2KIQA

Solution structure of the ff domain 2 of human transcription elongation factor ca150
Total Genus 12
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
12
sequence length
57
structure length
57
Chain Sequence
IMQAKEDFKKMMEEAKFNPRATFSEFAAKHAKDSRFKAIEKMKDREALFNEFVAAAR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Transcription elongation regulator 1
publication title High-resolution protein structure determination starting with a global fold calculated from exact solutions to the RDC equations.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transcription regulator
total genus 12
structure length 57
sequence length 57
ec nomenclature
pdb deposition date 2009-05-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01846 FF FF domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.440 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A FF domain 2kiqA00
4FQGA 2B7EA 2DOFA 2JUCA 1UZCA 2LKSA 2KISA 2KIQA 2E71A 2KZGA 2KFDA 2K85A 2DOEA 2L9VA 2DODA 2CQNA
chains in the Genus database with same CATH superfamily
2JWTA 2K86A 4HA8A 4A69C 3E0JB 3HOZJ 4IRHA 4KIFA 2HOAA 2X6WA 1JKOC 2DA2A 2JPBA 2CV2A 1BI1A 1VQ8I 4H4KC 1GXPA 3GFJA 4RB0A 4NHJA 1D1AA 4XN3A 1P92A 2Y0SN 3KIOA 1B8IA 4RB3C 3BR0A 3KP7A 4EV0A 2P81A 3TMOA 2CQNA 3KZYA 2A5WA 3TGNA 3C7JA 4Z2YA 3L1PA 1Y1VJ 1MSEC 5IOYA 1N77A 4CDGA 1U3EM 1Z3YA 1ZH5A 5F04A 2PLYA 3A02A 3DLAA 1QU3A 1R5ID 1J75A 2OU2A 4RB1A 4M9SA 2MLGA 2VBXA 5L3CA 2DTRA 5F08A 3BWGA 1FMVA 3G71I 5E8GA 3HHHA 4IHYA 1XGSA 3MZYA 3COAC 3LSIA 2CQXA 5KHDA 9ANTA 4YIRX 2VBYA 4DZPA 4A2UA 2HYFA 1BI2A 2HXOA 3G3ZA 4MEYF 4NUBA 1VNDA 4RAZA 4AU7A 2MC3A 2KJBA 4DOZA 3GX4X 1FTZA 4V19K 2QYOA 3E6BA 2JA6J 3DFGA 2Y0MA 2K4BA 2LD5A 2M3AA 5ICFA 3FXKA 4JX4A 1SFEA 2V1DA 2WY8Q 3HGYA 2ZB9A 4IL6C 5FLXZ 2EIMH 1H8AC 2UXXA 2IGNA 3AG3H 2NOGA 1ZGWA 1B1BA 2VT2A 4CYDA 2HDDA 4NC8A 2GA1A 3MKLA 3VEPA 2HPMA 4XLEA 5J1RA 3OYNA 2R7RA 3F9KA 5IY5H 4RA2A 3CUQB 1JE8A 2TCTA 5HLHA 5CQEA 2V9KA 3CP8A 1SMTA 1JJ6C 1E3OC 2GWRA 4G8XA 1OCTC 5DUKA 4ENKA 2K3FA 5HDNA 5GAHJ 2DTZA 2L9VA 3S1QJ 5CVIA 3HRUA 4FE4A 1Y0UA 3OIPA 3FMRA 1HDPA 2KIQA 4U0YA 3I54A 1KQ0A 2DI3A 5DTDA 4OIPF 2GOMA 3QAHA 2VJ5A 1NK3P 2PJRA 3C3WA 2X48A 2K85A 4AYBN 3ROUA 3RJPA 1H9GA 3HUGB 5FKOA 4O5VA 4PJJA 3OYFA 4A5NA 2IVMA 2JA2A 4F92B 4I76A 3L2WA 1GLNA 3KCCA 5HLTA 3U1KA 2O9LA 4L9NA 3QYBA 2CGPA 1Y56A 4OAZA 1XCBA 1X3ZB 1U0JA 1AKHA 3KZZA 1MDMA 5KNLA 4II2A 4FT8A 4DJAA 1T08B 3ZP5A 3ZQIA 4A3LJ 1HF0A 4KICA 3ONQA 3J81Z 4UV8A 4M9ZA 3IKVA 4JQFA 3OR1C 5HLIA 3U2RA 1MBJA 3OYKA 2LY1A 4M3EA 5DM6F 4KUMA 4GYIA 2L7MP 2OV7A 1LE8A 3CJRB 1WSUA 1Z67A 2FXAA 2Z1DA 4WF2A 1B72A 1ZN2A 2YS9A 4LIVA 1D5VA 3U21A 4C2TA 1BR1A 1MJBA 2BVLA 2W4SA 3ZMVA 3OYGA 4J00A 3QYFA 4IRGA 1YO5C 1MMDA 1WVRA 1O7LA 2DMQA 3FBNB 3F23A 2NVTJ 4J01A 3S15J 3FM3A 3Q0VA 4BQOA 4I0BA 1XPXA 2DMUA 2E71A 5D5XB 1AA7A 1JTYA 5CVJA 4FQGA 3M1EA 1Y8QB 4A3CJ 2HDCA 2H6BA 2OA4A 3GTMJ 3IAM2 3OSGA 4PGGA 2M30A 4XLFA 1TW3A 1YRNB 1T56A 4G6TB 2DPUA 1R4MB 2WC2A 2QLZA 5K5QA 4G7ZF 2JSCA 1R00A 1O3RA 1XDSA 1YLFA 4L0YB 2KDOA 3IHUA 4MGRA 2GZWA 3ABKH 2HFHA 2LF8A 1IUYA 2VJIA 4BBRJ 4CSWA 2IGMA 3E6DA 2F5EA 3KP5A 1D8KA 3CJTB 2BW3B 2QSHX 3WGGA 3OV8A 4M9XA 4NQWA 4WXDA 2PFBA 3DQVC 4RAGA 1TWGJ 5EG0A 2V9VA 3H0GJ 3B73A 4RDUA 4HEA2 2LMDA 1PDNC 5DDGA 1BIAA 1J7KA 3S2WA 2CV0A 1BN5A 4LFUA 4QIWN 5K7FA 3KE2A 2G0EA 5GTIC 2KMUA 3ZOBA 1OR7C 5ILVA 1RIOH 4F52A 1PYVA 1OYIA 5BS6A 2P5KA 1Q1VA 4ZZDA 2K9MA 1UELB 2VI6A 3IAS2 3BG3A 4UVCA 2HOSA 3CC2I 4U87A 2P0WA 2AS5F 5FO5A 3PNYA 4D7MA 4Y17A 4L9JA 2VKEA 3V8JA 2LRDA 4HG2A 2IGOA 2GOXB 3FXQA 1FZPB 4BJ5C 2DFHA 2MGQA 3GTKJ 4JYKA 1HSJA 3OS1A 1FLIA 1V5EA 2IA2A 2L01A 1JUSA 2HZDA 2ISYA 1FNNA 1U8RA 1VQ7I 4UUVA 2X1DA 2M9HA 1CQTA 3FX3A 3G4SI 2DK5A 3IH3A 1VQ5I 3R60A 3V8KA 3SDGA 4AIKA 4QPQA 5K5OA 4ENMA 3NAUA 2PJPA 2ESNA 3GCMA 3K70C 4HDUA 4MQVA 3FXJA 3JRHA 1FBUA 3E5QA 1PUFB 1K83J 3FMSA 3DBRB 4AC0A 3JAMZ 3BR1A 4BH9A 5J47A 1U9NA 2ID3A 3DEUA 3AG1H 2IAIA 2V9PA 4MLOA 5E3NA 4PZJA 2NS8A 4Q4ZF 3GYHX 2HYJA 1DUXC 2L4MA 1WGXA 2XVCA 3MMYB 4MO7A 1G6NA 1NG6A 3WTSC 2ME6A 5E17F 2FBIA 1A6QA 2X9DA 1ZHFA 4LMYA 1OR7A 5ILUA 5BPIA 5CLSA 3QU3A 2E19A 5JHUA 3DPTA 1F43A 4F7ZA 4N9IA 3L2UA 4G7OF 4BJ6C 3LSPA 4CCOA 3S3NA 1W0UA 1I27A 3CF5F 4GXOA 2OQRA 1ZG1A 4A3KJ 1R49A 5JLWA 2DOFA 1UG0A 5TGTA 3OS2A 5C4XJ 3Q9SA 2UV1A 3M07A 3LSJA 2OUMA 3L2RA 4I6ZA 4IHVA 3JW4A 4WX9A 1HKSA 4XNFA 4BHPA 1U6GA 4EM2A 4GYGA 5M5XJ 4PDKA 4UNOA 3CTAA 2OJED 3CUOA 3FXLA 5LGUA 5EF6A 4V2GA 2L7KA 2V4JC 3CUQC 3W6JB 3HKZA 1I3AA 1WI3A 4B3XA 4AD9A 4KN4X 5FRNA 1LDKB 2VJ4A 2E1CA 2E1NA 2ZMEB 1JUPA 4L5JA 3T8TA 3GLXA 5L3DA 4YELA 1G4DA 3ESWB 1IXRC 1VF9A 2JVGA 3PSIA 5D4RA 1UG2A 2DODA 4RLQA 3D5SC 3H9QA 4A3MJ 2WADA 3GTJJ 1KYZA 4EJOA 2NS0A 3O8GA 1A5JA 4XLCA 1SFKA 2PMUA 5HS9A 2ACJA 3R6SA 3E7LA 2R92J 2HS5A 5FKLA 2WAQA 4B09A 1X19A 3SXYA 2IA0A 1VQKI 2HXIA 3RQIA 1USSA 4XK4A 1SFXA 3SDBA 4YFXF 2LDUA 2LSOA 1ITYA 3A2KA 3OYEA 1MBEA 3TO9A 3JCUC 3GXOA 5AONA 2ZJPF 2JTVA 1O7FA 2KT0A 2Z16A 2XGCA 3G6EI 4AVPA 2OTJI 5K1YA 4A3IJ 2YSRA 1QGPA 3KEQA 3L09A 2KJCA 5DEQA 3L2QA 1QVTA 2N8GA 3R61A 3U1DA 1IXCA 1A36A 2EA2A 2ZKZA 1BOBA 3KPHA 4BHBA 3BG7A 2PN6A 2QF7A 2DT6A 3OIOA 3H92A 1RR7A 2ADUA 4M3DA 2M4KA 5JI6A 3V8LA 4XSXF 4B48A 3DP7A 3S16J 2VKDA 4UUTA 2V6EA 2V1UA 4A3BJ 4AVZA 1OKRA 3RTRA 2ZXWH 4BY1J 3CUQA 1LPQA 3AFHA 2XAJA 1O3QA 2PEXA 1P6RA 3MWMA 4IZZA 1EH7A 4E7KA 1FBQA 1MH3A 4XRFA 3BZKA 3CLQA 4HRIA 4ENJA 1QO0D 2B9SA 2XGEA 1UFMA 4IRIA 2BY0A 3LSTA 4EQQA 1ZYRF 1J2XA 1FYKA 4PJNA 3WU1B 1X4OA 3BZ6A 5KAIC 3VSKA 1G59A 5GPAA 2H1LA 2QKMB 1BW6A 1Y6IA 2LNBA 3O2PE 3TQNA 4L0ZB 3NWSA 1RUOA 4HX8A 2P6TA 3M4OJ 1OCCH 1SAUA 3GF2A 3HUGA 4B3AA 2H6CA 1FC3A 1UHSA 1T2KA 3MZ8A 2EPFA 1IGNA 2CUJA 5LEJA 2L9RA 2YX7A 2QGUA 2KRCA 2ZXJA 4A5MA 1OYYA 3DWLE 4UB6C 4U7BA 3H0DA 2F5DA 2PI0A 3H35A 2EFWA 5IP6A 2YX4A 4V2FA 3BQZA 2VXDA 4UY8I 4DGWB 2A6HF 5JLXA 3HSEA 3QP6A 2HWVA 3TOBA 2W48A 1W0TA 3TKYA 2AO9A 1YIJI 2Y9ZA 4CYCB 2EFQA 1R22A 1XMXA 2CW8A 1OCPA 3MD2A 2EILH 4NC7A 3X2QH 3ZMSA 1OQYA 4D1QA 2CYYA 2STWA 1RESA 2DOAA 3JTGA 2HPIA 3RPQA 5GPCA 3A0BC 2EZIA 2TDXA 3H5RA 4XBFA 2XAQA 2IGKA 5DCMB 1R4NB 4ZTFA 5D5WB 3EUHC 1NTCA 3VOEA 2LF7A 2WB1N 3QPSA 1APLC 3KZIC 2Y75A 4GO1A 1ZK8A 2DA7A 3M3YJ 1SEUA 2MH9A 2JN6A 3ISPA 2Y31A 3VDXA 3D1NI 1FSEA 1YRNA 1XGNA 5CJ9A 1R23A 3S3OA 3JRBA 4HF1A 1KQ8A 3VPRA 3S14J 2M8GX 4Y15A 4KIBA 5EZHA 4QPOA 2ISZA 3B02A 2RV8A 4CCMA 1PJRA 2LY9A 5LGTA 2NS7A 4I2OA 3RKXA 1TT0A 1RI7A 4IHWA 4IQJA 1SD5A 1B6AA 4Q47A 2BW3A 1WJCA 5KVRA 2BYVE 2XF5A 2E5ZA 4XL9A 2CUZA 3SQNA 1RPWA 3CCYA 1V54H 2DOEA 4P1WA 2L54A 5DYMA 2P7CB 4KNYA 1MJAA 3RQ4A 3DBLB 1V5FA 4MTDA 4G12A 4XLAA 3OYIA 2OD5A 2OBPA 1B9MA 1QZEA 1USTA 5E1WA 1O4XA 2JZYA 3BTJA 3IH2A 1FP2A 2P6SA 5CVRA 3UKGA 2HQAA 2ZXHA 3K4JA 1HDDC 5KK1A 1STZA 1EH6A 1OCRH 1FPQA 4N0BA 5EEGA 3PIPF 1EH8A 1YI2I 4G9YA 2DFIA 3I56I 1OJLA 4OMYA 4ASNA 3K70D 2V7FA 2COMA 3LSRA 1WRJA 5FB2A 5IP9J 4N4OB 3EUHA 3PIOF 2QEXI 2Z9OA 2QCOA 3BPXA 2AQFA 4N4NB 1RNLA 5E79C 4EJWA 5J1YA 3OWTA 4ZDLA 5IYBJ 3K4MA 4E7IA 3AL0B 4RM3A 3K7AJ 5HODA 1RC9A 5LHGA 1KU3A 4U7DA 2DFFA 5J4YA 1B9NA 1P9QC 3S1RJ 1FOKA 2ME0A 3CMEI 1H88C 2K3PA 2STTA 5LGNA 2QSGX 1X1AA 1KYWA 2R7DA 2ZMEC 5FFZA 1YOVB 1IRFA 3RPUA 3G2BA 3V7CA 1PUFA 3W2VA 1ZQ3P 3FXUA 5L3BA 2LTPA 2VQGA 4IVNA 1U5TB 4G7HF 1YHQI 2OAZA 5JVTA 4AWXB 1N25A 1DQUA 3BZCA 5L3FA 2DLLA 2EZHA 2LKPA 3QQAA 4IPAA 4KMUX 3LA2A 4FX0A 4HSTA 1ETQA 4B4CA 1FYMA 3ZMUA 3WG9A 4YFNF 4XQFA 4BQAA 4NBQA 4IHXA 1D3YA 1GT0C 3RDIA 1D0YA 4BY7J 4EATA 4QSHA 2CWEA 2IXSA 4IOAF 1ETKA 1QHGA 3JRFA 1A6IA 5K7ZA 2EJRA 1LDDA 3A01B 2GLOA 1TP4A 3C2HA 5E8IA 2OC6A 2DT5A 5E1ZB 3HRMA 2W82A 2A07F 2R93J 3QPTA 3BP8A 2VQCA 1JKQC 2AXTC 1L3LA 2VASA 3UR3C 2AHQA 5FGMA 2VODA 2B0LA 3CCJI 3LQRA 4F93B 3LAJA 5J3LA 3S17J 4B1RA 4ESFA 5EEAA 3EUAA 5DUIA 4BE0A 2ZJ2A 1YW8A 2ZMEA 1WH7A 5HLGA 5H20A 3IUOA 2YPRA 2W84A 4KFCA 3O6BB 4C3IJ 4EJTA 3BG6A 5L3GA 2JRMA 2M45A 3WHBA 4Y33A 3G1OA 5F1RA 3WGHA 1OLTA 1W7PB 1V5GA 2DYRH 1YJWI 1JGSA 1QHHD 1ETYA 2CG4A 4RGUA 3FM5A 3ECHA 2X1CA 2HYGD 2FOKA 4U88A 4UXNA 1T98A 1E3HA 2KRFA 2CV1A 1TQMA 2PMHA 2PX9A 3LOCA 2JUGA 1FT9A 1JT6A 2KFDA 3ZXSA 3KP3A 3ZGKA 2CUFA 1FEXA 4QTRA 2XPWA 3FHZA 4A3GJ 1ETWA 4ZZLA 1ZRDA 1BI0A 2IEKA 2MC4A 2UXNA 3W6KB 5ICCA 3DTEA 1LFUP 3C1DA 2HDWA 4A0ZA 4YFKF 4HLYA 2H8RA 4LIUA 2KPMA 4MFDA 5B1BH 1MBFA 2TRTA 1S7EA 3A1YA 1MMSA 2CH0A 3K69A 1FYLA 2NVQJ 3I9V2 3K10A 3KEOA 1TNSA 3CQZJ 2DPDA 1YW9A 2XROA 2JA8J 2R7XA 2HKXA 3E6CC 1AOYA 1F1ZA 4BKXA 2H09A 2PMZA 3L00A 3WHCA 2GXGA 3OOUA 1SD6A 1C0WA 1D8JA 5B3SH 1ZR2A 3WU2C 5HOOA 4JK1X 2BOLA 2IS6A 4BU2A 2XSJC 5HNFA 1PP7U 1LEBA 2PQ8A 1IV6A 3SFZA 1BBYA 3TW7A 2IPQX 2LOOA 3KYDB 1I1SA 2F4IA 2RN7A 2Y2ZA 3S32A 2EB7A 2DW4A 2V6CA 2O0YA 5D5UB 5LD2C 1L0OC 2KIMA 1FJLA 3P9IA 1D0ZA 1T6SA 3GTOJ 2CFOA 4S05A 3CDIA 1J5YA 1K4SA 1Z9CA 3FKIJ 4DZJA 5B66C 1Z91A 4BQQA 1MW7A 4IOCF 2QQAA 4Y7NJ 2DA1A 2YU3A 3CDHA 2QVOA 3JRIA 1Z77A 3HSFA 3LFKA 4R79A 4XIDA 4X6AJ 3E6MA 5F27A 1U2WA 4LJZF 2WTEA 1VQMI 1T0FC 5FLMJ 2JJ7A 2RGVA 1CF7B 1PVEA 3CCRI 2HVSA 4CCNA 1RRJA 4R8HA 2I10A 3GTQJ 2CQKA 1WQ2A 4CYCA 2F5CA 1VQ6I 3GVAA 1HCRA 5DD4A 4OWRB 3GUDA 3S1MJ 4LOCA 3IL2A 2VJJA 4X0GA 4G94A 3LSMA 3DEEA 4EGYA 2QQ9A 2XUBA 2VKVA 1X1DA 1MBGA 2A69F 3RKQA 2EQRA 3RPUD 5J40A 5DCMA 3M8FA 2OCCH 1KGSA 4P96A 2WV1A 2IA1A 5F0CA 3WU0A 1Z6TA 1U9OA 2ECBA 3ASNH 3AKZA 3CCMI 3CJQB 4IHTA 1TWHJ 5B5EC 1DGRM 1Z7LA 1W36C 3NEUA 4HPQA 3HYIA 1RKTA 4II3A 1IN4A 2L7ZA 4A6EA 3GWZA 2LY2A 3FBIB 3DBHB 3FWEA 3MEXA 3MKZA 4KA4A 4AIJA 3BPVA 1E2XA 3WGIA 1HOMA 1IRGA 3DTKA 2E2IJ 1ZGAA 3HB9A 1X3UA 4UVAA 2KZVA 1R71A 2RDPA 4G6DA 3IP4B 1IRZA 4XONA 2ETHA 5IT9K 1TQPA 4L5EA 4HDVA 1TTYA 4QWQA 1XD7A 5EGOB 2F5FA 1T8IA 4C3JJ 2D1HA 1I6XA 3G1LA 4YIFA 3LA7A 4OIRF 1EA3A 1T0FA 2CQ7A 4BL0B 2XASA 1U5TC 5IYCJ 3WG7H 3OMYA 1IDZA 4DQ2A 3I59A 2L7FP 3HG9A 5B1AH 2E1OA 2EINH 3LNQA 1V4RA 5IT3A 3ZMZA 2FE3A 2LC2A 1FSHA 2OPTA 4P9FA 3W3CA 2EH3A 2ZBKA 5A2QK 1O3SA 4UHTA 2OF7A 1Z0XA 2GQQA 4IJAA 3VWBA 4M6VA 2FSWA 3H3ZA 1IW7F 3SZPA 5HDKA 1VZ0A 3FHNA 4FISA 2JA7J 2VC0A 4OMZA 5FKKA 1F5TA 4PFPA 1O3TA 1R36A 1S5LC 4B47A 3ML6A 3HEFA 2R7WA 3R0AA 1MGTA 2E36A 1XS9A 2O03A 4BHCA 5LFAA 3ZPLA 2H27A 3OYDA 1JHHA 3MVPA 4BUPA 3CO7C 1P7IA 4OOIA 2Z5UA 3GEZA 3I53A 4AUXA 1R5GA 5DM7F 3BC8A 4BACA 1YE9A 1Y0NA 2W1OA 3WTUC 2X0LA 4IXAA 4IQ4A 3OR2C 4HX4A 2R7TA 5M5WJ 2J5OA 2KQRA 1FIAA 2W7NA 2R0QC 3CMMA 2LLKA 1IZ1A 3N05A 4BE1A 1JGGA 5C44J 4Y4RA 3J7ZI 1F9NA 3ECOA 4UB8C 1U5TA 1MD0A 4ZYDA 1TC3C 3RKYA 2E1MB 1I6HJ 5KAFC 2A68F 1R5HA 3ZQHA 1HQCA 5TJJA 1WJBA 3HHGA 4KJZA 4XLNF 3KYLA 1DU6A 3IC7A 4KIGA 1K78B 1ONVA 2HTJA 3V4GA 5JVGF 1K6YA 1F4KA 1GVJA 1TBXA 2CQQA 1T39A 3KETA 4M3BA 2V1NA 1G3SA 1JKPC 3GTPJ 4AIHA 2XB5A 3S2DJ 3OYMA 2M0CA 5H2FC 2CU7A 2XSDC 2DMNA 3BROA 3GW2A 4WXHA 3IH4A 4R1HA 2PBIA 2RQPA 2XAGA 2K7LA 3F72A 4BQNA 4HF2A 2E60A 1WJDA 3A01A 2O61A 1X2MA 1D0XA 3LQQA 3QODA 3V42A 1QNTA 3LSGA 4BGDA 5F1JA 1TNTA 4JOMA 5JHFA 3WTWC 1DDNA 2R5ZB 2KISA 2HR3A 2LBFB 4IF4A 1HXDA 3LA3A 1QPMA 4OINF 4XLPF 3S3MA 1ZRCA 1KONA 2PMZN 1ZG3A 5DS9A 3K6GA 4L9TA 2EIJH 2QQ8A 5FKNA 4Q5SF 3IRQA 3E97A 2IS4A 2NYXA 1UZCA 4LB6B 2UWMA 2E7WA 5K7HA 5F64A 3RZDJ 3ELKA 1B4AA 2ELJA 5FRMA 1IN7A 1FOYA 3J80K 3RSNA 1SMYF 4XKVA 5E20A 1HSTA 3EQLF 2DA4A 3FKJA 4NB5A 3ZQGA 1Z3XA 2VLAA 1W7PA 3KP6A 4DYCA 5JR3A 2XHKA 4ANJA 1W1WE 2EFOA 2J5PA 1AWCA 3ABTA 1JKRC 1BA5A 2L3DA 1IDYA 2Q1ZB 4L18B 4LLGF 1ERDA 2G7HA 2DA5A 2M4GA 3ZMDA 4W1UA 3OL3A 1P2FA 2CRGA 3LMMA 4LG3A 2QA4I 3TDUC 3OYCA 1HLVA 3I3LA 5ERIA 4A12A 1SFOJ 1NH3A 1ETXA 2MBFA 4ON0A 1FIPA 1I1GA 2D2WA 4I99C 5GAEJ 2AXLA 1FOWA 4BEHB 3GZ6A 1BR2A 3DKYA 1MKMA 2BEOA 1IG7A 2XRLA 2FBKA 4D5CA 1YJ9I 4A0YA 2VIXA 1QA6A 5E3OA 4FCYA 2DFEA 1X4PA 2K02A 1X3WB 2F4OB 4ABZA 1ENHA 3BCAA 4NDLA 1K4TA 2FMLA 2LKXA 2VONA 1BI3A 3O3KA 2RKHA 1IV8A 3CESA 2Y0SA 4JP0A 1Q1HA 3GFMA 2OZ6A 2Z33A 4IO9F 3B6CA 4EVIA 4CCJA 2DBBA 2DDAA 2DAOA 3BR2A 3H3VK 3D5LA 4KISA 1XMAA 4KITB 4JX5A 3VSLA 2HQRA 3JREA 2K40A 3GO5A 1G3TA 3K4CA 1Y8RB 2DT7B 1EF4A 3F8BA 5CYVA 2R3SA 3J7AY 1WI9A 3JRCA 4M3FA 2DJNA 3DLLF 4LGWA 2H94A 4KT5C 1KU9A 2MG4A 2KIFA 2XAHA 3HIFA 4GCVA 3DU6A 3OSFA 3GFIA 2UUZA 3DKXA 3ERED 3DXJF 3KLNA 1EV7A 2EZLA 4G6QA 2EV6A 4Q48A 2HI3A 2X6YA 3W2WA 1JI8A 2M8EA 2OCEA 1S6LA 3SHFA 4CHUA 1MIJA 1R7JA 3I4MJ 2EFNA 1K79A 3Q0WA 2O7OA 4ETSA 1BL0A 2MH2A 2EFPA 2XPUA 3C2BA 1IC8A 1H9TA 4U0VA 1W36D 3QPLA 3M8JA 1CF7A 2WA0A 2JSPA 3PM1A 1SD7A 1T33A 3R4KA 2COBA 4XRSA 1UHMA 2MABA 1S7OA 3G1MA 3MCZA 2OTLI 1ULYA 2XF7A 2LG4A 3HL2A 2R4GA 4XN0A 2X4HA 1LFBA 4O3MA 3MZHA 4OIOF 2QUFA 2W57A 2DN0A 5GAGJ 5ICEA 3HDDA 4FHTA 2HOTA 3KP4A 2LH9A 1N75A 2DA6A 4E7JA 4BS9A 4XM3A 2D5VA 1XC5A 3S2HJ 1KZHA 3CJNA 1IF1A 3EETA 2LYCA 1ETVA 1TWFJ 2CSOA 2EBIA 1JTXA 4EM1A 3P7NA 5J6XA 2ECCA 3S93A 1G3WA 3ZRGA 3VYTB 3RI4A 4EEFG 3W6VA 2E2HJ 5IYDJ 1DU0A 4AYBA 4IX7A 1MNEA 1BW5A 5TISC 3BTLA 1Z6RA 3ERMA 2M0MA 2NVUB 2DJIA 5DV5A 2KIUA 2HOEA 4AM3A 4S0HB 2BHZA 2MSYA 1FTTA 3Q5FA 1XB4A 2YR2A 3K4KA 3F6OA 4A3FJ 4PJMA 4PFOA 2PG4A 2KDZA 2WAEA 2GBYA 3T1BA 3VYRB 1DGWY 3AG2H 4Z6YA 4ESBA 2X6XA 5ICGA 2IRFG 2Y69H 4RLFA 3HTUA 4RB2C 1TLHB 3KP2A 1H89C 3V7RA 2E1MC 3ZCOA 3K9TA 2BHYA 4HV5A 2DCEA 3ZN1A 2FF4A 1A35A 3PO3J 1SFUA 3FISA 1J0RA 3J7YJ 2X51A 2QSFX 1FBSA 2VBWA 1ZG5A 2HTSA 3PSFA 2K9QA 3OYLA 5FD6A 1ETOA 3DF8A 4BAYA 5BQTA 4LG0B 3CCEI 2IJLA 2F2EA 3C18A 5K5RA 3I0TA 4HNUA 1W7PD 2QZ8A 1UAAA 2JQ7A 3FXRA 4HSRA 2R7SA 1A31A 3ZMTA 2WAFA 3FZVA 2FQ3A 5IT9Z 2X1EA 2LREA 3K4NA 4LITA 1SC7A 3EUKL 1I39A 2BE5F 3HKZN 1LVKA 2VE9A 3HRTA 3Q3SA 1QRYA 3QP5A 3UNGC 4NNJA 3VYSB 2HU9A 3L9FA 3I64A 4KT6A 1ZAOA 4F91B 1U8BA 3ZQCA 3PFYA 4M71A 4PK4A 1D1BA 5D8LB 3KLOA 4XKCA 4FTHA 1E3PA 5A2QZ 1RR8C 1U78A 3EPZA 3HOXJ 4RGRA 1NK2P 3GZ5A 3HPGA 3AAFA 2IT0A 1WH5A 2O8XA 1DP7P 2OQGA 2XKPA 3PQJA 2WAQN 3R0JA 2L9NA 5IOZA 3WODF 4EJVA 3OY9A 1K78A 2I8DA 4IHSA 2RNJA 4CCLA 1BJZA 2DMTA 2QWWA 1XN7A 4LB5A 4EM0B 2CS3A 2W85A 1SD4A 1XMKA 4P55A 4E7HA 5GADJ 3OOPA 5GP9A 4PCQA 3SZGA 1UB9A 4I01A 2VPRA 1LFPA 2RREA 3QPHA 3H9GA 3MQ0A 4K2EA 1X1PA 1IN6A 2A5YB 1X1BA 1WCMJ 2F48A 3EYYA 4IEJA 1IN8A 2M1BA 4UUSB 2LBFA 3K4LA 2R5ZA 2KRHA 1K6OA 3HJEA 2NRAC 5EZGA 1LQ1A 1ZLKA 2L2OA 3L7WA 2EV0A 4EJUA 1BC7C 2E5NA 3BDDA 1G2HA 3OL4A 2M5WA 3RKWA 2HQ5A 5KCMA 2QBYB 1MMGA 4MHGA 3F8NA 3PNVA 2A6EF 4E7LA 3U9GA 3E1SA 3SFIA 2K27A 1EKEA 4MFEA 3T0YA 4KN7X 2EK5A 1GXQA 1MMNA 5AIPA 1ZKGA 2QQBA 1G3YA 3TL4X 4C9YA 2E35A 4CO8A 3PQKA 3K1PA 2XKOA 1ZLJA 1VFCA 2DQRA 5F6FA 3H9JA 4HAMA 4OU0A 1JJ8C 3I4PA 2NXNB 3P9KA 3QU6A 5CKTA 1IUFA 4LK0F 5EYRA 3FK6A 3N97A 4BNCA 4YG2F 3F21A 2JRTA 1GHCA 6PAXA 1Z1DA 3DCFA 3IWZA 1XCVA 1FMWA 1GUUA 5D6FA 1XSDA 4HNTA 3F3XA 1YTYA 3ZQFA 4P5OA 4ZC3A 2MLKA 3GMEA 2HGCA 4BEHA 2CW7A 3PL8A 3TOAA 1WZ2A 1R1VA 2O8KA 2K9NA 2F6CA 2P5VA 4KYWA 4ZTJA 1ODDA 4C2UA 2R7ZJ 1YX5A 3J80Z 1W5SA 2ESHA 2D45A 1A04A 2WY7Q 3E5XA 4U0WA 3WTVC 4D5FA 1FP1D 4A93J 3HZJA 2BZTA 2H8WA 5LLQA 1WFXA 1TL8A 1Y1WJ 3WTYC 4RBOA 1JUMA 2WBMA 3E5UA 2ZJQF 2MFZA 3QOPA 1GDTA 3GTLJ 1UJ8A 4I7HA 3FDYA 3HOSA 4DIQA 4HV6A 4WWCA 4A3EJ 2FX0A 2FNPA 2GM4A 4BDYA 2QENA 1MMAA 3F8CA 3JTHA 3QOEA 1VTNC 2CW0F 2M7BA 4HBLA 1HKTA 2KKOA 3FXMA 4MIMA 5BNGA 5D8KB 2Z2SB 3VFZA 2W24A 3LL7A 4BXFA 3SEZA 1YS7A 1W5TA 1YITI 5CVVA 2QM3A 3CMAI 4DYQA 1CGPA 1Z21A 2Q0OA 1OCOH 2ZCWA 1I5ZA 3PO2J 2VN2A 2R5YB 3CCVI 2FNAA 1BOAA 1RKWA 4HQEA 3NWTA 4GDFA 1ZREA 2DQLA 4A0XA 4XKWA 2NOJB 4B43A 4YRVA 1P4AA 4WXCA 2NNNA 3WE3A 3GFLA 2JPCA 5HS7A 3HGGA 3TP3A 4HW0A 2E34A 1ZGJA 4JBAA 3FF5A 1H0MA 2KLOA 5HVQC 4W97A 3QWLA 4NC6A 5LHHA 3JSPA 2DO7A 1Y39A 3TP0A 2VC1A 1UCRA 2FEZA 1YIOA 3ABLH 2FU4A 2HQNA 3GLLA 1KA8A 3OYJA 1D5YA 2Q2EB 2ZSHB 2M34A 1DPUA 5FD5A 2XGXA 2XV4S 2HKOA 3C2GA 3AL0C 4MQ9F 2VE8A 4EMSA 4KMFA 3E3VA 4LK1F 3I58A 3DTIA 5CQGA 1O57A 2CFXA 3IKTA 3ZQLA 3LFUA 3Q9VA 5LRRA 3BLYA 3WTTC 2E2JJ 1E0EA 3DPLC 3F8FA 2FQ4A 1LKXA 3HXLA 3MFKA 3PFIA 5M5YJ 1KQ9A 1HBXG 3OYHA 2O3FA 3H1CA 1YJNI 2BY1A 4M6XA 4FE7A 4X1EA 5CVUA 3HOTA 1ZARA 5LEKA 3KFWX 2RC4A 2X85A 5D4SA 5E3LA 2DXIA 3IV5A 1LB2A 3I71A 1N78A 3DV8A 3M7GA 4XICA 1IJWC 2H1KA 3BG5A 4XORA 3DEWA 1SANA 3LWFA 4LLLA 3K4BA 3CCUI 2XB0X 2BXYA 5BPDA 1REPC 4Y13A 3OYAA 3CDLA 1MH4A 1R6RA 4XR6A 2YU9J 2Y9YA 2R7FA 3H5NA 2FBHA 1VQNI 4JX6A 5J1UA 4ZYAA 3OS0A 1WPKA 5E18F 5FLVA 3GTGJ 2GAUA 2ID6A 2HNHA 5FKMA 4CA0A 1OMIA 1RZ4A 2M2EA 5M3FJ 1XGMA 1DPRA 4XMYA 3WTZA 1R58A 5GTHC 5AIQA 4LG0A 3HC7A 2OZUA 2IW5A 3EDPA 1ACIA 2BV6A 3HPHA 2WB1A 3K1NA 4C2MJ 2EZKA 4RS8A 1OPCA 3BR5A 2IS1A 1J09A 4M74A 4XSZF 4OAYA 2JMWA 4GGGA 1S3JA 1VI0A 5H6RA 2BVMA 3F22A 1S29A 1P4XA 1ON2A 4HOBA 3HBLA 5HDGA 2NVXJ 4I02A 4B8XA 1RETA 1MBHA 2A61A 2NVYJ 4KDPA 2ZFUA 2GIZA 3NQOA 4LLNA 3F0CA 4PSXA 2R7VA 4MNUA 4CZCA 4OIQF 1HW5A 2BGCA 2V1XA 2JK3A 2XAFA 3BJAA 4P9UA 2EIKH 3DPUA 2ZNYA 4M72A 1EJ9A 1K7AA 1WHUA 5J8FA 4Y52J 2G7UA 1YS6A 4HQMA 1LDJA 3ZN0A 2ICWG 4CICA 3SYTA 2WWYA 4YEJA 2NAZA 4PJ0C 4M6YA 3I55I 1LEAA 4UV9A 2VL8A 2KP6A 2CUEA 1M1EB 3CO6C 1HW1A 2LVSA 4N9HA 2XIGA 4HZFA 2R7QA 2BY3A 3TEDA 1VQ4I 2CMPA 3VODA 2ZSIB 3DU5A 3RCOA 4GFBA 3K2AA 3HM5A 4FASD 3HOYJ 1BC8C 1BJAA 3BY6A 4E4HA 5D6EA 4C30A 3ASOH 2XRNA 1J9IA 1X2NA 4BBSJ 3N4MA 2MA3A 2RNGA 2A3SA 5HS8A 3S1NJ 1B59A 2GA2A 4UUSA 4PSWA 2B63J 2XF6A 1GV5A 1FX7A 2ZO4A 4ZDPA 2VPLA 4I98B 4M73A 1G8XA 2MD5A 4TV7A 2K9SA 3I5UA 3SJMA 1B8IB 3BTCA 3KEYA 4E6KG 2R7OA 4WCGA 2QBYA 3BCBA 2DMPA 5BOXA 4XLHA 4D0PA 4DBRA 5FLXK 4AIDA 5L3EA 4S04A 5JFRA 3TBIA 4BE2A 1YFHA 2HEOA 2IS2A 2BBYA 3KYCB 3TO6A 1R1TA 3BQYA 4E7SA 4PUSA 3OIQA 1V3FA 1YYVA 2ZFWA 1IXSB 3F8MA 1JXSA 1XGOA 4PGHA 3GZNB 3ABUA 1TZLA 1VQ9I 4ENNA 2VQHA 4XRSG 5E1XA 3W2AA 1POGA 5D5VB 4UVBA 4ZDOA 1R9TJ 3HSRA 3K2ZA 2L5QA 2DU9A 2Z3YA 3D0SA 2M7AA 4J19A 3JRAA 1S72I 1WJAA 3B6AA 2CJJA 3RYPA 3V7SA 3Q0UA 3PUBA 1PP8F 4MTEA 4O6JA 1OCZH 4A3JJ 2EWNA 2FJ1A 2FMYA 3GBGA 1XTAA 2KL4A 4HLXA 2RQQA 4F55A 1SAXA 1J59A 3A0HC 1S8NA 4ZH4F 1NHAA 2AQEA 1WJ5A 3A4CA 2XAUA 1X1CA 2JUCA 4RAFA 5TRDA 1I50J 2IBDA 2DYSH 2QKLB 4DNCA 1IAWA 2VB6A 1PUEE 2W00A 3F6VA 5DCFA 1UHWA 2UZKA 1JT0A 3L2CA 5LHIA 1XSVA 3PJRA 2LK2A 3VB2A 2HVRA 2RVCA 5EJCA 5HNHA 3J81K 1KU7A 3K1MA 5IP7J 4WK8F 3MN2A 2VOPA 1QZZA 3QRFF 1OISA 2VKHA 3LSKA 2P4WA 2P7VB 3BG9A 1ZRFA 2VOOA 3BR6A 4EGZA 1HC8A 4ITVA 1XDUA 2XPVA 1QQIA 1DP3A 1LNWA 3IWFA 1FY7A 2KZGA 4GRIA 2PJRB 2GXBA 1S7AA 3L2VA 3OYBA 3M1CA 4ZYHA 5J4VA 4L9VA 3M9AA 3IRRA 1TW2A 4F3QA 2DA3A 2MYSA 1IRXA 4CH7A 5CPRB 2ZNZA 5H6QA 4A6DA 3BJ6A 3CZ6A 4XOPA 1S9HA 4FX4A 3NRVA 4CGZA 1LUJB 1MSFC 3HRSA 3PNTA 5J8CA 3FIWA 2R5YA 1Z05A 2V26A 3H3UA 4RM2A 1AKHB 1MDMB 3LSHA 2ELKA 1MNMC 4ESJA 5IPAA 2LR8A 3MAJA 1TT5B 3J7AO 2O5RA 1GVDA 4ZYGA 1LJ9A 3G73A 2FD5A 2JA5J 2JT1A 2MD0A 2DDBA 4QLCU 4RMNA 1ZR4A 2L9SA 4A3DJ 3CCQI 5ILSA 4CCKA 2M87A 2P8TA 5F0HA 2JVHA 3SZTA 5DD8A 3BJOA 5ED4A 1LE8B 2XGDA 1MNDA 3CLOA 4YIIA 1OYWA 4IKFA 3T8RA 1B72B 4LD5A 3MKWB 1WWXA 2CO5A 3SEQA 4HYEA 3CCSI 1QPIA 2Q2EA 4DBQA 1FWZA 2BY2A 5EDNA 4BJTA 3JSOA 4I0AA 1VQPI 3CMYA 3JRGA 2B7EA 3TO7A 2LP0A 1BIBA 5FJ8J 5C3EJ 3O8HA 2FA5A 1YG2A 2IP2A 2Q8KA 1LVAA 1K61A 2C6YA 2FRHA 2F4MB 1V55H 2G9WA 4FETA 2LKSA 1SVLA 3M8EA 3D5RC 2FUG2 1WKMA 2W25A 5M3MJ 3CP2A 2GXAA 1UMQA 3HOVJ 2R7UA 2HVQA 5EGOA 4HF0A 4E70A 2NNYA 1AU7A 3PUFA 3EYIA 5C4JJ 4ZJZA 3TW6A 1P7JA 3BOQA 1KU2A 4NQWB 1WJEA 4D9JA 1VQLI 1ON1A 1ZELA 4D7NA 3A03A 1IN5A 3P9CA 1SVMA 1TQIA 4ZYEA 1GV2A 2FOWA 2K5CA 3FXOA 3REOA 5EG0B 2O6GE 3I4NJ 2ZC2A 3ZQQA 3CD6I 5FFXA 2VUMJ 1BM9A 2VXZA 1BR4A 4HNVA 1JHFA 1W5CC 2L02A 2K4JA 2VQLA 3ABMH 3RYRA 3I59B 5LRSA 4XKBA 3FK7A 3HOUJ 3HOWJ 1X58A 1HKQA 2BXZA 2LFBA 3JAMK 4RGSA 1NG7A 1FOXA 1YW7A 2F5VA 1HW2A 1YQAA 4CXFA 3S8PA 4XRMA 3BTIA 4HX7A 1AHDP 1MZBA 3H36A 3LAPA 2ZXIA 4MEXF 1W4MA 2RAEA 3MKYB 2GIVA 4DYRA 1QVUA 3CCLI 5E3MA 3RIRA 1QZYA 4BXXJ 2XC7A 1MBKA 1HA8A 2DK8A 3QYEA 3K0LA 2VT3A 5EEHA 3CC4I 4PJLA 2K9LA 3KX2A 2D1VA 4Y3OA 2A6TA 1E17A 3BT9A 3ZR8X 4BYYA 1SVOA 2L0KA 4E7ZA 2L4AA 1QBJA 4B44A 1Z7UA 2EV5A 1MJ9A 4BXUA 3DKWA 2MW8A 5FROA 5LBQA 3WE2A 5BMZA 4CZZA 3JR9A 1I3QJ 2P5LC 4H0EA 3VYUB 2ZJRF 2A05A 2ELHA 1TWCJ 2XDVA 3NARA 3CC7I 3TDZC 2Z99A 1YX3A 1T95A 1OFCX 1ZTRA 1RUNA 4RAYA 4M3GA 3FMQA 2VBZA 4RGXA 1WJFA 3CF2A 4DW6A 2EA4A 1R1UA 3ULQB 2Y30A 3P5JA 2E7XA 1VQOI 3H5AA 2KHMA 3ZQ7A 4BDZA 3HTSB 4L5IA 3T5XA 2HZTA 3JRDA 1ORKA 1F36A 3WTXC 1XSXA 1XX5A 1D1CA 4CUGA 4I09A 2Y48A 1TWAJ 2V79A 3AG4H 3BR3A 1XG1A 1IO2A 1P4WA 2I5UA 2X6OA 2YUSA 4C3HJ 3RZOJ 2WV0A 1T38A 5F0FA 4XOTA
chains in the Genus database with same CATH topology
4FQGA 2B7EA 2DOFA 2JUCA 1UZCA 2LKSA 2KISA 2KIQA 2E71A 2KZGA 2KFDA 2K85A 2DOEA 2L9VA 2DODA 2CQNA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4FQG A;  2B7E A;  2DOF A;  2JUC A;  1UZC A;  2LKS A;  2KIS A;  2KIQ A;  2E71 A;  2KZG A;  2KFD A;  2K85 A;  2DOE A;  2L9V A;  2DOD A;  2CQN A; 
#chains in the Genus database with same CATH topology
 2JWT A;  2K86 A;  4HA8 A;  4A69 C;  3E0J B;  3HOZ J;  4IRH A;  4KIF A;  2HOA A;  2X6W A;  1JKO C;  2DA2 A;  2JPB A;  2CV2 A;  1BI1 A;  1VQ8 I;  4H4K C;  1GXP A;  3GFJ A;  4RB0 A;  4NHJ A;  1D1A A;  4XN3 A;  1P92 A;  2Y0S N;  3KIO A;  1B8I A;  4RB3 C;  3BR0 A;  3KP7 A;  4EV0 A;  2P81 A;  3TMO A;  2CQN A;  3KZY A;  2A5W A;  3TGN A;  3C7J A;  4Z2Y A;  3L1P A;  1Y1V J;  1MSE C;  5IOY A;  1N77 A;  4CDG A;  1U3E M;  1Z3Y A;  1ZH5 A;  5F04 A;  2PLY A;  3A02 A;  3DLA A;  1QU3 A;  1R5I D;  1J75 A;  2OU2 A;  4RB1 A;  4M9S A;  2MLG A;  2VBX A;  5L3C A;  2DTR A;  5F08 A;  3BWG A;  1FMV A;  3G71 I;  5E8G A;  3HHH A;  4IHY A;  1XGS A;  3MZY A;  3COA C;  3LSI A;  2CQX A;  5KHD A;  9ANT A;  4YIR X;  2VBY A;  4DZP A;  4A2U A;  2HYF A;  1BI2 A;  2HXO A;  3G3Z A;  4MEY F;  4NUB A;  1VND A;  4RAZ A;  4AU7 A;  2MC3 A;  2KJB A;  4DOZ A;  3GX4 X;  1FTZ A;  4V19 K;  2QYO A;  3E6B A;  2JA6 J;  3DFG A;  2Y0M A;  2K4B A;  2LD5 A;  2M3A A;  5ICF A;  3FXK A;  4JX4 A;  1SFE A;  2V1D A;  2WY8 Q;  3HGY A;  2ZB9 A;  4IL6 C;  5FLX Z;  2EIM H;  1H8A C;  2UXX A;  2IGN A;  3AG3 H;  2NOG A;  1ZGW A;  1B1B A;  2VT2 A;  4CYD A;  2HDD A;  4NC8 A;  2GA1 A;  3MKL A;  3VEP A;  2HPM A;  4XLE A;  5J1R A;  3OYN A;  2R7R A;  3F9K A;  5IY5 H;  4RA2 A;  3CUQ B;  1JE8 A;  2TCT A;  5HLH A;  5CQE A;  2V9K A;  3CP8 A;  1SMT A;  1JJ6 C;  1E3O C;  2GWR A;  4G8X A;  1OCT C;  5DUK A;  4ENK A;  2K3F A;  5HDN A;  5GAH J;  2DTZ A;  2L9V A;  3S1Q J;  5CVI A;  3HRU A;  4FE4 A;  1Y0U A;  3OIP A;  3FMR A;  1HDP A;  2KIQ A;  4U0Y A;  3I54 A;  1KQ0 A;  2DI3 A;  5DTD A;  4OIP F;  2GOM A;  3QAH A;  2VJ5 A;  1NK3 P;  2PJR A;  3C3W A;  2X48 A;  2K85 A;  4AYB N;  3ROU A;  3RJP A;  1H9G A;  3HUG B;  5FKO A;  4O5V A;  4PJJ A;  3OYF A;  4A5N A;  2IVM A;  2JA2 A;  4F92 B;  4I76 A;  3L2W A;  1GLN A;  3KCC A;  5HLT A;  3U1K A;  2O9L A;  4L9N A;  3QYB A;  2CGP A;  1Y56 A;  4OAZ A;  1XCB A;  1X3Z B;  1U0J A;  1AKH A;  3KZZ A;  1MDM A;  5KNL A;  4II2 A;  4FT8 A;  4DJA A;  1T08 B;  3ZP5 A;  3ZQI A;  4A3L J;  1HF0 A;  4KIC A;  3ONQ A;  3J81 Z;  4UV8 A;  4M9Z A;  3IKV A;  4JQF A;  3OR1 C;  5HLI A;  3U2R A;  1MBJ A;  3OYK A;  2LY1 A;  4M3E A;  5DM6 F;  4KUM A;  4GYI A;  2L7M P;  2OV7 A;  1LE8 A;  3CJR B;  1WSU A;  1Z67 A;  2FXA A;  2Z1D A;  4WF2 A;  1B72 A;  1ZN2 A;  2YS9 A;  4LIV A;  1D5V A;  3U21 A;  4C2T A;  1BR1 A;  1MJB A;  2BVL A;  2W4S A;  3ZMV A;  3OYG A;  4J00 A;  3QYF A;  4IRG A;  1YO5 C;  1MMD A;  1WVR A;  1O7L A;  2DMQ A;  3FBN B;  3F23 A;  2NVT J;  4J01 A;  3S15 J;  3FM3 A;  3Q0V A;  4BQO A;  4I0B A;  1XPX A;  2DMU A;  2E71 A;  5D5X B;  1AA7 A;  1JTY A;  5CVJ A;  4FQG A;  3M1E A;  1Y8Q B;  4A3C J;  2HDC A;  2H6B A;  2OA4 A;  3GTM J;  3IAM 2;  3OSG A;  4PGG A;  2M30 A;  4XLF A;  1TW3 A;  1YRN B;  1T56 A;  4G6T B;  2DPU A;  1R4M B;  2WC2 A;  2QLZ A;  5K5Q A;  4G7Z F;  2JSC A;  1R00 A;  1O3R A;  1XDS A;  1YLF A;  4L0Y B;  2KDO A;  3IHU A;  4MGR A;  2GZW A;  3ABK H;  2HFH A;  2LF8 A;  1IUY A;  2VJI A;  4BBR J;  4CSW A;  2IGM A;  3E6D A;  2F5E A;  3KP5 A;  1D8K A;  3CJT B;  2BW3 B;  2QSH X;  3WGG A;  3OV8 A;  4M9X A;  4NQW A;  4WXD A;  2PFB A;  3DQV C;  4RAG A;  1TWG J;  5EG0 A;  2V9V A;  3H0G J;  3B73 A;  4RDU A;  4HEA 2;  2LMD A;  1PDN C;  5DDG A;  1BIA A;  1J7K A;  3S2W A;  2CV0 A;  1BN5 A;  4LFU A;  4QIW N;  5K7F A;  3KE2 A;  2G0E A;  5GTI C;  2KMU A;  3ZOB A;  1OR7 C;  5ILV A;  1RIO H;  4F52 A;  1PYV A;  1OYI A;  5BS6 A;  2P5K A;  1Q1V A;  4ZZD A;  2K9M A;  1UEL B;  2VI6 A;  3IAS 2;  3BG3 A;  4UVC A;  2HOS A;  3CC2 I;  4U87 A;  2P0W A;  2AS5 F;  5FO5 A;  3PNY A;  4D7M A;  4Y17 A;  4L9J A;  2VKE A;  3V8J A;  2LRD A;  4HG2 A;  2IGO A;  2GOX B;  3FXQ A;  1FZP B;  4BJ5 C;  2DFH A;  2MGQ A;  3GTK J;  4JYK A;  1HSJ A;  3OS1 A;  1FLI A;  1V5E A;  2IA2 A;  2L01 A;  1JUS A;  2HZD A;  2ISY A;  1FNN A;  1U8R A;  1VQ7 I;  4UUV A;  2X1D A;  2M9H A;  1CQT A;  3FX3 A;  3G4S I;  2DK5 A;  3IH3 A;  1VQ5 I;  3R60 A;  3V8K A;  3SDG A;  4AIK A;  4QPQ A;  5K5O A;  4ENM A;  3NAU A;  2PJP A;  2ESN A;  3GCM A;  3K70 C;  4HDU A;  4MQV A;  3FXJ A;  3JRH A;  1FBU A;  3E5Q A;  1PUF B;  1K83 J;  3FMS A;  3DBR B;  4AC0 A;  3JAM Z;  3BR1 A;  4BH9 A;  5J47 A;  1U9N A;  2ID3 A;  3DEU A;  3AG1 H;  2IAI A;  2V9P A;  4MLO A;  5E3N A;  4PZJ A;  2NS8 A;  4Q4Z F;  3GYH X;  2HYJ A;  1DUX C;  2L4M A;  1WGX A;  2XVC A;  3MMY B;  4MO7 A;  1G6N A;  1NG6 A;  3WTS C;  2ME6 A;  5E17 F;  2FBI A;  1A6Q A;  2X9D A;  1ZHF A;  4LMY A;  1OR7 A;  5ILU A;  5BPI A;  5CLS A;  3QU3 A;  2E19 A;  5JHU A;  3DPT A;  1F43 A;  4F7Z A;  4N9I A;  3L2U A;  4G7O F;  4BJ6 C;  3LSP A;  4CCO A;  3S3N A;  1W0U A;  1I27 A;  3CF5 F;  4GXO A;  2OQR A;  1ZG1 A;  4A3K J;  1R49 A;  5JLW A;  2DOF A;  1UG0 A;  5TGT A;  3OS2 A;  5C4X J;  3Q9S A;  2UV1 A;  3M07 A;  3LSJ A;  2OUM A;  3L2R A;  4I6Z A;  4IHV A;  3JW4 A;  4WX9 A;  1HKS A;  4XNF A;  4BHP A;  1U6G A;  4EM2 A;  4GYG A;  5M5X J;  4PDK A;  4UNO A;  3CTA A;  2OJE D;  3CUO A;  3FXL A;  5LGU A;  5EF6 A;  4V2G A;  2L7K A;  2V4J C;  3CUQ C;  3W6J B;  3HKZ A;  1I3A A;  1WI3 A;  4B3X A;  4AD9 A;  4KN4 X;  5FRN A;  1LDK B;  2VJ4 A;  2E1C A;  2E1N A;  2ZME B;  1JUP A;  4L5J A;  3T8T A;  3GLX A;  5L3D A;  4YEL A;  1G4D A;  3ESW B;  1IXR C;  1VF9 A;  2JVG A;  3PSI A;  5D4R A;  1UG2 A;  2DOD A;  4RLQ A;  3D5S C;  3H9Q A;  4A3M J;  2WAD A;  3GTJ J;  1KYZ A;  4EJO A;  2NS0 A;  3O8G A;  1A5J A;  4XLC A;  1SFK A;  2PMU A;  5HS9 A;  2ACJ A;  3R6S A;  3E7L A;  2R92 J;  2HS5 A;  5FKL A;  2WAQ A;  4B09 A;  1X19 A;  3SXY A;  2IA0 A;  1VQK I;  2HXI A;  3RQI A;  1USS A;  4XK4 A;  1SFX A;  3SDB A;  4YFX F;  2LDU A;  2LSO A;  1ITY A;  3A2K A;  3OYE A;  1MBE A;  3TO9 A;  3JCU C;  3GXO A;  5AON A;  2ZJP F;  2JTV A;  1O7F A;  2KT0 A;  2Z16 A;  2XGC A;  3G6E I;  4AVP A;  2OTJ I;  5K1Y A;  4A3I J;  2YSR A;  1QGP A;  3KEQ A;  3L09 A;  2KJC A;  5DEQ A;  3L2Q A;  1QVT A;  2N8G A;  3R61 A;  3U1D A;  1IXC A;  1A36 A;  2EA2 A;  2ZKZ A;  1BOB A;  3KPH A;  4BHB A;  3BG7 A;  2PN6 A;  2QF7 A;  2DT6 A;  3OIO A;  3H92 A;  1RR7 A;  2ADU A;  4M3D A;  2M4K A;  5JI6 A;  3V8L A;  4XSX F;  4B48 A;  3DP7 A;  3S16 J;  2VKD A;  4UUT A;  2V6E A;  2V1U A;  4A3B J;  4AVZ A;  1OKR A;  3RTR A;  2ZXW H;  4BY1 J;  3CUQ A;  1LPQ A;  3AFH A;  2XAJ A;  1O3Q A;  2PEX A;  1P6R A;  3MWM A;  4IZZ A;  1EH7 A;  4E7K A;  1FBQ A;  1MH3 A;  4XRF A;  3BZK A;  3CLQ A;  4HRI A;  4ENJ A;  1QO0 D;  2B9S A;  2XGE A;  1UFM A;  4IRI A;  2BY0 A;  3LST A;  4EQQ A;  1ZYR F;  1J2X A;  1FYK A;  4PJN A;  3WU1 B;  1X4O A;  3BZ6 A;  5KAI C;  3VSK A;  1G59 A;  5GPA A;  2H1L A;  2QKM B;  1BW6 A;  1Y6I A;  2LNB A;  3O2P E;  3TQN A;  4L0Z B;  3NWS A;  1RUO A;  4HX8 A;  2P6T A;  3M4O J;  1OCC H;  1SAU A;  3GF2 A;  3HUG A;  4B3A A;  2H6C A;  1FC3 A;  1UHS A;  1T2K A;  3MZ8 A;  2EPF A;  1IGN A;  2CUJ A;  5LEJ A;  2L9R A;  2YX7 A;  2QGU A;  2KRC A;  2ZXJ A;  4A5M A;  1OYY A;  3DWL E;  4UB6 C;  4U7B A;  3H0D A;  2F5D A;  2PI0 A;  3H35 A;  2EFW A;  5IP6 A;  2YX4 A;  4V2F A;  3BQZ A;  2VXD A;  4UY8 I;  4DGW B;  2A6H F;  5JLX A;  3HSE A;  3QP6 A;  2HWV A;  3TOB A;  2W48 A;  1W0T A;  3TKY A;  2AO9 A;  1YIJ I;  2Y9Z A;  4CYC B;  2EFQ A;  1R22 A;  1XMX A;  2CW8 A;  1OCP A;  3MD2 A;  2EIL H;  4NC7 A;  3X2Q H;  3ZMS A;  1OQY A;  4D1Q A;  2CYY A;  2STW A;  1RES A;  2DOA A;  3JTG A;  2HPI A;  3RPQ A;  5GPC A;  3A0B C;  2EZI A;  2TDX A;  3H5R A;  4XBF A;  2XAQ A;  2IGK A;  5DCM B;  1R4N B;  4ZTF A;  5D5W B;  3EUH C;  1NTC A;  3VOE A;  2LF7 A;  2WB1 N;  3QPS A;  1APL C;  3KZI C;  2Y75 A;  4GO1 A;  1ZK8 A;  2DA7 A;  3M3Y J;  1SEU A;  2MH9 A;  2JN6 A;  3ISP A;  2Y31 A;  3VDX A;  3D1N I;  1FSE A;  1YRN A;  1XGN A;  5CJ9 A;  1R23 A;  3S3O A;  3JRB A;  4HF1 A;  1KQ8 A;  3VPR A;  3S14 J;  2M8G X;  4Y15 A;  4KIB A;  5EZH A;  4QPO A;  2ISZ A;  3B02 A;  2RV8 A;  4CCM A;  1PJR A;  2LY9 A;  5LGT A;  2NS7 A;  4I2O A;  3RKX A;  1TT0 A;  1RI7 A;  4IHW A;  4IQJ A;  1SD5 A;  1B6A A;  4Q47 A;  2BW3 A;  1WJC A;  5KVR A;  2BYV E;  2XF5 A;  2E5Z A;  4XL9 A;  2CUZ A;  3SQN A;  1RPW A;  3CCY A;  1V54 H;  2DOE A;  4P1W A;  2L54 A;  5DYM A;  2P7C B;  4KNY A;  1MJA A;  3RQ4 A;  3DBL B;  1V5F A;  4MTD A;  4G12 A;  4XLA A;  3OYI A;  2OD5 A;  2OBP A;  1B9M A;  1QZE A;  1UST A;  5E1W A;  1O4X A;  2JZY A;  3BTJ A;  3IH2 A;  1FP2 A;  2P6S A;  5CVR A;  3UKG A;  2HQA A;  2ZXH A;  3K4J A;  1HDD C;  5KK1 A;  1STZ A;  1EH6 A;  1OCR H;  1FPQ A;  4N0B A;  5EEG A;  3PIP F;  1EH8 A;  1YI2 I;  4G9Y A;  2DFI A;  3I56 I;  1OJL A;  4OMY A;  4ASN A;  3K70 D;  2V7F A;  2COM A;  3LSR A;  1WRJ A;  5FB2 A;  5IP9 J;  4N4O B;  3EUH A;  3PIO F;  2QEX I;  2Z9O A;  2QCO A;  3BPX A;  2AQF A;  4N4N B;  1RNL A;  5E79 C;  4EJW A;  5J1Y A;  3OWT A;  4ZDL A;  5IYB J;  3K4M A;  4E7I A;  3AL0 B;  4RM3 A;  3K7A J;  5HOD A;  1RC9 A;  5LHG A;  1KU3 A;  4U7D A;  2DFF A;  5J4Y A;  1B9N A;  1P9Q C;  3S1R J;  1FOK A;  2ME0 A;  3CME I;  1H88 C;  2K3P A;  2STT A;  5LGN A;  2QSG X;  1X1A A;  1KYW A;  2R7D A;  2ZME C;  5FFZ A;  1YOV B;  1IRF A;  3RPU A;  3G2B A;  3V7C A;  1PUF A;  3W2V A;  1ZQ3 P;  3FXU A;  5L3B A;  2LTP A;  2VQG A;  4IVN A;  1U5T B;  4G7H F;  1YHQ I;  2OAZ A;  5JVT A;  4AWX B;  1N25 A;  1DQU A;  3BZC A;  5L3F A;  2DLL A;  2EZH A;  2LKP A;  3QQA A;  4IPA A;  4KMU X;  3LA2 A;  4FX0 A;  4HST A;  1ETQ A;  4B4C A;  1FYM A;  3ZMU A;  3WG9 A;  4YFN F;  4XQF A;  4BQA A;  4NBQ A;  4IHX A;  1D3Y A;  1GT0 C;  3RDI A;  1D0Y A;  4BY7 J;  4EAT A;  4QSH A;  2CWE A;  2IXS A;  4IOA F;  1ETK A;  1QHG A;  3JRF A;  1A6I A;  5K7Z A;  2EJR A;  1LDD A;  3A01 B;  2GLO A;  1TP4 A;  3C2H A;  5E8I A;  2OC6 A;  2DT5 A;  5E1Z B;  3HRM A;  2W82 A;  2A07 F;  2R93 J;  3QPT A;  3BP8 A;  2VQC A;  1JKQ C;  2AXT C;  1L3L A;  2VAS A;  3UR3 C;  2AHQ A;  5FGM A;  2VOD A;  2B0L A;  3CCJ I;  3LQR A;  4F93 B;  3LAJ A;  5J3L A;  3S17 J;  4B1R A;  4ESF A;  5EEA A;  3EUA A;  5DUI A;  4BE0 A;  2ZJ2 A;  1YW8 A;  2ZME A;  1WH7 A;  5HLG A;  5H20 A;  3IUO A;  2YPR A;  2W84 A;  4KFC A;  3O6B B;  4C3I J;  4EJT A;  3BG6 A;  5L3G A;  2JRM A;  2M45 A;  3WHB A;  4Y33 A;  3G1O A;  5F1R A;  3WGH A;  1OLT A;  1W7P B;  1V5G A;  2DYR H;  1YJW I;  1JGS A;  1QHH D;  1ETY A;  2CG4 A;  4RGU A;  3FM5 A;  3ECH A;  2X1C A;  2HYG D;  2FOK A;  4U88 A;  4UXN A;  1T98 A;  1E3H A;  2KRF A;  2CV1 A;  1TQM A;  2PMH A;  2PX9 A;  3LOC A;  2JUG A;  1FT9 A;  1JT6 A;  2KFD A;  3ZXS A;  3KP3 A;  3ZGK A;  2CUF A;  1FEX A;  4QTR A;  2XPW A;  3FHZ A;  4A3G J;  1ETW A;  4ZZL A;  1ZRD A;  1BI0 A;  2IEK A;  2MC4 A;  2UXN A;  3W6K B;  5ICC A;  3DTE A;  1LFU P;  3C1D A;  2HDW A;  4A0Z A;  4YFK F;  4HLY A;  2H8R A;  4LIU A;  2KPM A;  4MFD A;  5B1B H;  1MBF A;  2TRT A;  1S7E A;  3A1Y A;  1MMS A;  2CH0 A;  3K69 A;  1FYL A;  2NVQ J;  3I9V 2;  3K10 A;  3KEO A;  1TNS A;  3CQZ J;  2DPD A;  1YW9 A;  2XRO A;  2JA8 J;  2R7X A;  2HKX A;  3E6C C;  1AOY A;  1F1Z A;  4BKX A;  2H09 A;  2PMZ A;  3L00 A;  3WHC A;  2GXG A;  3OOU A;  1SD6 A;  1C0W A;  1D8J A;  5B3S H;  1ZR2 A;  3WU2 C;  5HOO A;  4JK1 X;  2BOL A;  2IS6 A;  4BU2 A;  2XSJ C;  5HNF A;  1PP7 U;  1LEB A;  2PQ8 A;  1IV6 A;  3SFZ A;  1BBY A;  3TW7 A;  2IPQ X;  2LOO A;  3KYD B;  1I1S A;  2F4I A;  2RN7 A;  2Y2Z A;  3S32 A;  2EB7 A;  2DW4 A;  2V6C A;  2O0Y A;  5D5U B;  5LD2 C;  1L0O C;  2KIM A;  1FJL A;  3P9I A;  1D0Z A;  1T6S A;  3GTO J;  2CFO A;  4S05 A;  3CDI A;  1J5Y A;  1K4S A;  1Z9C A;  3FKI J;  4DZJ A;  5B66 C;  1Z91 A;  4BQQ A;  1MW7 A;  4IOC F;  2QQA A;  4Y7N J;  2DA1 A;  2YU3 A;  3CDH A;  2QVO A;  3JRI A;  1Z77 A;  3HSF A;  3LFK A;  4R79 A;  4XID A;  4X6A J;  3E6M A;  5F27 A;  1U2W A;  4LJZ F;  2WTE A;  1VQM I;  1T0F C;  5FLM J;  2JJ7 A;  2RGV A;  1CF7 B;  1PVE A;  3CCR I;  2HVS A;  4CCN A;  1RRJ A;  4R8H A;  2I10 A;  3GTQ J;  2CQK A;  1WQ2 A;  4CYC A;  2F5C A;  1VQ6 I;  3GVA A;  1HCR A;  5DD4 A;  4OWR B;  3GUD A;  3S1M J;  4LOC A;  3IL2 A;  2VJJ A;  4X0G A;  4G94 A;  3LSM A;  3DEE A;  4EGY A;  2QQ9 A;  2XUB A;  2VKV A;  1X1D A;  1MBG A;  2A69 F;  3RKQ A;  2EQR A;  3RPU D;  5J40 A;  5DCM A;  3M8F A;  2OCC H;  1KGS A;  4P96 A;  2WV1 A;  2IA1 A;  5F0C A;  3WU0 A;  1Z6T A;  1U9O A;  2ECB A;  3ASN H;  3AKZ A;  3CCM I;  3CJQ B;  4IHT A;  1TWH J;  5B5E C;  1DGR M;  1Z7L A;  1W36 C;  3NEU A;  4HPQ A;  3HYI A;  1RKT A;  4II3 A;  1IN4 A;  2L7Z A;  4A6E A;  3GWZ A;  2LY2 A;  3FBI B;  3DBH B;  3FWE A;  3MEX A;  3MKZ A;  4KA4 A;  4AIJ A;  3BPV A;  1E2X A;  3WGI A;  1HOM A;  1IRG A;  3DTK A;  2E2I J;  1ZGA A;  3HB9 A;  1X3U A;  4UVA A;  2KZV A;  1R71 A;  2RDP A;  4G6D A;  3IP4 B;  1IRZ A;  4XON A;  2ETH A;  5IT9 K;  1TQP A;  4L5E A;  4HDV A;  1TTY A;  4QWQ A;  1XD7 A;  5EGO B;  2F5F A;  1T8I A;  4C3J J;  2D1H A;  1I6X A;  3G1L A;  4YIF A;  3LA7 A;  4OIR F;  1EA3 A;  1T0F A;  2CQ7 A;  4BL0 B;  2XAS A;  1U5T C;  5IYC J;  3WG7 H;  3OMY A;  1IDZ A;  4DQ2 A;  3I59 A;  2L7F P;  3HG9 A;  5B1A H;  2E1O A;  2EIN H;  3LNQ A;  1V4R A;  5IT3 A;  3ZMZ A;  2FE3 A;  2LC2 A;  1FSH A;  2OPT A;  4P9F A;  3W3C A;  2EH3 A;  2ZBK A;  5A2Q K;  1O3S A;  4UHT A;  2OF7 A;  1Z0X A;  2GQQ A;  4IJA A;  3VWB A;  4M6V A;  2FSW A;  3H3Z A;  1IW7 F;  3SZP A;  5HDK A;  1VZ0 A;  3FHN A;  4FIS A;  2JA7 J;  2VC0 A;  4OMZ A;  5FKK A;  1F5T A;  4PFP A;  1O3T A;  1R36 A;  1S5L C;  4B47 A;  3ML6 A;  3HEF A;  2R7W A;  3R0A A;  1MGT A;  2E36 A;  1XS9 A;  2O03 A;  4BHC A;  5LFA A;  3ZPL A;  2H27 A;  3OYD A;  1JHH A;  3MVP A;  4BUP A;  3CO7 C;  1P7I A;  4OOI A;  2Z5U A;  3GEZ A;  3I53 A;  4AUX A;  1R5G A;  5DM7 F;  3BC8 A;  4BAC A;  1YE9 A;  1Y0N A;  2W1O A;  3WTU C;  2X0L A;  4IXA A;  4IQ4 A;  3OR2 C;  4HX4 A;  2R7T A;  5M5W J;  2J5O A;  2KQR A;  1FIA A;  2W7N A;  2R0Q C;  3CMM A;  2LLK A;  1IZ1 A;  3N05 A;  4BE1 A;  1JGG A;  5C44 J;  4Y4R A;  3J7Z I;  1F9N A;  3ECO A;  4UB8 C;  1U5T A;  1MD0 A;  4ZYD A;  1TC3 C;  3RKY A;  2E1M B;  1I6H J;  5KAF C;  2A68 F;  1R5H A;  3ZQH A;  1HQC A;  5TJJ A;  1WJB A;  3HHG A;  4KJZ A;  4XLN F;  3KYL A;  1DU6 A;  3IC7 A;  4KIG A;  1K78 B;  1ONV A;  2HTJ A;  3V4G A;  5JVG F;  1K6Y A;  1F4K A;  1GVJ A;  1TBX A;  2CQQ A;  1T39 A;  3KET A;  4M3B A;  2V1N A;  1G3S A;  1JKP C;  3GTP J;  4AIH A;  2XB5 A;  3S2D J;  3OYM A;  2M0C A;  5H2F C;  2CU7 A;  2XSD C;  2DMN A;  3BRO A;  3GW2 A;  4WXH A;  3IH4 A;  4R1H A;  2PBI A;  2RQP A;  2XAG A;  2K7L A;  3F72 A;  4BQN A;  4HF2 A;  2E60 A;  1WJD A;  3A01 A;  2O61 A;  1X2M A;  1D0X A;  3LQQ A;  3QOD A;  3V42 A;  1QNT A;  3LSG A;  4BGD A;  5F1J A;  1TNT A;  4JOM A;  5JHF A;  3WTW C;  1DDN A;  2R5Z B;  2KIS A;  2HR3 A;  2LBF B;  4IF4 A;  1HXD A;  3LA3 A;  1QPM A;  4OIN F;  4XLP F;  3S3M A;  1ZRC A;  1KON A;  2PMZ N;  1ZG3 A;  5DS9 A;  3K6G A;  4L9T A;  2EIJ H;  2QQ8 A;  5FKN A;  4Q5S F;  3IRQ A;  3E97 A;  2IS4 A;  2NYX A;  1UZC A;  4LB6 B;  2UWM A;  2E7W A;  5K7H A;  5F64 A;  3RZD J;  3ELK A;  1B4A A;  2ELJ A;  5FRM A;  1IN7 A;  1FOY A;  3J80 K;  3RSN A;  1SMY F;  4XKV A;  5E20 A;  1HST A;  3EQL F;  2DA4 A;  3FKJ A;  4NB5 A;  3ZQG A;  1Z3X A;  2VLA A;  1W7P A;  3KP6 A;  4DYC A;  5JR3 A;  2XHK A;  4ANJ A;  1W1W E;  2EFO A;  2J5P A;  1AWC A;  3ABT A;  1JKR C;  1BA5 A;  2L3D A;  1IDY A;  2Q1Z B;  4L18 B;  4LLG F;  1ERD A;  2G7H A;  2DA5 A;  2M4G A;  3ZMD A;  4W1U A;  3OL3 A;  1P2F A;  2CRG A;  3LMM A;  4LG3 A;  2QA4 I;  3TDU C;  3OYC A;  1HLV A;  3I3L A;  5ERI A;  4A12 A;  1SFO J;  1NH3 A;  1ETX A;  2MBF A;  4ON0 A;  1FIP A;  1I1G A;  2D2W A;  4I99 C;  5GAE J;  2AXL A;  1FOW A;  4BEH B;  3GZ6 A;  1BR2 A;  3DKY A;  1MKM A;  2BEO A;  1IG7 A;  2XRL A;  2FBK A;  4D5C A;  1YJ9 I;  4A0Y A;  2VIX A;  1QA6 A;  5E3O A;  4FCY A;  2DFE A;  1X4P A;  2K02 A;  1X3W B;  2F4O B;  4ABZ A;  1ENH A;  3BCA A;  4NDL A;  1K4T A;  2FML A;  2LKX A;  2VON A;  1BI3 A;  3O3K A;  2RKH A;  1IV8 A;  3CES A;  2Y0S A;  4JP0 A;  1Q1H A;  3GFM A;  2OZ6 A;  2Z33 A;  4IO9 F;  3B6C A;  4EVI A;  4CCJ A;  2DBB A;  2DDA A;  2DAO A;  3BR2 A;  3H3V K;  3D5L A;  4KIS A;  1XMA A;  4KIT B;  4JX5 A;  3VSL A;  2HQR A;  3JRE A;  2K40 A;  3GO5 A;  1G3T A;  3K4C A;  1Y8R B;  2DT7 B;  1EF4 A;  3F8B A;  5CYV A;  2R3S A;  3J7A Y;  1WI9 A;  3JRC A;  4M3F A;  2DJN A;  3DLL F;  4LGW A;  2H94 A;  4KT5 C;  1KU9 A;  2MG4 A;  2KIF A;  2XAH A;  3HIF A;  4GCV A;  3DU6 A;  3OSF A;  3GFI A;  2UUZ A;  3DKX A;  3ERE D;  3DXJ F;  3KLN A;  1EV7 A;  2EZL A;  4G6Q A;  2EV6 A;  4Q48 A;  2HI3 A;  2X6Y A;  3W2W A;  1JI8 A;  2M8E A;  2OCE A;  1S6L A;  3SHF A;  4CHU A;  1MIJ A;  1R7J A;  3I4M J;  2EFN A;  1K79 A;  3Q0W A;  2O7O A;  4ETS A;  1BL0 A;  2MH2 A;  2EFP A;  2XPU A;  3C2B A;  1IC8 A;  1H9T A;  4U0V A;  1W36 D;  3QPL A;  3M8J A;  1CF7 A;  2WA0 A;  2JSP A;  3PM1 A;  1SD7 A;  1T33 A;  3R4K A;  2COB A;  4XRS A;  1UHM A;  2MAB A;  1S7O A;  3G1M A;  3MCZ A;  2OTL I;  1ULY A;  2XF7 A;  2LG4 A;  3HL2 A;  2R4G A;  4XN0 A;  2X4H A;  1LFB A;  4O3M A;  3MZH A;  4OIO F;  2QUF A;  2W57 A;  2DN0 A;  5GAG J;  5ICE A;  3HDD A;  4FHT A;  2HOT A;  3KP4 A;  2LH9 A;  1N75 A;  2DA6 A;  4E7J A;  4BS9 A;  4XM3 A;  2D5V A;  1XC5 A;  3S2H J;  1KZH A;  3CJN A;  1IF1 A;  3EET A;  2LYC A;  1ETV A;  1TWF J;  2CSO A;  2EBI A;  1JTX A;  4EM1 A;  3P7N A;  5J6X A;  2ECC A;  3S93 A;  1G3W A;  3ZRG A;  3VYT B;  3RI4 A;  4EEF G;  3W6V A;  2E2H J;  5IYD J;  1DU0 A;  4AYB A;  4IX7 A;  1MNE A;  1BW5 A;  5TIS C;  3BTL A;  1Z6R A;  3ERM A;  2M0M A;  2NVU B;  2DJI A;  5DV5 A;  2KIU A;  2HOE A;  4AM3 A;  4S0H B;  2BHZ A;  2MSY A;  1FTT A;  3Q5F A;  1XB4 A;  2YR2 A;  3K4K A;  3F6O A;  4A3F J;  4PJM A;  4PFO A;  2PG4 A;  2KDZ A;  2WAE A;  2GBY A;  3T1B A;  3VYR B;  1DGW Y;  3AG2 H;  4Z6Y A;  4ESB A;  2X6X A;  5ICG A;  2IRF G;  2Y69 H;  4RLF A;  3HTU A;  4RB2 C;  1TLH B;  3KP2 A;  1H89 C;  3V7R A;  2E1M C;  3ZCO A;  3K9T A;  2BHY A;  4HV5 A;  2DCE A;  3ZN1 A;  2FF4 A;  1A35 A;  3PO3 J;  1SFU A;  3FIS A;  1J0R A;  3J7Y J;  2X51 A;  2QSF X;  1FBS A;  2VBW A;  1ZG5 A;  2HTS A;  3PSF A;  2K9Q A;  3OYL A;  5FD6 A;  1ETO A;  3DF8 A;  4BAY A;  5BQT A;  4LG0 B;  3CCE I;  2IJL A;  2F2E A;  3C18 A;  5K5R A;  3I0T A;  4HNU A;  1W7P D;  2QZ8 A;  1UAA A;  2JQ7 A;  3FXR A;  4HSR A;  2R7S A;  1A31 A;  3ZMT A;  2WAF A;  3FZV A;  2FQ3 A;  5IT9 Z;  2X1E A;  2LRE A;  3K4N A;  4LIT A;  1SC7 A;  3EUK L;  1I39 A;  2BE5 F;  3HKZ N;  1LVK A;  2VE9 A;  3HRT A;  3Q3S A;  1QRY A;  3QP5 A;  3UNG C;  4NNJ A;  3VYS B;  2HU9 A;  3L9F A;  3I64 A;  4KT6 A;  1ZAO A;  4F91 B;  1U8B A;  3ZQC A;  3PFY A;  4M71 A;  4PK4 A;  1D1B A;  5D8L B;  3KLO A;  4XKC A;  4FTH A;  1E3P A;  5A2Q Z;  1RR8 C;  1U78 A;  3EPZ A;  3HOX J;  4RGR A;  1NK2 P;  3GZ5 A;  3HPG A;  3AAF A;  2IT0 A;  1WH5 A;  2O8X A;  1DP7 P;  2OQG A;  2XKP A;  3PQJ A;  2WAQ N;  3R0J A;  2L9N A;  5IOZ A;  3WOD F;  4EJV A;  3OY9 A;  1K78 A;  2I8D A;  4IHS A;  2RNJ A;  4CCL A;  1BJZ A;  2DMT A;  2QWW A;  1XN7 A;  4LB5 A;  4EM0 B;  2CS3 A;  2W85 A;  1SD4 A;  1XMK A;  4P55 A;  4E7H A;  5GAD J;  3OOP A;  5GP9 A;  4PCQ A;  3SZG A;  1UB9 A;  4I01 A;  2VPR A;  1LFP A;  2RRE A;  3QPH A;  3H9G A;  3MQ0 A;  4K2E A;  1X1P A;  1IN6 A;  2A5Y B;  1X1B A;  1WCM J;  2F48 A;  3EYY A;  4IEJ A;  1IN8 A;  2M1B A;  4UUS B;  2LBF A;  3K4L A;  2R5Z A;  2KRH A;  1K6O A;  3HJE A;  2NRA C;  5EZG A;  1LQ1 A;  1ZLK A;  2L2O A;  3L7W A;  2EV0 A;  4EJU A;  1BC7 C;  2E5N A;  3BDD A;  1G2H A;  3OL4 A;  2M5W A;  3RKW A;  2HQ5 A;  5KCM A;  2QBY B;  1MMG A;  4MHG A;  3F8N A;  3PNV A;  2A6E F;  4E7L A;  3U9G A;  3E1S A;  3SFI A;  2K27 A;  1EKE A;  4MFE A;  3T0Y A;  4KN7 X;  2EK5 A;  1GXQ A;  1MMN A;  5AIP A;  1ZKG A;  2QQB A;  1G3Y A;  3TL4 X;  4C9Y A;  2E35 A;  4CO8 A;  3PQK A;  3K1P A;  2XKO A;  1ZLJ A;  1VFC A;  2DQR A;  5F6F A;  3H9J A;  4HAM A;  4OU0 A;  1JJ8 C;  3I4P A;  2NXN B;  3P9K A;  3QU6 A;  5CKT A;  1IUF A;  4LK0 F;  5EYR A;  3FK6 A;  3N97 A;  4BNC A;  4YG2 F;  3F21 A;  2JRT A;  1GHC A;  6PAX A;  1Z1D A;  3DCF A;  3IWZ A;  1XCV A;  1FMW A;  1GUU A;  5D6F A;  1XSD A;  4HNT A;  3F3X A;  1YTY A;  3ZQF A;  4P5O A;  4ZC3 A;  2MLK A;  3GME A;  2HGC A;  4BEH A;  2CW7 A;  3PL8 A;  3TOA A;  1WZ2 A;  1R1V A;  2O8K A;  2K9N A;  2F6C A;  2P5V A;  4KYW A;  4ZTJ A;  1ODD A;  4C2U A;  2R7Z J;  1YX5 A;  3J80 Z;  1W5S A;  2ESH A;  2D45 A;  1A04 A;  2WY7 Q;  3E5X A;  4U0W A;  3WTV C;  4D5F A;  1FP1 D;  4A93 J;  3HZJ A;  2BZT A;  2H8W A;  5LLQ A;  1WFX A;  1TL8 A;  1Y1W J;  3WTY C;  4RBO A;  1JUM A;  2WBM A;  3E5U A;  2ZJQ F;  2MFZ A;  3QOP A;  1GDT A;  3GTL J;  1UJ8 A;  4I7H A;  3FDY A;  3HOS A;  4DIQ A;  4HV6 A;  4WWC A;  4A3E J;  2FX0 A;  2FNP A;  2GM4 A;  4BDY A;  2QEN A;  1MMA A;  3F8C A;  3JTH A;  3QOE A;  1VTN C;  2CW0 F;  2M7B A;  4HBL A;  1HKT A;  2KKO A;  3FXM A;  4MIM A;  5BNG A;  5D8K B;  2Z2S B;  3VFZ A;  2W24 A;  3LL7 A;  4BXF A;  3SEZ A;  1YS7 A;  1W5T A;  1YIT I;  5CVV A;  2QM3 A;  3CMA I;  4DYQ A;  1CGP A;  1Z21 A;  2Q0O A;  1OCO H;  2ZCW A;  1I5Z A;  3PO2 J;  2VN2 A;  2R5Y B;  3CCV I;  2FNA A;  1BOA A;  1RKW A;  4HQE A;  3NWT A;  4GDF A;  1ZRE A;  2DQL A;  4A0X A;  4XKW A;  2NOJ B;  4B43 A;  4YRV A;  1P4A A;  4WXC A;  2NNN A;  3WE3 A;  3GFL A;  2JPC A;  5HS7 A;  3HGG A;  3TP3 A;  4HW0 A;  2E34 A;  1ZGJ A;  4JBA A;  3FF5 A;  1H0M A;  2KLO A;  5HVQ C;  4W97 A;  3QWL A;  4NC6 A;  5LHH A;  3JSP A;  2DO7 A;  1Y39 A;  3TP0 A;  2VC1 A;  1UCR A;  2FEZ A;  1YIO A;  3ABL H;  2FU4 A;  2HQN A;  3GLL A;  1KA8 A;  3OYJ A;  1D5Y A;  2Q2E B;  2ZSH B;  2M34 A;  1DPU A;  5FD5 A;  2XGX A;  2XV4 S;  2HKO A;  3C2G A;  3AL0 C;  4MQ9 F;  2VE8 A;  4EMS A;  4KMF A;  3E3V A;  4LK1 F;  3I58 A;  3DTI A;  5CQG A;  1O57 A;  2CFX A;  3IKT A;  3ZQL A;  3LFU A;  3Q9V A;  5LRR A;  3BLY A;  3WTT C;  2E2J J;  1E0E A;  3DPL C;  3F8F A;  2FQ4 A;  1LKX A;  3HXL A;  3MFK A;  3PFI A;  5M5Y J;  1KQ9 A;  1HBX G;  3OYH A;  2O3F A;  3H1C A;  1YJN I;  2BY1 A;  4M6X A;  4FE7 A;  4X1E A;  5CVU A;  3HOT A;  1ZAR A;  5LEK A;  3KFW X;  2RC4 A;  2X85 A;  5D4S A;  5E3L A;  2DXI A;  3IV5 A;  1LB2 A;  3I71 A;  1N78 A;  3DV8 A;  3M7G A;  4XIC A;  1IJW C;  2H1K A;  3BG5 A;  4XOR A;  3DEW A;  1SAN A;  3LWF A;  4LLL A;  3K4B A;  3CCU I;  2XB0 X;  2BXY A;  5BPD A;  1REP C;  4Y13 A;  3OYA A;  3CDL A;  1MH4 A;  1R6R A;  4XR6 A;  2YU9 J;  2Y9Y A;  2R7F A;  3H5N A;  2FBH A;  1VQN I;  4JX6 A;  5J1U A;  4ZYA A;  3OS0 A;  1WPK A;  5E18 F;  5FLV A;  3GTG J;  2GAU A;  2ID6 A;  2HNH A;  5FKM A;  4CA0 A;  1OMI A;  1RZ4 A;  2M2E A;  5M3F J;  1XGM A;  1DPR A;  4XMY A;  3WTZ A;  1R58 A;  5GTH C;  5AIQ A;  4LG0 A;  3HC7 A;  2OZU A;  2IW5 A;  3EDP A;  1ACI A;  2BV6 A;  3HPH A;  2WB1 A;  3K1N A;  4C2M J;  2EZK A;  4RS8 A;  1OPC A;  3BR5 A;  2IS1 A;  1J09 A;  4M74 A;  4XSZ F;  4OAY A;  2JMW A;  4GGG A;  1S3J A;  1VI0 A;  5H6R A;  2BVM A;  3F22 A;  1S29 A;  1P4X A;  1ON2 A;  4HOB A;  3HBL A;  5HDG A;  2NVX J;  4I02 A;  4B8X A;  1RET A;  1MBH A;  2A61 A;  2NVY J;  4KDP A;  2ZFU A;  2GIZ A;  3NQO A;  4LLN A;  3F0C A;  4PSX A;  2R7V A;  4MNU A;  4CZC A;  4OIQ F;  1HW5 A;  2BGC A;  2V1X A;  2JK3 A;  2XAF A;  3BJA A;  4P9U A;  2EIK H;  3DPU A;  2ZNY A;  4M72 A;  1EJ9 A;  1K7A A;  1WHU A;  5J8F A;  4Y52 J;  2G7U A;  1YS6 A;  4HQM A;  1LDJ A;  3ZN0 A;  2ICW G;  4CIC A;  3SYT A;  2WWY A;  4YEJ A;  2NAZ A;  4PJ0 C;  4M6Y A;  3I55 I;  1LEA A;  4UV9 A;  2VL8 A;  2KP6 A;  2CUE A;  1M1E B;  3CO6 C;  1HW1 A;  2LVS A;  4N9H A;  2XIG A;  4HZF A;  2R7Q A;  2BY3 A;  3TED A;  1VQ4 I;  2CMP A;  3VOD A;  2ZSI B;  3DU5 A;  3RCO A;  4GFB A;  3K2A A;  3HM5 A;  4FAS D;  3HOY J;  1BC8 C;  1BJA A;  3BY6 A;  4E4H A;  5D6E A;  4C30 A;  3ASO H;  2XRN A;  1J9I A;  1X2N A;  4BBS J;  3N4M A;  2MA3 A;  2RNG A;  2A3S A;  5HS8 A;  3S1N J;  1B59 A;  2GA2 A;  4UUS A;  4PSW A;  2B63 J;  2XF6 A;  1GV5 A;  1FX7 A;  2ZO4 A;  4ZDP A;  2VPL A;  4I98 B;  4M73 A;  1G8X A;  2MD5 A;  4TV7 A;  2K9S A;  3I5U A;  3SJM A;  1B8I B;  3BTC A;  3KEY A;  4E6K G;  2R7O A;  4WCG A;  2QBY A;  3BCB A;  2DMP A;  5BOX A;  4XLH A;  4D0P A;  4DBR A;  5FLX K;  4AID A;  5L3E A;  4S04 A;  5JFR A;  3TBI A;  4BE2 A;  1YFH A;  2HEO A;  2IS2 A;  2BBY A;  3KYC B;  3TO6 A;  1R1T A;  3BQY A;  4E7S A;  4PUS A;  3OIQ A;  1V3F A;  1YYV A;  2ZFW A;  1IXS B;  3F8M A;  1JXS A;  1XGO A;  4PGH A;  3GZN B;  3ABU A;  1TZL A;  1VQ9 I;  4ENN A;  2VQH A;  4XRS G;  5E1X A;  3W2A A;  1POG A;  5D5V B;  4UVB A;  4ZDO A;  1R9T J;  3HSR A;  3K2Z A;  2L5Q A;  2DU9 A;  2Z3Y A;  3D0S A;  2M7A A;  4J19 A;  3JRA A;  1S72 I;  1WJA A;  3B6A A;  2CJJ A;  3RYP A;  3V7S A;  3Q0U A;  3PUB A;  1PP8 F;  4MTE A;  4O6J A;  1OCZ H;  4A3J J;  2EWN A;  2FJ1 A;  2FMY A;  3GBG A;  1XTA A;  2KL4 A;  4HLX A;  2RQQ A;  4F55 A;  1SAX A;  1J59 A;  3A0H C;  1S8N A;  4ZH4 F;  1NHA A;  2AQE A;  1WJ5 A;  3A4C A;  2XAU A;  1X1C A;  2JUC A;  4RAF A;  5TRD A;  1I50 J;  2IBD A;  2DYS H;  2QKL B;  4DNC A;  1IAW A;  2VB6 A;  1PUE E;  2W00 A;  3F6V A;  5DCF A;  1UHW A;  2UZK A;  1JT0 A;  3L2C A;  5LHI A;  1XSV A;  3PJR A;  2LK2 A;  3VB2 A;  2HVR A;  2RVC A;  5EJC A;  5HNH A;  3J81 K;  1KU7 A;  3K1M A;  5IP7 J;  4WK8 F;  3MN2 A;  2VOP A;  1QZZ A;  3QRF F;  1OIS A;  2VKH A;  3LSK A;  2P4W A;  2P7V B;  3BG9 A;  1ZRF A;  2VOO A;  3BR6 A;  4EGZ A;  1HC8 A;  4ITV A;  1XDU A;  2XPV A;  1QQI A;  1DP3 A;  1LNW A;  3IWF A;  1FY7 A;  2KZG A;  4GRI A;  2PJR B;  2GXB A;  1S7A A;  3L2V A;  3OYB A;  3M1C A;  4ZYH A;  5J4V A;  4L9V A;  3M9A A;  3IRR A;  1TW2 A;  4F3Q A;  2DA3 A;  2MYS A;  1IRX A;  4CH7 A;  5CPR B;  2ZNZ A;  5H6Q A;  4A6D A;  3BJ6 A;  3CZ6 A;  4XOP A;  1S9H A;  4FX4 A;  3NRV A;  4CGZ A;  1LUJ B;  1MSF C;  3HRS A;  3PNT A;  5J8C A;  3FIW A;  2R5Y A;  1Z05 A;  2V26 A;  3H3U A;  4RM2 A;  1AKH B;  1MDM B;  3LSH A;  2ELK A;  1MNM C;  4ESJ A;  5IPA A;  2LR8 A;  3MAJ A;  1TT5 B;  3J7A O;  2O5R A;  1GVD A;  4ZYG A;  1LJ9 A;  3G73 A;  2FD5 A;  2JA5 J;  2JT1 A;  2MD0 A;  2DDB A;  4QLC U;  4RMN A;  1ZR4 A;  2L9S A;  4A3D J;  3CCQ I;  5ILS A;  4CCK A;  2M87 A;  2P8T A;  5F0H A;  2JVH A;  3SZT A;  5DD8 A;  3BJO A;  5ED4 A;  1LE8 B;  2XGD A;  1MND A;  3CLO A;  4YII A;  1OYW A;  4IKF A;  3T8R A;  1B72 B;  4LD5 A;  3MKW B;  1WWX A;  2CO5 A;  3SEQ A;  4HYE A;  3CCS I;  1QPI A;  2Q2E A;  4DBQ A;  1FWZ A;  2BY2 A;  5EDN A;  4BJT A;  3JSO A;  4I0A A;  1VQP I;  3CMY A;  3JRG A;  2B7E A;  3TO7 A;  2LP0 A;  1BIB A;  5FJ8 J;  5C3E J;  3O8H A;  2FA5 A;  1YG2 A;  2IP2 A;  2Q8K A;  1LVA A;  1K61 A;  2C6Y A;  2FRH A;  2F4M B;  1V55 H;  2G9W A;  4FET A;  2LKS A;  1SVL A;  3M8E A;  3D5R C;  2FUG 2;  1WKM A;  2W25 A;  5M3M J;  3CP2 A;  2GXA A;  1UMQ A;  3HOV J;  2R7U A;  2HVQ A;  5EGO A;  4HF0 A;  4E70 A;  2NNY A;  1AU7 A;  3PUF A;  3EYI A;  5C4J J;  4ZJZ A;  3TW6 A;  1P7J A;  3BOQ A;  1KU2 A;  4NQW B;  1WJE A;  4D9J A;  1VQL I;  1ON1 A;  1ZEL A;  4D7N A;  3A03 A;  1IN5 A;  3P9C A;  1SVM A;  1TQI A;  4ZYE A;  1GV2 A;  2FOW A;  2K5C A;  3FXO A;  3REO A;  5EG0 B;  2O6G E;  3I4N J;  2ZC2 A;  3ZQQ A;  3CD6 I;  5FFX A;  2VUM J;  1BM9 A;  2VXZ A;  1BR4 A;  4HNV A;  1JHF A;  1W5C C;  2L02 A;  2K4J A;  2VQL A;  3ABM H;  3RYR A;  3I59 B;  5LRS A;  4XKB A;  3FK7 A;  3HOU J;  3HOW J;  1X58 A;  1HKQ A;  2BXZ A;  2LFB A;  3JAM K;  4RGS A;  1NG7 A;  1FOX A;  1YW7 A;  2F5V A;  1HW2 A;  1YQA A;  4CXF A;  3S8P A;  4XRM A;  3BTI A;  4HX7 A;  1AHD P;  1MZB A;  3H36 A;  3LAP A;  2ZXI A;  4MEX F;  1W4M A;  2RAE A;  3MKY B;  2GIV A;  4DYR A;  1QVU A;  3CCL I;  5E3M A;  3RIR A;  1QZY A;  4BXX J;  2XC7 A;  1MBK A;  1HA8 A;  2DK8 A;  3QYE A;  3K0L A;  2VT3 A;  5EEH A;  3CC4 I;  4PJL A;  2K9L A;  3KX2 A;  2D1V A;  4Y3O A;  2A6T A;  1E17 A;  3BT9 A;  3ZR8 X;  4BYY A;  1SVO A;  2L0K A;  4E7Z A;  2L4A A;  1QBJ A;  4B44 A;  1Z7U A;  2EV5 A;  1MJ9 A;  4BXU A;  3DKW A;  2MW8 A;  5FRO A;  5LBQ A;  3WE2 A;  5BMZ A;  4CZZ A;  3JR9 A;  1I3Q J;  2P5L C;  4H0E A;  3VYU B;  2ZJR F;  2A05 A;  2ELH A;  1TWC J;  2XDV A;  3NAR A;  3CC7 I;  3TDZ C;  2Z99 A;  1YX3 A;  1T95 A;  1OFC X;  1ZTR A;  1RUN A;  4RAY A;  4M3G A;  3FMQ A;  2VBZ A;  4RGX A;  1WJF A;  3CF2 A;  4DW6 A;  2EA4 A;  1R1U A;  3ULQ B;  2Y30 A;  3P5J A;  2E7X A;  1VQO I;  3H5A A;  2KHM A;  3ZQ7 A;  4BDZ A;  3HTS B;  4L5I A;  3T5X A;  2HZT A;  3JRD A;  1ORK A;  1F36 A;  3WTX C;  1XSX A;  1XX5 A;  1D1C A;  4CUG A;  4I09 A;  2Y48 A;  1TWA J;  2V79 A;  3AG4 H;  3BR3 A;  1XG1 A;  1IO2 A;  1P4W A;  2I5U A;  2X6O A;  2YUS A;  4C3H J;  3RZO J;  2WV0 A;  1T38 A;  5F0F A;  4XOT A; 
#chains in the Genus database with same CATH homology
 4FQG A;  2B7E A;  2DOF A;  2JUC A;  1UZC A;  2LKS A;  2KIS A;  2KIQ A;  2E71 A;  2KZG A;  2KFD A;  2K85 A;  2DOE A;  2L9V A;  2DOD A;  2CQN A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...