1UB9A

Structure of the transcriptional regulator homologue protein from pyrococcus horikoshii ot3
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
100
structure length
100
Chain Sequence
MEELKEIMKSHILGNPVRLGIMIFLLPRRKAPFSQIQKVLDLTPGNLDSHIRVLERNGLVKTYKVIADRPRTVVEITDFGMEEAKRFLSSLKAVIDGLDL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transcription
molecule keywords Hypothetical protein PH1061
publication title Structural analysis of the transcriptional regulator homolog protein from Pyrococcus horikoshii OT3.
pubmed doi rcsb
source organism Pyrococcus horikoshii
total genus 37
structure length 100
sequence length 100
ec nomenclature
pdb deposition date 2003-04-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13601 HTH_34 Winged helix DNA-binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 1ub9A00
2P4WA 2OA4A 2VE9A 2ACJA 2DI3A 1MGTA 2A68F 3H3UA 2OZ6A 4OIOF 2UXNA 4HF0A 2ISYA 1W5TA 5E1ZB 3C1DA 5L3GA 3JTGA 4K2EA 1ZARA 3PFIA 3WGGA 1I6XA 3E6CC 5J8CA 3ERED 1FY7A 1XGMA 4HF2A 3I0TA 2VT2A 1ZRFA 4KIFA 1V4RA 3R0JA 2G7HA 2M5WA 2R7FA 3F8CA 1K6OA 2M45A 3ZQ7A 2V9VA 2QBYA 4OIPF 4XBFA 2KJBA 1W7PA 4AIKA 1T0FA 2UXXA 5LHGA 1TQPA 5LHIA 2ESNA 5ED4A 3J80K 2XGXA 1G3YA 3O2PE 2HWVA 2ELHA 2OD5A 4LLNA 2WWYA 3FXQA 5J6XA 3LQQA 2STTA 3W6JB 1LJ9A 1ZG3A 1WQ2A 4OIRF 4EMSA 3SZTA 3KP2A 1ZYRF 1REPC 2FBIA 1X3UA 2GA2A 1USSA 4NB5A 1MDMA 4ZYGA 3LAJA 2ZMEA 5JVTA 4AIJA 1OPCA 4JQFA 4EM2A 2XAJA 5K5OA 2A5YB 3KLOA 1T6SA 2M8EA 1KU7A 3ZP5A 4KNYA 2XAGA 1ON2A 1J59A 1MJBA 4EJWA 4B8XA 3CUQA 4PDKA 2D1VA 5DCFA 1B9NA 4I2OA 3RYRA 4WCGA 2ZJ2A 2JZYA 2FNPA 1H9TA 5D8KB 3HSFA 4BHPA 1B9MA 4OIQF 1IRGA 1U6GA 3MQ0A 3RPQA 1XGNA 4Q47A 1TBXA 1IN4A 4HA8A 4RB0A 3MFKA 3CO7C 2J5PA 2PJPA 1PP8F 3EYIA 3M8FA 1UFMA 4LG0A 5L3FA 1K78B 3KP5A 3U9GA 4AIHA 2HYGD 3TKYA 1XMAA 4HOBA 2K4JA 1OYYA 4Y17A 5D5UB 3KETA 4G7HF 3SXYA 4IVNA 5LHHA 5JI6A 4O6JA 4LB6B 4I0BA 3E5XA 1J9IA 2M1BA 4G94A 3Q5FA 1R22A 1BC8C 4IJAA 2A3SA 1XN7A 1K79A 5CVVA 4YFXF 1GHCA 2Q8KA 2CGPA 1G3TA 1TLHB 2EFQA 4U0WA 1TQMA 1UB9A 2PLYA 2Z5UA 3GFJA 1OMIA 3MCZA 3WTSC 5H20A 1DP7P 4WWCA 2K86A 4M9ZA 2VBZA 5ERIA 2K4BA 3HOTA 2CFXA 3DPTA 3KEOA 2Q2EA 1TW3A 5CVUA 4HQMA 2NYXA 3WTUC 3IC7A 2ISZA 3DV8A 2O3FA 3GUDA 4M6XA 5ICGA 3JAMZ 4KIGA 1AOYA 4EGZA 5AIQA 2VOOA 1QQIA 2V1UA 1ZRDA 2KKOA 2UZKA 1KYWA 1HBXG 4G8XA 4UHTA 4KUMA 1UCRA 2A61A 4PGHA 3IRQA 1RIOH 3GZ5A 3GEZA 5K1YA 1J7KA 4EV0A 1QPMA 2Q0OA 5FLXZ 2NS0A 1J0RA 4L0YB 1RUNA 1B1BA 1S6LA 1DPRA 3K1MA 5FD6A 4EGYA 2KJCA 4UXNA 3JAMK 3KEQA 1ONVA 4A2UA 1J2XA 2EFPA 3ECHA 5ICFA 4FX0A 4HAMA 4RGRA 2L02A 1ZLJA 2O0YA 1R00A 3QP6A 1O3QA 2FBHA 4ZH4F 1ZGAA 2KRFA 2V79A 1P4XA 2WC2A 5HLIA 3M7GA 2VC1A 3F8BA 1UHMA 1XD7A 3VOEA 1ODDA 3IKTA 3RKXA 1QNTA 2HOEA 2VBYA 1Y0UA 5FLXK 3QRFF 1FX7A 2EFWA 1HW1A 2DQRA 1KA8A 2GXGA 3GFLA 1FYMA 1KQ9A 2PMUA 4ZZLA 3WTTC 1ZLKA 2E1CA 2R3SA 4KA4A 4OOIA 1R7JA 2QQBA 2W25A 1ZAOA 1CF7B 3F8MA 3C18A 1C0WA 4MHGA 3K1PA 5D6EA 4XLPF 5CYVA 4QLCU 3KP6A 5BPDA 1ZREA 2IPQX 5E8IA 5D4RA 4YFNF 2D2WA 2JRTA 1JHFA 4YIFA 4N0BA 1ULYA 4WXDA 3TGNA 3B73A 3VEPA 4O3MA 2PEXA 1XMKA 2FU4A 3P9KA 2GQQA 1MZBA 2Y48A 1XGOA 5DCMA 1AWCA 4HX4A 1XGSA 2RVCA 2EWNA 3HRMA 3TQNA 1G3SA 2Z33A 3L09A 1I1GA 3DP7A 1JHHA 1E17A 3ZMDA 3F21A 3WTZA 1IUYA 1LQ1A 3WGHA 5CVIA 3ULQB 1KQ8A 3E5QA 3VB2A 2X0LA 2MLGA 4GCVA 1QGPA 2Z99A 1G4DA 3CJNA 2G9WA 1FWZA 4KMFA 3BPXA 1XSVA 3MZYA 1XCBA 3V8JA 3G3ZA 3F22A 3BJOA 4UVAA 1JGSA 2TDXA 1SMTA 3M1EA 2LKPA 3TO6A 1IZ1A 3BWGA 3I54A 1LEBA 2P7VB 4KICA 1FSHA 2VODA 2XV4S 2XAQA 4PZJA 3B02A 2MBFA 2BBYA 4LFUA 4WX9A 5IT9Z 2H6CA 1S3JA 2XRNA 2W57A 3ABTA 2QLZA 1YLFA 4AVPA 4EJVA 4L9VA 3FMRA 2P6TA 4MQVA 4ESFA 2ZNYA 4U0VA 4N9HA 3K0LA 2XASA 2IA0A 4M72A 3HHGA 4EJUA 3KFWX 2L4AA 5E18F 1IN5A 1FBUA 3J80Z 2ADUA 1K7AA 2QM3A 2QENA 3FF5A 1U8RA 1FBQA 1CGPA 1DUXC 2W24A 3V4GA 3ZMVA 1IN8A 4H0EA 1FLIA 1SD7A 1I1SA 1U2WA 5FD5A 4ENMA 2E7WA 5IT9K 4M9SA 3RYPA 3HTUA 1VTNC 4XSZF 4MTDA 2YR2A 3TO7A 1RNLA 3ECOA 3T8RA 5DUIA 4HLYA 4IF4A 3WTWC 2EFNA 5BOXA 3Q9VA 2PBIA 4UVCA 5HDNA 3L9FA 1QBJA 2VE8A 1WWXA 4WXCA 5H6QA 2VBWA 5D5VB 5HVQC 3I59B 1USTA 2P8TA 4R8HA 3HYIA 4G9YA 3T8TA 1BI0A 4ZYDA 5LBQA 2DPDA 2FXAA 3HSEA 4ZYEA 4U88A 5K5QA 3FM5A 4MEYF 4IPAA 1OR7A 5HS7A 3E5UA 4ZZDA 2O8XA 1O7LA 2RQPA 1MKMA 1W5SA 3ZPLA 2EV0A 5LGTA 2D45A 3FHZA 4PCQA 4LJZF 1XB4A 2JTVA 5E1WA 3R6SA 4TV7A 1QZZA 1IXSB 1I5ZA 3RKWA 5HLHA 2YU3A 4MTEA 4A6EA 3K69A 4M71A 4GGGA 4N9IA 2RKHA 4JK1X 4S05A 2Z9OA 3D0SA 1S7OA 2OAZA 3IRRA 1SFUA 3HOSA 5EEGA 4UV9A 2IA1A 4M9XA 3RTRA 1S29A 1Z91A 1Q1HA 1HXDA 2DW4A 1EH7A 1O7FA 1BC7C 2EA2A 4BHCA 3M9AA 5LRSA 2PN6A 2DTRA 4HW0A 2H27A 3F8FA 2QBYB 4RAYA 3I71A 3REOA 4R79A 3FXUA 1BBYA 5FO5A 1ZG5A 4ZYHA 3RDIA 2LNBA 4IRGA 4RB3C 5FFZA 4S04A 4UV8A 1O3RA 2YSRA 3WTVC 5DD4A 1OYIA 1T38A 1Z1DA 1FBSA 4GO1A 2B0LA 2P7CB 1XDUA 4G6QA 3EQLF 4CZZA 3LSTA 5CLSA 5LGNA 2ZBKA 3LA7A 3J81Z 3BY6A 4XSXF 3EDPA 5CJ9A 1MDMB 2ZMEB 3FM3A 1KYZA 3J7AO 2BEOA 3C7JA 4UVBA 4FX4A 2COMA 4L9TA 2UWMA 1LDKB 2DK5A 1BOAA 4Q5SF 2A6EF 1GXQA 2WTEA 4LGWA 3F72A 1WSUA 3V7SA 4BQAA 2DFIA 4BH9A 2LSOA 5LLQA 3CUQB 4WF2A 5BS6A 2Y75A 5IT3A 2CO5A 3F6VA 1G3WA 3LWFA 3WTYC 4BNCA 5ILVA 2RDPA 4YFKF 4OINF 3FZVA 3TOBA 2IVMA 2XAFA 3RPUA 1R5HA 3J81K 2EA4A 3MWMA 1YS6A 2HTSA 2QWWA 1TQIA 2F5EA 3HIFA 5L3EA 4HYEA 3IHUA 2VXZA 3HHHA 1RI7A 2GAUA 3JTHA 2EV5A 2PMHA 1HW5A 2FOKA 3IWZA 1SFEA 2MH9A 5ILUA 2NNYA 2K02A 4U7DA 1MJAA 2FRHA 5HOOA 4P9FA 4U7BA 1PP7U 5AONA 4OU0A 3LA2A 1WRJA 4RS8A 1R1VA 1XSXA 3W6KB 2HS5A 2GXBA 5L3DA 4RAZA 3GW2A 3F23A 2F5DA 1BI2A 3FWEA 4G7ZF 3L00A 4CICA 3ZMUA 4YIIA 1Z6TA 2GA1A 1U5TB 1OYWA 2VBXA 1CF7A 2YX7A 3KE2A 2QQ9A 4HX8A 3CDHA 3R61A 3JSPA 2P5VA 3H92A 3ML6A 4I0AA 1DDNA 1ZH5A 4LMYA 1U3EM 5F6FA 3L7WA 2JSCA 1FYLA 2HKOA 2Y0MA 5FFXA 5KK1A 2J5OA 6PAXA 3CO6C 1F5TA 1D8JA 3KZZA 4HDVA 3ZN0A 2NNNA 5D5XB 3OV8A 2DAOA 5L3BA 1V3FA 2NAZA 4A5MA 2RV8A 3U1DA 2L01A 2X4HA 4LLGF 5JFRA 1FYKA 3MEXA 3RKYA 3SFZA 5EEHA 2H6BA 3TO9A 2NRAC 5E1XA 1OKRA 1L3LA 3QU6A 4P55A 3DEUA 1ZN2A 1Z6RA 4RGXA 3GWZA 4Z2YA 3TDUC 4A5NA 2KIMA 5JR3A 3CUQC 4IHSA 3WODF 1UHWA 5LRRA 1B4AA 1R58A 2HGCA 1STZA 1S7AA 1R36A 3F3XA 1RZ4A 5LEJA 4D0PA 2BV6A 3T1BA 5CVRA 2PI0A 5DV5A 3WU0A 3HRUA 2P5KA 2HQNA 4DQ2A 2JPCA 2HZTA 1T98A 4L18B 5HLGA 3WGIA 1LNWA 4XRFA 2C6YA 2L54A 1GXPA 3P7NA 2P5LC 1L0OC 4AWXB 3LA3A 2FEZA 2ZCWA 2W84A 2VT3A 4L5IA 5HS8A 3PQKA 1FP1D 1D5VA 2IJLA 1P6RA 2HR3A 5DEQA 1H0MA 2BE5F 2V1DA 3KCCA 1P2FA 1R23A 2O03A 3CUOA 2H09A 2EB7A 1U5TC 4HBLA 5J8FA 1IAWA 4ESBA 4MQ9F 3TOAA 1B59A 2PG4A 4EJTA 3V8KA 1YS7A 2A6HF 2RNJA 1BM9A 3HTSB 1DPUA 3V7CA 2FNAA 3WG9A 4I7HA 2FQ3A 3E3VA 3E6MA 3T5XA 4AD9A 1ZG1A 4A0YA 3GFIA 1FT9A 1Z05A 4I09A 4G6DA 3NRVA 4IRIA 3I59A 1TW2A 3V8LA 3EETA 3RIRA 1H9GA 3ZN1A 4MGRA 3I4PA 1EH6A 3I64A 2QYOA 2EK5A 2OBPA 4L5JA 4A0ZA 4NHJA 2F5CA 3BZ6A 2M87A 5CVJA 3MZHA 2Z3YA 4ETSA 2K27A 3ZMTA 2GWRA 3Q9SA 3R60A 3KP3A 4YG2F 1ZHFA 5DYMA 4HZFA 1FSEA 1G6NA 3I58A 5E20A 5DDGA 1P4AA 1BIBA 3CTAA 3SZPA 2AXLA 1HKSA 1XCVA 1A04A 1HQCA 2GZWA 2FMLA 3RI4A 2O6GE 1SMYF 2ESHA 4ON0A 1YTYA 3FMQA 1BN5A 4BYYA 4L0ZB 2BGCA 1Z7UA 2HQRA 3RJPA 3KZYA 4UUVA 5DD8A 2PQ8A 4EQQA 2XUBA 4EM1A 3F8NA 3HRSA 4F7ZA 1KU9A 3ZMSA 4ENJA 4LK0F 4KN7X 1SAXA 2IA2A 3P9CA 1D3YA 1JE8A 2LDUA 1SD6A 5DUKA 3H3ZA 1TTYA 4QWQA 3E97A 1IN6A 2XKPA 4Y15A 1R1TA 2XIGA 2G7UA 2RGVA 2CSOA 3QOPA 5ILSA 3KLNA 4KN4X 4M73A 2O61A 1YW8A 5TJJA 2LF8A 2A69F 4NQWA 4RB1A 4MEXF 1YQAA 3JW4A 1I27A 2CG4A 4M74A 4A0XA 3QPTA 3KP7A 1K78A 4G7OF 2MA3A 2IT0A 2MD5A 3R4KA 1ZRCA 2FE3A 2MLKA 2HFHA 2DPUA 4LB5A 1T39A 3EUHA 3LQRA 3GZ6A 3DXJF 1SD4A 4GYIA 1LVAA 3N4MA 2RC4A 2QQAA 2STWA 2VC0A 4P5OA 2VOPA 1Z9CA 1B6AA 1W7PB 3S2WA 4A12A 5F1RA 2XKOA 3K2ZA 2K7LA 1F9NA 2F2EA 2VONA 4UNOA 3K9TA 4I02A 1WKMA 2LF7A 3ROUA 3BROA 4KDPA 2KIUA 5H6RA 3KP4A 1F4KA 1W7PD 2OZUA 3O6BB 1BI1A 2OQRA 2ZXJA 1YG2A 5HS9A 1FC3A 5FB2A 3BPVA 2FF4A 2KIFA 4BAYA 2R7DA 3ISPA 3BJAA 2EFOA 5BPIA 4Y13A 3AAFA 2DT5A 4EJOA 3E6DA 2HKXA 4KT5C 3WTXC 5D4SA 1YFHA 5E8GA 2VN2A 4RB2C 1WI9A 1RUOA 2CW0F 1BIAA 3DPLC 2DQLA 2DLLA 4JBAA 2HTJA 4Q4ZF 4OMZA 3ELKA 1EH8A 2MC3A 3IKVA 3LFKA 4I98B 5BMZA 3N97A 3GYHX 4KIBA 4FT8A 1U5TA 3WE3A 3NEUA 3GO5A 1FP2A 3GX4X 2JT1A 2OQGA 3DFGA 3E6BA 4I01A 2XVCA 3PQJA 3BDDA 1IXCA 1HSTA 1QZYA 1HSJA 4RGUA 3ZMZA 2BYVE 4IXAA 3WU1B 1IXRC 3DKWA 5JHUA 2MH2A 2DU9A 2FBKA 1YYVA 4LG0B 2QUFA 4RGSA 1YW9A 4KFCA 2XHKA 3SQNA 1TNTA 3IWFA 2IP2A 3R0AA 4A6DA 5AIPA 4EM0B 3MAJA 2QZ8A 2L4MA 2CYYA 5FGMA 3FMSA 4KYWA 2ZO4A 3NQOA 4HV5A 5HDKA 2D1HA 3COAC 1PDNC 1QO0D 3BOQA 1IF1A 4EVIA 2FSWA 2HDCA 1ON1A 3P9IA 1HKQA 1LEAA 2OU2A 5D6FA 2EJRA 1HW2A 2ZFWA 2ETHA 3O3KA 4XLNF 2F5FA 4ASNA 2AS5F 1BJAA 1U78A 3QPHA 3VODA 1BI3A 1MD0A 3DF8A 5D5WB 3CLOA 3QU3A 4GXOA 2ZNZA 4LK1F 1KU2A 4LLLA 4CDGA 2FMYA 5E17F 4HV6A 5K5RA 1YW7A 2P6SA 4L9JA 1PUEE 3FXRA 1XSDA 3GLXA 4WXHA 3HUGA 1FPQA 1SD5A 3C3WA 1T2KA 3ABUA 3I53A 3M8EA 4HX7A 3L2CA 3WE2A 4IRHA 2IRFG 4BHBA 2YX4A 3GFMA 2XROA 3GF2A 4KMUX 2ZKZA 3OOPA 1KU3A 5BQTA 1SFXA 2E7XA 4FHTA 1KQ0A 1J75A 5D8LB 1E2XA 3QP5A 5LGUA 1TNSA 1FNNA 4Q48A 2QVOA 4O5VA 3IL2A 4U0YA 4B09A 4PGGA 4WK8F 1FOKA 1J5YA 1S8NA 4CHUA 4CXFA 1ZGJA 3VFZA 5KVRA 1R5GA 2FA5A 3D5LA 3G73A 3LAPA 1MJ9A 4CYDA 2CQKA 4ESJA 2E1NA 1O3TA 4IHTA 4MNUA 1HKTA 3GXOA 3TDZC 2HEOA 2EV6A 1P92A 1F1ZA 1EV7A 2PFBA 2V1XA 3I5UA 1LDDA 4CGZA 5LEKA 1KGSA 2A07F 2L3DA 4M6YA 1R1UA 1XDSA 2JPBA 4ENNA 3HRTA 3U2RA 1JXSA 1YO5C 2RN7A 3GVAA 2IW5A 1IN7A 2H94A 1IRFA 1IW7F 4OMYA 4CO8A 5L3CA 5A2QZ 2V6CA 4E70A 4HLXA 1GVJA 2HYFA 1O3SA 4HDUA 3F6OA 2DK8A 1FZPB 5TRDA 3SHFA 1W4MA 3BP8A 3HSRA 2YPRA 4L9NA 3FX3A 5HDGA 3JSOA 2XAHA 4P9UA 1D8KA 2CWEA 2WV0A 4P96A 1LDJA 4R1HA 3QAHA 4HQEA 4GYGA 3EYYA 3T0YA 4LD5A 2W85A 5ICEA 2DO7A 5F64A 2GIVA 1P4WA 1O57A 5DCMB 3K1NA 4ENKA 4HF1A 5ICCA 4DNCA 1YIOA 3DQVC 5A2QK 1NHAA 4BXUA 3BJ6A 1LB2A 2M30A 2DBBA 3V7RA
chains in the Genus database with same CATH superfamily
5F0HA 2EZIA 2MGQA 3OR1C 2P4WA 4RMNA 2OA4A 2VE9A 2X6XA 4XM3A 2ACJA 2DI3A 1XMXA 1MGTA 1HDPA 2A68F 4HEA2 3UR3C 4XLAA 3AKZA 3CCVI 3H3UA 2OZ6A 2Y69H 2D5VA 4OIOF 2UXNA 2DTZA 2NVTJ 4HF0A 3K70D 3EUKL 2ISYA 1W5TA 5IY5H 1I6HJ 4IX7A 5E1ZB 3AG1H 3C1DA 5L3GA 1QRYA 3JTGA 1WJCA 4K2EA 1ZGWA 1ZARA 2W82A 3PFIA 5FRNA 2YU9J 3WGGA 1I6XA 3E6CC 4AIDA 1VQ4I 3RSNA 4B1RA 2CJJA 1IO2A 5J8CA 3ERED 1FY7A 5J1RA 2QGUA 1XGMA 1Y0NA 5FROA 5FLMJ 4II2A 4HF2A 3I0TA 3KPHA 1MSEC 5EG0B 2ZC2A 3RZOJ 1Z7LA 4XOPA 2WAQA 2VT2A 1ZRFA 4KIFA 1JT0A 1EJ9A 3K4LA 1JUPA 1V4RA 5B3SH 2MSYA 3R0JA 3AG2H 2G7HA 2M5WA 2R7FA 3MD2A 3OR2C 3F8CA 1K6OA 2M45A 3ZQ7A 4D5CA 2BXYA 4A3FJ 1N75A 2V9VA 2QBYA 3CC4I 4OIPF 4XBFA 1IJWC 2KJBA 4I76A 3K4MA 1W7PA 3OYKA 4AIKA 1T0FA 2UXXA 5LHGA 4CCOA 1XC5A 4J00A 3OL3A 1TQPA 5LHIA 2ESNA 5ED4A 2KIQA 1DGWY 2E1MC 3J80K 2DDAA 3ZOBA 2XGXA 2HXIA 1G3YA 4CYCA 3CCJI 1T95A 1MMGA 3PO2J 2K40A 2CS3A 1X1DA 2HWVA 3O2PE 1SFKA 2K85A 3A02A 2GBYA 3QWLA 5C44J 2ELHA 2ZJQF 1T8IA 2E2IJ 2OD5A 4LLNA 4D7NA 2WWYA 1UHSA 4PSXA 2XF7A 3FXQA 5J6XA 3LQQA 1E3HA 2STTA 2DFEA 3W6JB 1LJ9A 2CV2A 3LMMA 4A93J 5BNGA 1ZG3A 3HDDA 1WQ2A 4OIRF 2XF5A 2IGKA 4EMSA 3A4CA 3SZTA 4DBRA 3KP2A 1ZYRF 2VJIA 3LSKA 1JJ8C 1B72A 1REPC 2FBIA 1X3UA 3S1NJ 2GA2A 2R7UA 1USSA 2VQGA 4NB5A 4LOCA 3JCUC 4ZYGA 2HYJA 1MDMA 2LRDA 3LAJA 2ZMEA 5JVTA 3VYSB 1OPCA 4AIJA 5KHDA 4JQFA 2H1LA 2OUMA 2XAJA 4EM2A 1HCRA 2DT7B 5K5OA 2A5YB 2P81A 3KLOA 1T6SA 2M8EA 4C3IJ 1KU7A 4YELA 4OWRB 3ZP5A 2O8KA 2MFZA 4KNYA 2JJ7A 2LBFA 4N4OB 2XAGA 4S0HB 1GLNA 3SZGA 1ON2A 2X48A 4NBQA 3PUBA 1J59A 3PO3J 2X6OA 4XLHA 1MJBA 3GTJJ 4EJWA 4B8XA 3CUQA 4A3CJ 1UELB 4RAGA 5M5YJ 4I6ZA 4PDKA 2CUFA 4AC0A 2D1VA 1SANA 1B9NA 1EA3A 5DCFA 3K4KA 4I2OA 3TL4X 2HOAA 1G8XA 3PNVA 3PL8A 3NWTA 3RYRA 3BTIA 3JRIA 3HOWJ 4WCGA 2CMPA 2BY0A 2ID6A 2M3AA 2ZJ2A 2JZYA 1FIAA 3OWTA 2FNPA 2O7OA 1H9TA 2EIKH 5D8KB 4IQJA 1XPXA 3HSFA 4BHPA 3CCYA 3K70C 1B9MA 5J4YA 3A0HC 2DODA 4OIQF 1MNMC 1IRGA 1BW5A 1U6GA 2ICWG 3MQ0A 4X1EA 3RPQA 1XGNA 4Q47A 2RNGA 1TBXA 1IN4A 4HA8A 4RB0A 3MFKA 4GDFA 3FBNB 3CO7C 4QPQA 3VDXA 2J5PA 1LE8A 2PJPA 5CQGA 2L9SA 4C2TA 1PP8F 2XB0X 3EYIA 2L9VA 3M8FA 2NVYJ 2HZDA 1UFMA 3Q0WA 1AKHA 1GT0C 4LG0A 5L3FA 1K78B 2VJ5A 1QVUA 3KP5A 4RDUA 4XLEA 3U9GA 4AIHA 1T08B 3HC7A 2F48A 2HYGD 3TKYA 1UJ8A 4HSTA 2W48A 4XICA 1XMAA 2Z2SB 2K9SA 5EEAA 2VXDA 4HOBA 2K4JA 1WZ2A 3CJTB 3HOYJ 1BR4A 1OYYA 4Y17A 5D5UB 3KETA 3DBLB 4G7HF 3SXYA 2Y0SA 3S14J 4IVNA 4BBRJ 5LHHA 5JI6A 4O6JA 1X2MA 4ZDLA 4LB6B 2QKMB 4I0BA 2DA5A 3E5XA 1SC7A 1ORKA 1J9IA 2M1BA 1ZELA 4QSHA 4G94A 3Q5FA 3E1SA 4XRSA 1R22A 2E34A 1BC8C 5FKNA 3FIWA 4IJAA 2A3SA 2HOTA 4G6TB 1XN7A 4JX4A 3ABMH 3OS1A 1K79A 2LTPA 5CVVA 4YFXF 1GHCA 2Q8KA 2CGPA 1G3TA 1TLHB 2EFQA 4U0WA 1TQMA 1UB9A 2PLYA 2Z5UA 1TP4A 3GMEA 3GFJA 1OMIA 2FOWA 2JN6A 3MCZA 3WTSC 3JRFA 2DYRH 5H20A 1DP7P 4WWCA 2K86A 4M9ZA 3H9JA 5EGOB 2VBZA 5ERIA 2KFDA 2ZXWH 1ETXA 3GTPJ 2K4BA 4RLQA 3M1CA 2CFXA 3DPTA 3HOTA 3KEOA 2LY2A 3HKZA 2Q2EA 3OMYA 1TW3A 4E7SA 5CVUA 2JA5J 4HQMA 2NYXA 1LFPA 3PNYA 4DBQA 2R5ZB 3WTUC 1JI8A 3GZNB 1MMDA 3IC7A 2LH9A 2ISZA 3DV8A 2DMQA 1GDTA 2O3FA 2HVRA 2V6EA 3GUDA 4M6XA 3VYTB 5ICGA 3CCUI 3S1MJ 3OYHA 4PK4A 1PUFA 4ZTJA 3JAMZ 1MBGA 3C2BA 4KIGA 1T56A 5KNLA 3PUFA 1AOYA 4EGZA 5AIQA 5HNFA 5CQEA 2VOOA 1QQIA 2V1UA 1YX3A 1ZRDA 4LIVA 4GRIA 1MMAA 1DU0A 4F92B 4CZCA 2KKOA 2UZKA 4B43A 3OIPA 1KYWA 3CDIA 4G8XA 4UHTA 1HBXG 2EINH 4KUMA 2F4MB 3GTKJ 2KLOA 1UCRA 3HBLA 2IGOA 2LY9A 5EYRA 2R5YB 2A61A 3S3NA 4Y3OA 4PGHA 3VWBA 2KDZA 3IRQA 1RIOH 3WHBA 3GZ5A 3IP4B 3GEZA 5K1YA 2G0EA 1J7KA 3DEWA 1NG6A 3ZR8X 3SDGA 1Z21A 1WH5A 4EV0A 1QPMA 1X58A 2Q0OA 1FOXA 5FLXZ 2NS0A 5KCMA 1DQUA 1J0RA 2H8RA 4L0YB 3DPUA 3PIOF 1RUNA 1B1BA 2V26A 1OR7C 1S6LA 2JSPA 4CCKA 3LL7A 1DPRA 3K1MA 2LOOA 2DT6A 4H4KC 5FD6A 4EGYA 2KJCA 4UXNA 3JAMK 1K6YA 3J7ZI 4BE0A 2Z1DA 3AFHA 3HXLA 1JKOC 3KEQA 1ONVA 4A2UA 1J2XA 4FE7A 1A5JA 2EFPA 3M8JA 3ECHA 5ICFA 4FX0A 4HAMA 2FX0A 2L02A 4RGRA 4IHYA 4BXFA 4HNUA 1ZLJA 2KRHA 2O0YA 2OCCH 5CKTA 5IP7J 3S17J 1R00A 2JRMA 3QP6A 1O3QA 2FBHA 4DGWB 2OTJI 4UUTA 4ZH4F 1FJLA 3CLQA 3RPUD 4QTRA 4A3BJ 1SVOA 1ZGAA 2KRFA 4IEJA 3TP0A 2V79A 5M5XJ 1H88C 1P4XA 2WC2A 2HDWA 5HLIA 3M7GA 2VC1A 3F8BA 1UHMA 1XD7A 3VOEA 2R7QA 3PFYA 1ODDA 1W5CC 3IKTA 3RKXA 1QNTA 2HOEA 2VBYA 2R7VA 1Y0UA 2V4JC 3EUHC 5FLXK 1E3OC 3QRFF 1FX7A 2EFWA 5B1AH 4AM3A 1HW1A 2DQRA 2VB6A 1KA8A 2GXGA 3GFLA 1FYMA 1KQ9A 2CUJA 3BTCA 5IOYA 4YIRX 3JRAA 2PMUA 4ZZLA 3WTTC 1NH3A 1ZLKA 2E1CA 1YE9A 2R3SA 3DLAA 4KA4A 4OOIA 1R7JA 2QQBA 2W25A 1S9HA 1ZAOA 1CF7B 3F8MA 2LR8A 3C18A 2BY2A 1C0WA 4MHGA 3DBRB 3CCRI 1HC8A 3K1PA 3PSIA 3FISA 5D6EA 4XKWA 2CRGA 2ZXHA 1EKEA 3SEZA 5E3LA 3KX2A 5M3MJ 4XLPF 4RM3A 1WFXA 4KJZA 3ASNH 5CYVA 4QLCU 3KP6A 5BPDA 1X4OA 1ZREA 2IPQX 5E8IA 5D4RA 4A3IJ 2XPVA 1JKPC 4YFNF 2D2WA 2JRTA 1JGGA 1JHFA 4YIFA 2X1EA 4N0BA 3PIPF 4A3JJ 2QQ8A 1ULYA 2EZHA 3K4JA 4WXDA 1YHQI 3TGNA 3B73A 1A31A 3VEPA 4O3MA 3C2HA 1TZLA 1FEXA 2PEXA 1FMVA 2E1MB 5JHFA 5C3EJ 1XMKA 2FU4A 5FJ8J 3I3LA 3IH4A 3P9KA 2GQQA 1MZBA 2Y48A 1APLC 1XGOA 5DCMA 1D1BA 1AWCA 4HX4A 1XGSA 3A0BC 2DFFA 1VQLI 2N8GA 3ASOH 3S1RJ 2RVCA 2EWNA 4PJ0C 3OYBA 3K4CA 3S3OA 3HRMA 4I99C 3TQNA 4IO9F 1G3SA 5JVGF 2Z33A 3L09A 1I1GA 2X51A 3DP7A 1JHHA 1E17A 2K3FA 3ZMDA 3F21A 3BTLA 1IRZA 3WTZA 1OCOH 3FXJA 2EIJH 1IUYA 1LQ1A 3WGHA 5CVIA 3ULQB 3S2HJ 1KQ8A 3E5QA 3H1CA 3HEFA 3VB2A 2X0LA 2MLGA 5EZHA 4GCVA 1LVKA 1QGPA 3OYFA 2Z99A 1G4DA 1R6RA 3CJNA 1WJFA 2G9WA 1FWZA 1FOWA 4KMFA 3BPXA 5DTDA 1XSVA 3MZYA 3RCOA 1R9TJ 4XN3A 3CCLI 3CJQB 1XCBA 3V8JA 3LSPA 3G3ZA 4CA0A 3F22A 3RQIA 3EUAA 3BJOA 3CCQI 2DDBA 4UVAA 1JGSA 1UG0A 4BQNA 3GTQJ 2TDXA 1SMTA 3M1EA 5GTIC 2E2HJ 2IS1A 2DA1A 2EILH 2LKPA 2XB5A 3TO6A 1IZ1A 3BQZA 3BWGA 3I54A 1LEBA 2OTLI 1V54H 2P7VB 4MIMA 4PFOA 2R92J 4KICA 1FSHA 4XRSG 2VODA 2XV4S 5EG0A 2XAQA 4PZJA 5HODA 1BA5A 3B02A 4N4NB 2MBFA 2BBYA 4LFUA 4OAYA 3BR1A 4L5EA 4WX9A 5IT9Z 2H6CA 3D5RC 1A35A 1Z3YA 1S3JA 5JLWA 2XRNA 1LFUP 3ZQQA 1KZHA 1R49A 2W57A 4UB6C 2V1NA 3OIOA 1VQ6I 3ABTA 2QLZA 1YLFA 4AVPA 4DZPA 4EJVA 1HDDC 2X9DA 4L9VA 3OYMA 4E7KA 2R93J 2BXZA 3FMRA 2P6TA 2WB1N 4MQVA 4ESFA 2ZNYA 4U0VA 4N9HA 3K0LA 2XASA 3BCBA 2IA0A 4M72A 2R7XA 5FRMA 3HHGA 4F52A 3K4NA 4EJUA 3KFWX 5JLXA 3W2AA 2L4AA 5E18F 1IN5A 1FIPA 5C4XJ 1FBUA 3W3CA 3J80Z 2ADUA 3AL0B 1K7AA 2QM3A 2QENA 2XGEA 5H2FC 3FF5A 5IYBJ 4C3JJ 1U8RA 2R7ZJ 2W7NA 1ZR4A 1FBQA 1CGPA 1DUXC 4B4CA 3G1OA 2W24A 2LP0A 3V4GA 2BHZA 1X1AA 3H0DA 2LVSA 3ZMVA 1Z3XA 2VQLA 1JUMA 1D5YA 1IN8A 3MKWB 2Z16A 4H0EA 1FLIA 1SD7A 1I1SA 2MD0A 1U2WA 2F5VA 5FD5A 4ENMA 1LPQA 1ERDA 2Y30A 4NC6A 4NUBA 2VQCA 2DJNA 2E7WA 2ZXIA 5IT9K 2R7SA 1X2NA 4M9SA 4RAFA 1LFBA 3QODA 1GV5A 3RYPA 2A5WA 3HTUA 4XSZF 1VTNC 3CCMI 4MTDA 2YR2A 3TO7A 3S15J 1POGA 4II3A 4C2MJ 1RNLA 3ECOA 3PM1A 2VJJA 5F04A 3JRDA 3T8RA 2HOSA 1GV2A 5DUIA 4HLYA 4IF4A 2VPLA 3WTWC 2OPTA 4BS9A 2EFNA 5BOXA 2KPMA 2PBIA 2PMZA 3Q9VA 4QPOA 4UVCA 5HDNA 2QSHX 3HOZJ 2LYCA 3L9FA 4XK4A 3H5AA 3JR9A 3FKJA 1QBJA 4RA2A 2VE8A 1WWXA 4WXCA 4JX6A 2VBWA 5H6QA 5D5VB 5HVQC 3I59B 1USTA 2P8TA 1K4SA 3S16J 4R8HA 1F43A 3HYIA 4G9YA 3T8TA 3LSGA 2UUZA 1MNEA 1WCMJ 2WAEA 1BI0A 4ZYDA 5LBQA 2DPDA 4V2FA 2FXAA 4A3DJ 3HSEA 4C3HJ 4U88A 4ZYEA 3FM5A 4MEYF 5K5QA 4IPAA 4M6VA 1OR7A 5HS7A 4D1QA 3E5UA 1VZ0A 2RAEA 4M3EA 4ZZDA 2O8XA 2XSDC 2DJIA 1VQPI 1O7LA 2RQPA 3E7LA 3F0CA 1MKMA 3KIOA 1W5SA 3ZPLA 3OYNA 2QCOA 2ZFUA 3OS0A 2EV0A 5LGTA 2D45A 3FHZA 4PCQA 5J4VA 4LJZF 2A05A 1XB4A 3J7YJ 3DTIA 2JTVA 1MBKA 3OOUA 2IS2A 5E1WA 3R6SA 4TV7A 1QZZA 2HVQA 1IXSB 3WG7H 1VNDA 4EEFG 1I5ZA 2DMTA 3BLYA 3RKWA 2YU3A 4MTEA 4A6EA 5HLHA 3BG9A 3K69A 2H1KA 2W4SA 4M71A 4GGGA 4N9IA 2K9LA 5E3NA 2RKHA 4JK1X 2LD5A 4S05A 2R7RA 1D1CA 3D0SA 2Z9OA 1S7OA 2OAZA 4W97A 3IRRA 2DA7A 1ZQ3P 4IOCF 5GTHC 1SFUA 3HOSA 2DOEA 5EEGA 1Z77A 2TRTA 2R7OA 2IA1A 4M9XA 4UV9A 3H0GJ 3RTRA 1I3QJ 1S29A 1Z91A 4B3AA 1VQNI 1Q1HA 1HXDA 2DW4A 1EH7A 3G1LA 1BR1A 1O7FA 2QSFX 1BC7C 2EA2A 4BHCA 3K4BA 3M9AA 4MFEA 5LRSA 2PN6A 1UG2A 5E79C 1B8IA 2JMWA 2EIMH 3IUOA 4HG2A 1XTAA 3VYUB 2DTRA 1WPKA 3HM5A 1NK3P 4HW0A 1MMSA 2H27A 3F8FA 2QBYB 2WAFA 4FTHA 3BR2A 4RAYA 3FXOA 1G2HA 2KRCA 3I71A 3REOA 2VPRA 2BY3A 2AXTC 4R79A 2M7BA 3FXUA 1BBYA 1TWAJ 5FO5A 2CQXA 1ZG5A 4ZYHA 1IDYA 3OYEA 3RDIA 3AG3H 3DEEA 2LNBA 4IRGA 2L0KA 4RB3C 1I50J 3DKYA 5FFZA 4CCMA 3LSRA 2Y9ZA 4CH7A 4DW6A 1ZK8A 4S04A 3K6GA 2CQ7A 4Y4RA 5EGOA 2LKXA 1IUFA 4UV8A 4NQWB 3ZQGA 1O3RA 1OQYA 1FMWA 2YSRA 3BG7A 3WTVC 1W0UA 5DD4A 1OYIA 2GIZA 1YJNI 4PJJA 1T38A 1Z1DA 5KAFC 3AL0C 4HRIA 1OCZH 1YOVB 1FBSA 4GO1A 4FASD 2IEKA 4BY1J 2B0LA 3SDBA 2P7CB 5GPAA 1XDUA 4G6QA 3EQLF 5GAGJ 1T33A 4CZZA 2I8DA 3TP3A 1VQKI 3LSTA 2M4GA 3QPLA 5CLSA 5LGNA 2L7FP 3BC8A 2WA0A 2X6YA 2ZBKA 4B3XA 3LA7A 4DYCA 3J81Z 2DN0A 3BY6A 1SVLA 1B72B 1MBJA 4XSXF 3EDPA 5CJ9A 1MNDA 1MDMB 1TWGJ 1X4PA 2ZMEB 3ZQHA 3DCFA 3FM3A 1KYZA 3J7AO 2BEOA 3C7JA 4UVBA 4UUSA 4J01A 2V9PA 4FX4A 4BE1A 2COMA 4L9TA 2R7WA 3QPSA 3QOEA 2UWMA 1LDKB 3BR3A 3KYDB 3KZIC 2DK5A 3MKZA 1BOAA 3BR6A 4Q5SF 2A6EF 1GXQA 2WTEA 4LGWA 1RKTA 3F72A 2DA4A 1SAUA 3GTMJ 2VASA 1WSUA 2MG4A 3V7SA 1XX5A 3H36A 4XORA 4BQAA 2DFIA 4BH9A 2LSOA 3H9GA 4FQGA 5LLQA 3CUQB 2M0CA 4PFPA 4WF2A 5BS6A 2GM4A 2ZJPF 1WJBA 4AUXA 2Y75A 5IT3A 2CO5A 3F6VA 4KITB 1G3WA 4NDLA 3CC7I 1YRNB 3LWFA 3WTYC 1NG7A 2PJRB 4DJAA 4BNCA 3CMEI 3LSHA 5M3FJ 5ILVA 1QU3A 2RDPA 5GP9A 4B44A 2CH0A 1DU6A 4YFKF 4OINF 3FZVA 3TOBA 3OYIA 4IHWA 2Q1ZB 2IVMA 4BDZA 2XAFA 3RPUA 1R5HA 2EA4A 3J81K 4A3MJ 1KONA 4NNJA 1I39A 1YS6A 2HTSA 3IH2A 3MWMA 4DIQA 3D1NI 2KDOA 2QWWA 1TQIA 2F5EA 1IRXA 1WJ5A 4UY8I 1MH4A 3HIFA 5L3EA 3IH3A 1LE8B 5EDNA 4HYEA 2DCEA 3IHUA 1IDZA 4BU2A 1SVMA 2VXZA 3HHHA 1RI7A 1Q1VA 2K9NA 3LSJA 1AKHB 2K5CA 2GAUA 2XGDA 3JTHA 3ZRGA 4C2UA 2DOFA 2EV5A 2PMHA 1HW5A 3KEYA 2FOKA 2MYSA 3IWZA 2OV7A 2B63J 1SFEA 2MH9A 5ILUA 2NXNB 5FKKA 2NNYA 2K02A 1XG1A 4U7DA 1MJAA 2FRHA 5HOOA 4P9FA 2XDVA 2E36A 1ETKA 3FXLA 4BEHB 4U7BA 1PP7U 3M3YJ 5AONA 2M34A 4OU0A 3LA2A 1WRJA 4RS8A 5GAEJ 2QSGX 1R1VA 1XSXA 5HLTA 3W6KB 5E3MA 2HS5A 2CW7A 2GXBA 5L3DA 1U9NA 1E3PA 3NARA 4RAZA 3GW2A 3F23A 3OYJA 2CQQA 5F0FA 2F5DA 1BI2A 3FWEA 2BZTA 3FXKA 2CW8A 4G7ZF 3L00A 4PSWA 2KZVA 5FKMA 3DWLE 2OCEA 2M0MA 2EZLA 2KP6A 3BZCA 4CICA 3BTJA 4HSRA 3ZMUA 5FLVA 4YIIA 1Z6TA 2GA1A 1U5TB 1BR2A 4A3EJ 1OYWA 2VBXA 2QA4I 1CF7A 4BE2A 2YX7A 3KE2A 2BW3B 2F4OB 2QQ9A 3TW6A 4HX8A 3CDHA 2GXAA 3R61A 3JSPA 2P5VA 3H92A 2LMDA 4XKCA 2JK3A 2L7ZA 3IAM2 4B47A 3ML6A 4I0AA 4BY7J 4BXXJ 1PVEA 1DDNA 1ZH5A 4DYRA 4LMYA 4XOTA 2DA3A 1U3EM 5F6FA 2WAQN 3L7WA 3G6EI 2HVSA 2JSCA 1WHUA 3ABKH 1FYLA 2HKOA 2Y0MA 2JA7J 5FFXA 5IOZA 1YITI 1YJ9I 5KK1A 2J5OA 4YRVA 4P1WA 6PAXA 3UNGC 4AU7A 1OISA 2PMZN 3CO6C 1IG7A 1F5TA 1D8JA 4FE4A 4BQQA 3KZZA 3C2GA 3ZN0A 2NNNA 4HDVA 5D5XB 1OCCH 3OV8A 1FOYA 1G59A 2OJED 2DAOA 5L3BA 3K2AA 4M3DA 1V3FA 2NAZA 4A5MA 1R71A 2RV8A 3U1DA 1ZR2A 1Z0XA 1Y1VJ 3BZKA 2ZMEC 2L01A 2X4HA 3RKQA 4FISA 3M4OJ 4LLGF 5JFRA 1FYKA 2CU7A 3MEXA 3RKYA 3CCSI 3SFZA 5EEHA 3GTGJ 5C4JJ 4G12A 2H6BA 1ZTRA 3TO9A 2B9SA 2NRAC 5E1XA 3HOXJ 1OKRA 1L3LA 3JRGA 4BJTA 3QU6A 3DEUA 4P55A 1ZN2A 2BOLA 1Z6RA 4RGXA 3GWZA 4Z2YA 1RETA 2HDDA 3TDUC 4A5NA 2KIMA 5JR3A 3JRBA 3CUQC 4IHSA 3HOUJ 3H5RA 3WODF 1UHWA 5LRRA 1B4AA 1S5LC 1R58A 3OYGA 2DA2A 2HGCA 1STZA 1S7AA 1JTYA 1R36A 3F3XA 2YS9A 3N05A 3S32A 1RZ4A 5LEJA 3FHNA 2FD5A 4D0PA 5J3LA 2BV6A 2JA8J 3T1BA 5CVRA 3A01B 2E35A 4DOZA 2PI0A 4LG3A 3KYCB 2RQQA 3BG3A 5DV5A 3WU0A 3L2QA 1H8AC 1WJEA 3HRUA 2P5KA 2HQNA 4DQ2A 2XPWA 4BJ5C 3M07A 2JPCA 1ETWA 2HZTA 1T98A 4L18B 3LFUA 2QEXI 5HLGA 1EF4A 2Y31A 3WGIA 4Y33A 1LNWA 2M8GX 4FCYA 2Y2ZA 3OYCA 3ZQCA 4AYBA 4XRFA 2C6YA 3BG5A 2E71A 2JVHA 2L54A 3HUGB 1GXPA 3VYRB 3P7NA 3PJRA 2Y9YA 2IGNA 1E0EA 2P5LC 3PSFA 1D0XA 2WY8Q 1N78A 1L0OC 2LY1A 4X0GA 2L2OA 2VUMJ 4AWXB 5LD2C 3LA3A 1YX5A 2FEZA 1X1CA 1SEUA 2ZCWA 1A6IA 3IAS2 2L7KA 3U21A 2NOGA 4F55A 1VQ5I 2W84A 3PNTA 4JP0A 2VT3A 4L5IA 1OFCX 5HS8A 3PQKA 1FP1D 3ZGKA 1D5VA 2LG4A 3OS2A 2IJLA 1P6RA 2HR3A 5DEQA 3P5JA 1H0MA 3J7AY 2MABA 2XC7A 2BE5F 2V1DA 3G2BA 3QQAA 2K9QA 2V7FA 1VQMI 1MBEA 2CQNA 3KCCA 3G1MA 4E7HA 1P2FA 2VJ4A 1R23A 4KT6A 2O03A 3CUOA 2H09A 2DXIA 2AHQA 2EB7A 1U5TC 4HBLA 5J8FA 3KYLA 1IAWA 4ESBA 4MQ9F 3TOAA 1B59A 2OC6A 2PG4A 4EJTA 3V8KA 1YS7A 2A6HF 2RNJA 1BM9A 3HTSB 1VF9A 1X1BA 3IV5A 2EZKA 1BOBA 1DPUA 4M3GA 3V7CA 4Z6YA 3ZQFA 2FNAA 3FXMA 3WG9A 4I7HA 2FQ3A 3E0JB 2Y0SN 1WVRA 3E3VA 3E6MA 3A1YA 2GOMA 3T5XA 3VPRA 4AD9A 3LOCA 1ZG1A 4A0YA 2KMUA 3GFIA 1U0JA 1FT9A 1Z05A 4I09A 4G6DA 1M1EB 3NRVA 4IRIA 3I59A 1TW2A 3V8LA 3EETA 3RIRA 1H9GA 3ZN1A 4MGRA 3I4PA 1EH6A 3L2RA 3CC2I 3I64A 2QYOA 2X1DA 3DU5A 2XF6A 4E4HA 2ECBA 2EK5A 2OBPA 4LITA 4L5JA 4A0ZA 4GFBA 3DLLF 4NHJA 4NC7A 2F5CA 1NK2P 4ITVA 2LLKA 3BZ6A 2M87A 3S3MA 5CVJA 4J19A 3MZHA 3OY9A 2HXOA 2Z3YA 4ETSA 1K4TA 3OL4A 5IP6A 2KISA 2K27A 4JX5A 3ZMTA 2GWRA 3Q9SA 1J09A 3R60A 4A69C 3Q0UA 4D5FA 2K9MA 2JA6J 4IOAF 3H35A 3KP3A 4XQFA 3RZDJ 4YG2F 3HKZN 4UB8C 3JREA 5K7ZA 1RR7A 3LSMA 4PJMA 1ZHFA 5F1JA 3MMYB 5DYMA 4HZFA 2LK2A 3OYAA 1FSEA 1G6NA 3QYEA 3I58A 3HPGA 2WV1A 5E20A 5DDGA 3BQYA 1P4AA 1W0TA 2JA2A 1BIBA 3CTAA 3O8GA 2AXLA 3FBIB 3SZPA 1HKSA 4E6KG 1A04A 1HQCA 1XCVA 2O5RA 4BACA 2GZWA 2IS4A 2JVGA 2FMLA 3RI4A 2O6GE 1BJZA 1ITYA 1SMYF 1OJLA 2ESHA 3ZCOA 5M5WJ 4ON0A 1YTYA 5TGTA 1WI3A 4MLOA 3HPHA 3FMQA 3QYBA 1BN5A 4BYYA 4L0ZB 2BGCA 1Z7UA 2E19A 2HQRA 3RJPA 3FK7A 4AVZA 3S2DJ 3KZYA 1K83J 3W6VA 3BT9A 2P0WA 2XRLA 1U8BA 5DD8A 2W00A 4UUVA 2PQ8A 4EQQA 5CPRB 2XUBA 2VKEA 2ME6A 4EM1A 3F8NA 3HRSA 1D0YA 4CCLA 4F7ZA 1KU9A 3ZMSA 4ENJA 4LK0F 4XR6A 4KN7X 2A6TA 1SAXA 2VIXA 2VLAA 2IA2A 1MIJA 3P9CA 1D3YA 3X2QH 1JE8A 2LDUA 1SD6A 5DUKA 1TL8A 3H3ZA 1TTYA 4QWQA 3E97A 1I3AA 1IN6A 2XKPA 1IV8A 4E7IA 2R4GA 4Y15A 1Y8RB 1QVTA 2L9RA 1R1TA 2XIGA 5K7HA 1RR8C 2G7UA 4ZTFA 2ZJRF 3CQZJ 2RGVA 1VI0A 1R5ID 2CSOA 3QOPA 1F36A 5ILSA 5EF6A 3KLNA 1VFCA 4KN4X 1OLTA 3Q0VA 4M73A 2O61A 1YW8A 5TJJA 2LF8A 1MH3A 4E7ZA 2A69F 1RPWA 4NQWA 4RB1A 4MEXF 1WH7A 1YQAA 5B66C 4EATA 3ONQA 4XL9A 3JW4A 1Y8QB 4ZJZA 1I27A 4D7MA 2QKLB 4HNVA 2CG4A 4M74A 4DYQA 4A0XA 1ETQA 3QPTA 5B1BH 4KISA 5GPCA 3KP7A 4IKFA 1K78A 4G7OF 2M4KA 2MA3A 2IT0A 2MD5A 2FUG2 3HB9A 3R4KA 4U87A 1TT5B 2KZGA 1ZRCA 2ZSHB 3DTKA 1AHDP 2FE3A 2MLKA 1JJ6C 1P7JA 4XONA 3CMAI 1HF0A 2HFHA 1HOMA 3CMYA 2DPUA 2DFHA 4LB5A 1T39A 3EUHA 1DP3A 2AO9A 3LQRA 4JOMA 3GZ6A 3DXJF 3L2WA 1SD4A 2CV1A 4GYIA 1ETVA 1LVAA 3N4MA 2WADA 1ENHA 2RC4A 4RLFA 4A3KJ 2QQAA 2JUGA 2STWA 3GBGA 2VC0A 2HNHA 2WBMA 4P5OA 2VOPA 5F08A 1UMQA 1Z9CA 1B6AA 2IXSA 3AG4H 1RC9A 1W7PB 3S2WA 3OYLA 2F4IA 4A12A 2E5ZA 5J40A 3JRHA 5F1RA 3NWSA 2XKOA 4FETA 2LKSA 3K2ZA 2K7LA 2X1CA 1F9NA 3TBIA 1QPIA 4BKXA 2F2EA 2VONA 3ESWB 1A36A 2EPFA 1ETOA 4UNOA 3K9TA 1V5GA 2MW8A 4I02A 3WHCA 3TEDA 4CYCB 1WKMA 2M2EA 3BCAA 2LF7A 3L2UA 1Y39A 3CP2A 3A2KA 3ROUA 3BROA 1UAAA 4KDPA 2KIUA 5H6RA 1YRNA 2X6WA 5EJCA 3KP4A 1F4KA 3RQ4A 1W7PD 2PJRA 5KAIC 2O9LA 2OZUA 1Y6IA 3O6BB 4PUSA 1BI1A 2OQRA 2ZXJA 1YG2A 5HS9A 2R5ZA 1N77A 1FC3A 5FB2A 2GLOA 2PX9A 3BPVA 1MSFC 1YI2I 1IV6A 3GLLA 2FF4A 3BG6A 2KQRA 2KIFA 3I4NJ 4BAYA 2R7DA 3ISPA 3OSFA 3BJAA 2EFOA 5FKOA 1BW6A 4RM2A 2HU9A 5BPIA 4Y13A 2VI6A 4F91B 3AAFA 5IYDJ 2EH3A 2DT5A 1XS9A 4EJOA 5HNHA 3E6DA 4XKVA 2HKXA 4KT5C 2DMPA 1ZKGA 2GOXB 2VKHA 1JTXA 1MBHA 1P9QC 2UV1A 3WU2C 2KT0A 1TWCJ 3WTXC 5D4SA 2L7MP 1YFHA 5E8GA 5E3OA 4BEHA 2VN2A 4AYBN 4RB2C 1WI9A 1RUOA 2CW0F 5DM6F 2LBFB 1BIAA 1N25A 3DPLC 3F9KA 1CQTA 4PJNA 2DQLA 2DLLA 4JYKA 3G71I 2R5YA 4JBAA 2NVUB 1S7EA 2CUEA 3W2VA 1H89C 1B8IB 1Z67A 2HTJA 4XNFA 4Q4ZF 3JRCA 4OMZA 2HPMA 3ELKA 2VKVA 4V19K 1EH8A 1D1AA 2WB1A 3I4MJ 2AQEA 2MC3A 3IKVA 4XMYA 4BJ6C 2B7EA 3B6CA 3LFKA 4I98B 3HOVJ 5BMZA 3N97A 3GYHX 2E5NA 4KIBA 4FT8A 1U5TA 3WE3A 1JKQC 2IAIA 3NEUA 3CDLA 3S93A 4XIDA 3CD6I 3GO5A 4BBSJ 1FP2A 3GX4X 1WJDA 2BW3A 3CZ6A 2JT1A 2OQGA 3DFGA 1Y1WJ 3E6BA 4QIWN 4I01A 2H8WA 2XVCA 3PQJA 3BDDA 1A6QA 1IXCA 1HSTA 1HA8A 1JKRC 3D5SC 1QZYA 3ZQIA 2NOJB 4BGDA 4IHXA 1S72I 1HSJA 4RGUA 3ZMZA 2BYVE 2JWTA 4IXAA 5LFAA 3WU1B 1IXRC 1W36D 3DKWA 2MH2A 5JHUA 2ZSIB 2DU9A 4F93B 2WY7Q 2FBKA 3DKXA 1YYVA 4LG0B 2QUFA 1IGNA 2M9HA 3I55I 1RRJA 4RGSA 2OF7A 1YW9A 4KFCA 2XHKA 4ABZA 1LKXA 3Q3SA 1FTZA 3SQNA 1TNTA 3CF2A 5IPAA 3IWFA 3SEQA 2IP2A 3R0AA 2XPUA 3A03A 4E7LA 3ZQLA 4A6DA 2ZB9A 5AIPA 4EM0B 5J1UA 5IP9J 3MAJA 3H3VK 4XN0A 3CMMA 3SYTA 1MBFA 2QZ8A 2L4MA 2CYYA 5FGMA 3FMSA 2I5UA 4KYWA 3TMOA 5GAHJ 2ZO4A 3NQOA 4HV5A 4DZJA 4UUSB 1ETYA 4YEJA 5HDKA 2NVXJ 2VQHA 2D1HA 3COAC 2DOAA 4B48A 1PDNC 1QO0D 3BOQA 2L5QA 2BVLA 2LREA 1IF1A 4EVIA 2FQ4A 2FSWA 2HDCA 1ON1A 1WGXA 3K7AJ 2ME0A 4C9YA 3L1PA 3P9IA 4F3QA 1HKQA 1LEAA 2QF7A 2EQRA 2OU2A 5D6FA 2EJRA 3DU6A 1HW2A 2E2JJ 2ZFWA 1T0FC 2ETHA 1OCTC 3SJMA 4A3LJ 3O3KA 4XLNF 2F5FA 3HZJA 2CUZA 4ASNA 2AS5F 3MKYB 1BJAA 4LIUA 4E7JA 2ECCA 3GTOJ 1U78A 3QPHA 2DYSH 3VODA 1BI3A 1MD0A 3DF8A 5D5WB 4XRMA 2ELKA 3CLOA 3GCMA 3QU3A 3HL2A 2Q2EB 5EZGA 5IYCJ 4GXOA 2ZNZA 4LK1F 1KU2A 1UZCA 3MKLA 4LLLA 1JUSA 4BL0B 3VSKA 3A01A 4HNTA 5DM7F 2ELJA 4PJLA 3CP8A 3BR0A 2M7AA 4CDGA 5J1YA 1SFOJ 4IHVA 1ACIA 2FMYA 1HLVA 5E17F 4HV6A 3MVPA 2AQFA 5K5RA 1YW7A 1D0ZA 1PUFB 4A3GJ 2P6SA 9ANTA 1VQ8I 4L9JA 1PUEE 3FXRA 2I10A 4D9JA 1XSDA 3W2WA 3HG9A 3GLXA 3S8PA 4WXHA 3ZXSA 3HGGA 2E60A 4BDYA 3HUGA 4ZC3A 1FPQA 4XLFA 4M3FA 4M3BA 1VQOI 2EBIA 1SD5A 3HGYA 2DA6A 2R0QC 2XGCA 2IBDA 1GVDA 3C3WA 4ZYAA 1T2KA 3ABUA 3I53A 4HPQA 3DTEA 4XKBA 3I9V2 4IQ4A 3M8EA 1Y56A 1NTCA 2E1OA 4HX7A 3L2CA 3WE2A 3NAUA 4IRHA 1X1PA 3G4SI 3ERMA 2IRFG 4BHBA 2YX4A 3GFMA 2K3PA 3GF2A 2XROA 4KMUX 2ZKZA 3OOPA 2JQ7A 1KU3A 1MW7A 1SFXA 3H9QA 4CCNA 5BQTA 2E7XA 4FHTA 1KQ0A 1V5FA 1J75A 5D8LB 4X6AJ 1TC3C 3LNQA 1E2XA 5FKLA 3SFIA 3QP5A 5LGUA 1TNSA 1U9OA 2HPIA 1FNNA 4Q48A 3FK6A 2QVOA 4O5VA 3IL2A 3S1QJ 4U0YA 2X85A 4PGGA 4B09A 4CUGA 4WK8F 4V2GA 1FOKA 1J5YA 4IL6C 1DGRM 1S8NA 1YJWI 4CHUA 4CXFA 1ZGJA 3VFZA 1W36C 4RBOA 5KVRA 1R5GA 2FA5A 3D5LA 3G73A 3LAPA 1R4NB 1MJ9A 4CYDA 2IS6A 2CQKA 3EPZA 4ESJA 2E1NA 1O3TA 4IHTA 1OCRH 5TISC 3K10A 3B6AA 3H5NA 1WJAA 2NVQJ 1TWHJ 4MNUA 1HKTA 3DBHB 3GXOA 4OAZA 4W1UA 3TDZC 2HEOA 2MC4A 1QZEA 2EV6A 1BL0A 3ABLH 1IC8A 1P92A 1F1ZA 1EV7A 2PFBA 3HJEA 2V1XA 5F27A 2NS8A 3GTLJ 3I5UA 1LDDA 1X3ZB 4CGZA 5LEKA 1KGSA 4C30A 1X3WB 2A07F 3OYDA 2L3DA 4M6YA 3QYFA 2KHMA 1QA6A 1R1UA 1GUUA 1XDSA 1TT0A 3VSLA 2JPBA 3I56I 4ENNA 3HRTA 3OSGA 3U2RA 1JXSA 1RKWA 2W1OA 2COBA 5GADJ 3L2VA 1YO5C 2RN7A 3CESA 1V55H 5J47A 4NC8A 4BUPA 3GVAA 4ZDOA 2IW5A 1VQ9I 3BR5A 2HQ5A 1IN7A 1AA7A 2IGMA 2H94A 1IRFA 2KL4A 3FDYA 3TW7A 1AU7A 1IW7F 4BQOA 4OMYA 4CO8A 5L3CA 4CCJA 5A2QZ 2BY1A 5B5EC 1QHGA 5K7FA 2V6CA 4E70A 4Y7NJ 4HLXA 1GVJA 2HYFA 1O3SA 4ANJA 2CFOA 4HDUA 2L9NA 3F6OA 2HQAA 2DK8A 2JUCA 5TRDA 1FZPB 1PYVA 3UKGA 3SHFA 1W4MA 3BP8A 2DMUA 3HSRA 1MMNA 2VL8A 2YPRA 4L9NA 3FX3A 4CSWA 1VQ7I 4ZDPA 5HDGA 3V42A 3JSOA 1X19A 2XAHA 4P9UA 2NS7A 2HI3A 1YIJI 1D8KA 2BHYA 2CWEA 1JT6A 2RREA 2WV0A 4P96A 1LDJA 4R1HA 3QAHA 4IZZA 4HQEA 4Y52J 3CCEI 1O4XA 4GYGA 1FTTA 3EYYA 3T0YA 2ID3A 3LSIA 4LD5A 2W85A 1LUJB 1W1WE 2CV0A 2FJ1A 1K61A 5ICEA 5DS9A 2TCTA 4XLCA 1OCPA 1PJRA 1RESA 1TWFJ 1R4MB 2DO7A 5F64A 2GIVA 1P4WA 3OIQA 2BVMA 2F6CA 1O57A 5DCMB 3K1NA 5F0CA 4MFDA 2DMNA 4ENKA 4HF1A 3MZ8A 3CJRB 5ICCA 2R7TA 4DNCA 3FKIJ 1V5EA 1YIOA 3DQVC 3O8HA 3U1KA 4MO7A 2XAUA 5A2QK 1NHAA 4BXUA 2VKDA 2LC2A 2V9KA 3BJ6A 1LB2A 1QHHD 3MN2A 2M30A 2YUSA 2LFBA 3CF5F 1P7IA 2XSJC 2DBBA 3V7RA
chains in the Genus database with same CATH topology
2P4WA 2OA4A 2VE9A 2ACJA 2DI3A 1MGTA 2A68F 3H3UA 2OZ6A 4OIOF 2UXNA 4HF0A 2ISYA 1W5TA 5E1ZB 3C1DA 5L3GA 3JTGA 4K2EA 1ZARA 3PFIA 3WGGA 1I6XA 3E6CC 5J8CA 3ERED 1FY7A 1XGMA 4HF2A 3I0TA 2VT2A 1ZRFA 4KIFA 1V4RA 3R0JA 2G7HA 2M5WA 2R7FA 3F8CA 1K6OA 2M45A 3ZQ7A 2V9VA 2QBYA 4OIPF 4XBFA 2KJBA 1W7PA 4AIKA 1T0FA 2UXXA 5LHGA 1TQPA 5LHIA 2ESNA 5ED4A 3J80K 2XGXA 1G3YA 3O2PE 2HWVA 2ELHA 2OD5A 4LLNA 2WWYA 3FXQA 5J6XA 3LQQA 2STTA 3W6JB 1LJ9A 1ZG3A 1WQ2A 4OIRF 4EMSA 3SZTA 3KP2A 1ZYRF 1REPC 2FBIA 1X3UA 2GA2A 1USSA 4NB5A 1MDMA 4ZYGA 3LAJA 2ZMEA 5JVTA 4AIJA 1OPCA 4JQFA 4EM2A 2XAJA 5K5OA 2A5YB 3KLOA 1T6SA 2M8EA 1KU7A 3ZP5A 4KNYA 2XAGA 1ON2A 1J59A 1MJBA 4EJWA 4B8XA 3CUQA 4PDKA 2D1VA 5DCFA 1B9NA 4I2OA 3RYRA 4WCGA 2ZJ2A 2JZYA 2FNPA 1H9TA 5D8KB 3HSFA 4BHPA 1B9MA 4OIQF 1IRGA 1U6GA 3MQ0A 3RPQA 1XGNA 4Q47A 1TBXA 1IN4A 4HA8A 4RB0A 3MFKA 3CO7C 2J5PA 2PJPA 1PP8F 3EYIA 3M8FA 1UFMA 4LG0A 5L3FA 1K78B 3KP5A 3U9GA 4AIHA 2HYGD 3TKYA 1XMAA 4HOBA 2K4JA 1OYYA 4Y17A 5D5UB 3KETA 4G7HF 3SXYA 4IVNA 5LHHA 5JI6A 4O6JA 4LB6B 4I0BA 3E5XA 1J9IA 2M1BA 4G94A 3Q5FA 1R22A 1BC8C 4IJAA 2A3SA 1XN7A 1K79A 5CVVA 4YFXF 1GHCA 2Q8KA 2CGPA 1G3TA 1TLHB 2EFQA 4U0WA 1TQMA 1UB9A 2PLYA 2Z5UA 3GFJA 1OMIA 3MCZA 3WTSC 5H20A 1DP7P 4WWCA 2K86A 4M9ZA 2VBZA 5ERIA 2K4BA 3HOTA 2CFXA 3DPTA 3KEOA 2Q2EA 1TW3A 5CVUA 4HQMA 2NYXA 3WTUC 3IC7A 2ISZA 3DV8A 2O3FA 3GUDA 4M6XA 5ICGA 3JAMZ 4KIGA 1AOYA 4EGZA 5AIQA 2VOOA 1QQIA 2V1UA 1ZRDA 2KKOA 2UZKA 1KYWA 1HBXG 4G8XA 4UHTA 4KUMA 1UCRA 2A61A 4PGHA 3IRQA 1RIOH 3GZ5A 3GEZA 5K1YA 1J7KA 4EV0A 1QPMA 2Q0OA 5FLXZ 2NS0A 1J0RA 4L0YB 1RUNA 1B1BA 1S6LA 1DPRA 3K1MA 5FD6A 4EGYA 2KJCA 4UXNA 3JAMK 3KEQA 1ONVA 4A2UA 1J2XA 2EFPA 3ECHA 5ICFA 4FX0A 4HAMA 4RGRA 2L02A 1ZLJA 2O0YA 1R00A 3QP6A 1O3QA 2FBHA 4ZH4F 1ZGAA 2KRFA 2V79A 1P4XA 2WC2A 5HLIA 3M7GA 2VC1A 3F8BA 1UHMA 1XD7A 3VOEA 1ODDA 3IKTA 3RKXA 1QNTA 2HOEA 2VBYA 1Y0UA 5FLXK 3QRFF 1FX7A 2EFWA 1HW1A 2DQRA 1KA8A 2GXGA 3GFLA 1FYMA 1KQ9A 2PMUA 4ZZLA 3WTTC 1ZLKA 2E1CA 2R3SA 4KA4A 4OOIA 1R7JA 2QQBA 2W25A 1ZAOA 1CF7B 3F8MA 3C18A 1C0WA 4MHGA 3K1PA 5D6EA 4XLPF 5CYVA 4QLCU 3KP6A 5BPDA 1ZREA 2IPQX 5E8IA 5D4RA 4YFNF 2D2WA 2JRTA 1JHFA 4YIFA 4N0BA 1ULYA 4WXDA 3TGNA 3B73A 3VEPA 4O3MA 2PEXA 1XMKA 2FU4A 3P9KA 2GQQA 1MZBA 2Y48A 1XGOA 5DCMA 1AWCA 4HX4A 1XGSA 2RVCA 2EWNA 3HRMA 3TQNA 1G3SA 2Z33A 3L09A 1I1GA 3DP7A 1JHHA 1E17A 3ZMDA 3F21A 3WTZA 1IUYA 1LQ1A 3WGHA 5CVIA 3ULQB 1KQ8A 3E5QA 3VB2A 2X0LA 2MLGA 4GCVA 1QGPA 2Z99A 1G4DA 3CJNA 2G9WA 1FWZA 4KMFA 3BPXA 1XSVA 3MZYA 1XCBA 3V8JA 3G3ZA 3F22A 3BJOA 4UVAA 1JGSA 2TDXA 1SMTA 3M1EA 2LKPA 3TO6A 1IZ1A 3BWGA 3I54A 1LEBA 2P7VB 4KICA 1FSHA 2VODA 2XV4S 2XAQA 4PZJA 3B02A 2MBFA 2BBYA 4LFUA 4WX9A 5IT9Z 2H6CA 1S3JA 2XRNA 2W57A 3ABTA 2QLZA 1YLFA 4AVPA 4EJVA 4L9VA 3FMRA 2P6TA 4MQVA 4ESFA 2ZNYA 4U0VA 4N9HA 3K0LA 2XASA 2IA0A 4M72A 3HHGA 4EJUA 3KFWX 2L4AA 5E18F 1IN5A 1FBUA 3J80Z 2ADUA 1K7AA 2QM3A 2QENA 3FF5A 1U8RA 1FBQA 1CGPA 1DUXC 2W24A 3V4GA 3ZMVA 1IN8A 4H0EA 1FLIA 1SD7A 1I1SA 1U2WA 5FD5A 4ENMA 2E7WA 5IT9K 4M9SA 3RYPA 3HTUA 1VTNC 4XSZF 4MTDA 2YR2A 3TO7A 1RNLA 3ECOA 3T8RA 5DUIA 4HLYA 4IF4A 3WTWC 2EFNA 5BOXA 3Q9VA 2PBIA 4UVCA 5HDNA 3L9FA 1QBJA 2VE8A 1WWXA 4WXCA 5H6QA 2VBWA 5D5VB 5HVQC 3I59B 1USTA 2P8TA 4R8HA 3HYIA 4G9YA 3T8TA 1BI0A 4ZYDA 5LBQA 2DPDA 2FXAA 3HSEA 4ZYEA 4U88A 5K5QA 3FM5A 4MEYF 4IPAA 1OR7A 5HS7A 3E5UA 4ZZDA 2O8XA 1O7LA 2RQPA 1MKMA 1W5SA 3ZPLA 2EV0A 5LGTA 2D45A 3FHZA 4PCQA 4LJZF 1XB4A 2JTVA 5E1WA 3R6SA 4TV7A 1QZZA 1IXSB 1I5ZA 3RKWA 5HLHA 2YU3A 4MTEA 4A6EA 3K69A 4M71A 4GGGA 4N9IA 2RKHA 4JK1X 4S05A 2Z9OA 3D0SA 1S7OA 2OAZA 3IRRA 1SFUA 3HOSA 5EEGA 4UV9A 2IA1A 4M9XA 3RTRA 1S29A 1Z91A 1Q1HA 1HXDA 2DW4A 1EH7A 1O7FA 1BC7C 2EA2A 4BHCA 3M9AA 5LRSA 2PN6A 2DTRA 4HW0A 2H27A 3F8FA 2QBYB 4RAYA 3I71A 3REOA 4R79A 3FXUA 1BBYA 5FO5A 1ZG5A 4ZYHA 3RDIA 2LNBA 4IRGA 4RB3C 5FFZA 4S04A 4UV8A 1O3RA 2YSRA 3WTVC 5DD4A 1OYIA 1T38A 1Z1DA 1FBSA 4GO1A 2B0LA 2P7CB 1XDUA 4G6QA 3EQLF 4CZZA 3LSTA 5CLSA 5LGNA 2ZBKA 3LA7A 3J81Z 3BY6A 4XSXF 3EDPA 5CJ9A 1MDMB 2ZMEB 3FM3A 1KYZA 3J7AO 2BEOA 3C7JA 4UVBA 4FX4A 2COMA 4L9TA 2UWMA 1LDKB 2DK5A 1BOAA 4Q5SF 2A6EF 1GXQA 2WTEA 4LGWA 3F72A 1WSUA 3V7SA 4BQAA 2DFIA 4BH9A 2LSOA 5LLQA 3CUQB 4WF2A 5BS6A 2Y75A 5IT3A 2CO5A 3F6VA 1G3WA 3LWFA 3WTYC 4BNCA 5ILVA 2RDPA 4YFKF 4OINF 3FZVA 3TOBA 2IVMA 2XAFA 3RPUA 1R5HA 3J81K 2EA4A 3MWMA 1YS6A 2HTSA 2QWWA 1TQIA 2F5EA 3HIFA 5L3EA 4HYEA 3IHUA 2VXZA 3HHHA 1RI7A 2GAUA 3JTHA 2EV5A 2PMHA 1HW5A 2FOKA 3IWZA 1SFEA 2MH9A 5ILUA 2NNYA 2K02A 4U7DA 1MJAA 2FRHA 5HOOA 4P9FA 4U7BA 1PP7U 5AONA 4OU0A 3LA2A 1WRJA 4RS8A 1R1VA 1XSXA 3W6KB 2HS5A 2GXBA 5L3DA 4RAZA 3GW2A 3F23A 2F5DA 1BI2A 3FWEA 4G7ZF 3L00A 4CICA 3ZMUA 4YIIA 1Z6TA 2GA1A 1U5TB 1OYWA 2VBXA 1CF7A 2YX7A 3KE2A 2QQ9A 4HX8A 3CDHA 3R61A 3JSPA 2P5VA 3H92A 3ML6A 4I0AA 1DDNA 1ZH5A 4LMYA 1U3EM 5F6FA 3L7WA 2JSCA 1FYLA 2HKOA 2Y0MA 5FFXA 5KK1A 2J5OA 6PAXA 3CO6C 1F5TA 1D8JA 3KZZA 4HDVA 3ZN0A 2NNNA 5D5XB 3OV8A 2DAOA 5L3BA 1V3FA 2NAZA 4A5MA 2RV8A 3U1DA 2L01A 2X4HA 4LLGF 5JFRA 1FYKA 3MEXA 3RKYA 3SFZA 5EEHA 2H6BA 3TO9A 2NRAC 5E1XA 1OKRA 1L3LA 3QU6A 4P55A 3DEUA 1ZN2A 1Z6RA 4RGXA 3GWZA 4Z2YA 3TDUC 4A5NA 2KIMA 5JR3A 3CUQC 4IHSA 3WODF 1UHWA 5LRRA 1B4AA 1R58A 2HGCA 1STZA 1S7AA 1R36A 3F3XA 1RZ4A 5LEJA 4D0PA 2BV6A 3T1BA 5CVRA 2PI0A 5DV5A 3WU0A 3HRUA 2P5KA 2HQNA 4DQ2A 2JPCA 2HZTA 1T98A 4L18B 5HLGA 3WGIA 1LNWA 4XRFA 2C6YA 2L54A 1GXPA 3P7NA 2P5LC 1L0OC 4AWXB 3LA3A 2FEZA 2ZCWA 2W84A 2VT3A 4L5IA 5HS8A 3PQKA 1FP1D 1D5VA 2IJLA 1P6RA 2HR3A 5DEQA 1H0MA 2BE5F 2V1DA 3KCCA 1P2FA 1R23A 2O03A 3CUOA 2H09A 2EB7A 1U5TC 4HBLA 5J8FA 1IAWA 4ESBA 4MQ9F 3TOAA 1B59A 2PG4A 4EJTA 3V8KA 1YS7A 2A6HF 2RNJA 1BM9A 3HTSB 1DPUA 3V7CA 2FNAA 3WG9A 4I7HA 2FQ3A 3E3VA 3E6MA 3T5XA 4AD9A 1ZG1A 4A0YA 3GFIA 1FT9A 1Z05A 4I09A 4G6DA 3NRVA 4IRIA 3I59A 1TW2A 3V8LA 3EETA 3RIRA 1H9GA 3ZN1A 4MGRA 3I4PA 1EH6A 3I64A 2QYOA 2EK5A 2OBPA 4L5JA 4A0ZA 4NHJA 2F5CA 3BZ6A 2M87A 5CVJA 3MZHA 2Z3YA 4ETSA 2K27A 3ZMTA 2GWRA 3Q9SA 3R60A 3KP3A 4YG2F 1ZHFA 5DYMA 4HZFA 1FSEA 1G6NA 3I58A 5E20A 5DDGA 1P4AA 1BIBA 3CTAA 3SZPA 2AXLA 1HKSA 1XCVA 1A04A 1HQCA 2GZWA 2FMLA 3RI4A 2O6GE 1SMYF 2ESHA 4ON0A 1YTYA 3FMQA 1BN5A 4BYYA 4L0ZB 2BGCA 1Z7UA 2HQRA 3RJPA 3KZYA 4UUVA 5DD8A 2PQ8A 4EQQA 2XUBA 4EM1A 3F8NA 3HRSA 4F7ZA 1KU9A 3ZMSA 4ENJA 4LK0F 4KN7X 1SAXA 2IA2A 3P9CA 1D3YA 1JE8A 2LDUA 1SD6A 5DUKA 3H3ZA 1TTYA 4QWQA 3E97A 1IN6A 2XKPA 4Y15A 1R1TA 2XIGA 2G7UA 2RGVA 2CSOA 3QOPA 5ILSA 3KLNA 4KN4X 4M73A 2O61A 1YW8A 5TJJA 2LF8A 2A69F 4NQWA 4RB1A 4MEXF 1YQAA 3JW4A 1I27A 2CG4A 4M74A 4A0XA 3QPTA 3KP7A 1K78A 4G7OF 2MA3A 2IT0A 2MD5A 3R4KA 1ZRCA 2FE3A 2MLKA 2HFHA 2DPUA 4LB5A 1T39A 3EUHA 3LQRA 3GZ6A 3DXJF 1SD4A 4GYIA 1LVAA 3N4MA 2RC4A 2QQAA 2STWA 2VC0A 4P5OA 2VOPA 1Z9CA 1B6AA 1W7PB 3S2WA 4A12A 5F1RA 2XKOA 3K2ZA 2K7LA 1F9NA 2F2EA 2VONA 4UNOA 3K9TA 4I02A 1WKMA 2LF7A 3ROUA 3BROA 4KDPA 2KIUA 5H6RA 3KP4A 1F4KA 1W7PD 2OZUA 3O6BB 1BI1A 2OQRA 2ZXJA 1YG2A 5HS9A 1FC3A 5FB2A 3BPVA 2FF4A 2KIFA 4BAYA 2R7DA 3ISPA 3BJAA 2EFOA 5BPIA 4Y13A 3AAFA 2DT5A 4EJOA 3E6DA 2HKXA 4KT5C 3WTXC 5D4SA 1YFHA 5E8GA 2VN2A 4RB2C 1WI9A 1RUOA 2CW0F 1BIAA 3DPLC 2DQLA 2DLLA 4JBAA 2HTJA 4Q4ZF 4OMZA 3ELKA 1EH8A 2MC3A 3IKVA 3LFKA 4I98B 5BMZA 3N97A 3GYHX 4KIBA 4FT8A 1U5TA 3WE3A 3NEUA 3GO5A 1FP2A 3GX4X 2JT1A 2OQGA 3DFGA 3E6BA 4I01A 2XVCA 3PQJA 3BDDA 1IXCA 1HSTA 1QZYA 1HSJA 4RGUA 3ZMZA 2BYVE 4IXAA 3WU1B 1IXRC 3DKWA 5JHUA 2MH2A 2DU9A 2FBKA 1YYVA 4LG0B 2QUFA 4RGSA 1YW9A 4KFCA 2XHKA 3SQNA 1TNTA 3IWFA 2IP2A 3R0AA 4A6DA 5AIPA 4EM0B 3MAJA 2QZ8A 2L4MA 2CYYA 5FGMA 3FMSA 4KYWA 2ZO4A 3NQOA 4HV5A 5HDKA 2D1HA 3COAC 1PDNC 1QO0D 3BOQA 1IF1A 4EVIA 2FSWA 2HDCA 1ON1A 3P9IA 1HKQA 1LEAA 2OU2A 5D6FA 2EJRA 1HW2A 2ZFWA 2ETHA 3O3KA 4XLNF 2F5FA 4ASNA 2AS5F 1BJAA 1U78A 3QPHA 3VODA 1BI3A 1MD0A 3DF8A 5D5WB 3CLOA 3QU3A 4GXOA 2ZNZA 4LK1F 1KU2A 4LLLA 4CDGA 2FMYA 5E17F 4HV6A 5K5RA 1YW7A 2P6SA 4L9JA 1PUEE 3FXRA 1XSDA 3GLXA 4WXHA 3HUGA 1FPQA 1SD5A 3C3WA 1T2KA 3ABUA 3I53A 3M8EA 4HX7A 3L2CA 3WE2A 4IRHA 2IRFG 4BHBA 2YX4A 3GFMA 2XROA 3GF2A 4KMUX 2ZKZA 3OOPA 1KU3A 5BQTA 1SFXA 2E7XA 4FHTA 1KQ0A 1J75A 5D8LB 1E2XA 3QP5A 5LGUA 1TNSA 1FNNA 4Q48A 2QVOA 4O5VA 3IL2A 4U0YA 4B09A 4PGGA 4WK8F 1FOKA 1J5YA 1S8NA 4CHUA 4CXFA 1ZGJA 3VFZA 5KVRA 1R5GA 2FA5A 3D5LA 3G73A 3LAPA 1MJ9A 4CYDA 2CQKA 4ESJA 2E1NA 1O3TA 4IHTA 4MNUA 1HKTA 3GXOA 3TDZC 2HEOA 2EV6A 1P92A 1F1ZA 1EV7A 2PFBA 2V1XA 3I5UA 1LDDA 4CGZA 5LEKA 1KGSA 2A07F 2L3DA 4M6YA 1R1UA 1XDSA 2JPBA 4ENNA 3HRTA 3U2RA 1JXSA 1YO5C 2RN7A 3GVAA 2IW5A 1IN7A 2H94A 1IRFA 1IW7F 4OMYA 4CO8A 5L3CA 5A2QZ 2V6CA 4E70A 4HLXA 1GVJA 2HYFA 1O3SA 4HDUA 3F6OA 2DK8A 1FZPB 5TRDA 3SHFA 1W4MA 3BP8A 3HSRA 2YPRA 4L9NA 3FX3A 5HDGA 3JSOA 2XAHA 4P9UA 1D8KA 2CWEA 2WV0A 4P96A 1LDJA 4R1HA 3QAHA 4HQEA 4GYGA 3EYYA 3T0YA 4LD5A 2W85A 5ICEA 2DO7A 5F64A 2GIVA 1P4WA 1O57A 5DCMB 3K1NA 4ENKA 4HF1A 5ICCA 4DNCA 1YIOA 3DQVC 5A2QK 1NHAA 4BXUA 3BJ6A 1LB2A 2M30A 2DBBA 3V7RA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2P4W A;  2OA4 A;  2VE9 A;  2ACJ A;  2DI3 A;  1MGT A;  2A68 F;  3H3U A;  2OZ6 A;  4OIO F;  2UXN A;  4HF0 A;  2ISY A;  1W5T A;  5E1Z B;  3C1D A;  5L3G A;  3JTG A;  4K2E A;  1ZAR A;  3PFI A;  3WGG A;  1I6X A;  3E6C C;  5J8C A;  3ERE D;  1FY7 A;  1XGM A;  4HF2 A;  3I0T A;  2VT2 A;  1ZRF A;  4KIF A;  1V4R A;  3R0J A;  2G7H A;  2M5W A;  2R7F A;  3F8C A;  1K6O A;  2M45 A;  3ZQ7 A;  2V9V A;  2QBY A;  4OIP F;  4XBF A;  2KJB A;  1W7P A;  4AIK A;  1T0F A;  2UXX A;  5LHG A;  1TQP A;  5LHI A;  2ESN A;  5ED4 A;  3J80 K;  2XGX A;  1G3Y A;  3O2P E;  2HWV A;  2ELH A;  2OD5 A;  4LLN A;  2WWY A;  3FXQ A;  5J6X A;  3LQQ A;  2STT A;  3W6J B;  1LJ9 A;  1ZG3 A;  1WQ2 A;  4OIR F;  4EMS A;  3SZT A;  3KP2 A;  1ZYR F;  1REP C;  2FBI A;  1X3U A;  2GA2 A;  1USS A;  4NB5 A;  1MDM A;  4ZYG A;  3LAJ A;  2ZME A;  5JVT A;  4AIJ A;  1OPC A;  4JQF A;  4EM2 A;  2XAJ A;  5K5O A;  2A5Y B;  3KLO A;  1T6S A;  2M8E A;  1KU7 A;  3ZP5 A;  4KNY A;  2XAG A;  1ON2 A;  1J59 A;  1MJB A;  4EJW A;  4B8X A;  3CUQ A;  4PDK A;  2D1V A;  5DCF A;  1B9N A;  4I2O A;  3RYR A;  4WCG A;  2ZJ2 A;  2JZY A;  2FNP A;  1H9T A;  5D8K B;  3HSF A;  4BHP A;  1B9M A;  4OIQ F;  1IRG A;  1U6G A;  3MQ0 A;  3RPQ A;  1XGN A;  4Q47 A;  1TBX A;  1IN4 A;  4HA8 A;  4RB0 A;  3MFK A;  3CO7 C;  2J5P A;  2PJP A;  1PP8 F;  3EYI A;  3M8F A;  1UFM A;  4LG0 A;  5L3F A;  1K78 B;  3KP5 A;  3U9G A;  4AIH A;  2HYG D;  3TKY A;  1XMA A;  4HOB A;  2K4J A;  1OYY A;  4Y17 A;  5D5U B;  3KET A;  4G7H F;  3SXY A;  4IVN A;  5LHH A;  5JI6 A;  4O6J A;  4LB6 B;  4I0B A;  3E5X A;  1J9I A;  2M1B A;  4G94 A;  3Q5F A;  1R22 A;  1BC8 C;  4IJA A;  2A3S A;  1XN7 A;  1K79 A;  5CVV A;  4YFX F;  1GHC A;  2Q8K A;  2CGP A;  1G3T A;  1TLH B;  2EFQ A;  4U0W A;  1TQM A;  1UB9 A;  2PLY A;  2Z5U A;  3GFJ A;  1OMI A;  3MCZ A;  3WTS C;  5H20 A;  1DP7 P;  4WWC A;  2K86 A;  4M9Z A;  2VBZ A;  5ERI A;  2K4B A;  3HOT A;  2CFX A;  3DPT A;  3KEO A;  2Q2E A;  1TW3 A;  5CVU A;  4HQM A;  2NYX A;  3WTU C;  3IC7 A;  2ISZ A;  3DV8 A;  2O3F A;  3GUD A;  4M6X A;  5ICG A;  3JAM Z;  4KIG A;  1AOY A;  4EGZ A;  5AIQ A;  2VOO A;  1QQI A;  2V1U A;  1ZRD A;  2KKO A;  2UZK A;  1KYW A;  1HBX G;  4G8X A;  4UHT A;  4KUM A;  1UCR A;  2A61 A;  4PGH A;  3IRQ A;  1RIO H;  3GZ5 A;  3GEZ A;  5K1Y A;  1J7K A;  4EV0 A;  1QPM A;  2Q0O A;  5FLX Z;  2NS0 A;  1J0R A;  4L0Y B;  1RUN A;  1B1B A;  1S6L A;  1DPR A;  3K1M A;  5FD6 A;  4EGY A;  2KJC A;  4UXN A;  3JAM K;  3KEQ A;  1ONV A;  4A2U A;  1J2X A;  2EFP A;  3ECH A;  5ICF A;  4FX0 A;  4HAM A;  4RGR A;  2L02 A;  1ZLJ A;  2O0Y A;  1R00 A;  3QP6 A;  1O3Q A;  2FBH A;  4ZH4 F;  1ZGA A;  2KRF A;  2V79 A;  1P4X A;  2WC2 A;  5HLI A;  3M7G A;  2VC1 A;  3F8B A;  1UHM A;  1XD7 A;  3VOE A;  1ODD A;  3IKT A;  3RKX A;  1QNT A;  2HOE A;  2VBY A;  1Y0U A;  5FLX K;  3QRF F;  1FX7 A;  2EFW A;  1HW1 A;  2DQR A;  1KA8 A;  2GXG A;  3GFL A;  1FYM A;  1KQ9 A;  2PMU A;  4ZZL A;  3WTT C;  1ZLK A;  2E1C A;  2R3S A;  4KA4 A;  4OOI A;  1R7J A;  2QQB A;  2W25 A;  1ZAO A;  1CF7 B;  3F8M A;  3C18 A;  1C0W A;  4MHG A;  3K1P A;  5D6E A;  4XLP F;  5CYV A;  4QLC U;  3KP6 A;  5BPD A;  1ZRE A;  2IPQ X;  5E8I A;  5D4R A;  4YFN F;  2D2W A;  2JRT A;  1JHF A;  4YIF A;  4N0B A;  1ULY A;  4WXD A;  3TGN A;  3B73 A;  3VEP A;  4O3M A;  2PEX A;  1XMK A;  2FU4 A;  3P9K A;  2GQQ A;  1MZB A;  2Y48 A;  1XGO A;  5DCM A;  1AWC A;  4HX4 A;  1XGS A;  2RVC A;  2EWN A;  3HRM A;  3TQN A;  1G3S A;  2Z33 A;  3L09 A;  1I1G A;  3DP7 A;  1JHH A;  1E17 A;  3ZMD A;  3F21 A;  3WTZ A;  1IUY A;  1LQ1 A;  3WGH A;  5CVI A;  3ULQ B;  1KQ8 A;  3E5Q A;  3VB2 A;  2X0L A;  2MLG A;  4GCV A;  1QGP A;  2Z99 A;  1G4D A;  3CJN A;  2G9W A;  1FWZ A;  4KMF A;  3BPX A;  1XSV A;  3MZY A;  1XCB A;  3V8J A;  3G3Z A;  3F22 A;  3BJO A;  4UVA A;  1JGS A;  2TDX A;  1SMT A;  3M1E A;  2LKP A;  3TO6 A;  1IZ1 A;  3BWG A;  3I54 A;  1LEB A;  2P7V B;  4KIC A;  1FSH A;  2VOD A;  2XV4 S;  2XAQ A;  4PZJ A;  3B02 A;  2MBF A;  2BBY A;  4LFU A;  4WX9 A;  5IT9 Z;  2H6C A;  1S3J A;  2XRN A;  2W57 A;  3ABT A;  2QLZ A;  1YLF A;  4AVP A;  4EJV A;  4L9V A;  3FMR A;  2P6T A;  4MQV A;  4ESF A;  2ZNY A;  4U0V A;  4N9H A;  3K0L A;  2XAS A;  2IA0 A;  4M72 A;  3HHG A;  4EJU A;  3KFW X;  2L4A A;  5E18 F;  1IN5 A;  1FBU A;  3J80 Z;  2ADU A;  1K7A A;  2QM3 A;  2QEN A;  3FF5 A;  1U8R A;  1FBQ A;  1CGP A;  1DUX C;  2W24 A;  3V4G A;  3ZMV A;  1IN8 A;  4H0E A;  1FLI A;  1SD7 A;  1I1S A;  1U2W A;  5FD5 A;  4ENM A;  2E7W A;  5IT9 K;  4M9S A;  3RYP A;  3HTU A;  1VTN C;  4XSZ F;  4MTD A;  2YR2 A;  3TO7 A;  1RNL A;  3ECO A;  3T8R A;  5DUI A;  4HLY A;  4IF4 A;  3WTW C;  2EFN A;  5BOX A;  3Q9V A;  2PBI A;  4UVC A;  5HDN A;  3L9F A;  1QBJ A;  2VE8 A;  1WWX A;  4WXC A;  5H6Q A;  2VBW A;  5D5V B;  5HVQ C;  3I59 B;  1UST A;  2P8T A;  4R8H A;  3HYI A;  4G9Y A;  3T8T A;  1BI0 A;  4ZYD A;  5LBQ A;  2DPD A;  2FXA A;  3HSE A;  4ZYE A;  4U88 A;  5K5Q A;  3FM5 A;  4MEY F;  4IPA A;  1OR7 A;  5HS7 A;  3E5U A;  4ZZD A;  2O8X A;  1O7L A;  2RQP A;  1MKM A;  1W5S A;  3ZPL A;  2EV0 A;  5LGT A;  2D45 A;  3FHZ A;  4PCQ A;  4LJZ F;  1XB4 A;  2JTV A;  5E1W A;  3R6S A;  4TV7 A;  1QZZ A;  1IXS B;  1I5Z A;  3RKW A;  5HLH A;  2YU3 A;  4MTE A;  4A6E A;  3K69 A;  4M71 A;  4GGG A;  4N9I A;  2RKH A;  4JK1 X;  4S05 A;  2Z9O A;  3D0S A;  1S7O A;  2OAZ A;  3IRR A;  1SFU A;  3HOS A;  5EEG A;  4UV9 A;  2IA1 A;  4M9X A;  3RTR A;  1S29 A;  1Z91 A;  1Q1H A;  1HXD A;  2DW4 A;  1EH7 A;  1O7F A;  1BC7 C;  2EA2 A;  4BHC A;  3M9A A;  5LRS A;  2PN6 A;  2DTR A;  4HW0 A;  2H27 A;  3F8F A;  2QBY B;  4RAY A;  3I71 A;  3REO A;  4R79 A;  3FXU A;  1BBY A;  5FO5 A;  1ZG5 A;  4ZYH A;  3RDI A;  2LNB A;  4IRG A;  4RB3 C;  5FFZ A;  4S04 A;  4UV8 A;  1O3R A;  2YSR A;  3WTV C;  5DD4 A;  1OYI A;  1T38 A;  1Z1D A;  1FBS A;  4GO1 A;  2B0L A;  2P7C B;  1XDU A;  4G6Q A;  3EQL F;  4CZZ A;  3LST A;  5CLS A;  5LGN A;  2ZBK A;  3LA7 A;  3J81 Z;  3BY6 A;  4XSX F;  3EDP A;  5CJ9 A;  1MDM B;  2ZME B;  3FM3 A;  1KYZ A;  3J7A O;  2BEO A;  3C7J A;  4UVB A;  4FX4 A;  2COM A;  4L9T A;  2UWM A;  1LDK B;  2DK5 A;  1BOA A;  4Q5S F;  2A6E F;  1GXQ A;  2WTE A;  4LGW A;  3F72 A;  1WSU A;  3V7S A;  4BQA A;  2DFI A;  4BH9 A;  2LSO A;  5LLQ A;  3CUQ B;  4WF2 A;  5BS6 A;  2Y75 A;  5IT3 A;  2CO5 A;  3F6V A;  1G3W A;  3LWF A;  3WTY C;  4BNC A;  5ILV A;  2RDP A;  4YFK F;  4OIN F;  3FZV A;  3TOB A;  2IVM A;  2XAF A;  3RPU A;  1R5H A;  3J81 K;  2EA4 A;  3MWM A;  1YS6 A;  2HTS A;  2QWW A;  1TQI A;  2F5E A;  3HIF A;  5L3E A;  4HYE A;  3IHU A;  2VXZ A;  3HHH A;  1RI7 A;  2GAU A;  3JTH A;  2EV5 A;  2PMH A;  1HW5 A;  2FOK A;  3IWZ A;  1SFE A;  2MH9 A;  5ILU A;  2NNY A;  2K02 A;  4U7D A;  1MJA A;  2FRH A;  5HOO A;  4P9F A;  4U7B A;  1PP7 U;  5AON A;  4OU0 A;  3LA2 A;  1WRJ A;  4RS8 A;  1R1V A;  1XSX A;  3W6K B;  2HS5 A;  2GXB A;  5L3D A;  4RAZ A;  3GW2 A;  3F23 A;  2F5D A;  1BI2 A;  3FWE A;  4G7Z F;  3L00 A;  4CIC A;  3ZMU A;  4YII A;  1Z6T A;  2GA1 A;  1U5T B;  1OYW A;  2VBX A;  1CF7 A;  2YX7 A;  3KE2 A;  2QQ9 A;  4HX8 A;  3CDH A;  3R61 A;  3JSP A;  2P5V A;  3H92 A;  3ML6 A;  4I0A A;  1DDN A;  1ZH5 A;  4LMY A;  1U3E M;  5F6F A;  3L7W A;  2JSC A;  1FYL A;  2HKO A;  2Y0M A;  5FFX A;  5KK1 A;  2J5O A;  6PAX A;  3CO6 C;  1F5T A;  1D8J A;  3KZZ A;  4HDV A;  3ZN0 A;  2NNN A;  5D5X B;  3OV8 A;  2DAO A;  5L3B A;  1V3F A;  2NAZ A;  4A5M A;  2RV8 A;  3U1D A;  2L01 A;  2X4H A;  4LLG F;  5JFR A;  1FYK A;  3MEX A;  3RKY A;  3SFZ A;  5EEH A;  2H6B A;  3TO9 A;  2NRA C;  5E1X A;  1OKR A;  1L3L A;  3QU6 A;  4P55 A;  3DEU A;  1ZN2 A;  1Z6R A;  4RGX A;  3GWZ A;  4Z2Y A;  3TDU C;  4A5N A;  2KIM A;  5JR3 A;  3CUQ C;  4IHS A;  3WOD F;  1UHW A;  5LRR A;  1B4A A;  1R58 A;  2HGC A;  1STZ A;  1S7A A;  1R36 A;  3F3X A;  1RZ4 A;  5LEJ A;  4D0P A;  2BV6 A;  3T1B A;  5CVR A;  2PI0 A;  5DV5 A;  3WU0 A;  3HRU A;  2P5K A;  2HQN A;  4DQ2 A;  2JPC A;  2HZT A;  1T98 A;  4L18 B;  5HLG A;  3WGI A;  1LNW A;  4XRF A;  2C6Y A;  2L54 A;  1GXP A;  3P7N A;  2P5L C;  1L0O C;  4AWX B;  3LA3 A;  2FEZ A;  2ZCW A;  2W84 A;  2VT3 A;  4L5I A;  5HS8 A;  3PQK A;  1FP1 D;  1D5V A;  2IJL A;  1P6R A;  2HR3 A;  5DEQ A;  1H0M A;  2BE5 F;  2V1D A;  3KCC A;  1P2F A;  1R23 A;  2O03 A;  3CUO A;  2H09 A;  2EB7 A;  1U5T C;  4HBL A;  5J8F A;  1IAW A;  4ESB A;  4MQ9 F;  3TOA A;  1B59 A;  2PG4 A;  4EJT A;  3V8K A;  1YS7 A;  2A6H F;  2RNJ A;  1BM9 A;  3HTS B;  1DPU A;  3V7C A;  2FNA A;  3WG9 A;  4I7H A;  2FQ3 A;  3E3V A;  3E6M A;  3T5X A;  4AD9 A;  1ZG1 A;  4A0Y A;  3GFI A;  1FT9 A;  1Z05 A;  4I09 A;  4G6D A;  3NRV A;  4IRI A;  3I59 A;  1TW2 A;  3V8L A;  3EET A;  3RIR A;  1H9G A;  3ZN1 A;  4MGR A;  3I4P A;  1EH6 A;  3I64 A;  2QYO A;  2EK5 A;  2OBP A;  4L5J A;  4A0Z A;  4NHJ A;  2F5C A;  3BZ6 A;  2M87 A;  5CVJ A;  3MZH A;  2Z3Y A;  4ETS A;  2K27 A;  3ZMT A;  2GWR A;  3Q9S A;  3R60 A;  3KP3 A;  4YG2 F;  1ZHF A;  5DYM A;  4HZF A;  1FSE A;  1G6N A;  3I58 A;  5E20 A;  5DDG A;  1P4A A;  1BIB A;  3CTA A;  3SZP A;  2AXL A;  1HKS A;  1XCV A;  1A04 A;  1HQC A;  2GZW A;  2FML A;  3RI4 A;  2O6G E;  1SMY F;  2ESH A;  4ON0 A;  1YTY A;  3FMQ A;  1BN5 A;  4BYY A;  4L0Z B;  2BGC A;  1Z7U A;  2HQR A;  3RJP A;  3KZY A;  4UUV A;  5DD8 A;  2PQ8 A;  4EQQ A;  2XUB A;  4EM1 A;  3F8N A;  3HRS A;  4F7Z A;  1KU9 A;  3ZMS A;  4ENJ A;  4LK0 F;  4KN7 X;  1SAX A;  2IA2 A;  3P9C A;  1D3Y A;  1JE8 A;  2LDU A;  1SD6 A;  5DUK A;  3H3Z A;  1TTY A;  4QWQ A;  3E97 A;  1IN6 A;  2XKP A;  4Y15 A;  1R1T A;  2XIG A;  2G7U A;  2RGV A;  2CSO A;  3QOP A;  5ILS A;  3KLN A;  4KN4 X;  4M73 A;  2O61 A;  1YW8 A;  5TJJ A;  2LF8 A;  2A69 F;  4NQW A;  4RB1 A;  4MEX F;  1YQA A;  3JW4 A;  1I27 A;  2CG4 A;  4M74 A;  4A0X A;  3QPT A;  3KP7 A;  1K78 A;  4G7O F;  2MA3 A;  2IT0 A;  2MD5 A;  3R4K A;  1ZRC A;  2FE3 A;  2MLK A;  2HFH A;  2DPU A;  4LB5 A;  1T39 A;  3EUH A;  3LQR A;  3GZ6 A;  3DXJ F;  1SD4 A;  4GYI A;  1LVA A;  3N4M A;  2RC4 A;  2QQA A;  2STW A;  2VC0 A;  4P5O A;  2VOP A;  1Z9C A;  1B6A A;  1W7P B;  3S2W A;  4A12 A;  5F1R A;  2XKO A;  3K2Z A;  2K7L A;  1F9N A;  2F2E A;  2VON A;  4UNO A;  3K9T A;  4I02 A;  1WKM A;  2LF7 A;  3ROU A;  3BRO A;  4KDP A;  2KIU A;  5H6R A;  3KP4 A;  1F4K A;  1W7P D;  2OZU A;  3O6B B;  1BI1 A;  2OQR A;  2ZXJ A;  1YG2 A;  5HS9 A;  1FC3 A;  5FB2 A;  3BPV A;  2FF4 A;  2KIF A;  4BAY A;  2R7D A;  3ISP A;  3BJA A;  2EFO A;  5BPI A;  4Y13 A;  3AAF A;  2DT5 A;  4EJO A;  3E6D A;  2HKX A;  4KT5 C;  3WTX C;  5D4S A;  1YFH A;  5E8G A;  2VN2 A;  4RB2 C;  1WI9 A;  1RUO A;  2CW0 F;  1BIA A;  3DPL C;  2DQL A;  2DLL A;  4JBA A;  2HTJ A;  4Q4Z F;  4OMZ A;  3ELK A;  1EH8 A;  2MC3 A;  3IKV A;  3LFK A;  4I98 B;  5BMZ A;  3N97 A;  3GYH X;  4KIB A;  4FT8 A;  1U5T A;  3WE3 A;  3NEU A;  3GO5 A;  1FP2 A;  3GX4 X;  2JT1 A;  2OQG A;  3DFG A;  3E6B A;  4I01 A;  2XVC A;  3PQJ A;  3BDD A;  1IXC A;  1HST A;  1QZY A;  1HSJ A;  4RGU A;  3ZMZ A;  2BYV E;  4IXA A;  3WU1 B;  1IXR C;  3DKW A;  5JHU A;  2MH2 A;  2DU9 A;  2FBK A;  1YYV A;  4LG0 B;  2QUF A;  4RGS A;  1YW9 A;  4KFC A;  2XHK A;  3SQN A;  1TNT A;  3IWF A;  2IP2 A;  3R0A A;  4A6D A;  5AIP A;  4EM0 B;  3MAJ A;  2QZ8 A;  2L4M A;  2CYY A;  5FGM A;  3FMS A;  4KYW A;  2ZO4 A;  3NQO A;  4HV5 A;  5HDK A;  2D1H A;  3COA C;  1PDN C;  1QO0 D;  3BOQ A;  1IF1 A;  4EVI A;  2FSW A;  2HDC A;  1ON1 A;  3P9I A;  1HKQ A;  1LEA A;  2OU2 A;  5D6F A;  2EJR A;  1HW2 A;  2ZFW A;  2ETH A;  3O3K A;  4XLN F;  2F5F A;  4ASN A;  2AS5 F;  1BJA A;  1U78 A;  3QPH A;  3VOD A;  1BI3 A;  1MD0 A;  3DF8 A;  5D5W B;  3CLO A;  3QU3 A;  4GXO A;  2ZNZ A;  4LK1 F;  1KU2 A;  4LLL A;  4CDG A;  2FMY A;  5E17 F;  4HV6 A;  5K5R A;  1YW7 A;  2P6S A;  4L9J A;  1PUE E;  3FXR A;  1XSD A;  3GLX A;  4WXH A;  3HUG A;  1FPQ A;  1SD5 A;  3C3W A;  1T2K A;  3ABU A;  3I53 A;  3M8E A;  4HX7 A;  3L2C A;  3WE2 A;  4IRH A;  2IRF G;  4BHB A;  2YX4 A;  3GFM A;  2XRO A;  3GF2 A;  4KMU X;  2ZKZ A;  3OOP A;  1KU3 A;  5BQT A;  1SFX A;  2E7X A;  4FHT A;  1KQ0 A;  1J75 A;  5D8L B;  1E2X A;  3QP5 A;  5LGU A;  1TNS A;  1FNN A;  4Q48 A;  2QVO A;  4O5V A;  3IL2 A;  4U0Y A;  4B09 A;  4PGG A;  4WK8 F;  1FOK A;  1J5Y A;  1S8N A;  4CHU A;  4CXF A;  1ZGJ A;  3VFZ A;  5KVR A;  1R5G A;  2FA5 A;  3D5L A;  3G73 A;  3LAP A;  1MJ9 A;  4CYD A;  2CQK A;  4ESJ A;  2E1N A;  1O3T A;  4IHT A;  4MNU A;  1HKT A;  3GXO A;  3TDZ C;  2HEO A;  2EV6 A;  1P92 A;  1F1Z A;  1EV7 A;  2PFB A;  2V1X A;  3I5U A;  1LDD A;  4CGZ A;  5LEK A;  1KGS A;  2A07 F;  2L3D A;  4M6Y A;  1R1U A;  1XDS A;  2JPB A;  4ENN A;  3HRT A;  3U2R A;  1JXS A;  1YO5 C;  2RN7 A;  3GVA A;  2IW5 A;  1IN7 A;  2H94 A;  1IRF A;  1IW7 F;  4OMY A;  4CO8 A;  5L3C A;  5A2Q Z;  2V6C A;  4E70 A;  4HLX A;  1GVJ A;  2HYF A;  1O3S A;  4HDU A;  3F6O A;  2DK8 A;  1FZP B;  5TRD A;  3SHF A;  1W4M A;  3BP8 A;  3HSR A;  2YPR A;  4L9N A;  3FX3 A;  5HDG A;  3JSO A;  2XAH A;  4P9U A;  1D8K A;  2CWE A;  2WV0 A;  4P96 A;  1LDJ A;  4R1H A;  3QAH A;  4HQE A;  4GYG A;  3EYY A;  3T0Y A;  4LD5 A;  2W85 A;  5ICE A;  2DO7 A;  5F64 A;  2GIV A;  1P4W A;  1O57 A;  5DCM B;  3K1N A;  4ENK A;  4HF1 A;  5ICC A;  4DNC A;  1YIO A;  3DQV C;  5A2Q K;  1NHA A;  4BXU A;  3BJ6 A;  1LB2 A;  2M30 A;  2DBB A;  3V7R A; 
#chains in the Genus database with same CATH topology
 5F0H A;  2EZI A;  2MGQ A;  3OR1 C;  2P4W A;  4RMN A;  2OA4 A;  2VE9 A;  2X6X A;  4XM3 A;  2ACJ A;  2DI3 A;  1XMX A;  1MGT A;  1HDP A;  2A68 F;  4HEA 2;  3UR3 C;  4XLA A;  3AKZ A;  3CCV I;  3H3U A;  2OZ6 A;  2Y69 H;  2D5V A;  4OIO F;  2UXN A;  2DTZ A;  2NVT J;  4HF0 A;  3K70 D;  3EUK L;  2ISY A;  1W5T A;  5IY5 H;  1I6H J;  4IX7 A;  5E1Z B;  3AG1 H;  3C1D A;  5L3G A;  1QRY A;  3JTG A;  1WJC A;  4K2E A;  1ZGW A;  1ZAR A;  2W82 A;  3PFI A;  5FRN A;  2YU9 J;  3WGG A;  1I6X A;  3E6C C;  4AID A;  1VQ4 I;  3RSN A;  4B1R A;  2CJJ A;  1IO2 A;  5J8C A;  3ERE D;  1FY7 A;  5J1R A;  2QGU A;  1XGM A;  1Y0N A;  5FRO A;  5FLM J;  4II2 A;  4HF2 A;  3I0T A;  3KPH A;  1MSE C;  5EG0 B;  2ZC2 A;  3RZO J;  1Z7L A;  4XOP A;  2WAQ A;  2VT2 A;  1ZRF A;  4KIF A;  1JT0 A;  1EJ9 A;  3K4L A;  1JUP A;  1V4R A;  5B3S H;  2MSY A;  3R0J A;  3AG2 H;  2G7H A;  2M5W A;  2R7F A;  3MD2 A;  3OR2 C;  3F8C A;  1K6O A;  2M45 A;  3ZQ7 A;  4D5C A;  2BXY A;  4A3F J;  1N75 A;  2V9V A;  2QBY A;  3CC4 I;  4OIP F;  4XBF A;  1IJW C;  2KJB A;  4I76 A;  3K4M A;  1W7P A;  3OYK A;  4AIK A;  1T0F A;  2UXX A;  5LHG A;  4CCO A;  1XC5 A;  4J00 A;  3OL3 A;  1TQP A;  5LHI A;  2ESN A;  5ED4 A;  2KIQ A;  1DGW Y;  2E1M C;  3J80 K;  2DDA A;  3ZOB A;  2XGX A;  2HXI A;  1G3Y A;  4CYC A;  3CCJ I;  1T95 A;  1MMG A;  3PO2 J;  2K40 A;  2CS3 A;  1X1D A;  2HWV A;  3O2P E;  1SFK A;  2K85 A;  3A02 A;  2GBY A;  3QWL A;  5C44 J;  2ELH A;  2ZJQ F;  1T8I A;  2E2I J;  2OD5 A;  4LLN A;  4D7N A;  2WWY A;  1UHS A;  4PSX A;  2XF7 A;  3FXQ A;  5J6X A;  3LQQ A;  1E3H A;  2STT A;  2DFE A;  3W6J B;  1LJ9 A;  2CV2 A;  3LMM A;  4A93 J;  5BNG A;  1ZG3 A;  3HDD A;  1WQ2 A;  4OIR F;  2XF5 A;  2IGK A;  4EMS A;  3A4C A;  3SZT A;  4DBR A;  3KP2 A;  1ZYR F;  2VJI A;  3LSK A;  1JJ8 C;  1B72 A;  1REP C;  2FBI A;  1X3U A;  3S1N J;  2GA2 A;  2R7U A;  1USS A;  2VQG A;  4NB5 A;  4LOC A;  3JCU C;  4ZYG A;  2HYJ A;  1MDM A;  2LRD A;  3LAJ A;  2ZME A;  5JVT A;  3VYS B;  1OPC A;  4AIJ A;  5KHD A;  4JQF A;  2H1L A;  2OUM A;  2XAJ A;  4EM2 A;  1HCR A;  2DT7 B;  5K5O A;  2A5Y B;  2P81 A;  3KLO A;  1T6S A;  2M8E A;  4C3I J;  1KU7 A;  4YEL A;  4OWR B;  3ZP5 A;  2O8K A;  2MFZ A;  4KNY A;  2JJ7 A;  2LBF A;  4N4O B;  2XAG A;  4S0H B;  1GLN A;  3SZG A;  1ON2 A;  2X48 A;  4NBQ A;  3PUB A;  1J59 A;  3PO3 J;  2X6O A;  4XLH A;  1MJB A;  3GTJ J;  4EJW A;  4B8X A;  3CUQ A;  4A3C J;  1UEL B;  4RAG A;  5M5Y J;  4I6Z A;  4PDK A;  2CUF A;  4AC0 A;  2D1V A;  1SAN A;  1B9N A;  1EA3 A;  5DCF A;  3K4K A;  4I2O A;  3TL4 X;  2HOA A;  1G8X A;  3PNV A;  3PL8 A;  3NWT A;  3RYR A;  3BTI A;  3JRI A;  3HOW J;  4WCG A;  2CMP A;  2BY0 A;  2ID6 A;  2M3A A;  2ZJ2 A;  2JZY A;  1FIA A;  3OWT A;  2FNP A;  2O7O A;  1H9T A;  2EIK H;  5D8K B;  4IQJ A;  1XPX A;  3HSF A;  4BHP A;  3CCY A;  3K70 C;  1B9M A;  5J4Y A;  3A0H C;  2DOD A;  4OIQ F;  1MNM C;  1IRG A;  1BW5 A;  1U6G A;  2ICW G;  3MQ0 A;  4X1E A;  3RPQ A;  1XGN A;  4Q47 A;  2RNG A;  1TBX A;  1IN4 A;  4HA8 A;  4RB0 A;  3MFK A;  4GDF A;  3FBN B;  3CO7 C;  4QPQ A;  3VDX A;  2J5P A;  1LE8 A;  2PJP A;  5CQG A;  2L9S A;  4C2T A;  1PP8 F;  2XB0 X;  3EYI A;  2L9V A;  3M8F A;  2NVY J;  2HZD A;  1UFM A;  3Q0W A;  1AKH A;  1GT0 C;  4LG0 A;  5L3F A;  1K78 B;  2VJ5 A;  1QVU A;  3KP5 A;  4RDU A;  4XLE A;  3U9G A;  4AIH A;  1T08 B;  3HC7 A;  2F48 A;  2HYG D;  3TKY A;  1UJ8 A;  4HST A;  2W48 A;  4XIC A;  1XMA A;  2Z2S B;  2K9S A;  5EEA A;  2VXD A;  4HOB A;  2K4J A;  1WZ2 A;  3CJT B;  3HOY J;  1BR4 A;  1OYY A;  4Y17 A;  5D5U B;  3KET A;  3DBL B;  4G7H F;  3SXY A;  2Y0S A;  3S14 J;  4IVN A;  4BBR J;  5LHH A;  5JI6 A;  4O6J A;  1X2M A;  4ZDL A;  4LB6 B;  2QKM B;  4I0B A;  2DA5 A;  3E5X A;  1SC7 A;  1ORK A;  1J9I A;  2M1B A;  1ZEL A;  4QSH A;  4G94 A;  3Q5F A;  3E1S A;  4XRS A;  1R22 A;  2E34 A;  1BC8 C;  5FKN A;  3FIW A;  4IJA A;  2A3S A;  2HOT A;  4G6T B;  1XN7 A;  4JX4 A;  3ABM H;  3OS1 A;  1K79 A;  2LTP A;  5CVV A;  4YFX F;  1GHC A;  2Q8K A;  2CGP A;  1G3T A;  1TLH B;  2EFQ A;  4U0W A;  1TQM A;  1UB9 A;  2PLY A;  2Z5U A;  1TP4 A;  3GME A;  3GFJ A;  1OMI A;  2FOW A;  2JN6 A;  3MCZ A;  3WTS C;  3JRF A;  2DYR H;  5H20 A;  1DP7 P;  4WWC A;  2K86 A;  4M9Z A;  3H9J A;  5EGO B;  2VBZ A;  5ERI A;  2KFD A;  2ZXW H;  1ETX A;  3GTP J;  2K4B A;  4RLQ A;  3M1C A;  2CFX A;  3DPT A;  3HOT A;  3KEO A;  2LY2 A;  3HKZ A;  2Q2E A;  3OMY A;  1TW3 A;  4E7S A;  5CVU A;  2JA5 J;  4HQM A;  2NYX A;  1LFP A;  3PNY A;  4DBQ A;  2R5Z B;  3WTU C;  1JI8 A;  3GZN B;  1MMD A;  3IC7 A;  2LH9 A;  2ISZ A;  3DV8 A;  2DMQ A;  1GDT A;  2O3F A;  2HVR A;  2V6E A;  3GUD A;  4M6X A;  3VYT B;  5ICG A;  3CCU I;  3S1M J;  3OYH A;  4PK4 A;  1PUF A;  4ZTJ A;  3JAM Z;  1MBG A;  3C2B A;  4KIG A;  1T56 A;  5KNL A;  3PUF A;  1AOY A;  4EGZ A;  5AIQ A;  5HNF A;  5CQE A;  2VOO A;  1QQI A;  2V1U A;  1YX3 A;  1ZRD A;  4LIV A;  4GRI A;  1MMA A;  1DU0 A;  4F92 B;  4CZC A;  2KKO A;  2UZK A;  4B43 A;  3OIP A;  1KYW A;  3CDI A;  4G8X A;  4UHT A;  1HBX G;  2EIN H;  4KUM A;  2F4M B;  3GTK J;  2KLO A;  1UCR A;  3HBL A;  2IGO A;  2LY9 A;  5EYR A;  2R5Y B;  2A61 A;  3S3N A;  4Y3O A;  4PGH A;  3VWB A;  2KDZ A;  3IRQ A;  1RIO H;  3WHB A;  3GZ5 A;  3IP4 B;  3GEZ A;  5K1Y A;  2G0E A;  1J7K A;  3DEW A;  1NG6 A;  3ZR8 X;  3SDG A;  1Z21 A;  1WH5 A;  4EV0 A;  1QPM A;  1X58 A;  2Q0O A;  1FOX A;  5FLX Z;  2NS0 A;  5KCM A;  1DQU A;  1J0R A;  2H8R A;  4L0Y B;  3DPU A;  3PIO F;  1RUN A;  1B1B A;  2V26 A;  1OR7 C;  1S6L A;  2JSP A;  4CCK A;  3LL7 A;  1DPR A;  3K1M A;  2LOO A;  2DT6 A;  4H4K C;  5FD6 A;  4EGY A;  2KJC A;  4UXN A;  3JAM K;  1K6Y A;  3J7Z I;  4BE0 A;  2Z1D A;  3AFH A;  3HXL A;  1JKO C;  3KEQ A;  1ONV A;  4A2U A;  1J2X A;  4FE7 A;  1A5J A;  2EFP A;  3M8J A;  3ECH A;  5ICF A;  4FX0 A;  4HAM A;  2FX0 A;  2L02 A;  4RGR A;  4IHY A;  4BXF A;  4HNU A;  1ZLJ A;  2KRH A;  2O0Y A;  2OCC H;  5CKT A;  5IP7 J;  3S17 J;  1R00 A;  2JRM A;  3QP6 A;  1O3Q A;  2FBH A;  4DGW B;  2OTJ I;  4UUT A;  4ZH4 F;  1FJL A;  3CLQ A;  3RPU D;  4QTR A;  4A3B J;  1SVO A;  1ZGA A;  2KRF A;  4IEJ A;  3TP0 A;  2V79 A;  5M5X J;  1H88 C;  1P4X A;  2WC2 A;  2HDW A;  5HLI A;  3M7G A;  2VC1 A;  3F8B A;  1UHM A;  1XD7 A;  3VOE A;  2R7Q A;  3PFY A;  1ODD A;  1W5C C;  3IKT A;  3RKX A;  1QNT A;  2HOE A;  2VBY A;  2R7V A;  1Y0U A;  2V4J C;  3EUH C;  5FLX K;  1E3O C;  3QRF F;  1FX7 A;  2EFW A;  5B1A H;  4AM3 A;  1HW1 A;  2DQR A;  2VB6 A;  1KA8 A;  2GXG A;  3GFL A;  1FYM A;  1KQ9 A;  2CUJ A;  3BTC A;  5IOY A;  4YIR X;  3JRA A;  2PMU A;  4ZZL A;  3WTT C;  1NH3 A;  1ZLK A;  2E1C A;  1YE9 A;  2R3S A;  3DLA A;  4KA4 A;  4OOI A;  1R7J A;  2QQB A;  2W25 A;  1S9H A;  1ZAO A;  1CF7 B;  3F8M A;  2LR8 A;  3C18 A;  2BY2 A;  1C0W A;  4MHG A;  3DBR B;  3CCR I;  1HC8 A;  3K1P A;  3PSI A;  3FIS A;  5D6E A;  4XKW A;  2CRG A;  2ZXH A;  1EKE A;  3SEZ A;  5E3L A;  3KX2 A;  5M3M J;  4XLP F;  4RM3 A;  1WFX A;  4KJZ A;  3ASN H;  5CYV A;  4QLC U;  3KP6 A;  5BPD A;  1X4O A;  1ZRE A;  2IPQ X;  5E8I A;  5D4R A;  4A3I J;  2XPV A;  1JKP C;  4YFN F;  2D2W A;  2JRT A;  1JGG A;  1JHF A;  4YIF A;  2X1E A;  4N0B A;  3PIP F;  4A3J J;  2QQ8 A;  1ULY A;  2EZH A;  3K4J A;  4WXD A;  1YHQ I;  3TGN A;  3B73 A;  1A31 A;  3VEP A;  4O3M A;  3C2H A;  1TZL A;  1FEX A;  2PEX A;  1FMV A;  2E1M B;  5JHF A;  5C3E J;  1XMK A;  2FU4 A;  5FJ8 J;  3I3L A;  3IH4 A;  3P9K A;  2GQQ A;  1MZB A;  2Y48 A;  1APL C;  1XGO A;  5DCM A;  1D1B A;  1AWC A;  4HX4 A;  1XGS A;  3A0B C;  2DFF A;  1VQL I;  2N8G A;  3ASO H;  3S1R J;  2RVC A;  2EWN A;  4PJ0 C;  3OYB A;  3K4C A;  3S3O A;  3HRM A;  4I99 C;  3TQN A;  4IO9 F;  1G3S A;  5JVG F;  2Z33 A;  3L09 A;  1I1G A;  2X51 A;  3DP7 A;  1JHH A;  1E17 A;  2K3F A;  3ZMD A;  3F21 A;  3BTL A;  1IRZ A;  3WTZ A;  1OCO H;  3FXJ A;  2EIJ H;  1IUY A;  1LQ1 A;  3WGH A;  5CVI A;  3ULQ B;  3S2H J;  1KQ8 A;  3E5Q A;  3H1C A;  3HEF A;  3VB2 A;  2X0L A;  2MLG A;  5EZH A;  4GCV A;  1LVK A;  1QGP A;  3OYF A;  2Z99 A;  1G4D A;  1R6R A;  3CJN A;  1WJF A;  2G9W A;  1FWZ A;  1FOW A;  4KMF A;  3BPX A;  5DTD A;  1XSV A;  3MZY A;  3RCO A;  1R9T J;  4XN3 A;  3CCL I;  3CJQ B;  1XCB A;  3V8J A;  3LSP A;  3G3Z A;  4CA0 A;  3F22 A;  3RQI A;  3EUA A;  3BJO A;  3CCQ I;  2DDB A;  4UVA A;  1JGS A;  1UG0 A;  4BQN A;  3GTQ J;  2TDX A;  1SMT A;  3M1E A;  5GTI C;  2E2H J;  2IS1 A;  2DA1 A;  2EIL H;  2LKP A;  2XB5 A;  3TO6 A;  1IZ1 A;  3BQZ A;  3BWG A;  3I54 A;  1LEB A;  2OTL I;  1V54 H;  2P7V B;  4MIM A;  4PFO A;  2R92 J;  4KIC A;  1FSH A;  4XRS G;  2VOD A;  2XV4 S;  5EG0 A;  2XAQ A;  4PZJ A;  5HOD A;  1BA5 A;  3B02 A;  4N4N B;  2MBF A;  2BBY A;  4LFU A;  4OAY A;  3BR1 A;  4L5E A;  4WX9 A;  5IT9 Z;  2H6C A;  3D5R C;  1A35 A;  1Z3Y A;  1S3J A;  5JLW A;  2XRN A;  1LFU P;  3ZQQ A;  1KZH A;  1R49 A;  2W57 A;  4UB6 C;  2V1N A;  3OIO A;  1VQ6 I;  3ABT A;  2QLZ A;  1YLF A;  4AVP A;  4DZP A;  4EJV A;  1HDD C;  2X9D A;  4L9V A;  3OYM A;  4E7K A;  2R93 J;  2BXZ A;  3FMR A;  2P6T A;  2WB1 N;  4MQV A;  4ESF A;  2ZNY A;  4U0V A;  4N9H A;  3K0L A;  2XAS A;  3BCB A;  2IA0 A;  4M72 A;  2R7X A;  5FRM A;  3HHG A;  4F52 A;  3K4N A;  4EJU A;  3KFW X;  5JLX A;  3W2A A;  2L4A A;  5E18 F;  1IN5 A;  1FIP A;  5C4X J;  1FBU A;  3W3C A;  3J80 Z;  2ADU A;  3AL0 B;  1K7A A;  2QM3 A;  2QEN A;  2XGE A;  5H2F C;  3FF5 A;  5IYB J;  4C3J J;  1U8R A;  2R7Z J;  2W7N A;  1ZR4 A;  1FBQ A;  1CGP A;  1DUX C;  4B4C A;  3G1O A;  2W24 A;  2LP0 A;  3V4G A;  2BHZ A;  1X1A A;  3H0D A;  2LVS A;  3ZMV A;  1Z3X A;  2VQL A;  1JUM A;  1D5Y A;  1IN8 A;  3MKW B;  2Z16 A;  4H0E A;  1FLI A;  1SD7 A;  1I1S A;  2MD0 A;  1U2W A;  2F5V A;  5FD5 A;  4ENM A;  1LPQ A;  1ERD A;  2Y30 A;  4NC6 A;  4NUB A;  2VQC A;  2DJN A;  2E7W A;  2ZXI A;  5IT9 K;  2R7S A;  1X2N A;  4M9S A;  4RAF A;  1LFB A;  3QOD A;  1GV5 A;  3RYP A;  2A5W A;  3HTU A;  4XSZ F;  1VTN C;  3CCM I;  4MTD A;  2YR2 A;  3TO7 A;  3S15 J;  1POG A;  4II3 A;  4C2M J;  1RNL A;  3ECO A;  3PM1 A;  2VJJ A;  5F04 A;  3JRD A;  3T8R A;  2HOS A;  1GV2 A;  5DUI A;  4HLY A;  4IF4 A;  2VPL A;  3WTW C;  2OPT A;  4BS9 A;  2EFN A;  5BOX A;  2KPM A;  2PBI A;  2PMZ A;  3Q9V A;  4QPO A;  4UVC A;  5HDN A;  2QSH X;  3HOZ J;  2LYC A;  3L9F A;  4XK4 A;  3H5A A;  3JR9 A;  3FKJ A;  1QBJ A;  4RA2 A;  2VE8 A;  1WWX A;  4WXC A;  4JX6 A;  2VBW A;  5H6Q A;  5D5V B;  5HVQ C;  3I59 B;  1UST A;  2P8T A;  1K4S A;  3S16 J;  4R8H A;  1F43 A;  3HYI A;  4G9Y A;  3T8T A;  3LSG A;  2UUZ A;  1MNE A;  1WCM J;  2WAE A;  1BI0 A;  4ZYD A;  5LBQ A;  2DPD A;  4V2F A;  2FXA A;  4A3D J;  3HSE A;  4C3H J;  4U88 A;  4ZYE A;  3FM5 A;  4MEY F;  5K5Q A;  4IPA A;  4M6V A;  1OR7 A;  5HS7 A;  4D1Q A;  3E5U A;  1VZ0 A;  2RAE A;  4M3E A;  4ZZD A;  2O8X A;  2XSD C;  2DJI A;  1VQP I;  1O7L A;  2RQP A;  3E7L A;  3F0C A;  1MKM A;  3KIO A;  1W5S A;  3ZPL A;  3OYN A;  2QCO A;  2ZFU A;  3OS0 A;  2EV0 A;  5LGT A;  2D45 A;  3FHZ A;  4PCQ A;  5J4V A;  4LJZ F;  2A05 A;  1XB4 A;  3J7Y J;  3DTI A;  2JTV A;  1MBK A;  3OOU A;  2IS2 A;  5E1W A;  3R6S A;  4TV7 A;  1QZZ A;  2HVQ A;  1IXS B;  3WG7 H;  1VND A;  4EEF G;  1I5Z A;  2DMT A;  3BLY A;  3RKW A;  2YU3 A;  4MTE A;  4A6E A;  5HLH A;  3BG9 A;  3K69 A;  2H1K A;  2W4S A;  4M71 A;  4GGG A;  4N9I A;  2K9L A;  5E3N A;  2RKH A;  4JK1 X;  2LD5 A;  4S05 A;  2R7R A;  1D1C A;  3D0S A;  2Z9O A;  1S7O A;  2OAZ A;  4W97 A;  3IRR A;  2DA7 A;  1ZQ3 P;  4IOC F;  5GTH C;  1SFU A;  3HOS A;  2DOE A;  5EEG A;  1Z77 A;  2TRT A;  2R7O A;  2IA1 A;  4M9X A;  4UV9 A;  3H0G J;  3RTR A;  1I3Q J;  1S29 A;  1Z91 A;  4B3A A;  1VQN I;  1Q1H A;  1HXD A;  2DW4 A;  1EH7 A;  3G1L A;  1BR1 A;  1O7F A;  2QSF X;  1BC7 C;  2EA2 A;  4BHC A;  3K4B A;  3M9A A;  4MFE A;  5LRS A;  2PN6 A;  1UG2 A;  5E79 C;  1B8I A;  2JMW A;  2EIM H;  3IUO A;  4HG2 A;  1XTA A;  3VYU B;  2DTR A;  1WPK A;  3HM5 A;  1NK3 P;  4HW0 A;  1MMS A;  2H27 A;  3F8F A;  2QBY B;  2WAF A;  4FTH A;  3BR2 A;  4RAY A;  3FXO A;  1G2H A;  2KRC A;  3I71 A;  3REO A;  2VPR A;  2BY3 A;  2AXT C;  4R79 A;  2M7B A;  3FXU A;  1BBY A;  1TWA J;  5FO5 A;  2CQX A;  1ZG5 A;  4ZYH A;  1IDY A;  3OYE A;  3RDI A;  3AG3 H;  3DEE A;  2LNB A;  4IRG A;  2L0K A;  4RB3 C;  1I50 J;  3DKY A;  5FFZ A;  4CCM A;  3LSR A;  2Y9Z A;  4CH7 A;  4DW6 A;  1ZK8 A;  4S04 A;  3K6G A;  2CQ7 A;  4Y4R A;  5EGO A;  2LKX A;  1IUF A;  4UV8 A;  4NQW B;  3ZQG A;  1O3R A;  1OQY A;  1FMW A;  2YSR A;  3BG7 A;  3WTV C;  1W0U A;  5DD4 A;  1OYI A;  2GIZ A;  1YJN I;  4PJJ A;  1T38 A;  1Z1D A;  5KAF C;  3AL0 C;  4HRI A;  1OCZ H;  1YOV B;  1FBS A;  4GO1 A;  4FAS D;  2IEK A;  4BY1 J;  2B0L A;  3SDB A;  2P7C B;  5GPA A;  1XDU A;  4G6Q A;  3EQL F;  5GAG J;  1T33 A;  4CZZ A;  2I8D A;  3TP3 A;  1VQK I;  3LST A;  2M4G A;  3QPL A;  5CLS A;  5LGN A;  2L7F P;  3BC8 A;  2WA0 A;  2X6Y A;  2ZBK A;  4B3X A;  3LA7 A;  4DYC A;  3J81 Z;  2DN0 A;  3BY6 A;  1SVL A;  1B72 B;  1MBJ A;  4XSX F;  3EDP A;  5CJ9 A;  1MND A;  1MDM B;  1TWG J;  1X4P A;  2ZME B;  3ZQH A;  3DCF A;  3FM3 A;  1KYZ A;  3J7A O;  2BEO A;  3C7J A;  4UVB A;  4UUS A;  4J01 A;  2V9P A;  4FX4 A;  4BE1 A;  2COM A;  4L9T A;  2R7W A;  3QPS A;  3QOE A;  2UWM A;  1LDK B;  3BR3 A;  3KYD B;  3KZI C;  2DK5 A;  3MKZ A;  1BOA A;  3BR6 A;  4Q5S F;  2A6E F;  1GXQ A;  2WTE A;  4LGW A;  1RKT A;  3F72 A;  2DA4 A;  1SAU A;  3GTM J;  2VAS A;  1WSU A;  2MG4 A;  3V7S A;  1XX5 A;  3H36 A;  4XOR A;  4BQA A;  2DFI A;  4BH9 A;  2LSO A;  3H9G A;  4FQG A;  5LLQ A;  3CUQ B;  2M0C A;  4PFP A;  4WF2 A;  5BS6 A;  2GM4 A;  2ZJP F;  1WJB A;  4AUX A;  2Y75 A;  5IT3 A;  2CO5 A;  3F6V A;  4KIT B;  1G3W A;  4NDL A;  3CC7 I;  1YRN B;  3LWF A;  3WTY C;  1NG7 A;  2PJR B;  4DJA A;  4BNC A;  3CME I;  3LSH A;  5M3F J;  5ILV A;  1QU3 A;  2RDP A;  5GP9 A;  4B44 A;  2CH0 A;  1DU6 A;  4YFK F;  4OIN F;  3FZV A;  3TOB A;  3OYI A;  4IHW A;  2Q1Z B;  2IVM A;  4BDZ A;  2XAF A;  3RPU A;  1R5H A;  2EA4 A;  3J81 K;  4A3M J;  1KON A;  4NNJ A;  1I39 A;  1YS6 A;  2HTS A;  3IH2 A;  3MWM A;  4DIQ A;  3D1N I;  2KDO A;  2QWW A;  1TQI A;  2F5E A;  1IRX A;  1WJ5 A;  4UY8 I;  1MH4 A;  3HIF A;  5L3E A;  3IH3 A;  1LE8 B;  5EDN A;  4HYE A;  2DCE A;  3IHU A;  1IDZ A;  4BU2 A;  1SVM A;  2VXZ A;  3HHH A;  1RI7 A;  1Q1V A;  2K9N A;  3LSJ A;  1AKH B;  2K5C A;  2GAU A;  2XGD A;  3JTH A;  3ZRG A;  4C2U A;  2DOF A;  2EV5 A;  2PMH A;  1HW5 A;  3KEY A;  2FOK A;  2MYS A;  3IWZ A;  2OV7 A;  2B63 J;  1SFE A;  2MH9 A;  5ILU A;  2NXN B;  5FKK A;  2NNY A;  2K02 A;  1XG1 A;  4U7D A;  1MJA A;  2FRH A;  5HOO A;  4P9F A;  2XDV A;  2E36 A;  1ETK A;  3FXL A;  4BEH B;  4U7B A;  1PP7 U;  3M3Y J;  5AON A;  2M34 A;  4OU0 A;  3LA2 A;  1WRJ A;  4RS8 A;  5GAE J;  2QSG X;  1R1V A;  1XSX A;  5HLT A;  3W6K B;  5E3M A;  2HS5 A;  2CW7 A;  2GXB A;  5L3D A;  1U9N A;  1E3P A;  3NAR A;  4RAZ A;  3GW2 A;  3F23 A;  3OYJ A;  2CQQ A;  5F0F A;  2F5D A;  1BI2 A;  3FWE A;  2BZT A;  3FXK A;  2CW8 A;  4G7Z F;  3L00 A;  4PSW A;  2KZV A;  5FKM A;  3DWL E;  2OCE A;  2M0M A;  2EZL A;  2KP6 A;  3BZC A;  4CIC A;  3BTJ A;  4HSR A;  3ZMU A;  5FLV A;  4YII A;  1Z6T A;  2GA1 A;  1U5T B;  1BR2 A;  4A3E J;  1OYW A;  2VBX A;  2QA4 I;  1CF7 A;  4BE2 A;  2YX7 A;  3KE2 A;  2BW3 B;  2F4O B;  2QQ9 A;  3TW6 A;  4HX8 A;  3CDH A;  2GXA A;  3R61 A;  3JSP A;  2P5V A;  3H92 A;  2LMD A;  4XKC A;  2JK3 A;  2L7Z A;  3IAM 2;  4B47 A;  3ML6 A;  4I0A A;  4BY7 J;  4BXX J;  1PVE A;  1DDN A;  1ZH5 A;  4DYR A;  4LMY A;  4XOT A;  2DA3 A;  1U3E M;  5F6F A;  2WAQ N;  3L7W A;  3G6E I;  2HVS A;  2JSC A;  1WHU A;  3ABK H;  1FYL A;  2HKO A;  2Y0M A;  2JA7 J;  5FFX A;  5IOZ A;  1YIT I;  1YJ9 I;  5KK1 A;  2J5O A;  4YRV A;  4P1W A;  6PAX A;  3UNG C;  4AU7 A;  1OIS A;  2PMZ N;  3CO6 C;  1IG7 A;  1F5T A;  1D8J A;  4FE4 A;  4BQQ A;  3KZZ A;  3C2G A;  3ZN0 A;  2NNN A;  4HDV A;  5D5X B;  1OCC H;  3OV8 A;  1FOY A;  1G59 A;  2OJE D;  2DAO A;  5L3B A;  3K2A A;  4M3D A;  1V3F A;  2NAZ A;  4A5M A;  1R71 A;  2RV8 A;  3U1D A;  1ZR2 A;  1Z0X A;  1Y1V J;  3BZK A;  2ZME C;  2L01 A;  2X4H A;  3RKQ A;  4FIS A;  3M4O J;  4LLG F;  5JFR A;  1FYK A;  2CU7 A;  3MEX A;  3RKY A;  3CCS I;  3SFZ A;  5EEH A;  3GTG J;  5C4J J;  4G12 A;  2H6B A;  1ZTR A;  3TO9 A;  2B9S A;  2NRA C;  5E1X A;  3HOX J;  1OKR A;  1L3L A;  3JRG A;  4BJT A;  3QU6 A;  3DEU A;  4P55 A;  1ZN2 A;  2BOL A;  1Z6R A;  4RGX A;  3GWZ A;  4Z2Y A;  1RET A;  2HDD A;  3TDU C;  4A5N A;  2KIM A;  5JR3 A;  3JRB A;  3CUQ C;  4IHS A;  3HOU J;  3H5R A;  3WOD F;  1UHW A;  5LRR A;  1B4A A;  1S5L C;  1R58 A;  3OYG A;  2DA2 A;  2HGC A;  1STZ A;  1S7A A;  1JTY A;  1R36 A;  3F3X A;  2YS9 A;  3N05 A;  3S32 A;  1RZ4 A;  5LEJ A;  3FHN A;  2FD5 A;  4D0P A;  5J3L A;  2BV6 A;  2JA8 J;  3T1B A;  5CVR A;  3A01 B;  2E35 A;  4DOZ A;  2PI0 A;  4LG3 A;  3KYC B;  2RQQ A;  3BG3 A;  5DV5 A;  3WU0 A;  3L2Q A;  1H8A C;  1WJE A;  3HRU A;  2P5K A;  2HQN A;  4DQ2 A;  2XPW A;  4BJ5 C;  3M07 A;  2JPC A;  1ETW A;  2HZT A;  1T98 A;  4L18 B;  3LFU A;  2QEX I;  5HLG A;  1EF4 A;  2Y31 A;  3WGI A;  4Y33 A;  1LNW A;  2M8G X;  4FCY A;  2Y2Z A;  3OYC A;  3ZQC A;  4AYB A;  4XRF A;  2C6Y A;  3BG5 A;  2E71 A;  2JVH A;  2L54 A;  3HUG B;  1GXP A;  3VYR B;  3P7N A;  3PJR A;  2Y9Y A;  2IGN A;  1E0E A;  2P5L C;  3PSF A;  1D0X A;  2WY8 Q;  1N78 A;  1L0O C;  2LY1 A;  4X0G A;  2L2O A;  2VUM J;  4AWX B;  5LD2 C;  3LA3 A;  1YX5 A;  2FEZ A;  1X1C A;  1SEU A;  2ZCW A;  1A6I A;  3IAS 2;  2L7K A;  3U21 A;  2NOG A;  4F55 A;  1VQ5 I;  2W84 A;  3PNT A;  4JP0 A;  2VT3 A;  4L5I A;  1OFC X;  5HS8 A;  3PQK A;  1FP1 D;  3ZGK A;  1D5V A;  2LG4 A;  3OS2 A;  2IJL A;  1P6R A;  2HR3 A;  5DEQ A;  3P5J A;  1H0M A;  3J7A Y;  2MAB A;  2XC7 A;  2BE5 F;  2V1D A;  3G2B A;  3QQA A;  2K9Q A;  2V7F A;  1VQM I;  1MBE A;  2CQN A;  3KCC A;  3G1M A;  4E7H A;  1P2F A;  2VJ4 A;  1R23 A;  4KT6 A;  2O03 A;  3CUO A;  2H09 A;  2DXI A;  2AHQ A;  2EB7 A;  1U5T C;  4HBL A;  5J8F A;  3KYL A;  1IAW A;  4ESB A;  4MQ9 F;  3TOA A;  1B59 A;  2OC6 A;  2PG4 A;  4EJT A;  3V8K A;  1YS7 A;  2A6H F;  2RNJ A;  1BM9 A;  3HTS B;  1VF9 A;  1X1B A;  3IV5 A;  2EZK A;  1BOB A;  1DPU A;  4M3G A;  3V7C A;  4Z6Y A;  3ZQF A;  2FNA A;  3FXM A;  3WG9 A;  4I7H A;  2FQ3 A;  3E0J B;  2Y0S N;  1WVR A;  3E3V A;  3E6M A;  3A1Y A;  2GOM A;  3T5X A;  3VPR A;  4AD9 A;  3LOC A;  1ZG1 A;  4A0Y A;  2KMU A;  3GFI A;  1U0J A;  1FT9 A;  1Z05 A;  4I09 A;  4G6D A;  1M1E B;  3NRV A;  4IRI A;  3I59 A;  1TW2 A;  3V8L A;  3EET A;  3RIR A;  1H9G A;  3ZN1 A;  4MGR A;  3I4P A;  1EH6 A;  3L2R A;  3CC2 I;  3I64 A;  2QYO A;  2X1D A;  3DU5 A;  2XF6 A;  4E4H A;  2ECB A;  2EK5 A;  2OBP A;  4LIT A;  4L5J A;  4A0Z A;  4GFB A;  3DLL F;  4NHJ A;  4NC7 A;  2F5C A;  1NK2 P;  4ITV A;  2LLK A;  3BZ6 A;  2M87 A;  3S3M A;  5CVJ A;  4J19 A;  3MZH A;  3OY9 A;  2HXO A;  2Z3Y A;  4ETS A;  1K4T A;  3OL4 A;  5IP6 A;  2KIS A;  2K27 A;  4JX5 A;  3ZMT A;  2GWR A;  3Q9S A;  1J09 A;  3R60 A;  4A69 C;  3Q0U A;  4D5F A;  2K9M A;  2JA6 J;  4IOA F;  3H35 A;  3KP3 A;  4XQF A;  3RZD J;  4YG2 F;  3HKZ N;  4UB8 C;  3JRE A;  5K7Z A;  1RR7 A;  3LSM A;  4PJM A;  1ZHF A;  5F1J A;  3MMY B;  5DYM A;  4HZF A;  2LK2 A;  3OYA A;  1FSE A;  1G6N A;  3QYE A;  3I58 A;  3HPG A;  2WV1 A;  5E20 A;  5DDG A;  3BQY A;  1P4A A;  1W0T A;  2JA2 A;  1BIB A;  3CTA A;  3O8G A;  2AXL A;  3FBI B;  3SZP A;  1HKS A;  4E6K G;  1A04 A;  1HQC A;  1XCV A;  2O5R A;  4BAC A;  2GZW A;  2IS4 A;  2JVG A;  2FML A;  3RI4 A;  2O6G E;  1BJZ A;  1ITY A;  1SMY F;  1OJL A;  2ESH A;  3ZCO A;  5M5W J;  4ON0 A;  1YTY A;  5TGT A;  1WI3 A;  4MLO A;  3HPH A;  3FMQ A;  3QYB A;  1BN5 A;  4BYY A;  4L0Z B;  2BGC A;  1Z7U A;  2E19 A;  2HQR A;  3RJP A;  3FK7 A;  4AVZ A;  3S2D J;  3KZY A;  1K83 J;  3W6V A;  3BT9 A;  2P0W A;  2XRL A;  1U8B A;  5DD8 A;  2W00 A;  4UUV A;  2PQ8 A;  4EQQ A;  5CPR B;  2XUB A;  2VKE A;  2ME6 A;  4EM1 A;  3F8N A;  3HRS A;  1D0Y A;  4CCL A;  4F7Z A;  1KU9 A;  3ZMS A;  4ENJ A;  4LK0 F;  4XR6 A;  4KN7 X;  2A6T A;  1SAX A;  2VIX A;  2VLA A;  2IA2 A;  1MIJ A;  3P9C A;  1D3Y A;  3X2Q H;  1JE8 A;  2LDU A;  1SD6 A;  5DUK A;  1TL8 A;  3H3Z A;  1TTY A;  4QWQ A;  3E97 A;  1I3A A;  1IN6 A;  2XKP A;  1IV8 A;  4E7I A;  2R4G A;  4Y15 A;  1Y8R B;  1QVT A;  2L9R A;  1R1T A;  2XIG A;  5K7H A;  1RR8 C;  2G7U A;  4ZTF A;  2ZJR F;  3CQZ J;  2RGV A;  1VI0 A;  1R5I D;  2CSO A;  3QOP A;  1F36 A;  5ILS A;  5EF6 A;  3KLN A;  1VFC A;  4KN4 X;  1OLT A;  3Q0V A;  4M73 A;  2O61 A;  1YW8 A;  5TJJ A;  2LF8 A;  1MH3 A;  4E7Z A;  2A69 F;  1RPW A;  4NQW A;  4RB1 A;  4MEX F;  1WH7 A;  1YQA A;  5B66 C;  4EAT A;  3ONQ A;  4XL9 A;  3JW4 A;  1Y8Q B;  4ZJZ A;  1I27 A;  4D7M A;  2QKL B;  4HNV A;  2CG4 A;  4M74 A;  4DYQ A;  4A0X A;  1ETQ A;  3QPT A;  5B1B H;  4KIS A;  5GPC A;  3KP7 A;  4IKF A;  1K78 A;  4G7O F;  2M4K A;  2MA3 A;  2IT0 A;  2MD5 A;  2FUG 2;  3HB9 A;  3R4K A;  4U87 A;  1TT5 B;  2KZG A;  1ZRC A;  2ZSH B;  3DTK A;  1AHD P;  2FE3 A;  2MLK A;  1JJ6 C;  1P7J A;  4XON A;  3CMA I;  1HF0 A;  2HFH A;  1HOM A;  3CMY A;  2DPU A;  2DFH A;  4LB5 A;  1T39 A;  3EUH A;  1DP3 A;  2AO9 A;  3LQR A;  4JOM A;  3GZ6 A;  3DXJ F;  3L2W A;  1SD4 A;  2CV1 A;  4GYI A;  1ETV A;  1LVA A;  3N4M A;  2WAD A;  1ENH A;  2RC4 A;  4RLF A;  4A3K J;  2QQA A;  2JUG A;  2STW A;  3GBG A;  2VC0 A;  2HNH A;  2WBM A;  4P5O A;  2VOP A;  5F08 A;  1UMQ A;  1Z9C A;  1B6A A;  2IXS A;  3AG4 H;  1RC9 A;  1W7P B;  3S2W A;  3OYL A;  2F4I A;  4A12 A;  2E5Z A;  5J40 A;  3JRH A;  5F1R A;  3NWS A;  2XKO A;  4FET A;  2LKS A;  3K2Z A;  2K7L A;  2X1C A;  1F9N A;  3TBI A;  1QPI A;  4BKX A;  2F2E A;  2VON A;  3ESW B;  1A36 A;  2EPF A;  1ETO A;  4UNO A;  3K9T A;  1V5G A;  2MW8 A;  4I02 A;  3WHC A;  3TED A;  4CYC B;  1WKM A;  2M2E A;  3BCA A;  2LF7 A;  3L2U A;  1Y39 A;  3CP2 A;  3A2K A;  3ROU A;  3BRO A;  1UAA A;  4KDP A;  2KIU A;  5H6R A;  1YRN A;  2X6W A;  5EJC A;  3KP4 A;  1F4K A;  3RQ4 A;  1W7P D;  2PJR A;  5KAI C;  2O9L A;  2OZU A;  1Y6I A;  3O6B B;  4PUS A;  1BI1 A;  2OQR A;  2ZXJ A;  1YG2 A;  5HS9 A;  2R5Z A;  1N77 A;  1FC3 A;  5FB2 A;  2GLO A;  2PX9 A;  3BPV A;  1MSF C;  1YI2 I;  1IV6 A;  3GLL A;  2FF4 A;  3BG6 A;  2KQR A;  2KIF A;  3I4N J;  4BAY A;  2R7D A;  3ISP A;  3OSF A;  3BJA A;  2EFO A;  5FKO A;  1BW6 A;  4RM2 A;  2HU9 A;  5BPI A;  4Y13 A;  2VI6 A;  4F91 B;  3AAF A;  5IYD J;  2EH3 A;  2DT5 A;  1XS9 A;  4EJO A;  5HNH A;  3E6D A;  4XKV A;  2HKX A;  4KT5 C;  2DMP A;  1ZKG A;  2GOX B;  2VKH A;  1JTX A;  1MBH A;  1P9Q C;  2UV1 A;  3WU2 C;  2KT0 A;  1TWC J;  3WTX C;  5D4S A;  2L7M P;  1YFH A;  5E8G A;  5E3O A;  4BEH A;  2VN2 A;  4AYB N;  4RB2 C;  1WI9 A;  1RUO A;  2CW0 F;  5DM6 F;  2LBF B;  1BIA A;  1N25 A;  3DPL C;  3F9K A;  1CQT A;  4PJN A;  2DQL A;  2DLL A;  4JYK A;  3G71 I;  2R5Y A;  4JBA A;  2NVU B;  1S7E A;  2CUE A;  3W2V A;  1H89 C;  1B8I B;  1Z67 A;  2HTJ A;  4XNF A;  4Q4Z F;  3JRC A;  4OMZ A;  2HPM A;  3ELK A;  2VKV A;  4V19 K;  1EH8 A;  1D1A A;  2WB1 A;  3I4M J;  2AQE A;  2MC3 A;  3IKV A;  4XMY A;  4BJ6 C;  2B7E A;  3B6C A;  3LFK A;  4I98 B;  3HOV J;  5BMZ A;  3N97 A;  3GYH X;  2E5N A;  4KIB A;  4FT8 A;  1U5T A;  3WE3 A;  1JKQ C;  2IAI A;  3NEU A;  3CDL A;  3S93 A;  4XID A;  3CD6 I;  3GO5 A;  4BBS J;  1FP2 A;  3GX4 X;  1WJD A;  2BW3 A;  3CZ6 A;  2JT1 A;  2OQG A;  3DFG A;  1Y1W J;  3E6B A;  4QIW N;  4I01 A;  2H8W A;  2XVC A;  3PQJ A;  3BDD A;  1A6Q A;  1IXC A;  1HST A;  1HA8 A;  1JKR C;  3D5S C;  1QZY A;  3ZQI A;  2NOJ B;  4BGD A;  4IHX A;  1S72 I;  1HSJ A;  4RGU A;  3ZMZ A;  2BYV E;  2JWT A;  4IXA A;  5LFA A;  3WU1 B;  1IXR C;  1W36 D;  3DKW A;  2MH2 A;  5JHU A;  2ZSI B;  2DU9 A;  4F93 B;  2WY7 Q;  2FBK A;  3DKX A;  1YYV A;  4LG0 B;  2QUF A;  1IGN A;  2M9H A;  3I55 I;  1RRJ A;  4RGS A;  2OF7 A;  1YW9 A;  4KFC A;  2XHK A;  4ABZ A;  1LKX A;  3Q3S A;  1FTZ A;  3SQN A;  1TNT A;  3CF2 A;  5IPA A;  3IWF A;  3SEQ A;  2IP2 A;  3R0A A;  2XPU A;  3A03 A;  4E7L A;  3ZQL A;  4A6D A;  2ZB9 A;  5AIP A;  4EM0 B;  5J1U A;  5IP9 J;  3MAJ A;  3H3V K;  4XN0 A;  3CMM A;  3SYT A;  1MBF A;  2QZ8 A;  2L4M A;  2CYY A;  5FGM A;  3FMS A;  2I5U A;  4KYW A;  3TMO A;  5GAH J;  2ZO4 A;  3NQO A;  4HV5 A;  4DZJ A;  4UUS B;  1ETY A;  4YEJ A;  5HDK A;  2NVX J;  2VQH A;  2D1H A;  3COA C;  2DOA A;  4B48 A;  1PDN C;  1QO0 D;  3BOQ A;  2L5Q A;  2BVL A;  2LRE A;  1IF1 A;  4EVI A;  2FQ4 A;  2FSW A;  2HDC A;  1ON1 A;  1WGX A;  3K7A J;  2ME0 A;  4C9Y A;  3L1P A;  3P9I A;  4F3Q A;  1HKQ A;  1LEA A;  2QF7 A;  2EQR A;  2OU2 A;  5D6F A;  2EJR A;  3DU6 A;  1HW2 A;  2E2J J;  2ZFW A;  1T0F C;  2ETH A;  1OCT C;  3SJM A;  4A3L J;  3O3K A;  4XLN F;  2F5F A;  3HZJ A;  2CUZ A;  4ASN A;  2AS5 F;  3MKY B;  1BJA A;  4LIU A;  4E7J A;  2ECC A;  3GTO J;  1U78 A;  3QPH A;  2DYS H;  3VOD A;  1BI3 A;  1MD0 A;  3DF8 A;  5D5W B;  4XRM A;  2ELK A;  3CLO A;  3GCM A;  3QU3 A;  3HL2 A;  2Q2E B;  5EZG A;  5IYC J;  4GXO A;  2ZNZ A;  4LK1 F;  1KU2 A;  1UZC A;  3MKL A;  4LLL A;  1JUS A;  4BL0 B;  3VSK A;  3A01 A;  4HNT A;  5DM7 F;  2ELJ A;  4PJL A;  3CP8 A;  3BR0 A;  2M7A A;  4CDG A;  5J1Y A;  1SFO J;  4IHV A;  1ACI A;  2FMY A;  1HLV A;  5E17 F;  4HV6 A;  3MVP A;  2AQF A;  5K5R A;  1YW7 A;  1D0Z A;  1PUF B;  4A3G J;  2P6S A;  9ANT A;  1VQ8 I;  4L9J A;  1PUE E;  3FXR A;  2I10 A;  4D9J A;  1XSD A;  3W2W A;  3HG9 A;  3GLX A;  3S8P A;  4WXH A;  3ZXS A;  3HGG A;  2E60 A;  4BDY A;  3HUG A;  4ZC3 A;  1FPQ A;  4XLF A;  4M3F A;  4M3B A;  1VQO I;  2EBI A;  1SD5 A;  3HGY A;  2DA6 A;  2R0Q C;  2XGC A;  2IBD A;  1GVD A;  3C3W A;  4ZYA A;  1T2K A;  3ABU A;  3I53 A;  4HPQ A;  3DTE A;  4XKB A;  3I9V 2;  4IQ4 A;  3M8E A;  1Y56 A;  1NTC A;  2E1O A;  4HX7 A;  3L2C A;  3WE2 A;  3NAU A;  4IRH A;  1X1P A;  3G4S I;  3ERM A;  2IRF G;  4BHB A;  2YX4 A;  3GFM A;  2K3P A;  3GF2 A;  2XRO A;  4KMU X;  2ZKZ A;  3OOP A;  2JQ7 A;  1KU3 A;  1MW7 A;  1SFX A;  3H9Q A;  4CCN A;  5BQT A;  2E7X A;  4FHT A;  1KQ0 A;  1V5F A;  1J75 A;  5D8L B;  4X6A J;  1TC3 C;  3LNQ A;  1E2X A;  5FKL A;  3SFI A;  3QP5 A;  5LGU A;  1TNS A;  1U9O A;  2HPI A;  1FNN A;  4Q48 A;  3FK6 A;  2QVO A;  4O5V A;  3IL2 A;  3S1Q J;  4U0Y A;  2X85 A;  4PGG A;  4B09 A;  4CUG A;  4WK8 F;  4V2G A;  1FOK A;  1J5Y A;  4IL6 C;  1DGR M;  1S8N A;  1YJW I;  4CHU A;  4CXF A;  1ZGJ A;  3VFZ A;  1W36 C;  4RBO A;  5KVR A;  1R5G A;  2FA5 A;  3D5L A;  3G73 A;  3LAP A;  1R4N B;  1MJ9 A;  4CYD A;  2IS6 A;  2CQK A;  3EPZ A;  4ESJ A;  2E1N A;  1O3T A;  4IHT A;  1OCR H;  5TIS C;  3K10 A;  3B6A A;  3H5N A;  1WJA A;  2NVQ J;  1TWH J;  4MNU A;  1HKT A;  3DBH B;  3GXO A;  4OAZ A;  4W1U A;  3TDZ C;  2HEO A;  2MC4 A;  1QZE A;  2EV6 A;  1BL0 A;  3ABL H;  1IC8 A;  1P92 A;  1F1Z A;  1EV7 A;  2PFB A;  3HJE A;  2V1X A;  5F27 A;  2NS8 A;  3GTL J;  3I5U A;  1LDD A;  1X3Z B;  4CGZ A;  5LEK A;  1KGS A;  4C30 A;  1X3W B;  2A07 F;  3OYD A;  2L3D A;  4M6Y A;  3QYF A;  2KHM A;  1QA6 A;  1R1U A;  1GUU A;  1XDS A;  1TT0 A;  3VSL A;  2JPB A;  3I56 I;  4ENN A;  3HRT A;  3OSG A;  3U2R A;  1JXS A;  1RKW A;  2W1O A;  2COB A;  5GAD J;  3L2V A;  1YO5 C;  2RN7 A;  3CES A;  1V55 H;  5J47 A;  4NC8 A;  4BUP A;  3GVA A;  4ZDO A;  2IW5 A;  1VQ9 I;  3BR5 A;  2HQ5 A;  1IN7 A;  1AA7 A;  2IGM A;  2H94 A;  1IRF A;  2KL4 A;  3FDY A;  3TW7 A;  1AU7 A;  1IW7 F;  4BQO A;  4OMY A;  4CO8 A;  5L3C A;  4CCJ A;  5A2Q Z;  2BY1 A;  5B5E C;  1QHG A;  5K7F A;  2V6C A;  4E70 A;  4Y7N J;  4HLX A;  1GVJ A;  2HYF A;  1O3S A;  4ANJ A;  2CFO A;  4HDU A;  2L9N A;  3F6O A;  2HQA A;  2DK8 A;  2JUC A;  5TRD A;  1FZP B;  1PYV A;  3UKG A;  3SHF A;  1W4M A;  3BP8 A;  2DMU A;  3HSR A;  1MMN A;  2VL8 A;  2YPR A;  4L9N A;  3FX3 A;  4CSW A;  1VQ7 I;  4ZDP A;  5HDG A;  3V42 A;  3JSO A;  1X19 A;  2XAH A;  4P9U A;  2NS7 A;  2HI3 A;  1YIJ I;  1D8K A;  2BHY A;  2CWE A;  1JT6 A;  2RRE A;  2WV0 A;  4P96 A;  1LDJ A;  4R1H A;  3QAH A;  4IZZ A;  4HQE A;  4Y52 J;  3CCE I;  1O4X A;  4GYG A;  1FTT A;  3EYY A;  3T0Y A;  2ID3 A;  3LSI A;  4LD5 A;  2W85 A;  1LUJ B;  1W1W E;  2CV0 A;  2FJ1 A;  1K61 A;  5ICE A;  5DS9 A;  2TCT A;  4XLC A;  1OCP A;  1PJR A;  1RES A;  1TWF J;  1R4M B;  2DO7 A;  5F64 A;  2GIV A;  1P4W A;  3OIQ A;  2BVM A;  2F6C A;  1O57 A;  5DCM B;  3K1N A;  5F0C A;  4MFD A;  2DMN A;  4ENK A;  4HF1 A;  3MZ8 A;  3CJR B;  5ICC A;  2R7T A;  4DNC A;  3FKI J;  1V5E A;  1YIO A;  3DQV C;  3O8H A;  3U1K A;  4MO7 A;  2XAU A;  5A2Q K;  1NHA A;  4BXU A;  2VKD A;  2LC2 A;  2V9K A;  3BJ6 A;  1LB2 A;  1QHH D;  3MN2 A;  2M30 A;  2YUS A;  2LFB A;  3CF5 F;  1P7I A;  2XSJ C;  2DBB A;  3V7R A; 
#chains in the Genus database with same CATH homology
 2P4W A;  2OA4 A;  2VE9 A;  2ACJ A;  2DI3 A;  1MGT A;  2A68 F;  3H3U A;  2OZ6 A;  4OIO F;  2UXN A;  4HF0 A;  2ISY A;  1W5T A;  5E1Z B;  3C1D A;  5L3G A;  3JTG A;  4K2E A;  1ZAR A;  3PFI A;  3WGG A;  1I6X A;  3E6C C;  5J8C A;  3ERE D;  1FY7 A;  1XGM A;  4HF2 A;  3I0T A;  2VT2 A;  1ZRF A;  4KIF A;  1V4R A;  3R0J A;  2G7H A;  2M5W A;  2R7F A;  3F8C A;  1K6O A;  2M45 A;  3ZQ7 A;  2V9V A;  2QBY A;  4OIP F;  4XBF A;  2KJB A;  1W7P A;  4AIK A;  1T0F A;  2UXX A;  5LHG A;  1TQP A;  5LHI A;  2ESN A;  5ED4 A;  3J80 K;  2XGX A;  1G3Y A;  3O2P E;  2HWV A;  2ELH A;  2OD5 A;  4LLN A;  2WWY A;  3FXQ A;  5J6X A;  3LQQ A;  2STT A;  3W6J B;  1LJ9 A;  1ZG3 A;  1WQ2 A;  4OIR F;  4EMS A;  3SZT A;  3KP2 A;  1ZYR F;  1REP C;  2FBI A;  1X3U A;  2GA2 A;  1USS A;  4NB5 A;  1MDM A;  4ZYG A;  3LAJ A;  2ZME A;  5JVT A;  4AIJ A;  1OPC A;  4JQF A;  4EM2 A;  2XAJ A;  5K5O A;  2A5Y B;  3KLO A;  1T6S A;  2M8E A;  1KU7 A;  3ZP5 A;  4KNY A;  2XAG A;  1ON2 A;  1J59 A;  1MJB A;  4EJW A;  4B8X A;  3CUQ A;  4PDK A;  2D1V A;  5DCF A;  1B9N A;  4I2O A;  3RYR A;  4WCG A;  2ZJ2 A;  2JZY A;  2FNP A;  1H9T A;  5D8K B;  3HSF A;  4BHP A;  1B9M A;  4OIQ F;  1IRG A;  1U6G A;  3MQ0 A;  3RPQ A;  1XGN A;  4Q47 A;  1TBX A;  1IN4 A;  4HA8 A;  4RB0 A;  3MFK A;  3CO7 C;  2J5P A;  2PJP A;  1PP8 F;  3EYI A;  3M8F A;  1UFM A;  4LG0 A;  5L3F A;  1K78 B;  3KP5 A;  3U9G A;  4AIH A;  2HYG D;  3TKY A;  1XMA A;  4HOB A;  2K4J A;  1OYY A;  4Y17 A;  5D5U B;  3KET A;  4G7H F;  3SXY A;  4IVN A;  5LHH A;  5JI6 A;  4O6J A;  4LB6 B;  4I0B A;  3E5X A;  1J9I A;  2M1B A;  4G94 A;  3Q5F A;  1R22 A;  1BC8 C;  4IJA A;  2A3S A;  1XN7 A;  1K79 A;  5CVV A;  4YFX F;  1GHC A;  2Q8K A;  2CGP A;  1G3T A;  1TLH B;  2EFQ A;  4U0W A;  1TQM A;  1UB9 A;  2PLY A;  2Z5U A;  3GFJ A;  1OMI A;  3MCZ A;  3WTS C;  5H20 A;  1DP7 P;  4WWC A;  2K86 A;  4M9Z A;  2VBZ A;  5ERI A;  2K4B A;  3HOT A;  2CFX A;  3DPT A;  3KEO A;  2Q2E A;  1TW3 A;  5CVU A;  4HQM A;  2NYX A;  3WTU C;  3IC7 A;  2ISZ A;  3DV8 A;  2O3F A;  3GUD A;  4M6X A;  5ICG A;  3JAM Z;  4KIG A;  1AOY A;  4EGZ A;  5AIQ A;  2VOO A;  1QQI A;  2V1U A;  1ZRD A;  2KKO A;  2UZK A;  1KYW A;  1HBX G;  4G8X A;  4UHT A;  4KUM A;  1UCR A;  2A61 A;  4PGH A;  3IRQ A;  1RIO H;  3GZ5 A;  3GEZ A;  5K1Y A;  1J7K A;  4EV0 A;  1QPM A;  2Q0O A;  5FLX Z;  2NS0 A;  1J0R A;  4L0Y B;  1RUN A;  1B1B A;  1S6L A;  1DPR A;  3K1M A;  5FD6 A;  4EGY A;  2KJC A;  4UXN A;  3JAM K;  3KEQ A;  1ONV A;  4A2U A;  1J2X A;  2EFP A;  3ECH A;  5ICF A;  4FX0 A;  4HAM A;  4RGR A;  2L02 A;  1ZLJ A;  2O0Y A;  1R00 A;  3QP6 A;  1O3Q A;  2FBH A;  4ZH4 F;  1ZGA A;  2KRF A;  2V79 A;  1P4X A;  2WC2 A;  5HLI A;  3M7G A;  2VC1 A;  3F8B A;  1UHM A;  1XD7 A;  3VOE A;  1ODD A;  3IKT A;  3RKX A;  1QNT A;  2HOE A;  2VBY A;  1Y0U A;  5FLX K;  3QRF F;  1FX7 A;  2EFW A;  1HW1 A;  2DQR A;  1KA8 A;  2GXG A;  3GFL A;  1FYM A;  1KQ9 A;  2PMU A;  4ZZL A;  3WTT C;  1ZLK A;  2E1C A;  2R3S A;  4KA4 A;  4OOI A;  1R7J A;  2QQB A;  2W25 A;  1ZAO A;  1CF7 B;  3F8M A;  3C18 A;  1C0W A;  4MHG A;  3K1P A;  5D6E A;  4XLP F;  5CYV A;  4QLC U;  3KP6 A;  5BPD A;  1ZRE A;  2IPQ X;  5E8I A;  5D4R A;  4YFN F;  2D2W A;  2JRT A;  1JHF A;  4YIF A;  4N0B A;  1ULY A;  4WXD A;  3TGN A;  3B73 A;  3VEP A;  4O3M A;  2PEX A;  1XMK A;  2FU4 A;  3P9K A;  2GQQ A;  1MZB A;  2Y48 A;  1XGO A;  5DCM A;  1AWC A;  4HX4 A;  1XGS A;  2RVC A;  2EWN A;  3HRM A;  3TQN A;  1G3S A;  2Z33 A;  3L09 A;  1I1G A;  3DP7 A;  1JHH A;  1E17 A;  3ZMD A;  3F21 A;  3WTZ A;  1IUY A;  1LQ1 A;  3WGH A;  5CVI A;  3ULQ B;  1KQ8 A;  3E5Q A;  3VB2 A;  2X0L A;  2MLG A;  4GCV A;  1QGP A;  2Z99 A;  1G4D A;  3CJN A;  2G9W A;  1FWZ A;  4KMF A;  3BPX A;  1XSV A;  3MZY A;  1XCB A;  3V8J A;  3G3Z A;  3F22 A;  3BJO A;  4UVA A;  1JGS A;  2TDX A;  1SMT A;  3M1E A;  2LKP A;  3TO6 A;  1IZ1 A;  3BWG A;  3I54 A;  1LEB A;  2P7V B;  4KIC A;  1FSH A;  2VOD A;  2XV4 S;  2XAQ A;  4PZJ A;  3B02 A;  2MBF A;  2BBY A;  4LFU A;  4WX9 A;  5IT9 Z;  2H6C A;  1S3J A;  2XRN A;  2W57 A;  3ABT A;  2QLZ A;  1YLF A;  4AVP A;  4EJV A;  4L9V A;  3FMR A;  2P6T A;  4MQV A;  4ESF A;  2ZNY A;  4U0V A;  4N9H A;  3K0L A;  2XAS A;  2IA0 A;  4M72 A;  3HHG A;  4EJU A;  3KFW X;  2L4A A;  5E18 F;  1IN5 A;  1FBU A;  3J80 Z;  2ADU A;  1K7A A;  2QM3 A;  2QEN A;  3FF5 A;  1U8R A;  1FBQ A;  1CGP A;  1DUX C;  2W24 A;  3V4G A;  3ZMV A;  1IN8 A;  4H0E A;  1FLI A;  1SD7 A;  1I1S A;  1U2W A;  5FD5 A;  4ENM A;  2E7W A;  5IT9 K;  4M9S A;  3RYP A;  3HTU A;  1VTN C;  4XSZ F;  4MTD A;  2YR2 A;  3TO7 A;  1RNL A;  3ECO A;  3T8R A;  5DUI A;  4HLY A;  4IF4 A;  3WTW C;  2EFN A;  5BOX A;  3Q9V A;  2PBI A;  4UVC A;  5HDN A;  3L9F A;  1QBJ A;  2VE8 A;  1WWX A;  4WXC A;  5H6Q A;  2VBW A;  5D5V B;  5HVQ C;  3I59 B;  1UST A;  2P8T A;  4R8H A;  3HYI A;  4G9Y A;  3T8T A;  1BI0 A;  4ZYD A;  5LBQ A;  2DPD A;  2FXA A;  3HSE A;  4ZYE A;  4U88 A;  5K5Q A;  3FM5 A;  4MEY F;  4IPA A;  1OR7 A;  5HS7 A;  3E5U A;  4ZZD A;  2O8X A;  1O7L A;  2RQP A;  1MKM A;  1W5S A;  3ZPL A;  2EV0 A;  5LGT A;  2D45 A;  3FHZ A;  4PCQ A;  4LJZ F;  1XB4 A;  2JTV A;  5E1W A;  3R6S A;  4TV7 A;  1QZZ A;  1IXS B;  1I5Z A;  3RKW A;  5HLH A;  2YU3 A;  4MTE A;  4A6E A;  3K69 A;  4M71 A;  4GGG A;  4N9I A;  2RKH A;  4JK1 X;  4S05 A;  2Z9O A;  3D0S A;  1S7O A;  2OAZ A;  3IRR A;  1SFU A;  3HOS A;  5EEG A;  4UV9 A;  2IA1 A;  4M9X A;  3RTR A;  1S29 A;  1Z91 A;  1Q1H A;  1HXD A;  2DW4 A;  1EH7 A;  1O7F A;  1BC7 C;  2EA2 A;  4BHC A;  3M9A A;  5LRS A;  2PN6 A;  2DTR A;  4HW0 A;  2H27 A;  3F8F A;  2QBY B;  4RAY A;  3I71 A;  3REO A;  4R79 A;  3FXU A;  1BBY A;  5FO5 A;  1ZG5 A;  4ZYH A;  3RDI A;  2LNB A;  4IRG A;  4RB3 C;  5FFZ A;  4S04 A;  4UV8 A;  1O3R A;  2YSR A;  3WTV C;  5DD4 A;  1OYI A;  1T38 A;  1Z1D A;  1FBS A;  4GO1 A;  2B0L A;  2P7C B;  1XDU A;  4G6Q A;  3EQL F;  4CZZ A;  3LST A;  5CLS A;  5LGN A;  2ZBK A;  3LA7 A;  3J81 Z;  3BY6 A;  4XSX F;  3EDP A;  5CJ9 A;  1MDM B;  2ZME B;  3FM3 A;  1KYZ A;  3J7A O;  2BEO A;  3C7J A;  4UVB A;  4FX4 A;  2COM A;  4L9T A;  2UWM A;  1LDK B;  2DK5 A;  1BOA A;  4Q5S F;  2A6E F;  1GXQ A;  2WTE A;  4LGW A;  3F72 A;  1WSU A;  3V7S A;  4BQA A;  2DFI A;  4BH9 A;  2LSO A;  5LLQ A;  3CUQ B;  4WF2 A;  5BS6 A;  2Y75 A;  5IT3 A;  2CO5 A;  3F6V A;  1G3W A;  3LWF A;  3WTY C;  4BNC A;  5ILV A;  2RDP A;  4YFK F;  4OIN F;  3FZV A;  3TOB A;  2IVM A;  2XAF A;  3RPU A;  1R5H A;  3J81 K;  2EA4 A;  3MWM A;  1YS6 A;  2HTS A;  2QWW A;  1TQI A;  2F5E A;  3HIF A;  5L3E A;  4HYE A;  3IHU A;  2VXZ A;  3HHH A;  1RI7 A;  2GAU A;  3JTH A;  2EV5 A;  2PMH A;  1HW5 A;  2FOK A;  3IWZ A;  1SFE A;  2MH9 A;  5ILU A;  2NNY A;  2K02 A;  4U7D A;  1MJA A;  2FRH A;  5HOO A;  4P9F A;  4U7B A;  1PP7 U;  5AON A;  4OU0 A;  3LA2 A;  1WRJ A;  4RS8 A;  1R1V A;  1XSX A;  3W6K B;  2HS5 A;  2GXB A;  5L3D A;  4RAZ A;  3GW2 A;  3F23 A;  2F5D A;  1BI2 A;  3FWE A;  4G7Z F;  3L00 A;  4CIC A;  3ZMU A;  4YII A;  1Z6T A;  2GA1 A;  1U5T B;  1OYW A;  2VBX A;  1CF7 A;  2YX7 A;  3KE2 A;  2QQ9 A;  4HX8 A;  3CDH A;  3R61 A;  3JSP A;  2P5V A;  3H92 A;  3ML6 A;  4I0A A;  1DDN A;  1ZH5 A;  4LMY A;  1U3E M;  5F6F A;  3L7W A;  2JSC A;  1FYL A;  2HKO A;  2Y0M A;  5FFX A;  5KK1 A;  2J5O A;  6PAX A;  3CO6 C;  1F5T A;  1D8J A;  3KZZ A;  4HDV A;  3ZN0 A;  2NNN A;  5D5X B;  3OV8 A;  2DAO A;  5L3B A;  1V3F A;  2NAZ A;  4A5M A;  2RV8 A;  3U1D A;  2L01 A;  2X4H A;  4LLG F;  5JFR A;  1FYK A;  3MEX A;  3RKY A;  3SFZ A;  5EEH A;  2H6B A;  3TO9 A;  2NRA C;  5E1X A;  1OKR A;  1L3L A;  3QU6 A;  4P55 A;  3DEU A;  1ZN2 A;  1Z6R A;  4RGX A;  3GWZ A;  4Z2Y A;  3TDU C;  4A5N A;  2KIM A;  5JR3 A;  3CUQ C;  4IHS A;  3WOD F;  1UHW A;  5LRR A;  1B4A A;  1R58 A;  2HGC A;  1STZ A;  1S7A A;  1R36 A;  3F3X A;  1RZ4 A;  5LEJ A;  4D0P A;  2BV6 A;  3T1B A;  5CVR A;  2PI0 A;  5DV5 A;  3WU0 A;  3HRU A;  2P5K A;  2HQN A;  4DQ2 A;  2JPC A;  2HZT A;  1T98 A;  4L18 B;  5HLG A;  3WGI A;  1LNW A;  4XRF A;  2C6Y A;  2L54 A;  1GXP A;  3P7N A;  2P5L C;  1L0O C;  4AWX B;  3LA3 A;  2FEZ A;  2ZCW A;  2W84 A;  2VT3 A;  4L5I A;  5HS8 A;  3PQK A;  1FP1 D;  1D5V A;  2IJL A;  1P6R A;  2HR3 A;  5DEQ A;  1H0M A;  2BE5 F;  2V1D A;  3KCC A;  1P2F A;  1R23 A;  2O03 A;  3CUO A;  2H09 A;  2EB7 A;  1U5T C;  4HBL A;  5J8F A;  1IAW A;  4ESB A;  4MQ9 F;  3TOA A;  1B59 A;  2PG4 A;  4EJT A;  3V8K A;  1YS7 A;  2A6H F;  2RNJ A;  1BM9 A;  3HTS B;  1DPU A;  3V7C A;  2FNA A;  3WG9 A;  4I7H A;  2FQ3 A;  3E3V A;  3E6M A;  3T5X A;  4AD9 A;  1ZG1 A;  4A0Y A;  3GFI A;  1FT9 A;  1Z05 A;  4I09 A;  4G6D A;  3NRV A;  4IRI A;  3I59 A;  1TW2 A;  3V8L A;  3EET A;  3RIR A;  1H9G A;  3ZN1 A;  4MGR A;  3I4P A;  1EH6 A;  3I64 A;  2QYO A;  2EK5 A;  2OBP A;  4L5J A;  4A0Z A;  4NHJ A;  2F5C A;  3BZ6 A;  2M87 A;  5CVJ A;  3MZH A;  2Z3Y A;  4ETS A;  2K27 A;  3ZMT A;  2GWR A;  3Q9S A;  3R60 A;  3KP3 A;  4YG2 F;  1ZHF A;  5DYM A;  4HZF A;  1FSE A;  1G6N A;  3I58 A;  5E20 A;  5DDG A;  1P4A A;  1BIB A;  3CTA A;  3SZP A;  2AXL A;  1HKS A;  1XCV A;  1A04 A;  1HQC A;  2GZW A;  2FML A;  3RI4 A;  2O6G E;  1SMY F;  2ESH A;  4ON0 A;  1YTY A;  3FMQ A;  1BN5 A;  4BYY A;  4L0Z B;  2BGC A;  1Z7U A;  2HQR A;  3RJP A;  3KZY A;  4UUV A;  5DD8 A;  2PQ8 A;  4EQQ A;  2XUB A;  4EM1 A;  3F8N A;  3HRS A;  4F7Z A;  1KU9 A;  3ZMS A;  4ENJ A;  4LK0 F;  4KN7 X;  1SAX A;  2IA2 A;  3P9C A;  1D3Y A;  1JE8 A;  2LDU A;  1SD6 A;  5DUK A;  3H3Z A;  1TTY A;  4QWQ A;  3E97 A;  1IN6 A;  2XKP A;  4Y15 A;  1R1T A;  2XIG A;  2G7U A;  2RGV A;  2CSO A;  3QOP A;  5ILS A;  3KLN A;  4KN4 X;  4M73 A;  2O61 A;  1YW8 A;  5TJJ A;  2LF8 A;  2A69 F;  4NQW A;  4RB1 A;  4MEX F;  1YQA A;  3JW4 A;  1I27 A;  2CG4 A;  4M74 A;  4A0X A;  3QPT A;  3KP7 A;  1K78 A;  4G7O F;  2MA3 A;  2IT0 A;  2MD5 A;  3R4K A;  1ZRC A;  2FE3 A;  2MLK A;  2HFH A;  2DPU A;  4LB5 A;  1T39 A;  3EUH A;  3LQR A;  3GZ6 A;  3DXJ F;  1SD4 A;  4GYI A;  1LVA A;  3N4M A;  2RC4 A;  2QQA A;  2STW A;  2VC0 A;  4P5O A;  2VOP A;  1Z9C A;  1B6A A;  1W7P B;  3S2W A;  4A12 A;  5F1R A;  2XKO A;  3K2Z A;  2K7L A;  1F9N A;  2F2E A;  2VON A;  4UNO A;  3K9T A;  4I02 A;  1WKM A;  2LF7 A;  3ROU A;  3BRO A;  4KDP A;  2KIU A;  5H6R A;  3KP4 A;  1F4K A;  1W7P D;  2OZU A;  3O6B B;  1BI1 A;  2OQR A;  2ZXJ A;  1YG2 A;  5HS9 A;  1FC3 A;  5FB2 A;  3BPV A;  2FF4 A;  2KIF A;  4BAY A;  2R7D A;  3ISP A;  3BJA A;  2EFO A;  5BPI A;  4Y13 A;  3AAF A;  2DT5 A;  4EJO A;  3E6D A;  2HKX A;  4KT5 C;  3WTX C;  5D4S A;  1YFH A;  5E8G A;  2VN2 A;  4RB2 C;  1WI9 A;  1RUO A;  2CW0 F;  1BIA A;  3DPL C;  2DQL A;  2DLL A;  4JBA A;  2HTJ A;  4Q4Z F;  4OMZ A;  3ELK A;  1EH8 A;  2MC3 A;  3IKV A;  3LFK A;  4I98 B;  5BMZ A;  3N97 A;  3GYH X;  4KIB A;  4FT8 A;  1U5T A;  3WE3 A;  3NEU A;  3GO5 A;  1FP2 A;  3GX4 X;  2JT1 A;  2OQG A;  3DFG A;  3E6B A;  4I01 A;  2XVC A;  3PQJ A;  3BDD A;  1IXC A;  1HST A;  1QZY A;  1HSJ A;  4RGU A;  3ZMZ A;  2BYV E;  4IXA A;  3WU1 B;  1IXR C;  3DKW A;  5JHU A;  2MH2 A;  2DU9 A;  2FBK A;  1YYV A;  4LG0 B;  2QUF A;  4RGS A;  1YW9 A;  4KFC A;  2XHK A;  3SQN A;  1TNT A;  3IWF A;  2IP2 A;  3R0A A;  4A6D A;  5AIP A;  4EM0 B;  3MAJ A;  2QZ8 A;  2L4M A;  2CYY A;  5FGM A;  3FMS A;  4KYW A;  2ZO4 A;  3NQO A;  4HV5 A;  5HDK A;  2D1H A;  3COA C;  1PDN C;  1QO0 D;  3BOQ A;  1IF1 A;  4EVI A;  2FSW A;  2HDC A;  1ON1 A;  3P9I A;  1HKQ A;  1LEA A;  2OU2 A;  5D6F A;  2EJR A;  1HW2 A;  2ZFW A;  2ETH A;  3O3K A;  4XLN F;  2F5F A;  4ASN A;  2AS5 F;  1BJA A;  1U78 A;  3QPH A;  3VOD A;  1BI3 A;  1MD0 A;  3DF8 A;  5D5W B;  3CLO A;  3QU3 A;  4GXO A;  2ZNZ A;  4LK1 F;  1KU2 A;  4LLL A;  4CDG A;  2FMY A;  5E17 F;  4HV6 A;  5K5R A;  1YW7 A;  2P6S A;  4L9J A;  1PUE E;  3FXR A;  1XSD A;  3GLX A;  4WXH A;  3HUG A;  1FPQ A;  1SD5 A;  3C3W A;  1T2K A;  3ABU A;  3I53 A;  3M8E A;  4HX7 A;  3L2C A;  3WE2 A;  4IRH A;  2IRF G;  4BHB A;  2YX4 A;  3GFM A;  2XRO A;  3GF2 A;  4KMU X;  2ZKZ A;  3OOP A;  1KU3 A;  5BQT A;  1SFX A;  2E7X A;  4FHT A;  1KQ0 A;  1J75 A;  5D8L B;  1E2X A;  3QP5 A;  5LGU A;  1TNS A;  1FNN A;  4Q48 A;  2QVO A;  4O5V A;  3IL2 A;  4U0Y A;  4B09 A;  4PGG A;  4WK8 F;  1FOK A;  1J5Y A;  1S8N A;  4CHU A;  4CXF A;  1ZGJ A;  3VFZ A;  5KVR A;  1R5G A;  2FA5 A;  3D5L A;  3G73 A;  3LAP A;  1MJ9 A;  4CYD A;  2CQK A;  4ESJ A;  2E1N A;  1O3T A;  4IHT A;  4MNU A;  1HKT A;  3GXO A;  3TDZ C;  2HEO A;  2EV6 A;  1P92 A;  1F1Z A;  1EV7 A;  2PFB A;  2V1X A;  3I5U A;  1LDD A;  4CGZ A;  5LEK A;  1KGS A;  2A07 F;  2L3D A;  4M6Y A;  1R1U A;  1XDS A;  2JPB A;  4ENN A;  3HRT A;  3U2R A;  1JXS A;  1YO5 C;  2RN7 A;  3GVA A;  2IW5 A;  1IN7 A;  2H94 A;  1IRF A;  1IW7 F;  4OMY A;  4CO8 A;  5L3C A;  5A2Q Z;  2V6C A;  4E70 A;  4HLX A;  1GVJ A;  2HYF A;  1O3S A;  4HDU A;  3F6O A;  2DK8 A;  1FZP B;  5TRD A;  3SHF A;  1W4M A;  3BP8 A;  3HSR A;  2YPR A;  4L9N A;  3FX3 A;  5HDG A;  3JSO A;  2XAH A;  4P9U A;  1D8K A;  2CWE A;  2WV0 A;  4P96 A;  1LDJ A;  4R1H A;  3QAH A;  4HQE A;  4GYG A;  3EYY A;  3T0Y A;  4LD5 A;  2W85 A;  5ICE A;  2DO7 A;  5F64 A;  2GIV A;  1P4W A;  1O57 A;  5DCM B;  3K1N A;  4ENK A;  4HF1 A;  5ICC A;  4DNC A;  1YIO A;  3DQV C;  5A2Q K;  1NHA A;  4BXU A;  3BJ6 A;  1LB2 A;  2M30 A;  2DBB A;  3V7R A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...