3S1MJ

Rna polymerase ii initiation complex with a 5-nt rna (variant 1)
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
65
structure length
65
Chain Sequence
MIVPVRCFSCGKVVGDKWESYLNLLQEDELDEGTALSRLGLKRYCCRRMILTHVDLIEKFLRYNP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA-directed RNA polymerase II subunit RPB1
publication title Initiation complex structure and promoter proofreading.
pubmed doi rcsb
molecule tags Transcription/rna/dna
total genus 15
structure length 65
sequence length 65
ec nomenclature
pdb deposition date 2011-05-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
J PF01194 RNA_pol_N RNA polymerases N / 8 kDa subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.60 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Homeodomain-like 3s1mJ00
1ETWA 2DA1A 1P7JA 5FKNA 4MIMA 3S1MJ 3M4OJ 1H8AC 1HCRA 1A5JA 2LTPA 3BR2A 2M9HA 4A69C 4C3HJ 1JT0A 1HDDC 2WB1N 5IOZA 2O9LA 4W97A 2X6OA 3HB9A 5J1YA 3JRCA 1W0UA 5FJ8J 4B3AA 4XK4A 2LVSA 4A3LJ 4I6ZA 2XPUA 1WCMJ 4HNVA 4AYBN 2NS7A 3JRHA 3ZQLA 3K2AA 3HOZJ 2O7OA 1UG2A 3S17J 3PO3J 2Y31A 2RAEA 3HDDA 2R92J 1I6HJ 2PMZN 2XGDA 3OOUA 3D1NI 3A01A 5K7FA 4UUTA 5M5YJ 2E19A 5M5XJ 1Y1VJ 1U78A 1MNMC 1ETQA 1IRZA 2IAIA 1OCTC 4IHVA 1QPIA 2HOSA 2IBDA 5GPCA 4NDLA 3CCYA 3UKGA 1ETKA 3G1MA 1P7IA 1T33A 3BTLA 5IP7J 2LD5A 1R9TJ 4X6AJ 3FKIJ 3GTJJ 5K7ZA 2YUSA 2VUMJ 2M2EA 4JX4A 2NVYJ 5E3OA 4QIWN 3S1QJ 1GV5A 5E3MA 2NVQJ 3QPLA 5EG0A 2K9QA 2TRTA 2P81A 2HXIA 2EZLA 4FE7A 3FIWA 5C4JJ 2QF7A 4RBOA 3B6CA 3GTQJ 2ME6A 1IDYA 2JN6A 2MG4A 3HGGA 3E7LA 1TWHJ 4D7NA 1JGGA 1JKOC 1ETVA 3Q0UA 2XB0X 3GBGA 5F27A 5J3LA 2DMTA 4DW6A 2GBYA 4M3FA 3HBLA 3HOXJ 5EYRA 5GP9A 1ITYA 5HODA 4RDUA 3HGYA 2M8GX 2DMUA 2EH3A 1LE8A 3QPSA 3B6AA 2COBA 2CQXA 3JRDA 4BY7J 3ZQFA 2CRGA 4X1EA 1JKQC 2K9NA 3BTIA 2QCOA 3Q0WA 1IDZA 2M0CA 2FQ4A 1GUUA 4UUSB 1AKHA 3BT9A 4B4CA 2CJJA 1SANA 4CYCB 3IH4A 2LK2A 2K40A 2MW8A 3BQZA 1K83J 1Q1VA 3TW6A 5IYCJ 5EDNA 3OSGA 2HOTA 4B1RA 2Y9YA 3H0GJ 3G1LA 1GVDA 1ZQ3P 1HOMA 4AUXA 1JJ8C 3HM5A 2MGQA 4M3BA 1Z0XA 1ETOA 2CU7A 2DA2A 2WAQN 4DYRA 1MBGA 2ELKA 3ZQHA 4L5EA 4A3BJ 5EEAA 1X2MA 1HDPA 5E3NA 1BW6A 1VI0A 3PM1A 4BKXA 3WHCA 2L7MP 1IG7A 1MSFC 5FKMA 1MH4A 3HEFA 4M3DA 4A3EJ 2DMNA 1ZGWA 3O8HA 1IUFA 3VPRA 3NAUA 1U8BA 3JRIA 1WH7A 1OJLA 4MFDA 5F08A 4ABZA 2KDZA 2R5YA 5IP9J 2VI6A 1MBJA 5FKKA 4V2FA 5EGOB 3S15J 3ZOBA 2FD5A 1NK2P 3F0CA 3WHBA 2YS9A 2R0QC 5M3MJ 3K7AJ 5M5WJ 1S7EA 1JUSA 4A3GJ 2JA7J 2H8RA 4Y52J 2HXOA 5IOYA 2XSDC 4M6VA 5F0CA 1TWAJ 3L1PA 2LLKA 1LE8B 2FX0A 3S2DJ 1JUMA 1Y1WJ 1BW5A 2K9SA 5FKLA 2D5VA 1I50J 1XG1A 3S1NJ 3SDGA 5M3FJ 2DN0A 1BJZA 1SFOJ 3BR0A 3CMYA 3BG3A 3SJMA 1B8IA 4J19A 3LSPA 2NOGA 2CQQA 2HI3A 2LY9A 2JJ7A 3FK6A 1GT0C 4S0HB 1WH5A 1XC5A 2X48A 3A02A 3CDLA 5C4XJ 4FE4A 1IV6A 2XB5A 2JA5J 3HOUJ 1MBFA 5DS9A 2X9DA 1PUFA 3TW7A 2XPWA 3PO2J 1JUPA 1RKWA 1H89C 4W1UA 1CQTA 1B72A 1APLC 4LOCA 1YRNA 3IV5A 1FIPA 2OF7A 4FISA 1E3OC 3S1RJ 2ID6A 5J1UA 2I10A 3GTOJ 4DYQA 4DZPA 2G0EA 4C2MJ 2VKVA 1Z77A 4D5CA 3S14J 4A3KJ 3TP0A 1ENHA 3TP3A 2DMQA 1A6IA 4BXXJ 4D7MA 3JRBA 2DTZA 2LFBA 4A3IJ 2E2HJ 2CUFA 2ECBA 4XRSG 2EQRA 2JWTA 2E2JJ 3ZQIA 1I3QJ 1ZK8A 1ETXA 2LP0A 2R5ZA 4DZJA 5IP6A 4C3JJ 4IHYA 5J1RA 3HKZN 5C44J 2E1OA 2JA8J 1ZTRA 1VNDA 5C3EJ 3OSFA 2L0KA 3O8GA 1AHDP 2IEKA 3ZQCA 3JRGA 3IH3A 1IJWC 1NK3P 3JRFA 3BQYA 5K7HA 3A01B 1ZR4A 1U9NA 3S2HJ 3GTGJ 1D5YA 5EZGA 1GDTA 1IC8A 3S16J 2EZHA 1JKPC 1F36A 1T56A 2B63J 2GM4A 3G1OA 4FCYA 4MLOA 2ECCA 5EF6A 3LSJA 3I4MJ 5EZHA 4JX6A 3M3YJ 2AO9A 4JX5A 2DA5A 2Y2ZA 4Y7NJ 2L7ZA 4G12A 5F0HA 3GTKJ 2H1KA 1POGA 2DJNA 4MFEA 2EZKA 4XRMA 5EG0B 2M34A 4JP0A 3MKLA 1LFBA 1TWGJ 2LR8A 3FISA 1ZKGA 4IHXA 3RZDJ 4EEFG 1JKRC 3Q3SA 5JLWA 1XS9A 1VF9A 2JK3A 1UMQA 3MN2A 1DU6A 3LNQA 3DCFA 4A3FJ 1BA5A 5FKOA 1X2NA 3JRAA 2NVTJ 2AHQA 3BG9A 5F04A 3BTCA 1HLVA 5FLVA 3CQZJ 9ANTA 2CUEA 1VFCA 2XGEA 1IGNA 4MO7A 2R5ZB 1QVUA 3NARA 4UUSA 2W48A 1AKHB 3MVPA 2DMPA 3JR9A 2TCTA 4C3IJ 3IH2A 2ME0A 2L9RA 4CYCA 1MBHA 2DA3A 1U9OA 2HYJA 4BBRJ 2ID3A 3BR6A 1JT6A 2Y30A 2VPRA 2GLOA 3JREA 3BR5A 2VKEA 3LSRA 2DA7A 4V2GA 2O8KA 3H3VK 1ETYA 1QRYA 3RQIA 4BBSJ 1O4XA 1TWCJ 3FK7A 4JYKA 4FTHA 2L7FP 2E2IJ 3I4NJ 1WPKA 2NVXJ 1FTZA 2LKXA 1X58A 5DTDA 3C2BA 1WGXA 4QTRA 2NS8A 1FTTA 1NTCA 1LFUP 1JJ6C 1TC3C 2Y0SN 4XIDA 4XICA 5IYDJ 1FEXA 2R7ZJ 2R5YB 2HOAA 2JMWA 4BY1J 2Y9ZA 1JTXA 3BR3A 1MH3A 3SFIA 1BL0A 5EGOA 5JLXA 4IHWA 1QVTA 2WV1A 1UHSA 4A3MJ 4XRSA 1TWFJ 3LSGA 1RKTA 3BR1A 2YU9J 1RESA 2R93J 1FIAA 4GFBA 3ZQGA 3OIOA 2EBIA 5BNGA 4A3DJ 5F1JA 3HOYJ 4A93J 2XRLA 3LOCA 3Q0VA 1K61A 4I76A 5FLMJ 1AU7A 2XGCA 3RZOJ 1RR7A 1ORKA 1WI3A 2KT0A 4AC0A 4A3CJ 2FJ1A 3HOVJ 2DA4A 2HDDA 4M3EA 1G2HA 5GPAA 1MSEC 2DA6A 1MBKA 2MSYA 4D5FA 3DEWA 1H88C 2N8GA 3GTMJ 2OPTA 1HF0A 1OCPA 5E3LA 3W6VA 3A03A 1B8IB 3TEDA 2EZIA 5IPAA 1JTYA 2HQ5A 1W0TA 1EF4A 4M3GA 1FJLA 1F43A 4A3JJ 4DYCA 1OFCX 1GV2A 1PUFB 3HOWJ 3BTJA 1RPWA 4IEJA 2XPVA 3QQAA 1ZR2A 3RKQA 3BG5A 1RETA 1B72B 2JA6J 3GTPJ 5F0FA 1YRNB 1DU0A 2ZB9A 4QSHA 5IYBJ 1MBEA 3GTLJ
chains in the Genus database with same CATH superfamily
4ZYEA 5FKNA 1DGWY 4PSWA 1B9NA 5A2QK 4GYIA 2HZTA 2BXYA 4LLLA 4JK1X 1BI3A 1HCRA 2LTPA 4N9IA 4RAYA 2R7FA 4C3HJ 1JT0A 2E71A 4Y13A 5IOZA 2O9LA 2HGCA 1HC8A 5D5WB 1MMGA 4Z6YA 3HRMA 2DT5A 3MEXA 4XK4A 2IJLA 1KONA 5HLGA 4KN7X 4XORA 3HZJA 1QZZA 2XPUA 3W2AA 3HPGA 1WCMJ 4AYBN 3JRHA 2C6YA 4IQ4A 3HOZJ 3MKYB 2Y31A 3A0HC 3FF5A 1IXCA 2R92J 3M1CA 3OOUA 4QPOA 2DPUA 3ZN0A 2COMA 5L3GA 2CQKA 3K1NA 1KU7A 4IXAA 5JR3A 1HW5A 1LDJA 5FLXZ 2E19A 1XSVA 5M5XJ 4ZDPA 1I1SA 4IKFA 4UUVA 3ZGKA 3QRFF 1XX5A 3WE3A 4LLGF 5GADJ 2DT7B 1ZN2A 2DODA 4OU0A 3UKGA 3G1MA 1P7IA 2OC6A 1QPMA 4E7ZA 2YUSA 2OJED 1E3HA 3GZ5A 3GTJJ 3H1CA 2M2EA 1ZG5A 1YJNI 3CC7I 2KLOA 2IRFG 1T08B 4XKCA 4EV0A 2W25A 2VLAA 5BOXA 1YOVB 2LBFB 3ABKH 2NVQJ 2EFPA 2DOAA 4L5IA 4LMYA 1LDKB 2KP6A 2R4GA 2Y0SA 3LQRA 3KIOA 1FNNA 1MIJA 3R61A 2RNJA 1IDYA 2KFDA 3GTQJ 4PGHA 3SFZA 4P96A 4GXOA 3ZCOA 2P7VB 3E7LA 4D7NA 3ZN1A 2LMDA 1TLHB 1SD4A 3ZP5A 1ZRDA 5K5QA 1O57A 1ETVA 1JKOC 3Q0UA 2B9SA 4OWRB 4RM3A 3OIQA 2W7NA 1CGPA 3HOXJ 3FHNA 3PUBA 3QOPA 5HODA 3HTSB 2PN6A 3HGYA 2K4BA 4I01A 5FRMA 2LNBA 2EH3A 3GEZA 1LE8A 2CMPA 1NHAA 3JRDA 3LMMA 4BY7J 2QQ9A 3K10A 1YW8A 1R23A 1A04A 1XGOA 1XDSA 2W84A 3K2ZA 3G3ZA 4Q47A 1IDZA 2M0CA 4UB8C 2RNGA 2E1NA 4MQ9F 4LB6B 5JFRA 2F4OB 1K83J 2R7DA 2HOTA 5ICEA 2EB7A 1UJ8A 3ZXSA 2VBYA 3D5LA 5CJ9A 3KETA 4I99C 1ZQ3P 4AUXA 2R7VA 1JHHA 1Z3XA 4L5EA 4LG3A 4MTEA 1G4DA 3IKVA 4UVAA 3ASOH 1BJAA 5FRNA 3EPZA 1S3JA 4E7JA 4CYDA 1G8XA 3K4LA 5LBQA 1LVAA 3T8RA 3SQNA 2X6WA 3MZ8A 2XAQA 2CW7A 3GZNB 3P9KA 3V7RA 4B48A 2CV0A 5LGUA 2P6TA 1WH7A 2D1HA 1B6AA 4ABZA 3CLQA 3K4MA 2KDZA 1WZ2A 2P5KA 4BHCA 3KE2A 3BCBA 3IP4B 2AXTC 4V2FA 4FX4A 4Q4ZF 1ERDA 3ABUA 4HQEA 3KEYA 2DK5A 3AKZA 3FXMA 3HJEA 4MQVA 3G71I 4J01A 2IVMA 2JRMA 1LUJB 2HXOA 5IOYA 2XSDC 4HV5A 4M6VA 4O5VA 1OCOH 5DCMA 3BROA 3OYEA 5L3EA 1TWAJ 3L1PA 2LLKA 1JUMA 2K9SA 4L5JA 4R79A 4F55A 2FE3A 3KP2A 2HOEA 2PMZA 2R7QA 5IT9Z 4ENKA 2VN2A 3VYSB 1XG1A 2VBZA 3ABLH 3H3ZA 3O6BB 2V79A 3U1DA 3S1NJ 3MKZA 1BJZA 4EM1A 1OCRH 2M30A 3BR0A 3C1DA 1KYWA 3M8EA 4L9JA 2CQQA 2IS6A 4A5MA 3FK6A 3O3KA 2G9WA 1QNTA 4S0HB 4BXFA 2FF4A 1XC5A 3CDLA 3R4KA 5CVVA 1YLFA 1YJWI 4PDKA 1MBFA 5DS9A 2FNAA 2X9DA 4AWXB 1G59A 3F8NA 4MGRA 1SFEA 2F5FA 4HX7A 1Q1HA 1DGRM 3J80Z 4XMYA 3KLNA 3QP6A 2Z33A 2FRHA 2K7LA 1V5GA 1XPXA 1ZARA 2CFOA 4LOCA 3CMEI 1YRNA 1SD6A 2VQLA 2KKOA 1ZGAA 5L3DA 5J1UA 4DZPA 1W7PB 2YSRA 1VZ0A 1N77A 2O3FA 1KQ8A 4M6YA 3S14J 3NEUA 4A3KJ 3OYMA 2RGVA 5IT9K 1PVEA 4M72A 3I56I 2QBYB 2HQNA 1EJ9A 2ECBA 2L4AA 4LG0A 1XSDA 2JWTA 2A68F 4BE2A 4CHUA 1XGNA 3ZQIA 4F52A 3ZR8X 4L9NA 5HVQC 3DU6A 2FU4A 2IP2A 3JSOA 1BC8C 4RM2A 2R5ZA 2DJIA 4DZJA 2BOLA 1Z05A 4IHYA 5J1RA 1SAXA 4D0PA 2R7RA 4AVZA 2JA8J 3CJTB 3MKWB 4H4KC 1LQ1A 4E6KG 1WJFA 2HNHA 3OSFA 1J09A 5K5RA 1BN5A 4G7ZF 3JRGA 3BQYA 3CO6C 2QUFA 3IWZA 1U9NA 2XAJA 3S2HJ 2P5VA 3K9TA 4YIRX 2R7SA 1EKEA 2EIJH 1VQ5I 2EZHA 2E5ZA 1F36A 2K02A 3TMOA 2B63J 2Q1ZB 1MMDA 4PZJA 1BI1A 3E6MA 3S3NA 3CJNA 2XRNA 2DPDA 2XDVA 5EF6A 2UV1A 2VBWA 5H2FC 2X4HA 5DUIA 1Y0UA 3M3YJ 2UXXA 4Y7NJ 2DA5A 2Y2ZA 4B09A 4WXDA 5FROA 4BAYA 2FNPA 3S93A 3QYBA 1OKRA 5E79C 2KRCA 3QP5A 2P6SA 2VJ5A 2CS3A 3SXYA 4OIOF 3K69A 2LR8A 5D8KB 3FISA 2ZC2A 3VOEA 1S8NA 1ZKGA 2OUMA 3FMQA 2KZVA 1O7LA 4CDGA 2EV6A 4S04A 1YITI 2HTSA 4OOIA 4EM2A 1XS9A 1XD7A 1HKTA 3RYRA 3QYFA 4HDVA 4CCMA 2W24A 2XAGA 3AG1H 2XV4S 1TZLA 2E34A 2EJRA 3DCFA 1HXDA 4PFOA 1RNLA 5L3CA 3JRAA 3RIRA 4D1QA 3RKYA 1IF1A 3BG9A 4ZJZA 3WTSC 2QQ8A 1VQKI 2FOWA 1Z9CA 2P8TA 2WADA 4WCGA 1WFXA 3JR9A 3SZPA 2QKMB 3FXJA 2E1CA 2ME0A 3J7YJ 4D9JA 3FKJA 3LAJA 3Q9SA 5TJJA 4HEA2 1U9OA 4HX8A 5D5XB 2GLOA 4ZYDA 1KYZA 4ASNA 2NS0A 2O8KA 1OYYA 1D1BA 1QRYA 3PL8A 3RQIA 3WE2A 1P4XA 3EUAA 2E2IJ 3I4NJ 3CZ6A 1WPKA 3FXUA 3JSPA 1KZHA 2AQEA 1GXQA 1X58A 4KITB 1BIAA 2WC2A 3C2BA 3S8PA 2QA4I 4NQWA 3F8CA 3E6DA 1FBSA 2HKOA 2LDUA 5E1XA 3DBLB 3E97A 4ZZLA 1JI8A 5D6EA 1SD5A 2WAFA 3FMRA 4EJTA 2H8WA 4M74A 1ULYA 2HS5A 2PQ8A 5HDNA 5IYDJ 1FEXA 1CF7A 3KZYA 3BR3A 2IS1A 1BL0A 1F4KA 3MAJA 2A61A 3BZCA 4IHWA 2YX7A 3BPVA 2M4KA 4R1HA 1G3YA 3MWMA 2WY8Q 4XRSA 1TWFJ 4CZZA 1NH3A 2MA3A 3LSGA 5F6FA 1RKTA 3BG7A 4G94A 4OIPF 2LF8A 3FHZA 1RESA 4ZTFA 1B4AA 2HU9A 5DEQA 1WSUA 4EMSA 1S7OA 3OIOA 3A0BC 3PUFA 2CG4A 5F1JA 3GZ6A 1T6SA 1K61A 4PSXA 3GF2A 4XOTA 3VSLA 2HR3A 1IAWA 2IS2A 3RZOJ 1R4MB 2DFIA 4E7LA 1Z1DA 1LNWA 1WI3A 4IF4A 4U88A 1S6LA 2ZCWA 4XLNF 3KZIC 3KZZA 2GWRA 1FZPB 4KYWA 2ZJPF 1UELB 2EILH 1K6YA 4XKWA 4F7ZA 1H88C 4DIQA 3OY9A 1HF0A 3BDDA 1FOYA 2L54A 2PJRA 1PP8F 1V4RA 1B8IB 2MD0A 1HSTA 2F5VA 5CQEA 3I53A 1VQ4I 3I64A 1UCRA 2ESHA 1W0TA 4PJLA 3ESWB 1UB9A 4AIHA 4DYCA 2PBIA 3KFWX 3TDUC 3CD6I 2R7XA 3GUDA 2E60A 2A6TA 3M07A 1PUFB 2EINH 3HOWJ 1O7FA 1RPWA 3BTJA 5E1ZB 1AOYA 4IEJA 4KNYA 2DQRA 2PMUA 3QQAA 4ZH4F 3RKQA 1ZR2A 1XMAA 2BGCA 2DO7A 3BG5A 2RN7A 2JSPA 1IRFA 3LSKA 5F0FA 1TBXA 1WHUA 5IYBJ 2ZXWH 4XM3A 2DA1A 5DM6F 1P7JA 2EFOA 4MIMA 3LA7A 2Y69H 3M4OJ 1YE9A 3K6GA 5K5OA 4ENMA 3RKWA 2XAUA 1GHCA 3IKTA 4AIKA 5E20A 2HZDA 2BZTA 4M73A 1TTYA 3BR2A 4BQNA 4A69C 3ECOA 4ON0A 3H3UA 2X51A 4EJOA 3HB9A 4UV9A 4P9UA 1MD0A 3BJ6A 4RB1A 2LVSA 3DP7A 4BJTA 4A3LJ 4PK4A 3O2PE 2XAFA 4E7SA 2VQGA 3V8KA 2NXNB 2WA0A 4CA0A 3FXQA 2NS7A 3ZQLA 3DF8A 1ZRCA 3EUKL 1BM9A 3BJAA 1UG2A 1R49A 2GZWA 3CMMA 3L9FA 3CMAI 4F3QA 1R1VA 3OYBA 1I6HJ 1N78A 1S9HA 3A01A 4HLXA 2D2WA 2E7WA 4XNFA 5DD8A 3PNVA 1KU3A 3F8BA 2IAIA 3BLYA 4ENNA 1BI2A 1T39A 1OCTC 6PAXA 5L3BA 1RUOA 3K70C 1NG7A 4IX7A 1SAUA 1T8IA 4XSZF 3VFZA 5HDKA 1T33A 4X6AJ 1J9IA 4B3XA 3RDIA 4HQMA 2K85A 1O3RA 3CCSI 5E8GA 3I54A 4LD5A 3X2QH 3E6BA 3QPLA 2K9QA 1HQCA 2YU3A 3BWGA 1LPQA 3DLLF 1K79A 2EZLA 4FE7A 3FIWA 5C4JJ 2QF7A 4RBOA 2OAZA 1SEUA 1D1CA 3A1YA 2K5CA 2F48A 2MG4A 3CCJI 1W36D 3J81Z 3HGGA 2KPMA 2Q2EA 1MNDA 1TWHJ 4GYGA 1F5TA 2OTJI 2ZFUA 3ERMA 1YFHA 1SD7A 1ZRFA 3HUGB 4CH7A 2STTA 5F27A 1JGSA 4XKVA 4DW6A 2GBYA 3HBLA 3LSMA 5FD6A 5EYRA 3IRQA 3MQ0A 4A0XA 1Z67A 2COBA 3ZQFA 2CRGA 1QGPA 1D8JA 4ZDLA 5J47A 2JPCA 2DQLA 3R0JA 2K9NA 3J7AY 2BHZA 1V3FA 3HOSA 2QCOA 4XN0A 1X1DA 3HRSA 2FQ4A 4A12A 3BP8A 4UUSB 1AKHA 3C2HA 3BT9A 3RI4A 4KJZA 5LEJA 2CJJA 4H0EA 2LK2A 2K40A 3TW6A 3HSEA 1Q1VA 3PNTA 4ZDOA 3P5JA 2IGNA 5KVRA 1D3YA 2FMYA 3G1LA 3CUQC 1IXRC 3HM5A 4PGGA 2KMUA 2L9SA 3H35A 3J81K 3AL0C 4A3BJ 1X2MA 5E3NA 4G7HF 3PM1A 3ERED 2BYVE 4RB3C 1U5TC 4NHJA 3WHCA 2QYOA 2ICWG 5FKMA 2K3FA 1IO2A 1MH4A 3HEFA 4RS8A 3K4KA 3PFIA 1ZGWA 3MD2A 2BBYA 2Z1DA 1ZYRF 2L5QA 3JRIA 4MFDA 1S5LC 1FBQA 3AAFA 2IA0A 5CVRA 5IP9J 1MBJA 1BIBA 5KAFC 1WJBA 3CUQA 5EGOB 3HOTA 4WF2A 1F9NA 1OLTA 3S15J 1L3LA 3K4BA 2VL8A 4C2UA 2FD5A 3HPHA 3F0CA 3L2VA 5M5WJ 4PUSA 1MJBA 4AD9A 1JUSA 2V1DA 4CCKA 5B3SH 1U5TA 3JCUC 4A3GJ 2JA7J 2H8RA 2NVUB 2V9VA 4I2OA 4J00A 2B0LA 3FBNB 4XLHA 4HF2A 2ZFWA 1LE8B 2FX0A 2R7OA 3H9JA 4LGWA 4F93B 1YIJI 2IGMA 3S2DJ 1M1EB 1FSHA 2VKDA 1E2XA 2D5VA 1I50J 1YHQI 3ZQQA 5FB2A 4BDYA 3VWBA 2Y48A 3SDGA 5M3FJ 4GGGA 1NG6A 2ZMEB 4KIGA 1KU2A 1C0WA 3RQ4A 1T0FC 5GTIC 2NOGA 5LRSA 2JJ7A 1GT0C 1UHMA 1R6RA 4KIFA 1WH5A 5C4XJ 5CVJA 3E5UA 3HOUJ 3CF5F 2RREA 2XHKA 1RR8C 3HIFA 3TW7A 1ON2A 3PO2J 5D5VB 1JUPA 1RC9A 1RKWA 4HW0A 2ISYA 3MMYB 1MDMB 2J5PA 1V54H 2VODA 1XCVA 2BV6A 3IV5A 2M1BA 3UNGC 2QENA 4FISA 1E3OC 2ID6A 5LHGA 1W4MA 4DYQA 2E35A 2G0EA 2M45A 3ZMVA 4Y17A 1T0FA 1Z77A 4PJ0C 4D5CA 1UAAA 5JI6A 3TP3A 4II2A 5FLXK 3CC2I 4BNCA 2DTZA 1KQ0A 4A3IJ 1Z6TA 4UXNA 1S72I 4XRSG 2WWYA 2EQRA 2GIVA 2E2JJ 3LAPA 5H6QA 4DOZA 1D5VA 1FSEA 1ZK8A 3DTEA 4UB6C 5AIQA 4A5NA 3H9GA 5FGMA 1ZTRA 2GIZA 3F9KA 1J59A 5C3EJ 5E17F 2MH9A 2BY1A 3OYIA 2IEKA 1Y8QB 4BEHB 2BE5F 1X1CA 2IGOA 3SZTA 4CO8A 4N9HA 4KUMA 4F91B 3ZQCA 1W5TA 1Z7LA 1PYVA 2VC1A 4UV8A 4IPAA 4UHTA 1ZR4A 1R5GA 4A6EA 5LLQA 3PNYA 2VB6A 3CCLI 3WTWC 5EZGA 1BI0A 4E7IA 3QPHA 3TOBA 3DU5A 2QM3A 4YIIA 1HKSA 3G1OA 4MLOA 3G4SI 4XL9A 3GXOA 2V9PA 3J7ZI 4EM0B 3LSJA 1YS7A 3M8FA 4KIBA 4OIQF 1I1GA 1P2FA 3C7JA 5LGNA 3WTXC 2A6EF 2X1CA 1BR2A 4CUGA 3GX4X 2AO9A 4JX5A 3NQOA 3KX2A 4IRIA 4EJUA 3BY6A 2JUGA 3F3XA 4AIDA 2LBFA 1YJ9I 2DJNA 4MFEA 5EG0B 2M4GA 2M34A 5HLIA 1G3TA 1LFBA 1F1ZA 2P0WA 1W5CC 1FP1D 2GXGA 3CESA 3KYDB 3KP6A 4RB2C 4BH9A 2ZSIB 4YFKF 2CSOA 1BC7C 4XR6A 2Z16A 2CGPA 1T98A 2H6BA 3K1PA 2E5NA 3N4MA 2NYXA 1R71A 2UUZA 2GA2A 2OU2A 5HNFA 1DU6A 1IN8A 4DNCA 3FXOA 2AXLA 3TQNA 3LNQA 3N05A 3VSKA 3CC4I 4KDPA 1BA5A 5FKOA 1X2NA 1R22A 1O3TA 1P4AA 4XLCA 3PJRA 1S29A 2AHQA 4QLCU 3FWEA 1B1BA 4Q5SF 2QSHX 4Y15A 1QQIA 3CQZJ 4ESFA 4YFNF 2CUEA 1YX5A 2R5ZB 1QVUA 4RLFA 3ISPA 4XLEA 5CYVA 1Y0NA 2DMPA 4P55A 3RPQA 2EWNA 1MBHA 1J75A 2CWEA 2DA3A 5TGTA 4HG2A 5BPDA 4BBRJ 2VPRA 3JREA 3F6OA 2VE9A 2ZXJA 2PFBA 3H3VK 2MYSA 3WGIA 2KQRA 2H6CA 1XCBA 2M3AA 2V1UA 1ZGJA 3KP5A 1O4XA 4FTHA 2L7FP 3VODA 1GXPA 2ZJ2A 2CV2A 2F5CA 1KU9A 5J6XA 2QQAA 4XQFA 4WWCA 4CXFA 3CCMI 4QTRA 2MFZA 3MZHA 1OQYA 3JAMZ 4GO1A 3TBIA 3NWSA 4ZYGA 2A3SA 1K4TA 3W2WA 3CJQB 3CCVI 4XKBA 2F4IA 2FOKA 4XIDA 2QEXI 2R5YB 4XOPA 1BBYA 3QODA 4BY1J 2W85A 1JTXA 3GFIA 1MH3A 3D5SC 3AG2H 1DPRA 1Z91A 2HDWA 2VXDA 5JLXA 2MH2A 3I0TA 2XSJC 1BOAA 4G6TB 4UVBA 2IS4A 1LB2A 4I98B 2W82A 5HNHA 3CJRB 4C30A 2NRAC 1QZEA 2CUJA 5ILSA 4ENJA 3LFKA 1UFMA 3B02A 4A3DJ 4A93J 2PI0A 3VEPA 3Q0VA 2L9NA 2CQNA 4I76A 1AU7A 1V5EA 1IN6A 2XGCA 2EFQA 4M6XA 2LYCA 5CVIA 3G73A 3J80K 1OYWA 2XAHA 5D4RA 4ZYHA 4IO9F 2DA4A 2KIUA 3D0SA 5B5EC 2KJCA 2JVGA 4MEXF 2DA6A 1MBKA 4E4HA 3GTMJ 3JAMK 3LFUA 2A07F 3I71A 1R1UA 1OCPA 3P9IA 5DD4A 5E3LA 3A03A 2EZIA 4XRFA 4LJZF 4OAZA 3RPUA 2V6EA 4CCJA 1IN4A 1ZG3A 2DBBA 1YW7A 2QWWA 4M3GA 4KT5C 5FFZA 4A3JJ 2YR2A 4M9XA 4XLFA 3KP7A 1GV2A 5ILUA 5EJCA 4AIJA 2KRFA 2D45A 3F21A 3KP3A 5KNLA 1WRJA 3SHFA 4B47A 1DP7P 1RETA 1B72B 2JA6J 3CP8A 3GTPJ 1ZH5A 4QSHA 3H0DA 1MBEA 2RDPA 1ETWA 4BL0B 1W7PA 2BVLA 3ZRGA 4BJ6C 3DQVC 1H8AC 1ZHFA 1K7AA 1SFKA 4IQJA 1A5JA 4G7OF 2LKSA 2M9HA 2QBYA 1HDDC 2WB1N 3UR3C 2X6OA 1W0UA 4RGUA 3JRCA 1TT0A 5FJ8J 2ZNYA 4B3AA 1ONVA 2P5LC 5ICGA 1E17A 4I09A 5CVUA 3ABMH 4V19K 5D5UB 1J2XA 4JQFA 5J8FA 3OYGA 4HNVA 5ERIA 5DDGA 4M71A 1YS6A 2XC7A 2W1OA 1D1AA 1YO5C 3PO3J 2JZYA 1ACIA 2RAEA 3ZMUA 3HDDA 2VJJA 2GQQA 5F1RA 2PEXA 3OS1A 3RKXA 4UUTA 1LFPA 5M5YJ 4PFPA 3F8MA 1YI2I 1Y1VJ 2FSWA 2A5WA 1QU3A 1U78A 2V1XA 2EK5A 1ETQA 1MNMC 1WWXA 1FX7A 1IRZA 4IHVA 3RJPA 1UHWA 1QPIA 2RQPA 5LHHA 1AWCA 2B7EA 5GPCA 1GLNA 4U0VA 2GXAA 3CCYA 2LD5A 1ETKA 2KRHA 1FY7A 1DDNA 2DLLA 3WODF 5H20A 4E70A 3G2BA 2H09A 4JX4A 4QIWN 3H36A 4AM3A 5LFAA 2RVCA 4G6QA 3V7SA 5E3MA 2K3PA 1AA7A 3I59B 2TRTA 4HRIA 1VQ6I 2P81A 4WXCA 2HXIA 2VKHA 1D0XA 3R0AA 3OR1C 4HF0A 4I02A 4OAYA 4HNTA 3M1EA 2EA2A 1MW7A 2FBKA 3AG3H 5B1AH 2KIMA 2VJ4A 2M5WA 2XB0X 5HDGA 1QZYA 2M8EA 3RSNA 2IA1A 3H9QA 5EEHA 5GP9A 1U2WA 3A2KA 4U7BA 1U6GA 4RDUA 4P5OA 2EV0A 2M8GX 2KHMA 1X4OA 5E18F 2F5EA 1T2KA 1VQLI 3B6AA 2CQXA 1ODDA 2O61A 3AG4H 5K1YA 4X1EA 4FX0A 5AONA 5LEKA 1JKQC 3EQLF 3OYFA 5HS7A 1ON1A 3Q0WA 2DI3A 3F8FA 3L2CA 1MMSA 3KEQA 4CYCB 1DP3A 3BQZA 5JHFA 4HSRA 1MNEA 5IYCJ 2J5OA 3PSFA 3W6KB 2XIGA 2Y9YA 3WG7H 3OYLA 2IA2A 2L4MA 1FT9A 1WJ5A 1EV7A 1JJ8C 4M3BA 2MGQA 5D6FA 4IHSA 1ETOA 1OMIA 2CU7A 2WAQN 3VYUB 2RC4A 1G3SA 4BACA 3OL3A 1U0JA 1VQOI 1BW6A 3W3CA 2WTEA 2VOOA 1STZA 1N75A 2UWMA 4BKXA 1DUXC 2L7MP 2E1MC 1IZ1A 1IV8A 3S32A 3WG9A 1QBJA 4M3DA 1X4PA 2Q0OA 4G9YA 2A6HF 1O3QA 4UVCA 1VQ9I 4A3EJ 2DMNA 4CCLA 1IUFA 1U8BA 2QSGX 4HX4A 3KP4A 1SMTA 1VQMI 1U3EM 1K78B 5IT3A 1EH6A 1P92A 2RKHA 2XF5A 5KAIC 3KPHA 3ZOBA 2LSOA 5D8LB 2VJIA 2BVMA 1TQMA 4IZZA 2O0YA 2YS9A 4PJNA 1Y6IA 5HS9A 3GLXA 5M3MJ 3E5XA 1FOKA 1S7EA 3GLLA 3IAS2 1R4NB 2Y75A 5BQTA 2CV1A 2HFHA 3V8LA 1G6NA 2P7CB 2BW3A 4LIVA 4XSXF 2CYYA 2H1LA 3HYIA 2FXAA 1A31A 2L02A 4KN4X 2XASA 1R5HA 5FKLA 1USTA 3F22A 2HPMA 3DBRB 1YX3A 3CCRI 3HSRA 4U87A 5EEGA 1LEAA 2HPIA 3ASNH 2JQ7A 3M8JA 2DN0A 1IW7F 1XMXA 3V8JA 5GAGJ 3KYLA 5LD2C 3PIOF 2D1VA 4Q48A 1TNSA 2MBFA 3BG3A 3ZMZA 1BR4A 4YRVA 3SJMA 1B8IA 4J19A 3LSIA 1R58A 2HI3A 2FBIA 2LY9A 3FM3A 4P1WA 2KZGA 1A35A 1LEBA 2X1DA 2X48A 3HHGA 3CCEI 4FE4A 2VASA 2GOMA 2JA5J 1QHHD 1T95A 2W00A 4RGSA 5TRDA 3DTKA 1PUFA 2XPWA 1H89C 2LRDA 1ZG1A 1DQUA 2Q8KA 5ED4A 1JXSA 1APLC 4DBQA 5LGTA 1OCCH 3QPTA 1X3UA 3LQQA 1GVJA 3LSTA 2VIXA 3GTOJ 3OYNA 5DV5A 2HVQA 4C2MJ 3I5UA 3QU6A 2FMLA 2HYGD 2F2EA 2ISZA 2JUCA 3IC7A 1REPC 2QLZA 3WU1B 1A6IA 5FFXA 4D7MA 3I3LA 2LFBA 5E1WA 2OBPA 3CUQB 4G6DA 1IRXA 4M9ZA 1R1TA 3GWZA 2A69F 1I3QJ 3ZMSA 3HC7A 3GYHX 1ETXA 5CLSA 3T8TA 5B1BH 1EA3A 3HKZN 2BY3A 5C44J 2E1OA 3DKYA 3PQJA 1VNDA 3L2QA 3BJOA 3K1MA 5J40A 2L0KA 4EJWA 4YG2F 2FBHA 2VPLA 1IJWC 3WTTC 2HQAA 3REOA 5A2QZ 3JRFA 2L01A 2ZKZA 1D5YA 3ZMDA 1GDTA 2I8DA 4MEYF 2QZ8A 3D5RC 1IC8A 4IRGA 4ETSA 3EYIA 4IHTA 1OR7C 4LK1F 1IUYA 5KK1A 1J7KA 4EGZA 3ELKA 2ECCA 2K86A 1WQ2A 3H5RA 4Y3OA 1HA8A 4O3MA 5GTHC 1BR1A 2EIKH 3GTKJ 2ZXHA 1POGA 4GRIA 3JW4A 3WGHA 1HKQA 3NWTA 4XN3A 3C3WA 4ITVA 4EVIA 2EFNA 2G7HA 4JP0A 2K9MA 4CCNA 1QA6A 1OPCA 1X1AA 4BJ5C 2OD5A 4IHXA 4BUPA 2E7XA 3TO9A 4EEFG 4UY8I 1JKRC 3V7CA 3WTVC 3R60A 3Q3SA 5JLWA 2QVOA 2GA1A 2OA4A 1UMQA 2V6CA 4BS9A 3MN2A 3HUGA 5J4VA 1OR7A 5BMZA 4EQQA 3BPXA 3COAC 3P7NA 5ICFA 4A3FJ 4AYBA 4MHGA 1VQ7I 3AFHA 4B44A 2GOXB 1R7JA 4ZYAA 2MC4A 4DBRA 5HS8A 2O8XA 3ML6A 1B9MA 1LJ9A 1HLVA 2CW8A 3OYAA 5FLVA 5L3FA 2XGEA 4LIUA 4KFCA 4HLYA 4MO7A 4L0YB 5CKTA 2DTRA 3DPLC 3NARA 4PJJA 2LY1A 3IUOA 4UUSA 3MVPA 4ANJA 1RRJA 4S05A 1IN5A 1XB4A 1W5SA 3WU0A 3PIPF 4BQQA 3WGGA 5DM7F 3BR6A 4CSWA 5GAEJ 3DEEA 1JT6A 2Y30A 3BR5A 2VKEA 2M0MA 2DA7A 2YPRA 3P9CA 4V2GA 4KICA 5FD5A 4BBSJ 2LKPA 1OYIA 3SZGA 2GXBA 3OMYA 3L2UA 1B59A 2HDCA 1FTZA 2BY0A 3HRTA 3I58A 3V42A 1WGXA 5H6RA 4DGWB 3DEUA 4LLNA 2NS8A 2DT6A 1RZ4A 3H5NA 2XKOA 1HBXG 4NNJA 2G7UA 1FBUA 1USSA 3ZMTA 3I4PA 3OWTA 2Y0SN 4A0ZA 1YW9A 2Y0MA 3TGNA 3U9GA 1UG0A 2JMWA 3N97A 2Y9ZA 3RCOA 5J8CA 2JT1A 2ZMEC 3SFIA 5EGOA 1TL8A 3L7WA 2W57A 4NC8A 1MKMA 2VT3A 1O3SA 1UHSA 3EETA 3VYRB 2WBMA 3BOQA 3BR1A 2YU9J 1TQPA 2MLKA 1FIAA 3FXRA 3HSFA 3WTZA 4GFBA 4BGDA 2EBIA 2DYSH 2XRLA 3LOCA 1PJRA 3BCAA 5JVTA 1WVRA 5DCMB 1VQPI 2HQRA 3TO6A 1A6QA 1IRGA 2FEZA 4EJVA 3HOVJ 1I39A 2ETHA 3BZKA 3OOPA 3MCZA 3Q5FA 5GPAA 1XTAA 2MSYA 3K0LA 3TOAA 3DEWA 2DDBA 2OPTA 1KGSA 2ZMEA 3KLOA 1VTNC 3DPUA 2O5RA 5IPAA 3S3MA 3S2WA 2R7UA 4HZFA 3PFYA 4IOAF 1EF4A 1F43A 2NAZA 2JVHA 4HBLA 3CCUI 5HLHA 4R8HA 2X6XA 1KA8A 2XPVA 2Z99A 2DXIA 3M9AA 2R3SA 2OZ6A 4BU2A 2LY2A 1MDMA 1MJAA 3LSHA 4DQ2A 2XGXA 1MGTA 2NNNA 1YRNB 1DU0A 2ZB9A 2Z5UA 1WJCA 2CUZA 2AQFA 2L2OA 2KDOA 3S1MJ 1VQ8I 2QGUA 1MZBA 4GDFA 2CO5A 1SVOA 2ZJRF 2LG4A 2HKXA 1R00A 3QWLA 2R7WA 4LG0B 1T38A 1R5ID 4DJAA 4W97A 1E3PA 5J1YA 1PUEE 3K70D 2I5UA 4LB5A 3CCQI 3LWFA 2PMHA 3DFGA 2O6GE 4I6ZA 4KISA 1XMKA 2QQBA 2WAEA 1V55H 1Z21A 4HV6A 3K2AA 3OYDA 3QYEA 5ICCA 2Z9OA 2O7OA 3VYTB 3DBHB 4RAZA 1MMNA 3S17J 2CFXA 3T0YA 5BS6A 4BEHA 2FA5A 4IRHA 2PMZN 2XGDA 2Z2SB 4KMUX 3U21A 3D1NI 5AIPA 2IPQX 3VDXA 2IGKA 2BHYA 5K7FA 3CTAA 3LA2A 3FXKA 3VB2A 4NB5A 1K4SA 1TW2A 3GVAA 3ZPLA 1FYKA 1YQAA 4I0BA 3SEQA 1LKXA 2HOSA 1H9GA 2IBDA 4TV7A 2CQ7A 1X1PA 4NDLA 1WJDA 2ELHA 1R9TJ 3BTLA 3JTHA 4RMNA 5IP7J 4Y4RA 3FKIJ 5K7ZA 2NOJB 3B73A 2VUMJ 1Z3YA 2EA4A 2NVYJ 5E3OA 3S1QJ 2F4MB 4NUBA 4YFXF 1JE8A 4XBFA 4L18B 1GV5A 2OQGA 3CF2A 5EG0A 2ZJQF 3T5XA 2LC2A 5ILVA 3T1BA 3OYHA 2O03A 4RA2A 4LFUA 3B6CA 1QO0D 2LREA 4I7HA 4QWQA 4G8XA 3LA3A 2ME6A 2JN6A 2XROA 4RB0A 3CP2A 3DLAA 4YIFA 2H94A 1MMAA 3ECHA 2VXZA 3DKWA 1JGGA 4CGZA 2PLYA 2R7TA 2Z3YA 4O6JA 2PX9A 3GBGA 1TP4A 4OMZA 1I27A 5J3LA 2DMTA 1SC7A 4M3FA 4WX9A 1ITYA 5BPIA 3FX3A 3OS2A 2DMUA 3QPSA 2VC0A 3ULQB 2V4JC 2VE8A 2KJBA 3CLOA 1WKMA 3BTIA 1W36C 3FXLA 4K2EA 1Y39A 3EDPA 1HW2A 3NRVA 1GUUA 2H27A 4B4CA 1SANA 3IH4A 1JHFA 4FETA 4E7KA 2MW8A 3OSGA 3FDYA 2HYFA 2OTLI 5EDNA 4CICA 1SVMA 4B1RA 3GFJA 2BY2A 3KCCA 3H0GJ 1GVDA 4N4OB 3V4GA 1HOMA 4LITA 1Z0XA 4QPQA 2DA2A 4DYRA 1MBGA 2ELKA 2BEOA 3ZQHA 1U8RA 5EEAA 1HDPA 4F92B 4FQGA 4ZZDA 2EPFA 2F5DA 1VI0A 2L9VA 1W1WE 3SDBA 1R36A 3K4JA 5D4SA 1FPQA 2X0LA 1IG7A 2ESNA 1MSFC 3GO5A 2DOFA 1V5FA 1RI7A 4ZC3A 4NQWB 4Z2YA 3OV8A 3M7GA 4BQOA 1YIOA 3DV8A 3O8HA 5LRRA 3VPRA 3NAUA 1FYLA 1D0ZA 1OJLA 2M7AA 5F08A 4KA4A 4L0ZB 2R5YA 4BHBA 3OS0A 1CF7B 5DCFA 1I3AA 2VI6A 1FLIA 3DWLE 3E1SA 3BC8A 5FKKA 2P4WA 2A05A 3CDHA 4ESJA 5E8IA 3HTUA 2JRTA 1NK2P 3WHBA 2WB1A 2K9LA 2R0QC 3LL7A 1TNTA 1VQNI 2VQCA 4JOMA 3DTIA 3K7AJ 4HOBA 4NC6A 3A4CA 1FMWA 4Y52J 3L2RA 2K4JA 1Z6RA 4IL6C 2OCEA 5F0CA 5FO5A 1OISA 4A0YA 4UNOA 2RV8A 1BW5A 1Y1WJ 3I55I 1DPUA 2HWVA 1IXSB 1I6XA 2HVSA 3WTYC 4HYEA 3ZQ7A 5DUKA 4BYYA 2NNYA 4BHPA 3DKXA 2DFEA 2HVRA 3IHUA 4A2UA 1J0RA 1ZAOA 2TDXA 1SFOJ 3WTUC 2M7BA 3CMYA 4MTDA 2PJRB 3IAM2 3LSPA 4OMYA 3U2RA 1D8KA 3WU2C 3QOEA 3L2WA 3A02A 3SYTA 1X3ZB 2DFFA 4ESBA 1IV6A 2XB5A 4L9TA 4HF1A 2LOOA 3OL4A 3F72A 3L00A 4P9FA 2DDAA 2JA2A 3C2GA 4IOCF 1EH8A 2XUBA 4W1UA 1CQTA 2DYRH 1B72A 1WJEA 3KYCB 4RGRA 2AS5F 4IVNA 2M87A 1FIPA 2OF7A 4FT8A 3S1RJ 4BE0A 2HEOA 2I10A 3C18A 3E5QA 4C2TA 2RQQA 2KISA 2VKVA 3H92A 3QU3A 3TL4X 1X1BA 4MNUA 2MABA 1ENHA 3TP0A 2DMQA 4BXXJ 3JRBA 2E2HJ 2CUFA 2ELJA 2QKLB 3ONQA 5DYMA 1TW3A 3OR2C 1XSXA 2X6YA 2L3DA 5B66C 3TKYA 2LH9A 2UZKA 4BDZA 4JBAA 2LP0A 5JHUA 4U7DA 5IP6A 3OYJA 2CW0F 4C3JJ 1TT5B 3FM5A 3FBIB 4HAMA 5JVGF 4M9SA 4N4NB 2KL4A 4PCQA 2E1MB 2DAOA 2VT2A 3G6EI 1X3WB 2IW5A 1LVKA 3O8GA 2BW3B 2XF6A 1HW1A 3ROUA 1AHDP 4B43A 1PP7U 3IH3A 2BXZA 3E6CC 1NK3P 5K7HA 3A01B 1WJAA 4OIRF 4HPQA 3GTGJ 1ZLKA 4PJMA 2PG4A 2WAQA 3BZ6A 3S16J 1JKPC 2VONA 1T56A 2GM4A 5IY5H 5KHDA 2JSCA 4FCYA 2XVCA 2IXSA 1FC3A 1HSJA 3E0JB 3I4MJ 5EZHA 4RLQA 4JX6A 2W4SA 4AU7A 2JTVA 4NC7A 1J5YA 4XLPF 4B8XA 2L7ZA 3E3VA 1H9TA 1E0EA 4G12A 5F0HA 4NBQA 2H1KA 3GFLA 2EZKA 3I59A 4XRMA 2VOPA 1P4WA 1EH7A 3MKLA 4KT6A 1TWGJ 2E36A 2OQRA 1N25A 3KEOA 4EGYA 1Y8RB 2ZBKA 2ADUA 2EV5A 2MLGA 2VBXA 2F6CA 4A6DA 3RZDJ 4IJAA 3EUHC 2Q2EB 1D0YA 4WXHA 1XGMA 3F6VA 1SFXA 1VF9A 4XONA 1A36A 1G3WA 2STWA 2JK3A 2LF7A 1WI9A 2MC3A 2WY7Q 4CCOA 5TISC 2V9KA 1FOWA 5HLTA 3EYYA 2WV0A 2A5YB 1S7AA 2JPBA 3MZYA 3K4NA 4GCVA 2FUG2 2XF7A 1YTYA 3GCMA 2NVTJ 5F04A 3BTCA 1I5ZA 1FMVA 3DPTA 1IN7A 4X0GA 3OYCA 1OCZH 3OYKA 9ANTA 1TQIA 3R6SA 3RTRA 1VFCA 2ZXIA 1IGNA 3HXLA 4I0AA 1AKHB 2W48A 1LDDA 1XDUA 4XLAA 2TCTA 2ZO4A 1SFUA 4C3IJ 3HRUA 3IH2A 2L9RA 4CYCA 3EUHA 4L9VA 1MJ9A 3MFKA 2HYJA 2ID3A 3U1KA 4FASD 2K27A 4LK0F 5J4YA 2V7FA 2UXNA 3LSRA 4RAFA 4BQAA 1ETYA 4OINF 4HNUA 2IT0A 3CDIA 1XGSA 2KIQA 3HG9A 3GW2A 4YEJA 1TWCJ 2DCEA 3FK7A 4JYKA 3TDZC 3F23A 1FOXA 4RAGA 1XN7A 2NVXJ 3JTGA 4C9YA 3QAHA 3IL2A 2DFHA 3PSIA 3RPUD 2LKXA 1X19A 3S3OA 5DTDA 3H5AA 1ZLJA 2X85A 1SVLA 3BG6A 4BXUA 4U0YA 4HSTA 3HL2A 3CUOA 2X1EA 3IRRA 1FTTA 2HTJA 1Y56A 3OIPA 4FHTA 3W2VA 4HA8A 2KIFA 2DOEA 3J7AO 1NTCA 3CO7C 1LFUP 3TO7A 5HOOA 2MD5A 3FZVA 4Y33A 4HDUA 1JJ6C 1TC3C 4EATA 4XICA 2ZNZA 4YELA 1QHGA 1K78A 2R7ZJ 2HOAA 3ABTA 4II3A 4WK8F 1FP2A 1KQ9A 3DXJF 4CZCA 3IWFA 1QVTA 3RYPA 1W7PD 2WV1A 3AL0B 4A3MJ 4U0WA 4N0BA 3SEZA 2CH0A 3W6JB 2OCCH 3GFMA 2R93J 2GAUA 1U5TB 3L09A 3ZQGA 5BNGA 3HOYJ 4BE1A 1PDNC 4RGXA 3HHHA 3HKZA 5FLMJ 1Z7UA 5LHIA 1RR7A 1P9QC 1ORKA 2KT0A 5KCMA 4AC0A 4KMFA 2PJPA 2ZSHB 4A3CJ 2FJ1A 2DW4A 4E7HA 2HDDA 3I9V2 4M3EA 1P6RA 1G2HA 1MSEC 3Q9VA 4D5FA 1YYVA 2N8GA 2V26A 2OZUA 3W6VA 3FMSA 5CQGA 3TEDA 2V1NA 1JTYA 2YX4A 3GMEA 2EFWA 5F64A 2HQ5A 1RUNA 2DU9A 2VQHA 2ACJA 1FJLA 1L0OC 1OFCX 3K4CA 1FWZA 2L7KA 4AVPA 5GAHJ 2FQ3A 1RIOH 5CPRB 3PQKA 2QSFX 1BOBA 1ZREA 2EIMH 1K6OA 1UZCA 1SMYF 2XKPA 4ZTJA 2OV7A 1H0MA 1FYMA 3GTLJ 2DK8A 1ZELA 1YG2A
chains in the Genus database with same CATH topology
1ETWA 2DA1A 1P7JA 5FKNA 4MIMA 3S1MJ 3M4OJ 1H8AC 1HCRA 1A5JA 2LTPA 3BR2A 2M9HA 4A69C 4C3HJ 1JT0A 1HDDC 2WB1N 5IOZA 2O9LA 4W97A 2X6OA 3HB9A 5J1YA 3JRCA 1W0UA 5FJ8J 4B3AA 4XK4A 2LVSA 4A3LJ 4I6ZA 2XPUA 1WCMJ 4HNVA 4AYBN 2NS7A 3JRHA 3ZQLA 3K2AA 3HOZJ 2O7OA 1UG2A 3S17J 3PO3J 2Y31A 2RAEA 3HDDA 2R92J 1I6HJ 2PMZN 2XGDA 3OOUA 3D1NI 3A01A 5K7FA 4UUTA 5M5YJ 2E19A 5M5XJ 1Y1VJ 1U78A 1MNMC 1ETQA 1IRZA 2IAIA 1OCTC 4IHVA 1QPIA 2HOSA 2IBDA 5GPCA 4NDLA 3CCYA 3UKGA 1ETKA 3G1MA 1P7IA 1T33A 3BTLA 5IP7J 2LD5A 1R9TJ 4X6AJ 3FKIJ 3GTJJ 5K7ZA 2YUSA 2VUMJ 2M2EA 4JX4A 2NVYJ 5E3OA 4QIWN 3S1QJ 1GV5A 5E3MA 2NVQJ 3QPLA 5EG0A 2K9QA 2TRTA 2P81A 2HXIA 2EZLA 4FE7A 3FIWA 5C4JJ 2QF7A 4RBOA 3B6CA 3GTQJ 2ME6A 1IDYA 2JN6A 2MG4A 3HGGA 3E7LA 1TWHJ 4D7NA 1JGGA 1JKOC 1ETVA 3Q0UA 2XB0X 3GBGA 5F27A 5J3LA 2DMTA 4DW6A 2GBYA 4M3FA 3HBLA 3HOXJ 5EYRA 5GP9A 1ITYA 5HODA 4RDUA 3HGYA 2M8GX 2DMUA 2EH3A 1LE8A 3QPSA 3B6AA 2COBA 2CQXA 3JRDA 4BY7J 3ZQFA 2CRGA 4X1EA 1JKQC 2K9NA 3BTIA 2QCOA 3Q0WA 1IDZA 2M0CA 2FQ4A 1GUUA 4UUSB 1AKHA 3BT9A 4B4CA 2CJJA 1SANA 4CYCB 3IH4A 2LK2A 2K40A 2MW8A 3BQZA 1K83J 1Q1VA 3TW6A 5IYCJ 5EDNA 3OSGA 2HOTA 4B1RA 2Y9YA 3H0GJ 3G1LA 1GVDA 1ZQ3P 1HOMA 4AUXA 1JJ8C 3HM5A 2MGQA 4M3BA 1Z0XA 1ETOA 2CU7A 2DA2A 2WAQN 4DYRA 1MBGA 2ELKA 3ZQHA 4L5EA 4A3BJ 5EEAA 1X2MA 1HDPA 5E3NA 1BW6A 1VI0A 3PM1A 4BKXA 3WHCA 2L7MP 1IG7A 1MSFC 5FKMA 1MH4A 3HEFA 4M3DA 4A3EJ 2DMNA 1ZGWA 3O8HA 1IUFA 3VPRA 3NAUA 1U8BA 3JRIA 1WH7A 1OJLA 4MFDA 5F08A 4ABZA 2KDZA 2R5YA 5IP9J 2VI6A 1MBJA 5FKKA 4V2FA 5EGOB 3S15J 3ZOBA 2FD5A 1NK2P 3F0CA 3WHBA 2YS9A 2R0QC 5M3MJ 3K7AJ 5M5WJ 1S7EA 1JUSA 4A3GJ 2JA7J 2H8RA 4Y52J 2HXOA 5IOYA 2XSDC 4M6VA 5F0CA 1TWAJ 3L1PA 2LLKA 1LE8B 2FX0A 3S2DJ 1JUMA 1Y1WJ 1BW5A 2K9SA 5FKLA 2D5VA 1I50J 1XG1A 3S1NJ 3SDGA 5M3FJ 2DN0A 1BJZA 1SFOJ 3BR0A 3CMYA 3BG3A 3SJMA 1B8IA 4J19A 3LSPA 2NOGA 2CQQA 2HI3A 2LY9A 2JJ7A 3FK6A 1GT0C 4S0HB 1WH5A 1XC5A 2X48A 3A02A 3CDLA 5C4XJ 4FE4A 1IV6A 2XB5A 2JA5J 3HOUJ 1MBFA 5DS9A 2X9DA 1PUFA 3TW7A 2XPWA 3PO2J 1JUPA 1RKWA 1H89C 4W1UA 1CQTA 1B72A 1APLC 4LOCA 1YRNA 3IV5A 1FIPA 2OF7A 4FISA 1E3OC 3S1RJ 2ID6A 5J1UA 2I10A 3GTOJ 4DYQA 4DZPA 2G0EA 4C2MJ 2VKVA 1Z77A 4D5CA 3S14J 4A3KJ 3TP0A 1ENHA 3TP3A 2DMQA 1A6IA 4BXXJ 4D7MA 3JRBA 2DTZA 2LFBA 4A3IJ 2E2HJ 2CUFA 2ECBA 4XRSG 2EQRA 2JWTA 2E2JJ 3ZQIA 1I3QJ 1ZK8A 1ETXA 2LP0A 2R5ZA 4DZJA 5IP6A 4C3JJ 4IHYA 5J1RA 3HKZN 5C44J 2E1OA 2JA8J 1ZTRA 1VNDA 5C3EJ 3OSFA 2L0KA 3O8GA 1AHDP 2IEKA 3ZQCA 3JRGA 3IH3A 1IJWC 1NK3P 3JRFA 3BQYA 5K7HA 3A01B 1ZR4A 1U9NA 3S2HJ 3GTGJ 1D5YA 5EZGA 1GDTA 1IC8A 3S16J 2EZHA 1JKPC 1F36A 1T56A 2B63J 2GM4A 3G1OA 4FCYA 4MLOA 2ECCA 5EF6A 3LSJA 3I4MJ 5EZHA 4JX6A 3M3YJ 2AO9A 4JX5A 2DA5A 2Y2ZA 4Y7NJ 2L7ZA 4G12A 5F0HA 3GTKJ 2H1KA 1POGA 2DJNA 4MFEA 2EZKA 4XRMA 5EG0B 2M34A 4JP0A 3MKLA 1LFBA 1TWGJ 2LR8A 3FISA 1ZKGA 4IHXA 3RZDJ 4EEFG 1JKRC 3Q3SA 5JLWA 1XS9A 1VF9A 2JK3A 1UMQA 3MN2A 1DU6A 3LNQA 3DCFA 4A3FJ 1BA5A 5FKOA 1X2NA 3JRAA 2NVTJ 2AHQA 3BG9A 5F04A 3BTCA 1HLVA 5FLVA 3CQZJ 9ANTA 2CUEA 1VFCA 2XGEA 1IGNA 4MO7A 2R5ZB 1QVUA 3NARA 4UUSA 2W48A 1AKHB 3MVPA 2DMPA 3JR9A 2TCTA 4C3IJ 3IH2A 2ME0A 2L9RA 4CYCA 1MBHA 2DA3A 1U9OA 2HYJA 4BBRJ 2ID3A 3BR6A 1JT6A 2Y30A 2VPRA 2GLOA 3JREA 3BR5A 2VKEA 3LSRA 2DA7A 4V2GA 2O8KA 3H3VK 1ETYA 1QRYA 3RQIA 4BBSJ 1O4XA 1TWCJ 3FK7A 4JYKA 4FTHA 2L7FP 2E2IJ 3I4NJ 1WPKA 2NVXJ 1FTZA 2LKXA 1X58A 5DTDA 3C2BA 1WGXA 4QTRA 2NS8A 1FTTA 1NTCA 1LFUP 1JJ6C 1TC3C 2Y0SN 4XIDA 4XICA 5IYDJ 1FEXA 2R7ZJ 2R5YB 2HOAA 2JMWA 4BY1J 2Y9ZA 1JTXA 3BR3A 1MH3A 3SFIA 1BL0A 5EGOA 5JLXA 4IHWA 1QVTA 2WV1A 1UHSA 4A3MJ 4XRSA 1TWFJ 3LSGA 1RKTA 3BR1A 2YU9J 1RESA 2R93J 1FIAA 4GFBA 3ZQGA 3OIOA 2EBIA 5BNGA 4A3DJ 5F1JA 3HOYJ 4A93J 2XRLA 3LOCA 3Q0VA 1K61A 4I76A 5FLMJ 1AU7A 2XGCA 3RZOJ 1RR7A 1ORKA 1WI3A 2KT0A 4AC0A 4A3CJ 2FJ1A 3HOVJ 2DA4A 2HDDA 4M3EA 1G2HA 5GPAA 1MSEC 2DA6A 1MBKA 2MSYA 4D5FA 3DEWA 1H88C 2N8GA 3GTMJ 2OPTA 1HF0A 1OCPA 5E3LA 3W6VA 3A03A 1B8IB 3TEDA 2EZIA 5IPAA 1JTYA 2HQ5A 1W0TA 1EF4A 4M3GA 1FJLA 1F43A 4A3JJ 4DYCA 1OFCX 1GV2A 1PUFB 3HOWJ 3BTJA 1RPWA 4IEJA 2XPVA 3QQAA 1ZR2A 3RKQA 3BG5A 1RETA 1B72B 2JA6J 3GTPJ 5F0FA 1YRNB 1DU0A 2ZB9A 4QSHA 5IYBJ 1MBEA 3GTLJ
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1ETW A;  2DA1 A;  1P7J A;  5FKN A;  4MIM A;  3S1M J;  3M4O J;  1H8A C;  1HCR A;  1A5J A;  2LTP A;  3BR2 A;  2M9H A;  4A69 C;  4C3H J;  1JT0 A;  1HDD C;  2WB1 N;  5IOZ A;  2O9L A;  4W97 A;  2X6O A;  3HB9 A;  5J1Y A;  3JRC A;  1W0U A;  5FJ8 J;  4B3A A;  4XK4 A;  2LVS A;  4A3L J;  4I6Z A;  2XPU A;  1WCM J;  4HNV A;  4AYB N;  2NS7 A;  3JRH A;  3ZQL A;  3K2A A;  3HOZ J;  2O7O A;  1UG2 A;  3S17 J;  3PO3 J;  2Y31 A;  2RAE A;  3HDD A;  2R92 J;  1I6H J;  2PMZ N;  2XGD A;  3OOU A;  3D1N I;  3A01 A;  5K7F A;  4UUT A;  5M5Y J;  2E19 A;  5M5X J;  1Y1V J;  1U78 A;  1MNM C;  1ETQ A;  1IRZ A;  2IAI A;  1OCT C;  4IHV A;  1QPI A;  2HOS A;  2IBD A;  5GPC A;  4NDL A;  3CCY A;  3UKG A;  1ETK A;  3G1M A;  1P7I A;  1T33 A;  3BTL A;  5IP7 J;  2LD5 A;  1R9T J;  4X6A J;  3FKI J;  3GTJ J;  5K7Z A;  2YUS A;  2VUM J;  2M2E A;  4JX4 A;  2NVY J;  5E3O A;  4QIW N;  3S1Q J;  1GV5 A;  5E3M A;  2NVQ J;  3QPL A;  5EG0 A;  2K9Q A;  2TRT A;  2P81 A;  2HXI A;  2EZL A;  4FE7 A;  3FIW A;  5C4J J;  2QF7 A;  4RBO A;  3B6C A;  3GTQ J;  2ME6 A;  1IDY A;  2JN6 A;  2MG4 A;  3HGG A;  3E7L A;  1TWH J;  4D7N A;  1JGG A;  1JKO C;  1ETV A;  3Q0U A;  2XB0 X;  3GBG A;  5F27 A;  5J3L A;  2DMT A;  4DW6 A;  2GBY A;  4M3F A;  3HBL A;  3HOX J;  5EYR A;  5GP9 A;  1ITY A;  5HOD A;  4RDU A;  3HGY A;  2M8G X;  2DMU A;  2EH3 A;  1LE8 A;  3QPS A;  3B6A A;  2COB A;  2CQX A;  3JRD A;  4BY7 J;  3ZQF A;  2CRG A;  4X1E A;  1JKQ C;  2K9N A;  3BTI A;  2QCO A;  3Q0W A;  1IDZ A;  2M0C A;  2FQ4 A;  1GUU A;  4UUS B;  1AKH A;  3BT9 A;  4B4C A;  2CJJ A;  1SAN A;  4CYC B;  3IH4 A;  2LK2 A;  2K40 A;  2MW8 A;  3BQZ A;  1K83 J;  1Q1V A;  3TW6 A;  5IYC J;  5EDN A;  3OSG A;  2HOT A;  4B1R A;  2Y9Y A;  3H0G J;  3G1L A;  1GVD A;  1ZQ3 P;  1HOM A;  4AUX A;  1JJ8 C;  3HM5 A;  2MGQ A;  4M3B A;  1Z0X A;  1ETO A;  2CU7 A;  2DA2 A;  2WAQ N;  4DYR A;  1MBG A;  2ELK A;  3ZQH A;  4L5E A;  4A3B J;  5EEA A;  1X2M A;  1HDP A;  5E3N A;  1BW6 A;  1VI0 A;  3PM1 A;  4BKX A;  3WHC A;  2L7M P;  1IG7 A;  1MSF C;  5FKM A;  1MH4 A;  3HEF A;  4M3D A;  4A3E J;  2DMN A;  1ZGW A;  3O8H A;  1IUF A;  3VPR A;  3NAU A;  1U8B A;  3JRI A;  1WH7 A;  1OJL A;  4MFD A;  5F08 A;  4ABZ A;  2KDZ A;  2R5Y A;  5IP9 J;  2VI6 A;  1MBJ A;  5FKK A;  4V2F A;  5EGO B;  3S15 J;  3ZOB A;  2FD5 A;  1NK2 P;  3F0C A;  3WHB A;  2YS9 A;  2R0Q C;  5M3M J;  3K7A J;  5M5W J;  1S7E A;  1JUS A;  4A3G J;  2JA7 J;  2H8R A;  4Y52 J;  2HXO A;  5IOY A;  2XSD C;  4M6V A;  5F0C A;  1TWA J;  3L1P A;  2LLK A;  1LE8 B;  2FX0 A;  3S2D J;  1JUM A;  1Y1W J;  1BW5 A;  2K9S A;  5FKL A;  2D5V A;  1I50 J;  1XG1 A;  3S1N J;  3SDG A;  5M3F J;  2DN0 A;  1BJZ A;  1SFO J;  3BR0 A;  3CMY A;  3BG3 A;  3SJM A;  1B8I A;  4J19 A;  3LSP A;  2NOG A;  2CQQ A;  2HI3 A;  2LY9 A;  2JJ7 A;  3FK6 A;  1GT0 C;  4S0H B;  1WH5 A;  1XC5 A;  2X48 A;  3A02 A;  3CDL A;  5C4X J;  4FE4 A;  1IV6 A;  2XB5 A;  2JA5 J;  3HOU J;  1MBF A;  5DS9 A;  2X9D A;  1PUF A;  3TW7 A;  2XPW A;  3PO2 J;  1JUP A;  1RKW A;  1H89 C;  4W1U A;  1CQT A;  1B72 A;  1APL C;  4LOC A;  1YRN A;  3IV5 A;  1FIP A;  2OF7 A;  4FIS A;  1E3O C;  3S1R J;  2ID6 A;  5J1U A;  2I10 A;  3GTO J;  4DYQ A;  4DZP A;  2G0E A;  4C2M J;  2VKV A;  1Z77 A;  4D5C A;  3S14 J;  4A3K J;  3TP0 A;  1ENH A;  3TP3 A;  2DMQ A;  1A6I A;  4BXX J;  4D7M A;  3JRB A;  2DTZ A;  2LFB A;  4A3I J;  2E2H J;  2CUF A;  2ECB A;  4XRS G;  2EQR A;  2JWT A;  2E2J J;  3ZQI A;  1I3Q J;  1ZK8 A;  1ETX A;  2LP0 A;  2R5Z A;  4DZJ A;  5IP6 A;  4C3J J;  4IHY A;  5J1R A;  3HKZ N;  5C44 J;  2E1O A;  2JA8 J;  1ZTR A;  1VND A;  5C3E J;  3OSF A;  2L0K A;  3O8G A;  1AHD P;  2IEK A;  3ZQC A;  3JRG A;  3IH3 A;  1IJW C;  1NK3 P;  3JRF A;  3BQY A;  5K7H A;  3A01 B;  1ZR4 A;  1U9N A;  3S2H J;  3GTG J;  1D5Y A;  5EZG A;  1GDT A;  1IC8 A;  3S16 J;  2EZH A;  1JKP C;  1F36 A;  1T56 A;  2B63 J;  2GM4 A;  3G1O A;  4FCY A;  4MLO A;  2ECC A;  5EF6 A;  3LSJ A;  3I4M J;  5EZH A;  4JX6 A;  3M3Y J;  2AO9 A;  4JX5 A;  2DA5 A;  2Y2Z A;  4Y7N J;  2L7Z A;  4G12 A;  5F0H A;  3GTK J;  2H1K A;  1POG A;  2DJN A;  4MFE A;  2EZK A;  4XRM A;  5EG0 B;  2M34 A;  4JP0 A;  3MKL A;  1LFB A;  1TWG J;  2LR8 A;  3FIS A;  1ZKG A;  4IHX A;  3RZD J;  4EEF G;  1JKR C;  3Q3S A;  5JLW A;  1XS9 A;  1VF9 A;  2JK3 A;  1UMQ A;  3MN2 A;  1DU6 A;  3LNQ A;  3DCF A;  4A3F J;  1BA5 A;  5FKO A;  1X2N A;  3JRA A;  2NVT J;  2AHQ A;  3BG9 A;  5F04 A;  3BTC A;  1HLV A;  5FLV A;  3CQZ J;  9ANT A;  2CUE A;  1VFC A;  2XGE A;  1IGN A;  4MO7 A;  2R5Z B;  1QVU A;  3NAR A;  4UUS A;  2W48 A;  1AKH B;  3MVP A;  2DMP A;  3JR9 A;  2TCT A;  4C3I J;  3IH2 A;  2ME0 A;  2L9R A;  4CYC A;  1MBH A;  2DA3 A;  1U9O A;  2HYJ A;  4BBR J;  2ID3 A;  3BR6 A;  1JT6 A;  2Y30 A;  2VPR A;  2GLO A;  3JRE A;  3BR5 A;  2VKE A;  3LSR A;  2DA7 A;  4V2G A;  2O8K A;  3H3V K;  1ETY A;  1QRY A;  3RQI A;  4BBS J;  1O4X A;  1TWC J;  3FK7 A;  4JYK A;  4FTH A;  2L7F P;  2E2I J;  3I4N J;  1WPK A;  2NVX J;  1FTZ A;  2LKX A;  1X58 A;  5DTD A;  3C2B A;  1WGX A;  4QTR A;  2NS8 A;  1FTT A;  1NTC A;  1LFU P;  1JJ6 C;  1TC3 C;  2Y0S N;  4XID A;  4XIC A;  5IYD J;  1FEX A;  2R7Z J;  2R5Y B;  2HOA A;  2JMW A;  4BY1 J;  2Y9Z A;  1JTX A;  3BR3 A;  1MH3 A;  3SFI A;  1BL0 A;  5EGO A;  5JLX A;  4IHW A;  1QVT A;  2WV1 A;  1UHS A;  4A3M J;  4XRS A;  1TWF J;  3LSG A;  1RKT A;  3BR1 A;  2YU9 J;  1RES A;  2R93 J;  1FIA A;  4GFB A;  3ZQG A;  3OIO A;  2EBI A;  5BNG A;  4A3D J;  5F1J A;  3HOY J;  4A93 J;  2XRL A;  3LOC A;  3Q0V A;  1K61 A;  4I76 A;  5FLM J;  1AU7 A;  2XGC A;  3RZO J;  1RR7 A;  1ORK A;  1WI3 A;  2KT0 A;  4AC0 A;  4A3C J;  2FJ1 A;  3HOV J;  2DA4 A;  2HDD A;  4M3E A;  1G2H A;  5GPA A;  1MSE C;  2DA6 A;  1MBK A;  2MSY A;  4D5F A;  3DEW A;  1H88 C;  2N8G A;  3GTM J;  2OPT A;  1HF0 A;  1OCP A;  5E3L A;  3W6V A;  3A03 A;  1B8I B;  3TED A;  2EZI A;  5IPA A;  1JTY A;  2HQ5 A;  1W0T A;  1EF4 A;  4M3G A;  1FJL A;  1F43 A;  4A3J J;  4DYC A;  1OFC X;  1GV2 A;  1PUF B;  3HOW J;  3BTJ A;  1RPW A;  4IEJ A;  2XPV A;  3QQA A;  1ZR2 A;  3RKQ A;  3BG5 A;  1RET A;  1B72 B;  2JA6 J;  3GTP J;  5F0F A;  1YRN B;  1DU0 A;  2ZB9 A;  4QSH A;  5IYB J;  1MBE A;  3GTL J; 
#chains in the Genus database with same CATH topology
 4ZYE A;  5FKN A;  1DGW Y;  4PSW A;  1B9N A;  5A2Q K;  4GYI A;  2HZT A;  2BXY A;  4LLL A;  4JK1 X;  1BI3 A;  1HCR A;  2LTP A;  4N9I A;  4RAY A;  2R7F A;  4C3H J;  1JT0 A;  2E71 A;  4Y13 A;  5IOZ A;  2O9L A;  2HGC A;  1HC8 A;  5D5W B;  1MMG A;  4Z6Y A;  3HRM A;  2DT5 A;  3MEX A;  4XK4 A;  2IJL A;  1KON A;  5HLG A;  4KN7 X;  4XOR A;  3HZJ A;  1QZZ A;  2XPU A;  3W2A A;  3HPG A;  1WCM J;  4AYB N;  3JRH A;  2C6Y A;  4IQ4 A;  3HOZ J;  3MKY B;  2Y31 A;  3A0H C;  3FF5 A;  1IXC A;  2R92 J;  3M1C A;  3OOU A;  4QPO A;  2DPU A;  3ZN0 A;  2COM A;  5L3G A;  2CQK A;  3K1N A;  1KU7 A;  4IXA A;  5JR3 A;  1HW5 A;  1LDJ A;  5FLX Z;  2E19 A;  1XSV A;  5M5X J;  4ZDP A;  1I1S A;  4IKF A;  4UUV A;  3ZGK A;  3QRF F;  1XX5 A;  3WE3 A;  4LLG F;  5GAD J;  2DT7 B;  1ZN2 A;  2DOD A;  4OU0 A;  3UKG A;  3G1M A;  1P7I A;  2OC6 A;  1QPM A;  4E7Z A;  2YUS A;  2OJE D;  1E3H A;  3GZ5 A;  3GTJ J;  3H1C A;  2M2E A;  1ZG5 A;  1YJN I;  3CC7 I;  2KLO A;  2IRF G;  1T08 B;  4XKC A;  4EV0 A;  2W25 A;  2VLA A;  5BOX A;  1YOV B;  2LBF B;  3ABK H;  2NVQ J;  2EFP A;  2DOA A;  4L5I A;  4LMY A;  1LDK B;  2KP6 A;  2R4G A;  2Y0S A;  3LQR A;  3KIO A;  1FNN A;  1MIJ A;  3R61 A;  2RNJ A;  1IDY A;  2KFD A;  3GTQ J;  4PGH A;  3SFZ A;  4P96 A;  4GXO A;  3ZCO A;  2P7V B;  3E7L A;  4D7N A;  3ZN1 A;  2LMD A;  1TLH B;  1SD4 A;  3ZP5 A;  1ZRD A;  5K5Q A;  1O57 A;  1ETV A;  1JKO C;  3Q0U A;  2B9S A;  4OWR B;  4RM3 A;  3OIQ A;  2W7N A;  1CGP A;  3HOX J;  3FHN A;  3PUB A;  3QOP A;  5HOD A;  3HTS B;  2PN6 A;  3HGY A;  2K4B A;  4I01 A;  5FRM A;  2LNB A;  2EH3 A;  3GEZ A;  1LE8 A;  2CMP A;  1NHA A;  3JRD A;  3LMM A;  4BY7 J;  2QQ9 A;  3K10 A;  1YW8 A;  1R23 A;  1A04 A;  1XGO A;  1XDS A;  2W84 A;  3K2Z A;  3G3Z A;  4Q47 A;  1IDZ A;  2M0C A;  4UB8 C;  2RNG A;  2E1N A;  4MQ9 F;  4LB6 B;  5JFR A;  2F4O B;  1K83 J;  2R7D A;  2HOT A;  5ICE A;  2EB7 A;  1UJ8 A;  3ZXS A;  2VBY A;  3D5L A;  5CJ9 A;  3KET A;  4I99 C;  1ZQ3 P;  4AUX A;  2R7V A;  1JHH A;  1Z3X A;  4L5E A;  4LG3 A;  4MTE A;  1G4D A;  3IKV A;  4UVA A;  3ASO H;  1BJA A;  5FRN A;  3EPZ A;  1S3J A;  4E7J A;  4CYD A;  1G8X A;  3K4L A;  5LBQ A;  1LVA A;  3T8R A;  3SQN A;  2X6W A;  3MZ8 A;  2XAQ A;  2CW7 A;  3GZN B;  3P9K A;  3V7R A;  4B48 A;  2CV0 A;  5LGU A;  2P6T A;  1WH7 A;  2D1H A;  1B6A A;  4ABZ A;  3CLQ A;  3K4M A;  2KDZ A;  1WZ2 A;  2P5K A;  4BHC A;  3KE2 A;  3BCB A;  3IP4 B;  2AXT C;  4V2F A;  4FX4 A;  4Q4Z F;  1ERD A;  3ABU A;  4HQE A;  3KEY A;  2DK5 A;  3AKZ A;  3FXM A;  3HJE A;  4MQV A;  3G71 I;  4J01 A;  2IVM A;  2JRM A;  1LUJ B;  2HXO A;  5IOY A;  2XSD C;  4HV5 A;  4M6V A;  4O5V A;  1OCO H;  5DCM A;  3BRO A;  3OYE A;  5L3E A;  1TWA J;  3L1P A;  2LLK A;  1JUM A;  2K9S A;  4L5J A;  4R79 A;  4F55 A;  2FE3 A;  3KP2 A;  2HOE A;  2PMZ A;  2R7Q A;  5IT9 Z;  4ENK A;  2VN2 A;  3VYS B;  1XG1 A;  2VBZ A;  3ABL H;  3H3Z A;  3O6B B;  2V79 A;  3U1D A;  3S1N J;  3MKZ A;  1BJZ A;  4EM1 A;  1OCR H;  2M30 A;  3BR0 A;  3C1D A;  1KYW A;  3M8E A;  4L9J A;  2CQQ A;  2IS6 A;  4A5M A;  3FK6 A;  3O3K A;  2G9W A;  1QNT A;  4S0H B;  4BXF A;  2FF4 A;  1XC5 A;  3CDL A;  3R4K A;  5CVV A;  1YLF A;  1YJW I;  4PDK A;  1MBF A;  5DS9 A;  2FNA A;  2X9D A;  4AWX B;  1G59 A;  3F8N A;  4MGR A;  1SFE A;  2F5F A;  4HX7 A;  1Q1H A;  1DGR M;  3J80 Z;  4XMY A;  3KLN A;  3QP6 A;  2Z33 A;  2FRH A;  2K7L A;  1V5G A;  1XPX A;  1ZAR A;  2CFO A;  4LOC A;  3CME I;  1YRN A;  1SD6 A;  2VQL A;  2KKO A;  1ZGA A;  5L3D A;  5J1U A;  4DZP A;  1W7P B;  2YSR A;  1VZ0 A;  1N77 A;  2O3F A;  1KQ8 A;  4M6Y A;  3S14 J;  3NEU A;  4A3K J;  3OYM A;  2RGV A;  5IT9 K;  1PVE A;  4M72 A;  3I56 I;  2QBY B;  2HQN A;  1EJ9 A;  2ECB A;  2L4A A;  4LG0 A;  1XSD A;  2JWT A;  2A68 F;  4BE2 A;  4CHU A;  1XGN A;  3ZQI A;  4F52 A;  3ZR8 X;  4L9N A;  5HVQ C;  3DU6 A;  2FU4 A;  2IP2 A;  3JSO A;  1BC8 C;  4RM2 A;  2R5Z A;  2DJI A;  4DZJ A;  2BOL A;  1Z05 A;  4IHY A;  5J1R A;  1SAX A;  4D0P A;  2R7R A;  4AVZ A;  2JA8 J;  3CJT B;  3MKW B;  4H4K C;  1LQ1 A;  4E6K G;  1WJF A;  2HNH A;  3OSF A;  1J09 A;  5K5R A;  1BN5 A;  4G7Z F;  3JRG A;  3BQY A;  3CO6 C;  2QUF A;  3IWZ A;  1U9N A;  2XAJ A;  3S2H J;  2P5V A;  3K9T A;  4YIR X;  2R7S A;  1EKE A;  2EIJ H;  1VQ5 I;  2EZH A;  2E5Z A;  1F36 A;  2K02 A;  3TMO A;  2B63 J;  2Q1Z B;  1MMD A;  4PZJ A;  1BI1 A;  3E6M A;  3S3N A;  3CJN A;  2XRN A;  2DPD A;  2XDV A;  5EF6 A;  2UV1 A;  2VBW A;  5H2F C;  2X4H A;  5DUI A;  1Y0U A;  3M3Y J;  2UXX A;  4Y7N J;  2DA5 A;  2Y2Z A;  4B09 A;  4WXD A;  5FRO A;  4BAY A;  2FNP A;  3S93 A;  3QYB A;  1OKR A;  5E79 C;  2KRC A;  3QP5 A;  2P6S A;  2VJ5 A;  2CS3 A;  3SXY A;  4OIO F;  3K69 A;  2LR8 A;  5D8K B;  3FIS A;  2ZC2 A;  3VOE A;  1S8N A;  1ZKG A;  2OUM A;  3FMQ A;  2KZV A;  1O7L A;  4CDG A;  2EV6 A;  4S04 A;  1YIT I;  2HTS A;  4OOI A;  4EM2 A;  1XS9 A;  1XD7 A;  1HKT A;  3RYR A;  3QYF A;  4HDV A;  4CCM A;  2W24 A;  2XAG A;  3AG1 H;  2XV4 S;  1TZL A;  2E34 A;  2EJR A;  3DCF A;  1HXD A;  4PFO A;  1RNL A;  5L3C A;  3JRA A;  3RIR A;  4D1Q A;  3RKY A;  1IF1 A;  3BG9 A;  4ZJZ A;  3WTS C;  2QQ8 A;  1VQK I;  2FOW A;  1Z9C A;  2P8T A;  2WAD A;  4WCG A;  1WFX A;  3JR9 A;  3SZP A;  2QKM B;  3FXJ A;  2E1C A;  2ME0 A;  3J7Y J;  4D9J A;  3FKJ A;  3LAJ A;  3Q9S A;  5TJJ A;  4HEA 2;  1U9O A;  4HX8 A;  5D5X B;  2GLO A;  4ZYD A;  1KYZ A;  4ASN A;  2NS0 A;  2O8K A;  1OYY A;  1D1B A;  1QRY A;  3PL8 A;  3RQI A;  3WE2 A;  1P4X A;  3EUA A;  2E2I J;  3I4N J;  3CZ6 A;  1WPK A;  3FXU A;  3JSP A;  1KZH A;  2AQE A;  1GXQ A;  1X58 A;  4KIT B;  1BIA A;  2WC2 A;  3C2B A;  3S8P A;  2QA4 I;  4NQW A;  3F8C A;  3E6D A;  1FBS A;  2HKO A;  2LDU A;  5E1X A;  3DBL B;  3E97 A;  4ZZL A;  1JI8 A;  5D6E A;  1SD5 A;  2WAF A;  3FMR A;  4EJT A;  2H8W A;  4M74 A;  1ULY A;  2HS5 A;  2PQ8 A;  5HDN A;  5IYD J;  1FEX A;  1CF7 A;  3KZY A;  3BR3 A;  2IS1 A;  1BL0 A;  1F4K A;  3MAJ A;  2A61 A;  3BZC A;  4IHW A;  2YX7 A;  3BPV A;  2M4K A;  4R1H A;  1G3Y A;  3MWM A;  2WY8 Q;  4XRS A;  1TWF J;  4CZZ A;  1NH3 A;  2MA3 A;  3LSG A;  5F6F A;  1RKT A;  3BG7 A;  4G94 A;  4OIP F;  2LF8 A;  3FHZ A;  1RES A;  4ZTF A;  1B4A A;  2HU9 A;  5DEQ A;  1WSU A;  4EMS A;  1S7O A;  3OIO A;  3A0B C;  3PUF A;  2CG4 A;  5F1J A;  3GZ6 A;  1T6S A;  1K61 A;  4PSX A;  3GF2 A;  4XOT A;  3VSL A;  2HR3 A;  1IAW A;  2IS2 A;  3RZO J;  1R4M B;  2DFI A;  4E7L A;  1Z1D A;  1LNW A;  1WI3 A;  4IF4 A;  4U88 A;  1S6L A;  2ZCW A;  4XLN F;  3KZI C;  3KZZ A;  2GWR A;  1FZP B;  4KYW A;  2ZJP F;  1UEL B;  2EIL H;  1K6Y A;  4XKW A;  4F7Z A;  1H88 C;  4DIQ A;  3OY9 A;  1HF0 A;  3BDD A;  1FOY A;  2L54 A;  2PJR A;  1PP8 F;  1V4R A;  1B8I B;  2MD0 A;  1HST A;  2F5V A;  5CQE A;  3I53 A;  1VQ4 I;  3I64 A;  1UCR A;  2ESH A;  1W0T A;  4PJL A;  3ESW B;  1UB9 A;  4AIH A;  4DYC A;  2PBI A;  3KFW X;  3TDU C;  3CD6 I;  2R7X A;  3GUD A;  2E60 A;  2A6T A;  3M07 A;  1PUF B;  2EIN H;  3HOW J;  1O7F A;  1RPW A;  3BTJ A;  5E1Z B;  1AOY A;  4IEJ A;  4KNY A;  2DQR A;  2PMU A;  3QQA A;  4ZH4 F;  3RKQ A;  1ZR2 A;  1XMA A;  2BGC A;  2DO7 A;  3BG5 A;  2RN7 A;  2JSP A;  1IRF A;  3LSK A;  5F0F A;  1TBX A;  1WHU A;  5IYB J;  2ZXW H;  4XM3 A;  2DA1 A;  5DM6 F;  1P7J A;  2EFO A;  4MIM A;  3LA7 A;  2Y69 H;  3M4O J;  1YE9 A;  3K6G A;  5K5O A;  4ENM A;  3RKW A;  2XAU A;  1GHC A;  3IKT A;  4AIK A;  5E20 A;  2HZD A;  2BZT A;  4M73 A;  1TTY A;  3BR2 A;  4BQN A;  4A69 C;  3ECO A;  4ON0 A;  3H3U A;  2X51 A;  4EJO A;  3HB9 A;  4UV9 A;  4P9U A;  1MD0 A;  3BJ6 A;  4RB1 A;  2LVS A;  3DP7 A;  4BJT A;  4A3L J;  4PK4 A;  3O2P E;  2XAF A;  4E7S A;  2VQG A;  3V8K A;  2NXN B;  2WA0 A;  4CA0 A;  3FXQ A;  2NS7 A;  3ZQL A;  3DF8 A;  1ZRC A;  3EUK L;  1BM9 A;  3BJA A;  1UG2 A;  1R49 A;  2GZW A;  3CMM A;  3L9F A;  3CMA I;  4F3Q A;  1R1V A;  3OYB A;  1I6H J;  1N78 A;  1S9H A;  3A01 A;  4HLX A;  2D2W A;  2E7W A;  4XNF A;  5DD8 A;  3PNV A;  1KU3 A;  3F8B A;  2IAI A;  3BLY A;  4ENN A;  1BI2 A;  1T39 A;  1OCT C;  6PAX A;  5L3B A;  1RUO A;  3K70 C;  1NG7 A;  4IX7 A;  1SAU A;  1T8I A;  4XSZ F;  3VFZ A;  5HDK A;  1T33 A;  4X6A J;  1J9I A;  4B3X A;  3RDI A;  4HQM A;  2K85 A;  1O3R A;  3CCS I;  5E8G A;  3I54 A;  4LD5 A;  3X2Q H;  3E6B A;  3QPL A;  2K9Q A;  1HQC A;  2YU3 A;  3BWG A;  1LPQ A;  3DLL F;  1K79 A;  2EZL A;  4FE7 A;  3FIW A;  5C4J J;  2QF7 A;  4RBO A;  2OAZ A;  1SEU A;  1D1C A;  3A1Y A;  2K5C A;  2F48 A;  2MG4 A;  3CCJ I;  1W36 D;  3J81 Z;  3HGG A;  2KPM A;  2Q2E A;  1MND A;  1TWH J;  4GYG A;  1F5T A;  2OTJ I;  2ZFU A;  3ERM A;  1YFH A;  1SD7 A;  1ZRF A;  3HUG B;  4CH7 A;  2STT A;  5F27 A;  1JGS A;  4XKV A;  4DW6 A;  2GBY A;  3HBL A;  3LSM A;  5FD6 A;  5EYR A;  3IRQ A;  3MQ0 A;  4A0X A;  1Z67 A;  2COB A;  3ZQF A;  2CRG A;  1QGP A;  1D8J A;  4ZDL A;  5J47 A;  2JPC A;  2DQL A;  3R0J A;  2K9N A;  3J7A Y;  2BHZ A;  1V3F A;  3HOS A;  2QCO A;  4XN0 A;  1X1D A;  3HRS A;  2FQ4 A;  4A12 A;  3BP8 A;  4UUS B;  1AKH A;  3C2H A;  3BT9 A;  3RI4 A;  4KJZ A;  5LEJ A;  2CJJ A;  4H0E A;  2LK2 A;  2K40 A;  3TW6 A;  3HSE A;  1Q1V A;  3PNT A;  4ZDO A;  3P5J A;  2IGN A;  5KVR A;  1D3Y A;  2FMY A;  3G1L A;  3CUQ C;  1IXR C;  3HM5 A;  4PGG A;  2KMU A;  2L9S A;  3H35 A;  3J81 K;  3AL0 C;  4A3B J;  1X2M A;  5E3N A;  4G7H F;  3PM1 A;  3ERE D;  2BYV E;  4RB3 C;  1U5T C;  4NHJ A;  3WHC A;  2QYO A;  2ICW G;  5FKM A;  2K3F A;  1IO2 A;  1MH4 A;  3HEF A;  4RS8 A;  3K4K A;  3PFI A;  1ZGW A;  3MD2 A;  2BBY A;  2Z1D A;  1ZYR F;  2L5Q A;  3JRI A;  4MFD A;  1S5L C;  1FBQ A;  3AAF A;  2IA0 A;  5CVR A;  5IP9 J;  1MBJ A;  1BIB A;  5KAF C;  1WJB A;  3CUQ A;  5EGO B;  3HOT A;  4WF2 A;  1F9N A;  1OLT A;  3S15 J;  1L3L A;  3K4B A;  2VL8 A;  4C2U A;  2FD5 A;  3HPH A;  3F0C A;  3L2V A;  5M5W J;  4PUS A;  1MJB A;  4AD9 A;  1JUS A;  2V1D A;  4CCK A;  5B3S H;  1U5T A;  3JCU C;  4A3G J;  2JA7 J;  2H8R A;  2NVU B;  2V9V A;  4I2O A;  4J00 A;  2B0L A;  3FBN B;  4XLH A;  4HF2 A;  2ZFW A;  1LE8 B;  2FX0 A;  2R7O A;  3H9J A;  4LGW A;  4F93 B;  1YIJ I;  2IGM A;  3S2D J;  1M1E B;  1FSH A;  2VKD A;  1E2X A;  2D5V A;  1I50 J;  1YHQ I;  3ZQQ A;  5FB2 A;  4BDY A;  3VWB A;  2Y48 A;  3SDG A;  5M3F J;  4GGG A;  1NG6 A;  2ZME B;  4KIG A;  1KU2 A;  1C0W A;  3RQ4 A;  1T0F C;  5GTI C;  2NOG A;  5LRS A;  2JJ7 A;  1GT0 C;  1UHM A;  1R6R A;  4KIF A;  1WH5 A;  5C4X J;  5CVJ A;  3E5U A;  3HOU J;  3CF5 F;  2RRE A;  2XHK A;  1RR8 C;  3HIF A;  3TW7 A;  1ON2 A;  3PO2 J;  5D5V B;  1JUP A;  1RC9 A;  1RKW A;  4HW0 A;  2ISY A;  3MMY B;  1MDM B;  2J5P A;  1V54 H;  2VOD A;  1XCV A;  2BV6 A;  3IV5 A;  2M1B A;  3UNG C;  2QEN A;  4FIS A;  1E3O C;  2ID6 A;  5LHG A;  1W4M A;  4DYQ A;  2E35 A;  2G0E A;  2M45 A;  3ZMV A;  4Y17 A;  1T0F A;  1Z77 A;  4PJ0 C;  4D5C A;  1UAA A;  5JI6 A;  3TP3 A;  4II2 A;  5FLX K;  3CC2 I;  4BNC A;  2DTZ A;  1KQ0 A;  4A3I J;  1Z6T A;  4UXN A;  1S72 I;  4XRS G;  2WWY A;  2EQR A;  2GIV A;  2E2J J;  3LAP A;  5H6Q A;  4DOZ A;  1D5V A;  1FSE A;  1ZK8 A;  3DTE A;  4UB6 C;  5AIQ A;  4A5N A;  3H9G A;  5FGM A;  1ZTR A;  2GIZ A;  3F9K A;  1J59 A;  5C3E J;  5E17 F;  2MH9 A;  2BY1 A;  3OYI A;  2IEK A;  1Y8Q B;  4BEH B;  2BE5 F;  1X1C A;  2IGO A;  3SZT A;  4CO8 A;  4N9H A;  4KUM A;  4F91 B;  3ZQC A;  1W5T A;  1Z7L A;  1PYV A;  2VC1 A;  4UV8 A;  4IPA A;  4UHT A;  1ZR4 A;  1R5G A;  4A6E A;  5LLQ A;  3PNY A;  2VB6 A;  3CCL I;  3WTW C;  5EZG A;  1BI0 A;  4E7I A;  3QPH A;  3TOB A;  3DU5 A;  2QM3 A;  4YII A;  1HKS A;  3G1O A;  4MLO A;  3G4S I;  4XL9 A;  3GXO A;  2V9P A;  3J7Z I;  4EM0 B;  3LSJ A;  1YS7 A;  3M8F A;  4KIB A;  4OIQ F;  1I1G A;  1P2F A;  3C7J A;  5LGN A;  3WTX C;  2A6E F;  2X1C A;  1BR2 A;  4CUG A;  3GX4 X;  2AO9 A;  4JX5 A;  3NQO A;  3KX2 A;  4IRI A;  4EJU A;  3BY6 A;  2JUG A;  3F3X A;  4AID A;  2LBF A;  1YJ9 I;  2DJN A;  4MFE A;  5EG0 B;  2M4G A;  2M34 A;  5HLI A;  1G3T A;  1LFB A;  1F1Z A;  2P0W A;  1W5C C;  1FP1 D;  2GXG A;  3CES A;  3KYD B;  3KP6 A;  4RB2 C;  4BH9 A;  2ZSI B;  4YFK F;  2CSO A;  1BC7 C;  4XR6 A;  2Z16 A;  2CGP A;  1T98 A;  2H6B A;  3K1P A;  2E5N A;  3N4M A;  2NYX A;  1R71 A;  2UUZ A;  2GA2 A;  2OU2 A;  5HNF A;  1DU6 A;  1IN8 A;  4DNC A;  3FXO A;  2AXL A;  3TQN A;  3LNQ A;  3N05 A;  3VSK A;  3CC4 I;  4KDP A;  1BA5 A;  5FKO A;  1X2N A;  1R22 A;  1O3T A;  1P4A A;  4XLC A;  3PJR A;  1S29 A;  2AHQ A;  4QLC U;  3FWE A;  1B1B A;  4Q5S F;  2QSH X;  4Y15 A;  1QQI A;  3CQZ J;  4ESF A;  4YFN F;  2CUE A;  1YX5 A;  2R5Z B;  1QVU A;  4RLF A;  3ISP A;  4XLE A;  5CYV A;  1Y0N A;  2DMP A;  4P55 A;  3RPQ A;  2EWN A;  1MBH A;  1J75 A;  2CWE A;  2DA3 A;  5TGT A;  4HG2 A;  5BPD A;  4BBR J;  2VPR A;  3JRE A;  3F6O A;  2VE9 A;  2ZXJ A;  2PFB A;  3H3V K;  2MYS A;  3WGI A;  2KQR A;  2H6C A;  1XCB A;  2M3A A;  2V1U A;  1ZGJ A;  3KP5 A;  1O4X A;  4FTH A;  2L7F P;  3VOD A;  1GXP A;  2ZJ2 A;  2CV2 A;  2F5C A;  1KU9 A;  5J6X A;  2QQA A;  4XQF A;  4WWC A;  4CXF A;  3CCM I;  4QTR A;  2MFZ A;  3MZH A;  1OQY A;  3JAM Z;  4GO1 A;  3TBI A;  3NWS A;  4ZYG A;  2A3S A;  1K4T A;  3W2W A;  3CJQ B;  3CCV I;  4XKB A;  2F4I A;  2FOK A;  4XID A;  2QEX I;  2R5Y B;  4XOP A;  1BBY A;  3QOD A;  4BY1 J;  2W85 A;  1JTX A;  3GFI A;  1MH3 A;  3D5S C;  3AG2 H;  1DPR A;  1Z91 A;  2HDW A;  2VXD A;  5JLX A;  2MH2 A;  3I0T A;  2XSJ C;  1BOA A;  4G6T B;  4UVB A;  2IS4 A;  1LB2 A;  4I98 B;  2W82 A;  5HNH A;  3CJR B;  4C30 A;  2NRA C;  1QZE A;  2CUJ A;  5ILS A;  4ENJ A;  3LFK A;  1UFM A;  3B02 A;  4A3D J;  4A93 J;  2PI0 A;  3VEP A;  3Q0V A;  2L9N A;  2CQN A;  4I76 A;  1AU7 A;  1V5E A;  1IN6 A;  2XGC A;  2EFQ A;  4M6X A;  2LYC A;  5CVI A;  3G73 A;  3J80 K;  1OYW A;  2XAH A;  5D4R A;  4ZYH A;  4IO9 F;  2DA4 A;  2KIU A;  3D0S A;  5B5E C;  2KJC A;  2JVG A;  4MEX F;  2DA6 A;  1MBK A;  4E4H A;  3GTM J;  3JAM K;  3LFU A;  2A07 F;  3I71 A;  1R1U A;  1OCP A;  3P9I A;  5DD4 A;  5E3L A;  3A03 A;  2EZI A;  4XRF A;  4LJZ F;  4OAZ A;  3RPU A;  2V6E A;  4CCJ A;  1IN4 A;  1ZG3 A;  2DBB A;  1YW7 A;  2QWW A;  4M3G A;  4KT5 C;  5FFZ A;  4A3J J;  2YR2 A;  4M9X A;  4XLF A;  3KP7 A;  1GV2 A;  5ILU A;  5EJC A;  4AIJ A;  2KRF A;  2D45 A;  3F21 A;  3KP3 A;  5KNL A;  1WRJ A;  3SHF A;  4B47 A;  1DP7 P;  1RET A;  1B72 B;  2JA6 J;  3CP8 A;  3GTP J;  1ZH5 A;  4QSH A;  3H0D A;  1MBE A;  2RDP A;  1ETW A;  4BL0 B;  1W7P A;  2BVL A;  3ZRG A;  4BJ6 C;  3DQV C;  1H8A C;  1ZHF A;  1K7A A;  1SFK A;  4IQJ A;  1A5J A;  4G7O F;  2LKS A;  2M9H A;  2QBY A;  1HDD C;  2WB1 N;  3UR3 C;  2X6O A;  1W0U A;  4RGU A;  3JRC A;  1TT0 A;  5FJ8 J;  2ZNY A;  4B3A A;  1ONV A;  2P5L C;  5ICG A;  1E17 A;  4I09 A;  5CVU A;  3ABM H;  4V19 K;  5D5U B;  1J2X A;  4JQF A;  5J8F A;  3OYG A;  4HNV A;  5ERI A;  5DDG A;  4M71 A;  1YS6 A;  2XC7 A;  2W1O A;  1D1A A;  1YO5 C;  3PO3 J;  2JZY A;  1ACI A;  2RAE A;  3ZMU A;  3HDD A;  2VJJ A;  2GQQ A;  5F1R A;  2PEX A;  3OS1 A;  3RKX A;  4UUT A;  1LFP A;  5M5Y J;  4PFP A;  3F8M A;  1YI2 I;  1Y1V J;  2FSW A;  2A5W A;  1QU3 A;  1U78 A;  2V1X A;  2EK5 A;  1ETQ A;  1MNM C;  1WWX A;  1FX7 A;  1IRZ A;  4IHV A;  3RJP A;  1UHW A;  1QPI A;  2RQP A;  5LHH A;  1AWC A;  2B7E A;  5GPC A;  1GLN A;  4U0V A;  2GXA A;  3CCY A;  2LD5 A;  1ETK A;  2KRH A;  1FY7 A;  1DDN A;  2DLL A;  3WOD F;  5H20 A;  4E70 A;  3G2B A;  2H09 A;  4JX4 A;  4QIW N;  3H36 A;  4AM3 A;  5LFA A;  2RVC A;  4G6Q A;  3V7S A;  5E3M A;  2K3P A;  1AA7 A;  3I59 B;  2TRT A;  4HRI A;  1VQ6 I;  2P81 A;  4WXC A;  2HXI A;  2VKH A;  1D0X A;  3R0A A;  3OR1 C;  4HF0 A;  4I02 A;  4OAY A;  4HNT A;  3M1E A;  2EA2 A;  1MW7 A;  2FBK A;  3AG3 H;  5B1A H;  2KIM A;  2VJ4 A;  2M5W A;  2XB0 X;  5HDG A;  1QZY A;  2M8E A;  3RSN A;  2IA1 A;  3H9Q A;  5EEH A;  5GP9 A;  1U2W A;  3A2K A;  4U7B A;  1U6G A;  4RDU A;  4P5O A;  2EV0 A;  2M8G X;  2KHM A;  1X4O A;  5E18 F;  2F5E A;  1T2K A;  1VQL I;  3B6A A;  2CQX A;  1ODD A;  2O61 A;  3AG4 H;  5K1Y A;  4X1E A;  4FX0 A;  5AON A;  5LEK A;  1JKQ C;  3EQL F;  3OYF A;  5HS7 A;  1ON1 A;  3Q0W A;  2DI3 A;  3F8F A;  3L2C A;  1MMS A;  3KEQ A;  4CYC B;  1DP3 A;  3BQZ A;  5JHF A;  4HSR A;  1MNE A;  5IYC J;  2J5O A;  3PSF A;  3W6K B;  2XIG A;  2Y9Y A;  3WG7 H;  3OYL A;  2IA2 A;  2L4M A;  1FT9 A;  1WJ5 A;  1EV7 A;  1JJ8 C;  4M3B A;  2MGQ A;  5D6F A;  4IHS A;  1ETO A;  1OMI A;  2CU7 A;  2WAQ N;  3VYU B;  2RC4 A;  1G3S A;  4BAC A;  3OL3 A;  1U0J A;  1VQO I;  1BW6 A;  3W3C A;  2WTE A;  2VOO A;  1STZ A;  1N75 A;  2UWM A;  4BKX A;  1DUX C;  2L7M P;  2E1M C;  1IZ1 A;  1IV8 A;  3S32 A;  3WG9 A;  1QBJ A;  4M3D A;  1X4P A;  2Q0O A;  4G9Y A;  2A6H F;  1O3Q A;  4UVC A;  1VQ9 I;  4A3E J;  2DMN A;  4CCL A;  1IUF A;  1U8B A;  2QSG X;  4HX4 A;  3KP4 A;  1SMT A;  1VQM I;  1U3E M;  1K78 B;  5IT3 A;  1EH6 A;  1P92 A;  2RKH A;  2XF5 A;  5KAI C;  3KPH A;  3ZOB A;  2LSO A;  5D8L B;  2VJI A;  2BVM A;  1TQM A;  4IZZ A;  2O0Y A;  2YS9 A;  4PJN A;  1Y6I A;  5HS9 A;  3GLX A;  5M3M J;  3E5X A;  1FOK A;  1S7E A;  3GLL A;  3IAS 2;  1R4N B;  2Y75 A;  5BQT A;  2CV1 A;  2HFH A;  3V8L A;  1G6N A;  2P7C B;  2BW3 A;  4LIV A;  4XSX F;  2CYY A;  2H1L A;  3HYI A;  2FXA A;  1A31 A;  2L02 A;  4KN4 X;  2XAS A;  1R5H A;  5FKL A;  1UST A;  3F22 A;  2HPM A;  3DBR B;  1YX3 A;  3CCR I;  3HSR A;  4U87 A;  5EEG A;  1LEA A;  2HPI A;  3ASN H;  2JQ7 A;  3M8J A;  2DN0 A;  1IW7 F;  1XMX A;  3V8J A;  5GAG J;  3KYL A;  5LD2 C;  3PIO F;  2D1V A;  4Q48 A;  1TNS A;  2MBF A;  3BG3 A;  3ZMZ A;  1BR4 A;  4YRV A;  3SJM A;  1B8I A;  4J19 A;  3LSI A;  1R58 A;  2HI3 A;  2FBI A;  2LY9 A;  3FM3 A;  4P1W A;  2KZG A;  1A35 A;  1LEB A;  2X1D A;  2X48 A;  3HHG A;  3CCE I;  4FE4 A;  2VAS A;  2GOM A;  2JA5 J;  1QHH D;  1T95 A;  2W00 A;  4RGS A;  5TRD A;  3DTK A;  1PUF A;  2XPW A;  1H89 C;  2LRD A;  1ZG1 A;  1DQU A;  2Q8K A;  5ED4 A;  1JXS A;  1APL C;  4DBQ A;  5LGT A;  1OCC H;  3QPT A;  1X3U A;  3LQQ A;  1GVJ A;  3LST A;  2VIX A;  3GTO J;  3OYN A;  5DV5 A;  2HVQ A;  4C2M J;  3I5U A;  3QU6 A;  2FML A;  2HYG D;  2F2E A;  2ISZ A;  2JUC A;  3IC7 A;  1REP C;  2QLZ A;  3WU1 B;  1A6I A;  5FFX A;  4D7M A;  3I3L A;  2LFB A;  5E1W A;  2OBP A;  3CUQ B;  4G6D A;  1IRX A;  4M9Z A;  1R1T A;  3GWZ A;  2A69 F;  1I3Q J;  3ZMS A;  3HC7 A;  3GYH X;  1ETX A;  5CLS A;  3T8T A;  5B1B H;  1EA3 A;  3HKZ N;  2BY3 A;  5C44 J;  2E1O A;  3DKY A;  3PQJ A;  1VND A;  3L2Q A;  3BJO A;  3K1M A;  5J40 A;  2L0K A;  4EJW A;  4YG2 F;  2FBH A;  2VPL A;  1IJW C;  3WTT C;  2HQA A;  3REO A;  5A2Q Z;  3JRF A;  2L01 A;  2ZKZ A;  1D5Y A;  3ZMD A;  1GDT A;  2I8D A;  4MEY F;  2QZ8 A;  3D5R C;  1IC8 A;  4IRG A;  4ETS A;  3EYI A;  4IHT A;  1OR7 C;  4LK1 F;  1IUY A;  5KK1 A;  1J7K A;  4EGZ A;  3ELK A;  2ECC A;  2K86 A;  1WQ2 A;  3H5R A;  4Y3O A;  1HA8 A;  4O3M A;  5GTH C;  1BR1 A;  2EIK H;  3GTK J;  2ZXH A;  1POG A;  4GRI A;  3JW4 A;  3WGH A;  1HKQ A;  3NWT A;  4XN3 A;  3C3W A;  4ITV A;  4EVI A;  2EFN A;  2G7H A;  4JP0 A;  2K9M A;  4CCN A;  1QA6 A;  1OPC A;  1X1A A;  4BJ5 C;  2OD5 A;  4IHX A;  4BUP A;  2E7X A;  3TO9 A;  4EEF G;  4UY8 I;  1JKR C;  3V7C A;  3WTV C;  3R60 A;  3Q3S A;  5JLW A;  2QVO A;  2GA1 A;  2OA4 A;  1UMQ A;  2V6C A;  4BS9 A;  3MN2 A;  3HUG A;  5J4V A;  1OR7 A;  5BMZ A;  4EQQ A;  3BPX A;  3COA C;  3P7N A;  5ICF A;  4A3F J;  4AYB A;  4MHG A;  1VQ7 I;  3AFH A;  4B44 A;  2GOX B;  1R7J A;  4ZYA A;  2MC4 A;  4DBR A;  5HS8 A;  2O8X A;  3ML6 A;  1B9M A;  1LJ9 A;  1HLV A;  2CW8 A;  3OYA A;  5FLV A;  5L3F A;  2XGE A;  4LIU A;  4KFC A;  4HLY A;  4MO7 A;  4L0Y B;  5CKT A;  2DTR A;  3DPL C;  3NAR A;  4PJJ A;  2LY1 A;  3IUO A;  4UUS A;  3MVP A;  4ANJ A;  1RRJ A;  4S05 A;  1IN5 A;  1XB4 A;  1W5S A;  3WU0 A;  3PIP F;  4BQQ A;  3WGG A;  5DM7 F;  3BR6 A;  4CSW A;  5GAE J;  3DEE A;  1JT6 A;  2Y30 A;  3BR5 A;  2VKE A;  2M0M A;  2DA7 A;  2YPR A;  3P9C A;  4V2G A;  4KIC A;  5FD5 A;  4BBS J;  2LKP A;  1OYI A;  3SZG A;  2GXB A;  3OMY A;  3L2U A;  1B59 A;  2HDC A;  1FTZ A;  2BY0 A;  3HRT A;  3I58 A;  3V42 A;  1WGX A;  5H6R A;  4DGW B;  3DEU A;  4LLN A;  2NS8 A;  2DT6 A;  1RZ4 A;  3H5N A;  2XKO A;  1HBX G;  4NNJ A;  2G7U A;  1FBU A;  1USS A;  3ZMT A;  3I4P A;  3OWT A;  2Y0S N;  4A0Z A;  1YW9 A;  2Y0M A;  3TGN A;  3U9G A;  1UG0 A;  2JMW A;  3N97 A;  2Y9Z A;  3RCO A;  5J8C A;  2JT1 A;  2ZME C;  3SFI A;  5EGO A;  1TL8 A;  3L7W A;  2W57 A;  4NC8 A;  1MKM A;  2VT3 A;  1O3S A;  1UHS A;  3EET A;  3VYR B;  2WBM A;  3BOQ A;  3BR1 A;  2YU9 J;  1TQP A;  2MLK A;  1FIA A;  3FXR A;  3HSF A;  3WTZ A;  4GFB A;  4BGD A;  2EBI A;  2DYS H;  2XRL A;  3LOC A;  1PJR A;  3BCA A;  5JVT A;  1WVR A;  5DCM B;  1VQP I;  2HQR A;  3TO6 A;  1A6Q A;  1IRG A;  2FEZ A;  4EJV A;  3HOV J;  1I39 A;  2ETH A;  3BZK A;  3OOP A;  3MCZ A;  3Q5F A;  5GPA A;  1XTA A;  2MSY A;  3K0L A;  3TOA A;  3DEW A;  2DDB A;  2OPT A;  1KGS A;  2ZME A;  3KLO A;  1VTN C;  3DPU A;  2O5R A;  5IPA A;  3S3M A;  3S2W A;  2R7U A;  4HZF A;  3PFY A;  4IOA F;  1EF4 A;  1F43 A;  2NAZ A;  2JVH A;  4HBL A;  3CCU I;  5HLH A;  4R8H A;  2X6X A;  1KA8 A;  2XPV A;  2Z99 A;  2DXI A;  3M9A A;  2R3S A;  2OZ6 A;  4BU2 A;  2LY2 A;  1MDM A;  1MJA A;  3LSH A;  4DQ2 A;  2XGX A;  1MGT A;  2NNN A;  1YRN B;  1DU0 A;  2ZB9 A;  2Z5U A;  1WJC A;  2CUZ A;  2AQF A;  2L2O A;  2KDO A;  3S1M J;  1VQ8 I;  2QGU A;  1MZB A;  4GDF A;  2CO5 A;  1SVO A;  2ZJR F;  2LG4 A;  2HKX A;  1R00 A;  3QWL A;  2R7W A;  4LG0 B;  1T38 A;  1R5I D;  4DJA A;  4W97 A;  1E3P A;  5J1Y A;  1PUE E;  3K70 D;  2I5U A;  4LB5 A;  3CCQ I;  3LWF A;  2PMH A;  3DFG A;  2O6G E;  4I6Z A;  4KIS A;  1XMK A;  2QQB A;  2WAE A;  1V55 H;  1Z21 A;  4HV6 A;  3K2A A;  3OYD A;  3QYE A;  5ICC A;  2Z9O A;  2O7O A;  3VYT B;  3DBH B;  4RAZ A;  1MMN A;  3S17 J;  2CFX A;  3T0Y A;  5BS6 A;  4BEH A;  2FA5 A;  4IRH A;  2PMZ N;  2XGD A;  2Z2S B;  4KMU X;  3U21 A;  3D1N I;  5AIP A;  2IPQ X;  3VDX A;  2IGK A;  2BHY A;  5K7F A;  3CTA A;  3LA2 A;  3FXK A;  3VB2 A;  4NB5 A;  1K4S A;  1TW2 A;  3GVA A;  3ZPL A;  1FYK A;  1YQA A;  4I0B A;  3SEQ A;  1LKX A;  2HOS A;  1H9G A;  2IBD A;  4TV7 A;  2CQ7 A;  1X1P A;  4NDL A;  1WJD A;  2ELH A;  1R9T J;  3BTL A;  3JTH A;  4RMN A;  5IP7 J;  4Y4R A;  3FKI J;  5K7Z A;  2NOJ B;  3B73 A;  2VUM J;  1Z3Y A;  2EA4 A;  2NVY J;  5E3O A;  3S1Q J;  2F4M B;  4NUB A;  4YFX F;  1JE8 A;  4XBF A;  4L18 B;  1GV5 A;  2OQG A;  3CF2 A;  5EG0 A;  2ZJQ F;  3T5X A;  2LC2 A;  5ILV A;  3T1B A;  3OYH A;  2O03 A;  4RA2 A;  4LFU A;  3B6C A;  1QO0 D;  2LRE A;  4I7H A;  4QWQ A;  4G8X A;  3LA3 A;  2ME6 A;  2JN6 A;  2XRO A;  4RB0 A;  3CP2 A;  3DLA A;  4YIF A;  2H94 A;  1MMA A;  3ECH A;  2VXZ A;  3DKW A;  1JGG A;  4CGZ A;  2PLY A;  2R7T A;  2Z3Y A;  4O6J A;  2PX9 A;  3GBG A;  1TP4 A;  4OMZ A;  1I27 A;  5J3L A;  2DMT A;  1SC7 A;  4M3F A;  4WX9 A;  1ITY A;  5BPI A;  3FX3 A;  3OS2 A;  2DMU A;  3QPS A;  2VC0 A;  3ULQ B;  2V4J C;  2VE8 A;  2KJB A;  3CLO A;  1WKM A;  3BTI A;  1W36 C;  3FXL A;  4K2E A;  1Y39 A;  3EDP A;  1HW2 A;  3NRV A;  1GUU A;  2H27 A;  4B4C A;  1SAN A;  3IH4 A;  1JHF A;  4FET A;  4E7K A;  2MW8 A;  3OSG A;  3FDY A;  2HYF A;  2OTL I;  5EDN A;  4CIC A;  1SVM A;  4B1R A;  3GFJ A;  2BY2 A;  3KCC A;  3H0G J;  1GVD A;  4N4O B;  3V4G A;  1HOM A;  4LIT A;  1Z0X A;  4QPQ A;  2DA2 A;  4DYR A;  1MBG A;  2ELK A;  2BEO A;  3ZQH A;  1U8R A;  5EEA A;  1HDP A;  4F92 B;  4FQG A;  4ZZD A;  2EPF A;  2F5D A;  1VI0 A;  2L9V A;  1W1W E;  3SDB A;  1R36 A;  3K4J A;  5D4S A;  1FPQ A;  2X0L A;  1IG7 A;  2ESN A;  1MSF C;  3GO5 A;  2DOF A;  1V5F A;  1RI7 A;  4ZC3 A;  4NQW B;  4Z2Y A;  3OV8 A;  3M7G A;  4BQO A;  1YIO A;  3DV8 A;  3O8H A;  5LRR A;  3VPR A;  3NAU A;  1FYL A;  1D0Z A;  1OJL A;  2M7A A;  5F08 A;  4KA4 A;  4L0Z B;  2R5Y A;  4BHB A;  3OS0 A;  1CF7 B;  5DCF A;  1I3A A;  2VI6 A;  1FLI A;  3DWL E;  3E1S A;  3BC8 A;  5FKK A;  2P4W A;  2A05 A;  3CDH A;  4ESJ A;  5E8I A;  3HTU A;  2JRT A;  1NK2 P;  3WHB A;  2WB1 A;  2K9L A;  2R0Q C;  3LL7 A;  1TNT A;  1VQN I;  2VQC A;  4JOM A;  3DTI A;  3K7A J;  4HOB A;  4NC6 A;  3A4C A;  1FMW A;  4Y52 J;  3L2R A;  2K4J A;  1Z6R A;  4IL6 C;  2OCE A;  5F0C A;  5FO5 A;  1OIS A;  4A0Y A;  4UNO A;  2RV8 A;  1BW5 A;  1Y1W J;  3I55 I;  1DPU A;  2HWV A;  1IXS B;  1I6X A;  2HVS A;  3WTY C;  4HYE A;  3ZQ7 A;  5DUK A;  4BYY A;  2NNY A;  4BHP A;  3DKX A;  2DFE A;  2HVR A;  3IHU A;  4A2U A;  1J0R A;  1ZAO A;  2TDX A;  1SFO J;  3WTU C;  2M7B A;  3CMY A;  4MTD A;  2PJR B;  3IAM 2;  3LSP A;  4OMY A;  3U2R A;  1D8K A;  3WU2 C;  3QOE A;  3L2W A;  3A02 A;  3SYT A;  1X3Z B;  2DFF A;  4ESB A;  1IV6 A;  2XB5 A;  4L9T A;  4HF1 A;  2LOO A;  3OL4 A;  3F72 A;  3L00 A;  4P9F A;  2DDA A;  2JA2 A;  3C2G A;  4IOC F;  1EH8 A;  2XUB A;  4W1U A;  1CQT A;  2DYR H;  1B72 A;  1WJE A;  3KYC B;  4RGR A;  2AS5 F;  4IVN A;  2M87 A;  1FIP A;  2OF7 A;  4FT8 A;  3S1R J;  4BE0 A;  2HEO A;  2I10 A;  3C18 A;  3E5Q A;  4C2T A;  2RQQ A;  2KIS A;  2VKV A;  3H92 A;  3QU3 A;  3TL4 X;  1X1B A;  4MNU A;  2MAB A;  1ENH A;  3TP0 A;  2DMQ A;  4BXX J;  3JRB A;  2E2H J;  2CUF A;  2ELJ A;  2QKL B;  3ONQ A;  5DYM A;  1TW3 A;  3OR2 C;  1XSX A;  2X6Y A;  2L3D A;  5B66 C;  3TKY A;  2LH9 A;  2UZK A;  4BDZ A;  4JBA A;  2LP0 A;  5JHU A;  4U7D A;  5IP6 A;  3OYJ A;  2CW0 F;  4C3J J;  1TT5 B;  3FM5 A;  3FBI B;  4HAM A;  5JVG F;  4M9S A;  4N4N B;  2KL4 A;  4PCQ A;  2E1M B;  2DAO A;  2VT2 A;  3G6E I;  1X3W B;  2IW5 A;  1LVK A;  3O8G A;  2BW3 B;  2XF6 A;  1HW1 A;  3ROU A;  1AHD P;  4B43 A;  1PP7 U;  3IH3 A;  2BXZ A;  3E6C C;  1NK3 P;  5K7H A;  3A01 B;  1WJA A;  4OIR F;  4HPQ A;  3GTG J;  1ZLK A;  4PJM A;  2PG4 A;  2WAQ A;  3BZ6 A;  3S16 J;  1JKP C;  2VON A;  1T56 A;  2GM4 A;  5IY5 H;  5KHD A;  2JSC A;  4FCY A;  2XVC A;  2IXS A;  1FC3 A;  1HSJ A;  3E0J B;  3I4M J;  5EZH A;  4RLQ A;  4JX6 A;  2W4S A;  4AU7 A;  2JTV A;  4NC7 A;  1J5Y A;  4XLP F;  4B8X A;  2L7Z A;  3E3V A;  1H9T A;  1E0E A;  4G12 A;  5F0H A;  4NBQ A;  2H1K A;  3GFL A;  2EZK A;  3I59 A;  4XRM A;  2VOP A;  1P4W A;  1EH7 A;  3MKL A;  4KT6 A;  1TWG J;  2E36 A;  2OQR A;  1N25 A;  3KEO A;  4EGY A;  1Y8R B;  2ZBK A;  2ADU A;  2EV5 A;  2MLG A;  2VBX A;  2F6C A;  4A6D A;  3RZD J;  4IJA A;  3EUH C;  2Q2E B;  1D0Y A;  4WXH A;  1XGM A;  3F6V A;  1SFX A;  1VF9 A;  4XON A;  1A36 A;  1G3W A;  2STW A;  2JK3 A;  2LF7 A;  1WI9 A;  2MC3 A;  2WY7 Q;  4CCO A;  5TIS C;  2V9K A;  1FOW A;  5HLT A;  3EYY A;  2WV0 A;  2A5Y B;  1S7A A;  2JPB A;  3MZY A;  3K4N A;  4GCV A;  2FUG 2;  2XF7 A;  1YTY A;  3GCM A;  2NVT J;  5F04 A;  3BTC A;  1I5Z A;  1FMV A;  3DPT A;  1IN7 A;  4X0G A;  3OYC A;  1OCZ H;  3OYK A;  9ANT A;  1TQI A;  3R6S A;  3RTR A;  1VFC A;  2ZXI A;  1IGN A;  3HXL A;  4I0A A;  1AKH B;  2W48 A;  1LDD A;  1XDU A;  4XLA A;  2TCT A;  2ZO4 A;  1SFU A;  4C3I J;  3HRU A;  3IH2 A;  2L9R A;  4CYC A;  3EUH A;  4L9V A;  1MJ9 A;  3MFK A;  2HYJ A;  2ID3 A;  3U1K A;  4FAS D;  2K27 A;  4LK0 F;  5J4Y A;  2V7F A;  2UXN A;  3LSR A;  4RAF A;  4BQA A;  1ETY A;  4OIN F;  4HNU A;  2IT0 A;  3CDI A;  1XGS A;  2KIQ A;  3HG9 A;  3GW2 A;  4YEJ A;  1TWC J;  2DCE A;  3FK7 A;  4JYK A;  3TDZ C;  3F23 A;  1FOX A;  4RAG A;  1XN7 A;  2NVX J;  3JTG A;  4C9Y A;  3QAH A;  3IL2 A;  2DFH A;  3PSI A;  3RPU D;  2LKX A;  1X19 A;  3S3O A;  5DTD A;  3H5A A;  1ZLJ A;  2X85 A;  1SVL A;  3BG6 A;  4BXU A;  4U0Y A;  4HST A;  3HL2 A;  3CUO A;  2X1E A;  3IRR A;  1FTT A;  2HTJ A;  1Y56 A;  3OIP A;  4FHT A;  3W2V A;  4HA8 A;  2KIF A;  2DOE A;  3J7A O;  1NTC A;  3CO7 C;  1LFU P;  3TO7 A;  5HOO A;  2MD5 A;  3FZV A;  4Y33 A;  4HDU A;  1JJ6 C;  1TC3 C;  4EAT A;  4XIC A;  2ZNZ A;  4YEL A;  1QHG A;  1K78 A;  2R7Z J;  2HOA A;  3ABT A;  4II3 A;  4WK8 F;  1FP2 A;  1KQ9 A;  3DXJ F;  4CZC A;  3IWF A;  1QVT A;  3RYP A;  1W7P D;  2WV1 A;  3AL0 B;  4A3M J;  4U0W A;  4N0B A;  3SEZ A;  2CH0 A;  3W6J B;  2OCC H;  3GFM A;  2R93 J;  2GAU A;  1U5T B;  3L09 A;  3ZQG A;  5BNG A;  3HOY J;  4BE1 A;  1PDN C;  4RGX A;  3HHH A;  3HKZ A;  5FLM J;  1Z7U A;  5LHI A;  1RR7 A;  1P9Q C;  1ORK A;  2KT0 A;  5KCM A;  4AC0 A;  4KMF A;  2PJP A;  2ZSH B;  4A3C J;  2FJ1 A;  2DW4 A;  4E7H A;  2HDD A;  3I9V 2;  4M3E A;  1P6R A;  1G2H A;  1MSE C;  3Q9V A;  4D5F A;  1YYV A;  2N8G A;  2V26 A;  2OZU A;  3W6V A;  3FMS A;  5CQG A;  3TED A;  2V1N A;  1JTY A;  2YX4 A;  3GME A;  2EFW A;  5F64 A;  2HQ5 A;  1RUN A;  2DU9 A;  2VQH A;  2ACJ A;  1FJL A;  1L0O C;  1OFC X;  3K4C A;  1FWZ A;  2L7K A;  4AVP A;  5GAH J;  2FQ3 A;  1RIO H;  5CPR B;  3PQK A;  2QSF X;  1BOB A;  1ZRE A;  2EIM H;  1K6O A;  1UZC A;  1SMY F;  2XKP A;  4ZTJ A;  2OV7 A;  1H0M A;  1FYM A;  3GTL J;  2DK8 A;  1ZEL A;  1YG2 A; 
#chains in the Genus database with same CATH homology
 1ETW A;  2DA1 A;  1P7J A;  5FKN A;  4MIM A;  3S1M J;  3M4O J;  1H8A C;  1HCR A;  1A5J A;  2LTP A;  3BR2 A;  2M9H A;  4A69 C;  4C3H J;  1JT0 A;  1HDD C;  2WB1 N;  5IOZ A;  2O9L A;  4W97 A;  2X6O A;  3HB9 A;  5J1Y A;  3JRC A;  1W0U A;  5FJ8 J;  4B3A A;  4XK4 A;  2LVS A;  4A3L J;  4I6Z A;  2XPU A;  1WCM J;  4HNV A;  4AYB N;  2NS7 A;  3JRH A;  3ZQL A;  3K2A A;  3HOZ J;  2O7O A;  1UG2 A;  3S17 J;  3PO3 J;  2Y31 A;  2RAE A;  3HDD A;  2R92 J;  1I6H J;  2PMZ N;  2XGD A;  3OOU A;  3D1N I;  3A01 A;  5K7F A;  4UUT A;  5M5Y J;  2E19 A;  5M5X J;  1Y1V J;  1U78 A;  1MNM C;  1ETQ A;  1IRZ A;  2IAI A;  1OCT C;  4IHV A;  1QPI A;  2HOS A;  2IBD A;  5GPC A;  4NDL A;  3CCY A;  3UKG A;  1ETK A;  3G1M A;  1P7I A;  1T33 A;  3BTL A;  5IP7 J;  2LD5 A;  1R9T J;  4X6A J;  3FKI J;  3GTJ J;  5K7Z A;  2YUS A;  2VUM J;  2M2E A;  4JX4 A;  2NVY J;  5E3O A;  4QIW N;  3S1Q J;  1GV5 A;  5E3M A;  2NVQ J;  3QPL A;  5EG0 A;  2K9Q A;  2TRT A;  2P81 A;  2HXI A;  2EZL A;  4FE7 A;  3FIW A;  5C4J J;  2QF7 A;  4RBO A;  3B6C A;  3GTQ J;  2ME6 A;  1IDY A;  2JN6 A;  2MG4 A;  3HGG A;  3E7L A;  1TWH J;  4D7N A;  1JGG A;  1JKO C;  1ETV A;  3Q0U A;  2XB0 X;  3GBG A;  5F27 A;  5J3L A;  2DMT A;  4DW6 A;  2GBY A;  4M3F A;  3HBL A;  3HOX J;  5EYR A;  5GP9 A;  1ITY A;  5HOD A;  4RDU A;  3HGY A;  2M8G X;  2DMU A;  2EH3 A;  1LE8 A;  3QPS A;  3B6A A;  2COB A;  2CQX A;  3JRD A;  4BY7 J;  3ZQF A;  2CRG A;  4X1E A;  1JKQ C;  2K9N A;  3BTI A;  2QCO A;  3Q0W A;  1IDZ A;  2M0C A;  2FQ4 A;  1GUU A;  4UUS B;  1AKH A;  3BT9 A;  4B4C A;  2CJJ A;  1SAN A;  4CYC B;  3IH4 A;  2LK2 A;  2K40 A;  2MW8 A;  3BQZ A;  1K83 J;  1Q1V A;  3TW6 A;  5IYC J;  5EDN A;  3OSG A;  2HOT A;  4B1R A;  2Y9Y A;  3H0G J;  3G1L A;  1GVD A;  1ZQ3 P;  1HOM A;  4AUX A;  1JJ8 C;  3HM5 A;  2MGQ A;  4M3B A;  1Z0X A;  1ETO A;  2CU7 A;  2DA2 A;  2WAQ N;  4DYR A;  1MBG A;  2ELK A;  3ZQH A;  4L5E A;  4A3B J;  5EEA A;  1X2M A;  1HDP A;  5E3N A;  1BW6 A;  1VI0 A;  3PM1 A;  4BKX A;  3WHC A;  2L7M P;  1IG7 A;  1MSF C;  5FKM A;  1MH4 A;  3HEF A;  4M3D A;  4A3E J;  2DMN A;  1ZGW A;  3O8H A;  1IUF A;  3VPR A;  3NAU A;  1U8B A;  3JRI A;  1WH7 A;  1OJL A;  4MFD A;  5F08 A;  4ABZ A;  2KDZ A;  2R5Y A;  5IP9 J;  2VI6 A;  1MBJ A;  5FKK A;  4V2F A;  5EGO B;  3S15 J;  3ZOB A;  2FD5 A;  1NK2 P;  3F0C A;  3WHB A;  2YS9 A;  2R0Q C;  5M3M J;  3K7A J;  5M5W J;  1S7E A;  1JUS A;  4A3G J;  2JA7 J;  2H8R A;  4Y52 J;  2HXO A;  5IOY A;  2XSD C;  4M6V A;  5F0C A;  1TWA J;  3L1P A;  2LLK A;  1LE8 B;  2FX0 A;  3S2D J;  1JUM A;  1Y1W J;  1BW5 A;  2K9S A;  5FKL A;  2D5V A;  1I50 J;  1XG1 A;  3S1N J;  3SDG A;  5M3F J;  2DN0 A;  1BJZ A;  1SFO J;  3BR0 A;  3CMY A;  3BG3 A;  3SJM A;  1B8I A;  4J19 A;  3LSP A;  2NOG A;  2CQQ A;  2HI3 A;  2LY9 A;  2JJ7 A;  3FK6 A;  1GT0 C;  4S0H B;  1WH5 A;  1XC5 A;  2X48 A;  3A02 A;  3CDL A;  5C4X J;  4FE4 A;  1IV6 A;  2XB5 A;  2JA5 J;  3HOU J;  1MBF A;  5DS9 A;  2X9D A;  1PUF A;  3TW7 A;  2XPW A;  3PO2 J;  1JUP A;  1RKW A;  1H89 C;  4W1U A;  1CQT A;  1B72 A;  1APL C;  4LOC A;  1YRN A;  3IV5 A;  1FIP A;  2OF7 A;  4FIS A;  1E3O C;  3S1R J;  2ID6 A;  5J1U A;  2I10 A;  3GTO J;  4DYQ A;  4DZP A;  2G0E A;  4C2M J;  2VKV A;  1Z77 A;  4D5C A;  3S14 J;  4A3K J;  3TP0 A;  1ENH A;  3TP3 A;  2DMQ A;  1A6I A;  4BXX J;  4D7M A;  3JRB A;  2DTZ A;  2LFB A;  4A3I J;  2E2H J;  2CUF A;  2ECB A;  4XRS G;  2EQR A;  2JWT A;  2E2J J;  3ZQI A;  1I3Q J;  1ZK8 A;  1ETX A;  2LP0 A;  2R5Z A;  4DZJ A;  5IP6 A;  4C3J J;  4IHY A;  5J1R A;  3HKZ N;  5C44 J;  2E1O A;  2JA8 J;  1ZTR A;  1VND A;  5C3E J;  3OSF A;  2L0K A;  3O8G A;  1AHD P;  2IEK A;  3ZQC A;  3JRG A;  3IH3 A;  1IJW C;  1NK3 P;  3JRF A;  3BQY A;  5K7H A;  3A01 B;  1ZR4 A;  1U9N A;  3S2H J;  3GTG J;  1D5Y A;  5EZG A;  1GDT A;  1IC8 A;  3S16 J;  2EZH A;  1JKP C;  1F36 A;  1T56 A;  2B63 J;  2GM4 A;  3G1O A;  4FCY A;  4MLO A;  2ECC A;  5EF6 A;  3LSJ A;  3I4M J;  5EZH A;  4JX6 A;  3M3Y J;  2AO9 A;  4JX5 A;  2DA5 A;  2Y2Z A;  4Y7N J;  2L7Z A;  4G12 A;  5F0H A;  3GTK J;  2H1K A;  1POG A;  2DJN A;  4MFE A;  2EZK A;  4XRM A;  5EG0 B;  2M34 A;  4JP0 A;  3MKL A;  1LFB A;  1TWG J;  2LR8 A;  3FIS A;  1ZKG A;  4IHX A;  3RZD J;  4EEF G;  1JKR C;  3Q3S A;  5JLW A;  1XS9 A;  1VF9 A;  2JK3 A;  1UMQ A;  3MN2 A;  1DU6 A;  3LNQ A;  3DCF A;  4A3F J;  1BA5 A;  5FKO A;  1X2N A;  3JRA A;  2NVT J;  2AHQ A;  3BG9 A;  5F04 A;  3BTC A;  1HLV A;  5FLV A;  3CQZ J;  9ANT A;  2CUE A;  1VFC A;  2XGE A;  1IGN A;  4MO7 A;  2R5Z B;  1QVU A;  3NAR A;  4UUS A;  2W48 A;  1AKH B;  3MVP A;  2DMP A;  3JR9 A;  2TCT A;  4C3I J;  3IH2 A;  2ME0 A;  2L9R A;  4CYC A;  1MBH A;  2DA3 A;  1U9O A;  2HYJ A;  4BBR J;  2ID3 A;  3BR6 A;  1JT6 A;  2Y30 A;  2VPR A;  2GLO A;  3JRE A;  3BR5 A;  2VKE A;  3LSR A;  2DA7 A;  4V2G A;  2O8K A;  3H3V K;  1ETY A;  1QRY A;  3RQI A;  4BBS J;  1O4X A;  1TWC J;  3FK7 A;  4JYK A;  4FTH A;  2L7F P;  2E2I J;  3I4N J;  1WPK A;  2NVX J;  1FTZ A;  2LKX A;  1X58 A;  5DTD A;  3C2B A;  1WGX A;  4QTR A;  2NS8 A;  1FTT A;  1NTC A;  1LFU P;  1JJ6 C;  1TC3 C;  2Y0S N;  4XID A;  4XIC A;  5IYD J;  1FEX A;  2R7Z J;  2R5Y B;  2HOA A;  2JMW A;  4BY1 J;  2Y9Z A;  1JTX A;  3BR3 A;  1MH3 A;  3SFI A;  1BL0 A;  5EGO A;  5JLX A;  4IHW A;  1QVT A;  2WV1 A;  1UHS A;  4A3M J;  4XRS A;  1TWF J;  3LSG A;  1RKT A;  3BR1 A;  2YU9 J;  1RES A;  2R93 J;  1FIA A;  4GFB A;  3ZQG A;  3OIO A;  2EBI A;  5BNG A;  4A3D J;  5F1J A;  3HOY J;  4A93 J;  2XRL A;  3LOC A;  3Q0V A;  1K61 A;  4I76 A;  5FLM J;  1AU7 A;  2XGC A;  3RZO J;  1RR7 A;  1ORK A;  1WI3 A;  2KT0 A;  4AC0 A;  4A3C J;  2FJ1 A;  3HOV J;  2DA4 A;  2HDD A;  4M3E A;  1G2H A;  5GPA A;  1MSE C;  2DA6 A;  1MBK A;  2MSY A;  4D5F A;  3DEW A;  1H88 C;  2N8G A;  3GTM J;  2OPT A;  1HF0 A;  1OCP A;  5E3L A;  3W6V A;  3A03 A;  1B8I B;  3TED A;  2EZI A;  5IPA A;  1JTY A;  2HQ5 A;  1W0T A;  1EF4 A;  4M3G A;  1FJL A;  1F43 A;  4A3J J;  4DYC A;  1OFC X;  1GV2 A;  1PUF B;  3HOW J;  3BTJ A;  1RPW A;  4IEJ A;  2XPV A;  3QQA A;  1ZR2 A;  3RKQ A;  3BG5 A;  1RET A;  1B72 B;  2JA6 J;  3GTP J;  5F0F A;  1YRN B;  1DU0 A;  2ZB9 A;  4QSH A;  5IYB J;  1MBE A;  3GTL J; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...