2KIQA

Solution structure of the ff domain 2 of human transcription elongation factor ca150
Total Genus 12
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
12
sequence length
57
structure length
57
Chain Sequence
IMQAKEDFKKMMEEAKFNPRATFSEFAAKHAKDSRFKAIEKMKDREALFNEFVAAAR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transcription regulator
molecule keywords Transcription elongation regulator 1
publication title High-resolution protein structure determination starting with a global fold calculated from exact solutions to the RDC equations.
pubmed doi rcsb
source organism Homo sapiens
total genus 12
structure length 57
sequence length 57
ec nomenclature
pdb deposition date 2009-05-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01846 FF FF domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.440 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A FF domain 2kiqA00
2L9VA 2KIQA 4FQGA 1UZCA 2KFDA 2B7EA 2JUCA 2K85A 2LKSA 2KISA 2CQNA 2E71A 2DOFA 2DODA 2DOEA 2KZGA
chains in the Genus database with same CATH superfamily
2L0KA 1T38A 1TWGJ 3EETA 4Q48A 4HLXA 1YIJI 2X1EA 2XPWA 1U3EM 3WU2C 1TWAJ 1U0JA 5D4RA 3J80K 1VQNI 4FE7A 3C18A 2DQLA 1H0MA 3ESWB 4YFXF 2LRDA 3RKWA 3RSNA 2AQFA 4KUMA 2ZNYA 1MH4A 2HGCA 3DFGA 5EG0A 1SEUA 5CQGA 2CRGA 5L3FA 4MHGA 2BYVE 4BBRJ 2HZDA 1HW2A 3RQ4A 1IRXA 4UV9A 3V8LA 3WODF 2V7FA 4IXAA 1LNWA 2ZFUA 4IHTA 2V1NA 2Z2SB 4HNUA 2X6OA 3IH4A 5CVUA 3ULQB 4YFNF 2P7VB 4E70A 1A6QA 2HR3A 2PFBA 4AC0A 3NWSA 4WCGA 1DGRM 3I71A 5BQTA 2K02A 2VQLA 2K40A 5K7ZA 2IA1A 1ULYA 2DA4A 2NNNA 5TGTA 2ZJ2A 2PMZA 1D5YA 4LD5A 3JAMK 5KNLA 3ERMA 2ME6A 3CF2A 1F36A 1STZA 3ABTA 2L54A 1A5JA 1Y8RB 5AONA 2DT5A 3TW7A 3L2QA 1IRZA 3IH2A 4LG0A 5HNFA 2NVXJ 1A36A 1VQPI 3KP4A 3ZMVA 5AIPA 2R5YB 5CVJA 1WVRA 4EM0B 3WTXC 3PO2J 4X6AJ 2M8EA 3LMMA 3K0LA 2R7ZJ 4N9HA 1YJ9I 2Y75A 3V42A 1XX5A 3ZMSA 3CMMA 3JCUC 1J0RA 4B43A 2OF7A 4QSHA 1MNEA 2K86A 3HGYA 4UUVA 5FKMA 3RPQA 2G7UA 2EFWA 5ICEA 2KIUA 2W57A 4EMSA 3A2KA 5GPAA 2H1KA 3ZGKA 2Z99A 5F0FA 3VFZA 2F5CA 2WC2A 1XDUA 3BCBA 1Y56A 1ENHA 2LKSA 1HCRA 4XLFA 4A69C 4XRSA 1FMWA 1I6XA 3RI4A 2FNPA 3AAFA 2YUSA 2VKHA 2QQ9A 3DPUA 2E2JJ 2JN6A 2QBYA 1SC7A 3QRFF 2CUFA 3HRUA 2W24A 4CUGA 3ABUA 4M3BA 3CJNA 4NC8A 3CCEI 1WJDA 4BEHB 1JGSA 4RGSA 1HLVA 1H88C 2F5VA 1KYZA 2DMQA 3PNVA 4XLCA 3E6DA 2MABA 2DA1A 3MN2A 2G9WA 1TNTA 3FK6A 4CYCB 4NBQA 4HW0A 2IVMA 1T98A 1MGTA 2QF7A 3H3VK 3K4LA 4M3GA 1XPXA 2VODA 3S32A 1FIPA 2NYXA 2XAFA 5E1WA 1UCRA 4G7ZF 2CW7A 4EJTA 2VC1A 2A05A 4Y52J 1ITYA 2CU7A 3E6MA 4TV7A 2VUMJ 3GX4X 4IZZA 3OL3A 4LLLA 4BU2A 2OCEA 1IN6A 3IWFA 3BT9A 3OOUA 2JZYA 3DLAA 1IUFA 4XKWA 3IRQA 3TQNA 3OIOA 1YTYA 1XN7A 2EV6A 3FF5A 6PAXA 5EEHA 4BY1J 1ZELA 2EILH 1USTA 3VPRA 2D45A 3C7JA 3GZ5A 4UHTA 1H9GA 2J5OA 4HV5A 4I0BA 3G6EI 3DU5A 3J81Z 4RAYA 1U78A 2KDZA 3KYCB 2IGNA 2E2IJ 3HDDA 2HTJA 1BOAA 2COMA 4N4OB 2BY3A 4RDUA 3OYJA 5D5VB 2Q0OA 3GFJA 2DOFA 4IL6C 2R4GA 3U1DA 5H2FC 3RKXA 5M5XJ 2YU9J 4IHYA 4B09A 1DU0A 5GPCA 4HA8A 1SVOA 2VN2A 2G0EA 2OZUA 2PMZN 2A5WA 4BHCA 4ZTJA 3CUQA 4C3IJ 3H9GA 4ZDPA 3PSFA 3CP8A 4X1EA 3MD2A 3PQKA 4FASD 3IL2A 4II3A 3L2VA 3DPLC 3GZ6A 2MGQA 3HPGA 4RB0A 1G3SA 4LIUA 4BACA 5GTHC 2VBXA 2KJBA 1G2HA 4M9XA 3E5UA 2HYFA 4L5IA 1ZG3A 4YELA 2BHZA 2ESHA 1S7AA 1BBYA 1D0XA 5FD5A 1A31A 1BL0A 2GXAA 1RR7A 2X48A 3PNTA 3MVPA 4G6TB 1R71A 2QWWA 1HXDA 2JTVA 4E7SA 1OCTC 2DMUA 1BOBA 3TW6A 4D1QA 5EGOA 5D8KB 2EA4A 4B4CA 1HW1A 3G4SI 4KDPA 4I99C 4CHUA 1M1EB 1U2WA 3DU6A 4IJAA 4RGXA 4W1UA 2VE8A 2Z5UA 2JVGA 3FXRA 4F91B 2CFXA 5K5QA 2ISYA 3D5RC 1APLC 3KYLA 3P7NA 1IRGA 3BC8A 1E0EA 3S1RJ 2GOXB 2OCCH 2A6TA 2Y2ZA 3VYSB 1K7AA 5L3EA 3WGIA 3CCMI 2A6EF 2Z3YA 3AG3H 5B3SH 3IUOA 3L09A 3V7RA 3HOYJ 4M9SA 2H94A 4AIJA 5BOXA 1BA5A 3HSEA 3IC7A 2DFHA 3FXLA 4RB1A 2H6BA 3S15J 4C2MJ 2R7QA 1FZPB 1MJAA 3GTQJ 3J7ZI 1POGA 1BJAA 2R5ZA 5KVRA 3WTZA 1ZQ3P 4FX0A 3VODA 4IKFA 2FRHA 5IT9K 3KLOA 4HLYA 3CCUI 4JOMA 2PI0A 2FE3A 3KPHA 5J8FA 2VJJA 1DUXC 4NHJA 2M34A 4PFPA 1L3LA 1WZ2A 3LAJA 2AQEA 4FE4A 4V2GA 1FOYA 4RM3A 4I2OA 3K1PA 1ZHFA 2HI3A 3A02A 3S1MJ 2EBIA 4HQMA 1O3QA 2HOSA 3RTRA 2O03A 3TMOA 4ENKA 1W5SA 1AHDP 2X1CA 1W36C 4Y7NJ 4A0ZA 2ZSHB 4KMUX 2IP2A 2EIKH 2R7UA 5HS9A 5D8LB 3PFIA 3HOTA 1A04A 1OQYA 2M7BA 4IRIA 4ESJA 1MDMA 5GAEJ 1LDKB 4LLGF 4PFOA 3OYAA 2GA1A 2VBYA 2UV1A 2LBFA 1D1CA 2ZJPF 2DLLA 3H9JA 4OAZA 2XIGA 4B48A 5DD4A 3M8FA 3SJMA 5HODA 5J8CA 2OQRA 4C3JJ 2P0WA 5CKTA 2VONA 5E18F 1HSJA 2NOGA 4BY7J 3ZQGA 3CCRI 2RNJA 4RLQA 3WG9A 2K27A 3HOUJ 3I54A 5TISC 3Q5FA 1ZLKA 3FXJA 1B6AA 5F6FA 3TBIA 1FJLA 1BM9A 3QOPA 5B1BH 1PP7U 3FK7A 3VWBA 1R7JA 4LG3A 2BY0A 1JKQC 5LFAA 2K9MA 1R5GA 1WJEA 1D1AA 1JHHA 2ZXJA 2Z9OA 4P96A 2A61A 4EM2A 4NDLA 2R7DA 3FMSA 1MW7A 2V26A 3T8TA 3LSMA 2GA2A 2HTSA 1D0YA 3X2QH 1JKRC 2CSOA 1SVMA 2M30A 1K4SA 4RAFA 2P5VA 5IYDJ 3CJTB 1JUPA 3L2CA 1OJLA 1OFCX 4PGGA 5FRNA 1EA3A 1Y8QB 4XKVA 1ZYRF 1AU7A 3Q0UA 1YRNB 3CCLI 1PVEA 3Q0VA 3HGGA 1PP8F 2JUGA 3ONQA 2MC4A 1XGMA 1U6GA 3KP6A 3CMYA 1FPQA 2CMPA 3L00A 1K83J 3KYDB 3KLNA 2E1CA 1U5TA 2R7FA 3FHZA 2WTEA 4DZPA 1FWZA 4YRVA 4RAGA 1ON1A 3IWZA 2K9NA 2DFEA 3OYKA 3N4MA 2HOAA 2FSWA 1LDJA 3O8HA 2CV2A 1V55H 3JRIA 3EQLF 2O0YA 3CZ6A 4MEYF 3PUFA 1TC3C 1ZLJA 1XGSA 3D1NI 3HPHA 5DV5A 3HEFA 3CCYA 1USSA 2ID6A 3JW4A 1BI2A 2KZGA 2QUFA 2TDXA 2NVQJ 2ADUA 4CO8A 4A3EJ 1JGGA 2GZWA 3BR6A 2EFPA 1FY7A 4U0VA 1Y1WJ 1IXCA 3MZ8A 4HDUA 3I5UA 4XN3A 3C2HA 3OMYA 3I4PA 3JSPA 2HS5A 2MBFA 5EF6A 4KYWA 2KFDA 1NK2P 2E71A 3BR0A 1B4AA 1ZRDA 4F92B 1MBEA 1WSUA 4Y3OA 2LMDA 2DTRA 2RAEA 2UUZA 4CDGA 3GVAA 5LRSA 2NNYA 1B72A 4L9JA 4ASNA 3JSOA 1S7EA 5JLXA 4PJLA 2ZMEC 5F0HA 2XKPA 5M3FJ 1D0ZA 1RKTA 4LK1F 2YR2A 2ZCWA 3V8JA 3HOWJ 4MLOA 1O3RA 2H1LA 3AFHA 5B5EC 5F64A 1R1TA 2E5NA 1VQMI 4A3IJ 3K1MA 4XORA 5CQEA 5KAFC 2MD5A 1QO0D 3HOXJ 5FLVA 4D7NA 1FP2A 2ZJRF 3K9TA 1SD4A 1GV5A 2ECCA 1KU2A 3QYBA 1AKHA 2HWVA 2LY2A 2VXZA 4LGWA 5JHFA 1MH3A 1KU9A 2NVTJ 3F3XA 1F1ZA 1GVJA 3VSLA 4MTDA 3HSFA 4B3AA 1QNTA 4FT8A 4YG2F 1XDSA 2VASA 5KAIC 4BE0A 3OIPA 3AG1H 5CVVA 2VOOA 2VE9A 1MKMA 1UZCA 3LSRA 3QPTA 3S8PA 1GVDA 4EATA 1QGPA 3M1CA 3MZHA 3FKJA 3AG4H 4HZFA 3G3ZA 4BUPA 1IXSB 1HW5A 1W5TA 3W2AA 2LFBA 5E3MA 1FIAA 3PO3J 1IV8A 2QVOA 3E7LA 3FDYA 5LHHA 1LE8B 5H20A 3T1BA 3VYTB 4CZZA 2P6SA 3LOCA 3VB2A 3LSIA 2DO7A 2CQKA 2HXOA 4PJ0C 4XLEA 5JVTA 3GW2A 5A2QK 3QWLA 2ZXIA 1QVTA 1FMVA 3F9KA 1HDPA 3S17J 2DMNA 3L7WA 1KU3A 1ETOA 3M1EA 4WX9A 1Q1HA 1OYIA 2DODA 2L9VA 2RV8A 4DYRA 1FNNA 1PUEE 2OC6A 1JI8A 3G2BA 3TO6A 2VC0A 3I9V2 4RLFA 4E6KG 2QSGX 4RM2A 3DP7A 2L3DA 1R22A 1BI0A 1YG2A 1JUSA 2WA0A 3IAS2 4BDYA 4XBFA 3OYFA 4ZTFA 2FBHA 2AO9A 2IEKA 2L5QA 4N9IA 2IBDA 1GXQA 3GTLJ 3I59A 4FCYA 1O3SA 1ZR4A 2HEOA 4BJ5C 2NVYJ 4WXDA 4XKCA 1X1BA 1IV6A 3G73A 3HOZJ 1UMQA 3CMEI 4C9YA 2KHMA 2Z16A 4QPQA 4EM1A 3TP0A 4Y15A 2RREA 3R0AA 2W25A 4R1HA 1ETQA 3EUAA 2NXNB 4M6VA 5BPIA 4RA2A 4CH7A 3QP6A 4CICA 1C0WA 1DPRA 2M1BA 2ECBA 2K3FA 5H6RA 2QZ8A 2XASA 5CVIA 1UG2A 1XMAA 1K78A 2BHYA 3BR5A 2FBKA 5LGNA 2BY1A 1EKEA 3HHGA 4CYDA 1LUJB 4NQWA 2M7AA 4AIHA 5CYVA 1IF1A 1U8RA 1S9HA 4LMYA 2V6EA 2A69F 2W48A 4JQFA 3CCJI 1A35A 3WTWC 2DDAA 3FISA 1SD5A 4GRIA 3RCOA 2IGOA 1ZRFA 5E17F 3I64A 3O3KA 5GP9A 4RGRA 2FMLA 4RB2C 1JT0A 3F22A 5HLGA 2DYSH 3OYNA 2HYJA 1YLFA 2Q2EA 4GYGA 2IS1A 2V1DA 2DAOA 2WB1A 3GYHX 1XCBA 4B44A 4RMNA 1MJ9A 1SAUA 3DEEA 2RDPA 1MNMC 3K4JA 1YI2I 1G3TA 2DPDA 3P9KA 3OR1C 3R4KA 1WJAA 1JE8A 2R93J 4ZJZA 3U2RA 2XKOA 4KN7X 1YOVB 1UB9A 3LSHA 1UJ8A 1O3TA 1V3FA 3BP8A 5CJ9A 1KQ8A 3S3MA 3GMEA 1ETWA 1I3AA 4CGZA 5C4XJ 5IT3A 2FNAA 2NAZA 5B66C 5K7FA 1FOWA 4EJOA 2X51A 4UXNA 2M5WA 2QGUA 5L3CA 2OPTA 2D5VA 1UHWA 4G7HF 2Q8KA 2YPRA 3SFIA 3L2RA 3S14J 3HJEA 1SFOJ 5F1RA 2JRTA 2K85A 2DU9A 5DD8A 2BVMA 2QQBA 4GXOA 3A03A 4MEXF 3J7YJ 3SYTA 3DBRB 2DK5A 4AM3A 1WJFA 3H3ZA 3OS1A 1X1DA 3KFWX 2ZMEB 3P9CA 4WF2A 5DM6F 3LQQA 4WWCA 3KEYA 1X1AA 3ASNH 1B8IB 2LY1A 1MSEC 2X0LA 1J2XA 2IPQX 5K7HA 5J4YA 3LFKA 2WAQA 3BZ6A 1R4MB 3K7AJ 4I7HA 4D9JA 2UXXA 1ERDA 4I02A 2NS8A 2GOMA 4ZZLA 4BH9A 3FXMA 3HZJA 1K79A 3CD6I 4I98B 3KE2A 1RR8C 1IZ1A 1IXRC 2NS0A 5GADJ 1I1SA 2HZTA 1ZREA 3WGGA 3VSKA 3TP3A 1LB2A 4WXHA 4IO9F 3F8MA 1Y0UA 1JJ8C 4PDKA 4PSXA 3OV8A 3Q9VA 2D2WA 4E4HA 3S93A 1ZG1A 3ZQ7A 3SZPA 1DQUA 4WXCA 2LG4A 5C3EJ 2K9QA 4ZDOA 1TWFJ 2DMTA 4UUSB 2STTA 3OYBA 3JTHA 4HX7A 3DKWA 2FA5A 3RPUD 2Y0MA 3GTKJ 1I6HJ 4CCOA 1OCCH 4IQ4A 1KA8A 1OYYA 1W7PB 4DJAA 2VJ4A 3A01B 4GFBA 3E5XA 2D1HA 4V19K 1WKMA 3CO7C 1PYVA 4CXFA 2DXIA 4JP0A 3MFKA 5E8IA 4BAYA 1W0UA 2EFQA 3H9QA 3MKLA 4C3HJ 4XICA 2WWYA 3ZN1A 2DTZA 5LEJA 2JK3A 2DI3A 4I01A 3HSRA 3OSGA 3ML6A 2PQ8A 1WI9A 3HBLA 2BOLA 4P5OA 1T0FA 2LR8A 4D0PA 1G59A 4XONA 3L1PA 4E7KA 1ZK8A 3M07A 1YIOA 1HOMA 1BIAA 1OCOH 2BXYA 4HSTA 3F8NA 3GLLA 2HPIA 5TRDA 3F0CA 3F23A 3CESA 3G1MA 1SFEA 3OYCA 3GTGJ 3S2HJ 3H36A 3NAUA 4PZJA 1KU7A 3IV5A 3ELKA 4CCLA 4IOAF 2HVRA 3K10A 4LLNA 3AL0C 4RGUA 3JREA 2W85A 3V4GA 3QAHA 2LD5A 4XN0A 2OD5A 1RESA 3J80Z 1ETYA 4GGGA 4OAYA 4S0HB 2ZMEA 3TOAA 4KA4A 1UHMA 5IYCJ 4ZH4F 1YW8A 1CGPA 2L9NA 5DYMA 2V1XA 4PCQA 4RBOA 2HVQA 3CO6C 2H8RA 3EUKL 1WGXA 2VJ5A 2LF8A 4A3BJ 2EIMH 1TT0A 2R5YA 2ZXHA 5DEQA 3BWGA 1ACIA 4S04A 3C3WA 3WTUC 2K7LA 1F43A 3GUDA 1X58A 2KL4A 1P2FA 1IJWC 4UB6C 5LBQA 1QPIA 4LB5A 5E3LA 2HQRA 2FJ1A 4XOPA 5FRMA 4UNOA 1YW9A 3HRMA 1FX7A 2WAQN 2A07F 2V79A 5HOOA 1JTYA 1FSHA 1D8KA 3EDPA 4HBLA 1MMAA 3OL4A 3ZN0A 1FT9A 2B0LA 2W7NA 1JKPC 5LHGA 5ILUA 3JRCA 4K2EA 4ESBA 3JAMZ 1R6RA 1Z7LA 1FLIA 1ZGWA 1ONVA 2HQNA 3BTJA 5L3DA 1RKWA 1O4XA 2E60A 1MMNA 1I50J 5DCMB 4BGDA 2O7OA 2N8GA 3O2PE 1QZZA 5CLSA 2DT7B 3OYGA 1XS9A 2Q1ZB 5JFRA 1V5FA 4MIMA 3FM3A 3L2UA 3DWLE 3QP5A 2X6XA 2OUMA 3K4KA 3D5SC 4BEHA 3GO5A 3QPSA 1Z7UA 2MH2A 1G3WA 5KK1A 5DDGA 3KETA 4A93J 2LNBA 1QU3A 3LSKA 2CFOA 4Y4RA 1PDNC 3PL8A 4FETA 2E1OA 4CYCA 1VNDA 3H0DA 1LFBA 2CJJA 2RQPA 2F2EA 1V54H 4XLHA 4A3DJ 4QTRA 4FHTA 2DA2A 1ZN2A 3BPVA 3PQJA 4H0EA 3TDUC 1KYWA 2R7OA 3TGNA 4A3GJ 3S16J 3ZXSA 2JWTA 3KZYA 1XB4A 1Z67A 2DN0A 4A6DA 2A5YB 2R0QC 1H8AC 1J5YA 3PM1A 3FBNB 3S3OA 1P4XA 4BQQA 2MLGA 2OZ6A 2IGMA 3ZCOA 3ZQQA 3CUOA 3WTVC 3IKVA 2HOTA 5EDNA 1HKSA 1ZGJA 2JA5J 3BOQA 2ZO4A 3DBHB 2E7XA 3K4CA 2GM4A 4E7JA 2KRHA 1XGOA 2L9SA 1BI3A 2KPMA 1FP1D 2GAUA 2HNHA 2R7XA 4OMZA 3NARA 5J40A 2F5EA 2KT0A 2CG4A 3HHHA 4U0WA 1J59A 3ZPLA 1G6NA 2XSJC 1J75A 4JX6A 2MYSA 1IN4A 5EEAA 1CQTA 3K6GA 1SMYF 2M2EA 4LOCA 4M9ZA 4ZYHA 1GDTA 1K61A 2L7ZA 2EQRA 1FBSA 2VLAA 1UELB 1LQ1A 1EH6A 1XCVA 1HC8A 1TNSA 1TQPA 1YHQI 1B1BA 2CW8A 1E3PA 3FXKA 1P92A 2E2HJ 3A0BC 1YO5C 1UG0A 2W1OA 1UAAA 3IRRA 4KMFA 5EEGA 3AKZA 1FOKA 4EJUA 4EJVA 4ON0A 4HF1A 4EVIA 3OS2A 2HOEA 5LEKA 1KQ0A 2GBYA 5FJ8J 2HPMA 2ZNZA 1G4DA 1TWHJ 1MMDA 2H27A 2IRFG 3LQRA 4GYIA 2ELHA 4DQ2A 4IQJA 3G71I 2ELJA 1GUUA 2LK2A 5L3GA 2LVSA 1ZTRA 5D6FA 5E3OA 4MTEA 4HF0A 4HF2A 5F0CA 4KIBA 2VKDA 2EFOA 1RZ4A 3GTMJ 4ENJA 1X3ZB 2LSOA 3WTYC 4XSXF 4R79A 2ELKA 2PJRB 4BQAA 2FMYA 4QIWN 5DUKA 2LOOA 3IH3A 2X6WA 3QPLA 3QPHA 1X4OA 1EJ9A 4PK4A 3SDGA 1E17A 1Y1VJ 4G8XA 3AL0B 3WU1B 3CQZJ 2Y9ZA 4PSWA 3F6OA 3V8KA 4MO7A 1R4NB 1QHHD 1S72I 2DA5A 1RIOH 4J19A 1MZBA 4HQEA 3CMAI 2AXTC 1QQIA 3K2AA 4AIKA 3QOEA 1FTTA 4MNUA 2XGDA 4XM3A 5TJJA 4DBQA 2IGKA 2VPRA 4DYCA 4HNVA 5HS7A 1HA8A 3FIWA 2ZBKA 1OCRH 2UXNA 3UKGA 2WAEA 2DCEA 5ERIA 1JHFA 4M6XA 4G7OF 3A0HC 2F5FA 4XR6A 4Y13A 2KQRA 3CP2A 3ZQCA 2CWEA 3RJPA 5AIQA 3FXOA 4V2FA 4L9NA 3BJOA 1R23A 4XSZF 3T8RA 1I5ZA 2B63J 2XRNA 4JBAA 4F3QA 3BCAA 3G1LA 3KZZA 1N75A 2P81A 4IHSA 2VQGA 3CLOA 4YIFA 1IO2A 2PBIA 5J6XA 3QQAA 4F7ZA 2ETHA 2XB0X 3VYUB 1W7PD 4ZYAA 1U8BA 3IHUA 1VFCA 2JPBA 5HNHA 1OCPA 1TW3A 3F8BA 5FD6A 4M73A 2MH9A 2Y69H 1PUFB 4OIRF 2IS6A 1J09A 4Y17A 2GXBA 1Z3XA 5IT9Z 4XQFA 1X3WB 4GCVA 2CUEA 1QA6A 2ZKZA 1SAXA 4AVZA 1IC8A 3VYRB 1F4KA 2ISZA 3S2WA 5GAHJ 1IN8A 4U87A 1ZGAA 1LPQA 2R92J 2CV1A 2JT1A 3RYRA 1WQ2A 4BQOA 1ZRCA 2M8GX 3KP7A 1XC5A 1Z6RA 2HU9A 3J7AO 1I39A 2EZIA 3RDIA 1XD7A 3HUGB 4B47A 1W5CC 3RKYA 3OIQA 2DMPA 4L9VA 5ICCA 1ZH5A 3ERED 2XPUA 1LEAA 1MSFC 5J1RA 2XF5A 4EJWA 2BZTA 3CF5F 2B9SA 1LFPA 3E97A 4ITVA 4IX7A 3JRAA 4ETSA 1R1VA 3H1CA 2L7KA 1FYLA 3BLYA 4E7ZA 1OMIA 3FZVA 1OCZH 4AYBA 3OYEA 1T95A 4R8HA 4OINF 1OPCA 5E1ZB 2DK8A 1FEXA 2OU2A 5J47A 3K4NA 4IRHA 4IEJA 4RB3C 2GWRA 1Z91A 4OWRB 3GWZA 3ZQLA 2LYCA 3M4OJ 2DW4A 4BNCA 4U7BA 1RNLA 1KZHA 1IDYA 4ABZA 3DTEA 3K70C 3DF8A 1I27A 2ZFWA 1R36A 1X19A 4AU7A 1YRNA 3FMQA 3QODA 3GLXA 3F6VA 4A2UA 5KCMA 4MQVA 3MQ0A 4EV0A 3K4BA 2OTJI 4BYYA 4BQNA 1V4RA 2WAFA 3CUQC 5DS9A 4E7LA 5LGUA 3RZDJ 2PLYA 5K5OA 4Q47A 3SFZA 2IA0A 4NC7A 3UR3C 5GTIC 2BW3B 4DOZA 1IGNA 3FX3A 4DZJA 1FYKA 3I3LA 2ZC2A 3HOSA 1MBJA 2EV0A 1XSVA 3DEWA 3D0SA 3SEQA 2CH0A 2OBPA 4BJTA 4U0YA 2VJIA 3RPUA 1QHGA 5LLQA 3DBLB 5HLTA 2RNGA 3I4MJ 2OTLI 3NEUA 1FBQA 3LSJA 4LK0F 1TTYA 5LRRA 2IA2A 2V9KA 3VDXA 5IOZA 4OIPF 2XAGA 2FOKA 3TO7A 2E1MB 5EG0B 4F93B 3RQIA 5K1YA 4MQ9F 1XSDA 2EV5A 3DCFA 3PUBA 2JVHA 2QCOA 2DOAA 2ZXWH 2MW8A 3OYLA 2NS7A 2K5CA 4XRFA 2VXDA 2P7CB 4BL0B 2EZHA 2LY9A 2DBBA 4F52A 3JTGA 5EZGA 4ZYEA 2CS3A 2XGXA 4CA0A 1MD0A 2KIQA 1QRYA 1JUMA 2LLKA 2QQ8A 3U9GA 2O61A 5E20A 1LVAA 4XKBA 5LD2C 3JRBA 3QU6A 2XHKA 3DLLF 4ZC3A 5D5UB 3C1DA 1AOYA 5JR3A 3CJQB 2X4HA 5F27A 1HF0A 2OQGA 1YJWI 2ZB9A 2LKPA 4E7IA 4FX4A 2XUBA 1MMGA 1VF9A 1RETA 4OOIA 4P9FA 1I1GA 3KP5A 4HPQA 1TZLA 4LG0B 4L18B 2IW5A 4XOTA 2BGCA 2R7RA 3WHCA 2I8DA 2L4AA 3CC7I 2FBIA 2LC2A 2O9LA 5FO5A 2GLOA 2WY7Q 3LFUA 2VIXA 2XAQA 4AD9A 2X85A 1VQ5I 4MGRA 2IS4A 1MJBA 4Z6YA 4U88A 1D1BA 3BZCA 2QENA 3I55I 1TP4A 1OYWA 5HLHA 3HG9A 2VPLA 3GBGA 3U1KA 5H6QA 2RKHA 1RC9A 4DIQA 4XMYA 1WHUA 2COBA 3JRFA 4LITA 4OIOF 2XGEA 4GO1A 2FF4A 2J5PA 4BXXJ 3LWFA 2YS9A 5F04A 4BHBA 4QPOA 5F1JA 4A3KJ 4IPAA 3SQNA 1S8NA 4HDVA 2QKLB 1N78A 1VQ4I 4XLPF 2M4KA 1BR1A 1XMKA 2QBYB 2JSPA 3TEDA 4ZZDA 2E7WA 2P5KA 1IRFA 4PJMA 1LE8A 3CLQA 2E35A 2L7MP 3MAJA 1D8JA 1YS7A 3H0GJ 1V5EA 3IP4B 2YSRA 1E3HA 2CO5A 2CQXA 4I76A 4A3CJ 1R9TJ 2VQHA 2LKXA 2ZSIB 2XAHA 2HQAA 3SZTA 1CF7A 3J81K 5KHDA 3GFLA 2R7TA 1VQKI 1O7LA 4A3LJ 2P8TA 5CVRA 1B59A 3VOEA 4M74A 2V4JC 2XV4S 4HAMA 2JA8J 2LREA 2Y31A 3BJAA 2P5LC 5FB2A 2KRFA 3DXJF 2ACJA 3P5JA 4XL9A 1YX5A 3HC7A 1GXPA 2LH9A 5C44J 1DDNA 3HYIA 4PJNA 3BG7A 2CQNA 4P55A 2PMHA 5A2QZ 2VOPA 1T39A 2C6YA 4OU0A 2NVUB 4ANJA 3MEXA 5FFXA 2IT0A 3S2DJ 4A5MA 4KN4X 1S6LA 2CUZA 3B6AA 3OWTA 2EJRA 3ZMTA 3Q9SA 1QPMA 1TLHB 1ZKGA 3PIPF 2EB7A 1W0TA 3PSIA 2LF7A 2M0CA 2EK5A 5JLWA 4G94A 3N05A 3U21A 3ZQHA 3M9AA 2E36A 2NOJB 1X2MA 4I09A 5M5YJ 1T56A 4UVAA 1IN7A 3CDLA 3GFMA 3CUQB 1TW2A 4QLCU 3B02A 1U5TC 1IW7F 1V5GA 4CCMA 4CCNA 2EFNA 3GXOA 1HSTA 3LNQA 1U9OA 2Z1DA 5J4VA 1VQLI 2JA2A 4L9TA 3K69A 3ZQIA 1YE9A 2VT2A 3TOBA 3DEUA 3VEPA 3W6VA 2O8XA 3MWMA 2XPVA 4XLAA 1TL8A 3GTOJ 3CC4I 3O6BB 1LEBA 3BJ6A 3OYMA 3PIOF 2XSDC 2G7HA 4HEA2 4YIIA 1QZEA 1GV2A 3MCZA 3GFIA 3HB9A 4RAZA 2CV0A 1J7KA 1FBUA 2JJ7A 2M45A 1SMTA 3WU0A 4CCKA 3BDDA 5EGOB 1YJNI 3DQVC 3P9IA 3H5NA 5EZHA 5DTDA 1TQMA 1Z1DA 2P4WA 2YU3A 1JT6A 4DGWB 3ZOBA 5LGTA 1T6SA 1OR7C 2WB1N 4A0YA 2I10A 2DA6A 1SD6A 4A3JJ 2AXLA 1FC3A 3BTLA 3SZGA 4CCJA 1U9NA 2VBWA 1IDZA 3HXLA 2H8WA 5DM7F 3W3CA 2JA6J 3R60A 2OV7A 1D3YA 3A4CA 3LA3A 4AWXB 2DYRH 1OLTA 5EYRA 4KICA 4RS8A 4BS9A 1HBXG 3RZOJ 2CQ7A 2TRTA 4UB8C 4G12A 4FTHA 3S1QJ 1ETVA 1ZG5A 2XAUA 2EIJH 1EH8A 1WRJA 4NUBA 1K4TA 5EJCA 5FROA 4XK4A 4OMYA 1WI3A 1SFKA 1R5ID 3BZKA 5HDKA 2E5ZA 3HIFA 3BG9A 2R5ZB 1XG1A 3ZR8X 3ZRGA 3L9FA 1MBGA 1WFXA 4NNJA 3ZMZA 3S1NJ 1B8IA 4HYEA 1XGNA 1LVKA 2OJED 4O5VA 1X4PA 4P9UA 4J00A 4OIQF 5F08A 1R58A 2L4MA 2X6YA 4XNFA 3CCQI 3E1SA 4AIDA 2QSFX 4A5NA 1Y39A 3A1YA 1NHAA 4X0GA 2DA3A 1BW6A 4UUTA 1P7JA 1FTZA 4ENMA 3NWTA 3ZP5A 2PEXA 4BBSJ 4DW6A 1DP7P 2EINH 3TKYA 5ICGA 4B8XA 1VQ6I 1W36D 1P4WA 1S29A 2GIZA 2CGPA 4A0XA 3TDZC 3Q3SA 1A6IA 1IAWA 3FXQA 4S05A 3PJRA 2WADA 2ID3A 2L01A 2XAJA 3MZYA 3ABKH 3WE3A 3M7GA 1FSEA 1XTAA 1ETKA 4F55A 5J1YA 3LSPA 3ZMUA 2EWNA 1R49A 2VT3A 2AS5F 1W4MA 1WJCA 2XVCA 5FKOA 5ED4A 2DPUA 4LFUA 1SFXA 3QYFA 1X3UA 3WTTC 4HX8A 4UUSA 1Z6TA 3KEQA 2IS2A 3W2WA 3BR3A 3T5XA 1MDMB 1B9NA 3BR2A 3COAC 1HKTA 4UY8I 2LBFB 1BR4A 1WWXA 2KZVA 3GF2A 3KP2A 3A01A 1W7PA 3H92A 3E3VA 1XSXA 1WPKA 4BE1A 3QU3A 4GDFA 1H9TA 1NG6A 2QM3A 3GCMA 2EZKA 3KX2A 4EGZA 3DPTA 5E3NA 1N77A 5CPRB 3HM5A 2KDOA 1CF7B 1BN5A 3O8GA 3G1OA 1REPC 3BPXA 4ESFA 4D5FA 3C2GA 1BR2A 2IAIA 3F8FA 4M6YA 3J7AY 2KISA 4J01A 2O3FA 4KFCA 4BHPA 3LSTA 1DPUA 1K6YA 3Q0WA 2XF6A 3RKQA 1PJRA 3EUHC 4HRIA 1NK3P 1T2KA 2MD0A 3W6KB 4WK8F 2Y48A 2PMUA 2XF7A 3D5LA 3CDIA 2GIVA 4JX5A 5DUIA 3ZQFA 1YFHA 2O6GE 2XB5A 3E0JB 3MMYB 4XRSG 2K9LA 2KP6A 4YFKF 1SFUA 1EH7A 3HRSA 3CTAA 2V9PA 2O8KA 1KQ9A 1D5VA 1R1UA 1TWCJ 2B7EA 3ROUA 1NTCA 3V7CA 3OYHA 1X2NA 5IP6A 3OYDA 2A68F 3HKZA 1P4AA 4M3DA 4G6QA 2AHQA 2W00A 4AVPA 1DP3A 1TBXA 2Y30A 4DYQA 1BW5A 1YW7A 5ILSA 5E8GA 3OYIA 1WCMJ 4YEJA 2JUCA 2KIFA 1VZ0A 5M3MJ 1VI0A 3CJRB 2P6TA 2O5RA 2R3SA 1MNDA 2M4GA 1U5TB 4IHWA 3FKIJ 5D6EA 2MA3A 2QSHX 2RQQA 2WBMA 2WV1A 2H09A 3F72A 4AUXA 5HS8A 4ENNA 3KZIC 1IN5A 2IJLA 4XRMA 1JKOC 1BC7C 2TCTA 3GTJJ 1HKQA 1P7IA 2QQAA 4E7HA 2PN6A 3NQOA 4XIDA 1G8XA 2KLOA 4KIFA 5D5WB 1Q1VA 1MBFA 1WH5A 3CCSI 5ILVA 2V6CA 3MKZA 3FM5A 2DOEA 3FBIB 4FQGA 4BXFA 3ABLH 1B9MA 2BXZA 2BE5F 3R61A 2IXSA 5BMZA 4G9YA 3IAM2 3OR2C 3LA7A 5BNGA 5FLXK 2HVSA 2Y0SA 1O57A 2E1MC 2VQCA 5DCMA 1BIBA 2W82A 4B1RA 3PNYA 4M3FA 1IG7A 2GXGA 1G3YA 3BROA 3H3UA 5FKNA 4ZDLA 4HNTA 2JPCA 2M9HA 1S7OA 3E6BA 3OY9A 1RUOA 1WJBA 4C2UA 3N97A 2CYYA 3OSFA 4BJ6C 2FXAA 1DU6A 2HQ5A 5IP9J 4UV8A 2R7SA 1X1PA 3RIRA 2KIMA 1N25A 1YITI 5IOYA 2JSCA 2CW0F 3LL7A 2RC4A 1S5LC 2HDCA 3WG7H 1MBKA 2F4IA 2STWA 2UZKA 3RYPA 3I4NJ 1B72B 5IY5H 2XROA 2GQQA 2E1NA 2FD5A 2K9SA 3WTSC 4HG2A 2PG4A 1RUNA 2FUG2 2OAZA 4KISA 3DKXA 2Z33A 1P6RA 4UVCA 1VQ8I 3KEOA 2HKXA 2CUJA 5FKLA 4EQQA 3K70D 3I53A 1F9NA 3R0JA 5C4JJ 1SANA 1NH3A 2JMWA 4LB6B 3SDBA 3JRGA 3H5RA 4HOBA 1AKHB 3EYYA 2DFIA 4M71A 1YX3A 2RGVA 1HQCA 5IPAA 1GLNA 1VQ7I 2YX4A 2L02A 3JRDA 1ON2A 4A3FJ 1ODDA 3DTIA 4IHXA 2DFFA 3M3YJ 2HFHA 2ESNA 3NRVA 4PGHA 5J3LA 2W4SA 4BXUA 4BE2A 1FYMA 4Z2YA 2MC3A 5FFZA 5K5RA 9ANTA 3CCVI 3BR1A 1L0OC 5D5XB 1BI1A 2VI6A 1RI7A 4N4NB 4IOCF 4LIVA 4A12A 3HOVJ 2M0MA 3HKZN 2WV0A 4G6DA 4M72A 5IP7J 1VTNC 3JR9A 4HSRA 2OA4A 2UWMA 3BQYA 4YIRX 1GHCA 2BBYA 4CSWA 2HYGD 3H5AA 2VKEA 4BKXA 3I0TA 3B6CA 4A6EA 1WH7A 2FQ4A 2QKMB 2HXIA 3WE2A 1UFMA 1QVUA 5IYBJ 1J9IA 1MIJA 3OS0A 1ZR2A 2QYOA 3FWEA 1SVLA 3FMRA 2ME0A 1AWCA 3GEZA 2MLKA 1ORKA 3BG6A 2LDUA 4DBRA 2VKVA 3AG2H 4MFEA 2EPFA 3LSGA 1T0FC 2PJPA 3FXUA 1OR7A 1F5TA 2JRMA 3I59B 3W6JB 1TT5B 2KJCA 1ZAOA 3HRTA 3HTUA 5D4SA 1JJ6C 5FKKA 2PJRA 2D1VA 4N0BA 1R5HA 3HTSB 5HLIA 1Z05A 3ECHA 1X1CA 1VQ9I 4FISA 1MMSA 3UNGC 5E79C 4LJZF 4P1WA 2EH3A 2Y0SN 2V9VA 4L5JA 2X1DA 2KKOA 4XLNF 5GAGJ 2KRCA 4I0AA 1HDDC 3EYIA 2F6CA 1P9QC 2FX0A 1T08B 5BS6A 2DDBA 5JVGF 4H4KC 2QLZA 2MSYA 1BJZA 3KP3A 2DA7A 3BG5A 3WHBA 4KT5C 1ZARA 4KT6A 4EGYA 2BY2A 4ZYGA 3DKYA 3K1NA 4KNYA 1K78B 1BC8C 3MKYB 4I6ZA 1UHSA 2F4OB 3BTIA 5FLXZ 1VQOI 3K2ZA 1YS6A 2H6CA 3GZNB 2F4MB 4NC6A 1W1WE 2EA2A 2MFZA 4NQWB 5FLMJ 4O3MA 3DV8A 4L5EA 4M3EA 2RN7A 3DTKA 3OOPA 2HDDA 2VL8A 5E1XA 2JA7J 2HDWA 4W97A 2PX9A 3BY6A 4L0ZB 4QWQA 1KGSA 2FQ3A 4KJZA 1TQIA 2YX7A 3TO9A 2Q2EB 2M3AA 1AA7A 2L9RA 3JRHA 2R7VA 3BQZA 4B3XA 2DT6A 1IUYA 5ICFA 3T0YA 2A6HF 1OISA 2QA4I 3WGHA 2JQ7A 2VB6A 3FHNA 3IKTA 4NB5A 1T33A 4JX4A 1E2XA 1ETXA 1Z77A 1T8IA 3E5QA 5LHIA 1Z3YA 3PFYA 4Q5SF 4IF4A 5JHUA 3SHFA 2W84A 1PUFA 2F48A 3ECOA 3H35A 4II2A 3V7SA 3I56I 2L2OA 4Y33A 1O7FA 5BPDA 2K3PA 3KCCA 4A3MJ 4JYKA 2WY8Q 3REOA 1EV7A 1H89C 1E3OC 1YYVA 1LFUP 2VBZA 2DJNA 2XGCA 3LA2A 3ABMH 4IRGA 5HDNA 4UVBA 3BTCA 3B73A 1QBJA 3E6CC 4ZYDA 2A3SA 4U7DA 4HX4A 4IHVA 3M8JA 1LJ9A 2FOWA 2Y9YA 1GT0C 4PUSA 5DCFA 1EF4A 2LTPA 4MFDA 5HDGA 1I3QJ 4HV6A 3HUGA 4EEFG 4KIGA 1WJ5A 2I5UA 1YQAA 3GTPJ 4Q4ZF 4IVNA 1Z21A 3F21A 1Y0NA 4O6JA 1KONA 2EZLA 1FOXA 2XRLA 3S3NA 2X9DA 1JTXA 3ZMDA 3EUHA 2KMUA 4JK1X 3I58A 2QEXI 1Z9CA 3CDHA 2RVCA 2FEZA 2K4JA 4D7MA 2R7WA 1Z0XA 2BEOA 1R00A 3R6SA 1K6OA 5M5WJ 2L7FP 1LKXA 4BDZA 3TL4X 2BV6A 3SXYA 1JXSA 1S3JA 1OKRA 1DGWY 2ZJQF 1Y6IA 5B1AH 3BG3A 2M87A 5J1UA 2DJIA 4PJJA 3CC2I 3KIOA 2CQQA 4C30A 2MG4A 3LAPA 3ISPA 2FU4A 1RPWA 3W2VA 3MKWB 2F5DA 2E34A 3EPZA 4AYBN 1MBHA 3M8EA 1QZYA 2DQRA 3ASOH 2K4BA 4C2TA 3C2BA 1NG7A 2XDVA 1SD7A 2BVLA 1LDDA 3K4MA 2XC7A 2V1UA 4KITB 3F8CA 2LP0A 4DNCA 5L3BA 4D5CA 3SEZA 3L2WA 1RRJA 2HKOA 3QYEA 2BW3A 2E19A 1XMXA 2NRAC 5HVQC 3HL2A 4CZCA 5JI6A 5FGMA 2ICWG 4L0YB
chains in the Genus database with same CATH topology
2L9VA 2KIQA 4FQGA 1UZCA 2KFDA 2B7EA 2JUCA 2K85A 2LKSA 2KISA 2CQNA 2E71A 2DOFA 2DODA 2DOEA 2KZGA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2L9V A;  2KIQ A;  4FQG A;  1UZC A;  2KFD A;  2B7E A;  2JUC A;  2K85 A;  2LKS A;  2KIS A;  2CQN A;  2E71 A;  2DOF A;  2DOD A;  2DOE A;  2KZG A; 
#chains in the Genus database with same CATH topology
 2L0K A;  1T38 A;  1TWG J;  3EET A;  4Q48 A;  4HLX A;  1YIJ I;  2X1E A;  2XPW A;  1U3E M;  3WU2 C;  1TWA J;  1U0J A;  5D4R A;  3J80 K;  1VQN I;  4FE7 A;  3C18 A;  2DQL A;  1H0M A;  3ESW B;  4YFX F;  2LRD A;  3RKW A;  3RSN A;  2AQF A;  4KUM A;  2ZNY A;  1MH4 A;  2HGC A;  3DFG A;  5EG0 A;  1SEU A;  5CQG A;  2CRG A;  5L3F A;  4MHG A;  2BYV E;  4BBR J;  2HZD A;  1HW2 A;  3RQ4 A;  1IRX A;  4UV9 A;  3V8L A;  3WOD F;  2V7F A;  4IXA A;  1LNW A;  2ZFU A;  4IHT A;  2V1N A;  2Z2S B;  4HNU A;  2X6O A;  3IH4 A;  5CVU A;  3ULQ B;  4YFN F;  2P7V B;  4E70 A;  1A6Q A;  2HR3 A;  2PFB A;  4AC0 A;  3NWS A;  4WCG A;  1DGR M;  3I71 A;  5BQT A;  2K02 A;  2VQL A;  2K40 A;  5K7Z A;  2IA1 A;  1ULY A;  2DA4 A;  2NNN A;  5TGT A;  2ZJ2 A;  2PMZ A;  1D5Y A;  4LD5 A;  3JAM K;  5KNL A;  3ERM A;  2ME6 A;  3CF2 A;  1F36 A;  1STZ A;  3ABT A;  2L54 A;  1A5J A;  1Y8R B;  5AON A;  2DT5 A;  3TW7 A;  3L2Q A;  1IRZ A;  3IH2 A;  4LG0 A;  5HNF A;  2NVX J;  1A36 A;  1VQP I;  3KP4 A;  3ZMV A;  5AIP A;  2R5Y B;  5CVJ A;  1WVR A;  4EM0 B;  3WTX C;  3PO2 J;  4X6A J;  2M8E A;  3LMM A;  3K0L A;  2R7Z J;  4N9H A;  1YJ9 I;  2Y75 A;  3V42 A;  1XX5 A;  3ZMS A;  3CMM A;  3JCU C;  1J0R A;  4B43 A;  2OF7 A;  4QSH A;  1MNE A;  2K86 A;  3HGY A;  4UUV A;  5FKM A;  3RPQ A;  2G7U A;  2EFW A;  5ICE A;  2KIU A;  2W57 A;  4EMS A;  3A2K A;  5GPA A;  2H1K A;  3ZGK A;  2Z99 A;  5F0F A;  3VFZ A;  2F5C A;  2WC2 A;  1XDU A;  3BCB A;  1Y56 A;  1ENH A;  2LKS A;  1HCR A;  4XLF A;  4A69 C;  4XRS A;  1FMW A;  1I6X A;  3RI4 A;  2FNP A;  3AAF A;  2YUS A;  2VKH A;  2QQ9 A;  3DPU A;  2E2J J;  2JN6 A;  2QBY A;  1SC7 A;  3QRF F;  2CUF A;  3HRU A;  2W24 A;  4CUG A;  3ABU A;  4M3B A;  3CJN A;  4NC8 A;  3CCE I;  1WJD A;  4BEH B;  1JGS A;  4RGS A;  1HLV A;  1H88 C;  2F5V A;  1KYZ A;  2DMQ A;  3PNV A;  4XLC A;  3E6D A;  2MAB A;  2DA1 A;  3MN2 A;  2G9W A;  1TNT A;  3FK6 A;  4CYC B;  4NBQ A;  4HW0 A;  2IVM A;  1T98 A;  1MGT A;  2QF7 A;  3H3V K;  3K4L A;  4M3G A;  1XPX A;  2VOD A;  3S32 A;  1FIP A;  2NYX A;  2XAF A;  5E1W A;  1UCR A;  4G7Z F;  2CW7 A;  4EJT A;  2VC1 A;  2A05 A;  4Y52 J;  1ITY A;  2CU7 A;  3E6M A;  4TV7 A;  2VUM J;  3GX4 X;  4IZZ A;  3OL3 A;  4LLL A;  4BU2 A;  2OCE A;  1IN6 A;  3IWF A;  3BT9 A;  3OOU A;  2JZY A;  3DLA A;  1IUF A;  4XKW A;  3IRQ A;  3TQN A;  3OIO A;  1YTY A;  1XN7 A;  2EV6 A;  3FF5 A;  6PAX A;  5EEH A;  4BY1 J;  1ZEL A;  2EIL H;  1UST A;  3VPR A;  2D45 A;  3C7J A;  3GZ5 A;  4UHT A;  1H9G A;  2J5O A;  4HV5 A;  4I0B A;  3G6E I;  3DU5 A;  3J81 Z;  4RAY A;  1U78 A;  2KDZ A;  3KYC B;  2IGN A;  2E2I J;  3HDD A;  2HTJ A;  1BOA A;  2COM A;  4N4O B;  2BY3 A;  4RDU A;  3OYJ A;  5D5V B;  2Q0O A;  3GFJ A;  2DOF A;  4IL6 C;  2R4G A;  3U1D A;  5H2F C;  3RKX A;  5M5X J;  2YU9 J;  4IHY A;  4B09 A;  1DU0 A;  5GPC A;  4HA8 A;  1SVO A;  2VN2 A;  2G0E A;  2OZU A;  2PMZ N;  2A5W A;  4BHC A;  4ZTJ A;  3CUQ A;  4C3I J;  3H9G A;  4ZDP A;  3PSF A;  3CP8 A;  4X1E A;  3MD2 A;  3PQK A;  4FAS D;  3IL2 A;  4II3 A;  3L2V A;  3DPL C;  3GZ6 A;  2MGQ A;  3HPG A;  4RB0 A;  1G3S A;  4LIU A;  4BAC A;  5GTH C;  2VBX A;  2KJB A;  1G2H A;  4M9X A;  3E5U A;  2HYF A;  4L5I A;  1ZG3 A;  4YEL A;  2BHZ A;  2ESH A;  1S7A A;  1BBY A;  1D0X A;  5FD5 A;  1A31 A;  1BL0 A;  2GXA A;  1RR7 A;  2X48 A;  3PNT A;  3MVP A;  4G6T B;  1R71 A;  2QWW A;  1HXD A;  2JTV A;  4E7S A;  1OCT C;  2DMU A;  1BOB A;  3TW6 A;  4D1Q A;  5EGO A;  5D8K B;  2EA4 A;  4B4C A;  1HW1 A;  3G4S I;  4KDP A;  4I99 C;  4CHU A;  1M1E B;  1U2W A;  3DU6 A;  4IJA A;  4RGX A;  4W1U A;  2VE8 A;  2Z5U A;  2JVG A;  3FXR A;  4F91 B;  2CFX A;  5K5Q A;  2ISY A;  3D5R C;  1APL C;  3KYL A;  3P7N A;  1IRG A;  3BC8 A;  1E0E A;  3S1R J;  2GOX B;  2OCC H;  2A6T A;  2Y2Z A;  3VYS B;  1K7A A;  5L3E A;  3WGI A;  3CCM I;  2A6E F;  2Z3Y A;  3AG3 H;  5B3S H;  3IUO A;  3L09 A;  3V7R A;  3HOY J;  4M9S A;  2H94 A;  4AIJ A;  5BOX A;  1BA5 A;  3HSE A;  3IC7 A;  2DFH A;  3FXL A;  4RB1 A;  2H6B A;  3S15 J;  4C2M J;  2R7Q A;  1FZP B;  1MJA A;  3GTQ J;  3J7Z I;  1POG A;  1BJA A;  2R5Z A;  5KVR A;  3WTZ A;  1ZQ3 P;  4FX0 A;  3VOD A;  4IKF A;  2FRH A;  5IT9 K;  3KLO A;  4HLY A;  3CCU I;  4JOM A;  2PI0 A;  2FE3 A;  3KPH A;  5J8F A;  2VJJ A;  1DUX C;  4NHJ A;  2M34 A;  4PFP A;  1L3L A;  1WZ2 A;  3LAJ A;  2AQE A;  4FE4 A;  4V2G A;  1FOY A;  4RM3 A;  4I2O A;  3K1P A;  1ZHF A;  2HI3 A;  3A02 A;  3S1M J;  2EBI A;  4HQM A;  1O3Q A;  2HOS A;  3RTR A;  2O03 A;  3TMO A;  4ENK A;  1W5S A;  1AHD P;  2X1C A;  1W36 C;  4Y7N J;  4A0Z A;  2ZSH B;  4KMU X;  2IP2 A;  2EIK H;  2R7U A;  5HS9 A;  5D8L B;  3PFI A;  3HOT A;  1A04 A;  1OQY A;  2M7B A;  4IRI A;  4ESJ A;  1MDM A;  5GAE J;  1LDK B;  4LLG F;  4PFO A;  3OYA A;  2GA1 A;  2VBY A;  2UV1 A;  2LBF A;  1D1C A;  2ZJP F;  2DLL A;  3H9J A;  4OAZ A;  2XIG A;  4B48 A;  5DD4 A;  3M8F A;  3SJM A;  5HOD A;  5J8C A;  2OQR A;  4C3J J;  2P0W A;  5CKT A;  2VON A;  5E18 F;  1HSJ A;  2NOG A;  4BY7 J;  3ZQG A;  3CCR I;  2RNJ A;  4RLQ A;  3WG9 A;  2K27 A;  3HOU J;  3I54 A;  5TIS C;  3Q5F A;  1ZLK A;  3FXJ A;  1B6A A;  5F6F A;  3TBI A;  1FJL A;  1BM9 A;  3QOP A;  5B1B H;  1PP7 U;  3FK7 A;  3VWB A;  1R7J A;  4LG3 A;  2BY0 A;  1JKQ C;  5LFA A;  2K9M A;  1R5G A;  1WJE A;  1D1A A;  1JHH A;  2ZXJ A;  2Z9O A;  4P96 A;  2A61 A;  4EM2 A;  4NDL A;  2R7D A;  3FMS A;  1MW7 A;  2V26 A;  3T8T A;  3LSM A;  2GA2 A;  2HTS A;  1D0Y A;  3X2Q H;  1JKR C;  2CSO A;  1SVM A;  2M30 A;  1K4S A;  4RAF A;  2P5V A;  5IYD J;  3CJT B;  1JUP A;  3L2C A;  1OJL A;  1OFC X;  4PGG A;  5FRN A;  1EA3 A;  1Y8Q B;  4XKV A;  1ZYR F;  1AU7 A;  3Q0U A;  1YRN B;  3CCL I;  1PVE A;  3Q0V A;  3HGG A;  1PP8 F;  2JUG A;  3ONQ A;  2MC4 A;  1XGM A;  1U6G A;  3KP6 A;  3CMY A;  1FPQ A;  2CMP A;  3L00 A;  1K83 J;  3KYD B;  3KLN A;  2E1C A;  1U5T A;  2R7F A;  3FHZ A;  2WTE A;  4DZP A;  1FWZ A;  4YRV A;  4RAG A;  1ON1 A;  3IWZ A;  2K9N A;  2DFE A;  3OYK A;  3N4M A;  2HOA A;  2FSW A;  1LDJ A;  3O8H A;  2CV2 A;  1V55 H;  3JRI A;  3EQL F;  2O0Y A;  3CZ6 A;  4MEY F;  3PUF A;  1TC3 C;  1ZLJ A;  1XGS A;  3D1N I;  3HPH A;  5DV5 A;  3HEF A;  3CCY A;  1USS A;  2ID6 A;  3JW4 A;  1BI2 A;  2KZG A;  2QUF A;  2TDX A;  2NVQ J;  2ADU A;  4CO8 A;  4A3E J;  1JGG A;  2GZW A;  3BR6 A;  2EFP A;  1FY7 A;  4U0V A;  1Y1W J;  1IXC A;  3MZ8 A;  4HDU A;  3I5U A;  4XN3 A;  3C2H A;  3OMY A;  3I4P A;  3JSP A;  2HS5 A;  2MBF A;  5EF6 A;  4KYW A;  2KFD A;  1NK2 P;  2E71 A;  3BR0 A;  1B4A A;  1ZRD A;  4F92 B;  1MBE A;  1WSU A;  4Y3O A;  2LMD A;  2DTR A;  2RAE A;  2UUZ A;  4CDG A;  3GVA A;  5LRS A;  2NNY A;  1B72 A;  4L9J A;  4ASN A;  3JSO A;  1S7E A;  5JLX A;  4PJL A;  2ZME C;  5F0H A;  2XKP A;  5M3F J;  1D0Z A;  1RKT A;  4LK1 F;  2YR2 A;  2ZCW A;  3V8J A;  3HOW J;  4MLO A;  1O3R A;  2H1L A;  3AFH A;  5B5E C;  5F64 A;  1R1T A;  2E5N A;  1VQM I;  4A3I J;  3K1M A;  4XOR A;  5CQE A;  5KAF C;  2MD5 A;  1QO0 D;  3HOX J;  5FLV A;  4D7N A;  1FP2 A;  2ZJR F;  3K9T A;  1SD4 A;  1GV5 A;  2ECC A;  1KU2 A;  3QYB A;  1AKH A;  2HWV A;  2LY2 A;  2VXZ A;  4LGW A;  5JHF A;  1MH3 A;  1KU9 A;  2NVT J;  3F3X A;  1F1Z A;  1GVJ A;  3VSL A;  4MTD A;  3HSF A;  4B3A A;  1QNT A;  4FT8 A;  4YG2 F;  1XDS A;  2VAS A;  5KAI C;  4BE0 A;  3OIP A;  3AG1 H;  5CVV A;  2VOO A;  2VE9 A;  1MKM A;  1UZC A;  3LSR A;  3QPT A;  3S8P A;  1GVD A;  4EAT A;  1QGP A;  3M1C A;  3MZH A;  3FKJ A;  3AG4 H;  4HZF A;  3G3Z A;  4BUP A;  1IXS B;  1HW5 A;  1W5T A;  3W2A A;  2LFB A;  5E3M A;  1FIA A;  3PO3 J;  1IV8 A;  2QVO A;  3E7L A;  3FDY A;  5LHH A;  1LE8 B;  5H20 A;  3T1B A;  3VYT B;  4CZZ A;  2P6S A;  3LOC A;  3VB2 A;  3LSI A;  2DO7 A;  2CQK A;  2HXO A;  4PJ0 C;  4XLE A;  5JVT A;  3GW2 A;  5A2Q K;  3QWL A;  2ZXI A;  1QVT A;  1FMV A;  3F9K A;  1HDP A;  3S17 J;  2DMN A;  3L7W A;  1KU3 A;  1ETO A;  3M1E A;  4WX9 A;  1Q1H A;  1OYI A;  2DOD A;  2L9V A;  2RV8 A;  4DYR A;  1FNN A;  1PUE E;  2OC6 A;  1JI8 A;  3G2B A;  3TO6 A;  2VC0 A;  3I9V 2;  4RLF A;  4E6K G;  2QSG X;  4RM2 A;  3DP7 A;  2L3D A;  1R22 A;  1BI0 A;  1YG2 A;  1JUS A;  2WA0 A;  3IAS 2;  4BDY A;  4XBF A;  3OYF A;  4ZTF A;  2FBH A;  2AO9 A;  2IEK A;  2L5Q A;  4N9I A;  2IBD A;  1GXQ A;  3GTL J;  3I59 A;  4FCY A;  1O3S A;  1ZR4 A;  2HEO A;  4BJ5 C;  2NVY J;  4WXD A;  4XKC A;  1X1B A;  1IV6 A;  3G73 A;  3HOZ J;  1UMQ A;  3CME I;  4C9Y A;  2KHM A;  2Z16 A;  4QPQ A;  4EM1 A;  3TP0 A;  4Y15 A;  2RRE A;  3R0A A;  2W25 A;  4R1H A;  1ETQ A;  3EUA A;  2NXN B;  4M6V A;  5BPI A;  4RA2 A;  4CH7 A;  3QP6 A;  4CIC A;  1C0W A;  1DPR A;  2M1B A;  2ECB A;  2K3F A;  5H6R A;  2QZ8 A;  2XAS A;  5CVI A;  1UG2 A;  1XMA A;  1K78 A;  2BHY A;  3BR5 A;  2FBK A;  5LGN A;  2BY1 A;  1EKE A;  3HHG A;  4CYD A;  1LUJ B;  4NQW A;  2M7A A;  4AIH A;  5CYV A;  1IF1 A;  1U8R A;  1S9H A;  4LMY A;  2V6E A;  2A69 F;  2W48 A;  4JQF A;  3CCJ I;  1A35 A;  3WTW C;  2DDA A;  3FIS A;  1SD5 A;  4GRI A;  3RCO A;  2IGO A;  1ZRF A;  5E17 F;  3I64 A;  3O3K A;  5GP9 A;  4RGR A;  2FML A;  4RB2 C;  1JT0 A;  3F22 A;  5HLG A;  2DYS H;  3OYN A;  2HYJ A;  1YLF A;  2Q2E A;  4GYG A;  2IS1 A;  2V1D A;  2DAO A;  2WB1 A;  3GYH X;  1XCB A;  4B44 A;  4RMN A;  1MJ9 A;  1SAU A;  3DEE A;  2RDP A;  1MNM C;  3K4J A;  1YI2 I;  1G3T A;  2DPD A;  3P9K A;  3OR1 C;  3R4K A;  1WJA A;  1JE8 A;  2R93 J;  4ZJZ A;  3U2R A;  2XKO A;  4KN7 X;  1YOV B;  1UB9 A;  3LSH A;  1UJ8 A;  1O3T A;  1V3F A;  3BP8 A;  5CJ9 A;  1KQ8 A;  3S3M A;  3GME A;  1ETW A;  1I3A A;  4CGZ A;  5C4X J;  5IT3 A;  2FNA A;  2NAZ A;  5B66 C;  5K7F A;  1FOW A;  4EJO A;  2X51 A;  4UXN A;  2M5W A;  2QGU A;  5L3C A;  2OPT A;  2D5V A;  1UHW A;  4G7H F;  2Q8K A;  2YPR A;  3SFI A;  3L2R A;  3S14 J;  3HJE A;  1SFO J;  5F1R A;  2JRT A;  2K85 A;  2DU9 A;  5DD8 A;  2BVM A;  2QQB A;  4GXO A;  3A03 A;  4MEX F;  3J7Y J;  3SYT A;  3DBR B;  2DK5 A;  4AM3 A;  1WJF A;  3H3Z A;  3OS1 A;  1X1D A;  3KFW X;  2ZME B;  3P9C A;  4WF2 A;  5DM6 F;  3LQQ A;  4WWC A;  3KEY A;  1X1A A;  3ASN H;  1B8I B;  2LY1 A;  1MSE C;  2X0L A;  1J2X A;  2IPQ X;  5K7H A;  5J4Y A;  3LFK A;  2WAQ A;  3BZ6 A;  1R4M B;  3K7A J;  4I7H A;  4D9J A;  2UXX A;  1ERD A;  4I02 A;  2NS8 A;  2GOM A;  4ZZL A;  4BH9 A;  3FXM A;  3HZJ A;  1K79 A;  3CD6 I;  4I98 B;  3KE2 A;  1RR8 C;  1IZ1 A;  1IXR C;  2NS0 A;  5GAD J;  1I1S A;  2HZT A;  1ZRE A;  3WGG A;  3VSK A;  3TP3 A;  1LB2 A;  4WXH A;  4IO9 F;  3F8M A;  1Y0U A;  1JJ8 C;  4PDK A;  4PSX A;  3OV8 A;  3Q9V A;  2D2W A;  4E4H A;  3S93 A;  1ZG1 A;  3ZQ7 A;  3SZP A;  1DQU A;  4WXC A;  2LG4 A;  5C3E J;  2K9Q A;  4ZDO A;  1TWF J;  2DMT A;  4UUS B;  2STT A;  3OYB A;  3JTH A;  4HX7 A;  3DKW A;  2FA5 A;  3RPU D;  2Y0M A;  3GTK J;  1I6H J;  4CCO A;  1OCC H;  4IQ4 A;  1KA8 A;  1OYY A;  1W7P B;  4DJA A;  2VJ4 A;  3A01 B;  4GFB A;  3E5X A;  2D1H A;  4V19 K;  1WKM A;  3CO7 C;  1PYV A;  4CXF A;  2DXI A;  4JP0 A;  3MFK A;  5E8I A;  4BAY A;  1W0U A;  2EFQ A;  3H9Q A;  3MKL A;  4C3H J;  4XIC A;  2WWY A;  3ZN1 A;  2DTZ A;  5LEJ A;  2JK3 A;  2DI3 A;  4I01 A;  3HSR A;  3OSG A;  3ML6 A;  2PQ8 A;  1WI9 A;  3HBL A;  2BOL A;  4P5O A;  1T0F A;  2LR8 A;  4D0P A;  1G59 A;  4XON A;  3L1P A;  4E7K A;  1ZK8 A;  3M07 A;  1YIO A;  1HOM A;  1BIA A;  1OCO H;  2BXY A;  4HST A;  3F8N A;  3GLL A;  2HPI A;  5TRD A;  3F0C A;  3F23 A;  3CES A;  3G1M A;  1SFE A;  3OYC A;  3GTG J;  3S2H J;  3H36 A;  3NAU A;  4PZJ A;  1KU7 A;  3IV5 A;  3ELK A;  4CCL A;  4IOA F;  2HVR A;  3K10 A;  4LLN A;  3AL0 C;  4RGU A;  3JRE A;  2W85 A;  3V4G A;  3QAH A;  2LD5 A;  4XN0 A;  2OD5 A;  1RES A;  3J80 Z;  1ETY A;  4GGG A;  4OAY A;  4S0H B;  2ZME A;  3TOA A;  4KA4 A;  1UHM A;  5IYC J;  4ZH4 F;  1YW8 A;  1CGP A;  2L9N A;  5DYM A;  2V1X A;  4PCQ A;  4RBO A;  2HVQ A;  3CO6 C;  2H8R A;  3EUK L;  1WGX A;  2VJ5 A;  2LF8 A;  4A3B J;  2EIM H;  1TT0 A;  2R5Y A;  2ZXH A;  5DEQ A;  3BWG A;  1ACI A;  4S04 A;  3C3W A;  3WTU C;  2K7L A;  1F43 A;  3GUD A;  1X58 A;  2KL4 A;  1P2F A;  1IJW C;  4UB6 C;  5LBQ A;  1QPI A;  4LB5 A;  5E3L A;  2HQR A;  2FJ1 A;  4XOP A;  5FRM A;  4UNO A;  1YW9 A;  3HRM A;  1FX7 A;  2WAQ N;  2A07 F;  2V79 A;  5HOO A;  1JTY A;  1FSH A;  1D8K A;  3EDP A;  4HBL A;  1MMA A;  3OL4 A;  3ZN0 A;  1FT9 A;  2B0L A;  2W7N A;  1JKP C;  5LHG A;  5ILU A;  3JRC A;  4K2E A;  4ESB A;  3JAM Z;  1R6R A;  1Z7L A;  1FLI A;  1ZGW A;  1ONV A;  2HQN A;  3BTJ A;  5L3D A;  1RKW A;  1O4X A;  2E60 A;  1MMN A;  1I50 J;  5DCM B;  4BGD A;  2O7O A;  2N8G A;  3O2P E;  1QZZ A;  5CLS A;  2DT7 B;  3OYG A;  1XS9 A;  2Q1Z B;  5JFR A;  1V5F A;  4MIM A;  3FM3 A;  3L2U A;  3DWL E;  3QP5 A;  2X6X A;  2OUM A;  3K4K A;  3D5S C;  4BEH A;  3GO5 A;  3QPS A;  1Z7U A;  2MH2 A;  1G3W A;  5KK1 A;  5DDG A;  3KET A;  4A93 J;  2LNB A;  1QU3 A;  3LSK A;  2CFO A;  4Y4R A;  1PDN C;  3PL8 A;  4FET A;  2E1O A;  4CYC A;  1VND A;  3H0D A;  1LFB A;  2CJJ A;  2RQP A;  2F2E A;  1V54 H;  4XLH A;  4A3D J;  4QTR A;  4FHT A;  2DA2 A;  1ZN2 A;  3BPV A;  3PQJ A;  4H0E A;  3TDU C;  1KYW A;  2R7O A;  3TGN A;  4A3G J;  3S16 J;  3ZXS A;  2JWT A;  3KZY A;  1XB4 A;  1Z67 A;  2DN0 A;  4A6D A;  2A5Y B;  2R0Q C;  1H8A C;  1J5Y A;  3PM1 A;  3FBN B;  3S3O A;  1P4X A;  4BQQ A;  2MLG A;  2OZ6 A;  2IGM A;  3ZCO A;  3ZQQ A;  3CUO A;  3WTV C;  3IKV A;  2HOT A;  5EDN A;  1HKS A;  1ZGJ A;  2JA5 J;  3BOQ A;  2ZO4 A;  3DBH B;  2E7X A;  3K4C A;  2GM4 A;  4E7J A;  2KRH A;  1XGO A;  2L9S A;  1BI3 A;  2KPM A;  1FP1 D;  2GAU A;  2HNH A;  2R7X A;  4OMZ A;  3NAR A;  5J40 A;  2F5E A;  2KT0 A;  2CG4 A;  3HHH A;  4U0W A;  1J59 A;  3ZPL A;  1G6N A;  2XSJ C;  1J75 A;  4JX6 A;  2MYS A;  1IN4 A;  5EEA A;  1CQT A;  3K6G A;  1SMY F;  2M2E A;  4LOC A;  4M9Z A;  4ZYH A;  1GDT A;  1K61 A;  2L7Z A;  2EQR A;  1FBS A;  2VLA A;  1UEL B;  1LQ1 A;  1EH6 A;  1XCV A;  1HC8 A;  1TNS A;  1TQP A;  1YHQ I;  1B1B A;  2CW8 A;  1E3P A;  3FXK A;  1P92 A;  2E2H J;  3A0B C;  1YO5 C;  1UG0 A;  2W1O A;  1UAA A;  3IRR A;  4KMF A;  5EEG A;  3AKZ A;  1FOK A;  4EJU A;  4EJV A;  4ON0 A;  4HF1 A;  4EVI A;  3OS2 A;  2HOE A;  5LEK A;  1KQ0 A;  2GBY A;  5FJ8 J;  2HPM A;  2ZNZ A;  1G4D A;  1TWH J;  1MMD A;  2H27 A;  2IRF G;  3LQR A;  4GYI A;  2ELH A;  4DQ2 A;  4IQJ A;  3G71 I;  2ELJ A;  1GUU A;  2LK2 A;  5L3G A;  2LVS A;  1ZTR A;  5D6F A;  5E3O A;  4MTE A;  4HF0 A;  4HF2 A;  5F0C A;  4KIB A;  2VKD A;  2EFO A;  1RZ4 A;  3GTM J;  4ENJ A;  1X3Z B;  2LSO A;  3WTY C;  4XSX F;  4R79 A;  2ELK A;  2PJR B;  4BQA A;  2FMY A;  4QIW N;  5DUK A;  2LOO A;  3IH3 A;  2X6W A;  3QPL A;  3QPH A;  1X4O A;  1EJ9 A;  4PK4 A;  3SDG A;  1E17 A;  1Y1V J;  4G8X A;  3AL0 B;  3WU1 B;  3CQZ J;  2Y9Z A;  4PSW A;  3F6O A;  3V8K A;  4MO7 A;  1R4N B;  1QHH D;  1S72 I;  2DA5 A;  1RIO H;  4J19 A;  1MZB A;  4HQE A;  3CMA I;  2AXT C;  1QQI A;  3K2A A;  4AIK A;  3QOE A;  1FTT A;  4MNU A;  2XGD A;  4XM3 A;  5TJJ A;  4DBQ A;  2IGK A;  2VPR A;  4DYC A;  4HNV A;  5HS7 A;  1HA8 A;  3FIW A;  2ZBK A;  1OCR H;  2UXN A;  3UKG A;  2WAE A;  2DCE A;  5ERI A;  1JHF A;  4M6X A;  4G7O F;  3A0H C;  2F5F A;  4XR6 A;  4Y13 A;  2KQR A;  3CP2 A;  3ZQC A;  2CWE A;  3RJP A;  5AIQ A;  3FXO A;  4V2F A;  4L9N A;  3BJO A;  1R23 A;  4XSZ F;  3T8R A;  1I5Z A;  2B63 J;  2XRN A;  4JBA A;  4F3Q A;  3BCA A;  3G1L A;  3KZZ A;  1N75 A;  2P81 A;  4IHS A;  2VQG A;  3CLO A;  4YIF A;  1IO2 A;  2PBI A;  5J6X A;  3QQA A;  4F7Z A;  2ETH A;  2XB0 X;  3VYU B;  1W7P D;  4ZYA A;  1U8B A;  3IHU A;  1VFC A;  2JPB A;  5HNH A;  1OCP A;  1TW3 A;  3F8B A;  5FD6 A;  4M73 A;  2MH9 A;  2Y69 H;  1PUF B;  4OIR F;  2IS6 A;  1J09 A;  4Y17 A;  2GXB A;  1Z3X A;  5IT9 Z;  4XQF A;  1X3W B;  4GCV A;  2CUE A;  1QA6 A;  2ZKZ A;  1SAX A;  4AVZ A;  1IC8 A;  3VYR B;  1F4K A;  2ISZ A;  3S2W A;  5GAH J;  1IN8 A;  4U87 A;  1ZGA A;  1LPQ A;  2R92 J;  2CV1 A;  2JT1 A;  3RYR A;  1WQ2 A;  4BQO A;  1ZRC A;  2M8G X;  3KP7 A;  1XC5 A;  1Z6R A;  2HU9 A;  3J7A O;  1I39 A;  2EZI A;  3RDI A;  1XD7 A;  3HUG B;  4B47 A;  1W5C C;  3RKY A;  3OIQ A;  2DMP A;  4L9V A;  5ICC A;  1ZH5 A;  3ERE D;  2XPU A;  1LEA A;  1MSF C;  5J1R A;  2XF5 A;  4EJW A;  2BZT A;  3CF5 F;  2B9S A;  1LFP A;  3E97 A;  4ITV A;  4IX7 A;  3JRA A;  4ETS A;  1R1V A;  3H1C A;  2L7K A;  1FYL A;  3BLY A;  4E7Z A;  1OMI A;  3FZV A;  1OCZ H;  4AYB A;  3OYE A;  1T95 A;  4R8H A;  4OIN F;  1OPC A;  5E1Z B;  2DK8 A;  1FEX A;  2OU2 A;  5J47 A;  3K4N A;  4IRH A;  4IEJ A;  4RB3 C;  2GWR A;  1Z91 A;  4OWR B;  3GWZ A;  3ZQL A;  2LYC A;  3M4O J;  2DW4 A;  4BNC A;  4U7B A;  1RNL A;  1KZH A;  1IDY A;  4ABZ A;  3DTE A;  3K70 C;  3DF8 A;  1I27 A;  2ZFW A;  1R36 A;  1X19 A;  4AU7 A;  1YRN A;  3FMQ A;  3QOD A;  3GLX A;  3F6V A;  4A2U A;  5KCM A;  4MQV A;  3MQ0 A;  4EV0 A;  3K4B A;  2OTJ I;  4BYY A;  4BQN A;  1V4R A;  2WAF A;  3CUQ C;  5DS9 A;  4E7L A;  5LGU A;  3RZD J;  2PLY A;  5K5O A;  4Q47 A;  3SFZ A;  2IA0 A;  4NC7 A;  3UR3 C;  5GTI C;  2BW3 B;  4DOZ A;  1IGN A;  3FX3 A;  4DZJ A;  1FYK A;  3I3L A;  2ZC2 A;  3HOS A;  1MBJ A;  2EV0 A;  1XSV A;  3DEW A;  3D0S A;  3SEQ A;  2CH0 A;  2OBP A;  4BJT A;  4U0Y A;  2VJI A;  3RPU A;  1QHG A;  5LLQ A;  3DBL B;  5HLT A;  2RNG A;  3I4M J;  2OTL I;  3NEU A;  1FBQ A;  3LSJ A;  4LK0 F;  1TTY A;  5LRR A;  2IA2 A;  2V9K A;  3VDX A;  5IOZ A;  4OIP F;  2XAG A;  2FOK A;  3TO7 A;  2E1M B;  5EG0 B;  4F93 B;  3RQI A;  5K1Y A;  4MQ9 F;  1XSD A;  2EV5 A;  3DCF A;  3PUB A;  2JVH A;  2QCO A;  2DOA A;  2ZXW H;  2MW8 A;  3OYL A;  2NS7 A;  2K5C A;  4XRF A;  2VXD A;  2P7C B;  4BL0 B;  2EZH A;  2LY9 A;  2DBB A;  4F52 A;  3JTG A;  5EZG A;  4ZYE A;  2CS3 A;  2XGX A;  4CA0 A;  1MD0 A;  2KIQ A;  1QRY A;  1JUM A;  2LLK A;  2QQ8 A;  3U9G A;  2O61 A;  5E20 A;  1LVA A;  4XKB A;  5LD2 C;  3JRB A;  3QU6 A;  2XHK A;  3DLL F;  4ZC3 A;  5D5U B;  3C1D A;  1AOY A;  5JR3 A;  3CJQ B;  2X4H A;  5F27 A;  1HF0 A;  2OQG A;  1YJW I;  2ZB9 A;  2LKP A;  4E7I A;  4FX4 A;  2XUB A;  1MMG A;  1VF9 A;  1RET A;  4OOI A;  4P9F A;  1I1G A;  3KP5 A;  4HPQ A;  1TZL A;  4LG0 B;  4L18 B;  2IW5 A;  4XOT A;  2BGC A;  2R7R A;  3WHC A;  2I8D A;  2L4A A;  3CC7 I;  2FBI A;  2LC2 A;  2O9L A;  5FO5 A;  2GLO A;  2WY7 Q;  3LFU A;  2VIX A;  2XAQ A;  4AD9 A;  2X85 A;  1VQ5 I;  4MGR A;  2IS4 A;  1MJB A;  4Z6Y A;  4U88 A;  1D1B A;  3BZC A;  2QEN A;  3I55 I;  1TP4 A;  1OYW A;  5HLH A;  3HG9 A;  2VPL A;  3GBG A;  3U1K A;  5H6Q A;  2RKH A;  1RC9 A;  4DIQ A;  4XMY A;  1WHU A;  2COB A;  3JRF A;  4LIT A;  4OIO F;  2XGE A;  4GO1 A;  2FF4 A;  2J5P A;  4BXX J;  3LWF A;  2YS9 A;  5F04 A;  4BHB A;  4QPO A;  5F1J A;  4A3K J;  4IPA A;  3SQN A;  1S8N A;  4HDV A;  2QKL B;  1N78 A;  1VQ4 I;  4XLP F;  2M4K A;  1BR1 A;  1XMK A;  2QBY B;  2JSP A;  3TED A;  4ZZD A;  2E7W A;  2P5K A;  1IRF A;  4PJM A;  1LE8 A;  3CLQ A;  2E35 A;  2L7M P;  3MAJ A;  1D8J A;  1YS7 A;  3H0G J;  1V5E A;  3IP4 B;  2YSR A;  1E3H A;  2CO5 A;  2CQX A;  4I76 A;  4A3C J;  1R9T J;  2VQH A;  2LKX A;  2ZSI B;  2XAH A;  2HQA A;  3SZT A;  1CF7 A;  3J81 K;  5KHD A;  3GFL A;  2R7T A;  1VQK I;  1O7L A;  4A3L J;  2P8T A;  5CVR A;  1B59 A;  3VOE A;  4M74 A;  2V4J C;  2XV4 S;  4HAM A;  2JA8 J;  2LRE A;  2Y31 A;  3BJA A;  2P5L C;  5FB2 A;  2KRF A;  3DXJ F;  2ACJ A;  3P5J A;  4XL9 A;  1YX5 A;  3HC7 A;  1GXP A;  2LH9 A;  5C44 J;  1DDN A;  3HYI A;  4PJN A;  3BG7 A;  2CQN A;  4P55 A;  2PMH A;  5A2Q Z;  2VOP A;  1T39 A;  2C6Y A;  4OU0 A;  2NVU B;  4ANJ A;  3MEX A;  5FFX A;  2IT0 A;  3S2D J;  4A5M A;  4KN4 X;  1S6L A;  2CUZ A;  3B6A A;  3OWT A;  2EJR A;  3ZMT A;  3Q9S A;  1QPM A;  1TLH B;  1ZKG A;  3PIP F;  2EB7 A;  1W0T A;  3PSI A;  2LF7 A;  2M0C A;  2EK5 A;  5JLW A;  4G94 A;  3N05 A;  3U21 A;  3ZQH A;  3M9A A;  2E36 A;  2NOJ B;  1X2M A;  4I09 A;  5M5Y J;  1T56 A;  4UVA A;  1IN7 A;  3CDL A;  3GFM A;  3CUQ B;  1TW2 A;  4QLC U;  3B02 A;  1U5T C;  1IW7 F;  1V5G A;  4CCM A;  4CCN A;  2EFN A;  3GXO A;  1HST A;  3LNQ A;  1U9O A;  2Z1D A;  5J4V A;  1VQL I;  2JA2 A;  4L9T A;  3K69 A;  3ZQI A;  1YE9 A;  2VT2 A;  3TOB A;  3DEU A;  3VEP A;  3W6V A;  2O8X A;  3MWM A;  2XPV A;  4XLA A;  1TL8 A;  3GTO J;  3CC4 I;  3O6B B;  1LEB A;  3BJ6 A;  3OYM A;  3PIO F;  2XSD C;  2G7H A;  4HEA 2;  4YII A;  1QZE A;  1GV2 A;  3MCZ A;  3GFI A;  3HB9 A;  4RAZ A;  2CV0 A;  1J7K A;  1FBU A;  2JJ7 A;  2M45 A;  1SMT A;  3WU0 A;  4CCK A;  3BDD A;  5EGO B;  1YJN I;  3DQV C;  3P9I A;  3H5N A;  5EZH A;  5DTD A;  1TQM A;  1Z1D A;  2P4W A;  2YU3 A;  1JT6 A;  4DGW B;  3ZOB A;  5LGT A;  1T6S A;  1OR7 C;  2WB1 N;  4A0Y A;  2I10 A;  2DA6 A;  1SD6 A;  4A3J J;  2AXL A;  1FC3 A;  3BTL A;  3SZG A;  4CCJ A;  1U9N A;  2VBW A;  1IDZ A;  3HXL A;  2H8W A;  5DM7 F;  3W3C A;  2JA6 J;  3R60 A;  2OV7 A;  1D3Y A;  3A4C A;  3LA3 A;  4AWX B;  2DYR H;  1OLT A;  5EYR A;  4KIC A;  4RS8 A;  4BS9 A;  1HBX G;  3RZO J;  2CQ7 A;  2TRT A;  4UB8 C;  4G12 A;  4FTH A;  3S1Q J;  1ETV A;  1ZG5 A;  2XAU A;  2EIJ H;  1EH8 A;  1WRJ A;  4NUB A;  1K4T A;  5EJC A;  5FRO A;  4XK4 A;  4OMY A;  1WI3 A;  1SFK A;  1R5I D;  3BZK A;  5HDK A;  2E5Z A;  3HIF A;  3BG9 A;  2R5Z B;  1XG1 A;  3ZR8 X;  3ZRG A;  3L9F A;  1MBG A;  1WFX A;  4NNJ A;  3ZMZ A;  3S1N J;  1B8I A;  4HYE A;  1XGN A;  1LVK A;  2OJE D;  4O5V A;  1X4P A;  4P9U A;  4J00 A;  4OIQ F;  5F08 A;  1R58 A;  2L4M A;  2X6Y A;  4XNF A;  3CCQ I;  3E1S A;  4AID A;  2QSF X;  4A5N A;  1Y39 A;  3A1Y A;  1NHA A;  4X0G A;  2DA3 A;  1BW6 A;  4UUT A;  1P7J A;  1FTZ A;  4ENM A;  3NWT A;  3ZP5 A;  2PEX A;  4BBS J;  4DW6 A;  1DP7 P;  2EIN H;  3TKY A;  5ICG A;  4B8X A;  1VQ6 I;  1W36 D;  1P4W A;  1S29 A;  2GIZ A;  2CGP A;  4A0X A;  3TDZ C;  3Q3S A;  1A6I A;  1IAW A;  3FXQ A;  4S05 A;  3PJR A;  2WAD A;  2ID3 A;  2L01 A;  2XAJ A;  3MZY A;  3ABK H;  3WE3 A;  3M7G A;  1FSE A;  1XTA A;  1ETK A;  4F55 A;  5J1Y A;  3LSP A;  3ZMU A;  2EWN A;  1R49 A;  2VT3 A;  2AS5 F;  1W4M A;  1WJC A;  2XVC A;  5FKO A;  5ED4 A;  2DPU A;  4LFU A;  1SFX A;  3QYF A;  1X3U A;  3WTT C;  4HX8 A;  4UUS A;  1Z6T A;  3KEQ A;  2IS2 A;  3W2W A;  3BR3 A;  3T5X A;  1MDM B;  1B9N A;  3BR2 A;  3COA C;  1HKT A;  4UY8 I;  2LBF B;  1BR4 A;  1WWX A;  2KZV A;  3GF2 A;  3KP2 A;  3A01 A;  1W7P A;  3H92 A;  3E3V A;  1XSX A;  1WPK A;  4BE1 A;  3QU3 A;  4GDF A;  1H9T A;  1NG6 A;  2QM3 A;  3GCM A;  2EZK A;  3KX2 A;  4EGZ A;  3DPT A;  5E3N A;  1N77 A;  5CPR B;  3HM5 A;  2KDO A;  1CF7 B;  1BN5 A;  3O8G A;  3G1O A;  1REP C;  3BPX A;  4ESF A;  4D5F A;  3C2G A;  1BR2 A;  2IAI A;  3F8F A;  4M6Y A;  3J7A Y;  2KIS A;  4J01 A;  2O3F A;  4KFC A;  4BHP A;  3LST A;  1DPU A;  1K6Y A;  3Q0W A;  2XF6 A;  3RKQ A;  1PJR A;  3EUH C;  4HRI A;  1NK3 P;  1T2K A;  2MD0 A;  3W6K B;  4WK8 F;  2Y48 A;  2PMU A;  2XF7 A;  3D5L A;  3CDI A;  2GIV A;  4JX5 A;  5DUI A;  3ZQF A;  1YFH A;  2O6G E;  2XB5 A;  3E0J B;  3MMY B;  4XRS G;  2K9L A;  2KP6 A;  4YFK F;  1SFU A;  1EH7 A;  3HRS A;  3CTA A;  2V9P A;  2O8K A;  1KQ9 A;  1D5V A;  1R1U A;  1TWC J;  2B7E A;  3ROU A;  1NTC A;  3V7C A;  3OYH A;  1X2N A;  5IP6 A;  3OYD A;  2A68 F;  3HKZ A;  1P4A A;  4M3D A;  4G6Q A;  2AHQ A;  2W00 A;  4AVP A;  1DP3 A;  1TBX A;  2Y30 A;  4DYQ A;  1BW5 A;  1YW7 A;  5ILS A;  5E8G A;  3OYI A;  1WCM J;  4YEJ A;  2JUC A;  2KIF A;  1VZ0 A;  5M3M J;  1VI0 A;  3CJR B;  2P6T A;  2O5R A;  2R3S A;  1MND A;  2M4G A;  1U5T B;  4IHW A;  3FKI J;  5D6E A;  2MA3 A;  2QSH X;  2RQQ A;  2WBM A;  2WV1 A;  2H09 A;  3F72 A;  4AUX A;  5HS8 A;  4ENN A;  3KZI C;  1IN5 A;  2IJL A;  4XRM A;  1JKO C;  1BC7 C;  2TCT A;  3GTJ J;  1HKQ A;  1P7I A;  2QQA A;  4E7H A;  2PN6 A;  3NQO A;  4XID A;  1G8X A;  2KLO A;  4KIF A;  5D5W B;  1Q1V A;  1MBF A;  1WH5 A;  3CCS I;  5ILV A;  2V6C A;  3MKZ A;  3FM5 A;  2DOE A;  3FBI B;  4FQG A;  4BXF A;  3ABL H;  1B9M A;  2BXZ A;  2BE5 F;  3R61 A;  2IXS A;  5BMZ A;  4G9Y A;  3IAM 2;  3OR2 C;  3LA7 A;  5BNG A;  5FLX K;  2HVS A;  2Y0S A;  1O57 A;  2E1M C;  2VQC A;  5DCM A;  1BIB A;  2W82 A;  4B1R A;  3PNY A;  4M3F A;  1IG7 A;  2GXG A;  1G3Y A;  3BRO A;  3H3U A;  5FKN A;  4ZDL A;  4HNT A;  2JPC A;  2M9H A;  1S7O A;  3E6B A;  3OY9 A;  1RUO A;  1WJB A;  4C2U A;  3N97 A;  2CYY A;  3OSF A;  4BJ6 C;  2FXA A;  1DU6 A;  2HQ5 A;  5IP9 J;  4UV8 A;  2R7S A;  1X1P A;  3RIR A;  2KIM A;  1N25 A;  1YIT I;  5IOY A;  2JSC A;  2CW0 F;  3LL7 A;  2RC4 A;  1S5L C;  2HDC A;  3WG7 H;  1MBK A;  2F4I A;  2STW A;  2UZK A;  3RYP A;  3I4N J;  1B72 B;  5IY5 H;  2XRO A;  2GQQ A;  2E1N A;  2FD5 A;  2K9S A;  3WTS C;  4HG2 A;  2PG4 A;  1RUN A;  2FUG 2;  2OAZ A;  4KIS A;  3DKX A;  2Z33 A;  1P6R A;  4UVC A;  1VQ8 I;  3KEO A;  2HKX A;  2CUJ A;  5FKL A;  4EQQ A;  3K70 D;  3I53 A;  1F9N A;  3R0J A;  5C4J J;  1SAN A;  1NH3 A;  2JMW A;  4LB6 B;  3SDB A;  3JRG A;  3H5R A;  4HOB A;  1AKH B;  3EYY A;  2DFI A;  4M71 A;  1YX3 A;  2RGV A;  1HQC A;  5IPA A;  1GLN A;  1VQ7 I;  2YX4 A;  2L02 A;  3JRD A;  1ON2 A;  4A3F J;  1ODD A;  3DTI A;  4IHX A;  2DFF A;  3M3Y J;  2HFH A;  2ESN A;  3NRV A;  4PGH A;  5J3L A;  2W4S A;  4BXU A;  4BE2 A;  1FYM A;  4Z2Y A;  2MC3 A;  5FFZ A;  5K5R A;  9ANT A;  3CCV I;  3BR1 A;  1L0O C;  5D5X B;  1BI1 A;  2VI6 A;  1RI7 A;  4N4N B;  4IOC F;  4LIV A;  4A12 A;  3HOV J;  2M0M A;  3HKZ N;  2WV0 A;  4G6D A;  4M72 A;  5IP7 J;  1VTN C;  3JR9 A;  4HSR A;  2OA4 A;  2UWM A;  3BQY A;  4YIR X;  1GHC A;  2BBY A;  4CSW A;  2HYG D;  3H5A A;  2VKE A;  4BKX A;  3I0T A;  3B6C A;  4A6E A;  1WH7 A;  2FQ4 A;  2QKM B;  2HXI A;  3WE2 A;  1UFM A;  1QVU A;  5IYB J;  1J9I A;  1MIJ A;  3OS0 A;  1ZR2 A;  2QYO A;  3FWE A;  1SVL A;  3FMR A;  2ME0 A;  1AWC A;  3GEZ A;  2MLK A;  1ORK A;  3BG6 A;  2LDU A;  4DBR A;  2VKV A;  3AG2 H;  4MFE A;  2EPF A;  3LSG A;  1T0F C;  2PJP A;  3FXU A;  1OR7 A;  1F5T A;  2JRM A;  3I59 B;  3W6J B;  1TT5 B;  2KJC A;  1ZAO A;  3HRT A;  3HTU A;  5D4S A;  1JJ6 C;  5FKK A;  2PJR A;  2D1V A;  4N0B A;  1R5H A;  3HTS B;  5HLI A;  1Z05 A;  3ECH A;  1X1C A;  1VQ9 I;  4FIS A;  1MMS A;  3UNG C;  5E79 C;  4LJZ F;  4P1W A;  2EH3 A;  2Y0S N;  2V9V A;  4L5J A;  2X1D A;  2KKO A;  4XLN F;  5GAG J;  2KRC A;  4I0A A;  1HDD C;  3EYI A;  2F6C A;  1P9Q C;  2FX0 A;  1T08 B;  5BS6 A;  2DDB A;  5JVG F;  4H4K C;  2QLZ A;  2MSY A;  1BJZ A;  3KP3 A;  2DA7 A;  3BG5 A;  3WHB A;  4KT5 C;  1ZAR A;  4KT6 A;  4EGY A;  2BY2 A;  4ZYG A;  3DKY A;  3K1N A;  4KNY A;  1K78 B;  1BC8 C;  3MKY B;  4I6Z A;  1UHS A;  2F4O B;  3BTI A;  5FLX Z;  1VQO I;  3K2Z A;  1YS6 A;  2H6C A;  3GZN B;  2F4M B;  4NC6 A;  1W1W E;  2EA2 A;  2MFZ A;  4NQW B;  5FLM J;  4O3M A;  3DV8 A;  4L5E A;  4M3E A;  2RN7 A;  3DTK A;  3OOP A;  2HDD A;  2VL8 A;  5E1X A;  2JA7 J;  2HDW A;  4W97 A;  2PX9 A;  3BY6 A;  4L0Z B;  4QWQ A;  1KGS A;  2FQ3 A;  4KJZ A;  1TQI A;  2YX7 A;  3TO9 A;  2Q2E B;  2M3A A;  1AA7 A;  2L9R A;  3JRH A;  2R7V A;  3BQZ A;  4B3X A;  2DT6 A;  1IUY A;  5ICF A;  3T0Y A;  2A6H F;  1OIS A;  2QA4 I;  3WGH A;  2JQ7 A;  2VB6 A;  3FHN A;  3IKT A;  4NB5 A;  1T33 A;  4JX4 A;  1E2X A;  1ETX A;  1Z77 A;  1T8I A;  3E5Q A;  5LHI A;  1Z3Y A;  3PFY A;  4Q5S F;  4IF4 A;  5JHU A;  3SHF A;  2W84 A;  1PUF A;  2F48 A;  3ECO A;  3H35 A;  4II2 A;  3V7S A;  3I56 I;  2L2O A;  4Y33 A;  1O7F A;  5BPD A;  2K3P A;  3KCC A;  4A3M J;  4JYK A;  2WY8 Q;  3REO A;  1EV7 A;  1H89 C;  1E3O C;  1YYV A;  1LFU P;  2VBZ A;  2DJN A;  2XGC A;  3LA2 A;  3ABM H;  4IRG A;  5HDN A;  4UVB A;  3BTC A;  3B73 A;  1QBJ A;  3E6C C;  4ZYD A;  2A3S A;  4U7D A;  4HX4 A;  4IHV A;  3M8J A;  1LJ9 A;  2FOW A;  2Y9Y A;  1GT0 C;  4PUS A;  5DCF A;  1EF4 A;  2LTP A;  4MFD A;  5HDG A;  1I3Q J;  4HV6 A;  3HUG A;  4EEF G;  4KIG A;  1WJ5 A;  2I5U A;  1YQA A;  3GTP J;  4Q4Z F;  4IVN A;  1Z21 A;  3F21 A;  1Y0N A;  4O6J A;  1KON A;  2EZL A;  1FOX A;  2XRL A;  3S3N A;  2X9D A;  1JTX A;  3ZMD A;  3EUH A;  2KMU A;  4JK1 X;  3I58 A;  2QEX I;  1Z9C A;  3CDH A;  2RVC A;  2FEZ A;  2K4J A;  4D7M A;  2R7W A;  1Z0X A;  2BEO A;  1R00 A;  3R6S A;  1K6O A;  5M5W J;  2L7F P;  1LKX A;  4BDZ A;  3TL4 X;  2BV6 A;  3SXY A;  1JXS A;  1S3J A;  1OKR A;  1DGW Y;  2ZJQ F;  1Y6I A;  5B1A H;  3BG3 A;  2M87 A;  5J1U A;  2DJI A;  4PJJ A;  3CC2 I;  3KIO A;  2CQQ A;  4C30 A;  2MG4 A;  3LAP A;  3ISP A;  2FU4 A;  1RPW A;  3W2V A;  3MKW B;  2F5D A;  2E34 A;  3EPZ A;  4AYB N;  1MBH A;  3M8E A;  1QZY A;  2DQR A;  3ASO H;  2K4B A;  4C2T A;  3C2B A;  1NG7 A;  2XDV A;  1SD7 A;  2BVL A;  1LDD A;  3K4M A;  2XC7 A;  2V1U A;  4KIT B;  3F8C A;  2LP0 A;  4DNC A;  5L3B A;  4D5C A;  3SEZ A;  3L2W A;  1RRJ A;  2HKO A;  3QYE A;  2BW3 A;  2E19 A;  1XMX A;  2NRA C;  5HVQ C;  3HL2 A;  4CZC A;  5JI6 A;  5FGM A;  2ICW G;  4L0Y B; 
#chains in the Genus database with same CATH homology
 2L9V A;  2KIQ A;  4FQG A;  1UZC A;  2KFD A;  2B7E A;  2JUC A;  2K85 A;  2LKS A;  2KIS A;  2CQN A;  2E71 A;  2DOF A;  2DOD A;  2DOE A;  2KZG A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...