3S1MJ

Rna polymerase ii initiation complex with a 5-nt rna (variant 1)
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
65
structure length
65
Chain Sequence
MIVPVRCFSCGKVVGDKWESYLNLLQEDELDEGTALSRLGLKRYCCRRMILTHVDLIEKFLRYNP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transcription/rna/dna
molecule keywords DNA-directed RNA polymerase II subunit RPB1
publication title Initiation complex structure and promoter proofreading.
pubmed doi rcsb
total genus 15
structure length 65
sequence length 65
ec nomenclature
pdb deposition date 2011-05-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
J PF01194 RNA_pol_N RNA polymerases N / 8 kDa subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.60 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Homeodomain-like 3s1mJ00
3E7LA 3OIOA 2HOAA 4I76A 1LFUP 2DMQA 2GLOA 1FIPA 4XRMA 2P81A 1MSFC 2LD5A 3FKIJ 3BT9A 3PO2J 4IHXA 2DA7A 2DA4A 3G1LA 4D5CA 3HOUJ 3I4MJ 5E3LA 1JTYA 2G0EA 4A69C 2O9LA 2LLKA 3WHBA 5IP6A 1RKTA 4RDUA 3JRCA 1H88C 1ETOA 1X2NA 4DZPA 1MH3A 1Z0XA 2NVQJ 1MBEA 4MIMA 1YRNB 3Q0UA 1GV2A 4V2FA 3SDGA 3D1NI 1NTCA 5FKKA 2DMUA 5E3NA 3HDDA 1H8AC 1H89C 3JRBA 3LSGA 1JGGA 1LFBA 4IHVA 4FE7A 3ZQHA 3OOUA 2E2JJ 1GVDA 1QVTA 4DYRA 1U78A 3HBLA 4A3DJ 4MLOA 2DN0A 2DMTA 3C2BA 1WH5A 1BA5A 3HOXJ 1IDZA 2CU7A 2L7MP 1Z77A 4A3CJ 4AYBN 1HCRA 3Q3SA 3GTMJ 3PM1A 3UKGA 1QVUA 2K9QA 1DU0A 3JRGA 3S16J 4FCYA 5EZGA 3ZQLA 3BR0A 1I50J 1POGA 2R5ZB 2Y31A 1BL0A 1ZTRA 1S7EA 2M8GX 5EGOB 4X6AJ 5J1UA 4CYCA 4A3EJ 1EF4A 4A3KJ 5F0FA 5M5WJ 2K9SA 2LK2A 1B72A 2RAEA 3HGGA 2MW8A 5FKOA 1XG1A 1TWFJ 3TP0A 4J19A 1MH4A 1GT0C 1NK3P 4A3GJ 4M3DA 3H3VK 5IYBJ 4FTHA 2H1KA 2DA1A 3JR9A 4M3FA 1I3QJ 3ZQIA 2X6OA 1WPKA 3GTGJ 1U9NA 4FE4A 1JT0A 4A3BJ 2VKVA 1IGNA 4DZJA 2QF7A 2W48A 1JTXA 1ZQ3P 1U9OA 4BY1J 2YS9A 4X1EA 4C3JJ 1MSEC 1ETKA 5EZHA 3JRFA 2JA7J 3F0CA 1RR7A 5FKNA 4C3HJ 2LY9A 5IPAA 2HOTA 1IDYA 5M3FJ 2OPTA 2VKEA 4JYKA 1FJLA 5FKMA 5K7FA 4JX4A 5F1JA 1JJ8C 2VUMJ 2JA6J 3FK7A 3Q0WA 4B4CA 2KDZA 1BW5A 1ZR2A 4XRSG 2AHQA 1UG2A 2JK3A 3HKZN 3TP3A 3BG5A 3GBGA 1W0UA 3BR6A 4DW6A 1B72B 2M34A 2E2HJ 2EZKA 1MBHA 3BQZA 1PUFB 2ZB9A 2L7ZA 2NOGA 4QTRA 2CJJA 5IYCJ 3BG9A 5JLXA 3BR2A 5DS9A 4JX6A 2MSYA 3K2AA 2Y30A 1BW6A 1UHSA 2XGEA 2XGCA 1B8IB 3CMYA 2M9HA 1IV6A 4Y7NJ 3H0GJ 2K40A 3IV5A 1Y1VJ 1F36A 1A6IA 5J1RA 1QPIA 1XS9A 1JUMA 1OJLA 3JRHA 4Y52J 1VFCA 3JRAA 4C2MJ 2LP0A 2L7FP 4UUTA 2K9NA 4UUSA 4A3MJ 1HDPA 1JJ6C 2DA3A 5EG0A 3DCFA 5J3LA 5GPCA 3A01A 3S15J 1VF9A 3HOYJ 3MKLA 4D7NA 3TW6A 5C44J 1Q1VA 1W0TA 2FX0A 5M5YJ 1CQTA 2X9DA 4BY7J 2EH3A 1SANA 3A02A 2ECBA 2H8RA 3DEWA 1I6HJ 1JKRC 2L9RA 5K7HA 3GTJJ 1JKQC 3IH3A 1ZK8A 1ETYA 1AKHA 1T33A 3I4NJ 2JWTA 2EZLA 1NK2P 5J1YA 2NVTJ 3S1MJ 2O8KA 5IP7J 1K61A 3S1NJ 1GDTA 2B63J 2CQQA 5M3MJ 5F08A 1ENHA 3TEDA 1VI0A 2DA6A 4DYQA 2WAQN 4M3EA 4UUSB 2JMWA 2LFBA 2PMZN 2CUEA 5EF6A 3IH2A 1X58A 4GFBA 3A01B 4XRSA 2E2IJ 2MGQA 3ZOBA 4XICA 5IOZA 1FIAA 2ID6A 1BJZA 4D7MA 4FISA 1G2HA 3BTJA 3GTOJ 2IAIA 2EBIA 1OFCX 1JT6A 1HDDC 1FEXA 2X48A 5K7ZA 2LKXA 1APLC 2CUFA 1XC5A 3HOWJ 3FK6A 1ETQA 1SFOJ 5IP9J 4MFEA 4IEJA 2I10A 3A03A 1ZKGA 3SFIA 1AKHB 2GM4A 2YUSA 4LOCA 3PO3J 2HYJA 4A93J 5DTDA 1E3OC 4EEFG 2COBA 3O8GA 2Y2ZA 1AHDP 5F0CA 2GBYA 1QRYA 4A3FJ 2HI3A 3BR3A 3SJMA 1LE8A 1ORKA 1O4XA 4BBRJ 4QSHA 4XK4A 4S0HB 1TC3C 2ME0A 3BG3A 4CYCB 1U8BA 2NVYJ 3GTLJ 1MBGA 2DA2A 4IHYA 5GP9A 1ITYA 1WI3A 2ECCA 3K7AJ 4JX5A 2WB1N 3HM5A 4A3JJ 2EQRA 4ABZA 2XB5A 4MO7A 4AUXA 5FJ8J 1TWHJ 5F0HA 1Y1WJ 4W1UA 1IRZA 4MFDA 1AU7A 1UMQA 2FD5A 3BR5A 3BTCA 1P7IA 2TCTA 2Y0SN 3MN2A 5C3EJ 1R9TJ 2YU9J 2XB0X 3HEFA 2OF7A 4M3GA 3NARA 3LNQA 1HOMA 3RQIA 3OSGA 2FQ4A 2FJ1A 3S1QJ 4B3AA 2XGDA 1VNDA 4V2GA 3QPLA 3BTLA 3TW7A 3CQZJ 5E3MA 2HQ5A 3GTPJ 3B6CA 3QPSA 1MBJA 1WGXA 1JKOC 2TRTA 3ZQCA 4I6ZA 2XSDC 4W97A 1FTTA 2IEKA 3B6AA 3ZQFA 1DU6A 3O8HA 3FISA 4B1RA 1TWGJ 1LE8B 2M0CA 2R5ZA 5C4XJ 3BR1A 4M3BA 3M4OJ 4A3IJ 5GPAA 1IUFA 5EGOA 1MNMC 3S2DJ 3W6VA 2D5VA 2LVSA 2NS7A 2N8GA 2E19A 3L1PA 4C3IJ 4QIWN 5FLVA 2DMPA 2R5YA 1RKWA 1D5YA 2R92J 1K83J 2JN6A 1JUPA 2XRLA 1P7JA 2AO9A 3JREA 3G1OA 3JRIA 2HXIA 3RZDJ 2DA5A 5HODA 4XIDA 3OSFA 2Y9ZA 5EDNA 5F04A 1ETXA 3LSRA 5BNGA 1MBFA 2HOSA 2ELKA 3NAUA 5M5XJ 2IBDA 1IC8A 9ANTA 5EG0B 4RBOA 1HLVA 3GTKJ 3BQYA 3FIWA 1RETA 1HF0A 3S14J 5IOYA 5EYRA 3ZQGA 3CDLA 3RKQA 5EEAA 3VPRA 3JRDA 2R7ZJ 2JA5J 4BXXJ 1A5JA 3RZOJ 1GV5A 2LTPA 5FLMJ 2Y9YA 2O7OA 2M2EA 3HGYA 4IHWA 1FTZA 1GUUA 5FKLA 1ZR4A 2R5YB 1PUFA 1RPWA 1X2MA 2E1OA 1ETWA 2HDDA 4L5EA 2R93J 1OCTC 1MBKA 4BBSJ 2VPRA 1B8IA 1TWAJ 3QQAA 1ETVA 2L0KA 3S1RJ 3CCYA 3LOCA 5E3OA 1JUSA 1IJWC 2EZIA 1ZGWA 2DMNA 2XPVA 3GTQJ 1F43A 2MG4A 3WHCA 5JLWA 3S17J 2HXOA 2WV1A 1WH7A 3HOVJ 2LR8A 4AC0A 3M3YJ 4A3LJ 2QCOA 1IG7A 3IH4A 5F27A 4G12A 3BTIA 2VI6A 4M6VA 4BKXA 1YRNA 2EZHA 2JA8J 4DYCA 2NVXJ 4HNVA 2KT0A 4JP0A 2XPWA 1WCMJ 2CQXA 1T56A 2DTZA 4NDLA 4D5FA 2JJ7A 5C4JJ 2NS8A 2ID3A 2ME6A 1RESA 1TWCJ 3HOZJ 2DJNA 2R0QC 3MVPA 3Q0VA 3LSPA 2XPUA 1JKPC 3HB9A 3LSJA 5IYDJ 2CRGA 3S2HJ 1OCPA 3G1MA
chains in the Genus database with same CATH superfamily
2CS3A 2JVHA 2DLLA 1FIPA 2DI3A 2QKLB 2ZXWH 3SZGA 2VASA 3HOTA 1KONA 2ZFUA 2CUJA 1B9MA 1ZLJA 4GYGA 4XLEA 3OS2A 3K70C 1IRGA 1Y8RB 3OV8A 1TQIA 2CMPA 1IXSB 2OBPA 1MMDA 1STZA 2RC4A 4RLQA 3R61A 3FXKA 4R8HA 3MKZA 2ZBKA 2A69F 3C2HA 4L9TA 1SVOA 4A69C 2HQRA 2O9LA 2LLKA 3L2VA 2FNAA 1G8XA 3WHBA 2WC2A 1H88C 5JHFA 4DZPA 1LPQA 5KVRA 2OC6A 2MD0A 2G7HA 3FMRA 1ZG1A 1FT9A 3BG6A 1YW7A 1NHAA 2WAEA 1X4PA 1R58A 3LA3A 4EJWA 3ZMDA 1AWCA 2BY0A 5ED4A 4ZH4F 3MAJA 4FE7A 3K0LA 3OOUA 5ICFA 3ZQHA 2D1HA 2VJ4A 4UB8C 1MZBA 3G2BA 3FKJA 2ZJQF 4Y33A 1FMVA 1Z77A 2HQAA 1HCRA 3LSTA 3OWTA 2XHKA 4Y3OA 4XLHA 2JSCA 2IJLA 2JZYA 4BQOA 3CUQA 2OUMA 4CCLA 3CC7I 4V19K 2W24A 4FCYA 3ML6A 1H9TA 2JRMA 5J47A 2QQ9A 2Y31A 3V8JA 1BL0A 2W57A 3CMMA 2QGUA 1Z91A 2GA2A 3F3XA 2EFOA 2M8GX 4XONA 4A0YA 2BYVE 1MMAA 2KRCA 4X6AJ 3HOSA 1EF4A 1DPRA 3IHUA 3ERMA 2F5VA 4AM3A 3OYMA 2LK2A 4XKCA 3V7SA 4MEXF 1B72A 5L3FA 2MW8A 3H35A 4PJJA 3H9QA 1GT0C 1Z7LA 1BIAA 3F6VA 2PMUA 5IYBJ 2MBFA 1DQUA 3EUKL 4E7LA 2BZTA 3GFMA 4KDPA 2FF4A 2WA0A 2AQEA 4QLCU 2EV0A 2X6OA 3DU6A 1DGWY 5FROA 4BXUA 2VKVA 3ASNH 2JA2A 1IGNA 2LOOA 1BN5A 1ZQ3P 2EIKH 4I09A 2YSRA 4X1EA 3GZ6A 1MSEC 4MQ9F 5FKNA 2VE8A 2R7RA 3LSKA 1KQ8A 2HOTA 1IDYA 1YE9A 2DYSH 3FBNB 5M3FJ 4M72A 2OPTA 2VKEA 5FKMA 2JSPA 2UXXA 4JX4A 2ZNYA 4I0BA 1KU7A 2WY8Q 3O3KA 1UB9A 4RB1A 2P7VB 3Q0WA 1RZ4A 2XVCA 2KDZA 4U0YA 2JK3A 2LF8A 1B9NA 3H5RA 3P7NA 2XKOA 3BG5A 5H20A 5HLTA 2VLAA 4XLPF 3BR6A 4F93B 4AIHA 4MHGA 3WGGA 2R3SA 2DFFA 3SZPA 2L7ZA 2L4AA 3TOAA 2DK8A 3BG9A 3D0SA 5JLXA 4JX6A 4IHTA 2MSYA 4L9VA 2EFPA 2Y30A 2A61A 2XGEA 2XGCA 3LFKA 3ZN1A 4OWRB 2DT5A 5TJJA 2Q1ZB 1IV6A 2K40A 4Q47A 5DUIA 3DBRB 1LEAA 2BBYA 2LKSA 2OCEA 1QPIA 1JUMA 5FFZA 3JRHA 3C2GA 2EIJH 2VQLA 5J8CA 3VYTB 2LP0A 3JRAA 4KN7X 2R7TA 2EILH 2PQ8A 1FLIA 2W84A 3KZIC 2XAJA 2H94A 1MJAA 1BI0A 2E1NA 5E18F 3ZMZA 4M73A 1VF9A 4PGGA 3K4CA 1BOAA 4KIFA 3SEZA 3AL0B 3J7AO 1BR2A 4IXAA 1Q1VA 5C44J 1OMIA 3IP4B 3UR3C 4E7SA 1ONVA 4BAYA 3E1SA 3DLLF 1IN8A 4ZYHA 4UVCA 1ZGAA 2XAHA 3AG1H 1TTYA 2ECBA 2H8RA 2ZMEB 1DDNA 1W1WE 3CTAA 5DCFA 2GA1A 2LSOA 4CCJA 1FC3A 2R7WA 4XLFA 3JTGA 4BJ6C 2L2OA 3X2QH 2Q8KA 2EV6A 1X4OA 2JWTA 3I4NJ 1ZRDA 1NK2P 2KRHA 1YJWI 5HS9A 5L3EA 5GTHC 4II2A 2O8KA 5IP7J 1YW9A 1GDTA 2V1NA 1YLFA 2BOLA 1Y0NA 4CSWA 2B63J 2LY2A 2XAUA 1OR7C 3WODF 2DFEA 2X6XA 4JQFA 1XCBA 3TEDA 2DFHA 1T0FC 2JUCA 3GLXA 1E2XA 4DYQA 1K78B 1XB4A 4EGYA 4Q5SF 3RPQA 1FYMA 4XR6A 2LFBA 4GCVA 3SHFA 5LLQA 2KIFA 2V9KA 3T0YA 3VOEA 1JHFA 1FYKA 4OAYA 4XICA 4DQ2A 4TV7A 1FIAA 1P4WA 1IXCA 3HRSA 1UCRA 3CJQB 3IWZA 4XMYA 3ZQQA 4FISA 3LQQA 2Y48A 1WJFA 2M0MA 1WJAA 3DTIA 2HZDA 2Z99A 1HDDC 5K7ZA 3ABKH 2PG4A 2K27A 2CUZA 4CH7A 5CKTA 1RNLA 2I10A 3A03A 4I0AA 3RKYA 4KMFA 4P9FA 5FRNA 2RREA 4LOCA 4HPQA 3TO6A 2IXSA 4C30A 4A93J 5CLSA 1YX5A 1E3OC 1CGPA 1WVRA 4ENNA 3O8GA 5HNFA 5F0CA 1LQ1A 2GBYA 3BWGA 3BG7A 2HI3A 3HSFA 2K02A 5HDKA 2W25A 2OV7A 2Z3YA 3GF2A 2H6BA 1ON2A 1TC3C 4GDFA 5IT9Z 3GTLJ 3SYTA 4IHYA 3KPHA 2OTJI 1WI3A 4IOAF 1KQ0A 1YYVA 2V9PA 1QZYA 2W85A 4CZZA 5J6XA 5LHIA 2G7UA 3M9AA 2L4MA 2PJRB 2BY3A 1K7AA 1X1AA 2GQQA 4MFDA 1AU7A 1IRZA 4YEJA 2L01A 2MA3A 2MH2A 1P7IA 2KLOA 1PUEE 5C3EJ 1R9TJ 4YFKF 3V8KA 2YU9J 3LA2A 2ZFWA 1X3UA 2MC4A 3CMEI 2OF7A 1A6QA 2ZKZA 5DV5A 2IGKA 3H9GA 1P4XA 3TOBA 2DFIA 4HZFA 1ZH5A 3RQIA 1HC8A 5CVRA 2FJ1A 4D1QA 2E7XA 3ZR8X 3CC4I 1VQ8I 4B3AA 3HRMA 2A6HF 1WRJA 4MTDA 1FBQA 3T8RA 1VNDA 5HLGA 4EJVA 2EA2A 4BE1A 4KMUX 5E3MA 1G3YA 4XN3A 4Q4ZF 3ZQCA 2HEOA 1Y0UA 2MD5A 2Q0OA 2ZNZA 4PK4A 3VB2A 2XSDC 3I58A 2ZJRF 3VWBA 3GFJA 2NAZA 2KHMA 3QRFF 1U5TC 3RYRA 4I98B 4GGGA 2R7DA 3LSIA 2R5ZA 1VTNC 3ASOH 5LGUA 5C4XJ 4ENMA 4M3BA 1FWZA 2DBBA 5GPAA 1IUFA 5EGOA 4WXCA 3W6VA 5FGMA 3K4KA 3F8MA 4BQNA 3DF8A 4XLCA 3K4BA 4XL9A 3BCBA 3EETA 5FLVA 5H6RA 5HDGA 1I1GA 1OCOH 2R92J 2JN6A 3G1OA 4DOZA 5KAFC 2E36A 1FP1D 1EH7A 4IVNA 2KQRA 1PP7U 4LLGF 3OSFA 5ILUA 4U87A 4CCKA 2BW3B 3DV8A 4KICA 5F04A 3P5JA 4WK8F 4YIIA 3EUAA 1VQ6I 1SMYF 4IX7A 3TQNA 5BNGA 5IY5H 1GXPA 4IRHA 2H6CA 4PUSA 3PUFA 2ELKA 1T38A 3NAUA 1ZG5A 4EM1A 4MTEA 2Z33A 1P2FA 1HW1A 3V7CA 4HX8A 2AQFA 1LEBA 5ILVA 3MKYB 3IKVA 3WTYC 1JHHA 3GO5A 3TDZC 2FEZA 3BQYA 3HIFA 3FIWA 3PNTA 4B3XA 3S14J 1WFXA 4HDUA 4KT5C 4HBLA 1WJBA 3GW2A 4YIRX 4B47A 3CDLA 5HOOA 3VPRA 1YHQI 2JA5J 2H27A 2Z9OA 2LBFB 1ZRCA 3C7JA 4JK1X 3BY6A 3M8EA 2CSOA 2M2EA 4J01A 2FSWA 3IC7A 1FTZA 3IRQA 2QENA 4KN4X 5GAGJ 4RB2C 2IP2A 1WWXA 1WSUA 5DYMA 2VOPA 4HOBA 3E6DA 1G59A 2HVRA 1W5SA 4E7ZA 2E1OA 2HDCA 3QPHA 1WJ5A 3LAJA 4L5EA 5BPIA 1OCTC 1FZPB 3KCCA 2X85A 2R7SA 5E3OA 2QBYB 3G3ZA 2D45A 2F48A 3HTUA 2DMNA 2XPVA 2BE5F 2DQLA 1X1DA 4EV0A 3RTRA 1TT5B 3S32A 4HLXA 4NQWA 2WV1A 5DCMA 1WH7A 2MLKA 1OCZH 4EJUA 1CF7B 2VB6A 2RV8A 2MLGA 2A5WA 5CVIA 5F27A 1TNSA 2QUFA 5DUKA 4BXFA 4CO8A 1Z05A 3BTIA 3WTUC 3FHNA 1MMGA 2V6EA 3PIOF 2QKMB 1YRNA 2FNPA 3VYSB 2KT0A 4JP0A 1V3FA 5LEKA 1A36A 2I5UA 2JQ7A 4LIUA 2DTZA 3T5XA 5C4JJ 3AAFA 1SD4A 3OYEA 1RESA 4I99C 3QAHA 1HXDA 1WQ2A 5L3GA 1HSTA 4OIOF 1LVAA 2EB7A 4Q48A 2XPUA 3HB9A 3A4CA 2CRGA 3ABUA 2E5ZA 2RQQA 3S2HJ 4KJZA 1YO5C 3HL2A 4CA0A 1G3WA 3E7LA 1TQPA 1SAUA 3AL0C 2HOAA 4I76A 1R5GA 4HAMA 4ENKA 3MZYA 5GAEJ 2COMA 2P81A 4BDYA 1MSFC 5EEGA 2LD5A 5KK1A 3RYPA 1FNNA 1XTAA 2HS5A 3FKIJ 2EINH 2ZMEC 4L18B 1Z6TA 2DA4A 4D5CA 3HOUJ 2E34A 4XLAA 1HKQA 3GFLA 2VBWA 2FOKA 3FXQA 4AD9A 2L5QA 4XRFA 3B73A 1ETOA 2GOXB 1W5TA 4G9YA 2QSHX 1EV7A 1MH3A 2NVQJ 1GV2A 3SDGA 4DBQA 2OAZA 3D1NI 3FXRA 1BJAA 1H8AC 2HNHA 1H89C 2KJCA 4N4OB 3U2RA 1JGGA 1YIOA 3ZQ7A 3HRUA 2E2JJ 2L7KA 4PSXA 3V4GA 1QQIA 5GTIC 2QSFX 3HBLA 1P4AA 2L9NA 2AS5F 3N4MA 3C2BA 2KISA 1WH5A 2IPQX 3JSPA 1BA5A 4GRIA 4A3CJ 1NG6A 5FD5A 3UKGA 4P55A 2K9QA 4BNCA 4PJ0C 5LRRA 1DU0A 3CP2A 3KE2A 3JRGA 1MW7A 3RSNA 4Z2YA 2CV0A 1V5EA 1POGA 1ZTRA 4ZDPA 1R1TA 5IT9K 1ACIA 2Y0MA 2LDUA 3U1KA 3M7GA 4H0EA 2HU9A 1KGSA 2DODA 2P4WA 3PL8A 3ZCOA 4CYCA 4A3EJ 1YIJI 3VDXA 5CQGA 3VYUB 2K9SA 4XKWA 3N97A 2VC0A 2LH9A 2HPIA 1TWFJ 1MH4A 4RAZA 2VN2A 2PFBA 1RUNA 3MEXA 2ISYA 2X1EA 2L3DA 2DA1A 2BHYA 2P6TA 4F3QA 4M3FA 1WPKA 3GTGJ 1KA8A 1KQ9A 4IRGA 1JT0A 2ZC2A 2B7EA 3ONQA 1U9OA 4BY1J 2YS9A 2STWA 4A6EA 4C3JJ 1TNTA 2M4GA 3PFIA 3JRFA 3PUBA 1RR7A 2BXYA 5IT3A 4A6DA 1VQ9I 1N25A 3OMYA 1FJLA 3CUQB 1N78A 2CFXA 2EK5A 4J00A 4UVBA 2JA6J 1FBUA 1BI2A 4B4CA 4XRSG 4ITVA 1D8JA 1FX7A 1R22A 2V7FA 2W4SA 3TP3A 2P0WA 3QU3A 1XGNA 4LG3A 3FMSA 1B72B 2F4IA 2EZKA 3AKZA 2M87A 4R79A 1ULYA 2F4OB 1I1SA 3OYGA 4QTRA 2YX4A 3CP8A 5IYCJ 3BR2A 5DS9A 5JVGF 3K2AA 1W7PA 3LAPA 1D1CA 1BW6A 3M1CA 2X51A 5H6QA 1UHSA 3CCMI 3E97A 3Q5FA 5J40A 3COAC 1B8IB 2E1MB 3MWMA 4KIBA 1J5YA 4Y7NJ 3IV5A 1Y1VJ 1VQOI 4BGDA 4UXNA 2R7OA 1F36A 4QWQA 1FOXA 1XS9A 1X19A 2KPMA 4BL0B 2L7FP 2HVSA 4UUTA 1QHGA 2K9NA 4KA4A 1TL8A 2LNBA 1OYIA 1JJ6C 1USTA 2IS4A 5EG0A 4Y4RA 4CCOA 5J3LA 5GPCA 3HUGB 2QYOA 3S15J 4DGWB 2DTRA 5LRSA 4D7NA 5ICCA 3TW6A 5BPDA 2P5LC 1LKXA 5B1BH 3OYFA 4ZTFA 3GEZA 3VODA 1OR7A 1K6YA 3CDIA 4BY7J 2DJIA 1SANA 1G3TA 4JOMA 3DEWA 1I6HJ 2HDWA 4AU7A 4LLNA 5K7HA 4HLYA 5HLHA 2WTEA 2NS0A 3IH3A 2K4BA 1ZRFA 3I59A 1ETYA 1OCRH 1V5FA 1PJRA 1AKHA 4PFPA 5CPRB 3JAMK 2DYRH 2VT2A 3GWZA 5KCMA 5E1ZB 3AG3H 2NVTJ 2KRFA 5ICGA 3M8JA 4B09A 3OYNA 3L2QA 2CW8A 1K61A 2E35A 4M6XA 3S1NJ 3ZPLA 2XRNA 1XMXA 5F08A 4M71A 2HYGD 1ENHA 3K4LA 2DA6A 4PJNA 4A0XA 2KMUA 5D5WB 4M3EA 4D9JA 1LUJB 2Y75A 3U1DA 3J81Z 1ZAOA 2DOEA 4FX0A 1QBJA 4CUGA 2XKPA 4G6TB 2UZKA 3U9GA 5EF6A 3IH2A 3OYIA 1X58A 3E5XA 4A12A 1FOYA 4CGZA 3W6JB 5LGNA 3QU6A 3E0JB 3MCZA 1BJZA 3OYKA 4XKVA 4D7MA 4BHCA 3QPTA 4EMSA 1G2HA 3BTJA 2OCCH 2JT1A 3GTOJ 4L5IA 2QA4I 4F7ZA 5F1RA 4HEA2 4P9UA 2L02A 3BZ6A 2X48A 2STTA 2HOEA 2LKXA 1IV8A 4LK0F 2X1CA 2CUFA 1XC5A 4C9YA 3BLYA 3HOWJ 3FK6A 4EJOA 5BQTA 1RUOA 4IEJA 1ZKGA 2HTSA 2YUSA 1QA6A 4PJLA 2LMDA 4EATA 5D6EA 2JVGA 2Y2ZA 5CVVA 3CCVI 4A3FJ 4IRIA 1R1UA 4Y13A 1OLTA 4YFXF 2VQGA 2J5OA 3H1CA 2MC3A 3SJMA 5L3CA 4BH9A 3GUDA 1FSEA 4FHTA 2XAQA 2ISZA 2DA2A 3K7AJ 2CQKA 2CH0A 2JPBA 2ZCWA 1XCVA 1U2WA 2EQRA 3CESA 4ABZA 4MO7A 4AUXA 1TWHJ 1Y1WJ 1IN7A 4BHBA 2YR2A 1USSA 4BE2A 2XASA 1TLHB 4OU0A 1O7LA 2TCTA 3BPVA 3HKZA 3N05A 3HEFA 1U5TA 1HW5A 4M3GA 4HX7A 3WU0A 1QO0D 1HOMA 2CG4A 4M9SA 4XORA 2Z1DA 4XM3A 1BOBA 3SZTA 2GWRA 2XGDA 4N0BA 2HKXA 1XN7A 5D5XB 3F8CA 3CQZJ 5DM6F 2HQ5A 3GTPJ 3CCSI 3B6CA 3A2KA 3G71I 2TRTA 3TDUC 2FOWA 1O7FA 4W97A 2IEKA 3B6AA 2XF5A 3KZZA 3K1NA 4IQJA 3O8HA 4MNUA 3DQVC 1TWGJ 3G6EI 1XPXA 4HYEA 2XAGA 4PGHA 4LB6B 1MNMC 1SD5A 4Y15A 2VXDA 3CCUI 2NS7A 1DP7P 4YFNF 2E19A 5J8FA 4C3IJ 2L9VA 4CDGA 4QIWN 4WWCA 1VQKI 2Y69H 2R5YA 2V1DA 1D5YA 5BOXA 2F5CA 1OPCA 2ICWG 3JRIA 1F1ZA 3RZDJ 2DA5A 2UV1A 3KEOA 2D2WA 3WTXC 2YU3A 3CLOA 3V42A 5EDNA 4QPQA 1S5LC 2Y9ZA 4A0ZA 1TW2A 3F22A 1R1VA 4XN0A 1X3ZB 2J5PA 2CV1A 1VQPI 2CQNA 2KP6A 2A05A 5ERIA 2IBDA 4PFOA 1S3JA 1D0XA 1O3SA 1XMKA 3RPUA 2VQHA 4LITA 3NRVA 5CJ9A 1HLVA 3W2AA 1IUYA 2IA1A 4PDKA 1RC9A 1K79A 1FPQA 3ZMVA 3PJRA 2IW5A 1IZ1A 1QPMA 2DCEA 4DNCA 2VBYA 5EYRA 3ZQGA 3CJRB 2R7UA 1T8IA 2XSJC 1R6RA 1SMTA 3DWLE 4KUMA 2O61A 3LL7A 4BACA 2PMZA 3C1DA 4B48A 1E3HA 1GV5A 2LTPA 3KYDB 1HQCA 2Y9YA 3TL4X 1SVMA 2LKPA 3HGYA 4DBRA 4OIRF 5FKLA 1ZR4A 1YJ9I 2JA7J 3L7WA 4LG0B 4EM2A 3CUQC 4NBQA 1ETWA 3BP8A 3HRTA 1I27A 1M1EB 1DPUA 1MBKA 1WI9A 3QQAA 1IN4A 1BR4A 1ETVA 2L0KA 3D5RC 1I3AA 2DK5A 1JUSA 1IJWC 5KHDA 3V7RA 1XMAA 1T95A 2OTLI 3K4NA 3GTQJ 2E5NA 2VODA 3S2WA 3OL4A 5E17F 1MDMA 4LJZF 3LFUA 4E7KA 3FZVA 1KU3A 2W00A 2LR8A 4BQAA 4AC0A 2L9SA 3U21A 1IG7A 3IH4A 5GADJ 2F5DA 4G12A 1EJ9A 2JUGA 3ECHA 1K6OA 1YG2A 4ON0A 2M5WA 4BKXA 4BDZA 4U88A 3WTSC 4CCMA 4HNVA 2DOAA 2EPFA 2XPWA 3QODA 1T56A 4NDLA 4D5FA 2ID3A 4HRIA 2E71A 2XF6A 3Q9SA 2PX9A 2Y0SA 3GCMA 2CO5A 4XLNF 5IYDJ 2UXNA 4IZZA 1OCCH 1OCPA 4H4KC 2LF7A 1VZ0A 3G1MA 1BC8C 3D5SC 4MGRA 1LFUP 3F6OA 3IUOA 3NWSA 1SFKA 1Z3YA 3F21A 2GLOA 1BBYA 2F5EA 2ETHA 3I9V2 1SD6A 3KEYA 2QLZA 4N4NB 3BT9A 1GLNA 3EUHC 3J81K 3PO2J 1DGRM 2HYFA 2O3FA 3J7ZI 1YTYA 4IL6C 2DA7A 3G1LA 4RMNA 2IGOA 3L9FA 4NQWB 1EA3A 1LVKA 3F8BA 3FX3A 4FETA 5DCMB 2G0EA 2W82A 1W7PD 1HKSA 1R23A 3FM5A 4FX4A 2A07F 5IP6A 4RDUA 2CYYA 1FMWA 2PMHA 4B8XA 4OAZA 4E7IA 4YIFA 1Z0XA 3C18A 4MIMA 1YRNB 2Q2EA 4UB6C 1I5ZA 3BJAA 3ROUA 1NTCA 4LD5A 5HDNA 3JRBA 2OZ6A 3LSGA 3R0JA 6PAXA 5FB2A 1GVDA 1G6NA 4DYRA 4ANJA 1U78A 4IKFA 3I53A 5CVUA 4CZCA 1VQNI 2AXLA 2DMTA 4C2TA 1IN6A 2PN6A 4HDVA 1Y39A 4YRVA 1IDZA 1Y6IA 2JPCA 2XGXA 3T8TA 3GTMJ 2K86A 2K3PA 1YS6A 1JE8A 2Z2SB 3FDYA 5EZGA 3ZQLA 2GXAA 3BR0A 4BYYA 5B3SH 2KIMA 4I01A 1LFPA 3ZXSA 3SQNA 1LDJA 1S7EA 1O3RA 1UG0A 2VT3A 4F52A 2K3FA 4EM0B 2C6YA 4L9JA 5J1UA 1YJNI 4U0WA 5F0FA 5M5WJ 1YW8A 4S05A 4X0GA 3HGGA 1BM9A 3DTKA 1R4NB 4LLLA 5ICEA 3TP0A 4J19A 3TMOA 1O3TA 3BC8A 3H5NA 4M3DA 3H3VK 1U3EM 4A3GJ 4YELA 1G4DA 1R5HA 1I3QJ 3F8NA 3JAMZ 2K5CA 5D4RA 3ZQIA 3I4PA 2XF7A 2DT6A 1U9NA 3CO6C 4FE4A 2A6EF 3I56I 4A3BJ 3CC2I 4DZJA 2QF7A 2B9SA 1JTXA 4IQ4A 1ETKA 3TKYA 3TO7A 2LYCA 4CYDA 3F0CA 3B02A 2F2EA 3SEQA 2LY9A 2XDVA 3NEUA 3HXLA 3HPGA 1OYYA 3HG9A 5K7FA 3EYIA 1HBXG 1MIJA 4KIGA 3FK7A 3LMMA 4AIJA 1TBXA 2KJBA 2A6TA 1PP8F 4M74A 1ZR2A 2K9LA 2DPUA 4RM3A 3SFZA 1UG2A 3F72A 2ZXIA 2R7VA 5F6FA 3HKZN 3OYLA 3KX2A 2YPRA 3JSOA 2ESHA 3MQ0A 3GBGA 1TZLA 4DW6A 2M34A 4ENJA 1D5VA 2R7QA 2M4KA 4LK1F 1PUFB 2ZB9A 2NOGA 4HNTA 2IS1A 1LNWA 2KDOA 1D3YA 5FRMA 4I02A 2K85A 3CMYA 1ZELA 1OYWA 3AG2H 3H0GJ 5CQEA 3CCJI 1KYWA 1A6IA 1XD7A 5J1RA 2HGCA 1B6AA 4EVIA 1OJLA 2Z16A 1HW2A 4Y52J 1IXRC 1VFCA 2V4JC 4Y17A 4C2MJ 2Z5UA 4HQMA 1P9QC 4ZZLA 4AIKA 3PIPF 4OIPF 1Z3XA 4UUSA 4A3MJ 2M8EA 4UVAA 2O6GE 3KZYA 2DA3A 2QQBA 3KP2A 4NUBA 1J0RA 2NNNA 1UFMA 4BJ5C 1GVJA 2MABA 3DCFA 5BMZA 2KFDA 3A01A 3HOYJ 2E7WA 3S8PA 4EQQA 2ZXHA 4M6YA 4ZTJA 2VQCA 3HJEA 3TBIA 1IN5A 5M5YJ 2BVLA 1CQTA 2MYSA 1UJ8A 1E3PA 4RB0A 1J59A 4UHTA 5L3DA 3A02A 2H8WA 4WCGA 1JKRC 4QPOA 5L3BA 4ZDOA 4HV5A 3GTJJ 2X1DA 3VSKA 3DU5A 1R36A 2W1OA 3NWTA 5TISC 1ZK8A 4A5MA 2VPLA 1T33A 2DDBA 1W7PB 3DBHB 2ELJA 3REOA 3S1MJ 1U0JA 2BY1A 3EPZA 4HQEA 2FA5A 1JI8A 5E8IA 3PFYA 3E5UA 4HX4A 3CCRI 4G6DA 4M9XA 1ODDA 2CQQA 5TGTA 1ZGJA 2VIXA 4BS9A 3OYCA 1FSHA 5DD8A 1VI0A 4I7HA 2JMWA 1MKMA 3L2CA 2X0LA 2PMZN 4AYBA 3FXLA 5E20A 2DXIA 1Z7UA 4LMYA 3GZ5A 3OL3A 2ADUA 4PZJA 1V5GA 1AOYA 1BR1A 1TW3A 3ZOBA 1FOWA 1EH8A 5IOZA 2VJIA 1S9HA 4AWXB 1GHCA 2WBMA 1XGOA 3AFHA 2VONA 1KYZA 1F5TA 4G7HF 4RA2A 2IAIA 1P6RA 1X3WB 2EBIA 1OFCX 3KETA 1FEXA 3LQRA 1YOVB 3R0AA 3CZ6A 1APLC 3K10A 1I39A 3JCUC 3BJOA 5IP9J 3W2WA 2IVMA 4BEHA 3HPHA 1HSJA 3I59B 4NC6A 2G9WA 3SFIA 1AKHB 5FFXA 2VE9A 3KP5A 3ABLH 1W5CC 2XIGA 3C3WA 4UUVA 2COBA 1AHDP 1XSXA 1QRYA 4FQGA 5FO5A 4RLFA 1FYLA 1MD0A 3BR3A 5CYVA 2HKOA 2V26A 1V4RA 1WJDA 2WV0A 3FWEA 3W3CA 1LE8A 3I71A 3RKWA 1VQ5I 3FXMA 2FBHA 1MBGA 5D5VB 5GP9A 2RVCA 1ITYA 4EGZA 4CICA 5LEJA 4A3JJ 3E3VA 4N9IA 5FJ8J 1UZCA 2P7CB 4W1UA 4MEYF 1UMQA 2LY1A 4ZYDA 3BR5A 2VJJA 3IWFA 2WWYA 1TQMA 1QU3A 4U0VA 2Y0SN 1UHWA 3WTWC 3G73A 3NQOA 2X4HA 2XB0X 2PEXA 3LNQA 3NARA 2VJ5A 4NC7A 1J09A 3KYCB 2A68F 3OSGA 2DO7A 2FQ4A 3CCEI 2UUZA 3DBLB 3GZNB 3S3NA 2NXNB 2OQRA 4JBAA 2QZ8A 4V2GA 1R49A 2LG4A 3BTLA 1D1BA 3QPLA 5LHGA 3GLLA 2FBKA 1F9NA 3JTHA 3ZP5A 1JKOC 1SC7A 3A0HC 4XSZF 3CCQI 3RI4A 2K9MA 4RM2A 5H2FC 1P92A 1FTTA 2HWVA 4G94A 1DU6A 3QYBA 5A2QK 3MZHA 1Y56A 4IJAA 3I0TA 4CXFA 4ZJZA 3DEEA 3BR1A 3K4JA 3CCLI 2O8XA 3GYHX 1NH3A 1Z9CA 3S2DJ 1T08B 3KP4A 4D0PA 3F8FA 1FBSA 5HLIA 2EFWA 1T0FA 3LA7A 2V1XA 4RS8A 1IRFA 3L1PA 1MMNA 3KIOA 2DMPA 1S7AA 1BC7C 5DEQA 1RKWA 4AIDA 2K4JA 3R4KA 4I2OA 1JUPA 2XRLA 2PI0A 3JREA 3BPXA 4RAFA 3E6CC 1ZHFA 3J80K 5HODA 3CO7C 4II3A 1U5TB 3OR2C 3PSFA 4XIDA 3DEUA 1MNDA 2F6CA 3LSRA 3K9TA 1XSVA 3WU1B 1RI7A 4U7DA 3ESWB 4KYWA 1MBFA 2HOSA 2RN7A 4E7JA 5KNLA 2HVQA 1Y8QB 2PJPA 1MJ9A 1ZYRF 5K1YA 3OYHA 2HFHA 3ABTA 1ERDA 4OINF 4BU2A 4UNOA 3GTKJ 4RB3C 1HF0A 1VQ4I 3DPUA 2CWEA 3EDPA 5IOYA 3G4SI 1UELB 2WAQA 4GXOA 1TT0A 4DJAA 3RKQA 4F55A 2KZVA 1F4KA 2VXZA 1T2KA 2WADA 2A3SA 3RZOJ 4ESFA 5FLMJ 4OIQF 5FLXZ 2O7OA 2VOOA 2ELHA 2DPDA 4NHJA 4IHWA 2RNGA 2DU9A 1GUUA 1PVEA 2PBIA 1DUXC 3RCOA 1T6SA 2R5YB 3L00A 3OR1C 3D5LA 3ZMUA 1RPWA 5HNHA 1K4TA 4BUPA 5JFRA 1J7KA 3PQKA 2D1VA 1YITI 2HDDA 3KFWX 1VQLI 1Q1HA 2RKHA 5D8KB 1B8IA 1TWAJ 2CFOA 3S1RJ 3CCYA 3LOCA 5D6FA 2GZWA 3GMEA 2EZIA 5K5QA 2CW0F 1HKTA 2BEOA 3IAS2 1UHMA 1QZZA 1F43A 4UY8I 2MG4A 3BJ6A 4P96A 3S17J 5K5OA 3H5AA 1N75A 2R4GA 3DPLC 3FXOA 3HOVJ 3WE2A 4BE0A 3M3YJ 4A3LJ 2RNJA 2QCOA 2P5VA 3LWFA 4PJMA 1S8NA 3HUGA 5D8LB 3PQJA 2VI6A 4M6VA 3ECOA 4O6JA 2EFQA 2H1LA 2WB1A 1W36D 1AA7A 2NVXJ 4OOIA 2JA8J 2FUG2 2HQNA 3FM3A 2GXGA 3EUHA 2JJ7A 3ZN0A 1XGSA 2MFZA 2ME6A 5FD6A 1TWCJ 3HOZJ 2VKHA 3CMAI 3MVPA 2IA0A 3Q0VA 3LSPA 1JKPC 5DM7F 4M9ZA 1ZARA 2QQAA 4MQVA 3CF5F 3OIOA 2EV5A 3LSMA 2DMQA 3GX4X 3K70D 2UWMA 5J4VA 4XRMA 2IT0A 2HR3A 2ZXJA 2KIQA 3DKXA 5EEHA 2OJED 4BJTA 1YX3A 3EYYA 2KKOA 4AVZA 4IHXA 3K4MA 4G7ZF 3SXYA 1MDMB 3I4MJ 1OQYA 1N77A 5E3LA 1JTYA 3ZRGA 2QVOA 3CJNA 1RKTA 2M1BA 1Z67A 3JRCA 1JGSA 1X2NA 4HA8A 2WAFA 3H3ZA 3WGIA 4XNFA 1MBEA 1QNTA 2TDXA 3Q0UA 2M7BA 4V2FA 2IGMA 3GFIA 4XBFA 5FKKA 2DMUA 5E3NA 3HDDA 1J2XA 4G6QA 1A04A 3PSIA 1LFBA 2FMLA 4G8XA 3ZMTA 1ZLKA 5JI6A 2M3AA 4IHVA 1QVTA 1LDKB 1X1BA 1ZN2A 3FXJA 4A3DJ 4MLOA 2DN0A 1SAXA 2NOJB 2V9VA 3HOXJ 1R71A 4L0YB 2CU7A 2L7MP 2GIZA 4AYBN 3Q3SA 4E4HA 4XQFA 3PM1A 1QVUA 2EJRA 3QYFA 3S16J 2FRHA 4DIQA 3QP5A 2KL4A 2OQGA 1D8KA 1I50J 2R5ZB 1B4AA 4L5JA 3ULQB 2IA2A 2BXZA 2FXAA 5EGOB 2X6WA 3S93A 2M7AA 4RGUA 3WE3A 3CF2A 1L0OC 2IS2A 4A3KJ 1MNEA 2FE3A 4IO9F 1VQ7I 3OOPA 2IGNA 2RAEA 5FKOA 1XG1A 3OYAA 2M30A 2OZUA 4E6KG 1NK3P 3HTSB 4FTHA 1O3QA 3WTVC 2H1KA 2Q2EB 2ESNA 3ELKA 1ON1A 4NNJA 3JR9A 3QOEA 5JHUA 1XDUA 3GVAA 1K4SA 1PDNC 3EQLF 1T98A 2RDPA 4HNUA 1SVLA 2ZSHB 1BI1A 5KAIC 5AIQA 2W48A 5E1WA 1H9GA 4UV9A 3L2WA 5EZHA 4E7HA 4B43A 3QYEA 4ZYEA 3WG9A 4XOPA 3RIRA 4Z6YA 5DDGA 2GXBA 1FP2A 2K7LA 4C3HJ 3HYIA 4KITB 5IPAA 1T39A 1BI3A 4JYKA 3IKTA 5LGTA 5E79C 5F1JA 4L0ZB 1LDDA 1A31A 3CD6I 4N9HA 1JJ8C 2VUMJ 3A0BC 4E70A 1A35A 3RDIA 1BW5A 1HA8A 2E1MC 2AHQA 5TRDA 2R7XA 1DP3A 2KIUA 1WKMA 5HS7A 2HZTA 1SD7A 1MMSA 1U8RA 1QHHD 4KFCA 1W0UA 2ZMEA 1IAWA 2E2HJ 1WHUA 1MBHA 1YS7A 3BQZA 4RGRA 4NB5A 3E6BA 4R1HA 1KU2A 3OS0A 1WJEA 2CJJA 2F4MB 2VBXA 3RQ4A 3BZCA 1U6GA 3E5QA 4EJTA 3OY9A 4ZDLA 2PLYA 4IHSA 1Z1DA 2FU4A 2GOMA 4HF1A 1SEUA 1NG7A 2M9HA 2V1UA 4ESJA 3S3MA 3BDDA 2DQRA 4ZYAA 3H92A 2NYXA 4RAYA 1YQAA 4F92B 3L2UA 3VEPA 3V8LA 1WJCA 1QGPA 1D0YA 5JVTA 1J9IA 1K78A 1H0MA 1HDPA 3AG4H 3I64A 4PSWA 3MFKA 3MD2A 2QM3A 1IF1A 1J75A 5E1XA 3HHGA 4F91B 3MKLA 1YFHA 2FBIA 4G7OF 2GAUA 2HTJA 3BROA 3P9KA 2CW7A 4GYIA 1W0TA 2FX0A 3M1EA 5D4SA 5LHHA 2X9DA 2WY7Q 5FLXK 3JW4A 2EH3A 3KLOA 3OS1A 2L9RA 2OU2A 3RJPA 4ZZDA 1JXSA 2JRTA 5BS6A 2L54A 1JKQC 3UNGC 2BGCA 3VSLA 4KISA 3H36A 2EZLA 4LG0A 1EKEA 3OYJA 4LB5A 3K1MA 1R7JA 1S6LA 1MGTA 4FASD 3L09A 2YX7A 2XV4S 5J1YA 4OMYA 2VKDA 1XDSA 4ZC3A 4HSTA 3CLQA 4P5OA 4KT6A 3I5UA 5M3MJ 4HF0A 5A2QZ 2NVUB 2V6CA 1MJBA 2EWNA 5JR3A 3HSRA 2WAQN 3S3OA 4A2UA 3PNVA 4UUSB 2VL8A 3WG7H 2CUEA 2NRAC 1E17A 1B1BA 3M8FA 3W2VA 1SFEA 4GFBA 4IF4A 2PJRA 3A01B 4XRSA 2E2IJ 2MGQA 1YI2I 3QWLA 2KZGA 3IAM2 3KLNA 4WF2A 2ID6A 3R60A 1TP4A 1S29A 4XKBA 4LFUA 1G3SA 1IW7F 3ABMH 3M07A 3J80Z 1SFXA 4ZYGA 1JT6A 2V79A 2MH9A 1Z21A 2OA4A 1QZEA 1ETQA 1SFOJ 4MFEA 2XAFA 2F5FA 2XC7A 5F64A 2ZO4A 2GM4A 1XGMA 3DP7A 3FXUA 4RAGA 4LIVA 3PO3J 2HYJA 3I54A 1R00A 3HZJA 3TO9A 5DTDA 4EEFG 4BHPA 1C0WA 3CJTB 3DKWA 5LD2C 3KYLA 3R6SA 1RRJA 3A1YA 3F9KA 3ZMSA 1ZG3A 3FHZA 1W4MA 3HHHA 1ORKA 1O4XA 2E60A 3DFGA 4QSHA 4BBRJ 1XX5A 4XK4A 4S0HB 2ME0A 3BG3A 4CYCB 1U8BA 2NVYJ 2LRDA 2ECCA 5AONA 4JX5A 2E1CA 2WB1N 3F23A 3HM5A 5LFAA 4GO1A 5AIPA 2XROA 2XB5A 2DW4A 3BCAA 5F0HA 2BY2A 1XSDA 3IRRA 2OD5A 2BVMA 2DOFA 1Z6RA 2FD5A 3HSEA 3BTCA 3OYBA 5ILSA 3MN2A 3OIQA 2R7FA 3O6BB 4WX9A 4WXHA 2O5RA 3BZKA 2BW3A 1V55H 2A5YB 4A5NA 1KZHA 4BEHB 3S1QJ 2B0LA 1X1CA 4WXDA 3WTTC 4ASNA 4PCQA 2JTVA 1R5ID 5B66C 3TW7A 2RQPA 3BOQA 1KU9A 2AXTC 5E8GA 4HF2A 3QPSA 1MBJA 1WGXA 3CUOA 1FY7A 2P6SA 4I6ZA 4L9NA 2XUBA 1WZ2A 2QEXI 3ZQFA 3J7YJ 3FISA 3FMQA 4B1RA 3RKXA 1LE8B 2M45A 2M0CA 3Q9VA 3VFZA 2GIVA 3P9IA 2CQ7A 5LBQA 3M4OJ 1O57A 2BV6A 4A3IJ 3FBIB 4AVPA 2LBFA 3ERED 1X1PA 2D5VA 4IPAA 5GAHJ 2LVSA 1L3LA 4XSXF 2N8GA 2IRFG 3OIPA 1R4MB 3FF5A 5K5RA 1B59A 1K83J 3MZ8A 2ACJA 1P7JA 2AO9A 4ESBA 5CVJA 4RGXA 2HXIA 1VQMI 3ISPA 3H9JA 3IL2A 4RGSA 1ETXA 1UAAA 2EA4A 2DDAA 3SDBA 3VYRB 2QBYA 3MMYB 3K1PA 1EH6A 5M5XJ 1GXQA 1SFUA 1IC8A 9ANTA 2HPMA 2RGVA 3KEQA 2O0YA 1BIBA 5EG0B 3L2RA 5HS8A 5DD4A 1IRXA 4RBOA 2ZSIB 4HW0A 4S04A 1ZREA 1RETA 1D1AA 1CF7A 1D0ZA 3E6MA 3DLAA 1LJ9A 3KP3A 4FT8A 4UV8A 1RIOH 2VBZA 4HG2A 5EEAA 2LC2A 4U7BA 1V54H 3QP6A 3JRDA 2R7ZJ 4BXXJ 1A5JA 3DXJF 2FMYA 3CDHA 1OKRA 4NC8A 3MKWB 2DAOA 5J4YA 2X6YA 1OISA 4O3MA 3GXOA 3RPUD 3KP6A 4B44A 2QWWA 2QQ8A 1E0EA 3K69A 4O5VA 2I8DA 2H09A 3OYDA 1PUFA 1LB2A 4C2UA 4HSRA 2P5KA 3ZGKA 1X2MA 3T1BA 3H0DA 4CHUA 2DT7B 1IO2A 3DPTA 5D5UB 2NNYA 2FQ3A 2BHZA 3LSHA 4P1WA 2QSGX 2R93J 4BBSJ 2VPRA 3KP7A 2EFNA 4YG2F 4XOTA 3WGHA 1ZGWA 2CV2A 4CCNA 3W6KB 2ZJPF 3O2PE 3K2ZA 3WHCA 3K6GA 1S72I 2CGPA 5JLWA 3DTEA 2W7NA 2HXOA 5HVQC 4ETSA 2ZJ2A 5B5EC 3H3UA 3HC7A 3WTZA 4LGWA 2P8TA 2VC1A 5EJCA 4BQQA 3P9CA 2IS6A 1I6XA 2LREA 4HV6A 2EZHA 1S7OA 4DYCA 5B1AH 1PYVA 4KNYA 4IOCF 2EIMH 1WCMJ 4K2EA 1W36C 2CQXA 2NS8A 3QOPA 2DJNA 2R0QC 3DKYA 3I3LA 1RR8C 1REPC 3I55I 1FOKA 3WU2C 3LSJA 4OMZA 3PNYA 3J7AY 2O03A 3TGNA
chains in the Genus database with same CATH topology
3E7LA 3OIOA 2HOAA 4I76A 1LFUP 2DMQA 2GLOA 1FIPA 4XRMA 2P81A 1MSFC 2LD5A 3FKIJ 3BT9A 3PO2J 4IHXA 2DA7A 2DA4A 3G1LA 4D5CA 3HOUJ 3I4MJ 5E3LA 1JTYA 2G0EA 4A69C 2O9LA 2LLKA 3WHBA 5IP6A 1RKTA 4RDUA 3JRCA 1H88C 1ETOA 1X2NA 4DZPA 1MH3A 1Z0XA 2NVQJ 1MBEA 4MIMA 1YRNB 3Q0UA 1GV2A 4V2FA 3SDGA 3D1NI 1NTCA 5FKKA 2DMUA 5E3NA 3HDDA 1H8AC 1H89C 3JRBA 3LSGA 1JGGA 1LFBA 4IHVA 4FE7A 3ZQHA 3OOUA 2E2JJ 1GVDA 1QVTA 4DYRA 1U78A 3HBLA 4A3DJ 4MLOA 2DN0A 2DMTA 3C2BA 1WH5A 1BA5A 3HOXJ 1IDZA 2CU7A 2L7MP 1Z77A 4A3CJ 4AYBN 1HCRA 3Q3SA 3GTMJ 3PM1A 3UKGA 1QVUA 2K9QA 1DU0A 3JRGA 3S16J 4FCYA 5EZGA 3ZQLA 3BR0A 1I50J 1POGA 2R5ZB 2Y31A 1BL0A 1ZTRA 1S7EA 2M8GX 5EGOB 4X6AJ 5J1UA 4CYCA 4A3EJ 1EF4A 4A3KJ 5F0FA 5M5WJ 2K9SA 2LK2A 1B72A 2RAEA 3HGGA 2MW8A 5FKOA 1XG1A 1TWFJ 3TP0A 4J19A 1MH4A 1GT0C 1NK3P 4A3GJ 4M3DA 3H3VK 5IYBJ 4FTHA 2H1KA 2DA1A 3JR9A 4M3FA 1I3QJ 3ZQIA 2X6OA 1WPKA 3GTGJ 1U9NA 4FE4A 1JT0A 4A3BJ 2VKVA 1IGNA 4DZJA 2QF7A 2W48A 1JTXA 1ZQ3P 1U9OA 4BY1J 2YS9A 4X1EA 4C3JJ 1MSEC 1ETKA 5EZHA 3JRFA 2JA7J 3F0CA 1RR7A 5FKNA 4C3HJ 2LY9A 5IPAA 2HOTA 1IDYA 5M3FJ 2OPTA 2VKEA 4JYKA 1FJLA 5FKMA 5K7FA 4JX4A 5F1JA 1JJ8C 2VUMJ 2JA6J 3FK7A 3Q0WA 4B4CA 2KDZA 1BW5A 1ZR2A 4XRSG 2AHQA 1UG2A 2JK3A 3HKZN 3TP3A 3BG5A 3GBGA 1W0UA 3BR6A 4DW6A 1B72B 2M34A 2E2HJ 2EZKA 1MBHA 3BQZA 1PUFB 2ZB9A 2L7ZA 2NOGA 4QTRA 2CJJA 5IYCJ 3BG9A 5JLXA 3BR2A 5DS9A 4JX6A 2MSYA 3K2AA 2Y30A 1BW6A 1UHSA 2XGEA 2XGCA 1B8IB 3CMYA 2M9HA 1IV6A 4Y7NJ 3H0GJ 2K40A 3IV5A 1Y1VJ 1F36A 1A6IA 5J1RA 1QPIA 1XS9A 1JUMA 1OJLA 3JRHA 4Y52J 1VFCA 3JRAA 4C2MJ 2LP0A 2L7FP 4UUTA 2K9NA 4UUSA 4A3MJ 1HDPA 1JJ6C 2DA3A 5EG0A 3DCFA 5J3LA 5GPCA 3A01A 3S15J 1VF9A 3HOYJ 3MKLA 4D7NA 3TW6A 5C44J 1Q1VA 1W0TA 2FX0A 5M5YJ 1CQTA 2X9DA 4BY7J 2EH3A 1SANA 3A02A 2ECBA 2H8RA 3DEWA 1I6HJ 1JKRC 2L9RA 5K7HA 3GTJJ 1JKQC 3IH3A 1ZK8A 1ETYA 1AKHA 1T33A 3I4NJ 2JWTA 2EZLA 1NK2P 5J1YA 2NVTJ 3S1MJ 2O8KA 5IP7J 1K61A 3S1NJ 1GDTA 2B63J 2CQQA 5M3MJ 5F08A 1ENHA 3TEDA 1VI0A 2DA6A 4DYQA 2WAQN 4M3EA 4UUSB 2JMWA 2LFBA 2PMZN 2CUEA 5EF6A 3IH2A 1X58A 4GFBA 3A01B 4XRSA 2E2IJ 2MGQA 3ZOBA 4XICA 5IOZA 1FIAA 2ID6A 1BJZA 4D7MA 4FISA 1G2HA 3BTJA 3GTOJ 2IAIA 2EBIA 1OFCX 1JT6A 1HDDC 1FEXA 2X48A 5K7ZA 2LKXA 1APLC 2CUFA 1XC5A 3HOWJ 3FK6A 1ETQA 1SFOJ 5IP9J 4MFEA 4IEJA 2I10A 3A03A 1ZKGA 3SFIA 1AKHB 2GM4A 2YUSA 4LOCA 3PO3J 2HYJA 4A93J 5DTDA 1E3OC 4EEFG 2COBA 3O8GA 2Y2ZA 1AHDP 5F0CA 2GBYA 1QRYA 4A3FJ 2HI3A 3BR3A 3SJMA 1LE8A 1ORKA 1O4XA 4BBRJ 4QSHA 4XK4A 4S0HB 1TC3C 2ME0A 3BG3A 4CYCB 1U8BA 2NVYJ 3GTLJ 1MBGA 2DA2A 4IHYA 5GP9A 1ITYA 1WI3A 2ECCA 3K7AJ 4JX5A 2WB1N 3HM5A 4A3JJ 2EQRA 4ABZA 2XB5A 4MO7A 4AUXA 5FJ8J 1TWHJ 5F0HA 1Y1WJ 4W1UA 1IRZA 4MFDA 1AU7A 1UMQA 2FD5A 3BR5A 3BTCA 1P7IA 2TCTA 2Y0SN 3MN2A 5C3EJ 1R9TJ 2YU9J 2XB0X 3HEFA 2OF7A 4M3GA 3NARA 3LNQA 1HOMA 3RQIA 3OSGA 2FQ4A 2FJ1A 3S1QJ 4B3AA 2XGDA 1VNDA 4V2GA 3QPLA 3BTLA 3TW7A 3CQZJ 5E3MA 2HQ5A 3GTPJ 3B6CA 3QPSA 1MBJA 1WGXA 1JKOC 2TRTA 3ZQCA 4I6ZA 2XSDC 4W97A 1FTTA 2IEKA 3B6AA 3ZQFA 1DU6A 3O8HA 3FISA 4B1RA 1TWGJ 1LE8B 2M0CA 2R5ZA 5C4XJ 3BR1A 4M3BA 3M4OJ 4A3IJ 5GPAA 1IUFA 5EGOA 1MNMC 3S2DJ 3W6VA 2D5VA 2LVSA 2NS7A 2N8GA 2E19A 3L1PA 4C3IJ 4QIWN 5FLVA 2DMPA 2R5YA 1RKWA 1D5YA 2R92J 1K83J 2JN6A 1JUPA 2XRLA 1P7JA 2AO9A 3JREA 3G1OA 3JRIA 2HXIA 3RZDJ 2DA5A 5HODA 4XIDA 3OSFA 2Y9ZA 5EDNA 5F04A 1ETXA 3LSRA 5BNGA 1MBFA 2HOSA 2ELKA 3NAUA 5M5XJ 2IBDA 1IC8A 9ANTA 5EG0B 4RBOA 1HLVA 3GTKJ 3BQYA 3FIWA 1RETA 1HF0A 3S14J 5IOYA 5EYRA 3ZQGA 3CDLA 3RKQA 5EEAA 3VPRA 3JRDA 2R7ZJ 2JA5J 4BXXJ 1A5JA 3RZOJ 1GV5A 2LTPA 5FLMJ 2Y9YA 2O7OA 2M2EA 3HGYA 4IHWA 1FTZA 1GUUA 5FKLA 1ZR4A 2R5YB 1PUFA 1RPWA 1X2MA 2E1OA 1ETWA 2HDDA 4L5EA 2R93J 1OCTC 1MBKA 4BBSJ 2VPRA 1B8IA 1TWAJ 3QQAA 1ETVA 2L0KA 3S1RJ 3CCYA 3LOCA 5E3OA 1JUSA 1IJWC 2EZIA 1ZGWA 2DMNA 2XPVA 3GTQJ 1F43A 2MG4A 3WHCA 5JLWA 3S17J 2HXOA 2WV1A 1WH7A 3HOVJ 2LR8A 4AC0A 3M3YJ 4A3LJ 2QCOA 1IG7A 3IH4A 5F27A 4G12A 3BTIA 2VI6A 4M6VA 4BKXA 1YRNA 2EZHA 2JA8J 4DYCA 2NVXJ 4HNVA 2KT0A 4JP0A 2XPWA 1WCMJ 2CQXA 1T56A 2DTZA 4NDLA 4D5FA 2JJ7A 5C4JJ 2NS8A 2ID3A 2ME6A 1RESA 1TWCJ 3HOZJ 2DJNA 2R0QC 3MVPA 3Q0VA 3LSPA 2XPUA 1JKPC 3HB9A 3LSJA 5IYDJ 2CRGA 3S2HJ 1OCPA 3G1MA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3E7L A;  3OIO A;  2HOA A;  4I76 A;  1LFU P;  2DMQ A;  2GLO A;  1FIP A;  4XRM A;  2P81 A;  1MSF C;  2LD5 A;  3FKI J;  3BT9 A;  3PO2 J;  4IHX A;  2DA7 A;  2DA4 A;  3G1L A;  4D5C A;  3HOU J;  3I4M J;  5E3L A;  1JTY A;  2G0E A;  4A69 C;  2O9L A;  2LLK A;  3WHB A;  5IP6 A;  1RKT A;  4RDU A;  3JRC A;  1H88 C;  1ETO A;  1X2N A;  4DZP A;  1MH3 A;  1Z0X A;  2NVQ J;  1MBE A;  4MIM A;  1YRN B;  3Q0U A;  1GV2 A;  4V2F A;  3SDG A;  3D1N I;  1NTC A;  5FKK A;  2DMU A;  5E3N A;  3HDD A;  1H8A C;  1H89 C;  3JRB A;  3LSG A;  1JGG A;  1LFB A;  4IHV A;  4FE7 A;  3ZQH A;  3OOU A;  2E2J J;  1GVD A;  1QVT A;  4DYR A;  1U78 A;  3HBL A;  4A3D J;  4MLO A;  2DN0 A;  2DMT A;  3C2B A;  1WH5 A;  1BA5 A;  3HOX J;  1IDZ A;  2CU7 A;  2L7M P;  1Z77 A;  4A3C J;  4AYB N;  1HCR A;  3Q3S A;  3GTM J;  3PM1 A;  3UKG A;  1QVU A;  2K9Q A;  1DU0 A;  3JRG A;  3S16 J;  4FCY A;  5EZG A;  3ZQL A;  3BR0 A;  1I50 J;  1POG A;  2R5Z B;  2Y31 A;  1BL0 A;  1ZTR A;  1S7E A;  2M8G X;  5EGO B;  4X6A J;  5J1U A;  4CYC A;  4A3E J;  1EF4 A;  4A3K J;  5F0F A;  5M5W J;  2K9S A;  2LK2 A;  1B72 A;  2RAE A;  3HGG A;  2MW8 A;  5FKO A;  1XG1 A;  1TWF J;  3TP0 A;  4J19 A;  1MH4 A;  1GT0 C;  1NK3 P;  4A3G J;  4M3D A;  3H3V K;  5IYB J;  4FTH A;  2H1K A;  2DA1 A;  3JR9 A;  4M3F A;  1I3Q J;  3ZQI A;  2X6O A;  1WPK A;  3GTG J;  1U9N A;  4FE4 A;  1JT0 A;  4A3B J;  2VKV A;  1IGN A;  4DZJ A;  2QF7 A;  2W48 A;  1JTX A;  1ZQ3 P;  1U9O A;  4BY1 J;  2YS9 A;  4X1E A;  4C3J J;  1MSE C;  1ETK A;  5EZH A;  3JRF A;  2JA7 J;  3F0C A;  1RR7 A;  5FKN A;  4C3H J;  2LY9 A;  5IPA A;  2HOT A;  1IDY A;  5M3F J;  2OPT A;  2VKE A;  4JYK A;  1FJL A;  5FKM A;  5K7F A;  4JX4 A;  5F1J A;  1JJ8 C;  2VUM J;  2JA6 J;  3FK7 A;  3Q0W A;  4B4C A;  2KDZ A;  1BW5 A;  1ZR2 A;  4XRS G;  2AHQ A;  1UG2 A;  2JK3 A;  3HKZ N;  3TP3 A;  3BG5 A;  3GBG A;  1W0U A;  3BR6 A;  4DW6 A;  1B72 B;  2M34 A;  2E2H J;  2EZK A;  1MBH A;  3BQZ A;  1PUF B;  2ZB9 A;  2L7Z A;  2NOG A;  4QTR A;  2CJJ A;  5IYC J;  3BG9 A;  5JLX A;  3BR2 A;  5DS9 A;  4JX6 A;  2MSY A;  3K2A A;  2Y30 A;  1BW6 A;  1UHS A;  2XGE A;  2XGC A;  1B8I B;  3CMY A;  2M9H A;  1IV6 A;  4Y7N J;  3H0G J;  2K40 A;  3IV5 A;  1Y1V J;  1F36 A;  1A6I A;  5J1R A;  1QPI A;  1XS9 A;  1JUM A;  1OJL A;  3JRH A;  4Y52 J;  1VFC A;  3JRA A;  4C2M J;  2LP0 A;  2L7F P;  4UUT A;  2K9N A;  4UUS A;  4A3M J;  1HDP A;  1JJ6 C;  2DA3 A;  5EG0 A;  3DCF A;  5J3L A;  5GPC A;  3A01 A;  3S15 J;  1VF9 A;  3HOY J;  3MKL A;  4D7N A;  3TW6 A;  5C44 J;  1Q1V A;  1W0T A;  2FX0 A;  5M5Y J;  1CQT A;  2X9D A;  4BY7 J;  2EH3 A;  1SAN A;  3A02 A;  2ECB A;  2H8R A;  3DEW A;  1I6H J;  1JKR C;  2L9R A;  5K7H A;  3GTJ J;  1JKQ C;  3IH3 A;  1ZK8 A;  1ETY A;  1AKH A;  1T33 A;  3I4N J;  2JWT A;  2EZL A;  1NK2 P;  5J1Y A;  2NVT J;  3S1M J;  2O8K A;  5IP7 J;  1K61 A;  3S1N J;  1GDT A;  2B63 J;  2CQQ A;  5M3M J;  5F08 A;  1ENH A;  3TED A;  1VI0 A;  2DA6 A;  4DYQ A;  2WAQ N;  4M3E A;  4UUS B;  2JMW A;  2LFB A;  2PMZ N;  2CUE A;  5EF6 A;  3IH2 A;  1X58 A;  4GFB A;  3A01 B;  4XRS A;  2E2I J;  2MGQ A;  3ZOB A;  4XIC A;  5IOZ A;  1FIA A;  2ID6 A;  1BJZ A;  4D7M A;  4FIS A;  1G2H A;  3BTJ A;  3GTO J;  2IAI A;  2EBI A;  1OFC X;  1JT6 A;  1HDD C;  1FEX A;  2X48 A;  5K7Z A;  2LKX A;  1APL C;  2CUF A;  1XC5 A;  3HOW J;  3FK6 A;  1ETQ A;  1SFO J;  5IP9 J;  4MFE A;  4IEJ A;  2I10 A;  3A03 A;  1ZKG A;  3SFI A;  1AKH B;  2GM4 A;  2YUS A;  4LOC A;  3PO3 J;  2HYJ A;  4A93 J;  5DTD A;  1E3O C;  4EEF G;  2COB A;  3O8G A;  2Y2Z A;  1AHD P;  5F0C A;  2GBY A;  1QRY A;  4A3F J;  2HI3 A;  3BR3 A;  3SJM A;  1LE8 A;  1ORK A;  1O4X A;  4BBR J;  4QSH A;  4XK4 A;  4S0H B;  1TC3 C;  2ME0 A;  3BG3 A;  4CYC B;  1U8B A;  2NVY J;  3GTL J;  1MBG A;  2DA2 A;  4IHY A;  5GP9 A;  1ITY A;  1WI3 A;  2ECC A;  3K7A J;  4JX5 A;  2WB1 N;  3HM5 A;  4A3J J;  2EQR A;  4ABZ A;  2XB5 A;  4MO7 A;  4AUX A;  5FJ8 J;  1TWH J;  5F0H A;  1Y1W J;  4W1U A;  1IRZ A;  4MFD A;  1AU7 A;  1UMQ A;  2FD5 A;  3BR5 A;  3BTC A;  1P7I A;  2TCT A;  2Y0S N;  3MN2 A;  5C3E J;  1R9T J;  2YU9 J;  2XB0 X;  3HEF A;  2OF7 A;  4M3G A;  3NAR A;  3LNQ A;  1HOM A;  3RQI A;  3OSG A;  2FQ4 A;  2FJ1 A;  3S1Q J;  4B3A A;  2XGD A;  1VND A;  4V2G A;  3QPL A;  3BTL A;  3TW7 A;  3CQZ J;  5E3M A;  2HQ5 A;  3GTP J;  3B6C A;  3QPS A;  1MBJ A;  1WGX A;  1JKO C;  2TRT A;  3ZQC A;  4I6Z A;  2XSD C;  4W97 A;  1FTT A;  2IEK A;  3B6A A;  3ZQF A;  1DU6 A;  3O8H A;  3FIS A;  4B1R A;  1TWG J;  1LE8 B;  2M0C A;  2R5Z A;  5C4X J;  3BR1 A;  4M3B A;  3M4O J;  4A3I J;  5GPA A;  1IUF A;  5EGO A;  1MNM C;  3S2D J;  3W6V A;  2D5V A;  2LVS A;  2NS7 A;  2N8G A;  2E19 A;  3L1P A;  4C3I J;  4QIW N;  5FLV A;  2DMP A;  2R5Y A;  1RKW A;  1D5Y A;  2R92 J;  1K83 J;  2JN6 A;  1JUP A;  2XRL A;  1P7J A;  2AO9 A;  3JRE A;  3G1O A;  3JRI A;  2HXI A;  3RZD J;  2DA5 A;  5HOD A;  4XID A;  3OSF A;  2Y9Z A;  5EDN A;  5F04 A;  1ETX A;  3LSR A;  5BNG A;  1MBF A;  2HOS A;  2ELK A;  3NAU A;  5M5X J;  2IBD A;  1IC8 A;  9ANT A;  5EG0 B;  4RBO A;  1HLV A;  3GTK J;  3BQY A;  3FIW A;  1RET A;  1HF0 A;  3S14 J;  5IOY A;  5EYR A;  3ZQG A;  3CDL A;  3RKQ A;  5EEA A;  3VPR A;  3JRD A;  2R7Z J;  2JA5 J;  4BXX J;  1A5J A;  3RZO J;  1GV5 A;  2LTP A;  5FLM J;  2Y9Y A;  2O7O A;  2M2E A;  3HGY A;  4IHW A;  1FTZ A;  1GUU A;  5FKL A;  1ZR4 A;  2R5Y B;  1PUF A;  1RPW A;  1X2M A;  2E1O A;  1ETW A;  2HDD A;  4L5E A;  2R93 J;  1OCT C;  1MBK A;  4BBS J;  2VPR A;  1B8I A;  1TWA J;  3QQA A;  1ETV A;  2L0K A;  3S1R J;  3CCY A;  3LOC A;  5E3O A;  1JUS A;  1IJW C;  2EZI A;  1ZGW A;  2DMN A;  2XPV A;  3GTQ J;  1F43 A;  2MG4 A;  3WHC A;  5JLW A;  3S17 J;  2HXO A;  2WV1 A;  1WH7 A;  3HOV J;  2LR8 A;  4AC0 A;  3M3Y J;  4A3L J;  2QCO A;  1IG7 A;  3IH4 A;  5F27 A;  4G12 A;  3BTI A;  2VI6 A;  4M6V A;  4BKX A;  1YRN A;  2EZH A;  2JA8 J;  4DYC A;  2NVX J;  4HNV A;  2KT0 A;  4JP0 A;  2XPW A;  1WCM J;  2CQX A;  1T56 A;  2DTZ A;  4NDL A;  4D5F A;  2JJ7 A;  5C4J J;  2NS8 A;  2ID3 A;  2ME6 A;  1RES A;  1TWC J;  3HOZ J;  2DJN A;  2R0Q C;  3MVP A;  3Q0V A;  3LSP A;  2XPU A;  1JKP C;  3HB9 A;  3LSJ A;  5IYD J;  2CRG A;  3S2H J;  1OCP A;  3G1M A; 
#chains in the Genus database with same CATH topology
 2CS3 A;  2JVH A;  2DLL A;  1FIP A;  2DI3 A;  2QKL B;  2ZXW H;  3SZG A;  2VAS A;  3HOT A;  1KON A;  2ZFU A;  2CUJ A;  1B9M A;  1ZLJ A;  4GYG A;  4XLE A;  3OS2 A;  3K70 C;  1IRG A;  1Y8R B;  3OV8 A;  1TQI A;  2CMP A;  1IXS B;  2OBP A;  1MMD A;  1STZ A;  2RC4 A;  4RLQ A;  3R61 A;  3FXK A;  4R8H A;  3MKZ A;  2ZBK A;  2A69 F;  3C2H A;  4L9T A;  1SVO A;  4A69 C;  2HQR A;  2O9L A;  2LLK A;  3L2V A;  2FNA A;  1G8X A;  3WHB A;  2WC2 A;  1H88 C;  5JHF A;  4DZP A;  1LPQ A;  5KVR A;  2OC6 A;  2MD0 A;  2G7H A;  3FMR A;  1ZG1 A;  1FT9 A;  3BG6 A;  1YW7 A;  1NHA A;  2WAE A;  1X4P A;  1R58 A;  3LA3 A;  4EJW A;  3ZMD A;  1AWC A;  2BY0 A;  5ED4 A;  4ZH4 F;  3MAJ A;  4FE7 A;  3K0L A;  3OOU A;  5ICF A;  3ZQH A;  2D1H A;  2VJ4 A;  4UB8 C;  1MZB A;  3G2B A;  3FKJ A;  2ZJQ F;  4Y33 A;  1FMV A;  1Z77 A;  2HQA A;  1HCR A;  3LST A;  3OWT A;  2XHK A;  4Y3O A;  4XLH A;  2JSC A;  2IJL A;  2JZY A;  4BQO A;  3CUQ A;  2OUM A;  4CCL A;  3CC7 I;  4V19 K;  2W24 A;  4FCY A;  3ML6 A;  1H9T A;  2JRM A;  5J47 A;  2QQ9 A;  2Y31 A;  3V8J A;  1BL0 A;  2W57 A;  3CMM A;  2QGU A;  1Z91 A;  2GA2 A;  3F3X A;  2EFO A;  2M8G X;  4XON A;  4A0Y A;  2BYV E;  1MMA A;  2KRC A;  4X6A J;  3HOS A;  1EF4 A;  1DPR A;  3IHU A;  3ERM A;  2F5V A;  4AM3 A;  3OYM A;  2LK2 A;  4XKC A;  3V7S A;  4MEX F;  1B72 A;  5L3F A;  2MW8 A;  3H35 A;  4PJJ A;  3H9Q A;  1GT0 C;  1Z7L A;  1BIA A;  3F6V A;  2PMU A;  5IYB J;  2MBF A;  1DQU A;  3EUK L;  4E7L A;  2BZT A;  3GFM A;  4KDP A;  2FF4 A;  2WA0 A;  2AQE A;  4QLC U;  2EV0 A;  2X6O A;  3DU6 A;  1DGW Y;  5FRO A;  4BXU A;  2VKV A;  3ASN H;  2JA2 A;  1IGN A;  2LOO A;  1BN5 A;  1ZQ3 P;  2EIK H;  4I09 A;  2YSR A;  4X1E A;  3GZ6 A;  1MSE C;  4MQ9 F;  5FKN A;  2VE8 A;  2R7R A;  3LSK A;  1KQ8 A;  2HOT A;  1IDY A;  1YE9 A;  2DYS H;  3FBN B;  5M3F J;  4M72 A;  2OPT A;  2VKE A;  5FKM A;  2JSP A;  2UXX A;  4JX4 A;  2ZNY A;  4I0B A;  1KU7 A;  2WY8 Q;  3O3K A;  1UB9 A;  4RB1 A;  2P7V B;  3Q0W A;  1RZ4 A;  2XVC A;  2KDZ A;  4U0Y A;  2JK3 A;  2LF8 A;  1B9N A;  3H5R A;  3P7N A;  2XKO A;  3BG5 A;  5H20 A;  5HLT A;  2VLA A;  4XLP F;  3BR6 A;  4F93 B;  4AIH A;  4MHG A;  3WGG A;  2R3S A;  2DFF A;  3SZP A;  2L7Z A;  2L4A A;  3TOA A;  2DK8 A;  3BG9 A;  3D0S A;  5JLX A;  4JX6 A;  4IHT A;  2MSY A;  4L9V A;  2EFP A;  2Y30 A;  2A61 A;  2XGE A;  2XGC A;  3LFK A;  3ZN1 A;  4OWR B;  2DT5 A;  5TJJ A;  2Q1Z B;  1IV6 A;  2K40 A;  4Q47 A;  5DUI A;  3DBR B;  1LEA A;  2BBY A;  2LKS A;  2OCE A;  1QPI A;  1JUM A;  5FFZ A;  3JRH A;  3C2G A;  2EIJ H;  2VQL A;  5J8C A;  3VYT B;  2LP0 A;  3JRA A;  4KN7 X;  2R7T A;  2EIL H;  2PQ8 A;  1FLI A;  2W84 A;  3KZI C;  2XAJ A;  2H94 A;  1MJA A;  1BI0 A;  2E1N A;  5E18 F;  3ZMZ A;  4M73 A;  1VF9 A;  4PGG A;  3K4C A;  1BOA A;  4KIF A;  3SEZ A;  3AL0 B;  3J7A O;  1BR2 A;  4IXA A;  1Q1V A;  5C44 J;  1OMI A;  3IP4 B;  3UR3 C;  4E7S A;  1ONV A;  4BAY A;  3E1S A;  3DLL F;  1IN8 A;  4ZYH A;  4UVC A;  1ZGA A;  2XAH A;  3AG1 H;  1TTY A;  2ECB A;  2H8R A;  2ZME B;  1DDN A;  1W1W E;  3CTA A;  5DCF A;  2GA1 A;  2LSO A;  4CCJ A;  1FC3 A;  2R7W A;  4XLF A;  3JTG A;  4BJ6 C;  2L2O A;  3X2Q H;  2Q8K A;  2EV6 A;  1X4O A;  2JWT A;  3I4N J;  1ZRD A;  1NK2 P;  2KRH A;  1YJW I;  5HS9 A;  5L3E A;  5GTH C;  4II2 A;  2O8K A;  5IP7 J;  1YW9 A;  1GDT A;  2V1N A;  1YLF A;  2BOL A;  1Y0N A;  4CSW A;  2B63 J;  2LY2 A;  2XAU A;  1OR7 C;  3WOD F;  2DFE A;  2X6X A;  4JQF A;  1XCB A;  3TED A;  2DFH A;  1T0F C;  2JUC A;  3GLX A;  1E2X A;  4DYQ A;  1K78 B;  1XB4 A;  4EGY A;  4Q5S F;  3RPQ A;  1FYM A;  4XR6 A;  2LFB A;  4GCV A;  3SHF A;  5LLQ A;  2KIF A;  2V9K A;  3T0Y A;  3VOE A;  1JHF A;  1FYK A;  4OAY A;  4XIC A;  4DQ2 A;  4TV7 A;  1FIA A;  1P4W A;  1IXC A;  3HRS A;  1UCR A;  3CJQ B;  3IWZ A;  4XMY A;  3ZQQ A;  4FIS A;  3LQQ A;  2Y48 A;  1WJF A;  2M0M A;  1WJA A;  3DTI A;  2HZD A;  2Z99 A;  1HDD C;  5K7Z A;  3ABK H;  2PG4 A;  2K27 A;  2CUZ A;  4CH7 A;  5CKT A;  1RNL A;  2I10 A;  3A03 A;  4I0A A;  3RKY A;  4KMF A;  4P9F A;  5FRN A;  2RRE A;  4LOC A;  4HPQ A;  3TO6 A;  2IXS A;  4C30 A;  4A93 J;  5CLS A;  1YX5 A;  1E3O C;  1CGP A;  1WVR A;  4ENN A;  3O8G A;  5HNF A;  5F0C A;  1LQ1 A;  2GBY A;  3BWG A;  3BG7 A;  2HI3 A;  3HSF A;  2K02 A;  5HDK A;  2W25 A;  2OV7 A;  2Z3Y A;  3GF2 A;  2H6B A;  1ON2 A;  1TC3 C;  4GDF A;  5IT9 Z;  3GTL J;  3SYT A;  4IHY A;  3KPH A;  2OTJ I;  1WI3 A;  4IOA F;  1KQ0 A;  1YYV A;  2V9P A;  1QZY A;  2W85 A;  4CZZ A;  5J6X A;  5LHI A;  2G7U A;  3M9A A;  2L4M A;  2PJR B;  2BY3 A;  1K7A A;  1X1A A;  2GQQ A;  4MFD A;  1AU7 A;  1IRZ A;  4YEJ A;  2L01 A;  2MA3 A;  2MH2 A;  1P7I A;  2KLO A;  1PUE E;  5C3E J;  1R9T J;  4YFK F;  3V8K A;  2YU9 J;  3LA2 A;  2ZFW A;  1X3U A;  2MC4 A;  3CME I;  2OF7 A;  1A6Q A;  2ZKZ A;  5DV5 A;  2IGK A;  3H9G A;  1P4X A;  3TOB A;  2DFI A;  4HZF A;  1ZH5 A;  3RQI A;  1HC8 A;  5CVR A;  2FJ1 A;  4D1Q A;  2E7X A;  3ZR8 X;  3CC4 I;  1VQ8 I;  4B3A A;  3HRM A;  2A6H F;  1WRJ A;  4MTD A;  1FBQ A;  3T8R A;  1VND A;  5HLG A;  4EJV A;  2EA2 A;  4BE1 A;  4KMU X;  5E3M A;  1G3Y A;  4XN3 A;  4Q4Z F;  3ZQC A;  2HEO A;  1Y0U A;  2MD5 A;  2Q0O A;  2ZNZ A;  4PK4 A;  3VB2 A;  2XSD C;  3I58 A;  2ZJR F;  3VWB A;  3GFJ A;  2NAZ A;  2KHM A;  3QRF F;  1U5T C;  3RYR A;  4I98 B;  4GGG A;  2R7D A;  3LSI A;  2R5Z A;  1VTN C;  3ASO H;  5LGU A;  5C4X J;  4ENM A;  4M3B A;  1FWZ A;  2DBB A;  5GPA A;  1IUF A;  5EGO A;  4WXC A;  3W6V A;  5FGM A;  3K4K A;  3F8M A;  4BQN A;  3DF8 A;  4XLC A;  3K4B A;  4XL9 A;  3BCB A;  3EET A;  5FLV A;  5H6R A;  5HDG A;  1I1G A;  1OCO H;  2R92 J;  2JN6 A;  3G1O A;  4DOZ A;  5KAF C;  2E36 A;  1FP1 D;  1EH7 A;  4IVN A;  2KQR A;  1PP7 U;  4LLG F;  3OSF A;  5ILU A;  4U87 A;  4CCK A;  2BW3 B;  3DV8 A;  4KIC A;  5F04 A;  3P5J A;  4WK8 F;  4YII A;  3EUA A;  1VQ6 I;  1SMY F;  4IX7 A;  3TQN A;  5BNG A;  5IY5 H;  1GXP A;  4IRH A;  2H6C A;  4PUS A;  3PUF A;  2ELK A;  1T38 A;  3NAU A;  1ZG5 A;  4EM1 A;  4MTE A;  2Z33 A;  1P2F A;  1HW1 A;  3V7C A;  4HX8 A;  2AQF A;  1LEB A;  5ILV A;  3MKY B;  3IKV A;  3WTY C;  1JHH A;  3GO5 A;  3TDZ C;  2FEZ A;  3BQY A;  3HIF A;  3FIW A;  3PNT A;  4B3X A;  3S14 J;  1WFX A;  4HDU A;  4KT5 C;  4HBL A;  1WJB A;  3GW2 A;  4YIR X;  4B47 A;  3CDL A;  5HOO A;  3VPR A;  1YHQ I;  2JA5 J;  2H27 A;  2Z9O A;  2LBF B;  1ZRC A;  3C7J A;  4JK1 X;  3BY6 A;  3M8E A;  2CSO A;  2M2E A;  4J01 A;  2FSW A;  3IC7 A;  1FTZ A;  3IRQ A;  2QEN A;  4KN4 X;  5GAG J;  4RB2 C;  2IP2 A;  1WWX A;  1WSU A;  5DYM A;  2VOP A;  4HOB A;  3E6D A;  1G59 A;  2HVR A;  1W5S A;  4E7Z A;  2E1O A;  2HDC A;  3QPH A;  1WJ5 A;  3LAJ A;  4L5E A;  5BPI A;  1OCT C;  1FZP B;  3KCC A;  2X85 A;  2R7S A;  5E3O A;  2QBY B;  3G3Z A;  2D45 A;  2F48 A;  3HTU A;  2DMN A;  2XPV A;  2BE5 F;  2DQL A;  1X1D A;  4EV0 A;  3RTR A;  1TT5 B;  3S32 A;  4HLX A;  4NQW A;  2WV1 A;  5DCM A;  1WH7 A;  2MLK A;  1OCZ H;  4EJU A;  1CF7 B;  2VB6 A;  2RV8 A;  2MLG A;  2A5W A;  5CVI A;  5F27 A;  1TNS A;  2QUF A;  5DUK A;  4BXF A;  4CO8 A;  1Z05 A;  3BTI A;  3WTU C;  3FHN A;  1MMG A;  2V6E A;  3PIO F;  2QKM B;  1YRN A;  2FNP A;  3VYS B;  2KT0 A;  4JP0 A;  1V3F A;  5LEK A;  1A36 A;  2I5U A;  2JQ7 A;  4LIU A;  2DTZ A;  3T5X A;  5C4J J;  3AAF A;  1SD4 A;  3OYE A;  1RES A;  4I99 C;  3QAH A;  1HXD A;  1WQ2 A;  5L3G A;  1HST A;  4OIO F;  1LVA A;  2EB7 A;  4Q48 A;  2XPU A;  3HB9 A;  3A4C A;  2CRG A;  3ABU A;  2E5Z A;  2RQQ A;  3S2H J;  4KJZ A;  1YO5 C;  3HL2 A;  4CA0 A;  1G3W A;  3E7L A;  1TQP A;  1SAU A;  3AL0 C;  2HOA A;  4I76 A;  1R5G A;  4HAM A;  4ENK A;  3MZY A;  5GAE J;  2COM A;  2P81 A;  4BDY A;  1MSF C;  5EEG A;  2LD5 A;  5KK1 A;  3RYP A;  1FNN A;  1XTA A;  2HS5 A;  3FKI J;  2EIN H;  2ZME C;  4L18 B;  1Z6T A;  2DA4 A;  4D5C A;  3HOU J;  2E34 A;  4XLA A;  1HKQ A;  3GFL A;  2VBW A;  2FOK A;  3FXQ A;  4AD9 A;  2L5Q A;  4XRF A;  3B73 A;  1ETO A;  2GOX B;  1W5T A;  4G9Y A;  2QSH X;  1EV7 A;  1MH3 A;  2NVQ J;  1GV2 A;  3SDG A;  4DBQ A;  2OAZ A;  3D1N I;  3FXR A;  1BJA A;  1H8A C;  2HNH A;  1H89 C;  2KJC A;  4N4O B;  3U2R A;  1JGG A;  1YIO A;  3ZQ7 A;  3HRU A;  2E2J J;  2L7K A;  4PSX A;  3V4G A;  1QQI A;  5GTI C;  2QSF X;  3HBL A;  1P4A A;  2L9N A;  2AS5 F;  3N4M A;  3C2B A;  2KIS A;  1WH5 A;  2IPQ X;  3JSP A;  1BA5 A;  4GRI A;  4A3C J;  1NG6 A;  5FD5 A;  3UKG A;  4P55 A;  2K9Q A;  4BNC A;  4PJ0 C;  5LRR A;  1DU0 A;  3CP2 A;  3KE2 A;  3JRG A;  1MW7 A;  3RSN A;  4Z2Y A;  2CV0 A;  1V5E A;  1POG A;  1ZTR A;  4ZDP A;  1R1T A;  5IT9 K;  1ACI A;  2Y0M A;  2LDU A;  3U1K A;  3M7G A;  4H0E A;  2HU9 A;  1KGS A;  2DOD A;  2P4W A;  3PL8 A;  3ZCO A;  4CYC A;  4A3E J;  1YIJ I;  3VDX A;  5CQG A;  3VYU B;  2K9S A;  4XKW A;  3N97 A;  2VC0 A;  2LH9 A;  2HPI A;  1TWF J;  1MH4 A;  4RAZ A;  2VN2 A;  2PFB A;  1RUN A;  3MEX A;  2ISY A;  2X1E A;  2L3D A;  2DA1 A;  2BHY A;  2P6T A;  4F3Q A;  4M3F A;  1WPK A;  3GTG J;  1KA8 A;  1KQ9 A;  4IRG A;  1JT0 A;  2ZC2 A;  2B7E A;  3ONQ A;  1U9O A;  4BY1 J;  2YS9 A;  2STW A;  4A6E A;  4C3J J;  1TNT A;  2M4G A;  3PFI A;  3JRF A;  3PUB A;  1RR7 A;  2BXY A;  5IT3 A;  4A6D A;  1VQ9 I;  1N25 A;  3OMY A;  1FJL A;  3CUQ B;  1N78 A;  2CFX A;  2EK5 A;  4J00 A;  4UVB A;  2JA6 J;  1FBU A;  1BI2 A;  4B4C A;  4XRS G;  4ITV A;  1D8J A;  1FX7 A;  1R22 A;  2V7F A;  2W4S A;  3TP3 A;  2P0W A;  3QU3 A;  1XGN A;  4LG3 A;  3FMS A;  1B72 B;  2F4I A;  2EZK A;  3AKZ A;  2M87 A;  4R79 A;  1ULY A;  2F4O B;  1I1S A;  3OYG A;  4QTR A;  2YX4 A;  3CP8 A;  5IYC J;  3BR2 A;  5DS9 A;  5JVG F;  3K2A A;  1W7P A;  3LAP A;  1D1C A;  1BW6 A;  3M1C A;  2X51 A;  5H6Q A;  1UHS A;  3CCM I;  3E97 A;  3Q5F A;  5J40 A;  3COA C;  1B8I B;  2E1M B;  3MWM A;  4KIB A;  1J5Y A;  4Y7N J;  3IV5 A;  1Y1V J;  1VQO I;  4BGD A;  4UXN A;  2R7O A;  1F36 A;  4QWQ A;  1FOX A;  1XS9 A;  1X19 A;  2KPM A;  4BL0 B;  2L7F P;  2HVS A;  4UUT A;  1QHG A;  2K9N A;  4KA4 A;  1TL8 A;  2LNB A;  1OYI A;  1JJ6 C;  1UST A;  2IS4 A;  5EG0 A;  4Y4R A;  4CCO A;  5J3L A;  5GPC A;  3HUG B;  2QYO A;  3S15 J;  4DGW B;  2DTR A;  5LRS A;  4D7N A;  5ICC A;  3TW6 A;  5BPD A;  2P5L C;  1LKX A;  5B1B H;  3OYF A;  4ZTF A;  3GEZ A;  3VOD A;  1OR7 A;  1K6Y A;  3CDI A;  4BY7 J;  2DJI A;  1SAN A;  1G3T A;  4JOM A;  3DEW A;  1I6H J;  2HDW A;  4AU7 A;  4LLN A;  5K7H A;  4HLY A;  5HLH A;  2WTE A;  2NS0 A;  3IH3 A;  2K4B A;  1ZRF A;  3I59 A;  1ETY A;  1OCR H;  1V5F A;  1PJR A;  1AKH A;  4PFP A;  5CPR B;  3JAM K;  2DYR H;  2VT2 A;  3GWZ A;  5KCM A;  5E1Z B;  3AG3 H;  2NVT J;  2KRF A;  5ICG A;  3M8J A;  4B09 A;  3OYN A;  3L2Q A;  2CW8 A;  1K61 A;  2E35 A;  4M6X A;  3S1N J;  3ZPL A;  2XRN A;  1XMX A;  5F08 A;  4M71 A;  2HYG D;  1ENH A;  3K4L A;  2DA6 A;  4PJN A;  4A0X A;  2KMU A;  5D5W B;  4M3E A;  4D9J A;  1LUJ B;  2Y75 A;  3U1D A;  3J81 Z;  1ZAO A;  2DOE A;  4FX0 A;  1QBJ A;  4CUG A;  2XKP A;  4G6T B;  2UZK A;  3U9G A;  5EF6 A;  3IH2 A;  3OYI A;  1X58 A;  3E5X A;  4A12 A;  1FOY A;  4CGZ A;  3W6J B;  5LGN A;  3QU6 A;  3E0J B;  3MCZ A;  1BJZ A;  3OYK A;  4XKV A;  4D7M A;  4BHC A;  3QPT A;  4EMS A;  1G2H A;  3BTJ A;  2OCC H;  2JT1 A;  3GTO J;  4L5I A;  2QA4 I;  4F7Z A;  5F1R A;  4HEA 2;  4P9U A;  2L02 A;  3BZ6 A;  2X48 A;  2STT A;  2HOE A;  2LKX A;  1IV8 A;  4LK0 F;  2X1C A;  2CUF A;  1XC5 A;  4C9Y A;  3BLY A;  3HOW J;  3FK6 A;  4EJO A;  5BQT A;  1RUO A;  4IEJ A;  1ZKG A;  2HTS A;  2YUS A;  1QA6 A;  4PJL A;  2LMD A;  4EAT A;  5D6E A;  2JVG A;  2Y2Z A;  5CVV A;  3CCV I;  4A3F J;  4IRI A;  1R1U A;  4Y13 A;  1OLT A;  4YFX F;  2VQG A;  2J5O A;  3H1C A;  2MC3 A;  3SJM A;  5L3C A;  4BH9 A;  3GUD A;  1FSE A;  4FHT A;  2XAQ A;  2ISZ A;  2DA2 A;  3K7A J;  2CQK A;  2CH0 A;  2JPB A;  2ZCW A;  1XCV A;  1U2W A;  2EQR A;  3CES A;  4ABZ A;  4MO7 A;  4AUX A;  1TWH J;  1Y1W J;  1IN7 A;  4BHB A;  2YR2 A;  1USS A;  4BE2 A;  2XAS A;  1TLH B;  4OU0 A;  1O7L A;  2TCT A;  3BPV A;  3HKZ A;  3N05 A;  3HEF A;  1U5T A;  1HW5 A;  4M3G A;  4HX7 A;  3WU0 A;  1QO0 D;  1HOM A;  2CG4 A;  4M9S A;  4XOR A;  2Z1D A;  4XM3 A;  1BOB A;  3SZT A;  2GWR A;  2XGD A;  4N0B A;  2HKX A;  1XN7 A;  5D5X B;  3F8C A;  3CQZ J;  5DM6 F;  2HQ5 A;  3GTP J;  3CCS I;  3B6C A;  3A2K A;  3G71 I;  2TRT A;  3TDU C;  2FOW A;  1O7F A;  4W97 A;  2IEK A;  3B6A A;  2XF5 A;  3KZZ A;  3K1N A;  4IQJ A;  3O8H A;  4MNU A;  3DQV C;  1TWG J;  3G6E I;  1XPX A;  4HYE A;  2XAG A;  4PGH A;  4LB6 B;  1MNM C;  1SD5 A;  4Y15 A;  2VXD A;  3CCU I;  2NS7 A;  1DP7 P;  4YFN F;  2E19 A;  5J8F A;  4C3I J;  2L9V A;  4CDG A;  4QIW N;  4WWC A;  1VQK I;  2Y69 H;  2R5Y A;  2V1D A;  1D5Y A;  5BOX A;  2F5C A;  1OPC A;  2ICW G;  3JRI A;  1F1Z A;  3RZD J;  2DA5 A;  2UV1 A;  3KEO A;  2D2W A;  3WTX C;  2YU3 A;  3CLO A;  3V42 A;  5EDN A;  4QPQ A;  1S5L C;  2Y9Z A;  4A0Z A;  1TW2 A;  3F22 A;  1R1V A;  4XN0 A;  1X3Z B;  2J5P A;  2CV1 A;  1VQP I;  2CQN A;  2KP6 A;  2A05 A;  5ERI A;  2IBD A;  4PFO A;  1S3J A;  1D0X A;  1O3S A;  1XMK A;  3RPU A;  2VQH A;  4LIT A;  3NRV A;  5CJ9 A;  1HLV A;  3W2A A;  1IUY A;  2IA1 A;  4PDK A;  1RC9 A;  1K79 A;  1FPQ A;  3ZMV A;  3PJR A;  2IW5 A;  1IZ1 A;  1QPM A;  2DCE A;  4DNC A;  2VBY A;  5EYR A;  3ZQG A;  3CJR B;  2R7U A;  1T8I A;  2XSJ C;  1R6R A;  1SMT A;  3DWL E;  4KUM A;  2O61 A;  3LL7 A;  4BAC A;  2PMZ A;  3C1D A;  4B48 A;  1E3H A;  1GV5 A;  2LTP A;  3KYD B;  1HQC A;  2Y9Y A;  3TL4 X;  1SVM A;  2LKP A;  3HGY A;  4DBR A;  4OIR F;  5FKL A;  1ZR4 A;  1YJ9 I;  2JA7 J;  3L7W A;  4LG0 B;  4EM2 A;  3CUQ C;  4NBQ A;  1ETW A;  3BP8 A;  3HRT A;  1I27 A;  1M1E B;  1DPU A;  1MBK A;  1WI9 A;  3QQA A;  1IN4 A;  1BR4 A;  1ETV A;  2L0K A;  3D5R C;  1I3A A;  2DK5 A;  1JUS A;  1IJW C;  5KHD A;  3V7R A;  1XMA A;  1T95 A;  2OTL I;  3K4N A;  3GTQ J;  2E5N A;  2VOD A;  3S2W A;  3OL4 A;  5E17 F;  1MDM A;  4LJZ F;  3LFU A;  4E7K A;  3FZV A;  1KU3 A;  2W00 A;  2LR8 A;  4BQA A;  4AC0 A;  2L9S A;  3U21 A;  1IG7 A;  3IH4 A;  5GAD J;  2F5D A;  4G12 A;  1EJ9 A;  2JUG A;  3ECH A;  1K6O A;  1YG2 A;  4ON0 A;  2M5W A;  4BKX A;  4BDZ A;  4U88 A;  3WTS C;  4CCM A;  4HNV A;  2DOA A;  2EPF A;  2XPW A;  3QOD A;  1T56 A;  4NDL A;  4D5F A;  2ID3 A;  4HRI A;  2E71 A;  2XF6 A;  3Q9S A;  2PX9 A;  2Y0S A;  3GCM A;  2CO5 A;  4XLN F;  5IYD J;  2UXN A;  4IZZ A;  1OCC H;  1OCP A;  4H4K C;  2LF7 A;  1VZ0 A;  3G1M A;  1BC8 C;  3D5S C;  4MGR A;  1LFU P;  3F6O A;  3IUO A;  3NWS A;  1SFK A;  1Z3Y A;  3F21 A;  2GLO A;  1BBY A;  2F5E A;  2ETH A;  3I9V 2;  1SD6 A;  3KEY A;  2QLZ A;  4N4N B;  3BT9 A;  1GLN A;  3EUH C;  3J81 K;  3PO2 J;  1DGR M;  2HYF A;  2O3F A;  3J7Z I;  1YTY A;  4IL6 C;  2DA7 A;  3G1L A;  4RMN A;  2IGO A;  3L9F A;  4NQW B;  1EA3 A;  1LVK A;  3F8B A;  3FX3 A;  4FET A;  5DCM B;  2G0E A;  2W82 A;  1W7P D;  1HKS A;  1R23 A;  3FM5 A;  4FX4 A;  2A07 F;  5IP6 A;  4RDU A;  2CYY A;  1FMW A;  2PMH A;  4B8X A;  4OAZ A;  4E7I A;  4YIF A;  1Z0X A;  3C18 A;  4MIM A;  1YRN B;  2Q2E A;  4UB6 C;  1I5Z A;  3BJA A;  3ROU A;  1NTC A;  4LD5 A;  5HDN A;  3JRB A;  2OZ6 A;  3LSG A;  3R0J A;  6PAX A;  5FB2 A;  1GVD A;  1G6N A;  4DYR A;  4ANJ A;  1U78 A;  4IKF A;  3I53 A;  5CVU A;  4CZC A;  1VQN I;  2AXL A;  2DMT A;  4C2T A;  1IN6 A;  2PN6 A;  4HDV A;  1Y39 A;  4YRV A;  1IDZ A;  1Y6I A;  2JPC A;  2XGX A;  3T8T A;  3GTM J;  2K86 A;  2K3P A;  1YS6 A;  1JE8 A;  2Z2S B;  3FDY A;  5EZG A;  3ZQL A;  2GXA A;  3BR0 A;  4BYY A;  5B3S H;  2KIM A;  4I01 A;  1LFP A;  3ZXS A;  3SQN A;  1LDJ A;  1S7E A;  1O3R A;  1UG0 A;  2VT3 A;  4F52 A;  2K3F A;  4EM0 B;  2C6Y A;  4L9J A;  5J1U A;  1YJN I;  4U0W A;  5F0F A;  5M5W J;  1YW8 A;  4S05 A;  4X0G A;  3HGG A;  1BM9 A;  3DTK A;  1R4N B;  4LLL A;  5ICE A;  3TP0 A;  4J19 A;  3TMO A;  1O3T A;  3BC8 A;  3H5N A;  4M3D A;  3H3V K;  1U3E M;  4A3G J;  4YEL A;  1G4D A;  1R5H A;  1I3Q J;  3F8N A;  3JAM Z;  2K5C A;  5D4R A;  3ZQI A;  3I4P A;  2XF7 A;  2DT6 A;  1U9N A;  3CO6 C;  4FE4 A;  2A6E F;  3I56 I;  4A3B J;  3CC2 I;  4DZJ A;  2QF7 A;  2B9S A;  1JTX A;  4IQ4 A;  1ETK A;  3TKY A;  3TO7 A;  2LYC A;  4CYD A;  3F0C A;  3B02 A;  2F2E A;  3SEQ A;  2LY9 A;  2XDV A;  3NEU A;  3HXL A;  3HPG A;  1OYY A;  3HG9 A;  5K7F A;  3EYI A;  1HBX G;  1MIJ A;  4KIG A;  3FK7 A;  3LMM A;  4AIJ A;  1TBX A;  2KJB A;  2A6T A;  1PP8 F;  4M74 A;  1ZR2 A;  2K9L A;  2DPU A;  4RM3 A;  3SFZ A;  1UG2 A;  3F72 A;  2ZXI A;  2R7V A;  5F6F A;  3HKZ N;  3OYL A;  3KX2 A;  2YPR A;  3JSO A;  2ESH A;  3MQ0 A;  3GBG A;  1TZL A;  4DW6 A;  2M34 A;  4ENJ A;  1D5V A;  2R7Q A;  2M4K A;  4LK1 F;  1PUF B;  2ZB9 A;  2NOG A;  4HNT A;  2IS1 A;  1LNW A;  2KDO A;  1D3Y A;  5FRM A;  4I02 A;  2K85 A;  3CMY A;  1ZEL A;  1OYW A;  3AG2 H;  3H0G J;  5CQE A;  3CCJ I;  1KYW A;  1A6I A;  1XD7 A;  5J1R A;  2HGC A;  1B6A A;  4EVI A;  1OJL A;  2Z16 A;  1HW2 A;  4Y52 J;  1IXR C;  1VFC A;  2V4J C;  4Y17 A;  4C2M J;  2Z5U A;  4HQM A;  1P9Q C;  4ZZL A;  4AIK A;  3PIP F;  4OIP F;  1Z3X A;  4UUS A;  4A3M J;  2M8E A;  4UVA A;  2O6G E;  3KZY A;  2DA3 A;  2QQB A;  3KP2 A;  4NUB A;  1J0R A;  2NNN A;  1UFM A;  4BJ5 C;  1GVJ A;  2MAB A;  3DCF A;  5BMZ A;  2KFD A;  3A01 A;  3HOY J;  2E7W A;  3S8P A;  4EQQ A;  2ZXH A;  4M6Y A;  4ZTJ A;  2VQC A;  3HJE A;  3TBI A;  1IN5 A;  5M5Y J;  2BVL A;  1CQT A;  2MYS A;  1UJ8 A;  1E3P A;  4RB0 A;  1J59 A;  4UHT A;  5L3D A;  3A02 A;  2H8W A;  4WCG A;  1JKR C;  4QPO A;  5L3B A;  4ZDO A;  4HV5 A;  3GTJ J;  2X1D A;  3VSK A;  3DU5 A;  1R36 A;  2W1O A;  3NWT A;  5TIS C;  1ZK8 A;  4A5M A;  2VPL A;  1T33 A;  2DDB A;  1W7P B;  3DBH B;  2ELJ A;  3REO A;  3S1M J;  1U0J A;  2BY1 A;  3EPZ A;  4HQE A;  2FA5 A;  1JI8 A;  5E8I A;  3PFY A;  3E5U A;  4HX4 A;  3CCR I;  4G6D A;  4M9X A;  1ODD A;  2CQQ A;  5TGT A;  1ZGJ A;  2VIX A;  4BS9 A;  3OYC A;  1FSH A;  5DD8 A;  1VI0 A;  4I7H A;  2JMW A;  1MKM A;  3L2C A;  2X0L A;  2PMZ N;  4AYB A;  3FXL A;  5E20 A;  2DXI A;  1Z7U A;  4LMY A;  3GZ5 A;  3OL3 A;  2ADU A;  4PZJ A;  1V5G A;  1AOY A;  1BR1 A;  1TW3 A;  3ZOB A;  1FOW A;  1EH8 A;  5IOZ A;  2VJI A;  1S9H A;  4AWX B;  1GHC A;  2WBM A;  1XGO A;  3AFH A;  2VON A;  1KYZ A;  1F5T A;  4G7H F;  4RA2 A;  2IAI A;  1P6R A;  1X3W B;  2EBI A;  1OFC X;  3KET A;  1FEX A;  3LQR A;  1YOV B;  3R0A A;  3CZ6 A;  1APL C;  3K10 A;  1I39 A;  3JCU C;  3BJO A;  5IP9 J;  3W2W A;  2IVM A;  4BEH A;  3HPH A;  1HSJ A;  3I59 B;  4NC6 A;  2G9W A;  3SFI A;  1AKH B;  5FFX A;  2VE9 A;  3KP5 A;  3ABL H;  1W5C C;  2XIG A;  3C3W A;  4UUV A;  2COB A;  1AHD P;  1XSX A;  1QRY A;  4FQG A;  5FO5 A;  4RLF A;  1FYL A;  1MD0 A;  3BR3 A;  5CYV A;  2HKO A;  2V26 A;  1V4R A;  1WJD A;  2WV0 A;  3FWE A;  3W3C A;  1LE8 A;  3I71 A;  3RKW A;  1VQ5 I;  3FXM A;  2FBH A;  1MBG A;  5D5V B;  5GP9 A;  2RVC A;  1ITY A;  4EGZ A;  4CIC A;  5LEJ A;  4A3J J;  3E3V A;  4N9I A;  5FJ8 J;  1UZC A;  2P7C B;  4W1U A;  4MEY F;  1UMQ A;  2LY1 A;  4ZYD A;  3BR5 A;  2VJJ A;  3IWF A;  2WWY A;  1TQM A;  1QU3 A;  4U0V A;  2Y0S N;  1UHW A;  3WTW C;  3G73 A;  3NQO A;  2X4H A;  2XB0 X;  2PEX A;  3LNQ A;  3NAR A;  2VJ5 A;  4NC7 A;  1J09 A;  3KYC B;  2A68 F;  3OSG A;  2DO7 A;  2FQ4 A;  3CCE I;  2UUZ A;  3DBL B;  3GZN B;  3S3N A;  2NXN B;  2OQR A;  4JBA A;  2QZ8 A;  4V2G A;  1R49 A;  2LG4 A;  3BTL A;  1D1B A;  3QPL A;  5LHG A;  3GLL A;  2FBK A;  1F9N A;  3JTH A;  3ZP5 A;  1JKO C;  1SC7 A;  3A0H C;  4XSZ F;  3CCQ I;  3RI4 A;  2K9M A;  4RM2 A;  5H2F C;  1P92 A;  1FTT A;  2HWV A;  4G94 A;  1DU6 A;  3QYB A;  5A2Q K;  3MZH A;  1Y56 A;  4IJA A;  3I0T A;  4CXF A;  4ZJZ A;  3DEE A;  3BR1 A;  3K4J A;  3CCL I;  2O8X A;  3GYH X;  1NH3 A;  1Z9C A;  3S2D J;  1T08 B;  3KP4 A;  4D0P A;  3F8F A;  1FBS A;  5HLI A;  2EFW A;  1T0F A;  3LA7 A;  2V1X A;  4RS8 A;  1IRF A;  3L1P A;  1MMN A;  3KIO A;  2DMP A;  1S7A A;  1BC7 C;  5DEQ A;  1RKW A;  4AID A;  2K4J A;  3R4K A;  4I2O A;  1JUP A;  2XRL A;  2PI0 A;  3JRE A;  3BPX A;  4RAF A;  3E6C C;  1ZHF A;  3J80 K;  5HOD A;  3CO7 C;  4II3 A;  1U5T B;  3OR2 C;  3PSF A;  4XID A;  3DEU A;  1MND A;  2F6C A;  3LSR A;  3K9T A;  1XSV A;  3WU1 B;  1RI7 A;  4U7D A;  3ESW B;  4KYW A;  1MBF A;  2HOS A;  2RN7 A;  4E7J A;  5KNL A;  2HVQ A;  1Y8Q B;  2PJP A;  1MJ9 A;  1ZYR F;  5K1Y A;  3OYH A;  2HFH A;  3ABT A;  1ERD A;  4OIN F;  4BU2 A;  4UNO A;  3GTK J;  4RB3 C;  1HF0 A;  1VQ4 I;  3DPU A;  2CWE A;  3EDP A;  5IOY A;  3G4S I;  1UEL B;  2WAQ A;  4GXO A;  1TT0 A;  4DJA A;  3RKQ A;  4F55 A;  2KZV A;  1F4K A;  2VXZ A;  1T2K A;  2WAD A;  2A3S A;  3RZO J;  4ESF A;  5FLM J;  4OIQ F;  5FLX Z;  2O7O A;  2VOO A;  2ELH A;  2DPD A;  4NHJ A;  4IHW A;  2RNG A;  2DU9 A;  1GUU A;  1PVE A;  2PBI A;  1DUX C;  3RCO A;  1T6S A;  2R5Y B;  3L00 A;  3OR1 C;  3D5L A;  3ZMU A;  1RPW A;  5HNH A;  1K4T A;  4BUP A;  5JFR A;  1J7K A;  3PQK A;  2D1V A;  1YIT I;  2HDD A;  3KFW X;  1VQL I;  1Q1H A;  2RKH A;  5D8K B;  1B8I A;  1TWA J;  2CFO A;  3S1R J;  3CCY A;  3LOC A;  5D6F A;  2GZW A;  3GME A;  2EZI A;  5K5Q A;  2CW0 F;  1HKT A;  2BEO A;  3IAS 2;  1UHM A;  1QZZ A;  1F43 A;  4UY8 I;  2MG4 A;  3BJ6 A;  4P96 A;  3S17 J;  5K5O A;  3H5A A;  1N75 A;  2R4G A;  3DPL C;  3FXO A;  3HOV J;  3WE2 A;  4BE0 A;  3M3Y J;  4A3L J;  2RNJ A;  2QCO A;  2P5V A;  3LWF A;  4PJM A;  1S8N A;  3HUG A;  5D8L B;  3PQJ A;  2VI6 A;  4M6V A;  3ECO A;  4O6J A;  2EFQ A;  2H1L A;  2WB1 A;  1W36 D;  1AA7 A;  2NVX J;  4OOI A;  2JA8 J;  2FUG 2;  2HQN A;  3FM3 A;  2GXG A;  3EUH A;  2JJ7 A;  3ZN0 A;  1XGS A;  2MFZ A;  2ME6 A;  5FD6 A;  1TWC J;  3HOZ J;  2VKH A;  3CMA I;  3MVP A;  2IA0 A;  3Q0V A;  3LSP A;  1JKP C;  5DM7 F;  4M9Z A;  1ZAR A;  2QQA A;  4MQV A;  3CF5 F;  3OIO A;  2EV5 A;  3LSM A;  2DMQ A;  3GX4 X;  3K70 D;  2UWM A;  5J4V A;  4XRM A;  2IT0 A;  2HR3 A;  2ZXJ A;  2KIQ A;  3DKX A;  5EEH A;  2OJE D;  4BJT A;  1YX3 A;  3EYY A;  2KKO A;  4AVZ A;  4IHX A;  3K4M A;  4G7Z F;  3SXY A;  1MDM B;  3I4M J;  1OQY A;  1N77 A;  5E3L A;  1JTY A;  3ZRG A;  2QVO A;  3CJN A;  1RKT A;  2M1B A;  1Z67 A;  3JRC A;  1JGS A;  1X2N A;  4HA8 A;  2WAF A;  3H3Z A;  3WGI A;  4XNF A;  1MBE A;  1QNT A;  2TDX A;  3Q0U A;  2M7B A;  4V2F A;  2IGM A;  3GFI A;  4XBF A;  5FKK A;  2DMU A;  5E3N A;  3HDD A;  1J2X A;  4G6Q A;  1A04 A;  3PSI A;  1LFB A;  2FML A;  4G8X A;  3ZMT A;  1ZLK A;  5JI6 A;  2M3A A;  4IHV A;  1QVT A;  1LDK B;  1X1B A;  1ZN2 A;  3FXJ A;  4A3D J;  4MLO A;  2DN0 A;  1SAX A;  2NOJ B;  2V9V A;  3HOX J;  1R71 A;  4L0Y B;  2CU7 A;  2L7M P;  2GIZ A;  4AYB N;  3Q3S A;  4E4H A;  4XQF A;  3PM1 A;  1QVU A;  2EJR A;  3QYF A;  3S16 J;  2FRH A;  4DIQ A;  3QP5 A;  2KL4 A;  2OQG A;  1D8K A;  1I50 J;  2R5Z B;  1B4A A;  4L5J A;  3ULQ B;  2IA2 A;  2BXZ A;  2FXA A;  5EGO B;  2X6W A;  3S93 A;  2M7A A;  4RGU A;  3WE3 A;  3CF2 A;  1L0O C;  2IS2 A;  4A3K J;  1MNE A;  2FE3 A;  4IO9 F;  1VQ7 I;  3OOP A;  2IGN A;  2RAE A;  5FKO A;  1XG1 A;  3OYA A;  2M30 A;  2OZU A;  4E6K G;  1NK3 P;  3HTS B;  4FTH A;  1O3Q A;  3WTV C;  2H1K A;  2Q2E B;  2ESN A;  3ELK A;  1ON1 A;  4NNJ A;  3JR9 A;  3QOE A;  5JHU A;  1XDU A;  3GVA A;  1K4S A;  1PDN C;  3EQL F;  1T98 A;  2RDP A;  4HNU A;  1SVL A;  2ZSH B;  1BI1 A;  5KAI C;  5AIQ A;  2W48 A;  5E1W A;  1H9G A;  4UV9 A;  3L2W A;  5EZH A;  4E7H A;  4B43 A;  3QYE A;  4ZYE A;  3WG9 A;  4XOP A;  3RIR A;  4Z6Y A;  5DDG A;  2GXB A;  1FP2 A;  2K7L A;  4C3H J;  3HYI A;  4KIT B;  5IPA A;  1T39 A;  1BI3 A;  4JYK A;  3IKT A;  5LGT A;  5E79 C;  5F1J A;  4L0Z B;  1LDD A;  1A31 A;  3CD6 I;  4N9H A;  1JJ8 C;  2VUM J;  3A0B C;  4E70 A;  1A35 A;  3RDI A;  1BW5 A;  1HA8 A;  2E1M C;  2AHQ A;  5TRD A;  2R7X A;  1DP3 A;  2KIU A;  1WKM A;  5HS7 A;  2HZT A;  1SD7 A;  1MMS A;  1U8R A;  1QHH D;  4KFC A;  1W0U A;  2ZME A;  1IAW A;  2E2H J;  1WHU A;  1MBH A;  1YS7 A;  3BQZ A;  4RGR A;  4NB5 A;  3E6B A;  4R1H A;  1KU2 A;  3OS0 A;  1WJE A;  2CJJ A;  2F4M B;  2VBX A;  3RQ4 A;  3BZC A;  1U6G A;  3E5Q A;  4EJT A;  3OY9 A;  4ZDL A;  2PLY A;  4IHS A;  1Z1D A;  2FU4 A;  2GOM A;  4HF1 A;  1SEU A;  1NG7 A;  2M9H A;  2V1U A;  4ESJ A;  3S3M A;  3BDD A;  2DQR A;  4ZYA A;  3H92 A;  2NYX A;  4RAY A;  1YQA A;  4F92 B;  3L2U A;  3VEP A;  3V8L A;  1WJC A;  1QGP A;  1D0Y A;  5JVT A;  1J9I A;  1K78 A;  1H0M A;  1HDP A;  3AG4 H;  3I64 A;  4PSW A;  3MFK A;  3MD2 A;  2QM3 A;  1IF1 A;  1J75 A;  5E1X A;  3HHG A;  4F91 B;  3MKL A;  1YFH A;  2FBI A;  4G7O F;  2GAU A;  2HTJ A;  3BRO A;  3P9K A;  2CW7 A;  4GYI A;  1W0T A;  2FX0 A;  3M1E A;  5D4S A;  5LHH A;  2X9D A;  2WY7 Q;  5FLX K;  3JW4 A;  2EH3 A;  3KLO A;  3OS1 A;  2L9R A;  2OU2 A;  3RJP A;  4ZZD A;  1JXS A;  2JRT A;  5BS6 A;  2L54 A;  1JKQ C;  3UNG C;  2BGC A;  3VSL A;  4KIS A;  3H36 A;  2EZL A;  4LG0 A;  1EKE A;  3OYJ A;  4LB5 A;  3K1M A;  1R7J A;  1S6L A;  1MGT A;  4FAS D;  3L09 A;  2YX7 A;  2XV4 S;  5J1Y A;  4OMY A;  2VKD A;  1XDS A;  4ZC3 A;  4HST A;  3CLQ A;  4P5O A;  4KT6 A;  3I5U A;  5M3M J;  4HF0 A;  5A2Q Z;  2NVU B;  2V6C A;  1MJB A;  2EWN A;  5JR3 A;  3HSR A;  2WAQ N;  3S3O A;  4A2U A;  3PNV A;  4UUS B;  2VL8 A;  3WG7 H;  2CUE A;  2NRA C;  1E17 A;  1B1B A;  3M8F A;  3W2V A;  1SFE A;  4GFB A;  4IF4 A;  2PJR A;  3A01 B;  4XRS A;  2E2I J;  2MGQ A;  1YI2 I;  3QWL A;  2KZG A;  3IAM 2;  3KLN A;  4WF2 A;  2ID6 A;  3R60 A;  1TP4 A;  1S29 A;  4XKB A;  4LFU A;  1G3S A;  1IW7 F;  3ABM H;  3M07 A;  3J80 Z;  1SFX A;  4ZYG A;  1JT6 A;  2V79 A;  2MH9 A;  1Z21 A;  2OA4 A;  1QZE A;  1ETQ A;  1SFO J;  4MFE A;  2XAF A;  2F5F A;  2XC7 A;  5F64 A;  2ZO4 A;  2GM4 A;  1XGM A;  3DP7 A;  3FXU A;  4RAG A;  4LIV A;  3PO3 J;  2HYJ A;  3I54 A;  1R00 A;  3HZJ A;  3TO9 A;  5DTD A;  4EEF G;  4BHP A;  1C0W A;  3CJT B;  3DKW A;  5LD2 C;  3KYL A;  3R6S A;  1RRJ A;  3A1Y A;  3F9K A;  3ZMS A;  1ZG3 A;  3FHZ A;  1W4M A;  3HHH A;  1ORK A;  1O4X A;  2E60 A;  3DFG A;  4QSH A;  4BBR J;  1XX5 A;  4XK4 A;  4S0H B;  2ME0 A;  3BG3 A;  4CYC B;  1U8B A;  2NVY J;  2LRD A;  2ECC A;  5AON A;  4JX5 A;  2E1C A;  2WB1 N;  3F23 A;  3HM5 A;  5LFA A;  4GO1 A;  5AIP A;  2XRO A;  2XB5 A;  2DW4 A;  3BCA A;  5F0H A;  2BY2 A;  1XSD A;  3IRR A;  2OD5 A;  2BVM A;  2DOF A;  1Z6R A;  2FD5 A;  3HSE A;  3BTC A;  3OYB A;  5ILS A;  3MN2 A;  3OIQ A;  2R7F A;  3O6B B;  4WX9 A;  4WXH A;  2O5R A;  3BZK A;  2BW3 A;  1V55 H;  2A5Y B;  4A5N A;  1KZH A;  4BEH B;  3S1Q J;  2B0L A;  1X1C A;  4WXD A;  3WTT C;  4ASN A;  4PCQ A;  2JTV A;  1R5I D;  5B66 C;  3TW7 A;  2RQP A;  3BOQ A;  1KU9 A;  2AXT C;  5E8G A;  4HF2 A;  3QPS A;  1MBJ A;  1WGX A;  3CUO A;  1FY7 A;  2P6S A;  4I6Z A;  4L9N A;  2XUB A;  1WZ2 A;  2QEX I;  3ZQF A;  3J7Y J;  3FIS A;  3FMQ A;  4B1R A;  3RKX A;  1LE8 B;  2M45 A;  2M0C A;  3Q9V A;  3VFZ A;  2GIV A;  3P9I A;  2CQ7 A;  5LBQ A;  3M4O J;  1O57 A;  2BV6 A;  4A3I J;  3FBI B;  4AVP A;  2LBF A;  3ERE D;  1X1P A;  2D5V A;  4IPA A;  5GAH J;  2LVS A;  1L3L A;  4XSX F;  2N8G A;  2IRF G;  3OIP A;  1R4M B;  3FF5 A;  5K5R A;  1B59 A;  1K83 J;  3MZ8 A;  2ACJ A;  1P7J A;  2AO9 A;  4ESB A;  5CVJ A;  4RGX A;  2HXI A;  1VQM I;  3ISP A;  3H9J A;  3IL2 A;  4RGS A;  1ETX A;  1UAA A;  2EA4 A;  2DDA A;  3SDB A;  3VYR B;  2QBY A;  3MMY B;  3K1P A;  1EH6 A;  5M5X J;  1GXQ A;  1SFU A;  1IC8 A;  9ANT A;  2HPM A;  2RGV A;  3KEQ A;  2O0Y A;  1BIB A;  5EG0 B;  3L2R A;  5HS8 A;  5DD4 A;  1IRX A;  4RBO A;  2ZSI B;  4HW0 A;  4S04 A;  1ZRE A;  1RET A;  1D1A A;  1CF7 A;  1D0Z A;  3E6M A;  3DLA A;  1LJ9 A;  3KP3 A;  4FT8 A;  4UV8 A;  1RIO H;  2VBZ A;  4HG2 A;  5EEA A;  2LC2 A;  4U7B A;  1V54 H;  3QP6 A;  3JRD A;  2R7Z J;  4BXX J;  1A5J A;  3DXJ F;  2FMY A;  3CDH A;  1OKR A;  4NC8 A;  3MKW B;  2DAO A;  5J4Y A;  2X6Y A;  1OIS A;  4O3M A;  3GXO A;  3RPU D;  3KP6 A;  4B44 A;  2QWW A;  2QQ8 A;  1E0E A;  3K69 A;  4O5V A;  2I8D A;  2H09 A;  3OYD A;  1PUF A;  1LB2 A;  4C2U A;  4HSR A;  2P5K A;  3ZGK A;  1X2M A;  3T1B A;  3H0D A;  4CHU A;  2DT7 B;  1IO2 A;  3DPT A;  5D5U B;  2NNY A;  2FQ3 A;  2BHZ A;  3LSH A;  4P1W A;  2QSG X;  2R93 J;  4BBS J;  2VPR A;  3KP7 A;  2EFN A;  4YG2 F;  4XOT A;  3WGH A;  1ZGW A;  2CV2 A;  4CCN A;  3W6K B;  2ZJP F;  3O2P E;  3K2Z A;  3WHC A;  3K6G A;  1S72 I;  2CGP A;  5JLW A;  3DTE A;  2W7N A;  2HXO A;  5HVQ C;  4ETS A;  2ZJ2 A;  5B5E C;  3H3U A;  3HC7 A;  3WTZ A;  4LGW A;  2P8T A;  2VC1 A;  5EJC A;  4BQQ A;  3P9C A;  2IS6 A;  1I6X A;  2LRE A;  4HV6 A;  2EZH A;  1S7O A;  4DYC A;  5B1A H;  1PYV A;  4KNY A;  4IOC F;  2EIM H;  1WCM J;  4K2E A;  1W36 C;  2CQX A;  2NS8 A;  3QOP A;  2DJN A;  2R0Q C;  3DKY A;  3I3L A;  1RR8 C;  1REP C;  3I55 I;  1FOK A;  3WU2 C;  3LSJ A;  4OMZ A;  3PNY A;  3J7A Y;  2O03 A;  3TGN A; 
#chains in the Genus database with same CATH homology
 3E7L A;  3OIO A;  2HOA A;  4I76 A;  1LFU P;  2DMQ A;  2GLO A;  1FIP A;  4XRM A;  2P81 A;  1MSF C;  2LD5 A;  3FKI J;  3BT9 A;  3PO2 J;  4IHX A;  2DA7 A;  2DA4 A;  3G1L A;  4D5C A;  3HOU J;  3I4M J;  5E3L A;  1JTY A;  2G0E A;  4A69 C;  2O9L A;  2LLK A;  3WHB A;  5IP6 A;  1RKT A;  4RDU A;  3JRC A;  1H88 C;  1ETO A;  1X2N A;  4DZP A;  1MH3 A;  1Z0X A;  2NVQ J;  1MBE A;  4MIM A;  1YRN B;  3Q0U A;  1GV2 A;  4V2F A;  3SDG A;  3D1N I;  1NTC A;  5FKK A;  2DMU A;  5E3N A;  3HDD A;  1H8A C;  1H89 C;  3JRB A;  3LSG A;  1JGG A;  1LFB A;  4IHV A;  4FE7 A;  3ZQH A;  3OOU A;  2E2J J;  1GVD A;  1QVT A;  4DYR A;  1U78 A;  3HBL A;  4A3D J;  4MLO A;  2DN0 A;  2DMT A;  3C2B A;  1WH5 A;  1BA5 A;  3HOX J;  1IDZ A;  2CU7 A;  2L7M P;  1Z77 A;  4A3C J;  4AYB N;  1HCR A;  3Q3S A;  3GTM J;  3PM1 A;  3UKG A;  1QVU A;  2K9Q A;  1DU0 A;  3JRG A;  3S16 J;  4FCY A;  5EZG A;  3ZQL A;  3BR0 A;  1I50 J;  1POG A;  2R5Z B;  2Y31 A;  1BL0 A;  1ZTR A;  1S7E A;  2M8G X;  5EGO B;  4X6A J;  5J1U A;  4CYC A;  4A3E J;  1EF4 A;  4A3K J;  5F0F A;  5M5W J;  2K9S A;  2LK2 A;  1B72 A;  2RAE A;  3HGG A;  2MW8 A;  5FKO A;  1XG1 A;  1TWF J;  3TP0 A;  4J19 A;  1MH4 A;  1GT0 C;  1NK3 P;  4A3G J;  4M3D A;  3H3V K;  5IYB J;  4FTH A;  2H1K A;  2DA1 A;  3JR9 A;  4M3F A;  1I3Q J;  3ZQI A;  2X6O A;  1WPK A;  3GTG J;  1U9N A;  4FE4 A;  1JT0 A;  4A3B J;  2VKV A;  1IGN A;  4DZJ A;  2QF7 A;  2W48 A;  1JTX A;  1ZQ3 P;  1U9O A;  4BY1 J;  2YS9 A;  4X1E A;  4C3J J;  1MSE C;  1ETK A;  5EZH A;  3JRF A;  2JA7 J;  3F0C A;  1RR7 A;  5FKN A;  4C3H J;  2LY9 A;  5IPA A;  2HOT A;  1IDY A;  5M3F J;  2OPT A;  2VKE A;  4JYK A;  1FJL A;  5FKM A;  5K7F A;  4JX4 A;  5F1J A;  1JJ8 C;  2VUM J;  2JA6 J;  3FK7 A;  3Q0W A;  4B4C A;  2KDZ A;  1BW5 A;  1ZR2 A;  4XRS G;  2AHQ A;  1UG2 A;  2JK3 A;  3HKZ N;  3TP3 A;  3BG5 A;  3GBG A;  1W0U A;  3BR6 A;  4DW6 A;  1B72 B;  2M34 A;  2E2H J;  2EZK A;  1MBH A;  3BQZ A;  1PUF B;  2ZB9 A;  2L7Z A;  2NOG A;  4QTR A;  2CJJ A;  5IYC J;  3BG9 A;  5JLX A;  3BR2 A;  5DS9 A;  4JX6 A;  2MSY A;  3K2A A;  2Y30 A;  1BW6 A;  1UHS A;  2XGE A;  2XGC A;  1B8I B;  3CMY A;  2M9H A;  1IV6 A;  4Y7N J;  3H0G J;  2K40 A;  3IV5 A;  1Y1V J;  1F36 A;  1A6I A;  5J1R A;  1QPI A;  1XS9 A;  1JUM A;  1OJL A;  3JRH A;  4Y52 J;  1VFC A;  3JRA A;  4C2M J;  2LP0 A;  2L7F P;  4UUT A;  2K9N A;  4UUS A;  4A3M J;  1HDP A;  1JJ6 C;  2DA3 A;  5EG0 A;  3DCF A;  5J3L A;  5GPC A;  3A01 A;  3S15 J;  1VF9 A;  3HOY J;  3MKL A;  4D7N A;  3TW6 A;  5C44 J;  1Q1V A;  1W0T A;  2FX0 A;  5M5Y J;  1CQT A;  2X9D A;  4BY7 J;  2EH3 A;  1SAN A;  3A02 A;  2ECB A;  2H8R A;  3DEW A;  1I6H J;  1JKR C;  2L9R A;  5K7H A;  3GTJ J;  1JKQ C;  3IH3 A;  1ZK8 A;  1ETY A;  1AKH A;  1T33 A;  3I4N J;  2JWT A;  2EZL A;  1NK2 P;  5J1Y A;  2NVT J;  3S1M J;  2O8K A;  5IP7 J;  1K61 A;  3S1N J;  1GDT A;  2B63 J;  2CQQ A;  5M3M J;  5F08 A;  1ENH A;  3TED A;  1VI0 A;  2DA6 A;  4DYQ A;  2WAQ N;  4M3E A;  4UUS B;  2JMW A;  2LFB A;  2PMZ N;  2CUE A;  5EF6 A;  3IH2 A;  1X58 A;  4GFB A;  3A01 B;  4XRS A;  2E2I J;  2MGQ A;  3ZOB A;  4XIC A;  5IOZ A;  1FIA A;  2ID6 A;  1BJZ A;  4D7M A;  4FIS A;  1G2H A;  3BTJ A;  3GTO J;  2IAI A;  2EBI A;  1OFC X;  1JT6 A;  1HDD C;  1FEX A;  2X48 A;  5K7Z A;  2LKX A;  1APL C;  2CUF A;  1XC5 A;  3HOW J;  3FK6 A;  1ETQ A;  1SFO J;  5IP9 J;  4MFE A;  4IEJ A;  2I10 A;  3A03 A;  1ZKG A;  3SFI A;  1AKH B;  2GM4 A;  2YUS A;  4LOC A;  3PO3 J;  2HYJ A;  4A93 J;  5DTD A;  1E3O C;  4EEF G;  2COB A;  3O8G A;  2Y2Z A;  1AHD P;  5F0C A;  2GBY A;  1QRY A;  4A3F J;  2HI3 A;  3BR3 A;  3SJM A;  1LE8 A;  1ORK A;  1O4X A;  4BBR J;  4QSH A;  4XK4 A;  4S0H B;  1TC3 C;  2ME0 A;  3BG3 A;  4CYC B;  1U8B A;  2NVY J;  3GTL J;  1MBG A;  2DA2 A;  4IHY A;  5GP9 A;  1ITY A;  1WI3 A;  2ECC A;  3K7A J;  4JX5 A;  2WB1 N;  3HM5 A;  4A3J J;  2EQR A;  4ABZ A;  2XB5 A;  4MO7 A;  4AUX A;  5FJ8 J;  1TWH J;  5F0H A;  1Y1W J;  4W1U A;  1IRZ A;  4MFD A;  1AU7 A;  1UMQ A;  2FD5 A;  3BR5 A;  3BTC A;  1P7I A;  2TCT A;  2Y0S N;  3MN2 A;  5C3E J;  1R9T J;  2YU9 J;  2XB0 X;  3HEF A;  2OF7 A;  4M3G A;  3NAR A;  3LNQ A;  1HOM A;  3RQI A;  3OSG A;  2FQ4 A;  2FJ1 A;  3S1Q J;  4B3A A;  2XGD A;  1VND A;  4V2G A;  3QPL A;  3BTL A;  3TW7 A;  3CQZ J;  5E3M A;  2HQ5 A;  3GTP J;  3B6C A;  3QPS A;  1MBJ A;  1WGX A;  1JKO C;  2TRT A;  3ZQC A;  4I6Z A;  2XSD C;  4W97 A;  1FTT A;  2IEK A;  3B6A A;  3ZQF A;  1DU6 A;  3O8H A;  3FIS A;  4B1R A;  1TWG J;  1LE8 B;  2M0C A;  2R5Z A;  5C4X J;  3BR1 A;  4M3B A;  3M4O J;  4A3I J;  5GPA A;  1IUF A;  5EGO A;  1MNM C;  3S2D J;  3W6V A;  2D5V A;  2LVS A;  2NS7 A;  2N8G A;  2E19 A;  3L1P A;  4C3I J;  4QIW N;  5FLV A;  2DMP A;  2R5Y A;  1RKW A;  1D5Y A;  2R92 J;  1K83 J;  2JN6 A;  1JUP A;  2XRL A;  1P7J A;  2AO9 A;  3JRE A;  3G1O A;  3JRI A;  2HXI A;  3RZD J;  2DA5 A;  5HOD A;  4XID A;  3OSF A;  2Y9Z A;  5EDN A;  5F04 A;  1ETX A;  3LSR A;  5BNG A;  1MBF A;  2HOS A;  2ELK A;  3NAU A;  5M5X J;  2IBD A;  1IC8 A;  9ANT A;  5EG0 B;  4RBO A;  1HLV A;  3GTK J;  3BQY A;  3FIW A;  1RET A;  1HF0 A;  3S14 J;  5IOY A;  5EYR A;  3ZQG A;  3CDL A;  3RKQ A;  5EEA A;  3VPR A;  3JRD A;  2R7Z J;  2JA5 J;  4BXX J;  1A5J A;  3RZO J;  1GV5 A;  2LTP A;  5FLM J;  2Y9Y A;  2O7O A;  2M2E A;  3HGY A;  4IHW A;  1FTZ A;  1GUU A;  5FKL A;  1ZR4 A;  2R5Y B;  1PUF A;  1RPW A;  1X2M A;  2E1O A;  1ETW A;  2HDD A;  4L5E A;  2R93 J;  1OCT C;  1MBK A;  4BBS J;  2VPR A;  1B8I A;  1TWA J;  3QQA A;  1ETV A;  2L0K A;  3S1R J;  3CCY A;  3LOC A;  5E3O A;  1JUS A;  1IJW C;  2EZI A;  1ZGW A;  2DMN A;  2XPV A;  3GTQ J;  1F43 A;  2MG4 A;  3WHC A;  5JLW A;  3S17 J;  2HXO A;  2WV1 A;  1WH7 A;  3HOV J;  2LR8 A;  4AC0 A;  3M3Y J;  4A3L J;  2QCO A;  1IG7 A;  3IH4 A;  5F27 A;  4G12 A;  3BTI A;  2VI6 A;  4M6V A;  4BKX A;  1YRN A;  2EZH A;  2JA8 J;  4DYC A;  2NVX J;  4HNV A;  2KT0 A;  4JP0 A;  2XPW A;  1WCM J;  2CQX A;  1T56 A;  2DTZ A;  4NDL A;  4D5F A;  2JJ7 A;  5C4J J;  2NS8 A;  2ID3 A;  2ME6 A;  1RES A;  1TWC J;  3HOZ J;  2DJN A;  2R0Q C;  3MVP A;  3Q0V A;  3LSP A;  2XPU A;  1JKP C;  3HB9 A;  3LSJ A;  5IYD J;  2CRG A;  3S2H J;  1OCP A;  3G1M A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...