3S1MJ

Rna polymerase ii initiation complex with a 5-nt rna (variant 1)
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
65
structure length
65
Chain Sequence
b'MIVPVRCFSCGKVVGDKWESYLNLLQEDELDEGTALSRLGLKRYCCRRMILTHVDLIEKFLRYNP'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA-directed RNA polymerase II subunit RPB1
publication title Initiation complex structure and promoter proofreading.
pubmed doi rcsb
molecule tags Transcription/rna/dna
total genus 15
structure length 65
sequence length 65
ec nomenclature
pdb deposition date 2011-05-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
J PF01194 RNA_pol_N RNA polymerases N / 8 kDa subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.60 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Homeodomain-like 3s1mJ00
2FQ4A 1ZTRA 1QRYA 2EZIA 3S16J 4A3FJ 1MH3A 2JA6J 5C4XJ 4A3BJ 4EEFG 3S14J 2M9HA 3IH2A 3ZQGA 5J1RA 1JJ6C 5M3MJ 2PMZN 1X2NA 5GPAA 5EZHA 1B8IA 2EZHA 4MFDA 1A5JA 1JUPA 3ZQIA 2E2IJ 2NS7A 3FISA 4V2FA 4D5FA 2L7MP 1GV2A 4Y7NJ 2CJJA 2JK3A 1F43A 1ETWA 3Q0WA 1CQTA 4C3JJ 1TWCJ 3QPLA 5FKMA 1T33A 2VI6A 3BQZA 3HEFA 4CYCA 1R9TJ 2E2JJ 3H0GJ 3S1NJ 4A3IJ 5E3LA 5EF6A 4Y52J 2EBIA 1JUSA 2M2EA 1VI0A 2L9RA 3TP3A 2DMPA 3G1OA 3FK7A 2TCTA 2FD5A 3JRDA 1DU6A 1AHDP 1W0TA 2VUMJ 2ME6A 3HBLA 4IHXA 3NAUA 2W48A 4DYCA 3A01A 1PUFB 4DYQA 2DA4A 1DU0A 4GFBA 3L1PA 4I76A 2GBYA 4FE7A 4D5CA 3IH4A 1ETQA 1IGNA 1TWGJ 2HOSA 1MNMC 4MLOA 2Y9YA 2X9DA 4X1EA 1S7EA 3JRHA 4B3AA 1IRZA 2YUSA 4RDUA 1T56A 4JX5A 4FE4A 5E3OA 2MGQA 1BW6A 3S15J 5K7HA 3F0CA 1LFUP 2G0EA 2H8RA 1Z0XA 1HDPA 2JMWA 2LLKA 1H88C 3A02A 2L0KA 2WV1A 4XRMA 1MBEA 5JLWA 1IDYA 3PO2J 3BTJA 1XG1A 4I6ZA 2YU9J 3QPSA 1B8IB 1B72A 2Y31A 5F04A 2VKVA 1NK2P 1VF9A 4A3JJ 3BQYA 4X6AJ 2L7FP 2RAEA 2XGCA 2WB1N 4V2GA 1I3QJ 1JT6A 2XB5A 5FJ8J 1WH5A 5GPCA 2AHQA 4M6VA 5IPAA 1ZKGA 2LTPA 1O4XA 3K7AJ 2ECBA 2E2HJ 5F1JA 2R5YB 3PO3J 4BY7J 1HLVA 1ITYA 3BT9A 2HOTA 4XK4A 2HXOA 3BR5A 2E1OA 3JRBA 2OF7A 1U8BA 3GTLJ 1TWHJ 1UMQA 4XRSG 2X6OA 5M5YJ 5C3EJ 1GUUA 1JKRC 1JUMA 5FKNA 1IC8A 1A6IA 3JRAA 3CQZJ 3NARA 4M3GA 3OSFA 4W97A 4DZJA 2XSDC 4G12A 1JTXA 1OCTC 4D7NA 5IP6A 3QQAA 3GTJJ 3HB9A 3BR0A 4J19A 1SANA 1ZQ3P 5EEAA 2ELKA 5IYCJ 4A3MJ 1BA5A 1MSFC 1ETOA 4IHWA 2XRLA 2R7ZJ 1ETYA 1FJLA 2LKXA 4AYBN 2YS9A 2ZB9A 5EG0A 3JREA 1WI3A 2HXIA 2CUFA 2XPVA 3BR1A 1FTZA 2CQXA 2L7ZA 3FIWA 2LVSA 5E3NA 4IEJA 4IHVA 3HGYA 5K7ZA 2K9NA 1ETXA 1YRNA 1TWAJ 3ZQCA 2O8KA 4DZPA 3GTKJ 2O7OA 1B72B 2GM4A 5FKLA 3DCFA 4M3EA 3HOUJ 3JR9A 1Z77A 4XIDA 2DMNA 5IYBJ 2R5YA 3BTLA 1IG7A 3K2AA 2I10A 3LSJA 2ME0A 4JYKA 1MBGA 2DA6A 2E19A 3BTIA 2ID3A 3SDGA 4BKXA 4BXXJ 4XICA 4QSHA 1LFBA 2HQ5A 3C2BA 2Y9ZA 5EYRA 2NVTJ 2NVQJ 3S2HJ 9ANTA 2NVYJ 5EDNA 1JKOC 1Q1VA 1IUFA 2IAIA 5M5WJ 2MSYA 3I4NJ 1GVDA 2DMUA 4A3LJ 3I4MJ 1MBKA 3MN2A 1FEXA 3RZDJ 4C3IJ 1EF4A 3RKQA 3RZOJ 3G1LA 1RR7A 1ZR4A 1U9OA 4QTRA 1IV6A 5IOYA 2LY9A 3LNQA 1QPIA 1HDDC 3D1NI 1JTYA 1I6HJ 2Y0SN 2NS8A 2B63J 1D5YA 2NVXJ 5EGOA 1ORKA 1WCMJ 4A3KJ 3O8GA 1FIAA 4UUSB 5GP9A 5EG0B 1AKHA 5M5XJ 4C3HJ 3A03A 3LSPA 1RPWA 1X2MA 4FCYA 2DA1A 4A3EJ 1ENHA 1E3OC 1YRNB 1P7JA 2FX0A 3GTMJ 3H3VK 3TW6A 3JRFA 1IDZA 3ZOBA 1QVUA 2M8GX 2H1KA 1XC5A 4QIWN 2M34A 3HDDA 1QVTA 2DA2A 3IH3A 4M3DA 5IP9J 5F27A 1GV5A 3B6CA 2XB0X 5C4JJ 1RESA 4UUTA 3BR3A 3LSRA 1Y1WJ 1I50J 2JA7J 2JA8J 5IYDJ 4A3DJ 1TWFJ 1RETA 1LE8A 2EQRA 3SJMA 3OIOA 2FJ1A 2OPTA 3HOWJ 4LOCA 3WHBA 3JRCA 2Y30A 3Q0UA 1U78A 5J3LA 5IOZA 2K40A 2JWTA 3BG3A 3HM5A 1JGGA 4JX6A 2MG4A 4B1RA 2QF7A 2EZLA 3S1RJ 1BW5A 3OSGA 4UUSA 2DA5A 3G1MA 4BBRJ 1BL0A 5E3MA 3BG9A 2IBDA 2TRTA 2VKEA 1HF0A 2LK2A 5EZGA 5FLVA 3ZQHA 3SFIA 4C2MJ 3BTCA 5EGOB 2R92J 4IHYA 4JX4A 5M3FJ 3GTGJ 3Q3SA 3HGGA 1AKHB 1OCPA 1ETKA 3CMYA 2EZKA 5IP7J 4MO7A 2R5ZA 1FTTA 1ZK8A 1H89C 3VPRA 1G2HA 3GTOJ 3GTQJ 3O8HA 4W1UA 2O9LA 3Q0VA 4RBOA 2M0CA 5J1UA 2DJNA 1ZGWA 2VPRA 5F08A 3MVPA 1K83J 3S2DJ 2DA7A 1OJLA 5DS9A 4S0HB 2HOAA 2LFBA 1AU7A 1OFCX 2LP0A 2HDDA 1FIPA 3ZQFA 2LD5A 3IV5A 3TEDA 4DW6A 1WGXA 2QCOA 2R93J 1HCRA 2COBA 2CUEA 3HKZN 4BBSJ 3BG5A 4FTHA 2AO9A 5FKOA 5DTDA 1JJ8C 3GBGA 1Y1VJ 5J1YA 3HOZJ 2D5VA 2DA3A 2DMTA 3FKIJ 3HOVJ 2CRGA 1LE8B 3TP0A 3OOUA 5F0FA 5BNGA 1XS9A 4MFEA 5F0CA 3S1QJ 3JRGA 3JRIA 2JN6A 4NDLA 1MBJA 4M3BA 3B6AA 2DMQA 1IJWC 3TW7A 1GDTA 2DTZA 2IEKA 3HOYJ 2NOGA 2P81A 5FKKA 1ZR2A 1X58A 3LSGA 1JT0A 1ETVA 1WH7A 2JJ7A 4DYRA 1F36A 1TC3C 3DEWA 1WPKA 4ABZA 4BY1J 1APLC 4L5EA 1MH4A 2HI3A 2KT0A 3RQIA 1BJZA 3M3YJ 5FLMJ 2MW8A 1RKWA 4A69C 3PM1A 3WHCA 1K61A 1P7IA 3BR6A 3CDLA 4MIMA 4AC0A 2ID6A 2R5ZB 3UKGA 2XPWA 1NTCA 2ECCA 3FK6A 1MSEC 4AUXA 4A3CJ 1W0UA 1U9NA 4B4CA 1HOMA 4D7MA 5F0HA 1JKQC 3GTPJ 1SFOJ 2R0QC 2GLOA 2K9SA 5JLXA 3HOXJ 3CCYA 1VFCA 1UG2A 3BR2A 4A93J 1JKPC 3S1MJ 2N8GA 2XPUA 2K9QA 1NK3P 1UHSA 3LOCA 4CYCB 1VNDA 5HODA 3E7LA 2WAQN 1GT0C 1H8AC 2X48A 5K7FA 1MBFA 4FISA 4M3FA 3MKLA 1PUFA 4A3GJ 1RKTA 2XGDA 3S17J 2Y2ZA 4JP0A 4HNVA 3M4OJ 2EH3A 2CU7A 1MBHA 2DN0A 2JA5J 3W6VA 1POGA 2CQQA 3A01B 3ZQLA 2KDZA 2XGEA 2LR8A 2HYJA 5C44J 4XRSA
chains in the Genus database with same CATH superfamily
2PG4A 1ZTRA 1D1BA 1AA7A 2PJRB 2DBBA 4G8XA 3RQ4A 3MKWB 3S16J 1D5VA 1FSHA 4Q48A 3LFUA 4B43A 4A3FJ 2X6YA 3LA7A 2JA6J 5FROA 4LJZF 3H92A 4JQFA 3AL0B 4A3BJ 1QZZA 2K3PA 2ZO4A 5J1RA 2Q8KA 1FYLA 2QKMB 5M3MJ 1MDMA 1T98A 2EZHA 4MFDA 1BN5A 1TBXA 1BC7C 2QVOA 4WXCA 3L09A 1I6XA 4V2FA 3PNYA 1YJNI 2F2EA 5HOOA 2CJJA 3N05A 3BLYA 1NH3A 1F43A 3Q0WA 4XN0A 3U2RA 1U5TA 4FHTA 2VI6A 2Z3YA 1D0YA 2ACJA 3LA3A 3ZP5A 2E2JJ 2D1VA 4XR6A 3H0GJ 4A3IJ 4G7HF 2X51A 5E3LA 5EF6A 1ZGJA 2OCEA 5CLSA 3NRVA 2BHZA 1KU9A 3TP3A 3K6GA 3G1OA 3RJPA 3FK7A 1FWZA 2FD5A 4WWCA 1WFXA 2OV7A 5ICGA 1AHDP 1YYVA 2QYOA 2ME6A 2FBIA 4FX4A 3NAUA 5HS9A 1PUFB 4BE2A 3J7YJ 3I9V2 1DU0A 5FB2A 4GFBA 5LGTA 3OYDA 1BC8C 4XMYA 2A07F 4BE1A 4FE7A 3PIPF 1S7OA 1ETQA 3O2PE 2ZXWH 5CVRA 2HOSA 3IAM2 3FXQA 1MNMC 2F5EA 2LYCA 2O61A 1S9HA 2P7VB 4X1EA 3JRHA 2VONA 2YUSA 4E7SA 1WVRA 4JX5A 4XBFA 2CV0A 1FY7A 2H8RA 1YS6A 1H88C 4PGGA 4HRIA 4KNYA 2EFOA 3A02A 1IRGA 1Z7LA 1MBEA 4II2A 4XOTA 4ZJZA 5L3FA 3J7AO 3CC7I 1N25A 2P6SA 4BHBA 1T38A 4I6ZA 3QPSA 1B8IB 1ZYRF 2IXSA 1LEAA 5F04A 4CA0A 1MMNA 3OOPA 4OIRF 4HAMA 1LJ9A 1VF9A 3IWFA 4PSXA 5CKTA 2A6EF 3W2VA 2V6EA 4A3JJ 4IQ4A 2LH9A 3FX3A 4D1QA 2DK8A 2F4OB 2E34A 2BY2A 1UHMA 5GPCA 2FRHA 2LG4A 2A69F 4M6VA 2IT0A 2HPIA 5DEQA 2VKDA 3CCUI 3ML6A 3ECHA 1FBQA 5F1JA 3FF5A 4NUBA 3PO3J 4HYEA 4EM1A 1FYKA 2R7SA 2HOTA 2QLZA 3PQJA 1MJBA 2RQPA 2Z2SB 3BR5A 1LKXA 4BHPA 3JRBA 1IRXA 3F8MA 3WE2A 3HTSB 3CUQB 1MJAA 3IAS2 3QYBA 1XGSA 4F55A 2JPCA 1SAUA 4ESJA 1QHGA 2YPRA 1TQMA 3EUAA 4YEJA 3CQZJ 1U0JA 4M3GA 4NC7A 2XVCA 4W97A 4DZJA 3FXKA 3JTHA 3MD2A 5E1WA 4CICA 1JTXA 1KU7A 4I7HA 5IP6A 4KISA 5EEGA 3O6BB 2ELKA 4WF2A 3RIRA 5LD2C 4IHWA 3M1CA 3TKYA 2R7ZJ 4AWXB 3V7SA 3LFKA 4PK4A 3H35A 1D1AA 2MA3A 2XPVA 1JHFA 3R0AA 5HLGA 2OUMA 2CQXA 3FIWA 2FNPA 3HRUA 4DQ2A 1QPMA 3RTRA 2WBMA 1ETXA 3KE2A 1YRNA 1B72B 2ZJQF 2M4KA 2L5QA 3DCFA 1Z77A 3KZIC 3GVAA 2DMNA 4II3A 5E17F 4JK1X 2R5YA 4IRHA 3ZMDA 5BQTA 1UG0A 2G7HA 3R0JA 4H0EA 3A4CA 1SVMA 2KIUA 3L2VA 3SDGA 4UB6C 3VODA 2V6CA 4I2OA 4UUVA 3JSOA 2AXLA 4BXXJ 1IN7A 5K1YA 2M4GA 4EM0B 5EYRA 2NVTJ 2COMA 3N4MA 2NVQJ 3S2HJ 2Q0OA 3FXLA 2HQNA 4HLXA 1N78A 5EDNA 2QSFX 1J09A 1ZG1A 2ADUA 2FBHA 3VSKA 1QU3A 1TL8A 1DPUA 2P6TA 3OYKA 3WU0A 4M72A 4RAZA 3L2WA 2W84A 4U87A 3P9IA 3H3UA 3VYUB 1FOKA 3S3OA 4KUMA 4C3IJ 3L2UA 1VQ5I 2ISYA 1IV6A 2RQQA 5IOYA 3KEOA 5J8CA 5LEJA 1QPIA 3E0JB 3D1NI 1JTYA 3MZ8A 1OMIA 2J5OA 3FDYA 4PJMA 2H6BA 4LB6B 1CF7A 1W36C 2IW5A 1WCMJ 2V1NA 4A3KJ 1HW2A 3PNTA 3O8GA 3ERED 2QKLB 2V26A 4HPQA 3B73A 2GWRA 3GUDA 3OY9A 3LSIA 5E8GA 3I53A 3WE3A 1X2MA 3QAHA 3DV8A 4HNTA 2L54A 1R5HA 2DYRH 1TQIA 1ENHA 4KFCA 1AOYA 4NQWB 2F4MB 4ZYDA 3ZPLA 3GTMJ 2QBYB 3JRFA 5AIPA 3OL3A 1I5ZA 2MFZA 2KHMA 5DCMB 1ZG5A 2M34A 3HDDA 4EGYA 5BPIA 2DA2A 3IH3A 2MABA 1OISA 2BXZA 5F64A 2HOEA 3VYRB 2PFBA 1FNNA 2V4JC 4KN4X 4XLCA 4RGUA 4DNCA 4UUTA 3VB2A 4BEHA 1UHWA 1I50J 4BH9A 2JA8J 4CSWA 3TDZC 3M8EA 1NHAA 4YFKF 3MQ0A 2HKOA 3I59A 2ESNA 4L9VA 1ZHFA 2EQRA 2M0MA 3SJMA 4QPOA 2FJ1A 3G73A 4IZZA 3V42A 5F1RA 3W2AA 1I1SA 1U78A 5BMZA 4OAZA 2XGXA 2K9MA 2L7KA 4U7BA 1RNLA 2JWTA 2K3FA 3GEZA 3HM5A 5TRDA 1JGGA 1ERDA 4EVIA 3H9QA 5FGMA 3UNGC 2EZLA 4KITB 1S72I 3CD6I 1ULYA 1UJ8A 2EPFA 4XLEA 1X1AA 3OSGA 4EM2A 4EV0A 3G1MA 4Q5SF 4BBRJ 3FBIB 1WQ2A 4FX0A 3LQRA 1R00A 1Z3XA 2LK2A 1MW7A 3KYCB 5DM7F 4KT6A 4N9IA 4U7DA 1P6RA 3ASNH 5D8KB 1E0EA 2E7WA 3WG7H 1Q1HA 1D3YA 2RVCA 2O3FA 1L0OC 1ETKA 4R79A 3CMYA 2V79A 2EZKA 3DPTA 3RYPA 5IP7J 2E5NA 2R5ZA 1ZK8A 3BC8A 2FNAA 1H89C 2ZC2A 3VPRA 2VOPA 1G2HA 4CH7A 4RBOA 1YS7A 1O3RA 2HDWA 4LD5A 2DJNA 3GFIA 1ZGWA 3MVPA 2IS1A 5AONA 1OQYA 1OJLA 3QP5A 3A0HC 4HLYA 1VQMI 1VQNI 2HOAA 1AU7A 2CUJA 3KFWX 1Z05A 2RDPA 3FZVA 4RM2A 4ETSA 3U1DA 2GIVA 2LD5A 1LEBA 3CMMA 2XAFA 4LLNA 5CYVA 4DW6A 2IPQX 2MBFA 4KA4A 4EJWA 2R93J 4BBSJ 2VASA 4UNOA 5FKOA 5DTDA 5LFAA 1SFUA 1BR2A 1Y1VJ 2PBIA 1VQ9I 3JTGA 3DWLE 2D5VA 3DKYA 2DMTA 2R7RA 5GAEJ 2BZTA 2ELHA 5HS7A 3I71A 5LEKA 1LE8B 3OOUA 2VQHA 2LY2A 3F8CA 3KX2A 3K4JA 4U0YA 1BR4A 5BNGA 5F0CA 3IHUA 1XX5A 2EIMH 2BYVE 5KAIC 1MBJA 5L3DA 4M3BA 2DMQA 3TL4X 3CMEI 3TW7A 3CCSI 2DTZA 1GDTA 4GYIA 2VODA 1KONA 3HOYJ 1ODDA 2P81A 1ZR2A 4O3MA 1R22A 1DGWY 2EFWA 1JT0A 3HOSA 3VSLA 4DYRA 4ABZA 1XN7A 5IT9Z 5HDKA 2HPMA 2KT0A 3KP6A 2K02A 1LPQA 2HZTA 4TV7A 4M6XA 5DD4A 2MW8A 1TW3A 4A69C 4UHTA 5GTHC 2ZBKA 4I98B 3UKGA 1SFKA 2H8WA 2MD0A 3FK6A 4AUXA 3REOA 3ABUA 4RM3A 1HOMA 4EQQA 4BJ5C 4D7MA 1D0XA 1T95A 1JKQC 1KYZA 1Y6IA 3CZ6A 4KMUX 5HNHA 2NNYA 3I55I 4BYYA 4ASNA 3HOXJ 4AM3A 1Z3YA 2D2WA 2W7NA 3BR2A 4GO1A 2E60A 2XHKA 2EA4A 4XOPA 4A93J 3LAJA 1MNEA 2Q1ZB 3EUKL 2QWWA 1UHSA 4CYCB 5FFXA 2L02A 3E3VA 2LOOA 1Z6RA 1R5GA 2A5WA 2VE9A 3BJ6A 1H0MA 3BG7A 1A35A 4FISA 3BDDA 3MKLA 1PUFA 1JHHA 3DEUA 1PVEA 1TLHB 1QA6A 3LSHA 4E6KG 4RGSA 4PJLA 1YTYA 2XGDA 1USTA 3S17J 1I39A 2EH3A 3OIPA 4NHJA 1MBHA 2JA5J 3S93A 3K4CA 1WJCA 2OQGA 2WWYA 2LR8A 1SMTA 3OIQA 4LG0B 1JI8A 3FBNB 2VLAA 1T0FC 3LSTA 3KP4A 2H94A 1WJ5A 3OV8A 1MH3A 4LK1F 5C4XJ 4RAGA 4EEFG 4A6DA 3QRFF 2HQRA 3ZQGA 2M3AA 1JJ6C 1HKTA 2PMZN 1OCRH 1X2NA 3LWFA 3ZR8X 1K7AA 1B8IA 4CCNA 4PSWA 5LHIA 1YW9A 2KFDA 3VWBA 3ZQIA 2E2IJ 3DTEA 4IOCF 2EFQA 2NS7A 3FISA 1W7PB 1FP1D 2NVUB 1WZ2A 1N75A 4IO9F 3HHHA 4CCKA 1TWCJ 3QPLA 3F8FA 2FE3A 1XDUA 3BZCA 3S1NJ 4XL9A 1XGNA 4CYDA 4Z2YA 1OYYA 4BNCA 2TDXA 1VI0A 2KQRA 2QA4I 2DMPA 1YJ9I 4EGZA 1N77A 3MKYB 5HDNA 1DU6A 3VYTB 2KP6A 1IAWA 3T8RA 2MD5A 5L3GA 2LRDA 1S6LA 4F3QA 4H4KC 3K4MA 1V4RA 3A01A 2R7VA 4HV6A 4DYQA 2DA4A 4BDYA 1XSDA 1USSA 3L1PA 2GXAA 2Q2EB 1EA3A 3OYCA 4F93B 4KDPA 2JRMA 4UVBA 3V7CA 4HQMA 4AYBA 3IH4A 3I3LA 4B48A 3T5XA 2VIXA 1IGNA 2HS5A 1YHQI 5FFZA 3PQKA 2STTA 1TNTA 3QYEA 2G7UA 2KMUA 2Y9YA 2BW3B 4KN7X 4B3AA 4RDUA 4PZJA 3FKJA 3TQNA 3CO6C 3P9CA 2UUZA 2ZXIA 3S2WA 5K7HA 4MQ9F 5AIQA 5CVIA 2DPUA 2G0EA 3DP7A 2L0KA 2WV1A 2Y69H 2V9KA 2UV1A 5JFRA 1IDYA 3ZMUA 1UZCA 3F8NA 4M9ZA 1B72A 2Y31A 3G3ZA 3CJNA 4AU7A 3BQYA 4S04A 4X6AJ 1R5ID 3P5JA 2RAEA 4V2GA 4RAYA 5HLIA 3GCMA 4RMNA 5FJ8J 3HKZA 3HUGB 4HOBA 3Q9VA 2RNJA 1IO2A 2VXZA 4J01A 2XAHA 3LMMA 4I99C 2OCCH 2K9LA 4BU2A 3QP6A 3WTYC 2HXOA 3ZQQA 2KJBA 2QQAA 2KL4A 5J6XA 5ILSA 2ICWG 2PQ8A 5CPRB 3FXRA 2VQLA 5ERIA 1UMQA 2WC2A 4ZZDA 4YIIA 5M5YJ 5C3EJ 1SD4A 4RB3C 1T2KA 4AIKA 5FKNA 3A1YA 1WWXA 3WG9A 1MMGA 3HJEA 3OSFA 3MZYA 1R36A 3QPHA 4IVNA 3F72A 4D7NA 2W82A 4J19A 1SANA 1X1CA 2HYFA 1JE8A 1ZQ3P 1BBYA 3CC2I 3GW2A 4C2TA 1P4AA 2XRLA 2PJPA 1LVAA 1G3SA 4AYBN 2YS9A 2ZB9A 3COAC 3JREA 4UVCA 5KCMA 4Q47A 1WI3A 3D5RC 4DGWB 3ZXSA 3SHFA 4AIDA 1FTZA 3BZ6A 3SDBA 2LVSA 4ESBA 3OS2A 1C0WA 3HGYA 2K9NA 3LSMA 4E7HA 2AS5F 4NQWA 3WTSC 2CFOA 4DZPA 1Z67A 3KP7A 2XF7A 3EYYA 2LF7A 1QGPA 3JR9A 1EJ9A 2LDUA 1F9NA 2OBPA 5LRRA 4ANJA 2MLKA 2UZKA 4YRVA 4F7ZA 2KKOA 3RCOA 3RKWA 4XLAA 3LSJA 4D9JA 2QSHX 2DA6A 2RNGA 2E19A 1ONVA 5GAGJ 2FF4A 3E5XA 3FXUA 5F6FA 4QSHA 4ENKA 1YIOA 3NWSA 3CCMI 1MJ9A 5D4SA 5D5XB 2IJLA 1JKOC 1Q1VA 2O5RA 4IX7A 2R7UA 1TT5B 4XKBA 4LK0F 1LDJA 1D8KA 2XASA 2XROA 2IS2A 2WAEA 1MBKA 3ECOA 1FEXA 1PJRA 4CCJA 3RKQA 2P8TA 1G3YA 4XKWA 1ZR4A 3IP4B 4IF4A 3PFYA 1HDDC 1I6HJ 2GIZA 1J2XA 3FXOA 1Z7UA 2NS8A 3GLXA 4B3XA 1V5FA 2NVXJ 2RREA 5L3CA 1VTNC 4Y33A 2FQ3A 4G6TB 3OYGA 3E6DA 5GP9A 4G9YA 5M5XJ 3CUOA 3RSNA 4HW0A 1CGPA 4ENNA 2FUG2 3GZNB 3AAFA 3A03A 1RPWA 1IF1A 4FCYA 2DA1A 1RC9A 2CQNA 2LKSA 2QEXI 2DQLA 2I5UA 4B09A 4A3EJ 1E3OC 5D5WB 5HNFA 2R4GA 5LBQA 1YITI 1OKRA 4XN3A 5J4VA 3ZOBA 4ZDLA 3QWLA 3E1SA 2O0YA 2K85A 2OA4A 4ESFA 3PFIA 3OS1A 2I8DA 4M3DA 1KA8A 2A3SA 5F27A 1EH8A 1Z1DA 1GV5A 4RB1A 2R7XA 2XB0X 1Y1WJ 2LREA 2XF5A 1HXDA 3F6OA 3AG3H 4A3DJ 4CO8A 4X0GA 4HSRA 1W5SA 1TWFJ 4XSXF 3GFLA 2CUZA 2MC4A 3CJQB 1LE8A 1EV7A 2L4MA 1VQKI 2VN2A 2OPTA 3WHBA 2CSOA 3CDIA 1X1DA 3ELKA 3Q0UA 2IA0A 1VQ4I 2KISA 5J3LA 1SEUA 5IOZA 3T1BA 3I56I 2ZJRF 4WX9A 2EFPA 3BG3A 2L3DA 4QWQA 4JX6A 2MG4A 1M1EB 1T8IA 4Y17A 3E5QA 3S1RJ 3CP8A 4UUSA 1FC3A 4UB8C 1J75A 2KJCA 2HGCA 2IGMA 1BL0A 3WTVC 3ZQHA 3IC7A 4C2MJ 2R92J 5B5EC 4IHYA 5M3FJ 1FP2A 2VOOA 3Q3SA 3QPTA 2X1EA 4XLFA 1OCPA 4N0BA 3HYIA 4F91B 4MO7A 1LQ1A 2AXTC 3BCBA 2WB1A 3OR1C 2P5VA 5KAFC 3VEPA 3K70C 2F5VA 3FHNA 1MGTA 3BWGA 4ZC3A 5ILUA 2HTJA 1P4XA 2DA7A 5GADJ 2BGCA 3H3ZA 4LIUA 2FOKA 1OFCX 2HDDA 5JHFA 3MMYB 2VJJA 3WU2C 1FZPB 2EINH 3PUFA 2LMDA 4OIPF 2VXDA 3F3XA 4HQEA 4HZFA 1F1ZA 4LMYA 2CUEA 2K4JA 4KIBA 4HF0A 4AVZA 1D1CA 4FTHA 2AO9A 3L00A 3C1DA 4AIHA 1VQLI 5E8IA 3CCQI 2YR2A 2H09A 3QU3A 5L3BA 5LGNA 4BDZA 3F6VA 1WKMA 2CRGA 3TP0A 1MZBA 3RKXA 3HZJA 4G7OF 1KQ8A 2M30A 3S1QJ 5DD8A 4E70A 1R4MB 5ILVA 2BY0A 2R7OA 3MAJA 1ZN2A 4LG0A 1FMVA 2V9VA 2XUBA 5A2QZ 1PUEE 2E35A 1XSVA 1SD7A 1VQ7I 2IEKA 2IP2A 3G71I 3J81K 3HPGA 1O7FA 1X58A 5E18F 4ENMA 4XONA 1WH7A 2JJ7A 1F36A 1TC3C 3DEWA 2VPLA 1WPKA 4BY1J 3R6SA 3B02A 4L5EA 1FOYA 2CFXA 4UV9A 2HI3A 4UV8A 3RQIA 1R71A 1BJZA 5ED4A 4WXHA 2Z16A 3IUOA 2DYSH 3TGNA 5FLMJ 1IN5A 5LHGA 3K4LA 1RKWA 3WHCA 1P7IA 2RV8A 5H6RA 3BG6A 4MIMA 1YJWI 2H27A 4LLLA 2DT7B 1RZ4A 1W0UA 2J5PA 3M9AA 2VL8A 1ZH5A 5F0HA 3RYRA 1K6OA 2MH2A 2E1NA 4Y3OA 1FLIA 2JSCA 3K1PA 3GTPJ 2FA5A 2K9SA 5JLXA 3IRQA 2VBWA 3BY6A 3CCYA 2CW0F 4N9HA 4J00A 1L3LA 1F4KA 3S1MJ 2N8GA 2OQRA 1OR7A 4BHCA 3ZMTA 4DJAA 5HODA 4IOAF 3WODF 2STWA 1KQ9A 3M8FA 1FBUA 4LFUA 1XMXA 4WCGA 2Q2EA 3J7ZI 2IA2A 3EETA 2F4IA 3H5NA 4GXOA 1Y8RB 2Y2ZA 4BL0B 3D0SA 4JP0A 3EQLF 2CU7A 2Y0SA 4L5JA 2L9NA 1IZ1A 4DBQA 1V3FA 1POGA 5HVQC 1O3TA 4BXFA 1HKQA 2EWNA 1QZYA 2XGEA 3ULQB 4ITVA 5BPDA 3E6CC 1U3EM 2DTRA 2RKHA 3V4GA 1MD0A 2A5YB 4BAYA 2EV6A 3OMYA 2GXBA 1X3WB 2QQBA 1K79A 4G6QA 1IXCA 2M9HA 3IH2A 2VJ5A 4U88A 3OWTA 4E7LA 5GPAA 2JQ7A 2NOJB 2ZNYA 4P55A 1UB9A 1B1BA 1BIBA 3R60A 1JUPA 4BQQA 3I5UA 1UELB 4D5FA 3S3NA 3I64A 2HR3A 3DPUA 4Y7NJ 1LUJB 4OWRB 1ETWA 4A6EA 2BXYA 1R7JA 4C3JJ 2ZSIB 2A68F 1X3ZB 3H5AA 1RRJA 3BQZA 3GF2A 1YI2I 4IL6C 1R9TJ 1P92A 1KYWA 3K0LA 1FOWA 2EBIA 1JUSA 3C2HA 2M2EA 2L9RA 2EIKH 3QYFA 1Y0UA 3E5UA 4A12A 3EYIA 3OYFA 1YO5C 2CMPA 2TCTA 1H9GA 3FM3A 2M87A 2JA2A 3QOEA 1K4SA 4HSTA 1TQPA 5FLXZ 1W0TA 3HBLA 4IHXA 1GVJA 4EJTA 2W48A 4DYCA 3CCLI 3CJTB 2E5ZA 1ZG3A 4BUPA 1ZRDA 4IRGA 3Q5FA 2KRHA 3GX4X 2YSRA 2PLYA 3L2QA 2WADA 4D5CA 2PJRA 3HRTA 2PI0A 4MGRA 5CQEA 2B9SA 1U2WA 2UWMA 4CCMA 1TWGJ 1QO0D 3CF5F 4MLOA 1K78B 2VBZA 2WY8Q 3Q9SA 1S7EA 3HL2A 1IRZA 2A6TA 3V8JA 4M9SA 1ZREA 1T56A 2ZSHB 3S8PA 4FE4A 2MGQA 1BW6A 3S15J 3GZ5A 3DBRB 3P7NA 2LLKA 5J4YA 1X1PA 4XRMA 1WJAA 1FMWA 5JLWA 4YFNF 3PO2J 2FEZA 2OD5A 1XG1A 1NG7A 2YU9J 4RS8A 1R1VA 3AKZA 1W1WE 3CCRI 3CF2A 2OTJI 4S05A 3DKWA 1DP7P 5L3EA 4A0YA 2L7FP 4P9FA 3OYJA 2R7TA 4CCOA 4GCVA 4G6DA 1JT6A 2XB5A 1TNSA 1JXSA 3RKYA 4B47A 2A6HF 1U6GA 5IPAA 2LTPA 1O4XA 3K7AJ 2ECBA 3LQQA 4ZYEA 1J9IA 4OAYA 2ZKZA 2R5YB 3BT9A 3CLQA 2JSPA 4FT8A 3D5LA 4E7ZA 3HRMA 2OF7A 3GTLJ 2BBYA 3GYHX 5LGUA 4XRSG 2X6OA 4P5OA 4GDFA 2FXAA 4UY8I 1MIJA 3KCCA 5BS6A 3FXJA 1A6IA 4Z6YA 3GFJA 4HX4A 3U9GA 3QQAA 3BOQA 3HB9A 3HIFA 3ROUA 4WK8F 2HVRA 2DFIA 1ETOA 1HW5A 2JRTA 4P96A 3WTXC 1ETYA 3ZCOA 2ZXHA 4GYGA 2XSJC 4JOMA 2BY3A 2LKXA 4I01A 3IRRA 1YX3A 3BJOA 2CUFA 4AD9A 5K5RA 2Y0MA 3H9GA 1QBJA 2OC6A 3BR1A 1CF7B 2L7ZA 3F22A 5E3NA 2VBXA 1YFHA 2BE5F 4IHVA 1LDKB 2XRNA 3GFMA 4PJNA 5TJJA 3G6EI 3ZQCA 3BPVA 4KYWA 2FMYA 3W6KB 2O6GE 2XIGA 3FMRA 5FKLA 4M3EA 1MMDA 3TDUC 3HOUJ 2WTEA 1GXQA 1YIJI 4EMSA 3LAPA 5CVVA 2Y48A 3FMQA 4XSZF 2E36A 1IG7A 1TW2A 3ISPA 3K2AA 5FD5A 1MBGA 1BIAA 2VE8A 2ID3A 3PNVA 3EUHA 3I4PA 3J7AY 4BKXA 1R4NB 2X0LA 5H2FC 4XICA 3DPLC 2CG4A 3CUQA 1LFBA 4IXAA 3C2BA 1SAXA 3I54A 2Y9ZA 3EDPA 3N97A 9ANTA 4YELA 2DOFA 4NBQA 2EA2A 2IAIA 2EK5A 1BOBA 1OCOH 4XM3A 5H6QA 5M5WJ 2MSYA 5E79C 1YE9A 2W85A 2DMUA 3I4MJ 2NS0A 1O7LA 3U21A 1ZLKA 3RZOJ 3ASOH 3G1LA 1RR7A 2PMUA 4LGWA 4A2UA 5ICFA 2Z9OA 2NYXA 4OOIA 3JW4A 2DJIA 3C18A 2DDBA 1UFMA 3MKZA 2KIFA 3ZQ7A 2VC0A 2Z5UA 1O3QA 2B63J 1D5YA 1TT0A 3PSFA 2ZMEC 1BI3A 1XCVA 5DYMA 1TZLA 3SXYA 1Z21A 1FIAA 2LBFB 3RI4A 3H1CA 2JUCA 3M8JA 2XC7A 3KLOA 3DQVC 5EG0B 1XMKA 2HWVA 2KZVA 3M1EA 3LSPA 3HXLA 3WTTC 4HDUA 2IGOA 1HQCA 1OYIA 3K4KA 5IT3A 4E4HA 4EJOA 2Y75A 2FX0A 1W7PD 2BY1A 3H3VK 4Y15A 4KIFA 1IDZA 1K6YA 4OMYA 1QVUA 2W4SA 3J80Z 4XNFA 1BOAA 2M8GX 1XC5A 2MH9A 2B0LA 2W00A 5CJ9A 1QVTA 5IP9J 3JAMZ 4Y4RA 1ZARA 4M71A 5JHUA 1GHCA 4BS9A 3DXJF 2HKXA 2K27A 1RESA 4DIQA 3LSRA 2JT1A 2OAZA 5IYDJ 1XTAA 1BM9A 5K5OA 3HSEA 3HC7A 4DOZA 1QQIA 1NG6A 3GO5A 1Z9CA 1SVLA 1U5TC 1YLFA 1SFEA 1HKSA 3HOWJ 4LOCA 3JRCA 4U0VA 2DCEA 2Y30A 5DM6F 2DPDA 3L2CA 5LLQA 5KK1A 3BCAA 1DGRM 3MFKA 1W36D 1A31A 2K40A 3KP3A 6PAXA 2H1LA 1LNWA 1J7KA 2NXNB 2QF7A 3C7JA 4B1RA 4HG2A 3FXMA 2DA5A 2W24A 3ESWB 4PUSA 1E3HA 2DI3A 5E3MA 3MZHA 1R6RA 1I27A 3BG9A 2IBDA 2E1MC 2HYGD 2L4AA 2VKEA 2HVQA 5EZGA 1HF0A 2D1HA 2CV1A 5FLVA 1R1UA 2VBYA 3LA2A 4O6JA 4BQOA 5EGOB 1ZRFA 5D8LB 5FRMA 2UXXA 4JX4A 4E7JA 1BI1A 3HGGA 2V1XA 2R7FA 2M5WA 1WRJA 1AKHB 2IRFG 3CP2A 2QBYA 2WA0A 1KZHA 2HNHA 2L9SA 2B7EA 1W4MA 5HDGA 4RAFA 1SMYF 2ETHA 4L9NA 2HEOA 1FTTA 2PMHA 5HS8A 3GTOJ 1X4PA 5DCMA 4CXFA 4W1UA 2O9LA 2ZFUA 1QNTA 3Q0VA 3NWTA 3S3MA 4IRIA 2M0CA 3DU6A 5FD6A 2ESHA 2YX7A 5J1UA 3RPUD 2VPRA 3SEZA 1K83J 4CDGA 2P5KA 1R23A 5DS9A 4S0HB 1RR8C 1ZRCA 1XCBA 2LFBA 2WAQA 1D8JA 4RB0A 1VQ8I 3F9KA 5JI6A 1G6NA 4LITA 3HG9A 3WTUC 2BHYA 2P4WA 4D0PA 3OS0A 3IV5A 2X4HA 2R7QA 4XKVA 3JCUC 3CO7C 4G7ZF 4MQVA 3TBIA 1DPRA 1FBSA 2QCOA 3F21A 1HCRA 2COBA 3HKZN 4I09A 1FX7A 3CCVI 2NNNA 3CCEI 1VQOI 5J1YA 3HOZJ 4BJ6C 2IVMA 1QHHD 3K69A 2DA3A 3FKIJ 4XKCA 1R49A 2PX9A 4CGZA 3ZRGA 1PP8F 3ABLH 3H36A 3MEXA 3GWZA 3JRGA 5EEHA 1T39A 1REPC 2JN6A 4NDLA 1S29A 2M45A 3VOEA 2P5LC 2OTLI 4M9XA 2R7WA 4L9JA 2HU9A 5ICCA 3L9FA 2DO7A 1J5YA 2VQGA 2BOLA 3PL8A 3KLNA 3PJRA 3K9TA 1E17A 1XSXA 3H5RA 1WSUA 1HBXG 4RLFA 1FT9A 2QSGX 2F5FA 1A04A 1F5TA 4EJUA 4JBAA 1IW7F 2JZYA 1KU2A 5J8FA 2FU4A 5H20A 3ABKH 1V5GA 5FLXK 2XAQA 2W1OA 3SZPA 4ZDPA 2Z99A 4HX7A 2XAUA 3OR2C 3HSFA 1K61A 3CDLA 4AC0A 3ZN0A 2LF8A 3A2KA 2XPWA 4A3CJ 2ECCA 2MC3A 1MSEC 2EIJH 2NRAC 1DUXC 4B4CA 1WI9A 2DOAA 1S5LC 4K2EA 2IS4A 1B9NA 3CCJI 4KMFA 3LSKA 3TOBA 2DDAA 4A5NA 2X85A 2KDOA 3O3KA 2GA2A 3KP2A 2PEXA 4N4OB 3WTWC 2XAGA 1DDNA 4L0YB 3FHZA 2E71A 1ZAOA 1WJEA 2K9QA 3ONQA 3WGHA 2VJIA 1NK3P 5IT9K 1P9QC 2ZFWA 4IKFA 3GLLA 3KPHA 5JR3A 3L2RA 2ZJPF 2WAQN 1GT0C 3CDHA 2X48A 5K7FA 1MBFA 2EILH 2OJED 1FPQA 3KZYA 1UAAA 5HLHA 2K4BA 2QZ8A 1S8NA 1HW1A 1J0RA 4HNVA 5DUKA 3M7GA 4MTEA 2DN0A 3W6VA 1WJBA 2CQQA 3A01B 3ZQLA 1K78A 2ISZA 1OCCH 4FQGA 2HYJA 4BE0A 5C44J 2DLLA 5KVRA 2KLOA 2FQ4A 4HF2A 2X6WA 5KNLA 1QRYA 4FASD 2VQCA 2EZIA 4OMZA 1Y56A 2FMLA 5E20A 2L01A 2KRFA 3KYDB 3ZMVA 3RPQA 3CLOA 3JSPA 2LC2A 1OPCA 4IHTA 3S14J 1DQUA 3H0DA 2QENA 1XD7A 4N4NB 2EFNA 2X1DA 5EZHA 5TGTA 2CV2A 2VT3A 3DF8A 1A5JA 1LDDA 2XKPA 2R3SA 2GOXB 5B1AH 3WU1B 4R8HA 2QQ8A 3G4SI 4ZH4F 1H9TA 2L7MP 1GV2A 2JK3A 2FOWA 1SFXA 3U1KA 1CQTA 5ICEA 4E7KA 5FKMA 1ON2A 1T33A 2IA1A 1VQPI 1T6SA 2QGUA 3HEFA 5E1ZB 4CYCA 2ZXJA 3LL7A 3FM5A 2EV5A 4Y52J 2VB6A 1G3TA 3R4KA 4L9TA 1I1GA 4RA2A 2KIMA 3D5SC 2JPBA 3ABTA 3JRDA 3P9KA 3NEUA 4HV5A 3L7WA 5D5VB 3ZN1A 2VUMJ 5B3SH 1PP7U 1G59A 4CZCA 1IUYA 4CHUA 2KZGA 4I0BA 4RB2C 2HVSA 1SC7A 2P7CB 1HSJA 2ZMEB 4I76A 1UCRA 2GBYA 4M73A 3E6BA 3C3WA 1GLNA 4PDKA 3BJAA 2M7BA 2CQKA 2QM3A 4GRIA 4RLQA 5KHDA 1LFPA 2X9DA 4YG2F 1OR7C 1HSTA 1ZGAA 5CVJA 1EH6A 5E3OA 1KGSA 1WJDA 2KPMA 1FOXA 3K2ZA 4LLGF 1TTYA 3EPZA 4HNUA 3GMEA 3F0CA 4YFXF 2XV4S 1LFUP 2Z33A 1Z0XA 1HDPA 2JMWA 1W7PA 2F5DA 4HF1A 4RGXA 5EJCA 1D0ZA 1ACIA 3BTJA 4G94A 2V1DA 1MDMB 3C2GA 4PCQA 3F23A 3I0TA 2VKVA 3AG2H 3TO6A 1NK2P 2VJ4A 2BVMA 2CYYA 1VZ0A 4LIVA 3PIOF 4OIOF 4MEXF 2XGCA 2WB1N 2IS6A 1GXPA 1XDSA 4XLHA 1RIOH 1P2FA 1I3QJ 3FWEA 2HFHA 2OU2A 1U5TB 2M7AA 2OZUA 4M74A 3UR3C 1WH5A 4C2UA 3A0BC 5GAHJ 2AHQA 1ON1A 1ZKGA 1S3JA 4XRFA 4AIJA 1KU3A 4F92B 2IGNA 2H6CA 3HHGA 2E2HJ 1FYMA 1ZLJA 4UXNA 1XPXA 3AFHA 1E3PA 4BY7J 1HLVA 1ITYA 1O57A 1PYVA 3DLLF 1B6AA 4KJZA 4XK4A 3OYIA 3VDXA 1BR1A 2PN6A 5D4RA 5CVUA 4UVAA 1OLTA 2E1OA 3RDIA 1X4OA 4IJAA 1T08B 3K1MA 4KIGA 1U8BA 1XGMA 2UXNA 1TWHJ 3TMOA 1K4TA 2E1MB 1GUUA 1JKRC 4XQFA 3KETA 5FRNA 3H9JA 1JUMA 2BW3A 2XF6A 1X3UA 4ZZLA 2GA1A 1IC8A 1MMSA 3DBLB 3JRAA 3NARA 3ZMZA 3I58A 1R58A 1DP3A 1I3AA 2XSDC 2K7LA 4G12A 3J80K 1OCTC 3GTJJ 3BR0A 2XDVA 5LRSA 5EEAA 5IYCJ 2CQ7A 4A3MJ 1BA5A 4C9YA 2M1BA 5FO5A 1MSFC 3JAMK 4QLCU 4BQAA 3CJRB 1MNDA 2BV6A 1FJLA 2LBFA 3QOPA 3T0YA 3SEQA 3GZ6A 1STZA 3OYNA 2QUFA 3DLAA 5EG0A 2DK5A 2HXIA 4BQNA 2GQQA 3X2QH 2CW7A 1HA8A 2P0WA 1B9MA 1MMAA 3RPUA 3TOAA 3BROA 4ZTFA 4IEJA 3T8TA 4PFPA 1EH7A 5K7ZA 1X19A 1TWAJ 2O8KA 3SQNA 3IL2A 3GTKJ 2O7OA 2GM4A 4ENJA 2JUGA 3WTZA 2DT5A 4QPQA 4XIDA 3HUGA 2CGPA 3AL0C 3OYMA 2E1CA 2DFEA 5IYBJ 2X1CA 3BTLA 3OYEA 1AWCA 2I10A 2ME0A 4JYKA 3PUBA 2BEOA 3KZZA 3DTKA 5BOXA 3BTIA 1P4WA 2A61A 1OCZH 1QZEA 4CUGA 2AQEA 4FETA 4AVPA 5TISC 4B44A 3IKTA 4O5VA 2VKHA 2HQ5A 2GXGA 1SD6A 3WGIA 2MLGA 3ABMH 3MWMA 3WGGA 3CC4I 1U8RA 4PFOA 1EKEA 2NVYJ 1YOVB 2YX4A 3DTIA 1IUFA 4CCLA 2GOMA 3K4BA 5DV5A 3I4NJ 4ZYAA 1GVDA 1Z6TA 4R1HA 2FBKA 4A3LJ 4IHSA 2K86A 1E2XA 3MN2A 4DBRA 3RZDJ 1EF4A 1IXRC 3IWZA 4CZZA 1Y8QB 1U9OA 4QTRA 4NNJA 4LB5A 2LY9A 2DFFA 3LNQA 3E97A 5K5QA 4B8XA 2CS3A 2Y0SN 1FSEA 5DDGA 3IKVA 4EJVA 2C6YA 3AG1H 5EGOA 1YW7A 1ORKA 2PMZA 2HDCA 4HEA2 3BP8A 1BI0A 4M6YA 4UUSB 1V54H 2FSWA 4I0AA 1AKHA 2AQFA 4C3HJ 4P1WA 2DXIA 3KYLA 4XORA 3KIOA 3DFGA 2E7XA 4PJ0C 1YRNB 3DU5A 2V1UA 5J47A 1P7JA 1XGOA 3TW6A 3F8BA 4MNUA 2DT6A 3DEEA 2DFHA 2H1KA 1LVKA 4MHGA 1O3SA 4QIWN 4ZDOA 2V9PA 3PSIA 3ZMSA 4NB5A 3ERMA 3V7RA 3CMAI 5JVGF 4MTDA 3DBHB 1IV8A 3B6CA 1V5EA 5C4JJ 3BR3A 4HA8A 4I02A 2JA7J 1YG2A 2LKPA 4BXUA 2JVGA 2GZWA 1IRFA 1HC8A 1RETA 5CQGA 1Z91A 1PDNC 3W3CA 4YIRX 3OIOA 1G8XA 2OZ6A 2W57A 3TO9A 3V8LA 4C30A 1IN4A 2F6CA 2F48A 2YU3A 1BI2A 1G3WA 1S7AA 4ZTJA 4ON0A 1Y39A 5B1BH 2CW8A 1W5CC 2LNBA 4RGRA 3CESA 1A36A 2K5CA 4OIQF 1X1BA 3BPXA 4IPAA 3EUHC 1BW5A 3OL4A 5IY5H 4Q4ZF 1KQ0A 4OINF 4NC6A 5JVTA 2ZNZA 1BJAA 1B59A 3CUQC 4YIFA 5LHHA 3KEQA 4LG3A 3CTAA 2TRTA 2DW4A 2NAZA 2ZJ2A 3ZGKA 2CWEA 3SFIA 3BTCA 2JTVA 2ELJA 5B66C 4L18B 3GTGJ 3HPHA 2G9WA 2L9VA 5HLTA 3W6JB 3AG4H 1IXSB 1SD5A 5D6FA 2DU9A 2HQAA 3SZTA 3GXOA 2QQ9A 1WHUA 3GTQJ 2RN7A 3O8HA 1MKMA 3R61A 4L5IA 1Y0NA 1XMAA 3FMSA 5F08A 3S2DJ 2JVHA 3K1NA 2R7DA 1YQAA 3KP5A 2CO5A 4PJJA 4HX8A 5E1XA 2O8XA 2RGVA 2EB7A 2LP0A 1FIPA 5J40A 3ZQFA 2WV0A 2HZDA 3TEDA 1WGXA 3TO7A 1LB2A 4U0WA 3J81Z 1RI7A 4IQJA 1T0FA 3BG5A 4MEYF 2Z1DA 3NQOA 1JJ8C 4BEHB 3V8KA 2V7FA 3GBGA 2LSOA 1XB4A 3OYBA 2LY1A 3I59B 3SFZA 3HOVJ 2DQRA 5F0FA 1R1TA 2KIQA 4P9UA 1XS9A 4MFEA 2VC1A 2W25A 1IN6A 2EV0A 3JRIA 2D45A 3G2BA 2BVLA 2M8EA 3B6AA 2KRCA 1IJWC 1W5TA 2DAOA 4KT5C 5DCFA 1RUNA 2NOGA 4ZYHA 5FKKA 1J59A 4HBLA 3LSGA 2CH0A 3MCZA 4A5MA 4BGDA 1ETVA 1YW8A 2IGKA 3QU6A 4EATA 2A05A 1IN8A 3OYLA 3K70D 2ZCWA 1APLC 4BJTA 1MH4A 2MYSA 2HTSA 3HTUA 1RUOA 4L0ZB 1V55H 3M07A 3M3YJ 2F5CA 4A0XA 5GTIC 3PM1A 3BR6A 2R5ZB 2ID6A 5A2QK 1NTCA 3HSRA 4KICA 4PGHA 1U9NA 4E7IA 3K4NA 1ZELA 2WAFA 1WJFA 3S32A 5DUIA 4V19K 3HOTA 2L2OA 4WXDA 3W2WA 2XKOA 1SFOJ 2R0QC 2GLOA 3KEYA 4Y13A 3QODA 1OYWA 5D5UB 1VFCA 1UG2A 4BACA 2X6XA 4HDVA 4NC8A 3OYAA 1JKPC 1TP4A 2XPUA 2WY7Q 3LOCA 3OYHA 2O03A 4A0ZA 1VNDA 4ZYGA 4XLPF 1B4AA 2XAJA 4GGGA 3SYTA 3BZKA 3E7LA 1SVOA 3VYSB 1H8AC 1A6QA 3HRSA 4M3FA 1VQ6I 5D6EA 4A3GJ 4F52A 2ZMEA 2DOEA 4XLNF 1RKTA 3VFZA 2EJRA 2GAUA 3M4OJ 2VT2A 1G4DA 2KDZA 3K10A 1YX5A 3E6MA 3SZGA 2RC4A 4OU0A 4XRSA 3DKXA 2DODA 1JGSA
chains in the Genus database with same CATH topology
2FQ4A 1ZTRA 1QRYA 2EZIA 3S16J 4A3FJ 1MH3A 2JA6J 5C4XJ 4A3BJ 4EEFG 3S14J 2M9HA 3IH2A 3ZQGA 5J1RA 1JJ6C 5M3MJ 2PMZN 1X2NA 5GPAA 5EZHA 1B8IA 2EZHA 4MFDA 1A5JA 1JUPA 3ZQIA 2E2IJ 2NS7A 3FISA 4V2FA 4D5FA 2L7MP 1GV2A 4Y7NJ 2CJJA 2JK3A 1F43A 1ETWA 3Q0WA 1CQTA 4C3JJ 1TWCJ 3QPLA 5FKMA 1T33A 2VI6A 3BQZA 3HEFA 4CYCA 1R9TJ 2E2JJ 3H0GJ 3S1NJ 4A3IJ 5E3LA 5EF6A 4Y52J 2EBIA 1JUSA 2M2EA 1VI0A 2L9RA 3TP3A 2DMPA 3G1OA 3FK7A 2TCTA 2FD5A 3JRDA 1DU6A 1AHDP 1W0TA 2VUMJ 2ME6A 3HBLA 4IHXA 3NAUA 2W48A 4DYCA 3A01A 1PUFB 4DYQA 2DA4A 1DU0A 4GFBA 3L1PA 4I76A 2GBYA 4FE7A 4D5CA 3IH4A 1ETQA 1IGNA 1TWGJ 2HOSA 1MNMC 4MLOA 2Y9YA 2X9DA 4X1EA 1S7EA 3JRHA 4B3AA 1IRZA 2YUSA 4RDUA 1T56A 4JX5A 4FE4A 5E3OA 2MGQA 1BW6A 3S15J 5K7HA 3F0CA 1LFUP 2G0EA 2H8RA 1Z0XA 1HDPA 2JMWA 2LLKA 1H88C 3A02A 2L0KA 2WV1A 4XRMA 1MBEA 5JLWA 1IDYA 3PO2J 3BTJA 1XG1A 4I6ZA 2YU9J 3QPSA 1B8IB 1B72A 2Y31A 5F04A 2VKVA 1NK2P 1VF9A 4A3JJ 3BQYA 4X6AJ 2L7FP 2RAEA 2XGCA 2WB1N 4V2GA 1I3QJ 1JT6A 2XB5A 5FJ8J 1WH5A 5GPCA 2AHQA 4M6VA 5IPAA 1ZKGA 2LTPA 1O4XA 3K7AJ 2ECBA 2E2HJ 5F1JA 2R5YB 3PO3J 4BY7J 1HLVA 1ITYA 3BT9A 2HOTA 4XK4A 2HXOA 3BR5A 2E1OA 3JRBA 2OF7A 1U8BA 3GTLJ 1TWHJ 1UMQA 4XRSG 2X6OA 5M5YJ 5C3EJ 1GUUA 1JKRC 1JUMA 5FKNA 1IC8A 1A6IA 3JRAA 3CQZJ 3NARA 4M3GA 3OSFA 4W97A 4DZJA 2XSDC 4G12A 1JTXA 1OCTC 4D7NA 5IP6A 3QQAA 3GTJJ 3HB9A 3BR0A 4J19A 1SANA 1ZQ3P 5EEAA 2ELKA 5IYCJ 4A3MJ 1BA5A 1MSFC 1ETOA 4IHWA 2XRLA 2R7ZJ 1ETYA 1FJLA 2LKXA 4AYBN 2YS9A 2ZB9A 5EG0A 3JREA 1WI3A 2HXIA 2CUFA 2XPVA 3BR1A 1FTZA 2CQXA 2L7ZA 3FIWA 2LVSA 5E3NA 4IEJA 4IHVA 3HGYA 5K7ZA 2K9NA 1ETXA 1YRNA 1TWAJ 3ZQCA 2O8KA 4DZPA 3GTKJ 2O7OA 1B72B 2GM4A 5FKLA 3DCFA 4M3EA 3HOUJ 3JR9A 1Z77A 4XIDA 2DMNA 5IYBJ 2R5YA 3BTLA 1IG7A 3K2AA 2I10A 3LSJA 2ME0A 4JYKA 1MBGA 2DA6A 2E19A 3BTIA 2ID3A 3SDGA 4BKXA 4BXXJ 4XICA 4QSHA 1LFBA 2HQ5A 3C2BA 2Y9ZA 5EYRA 2NVTJ 2NVQJ 3S2HJ 9ANTA 2NVYJ 5EDNA 1JKOC 1Q1VA 1IUFA 2IAIA 5M5WJ 2MSYA 3I4NJ 1GVDA 2DMUA 4A3LJ 3I4MJ 1MBKA 3MN2A 1FEXA 3RZDJ 4C3IJ 1EF4A 3RKQA 3RZOJ 3G1LA 1RR7A 1ZR4A 1U9OA 4QTRA 1IV6A 5IOYA 2LY9A 3LNQA 1QPIA 1HDDC 3D1NI 1JTYA 1I6HJ 2Y0SN 2NS8A 2B63J 1D5YA 2NVXJ 5EGOA 1ORKA 1WCMJ 4A3KJ 3O8GA 1FIAA 4UUSB 5GP9A 5EG0B 1AKHA 5M5XJ 4C3HJ 3A03A 3LSPA 1RPWA 1X2MA 4FCYA 2DA1A 4A3EJ 1ENHA 1E3OC 1YRNB 1P7JA 2FX0A 3GTMJ 3H3VK 3TW6A 3JRFA 1IDZA 3ZOBA 1QVUA 2M8GX 2H1KA 1XC5A 4QIWN 2M34A 3HDDA 1QVTA 2DA2A 3IH3A 4M3DA 5IP9J 5F27A 1GV5A 3B6CA 2XB0X 5C4JJ 1RESA 4UUTA 3BR3A 3LSRA 1Y1WJ 1I50J 2JA7J 2JA8J 5IYDJ 4A3DJ 1TWFJ 1RETA 1LE8A 2EQRA 3SJMA 3OIOA 2FJ1A 2OPTA 3HOWJ 4LOCA 3WHBA 3JRCA 2Y30A 3Q0UA 1U78A 5J3LA 5IOZA 2K40A 2JWTA 3BG3A 3HM5A 1JGGA 4JX6A 2MG4A 4B1RA 2QF7A 2EZLA 3S1RJ 1BW5A 3OSGA 4UUSA 2DA5A 3G1MA 4BBRJ 1BL0A 5E3MA 3BG9A 2IBDA 2TRTA 2VKEA 1HF0A 2LK2A 5EZGA 5FLVA 3ZQHA 3SFIA 4C2MJ 3BTCA 5EGOB 2R92J 4IHYA 4JX4A 5M3FJ 3GTGJ 3Q3SA 3HGGA 1AKHB 1OCPA 1ETKA 3CMYA 2EZKA 5IP7J 4MO7A 2R5ZA 1FTTA 1ZK8A 1H89C 3VPRA 1G2HA 3GTOJ 3GTQJ 3O8HA 4W1UA 2O9LA 3Q0VA 4RBOA 2M0CA 5J1UA 2DJNA 1ZGWA 2VPRA 5F08A 3MVPA 1K83J 3S2DJ 2DA7A 1OJLA 5DS9A 4S0HB 2HOAA 2LFBA 1AU7A 1OFCX 2LP0A 2HDDA 1FIPA 3ZQFA 2LD5A 3IV5A 3TEDA 4DW6A 1WGXA 2QCOA 2R93J 1HCRA 2COBA 2CUEA 3HKZN 4BBSJ 3BG5A 4FTHA 2AO9A 5FKOA 5DTDA 1JJ8C 3GBGA 1Y1VJ 5J1YA 3HOZJ 2D5VA 2DA3A 2DMTA 3FKIJ 3HOVJ 2CRGA 1LE8B 3TP0A 3OOUA 5F0FA 5BNGA 1XS9A 4MFEA 5F0CA 3S1QJ 3JRGA 3JRIA 2JN6A 4NDLA 1MBJA 4M3BA 3B6AA 2DMQA 1IJWC 3TW7A 1GDTA 2DTZA 2IEKA 3HOYJ 2NOGA 2P81A 5FKKA 1ZR2A 1X58A 3LSGA 1JT0A 1ETVA 1WH7A 2JJ7A 4DYRA 1F36A 1TC3C 3DEWA 1WPKA 4ABZA 4BY1J 1APLC 4L5EA 1MH4A 2HI3A 2KT0A 3RQIA 1BJZA 3M3YJ 5FLMJ 2MW8A 1RKWA 4A69C 3PM1A 3WHCA 1K61A 1P7IA 3BR6A 3CDLA 4MIMA 4AC0A 2ID6A 2R5ZB 3UKGA 2XPWA 1NTCA 2ECCA 3FK6A 1MSEC 4AUXA 4A3CJ 1W0UA 1U9NA 4B4CA 1HOMA 4D7MA 5F0HA 1JKQC 3GTPJ 1SFOJ 2R0QC 2GLOA 2K9SA 5JLXA 3HOXJ 3CCYA 1VFCA 1UG2A 3BR2A 4A93J 1JKPC 3S1MJ 2N8GA 2XPUA 2K9QA 1NK3P 1UHSA 3LOCA 4CYCB 1VNDA 5HODA 3E7LA 2WAQN 1GT0C 1H8AC 2X48A 5K7FA 1MBFA 4FISA 4M3FA 3MKLA 1PUFA 4A3GJ 1RKTA 2XGDA 3S17J 2Y2ZA 4JP0A 4HNVA 3M4OJ 2EH3A 2CU7A 1MBHA 2DN0A 2JA5J 3W6VA 1POGA 2CQQA 3A01B 3ZQLA 2KDZA 2XGEA 2LR8A 2HYJA 5C44J 4XRSA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2FQ4 A;  1ZTR A;  1QRY A;  2EZI A;  3S16 J;  4A3F J;  1MH3 A;  2JA6 J;  5C4X J;  4A3B J;  4EEF G;  3S14 J;  2M9H A;  3IH2 A;  3ZQG A;  5J1R A;  1JJ6 C;  5M3M J;  2PMZ N;  1X2N A;  5GPA A;  5EZH A;  1B8I A;  2EZH A;  4MFD A;  1A5J A;  1JUP A;  3ZQI A;  2E2I J;  2NS7 A;  3FIS A;  4V2F A;  4D5F A;  2L7M P;  1GV2 A;  4Y7N J;  2CJJ A;  2JK3 A;  1F43 A;  1ETW A;  3Q0W A;  1CQT A;  4C3J J;  1TWC J;  3QPL A;  5FKM A;  1T33 A;  2VI6 A;  3BQZ A;  3HEF A;  4CYC A;  1R9T J;  2E2J J;  3H0G J;  3S1N J;  4A3I J;  5E3L A;  5EF6 A;  4Y52 J;  2EBI A;  1JUS A;  2M2E A;  1VI0 A;  2L9R A;  3TP3 A;  2DMP A;  3G1O A;  3FK7 A;  2TCT A;  2FD5 A;  3JRD A;  1DU6 A;  1AHD P;  1W0T A;  2VUM J;  2ME6 A;  3HBL A;  4IHX A;  3NAU A;  2W48 A;  4DYC A;  3A01 A;  1PUF B;  4DYQ A;  2DA4 A;  1DU0 A;  4GFB A;  3L1P A;  4I76 A;  2GBY A;  4FE7 A;  4D5C A;  3IH4 A;  1ETQ A;  1IGN A;  1TWG J;  2HOS A;  1MNM C;  4MLO A;  2Y9Y A;  2X9D A;  4X1E A;  1S7E A;  3JRH A;  4B3A A;  1IRZ A;  2YUS A;  4RDU A;  1T56 A;  4JX5 A;  4FE4 A;  5E3O A;  2MGQ A;  1BW6 A;  3S15 J;  5K7H A;  3F0C A;  1LFU P;  2G0E A;  2H8R A;  1Z0X A;  1HDP A;  2JMW A;  2LLK A;  1H88 C;  3A02 A;  2L0K A;  2WV1 A;  4XRM A;  1MBE A;  5JLW A;  1IDY A;  3PO2 J;  3BTJ A;  1XG1 A;  4I6Z A;  2YU9 J;  3QPS A;  1B8I B;  1B72 A;  2Y31 A;  5F04 A;  2VKV A;  1NK2 P;  1VF9 A;  4A3J J;  3BQY A;  4X6A J;  2L7F P;  2RAE A;  2XGC A;  2WB1 N;  4V2G A;  1I3Q J;  1JT6 A;  2XB5 A;  5FJ8 J;  1WH5 A;  5GPC A;  2AHQ A;  4M6V A;  5IPA A;  1ZKG A;  2LTP A;  1O4X A;  3K7A J;  2ECB A;  2E2H J;  5F1J A;  2R5Y B;  3PO3 J;  4BY7 J;  1HLV A;  1ITY A;  3BT9 A;  2HOT A;  4XK4 A;  2HXO A;  3BR5 A;  2E1O A;  3JRB A;  2OF7 A;  1U8B A;  3GTL J;  1TWH J;  1UMQ A;  4XRS G;  2X6O A;  5M5Y J;  5C3E J;  1GUU A;  1JKR C;  1JUM A;  5FKN A;  1IC8 A;  1A6I A;  3JRA A;  3CQZ J;  3NAR A;  4M3G A;  3OSF A;  4W97 A;  4DZJ A;  2XSD C;  4G12 A;  1JTX A;  1OCT C;  4D7N A;  5IP6 A;  3QQA A;  3GTJ J;  3HB9 A;  3BR0 A;  4J19 A;  1SAN A;  1ZQ3 P;  5EEA A;  2ELK A;  5IYC J;  4A3M J;  1BA5 A;  1MSF C;  1ETO A;  4IHW A;  2XRL A;  2R7Z J;  1ETY A;  1FJL A;  2LKX A;  4AYB N;  2YS9 A;  2ZB9 A;  5EG0 A;  3JRE A;  1WI3 A;  2HXI A;  2CUF A;  2XPV A;  3BR1 A;  1FTZ A;  2CQX A;  2L7Z A;  3FIW A;  2LVS A;  5E3N A;  4IEJ A;  4IHV A;  3HGY A;  5K7Z A;  2K9N A;  1ETX A;  1YRN A;  1TWA J;  3ZQC A;  2O8K A;  4DZP A;  3GTK J;  2O7O A;  1B72 B;  2GM4 A;  5FKL A;  3DCF A;  4M3E A;  3HOU J;  3JR9 A;  1Z77 A;  4XID A;  2DMN A;  5IYB J;  2R5Y A;  3BTL A;  1IG7 A;  3K2A A;  2I10 A;  3LSJ A;  2ME0 A;  4JYK A;  1MBG A;  2DA6 A;  2E19 A;  3BTI A;  2ID3 A;  3SDG A;  4BKX A;  4BXX J;  4XIC A;  4QSH A;  1LFB A;  2HQ5 A;  3C2B A;  2Y9Z A;  5EYR A;  2NVT J;  2NVQ J;  3S2H J;  9ANT A;  2NVY J;  5EDN A;  1JKO C;  1Q1V A;  1IUF A;  2IAI A;  5M5W J;  2MSY A;  3I4N J;  1GVD A;  2DMU A;  4A3L J;  3I4M J;  1MBK A;  3MN2 A;  1FEX A;  3RZD J;  4C3I J;  1EF4 A;  3RKQ A;  3RZO J;  3G1L A;  1RR7 A;  1ZR4 A;  1U9O A;  4QTR A;  1IV6 A;  5IOY A;  2LY9 A;  3LNQ A;  1QPI A;  1HDD C;  3D1N I;  1JTY A;  1I6H J;  2Y0S N;  2NS8 A;  2B63 J;  1D5Y A;  2NVX J;  5EGO A;  1ORK A;  1WCM J;  4A3K J;  3O8G A;  1FIA A;  4UUS B;  5GP9 A;  5EG0 B;  1AKH A;  5M5X J;  4C3H J;  3A03 A;  3LSP A;  1RPW A;  1X2M A;  4FCY A;  2DA1 A;  4A3E J;  1ENH A;  1E3O C;  1YRN B;  1P7J A;  2FX0 A;  3GTM J;  3H3V K;  3TW6 A;  3JRF A;  1IDZ A;  3ZOB A;  1QVU A;  2M8G X;  2H1K A;  1XC5 A;  4QIW N;  2M34 A;  3HDD A;  1QVT A;  2DA2 A;  3IH3 A;  4M3D A;  5IP9 J;  5F27 A;  1GV5 A;  3B6C A;  2XB0 X;  5C4J J;  1RES A;  4UUT A;  3BR3 A;  3LSR A;  1Y1W J;  1I50 J;  2JA7 J;  2JA8 J;  5IYD J;  4A3D J;  1TWF J;  1RET A;  1LE8 A;  2EQR A;  3SJM A;  3OIO A;  2FJ1 A;  2OPT A;  3HOW J;  4LOC A;  3WHB A;  3JRC A;  2Y30 A;  3Q0U A;  1U78 A;  5J3L A;  5IOZ A;  2K40 A;  2JWT A;  3BG3 A;  3HM5 A;  1JGG A;  4JX6 A;  2MG4 A;  4B1R A;  2QF7 A;  2EZL A;  3S1R J;  1BW5 A;  3OSG A;  4UUS A;  2DA5 A;  3G1M A;  4BBR J;  1BL0 A;  5E3M A;  3BG9 A;  2IBD A;  2TRT A;  2VKE A;  1HF0 A;  2LK2 A;  5EZG A;  5FLV A;  3ZQH A;  3SFI A;  4C2M J;  3BTC A;  5EGO B;  2R92 J;  4IHY A;  4JX4 A;  5M3F J;  3GTG J;  3Q3S A;  3HGG A;  1AKH B;  1OCP A;  1ETK A;  3CMY A;  2EZK A;  5IP7 J;  4MO7 A;  2R5Z A;  1FTT A;  1ZK8 A;  1H89 C;  3VPR A;  1G2H A;  3GTO J;  3GTQ J;  3O8H A;  4W1U A;  2O9L A;  3Q0V A;  4RBO A;  2M0C A;  5J1U A;  2DJN A;  1ZGW A;  2VPR A;  5F08 A;  3MVP A;  1K83 J;  3S2D J;  2DA7 A;  1OJL A;  5DS9 A;  4S0H B;  2HOA A;  2LFB A;  1AU7 A;  1OFC X;  2LP0 A;  2HDD A;  1FIP A;  3ZQF A;  2LD5 A;  3IV5 A;  3TED A;  4DW6 A;  1WGX A;  2QCO A;  2R93 J;  1HCR A;  2COB A;  2CUE A;  3HKZ N;  4BBS J;  3BG5 A;  4FTH A;  2AO9 A;  5FKO A;  5DTD A;  1JJ8 C;  3GBG A;  1Y1V J;  5J1Y A;  3HOZ J;  2D5V A;  2DA3 A;  2DMT A;  3FKI J;  3HOV J;  2CRG A;  1LE8 B;  3TP0 A;  3OOU A;  5F0F A;  5BNG A;  1XS9 A;  4MFE A;  5F0C A;  3S1Q J;  3JRG A;  3JRI A;  2JN6 A;  4NDL A;  1MBJ A;  4M3B A;  3B6A A;  2DMQ A;  1IJW C;  3TW7 A;  1GDT A;  2DTZ A;  2IEK A;  3HOY J;  2NOG A;  2P81 A;  5FKK A;  1ZR2 A;  1X58 A;  3LSG A;  1JT0 A;  1ETV A;  1WH7 A;  2JJ7 A;  4DYR A;  1F36 A;  1TC3 C;  3DEW A;  1WPK A;  4ABZ A;  4BY1 J;  1APL C;  4L5E A;  1MH4 A;  2HI3 A;  2KT0 A;  3RQI A;  1BJZ A;  3M3Y J;  5FLM J;  2MW8 A;  1RKW A;  4A69 C;  3PM1 A;  3WHC A;  1K61 A;  1P7I A;  3BR6 A;  3CDL A;  4MIM A;  4AC0 A;  2ID6 A;  2R5Z B;  3UKG A;  2XPW A;  1NTC A;  2ECC A;  3FK6 A;  1MSE C;  4AUX A;  4A3C J;  1W0U A;  1U9N A;  4B4C A;  1HOM A;  4D7M A;  5F0H A;  1JKQ C;  3GTP J;  1SFO J;  2R0Q C;  2GLO A;  2K9S A;  5JLX A;  3HOX J;  3CCY A;  1VFC A;  1UG2 A;  3BR2 A;  4A93 J;  1JKP C;  3S1M J;  2N8G A;  2XPU A;  2K9Q A;  1NK3 P;  1UHS A;  3LOC A;  4CYC B;  1VND A;  5HOD A;  3E7L A;  2WAQ N;  1GT0 C;  1H8A C;  2X48 A;  5K7F A;  1MBF A;  4FIS A;  4M3F A;  3MKL A;  1PUF A;  4A3G J;  1RKT A;  2XGD A;  3S17 J;  2Y2Z A;  4JP0 A;  4HNV A;  3M4O J;  2EH3 A;  2CU7 A;  1MBH A;  2DN0 A;  2JA5 J;  3W6V A;  1POG A;  2CQQ A;  3A01 B;  3ZQL A;  2KDZ A;  2XGE A;  2LR8 A;  2HYJ A;  5C44 J;  4XRS A; 
#chains in the Genus database with same CATH topology
 2PG4 A;  1ZTR A;  1D1B A;  1AA7 A;  2PJR B;  2DBB A;  4G8X A;  3RQ4 A;  3MKW B;  3S16 J;  1D5V A;  1FSH A;  4Q48 A;  3LFU A;  4B43 A;  4A3F J;  2X6Y A;  3LA7 A;  2JA6 J;  5FRO A;  4LJZ F;  3H92 A;  4JQF A;  3AL0 B;  4A3B J;  1QZZ A;  2K3P A;  2ZO4 A;  5J1R A;  2Q8K A;  1FYL A;  2QKM B;  5M3M J;  1MDM A;  1T98 A;  2EZH A;  4MFD A;  1BN5 A;  1TBX A;  1BC7 C;  2QVO A;  4WXC A;  3L09 A;  1I6X A;  4V2F A;  3PNY A;  1YJN I;  2F2E A;  5HOO A;  2CJJ A;  3N05 A;  3BLY A;  1NH3 A;  1F43 A;  3Q0W A;  4XN0 A;  3U2R A;  1U5T A;  4FHT A;  2VI6 A;  2Z3Y A;  1D0Y A;  2ACJ A;  3LA3 A;  3ZP5 A;  2E2J J;  2D1V A;  4XR6 A;  3H0G J;  4A3I J;  4G7H F;  2X51 A;  5E3L A;  5EF6 A;  1ZGJ A;  2OCE A;  5CLS A;  3NRV A;  2BHZ A;  1KU9 A;  3TP3 A;  3K6G A;  3G1O A;  3RJP A;  3FK7 A;  1FWZ A;  2FD5 A;  4WWC A;  1WFX A;  2OV7 A;  5ICG A;  1AHD P;  1YYV A;  2QYO A;  2ME6 A;  2FBI A;  4FX4 A;  3NAU A;  5HS9 A;  1PUF B;  4BE2 A;  3J7Y J;  3I9V 2;  1DU0 A;  5FB2 A;  4GFB A;  5LGT A;  3OYD A;  1BC8 C;  4XMY A;  2A07 F;  4BE1 A;  4FE7 A;  3PIP F;  1S7O A;  1ETQ A;  3O2P E;  2ZXW H;  5CVR A;  2HOS A;  3IAM 2;  3FXQ A;  1MNM C;  2F5E A;  2LYC A;  2O61 A;  1S9H A;  2P7V B;  4X1E A;  3JRH A;  2VON A;  2YUS A;  4E7S A;  1WVR A;  4JX5 A;  4XBF A;  2CV0 A;  1FY7 A;  2H8R A;  1YS6 A;  1H88 C;  4PGG A;  4HRI A;  4KNY A;  2EFO A;  3A02 A;  1IRG A;  1Z7L A;  1MBE A;  4II2 A;  4XOT A;  4ZJZ A;  5L3F A;  3J7A O;  3CC7 I;  1N25 A;  2P6S A;  4BHB A;  1T38 A;  4I6Z A;  3QPS A;  1B8I B;  1ZYR F;  2IXS A;  1LEA A;  5F04 A;  4CA0 A;  1MMN A;  3OOP A;  4OIR F;  4HAM A;  1LJ9 A;  1VF9 A;  3IWF A;  4PSX A;  5CKT A;  2A6E F;  3W2V A;  2V6E A;  4A3J J;  4IQ4 A;  2LH9 A;  3FX3 A;  4D1Q A;  2DK8 A;  2F4O B;  2E34 A;  2BY2 A;  1UHM A;  5GPC A;  2FRH A;  2LG4 A;  2A69 F;  4M6V A;  2IT0 A;  2HPI A;  5DEQ A;  2VKD A;  3CCU I;  3ML6 A;  3ECH A;  1FBQ A;  5F1J A;  3FF5 A;  4NUB A;  3PO3 J;  4HYE A;  4EM1 A;  1FYK A;  2R7S A;  2HOT A;  2QLZ A;  3PQJ A;  1MJB A;  2RQP A;  2Z2S B;  3BR5 A;  1LKX A;  4BHP A;  3JRB A;  1IRX A;  3F8M A;  3WE2 A;  3HTS B;  3CUQ B;  1MJA A;  3IAS 2;  3QYB A;  1XGS A;  4F55 A;  2JPC A;  1SAU A;  4ESJ A;  1QHG A;  2YPR A;  1TQM A;  3EUA A;  4YEJ A;  3CQZ J;  1U0J A;  4M3G A;  4NC7 A;  2XVC A;  4W97 A;  4DZJ A;  3FXK A;  3JTH A;  3MD2 A;  5E1W A;  4CIC A;  1JTX A;  1KU7 A;  4I7H A;  5IP6 A;  4KIS A;  5EEG A;  3O6B B;  2ELK A;  4WF2 A;  3RIR A;  5LD2 C;  4IHW A;  3M1C A;  3TKY A;  2R7Z J;  4AWX B;  3V7S A;  3LFK A;  4PK4 A;  3H35 A;  1D1A A;  2MA3 A;  2XPV A;  1JHF A;  3R0A A;  5HLG A;  2OUM A;  2CQX A;  3FIW A;  2FNP A;  3HRU A;  4DQ2 A;  1QPM A;  3RTR A;  2WBM A;  1ETX A;  3KE2 A;  1YRN A;  1B72 B;  2ZJQ F;  2M4K A;  2L5Q A;  3DCF A;  1Z77 A;  3KZI C;  3GVA A;  2DMN A;  4II3 A;  5E17 F;  4JK1 X;  2R5Y A;  4IRH A;  3ZMD A;  5BQT A;  1UG0 A;  2G7H A;  3R0J A;  4H0E A;  3A4C A;  1SVM A;  2KIU A;  3L2V A;  3SDG A;  4UB6 C;  3VOD A;  2V6C A;  4I2O A;  4UUV A;  3JSO A;  2AXL A;  4BXX J;  1IN7 A;  5K1Y A;  2M4G A;  4EM0 B;  5EYR A;  2NVT J;  2COM A;  3N4M A;  2NVQ J;  3S2H J;  2Q0O A;  3FXL A;  2HQN A;  4HLX A;  1N78 A;  5EDN A;  2QSF X;  1J09 A;  1ZG1 A;  2ADU A;  2FBH A;  3VSK A;  1QU3 A;  1TL8 A;  1DPU A;  2P6T A;  3OYK A;  3WU0 A;  4M72 A;  4RAZ A;  3L2W A;  2W84 A;  4U87 A;  3P9I A;  3H3U A;  3VYU B;  1FOK A;  3S3O A;  4KUM A;  4C3I J;  3L2U A;  1VQ5 I;  2ISY A;  1IV6 A;  2RQQ A;  5IOY A;  3KEO A;  5J8C A;  5LEJ A;  1QPI A;  3E0J B;  3D1N I;  1JTY A;  3MZ8 A;  1OMI A;  2J5O A;  3FDY A;  4PJM A;  2H6B A;  4LB6 B;  1CF7 A;  1W36 C;  2IW5 A;  1WCM J;  2V1N A;  4A3K J;  1HW2 A;  3PNT A;  3O8G A;  3ERE D;  2QKL B;  2V26 A;  4HPQ A;  3B73 A;  2GWR A;  3GUD A;  3OY9 A;  3LSI A;  5E8G A;  3I53 A;  3WE3 A;  1X2M A;  3QAH A;  3DV8 A;  4HNT A;  2L54 A;  1R5H A;  2DYR H;  1TQI A;  1ENH A;  4KFC A;  1AOY A;  4NQW B;  2F4M B;  4ZYD A;  3ZPL A;  3GTM J;  2QBY B;  3JRF A;  5AIP A;  3OL3 A;  1I5Z A;  2MFZ A;  2KHM A;  5DCM B;  1ZG5 A;  2M34 A;  3HDD A;  4EGY A;  5BPI A;  2DA2 A;  3IH3 A;  2MAB A;  1OIS A;  2BXZ A;  5F64 A;  2HOE A;  3VYR B;  2PFB A;  1FNN A;  2V4J C;  4KN4 X;  4XLC A;  4RGU A;  4DNC A;  4UUT A;  3VB2 A;  4BEH A;  1UHW A;  1I50 J;  4BH9 A;  2JA8 J;  4CSW A;  3TDZ C;  3M8E A;  1NHA A;  4YFK F;  3MQ0 A;  2HKO A;  3I59 A;  2ESN A;  4L9V A;  1ZHF A;  2EQR A;  2M0M A;  3SJM A;  4QPO A;  2FJ1 A;  3G73 A;  4IZZ A;  3V42 A;  5F1R A;  3W2A A;  1I1S A;  1U78 A;  5BMZ A;  4OAZ A;  2XGX A;  2K9M A;  2L7K A;  4U7B A;  1RNL A;  2JWT A;  2K3F A;  3GEZ A;  3HM5 A;  5TRD A;  1JGG A;  1ERD A;  4EVI A;  3H9Q A;  5FGM A;  3UNG C;  2EZL A;  4KIT B;  1S72 I;  3CD6 I;  1ULY A;  1UJ8 A;  2EPF A;  4XLE A;  1X1A A;  3OSG A;  4EM2 A;  4EV0 A;  3G1M A;  4Q5S F;  4BBR J;  3FBI B;  1WQ2 A;  4FX0 A;  3LQR A;  1R00 A;  1Z3X A;  2LK2 A;  1MW7 A;  3KYC B;  5DM7 F;  4KT6 A;  4N9I A;  4U7D A;  1P6R A;  3ASN H;  5D8K B;  1E0E A;  2E7W A;  3WG7 H;  1Q1H A;  1D3Y A;  2RVC A;  2O3F A;  1L0O C;  1ETK A;  4R79 A;  3CMY A;  2V79 A;  2EZK A;  3DPT A;  3RYP A;  5IP7 J;  2E5N A;  2R5Z A;  1ZK8 A;  3BC8 A;  2FNA A;  1H89 C;  2ZC2 A;  3VPR A;  2VOP A;  1G2H A;  4CH7 A;  4RBO A;  1YS7 A;  1O3R A;  2HDW A;  4LD5 A;  2DJN A;  3GFI A;  1ZGW A;  3MVP A;  2IS1 A;  5AON A;  1OQY A;  1OJL A;  3QP5 A;  3A0H C;  4HLY A;  1VQM I;  1VQN I;  2HOA A;  1AU7 A;  2CUJ A;  3KFW X;  1Z05 A;  2RDP A;  3FZV A;  4RM2 A;  4ETS A;  3U1D A;  2GIV A;  2LD5 A;  1LEB A;  3CMM A;  2XAF A;  4LLN A;  5CYV A;  4DW6 A;  2IPQ X;  2MBF A;  4KA4 A;  4EJW A;  2R93 J;  4BBS J;  2VAS A;  4UNO A;  5FKO A;  5DTD A;  5LFA A;  1SFU A;  1BR2 A;  1Y1V J;  2PBI A;  1VQ9 I;  3JTG A;  3DWL E;  2D5V A;  3DKY A;  2DMT A;  2R7R A;  5GAE J;  2BZT A;  2ELH A;  5HS7 A;  3I71 A;  5LEK A;  1LE8 B;  3OOU A;  2VQH A;  2LY2 A;  3F8C A;  3KX2 A;  3K4J A;  4U0Y A;  1BR4 A;  5BNG A;  5F0C A;  3IHU A;  1XX5 A;  2EIM H;  2BYV E;  5KAI C;  1MBJ A;  5L3D A;  4M3B A;  2DMQ A;  3TL4 X;  3CME I;  3TW7 A;  3CCS I;  2DTZ A;  1GDT A;  4GYI A;  2VOD A;  1KON A;  3HOY J;  1ODD A;  2P81 A;  1ZR2 A;  4O3M A;  1R22 A;  1DGW Y;  2EFW A;  1JT0 A;  3HOS A;  3VSL A;  4DYR A;  4ABZ A;  1XN7 A;  5IT9 Z;  5HDK A;  2HPM A;  2KT0 A;  3KP6 A;  2K02 A;  1LPQ A;  2HZT A;  4TV7 A;  4M6X A;  5DD4 A;  2MW8 A;  1TW3 A;  4A69 C;  4UHT A;  5GTH C;  2ZBK A;  4I98 B;  3UKG A;  1SFK A;  2H8W A;  2MD0 A;  3FK6 A;  4AUX A;  3REO A;  3ABU A;  4RM3 A;  1HOM A;  4EQQ A;  4BJ5 C;  4D7M A;  1D0X A;  1T95 A;  1JKQ C;  1KYZ A;  1Y6I A;  3CZ6 A;  4KMU X;  5HNH A;  2NNY A;  3I55 I;  4BYY A;  4ASN A;  3HOX J;  4AM3 A;  1Z3Y A;  2D2W A;  2W7N A;  3BR2 A;  4GO1 A;  2E60 A;  2XHK A;  2EA4 A;  4XOP A;  4A93 J;  3LAJ A;  1MNE A;  2Q1Z B;  3EUK L;  2QWW A;  1UHS A;  4CYC B;  5FFX A;  2L02 A;  3E3V A;  2LOO A;  1Z6R A;  1R5G A;  2A5W A;  2VE9 A;  3BJ6 A;  1H0M A;  3BG7 A;  1A35 A;  4FIS A;  3BDD A;  3MKL A;  1PUF A;  1JHH A;  3DEU A;  1PVE A;  1TLH B;  1QA6 A;  3LSH A;  4E6K G;  4RGS A;  4PJL A;  1YTY A;  2XGD A;  1UST A;  3S17 J;  1I39 A;  2EH3 A;  3OIP A;  4NHJ A;  1MBH A;  2JA5 J;  3S93 A;  3K4C A;  1WJC A;  2OQG A;  2WWY A;  2LR8 A;  1SMT A;  3OIQ A;  4LG0 B;  1JI8 A;  3FBN B;  2VLA A;  1T0F C;  3LST A;  3KP4 A;  2H94 A;  1WJ5 A;  3OV8 A;  1MH3 A;  4LK1 F;  5C4X J;  4RAG A;  4EEF G;  4A6D A;  3QRF F;  2HQR A;  3ZQG A;  2M3A A;  1JJ6 C;  1HKT A;  2PMZ N;  1OCR H;  1X2N A;  3LWF A;  3ZR8 X;  1K7A A;  1B8I A;  4CCN A;  4PSW A;  5LHI A;  1YW9 A;  2KFD A;  3VWB A;  3ZQI A;  2E2I J;  3DTE A;  4IOC F;  2EFQ A;  2NS7 A;  3FIS A;  1W7P B;  1FP1 D;  2NVU B;  1WZ2 A;  1N75 A;  4IO9 F;  3HHH A;  4CCK A;  1TWC J;  3QPL A;  3F8F A;  2FE3 A;  1XDU A;  3BZC A;  3S1N J;  4XL9 A;  1XGN A;  4CYD A;  4Z2Y A;  1OYY A;  4BNC A;  2TDX A;  1VI0 A;  2KQR A;  2QA4 I;  2DMP A;  1YJ9 I;  4EGZ A;  1N77 A;  3MKY B;  5HDN A;  1DU6 A;  3VYT B;  2KP6 A;  1IAW A;  3T8R A;  2MD5 A;  5L3G A;  2LRD A;  1S6L A;  4F3Q A;  4H4K C;  3K4M A;  1V4R A;  3A01 A;  2R7V A;  4HV6 A;  4DYQ A;  2DA4 A;  4BDY A;  1XSD A;  1USS A;  3L1P A;  2GXA A;  2Q2E B;  1EA3 A;  3OYC A;  4F93 B;  4KDP A;  2JRM A;  4UVB A;  3V7C A;  4HQM A;  4AYB A;  3IH4 A;  3I3L A;  4B48 A;  3T5X A;  2VIX A;  1IGN A;  2HS5 A;  1YHQ I;  5FFZ A;  3PQK A;  2STT A;  1TNT A;  3QYE A;  2G7U A;  2KMU A;  2Y9Y A;  2BW3 B;  4KN7 X;  4B3A A;  4RDU A;  4PZJ A;  3FKJ A;  3TQN A;  3CO6 C;  3P9C A;  2UUZ A;  2ZXI A;  3S2W A;  5K7H A;  4MQ9 F;  5AIQ A;  5CVI A;  2DPU A;  2G0E A;  3DP7 A;  2L0K A;  2WV1 A;  2Y69 H;  2V9K A;  2UV1 A;  5JFR A;  1IDY A;  3ZMU A;  1UZC A;  3F8N A;  4M9Z A;  1B72 A;  2Y31 A;  3G3Z A;  3CJN A;  4AU7 A;  3BQY A;  4S04 A;  4X6A J;  1R5I D;  3P5J A;  2RAE A;  4V2G A;  4RAY A;  5HLI A;  3GCM A;  4RMN A;  5FJ8 J;  3HKZ A;  3HUG B;  4HOB A;  3Q9V A;  2RNJ A;  1IO2 A;  2VXZ A;  4J01 A;  2XAH A;  3LMM A;  4I99 C;  2OCC H;  2K9L A;  4BU2 A;  3QP6 A;  3WTY C;  2HXO A;  3ZQQ A;  2KJB A;  2QQA A;  2KL4 A;  5J6X A;  5ILS A;  2ICW G;  2PQ8 A;  5CPR B;  3FXR A;  2VQL A;  5ERI A;  1UMQ A;  2WC2 A;  4ZZD A;  4YII A;  5M5Y J;  5C3E J;  1SD4 A;  4RB3 C;  1T2K A;  4AIK A;  5FKN A;  3A1Y A;  1WWX A;  3WG9 A;  1MMG A;  3HJE A;  3OSF A;  3MZY A;  1R36 A;  3QPH A;  4IVN A;  3F72 A;  4D7N A;  2W82 A;  4J19 A;  1SAN A;  1X1C A;  2HYF A;  1JE8 A;  1ZQ3 P;  1BBY A;  3CC2 I;  3GW2 A;  4C2T A;  1P4A A;  2XRL A;  2PJP A;  1LVA A;  1G3S A;  4AYB N;  2YS9 A;  2ZB9 A;  3COA C;  3JRE A;  4UVC A;  5KCM A;  4Q47 A;  1WI3 A;  3D5R C;  4DGW B;  3ZXS A;  3SHF A;  4AID A;  1FTZ A;  3BZ6 A;  3SDB A;  2LVS A;  4ESB A;  3OS2 A;  1C0W A;  3HGY A;  2K9N A;  3LSM A;  4E7H A;  2AS5 F;  4NQW A;  3WTS C;  2CFO A;  4DZP A;  1Z67 A;  3KP7 A;  2XF7 A;  3EYY A;  2LF7 A;  1QGP A;  3JR9 A;  1EJ9 A;  2LDU A;  1F9N A;  2OBP A;  5LRR A;  4ANJ A;  2MLK A;  2UZK A;  4YRV A;  4F7Z A;  2KKO A;  3RCO A;  3RKW A;  4XLA A;  3LSJ A;  4D9J A;  2QSH X;  2DA6 A;  2RNG A;  2E19 A;  1ONV A;  5GAG J;  2FF4 A;  3E5X A;  3FXU A;  5F6F A;  4QSH A;  4ENK A;  1YIO A;  3NWS A;  3CCM I;  1MJ9 A;  5D4S A;  5D5X B;  2IJL A;  1JKO C;  1Q1V A;  2O5R A;  4IX7 A;  2R7U A;  1TT5 B;  4XKB A;  4LK0 F;  1LDJ A;  1D8K A;  2XAS A;  2XRO A;  2IS2 A;  2WAE A;  1MBK A;  3ECO A;  1FEX A;  1PJR A;  4CCJ A;  3RKQ A;  2P8T A;  1G3Y A;  4XKW A;  1ZR4 A;  3IP4 B;  4IF4 A;  3PFY A;  1HDD C;  1I6H J;  2GIZ A;  1J2X A;  3FXO A;  1Z7U A;  2NS8 A;  3GLX A;  4B3X A;  1V5F A;  2NVX J;  2RRE A;  5L3C A;  1VTN C;  4Y33 A;  2FQ3 A;  4G6T B;  3OYG A;  3E6D A;  5GP9 A;  4G9Y A;  5M5X J;  3CUO A;  3RSN A;  4HW0 A;  1CGP A;  4ENN A;  2FUG 2;  3GZN B;  3AAF A;  3A03 A;  1RPW A;  1IF1 A;  4FCY A;  2DA1 A;  1RC9 A;  2CQN A;  2LKS A;  2QEX I;  2DQL A;  2I5U A;  4B09 A;  4A3E J;  1E3O C;  5D5W B;  5HNF A;  2R4G A;  5LBQ A;  1YIT I;  1OKR A;  4XN3 A;  5J4V A;  3ZOB A;  4ZDL A;  3QWL A;  3E1S A;  2O0Y A;  2K85 A;  2OA4 A;  4ESF A;  3PFI A;  3OS1 A;  2I8D A;  4M3D A;  1KA8 A;  2A3S A;  5F27 A;  1EH8 A;  1Z1D A;  1GV5 A;  4RB1 A;  2R7X A;  2XB0 X;  1Y1W J;  2LRE A;  2XF5 A;  1HXD A;  3F6O A;  3AG3 H;  4A3D J;  4CO8 A;  4X0G A;  4HSR A;  1W5S A;  1TWF J;  4XSX F;  3GFL A;  2CUZ A;  2MC4 A;  3CJQ B;  1LE8 A;  1EV7 A;  2L4M A;  1VQK I;  2VN2 A;  2OPT A;  3WHB A;  2CSO A;  3CDI A;  1X1D A;  3ELK A;  3Q0U A;  2IA0 A;  1VQ4 I;  2KIS A;  5J3L A;  1SEU A;  5IOZ A;  3T1B A;  3I56 I;  2ZJR F;  4WX9 A;  2EFP A;  3BG3 A;  2L3D A;  4QWQ A;  4JX6 A;  2MG4 A;  1M1E B;  1T8I A;  4Y17 A;  3E5Q A;  3S1R J;  3CP8 A;  4UUS A;  1FC3 A;  4UB8 C;  1J75 A;  2KJC A;  2HGC A;  2IGM A;  1BL0 A;  3WTV C;  3ZQH A;  3IC7 A;  4C2M J;  2R92 J;  5B5E C;  4IHY A;  5M3F J;  1FP2 A;  2VOO A;  3Q3S A;  3QPT A;  2X1E A;  4XLF A;  1OCP A;  4N0B A;  3HYI A;  4F91 B;  4MO7 A;  1LQ1 A;  2AXT C;  3BCB A;  2WB1 A;  3OR1 C;  2P5V A;  5KAF C;  3VEP A;  3K70 C;  2F5V A;  3FHN A;  1MGT A;  3BWG A;  4ZC3 A;  5ILU A;  2HTJ A;  1P4X A;  2DA7 A;  5GAD J;  2BGC A;  3H3Z A;  4LIU A;  2FOK A;  1OFC X;  2HDD A;  5JHF A;  3MMY B;  2VJJ A;  3WU2 C;  1FZP B;  2EIN H;  3PUF A;  2LMD A;  4OIP F;  2VXD A;  3F3X A;  4HQE A;  4HZF A;  1F1Z A;  4LMY A;  2CUE A;  2K4J A;  4KIB A;  4HF0 A;  4AVZ A;  1D1C A;  4FTH A;  2AO9 A;  3L00 A;  3C1D A;  4AIH A;  1VQL I;  5E8I A;  3CCQ I;  2YR2 A;  2H09 A;  3QU3 A;  5L3B A;  5LGN A;  4BDZ A;  3F6V A;  1WKM A;  2CRG A;  3TP0 A;  1MZB A;  3RKX A;  3HZJ A;  4G7O F;  1KQ8 A;  2M30 A;  3S1Q J;  5DD8 A;  4E70 A;  1R4M B;  5ILV A;  2BY0 A;  2R7O A;  3MAJ A;  1ZN2 A;  4LG0 A;  1FMV A;  2V9V A;  2XUB A;  5A2Q Z;  1PUE E;  2E35 A;  1XSV A;  1SD7 A;  1VQ7 I;  2IEK A;  2IP2 A;  3G71 I;  3J81 K;  3HPG A;  1O7F A;  1X58 A;  5E18 F;  4ENM A;  4XON A;  1WH7 A;  2JJ7 A;  1F36 A;  1TC3 C;  3DEW A;  2VPL A;  1WPK A;  4BY1 J;  3R6S A;  3B02 A;  4L5E A;  1FOY A;  2CFX A;  4UV9 A;  2HI3 A;  4UV8 A;  3RQI A;  1R71 A;  1BJZ A;  5ED4 A;  4WXH A;  2Z16 A;  3IUO A;  2DYS H;  3TGN A;  5FLM J;  1IN5 A;  5LHG A;  3K4L A;  1RKW A;  3WHC A;  1P7I A;  2RV8 A;  5H6R A;  3BG6 A;  4MIM A;  1YJW I;  2H27 A;  4LLL A;  2DT7 B;  1RZ4 A;  1W0U A;  2J5P A;  3M9A A;  2VL8 A;  1ZH5 A;  5F0H A;  3RYR A;  1K6O A;  2MH2 A;  2E1N A;  4Y3O A;  1FLI A;  2JSC A;  3K1P A;  3GTP J;  2FA5 A;  2K9S A;  5JLX A;  3IRQ A;  2VBW A;  3BY6 A;  3CCY A;  2CW0 F;  4N9H A;  4J00 A;  1L3L A;  1F4K A;  3S1M J;  2N8G A;  2OQR A;  1OR7 A;  4BHC A;  3ZMT A;  4DJA A;  5HOD A;  4IOA F;  3WOD F;  2STW A;  1KQ9 A;  3M8F A;  1FBU A;  4LFU A;  1XMX A;  4WCG A;  2Q2E A;  3J7Z I;  2IA2 A;  3EET A;  2F4I A;  3H5N A;  4GXO A;  1Y8R B;  2Y2Z A;  4BL0 B;  3D0S A;  4JP0 A;  3EQL F;  2CU7 A;  2Y0S A;  4L5J A;  2L9N A;  1IZ1 A;  4DBQ A;  1V3F A;  1POG A;  5HVQ C;  1O3T A;  4BXF A;  1HKQ A;  2EWN A;  1QZY A;  2XGE A;  3ULQ B;  4ITV A;  5BPD A;  3E6C C;  1U3E M;  2DTR A;  2RKH A;  3V4G A;  1MD0 A;  2A5Y B;  4BAY A;  2EV6 A;  3OMY A;  2GXB A;  1X3W B;  2QQB A;  1K79 A;  4G6Q A;  1IXC A;  2M9H A;  3IH2 A;  2VJ5 A;  4U88 A;  3OWT A;  4E7L A;  5GPA A;  2JQ7 A;  2NOJ B;  2ZNY A;  4P55 A;  1UB9 A;  1B1B A;  1BIB A;  3R60 A;  1JUP A;  4BQQ A;  3I5U A;  1UEL B;  4D5F A;  3S3N A;  3I64 A;  2HR3 A;  3DPU A;  4Y7N J;  1LUJ B;  4OWR B;  1ETW A;  4A6E A;  2BXY A;  1R7J A;  4C3J J;  2ZSI B;  2A68 F;  1X3Z B;  3H5A A;  1RRJ A;  3BQZ A;  3GF2 A;  1YI2 I;  4IL6 C;  1R9T J;  1P92 A;  1KYW A;  3K0L A;  1FOW A;  2EBI A;  1JUS A;  3C2H A;  2M2E A;  2L9R A;  2EIK H;  3QYF A;  1Y0U A;  3E5U A;  4A12 A;  3EYI A;  3OYF A;  1YO5 C;  2CMP A;  2TCT A;  1H9G A;  3FM3 A;  2M87 A;  2JA2 A;  3QOE A;  1K4S A;  4HST A;  1TQP A;  5FLX Z;  1W0T A;  3HBL A;  4IHX A;  1GVJ A;  4EJT A;  2W48 A;  4DYC A;  3CCL I;  3CJT B;  2E5Z A;  1ZG3 A;  4BUP A;  1ZRD A;  4IRG A;  3Q5F A;  2KRH A;  3GX4 X;  2YSR A;  2PLY A;  3L2Q A;  2WAD A;  4D5C A;  2PJR A;  3HRT A;  2PI0 A;  4MGR A;  5CQE A;  2B9S A;  1U2W A;  2UWM A;  4CCM A;  1TWG J;  1QO0 D;  3CF5 F;  4MLO A;  1K78 B;  2VBZ A;  2WY8 Q;  3Q9S A;  1S7E A;  3HL2 A;  1IRZ A;  2A6T A;  3V8J A;  4M9S A;  1ZRE A;  1T56 A;  2ZSH B;  3S8P A;  4FE4 A;  2MGQ A;  1BW6 A;  3S15 J;  3GZ5 A;  3DBR B;  3P7N A;  2LLK A;  5J4Y A;  1X1P A;  4XRM A;  1WJA A;  1FMW A;  5JLW A;  4YFN F;  3PO2 J;  2FEZ A;  2OD5 A;  1XG1 A;  1NG7 A;  2YU9 J;  4RS8 A;  1R1V A;  3AKZ A;  1W1W E;  3CCR I;  3CF2 A;  2OTJ I;  4S05 A;  3DKW A;  1DP7 P;  5L3E A;  4A0Y A;  2L7F P;  4P9F A;  3OYJ A;  2R7T A;  4CCO A;  4GCV A;  4G6D A;  1JT6 A;  2XB5 A;  1TNS A;  1JXS A;  3RKY A;  4B47 A;  2A6H F;  1U6G A;  5IPA A;  2LTP A;  1O4X A;  3K7A J;  2ECB A;  3LQQ A;  4ZYE A;  1J9I A;  4OAY A;  2ZKZ A;  2R5Y B;  3BT9 A;  3CLQ A;  2JSP A;  4FT8 A;  3D5L A;  4E7Z A;  3HRM A;  2OF7 A;  3GTL J;  2BBY A;  3GYH X;  5LGU A;  4XRS G;  2X6O A;  4P5O A;  4GDF A;  2FXA A;  4UY8 I;  1MIJ A;  3KCC A;  5BS6 A;  3FXJ A;  1A6I A;  4Z6Y A;  3GFJ A;  4HX4 A;  3U9G A;  3QQA A;  3BOQ A;  3HB9 A;  3HIF A;  3ROU A;  4WK8 F;  2HVR A;  2DFI A;  1ETO A;  1HW5 A;  2JRT A;  4P96 A;  3WTX C;  1ETY A;  3ZCO A;  2ZXH A;  4GYG A;  2XSJ C;  4JOM A;  2BY3 A;  2LKX A;  4I01 A;  3IRR A;  1YX3 A;  3BJO A;  2CUF A;  4AD9 A;  5K5R A;  2Y0M A;  3H9G A;  1QBJ A;  2OC6 A;  3BR1 A;  1CF7 B;  2L7Z A;  3F22 A;  5E3N A;  2VBX A;  1YFH A;  2BE5 F;  4IHV A;  1LDK B;  2XRN A;  3GFM A;  4PJN A;  5TJJ A;  3G6E I;  3ZQC A;  3BPV A;  4KYW A;  2FMY A;  3W6K B;  2O6G E;  2XIG A;  3FMR A;  5FKL A;  4M3E A;  1MMD A;  3TDU C;  3HOU J;  2WTE A;  1GXQ A;  1YIJ I;  4EMS A;  3LAP A;  5CVV A;  2Y48 A;  3FMQ A;  4XSZ F;  2E36 A;  1IG7 A;  1TW2 A;  3ISP A;  3K2A A;  5FD5 A;  1MBG A;  1BIA A;  2VE8 A;  2ID3 A;  3PNV A;  3EUH A;  3I4P A;  3J7A Y;  4BKX A;  1R4N B;  2X0L A;  5H2F C;  4XIC A;  3DPL C;  2CG4 A;  3CUQ A;  1LFB A;  4IXA A;  3C2B A;  1SAX A;  3I54 A;  2Y9Z A;  3EDP A;  3N97 A;  9ANT A;  4YEL A;  2DOF A;  4NBQ A;  2EA2 A;  2IAI A;  2EK5 A;  1BOB A;  1OCO H;  4XM3 A;  5H6Q A;  5M5W J;  2MSY A;  5E79 C;  1YE9 A;  2W85 A;  2DMU A;  3I4M J;  2NS0 A;  1O7L A;  3U21 A;  1ZLK A;  3RZO J;  3ASO H;  3G1L A;  1RR7 A;  2PMU A;  4LGW A;  4A2U A;  5ICF A;  2Z9O A;  2NYX A;  4OOI A;  3JW4 A;  2DJI A;  3C18 A;  2DDB A;  1UFM A;  3MKZ A;  2KIF A;  3ZQ7 A;  2VC0 A;  2Z5U A;  1O3Q A;  2B63 J;  1D5Y A;  1TT0 A;  3PSF A;  2ZME C;  1BI3 A;  1XCV A;  5DYM A;  1TZL A;  3SXY A;  1Z21 A;  1FIA A;  2LBF B;  3RI4 A;  3H1C A;  2JUC A;  3M8J A;  2XC7 A;  3KLO A;  3DQV C;  5EG0 B;  1XMK A;  2HWV A;  2KZV A;  3M1E A;  3LSP A;  3HXL A;  3WTT C;  4HDU A;  2IGO A;  1HQC A;  1OYI A;  3K4K A;  5IT3 A;  4E4H A;  4EJO A;  2Y75 A;  2FX0 A;  1W7P D;  2BY1 A;  3H3V K;  4Y15 A;  4KIF A;  1IDZ A;  1K6Y A;  4OMY A;  1QVU A;  2W4S A;  3J80 Z;  4XNF A;  1BOA A;  2M8G X;  1XC5 A;  2MH9 A;  2B0L A;  2W00 A;  5CJ9 A;  1QVT A;  5IP9 J;  3JAM Z;  4Y4R A;  1ZAR A;  4M71 A;  5JHU A;  1GHC A;  4BS9 A;  3DXJ F;  2HKX A;  2K27 A;  1RES A;  4DIQ A;  3LSR A;  2JT1 A;  2OAZ A;  5IYD J;  1XTA A;  1BM9 A;  5K5O A;  3HSE A;  3HC7 A;  4DOZ A;  1QQI A;  1NG6 A;  3GO5 A;  1Z9C A;  1SVL A;  1U5T C;  1YLF A;  1SFE A;  1HKS A;  3HOW J;  4LOC A;  3JRC A;  4U0V A;  2DCE A;  2Y30 A;  5DM6 F;  2DPD A;  3L2C A;  5LLQ A;  5KK1 A;  3BCA A;  1DGR M;  3MFK A;  1W36 D;  1A31 A;  2K40 A;  3KP3 A;  6PAX A;  2H1L A;  1LNW A;  1J7K A;  2NXN B;  2QF7 A;  3C7J A;  4B1R A;  4HG2 A;  3FXM A;  2DA5 A;  2W24 A;  3ESW B;  4PUS A;  1E3H A;  2DI3 A;  5E3M A;  3MZH A;  1R6R A;  1I27 A;  3BG9 A;  2IBD A;  2E1M C;  2HYG D;  2L4A A;  2VKE A;  2HVQ A;  5EZG A;  1HF0 A;  2D1H A;  2CV1 A;  5FLV A;  1R1U A;  2VBY A;  3LA2 A;  4O6J A;  4BQO A;  5EGO B;  1ZRF A;  5D8L B;  5FRM A;  2UXX A;  4JX4 A;  4E7J A;  1BI1 A;  3HGG A;  2V1X A;  2R7F A;  2M5W A;  1WRJ A;  1AKH B;  2IRF G;  3CP2 A;  2QBY A;  2WA0 A;  1KZH A;  2HNH A;  2L9S A;  2B7E A;  1W4M A;  5HDG A;  4RAF A;  1SMY F;  2ETH A;  4L9N A;  2HEO A;  1FTT A;  2PMH A;  5HS8 A;  3GTO J;  1X4P A;  5DCM A;  4CXF A;  4W1U A;  2O9L A;  2ZFU A;  1QNT A;  3Q0V A;  3NWT A;  3S3M A;  4IRI A;  2M0C A;  3DU6 A;  5FD6 A;  2ESH A;  2YX7 A;  5J1U A;  3RPU D;  2VPR A;  3SEZ A;  1K83 J;  4CDG A;  2P5K A;  1R23 A;  5DS9 A;  4S0H B;  1RR8 C;  1ZRC A;  1XCB A;  2LFB A;  2WAQ A;  1D8J A;  4RB0 A;  1VQ8 I;  3F9K A;  5JI6 A;  1G6N A;  4LIT A;  3HG9 A;  3WTU C;  2BHY A;  2P4W A;  4D0P A;  3OS0 A;  3IV5 A;  2X4H A;  2R7Q A;  4XKV A;  3JCU C;  3CO7 C;  4G7Z F;  4MQV A;  3TBI A;  1DPR A;  1FBS A;  2QCO A;  3F21 A;  1HCR A;  2COB A;  3HKZ N;  4I09 A;  1FX7 A;  3CCV I;  2NNN A;  3CCE I;  1VQO I;  5J1Y A;  3HOZ J;  4BJ6 C;  2IVM A;  1QHH D;  3K69 A;  2DA3 A;  3FKI J;  4XKC A;  1R49 A;  2PX9 A;  4CGZ A;  3ZRG A;  1PP8 F;  3ABL H;  3H36 A;  3MEX A;  3GWZ A;  3JRG A;  5EEH A;  1T39 A;  1REP C;  2JN6 A;  4NDL A;  1S29 A;  2M45 A;  3VOE A;  2P5L C;  2OTL I;  4M9X A;  2R7W A;  4L9J A;  2HU9 A;  5ICC A;  3L9F A;  2DO7 A;  1J5Y A;  2VQG A;  2BOL A;  3PL8 A;  3KLN A;  3PJR A;  3K9T A;  1E17 A;  1XSX A;  3H5R A;  1WSU A;  1HBX G;  4RLF A;  1FT9 A;  2QSG X;  2F5F A;  1A04 A;  1F5T A;  4EJU A;  4JBA A;  1IW7 F;  2JZY A;  1KU2 A;  5J8F A;  2FU4 A;  5H20 A;  3ABK H;  1V5G A;  5FLX K;  2XAQ A;  2W1O A;  3SZP A;  4ZDP A;  2Z99 A;  4HX7 A;  2XAU A;  3OR2 C;  3HSF A;  1K61 A;  3CDL A;  4AC0 A;  3ZN0 A;  2LF8 A;  3A2K A;  2XPW A;  4A3C J;  2ECC A;  2MC3 A;  1MSE C;  2EIJ H;  2NRA C;  1DUX C;  4B4C A;  1WI9 A;  2DOA A;  1S5L C;  4K2E A;  2IS4 A;  1B9N A;  3CCJ I;  4KMF A;  3LSK A;  3TOB A;  2DDA A;  4A5N A;  2X85 A;  2KDO A;  3O3K A;  2GA2 A;  3KP2 A;  2PEX A;  4N4O B;  3WTW C;  2XAG A;  1DDN A;  4L0Y B;  3FHZ A;  2E71 A;  1ZAO A;  1WJE A;  2K9Q A;  3ONQ A;  3WGH A;  2VJI A;  1NK3 P;  5IT9 K;  1P9Q C;  2ZFW A;  4IKF A;  3GLL A;  3KPH A;  5JR3 A;  3L2R A;  2ZJP F;  2WAQ N;  1GT0 C;  3CDH A;  2X48 A;  5K7F A;  1MBF A;  2EIL H;  2OJE D;  1FPQ A;  3KZY A;  1UAA A;  5HLH A;  2K4B A;  2QZ8 A;  1S8N A;  1HW1 A;  1J0R A;  4HNV A;  5DUK A;  3M7G A;  4MTE A;  2DN0 A;  3W6V A;  1WJB A;  2CQQ A;  3A01 B;  3ZQL A;  1K78 A;  2ISZ A;  1OCC H;  4FQG A;  2HYJ A;  4BE0 A;  5C44 J;  2DLL A;  5KVR A;  2KLO A;  2FQ4 A;  4HF2 A;  2X6W A;  5KNL A;  1QRY A;  4FAS D;  2VQC A;  2EZI A;  4OMZ A;  1Y56 A;  2FML A;  5E20 A;  2L01 A;  2KRF A;  3KYD B;  3ZMV A;  3RPQ A;  3CLO A;  3JSP A;  2LC2 A;  1OPC A;  4IHT A;  3S14 J;  1DQU A;  3H0D A;  2QEN A;  1XD7 A;  4N4N B;  2EFN A;  2X1D A;  5EZH A;  5TGT A;  2CV2 A;  2VT3 A;  3DF8 A;  1A5J A;  1LDD A;  2XKP A;  2R3S A;  2GOX B;  5B1A H;  3WU1 B;  4R8H A;  2QQ8 A;  3G4S I;  4ZH4 F;  1H9T A;  2L7M P;  1GV2 A;  2JK3 A;  2FOW A;  1SFX A;  3U1K A;  1CQT A;  5ICE A;  4E7K A;  5FKM A;  1ON2 A;  1T33 A;  2IA1 A;  1VQP I;  1T6S A;  2QGU A;  3HEF A;  5E1Z B;  4CYC A;  2ZXJ A;  3LL7 A;  3FM5 A;  2EV5 A;  4Y52 J;  2VB6 A;  1G3T A;  3R4K A;  4L9T A;  1I1G A;  4RA2 A;  2KIM A;  3D5S C;  2JPB A;  3ABT A;  3JRD A;  3P9K A;  3NEU A;  4HV5 A;  3L7W A;  5D5V B;  3ZN1 A;  2VUM J;  5B3S H;  1PP7 U;  1G59 A;  4CZC A;  1IUY A;  4CHU A;  2KZG A;  4I0B A;  4RB2 C;  2HVS A;  1SC7 A;  2P7C B;  1HSJ A;  2ZME B;  4I76 A;  1UCR A;  2GBY A;  4M73 A;  3E6B A;  3C3W A;  1GLN A;  4PDK A;  3BJA A;  2M7B A;  2CQK A;  2QM3 A;  4GRI A;  4RLQ A;  5KHD A;  1LFP A;  2X9D A;  4YG2 F;  1OR7 C;  1HST A;  1ZGA A;  5CVJ A;  1EH6 A;  5E3O A;  1KGS A;  1WJD A;  2KPM A;  1FOX A;  3K2Z A;  4LLG F;  1TTY A;  3EPZ A;  4HNU A;  3GME A;  3F0C A;  4YFX F;  2XV4 S;  1LFU P;  2Z33 A;  1Z0X A;  1HDP A;  2JMW A;  1W7P A;  2F5D A;  4HF1 A;  4RGX A;  5EJC A;  1D0Z A;  1ACI A;  3BTJ A;  4G94 A;  2V1D A;  1MDM B;  3C2G A;  4PCQ A;  3F23 A;  3I0T A;  2VKV A;  3AG2 H;  3TO6 A;  1NK2 P;  2VJ4 A;  2BVM A;  2CYY A;  1VZ0 A;  4LIV A;  3PIO F;  4OIO F;  4MEX F;  2XGC A;  2WB1 N;  2IS6 A;  1GXP A;  1XDS A;  4XLH A;  1RIO H;  1P2F A;  1I3Q J;  3FWE A;  2HFH A;  2OU2 A;  1U5T B;  2M7A A;  2OZU A;  4M74 A;  3UR3 C;  1WH5 A;  4C2U A;  3A0B C;  5GAH J;  2AHQ A;  1ON1 A;  1ZKG A;  1S3J A;  4XRF A;  4AIJ A;  1KU3 A;  4F92 B;  2IGN A;  2H6C A;  3HHG A;  2E2H J;  1FYM A;  1ZLJ A;  4UXN A;  1XPX A;  3AFH A;  1E3P A;  4BY7 J;  1HLV A;  1ITY A;  1O57 A;  1PYV A;  3DLL F;  1B6A A;  4KJZ A;  4XK4 A;  3OYI A;  3VDX A;  1BR1 A;  2PN6 A;  5D4R A;  5CVU A;  4UVA A;  1OLT A;  2E1O A;  3RDI A;  1X4O A;  4IJA A;  1T08 B;  3K1M A;  4KIG A;  1U8B A;  1XGM A;  2UXN A;  1TWH J;  3TMO A;  1K4T A;  2E1M B;  1GUU A;  1JKR C;  4XQF A;  3KET A;  5FRN A;  3H9J A;  1JUM A;  2BW3 A;  2XF6 A;  1X3U A;  4ZZL A;  2GA1 A;  1IC8 A;  1MMS A;  3DBL B;  3JRA A;  3NAR A;  3ZMZ A;  3I58 A;  1R58 A;  1DP3 A;  1I3A A;  2XSD C;  2K7L A;  4G12 A;  3J80 K;  1OCT C;  3GTJ J;  3BR0 A;  2XDV A;  5LRS A;  5EEA A;  5IYC J;  2CQ7 A;  4A3M J;  1BA5 A;  4C9Y A;  2M1B A;  5FO5 A;  1MSF C;  3JAM K;  4QLC U;  4BQA A;  3CJR B;  1MND A;  2BV6 A;  1FJL A;  2LBF A;  3QOP A;  3T0Y A;  3SEQ A;  3GZ6 A;  1STZ A;  3OYN A;  2QUF A;  3DLA A;  5EG0 A;  2DK5 A;  2HXI A;  4BQN A;  2GQQ A;  3X2Q H;  2CW7 A;  1HA8 A;  2P0W A;  1B9M A;  1MMA A;  3RPU A;  3TOA A;  3BRO A;  4ZTF A;  4IEJ A;  3T8T A;  4PFP A;  1EH7 A;  5K7Z A;  1X19 A;  1TWA J;  2O8K A;  3SQN A;  3IL2 A;  3GTK J;  2O7O A;  2GM4 A;  4ENJ A;  2JUG A;  3WTZ A;  2DT5 A;  4QPQ A;  4XID A;  3HUG A;  2CGP A;  3AL0 C;  3OYM A;  2E1C A;  2DFE A;  5IYB J;  2X1C A;  3BTL A;  3OYE A;  1AWC A;  2I10 A;  2ME0 A;  4JYK A;  3PUB A;  2BEO A;  3KZZ A;  3DTK A;  5BOX A;  3BTI A;  1P4W A;  2A61 A;  1OCZ H;  1QZE A;  4CUG A;  2AQE A;  4FET A;  4AVP A;  5TIS C;  4B44 A;  3IKT A;  4O5V A;  2VKH A;  2HQ5 A;  2GXG A;  1SD6 A;  3WGI A;  2MLG A;  3ABM H;  3MWM A;  3WGG A;  3CC4 I;  1U8R A;  4PFO A;  1EKE A;  2NVY J;  1YOV B;  2YX4 A;  3DTI A;  1IUF A;  4CCL A;  2GOM A;  3K4B A;  5DV5 A;  3I4N J;  4ZYA A;  1GVD A;  1Z6T A;  4R1H A;  2FBK A;  4A3L J;  4IHS A;  2K86 A;  1E2X A;  3MN2 A;  4DBR A;  3RZD J;  1EF4 A;  1IXR C;  3IWZ A;  4CZZ A;  1Y8Q B;  1U9O A;  4QTR A;  4NNJ A;  4LB5 A;  2LY9 A;  2DFF A;  3LNQ A;  3E97 A;  5K5Q A;  4B8X A;  2CS3 A;  2Y0S N;  1FSE A;  5DDG A;  3IKV A;  4EJV A;  2C6Y A;  3AG1 H;  5EGO A;  1YW7 A;  1ORK A;  2PMZ A;  2HDC A;  4HEA 2;  3BP8 A;  1BI0 A;  4M6Y A;  4UUS B;  1V54 H;  2FSW A;  4I0A A;  1AKH A;  2AQF A;  4C3H J;  4P1W A;  2DXI A;  3KYL A;  4XOR A;  3KIO A;  3DFG A;  2E7X A;  4PJ0 C;  1YRN B;  3DU5 A;  2V1U A;  5J47 A;  1P7J A;  1XGO A;  3TW6 A;  3F8B A;  4MNU A;  2DT6 A;  3DEE A;  2DFH A;  2H1K A;  1LVK A;  4MHG A;  1O3S A;  4QIW N;  4ZDO A;  2V9P A;  3PSI A;  3ZMS A;  4NB5 A;  3ERM A;  3V7R A;  3CMA I;  5JVG F;  4MTD A;  3DBH B;  1IV8 A;  3B6C A;  1V5E A;  5C4J J;  3BR3 A;  4HA8 A;  4I02 A;  2JA7 J;  1YG2 A;  2LKP A;  4BXU A;  2JVG A;  2GZW A;  1IRF A;  1HC8 A;  1RET A;  5CQG A;  1Z91 A;  1PDN C;  3W3C A;  4YIR X;  3OIO A;  1G8X A;  2OZ6 A;  2W57 A;  3TO9 A;  3V8L A;  4C30 A;  1IN4 A;  2F6C A;  2F48 A;  2YU3 A;  1BI2 A;  1G3W A;  1S7A A;  4ZTJ A;  4ON0 A;  1Y39 A;  5B1B H;  2CW8 A;  1W5C C;  2LNB A;  4RGR A;  3CES A;  1A36 A;  2K5C A;  4OIQ F;  1X1B A;  3BPX A;  4IPA A;  3EUH C;  1BW5 A;  3OL4 A;  5IY5 H;  4Q4Z F;  1KQ0 A;  4OIN F;  4NC6 A;  5JVT A;  2ZNZ A;  1BJA A;  1B59 A;  3CUQ C;  4YIF A;  5LHH A;  3KEQ A;  4LG3 A;  3CTA A;  2TRT A;  2DW4 A;  2NAZ A;  2ZJ2 A;  3ZGK A;  2CWE A;  3SFI A;  3BTC A;  2JTV A;  2ELJ A;  5B66 C;  4L18 B;  3GTG J;  3HPH A;  2G9W A;  2L9V A;  5HLT A;  3W6J B;  3AG4 H;  1IXS B;  1SD5 A;  5D6F A;  2DU9 A;  2HQA A;  3SZT A;  3GXO A;  2QQ9 A;  1WHU A;  3GTQ J;  2RN7 A;  3O8H A;  1MKM A;  3R61 A;  4L5I A;  1Y0N A;  1XMA A;  3FMS A;  5F08 A;  3S2D J;  2JVH A;  3K1N A;  2R7D A;  1YQA A;  3KP5 A;  2CO5 A;  4PJJ A;  4HX8 A;  5E1X A;  2O8X A;  2RGV A;  2EB7 A;  2LP0 A;  1FIP A;  5J40 A;  3ZQF A;  2WV0 A;  2HZD A;  3TED A;  1WGX A;  3TO7 A;  1LB2 A;  4U0W A;  3J81 Z;  1RI7 A;  4IQJ A;  1T0F A;  3BG5 A;  4MEY F;  2Z1D A;  3NQO A;  1JJ8 C;  4BEH B;  3V8K A;  2V7F A;  3GBG A;  2LSO A;  1XB4 A;  3OYB A;  2LY1 A;  3I59 B;  3SFZ A;  3HOV J;  2DQR A;  5F0F A;  1R1T A;  2KIQ A;  4P9U A;  1XS9 A;  4MFE A;  2VC1 A;  2W25 A;  1IN6 A;  2EV0 A;  3JRI A;  2D45 A;  3G2B A;  2BVL A;  2M8E A;  3B6A A;  2KRC A;  1IJW C;  1W5T A;  2DAO A;  4KT5 C;  5DCF A;  1RUN A;  2NOG A;  4ZYH A;  5FKK A;  1J59 A;  4HBL A;  3LSG A;  2CH0 A;  3MCZ A;  4A5M A;  4BGD A;  1ETV A;  1YW8 A;  2IGK A;  3QU6 A;  4EAT A;  2A05 A;  1IN8 A;  3OYL A;  3K70 D;  2ZCW A;  1APL C;  4BJT A;  1MH4 A;  2MYS A;  2HTS A;  3HTU A;  1RUO A;  4L0Z B;  1V55 H;  3M07 A;  3M3Y J;  2F5C A;  4A0X A;  5GTI C;  3PM1 A;  3BR6 A;  2R5Z B;  2ID6 A;  5A2Q K;  1NTC A;  3HSR A;  4KIC A;  4PGH A;  1U9N A;  4E7I A;  3K4N A;  1ZEL A;  2WAF A;  1WJF A;  3S32 A;  5DUI A;  4V19 K;  3HOT A;  2L2O A;  4WXD A;  3W2W A;  2XKO A;  1SFO J;  2R0Q C;  2GLO A;  3KEY A;  4Y13 A;  3QOD A;  1OYW A;  5D5U B;  1VFC A;  1UG2 A;  4BAC A;  2X6X A;  4HDV A;  4NC8 A;  3OYA A;  1JKP C;  1TP4 A;  2XPU A;  2WY7 Q;  3LOC A;  3OYH A;  2O03 A;  4A0Z A;  1VND A;  4ZYG A;  4XLP F;  1B4A A;  2XAJ A;  4GGG A;  3SYT A;  3BZK A;  3E7L A;  1SVO A;  3VYS B;  1H8A C;  1A6Q A;  3HRS A;  4M3F A;  1VQ6 I;  5D6E A;  4A3G J;  4F52 A;  2ZME A;  2DOE A;  4XLN F;  1RKT A;  3VFZ A;  2EJR A;  2GAU A;  3M4O J;  2VT2 A;  1G4D A;  2KDZ A;  3K10 A;  1YX5 A;  3E6M A;  3SZG A;  2RC4 A;  4OU0 A;  4XRS A;  3DKX A;  2DOD A;  1JGS A; 
#chains in the Genus database with same CATH homology
 2FQ4 A;  1ZTR A;  1QRY A;  2EZI A;  3S16 J;  4A3F J;  1MH3 A;  2JA6 J;  5C4X J;  4A3B J;  4EEF G;  3S14 J;  2M9H A;  3IH2 A;  3ZQG A;  5J1R A;  1JJ6 C;  5M3M J;  2PMZ N;  1X2N A;  5GPA A;  5EZH A;  1B8I A;  2EZH A;  4MFD A;  1A5J A;  1JUP A;  3ZQI A;  2E2I J;  2NS7 A;  3FIS A;  4V2F A;  4D5F A;  2L7M P;  1GV2 A;  4Y7N J;  2CJJ A;  2JK3 A;  1F43 A;  1ETW A;  3Q0W A;  1CQT A;  4C3J J;  1TWC J;  3QPL A;  5FKM A;  1T33 A;  2VI6 A;  3BQZ A;  3HEF A;  4CYC A;  1R9T J;  2E2J J;  3H0G J;  3S1N J;  4A3I J;  5E3L A;  5EF6 A;  4Y52 J;  2EBI A;  1JUS A;  2M2E A;  1VI0 A;  2L9R A;  3TP3 A;  2DMP A;  3G1O A;  3FK7 A;  2TCT A;  2FD5 A;  3JRD A;  1DU6 A;  1AHD P;  1W0T A;  2VUM J;  2ME6 A;  3HBL A;  4IHX A;  3NAU A;  2W48 A;  4DYC A;  3A01 A;  1PUF B;  4DYQ A;  2DA4 A;  1DU0 A;  4GFB A;  3L1P A;  4I76 A;  2GBY A;  4FE7 A;  4D5C A;  3IH4 A;  1ETQ A;  1IGN A;  1TWG J;  2HOS A;  1MNM C;  4MLO A;  2Y9Y A;  2X9D A;  4X1E A;  1S7E A;  3JRH A;  4B3A A;  1IRZ A;  2YUS A;  4RDU A;  1T56 A;  4JX5 A;  4FE4 A;  5E3O A;  2MGQ A;  1BW6 A;  3S15 J;  5K7H A;  3F0C A;  1LFU P;  2G0E A;  2H8R A;  1Z0X A;  1HDP A;  2JMW A;  2LLK A;  1H88 C;  3A02 A;  2L0K A;  2WV1 A;  4XRM A;  1MBE A;  5JLW A;  1IDY A;  3PO2 J;  3BTJ A;  1XG1 A;  4I6Z A;  2YU9 J;  3QPS A;  1B8I B;  1B72 A;  2Y31 A;  5F04 A;  2VKV A;  1NK2 P;  1VF9 A;  4A3J J;  3BQY A;  4X6A J;  2L7F P;  2RAE A;  2XGC A;  2WB1 N;  4V2G A;  1I3Q J;  1JT6 A;  2XB5 A;  5FJ8 J;  1WH5 A;  5GPC A;  2AHQ A;  4M6V A;  5IPA A;  1ZKG A;  2LTP A;  1O4X A;  3K7A J;  2ECB A;  2E2H J;  5F1J A;  2R5Y B;  3PO3 J;  4BY7 J;  1HLV A;  1ITY A;  3BT9 A;  2HOT A;  4XK4 A;  2HXO A;  3BR5 A;  2E1O A;  3JRB A;  2OF7 A;  1U8B A;  3GTL J;  1TWH J;  1UMQ A;  4XRS G;  2X6O A;  5M5Y J;  5C3E J;  1GUU A;  1JKR C;  1JUM A;  5FKN A;  1IC8 A;  1A6I A;  3JRA A;  3CQZ J;  3NAR A;  4M3G A;  3OSF A;  4W97 A;  4DZJ A;  2XSD C;  4G12 A;  1JTX A;  1OCT C;  4D7N A;  5IP6 A;  3QQA A;  3GTJ J;  3HB9 A;  3BR0 A;  4J19 A;  1SAN A;  1ZQ3 P;  5EEA A;  2ELK A;  5IYC J;  4A3M J;  1BA5 A;  1MSF C;  1ETO A;  4IHW A;  2XRL A;  2R7Z J;  1ETY A;  1FJL A;  2LKX A;  4AYB N;  2YS9 A;  2ZB9 A;  5EG0 A;  3JRE A;  1WI3 A;  2HXI A;  2CUF A;  2XPV A;  3BR1 A;  1FTZ A;  2CQX A;  2L7Z A;  3FIW A;  2LVS A;  5E3N A;  4IEJ A;  4IHV A;  3HGY A;  5K7Z A;  2K9N A;  1ETX A;  1YRN A;  1TWA J;  3ZQC A;  2O8K A;  4DZP A;  3GTK J;  2O7O A;  1B72 B;  2GM4 A;  5FKL A;  3DCF A;  4M3E A;  3HOU J;  3JR9 A;  1Z77 A;  4XID A;  2DMN A;  5IYB J;  2R5Y A;  3BTL A;  1IG7 A;  3K2A A;  2I10 A;  3LSJ A;  2ME0 A;  4JYK A;  1MBG A;  2DA6 A;  2E19 A;  3BTI A;  2ID3 A;  3SDG A;  4BKX A;  4BXX J;  4XIC A;  4QSH A;  1LFB A;  2HQ5 A;  3C2B A;  2Y9Z A;  5EYR A;  2NVT J;  2NVQ J;  3S2H J;  9ANT A;  2NVY J;  5EDN A;  1JKO C;  1Q1V A;  1IUF A;  2IAI A;  5M5W J;  2MSY A;  3I4N J;  1GVD A;  2DMU A;  4A3L J;  3I4M J;  1MBK A;  3MN2 A;  1FEX A;  3RZD J;  4C3I J;  1EF4 A;  3RKQ A;  3RZO J;  3G1L A;  1RR7 A;  1ZR4 A;  1U9O A;  4QTR A;  1IV6 A;  5IOY A;  2LY9 A;  3LNQ A;  1QPI A;  1HDD C;  3D1N I;  1JTY A;  1I6H J;  2Y0S N;  2NS8 A;  2B63 J;  1D5Y A;  2NVX J;  5EGO A;  1ORK A;  1WCM J;  4A3K J;  3O8G A;  1FIA A;  4UUS B;  5GP9 A;  5EG0 B;  1AKH A;  5M5X J;  4C3H J;  3A03 A;  3LSP A;  1RPW A;  1X2M A;  4FCY A;  2DA1 A;  4A3E J;  1ENH A;  1E3O C;  1YRN B;  1P7J A;  2FX0 A;  3GTM J;  3H3V K;  3TW6 A;  3JRF A;  1IDZ A;  3ZOB A;  1QVU A;  2M8G X;  2H1K A;  1XC5 A;  4QIW N;  2M34 A;  3HDD A;  1QVT A;  2DA2 A;  3IH3 A;  4M3D A;  5IP9 J;  5F27 A;  1GV5 A;  3B6C A;  2XB0 X;  5C4J J;  1RES A;  4UUT A;  3BR3 A;  3LSR A;  1Y1W J;  1I50 J;  2JA7 J;  2JA8 J;  5IYD J;  4A3D J;  1TWF J;  1RET A;  1LE8 A;  2EQR A;  3SJM A;  3OIO A;  2FJ1 A;  2OPT A;  3HOW J;  4LOC A;  3WHB A;  3JRC A;  2Y30 A;  3Q0U A;  1U78 A;  5J3L A;  5IOZ A;  2K40 A;  2JWT A;  3BG3 A;  3HM5 A;  1JGG A;  4JX6 A;  2MG4 A;  4B1R A;  2QF7 A;  2EZL A;  3S1R J;  1BW5 A;  3OSG A;  4UUS A;  2DA5 A;  3G1M A;  4BBR J;  1BL0 A;  5E3M A;  3BG9 A;  2IBD A;  2TRT A;  2VKE A;  1HF0 A;  2LK2 A;  5EZG A;  5FLV A;  3ZQH A;  3SFI A;  4C2M J;  3BTC A;  5EGO B;  2R92 J;  4IHY A;  4JX4 A;  5M3F J;  3GTG J;  3Q3S A;  3HGG A;  1AKH B;  1OCP A;  1ETK A;  3CMY A;  2EZK A;  5IP7 J;  4MO7 A;  2R5Z A;  1FTT A;  1ZK8 A;  1H89 C;  3VPR A;  1G2H A;  3GTO J;  3GTQ J;  3O8H A;  4W1U A;  2O9L A;  3Q0V A;  4RBO A;  2M0C A;  5J1U A;  2DJN A;  1ZGW A;  2VPR A;  5F08 A;  3MVP A;  1K83 J;  3S2D J;  2DA7 A;  1OJL A;  5DS9 A;  4S0H B;  2HOA A;  2LFB A;  1AU7 A;  1OFC X;  2LP0 A;  2HDD A;  1FIP A;  3ZQF A;  2LD5 A;  3IV5 A;  3TED A;  4DW6 A;  1WGX A;  2QCO A;  2R93 J;  1HCR A;  2COB A;  2CUE A;  3HKZ N;  4BBS J;  3BG5 A;  4FTH A;  2AO9 A;  5FKO A;  5DTD A;  1JJ8 C;  3GBG A;  1Y1V J;  5J1Y A;  3HOZ J;  2D5V A;  2DA3 A;  2DMT A;  3FKI J;  3HOV J;  2CRG A;  1LE8 B;  3TP0 A;  3OOU A;  5F0F A;  5BNG A;  1XS9 A;  4MFE A;  5F0C A;  3S1Q J;  3JRG A;  3JRI A;  2JN6 A;  4NDL A;  1MBJ A;  4M3B A;  3B6A A;  2DMQ A;  1IJW C;  3TW7 A;  1GDT A;  2DTZ A;  2IEK A;  3HOY J;  2NOG A;  2P81 A;  5FKK A;  1ZR2 A;  1X58 A;  3LSG A;  1JT0 A;  1ETV A;  1WH7 A;  2JJ7 A;  4DYR A;  1F36 A;  1TC3 C;  3DEW A;  1WPK A;  4ABZ A;  4BY1 J;  1APL C;  4L5E A;  1MH4 A;  2HI3 A;  2KT0 A;  3RQI A;  1BJZ A;  3M3Y J;  5FLM J;  2MW8 A;  1RKW A;  4A69 C;  3PM1 A;  3WHC A;  1K61 A;  1P7I A;  3BR6 A;  3CDL A;  4MIM A;  4AC0 A;  2ID6 A;  2R5Z B;  3UKG A;  2XPW A;  1NTC A;  2ECC A;  3FK6 A;  1MSE C;  4AUX A;  4A3C J;  1W0U A;  1U9N A;  4B4C A;  1HOM A;  4D7M A;  5F0H A;  1JKQ C;  3GTP J;  1SFO J;  2R0Q C;  2GLO A;  2K9S A;  5JLX A;  3HOX J;  3CCY A;  1VFC A;  1UG2 A;  3BR2 A;  4A93 J;  1JKP C;  3S1M J;  2N8G A;  2XPU A;  2K9Q A;  1NK3 P;  1UHS A;  3LOC A;  4CYC B;  1VND A;  5HOD A;  3E7L A;  2WAQ N;  1GT0 C;  1H8A C;  2X48 A;  5K7F A;  1MBF A;  4FIS A;  4M3F A;  3MKL A;  1PUF A;  4A3G J;  1RKT A;  2XGD A;  3S17 J;  2Y2Z A;  4JP0 A;  4HNV A;  3M4O J;  2EH3 A;  2CU7 A;  1MBH A;  2DN0 A;  2JA5 J;  3W6V A;  1POG A;  2CQQ A;  3A01 B;  3ZQL A;  2KDZ A;  2XGE A;  2LR8 A;  2HYJ A;  5C44 J;  4XRS A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...