2QSHX

Crystal structure of rad4-rad23 bound to a mismatch dna
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
54
structure length
54
Chain Sequence
GLTVEDLLSLRQVVSGNPEALAPLLENISARYPQLREHIMANPEVFVSMLLEAV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords top strand of the mismatch DNA
publication title Recognition of DNA damage by the Rad4 nucleotide excision repair protein
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Dna binding protein/dna
total genus 20
structure length 54
sequence length 54
ec nomenclature
pdb deposition date 2007-07-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
X PF00627 UBA UBA/TS-N domain
X PF09280 XPC-binding XPC-binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.540 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A XPC-binding domain 2qshX00
1PVEA 2F4MB 1TP4A 1X3ZB 2QSGX 1OQYA 4YIRX 2QSHX 1QZEA 3ESWB 2F4OB 1X3WB 2QSFX
chains in the Genus database with same CATH superfamily
2GAUA 2JWTA 2ZXWH 4C30A 3SYTA 5L3DA 5M5WJ 2VBWA 2VPRA 2X6WA 2BXYA 1FBSA 4IHSA 5HS7A 2LDUA 4IRIA 2IAIA 4FISA 2CV1A 3TQNA 4IQJA 3WTVC 5FD5A 2ZSIB 3FBNB 2GOMA 3J7AO 3RZDJ 2FBKA 2LKXA 2HVQA 3LOCA 4DOZA 3CCUI 4AIKA 4BE1A 1G3WA 2ZCWA 1VQ9I 3AFHA 1SEUA 2FNPA 5EEAA 3BDDA 3DU5A 4D9JA 4ZH4F 3HC7A 2ZSHB 3MQ0A 2IEKA 1R5HA 2H09A 4BY1J 2JVHA 2XUBA 4BACA 4IHTA 3CCEI 1V5EA 1Y0UA 1JXSA 2VN2A 4FX4A 3RKWA 2W7NA 5J4YA 1Y8QB 1WVRA 3KYCB 3TW7A 2M8GX 1LJ9A 4CO8A 2A6EF 1AHDP 2VC0A 2ESHA 4UVBA 5ICCA 1EKEA 2JSCA 1DQUA 4ITVA 3LAPA 1SFEA 1Z9CA 5DV5A 2BYVE 2OPTA 4PJNA 3ZMDA 4TV7A 1A04A 4AVZA 2ZKZA 5JLXA 5FFZA 1YRNA 2EV5A 1OYYA 1OISA 1MNMC 3OR2C 3BTIA 5GTHC 2CRGA 1QHHD 1WJFA 2GA1A 1YQAA 3SFZA 5L3GA 3CP8A 5LBQA 3JSOA 2M2EA 1G3TA 1T33A 1IV6A 3U1DA 5B3SH 5EGOA 2VQGA 3A0HC 3JR9A 1P2FA 1V5FA 1WPKA 1YX3A 2FQ3A 3RYRA 2VBXA 2B7EA 3V7CA 3JAMK 3ZRGA 4KDPA 2XRNA 1MH3A 2KJBA 3KX2A 2CW0F 1TC3C 2EQRA 1V4RA 3LSRA 3JRDA 4BL0B 1STZA 2QWWA 5BS6A 2R7XA 2VJ5A 3SFIA 3ZMTA 2YX7A 3C3WA 2XPVA 2OTLI 2VPLA 3K1NA 4L9NA 2E71A 2ZXHA 2JUGA 4LFUA 1FOYA 4AYBA 1OCZH 2BOLA 2QF7A 1LNWA 2DU9A 3B6CA 2HU9A 3IH3A 2WV1A 5IP7J 1P9QC 4XRSG 2E1NA 1XMXA 2FD5A 1VQNI 1FMVA 3JTHA 4GRIA 3OYNA 1WFXA 1MIJA 2JA7J 1OKRA 2DJNA 4E7HA 2Q2EA 4YFKF 2ACJA 1TWFJ 5FB2A 3J81K 3QOPA 4FQGA 1G8XA 4I7HA 5GADJ 2BY1A 1R49A 4RA2A 2MW8A 5B1AH 3QQAA 3HGYA 1G3SA 2EZLA 2K7LA 2CJJA 5CVIA 2O3FA 3DKWA 1A36A 4H4KC 2B9SA 1P92A 4PGHA 4W1UA 2EB7A 4QPOA 2Y0SA 2KIQA 1Q1HA 2IPQX 2LY1A 1OMIA 1QA6A 1FYKA 3HOZJ 5TGTA 1VQ4I 1BI1A 4M9XA 3ZQ7A 4IO9F 1X2MA 1MSEC 1ZG5A 4BJ6C 2ISYA 4G7HF 5CJ9A 2VONA 1E3HA 2JA2A 4DW6A 1AWCA 2EH3A 2F4MB 3T5XA 3WHBA 1UG0A 4MFDA 4DNCA 2R7UA 2LK2A 4ENMA 2OTJI 5KVRA 1IRXA 1KZHA 3U9GA 2HYFA 2GIVA 3F6OA 3SQNA 3CO7C 1ERDA 4JX6A 1Y6IA 4NQWA 4CYCB 3CLQA 1BI3A 5IP6A 5E1WA 1OCPA 2HDDA 1D3YA 4HSTA 2K86A 2JA8J 1V55H 3OL3A 1WJBA 3WHCA 4BQOA 1DP3A 2Y48A 2K9QA 1T56A 4AWXB 3NRVA 3BG6A 2ZMEC 2CS3A 1FBUA 2KLOA 3PNTA 3ABKH 5A2QZ 1O4XA 1J2XA 3DPTA 2M9HA 2OA4A 4CCKA 1A6QA 2BXZA 3E5XA 2HVSA 2R92J 4C2TA 2FF4A 2V6EA 5GAGJ 1YW8A 2JK3A 1Y1VJ 2MG4A 2DYRH 3FK6A 1WJ5A 4EGZA 4CCOA 4LG0B 1MMGA 2RC4A 4KIGA 3GTOJ 2A3SA 3M4OJ 3HPGA 2RV8A 1U0JA 3W6JB 4HA8A 4BQNA 2K9LA 4M9SA 5E79C 3OYGA 3MZHA 3WGIA 3CCSI 3IKVA 4KT6A 5D6FA 5J47A 3IH2A 1W7PA 1ZELA 4XLEA 2YUSA 4I01A 4AU7A 4HRIA 2L54A 2DMPA 2EZHA 2MA3A 5EJCA 1GUUA 1T0FA 4A5NA 1GLNA 2RREA 4WXCA 2V9VA 2KDOA 4I76A 1OYWA 2FBIA 4IPAA 3FWEA 3ZXSA 5F64A 4PJ0C 4XM3A 2DMTA 3DXJF 2DO7A 1G6NA 3ML6A 2VBYA 2CQKA 4EMSA 3K4LA 5IOYA 4G6DA 1TQIA 3CJRB 1WKMA 1MJAA 1S7EA 3RIRA 3V8LA 4YELA 3ABMH 1XX5A 4ZC3A 3HJEA 3BG5A 4BGDA 2Q0OA 4NBQA 3K4KA 1D1BA 2LBFA 3F8MA 3I4MJ 1O3SA 2DA5A 2I5UA 2WWYA 4YIFA 1D0XA 3CCVI 2HOTA 1MJ9A 4KA4A 4EJWA 3GXOA 3LSIA 2BBYA 3JRFA 1BL0A 3LA2A 1ZTRA 5C4JJ 5FKMA 2KRFA 2XB5A 1ZGWA 5BPDA 2LH9A 4OMZA 5CQGA 1RR7A 2CSOA 1BIBA 3F8FA 5JR3A 3S32A 2WAQN 3RQIA 1U6GA 2O5RA 3FISA 4PK4A 1P7IA 3V4GA 2Y30A 2DN0A 5K1YA 3ZMZA 3Q5FA 4AIDA 3OYAA 3SHFA 3RYPA 4P1WA 1B59A 4NUBA 2MFZA 2XGDA 1MW7A 1G59A 1B8IA 3BWGA 2GM4A 3R61A 2DOAA 2ICWG 3J7YJ 4IHWA 5J1YA 3I5UA 3KLOA 4LLGF 3HL2A 1R7JA 3I9V2 5D5VB 1I1GA 2F48A 4ZYAA 4F92B 1TW3A 3E97A 3Q3SA 4A3DJ 1JE8A 4LLNA 1HXDA 3S2DJ 2IA2A 3E1SA 3HDDA 2VT2A 4LG3A 1W5TA 3EUAA 4UV8A 4U87A 3ZCOA 3BR0A 3VDXA 4YEJA 2EFWA 3T0YA 1X3ZB 4YIRX 5F0FA 1Z3XA 1GXQA 4E70A 3KP4A 3GUDA 3A2KA 4C3JJ 2V1DA 2X51A 4KN4X 4EEFG 1G4DA 4LGWA 2KKOA 2PN6A 3FBIB 2AO9A 2VT3A 1K78A 1VQPI 2UV1A 2ZBKA 5KK1A 1D0YA 3RSNA 5J3LA 3W6KB 3P9CA 1VZ0A 1GHCA 5ED4A 1O3QA 4A93J 1T2KA 1NK2P 2KJCA 1T6SA 1YG2A 5LLQA 5JVGF 4RAGA 4IF4A 1QVUA 3SJMA 3FMQA 1DPUA 1QGPA 3LFKA 1YOVB 3TOBA 2PX9A 4HX7A 4CH7A 4XOTA 2BY2A 3HTUA 1TT5B 4C2UA 4JP0A 5H6QA 2A61A 2D1VA 1RUOA 3BPXA 2YX4A 3UR3C 4M73A 4R79A 1EH6A 2O6GE 1WCMJ 3PFYA 4MTDA 3OMYA 2MC4A 4FT8A 4E7LA 2H1LA 3S17J 1FBQA 4I09A 2EFNA 1YYVA 4YG2F 2G0EA 4A0XA 1UJ8A 1NG7A 2HDWA 3HOVJ 4BEHB 2W57A 2DJIA 1D1CA 3HUGB 4B43A 1HA8A 3O6BB 1S29A 3P5JA 2R5ZA 1HKQA 1IC8A 3DCFA 1VNDA 2ZC2A 2BW3B 3A1YA 5E3LA 6PAXA 2FOKA 3U21A 2K9MA 3I56I 3HTSB 4S0HB 3H9QA 3BZ6A 5DTDA 3C18A 4MLOA 2RQPA 3G4SI 3LFUA 4XSXF 4S04A 2VKEA 2Q8KA 3HSFA 1B6AA 2L7MP 3CTAA 1P7JA 4A3IJ 1USSA 4JOMA 2V26A 1Z1DA 2LR8A 2M3AA 2RGVA 2OD5A 4ZYDA 4HV6A 1WSUA 4UUTA 3L2VA 2IGMA 5CQEA 3H0GJ 4I0AA 4XLNF 1PUFA 1F4KA 2R7WA 3QYEA 3KLNA 5J40A 2K27A 5EDNA 4O3MA 5LRRA 3CF2A 4Y33A 1F9NA 2VL8A 5E1XA 2RQQA 1OCTC 3DTKA 1J59A 2OUMA 1W5CC 4A0ZA 2VKVA 3I0TA 3GTQJ 4GDFA 2QKMB 1D8JA 2Z99A 3LSMA 3TGNA 3WE3A 1U3EM 4NNJA 3SXYA 1RETA 2HFHA 3HB9A 1UELB 4Y15A 1LQ1A 2QBYA 1X58A 4Q5SF 2FRHA 2ZMEB 4S05A 1HCRA 2L9VA 2ADUA 2ESNA 3PUFA 4MQVA 1RZ4A 1MGTA 3AG3H 4UUSA 1K79A 1WJEA 4E6KG 3OOPA 3A02A 1LFPA 3MAJA 5D8KB 1AKHA 1X1CA 1IF1A 2JPCA 3E6MA 1IW7F 3K10A 1N25A 1BM9A 1LE8A 1MZBA 5F27A 3BQYA 3CO6C 3A01A 3IAS2 2VJIA 1MSFC 1TL8A 2HR3A 4GGGA 3MKZA 5DM7F 5AONA 2MABA 1ZGJA 3GZ5A 5GPCA 1JUPA 2XIGA 3B6AA 4RAZA 4PJLA 5LGTA 1O3RA 2PMZA 2AXTC 2L3DA 3CUQA 2VB6A 5J4VA 1E17A 1EH7A 5EZHA 3CMEI 4OIPF 2XPUA 4OINF 4XSZF 3D0SA 2CGPA 1JUSA 4B44A 2P7CB 2HQAA 2VQLA 3G1OA 4DYCA 4Y13A 1TBXA 4XN0A 1X1AA 2JMWA 2JSPA 5EEHA 1YO5C 1J9IA 2D5VA 3F72A 3OR1C 4UHTA 1LDJA 3PQJA 2O9LA 3LMMA 2QYOA 5HDKA 2WADA 4ZTFA 3W6VA 2G7HA 2NVUB 3TO6A 1HW5A 5LHGA 4WK8F 4HYEA 1FMWA 3RI4A 4G8XA 5K5OA 3BJOA 3OYHA 4L9VA 1F36A 3M8EA 3NAUA 3J80Z 4HW0A 3ZQIA 4F7ZA 3EPZA 1K4TA 2FOWA 4NC7A 4LLLA 4HPQA 2DI3A 3AG4H 4CXFA 3MD2A 3CCYA 1CQTA 3PO2J 4Q47A 1YS6A 1YITI 3TBIA 3BP8A 2X4HA 2UZKA 2IS1A 1T0FC 1WZ2A 3QP6A 3CDHA 2CUZA 4DYQA 4OAZA 1N77A 3FKIJ 4A12A 2VI6A 3MN2A 1VQ8I 1SMYF 5E3OA 3CZ6A 3JTGA 3COAC 4HF2A 3RCOA 2XPWA 2O61A 3LL7A 3L00A 5E8IA 2E5ZA 1OQYA 4PCQA 3UKGA 4LB5A 4P96A 2R0QC 5BMZA 1U78A 3SEZA 4WF2A 4EJOA 1P6RA 2KQRA 5M5YJ 3G1MA 2R7ZJ 2X1EA 3TDZC 3KE2A 3BJ6A 4EJUA 3WU1B 2ZJRF 4A3LJ 4A3EJ 1WGXA 4NC6A 1IUFA 3KZIC 4A3JJ 1BW5A 1PP7U 3S15J 2XB0X 4MEYF 1EV7A 2E1MB 3CDIA 1B72B 1SVMA 1BOBA 2FA5A 3GVAA 2L02A 1D5VA 1JKQC 4L5JA 3QPHA 4OMYA 2EFQA 1BI2A 2XHKA 3ZGKA 3MKWB 3E5QA 2VKDA 1FYMA 4D7NA 3EUHA 5LEKA 3WE2A 4J19A 1UHMA 2DMUA 4QSHA 3N4MA 2V4JC 3MWMA 4KJZA 2FNAA 2NYXA 1LUJB 3HOWJ 4L5EA 1XPXA 2LY2A 3BR1A 4ZDPA 5JHUA 2QVOA 3DP7A 3KZYA 1KU7A 2A69F 3DBHB 3K70C 4IKFA 4M74A 1TWCJ 2H8WA 4U7BA 2CQQA 5H6RA 2FU4A 3K69A 1N78A 3HSEA 5ILSA 3CJTB 3QPLA 4B09A 3IC7A 1OLTA 2A6TA 3AKZA 3GCMA 2HQ5A 1IRFA 3JREA 1WI3A 3U2RA 4JX4A 3MZYA 1FX7A 3CQZJ 1W7PD 3S93A 3MCZA 3M1EA 1E3OC 1I50J 4BXXJ 4P55A 1BA5A 5J6XA 1ZLJA 2X0LA 3WU2C 1RR8C 4BYYA 5C44J 3TMOA 3M9AA 4CHUA 5LHIA 1X2NA 3AL0C 2F2EA 2XAQA 2Z5UA 1KYWA 1H89C 1SFKA 2W00A 2YS9A 2R7VA 2L2OA 3DBLB 3QWLA 2XC7A 3ONQA 4HX4A 2Z33A 3TL4X 4G7OF 3OYLA 4HNTA 4E4HA 5BQTA 2DOFA 5D5XB 5E8GA 2E35A 4GO1A 5FLXK 1DUXC 4XLFA 4JX5A 2A07F 3NWSA 3P9IA 2R5YA 1QVTA 5CKTA 4CUGA 5HNFA 3D5SC 2KZVA 4A69C 3GW2A 3U1KA 1X1BA 4PFOA 2ECCA 1R5ID 5FD6A 1NHAA 1R58A 2HI3A 2DFIA 2EIJH 2P6TA 2STWA 2KIFA 2ZNYA 3HOXJ 4KISA 5LRSA 2ZXJA 2E2HJ 3GTMJ 4AM3A 4D7MA 4J00A 3K1PA 4HDUA 4M71A 3S3NA 1XSXA 3RQ4A 1ODDA 1E0EA 4HV5A 5HS9A 3LSPA 1XG1A 3O2PE 3QOEA 1QQIA 1R9TJ 2IBDA 5HLHA 2Q2EB 2K5CA 2N8GA 1SD5A 4A5MA 1DP7P 2X48A 2EV6A 5HVQC 4XRMA 3FXLA 2CUFA 4CCJA 4IHVA 5LEJA 3K70D 1S7OA 2EWNA 4I0BA 4LMYA 1QBJA 4GCVA 5AIQA 5DUIA 3JSPA 4Y4RA 5LGUA 1QRYA 4U0YA 1Z91A 2LYCA 2OBPA 2RAEA 3L09A 5LD2C 2IXSA 2ZXIA 2HYJA 2P6SA 2WB1N 2DDAA 3L2WA 4LITA 4N0BA 2V1UA 2WAFA 1U5TA 2QQBA 1ONVA 1SC7A 4RB2C 3PJRA 1S3JA 1K61A 3Q0UA 1R1UA 3K6GA 1FSEA 2ZB9A 2K02A 2PQ8A 4H0EA 4HSRA 4D0PA 1W0UA 1IN4A 1GVDA 1WI9A 1Z67A 1HOMA 3OY9A 1BR4A 2DA2A 2R7DA 4B47A 5B66C 5ERIA 4EM2A 3ZN0A 4XMYA 3W2AA 4QIWN 5JI6A 4ZJZA 2GBYA 1TWHJ 1W4MA 1MMNA 4UV9A 2DA4A 3P7NA 2HWVA 2PEXA 5F08A 4IL6C 3D5LA 2L9RA 3HRUA 5JFRA 2E36A 1RIOH 2F4IA 4NQWB 3FXKA 4DQ2A 2ME0A 1K4SA 2IGOA 1G3YA 3MKLA 3JRGA 1O3TA 5B5EC 1LEBA 2CG4A 5F0CA 3QPSA 2A5WA 1T08B 3HYIA 2F5DA 2OAZA 1JKRC 3ZR8X 5F6FA 3CF5F 2IS4A 1XCBA 3FF5A 4HF1A 1YLFA 2QLZA 2VOPA 3CUOA 2ZO4A 3MEXA 5FGMA 4BAYA 2GXBA 3ROUA 2DTRA 5ILVA 1S7AA 2C6YA 3REOA 3ISPA 3GMEA 2LKPA 4DBQA 3ZQFA 3BR3A 2X6OA 3A03A 3C7JA 2WAQA 2BHYA 3PNVA 4Q4ZF 3HOUJ 2DAOA 1K83J 2QSFX 1PYVA 2MLGA 3AG1H 1MMSA 2A68F 4IXAA 4XLCA 3PL8A 4E7JA 4EGYA 3QU3A 2XF5A 5M5XJ 1BN5A 1Y39A 3TKYA 4A0YA 2JQ7A 2JN6A 3QU6A 3CESA 2PMHA 1NTCA 2BEOA 2QQAA 3IRQA 4P5OA 1SFOJ 2Z16A 3KP2A 2OQRA 2CUJA 2F4OB 4A2UA 5GTIC 3FZVA 3BG9A 2Q1ZB 4FX0A 1YJWI 1ON1A 1AA7A 2HXOA 4MTEA 2OU2A 1ETOA 3ERED 3KEQA 2HOSA 4BXFA 3H3VK 4BNCA 3DWLE 1YW9A 1Z77A 3PIPF 3CJQB 3FXOA 4XR6A 4M3GA 2WY7Q 1BC8C 4HAMA 1R71A 3DBRB 3MFKA 2QUFA 1XCVA 2HZTA 3L2CA 1QNTA 3L2RA 4M3BA 2PLYA 4CSWA 4FTHA 5K7ZA 2Y0SN 2X6XA 2RKHA 2RDPA 2HVRA 1VQ6I 1A6IA 5GAEJ 2JA5J 4BXUA 1YJ9I 2Z9OA 1H9GA 1FYLA 4B3AA 3GLLA 2EILH 4XKWA 2XAFA 3I3LA 2V9KA 2ZNZA 3GFJA 3MZ8A 1LB2A 1A31A 2W4SA 1MMDA 4IEJA 4AUXA 4WXHA 4U7DA 1D1AA 2MC3A 3DPLC 2QQ9A 3AAFA 1I5ZA 1R4NB 3VEPA 3BR2A 2NS0A 4E7ZA 1HSTA 3L2QA 1ZKGA 2VLAA 1FIPA 4HX8A 5HLGA 2IJLA 2HOEA 4PSWA 3HOTA 2H6BA 2OQGA 4KN7X 3KYLA 3WG9A 5TRDA 2QA4I 2RNGA 2A5YB 5DS9A 2GQQA 2LKSA 5DYMA 1YIOA 1H8AC 3SDBA 2UXXA 3LSJA 4HQMA 1B8IB 1XGOA 3GLXA 4M9ZA 4BBSJ 1EJ9A 2V7FA 4RBOA 1OPCA 3EYIA 5FJ8J 5DCMA 4G9YA 2VJJA 1NK3P 2LTPA 2WAEA 3DFGA 3L1PA 4LK0F 1IV8A 4N9IA 2OZ6A 1TZLA 4WXDA 5H20A 1DDNA 2HOAA 5HS8A 1ZH5A 2LSOA 5EYRA 1JI8A 1CF7A 1I1SA 3OV8A 2L0KA 1LVKA 1K6YA 1EH8A 2BZTA 3SEQA 2EPFA 5LFAA 3IL2A 1KU2A 1IXCA 1KQ0A 2JZYA 4UVAA 3BCBA 4JBAA 1FT9A 1I6XA 4O5VA 1HF0A 2KRHA 3TW6A 2XAUA 3WODF 4IOCF 1H0MA 5DUKA 5TJJA 1H9TA 2PFBA 3LQQA 1B1BA 4XLHA 1Y56A 3LAJA 4G6QA 2QM3A 2GA2A 4DZJA 3AL0B 4XRFA 2VE8A 5CVUA 2OCCH 3OYKA 3ESWB 3H0DA 1ZRCA 3EUHC 1FOXA 2CFXA 1W1WE 2XAHA 1XDUA 2FE3A 3D5RC 4A6EA 1B4AA 2H6CA 2Y2ZA 1BI0A 4PDKA 3T8RA 1FPQA 3OYMA 1B9MA 2KT0A 3KZZA 3QP5A 3JRAA 3W3CA 4MQ9F 2D2WA 1UG2A 1Z6RA 1ZLKA 3ABUA 1LEAA 3MMYB 2H27A 3F3XA 1HQCA 2OZUA 5CLSA 3KYDB 4HNVA 5IOZA 3JRIA 1RI7A 1CGPA 2KMUA 5LGNA 4D5CA 4KIFA 2RVCA 1YFHA 3EDPA 3HHGA 3S8PA 1JHHA 4XL9A 2XSJC 3BLYA 4KT5C 4PZJA 4B48A 3DEWA 4U88A 4NC8A 4PUSA 4ETSA 1MNEA 3CJNA 2HXIA 1XDSA 2FBHA 1WH7A 4A3CJ 1Z7LA 4X6AJ 1QZEA 2W1OA 3QPTA 1D5YA 2DFEA 1Y8RB 4I99C 3TO7A 3HG9A 1DGWY 2FJ1A 2XKOA 3I53A 3IHUA 3OYBA 4X1EA 1XB4A 3BR6A 3L7WA 2E7WA 3KCCA 4R8HA 1HLVA 3FXJA 3V8JA 2MH9A 1BOAA 5KNLA 3F21A 1MDMA 2CQ7A 2EINH 2F5VA 3LSTA 2CYYA 3BPVA 3R4KA 2DDBA 2NOJB 3Q9SA 1MH4A 4FHTA 3G2BA 5F0HA 5D4RA 2NNYA 1OR7A 3VOEA 3J7ZI 4OIQF 1I39A 4DYRA 1ORKA 2M0CA 5KAFC 3IP4B 3DV8A 2HS5A 3M8FA 2YU3A 1UHSA 4I2OA 4G12A 3VYSB 2K9NA 3ZP5A 3S1QJ 2R7OA 4Y7NJ 2I8DA 1WH5A 4CGZA 3FM3A 2KPMA 4XKCA 2CU7A 2AQEA 2W84A 3I59B 4F91B 2ZJPF 3KIOA 3GBGA 5D5WB 1Q1VA 3WTUC 1YHQI 3BTJA 4XRSA 2BV6A 3AG2H 3DEUA 2ELJA 3C1DA 4RGRA 2M30A 3RJPA 3F22A 5HOOA 2LREA 3JRBA 2FEZA 5EF6A 2UXNA 3K4CA 5FKLA 1RESA 1LFBA 1J5YA 2KIUA 1UCRA 4RM3A 4BEHA 4ANJA 4BE2A 2GIZA 4OOIA 2LMDA 4ZYEA 2H8RA 1LKXA 2BHZA 3KEOA 3F0CA 3TEDA 5D6EA 5HLTA 2DT7B 3WTWC 2M87A 1IZ1A 4B3XA 1ETKA 2IGKA 2Y75A 2YU9J 1ZK8A 3JAMZ 4MHGA 2DYSH 2UUZA 1I3QJ 2JJ7A 1W0TA 1BC7C 2PMUA 3GFLA 1T8IA 4CICA 1KU9A 3E3VA 3PIOF 3BTLA 3KPHA 1S72I 1RPWA 1FNNA 4M3EA 1T39A 2JT1A 2QKLB 2DBBA 3E6DA 4I02A 2QCOA 3TDUC 2CUEA 3DLAA 4B8XA 5A2QK 1VQ5I 1T95A 3HEFA 3N05A 4ABZA 1QO0D 4L9JA 1Z21A 1U5TC 3V7SA 5JVTA 4ASNA 2Z2SB 4CYDA 5J1RA 1HSJA 4II3A 2P8TA 2XASA 4UUSB 2E19A 5EG0B 1U8RA 1V3FA 4GYIA 3L2UA 2ME6A 2B63J 5D4SA 4ESJA 4MIMA 1VQOI 4MNUA 1KYZA 3BJAA 3FDYA 2M7BA 4BH9A 2NVXJ 3EETA 2HPMA 3ELKA 1R00A 3EUKL 2L01A 3VYUB 3J81Z 1I27A 3A01B 1Z0XA 3G1LA 1QU3A 2ZFWA 3GEZA 3FHZA 2VOOA 2HTSA 2HDCA 2I10A 3KP7A 1U8BA 3M07A 2YSRA 2ZMEA 3ECHA 2ELKA 4BQQA 1IXSB 1T38A 1MD0A 2H1KA 1ITYA 3BR5A 2V1NA 4M6YA 2DA7A 2VODA 2QGUA 3K2AA 3F8NA 3IRRA 2HQRA 2V1XA 2Y9YA 2XROA 3GX4X 4XBFA 1JKOC 4CCNA 2VUMJ 3CMMA 2JUCA 3E6CC 5J1UA 2R7TA 4EJTA 4KMUX 1WJAA 4EM1A 2O8KA 3HM5A 1KGSA 1I6HJ 1L3LA 1R22A 1XGMA 2JPBA 3J7AY 3K4MA 1TP4A 1DU6A 1HW2A 1M1EB 2X6YA 2EA4A 3A0BC 3F8CA 5E17F 2XKPA 2OCEA 3N97A 3HIFA 4JYKA 1SVLA 4EQQA 2PG4A 2XDVA 2KRCA 1FJLA 2LF7A 4N9HA 4L9TA 3Q0WA 3F23A 1ZG1A 5ICFA 3OYIA 2BY3A 1Z7UA 3IH4A 3WTTC 3X2QH 4HLXA 4DGWB 4GXOA 2MH2A 4KFCA 2UWMA 3BC8A 3CMAI 1L0OC 4KUMA 1DU0A 2VQHA 3K4JA 2PJPA 1ZYRF 1X19A 4UNOA 3OSFA 1MBJA 1IAWA 2IVMA 4M72A 4B4CA 4C3IJ 3RKQA 2R4GA 1GV5A 1XMKA 3FHNA 2J5OA 3WTYC 2MGQA 1J0RA 1YS7A 1IRGA 3S16J 3TP3A 5HDNA 2DQRA 1JGSA 3GZNB 5IP9J 4ENJA 2FUG2 3F8BA 1ETXA 3DU6A 2HTJA 3ZN1A 2NOGA 2PI0A 3GF2A 2VJ4A 1ETVA 1D8KA 3SZPA 5ILUA 4HDVA 2JA6J 1HKSA 3F6VA 4QTRA 2CMPA 4RGXA 3LSHA 1IN5A 1KQ8A 2NS8A 3M8JA 1FSHA 2X9DA 3CD6I 3LSKA 2PJRB 3ABLH 3VODA 4IQ4A 1Z05A 2JVGA 3V42A 3R0JA 4BY7J 3S1NJ 1YTYA 3CC7I 2AQFA 2KP6A 1V54H 2X1CA 4CCLA 3IUOA 1TW2A 5KHDA 1K6OA 1IG7A 5B1BH 4LB6B 3H5RA 1T98A 2ZJ2A 3V7RA 1GV2A 1OFCX 1LDKB 3CMYA 3VB2A 4F55A 2IA0A 3E7LA 4PJJA 1TNSA 4YFNF 2LY9A 2AXLA 3DTEA 1HDDC 4OWRB 5LHHA 1SMTA 1TWAJ 5L3CA 2Y69H 1DGRM 1KU3A 2DA6A 2R93J 4BJ5C 3QRFF 2NS7A 2BGCA 2E7XA 3CDLA 3QAHA 2CW7A 1FWZA 2CWEA 3RPUA 4YFXF 1B72A 4GYGA 2DPUA 2RNJA 3K1MA 4RS8A 2WBMA 5FKKA 3VWBA 3IAM2 5DEQA 1A5JA 3ZMSA 3RKYA 5F1JA 1O7LA 2AS5F 1HDPA 2IS2A 1RKWA 2O0YA 2OJED 3HGGA 1ZAOA 2VBZA 1KQ9A 2P5KA 3ECOA 1SFXA 1FTTA 2HKOA 1YIJI 1TTYA 1R1VA 2XGCA 4HG2A 3HOYJ 2DODA 1MBHA 3H36A 1JTYA 3ZQCA 2WB1A 3HKZN 3T1BA 4QLCU 1BBYA 2M7AA 2L7KA 3RTRA 3LSGA 5ICGA 1UAAA 4BHCA 3MKYB 2EBIA 1XMAA 5DD8A 1RNLA 1YRNB 3K4BA 4I98B 1OCRH 3FXMA 4FE4A 4LOCA 3PQKA 4M3FA 3VPRA 2LC2A 1FP1D 2A6HF 5L3FA 4Q48A 3GFIA 1GDTA 2H94A 5EGOB 1MMAA 2E1OA 2HEOA 2PBIA 3M1CA 2W82A 2R5YB 3NWTA 1X4OA 5IYDJ 1UMQA 2BVLA 4NDLA 3S3OA 3OL4A 3QODA 3MVPA 3PFIA 2GXGA 3K4NA 3OYJA 5BOXA 1X3UA 1OYIA 4DZPA 4X0GA 2KFDA 1NH3A 5FFXA 3IKTA 1ON2A 4PSXA 3C2GA 3VYRB 2XRLA 2P5VA 1POGA 4XNFA 2L7FP 2DK8A 3OIOA 5IY5H 2E5NA 4DJAA 4KYWA 2R7FA 5IYBJ 2F5FA 1SD6A 3BT9A 3ZMUA 2CFOA 5TISC 2M1BA 1BR2A 4P9UA 4RB3C 4RGUA 2MYSA 2WA0A 3G73A 4A3KJ 3OYDA 4RMNA 1MNDA 2MBFA 5CPRB 3Q9VA 3BQZA 4ENKA 1SANA 4MEXF 1R4MB 2OC6A 1BR1A 1LPQA 2IT0A 2L9SA 4M6XA 3G6EI 2IS6A 2COBA 2VXZA 2M4GA 4BUPA 1ZR4A 3H1CA 1U2WA 2W24A 1OR7C 1IDYA 2EA2A 4IX7A 2DT6A 4MGRA 1FC3A 3GZ6A 2CH0A 4ENNA 5K5QA 1HKTA 1MKMA 3HRMA 4AD9A 1R6RA 4XORA 3VYTB 3FMSA 4G6TB 1W5SA 2QZ8A 3H3UA 5CVJA 5CVRA 3PSIA 1JTXA 1U5TB 1WHUA 1Y1WJ 1S6LA 1ZRFA 3R0AA 4BDZA 3M3YJ 1G2HA 1SVOA 3E5UA 4ZZDA 3ULQB 2R7RA 5IPAA 1QPMA 2X85A 2LOOA 5GPAA 2CV0A 2F5EA 1ENHA 5KAIC 3CC4I 2M4KA 5E18F 3DPUA 3S3MA 1WQ2A 3EQLF 3KEYA 1ZGAA 3LA3A 4A3GJ 5CYVA 3CP2A 2VKHA 1NG6A 3KETA 4FETA 3GTLJ 4IRHA 2QQ8A 1IN8A 3SDGA 3WGGA 2LF8A 1J7KA 4A3BJ 1I3AA 1VFCA 1SAXA 3ASOH 2NRAC 5J8FA 4PFPA 2K4JA 2LG4A 1LDDA 2NAZA 1Y0NA 5HNHA 1XGNA 2XAJA 3HRTA 2FX0A 3DEEA 5FLVA 3KP3A 2R7SA 1VQMI 2ID3A 3ZMVA 4C2MJ 2O7OA 1ACIA 4IHYA 3OS1A 5DCFA 3FX3A 3H5AA 2M34A 5JLWA 4C3HJ 2COMA 5JHFA 1C0WA 3KP6A 3BROA 2D45A 2L4AA 2WC2A 1W36C 4N4NB 5GP9A 1FLIA 4BE0A 2HQNA 1MJBA 4RLFA 2KIMA 5M3FJ 4D1QA 4AIJA 1J09A 4BHBA 5D5UB 2HZDA 4L5IA 3OS0A 3ZQLA 1EF4A 3J80K 3E6BA 4HQEA 1A35A 1U9NA 3S1MJ 1XTAA 3HBLA 4CYCA 4AYBN 1REPC 4XONA 5H2FC 1WJCA 3O3KA 1MBEA 4XICA 1YW7A 1K7AA 2K85A 2L9NA 1B9NA 4BKXA 4RM2A 2J5PA 1W7PB 2RN7A 3BY6A 2QEXI 5FLMJ 4FE7A 2V6CA 3BZCA 4EV0A 4RAFA 4LIVA 4KITB 2XGEA 1RRJA 4XOPA 4Y52J 3V8KA 3CUQC 5C3EJ 2BY0A 2HPIA 4WWCA 4A6DA 3RKXA 4UVCA 1PJRA 2XF7A 4RLQA 4NB5A 4XN3A 2CV2A 4I6ZA 1FIAA 3OWTA 2DMQA 4XK4A 4MFEA 4F93B 2KL4A 4LG0A 4QWQA 4ON0A 3FXQA 4LIUA 1HBXG 3LA7A 2QSHX 3W2VA 3L9FA 4F52A 2ZFUA 4UB8C 1IO2A 3DKYA 1ZG3A 2G7UA 2XVCA 3NQOA 1PP8F 4RB1A 4EVIA 2EIMH 4KICA 4UY8I 1D0ZA 4IVNA 2WTEA 4LK1F 3CCMI 2EK5A 1BJZA 3B02A 3FMRA 2LBFB 1R23A 1E2XA 3ASNH 2L4MA 4XQFA 4ZTJA 2Z1DA 1J75A 4MO7A 3K2ZA 5FKOA 5HLIA 4L0ZB 1FP2A 4AVPA 4BQAA 2F6CA 4CCMA 2K3PA 4E7SA 5K5RA 2NNNA 1VTNC 1F43A 4OIOF 2DFFA 1XN7A 3OYEA 4OU0A 2VQCA 2ETHA 1FY7A 1PDNC 1UZCA 4BDYA 3O8GA 1O57A 2P5LC 1IN7A 3KP5A 4EM0B 3S14J 2DOEA 5FKNA 2STTA 2XSDC 4BS9A 4V2FA 3RPQA 2DK5A 5GAHJ 1Z6TA 2DW4A 1MBKA 3QYBA 3ZQQA 3H92A 1W36D 5DCMB 4G7ZF 2CQXA 1VI0A 1X3WB 3GFMA 4GFBA 1X1DA 2M8EA 2NXNB 4IRGA 3QYFA 1V5GA 5E1ZB 2EZIA 4NHJA 1IN6A 4ZYGA 1LVAA 2V9PA 5EZGA 3R6SA 3VSKA 4K2EA 1CF7B 3H35A 1SD7A 2EZKA 4ESFA 1MBGA 3KFWX 4CZCA 2ECBA 2GZWA 2IA1A 4B1RA 2P81A 4WCGA 1PUEE 1BJAA 4BHPA 1KA8A 3BOQA 3I54A 2R7QA 5IT9Z 4M6VA 2XV4S 2KZGA 1IDZA 4FASD 1QZYA 2W85A 4HBLA 3LQRA 2K9SA 1ZN2A 3GTPJ 3WTXC 3GTKJ 4ZDOA 2Y31A 1XSVA 2IGNA 1WWXA 3JRCA 3DTIA 1ETYA 2FSWA 1F5TA 2KHMA 2MSYA 1MBFA 2EFPA 3FK7A 1S9HA 4EATA 1P4WA 3Q0VA 3S2WA 1AU7A 1K78B 3FM5A 1UFMA 3OS2A 3HXLA 3HZJA 3T8TA 2DA3A 3BTCA 1RUNA 2E1MC 5HODA 3G3ZA 1P4AA 2M45A 2E34A 2F5CA 2MD5A 3RDIA 1YI2I 1USTA 2ELHA 4L18B 3K0LA 3TO9A 5E3NA 1ZARA 3E0JB 4R1HA 5E3MA 2K3FA 2EV0A 2FXAA 1IXRC 2GXAA 3FXUA 5BPIA 4U0VA 3D1NI 4A3FJ 1R1TA 4AC0A 2EJRA 2Y0MA 1S5LC 3JW4A 2Z3YA 1ULYA 4Z6YA 2Y9ZA 3F9KA 4UB6C 2V79A 2VIXA 2IW5A 2KDZA 3RZOJ 2W48A 4QPQA 2O8XA 5D8LB 5C4XJ 2TDXA 5E20A 2GLOA 1MDMB 2ZJQF 1JJ8C 2NVQJ 4P9FA 2E1CA 1TWGJ 1Z3YA 1WRJA 4L0YB 1S8NA 4XLPF 1GVJA 3HRSA 2EIKH 1VF9A 2MLKA 4G94A 4UXNA 3C2BA 1QPIA 3ERMA 2DTZA 1TNTA 1FOWA 3R60A 1YX5A 2OV7A 4V2GA 2R5ZB 1TLHB 3BG3A 5FROA 2LFBA 2O03A 4RAYA 2E2IJ 2ID6A 3ZQGA 1SAUA 3PM1A 2P4WA 2DXIA 1R36A 2TCTA 2G9WA 2NVTJ 4HEA2 2XF6A 3I71A 4M3DA 1FZPB 3CC2I 4JK1X 4RB0A 1JT6A 2DA1A 2L7ZA 3WTZA 4E7KA 1JHFA 2HNHA 4LD5A 2DPDA 2A05A 3NARA 4Z2YA 1JT0A 3HHHA 1QHGA 2LRDA 1XC5A 1O7FA 1UB9A 3WG7H 1VQKI 4WX9A 1SFUA 3HUGA 5FLXZ 1PUFB 3FKJA 3I4PA 2LD5A 1UHWA 1VQLI 1TQPA 4A3MJ 2BW3A 2GOXB 1QZZA 1SD4A 2TRTA 3I59A 4CZZA 2FMYA 2BE5F 3RPUD 1ETWA 4E7IA 1X4PA 4HF0A 4PGGA 3K7AJ 2BVMA 2DCEA 4ZZLA 5IYCJ 4ZDLA 3H3ZA 1OCCH 2QBYB 1ZHFA 1GT0C 4DIQA 3P9KA 2QENA 3B73A 1IJWC 1IUYA 1FTZA 2K40A 1RKTA 2MD0A 2LNBA 3IWZA 4II2A 1FOKA 3S2HJ 2DFHA 4JQFA 3I64A 3OIPA 5DD4A 2FMLA 4CA0A 3S1RJ 1YJNI 2P7VB 3EYYA 3HSRA 5F1RA 1HW1A 3ABTA 3I58A 1AKHB 1JKPC 1ZRDA 5FRNA 3PNYA 4BBRJ 4HLYA 5EEGA 3OOUA 3JCUC 4IJAA 3VFZA 1LE8B 3DLLF 4ZYHA 1OJLA 2OF7A 4KIBA 4CDGA 3BG7A 4O6JA 4BU2A 3BZKA 2VXDA 2JTVA 3G71I 1JUMA 3A4CA 3DKXA 1TT0A 5EG0A 3CUQB 2FQ4A 4IZZA 1TQMA 3BCAA 2VC1A 2VE9A 3FXRA 5J8CA 2P0WA 4J01A 2XAGA 1HC8A 2KISA 3FIWA 2JRMA 3GTJJ 1KONA 5FO5A 2DT5A 1JJ6C 1JGGA 1YE9A 1ETQA 4HOBA 1ZQ3P 3H9GA 2WV0A 3PSFA 2GWRA 1H88C 3C2HA 3WTSC 3OYCA 1FEXA 5DDGA 3HOSA 4EJVA 4D5FA 2E60A 3TOAA 2W25A 2DQLA 2EFOA 4RDUA 2YPRA 2XGXA 9ANTA 5K7HA 4KNYA 3VSLA 1OCOH 4Y17A 4IHXA 2L5QA 5HDGA 1BW6A 4OIRF 1LFUP 4PJMA 1BIAA 1RC9A 3ZOBA 4HZFA 2ISZA 2LP0A 5L3EA 4KMFA 3GTGJ 3HPHA 4C9YA 2NVYJ 1DPRA 5K7FA 1XGSA 2LLKA 3H5NA 3O8HA 5ICEA 4XIDA 3I55I 2JRTA 3PUBA 4U0WA 5CVVA 1EA3A 2D1HA 2CO5A 1GXPA 2AHQA 2CQNA 2E2JJ 4N4OB 5IT3A 1E3PA 2DLLA 3PO3J 1IRZA 3OIQA 3SZGA 2IRFG 3UNGC 1F1ZA 1AOYA 3DF8A 4ESBA 5M3MJ 1IGNA 1X1PA 5KCMA 2M5WA 3GWZA 3HKZA 4XKBA 4UUVA 3ZPLA 2LVSA 2X1DA 5AIPA 2WY8Q 2HYGD 3SZTA 3LNQA 3NEUA 2YR2A 3TP0A 2IP2A 1ZREA 2QSGX 3GYHX 2B0LA 1APLC 4AIHA 5IT9K 3GO5A 4Y3OA 4V19K 3CCLI 3WGHA 3CCQI 4RGSA 3CCRI 3OSGA 4F3QA 4IOAF 2K4BA 1WJDA 3IWFA 1ZR2A 4FCYA 2R3SA 3OYFA 4DBRA 2DMNA 4XKVA 3IV5A 4YIIA 1XD7A 1VQ7I 2VASA 3W2WA 1XS9A 1U9OA 4BJTA 4OAYA 1R5GA 5F04A 4HNUA 3JRHA 2HKXA 2CW8A 4XLAA 1XSDA 3I4NJ 1N75A 5L3BA 4YRVA 3ZQHA 2M0MA 3WU0A 3LWFA 1P4XA 5FRMA 3M7GA 2PJRA 2HGCA 1PVEA 2PMZN 5DM6F 3CLOA 3DQVC 4W97A 3H9JA 3CCJI 3K9TA 4LJZF 5BNGA
chains in the Genus database with same CATH topology
1PVEA 2F4MB 1TP4A 1X3ZB 2QSGX 1OQYA 4YIRX 2QSHX 1QZEA 3ESWB 2F4OB 1X3WB 2QSFX
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1PVE A;  2F4M B;  1TP4 A;  1X3Z B;  2QSG X;  1OQY A;  4YIR X;  2QSH X;  1QZE A;  3ESW B;  2F4O B;  1X3W B;  2QSF X; 
#chains in the Genus database with same CATH topology
 2GAU A;  2JWT A;  2ZXW H;  4C30 A;  3SYT A;  5L3D A;  5M5W J;  2VBW A;  2VPR A;  2X6W A;  2BXY A;  1FBS A;  4IHS A;  5HS7 A;  2LDU A;  4IRI A;  2IAI A;  4FIS A;  2CV1 A;  3TQN A;  4IQJ A;  3WTV C;  5FD5 A;  2ZSI B;  3FBN B;  2GOM A;  3J7A O;  3RZD J;  2FBK A;  2LKX A;  2HVQ A;  3LOC A;  4DOZ A;  3CCU I;  4AIK A;  4BE1 A;  1G3W A;  2ZCW A;  1VQ9 I;  3AFH A;  1SEU A;  2FNP A;  5EEA A;  3BDD A;  3DU5 A;  4D9J A;  4ZH4 F;  3HC7 A;  2ZSH B;  3MQ0 A;  2IEK A;  1R5H A;  2H09 A;  4BY1 J;  2JVH A;  2XUB A;  4BAC A;  4IHT A;  3CCE I;  1V5E A;  1Y0U A;  1JXS A;  2VN2 A;  4FX4 A;  3RKW A;  2W7N A;  5J4Y A;  1Y8Q B;  1WVR A;  3KYC B;  3TW7 A;  2M8G X;  1LJ9 A;  4CO8 A;  2A6E F;  1AHD P;  2VC0 A;  2ESH A;  4UVB A;  5ICC A;  1EKE A;  2JSC A;  1DQU A;  4ITV A;  3LAP A;  1SFE A;  1Z9C A;  5DV5 A;  2BYV E;  2OPT A;  4PJN A;  3ZMD A;  4TV7 A;  1A04 A;  4AVZ A;  2ZKZ A;  5JLX A;  5FFZ A;  1YRN A;  2EV5 A;  1OYY A;  1OIS A;  1MNM C;  3OR2 C;  3BTI A;  5GTH C;  2CRG A;  1QHH D;  1WJF A;  2GA1 A;  1YQA A;  3SFZ A;  5L3G A;  3CP8 A;  5LBQ A;  3JSO A;  2M2E A;  1G3T A;  1T33 A;  1IV6 A;  3U1D A;  5B3S H;  5EGO A;  2VQG A;  3A0H C;  3JR9 A;  1P2F A;  1V5F A;  1WPK A;  1YX3 A;  2FQ3 A;  3RYR A;  2VBX A;  2B7E A;  3V7C A;  3JAM K;  3ZRG A;  4KDP A;  2XRN A;  1MH3 A;  2KJB A;  3KX2 A;  2CW0 F;  1TC3 C;  2EQR A;  1V4R A;  3LSR A;  3JRD A;  4BL0 B;  1STZ A;  2QWW A;  5BS6 A;  2R7X A;  2VJ5 A;  3SFI A;  3ZMT A;  2YX7 A;  3C3W A;  2XPV A;  2OTL I;  2VPL A;  3K1N A;  4L9N A;  2E71 A;  2ZXH A;  2JUG A;  4LFU A;  1FOY A;  4AYB A;  1OCZ H;  2BOL A;  2QF7 A;  1LNW A;  2DU9 A;  3B6C A;  2HU9 A;  3IH3 A;  2WV1 A;  5IP7 J;  1P9Q C;  4XRS G;  2E1N A;  1XMX A;  2FD5 A;  1VQN I;  1FMV A;  3JTH A;  4GRI A;  3OYN A;  1WFX A;  1MIJ A;  2JA7 J;  1OKR A;  2DJN A;  4E7H A;  2Q2E A;  4YFK F;  2ACJ A;  1TWF J;  5FB2 A;  3J81 K;  3QOP A;  4FQG A;  1G8X A;  4I7H A;  5GAD J;  2BY1 A;  1R49 A;  4RA2 A;  2MW8 A;  5B1A H;  3QQA A;  3HGY A;  1G3S A;  2EZL A;  2K7L A;  2CJJ A;  5CVI A;  2O3F A;  3DKW A;  1A36 A;  4H4K C;  2B9S A;  1P92 A;  4PGH A;  4W1U A;  2EB7 A;  4QPO A;  2Y0S A;  2KIQ A;  1Q1H A;  2IPQ X;  2LY1 A;  1OMI A;  1QA6 A;  1FYK A;  3HOZ J;  5TGT A;  1VQ4 I;  1BI1 A;  4M9X A;  3ZQ7 A;  4IO9 F;  1X2M A;  1MSE C;  1ZG5 A;  4BJ6 C;  2ISY A;  4G7H F;  5CJ9 A;  2VON A;  1E3H A;  2JA2 A;  4DW6 A;  1AWC A;  2EH3 A;  2F4M B;  3T5X A;  3WHB A;  1UG0 A;  4MFD A;  4DNC A;  2R7U A;  2LK2 A;  4ENM A;  2OTJ I;  5KVR A;  1IRX A;  1KZH A;  3U9G A;  2HYF A;  2GIV A;  3F6O A;  3SQN A;  3CO7 C;  1ERD A;  4JX6 A;  1Y6I A;  4NQW A;  4CYC B;  3CLQ A;  1BI3 A;  5IP6 A;  5E1W A;  1OCP A;  2HDD A;  1D3Y A;  4HST A;  2K86 A;  2JA8 J;  1V55 H;  3OL3 A;  1WJB A;  3WHC A;  4BQO A;  1DP3 A;  2Y48 A;  2K9Q A;  1T56 A;  4AWX B;  3NRV A;  3BG6 A;  2ZME C;  2CS3 A;  1FBU A;  2KLO A;  3PNT A;  3ABK H;  5A2Q Z;  1O4X A;  1J2X A;  3DPT A;  2M9H A;  2OA4 A;  4CCK A;  1A6Q A;  2BXZ A;  3E5X A;  2HVS A;  2R92 J;  4C2T A;  2FF4 A;  2V6E A;  5GAG J;  1YW8 A;  2JK3 A;  1Y1V J;  2MG4 A;  2DYR H;  3FK6 A;  1WJ5 A;  4EGZ A;  4CCO A;  4LG0 B;  1MMG A;  2RC4 A;  4KIG A;  3GTO J;  2A3S A;  3M4O J;  3HPG A;  2RV8 A;  1U0J A;  3W6J B;  4HA8 A;  4BQN A;  2K9L A;  4M9S A;  5E79 C;  3OYG A;  3MZH A;  3WGI A;  3CCS I;  3IKV A;  4KT6 A;  5D6F A;  5J47 A;  3IH2 A;  1W7P A;  1ZEL A;  4XLE A;  2YUS A;  4I01 A;  4AU7 A;  4HRI A;  2L54 A;  2DMP A;  2EZH A;  2MA3 A;  5EJC A;  1GUU A;  1T0F A;  4A5N A;  1GLN A;  2RRE A;  4WXC A;  2V9V A;  2KDO A;  4I76 A;  1OYW A;  2FBI A;  4IPA A;  3FWE A;  3ZXS A;  5F64 A;  4PJ0 C;  4XM3 A;  2DMT A;  3DXJ F;  2DO7 A;  1G6N A;  3ML6 A;  2VBY A;  2CQK A;  4EMS A;  3K4L A;  5IOY A;  4G6D A;  1TQI A;  3CJR B;  1WKM A;  1MJA A;  1S7E A;  3RIR A;  3V8L A;  4YEL A;  3ABM H;  1XX5 A;  4ZC3 A;  3HJE A;  3BG5 A;  4BGD A;  2Q0O A;  4NBQ A;  3K4K A;  1D1B A;  2LBF A;  3F8M A;  3I4M J;  1O3S A;  2DA5 A;  2I5U A;  2WWY A;  4YIF A;  1D0X A;  3CCV I;  2HOT A;  1MJ9 A;  4KA4 A;  4EJW A;  3GXO A;  3LSI A;  2BBY A;  3JRF A;  1BL0 A;  3LA2 A;  1ZTR A;  5C4J J;  5FKM A;  2KRF A;  2XB5 A;  1ZGW A;  5BPD A;  2LH9 A;  4OMZ A;  5CQG A;  1RR7 A;  2CSO A;  1BIB A;  3F8F A;  5JR3 A;  3S32 A;  2WAQ N;  3RQI A;  1U6G A;  2O5R A;  3FIS A;  4PK4 A;  1P7I A;  3V4G A;  2Y30 A;  2DN0 A;  5K1Y A;  3ZMZ A;  3Q5F A;  4AID A;  3OYA A;  3SHF A;  3RYP A;  4P1W A;  1B59 A;  4NUB A;  2MFZ A;  2XGD A;  1MW7 A;  1G59 A;  1B8I A;  3BWG A;  2GM4 A;  3R61 A;  2DOA A;  2ICW G;  3J7Y J;  4IHW A;  5J1Y A;  3I5U A;  3KLO A;  4LLG F;  3HL2 A;  1R7J A;  3I9V 2;  5D5V B;  1I1G A;  2F48 A;  4ZYA A;  4F92 B;  1TW3 A;  3E97 A;  3Q3S A;  4A3D J;  1JE8 A;  4LLN A;  1HXD A;  3S2D J;  2IA2 A;  3E1S A;  3HDD A;  2VT2 A;  4LG3 A;  1W5T A;  3EUA A;  4UV8 A;  4U87 A;  3ZCO A;  3BR0 A;  3VDX A;  4YEJ A;  2EFW A;  3T0Y A;  1X3Z B;  4YIR X;  5F0F A;  1Z3X A;  1GXQ A;  4E70 A;  3KP4 A;  3GUD A;  3A2K A;  4C3J J;  2V1D A;  2X51 A;  4KN4 X;  4EEF G;  1G4D A;  4LGW A;  2KKO A;  2PN6 A;  3FBI B;  2AO9 A;  2VT3 A;  1K78 A;  1VQP I;  2UV1 A;  2ZBK A;  5KK1 A;  1D0Y A;  3RSN A;  5J3L A;  3W6K B;  3P9C A;  1VZ0 A;  1GHC A;  5ED4 A;  1O3Q A;  4A93 J;  1T2K A;  1NK2 P;  2KJC A;  1T6S A;  1YG2 A;  5LLQ A;  5JVG F;  4RAG A;  4IF4 A;  1QVU A;  3SJM A;  3FMQ A;  1DPU A;  1QGP A;  3LFK A;  1YOV B;  3TOB A;  2PX9 A;  4HX7 A;  4CH7 A;  4XOT A;  2BY2 A;  3HTU A;  1TT5 B;  4C2U A;  4JP0 A;  5H6Q A;  2A61 A;  2D1V A;  1RUO A;  3BPX A;  2YX4 A;  3UR3 C;  4M73 A;  4R79 A;  1EH6 A;  2O6G E;  1WCM J;  3PFY A;  4MTD A;  3OMY A;  2MC4 A;  4FT8 A;  4E7L A;  2H1L A;  3S17 J;  1FBQ A;  4I09 A;  2EFN A;  1YYV A;  4YG2 F;  2G0E A;  4A0X A;  1UJ8 A;  1NG7 A;  2HDW A;  3HOV J;  4BEH B;  2W57 A;  2DJI A;  1D1C A;  3HUG B;  4B43 A;  1HA8 A;  3O6B B;  1S29 A;  3P5J A;  2R5Z A;  1HKQ A;  1IC8 A;  3DCF A;  1VND A;  2ZC2 A;  2BW3 B;  3A1Y A;  5E3L A;  6PAX A;  2FOK A;  3U21 A;  2K9M A;  3I56 I;  3HTS B;  4S0H B;  3H9Q A;  3BZ6 A;  5DTD A;  3C18 A;  4MLO A;  2RQP A;  3G4S I;  3LFU A;  4XSX F;  4S04 A;  2VKE A;  2Q8K A;  3HSF A;  1B6A A;  2L7M P;  3CTA A;  1P7J A;  4A3I J;  1USS A;  4JOM A;  2V26 A;  1Z1D A;  2LR8 A;  2M3A A;  2RGV A;  2OD5 A;  4ZYD A;  4HV6 A;  1WSU A;  4UUT A;  3L2V A;  2IGM A;  5CQE A;  3H0G J;  4I0A A;  4XLN F;  1PUF A;  1F4K A;  2R7W A;  3QYE A;  3KLN A;  5J40 A;  2K27 A;  5EDN A;  4O3M A;  5LRR A;  3CF2 A;  4Y33 A;  1F9N A;  2VL8 A;  5E1X A;  2RQQ A;  1OCT C;  3DTK A;  1J59 A;  2OUM A;  1W5C C;  4A0Z A;  2VKV A;  3I0T A;  3GTQ J;  4GDF A;  2QKM B;  1D8J A;  2Z99 A;  3LSM A;  3TGN A;  3WE3 A;  1U3E M;  4NNJ A;  3SXY A;  1RET A;  2HFH A;  3HB9 A;  1UEL B;  4Y15 A;  1LQ1 A;  2QBY A;  1X58 A;  4Q5S F;  2FRH A;  2ZME B;  4S05 A;  1HCR A;  2L9V A;  2ADU A;  2ESN A;  3PUF A;  4MQV A;  1RZ4 A;  1MGT A;  3AG3 H;  4UUS A;  1K79 A;  1WJE A;  4E6K G;  3OOP A;  3A02 A;  1LFP A;  3MAJ A;  5D8K B;  1AKH A;  1X1C A;  1IF1 A;  2JPC A;  3E6M A;  1IW7 F;  3K10 A;  1N25 A;  1BM9 A;  1LE8 A;  1MZB A;  5F27 A;  3BQY A;  3CO6 C;  3A01 A;  3IAS 2;  2VJI A;  1MSF C;  1TL8 A;  2HR3 A;  4GGG A;  3MKZ A;  5DM7 F;  5AON A;  2MAB A;  1ZGJ A;  3GZ5 A;  5GPC A;  1JUP A;  2XIG A;  3B6A A;  4RAZ A;  4PJL A;  5LGT A;  1O3R A;  2PMZ A;  2AXT C;  2L3D A;  3CUQ A;  2VB6 A;  5J4V A;  1E17 A;  1EH7 A;  5EZH A;  3CME I;  4OIP F;  2XPU A;  4OIN F;  4XSZ F;  3D0S A;  2CGP A;  1JUS A;  4B44 A;  2P7C B;  2HQA A;  2VQL A;  3G1O A;  4DYC A;  4Y13 A;  1TBX A;  4XN0 A;  1X1A A;  2JMW A;  2JSP A;  5EEH A;  1YO5 C;  1J9I A;  2D5V A;  3F72 A;  3OR1 C;  4UHT A;  1LDJ A;  3PQJ A;  2O9L A;  3LMM A;  2QYO A;  5HDK A;  2WAD A;  4ZTF A;  3W6V A;  2G7H A;  2NVU B;  3TO6 A;  1HW5 A;  5LHG A;  4WK8 F;  4HYE A;  1FMW A;  3RI4 A;  4G8X A;  5K5O A;  3BJO A;  3OYH A;  4L9V A;  1F36 A;  3M8E A;  3NAU A;  3J80 Z;  4HW0 A;  3ZQI A;  4F7Z A;  3EPZ A;  1K4T A;  2FOW A;  4NC7 A;  4LLL A;  4HPQ A;  2DI3 A;  3AG4 H;  4CXF A;  3MD2 A;  3CCY A;  1CQT A;  3PO2 J;  4Q47 A;  1YS6 A;  1YIT I;  3TBI A;  3BP8 A;  2X4H A;  2UZK A;  2IS1 A;  1T0F C;  1WZ2 A;  3QP6 A;  3CDH A;  2CUZ A;  4DYQ A;  4OAZ A;  1N77 A;  3FKI J;  4A12 A;  2VI6 A;  3MN2 A;  1VQ8 I;  1SMY F;  5E3O A;  3CZ6 A;  3JTG A;  3COA C;  4HF2 A;  3RCO A;  2XPW A;  2O61 A;  3LL7 A;  3L00 A;  5E8I A;  2E5Z A;  1OQY A;  4PCQ A;  3UKG A;  4LB5 A;  4P96 A;  2R0Q C;  5BMZ A;  1U78 A;  3SEZ A;  4WF2 A;  4EJO A;  1P6R A;  2KQR A;  5M5Y J;  3G1M A;  2R7Z J;  2X1E A;  3TDZ C;  3KE2 A;  3BJ6 A;  4EJU A;  3WU1 B;  2ZJR F;  4A3L J;  4A3E J;  1WGX A;  4NC6 A;  1IUF A;  3KZI C;  4A3J J;  1BW5 A;  1PP7 U;  3S15 J;  2XB0 X;  4MEY F;  1EV7 A;  2E1M B;  3CDI A;  1B72 B;  1SVM A;  1BOB A;  2FA5 A;  3GVA A;  2L02 A;  1D5V A;  1JKQ C;  4L5J A;  3QPH A;  4OMY A;  2EFQ A;  1BI2 A;  2XHK A;  3ZGK A;  3MKW B;  3E5Q A;  2VKD A;  1FYM A;  4D7N A;  3EUH A;  5LEK A;  3WE2 A;  4J19 A;  1UHM A;  2DMU A;  4QSH A;  3N4M A;  2V4J C;  3MWM A;  4KJZ A;  2FNA A;  2NYX A;  1LUJ B;  3HOW J;  4L5E A;  1XPX A;  2LY2 A;  3BR1 A;  4ZDP A;  5JHU A;  2QVO A;  3DP7 A;  3KZY A;  1KU7 A;  2A69 F;  3DBH B;  3K70 C;  4IKF A;  4M74 A;  1TWC J;  2H8W A;  4U7B A;  2CQQ A;  5H6R A;  2FU4 A;  3K69 A;  1N78 A;  3HSE A;  5ILS A;  3CJT B;  3QPL A;  4B09 A;  3IC7 A;  1OLT A;  2A6T A;  3AKZ A;  3GCM A;  2HQ5 A;  1IRF A;  3JRE A;  1WI3 A;  3U2R A;  4JX4 A;  3MZY A;  1FX7 A;  3CQZ J;  1W7P D;  3S93 A;  3MCZ A;  3M1E A;  1E3O C;  1I50 J;  4BXX J;  4P55 A;  1BA5 A;  5J6X A;  1ZLJ A;  2X0L A;  3WU2 C;  1RR8 C;  4BYY A;  5C44 J;  3TMO A;  3M9A A;  4CHU A;  5LHI A;  1X2N A;  3AL0 C;  2F2E A;  2XAQ A;  2Z5U A;  1KYW A;  1H89 C;  1SFK A;  2W00 A;  2YS9 A;  2R7V A;  2L2O A;  3DBL B;  3QWL A;  2XC7 A;  3ONQ A;  4HX4 A;  2Z33 A;  3TL4 X;  4G7O F;  3OYL A;  4HNT A;  4E4H A;  5BQT A;  2DOF A;  5D5X B;  5E8G A;  2E35 A;  4GO1 A;  5FLX K;  1DUX C;  4XLF A;  4JX5 A;  2A07 F;  3NWS A;  3P9I A;  2R5Y A;  1QVT A;  5CKT A;  4CUG A;  5HNF A;  3D5S C;  2KZV A;  4A69 C;  3GW2 A;  3U1K A;  1X1B A;  4PFO A;  2ECC A;  1R5I D;  5FD6 A;  1NHA A;  1R58 A;  2HI3 A;  2DFI A;  2EIJ H;  2P6T A;  2STW A;  2KIF A;  2ZNY A;  3HOX J;  4KIS A;  5LRS A;  2ZXJ A;  2E2H J;  3GTM J;  4AM3 A;  4D7M A;  4J00 A;  3K1P A;  4HDU A;  4M71 A;  3S3N A;  1XSX A;  3RQ4 A;  1ODD A;  1E0E A;  4HV5 A;  5HS9 A;  3LSP A;  1XG1 A;  3O2P E;  3QOE A;  1QQI A;  1R9T J;  2IBD A;  5HLH A;  2Q2E B;  2K5C A;  2N8G A;  1SD5 A;  4A5M A;  1DP7 P;  2X48 A;  2EV6 A;  5HVQ C;  4XRM A;  3FXL A;  2CUF A;  4CCJ A;  4IHV A;  5LEJ A;  3K70 D;  1S7O A;  2EWN A;  4I0B A;  4LMY A;  1QBJ A;  4GCV A;  5AIQ A;  5DUI A;  3JSP A;  4Y4R A;  5LGU A;  1QRY A;  4U0Y A;  1Z91 A;  2LYC A;  2OBP A;  2RAE A;  3L09 A;  5LD2 C;  2IXS A;  2ZXI A;  2HYJ A;  2P6S A;  2WB1 N;  2DDA A;  3L2W A;  4LIT A;  4N0B A;  2V1U A;  2WAF A;  1U5T A;  2QQB A;  1ONV A;  1SC7 A;  4RB2 C;  3PJR A;  1S3J A;  1K61 A;  3Q0U A;  1R1U A;  3K6G A;  1FSE A;  2ZB9 A;  2K02 A;  2PQ8 A;  4H0E A;  4HSR A;  4D0P A;  1W0U A;  1IN4 A;  1GVD A;  1WI9 A;  1Z67 A;  1HOM A;  3OY9 A;  1BR4 A;  2DA2 A;  2R7D A;  4B47 A;  5B66 C;  5ERI A;  4EM2 A;  3ZN0 A;  4XMY A;  3W2A A;  4QIW N;  5JI6 A;  4ZJZ A;  2GBY A;  1TWH J;  1W4M A;  1MMN A;  4UV9 A;  2DA4 A;  3P7N A;  2HWV A;  2PEX A;  5F08 A;  4IL6 C;  3D5L A;  2L9R A;  3HRU A;  5JFR A;  2E36 A;  1RIO H;  2F4I A;  4NQW B;  3FXK A;  4DQ2 A;  2ME0 A;  1K4S A;  2IGO A;  1G3Y A;  3MKL A;  3JRG A;  1O3T A;  5B5E C;  1LEB A;  2CG4 A;  5F0C A;  3QPS A;  2A5W A;  1T08 B;  3HYI A;  2F5D A;  2OAZ A;  1JKR C;  3ZR8 X;  5F6F A;  3CF5 F;  2IS4 A;  1XCB A;  3FF5 A;  4HF1 A;  1YLF A;  2QLZ A;  2VOP A;  3CUO A;  2ZO4 A;  3MEX A;  5FGM A;  4BAY A;  2GXB A;  3ROU A;  2DTR A;  5ILV A;  1S7A A;  2C6Y A;  3REO A;  3ISP A;  3GME A;  2LKP A;  4DBQ A;  3ZQF A;  3BR3 A;  2X6O A;  3A03 A;  3C7J A;  2WAQ A;  2BHY A;  3PNV A;  4Q4Z F;  3HOU J;  2DAO A;  1K83 J;  2QSF X;  1PYV A;  2MLG A;  3AG1 H;  1MMS A;  2A68 F;  4IXA A;  4XLC A;  3PL8 A;  4E7J A;  4EGY A;  3QU3 A;  2XF5 A;  5M5X J;  1BN5 A;  1Y39 A;  3TKY A;  4A0Y A;  2JQ7 A;  2JN6 A;  3QU6 A;  3CES A;  2PMH A;  1NTC A;  2BEO A;  2QQA A;  3IRQ A;  4P5O A;  1SFO J;  2Z16 A;  3KP2 A;  2OQR A;  2CUJ A;  2F4O B;  4A2U A;  5GTI C;  3FZV A;  3BG9 A;  2Q1Z B;  4FX0 A;  1YJW I;  1ON1 A;  1AA7 A;  2HXO A;  4MTE A;  2OU2 A;  1ETO A;  3ERE D;  3KEQ A;  2HOS A;  4BXF A;  3H3V K;  4BNC A;  3DWL E;  1YW9 A;  1Z77 A;  3PIP F;  3CJQ B;  3FXO A;  4XR6 A;  4M3G A;  2WY7 Q;  1BC8 C;  4HAM A;  1R71 A;  3DBR B;  3MFK A;  2QUF A;  1XCV A;  2HZT A;  3L2C A;  1QNT A;  3L2R A;  4M3B A;  2PLY A;  4CSW A;  4FTH A;  5K7Z A;  2Y0S N;  2X6X A;  2RKH A;  2RDP A;  2HVR A;  1VQ6 I;  1A6I A;  5GAE J;  2JA5 J;  4BXU A;  1YJ9 I;  2Z9O A;  1H9G A;  1FYL A;  4B3A A;  3GLL A;  2EIL H;  4XKW A;  2XAF A;  3I3L A;  2V9K A;  2ZNZ A;  3GFJ A;  3MZ8 A;  1LB2 A;  1A31 A;  2W4S A;  1MMD A;  4IEJ A;  4AUX A;  4WXH A;  4U7D A;  1D1A A;  2MC3 A;  3DPL C;  2QQ9 A;  3AAF A;  1I5Z A;  1R4N B;  3VEP A;  3BR2 A;  2NS0 A;  4E7Z A;  1HST A;  3L2Q A;  1ZKG A;  2VLA A;  1FIP A;  4HX8 A;  5HLG A;  2IJL A;  2HOE A;  4PSW A;  3HOT A;  2H6B A;  2OQG A;  4KN7 X;  3KYL A;  3WG9 A;  5TRD A;  2QA4 I;  2RNG A;  2A5Y B;  5DS9 A;  2GQQ A;  2LKS A;  5DYM A;  1YIO A;  1H8A C;  3SDB A;  2UXX A;  3LSJ A;  4HQM A;  1B8I B;  1XGO A;  3GLX A;  4M9Z A;  4BBS J;  1EJ9 A;  2V7F A;  4RBO A;  1OPC A;  3EYI A;  5FJ8 J;  5DCM A;  4G9Y A;  2VJJ A;  1NK3 P;  2LTP A;  2WAE A;  3DFG A;  3L1P A;  4LK0 F;  1IV8 A;  4N9I A;  2OZ6 A;  1TZL A;  4WXD A;  5H20 A;  1DDN A;  2HOA A;  5HS8 A;  1ZH5 A;  2LSO A;  5EYR A;  1JI8 A;  1CF7 A;  1I1S A;  3OV8 A;  2L0K A;  1LVK A;  1K6Y A;  1EH8 A;  2BZT A;  3SEQ A;  2EPF A;  5LFA A;  3IL2 A;  1KU2 A;  1IXC A;  1KQ0 A;  2JZY A;  4UVA A;  3BCB A;  4JBA A;  1FT9 A;  1I6X A;  4O5V A;  1HF0 A;  2KRH A;  3TW6 A;  2XAU A;  3WOD F;  4IOC F;  1H0M A;  5DUK A;  5TJJ A;  1H9T A;  2PFB A;  3LQQ A;  1B1B A;  4XLH A;  1Y56 A;  3LAJ A;  4G6Q A;  2QM3 A;  2GA2 A;  4DZJ A;  3AL0 B;  4XRF A;  2VE8 A;  5CVU A;  2OCC H;  3OYK A;  3ESW B;  3H0D A;  1ZRC A;  3EUH C;  1FOX A;  2CFX A;  1W1W E;  2XAH A;  1XDU A;  2FE3 A;  3D5R C;  4A6E A;  1B4A A;  2H6C A;  2Y2Z A;  1BI0 A;  4PDK A;  3T8R A;  1FPQ A;  3OYM A;  1B9M A;  2KT0 A;  3KZZ A;  3QP5 A;  3JRA A;  3W3C A;  4MQ9 F;  2D2W A;  1UG2 A;  1Z6R A;  1ZLK A;  3ABU A;  1LEA A;  3MMY B;  2H27 A;  3F3X A;  1HQC A;  2OZU A;  5CLS A;  3KYD B;  4HNV A;  5IOZ A;  3JRI A;  1RI7 A;  1CGP A;  2KMU A;  5LGN A;  4D5C A;  4KIF A;  2RVC A;  1YFH A;  3EDP A;  3HHG A;  3S8P A;  1JHH A;  4XL9 A;  2XSJ C;  3BLY A;  4KT5 C;  4PZJ A;  4B48 A;  3DEW A;  4U88 A;  4NC8 A;  4PUS A;  4ETS A;  1MNE A;  3CJN A;  2HXI A;  1XDS A;  2FBH A;  1WH7 A;  4A3C J;  1Z7L A;  4X6A J;  1QZE A;  2W1O A;  3QPT A;  1D5Y A;  2DFE A;  1Y8R B;  4I99 C;  3TO7 A;  3HG9 A;  1DGW Y;  2FJ1 A;  2XKO A;  3I53 A;  3IHU A;  3OYB A;  4X1E A;  1XB4 A;  3BR6 A;  3L7W A;  2E7W A;  3KCC A;  4R8H A;  1HLV A;  3FXJ A;  3V8J A;  2MH9 A;  1BOA A;  5KNL A;  3F21 A;  1MDM A;  2CQ7 A;  2EIN H;  2F5V A;  3LST A;  2CYY A;  3BPV A;  3R4K A;  2DDB A;  2NOJ B;  3Q9S A;  1MH4 A;  4FHT A;  3G2B A;  5F0H A;  5D4R A;  2NNY A;  1OR7 A;  3VOE A;  3J7Z I;  4OIQ F;  1I39 A;  4DYR A;  1ORK A;  2M0C A;  5KAF C;  3IP4 B;  3DV8 A;  2HS5 A;  3M8F A;  2YU3 A;  1UHS A;  4I2O A;  4G12 A;  3VYS B;  2K9N A;  3ZP5 A;  3S1Q J;  2R7O A;  4Y7N J;  2I8D A;  1WH5 A;  4CGZ A;  3FM3 A;  2KPM A;  4XKC A;  2CU7 A;  2AQE A;  2W84 A;  3I59 B;  4F91 B;  2ZJP F;  3KIO A;  3GBG A;  5D5W B;  1Q1V A;  3WTU C;  1YHQ I;  3BTJ A;  4XRS A;  2BV6 A;  3AG2 H;  3DEU A;  2ELJ A;  3C1D A;  4RGR A;  2M30 A;  3RJP A;  3F22 A;  5HOO A;  2LRE A;  3JRB A;  2FEZ A;  5EF6 A;  2UXN A;  3K4C A;  5FKL A;  1RES A;  1LFB A;  1J5Y A;  2KIU A;  1UCR A;  4RM3 A;  4BEH A;  4ANJ A;  4BE2 A;  2GIZ A;  4OOI A;  2LMD A;  4ZYE A;  2H8R A;  1LKX A;  2BHZ A;  3KEO A;  3F0C A;  3TED A;  5D6E A;  5HLT A;  2DT7 B;  3WTW C;  2M87 A;  1IZ1 A;  4B3X A;  1ETK A;  2IGK A;  2Y75 A;  2YU9 J;  1ZK8 A;  3JAM Z;  4MHG A;  2DYS H;  2UUZ A;  1I3Q J;  2JJ7 A;  1W0T A;  1BC7 C;  2PMU A;  3GFL A;  1T8I A;  4CIC A;  1KU9 A;  3E3V A;  3PIO F;  3BTL A;  3KPH A;  1S72 I;  1RPW A;  1FNN A;  4M3E A;  1T39 A;  2JT1 A;  2QKL B;  2DBB A;  3E6D A;  4I02 A;  2QCO A;  3TDU C;  2CUE A;  3DLA A;  4B8X A;  5A2Q K;  1VQ5 I;  1T95 A;  3HEF A;  3N05 A;  4ABZ A;  1QO0 D;  4L9J A;  1Z21 A;  1U5T C;  3V7S A;  5JVT A;  4ASN A;  2Z2S B;  4CYD A;  5J1R A;  1HSJ A;  4II3 A;  2P8T A;  2XAS A;  4UUS B;  2E19 A;  5EG0 B;  1U8R A;  1V3F A;  4GYI A;  3L2U A;  2ME6 A;  2B63 J;  5D4S A;  4ESJ A;  4MIM A;  1VQO I;  4MNU A;  1KYZ A;  3BJA A;  3FDY A;  2M7B A;  4BH9 A;  2NVX J;  3EET A;  2HPM A;  3ELK A;  1R00 A;  3EUK L;  2L01 A;  3VYU B;  3J81 Z;  1I27 A;  3A01 B;  1Z0X A;  3G1L A;  1QU3 A;  2ZFW A;  3GEZ A;  3FHZ A;  2VOO A;  2HTS A;  2HDC A;  2I10 A;  3KP7 A;  1U8B A;  3M07 A;  2YSR A;  2ZME A;  3ECH A;  2ELK A;  4BQQ A;  1IXS B;  1T38 A;  1MD0 A;  2H1K A;  1ITY A;  3BR5 A;  2V1N A;  4M6Y A;  2DA7 A;  2VOD A;  2QGU A;  3K2A A;  3F8N A;  3IRR A;  2HQR A;  2V1X A;  2Y9Y A;  2XRO A;  3GX4 X;  4XBF A;  1JKO C;  4CCN A;  2VUM J;  3CMM A;  2JUC A;  3E6C C;  5J1U A;  2R7T A;  4EJT A;  4KMU X;  1WJA A;  4EM1 A;  2O8K A;  3HM5 A;  1KGS A;  1I6H J;  1L3L A;  1R22 A;  1XGM A;  2JPB A;  3J7A Y;  3K4M A;  1TP4 A;  1DU6 A;  1HW2 A;  1M1E B;  2X6Y A;  2EA4 A;  3A0B C;  3F8C A;  5E17 F;  2XKP A;  2OCE A;  3N97 A;  3HIF A;  4JYK A;  1SVL A;  4EQQ A;  2PG4 A;  2XDV A;  2KRC A;  1FJL A;  2LF7 A;  4N9H A;  4L9T A;  3Q0W A;  3F23 A;  1ZG1 A;  5ICF A;  3OYI A;  2BY3 A;  1Z7U A;  3IH4 A;  3WTT C;  3X2Q H;  4HLX A;  4DGW B;  4GXO A;  2MH2 A;  4KFC A;  2UWM A;  3BC8 A;  3CMA I;  1L0O C;  4KUM A;  1DU0 A;  2VQH A;  3K4J A;  2PJP A;  1ZYR F;  1X19 A;  4UNO A;  3OSF A;  1MBJ A;  1IAW A;  2IVM A;  4M72 A;  4B4C A;  4C3I J;  3RKQ A;  2R4G A;  1GV5 A;  1XMK A;  3FHN A;  2J5O A;  3WTY C;  2MGQ A;  1J0R A;  1YS7 A;  1IRG A;  3S16 J;  3TP3 A;  5HDN A;  2DQR A;  1JGS A;  3GZN B;  5IP9 J;  4ENJ A;  2FUG 2;  3F8B A;  1ETX A;  3DU6 A;  2HTJ A;  3ZN1 A;  2NOG A;  2PI0 A;  3GF2 A;  2VJ4 A;  1ETV A;  1D8K A;  3SZP A;  5ILU A;  4HDV A;  2JA6 J;  1HKS A;  3F6V A;  4QTR A;  2CMP A;  4RGX A;  3LSH A;  1IN5 A;  1KQ8 A;  2NS8 A;  3M8J A;  1FSH A;  2X9D A;  3CD6 I;  3LSK A;  2PJR B;  3ABL H;  3VOD A;  4IQ4 A;  1Z05 A;  2JVG A;  3V42 A;  3R0J A;  4BY7 J;  3S1N J;  1YTY A;  3CC7 I;  2AQF A;  2KP6 A;  1V54 H;  2X1C A;  4CCL A;  3IUO A;  1TW2 A;  5KHD A;  1K6O A;  1IG7 A;  5B1B H;  4LB6 B;  3H5R A;  1T98 A;  2ZJ2 A;  3V7R A;  1GV2 A;  1OFC X;  1LDK B;  3CMY A;  3VB2 A;  4F55 A;  2IA0 A;  3E7L A;  4PJJ A;  1TNS A;  4YFN F;  2LY9 A;  2AXL A;  3DTE A;  1HDD C;  4OWR B;  5LHH A;  1SMT A;  1TWA J;  5L3C A;  2Y69 H;  1DGR M;  1KU3 A;  2DA6 A;  2R93 J;  4BJ5 C;  3QRF F;  2NS7 A;  2BGC A;  2E7X A;  3CDL A;  3QAH A;  2CW7 A;  1FWZ A;  2CWE A;  3RPU A;  4YFX F;  1B72 A;  4GYG A;  2DPU A;  2RNJ A;  3K1M A;  4RS8 A;  2WBM A;  5FKK A;  3VWB A;  3IAM 2;  5DEQ A;  1A5J A;  3ZMS A;  3RKY A;  5F1J A;  1O7L A;  2AS5 F;  1HDP A;  2IS2 A;  1RKW A;  2O0Y A;  2OJE D;  3HGG A;  1ZAO A;  2VBZ A;  1KQ9 A;  2P5K A;  3ECO A;  1SFX A;  1FTT A;  2HKO A;  1YIJ I;  1TTY A;  1R1V A;  2XGC A;  4HG2 A;  3HOY J;  2DOD A;  1MBH A;  3H36 A;  1JTY A;  3ZQC A;  2WB1 A;  3HKZ N;  3T1B A;  4QLC U;  1BBY A;  2M7A A;  2L7K A;  3RTR A;  3LSG A;  5ICG A;  1UAA A;  4BHC A;  3MKY B;  2EBI A;  1XMA A;  5DD8 A;  1RNL A;  1YRN B;  3K4B A;  4I98 B;  1OCR H;  3FXM A;  4FE4 A;  4LOC A;  3PQK A;  4M3F A;  3VPR A;  2LC2 A;  1FP1 D;  2A6H F;  5L3F A;  4Q48 A;  3GFI A;  1GDT A;  2H94 A;  5EGO B;  1MMA A;  2E1O A;  2HEO A;  2PBI A;  3M1C A;  2W82 A;  2R5Y B;  3NWT A;  1X4O A;  5IYD J;  1UMQ A;  2BVL A;  4NDL A;  3S3O A;  3OL4 A;  3QOD A;  3MVP A;  3PFI A;  2GXG A;  3K4N A;  3OYJ A;  5BOX A;  1X3U A;  1OYI A;  4DZP A;  4X0G A;  2KFD A;  1NH3 A;  5FFX A;  3IKT A;  1ON2 A;  4PSX A;  3C2G A;  3VYR B;  2XRL A;  2P5V A;  1POG A;  4XNF A;  2L7F P;  2DK8 A;  3OIO A;  5IY5 H;  2E5N A;  4DJA A;  4KYW A;  2R7F A;  5IYB J;  2F5F A;  1SD6 A;  3BT9 A;  3ZMU A;  2CFO A;  5TIS C;  2M1B A;  1BR2 A;  4P9U A;  4RB3 C;  4RGU A;  2MYS A;  2WA0 A;  3G73 A;  4A3K J;  3OYD A;  4RMN A;  1MND A;  2MBF A;  5CPR B;  3Q9V A;  3BQZ A;  4ENK A;  1SAN A;  4MEX F;  1R4M B;  2OC6 A;  1BR1 A;  1LPQ A;  2IT0 A;  2L9S A;  4M6X A;  3G6E I;  2IS6 A;  2COB A;  2VXZ A;  2M4G A;  4BUP A;  1ZR4 A;  3H1C A;  1U2W A;  2W24 A;  1OR7 C;  1IDY A;  2EA2 A;  4IX7 A;  2DT6 A;  4MGR A;  1FC3 A;  3GZ6 A;  2CH0 A;  4ENN A;  5K5Q A;  1HKT A;  1MKM A;  3HRM A;  4AD9 A;  1R6R A;  4XOR A;  3VYT B;  3FMS A;  4G6T B;  1W5S A;  2QZ8 A;  3H3U A;  5CVJ A;  5CVR A;  3PSI A;  1JTX A;  1U5T B;  1WHU A;  1Y1W J;  1S6L A;  1ZRF A;  3R0A A;  4BDZ A;  3M3Y J;  1G2H A;  1SVO A;  3E5U A;  4ZZD A;  3ULQ B;  2R7R A;  5IPA A;  1QPM A;  2X85 A;  2LOO A;  5GPA A;  2CV0 A;  2F5E A;  1ENH A;  5KAI C;  3CC4 I;  2M4K A;  5E18 F;  3DPU A;  3S3M A;  1WQ2 A;  3EQL F;  3KEY A;  1ZGA A;  3LA3 A;  4A3G J;  5CYV A;  3CP2 A;  2VKH A;  1NG6 A;  3KET A;  4FET A;  3GTL J;  4IRH A;  2QQ8 A;  1IN8 A;  3SDG A;  3WGG A;  2LF8 A;  1J7K A;  4A3B J;  1I3A A;  1VFC A;  1SAX A;  3ASO H;  2NRA C;  5J8F A;  4PFP A;  2K4J A;  2LG4 A;  1LDD A;  2NAZ A;  1Y0N A;  5HNH A;  1XGN A;  2XAJ A;  3HRT A;  2FX0 A;  3DEE A;  5FLV A;  3KP3 A;  2R7S A;  1VQM I;  2ID3 A;  3ZMV A;  4C2M J;  2O7O A;  1ACI A;  4IHY A;  3OS1 A;  5DCF A;  3FX3 A;  3H5A A;  2M34 A;  5JLW A;  4C3H J;  2COM A;  5JHF A;  1C0W A;  3KP6 A;  3BRO A;  2D45 A;  2L4A A;  2WC2 A;  1W36 C;  4N4N B;  5GP9 A;  1FLI A;  4BE0 A;  2HQN A;  1MJB A;  4RLF A;  2KIM A;  5M3F J;  4D1Q A;  4AIJ A;  1J09 A;  4BHB A;  5D5U B;  2HZD A;  4L5I A;  3OS0 A;  3ZQL A;  1EF4 A;  3J80 K;  3E6B A;  4HQE A;  1A35 A;  1U9N A;  3S1M J;  1XTA A;  3HBL A;  4CYC A;  4AYB N;  1REP C;  4XON A;  5H2F C;  1WJC A;  3O3K A;  1MBE A;  4XIC A;  1YW7 A;  1K7A A;  2K85 A;  2L9N A;  1B9N A;  4BKX A;  4RM2 A;  2J5P A;  1W7P B;  2RN7 A;  3BY6 A;  2QEX I;  5FLM J;  4FE7 A;  2V6C A;  3BZC A;  4EV0 A;  4RAF A;  4LIV A;  4KIT B;  2XGE A;  1RRJ A;  4XOP A;  4Y52 J;  3V8K A;  3CUQ C;  5C3E J;  2BY0 A;  2HPI A;  4WWC A;  4A6D A;  3RKX A;  4UVC A;  1PJR A;  2XF7 A;  4RLQ A;  4NB5 A;  4XN3 A;  2CV2 A;  4I6Z A;  1FIA A;  3OWT A;  2DMQ A;  4XK4 A;  4MFE A;  4F93 B;  2KL4 A;  4LG0 A;  4QWQ A;  4ON0 A;  3FXQ A;  4LIU A;  1HBX G;  3LA7 A;  2QSH X;  3W2V A;  3L9F A;  4F52 A;  2ZFU A;  4UB8 C;  1IO2 A;  3DKY A;  1ZG3 A;  2G7U A;  2XVC A;  3NQO A;  1PP8 F;  4RB1 A;  4EVI A;  2EIM H;  4KIC A;  4UY8 I;  1D0Z A;  4IVN A;  2WTE A;  4LK1 F;  3CCM I;  2EK5 A;  1BJZ A;  3B02 A;  3FMR A;  2LBF B;  1R23 A;  1E2X A;  3ASN H;  2L4M A;  4XQF A;  4ZTJ A;  2Z1D A;  1J75 A;  4MO7 A;  3K2Z A;  5FKO A;  5HLI A;  4L0Z B;  1FP2 A;  4AVP A;  4BQA A;  2F6C A;  4CCM A;  2K3P A;  4E7S A;  5K5R A;  2NNN A;  1VTN C;  1F43 A;  4OIO F;  2DFF A;  1XN7 A;  3OYE A;  4OU0 A;  2VQC A;  2ETH A;  1FY7 A;  1PDN C;  1UZC A;  4BDY A;  3O8G A;  1O57 A;  2P5L C;  1IN7 A;  3KP5 A;  4EM0 B;  3S14 J;  2DOE A;  5FKN A;  2STT A;  2XSD C;  4BS9 A;  4V2F A;  3RPQ A;  2DK5 A;  5GAH J;  1Z6T A;  2DW4 A;  1MBK A;  3QYB A;  3ZQQ A;  3H92 A;  1W36 D;  5DCM B;  4G7Z F;  2CQX A;  1VI0 A;  1X3W B;  3GFM A;  4GFB A;  1X1D A;  2M8E A;  2NXN B;  4IRG A;  3QYF A;  1V5G A;  5E1Z B;  2EZI A;  4NHJ A;  1IN6 A;  4ZYG A;  1LVA A;  2V9P A;  5EZG A;  3R6S A;  3VSK A;  4K2E A;  1CF7 B;  3H35 A;  1SD7 A;  2EZK A;  4ESF A;  1MBG A;  3KFW X;  4CZC A;  2ECB A;  2GZW A;  2IA1 A;  4B1R A;  2P81 A;  4WCG A;  1PUE E;  1BJA A;  4BHP A;  1KA8 A;  3BOQ A;  3I54 A;  2R7Q A;  5IT9 Z;  4M6V A;  2XV4 S;  2KZG A;  1IDZ A;  4FAS D;  1QZY A;  2W85 A;  4HBL A;  3LQR A;  2K9S A;  1ZN2 A;  3GTP J;  3WTX C;  3GTK J;  4ZDO A;  2Y31 A;  1XSV A;  2IGN A;  1WWX A;  3JRC A;  3DTI A;  1ETY A;  2FSW A;  1F5T A;  2KHM A;  2MSY A;  1MBF A;  2EFP A;  3FK7 A;  1S9H A;  4EAT A;  1P4W A;  3Q0V A;  3S2W A;  1AU7 A;  1K78 B;  3FM5 A;  1UFM A;  3OS2 A;  3HXL A;  3HZJ A;  3T8T A;  2DA3 A;  3BTC A;  1RUN A;  2E1M C;  5HOD A;  3G3Z A;  1P4A A;  2M45 A;  2E34 A;  2F5C A;  2MD5 A;  3RDI A;  1YI2 I;  1UST A;  2ELH A;  4L18 B;  3K0L A;  3TO9 A;  5E3N A;  1ZAR A;  3E0J B;  4R1H A;  5E3M A;  2K3F A;  2EV0 A;  2FXA A;  1IXR C;  2GXA A;  3FXU A;  5BPI A;  4U0V A;  3D1N I;  4A3F J;  1R1T A;  4AC0 A;  2EJR A;  2Y0M A;  1S5L C;  3JW4 A;  2Z3Y A;  1ULY A;  4Z6Y A;  2Y9Z A;  3F9K A;  4UB6 C;  2V79 A;  2VIX A;  2IW5 A;  2KDZ A;  3RZO J;  2W48 A;  4QPQ A;  2O8X A;  5D8L B;  5C4X J;  2TDX A;  5E20 A;  2GLO A;  1MDM B;  2ZJQ F;  1JJ8 C;  2NVQ J;  4P9F A;  2E1C A;  1TWG J;  1Z3Y A;  1WRJ A;  4L0Y B;  1S8N A;  4XLP F;  1GVJ A;  3HRS A;  2EIK H;  1VF9 A;  2MLK A;  4G94 A;  4UXN A;  3C2B A;  1QPI A;  3ERM A;  2DTZ A;  1TNT A;  1FOW A;  3R60 A;  1YX5 A;  2OV7 A;  4V2G A;  2R5Z B;  1TLH B;  3BG3 A;  5FRO A;  2LFB A;  2O03 A;  4RAY A;  2E2I J;  2ID6 A;  3ZQG A;  1SAU A;  3PM1 A;  2P4W A;  2DXI A;  1R36 A;  2TCT A;  2G9W A;  2NVT J;  4HEA 2;  2XF6 A;  3I71 A;  4M3D A;  1FZP B;  3CC2 I;  4JK1 X;  4RB0 A;  1JT6 A;  2DA1 A;  2L7Z A;  3WTZ A;  4E7K A;  1JHF A;  2HNH A;  4LD5 A;  2DPD A;  2A05 A;  3NAR A;  4Z2Y A;  1JT0 A;  3HHH A;  1QHG A;  2LRD A;  1XC5 A;  1O7F A;  1UB9 A;  3WG7 H;  1VQK I;  4WX9 A;  1SFU A;  3HUG A;  5FLX Z;  1PUF B;  3FKJ A;  3I4P A;  2LD5 A;  1UHW A;  1VQL I;  1TQP A;  4A3M J;  2BW3 A;  2GOX B;  1QZZ A;  1SD4 A;  2TRT A;  3I59 A;  4CZZ A;  2FMY A;  2BE5 F;  3RPU D;  1ETW A;  4E7I A;  1X4P A;  4HF0 A;  4PGG A;  3K7A J;  2BVM A;  2DCE A;  4ZZL A;  5IYC J;  4ZDL A;  3H3Z A;  1OCC H;  2QBY B;  1ZHF A;  1GT0 C;  4DIQ A;  3P9K A;  2QEN A;  3B73 A;  1IJW C;  1IUY A;  1FTZ A;  2K40 A;  1RKT A;  2MD0 A;  2LNB A;  3IWZ A;  4II2 A;  1FOK A;  3S2H J;  2DFH A;  4JQF A;  3I64 A;  3OIP A;  5DD4 A;  2FML A;  4CA0 A;  3S1R J;  1YJN I;  2P7V B;  3EYY A;  3HSR A;  5F1R A;  1HW1 A;  3ABT A;  3I58 A;  1AKH B;  1JKP C;  1ZRD A;  5FRN A;  3PNY A;  4BBR J;  4HLY A;  5EEG A;  3OOU A;  3JCU C;  4IJA A;  3VFZ A;  1LE8 B;  3DLL F;  4ZYH A;  1OJL A;  2OF7 A;  4KIB A;  4CDG A;  3BG7 A;  4O6J A;  4BU2 A;  3BZK A;  2VXD A;  2JTV A;  3G71 I;  1JUM A;  3A4C A;  3DKX A;  1TT0 A;  5EG0 A;  3CUQ B;  2FQ4 A;  4IZZ A;  1TQM A;  3BCA A;  2VC1 A;  2VE9 A;  3FXR A;  5J8C A;  2P0W A;  4J01 A;  2XAG A;  1HC8 A;  2KIS A;  3FIW A;  2JRM A;  3GTJ J;  1KON A;  5FO5 A;  2DT5 A;  1JJ6 C;  1JGG A;  1YE9 A;  1ETQ A;  4HOB A;  1ZQ3 P;  3H9G A;  2WV0 A;  3PSF A;  2GWR A;  1H88 C;  3C2H A;  3WTS C;  3OYC A;  1FEX A;  5DDG A;  3HOS A;  4EJV A;  4D5F A;  2E60 A;  3TOA A;  2W25 A;  2DQL A;  2EFO A;  4RDU A;  2YPR A;  2XGX A;  9ANT A;  5K7H A;  4KNY A;  3VSL A;  1OCO H;  4Y17 A;  4IHX A;  2L5Q A;  5HDG A;  1BW6 A;  4OIR F;  1LFU P;  4PJM A;  1BIA A;  1RC9 A;  3ZOB A;  4HZF A;  2ISZ A;  2LP0 A;  5L3E A;  4KMF A;  3GTG J;  3HPH A;  4C9Y A;  2NVY J;  1DPR A;  5K7F A;  1XGS A;  2LLK A;  3H5N A;  3O8H A;  5ICE A;  4XID A;  3I55 I;  2JRT A;  3PUB A;  4U0W A;  5CVV A;  1EA3 A;  2D1H A;  2CO5 A;  1GXP A;  2AHQ A;  2CQN A;  2E2J J;  4N4O B;  5IT3 A;  1E3P A;  2DLL A;  3PO3 J;  1IRZ A;  3OIQ A;  3SZG A;  2IRF G;  3UNG C;  1F1Z A;  1AOY A;  3DF8 A;  4ESB A;  5M3M J;  1IGN A;  1X1P A;  5KCM A;  2M5W A;  3GWZ A;  3HKZ A;  4XKB A;  4UUV A;  3ZPL A;  2LVS A;  2X1D A;  5AIP A;  2WY8 Q;  2HYG D;  3SZT A;  3LNQ A;  3NEU A;  2YR2 A;  3TP0 A;  2IP2 A;  1ZRE A;  2QSG X;  3GYH X;  2B0L A;  1APL C;  4AIH A;  5IT9 K;  3GO5 A;  4Y3O A;  4V19 K;  3CCL I;  3WGH A;  3CCQ I;  4RGS A;  3CCR I;  3OSG A;  4F3Q A;  4IOA F;  2K4B A;  1WJD A;  3IWF A;  1ZR2 A;  4FCY A;  2R3S A;  3OYF A;  4DBR A;  2DMN A;  4XKV A;  3IV5 A;  4YII A;  1XD7 A;  1VQ7 I;  2VAS A;  3W2W A;  1XS9 A;  1U9O A;  4BJT A;  4OAY A;  1R5G A;  5F04 A;  4HNU A;  3JRH A;  2HKX A;  2CW8 A;  4XLA A;  1XSD A;  3I4N J;  1N75 A;  5L3B A;  4YRV A;  3ZQH A;  2M0M A;  3WU0 A;  3LWF A;  1P4X A;  5FRM A;  3M7G A;  2PJR A;  2HGC A;  1PVE A;  2PMZ N;  5DM6 F;  3CLO A;  3DQV C;  4W97 A;  3H9J A;  3CCJ I;  3K9T A;  4LJZ F;  5BNG A; 
#chains in the Genus database with same CATH homology
 1PVE A;  2F4M B;  1TP4 A;  1X3Z B;  2QSG X;  1OQY A;  4YIR X;  2QSH X;  1QZE A;  3ESW B;  2F4O B;  1X3W B;  2QSF X; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...