3HRMA

Crystal structure of staphylococcus aureus protein sarz in sulfenic acid form
Total Genus 44
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
44
sequence length
139
structure length
130
Chain Sequence
GSHMYLSKQLFLFYVSSKEIIKKYTNYLKEYDLTYTGYIVLMAIENDEKLNIKKLGERVFLDSGTLTPLLKKLEKKDYVVRTLQISLTEQGKAIKSPLAEISVKVFNEFNISEREASDIINNLRNFVSKN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transcription regulator
molecule keywords HTH-type transcriptional regulator sarZ
publication title Crystal structures of the reduced, sulfenic acid, and mixed disulfide forms of SarZ, a redox active global regulator in Staphylococcus aureus.
pubmed doi rcsb
source organism Staphylococcus aureus subsp. aureus
total genus 44
structure length 130
sequence length 139
chains with identical sequence B
ec nomenclature
pdb deposition date 2009-06-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01047 MarR MarR family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 3hrmA00
3HRUA 1XN7A 4LMYA 1HXDA 1TW3A 4L18B 4ETSA 3FF5A 1XMKA 2X0LA 2JSCA 2D1HA 2V1XA 1SAXA 1S29A 2DFIA 2XGXA 2VT2A 2VBXA 3IWZA 3VFZA 4AWXB 4BH9A 3R60A 4RB2C 3WG9A 2DTRA 4UXNA 4GCVA 1XDSA 3GWZA 5LHGA 2A07F 5E20A 3BJ6A 3I59B 4NB5A 3BWGA 3CLOA 2Q8KA 2XAHA 2HKOA 2V9VA 3KFWX 5LBQA 2NS0A 3KLNA 4HLXA 1J59A 4OINF 3QP5A 4IHSA 3H92A 5HVQC 4N9HA 5D6FA 2BE5F 1K78B 2Y75A 4MTEA 2EV0A 1IXSB 1MJBA 2EFQA 1YLFA 4EGZA 4GYGA 2QUFA 5F64A 1VTNC 4P96A 3IL2A 2Z3YA 3ZP5A 4LLNA 1U5TA 4ENKA 3GF2A 4EJOA 3ZMDA 2ZXJA 4CICA 1MDMA 4HF2A 3O2PE 1IN5A 4JQFA 1UFMA 3DF8A 5K5OA 4YFXF 5TRDA 4Q4ZF 5L3DA 2DQLA 1FY7A 5LGUA 1FZPB 5HLGA 4YFKF 1KGSA 5ILVA 3G3ZA 1ON2A 1X3UA 2GQQA 3ISPA 2DI3A 2QVOA 4ENNA 3LQQA 1GVJA 2O8XA 4HQMA 5IT9Z 1Y0UA 3R6SA 4B09A 5CVVA 1V3FA 4L9TA 2DPUA 3IKVA 2A69F 4UVCA 3V8JA 2HZTA 3T0YA 2MLKA 3L7WA 4HV5A 2D1VA 3MCZA 5ICGA 1S3JA 3NQOA 2PFBA 1RI7A 5E18F 5EEHA 4ASNA 1XSVA 1WQ2A 4H0EA 2QBYB 1STZA 1D3YA 4EJTA 1BC7C 1ZREA 2RC4A 1R36A 1RUNA 1REPC 1O3QA 3GFIA 1TLHB 3JSOA 1QPMA 1ZHFA 5DEQA 2RN7A 3V7CA 1LNWA 2ACJA 4U88A 2HDCA 1YYVA 3C3WA 5JHUA 3BPVA 2K02A 2M8EA 1SD7A 1R7JA 2OA4A 5CLSA 4KIGA 1JGSA 2KIMA 1TQPA 3GLXA 2JRTA 4N9IA 1J75A 3W6KB 4OIOF 2FU4A 1QNTA 4E70A 1R1TA 5JVTA 4DQ2A 2JZYA 3R0AA 5CVJA 4DNCA 4L5JA 4A0ZA 1JHFA 1ODDA 5LLQA 1LB2A 4M9ZA 1TQIA 1R00A 1XB4A 2DAOA 4HYEA 1P2FA 1P92A 1XD7A 2YR2A 1Z05A 2RQPA 4LK0F 1HW2A 3KEOA 2P6TA 3VB2A 2LKPA 3FXQA 4G6DA 3DV8A 3KP6A 3CJNA 2QQ9A 1I1GA 1NHAA 5HOOA 1BI3A 2LF7A 3IWFA 4CXFA 1F5TA 2CQKA 4IVNA 3F23A 3E6MA 1MJAA 1DPRA 5BPDA 1D8KA 1J5YA 3R0JA 3U1DA 1KYZA 3BDDA 3GXOA 3V8KA 3R4KA 1J7KA 1ZN2A 2FMLA 3DQVC 4GYIA 3DPLC 2CGPA 3P9CA 3H3UA 2KKOA 5IT9K 1W5TA 1ZRFA 4TV7A 2FF4A 4Q48A 5D5UB 2EK5A 5BQTA 2YX4A 3RTRA 3KE2A 3QOPA 4RGRA 4HW0A 1AWCA 2IP2A 5DD8A 3ZMZA 4U0WA 5BS6A 5D4SA 2FOKA 4GGGA 1KQ8A 1YQAA 4M6XA 1W7PD 1B6AA 2YPRA 5FFXA 3B73A 2O3FA 3CUQB 1GXPA 3O3KA 3L9FA 1LDJA 1IAWA 2GZWA 1FPQA 5LHHA 3ERED 2XAGA 2ESHA 1XCBA 3KP5A 4ZZLA 3TDZC 1FX7A 3IRRA 1ZG1A 3J80Z 4NHJA 2G7UA 4IHTA 1T38A 3LSTA 1J2XA 2ZMEA 5DDGA 3FXRA 5AIPA 4ZYHA 2EV6A 4AVPA 1SMTA 2DLLA 5BMZA 3PQKA 2MLGA 2O0YA 2EFOA 2UXXA 2C6YA 5HS9A 4ZZDA 1UCRA 2XASA 2KRFA 2V79A 4WWCA 1WI9A 1XSDA 3LQRA 3KETA 1RZ4A 2QQAA 5DCFA 1WKMA 3J81K 2FSWA 3TO9A 3ZMSA 2COMA 1IXCA 2GIVA 1TW2A 2FBKA 2IPQX 3BPXA 3HHHA 2PMHA 3U2RA 5JR3A 2JTVA 1XMAA 3F8FA 3TQNA 3RYRA 1BI0A 3ECOA 1I1SA 4LB5A 1P4XA 3QU3A 2EA2A 3ZMUA 2IA2A 2XAJA 4BQAA 2L3DA 1WWXA 3FM5A 4BYYA 2M45A 5E8IA 3MZHA 5ILSA 5JFRA 5TJJA 2VOPA 4KT5C 4AIHA 1CF7A 1OMIA 1R1VA 3B02A 4A5MA 1T98A 2STTA 5JI6A 3TKYA 2BBYA 1FBSA 5AONA 1QGPA 2Z5UA 4LLLA 2VE8A 3ZMTA 1QZYA 3NEUA 5A2QZ 4RB0A 4PDKA 3QRFF 5FO5A 3SFZA 1K6OA 3V8LA 3P7NA 1U5TB 2K27A 4EV0A 5HS8A 1MDMB 1LVAA 3BZ6A 3VOEA 4LK1F 3E5QA 5KK1A 2PQ8A 5FLXZ 1ZAOA 2M1BA 2ZJ2A 5LRSA 2H94A 4WXCA 2P5VA 3F8CA 4QWQA 1G3TA 4IRHA 3F8NA 2R7FA 5CVUA 1KQ9A 2LNBA 2LSOA 2P4WA 3QPHA 4WXHA 3K1PA 5ICEA 1YO5C 5CYVA 3I53A 1FC3A 4WX9A 3N97A 1I27A 1L3LA 3HHGA 3K0LA 2P8TA 3TGNA 2P5KA 2DT5A 1Z6RA 4OIQF 1YS7A 4U0VA 4B8XA 3JAMK 3LAJA 5D8KB 4G7OF 4ENMA 1HSTA 1R1UA 3WGIA 3IHUA 2Z9OA 4I02A 4FT8A 1E17A 2E1NA 3JTHA 3VEPA 4WF2A 3SZTA 1PDNC 3BJAA 3MFKA 4MGRA 3DPTA 3ZMVA 3U9GA 2IT0A 1UHWA 4MQ9F 2QWWA 1DUXC 3HTSB 4R8HA 4LJZF 3WTXC 2Z33A 5E8GA 1U2WA 2OD5A 4WXDA 1KU2A 3F22A 1OKRA 1BIAA 4K2EA 2W24A 4KN7X 3TDUC 1QQIA 5L3GA 2FMYA 5H6QA 1K79A 1LDDA 4I01A 1TNTA 3BROA 3WGGA 2HS5A 1ON1A 2OQGA 4A12A 5F6FA 2B0LA 2FXAA 1TTYA 2GA1A 4YIFA 2V1UA 4LG0A 3WTYC 4Z2YA 2FA5A 3FM3A 1L0OC 2PMUA 2L01A 4O6JA 4EJUA 1MJ9A 1KU7A 2MH2A 2ZBKA 3KP3A 2ZO4A 2LF8A 5KVRA 2UZKA 3REOA 3F3XA 5DUKA 2DPDA 2M5WA 5E17F 3QAHA 3CO7C 2XHKA 2ISZA 4HDUA 1E2XA 4CYDA 5A2QK 1B4AA 3M8FA 1ZLKA 2STWA 2PG4A 4L9VA 2PJPA 3GFLA 3LFKA 1RIOH 4UVBA 1KYWA 1USSA 2FQ3A 4A0YA 4XBFA 1HW1A 2IJLA 1YFHA 4AD9A 1OYIA 5FLXK 3V4GA 2CG4A 1AOYA 4A6EA 4ESBA 2QZ8A 4UHTA 2RVCA 1LJ9A 3QPTA 3WTTC 1HKQA 3L09A 5E1ZB 1A04A 1FOKA 2A6EF 4BHCA 3T8RA 6PAXA 2ZKZA 3OOPA 4LFUA 2NRAC 3E5XA 4M72A 1F4KA 2MH9A 4PZJA 5DD4A 5ED4A 2V6CA 4YIIA 4A2UA 4HBLA 1YIOA 3ELKA 3AAFA 5F1RA 2P7CB 1G6NA 3DEUA 2E7XA 1V4RA 3CO6C 5DV5A 1ZYRF 4IPAA 2ZFWA 2XROA 2GAUA 5IT3A 5K1YA 4I0BA 2OU2A 3RPUA 3EDPA 2VBWA 3GYHX 1G3YA 1K78A 2XIGA 3HSRA 4OOIA 3E6CC 1OR7A 4PGHA 1O3TA 1H9GA 1FYLA 4D0PA 1R23A 1S8NA 4HX4A 4P55A 4HV6A 3CUQC 1ONVA 2PLYA 2V1DA 4Q47A 3GEZA 1F1ZA 1W4MA 2XKPA 4BHBA 2ZMEB 1Z9CA 2K86A 3RDIA 5BPIA 3DKWA 4CGZA 3FHZA 4A0XA 2ISYA 2O03A 1GXQA 2YX7A 1P4WA 2VXZA 2KJBA 4G7HF 4EJWA 2UXNA 1ZLJA 4I09A 2OBPA 4EGYA 3IRQA 3LA7A 3F21A 2FE3A 3CTAA 1MGTA 1IN7A 2OQRA 1FNNA 2R3SA 1EV7A 5J8FA 2HTSA 5HDGA 4L0YB 2GXGA 1WSUA 3RI4A 3LAPA 1MKMA 1O7LA 2E7WA 2FNAA 1QBJA 3F8BA 1W5SA 5LHIA 3HYIA 2DK8A 4FX4A 2KIUA 1YW7A 2EFNA 3BOQA 1B59A 1IUYA 4R79A 2F2EA 2XV4S 3COAC 3FMRA 2QBYA 4HQEA 4RB3C 4BAYA 3BJOA 1UHMA 5K5RA 4I0AA 3HSEA 2HFHA 3OV8A 1D5VA 4UV9A 4AIKA 2FRHA 5ERIA 1CF7B 4LD5A 1J9IA 2IW5A 5CVRA 5HDNA 3TO6A 1U8RA 5DCMB 2DK5A 2RV8A 3M7GA 5J6XA 1QZZA 3HRMA 3TOAA 5FD5A 4HX7A 4L9JA 4P9FA 2XAQA 3L2CA 2O6GE 1MZBA 1H9TA 2DQRA 3MAJA 4XSXF 1BIBA 1IZ1A 2OZUA 1QO0D 1P4AA 3WU1B 4HLYA 3SXYA 1XGSA 1LEAA 2PI0A 2YU3A 2GXBA 4L5IA 5FFZA 4KNYA 1EH7A 3W6JB 1ZARA 4JBAA 2Q0OA 3MQ0A 1DDNA 1BN5A 4EVIA 5D4RA 5D6EA 1Q1HA 2JPBA 3HTUA 2M30A 2HYGD 2OAZA 3R61A 3RKWA 4A6DA 4ZYEA 4I2OA 1XGOA 3WTSC 3FZVA 4CHUA 4M6YA 1KU9A 4Q5SF 1BC8C 3I64A 1D8JA 1FP1D 2F5EA 3RJPA 2IA1A 3RKXA 1U3EM 2VBYA 4OMYA 2WC2A 3CDHA 1ZH5A 2F5FA 3WTZA 4MEYF 2CFXA 1O3SA 1SD4A 4BXUA 4ENJA 3K1NA 1CGPA 3DFGA 1FWZA 1B9MA 3KLOA 4L9NA 2VOOA 4M9XA 4HA8A 3WE3A 4OIRF 1FYMA 2VONA 3FX3A 2W84A 5CJ9A 3F72A 2FBHA 2R7DA 4KFCA 1HBXG 1FLIA 2AS5F 4S05A 1K7AA 3IC7A 2DW4A 2H6CA 3Q5FA 5D5VB 1BOAA 1TQMA 3SZPA 1KA8A 2EA4A 2KIFA 4CZZA 3Q9SA 3CUQA 3RPQA 1XGMA 3S2WA 1FYKA 2X4HA 3CUOA 5E1WA 2ELHA 2VC0A 4IRIA 2HWVA 2Q2EA 1RUOA 2BYVE 1SFXA 1T6SA 4EM0B 3WTUC 4HDVA 1I6XA 1USTA 4WCGA 4RGUA 4IF4A 2WWYA 2P5LC 1RNLA 3M8EA 3K69A 3F8MA 4LGWA 4HZFA 1FT9A 3J80K 3FMSA 3WTVC 2MD5A 3M1EA 2YSRA 3ABTA 4I7HA 5ICCA 2J5OA 4KDPA 3ZQ7A 1R22A 2HOEA 2HR3A 4MNUA 1H0MA 3QU6A 2CSOA 1P6RA 1SD6A 1W7PA 4WK8F 2QM3A 2MBFA 4XRFA 4BHPA 2H27A 2O61A 3WU0A 2IRFG 1FSHA 3MZYA 4LB6B 2ZNZA 5LEJA 4IJAA 2D45A 4UUVA 4Y17A 1KU3A 4O5VA 3GO5A 1SFUA 3HIFA 1HKTA 2P6SA 2Y48A 2QENA 3C1DA 1SMYF 3FMQA 4CO8A 3N4MA 4U7DA 1FP2A 5L3EA 1OYWA 1SD5A 1B1BA 2VBZA 3MWMA 3SQNA 2KJCA 1FBUA 1ZG3A 4RAZA 2IA0A 5DYMA 5LEKA 3EYIA 3MEXA 3DXJF 4ZYDA 4A5NA 1O3RA 3EUHA 5D5XB 2W85A 2WTEA 2F5CA 1B9NA 1KQ0A 4P5OA 3TO7A 2ESNA 2MC3A 3P9KA 2EWNA 3FXUA 2P7VB 2A3SA 4EM2A 2PN6A 3T1BA 1XCVA 3HOSA 4M73A 2BGCA 3Q9VA 1XGNA 1LDKB 2EFWA 1FBQA 1SFEA 2AXLA 1C0WA 3GZ6A 4KMUX 5D5WB 2HKXA 4EMSA 2JPCA 1F9NA 5L3CA 3LWFA 4HF0A 1HW5A 2ETHA 1YW9A 4KN4X 3V7SA 2H09A 1G4DA 2TDXA 2L4AA 3RYPA 1GHCA 1Z91A 3KZYA 2K4JA 3K2ZA 1EH6A 3DP7A 3E97A 4OIPF 1PUEE 4GXOA 4UVAA 4GO1A 2VC1A 4Y15A 4PGGA 3C18A 1JXSA 5LGNA 3GFJA 4RGSA 2HQNA 2GA2A 2MA3A 3PFIA 2K4BA 3EQLF 2J5PA 3KZZA 3ZN1A 5E1XA 3G73A 3ECHA 2A61A 2G9WA 3I59A 3I0TA 1O7FA 4MQVA 1ZGJA 4OMZA 4CDGA 4RGXA 2DO7A 3I54A 3ABUA 3HOTA 3F6OA 1TBXA 1BBYA 2FEZA 3T8TA 2EB7A 1T0FA 2W25A 1HQCA 2XUBA 3BY6A 1WRJA 3WODF 1ZRCA 4QLCU 4M9SA 4ON0A 2A6HF 1U78A 1EH8A 4MEXF 1R5GA 3GFMA 1OYYA 1PP8F 3H3ZA 5J8CA 2F5DA 3HRTA 4R1HA 4OU0A 4FX0A 4ZYGA 4MHGA 3TOBA 4KYWA 1FSEA 2A5YB 4IRGA 3C7JA 5FGMA 2JT1A 1ZRDA 5D8LB 2EV5A 4XLNF 1HKSA 1JE8A 2L54A 2H6BA 1UB9A 2OZ6A 4LLGF 2HYFA 3J81Z 2QYOA 4M74A 3K1MA 2HTJA 1BJAA 5H20A 2XAFA 5HS7A 1IF1A 3WTWC 2FBIA 4EJVA 3KEQA 3E6DA 4NQWA 4KMFA 3JSPA 1IN6A 2DBBA 2NAZA 2HGCA 2HQRA 2ADUA 2VN2A 1IXRC 2ZCWA 4S04A 2XRNA 3FWEA 3M9AA 4ESFA 4XSZF 2Y0MA 4G9YA 2NYXA 2L02A 3JW4A 1YS6A 3ML6A 1DPUA 3PQJA 3JTGA 3HRSA 2A68F 4IXAA 3EYYA 3GUDA 5CVIA 5BOXA 3T5XA 3WE2A 3D5LA 3GVAA 5LRRA 2RKHA 2VODA 2QQBA 3I58A 4RB1A 4U0YA 2EJRA 1MD0A 1ULYA 3GZ5A 1YTYA 4FHTA 4YFNF 4F7ZA 3QP6A 2M87A 2VT3A 3RIRA 2Z99A 3SHFA 3RKYA 3V7RA 1LQ1A 4KUMA 1U6GA 3HSFA 1S6LA 1BI2A 4EQQA 3ZN0A 1PP7U 5L3BA 2EFPA 1YW8A 2CO5A 2XVCA 1U5TC 3IKTA 4PCQA 4N0BA 1T2KA 2QLZA 4HOBA 5HLHA 1ZGAA 2IVMA 3E5UA 3JAMZ 3L00A 5FD6A 4ESJA 4KA4A 3LA3A 3LA2A 1DP7P 4P9UA 4G8XA 2VE9A 3KP2A 3O6BB 1G3WA 3VODA 5K5QA 3E6BA 1IRGA 2L4MA 3E3VA 3I71A 4ZH4F 4KICA 3EETA 2FNPA 4UNOA 1W7PB 1BM9A 2GWRA 4KIFA 4HAMA 2WV0A 2W57A 3ULQB 2LDUA 2PBIA 4YG2F 5ICFA 2RDPA 2NNYA 5ILUA 1S7OA 2HEOA 2G7HA 1YG2A 4I98B 2CW0F 3I5UA 2ZNYA 3ROUA 1T39A 4XLPF 2CWEA 2CYYA 4L0ZB 3F6VA 3KCCA 3KP4A 1LEBA 4UV8A 1TNSA 5FB2A 4HF1A 1OPCA 1IN4A 1IRFA 3NRVA 2PEXA 4G94A 4MTDA 1Z1DA 4RS8A 1BI1A 1J0RA 5AIQA 2DU9A 3K9TA 2RNJA 1Z6TA 3ZPLA 5HLIA 4RAYA 1JHHA 3WGHA 3I4PA 1R5HA 5DCMA 1HSJA 4G6QA 4LG0B 4HX8A 1XDUA 3HUGA 2UWMA 3BP8A 3GX4X 3GW2A 4KIBA 2XKOA 4BNCA 5EEGA 4AIJA 1G3SA 5H6RA 4U7BA 1IN8A 2BEOA 4O3MA 1R58A 4G7ZF 5DUIA 3P9IA 3D0SA 3KP7A 1ZG5A 4JK1X 4M71A 1IW7F 2NNNA 1I5ZA 2RGVA 1S7AA 5HDKA 1Z7UA 5LGTA 4Y13A 1O57A 2E1CA 5L3FA 4EM1A 2D2WA 2BV6A 1XSXA 2K7LA 3J7AO
chains in the Genus database with same CATH superfamily
3HRUA 1XN7A 4LMYA 1HXDA 1TW3A 3MKWB 3IH4A 4L18B 4ETSA 4HSTA 4C3HJ 2VJJA 3FF5A 3ZQFA 1XMKA 2X0LA 5E3MA 2JMWA 2D1HA 2JSCA 2V1XA 3AKZA 3GLLA 3K4JA 1YITI 2FD5A 1SAXA 1VQLI 1S29A 2DFIA 3OL3A 2XGXA 4XOPA 2VT2A 2VBXA 3IWZA 3VFZA 4AWXB 4BH9A 3R60A 4RB2C 3G1OA 1OJLA 4B44A 5EGOB 3WG9A 1JUMA 1ZR2A 1HOMA 2DTRA 3OYMA 4UXNA 4GCVA 2K3FA 5C3EJ 2R7RA 1XDSA 3GWZA 5LHGA 2VUMJ 2R0QC 3OL4A 5E20A 2A07F 5K7FA 3OY9A 1WPKA 2LBFA 3BJ6A 3I59B 4NB5A 2MC4A 1RC9A 5J47A 3BWGA 3CLOA 2ZJQF 2Q8KA 4NBQA 5HNHA 2R7TA 1FTZA 2XAHA 1S5LC 2HKOA 2V9VA 3KFWX 5LBQA 1U9OA 2NS0A 3KLNA 1D0XA 2RREA 4HLXA 2VKVA 1J59A 1FIPA 5M5XJ 2L5QA 2JJ7A 3PNTA 4OINF 3QP5A 3A0BC 1YJ9I 4IHSA 3BT9A 3H92A 3FISA 3GTJJ 5K7ZA 5HVQC 4N9HA 2MYSA 5D6FA 2BE5F 3L2VA 1K78B 2Y75A 1V5GA 1LFPA 2X51A 4MTEA 2EV0A 1IXSB 1MJBA 4PFOA 2NOGA 2EFQA 3OYHA 1YLFA 1A6IA 5GADJ 4EGZA 3CESA 2ECCA 3BTJA 4GRIA 4GYGA 4BQOA 3JRHA 4Y33A 5E3LA 2QUFA 5F64A 2CRGA 1VTNC 4P96A 4M3FA 3IL2A 2Z3YA 3ZP5A 4LLNA 1E0EA 1U5TA 4ENKA 3GF2A 4EJOA 3ZMDA 2ZXJA 3HOWJ 4CICA 1MDMA 4HF2A 3O2PE 1IN5A 2CQ7A 2CJJA 3S17J 4JQFA 4RLQA 1UFMA 3DF8A 2P81A 5K5OA 4YFXF 5TRDA 4Q4ZF 5L3DA 2DQLA 2NOJB 1FY7A 1LUJB 2CS3A 3QOEA 5LGUA 2A05A 3HOUJ 1MSFC 3FXOA 1B8IB 1FZPB 2DMUA 2FJ1A 2ZMEC 1Y39A 4ZJZA 2L7FP 5HLGA 1PJRA 1ZR4A 3VSKA 4YFKF 1KGSA 5ILVA 3G3ZA 1ON2A 1X3UA 2GQQA 1XX5A 3ISPA 2DI3A 2QVOA 4ENNA 3LQQA 2VJ5A 2Y31A 4DJAA 4E6KG 1GVJA 2O8XA 2Y2ZA 3BTIA 4HQMA 4N4NB 5IT9Z 2OV7A 1Y0UA 2LKXA 3R6SA 3BCAA 4B09A 5CVVA 1V3FA 1X58A 1XTAA 4L9TA 4FETA 2DPUA 1WJEA 3IKVA 2A69F 3PO2J 4UVCA 3V8JA 3BR5A 2HZTA 2VPLA 4B1RA 3T0YA 2MLKA 3L7WA 4HV5A 3OYJA 3K70C 2D1VA 3IUOA 1J09A 4OWRB 3MCZA 4CCMA 2DJNA 5TGTA 3WHBA 1OCZH 5ICGA 2R5ZB 1BR1A 1S3JA 1YJWI 3NQOA 2IGNA 2H1LA 2PFBA 5B1AH 3B6AA 2KRHA 2VJ4A 1RI7A 3OIQA 5E18F 5EEHA 4BEHB 4ASNA 1XSVA 1WQ2A 4H0EA 3I3LA 1X19A 4DYQA 2VQHA 2QBYB 5E79C 1STZA 1D3YA 1TC3C 3CCYA 1GLNA 4EJTA 1BC7C 1Y1VJ 4BE0A 1OCTC 1ZREA 2RC4A 3K4KA 5HODA 1RR7A 1R36A 3KEYA 1RUNA 1REPC 2EIJH 4M3GA 1O3QA 1QVTA 1OCCH 3GFIA 1TLHB 3JSOA 4F92B 3TW6A 2ZSHB 3K70D 2QSFX 3DLLF 1QPMA 3G1LA 4M3BA 1ZHFA 2LY1A 5DEQA 1JJ6C 2RN7A 3V7CA 3GTMJ 3FHNA 1TP4A 4RLFA 1LNWA 2X1CA 2ACJA 5F0HA 2M4KA 4U88A 2HDCA 3BG3A 1YYVA 3C3WA 4A3IJ 3IAS2 3S1NJ 5JHUA 3BPVA 2K02A 2M8EA 1SD7A 3H9JA 3M07A 3SJMA 4CSWA 1R7JA 2OA4A 4KISA 5CLSA 3KYLA 3Q0WA 4KIGA 4J00A 2HOSA 1JGSA 2KIMA 1YI2I 1TQPA 3GLXA 2JRTA 1V55H 4N9IA 1J75A 3W6KB 4OIOF 2QGUA 2EH3A 4HPQA 2BY2A 2FU4A 1RRJA 1QNTA 4E70A 2FX0A 1R1TA 5JVTA 2XC7A 2CW7A 2VPRA 2DXIA 5J40A 3DBHB 4DQ2A 2JZYA 2E1OA 5FKKA 1OLTA 2DTZA 3R0AA 5CVJA 4DNCA 5J4VA 2K9NA 4L5JA 4A0ZA 4ZYAA 1JHFA 1ODDA 2JVHA 3MKZA 3VYRB 5LLQA 1LB2A 2IGOA 1MW7A 3ZQCA 1Z3XA 2ECBA 4M9ZA 1TQIA 3HB9A 5LD2C 1R00A 4PJMA 1FMVA 3GZNB 1XB4A 2DAOA 4HYEA 2HVRA 1P2FA 1P92A 3PNVA 2BVMA 1OCOH 4DGWB 5J3LA 3DU6A 3HJEA 3PO3J 1N75A 1XD7A 1Z05A 2YR2A 3DWLE 3A01A 1O4XA 4C2UA 2JA6J 2RQPA 4LK0F 1HW2A 3KEOA 2P6TA 2DT7B 3VB2A 3ZQHA 3OYKA 1B72A 3JR9A 2LKPA 3LSJA 3FXQA 4G6DA 1YX3A 3DV8A 3KP6A 2OUMA 3CJNA 1YIJI 2QQ9A 3A4CA 1I1GA 1NHAA 1E3HA 1VQ7I 2MGQA 2JA7J 1I3QJ 3CDIA 3CCVI 5HOOA 1VFCA 3DTKA 3OYCA 1MBJA 1BI3A 3HC7A 2LF7A 3IWFA 4CXFA 1F5TA 3ABKH 3MN2A 3ONQA 2CQKA 4E7SA 4IVNA 3E6MA 3AG3H 3F23A 4BBSJ 1MJAA 1DPRA 5BPDA 3M4OJ 2H8WA 1BR4A 1W36C 2K3PA 1D8KA 1U9NA 1J5YA 2AXTC 2MSYA 3R0JA 3U1DA 4IKFA 2BXZA 1KYZA 3BDDA 2R4GA 2Z16A 3GXOA 3BG9A 3V8KA 1K61A 4BXXJ 3R4KA 1J7KA 2L0KA 4BE2A 1ZN2A 2Z2SB 2FMLA 2WADA 3DQVC 3CF5F 3PSIA 2GM4A 1WZ2A 1HA8A 3S2HJ 4GYIA 2VB6A 3L2RA 3DPLC 2CGPA 4A3JJ 2L9NA 3P9CA 3H3UA 2KKOA 3AG1H 3HKZN 5IT9K 1W5TA 2KQRA 1ZRFA 4B48A 2K9SA 4TV7A 4X0GA 2FF4A 2V9PA 4Q48A 5D5UB 2EK5A 5BQTA 2YX4A 3G4SI 3RTRA 3KE2A 2M2EA 3QOPA 4RGRA 4HW0A 1AWCA 2IP2A 5DD8A 2B7EA 1MSEC 4DZJA 3ZMZA 4U0WA 5DM6F 3H0DA 4AU7A 1IRZA 4FE4A 2CUJA 5BS6A 3CZ6A 1GV5A 5D4SA 2FOKA 2OJED 4GGGA 3OS1A 4RMNA 1HF0A 3Q0VA 2X48A 1KQ8A 1POGA 3LSRA 1YQAA 1D1BA 2F6CA 4M6XA 3DBRB 1W7PD 2K9QA 3BG5A 1B6AA 2YPRA 1IRXA 2HQ5A 5FFXA 1WH5A 1X2NA 3B73A 2O3FA 3CUQB 1GXPA 3O3KA 5KAFC 2EZHA 2E1MC 3L9FA 1D1AA 1LDJA 1IAWA 2GZWA 3HUGB 1Y6IA 1FPQA 4BJ6C 2F48A 5LHHA 3CJTB 4AIDA 2P0WA 3ERED 2XAGA 2DN0A 2ESHA 1XCBA 3KP5A 4ZZLA 3TDZC 4D1QA 3D5SC 5GTIC 3HKZA 4CZCA 1WI3A 1FX7A 3CCEI 3IRRA 1T8IA 1ZG1A 2DOFA 3J80Z 4E7JA 2QSHX 3CCSI 1WJBA 4NHJA 2G7UA 4IHTA 1T38A 3LSTA 4XLFA 4IQ4A 1J2XA 2M7AA 3IH3A 1ZELA 2ZMEA 1FEXA 1ETVA 3FXRA 5AIPA 5DDGA 4ZYHA 1VNDA 2EV6A 2PMZN 2FQ4A 4AVPA 1SMTA 2DLLA 1V54H 3PQKA 4LIUA 5EG0B 5BMZA 2MLGA 2O0YA 2VKEA 2EFOA 2UXXA 2C6YA 5HS9A 4ZZDA 3HG9A 2QA4I 1UCRA 2XASA 2KRFA 2V79A 4WWCA 4PK4A 2E5ZA 3PL8A 2NVYJ 3S8PA 1JKPC 1WI9A 2OTLI 1MMSA 1XSDA 2ZFUA 2A5WA 3LQRA 2VASA 1TWFJ 3D5RC 2KIQA 4EEFG 3KETA 2JQ7A 3BG7A 1IG7A 1RZ4A 1TWHJ 2QQAA 3TW7A 3DLAA 3IV5A 4FCYA 5DCFA 1WKMA 4NUBA 3J81K 2FSWA 3TO9A 3ZMSA 5JHFA 3B6CA 2COMA 2R7SA 1TT0A 1IXCA 2GIVA 4CCLA 1TW2A 2FBKA 4BKXA 1ETXA 1UMQA 2I10A 2IPQX 1K4SA 3BPXA 3JRCA 3HHHA 2HPIA 1H8AC 2PMHA 2YS9A 2DMPA 3MZ8A 3PJRA 3U2RA 1RETA 2LK2A 5JR3A 2JTVA 2ELJA 1XMAA 3F8FA 4OAZA 5J1UA 2KRCA 1BW6A 3RYRA 3TQNA 1BI0A 1YOVB 3OS2A 3G71I 2KZGA 3ECOA 5HLTA 2E2JJ 1I1SA 4LB5A 1EJ9A 4QTRA 1P4XA 3UR3C 1UELB 2PMZA 3HPGA 3QU3A 2EA2A 3UNGC 3ZMUA 2IA2A 2XAJA 5FLVA 4BQAA 4BUPA 2L3DA 1WWXA 3GTQJ 3FM5A 3LSMA 4BYYA 2M45A 3HM5A 4BJTA 1Y0NA 5E8IA 3MZHA 5ILSA 3ZQQA 4BQNA 5JFRA 5TJJA 1ZKGA 4HRIA 3BZCA 3NARA 3OR2C 2VOPA 3MMYB 3TP3A 4KT5C 3G6EI 4AIHA 5CQEA 1CF7A 1YX5A 2WV1A 2HOAA 3MKYB 3M8JA 1OMIA 2KHMA 4ITVA 1R1VA 3B02A 4A3BJ 3GCMA 4A5MA 1T98A 2STTA 3OYLA 2R7XA 2WB1N 2TRTA 5JI6A 2E2HJ 3TKYA 2BBYA 1FBSA 5AONA 1QGPA 2Z5UA 1U8BA 1WGXA 4LLLA 4XORA 3S1MJ 2VE8A 3ZMTA 1VF9A 1TL8A 1SFOJ 3CCQI 1QZYA 1I6HJ 3NEUA 2H1KA 3CC7I 4S0HB 2XF7A 3LMMA 5A2QZ 1UG0A 4RB0A 4A69C 4PDKA 1U0JA 4PSWA 4XN0A 3QRFF 5FO5A 1KONA 5BNGA 3SFZA 3CP8A 2EILH 3QODA 1OR7C 3PSFA 4QIWN 4II2A 1UZCA 1K6OA 1FJLA 3V8LA 3P7NA 4KJZA 3PNYA 1U5TB 1NK3P 2K27A 4EV0A 5HS8A 1AHDP 1MDMB 1LVAA 1ETYA 3BZ6A 3VOEA 4LK1F 3E5QA 1X3WB 5KK1A 4C3IJ 2W82A 4J19A 3RZOJ 5TISC 2PQ8A 3VYUB 5FLXZ 4E7IA 3I4MJ 5EEAA 1ZAOA 2M1BA 2M9HA 2ZJ2A 3HPHA 3SDGA 4B3AA 2BY3A 5GTHC 1HDPA 2V9KA 5LRSA 2H94A 3DPUA 4WXCA 3DKXA 5IP6A 2QKLB 2P5VA 3F8CA 2B63J 3HL2A 4QWQA 3RPUD 4CCJA 1G3TA 1QHHD 1PVEA 4IRHA 4RDUA 2OCCH 3F8NA 5F27A 1WCMJ 2R7FA 5CVUA 1KQ9A 2E36A 2LNBA 2LSOA 2P4WA 3QPHA 2IBDA 4WXHA 3K1PA 2WY7Q 5ICEA 2BHZA 2AQFA 2HPMA 1YO5C 5CYVA 2IAIA 3QWLA 3I53A 1FC3A 4WX9A 1WJCA 3N97A 1I27A 1L3LA 1QHGA 3HHGA 1JUPA 1XG1A 2F5VA 2HZDA 2P5KA 2P8TA 3K0LA 3TGNA 4Y7NJ 2DYRH 2DT5A 1Z6RA 3F9KA 3FIWA 1YJNI 4UB8C 2IGMA 4OIQF 1YS7A 2E34A 3FKIJ 5LFAA 9ANTA 4ZDOA 4U0VA 4B8XA 3LSGA 2VL8A 3JAMK 3LAJA 5D8KB 4NNJA 4G7OF 2E60A 2XSJC 4ENMA 1HSTA 1R1UA 3WGIA 3IHUA 2Z9OA 2BHYA 4I02A 4V2GA 2GIZA 4BXFA 4ZDLA 4FT8A 1E17A 2DOEA 2L2OA 2E1NA 3JTHA 3I56I 3HGGA 4WF2A 3VEPA 3I4NJ 3SZTA 4XICA 1G59A 1PDNC 1TT5B 3BJAA 2NVQJ 3MFKA 3K4CA 3BCBA 3OSFA 4MGRA 2JA8J 3DPTA 2DA2A 2LYCA 2HXOA 3U9GA 3ZMVA 2M0MA 2IT0A 1UHWA 4MQ9F 2QWWA 1DUXC 3HTSB 4R8HA 3ZOBA 1QZEA 1NG7A 3ASOH 1R71A 4LJZF 3WTXC 1NTCA 3OIPA 5E8GA 2Z33A 1U2WA 3CJQB 2OD5A 4WXDA 4E7KA 1KU2A 3P5JA 2VQCA 2LY2A 3F22A 3GTLJ 2MABA 4JX6A 2ID6A 1OKRA 1BIAA 4K2EA 2MFZA 2CMPA 3IP4B 2W24A 4AYBN 2KZVA 4KN7X 3TDUC 2R7OA 4AC0A 1NK2P 2ZJPF 1QQIA 4XKBA 5L3GA 1D1CA 2FMYA 5H6QA 1K79A 2ZC2A 1LDDA 1SVOA 4I01A 3JRFA 1ZQ3P 3RQIA 1TNTA 3DU5A 3BROA 1Z0XA 3WGGA 5GPAA 2HS5A 4MO7A 1IJWC 1ON1A 4UUSB 2OQGA 4XOTA 4A12A 1JTXA 5F6FA 4PJJA 2B0LA 2FXAA 3K7AJ 1TTYA 2GA1A 1WJFA 3ERMA 4YIFA 1X4PA 2V1UA 4LG0A 3WTYC 4Z2YA 2FA5A 2L9SA 3FM3A 1A5JA 1L0OC 2M0CA 2PMUA 4V19K 2L01A 3HZJA 3CD6I 4XKVA 1AA7A 1MBHA 3CQZJ 4O6JA 2BW3A 4EJUA 1S72I 1MJ9A 3J7AY 2DCEA 1KU7A 3AL0B 2XB0X 2MH2A 2ZBKA 3AG4H 3KP3A 2ZO4A 2LF8A 1SVLA 4M6VA 5KVRA 2UZKA 4V2FA 3REOA 3F3XA 2EBIA 5DUKA 2M5WA 2DPDA 5E17F 3QAHA 3CO7C 2XHKA 2ISZA 5IOYA 4HDUA 1E2XA 4XIDA 4CYDA 5A2QK 1B4AA 4C9YA 4HG2A 1OCRH 3M8FA 3TMOA 1ZLKA 2STWA 2KP6A 2PG4A 4L9VA 2G0EA 2PJPA 3GFLA 3LFKA 4E7LA 2WAFA 1SC7A 4UVBA 1RIOH 1KYWA 1USSA 2VKHA 3OYEA 3CC2I 3O8GA 4NQWB 2FQ3A 1I50J 3ABMH 4A0YA 3HDDA 2WBMA 2IEKA 4XBFA 5GAEJ 1HW1A 2IJLA 1YFHA 4AD9A 1OYIA 5FLXK 3V4GA 1NH3A 2LLKA 4D7MA 2CG4A 1AOYA 4A6EA 4ESBA 5F04A 2V26A 2QZ8A 2COBA 5JLWA 3FXKA 4UHTA 5EF6A 2RVCA 2M4GA 1FOXA 1JGGA 2CU7A 1LJ9A 1LFBA 1MBFA 3D1NI 3QPTA 3WTTC 1HKQA 3L09A 5E1ZB 1A04A 3DTIA 1FOKA 3C2BA 3V42A 2A6EF 4BHCA 3T8RA 6PAXA 2K9LA 2ZKZA 3OOPA 4LFUA 2NRAC 3E5XA 1WJ5A 4M72A 3GTGJ 1F4KA 2MH9A 4PZJA 5DD4A 3W3CA 5EGOA 1S9HA 5ED4A 2V6CA 5F08A 4YIIA 2F4MB 4A2UA 4BS9A 4HBLA 3OYBA 5J1YA 1MMAA 3FKJA 1YIOA 3ELKA 3AAFA 5M3MJ 5F1RA 2P7CB 1V5EA 4LITA 1G6NA 3OSGA 2CQNA 3DEUA 2E7XA 1V4RA 3CO6C 5DV5A 1IUFA 4II3A 1ZYRF 4IPAA 2W48A 2ZFWA 2R5YA 2VIXA 2X6YA 2XROA 2GAUA 3SYTA 5IT3A 1ETKA 3W2WA 5J4YA 3H3VK 1P7JA 2EPFA 5K1YA 4Z6YA 4I0BA 1VQ6I 2LFBA 2OU2A 2VXDA 3RPUA 5EZHA 1ETQA 3EDPA 1UHSA 4N4OB 3A03A 2VBWA 3W2VA 3BG6A 3GYHX 1G3YA 2CUEA 3CP2A 1K78A 2XIGA 1Z21A 2M7BA 3HSRA 4OOIA 3E6CC 4GFBA 1OR7A 4PGHA 1O3TA 1X4OA 3KX2A 1H9GA 1FYLA 3PIOF 1PYVA 3JRBA 4D0PA 1IGNA 1IDYA 1TWAJ 5B66C 1R23A 2NVXJ 1S8NA 4HX4A 1N78A 3A02A 2LC2A 4P55A 3ZQLA 1LVKA 4XONA 4HV6A 3CUQC 1ONVA 2DFEA 1E3PA 2PLYA 2NXNB 2V1DA 4Q47A 4XMYA 3ZGKA 3GEZA 1F1ZA 1VQ8I 3S2DJ 2DFFA 2BXYA 1MH3A 1W4MA 2IS6A 5CQGA 2XAUA 4W1UA 2XKPA 4XR6A 4BHBA 2ZMEB 1Z9CA 2HYJA 4OAYA 2K86A 2HVQA 3RDIA 1WJDA 5BPIA 2LVSA 3DKWA 2ICWG 4CGZA 4JP0A 3FHZA 2R7QA 4A0XA 2ISYA 2O03A 1GXQA 2YX7A 3BTCA 1P4WA 2VXZA 2KJBA 1VQ5I 4G7HF 3S3OA 4UUTA 4EJWA 4UB6C 2UXNA 1ZLJA 4I09A 2OBPA 5DS9A 3OYIA 4EGYA 3IRQA 3LA7A 3QPSA 3F21A 2FE3A 3CTAA 1BW5A 1MGTA 1RKWA 4IL6C 1ITYA 1IN7A 4IHVA 1JJ8C 2GBYA 3BR3A 2XSDC 2OQRA 1FNNA 2R3SA 2ZXHA 1EV7A 5J8FA 2HTSA 2FOWA 4HNVA 2W00A 5HDGA 3OOUA 1YRNB 4L0YB 2GXGA 1WSUA 4PUSA 3RI4A 3LAPA 3GTKJ 1ERDA 1MKMA 1R4NB 1LPQA 5K7HA 1O7LA 4LG3A 2UV1A 2E7WA 2XPVA 2FNAA 1ZGWA 4C2MJ 2B9SA 3H35A 4UY8I 1IV8A 1QBJA 2JWTA 4HEA2 1WVRA 1SFKA 3F8BA 2Y9ZA 3H1CA 1W5SA 2I8DA 5LHIA 3OYGA 1H88C 2LKSA 3HYIA 3PM1A 2OF7A 2ME6A 2DK8A 3ZXSA 4FX4A 2N8GA 2ME0A 2KIUA 1AU7A 2O7OA 1YW7A 2EFNA 4BEHA 3BOQA 1B59A 5FLMJ 3DEEA 1IUYA 4R79A 2F2EA 2XV4S 3COAC 1RKTA 1W5CC 5EJCA 3L2WA 3FMRA 1PUFA 3CC4I 2QBYA 4HQEA 4RB3C 4BAYA 1MMDA 1R6RA 4XKWA 1JUSA 1SVMA 1OQYA 5GP9A 3BJOA 2CV1A 4A3FJ 5IP9J 1UHMA 5K5RA 1ENHA 3BQZA 2EIMH 4I0AA 3HSEA 2HFHA 3OV8A 1D5VA 4UV9A 3CF2A 2NS8A 3GMEA 4AIKA 2FRHA 2LY9A 5ERIA 1CF7B 4KT6A 4LD5A 1J9IA 3CMMA 2IW5A 5CPRB 2QEXI 5CVRA 2ZXIA 5HDNA 1K83J 3X2QH 5B3SH 4MFDA 2LRDA 2L9RA 4IEJA 3TO6A 2NVUB 1U8RA 5DCMB 2DK5A 1EF4A 2RV8A 3M7GA 5J6XA 4CUGA 1QZZA 3OYFA 2GOMA 3HRMA 3WHCA 3ESWB 3TOAA 3NAUA 5FD5A 3FXJA 5E3OA 3JREA 4HX7A 3HOZJ 4QPQA 4L9JA 4RM3A 2QSGX 3EUHC 1A36A 2F4IA 1E3OC 5FRMA 3M1CA 5FROA 3SZGA 5IYCJ 4P9FA 2XAQA 1N25A 3L2CA 2O6GE 1EKEA 2GLOA 1MZBA 4A93J 4B4CA 5CKTA 4M3EA 1H9TA 2DQRA 2IXSA 3MAJA 4XSXF 1BIBA 2HI3A 5KHDA 3L1PA 4HNTA 1IZ1A 2OZUA 1QO0D 2PJRB 1P4AA 3LSKA 3WU1B 3OYNA 4HLYA 4IO9F 3SXYA 1XGSA 2X85A 1LEAA 2PI0A 2YU3A 5HNFA 2GXBA 1JKQC 4L5IA 5FFZA 3ZQGA 3ZRGA 1VQOI 1EH7A 4KNYA 3W6JB 1ZARA 1ORKA 4JBAA 1MBKA 2E2IJ 2Q0OA 3FDYA 3MQ0A 4IOCF 2HOTA 2R93J 2DA4A 1DDNA 2M8GX 3H36A 1BN5A 4EVIA 4IOAF 1I3AA 3SEZA 5D4RA 5D6EA 1Q1HA 4AM3A 4E4HA 2EZIA 2JPBA 4X1EA 3HTUA 2M30A 2HYGD 2OAZA 5EDNA 3R61A 3RKWA 2ID3A 3FXMA 5DTDA 4A6DA 4ZYEA 1QRYA 2LD5A 4I2OA 1XGOA 3WTSC 2DMNA 3FZVA 3KPHA 2O8KA 5FKMA 3FBNB 3OIOA 4CHUA 4M6YA 1WH7A 1KU9A 3JCUC 2KDZA 3W6VA 4Q5SF 1BR2A 2DA7A 2DJIA 2AHQA 1BC8C 3I64A 1D8JA 1FP1D 2F5EA 3RJPA 2IA1A 3RKXA 4PJ0C 4I76A 1U3EM 2KLOA 3LNQA 4HSRA 2VBYA 4OMYA 4M3DA 2WC2A 3CDHA 1ZH5A 3MVPA 3K2AA 4XRMA 2F5FA 3WTZA 2W7NA 4MEYF 2BVLA 3WG7H 1FIAA 2LBFB 2YU9J 1Y8RB 2CFXA 4I6ZA 1O3SA 2WY8Q 4IHXA 1SD4A 1R5ID 2JK3A 4BXUA 1WJAA 4ENJA 3K1NA 1CGPA 4U87A 3DFGA 1FWZA 1B9MA 3KLOA 1SAUA 1QA6A 2CH0A 3HOYJ 3I9V2 1TWGJ 4L9NA 4KITB 2VOOA 1X1AA 2XGDA 3A0HC 4M9XA 2LG4A 1T95A 1G2HA 4HA8A 1WFXA 1IO2A 3WE3A 1F43A 3K4MA 1W0TA 4OIRF 1FYMA 2EQRA 2VONA 3FX3A 1R49A 5FKNA 4MIMA 2W84A 5CJ9A 3F72A 3CCRI 3K10A 2HDDA 2FBHA 1IC8A 2R7DA 4KFCA 1T0FC 5GPCA 1HBXG 1FLIA 1MNMC 1Z3YA 4P1WA 4S05A 1K7AA 2AS5F 3IC7A 2E1MB 2CV0A 2QF7A 4BBRJ 2DW4A 2GOXB 4EATA 3A1YA 3K4BA 2H6CA 3OS0A 3Q5FA 2DA1A 2V4JC 1DU0A 5D5VB 1FOWA 4IHWA 1VQKI 1BOAA 1TQMA 3SZPA 1KA8A 2EA4A 2KIFA 2OCEA 3RQ4A 4CZZA 4D7NA 3BTLA 3Q9SA 3CUQA 3RPQA 3HOVJ 4DIQA 4A3GJ 3DKYA 1XGMA 4XL9A 3S2WA 1FYKA 4D5FA 3S14J 2X4HA 4L5EA 3CUOA 1ZTRA 2BW3B 3E7LA 1YHQI 4GDFA 5M3FJ 5E1WA 2ELHA 5GAGJ 1GDTA 4MFEA 3TEDA 1HLVA 2VC0A 2W4SA 2X9DA 1UAAA 4IRIA 3C2GA 4JYKA 2HWVA 1F36A 2Q2EA 1RUOA 2BYVE 1SFXA 1VI0A 2X6XA 3QYBA 1T6SA 4EM0B 4LIVA 3A2KA 3WTUC 3J7ZI 4HDVA 5KCMA 1OISA 2E19A 1KZHA 5F1JA 1I6XA 3OYDA 2WB1A 3LFUA 1USTA 4WCGA 1HDDC 4XQFA 5C44J 2LOOA 4RGUA 4IF4A 3JRGA 2WWYA 2P5LC 1RNLA 3EPZA 3M8EA 4DYCA 4A3DJ 3LOCA 1BOBA 4E7HA 3K69A 3F8MA 4LGWA 2DA6A 1FTTA 2OC6A 4HZFA 1W1WE 4LOCA 1FT9A 3J80K 4YIRX 2XPUA 1X1PA 3JRDA 3CMEI 3FMSA 3E1SA 3WTVC 2MG4A 2MD5A 3OR1C 3M1EA 2L7KA 5IPAA 2YSRA 3ABTA 4I7HA 3S3MA 4Y3OA 5ICCA 2J5OA 4KDPA 3ZQ7A 2KT0A 1R22A 2HOEA 4B43A 2HR3A 4MNUA 1H0MA 3QU6A 5IY5H 2CSOA 1P6RA 1SD6A 3SFIA 3VPRA 3K4NA 2JVGA 1W7PA 4NC8A 4XNFA 4BGDA 4WK8F 2QM3A 1LKXA 2MBFA 4XRFA 4BHPA 3S1QJ 4BU2A 2H27A 2O61A 3HXLA 1IDZA 1AKHA 3WU0A 2IRFG 1FSHA 3K6GA 1XPXA 2LP0A 3MZYA 1K4TA 4LB6B 2ZNZA 5IYDJ 5LEJA 1MBGA 3CMYA 4B47A 4IJAA 2D45A 4UUVA 4Y17A 1KU3A 4O5VA 3GO5A 5B1BH 3FK7A 1S7EA 1SFUA 3FK6A 4NDLA 3HIFA 1TWCJ 1HKTA 2P6SA 2Y48A 1MBEA 2QENA 3AFHA 1SMYF 3C1DA 4QPOA 4PFPA 4QSHA 4DBQA 3DEWA 4F91B 1T33A 1I39A 2UUZA 3FMQA 4CO8A 3CMAI 2L9VA 3N4MA 4U7DA 3H5RA 2QKMB 5M5WJ 1FP2A 5L3EA 4NC6A 3RKQA 1OYWA 1SD5A 1T08B 4FE7A 1B1BA 2VBZA 3MWMA 3SQNA 2Y9YA 1QVUA 2KJCA 3M3YJ 1FBUA 2A6TA 2LH9A 1ZG3A 3U21A 3JRIA 3LSHA 4C30A 3OYAA 4AUXA 2I5UA 2R5YB 4RAZA 5J1RA 3ZQIA 1HC8A 2ZB9A 2IA0A 5DYMA 4A3MJ 5LEKA 2KMUA 3EYIA 3MEXA 3DXJF 1A6QA 4ZTFA 4ZYDA 2EZKA 4A5NA 3BZKA 4CYCA 1O3RA 3EUHA 1A31A 3S15J 2IS4A 3DTEA 5D5XB 2W85A 3MD2A 2WTEA 1LE8A 2F5CA 1B9NA 3H9GA 1KQ0A 4XN3A 4P5OA 3S32A 1H89C 3TO7A 2ESNA 4CCOA 4DBRA 2MC3A 4IHYA 3H9QA 1RR8C 3P9KA 3WU2C 1ZK8A 5IYBJ 2EWNA 3FXUA 3PFYA 1MH4A 2P7VB 2A3SA 2FUG2 4DW6A 4EM2A 2XF6A 2K5CA 2PN6A 3T1BA 1XCVA 3HOSA 3L2UA 4M73A 2BGCA 2JUCA 3Q9VA 3NWTA 1XGNA 3VDXA 1LDKB 3ZCOA 2Y30A 2TCTA 1OFCX 2EFWA 1FBQA 1SFEA 2AXLA 3A01B 1C0WA 1P9QC 2EZLA 2LMDA 3GZ6A 3BC8A 1ACIA 4KMUX 1N77A 1B72B 5D5WB 2XDVA 2HKXA 2AQEA 4AYBA 2V6EA 2JUGA 4EMSA 2JPCA 1F9NA 2DYSH 5L3CA 3VSLA 3H0GJ 1DGWY 1X3ZB 1R9TJ 1DQUA 3LWFA 4HF0A 2XF5A 5FKOA 5C4JJ 1HW5A 2ETHA 1YW9A 4KN4X 4IX7A 4A3EJ 1QPIA 3PUFA 3SEQA 3V7SA 2H09A 1G4DA 4C3JJ 2TDXA 4I99C 2L4AA 2BY1A 2R7WA 3RYPA 1GHCA 1DGRM 1Z91A 3LSIA 2WAEA 1Q1VA 2K4JA 3KZYA 3K2ZA 1EH6A 1Y56A 2ELKA 3DP7A 2XGCA 3EUAA 4YEJA 3E97A 4OIPF 3ZR8X 1JTYA 4A3LJ 4AVZA 1PUEE 2E71A 4GXOA 4UVAA 4GO1A 2VC1A 4Y15A 3DBLB 2O9LA 3CCMI 5F0CA 4PGGA 3C18A 1JXSA 1OCPA 5LGNA 3GFJA 4H4KC 1VQPI 1APLC 4F93B 2X1EA 4RGSA 2HNHA 3ASNH 3EUKL 2HQNA 2GA2A 1VZ0A 1Z77A 5JLXA 2GXAA 2MA3A 3PFIA 1EA3A 2K4BA 3EQLF 2J5PA 3KZZA 4XKCA 2LTPA 3ZN1A 1PUFB 5E1XA 5DM7F 5B5EC 3G73A 3ECHA 2V7FA 1LFUP 1X1DA 2A61A 2G9WA 2HU9A 3I59A 4BDYA 3I0TA 5E3NA 2H8RA 1O7FA 4G6TB 4MQVA 3ABLH 2NVTJ 4FASD 1UG2A 1ZGJA 4OMZA 3BR1A 4CDGA 4RGXA 3RCOA 2DO7A 3I54A 2BOLA 2DDBA 4CCKA 2XGEA 3ABUA 3GBGA 3F6OA 3S93A 3HOTA 4X6AJ 1Z67A 1TBXA 1BBYA 2FEZA 3T8TA 2EB7A 1T0FA 2W25A 1HQCA 3CJRB 4PJNA 1MIJA 3S3NA 2K85A 2E5NA 2XUBA 4BY7J 3BY6A 4DZPA 1WRJA 3WODF 3U1KA 1ZRCA 4XK4A 2JA2A 4QLCU 2ZXWH 4M9SA 4ON0A 2A6HF 1U78A 1EH8A 4MEXF 2L7ZA 1R5GA 3GFMA 2F4OB 1OYYA 4YELA 3L2QA 2VQGA 5KAIC 1PP8F 2MW8A 2QCOA 4XLHA 4UUSA 2QQ8A 3H3ZA 3NWSA 5J8CA 2F5DA 3HRTA 2EIKH 1D0YA 4OU0A 4FX0A 4R1HA 4ZYGA 4XLCA 4MHGA 3TOBA 1IV6A 1FSEA 4KYWA 2A5YB 5IP7J 1XC5A 2KDOA 1V5FA 3IH2A 3C7JA 4IRGA 4ANJA 1YE9A 5FGMA 2JT1A 1ZRDA 1DU6A 5D8LB 2EV5A 2YUSA 4XLNF 2K9MA 1HKSA 1XMXA 1JE8A 2RAEA 2L54A 2HVSA 2H6BA 4BDZA 1UB9A 2OZ6A 4LLGF 1GT0C 2HYFA 1GV2A 2RNGA 2LR8A 3J81Z 1B8IA 3HEFA 2QYOA 2O5RA 2Y0SN 3CLQA 4M74A 2CUFA 1RESA 3K1MA 4Y4RA 2X6WA 2HTJA 1BJAA 3CDLA 4C2TA 2Q1ZB 5H20A 4IQJA 2CFOA 2XAFA 2DDAA 2VKDA 3KYDB 5HS7A 3QPLA 2W1OA 1JKOC 1IF1A 3WTWC 2FBIA 3G1MA 5F0FA 4CA0A 3HGYA 4EJVA 2IS2A 3KEQA 3E6DA 2WAQN 4NQWA 4KMFA 4XM3A 3UKGA 3JSPA 4XLAA 1IN6A 3TBIA 1VQNI 2DBBA 2KISA 2NAZA 1TZLA 2HGCA 2HQRA 2OTJI 4JX4A 4RBOA 3KYCB 2ADUA 2ZSIB 2VN2A 3KZIC 2R5ZA 1IXRC 2ZCWA 4S04A 2XRNA 3F0CA 3FWEA 3M9AA 3BR6A 4ESFA 2VI6A 2X1DA 4XSZF 1D0ZA 2Y0MA 4G9YA 2NYXA 1R4MB 5IOZA 1X2MA 3JRAA 1K6YA 2L02A 2MD0A 3JW4A 1YS6A 3G2BA 3ML6A 1DPUA 3PQJA 4RAGA 3OWTA 2EINH 2BZTA 3JTGA 2E35A 3HRSA 2A68F 4IXAA 4ZDPA 3EYYA 3GUDA 1JI8A 3O8HA 2HQAA 3Q3SA 5CVIA 2Y0SA 1VQ4I 3RZDJ 4RA2A 2VLAA 4A3CJ 5BOXA 3CCUI 5EYRA 3T5XA 3WE2A 3PUBA 3D5LA 1WHUA 4G12A 4BQQA 3GVAA 5LRRA 2RKHA 2JRMA 2VODA 5KNLA 1NG6A 3VWBA 2QQBA 3I58A 4RB1A 3W2AA 4U0YA 2EJRA 2XPWA 1X1CA 4D5CA 4IZZA 2DA3A 1MD0A 2JN6A 2WAQA 3OMYA 3I55I 3MKLA 1W36D 1ULYA 3GZ5A 1JT6A 2LREA 4FHTA 1YTYA 2Z1DA 4YFNF 1VQMI 4ZC3A 4F7ZA 3QP6A 4BY1J 2M87A 2K40A 2VT3A 2R7VA 3RIRA 3IAM2 2Z99A 3PIPF 3SHFA 1D5YA 3HBLA 2R7ZJ 3RKYA 3H5AA 3V7RA 4JX5A 3BQYA 1LQ1A 2KPMA 4KUMA 2JA5J 1U6GA 3HSFA 3KIOA 1S6LA 1RPWA 3N05A 1BI2A 4E7ZA 2DMQA 3FBIB 3H5NA 4EQQA 3ZN0A 4FISA 4FTHA 1PP7U 5L3BA 2EFPA 3BLYA 3LL7A 1YW8A 2M34A 2CO5A 2HDWA 2XVCA 1U5TC 2OPTA 3IKTA 4PCQA 5FKLA 2RQQA 4N0BA 4BJ5C 1T2KA 2CW8A 1MMNA 2Q2EB 2WA0A 4YRVA 3J7YJ 2QLZA 4HOBA 1UJ8A 5HLHA 4F55A 3CCLI 1VQ9I 5GAHJ 4Y52J 3Q0UA 1ZGAA 2IVMA 3E5UA 2BY0A 3JAMZ 3L00A 5FD6A 2XB5A 4ESJA 1BA5A 2XRLA 2DODA 1XS9A 3SDBA 3DCFA 4KA4A 2X6OA 1GVDA 3QYFA 1QU3A 3LA3A 3GTOJ 3LA2A 1DP7P 4XRSG 4P9UA 4G8XA 2VE9A 3KP2A 3O6BB 1G3WA 4F52A 4XLEA 3VODA 3AG2H 5K5QA 2R92J 3E6BA 1IRGA 2L4MA 1BJZA 3E3VA 3I71A 2IS1A 1JKRC 4ZH4F 5H2FC 3GTPJ 1YRNA 4DYRA 1M1EB 1SANA 4KICA 3EETA 2FNPA 4UNOA 2DMTA 2KL4A 2CQQA 1W7PB 1BM9A 4JOMA 2GWRA 4KIFA 4HAMA 1AKHB 2WV0A 2W57A 3BR2A 3ULQB 2LDUA 2PBIA 4YG2F 4RM2A 5ICFA 2RDPA 4BL0B 2NNYA 1MNEA 5ILUA 3FXLA 2IGKA 3HOXJ 2R7UA 1S7OA 2HEOA 1JT0A 2G7HA 1YG2A 4I98B 2CW0F 4DOZA 3I5UA 2ZNYA 3ROUA 1FOYA 3TP0A 1T39A 1FMWA 1BL0A 4XLPF 2V1NA 4NC7A 2L7MP 2CWEA 1T56A 2CYYA 4MLOA 5JVGF 1MMGA 1CQTA 2CQXA 2M3AA 4L0ZB 3S16J 3F6VA 3KCCA 3KP4A 1LEBA 4UV8A 3RSNA 1TNSA 5FB2A 5C4XJ 4F3QA 4HF1A 1OPCA 1IN4A 1IRFA 4W97A 5M5YJ 3NRVA 1DP3A 2PEXA 4G94A 4HNUA 4MTDA 1Z7LA 4PJLA 1Z1DA 4RS8A 1ETWA 1BI1A 3BR0A 1J0RA 5AIQA 2DU9A 5FJ8J 3K9TA 2VJIA 2RNJA 1Z6TA 4FQGA 2CV2A 5HLIA 3ZPLA 4RAYA 1X1BA 1JHHA 3WGHA 4CYCB 4XRSA 1MNDA 1R5HA 3I4PA 4ABZA 5DCMA 1HSJA 4G6QA 4ZTJA 1LE8B 4LG0B 4HX8A 1G8XA 1XDUA 3HUGA 2NS7A 2ZJRF 2UWMA 2AO9A 3BP8A 3GX4X 4PSXA 3GW2A 4KIBA 4CCNA 2XKOA 4BNCA 1GUUA 1P7IA 3QYEA 5EEGA 4AIJA 1G3SA 2CUZA 1ETOA 3VYSB 5H6RA 4U7BA 2Y69H 4A3KJ 4CH7A 1HCRA 1IN8A 3VYTB 2BEOA 2DA5A 2PX9A 4O3MA 1R58A 4G7ZF 3AL0C 5DUIA 3P9IA 2DFHA 2D5VA 3C2HA 3E0JB 1SEUA 3D0SA 2PJRA 3LSPA 3KP7A 1ZG5A 2DT6A 4JK1X 4M71A 5EG0A 1IW7F 2HXIA 1W0UA 2KFDA 1A35A 2JSPA 5FRNA 4J01A 3S1RJ 2NNNA 1I5ZA 3TL4X 4BACA 2RGVA 1S7AA 5HDKA 2VQLA 5EZGA 4B3XA 3K4LA 1Z7UA 5LGTA 4BE1A 4D9JA 4Y13A 1O57A 2E1CA 3QQAA 5L3FA 3CCJI 4EM1A 2DOAA 1Y8QB 2D2WA 4RAFA 2BV6A 1XSXA 1Y1WJ 2K7LA 3J7AO
chains in the Genus database with same CATH topology
3HRUA 1XN7A 4LMYA 1HXDA 1TW3A 4L18B 4ETSA 3FF5A 1XMKA 2X0LA 2JSCA 2D1HA 2V1XA 1SAXA 1S29A 2DFIA 2XGXA 2VT2A 2VBXA 3IWZA 3VFZA 4AWXB 4BH9A 3R60A 4RB2C 3WG9A 2DTRA 4UXNA 4GCVA 1XDSA 3GWZA 5LHGA 2A07F 5E20A 3BJ6A 3I59B 4NB5A 3BWGA 3CLOA 2Q8KA 2XAHA 2HKOA 2V9VA 3KFWX 5LBQA 2NS0A 3KLNA 4HLXA 1J59A 4OINF 3QP5A 4IHSA 3H92A 5HVQC 4N9HA 5D6FA 2BE5F 1K78B 2Y75A 4MTEA 2EV0A 1IXSB 1MJBA 2EFQA 1YLFA 4EGZA 4GYGA 2QUFA 5F64A 1VTNC 4P96A 3IL2A 2Z3YA 3ZP5A 4LLNA 1U5TA 4ENKA 3GF2A 4EJOA 3ZMDA 2ZXJA 4CICA 1MDMA 4HF2A 3O2PE 1IN5A 4JQFA 1UFMA 3DF8A 5K5OA 4YFXF 5TRDA 4Q4ZF 5L3DA 2DQLA 1FY7A 5LGUA 1FZPB 5HLGA 4YFKF 1KGSA 5ILVA 3G3ZA 1ON2A 1X3UA 2GQQA 3ISPA 2DI3A 2QVOA 4ENNA 3LQQA 1GVJA 2O8XA 4HQMA 5IT9Z 1Y0UA 3R6SA 4B09A 5CVVA 1V3FA 4L9TA 2DPUA 3IKVA 2A69F 4UVCA 3V8JA 2HZTA 3T0YA 2MLKA 3L7WA 4HV5A 2D1VA 3MCZA 5ICGA 1S3JA 3NQOA 2PFBA 1RI7A 5E18F 5EEHA 4ASNA 1XSVA 1WQ2A 4H0EA 2QBYB 1STZA 1D3YA 4EJTA 1BC7C 1ZREA 2RC4A 1R36A 1RUNA 1REPC 1O3QA 3GFIA 1TLHB 3JSOA 1QPMA 1ZHFA 5DEQA 2RN7A 3V7CA 1LNWA 2ACJA 4U88A 2HDCA 1YYVA 3C3WA 5JHUA 3BPVA 2K02A 2M8EA 1SD7A 1R7JA 2OA4A 5CLSA 4KIGA 1JGSA 2KIMA 1TQPA 3GLXA 2JRTA 4N9IA 1J75A 3W6KB 4OIOF 2FU4A 1QNTA 4E70A 1R1TA 5JVTA 4DQ2A 2JZYA 3R0AA 5CVJA 4DNCA 4L5JA 4A0ZA 1JHFA 1ODDA 5LLQA 1LB2A 4M9ZA 1TQIA 1R00A 1XB4A 2DAOA 4HYEA 1P2FA 1P92A 1XD7A 2YR2A 1Z05A 2RQPA 4LK0F 1HW2A 3KEOA 2P6TA 3VB2A 2LKPA 3FXQA 4G6DA 3DV8A 3KP6A 3CJNA 2QQ9A 1I1GA 1NHAA 5HOOA 1BI3A 2LF7A 3IWFA 4CXFA 1F5TA 2CQKA 4IVNA 3F23A 3E6MA 1MJAA 1DPRA 5BPDA 1D8KA 1J5YA 3R0JA 3U1DA 1KYZA 3BDDA 3GXOA 3V8KA 3R4KA 1J7KA 1ZN2A 2FMLA 3DQVC 4GYIA 3DPLC 2CGPA 3P9CA 3H3UA 2KKOA 5IT9K 1W5TA 1ZRFA 4TV7A 2FF4A 4Q48A 5D5UB 2EK5A 5BQTA 2YX4A 3RTRA 3KE2A 3QOPA 4RGRA 4HW0A 1AWCA 2IP2A 5DD8A 3ZMZA 4U0WA 5BS6A 5D4SA 2FOKA 4GGGA 1KQ8A 1YQAA 4M6XA 1W7PD 1B6AA 2YPRA 5FFXA 3B73A 2O3FA 3CUQB 1GXPA 3O3KA 3L9FA 1LDJA 1IAWA 2GZWA 1FPQA 5LHHA 3ERED 2XAGA 2ESHA 1XCBA 3KP5A 4ZZLA 3TDZC 1FX7A 3IRRA 1ZG1A 3J80Z 4NHJA 2G7UA 4IHTA 1T38A 3LSTA 1J2XA 2ZMEA 5DDGA 3FXRA 5AIPA 4ZYHA 2EV6A 4AVPA 1SMTA 2DLLA 5BMZA 3PQKA 2MLGA 2O0YA 2EFOA 2UXXA 2C6YA 5HS9A 4ZZDA 1UCRA 2XASA 2KRFA 2V79A 4WWCA 1WI9A 1XSDA 3LQRA 3KETA 1RZ4A 2QQAA 5DCFA 1WKMA 3J81K 2FSWA 3TO9A 3ZMSA 2COMA 1IXCA 2GIVA 1TW2A 2FBKA 2IPQX 3BPXA 3HHHA 2PMHA 3U2RA 5JR3A 2JTVA 1XMAA 3F8FA 3TQNA 3RYRA 1BI0A 3ECOA 1I1SA 4LB5A 1P4XA 3QU3A 2EA2A 3ZMUA 2IA2A 2XAJA 4BQAA 2L3DA 1WWXA 3FM5A 4BYYA 2M45A 5E8IA 3MZHA 5ILSA 5JFRA 5TJJA 2VOPA 4KT5C 4AIHA 1CF7A 1OMIA 1R1VA 3B02A 4A5MA 1T98A 2STTA 5JI6A 3TKYA 2BBYA 1FBSA 5AONA 1QGPA 2Z5UA 4LLLA 2VE8A 3ZMTA 1QZYA 3NEUA 5A2QZ 4RB0A 4PDKA 3QRFF 5FO5A 3SFZA 1K6OA 3V8LA 3P7NA 1U5TB 2K27A 4EV0A 5HS8A 1MDMB 1LVAA 3BZ6A 3VOEA 4LK1F 3E5QA 5KK1A 2PQ8A 5FLXZ 1ZAOA 2M1BA 2ZJ2A 5LRSA 2H94A 4WXCA 2P5VA 3F8CA 4QWQA 1G3TA 4IRHA 3F8NA 2R7FA 5CVUA 1KQ9A 2LNBA 2LSOA 2P4WA 3QPHA 4WXHA 3K1PA 5ICEA 1YO5C 5CYVA 3I53A 1FC3A 4WX9A 3N97A 1I27A 1L3LA 3HHGA 3K0LA 2P8TA 3TGNA 2P5KA 2DT5A 1Z6RA 4OIQF 1YS7A 4U0VA 4B8XA 3JAMK 3LAJA 5D8KB 4G7OF 4ENMA 1HSTA 1R1UA 3WGIA 3IHUA 2Z9OA 4I02A 4FT8A 1E17A 2E1NA 3JTHA 3VEPA 4WF2A 3SZTA 1PDNC 3BJAA 3MFKA 4MGRA 3DPTA 3ZMVA 3U9GA 2IT0A 1UHWA 4MQ9F 2QWWA 1DUXC 3HTSB 4R8HA 4LJZF 3WTXC 2Z33A 5E8GA 1U2WA 2OD5A 4WXDA 1KU2A 3F22A 1OKRA 1BIAA 4K2EA 2W24A 4KN7X 3TDUC 1QQIA 5L3GA 2FMYA 5H6QA 1K79A 1LDDA 4I01A 1TNTA 3BROA 3WGGA 2HS5A 1ON1A 2OQGA 4A12A 5F6FA 2B0LA 2FXAA 1TTYA 2GA1A 4YIFA 2V1UA 4LG0A 3WTYC 4Z2YA 2FA5A 3FM3A 1L0OC 2PMUA 2L01A 4O6JA 4EJUA 1MJ9A 1KU7A 2MH2A 2ZBKA 3KP3A 2ZO4A 2LF8A 5KVRA 2UZKA 3REOA 3F3XA 5DUKA 2DPDA 2M5WA 5E17F 3QAHA 3CO7C 2XHKA 2ISZA 4HDUA 1E2XA 4CYDA 5A2QK 1B4AA 3M8FA 1ZLKA 2STWA 2PG4A 4L9VA 2PJPA 3GFLA 3LFKA 1RIOH 4UVBA 1KYWA 1USSA 2FQ3A 4A0YA 4XBFA 1HW1A 2IJLA 1YFHA 4AD9A 1OYIA 5FLXK 3V4GA 2CG4A 1AOYA 4A6EA 4ESBA 2QZ8A 4UHTA 2RVCA 1LJ9A 3QPTA 3WTTC 1HKQA 3L09A 5E1ZB 1A04A 1FOKA 2A6EF 4BHCA 3T8RA 6PAXA 2ZKZA 3OOPA 4LFUA 2NRAC 3E5XA 4M72A 1F4KA 2MH9A 4PZJA 5DD4A 5ED4A 2V6CA 4YIIA 4A2UA 4HBLA 1YIOA 3ELKA 3AAFA 5F1RA 2P7CB 1G6NA 3DEUA 2E7XA 1V4RA 3CO6C 5DV5A 1ZYRF 4IPAA 2ZFWA 2XROA 2GAUA 5IT3A 5K1YA 4I0BA 2OU2A 3RPUA 3EDPA 2VBWA 3GYHX 1G3YA 1K78A 2XIGA 3HSRA 4OOIA 3E6CC 1OR7A 4PGHA 1O3TA 1H9GA 1FYLA 4D0PA 1R23A 1S8NA 4HX4A 4P55A 4HV6A 3CUQC 1ONVA 2PLYA 2V1DA 4Q47A 3GEZA 1F1ZA 1W4MA 2XKPA 4BHBA 2ZMEB 1Z9CA 2K86A 3RDIA 5BPIA 3DKWA 4CGZA 3FHZA 4A0XA 2ISYA 2O03A 1GXQA 2YX7A 1P4WA 2VXZA 2KJBA 4G7HF 4EJWA 2UXNA 1ZLJA 4I09A 2OBPA 4EGYA 3IRQA 3LA7A 3F21A 2FE3A 3CTAA 1MGTA 1IN7A 2OQRA 1FNNA 2R3SA 1EV7A 5J8FA 2HTSA 5HDGA 4L0YB 2GXGA 1WSUA 3RI4A 3LAPA 1MKMA 1O7LA 2E7WA 2FNAA 1QBJA 3F8BA 1W5SA 5LHIA 3HYIA 2DK8A 4FX4A 2KIUA 1YW7A 2EFNA 3BOQA 1B59A 1IUYA 4R79A 2F2EA 2XV4S 3COAC 3FMRA 2QBYA 4HQEA 4RB3C 4BAYA 3BJOA 1UHMA 5K5RA 4I0AA 3HSEA 2HFHA 3OV8A 1D5VA 4UV9A 4AIKA 2FRHA 5ERIA 1CF7B 4LD5A 1J9IA 2IW5A 5CVRA 5HDNA 3TO6A 1U8RA 5DCMB 2DK5A 2RV8A 3M7GA 5J6XA 1QZZA 3HRMA 3TOAA 5FD5A 4HX7A 4L9JA 4P9FA 2XAQA 3L2CA 2O6GE 1MZBA 1H9TA 2DQRA 3MAJA 4XSXF 1BIBA 1IZ1A 2OZUA 1QO0D 1P4AA 3WU1B 4HLYA 3SXYA 1XGSA 1LEAA 2PI0A 2YU3A 2GXBA 4L5IA 5FFZA 4KNYA 1EH7A 3W6JB 1ZARA 4JBAA 2Q0OA 3MQ0A 1DDNA 1BN5A 4EVIA 5D4RA 5D6EA 1Q1HA 2JPBA 3HTUA 2M30A 2HYGD 2OAZA 3R61A 3RKWA 4A6DA 4ZYEA 4I2OA 1XGOA 3WTSC 3FZVA 4CHUA 4M6YA 1KU9A 4Q5SF 1BC8C 3I64A 1D8JA 1FP1D 2F5EA 3RJPA 2IA1A 3RKXA 1U3EM 2VBYA 4OMYA 2WC2A 3CDHA 1ZH5A 2F5FA 3WTZA 4MEYF 2CFXA 1O3SA 1SD4A 4BXUA 4ENJA 3K1NA 1CGPA 3DFGA 1FWZA 1B9MA 3KLOA 4L9NA 2VOOA 4M9XA 4HA8A 3WE3A 4OIRF 1FYMA 2VONA 3FX3A 2W84A 5CJ9A 3F72A 2FBHA 2R7DA 4KFCA 1HBXG 1FLIA 2AS5F 4S05A 1K7AA 3IC7A 2DW4A 2H6CA 3Q5FA 5D5VB 1BOAA 1TQMA 3SZPA 1KA8A 2EA4A 2KIFA 4CZZA 3Q9SA 3CUQA 3RPQA 1XGMA 3S2WA 1FYKA 2X4HA 3CUOA 5E1WA 2ELHA 2VC0A 4IRIA 2HWVA 2Q2EA 1RUOA 2BYVE 1SFXA 1T6SA 4EM0B 3WTUC 4HDVA 1I6XA 1USTA 4WCGA 4RGUA 4IF4A 2WWYA 2P5LC 1RNLA 3M8EA 3K69A 3F8MA 4LGWA 4HZFA 1FT9A 3J80K 3FMSA 3WTVC 2MD5A 3M1EA 2YSRA 3ABTA 4I7HA 5ICCA 2J5OA 4KDPA 3ZQ7A 1R22A 2HOEA 2HR3A 4MNUA 1H0MA 3QU6A 2CSOA 1P6RA 1SD6A 1W7PA 4WK8F 2QM3A 2MBFA 4XRFA 4BHPA 2H27A 2O61A 3WU0A 2IRFG 1FSHA 3MZYA 4LB6B 2ZNZA 5LEJA 4IJAA 2D45A 4UUVA 4Y17A 1KU3A 4O5VA 3GO5A 1SFUA 3HIFA 1HKTA 2P6SA 2Y48A 2QENA 3C1DA 1SMYF 3FMQA 4CO8A 3N4MA 4U7DA 1FP2A 5L3EA 1OYWA 1SD5A 1B1BA 2VBZA 3MWMA 3SQNA 2KJCA 1FBUA 1ZG3A 4RAZA 2IA0A 5DYMA 5LEKA 3EYIA 3MEXA 3DXJF 4ZYDA 4A5NA 1O3RA 3EUHA 5D5XB 2W85A 2WTEA 2F5CA 1B9NA 1KQ0A 4P5OA 3TO7A 2ESNA 2MC3A 3P9KA 2EWNA 3FXUA 2P7VB 2A3SA 4EM2A 2PN6A 3T1BA 1XCVA 3HOSA 4M73A 2BGCA 3Q9VA 1XGNA 1LDKB 2EFWA 1FBQA 1SFEA 2AXLA 1C0WA 3GZ6A 4KMUX 5D5WB 2HKXA 4EMSA 2JPCA 1F9NA 5L3CA 3LWFA 4HF0A 1HW5A 2ETHA 1YW9A 4KN4X 3V7SA 2H09A 1G4DA 2TDXA 2L4AA 3RYPA 1GHCA 1Z91A 3KZYA 2K4JA 3K2ZA 1EH6A 3DP7A 3E97A 4OIPF 1PUEE 4GXOA 4UVAA 4GO1A 2VC1A 4Y15A 4PGGA 3C18A 1JXSA 5LGNA 3GFJA 4RGSA 2HQNA 2GA2A 2MA3A 3PFIA 2K4BA 3EQLF 2J5PA 3KZZA 3ZN1A 5E1XA 3G73A 3ECHA 2A61A 2G9WA 3I59A 3I0TA 1O7FA 4MQVA 1ZGJA 4OMZA 4CDGA 4RGXA 2DO7A 3I54A 3ABUA 3HOTA 3F6OA 1TBXA 1BBYA 2FEZA 3T8TA 2EB7A 1T0FA 2W25A 1HQCA 2XUBA 3BY6A 1WRJA 3WODF 1ZRCA 4QLCU 4M9SA 4ON0A 2A6HF 1U78A 1EH8A 4MEXF 1R5GA 3GFMA 1OYYA 1PP8F 3H3ZA 5J8CA 2F5DA 3HRTA 4R1HA 4OU0A 4FX0A 4ZYGA 4MHGA 3TOBA 4KYWA 1FSEA 2A5YB 4IRGA 3C7JA 5FGMA 2JT1A 1ZRDA 5D8LB 2EV5A 4XLNF 1HKSA 1JE8A 2L54A 2H6BA 1UB9A 2OZ6A 4LLGF 2HYFA 3J81Z 2QYOA 4M74A 3K1MA 2HTJA 1BJAA 5H20A 2XAFA 5HS7A 1IF1A 3WTWC 2FBIA 4EJVA 3KEQA 3E6DA 4NQWA 4KMFA 3JSPA 1IN6A 2DBBA 2NAZA 2HGCA 2HQRA 2ADUA 2VN2A 1IXRC 2ZCWA 4S04A 2XRNA 3FWEA 3M9AA 4ESFA 4XSZF 2Y0MA 4G9YA 2NYXA 2L02A 3JW4A 1YS6A 3ML6A 1DPUA 3PQJA 3JTGA 3HRSA 2A68F 4IXAA 3EYYA 3GUDA 5CVIA 5BOXA 3T5XA 3WE2A 3D5LA 3GVAA 5LRRA 2RKHA 2VODA 2QQBA 3I58A 4RB1A 4U0YA 2EJRA 1MD0A 1ULYA 3GZ5A 1YTYA 4FHTA 4YFNF 4F7ZA 3QP6A 2M87A 2VT3A 3RIRA 2Z99A 3SHFA 3RKYA 3V7RA 1LQ1A 4KUMA 1U6GA 3HSFA 1S6LA 1BI2A 4EQQA 3ZN0A 1PP7U 5L3BA 2EFPA 1YW8A 2CO5A 2XVCA 1U5TC 3IKTA 4PCQA 4N0BA 1T2KA 2QLZA 4HOBA 5HLHA 1ZGAA 2IVMA 3E5UA 3JAMZ 3L00A 5FD6A 4ESJA 4KA4A 3LA3A 3LA2A 1DP7P 4P9UA 4G8XA 2VE9A 3KP2A 3O6BB 1G3WA 3VODA 5K5QA 3E6BA 1IRGA 2L4MA 3E3VA 3I71A 4ZH4F 4KICA 3EETA 2FNPA 4UNOA 1W7PB 1BM9A 2GWRA 4KIFA 4HAMA 2WV0A 2W57A 3ULQB 2LDUA 2PBIA 4YG2F 5ICFA 2RDPA 2NNYA 5ILUA 1S7OA 2HEOA 2G7HA 1YG2A 4I98B 2CW0F 3I5UA 2ZNYA 3ROUA 1T39A 4XLPF 2CWEA 2CYYA 4L0ZB 3F6VA 3KCCA 3KP4A 1LEBA 4UV8A 1TNSA 5FB2A 4HF1A 1OPCA 1IN4A 1IRFA 3NRVA 2PEXA 4G94A 4MTDA 1Z1DA 4RS8A 1BI1A 1J0RA 5AIQA 2DU9A 3K9TA 2RNJA 1Z6TA 3ZPLA 5HLIA 4RAYA 1JHHA 3WGHA 3I4PA 1R5HA 5DCMA 1HSJA 4G6QA 4LG0B 4HX8A 1XDUA 3HUGA 2UWMA 3BP8A 3GX4X 3GW2A 4KIBA 2XKOA 4BNCA 5EEGA 4AIJA 1G3SA 5H6RA 4U7BA 1IN8A 2BEOA 4O3MA 1R58A 4G7ZF 5DUIA 3P9IA 3D0SA 3KP7A 1ZG5A 4JK1X 4M71A 1IW7F 2NNNA 1I5ZA 2RGVA 1S7AA 5HDKA 1Z7UA 5LGTA 4Y13A 1O57A 2E1CA 5L3FA 4EM1A 2D2WA 2BV6A 1XSXA 2K7LA 3J7AO
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3HRU A;  1XN7 A;  4LMY A;  1HXD A;  1TW3 A;  4L18 B;  4ETS A;  3FF5 A;  1XMK A;  2X0L A;  2JSC A;  2D1H A;  2V1X A;  1SAX A;  1S29 A;  2DFI A;  2XGX A;  2VT2 A;  2VBX A;  3IWZ A;  3VFZ A;  4AWX B;  4BH9 A;  3R60 A;  4RB2 C;  3WG9 A;  2DTR A;  4UXN A;  4GCV A;  1XDS A;  3GWZ A;  5LHG A;  2A07 F;  5E20 A;  3BJ6 A;  3I59 B;  4NB5 A;  3BWG A;  3CLO A;  2Q8K A;  2XAH A;  2HKO A;  2V9V A;  3KFW X;  5LBQ A;  2NS0 A;  3KLN A;  4HLX A;  1J59 A;  4OIN F;  3QP5 A;  4IHS A;  3H92 A;  5HVQ C;  4N9H A;  5D6F A;  2BE5 F;  1K78 B;  2Y75 A;  4MTE A;  2EV0 A;  1IXS B;  1MJB A;  2EFQ A;  1YLF A;  4EGZ A;  4GYG A;  2QUF A;  5F64 A;  1VTN C;  4P96 A;  3IL2 A;  2Z3Y A;  3ZP5 A;  4LLN A;  1U5T A;  4ENK A;  3GF2 A;  4EJO A;  3ZMD A;  2ZXJ A;  4CIC A;  1MDM A;  4HF2 A;  3O2P E;  1IN5 A;  4JQF A;  1UFM A;  3DF8 A;  5K5O A;  4YFX F;  5TRD A;  4Q4Z F;  5L3D A;  2DQL A;  1FY7 A;  5LGU A;  1FZP B;  5HLG A;  4YFK F;  1KGS A;  5ILV A;  3G3Z A;  1ON2 A;  1X3U A;  2GQQ A;  3ISP A;  2DI3 A;  2QVO A;  4ENN A;  3LQQ A;  1GVJ A;  2O8X A;  4HQM A;  5IT9 Z;  1Y0U A;  3R6S A;  4B09 A;  5CVV A;  1V3F A;  4L9T A;  2DPU A;  3IKV A;  2A69 F;  4UVC A;  3V8J A;  2HZT A;  3T0Y A;  2MLK A;  3L7W A;  4HV5 A;  2D1V A;  3MCZ A;  5ICG A;  1S3J A;  3NQO A;  2PFB A;  1RI7 A;  5E18 F;  5EEH A;  4ASN A;  1XSV A;  1WQ2 A;  4H0E A;  2QBY B;  1STZ A;  1D3Y A;  4EJT A;  1BC7 C;  1ZRE A;  2RC4 A;  1R36 A;  1RUN A;  1REP C;  1O3Q A;  3GFI A;  1TLH B;  3JSO A;  1QPM A;  1ZHF A;  5DEQ A;  2RN7 A;  3V7C A;  1LNW A;  2ACJ A;  4U88 A;  2HDC A;  1YYV A;  3C3W A;  5JHU A;  3BPV A;  2K02 A;  2M8E A;  1SD7 A;  1R7J A;  2OA4 A;  5CLS A;  4KIG A;  1JGS A;  2KIM A;  1TQP A;  3GLX A;  2JRT A;  4N9I A;  1J75 A;  3W6K B;  4OIO F;  2FU4 A;  1QNT A;  4E70 A;  1R1T A;  5JVT A;  4DQ2 A;  2JZY A;  3R0A A;  5CVJ A;  4DNC A;  4L5J A;  4A0Z A;  1JHF A;  1ODD A;  5LLQ A;  1LB2 A;  4M9Z A;  1TQI A;  1R00 A;  1XB4 A;  2DAO A;  4HYE A;  1P2F A;  1P92 A;  1XD7 A;  2YR2 A;  1Z05 A;  2RQP A;  4LK0 F;  1HW2 A;  3KEO A;  2P6T A;  3VB2 A;  2LKP A;  3FXQ A;  4G6D A;  3DV8 A;  3KP6 A;  3CJN A;  2QQ9 A;  1I1G A;  1NHA A;  5HOO A;  1BI3 A;  2LF7 A;  3IWF A;  4CXF A;  1F5T A;  2CQK A;  4IVN A;  3F23 A;  3E6M A;  1MJA A;  1DPR A;  5BPD A;  1D8K A;  1J5Y A;  3R0J A;  3U1D A;  1KYZ A;  3BDD A;  3GXO A;  3V8K A;  3R4K A;  1J7K A;  1ZN2 A;  2FML A;  3DQV C;  4GYI A;  3DPL C;  2CGP A;  3P9C A;  3H3U A;  2KKO A;  5IT9 K;  1W5T A;  1ZRF A;  4TV7 A;  2FF4 A;  4Q48 A;  5D5U B;  2EK5 A;  5BQT A;  2YX4 A;  3RTR A;  3KE2 A;  3QOP A;  4RGR A;  4HW0 A;  1AWC A;  2IP2 A;  5DD8 A;  3ZMZ A;  4U0W A;  5BS6 A;  5D4S A;  2FOK A;  4GGG A;  1KQ8 A;  1YQA A;  4M6X A;  1W7P D;  1B6A A;  2YPR A;  5FFX A;  3B73 A;  2O3F A;  3CUQ B;  1GXP A;  3O3K A;  3L9F A;  1LDJ A;  1IAW A;  2GZW A;  1FPQ A;  5LHH A;  3ERE D;  2XAG A;  2ESH A;  1XCB A;  3KP5 A;  4ZZL A;  3TDZ C;  1FX7 A;  3IRR A;  1ZG1 A;  3J80 Z;  4NHJ A;  2G7U A;  4IHT A;  1T38 A;  3LST A;  1J2X A;  2ZME A;  5DDG A;  3FXR A;  5AIP A;  4ZYH A;  2EV6 A;  4AVP A;  1SMT A;  2DLL A;  5BMZ A;  3PQK A;  2MLG A;  2O0Y A;  2EFO A;  2UXX A;  2C6Y A;  5HS9 A;  4ZZD A;  1UCR A;  2XAS A;  2KRF A;  2V79 A;  4WWC A;  1WI9 A;  1XSD A;  3LQR A;  3KET A;  1RZ4 A;  2QQA A;  5DCF A;  1WKM A;  3J81 K;  2FSW A;  3TO9 A;  3ZMS A;  2COM A;  1IXC A;  2GIV A;  1TW2 A;  2FBK A;  2IPQ X;  3BPX A;  3HHH A;  2PMH A;  3U2R A;  5JR3 A;  2JTV A;  1XMA A;  3F8F A;  3TQN A;  3RYR A;  1BI0 A;  3ECO A;  1I1S A;  4LB5 A;  1P4X A;  3QU3 A;  2EA2 A;  3ZMU A;  2IA2 A;  2XAJ A;  4BQA A;  2L3D A;  1WWX A;  3FM5 A;  4BYY A;  2M45 A;  5E8I A;  3MZH A;  5ILS A;  5JFR A;  5TJJ A;  2VOP A;  4KT5 C;  4AIH A;  1CF7 A;  1OMI A;  1R1V A;  3B02 A;  4A5M A;  1T98 A;  2STT A;  5JI6 A;  3TKY A;  2BBY A;  1FBS A;  5AON A;  1QGP A;  2Z5U A;  4LLL A;  2VE8 A;  3ZMT A;  1QZY A;  3NEU A;  5A2Q Z;  4RB0 A;  4PDK A;  3QRF F;  5FO5 A;  3SFZ A;  1K6O A;  3V8L A;  3P7N A;  1U5T B;  2K27 A;  4EV0 A;  5HS8 A;  1MDM B;  1LVA A;  3BZ6 A;  3VOE A;  4LK1 F;  3E5Q A;  5KK1 A;  2PQ8 A;  5FLX Z;  1ZAO A;  2M1B A;  2ZJ2 A;  5LRS A;  2H94 A;  4WXC A;  2P5V A;  3F8C A;  4QWQ A;  1G3T A;  4IRH A;  3F8N A;  2R7F A;  5CVU A;  1KQ9 A;  2LNB A;  2LSO A;  2P4W A;  3QPH A;  4WXH A;  3K1P A;  5ICE A;  1YO5 C;  5CYV A;  3I53 A;  1FC3 A;  4WX9 A;  3N97 A;  1I27 A;  1L3L A;  3HHG A;  3K0L A;  2P8T A;  3TGN A;  2P5K A;  2DT5 A;  1Z6R A;  4OIQ F;  1YS7 A;  4U0V A;  4B8X A;  3JAM K;  3LAJ A;  5D8K B;  4G7O F;  4ENM A;  1HST A;  1R1U A;  3WGI A;  3IHU A;  2Z9O A;  4I02 A;  4FT8 A;  1E17 A;  2E1N A;  3JTH A;  3VEP A;  4WF2 A;  3SZT A;  1PDN C;  3BJA A;  3MFK A;  4MGR A;  3DPT A;  3ZMV A;  3U9G A;  2IT0 A;  1UHW A;  4MQ9 F;  2QWW A;  1DUX C;  3HTS B;  4R8H A;  4LJZ F;  3WTX C;  2Z33 A;  5E8G A;  1U2W A;  2OD5 A;  4WXD A;  1KU2 A;  3F22 A;  1OKR A;  1BIA A;  4K2E A;  2W24 A;  4KN7 X;  3TDU C;  1QQI A;  5L3G A;  2FMY A;  5H6Q A;  1K79 A;  1LDD A;  4I01 A;  1TNT A;  3BRO A;  3WGG A;  2HS5 A;  1ON1 A;  2OQG A;  4A12 A;  5F6F A;  2B0L A;  2FXA A;  1TTY A;  2GA1 A;  4YIF A;  2V1U A;  4LG0 A;  3WTY C;  4Z2Y A;  2FA5 A;  3FM3 A;  1L0O C;  2PMU A;  2L01 A;  4O6J A;  4EJU A;  1MJ9 A;  1KU7 A;  2MH2 A;  2ZBK A;  3KP3 A;  2ZO4 A;  2LF8 A;  5KVR A;  2UZK A;  3REO A;  3F3X A;  5DUK A;  2DPD A;  2M5W A;  5E17 F;  3QAH A;  3CO7 C;  2XHK A;  2ISZ A;  4HDU A;  1E2X A;  4CYD A;  5A2Q K;  1B4A A;  3M8F A;  1ZLK A;  2STW A;  2PG4 A;  4L9V A;  2PJP A;  3GFL A;  3LFK A;  1RIO H;  4UVB A;  1KYW A;  1USS A;  2FQ3 A;  4A0Y A;  4XBF A;  1HW1 A;  2IJL A;  1YFH A;  4AD9 A;  1OYI A;  5FLX K;  3V4G A;  2CG4 A;  1AOY A;  4A6E A;  4ESB A;  2QZ8 A;  4UHT A;  2RVC A;  1LJ9 A;  3QPT A;  3WTT C;  1HKQ A;  3L09 A;  5E1Z B;  1A04 A;  1FOK A;  2A6E F;  4BHC A;  3T8R A;  6PAX A;  2ZKZ A;  3OOP A;  4LFU A;  2NRA C;  3E5X A;  4M72 A;  1F4K A;  2MH9 A;  4PZJ A;  5DD4 A;  5ED4 A;  2V6C A;  4YII A;  4A2U A;  4HBL A;  1YIO A;  3ELK A;  3AAF A;  5F1R A;  2P7C B;  1G6N A;  3DEU A;  2E7X A;  1V4R A;  3CO6 C;  5DV5 A;  1ZYR F;  4IPA A;  2ZFW A;  2XRO A;  2GAU A;  5IT3 A;  5K1Y A;  4I0B A;  2OU2 A;  3RPU A;  3EDP A;  2VBW A;  3GYH X;  1G3Y A;  1K78 A;  2XIG A;  3HSR A;  4OOI A;  3E6C C;  1OR7 A;  4PGH A;  1O3T A;  1H9G A;  1FYL A;  4D0P A;  1R23 A;  1S8N A;  4HX4 A;  4P55 A;  4HV6 A;  3CUQ C;  1ONV A;  2PLY A;  2V1D A;  4Q47 A;  3GEZ A;  1F1Z A;  1W4M A;  2XKP A;  4BHB A;  2ZME B;  1Z9C A;  2K86 A;  3RDI A;  5BPI A;  3DKW A;  4CGZ A;  3FHZ A;  4A0X A;  2ISY A;  2O03 A;  1GXQ A;  2YX7 A;  1P4W A;  2VXZ A;  2KJB A;  4G7H F;  4EJW A;  2UXN A;  1ZLJ A;  4I09 A;  2OBP A;  4EGY A;  3IRQ A;  3LA7 A;  3F21 A;  2FE3 A;  3CTA A;  1MGT A;  1IN7 A;  2OQR A;  1FNN A;  2R3S A;  1EV7 A;  5J8F A;  2HTS A;  5HDG A;  4L0Y B;  2GXG A;  1WSU A;  3RI4 A;  3LAP A;  1MKM A;  1O7L A;  2E7W A;  2FNA A;  1QBJ A;  3F8B A;  1W5S A;  5LHI A;  3HYI A;  2DK8 A;  4FX4 A;  2KIU A;  1YW7 A;  2EFN A;  3BOQ A;  1B59 A;  1IUY A;  4R79 A;  2F2E A;  2XV4 S;  3COA C;  3FMR A;  2QBY A;  4HQE A;  4RB3 C;  4BAY A;  3BJO A;  1UHM A;  5K5R A;  4I0A A;  3HSE A;  2HFH A;  3OV8 A;  1D5V A;  4UV9 A;  4AIK A;  2FRH A;  5ERI A;  1CF7 B;  4LD5 A;  1J9I A;  2IW5 A;  5CVR A;  5HDN A;  3TO6 A;  1U8R A;  5DCM B;  2DK5 A;  2RV8 A;  3M7G A;  5J6X A;  1QZZ A;  3HRM A;  3TOA A;  5FD5 A;  4HX7 A;  4L9J A;  4P9F A;  2XAQ A;  3L2C A;  2O6G E;  1MZB A;  1H9T A;  2DQR A;  3MAJ A;  4XSX F;  1BIB A;  1IZ1 A;  2OZU A;  1QO0 D;  1P4A A;  3WU1 B;  4HLY A;  3SXY A;  1XGS A;  1LEA A;  2PI0 A;  2YU3 A;  2GXB A;  4L5I A;  5FFZ A;  4KNY A;  1EH7 A;  3W6J B;  1ZAR A;  4JBA A;  2Q0O A;  3MQ0 A;  1DDN A;  1BN5 A;  4EVI A;  5D4R A;  5D6E A;  1Q1H A;  2JPB A;  3HTU A;  2M30 A;  2HYG D;  2OAZ A;  3R61 A;  3RKW A;  4A6D A;  4ZYE A;  4I2O A;  1XGO A;  3WTS C;  3FZV A;  4CHU A;  4M6Y A;  1KU9 A;  4Q5S F;  1BC8 C;  3I64 A;  1D8J A;  1FP1 D;  2F5E A;  3RJP A;  2IA1 A;  3RKX A;  1U3E M;  2VBY A;  4OMY A;  2WC2 A;  3CDH A;  1ZH5 A;  2F5F A;  3WTZ A;  4MEY F;  2CFX A;  1O3S A;  1SD4 A;  4BXU A;  4ENJ A;  3K1N A;  1CGP A;  3DFG A;  1FWZ A;  1B9M A;  3KLO A;  4L9N A;  2VOO A;  4M9X A;  4HA8 A;  3WE3 A;  4OIR F;  1FYM A;  2VON A;  3FX3 A;  2W84 A;  5CJ9 A;  3F72 A;  2FBH A;  2R7D A;  4KFC A;  1HBX G;  1FLI A;  2AS5 F;  4S05 A;  1K7A A;  3IC7 A;  2DW4 A;  2H6C A;  3Q5F A;  5D5V B;  1BOA A;  1TQM A;  3SZP A;  1KA8 A;  2EA4 A;  2KIF A;  4CZZ A;  3Q9S A;  3CUQ A;  3RPQ A;  1XGM A;  3S2W A;  1FYK A;  2X4H A;  3CUO A;  5E1W A;  2ELH A;  2VC0 A;  4IRI A;  2HWV A;  2Q2E A;  1RUO A;  2BYV E;  1SFX A;  1T6S A;  4EM0 B;  3WTU C;  4HDV A;  1I6X A;  1UST A;  4WCG A;  4RGU A;  4IF4 A;  2WWY A;  2P5L C;  1RNL A;  3M8E A;  3K69 A;  3F8M A;  4LGW A;  4HZF A;  1FT9 A;  3J80 K;  3FMS A;  3WTV C;  2MD5 A;  3M1E A;  2YSR A;  3ABT A;  4I7H A;  5ICC A;  2J5O A;  4KDP A;  3ZQ7 A;  1R22 A;  2HOE A;  2HR3 A;  4MNU A;  1H0M A;  3QU6 A;  2CSO A;  1P6R A;  1SD6 A;  1W7P A;  4WK8 F;  2QM3 A;  2MBF A;  4XRF A;  4BHP A;  2H27 A;  2O61 A;  3WU0 A;  2IRF G;  1FSH A;  3MZY A;  4LB6 B;  2ZNZ A;  5LEJ A;  4IJA A;  2D45 A;  4UUV A;  4Y17 A;  1KU3 A;  4O5V A;  3GO5 A;  1SFU A;  3HIF A;  1HKT A;  2P6S A;  2Y48 A;  2QEN A;  3C1D A;  1SMY F;  3FMQ A;  4CO8 A;  3N4M A;  4U7D A;  1FP2 A;  5L3E A;  1OYW A;  1SD5 A;  1B1B A;  2VBZ A;  3MWM A;  3SQN A;  2KJC A;  1FBU A;  1ZG3 A;  4RAZ A;  2IA0 A;  5DYM A;  5LEK A;  3EYI A;  3MEX A;  3DXJ F;  4ZYD A;  4A5N A;  1O3R A;  3EUH A;  5D5X B;  2W85 A;  2WTE A;  2F5C A;  1B9N A;  1KQ0 A;  4P5O A;  3TO7 A;  2ESN A;  2MC3 A;  3P9K A;  2EWN A;  3FXU A;  2P7V B;  2A3S A;  4EM2 A;  2PN6 A;  3T1B A;  1XCV A;  3HOS A;  4M73 A;  2BGC A;  3Q9V A;  1XGN A;  1LDK B;  2EFW A;  1FBQ A;  1SFE A;  2AXL A;  1C0W A;  3GZ6 A;  4KMU X;  5D5W B;  2HKX A;  4EMS A;  2JPC A;  1F9N A;  5L3C A;  3LWF A;  4HF0 A;  1HW5 A;  2ETH A;  1YW9 A;  4KN4 X;  3V7S A;  2H09 A;  1G4D A;  2TDX A;  2L4A A;  3RYP A;  1GHC A;  1Z91 A;  3KZY A;  2K4J A;  3K2Z A;  1EH6 A;  3DP7 A;  3E97 A;  4OIP F;  1PUE E;  4GXO A;  4UVA A;  4GO1 A;  2VC1 A;  4Y15 A;  4PGG A;  3C18 A;  1JXS A;  5LGN A;  3GFJ A;  4RGS A;  2HQN A;  2GA2 A;  2MA3 A;  3PFI A;  2K4B A;  3EQL F;  2J5P A;  3KZZ A;  3ZN1 A;  5E1X A;  3G73 A;  3ECH A;  2A61 A;  2G9W A;  3I59 A;  3I0T A;  1O7F A;  4MQV A;  1ZGJ A;  4OMZ A;  4CDG A;  4RGX A;  2DO7 A;  3I54 A;  3ABU A;  3HOT A;  3F6O A;  1TBX A;  1BBY A;  2FEZ A;  3T8T A;  2EB7 A;  1T0F A;  2W25 A;  1HQC A;  2XUB A;  3BY6 A;  1WRJ A;  3WOD F;  1ZRC A;  4QLC U;  4M9S A;  4ON0 A;  2A6H F;  1U78 A;  1EH8 A;  4MEX F;  1R5G A;  3GFM A;  1OYY A;  1PP8 F;  3H3Z A;  5J8C A;  2F5D A;  3HRT A;  4R1H A;  4OU0 A;  4FX0 A;  4ZYG A;  4MHG A;  3TOB A;  4KYW A;  1FSE A;  2A5Y B;  4IRG A;  3C7J A;  5FGM A;  2JT1 A;  1ZRD A;  5D8L B;  2EV5 A;  4XLN F;  1HKS A;  1JE8 A;  2L54 A;  2H6B A;  1UB9 A;  2OZ6 A;  4LLG F;  2HYF A;  3J81 Z;  2QYO A;  4M74 A;  3K1M A;  2HTJ A;  1BJA A;  5H20 A;  2XAF A;  5HS7 A;  1IF1 A;  3WTW C;  2FBI A;  4EJV A;  3KEQ A;  3E6D A;  4NQW A;  4KMF A;  3JSP A;  1IN6 A;  2DBB A;  2NAZ A;  2HGC A;  2HQR A;  2ADU A;  2VN2 A;  1IXR C;  2ZCW A;  4S04 A;  2XRN A;  3FWE A;  3M9A A;  4ESF A;  4XSZ F;  2Y0M A;  4G9Y A;  2NYX A;  2L02 A;  3JW4 A;  1YS6 A;  3ML6 A;  1DPU A;  3PQJ A;  3JTG A;  3HRS A;  2A68 F;  4IXA A;  3EYY A;  3GUD A;  5CVI A;  5BOX A;  3T5X A;  3WE2 A;  3D5L A;  3GVA A;  5LRR A;  2RKH A;  2VOD A;  2QQB A;  3I58 A;  4RB1 A;  4U0Y A;  2EJR A;  1MD0 A;  1ULY A;  3GZ5 A;  1YTY A;  4FHT A;  4YFN F;  4F7Z A;  3QP6 A;  2M87 A;  2VT3 A;  3RIR A;  2Z99 A;  3SHF A;  3RKY A;  3V7R A;  1LQ1 A;  4KUM A;  1U6G A;  3HSF A;  1S6L A;  1BI2 A;  4EQQ A;  3ZN0 A;  1PP7 U;  5L3B A;  2EFP A;  1YW8 A;  2CO5 A;  2XVC A;  1U5T C;  3IKT A;  4PCQ A;  4N0B A;  1T2K A;  2QLZ A;  4HOB A;  5HLH A;  1ZGA A;  2IVM A;  3E5U A;  3JAM Z;  3L00 A;  5FD6 A;  4ESJ A;  4KA4 A;  3LA3 A;  3LA2 A;  1DP7 P;  4P9U A;  4G8X A;  2VE9 A;  3KP2 A;  3O6B B;  1G3W A;  3VOD A;  5K5Q A;  3E6B A;  1IRG A;  2L4M A;  3E3V A;  3I71 A;  4ZH4 F;  4KIC A;  3EET A;  2FNP A;  4UNO A;  1W7P B;  1BM9 A;  2GWR A;  4KIF A;  4HAM A;  2WV0 A;  2W57 A;  3ULQ B;  2LDU A;  2PBI A;  4YG2 F;  5ICF A;  2RDP A;  2NNY A;  5ILU A;  1S7O A;  2HEO A;  2G7H A;  1YG2 A;  4I98 B;  2CW0 F;  3I5U A;  2ZNY A;  3ROU A;  1T39 A;  4XLP F;  2CWE A;  2CYY A;  4L0Z B;  3F6V A;  3KCC A;  3KP4 A;  1LEB A;  4UV8 A;  1TNS A;  5FB2 A;  4HF1 A;  1OPC A;  1IN4 A;  1IRF A;  3NRV A;  2PEX A;  4G94 A;  4MTD A;  1Z1D A;  4RS8 A;  1BI1 A;  1J0R A;  5AIQ A;  2DU9 A;  3K9T A;  2RNJ A;  1Z6T A;  3ZPL A;  5HLI A;  4RAY A;  1JHH A;  3WGH A;  3I4P A;  1R5H A;  5DCM A;  1HSJ A;  4G6Q A;  4LG0 B;  4HX8 A;  1XDU A;  3HUG A;  2UWM A;  3BP8 A;  3GX4 X;  3GW2 A;  4KIB A;  2XKO A;  4BNC A;  5EEG A;  4AIJ A;  1G3S A;  5H6R A;  4U7B A;  1IN8 A;  2BEO A;  4O3M A;  1R58 A;  4G7Z F;  5DUI A;  3P9I A;  3D0S A;  3KP7 A;  1ZG5 A;  4JK1 X;  4M71 A;  1IW7 F;  2NNN A;  1I5Z A;  2RGV A;  1S7A A;  5HDK A;  1Z7U A;  5LGT A;  4Y13 A;  1O57 A;  2E1C A;  5L3F A;  4EM1 A;  2D2W A;  2BV6 A;  1XSX A;  2K7L A;  3J7A O; 
#chains in the Genus database with same CATH topology
 3HRU A;  1XN7 A;  4LMY A;  1HXD A;  1TW3 A;  3MKW B;  3IH4 A;  4L18 B;  4ETS A;  4HST A;  4C3H J;  2VJJ A;  3FF5 A;  3ZQF A;  1XMK A;  2X0L A;  5E3M A;  2JMW A;  2D1H A;  2JSC A;  2V1X A;  3AKZ A;  3GLL A;  3K4J A;  1YIT I;  2FD5 A;  1SAX A;  1VQL I;  1S29 A;  2DFI A;  3OL3 A;  2XGX A;  4XOP A;  2VT2 A;  2VBX A;  3IWZ A;  3VFZ A;  4AWX B;  4BH9 A;  3R60 A;  4RB2 C;  3G1O A;  1OJL A;  4B44 A;  5EGO B;  3WG9 A;  1JUM A;  1ZR2 A;  1HOM A;  2DTR A;  3OYM A;  4UXN A;  4GCV A;  2K3F A;  5C3E J;  2R7R A;  1XDS A;  3GWZ A;  5LHG A;  2VUM J;  2R0Q C;  3OL4 A;  5E20 A;  2A07 F;  5K7F A;  3OY9 A;  1WPK A;  2LBF A;  3BJ6 A;  3I59 B;  4NB5 A;  2MC4 A;  1RC9 A;  5J47 A;  3BWG A;  3CLO A;  2ZJQ F;  2Q8K A;  4NBQ A;  5HNH A;  2R7T A;  1FTZ A;  2XAH A;  1S5L C;  2HKO A;  2V9V A;  3KFW X;  5LBQ A;  1U9O A;  2NS0 A;  3KLN A;  1D0X A;  2RRE A;  4HLX A;  2VKV A;  1J59 A;  1FIP A;  5M5X J;  2L5Q A;  2JJ7 A;  3PNT A;  4OIN F;  3QP5 A;  3A0B C;  1YJ9 I;  4IHS A;  3BT9 A;  3H92 A;  3FIS A;  3GTJ J;  5K7Z A;  5HVQ C;  4N9H A;  2MYS A;  5D6F A;  2BE5 F;  3L2V A;  1K78 B;  2Y75 A;  1V5G A;  1LFP A;  2X51 A;  4MTE A;  2EV0 A;  1IXS B;  1MJB A;  4PFO A;  2NOG A;  2EFQ A;  3OYH A;  1YLF A;  1A6I A;  5GAD J;  4EGZ A;  3CES A;  2ECC A;  3BTJ A;  4GRI A;  4GYG A;  4BQO A;  3JRH A;  4Y33 A;  5E3L A;  2QUF A;  5F64 A;  2CRG A;  1VTN C;  4P96 A;  4M3F A;  3IL2 A;  2Z3Y A;  3ZP5 A;  4LLN A;  1E0E A;  1U5T A;  4ENK A;  3GF2 A;  4EJO A;  3ZMD A;  2ZXJ A;  3HOW J;  4CIC A;  1MDM A;  4HF2 A;  3O2P E;  1IN5 A;  2CQ7 A;  2CJJ A;  3S17 J;  4JQF A;  4RLQ A;  1UFM A;  3DF8 A;  2P81 A;  5K5O A;  4YFX F;  5TRD A;  4Q4Z F;  5L3D A;  2DQL A;  2NOJ B;  1FY7 A;  1LUJ B;  2CS3 A;  3QOE A;  5LGU A;  2A05 A;  3HOU J;  1MSF C;  3FXO A;  1B8I B;  1FZP B;  2DMU A;  2FJ1 A;  2ZME C;  1Y39 A;  4ZJZ A;  2L7F P;  5HLG A;  1PJR A;  1ZR4 A;  3VSK A;  4YFK F;  1KGS A;  5ILV A;  3G3Z A;  1ON2 A;  1X3U A;  2GQQ A;  1XX5 A;  3ISP A;  2DI3 A;  2QVO A;  4ENN A;  3LQQ A;  2VJ5 A;  2Y31 A;  4DJA A;  4E6K G;  1GVJ A;  2O8X A;  2Y2Z A;  3BTI A;  4HQM A;  4N4N B;  5IT9 Z;  2OV7 A;  1Y0U A;  2LKX A;  3R6S A;  3BCA A;  4B09 A;  5CVV A;  1V3F A;  1X58 A;  1XTA A;  4L9T A;  4FET A;  2DPU A;  1WJE A;  3IKV A;  2A69 F;  3PO2 J;  4UVC A;  3V8J A;  3BR5 A;  2HZT A;  2VPL A;  4B1R A;  3T0Y A;  2MLK A;  3L7W A;  4HV5 A;  3OYJ A;  3K70 C;  2D1V A;  3IUO A;  1J09 A;  4OWR B;  3MCZ A;  4CCM A;  2DJN A;  5TGT A;  3WHB A;  1OCZ H;  5ICG A;  2R5Z B;  1BR1 A;  1S3J A;  1YJW I;  3NQO A;  2IGN A;  2H1L A;  2PFB A;  5B1A H;  3B6A A;  2KRH A;  2VJ4 A;  1RI7 A;  3OIQ A;  5E18 F;  5EEH A;  4BEH B;  4ASN A;  1XSV A;  1WQ2 A;  4H0E A;  3I3L A;  1X19 A;  4DYQ A;  2VQH A;  2QBY B;  5E79 C;  1STZ A;  1D3Y A;  1TC3 C;  3CCY A;  1GLN A;  4EJT A;  1BC7 C;  1Y1V J;  4BE0 A;  1OCT C;  1ZRE A;  2RC4 A;  3K4K A;  5HOD A;  1RR7 A;  1R36 A;  3KEY A;  1RUN A;  1REP C;  2EIJ H;  4M3G A;  1O3Q A;  1QVT A;  1OCC H;  3GFI A;  1TLH B;  3JSO A;  4F92 B;  3TW6 A;  2ZSH B;  3K70 D;  2QSF X;  3DLL F;  1QPM A;  3G1L A;  4M3B A;  1ZHF A;  2LY1 A;  5DEQ A;  1JJ6 C;  2RN7 A;  3V7C A;  3GTM J;  3FHN A;  1TP4 A;  4RLF A;  1LNW A;  2X1C A;  2ACJ A;  5F0H A;  2M4K A;  4U88 A;  2HDC A;  3BG3 A;  1YYV A;  3C3W A;  4A3I J;  3IAS 2;  3S1N J;  5JHU A;  3BPV A;  2K02 A;  2M8E A;  1SD7 A;  3H9J A;  3M07 A;  3SJM A;  4CSW A;  1R7J A;  2OA4 A;  4KIS A;  5CLS A;  3KYL A;  3Q0W A;  4KIG A;  4J00 A;  2HOS A;  1JGS A;  2KIM A;  1YI2 I;  1TQP A;  3GLX A;  2JRT A;  1V55 H;  4N9I A;  1J75 A;  3W6K B;  4OIO F;  2QGU A;  2EH3 A;  4HPQ A;  2BY2 A;  2FU4 A;  1RRJ A;  1QNT A;  4E70 A;  2FX0 A;  1R1T A;  5JVT A;  2XC7 A;  2CW7 A;  2VPR A;  2DXI A;  5J40 A;  3DBH B;  4DQ2 A;  2JZY A;  2E1O A;  5FKK A;  1OLT A;  2DTZ A;  3R0A A;  5CVJ A;  4DNC A;  5J4V A;  2K9N A;  4L5J A;  4A0Z A;  4ZYA A;  1JHF A;  1ODD A;  2JVH A;  3MKZ A;  3VYR B;  5LLQ A;  1LB2 A;  2IGO A;  1MW7 A;  3ZQC A;  1Z3X A;  2ECB A;  4M9Z A;  1TQI A;  3HB9 A;  5LD2 C;  1R00 A;  4PJM A;  1FMV A;  3GZN B;  1XB4 A;  2DAO A;  4HYE A;  2HVR A;  1P2F A;  1P92 A;  3PNV A;  2BVM A;  1OCO H;  4DGW B;  5J3L A;  3DU6 A;  3HJE A;  3PO3 J;  1N75 A;  1XD7 A;  1Z05 A;  2YR2 A;  3DWL E;  3A01 A;  1O4X A;  4C2U A;  2JA6 J;  2RQP A;  4LK0 F;  1HW2 A;  3KEO A;  2P6T A;  2DT7 B;  3VB2 A;  3ZQH A;  3OYK A;  1B72 A;  3JR9 A;  2LKP A;  3LSJ A;  3FXQ A;  4G6D A;  1YX3 A;  3DV8 A;  3KP6 A;  2OUM A;  3CJN A;  1YIJ I;  2QQ9 A;  3A4C A;  1I1G A;  1NHA A;  1E3H A;  1VQ7 I;  2MGQ A;  2JA7 J;  1I3Q J;  3CDI A;  3CCV I;  5HOO A;  1VFC A;  3DTK A;  3OYC A;  1MBJ A;  1BI3 A;  3HC7 A;  2LF7 A;  3IWF A;  4CXF A;  1F5T A;  3ABK H;  3MN2 A;  3ONQ A;  2CQK A;  4E7S A;  4IVN A;  3E6M A;  3AG3 H;  3F23 A;  4BBS J;  1MJA A;  1DPR A;  5BPD A;  3M4O J;  2H8W A;  1BR4 A;  1W36 C;  2K3P A;  1D8K A;  1U9N A;  1J5Y A;  2AXT C;  2MSY A;  3R0J A;  3U1D A;  4IKF A;  2BXZ A;  1KYZ A;  3BDD A;  2R4G A;  2Z16 A;  3GXO A;  3BG9 A;  3V8K A;  1K61 A;  4BXX J;  3R4K A;  1J7K A;  2L0K A;  4BE2 A;  1ZN2 A;  2Z2S B;  2FML A;  2WAD A;  3DQV C;  3CF5 F;  3PSI A;  2GM4 A;  1WZ2 A;  1HA8 A;  3S2H J;  4GYI A;  2VB6 A;  3L2R A;  3DPL C;  2CGP A;  4A3J J;  2L9N A;  3P9C A;  3H3U A;  2KKO A;  3AG1 H;  3HKZ N;  5IT9 K;  1W5T A;  2KQR A;  1ZRF A;  4B48 A;  2K9S A;  4TV7 A;  4X0G A;  2FF4 A;  2V9P A;  4Q48 A;  5D5U B;  2EK5 A;  5BQT A;  2YX4 A;  3G4S I;  3RTR A;  3KE2 A;  2M2E A;  3QOP A;  4RGR A;  4HW0 A;  1AWC A;  2IP2 A;  5DD8 A;  2B7E A;  1MSE C;  4DZJ A;  3ZMZ A;  4U0W A;  5DM6 F;  3H0D A;  4AU7 A;  1IRZ A;  4FE4 A;  2CUJ A;  5BS6 A;  3CZ6 A;  1GV5 A;  5D4S A;  2FOK A;  2OJE D;  4GGG A;  3OS1 A;  4RMN A;  1HF0 A;  3Q0V A;  2X48 A;  1KQ8 A;  1POG A;  3LSR A;  1YQA A;  1D1B A;  2F6C A;  4M6X A;  3DBR B;  1W7P D;  2K9Q A;  3BG5 A;  1B6A A;  2YPR A;  1IRX A;  2HQ5 A;  5FFX A;  1WH5 A;  1X2N A;  3B73 A;  2O3F A;  3CUQ B;  1GXP A;  3O3K A;  5KAF C;  2EZH A;  2E1M C;  3L9F A;  1D1A A;  1LDJ A;  1IAW A;  2GZW A;  3HUG B;  1Y6I A;  1FPQ A;  4BJ6 C;  2F48 A;  5LHH A;  3CJT B;  4AID A;  2P0W A;  3ERE D;  2XAG A;  2DN0 A;  2ESH A;  1XCB A;  3KP5 A;  4ZZL A;  3TDZ C;  4D1Q A;  3D5S C;  5GTI C;  3HKZ A;  4CZC A;  1WI3 A;  1FX7 A;  3CCE I;  3IRR A;  1T8I A;  1ZG1 A;  2DOF A;  3J80 Z;  4E7J A;  2QSH X;  3CCS I;  1WJB A;  4NHJ A;  2G7U A;  4IHT A;  1T38 A;  3LST A;  4XLF A;  4IQ4 A;  1J2X A;  2M7A A;  3IH3 A;  1ZEL A;  2ZME A;  1FEX A;  1ETV A;  3FXR A;  5AIP A;  5DDG A;  4ZYH A;  1VND A;  2EV6 A;  2PMZ N;  2FQ4 A;  4AVP A;  1SMT A;  2DLL A;  1V54 H;  3PQK A;  4LIU A;  5EG0 B;  5BMZ A;  2MLG A;  2O0Y A;  2VKE A;  2EFO A;  2UXX A;  2C6Y A;  5HS9 A;  4ZZD A;  3HG9 A;  2QA4 I;  1UCR A;  2XAS A;  2KRF A;  2V79 A;  4WWC A;  4PK4 A;  2E5Z A;  3PL8 A;  2NVY J;  3S8P A;  1JKP C;  1WI9 A;  2OTL I;  1MMS A;  1XSD A;  2ZFU A;  2A5W A;  3LQR A;  2VAS A;  1TWF J;  3D5R C;  2KIQ A;  4EEF G;  3KET A;  2JQ7 A;  3BG7 A;  1IG7 A;  1RZ4 A;  1TWH J;  2QQA A;  3TW7 A;  3DLA A;  3IV5 A;  4FCY A;  5DCF A;  1WKM A;  4NUB A;  3J81 K;  2FSW A;  3TO9 A;  3ZMS A;  5JHF A;  3B6C A;  2COM A;  2R7S A;  1TT0 A;  1IXC A;  2GIV A;  4CCL A;  1TW2 A;  2FBK A;  4BKX A;  1ETX A;  1UMQ A;  2I10 A;  2IPQ X;  1K4S A;  3BPX A;  3JRC A;  3HHH A;  2HPI A;  1H8A C;  2PMH A;  2YS9 A;  2DMP A;  3MZ8 A;  3PJR A;  3U2R A;  1RET A;  2LK2 A;  5JR3 A;  2JTV A;  2ELJ A;  1XMA A;  3F8F A;  4OAZ A;  5J1U A;  2KRC A;  1BW6 A;  3RYR A;  3TQN A;  1BI0 A;  1YOV B;  3OS2 A;  3G71 I;  2KZG A;  3ECO A;  5HLT A;  2E2J J;  1I1S A;  4LB5 A;  1EJ9 A;  4QTR A;  1P4X A;  3UR3 C;  1UEL B;  2PMZ A;  3HPG A;  3QU3 A;  2EA2 A;  3UNG C;  3ZMU A;  2IA2 A;  2XAJ A;  5FLV A;  4BQA A;  4BUP A;  2L3D A;  1WWX A;  3GTQ J;  3FM5 A;  3LSM A;  4BYY A;  2M45 A;  3HM5 A;  4BJT A;  1Y0N A;  5E8I A;  3MZH A;  5ILS A;  3ZQQ A;  4BQN A;  5JFR A;  5TJJ A;  1ZKG A;  4HRI A;  3BZC A;  3NAR A;  3OR2 C;  2VOP A;  3MMY B;  3TP3 A;  4KT5 C;  3G6E I;  4AIH A;  5CQE A;  1CF7 A;  1YX5 A;  2WV1 A;  2HOA A;  3MKY B;  3M8J A;  1OMI A;  2KHM A;  4ITV A;  1R1V A;  3B02 A;  4A3B J;  3GCM A;  4A5M A;  1T98 A;  2STT A;  3OYL A;  2R7X A;  2WB1 N;  2TRT A;  5JI6 A;  2E2H J;  3TKY A;  2BBY A;  1FBS A;  5AON A;  1QGP A;  2Z5U A;  1U8B A;  1WGX A;  4LLL A;  4XOR A;  3S1M J;  2VE8 A;  3ZMT A;  1VF9 A;  1TL8 A;  1SFO J;  3CCQ I;  1QZY A;  1I6H J;  3NEU A;  2H1K A;  3CC7 I;  4S0H B;  2XF7 A;  3LMM A;  5A2Q Z;  1UG0 A;  4RB0 A;  4A69 C;  4PDK A;  1U0J A;  4PSW A;  4XN0 A;  3QRF F;  5FO5 A;  1KON A;  5BNG A;  3SFZ A;  3CP8 A;  2EIL H;  3QOD A;  1OR7 C;  3PSF A;  4QIW N;  4II2 A;  1UZC A;  1K6O A;  1FJL A;  3V8L A;  3P7N A;  4KJZ A;  3PNY A;  1U5T B;  1NK3 P;  2K27 A;  4EV0 A;  5HS8 A;  1AHD P;  1MDM B;  1LVA A;  1ETY A;  3BZ6 A;  3VOE A;  4LK1 F;  3E5Q A;  1X3W B;  5KK1 A;  4C3I J;  2W82 A;  4J19 A;  3RZO J;  5TIS C;  2PQ8 A;  3VYU B;  5FLX Z;  4E7I A;  3I4M J;  5EEA A;  1ZAO A;  2M1B A;  2M9H A;  2ZJ2 A;  3HPH A;  3SDG A;  4B3A A;  2BY3 A;  5GTH C;  1HDP A;  2V9K A;  5LRS A;  2H94 A;  3DPU A;  4WXC A;  3DKX A;  5IP6 A;  2QKL B;  2P5V A;  3F8C A;  2B63 J;  3HL2 A;  4QWQ A;  3RPU D;  4CCJ A;  1G3T A;  1QHH D;  1PVE A;  4IRH A;  4RDU A;  2OCC H;  3F8N A;  5F27 A;  1WCM J;  2R7F A;  5CVU A;  1KQ9 A;  2E36 A;  2LNB A;  2LSO A;  2P4W A;  3QPH A;  2IBD A;  4WXH A;  3K1P A;  2WY7 Q;  5ICE A;  2BHZ A;  2AQF A;  2HPM A;  1YO5 C;  5CYV A;  2IAI A;  3QWL A;  3I53 A;  1FC3 A;  4WX9 A;  1WJC A;  3N97 A;  1I27 A;  1L3L A;  1QHG A;  3HHG A;  1JUP A;  1XG1 A;  2F5V A;  2HZD A;  2P5K A;  2P8T A;  3K0L A;  3TGN A;  4Y7N J;  2DYR H;  2DT5 A;  1Z6R A;  3F9K A;  3FIW A;  1YJN I;  4UB8 C;  2IGM A;  4OIQ F;  1YS7 A;  2E34 A;  3FKI J;  5LFA A;  9ANT A;  4ZDO A;  4U0V A;  4B8X A;  3LSG A;  2VL8 A;  3JAM K;  3LAJ A;  5D8K B;  4NNJ A;  4G7O F;  2E60 A;  2XSJ C;  4ENM A;  1HST A;  1R1U A;  3WGI A;  3IHU A;  2Z9O A;  2BHY A;  4I02 A;  4V2G A;  2GIZ A;  4BXF A;  4ZDL A;  4FT8 A;  1E17 A;  2DOE A;  2L2O A;  2E1N A;  3JTH A;  3I56 I;  3HGG A;  4WF2 A;  3VEP A;  3I4N J;  3SZT A;  4XIC A;  1G59 A;  1PDN C;  1TT5 B;  3BJA A;  2NVQ J;  3MFK A;  3K4C A;  3BCB A;  3OSF A;  4MGR A;  2JA8 J;  3DPT A;  2DA2 A;  2LYC A;  2HXO A;  3U9G A;  3ZMV A;  2M0M A;  2IT0 A;  1UHW A;  4MQ9 F;  2QWW A;  1DUX C;  3HTS B;  4R8H A;  3ZOB A;  1QZE A;  1NG7 A;  3ASO H;  1R71 A;  4LJZ F;  3WTX C;  1NTC A;  3OIP A;  5E8G A;  2Z33 A;  1U2W A;  3CJQ B;  2OD5 A;  4WXD A;  4E7K A;  1KU2 A;  3P5J A;  2VQC A;  2LY2 A;  3F22 A;  3GTL J;  2MAB A;  4JX6 A;  2ID6 A;  1OKR A;  1BIA A;  4K2E A;  2MFZ A;  2CMP A;  3IP4 B;  2W24 A;  4AYB N;  2KZV A;  4KN7 X;  3TDU C;  2R7O A;  4AC0 A;  1NK2 P;  2ZJP F;  1QQI A;  4XKB A;  5L3G A;  1D1C A;  2FMY A;  5H6Q A;  1K79 A;  2ZC2 A;  1LDD A;  1SVO A;  4I01 A;  3JRF A;  1ZQ3 P;  3RQI A;  1TNT A;  3DU5 A;  3BRO A;  1Z0X A;  3WGG A;  5GPA A;  2HS5 A;  4MO7 A;  1IJW C;  1ON1 A;  4UUS B;  2OQG A;  4XOT A;  4A12 A;  1JTX A;  5F6F A;  4PJJ A;  2B0L A;  2FXA A;  3K7A J;  1TTY A;  2GA1 A;  1WJF A;  3ERM A;  4YIF A;  1X4P A;  2V1U A;  4LG0 A;  3WTY C;  4Z2Y A;  2FA5 A;  2L9S A;  3FM3 A;  1A5J A;  1L0O C;  2M0C A;  2PMU A;  4V19 K;  2L01 A;  3HZJ A;  3CD6 I;  4XKV A;  1AA7 A;  1MBH A;  3CQZ J;  4O6J A;  2BW3 A;  4EJU A;  1S72 I;  1MJ9 A;  3J7A Y;  2DCE A;  1KU7 A;  3AL0 B;  2XB0 X;  2MH2 A;  2ZBK A;  3AG4 H;  3KP3 A;  2ZO4 A;  2LF8 A;  1SVL A;  4M6V A;  5KVR A;  2UZK A;  4V2F A;  3REO A;  3F3X A;  2EBI A;  5DUK A;  2M5W A;  2DPD A;  5E17 F;  3QAH A;  3CO7 C;  2XHK A;  2ISZ A;  5IOY A;  4HDU A;  1E2X A;  4XID A;  4CYD A;  5A2Q K;  1B4A A;  4C9Y A;  4HG2 A;  1OCR H;  3M8F A;  3TMO A;  1ZLK A;  2STW A;  2KP6 A;  2PG4 A;  4L9V A;  2G0E A;  2PJP A;  3GFL A;  3LFK A;  4E7L A;  2WAF A;  1SC7 A;  4UVB A;  1RIO H;  1KYW A;  1USS A;  2VKH A;  3OYE A;  3CC2 I;  3O8G A;  4NQW B;  2FQ3 A;  1I50 J;  3ABM H;  4A0Y A;  3HDD A;  2WBM A;  2IEK A;  4XBF A;  5GAE J;  1HW1 A;  2IJL A;  1YFH A;  4AD9 A;  1OYI A;  5FLX K;  3V4G A;  1NH3 A;  2LLK A;  4D7M A;  2CG4 A;  1AOY A;  4A6E A;  4ESB A;  5F04 A;  2V26 A;  2QZ8 A;  2COB A;  5JLW A;  3FXK A;  4UHT A;  5EF6 A;  2RVC A;  2M4G A;  1FOX A;  1JGG A;  2CU7 A;  1LJ9 A;  1LFB A;  1MBF A;  3D1N I;  3QPT A;  3WTT C;  1HKQ A;  3L09 A;  5E1Z B;  1A04 A;  3DTI A;  1FOK A;  3C2B A;  3V42 A;  2A6E F;  4BHC A;  3T8R A;  6PAX A;  2K9L A;  2ZKZ A;  3OOP A;  4LFU A;  2NRA C;  3E5X A;  1WJ5 A;  4M72 A;  3GTG J;  1F4K A;  2MH9 A;  4PZJ A;  5DD4 A;  3W3C A;  5EGO A;  1S9H A;  5ED4 A;  2V6C A;  5F08 A;  4YII A;  2F4M B;  4A2U A;  4BS9 A;  4HBL A;  3OYB A;  5J1Y A;  1MMA A;  3FKJ A;  1YIO A;  3ELK A;  3AAF A;  5M3M J;  5F1R A;  2P7C B;  1V5E A;  4LIT A;  1G6N A;  3OSG A;  2CQN A;  3DEU A;  2E7X A;  1V4R A;  3CO6 C;  5DV5 A;  1IUF A;  4II3 A;  1ZYR F;  4IPA A;  2W48 A;  2ZFW A;  2R5Y A;  2VIX A;  2X6Y A;  2XRO A;  2GAU A;  3SYT A;  5IT3 A;  1ETK A;  3W2W A;  5J4Y A;  3H3V K;  1P7J A;  2EPF A;  5K1Y A;  4Z6Y A;  4I0B A;  1VQ6 I;  2LFB A;  2OU2 A;  2VXD A;  3RPU A;  5EZH A;  1ETQ A;  3EDP A;  1UHS A;  4N4O B;  3A03 A;  2VBW A;  3W2V A;  3BG6 A;  3GYH X;  1G3Y A;  2CUE A;  3CP2 A;  1K78 A;  2XIG A;  1Z21 A;  2M7B A;  3HSR A;  4OOI A;  3E6C C;  4GFB A;  1OR7 A;  4PGH A;  1O3T A;  1X4O A;  3KX2 A;  1H9G A;  1FYL A;  3PIO F;  1PYV A;  3JRB A;  4D0P A;  1IGN A;  1IDY A;  1TWA J;  5B66 C;  1R23 A;  2NVX J;  1S8N A;  4HX4 A;  1N78 A;  3A02 A;  2LC2 A;  4P55 A;  3ZQL A;  1LVK A;  4XON A;  4HV6 A;  3CUQ C;  1ONV A;  2DFE A;  1E3P A;  2PLY A;  2NXN B;  2V1D A;  4Q47 A;  4XMY A;  3ZGK A;  3GEZ A;  1F1Z A;  1VQ8 I;  3S2D J;  2DFF A;  2BXY A;  1MH3 A;  1W4M A;  2IS6 A;  5CQG A;  2XAU A;  4W1U A;  2XKP A;  4XR6 A;  4BHB A;  2ZME B;  1Z9C A;  2HYJ A;  4OAY A;  2K86 A;  2HVQ A;  3RDI A;  1WJD A;  5BPI A;  2LVS A;  3DKW A;  2ICW G;  4CGZ A;  4JP0 A;  3FHZ A;  2R7Q A;  4A0X A;  2ISY A;  2O03 A;  1GXQ A;  2YX7 A;  3BTC A;  1P4W A;  2VXZ A;  2KJB A;  1VQ5 I;  4G7H F;  3S3O A;  4UUT A;  4EJW A;  4UB6 C;  2UXN A;  1ZLJ A;  4I09 A;  2OBP A;  5DS9 A;  3OYI A;  4EGY A;  3IRQ A;  3LA7 A;  3QPS A;  3F21 A;  2FE3 A;  3CTA A;  1BW5 A;  1MGT A;  1RKW A;  4IL6 C;  1ITY A;  1IN7 A;  4IHV A;  1JJ8 C;  2GBY A;  3BR3 A;  2XSD C;  2OQR A;  1FNN A;  2R3S A;  2ZXH A;  1EV7 A;  5J8F A;  2HTS A;  2FOW A;  4HNV A;  2W00 A;  5HDG A;  3OOU A;  1YRN B;  4L0Y B;  2GXG A;  1WSU A;  4PUS A;  3RI4 A;  3LAP A;  3GTK J;  1ERD A;  1MKM A;  1R4N B;  1LPQ A;  5K7H A;  1O7L A;  4LG3 A;  2UV1 A;  2E7W A;  2XPV A;  2FNA A;  1ZGW A;  4C2M J;  2B9S A;  3H35 A;  4UY8 I;  1IV8 A;  1QBJ A;  2JWT A;  4HEA 2;  1WVR A;  1SFK A;  3F8B A;  2Y9Z A;  3H1C A;  1W5S A;  2I8D A;  5LHI A;  3OYG A;  1H88 C;  2LKS A;  3HYI A;  3PM1 A;  2OF7 A;  2ME6 A;  2DK8 A;  3ZXS A;  4FX4 A;  2N8G A;  2ME0 A;  2KIU A;  1AU7 A;  2O7O A;  1YW7 A;  2EFN A;  4BEH A;  3BOQ A;  1B59 A;  5FLM J;  3DEE A;  1IUY A;  4R79 A;  2F2E A;  2XV4 S;  3COA C;  1RKT A;  1W5C C;  5EJC A;  3L2W A;  3FMR A;  1PUF A;  3CC4 I;  2QBY A;  4HQE A;  4RB3 C;  4BAY A;  1MMD A;  1R6R A;  4XKW A;  1JUS A;  1SVM A;  1OQY A;  5GP9 A;  3BJO A;  2CV1 A;  4A3F J;  5IP9 J;  1UHM A;  5K5R A;  1ENH A;  3BQZ A;  2EIM H;  4I0A A;  3HSE A;  2HFH A;  3OV8 A;  1D5V A;  4UV9 A;  3CF2 A;  2NS8 A;  3GME A;  4AIK A;  2FRH A;  2LY9 A;  5ERI A;  1CF7 B;  4KT6 A;  4LD5 A;  1J9I A;  3CMM A;  2IW5 A;  5CPR B;  2QEX I;  5CVR A;  2ZXI A;  5HDN A;  1K83 J;  3X2Q H;  5B3S H;  4MFD A;  2LRD A;  2L9R A;  4IEJ A;  3TO6 A;  2NVU B;  1U8R A;  5DCM B;  2DK5 A;  1EF4 A;  2RV8 A;  3M7G A;  5J6X A;  4CUG A;  1QZZ A;  3OYF A;  2GOM A;  3HRM A;  3WHC A;  3ESW B;  3TOA A;  3NAU A;  5FD5 A;  3FXJ A;  5E3O A;  3JRE A;  4HX7 A;  3HOZ J;  4QPQ A;  4L9J A;  4RM3 A;  2QSG X;  3EUH C;  1A36 A;  2F4I A;  1E3O C;  5FRM A;  3M1C A;  5FRO A;  3SZG A;  5IYC J;  4P9F A;  2XAQ A;  1N25 A;  3L2C A;  2O6G E;  1EKE A;  2GLO A;  1MZB A;  4A93 J;  4B4C A;  5CKT A;  4M3E A;  1H9T A;  2DQR A;  2IXS A;  3MAJ A;  4XSX F;  1BIB A;  2HI3 A;  5KHD A;  3L1P A;  4HNT A;  1IZ1 A;  2OZU A;  1QO0 D;  2PJR B;  1P4A A;  3LSK A;  3WU1 B;  3OYN A;  4HLY A;  4IO9 F;  3SXY A;  1XGS A;  2X85 A;  1LEA A;  2PI0 A;  2YU3 A;  5HNF A;  2GXB A;  1JKQ C;  4L5I A;  5FFZ A;  3ZQG A;  3ZRG A;  1VQO I;  1EH7 A;  4KNY A;  3W6J B;  1ZAR A;  1ORK A;  4JBA A;  1MBK A;  2E2I J;  2Q0O A;  3FDY A;  3MQ0 A;  4IOC F;  2HOT A;  2R93 J;  2DA4 A;  1DDN A;  2M8G X;  3H36 A;  1BN5 A;  4EVI A;  4IOA F;  1I3A A;  3SEZ A;  5D4R A;  5D6E A;  1Q1H A;  4AM3 A;  4E4H A;  2EZI A;  2JPB A;  4X1E A;  3HTU A;  2M30 A;  2HYG D;  2OAZ A;  5EDN A;  3R61 A;  3RKW A;  2ID3 A;  3FXM A;  5DTD A;  4A6D A;  4ZYE A;  1QRY A;  2LD5 A;  4I2O A;  1XGO A;  3WTS C;  2DMN A;  3FZV A;  3KPH A;  2O8K A;  5FKM A;  3FBN B;  3OIO A;  4CHU A;  4M6Y A;  1WH7 A;  1KU9 A;  3JCU C;  2KDZ A;  3W6V A;  4Q5S F;  1BR2 A;  2DA7 A;  2DJI A;  2AHQ A;  1BC8 C;  3I64 A;  1D8J A;  1FP1 D;  2F5E A;  3RJP A;  2IA1 A;  3RKX A;  4PJ0 C;  4I76 A;  1U3E M;  2KLO A;  3LNQ A;  4HSR A;  2VBY A;  4OMY A;  4M3D A;  2WC2 A;  3CDH A;  1ZH5 A;  3MVP A;  3K2A A;  4XRM A;  2F5F A;  3WTZ A;  2W7N A;  4MEY F;  2BVL A;  3WG7 H;  1FIA A;  2LBF B;  2YU9 J;  1Y8R B;  2CFX A;  4I6Z A;  1O3S A;  2WY8 Q;  4IHX A;  1SD4 A;  1R5I D;  2JK3 A;  4BXU A;  1WJA A;  4ENJ A;  3K1N A;  1CGP A;  4U87 A;  3DFG A;  1FWZ A;  1B9M A;  3KLO A;  1SAU A;  1QA6 A;  2CH0 A;  3HOY J;  3I9V 2;  1TWG J;  4L9N A;  4KIT B;  2VOO A;  1X1A A;  2XGD A;  3A0H C;  4M9X A;  2LG4 A;  1T95 A;  1G2H A;  4HA8 A;  1WFX A;  1IO2 A;  3WE3 A;  1F43 A;  3K4M A;  1W0T A;  4OIR F;  1FYM A;  2EQR A;  2VON A;  3FX3 A;  1R49 A;  5FKN A;  4MIM A;  2W84 A;  5CJ9 A;  3F72 A;  3CCR I;  3K10 A;  2HDD A;  2FBH A;  1IC8 A;  2R7D A;  4KFC A;  1T0F C;  5GPC A;  1HBX G;  1FLI A;  1MNM C;  1Z3Y A;  4P1W A;  4S05 A;  1K7A A;  2AS5 F;  3IC7 A;  2E1M B;  2CV0 A;  2QF7 A;  4BBR J;  2DW4 A;  2GOX B;  4EAT A;  3A1Y A;  3K4B A;  2H6C A;  3OS0 A;  3Q5F A;  2DA1 A;  2V4J C;  1DU0 A;  5D5V B;  1FOW A;  4IHW A;  1VQK I;  1BOA A;  1TQM A;  3SZP A;  1KA8 A;  2EA4 A;  2KIF A;  2OCE A;  3RQ4 A;  4CZZ A;  4D7N A;  3BTL A;  3Q9S A;  3CUQ A;  3RPQ A;  3HOV J;  4DIQ A;  4A3G J;  3DKY A;  1XGM A;  4XL9 A;  3S2W A;  1FYK A;  4D5F A;  3S14 J;  2X4H A;  4L5E A;  3CUO A;  1ZTR A;  2BW3 B;  3E7L A;  1YHQ I;  4GDF A;  5M3F J;  5E1W A;  2ELH A;  5GAG J;  1GDT A;  4MFE A;  3TED A;  1HLV A;  2VC0 A;  2W4S A;  2X9D A;  1UAA A;  4IRI A;  3C2G A;  4JYK A;  2HWV A;  1F36 A;  2Q2E A;  1RUO A;  2BYV E;  1SFX A;  1VI0 A;  2X6X A;  3QYB A;  1T6S A;  4EM0 B;  4LIV A;  3A2K A;  3WTU C;  3J7Z I;  4HDV A;  5KCM A;  1OIS A;  2E19 A;  1KZH A;  5F1J A;  1I6X A;  3OYD A;  2WB1 A;  3LFU A;  1UST A;  4WCG A;  1HDD C;  4XQF A;  5C44 J;  2LOO A;  4RGU A;  4IF4 A;  3JRG A;  2WWY A;  2P5L C;  1RNL A;  3EPZ A;  3M8E A;  4DYC A;  4A3D J;  3LOC A;  1BOB A;  4E7H A;  3K69 A;  3F8M A;  4LGW A;  2DA6 A;  1FTT A;  2OC6 A;  4HZF A;  1W1W E;  4LOC A;  1FT9 A;  3J80 K;  4YIR X;  2XPU A;  1X1P A;  3JRD A;  3CME I;  3FMS A;  3E1S A;  3WTV C;  2MG4 A;  2MD5 A;  3OR1 C;  3M1E A;  2L7K A;  5IPA A;  2YSR A;  3ABT A;  4I7H A;  3S3M A;  4Y3O A;  5ICC A;  2J5O A;  4KDP A;  3ZQ7 A;  2KT0 A;  1R22 A;  2HOE A;  4B43 A;  2HR3 A;  4MNU A;  1H0M A;  3QU6 A;  5IY5 H;  2CSO A;  1P6R A;  1SD6 A;  3SFI A;  3VPR A;  3K4N A;  2JVG A;  1W7P A;  4NC8 A;  4XNF A;  4BGD A;  4WK8 F;  2QM3 A;  1LKX A;  2MBF A;  4XRF A;  4BHP A;  3S1Q J;  4BU2 A;  2H27 A;  2O61 A;  3HXL A;  1IDZ A;  1AKH A;  3WU0 A;  2IRF G;  1FSH A;  3K6G A;  1XPX A;  2LP0 A;  3MZY A;  1K4T A;  4LB6 B;  2ZNZ A;  5IYD J;  5LEJ A;  1MBG A;  3CMY A;  4B47 A;  4IJA A;  2D45 A;  4UUV A;  4Y17 A;  1KU3 A;  4O5V A;  3GO5 A;  5B1B H;  3FK7 A;  1S7E A;  1SFU A;  3FK6 A;  4NDL A;  3HIF A;  1TWC J;  1HKT A;  2P6S A;  2Y48 A;  1MBE A;  2QEN A;  3AFH A;  1SMY F;  3C1D A;  4QPO A;  4PFP A;  4QSH A;  4DBQ A;  3DEW A;  4F91 B;  1T33 A;  1I39 A;  2UUZ A;  3FMQ A;  4CO8 A;  3CMA I;  2L9V A;  3N4M A;  4U7D A;  3H5R A;  2QKM B;  5M5W J;  1FP2 A;  5L3E A;  4NC6 A;  3RKQ A;  1OYW A;  1SD5 A;  1T08 B;  4FE7 A;  1B1B A;  2VBZ A;  3MWM A;  3SQN A;  2Y9Y A;  1QVU A;  2KJC A;  3M3Y J;  1FBU A;  2A6T A;  2LH9 A;  1ZG3 A;  3U21 A;  3JRI A;  3LSH A;  4C30 A;  3OYA A;  4AUX A;  2I5U A;  2R5Y B;  4RAZ A;  5J1R A;  3ZQI A;  1HC8 A;  2ZB9 A;  2IA0 A;  5DYM A;  4A3M J;  5LEK A;  2KMU A;  3EYI A;  3MEX A;  3DXJ F;  1A6Q A;  4ZTF A;  4ZYD A;  2EZK A;  4A5N A;  3BZK A;  4CYC A;  1O3R A;  3EUH A;  1A31 A;  3S15 J;  2IS4 A;  3DTE A;  5D5X B;  2W85 A;  3MD2 A;  2WTE A;  1LE8 A;  2F5C A;  1B9N A;  3H9G A;  1KQ0 A;  4XN3 A;  4P5O A;  3S32 A;  1H89 C;  3TO7 A;  2ESN A;  4CCO A;  4DBR A;  2MC3 A;  4IHY A;  3H9Q A;  1RR8 C;  3P9K A;  3WU2 C;  1ZK8 A;  5IYB J;  2EWN A;  3FXU A;  3PFY A;  1MH4 A;  2P7V B;  2A3S A;  2FUG 2;  4DW6 A;  4EM2 A;  2XF6 A;  2K5C A;  2PN6 A;  3T1B A;  1XCV A;  3HOS A;  3L2U A;  4M73 A;  2BGC A;  2JUC A;  3Q9V A;  3NWT A;  1XGN A;  3VDX A;  1LDK B;  3ZCO A;  2Y30 A;  2TCT A;  1OFC X;  2EFW A;  1FBQ A;  1SFE A;  2AXL A;  3A01 B;  1C0W A;  1P9Q C;  2EZL A;  2LMD A;  3GZ6 A;  3BC8 A;  1ACI A;  4KMU X;  1N77 A;  1B72 B;  5D5W B;  2XDV A;  2HKX A;  2AQE A;  4AYB A;  2V6E A;  2JUG A;  4EMS A;  2JPC A;  1F9N A;  2DYS H;  5L3C A;  3VSL A;  3H0G J;  1DGW Y;  1X3Z B;  1R9T J;  1DQU A;  3LWF A;  4HF0 A;  2XF5 A;  5FKO A;  5C4J J;  1HW5 A;  2ETH A;  1YW9 A;  4KN4 X;  4IX7 A;  4A3E J;  1QPI A;  3PUF A;  3SEQ A;  3V7S A;  2H09 A;  1G4D A;  4C3J J;  2TDX A;  4I99 C;  2L4A A;  2BY1 A;  2R7W A;  3RYP A;  1GHC A;  1DGR M;  1Z91 A;  3LSI A;  2WAE A;  1Q1V A;  2K4J A;  3KZY A;  3K2Z A;  1EH6 A;  1Y56 A;  2ELK A;  3DP7 A;  2XGC A;  3EUA A;  4YEJ A;  3E97 A;  4OIP F;  3ZR8 X;  1JTY A;  4A3L J;  4AVZ A;  1PUE E;  2E71 A;  4GXO A;  4UVA A;  4GO1 A;  2VC1 A;  4Y15 A;  3DBL B;  2O9L A;  3CCM I;  5F0C A;  4PGG A;  3C18 A;  1JXS A;  1OCP A;  5LGN A;  3GFJ A;  4H4K C;  1VQP I;  1APL C;  4F93 B;  2X1E A;  4RGS A;  2HNH A;  3ASN H;  3EUK L;  2HQN A;  2GA2 A;  1VZ0 A;  1Z77 A;  5JLX A;  2GXA A;  2MA3 A;  3PFI A;  1EA3 A;  2K4B A;  3EQL F;  2J5P A;  3KZZ A;  4XKC A;  2LTP A;  3ZN1 A;  1PUF B;  5E1X A;  5DM7 F;  5B5E C;  3G73 A;  3ECH A;  2V7F A;  1LFU P;  1X1D A;  2A61 A;  2G9W A;  2HU9 A;  3I59 A;  4BDY A;  3I0T A;  5E3N A;  2H8R A;  1O7F A;  4G6T B;  4MQV A;  3ABL H;  2NVT J;  4FAS D;  1UG2 A;  1ZGJ A;  4OMZ A;  3BR1 A;  4CDG A;  4RGX A;  3RCO A;  2DO7 A;  3I54 A;  2BOL A;  2DDB A;  4CCK A;  2XGE A;  3ABU A;  3GBG A;  3F6O A;  3S93 A;  3HOT A;  4X6A J;  1Z67 A;  1TBX A;  1BBY A;  2FEZ A;  3T8T A;  2EB7 A;  1T0F A;  2W25 A;  1HQC A;  3CJR B;  4PJN A;  1MIJ A;  3S3N A;  2K85 A;  2E5N A;  2XUB A;  4BY7 J;  3BY6 A;  4DZP A;  1WRJ A;  3WOD F;  3U1K A;  1ZRC A;  4XK4 A;  2JA2 A;  4QLC U;  2ZXW H;  4M9S A;  4ON0 A;  2A6H F;  1U78 A;  1EH8 A;  4MEX F;  2L7Z A;  1R5G A;  3GFM A;  2F4O B;  1OYY A;  4YEL A;  3L2Q A;  2VQG A;  5KAI C;  1PP8 F;  2MW8 A;  2QCO A;  4XLH A;  4UUS A;  2QQ8 A;  3H3Z A;  3NWS A;  5J8C A;  2F5D A;  3HRT A;  2EIK H;  1D0Y A;  4OU0 A;  4FX0 A;  4R1H A;  4ZYG A;  4XLC A;  4MHG A;  3TOB A;  1IV6 A;  1FSE A;  4KYW A;  2A5Y B;  5IP7 J;  1XC5 A;  2KDO A;  1V5F A;  3IH2 A;  3C7J A;  4IRG A;  4ANJ A;  1YE9 A;  5FGM A;  2JT1 A;  1ZRD A;  1DU6 A;  5D8L B;  2EV5 A;  2YUS A;  4XLN F;  2K9M A;  1HKS A;  1XMX A;  1JE8 A;  2RAE A;  2L54 A;  2HVS A;  2H6B A;  4BDZ A;  1UB9 A;  2OZ6 A;  4LLG F;  1GT0 C;  2HYF A;  1GV2 A;  2RNG A;  2LR8 A;  3J81 Z;  1B8I A;  3HEF A;  2QYO A;  2O5R A;  2Y0S N;  3CLQ A;  4M74 A;  2CUF A;  1RES A;  3K1M A;  4Y4R A;  2X6W A;  2HTJ A;  1BJA A;  3CDL A;  4C2T A;  2Q1Z B;  5H20 A;  4IQJ A;  2CFO A;  2XAF A;  2DDA A;  2VKD A;  3KYD B;  5HS7 A;  3QPL A;  2W1O A;  1JKO C;  1IF1 A;  3WTW C;  2FBI A;  3G1M A;  5F0F A;  4CA0 A;  3HGY A;  4EJV A;  2IS2 A;  3KEQ A;  3E6D A;  2WAQ N;  4NQW A;  4KMF A;  4XM3 A;  3UKG A;  3JSP A;  4XLA A;  1IN6 A;  3TBI A;  1VQN I;  2DBB A;  2KIS A;  2NAZ A;  1TZL A;  2HGC A;  2HQR A;  2OTJ I;  4JX4 A;  4RBO A;  3KYC B;  2ADU A;  2ZSI B;  2VN2 A;  3KZI C;  2R5Z A;  1IXR C;  2ZCW A;  4S04 A;  2XRN A;  3F0C A;  3FWE A;  3M9A A;  3BR6 A;  4ESF A;  2VI6 A;  2X1D A;  4XSZ F;  1D0Z A;  2Y0M A;  4G9Y A;  2NYX A;  1R4M B;  5IOZ A;  1X2M A;  3JRA A;  1K6Y A;  2L02 A;  2MD0 A;  3JW4 A;  1YS6 A;  3G2B A;  3ML6 A;  1DPU A;  3PQJ A;  4RAG A;  3OWT A;  2EIN H;  2BZT A;  3JTG A;  2E35 A;  3HRS A;  2A68 F;  4IXA A;  4ZDP A;  3EYY A;  3GUD A;  1JI8 A;  3O8H A;  2HQA A;  3Q3S A;  5CVI A;  2Y0S A;  1VQ4 I;  3RZD J;  4RA2 A;  2VLA A;  4A3C J;  5BOX A;  3CCU I;  5EYR A;  3T5X A;  3WE2 A;  3PUB A;  3D5L A;  1WHU A;  4G12 A;  4BQQ A;  3GVA A;  5LRR A;  2RKH A;  2JRM A;  2VOD A;  5KNL A;  1NG6 A;  3VWB A;  2QQB A;  3I58 A;  4RB1 A;  3W2A A;  4U0Y A;  2EJR A;  2XPW A;  1X1C A;  4D5C A;  4IZZ A;  2DA3 A;  1MD0 A;  2JN6 A;  2WAQ A;  3OMY A;  3I55 I;  3MKL A;  1W36 D;  1ULY A;  3GZ5 A;  1JT6 A;  2LRE A;  4FHT A;  1YTY A;  2Z1D A;  4YFN F;  1VQM I;  4ZC3 A;  4F7Z A;  3QP6 A;  4BY1 J;  2M87 A;  2K40 A;  2VT3 A;  2R7V A;  3RIR A;  3IAM 2;  2Z99 A;  3PIP F;  3SHF A;  1D5Y A;  3HBL A;  2R7Z J;  3RKY A;  3H5A A;  3V7R A;  4JX5 A;  3BQY A;  1LQ1 A;  2KPM A;  4KUM A;  2JA5 J;  1U6G A;  3HSF A;  3KIO A;  1S6L A;  1RPW A;  3N05 A;  1BI2 A;  4E7Z A;  2DMQ A;  3FBI B;  3H5N A;  4EQQ A;  3ZN0 A;  4FIS A;  4FTH A;  1PP7 U;  5L3B A;  2EFP A;  3BLY A;  3LL7 A;  1YW8 A;  2M34 A;  2CO5 A;  2HDW A;  2XVC A;  1U5T C;  2OPT A;  3IKT A;  4PCQ A;  5FKL A;  2RQQ A;  4N0B A;  4BJ5 C;  1T2K A;  2CW8 A;  1MMN A;  2Q2E B;  2WA0 A;  4YRV A;  3J7Y J;  2QLZ A;  4HOB A;  1UJ8 A;  5HLH A;  4F55 A;  3CCL I;  1VQ9 I;  5GAH J;  4Y52 J;  3Q0U A;  1ZGA A;  2IVM A;  3E5U A;  2BY0 A;  3JAM Z;  3L00 A;  5FD6 A;  2XB5 A;  4ESJ A;  1BA5 A;  2XRL A;  2DOD A;  1XS9 A;  3SDB A;  3DCF A;  4KA4 A;  2X6O A;  1GVD A;  3QYF A;  1QU3 A;  3LA3 A;  3GTO J;  3LA2 A;  1DP7 P;  4XRS G;  4P9U A;  4G8X A;  2VE9 A;  3KP2 A;  3O6B B;  1G3W A;  4F52 A;  4XLE A;  3VOD A;  3AG2 H;  5K5Q A;  2R92 J;  3E6B A;  1IRG A;  2L4M A;  1BJZ A;  3E3V A;  3I71 A;  2IS1 A;  1JKR C;  4ZH4 F;  5H2F C;  3GTP J;  1YRN A;  4DYR A;  1M1E B;  1SAN A;  4KIC A;  3EET A;  2FNP A;  4UNO A;  2DMT A;  2KL4 A;  2CQQ A;  1W7P B;  1BM9 A;  4JOM A;  2GWR A;  4KIF A;  4HAM A;  1AKH B;  2WV0 A;  2W57 A;  3BR2 A;  3ULQ B;  2LDU A;  2PBI A;  4YG2 F;  4RM2 A;  5ICF A;  2RDP A;  4BL0 B;  2NNY A;  1MNE A;  5ILU A;  3FXL A;  2IGK A;  3HOX J;  2R7U A;  1S7O A;  2HEO A;  1JT0 A;  2G7H A;  1YG2 A;  4I98 B;  2CW0 F;  4DOZ A;  3I5U A;  2ZNY A;  3ROU A;  1FOY A;  3TP0 A;  1T39 A;  1FMW A;  1BL0 A;  4XLP F;  2V1N A;  4NC7 A;  2L7M P;  2CWE A;  1T56 A;  2CYY A;  4MLO A;  5JVG F;  1MMG A;  1CQT A;  2CQX A;  2M3A A;  4L0Z B;  3S16 J;  3F6V A;  3KCC A;  3KP4 A;  1LEB A;  4UV8 A;  3RSN A;  1TNS A;  5FB2 A;  5C4X J;  4F3Q A;  4HF1 A;  1OPC A;  1IN4 A;  1IRF A;  4W97 A;  5M5Y J;  3NRV A;  1DP3 A;  2PEX A;  4G94 A;  4HNU A;  4MTD A;  1Z7L A;  4PJL A;  1Z1D A;  4RS8 A;  1ETW A;  1BI1 A;  3BR0 A;  1J0R A;  5AIQ A;  2DU9 A;  5FJ8 J;  3K9T A;  2VJI A;  2RNJ A;  1Z6T A;  4FQG A;  2CV2 A;  5HLI A;  3ZPL A;  4RAY A;  1X1B A;  1JHH A;  3WGH A;  4CYC B;  4XRS A;  1MND A;  1R5H A;  3I4P A;  4ABZ A;  5DCM A;  1HSJ A;  4G6Q A;  4ZTJ A;  1LE8 B;  4LG0 B;  4HX8 A;  1G8X A;  1XDU A;  3HUG A;  2NS7 A;  2ZJR F;  2UWM A;  2AO9 A;  3BP8 A;  3GX4 X;  4PSX A;  3GW2 A;  4KIB A;  4CCN A;  2XKO A;  4BNC A;  1GUU A;  1P7I A;  3QYE A;  5EEG A;  4AIJ A;  1G3S A;  2CUZ A;  1ETO A;  3VYS B;  5H6R A;  4U7B A;  2Y69 H;  4A3K J;  4CH7 A;  1HCR A;  1IN8 A;  3VYT B;  2BEO A;  2DA5 A;  2PX9 A;  4O3M A;  1R58 A;  4G7Z F;  3AL0 C;  5DUI A;  3P9I A;  2DFH A;  2D5V A;  3C2H A;  3E0J B;  1SEU A;  3D0S A;  2PJR A;  3LSP A;  3KP7 A;  1ZG5 A;  2DT6 A;  4JK1 X;  4M71 A;  5EG0 A;  1IW7 F;  2HXI A;  1W0U A;  2KFD A;  1A35 A;  2JSP A;  5FRN A;  4J01 A;  3S1R J;  2NNN A;  1I5Z A;  3TL4 X;  4BAC A;  2RGV A;  1S7A A;  5HDK A;  2VQL A;  5EZG A;  4B3X A;  3K4L A;  1Z7U A;  5LGT A;  4BE1 A;  4D9J A;  4Y13 A;  1O57 A;  2E1C A;  3QQA A;  5L3F A;  3CCJ I;  4EM1 A;  2DOA A;  1Y8Q B;  2D2W A;  4RAF A;  2BV6 A;  1XSX A;  1Y1W J;  2K7L A;  3J7A O; 
#chains in the Genus database with same CATH homology
 3HRU A;  1XN7 A;  4LMY A;  1HXD A;  1TW3 A;  4L18 B;  4ETS A;  3FF5 A;  1XMK A;  2X0L A;  2JSC A;  2D1H A;  2V1X A;  1SAX A;  1S29 A;  2DFI A;  2XGX A;  2VT2 A;  2VBX A;  3IWZ A;  3VFZ A;  4AWX B;  4BH9 A;  3R60 A;  4RB2 C;  3WG9 A;  2DTR A;  4UXN A;  4GCV A;  1XDS A;  3GWZ A;  5LHG A;  2A07 F;  5E20 A;  3BJ6 A;  3I59 B;  4NB5 A;  3BWG A;  3CLO A;  2Q8K A;  2XAH A;  2HKO A;  2V9V A;  3KFW X;  5LBQ A;  2NS0 A;  3KLN A;  4HLX A;  1J59 A;  4OIN F;  3QP5 A;  4IHS A;  3H92 A;  5HVQ C;  4N9H A;  5D6F A;  2BE5 F;  1K78 B;  2Y75 A;  4MTE A;  2EV0 A;  1IXS B;  1MJB A;  2EFQ A;  1YLF A;  4EGZ A;  4GYG A;  2QUF A;  5F64 A;  1VTN C;  4P96 A;  3IL2 A;  2Z3Y A;  3ZP5 A;  4LLN A;  1U5T A;  4ENK A;  3GF2 A;  4EJO A;  3ZMD A;  2ZXJ A;  4CIC A;  1MDM A;  4HF2 A;  3O2P E;  1IN5 A;  4JQF A;  1UFM A;  3DF8 A;  5K5O A;  4YFX F;  5TRD A;  4Q4Z F;  5L3D A;  2DQL A;  1FY7 A;  5LGU A;  1FZP B;  5HLG A;  4YFK F;  1KGS A;  5ILV A;  3G3Z A;  1ON2 A;  1X3U A;  2GQQ A;  3ISP A;  2DI3 A;  2QVO A;  4ENN A;  3LQQ A;  1GVJ A;  2O8X A;  4HQM A;  5IT9 Z;  1Y0U A;  3R6S A;  4B09 A;  5CVV A;  1V3F A;  4L9T A;  2DPU A;  3IKV A;  2A69 F;  4UVC A;  3V8J A;  2HZT A;  3T0Y A;  2MLK A;  3L7W A;  4HV5 A;  2D1V A;  3MCZ A;  5ICG A;  1S3J A;  3NQO A;  2PFB A;  1RI7 A;  5E18 F;  5EEH A;  4ASN A;  1XSV A;  1WQ2 A;  4H0E A;  2QBY B;  1STZ A;  1D3Y A;  4EJT A;  1BC7 C;  1ZRE A;  2RC4 A;  1R36 A;  1RUN A;  1REP C;  1O3Q A;  3GFI A;  1TLH B;  3JSO A;  1QPM A;  1ZHF A;  5DEQ A;  2RN7 A;  3V7C A;  1LNW A;  2ACJ A;  4U88 A;  2HDC A;  1YYV A;  3C3W A;  5JHU A;  3BPV A;  2K02 A;  2M8E A;  1SD7 A;  1R7J A;  2OA4 A;  5CLS A;  4KIG A;  1JGS A;  2KIM A;  1TQP A;  3GLX A;  2JRT A;  4N9I A;  1J75 A;  3W6K B;  4OIO F;  2FU4 A;  1QNT A;  4E70 A;  1R1T A;  5JVT A;  4DQ2 A;  2JZY A;  3R0A A;  5CVJ A;  4DNC A;  4L5J A;  4A0Z A;  1JHF A;  1ODD A;  5LLQ A;  1LB2 A;  4M9Z A;  1TQI A;  1R00 A;  1XB4 A;  2DAO A;  4HYE A;  1P2F A;  1P92 A;  1XD7 A;  2YR2 A;  1Z05 A;  2RQP A;  4LK0 F;  1HW2 A;  3KEO A;  2P6T A;  3VB2 A;  2LKP A;  3FXQ A;  4G6D A;  3DV8 A;  3KP6 A;  3CJN A;  2QQ9 A;  1I1G A;  1NHA A;  5HOO A;  1BI3 A;  2LF7 A;  3IWF A;  4CXF A;  1F5T A;  2CQK A;  4IVN A;  3F23 A;  3E6M A;  1MJA A;  1DPR A;  5BPD A;  1D8K A;  1J5Y A;  3R0J A;  3U1D A;  1KYZ A;  3BDD A;  3GXO A;  3V8K A;  3R4K A;  1J7K A;  1ZN2 A;  2FML A;  3DQV C;  4GYI A;  3DPL C;  2CGP A;  3P9C A;  3H3U A;  2KKO A;  5IT9 K;  1W5T A;  1ZRF A;  4TV7 A;  2FF4 A;  4Q48 A;  5D5U B;  2EK5 A;  5BQT A;  2YX4 A;  3RTR A;  3KE2 A;  3QOP A;  4RGR A;  4HW0 A;  1AWC A;  2IP2 A;  5DD8 A;  3ZMZ A;  4U0W A;  5BS6 A;  5D4S A;  2FOK A;  4GGG A;  1KQ8 A;  1YQA A;  4M6X A;  1W7P D;  1B6A A;  2YPR A;  5FFX A;  3B73 A;  2O3F A;  3CUQ B;  1GXP A;  3O3K A;  3L9F A;  1LDJ A;  1IAW A;  2GZW A;  1FPQ A;  5LHH A;  3ERE D;  2XAG A;  2ESH A;  1XCB A;  3KP5 A;  4ZZL A;  3TDZ C;  1FX7 A;  3IRR A;  1ZG1 A;  3J80 Z;  4NHJ A;  2G7U A;  4IHT A;  1T38 A;  3LST A;  1J2X A;  2ZME A;  5DDG A;  3FXR A;  5AIP A;  4ZYH A;  2EV6 A;  4AVP A;  1SMT A;  2DLL A;  5BMZ A;  3PQK A;  2MLG A;  2O0Y A;  2EFO A;  2UXX A;  2C6Y A;  5HS9 A;  4ZZD A;  1UCR A;  2XAS A;  2KRF A;  2V79 A;  4WWC A;  1WI9 A;  1XSD A;  3LQR A;  3KET A;  1RZ4 A;  2QQA A;  5DCF A;  1WKM A;  3J81 K;  2FSW A;  3TO9 A;  3ZMS A;  2COM A;  1IXC A;  2GIV A;  1TW2 A;  2FBK A;  2IPQ X;  3BPX A;  3HHH A;  2PMH A;  3U2R A;  5JR3 A;  2JTV A;  1XMA A;  3F8F A;  3TQN A;  3RYR A;  1BI0 A;  3ECO A;  1I1S A;  4LB5 A;  1P4X A;  3QU3 A;  2EA2 A;  3ZMU A;  2IA2 A;  2XAJ A;  4BQA A;  2L3D A;  1WWX A;  3FM5 A;  4BYY A;  2M45 A;  5E8I A;  3MZH A;  5ILS A;  5JFR A;  5TJJ A;  2VOP A;  4KT5 C;  4AIH A;  1CF7 A;  1OMI A;  1R1V A;  3B02 A;  4A5M A;  1T98 A;  2STT A;  5JI6 A;  3TKY A;  2BBY A;  1FBS A;  5AON A;  1QGP A;  2Z5U A;  4LLL A;  2VE8 A;  3ZMT A;  1QZY A;  3NEU A;  5A2Q Z;  4RB0 A;  4PDK A;  3QRF F;  5FO5 A;  3SFZ A;  1K6O A;  3V8L A;  3P7N A;  1U5T B;  2K27 A;  4EV0 A;  5HS8 A;  1MDM B;  1LVA A;  3BZ6 A;  3VOE A;  4LK1 F;  3E5Q A;  5KK1 A;  2PQ8 A;  5FLX Z;  1ZAO A;  2M1B A;  2ZJ2 A;  5LRS A;  2H94 A;  4WXC A;  2P5V A;  3F8C A;  4QWQ A;  1G3T A;  4IRH A;  3F8N A;  2R7F A;  5CVU A;  1KQ9 A;  2LNB A;  2LSO A;  2P4W A;  3QPH A;  4WXH A;  3K1P A;  5ICE A;  1YO5 C;  5CYV A;  3I53 A;  1FC3 A;  4WX9 A;  3N97 A;  1I27 A;  1L3L A;  3HHG A;  3K0L A;  2P8T A;  3TGN A;  2P5K A;  2DT5 A;  1Z6R A;  4OIQ F;  1YS7 A;  4U0V A;  4B8X A;  3JAM K;  3LAJ A;  5D8K B;  4G7O F;  4ENM A;  1HST A;  1R1U A;  3WGI A;  3IHU A;  2Z9O A;  4I02 A;  4FT8 A;  1E17 A;  2E1N A;  3JTH A;  3VEP A;  4WF2 A;  3SZT A;  1PDN C;  3BJA A;  3MFK A;  4MGR A;  3DPT A;  3ZMV A;  3U9G A;  2IT0 A;  1UHW A;  4MQ9 F;  2QWW A;  1DUX C;  3HTS B;  4R8H A;  4LJZ F;  3WTX C;  2Z33 A;  5E8G A;  1U2W A;  2OD5 A;  4WXD A;  1KU2 A;  3F22 A;  1OKR A;  1BIA A;  4K2E A;  2W24 A;  4KN7 X;  3TDU C;  1QQI A;  5L3G A;  2FMY A;  5H6Q A;  1K79 A;  1LDD A;  4I01 A;  1TNT A;  3BRO A;  3WGG A;  2HS5 A;  1ON1 A;  2OQG A;  4A12 A;  5F6F A;  2B0L A;  2FXA A;  1TTY A;  2GA1 A;  4YIF A;  2V1U A;  4LG0 A;  3WTY C;  4Z2Y A;  2FA5 A;  3FM3 A;  1L0O C;  2PMU A;  2L01 A;  4O6J A;  4EJU A;  1MJ9 A;  1KU7 A;  2MH2 A;  2ZBK A;  3KP3 A;  2ZO4 A;  2LF8 A;  5KVR A;  2UZK A;  3REO A;  3F3X A;  5DUK A;  2DPD A;  2M5W A;  5E17 F;  3QAH A;  3CO7 C;  2XHK A;  2ISZ A;  4HDU A;  1E2X A;  4CYD A;  5A2Q K;  1B4A A;  3M8F A;  1ZLK A;  2STW A;  2PG4 A;  4L9V A;  2PJP A;  3GFL A;  3LFK A;  1RIO H;  4UVB A;  1KYW A;  1USS A;  2FQ3 A;  4A0Y A;  4XBF A;  1HW1 A;  2IJL A;  1YFH A;  4AD9 A;  1OYI A;  5FLX K;  3V4G A;  2CG4 A;  1AOY A;  4A6E A;  4ESB A;  2QZ8 A;  4UHT A;  2RVC A;  1LJ9 A;  3QPT A;  3WTT C;  1HKQ A;  3L09 A;  5E1Z B;  1A04 A;  1FOK A;  2A6E F;  4BHC A;  3T8R A;  6PAX A;  2ZKZ A;  3OOP A;  4LFU A;  2NRA C;  3E5X A;  4M72 A;  1F4K A;  2MH9 A;  4PZJ A;  5DD4 A;  5ED4 A;  2V6C A;  4YII A;  4A2U A;  4HBL A;  1YIO A;  3ELK A;  3AAF A;  5F1R A;  2P7C B;  1G6N A;  3DEU A;  2E7X A;  1V4R A;  3CO6 C;  5DV5 A;  1ZYR F;  4IPA A;  2ZFW A;  2XRO A;  2GAU A;  5IT3 A;  5K1Y A;  4I0B A;  2OU2 A;  3RPU A;  3EDP A;  2VBW A;  3GYH X;  1G3Y A;  1K78 A;  2XIG A;  3HSR A;  4OOI A;  3E6C C;  1OR7 A;  4PGH A;  1O3T A;  1H9G A;  1FYL A;  4D0P A;  1R23 A;  1S8N A;  4HX4 A;  4P55 A;  4HV6 A;  3CUQ C;  1ONV A;  2PLY A;  2V1D A;  4Q47 A;  3GEZ A;  1F1Z A;  1W4M A;  2XKP A;  4BHB A;  2ZME B;  1Z9C A;  2K86 A;  3RDI A;  5BPI A;  3DKW A;  4CGZ A;  3FHZ A;  4A0X A;  2ISY A;  2O03 A;  1GXQ A;  2YX7 A;  1P4W A;  2VXZ A;  2KJB A;  4G7H F;  4EJW A;  2UXN A;  1ZLJ A;  4I09 A;  2OBP A;  4EGY A;  3IRQ A;  3LA7 A;  3F21 A;  2FE3 A;  3CTA A;  1MGT A;  1IN7 A;  2OQR A;  1FNN A;  2R3S A;  1EV7 A;  5J8F A;  2HTS A;  5HDG A;  4L0Y B;  2GXG A;  1WSU A;  3RI4 A;  3LAP A;  1MKM A;  1O7L A;  2E7W A;  2FNA A;  1QBJ A;  3F8B A;  1W5S A;  5LHI A;  3HYI A;  2DK8 A;  4FX4 A;  2KIU A;  1YW7 A;  2EFN A;  3BOQ A;  1B59 A;  1IUY A;  4R79 A;  2F2E A;  2XV4 S;  3COA C;  3FMR A;  2QBY A;  4HQE A;  4RB3 C;  4BAY A;  3BJO A;  1UHM A;  5K5R A;  4I0A A;  3HSE A;  2HFH A;  3OV8 A;  1D5V A;  4UV9 A;  4AIK A;  2FRH A;  5ERI A;  1CF7 B;  4LD5 A;  1J9I A;  2IW5 A;  5CVR A;  5HDN A;  3TO6 A;  1U8R A;  5DCM B;  2DK5 A;  2RV8 A;  3M7G A;  5J6X A;  1QZZ A;  3HRM A;  3TOA A;  5FD5 A;  4HX7 A;  4L9J A;  4P9F A;  2XAQ A;  3L2C A;  2O6G E;  1MZB A;  1H9T A;  2DQR A;  3MAJ A;  4XSX F;  1BIB A;  1IZ1 A;  2OZU A;  1QO0 D;  1P4A A;  3WU1 B;  4HLY A;  3SXY A;  1XGS A;  1LEA A;  2PI0 A;  2YU3 A;  2GXB A;  4L5I A;  5FFZ A;  4KNY A;  1EH7 A;  3W6J B;  1ZAR A;  4JBA A;  2Q0O A;  3MQ0 A;  1DDN A;  1BN5 A;  4EVI A;  5D4R A;  5D6E A;  1Q1H A;  2JPB A;  3HTU A;  2M30 A;  2HYG D;  2OAZ A;  3R61 A;  3RKW A;  4A6D A;  4ZYE A;  4I2O A;  1XGO A;  3WTS C;  3FZV A;  4CHU A;  4M6Y A;  1KU9 A;  4Q5S F;  1BC8 C;  3I64 A;  1D8J A;  1FP1 D;  2F5E A;  3RJP A;  2IA1 A;  3RKX A;  1U3E M;  2VBY A;  4OMY A;  2WC2 A;  3CDH A;  1ZH5 A;  2F5F A;  3WTZ A;  4MEY F;  2CFX A;  1O3S A;  1SD4 A;  4BXU A;  4ENJ A;  3K1N A;  1CGP A;  3DFG A;  1FWZ A;  1B9M A;  3KLO A;  4L9N A;  2VOO A;  4M9X A;  4HA8 A;  3WE3 A;  4OIR F;  1FYM A;  2VON A;  3FX3 A;  2W84 A;  5CJ9 A;  3F72 A;  2FBH A;  2R7D A;  4KFC A;  1HBX G;  1FLI A;  2AS5 F;  4S05 A;  1K7A A;  3IC7 A;  2DW4 A;  2H6C A;  3Q5F A;  5D5V B;  1BOA A;  1TQM A;  3SZP A;  1KA8 A;  2EA4 A;  2KIF A;  4CZZ A;  3Q9S A;  3CUQ A;  3RPQ A;  1XGM A;  3S2W A;  1FYK A;  2X4H A;  3CUO A;  5E1W A;  2ELH A;  2VC0 A;  4IRI A;  2HWV A;  2Q2E A;  1RUO A;  2BYV E;  1SFX A;  1T6S A;  4EM0 B;  3WTU C;  4HDV A;  1I6X A;  1UST A;  4WCG A;  4RGU A;  4IF4 A;  2WWY A;  2P5L C;  1RNL A;  3M8E A;  3K69 A;  3F8M A;  4LGW A;  4HZF A;  1FT9 A;  3J80 K;  3FMS A;  3WTV C;  2MD5 A;  3M1E A;  2YSR A;  3ABT A;  4I7H A;  5ICC A;  2J5O A;  4KDP A;  3ZQ7 A;  1R22 A;  2HOE A;  2HR3 A;  4MNU A;  1H0M A;  3QU6 A;  2CSO A;  1P6R A;  1SD6 A;  1W7P A;  4WK8 F;  2QM3 A;  2MBF A;  4XRF A;  4BHP A;  2H27 A;  2O61 A;  3WU0 A;  2IRF G;  1FSH A;  3MZY A;  4LB6 B;  2ZNZ A;  5LEJ A;  4IJA A;  2D45 A;  4UUV A;  4Y17 A;  1KU3 A;  4O5V A;  3GO5 A;  1SFU A;  3HIF A;  1HKT A;  2P6S A;  2Y48 A;  2QEN A;  3C1D A;  1SMY F;  3FMQ A;  4CO8 A;  3N4M A;  4U7D A;  1FP2 A;  5L3E A;  1OYW A;  1SD5 A;  1B1B A;  2VBZ A;  3MWM A;  3SQN A;  2KJC A;  1FBU A;  1ZG3 A;  4RAZ A;  2IA0 A;  5DYM A;  5LEK A;  3EYI A;  3MEX A;  3DXJ F;  4ZYD A;  4A5N A;  1O3R A;  3EUH A;  5D5X B;  2W85 A;  2WTE A;  2F5C A;  1B9N A;  1KQ0 A;  4P5O A;  3TO7 A;  2ESN A;  2MC3 A;  3P9K A;  2EWN A;  3FXU A;  2P7V B;  2A3S A;  4EM2 A;  2PN6 A;  3T1B A;  1XCV A;  3HOS A;  4M73 A;  2BGC A;  3Q9V A;  1XGN A;  1LDK B;  2EFW A;  1FBQ A;  1SFE A;  2AXL A;  1C0W A;  3GZ6 A;  4KMU X;  5D5W B;  2HKX A;  4EMS A;  2JPC A;  1F9N A;  5L3C A;  3LWF A;  4HF0 A;  1HW5 A;  2ETH A;  1YW9 A;  4KN4 X;  3V7S A;  2H09 A;  1G4D A;  2TDX A;  2L4A A;  3RYP A;  1GHC A;  1Z91 A;  3KZY A;  2K4J A;  3K2Z A;  1EH6 A;  3DP7 A;  3E97 A;  4OIP F;  1PUE E;  4GXO A;  4UVA A;  4GO1 A;  2VC1 A;  4Y15 A;  4PGG A;  3C18 A;  1JXS A;  5LGN A;  3GFJ A;  4RGS A;  2HQN A;  2GA2 A;  2MA3 A;  3PFI A;  2K4B A;  3EQL F;  2J5P A;  3KZZ A;  3ZN1 A;  5E1X A;  3G73 A;  3ECH A;  2A61 A;  2G9W A;  3I59 A;  3I0T A;  1O7F A;  4MQV A;  1ZGJ A;  4OMZ A;  4CDG A;  4RGX A;  2DO7 A;  3I54 A;  3ABU A;  3HOT A;  3F6O A;  1TBX A;  1BBY A;  2FEZ A;  3T8T A;  2EB7 A;  1T0F A;  2W25 A;  1HQC A;  2XUB A;  3BY6 A;  1WRJ A;  3WOD F;  1ZRC A;  4QLC U;  4M9S A;  4ON0 A;  2A6H F;  1U78 A;  1EH8 A;  4MEX F;  1R5G A;  3GFM A;  1OYY A;  1PP8 F;  3H3Z A;  5J8C A;  2F5D A;  3HRT A;  4R1H A;  4OU0 A;  4FX0 A;  4ZYG A;  4MHG A;  3TOB A;  4KYW A;  1FSE A;  2A5Y B;  4IRG A;  3C7J A;  5FGM A;  2JT1 A;  1ZRD A;  5D8L B;  2EV5 A;  4XLN F;  1HKS A;  1JE8 A;  2L54 A;  2H6B A;  1UB9 A;  2OZ6 A;  4LLG F;  2HYF A;  3J81 Z;  2QYO A;  4M74 A;  3K1M A;  2HTJ A;  1BJA A;  5H20 A;  2XAF A;  5HS7 A;  1IF1 A;  3WTW C;  2FBI A;  4EJV A;  3KEQ A;  3E6D A;  4NQW A;  4KMF A;  3JSP A;  1IN6 A;  2DBB A;  2NAZ A;  2HGC A;  2HQR A;  2ADU A;  2VN2 A;  1IXR C;  2ZCW A;  4S04 A;  2XRN A;  3FWE A;  3M9A A;  4ESF A;  4XSZ F;  2Y0M A;  4G9Y A;  2NYX A;  2L02 A;  3JW4 A;  1YS6 A;  3ML6 A;  1DPU A;  3PQJ A;  3JTG A;  3HRS A;  2A68 F;  4IXA A;  3EYY A;  3GUD A;  5CVI A;  5BOX A;  3T5X A;  3WE2 A;  3D5L A;  3GVA A;  5LRR A;  2RKH A;  2VOD A;  2QQB A;  3I58 A;  4RB1 A;  4U0Y A;  2EJR A;  1MD0 A;  1ULY A;  3GZ5 A;  1YTY A;  4FHT A;  4YFN F;  4F7Z A;  3QP6 A;  2M87 A;  2VT3 A;  3RIR A;  2Z99 A;  3SHF A;  3RKY A;  3V7R A;  1LQ1 A;  4KUM A;  1U6G A;  3HSF A;  1S6L A;  1BI2 A;  4EQQ A;  3ZN0 A;  1PP7 U;  5L3B A;  2EFP A;  1YW8 A;  2CO5 A;  2XVC A;  1U5T C;  3IKT A;  4PCQ A;  4N0B A;  1T2K A;  2QLZ A;  4HOB A;  5HLH A;  1ZGA A;  2IVM A;  3E5U A;  3JAM Z;  3L00 A;  5FD6 A;  4ESJ A;  4KA4 A;  3LA3 A;  3LA2 A;  1DP7 P;  4P9U A;  4G8X A;  2VE9 A;  3KP2 A;  3O6B B;  1G3W A;  3VOD A;  5K5Q A;  3E6B A;  1IRG A;  2L4M A;  3E3V A;  3I71 A;  4ZH4 F;  4KIC A;  3EET A;  2FNP A;  4UNO A;  1W7P B;  1BM9 A;  2GWR A;  4KIF A;  4HAM A;  2WV0 A;  2W57 A;  3ULQ B;  2LDU A;  2PBI A;  4YG2 F;  5ICF A;  2RDP A;  2NNY A;  5ILU A;  1S7O A;  2HEO A;  2G7H A;  1YG2 A;  4I98 B;  2CW0 F;  3I5U A;  2ZNY A;  3ROU A;  1T39 A;  4XLP F;  2CWE A;  2CYY A;  4L0Z B;  3F6V A;  3KCC A;  3KP4 A;  1LEB A;  4UV8 A;  1TNS A;  5FB2 A;  4HF1 A;  1OPC A;  1IN4 A;  1IRF A;  3NRV A;  2PEX A;  4G94 A;  4MTD A;  1Z1D A;  4RS8 A;  1BI1 A;  1J0R A;  5AIQ A;  2DU9 A;  3K9T A;  2RNJ A;  1Z6T A;  3ZPL A;  5HLI A;  4RAY A;  1JHH A;  3WGH A;  3I4P A;  1R5H A;  5DCM A;  1HSJ A;  4G6Q A;  4LG0 B;  4HX8 A;  1XDU A;  3HUG A;  2UWM A;  3BP8 A;  3GX4 X;  3GW2 A;  4KIB A;  2XKO A;  4BNC A;  5EEG A;  4AIJ A;  1G3S A;  5H6R A;  4U7B A;  1IN8 A;  2BEO A;  4O3M A;  1R58 A;  4G7Z F;  5DUI A;  3P9I A;  3D0S A;  3KP7 A;  1ZG5 A;  4JK1 X;  4M71 A;  1IW7 F;  2NNN A;  1I5Z A;  2RGV A;  1S7A A;  5HDK A;  1Z7U A;  5LGT A;  4Y13 A;  1O57 A;  2E1C A;  5L3F A;  4EM1 A;  2D2W A;  2BV6 A;  1XSX A;  2K7L A;  3J7A O; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...