QLZA 3DLLF 3EQLF 1CF7A 4HSRA 2K02A 1SFEA 1RETA 2JRTA 3CTAA 5L3FA 3MWMA 2H1KA 4KN7X 2Z9OA 4IVNA 3ZXSA 5EGOB 1J09A 2DT7B 1VI0A 2BGCA 1KA8A 2V1DA 1Z0XA 2IJLA 5J47A 2WAQN 2LY1A 2YX4A 3W6KB 2K7LA 1SVMA 3OS1A 2XAGA 3RKXA 1K7AA 1EKEA 1V4RA 5J1RA 3KE2A 1TQPA 4A3FJ 2HQNA 4HLXA 3NWSA 1B1BA 2DA1A 4JX5A 4KFCA 3UNGC 2AQEA 5ERIA 3KP3A 1O7FA 3N05A 2CWEA 5DV5A 4XKVA 1DGWY 3KP6A 2L9NA 2PJRA 1KU3A 1HDPA 5DUKA 1LFBA 1K78B 2PI0A 3JRGA 4ZZLA 1G59A 5DCMA 2KZGA 3ROUA 3BPXA 5L3BA 3P9CA 4LGWA 2GA2A 4PSWA 1VF9A 2GAUA 1XDSA 1MJ9A 4MQVA 3WHBA 4U0WA 4A0YA 2M5WA 3KIOA 1Z1DA 3CDIA 2JN6A 2X4HA 2ZMEB 3A02A 2YSRA 1F43A 2ID3A 4UV8A 1IW7F 4BH9A 3LMMA 3RKYA 1I6XA 2WY7Q 2XV4S 3S16J 4M3EA 1BR1A 1W4MA 5J3LA 4AUXA 2J5OA 2CGPA 4IHXA 2R5YB 1J9IA 5DUIA 4PJ0C 2L7ZA 1ZRDA 1OKRA 2CQKA 4A5MA 3ZMTA 3S14J 3QYFA 1TQMA 3JRCA 2M4KA 4ASNA 1Z9CA 5HNHA 2E5NA 2M45A 3W6JB 2P7CB 3DPTA 4S0HB 3OYDA 2NNYA 1RUOA 3S1MJ 2P5LC 2LD5A 2ZKZA 4YIRX 2PJRB 3ESWB 5K5OA 3BZCA 3FZVA 4DGWB 1O3QA 1VQ5I 3G1MA 3ZN0A 5D8LB 3J81Z 5E3NA 1S7AA 2M3AA 3O8GA 3VPRA 5HS8A 1WJEA 2VJ4A 5F04A 2JPCA 4ZYGA 1LFPA 5D8KB 1I3AA 3GFIA 3MZHA 2XAHA 5K5QA 2RKHA 4FHTA 4E7ZA 2E19A 4M3DA 4BGDA 1AOYA 3U2RA 1Z91A 1BJAA 1U8BA 1X3WB 2DTRA 2J5PA 1OCTC 5LBQA 2CV1A 1WJCA 4DIQA 5DTDA 5GAHJ 4ZH4F 1HXDA 3FF5A 2JVGA 1I6HJ 1BI3A 2IW5A 4GXOA 5FFXA 3P7NA 3I4PA 5J1UA 4G12A 2BE5F 3MD2A 5D6EA 1U5TB 1ULYA 4CDGA 1IXRC 4MFEA 5JHUA 2LSOA 1ETKA 3GTMJ 3SYTA 5DD8A 1RZ4A 3OYEA 2HKXA 4HEA2 3ZQFA 2RVCA 5F1RA 4IX7A 1USTA 4IHSA 2JA7J 3A03A 3LOCA 1ETYA 3LSPA 1ZH5A 2A6TA 2D45A 3Q5FA 2XUBA 3KX2A 1AWCA 1S5LC 1FIAA 4HNVA 5JLXA 2Y69H 4M9ZA 2A61A 1A6QA 3ZMZA 4GRIA 3DV8A 4ZDLA 2PEXA 2CQXA 1SC7A 3REOA 4FETA 1S7OA 2QKLB 3BWGA 2WAQA 2RREA 4ZDOA 2LKPA 3K10A 4IRIA 1R7JA 2Y0MA 3K6GA 3E5UA 3G73A 3L2WA 2L7FP 2VPLA
chains in the Genus database with same CATH topology
2XVCA 4RGXA 3C3WA 1YW8A 3K0LA 1I1SA 4RGSA 2P4WA 2E7XA 4G94A 3M7GA 1KGSA 5DCFA 1KU9A 4UHTA 2IVMA 2QUFA 2OA4A 2EFPA 3K69A 3HSRA 5CLSA 1Z6RA 4UXNA 2HR3A 2M1BA 2O61A 2FSWA 1K79A 2KIFA 1OYYA 5L3CA 4HF2A 5BQTA 4RS8A 1QNTA 4EMSA 3CO6C 1XN7A 3SHFA 4HV5A 2V1UA 3N97A 4I0AA 3I59B 3V8LA 2HFHA 2DK5A 3J7AO 4PGHA 5L3GA 2STTA 2K86A 4HLYA 5CVRA 4IHTA 1HKSA 4RGRA 2LDUA 2EFNA 2IP2A 1IXCA 2BYVE 3GZ5A 5BPIA 1Z7UA 1TBXA 1QBJA 3T1BA 5D4SA 3F8FA 3F8CA 1UHMA 3ISPA 4KN4X 2XAJA 1G3SA 1BBYA 4HAMA 5CVUA 4CHUA 2GA1A 1DDNA 2CYYA 4OINF 4PGGA 2VOOA 4GYGA 5HDNA 3TOBA 1ZLJA 4O5VA 5TJJA 5ICCA 2CFXA 3JSOA 3I58A 3GEZA 1C0WA 1SFUA 4LJZF 4N9HA 5A2QZ 1ZARA 1W5SA 2YU3A 3ZMDA 3DEUA 1PP7U 2MD5A 3WTVC 2PJPA 5AIPA 5LHIA 2H6CA 2FQ3A 2KIUA 1XSXA 3E5XA 4BHPA 4QLCU 3KEQA 3WG9A 1P4WA 1K6OA 3R0JA 3E6DA 1J2XA 4OIQF 2G7UA 2FBIA 3GZ6A 3ABUA 3DPLC 1KQ8A 2W84A 3ELKA 1R58A 4HF1A 1R1TA 2DI3A 4I7HA 5L3DA 4U0YA 4L9JA 2AS5F 1XDUA 3O3KA 3L2CA 3ML6A 1BOAA 2F2EA 1OYIA 4EM0B 4RGUA 1FX7A 1U2WA 2GXGA 3E6BA 4IPAA 1FPQA 5EEGA 2PMHA 3WE3A 3SZTA 2ZJ2A 2Y48A 2DQLA 2GZWA 3MEXA 2ZO4A 3QOPA 4Q47A 1J7KA 4KDPA 2CSOA 1KYWA 3RKWA 1H0MA 4RAZA 3WTYC 2QQAA 1D8JA 4BYYA 4KUMA 3L09A 2Z33A 1ZREA 5D5XB 1SD4A 3KP7A 3PQJA 2JT1A 2HQRA 3EETA 1OYWA 2EJRA 4BNCA 3HYIA 2OQRA 1BN5A 3NRVA 1FYKA 4CYDA 4R1HA 3FXQA 3M8EA 2DPUA 3JAMZ 4RB1A 2O6GE 2L3DA 5DDGA 1JE8A 3COAC 4OIPF 4L5IA 3HOSA 1HW2A 1BIBA 4Y13A 5TRDA 4HYEA 3N4MA 3ZMUA 4KIGA 4ZYEA 1ZGAA 4LK1F 2V1XA 4M74A 3GFMA 3CUQA 5IT3A 5LEJA 1O3SA 2KKOA 5LGTA 5J6XA 4R8HA 4L9TA 3K2ZA 1MKMA 2JPBA 3CJNA 3NQOA 2QZ8A 2ZNYA 3C18A 3FMSA 2QYOA 4Q4ZF 3J80K 2FEZA 2ZXJA 2OD5A 5E18F 4DNCA 2O0YA 1SD7A 2OAZA 4KIFA 4YG2F 1F1ZA 1FC3A 3KLOA 2V9VA 4HA8A 3FWEA 2O03A 2Q0OA 3HUGA 4HOBA 3HSFA 4PDKA 1P92A 2W85A 1UB9A 1R5HA 3HRTA 4O3MA 2RV8A 4M9XA 2A69F 5ILVA 3V8JA 3Q9VA 4U88A 3WTTC 3GLXA 2F5CA 4G7HF 2FF4A 5HLGA 4B8XA 1P4XA 1JHFA 3PFIA 1L3LA 2KIMA 1XGSA 2QBYB 1RUNA 2R3SA 4LG0A 3E6MA 1GHCA 2IRFG 2RN7A 4UV9A 1F5TA 2VT2A 3RTRA 1BIAA 3HOTA 1O3RA 1YS6A 5CVIA 3KEOA 4DQ2A 1IN7A 4IF4A 1IN6A 1ZG3A 3I54A 2XAQA 2OQGA 1GXPA 5FLXK 2HZTA 3QPHA 4HW0A 4L18B 3WU1B 3GFLA 1UFMA 4MQ9F 5HDKA 3FM3A 1TNSA 2Y75A 2BEOA 1YQAA 2MBFA 4ENKA 4YIFA 1YW9A 1SFXA 3MZYA 4I2OA 1LEAA 3F72A 2YR2A 3IL2A 3FM5A 5FO5A 1ZRFA 2XGXA 2P5VA 1IN4A 1EH7A 5LHHA 1STZA 3QP5A 1IZ1A 1CF7B 4UUVA 1FYMA 5ED4A 4BAYA 3F22A 1F4KA 3P9IA 2B0LA 3WU0A 2OU2A 2FE3A 1KYZA 4LLGF 1FNNA 2DT5A 4WWCA 1XCVA 5JFRA 2VBXA 2VC0A 3ECOA 1B9MA 3LQQA 3BJOA 2E1CA 3ZN1A 3PQKA 5EEHA 3E6CC 5D6FA 4P5OA 4MGRA 2R7DA 2G7HA 3TDUC 4G9YA 1FBUA 3FX3A 4F7ZA 2K4BA 1YTYA 1R5GA 3RPUA 5DCMB 1O57A 1ZG1A 4L9NA 4HX4A 1R1VA 4IRGA 2DU9A 4I0BA 1SMYF 1QQIA 3HTUA 3KZZA 2VONA 3TO7A 2PG4A 4KT5C 1HSJA 3ERED 3E97A 1MDMA 3H3UA 2DBBA 1KU7A 3CUQC 4HV6A 3IRQA 3V7SA 5J8CA 3L00A 4L5JA 4EVIA 3ZPLA 3I0TA 1XB4A 1BC7C 1R23A 3S2WA 5HLIA 4ENMA 1A04A 2HGCA 2A3SA 1XSDA 4ENJA 2EWNA 2UXXA 1I27A 4Z2YA 3TGNA 4QWQA 1TTYA 4NB5A 3IKVA 4AD9A 5E8IA 5LGUA 2MA3A 2XROA 3BOQA 4RB0A 3G3ZA 3K1MA 1LNWA 3U9GA 2WWYA 1T38A 5HS7A 2HEOA 1QZZA 4AIKA 2VODA 3KZYA 3TDZC 2HKOA 2MLGA 2VE9A 4CZZA 2RGVA 2STWA 3O6BB 4L9VA 1HW1A 3MCZA 4S05A 2DK8A 1U78A 1TW3A 5DEQA 3VB2A 1YLFA 2HWVA 1D8KA 2UXNA 1MJBA 2P6TA 1RIOH 3B73A 2FMYA 2DW4A 1ZGJA 2COMA 4AIHA 1V3FA 1FBSA 3TOAA 1YIOA 2TDXA 1KU2A 3ZMVA 3D5LA 5KK1A 4GYIA 1FLIA 4GO1A 1TW2A 1BI0A 4L0ZB 1LDDA 1ZN2A 4EGZA 3JW4A 4KYWA 4EV0A 4O6JA 1XCBA 3LA3A 3CLOA 1FWZA 1B4AA 1S3JA 2QQBA 1W7PA 4XSZF 2QENA 2WC2A 2QWWA 4G7ZF 2FU4A 3WE2A 3GVAA 3BROA 2A6HF 2FNAA 4G6DA 2NNNA 1I1GA 5D4RA 1KQ9A 4RAYA 1XGOA 2IPQX 1BM9A 3WTUC 3GUDA 2VE8A 1IRGA 4OMZA 3LWFA 1MD0A 2HTSA 3NEUA 2JZYA 1LEBA 2MC3A 3DQVC 4WXCA 2XKPA 2YX7A 5E1ZB 2EFOA 4LLLA 2F5FA 3HHHA 3OV8A 4PCQA 4YFNF 1G3TA 2W57A 3E3VA 1ON2A 2KJCA 2GQQA 2L4MA 3RI4A 1WKMA 4UVCA 4FX0A 3IWZA 2XKOA 5D5VB 2ISYA 1LVAA 2MH2A 1J75A 1IF1A 1REPC 2UWMA 1U5TC 3GXOA 4RB3C 4K2EA 3GFJA 3TQNA 4S04A 4RB2C 3K9TA 1S29A 2A6EF 1EH8A 2PQ8A 2L01A 1ONVA 5LHGA 2F5EA 2FA5A 3LAPA 1G4DA 3OOPA 3LA7A 4HZFA 2Q8KA 4LB6B 3D0SA 4U0VA 3RJPA 4JK1X 3GX4X 1LB2A 4M73A 4KIBA 2RNJA 1WI9A 3TKYA 1PP8F 3MAJA 2OBPA 4P9FA 2Z5UA 3BJAA 3WTWC 5CJ9A 2FBHA 1D3YA 3DKWA 2A5YB 3WGHA 2LNBA 1BC8C 4P55A 2ACJA 2BBYA 1RI7A 4XLPF 1HSTA 4MHGA 1MGTA 3T8RA 3VFZA 3KP2A 2OZ6A 2DFIA 2W24A 5CYVA 4HBLA 5ILSA 3J81K 4HQEA 1OR7A 5H6QA 4A0ZA 3C7JA 2EV6A 3RPQA 1DPRA 5BMZA 3QU6A 4I09A 2K27A 4LLNA 1J0RA 1T2KA 3V7CA 2PBIA 1MZBA 3E5QA 4M9SA 1R22A 4LMYA 3KETA 2D1VA 1YFHA 3JTHA 5HLHA 2RC4A 4A5NA 2KJBA 1ZYRF 1O7LA 2PLYA 1JGSA 3RYPA 4A6DA 4IJAA 1SD5A 3CUQB 5FB2A 1IXSB 3FMRA 3HHGA 3L7WA 2O8XA 4KMFA 3F8BA 5FFZA 1NHAA 4G7OF 3JSPA 4ZZDA 2H94A 1B6AA 1T98A 1YYVA 2HTJA 4G6QA 1BI2A 1FSEA 2KRFA 4NQWA 2M87A 2OZUA 1OMIA 5HDGA 4UVAA 4XSXF 4EJOA 2H09A 3T0YA 4JBAA 1H9TA 5LRRA 2M8EA 4EJVA 3IKTA 4HDUA 2ZNZA 5E1WA 2P5KA 4MTEA 4WXHA 3KFWX 3ECHA 3IWFA 5BOXA 4EJUA 2DLLA 1JXSA 1P4AA 2ELHA 1ZLKA 3F6VA 3KP4A 2HS5A 4KICA 4BHCA 4Y17A 3K1PA 4ZYHA 1LQ1A 4ZYDA 4XLNF 2VT3A 2O3FA 3I64A 2NRAC 3QAHA 4EM2A 3HIFA 4LFUA 1G3YA 3TO6A 3O2PE 2EFQA 6PAXA 2CG4A 5BPDA 3SQNA 1R36A 5K1YA 5L3EA 1WRJA 2F5DA 3T5XA 1DUXC 1K78A 3BP8A 4LG0B 2E7WA 1G6NA 5LLQA 4TV7A 4I02A 4CICA 2PMUA 1HW5A 2R7FA 4HDVA 2EA2A 1FOKA 1XMAA 2P7VB 2ADUA 2ZMEA 5H6RA 5IT9K 4M71A 3V8KA 1X3UA 3RYRA 4D0PA 2PN6A 2P6SA 3BJ6A 1U3EM 4CXFA 4YFKF 4MNUA 4GGGA 1SAXA 4KNYA 2XASA 3DFGA 3IHUA 3R61A 5HVQC 1IAWA 5A2QK 1W7PD 3M8FA 4ESFA 2FOKA 1W5TA 4M72A 3WTSC 1Y0UA 2FMLA 4A6EA 4AWXB 3CUOA 2FRHA 1XMKA 2VOPA 4LD5A 3BZ6A 1PDNC 1U5TA 1BI1A 1DPUA 2XHKA 1KQ0A 1O3TA 1ON1A 2BV6A 3WODF 5J8FA 1P2FA 3F6OA 2C6YA 5ILUA 4IRHA 4HX7A 2EB7A 4Q5SF 5LRSA 2D1HA 2NYXA 2Z99A 5BS6A 5ICEA 1S8NA 1FSHA 3IRRA 3SXYA 5K5RA 1TQIA 4JQFA 4HQMA 4FT8A 5DD4A 5E1XA 1ZAOA 3GF2A 2NAZA 3T8TA 3ABTA 1E2XA 1LJ9A 2K4JA 2M30A 2EV5A 2DO7A 3CDHA 5JI6A 3J80Z 1QGPA 3U1DA 3R60A 5D5UB 1G3WA 5H20A 1MDMB 2HDCA 2Z3YA 3FMQA 3LAJA 3HTSB 4KMUX 1QO0D 1T0FA 4IXAA 1U8RA 1XSVA 2EFWA 4UNOA 2L4AA 2VXZA 3I53A 4OU0A 3I5UA 1LDKB 4A2UA 1U6GA 1QZYA 3WTXC 3GYHX 1HBXG 1WQ2A 1WWXA 1UHWA 3L9FA 3I59A 2FNPA 2LF8A 3I71A 2ZBKA 1XD7A 1B59A 1QPMA 1PUEE 3JAMK 3EUHA 1FZPB 2VBYA 1T39A 4EJWA 1RNLA 3MQ0A 4YFXF 2P8TA 3BPVA 1XGMA 2DPDA 3WGGA 3H3ZA 3CO7C 5CVVA 3Q9SA 1S6LA 2HOEA 3R6SA 3R4KA 2GWRA 1HQCA 2G9WA 2YPRA 2HYFA 4U7BA 3KCCA 3B02A 3SZPA 3V4GA 4ESJA 5FD5A 1CGPA 5CVJA 2CO5A 3H92A 2JTVA 3M1EA 2XAFA 3VEPA 1YO5C 2QM3A 3EYIA 1YW7A 5FLXZ 3GW2A 2NS0A 5LEKA 5E8GA 3DF8A 3F3XA 3LQRA 1GXQA 2GXBA 4LB5A 3QP6A 4ESBA 4OMYA 1IN8A 3ZQ7A 4ENNA 4Q48A 2Q2EA 5E20A 4WXDA 5IT9Z 1FBQA 4A0XA 2MH9A 4WK8F 5KVRA 2IA0A 4HF0A 4E70A 2ZFWA 2RQPA 3R0AA 4N9IA 4EM1A 3FHZA 2RDPA 3HRUA 1W7PB 4EGYA 4I98B 4ON0A 1J5YA 2EK5A 2EV0A 1J59A 3LFKA 2DAOA 3DP7A 4WX9A 1Z6TA 3C1DA 3F8NA 4I01A 5ICFA 4H0EA 5DYMA 4BHBA 4P9UA 1SMTA 1LDJA 3BDDA 2H6BA 2V6CA 2JSCA 3F21A 1FYLA 1F9NA 2QQ9A 2XRNA 1B9NA 2A68F 1I5ZA 5F64A 2WV0A 3V7RA 4XRFA 4U7DA 1JHHA 1IRFA 3BY6A 1YG2A 4ETSA 3FXRA 4GCVA 4FX4A 5E17F 4A12A 4YIIA 4MEYF 2X0LA 3VOEA 4PZJA 4XBFA 3F23A 1SD6A 5FD6A 3EYYA 4CO8A 5ICGA 2VN2A 4EQQA 2A07F 4OIOF 2V79A 1UCRA 1ZRCA 2ZCWA 1ODDA 2EA4A 3K1NA 3HRMA 1R1UA 4G8XA 4P96A 2HYGD 4EJTA 2GIVA 4LK0F 1E17A 3JTGA 1OPCA 2IT0A 4AIJA 2UZKA 3DXJF 3ULQB 3HRSA 1FY7A 1YS7A 5JVTA 2D2WA 2ETHA 3EDPA 1HKTA 1Z05A 3VODA 4AVPA 1ZHFA 5AONA 1TLHB 1HKQA 3IC7A 1IUYA 1DP7P 3SFZA 4M6XA 4Y15A 1MJAA 3F8MA 5JR3A 1EH6A 2IA1A 4N0BA 4NHJA 1FP1D 3QRFF 5AIQA 2DQRA 3AAFA 1FT9A 3HSEA 3M9AA 4M6YA 1P6RA 2XIGA 2L02A 3LSTA 1VTNC 1EV7A 2ESNA 1TNTA 1H9GA 2VBZA 1ZG5A 1FP2A 1IN5A 2H27A 2FXAA 3TO9A 4B09A 3KLNA 2FBKA 1D5VA 1R00A 3WGIA 4MTDA 3GO5A 2ISZA 5FGMA 3ZMSA 2PFBA 2QBYA 2MLKA 4OIRF 3FXUA 5LGNA 1USSA 2QVOA 4CGZA 5F6FA 4HX8A 3ZP5A 4BXUA 2L54A 3QU3A 1GVJA 2ESHA 2VBWA 3MFKA 3GWZA 2WTEA 2CW0F 4MEXF 3LA2A 4R79A 4UVBA 4KA4A 2IA2A 4WCGA 2VC1A 1XGNA 4BQAA 3QPTA 3WTZA 2W25A 5D5WB 2E1NA 1WSUA 1Q1HA 4WF2A 3RDIA 2LF7A 3P9KA 1T6SA 1L0OC 3RIRA 4OOIA 5HOOA 3KP5A 5HS9A 2AXLA 4L0YB 2QLZA 3EQLF 1CF7A 2K02A 1SFEA 2JRTA 3CTAA 5L3FA 3MWMA 4KN7X 2Z9OA 4IVNA 2BGCA 1KA8A 2V1DA 2IJLA 2YX4A 3W6KB 2K7LA 2XAGA 3RKXA 1K7AA 1V4RA 3KE2A 1TQPA 2HQNA 4HLXA 1B1BA 4KFCA 5ERIA 3KP3A 1O7FA 2CWEA 5DV5A 3KP6A 1KU3A 5DUKA 1K78B 2PI0A 4ZZLA 5DCMA 3ROUA 5L3BA 3BPXA 3P9CA 4LGWA 2GA2A 2GAUA 1XDSA 1MJ9A 4MQVA 4U0WA 4A0YA 2M5WA 1Z1DA 2X4HA 2ZMEB 2YSRA 4UV8A 1IW7F 4BH9A 3RKYA 1I6XA 2XV4S 1W4MA 2J5OA 2CGPA 1J9IA 5DUIA 1ZRDA 1OKRA 2CQKA 4A5MA 3ZMTA 1TQMA 4ASNA 1Z9CA 2M45A 3W6JB 2P7CB 3DPTA 1RUOA 2NNYA 2P5LC 2ZKZA 5K5OA 1O3QA 3FZVA 3ZN0A 5D8LB 3J81Z 1S7AA 5HS8A 2JPCA 4ZYGA 5D8KB 3GFIA 3MZHA 2XAHA 5K5QA 2RKHA 4FHTA 1AOYA 3U2RA 1Z91A 1BJAA 2DTRA 2J5PA 5LBQA 4ZH4F 1HXDA 3FF5A 1BI3A 2IW5A 4GXOA 5FFXA 3P7NA 3I4PA 2BE5F 5D6EA 1U5TB 1ULYA 4CDGA 1IXRC 5JHUA 2LSOA 5DD8A 1RZ4A 2HKXA 5F1RA 2RVCA 1USTA 4IHSA 1ZH5A 2D45A 3Q5FA 2XUBA 1AWCA 4M9ZA 2A61A 3ZMZA 3DV8A 2PEXA 3REOA 1S7OA 3BWGA 2LKPA 4IRIA 1R7JA 2Y0MA 3E5UA 3G73A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2XVC A;  4RGX A;  3C3W A;  1YW8 A;  3K0L A;  1I1S A;  4RGS A;  2P4W A;  2E7X A;  4G94 A;  3M7G A;  1KGS A;  5DCF A;  1KU9 A;  4UHT A;  2IVM A;  2QUF A;  2OA4 A;  2EFP A;  3K69 A;  3HSR A;  5CLS A;  1Z6R A;  4UXN A;  2HR3 A;  2M1B A;  2O61 A;  2FSW A;  1K79 A;  2KIF A;  1OYY A;  5L3C A;  4HF2 A;  5BQT A;  4RS8 A;  1QNT A;  4EMS A;  3CO6 C;  1XN7 A;  3SHF A;  4HV5 A;  2V1U A;  3N97 A;  4I0A A;  3I59 B;  3V8L A;  2HFH A;  2DK5 A;  3J7A O;  4PGH A;  5L3G A;  2STT A;  2K86 A;  4HLY A;  5CVR A;  4IHT A;  1HKS A;  4RGR A;  2LDU A;  2EFN A;  2IP2 A;  1IXC A;  2BYV E;  3GZ5 A;  5BPI A;  1Z7U A;  1TBX A;  1QBJ A;  3T1B A;  5D4S A;  3F8F A;  3F8C A;  1UHM A;  3ISP A;  4KN4 X;  2XAJ A;  1G3S A;  1BBY A;  4HAM A;  5CVU A;  4CHU A;  2GA1 A;  1DDN A;  2CYY A;  4OIN F;  4PGG A;  2VOO A;  4GYG A;  5HDN A;  3TOB A;  1ZLJ A;  4O5V A;  5TJJ A;  5ICC A;  2CFX A;  3JSO A;  3I58 A;  3GEZ A;  1C0W A;  1SFU A;  4LJZ F;  4N9H A;  5A2Q Z;  1ZAR A;  1W5S A;  2YU3 A;  3ZMD A;  3DEU A;  1PP7 U;  2MD5 A;  3WTV C;  2PJP A;  5AIP A;  5LHI A;  2H6C A;  2FQ3 A;  2KIU A;  1XSX A;  3E5X A;  4BHP A;  4QLC U;  3KEQ A;  3WG9 A;  1P4W A;  1K6O A;  3R0J A;  3E6D A;  1J2X A;  4OIQ F;  2G7U A;  2FBI A;  3GZ6 A;  3ABU A;  3DPL C;  1KQ8 A;  2W84 A;  3ELK A;  1R58 A;  4HF1 A;  1R1T A;  2DI3 A;  4I7H A;  5L3D A;  4U0Y A;  4L9J A;  2AS5 F;  1XDU A;  3O3K A;  3L2C A;  3ML6 A;  1BOA A;  2F2E A;  1OYI A;  4EM0 B;  4RGU A;  1FX7 A;  1U2W A;  2GXG A;  3E6B A;  4IPA A;  1FPQ A;  5EEG A;  2PMH A;  3WE3 A;  3SZT A;  2ZJ2 A;  2Y48 A;  2DQL A;  2GZW A;  3MEX A;  2ZO4 A;  3QOP A;  4Q47 A;  1J7K A;  4KDP A;  2CSO A;  1KYW A;  3RKW A;  1H0M A;  4RAZ A;  3WTY C;  2QQA A;  1D8J A;  4BYY A;  4KUM A;  3L09 A;  2Z33 A;  1ZRE A;  5D5X B;  1SD4 A;  3KP7 A;  3PQJ A;  2JT1 A;  2HQR A;  3EET A;  1OYW A;  2EJR A;  4BNC A;  3HYI A;  2OQR A;  1BN5 A;  3NRV A;  1FYK A;  4CYD A;  4R1H A;  3FXQ A;  3M8E A;  2DPU A;  3JAM Z;  4RB1 A;  2O6G E;  2L3D A;  5DDG A;  1JE8 A;  3COA C;  4OIP F;  4L5I A;  3HOS A;  1HW2 A;  1BIB A;  4Y13 A;  5TRD A;  4HYE A;  3N4M A;  3ZMU A;  4KIG A;  4ZYE A;  1ZGA A;  4LK1 F;  2V1X A;  4M74 A;  3GFM A;  3CUQ A;  5IT3 A;  5LEJ A;  1O3S A;  2KKO A;  5LGT A;  5J6X A;  4R8H A;  4L9T A;  3K2Z A;  1MKM A;  2JPB A;  3CJN A;  3NQO A;  2QZ8 A;  2ZNY A;  3C18 A;  3FMS A;  2QYO A;  4Q4Z F;  3J80 K;  2FEZ A;  2ZXJ A;  2OD5 A;  5E18 F;  4DNC A;  2O0Y A;  1SD7 A;  2OAZ A;  4KIF A;  4YG2 F;  1F1Z A;  1FC3 A;  3KLO A;  2V9V A;  4HA8 A;  3FWE A;  2O03 A;  2Q0O A;  3HUG A;  4HOB A;  3HSF A;  4PDK A;  1P92 A;  2W85 A;  1UB9 A;  1R5H A;  3HRT A;  4O3M A;  2RV8 A;  4M9X A;  2A69 F;  5ILV A;  3V8J A;  3Q9V A;  4U88 A;  3WTT C;  3GLX A;  2F5C A;  4G7H F;  2FF4 A;  5HLG A;  4B8X A;  1P4X A;  1JHF A;  3PFI A;  1L3L A;  2KIM A;  1XGS A;  2QBY B;  1RUN A;  2R3S A;  4LG0 A;  3E6M A;  1GHC A;  2IRF G;  2RN7 A;  4UV9 A;  1F5T A;  2VT2 A;  3RTR A;  1BIA A;  3HOT A;  1O3R A;  1YS6 A;  5CVI A;  3KEO A;  4DQ2 A;  1IN7 A;  4IF4 A;  1IN6 A;  1ZG3 A;  3I54 A;  2XAQ A;  2OQG A;  1GXP A;  5FLX K;  2HZT A;  3QPH A;  4HW0 A;  4L18 B;  3WU1 B;  3GFL A;  1UFM A;  4MQ9 F;  5HDK A;  3FM3 A;  1TNS A;  2Y75 A;  2BEO A;  1YQA A;  2MBF A;  4ENK A;  4YIF A;  1YW9 A;  1SFX A;  3MZY A;  4I2O A;  1LEA A;  3F72 A;  2YR2 A;  3IL2 A;  3FM5 A;  5FO5 A;  1ZRF A;  2XGX A;  2P5V A;  1IN4 A;  1EH7 A;  5LHH A;  1STZ A;  3QP5 A;  1IZ1 A;  1CF7 B;  4UUV A;  1FYM A;  5ED4 A;  4BAY A;  3F22 A;  1F4K A;  3P9I A;  2B0L A;  3WU0 A;  2OU2 A;  2FE3 A;  1KYZ A;  4LLG F;  1FNN A;  2DT5 A;  4WWC A;  1XCV A;  5JFR A;  2VBX A;  2VC0 A;  3ECO A;  1B9M A;  3LQQ A;  3BJO A;  2E1C A;  3ZN1 A;  3PQK A;  5EEH A;  3E6C C;  5D6F A;  4P5O A;  4MGR A;  2R7D A;  2G7H A;  3TDU C;  4G9Y A;  1FBU A;  3FX3 A;  4F7Z A;  2K4B A;  1YTY A;  1R5G A;  3RPU A;  5DCM B;  1O57 A;  1ZG1 A;  4L9N A;  4HX4 A;  1R1V A;  4IRG A;  2DU9 A;  4I0B A;  1SMY F;  1QQI A;  3HTU A;  3KZZ A;  2VON A;  3TO7 A;  2PG4 A;  4KT5 C;  1HSJ A;  3ERE D;  3E97 A;  1MDM A;  3H3U A;  2DBB A;  1KU7 A;  3CUQ C;  4HV6 A;  3IRQ A;  3V7S A;  5J8C A;  3L00 A;  4L5J A;  4EVI A;  3ZPL A;  3I0T A;  1XB4 A;  1BC7 C;  1R23 A;  3S2W A;  5HLI A;  4ENM A;  1A04 A;  2HGC A;  2A3S A;  1XSD A;  4ENJ A;  2EWN A;  2UXX A;  1I27 A;  4Z2Y A;  3TGN A;  4QWQ A;  1TTY A;  4NB5 A;  3IKV A;  4AD9 A;  5E8I A;  5LGU A;  2MA3 A;  2XRO A;  3BOQ A;  4RB0 A;  3G3Z A;  3K1M A;  1LNW A;  3U9G A;  2WWY A;  1T38 A;  5HS7 A;  2HEO A;  1QZZ A;  4AIK A;  2VOD A;  3KZY A;  3TDZ C;  2HKO A;  2MLG A;  2VE9 A;  4CZZ A;  2RGV A;  2STW A;  3O6B B;  4L9V A;  1HW1 A;  3MCZ A;  4S05 A;  2DK8 A;  1U78 A;  1TW3 A;  5DEQ A;  3VB2 A;  1YLF A;  2HWV A;  1D8K A;  2UXN A;  1MJB A;  2P6T A;  1RIO H;  3B73 A;  2FMY A;  2DW4 A;  1ZGJ A;  2COM A;  4AIH A;  1V3F A;  1FBS A;  3TOA A;  1YIO A;  2TDX A;  1KU2 A;  3ZMV A;  3D5L A;  5KK1 A;  4GYI A;  1FLI A;  4GO1 A;  1TW2 A;  1BI0 A;  4L0Z B;  1LDD A;  1ZN2 A;  4EGZ A;  3JW4 A;  4KYW A;  4EV0 A;  4O6J A;  1XCB A;  3LA3 A;  3CLO A;  1FWZ A;  1B4A A;  1S3J A;  2QQB A;  1W7P A;  4XSZ F;  2QEN A;  2WC2 A;  2QWW A;  4G7Z F;  2FU4 A;  3WE2 A;  3GVA A;  3BRO A;  2A6H F;  2FNA A;  4G6D A;  2NNN A;  1I1G A;  5D4R A;  1KQ9 A;  4RAY A;  1XGO A;  2IPQ X;  1BM9 A;  3WTU C;  3GUD A;  2VE8 A;  1IRG A;  4OMZ A;  3LWF A;  1MD0 A;  2HTS A;  3NEU A;  2JZY A;  1LEB A;  2MC3 A;  3DQV C;  4WXC A;  2XKP A;  2YX7 A;  5E1Z B;  2EFO A;  4LLL A;  2F5F A;  3HHH A;  3OV8 A;  4PCQ A;  4YFN F;  1G3T A;  2W57 A;  3E3V A;  1ON2 A;  2KJC A;  2GQQ A;  2L4M A;  3RI4 A;  1WKM A;  4UVC A;  4FX0 A;  3IWZ A;  2XKO A;  5D5V B;  2ISY A;  1LVA A;  2MH2 A;  1J75 A;  1IF1 A;  1REP C;  2UWM A;  1U5T C;  3GXO A;  4RB3 C;  4K2E A;  3GFJ A;  3TQN A;  4S04 A;  4RB2 C;  3K9T A;  1S29 A;  2A6E F;  1EH8 A;  2PQ8 A;  2L01 A;  1ONV A;  5LHG A;  2F5E A;  2FA5 A;  3LAP A;  1G4D A;  3OOP A;  3LA7 A;  4HZF A;  2Q8K A;  4LB6 B;  3D0S A;  4U0V A;  3RJP A;  4JK1 X;  3GX4 X;  1LB2 A;  4M73 A;  4KIB A;  2RNJ A;  1WI9 A;  3TKY A;  1PP8 F;  3MAJ A;  2OBP A;  4P9F A;  2Z5U A;  3BJA A;  3WTW C;  5CJ9 A;  2FBH A;  1D3Y A;  3DKW A;  2A5Y B;  3WGH A;  2LNB A;  1BC8 C;  4P55 A;  2ACJ A;  2BBY A;  1RI7 A;  4XLP F;  1HST A;  4MHG A;  1MGT A;  3T8R A;  3VFZ A;  3KP2 A;  2OZ6 A;  2DFI A;  2W24 A;  5CYV A;  4HBL A;  5ILS A;  3J81 K;  4HQE A;  1OR7 A;  5H6Q A;  4A0Z A;  3C7J A;  2EV6 A;  3RPQ A;  1DPR A;  5BMZ A;  3QU6 A;  4I09 A;  2K27 A;  4LLN A;  1J0R A;  1T2K A;  3V7C A;  2PBI A;  1MZB A;  3E5Q A;  4M9S A;  1R22 A;  4LMY A;  3KET A;  2D1V A;  1YFH A;  3JTH A;  5HLH A;  2RC4 A;  4A5N A;  2KJB A;  1ZYR F;  1O7L A;  2PLY A;  1JGS A;  3RYP A;  4A6D A;  4IJA A;  1SD5 A;  3CUQ B;  5FB2 A;  1IXS B;  3FMR A;  3HHG A;  3L7W A;  2O8X A;  4KMF A;  3F8B A;  5FFZ A;  1NHA A;  4G7O F;  3JSP A;  4ZZD A;  2H94 A;  1B6A A;  1T98 A;  1YYV A;  2HTJ A;  4G6Q A;  1BI2 A;  1FSE A;  2KRF A;  4NQW A;  2M87 A;  2OZU A;  1OMI A;  5HDG A;  4UVA A;  4XSX F;  4EJO A;  2H09 A;  3T0Y A;  4JBA A;  1H9T A;  5LRR A;  2M8E A;  4EJV A;  3IKT A;  4HDU A;  2ZNZ A;  5E1W A;  2P5K A;  4MTE A;  4WXH A;  3KFW X;  3ECH A;  3IWF A;  5BOX A;  4EJU A;  2DLL A;  1JXS A;  1P4A A;  2ELH A;  1ZLK A;  3F6V A;  3KP4 A;  2HS5 A;  4KIC A;  4BHC A;  4Y17 A;  3K1P A;  4ZYH A;  1LQ1 A;  4ZYD A;  4XLN F;  2VT3 A;  2O3F A;  3I64 A;  2NRA C;  3QAH A;  4EM2 A;  3HIF A;  4LFU A;  1G3Y A;  3TO6 A;  3O2P E;  2EFQ A;  6PAX A;  2CG4 A;  5BPD A;  3SQN A;  1R36 A;  5K1Y A;  5L3E A;  1WRJ A;  2F5D A;  3T5X A;  1DUX C;  1K78 A;  3BP8 A;  4LG0 B;  2E7W A;  1G6N A;  5LLQ A;  4TV7 A;  4I02 A;  4CIC A;  2PMU A;  1HW5 A;  2R7F A;  4HDV A;  2EA2 A;  1FOK A;  1XMA A;  2P7V B;  2ADU A;  2ZME A;  5H6R A;  5IT9 K;  4M71 A;  3V8K A;  1X3U A;  3RYR A;  4D0P A;  2PN6 A;  2P6S A;  3BJ6 A;  1U3E M;  4CXF A;  4YFK F;  4MNU A;  4GGG A;  1SAX A;  4KNY A;  2XAS A;  3DFG A;  3IHU A;  3R61 A;  5HVQ C;  1IAW A;  5A2Q K;  1W7P D;  3M8F A;  4ESF A;  2FOK A;  1W5T A;  4M72 A;  3WTS C;  1Y0U A;  2FML A;  4A6E A;  4AWX B;  3CUO A;  2FRH A;  1XMK A;  2VOP A;  4LD5 A;  3BZ6 A;  1PDN C;  1U5T A;  1BI1 A;  1DPU A;  2XHK A;  1KQ0 A;  1O3T A;  1ON1 A;  2BV6 A;  3WOD F;  5J8F A;  1P2F A;  3F6O A;  2C6Y A;  5ILU A;  4IRH A;  4HX7 A;  2EB7 A;  4Q5S F;  5LRS A;  2D1H A;  2NYX A;  2Z99 A;  5BS6 A;  5ICE A;  1S8N A;  1FSH A;  3IRR A;  3SXY A;  5K5R A;  1TQI A;  4JQF A;  4HQM A;  4FT8 A;  5DD4 A;  5E1X A;  1ZAO A;  3GF2 A;  2NAZ A;  3T8T A;  3ABT A;  1E2X A;  1LJ9 A;  2K4J A;  2M30 A;  2EV5 A;  2DO7 A;  3CDH A;  5JI6 A;  3J80 Z;  1QGP A;  3U1D A;  3R60 A;  5D5U B;  1G3W A;  5H20 A;  1MDM B;  2HDC A;  2Z3Y A;  3FMQ A;  3LAJ A;  3HTS B;  4KMU X;  1QO0 D;  1T0F A;  4IXA A;  1U8R A;  1XSV A;  2EFW A;  4UNO A;  2L4A A;  2VXZ A;  3I53 A;  4OU0 A;  3I5U A;  1LDK B;  4A2U A;  1U6G A;  1QZY A;  3WTX C;  3GYH X;  1HBX G;  1WQ2 A;  1WWX A;  1UHW A;  3L9F A;  3I59 A;  2FNP A;  2LF8 A;  3I71 A;  2ZBK A;  1XD7 A;  1B59 A;  1QPM A;  1PUE E;  3JAM K;  3EUH A;  1FZP B;  2VBY A;  1T39 A;  4EJW A;  1RNL A;  3MQ0 A;  4YFX F;  2P8T A;  3BPV A;  1XGM A;  2DPD A;  3WGG A;  3H3Z A;  3CO7 C;  5CVV A;  3Q9S A;  1S6L A;  2HOE A;  3R6S A;  3R4K A;  2GWR A;  1HQC A;  2G9W A;  2YPR A;  2HYF A;  4U7B A;  3KCC A;  3B02 A;  3SZP A;  3V4G A;  4ESJ A;  5FD5 A;  1CGP A;  5CVJ A;  2CO5 A;  3H92 A;  2JTV A;  3M1E A;  2XAF A;  3VEP A;  1YO5 C;  2QM3 A;  3EYI A;  1YW7 A;  5FLX Z;  3GW2 A;  2NS0 A;  5LEK A;  5E8G A;  3DF8 A;  3F3X A;  3LQR A;  1GXQ A;  2GXB A;  4LB5 A;  3QP6 A;  4ESB A;  4OMY A;  1IN8 A;  3ZQ7 A;  4ENN A;  4Q48 A;  2Q2E A;  5E20 A;  4WXD A;  5IT9 Z;  1FBQ A;  4A0X A;  2MH9 A;  4WK8 F;  5KVR A;  2IA0 A;  4HF0 A;  4E70 A;  2ZFW A;  2RQP A;  3R0A A;  4N9I A;  4EM1 A;  3FHZ A;  2RDP A;  3HRU A;  1W7P B;  4EGY A;  4I98 B;  4ON0 A;  1J5Y A;  2EK5 A;  2EV0 A;  1J59 A;  3LFK A;  2DAO A;  3DP7 A;  4WX9 A;  1Z6T A;  3C1D A;  3F8N A;  4I01 A;  5ICF A;  4H0E A;  5DYM A;  4BHB A;  4P9U A;  1SMT A;  1LDJ A;  3BDD A;  2H6B A;  2V6C A;  2JSC A;  3F21 A;  1FYL A;  1F9N A;  2QQ9 A;  2XRN A;  1B9N A;  2A68 F;  1I5Z A;  5F64 A;  2WV0 A;  3V7R A;  4XRF A;  4U7D A;  1JHH A;  1IRF A;  3BY6 A;  1YG2 A;  4ETS A;  3FXR A;  4GCV A;  4FX4 A;  5E17 F;  4A12 A;  4YII A;  4MEY F;  2X0L A;  3VOE A;  4PZJ A;  4XBF A;  3F23 A;  1SD6 A;  5FD6 A;  3EYY A;  4CO8 A;  5ICG A;  2VN2 A;  4EQQ A;  2A07 F;  4OIO F;  2V79 A;  1UCR A;  1ZRC A;  2ZCW A;  1ODD A;  2EA4 A;  3K1N A;  3HRM A;  1R1U A;  4G8X A;  4P96 A;  2HYG D;  4EJT A;  2GIV A;  4LK0 F;  1E17 A;  3JTG A;  1OPC A;  2IT0 A;  4AIJ A;  2UZK A;  3DXJ F;  3ULQ B;  3HRS A;  1FY7 A;  1YS7 A;  5JVT A;  2D2W A;  2ETH A;  3EDP A;  1HKT A;  1Z05 A;  3VOD A;  4AVP A;  1ZHF A;  5AON A;  1TLH B;  1HKQ A;  3IC7 A;  1IUY A;  1DP7 P;  3SFZ A;  4M6X A;  4Y15 A;  1MJA A;  3F8M A;  5JR3 A;  1EH6 A;  2IA1 A;  4N0B A;  4NHJ A;  1FP1 D;  3QRF F;  5AIQ A;  2DQR A;  3AAF A;  1FT9 A;  3HSE A;  3M9A A;  4M6Y A;  1P6R A;  2XIG A;  2L02 A;  3LST A;  1VTN C;  1EV7 A;  2ESN A;  1TNT A;  1H9G A;  2VBZ A;  1ZG5 A;  1FP2 A;  1IN5 A;  2H27 A;  2FXA A;  3TO9 A;  4B09 A;  3KLN A;  2FBK A;  1D5V A;  1R00 A;  3WGI A;  4MTD A;  3GO5 A;  2ISZ A;  5FGM A;  3ZMS A;  2PFB A;  2QBY A;  2MLK A;  4OIR F;  3FXU A;  5LGN A;  1USS A;  2QVO A;  4CGZ A;  5F6F A;  4HX8 A;  3ZP5 A;  4BXU A;  2L54 A;  3QU3 A;  1GVJ A;  2ESH A;  2VBW A;  3MFK A;  3GWZ A;  2WTE A;  2CW0 F;  4MEX F;  3LA2 A;  4R79 A;  4UVB A;  4KA4 A;  2IA2 A;  4WCG A;  2VC1 A;  1XGN A;  4BQA A;  3QPT A;  3WTZ A;  2W25 A;  5D5W B;  2E1N A;  1WSU A;  1Q1H A;  4WF2 A;  3RDI A;  2LF7 A;  3P9K A;  1T6S A;  1L0O C;  3RIR A;  4OOI A;  5HOO A;  3KP5 A;  5HS9 A;  2AXL A;  4L0Y B;  2QLZ A;  3EQL F;  1CF7 A;  2K02 A;  1SFE A;  2JRT A;  3CTA A;  5L3F A;  3MWM A;  4KN7 X;  2Z9O A;  4IVN A;  2BGC A;  1KA8 A;  2V1D A;  2IJL A;  2YX4 A;  3W6K B;  2K7L A;  2XAG A;  3RKX A;  1K7A A;  1V4R A;  3KE2 A;  1TQP A;  2HQN A;  4HLX A;  1B1B A;  4KFC A;  5ERI A;  3KP3 A;  1O7F A;  2CWE A;  5DV5 A;  3KP6 A;  1KU3 A;  5DUK A;  1K78 B;  2PI0 A;  4ZZL A;  5DCM A;  3ROU A;  5L3B A;  3BPX A;  3P9C A;  4LGW A;  2GA2 A;  2GAU A;  1XDS A;  1MJ9 A;  4MQV A;  4U0W A;  4A0Y A;  2M5W A;  1Z1D A;  2X4H A;  2ZME B;  2YSR A;  4UV8 A;  1IW7 F;  4BH9 A;  3RKY A;  1I6X A;  2XV4 S;  1W4M A;  2J5O A;  2CGP A;  1J9I A;  5DUI A;  1ZRD A;  1OKR A;  2CQK A;  4A5M A;  3ZMT A;  1TQM A;  4ASN A;  1Z9C A;  2M45 A;  3W6J B;  2P7C B;  3DPT A;  1RUO A;  2NNY A;  2P5L C;  2ZKZ A;  5K5O A;  1O3Q A;  3FZV A;  3ZN0 A;  5D8L B;  3J81 Z;  1S7A A;  5HS8 A;  2JPC A;  4ZYG A;  5D8K B;  3GFI A;  3MZH A;  2XAH A;  5K5Q A;  2RKH A;  4FHT A;  1AOY A;  3U2R A;  1Z91 A;  1BJA A;  2DTR A;  2J5P A;  5LBQ A;  4ZH4 F;  1HXD A;  3FF5 A;  1BI3 A;  2IW5 A;  4GXO A;  5FFX A;  3P7N A;  3I4P A;  2BE5 F;  5D6E A;  1U5T B;  1ULY A;  4CDG A;  1IXR C;  5JHU A;  2LSO A;  5DD8 A;  1RZ4 A;  2HKX A;  5F1R A;  2RVC A;  1UST A;  4IHS A;  1ZH5 A;  2D45 A;  3Q5F A;  2XUB A;  1AWC A;  4M9Z A;  2A61 A;  3ZMZ A;  3DV8 A;  2PEX A;  3REO A;  1S7O A;  3BWG A;  2LKP A;  4IRI A;  1R7J A;  2Y0M A;  3E5U A;  3G73 A; 
#chains in the Genus database with same CATH topology
 1X1B A;  2XVC A;  4RGX A;  3C3W A;  4E7J A;  1YW8 A;  3BG7 A;  3RKQ A;  1MBJ A;  2X6X A;  3K0L A;  1I1S A;  4RGS A;  2P4W A;  2XAU A;  2E7X A;  1OIS A;  4G94 A;  3M7G A;  1KGS A;  4AID A;  5DCF A;  2MD0 A;  5CQE A;  1KU9 A;  1GVD A;  4UHT A;  1RPW A;  2IVM A;  2QUF A;  2OA4 A;  1NTC A;  2EFP A;  3K69 A;  3HSR A;  2F4M B;  5CLS A;  1Z6R A;  4UXN A;  3GLL A;  2HR3 A;  1OCZ H;  2M1B A;  4FCY A;  3ASN H;  2O61 A;  2FSW A;  3H0D A;  1K79 A;  2KIF A;  3BTL A;  1OYY A;  3CJR B;  2L0K A;  2VXD A;  5L3C A;  2IGM A;  4HF2 A;  5BQT A;  4A3G J;  4RS8 A;  4GFB A;  3H3V K;  1QNT A;  2I8D A;  4EMS A;  1XN7 A;  3SHF A;  3CO6 C;  2VUM J;  4HV5 A;  1R4N B;  3OR2 C;  2V1U A;  3IAS 2;  3N97 A;  1IG7 A;  4I0A A;  3VYT B;  3OYL A;  4BY1 J;  3I59 B;  1K61 A;  3V8L A;  1QHH D;  2HFH A;  3H0G J;  2DK5 A;  3J7A O;  3GTK J;  4PGH A;  3FBN B;  3M4O J;  2HVQ A;  5L3G A;  2STT A;  2K86 A;  2LC2 A;  4HLY A;  4A3I J;  5CVR A;  4IHT A;  1HKS A;  3ERM A;  4XKB A;  2O5R A;  4RGR A;  2LDU A;  1QVT A;  2EFN A;  2IP2 A;  4XN0 A;  3VYR B;  1YI2 I;  1IXC A;  2QQ8 A;  3SEZ A;  4FIS A;  4RM3 A;  3HC7 A;  2BYV E;  3GZ5 A;  1ACI A;  5BPI A;  1Z7U A;  2ICW G;  2B63 J;  1TBX A;  1QBJ A;  3T1B A;  5D4S A;  3F8F A;  1Y8Q B;  3MZ8 A;  3HDD A;  2Q1Z B;  5CPR B;  3BR5 A;  4A3J J;  3F8C A;  1UHM A;  1D0Z A;  2DT6 A;  1IRZ A;  3ISP A;  4KN4 X;  2XAJ A;  4MFD A;  2M7B A;  1G3S A;  1BBY A;  4HAM A;  5CVU A;  4B1R A;  2M8G X;  4A3K J;  4CHU A;  2GA1 A;  1DDN A;  1TC3 C;  2CYY A;  3FXM A;  4OIN F;  3C2B A;  2KQR A;  4PGG A;  2VOO A;  4GYG A;  3TL4 X;  5HDN A;  4A3B J;  3TOB A;  5IY5 H;  3LFU A;  1K4S A;  1WH7 A;  1NK3 P;  1S7E A;  2CFO A;  1ZLJ A;  2WBM A;  2M9H A;  4O5V A;  4A3C J;  1A5J A;  2IS4 A;  2MFZ A;  1Y8R B;  3BG3 A;  5TJJ A;  5LD2 C;  3PNY A;  4IEJ A;  5KAF C;  5ICC A;  4FE7 A;  2CFX A;  3P5J A;  3I58 A;  5KCM A;  3JSO A;  1MH4 A;  3I9V 2;  1FOW A;  4C3I J;  3GEZ A;  4UY8 I;  3CLQ A;  3MN2 A;  1C0W A;  1SFU A;  2RQQ A;  4LJZ F;  4N9H A;  5KNL A;  5A2Q Z;  4D7M A;  1SEU A;  1ZAR A;  4F52 A;  2GBY A;  2WAE A;  5B3S H;  1W5S A;  2YU3 A;  3IUO A;  3ZMD A;  3HPH A;  1LPQ A;  3DEU A;  1PP7 U;  1HC8 A;  4PJJ A;  2Q2E B;  2MD5 A;  3WTV C;  2H8W A;  1H88 C;  2PJP A;  3S2D J;  5AIP A;  5LHI A;  3Q3S A;  1WVR A;  2H6C A;  3M1C A;  2FQ3 A;  1E3P A;  2XPV A;  2KIU A;  3FIW A;  2AXT C;  1XSX A;  4DBR A;  2IGN A;  3E5X A;  5FLV A;  1RES A;  1ETW A;  4BHP A;  4QLC U;  3KEQ A;  3WG9 A;  4D5C A;  2VKE A;  3OIP A;  1P4W A;  1K6O A;  2E1O A;  1W0T A;  2X6O A;  3R0J A;  3E6D A;  1J2X A;  4FTH A;  2GM4 A;  4OIQ F;  3FXO A;  2G7U A;  3PNV A;  1ENH A;  3CQZ J;  2FBI A;  2FQ4 A;  2HXO A;  3GZ6 A;  2TCT A;  3DWL E;  3ABU A;  2BY1 A;  3DPL C;  1AU7 A;  2W84 A;  1KQ8 A;  3ELK A;  5IPA A;  4ZYA A;  3SZG A;  1R58 A;  5DM6 F;  4D7N A;  4HF1 A;  1R1T A;  2DYR H;  3AL0 B;  2MGQ A;  2KRC A;  2DI3 A;  2K85 A;  4I7H A;  5EZG A;  5L3D A;  3S32 A;  4A3L J;  4U0Y A;  4L9J A;  1JUM A;  4B47 A;  2AS5 F;  4BQN A;  3HPG A;  1XDU A;  3O3K A;  2ID6 A;  1K83 J;  3L2C A;  2PX9 A;  3ML6 A;  1BOA A;  2CUZ A;  2VB6 A;  2F2E A;  1OYI A;  4EM0 B;  2F5V A;  4RGU A;  1FX7 A;  1DP3 A;  1U2W A;  1H8A C;  1UEL B;  2GXG A;  2QSH X;  4F92 B;  3E6B A;  4IPA A;  1FPQ A;  1TZL A;  5EEG A;  3PO2 J;  2PMH A;  3WE3 A;  4E4H A;  4B44 A;  3SZT A;  2LKS A;  2EIK H;  2ZJ2 A;  2Y48 A;  5FKN A;  3DBH B;  2DQL A;  2GZW A;  2XF5 A;  1W0U A;  3HKZ N;  2ZO4 A;  3BR6 A;  2E71 A;  3MEX A;  3QOP A;  4H4K C;  4Q47 A;  2F4O B;  2XC7 A;  5CKT A;  1J7K A;  1A6I A;  4KDP A;  3GTG J;  1DQU A;  3K4J A;  2CSO A;  1KYW A;  1RKT A;  5IOY A;  3RKW A;  1H0M A;  4RAZ A;  3WTY C;  2UUZ A;  2QQA A;  1WJA A;  1D8J A;  3MVP A;  4BYY A;  2QA4 I;  4KUM A;  2FJ1 A;  3L09 A;  2ME6 A;  4RMN A;  4NC8 A;  2R7Q A;  2Z33 A;  2E2I J;  1T95 A;  3CME I;  4CCN A;  1ZRE A;  3K4B A;  5D5X B;  1UMQ A;  1SD4 A;  3BG5 A;  3AG3 H;  1LE8 B;  2ZB9 A;  3ABL H;  1WCM J;  3KP7 A;  3KYC B;  3PQJ A;  2JT1 A;  4JX6 A;  3I4N J;  3LSH A;  2HU9 A;  2HQR A;  5J4V A;  3HL2 A;  3EET A;  1OYW A;  2EJR A;  3TP0 A;  1E3O C;  4OAY A;  4BNC A;  3HYI A;  2OQR A;  1BN5 A;  4B3A A;  3NRV A;  2Y0S N;  1FYK A;  2QF7 A;  4W97 A;  3GTL J;  4CYD A;  2P81 A;  3OYN A;  4U87 A;  4R1H A;  2MW8 A;  3FXQ A;  3M8E A;  1V54 H;  4PFP A;  2DPU A;  5LFA A;  3LSM A;  1ZEL A;  3JAM Z;  4RB1 A;  2O6G E;  1ETO A;  2L3D A;  5DDG A;  1JE8 A;  4CYC A;  3COA C;  4C2T A;  4DZJ A;  2X6Y A;  4OIP F;  2NS7 A;  2LP0 A;  4L5I A;  3HOS A;  1X3Z B;  1HW2 A;  2ELJ A;  3CP2 A;  1W36 C;  1WHU A;  2X6W A;  4BAC A;  1BIB A;  4Y13 A;  5TRD A;  1S72 I;  4CCL A;  4HYE A;  3IAM 2;  3ZMU A;  3N4M A;  4NBQ A;  2V4J C;  2B9S A;  4KIG A;  4ZYE A;  2K9Q A;  4BXF A;  4AVZ A;  1ZGA A;  4LK1 F;  2V1X A;  1MBH A;  3GFM A;  4M74 A;  3LSJ A;  3CUQ A;  5IT3 A;  5LEJ A;  2VKD A;  1O3S A;  2WB1 A;  2KKO A;  1B72 A;  5LGT A;  5J6X A;  3SEQ A;  2HPI A;  1TP4 A;  4R8H A;  4L9T A;  3DU6 A;  2V7F A;  1UAA A;  2V9K A;  3A0B C;  4XL9 A;  3VDX A;  3K2Z A;  5EG0 B;  2LMD A;  1MKM A;  4M3F A;  1VQ4 I;  4B4C A;  2JPB A;  4JYK A;  1KZH A;  1IJW C;  3CJN A;  2GLO A;  2CQN A;  1APL C;  3DEW A;  3NQO A;  3DTE A;  4FQG A;  2M4G A;  2QZ8 A;  2ZNY A;  3C18 A;  3FMS A;  3LSG A;  2QYO A;  4Q4Z F;  1NK2 P;  1N25 A;  4XK4 A;  3J80 K;  2FEZ A;  2ZXJ A;  2R7O A;  2OD5 A;  4DYR A;  5E18 F;  3S1Q J;  2X1C A;  4JX4 A;  4DNC A;  2R7U A;  2O0Y A;  1SD7 A;  2L2O A;  4BEH A;  3H1C A;  2OAZ A;  2JMW A;  4KIF A;  1GV2 A;  4ABZ A;  3E7L A;  4YG2 F;  4CCO A;  1F1Z A;  3HJE A;  1FC3 A;  1YX5 A;  3KLO A;  2V9V A;  3IH4 A;  4HA8 A;  4RAG A;  2PMZ A;  4HNT A;  4ZTJ A;  3FWE A;  2O03 A;  2Q0O A;  1RRJ A;  3DCF A;  3HUG A;  1YIJ I;  4HOB A;  1SAU A;  3HSF A;  1V5F A;  4A93 J;  4PDK A;  1I50 J;  1P92 A;  2W85 A;  1UB9 A;  3FKI J;  1R5H A;  3HRT A;  4O3M A;  2RV8 A;  4M9X A;  2A69 F;  5ILV A;  4E7H A;  3QYB A;  3V8J A;  3CC2 I;  3ABK H;  3DKY A;  3CMA I;  3S1R J;  4BDY A;  3Q9V A;  4P1W A;  4U88 A;  3WTT C;  2CV2 A;  1OLT A;  5FRO A;  3GLX A;  2F5C A;  2WY8 Q;  4G7H F;  5TGT A;  2KZV A;  2ZXW H;  2FF4 A;  4PJN A;  2H1L A;  4BDZ A;  5C3E J;  5HLG A;  4B8X A;  2EBI A;  1P4X A;  2DCE A;  3JRA A;  1JHF A;  4D5F A;  2JSP A;  3PFI A;  1L3L A;  3OSG A;  2KIM A;  2CRG A;  1XGS A;  4KJZ A;  2QBY B;  1T56 A;  1RUN A;  2R3S A;  4LG0 A;  4RM2 A;  2O8K A;  1P7J A;  3E6M A;  1GHC A;  1OQY A;  4IQJ A;  2IRF G;  2QSG X;  2RN7 A;  4CSW A;  3CCU I;  4UV9 A;  1F5T A;  2VT2 A;  1JJ8 C;  2KHM A;  3RTR A;  1TWG J;  1BIA A;  3HOT A;  1O3R A;  1YS6 A;  5CVI A;  4XIC A;  2F6C A;  3KEO A;  3IH2 A;  4DQ2 A;  2MAB A;  2R7V A;  1IN7 A;  1IO2 A;  5K7Z A;  1E3H A;  4IF4 A;  1IN6 A;  1ZG3 A;  3I54 A;  1Y1W J;  2XAQ A;  2R0Q C;  2OQG A;  3E0J B;  1GXP A;  5FLX K;  2HZT A;  1U0J A;  3QPH A;  3HXL A;  3CJQ B;  4FE4 A;  4HW0 A;  4L18 B;  2OJE D;  5EJC A;  3WU1 B;  3GFL A;  1G2H A;  1UFM A;  2DMQ A;  4MQ9 F;  5HDK A;  1WI3 A;  3FM3 A;  2ZXH A;  1TNS A;  4AM3 A;  1MMD A;  2Y75 A;  1YHQ I;  2BEO A;  1YQA A;  2MBF A;  4ENK A;  4YIF A;  2ZJQ F;  1YW9 A;  1SFX A;  3MZY A;  2R5Z A;  4I2O A;  1LEA A;  3F72 A;  3BCB A;  2QSF X;  2YR2 A;  3IL2 A;  3FM5 A;  5FO5 A;  4XOP A;  1ZRF A;  3CF5 F;  2XGX A;  3OYM A;  3FXK A;  2P5V A;  3NAR A;  1TL8 A;  1GT0 C;  1IN4 A;  1EH7 A;  3OWT A;  3PNT A;  5LHH A;  1STZ A;  3QP5 A;  1BOB A;  1IZ1 A;  1CF7 B;  4UUV A;  1FYM A;  5ED4 A;  1X1A A;  3LSI A;  3ZOB A;  2E34 A;  4BAY A;  4F3Q A;  2V1N A;  3F22 A;  4XMY A;  2ZC2 A;  1O4X A;  3P9I A;  1F4K A;  2B0L A;  2LY9 A;  3GBG A;  2H8R A;  2JQ7 A;  1R5I D;  3WU0 A;  2OU2 A;  2FE3 A;  1KYZ A;  4LLG F;  2HOS A;  2BXZ A;  1FNN A;  2CW7 A;  2DT5 A;  1YIT I;  2X1D A;  4WWC A;  5KHD A;  1XCV A;  5JFR A;  2VBX A;  2VC0 A;  3RCO A;  3ECO A;  1B9M A;  3LQQ A;  2MYS A;  3BJO A;  2E1C A;  3ZN1 A;  2EZH A;  3G2B A;  3PQK A;  4PFO A;  1IV8 A;  3C2H A;  5EEH A;  3E6C C;  5D6F A;  4P5O A;  4MGR A;  1VND A;  2R7D A;  2G7H A;  3TDU C;  4G9Y A;  1FBU A;  3FX3 A;  4F7Z A;  5B1B H;  2QEX I;  3EUA A;  2K4B A;  2LRD A;  1YTY A;  1R5G A;  1QU3 A;  3RPU A;  5DCM B;  1O57 A;  3TP3 A;  2VQH A;  1ZG1 A;  4L9N A;  4HX4 A;  1R1V A;  4XID A;  4IRG A;  2DU9 A;  4I0B A;  1SMY F;  1QQI A;  3HTU A;  3KZZ A;  4C30 A;  4XLH A;  2VON A;  3BG9 A;  4RA2 A;  3TO7 A;  2BVL A;  2PG4 A;  4KT5 C;  1HSJ A;  3ERE D;  3E97 A;  5E3O A;  4E7S A;  5F1J A;  1MDM A;  3H3U A;  2R93 J;  2DBB A;  2P0W A;  1UG0 A;  1KU7 A;  2LVS A;  5GAG J;  3CUQ C;  3HB9 A;  4HV6 A;  3IRQ A;  5DS9 A;  3V7S A;  5J8C A;  1R6R A;  3L00 A;  4L5J A;  2UV1 A;  1A31 A;  3A01 A;  2XRL A;  1QVU A;  4EVI A;  2K9M A;  2KDZ A;  3ZPL A;  2BOL A;  3I0T A;  1Y0N A;  1XB4 A;  1BC7 C;  1R23 A;  3UKG A;  3S2W A;  5HLI A;  4ENM A;  3GTO J;  1A04 A;  2HGC A;  1N77 A;  3CCV I;  2A3S A;  3TW7 A;  4CZC A;  1XSD A;  1LUJ B;  4ENJ A;  4AU7 A;  4XKC A;  2EWN A;  3CCM I;  2UXX A;  2KT0 A;  1I27 A;  1T08 B;  4Z2Y A;  3TGN A;  3QPL A;  2K3P A;  3GTQ J;  2LY2 A;  1BR2 A;  4Y7N J;  4XRM A;  2DMN A;  4QWQ A;  3K70 C;  2K9S A;  2XSD C;  3K4M A;  1TTY A;  3OR1 C;  4NB5 A;  1Y39 A;  3IKV A;  4AD9 A;  5E8I A;  2R7Z J;  5LGU A;  3G6E I;  2MA3 A;  2XRO A;  5B5E C;  1D1B A;  3BOQ A;  3FXL A;  1N75 A;  2HI3 A;  3G3Z A;  4RB0 A;  4IHY A;  3K1M A;  4XNF A;  1D1C A;  2DTZ A;  4HPQ A;  1LNW A;  1H89 C;  3CC4 I;  3U9G A;  2WWY A;  1T38 A;  2XF7 A;  3CJT B;  5HS7 A;  2LG4 A;  2HEO A;  1QZZ A;  1WPK A;  4AIK A;  2VOD A;  4IQ4 A;  3CF2 A;  3DKX A;  3TED A;  1OCC H;  1SVL A;  2K9N A;  3KZY A;  3PSF A;  3TDZ C;  2HKO A;  1DU6 A;  3DTK A;  4BU2 A;  1Z7L A;  2K9L A;  3DBR B;  1YX3 A;  2MLG A;  2VAS A;  3MKL A;  3D5R C;  1DGR M;  4CZZ A;  2M0C A;  2VE9 A;  3HM5 A;  3CDL A;  2RGV A;  4PJL A;  3DBL B;  3KPH A;  2STW A;  3O6B B;  4L9V A;  1X1P A;  1MSE C;  1HW1 A;  5FKM A;  3MCZ A;  4S05 A;  1LFU P;  1PVE A;  2DK8 A;  1R9T J;  1U78 A;  3H5N A;  1TW3 A;  5DEQ A;  5IP9 J;  1NG6 A;  3VB2 A;  1V55 H;  1YLF A;  1VQM I;  3HEF A;  2HWV A;  4BUP A;  1D8K A;  1MMA A;  2UXN A;  1MJB A;  2P6T A;  3PJR A;  1EF4 A;  3Q0V A;  2V6E A;  1V5G A;  1RIO H;  3G1O A;  1RKW A;  4V19 K;  3B73 A;  2FMY A;  3GZN B;  2DW4 A;  3CP8 A;  1ZGJ A;  2COM A;  3MKY B;  3M07 A;  1V3F A;  1FBS A;  1ORK A;  4AIH A;  3TOA A;  2VPR A;  1Y56 A;  3DU5 A;  4DYQ A;  2L7K A;  1JTY A;  1YIO A;  2TDX A;  1MBE A;  1JKR C;  2E1M C;  5FRN A;  1KU2 A;  3ZMV A;  3D5L A;  1YRN A;  3SJM A;  4NNJ A;  5KK1 A;  1Z21 A;  4BXX J;  4D1Q A;  4GYI A;  1FLI A;  3LSK A;  2L9S A;  1W5C C;  4GO1 A;  2ZSH B;  2NVT J;  1TW2 A;  1IGN A;  4II3 A;  4AYB A;  1BI0 A;  2Y9Z A;  4L0Z B;  1LDD A;  1ZN2 A;  4EGZ A;  4ZJZ A;  2DMT A;  3JW4 A;  4KYW A;  4EV0 A;  4O6J A;  1XCB A;  1NG7 A;  3LA3 A;  3AG1 H;  1Z3X A;  5BNG A;  2B7E A;  3CLO A;  3QPS A;  1FWZ A;  5B1A H;  1B4A A;  1VFC A;  1S3J A;  2VKH A;  3PSI A;  1G8X A;  2QQB A;  1W7P A;  4XSZ F;  2QEN A;  2M2E A;  2WC2 A;  2QWW A;  4G7Z F;  2FU4 A;  2LRE A;  3WE2 A;  3GVA A;  3BRO A;  2A6H F;  2FNA A;  2CQQ A;  4G6D A;  2CMP A;  2NNN A;  3OIQ A;  1YJN I;  2EZL A;  1I1G A;  2BXY A;  3LSR A;  5D4R A;  2GOX B;  1KQ9 A;  4RAY A;  2BW3 A;  2HQ5 A;  2DDA A;  3FHN A;  5IP6 A;  2ZME C;  1JKQ C;  1XGO A;  2OF7 A;  2DOE A;  2Y31 A;  3BTI A;  1P7I A;  2K3F A;  3TMO A;  2IPQ X;  2YS9 A;  1BM9 A;  4M3B A;  2DMP A;  1MMG A;  2EIJ H;  2XPU A;  1MH3 A;  3WTU C;  1HA8 A;  3GTP J;  3GUD A;  2VE8 A;  2MSY A;  3K70 D;  2IEK A;  1IRG A;  3TBI A;  4OMZ A;  3LWF A;  1MD0 A;  2HTS A;  3NEU A;  2NVY J;  2JZY A;  1LEB A;  2MC3 A;  3DQV C;  4WXC A;  2XKP A;  2YX7 A;  5E1Z B;  2EFO A;  4LLL A;  2F5F A;  4IHW A;  3F0C A;  1D0X A;  3HHH A;  3OV8 A;  1FOY A;  2L9R A;  2HPM A;  2VQG A;  2WAF A;  3JRB A;  2JUC A;  1R49 A;  2BVM A;  4PCQ A;  5GTI C;  5F27 A;  2WB1 N;  4M3G A;  4YFN F;  1NH3 A;  1G3T A;  2W57 A;  3E3V A;  1ON2 A;  3ABM H;  2HOT A;  2Y9Y A;  2KJC A;  2GQQ A;  2ECB A;  1YJW I;  2G0E A;  2L4M A;  2OTJ I;  3RI4 A;  3OL4 A;  2DMU A;  1A36 A;  4C3H J;  4RDU A;  1WKM A;  4UVC A;  3FK6 A;  4FX0 A;  4YEL A;  2GOM A;  3IWZ A;  2XKO A;  1IC8 A;  3H5A A;  1MBG A;  3JCU C;  5D5V B;  2ISY A;  1LVA A;  2MH2 A;  2HNH A;  1J75 A;  1IF1 A;  1REP C;  2UWM A;  4Y52 J;  1WJB A;  1U5T C;  4RLQ A;  1HOM A;  3GXO A;  2FD5 A;  4K2E A;  3GFJ A;  4PSX A;  3TQN A;  4S04 A;  4RB2 C;  5DM7 F;  4RB3 C;  3K9T A;  3CCY A;  1FMV A;  2IBD A;  1S29 A;  2A6E F;  3MKZ A;  5FKO A;  1EH8 A;  3ONQ A;  5M3F J;  1MIJ A;  2PQ8 A;  2L01 A;  1ONV A;  5LHG A;  4DOZ A;  3ZQL A;  5IYD J;  3DEE A;  4QSH A;  2DOD A;  2F5E A;  4DJA A;  2PMZ N;  2FA5 A;  3LAP A;  1G4D A;  2VLA A;  3OSF A;  3PIO F;  2IS2 A;  1BJZ A;  3A4C A;  3OOP A;  1Z77 A;  4LIU A;  1X19 A;  2XB0 X;  3LA7 A;  4HZF A;  2HDD A;  4C2M J;  2Q8K A;  4LB6 B;  3D0S A;  2JWT A;  2XB5 A;  4XM3 A;  3VYU B;  2CUE A;  2CV0 A;  2LFB A;  4U0V A;  1SAN A;  3RJP A;  4JK1 X;  4F93 B;  1VQ7 I;  3GX4 X;  1LB2 A;  1BA5 A;  4M73 A;  4E7K A;  1X4P A;  4KIB A;  3IH3 A;  2JUG A;  4IL6 C;  2RNJ A;  1WI9 A;  2BHZ A;  3PUF A;  3L1P A;  1Z67 A;  3TKY A;  4XQF A;  1PP8 F;  3MAJ A;  4KT6 A;  2OBP A;  4P9F A;  2Z5U A;  3G71 I;  4E6K G;  1E0E A;  2LH9 A;  3O8H A;  2DA6 A;  3BJA A;  3WTW C;  3EPZ A;  2GIZ A;  3S8P A;  5CJ9 A;  2Z2S B;  2FBH A;  4NC7 A;  1D3Y A;  3DKW A;  3KEY A;  5HOD A;  1FEX A;  5GPC A;  2A5Y B;  1K4T A;  3WGH A;  5IP7 J;  2R7R A;  3X2Q H;  4BS9 A;  3BT9 A;  2LNB A;  1XPX A;  3A0H C;  1Y1V J;  1BC8 C;  5EZH A;  2KLO A;  4P55 A;  2ACJ A;  2K5C A;  4IOC F;  2BBY A;  5E3M A;  1B8I A;  1RI7 A;  4XLP F;  3CCR I;  1HST A;  4MHG A;  3RZO J;  1MGT A;  1OFC X;  9ANT A;  1MMS A;  2GXA A;  1FTZ A;  3T8R A;  3VFZ A;  4F55 A;  2CUJ A;  3BTC A;  1VQK I;  3KP2 A;  3E1S A;  2OZ6 A;  2NOG A;  2DFI A;  3BG6 A;  2W24 A;  5CYV A;  2XGE A;  1VQP I;  4HBL A;  5ILS A;  3J81 K;  1ZK8 A;  5FRM A;  4HQE A;  1OR7 A;  4XRS G;  5H6Q A;  2JRM A;  1ZTR A;  4A0Z A;  3C7J A;  2EV6 A;  2F4I A;  3RPQ A;  1BR4 A;  1DPR A;  2MC4 A;  3MMY B;  5BMZ A;  3QU6 A;  4I09 A;  2K27 A;  3J7A Y;  1JTX A;  4LLN A;  1J0R A;  2NVU B;  1POG A;  1Z3Y A;  4L5E A;  4A69 C;  2ECC A;  3JRH A;  2KFD A;  1T2K A;  3V7C A;  2PBI A;  4XRS A;  5M5X J;  1PUF A;  1VQ8 I;  3BR1 A;  4CYC B;  2OCE A;  1JUP A;  1MZB A;  3E5Q A;  4M9S A;  1R22 A;  4LMY A;  3KET A;  1IV6 A;  1MND A;  1MW7 A;  1CQT A;  3RPU D;  3K7A J;  3H36 A;  2D1V A;  1YFH A;  3HGG A;  3HOW J;  3IP4 B;  3JTH A;  5HLH A;  2RC4 A;  4A5N A;  2KJB A;  1ZYR F;  1O7L A;  2PLY A;  5GP9 A;  1JGS A;  4A3E J;  3IV5 A;  1GLN A;  3RYP A;  3BR2 A;  4XLA A;  1PYV A;  2HXI A;  4A6D A;  4IJA A;  4XN3 A;  3W2A A;  1SD5 A;  2VQL A;  3CUQ B;  5FB2 A;  1B72 B;  1IXS B;  3FMR A;  3HHG A;  2JA8 J;  3L7W A;  4BBR J;  2O8X A;  2FOW A;  4KMF A;  3F8B A;  5FFZ A;  1NHA A;  4G7O F;  3L2Q A;  2D5V A;  4UUS A;  2W48 A;  3JSP A;  2ZFU A;  4ZZD A;  2DFF A;  2H94 A;  1B6A A;  1T98 A;  2EH3 A;  1ZKG A;  2O9L A;  1YYV A;  2HTJ A;  2HVS A;  2R7S A;  4G6Q A;  1BI2 A;  2DJI A;  1F36 A;  1FSE A;  1JUS A;  2KRF A;  4EEF G;  1GDT A;  4NQW A;  2M87 A;  2OZU A;  4IOA F;  1OMI A;  5HDG A;  4C2U A;  4UVA A;  2X9D A;  3GTJ J;  2FX0 A;  4BY7 J;  2BHY A;  2YUS A;  1YOV B;  2EIN H;  1IUF A;  2F48 A;  4XSX F;  4EJO A;  2H09 A;  2NS8 A;  3T0Y A;  1OCP A;  3BQY A;  4BEH B;  1WGX A;  4JBA A;  4LOC A;  4ITV A;  3HOV J;  1H9T A;  4I76 A;  5LRR A;  2M8E A;  4DBQ A;  2CJJ A;  4EJV A;  3IKT A;  4HDU A;  1GUU A;  3C2G A;  1SFO J;  2ZNZ A;  3PO3 J;  5K7F A;  5E1W A;  3FBI B;  2P5K A;  1MNE A;  1X2M A;  4WXH A;  4MTE A;  5H2F C;  2HQA A;  1PJR A;  2QCO A;  3KFW X;  1JKP C;  3HUG B;  3ECH A;  3W2V A;  2LBF A;  3ZQI A;  3IWF A;  3PL8 A;  5BOX A;  3HOY J;  4EJU A;  2DLL A;  1JXS A;  1ZR4 A;  1P4A A;  2ELH A;  1ZLK A;  2EPF A;  3F6V A;  3KP4 A;  3AL0 C;  2A05 A;  2HS5 A;  2AO9 A;  1Y6I A;  4A3D J;  4KIC A;  4BHC A;  4Y17 A;  2ELK A;  5EGO A;  3H9G A;  3K1P A;  4ZYH A;  1LQ1 A;  2RNG A;  2IAI A;  1HCR A;  3CMY A;  4KIT B;  1QHG A;  4ZYD A;  4XLN F;  3QQA A;  2VT3 A;  2O3F A;  3I64 A;  1WZ2 A;  2NRA C;  2Y30 A;  3QAH A;  3BTJ A;  1W36 D;  4EM2 A;  3HOX J;  3SDG A;  3K4L A;  3EUK L;  2NVX J;  4Y3O A;  3HIF A;  4MO7 A;  4C3J J;  2XGD A;  4LFU A;  3PM1 A;  1G3Y A;  3TO6 A;  4E7I A;  3QWL A;  3O2P E;  2EFQ A;  3S1N J;  6PAX A;  2CG4 A;  1UHS A;  3SQN A;  5BPD A;  1R36 A;  2M34 A;  5M3M J;  5K1Y A;  5L3E A;  1WRJ A;  2F5D A;  3T5X A;  4ZDP A;  1DUX C;  1VQL I;  4YEJ A;  1VQO I;  1K78 A;  3BP8 A;  4Y4R A;  4LG0 B;  2E7W A;  1G6N A;  3BC8 A;  5LLQ A;  4TV7 A;  3GCM A;  3H9Q A;  2E2H J;  4I02 A;  4CIC A;  2PMU A;  1R4M B;  1KON A;  1JGG A;  1HW5 A;  2R7F A;  1XG1 A;  1RR7 A;  2E1M B;  4HDV A;  2EA2 A;  1FOK A;  1XMA A;  2Y2Z A;  2P7V B;  2ADU A;  2ZME A;  5H6R A;  4ANJ A;  5IT9 K;  4M71 A;  2ZSI B;  3V8K A;  3L2V A;  1X3U A;  3RYR A;  4D0P A;  2PN6 A;  2P6S A;  2JJ7 A;  1TWC J;  1MNM C;  3BJ6 A;  3ASO H;  5GTH C;  1U3E M;  4CXF A;  4YFK F;  2DA5 A;  2R5Y A;  2XDV A;  4MNU A;  3KYL A;  2JA6 J;  3AG4 H;  1ZR2 A;  4JOM A;  4CUG A;  4GGG A;  1S9H A;  2EZK A;  1SAX A;  4KNY A;  4I6Z A;  3SFI A;  3VSL A;  2XAS A;  4XOR A;  2OC6 A;  3DFG A;  3IHU A;  3R61 A;  4A3M J;  5HVQ C;  1IAW A;  1VZ0 A;  2JVH A;  5A2Q K;  5KAI C;  1W7P D;  3M8F A;  1DU0 A;  2R7T A;  4ESF A;  2FOK A;  4DYC A;  3OYG A;  1W5T A;  4M72 A;  4QIW N;  5EF6 A;  3WTS C;  2R5Z B;  1Y0U A;  3OYF A;  2DYS H;  2FML A;  4A6E A;  1JJ6 C;  4AWX B;  3FKJ A;  2XGC A;  2V9P A;  3CUO A;  2FRH A;  4N4N B;  1XMK A;  5IYB J;  2R4G A;  4J19 A;  4LD5 A;  2VOP A;  3OYA A;  1WFX A;  4CA0 A;  1BL0 A;  1SFK A;  2BY0 A;  2XF6 A;  5FJ8 J;  3BZ6 A;  1PDN C;  1U5T A;  1ERD A;  2ME0 A;  3PIP F;  1ZQ3 P;  1BI1 A;  1DPU A;  1YE9 A;  2XHK A;  5EYR A;  2VL8 A;  1KQ0 A;  5CQG A;  4AYB N;  1O3T A;  1ON1 A;  2BV6 A;  2IXS A;  3HG9 A;  2R7W A;  3OOU A;  2WA0 A;  4LIT A;  3WOD F;  5J8F A;  3WU2 C;  4BE2 A;  1P2F A;  3F6O A;  2C6Y A;  5ILU A;  1OR7 C;  1WJD A;  4IRH A;  2ZJP F;  5M5W J;  4HX7 A;  4E7L A;  2EB7 A;  2XSJ C;  3ZRG A;  4Q5S F;  5LRS A;  3J7Y J;  2D1H A;  4XLC A;  4RAF A;  2NYX A;  2Z99 A;  5BS6 A;  3OL3 A;  5ICE A;  1S8N A;  5JHF A;  2VJJ A;  1AKH A;  3IRR A;  3SXY A;  1FSH A;  5K5R A;  1TQI A;  2CW8 A;  4JQF A;  1X1C A;  4HQM A;  4FT8 A;  5DD4 A;  5E1X A;  1ZAO A;  3GF2 A;  1QPI A;  2NAZ A;  2ZJR F;  3T8T A;  5FKK A;  4B3X A;  3ABT A;  1E2X A;  1LJ9 A;  5J1Y A;  4DZP A;  5C4J J;  2K4J A;  2AHQ A;  2M30 A;  4UB8 C;  2EV5 A;  2DO7 A;  1FIP A;  3CDH A;  1QRY A;  3ZQQ A;  5JI6 A;  2E35 A;  1AHD P;  3FXJ A;  3J80 Z;  1QGP A;  3CCL I;  3U1D A;  4BL0 B;  4CCK A;  2CUF A;  2COB A;  3R60 A;  4BE1 A;  5D5U B;  2IS6 A;  1G3W A;  5H20 A;  1MDM B;  2HDC A;  4B48 A;  2Z3Y A;  3FMQ A;  3LAJ A;  3HTS B;  1AA7 A;  4KMU X;  4C9Y A;  1QO0 D;  2DFH A;  1T0F A;  2NOJ B;  4IXA A;  2L9V A;  1U8R A;  3HOZ J;  1XC5 A;  1ETQ A;  1XSV A;  2ZXI A;  2EFW A;  3S3O A;  1JI8 A;  2FUG 2;  4UNO A;  1D1A A;  2L4A A;  1SVO A;  2VXZ A;  3I53 A;  3A01 B;  1XMX A;  4OAZ A;  2WV1 A;  4OU0 A;  3I5U A;  3NWT A;  1LDK B;  4A2U A;  1AKH B;  1RR8 C;  1U6G A;  1QZY A;  4MLO A;  3VSK A;  1XS9 A;  4KIS A;  2LK2 A;  4HST A;  3WTX C;  3GYH X;  1FOX A;  1HBX G;  2EIM H;  4IKF A;  1U9O A;  3WG7 H;  1WQ2 A;  1WWX A;  1UHW A;  2E5Z A;  3L9F A;  3I59 A;  4XR6 A;  3TW6 A;  2FNP A;  1X4O A;  2LF8 A;  2AQF A;  3DLA A;  2M7A A;  3I71 A;  3H5R A;  2ZBK A;  4MIM A;  2DN0 A;  1XD7 A;  1B59 A;  4BJ6 C;  1QPM A;  2BY2 A;  2DJN A;  2R7X A;  1PUE E;  3JAM K;  3EUH A;  4QPQ A;  3FK7 A;  1FZP B;  2LLK A;  3K4K A;  2VBY A;  2W4S A;  2QKM B;  1Q1V A;  1T39 A;  4EJW A;  3V42 A;  4J01 A;  3D1N I;  3J7Z I;  3JRE A;  4CCJ A;  1RNL A;  3MQ0 A;  4OWR B;  4YFX F;  2KMU A;  2JA5 J;  2P8T A;  3ZQH A;  2KDO A;  3BPV A;  1XGM A;  2HOA A;  2DPD A;  2KL4 A;  3WGG A;  5GAD J;  3H3Z A;  3G4S I;  5JVG F;  3I3L A;  4DW6 A;  3CO7 C;  2W00 A;  5CVV A;  3Q9S A;  4JP0 A;  4II2 A;  1S6L A;  2HOE A;  3OS2 A;  1JT6 A;  3HGY A;  2L5Q A;  3R6S A;  3GME A;  3R4K A;  2GWR A;  2LOO A;  1HQC A;  2G9W A;  2YPR A;  2HYF A;  4U7B A;  3KCC A;  3G1L A;  3K2A A;  1ETV A;  4XKW A;  5M5Y J;  4F91 B;  3CMM A;  3B02 A;  2OTL I;  3SZP A;  3V4G A;  4ESJ A;  5FD5 A;  1CGP A;  3DPU A;  3BZK A;  2E36 A;  5CVJ A;  2CO5 A;  3AFH A;  3H92 A;  2EIL H;  2JTV A;  3M1E A;  2XAF A;  3OY9 A;  4X1E A;  3PFY A;  3VEP A;  1YO5 C;  2QM3 A;  1UJ8 A;  3EYI A;  1YW7 A;  1OJL A;  5FLX Z;  3ZQC A;  2R92 J;  3GW2 A;  3I56 I;  1QZE A;  2NS0 A;  5LEK A;  5E8G A;  3I4M J;  3DF8 A;  3F3X A;  3I55 I;  1IDY A;  1V5E A;  3LQR A;  1GXQ A;  2GXB A;  2A5W A;  4LB5 A;  5IYC J;  4IHV A;  5JLW A;  4HRI A;  3QP6 A;  4ESB A;  1LKX A;  3JRI A;  1MBF A;  4OMY A;  1IN8 A;  3ZQ7 A;  2OUM A;  2DOA A;  4ENN A;  1N78 A;  1X2N A;  1YRN B;  1I39 A;  3BQZ A;  3L2U A;  2W82 A;  4Q48 A;  2Q2E A;  1TWA J;  5E20 A;  4WXD A;  5IT9 Z;  2JA2 A;  3A2K A;  1FBQ A;  3VYS B;  5C44 J;  3OIO A;  3S3M A;  4A0X A;  3BLY A;  2MH9 A;  2OV7 A;  1FTT A;  4WK8 F;  5KVR A;  1VQ9 I;  2IA0 A;  4HF0 A;  4E70 A;  4D9J A;  1I3Q J;  2ZFW A;  4BJT A;  2RQP A;  2KPM A;  3NAU A;  2HYJ A;  1VQN I;  3R0A A;  1WJF A;  4N9I A;  4EM1 A;  3FHZ A;  2RDP A;  4XLF A;  3OYK A;  3HRU A;  3S3N A;  1W7P B;  4CH7 A;  4EGY A;  2X1E A;  4I98 B;  4PK4 A;  1EA3 A;  4ON0 A;  2JK3 A;  2LYC A;  1J5Y A;  2V26 A;  3FIS A;  3M8J A;  1HLV A;  2EK5 A;  2EV0 A;  1J59 A;  3LFK A;  3H35 A;  2DAO A;  2YU9 J;  3DP7 A;  2VI6 A;  1Z6T A;  4WX9 A;  3C1D A;  3F8N A;  1OCR H;  1W1W E;  4I01 A;  5ICF A;  4H0E A;  5DYM A;  2BW3 B;  3CC7 I;  4BHB A;  2MG4 A;  1D5Y A;  4W1U A;  1M1E B;  3LL7 A;  4P9U A;  5FLM J;  5F0C A;  2KIQ A;  1SMT A;  1LDJ A;  3BDD A;  2H6B A;  2V6C A;  3BCA A;  4XLE A;  5F08 A;  2JSC A;  3F21 A;  1FYL A;  1F9N A;  2VJ5 A;  4IZZ A;  3Q0W A;  2QQ9 A;  3CD6 I;  2XRN A;  1B9N A;  1U9N A;  2A68 F;  2I5U A;  3FDY A;  1I5Z A;  5F64 A;  1BW6 A;  2W7N A;  2WV0 A;  1IDZ A;  3V7R A;  4XRF A;  2OCC H;  2VJI A;  4U7D A;  1JHH A;  1IRF A;  3BY6 A;  2XPW A;  1YG2 A;  3BR0 A;  4ETS A;  3W6V A;  2DA4 A;  4BBS J;  3FXR A;  4GCV A;  4FX4 A;  5E17 F;  1A35 A;  4A12 A;  5J40 A;  2DDB A;  1IRX A;  2DA2 A;  4YII A;  4HG2 A;  4Z6Y A;  4GDF A;  2DA7 A;  5IOZ A;  4G6T B;  2X0L A;  2X85 A;  4MEY F;  2OPT A;  3M3Y J;  3VOE A;  2VQC A;  4PZJ A;  3UR3 C;  4XBF A;  3F23 A;  1SD6 A;  1TT0 A;  3CES A;  4BJ5 C;  3KZI C;  4UB6 C;  3F9K A;  5FD6 A;  1LE8 A;  3EYY A;  3S93 A;  3K4C A;  4CO8 A;  5B66 C;  5ICG A;  3U21 A;  2VN2 A;  2N8G A;  4EQQ A;  3OS0 A;  2CQ7 A;  5E3L A;  2A07 F;  1GV5 A;  4OIO F;  2V79 A;  1UCR A;  5FKL A;  1ZRC A;  1ITY A;  2ZCW A;  1ODD A;  2EA4 A;  3K1N A;  1ZGW A;  2L7M P;  4LIV A;  4X0G A;  1T8I A;  3HRM A;  4HNU A;  1R1U A;  4G8X A;  1T33 A;  1FMW A;  4P96 A;  2HYG D;  3CCJ I;  4EJT A;  2GIV A;  3QOD A;  4LK0 F;  1T0F C;  2E60 A;  3S17 J;  1E17 A;  1TWH J;  5EDN A;  3ZR8 X;  2W1O A;  3JTG A;  2K40 A;  4X6A J;  3Q0U A;  2EQR A;  4V2F A;  1OPC A;  1X58 A;  4XOT A;  2IT0 A;  3OMY A;  1WH5 A;  2CU7 A;  4J00 A;  4AIJ A;  2UZK A;  3AG2 H;  3DXJ F;  3ULQ B;  3HRS A;  1FY7 A;  1P9Q C;  3B6A A;  1YS7 A;  2QGU A;  4NC6 A;  5JVT A;  2HVR A;  3OYC A;  2D2W A;  2VKV A;  1UG2 A;  2ETH A;  3EDP A;  3KYD B;  4YRV A;  3D5S C;  2BY3 A;  2CH0 A;  1HKT A;  4LG3 A;  1Z05 A;  3VOD A;  4BKX A;  5E79 C;  2IS1 A;  4AVP A;  3HZJ A;  1ZHF A;  1HDD C;  4ZC3 A;  5EG0 A;  3OYH A;  5AON A;  1JT0 A;  3B6C A;  1TLH B;  2HDW A;  1HKQ A;  1WJ5 A;  3EUH C;  3IC7 A;  3QOE A;  1IUY A;  1DP7 P;  5C4X J;  2LR8 A;  1XTA A;  3SFZ A;  1X1D A;  2KRH A;  4M6X A;  4Y15 A;  1MJA A;  1RC9 A;  2CS3 A;  2KP6 A;  3CCE I;  5F0H A;  3F8M A;  3ZCO A;  1HF0 A;  5JR3 A;  2VIX A;  3L2R A;  5EEA A;  1EH6 A;  2IA1 A;  1R71 A;  3BR3 A;  2DA3 A;  1MSF C;  4BE0 A;  2E2J J;  3K4N A;  4N0B A;  4NHJ A;  1B8I B;  3U1K A;  1LVK A;  3S2H J;  1FP1 D;  3QRF F;  3DTI A;  3CZ6 A;  4RBO A;  5AIQ A;  3OYJ A;  2DQR A;  3AAF A;  1TT5 B;  1FT9 A;  3HSE A;  3M9A A;  1K6Y A;  2IGK A;  4M6Y A;  4BQO A;  1P6R A;  3ZQG A;  2XIG A;  2L02 A;  3OYB A;  4CCM A;  3A1Y A;  3LST A;  5TIS C;  2HZD A;  1VTN C;  4IO9 F;  3ZGK A;  1ETX A;  1EV7 A;  2ESN A;  1TNT A;  4UUT A;  2NXN B;  1H9G A;  3H9J A;  3SDB A;  3RQI A;  2KIS A;  2VBZ A;  2Z16 A;  1ZG5 A;  5GPA A;  3OYI A;  1FP2 A;  1IN5 A;  2H27 A;  2FXA A;  2DFE A;  1MBK A;  5HNF A;  3S15 J;  1XX5 A;  4N4O B;  3TO9 A;  4B09 A;  5J4Y A;  3KLN A;  3VWB A;  1EJ9 A;  2NVQ J;  2FBK A;  2DXI A;  1D5V A;  4QTR A;  1R00 A;  3WGI A;  4MTD A;  1PUF B;  2LTP A;  2LKX A;  1FJL A;  1UZC A;  2I10 A;  3GO5 A;  4EAT A;  4V2G A;  5FGM A;  3ZMS A;  2ISZ A;  2PFB A;  2QBY A;  2MLK A;  4OIR F;  3FXU A;  4QPO A;  3MKW B;  1OCO H;  5K7H A;  5LGN A;  4M6V A;  4PJM A;  3JRD A;  1USS A;  2WAD A;  2QVO A;  4BQQ A;  1VQ6 I;  4AC0 A;  4CGZ A;  5F6F A;  1YJ9 I;  4HX8 A;  3ZP5 A;  3HKZ A;  4BXU A;  3LNQ A;  2L54 A;  3QU3 A;  1BW5 A;  1GVJ A;  2ESH A;  2VBW A;  3WHC A;  3MFK A;  3GWZ A;  2WTE A;  2IGO A;  4NUB A;  4UUS B;  3JRF A;  1JKO C;  2CW0 F;  4MEX F;  1TWF J;  4ZTF A;  3LA2 A;  2X48 A;  4R79 A;  3RSN A;  4UVB A;  3AKZ A;  4KA4 A;  3HOU J;  2IA2 A;  4NQW B;  2M0M A;  4WCG A;  3JR9 A;  2VC1 A;  1XGN A;  2X51 A;  4BQA A;  3CCQ I;  2DOF A;  2Z1D A;  4PUS A;  3QPT A;  2Y0S A;  4Y33 A;  2BZT A;  4I99 C;  3WTZ A;  2W25 A;  4FAS D;  2TRT A;  5D5W B;  2EZI A;  4RLF A;  2E1N A;  5HLT A;  1WSU A;  1Q1H A;  4WF2 A;  3QYE A;  4B43 A;  3RDI A;  3RZD J;  4NDL A;  3RQ4 A;  2LF7 A;  3P9K A;  3PUB A;  3CCS I;  2RAE A;  1T6S A;  2O7O A;  2LBF B;  1L0O C;  5GAE J;  3RIR A;  1MMN A;  4OOI A;  5F0F A;  4XON A;  5HOO A;  3KP5 A;  5HS9 A;  3W2W A;  1QA6 A;  3W3C A;  1D0Y A;  2AXL A;  4L0Y B;  3HBL A;  2QLZ A;  3DLL F;  3EQL F;  1CF7 A;  4HSR A;  2K02 A;  1SFE A;  1RET A;  2JRT A;  3CTA A;  5L3F A;  3MWM A;  2H1K A;  4KN7 X;  2Z9O A;  4IVN A;  3ZXS A;  5EGO B;  1J09 A;  2DT7 B;  1VI0 A;  2BGC A;  1KA8 A;  2V1D A;  1Z0X A;  2IJL A;  5J47 A;  2WAQ N;  2LY1 A;  2YX4 A;  3W6K B;  2K7L A;  1SVM A;  3OS1 A;  2XAG A;  3RKX A;  1K7A A;  1EKE A;  1V4R A;  5J1R A;  3KE2 A;  1TQP A;  4A3F J;  2HQN A;  4HLX A;  3NWS A;  1B1B A;  2DA1 A;  4JX5 A;  4KFC A;  3UNG C;  2AQE A;  5ERI A;  3KP3 A;  1O7F A;  3N05 A;  2CWE A;  5DV5 A;  4XKV A;  1DGW Y;  3KP6 A;  2L9N A;  2PJR A;  1KU3 A;  1HDP A;  5DUK A;  1LFB A;  1K78 B;  2PI0 A;  3JRG A;  4ZZL A;  1G59 A;  5DCM A;  2KZG A;  3ROU A;  3BPX A;  5L3B A;  3P9C A;  4LGW A;  2GA2 A;  4PSW A;  1VF9 A;  2GAU A;  1XDS A;  1MJ9 A;  4MQV A;  3WHB A;  4U0W A;  4A0Y A;  2M5W A;  3KIO A;  1Z1D A;  3CDI A;  2JN6 A;  2X4H A;  2ZME B;  3A02 A;  2YSR A;  1F43 A;  2ID3 A;  4UV8 A;  1IW7 F;  4BH9 A;  3LMM A;  3RKY A;  1I6X A;  2WY7 Q;  2XV4 S;  3S16 J;  4M3E A;  1BR1 A;  1W4M A;  5J3L A;  4AUX A;  2J5O A;  2CGP A;  4IHX A;  2R5Y B;  1J9I A;  5DUI A;  4PJ0 C;  2L7Z A;  1ZRD A;  1OKR A;  2CQK A;  4A5M A;  3ZMT A;  3S14 J;  3QYF A;  1TQM A;  3JRC A;  2M4K A;  4ASN A;  1Z9C A;  5HNH A;  2E5N A;  2M45 A;  3W6J B;  2P7C B;  3DPT A;  4S0H B;  3OYD A;  2NNY A;  1RUO A;  3S1M J;  2P5L C;  2LD5 A;  2ZKZ A;  4YIR X;  2PJR B;  3ESW B;  5K5O A;  3BZC A;  3FZV A;  4DGW B;  1O3Q A;  1VQ5 I;  3G1M A;  3ZN0 A;  5D8L B;  3J81 Z;  5E3N A;  1S7A A;  2M3A A;  3O8G A;  3VPR A;  5HS8 A;  1WJE A;  2VJ4 A;  5F04 A;  2JPC A;  4ZYG A;  1LFP A;  5D8K B;  1I3A A;  3GFI A;  3MZH A;  2XAH A;  5K5Q A;  2RKH A;  4FHT A;  4E7Z A;  2E19 A;  4M3D A;  4BGD A;  1AOY A;  3U2R A;  1Z91 A;  1BJA A;  1U8B A;  1X3W B;  2DTR A;  2J5P A;  1OCT C;  5LBQ A;  2CV1 A;  1WJC A;  4DIQ A;  5DTD A;  5GAH J;  4ZH4 F;  1HXD A;  3FF5 A;  2JVG A;  1I6H J;  1BI3 A;  2IW5 A;  4GXO A;  5FFX A;  3P7N A;  3I4P A;  5J1U A;  4G12 A;  2BE5 F;  3MD2 A;  5D6E A;  1U5T B;  1ULY A;  4CDG A;  1IXR C;  4MFE A;  5JHU A;  2LSO A;  1ETK A;  3GTM J;  3SYT A;  5DD8 A;  1RZ4 A;  3OYE A;  2HKX A;  4HEA 2;  3ZQF A;  2RVC A;  5F1R A;  4IX7 A;  1UST A;  4IHS A;  2JA7 J;  3A03 A;  3LOC A;  1ETY A;  3LSP A;  1ZH5 A;  2A6T A;  2D45 A;  3Q5F A;  2XUB A;  3KX2 A;  1AWC A;  1S5L C;  1FIA A;  4HNV A;  5JLX A;  2Y69 H;  4M9Z A;  2A61 A;  1A6Q A;  3ZMZ A;  4GRI A;  3DV8 A;  4ZDL A;  2PEX A;  2CQX A;  1SC7 A;  3REO A;  4FET A;  1S7O A;  2QKL B;  3BWG A;  2WAQ A;  2RRE A;  4ZDO A;  2LKP A;  3K10 A;  4IRI A;  1R7J A;  2Y0M A;  3K6G A;  3E5U A;  3G73 A;  3L2W A;  2L7F P;  2VPL A; 
#chains in the Genus database with same CATH homology
 2XVC A;  4RGX A;  3C3W A;  1YW8 A;  3K0L A;  1I1S A;  4RGS A;  2P4W A;  2E7X A;  4G94 A;  3M7G A;  1KGS A;  5DCF A;  1KU9 A;  4UHT A;  2IVM A;  2QUF A;  2OA4 A;  2EFP A;  3K69 A;  3HSR A;  5CLS A;  1Z6R A;  4UXN A;  2HR3 A;  2M1B A;  2O61 A;  2FSW A;  1K79 A;  2KIF A;  1OYY A;  5L3C A;  4HF2 A;  5BQT A;  4RS8 A;  1QNT A;  4EMS A;  3CO6 C;  1XN7 A;  3SHF A;  4HV5 A;  2V1U A;  3N97 A;  4I0A A;  3I59 B;  3V8L A;  2HFH A;  2DK5 A;  3J7A O;  4PGH A;  5L3G A;  2STT A;  2K86 A;  4HLY A;  5CVR A;  4IHT A;  1HKS A;  4RGR A;  2LDU A;  2EFN A;  2IP2 A;  1IXC A;  2BYV E;  3GZ5 A;  5BPI A;  1Z7U A;  1TBX A;  1QBJ A;  3T1B A;  5D4S A;  3F8F A;  3F8C A;  1UHM A;  3ISP A;  4KN4 X;  2XAJ A;  1G3S A;  1BBY A;  4HAM A;  5CVU A;  4CHU A;  2GA1 A;  1DDN A;  2CYY A;  4OIN F;  4PGG A;  2VOO A;  4GYG A;  5HDN A;  3TOB A;  1ZLJ A;  4O5V A;  5TJJ A;  5ICC A;  2CFX A;  3JSO A;  3I58 A;  3GEZ A;  1C0W A;  1SFU A;  4LJZ F;  4N9H A;  5A2Q Z;  1ZAR A;  1W5S A;  2YU3 A;  3ZMD A;  3DEU A;  1PP7 U;  2MD5 A;  3WTV C;  2PJP A;  5AIP A;  5LHI A;  2H6C A;  2FQ3 A;  2KIU A;  1XSX A;  3E5X A;  4BHP A;  4QLC U;  3KEQ A;  3WG9 A;  1P4W A;  1K6O A;  3R0J A;  3E6D A;  1J2X A;  4OIQ F;  2G7U A;  2FBI A;  3GZ6 A;  3ABU A;  3DPL C;  1KQ8 A;  2W84 A;  3ELK A;  1R58 A;  4HF1 A;  1R1T A;  2DI3 A;  4I7H A;  5L3D A;  4U0Y A;  4L9J A;  2AS5 F;  1XDU A;  3O3K A;  3L2C A;  3ML6 A;  1BOA A;  2F2E A;  1OYI A;  4EM0 B;  4RGU A;  1FX7 A;  1U2W A;  2GXG A;  3E6B A;  4IPA A;  1FPQ A;  5EEG A;  2PMH A;  3WE3 A;  3SZT A;  2ZJ2 A;  2Y48 A;  2DQL A;  2GZW A;  3MEX A;  2ZO4 A;  3QOP A;  4Q47 A;  1J7K A;  4KDP A;  2CSO A;  1KYW A;  3RKW A;  1H0M A;  4RAZ A;  3WTY C;  2QQA A;  1D8J A;  4BYY A;  4KUM A;  3L09 A;  2Z33 A;  1ZRE A;  5D5X B;  1SD4 A;  3KP7 A;  3PQJ A;  2JT1 A;  2HQR A;  3EET A;  1OYW A;  2EJR A;  4BNC A;  3HYI A;  2OQR A;  1BN5 A;  3NRV A;  1FYK A;  4CYD A;  4R1H A;  3FXQ A;  3M8E A;  2DPU A;  3JAM Z;  4RB1 A;  2O6G E;  2L3D A;  5DDG A;  1JE8 A;  3COA C;  4OIP F;  4L5I A;  3HOS A;  1HW2 A;  1BIB A;  4Y13 A;  5TRD A;  4HYE A;  3N4M A;  3ZMU A;  4KIG A;  4ZYE A;  1ZGA A;  4LK1 F;  2V1X A;  4M74 A;  3GFM A;  3CUQ A;  5IT3 A;  5LEJ A;  1O3S A;  2KKO A;  5LGT A;  5J6X A;  4R8H A;  4L9T A;  3K2Z A;  1MKM A;  2JPB A;  3CJN A;  3NQO A;  2QZ8 A;  2ZNY A;  3C18 A;  3FMS A;  2QYO A;  4Q4Z F;  3J80 K;  2FEZ A;  2ZXJ A;  2OD5 A;  5E18 F;  4DNC A;  2O0Y A;  1SD7 A;  2OAZ A;  4KIF A;  4YG2 F;  1F1Z A;  1FC3 A;  3KLO A;  2V9V A;  4HA8 A;  3FWE A;  2O03 A;  2Q0O A;  3HUG A;  4HOB A;  3HSF A;  4PDK A;  1P92 A;  2W85 A;  1UB9 A;  1R5H A;  3HRT A;  4O3M A;  2RV8 A;  4M9X A;  2A69 F;  5ILV A;  3V8J A;  3Q9V A;  4U88 A;  3WTT C;  3GLX A;  2F5C A;  4G7H F;  2FF4 A;  5HLG A;  4B8X A;  1P4X A;  1JHF A;  3PFI A;  1L3L A;  2KIM A;  1XGS A;  2QBY B;  1RUN A;  2R3S A;  4LG0 A;  3E6M A;  1GHC A;  2IRF G;  2RN7 A;  4UV9 A;  1F5T A;  2VT2 A;  3RTR A;  1BIA A;  3HOT A;  1O3R A;  1YS6 A;  5CVI A;  3KEO A;  4DQ2 A;  1IN7 A;  4IF4 A;  1IN6 A;  1ZG3 A;  3I54 A;  2XAQ A;  2OQG A;  1GXP A;  5FLX K;  2HZT A;  3QPH A;  4HW0 A;  4L18 B;  3WU1 B;  3GFL A;  1UFM A;  4MQ9 F;  5HDK A;  3FM3 A;  1TNS A;  2Y75 A;  2BEO A;  1YQA A;  2MBF A;  4ENK A;  4YIF A;  1YW9 A;  1SFX A;  3MZY A;  4I2O A;  1LEA A;  3F72 A;  2YR2 A;  3IL2 A;  3FM5 A;  5FO5 A;  1ZRF A;  2XGX A;  2P5V A;  1IN4 A;  1EH7 A;  5LHH A;  1STZ A;  3QP5 A;  1IZ1 A;  1CF7 B;  4UUV A;  1FYM A;  5ED4 A;  4BAY A;  3F22 A;  1F4K A;  3P9I A;  2B0L A;  3WU0 A;  2OU2 A;  2FE3 A;  1KYZ A;  4LLG F;  1FNN A;  2DT5 A;  4WWC A;  1XCV A;  5JFR A;  2VBX A;  2VC0 A;  3ECO A;  1B9M A;  3LQQ A;  3BJO A;  2E1C A;  3ZN1 A;  3PQK A;  5EEH A;  3E6C C;  5D6F A;  4P5O A;  4MGR A;  2R7D A;  2G7H A;  3TDU C;  4G9Y A;  1FBU A;  3FX3 A;  4F7Z A;  2K4B A;  1YTY A;  1R5G A;  3RPU A;  5DCM B;  1O57 A;  1ZG1 A;  4L9N A;  4HX4 A;  1R1V A;  4IRG A;  2DU9 A;  4I0B A;  1SMY F;  1QQI A;  3HTU A;  3KZZ A;  2VON A;  3TO7 A;  2PG4 A;  4KT5 C;  1HSJ A;  3ERE D;  3E97 A;  1MDM A;  3H3U A;  2DBB A;  1KU7 A;  3CUQ C;  4HV6 A;  3IRQ A;  3V7S A;  5J8C A;  3L00 A;  4L5J A;  4EVI A;  3ZPL A;  3I0T A;  1XB4 A;  1BC7 C;  1R23 A;  3S2W A;  5HLI A;  4ENM A;  1A04 A;  2HGC A;  2A3S A;  1XSD A;  4ENJ A;  2EWN A;  2UXX A;  1I27 A;  4Z2Y A;  3TGN A;  4QWQ A;  1TTY A;  4NB5 A;  3IKV A;  4AD9 A;  5E8I A;  5LGU A;  2MA3 A;  2XRO A;  3BOQ A;  4RB0 A;  3G3Z A;  3K1M A;  1LNW A;  3U9G A;  2WWY A;  1T38 A;  5HS7 A;  2HEO A;  1QZZ A;  4AIK A;  2VOD A;  3KZY A;  3TDZ C;  2HKO A;  2MLG A;  2VE9 A;  4CZZ A;  2RGV A;  2STW A;  3O6B B;  4L9V A;  1HW1 A;  3MCZ A;  4S05 A;  2DK8 A;  1U78 A;  1TW3 A;  5DEQ A;  3VB2 A;  1YLF A;  2HWV A;  1D8K A;  2UXN A;  1MJB A;  2P6T A;  1RIO H;  3B73 A;  2FMY A;  2DW4 A;  1ZGJ A;  2COM A;  4AIH A;  1V3F A;  1FBS A;  3TOA A;  1YIO A;  2TDX A;  1KU2 A;  3ZMV A;  3D5L A;  5KK1 A;  4GYI A;  1FLI A;  4GO1 A;  1TW2 A;  1BI0 A;  4L0Z B;  1LDD A;  1ZN2 A;  4EGZ A;  3JW4 A;  4KYW A;  4EV0 A;  4O6J A;  1XCB A;  3LA3 A;  3CLO A;  1FWZ A;  1B4A A;  1S3J A;  2QQB A;  1W7P A;  4XSZ F;  2QEN A;  2WC2 A;  2QWW A;  4G7Z F;  2FU4 A;  3WE2 A;  3GVA A;  3BRO A;  2A6H F;  2FNA A;  4G6D A;  2NNN A;  1I1G A;  5D4R A;  1KQ9 A;  4RAY A;  1XGO A;  2IPQ X;  1BM9 A;  3WTU C;  3GUD A;  2VE8 A;  1IRG A;  4OMZ A;  3LWF A;  1MD0 A;  2HTS A;  3NEU A;  2JZY A;  1LEB A;  2MC3 A;  3DQV C;  4WXC A;  2XKP A;  2YX7 A;  5E1Z B;  2EFO A;  4LLL A;  2F5F A;  3HHH A;  3OV8 A;  4PCQ A;  4YFN F;  1G3T A;  2W57 A;  3E3V A;  1ON2 A;  2KJC A;  2GQQ A;  2L4M A;  3RI4 A;  1WKM A;  4UVC A;  4FX0 A;  3IWZ A;  2XKO A;  5D5V B;  2ISY A;  1LVA A;  2MH2 A;  1J75 A;  1IF1 A;  1REP C;  2UWM A;  1U5T C;  3GXO A;  4RB3 C;  4K2E A;  3GFJ A;  3TQN A;  4S04 A;  4RB2 C;  3K9T A;  1S29 A;  2A6E F;  1EH8 A;  2PQ8 A;  2L01 A;  1ONV A;  5LHG A;  2F5E A;  2FA5 A;  3LAP A;  1G4D A;  3OOP A;  3LA7 A;  4HZF A;  2Q8K A;  4LB6 B;  3D0S A;  4U0V A;  3RJP A;  4JK1 X;  3GX4 X;  1LB2 A;  4M73 A;  4KIB A;  2RNJ A;  1WI9 A;  3TKY A;  1PP8 F;  3MAJ A;  2OBP A;  4P9F A;  2Z5U A;  3BJA A;  3WTW C;  5CJ9 A;  2FBH A;  1D3Y A;  3DKW A;  2A5Y B;  3WGH A;  2LNB A;  1BC8 C;  4P55 A;  2ACJ A;  2BBY A;  1RI7 A;  4XLP F;  1HST A;  4MHG A;  1MGT A;  3T8R A;  3VFZ A;  3KP2 A;  2OZ6 A;  2DFI A;  2W24 A;  5CYV A;  4HBL A;  5ILS A;  3J81 K;  4HQE A;  1OR7 A;  5H6Q A;  4A0Z A;  3C7J A;  2EV6 A;  3RPQ A;  1DPR A;  5BMZ A;  3QU6 A;  4I09 A;  2K27 A;  4LLN A;  1J0R A;  1T2K A;  3V7C A;  2PBI A;  1MZB A;  3E5Q A;  4M9S A;  1R22 A;  4LMY A;  3KET A;  2D1V A;  1YFH A;  3JTH A;  5HLH A;  2RC4 A;  4A5N A;  2KJB A;  1ZYR F;  1O7L A;  2PLY A;  1JGS A;  3RYP A;  4A6D A;  4IJA A;  1SD5 A;  3CUQ B;  5FB2 A;  1IXS B;  3FMR A;  3HHG A;  3L7W A;  2O8X A;  4KMF A;  3F8B A;  5FFZ A;  1NHA A;  4G7O F;  3JSP A;  4ZZD A;  2H94 A;  1B6A A;  1T98 A;  1YYV A;  2HTJ A;  4G6Q A;  1BI2 A;  1FSE A;  2KRF A;  4NQW A;  2M87 A;  2OZU A;  1OMI A;  5HDG A;  4UVA A;  4XSX F;  4EJO A;  2H09 A;  3T0Y A;  4JBA A;  1H9T A;  5LRR A;  2M8E A;  4EJV A;  3IKT A;  4HDU A;  2ZNZ A;  5E1W A;  2P5K A;  4MTE A;  4WXH A;  3KFW X;  3ECH A;  3IWF A;  5BOX A;  4EJU A;  2DLL A;  1JXS A;  1P4A A;  2ELH A;  1ZLK A;  3F6V A;  3KP4 A;  2HS5 A;  4KIC A;  4BHC A;  4Y17 A;  3K1P A;  4ZYH A;  1LQ1 A;  4ZYD A;  4XLN F;  2VT3 A;  2O3F A;  3I64 A;  2NRA C;  3QAH A;  4EM2 A;  3HIF A;  4LFU A;  1G3Y A;  3TO6 A;  3O2P E;  2EFQ A;  6PAX A;  2CG4 A;  5BPD A;  3SQN A;  1R36 A;  5K1Y A;  5L3E A;  1WRJ A;  2F5D A;  3T5X A;  1DUX C;  1K78 A;  3BP8 A;  4LG0 B;  2E7W A;  1G6N A;  5LLQ A;  4TV7 A;  4I02 A;  4CIC A;  2PMU A;  1HW5 A;  2R7F A;  4HDV A;  2EA2 A;  1FOK A;  1XMA A;  2P7V B;  2ADU A;  2ZME A;  5H6R A;  5IT9 K;  4M71 A;  3V8K A;  1X3U A;  3RYR A;  4D0P A;  2PN6 A;  2P6S A;  3BJ6 A;  1U3E M;  4CXF A;  4YFK F;  4MNU A;  4GGG A;  1SAX A;  4KNY A;  2XAS A;  3DFG A;  3IHU A;  3R61 A;  5HVQ C;  1IAW A;  5A2Q K;  1W7P D;  3M8F A;  4ESF A;  2FOK A;  1W5T A;  4M72 A;  3WTS C;  1Y0U A;  2FML A;  4A6E A;  4AWX B;  3CUO A;  2FRH A;  1XMK A;  2VOP A;  4LD5 A;  3BZ6 A;  1PDN C;  1U5T A;  1BI1 A;  1DPU A;  2XHK A;  1KQ0 A;  1O3T A;  1ON1 A;  2BV6 A;  3WOD F;  5J8F A;  1P2F A;  3F6O A;  2C6Y A;  5ILU A;  4IRH A;  4HX7 A;  2EB7 A;  4Q5S F;  5LRS A;  2D1H A;  2NYX A;  2Z99 A;  5BS6 A;  5ICE A;  1S8N A;  1FSH A;  3IRR A;  3SXY A;  5K5R A;  1TQI A;  4JQF A;  4HQM A;  4FT8 A;  5DD4 A;  5E1X A;  1ZAO A;  3GF2 A;  2NAZ A;  3T8T A;  3ABT A;  1E2X A;  1LJ9 A;  2K4J A;  2M30 A;  2EV5 A;  2DO7 A;  3CDH A;  5JI6 A;  3J80 Z;  1QGP A;  3U1D A;  3R60 A;  5D5U B;  1G3W A;  5H20 A;  1MDM B;  2HDC A;  2Z3Y A;  3FMQ A;  3LAJ A;  3HTS B;  4KMU X;  1QO0 D;  1T0F A;  4IXA A;  1U8R A;  1XSV A;  2EFW A;  4UNO A;  2L4A A;  2VXZ A;  3I53 A;  4OU0 A;  3I5U A;  1LDK B;  4A2U A;  1U6G A;  1QZY A;  3WTX C;  3GYH X;  1HBX G;  1WQ2 A;  1WWX A;  1UHW A;  3L9F A;  3I59 A;  2FNP A;  2LF8 A;  3I71 A;  2ZBK A;  1XD7 A;  1B59 A;  1QPM A;  1PUE E;  3JAM K;  3EUH A;  1FZP B;  2VBY A;  1T39 A;  4EJW A;  1RNL A;  3MQ0 A;  4YFX F;  2P8T A;  3BPV A;  1XGM A;  2DPD A;  3WGG A;  3H3Z A;  3CO7 C;  5CVV A;  3Q9S A;  1S6L A;  2HOE A;  3R6S A;  3R4K A;  2GWR A;  1HQC A;  2G9W A;  2YPR A;  2HYF A;  4U7B A;  3KCC A;  3B02 A;  3SZP A;  3V4G A;  4ESJ A;  5FD5 A;  1CGP A;  5CVJ A;  2CO5 A;  3H92 A;  2JTV A;  3M1E A;  2XAF A;  3VEP A;  1YO5 C;  2QM3 A;  3EYI A;  1YW7 A;  5FLX Z;  3GW2 A;  2NS0 A;  5LEK A;  5E8G A;  3DF8 A;  3F3X A;  3LQR A;  1GXQ A;  2GXB A;  4LB5 A;  3QP6 A;  4ESB A;  4OMY A;  1IN8 A;  3ZQ7 A;  4ENN A;  4Q48 A;  2Q2E A;  5E20 A;  4WXD A;  5IT9 Z;  1FBQ A;  4A0X A;  2MH9 A;  4WK8 F;  5KVR A;  2IA0 A;  4HF0 A;  4E70 A;  2ZFW A;  2RQP A;  3R0A A;  4N9I A;  4EM1 A;  3FHZ A;  2RDP A;  3HRU A;  1W7P B;  4EGY A;  4I98 B;  4ON0 A;  1J5Y A;  2EK5 A;  2EV0 A;  1J59 A;  3LFK A;  2DAO A;  3DP7 A;  4WX9 A;  1Z6T A;  3C1D A;  3F8N A;  4I01 A;  5ICF A;  4H0E A;  5DYM A;  4BHB A;  4P9U A;  1SMT A;  1LDJ A;  3BDD A;  2H6B A;  2V6C A;  2JSC A;  3F21 A;  1FYL A;  1F9N A;  2QQ9 A;  2XRN A;  1B9N A;  2A68 F;  1I5Z A;  5F64 A;  2WV0 A;  3V7R A;  4XRF A;  4U7D A;  1JHH A;  1IRF A;  3BY6 A;  1YG2 A;  4ETS A;  3FXR A;  4GCV A;  4FX4 A;  5E17 F;  4A12 A;  4YII A;  4MEY F;  2X0L A;  3VOE A;  4PZJ A;  4XBF A;  3F23 A;  1SD6 A;  5FD6 A;  3EYY A;  4CO8 A;  5ICG A;  2VN2 A;  4EQQ A;  2A07 F;  4OIO F;  2V79 A;  1UCR A;  1ZRC A;  2ZCW A;  1ODD A;  2EA4 A;  3K1N A;  3HRM A;  1R1U A;  4G8X A;  4P96 A;  2HYG D;  4EJT A;  2GIV A;  4LK0 F;  1E17 A;  3JTG A;  1OPC A;  2IT0 A;  4AIJ A;  2UZK A;  3DXJ F;  3ULQ B;  3HRS A;  1FY7 A;  1YS7 A;  5JVT A;  2D2W A;  2ETH A;  3EDP A;  1HKT A;  1Z05 A;  3VOD A;  4AVP A;  1ZHF A;  5AON A;  1TLH B;  1HKQ A;  3IC7 A;  1IUY A;  1DP7 P;  3SFZ A;  4M6X A;  4Y15 A;  1MJA A;  3F8M A;  5JR3 A;  1EH6 A;  2IA1 A;  4N0B A;  4NHJ A;  1FP1 D;  3QRF F;  5AIQ A;  2DQR A;  3AAF A;  1FT9 A;  3HSE A;  3M9A A;  4M6Y A;  1P6R A;  2XIG A;  2L02 A;  3LST A;  1VTN C;  1EV7 A;  2ESN A;  1TNT A;  1H9G A;  2VBZ A;  1ZG5 A;  1FP2 A;  1IN5 A;  2H27 A;  2FXA A;  3TO9 A;  4B09 A;  3KLN A;  2FBK A;  1D5V A;  1R00 A;  3WGI A;  4MTD A;  3GO5 A;  2ISZ A;  5FGM A;  3ZMS A;  2PFB A;  2QBY A;  2MLK A;  4OIR F;  3FXU A;  5LGN A;  1USS A;  2QVO A;  4CGZ A;  5F6F A;  4HX8 A;  3ZP5 A;  4BXU A;  2L54 A;  3QU3 A;  1GVJ A;  2ESH A;  2VBW A;  3MFK A;  3GWZ A;  2WTE A;  2CW0 F;  4MEX F;  3LA2 A;  4R79 A;  4UVB A;  4KA4 A;  2IA2 A;  4WCG A;  2VC1 A;  1XGN A;  4BQA A;  3QPT A;  3WTZ A;  2W25 A;  5D5W B;  2E1N A;  1WSU A;  1Q1H A;  4WF2 A;  3RDI A;  2LF7 A;  3P9K A;  1T6S A;  1L0O C;  3RIR A;  4OOI A;  5HOO A;  3KP5 A;  5HS9 A;  2AXL A;  4L0Y B;  2QLZ A;  3EQL F;  1CF7 A;  2K02 A;  1SFE A;  2JRT A;  3CTA A;  5L3F A;  3MWM A;  4KN7 X;  2Z9O A;  4IVN A;  2BGC A;  1KA8 A;  2V1D A;  2IJL A;  2YX4 A;  3W6K B;  2K7L A;  2XAG A;  3RKX A;  1K7A A;  1V4R A;  3KE2 A;  1TQP A;  2HQN A;  4HLX A;  1B1B A;  4KFC A;  5ERI A;  3KP3 A;  1O7F A;  2CWE A;  5DV5 A;  3KP6 A;  1KU3 A;  5DUK A;  1K78 B;  2PI0 A;  4ZZL A;  5DCM A;  3ROU A;  5L3B A;  3BPX A;  3P9C A;  4LGW A;  2GA2 A;  2GAU A;  1XDS A;  1MJ9 A;  4MQV A;  4U0W A;  4A0Y A;  2M5W A;  1Z1D A;  2X4H A;  2ZME B;  2YSR A;  4UV8 A;  1IW7 F;  4BH9 A;  3RKY A;  1I6X A;  2XV4 S;  1W4M A;  2J5O A;  2CGP A;  1J9I A;  5DUI A;  1ZRD A;  1OKR A;  2CQK A;  4A5M A;  3ZMT A;  1TQM A;  4ASN A;  1Z9C A;  2M45 A;  3W6J B;  2P7C B;  3DPT A;  1RUO A;  2NNY A;  2P5L C;  2ZKZ A;  5K5O A;  1O3Q A;  3FZV A;  3ZN0 A;  5D8L B;  3J81 Z;  1S7A A;  5HS8 A;  2JPC A;  4ZYG A;  5D8K B;  3GFI A;  3MZH A;  2XAH A;  5K5Q A;  2RKH A;  4FHT A;  1AOY A;  3U2R A;  1Z91 A;  1BJA A;  2DTR A;  2J5P A;  5LBQ A;  4ZH4 F;  1HXD A;  3FF5 A;  1BI3 A;  2IW5 A;  4GXO A;  5FFX A;  3P7N A;  3I4P A;  2BE5 F;  5D6E A;  1U5T B;  1ULY A;  4CDG A;  1IXR C;  5JHU A;  2LSO A;  5DD8 A;  1RZ4 A;  2HKX A;  5F1R A;  2RVC A;  1UST A;  4IHS A;  1ZH5 A;  2D45 A;  3Q5F A;  2XUB A;  1AWC A;  4M9Z A;  2A61 A;  3ZMZ A;  3DV8 A;  2PEX A;  3REO A;  1S7O A;  3BWG A;  2LKP A;  4IRI A;  1R7J A;  2Y0M A;  3E5U A;  3G73 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...