2KIQA

Solution structure of the ff domain 2 of human transcription elongation factor ca150
Total Genus 12
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
12
sequence length
57
structure length
57
Chain Sequence
IMQAKEDFKKMMEEAKFNPRATFSEFAAKHAKDSRFKAIEKMKDREALFNEFVAAAR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Transcription elongation regulator 1
publication title High-resolution protein structure determination starting with a global fold calculated from exact solutions to the RDC equations.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transcription regulator
total genus 12
structure length 57
sequence length 57
ec nomenclature
pdb deposition date 2009-05-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01846 FF FF domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.440 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A FF domain 2kiqA00
2LKSA 2B7EA 2DODA 2JUCA 2KFDA 2DOFA 2KIQA 1UZCA 2DOEA 2KISA 2E71A 2L9VA 2CQNA 2K85A 4FQGA 2KZGA
chains in the Genus database with same CATH superfamily
4AIHA 2X6XA 3K69A 3P9KA 2LY2A 3DTKA 4BEHB 1Z7LA 2M7AA 3PUFA 2FE3A 1XCVA 3CDHA 5HLGA 2FNAA 3K70C 1VQMI 2PJRA 2DA7A 2PFBA 1R22A 2OD5A 1TT0A 1YX5A 1JHHA 1C0WA 1TWCJ 3PUBA 4XR6A 2LRDA 2OCCH 4CCOA 2XGEA 1PUFA 4LG0B 9ANTA 2JUCA 2WBMA 1TBXA 5KK1A 3K4KA 4IHWA 4LK0F 2QVOA 4ZDPA 4ENNA 2V9KA 3MQ0A 1HKQA 3S2HJ 2A61A 4D9JA 1AHDP 4O3MA 4ENKA 5E8GA 3ZR8X 5DM6F 1LB2A 3CUOA 1OCOH 4PUSA 3TDZC 3J81K 2KFDA 1LVKA 2MBFA 3MZ8A 3O8HA 1U8BA 2OA4A 2LFBA 4QSHA 4FHTA 1RI7A 4RB0A 5E20A 3L2VA 1DP3A 2FMYA 5EDNA 5E3MA 1ZGWA 1BA5A 3M8JA 4RAYA 2Z16A 1MBKA 4D7NA 1L0OC 2LREA 5K1YA 1QVUA 2IAIA 5BS6A 1UB9A 5L3DA 1O7FA 4GGGA 1STZA 1OKRA 2VKVA 2VT3A 4PGHA 2Q1ZB 1EF4A 2IW5A 3D0SA 1SC7A 3CF2A 4HYEA 4B4CA 2E1MC 2Y30A 1I3AA 1VFCA 1FX7A 4DGWB 2QSGX 4KT6A 5B5EC 2VXZA 4A0YA 4IRIA 4PFPA 2FEZA 5EEAA 2HKOA 3HBLA 5EG0A 5BMZA 2M4KA 1MDMB 3PFYA 1YIJI 1FSHA 1J0RA 4UUSB 2O0YA 3UNGC 4OU0A 1MJ9A 4HNVA 4KA4A 3CJRB 2HOTA 3K2AA 2DO7A 1MH4A 4BGDA 1R71A 4YELA 4KN4X 2ZSHB 4ZC3A 4BNCA 1T38A 5FFZA 2JRTA 2VPRA 5FLMJ 1BJZA 4MNUA 1RIOH 2O7OA 4DBRA 1BIBA 2KIUA 3S2DJ 4CCKA 3CMEI 1JTXA 4HPQA 1AKHB 2BXZA 2MH9A 2WC2A 3CCYA 4QPQA 1CQTA 1YRNA 3OV8A 3ZMDA 2DU9A 5JHUA 4HDUA 2GLOA 2EA4A 1ZRCA 3JR9A 3LFUA 3AL0B 2K9QA 3FXUA 4JK1X 3KP3A 2QBYA 2DYSH 4MO7A 2E2IJ 1LVAA 1IRZA 3HRTA 2JK3A 5F0HA 4U7BA 3S3MA 1GXPA 2YS9A 1P4AA 2VBXA 2MD0A 5IT3A 4Q5SF 3KYCB 1VQOI 4BDYA 4I98B 1XS9A 2ZXHA 4OIRF 4EM0B 4GDFA 1QZYA 1YLFA 3MD2A 2GWRA 4E7ZA 1O3TA 1VZ0A 2W00A 3K4NA 3IHUA 1ZG5A 1J5YA 2P4WA 2M30A 1GV2A 2XROA 4JX4A 2CGPA 2AXTC 4XLNF 2W4SA 2DJIA 2R3SA 4AD9A 1XGOA 2GA1A 4ZDLA 2QSFX 3S3NA 2BY0A 3KLNA 3PO2J 1VQNI 4DW6A 3H3UA 3WGIA 2MLGA 1X58A 2MYSA 2VN2A 3F8FA 3PSFA 3QOEA 3CMAI 4EQQA 4ZTFA 1U2WA 3H92A 5BPIA 4M74A 2IS2A 3ULQB 5FD6A 2NRAC 1BR4A 4D7MA 1QVTA 2L7ZA 1I27A 2ZFWA 2HVQA 3G4SI 4XOPA 1Q1VA 2VI6A 3ZRGA 3K9TA 3I53A 1X4OA 3WTXC 1MBGA 1SD7A 2Q2EA 3P7NA 2VQLA 3T5XA 2FMLA 4KN7X 2EIKH 2KP6A 2LD5A 3O2PE 3JRFA 1LE8A 2R7SA 1KYWA 2FOKA 4BQNA 1WH7A 3L00A 1XG1A 3HOXJ 3TGNA 2AQEA 1EKEA 3DEUA 2QWWA 5CKTA 1SAUA 1ORKA 3IH3A 2YPRA 2QA4I 1R5ID 3FIWA 4L0ZB 2YX7A 4EV0A 4B44A 3CCLI 1LEBA 2QKMB 3HB9A 1LEAA 1MD0A 2HDWA 3T8RA 4A5NA 1DUXC 1D1CA 4PJLA 3R4KA 1IV6A 2P81A 2FOWA 2BEOA 3GO5A 3LA2A 1OCZH 3WTTC 1R1VA 3FXLA 3JAMZ 2DQLA 4BU2A 3W6VA 4AYBN 2LBFA 4H4KC 4BXFA 5B1BH 2EZLA 2DW4A 3HOTA 1MBEA 3J7YJ 1RRJA 1G8XA 1J59A 4B48A 1HSTA 3NAUA 5GTHC 1XMKA 3LOCA 3EQLF 4IQJA 1TNSA 1YE9A 2E71A 1S8NA 5K7FA 1NG7A 2W85A 3F0CA 2ACJA 3OR2C 3BJAA 3SEQA 2WAQN 1U9NA 2KKOA 1V55H 3GFMA 1SFXA 3KEOA 1H8AC 3C7JA 1WJCA 5F0FA 4XLCA 2E2JJ 2YX4A 2CUZA 2P7VB 3K4LA 2R7OA 3QYEA 2O8XA 2XKOA 1V5FA 2AHQA 4XRMA 1W5SA 2DA3A 2QQ9A 3GTGJ 5C44J 4EGZA 3ZMUA 1QGPA 2A69F 4PCQA 3AAFA 2F5FA 3CJNA 2LK2A 3RPUD 2H09A 1NG6A 5CLSA 4CA0A 1HW5A 3G1OA 1JGGA 3IC7A 3GTKJ 4A3GJ 1HW2A 3CUQC 3LA7A 3UKGA 2WADA 3JRAA 5LRSA 1FY7A 3OSGA 2RAEA 1Z91A 1IXSB 4L18B 4LFUA 1ETXA 3DLAA 3FM5A 2XC7A 1R58A 2RREA 3BR2A 2QBYB 3IWFA 2LOOA 5M3MJ 4LLGF 2H8WA 1YTYA 4FASD 5BOXA 3I71A 4DYCA 2KIMA 2G9WA 5EJCA 5EEGA 1QU3A 2PEXA 1LKXA 1R00A 1WJFA 2EV6A 4XQFA 3S1MJ 1D0YA 2F48A 4UHTA 1LDJA 1X1CA 1O4XA 1U0JA 2DFEA 4KMUX 3ELKA 2BGCA 1D5VA 1WJDA 3F21A 3DU6A 4A2UA 1H0MA 1RR8C 5AONA 3K7AJ 1FJLA 4D5FA 2EILH 2GIZA 5ICEA 5FGMA 2ZNYA 1HLVA 1N77A 1CGPA 2E5NA 5HLIA 5TRDA 2W1OA 3ZQLA 1XCBA 2PX9A 1ZTRA 1FP1D 3ONQA 2O8KA 4F92B 3SXYA 1IXCA 3HKZN 3OYAA 1RETA 1T6SA 5DUKA 2FXAA 3BPVA 2KDOA 2Z2SB 3LAJA 3HRUA 1TQMA 3QP5A 5M5WJ 2HWVA 3ZQ7A 2HXIA 2IEKA 3IKVA 3AG3H 3CESA 1R9TJ 2H27A 3MN2A 4E7IA 5E1XA 4IVNA 5DCMA 1DDNA 2XF7A 2V1DA 3LMMA 4XKBA 4LK1F 4BBSJ 4C3JJ 2Y9ZA 2RDPA 1JJ8C 5F1JA 3F8NA 3WG7H 4AVPA 2WV1A 2B9SA 1FC3A 2JA6J 2CRGA 1B72A 2K7LA 4A93J 1TW3A 3I4PA 2XPWA 4HX7A 2EFWA 1G6NA 2ZKZA 2R7TA 2X85A 3R0AA 4L5JA 1HKSA 4E4HA 3S2WA 1T0FA 3ZN1A 4EEFG 2DPUA 4BXUA 4NQWA 5CVJA 2KPMA 2R7RA 4L0YB 1LNWA 3CF5F 2XSDC 3CLQA 5LGTA 1KU9A 5CVUA 3DV8A 1PYVA 2DPDA 3KETA 3Q0VA 2DMUA 3RQ4A 3GVAA 1FTTA 3DKYA 1EA3A 3F23A 2P5VA 2K5CA 1FIPA 1ON1A 2AXLA 4HSRA 2BY3A 2QM3A 2ZJRF 3U2RA 1S7EA 2E34A 3KIOA 3FXJA 2XVCA 3S16J 3H1CA 1UG2A 3ECOA 4E6KG 2CG4A 2CV2A 5CVRA 3KP6A 3H9JA 2K40A 1ENHA 4M3FA 5D8KB 3DPLC 4M3EA 3UR3C 3IAS2 1P4WA 5LGNA 5LBQA 2OZUA 3FXQA 2CH0A 1JUSA 3PL8A 2F4IA 3BG7A 3BR0A 3OIPA 4LG0A 3SEZA 2NOJB 1ONVA 3S1NJ 2HEOA 1J2XA 2B63J 5H6QA 2RQQA 3I59A 1WWXA 2ESNA 1H88C 2R7UA 1IDYA 3ABUA 4LIUA 5E1ZB 1WSUA 3R0JA 3D5RC 2XAJA 5B66C 4LB5A 2GOMA 3CMMA 3R6SA 2R7FA 1GDTA 4UY8I 2WV0A 2IS4A 2DK5A 1YJNI 5CVVA 4M9SA 3KE2A 4N4NB 4ENJA 3GTPJ 2ZMEB 5IP9J 5FJ8J 4ZYAA 2ZB9A 2K85A 2KDZA 1IRFA 4FCYA 1BN5A 3HGYA 1P7JA 1VQ5I 3ZMZA 2FBIA 3OIQA 1TWGJ 4F91B 3CCMI 3WU2C 1VQ9I 2M45A 2K02A 2L9SA 3BJOA 2LF7A 2EFPA 5B1AH 2OTJI 1GUUA 3ZPLA 3O8GA 5ICGA 4A3IJ 5LEJA 4QIWN 1WFXA 3EUHA 2ID3A 1MGTA 4MIMA 3D5LA 4I02A 3A01A 2W48A 1G3TA 4RGSA 3RPUA 1KZHA 1ETOA 4EMSA 2XASA 4F55A 2OCEA 1VQLI 1KONA 3CC7I 1BIAA 2HQAA 2TCTA 2DT5A 3K4BA 3BJ6A 5J6XA 4AC0A 1OJLA 4RB1A 1WH5A 1Y39A 1EH8A 4UNOA 5L3FA 2TRTA 1U5TC 3HUGB 4UUSA 1DU0A 1FBQA 1B4AA 2VIXA 1OQYA 3ZQGA 2ICWG 1OCTC 3MKZA 3F72A 2EZKA 4J19A 3BWGA 4I6ZA 4G6DA 3V7CA 5GP9A 4IEJA 3OY9A 4UUTA 2I10A 4I99C 1F4KA 2CV1A 1SVMA 4E7SA 1ON2A 4XSZF 4DZJA 2VXDA 5E1WA 4IHTA 4HX8A 2PN6A 2CQXA 3FHZA 2VJ5A 3CTAA 1QQIA 3GZNB 3OYLA 5HDNA 2HVSA 4HRIA 2E35A 3ABKH 3W6JB 2V9PA 4A3LJ 4I2OA 1R4NB 5J40A 3L2CA 4KDPA 3B6AA 3RYPA 2WAFA 5ICCA 4ZJZA 5L3EA 4RS8A 4BQQA 3W2AA 5J3LA 3MVPA 4XBFA 1D1AA 1EH6A 2DDAA 2FBHA 1IC8A 4BQAA 4NQWB 1TQIA 4LMYA 3ESWB 4L9VA 2W82A 3G2BA 3KFWX 3QQAA 2A6HF 2Y9YA 5H20A 4EM2A 2OF7A 1QBJA 2DA4A 1X3WB 1SFUA 1T39A 4WXHA 1AU7A 2DFIA 4XKWA 4Y15A 3V8JA 1REPC 2XHKA 5E3OA 4MQ9F 1S5LC 1BC7C 3HDDA 1OPCA 1T2KA 3CLOA 3C2HA 1XGNA 4RB3C 1S9HA 3GXOA 1FBSA 5KAIC 4AM3A 2F2EA 2F4OB 5HDKA 2DA5A 3QPTA 2EK5A 1I1SA 3HOYJ 2BY2A 3I55I 2BV6A 1Y56A 2CO5A 3L2RA 4FQGA 2KZGA 4XKCA 1POGA 3V7SA 4L5EA 5HVQC 1BI1A 3RCOA 4KNYA 2IGOA 2MG4A 3ZGKA 5CJ9A 5IT9K 4IHXA 1CF7A 1FBUA 1P92A 2CJJA 1IN8A 2VE9A 1U3EM 5FFXA 1W0UA 1BM9A 1X1PA 1UZCA 5K5QA 1BL0A 2A07F 3I59B 1XN7A 5D5XB 3CCQI 4PK4A 2LY9A 5FKMA 4JBAA 1XMAA 3FK6A 4A0ZA 1RESA 2R7VA 1FZPB 2W25A 3IWZA 2JN6A 1X19A 3RDIA 4FETA 2DQRA 2OPTA 2RNJA 3QWLA 4HSTA 1TWFJ 1A36A 2RN7A 3ISPA 2HKXA 3K70D 5FRNA 3A1YA 4UB8C 1G2HA 1TQPA 3CCVI 1XC5A 3BOQA 3WODF 3AG4H 2PLYA 2X6OA 5FROA 1OYYA 4HQMA 3JRHA 1B9MA 2NNNA 1N78A 4Y52J 2EFNA 2XAUA 2E2HJ 2HOSA 3U1DA 3T0YA 2DOEA 5CPRB 1T98A 1R5GA 2JT1A 4PSXA 4II2A 5FKLA 2EFQA 5HS9A 3RKYA 2K3PA 3I9V2 2QEXI 4NC6A 5E3NA 1HSJA 5DEQA 1WRJA 3RJPA 4DIQA 1SVLA 1RUNA 1FWZA 2PMHA 2PQ8A 2M87A 3DF8A 2MGQA 2JWTA 2HQRA 2D1VA 3WE3A 3A01B 2Z99A 1QO0D 2DK8A 3E0JB 4M6XA 3HOUJ 3U1KA 2A5WA 4MLOA 1TT5B 1HKTA 2K86A 2E1CA 3L9FA 2FX0A 3F6OA 4G94A 2QQAA 4Z2YA 3MEXA 3CC2I 1UMQA 2K9LA 1YYVA 1Y1VJ 4UVBA 2O9LA 3B73A 4XLEA 1TW2A 1Z0XA 4HV5A 1PJRA 1S29A 2IPQX 3W6KB 1JHFA 3WTYC 3J7AO 3RZDJ 3ERMA 4Y7NJ 2KRCA 4OIQF 1XDUA 2LY1A 1UG0A 2P6TA 1FIAA 4J01A 1IF1A 1NTCA 1BJAA 3GLLA 4FE7A 1K78B 1YITI 2ID6A 2V9VA 2Z3YA 4I7HA 1YFHA 4RGXA 5DTDA 2ZFUA 3WG9A 3HTSB 4CZZA 3I58A 5ILUA 2BVLA 2QKLB 5FLXZ 1MMDA 5KCMA 4WXCA 1OISA 3CMYA 1W36D 4UB6C 2AS5F 3PO3J 1G59A 3F3XA 4WF2A 2PI0A 1SFEA 3SJMA 3V8LA 4I09A 4MTDA 2XB5A 4V2FA 4CZCA 3DEEA 1NH3A 2IA0A 4KJZA 3TOAA 1D1BA 1IAWA 1K4SA 1FP2A 3BDDA 3Q5FA 2BY1A 1HA8A 2MFZA 3AG2H 2HZTA 2JRMA 1OYWA 2ZSIB 2M0CA 3A4CA 3D5SC 4Q48A 3HOSA 4P9UA 4KUMA 3CD6I 3FK7A 3RYRA 1IGNA 4KMFA 3CJQB 1OCCH 2HZDA 2L9VA 4IZZA 2RKHA 4KFCA 3PIOF 3E6CC 4B43A 4IOCF 4XORA 3RIRA 3DTEA 5GTIC 3IRQA 3G1MA 4QLCU 4A3JJ 2BBYA 1IUFA 2DYRH 3E7LA 4YEJA 1U6GA 3SQNA 3TEDA 2CFOA 4MFDA 2F5CA 3K10A 3H5AA 1T0FC 5LD2C 4P96A 2LR8A 3GEZA 1ZH5A 1SD6A 4DYRA 4HF2A 3NQOA 4E70A 4LLLA 3DP7A 3CO7C 2FUG2 3F8CA 1B8IB 2E1OA 3PNTA 2F6CA 3CP2A 1CF7B 2COMA 5IYBJ 3ROUA 1E2XA 3RSNA 2D1HA 3VYUB 2BE5F 2DMNA 2HTJA 1JJ6C 4EGYA 1MJAA 5FKKA 4HA8A 4HNTA 1FMVA 1HOMA 3WTVC 2GOXB 3OYGA 5BQTA 4G6TB 2R7DA 5ICFA 4EJUA 4A3EJ 3IH2A 1JT0A 1EH7A 1R1TA 1KQ9A 1LJ9A 1SFKA 4CUGA 2KIQA 3TO6A 4P5OA 4HW0A 1HBXG 3K2ZA 4BHPA 3JRIA 2AO9A 3KZIC 3H3VK 3WU0A 3LSKA 4BHBA 3K1NA 1ETYA 4CCNA 2TDXA 5H6RA 3HRSA 5HLHA 2UUZA 1MSFC 3DKXA 1JI8A 1YW8A 4BL0B 1KGSA 5J8CA 4CO8A 2R0QC 2P0WA 4V2GA 4D0PA 2CWEA 4BDZA 3ZQFA 2P6SA 2UWMA 3EUAA 1GXQA 1Z67A 1LFBA 4BJ6C 4YG2F 3K4CA 2VT2A 4FISA 3FXKA 2IBDA 2LSOA 3ZQQA 6PAXA 1XSXA 1EV7A 1YJ9I 4U0YA 2XRLA 4CDGA 1YI2I 1T95A 1TWAJ 1DQUA 1Y0NA 2IGKA 2XGXA 2Y75A 2VKEA 3H9GA 2MA3A 2M2EA 3HJEA 2R7WA 2CQNA 1ZQ3P 5K7ZA 2E7XA 3FMQA 3S17J 4OWRB 5EZHA 1O3QA 1ITYA 1GV5A 2IVMA 2OQGA 1XGMA 5GAGJ 2HR3A 4M9XA 3JREA 4RGUA 4XLAA 2J5PA 1WI3A 1HF0A 3DEWA 4N9IA 4YFXF 5JVGF 4PDKA 3BTLA 1S7AA 3F8MA 3FXRA 1D8JA 2ZXJA 5JHFA 3NWSA 1B1BA 4XOTA 3ZCOA 1JKPC 2HS5A 2EPFA 1I6HJ 2STTA 1I1GA 4ABZA 2JVHA 3SFIA 1G4DA 5E79C 4QTRA 3VB2A 3C2GA 5D6FA 1MBFA 3K6GA 4BJ5C 2LKXA 1XSDA 4BJTA 1K7AA 2EWNA 1B59A 4AIDA 2QUFA 2OU2A 3QAHA 3RI4A 3FBNB 2DT6A 4Z6YA 5JI6A 4WWCA 4NC7A 1OCRH 5IY5H 1USSA 3ABLH 2DOAA 2QENA 3GUDA 4HEA2 3OYJA 5FLVA 3HYIA 1KQ0A 3FMRA 3MKYB 4F7ZA 2Y48A 5M5XJ 5LRRA 5L3GA 3L2UA 2FJ1A 1TL8A 1Y8QB 3O3KA 1OMIA 3RKWA 2JA5J 4YFNF 3KPHA 2LNBA 3M1EA 4JX5A 1RPWA 4XIDA 2K9NA 2ZMEA 4X1EA 4R8HA 4W97A 5L3CA 4E7HA 4RBOA 2X6WA 1SAXA 1W7PD 2CW0F 4NBQA 4QWQA 1IRXA 4OMZA 1FSEA 3FISA 1W1WE 2M4GA 1NK2P 3I4MJ 3TMOA 2EINH 4ZYEA 1QA6A 4XLHA 2ADUA 3JRCA 1ETQA 3MKWB 2DFFA 3GFIA 5IT9Z 1XD7A 4DQ2A 1ULYA 1SD4A 1X1BA 1LQ1A 5IYDJ 3Q0WA 3AL0C 2CYYA 3OYHA 3SYTA 3GF2A 1F43A 1K83J 1QZEA 4DOZA 4LG3A 3FXMA 2KRHA 2PMUA 1P6RA 3DBRB 3CQZJ 5FO5A 3HPHA 4EJVA 4RMNA 5FKOA 1U8RA 3I64A 4CCLA 2XDVA 3DBHB 1RKTA 1JKOC 2QQBA 3S15J 2NS8A 4P9FA 3M07A 1Z1DA 4WXDA 5JFRA 2WB1A 3BY6A 3HHGA 4BHCA 3G3ZA 2ELJA 1RR7A 4IHSA 3HUGA 2HXOA 3IUOA 1MMSA 3GWZA 3OS1A 4XRSG 2LF8A 4RLFA 5GPAA 5J4YA 1QHGA 3QPSA 3E6MA 1YJWI 2EV5A 1R36A 1UHWA 2NOGA 4OIOF 2R7ZJ 4CSWA 2Y0MA 3GYHX 1MMGA 5EGOB 3A2KA 2ZXIA 2COBA 4E7LA 1YW7A 1RUOA 3GW2A 4PZJA 1PP7U 2HDDA 1ERDA 5JLWA 1UELB 4RB2C 4U0WA 2C6YA 3U21A 3KX2A 3S1QJ 3BP8A 2CSOA 3PNVA 3H0DA 1BBYA 3OYDA 1LPQA 3HXLA 4O5VA 1XDSA 2FU4A 3OOUA 2QGUA 2DMQA 3MKLA 2WAQA 5LHGA 3GTQJ 5LEKA 4IX7A 1G3YA 1ZGJA 2X4HA 1IN7A 3FKIJ 3HOVJ 2DTRA 2CW7A 2LMDA 3K4JA 5FLXK 4C9YA 3X2QH 2VC0A 2IGMA 3F9KA 4UXNA 4EVIA 5IPAA 2KRFA 2P7CB 2JUGA 3BLYA 2JVGA 2WY8Q 4U7DA 3TW7A 2Z9OA 2ELKA 4NNJA 4A3KJ 1W5TA 1NK3P 5EYRA 4NUBA 3DTIA 1KU7A 3HSFA 2MH2A 3M8FA 2NAZA 1ETVA 4BKXA 1SMYF 3N05A 1KU2A 3RPQA 2DDBA 2M34A 4CGZA 2Y69H 3NARA 3CDIA 1U78A 2Q8KA 5HODA 1IW7F 1UCRA 4E7JA 4IXAA 3RKQA 4XRSA 3WTWC 3QPLA 3QU3A 4C2MJ 5C4JJ 1MBHA 2N8GA 4M73A 4ETSA 2KL4A 2H6BA 3IH4A 3SDBA 1QPIA 1WKMA 1FT9A 2L4AA 2YU9J 2VJ4A 3HPGA 3KEQA 3LL7A 2VL8A 1UAAA 1WHUA 2DI3A 1FOWA 2ZC2A 4MEYF 1S72I 3N4MA 2O61A 3HRMA 5TJJA 5DS9A 2EZHA 2XPVA 4AWXB 4CH7A 5CVIA 4MTEA 2HPMA 3S1RJ 1H9GA 2JPCA 3OSFA 2R5YA 2G7HA 2Y31A 2FQ4A 4C2TA 1VTNC 4Y17A 4BS9A 5DUIA 3ZP5A 3KP2A 1ZRFA 1GVJA 1JUMA 2FNPA 5KVRA 4E7KA 5CYVA 4NC8A 3A02A 1Q1HA 5D5VB 3HTUA 3RKXA 4B09A 3H3ZA 4UVCA 4C3HJ 5GPCA 1GVDA 1VF9A 1X1DA 2O5RA 1ZYRF 2NVYJ 4OAZA 1ETWA 3BQYA 5B3SH 3H0GJ 3A0HC 4F3QA 3VWBA 5F08A 4G7OF 1FOYA 2L7KA 3E97A 1A31A 1XGSA 3LQRA 4K2EA 3HG9A 1O3SA 4A3BJ 3FF5A 3OR1C 2FRHA 2E1MB 3W2VA 3HEFA 5JR3A 3RZOJ 2PMZA 2FD5A 2XF5A 4L9NA 1SMTA 2LH9A 4IQ4A 2EB7A 3B02A 3IP4B 3VOEA 3LFKA 2G0EA 5D6EA 3L2WA 4ZYDA 2EH3A 2MLKA 1Z7UA 3T8TA 3LSTA 4HNUA 2JA7J 2CUFA 2CMPA 2H8RA 4JP0A 4OIPF 2QZ8A 4M72A 2GZWA 4IJAA 3EYYA 2E1NA 4Q47A 3ZXSA 2NVXJ 2R4GA 2VASA 4G9YA 2RV8A 4IL6C 2V7FA 3FKJA 5L3BA 1OR7A 1Z6RA 2XAFA 2W7NA 2DODA 2M5WA 4PSWA 4Y4RA 1FNNA 3PSIA 1X1AA 1KA8A 5LHIA 3PNYA 1M1EB 3OOPA 4P55A 3CC4I 4OINF 1BC8C 2BW3A 3LWFA 2STWA 2HQ5A 1QZZA 1BOAA 1RC9A 4XK4A 1Z21A 1K78A 4ESJA 2XAHA 4LGWA 3JCUC 1Z3YA 1O7LA 1ZELA 4L9JA 1W7PA 1R49A 2DA2A 4YIRX 2JTVA 1SVOA 4NDLA 1R4MB 2CV0A 1IN4A 1Z3XA 2WTEA 3D1NI 2KMUA 4PJMA 2X1DA 2H94A 1OYIA 2NVUB 2DT7B 1QPMA 3ML6A 3H5NA 4ZZLA 4GYIA 4FTHA 4G6QA 4UV8A 4DZPA 4OAYA 4W1UA 4KITB 5E8IA 1WPKA 4G7ZF 3AG1H 2ZJ2A 3GCMA 3O6BB 2EV0A 3CDLA 2L7MP 3PQKA 4XLFA 1IO2A 4IHYA 3CCUI 2HPIA 1RZ4A 1ZARA 1F9NA 3TL4X 4LB6B 5DD4A 2ESHA 1DU6A 3KP4A 4I0AA 2K9SA 1MBJA 1WJAA 2E60A 2RNGA 3NWTA 2X48A 1TTYA 2BYVE 3ZQHA 4GRIA 4ZZDA 3HC7A 5C3EJ 4J00A 2Z5UA 2HQNA 1TZLA 3G71I 3I0TA 3I54A 3OL4A 1IN5A 5FKNA 2LTPA 2UV1A 3I3LA 4X0GA 2P5KA 1FYLA 3LSJA 4HV6A 1IN6A 3LQQA 4P1WA 1ZKGA 5DV5A 1GHCA 1DPRA 1IV8A 1JTYA 2M8EA 4LITA 3S8PA 1QRYA 3ABMH 3TO9A 4IO9F 4M3BA 1MMAA 5ILSA 3OYEA 3GTLJ 4AIJA 2K4BA 4G12A 3G6EI 5K5RA 1WZ2A 2E19A 4FT8A 4B8XA 3MZHA 4MHGA 1UHMA 5JLXA 2BOLA 1B8IA 3QODA 2UZKA 2HFHA 2VLAA 4DJAA 1E3HA 2JMWA 1HQCA 3OYIA 2P8TA 3DPUA 3KLOA 3OYMA 2R5ZB 2L0KA 4IKFA 2OQRA 1JE8A 4A3CJ 3MZYA 4GYGA 4XL9A 3TBIA 3M4OJ 3ZMSA 2R7XA 5K5OA 4RLQA 3I56I 3VSKA 2VJJA 3VYTB 3HHHA 2GXGA 3E5XA 1MIJA 2R5YB 2RQPA 4HOBA 2QQ8A 2VQGA 1UFMA 3Q9VA 4AVZA 5FRMA 2MW8A 3FMSA 3GMEA 3DKWA 3ZOBA 1Y0UA 2M0MA 2I5UA 3CO6C 3OMYA 1BW6A 3DLLF 4ANJA 1ZK8A 3KP7A 3S14J 1GLNA 1OLTA 1BW5A 1FLIA 2X6YA 4ZDOA 1KYZA 3A03A 1BI3A 1HXDA 5F27A 2ISZA 2A05A 1HDPA 2E7WA 4A69C 2OV7A 5F04A 4G7HF 3J7ZI 1K6YA 4EJWA 2A6TA 4LIVA 2NNYA 3PJRA 2OAZA 3EETA 4KYWA 2IS1A 2ECCA 1SD5A 1D0ZA 3LSMA 2Y0SA 3V4GA 5KNLA 2IXSA 1O3RA 2MABA 2DXIA 3R60A 4MQVA 3GX4X 1SEUA 3VEPA 1J9IA 1BOBA 4GO1A 3TKYA 4A6DA 1FYMA 2HYFA 2ZMEC 3LAPA 2L3DA 4YRVA 3C1DA 1IDZA 3F22A 4N9HA 3E6DA 2BHYA 3WGGA 3ASOH 2PBIA 2IA1A 2VKHA 2VB6A 2O03A 3JSOA 4GFBA 2K3FA 1USTA 3L1PA 4A3DJ 4G8XA 5TISC 2MC4A 2AQFA 1WI9A 1OCPA 3M3YJ 2VBWA 3KYDB 4AIKA 2A6EF 2BW3B 4DBQA 1MNEA 4XRFA 2WWYA 5CQEA 2NVQJ 3F8BA 5E18F 1ZRDA 5F1RA 1W7PB 4RA2A 4CHUA 4ZTJA 5C4XJ 5J1RA 1X3UA 2OTLI 3CUQB 2KJBA 2XGDA 4LOCA 2VUMJ 4B1RA 1W36C 3DXJF 2CFXA 1B6AA 1MJBA 2DBBA 2ME0A 4I76A 3BR3A 2KIFA 3VPRA 3M9AA 1P4XA 5BPDA 4HF1A 1WJBA 2IS6A 5CQGA 1R7JA 1ZG1A 2VOOA 2ELHA 4XSXF 3M7GA 3V7RA 4OOIA 1ZAOA 1X3ZB 2K4JA 5M5YJ 3NRVA 3QOPA 3TQNA 3V42A 1E3OC 3KP5A 2IRFG 2F5DA 1UJ8A 1OFCX 3HM5A 2E36A 1VQPI 2A5YB 1A35A 4V19K 1FTZA 2BZTA 2L7FP 4UVAA 4A6EA 1X2MA 3VYRB 1W5CC 2HVRA 1N25A 4XMYA 1B9NA 2OJED 3QYBA 1ZR4A 4UUVA 3MWMA 2H1LA 3OWTA 1A5JA 3R61A 3VFZA 3IKTA 5HS8A 3GTJJ 2GM4A 5DM7F 2LKPA 3EDPA 5HOOA 1GT0C 4XONA 3SHFA 1XTAA 2FF4A 1RNLA 2UXXA 1P9QC 5TGTA 1PP8F 1ZREA 1H9TA 1SFOJ 2OZ6A 2DLLA 4JX6A 3SZGA 1ZHFA 2IA2A 5H2FC 3LSGA 1ZLJA 4O6JA 1U5TA 3K1MA 2QCOA 3DWLE 2NVTJ 1S7OA 3AFHA 3GTMJ 1AWCA 4IF4A 1I50J 3G73A 4S04A 2JSPA 5M3FJ 2VC1A 5D4RA 3KZYA 5J1YA 2VJIA 1LDDA 2VBYA 3OS0A 3ZMVA 5JVTA 4HLYA 3SZPA 1N75A 2CUEA 1O57A 1VQ6I 1K61A 1A6IA 3J80K 4C2UA 1Y8RB 4D1QA 1I39A 4IRGA 3GFJA 3V8KA 2EFOA 4WK8F 2DMPA 2V79A 3JTGA 2HDCA 4DNCA 4EJOA 2PJRB 3WTSC 5EGOA 5F64A 5E17F 2XKPA 5F0CA 1IUYA 4RAZA 2KISA 1PUFB 3GFLA 3ZQCA 2XV4S 5GADJ 5HDGA 3QYFA 1I5ZA 2HOAA 3BG6A 2M9HA 3KZZA 2HU9A 4B3AA 1BR2A 5A2QK 4QPOA 3EUKL 4KISA 3HZJA 1FYKA 2WB1N 1W0TA 3QU6A 2Q0OA 5LFAA 1E3PA 4CCMA 2EZIA 3QP6A 5LGUA 3VSLA 3Q0UA 3BTCA 1D8KA 3MMYB 4NB5A 4HX4A 1YS6A 2DN0A 4HBLA 4LD5A 5IOYA 3HSEA 4FE4A 2ZJQF 2V6CA 4FX4A 3OL3A 1Z6TA 1WVRA 3GLXA 4ZH4F 2ZBKA 5ED4A 1L3LA 2GBYA 4KT5C 2FA5A 4D5CA 1MNMC 2HI3A 3WTZA 2HOEA 1V5EA 4N4OB 1LDKB 3F6VA 3TP3A 5KAFC 1D5YA 4BE1A 1TP4A 4M3DA 2JSCA 3JRDA 3LA3A 1W4MA 3DCFA 3EUHC 2Z33A 1APLC 4RAGA 2YUSA 3L09A 2B7EA 5KHDA 5J4VA 3BG3A 1I3QJ 1G3WA 4MFEA 4MGRA 5IP6A 4WCGA 2KQRA 3EPZA 2WY7Q 1I6XA 5HNHA 3IRRA 1F36A 4BE0A 4CYDA 2H1KA 2WAEA 4B3XA 3GZ5A 3P9CA 5EG0B 1V5GA 2MC3A 3HGGA 4XN0A 4BACA 1ACIA 4CXFA 5BNGA 1OR7C 3C18A 2E5ZA 4EATA 3G1LA 3BCAA 3BG5A 2IGNA 2OUMA 4EJTA 4R79A 1E0EA 3C3WA 5E3LA 4S0HB 3BZ6A 4IPAA 2I8DA 4EM1A 3VODA 3H36A 1HDDC 1TLHB 4ASNA 5J1UA 1BI2A 1MMNA 1P2FA 2KHMA 3DFGA 3CZ6A 1J09A 3I5UA 4R1HA 1H89C 3CCSI 1JKRC 2VPLA 1QHHD 4BE2A 2JJ7A 3FX3A 2L02A 2VONA 2P5LC 1YRNB 4U87A 4LJZF 2ETHA 3OYNA 2DA6A 2VQHA 4A12A 3CCRI 1V4RA 2L2OA 2YSRA 2LYCA 2H6CA 2UXNA 4HLXA 1FOXA 2MSYA 2LDUA 4BY7J 3K4MA 3RTRA 4A3FJ 2ME6A 1DGWY 4F52A 3PQJA 3Q3SA 1T8IA 1YQAA 2D2WA 3E1SA 1K6OA 4ZYHA 1VNDA 2NYXA 2V1NA 4JQFA 5AIPA 3BR1A 1MKMA 2DTZA 1V3FA 1VI0A 1AOYA 1R23A 4GXOA 3ECHA 1V54H 1FPQA 1U5TB 2ECBA 1VQ4I 1F5TA 3I4NJ 2HGCA 2PJPA 2V26A 2VBZA 3WGHA 2R92J 2KLOA 3BTIA 4M9ZA 4YIIA 2NXNB 2Z1DA 1D3YA 3BR6A 1WCMJ 4AU7A 2V6EA 5AIQA 4ESBA 2IT0A 2FQ3A 2GAUA 2L01A 3SFZA 1X2NA 2LP0A 1LFUP 4JOMA 3TDUC 2YR2A 3JRGA 2GQQA 2JPBA 3J81Z 4KIGA 4AYBA 4A3MJ 1DGRM 2OC6A 2PMZN 2EQRA 1WQ2A 3SZTA 3LSHA 2O3FA 2ZJPF 2ZCWA 3ASNH 4TV7A 2EA2A 3M8EA 5ERIA 3VDXA 3DBLB 3OS2A 3ABTA 2PG4A 2XGCA 3HOZJ 3MFKA 1MH3A 2Q2EB 4Y13A 1ETKA 1KU3A 1RKWA 3DQVC 3COAC 4ITVA 1Z9CA 1MZBA 3FM3A 2X51A 4RDUA 4FX0A 1IRGA 1FEXA 3WHCA 3H9QA 2JA2A 5D8LB 5J8FA 2EBIA 1LE8B 2XRNA 3A0BC 3E3VA 2ISYA 3KYLA 1MW7A 3WE2A 3K0LA 3W2WA 2GA2A 2XB0X 4CYCA 1U9OA 1ODDA 3H5RA 4PJJA 3LSPA 2WA0A 5IYCJ 3HL2A 5LLQA 4BYYA 1LUJB 3IV5A 3N97A 1A6QA 3J7AY 4OMYA 2XSJC 3BPXA 4IOAF 4ON0A 1YX3A 3TW6A 3AKZA 2B0LA 4ENMA 4RGRA 4BUPA 2CU7A 4C3IJ 2VE8A 2DMTA 3HOWJ 3S93A 1WJ5A 2LKSA 3EYIA 1HW1A 3ZN0A 2ZXWH 4DYQA 4F93B 4M6YA 2LBFB 2XPUA 3C2BA 1LFPA 2DOFA 3PFIA 4BAYA 1YS7A 2JZYA 4I01A 4XKVA 1K4TA 1VQKI 2KZVA 2V4JC 4PFOA 2A3SA 1YW9A 1JXSA 4MEXF 2O6GE 1WJEA 3TO7A 4ESFA 3TP0A 2D45A 1PUEE 2M7BA 2G7UA 4YIFA 4JYKA 5D5WB 2XAGA 2BXYA 3GZ6A 4XM3A 3WHBA 3OYKA 4XN3A 3OIOA 5ILVA 2QLZA 4I0BA 3BTJA 2R5ZA 2LVSA 3IAM2 4S05A 3E5UA 2ZNZA 1J75A 4XNFA 2DJNA 2V1UA 3BROA 2YU3A 3P9IA 4AUXA 5FB2A 3FZVA 2RGVA 1IZ1A 3PIPF 2V1XA 4BEHA 1PDNC 1TWHJ 3RQIA 2L9RA 1YIOA 1D0XA 2ZO4A 4RAFA 4U0VA 5J47A 1XPXA 5GAHJ 1YO5C 4C30A 3LNQA 5IOZA 1SANA 3KCCA 4PJ0C 3S32A 1XSVA 3TOBA 2NS0A 1Y6IA 1HC8A 2XIGA 1Y1WJ 4A5MA 1MSEC 3ERED 2FSWA 1XMXA 3H35A 2VKDA 1ZG3A 1E17A 3WU1B 2CQKA 1HCRA 2M3AA 5EZGA 3VYSB 4ZYGA 2XAQA 3KEYA 3BZCA 1T56A 3BCBA 4N0BA 2XF6A 3DU5A 2X1EA 4BY1J 2MD5A 1EJ9A 2HYJA 2X0LA 4B47A 4CICA 4M71A 3HKZA 5GAEJ 1K79A 2L4MA 3K1PA 4Y3OA 2RVCA 4CCJA 5HLTA 3L2QA 1YHQI 5EEHA 4RM3A 1TC3C 1P7IA 1F1ZA 3DPTA 3FXOA 2OBPA 3BR5A 3T1BA 1A04A 1NHAA 3REOA 3J80Z 3ZMTA 2JA8J 5D4SA 2L5QA 2EIJH 2Y2ZA 4L5IA 4BQOA 3JRBA 3QPHA 1T33A 5HNFA 3BZKA 2DCEA 3JTHA 2K27A 1ZR2A 2KT0A 3S3OA 1G3SA 5EF6A 1S3JA 3CJTB 1JT6A 2JQ7A 2CUJA 2KJCA 4U88A 5F6FA 2GXAA 2F5EA 2NS7A 4BBRJ 3OYFA 3FHNA 5DCFA 2VOPA 3GBGA 1T08B 4YFKF 4UV9A 4L9TA 4H0EA 1ZN2A 2W57A 3M1CA 4IHVA 1JUPA 4HZFA 5A2QZ 3B6CA 2IJLA 2DFHA 3E5QA 1YOVB 3QRFF 2A68F 3E6BA 3JAMK 1KQ8A 4HQEA 1BR1A 1MNDA 2M8GX 3FBIB 3SDGA 3CUQA 2R93J 3W3CA 5K7HA 1MDMA 4II3A 1VQ8I 2Y0SN 3BC8A 5IP7J 2L9NA 2QF7A 1ZGAA 3FDYA 4X6AJ 1PVEA 3CCEI 2QSHX 4LLNA 2F5VA 2K9MA 2CQ7A 2CQQA 3LSIA 5DD8A 4WX9A 4NHJA 2J5OA 4PGGA 1WGXA 3HSRA 3P5JA 5DCMB 2LLKA 1VQ7I 3NEUA 2L54A 2GXBA 1S6LA 1X4PA 2HTSA 4KICA 3CP8A 1XX5A 2BHZA 4CYCB 1QNTA 2FBKA 5FD5A 1AKHA 2W84A 3JSPA 4HF0A 5DYMA 3OYCA 2CS3A 1J7KA 1R6RA 5DDGA 3Q9SA 2W24A 1B72B 1XB4A 2X9DA 3MCZA 2LG4A 1JGSA 4GCVA 1IXRC 1FMWA 5LHHA 2X1CA 3BQZA 3CCJI 3MAJA 2EJRA 2VQCA 4HAMA 3ZQIA 1R5HA 4RM2A 1DPUA 3JW4A 2DAOA 3U9GA 4KIFA 2EIMH 2RC4A 3FWEA 2HNHA 4M3GA 1BI0A 1JKQC 3LSRA 2M1BA 4XLPF 4XICA 2HYGD 3GTOJ 3OYBA 2GIVA 3IL2A 1Z77A 3PM1A 4PJNA 1FOKA 4Q4ZF 5HS7A 1AA7A 2CW8A 2QYOA 4A0XA 2R7QA 1IJWC 1DP7P 1TNTA 2F4MB 2DA1A 1Z05A 2BVMA 4M6VA 4HG2A 1IG7A 2D5VA 4IRHA 2VODA 1UHSA 2IP2A 3HIFA 3WTUC 2LC2A 4BH9A 5D5UB 2XUBA 1R1UA 4Y33A 4HDVA 1ZLKA 3BT9A 1YG2A 3L7WA 4KIBA 3BG9A 4BXXJ
chains in the Genus database with same CATH topology
2LKSA 2B7EA 2DODA 2JUCA 2KFDA 2DOFA 2KIQA 1UZCA 2DOEA 2KISA 2E71A 2L9VA 2CQNA 2K85A 4FQGA 2KZGA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2LKS A;  2B7E A;  2DOD A;  2JUC A;  2KFD A;  2DOF A;  2KIQ A;  1UZC A;  2DOE A;  2KIS A;  2E71 A;  2L9V A;  2CQN A;  2K85 A;  4FQG A;  2KZG A; 
#chains in the Genus database with same CATH topology
 4AIH A;  2X6X A;  3K69 A;  3P9K A;  2LY2 A;  3DTK A;  4BEH B;  1Z7L A;  2M7A A;  3PUF A;  2FE3 A;  1XCV A;  3CDH A;  5HLG A;  2FNA A;  3K70 C;  1VQM I;  2PJR A;  2DA7 A;  2PFB A;  1R22 A;  2OD5 A;  1TT0 A;  1YX5 A;  1JHH A;  1C0W A;  1TWC J;  3PUB A;  4XR6 A;  2LRD A;  2OCC H;  4CCO A;  2XGE A;  1PUF A;  4LG0 B;  9ANT A;  2JUC A;  2WBM A;  1TBX A;  5KK1 A;  3K4K A;  4IHW A;  4LK0 F;  2QVO A;  4ZDP A;  4ENN A;  2V9K A;  3MQ0 A;  1HKQ A;  3S2H J;  2A61 A;  4D9J A;  1AHD P;  4O3M A;  4ENK A;  5E8G A;  3ZR8 X;  5DM6 F;  1LB2 A;  3CUO A;  1OCO H;  4PUS A;  3TDZ C;  3J81 K;  2KFD A;  1LVK A;  2MBF A;  3MZ8 A;  3O8H A;  1U8B A;  2OA4 A;  2LFB A;  4QSH A;  4FHT A;  1RI7 A;  4RB0 A;  5E20 A;  3L2V A;  1DP3 A;  2FMY A;  5EDN A;  5E3M A;  1ZGW A;  1BA5 A;  3M8J A;  4RAY A;  2Z16 A;  1MBK A;  4D7N A;  1L0O C;  2LRE A;  5K1Y A;  1QVU A;  2IAI A;  5BS6 A;  1UB9 A;  5L3D A;  1O7F A;  4GGG A;  1STZ A;  1OKR A;  2VKV A;  2VT3 A;  4PGH A;  2Q1Z B;  1EF4 A;  2IW5 A;  3D0S A;  1SC7 A;  3CF2 A;  4HYE A;  4B4C A;  2E1M C;  2Y30 A;  1I3A A;  1VFC A;  1FX7 A;  4DGW B;  2QSG X;  4KT6 A;  5B5E C;  2VXZ A;  4A0Y A;  4IRI A;  4PFP A;  2FEZ A;  5EEA A;  2HKO A;  3HBL A;  5EG0 A;  5BMZ A;  2M4K A;  1MDM B;  3PFY A;  1YIJ I;  1FSH A;  1J0R A;  4UUS B;  2O0Y A;  3UNG C;  4OU0 A;  1MJ9 A;  4HNV A;  4KA4 A;  3CJR B;  2HOT A;  3K2A A;  2DO7 A;  1MH4 A;  4BGD A;  1R71 A;  4YEL A;  4KN4 X;  2ZSH B;  4ZC3 A;  4BNC A;  1T38 A;  5FFZ A;  2JRT A;  2VPR A;  5FLM J;  1BJZ A;  4MNU A;  1RIO H;  2O7O A;  4DBR A;  1BIB A;  2KIU A;  3S2D J;  4CCK A;  3CME I;  1JTX A;  4HPQ A;  1AKH B;  2BXZ A;  2MH9 A;  2WC2 A;  3CCY A;  4QPQ A;  1CQT A;  1YRN A;  3OV8 A;  3ZMD A;  2DU9 A;  5JHU A;  4HDU A;  2GLO A;  2EA4 A;  1ZRC A;  3JR9 A;  3LFU A;  3AL0 B;  2K9Q A;  3FXU A;  4JK1 X;  3KP3 A;  2QBY A;  2DYS H;  4MO7 A;  2E2I J;  1LVA A;  1IRZ A;  3HRT A;  2JK3 A;  5F0H A;  4U7B A;  3S3M A;  1GXP A;  2YS9 A;  1P4A A;  2VBX A;  2MD0 A;  5IT3 A;  4Q5S F;  3KYC B;  1VQO I;  4BDY A;  4I98 B;  1XS9 A;  2ZXH A;  4OIR F;  4EM0 B;  4GDF A;  1QZY A;  1YLF A;  3MD2 A;  2GWR A;  4E7Z A;  1O3T A;  1VZ0 A;  2W00 A;  3K4N A;  3IHU A;  1ZG5 A;  1J5Y A;  2P4W A;  2M30 A;  1GV2 A;  2XRO A;  4JX4 A;  2CGP A;  2AXT C;  4XLN F;  2W4S A;  2DJI A;  2R3S A;  4AD9 A;  1XGO A;  2GA1 A;  4ZDL A;  2QSF X;  3S3N A;  2BY0 A;  3KLN A;  3PO2 J;  1VQN I;  4DW6 A;  3H3U A;  3WGI A;  2MLG A;  1X58 A;  2MYS A;  2VN2 A;  3F8F A;  3PSF A;  3QOE A;  3CMA I;  4EQQ A;  4ZTF A;  1U2W A;  3H92 A;  5BPI A;  4M74 A;  2IS2 A;  3ULQ B;  5FD6 A;  2NRA C;  1BR4 A;  4D7M A;  1QVT A;  2L7Z A;  1I27 A;  2ZFW A;  2HVQ A;  3G4S I;  4XOP A;  1Q1V A;  2VI6 A;  3ZRG A;  3K9T A;  3I53 A;  1X4O A;  3WTX C;  1MBG A;  1SD7 A;  2Q2E A;  3P7N A;  2VQL A;  3T5X A;  2FML A;  4KN7 X;  2EIK H;  2KP6 A;  2LD5 A;  3O2P E;  3JRF A;  1LE8 A;  2R7S A;  1KYW A;  2FOK A;  4BQN A;  1WH7 A;  3L00 A;  1XG1 A;  3HOX J;  3TGN A;  2AQE A;  1EKE A;  3DEU A;  2QWW A;  5CKT A;  1SAU A;  1ORK A;  3IH3 A;  2YPR A;  2QA4 I;  1R5I D;  3FIW A;  4L0Z B;  2YX7 A;  4EV0 A;  4B44 A;  3CCL I;  1LEB A;  2QKM B;  3HB9 A;  1LEA A;  1MD0 A;  2HDW A;  3T8R A;  4A5N A;  1DUX C;  1D1C A;  4PJL A;  3R4K A;  1IV6 A;  2P81 A;  2FOW A;  2BEO A;  3GO5 A;  3LA2 A;  1OCZ H;  3WTT C;  1R1V A;  3FXL A;  3JAM Z;  2DQL A;  4BU2 A;  3W6V A;  4AYB N;  2LBF A;  4H4K C;  4BXF A;  5B1B H;  2EZL A;  2DW4 A;  3HOT A;  1MBE A;  3J7Y J;  1RRJ A;  1G8X A;  1J59 A;  4B48 A;  1HST A;  3NAU A;  5GTH C;  1XMK A;  3LOC A;  3EQL F;  4IQJ A;  1TNS A;  1YE9 A;  2E71 A;  1S8N A;  5K7F A;  1NG7 A;  2W85 A;  3F0C A;  2ACJ A;  3OR2 C;  3BJA A;  3SEQ A;  2WAQ N;  1U9N A;  2KKO A;  1V55 H;  3GFM A;  1SFX A;  3KEO A;  1H8A C;  3C7J A;  1WJC A;  5F0F A;  4XLC A;  2E2J J;  2YX4 A;  2CUZ A;  2P7V B;  3K4L A;  2R7O A;  3QYE A;  2O8X A;  2XKO A;  1V5F A;  2AHQ A;  4XRM A;  1W5S A;  2DA3 A;  2QQ9 A;  3GTG J;  5C44 J;  4EGZ A;  3ZMU A;  1QGP A;  2A69 F;  4PCQ A;  3AAF A;  2F5F A;  3CJN A;  2LK2 A;  3RPU D;  2H09 A;  1NG6 A;  5CLS A;  4CA0 A;  1HW5 A;  3G1O A;  1JGG A;  3IC7 A;  3GTK J;  4A3G J;  1HW2 A;  3CUQ C;  3LA7 A;  3UKG A;  2WAD A;  3JRA A;  5LRS A;  1FY7 A;  3OSG A;  2RAE A;  1Z91 A;  1IXS B;  4L18 B;  4LFU A;  1ETX A;  3DLA A;  3FM5 A;  2XC7 A;  1R58 A;  2RRE A;  3BR2 A;  2QBY B;  3IWF A;  2LOO A;  5M3M J;  4LLG F;  2H8W A;  1YTY A;  4FAS D;  5BOX A;  3I71 A;  4DYC A;  2KIM A;  2G9W A;  5EJC A;  5EEG A;  1QU3 A;  2PEX A;  1LKX A;  1R00 A;  1WJF A;  2EV6 A;  4XQF A;  3S1M J;  1D0Y A;  2F48 A;  4UHT A;  1LDJ A;  1X1C A;  1O4X A;  1U0J A;  2DFE A;  4KMU X;  3ELK A;  2BGC A;  1D5V A;  1WJD A;  3F21 A;  3DU6 A;  4A2U A;  1H0M A;  1RR8 C;  5AON A;  3K7A J;  1FJL A;  4D5F A;  2EIL H;  2GIZ A;  5ICE A;  5FGM A;  2ZNY A;  1HLV A;  1N77 A;  1CGP A;  2E5N A;  5HLI A;  5TRD A;  2W1O A;  3ZQL A;  1XCB A;  2PX9 A;  1ZTR A;  1FP1 D;  3ONQ A;  2O8K A;  4F92 B;  3SXY A;  1IXC A;  3HKZ N;  3OYA A;  1RET A;  1T6S A;  5DUK A;  2FXA A;  3BPV A;  2KDO A;  2Z2S B;  3LAJ A;  3HRU A;  1TQM A;  3QP5 A;  5M5W J;  2HWV A;  3ZQ7 A;  2HXI A;  2IEK A;  3IKV A;  3AG3 H;  3CES A;  1R9T J;  2H27 A;  3MN2 A;  4E7I A;  5E1X A;  4IVN A;  5DCM A;  1DDN A;  2XF7 A;  2V1D A;  3LMM A;  4XKB A;  4LK1 F;  4BBS J;  4C3J J;  2Y9Z A;  2RDP A;  1JJ8 C;  5F1J A;  3F8N A;  3WG7 H;  4AVP A;  2WV1 A;  2B9S A;  1FC3 A;  2JA6 J;  2CRG A;  1B72 A;  2K7L A;  4A93 J;  1TW3 A;  3I4P A;  2XPW A;  4HX7 A;  2EFW A;  1G6N A;  2ZKZ A;  2R7T A;  2X85 A;  3R0A A;  4L5J A;  1HKS A;  4E4H A;  3S2W A;  1T0F A;  3ZN1 A;  4EEF G;  2DPU A;  4BXU A;  4NQW A;  5CVJ A;  2KPM A;  2R7R A;  4L0Y B;  1LNW A;  3CF5 F;  2XSD C;  3CLQ A;  5LGT A;  1KU9 A;  5CVU A;  3DV8 A;  1PYV A;  2DPD A;  3KET A;  3Q0V A;  2DMU A;  3RQ4 A;  3GVA A;  1FTT A;  3DKY A;  1EA3 A;  3F23 A;  2P5V A;  2K5C A;  1FIP A;  1ON1 A;  2AXL A;  4HSR A;  2BY3 A;  2QM3 A;  2ZJR F;  3U2R A;  1S7E A;  2E34 A;  3KIO A;  3FXJ A;  2XVC A;  3S16 J;  3H1C A;  1UG2 A;  3ECO A;  4E6K G;  2CG4 A;  2CV2 A;  5CVR A;  3KP6 A;  3H9J A;  2K40 A;  1ENH A;  4M3F A;  5D8K B;  3DPL C;  4M3E A;  3UR3 C;  3IAS 2;  1P4W A;  5LGN A;  5LBQ A;  2OZU A;  3FXQ A;  2CH0 A;  1JUS A;  3PL8 A;  2F4I A;  3BG7 A;  3BR0 A;  3OIP A;  4LG0 A;  3SEZ A;  2NOJ B;  1ONV A;  3S1N J;  2HEO A;  1J2X A;  2B63 J;  5H6Q A;  2RQQ A;  3I59 A;  1WWX A;  2ESN A;  1H88 C;  2R7U A;  1IDY A;  3ABU A;  4LIU A;  5E1Z B;  1WSU A;  3R0J A;  3D5R C;  2XAJ A;  5B66 C;  4LB5 A;  2GOM A;  3CMM A;  3R6S A;  2R7F A;  1GDT A;  4UY8 I;  2WV0 A;  2IS4 A;  2DK5 A;  1YJN I;  5CVV A;  4M9S A;  3KE2 A;  4N4N B;  4ENJ A;  3GTP J;  2ZME B;  5IP9 J;  5FJ8 J;  4ZYA A;  2ZB9 A;  2K85 A;  2KDZ A;  1IRF A;  4FCY A;  1BN5 A;  3HGY A;  1P7J A;  1VQ5 I;  3ZMZ A;  2FBI A;  3OIQ A;  1TWG J;  4F91 B;  3CCM I;  3WU2 C;  1VQ9 I;  2M45 A;  2K02 A;  2L9S A;  3BJO A;  2LF7 A;  2EFP A;  5B1A H;  2OTJ I;  1GUU A;  3ZPL A;  3O8G A;  5ICG A;  4A3I J;  5LEJ A;  4QIW N;  1WFX A;  3EUH A;  2ID3 A;  1MGT A;  4MIM A;  3D5L A;  4I02 A;  3A01 A;  2W48 A;  1G3T A;  4RGS A;  3RPU A;  1KZH A;  1ETO A;  4EMS A;  2XAS A;  4F55 A;  2OCE A;  1VQL I;  1KON A;  3CC7 I;  1BIA A;  2HQA A;  2TCT A;  2DT5 A;  3K4B A;  3BJ6 A;  5J6X A;  4AC0 A;  1OJL A;  4RB1 A;  1WH5 A;  1Y39 A;  1EH8 A;  4UNO A;  5L3F A;  2TRT A;  1U5T C;  3HUG B;  4UUS A;  1DU0 A;  1FBQ A;  1B4A A;  2VIX A;  1OQY A;  3ZQG A;  2ICW G;  1OCT C;  3MKZ A;  3F72 A;  2EZK A;  4J19 A;  3BWG A;  4I6Z A;  4G6D A;  3V7C A;  5GP9 A;  4IEJ A;  3OY9 A;  4UUT A;  2I10 A;  4I99 C;  1F4K A;  2CV1 A;  1SVM A;  4E7S A;  1ON2 A;  4XSZ F;  4DZJ A;  2VXD A;  5E1W A;  4IHT A;  4HX8 A;  2PN6 A;  2CQX A;  3FHZ A;  2VJ5 A;  3CTA A;  1QQI A;  3GZN B;  3OYL A;  5HDN A;  2HVS A;  4HRI A;  2E35 A;  3ABK H;  3W6J B;  2V9P A;  4A3L J;  4I2O A;  1R4N B;  5J40 A;  3L2C A;  4KDP A;  3B6A A;  3RYP A;  2WAF A;  5ICC A;  4ZJZ A;  5L3E A;  4RS8 A;  4BQQ A;  3W2A A;  5J3L A;  3MVP A;  4XBF A;  1D1A A;  1EH6 A;  2DDA A;  2FBH A;  1IC8 A;  4BQA A;  4NQW B;  1TQI A;  4LMY A;  3ESW B;  4L9V A;  2W82 A;  3G2B A;  3KFW X;  3QQA A;  2A6H F;  2Y9Y A;  5H20 A;  4EM2 A;  2OF7 A;  1QBJ A;  2DA4 A;  1X3W B;  1SFU A;  1T39 A;  4WXH A;  1AU7 A;  2DFI A;  4XKW A;  4Y15 A;  3V8J A;  1REP C;  2XHK A;  5E3O A;  4MQ9 F;  1S5L C;  1BC7 C;  3HDD A;  1OPC A;  1T2K A;  3CLO A;  3C2H A;  1XGN A;  4RB3 C;  1S9H A;  3GXO A;  1FBS A;  5KAI C;  4AM3 A;  2F2E A;  2F4O B;  5HDK A;  2DA5 A;  3QPT A;  2EK5 A;  1I1S A;  3HOY J;  2BY2 A;  3I55 I;  2BV6 A;  1Y56 A;  2CO5 A;  3L2R A;  4FQG A;  2KZG A;  4XKC A;  1POG A;  3V7S A;  4L5E A;  5HVQ C;  1BI1 A;  3RCO A;  4KNY A;  2IGO A;  2MG4 A;  3ZGK A;  5CJ9 A;  5IT9 K;  4IHX A;  1CF7 A;  1FBU A;  1P92 A;  2CJJ A;  1IN8 A;  2VE9 A;  1U3E M;  5FFX A;  1W0U A;  1BM9 A;  1X1P A;  1UZC A;  5K5Q A;  1BL0 A;  2A07 F;  3I59 B;  1XN7 A;  5D5X B;  3CCQ I;  4PK4 A;  2LY9 A;  5FKM A;  4JBA A;  1XMA A;  3FK6 A;  4A0Z A;  1RES A;  2R7V A;  1FZP B;  2W25 A;  3IWZ A;  2JN6 A;  1X19 A;  3RDI A;  4FET A;  2DQR A;  2OPT A;  2RNJ A;  3QWL A;  4HST A;  1TWF J;  1A36 A;  2RN7 A;  3ISP A;  2HKX A;  3K70 D;  5FRN A;  3A1Y A;  4UB8 C;  1G2H A;  1TQP A;  3CCV I;  1XC5 A;  3BOQ A;  3WOD F;  3AG4 H;  2PLY A;  2X6O A;  5FRO A;  1OYY A;  4HQM A;  3JRH A;  1B9M A;  2NNN A;  1N78 A;  4Y52 J;  2EFN A;  2XAU A;  2E2H J;  2HOS A;  3U1D A;  3T0Y A;  2DOE A;  5CPR B;  1T98 A;  1R5G A;  2JT1 A;  4PSX A;  4II2 A;  5FKL A;  2EFQ A;  5HS9 A;  3RKY A;  2K3P A;  3I9V 2;  2QEX I;  4NC6 A;  5E3N A;  1HSJ A;  5DEQ A;  1WRJ A;  3RJP A;  4DIQ A;  1SVL A;  1RUN A;  1FWZ A;  2PMH A;  2PQ8 A;  2M87 A;  3DF8 A;  2MGQ A;  2JWT A;  2HQR A;  2D1V A;  3WE3 A;  3A01 B;  2Z99 A;  1QO0 D;  2DK8 A;  3E0J B;  4M6X A;  3HOU J;  3U1K A;  2A5W A;  4MLO A;  1TT5 B;  1HKT A;  2K86 A;  2E1C A;  3L9F A;  2FX0 A;  3F6O A;  4G94 A;  2QQA A;  4Z2Y A;  3MEX A;  3CC2 I;  1UMQ A;  2K9L A;  1YYV A;  1Y1V J;  4UVB A;  2O9L A;  3B73 A;  4XLE A;  1TW2 A;  1Z0X A;  4HV5 A;  1PJR A;  1S29 A;  2IPQ X;  3W6K B;  1JHF A;  3WTY C;  3J7A O;  3RZD J;  3ERM A;  4Y7N J;  2KRC A;  4OIQ F;  1XDU A;  2LY1 A;  1UG0 A;  2P6T A;  1FIA A;  4J01 A;  1IF1 A;  1NTC A;  1BJA A;  3GLL A;  4FE7 A;  1K78 B;  1YIT I;  2ID6 A;  2V9V A;  2Z3Y A;  4I7H A;  1YFH A;  4RGX A;  5DTD A;  2ZFU A;  3WG9 A;  3HTS B;  4CZZ A;  3I58 A;  5ILU A;  2BVL A;  2QKL B;  5FLX Z;  1MMD A;  5KCM A;  4WXC A;  1OIS A;  3CMY A;  1W36 D;  4UB6 C;  2AS5 F;  3PO3 J;  1G59 A;  3F3X A;  4WF2 A;  2PI0 A;  1SFE A;  3SJM A;  3V8L A;  4I09 A;  4MTD A;  2XB5 A;  4V2F A;  4CZC A;  3DEE A;  1NH3 A;  2IA0 A;  4KJZ A;  3TOA A;  1D1B A;  1IAW A;  1K4S A;  1FP2 A;  3BDD A;  3Q5F A;  2BY1 A;  1HA8 A;  2MFZ A;  3AG2 H;  2HZT A;  2JRM A;  1OYW A;  2ZSI B;  2M0C A;  3A4C A;  3D5S C;  4Q48 A;  3HOS A;  4P9U A;  4KUM A;  3CD6 I;  3FK7 A;  3RYR A;  1IGN A;  4KMF A;  3CJQ B;  1OCC H;  2HZD A;  2L9V A;  4IZZ A;  2RKH A;  4KFC A;  3PIO F;  3E6C C;  4B43 A;  4IOC F;  4XOR A;  3RIR A;  3DTE A;  5GTI C;  3IRQ A;  3G1M A;  4QLC U;  4A3J J;  2BBY A;  1IUF A;  2DYR H;  3E7L A;  4YEJ A;  1U6G A;  3SQN A;  3TED A;  2CFO A;  4MFD A;  2F5C A;  3K10 A;  3H5A A;  1T0F C;  5LD2 C;  4P96 A;  2LR8 A;  3GEZ A;  1ZH5 A;  1SD6 A;  4DYR A;  4HF2 A;  3NQO A;  4E70 A;  4LLL A;  3DP7 A;  3CO7 C;  2FUG 2;  3F8C A;  1B8I B;  2E1O A;  3PNT A;  2F6C A;  3CP2 A;  1CF7 B;  2COM A;  5IYB J;  3ROU A;  1E2X A;  3RSN A;  2D1H A;  3VYU B;  2BE5 F;  2DMN A;  2HTJ A;  1JJ6 C;  4EGY A;  1MJA A;  5FKK A;  4HA8 A;  4HNT A;  1FMV A;  1HOM A;  3WTV C;  2GOX B;  3OYG A;  5BQT A;  4G6T B;  2R7D A;  5ICF A;  4EJU A;  4A3E J;  3IH2 A;  1JT0 A;  1EH7 A;  1R1T A;  1KQ9 A;  1LJ9 A;  1SFK A;  4CUG A;  2KIQ A;  3TO6 A;  4P5O A;  4HW0 A;  1HBX G;  3K2Z A;  4BHP A;  3JRI A;  2AO9 A;  3KZI C;  3H3V K;  3WU0 A;  3LSK A;  4BHB A;  3K1N A;  1ETY A;  4CCN A;  2TDX A;  5H6R A;  3HRS A;  5HLH A;  2UUZ A;  1MSF C;  3DKX A;  1JI8 A;  1YW8 A;  4BL0 B;  1KGS A;  5J8C A;  4CO8 A;  2R0Q C;  2P0W A;  4V2G A;  4D0P A;  2CWE A;  4BDZ A;  3ZQF A;  2P6S A;  2UWM A;  3EUA A;  1GXQ A;  1Z67 A;  1LFB A;  4BJ6 C;  4YG2 F;  3K4C A;  2VT2 A;  4FIS A;  3FXK A;  2IBD A;  2LSO A;  3ZQQ A;  6PAX A;  1XSX A;  1EV7 A;  1YJ9 I;  4U0Y A;  2XRL A;  4CDG A;  1YI2 I;  1T95 A;  1TWA J;  1DQU A;  1Y0N A;  2IGK A;  2XGX A;  2Y75 A;  2VKE A;  3H9G A;  2MA3 A;  2M2E A;  3HJE A;  2R7W A;  2CQN A;  1ZQ3 P;  5K7Z A;  2E7X A;  3FMQ A;  3S17 J;  4OWR B;  5EZH A;  1O3Q A;  1ITY A;  1GV5 A;  2IVM A;  2OQG A;  1XGM A;  5GAG J;  2HR3 A;  4M9X A;  3JRE A;  4RGU A;  4XLA A;  2J5P A;  1WI3 A;  1HF0 A;  3DEW A;  4N9I A;  4YFX F;  5JVG F;  4PDK A;  3BTL A;  1S7A A;  3F8M A;  3FXR A;  1D8J A;  2ZXJ A;  5JHF A;  3NWS A;  1B1B A;  4XOT A;  3ZCO A;  1JKP C;  2HS5 A;  2EPF A;  1I6H J;  2STT A;  1I1G A;  4ABZ A;  2JVH A;  3SFI A;  1G4D A;  5E79 C;  4QTR A;  3VB2 A;  3C2G A;  5D6F A;  1MBF A;  3K6G A;  4BJ5 C;  2LKX A;  1XSD A;  4BJT A;  1K7A A;  2EWN A;  1B59 A;  4AID A;  2QUF A;  2OU2 A;  3QAH A;  3RI4 A;  3FBN B;  2DT6 A;  4Z6Y A;  5JI6 A;  4WWC A;  4NC7 A;  1OCR H;  5IY5 H;  1USS A;  3ABL H;  2DOA A;  2QEN A;  3GUD A;  4HEA 2;  3OYJ A;  5FLV A;  3HYI A;  1KQ0 A;  3FMR A;  3MKY B;  4F7Z A;  2Y48 A;  5M5X J;  5LRR A;  5L3G A;  3L2U A;  2FJ1 A;  1TL8 A;  1Y8Q B;  3O3K A;  1OMI A;  3RKW A;  2JA5 J;  4YFN F;  3KPH A;  2LNB A;  3M1E A;  4JX5 A;  1RPW A;  4XID A;  2K9N A;  2ZME A;  4X1E A;  4R8H A;  4W97 A;  5L3C A;  4E7H A;  4RBO A;  2X6W A;  1SAX A;  1W7P D;  2CW0 F;  4NBQ A;  4QWQ A;  1IRX A;  4OMZ A;  1FSE A;  3FIS A;  1W1W E;  2M4G A;  1NK2 P;  3I4M J;  3TMO A;  2EIN H;  4ZYE A;  1QA6 A;  4XLH A;  2ADU A;  3JRC A;  1ETQ A;  3MKW B;  2DFF A;  3GFI A;  5IT9 Z;  1XD7 A;  4DQ2 A;  1ULY A;  1SD4 A;  1X1B A;  1LQ1 A;  5IYD J;  3Q0W A;  3AL0 C;  2CYY A;  3OYH A;  3SYT A;  3GF2 A;  1F43 A;  1K83 J;  1QZE A;  4DOZ A;  4LG3 A;  3FXM A;  2KRH A;  2PMU A;  1P6R A;  3DBR B;  3CQZ J;  5FO5 A;  3HPH A;  4EJV A;  4RMN A;  5FKO A;  1U8R A;  3I64 A;  4CCL A;  2XDV A;  3DBH B;  1RKT A;  1JKO C;  2QQB A;  3S15 J;  2NS8 A;  4P9F A;  3M07 A;  1Z1D A;  4WXD A;  5JFR A;  2WB1 A;  3BY6 A;  3HHG A;  4BHC A;  3G3Z A;  2ELJ A;  1RR7 A;  4IHS A;  3HUG A;  2HXO A;  3IUO A;  1MMS A;  3GWZ A;  3OS1 A;  4XRS G;  2LF8 A;  4RLF A;  5GPA A;  5J4Y A;  1QHG A;  3QPS A;  3E6M A;  1YJW I;  2EV5 A;  1R36 A;  1UHW A;  2NOG A;  4OIO F;  2R7Z J;  4CSW A;  2Y0M A;  3GYH X;  1MMG A;  5EGO B;  3A2K A;  2ZXI A;  2COB A;  4E7L A;  1YW7 A;  1RUO A;  3GW2 A;  4PZJ A;  1PP7 U;  2HDD A;  1ERD A;  5JLW A;  1UEL B;  4RB2 C;  4U0W A;  2C6Y A;  3U21 A;  3KX2 A;  3S1Q J;  3BP8 A;  2CSO A;  3PNV A;  3H0D A;  1BBY A;  3OYD A;  1LPQ A;  3HXL A;  4O5V A;  1XDS A;  2FU4 A;  3OOU A;  2QGU A;  2DMQ A;  3MKL A;  2WAQ A;  5LHG A;  3GTQ J;  5LEK A;  4IX7 A;  1G3Y A;  1ZGJ A;  2X4H A;  1IN7 A;  3FKI J;  3HOV J;  2DTR A;  2CW7 A;  2LMD A;  3K4J A;  5FLX K;  4C9Y A;  3X2Q H;  2VC0 A;  2IGM A;  3F9K A;  4UXN A;  4EVI A;  5IPA A;  2KRF A;  2P7C B;  2JUG A;  3BLY A;  2JVG A;  2WY8 Q;  4U7D A;  3TW7 A;  2Z9O A;  2ELK A;  4NNJ A;  4A3K J;  1W5T A;  1NK3 P;  5EYR A;  4NUB A;  3DTI A;  1KU7 A;  3HSF A;  2MH2 A;  3M8F A;  2NAZ A;  1ETV A;  4BKX A;  1SMY F;  3N05 A;  1KU2 A;  3RPQ A;  2DDB A;  2M34 A;  4CGZ A;  2Y69 H;  3NAR A;  3CDI A;  1U78 A;  2Q8K A;  5HOD A;  1IW7 F;  1UCR A;  4E7J A;  4IXA A;  3RKQ A;  4XRS A;  3WTW C;  3QPL A;  3QU3 A;  4C2M J;  5C4J J;  1MBH A;  2N8G A;  4M73 A;  4ETS A;  2KL4 A;  2H6B A;  3IH4 A;  3SDB A;  1QPI A;  1WKM A;  1FT9 A;  2L4A A;  2YU9 J;  2VJ4 A;  3HPG A;  3KEQ A;  3LL7 A;  2VL8 A;  1UAA A;  1WHU A;  2DI3 A;  1FOW A;  2ZC2 A;  4MEY F;  1S72 I;  3N4M A;  2O61 A;  3HRM A;  5TJJ A;  5DS9 A;  2EZH A;  2XPV A;  4AWX B;  4CH7 A;  5CVI A;  4MTE A;  2HPM A;  3S1R J;  1H9G A;  2JPC A;  3OSF A;  2R5Y A;  2G7H A;  2Y31 A;  2FQ4 A;  4C2T A;  1VTN C;  4Y17 A;  4BS9 A;  5DUI A;  3ZP5 A;  3KP2 A;  1ZRF A;  1GVJ A;  1JUM A;  2FNP A;  5KVR A;  4E7K A;  5CYV A;  4NC8 A;  3A02 A;  1Q1H A;  5D5V B;  3HTU A;  3RKX A;  4B09 A;  3H3Z A;  4UVC A;  4C3H J;  5GPC A;  1GVD A;  1VF9 A;  1X1D A;  2O5R A;  1ZYR F;  2NVY J;  4OAZ A;  1ETW A;  3BQY A;  5B3S H;  3H0G J;  3A0H C;  4F3Q A;  3VWB A;  5F08 A;  4G7O F;  1FOY A;  2L7K A;  3E97 A;  1A31 A;  1XGS A;  3LQR A;  4K2E A;  3HG9 A;  1O3S A;  4A3B J;  3FF5 A;  3OR1 C;  2FRH A;  2E1M B;  3W2V A;  3HEF A;  5JR3 A;  3RZO J;  2PMZ A;  2FD5 A;  2XF5 A;  4L9N A;  1SMT A;  2LH9 A;  4IQ4 A;  2EB7 A;  3B02 A;  3IP4 B;  3VOE A;  3LFK A;  2G0E A;  5D6E A;  3L2W A;  4ZYD A;  2EH3 A;  2MLK A;  1Z7U A;  3T8T A;  3LST A;  4HNU A;  2JA7 J;  2CUF A;  2CMP A;  2H8R A;  4JP0 A;  4OIP F;  2QZ8 A;  4M72 A;  2GZW A;  4IJA A;  3EYY A;  2E1N A;  4Q47 A;  3ZXS A;  2NVX J;  2R4G A;  2VAS A;  4G9Y A;  2RV8 A;  4IL6 C;  2V7F A;  3FKJ A;  5L3B A;  1OR7 A;  1Z6R A;  2XAF A;  2W7N A;  2DOD A;  2M5W A;  4PSW A;  4Y4R A;  1FNN A;  3PSI A;  1X1A A;  1KA8 A;  5LHI A;  3PNY A;  1M1E B;  3OOP A;  4P55 A;  3CC4 I;  4OIN F;  1BC8 C;  2BW3 A;  3LWF A;  2STW A;  2HQ5 A;  1QZZ A;  1BOA A;  1RC9 A;  4XK4 A;  1Z21 A;  1K78 A;  4ESJ A;  2XAH A;  4LGW A;  3JCU C;  1Z3Y A;  1O7L A;  1ZEL A;  4L9J A;  1W7P A;  1R49 A;  2DA2 A;  4YIR X;  2JTV A;  1SVO A;  4NDL A;  1R4M B;  2CV0 A;  1IN4 A;  1Z3X A;  2WTE A;  3D1N I;  2KMU A;  4PJM A;  2X1D A;  2H94 A;  1OYI A;  2NVU B;  2DT7 B;  1QPM A;  3ML6 A;  3H5N A;  4ZZL A;  4GYI A;  4FTH A;  4G6Q A;  4UV8 A;  4DZP A;  4OAY A;  4W1U A;  4KIT B;  5E8I A;  1WPK A;  4G7Z F;  3AG1 H;  2ZJ2 A;  3GCM A;  3O6B B;  2EV0 A;  3CDL A;  2L7M P;  3PQK A;  4XLF A;  1IO2 A;  4IHY A;  3CCU I;  2HPI A;  1RZ4 A;  1ZAR A;  1F9N A;  3TL4 X;  4LB6 B;  5DD4 A;  2ESH A;  1DU6 A;  3KP4 A;  4I0A A;  2K9S A;  1MBJ A;  1WJA A;  2E60 A;  2RNG A;  3NWT A;  2X48 A;  1TTY A;  2BYV E;  3ZQH A;  4GRI A;  4ZZD A;  3HC7 A;  5C3E J;  4J00 A;  2Z5U A;  2HQN A;  1TZL A;  3G71 I;  3I0T A;  3I54 A;  3OL4 A;  1IN5 A;  5FKN A;  2LTP A;  2UV1 A;  3I3L A;  4X0G A;  2P5K A;  1FYL A;  3LSJ A;  4HV6 A;  1IN6 A;  3LQQ A;  4P1W A;  1ZKG A;  5DV5 A;  1GHC A;  1DPR A;  1IV8 A;  1JTY A;  2M8E A;  4LIT A;  3S8P A;  1QRY A;  3ABM H;  3TO9 A;  4IO9 F;  4M3B A;  1MMA A;  5ILS A;  3OYE A;  3GTL J;  4AIJ A;  2K4B A;  4G12 A;  3G6E I;  5K5R A;  1WZ2 A;  2E19 A;  4FT8 A;  4B8X A;  3MZH A;  4MHG A;  1UHM A;  5JLX A;  2BOL A;  1B8I A;  3QOD A;  2UZK A;  2HFH A;  2VLA A;  4DJA A;  1E3H A;  2JMW A;  1HQC A;  3OYI A;  2P8T A;  3DPU A;  3KLO A;  3OYM A;  2R5Z B;  2L0K A;  4IKF A;  2OQR A;  1JE8 A;  4A3C J;  3MZY A;  4GYG A;  4XL9 A;  3TBI A;  3M4O J;  3ZMS A;  2R7X A;  5K5O A;  4RLQ A;  3I56 I;  3VSK A;  2VJJ A;  3VYT B;  3HHH A;  2GXG A;  3E5X A;  1MIJ A;  2R5Y B;  2RQP A;  4HOB A;  2QQ8 A;  2VQG A;  1UFM A;  3Q9V A;  4AVZ A;  5FRM A;  2MW8 A;  3FMS A;  3GME A;  3DKW A;  3ZOB A;  1Y0U A;  2M0M A;  2I5U A;  3CO6 C;  3OMY A;  1BW6 A;  3DLL F;  4ANJ A;  1ZK8 A;  3KP7 A;  3S14 J;  1GLN A;  1OLT A;  1BW5 A;  1FLI A;  2X6Y A;  4ZDO A;  1KYZ A;  3A03 A;  1BI3 A;  1HXD A;  5F27 A;  2ISZ A;  2A05 A;  1HDP A;  2E7W A;  4A69 C;  2OV7 A;  5F04 A;  4G7H F;  3J7Z I;  1K6Y A;  4EJW A;  2A6T A;  4LIV A;  2NNY A;  3PJR A;  2OAZ A;  3EET A;  4KYW A;  2IS1 A;  2ECC A;  1SD5 A;  1D0Z A;  3LSM A;  2Y0S A;  3V4G A;  5KNL A;  2IXS A;  1O3R A;  2MAB A;  2DXI A;  3R60 A;  4MQV A;  3GX4 X;  1SEU A;  3VEP A;  1J9I A;  1BOB A;  4GO1 A;  3TKY A;  4A6D A;  1FYM A;  2HYF A;  2ZME C;  3LAP A;  2L3D A;  4YRV A;  3C1D A;  1IDZ A;  3F22 A;  4N9H A;  3E6D A;  2BHY A;  3WGG A;  3ASO H;  2PBI A;  2IA1 A;  2VKH A;  2VB6 A;  2O03 A;  3JSO A;  4GFB A;  2K3F A;  1UST A;  3L1P A;  4A3D J;  4G8X A;  5TIS C;  2MC4 A;  2AQF A;  1WI9 A;  1OCP A;  3M3Y J;  2VBW A;  3KYD B;  4AIK A;  2A6E F;  2BW3 B;  4DBQ A;  1MNE A;  4XRF A;  2WWY A;  5CQE A;  2NVQ J;  3F8B A;  5E18 F;  1ZRD A;  5F1R A;  1W7P B;  4RA2 A;  4CHU A;  4ZTJ A;  5C4X J;  5J1R A;  1X3U A;  2OTL I;  3CUQ B;  2KJB A;  2XGD A;  4LOC A;  2VUM J;  4B1R A;  1W36 C;  3DXJ F;  2CFX A;  1B6A A;  1MJB A;  2DBB A;  2ME0 A;  4I76 A;  3BR3 A;  2KIF A;  3VPR A;  3M9A A;  1P4X A;  5BPD A;  4HF1 A;  1WJB A;  2IS6 A;  5CQG A;  1R7J A;  1ZG1 A;  2VOO A;  2ELH A;  4XSX F;  3M7G A;  3V7R A;  4OOI A;  1ZAO A;  1X3Z B;  2K4J A;  5M5Y J;  3NRV A;  3QOP A;  3TQN A;  3V42 A;  1E3O C;  3KP5 A;  2IRF G;  2F5D A;  1UJ8 A;  1OFC X;  3HM5 A;  2E36 A;  1VQP I;  2A5Y B;  1A35 A;  4V19 K;  1FTZ A;  2BZT A;  2L7F P;  4UVA A;  4A6E A;  1X2M A;  3VYR B;  1W5C C;  2HVR A;  1N25 A;  4XMY A;  1B9N A;  2OJE D;  3QYB A;  1ZR4 A;  4UUV A;  3MWM A;  2H1L A;  3OWT A;  1A5J A;  3R61 A;  3VFZ A;  3IKT A;  5HS8 A;  3GTJ J;  2GM4 A;  5DM7 F;  2LKP A;  3EDP A;  5HOO A;  1GT0 C;  4XON A;  3SHF A;  1XTA A;  2FF4 A;  1RNL A;  2UXX A;  1P9Q C;  5TGT A;  1PP8 F;  1ZRE A;  1H9T A;  1SFO J;  2OZ6 A;  2DLL A;  4JX6 A;  3SZG A;  1ZHF A;  2IA2 A;  5H2F C;  3LSG A;  1ZLJ A;  4O6J A;  1U5T A;  3K1M A;  2QCO A;  3DWL E;  2NVT J;  1S7O A;  3AFH A;  3GTM J;  1AWC A;  4IF4 A;  1I50 J;  3G73 A;  4S04 A;  2JSP A;  5M3F J;  2VC1 A;  5D4R A;  3KZY A;  5J1Y A;  2VJI A;  1LDD A;  2VBY A;  3OS0 A;  3ZMV A;  5JVT A;  4HLY A;  3SZP A;  1N75 A;  2CUE A;  1O57 A;  1VQ6 I;  1K61 A;  1A6I A;  3J80 K;  4C2U A;  1Y8R B;  4D1Q A;  1I39 A;  4IRG A;  3GFJ A;  3V8K A;  2EFO A;  4WK8 F;  2DMP A;  2V79 A;  3JTG A;  2HDC A;  4DNC A;  4EJO A;  2PJR B;  3WTS C;  5EGO A;  5F64 A;  5E17 F;  2XKP A;  5F0C A;  1IUY A;  4RAZ A;  2KIS A;  1PUF B;  3GFL A;  3ZQC A;  2XV4 S;  5GAD J;  5HDG A;  3QYF A;  1I5Z A;  2HOA A;  3BG6 A;  2M9H A;  3KZZ A;  2HU9 A;  4B3A A;  1BR2 A;  5A2Q K;  4QPO A;  3EUK L;  4KIS A;  3HZJ A;  1FYK A;  2WB1 N;  1W0T A;  3QU6 A;  2Q0O A;  5LFA A;  1E3P A;  4CCM A;  2EZI A;  3QP6 A;  5LGU A;  3VSL A;  3Q0U A;  3BTC A;  1D8K A;  3MMY B;  4NB5 A;  4HX4 A;  1YS6 A;  2DN0 A;  4HBL A;  4LD5 A;  5IOY A;  3HSE A;  4FE4 A;  2ZJQ F;  2V6C A;  4FX4 A;  3OL3 A;  1Z6T A;  1WVR A;  3GLX A;  4ZH4 F;  2ZBK A;  5ED4 A;  1L3L A;  2GBY A;  4KT5 C;  2FA5 A;  4D5C A;  1MNM C;  2HI3 A;  3WTZ A;  2HOE A;  1V5E A;  4N4O B;  1LDK B;  3F6V A;  3TP3 A;  5KAF C;  1D5Y A;  4BE1 A;  1TP4 A;  4M3D A;  2JSC A;  3JRD A;  3LA3 A;  1W4M A;  3DCF A;  3EUH C;  2Z33 A;  1APL C;  4RAG A;  2YUS A;  3L09 A;  2B7E A;  5KHD A;  5J4V A;  3BG3 A;  1I3Q J;  1G3W A;  4MFE A;  4MGR A;  5IP6 A;  4WCG A;  2KQR A;  3EPZ A;  2WY7 Q;  1I6X A;  5HNH A;  3IRR A;  1F36 A;  4BE0 A;  4CYD A;  2H1K A;  2WAE A;  4B3X A;  3GZ5 A;  3P9C A;  5EG0 B;  1V5G A;  2MC3 A;  3HGG A;  4XN0 A;  4BAC A;  1ACI A;  4CXF A;  5BNG A;  1OR7 C;  3C18 A;  2E5Z A;  4EAT A;  3G1L A;  3BCA A;  3BG5 A;  2IGN A;  2OUM A;  4EJT A;  4R79 A;  1E0E A;  3C3W A;  5E3L A;  4S0H B;  3BZ6 A;  4IPA A;  2I8D A;  4EM1 A;  3VOD A;  3H36 A;  1HDD C;  1TLH B;  4ASN A;  5J1U A;  1BI2 A;  1MMN A;  1P2F A;  2KHM A;  3DFG A;  3CZ6 A;  1J09 A;  3I5U A;  4R1H A;  1H89 C;  3CCS I;  1JKR C;  2VPL A;  1QHH D;  4BE2 A;  2JJ7 A;  3FX3 A;  2L02 A;  2VON A;  2P5L C;  1YRN B;  4U87 A;  4LJZ F;  2ETH A;  3OYN A;  2DA6 A;  2VQH A;  4A12 A;  3CCR I;  1V4R A;  2L2O A;  2YSR A;  2LYC A;  2H6C A;  2UXN A;  4HLX A;  1FOX A;  2MSY A;  2LDU A;  4BY7 J;  3K4M A;  3RTR A;  4A3F J;  2ME6 A;  1DGW Y;  4F52 A;  3PQJ A;  3Q3S A;  1T8I A;  1YQA A;  2D2W A;  3E1S A;  1K6O A;  4ZYH A;  1VND A;  2NYX A;  2V1N A;  4JQF A;  5AIP A;  3BR1 A;  1MKM A;  2DTZ A;  1V3F A;  1VI0 A;  1AOY A;  1R23 A;  4GXO A;  3ECH A;  1V54 H;  1FPQ A;  1U5T B;  2ECB A;  1VQ4 I;  1F5T A;  3I4N J;  2HGC A;  2PJP A;  2V26 A;  2VBZ A;  3WGH A;  2R92 J;  2KLO A;  3BTI A;  4M9Z A;  4YII A;  2NXN B;  2Z1D A;  1D3Y A;  3BR6 A;  1WCM J;  4AU7 A;  2V6E A;  5AIQ A;  4ESB A;  2IT0 A;  2FQ3 A;  2GAU A;  2L01 A;  3SFZ A;  1X2N A;  2LP0 A;  1LFU P;  4JOM A;  3TDU C;  2YR2 A;  3JRG A;  2GQQ A;  2JPB A;  3J81 Z;  4KIG A;  4AYB A;  4A3M J;  1DGR M;  2OC6 A;  2PMZ N;  2EQR A;  1WQ2 A;  3SZT A;  3LSH A;  2O3F A;  2ZJP F;  2ZCW A;  3ASN H;  4TV7 A;  2EA2 A;  3M8E A;  5ERI A;  3VDX A;  3DBL B;  3OS2 A;  3ABT A;  2PG4 A;  2XGC A;  3HOZ J;  3MFK A;  1MH3 A;  2Q2E B;  4Y13 A;  1ETK A;  1KU3 A;  1RKW A;  3DQV C;  3COA C;  4ITV A;  1Z9C A;  1MZB A;  3FM3 A;  2X51 A;  4RDU A;  4FX0 A;  1IRG A;  1FEX A;  3WHC A;  3H9Q A;  2JA2 A;  5D8L B;  5J8F A;  2EBI A;  1LE8 B;  2XRN A;  3A0B C;  3E3V A;  2ISY A;  3KYL A;  1MW7 A;  3WE2 A;  3K0L A;  3W2W A;  2GA2 A;  2XB0 X;  4CYC A;  1U9O A;  1ODD A;  3H5R A;  4PJJ A;  3LSP A;  2WA0 A;  5IYC J;  3HL2 A;  5LLQ A;  4BYY A;  1LUJ B;  3IV5 A;  3N97 A;  1A6Q A;  3J7A Y;  4OMY A;  2XSJ C;  3BPX A;  4IOA F;  4ON0 A;  1YX3 A;  3TW6 A;  3AKZ A;  2B0L A;  4ENM A;  4RGR A;  4BUP A;  2CU7 A;  4C3I J;  2VE8 A;  2DMT A;  3HOW J;  3S93 A;  1WJ5 A;  2LKS A;  3EYI A;  1HW1 A;  3ZN0 A;  2ZXW H;  4DYQ A;  4F93 B;  4M6Y A;  2LBF B;  2XPU A;  3C2B A;  1LFP A;  2DOF A;  3PFI A;  4BAY A;  1YS7 A;  2JZY A;  4I01 A;  4XKV A;  1K4T A;  1VQK I;  2KZV A;  2V4J C;  4PFO A;  2A3S A;  1YW9 A;  1JXS A;  4MEX F;  2O6G E;  1WJE A;  3TO7 A;  4ESF A;  3TP0 A;  2D45 A;  1PUE E;  2M7B A;  2G7U A;  4YIF A;  4JYK A;  5D5W B;  2XAG A;  2BXY A;  3GZ6 A;  4XM3 A;  3WHB A;  3OYK A;  4XN3 A;  3OIO A;  5ILV A;  2QLZ A;  4I0B A;  3BTJ A;  2R5Z A;  2LVS A;  3IAM 2;  4S05 A;  3E5U A;  2ZNZ A;  1J75 A;  4XNF A;  2DJN A;  2V1U A;  3BRO A;  2YU3 A;  3P9I A;  4AUX A;  5FB2 A;  3FZV A;  2RGV A;  1IZ1 A;  3PIP F;  2V1X A;  4BEH A;  1PDN C;  1TWH J;  3RQI A;  2L9R A;  1YIO A;  1D0X A;  2ZO4 A;  4RAF A;  4U0V A;  5J47 A;  1XPX A;  5GAH J;  1YO5 C;  4C30 A;  3LNQ A;  5IOZ A;  1SAN A;  3KCC A;  4PJ0 C;  3S32 A;  1XSV A;  3TOB A;  2NS0 A;  1Y6I A;  1HC8 A;  2XIG A;  1Y1W J;  4A5M A;  1MSE C;  3ERE D;  2FSW A;  1XMX A;  3H35 A;  2VKD A;  1ZG3 A;  1E17 A;  3WU1 B;  2CQK A;  1HCR A;  2M3A A;  5EZG A;  3VYS B;  4ZYG A;  2XAQ A;  3KEY A;  3BZC A;  1T56 A;  3BCB A;  4N0B A;  2XF6 A;  3DU5 A;  2X1E A;  4BY1 J;  2MD5 A;  1EJ9 A;  2HYJ A;  2X0L A;  4B47 A;  4CIC A;  4M71 A;  3HKZ A;  5GAE J;  1K79 A;  2L4M A;  3K1P A;  4Y3O A;  2RVC A;  4CCJ A;  5HLT A;  3L2Q A;  1YHQ I;  5EEH A;  4RM3 A;  1TC3 C;  1P7I A;  1F1Z A;  3DPT A;  3FXO A;  2OBP A;  3BR5 A;  3T1B A;  1A04 A;  1NHA A;  3REO A;  3J80 Z;  3ZMT A;  2JA8 J;  5D4S A;  2L5Q A;  2EIJ H;  2Y2Z A;  4L5I A;  4BQO A;  3JRB A;  3QPH A;  1T33 A;  5HNF A;  3BZK A;  2DCE A;  3JTH A;  2K27 A;  1ZR2 A;  2KT0 A;  3S3O A;  1G3S A;  5EF6 A;  1S3J A;  3CJT B;  1JT6 A;  2JQ7 A;  2CUJ A;  2KJC A;  4U88 A;  5F6F A;  2GXA A;  2F5E A;  2NS7 A;  4BBR J;  3OYF A;  3FHN A;  5DCF A;  2VOP A;  3GBG A;  1T08 B;  4YFK F;  4UV9 A;  4L9T A;  4H0E A;  1ZN2 A;  2W57 A;  3M1C A;  4IHV A;  1JUP A;  4HZF A;  5A2Q Z;  3B6C A;  2IJL A;  2DFH A;  3E5Q A;  1YOV B;  3QRF F;  2A68 F;  3E6B A;  3JAM K;  1KQ8 A;  4HQE A;  1BR1 A;  1MND A;  2M8G X;  3FBI B;  3SDG A;  3CUQ A;  2R93 J;  3W3C A;  5K7H A;  1MDM A;  4II3 A;  1VQ8 I;  2Y0S N;  3BC8 A;  5IP7 J;  2L9N A;  2QF7 A;  1ZGA A;  3FDY A;  4X6A J;  1PVE A;  3CCE I;  2QSH X;  4LLN A;  2F5V A;  2K9M A;  2CQ7 A;  2CQQ A;  3LSI A;  5DD8 A;  4WX9 A;  4NHJ A;  2J5O A;  4PGG A;  1WGX A;  3HSR A;  3P5J A;  5DCM B;  2LLK A;  1VQ7 I;  3NEU A;  2L54 A;  2GXB A;  1S6L A;  1X4P A;  2HTS A;  4KIC A;  3CP8 A;  1XX5 A;  2BHZ A;  4CYC B;  1QNT A;  2FBK A;  5FD5 A;  1AKH A;  2W84 A;  3JSP A;  4HF0 A;  5DYM A;  3OYC A;  2CS3 A;  1J7K A;  1R6R A;  5DDG A;  3Q9S A;  2W24 A;  1B72 B;  1XB4 A;  2X9D A;  3MCZ A;  2LG4 A;  1JGS A;  4GCV A;  1IXR C;  1FMW A;  5LHH A;  2X1C A;  3BQZ A;  3CCJ I;  3MAJ A;  2EJR A;  2VQC A;  4HAM A;  3ZQI A;  1R5H A;  4RM2 A;  1DPU A;  3JW4 A;  2DAO A;  3U9G A;  4KIF A;  2EIM H;  2RC4 A;  3FWE A;  2HNH A;  4M3G A;  1BI0 A;  1JKQ C;  3LSR A;  2M1B A;  4XLP F;  4XIC A;  2HYG D;  3GTO J;  3OYB A;  2GIV A;  3IL2 A;  1Z77 A;  3PM1 A;  4PJN A;  1FOK A;  4Q4Z F;  5HS7 A;  1AA7 A;  2CW8 A;  2QYO A;  4A0X A;  2R7Q A;  1IJW C;  1DP7 P;  1TNT A;  2F4M B;  2DA1 A;  1Z05 A;  2BVM A;  4M6V A;  4HG2 A;  1IG7 A;  2D5V A;  4IRH A;  2VOD A;  1UHS A;  2IP2 A;  3HIF A;  3WTU C;  2LC2 A;  4BH9 A;  5D5U B;  2XUB A;  1R1U A;  4Y33 A;  4HDV A;  1ZLK A;  3BT9 A;  1YG2 A;  3L7W A;  4KIB A;  3BG9 A;  4BXX J; 
#chains in the Genus database with same CATH homology
 2LKS A;  2B7E A;  2DOD A;  2JUC A;  2KFD A;  2DOF A;  2KIQ A;  1UZC A;  2DOE A;  2KIS A;  2E71 A;  2L9V A;  2CQN A;  2K85 A;  4FQG A;  2KZG A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...