3HRMA

Crystal structure of staphylococcus aureus protein sarz in sulfenic acid form
Total Genus 44
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
44
sequence length
139
structure length
130
Chain Sequence
GSHMYLSKQLFLFYVSSKEIIKKYTNYLKEYDLTYTGYIVLMAIENDEKLNIKKLGERVFLDSGTLTPLLKKLEKKDYVVRTLQISLTEQGKAIKSPLAEISVKVFNEFNISEREASDIINNLRNFVSKN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords HTH-type transcriptional regulator sarZ
publication title Crystal structures of the reduced, sulfenic acid, and mixed disulfide forms of SarZ, a redox active global regulator in Staphylococcus aureus.
pubmed doi rcsb
source organism Staphylococcus aureus subsp. aureus
molecule tags Transcription regulator
total genus 44
structure length 130
sequence length 139
chains with identical sequence B
ec nomenclature
pdb deposition date 2009-06-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01047 MarR MarR family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 3hrmA00
1G3WA 3T8RA 1LDKB 2IA0A 5L3BA 2FSWA 2PBIA 3ELKA 2VODA 4KN4X 1I6XA 2FBHA 4EM2A 3FZVA 4TV7A 1XB4A 1RI7A 3C7JA 2QBYA 1D3YA 3ZMZA 4HF0A 1YLFA 4P9FA 1KU3A 1K7AA 3SZTA 5K5OA 2HTJA 2GQQA 2HYGD 1XSXA 4XSXF 2G7UA 2ISYA 1FBSA 3WE2A 2P5KA 4YG2F 1IF1A 3FHZA 2DK8A 2R7DA 3BPVA 4G7OF 1R58A 1FT9A 2QQBA 2KJCA 3WTTC 4EGZA 4KIGA 4A0ZA 1EV7A 5HOOA 5HLIA 2DT5A 5TRDA 2CG4A 2COMA 1BC8C 1DPUA 5HS9A 4BHPA 3ZMTA 2ZNZA 4EV0A 3DV8A 1HW2A 3WODF 1BOAA 2GIVA 5FB2A 5DD8A 2DW4A 5IT9K 3C18A 2A6HF 3EETA 5D8LB 1YIOA 3KP3A 3QPTA 1QZYA 1LJ9A 1SMYF 1FNNA 5LBQA 2VT3A 3WU1B 4LB5A 2QBYB 2RC4A 1B9MA 4HF1A 3ZMSA 4G6QA 3CUOA 4LFUA 5CLSA 1MJAA 2QM3A 3MZHA 4RGSA 4M71A 3V7SA 3TQNA 1Z6RA 3I0TA 1P4WA 2OQGA 3FM3A 4I98B 2VBWA 5D8KB 3BOQA 4KMUX 2EFNA 5E8GA 1S7AA 3BWGA 4ENMA 1K6OA 2OU2A 1TNSA 2ESNA 5ED4A 5L3CA 3BY6A 4L9VA 4CICA 5FLXZ 2HDCA 2W25A 3WGGA 4IHSA 2V6CA 5DUIA 3N97A 2M1BA 3F72A 2IA1A 4P9UA 4EM1A 3WTSC 4HQEA 1HSTA 3JW4A 1BI2A 2Z9OA 1T38A 4M73A 5JI6A 4I0AA 3JAMZ 2L01A 5JR3A 1YFHA 3M1EA 1FLIA 4WF2A 4U7DA 2A69F 4L9NA 3BZ6A 4KIBA 3IWZA 2PLYA 3SFZA 3J7AO 4IJAA 2RVCA 1LDJA 3O6BB 4BHCA 1U3EM 1IXSB 2NYXA 2GA1A 3NEUA 2IVMA 5DV5A 4HAMA 2F5CA 3ZN1A 2XUBA 1YTYA 4QLCU 4G7HF 2BV6A 3RPQA 3PFIA 2EV6A 3IKVA 1KU7A 1R23A 2OA4A 2KIUA 5FLXK 4G8XA 4EJWA 3CJNA 1GXPA 1V3FA 2YPRA 4GYGA 1G3TA 1XDUA 4ZH4F 4EJVA 4RS8A 1J75A 4UUVA 2M8EA 4XBFA 4KT5C 2DLLA 4I02A 2CQKA 2R7FA 4R79A 1OR7A 1FBUA 2LF7A 4MTDA 2K27A 2KIFA 2W85A 2L3DA 3JAMK 3HRUA 2ZNYA 5KK1A 1R1TA 4U88A 1J7KA 5E1ZB 1BBYA 4M72A 2VOOA 3WTYC 2F2EA 3F3XA 2KKOA 1DPRA 3FF5A 3OOPA 3CUQA 3KEOA 3ZQ7A 3TO9A 2VC1A 4JK1X 2A3SA 4ETSA 1KYZA 4JBAA 4GYIA 1U2WA 2AS5F 4E70A 5DYMA 4HF2A 4MGRA 4F7ZA 2VE9A 3O2PE 2UXXA 2P7CB 2MA3A 4BQAA 3KLOA 4A6EA 1ZG1A 3T1BA 4OMZA 5L3DA 1IAWA 5LHHA 4CXFA 2EK5A 3NRVA 4RGRA 2CYYA 2XVCA 1WQ2A 4HDVA 2RGVA 1BI0A 3I64A 1B9NA 3IC7A 5K1YA 4ON0A 3LAJA 3V7CA 5J6XA 1XMAA 3FWEA 4OINF 4NHJA 4P96A 4AIJA 1TLHB 4S05A 1ZRFA 1PDNC 3MQ0A 2ESHA 3P9CA 2YR2A 3RKWA 5JFRA 2A5YB 4A2UA 3GEZA 4HX4A 2QENA 2XAFA 2IA2A 4RAYA 4WWCA 1YW7A 2XKPA 4KUMA 1WI9A 1O3SA 2GXGA 3CUQB 4CZZA 1K79A 4FX0A 5H6QA 4ZYGA 1ZAOA 1QO0D 3I53A 4ENJA 3KP2A 3V4GA 3QP5A 4P5OA 2NRAC 2ZFWA 2OAZA 4WXCA 1SAXA 3I71A 1ULYA 1YW8A 1NHAA 1RZ4A 1K78A 1B6AA 3DFGA 4N9HA 3GFMA 4AD9A 2FMYA 2KJBA 4XLPF 3K9TA 2VXZA 3E6MA 4UVCA 4BAYA 1T39A 4PZJA 5HDGA 4LK1F 1ZLKA 1P6RA 2DK5A 3LWFA 1O3QA 1IZ1A 4KICA 1ZH5A 2NNNA 1Y0UA 4PGHA 1IXCA 5HDNA 3WGHA 3TOBA 3JTHA 2PJPA 2NS0A 4OIPF 5E1WA 2JPBA 1FX7A 1U5TC 3L7WA 5AIPA 4S04A 1ZG3A 4Q47A 4L9TA 5BPDA 2HEOA 4FT8A 4O6JA 3COAC 2K02A 4LGWA 4B09A 2ZJ2A 1YO5C 2ZCWA 1V4RA 2MLGA 3IRRA 3GXOA 4RB0A 1K78B 3L00A 4IVNA 4RGXA 3IL2A 5AIQA 4HLYA 5AONA 1TW2A 2VBXA 5LGNA 2FEZA 1JHHA 1YG2A 5F6FA 2BEOA 2V9VA 3F8CA 1G3SA 3V8KA 3M9AA 1TBXA 5JVTA 4UNOA 2XASA 1S8NA 2WV0A 3RYRA 1BIAA 2VN2A 4AVPA 5L3GA 1FWZA 1HKTA 1F4KA 3EYIA 1I5ZA 3DQVC 1F1ZA 4I2OA 1C0WA 3R0JA 3E5XA 4IRIA 1P4XA 2MC3A 1ZGAA 1T2KA 3QOPA 1SD5A 1T0FA 4KYWA 3F8NA 3WTUC 5HS8A 2J5OA 3H92A 3FM5A 1AWCA 3HRTA 5BQTA 3SQNA 3CDHA 1ZG5A 2EB7A 3L9FA 3BDDA 4DQ2A 5D6FA 2GA2A 2UWMA 4KIFA 1XN7A 2PFBA 2XROA 2WWYA 3T0YA 2M5WA 2AXLA 4M74A 5CVVA 1F9NA 2EFPA 1HXDA 1OPCA 1WRJA 5FD6A 3HOTA 4M9ZA 4ZYDA 4MQ9F 3E97A 4U7BA 2FNPA 3P7NA 3ROUA 2EFOA 4LK0F 2O6GE 4A12A 1XSDA 2IT0A 1USTA 1BI1A 2MD5A 3HUGA 2V1UA 4BHBA 4L18B 1RNLA 3WG9A 5LHIA 3T8TA 1XGMA 1GXQA 2STWA 1ZREA 1PP7U 4L9JA 4ESBA 3MZYA 4B8XA 4ZYHA 3ML6A 3HRSA 3E6DA 1XGNA 2MLKA 2C6YA 5J8CA 3E3VA 2H6CA 3LFKA 5LRSA 2PN6A 1YS6A 3GO5A 2D1VA 2ZO4A 3K1PA 2OZ6A 3DPTA 1OYIA 3ULQB 4EVIA 2L54A 5DCMA 1HKQA 3LQRA 2KRFA 1KGSA 1I27A 2QLZA 2CFXA 3M7GA 1R5HA 4WXDA 5CVJA 2XGXA 4ENKA 1JGSA 4HV5A 5CVUA 1XGOA 3R4KA 2GWRA 1RUOA 3DXJF 1YQAA 2HQRA 3L2CA 2P7VB 3CLOA 1WKMA 1LQ1A 3QPHA 3DKWA 1D8JA 1TW3A 3WTXC 1STZA 3RPUA 2GZWA 3P9KA 3O3KA 2FQ3A 1GHCA 2CO5A 4LJZF 3WE3A 1HKSA 1W5SA 4UV8A 1U8RA 4A6DA 3D0SA 5L3FA 2E1CA 3TO6A 3F23A 2H6BA 4IPAA 1SMTA 4BH9A 3GZ5A 2FBIA 4WXHA 1CF7A 4FX4A 2HYFA 4Y17A 1KQ0A 2HZTA 5CJ9A 2TDXA 4YIFA 4OOIA 4A0XA 3REOA 2HKXA 2CSOA 2XKOA 5DCMB 2BGCA 2L4MA 2WC2A 3RI4A 2IW5A 3HTUA 2V1XA 5D5WB 2JPCA 3D5LA 4HV6A 2FU4A 5L3EA 4G9YA 1MD0A 1ZYRF 3H3ZA 3K1MA 1HBXG 5K5QA 1QZZA 2Z99A 4HQMA 4YFKF 1R36A 4DNCA 2ZKZA 4LB6B 1BC7C 3BJAA 4ZZDA 4GGGA 1REPC 2Z3YA 2DU9A 4RB2C 1MDMA 2EFWA 3GVAA 3QP6A 4O5VA 3QU6A 4Q5SF 4U0WA 3W6JB 3U1DA 1TQIA 3KFWX 3GYHX 1ZRCA 1ZN2A 5D5XB 1RIOH 3K2ZA 1BN5A 2GXBA 1R1VA 3ZMDA 2DO7A 3WGIA 1FC3A 1CF7B 1P92A 5IT3A 3JSPA 2YSRA 4NB5A 3TO7A 4IXAA 2P5LC 3DP7A 1E2XA 2HS5A 1T6SA 2HQNA 4GCVA 1P4AA 3RYPA 1MZBA 3V7RA 3ERED 3JSOA 3QAHA 5H20A 2QQAA 3GLXA 1L0OC 1ON2A 2DFIA 4UVAA 4KDPA 2E1NA 2B0LA 5EEHA 1TNTA 3GFLA 2ZMEA 3K1NA 3HIFA 4G94A 4CHUA 2M45A 3ECHA 3ZMVA 3GFJA 5HDKA 1Z9CA 3OV8A 1LVAA 3KP4A 2DAOA 1MDMB 1FPQA 2DBBA 1Z6TA 2G7HA 4OIRF 5HS7A 2RN7A 3B02A 2W57A 5FD5A 3GZ6A 2XRNA 1IN6A 1B1BA 4HDUA 3ECOA 2GAUA 1R1UA 3GWZA 6PAXA 5LRRA 3KZZA 2OZUA 4PDKA 3J81Z 2FBKA 3I54A 2XIGA 5E8IA 1W4MA 2K4BA 4HBLA 4HYEA 3BPXA 2BYVE 5DCFA 2Y0MA 1OYYA 3HYIA 1QQIA 1HW1A 4L0ZB 4BNCA 2VBYA 1XGSA 2EA4A 3V8JA 4GO1A 3LAPA 3RDIA 2STTA 4Q48A 2F5DA 3ZP5A 2VBZA 5BS6A 1B4AA 2ZMEB 3U2RA 4OIQF 3F8FA 4YFXF 4I0BA 1S3JA 1R22A 2FOKA 4D0PA 3TGNA 3KP6A 1XCVA 3LA3A 4HA8A 3VFZA 4UV9A 1J59A 2H27A 3EDPA 5HLGA 1H0MA 2XAQA 4U0YA 2QYOA 4I09A 1BIBA 3MFKA 2PMUA 1IN7A 2HKOA 3HRMA 1SFUA 2D2WA 1S6LA 4EMSA 2FF4A 1LNWA 3ABTA 2D45A 2Q0OA 2KIMA 4R1HA 3QU3A 3KE2A 4M9SA 2IRFG 3I5UA 3BP8A 1JXSA 3J80Z 5ICEA 1JE8A 2OD5A 2FA5A 5ICFA 1FP1D 2FXAA 3MCZA 4Y13A 4IRGA 2O3FA 3LA7A 3IKTA 3FMQA 1OYWA 2BBYA 4Y15A 1I1GA 4PGGA 3FX3A 5DDGA 3JTGA 2HWVA 3FXRA 3M8EA 3VODA 1IW7F 1W5TA 3U9GA 3HOSA 2P4WA 4EJTA 5LEKA 4XRFA 2A61A 1YS7A 5K5RA 1FYMA 1R7JA 1AOYA 2YX7A 4CO8A 1R00A 3ZPLA 4I7HA 2EV5A 1SFXA 3R0AA 5LEJA 1O7LA 2QWWA 2XAGA 4L0YB 4A0YA 1Z91A 4ESFA 1SD6A 1O57A 2DTRA 1FY7A 5JHUA 1UHWA 5CVIA 4LLNA 4KN7X 1XSVA 2XV4S 3J80K 2EWNA 1IRGA 2WTEA 5IT9Z 4HW0A 2HTSA 2IPQX 5TJJA 1G4DA 2FMLA 4HX7A 2P5VA 1ON1A 1O3TA 1HSJA 1S29A 2EA2A 1QBJA 1GVJA 1IN8A 1IRFA 2O61A 1IUYA 3N4MA 1LEAA 4L5IA 1FBQA 2A68F 4KMFA 5HVQC 1RUNA 3F6VA 1A04A 3RIRA 2PMHA 2QUFA 1B59A 4ESJA 1G3YA 3KP7A 1UHMA 2ZXJA 2O0YA 2YU3A 2P6SA 2JSCA 2VC0A 4XSZF 1W7PD 3FMRA 4I01A 1IN4A 3GX4X 4H0EA 3RKYA 4ZZLA 2CWEA 1UCRA 2A6EF 3W6KB 1U5TA 1FSHA 4BYYA 4P55A 3LSTA 4CDGA 2IJLA 3GF2A 3HSRA 1E17A 1S7OA 3KZYA 2O8XA 4MQVA 1PP8F 1USSA 2M30A 4EM0B 3EUHA 3BJOA 4HZFA 3PQJA 1WWXA 1X3UA 1L3LA 4R8HA 5E17F 1D8KA 2O03A 3E6CC 3ZN0A 3F8MA 3G3ZA 4OIOF 1CGPA 1MGTA 4EQQA 1R5GA 2XAHA 3VEPA 4OU0A 3I59A 4L5JA 3CUQC 2OQRA 5F64A 1O7FA 2MH9A 4NQWA 3H3UA 2HFHA 1Z7UA 3HHGA 1QNTA 5A2QZ 2LSOA 4LLGF 2ETHA 1HQCA 5LLQA 3F8BA 2VOPA 3LQQA 1XDSA 3SZPA 2CW0F 3HSFA 2PQ8A 3ZMUA 1U5TB 2ISZA 1SFEA 2LNBA 1LEBA 4LLLA 2VONA 3KP5A 5FO5A 3R60A 2A07F 1FOKA 4IF4A 1TQMA 3SHFA 2JT1A 1UB9A 4RAZA 5DD4A 2JRTA 2DPDA 4KA4A 1UFMA 1XMKA 2PG4A 2X0LA 3DPLC 4HX8A 1J0RA 1EH7A 1BM9A 2Y48A 1TQPA 5DUKA 5D5UB 2QZ8A 2K86A 2V79A 1OKRA 2JTVA 4O3MA 2LKPA 4UVBA 4WX9A 3T5XA 2F5EA 2DI3A 4KNYA 5ICGA 4WCGA 3I59B 3CO6C 3HHHA 2K7LA 3HSEA 3MEXA 2Q2EA 3L09A 1JHFA 1YYVA 2G9WA 4AIKA 3NQOA 5A2QK 3K69A 4RB1A 5BMZA 3SXYA 2JZYA 2K4JA 4IRHA 4ASNA 3WTZA 5LGTA 2RKHA 1U6GA 3BROA 1ZARA 2DPUA 4AIHA 2UZKA 4LMYA 4CGZA 2YX4A 2PEXA 2CGPA 3DF8A 2E7WA 4MHGA 3BJ6A 3E5QA 1O3RA 2Y75A 2XAJA 3ISPA 1Z05A 2UXNA 2FRHA 2W24A 3RKXA 4A5MA 3EQLF 4CYDA 3VB2A 3EYYA 3G73A 3IHUA 5D6EA 5BPIA 4YFNF 4UXNA 3F22A 1BJAA 1YW9A 1FZPB 2DQRA 1HW5A 5D4RA 5LHGA 2HOEA 5FGMA 5DEQA 3E6BA 1EH6A 5CVRA 4ZYEA 3S2WA 2Q8KA 3Q9SA 5ILVA 2X4HA 1MJ9A 2L02A 3TKYA 2J5PA 4HOBA 1DP7P 2EV0A 1I1SA 2ADUA 2ELHA 5EEGA 5E1XA 3R6SA 5ERIA 4N9IA 2RV8A 5D4SA 3WU0A 4MEYF 3I4PA 3F6OA 5H6RA 3E5UA 2L4AA 4U0VA 4Z2YA 3HTSB 5ICCA 4EJOA 2IP2A 3KETA 3K0LA 3R61A 4M6XA 4MNUA 4PCQA 3ABUA 4FHTA 5E18F 1J5YA 4OMYA 3FXQA 4G7ZF 1MJBA 4M6YA 2QQ9A 2VT2A 4Q4ZF 3F21A 5KVRA 2RQPA 2PI0A 1DUXC 2VE8A 2D1HA 2HR3A 1KQ9A 1TTYA 3FMSA 5F1RA 2F5FA 4WK8F 5FFXA 2LDUA 4IHTA 1ONVA 2W84A 4QWQA 2NAZA 3V8LA 3DEUA 1KYWA 4RGUA 4KFCA 4K2EA 1F5TA 3WTVC 3AAFA 2ZBKA 3IWFA 3RJPA 1U78A 3C3WA 3VOEA 5J8FA 2ACJA 3Q5FA 3WTWC 1G6NA 4LG0A 1H9TA 3KLNA 5BOXA 2EJRA 4MTEA 2OBPA 4G6DA 2HGCA 1FYLA 4UHTA 1OMIA 3IRQA 5E20A 1KU9A 4N0BA 2P6TA 1FSEA 1FYKA 3GW2A 5HLHA 4AWXB 3B73A 1XD7A 2Z5UA 2MBFA 3GUDA 3TOAA 4EGYA 2RDPA 1LB2A 3GFIA 3KEQA 2QVOA 2Z33A 3M8FA 1BI3A 3Q9VA 1ZGJA 1EH8A 2RNJA 2NNYA 4JQFA 5D5VB 3TDUC 3MAJA 1SD4A 1W7PA 2EFQA 3MWMA 1VTNC 1KQ8A 4EJUA 4MEXF 2BE5F 5ILUA 3KCCA 2V1DA 4HLXA 3J81K 4XLNF 1ZHFA 1IN5A 2H09A 4BXUA 1PUEE 5FFZA 1T98A 4ENNA 2H94A 2E7XA 4RB3C 4LG0B 1XCBA 1J2XA 3PQKA 4LD5A 1ZRDA 2XHKA 2M87A 2FNAA 2DQLA 1Z1DA 1D5VA 1IXRC 1J9IA 1DDNA 5CYVA 4M9XA 3TDZC 1QPMA 1ZLJA 1ODDA 3P9IA 1QGPA 1WSUA 3RTRA 3C1DA 3FXUA 3QRFF 1LDDA 3I58A 5LGUA 1KA8A 1Q1HA 5ILSA 2MH2A 2FE3A 1SD7A 3CTAA 4A5NA 2LF8A 2P8TA 3LA2A 1W7PB 4GXOA 1P2FA 1H9GA 1FP2A 2R3SA 3CO7C 1MKMA 4YIIA 1KU2A
chains in the Genus database with same CATH superfamily
1XMXA 2F48A 1MMSA 1G3WA 2QSFX 3T8RA 1LDKB 4IHYA 2IA0A 2WY7Q 2FSWA 5L3BA 2PBIA 3ELKA 2GBYA 5EDNA 2JA8J 2VODA 4KN4X 4XLFA 1I6XA 3RZOJ 2E19A 2FBHA 4EM2A 4RBOA 1OLTA 3FZVA 4TV7A 4IOAF 4CZCA 1XB4A 1RI7A 3C7JA 3G4SI 2QBYA 1D3YA 3OL3A 4PK4A 3ZMZA 1S72I 2CQQA 4HF0A 1YLFA 2JQ7A 2K9LA 4A3FJ 2QSGX 4P9FA 4CCNA 1KU3A 5DM6F 2WY8Q 2EPFA 2M8GX 1K7AA 1BL0A 3OYGA 3SZTA 4MFDA 5K5OA 3TP3A 2WV1A 3HJEA 2HTJA 1UZCA 4RLQA 2GQQA 2HYGD 3BQZA 4N4OB 3LMMA 2X1EA 1XSXA 4XSXF 2G7UA 2ISYA 1FBSA 4CSWA 1QPIA 2K85A 2L7MP 3QOEA 1RKTA 3WE2A 2P5KA 2M2EA 4BE1A 4YG2F 3VPRA 1IF1A 3ZGKA 3FHZA 2DK8A 2HPMA 2R7DA 4CA0A 3BPVA 1WH5A 3CCJI 4G7OF 3OYHA 1R58A 1FT9A 2QQBA 2R93J 3TW7A 1OJLA 2KJCA 3WTTC 1N75A 4XRSA 4EGZA 4KIGA 4A0ZA 2K5CA 1EV7A 5HOOA 5HLIA 4A93J 2DT5A 5TRDA 4ZC3A 3I4NJ 1DP3A 3Q3SA 1MBEA 4UB6C 2CG4A 2COMA 1BC8C 1DPUA 5HS9A 2HXIA 4BHPA 5HLTA 3S1MJ 3ZMTA 2ZNZA 4EV0A 3DV8A 1HW2A 1V55H 3WODF 1BOAA 2GIVA 1WVRA 5FB2A 5DD8A 2DW4A 2KISA 2R7QA 3UR3C 5IT9K 3C18A 2A6HF 3EETA 5D8LB 1JKRC 2DTZA 4E7HA 1YIOA 3KP3A 3QPTA 3QPSA 4M3BA 4NDLA 3PIPF 1QZYA 1YE9A 2FJ1A 2CQXA 4CYCA 3B6AA 1LJ9A 1SMYF 1TT0A 1IV6A 1FNNA 5C4JJ 5LBQA 2VT3A 5DTDA 3WU1B 3ZQCA 1XTAA 4LB5A 4FE4A 3H9GA 5IP6A 2VUMJ 2QBYB 2RC4A 3K6GA 4HEA2 1B9MA 4HSTA 4AUXA 4HF1A 3ZMSA 4G6QA 2QSHX 5EG0A 3CUOA 4LFUA 1KONA 5CLSA 2YU9J 1MJAA 2WBMA 3CCUI 2QM3A 2OTLI 2XPUA 3MZHA 4G6TB 4E7KA 1WH7A 4RGSA 4M71A 5IYBJ 3J7YJ 3V7SA 2DJIA 3TQNA 3JRDA 1Z6RA 2GLOA 5KNLA 2VQLA 3H5NA 3I0TA 1P4WA 2OQGA 2KQRA 3FM3A 2LRDA 4I98B 4KITB 2VBWA 5D8KB 3BOQA 3CESA 1X1PA 2X6OA 1K6YA 2E2HJ 2ME0A 4AC0A 4KMUX 2EFNA 1YIJI 5E8GA 1S7AA 2XRLA 3BWGA 4ENMA 2VJ5A 4ZTFA 1K6OA 2OU2A 3L2WA 3BG7A 1TNSA 2ESNA 5ED4A 3JRBA 2M4GA 2Y0SA 5L3CA 1PYVA 2WADA 3BY6A 4L9VA 4CICA 5FLXZ 1YITI 3GMEA 2HDCA 2W25A 2ECBA 3WGGA 4IHSA 1E3HA 4BL0B 2LY2A 2V6CA 3E1SA 5DUIA 3N97A 1GT0C 1NH3A 2M1BA 2KZGA 3KYCB 3RZDJ 3F72A 3M8JA 4M6VA 2IA1A 4P9UA 4EM1A 1WFXA 1VQ5I 3FISA 1W36C 4CYCB 3BR6A 1MMDA 3WTSC 4HQEA 3LSKA 1X4OA 1HSTA 3JW4A 1LVKA 1BI2A 3OYMA 2X1DA 2Z9OA 2DA4A 4IZZA 4M73A 5JI6A 1T38A 4I0AA 3JAMZ 2L01A 3HOZJ 5JR3A 3OOUA 3M1EA 3BLYA 1YFHA 4NC7A 1EKEA 5EG0B 1FLIA 3BQYA 1GUUA 3M07A 4WF2A 4U7DA 2QEXI 1FOWA 2A69F 4L9NA 5HNFA 3ZRGA 3BZ6A 4KIBA 2E2IJ 3ZQHA 3IWZA 2PLYA 2QKMB 3SFZA 3J7AO 3PSFA 4IJAA 3JRGA 2RVCA 4BQOA 4XQFA 2ELKA 1LDJA 3O6BB 4F92B 4BHCA 2DMUA 3VDXA 2AQEA 2IXSA 3MN2A 1U3EM 1IXSB 2NYXA 4XLEA 2GA1A 2OUMA 3NEUA 4HG2A 2IVMA 5EZGA 2MFZA 5DV5A 3SEZA 3CZ6A 4HAMA 2F5CA 3ZN1A 1ACIA 4D5CA 2XUBA 1YTYA 2CS3A 4QLCU 4G7HF 2BV6A 3RPQA 4S0HB 3PFIA 5CQEA 2KIQA 2EV6A 3IKVA 4ANJA 4E7ZA 1KU7A 1R23A 2FQ4A 5HODA 2OA4A 1R49A 2KIUA 1VQNI 5FLXK 4G8XA 4EJWA 1MMAA 3CJNA 1GXPA 1V3FA 2YPRA 4GYGA 1E3OC 3LSPA 4UY8I 1G3TA 1XDUA 3S3MA 4ZH4F 3FHNA 3FXKA 4EJVA 4RS8A 4B4CA 2DXIA 3RQIA 1J75A 4UUVA 2M8EA 3H1CA 3OMYA 3OR1C 4QPQA 5M5WJ 1HA8A 4XBFA 4HPQA 4KT5C 2DLLA 1VI0A 2DFFA 5GTIC 4I02A 2CQKA 1HLVA 2R7FA 1Y56A 4R79A 2JRMA 1OR7A 1JTYA 1FBUA 2LF7A 4MTDA 4ZJZA 4PSXA 2K27A 2KIFA 2W85A 1DU0A 2L3DA 3JAMK 3HRUA 2ZNYA 5KK1A 1EA3A 1R1TA 3Q0WA 3CQZJ 1JT0A 5EZHA 2QKLB 4U88A 1J7KA 4IL6C 5E1ZB 1BBYA 4M72A 2MW8A 2CUEA 2VOOA 4EEFG 3HDDA 3DCFA 4HNTA 3CDLA 3WTYC 1D5YA 4C3HJ 2F2EA 1U9OA 2KKOA 3F3XA 2DMQA 1DPRA 4NC6A 3FF5A 2HNHA 3OOPA 3HGGA 4PSWA 1NG6A 1S9HA 3D1NI 3LOCA 2HOSA 3CUQA 3KEOA 1QA6A 3ZQ7A 3TO9A 3ZR8X 2VC1A 4JK1X 2A3SA 4ETSA 4FASD 1KYZA 3ZQIA 4PJNA 4UUSA 2JA5J 4JBAA 1D0ZA 4GYIA 1U2WA 3GTKJ 2LK2A 4E70A 2AS5F 5DYMA 2XGCA 4HF2A 4MGRA 4F7ZA 2VE9A 3O2PE 3PSIA 4XOTA 2LYCA 4IEJA 1H8AC 2UXXA 3OSFA 3AFHA 1QZEA 4V2GA 2P7CB 2MA3A 2Y2ZA 3KLOA 4BQAA 4A6EA 1ZG1A 3T1BA 3OWTA 2YS9A 4OMZA 5L3DA 3JREA 1IAWA 4CH7A 5LHHA 3LSJA 1AKHA 4CXFA 4F91B 2VL8A 2EK5A 3OL4A 3CCYA 4AYBN 3MKYB 3NRVA 4RGRA 2NXNB 3OYAA 4PFOA 2CYYA 2XVCA 1OFCX 1LFUP 1WQ2A 3I9V2 5B66C 4HDVA 2RGVA 4RAFA 1YJNI 1BI0A 3I64A 3RPUD 1B9NA 3IC7A 1MBKA 5K1YA 2DT7B 4ON0A 2NVTJ 3LAJA 3V7CA 5J6XA 1XMAA 4X6AJ 3LSIA 3FWEA 4OINF 2NVQJ 4NHJA 4P96A 4AIJA 1TLHB 2CFOA 4S05A 1I50J 1ZRFA 1PDNC 2EQRA 3MQ0A 2ESHA 3P9CA 5JHFA 2YR2A 2KPMA 1KZHA 2Y30A 4XMYA 3RKWA 5JFRA 1R71A 2A5YB 4A2UA 4M3EA 1P7IA 3GEZA 3DKXA 4HX4A 2LY1A 3OSGA 3CLQA 3LSGA 2QENA 2XAFA 2IA2A 5JVGF 4RAYA 4WWCA 1YW7A 2XKPA 4KUMA 1WI9A 3QYFA 3I3LA 1X3ZB 1O3SA 2GXGA 3CUQB 4CZZA 1WPKA 3CMAI 1K79A 4FX0A 5H6QA 3BG3A 3CP2A 4ZYGA 1ZAOA 1QO0D 3I53A 4UUSB 2M0MA 4ENJA 3KP2A 3V4GA 5B5EC 3UNGC 4D1QA 1UG0A 3QP5A 4C2TA 4P5OA 2MC4A 2LG4A 2EIJH 1UJ8A 2NRAC 2ZFWA 2OAZA 4WXCA 3Q0VA 3AG2H 1X3WB 4B43A 3CCLI 2MYSA 2L9RA 1SAXA 3I71A 2OF7A 2V4JC 1ULYA 1YW8A 1XS9A 3BG9A 4HNUA 3HM5A 1NHAA 2CW8A 2Z1DA 1RZ4A 1K78A 1AKHB 1B6AA 3DFGA 4N9HA 3WU2C 3GFMA 4AD9A 2FMYA 2HZDA 3CD6I 3CDIA 1BR4A 2KJBA 4XLPF 3K9TA 3FK6A 2VXZA 3E6MA 4J00A 4UVCA 4BAYA 1T39A 3AG3H 2JSPA 4PZJA 2HXOA 5HDGA 3J7ZI 1ZK8A 2R7OA 4LK1F 1AHDP 1ZLKA 1P6RA 2DK5A 3LWFA 1O3QA 1NTCA 1JUMA 1YHQI 4CCMA 1LE8A 1IZ1A 4KICA 1ZH5A 2JK3A 2NNNA 1Y0UA 3DEEA 4PGHA 3OYDA 1IXCA 5HDNA 4JOMA 3WGHA 3TOBA 3JTHA 2PJPA 2NS0A 3C2GA 1IUFA 3OYNA 4C9YA 4OIPF 5E1WA 2X1CA 2JPBA 1FX7A 1U5TC 3JR9A 3LSHA 3L7WA 5AIPA 2DA7A 4S04A 1BR1A 3SEQA 2Z2SB 1ZG3A 4B1RA 1YJWI 3NWSA 1HF0A 2HDWA 5IOYA 3S93A 4Q47A 2VI6A 4L9TA 5BPDA 2HEOA 4FT8A 2HVQA 4O6JA 3COAC 2M0CA 2K02A 4LGWA 5F27A 4B09A 2DA2A 3EUHC 5M3MJ 2I10A 2ZJ2A 4LIUA 1QHGA 1YO5C 3HB9A 3A01A 4FQGA 4A3DJ 1VQMI 5DM7F 4BBRJ 1XPXA 2RNGA 2ZCWA 1V4RA 2QF7A 2ZC2A 2MLGA 1T95A 2H1KA 1IGNA 3IRRA 3GXOA 4RB0A 3PJRA 2CRGA 5KAFC 4XORA 2BXYA 5IPAA 1K78B 3L00A 3S16J 4IVNA 1TWAJ 4RGXA 5AIQA 3IL2A 1GLNA 2OPTA 4HLYA 4XNFA 5AONA 1ERDA 1TW2A 5GP9A 2HOAA 2VBXA 2BZTA 2EZLA 1JJ8C 5LGNA 1TWCJ 2FEZA 1JHHA 3IV5A 1W36D 1YG2A 1X1CA 4DOZA 5F6FA 5HNHA 1W0TA 2IS1A 2BEOA 3C2HA 4E7JA 2V9VA 3F8CA 4F55A 2OTJI 1G3SA 3VWBA 1R9TJ 3V8KA 3M9AA 1TBXA 5JVTA 1LE8B 4UNOA 2XASA 1S8NA 4AYBA 5FJ8J 2WV0A 3RYRA 5IY5H 3D5RC 1BIAA 5JLXA 2VN2A 2NOGA 2LP0A 3MVPA 4AVPA 5L3GA 2B7EA 2R7XA 2AHQA 1FWZA 1JUSA 1A35A 5IP7J 3LSRA 1APLC 1Z67A 4YRVA 1HDPA 1XX5A 1FMWA 1HKTA 3IUOA 1F4KA 3EYIA 2X6WA 1RC9A 1I5ZA 2I5UA 3DQVC 1F1ZA 4I2OA 1DGWY 1C0WA 3R0JA 1X1BA 1N77A 5IP9J 3E5XA 1AA7A 4IRIA 2HI3A 1P4XA 1MSFC 5GAHJ 2MC3A 3DU6A 1ZGAA 3IAM2 1JKOC 1T2KA 3QOPA 3CCEI 1SD5A 1TT5B 1T0FA 2LFBA 3HKZA 4U87A 2KP6A 4KYWA 3F8NA 2W82A 3WTUC 3FBNB 5HS8A 3W6VA 5TGTA 2J5OA 5GPCA 3H92A 3FM5A 2IGNA 1AWCA 3HRTA 5BQTA 3SQNA 1QVUA 3A01B 2XPWA 3CDHA 1ZG5A 2EB7A 3L2QA 1VQPI 2JUCA 1YI2I 2DJNA 3L9FA 3BR1A 3BDDA 4DQ2A 5D6FA 1K4TA 1XC5A 4FE7A 1TWHJ 2GA2A 2K9QA 2UWMA 3CMMA 4AVZA 4KIFA 1ZR4A 3BZKA 5EYRA 3GTMJ 1OCTC 3CMEI 3E7LA 2FOWA 2HQ5A 1XN7A 4A3LJ 4XOPA 1T08B 4DGWB 2KMUA 2PFBA 5CKTA 2GM4A 2XROA 3GTOJ 3S3NA 1ITYA 5E79C 2COBA 2WWYA 3S8PA 2M7AA 2NS8A 1SANA 2DA1A 2VJJA 4KJZA 2CQNA 4W1UA 3NAUA 3T0YA 4LIVA 1WI3A 2M5WA 4BACA 2AXLA 2O7OA 4M74A 5CVVA 2HU9A 1I39A 1F9NA 3DTKA 3OIOA 2EFPA 1HXDA 1OPCA 4CCOA 4IO9F 2E1MB 2XPVA 1WRJA 5FD6A 3HOTA 1OCOH 4M9ZA 5F04A 4ZYDA 4MQ9F 2LBFA 3E97A 3HZJA 3K4CA 3HC7A 4U7BA 2FNPA 3P7NA 3G2BA 3ROUA 2EFOA 2R4GA 4LK0F 2O6GE 1WJFA 4A12A 2M3AA 3H5RA 1XSDA 2IT0A 1USTA 3BTJA 1BI1A 2Z16A 2MD5A 1EJ9A 1Y1VJ 1FOXA 3HUGA 3DBHB 2V1UA 3OS1A 4BHBA 3DBLB 3KEYA 4L18B 1RNLA 3WG9A 3K4JA 5LHIA 4A3EJ 3T8TA 1XGMA 1GXQA 2STWA 2BW3A 3RKQA 1ZREA 1PP7U 2BOLA 4L9JA 4ESBA 3B6CA 3MZYA 4B8XA 4ZYHA 3ABMH 2E5NA 3ML6A 3HRSA 3A02A 2K9NA 5GAGJ 3VSKA 2WAQA 3E6DA 3K7AJ 1XGNA 2BVLA 4ZDPA 3JRFA 2LR8A 2MLKA 2A6TA 2C6YA 5J8CA 2JA6J 2JWTA 2MGQA 3E3VA 3QPLA 2H6CA 5EF6A 2TRTA 3A0BC 3LFKA 5LRSA 2IGKA 1OCPA 2PN6A 2PMZN 1W0UA 2B63J 1YS6A 3GO5A 2CV1A 2D1VA 2JVGA 2ZO4A 3K1PA 4I6ZA 2OZ6A 2NS7A 1DQUA 2ID3A 3DPTA 1OYIA 3FXOA 4B48A 3ULQB 2Y69H 4EVIA 4PJ0C 4QIWN 2L54A 5DCMA 1HKQA 5K7FA 4RA2A 3BTCA 3LQRA 1H88C 4BY1J 2E60A 1K83J 1VQ8I 2KRFA 1KGSA 1I27A 2QLZA 2CFXA 3KIOA 2LBFB 4IX7A 3PNVA 3M7GA 1R5HA 3GTQJ 5FLMJ 4WXDA 5CVJA 4CCLA 1VQKI 1MW7A 5FRMA 2KHMA 2XGXA 4ENKA 3DKYA 1JGSA 4HV5A 5CVUA 4XN0A 3A2KA 1XGOA 3R4KA 2GWRA 1IDYA 3ESWB 1RUOA 3DXJF 4JX6A 4D5FA 3D5SC 3FDYA 3HUGB 2NVUB 2IS4A 1YQAA 1Z21A 2HQRA 3L2CA 2P7VB 3CLOA 1RR8C 2FD5A 1D1AA 3IAS2 1WKMA 1LQ1A 1LPQA 3QPHA 3DKWA 1D8JA 3BTIA 4QPOA 1TW3A 2BW3B 3WTXC 2JA2A 2DFEA 5CQGA 4YELA 2DODA 1STZA 5F08A 4A3IJ 3RPUA 4XKVA 5E3NA 3K4LA 2W1OA 2GZWA 3P9KA 3O3KA 2FQ3A 3CC2I 1GHCA 2HOTA 2CO5A 4LJZF 3LNQA 3WE3A 1HKSA 1W5SA 3K4BA 4UV8A 1U8RA 4A6DA 3GTLJ 3D0SA 4C3JJ 3KYDB 5L3FA 2E1CA 1T56A 3TO6A 3F23A 2H6BA 1P9QC 3V42A 4IPAA 1SMTA 1IJWC 4BH9A 3GZ5A 1VFCA 4ZYAA 4BU2A 2FBIA 1BOBA 4DBRA 4WXHA 1CF7A 1W1WE 2PX9A 4FX4A 1Y8RB 1FJLA 2HYFA 1TP4A 4Y17A 1KQ0A 2HZTA 1RETA 2X85A 5CJ9A 3IH4A 2H8RA 2TDXA 4E6KG 3W2AA 1D0XA 4YIFA 2EZHA 4OOIA 1SVMA 4A0XA 3REOA 2HKXA 2CSOA 2XKOA 5DCMB 2BGCA 2L4MA 1DGRM 1ETOA 2WC2A 2X9DA 2O5RA 2R5YA 1WJCA 3RI4A 2IW5A 4EATA 3HTUA 4JYKA 2V1XA 4JP0A 5D5WB 2L7ZA 4OWRB 4NNJA 2JPCA 1XG1A 4PJLA 1JKQC 2GOMA 3G6EI 1N78A 3IH2A 3D5LA 2FX0A 2FU4A 4HV6A 4G9YA 5L3EA 3W2VA 1MD0A 4D9JA 4RAGA 1X1AA 1ZYRF 3OS2A 1WJBA 4HRIA 3H3ZA 1A6IA 3K1MA 1HBXG 5LFAA 2K3FA 5K5QA 2V26A 4PJMA 3H0DA 1HC8A 1QZZA 3OY9A 1D1CA 2A5WA 2Z99A 4HQMA 4II3A 4YFKF 1T8IA 1R36A 4DNCA 4DZPA 2ZKZA 4CUGA 2LKXA 2NOJB 5IYDJ 4LB6B 1BC7C 2HPIA 2H1LA 3CJRB 2BY3A 3BJAA 3DLAA 1JI8A 2K9MA 4ZZDA 4GGGA 1J09A 2R0QC 1JKPC 1REPC 1UMQA 3QQAA 2Z3YA 2CV0A 2DU9A 4RB2C 1MDMA 2EFWA 3OYLA 4BUPA 1ZELA 3GVAA 3A1YA 2RAEA 3QP6A 4O5VA 3LL7A 3QU6A 4Q5SF 4U0WA 4ITVA 3W6JB 5F0HA 3U1DA 2QCOA 3I4MJ 1IV8A 1IRZA 2R7ZJ 1TQIA 3KFWX 5IYCJ 2YUSA 3GYHX 1ZRCA 3OYIA 4C2MJ 3TBIA 1ZN2A 5D5XB 1RIOH 3KYLA 3K2ZA 1BN5A 1DU6A 2VQHA 2GXBA 1N25A 1R1VA 1R5ID 4AU7A 3ZMDA 2DO7A 3WGIA 1RPWA 1FC3A 3OYKA 1CF7B 1UAAA 4V2FA 1LFPA 2DOEA 1P92A 5IT3A 1G2HA 2R92J 4BE0A 3JSPA 2YSRA 1Z3XA 4NB5A 2ZXWH 3TO7A 1RR7A 4PUSA 2F5VA 4IXAA 4NBQA 3VYRB 3KZIC 2P5LC 3DP7A 2RQQA 3KX2A 1E2XA 2R5YB 2DA6A 2HS5A 1FEXA 1T6SA 3ZQLA 2O9LA 2XAUA 3FKJA 2HQNA 4GCVA 2E2JJ 1P4AA 3RYPA 1P7JA 1MZBA 3V7RA 5TISC 1E0EA 2PMZA 5C3EJ 3ERED 2CJJA 3JSOA 5C4XJ 4KISA 3QAHA 2OCCH 5H20A 2ICWG 1MH4A 2LOOA 2QQAA 3GLXA 1L0OC 1ON2A 3PO2J 2DFIA 4UVAA 4KDPA 2E1NA 1LUJB 2B0LA 2D5VA 5EEHA 5FKNA 3MKWB 4XRMA 4ZDLA 2VB6A 4LITA 1TNTA 3GFLA 4P1WA 2IS6A 2ZMEA 3G71I 3K1NA 1Y39A 3HIFA 4G94A 4CHUA 2DN0A 2M45A 1MBGA 3ECHA 3PO3J 3ZMVA 2IEKA 4LOCA 9ANTA 3GFJA 5HDKA 2VKHA 1Z9CA 4E7SA 4XIDA 3OV8A 4BQNA 1LVAA 3KP4A 5BNGA 3ZCOA 3K4KA 2DAOA 1MDMB 1FPQA 1VQ6I 4XKWA 3TMOA 3HKZN 4B47A 2E1MC 2DBBA 2AQFA 4Y7NJ 1Y8QB 1Z6TA 4HNVA 2G7HA 4OIRF 5HS7A 2RN7A 3DWLE 3B02A 2W57A 5FD5A 4YIRX 2H8WA 3AKZA 2XRNA 1IN6A 3OYFA 3GZ6A 2DOAA 1B72A 3F0CA 1B1BA 4HDUA 2E35A 3S14J 2NVXJ 3H9QA 1X2MA 1I3QJ 3ECOA 3VSLA 4BS9A 2VJIA 3GLLA 3WHBA 2GAUA 1R1UA 3GWZA 6PAXA 1UHSA 3KZZA 5LRRA 2OZUA 4PDKA 5F0CA 4NUBA 1OCZH 3J81Z 1Y6IA 2FBKA 3I54A 2XIGA 5E8IA 2EH3A 1I3AA 4MFEA 1T0FC 2R7RA 4ABZA 3OR2C 2A05A 1CQTA 4V19K 1W4MA 2K4BA 4HBLA 4HYEA 5J1YA 3BPXA 2VASA 2BYVE 5DCFA 4BXFA 1GVDA 2CMPA 2XGEA 2Y0MA 1OYYA 2CUJA 3HYIA 1QQIA 1VQLI 1HW1A 4L0ZB 2IGMA 3OYBA 2VBYA 4BNCA 3IH3A 1NG7A 1XGSA 1WHUA 2LC2A 4XKBA 2EA4A 1ENHA 3EPZA 1BJZA 3V8JA 5J1RA 4A3CJ 2X48A 2XDVA 4GO1A 3MKZA 3LAPA 3BTLA 2Y9ZA 2IS2A 3RDIA 2EZIA 2STTA 1BR2A 4Q48A 2F5DA 3ZP5A 2VBZA 5BS6A 2O8KA 1B4AA 2ZMEB 2W00A 3U2RA 2E5ZA 1RKWA 4OIQF 3F8FA 3KPHA 4N4NB 3GCMA 4YFXF 4I0BA 1S3JA 1R22A 4H4KC 4BXXJ 2FOKA 4D0PA 3TGNA 2QGUA 3KP6A 1XCVA 2BVMA 1SFOJ 3PIOF 3S17J 1JT6A 3LA3A 4HA8A 1IG7A 3VFZA 5CPRB 4A3MJ 4UV9A 1J59A 1SC7A 2H27A 4GFBA 1SVOA 2F4MB 3EDPA 3S1RJ 5HLGA 2L9NA 1H0MA 2CUFA 2XAQA 2WAQN 1GV5A 4U0YA 1VQ7I 2QYOA 4I09A 4F3QA 1B72B 1BIBA 3MFKA 1MBFA 2PMUA 1IN7A 1Z77A 3S32A 2ZB9A 4IKFA 3N05A 2HKOA 3HRMA 1SFUA 3E0JB 5GTHC 3QYEA 2D2WA 1S6LA 1SAUA 4EMSA 1YRNA 2FF4A 1HOMA 1LNWA 3ABTA 2D45A 1ZQ3P 2Q0OA 2KIMA 2XF7A 3QU3A 4R1HA 5C44J 5GADJ 2LD5A 1JJ6C 3CC7I 3SDBA 2KDOA 3KE2A 4M9SA 5GAEJ 2IRFG 3I5UA 3NARA 3BP8A 1JXSA 3J80Z 1ORKA 4GDFA 1JGGA 2MG4A 5ICEA 1LFBA 1JE8A 1TWFJ 2OD5A 5E3LA 2FA5A 5ICFA 4DIQA 1S7EA 1FP1D 3CCSI 2HYJA 3HBLA 4A69C 2FXAA 1FOYA 3MCZA 3BCBA 4Y13A 1I6HJ 4IRGA 2KRCA 2O3FA 3GTGJ 3X2QH 2L9VA 2DMTA 3HG9A 3LA7A 3IKTA 3FMQA 1OYWA 2BBYA 4CCKA 1YX3A 4Y15A 4W97A 1I1GA 4PGGA 1Q1VA 3FX3A 5DDGA 3HOWJ 4BQQA 3JTGA 2HWVA 3FXRA 1ETVA 2XF5A 3ABKH 3M8EA 4DJAA 2CUZA 3VODA 2ZFUA 3OYEA 3OIPA 3PFYA 3QYBA 1EF4A 1IW7F 4FCYA 1W5TA 2BHYA 3U9GA 2I8DA 2GXAA 1RRJA 4CCJA 5B1AH 3HOSA 2P4WA 1ZGWA 2WB1N 1MH3A 2KDZA 4EJTA 3DEWA 5LEKA 1VQ9I 4XR6A 3MMYB 4XRFA 5EJCA 2LKSA 2A61A 4BDYA 4IQJA 3SFIA 1QVTA 1YS7A 4A3BJ 5K5RA 1FYMA 1R7JA 5K7HA 2DA3A 1AOYA 2YX7A 4HSRA 4CO8A 4Y3OA 1A36A 1R00A 1D1BA 2R5ZA 3ZPLA 4I7HA 3FIWA 4GRIA 3TEDA 2EV5A 4E7IA 1OCRH 1HDDC 1SFXA 3R0AA 5LEJA 1O7LA 2QWWA 2XAGA 4L0YB 3M1CA 3IP4B 1PJRA 2KLOA 4A0YA 1Z91A 4ESFA 2X6YA 1F36A 1YRNB 3DTEA 1SD6A 1X19A 3U21A 1O57A 2DTRA 4IOCF 1VQ4I 3A4CA 1IO2A 1FY7A 4Y4RA 4B44A 5JHUA 1UHWA 5CVIA 4LLNA 1FIPA 4KN7X 1XSVA 2XV4S 2TCTA 3J80K 2EWNA 3CMYA 1IRGA 2WAFA 2WTEA 3BG5A 5IT9Z 3WG7H 3G1OA 4HW0A 2HTSA 1WJDA 2XF6A 3LFUA 2L5QA 4X0GA 3CJTB 3GTPJ 3L2UA 3DPUA 1NK3P 3FBIB 2IPQX 5TJJA 1G4DA 2FMLA 4HX7A 2P5VA 5M5XJ 3PNTA 3H9JA 2JJ7A 5E3OA 3MZ8A 5EGOA 1PVEA 1ON1A 1O3TA 3OYCA 1HSJA 1S29A 1R4NB 2CW7A 2E1OA 2EA2A 3O8GA 4RLFA 4Y33A 1QBJA 3H35A 1GVJA 3CCVI 2ID6A 1IC8A 1IN8A 4XM3A 1IRFA 2Y31A 4M3FA 2O61A 4Z6YA 1IUYA 3N4MA 1LEAA 4L5IA 1ZR2A 4A3GJ 4XICA 4BJTA 3DU5A 1V54H 1FBQA 3JCUC 3GBGA 1BW6A 3L1PA 2A68F 4KMFA 3HPGA 5HVQC 4BJ6C 3H5AA 1U9NA 1RUNA 3F6VA 3HL2A 1A04A 3RIRA 1X58A 2PMHA 2QUFA 4PFPA 1B59A 4ESJA 1G3YA 3KP7A 4I99C 1Z7LA 2KL4A 2E36A 2LY9A 1UHMA 4G12A 2IGOA 2ZXJA 2O0YA 3W2WA 2VQGA 1TWGJ 2YU3A 3OS0A 2P6SA 2QQ8A 2JSCA 4A3KJ 2VC0A 4I01A 1W7PD 3FMRA 4XSZF 2R5ZB 1IN4A 2DFHA 3EUAA 3GX4X 3CCMI 4H0EA 3PNYA 3RKYA 2X51A 4ZZLA 1MBJA 4J01A 2LVSA 1A5JA 4C30A 2CWEA 1JTXA 3CF2A 4M3GA 2K3PA 1RESA 1UCRA 2A6EF 1VQOI 5FKKA 1U5TA 3W6KB 1TC3C 1WCMJ 2V9PA 1FSHA 4D7MA 1MIJA 2K40A 1D0YA 4BYYA 2ZJQF 4P55A 3LSTA 4CDGA 2IJLA 3GF2A 3HSRA 2VLAA 1R4MB 2JA7J 1MSEC 3SYTA 3UKGA 2MSYA 1E17A 2BY2A 1S7OA 3KZYA 2O8XA 4MQVA 1K4SA 1ETQA 3PM1A 4ZTJA 1PP8F 1USSA 3JRIA 2ZJRF 4BBSJ 1OR7C 2M30A 4EM0B 3EUHA 3BJOA 4HZFA 3PQJA 3U1KA 4D7NA 2HQAA 1X4PA 4E7LA 3RQ4A 1WWXA 2VQCA 5EGOB 1X3UA 3BC8A 1FTZA 1L3LA 4R8HA 5E17F 3ONQA 1D8KA 2O03A 3ZN0A 3E6CC 4DW6A 3F8MA 4RM2A 3G3ZA 2W48A 4BGDA 4OIOF 1CGPA 1MGTA 1SVLA 3BCAA 4ZDOA 3BZCA 4EQQA 1R5GA 2XAHA 3VEPA 2P0WA 4OU0A 2F6CA 4QSHA 3I59A 4L5JA 3CUQC 3FXJA 1QHHD 2DDAA 2OQRA 5JLWA 4OAZA 5KHDA 5F64A 1T33A 1UELB 1O7FA 2MH9A 3EUKL 4FETA 4NQWA 4A3JJ 3H3UA 3GTJJ 2HFHA 2L7KA 1MNMC 1Z7UA 3CP8A 1FTTA 2EBIA 1E3PA 4Y52J 3HHGA 1QNTA 3Q0UA 1VF9A 5FROA 2LSOA 4BEHA 3ABLH 5A2QZ 2DOFA 4LLGF 3OYJA 3I55I 2ETHA 3K70C 2AXTC 4DYQA 3HXLA 4BKXA 1HQCA 1ZKGA 5LLQA 1A31A 3F8BA 2K9SA 2VOPA 2WB1A 3LQQA 1XDSA 3SZPA 2CW0F 3L2VA 4BJ5C 2VPLA 3F9KA 3JRHA 3HSFA 2PQ8A 3ZMUA 1U5TB 2ISZA 1SFEA 2LNBA 1LEBA 4LLLA 2VONA 3KP5A 5FO5A 3R60A 4E4HA 3CCQI 1V5FA 1NK2P 2A07F 2OCEA 1FOKA 4IF4A 1TQMA 1G59A 2JUGA 4BDZA 2ZMEC 3SHFA 2JT1A 3CJQB 5DS9A 1MMGA 1UB9A 4RAZA 2KT0A 5DD4A 2JRTA 2BXZA 3VYUB 2DPDA 3S2DJ 4KA4A 1UFMA 1OCCH 1XMKA 2QA4I 2PG4A 2PJRA 3W3CA 5J47A 2VKDA 2X0LA 1A6QA 2FUG2 3DPLC 4HX8A 1J0RA 4KT6A 1H89C 5FLVA 2ELJA 3ASNH 1EH7A 3HPHA 1BM9A 2Y48A 1TQPA 5DUKA 2HDDA 1QRYA 2HVRA 5D5UB 3JRAA 1Y1WJ 2QZ8A 5LD2C 2K86A 2V79A 4B3AA 5B3SH 1OKRA 1MNDA 3VYTB 2JTVA 4O3MA 2LKPA 2VKEA 4UVBA 5F1JA 4WX9A 3T5XA 2DI3A 2F5EA 3K2AA 4KNYA 5M5YJ 2LLKA 5ICGA 4WCGA 3I59B 3CO6C 2VJ4A 2XB5A 3HHHA 2K7LA 3HSEA 3VYSB 4AM3A 4NQWB 2KFDA 2JMWA 3MEXA 3SJMA 2Q2EA 3L09A 1JHFA 1YYVA 2G9WA 4AIKA 2AO9A 3NQOA 4OAYA 5A2QK 1Z0XA 3PUBA 3K69A 4BEHB 4RB1A 2L2OA 3TP0A 2DDBA 2R7TA 5BMZA 3SXYA 3BR2A 2JZYA 2K4JA 4IRHA 3PL8A 4ASNA 1ETKA 1ETWA 3ERMA 3AL0B 2GOXB 3MD2A 3WTZA 5LGTA 2RKHA 1U6GA 3BROA 2BY0A 1ZARA 2DPUA 3C2BA 1MNEA 3DBRB 4AIHA 4QTRA 2UZKA 4LMYA 4XLHA 4CGZA 3G1MA 2N8GA 2EIKH 2YX4A 2PEXA 2R7VA 2CGPA 3DF8A 2E7WA 4MHGA 5FKLA 2JVHA 1LKXA 3BJ6A 3E5QA 1O3RA 2Y75A 2XAJA 3ISPA 1Z05A 1WZ2A 1YJ9I 5GPAA 2UXNA 2FRHA 1MMNA 2W24A 1FIAA 2UUZA 3RKXA 1HCRA 1YX5A 4A5MA 3EQLF 2VPRA 2M9HA 3BG6A 5FRNA 1FMVA 4CYDA 4J19A 3VB2A 3EYYA 2PJRB 3G73A 3IHUA 2M7BA 2BHZA 5D6EA 5BPIA 2V7FA 4YFNF 4UXNA 3FKIJ 2VIXA 3F22A 1BJAA 1YW9A 2DA5A 1X2NA 1YOVB 1FZPB 2DQRA 1HW5A 2X6XA 5D4RA 5LHGA 3HOUJ 2HOEA 3DTIA 5FGMA 5DEQA 3E6BA 1ETXA 5M3FJ 5E3MA 1PUFA 2DT6A 4F93B 3ZXSA 1BW5A 2OV7A 1EH6A 2R7UA 2W7NA 5CVRA 4ZYEA 3S2WA 2MD0A 2Q8KA 3Q9SA 5ILVA 1POGA 2X4HA 1MJ9A 2M34A 2Q2EB 2L02A 3TKYA 2J5PA 1Y0NA 4HOBA 2IBDA 1DP7P 2EV0A 2IAIA 1I1SA 2ADUA 2ELHA 2DYRH 5EEGA 3CC4I 4M3DA 4FISA 5E1XA 3R6SA 5ERIA 4N9IA 4IHVA 2RV8A 1JUPA 5D4SA 3WU0A 4MEYF 3M3YJ 3AG1H 3I4PA 3L2RA 3F6OA 2L7FP 5H6RA 3E5UA 4LG3A 4II2A 2L4AA 4U0VA 5B1BH 4Z2YA 3HTSB 5ICCA 4EJOA 4AIDA 1VNDA 5F0FA 4BY7J 3S3OA 4B3XA 2IP2A 1S5LC 3J7AY 3KETA 3K0LA 3PUFA 2ZSIB 2ZXIA 3R61A 4M6XA 4MNUA 4PCQA 4DYCA 3ABUA 4FHTA 5H2FC 5E18F 1J5YA 4OMYA 2UV1A 3WHCA 3FXQA 4G7ZF 1MJBA 4C2UA 2E34A 1SEUA 1IDZA 4L5EA 4M6YA 2QQ9A 2VT2A 2ZXHA 3AG4H 4Q4ZF 1TL8A 3F21A 2RREA 5KVRA 2RQPA 3BR0A 2PI0A 2CV2A 3RCOA 1DUXC 1K61A 2VE8A 4RDUA 5KCMA 1U0JA 3FXLA 2D1HA 2HR3A 1QU3A 1KQ9A 1TTYA 2EILH 3FMSA 3FXMA 4DYRA 1WJAA 5F1RA 2F5FA 4WK8F 2Q1ZB 5FFXA 1M1EB 4DZJA 2LDUA 4IHTA 1X1DA 1ONVA 2W84A 2OJED 2EZKA 4QWQA 2DYSH 2NAZA 1BA5A 2DMNA 2LREA 3V8LA 3DEUA 1KYWA 1VZ0A 3OIQA 4RGUA 4K2EA 1PUFB 4KFCA 1F5TA 3WTVC 1GDTA 4JX4A 4XLCA 3AAFA 2ZBKA 1F43A 4RMNA 3H0GJ 3IWFA 4JX5A 3A0HC 3HEFA 3RJPA 5J4YA 1U78A 1TZLA 4MLOA 4MIMA 4IQ4A 3C3WA 3VOEA 5J8FA 3BT9A 2ACJA 3S15J 3Q5FA 3WTWC 1G6NA 4LG0A 2V6EA 1H9TA 3JRCA 3TL4X 3KLNA 4RM3A 4XLAA 5J3LA 3S2HJ 1OISA 5BOXA 2XGDA 2EJRA 4UB8C 4MTEA 3RSNA 3CF5F 2OBPA 2CQ7A 4G6DA 2HGCA 4XL9A 3ZQFA 1FYLA 5J40A 2WA0A 4YEJA 4XKCA 2NVYJ 4UHTA 1OMIA 3IRQA 5E20A 1KU9A 1WGXA 4N0BA 2W4SA 3CCRI 2LTPA 1FSEA 2P6TA 3GW2A 3P5JA 5HLHA 1FYKA 4AWXB 2CU7A 3B73A 1XD7A 2Z5UA 2MBFA 3GUDA 4MO7A 3TOAA 4C3IJ 3S1NJ 1IRXA 3NWTA 4EGYA 3HOYJ 2JN6A 3ZQQA 2RDPA 2F4IA 3H36A 5FKMA 2EIMH 2LH9A 4DBQA 5J4VA 3BR5A 3GFIA 1LB2A 3KEQA 2VKVA 1B8IA 2BY1A 2QVOA 3SZGA 2GIZA 2Z33A 4NC8A 2G0EA 2L9SA 1O4XA 4IHXA 2F4OB 3M8FA 1BI3A 2WAEA 3Q9VA 1ZGJA 1EH8A 2RNJA 2NNYA 4JQFA 5D5VB 3G1LA 3K4MA 5KAIC 3TDUC 3MAJA 1OQYA 1SD4A 1W7PA 2EFQA 3MWMA 3I56I 1VTNC 1KQ8A 4EJUA 4MEXF 2BE5F 5ILUA 1V5GA 3KCCA 2LMDA 2V1DA 4HLXA 3J81K 3TW6A 4XLNF 1V5EA 1W5CC 1R6RA 2XB0X 2R7SA 1ZHFA 1IN5A 4XONA 2H09A 2VXDA 2M4KA 4BXUA 2V9KA 1ZTRA 3HOXJ 1PUEE 2DMPA 5FFZA 5EEAA 4I76A 2XC7A 1T98A 2L0KA 4ENNA 3O8HA 2P81A 2H94A 2E7XA 4RB3C 2HVSA 3K10A 4LG0B 2ZSHB 3K70D 1XCBA 4UUTA 1J2XA 3QODA 2MABA 3QWLA 1U8BA 3MKLA 1G8XA 3PQKA 4LD5A 1ZRDA 4XN3A 2XHKA 4XK4A 4BE2A 1ETYA 3ZQGA 2M87A 2ZJPF 2FNAA 2DQLA 2XSJC 3FK7A 4XRSG 2B9SA 1Z1DA 3LSMA 3HOVJ 1D5VA 1IXRC 1GV2A 1J9IA 1UG2A 1DDNA 5CYVA 2KZVA 3H3VK 4M9XA 3ZOBA 2Y0SN 3TDZC 3A03A 2V1NA 3M4OJ 1QPMA 4X1EA 1ZLJA 1ODDA 5K7ZA 3P9IA 3ASOH 1QGPA 2OC6A 1WSUA 3RTRA 3S1QJ 3C1DA 2EINH 3FXUA 2CH0A 1B8IB 2E71A 2R7WA 3QRFF 1LDDA 3I58A 1WJEA 5LGUA 3DLLF 2Y9YA 1Z3YA 3K4NA 1KA8A 5IOZA 1Q1HA 5FKOA 5ILSA 2MH2A 2FE3A 1SD7A 3CTAA 4F52A 5J1UA 2ME6A 1WJ5A 1AU7A 4A5NA 2LF8A 4PJJA 4FTHA 2P8TA 3GZNB 3LA2A 3SDGA 1W7PB 3BR3A 4GXOA 2ECCA 2DCEA 3AL0C 2XSDC 1P2FA 1H9GA 1FP2A 2R3SA 1MBHA 3HGYA 1SFKA 3CO7C 2KRHA 1MKMA 4YIIA 4IHWA 1KU2A
chains in the Genus database with same CATH topology
1G3WA 3T8RA 1LDKB 2IA0A 5L3BA 2FSWA 2PBIA 3ELKA 2VODA 4KN4X 1I6XA 2FBHA 4EM2A 3FZVA 4TV7A 1XB4A 1RI7A 3C7JA 2QBYA 1D3YA 3ZMZA 4HF0A 1YLFA 4P9FA 1KU3A 1K7AA 3SZTA 5K5OA 2HTJA 2GQQA 2HYGD 1XSXA 4XSXF 2G7UA 2ISYA 1FBSA 3WE2A 2P5KA 4YG2F 1IF1A 3FHZA 2DK8A 2R7DA 3BPVA 4G7OF 1R58A 1FT9A 2QQBA 2KJCA 3WTTC 4EGZA 4KIGA 4A0ZA 1EV7A 5HOOA 5HLIA 2DT5A 5TRDA 2CG4A 2COMA 1BC8C 1DPUA 5HS9A 4BHPA 3ZMTA 2ZNZA 4EV0A 3DV8A 1HW2A 3WODF 1BOAA 2GIVA 5FB2A 5DD8A 2DW4A 5IT9K 3C18A 2A6HF 3EETA 5D8LB 1YIOA 3KP3A 3QPTA 1QZYA 1LJ9A 1SMYF 1FNNA 5LBQA 2VT3A 3WU1B 4LB5A 2QBYB 2RC4A 1B9MA 4HF1A 3ZMSA 4G6QA 3CUOA 4LFUA 5CLSA 1MJAA 2QM3A 3MZHA 4RGSA 4M71A 3V7SA 3TQNA 1Z6RA 3I0TA 1P4WA 2OQGA 3FM3A 4I98B 2VBWA 5D8KB 3BOQA 4KMUX 2EFNA 5E8GA 1S7AA 3BWGA 4ENMA 1K6OA 2OU2A 1TNSA 2ESNA 5ED4A 5L3CA 3BY6A 4L9VA 4CICA 5FLXZ 2HDCA 2W25A 3WGGA 4IHSA 2V6CA 5DUIA 3N97A 2M1BA 3F72A 2IA1A 4P9UA 4EM1A 3WTSC 4HQEA 1HSTA 3JW4A 1BI2A 2Z9OA 1T38A 4M73A 5JI6A 4I0AA 3JAMZ 2L01A 5JR3A 1YFHA 3M1EA 1FLIA 4WF2A 4U7DA 2A69F 4L9NA 3BZ6A 4KIBA 3IWZA 2PLYA 3SFZA 3J7AO 4IJAA 2RVCA 1LDJA 3O6BB 4BHCA 1U3EM 1IXSB 2NYXA 2GA1A 3NEUA 2IVMA 5DV5A 4HAMA 2F5CA 3ZN1A 2XUBA 1YTYA 4QLCU 4G7HF 2BV6A 3RPQA 3PFIA 2EV6A 3IKVA 1KU7A 1R23A 2OA4A 2KIUA 5FLXK 4G8XA 4EJWA 3CJNA 1GXPA 1V3FA 2YPRA 4GYGA 1G3TA 1XDUA 4ZH4F 4EJVA 4RS8A 1J75A 4UUVA 2M8EA 4XBFA 4KT5C 2DLLA 4I02A 2CQKA 2R7FA 4R79A 1OR7A 1FBUA 2LF7A 4MTDA 2K27A 2KIFA 2W85A 2L3DA 3JAMK 3HRUA 2ZNYA 5KK1A 1R1TA 4U88A 1J7KA 5E1ZB 1BBYA 4M72A 2VOOA 3WTYC 2F2EA 3F3XA 2KKOA 1DPRA 3FF5A 3OOPA 3CUQA 3KEOA 3ZQ7A 3TO9A 2VC1A 4JK1X 2A3SA 4ETSA 1KYZA 4JBAA 4GYIA 1U2WA 2AS5F 4E70A 5DYMA 4HF2A 4MGRA 4F7ZA 2VE9A 3O2PE 2UXXA 2P7CB 2MA3A 4BQAA 3KLOA 4A6EA 1ZG1A 3T1BA 4OMZA 5L3DA 1IAWA 5LHHA 4CXFA 2EK5A 3NRVA 4RGRA 2CYYA 2XVCA 1WQ2A 4HDVA 2RGVA 1BI0A 3I64A 1B9NA 3IC7A 5K1YA 4ON0A 3LAJA 3V7CA 5J6XA 1XMAA 3FWEA 4OINF 4NHJA 4P96A 4AIJA 1TLHB 4S05A 1ZRFA 1PDNC 3MQ0A 2ESHA 3P9CA 2YR2A 3RKWA 5JFRA 2A5YB 4A2UA 3GEZA 4HX4A 2QENA 2XAFA 2IA2A 4RAYA 4WWCA 1YW7A 2XKPA 4KUMA 1WI9A 1O3SA 2GXGA 3CUQB 4CZZA 1K79A 4FX0A 5H6QA 4ZYGA 1ZAOA 1QO0D 3I53A 4ENJA 3KP2A 3V4GA 3QP5A 4P5OA 2NRAC 2ZFWA 2OAZA 4WXCA 1SAXA 3I71A 1ULYA 1YW8A 1NHAA 1RZ4A 1K78A 1B6AA 3DFGA 4N9HA 3GFMA 4AD9A 2FMYA 2KJBA 4XLPF 3K9TA 2VXZA 3E6MA 4UVCA 4BAYA 1T39A 4PZJA 5HDGA 4LK1F 1ZLKA 1P6RA 2DK5A 3LWFA 1O3QA 1IZ1A 4KICA 1ZH5A 2NNNA 1Y0UA 4PGHA 1IXCA 5HDNA 3WGHA 3TOBA 3JTHA 2PJPA 2NS0A 4OIPF 5E1WA 2JPBA 1FX7A 1U5TC 3L7WA 5AIPA 4S04A 1ZG3A 4Q47A 4L9TA 5BPDA 2HEOA 4FT8A 4O6JA 3COAC 2K02A 4LGWA 4B09A 2ZJ2A 1YO5C 2ZCWA 1V4RA 2MLGA 3IRRA 3GXOA 4RB0A 1K78B 3L00A 4IVNA 4RGXA 3IL2A 5AIQA 4HLYA 5AONA 1TW2A 2VBXA 5LGNA 2FEZA 1JHHA 1YG2A 5F6FA 2BEOA 2V9VA 3F8CA 1G3SA 3V8KA 3M9AA 1TBXA 5JVTA 4UNOA 2XASA 1S8NA 2WV0A 3RYRA 1BIAA 2VN2A 4AVPA 5L3GA 1FWZA 1HKTA 1F4KA 3EYIA 1I5ZA 3DQVC 1F1ZA 4I2OA 1C0WA 3R0JA 3E5XA 4IRIA 1P4XA 2MC3A 1ZGAA 1T2KA 3QOPA 1SD5A 1T0FA 4KYWA 3F8NA 3WTUC 5HS8A 2J5OA 3H92A 3FM5A 1AWCA 3HRTA 5BQTA 3SQNA 3CDHA 1ZG5A 2EB7A 3L9FA 3BDDA 4DQ2A 5D6FA 2GA2A 2UWMA 4KIFA 1XN7A 2PFBA 2XROA 2WWYA 3T0YA 2M5WA 2AXLA 4M74A 5CVVA 1F9NA 2EFPA 1HXDA 1OPCA 1WRJA 5FD6A 3HOTA 4M9ZA 4ZYDA 4MQ9F 3E97A 4U7BA 2FNPA 3P7NA 3ROUA 2EFOA 4LK0F 2O6GE 4A12A 1XSDA 2IT0A 1USTA 1BI1A 2MD5A 3HUGA 2V1UA 4BHBA 4L18B 1RNLA 3WG9A 5LHIA 3T8TA 1XGMA 1GXQA 2STWA 1ZREA 1PP7U 4L9JA 4ESBA 3MZYA 4B8XA 4ZYHA 3ML6A 3HRSA 3E6DA 1XGNA 2MLKA 2C6YA 5J8CA 3E3VA 2H6CA 3LFKA 5LRSA 2PN6A 1YS6A 3GO5A 2D1VA 2ZO4A 3K1PA 2OZ6A 3DPTA 1OYIA 3ULQB 4EVIA 2L54A 5DCMA 1HKQA 3LQRA 2KRFA 1KGSA 1I27A 2QLZA 2CFXA 3M7GA 1R5HA 4WXDA 5CVJA 2XGXA 4ENKA 1JGSA 4HV5A 5CVUA 1XGOA 3R4KA 2GWRA 1RUOA 3DXJF 1YQAA 2HQRA 3L2CA 2P7VB 3CLOA 1WKMA 1LQ1A 3QPHA 3DKWA 1D8JA 1TW3A 3WTXC 1STZA 3RPUA 2GZWA 3P9KA 3O3KA 2FQ3A 1GHCA 2CO5A 4LJZF 3WE3A 1HKSA 1W5SA 4UV8A 1U8RA 4A6DA 3D0SA 5L3FA 2E1CA 3TO6A 3F23A 2H6BA 4IPAA 1SMTA 4BH9A 3GZ5A 2FBIA 4WXHA 1CF7A 4FX4A 2HYFA 4Y17A 1KQ0A 2HZTA 5CJ9A 2TDXA 4YIFA 4OOIA 4A0XA 3REOA 2HKXA 2CSOA 2XKOA 5DCMB 2BGCA 2L4MA 2WC2A 3RI4A 2IW5A 3HTUA 2V1XA 5D5WB 2JPCA 3D5LA 4HV6A 2FU4A 5L3EA 4G9YA 1MD0A 1ZYRF 3H3ZA 3K1MA 1HBXG 5K5QA 1QZZA 2Z99A 4HQMA 4YFKF 1R36A 4DNCA 2ZKZA 4LB6B 1BC7C 3BJAA 4ZZDA 4GGGA 1REPC 2Z3YA 2DU9A 4RB2C 1MDMA 2EFWA 3GVAA 3QP6A 4O5VA 3QU6A 4Q5SF 4U0WA 3W6JB 3U1DA 1TQIA 3KFWX 3GYHX 1ZRCA 1ZN2A 5D5XB 1RIOH 3K2ZA 1BN5A 2GXBA 1R1VA 3ZMDA 2DO7A 3WGIA 1FC3A 1CF7B 1P92A 5IT3A 3JSPA 2YSRA 4NB5A 3TO7A 4IXAA 2P5LC 3DP7A 1E2XA 2HS5A 1T6SA 2HQNA 4GCVA 1P4AA 3RYPA 1MZBA 3V7RA 3ERED 3JSOA 3QAHA 5H20A 2QQAA 3GLXA 1L0OC 1ON2A 2DFIA 4UVAA 4KDPA 2E1NA 2B0LA 5EEHA 1TNTA 3GFLA 2ZMEA 3K1NA 3HIFA 4G94A 4CHUA 2M45A 3ECHA 3ZMVA 3GFJA 5HDKA 1Z9CA 3OV8A 1LVAA 3KP4A 2DAOA 1MDMB 1FPQA 2DBBA 1Z6TA 2G7HA 4OIRF 5HS7A 2RN7A 3B02A 2W57A 5FD5A 3GZ6A 2XRNA 1IN6A 1B1BA 4HDUA 3ECOA 2GAUA 1R1UA 3GWZA 6PAXA 5LRRA 3KZZA 2OZUA 4PDKA 3J81Z 2FBKA 3I54A 2XIGA 5E8IA 1W4MA 2K4BA 4HBLA 4HYEA 3BPXA 2BYVE 5DCFA 2Y0MA 1OYYA 3HYIA 1QQIA 1HW1A 4L0ZB 4BNCA 2VBYA 1XGSA 2EA4A 3V8JA 4GO1A 3LAPA 3RDIA 2STTA 4Q48A 2F5DA 3ZP5A 2VBZA 5BS6A 1B4AA 2ZMEB 3U2RA 4OIQF 3F8FA 4YFXF 4I0BA 1S3JA 1R22A 2FOKA 4D0PA 3TGNA 3KP6A 1XCVA 3LA3A 4HA8A 3VFZA 4UV9A 1J59A 2H27A 3EDPA 5HLGA 1H0MA 2XAQA 4U0YA 2QYOA 4I09A 1BIBA 3MFKA 2PMUA 1IN7A 2HKOA 3HRMA 1SFUA 2D2WA 1S6LA 4EMSA 2FF4A 1LNWA 3ABTA 2D45A 2Q0OA 2KIMA 4R1HA 3QU3A 3KE2A 4M9SA 2IRFG 3I5UA 3BP8A 1JXSA 3J80Z 5ICEA 1JE8A 2OD5A 2FA5A 5ICFA 1FP1D 2FXAA 3MCZA 4Y13A 4IRGA 2O3FA 3LA7A 3IKTA 3FMQA 1OYWA 2BBYA 4Y15A 1I1GA 4PGGA 3FX3A 5DDGA 3JTGA 2HWVA 3FXRA 3M8EA 3VODA 1IW7F 1W5TA 3U9GA 3HOSA 2P4WA 4EJTA 5LEKA 4XRFA 2A61A 1YS7A 5K5RA 1FYMA 1R7JA 1AOYA 2YX7A 4CO8A 1R00A 3ZPLA 4I7HA 2EV5A 1SFXA 3R0AA 5LEJA 1O7LA 2QWWA 2XAGA 4L0YB 4A0YA 1Z91A 4ESFA 1SD6A 1O57A 2DTRA 1FY7A 5JHUA 1UHWA 5CVIA 4LLNA 4KN7X 1XSVA 2XV4S 3J80K 2EWNA 1IRGA 2WTEA 5IT9Z 4HW0A 2HTSA 2IPQX 5TJJA 1G4DA 2FMLA 4HX7A 2P5VA 1ON1A 1O3TA 1HSJA 1S29A 2EA2A 1QBJA 1GVJA 1IN8A 1IRFA 2O61A 1IUYA 3N4MA 1LEAA 4L5IA 1FBQA 2A68F 4KMFA 5HVQC 1RUNA 3F6VA 1A04A 3RIRA 2PMHA 2QUFA 1B59A 4ESJA 1G3YA 3KP7A 1UHMA 2ZXJA 2O0YA 2YU3A 2P6SA 2JSCA 2VC0A 4XSZF 1W7PD 3FMRA 4I01A 1IN4A 3GX4X 4H0EA 3RKYA 4ZZLA 2CWEA 1UCRA 2A6EF 3W6KB 1U5TA 1FSHA 4BYYA 4P55A 3LSTA 4CDGA 2IJLA 3GF2A 3HSRA 1E17A 1S7OA 3KZYA 2O8XA 4MQVA 1PP8F 1USSA 2M30A 4EM0B 3EUHA 3BJOA 4HZFA 3PQJA 1WWXA 1X3UA 1L3LA 4R8HA 5E17F 1D8KA 2O03A 3E6CC 3ZN0A 3F8MA 3G3ZA 4OIOF 1CGPA 1MGTA 4EQQA 1R5GA 2XAHA 3VEPA 4OU0A 3I59A 4L5JA 3CUQC 2OQRA 5F64A 1O7FA 2MH9A 4NQWA 3H3UA 2HFHA 1Z7UA 3HHGA 1QNTA 5A2QZ 2LSOA 4LLGF 2ETHA 1HQCA 5LLQA 3F8BA 2VOPA 3LQQA 1XDSA 3SZPA 2CW0F 3HSFA 2PQ8A 3ZMUA 1U5TB 2ISZA 1SFEA 2LNBA 1LEBA 4LLLA 2VONA 3KP5A 5FO5A 3R60A 2A07F 1FOKA 4IF4A 1TQMA 3SHFA 2JT1A 1UB9A 4RAZA 5DD4A 2JRTA 2DPDA 4KA4A 1UFMA 1XMKA 2PG4A 2X0LA 3DPLC 4HX8A 1J0RA 1EH7A 1BM9A 2Y48A 1TQPA 5DUKA 5D5UB 2QZ8A 2K86A 2V79A 1OKRA 2JTVA 4O3MA 2LKPA 4UVBA 4WX9A 3T5XA 2F5EA 2DI3A 4KNYA 5ICGA 4WCGA 3I59B 3CO6C 3HHHA 2K7LA 3HSEA 3MEXA 2Q2EA 3L09A 1JHFA 1YYVA 2G9WA 4AIKA 3NQOA 5A2QK 3K69A 4RB1A 5BMZA 3SXYA 2JZYA 2K4JA 4IRHA 4ASNA 3WTZA 5LGTA 2RKHA 1U6GA 3BROA 1ZARA 2DPUA 4AIHA 2UZKA 4LMYA 4CGZA 2YX4A 2PEXA 2CGPA 3DF8A 2E7WA 4MHGA 3BJ6A 3E5QA 1O3RA 2Y75A 2XAJA 3ISPA 1Z05A 2UXNA 2FRHA 2W24A 3RKXA 4A5MA 3EQLF 4CYDA 3VB2A 3EYYA 3G73A 3IHUA 5D6EA 5BPIA 4YFNF 4UXNA 3F22A 1BJAA 1YW9A 1FZPB 2DQRA 1HW5A 5D4RA 5LHGA 2HOEA 5FGMA 5DEQA 3E6BA 1EH6A 5CVRA 4ZYEA 3S2WA 2Q8KA 3Q9SA 5ILVA 2X4HA 1MJ9A 2L02A 3TKYA 2J5PA 4HOBA 1DP7P 2EV0A 1I1SA 2ADUA 2ELHA 5EEGA 5E1XA 3R6SA 5ERIA 4N9IA 2RV8A 5D4SA 3WU0A 4MEYF 3I4PA 3F6OA 5H6RA 3E5UA 2L4AA 4U0VA 4Z2YA 3HTSB 5ICCA 4EJOA 2IP2A 3KETA 3K0LA 3R61A 4M6XA 4MNUA 4PCQA 3ABUA 4FHTA 5E18F 1J5YA 4OMYA 3FXQA 4G7ZF 1MJBA 4M6YA 2QQ9A 2VT2A 4Q4ZF 3F21A 5KVRA 2RQPA 2PI0A 1DUXC 2VE8A 2D1HA 2HR3A 1KQ9A 1TTYA 3FMSA 5F1RA 2F5FA 4WK8F 5FFXA 2LDUA 4IHTA 1ONVA 2W84A 4QWQA 2NAZA 3V8LA 3DEUA 1KYWA 4RGUA 4KFCA 4K2EA 1F5TA 3WTVC 3AAFA 2ZBKA 3IWFA 3RJPA 1U78A 3C3WA 3VOEA 5J8FA 2ACJA 3Q5FA 3WTWC 1G6NA 4LG0A 1H9TA 3KLNA 5BOXA 2EJRA 4MTEA 2OBPA 4G6DA 2HGCA 1FYLA 4UHTA 1OMIA 3IRQA 5E20A 1KU9A 4N0BA 2P6TA 1FSEA 1FYKA 3GW2A 5HLHA 4AWXB 3B73A 1XD7A 2Z5UA 2MBFA 3GUDA 3TOAA 4EGYA 2RDPA 1LB2A 3GFIA 3KEQA 2QVOA 2Z33A 3M8FA 1BI3A 3Q9VA 1ZGJA 1EH8A 2RNJA 2NNYA 4JQFA 5D5VB 3TDUC 3MAJA 1SD4A 1W7PA 2EFQA 3MWMA 1VTNC 1KQ8A 4EJUA 4MEXF 2BE5F 5ILUA 3KCCA 2V1DA 4HLXA 3J81K 4XLNF 1ZHFA 1IN5A 2H09A 4BXUA 1PUEE 5FFZA 1T98A 4ENNA 2H94A 2E7XA 4RB3C 4LG0B 1XCBA 1J2XA 3PQKA 4LD5A 1ZRDA 2XHKA 2M87A 2FNAA 2DQLA 1Z1DA 1D5VA 1IXRC 1J9IA 1DDNA 5CYVA 4M9XA 3TDZC 1QPMA 1ZLJA 1ODDA 3P9IA 1QGPA 1WSUA 3RTRA 3C1DA 3FXUA 3QRFF 1LDDA 3I58A 5LGUA 1KA8A 1Q1HA 5ILSA 2MH2A 2FE3A 1SD7A 3CTAA 4A5NA 2LF8A 2P8TA 3LA2A 1W7PB 4GXOA 1P2FA 1H9GA 1FP2A 2R3SA 3CO7C 1MKMA 4YIIA 1KU2A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1G3W A;  3T8R A;  1LDK B;  2IA0 A;  5L3B A;  2FSW A;  2PBI A;  3ELK A;  2VOD A;  4KN4 X;  1I6X A;  2FBH A;  4EM2 A;  3FZV A;  4TV7 A;  1XB4 A;  1RI7 A;  3C7J A;  2QBY A;  1D3Y A;  3ZMZ A;  4HF0 A;  1YLF A;  4P9F A;  1KU3 A;  1K7A A;  3SZT A;  5K5O A;  2HTJ A;  2GQQ A;  2HYG D;  1XSX A;  4XSX F;  2G7U A;  2ISY A;  1FBS A;  3WE2 A;  2P5K A;  4YG2 F;  1IF1 A;  3FHZ A;  2DK8 A;  2R7D A;  3BPV A;  4G7O F;  1R58 A;  1FT9 A;  2QQB A;  2KJC A;  3WTT C;  4EGZ A;  4KIG A;  4A0Z A;  1EV7 A;  5HOO A;  5HLI A;  2DT5 A;  5TRD A;  2CG4 A;  2COM A;  1BC8 C;  1DPU A;  5HS9 A;  4BHP A;  3ZMT A;  2ZNZ A;  4EV0 A;  3DV8 A;  1HW2 A;  3WOD F;  1BOA A;  2GIV A;  5FB2 A;  5DD8 A;  2DW4 A;  5IT9 K;  3C18 A;  2A6H F;  3EET A;  5D8L B;  1YIO A;  3KP3 A;  3QPT A;  1QZY A;  1LJ9 A;  1SMY F;  1FNN A;  5LBQ A;  2VT3 A;  3WU1 B;  4LB5 A;  2QBY B;  2RC4 A;  1B9M A;  4HF1 A;  3ZMS A;  4G6Q A;  3CUO A;  4LFU A;  5CLS A;  1MJA A;  2QM3 A;  3MZH A;  4RGS A;  4M71 A;  3V7S A;  3TQN A;  1Z6R A;  3I0T A;  1P4W A;  2OQG A;  3FM3 A;  4I98 B;  2VBW A;  5D8K B;  3BOQ A;  4KMU X;  2EFN A;  5E8G A;  1S7A A;  3BWG A;  4ENM A;  1K6O A;  2OU2 A;  1TNS A;  2ESN A;  5ED4 A;  5L3C A;  3BY6 A;  4L9V A;  4CIC A;  5FLX Z;  2HDC A;  2W25 A;  3WGG A;  4IHS A;  2V6C A;  5DUI A;  3N97 A;  2M1B A;  3F72 A;  2IA1 A;  4P9U A;  4EM1 A;  3WTS C;  4HQE A;  1HST A;  3JW4 A;  1BI2 A;  2Z9O A;  1T38 A;  4M73 A;  5JI6 A;  4I0A A;  3JAM Z;  2L01 A;  5JR3 A;  1YFH A;  3M1E A;  1FLI A;  4WF2 A;  4U7D A;  2A69 F;  4L9N A;  3BZ6 A;  4KIB A;  3IWZ A;  2PLY A;  3SFZ A;  3J7A O;  4IJA A;  2RVC A;  1LDJ A;  3O6B B;  4BHC A;  1U3E M;  1IXS B;  2NYX A;  2GA1 A;  3NEU A;  2IVM A;  5DV5 A;  4HAM A;  2F5C A;  3ZN1 A;  2XUB A;  1YTY A;  4QLC U;  4G7H F;  2BV6 A;  3RPQ A;  3PFI A;  2EV6 A;  3IKV A;  1KU7 A;  1R23 A;  2OA4 A;  2KIU A;  5FLX K;  4G8X A;  4EJW A;  3CJN A;  1GXP A;  1V3F A;  2YPR A;  4GYG A;  1G3T A;  1XDU A;  4ZH4 F;  4EJV A;  4RS8 A;  1J75 A;  4UUV A;  2M8E A;  4XBF A;  4KT5 C;  2DLL A;  4I02 A;  2CQK A;  2R7F A;  4R79 A;  1OR7 A;  1FBU A;  2LF7 A;  4MTD A;  2K27 A;  2KIF A;  2W85 A;  2L3D A;  3JAM K;  3HRU A;  2ZNY A;  5KK1 A;  1R1T A;  4U88 A;  1J7K A;  5E1Z B;  1BBY A;  4M72 A;  2VOO A;  3WTY C;  2F2E A;  3F3X A;  2KKO A;  1DPR A;  3FF5 A;  3OOP A;  3CUQ A;  3KEO A;  3ZQ7 A;  3TO9 A;  2VC1 A;  4JK1 X;  2A3S A;  4ETS A;  1KYZ A;  4JBA A;  4GYI A;  1U2W A;  2AS5 F;  4E70 A;  5DYM A;  4HF2 A;  4MGR A;  4F7Z A;  2VE9 A;  3O2P E;  2UXX A;  2P7C B;  2MA3 A;  4BQA A;  3KLO A;  4A6E A;  1ZG1 A;  3T1B A;  4OMZ A;  5L3D A;  1IAW A;  5LHH A;  4CXF A;  2EK5 A;  3NRV A;  4RGR A;  2CYY A;  2XVC A;  1WQ2 A;  4HDV A;  2RGV A;  1BI0 A;  3I64 A;  1B9N A;  3IC7 A;  5K1Y A;  4ON0 A;  3LAJ A;  3V7C A;  5J6X A;  1XMA A;  3FWE A;  4OIN F;  4NHJ A;  4P96 A;  4AIJ A;  1TLH B;  4S05 A;  1ZRF A;  1PDN C;  3MQ0 A;  2ESH A;  3P9C A;  2YR2 A;  3RKW A;  5JFR A;  2A5Y B;  4A2U A;  3GEZ A;  4HX4 A;  2QEN A;  2XAF A;  2IA2 A;  4RAY A;  4WWC A;  1YW7 A;  2XKP A;  4KUM A;  1WI9 A;  1O3S A;  2GXG A;  3CUQ B;  4CZZ A;  1K79 A;  4FX0 A;  5H6Q A;  4ZYG A;  1ZAO A;  1QO0 D;  3I53 A;  4ENJ A;  3KP2 A;  3V4G A;  3QP5 A;  4P5O A;  2NRA C;  2ZFW A;  2OAZ A;  4WXC A;  1SAX A;  3I71 A;  1ULY A;  1YW8 A;  1NHA A;  1RZ4 A;  1K78 A;  1B6A A;  3DFG A;  4N9H A;  3GFM A;  4AD9 A;  2FMY A;  2KJB A;  4XLP F;  3K9T A;  2VXZ A;  3E6M A;  4UVC A;  4BAY A;  1T39 A;  4PZJ A;  5HDG A;  4LK1 F;  1ZLK A;  1P6R A;  2DK5 A;  3LWF A;  1O3Q A;  1IZ1 A;  4KIC A;  1ZH5 A;  2NNN A;  1Y0U A;  4PGH A;  1IXC A;  5HDN A;  3WGH A;  3TOB A;  3JTH A;  2PJP A;  2NS0 A;  4OIP F;  5E1W A;  2JPB A;  1FX7 A;  1U5T C;  3L7W A;  5AIP A;  4S04 A;  1ZG3 A;  4Q47 A;  4L9T A;  5BPD A;  2HEO A;  4FT8 A;  4O6J A;  3COA C;  2K02 A;  4LGW A;  4B09 A;  2ZJ2 A;  1YO5 C;  2ZCW A;  1V4R A;  2MLG A;  3IRR A;  3GXO A;  4RB0 A;  1K78 B;  3L00 A;  4IVN A;  4RGX A;  3IL2 A;  5AIQ A;  4HLY A;  5AON A;  1TW2 A;  2VBX A;  5LGN A;  2FEZ A;  1JHH A;  1YG2 A;  5F6F A;  2BEO A;  2V9V A;  3F8C A;  1G3S A;  3V8K A;  3M9A A;  1TBX A;  5JVT A;  4UNO A;  2XAS A;  1S8N A;  2WV0 A;  3RYR A;  1BIA A;  2VN2 A;  4AVP A;  5L3G A;  1FWZ A;  1HKT A;  1F4K A;  3EYI A;  1I5Z A;  3DQV C;  1F1Z A;  4I2O A;  1C0W A;  3R0J A;  3E5X A;  4IRI A;  1P4X A;  2MC3 A;  1ZGA A;  1T2K A;  3QOP A;  1SD5 A;  1T0F A;  4KYW A;  3F8N A;  3WTU C;  5HS8 A;  2J5O A;  3H92 A;  3FM5 A;  1AWC A;  3HRT A;  5BQT A;  3SQN A;  3CDH A;  1ZG5 A;  2EB7 A;  3L9F A;  3BDD A;  4DQ2 A;  5D6F A;  2GA2 A;  2UWM A;  4KIF A;  1XN7 A;  2PFB A;  2XRO A;  2WWY A;  3T0Y A;  2M5W A;  2AXL A;  4M74 A;  5CVV A;  1F9N A;  2EFP A;  1HXD A;  1OPC A;  1WRJ A;  5FD6 A;  3HOT A;  4M9Z A;  4ZYD A;  4MQ9 F;  3E97 A;  4U7B A;  2FNP A;  3P7N A;  3ROU A;  2EFO A;  4LK0 F;  2O6G E;  4A12 A;  1XSD A;  2IT0 A;  1UST A;  1BI1 A;  2MD5 A;  3HUG A;  2V1U A;  4BHB A;  4L18 B;  1RNL A;  3WG9 A;  5LHI A;  3T8T A;  1XGM A;  1GXQ A;  2STW A;  1ZRE A;  1PP7 U;  4L9J A;  4ESB A;  3MZY A;  4B8X A;  4ZYH A;  3ML6 A;  3HRS A;  3E6D A;  1XGN A;  2MLK A;  2C6Y A;  5J8C A;  3E3V A;  2H6C A;  3LFK A;  5LRS A;  2PN6 A;  1YS6 A;  3GO5 A;  2D1V A;  2ZO4 A;  3K1P A;  2OZ6 A;  3DPT A;  1OYI A;  3ULQ B;  4EVI A;  2L54 A;  5DCM A;  1HKQ A;  3LQR A;  2KRF A;  1KGS A;  1I27 A;  2QLZ A;  2CFX A;  3M7G A;  1R5H A;  4WXD A;  5CVJ A;  2XGX A;  4ENK A;  1JGS A;  4HV5 A;  5CVU A;  1XGO A;  3R4K A;  2GWR A;  1RUO A;  3DXJ F;  1YQA A;  2HQR A;  3L2C A;  2P7V B;  3CLO A;  1WKM A;  1LQ1 A;  3QPH A;  3DKW A;  1D8J A;  1TW3 A;  3WTX C;  1STZ A;  3RPU A;  2GZW A;  3P9K A;  3O3K A;  2FQ3 A;  1GHC A;  2CO5 A;  4LJZ F;  3WE3 A;  1HKS A;  1W5S A;  4UV8 A;  1U8R A;  4A6D A;  3D0S A;  5L3F A;  2E1C A;  3TO6 A;  3F23 A;  2H6B A;  4IPA A;  1SMT A;  4BH9 A;  3GZ5 A;  2FBI A;  4WXH A;  1CF7 A;  4FX4 A;  2HYF A;  4Y17 A;  1KQ0 A;  2HZT A;  5CJ9 A;  2TDX A;  4YIF A;  4OOI A;  4A0X A;  3REO A;  2HKX A;  2CSO A;  2XKO A;  5DCM B;  2BGC A;  2L4M A;  2WC2 A;  3RI4 A;  2IW5 A;  3HTU A;  2V1X A;  5D5W B;  2JPC A;  3D5L A;  4HV6 A;  2FU4 A;  5L3E A;  4G9Y A;  1MD0 A;  1ZYR F;  3H3Z A;  3K1M A;  1HBX G;  5K5Q A;  1QZZ A;  2Z99 A;  4HQM A;  4YFK F;  1R36 A;  4DNC A;  2ZKZ A;  4LB6 B;  1BC7 C;  3BJA A;  4ZZD A;  4GGG A;  1REP C;  2Z3Y A;  2DU9 A;  4RB2 C;  1MDM A;  2EFW A;  3GVA A;  3QP6 A;  4O5V A;  3QU6 A;  4Q5S F;  4U0W A;  3W6J B;  3U1D A;  1TQI A;  3KFW X;  3GYH X;  1ZRC A;  1ZN2 A;  5D5X B;  1RIO H;  3K2Z A;  1BN5 A;  2GXB A;  1R1V A;  3ZMD A;  2DO7 A;  3WGI A;  1FC3 A;  1CF7 B;  1P92 A;  5IT3 A;  3JSP A;  2YSR A;  4NB5 A;  3TO7 A;  4IXA A;  2P5L C;  3DP7 A;  1E2X A;  2HS5 A;  1T6S A;  2HQN A;  4GCV A;  1P4A A;  3RYP A;  1MZB A;  3V7R A;  3ERE D;  3JSO A;  3QAH A;  5H20 A;  2QQA A;  3GLX A;  1L0O C;  1ON2 A;  2DFI A;  4UVA A;  4KDP A;  2E1N A;  2B0L A;  5EEH A;  1TNT A;  3GFL A;  2ZME A;  3K1N A;  3HIF A;  4G94 A;  4CHU A;  2M45 A;  3ECH A;  3ZMV A;  3GFJ A;  5HDK A;  1Z9C A;  3OV8 A;  1LVA A;  3KP4 A;  2DAO A;  1MDM B;  1FPQ A;  2DBB A;  1Z6T A;  2G7H A;  4OIR F;  5HS7 A;  2RN7 A;  3B02 A;  2W57 A;  5FD5 A;  3GZ6 A;  2XRN A;  1IN6 A;  1B1B A;  4HDU A;  3ECO A;  2GAU A;  1R1U A;  3GWZ A;  6PAX A;  5LRR A;  3KZZ A;  2OZU A;  4PDK A;  3J81 Z;  2FBK A;  3I54 A;  2XIG A;  5E8I A;  1W4M A;  2K4B A;  4HBL A;  4HYE A;  3BPX A;  2BYV E;  5DCF A;  2Y0M A;  1OYY A;  3HYI A;  1QQI A;  1HW1 A;  4L0Z B;  4BNC A;  2VBY A;  1XGS A;  2EA4 A;  3V8J A;  4GO1 A;  3LAP A;  3RDI A;  2STT A;  4Q48 A;  2F5D A;  3ZP5 A;  2VBZ A;  5BS6 A;  1B4A A;  2ZME B;  3U2R A;  4OIQ F;  3F8F A;  4YFX F;  4I0B A;  1S3J A;  1R22 A;  2FOK A;  4D0P A;  3TGN A;  3KP6 A;  1XCV A;  3LA3 A;  4HA8 A;  3VFZ A;  4UV9 A;  1J59 A;  2H27 A;  3EDP A;  5HLG A;  1H0M A;  2XAQ A;  4U0Y A;  2QYO A;  4I09 A;  1BIB A;  3MFK A;  2PMU A;  1IN7 A;  2HKO A;  3HRM A;  1SFU A;  2D2W A;  1S6L A;  4EMS A;  2FF4 A;  1LNW A;  3ABT A;  2D45 A;  2Q0O A;  2KIM A;  4R1H A;  3QU3 A;  3KE2 A;  4M9S A;  2IRF G;  3I5U A;  3BP8 A;  1JXS A;  3J80 Z;  5ICE A;  1JE8 A;  2OD5 A;  2FA5 A;  5ICF A;  1FP1 D;  2FXA A;  3MCZ A;  4Y13 A;  4IRG A;  2O3F A;  3LA7 A;  3IKT A;  3FMQ A;  1OYW A;  2BBY A;  4Y15 A;  1I1G A;  4PGG A;  3FX3 A;  5DDG A;  3JTG A;  2HWV A;  3FXR A;  3M8E A;  3VOD A;  1IW7 F;  1W5T A;  3U9G A;  3HOS A;  2P4W A;  4EJT A;  5LEK A;  4XRF A;  2A61 A;  1YS7 A;  5K5R A;  1FYM A;  1R7J A;  1AOY A;  2YX7 A;  4CO8 A;  1R00 A;  3ZPL A;  4I7H A;  2EV5 A;  1SFX A;  3R0A A;  5LEJ A;  1O7L A;  2QWW A;  2XAG A;  4L0Y B;  4A0Y A;  1Z91 A;  4ESF A;  1SD6 A;  1O57 A;  2DTR A;  1FY7 A;  5JHU A;  1UHW A;  5CVI A;  4LLN A;  4KN7 X;  1XSV A;  2XV4 S;  3J80 K;  2EWN A;  1IRG A;  2WTE A;  5IT9 Z;  4HW0 A;  2HTS A;  2IPQ X;  5TJJ A;  1G4D A;  2FML A;  4HX7 A;  2P5V A;  1ON1 A;  1O3T A;  1HSJ A;  1S29 A;  2EA2 A;  1QBJ A;  1GVJ A;  1IN8 A;  1IRF A;  2O61 A;  1IUY A;  3N4M A;  1LEA A;  4L5I A;  1FBQ A;  2A68 F;  4KMF A;  5HVQ C;  1RUN A;  3F6V A;  1A04 A;  3RIR A;  2PMH A;  2QUF A;  1B59 A;  4ESJ A;  1G3Y A;  3KP7 A;  1UHM A;  2ZXJ A;  2O0Y A;  2YU3 A;  2P6S A;  2JSC A;  2VC0 A;  4XSZ F;  1W7P D;  3FMR A;  4I01 A;  1IN4 A;  3GX4 X;  4H0E A;  3RKY A;  4ZZL A;  2CWE A;  1UCR A;  2A6E F;  3W6K B;  1U5T A;  1FSH A;  4BYY A;  4P55 A;  3LST A;  4CDG A;  2IJL A;  3GF2 A;  3HSR A;  1E17 A;  1S7O A;  3KZY A;  2O8X A;  4MQV A;  1PP8 F;  1USS A;  2M30 A;  4EM0 B;  3EUH A;  3BJO A;  4HZF A;  3PQJ A;  1WWX A;  1X3U A;  1L3L A;  4R8H A;  5E17 F;  1D8K A;  2O03 A;  3E6C C;  3ZN0 A;  3F8M A;  3G3Z A;  4OIO F;  1CGP A;  1MGT A;  4EQQ A;  1R5G A;  2XAH A;  3VEP A;  4OU0 A;  3I59 A;  4L5J A;  3CUQ C;  2OQR A;  5F64 A;  1O7F A;  2MH9 A;  4NQW A;  3H3U A;  2HFH A;  1Z7U A;  3HHG A;  1QNT A;  5A2Q Z;  2LSO A;  4LLG F;  2ETH A;  1HQC A;  5LLQ A;  3F8B A;  2VOP A;  3LQQ A;  1XDS A;  3SZP A;  2CW0 F;  3HSF A;  2PQ8 A;  3ZMU A;  1U5T B;  2ISZ A;  1SFE A;  2LNB A;  1LEB A;  4LLL A;  2VON A;  3KP5 A;  5FO5 A;  3R60 A;  2A07 F;  1FOK A;  4IF4 A;  1TQM A;  3SHF A;  2JT1 A;  1UB9 A;  4RAZ A;  5DD4 A;  2JRT A;  2DPD A;  4KA4 A;  1UFM A;  1XMK A;  2PG4 A;  2X0L A;  3DPL C;  4HX8 A;  1J0R A;  1EH7 A;  1BM9 A;  2Y48 A;  1TQP A;  5DUK A;  5D5U B;  2QZ8 A;  2K86 A;  2V79 A;  1OKR A;  2JTV A;  4O3M A;  2LKP A;  4UVB A;  4WX9 A;  3T5X A;  2F5E A;  2DI3 A;  4KNY A;  5ICG A;  4WCG A;  3I59 B;  3CO6 C;  3HHH A;  2K7L A;  3HSE A;  3MEX A;  2Q2E A;  3L09 A;  1JHF A;  1YYV A;  2G9W A;  4AIK A;  3NQO A;  5A2Q K;  3K69 A;  4RB1 A;  5BMZ A;  3SXY A;  2JZY A;  2K4J A;  4IRH A;  4ASN A;  3WTZ A;  5LGT A;  2RKH A;  1U6G A;  3BRO A;  1ZAR A;  2DPU A;  4AIH A;  2UZK A;  4LMY A;  4CGZ A;  2YX4 A;  2PEX A;  2CGP A;  3DF8 A;  2E7W A;  4MHG A;  3BJ6 A;  3E5Q A;  1O3R A;  2Y75 A;  2XAJ A;  3ISP A;  1Z05 A;  2UXN A;  2FRH A;  2W24 A;  3RKX A;  4A5M A;  3EQL F;  4CYD A;  3VB2 A;  3EYY A;  3G73 A;  3IHU A;  5D6E A;  5BPI A;  4YFN F;  4UXN A;  3F22 A;  1BJA A;  1YW9 A;  1FZP B;  2DQR A;  1HW5 A;  5D4R A;  5LHG A;  2HOE A;  5FGM A;  5DEQ A;  3E6B A;  1EH6 A;  5CVR A;  4ZYE A;  3S2W A;  2Q8K A;  3Q9S A;  5ILV A;  2X4H A;  1MJ9 A;  2L02 A;  3TKY A;  2J5P A;  4HOB A;  1DP7 P;  2EV0 A;  1I1S A;  2ADU A;  2ELH A;  5EEG A;  5E1X A;  3R6S A;  5ERI A;  4N9I A;  2RV8 A;  5D4S A;  3WU0 A;  4MEY F;  3I4P A;  3F6O A;  5H6R A;  3E5U A;  2L4A A;  4U0V A;  4Z2Y A;  3HTS B;  5ICC A;  4EJO A;  2IP2 A;  3KET A;  3K0L A;  3R61 A;  4M6X A;  4MNU A;  4PCQ A;  3ABU A;  4FHT A;  5E18 F;  1J5Y A;  4OMY A;  3FXQ A;  4G7Z F;  1MJB A;  4M6Y A;  2QQ9 A;  2VT2 A;  4Q4Z F;  3F21 A;  5KVR A;  2RQP A;  2PI0 A;  1DUX C;  2VE8 A;  2D1H A;  2HR3 A;  1KQ9 A;  1TTY A;  3FMS A;  5F1R A;  2F5F A;  4WK8 F;  5FFX A;  2LDU A;  4IHT A;  1ONV A;  2W84 A;  4QWQ A;  2NAZ A;  3V8L A;  3DEU A;  1KYW A;  4RGU A;  4KFC A;  4K2E A;  1F5T A;  3WTV C;  3AAF A;  2ZBK A;  3IWF A;  3RJP A;  1U78 A;  3C3W A;  3VOE A;  5J8F A;  2ACJ A;  3Q5F A;  3WTW C;  1G6N A;  4LG0 A;  1H9T A;  3KLN A;  5BOX A;  2EJR A;  4MTE A;  2OBP A;  4G6D A;  2HGC A;  1FYL A;  4UHT A;  1OMI A;  3IRQ A;  5E20 A;  1KU9 A;  4N0B A;  2P6T A;  1FSE A;  1FYK A;  3GW2 A;  5HLH A;  4AWX B;  3B73 A;  1XD7 A;  2Z5U A;  2MBF A;  3GUD A;  3TOA A;  4EGY A;  2RDP A;  1LB2 A;  3GFI A;  3KEQ A;  2QVO A;  2Z33 A;  3M8F A;  1BI3 A;  3Q9V A;  1ZGJ A;  1EH8 A;  2RNJ A;  2NNY A;  4JQF A;  5D5V B;  3TDU C;  3MAJ A;  1SD4 A;  1W7P A;  2EFQ A;  3MWM A;  1VTN C;  1KQ8 A;  4EJU A;  4MEX F;  2BE5 F;  5ILU A;  3KCC A;  2V1D A;  4HLX A;  3J81 K;  4XLN F;  1ZHF A;  1IN5 A;  2H09 A;  4BXU A;  1PUE E;  5FFZ A;  1T98 A;  4ENN A;  2H94 A;  2E7X A;  4RB3 C;  4LG0 B;  1XCB A;  1J2X A;  3PQK A;  4LD5 A;  1ZRD A;  2XHK A;  2M87 A;  2FNA A;  2DQL A;  1Z1D A;  1D5V A;  1IXR C;  1J9I A;  1DDN A;  5CYV A;  4M9X A;  3TDZ C;  1QPM A;  1ZLJ A;  1ODD A;  3P9I A;  1QGP A;  1WSU A;  3RTR A;  3C1D A;  3FXU A;  3QRF F;  1LDD A;  3I58 A;  5LGU A;  1KA8 A;  1Q1H A;  5ILS A;  2MH2 A;  2FE3 A;  1SD7 A;  3CTA A;  4A5N A;  2LF8 A;  2P8T A;  3LA2 A;  1W7P B;  4GXO A;  1P2F A;  1H9G A;  1FP2 A;  2R3S A;  3CO7 C;  1MKM A;  4YII A;  1KU2 A; 
#chains in the Genus database with same CATH topology
 1XMX A;  2F48 A;  1MMS A;  1G3W A;  2QSF X;  3T8R A;  1LDK B;  4IHY A;  2IA0 A;  2WY7 Q;  2FSW A;  5L3B A;  2PBI A;  3ELK A;  2GBY A;  5EDN A;  2JA8 J;  2VOD A;  4KN4 X;  4XLF A;  1I6X A;  3RZO J;  2E19 A;  2FBH A;  4EM2 A;  4RBO A;  1OLT A;  3FZV A;  4TV7 A;  4IOA F;  4CZC A;  1XB4 A;  1RI7 A;  3C7J A;  3G4S I;  2QBY A;  1D3Y A;  3OL3 A;  4PK4 A;  3ZMZ A;  1S72 I;  2CQQ A;  4HF0 A;  1YLF A;  2JQ7 A;  2K9L A;  4A3F J;  2QSG X;  4P9F A;  4CCN A;  1KU3 A;  5DM6 F;  2WY8 Q;  2EPF A;  2M8G X;  1K7A A;  1BL0 A;  3OYG A;  3SZT A;  4MFD A;  5K5O A;  3TP3 A;  2WV1 A;  3HJE A;  2HTJ A;  1UZC A;  4RLQ A;  2GQQ A;  2HYG D;  3BQZ A;  4N4O B;  3LMM A;  2X1E A;  1XSX A;  4XSX F;  2G7U A;  2ISY A;  1FBS A;  4CSW A;  1QPI A;  2K85 A;  2L7M P;  3QOE A;  1RKT A;  3WE2 A;  2P5K A;  2M2E A;  4BE1 A;  4YG2 F;  3VPR A;  1IF1 A;  3ZGK A;  3FHZ A;  2DK8 A;  2HPM A;  2R7D A;  4CA0 A;  3BPV A;  1WH5 A;  3CCJ I;  4G7O F;  3OYH A;  1R58 A;  1FT9 A;  2QQB A;  2R93 J;  3TW7 A;  1OJL A;  2KJC A;  3WTT C;  1N75 A;  4XRS A;  4EGZ A;  4KIG A;  4A0Z A;  2K5C A;  1EV7 A;  5HOO A;  5HLI A;  4A93 J;  2DT5 A;  5TRD A;  4ZC3 A;  3I4N J;  1DP3 A;  3Q3S A;  1MBE A;  4UB6 C;  2CG4 A;  2COM A;  1BC8 C;  1DPU A;  5HS9 A;  2HXI A;  4BHP A;  5HLT A;  3S1M J;  3ZMT A;  2ZNZ A;  4EV0 A;  3DV8 A;  1HW2 A;  1V55 H;  3WOD F;  1BOA A;  2GIV A;  1WVR A;  5FB2 A;  5DD8 A;  2DW4 A;  2KIS A;  2R7Q A;  3UR3 C;  5IT9 K;  3C18 A;  2A6H F;  3EET A;  5D8L B;  1JKR C;  2DTZ A;  4E7H A;  1YIO A;  3KP3 A;  3QPT A;  3QPS A;  4M3B A;  4NDL A;  3PIP F;  1QZY A;  1YE9 A;  2FJ1 A;  2CQX A;  4CYC A;  3B6A A;  1LJ9 A;  1SMY F;  1TT0 A;  1IV6 A;  1FNN A;  5C4J J;  5LBQ A;  2VT3 A;  5DTD A;  3WU1 B;  3ZQC A;  1XTA A;  4LB5 A;  4FE4 A;  3H9G A;  5IP6 A;  2VUM J;  2QBY B;  2RC4 A;  3K6G A;  4HEA 2;  1B9M A;  4HST A;  4AUX A;  4HF1 A;  3ZMS A;  4G6Q A;  2QSH X;  5EG0 A;  3CUO A;  4LFU A;  1KON A;  5CLS A;  2YU9 J;  1MJA A;  2WBM A;  3CCU I;  2QM3 A;  2OTL I;  2XPU A;  3MZH A;  4G6T B;  4E7K A;  1WH7 A;  4RGS A;  4M71 A;  5IYB J;  3J7Y J;  3V7S A;  2DJI A;  3TQN A;  3JRD A;  1Z6R A;  2GLO A;  5KNL A;  2VQL A;  3H5N A;  3I0T A;  1P4W A;  2OQG A;  2KQR A;  3FM3 A;  2LRD A;  4I98 B;  4KIT B;  2VBW A;  5D8K B;  3BOQ A;  3CES A;  1X1P A;  2X6O A;  1K6Y A;  2E2H J;  2ME0 A;  4AC0 A;  4KMU X;  2EFN A;  1YIJ I;  5E8G A;  1S7A A;  2XRL A;  3BWG A;  4ENM A;  2VJ5 A;  4ZTF A;  1K6O A;  2OU2 A;  3L2W A;  3BG7 A;  1TNS A;  2ESN A;  5ED4 A;  3JRB A;  2M4G A;  2Y0S A;  5L3C A;  1PYV A;  2WAD A;  3BY6 A;  4L9V A;  4CIC A;  5FLX Z;  1YIT I;  3GME A;  2HDC A;  2W25 A;  2ECB A;  3WGG A;  4IHS A;  1E3H A;  4BL0 B;  2LY2 A;  2V6C A;  3E1S A;  5DUI A;  3N97 A;  1GT0 C;  1NH3 A;  2M1B A;  2KZG A;  3KYC B;  3RZD J;  3F72 A;  3M8J A;  4M6V A;  2IA1 A;  4P9U A;  4EM1 A;  1WFX A;  1VQ5 I;  3FIS A;  1W36 C;  4CYC B;  3BR6 A;  1MMD A;  3WTS C;  4HQE A;  3LSK A;  1X4O A;  1HST A;  3JW4 A;  1LVK A;  1BI2 A;  3OYM A;  2X1D A;  2Z9O A;  2DA4 A;  4IZZ A;  4M73 A;  5JI6 A;  1T38 A;  4I0A A;  3JAM Z;  2L01 A;  3HOZ J;  5JR3 A;  3OOU A;  3M1E A;  3BLY A;  1YFH A;  4NC7 A;  1EKE A;  5EG0 B;  1FLI A;  3BQY A;  1GUU A;  3M07 A;  4WF2 A;  4U7D A;  2QEX I;  1FOW A;  2A69 F;  4L9N A;  5HNF A;  3ZRG A;  3BZ6 A;  4KIB A;  2E2I J;  3ZQH A;  3IWZ A;  2PLY A;  2QKM B;  3SFZ A;  3J7A O;  3PSF A;  4IJA A;  3JRG A;  2RVC A;  4BQO A;  4XQF A;  2ELK A;  1LDJ A;  3O6B B;  4F92 B;  4BHC A;  2DMU A;  3VDX A;  2AQE A;  2IXS A;  3MN2 A;  1U3E M;  1IXS B;  2NYX A;  4XLE A;  2GA1 A;  2OUM A;  3NEU A;  4HG2 A;  2IVM A;  5EZG A;  2MFZ A;  5DV5 A;  3SEZ A;  3CZ6 A;  4HAM A;  2F5C A;  3ZN1 A;  1ACI A;  4D5C A;  2XUB A;  1YTY A;  2CS3 A;  4QLC U;  4G7H F;  2BV6 A;  3RPQ A;  4S0H B;  3PFI A;  5CQE A;  2KIQ A;  2EV6 A;  3IKV A;  4ANJ A;  4E7Z A;  1KU7 A;  1R23 A;  2FQ4 A;  5HOD A;  2OA4 A;  1R49 A;  2KIU A;  1VQN I;  5FLX K;  4G8X A;  4EJW A;  1MMA A;  3CJN A;  1GXP A;  1V3F A;  2YPR A;  4GYG A;  1E3O C;  3LSP A;  4UY8 I;  1G3T A;  1XDU A;  3S3M A;  4ZH4 F;  3FHN A;  3FXK A;  4EJV A;  4RS8 A;  4B4C A;  2DXI A;  3RQI A;  1J75 A;  4UUV A;  2M8E A;  3H1C A;  3OMY A;  3OR1 C;  4QPQ A;  5M5W J;  1HA8 A;  4XBF A;  4HPQ A;  4KT5 C;  2DLL A;  1VI0 A;  2DFF A;  5GTI C;  4I02 A;  2CQK A;  1HLV A;  2R7F A;  1Y56 A;  4R79 A;  2JRM A;  1OR7 A;  1JTY A;  1FBU A;  2LF7 A;  4MTD A;  4ZJZ A;  4PSX A;  2K27 A;  2KIF A;  2W85 A;  1DU0 A;  2L3D A;  3JAM K;  3HRU A;  2ZNY A;  5KK1 A;  1EA3 A;  1R1T A;  3Q0W A;  3CQZ J;  1JT0 A;  5EZH A;  2QKL B;  4U88 A;  1J7K A;  4IL6 C;  5E1Z B;  1BBY A;  4M72 A;  2MW8 A;  2CUE A;  2VOO A;  4EEF G;  3HDD A;  3DCF A;  4HNT A;  3CDL A;  3WTY C;  1D5Y A;  4C3H J;  2F2E A;  1U9O A;  2KKO A;  3F3X A;  2DMQ A;  1DPR A;  4NC6 A;  3FF5 A;  2HNH A;  3OOP A;  3HGG A;  4PSW A;  1NG6 A;  1S9H A;  3D1N I;  3LOC A;  2HOS A;  3CUQ A;  3KEO A;  1QA6 A;  3ZQ7 A;  3TO9 A;  3ZR8 X;  2VC1 A;  4JK1 X;  2A3S A;  4ETS A;  4FAS D;  1KYZ A;  3ZQI A;  4PJN A;  4UUS A;  2JA5 J;  4JBA A;  1D0Z A;  4GYI A;  1U2W A;  3GTK J;  2LK2 A;  4E70 A;  2AS5 F;  5DYM A;  2XGC A;  4HF2 A;  4MGR A;  4F7Z A;  2VE9 A;  3O2P E;  3PSI A;  4XOT A;  2LYC A;  4IEJ A;  1H8A C;  2UXX A;  3OSF A;  3AFH A;  1QZE A;  4V2G A;  2P7C B;  2MA3 A;  2Y2Z A;  3KLO A;  4BQA A;  4A6E A;  1ZG1 A;  3T1B A;  3OWT A;  2YS9 A;  4OMZ A;  5L3D A;  3JRE A;  1IAW A;  4CH7 A;  5LHH A;  3LSJ A;  1AKH A;  4CXF A;  4F91 B;  2VL8 A;  2EK5 A;  3OL4 A;  3CCY A;  4AYB N;  3MKY B;  3NRV A;  4RGR A;  2NXN B;  3OYA A;  4PFO A;  2CYY A;  2XVC A;  1OFC X;  1LFU P;  1WQ2 A;  3I9V 2;  5B66 C;  4HDV A;  2RGV A;  4RAF A;  1YJN I;  1BI0 A;  3I64 A;  3RPU D;  1B9N A;  3IC7 A;  1MBK A;  5K1Y A;  2DT7 B;  4ON0 A;  2NVT J;  3LAJ A;  3V7C A;  5J6X A;  1XMA A;  4X6A J;  3LSI A;  3FWE A;  4OIN F;  2NVQ J;  4NHJ A;  4P96 A;  4AIJ A;  1TLH B;  2CFO A;  4S05 A;  1I50 J;  1ZRF A;  1PDN C;  2EQR A;  3MQ0 A;  2ESH A;  3P9C A;  5JHF A;  2YR2 A;  2KPM A;  1KZH A;  2Y30 A;  4XMY A;  3RKW A;  5JFR A;  1R71 A;  2A5Y B;  4A2U A;  4M3E A;  1P7I A;  3GEZ A;  3DKX A;  4HX4 A;  2LY1 A;  3OSG A;  3CLQ A;  3LSG A;  2QEN A;  2XAF A;  2IA2 A;  5JVG F;  4RAY A;  4WWC A;  1YW7 A;  2XKP A;  4KUM A;  1WI9 A;  3QYF A;  3I3L A;  1X3Z B;  1O3S A;  2GXG A;  3CUQ B;  4CZZ A;  1WPK A;  3CMA I;  1K79 A;  4FX0 A;  5H6Q A;  3BG3 A;  3CP2 A;  4ZYG A;  1ZAO A;  1QO0 D;  3I53 A;  4UUS B;  2M0M A;  4ENJ A;  3KP2 A;  3V4G A;  5B5E C;  3UNG C;  4D1Q A;  1UG0 A;  3QP5 A;  4C2T A;  4P5O A;  2MC4 A;  2LG4 A;  2EIJ H;  1UJ8 A;  2NRA C;  2ZFW A;  2OAZ A;  4WXC A;  3Q0V A;  3AG2 H;  1X3W B;  4B43 A;  3CCL I;  2MYS A;  2L9R A;  1SAX A;  3I71 A;  2OF7 A;  2V4J C;  1ULY A;  1YW8 A;  1XS9 A;  3BG9 A;  4HNU A;  3HM5 A;  1NHA A;  2CW8 A;  2Z1D A;  1RZ4 A;  1K78 A;  1AKH B;  1B6A A;  3DFG A;  4N9H A;  3WU2 C;  3GFM A;  4AD9 A;  2FMY A;  2HZD A;  3CD6 I;  3CDI A;  1BR4 A;  2KJB A;  4XLP F;  3K9T A;  3FK6 A;  2VXZ A;  3E6M A;  4J00 A;  4UVC A;  4BAY A;  1T39 A;  3AG3 H;  2JSP A;  4PZJ A;  2HXO A;  5HDG A;  3J7Z I;  1ZK8 A;  2R7O A;  4LK1 F;  1AHD P;  1ZLK A;  1P6R A;  2DK5 A;  3LWF A;  1O3Q A;  1NTC A;  1JUM A;  1YHQ I;  4CCM A;  1LE8 A;  1IZ1 A;  4KIC A;  1ZH5 A;  2JK3 A;  2NNN A;  1Y0U A;  3DEE A;  4PGH A;  3OYD A;  1IXC A;  5HDN A;  4JOM A;  3WGH A;  3TOB A;  3JTH A;  2PJP A;  2NS0 A;  3C2G A;  1IUF A;  3OYN A;  4C9Y A;  4OIP F;  5E1W A;  2X1C A;  2JPB A;  1FX7 A;  1U5T C;  3JR9 A;  3LSH A;  3L7W A;  5AIP A;  2DA7 A;  4S04 A;  1BR1 A;  3SEQ A;  2Z2S B;  1ZG3 A;  4B1R A;  1YJW I;  3NWS A;  1HF0 A;  2HDW A;  5IOY A;  3S93 A;  4Q47 A;  2VI6 A;  4L9T A;  5BPD A;  2HEO A;  4FT8 A;  2HVQ A;  4O6J A;  3COA C;  2M0C A;  2K02 A;  4LGW A;  5F27 A;  4B09 A;  2DA2 A;  3EUH C;  5M3M J;  2I10 A;  2ZJ2 A;  4LIU A;  1QHG A;  1YO5 C;  3HB9 A;  3A01 A;  4FQG A;  4A3D J;  1VQM I;  5DM7 F;  4BBR J;  1XPX A;  2RNG A;  2ZCW A;  1V4R A;  2QF7 A;  2ZC2 A;  2MLG A;  1T95 A;  2H1K A;  1IGN A;  3IRR A;  3GXO A;  4RB0 A;  3PJR A;  2CRG A;  5KAF C;  4XOR A;  2BXY A;  5IPA A;  1K78 B;  3L00 A;  3S16 J;  4IVN A;  1TWA J;  4RGX A;  5AIQ A;  3IL2 A;  1GLN A;  2OPT A;  4HLY A;  4XNF A;  5AON A;  1ERD A;  1TW2 A;  5GP9 A;  2HOA A;  2VBX A;  2BZT A;  2EZL A;  1JJ8 C;  5LGN A;  1TWC J;  2FEZ A;  1JHH A;  3IV5 A;  1W36 D;  1YG2 A;  1X1C A;  4DOZ A;  5F6F A;  5HNH A;  1W0T A;  2IS1 A;  2BEO A;  3C2H A;  4E7J A;  2V9V A;  3F8C A;  4F55 A;  2OTJ I;  1G3S A;  3VWB A;  1R9T J;  3V8K A;  3M9A A;  1TBX A;  5JVT A;  1LE8 B;  4UNO A;  2XAS A;  1S8N A;  4AYB A;  5FJ8 J;  2WV0 A;  3RYR A;  5IY5 H;  3D5R C;  1BIA A;  5JLX A;  2VN2 A;  2NOG A;  2LP0 A;  3MVP A;  4AVP A;  5L3G A;  2B7E A;  2R7X A;  2AHQ A;  1FWZ A;  1JUS A;  1A35 A;  5IP7 J;  3LSR A;  1APL C;  1Z67 A;  4YRV A;  1HDP A;  1XX5 A;  1FMW A;  1HKT A;  3IUO A;  1F4K A;  3EYI A;  2X6W A;  1RC9 A;  1I5Z A;  2I5U A;  3DQV C;  1F1Z A;  4I2O A;  1DGW Y;  1C0W A;  3R0J A;  1X1B A;  1N77 A;  5IP9 J;  3E5X A;  1AA7 A;  4IRI A;  2HI3 A;  1P4X A;  1MSF C;  5GAH J;  2MC3 A;  3DU6 A;  1ZGA A;  3IAM 2;  1JKO C;  1T2K A;  3QOP A;  3CCE I;  1SD5 A;  1TT5 B;  1T0F A;  2LFB A;  3HKZ A;  4U87 A;  2KP6 A;  4KYW A;  3F8N A;  2W82 A;  3WTU C;  3FBN B;  5HS8 A;  3W6V A;  5TGT A;  2J5O A;  5GPC A;  3H92 A;  3FM5 A;  2IGN A;  1AWC A;  3HRT A;  5BQT A;  3SQN A;  1QVU A;  3A01 B;  2XPW A;  3CDH A;  1ZG5 A;  2EB7 A;  3L2Q A;  1VQP I;  2JUC A;  1YI2 I;  2DJN A;  3L9F A;  3BR1 A;  3BDD A;  4DQ2 A;  5D6F A;  1K4T A;  1XC5 A;  4FE7 A;  1TWH J;  2GA2 A;  2K9Q A;  2UWM A;  3CMM A;  4AVZ A;  4KIF A;  1ZR4 A;  3BZK A;  5EYR A;  3GTM J;  1OCT C;  3CME I;  3E7L A;  2FOW A;  2HQ5 A;  1XN7 A;  4A3L J;  4XOP A;  1T08 B;  4DGW B;  2KMU A;  2PFB A;  5CKT A;  2GM4 A;  2XRO A;  3GTO J;  3S3N A;  1ITY A;  5E79 C;  2COB A;  2WWY A;  3S8P A;  2M7A A;  2NS8 A;  1SAN A;  2DA1 A;  2VJJ A;  4KJZ A;  2CQN A;  4W1U A;  3NAU A;  3T0Y A;  4LIV A;  1WI3 A;  2M5W A;  4BAC A;  2AXL A;  2O7O A;  4M74 A;  5CVV A;  2HU9 A;  1I39 A;  1F9N A;  3DTK A;  3OIO A;  2EFP A;  1HXD A;  1OPC A;  4CCO A;  4IO9 F;  2E1M B;  2XPV A;  1WRJ A;  5FD6 A;  3HOT A;  1OCO H;  4M9Z A;  5F04 A;  4ZYD A;  4MQ9 F;  2LBF A;  3E97 A;  3HZJ A;  3K4C A;  3HC7 A;  4U7B A;  2FNP A;  3P7N A;  3G2B A;  3ROU A;  2EFO A;  2R4G A;  4LK0 F;  2O6G E;  1WJF A;  4A12 A;  2M3A A;  3H5R A;  1XSD A;  2IT0 A;  1UST A;  3BTJ A;  1BI1 A;  2Z16 A;  2MD5 A;  1EJ9 A;  1Y1V J;  1FOX A;  3HUG A;  3DBH B;  2V1U A;  3OS1 A;  4BHB A;  3DBL B;  3KEY A;  4L18 B;  1RNL A;  3WG9 A;  3K4J A;  5LHI A;  4A3E J;  3T8T A;  1XGM A;  1GXQ A;  2STW A;  2BW3 A;  3RKQ A;  1ZRE A;  1PP7 U;  2BOL A;  4L9J A;  4ESB A;  3B6C A;  3MZY A;  4B8X A;  4ZYH A;  3ABM H;  2E5N A;  3ML6 A;  3HRS A;  3A02 A;  2K9N A;  5GAG J;  3VSK A;  2WAQ A;  3E6D A;  3K7A J;  1XGN A;  2BVL A;  4ZDP A;  3JRF A;  2LR8 A;  2MLK A;  2A6T A;  2C6Y A;  5J8C A;  2JA6 J;  2JWT A;  2MGQ A;  3E3V A;  3QPL A;  2H6C A;  5EF6 A;  2TRT A;  3A0B C;  3LFK A;  5LRS A;  2IGK A;  1OCP A;  2PN6 A;  2PMZ N;  1W0U A;  2B63 J;  1YS6 A;  3GO5 A;  2CV1 A;  2D1V A;  2JVG A;  2ZO4 A;  3K1P A;  4I6Z A;  2OZ6 A;  2NS7 A;  1DQU A;  2ID3 A;  3DPT A;  1OYI A;  3FXO A;  4B48 A;  3ULQ B;  2Y69 H;  4EVI A;  4PJ0 C;  4QIW N;  2L54 A;  5DCM A;  1HKQ A;  5K7F A;  4RA2 A;  3BTC A;  3LQR A;  1H88 C;  4BY1 J;  2E60 A;  1K83 J;  1VQ8 I;  2KRF A;  1KGS A;  1I27 A;  2QLZ A;  2CFX A;  3KIO A;  2LBF B;  4IX7 A;  3PNV A;  3M7G A;  1R5H A;  3GTQ J;  5FLM J;  4WXD A;  5CVJ A;  4CCL A;  1VQK I;  1MW7 A;  5FRM A;  2KHM A;  2XGX A;  4ENK A;  3DKY A;  1JGS A;  4HV5 A;  5CVU A;  4XN0 A;  3A2K A;  1XGO A;  3R4K A;  2GWR A;  1IDY A;  3ESW B;  1RUO A;  3DXJ F;  4JX6 A;  4D5F A;  3D5S C;  3FDY A;  3HUG B;  2NVU B;  2IS4 A;  1YQA A;  1Z21 A;  2HQR A;  3L2C A;  2P7V B;  3CLO A;  1RR8 C;  2FD5 A;  1D1A A;  3IAS 2;  1WKM A;  1LQ1 A;  1LPQ A;  3QPH A;  3DKW A;  1D8J A;  3BTI A;  4QPO A;  1TW3 A;  2BW3 B;  3WTX C;  2JA2 A;  2DFE A;  5CQG A;  4YEL A;  2DOD A;  1STZ A;  5F08 A;  4A3I J;  3RPU A;  4XKV A;  5E3N A;  3K4L A;  2W1O A;  2GZW A;  3P9K A;  3O3K A;  2FQ3 A;  3CC2 I;  1GHC A;  2HOT A;  2CO5 A;  4LJZ F;  3LNQ A;  3WE3 A;  1HKS A;  1W5S A;  3K4B A;  4UV8 A;  1U8R A;  4A6D A;  3GTL J;  3D0S A;  4C3J J;  3KYD B;  5L3F A;  2E1C A;  1T56 A;  3TO6 A;  3F23 A;  2H6B A;  1P9Q C;  3V42 A;  4IPA A;  1SMT A;  1IJW C;  4BH9 A;  3GZ5 A;  1VFC A;  4ZYA A;  4BU2 A;  2FBI A;  1BOB A;  4DBR A;  4WXH A;  1CF7 A;  1W1W E;  2PX9 A;  4FX4 A;  1Y8R B;  1FJL A;  2HYF A;  1TP4 A;  4Y17 A;  1KQ0 A;  2HZT A;  1RET A;  2X85 A;  5CJ9 A;  3IH4 A;  2H8R A;  2TDX A;  4E6K G;  3W2A A;  1D0X A;  4YIF A;  2EZH A;  4OOI A;  1SVM A;  4A0X A;  3REO A;  2HKX A;  2CSO A;  2XKO A;  5DCM B;  2BGC A;  2L4M A;  1DGR M;  1ETO A;  2WC2 A;  2X9D A;  2O5R A;  2R5Y A;  1WJC A;  3RI4 A;  2IW5 A;  4EAT A;  3HTU A;  4JYK A;  2V1X A;  4JP0 A;  5D5W B;  2L7Z A;  4OWR B;  4NNJ A;  2JPC A;  1XG1 A;  4PJL A;  1JKQ C;  2GOM A;  3G6E I;  1N78 A;  3IH2 A;  3D5L A;  2FX0 A;  2FU4 A;  4HV6 A;  4G9Y A;  5L3E A;  3W2V A;  1MD0 A;  4D9J A;  4RAG A;  1X1A A;  1ZYR F;  3OS2 A;  1WJB A;  4HRI A;  3H3Z A;  1A6I A;  3K1M A;  1HBX G;  5LFA A;  2K3F A;  5K5Q A;  2V26 A;  4PJM A;  3H0D A;  1HC8 A;  1QZZ A;  3OY9 A;  1D1C A;  2A5W A;  2Z99 A;  4HQM A;  4II3 A;  4YFK F;  1T8I A;  1R36 A;  4DNC A;  4DZP A;  2ZKZ A;  4CUG A;  2LKX A;  2NOJ B;  5IYD J;  4LB6 B;  1BC7 C;  2HPI A;  2H1L A;  3CJR B;  2BY3 A;  3BJA A;  3DLA A;  1JI8 A;  2K9M A;  4ZZD A;  4GGG A;  1J09 A;  2R0Q C;  1JKP C;  1REP C;  1UMQ A;  3QQA A;  2Z3Y A;  2CV0 A;  2DU9 A;  4RB2 C;  1MDM A;  2EFW A;  3OYL A;  4BUP A;  1ZEL A;  3GVA A;  3A1Y A;  2RAE A;  3QP6 A;  4O5V A;  3LL7 A;  3QU6 A;  4Q5S F;  4U0W A;  4ITV A;  3W6J B;  5F0H A;  3U1D A;  2QCO A;  3I4M J;  1IV8 A;  1IRZ A;  2R7Z J;  1TQI A;  3KFW X;  5IYC J;  2YUS A;  3GYH X;  1ZRC A;  3OYI A;  4C2M J;  3TBI A;  1ZN2 A;  5D5X B;  1RIO H;  3KYL A;  3K2Z A;  1BN5 A;  1DU6 A;  2VQH A;  2GXB A;  1N25 A;  1R1V A;  1R5I D;  4AU7 A;  3ZMD A;  2DO7 A;  3WGI A;  1RPW A;  1FC3 A;  3OYK A;  1CF7 B;  1UAA A;  4V2F A;  1LFP A;  2DOE A;  1P92 A;  5IT3 A;  1G2H A;  2R92 J;  4BE0 A;  3JSP A;  2YSR A;  1Z3X A;  4NB5 A;  2ZXW H;  3TO7 A;  1RR7 A;  4PUS A;  2F5V A;  4IXA A;  4NBQ A;  3VYR B;  3KZI C;  2P5L C;  3DP7 A;  2RQQ A;  3KX2 A;  1E2X A;  2R5Y B;  2DA6 A;  2HS5 A;  1FEX A;  1T6S A;  3ZQL A;  2O9L A;  2XAU A;  3FKJ A;  2HQN A;  4GCV A;  2E2J J;  1P4A A;  3RYP A;  1P7J A;  1MZB A;  3V7R A;  5TIS C;  1E0E A;  2PMZ A;  5C3E J;  3ERE D;  2CJJ A;  3JSO A;  5C4X J;  4KIS A;  3QAH A;  2OCC H;  5H20 A;  2ICW G;  1MH4 A;  2LOO A;  2QQA A;  3GLX A;  1L0O C;  1ON2 A;  3PO2 J;  2DFI A;  4UVA A;  4KDP A;  2E1N A;  1LUJ B;  2B0L A;  2D5V A;  5EEH A;  5FKN A;  3MKW B;  4XRM A;  4ZDL A;  2VB6 A;  4LIT A;  1TNT A;  3GFL A;  4P1W A;  2IS6 A;  2ZME A;  3G71 I;  3K1N A;  1Y39 A;  3HIF A;  4G94 A;  4CHU A;  2DN0 A;  2M45 A;  1MBG A;  3ECH A;  3PO3 J;  3ZMV A;  2IEK A;  4LOC A;  9ANT A;  3GFJ A;  5HDK A;  2VKH A;  1Z9C A;  4E7S A;  4XID A;  3OV8 A;  4BQN A;  1LVA A;  3KP4 A;  5BNG A;  3ZCO A;  3K4K A;  2DAO A;  1MDM B;  1FPQ A;  1VQ6 I;  4XKW A;  3TMO A;  3HKZ N;  4B47 A;  2E1M C;  2DBB A;  2AQF A;  4Y7N J;  1Y8Q B;  1Z6T A;  4HNV A;  2G7H A;  4OIR F;  5HS7 A;  2RN7 A;  3DWL E;  3B02 A;  2W57 A;  5FD5 A;  4YIR X;  2H8W A;  3AKZ A;  2XRN A;  1IN6 A;  3OYF A;  3GZ6 A;  2DOA A;  1B72 A;  3F0C A;  1B1B A;  4HDU A;  2E35 A;  3S14 J;  2NVX J;  3H9Q A;  1X2M A;  1I3Q J;  3ECO A;  3VSL A;  4BS9 A;  2VJI A;  3GLL A;  3WHB A;  2GAU A;  1R1U A;  3GWZ A;  6PAX A;  1UHS A;  3KZZ A;  5LRR A;  2OZU A;  4PDK A;  5F0C A;  4NUB A;  1OCZ H;  3J81 Z;  1Y6I A;  2FBK A;  3I54 A;  2XIG A;  5E8I A;  2EH3 A;  1I3A A;  4MFE A;  1T0F C;  2R7R A;  4ABZ A;  3OR2 C;  2A05 A;  1CQT A;  4V19 K;  1W4M A;  2K4B A;  4HBL A;  4HYE A;  5J1Y A;  3BPX A;  2VAS A;  2BYV E;  5DCF A;  4BXF A;  1GVD A;  2CMP A;  2XGE A;  2Y0M A;  1OYY A;  2CUJ A;  3HYI A;  1QQI A;  1VQL I;  1HW1 A;  4L0Z B;  2IGM A;  3OYB A;  2VBY A;  4BNC A;  3IH3 A;  1NG7 A;  1XGS A;  1WHU A;  2LC2 A;  4XKB A;  2EA4 A;  1ENH A;  3EPZ A;  1BJZ A;  3V8J A;  5J1R A;  4A3C J;  2X48 A;  2XDV A;  4GO1 A;  3MKZ A;  3LAP A;  3BTL A;  2Y9Z A;  2IS2 A;  3RDI A;  2EZI A;  2STT A;  1BR2 A;  4Q48 A;  2F5D A;  3ZP5 A;  2VBZ A;  5BS6 A;  2O8K A;  1B4A A;  2ZME B;  2W00 A;  3U2R A;  2E5Z A;  1RKW A;  4OIQ F;  3F8F A;  3KPH A;  4N4N B;  3GCM A;  4YFX F;  4I0B A;  1S3J A;  1R22 A;  4H4K C;  4BXX J;  2FOK A;  4D0P A;  3TGN A;  2QGU A;  3KP6 A;  1XCV A;  2BVM A;  1SFO J;  3PIO F;  3S17 J;  1JT6 A;  3LA3 A;  4HA8 A;  1IG7 A;  3VFZ A;  5CPR B;  4A3M J;  4UV9 A;  1J59 A;  1SC7 A;  2H27 A;  4GFB A;  1SVO A;  2F4M B;  3EDP A;  3S1R J;  5HLG A;  2L9N A;  1H0M A;  2CUF A;  2XAQ A;  2WAQ N;  1GV5 A;  4U0Y A;  1VQ7 I;  2QYO A;  4I09 A;  4F3Q A;  1B72 B;  1BIB A;  3MFK A;  1MBF A;  2PMU A;  1IN7 A;  1Z77 A;  3S32 A;  2ZB9 A;  4IKF A;  3N05 A;  2HKO A;  3HRM A;  1SFU A;  3E0J B;  5GTH C;  3QYE A;  2D2W A;  1S6L A;  1SAU A;  4EMS A;  1YRN A;  2FF4 A;  1HOM A;  1LNW A;  3ABT A;  2D45 A;  1ZQ3 P;  2Q0O A;  2KIM A;  2XF7 A;  3QU3 A;  4R1H A;  5C44 J;  5GAD J;  2LD5 A;  1JJ6 C;  3CC7 I;  3SDB A;  2KDO A;  3KE2 A;  4M9S A;  5GAE J;  2IRF G;  3I5U A;  3NAR A;  3BP8 A;  1JXS A;  3J80 Z;  1ORK A;  4GDF A;  1JGG A;  2MG4 A;  5ICE A;  1LFB A;  1JE8 A;  1TWF J;  2OD5 A;  5E3L A;  2FA5 A;  5ICF A;  4DIQ A;  1S7E A;  1FP1 D;  3CCS I;  2HYJ A;  3HBL A;  4A69 C;  2FXA A;  1FOY A;  3MCZ A;  3BCB A;  4Y13 A;  1I6H J;  4IRG A;  2KRC A;  2O3F A;  3GTG J;  3X2Q H;  2L9V A;  2DMT A;  3HG9 A;  3LA7 A;  3IKT A;  3FMQ A;  1OYW A;  2BBY A;  4CCK A;  1YX3 A;  4Y15 A;  4W97 A;  1I1G A;  4PGG A;  1Q1V A;  3FX3 A;  5DDG A;  3HOW J;  4BQQ A;  3JTG A;  2HWV A;  3FXR A;  1ETV A;  2XF5 A;  3ABK H;  3M8E A;  4DJA A;  2CUZ A;  3VOD A;  2ZFU A;  3OYE A;  3OIP A;  3PFY A;  3QYB A;  1EF4 A;  1IW7 F;  4FCY A;  1W5T A;  2BHY A;  3U9G A;  2I8D A;  2GXA A;  1RRJ A;  4CCJ A;  5B1A H;  3HOS A;  2P4W A;  1ZGW A;  2WB1 N;  1MH3 A;  2KDZ A;  4EJT A;  3DEW A;  5LEK A;  1VQ9 I;  4XR6 A;  3MMY B;  4XRF A;  5EJC A;  2LKS A;  2A61 A;  4BDY A;  4IQJ A;  3SFI A;  1QVT A;  1YS7 A;  4A3B J;  5K5R A;  1FYM A;  1R7J A;  5K7H A;  2DA3 A;  1AOY A;  2YX7 A;  4HSR A;  4CO8 A;  4Y3O A;  1A36 A;  1R00 A;  1D1B A;  2R5Z A;  3ZPL A;  4I7H A;  3FIW A;  4GRI A;  3TED A;  2EV5 A;  4E7I A;  1OCR H;  1HDD C;  1SFX A;  3R0A A;  5LEJ A;  1O7L A;  2QWW A;  2XAG A;  4L0Y B;  3M1C A;  3IP4 B;  1PJR A;  2KLO A;  4A0Y A;  1Z91 A;  4ESF A;  2X6Y A;  1F36 A;  1YRN B;  3DTE A;  1SD6 A;  1X19 A;  3U21 A;  1O57 A;  2DTR A;  4IOC F;  1VQ4 I;  3A4C A;  1IO2 A;  1FY7 A;  4Y4R A;  4B44 A;  5JHU A;  1UHW A;  5CVI A;  4LLN A;  1FIP A;  4KN7 X;  1XSV A;  2XV4 S;  2TCT A;  3J80 K;  2EWN A;  3CMY A;  1IRG A;  2WAF A;  2WTE A;  3BG5 A;  5IT9 Z;  3WG7 H;  3G1O A;  4HW0 A;  2HTS A;  1WJD A;  2XF6 A;  3LFU A;  2L5Q A;  4X0G A;  3CJT B;  3GTP J;  3L2U A;  3DPU A;  1NK3 P;  3FBI B;  2IPQ X;  5TJJ A;  1G4D A;  2FML A;  4HX7 A;  2P5V A;  5M5X J;  3PNT A;  3H9J A;  2JJ7 A;  5E3O A;  3MZ8 A;  5EGO A;  1PVE A;  1ON1 A;  1O3T A;  3OYC A;  1HSJ A;  1S29 A;  1R4N B;  2CW7 A;  2E1O A;  2EA2 A;  3O8G A;  4RLF A;  4Y33 A;  1QBJ A;  3H35 A;  1GVJ A;  3CCV I;  2ID6 A;  1IC8 A;  1IN8 A;  4XM3 A;  1IRF A;  2Y31 A;  4M3F A;  2O61 A;  4Z6Y A;  1IUY A;  3N4M A;  1LEA A;  4L5I A;  1ZR2 A;  4A3G J;  4XIC A;  4BJT A;  3DU5 A;  1V54 H;  1FBQ A;  3JCU C;  3GBG A;  1BW6 A;  3L1P A;  2A68 F;  4KMF A;  3HPG A;  5HVQ C;  4BJ6 C;  3H5A A;  1U9N A;  1RUN A;  3F6V A;  3HL2 A;  1A04 A;  3RIR A;  1X58 A;  2PMH A;  2QUF A;  4PFP A;  1B59 A;  4ESJ A;  1G3Y A;  3KP7 A;  4I99 C;  1Z7L A;  2KL4 A;  2E36 A;  2LY9 A;  1UHM A;  4G12 A;  2IGO A;  2ZXJ A;  2O0Y A;  3W2W A;  2VQG A;  1TWG J;  2YU3 A;  3OS0 A;  2P6S A;  2QQ8 A;  2JSC A;  4A3K J;  2VC0 A;  4I01 A;  1W7P D;  3FMR A;  4XSZ F;  2R5Z B;  1IN4 A;  2DFH A;  3EUA A;  3GX4 X;  3CCM I;  4H0E A;  3PNY A;  3RKY A;  2X51 A;  4ZZL A;  1MBJ A;  4J01 A;  2LVS A;  1A5J A;  4C30 A;  2CWE A;  1JTX A;  3CF2 A;  4M3G A;  2K3P A;  1RES A;  1UCR A;  2A6E F;  1VQO I;  5FKK A;  1U5T A;  3W6K B;  1TC3 C;  1WCM J;  2V9P A;  1FSH A;  4D7M A;  1MIJ A;  2K40 A;  1D0Y A;  4BYY A;  2ZJQ F;  4P55 A;  3LST A;  4CDG A;  2IJL A;  3GF2 A;  3HSR A;  2VLA A;  1R4M B;  2JA7 J;  1MSE C;  3SYT A;  3UKG A;  2MSY A;  1E17 A;  2BY2 A;  1S7O A;  3KZY A;  2O8X A;  4MQV A;  1K4S A;  1ETQ A;  3PM1 A;  4ZTJ A;  1PP8 F;  1USS A;  3JRI A;  2ZJR F;  4BBS J;  1OR7 C;  2M30 A;  4EM0 B;  3EUH A;  3BJO A;  4HZF A;  3PQJ A;  3U1K A;  4D7N A;  2HQA A;  1X4P A;  4E7L A;  3RQ4 A;  1WWX A;  2VQC A;  5EGO B;  1X3U A;  3BC8 A;  1FTZ A;  1L3L A;  4R8H A;  5E17 F;  3ONQ A;  1D8K A;  2O03 A;  3ZN0 A;  3E6C C;  4DW6 A;  3F8M A;  4RM2 A;  3G3Z A;  2W48 A;  4BGD A;  4OIO F;  1CGP A;  1MGT A;  1SVL A;  3BCA A;  4ZDO A;  3BZC A;  4EQQ A;  1R5G A;  2XAH A;  3VEP A;  2P0W A;  4OU0 A;  2F6C A;  4QSH A;  3I59 A;  4L5J A;  3CUQ C;  3FXJ A;  1QHH D;  2DDA A;  2OQR A;  5JLW A;  4OAZ A;  5KHD A;  5F64 A;  1T33 A;  1UEL B;  1O7F A;  2MH9 A;  3EUK L;  4FET A;  4NQW A;  4A3J J;  3H3U A;  3GTJ J;  2HFH A;  2L7K A;  1MNM C;  1Z7U A;  3CP8 A;  1FTT A;  2EBI A;  1E3P A;  4Y52 J;  3HHG A;  1QNT A;  3Q0U A;  1VF9 A;  5FRO A;  2LSO A;  4BEH A;  3ABL H;  5A2Q Z;  2DOF A;  4LLG F;  3OYJ A;  3I55 I;  2ETH A;  3K70 C;  2AXT C;  4DYQ A;  3HXL A;  4BKX A;  1HQC A;  1ZKG A;  5LLQ A;  1A31 A;  3F8B A;  2K9S A;  2VOP A;  2WB1 A;  3LQQ A;  1XDS A;  3SZP A;  2CW0 F;  3L2V A;  4BJ5 C;  2VPL A;  3F9K A;  3JRH A;  3HSF A;  2PQ8 A;  3ZMU A;  1U5T B;  2ISZ A;  1SFE A;  2LNB A;  1LEB A;  4LLL A;  2VON A;  3KP5 A;  5FO5 A;  3R60 A;  4E4H A;  3CCQ I;  1V5F A;  1NK2 P;  2A07 F;  2OCE A;  1FOK A;  4IF4 A;  1TQM A;  1G59 A;  2JUG A;  4BDZ A;  2ZME C;  3SHF A;  2JT1 A;  3CJQ B;  5DS9 A;  1MMG A;  1UB9 A;  4RAZ A;  2KT0 A;  5DD4 A;  2JRT A;  2BXZ A;  3VYU B;  2DPD A;  3S2D J;  4KA4 A;  1UFM A;  1OCC H;  1XMK A;  2QA4 I;  2PG4 A;  2PJR A;  3W3C A;  5J47 A;  2VKD A;  2X0L A;  1A6Q A;  2FUG 2;  3DPL C;  4HX8 A;  1J0R A;  4KT6 A;  1H89 C;  5FLV A;  2ELJ A;  3ASN H;  1EH7 A;  3HPH A;  1BM9 A;  2Y48 A;  1TQP A;  5DUK A;  2HDD A;  1QRY A;  2HVR A;  5D5U B;  3JRA A;  1Y1W J;  2QZ8 A;  5LD2 C;  2K86 A;  2V79 A;  4B3A A;  5B3S H;  1OKR A;  1MND A;  3VYT B;  2JTV A;  4O3M A;  2LKP A;  2VKE A;  4UVB A;  5F1J A;  4WX9 A;  3T5X A;  2DI3 A;  2F5E A;  3K2A A;  4KNY A;  5M5Y J;  2LLK A;  5ICG A;  4WCG A;  3I59 B;  3CO6 C;  2VJ4 A;  2XB5 A;  3HHH A;  2K7L A;  3HSE A;  3VYS B;  4AM3 A;  4NQW B;  2KFD A;  2JMW A;  3MEX A;  3SJM A;  2Q2E A;  3L09 A;  1JHF A;  1YYV A;  2G9W A;  4AIK A;  2AO9 A;  3NQO A;  4OAY A;  5A2Q K;  1Z0X A;  3PUB A;  3K69 A;  4BEH B;  4RB1 A;  2L2O A;  3TP0 A;  2DDB A;  2R7T A;  5BMZ A;  3SXY A;  3BR2 A;  2JZY A;  2K4J A;  4IRH A;  3PL8 A;  4ASN A;  1ETK A;  1ETW A;  3ERM A;  3AL0 B;  2GOX B;  3MD2 A;  3WTZ A;  5LGT A;  2RKH A;  1U6G A;  3BRO A;  2BY0 A;  1ZAR A;  2DPU A;  3C2B A;  1MNE A;  3DBR B;  4AIH A;  4QTR A;  2UZK A;  4LMY A;  4XLH A;  4CGZ A;  3G1M A;  2N8G A;  2EIK H;  2YX4 A;  2PEX A;  2R7V A;  2CGP A;  3DF8 A;  2E7W A;  4MHG A;  5FKL A;  2JVH A;  1LKX A;  3BJ6 A;  3E5Q A;  1O3R A;  2Y75 A;  2XAJ A;  3ISP A;  1Z05 A;  1WZ2 A;  1YJ9 I;  5GPA A;  2UXN A;  2FRH A;  1MMN A;  2W24 A;  1FIA A;  2UUZ A;  3RKX A;  1HCR A;  1YX5 A;  4A5M A;  3EQL F;  2VPR A;  2M9H A;  3BG6 A;  5FRN A;  1FMV A;  4CYD A;  4J19 A;  3VB2 A;  3EYY A;  2PJR B;  3G73 A;  3IHU A;  2M7B A;  2BHZ A;  5D6E A;  5BPI A;  2V7F A;  4YFN F;  4UXN A;  3FKI J;  2VIX A;  3F22 A;  1BJA A;  1YW9 A;  2DA5 A;  1X2N A;  1YOV B;  1FZP B;  2DQR A;  1HW5 A;  2X6X A;  5D4R A;  5LHG A;  3HOU J;  2HOE A;  3DTI A;  5FGM A;  5DEQ A;  3E6B A;  1ETX A;  5M3F J;  5E3M A;  1PUF A;  2DT6 A;  4F93 B;  3ZXS A;  1BW5 A;  2OV7 A;  1EH6 A;  2R7U A;  2W7N A;  5CVR A;  4ZYE A;  3S2W A;  2MD0 A;  2Q8K A;  3Q9S A;  5ILV A;  1POG A;  2X4H A;  1MJ9 A;  2M34 A;  2Q2E B;  2L02 A;  3TKY A;  2J5P A;  1Y0N A;  4HOB A;  2IBD A;  1DP7 P;  2EV0 A;  2IAI A;  1I1S A;  2ADU A;  2ELH A;  2DYR H;  5EEG A;  3CC4 I;  4M3D A;  4FIS A;  5E1X A;  3R6S A;  5ERI A;  4N9I A;  4IHV A;  2RV8 A;  1JUP A;  5D4S A;  3WU0 A;  4MEY F;  3M3Y J;  3AG1 H;  3I4P A;  3L2R A;  3F6O A;  2L7F P;  5H6R A;  3E5U A;  4LG3 A;  4II2 A;  2L4A A;  4U0V A;  5B1B H;  4Z2Y A;  3HTS B;  5ICC A;  4EJO A;  4AID A;  1VND A;  5F0F A;  4BY7 J;  3S3O A;  4B3X A;  2IP2 A;  1S5L C;  3J7A Y;  3KET A;  3K0L A;  3PUF A;  2ZSI B;  2ZXI A;  3R61 A;  4M6X A;  4MNU A;  4PCQ A;  4DYC A;  3ABU A;  4FHT A;  5H2F C;  5E18 F;  1J5Y A;  4OMY A;  2UV1 A;  3WHC A;  3FXQ A;  4G7Z F;  1MJB A;  4C2U A;  2E34 A;  1SEU A;  1IDZ A;  4L5E A;  4M6Y A;  2QQ9 A;  2VT2 A;  2ZXH A;  3AG4 H;  4Q4Z F;  1TL8 A;  3F21 A;  2RRE A;  5KVR A;  2RQP A;  3BR0 A;  2PI0 A;  2CV2 A;  3RCO A;  1DUX C;  1K61 A;  2VE8 A;  4RDU A;  5KCM A;  1U0J A;  3FXL A;  2D1H A;  2HR3 A;  1QU3 A;  1KQ9 A;  1TTY A;  2EIL H;  3FMS A;  3FXM A;  4DYR A;  1WJA A;  5F1R A;  2F5F A;  4WK8 F;  2Q1Z B;  5FFX A;  1M1E B;  4DZJ A;  2LDU A;  4IHT A;  1X1D A;  1ONV A;  2W84 A;  2OJE D;  2EZK A;  4QWQ A;  2DYS H;  2NAZ A;  1BA5 A;  2DMN A;  2LRE A;  3V8L A;  3DEU A;  1KYW A;  1VZ0 A;  3OIQ A;  4RGU A;  4K2E A;  1PUF B;  4KFC A;  1F5T A;  3WTV C;  1GDT A;  4JX4 A;  4XLC A;  3AAF A;  2ZBK A;  1F43 A;  4RMN A;  3H0G J;  3IWF A;  4JX5 A;  3A0H C;  3HEF A;  3RJP A;  5J4Y A;  1U78 A;  1TZL A;  4MLO A;  4MIM A;  4IQ4 A;  3C3W A;  3VOE A;  5J8F A;  3BT9 A;  2ACJ A;  3S15 J;  3Q5F A;  3WTW C;  1G6N A;  4LG0 A;  2V6E A;  1H9T A;  3JRC A;  3TL4 X;  3KLN A;  4RM3 A;  4XLA A;  5J3L A;  3S2H J;  1OIS A;  5BOX A;  2XGD A;  2EJR A;  4UB8 C;  4MTE A;  3RSN A;  3CF5 F;  2OBP A;  2CQ7 A;  4G6D A;  2HGC A;  4XL9 A;  3ZQF A;  1FYL A;  5J40 A;  2WA0 A;  4YEJ A;  4XKC A;  2NVY J;  4UHT A;  1OMI A;  3IRQ A;  5E20 A;  1KU9 A;  1WGX A;  4N0B A;  2W4S A;  3CCR I;  2LTP A;  1FSE A;  2P6T A;  3GW2 A;  3P5J A;  5HLH A;  1FYK A;  4AWX B;  2CU7 A;  3B73 A;  1XD7 A;  2Z5U A;  2MBF A;  3GUD A;  4MO7 A;  3TOA A;  4C3I J;  3S1N J;  1IRX A;  3NWT A;  4EGY A;  3HOY J;  2JN6 A;  3ZQQ A;  2RDP A;  2F4I A;  3H36 A;  5FKM A;  2EIM H;  2LH9 A;  4DBQ A;  5J4V A;  3BR5 A;  3GFI A;  1LB2 A;  3KEQ A;  2VKV A;  1B8I A;  2BY1 A;  2QVO A;  3SZG A;  2GIZ A;  2Z33 A;  4NC8 A;  2G0E A;  2L9S A;  1O4X A;  4IHX A;  2F4O B;  3M8F A;  1BI3 A;  2WAE A;  3Q9V A;  1ZGJ A;  1EH8 A;  2RNJ A;  2NNY A;  4JQF A;  5D5V B;  3G1L A;  3K4M A;  5KAI C;  3TDU C;  3MAJ A;  1OQY A;  1SD4 A;  1W7P A;  2EFQ A;  3MWM A;  3I56 I;  1VTN C;  1KQ8 A;  4EJU A;  4MEX F;  2BE5 F;  5ILU A;  1V5G A;  3KCC A;  2LMD A;  2V1D A;  4HLX A;  3J81 K;  3TW6 A;  4XLN F;  1V5E A;  1W5C C;  1R6R A;  2XB0 X;  2R7S A;  1ZHF A;  1IN5 A;  4XON A;  2H09 A;  2VXD A;  2M4K A;  4BXU A;  2V9K A;  1ZTR A;  3HOX J;  1PUE E;  2DMP A;  5FFZ A;  5EEA A;  4I76 A;  2XC7 A;  1T98 A;  2L0K A;  4ENN A;  3O8H A;  2P81 A;  2H94 A;  2E7X A;  4RB3 C;  2HVS A;  3K10 A;  4LG0 B;  2ZSH B;  3K70 D;  1XCB A;  4UUT A;  1J2X A;  3QOD A;  2MAB A;  3QWL A;  1U8B A;  3MKL A;  1G8X A;  3PQK A;  4LD5 A;  1ZRD A;  4XN3 A;  2XHK A;  4XK4 A;  4BE2 A;  1ETY A;  3ZQG A;  2M87 A;  2ZJP F;  2FNA A;  2DQL A;  2XSJ C;  3FK7 A;  4XRS G;  2B9S A;  1Z1D A;  3LSM A;  3HOV J;  1D5V A;  1IXR C;  1GV2 A;  1J9I A;  1UG2 A;  1DDN A;  5CYV A;  2KZV A;  3H3V K;  4M9X A;  3ZOB A;  2Y0S N;  3TDZ C;  3A03 A;  2V1N A;  3M4O J;  1QPM A;  4X1E A;  1ZLJ A;  1ODD A;  5K7Z A;  3P9I A;  3ASO H;  1QGP A;  2OC6 A;  1WSU A;  3RTR A;  3S1Q J;  3C1D A;  2EIN H;  3FXU A;  2CH0 A;  1B8I B;  2E71 A;  2R7W A;  3QRF F;  1LDD A;  3I58 A;  1WJE A;  5LGU A;  3DLL F;  2Y9Y A;  1Z3Y A;  3K4N A;  1KA8 A;  5IOZ A;  1Q1H A;  5FKO A;  5ILS A;  2MH2 A;  2FE3 A;  1SD7 A;  3CTA A;  4F52 A;  5J1U A;  2ME6 A;  1WJ5 A;  1AU7 A;  4A5N A;  2LF8 A;  4PJJ A;  4FTH A;  2P8T A;  3GZN B;  3LA2 A;  3SDG A;  1W7P B;  3BR3 A;  4GXO A;  2ECC A;  2DCE A;  3AL0 C;  2XSD C;  1P2F A;  1H9G A;  1FP2 A;  2R3S A;  1MBH A;  3HGY A;  1SFK A;  3CO7 C;  2KRH A;  1MKM A;  4YII A;  4IHW A;  1KU2 A; 
#chains in the Genus database with same CATH homology
 1G3W A;  3T8R A;  1LDK B;  2IA0 A;  5L3B A;  2FSW A;  2PBI A;  3ELK A;  2VOD A;  4KN4 X;  1I6X A;  2FBH A;  4EM2 A;  3FZV A;  4TV7 A;  1XB4 A;  1RI7 A;  3C7J A;  2QBY A;  1D3Y A;  3ZMZ A;  4HF0 A;  1YLF A;  4P9F A;  1KU3 A;  1K7A A;  3SZT A;  5K5O A;  2HTJ A;  2GQQ A;  2HYG D;  1XSX A;  4XSX F;  2G7U A;  2ISY A;  1FBS A;  3WE2 A;  2P5K A;  4YG2 F;  1IF1 A;  3FHZ A;  2DK8 A;  2R7D A;  3BPV A;  4G7O F;  1R58 A;  1FT9 A;  2QQB A;  2KJC A;  3WTT C;  4EGZ A;  4KIG A;  4A0Z A;  1EV7 A;  5HOO A;  5HLI A;  2DT5 A;  5TRD A;  2CG4 A;  2COM A;  1BC8 C;  1DPU A;  5HS9 A;  4BHP A;  3ZMT A;  2ZNZ A;  4EV0 A;  3DV8 A;  1HW2 A;  3WOD F;  1BOA A;  2GIV A;  5FB2 A;  5DD8 A;  2DW4 A;  5IT9 K;  3C18 A;  2A6H F;  3EET A;  5D8L B;  1YIO A;  3KP3 A;  3QPT A;  1QZY A;  1LJ9 A;  1SMY F;  1FNN A;  5LBQ A;  2VT3 A;  3WU1 B;  4LB5 A;  2QBY B;  2RC4 A;  1B9M A;  4HF1 A;  3ZMS A;  4G6Q A;  3CUO A;  4LFU A;  5CLS A;  1MJA A;  2QM3 A;  3MZH A;  4RGS A;  4M71 A;  3V7S A;  3TQN A;  1Z6R A;  3I0T A;  1P4W A;  2OQG A;  3FM3 A;  4I98 B;  2VBW A;  5D8K B;  3BOQ A;  4KMU X;  2EFN A;  5E8G A;  1S7A A;  3BWG A;  4ENM A;  1K6O A;  2OU2 A;  1TNS A;  2ESN A;  5ED4 A;  5L3C A;  3BY6 A;  4L9V A;  4CIC A;  5FLX Z;  2HDC A;  2W25 A;  3WGG A;  4IHS A;  2V6C A;  5DUI A;  3N97 A;  2M1B A;  3F72 A;  2IA1 A;  4P9U A;  4EM1 A;  3WTS C;  4HQE A;  1HST A;  3JW4 A;  1BI2 A;  2Z9O A;  1T38 A;  4M73 A;  5JI6 A;  4I0A A;  3JAM Z;  2L01 A;  5JR3 A;  1YFH A;  3M1E A;  1FLI A;  4WF2 A;  4U7D A;  2A69 F;  4L9N A;  3BZ6 A;  4KIB A;  3IWZ A;  2PLY A;  3SFZ A;  3J7A O;  4IJA A;  2RVC A;  1LDJ A;  3O6B B;  4BHC A;  1U3E M;  1IXS B;  2NYX A;  2GA1 A;  3NEU A;  2IVM A;  5DV5 A;  4HAM A;  2F5C A;  3ZN1 A;  2XUB A;  1YTY A;  4QLC U;  4G7H F;  2BV6 A;  3RPQ A;  3PFI A;  2EV6 A;  3IKV A;  1KU7 A;  1R23 A;  2OA4 A;  2KIU A;  5FLX K;  4G8X A;  4EJW A;  3CJN A;  1GXP A;  1V3F A;  2YPR A;  4GYG A;  1G3T A;  1XDU A;  4ZH4 F;  4EJV A;  4RS8 A;  1J75 A;  4UUV A;  2M8E A;  4XBF A;  4KT5 C;  2DLL A;  4I02 A;  2CQK A;  2R7F A;  4R79 A;  1OR7 A;  1FBU A;  2LF7 A;  4MTD A;  2K27 A;  2KIF A;  2W85 A;  2L3D A;  3JAM K;  3HRU A;  2ZNY A;  5KK1 A;  1R1T A;  4U88 A;  1J7K A;  5E1Z B;  1BBY A;  4M72 A;  2VOO A;  3WTY C;  2F2E A;  3F3X A;  2KKO A;  1DPR A;  3FF5 A;  3OOP A;  3CUQ A;  3KEO A;  3ZQ7 A;  3TO9 A;  2VC1 A;  4JK1 X;  2A3S A;  4ETS A;  1KYZ A;  4JBA A;  4GYI A;  1U2W A;  2AS5 F;  4E70 A;  5DYM A;  4HF2 A;  4MGR A;  4F7Z A;  2VE9 A;  3O2P E;  2UXX A;  2P7C B;  2MA3 A;  4BQA A;  3KLO A;  4A6E A;  1ZG1 A;  3T1B A;  4OMZ A;  5L3D A;  1IAW A;  5LHH A;  4CXF A;  2EK5 A;  3NRV A;  4RGR A;  2CYY A;  2XVC A;  1WQ2 A;  4HDV A;  2RGV A;  1BI0 A;  3I64 A;  1B9N A;  3IC7 A;  5K1Y A;  4ON0 A;  3LAJ A;  3V7C A;  5J6X A;  1XMA A;  3FWE A;  4OIN F;  4NHJ A;  4P96 A;  4AIJ A;  1TLH B;  4S05 A;  1ZRF A;  1PDN C;  3MQ0 A;  2ESH A;  3P9C A;  2YR2 A;  3RKW A;  5JFR A;  2A5Y B;  4A2U A;  3GEZ A;  4HX4 A;  2QEN A;  2XAF A;  2IA2 A;  4RAY A;  4WWC A;  1YW7 A;  2XKP A;  4KUM A;  1WI9 A;  1O3S A;  2GXG A;  3CUQ B;  4CZZ A;  1K79 A;  4FX0 A;  5H6Q A;  4ZYG A;  1ZAO A;  1QO0 D;  3I53 A;  4ENJ A;  3KP2 A;  3V4G A;  3QP5 A;  4P5O A;  2NRA C;  2ZFW A;  2OAZ A;  4WXC A;  1SAX A;  3I71 A;  1ULY A;  1YW8 A;  1NHA A;  1RZ4 A;  1K78 A;  1B6A A;  3DFG A;  4N9H A;  3GFM A;  4AD9 A;  2FMY A;  2KJB A;  4XLP F;  3K9T A;  2VXZ A;  3E6M A;  4UVC A;  4BAY A;  1T39 A;  4PZJ A;  5HDG A;  4LK1 F;  1ZLK A;  1P6R A;  2DK5 A;  3LWF A;  1O3Q A;  1IZ1 A;  4KIC A;  1ZH5 A;  2NNN A;  1Y0U A;  4PGH A;  1IXC A;  5HDN A;  3WGH A;  3TOB A;  3JTH A;  2PJP A;  2NS0 A;  4OIP F;  5E1W A;  2JPB A;  1FX7 A;  1U5T C;  3L7W A;  5AIP A;  4S04 A;  1ZG3 A;  4Q47 A;  4L9T A;  5BPD A;  2HEO A;  4FT8 A;  4O6J A;  3COA C;  2K02 A;  4LGW A;  4B09 A;  2ZJ2 A;  1YO5 C;  2ZCW A;  1V4R A;  2MLG A;  3IRR A;  3GXO A;  4RB0 A;  1K78 B;  3L00 A;  4IVN A;  4RGX A;  3IL2 A;  5AIQ A;  4HLY A;  5AON A;  1TW2 A;  2VBX A;  5LGN A;  2FEZ A;  1JHH A;  1YG2 A;  5F6F A;  2BEO A;  2V9V A;  3F8C A;  1G3S A;  3V8K A;  3M9A A;  1TBX A;  5JVT A;  4UNO A;  2XAS A;  1S8N A;  2WV0 A;  3RYR A;  1BIA A;  2VN2 A;  4AVP A;  5L3G A;  1FWZ A;  1HKT A;  1F4K A;  3EYI A;  1I5Z A;  3DQV C;  1F1Z A;  4I2O A;  1C0W A;  3R0J A;  3E5X A;  4IRI A;  1P4X A;  2MC3 A;  1ZGA A;  1T2K A;  3QOP A;  1SD5 A;  1T0F A;  4KYW A;  3F8N A;  3WTU C;  5HS8 A;  2J5O A;  3H92 A;  3FM5 A;  1AWC A;  3HRT A;  5BQT A;  3SQN A;  3CDH A;  1ZG5 A;  2EB7 A;  3L9F A;  3BDD A;  4DQ2 A;  5D6F A;  2GA2 A;  2UWM A;  4KIF A;  1XN7 A;  2PFB A;  2XRO A;  2WWY A;  3T0Y A;  2M5W A;  2AXL A;  4M74 A;  5CVV A;  1F9N A;  2EFP A;  1HXD A;  1OPC A;  1WRJ A;  5FD6 A;  3HOT A;  4M9Z A;  4ZYD A;  4MQ9 F;  3E97 A;  4U7B A;  2FNP A;  3P7N A;  3ROU A;  2EFO A;  4LK0 F;  2O6G E;  4A12 A;  1XSD A;  2IT0 A;  1UST A;  1BI1 A;  2MD5 A;  3HUG A;  2V1U A;  4BHB A;  4L18 B;  1RNL A;  3WG9 A;  5LHI A;  3T8T A;  1XGM A;  1GXQ A;  2STW A;  1ZRE A;  1PP7 U;  4L9J A;  4ESB A;  3MZY A;  4B8X A;  4ZYH A;  3ML6 A;  3HRS A;  3E6D A;  1XGN A;  2MLK A;  2C6Y A;  5J8C A;  3E3V A;  2H6C A;  3LFK A;  5LRS A;  2PN6 A;  1YS6 A;  3GO5 A;  2D1V A;  2ZO4 A;  3K1P A;  2OZ6 A;  3DPT A;  1OYI A;  3ULQ B;  4EVI A;  2L54 A;  5DCM A;  1HKQ A;  3LQR A;  2KRF A;  1KGS A;  1I27 A;  2QLZ A;  2CFX A;  3M7G A;  1R5H A;  4WXD A;  5CVJ A;  2XGX A;  4ENK A;  1JGS A;  4HV5 A;  5CVU A;  1XGO A;  3R4K A;  2GWR A;  1RUO A;  3DXJ F;  1YQA A;  2HQR A;  3L2C A;  2P7V B;  3CLO A;  1WKM A;  1LQ1 A;  3QPH A;  3DKW A;  1D8J A;  1TW3 A;  3WTX C;  1STZ A;  3RPU A;  2GZW A;  3P9K A;  3O3K A;  2FQ3 A;  1GHC A;  2CO5 A;  4LJZ F;  3WE3 A;  1HKS A;  1W5S A;  4UV8 A;  1U8R A;  4A6D A;  3D0S A;  5L3F A;  2E1C A;  3TO6 A;  3F23 A;  2H6B A;  4IPA A;  1SMT A;  4BH9 A;  3GZ5 A;  2FBI A;  4WXH A;  1CF7 A;  4FX4 A;  2HYF A;  4Y17 A;  1KQ0 A;  2HZT A;  5CJ9 A;  2TDX A;  4YIF A;  4OOI A;  4A0X A;  3REO A;  2HKX A;  2CSO A;  2XKO A;  5DCM B;  2BGC A;  2L4M A;  2WC2 A;  3RI4 A;  2IW5 A;  3HTU A;  2V1X A;  5D5W B;  2JPC A;  3D5L A;  4HV6 A;  2FU4 A;  5L3E A;  4G9Y A;  1MD0 A;  1ZYR F;  3H3Z A;  3K1M A;  1HBX G;  5K5Q A;  1QZZ A;  2Z99 A;  4HQM A;  4YFK F;  1R36 A;  4DNC A;  2ZKZ A;  4LB6 B;  1BC7 C;  3BJA A;  4ZZD A;  4GGG A;  1REP C;  2Z3Y A;  2DU9 A;  4RB2 C;  1MDM A;  2EFW A;  3GVA A;  3QP6 A;  4O5V A;  3QU6 A;  4Q5S F;  4U0W A;  3W6J B;  3U1D A;  1TQI A;  3KFW X;  3GYH X;  1ZRC A;  1ZN2 A;  5D5X B;  1RIO H;  3K2Z A;  1BN5 A;  2GXB A;  1R1V A;  3ZMD A;  2DO7 A;  3WGI A;  1FC3 A;  1CF7 B;  1P92 A;  5IT3 A;  3JSP A;  2YSR A;  4NB5 A;  3TO7 A;  4IXA A;  2P5L C;  3DP7 A;  1E2X A;  2HS5 A;  1T6S A;  2HQN A;  4GCV A;  1P4A A;  3RYP A;  1MZB A;  3V7R A;  3ERE D;  3JSO A;  3QAH A;  5H20 A;  2QQA A;  3GLX A;  1L0O C;  1ON2 A;  2DFI A;  4UVA A;  4KDP A;  2E1N A;  2B0L A;  5EEH A;  1TNT A;  3GFL A;  2ZME A;  3K1N A;  3HIF A;  4G94 A;  4CHU A;  2M45 A;  3ECH A;  3ZMV A;  3GFJ A;  5HDK A;  1Z9C A;  3OV8 A;  1LVA A;  3KP4 A;  2DAO A;  1MDM B;  1FPQ A;  2DBB A;  1Z6T A;  2G7H A;  4OIR F;  5HS7 A;  2RN7 A;  3B02 A;  2W57 A;  5FD5 A;  3GZ6 A;  2XRN A;  1IN6 A;  1B1B A;  4HDU A;  3ECO A;  2GAU A;  1R1U A;  3GWZ A;  6PAX A;  5LRR A;  3KZZ A;  2OZU A;  4PDK A;  3J81 Z;  2FBK A;  3I54 A;  2XIG A;  5E8I A;  1W4M A;  2K4B A;  4HBL A;  4HYE A;  3BPX A;  2BYV E;  5DCF A;  2Y0M A;  1OYY A;  3HYI A;  1QQI A;  1HW1 A;  4L0Z B;  4BNC A;  2VBY A;  1XGS A;  2EA4 A;  3V8J A;  4GO1 A;  3LAP A;  3RDI A;  2STT A;  4Q48 A;  2F5D A;  3ZP5 A;  2VBZ A;  5BS6 A;  1B4A A;  2ZME B;  3U2R A;  4OIQ F;  3F8F A;  4YFX F;  4I0B A;  1S3J A;  1R22 A;  2FOK A;  4D0P A;  3TGN A;  3KP6 A;  1XCV A;  3LA3 A;  4HA8 A;  3VFZ A;  4UV9 A;  1J59 A;  2H27 A;  3EDP A;  5HLG A;  1H0M A;  2XAQ A;  4U0Y A;  2QYO A;  4I09 A;  1BIB A;  3MFK A;  2PMU A;  1IN7 A;  2HKO A;  3HRM A;  1SFU A;  2D2W A;  1S6L A;  4EMS A;  2FF4 A;  1LNW A;  3ABT A;  2D45 A;  2Q0O A;  2KIM A;  4R1H A;  3QU3 A;  3KE2 A;  4M9S A;  2IRF G;  3I5U A;  3BP8 A;  1JXS A;  3J80 Z;  5ICE A;  1JE8 A;  2OD5 A;  2FA5 A;  5ICF A;  1FP1 D;  2FXA A;  3MCZ A;  4Y13 A;  4IRG A;  2O3F A;  3LA7 A;  3IKT A;  3FMQ A;  1OYW A;  2BBY A;  4Y15 A;  1I1G A;  4PGG A;  3FX3 A;  5DDG A;  3JTG A;  2HWV A;  3FXR A;  3M8E A;  3VOD A;  1IW7 F;  1W5T A;  3U9G A;  3HOS A;  2P4W A;  4EJT A;  5LEK A;  4XRF A;  2A61 A;  1YS7 A;  5K5R A;  1FYM A;  1R7J A;  1AOY A;  2YX7 A;  4CO8 A;  1R00 A;  3ZPL A;  4I7H A;  2EV5 A;  1SFX A;  3R0A A;  5LEJ A;  1O7L A;  2QWW A;  2XAG A;  4L0Y B;  4A0Y A;  1Z91 A;  4ESF A;  1SD6 A;  1O57 A;  2DTR A;  1FY7 A;  5JHU A;  1UHW A;  5CVI A;  4LLN A;  4KN7 X;  1XSV A;  2XV4 S;  3J80 K;  2EWN A;  1IRG A;  2WTE A;  5IT9 Z;  4HW0 A;  2HTS A;  2IPQ X;  5TJJ A;  1G4D A;  2FML A;  4HX7 A;  2P5V A;  1ON1 A;  1O3T A;  1HSJ A;  1S29 A;  2EA2 A;  1QBJ A;  1GVJ A;  1IN8 A;  1IRF A;  2O61 A;  1IUY A;  3N4M A;  1LEA A;  4L5I A;  1FBQ A;  2A68 F;  4KMF A;  5HVQ C;  1RUN A;  3F6V A;  1A04 A;  3RIR A;  2PMH A;  2QUF A;  1B59 A;  4ESJ A;  1G3Y A;  3KP7 A;  1UHM A;  2ZXJ A;  2O0Y A;  2YU3 A;  2P6S A;  2JSC A;  2VC0 A;  4XSZ F;  1W7P D;  3FMR A;  4I01 A;  1IN4 A;  3GX4 X;  4H0E A;  3RKY A;  4ZZL A;  2CWE A;  1UCR A;  2A6E F;  3W6K B;  1U5T A;  1FSH A;  4BYY A;  4P55 A;  3LST A;  4CDG A;  2IJL A;  3GF2 A;  3HSR A;  1E17 A;  1S7O A;  3KZY A;  2O8X A;  4MQV A;  1PP8 F;  1USS A;  2M30 A;  4EM0 B;  3EUH A;  3BJO A;  4HZF A;  3PQJ A;  1WWX A;  1X3U A;  1L3L A;  4R8H A;  5E17 F;  1D8K A;  2O03 A;  3E6C C;  3ZN0 A;  3F8M A;  3G3Z A;  4OIO F;  1CGP A;  1MGT A;  4EQQ A;  1R5G A;  2XAH A;  3VEP A;  4OU0 A;  3I59 A;  4L5J A;  3CUQ C;  2OQR A;  5F64 A;  1O7F A;  2MH9 A;  4NQW A;  3H3U A;  2HFH A;  1Z7U A;  3HHG A;  1QNT A;  5A2Q Z;  2LSO A;  4LLG F;  2ETH A;  1HQC A;  5LLQ A;  3F8B A;  2VOP A;  3LQQ A;  1XDS A;  3SZP A;  2CW0 F;  3HSF A;  2PQ8 A;  3ZMU A;  1U5T B;  2ISZ A;  1SFE A;  2LNB A;  1LEB A;  4LLL A;  2VON A;  3KP5 A;  5FO5 A;  3R60 A;  2A07 F;  1FOK A;  4IF4 A;  1TQM A;  3SHF A;  2JT1 A;  1UB9 A;  4RAZ A;  5DD4 A;  2JRT A;  2DPD A;  4KA4 A;  1UFM A;  1XMK A;  2PG4 A;  2X0L A;  3DPL C;  4HX8 A;  1J0R A;  1EH7 A;  1BM9 A;  2Y48 A;  1TQP A;  5DUK A;  5D5U B;  2QZ8 A;  2K86 A;  2V79 A;  1OKR A;  2JTV A;  4O3M A;  2LKP A;  4UVB A;  4WX9 A;  3T5X A;  2F5E A;  2DI3 A;  4KNY A;  5ICG A;  4WCG A;  3I59 B;  3CO6 C;  3HHH A;  2K7L A;  3HSE A;  3MEX A;  2Q2E A;  3L09 A;  1JHF A;  1YYV A;  2G9W A;  4AIK A;  3NQO A;  5A2Q K;  3K69 A;  4RB1 A;  5BMZ A;  3SXY A;  2JZY A;  2K4J A;  4IRH A;  4ASN A;  3WTZ A;  5LGT A;  2RKH A;  1U6G A;  3BRO A;  1ZAR A;  2DPU A;  4AIH A;  2UZK A;  4LMY A;  4CGZ A;  2YX4 A;  2PEX A;  2CGP A;  3DF8 A;  2E7W A;  4MHG A;  3BJ6 A;  3E5Q A;  1O3R A;  2Y75 A;  2XAJ A;  3ISP A;  1Z05 A;  2UXN A;  2FRH A;  2W24 A;  3RKX A;  4A5M A;  3EQL F;  4CYD A;  3VB2 A;  3EYY A;  3G73 A;  3IHU A;  5D6E A;  5BPI A;  4YFN F;  4UXN A;  3F22 A;  1BJA A;  1YW9 A;  1FZP B;  2DQR A;  1HW5 A;  5D4R A;  5LHG A;  2HOE A;  5FGM A;  5DEQ A;  3E6B A;  1EH6 A;  5CVR A;  4ZYE A;  3S2W A;  2Q8K A;  3Q9S A;  5ILV A;  2X4H A;  1MJ9 A;  2L02 A;  3TKY A;  2J5P A;  4HOB A;  1DP7 P;  2EV0 A;  1I1S A;  2ADU A;  2ELH A;  5EEG A;  5E1X A;  3R6S A;  5ERI A;  4N9I A;  2RV8 A;  5D4S A;  3WU0 A;  4MEY F;  3I4P A;  3F6O A;  5H6R A;  3E5U A;  2L4A A;  4U0V A;  4Z2Y A;  3HTS B;  5ICC A;  4EJO A;  2IP2 A;  3KET A;  3K0L A;  3R61 A;  4M6X A;  4MNU A;  4PCQ A;  3ABU A;  4FHT A;  5E18 F;  1J5Y A;  4OMY A;  3FXQ A;  4G7Z F;  1MJB A;  4M6Y A;  2QQ9 A;  2VT2 A;  4Q4Z F;  3F21 A;  5KVR A;  2RQP A;  2PI0 A;  1DUX C;  2VE8 A;  2D1H A;  2HR3 A;  1KQ9 A;  1TTY A;  3FMS A;  5F1R A;  2F5F A;  4WK8 F;  5FFX A;  2LDU A;  4IHT A;  1ONV A;  2W84 A;  4QWQ A;  2NAZ A;  3V8L A;  3DEU A;  1KYW A;  4RGU A;  4KFC A;  4K2E A;  1F5T A;  3WTV C;  3AAF A;  2ZBK A;  3IWF A;  3RJP A;  1U78 A;  3C3W A;  3VOE A;  5J8F A;  2ACJ A;  3Q5F A;  3WTW C;  1G6N A;  4LG0 A;  1H9T A;  3KLN A;  5BOX A;  2EJR A;  4MTE A;  2OBP A;  4G6D A;  2HGC A;  1FYL A;  4UHT A;  1OMI A;  3IRQ A;  5E20 A;  1KU9 A;  4N0B A;  2P6T A;  1FSE A;  1FYK A;  3GW2 A;  5HLH A;  4AWX B;  3B73 A;  1XD7 A;  2Z5U A;  2MBF A;  3GUD A;  3TOA A;  4EGY A;  2RDP A;  1LB2 A;  3GFI A;  3KEQ A;  2QVO A;  2Z33 A;  3M8F A;  1BI3 A;  3Q9V A;  1ZGJ A;  1EH8 A;  2RNJ A;  2NNY A;  4JQF A;  5D5V B;  3TDU C;  3MAJ A;  1SD4 A;  1W7P A;  2EFQ A;  3MWM A;  1VTN C;  1KQ8 A;  4EJU A;  4MEX F;  2BE5 F;  5ILU A;  3KCC A;  2V1D A;  4HLX A;  3J81 K;  4XLN F;  1ZHF A;  1IN5 A;  2H09 A;  4BXU A;  1PUE E;  5FFZ A;  1T98 A;  4ENN A;  2H94 A;  2E7X A;  4RB3 C;  4LG0 B;  1XCB A;  1J2X A;  3PQK A;  4LD5 A;  1ZRD A;  2XHK A;  2M87 A;  2FNA A;  2DQL A;  1Z1D A;  1D5V A;  1IXR C;  1J9I A;  1DDN A;  5CYV A;  4M9X A;  3TDZ C;  1QPM A;  1ZLJ A;  1ODD A;  3P9I A;  1QGP A;  1WSU A;  3RTR A;  3C1D A;  3FXU A;  3QRF F;  1LDD A;  3I58 A;  5LGU A;  1KA8 A;  1Q1H A;  5ILS A;  2MH2 A;  2FE3 A;  1SD7 A;  3CTA A;  4A5N A;  2LF8 A;  2P8T A;  3LA2 A;  1W7P B;  4GXO A;  1P2F A;  1H9G A;  1FP2 A;  2R3S A;  3CO7 C;  1MKM A;  4YII A;  1KU2 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...