2QSHX

Crystal structure of rad4-rad23 bound to a mismatch dna
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
54
structure length
54
Chain Sequence
GLTVEDLLSLRQVVSGNPEALAPLLENISARYPQLREHIMANPEVFVSMLLEAV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Dna binding protein/dna
molecule keywords top strand of the mismatch DNA
publication title Recognition of DNA damage by the Rad4 nucleotide excision repair protein
pubmed doi rcsb
source organism Saccharomyces cerevisiae
total genus 20
structure length 54
sequence length 54
ec nomenclature
pdb deposition date 2007-07-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
X PF00627 UBA UBA/TS-N domain
X PF09280 XPC-binding XPC-binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.540 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A XPC-binding domain 2qshX00
1X3ZB 3ESWB 4YIRX 1TP4A 2F4OB 2F4MB 2QSHX 1X3WB 2QSGX 1QZEA 1PVEA 2QSFX 1OQYA
chains in the Genus database with same CATH superfamily
4N9IA 1FBSA 3BTLA 2M8GX 2ZJPF 1SD6A 1F9NA 2JPBA 3HXLA 5CLSA 1NHAA 2B9SA 1GVJA 2X0LA 3C2BA 3P9IA 4U0VA 3KP2A 2E2HJ 2H1KA 1RPWA 4HSRA 4I99C 3GTPJ 4HF0A 2DYSH 2AQFA 3TP3A 6PAXA 4LB5A 4NDLA 4BJTA 1R5HA 3GTJJ 3F21A 2CS3A 4KITB 1KZHA 1T0FA 3JRCA 3CMAI 1TWAJ 2H6CA 1FY7A 3ZOBA 5JFRA 4BQOA 1ZGJA 2Z16A 3KZYA 5EEAA 5H6RA 1KQ0A 3SQNA 4RMNA 1VQ8I 2LKPA 2YX7A 1X19A 1IN6A 4EMSA 3OYIA 3I59B 1VNDA 5EEHA 3KFWX 1VQ5I 2VE8A 3CZ6A 3QPHA 5C4XJ 4XLPF 2X51A 3MD2A 1B72A 3U1DA 2O61A 2VJJA 1HDDC 2IGNA 1F1ZA 2EZIA 4K2EA 2YX4A 4C9YA 2B0LA 1LVAA 2DFEA 2ACJA 3QP5A 1YO5C 1TQPA 1AU7A 1DPRA 1DDNA 4RA2A 1MBHA 1M1EB 2BY1A 2D2WA 2OA4A 2DJNA 1SD7A 1I39A 3DXJF 3TBIA 2BOLA 4LGWA 1PDNC 3DU5A 1QPIA 4HX8A 1Q1VA 1X2MA 3W6VA 3QODA 3WGHA 1APLC 2FF4A 3AL0B 5DCMA 3DBRB 4V2FA 4I0BA 2A05A 2K3PA 2JSCA 3D5RC 1G3SA 2LC2A 2CUZA 2M0MA 1RZ4A 3OOUA 4IRIA 4EGZA 1LDKB 4GRIA 3GTKJ 4JQFA 5AIPA 4U7BA 2EA2A 2P8TA 2JA2A 4E7HA 2CJJA 2RVCA 2IBDA 4DYCA 3QYFA 2Q0OA 3EUHC 1FTZA 3FXMA 2C6YA 1AWCA 1UB9A 2Y75A 2JUGA 2GIZA 1U8RA 3L2QA 4L9VA 4B09A 5IT9K 2R7WA 2Z5UA 2DFFA 2DXIA 4KT6A 3CCSI 4KT5C 2QZ8A 3RPQA 2IXSA 2R7QA 3KP4A 2IPQX 1B1BA 5KHDA 2GWRA 4E7SA 3IL2A 3WHCA 5K5OA 3CUQB 3S3MA 2UV1A 5D5UB 4MO7A 1TC3C 3K1MA 3H0DA 3CMYA 4G7HF 1O7LA 4M6XA 1RNLA 1CGPA 4A3GJ 2BHYA 2ZJ2A 3JSPA 3ZCOA 1LB2A 4CCMA 4Q48A 2KFDA 1UJ8A 2E34A 3O2PE 4I98B 4XLCA 4B3AA 3I53A 4AIDA 2E36A 3C2HA 3HRMA 4JBAA 1BI0A 5E1WA 1WRJA 2M8EA 3GF2A 1W36D 1LE8B 1PP8F 4HX4A 4EM2A 2DQRA 2Y0SA 2MD5A 2ZKZA 2IJLA 1U3EM 2HOSA 3KZIC 2EFQA 2XAUA 1WGXA 1A31A 2YSRA 2JRTA 4FCYA 2VOPA 4YIIA 2ZMEC 3G2BA 4NC8A 2VQHA 3OIQA 3GTQJ 2O9LA 2FA5A 4I01A 1CQTA 2PFBA 5JR3A 3D5SC 3ZXSA 5CPRB 3FZVA 3HOVJ 5LGUA 2YU3A 3J7AY 3PO3J 1AOYA 4II3A 4A69C 4EM1A 2VASA 3IRQA 4ANJA 1T39A 2KHMA 3HRTA 5E8GA 2LRDA 1J9IA 2E5NA 1H9TA 3I0TA 3FMRA 4QPOA 3D5LA 3ZQGA 4YIRX 1JUPA 1T33A 3WHBA 2VBWA 1MBJA 4O6JA 4EJVA 1ZTRA 2LSOA 2MLGA 1JJ6C 4NQWA 1IUFA 3E6CC 3E3VA 1P6RA 2HDDA 3JAMK 1Y8RB 3LOCA 2P5LC 2YU9J 2LNBA 3CESA 2X48A 3MEXA 1MSFC 1PVEA 3I56I 2K9QA 1V4RA 5DS9A 5IP9J 2HU9A 1QBJA 3BR2A 1JHHA 3G71I 4IQ4A 1B6AA 1FP2A 4J01A 5EZGA 2QF7A 3F23A 4A6DA 1H88C 3VPRA 4ZYGA 2ID6A 5E79C 3F0CA 3K4JA 4LK0F 4L5EA 1A04A 4EM0B 2LD5A 1MBKA 2M7AA 3ZGKA 2QBYA 3FXUA 1TQMA 1XMXA 2TDXA 1RKWA 4A3IJ 4IRHA 3EUHA 1MBGA 3GFLA 1RRJA 2F5FA 2LDUA 2H6BA 4QIWN 2JN6A 5JHUA 1IDZA 2H1LA 2Y0SN 2YUSA 3A1YA 1LKXA 2W25A 2CYYA 5M5XJ 3PL8A 4HQEA 3H35A 5F27A 4R1HA 3D1NI 3ABTA 1ZH5A 4PZJA 2W57A 3ASOH 5B3SH 1JKRC 4UY8I 4PK4A 1FYLA 1EA3A 1OYWA 3FKIJ 2L9NA 1MH3A 2VXZA 2BW3B 2Y30A 3V7RA 4A0YA 4HLXA 3E97A 3JR9A 2EV5A 1MIJA 2ZBKA 2VIXA 2MD0A 1FX7A 4RGXA 3KYDB 1DP3A 4HA8A 3QPTA 5HS8A 2LLKA 4BBRJ 3DFGA 3RYPA 4HX7A 2AQEA 1ZYRF 2W82A 2EINH 5ICGA 1K4SA 2QUFA 3VODA 1X58A 4L5JA 1HW5A 1X4OA 4X6AJ 1R58A 3FMQA 1RIOH 1QPMA 3EQLF 2J5PA 2JVGA 3CCJI 3GTGJ 4XLAA 4BACA 4D7MA 1O3TA 5F64A 2ME6A 4F92B 4DYRA 3CO6C 5L3CA 4IF4A 3ZR8X 3EUKL 3OYJA 4DQ2A 2L7ZA 1I3QJ 2MC3A 3CLOA 3MVPA 4IHTA 5FRNA 2ZMEA 4HNUA 2GLOA 3DPTA 3I4MJ 4BDYA 3I58A 2KIQA 2QLZA 4FISA 1ZR2A 4MGRA 2R3SA 4IO9F 3I54A 1FSHA 3AL0C 4KJZA 1S72I 3DCFA 2MFZA 2XAJA 2H09A 2L9RA 3KE2A 4C30A 5B1BH 4I7HA 3RQ4A 2QA4I 3M07A 2HQAA 1QGPA 1ZKGA 1Z21A 3BY6A 4I76A 3PIPF 4G9YA 4DBQA 1UMQA 2PJPA 2VOOA 1RR7A 1XX5A 3R61A 3OYNA 4BEHB 3HUGA 3TKYA 3A4CA 4ZDPA 4WXCA 4RAZA 4A3BJ 3A0HC 2F6CA 1P4AA 3ERMA 4QLCU 2DT6A 2W24A 4BQQA 3J7AO 3BR0A 3RKWA 2ZSIB 3WTWC 3HC7A 5IYDJ 3BG6A 4IHXA 3MQ0A 5E3OA 3E6MA 5C4JJ 4CCJA 2CV1A 2V9KA 4JP0A 2DA4A 4A3FJ 3GZ6A 2VONA 1SFXA 1A36A 1F36A 4UB6C 4E7JA 2QSGX 3HBLA 1LEBA 2RAEA 1EH6A 1IJWC 2CO5A 2NOGA 4RB1A 3D0SA 1QZYA 2DTRA 4AIKA 2KIUA 2EV6A 2QENA 2FRHA 1KU2A 3V42A 4WXHA 1A6IA 2WTEA 1S6LA 2XASA 3GVAA 3HTUA 4XICA 3K2AA 4XBFA 1JJ8C 3U1KA 4WCGA 3GO5A 2A6HF 5HDGA 3FX3A 3CCMI 2HYGD 3S2DJ 4C3HJ 2FOKA 1HSTA 4GGGA 1S7OA 2JA5J 2X6YA 3I59A 3BR3A 3IKVA 1FMVA 2FX0A 3DEEA 1ODDA 3M9AA 4XK4A 3HOYJ 1ON1A 3FDYA 3S17J 1P7IA 4HRIA 2L4MA 2IP2A 2XPUA 2K9NA 1Z77A 2ZXIA 1Z91A 3PNVA 5M3FJ 2K27A 1LFUP 4CSWA 1RKTA 1KONA 2R7OA 5ILSA 4WWCA 5EJCA 5TRDA 3Q9VA 3CCVI 3H3VK 2IS4A 1U0JA 2X1EA 1BC8C 3OOPA 1IUYA 4HV5A 3LL7A 3K4CA 3E0JB 2OU2A 2VT3A 2HR3A 2JWTA 3SFZA 5J8CA 1YG2A 2H94A 2HDWA 1W5CC 1TBXA 2HOEA 4L5IA 2KZGA 2LTPA 2FQ4A 3KP5A 2HVSA 1PJRA 4LMYA 4II2A 4BDZA 5ICCA 2E5ZA 3QPLA 2JUCA 3A03A 2F2EA 4B44A 1GHCA 5D5VB 1BN5A 2VI6A 4IX7A 2Y48A 3HZJA 1BC7C 2AXLA 2VC0A 1WJFA 3O6BB 3F8BA 2LK2A 2PG4A 3HPHA 1X3UA 5LHHA 3QRFF 2JSPA 4G6TB 3OYAA 2PLYA 2KRFA 3G1MA 1TT0A 2L3DA 4KISA 2EFPA 2FBKA 2FE3A 4M9ZA 1XGSA 4E7KA 1OYIA 4JX6A 4KIFA 1I1GA 3VSKA 3LAJA 2E2IJ 3FK7A 2MSYA 3TOBA 4IZZA 2PMHA 3IAS2 5ED4A 1A5JA 3LA2A 1TNTA 5HOOA 1NH3A 4A0ZA 2MBFA 1W1WE 4Q5SF 2MH9A 2WAEA 1MNMC 4AC0A 5CJ9A 4ENMA 4MHGA 2E7XA 2V1UA 5BQTA 1BW6A 1BOBA 2CUJA 1KQ9A 4S0HB 5D4RA 2K4BA 3AG3H 1Z9CA 2IS2A 4LIUA 5FLXZ 2ZC2A 2L9SA 3F22A 5LHIA 4BE2A 3HDDA 3ML6A 4NHJA 4CYDA 4M73A 2JJ7A 5L3GA 1FP1D 3HRUA 2D5VA 2NVXJ 2QVOA 3H9JA 3BR5A 2EWNA 3NQOA 3MKZA 5DDGA 5M3MJ 1UHSA 4OAZA 5CVIA 3JSOA 1SAXA 5CKTA 3LSGA 2QSHX 1OQYA 2LP0A 3JRHA 2X85A 4XKWA 2LY9A 4IPAA 3VYTB 4RAGA 4ABZA 2ZO4A 2NVTJ 4C2MJ 1IZ1A 3CO7C 3UNGC 1IN7A 3DEUA 1U5TB 4OMZA 2D45A 2ZXWH 2RKHA 1NK2P 2K3FA 2QQ9A 3OMYA 1R1TA 2KJBA 2EFWA 1YE9A 1O7FA 4LITA 1KGSA 1VQPI 3H5AA 4XRSA 2DW4A 2R7DA 1YW9A 4XLEA 2CV2A 4BE1A 1ONVA 2HKXA 4J00A 1VQ4I 3HPGA 3MWMA 1Q1HA 2WY7Q 1IW7F 2EH3A 2VODA 1G3YA 4RS8A 2G7UA 5FLMJ 2DPUA 3BTCA 1YLFA 2LH9A 4KYWA 3U9GA 2FNPA 3GTLJ 1JGGA 1JUSA 2TCTA 1L3LA 1OKRA 4H4KC 1VI0A 2COMA 2LBFB 5DD8A 1U8BA 3IAM2 3J81Z 2ZFWA 1UAAA 2LF8A 3M8JA 1XCBA 2CRGA 3FXLA 2CU7A 3FK6A 1IXCA 5FKKA 2LG4A 2V1DA 2Q2EB 1XMKA 3S15J 2K9LA 2XKPA 4LLNA 2OF7A 3RI4A 2XF7A 1LDJA 3BPVA 4LG0B 1IV8A 2HQNA 3SEZA 1USTA 3OR2C 1ZN2A 4HQMA 4ESJA 1Y39A 1HC8A 1V55H 5M5YJ 4UUSB 5DTDA 3X2QH 1OJLA 4Q4ZF 4L9TA 1DQUA 1U2WA 1YRNB 4LD5A 1YFHA 3G73A 1MMNA 3U2RA 2MG4A 1K61A 2NAZA 1T2KA 2X4HA 3CQZJ 5ICFA 4AU7A 4E6KG 1EKEA 3K4LA 5E18F 4L9JA 4ZH4F 2Z9OA 1BJZA 1TLHB 5FGMA 1IRGA 1IG7A 3GWZA 1UHMA 5KVRA 3RKQA 2HNHA 1T38A 3QOPA 4M6YA 4BKXA 4ZJZA 5BPDA 2HS5A 2HOAA 1RESA 1V3FA 3KPHA 5JLWA 2X6WA 4N0BA 2I5UA 2HYJA 3CCLI 2ISYA 2M7BA 4RB0A 3DU6A 3BZKA 3OYCA 4KMUX 5FKMA 3E1SA 2LMDA 3E5QA 1WJ5A 3BR6A 3ZMDA 1GT0C 3T0YA 1FYMA 4A3KJ 1QA6A 2F4IA 1Y8QB 4FE4A 1FC3A 5TJJA 3EPZA 2R7SA 3ABKH 4X1EA 1UZCA 3LSHA 2IGOA 2OD5A 4M3GA 2DK5A 2F4MB 3QAHA 2Q1ZB 3WTYC 2KDOA 1VFCA 1H0MA 1ETKA 2R5ZB 1R23A 1YJWI 1QRYA 1F4KA 4IJAA 1WJDA 3F72A 3N05A 3MMYB 3PIOF 1LFBA 1G3WA 3Q0UA 2E60A 4BXFA 3HSEA 1N25A 1R1VA 2FBIA 3PUBA 4LFUA 4BHBA 4UNOA 4Y52J 2ICWG 4BU2A 3K69A 4RB3C 1E2XA 1E17A 5GAHJ 5J40A 5LEJA 3SYTA 3CF5F 1D5YA 4XOTA 4BEHA 1E3OC 3CF2A 4L0YB 5C3EJ 5DYMA 5HLTA 3OSFA 3WG9A 1Z0XA 1O3RA 5F04A 2OQRA 2KMUA 1Z05A 2A07F 2KRCA 3M1EA 5J4VA 1GV5A 1GV2A 1G8XA 1ZGWA 1MMGA 3TO7A 5HVQC 5KNLA 4FHTA 2FNAA 1PYVA 2ADUA 4UVBA 3DTKA 1RETA 3LSMA 4EGYA 1TW2A 3FWEA 5HLGA 2GZWA 1SANA 3DLLF 1WI9A 1MDMB 2JQ7A 1BI3A 2AS5F 1B59A 2NYXA 2D1VA 2E1MB 3ECHA 3M1CA 2P0WA 1O4XA 3I4NJ 2KKOA 5FKNA 4XSZF 2HQ5A 3CC2I 1Z67A 5B1AH 1W0TA 1GDTA 4MFEA 2V7FA 4RGUA 3EYYA 3WE2A 2O8KA 1VQ6I 4AIJA 4MQ9F 1MBEA 4MTDA 3IP4B 3PFYA 2GBYA 4D5FA 2VBZA 3F8FA 2V79A 2JK3A 1REPC 2BY2A 2NS8A 4RGSA 3V8KA 1R00A 1MGTA 5F1JA 1FIPA 4ENJA 2JA8J 2UXNA 2QKMB 1XSDA 1Y56A 1ULYA 2PBIA 2JTVA 4BNCA 1E0EA 4CCKA 3FMSA 5A2QK 3SZTA 4XN3A 3SZGA 1U5TC 1S29A 2FQ3A 4EJOA 5HS9A 1ON2A 1D1AA 1I5ZA 4WK8F 2K9MA 2Z1DA 5H2FC 1IC8A 1SFUA 1FOYA 3DKYA 4ZZDA 1S9HA 2HFHA 2KIFA 2DYRH 4OWRB 4ITVA 2V26A 2KLOA 5FLVA 2KRHA 4JK1X 2X1CA 3L1PA 4A0XA 3N97A 3EETA 3QYBA 4B47A 4S04A 1XDUA 2MA3A 3I71A 4ZC3A 3S3NA 1QZEA 1LNWA 5D6EA 2ZXHA 1W0UA 3FBNB 2I10A 2PMZA 3FIWA 4I09A 2R7ZJ 2DFHA 1X1DA 2MGQA 5LHGA 2BZTA 3REOA 3LAPA 1FT9A 3NWSA 3TO6A 1QVTA 3ZP5A 3JW4A 3L2UA 1DUXC 3IV5A 2AHQA 5DM6F 1D8JA 2DU9A 3E5UA 2Z33A 1D1CA 3I3LA 2M45A 2L2OA 2P7VB 2HDCA 3S93A 2XC7A 1X2NA 4ON0A 5JHFA 2F4OB 3S2HJ 5J4YA 4W1UA 1JUMA 3KX2A 3K1NA 4UXNA 1RC9A 3PFIA 3A01B 2H27A 1G3TA 1CF7A 4MIMA 4PJJA 1ZK8A 5CVJA 2CW8A 2VL8A 3DQVC 5IT3A 4ZTJA 4UVAA 2UWMA 2KP6A 3BP8A 2R5YB 1I1SA 2NVUB 1Y1WJ 3TDZC 5J1RA 1HQCA 2Y69H 2W1OA 4B8XA 2EB7A 2HVQA 4F3QA 1SD4A 4HYEA 2FXAA 1P4WA 2JRMA 1G6NA 3BG9A 4KIBA 5TISC 1FJLA 2VPLA 2LR8A 2BYVE 3OYFA 3BG3A 4XL9A 2ESNA 1B8IB 2DOFA 4S05A 3SFIA 5HODA 1UFMA 4HLYA 5IOZA 1R9TJ 2HYFA 4UV9A 4XONA 5BOXA 3G3ZA 1JKQC 2EZHA 3PNTA 1ZG1A 5EGOA 3GTMJ 2WB1A 2CGPA 2OZ6A 4L18B 1G4DA 3W6JB 3MKLA 2XB5A 2XUBA 1JTXA 1MMDA 3MZ8A 4ZDLA 1TNSA 2PN6A 2EV0A 3LQQA 3ZN0A 3C1DA 3DLAA 1R49A 1S7AA 3W6KB 1J09A 5DV5A 2PMZN 3Q3SA 3S3OA 2R7FA 4OU0A 5DD4A 2PJRB 1KU3A 2K85A 3SXYA 5EDNA 3BOQA 1R4NB 3V7SA 4EJTA 3WTXC 2ZB9A 4AYBA 3VOEA 2X6OA 2MH2A 2O7OA 3BJOA 5D4SA 5GADJ 4KIGA 3HEFA 4XKBA 3IHUA 3KP6A 4PDKA 4HZFA 3ECOA 1F43A 3K4KA 2R4GA 1ETXA 3HHGA 3RJPA 3MKYB 1XSVA 3JTHA 5K7ZA 2F5CA 3KEQA 3OSGA 2FD5A 3LSJA 1ZR4A 1VQMI 1MJ9A 3NEUA 1V5GA 5F1RA 2FEZA 1Z6RA 2FMYA 1USSA 3K7AJ 2IA1A 1SFKA 5GTIC 2W84A 2DLLA 3ZPLA 4A3DJ 2XGCA 3JRDA 5E1XA 2MW8A 1BI2A 5B66C 3FHNA 3LSIA 2BY3A 2LBFA 3VFZA 2W48A 3CCRI 4ZZLA 2GA1A 5FROA 4XLHA 1P92A 2AXTC 3E6BA 2G0EA 2BXYA 1ZLJA 2M87A 2ZFUA 3CDIA 1V5EA 1W7PB 4A3CJ 4WF2A 2GIVA 3BC8A 3A2KA 2PMUA 5E1ZB 3HRSA 3R6SA 4OIQF 1S3JA 5IOYA 1ETWA 2Q2EA 3VYUB 2EILH 4HW0A 2E1MC 4UUTA 1VQLI 2QQBA 4I2OA 2RREA 4GCVA 5GTHC 2WB1N 3E5XA 2CQQA 4LG0A 4HBLA 1IRZA 3RZOJ 3HOZJ 2OC6A 3KEYA 2E1NA 2GM4A 2QYOA 1Z3XA 1KU9A 2GXAA 4Y15A 3S1MJ 1DU6A 2WADA 3RDIA 4UUSA 2DMNA 3H3UA 4BGDA 3GLXA 4PSWA 2XSJC 1E3PA 2CW0F 3BROA 2KPMA 3OYMA 1T95A 2VBXA 1YRNA 4ZTFA 3FXOA 2J5OA 2VT2A 1SEUA 5HDKA 2VLAA 4AYBN 5IY5H 1H8AC 1S8NA 3WTZA 1HW1A 2ZJRF 1VTNC 2OBPA 1X1BA 2HPIA 3L2WA 4TV7A 2XB0X 2DDBA 2M30A 5E20A 4ETSA 3Q0VA 1MNDA 4NC7A 3KLOA 3L2RA 4B43A 1I50J 2NNYA 4F91B 5CYVA 4C2TA 3HGYA 1H9GA 4CZZA 4A3LJ 1LUJB 1TWHJ 2ZCWA 2ZXJA 3L2CA 4IOAF 2R7UA 1ZAOA 1JI8A 2E1OA 2Y9YA 2AO9A 1P2FA 2R7TA 2VN2A 1X3ZB 2DA7A 3C3WA 4NNJA 3C18A 3R0JA 1D1BA 2L4AA 3ELKA 1ETVA 2ISZA 3GBGA 1TWCJ 5CQGA 3JREA 1D8KA 3IRRA 3CUQC 4P55A 3B73A 1YW7A 5IPAA 2LF7A 2HI3A 1WI3A 2BHZA 3K4NA 1AHDP 3PSIA 1B9MA 2R5ZA 1BIBA 3KP3A 3F3XA 4R8HA 2A3SA 1S7EA 4U0WA 5D6FA 4CGZA 1XGOA 3HSRA 4KNYA 4CDGA 2YPRA 3WU2C 1WWXA 1UHWA 3AG2H 5GAGJ 1VQ9I 1S5LC 4G6DA 1B72B 2WAFA 2CQ7A 2OJED 2WV1A 3IH3A 2G9WA 2FSWA 4U87A 4RDUA 3OS2A 2WAQA 5C44J 4OAYA 3DV8A 3R4KA 1PUFB 2DTZA 4ESBA 3KIOA 1K4TA 4A3MJ 2MC4A 4OIOF 3G1OA 3HKZA 4B48A 3DWLE 2G7HA 5EF6A 3TDUC 2P6TA 1DP7P 2IVMA 1ERDA 1STZA 2HTSA 4WXDA 3OY9A 2JPCA 3AKZA 2L7MP 2VKHA 1EH7A 5DCMB 4CZCA 1HW2A 3K70D 2VUMJ 1MDMA 2VBYA 1UG2A 2RNJA 4AVZA 2WY8Q 1Z7UA 1W4MA 4XKVA 1SC7A 4ZYAA 5GPAA 2CUEA 2OZUA 3WU0A 3GX4X 4Y17A 3BTJA 2O0YA 4U7DA 3P7NA 3JRBA 4OMYA 3NAUA 3K4MA 1SVLA 5TGTA 3Q0WA 1YYVA 1N77A 3ZQFA 4J19A 5GP9A 5LBQA 4XQFA 4MFDA 4Y3OA 2H8WA 5EEGA 2XDVA 1K6YA 1Z3YA 2M5WA 2BV6A 3CCQI 3S14J 1A6QA 3TL4X 5HLHA 1C0WA 3UKGA 4KICA 4I02A 4HDVA 4FETA 3RTRA 2DAOA 1MH4A 1HSJA 4XORA 4HF2A 3QPSA 2MYSA 1G2HA 2VC1A 2V4JC 3Q5FA 1YS7A 1YJ9I 2IEKA 3LMMA 1UCRA 2BY0A 5LGNA 1D3YA 1QO0D 2OTLI 2STTA 2L01A 3GYHX 3AG4H 3ABUA 3W3CA 2GXBA 2WAQN 1ORKA 3ONQA 2RC4A 2KZVA 2HXOA 1FOXA 1IN4A 4XLFA 2M4GA 3CDLA 4V2GA 4YELA 2BXZA 5K5RA 2XVCA 3FXJA 3HKZN 1R4MB 3CUQA 2HPMA 5AIQA 1EH8A 1XGMA 1RI7A 1R7JA 3DPUA 3BZ6A 3H92A 3CJNA 4BXXJ 1JHFA 1JKPC 4PJMA 2V1XA 4I6ZA 4X0GA 4PJNA 3BT9A 4PFPA 2W7NA 1IDYA 3TW7A 4CO8A 3BJ6A 5J8FA 1WQ2A 4HEA2 1MNEA 4PFOA 4BQNA 4HNTA 1VF9A 1HBXG 3HYIA 1LE8A 5FO5A 4QTRA 1WZ2A 4OIRF 2PX9A 1E3HA 2DA6A 3HG9A 2HZTA 3CUOA 2WBMA 3ABLH 1IGNA 4OOIA 5HNHA 1HOMA 1KQ8A 4YRVA 1J59A 4BYYA 2EZLA 1UG0A 3QYEA 2WC2A 5K7HA 4I0AA 1MMAA 4KN7X 3A01A 4NQWB 1IAWA 2ZNYA 4XRSG 5ILUA 4RAFA 5L3BA 1BR2A 5ICEA 1EF4A 2R5YA 5K1YA 5IT9Z 1D0YA 1GVDA 5BNGA 3H9QA 1YOVB 4HPQA 1MJAA 1IXSB 3FBIB 1V54H 3OYDA 3F6OA 3S1RJ 2HVRA 1TL8A 2LY2A 1GXPA 2DMUA 1B8IA 3IUOA 4XSXF 5L3DA 3CD6I 4M3FA 4BUPA 1XMAA 3LSTA 1IRFA 1I6HJ 2LOOA 5EG0B 2KIMA 3FM5A 1XPXA 3LFUA 2QBYB 3TGNA 4R79A 1BJAA 2A5YB 2XAGA 3ZMTA 4P1WA 5EYRA 3Q9SA 4LJZF 3ZN1A 2X6XA 1OCRH 2XHKA 1OCCH 3GUDA 2Y0MA 3ISPA 3K6GA 3L00A 1IV6A 4DBRA 3COAC 1V5FA 3MZYA 3LSPA 4HAMA 2ETHA 2R7XA 3CMMA 4ESFA 2F5EA 5LGTA 1BW5A 3A0BC 2XKOA 3WTUC 1FBQA 1IRXA 2VKEA 4LLLA 3L2VA 1PUEE 2D1HA 4BH9A 1WPKA 3FXKA 4F7ZA 2VQGA 3SEQA 3QOEA 4RBOA 3OS1A 1NK3P 5E3MA 4D5CA 2XIGA 2K40A 4PCQA 3T5XA 4EJWA 3KYLA 1R1UA 3HGGA 4C3IJ 4F93B 1HKQA 4EJUA 4UVCA 3QQAA 3WODF 2MABA 3WTTC 2WV0A 3PUFA 2BW3A 3IKTA 3R0AA 4CYCB 2VKDA 3I64A 4IHWA 5J1YA 2ID3A 1OMIA 2NOJB 3BG7A 2DN0A 3VEPA 3BQYA 1GLNA 1RUOA 1ZARA 2DMPA 2K4JA 4FASD 3CCYA 2DA5A 2OCEA 1SAUA 2Z2SB 4MQVA 1QNTA 2DA1A 3TW6A 3H5NA 1XDSA 1ENHA 2BBYA 3RKYA 4D9JA 1HA8A 1JXSA 4GXOA 4DGWB 2VJ5A 1P9QC 1X1AA 5JI6A 4GDFA 4FQGA 1W7PA 2HKOA 2NNNA 4A2UA 2BVLA 1NG7A 4F52A 2CQKA 2K7LA 3FXQA 3GXOA 3FM3A 1ZRCA 3VDXA 2CWEA 4M71A 4O3MA 1TWGJ 2COBA 5J1UA 2LFBA 2OPTA 1Z6TA 2EIKH 3LA7A 1JE8A 4C2UA 1LDDA 3ERED 1VQ7I 1A35A 2V9VA 2N8GA 3RCOA 2LREA 1MZBA 2XGXA 2BE5F 1D0XA 5FJ8J 1WH5A 3K10A 4DIQA 2FU4A 3CC4I 1VQOI 4XOPA 1O3QA 2HZDA 1B4AA 2GAUA 4M9SA 1YTYA 3ZQ7A 5AONA 2VQLA 2W4SA 2Z3YA 3HM5A 4L0ZB 4HG2A 2P7CB 3CJTB 4FX4A 5M5WJ 1WFXA 2E7WA 3PJRA 1ETOA 1R5GA 4AM3A 2QEXI 3R60A 4BQAA 3WGGA 1KYZA 4EATA 3J7YJ 3F9KA 4A5MA 3GCMA 2DCEA 1FMWA 2OTJI 4PUSA 4ENNA 1OCOH 3KEOA 1YX5A 2K9SA 1X3WB 1POGA 1F5TA 3ZQQA 3WGIA 4NBQA 4D0PA 4DNCA 5B5EC 5ERIA 1BIAA 2GQQA 3GFMA 4A3EJ 3L7WA 4MTEA 1R36A 5FD5A 2NRAC 1W7PD 4HV6A 4UHTA 4CXFA 3OYBA 1MMSA 1FYKA 3ZQHA 4LG3A 2EPFA 1X1PA 2VB6A 5DUKA 3BG5A 2XPWA 3ROUA 3F6VA 4E4HA 3BZCA 1P7JA 1NG6A 2H8RA 4QWQA 3W2VA 2FUG2 2UZKA 1MKMA 1IN8A 1O3SA 2XSDC 5IP6A 3DKXA 3CC7I 4GYIA 1VQNI 1XGNA 5F08A 3MZHA 4A12A 5JVGF 1SMTA 2LVSA 4KUMA 3ZMVA 1PUFA 2F5VA 1K83J 2DOAA 2EIJH 1BM9A 4YFKF 4JYKA 1U78A 1J2XA 2NS0A 2XF5A 4YEJA 3H9GA 4JX4A 1FPQA 2O5RA 5IYBJ 2BVMA 2A5WA 2O8XA 1ZLKA 4UB8C 1FIAA 2M1BA 3T8RA 2FOWA 2K86A 2IAIA 1Z7LA 2WA0A 4BY1J 4KA4A 5FLXK 5EZHA 2CUFA 1T6SA 3TP0A 4BE0A 3JRGA 2VJIA 4V19K 4A6EA 4BXUA 2GXGA 4AIHA 3CJQB 3RPUA 3ABMH 2Y31A 4G8XA 5E3NA 3JRAA 1FZPB 2CV0A 2JVHA 2E19A 3U21A 1KYWA 2NVQJ 4LOCA 4EVIA 4CHUA 1X4PA 2XGDA 3HSFA 3P9KA 4CICA 3JRFA 1ZRDA 2DMTA 1IO2A 4QSHA 1PP7U 4RLQA 3K0LA 2VE9A 2OAZA 3KP7A 2DA2A 9ANTA 4IOCF 3LSRA 2IW5A 2EBIA 1Y1VJ 4IKFA 3RQIA 2DOEA 3LNQA 2Y2ZA 2A69F 3A02A 3JTGA 2FJ1A 2KISA 4BY7J 1YS6A 3F8NA 2M0CA 5E3LA 3J80Z 1OPCA 2Y9ZA 2R92J 1XSXA 4Y13A 3KETA 3DPLC 2E1CA 2IA0A 1QHHD 1JT6A 3MN2A 3IH4A 2W85A 4E70A 3OS0A 1YI2I 3KCCA 2FMLA 3SZPA 3FKJA 3AAFA 2IA2A 4IEJA 3BQZA 1TW3A 3VYRB 4CUGA 4G7ZF 4FE7A 2UUZA 5D8LB 3JCUC 1K7AA 3MAJA 3ULQB 4DYQA 4EQQA 1KA8A 4H0EA 2HWVA 2X9DA 2DI3A 1TQIA 1AKHB 1T98A 1YIOA 4XN0A 5FB2A 3J81K 1JKOC 3VWBA 1XN7A 3OYHA 3B6CA 2UXXA 3ZQCA 2M9HA 2ELHA 3BWGA 2O6GE 4F55A 1XB4A 4M3EA 3IC7A 2GOXB 3RPUD 2KT0A 2IRFG 1J75A 2CH0A 2W00A 3O8HA 4XKCA 1AA7A 3K70C 3O3KA 3DP7A 3OV8A 2LY1A 3QU6A 3EUAA 4PJ0C 4BHCA 3HOSA 3FHZA 1ZGAA 2QGUA 1K78B 2V9PA 1G59A 2PQ8A 5CQEA 3V8LA 4E7IA 2HOTA 1BOAA 2GA2A 2IGKA 2R0QC 3E7LA 3CP8A 3BLYA 4AUXA 1T08B 2ECBA 2CFXA 5F0FA 1YITI 3I4PA 3MKWB 3BCBA 4KN4X 3UR3C 1U5TA 1EV7A 3HB9A 4IQJA 2L0KA 2L02A 2DPDA 2EFNA 4KDPA 1DGWY 3MCZA 3M8FA 3L9FA 1LFPA 3OWTA 1LVKA 4JOMA 4RM3A 5FKOA 3HOUJ 1IN5A 2EZKA 2RGVA 1ITYA 5FD6A 3M3YJ 1WJBA 3DKWA 3T1BA 2KDZA 3SJMA 1T8IA 3OIOA 4NB5A 3HOWJ 4EV0A 1OYYA 3OYLA 3GEZA 1TP4A 1YW8A 3H3ZA 2DK8A 5IP7J 4U0YA 3KZZA 2QSFX 2XV4S 3IWZA 5EG0A 3HTSB 1XC5A 1YHQI 4XLNF 5BMZA 4QPQA 4IXAA 3K4BA 2CW7A 4PSXA 1MD0A 5F0HA 5E17F 4HOBA 4DW6A 2M4KA 3TOAA 4CCLA 1MJBA 3I9V2 4N4NB 4ZYDA 3K1PA 4AVPA 4LB6B 2O03A 3HHHA 5F6FA 3HOXJ 2XF6A 3M7GA 3GZNB 1J0RA 3CCUI 1R71A 3PNYA 4P96A 3HJEA 4BS9A 3W2AA 3DF8A 4CCNA 4G94A 4KFCA 3O8GA 3FF5A 2B63J 5DEQA 2HGCA 5H6QA 3B6AA 3RIRA 1ZHFA 3PSFA 5CVVA 2DJIA 2VPRA 4P9FA 2JMWA 4CA0A 2M34A 1WVRA 1W5TA 1ZG3A 3WG7H 4KMFA 1Y0NA 3ZQLA 2P5KA 1P4XA 5KCMA 2QCOA 4CYCA 5CVUA 1Y0UA 2CQNA 3T8TA 4Z2YA 3BCAA 5L3EA 2OV7A 1X1CA 3DTIA 4L9NA 4GO1A 2HQRA 2E35A 1YJNI 1QVUA 1EJ9A 2I8DA 3PQJA 2V6EA 1ZQ3P 2EK5A 4HNVA 3DTEA 4D7NA 2R93J 4M3DA 4RLFA 5LRSA 4HSTA 1HLVA 3OIPA 3PQKA 3G4SI 1FLIA 1QQIA 1MW7A 3NWTA 3ASNH 3JRIA 1BA5A 4M9XA 1GXQA 2Q8KA 1XG1A 4XIDA 1I6XA 2MLKA 2STWA 5BS6A 2PEXA 1BL0A 3K9TA 3I5UA 1YX3A 2HTJA 2CG4A 1SD5A 2LKSA 5CVRA 1WCMJ 1FNNA 2QQAA 3S32A 2A68F 1JTYA 4OINF 4RAYA 3IWFA 1T56A 1JGSA 3TMOA 4DZJA 5HLIA 2KL4A 2VKVA 3BTIA 2XAFA 3GFJA 5F0CA 4PGGA 1U9NA 3CDHA 1R6RA 3S1QJ 5FRMA 5GPCA 2XROA 2NVYJ 3DEWA 3F8CA 3H36A 5LEKA 1TZLA 1XD7A 2WWYA 4YFXF 3S2WA 5K5QA 2DFIA 2L7KA 4GYGA 1SVMA 4IL6C 1FBUA 3ESWB 3IH2A 4LK1F 2F48A 3GLLA 1HF0A 4O5VA 2QKLB 5LLQA 5LRRA 3OR1C 5HDNA 2RDPA 1DU0A 3OL3A 2XRNA 4UV8A 1FWZA 1BBYA 3MFKA 3BJAA 2Z99A 4B3XA 3TQNA 1OR7C 2EIMH 4NC6A 4NUBA 4MEXF 2F5DA 2E2JJ 1WH7A 1HKTA 3S8PA 1I3AA 1SVOA 1WJCA 3CLQA 1LPQA 2PI0A 4A93J 4JX5A 2CMPA 2VXDA 4M6VA 1JT0A 2RQPA 5K7FA 1LQ1A 3VSLA 4M74A 1DGRM 3RZDJ 1K6OA 3QP6A 4YIFA 1IXRC 2DA3A 5L3FA 1XTAA 3NARA 2ZJQF 4Y7NJ 3J80K 4G7OF 2XAHA 1J7KA 2BGCA 4RB2C 3QWLA 2R7RA 5GAEJ 3GFIA 2L54A 1D5VA 4XMYA 5FKLA 2HEOA 4N4OB 3V7CA 4PGHA 2L5QA 2JA6J 5FFXA 4IRGA 3WU1B 1SFOJ 2HXIA 5J3LA 1XS9A 1OFCX 3SDBA 1OCZH 3H1CA 4MNUA 4BHPA 3C2GA 5IYCJ 4HDUA 3ZRGA 1K79A 3LWFA 2A61A 4GFBA 1ETQA 3FXRA 3L09A 4YG2F 3E6DA 2CQXA 2EA4A 3P9CA 4ZYHA 1LJ9A 2NXNB 2ME0A 2EQRA 2V6CA 3HIFA 1MSEC 2OUMA 2P5VA 1OISA 3S1NJ 4ZYEA 1VZ0A 3F8MA 4BAYA 3RSNA 2KQRA 3H5RA 4D1QA 2TRTA 4PJLA 2JT1A 3KYCB 3CMEI 5KK1A 4A5NA 3V4GA 1BI1A 2YR2A 3GZ5A 2CFOA 2YS9A 3DBHB 1FOKA 3PM1A 1J5YA 4C3JJ 1QHGA 2ELJA 4CH7A 1WSUA 2K02A 2JZYA 3AFHA 2QQ8A 3I55I 1W5SA 4ZDOA 1NTCA 1WKMA 3GW2A 3RKXA 2QWWA 3B02A 1U6GA 1ETYA 1XCVA 2NS7A 2RNGA 4XR6A 3G6EI 1CF7B 3AG1H 4P5OA 1VQKI 4HF1A 3RYRA 3BDDA 2XAQA 4IHSA 3SHFA 4BJ5C 3M8EA 1LEAA 4CCOA 3ZMZA 4MLOA 2OQGA 5KAIC 2IS6A 3TEDA 4U88A 1TT5B 3VB2A 3SDGA 4AD9A 1ZREA 2DO7A 5A2QZ 5BPIA 1OR7A 4MEYF 1DPUA 1HDPA 1L0OC 2K5CA 2M3AA 3LQRA 2DT7B 1HCRA 1ACIA 4Y33A 4BJ6C 2JA7J 3CTAA 3WTSC 2IGMA 4DZPA 1B9NA 5H20A 4DOZA 4E7ZA 2M2EA 1BR1A 2DDAA 3BR1A 4W97A 4RM2A 2X1DA 3K2ZA 2FBHA 5EGOB 2ECCA 3CCEI 2P4WA 5DUIA 4N9HA 1FEXA 1AKHA 3V8JA 3EYIA 3PO2J 4Z6YA 4G12A 3ZMSA 1U9OA 2P81A 3ZQIA 1SMYF 2L7FP 2LYCA 3CP2A 4M3BA 1OCPA 3WTVC 1MBFA 1YIJI 2EFOA 2GOMA 3LA3A 1RR8C 3M4OJ 3G1LA 4IHVA 5J47A 4XM3A 5HNFA 2IS1A 3QU3A 4XNFA 4OIPF 3NRVA 2LKXA 3W2WA 2DODA 4UUVA 1D0ZA 1H89C 2XRLA 1K78A 2A6EF 4BBSJ 2BEOA 4AWXB 3N4MA 2DMQA 5J6XA 2V1NA 3FISA 2O3FA 1SFEA 3BPXA 1FOWA 3GTOJ 1I27A 1N78A 1ZRFA 2PJRA 2VQCA 1WJEA 2ZSHB 1T0FC 2RV8A 1YQAA 2ZNZA 3EDPA 4RGRA 5JLXA 4LIVA 1R22A 2R7VA 4FX0A 1Z1DA 4G6QA 1R5ID 2RQQA 1ZELA 4E7LA 2P6SA 1N75A 3KLNA 2RN7A 4WX9A 1WHUA 4IHYA 2CSOA 1IF1A 4BL0B 5D5XB 5D5WB 5D8KB 4P9UA 5LD2C 4B1RA 5KAFC 1WJAA 1FSEA 2EJRA 4FT8A 3TO9A 5E8IA 4XRFA 2OCCH 2IT0A 5ILVA 1OCTC 4Q47A 3JAMZ 3OYGA 5LFAA 2B7EA 4FTHA 5HS7A 2A6TA 5FFZA 2XPVA 3OYEA 1UELB 2DT5A 2KJCA 1HXDA 3P5JA 2DQLA 2ELKA 2ZMEB 3GMEA 1W36C 5DM7F 3HOTA 4A3JJ 3OL4A 2L9VA 2XGEA 4Y4RA 3LSKA 1GUUA 4ENKA 1RUNA 1O57A 3J7ZI 3OYKA 4YFNF 4XRMA 3C7JA 2QM3A 5DCFA 3DBLB 1QZZA 1ZG5A 3CJRB 2VJ4A 3HL2A 3VYSB 4IVNA 4ASNA 3WE3A 4EEFG 5JVTA 3H0GJ 1TTYA 3HUGB 3ZMUA 1BR4A 1TWFJ 4LLGF 1FTTA 3LFKA 1HKSA 4M72A 1Y6IA 1KU7A 4DJAA 3S16J 1OLTA 1QU3A 2E71A 4B4CA 2ESHA 2DBBA
chains in the Genus database with same CATH topology
1X3ZB 3ESWB 4YIRX 1TP4A 2F4OB 2F4MB 2QSHX 1X3WB 2QSGX 1QZEA 1PVEA 2QSFX 1OQYA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1X3Z B;  3ESW B;  4YIR X;  1TP4 A;  2F4O B;  2F4M B;  2QSH X;  1X3W B;  2QSG X;  1QZE A;  1PVE A;  2QSF X;  1OQY A; 
#chains in the Genus database with same CATH topology
 4N9I A;  1FBS A;  3BTL A;  2M8G X;  2ZJP F;  1SD6 A;  1F9N A;  2JPB A;  3HXL A;  5CLS A;  1NHA A;  2B9S A;  1GVJ A;  2X0L A;  3C2B A;  3P9I A;  4U0V A;  3KP2 A;  2E2H J;  2H1K A;  1RPW A;  4HSR A;  4I99 C;  3GTP J;  4HF0 A;  2DYS H;  2AQF A;  3TP3 A;  6PAX A;  4LB5 A;  4NDL A;  4BJT A;  1R5H A;  3GTJ J;  3F21 A;  2CS3 A;  4KIT B;  1KZH A;  1T0F A;  3JRC A;  3CMA I;  1TWA J;  2H6C A;  1FY7 A;  3ZOB A;  5JFR A;  4BQO A;  1ZGJ A;  2Z16 A;  3KZY A;  5EEA A;  5H6R A;  1KQ0 A;  3SQN A;  4RMN A;  1VQ8 I;  2LKP A;  2YX7 A;  1X19 A;  1IN6 A;  4EMS A;  3OYI A;  3I59 B;  1VND A;  5EEH A;  3KFW X;  1VQ5 I;  2VE8 A;  3CZ6 A;  3QPH A;  5C4X J;  4XLP F;  2X51 A;  3MD2 A;  1B72 A;  3U1D A;  2O61 A;  2VJJ A;  1HDD C;  2IGN A;  1F1Z A;  2EZI A;  4K2E A;  2YX4 A;  4C9Y A;  2B0L A;  1LVA A;  2DFE A;  2ACJ A;  3QP5 A;  1YO5 C;  1TQP A;  1AU7 A;  1DPR A;  1DDN A;  4RA2 A;  1MBH A;  1M1E B;  2BY1 A;  2D2W A;  2OA4 A;  2DJN A;  1SD7 A;  1I39 A;  3DXJ F;  3TBI A;  2BOL A;  4LGW A;  1PDN C;  3DU5 A;  1QPI A;  4HX8 A;  1Q1V A;  1X2M A;  3W6V A;  3QOD A;  3WGH A;  1APL C;  2FF4 A;  3AL0 B;  5DCM A;  3DBR B;  4V2F A;  4I0B A;  2A05 A;  2K3P A;  2JSC A;  3D5R C;  1G3S A;  2LC2 A;  2CUZ A;  2M0M A;  1RZ4 A;  3OOU A;  4IRI A;  4EGZ A;  1LDK B;  4GRI A;  3GTK J;  4JQF A;  5AIP A;  4U7B A;  2EA2 A;  2P8T A;  2JA2 A;  4E7H A;  2CJJ A;  2RVC A;  2IBD A;  4DYC A;  3QYF A;  2Q0O A;  3EUH C;  1FTZ A;  3FXM A;  2C6Y A;  1AWC A;  1UB9 A;  2Y75 A;  2JUG A;  2GIZ A;  1U8R A;  3L2Q A;  4L9V A;  4B09 A;  5IT9 K;  2R7W A;  2Z5U A;  2DFF A;  2DXI A;  4KT6 A;  3CCS I;  4KT5 C;  2QZ8 A;  3RPQ A;  2IXS A;  2R7Q A;  3KP4 A;  2IPQ X;  1B1B A;  5KHD A;  2GWR A;  4E7S A;  3IL2 A;  3WHC A;  5K5O A;  3CUQ B;  3S3M A;  2UV1 A;  5D5U B;  4MO7 A;  1TC3 C;  3K1M A;  3H0D A;  3CMY A;  4G7H F;  1O7L A;  4M6X A;  1RNL A;  1CGP A;  4A3G J;  2BHY A;  2ZJ2 A;  3JSP A;  3ZCO A;  1LB2 A;  4CCM A;  4Q48 A;  2KFD A;  1UJ8 A;  2E34 A;  3O2P E;  4I98 B;  4XLC A;  4B3A A;  3I53 A;  4AID A;  2E36 A;  3C2H A;  3HRM A;  4JBA A;  1BI0 A;  5E1W A;  1WRJ A;  2M8E A;  3GF2 A;  1W36 D;  1LE8 B;  1PP8 F;  4HX4 A;  4EM2 A;  2DQR A;  2Y0S A;  2MD5 A;  2ZKZ A;  2IJL A;  1U3E M;  2HOS A;  3KZI C;  2EFQ A;  2XAU A;  1WGX A;  1A31 A;  2YSR A;  2JRT A;  4FCY A;  2VOP A;  4YII A;  2ZME C;  3G2B A;  4NC8 A;  2VQH A;  3OIQ A;  3GTQ J;  2O9L A;  2FA5 A;  4I01 A;  1CQT A;  2PFB A;  5JR3 A;  3D5S C;  3ZXS A;  5CPR B;  3FZV A;  3HOV J;  5LGU A;  2YU3 A;  3J7A Y;  3PO3 J;  1AOY A;  4II3 A;  4A69 C;  4EM1 A;  2VAS A;  3IRQ A;  4ANJ A;  1T39 A;  2KHM A;  3HRT A;  5E8G A;  2LRD A;  1J9I A;  2E5N A;  1H9T A;  3I0T A;  3FMR A;  4QPO A;  3D5L A;  3ZQG A;  4YIR X;  1JUP A;  1T33 A;  3WHB A;  2VBW A;  1MBJ A;  4O6J A;  4EJV A;  1ZTR A;  2LSO A;  2MLG A;  1JJ6 C;  4NQW A;  1IUF A;  3E6C C;  3E3V A;  1P6R A;  2HDD A;  3JAM K;  1Y8R B;  3LOC A;  2P5L C;  2YU9 J;  2LNB A;  3CES A;  2X48 A;  3MEX A;  1MSF C;  1PVE A;  3I56 I;  2K9Q A;  1V4R A;  5DS9 A;  5IP9 J;  2HU9 A;  1QBJ A;  3BR2 A;  1JHH A;  3G71 I;  4IQ4 A;  1B6A A;  1FP2 A;  4J01 A;  5EZG A;  2QF7 A;  3F23 A;  4A6D A;  1H88 C;  3VPR A;  4ZYG A;  2ID6 A;  5E79 C;  3F0C A;  3K4J A;  4LK0 F;  4L5E A;  1A04 A;  4EM0 B;  2LD5 A;  1MBK A;  2M7A A;  3ZGK A;  2QBY A;  3FXU A;  1TQM A;  1XMX A;  2TDX A;  1RKW A;  4A3I J;  4IRH A;  3EUH A;  1MBG A;  3GFL A;  1RRJ A;  2F5F A;  2LDU A;  2H6B A;  4QIW N;  2JN6 A;  5JHU A;  1IDZ A;  2H1L A;  2Y0S N;  2YUS A;  3A1Y A;  1LKX A;  2W25 A;  2CYY A;  5M5X J;  3PL8 A;  4HQE A;  3H35 A;  5F27 A;  4R1H A;  3D1N I;  3ABT A;  1ZH5 A;  4PZJ A;  2W57 A;  3ASO H;  5B3S H;  1JKR C;  4UY8 I;  4PK4 A;  1FYL A;  1EA3 A;  1OYW A;  3FKI J;  2L9N A;  1MH3 A;  2VXZ A;  2BW3 B;  2Y30 A;  3V7R A;  4A0Y A;  4HLX A;  3E97 A;  3JR9 A;  2EV5 A;  1MIJ A;  2ZBK A;  2VIX A;  2MD0 A;  1FX7 A;  4RGX A;  3KYD B;  1DP3 A;  4HA8 A;  3QPT A;  5HS8 A;  2LLK A;  4BBR J;  3DFG A;  3RYP A;  4HX7 A;  2AQE A;  1ZYR F;  2W82 A;  2EIN H;  5ICG A;  1K4S A;  2QUF A;  3VOD A;  1X58 A;  4L5J A;  1HW5 A;  1X4O A;  4X6A J;  1R58 A;  3FMQ A;  1RIO H;  1QPM A;  3EQL F;  2J5P A;  2JVG A;  3CCJ I;  3GTG J;  4XLA A;  4BAC A;  4D7M A;  1O3T A;  5F64 A;  2ME6 A;  4F92 B;  4DYR A;  3CO6 C;  5L3C A;  4IF4 A;  3ZR8 X;  3EUK L;  3OYJ A;  4DQ2 A;  2L7Z A;  1I3Q J;  2MC3 A;  3CLO A;  3MVP A;  4IHT A;  5FRN A;  2ZME A;  4HNU A;  2GLO A;  3DPT A;  3I4M J;  4BDY A;  3I58 A;  2KIQ A;  2QLZ A;  4FIS A;  1ZR2 A;  4MGR A;  2R3S A;  4IO9 F;  3I54 A;  1FSH A;  3AL0 C;  4KJZ A;  1S72 I;  3DCF A;  2MFZ A;  2XAJ A;  2H09 A;  2L9R A;  3KE2 A;  4C30 A;  5B1B H;  4I7H A;  3RQ4 A;  2QA4 I;  3M07 A;  2HQA A;  1QGP A;  1ZKG A;  1Z21 A;  3BY6 A;  4I76 A;  3PIP F;  4G9Y A;  4DBQ A;  1UMQ A;  2PJP A;  2VOO A;  1RR7 A;  1XX5 A;  3R61 A;  3OYN A;  4BEH B;  3HUG A;  3TKY A;  3A4C A;  4ZDP A;  4WXC A;  4RAZ A;  4A3B J;  3A0H C;  2F6C A;  1P4A A;  3ERM A;  4QLC U;  2DT6 A;  2W24 A;  4BQQ A;  3J7A O;  3BR0 A;  3RKW A;  2ZSI B;  3WTW C;  3HC7 A;  5IYD J;  3BG6 A;  4IHX A;  3MQ0 A;  5E3O A;  3E6M A;  5C4J J;  4CCJ A;  2CV1 A;  2V9K A;  4JP0 A;  2DA4 A;  4A3F J;  3GZ6 A;  2VON A;  1SFX A;  1A36 A;  1F36 A;  4UB6 C;  4E7J A;  2QSG X;  3HBL A;  1LEB A;  2RAE A;  1EH6 A;  1IJW C;  2CO5 A;  2NOG A;  4RB1 A;  3D0S A;  1QZY A;  2DTR A;  4AIK A;  2KIU A;  2EV6 A;  2QEN A;  2FRH A;  1KU2 A;  3V42 A;  4WXH A;  1A6I A;  2WTE A;  1S6L A;  2XAS A;  3GVA A;  3HTU A;  4XIC A;  3K2A A;  4XBF A;  1JJ8 C;  3U1K A;  4WCG A;  3GO5 A;  2A6H F;  5HDG A;  3FX3 A;  3CCM I;  2HYG D;  3S2D J;  4C3H J;  2FOK A;  1HST A;  4GGG A;  1S7O A;  2JA5 J;  2X6Y A;  3I59 A;  3BR3 A;  3IKV A;  1FMV A;  2FX0 A;  3DEE A;  1ODD A;  3M9A A;  4XK4 A;  3HOY J;  1ON1 A;  3FDY A;  3S17 J;  1P7I A;  4HRI A;  2L4M A;  2IP2 A;  2XPU A;  2K9N A;  1Z77 A;  2ZXI A;  1Z91 A;  3PNV A;  5M3F J;  2K27 A;  1LFU P;  4CSW A;  1RKT A;  1KON A;  2R7O A;  5ILS A;  4WWC A;  5EJC A;  5TRD A;  3Q9V A;  3CCV I;  3H3V K;  2IS4 A;  1U0J A;  2X1E A;  1BC8 C;  3OOP A;  1IUY A;  4HV5 A;  3LL7 A;  3K4C A;  3E0J B;  2OU2 A;  2VT3 A;  2HR3 A;  2JWT A;  3SFZ A;  5J8C A;  1YG2 A;  2H94 A;  2HDW A;  1W5C C;  1TBX A;  2HOE A;  4L5I A;  2KZG A;  2LTP A;  2FQ4 A;  3KP5 A;  2HVS A;  1PJR A;  4LMY A;  4II2 A;  4BDZ A;  5ICC A;  2E5Z A;  3QPL A;  2JUC A;  3A03 A;  2F2E A;  4B44 A;  1GHC A;  5D5V B;  1BN5 A;  2VI6 A;  4IX7 A;  2Y48 A;  3HZJ A;  1BC7 C;  2AXL A;  2VC0 A;  1WJF A;  3O6B B;  3F8B A;  2LK2 A;  2PG4 A;  3HPH A;  1X3U A;  5LHH A;  3QRF F;  2JSP A;  4G6T B;  3OYA A;  2PLY A;  2KRF A;  3G1M A;  1TT0 A;  2L3D A;  4KIS A;  2EFP A;  2FBK A;  2FE3 A;  4M9Z A;  1XGS A;  4E7K A;  1OYI A;  4JX6 A;  4KIF A;  1I1G A;  3VSK A;  3LAJ A;  2E2I J;  3FK7 A;  2MSY A;  3TOB A;  4IZZ A;  2PMH A;  3IAS 2;  5ED4 A;  1A5J A;  3LA2 A;  1TNT A;  5HOO A;  1NH3 A;  4A0Z A;  2MBF A;  1W1W E;  4Q5S F;  2MH9 A;  2WAE A;  1MNM C;  4AC0 A;  5CJ9 A;  4ENM A;  4MHG A;  2E7X A;  2V1U A;  5BQT A;  1BW6 A;  1BOB A;  2CUJ A;  1KQ9 A;  4S0H B;  5D4R A;  2K4B A;  3AG3 H;  1Z9C A;  2IS2 A;  4LIU A;  5FLX Z;  2ZC2 A;  2L9S A;  3F22 A;  5LHI A;  4BE2 A;  3HDD A;  3ML6 A;  4NHJ A;  4CYD A;  4M73 A;  2JJ7 A;  5L3G A;  1FP1 D;  3HRU A;  2D5V A;  2NVX J;  2QVO A;  3H9J A;  3BR5 A;  2EWN A;  3NQO A;  3MKZ A;  5DDG A;  5M3M J;  1UHS A;  4OAZ A;  5CVI A;  3JSO A;  1SAX A;  5CKT A;  3LSG A;  2QSH X;  1OQY A;  2LP0 A;  3JRH A;  2X85 A;  4XKW A;  2LY9 A;  4IPA A;  3VYT B;  4RAG A;  4ABZ A;  2ZO4 A;  2NVT J;  4C2M J;  1IZ1 A;  3CO7 C;  3UNG C;  1IN7 A;  3DEU A;  1U5T B;  4OMZ A;  2D45 A;  2ZXW H;  2RKH A;  1NK2 P;  2K3F A;  2QQ9 A;  3OMY A;  1R1T A;  2KJB A;  2EFW A;  1YE9 A;  1O7F A;  4LIT A;  1KGS A;  1VQP I;  3H5A A;  4XRS A;  2DW4 A;  2R7D A;  1YW9 A;  4XLE A;  2CV2 A;  4BE1 A;  1ONV A;  2HKX A;  4J00 A;  1VQ4 I;  3HPG A;  3MWM A;  1Q1H A;  2WY7 Q;  1IW7 F;  2EH3 A;  2VOD A;  1G3Y A;  4RS8 A;  2G7U A;  5FLM J;  2DPU A;  3BTC A;  1YLF A;  2LH9 A;  4KYW A;  3U9G A;  2FNP A;  3GTL J;  1JGG A;  1JUS A;  2TCT A;  1L3L A;  1OKR A;  4H4K C;  1VI0 A;  2COM A;  2LBF B;  5DD8 A;  1U8B A;  3IAM 2;  3J81 Z;  2ZFW A;  1UAA A;  2LF8 A;  3M8J A;  1XCB A;  2CRG A;  3FXL A;  2CU7 A;  3FK6 A;  1IXC A;  5FKK A;  2LG4 A;  2V1D A;  2Q2E B;  1XMK A;  3S15 J;  2K9L A;  2XKP A;  4LLN A;  2OF7 A;  3RI4 A;  2XF7 A;  1LDJ A;  3BPV A;  4LG0 B;  1IV8 A;  2HQN A;  3SEZ A;  1UST A;  3OR2 C;  1ZN2 A;  4HQM A;  4ESJ A;  1Y39 A;  1HC8 A;  1V55 H;  5M5Y J;  4UUS B;  5DTD A;  3X2Q H;  1OJL A;  4Q4Z F;  4L9T A;  1DQU A;  1U2W A;  1YRN B;  4LD5 A;  1YFH A;  3G73 A;  1MMN A;  3U2R A;  2MG4 A;  1K61 A;  2NAZ A;  1T2K A;  2X4H A;  3CQZ J;  5ICF A;  4AU7 A;  4E6K G;  1EKE A;  3K4L A;  5E18 F;  4L9J A;  4ZH4 F;  2Z9O A;  1BJZ A;  1TLH B;  5FGM A;  1IRG A;  1IG7 A;  3GWZ A;  1UHM A;  5KVR A;  3RKQ A;  2HNH A;  1T38 A;  3QOP A;  4M6Y A;  4BKX A;  4ZJZ A;  5BPD A;  2HS5 A;  2HOA A;  1RES A;  1V3F A;  3KPH A;  5JLW A;  2X6W A;  4N0B A;  2I5U A;  2HYJ A;  3CCL I;  2ISY A;  2M7B A;  4RB0 A;  3DU6 A;  3BZK A;  3OYC A;  4KMU X;  5FKM A;  3E1S A;  2LMD A;  3E5Q A;  1WJ5 A;  3BR6 A;  3ZMD A;  1GT0 C;  3T0Y A;  1FYM A;  4A3K J;  1QA6 A;  2F4I A;  1Y8Q B;  4FE4 A;  1FC3 A;  5TJJ A;  3EPZ A;  2R7S A;  3ABK H;  4X1E A;  1UZC A;  3LSH A;  2IGO A;  2OD5 A;  4M3G A;  2DK5 A;  2F4M B;  3QAH A;  2Q1Z B;  3WTY C;  2KDO A;  1VFC A;  1H0M A;  1ETK A;  2R5Z B;  1R23 A;  1YJW I;  1QRY A;  1F4K A;  4IJA A;  1WJD A;  3F72 A;  3N05 A;  3MMY B;  3PIO F;  1LFB A;  1G3W A;  3Q0U A;  2E60 A;  4BXF A;  3HSE A;  1N25 A;  1R1V A;  2FBI A;  3PUB A;  4LFU A;  4BHB A;  4UNO A;  4Y52 J;  2ICW G;  4BU2 A;  3K69 A;  4RB3 C;  1E2X A;  1E17 A;  5GAH J;  5J40 A;  5LEJ A;  3SYT A;  3CF5 F;  1D5Y A;  4XOT A;  4BEH A;  1E3O C;  3CF2 A;  4L0Y B;  5C3E J;  5DYM A;  5HLT A;  3OSF A;  3WG9 A;  1Z0X A;  1O3R A;  5F04 A;  2OQR A;  2KMU A;  1Z05 A;  2A07 F;  2KRC A;  3M1E A;  5J4V A;  1GV5 A;  1GV2 A;  1G8X A;  1ZGW A;  1MMG A;  3TO7 A;  5HVQ C;  5KNL A;  4FHT A;  2FNA A;  1PYV A;  2ADU A;  4UVB A;  3DTK A;  1RET A;  3LSM A;  4EGY A;  1TW2 A;  3FWE A;  5HLG A;  2GZW A;  1SAN A;  3DLL F;  1WI9 A;  1MDM B;  2JQ7 A;  1BI3 A;  2AS5 F;  1B59 A;  2NYX A;  2D1V A;  2E1M B;  3ECH A;  3M1C A;  2P0W A;  1O4X A;  3I4N J;  2KKO A;  5FKN A;  4XSZ F;  2HQ5 A;  3CC2 I;  1Z67 A;  5B1A H;  1W0T A;  1GDT A;  4MFE A;  2V7F A;  4RGU A;  3EYY A;  3WE2 A;  2O8K A;  1VQ6 I;  4AIJ A;  4MQ9 F;  1MBE A;  4MTD A;  3IP4 B;  3PFY A;  2GBY A;  4D5F A;  2VBZ A;  3F8F A;  2V79 A;  2JK3 A;  1REP C;  2BY2 A;  2NS8 A;  4RGS A;  3V8K A;  1R00 A;  1MGT A;  5F1J A;  1FIP A;  4ENJ A;  2JA8 J;  2UXN A;  2QKM B;  1XSD A;  1Y56 A;  1ULY A;  2PBI A;  2JTV A;  4BNC A;  1E0E A;  4CCK A;  3FMS A;  5A2Q K;  3SZT A;  4XN3 A;  3SZG A;  1U5T C;  1S29 A;  2FQ3 A;  4EJO A;  5HS9 A;  1ON2 A;  1D1A A;  1I5Z A;  4WK8 F;  2K9M A;  2Z1D A;  5H2F C;  1IC8 A;  1SFU A;  1FOY A;  3DKY A;  4ZZD A;  1S9H A;  2HFH A;  2KIF A;  2DYR H;  4OWR B;  4ITV A;  2V26 A;  2KLO A;  5FLV A;  2KRH A;  4JK1 X;  2X1C A;  3L1P A;  4A0X A;  3N97 A;  3EET A;  3QYB A;  4B47 A;  4S04 A;  1XDU A;  2MA3 A;  3I71 A;  4ZC3 A;  3S3N A;  1QZE A;  1LNW A;  5D6E A;  2ZXH A;  1W0U A;  3FBN B;  2I10 A;  2PMZ A;  3FIW A;  4I09 A;  2R7Z J;  2DFH A;  1X1D A;  2MGQ A;  5LHG A;  2BZT A;  3REO A;  3LAP A;  1FT9 A;  3NWS A;  3TO6 A;  1QVT A;  3ZP5 A;  3JW4 A;  3L2U A;  1DUX C;  3IV5 A;  2AHQ A;  5DM6 F;  1D8J A;  2DU9 A;  3E5U A;  2Z33 A;  1D1C A;  3I3L A;  2M45 A;  2L2O A;  2P7V B;  2HDC A;  3S93 A;  2XC7 A;  1X2N A;  4ON0 A;  5JHF A;  2F4O B;  3S2H J;  5J4Y A;  4W1U A;  1JUM A;  3KX2 A;  3K1N A;  4UXN A;  1RC9 A;  3PFI A;  3A01 B;  2H27 A;  1G3T A;  1CF7 A;  4MIM A;  4PJJ A;  1ZK8 A;  5CVJ A;  2CW8 A;  2VL8 A;  3DQV C;  5IT3 A;  4ZTJ A;  4UVA A;  2UWM A;  2KP6 A;  3BP8 A;  2R5Y B;  1I1S A;  2NVU B;  1Y1W J;  3TDZ C;  5J1R A;  1HQC A;  2Y69 H;  2W1O A;  4B8X A;  2EB7 A;  2HVQ A;  4F3Q A;  1SD4 A;  4HYE A;  2FXA A;  1P4W A;  2JRM A;  1G6N A;  3BG9 A;  4KIB A;  5TIS C;  1FJL A;  2VPL A;  2LR8 A;  2BYV E;  3OYF A;  3BG3 A;  4XL9 A;  2ESN A;  1B8I B;  2DOF A;  4S05 A;  3SFI A;  5HOD A;  1UFM A;  4HLY A;  5IOZ A;  1R9T J;  2HYF A;  4UV9 A;  4XON A;  5BOX A;  3G3Z A;  1JKQ C;  2EZH A;  3PNT A;  1ZG1 A;  5EGO A;  3GTM J;  2WB1 A;  2CGP A;  2OZ6 A;  4L18 B;  1G4D A;  3W6J B;  3MKL A;  2XB5 A;  2XUB A;  1JTX A;  1MMD A;  3MZ8 A;  4ZDL A;  1TNS A;  2PN6 A;  2EV0 A;  3LQQ A;  3ZN0 A;  3C1D A;  3DLA A;  1R49 A;  1S7A A;  3W6K B;  1J09 A;  5DV5 A;  2PMZ N;  3Q3S A;  3S3O A;  2R7F A;  4OU0 A;  5DD4 A;  2PJR B;  1KU3 A;  2K85 A;  3SXY A;  5EDN A;  3BOQ A;  1R4N B;  3V7S A;  4EJT A;  3WTX C;  2ZB9 A;  4AYB A;  3VOE A;  2X6O A;  2MH2 A;  2O7O A;  3BJO A;  5D4S A;  5GAD J;  4KIG A;  3HEF A;  4XKB A;  3IHU A;  3KP6 A;  4PDK A;  4HZF A;  3ECO A;  1F43 A;  3K4K A;  2R4G A;  1ETX A;  3HHG A;  3RJP A;  3MKY B;  1XSV A;  3JTH A;  5K7Z A;  2F5C A;  3KEQ A;  3OSG A;  2FD5 A;  3LSJ A;  1ZR4 A;  1VQM I;  1MJ9 A;  3NEU A;  1V5G A;  5F1R A;  2FEZ A;  1Z6R A;  2FMY A;  1USS A;  3K7A J;  2IA1 A;  1SFK A;  5GTI C;  2W84 A;  2DLL A;  3ZPL A;  4A3D J;  2XGC A;  3JRD A;  5E1X A;  2MW8 A;  1BI2 A;  5B66 C;  3FHN A;  3LSI A;  2BY3 A;  2LBF A;  3VFZ A;  2W48 A;  3CCR I;  4ZZL A;  2GA1 A;  5FRO A;  4XLH A;  1P92 A;  2AXT C;  3E6B A;  2G0E A;  2BXY A;  1ZLJ A;  2M87 A;  2ZFU A;  3CDI A;  1V5E A;  1W7P B;  4A3C J;  4WF2 A;  2GIV A;  3BC8 A;  3A2K A;  2PMU A;  5E1Z B;  3HRS A;  3R6S A;  4OIQ F;  1S3J A;  5IOY A;  1ETW A;  2Q2E A;  3VYU B;  2EIL H;  4HW0 A;  2E1M C;  4UUT A;  1VQL I;  2QQB A;  4I2O A;  2RRE A;  4GCV A;  5GTH C;  2WB1 N;  3E5X A;  2CQQ A;  4LG0 A;  4HBL A;  1IRZ A;  3RZO J;  3HOZ J;  2OC6 A;  3KEY A;  2E1N A;  2GM4 A;  2QYO A;  1Z3X A;  1KU9 A;  2GXA A;  4Y15 A;  3S1M J;  1DU6 A;  2WAD A;  3RDI A;  4UUS A;  2DMN A;  3H3U A;  4BGD A;  3GLX A;  4PSW A;  2XSJ C;  1E3P A;  2CW0 F;  3BRO A;  2KPM A;  3OYM A;  1T95 A;  2VBX A;  1YRN A;  4ZTF A;  3FXO A;  2J5O A;  2VT2 A;  1SEU A;  5HDK A;  2VLA A;  4AYB N;  5IY5 H;  1H8A C;  1S8N A;  3WTZ A;  1HW1 A;  2ZJR F;  1VTN C;  2OBP A;  1X1B A;  2HPI A;  3L2W A;  4TV7 A;  2XB0 X;  2DDB A;  2M30 A;  5E20 A;  4ETS A;  3Q0V A;  1MND A;  4NC7 A;  3KLO A;  3L2R A;  4B43 A;  1I50 J;  2NNY A;  4F91 B;  5CYV A;  4C2T A;  3HGY A;  1H9G A;  4CZZ A;  4A3L J;  1LUJ B;  1TWH J;  2ZCW A;  2ZXJ A;  3L2C A;  4IOA F;  2R7U A;  1ZAO A;  1JI8 A;  2E1O A;  2Y9Y A;  2AO9 A;  1P2F A;  2R7T A;  2VN2 A;  1X3Z B;  2DA7 A;  3C3W A;  4NNJ A;  3C18 A;  3R0J A;  1D1B A;  2L4A A;  3ELK A;  1ETV A;  2ISZ A;  3GBG A;  1TWC J;  5CQG A;  3JRE A;  1D8K A;  3IRR A;  3CUQ C;  4P55 A;  3B73 A;  1YW7 A;  5IPA A;  2LF7 A;  2HI3 A;  1WI3 A;  2BHZ A;  3K4N A;  1AHD P;  3PSI A;  1B9M A;  2R5Z A;  1BIB A;  3KP3 A;  3F3X A;  4R8H A;  2A3S A;  1S7E A;  4U0W A;  5D6F A;  4CGZ A;  1XGO A;  3HSR A;  4KNY A;  4CDG A;  2YPR A;  3WU2 C;  1WWX A;  1UHW A;  3AG2 H;  5GAG J;  1VQ9 I;  1S5L C;  4G6D A;  1B72 B;  2WAF A;  2CQ7 A;  2OJE D;  2WV1 A;  3IH3 A;  2G9W A;  2FSW A;  4U87 A;  4RDU A;  3OS2 A;  2WAQ A;  5C44 J;  4OAY A;  3DV8 A;  3R4K A;  1PUF B;  2DTZ A;  4ESB A;  3KIO A;  1K4T A;  4A3M J;  2MC4 A;  4OIO F;  3G1O A;  3HKZ A;  4B48 A;  3DWL E;  2G7H A;  5EF6 A;  3TDU C;  2P6T A;  1DP7 P;  2IVM A;  1ERD A;  1STZ A;  2HTS A;  4WXD A;  3OY9 A;  2JPC A;  3AKZ A;  2L7M P;  2VKH A;  1EH7 A;  5DCM B;  4CZC A;  1HW2 A;  3K70 D;  2VUM J;  1MDM A;  2VBY A;  1UG2 A;  2RNJ A;  4AVZ A;  2WY8 Q;  1Z7U A;  1W4M A;  4XKV A;  1SC7 A;  4ZYA A;  5GPA A;  2CUE A;  2OZU A;  3WU0 A;  3GX4 X;  4Y17 A;  3BTJ A;  2O0Y A;  4U7D A;  3P7N A;  3JRB A;  4OMY A;  3NAU A;  3K4M A;  1SVL A;  5TGT A;  3Q0W A;  1YYV A;  1N77 A;  3ZQF A;  4J19 A;  5GP9 A;  5LBQ A;  4XQF A;  4MFD A;  4Y3O A;  2H8W A;  5EEG A;  2XDV A;  1K6Y A;  1Z3Y A;  2M5W A;  2BV6 A;  3CCQ I;  3S14 J;  1A6Q A;  3TL4 X;  5HLH A;  1C0W A;  3UKG A;  4KIC A;  4I02 A;  4HDV A;  4FET A;  3RTR A;  2DAO A;  1MH4 A;  1HSJ A;  4XOR A;  4HF2 A;  3QPS A;  2MYS A;  1G2H A;  2VC1 A;  2V4J C;  3Q5F A;  1YS7 A;  1YJ9 I;  2IEK A;  3LMM A;  1UCR A;  2BY0 A;  5LGN A;  1D3Y A;  1QO0 D;  2OTL I;  2STT A;  2L01 A;  3GYH X;  3AG4 H;  3ABU A;  3W3C A;  2GXB A;  2WAQ N;  1ORK A;  3ONQ A;  2RC4 A;  2KZV A;  2HXO A;  1FOX A;  1IN4 A;  4XLF A;  2M4G A;  3CDL A;  4V2G A;  4YEL A;  2BXZ A;  5K5R A;  2XVC A;  3FXJ A;  3HKZ N;  1R4M B;  3CUQ A;  2HPM A;  5AIQ A;  1EH8 A;  1XGM A;  1RI7 A;  1R7J A;  3DPU A;  3BZ6 A;  3H92 A;  3CJN A;  4BXX J;  1JHF A;  1JKP C;  4PJM A;  2V1X A;  4I6Z A;  4X0G A;  4PJN A;  3BT9 A;  4PFP A;  2W7N A;  1IDY A;  3TW7 A;  4CO8 A;  3BJ6 A;  5J8F A;  1WQ2 A;  4HEA 2;  1MNE A;  4PFO A;  4BQN A;  4HNT A;  1VF9 A;  1HBX G;  3HYI A;  1LE8 A;  5FO5 A;  4QTR A;  1WZ2 A;  4OIR F;  2PX9 A;  1E3H A;  2DA6 A;  3HG9 A;  2HZT A;  3CUO A;  2WBM A;  3ABL H;  1IGN A;  4OOI A;  5HNH A;  1HOM A;  1KQ8 A;  4YRV A;  1J59 A;  4BYY A;  2EZL A;  1UG0 A;  3QYE A;  2WC2 A;  5K7H A;  4I0A A;  1MMA A;  4KN7 X;  3A01 A;  4NQW B;  1IAW A;  2ZNY A;  4XRS G;  5ILU A;  4RAF A;  5L3B A;  1BR2 A;  5ICE A;  1EF4 A;  2R5Y A;  5K1Y A;  5IT9 Z;  1D0Y A;  1GVD A;  5BNG A;  3H9Q A;  1YOV B;  4HPQ A;  1MJA A;  1IXS B;  3FBI B;  1V54 H;  3OYD A;  3F6O A;  3S1R J;  2HVR A;  1TL8 A;  2LY2 A;  1GXP A;  2DMU A;  1B8I A;  3IUO A;  4XSX F;  5L3D A;  3CD6 I;  4M3F A;  4BUP A;  1XMA A;  3LST A;  1IRF A;  1I6H J;  2LOO A;  5EG0 B;  2KIM A;  3FM5 A;  1XPX A;  3LFU A;  2QBY B;  3TGN A;  4R79 A;  1BJA A;  2A5Y B;  2XAG A;  3ZMT A;  4P1W A;  5EYR A;  3Q9S A;  4LJZ F;  3ZN1 A;  2X6X A;  1OCR H;  2XHK A;  1OCC H;  3GUD A;  2Y0M A;  3ISP A;  3K6G A;  3L00 A;  1IV6 A;  4DBR A;  3COA C;  1V5F A;  3MZY A;  3LSP A;  4HAM A;  2ETH A;  2R7X A;  3CMM A;  4ESF A;  2F5E A;  5LGT A;  1BW5 A;  3A0B C;  2XKO A;  3WTU C;  1FBQ A;  1IRX A;  2VKE A;  4LLL A;  3L2V A;  1PUE E;  2D1H A;  4BH9 A;  1WPK A;  3FXK A;  4F7Z A;  2VQG A;  3SEQ A;  3QOE A;  4RBO A;  3OS1 A;  1NK3 P;  5E3M A;  4D5C A;  2XIG A;  2K40 A;  4PCQ A;  3T5X A;  4EJW A;  3KYL A;  1R1U A;  3HGG A;  4C3I J;  4F93 B;  1HKQ A;  4EJU A;  4UVC A;  3QQA A;  3WOD F;  2MAB A;  3WTT C;  2WV0 A;  3PUF A;  2BW3 A;  3IKT A;  3R0A A;  4CYC B;  2VKD A;  3I64 A;  4IHW A;  5J1Y A;  2ID3 A;  1OMI A;  2NOJ B;  3BG7 A;  2DN0 A;  3VEP A;  3BQY A;  1GLN A;  1RUO A;  1ZAR A;  2DMP A;  2K4J A;  4FAS D;  3CCY A;  2DA5 A;  2OCE A;  1SAU A;  2Z2S B;  4MQV A;  1QNT A;  2DA1 A;  3TW6 A;  3H5N A;  1XDS A;  1ENH A;  2BBY A;  3RKY A;  4D9J A;  1HA8 A;  1JXS A;  4GXO A;  4DGW B;  2VJ5 A;  1P9Q C;  1X1A A;  5JI6 A;  4GDF A;  4FQG A;  1W7P A;  2HKO A;  2NNN A;  4A2U A;  2BVL A;  1NG7 A;  4F52 A;  2CQK A;  2K7L A;  3FXQ A;  3GXO A;  3FM3 A;  1ZRC A;  3VDX A;  2CWE A;  4M71 A;  4O3M A;  1TWG J;  2COB A;  5J1U A;  2LFB A;  2OPT A;  1Z6T A;  2EIK H;  3LA7 A;  1JE8 A;  4C2U A;  1LDD A;  3ERE D;  1VQ7 I;  1A35 A;  2V9V A;  2N8G A;  3RCO A;  2LRE A;  1MZB A;  2XGX A;  2BE5 F;  1D0X A;  5FJ8 J;  1WH5 A;  3K10 A;  4DIQ A;  2FU4 A;  3CC4 I;  1VQO I;  4XOP A;  1O3Q A;  2HZD A;  1B4A A;  2GAU A;  4M9S A;  1YTY A;  3ZQ7 A;  5AON A;  2VQL A;  2W4S A;  2Z3Y A;  3HM5 A;  4L0Z B;  4HG2 A;  2P7C B;  3CJT B;  4FX4 A;  5M5W J;  1WFX A;  2E7W A;  3PJR A;  1ETO A;  1R5G A;  4AM3 A;  2QEX I;  3R60 A;  4BQA A;  3WGG A;  1KYZ A;  4EAT A;  3J7Y J;  3F9K A;  4A5M A;  3GCM A;  2DCE A;  1FMW A;  2OTJ I;  4PUS A;  4ENN A;  1OCO H;  3KEO A;  1YX5 A;  2K9S A;  1X3W B;  1POG A;  1F5T A;  3ZQQ A;  3WGI A;  4NBQ A;  4D0P A;  4DNC A;  5B5E C;  5ERI A;  1BIA A;  2GQQ A;  3GFM A;  4A3E J;  3L7W A;  4MTE A;  1R36 A;  5FD5 A;  2NRA C;  1W7P D;  4HV6 A;  4UHT A;  4CXF A;  3OYB A;  1MMS A;  1FYK A;  3ZQH A;  4LG3 A;  2EPF A;  1X1P A;  2VB6 A;  5DUK A;  3BG5 A;  2XPW A;  3ROU A;  3F6V A;  4E4H A;  3BZC A;  1P7J A;  1NG6 A;  2H8R A;  4QWQ A;  3W2V A;  2FUG 2;  2UZK A;  1MKM A;  1IN8 A;  1O3S A;  2XSD C;  5IP6 A;  3DKX A;  3CC7 I;  4GYI A;  1VQN I;  1XGN A;  5F08 A;  3MZH A;  4A12 A;  5JVG F;  1SMT A;  2LVS A;  4KUM A;  3ZMV A;  1PUF A;  2F5V A;  1K83 J;  2DOA A;  2EIJ H;  1BM9 A;  4YFK F;  4JYK A;  1U78 A;  1J2X A;  2NS0 A;  2XF5 A;  4YEJ A;  3H9G A;  4JX4 A;  1FPQ A;  2O5R A;  5IYB J;  2BVM A;  2A5W A;  2O8X A;  1ZLK A;  4UB8 C;  1FIA A;  2M1B A;  3T8R A;  2FOW A;  2K86 A;  2IAI A;  1Z7L A;  2WA0 A;  4BY1 J;  4KA4 A;  5FLX K;  5EZH A;  2CUF A;  1T6S A;  3TP0 A;  4BE0 A;  3JRG A;  2VJI A;  4V19 K;  4A6E A;  4BXU A;  2GXG A;  4AIH A;  3CJQ B;  3RPU A;  3ABM H;  2Y31 A;  4G8X A;  5E3N A;  3JRA A;  1FZP B;  2CV0 A;  2JVH A;  2E19 A;  3U21 A;  1KYW A;  2NVQ J;  4LOC A;  4EVI A;  4CHU A;  1X4P A;  2XGD A;  3HSF A;  3P9K A;  4CIC A;  3JRF A;  1ZRD A;  2DMT A;  1IO2 A;  4QSH A;  1PP7 U;  4RLQ A;  3K0L A;  2VE9 A;  2OAZ A;  3KP7 A;  2DA2 A;  9ANT A;  4IOC F;  3LSR A;  2IW5 A;  2EBI A;  1Y1V J;  4IKF A;  3RQI A;  2DOE A;  3LNQ A;  2Y2Z A;  2A69 F;  3A02 A;  3JTG A;  2FJ1 A;  2KIS A;  4BY7 J;  1YS6 A;  3F8N A;  2M0C A;  5E3L A;  3J80 Z;  1OPC A;  2Y9Z A;  2R92 J;  1XSX A;  4Y13 A;  3KET A;  3DPL C;  2E1C A;  2IA0 A;  1QHH D;  1JT6 A;  3MN2 A;  3IH4 A;  2W85 A;  4E70 A;  3OS0 A;  1YI2 I;  3KCC A;  2FML A;  3SZP A;  3FKJ A;  3AAF A;  2IA2 A;  4IEJ A;  3BQZ A;  1TW3 A;  3VYR B;  4CUG A;  4G7Z F;  4FE7 A;  2UUZ A;  5D8L B;  3JCU C;  1K7A A;  3MAJ A;  3ULQ B;  4DYQ A;  4EQQ A;  1KA8 A;  4H0E A;  2HWV A;  2X9D A;  2DI3 A;  1TQI A;  1AKH B;  1T98 A;  1YIO A;  4XN0 A;  5FB2 A;  3J81 K;  1JKO C;  3VWB A;  1XN7 A;  3OYH A;  3B6C A;  2UXX A;  3ZQC A;  2M9H A;  2ELH A;  3BWG A;  2O6G E;  4F55 A;  1XB4 A;  4M3E A;  3IC7 A;  2GOX B;  3RPU D;  2KT0 A;  2IRF G;  1J75 A;  2CH0 A;  2W00 A;  3O8H A;  4XKC A;  1AA7 A;  3K70 C;  3O3K A;  3DP7 A;  3OV8 A;  2LY1 A;  3QU6 A;  3EUA A;  4PJ0 C;  4BHC A;  3HOS A;  3FHZ A;  1ZGA A;  2QGU A;  1K78 B;  2V9P A;  1G59 A;  2PQ8 A;  5CQE A;  3V8L A;  4E7I A;  2HOT A;  1BOA A;  2GA2 A;  2IGK A;  2R0Q C;  3E7L A;  3CP8 A;  3BLY A;  4AUX A;  1T08 B;  2ECB A;  2CFX A;  5F0F A;  1YIT I;  3I4P A;  3MKW B;  3BCB A;  4KN4 X;  3UR3 C;  1U5T A;  1EV7 A;  3HB9 A;  4IQJ A;  2L0K A;  2L02 A;  2DPD A;  2EFN A;  4KDP A;  1DGW Y;  3MCZ A;  3M8F A;  3L9F A;  1LFP A;  3OWT A;  1LVK A;  4JOM A;  4RM3 A;  5FKO A;  3HOU J;  1IN5 A;  2EZK A;  2RGV A;  1ITY A;  5FD6 A;  3M3Y J;  1WJB A;  3DKW A;  3T1B A;  2KDZ A;  3SJM A;  1T8I A;  3OIO A;  4NB5 A;  3HOW J;  4EV0 A;  1OYY A;  3OYL A;  3GEZ A;  1TP4 A;  1YW8 A;  3H3Z A;  2DK8 A;  5IP7 J;  4U0Y A;  3KZZ A;  2QSF X;  2XV4 S;  3IWZ A;  5EG0 A;  3HTS B;  1XC5 A;  1YHQ I;  4XLN F;  5BMZ A;  4QPQ A;  4IXA A;  3K4B A;  2CW7 A;  4PSX A;  1MD0 A;  5F0H A;  5E17 F;  4HOB A;  4DW6 A;  2M4K A;  3TOA A;  4CCL A;  1MJB A;  3I9V 2;  4N4N B;  4ZYD A;  3K1P A;  4AVP A;  4LB6 B;  2O03 A;  3HHH A;  5F6F A;  3HOX J;  2XF6 A;  3M7G A;  3GZN B;  1J0R A;  3CCU I;  1R71 A;  3PNY A;  4P96 A;  3HJE A;  4BS9 A;  3W2A A;  3DF8 A;  4CCN A;  4G94 A;  4KFC A;  3O8G A;  3FF5 A;  2B63 J;  5DEQ A;  2HGC A;  5H6Q A;  3B6A A;  3RIR A;  1ZHF A;  3PSF A;  5CVV A;  2DJI A;  2VPR A;  4P9F A;  2JMW A;  4CA0 A;  2M34 A;  1WVR A;  1W5T A;  1ZG3 A;  3WG7 H;  4KMF A;  1Y0N A;  3ZQL A;  2P5K A;  1P4X A;  5KCM A;  2QCO A;  4CYC A;  5CVU A;  1Y0U A;  2CQN A;  3T8T A;  4Z2Y A;  3BCA A;  5L3E A;  2OV7 A;  1X1C A;  3DTI A;  4L9N A;  4GO1 A;  2HQR A;  2E35 A;  1YJN I;  1QVU A;  1EJ9 A;  2I8D A;  3PQJ A;  2V6E A;  1ZQ3 P;  2EK5 A;  4HNV A;  3DTE A;  4D7N A;  2R93 J;  4M3D A;  4RLF A;  5LRS A;  4HST A;  1HLV A;  3OIP A;  3PQK A;  3G4S I;  1FLI A;  1QQI A;  1MW7 A;  3NWT A;  3ASN H;  3JRI A;  1BA5 A;  4M9X A;  1GXQ A;  2Q8K A;  1XG1 A;  4XID A;  1I6X A;  2MLK A;  2STW A;  5BS6 A;  2PEX A;  1BL0 A;  3K9T A;  3I5U A;  1YX3 A;  2HTJ A;  2CG4 A;  1SD5 A;  2LKS A;  5CVR A;  1WCM J;  1FNN A;  2QQA A;  3S32 A;  2A68 F;  1JTY A;  4OIN F;  4RAY A;  3IWF A;  1T56 A;  1JGS A;  3TMO A;  4DZJ A;  5HLI A;  2KL4 A;  2VKV A;  3BTI A;  2XAF A;  3GFJ A;  5F0C A;  4PGG A;  1U9N A;  3CDH A;  1R6R A;  3S1Q J;  5FRM A;  5GPC A;  2XRO A;  2NVY J;  3DEW A;  3F8C A;  3H36 A;  5LEK A;  1TZL A;  1XD7 A;  2WWY A;  4YFX F;  3S2W A;  5K5Q A;  2DFI A;  2L7K A;  4GYG A;  1SVM A;  4IL6 C;  1FBU A;  3ESW B;  3IH2 A;  4LK1 F;  2F48 A;  3GLL A;  1HF0 A;  4O5V A;  2QKL B;  5LLQ A;  5LRR A;  3OR1 C;  5HDN A;  2RDP A;  1DU0 A;  3OL3 A;  2XRN A;  4UV8 A;  1FWZ A;  1BBY A;  3MFK A;  3BJA A;  2Z99 A;  4B3X A;  3TQN A;  1OR7 C;  2EIM H;  4NC6 A;  4NUB A;  4MEX F;  2F5D A;  2E2J J;  1WH7 A;  1HKT A;  3S8P A;  1I3A A;  1SVO A;  1WJC A;  3CLQ A;  1LPQ A;  2PI0 A;  4A93 J;  4JX5 A;  2CMP A;  2VXD A;  4M6V A;  1JT0 A;  2RQP A;  5K7F A;  1LQ1 A;  3VSL A;  4M74 A;  1DGR M;  3RZD J;  1K6O A;  3QP6 A;  4YIF A;  1IXR C;  2DA3 A;  5L3F A;  1XTA A;  3NAR A;  2ZJQ F;  4Y7N J;  3J80 K;  4G7O F;  2XAH A;  1J7K A;  2BGC A;  4RB2 C;  3QWL A;  2R7R A;  5GAE J;  3GFI A;  2L54 A;  1D5V A;  4XMY A;  5FKL A;  2HEO A;  4N4O B;  3V7C A;  4PGH A;  2L5Q A;  2JA6 J;  5FFX A;  4IRG A;  3WU1 B;  1SFO J;  2HXI A;  5J3L A;  1XS9 A;  1OFC X;  3SDB A;  1OCZ H;  3H1C A;  4MNU A;  4BHP A;  3C2G A;  5IYC J;  4HDU A;  3ZRG A;  1K79 A;  3LWF A;  2A61 A;  4GFB A;  1ETQ A;  3FXR A;  3L09 A;  4YG2 F;  3E6D A;  2CQX A;  2EA4 A;  3P9C A;  4ZYH A;  1LJ9 A;  2NXN B;  2ME0 A;  2EQR A;  2V6C A;  3HIF A;  1MSE C;  2OUM A;  2P5V A;  1OIS A;  3S1N J;  4ZYE A;  1VZ0 A;  3F8M A;  4BAY A;  3RSN A;  2KQR A;  3H5R A;  4D1Q A;  2TRT A;  4PJL A;  2JT1 A;  3KYC B;  3CME I;  5KK1 A;  4A5N A;  3V4G A;  1BI1 A;  2YR2 A;  3GZ5 A;  2CFO A;  2YS9 A;  3DBH B;  1FOK A;  3PM1 A;  1J5Y A;  4C3J J;  1QHG A;  2ELJ A;  4CH7 A;  1WSU A;  2K02 A;  2JZY A;  3AFH A;  2QQ8 A;  3I55 I;  1W5S A;  4ZDO A;  1NTC A;  1WKM A;  3GW2 A;  3RKX A;  2QWW A;  3B02 A;  1U6G A;  1ETY A;  1XCV A;  2NS7 A;  2RNG A;  4XR6 A;  3G6E I;  1CF7 B;  3AG1 H;  4P5O A;  1VQK I;  4HF1 A;  3RYR A;  3BDD A;  2XAQ A;  4IHS A;  3SHF A;  4BJ5 C;  3M8E A;  1LEA A;  4CCO A;  3ZMZ A;  4MLO A;  2OQG A;  5KAI C;  2IS6 A;  3TED A;  4U88 A;  1TT5 B;  3VB2 A;  3SDG A;  4AD9 A;  1ZRE A;  2DO7 A;  5A2Q Z;  5BPI A;  1OR7 A;  4MEY F;  1DPU A;  1HDP A;  1L0O C;  2K5C A;  2M3A A;  3LQR A;  2DT7 B;  1HCR A;  1ACI A;  4Y33 A;  4BJ6 C;  2JA7 J;  3CTA A;  3WTS C;  2IGM A;  4DZP A;  1B9N A;  5H20 A;  4DOZ A;  4E7Z A;  2M2E A;  1BR1 A;  2DDA A;  3BR1 A;  4W97 A;  4RM2 A;  2X1D A;  3K2Z A;  2FBH A;  5EGO B;  2ECC A;  3CCE I;  2P4W A;  5DUI A;  4N9H A;  1FEX A;  1AKH A;  3V8J A;  3EYI A;  3PO2 J;  4Z6Y A;  4G12 A;  3ZMS A;  1U9O A;  2P81 A;  3ZQI A;  1SMY F;  2L7F P;  2LYC A;  3CP2 A;  4M3B A;  1OCP A;  3WTV C;  1MBF A;  1YIJ I;  2EFO A;  2GOM A;  3LA3 A;  1RR8 C;  3M4O J;  3G1L A;  4IHV A;  5J47 A;  4XM3 A;  5HNF A;  2IS1 A;  3QU3 A;  4XNF A;  4OIP F;  3NRV A;  2LKX A;  3W2W A;  2DOD A;  4UUV A;  1D0Z A;  1H89 C;  2XRL A;  1K78 A;  2A6E F;  4BBS J;  2BEO A;  4AWX B;  3N4M A;  2DMQ A;  5J6X A;  2V1N A;  3FIS A;  2O3F A;  1SFE A;  3BPX A;  1FOW A;  3GTO J;  1I27 A;  1N78 A;  1ZRF A;  2PJR A;  2VQC A;  1WJE A;  2ZSH B;  1T0F C;  2RV8 A;  1YQA A;  2ZNZ A;  3EDP A;  4RGR A;  5JLX A;  4LIV A;  1R22 A;  2R7V A;  4FX0 A;  1Z1D A;  4G6Q A;  1R5I D;  2RQQ A;  1ZEL A;  4E7L A;  2P6S A;  1N75 A;  3KLN A;  2RN7 A;  4WX9 A;  1WHU A;  4IHY A;  2CSO A;  1IF1 A;  4BL0 B;  5D5X B;  5D5W B;  5D8K B;  4P9U A;  5LD2 C;  4B1R A;  5KAF C;  1WJA A;  1FSE A;  2EJR A;  4FT8 A;  3TO9 A;  5E8I A;  4XRF A;  2OCC H;  2IT0 A;  5ILV A;  1OCT C;  4Q47 A;  3JAM Z;  3OYG A;  5LFA A;  2B7E A;  4FTH A;  5HS7 A;  2A6T A;  5FFZ A;  2XPV A;  3OYE A;  1UEL B;  2DT5 A;  2KJC A;  1HXD A;  3P5J A;  2DQL A;  2ELK A;  2ZME B;  3GME A;  1W36 C;  5DM7 F;  3HOT A;  4A3J J;  3OL4 A;  2L9V A;  2XGE A;  4Y4R A;  3LSK A;  1GUU A;  4ENK A;  1RUN A;  1O57 A;  3J7Z I;  3OYK A;  4YFN F;  4XRM A;  3C7J A;  2QM3 A;  5DCF A;  3DBL B;  1QZZ A;  1ZG5 A;  3CJR B;  2VJ4 A;  3HL2 A;  3VYS B;  4IVN A;  4ASN A;  3WE3 A;  4EEF G;  5JVT A;  3H0G J;  1TTY A;  3HUG B;  3ZMU A;  1BR4 A;  1TWF J;  4LLG F;  1FTT A;  3LFK A;  1HKS A;  4M72 A;  1Y6I A;  1KU7 A;  4DJA A;  3S16 J;  1OLT A;  1QU3 A;  2E71 A;  4B4C A;  2ESH A;  2DBB A; 
#chains in the Genus database with same CATH homology
 1X3Z B;  3ESW B;  4YIR X;  1TP4 A;  2F4O B;  2F4M B;  2QSH X;  1X3W B;  2QSG X;  1QZE A;  1PVE A;  2QSF X;  1OQY A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...