1UB9A

Structure of the transcriptional regulator homologue protein from pyrococcus horikoshii ot3
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
100
structure length
100
Chain Sequence
MEELKEIMKSHILGNPVRLGIMIFLLPRRKAPFSQIQKVLDLTPGNLDSHIRVLERNGLVKTYKVIADRPRTVVEITDFGMEEAKRFLSSLKAVIDGLDL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Hypothetical protein PH1061
publication title Structural analysis of the transcriptional regulator homolog protein from Pyrococcus horikoshii OT3.
pubmed doi rcsb
source organism Pyrococcus horikoshii
molecule tags Transcription
total genus 37
structure length 100
sequence length 100
ec nomenclature
pdb deposition date 2003-04-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13601 HTH_34 Winged helix DNA-binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 1ub9A00
1J75A 2ZNZA 2ISZA 4KNYA 1MKMA 2E7WA 3SXYA 2DAOA 4E70A 1B9MA 1WKMA 5CLSA 2HGCA 2Q0OA 3R4KA 4KICA 4IVNA 6PAXA 1OMIA 3FF5A 2PMUA 1AWCA 3ZMDA 2QWWA 3FM3A 4M9SA 2NRAC 4BYYA 2DLLA 1SAXA 3WGIA 3PQKA 1DP7P 1Z9CA 2M30A 4XBFA 3TO6A 2P5KA 3TOBA 3ROUA 2W57A 1K78A 4FX4A 4XLNF 5KVRA 1HKSA 3W6KB 2ZNYA 2IT0A 1WI9A 1SFUA 1HW5A 1IRFA 2P7CB 5E18F 3OOPA 1FOKA 5CVRA 3K69A 3V8LA 1OPCA 2EV0A 4OIRF 2PMHA 4WF2A 3VEPA 3K2ZA 2HS5A 2H94A 5FD6A 1R36A 4MEXF 2LF7A 4N9HA 4EM1A 2BBYA 2CGPA 4RGXA 2NYXA 3LSTA 3CO6C 2FOKA 2Y75A 2F5EA 3BJOA 1YS6A 3O3KA 2CW0F 2A6HF 3GW2A 3GFMA 5LHIA 1RI7A 1FSEA 5D8LB 5DCFA 2O03A 3V8KA 4Q47A 2M8EA 1YW8A 5DEQA 1GXQA 5JR3A 1BC7C 4QLCU 2RGVA 3JAMZ 1W4MA 2ZKZA 1YLFA 4YG2F 2YX4A 4EM2A 2OQGA 1K79A 1OKRA 1ZAOA 5JVTA 2KJBA 3DQVC 3ECOA 4RGSA 5J8FA 1PP8F 4XRFA 2ETHA 4YIIA 3G73A 3R61A 1XGMA 5FLXK 2QVOA 1U5TC 2V6CA 4KMFA 1IZ1A 2K86A 1ONVA 1DDNA 3RKXA 4Q4ZF 4PZJA 5FFXA 2FBKA 2XHKA 2HQRA 5E8IA 2M1BA 2JSCA 3LA3A 4EMSA 2XIGA 4BHPA 2ESNA 2GQQA 1LNWA 4P5OA 2FA5A 3WU1B 5A2QZ 2EK5A 2FU4A 3M9AA 4ASNA 1W7PB 5ILUA 2ZXJA 2O3FA 1ZGJA 1H0MA 1Z7UA 1J59A 2STTA 1DUXC 1KU9A 4I98B 3E6DA 2EJRA 3K1PA 2Y0MA 2P7VB 2HR3A 4BH9A 3AAFA 2EWNA 1G3YA 4LGWA 3U1DA 3IWFA 2XAJA 3D5LA 4PGHA 3FZVA 1SD6A 2K4JA 2HWVA 3RYPA 4HZFA 1T6SA 3KCCA 2EFNA 3O2PE 3V7CA 1F5TA 4WX9A 3EYYA 1YFHA 4KDPA 1QO0D 2NNNA 3EETA 5J8CA 3L9FA 2QQBA 3F6OA 1MGTA 3JTGA 2Q2EA 4L9NA 4HDVA 1WSUA 5CVUA 3J7AO 3ULQB 5FD5A 2BEOA 1BM9A 3FMQA 5IT3A 2MH2A 1KQ8A 3IC7A 3WTTC 1FYMA 2WC2A 3KLOA 4IPAA 3F6VA 1S6LA 3L2CA 1TQMA 2E7XA 1PP7U 1S3JA 5ILSA 2HFHA 4M74A 1FNNA 2X4HA 2XAGA 1R1VA 2BE5F 3E5XA 2HOEA 2WV0A 4HQEA 2DPUA 2MBFA 3CJNA 1USSA 2EA4A 3GUDA 4MQ9F 3RKYA 2QUFA 2DQRA 5E20A 1XCBA 3ZMZA 1IN8A 1HQCA 2HTSA 5L3CA 1YYVA 4BNCA 2OBPA 4AIJA 5DUIA 2CWEA 2PG4A 4CYDA 3C3WA 3FMRA 2AXLA 1ZG3A 1CF7B 4MNUA 1UCRA 4ESBA 4G6QA 5ICFA 2ESHA 4L9TA 1LDJA 3BDDA 2ZMEA 3R6SA 1QZZA 4B09A 4Y15A 2EA2A 1D3YA 5ICCA 4YFXF 4EGZA 3IL2A 1MZBA 3F8CA 1UFMA 2H09A 3MZYA 5DDGA 2IPQX 2K4BA 1IXSB 3ELKA 1G3SA 1R58A 2A61A 3VODA 2HTJA 1TW3A 2AS5F 4HYEA 5D4SA 5CYVA 4A5NA 5LGUA 1A04A 2P4WA 2MA3A 4Z2YA 3WTSC 2YU3A 1FSHA 1J5YA 1S7OA 4RS8A 3JW4A 4IJAA 1XMAA 4HQMA 2RKHA 3REOA 5DD8A 3ERED 2KKOA 1W7PD 2O0YA 2CG4A 5AIPA 4ZYDA 1IUYA 1RNLA 3KFWX 1TNSA 5FLXZ 2FF4A 2VOPA 2DTRA 5D5XB 2A69F 1R1TA 2JTVA 4FT8A 4L9VA 5HOOA 1FBQA 5HDKA 5K5RA 1UB9A 3J80K 5HLHA 3LAJA 4ZH4F 3DPLC 1IN7A 2V1XA 1XSXA 1FZPB 1J2XA 1B9NA 1REPC 2J5OA 2W25A 1J0RA 4UNOA 4JQFA 3FXUA 4O5VA 3HTUA 2FNAA 1Z05A 3R0AA 4O3MA 4N9IA 1B1BA 4A0ZA 4P55A 4LJZF 3ZMUA 4LK0F 3ZMSA 3TQNA 3V7SA 1RUNA 2L3DA 3TDUC 3Q9SA 1U5TB 2A68F 1YW7A 3N4MA 4HBLA 5LBQA 4GO1A 3E97A 3F22A 1J9IA 3WE3A 2V1DA 1NHAA 4S05A 5KK1A 2RDPA 5DD4A 3BOQA 3P9CA 3R60A 2EFQA 1BBYA 3KP3A 3GFJA 3CUQA 2L4MA 3HOSA 3HRSA 1LEBA 4RB0A 3BP8A 1LEAA 2XASA 3QU3A 4S04A 1BJAA 4I02A 5LGTA 2IA0A 5L3GA 3IRRA 5CJ9A 1TQIA 3ISPA 3WGHA 3KP7A 1H9TA 2GZWA 4UVBA 3HYIA 3RI4A 1FLIA 4LLGF 2F5DA 1KU7A 1LDKB 4EV0A 1LQ1A 3O6BB 1BIAA 2MLGA 4A0XA 4XSXF 3T8RA 2CQKA 2Z5UA 3WTZA 3V4GA 4P9FA 1YQAA 2XGXA 2Q8KA 2XUBA 4Q48A 2JPBA 4IRGA 3M7GA 3ABUA 3Q9VA 3GXOA 1BIBA 4WXHA 1YO5C 1VTNC 3GFIA 1O7FA 5FO5A 1FPQA 2G7HA 2Z3YA 3GF2A 3TGNA 5TJJA 2GXBA 4JBAA 2ZO4A 3QP6A 1XB4A 2NS0A 4HX4A 2PJPA 1H9GA 1O7LA 1SMYF 3WTYC 4HF0A 2ADUA 1O3RA 3RPUA 4A5MA 4KUMA 3TOAA 4CZZA 2CSOA 5JHUA 3M8FA 2PI0A 1P6RA 1J7KA 2DO7A 2RN7A 4EVIA 2ACJA 1ZARA 2A3SA 2CO5A 4YIFA 2JT1A 2D1VA 4OU0A 4MTDA 2RVCA 1OR7A 2KRFA 3KLNA 4UV8A 4EJWA 3WTUC 2HYFA 4FHTA 1U8RA 1GHCA 1HXDA 3CUOA 4ETSA 4I0AA 1XDSA 5DCMB 4HA8A 2FMLA 4WWCA 2M87A 4PDKA 2E1CA 3WTWC 3RYRA 2MD5A 1S7AA 2PQ8A 4U0YA 5L3EA 1W5TA 2YSRA 3IHUA 2BYVE 3GO5A 4Q5SF 1T98A 5D4RA 2VT3A 1TLHB 4ZYHA 2V1UA 3RIRA 4GXOA 4NQWA 4G9YA 5LLQA 2PEXA 3P9KA 4LFUA 1MDMA 4U0VA 4BXUA 5D5UB 5H6RA 3QP5A 2VN2A 2CFXA 3T5XA 3I54A 4YFKF 4XLPF 2COMA 3J80Z 1U2WA 1ON1A 4QWQA 1Z91A 1GXPA 3F8FA 5ILVA 1ZH5A 2KIFA 3WE2A 2VE9A 1MJBA 3KE2A 4JK1X 1RZ4A 3HRUA 2KJCA 3DFGA 2K27A 2FE3A 5LRSA 5D8KB 5CVVA 1K6OA 3IRQA 5BS6A 4GCVA 2BGCA 2P6SA 3K1NA 3GVAA 5BPIA 5BMZA 4HV6A 2PN6A 4L0YB 3DKWA 1F9NA 4ON0A 3WODF 1TTYA 4P96A 4H0EA 1CF7A 1PDNC 4A2UA 3NRVA 5FFZA 5IT9Z 2DK5A 4M6YA 3NEUA 4RAZA 1YTYA 4EJVA 2DBBA 2IW5A 3WTVC 1FC3A 4N0BA 2ZFWA 1ON2A 4WCGA 3TO7A 3L7WA 2WTEA 2OZUA 2QBYB 4OMYA 3RDIA 1ZHFA 3K9TA 4HF1A 4BQAA 4K2EA 1DPUA 3MCZA 1V3FA 4KYWA 1WQ2A 1UHMA 2OU2A 4MEYF 4BHBA 2MLKA 2FEZA 3KP2A 3J81K 3QOPA 3V7RA 2QQAA 2PLYA 1JHFA 3PQJA 4AIHA 1STZA 1GVJA 3ZPLA 4CDGA 5E1WA 5CVJA 2IP2A 2VBYA 1IN6A 3EQLF 2XAHA 2FXAA 1KU2A 4ESJA 4A12A 4RB3C 4IRIA 3S2WA 4A6EA 1I6XA 3WTXC 2D2WA 1BI0A 4ENMA 5FGMA 3KZZA 2VBWA 4OOIA 1PUEE 2VC0A 1IW7F 3I0TA 2E1NA 4RGUA 3LA7A 2XRNA 3I4PA 2QLZA 3KETA 2IJLA 2YR2A 4M72A 1ZRDA 3HIFA 1UHWA 4DNCA 2DU9A 1E17A 5LHHA 3BWGA 3E6CC 2JPCA 2DPDA 4EQQA 2GAUA 4KIFA 3CTAA 2VC1A 1ZREA 1E2XA 5BPDA 1G4DA 2BV6A 4L5JA 3E5QA 4NB5A 3HUGA 1O3SA 4OMZA 5F64A 4KA4A 4HAMA 4LK1F 1T39A 2LSOA 4BHCA 2IRFG 3E5UA 2LKPA 3VOEA 1ZLJA 2FQ3A 3BJAA 1U5TA 1IXCA 1MJAA 1T2KA 4HV5A 4KT5C 4DQ2A 1KU3A 5ICGA 3B02A 4P9UA 2H6BA 4ENKA 2NAZA 4MQVA 2A5YB 1JE8A 5K1YA 2GA1A 2O61A 5JI6A 2KIMA 3FWEA 3IWZA 5HS7A 1XSVA 5LEJA 2XVCA 5ERIA 5AIQA 4HW0A 3FMSA 3ML6A 4A6DA 2GWRA 2VOOA 4MGRA 4G8XA 2HKOA 3I53A 5F1RA 2R7DA 4EJOA 4UVCA 5K5QA 3T1BA 4EGYA 2QZ8A 2TDXA 3I58A 5BOXA 2L01A 2P8TA 3WGGA 3U9GA 2W84A 3GLXA 1SFXA 5LGNA 2HQNA 3N97A 1FBUA 1KQ9A 2X0LA 3IKVA 3BROA 4LMYA 5HDNA 4ZYEA 3BY6A 1CGPA 2HZTA 1ZN2A 3V8JA 3ABTA 1OYYA 3E6BA 3E3VA 3SHFA 3E6MA 3DPTA 3BZ6A 4ESFA 3B73A 3G3ZA 2OD5A 2VT2A 2UZKA 4U88A 3MWMA 1B59A 3DEUA 3Q5FA 1Z6RA 3FM5A 3QPHA 2LNBA 5A2QK 4OINF 2R7FA 1QGPA 1BC8C 1TNTA 5ED4A 3JSOA 1R7JA 2D1HA 3HRMA 1FBSA 1IN4A 3M8EA 5H6QA 4NHJA 5D5VB 3COAC 1OYIA 2CYYA 4AWXB 5EEHA 3ZQ7A 2L54A 3QRFF 1G3TA 1G3WA 5DUKA 2UXNA 3KP5A 1HSJA 3GZ5A 4HOBA 3BJ6A 1TBXA 4M71A 4R79A 2RV8A 3IKTA 1DPRA 2OAZA 1XGSA 2QYOA 3GEZA 1Q1HA 1R1UA 2VE8A 4M9XA 1QBJA 3LQQA 3HHGA 1FYLA 4G94A 3DP7A 3RKWA 2VODA 1HW1A 2F5CA 3J81Z 1MD0A 2EFWA 1MJ9A 4L18B 3F72A 1USTA 5CVIA 3NQOA 5DCMA 5HVQC 2DT5A 1ZRCA 3D0SA 2ELHA 1B6AA 4RB1A 2KIUA 2HYGD 3L09A 3WU0A 2FMYA 1D8JA 3VB2A 3ZMTA 2L4AA 4M9ZA 1LB2A 1LDDA 4AIKA 3I5UA 4ENJA 1WWXA 1S8NA 2LF8A 1YW9A 5F6FA 1SD5A 1YS7A 4CXFA 3T8TA 4L0ZB 3FHZA 4G7HF 4ZZDA 3RJPA 4HLXA 3P7NA 4B8XA 4OIPF 4OIOF 5E1XA 4GGGA 1R00A 1R22A 1BOAA 2FRHA 4XSZF 2K7LA 1XN7A 4YFNF 1T38A 1W7PA 1Z1DA 5L3DA 4U0WA 4I09A 3I64A 4WXDA 3H3UA 1FYKA 1FWZA 5AONA 1QZYA 2HEOA 2PBIA 3EYIA 1X3UA 2K02A 3GX4X 2FSWA 4WXCA 2EFOA 3KEQA 4LB6B 3HRTA 1ZG5A 3R0JA 2MC3A 4HDUA 2XAQA 2GA2A 3CUQB 3JTHA 3HHHA 2QBYA 4I7HA 4LG0B 1I5ZA 3LA2A 2A6EF 4KIGA 3I59B 1EH6A 2P6TA 5BQTA 2YPRA 3ECHA 4KMUX 4R1HA 3K1MA 3P9IA 3DV8A 3K0LA 4RAYA 3C1DA 2NNYA 1F4KA 2OZ6A 3GFLA 1JXSA 3W6JB 1ODDA 1SD7A 3BPVA 5HS8A 3MFKA 3VFZA 3MQ0A 3KP4A 1HKQA 3JSPA 1R5HA 2OA4A 4PGGA 5HLGA 4EJUA 4EJTA 2A07F 2J5PA 3HSFA 4I2OA 2GXGA 3RPQA 4BAYA 1SD4A 1EH7A 5DYMA 3EUHA 1XDUA 2IA1A 2M45A 2B0LA 2DK8A 4Y13A 4UV9A 3F8NA 3HOTA 3OV8A 4GYIA 3H92A 1K78B 1BI3A 1TQPA 2XKOA 2RQPA 1SFEA 1D5VA 3ZP5A 4KN4X 1QPMA 5ICEA 1C0WA 4ENNA 4KN7X 3C7JA 3QPTA 3CLOA 1U78A 3SZTA 1ZYRF 3HSRA 3DF8A 1TW2A 4ZZLA 5TRDA 1JGSA 1HW2A 4AVPA 2Z99A 1FX7A 4LLNA 1AOYA 3GZ6A 3FXRA 1HKTA 1KYWA 1KA8A 2IA2A 5HS9A 1YIOA 2GIVA 1IRGA 1HSTA 2RC4A 3F8BA 4M6XA 2IVMA 3T0YA 5EEGA 1XD7A 2FBIA 3EDPA 1XCVA 2FBHA 3FXQA 2VXZA 1IF1A 2MH9A 1Z6TA 2Z33A 3TKYA 2UWMA 5DV5A 5J6XA 4CO8A 4CGZA 4RGRA 2STWA 2DQLA 2QM3A 4IHTA 1P2FA 2JZYA 2G9WA 1K7AA 2DI3A 1QNTA 3FX3A 3KP6A 2Z9OA 1I1SA 1IXRC 1MDMB 4M73A 1BI1A 4HX8A 2F5FA 3L00A 2QQ9A 1R23A 1I1GA 4MHGA 4MTEA 2XAFA 3QU6A 5HDGA 1XSDA 1ULYA 3MZHA 2HKXA 1L3LA 3CUQC 3F8MA 4L5IA 4G7ZF 4CHUA 1IN5A 1T0FA 3WG9A 1FY7A 5H20A 3LQRA 2V9VA 3HSEA 3PFIA 2M5WA 4LD5A 4ZYGA 2G7UA 1D8KA 1L0OC 1KGSA 2DW4A 3H3ZA 5E17F 2W24A 2R3SA 4KIBA 4U7BA 4TV7A 2W85A 3RTRA 1ZLKA 2ZCWA 3F23A 5HLIA 4U7DA 2F2EA 1P4XA 5JFRA 2P5VA 4PCQA 1R5GA 4HX7A 3TDZC 2VBXA 3DXJF 4L9JA 1O3QA 2VONA 3M1EA 1XGOA 3I71A 1KQ0A 1B4AA 2UXXA 1O3TA 5FB2A 4G7OF 1O57A 2H6CA 1YG2A 5E8GA 1V4RA 3HTSB 2L02A 5D5WB 1BI2A 5E1ZB 2H27A 2VBZA 3ZN0A 1G6NA 1I27A 5K5OA 4OIQF 1LJ9A 5L3FA 3MAJA 1XGNA 3JAMK 1XMKA 4IRHA 1SMTA 2QENA 1ZRFA 3KEOA 3SZPA 4EM0B 2D45A 1P4AA 2PFBA 1RUOA 2EFPA 2JRTA 4UHTA 3LAPA 3GWZA 2EB7A 2EV5A 2OQRA 2P5LC 1EH8A 4IHSA 1RIOH 1FP1D 3F21A 4UXNA 1W5SA 1QQIA 2FNPA 2EV6A 1JHHA 3GYHX 3SFZA 2LDUA 1Y0UA 1U3EM 1KYZA 2ISYA 2YX7A 2O6GE 5LEKA 2RNJA 3SQNA 3CO7C 4O6JA 3TO9A 1BN5A 1ZG1A 3QAHA 4HLYA 4IXAA 3F3XA 3BPXA 1S29A 3KZYA 4I01A 1EV7A 1F1ZA 3C18A 1ZGAA 2XROA 1WRJA 3ZMVA 4FX0A 3LWFA 5LRRA 4GYGA 5LHGA 2ZMEB 4AD9A 5L3BA 4D0PA 4KFCA 2WWYA 4LB5A 1IAWA 5IT9K 1P4WA 2ZJ2A 4G6DA 4UVAA 5D6EA 2O8XA 3LFKA 1HBXG 4RB2C 4IF4A 4F7ZA 4I0BA 1LVAA 4A0YA 4WK8F 1OYWA 3ZN1A 2XV4S 1FP2A 2C6YA 1P92A 2XKPA 2ZBKA 3MEXA 4Y17A 1U6GA 4HF2A 2V79A 4LG0A 4LLLA 1FT9A 4UUVA 3CDHA 3U2RA 4CICA 5D6FA 2Y48A 2HDCA 3I59A 4R8HA 2DFIA
chains in the Genus database with same CATH superfamily
1U9NA 2OCCH 1J75A 2KPMA 2ZNZA 2ISZA 4B1RA 4KNYA 4AM3A 1ETXA 1MKMA 2E7WA 3SXYA 2DAOA 5J47A 3K7AJ 2HOSA 2R92J 4E70A 1B9MA 5M3FJ 4CSWA 1WKMA 5CLSA 2HGCA 1Y1VJ 2Q0OA 3R4KA 2IS2A 4BU2A 4FE4A 4KICA 1QHGA 5IYCJ 1S5LC 4IVNA 4CCNA 6PAXA 1OMIA 3LSGA 3FF5A 2PMUA 1AWCA 2XSJC 2HNHA 1ETQA 2LY2A 3ZMDA 2QWWA 3C2GA 3FM3A 4M9SA 2NRAC 4BYYA 2DLLA 1SAXA 2ZJQF 3H9JA 2XB5A 3WGIA 3PQKA 1DP7P 2CFOA 1Z9CA 2M30A 4ZDLA 4XBFA 1I6HJ 2K9SA 3TO6A 3WG7H 4BGDA 4IHWA 2P5KA 1VQMI 3TOBA 2Y9ZA 3ROUA 3M3YJ 2W57A 3KIOA 1NG6A 2JK3A 1ZR2A 4FX4A 1K78A 2H8WA 2L9SA 4XLNF 2L9VA 5KVRA 3JREA 1HKSA 3W6KB 2ZNYA 2LP0A 3BZCA 2M7AA 3G2BA 2IT0A 3RQIA 1WI9A 2CH0A 2HVQA 3CD6I 1SFUA 1HW5A 1IRFA 2P7CB 2X1EA 5E18F 3OOPA 4CCOA 4BEHB 1FOKA 5CVRA 3K69A 2IGOA 2K9LA 3V8LA 2DA6A 1OPCA 2DA1A 2EV0A 2QCOA 3HM5A 3NARA 4OIRF 2DXIA 1SANA 1JT6A 2W82A 4JX4A 1UHSA 2PMHA 3OYGA 2CU7A 4AYBA 2DODA 4OAZA 5M5WJ 4WF2A 2Y0SN 3EUAA 3VEPA 3K2ZA 2HS5A 2I5UA 4RAFA 3VPRA 2H94A 3H5AA 4X1EA 5FD6A 1R36A 4MEXF 2LF7A 4N9HA 4EM1A 1ZTRA 2CV1A 2BBYA 2CGPA 2IAIA 4RGXA 2L0KA 4PSWA 1OCCH 2X1CA 4D5CA 2NYXA 3LSTA 2M4KA 3CO6C 3TL4X 4UB8C 2FOKA 2Y75A 3K4LA 2F5EA 2Z1DA 3BJOA 3GMEA 1YS6A 1WJCA 3O3KA 2JA2A 3CF5F 2CW0F 2A6HF 2PMZA 3GW2A 3BR5A 5JLXA 3GFMA 2DOFA 5LHIA 1G59A 3CCSI 1RI7A 2PX9A 4NC8A 1JGGA 1FSEA 1X4OA 2BHYA 5D8LB 5DCFA 2O03A 3V8KA 4J00A 3FKIJ 2EZLA 3K6GA 4Q47A 1FIAA 2M8EA 4A3EJ 1YW8A 5DEQA 1GXQA 5JR3A 1AA7A 1R6RA 2JUCA 1BC7C 1B8IA 2DT7B 2M0CA 2RGVA 3JAMZ 4QLCU 1W4MA 2ZKZA 1YLFA 5GAGJ 4YG2F 3S3NA 2YX4A 3BLYA 4EM2A 2Y31A 2VQGA 2OQGA 2V9PA 1SVOA 1K79A 3KPHA 4Y33A 5KNLA 1OKRA 3OOUA 1ZAOA 2ZC2A 5JVTA 3CDIA 2KJBA 3DQVC 3ECOA 4RGSA 5J8FA 1PP8F 2R7OA 4XRFA 2ETHA 2O9LA 4YIIA 4D7MA 5F04A 3R61A 3G73A 5DS9A 3CDLA 1XGMA 3L2RA 5FLXK 3Q0VA 2QVOA 1U5TC 2V6CA 4KMFA 1IZ1A 2K86A 3OYKA 1VQ9I 1ONVA 4G12A 4A3CJ 2P81A 1DDNA 2HZDA 5FLMJ 2LMDA 5EG0B 3PO3J 3RKXA 4XRSA 4Q4ZF 4PZJA 2RNGA 1QU3A 1FIPA 5FFXA 2AQEA 2FBKA 4DGWB 1VF9A 2RAEA 2XHKA 2HQRA 5E8IA 4I6ZA 4C2UA 2M1BA 1X1CA 3Q0UA 1UMQA 2JSCA 4DYRA 3LA3A 4EMSA 2XIGA 4BHPA 2ESNA 4LIVA 2GQQA 1LNWA 1E0EA 4FTHA 2WADA 4P5OA 2IBDA 5B5EC 5GTHC 2FA5A 1KZHA 1GDTA 3A0BC 1FMVA 1VFCA 1W36D 3OYAA 2E1MC 3WU1B 4HNVA 5A2QZ 2EK5A 2FU4A 1W5CC 3M9AA 4ASNA 3K2AA 1BR2A 1WJ5A 2V7FA 4QPOA 5TGTA 3SFIA 3S17J 1W7PB 5ILUA 2ZXJA 5J3LA 4BBRJ 2O3FA 1ZGJA 2VXDA 1MMAA 2AQFA 1H0MA 1Z7UA 1J59A 1Y56A 1HDPA 2STTA 1DUXC 1RRJA 3VYRB 1YITI 4XIDA 1KU9A 4I98B 4LOCA 3E6DA 2DTZA 1TP4A 2EJRA 3K1PA 3P5JA 2VJ5A 2Y0MA 3PUBA 3PSIA 3QODA 2P7VB 2Z16A 2HR3A 2EINH 4BH9A 3DLLF 3AAFA 3PUFA 2EWNA 1OCOH 1A5JA 2VKVA 1G3YA 4LGWA 2QSFX 3AG2H 3U1DA 3JRHA 3IWFA 1AU7A 2XAJA 1KONA 3BR1A 3D5LA 4PGHA 3FZVA 1SD6A 2K4JA 2HWVA 2R93J 3RYPA 4HZFA 1N78A 1T6SA 1VI0A 2OF7A 3IP4B 4XL9A 3K10A 3KCCA 2EFNA 2VQHA 2DYRH 1LE8B 5K7FA 4JX6A 3O2PE 3V7CA 1F5TA 4F3QA 4WX9A 3EYYA 3S3MA 2R7ZJ 3CP8A 3A1YA 1YFHA 1GT0C 4KDPA 1QO0D 2FJ1A 2LBFA 3ZQQA 2L9NA 3JRDA 2M9HA 4MFEA 2NNNA 3DTKA 3EETA 2KMUA 3L9FA 2QQBA 2L5QA 4M3FA 5J8CA 3F6OA 2RREA 1WI3A 1MGTA 2NXNB 2XPVA 3JTGA 2Q2EA 3OYLA 1MNEA 4L9NA 4HDVA 1WSUA 5CVUA 3J7AO 3ULQB 5FD5A 2GLOA 2BEOA 1BM9A 1IDZA 5C4XJ 3FMQA 5IT3A 2MH2A 1KQ8A 4NQWB 5E3OA 3IC7A 3WTTC 1FYMA 2LOOA 3A01B 2WC2A 3KLOA 3OYMA 3PIOF 2EZKA 4IPAA 3F6VA 2Y69H 2E1OA 1S6LA 2UUZA 2X51A 1FJLA 3ABLH 3CCLI 1WH7A 3L2CA 1TQMA 2DT6A 2E7XA 2H8RA 1PP7U 2HVSA 4C2MJ 1S3JA 1GLNA 3A03A 5ILSA 2HFHA 2NVQJ 4IL6C 4M74A 5FJ8J 1R4NB 1FNNA 2X4HA 2XAGA 1R1VA 2BE5F 3ZQLA 3E5XA 2HOEA 5J4VA 5B3SH 2WV0A 2LKSA 3BTCA 4HQEA 2DPUA 2LYCA 2XF7A 2MBFA 4KT6A 3CJNA 3OMYA 2K5CA 2XGDA 1USSA 3QPLA 2EA4A 2EPFA 3GUDA 2DMPA 4ITVA 4EATA 4MQ9F 3RKYA 2DMQA 2HOTA 2QUFA 4XMYA 1SVMA 2DQRA 5E20A 1JKOC 1XCBA 4DYCA 3ZMZA 1TWGJ 1IN8A 1CQTA 3H0DA 1HQCA 4I99C 3FK7A 2HTSA 5L3CA 1YYVA 5JHFA 2V6EA 2X6WA 1XTAA 2JJ7A 4BNCA 4YRVA 3DLAA 2OBPA 4AIJA 3AL0C 4FQGA 5DUIA 3OS0A 2CWEA 2PG4A 4CYDA 3C3WA 3FMRA 1UZCA 2AXLA 2PJRA 1ZG3A 1CF7B 2DFHA 4GDFA 2R7RA 4MNUA 1UCRA 3FISA 4ESBA 4G6QA 5ICFA 2ESHA 4L9TA 2OC6A 2F4IA 1LDJA 2UV1A 2LTPA 3BDDA 2HDDA 2ZMEA 3R6SA 1YOVB 1AKHB 2JA6J 1QZZA 1WVRA 4B09A 5C4JJ 2FQ4A 2HU9A 4Y15A 2EA2A 3L2QA 4FCYA 1D3YA 4BQOA 3OL4A 5ICCA 4D9JA 4YFXF 4EGZA 1PUFA 3GBGA 3IL2A 1MZBA 2MC4A 3F8CA 2JA5J 4UUSB 1UFMA 2H09A 3F9KA 3MZYA 5DDGA 3CF2A 3H0GJ 5DM6F 2R5YA 2CV2A 4NC7A 5E79C 4FASD 3LSMA 2LREA 1XPXA 2HPIA 1BR4A 3OYNA 2CQNA 2IPQX 4F93B 2K4BA 1IXSB 3ELKA 1G3SA 4AYBN 2R7WA 1R58A 2A61A 3VODA 1VQNI 1G8XA 2ECBA 2HTJA 3PJRA 1K4SA 1TW3A 1I3QJ 2LH9A 2AS5F 4HYEA 3H3VK 5D4SA 5CYVA 4A5NA 2Y2ZA 3O8GA 5LGUA 1A04A 4QPQA 2P4WA 4E7LA 2MA3A 4Z2YA 1ETYA 3CC4I 2YU3A 3WTSC 1FSHA 1J5YA 1S7OA 4RS8A 2MD0A 3JW4A 1MMSA 4IJAA 2DJNA 1XMAA 4HQMA 1XC5A 4A3BJ 2RKHA 3REOA 5DD8A 3S32A 3H35A 4HSTA 2NVXJ 3ERED 2KKOA 2BW3A 1W7PD 2PMZN 2O0YA 1MSFC 1JT0A 3LSRA 3S15J 2CG4A 1V55H 3RZDJ 5AIPA 4ZYDA 1IUYA 4D5FA 3HOXJ 1ZK8A 3MMYB 2IEKA 3RPUD 1OCPA 1RNLA 3KFWX 1K61A 1TNSA 2XF6A 5FLXZ 2FF4A 2VOPA 2DTRA 5D5XB 2A69F 1O4XA 1R1TA 4LG3A 3FIWA 1QZEA 2JTVA 4FT8A 2JVGA 4L9VA 1ORKA 1MMGA 5HOOA 2HVRA 4C9YA 1FBQA 3LOCA 2IS6A 4CYCA 5HDKA 5K5RA 3HG9A 1N75A 2OUMA 4FISA 3JR9A 1UB9A 3J80K 1I39A 4BQQA 5HLHA 1BW6A 3LAJA 4ZH4F 3JRCA 3G1LA 1E3PA 5IP7J 3DPLC 3ZQHA 2E5NA 2NVUB 1IN7A 2V1XA 2F4OB 1XSXA 2OV7A 3IH3A 1FZPB 1J2XA 1B9NA 3A02A 5LD2C 4RLQA 1REPC 2J5OA 4XOTA 1G2HA 2W25A 5CKTA 1J0RA 3DKXA 4UNOA 4JQFA 5HNFA 3FXUA 4O5VA 3HTUA 5M5YJ 2FNAA 4YELA 3WHBA 1Z05A 3DTIA 1JTYA 3HUGB 3MD2A 3R0AA 4XKCA 4O3MA 4AUXA 2KHMA 4N9IA 1B1BA 1VZ0A 1D1BA 4A0ZA 2VKEA 4BEHA 4P55A 2O7OA 4LJZF 3ZMUA 4LK0F 2XGCA 4A3MJ 3I3LA 4QSHA 3WHCA 1OLTA 1YRNB 3ZMSA 3TBIA 1YI2I 3TQNA 1WHUA 3V7SA 1RUNA 2L3DA 3EPZA 3TDUC 3K4BA 3Q9SA 1U5TB 2X6XA 2A68F 1YW7A 3N4MA 5H2FC 4HBLA 1X1BA 3LSHA 1Z3YA 5LBQA 4A3LJ 2K3PA 2KQRA 4IOCF 2JVHA 2LFBA 4GO1A 4UUTA 3E97A 3F22A 1J9IA 2DN0A 3WE3A 2V1DA 1NHAA 4HEA2 3D1NI 3GTGJ 4S05A 5KK1A 3N05A 2M34A 2RDPA 2ME0A 5DD4A 3BOQA 1ETOA 2ZSHB 3P9CA 3BTJA 3R60A 2ZXWH 4E7JA 2EFQA 2EIMH 1BBYA 2LC2A 3KP3A 2K9QA 2XB0X 3JRIA 2FD5A 4XK4A 2LKXA 3GFJA 4A3KJ 4B3AA 3CUQA 2L4MA 2CW8A 4GFBA 1ZKGA 4F55A 2X1DA 3HOSA 3HRSA 2ZB9A 1LEBA 2VJ4A 4U87A 4RB0A 2DA7A 3BP8A 5F0HA 3H9QA 1LEAA 2XASA 3QU3A 4S04A 1BJAA 1JJ8C 4I02A 4LITA 5F0FA 4BKXA 5LGTA 2IA0A 1K6YA 3AG4H 4DOZA 4BUPA 4V19K 2JQ7A 5L3GA 3IRRA 5CJ9A 1TQIA 3ISPA 3WGHA 3KP7A 1BR1A 1BL0A 3SZGA 4Y7NJ 5GAEJ 1JTXA 1TT0A 1H9TA 3KYLA 1MNDA 2GZWA 2BXZA 4UVBA 3HYIA 3HOVJ 3RI4A 1TWFJ 3M07A 1Z77A 3W2VA 1FLIA 4XLAA 3PO2J 4LLGF 3FXMA 1ETVA 2E36A 2L7FP 1QVUA 2F5DA 2ICWG 1R5ID 4XN0A 1KU7A 1LDKB 4EV0A 1B72A 1P9QC 1LQ1A 3O6BB 1TWCJ 4IHYA 3PIPF 1BIAA 2MLGA 2B7EA 4A0XA 4XSXF 1LKXA 1OFCX 3T8RA 1T08B 4AU7A 2CQKA 1Y1WJ 1H88C 2Z5UA 3OL3A 3WTZA 4E7ZA 3JCUC 3V4GA 4P9FA 3OYBA 1YQAA 2XGXA 2Q8KA 2XUBA 5EG0A 4Q48A 2DA3A 2JPBA 4J01A 3FXLA 4IRGA 3M7GA 1D1AA 3ABUA 3Q9VA 3GXOA 2CUJA 1BIBA 1SC7A 2JUGA 4WXHA 1YO5C 1VTNC 2MG4A 3GFIA 5IP6A 4GRIA 1O7FA 2ME6A 5FO5A 4BDYA 1FPQA 1QHHD 2G7HA 2Z3YA 3GF2A 3OWTA 4IHXA 3W2WA 3TGNA 4J19A 1BA5A 1MMNA 4BQNA 4XICA 5TJJA 1FOWA 2JN6A 2GXBA 3QOEA 4JBAA 3B6CA 3MKLA 2ZO4A 3QP6A 1XB4A 3CESA 2NS0A 4HX4A 2PJPA 1A31A 3QPSA 1H9GA 2BY0A 1LFPA 1O7LA 1SMYF 3LMMA 4HF0A 3WTYC 2GOXB 2ADUA 1O3RA 3RPUA 1OJLA 4A5MA 4KUMA 1T95A 3TOAA 4CZZA 2CSOA 2CS3A 5JHUA 4XLFA 1ZELA 3M8FA 1V5FA 4V2GA 1P6RA 1J7KA 2PI0A 5GPCA 2DO7A 3S1MJ 2N8GA 3E7LA 2RN7A 3CMAI 3MVPA 3FXOA 3NWTA 5J4YA 4EVIA 2LR8A 2ACJA 3S14J 3FXKA 5IOZA 1ZARA 2A3SA 2CO5A 4E6KG 4YIFA 3HDDA 2JT1A 4G6TB 2M0MA 2D1VA 1HC8A 4OU0A 3S93A 2RVCA 4MTDA 1OR7A 2KRFA 3KLNA 4UV8A 5FKMA 3S2HJ 1FMWA 4EJWA 3C2BA 3WTUC 1WJFA 2AO9A 2KFDA 3TEDA 2XRLA 2HYFA 4FHTA 1U8RA 1T0FC 2Y9YA 4XOPA 3IUOA 1GHCA 1YIJI 2OTJI 1HXDA 3Q0WA 1LE8A 3CC2I 3MZ8A 4F52A 4RLFA 1MBJA 4ZC3A 3CUOA 4ETSA 4PFPA 4I0AA 1XDSA 2VPRA 5DCMB 1FTZA 4HA8A 2FMLA 1A6QA 4WWCA 3AL0B 4PK4A 2M87A 4PDKA 3CCQI 4CZCA 2E1CA 1VQ6I 3WTWC 3RYRA 3PM1A 2MD5A 1S7AA 2PQ8A 4U0YA 4FE7A 4MIMA 5L3EA 1W5TA 2EIJH 2YSRA 3IHUA 1BJZA 3HXLA 4BDZA 2BYVE 2NS8A 3OS1A 3CCMI 1JJ6C 4PSXA 3GO5A 1UG2A 4Q5SF 1T98A 3UR3C 5D4RA 2VT3A 3S1QJ 2QF7A 3B6AA 2R7XA 1TLHB 4XR6A 4ZYHA 2V1UA 3RQ4A 3RIRA 4GXOA 4NQWA 3MKZA 4G9YA 4MO7A 5LLQA 4RA2A 2K9NA 5KAIC 2PEXA 3P9KA 4LFUA 1MSEC 3CCEI 2QKMB 2K40A 1MDMA 5FRNA 2A6TA 2CUZA 4HRIA 2QQ8A 2E60A 4U0VA 4AVZA 9ANTA 3JRAA 4BXUA 3TW6A 5H6RA 5D5UB 3QP5A 2KDZA 2VN2A 2DA4A 4IOAF 2XDVA 2CFXA 3T5XA 3I54A 4YFKF 4XLPF 2COMA 5CPRB 4CCJA 3J80Z 1U2WA 3QYFA 1ON1A 2BY3A 5C3EJ 2KLOA 4QWQA 4BY1J 1Z91A 1GXPA 3LNQA 3F8FA 5ILVA 1ZH5A 3QYEA 3CCUI 2KIFA 4H4KC 4PJJA 3BR3A 3WE2A 1Y39A 2VE9A 1SAUA 1WJBA 3D5RC 1MJBA 3KE2A 1S7EA 2QGUA 3BCAA 3A0HC 4JK1X 4D7NA 4BE2A 5GPAA 1RZ4A 2F4MB 1IG7A 3HRUA 2KJCA 3DFGA 3AFHA 2E2JJ 2B63J 2K27A 2FE3A 2X6YA 5LRSA 1J09A 3BG3A 5D8KB 3HGYA 5CVVA 1K6OA 3IRQA 3LFUA 2CJJA 4ABZA 5BS6A 4GCVA 2BGCA 2P6SA 5FRMA 3E0JB 3K1NA 3TP0A 3L2UA 2MGQA 3GVAA 4RM2A 1RPWA 5BPIA 5BMZA 4HV6A 4HG2A 5KHDA 4KJZA 2PN6A 4L0YB 3DKWA 1F9NA 3I4NJ 4ON0A 3WODF 1QA6A 1TTYA 3JRBA 4P96A 4H0EA 1CF7A 3OIOA 3HKZA 1Z3XA 3K4NA 4XM3A 4A2UA 1PDNC 3G4SI 1ZQ3P 1SFKA 3NRVA 3VYUB 5FFZA 1AKHA 5IT9Z 2DDAA 2DK5A 2GIZA 4M6YA 1RESA 2EZHA 3NEUA 4RAZA 4Y3OA 1YTYA 2BY2A 3KX2A 4EJVA 4B48A 2DBBA 2IW5A 5F08A 3WTVC 1FC3A 4N0BA 3H1CA 5K7HA 1MBGA 2EBIA 2ZFWA 2R7TA 3LSJA 4XRMA 1ON2A 2E2HJ 4UUSA 3BG9A 4P1WA 2LY1A 3TO7A 4WCGA 3L7WA 2WTEA 3I56I 2OZUA 1RKTA 2W48A 2QBYB 4OMYA 3RDIA 2TCTA 5GTIC 1ZHFA 3K9TA 3G1OA 2BHZA 4HF1A 2EZIA 4BQAA 4K2EA 1DPUA 3MCZA 1V3FA 2VASA 4KYWA 1WQ2A 1UHMA 2OU2A 4MEYF 4BHBA 2MLKA 2FEZA 3KP2A 2ID3A 3J81K 2BZTA 3E1SA 4AC0A 1W0UA 2QSHX 3QOPA 4AIDA 1X2NA 4XNFA 2VI6A 2CV0A 1XG1A 3V7RA 2GXAA 1FOXA 3VSLA 1QRYA 5E3NA 2QQAA 2PLYA 1JHFA 3PQJA 2WAFA 2CUEA 4X0GA 4AIHA 1STZA 3H9GA 1GVJA 3ZPLA 4CDGA 4A3GJ 3GTPJ 2YS9A 3H5RA 3OSGA 2M8GX 4E4HA 2KZVA 1HLVA 1D0XA 1MH4A 2CQXA 5E1WA 5CVJA 4E7HA 3OYIA 2IP2A 1D0ZA 2VBYA 1IN6A 3EQLF 2XAHA 2FXAA 1KU2A 4ESJA 4A12A 4IZZA 3DWLE 4RB3C 4JX5A 1EF4A 4IRIA 1H8AC 3S2WA 4A6EA 1I6XA 1JUSA 2D2WA 3WTXC 3ZQCA 1BI0A 4ENMA 4QTRA 5FGMA 3KZZA 2VBWA 3ASNH 4OOIA 1PUEE 2VC0A 1IW7F 3I0TA 2E1NA 4RGUA 3LA7A 2XRNA 3I4PA 2XAUA 2QLZA 1YJ9I 3C2HA 3CQZJ 3KETA 1H89C 2MSYA 2IJLA 2YR2A 4ZYAA 4M72A 1ZRDA 2CMPA 3HIFA 2ELJA 5DTDA 1UHWA 5E3LA 4DNCA 3QYBA 2DU9A 3HZJA 4OWRB 2R7SA 1E17A 5LHHA 1GV5A 3CMYA 5FKKA 2ZJPF 3BWGA 3E6CC 4CUGA 2JPCA 5DM7F 1MMDA 2E19A 2IXSA 2VIXA 4EQQA 2DPDA 2GAUA 1ETKA 3DCFA 4KIFA 1QVTA 3CTAA 2VC1A 1IGNA 4JP0A 1ZREA 2H1KA 1E2XA 5BPDA 2G0EA 1G4DA 4BXXJ 2BV6A 1BW5A 4L5JA 3E5QA 4NB5A 3HUGA 1O3SA 4OMZA 2F5VA 5F64A 4PJNA 2MFZA 4KA4A 1D0YA 4BY7J 4HAMA 2VB6A 3PSFA 4LK1F 2CUFA 4BE1A 2LK2A 1T39A 2E5ZA 2LSOA 4BHCA 2R4GA 2TRTA 2KP6A 1YRNA 3E5UA 2IRFG 2LKPA 1XMXA 3VOEA 1ZLJA 3AKZA 4ZJZA 4XKBA 1TC3C 2FQ3A 1TZLA 5FKOA 2VJJA 3BJAA 1U5TA 2V4JC 1OCZH 1IXCA 5IY5H 3GTJJ 2DA2A 4Y52J 5IP9J 1MJAA 1T2KA 3OYFA 4HV5A 4KT5C 4DQ2A 3VYTB 1PJRA 4BJ5C 3HJEA 1KU3A 2CRGA 5ICGA 3B02A 4P9UA 1LPQA 4IQ4A 2H6BA 4ENKA 1T33A 2NAZA 2V1NA 4MQVA 2A5YB 1JE8A 5K1YA 1XX5A 4RAGA 2GA1A 3RSNA 4XN3A 2O61A 3ZQIA 5JI6A 2KIMA 3FWEA 3IWZA 2QKLB 2M4GA 3OYDA 3CJTB 2R5ZA 5HS7A 1XSVA 5LEJA 2XVCA 5ERIA 1I3AA 2KL4A 1GV2A 5AIQA 2WV1A 4HW0A 2LBFB 3FMSA 1VQPI 3ML6A 2VUMJ 3RCOA 4A6DA 2GWRA 2A5WA 2VOOA 4MGRA 2GM4A 2DOEA 4G8XA 1VQLI 2JA8J 4V2FA 4BL0B 4X6AJ 2HKOA 2O5RA 3I53A 5F1RA 1DGWY 4DYQA 2R7DA 4EJOA 1S72I 4UVCA 4C3HJ 5K5QA 4II2A 3T1BA 2X85A 5FLVA 1E3HA 2LRDA 2HXIA 2QZ8A 2TDXA 3I58A 4EGYA 5BOXA 2L01A 4HNTA 2Y30A 2CQ7A 2P8TA 2ZXHA 2VQLA 3WGGA 2HXOA 2WAQA 3RKQA 3U9GA 2W84A 3GLXA 1SFXA 3OS2A 3HB9A 1IRXA 1TWAJ 4RM3A 2HQ5A 5LGNA 5E3MA 3HOUJ 4A3FJ 4ANJA 4IX7A 2HQNA 3ZRGA 3FKJA 4YEJA 3N97A 1FBUA 1KQ9A 2X0LA 5JVGF 3IKVA 2IGNA 3BROA 4LMYA 5HDNA 3ONQA 4ZYEA 3BY6A 1CGPA 2HZTA 3K4MA 1ZN2A 1I50J 3V8JA 2V9KA 4M3DA 1WCMJ 3ABTA 1OYYA 1W1WE 5GAHJ 3U21A 1V54H 1DGRM 3E6BA 3W2AA 3E3VA 3SHFA 3E6MA 2ELKA 3ZR8X 3DPTA 1JI8A 3AG1H 1POGA 2HDWA 3BZ6A 3WU2C 1F43A 2K85A 1JKRC 4ESFA 3IH4A 3FDYA 2HI3A 3B73A 1TT5B 3G3ZA 2OD5A 3BC8A 2VT2A 2VL8A 3KEYA 2UZKA 2WA0A 4U88A 5F1JA 3MWMA 1B59A 2WB1N 3L2WA 3DEUA 3Q5FA 2HQAA 1XS9A 1Z6RA 3FM5A 4C3IJ 1F36A 1IC8A 3QPHA 2XC7A 4BACA 2LNBA 5A2QK 3FK6A 4OINF 2R7FA 1QGPA 2L7ZA 1BC8C 1TNTA 3GTQJ 5ED4A 1HF0A 3JSOA 1R7JA 2D1HA 1NK3P 3HRMA 1FBSA 1IN4A 3M8EA 5H6QA 3SDBA 2DFEA 3DBHB 4NHJA 3OYHA 3GTOJ 4KITB 1LFUP 5B1BH 3S1NJ 5D5VB 3COAC 2LG4A 3ZOBA 1OYIA 2CYYA 4AWXB 5EEHA 1K4TA 3ZQ7A 1DU6A 2L54A 3QRFF 1G3TA 1G3WA 5DUKA 1N77A 4KISA 2UXNA 4JOMA 3KP5A 1UJ8A 1HSJA 4ZDOA 1VQ7I 3GZ5A 4HOBA 3EUHC 1DU0A 3BJ6A 3IAS2 1TBXA 1PUFB 4M71A 5K7ZA 3FXJA 4R79A 1IUFA 2RV8A 3IKTA 1DPRA 4N4OB 2OAZA 3GZNB 2R5YB 1NK2P 1XGSA 2QYOA 3RZOJ 1NTCA 3GEZA 5EGOB 2OCEA 1YE9A 1Q1HA 1R1UA 3TMOA 2VE8A 1V5GA 1WFXA 4M9XA 1QBJA 1PVEA 2Q1ZB 3HHGA 3LQQA 1FYLA 4G94A 3DP7A 4EEFG 4IEJA 3RKWA 2EH3A 2FOWA 2VODA 3IAM2 1HW1A 3HKZN 2F5CA 3U1KA 4BJ6C 1MD0A 1RETA 3J81Z 2EFWA 4XLHA 2XF5A 1MJ9A 4L18B 3F72A 2NVTJ 5F27A 1USTA 5CVIA 1X19A 3NQOA 5DCMA 2NS7A 5HVQC 2DT5A 2EIKH 4B4CA 3BTLA 5J1RA 1ZRCA 4A3JJ 1U8BA 3ABKH 1YJNI 3D0SA 2ELHA 2DMUA 1B6AA 2DFFA 2EQRA 4RB1A 1Z21A 2KIUA 2BW3B 2IGKA 3TP3A 4NNJA 1N25A 2W7NA 2HYGD 3L09A 3WU0A 2FMYA 3OYEA 1D8JA 3VB2A 2BVMA 3ZMTA 3ERMA 1RR7A 4MFDA 4M3BA 1K83J 4RDUA 2L4AA 2MYSA 4M9ZA 4S0HB 1LB2A 1LDDA 1IRZA 4AIKA 1AHDP 3I5UA 4ENJA 1OQYA 3BG7A 1WWXA 4F91B 1S8NA 3DEWA 4II3A 2LF8A 1YW9A 5F6FA 4UB6C 1IO2A 3S2DJ 1SD5A 2L7KA 4E7KA 1YS7A 4CYCB 3QQAA 1ACIA 1FOYA 1MBKA 3LSKA 4CXFA 1VQ5I 3T8TA 4L0ZB 3I9V2 3FHZA 4G7HF 1HCRA 4ZZDA 3LSPA 3RJPA 3DU6A 4C30A 4HLXA 1OCTC 2D5VA 1JUMA 3P7NA 4B8XA 4OIPF 4PJ0C 4OIOF 5EZHA 3PFYA 3SEQA 3SEZA 5E1XA 4GGGA 1R00A 1R22A 1BOAA 3ZQGA 4M3EA 3LSIA 2HOAA 2FRHA 3TW7A 4XSZF 2K7LA 1XN7A 3OIQA 2KRHA 4YFNF 1T38A 2DMNA 2K9MA 5LFAA 1R9TJ 1MNMC 5EDNA 1W7PA 2LD5A 3F0CA 4BJTA 1A36A 1Z1DA 3OR2C 1P7JA 2R7UA 3JRGA 4XKWA 2VLAA 5L3DA 4U0WA 5IYBJ 1HOMA 5IOYA 4I09A 3HPHA 3I64A 3Q3SA 4WXDA 3H3UA 2BOLA 1FYKA 2LY9A 1FWZA 5AONA 1QZYA 1MH3A 3DKYA 2HEOA 2PBIA 3CJQB 3CC7I 3EYIA 1X3UA 2E71A 2K02A 3GX4X 3SJMA 3FHNA 2FSWA 4WXCA 2EFOA 3KEQA 3NAUA 4LB6B 5J40A 1FEXA 3BCBA 3HRTA 3H5NA 5KCMA 1ZG5A 3R0JA 2MC3A 3BTIA 3O8HA 4HDUA 3HGGA 3JRFA 4IKFA 3FBIB 4CCMA 3MKYB 2XAQA 4XORA 2GA2A 3VWBA 3CUQB 3JTHA 5GADJ 2ZXIA 3HHHA 2QBYA 4I7HA 4LG0B 1LVKA 2W1OA 1I5ZA 3LA2A 2A6EF 3OYJA 4XRSG 1Y6IA 2DJIA 4KIGA 3I59B 1EH6A 2P6TA 1IV8A 4OAYA 5BQTA 2YPRA 3G71I 3ECHA 1X3WB 1T56A 4KMUX 2BXYA 3K70C 4FETA 2JWTA 1SEUA 3GTMJ 5FKLA 4R1HA 4BBSJ 1NH3A 2DMTA 2FUG2 3K1MA 3P9IA 1IDYA 3CZ6A 3CCRI 2L9RA 2JA7J 2WB1A 1WH5A 3DV8A 3K0LA 4RAYA 3C1DA 2NNYA 3BG5A 1F4KA 2OZ6A 3LL7A 3GFLA 1VQ4I 1P7IA 2CQQA 1JXSA 3K70D 1U9OA 3A01A 3W6JB 1ODDA 1SD7A 2XPUA 3BPVA 3MKWB 2ZMEC 5HS8A 3MFKA 1WJAA 3VFZA 1X4PA 4DBRA 3MQ0A 3KP4A 1HKQA 3JSPA 1V5EA 1R5HA 2NOJB 2M2EA 2OA4A 1D5YA 1U0JA 4PGGA 5HLGA 4EJUA 1MBHA 2M3AA 5CQEA 4ZTJA 1B72B 4EJTA 1ENHA 2JRMA 2A07F 2J5PA 3HSFA 4I2OA 2GXGA 3M1CA 3RPQA 3GCMA 4BAYA 4PJLA 1SD4A 3I55I 2KT0A 4BE0A 4Y4RA 1EH7A 5DYMA 2H1LA 1X1DA 3EUHA 1XDUA 2IA1A 2M45A 4NC6A 1HDDC 2ZSIB 2B0LA 2DK8A 4Y13A 4BXFA 3HBLA 2WBMA 1WJDA 3PNYA 3F8NA 4UV9A 5BNGA 3HOTA 1W36C 1Z67A 3OV8A 1MIJA 2M7BA 3H92A 4GYIA 3J7ZI 1BI3A 1EA3A 2WAQN 1K78B 2HYJA 1OISA 3S3OA 1ERDA 1TQPA 2XKOA 3DEEA 3K4KA 2RQPA 2FX0A 4HSRA 4XKVA 2NOGA 5F0CA 3V42A 4I76A 1SFEA 1D5VA 4B3XA 1UELB 3ZP5A 4KN4X 1QPMA 5ICEA 1C0WA 5GP9A 4ENNA 4KN7X 3C7JA 3QWLA 3CMMA 3OR1C 2VQCA 2DCEA 3QPTA 3CLOA 1U78A 1OCRH 3SZTA 3BG6A 1ZYRF 4NDLA 3HSRA 3NWSA 3DF8A 4DBQA 1TW2A 2OPTA 4ZZLA 5TRDA 2GOMA 1JGSA 1HW2A 4AVPA 4RBOA 2Z99A 1FX7A 2JMWA 3CJRB 4HPQA 4LLNA 3KYCB 4CCKA 3CMEI 1MBFA 1AOYA 3GZ6A 3BQZA 2VJIA 3W6VA 4YIRX 3FXRA 1HKTA 1KYWA 3G1MA 2X9DA 2WY7Q 1KA8A 2IA2A 3CCVI 5HS9A 1YIOA 2GIVA 2B9SA 2L2OA 1IRGA 1HSTA 3KYDB 2RC4A 3F8BA 1Z7LA 2VKDA 4QIWN 5HNHA 4M6XA 4XONA 1X58A 2IVMA 3T0YA 4CCLA 3DTEA 3M8JA 4M3GA 5EEGA 1YJWI 1UAAA 1Y0NA 1YX5A 3SDGA 1XD7A 2FBIA 4LIUA 1D1CA 3EDPA 1XCVA 5IYDJ 2L7MP 2FBHA 3FXQA 2VXZA 2QA4I 1B8IB 3BZKA 1IF1A 2MABA 2W00A 2P0WA 3G6EI 2MH9A 1Z6TA 2Z33A 3TKYA 1UG0A 5CQGA 5J1UA 4IHVA 1BOBA 2UWMA 5DV5A 5J6XA 4HNUA 3BR0A 4CO8A 4DZPA 4DJAA 4CGZA 1VQKI 4RGRA 2A05A 2DYSH 3GTKJ 2QSGX 1Y8QB 4E7IA 2IS4A 5EF6A 2KRCA 2STWA 2DQLA 2QM3A 4IHTA 3DBRB 1P2FA 1GVDA 2JZYA 3ABMH 5EYRA 1JKQC 2G9WA 2IGMA 1K7AA 3GLLA 2DI3A 1QNTA 3FX3A 3KP6A 2Z9OA 1I1SA 3J7YJ 1IXRC 1MDMB 2LLKA 4M73A 3ZXSA 1BI1A 2X6OA 4HX8A 2F5FA 3L00A 2QQ9A 1M1EB 4NBQA 5B1AH 1R23A 1I1GA 4MHGA 3HEFA 4E7SA 4MTEA 3CCJI 2O8KA 1EKEA 2BY1A 2XAFA 2WAEA 3GTLJ 3QU6A 5HDGA 1XSDA 1ULYA 3MZHA 1WJEA 3K4CA 2HKXA 3S16J 4XLEA 3HOYJ 1IJWC 1L3LA 3CUQC 3F8MA 4L5IA 4G7ZF 2ID6A 1WZ2A 4CHUA 1DP3A 2Y0SA 2VKHA 2QEXI 1IN5A 1T0FA 3WG9A 3L1PA 1TL8A 1FY7A 3PNVA 5H20A 3LQRA 2ECCA 2V9VA 3HSEA 3PFIA 3K4JA 2K3FA 2XSDC 3HL2A 2YUSA 3VYSB 2CW7A 2M5WA 2XPWA 2I8DA 2V26A 4IQJA 2ZJRF 3ESWB 4LD5A 4ZYGA 2G7UA 1D8KA 1L0OC 1KGSA 2DW4A 3H3ZA 3HOZJ 4ZDPA 4W97A 3OSFA 4Z6YA 2E2IJ 5E17F 2W24A 2R3SA 4KIBA 4U7BA 1HA8A 1R4MB 4TV7A 2W85A 3RTRA 4PFOA 4A3IJ 1ZLKA 2ZCWA 2R7VA 3F23A 1T8IA 5HLIA 4U7DA 3CCYA 4A93J 3BT9A 2F2EA 1P4XA 5JFRA 4DW6A 2GBYA 2F48A 2P5VA 5J1YA 1WPKA 3UNGC 2XGEA 1S9HA 3W3CA 5B66C 4RMNA 1ETWA 3KZIC 1QPIA 4PCQA 1R5GA 4ZTFA 4HX7A 3TDZC 2VBXA 3DXJF 4L9JA 1O3QA 1EJ9A 2VONA 5C44J 3M1EA 4B43A 4N4NB 1XGOA 2WY8Q 2OTLI 3BR6A 3I71A 1YX3A 1KQ0A 1B4AA 2UXXA 1O3TA 4M6VA 3A2KA 5FB2A 4G7OF 3DPUA 1O57A 2H6CA 3PL8A 1ITYA 1YG2A 3X2QH 5E8GA 1V4RA 3IV5A 2L02A 3BR2A 5D5WB 4DIQA 3HTSB 2BVLA 1MW7A 1BI2A 3H36A 1NG7A 5E1ZB 2H27A 4NUBA 2VBZA 3ZN0A 5EGOA 3I4MJ 1G6NA 2COBA 1I27A 5EJCA 5K5OA 1E3OC 2IS1A 1X1PA 1LJ9A 4OIQF 5L3FA 1GUUA 4L5EA 5FKNA 3MAJA 1XGNA 2Q2EB 3JAMK 1XMKA 4IRHA 1SMTA 3CP2A 4DZJA 3HOWJ 2QENA 4A3DJ 1ZRFA 1DQUA 2KDOA 4BS9A 3KEOA 3SZPA 4EM0B 1MBEA 1Q1VA 1RR8C 2D45A 1P4AA 2PFBA 1RUOA 2EFPA 2JRTA 5EZGA 4UHTA 1LFBA 3LAPA 1TWHJ 1YHQI 3S1RJ 5TISC 3GWZA 3ASOH 1R49A 2EB7A 4JYKA 3OY9A 2EV5A 2OQRA 2DA5A 4C3JJ 2HPMA 2P5LC 1EH8A 4IHSA 3ZCOA 5HODA 5HLTA 1W0TA 1WGXA 2KZGA 3UKGA 1RIOH 1A6IA 1FP1D 1X3ZB 3F21A 4PJMA 1W5SA 4UXNA 1Y8RB 1QQIA 2FNPA 2EV6A 1JHHA 2ZFUA 3DBLB 3GYHX 1SFOJ 1IV6A 4UY8I 3SFZA 4MLOA 2I10A 2LDUA 1Y0UA 1U3EM 1OR7C 1KYZA 2ISYA 2OJED 1X2MA 2DOAA 2YX7A 2O6GE 5LEKA 2RNJA 4CH7A 4XQFA 3M4OJ 2W4SA 4D1QA 3SQNA 2E34A 3CO7C 1SVLA 4O6JA 2R7QA 3L2VA 3TO9A 1X1AA 1BN5A 1VQOI 1ZG1A 1ZGWA 1VQ8I 2MW8A 3QAHA 2Z2SB 4HLYA 4IXAA 3VDXA 3F3XA 5EEAA 5M5XJ 3BPXA 1S29A 1LUJB 3ZQFA 3KZYA 3FBNB 3OIPA 4I01A 4XLCA 2YU9J 3IH2A 4PUSA 1EV7A 1F1ZA 1RC9A 3C18A 2PJRB 3AG3H 1ZGAA 3MN2A 2XROA 1WRJA 1ZR4A 3ZMVA 3ZGKA 1VNDA 4FX0A 3DU5A 3LWFA 4IO9F 5LRRA 4GYGA 5LHGA 2ZMEB 4W1UA 3HC7A 1Z0XA 4AD9A 5L3BA 4D0PA 2DDBA 4KFCA 4B47A 2WWYA 1A35A 3VSKA 2AHQA 5IPAA 4LB5A 1IAWA 5IT9K 1P4WA 2LVSA 2ZJ2A 4G6DA 4UVAA 2E35A 2O8XA 3LFKA 5D6EA 1HBXG 2KIQA 2VPLA 2RQQA 4RB2C 4IF4A 1RKWA 4CA0A 4F92B 2KISA 1FTTA 4F7ZA 1JKPC 4I0BA 1LVAA 4A0YA 4WK8F 1R71A 2AXTC 3J7AY 2JSPA 1OYWA 3ZN1A 3BQYA 2XV4S 4B44A 3S8PA 3OYCA 1PYVA 1FP2A 2C6YA 2X48A 3CLQA 4A69C 1P92A 2NVYJ 2XKPA 3D5SC 2ZBKA 5FROA 3MEXA 1JUPA 2R5ZB 4Y17A 3A4CA 1U6GA 5M3MJ 4HF2A 2V79A 5KAFC 2E1MB 4LG0A 4LLLA 1APLC 1FT9A 4UUVA 3CDHA 3HPGA 5JLWA 3U2RA 2R0QC 3SYTA 2F6CA 4CICA 5D6FA 2Y48A 2HDCA 2EILH 3EUKL 3I59A 4R8HA 3PNTA 2DFIA 4C2TA
chains in the Genus database with same CATH topology
1J75A 2ZNZA 2ISZA 4KNYA 1MKMA 2E7WA 3SXYA 2DAOA 4E70A 1B9MA 1WKMA 5CLSA 2HGCA 2Q0OA 3R4KA 4KICA 4IVNA 6PAXA 1OMIA 3FF5A 2PMUA 1AWCA 3ZMDA 2QWWA 3FM3A 4M9SA 2NRAC 4BYYA 2DLLA 1SAXA 3WGIA 3PQKA 1DP7P 1Z9CA 2M30A 4XBFA 3TO6A 2P5KA 3TOBA 3ROUA 2W57A 1K78A 4FX4A 4XLNF 5KVRA 1HKSA 3W6KB 2ZNYA 2IT0A 1WI9A 1SFUA 1HW5A 1IRFA 2P7CB 5E18F 3OOPA 1FOKA 5CVRA 3K69A 3V8LA 1OPCA 2EV0A 4OIRF 2PMHA 4WF2A 3VEPA 3K2ZA 2HS5A 2H94A 5FD6A 1R36A 4MEXF 2LF7A 4N9HA 4EM1A 2BBYA 2CGPA 4RGXA 2NYXA 3LSTA 3CO6C 2FOKA 2Y75A 2F5EA 3BJOA 1YS6A 3O3KA 2CW0F 2A6HF 3GW2A 3GFMA 5LHIA 1RI7A 1FSEA 5D8LB 5DCFA 2O03A 3V8KA 4Q47A 2M8EA 1YW8A 5DEQA 1GXQA 5JR3A 1BC7C 4QLCU 2RGVA 3JAMZ 1W4MA 2ZKZA 1YLFA 4YG2F 2YX4A 4EM2A 2OQGA 1K79A 1OKRA 1ZAOA 5JVTA 2KJBA 3DQVC 3ECOA 4RGSA 5J8FA 1PP8F 4XRFA 2ETHA 4YIIA 3G73A 3R61A 1XGMA 5FLXK 2QVOA 1U5TC 2V6CA 4KMFA 1IZ1A 2K86A 1ONVA 1DDNA 3RKXA 4Q4ZF 4PZJA 5FFXA 2FBKA 2XHKA 2HQRA 5E8IA 2M1BA 2JSCA 3LA3A 4EMSA 2XIGA 4BHPA 2ESNA 2GQQA 1LNWA 4P5OA 2FA5A 3WU1B 5A2QZ 2EK5A 2FU4A 3M9AA 4ASNA 1W7PB 5ILUA 2ZXJA 2O3FA 1ZGJA 1H0MA 1Z7UA 1J59A 2STTA 1DUXC 1KU9A 4I98B 3E6DA 2EJRA 3K1PA 2Y0MA 2P7VB 2HR3A 4BH9A 3AAFA 2EWNA 1G3YA 4LGWA 3U1DA 3IWFA 2XAJA 3D5LA 4PGHA 3FZVA 1SD6A 2K4JA 2HWVA 3RYPA 4HZFA 1T6SA 3KCCA 2EFNA 3O2PE 3V7CA 1F5TA 4WX9A 3EYYA 1YFHA 4KDPA 1QO0D 2NNNA 3EETA 5J8CA 3L9FA 2QQBA 3F6OA 1MGTA 3JTGA 2Q2EA 4L9NA 4HDVA 1WSUA 5CVUA 3J7AO 3ULQB 5FD5A 2BEOA 1BM9A 3FMQA 5IT3A 2MH2A 1KQ8A 3IC7A 3WTTC 1FYMA 2WC2A 3KLOA 4IPAA 3F6VA 1S6LA 3L2CA 1TQMA 2E7XA 1PP7U 1S3JA 5ILSA 2HFHA 4M74A 1FNNA 2X4HA 2XAGA 1R1VA 2BE5F 3E5XA 2HOEA 2WV0A 4HQEA 2DPUA 2MBFA 3CJNA 1USSA 2EA4A 3GUDA 4MQ9F 3RKYA 2QUFA 2DQRA 5E20A 1XCBA 3ZMZA 1IN8A 1HQCA 2HTSA 5L3CA 1YYVA 4BNCA 2OBPA 4AIJA 5DUIA 2CWEA 2PG4A 4CYDA 3C3WA 3FMRA 2AXLA 1ZG3A 1CF7B 4MNUA 1UCRA 4ESBA 4G6QA 5ICFA 2ESHA 4L9TA 1LDJA 3BDDA 2ZMEA 3R6SA 1QZZA 4B09A 4Y15A 2EA2A 1D3YA 5ICCA 4YFXF 4EGZA 3IL2A 1MZBA 3F8CA 1UFMA 2H09A 3MZYA 5DDGA 2IPQX 2K4BA 1IXSB 3ELKA 1G3SA 1R58A 2A61A 3VODA 2HTJA 1TW3A 2AS5F 4HYEA 5D4SA 5CYVA 4A5NA 5LGUA 1A04A 2P4WA 2MA3A 4Z2YA 3WTSC 2YU3A 1FSHA 1J5YA 1S7OA 4RS8A 3JW4A 4IJAA 1XMAA 4HQMA 2RKHA 3REOA 5DD8A 3ERED 2KKOA 1W7PD 2O0YA 2CG4A 5AIPA 4ZYDA 1IUYA 1RNLA 3KFWX 1TNSA 5FLXZ 2FF4A 2VOPA 2DTRA 5D5XB 2A69F 1R1TA 2JTVA 4FT8A 4L9VA 5HOOA 1FBQA 5HDKA 5K5RA 1UB9A 3J80K 5HLHA 3LAJA 4ZH4F 3DPLC 1IN7A 2V1XA 1XSXA 1FZPB 1J2XA 1B9NA 1REPC 2J5OA 2W25A 1J0RA 4UNOA 4JQFA 3FXUA 4O5VA 3HTUA 2FNAA 1Z05A 3R0AA 4O3MA 4N9IA 1B1BA 4A0ZA 4P55A 4LJZF 3ZMUA 4LK0F 3ZMSA 3TQNA 3V7SA 1RUNA 2L3DA 3TDUC 3Q9SA 1U5TB 2A68F 1YW7A 3N4MA 4HBLA 5LBQA 4GO1A 3E97A 3F22A 1J9IA 3WE3A 2V1DA 1NHAA 4S05A 5KK1A 2RDPA 5DD4A 3BOQA 3P9CA 3R60A 2EFQA 1BBYA 3KP3A 3GFJA 3CUQA 2L4MA 3HOSA 3HRSA 1LEBA 4RB0A 3BP8A 1LEAA 2XASA 3QU3A 4S04A 1BJAA 4I02A 5LGTA 2IA0A 5L3GA 3IRRA 5CJ9A 1TQIA 3ISPA 3WGHA 3KP7A 1H9TA 2GZWA 4UVBA 3HYIA 3RI4A 1FLIA 4LLGF 2F5DA 1KU7A 1LDKB 4EV0A 1LQ1A 3O6BB 1BIAA 2MLGA 4A0XA 4XSXF 3T8RA 2CQKA 2Z5UA 3WTZA 3V4GA 4P9FA 1YQAA 2XGXA 2Q8KA 2XUBA 4Q48A 2JPBA 4IRGA 3M7GA 3ABUA 3Q9VA 3GXOA 1BIBA 4WXHA 1YO5C 1VTNC 3GFIA 1O7FA 5FO5A 1FPQA 2G7HA 2Z3YA 3GF2A 3TGNA 5TJJA 2GXBA 4JBAA 2ZO4A 3QP6A 1XB4A 2NS0A 4HX4A 2PJPA 1H9GA 1O7LA 1SMYF 3WTYC 4HF0A 2ADUA 1O3RA 3RPUA 4A5MA 4KUMA 3TOAA 4CZZA 2CSOA 5JHUA 3M8FA 2PI0A 1P6RA 1J7KA 2DO7A 2RN7A 4EVIA 2ACJA 1ZARA 2A3SA 2CO5A 4YIFA 2JT1A 2D1VA 4OU0A 4MTDA 2RVCA 1OR7A 2KRFA 3KLNA 4UV8A 4EJWA 3WTUC 2HYFA 4FHTA 1U8RA 1GHCA 1HXDA 3CUOA 4ETSA 4I0AA 1XDSA 5DCMB 4HA8A 2FMLA 4WWCA 2M87A 4PDKA 2E1CA 3WTWC 3RYRA 2MD5A 1S7AA 2PQ8A 4U0YA 5L3EA 1W5TA 2YSRA 3IHUA 2BYVE 3GO5A 4Q5SF 1T98A 5D4RA 2VT3A 1TLHB 4ZYHA 2V1UA 3RIRA 4GXOA 4NQWA 4G9YA 5LLQA 2PEXA 3P9KA 4LFUA 1MDMA 4U0VA 4BXUA 5D5UB 5H6RA 3QP5A 2VN2A 2CFXA 3T5XA 3I54A 4YFKF 4XLPF 2COMA 3J80Z 1U2WA 1ON1A 4QWQA 1Z91A 1GXPA 3F8FA 5ILVA 1ZH5A 2KIFA 3WE2A 2VE9A 1MJBA 3KE2A 4JK1X 1RZ4A 3HRUA 2KJCA 3DFGA 2K27A 2FE3A 5LRSA 5D8KB 5CVVA 1K6OA 3IRQA 5BS6A 4GCVA 2BGCA 2P6SA 3K1NA 3GVAA 5BPIA 5BMZA 4HV6A 2PN6A 4L0YB 3DKWA 1F9NA 4ON0A 3WODF 1TTYA 4P96A 4H0EA 1CF7A 1PDNC 4A2UA 3NRVA 5FFZA 5IT9Z 2DK5A 4M6YA 3NEUA 4RAZA 1YTYA 4EJVA 2DBBA 2IW5A 3WTVC 1FC3A 4N0BA 2ZFWA 1ON2A 4WCGA 3TO7A 3L7WA 2WTEA 2OZUA 2QBYB 4OMYA 3RDIA 1ZHFA 3K9TA 4HF1A 4BQAA 4K2EA 1DPUA 3MCZA 1V3FA 4KYWA 1WQ2A 1UHMA 2OU2A 4MEYF 4BHBA 2MLKA 2FEZA 3KP2A 3J81K 3QOPA 3V7RA 2QQAA 2PLYA 1JHFA 3PQJA 4AIHA 1STZA 1GVJA 3ZPLA 4CDGA 5E1WA 5CVJA 2IP2A 2VBYA 1IN6A 3EQLF 2XAHA 2FXAA 1KU2A 4ESJA 4A12A 4RB3C 4IRIA 3S2WA 4A6EA 1I6XA 3WTXC 2D2WA 1BI0A 4ENMA 5FGMA 3KZZA 2VBWA 4OOIA 1PUEE 2VC0A 1IW7F 3I0TA 2E1NA 4RGUA 3LA7A 2XRNA 3I4PA 2QLZA 3KETA 2IJLA 2YR2A 4M72A 1ZRDA 3HIFA 1UHWA 4DNCA 2DU9A 1E17A 5LHHA 3BWGA 3E6CC 2JPCA 2DPDA 4EQQA 2GAUA 4KIFA 3CTAA 2VC1A 1ZREA 1E2XA 5BPDA 1G4DA 2BV6A 4L5JA 3E5QA 4NB5A 3HUGA 1O3SA 4OMZA 5F64A 4KA4A 4HAMA 4LK1F 1T39A 2LSOA 4BHCA 2IRFG 3E5UA 2LKPA 3VOEA 1ZLJA 2FQ3A 3BJAA 1U5TA 1IXCA 1MJAA 1T2KA 4HV5A 4KT5C 4DQ2A 1KU3A 5ICGA 3B02A 4P9UA 2H6BA 4ENKA 2NAZA 4MQVA 2A5YB 1JE8A 5K1YA 2GA1A 2O61A 5JI6A 2KIMA 3FWEA 3IWZA 5HS7A 1XSVA 5LEJA 2XVCA 5ERIA 5AIQA 4HW0A 3FMSA 3ML6A 4A6DA 2GWRA 2VOOA 4MGRA 4G8XA 2HKOA 3I53A 5F1RA 2R7DA 4EJOA 4UVCA 5K5QA 3T1BA 4EGYA 2QZ8A 2TDXA 3I58A 5BOXA 2L01A 2P8TA 3WGGA 3U9GA 2W84A 3GLXA 1SFXA 5LGNA 2HQNA 3N97A 1FBUA 1KQ9A 2X0LA 3IKVA 3BROA 4LMYA 5HDNA 4ZYEA 3BY6A 1CGPA 2HZTA 1ZN2A 3V8JA 3ABTA 1OYYA 3E6BA 3E3VA 3SHFA 3E6MA 3DPTA 3BZ6A 4ESFA 3B73A 3G3ZA 2OD5A 2VT2A 2UZKA 4U88A 3MWMA 1B59A 3DEUA 3Q5FA 1Z6RA 3FM5A 3QPHA 2LNBA 5A2QK 4OINF 2R7FA 1QGPA 1BC8C 1TNTA 5ED4A 3JSOA 1R7JA 2D1HA 3HRMA 1FBSA 1IN4A 3M8EA 5H6QA 4NHJA 5D5VB 3COAC 1OYIA 2CYYA 4AWXB 5EEHA 3ZQ7A 2L54A 3QRFF 1G3TA 1G3WA 5DUKA 2UXNA 3KP5A 1HSJA 3GZ5A 4HOBA 3BJ6A 1TBXA 4M71A 4R79A 2RV8A 3IKTA 1DPRA 2OAZA 1XGSA 2QYOA 3GEZA 1Q1HA 1R1UA 2VE8A 4M9XA 1QBJA 3LQQA 3HHGA 1FYLA 4G94A 3DP7A 3RKWA 2VODA 1HW1A 2F5CA 3J81Z 1MD0A 2EFWA 1MJ9A 4L18B 3F72A 1USTA 5CVIA 3NQOA 5DCMA 5HVQC 2DT5A 1ZRCA 3D0SA 2ELHA 1B6AA 4RB1A 2KIUA 2HYGD 3L09A 3WU0A 2FMYA 1D8JA 3VB2A 3ZMTA 2L4AA 4M9ZA 1LB2A 1LDDA 4AIKA 3I5UA 4ENJA 1WWXA 1S8NA 2LF8A 1YW9A 5F6FA 1SD5A 1YS7A 4CXFA 3T8TA 4L0ZB 3FHZA 4G7HF 4ZZDA 3RJPA 4HLXA 3P7NA 4B8XA 4OIPF 4OIOF 5E1XA 4GGGA 1R00A 1R22A 1BOAA 2FRHA 4XSZF 2K7LA 1XN7A 4YFNF 1T38A 1W7PA 1Z1DA 5L3DA 4U0WA 4I09A 3I64A 4WXDA 3H3UA 1FYKA 1FWZA 5AONA 1QZYA 2HEOA 2PBIA 3EYIA 1X3UA 2K02A 3GX4X 2FSWA 4WXCA 2EFOA 3KEQA 4LB6B 3HRTA 1ZG5A 3R0JA 2MC3A 4HDUA 2XAQA 2GA2A 3CUQB 3JTHA 3HHHA 2QBYA 4I7HA 4LG0B 1I5ZA 3LA2A 2A6EF 4KIGA 3I59B 1EH6A 2P6TA 5BQTA 2YPRA 3ECHA 4KMUX 4R1HA 3K1MA 3P9IA 3DV8A 3K0LA 4RAYA 3C1DA 2NNYA 1F4KA 2OZ6A 3GFLA 1JXSA 3W6JB 1ODDA 1SD7A 3BPVA 5HS8A 3MFKA 3VFZA 3MQ0A 3KP4A 1HKQA 3JSPA 1R5HA 2OA4A 4PGGA 5HLGA 4EJUA 4EJTA 2A07F 2J5PA 3HSFA 4I2OA 2GXGA 3RPQA 4BAYA 1SD4A 1EH7A 5DYMA 3EUHA 1XDUA 2IA1A 2M45A 2B0LA 2DK8A 4Y13A 4UV9A 3F8NA 3HOTA 3OV8A 4GYIA 3H92A 1K78B 1BI3A 1TQPA 2XKOA 2RQPA 1SFEA 1D5VA 3ZP5A 4KN4X 1QPMA 5ICEA 1C0WA 4ENNA 4KN7X 3C7JA 3QPTA 3CLOA 1U78A 3SZTA 1ZYRF 3HSRA 3DF8A 1TW2A 4ZZLA 5TRDA 1JGSA 1HW2A 4AVPA 2Z99A 1FX7A 4LLNA 1AOYA 3GZ6A 3FXRA 1HKTA 1KYWA 1KA8A 2IA2A 5HS9A 1YIOA 2GIVA 1IRGA 1HSTA 2RC4A 3F8BA 4M6XA 2IVMA 3T0YA 5EEGA 1XD7A 2FBIA 3EDPA 1XCVA 2FBHA 3FXQA 2VXZA 1IF1A 2MH9A 1Z6TA 2Z33A 3TKYA 2UWMA 5DV5A 5J6XA 4CO8A 4CGZA 4RGRA 2STWA 2DQLA 2QM3A 4IHTA 1P2FA 2JZYA 2G9WA 1K7AA 2DI3A 1QNTA 3FX3A 3KP6A 2Z9OA 1I1SA 1IXRC 1MDMB 4M73A 1BI1A 4HX8A 2F5FA 3L00A 2QQ9A 1R23A 1I1GA 4MHGA 4MTEA 2XAFA 3QU6A 5HDGA 1XSDA 1ULYA 3MZHA 2HKXA 1L3LA 3CUQC 3F8MA 4L5IA 4G7ZF 4CHUA 1IN5A 1T0FA 3WG9A 1FY7A 5H20A 3LQRA 2V9VA 3HSEA 3PFIA 2M5WA 4LD5A 4ZYGA 2G7UA 1D8KA 1L0OC 1KGSA 2DW4A 3H3ZA 5E17F 2W24A 2R3SA 4KIBA 4U7BA 4TV7A 2W85A 3RTRA 1ZLKA 2ZCWA 3F23A 5HLIA 4U7DA 2F2EA 1P4XA 5JFRA 2P5VA 4PCQA 1R5GA 4HX7A 3TDZC 2VBXA 3DXJF 4L9JA 1O3QA 2VONA 3M1EA 1XGOA 3I71A 1KQ0A 1B4AA 2UXXA 1O3TA 5FB2A 4G7OF 1O57A 2H6CA 1YG2A 5E8GA 1V4RA 3HTSB 2L02A 5D5WB 1BI2A 5E1ZB 2H27A 2VBZA 3ZN0A 1G6NA 1I27A 5K5OA 4OIQF 1LJ9A 5L3FA 3MAJA 1XGNA 3JAMK 1XMKA 4IRHA 1SMTA 2QENA 1ZRFA 3KEOA 3SZPA 4EM0B 2D45A 1P4AA 2PFBA 1RUOA 2EFPA 2JRTA 4UHTA 3LAPA 3GWZA 2EB7A 2EV5A 2OQRA 2P5LC 1EH8A 4IHSA 1RIOH 1FP1D 3F21A 4UXNA 1W5SA 1QQIA 2FNPA 2EV6A 1JHHA 3GYHX 3SFZA 2LDUA 1Y0UA 1U3EM 1KYZA 2ISYA 2YX7A 2O6GE 5LEKA 2RNJA 3SQNA 3CO7C 4O6JA 3TO9A 1BN5A 1ZG1A 3QAHA 4HLYA 4IXAA 3F3XA 3BPXA 1S29A 3KZYA 4I01A 1EV7A 1F1ZA 3C18A 1ZGAA 2XROA 1WRJA 3ZMVA 4FX0A 3LWFA 5LRRA 4GYGA 5LHGA 2ZMEB 4AD9A 5L3BA 4D0PA 4KFCA 2WWYA 4LB5A 1IAWA 5IT9K 1P4WA 2ZJ2A 4G6DA 4UVAA 5D6EA 2O8XA 3LFKA 1HBXG 4RB2C 4IF4A 4F7ZA 4I0BA 1LVAA 4A0YA 4WK8F 1OYWA 3ZN1A 2XV4S 1FP2A 2C6YA 1P92A 2XKPA 2ZBKA 3MEXA 4Y17A 1U6GA 4HF2A 2V79A 4LG0A 4LLLA 1FT9A 4UUVA 3CDHA 3U2RA 4CICA 5D6FA 2Y48A 2HDCA 3I59A 4R8HA 2DFIA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1J75 A;  2ZNZ A;  2ISZ A;  4KNY A;  1MKM A;  2E7W A;  3SXY A;  2DAO A;  4E70 A;  1B9M A;  1WKM A;  5CLS A;  2HGC A;  2Q0O A;  3R4K A;  4KIC A;  4IVN A;  6PAX A;  1OMI A;  3FF5 A;  2PMU A;  1AWC A;  3ZMD A;  2QWW A;  3FM3 A;  4M9S A;  2NRA C;  4BYY A;  2DLL A;  1SAX A;  3WGI A;  3PQK A;  1DP7 P;  1Z9C A;  2M30 A;  4XBF A;  3TO6 A;  2P5K A;  3TOB A;  3ROU A;  2W57 A;  1K78 A;  4FX4 A;  4XLN F;  5KVR A;  1HKS A;  3W6K B;  2ZNY A;  2IT0 A;  1WI9 A;  1SFU A;  1HW5 A;  1IRF A;  2P7C B;  5E18 F;  3OOP A;  1FOK A;  5CVR A;  3K69 A;  3V8L A;  1OPC A;  2EV0 A;  4OIR F;  2PMH A;  4WF2 A;  3VEP A;  3K2Z A;  2HS5 A;  2H94 A;  5FD6 A;  1R36 A;  4MEX F;  2LF7 A;  4N9H A;  4EM1 A;  2BBY A;  2CGP A;  4RGX A;  2NYX A;  3LST A;  3CO6 C;  2FOK A;  2Y75 A;  2F5E A;  3BJO A;  1YS6 A;  3O3K A;  2CW0 F;  2A6H F;  3GW2 A;  3GFM A;  5LHI A;  1RI7 A;  1FSE A;  5D8L B;  5DCF A;  2O03 A;  3V8K A;  4Q47 A;  2M8E A;  1YW8 A;  5DEQ A;  1GXQ A;  5JR3 A;  1BC7 C;  4QLC U;  2RGV A;  3JAM Z;  1W4M A;  2ZKZ A;  1YLF A;  4YG2 F;  2YX4 A;  4EM2 A;  2OQG A;  1K79 A;  1OKR A;  1ZAO A;  5JVT A;  2KJB A;  3DQV C;  3ECO A;  4RGS A;  5J8F A;  1PP8 F;  4XRF A;  2ETH A;  4YII A;  3G73 A;  3R61 A;  1XGM A;  5FLX K;  2QVO A;  1U5T C;  2V6C A;  4KMF A;  1IZ1 A;  2K86 A;  1ONV A;  1DDN A;  3RKX A;  4Q4Z F;  4PZJ A;  5FFX A;  2FBK A;  2XHK A;  2HQR A;  5E8I A;  2M1B A;  2JSC A;  3LA3 A;  4EMS A;  2XIG A;  4BHP A;  2ESN A;  2GQQ A;  1LNW A;  4P5O A;  2FA5 A;  3WU1 B;  5A2Q Z;  2EK5 A;  2FU4 A;  3M9A A;  4ASN A;  1W7P B;  5ILU A;  2ZXJ A;  2O3F A;  1ZGJ A;  1H0M A;  1Z7U A;  1J59 A;  2STT A;  1DUX C;  1KU9 A;  4I98 B;  3E6D A;  2EJR A;  3K1P A;  2Y0M A;  2P7V B;  2HR3 A;  4BH9 A;  3AAF A;  2EWN A;  1G3Y A;  4LGW A;  3U1D A;  3IWF A;  2XAJ A;  3D5L A;  4PGH A;  3FZV A;  1SD6 A;  2K4J A;  2HWV A;  3RYP A;  4HZF A;  1T6S A;  3KCC A;  2EFN A;  3O2P E;  3V7C A;  1F5T A;  4WX9 A;  3EYY A;  1YFH A;  4KDP A;  1QO0 D;  2NNN A;  3EET A;  5J8C A;  3L9F A;  2QQB A;  3F6O A;  1MGT A;  3JTG A;  2Q2E A;  4L9N A;  4HDV A;  1WSU A;  5CVU A;  3J7A O;  3ULQ B;  5FD5 A;  2BEO A;  1BM9 A;  3FMQ A;  5IT3 A;  2MH2 A;  1KQ8 A;  3IC7 A;  3WTT C;  1FYM A;  2WC2 A;  3KLO A;  4IPA A;  3F6V A;  1S6L A;  3L2C A;  1TQM A;  2E7X A;  1PP7 U;  1S3J A;  5ILS A;  2HFH A;  4M74 A;  1FNN A;  2X4H A;  2XAG A;  1R1V A;  2BE5 F;  3E5X A;  2HOE A;  2WV0 A;  4HQE A;  2DPU A;  2MBF A;  3CJN A;  1USS A;  2EA4 A;  3GUD A;  4MQ9 F;  3RKY A;  2QUF A;  2DQR A;  5E20 A;  1XCB A;  3ZMZ A;  1IN8 A;  1HQC A;  2HTS A;  5L3C A;  1YYV A;  4BNC A;  2OBP A;  4AIJ A;  5DUI A;  2CWE A;  2PG4 A;  4CYD A;  3C3W A;  3FMR A;  2AXL A;  1ZG3 A;  1CF7 B;  4MNU A;  1UCR A;  4ESB A;  4G6Q A;  5ICF A;  2ESH A;  4L9T A;  1LDJ A;  3BDD A;  2ZME A;  3R6S A;  1QZZ A;  4B09 A;  4Y15 A;  2EA2 A;  1D3Y A;  5ICC A;  4YFX F;  4EGZ A;  3IL2 A;  1MZB A;  3F8C A;  1UFM A;  2H09 A;  3MZY A;  5DDG A;  2IPQ X;  2K4B A;  1IXS B;  3ELK A;  1G3S A;  1R58 A;  2A61 A;  3VOD A;  2HTJ A;  1TW3 A;  2AS5 F;  4HYE A;  5D4S A;  5CYV A;  4A5N A;  5LGU A;  1A04 A;  2P4W A;  2MA3 A;  4Z2Y A;  3WTS C;  2YU3 A;  1FSH A;  1J5Y A;  1S7O A;  4RS8 A;  3JW4 A;  4IJA A;  1XMA A;  4HQM A;  2RKH A;  3REO A;  5DD8 A;  3ERE D;  2KKO A;  1W7P D;  2O0Y A;  2CG4 A;  5AIP A;  4ZYD A;  1IUY A;  1RNL A;  3KFW X;  1TNS A;  5FLX Z;  2FF4 A;  2VOP A;  2DTR A;  5D5X B;  2A69 F;  1R1T A;  2JTV A;  4FT8 A;  4L9V A;  5HOO A;  1FBQ A;  5HDK A;  5K5R A;  1UB9 A;  3J80 K;  5HLH A;  3LAJ A;  4ZH4 F;  3DPL C;  1IN7 A;  2V1X A;  1XSX A;  1FZP B;  1J2X A;  1B9N A;  1REP C;  2J5O A;  2W25 A;  1J0R A;  4UNO A;  4JQF A;  3FXU A;  4O5V A;  3HTU A;  2FNA A;  1Z05 A;  3R0A A;  4O3M A;  4N9I A;  1B1B A;  4A0Z A;  4P55 A;  4LJZ F;  3ZMU A;  4LK0 F;  3ZMS A;  3TQN A;  3V7S A;  1RUN A;  2L3D A;  3TDU C;  3Q9S A;  1U5T B;  2A68 F;  1YW7 A;  3N4M A;  4HBL A;  5LBQ A;  4GO1 A;  3E97 A;  3F22 A;  1J9I A;  3WE3 A;  2V1D A;  1NHA A;  4S05 A;  5KK1 A;  2RDP A;  5DD4 A;  3BOQ A;  3P9C A;  3R60 A;  2EFQ A;  1BBY A;  3KP3 A;  3GFJ A;  3CUQ A;  2L4M A;  3HOS A;  3HRS A;  1LEB A;  4RB0 A;  3BP8 A;  1LEA A;  2XAS A;  3QU3 A;  4S04 A;  1BJA A;  4I02 A;  5LGT A;  2IA0 A;  5L3G A;  3IRR A;  5CJ9 A;  1TQI A;  3ISP A;  3WGH A;  3KP7 A;  1H9T A;  2GZW A;  4UVB A;  3HYI A;  3RI4 A;  1FLI A;  4LLG F;  2F5D A;  1KU7 A;  1LDK B;  4EV0 A;  1LQ1 A;  3O6B B;  1BIA A;  2MLG A;  4A0X A;  4XSX F;  3T8R A;  2CQK A;  2Z5U A;  3WTZ A;  3V4G A;  4P9F A;  1YQA A;  2XGX A;  2Q8K A;  2XUB A;  4Q48 A;  2JPB A;  4IRG A;  3M7G A;  3ABU A;  3Q9V A;  3GXO A;  1BIB A;  4WXH A;  1YO5 C;  1VTN C;  3GFI A;  1O7F A;  5FO5 A;  1FPQ A;  2G7H A;  2Z3Y A;  3GF2 A;  3TGN A;  5TJJ A;  2GXB A;  4JBA A;  2ZO4 A;  3QP6 A;  1XB4 A;  2NS0 A;  4HX4 A;  2PJP A;  1H9G A;  1O7L A;  1SMY F;  3WTY C;  4HF0 A;  2ADU A;  1O3R A;  3RPU A;  4A5M A;  4KUM A;  3TOA A;  4CZZ A;  2CSO A;  5JHU A;  3M8F A;  2PI0 A;  1P6R A;  1J7K A;  2DO7 A;  2RN7 A;  4EVI A;  2ACJ A;  1ZAR A;  2A3S A;  2CO5 A;  4YIF A;  2JT1 A;  2D1V A;  4OU0 A;  4MTD A;  2RVC A;  1OR7 A;  2KRF A;  3KLN A;  4UV8 A;  4EJW A;  3WTU C;  2HYF A;  4FHT A;  1U8R A;  1GHC A;  1HXD A;  3CUO A;  4ETS A;  4I0A A;  1XDS A;  5DCM B;  4HA8 A;  2FML A;  4WWC A;  2M87 A;  4PDK A;  2E1C A;  3WTW C;  3RYR A;  2MD5 A;  1S7A A;  2PQ8 A;  4U0Y A;  5L3E A;  1W5T A;  2YSR A;  3IHU A;  2BYV E;  3GO5 A;  4Q5S F;  1T98 A;  5D4R A;  2VT3 A;  1TLH B;  4ZYH A;  2V1U A;  3RIR A;  4GXO A;  4NQW A;  4G9Y A;  5LLQ A;  2PEX A;  3P9K A;  4LFU A;  1MDM A;  4U0V A;  4BXU A;  5D5U B;  5H6R A;  3QP5 A;  2VN2 A;  2CFX A;  3T5X A;  3I54 A;  4YFK F;  4XLP F;  2COM A;  3J80 Z;  1U2W A;  1ON1 A;  4QWQ A;  1Z91 A;  1GXP A;  3F8F A;  5ILV A;  1ZH5 A;  2KIF A;  3WE2 A;  2VE9 A;  1MJB A;  3KE2 A;  4JK1 X;  1RZ4 A;  3HRU A;  2KJC A;  3DFG A;  2K27 A;  2FE3 A;  5LRS A;  5D8K B;  5CVV A;  1K6O A;  3IRQ A;  5BS6 A;  4GCV A;  2BGC A;  2P6S A;  3K1N A;  3GVA A;  5BPI A;  5BMZ A;  4HV6 A;  2PN6 A;  4L0Y B;  3DKW A;  1F9N A;  4ON0 A;  3WOD F;  1TTY A;  4P96 A;  4H0E A;  1CF7 A;  1PDN C;  4A2U A;  3NRV A;  5FFZ A;  5IT9 Z;  2DK5 A;  4M6Y A;  3NEU A;  4RAZ A;  1YTY A;  4EJV A;  2DBB A;  2IW5 A;  3WTV C;  1FC3 A;  4N0B A;  2ZFW A;  1ON2 A;  4WCG A;  3TO7 A;  3L7W A;  2WTE A;  2OZU A;  2QBY B;  4OMY A;  3RDI A;  1ZHF A;  3K9T A;  4HF1 A;  4BQA A;  4K2E A;  1DPU A;  3MCZ A;  1V3F A;  4KYW A;  1WQ2 A;  1UHM A;  2OU2 A;  4MEY F;  4BHB A;  2MLK A;  2FEZ A;  3KP2 A;  3J81 K;  3QOP A;  3V7R A;  2QQA A;  2PLY A;  1JHF A;  3PQJ A;  4AIH A;  1STZ A;  1GVJ A;  3ZPL A;  4CDG A;  5E1W A;  5CVJ A;  2IP2 A;  2VBY A;  1IN6 A;  3EQL F;  2XAH A;  2FXA A;  1KU2 A;  4ESJ A;  4A12 A;  4RB3 C;  4IRI A;  3S2W A;  4A6E A;  1I6X A;  3WTX C;  2D2W A;  1BI0 A;  4ENM A;  5FGM A;  3KZZ A;  2VBW A;  4OOI A;  1PUE E;  2VC0 A;  1IW7 F;  3I0T A;  2E1N A;  4RGU A;  3LA7 A;  2XRN A;  3I4P A;  2QLZ A;  3KET A;  2IJL A;  2YR2 A;  4M72 A;  1ZRD A;  3HIF A;  1UHW A;  4DNC A;  2DU9 A;  1E17 A;  5LHH A;  3BWG A;  3E6C C;  2JPC A;  2DPD A;  4EQQ A;  2GAU A;  4KIF A;  3CTA A;  2VC1 A;  1ZRE A;  1E2X A;  5BPD A;  1G4D A;  2BV6 A;  4L5J A;  3E5Q A;  4NB5 A;  3HUG A;  1O3S A;  4OMZ A;  5F64 A;  4KA4 A;  4HAM A;  4LK1 F;  1T39 A;  2LSO A;  4BHC A;  2IRF G;  3E5U A;  2LKP A;  3VOE A;  1ZLJ A;  2FQ3 A;  3BJA A;  1U5T A;  1IXC A;  1MJA A;  1T2K A;  4HV5 A;  4KT5 C;  4DQ2 A;  1KU3 A;  5ICG A;  3B02 A;  4P9U A;  2H6B A;  4ENK A;  2NAZ A;  4MQV A;  2A5Y B;  1JE8 A;  5K1Y A;  2GA1 A;  2O61 A;  5JI6 A;  2KIM A;  3FWE A;  3IWZ A;  5HS7 A;  1XSV A;  5LEJ A;  2XVC A;  5ERI A;  5AIQ A;  4HW0 A;  3FMS A;  3ML6 A;  4A6D A;  2GWR A;  2VOO A;  4MGR A;  4G8X A;  2HKO A;  3I53 A;  5F1R A;  2R7D A;  4EJO A;  4UVC A;  5K5Q A;  3T1B A;  4EGY A;  2QZ8 A;  2TDX A;  3I58 A;  5BOX A;  2L01 A;  2P8T A;  3WGG A;  3U9G A;  2W84 A;  3GLX A;  1SFX A;  5LGN A;  2HQN A;  3N97 A;  1FBU A;  1KQ9 A;  2X0L A;  3IKV A;  3BRO A;  4LMY A;  5HDN A;  4ZYE A;  3BY6 A;  1CGP A;  2HZT A;  1ZN2 A;  3V8J A;  3ABT A;  1OYY A;  3E6B A;  3E3V A;  3SHF A;  3E6M A;  3DPT A;  3BZ6 A;  4ESF A;  3B73 A;  3G3Z A;  2OD5 A;  2VT2 A;  2UZK A;  4U88 A;  3MWM A;  1B59 A;  3DEU A;  3Q5F A;  1Z6R A;  3FM5 A;  3QPH A;  2LNB A;  5A2Q K;  4OIN F;  2R7F A;  1QGP A;  1BC8 C;  1TNT A;  5ED4 A;  3JSO A;  1R7J A;  2D1H A;  3HRM A;  1FBS A;  1IN4 A;  3M8E A;  5H6Q A;  4NHJ A;  5D5V B;  3COA C;  1OYI A;  2CYY A;  4AWX B;  5EEH A;  3ZQ7 A;  2L54 A;  3QRF F;  1G3T A;  1G3W A;  5DUK A;  2UXN A;  3KP5 A;  1HSJ A;  3GZ5 A;  4HOB A;  3BJ6 A;  1TBX A;  4M71 A;  4R79 A;  2RV8 A;  3IKT A;  1DPR A;  2OAZ A;  1XGS A;  2QYO A;  3GEZ A;  1Q1H A;  1R1U A;  2VE8 A;  4M9X A;  1QBJ A;  3LQQ A;  3HHG A;  1FYL A;  4G94 A;  3DP7 A;  3RKW A;  2VOD A;  1HW1 A;  2F5C A;  3J81 Z;  1MD0 A;  2EFW A;  1MJ9 A;  4L18 B;  3F72 A;  1UST A;  5CVI A;  3NQO A;  5DCM A;  5HVQ C;  2DT5 A;  1ZRC A;  3D0S A;  2ELH A;  1B6A A;  4RB1 A;  2KIU A;  2HYG D;  3L09 A;  3WU0 A;  2FMY A;  1D8J A;  3VB2 A;  3ZMT A;  2L4A A;  4M9Z A;  1LB2 A;  1LDD A;  4AIK A;  3I5U A;  4ENJ A;  1WWX A;  1S8N A;  2LF8 A;  1YW9 A;  5F6F A;  1SD5 A;  1YS7 A;  4CXF A;  3T8T A;  4L0Z B;  3FHZ A;  4G7H F;  4ZZD A;  3RJP A;  4HLX A;  3P7N A;  4B8X A;  4OIP F;  4OIO F;  5E1X A;  4GGG A;  1R00 A;  1R22 A;  1BOA A;  2FRH A;  4XSZ F;  2K7L A;  1XN7 A;  4YFN F;  1T38 A;  1W7P A;  1Z1D A;  5L3D A;  4U0W A;  4I09 A;  3I64 A;  4WXD A;  3H3U A;  1FYK A;  1FWZ A;  5AON A;  1QZY A;  2HEO A;  2PBI A;  3EYI A;  1X3U A;  2K02 A;  3GX4 X;  2FSW A;  4WXC A;  2EFO A;  3KEQ A;  4LB6 B;  3HRT A;  1ZG5 A;  3R0J A;  2MC3 A;  4HDU A;  2XAQ A;  2GA2 A;  3CUQ B;  3JTH A;  3HHH A;  2QBY A;  4I7H A;  4LG0 B;  1I5Z A;  3LA2 A;  2A6E F;  4KIG A;  3I59 B;  1EH6 A;  2P6T A;  5BQT A;  2YPR A;  3ECH A;  4KMU X;  4R1H A;  3K1M A;  3P9I A;  3DV8 A;  3K0L A;  4RAY A;  3C1D A;  2NNY A;  1F4K A;  2OZ6 A;  3GFL A;  1JXS A;  3W6J B;  1ODD A;  1SD7 A;  3BPV A;  5HS8 A;  3MFK A;  3VFZ A;  3MQ0 A;  3KP4 A;  1HKQ A;  3JSP A;  1R5H A;  2OA4 A;  4PGG A;  5HLG A;  4EJU A;  4EJT A;  2A07 F;  2J5P A;  3HSF A;  4I2O A;  2GXG A;  3RPQ A;  4BAY A;  1SD4 A;  1EH7 A;  5DYM A;  3EUH A;  1XDU A;  2IA1 A;  2M45 A;  2B0L A;  2DK8 A;  4Y13 A;  4UV9 A;  3F8N A;  3HOT A;  3OV8 A;  4GYI A;  3H92 A;  1K78 B;  1BI3 A;  1TQP A;  2XKO A;  2RQP A;  1SFE A;  1D5V A;  3ZP5 A;  4KN4 X;  1QPM A;  5ICE A;  1C0W A;  4ENN A;  4KN7 X;  3C7J A;  3QPT A;  3CLO A;  1U78 A;  3SZT A;  1ZYR F;  3HSR A;  3DF8 A;  1TW2 A;  4ZZL A;  5TRD A;  1JGS A;  1HW2 A;  4AVP A;  2Z99 A;  1FX7 A;  4LLN A;  1AOY A;  3GZ6 A;  3FXR A;  1HKT A;  1KYW A;  1KA8 A;  2IA2 A;  5HS9 A;  1YIO A;  2GIV A;  1IRG A;  1HST A;  2RC4 A;  3F8B A;  4M6X A;  2IVM A;  3T0Y A;  5EEG A;  1XD7 A;  2FBI A;  3EDP A;  1XCV A;  2FBH A;  3FXQ A;  2VXZ A;  1IF1 A;  2MH9 A;  1Z6T A;  2Z33 A;  3TKY A;  2UWM A;  5DV5 A;  5J6X A;  4CO8 A;  4CGZ A;  4RGR A;  2STW A;  2DQL A;  2QM3 A;  4IHT A;  1P2F A;  2JZY A;  2G9W A;  1K7A A;  2DI3 A;  1QNT A;  3FX3 A;  3KP6 A;  2Z9O A;  1I1S A;  1IXR C;  1MDM B;  4M73 A;  1BI1 A;  4HX8 A;  2F5F A;  3L00 A;  2QQ9 A;  1R23 A;  1I1G A;  4MHG A;  4MTE A;  2XAF A;  3QU6 A;  5HDG A;  1XSD A;  1ULY A;  3MZH A;  2HKX A;  1L3L A;  3CUQ C;  3F8M A;  4L5I A;  4G7Z F;  4CHU A;  1IN5 A;  1T0F A;  3WG9 A;  1FY7 A;  5H20 A;  3LQR A;  2V9V A;  3HSE A;  3PFI A;  2M5W A;  4LD5 A;  4ZYG A;  2G7U A;  1D8K A;  1L0O C;  1KGS A;  2DW4 A;  3H3Z A;  5E17 F;  2W24 A;  2R3S A;  4KIB A;  4U7B A;  4TV7 A;  2W85 A;  3RTR A;  1ZLK A;  2ZCW A;  3F23 A;  5HLI A;  4U7D A;  2F2E A;  1P4X A;  5JFR A;  2P5V A;  4PCQ A;  1R5G A;  4HX7 A;  3TDZ C;  2VBX A;  3DXJ F;  4L9J A;  1O3Q A;  2VON A;  3M1E A;  1XGO A;  3I71 A;  1KQ0 A;  1B4A A;  2UXX A;  1O3T A;  5FB2 A;  4G7O F;  1O57 A;  2H6C A;  1YG2 A;  5E8G A;  1V4R A;  3HTS B;  2L02 A;  5D5W B;  1BI2 A;  5E1Z B;  2H27 A;  2VBZ A;  3ZN0 A;  1G6N A;  1I27 A;  5K5O A;  4OIQ F;  1LJ9 A;  5L3F A;  3MAJ A;  1XGN A;  3JAM K;  1XMK A;  4IRH A;  1SMT A;  2QEN A;  1ZRF A;  3KEO A;  3SZP A;  4EM0 B;  2D45 A;  1P4A A;  2PFB A;  1RUO A;  2EFP A;  2JRT A;  4UHT A;  3LAP A;  3GWZ A;  2EB7 A;  2EV5 A;  2OQR A;  2P5L C;  1EH8 A;  4IHS A;  1RIO H;  1FP1 D;  3F21 A;  4UXN A;  1W5S A;  1QQI A;  2FNP A;  2EV6 A;  1JHH A;  3GYH X;  3SFZ A;  2LDU A;  1Y0U A;  1U3E M;  1KYZ A;  2ISY A;  2YX7 A;  2O6G E;  5LEK A;  2RNJ A;  3SQN A;  3CO7 C;  4O6J A;  3TO9 A;  1BN5 A;  1ZG1 A;  3QAH A;  4HLY A;  4IXA A;  3F3X A;  3BPX A;  1S29 A;  3KZY A;  4I01 A;  1EV7 A;  1F1Z A;  3C18 A;  1ZGA A;  2XRO A;  1WRJ A;  3ZMV A;  4FX0 A;  3LWF A;  5LRR A;  4GYG A;  5LHG A;  2ZME B;  4AD9 A;  5L3B A;  4D0P A;  4KFC A;  2WWY A;  4LB5 A;  1IAW A;  5IT9 K;  1P4W A;  2ZJ2 A;  4G6D A;  4UVA A;  5D6E A;  2O8X A;  3LFK A;  1HBX G;  4RB2 C;  4IF4 A;  4F7Z A;  4I0B A;  1LVA A;  4A0Y A;  4WK8 F;  1OYW A;  3ZN1 A;  2XV4 S;  1FP2 A;  2C6Y A;  1P92 A;  2XKP A;  2ZBK A;  3MEX A;  4Y17 A;  1U6G A;  4HF2 A;  2V79 A;  4LG0 A;  4LLL A;  1FT9 A;  4UUV A;  3CDH A;  3U2R A;  4CIC A;  5D6F A;  2Y48 A;  2HDC A;  3I59 A;  4R8H A;  2DFI A; 
#chains in the Genus database with same CATH topology
 1U9N A;  2OCC H;  1J75 A;  2KPM A;  2ZNZ A;  2ISZ A;  4B1R A;  4KNY A;  4AM3 A;  1ETX A;  1MKM A;  2E7W A;  3SXY A;  2DAO A;  5J47 A;  3K7A J;  2HOS A;  2R92 J;  4E70 A;  1B9M A;  5M3F J;  4CSW A;  1WKM A;  5CLS A;  2HGC A;  1Y1V J;  2Q0O A;  3R4K A;  2IS2 A;  4BU2 A;  4FE4 A;  4KIC A;  1QHG A;  5IYC J;  1S5L C;  4IVN A;  4CCN A;  6PAX A;  1OMI A;  3LSG A;  3FF5 A;  2PMU A;  1AWC A;  2XSJ C;  2HNH A;  1ETQ A;  2LY2 A;  3ZMD A;  2QWW A;  3C2G A;  3FM3 A;  4M9S A;  2NRA C;  4BYY A;  2DLL A;  1SAX A;  2ZJQ F;  3H9J A;  2XB5 A;  3WGI A;  3PQK A;  1DP7 P;  2CFO A;  1Z9C A;  2M30 A;  4ZDL A;  4XBF A;  1I6H J;  2K9S A;  3TO6 A;  3WG7 H;  4BGD A;  4IHW A;  2P5K A;  1VQM I;  3TOB A;  2Y9Z A;  3ROU A;  3M3Y J;  2W57 A;  3KIO A;  1NG6 A;  2JK3 A;  1ZR2 A;  4FX4 A;  1K78 A;  2H8W A;  2L9S A;  4XLN F;  2L9V A;  5KVR A;  3JRE A;  1HKS A;  3W6K B;  2ZNY A;  2LP0 A;  3BZC A;  2M7A A;  3G2B A;  2IT0 A;  3RQI A;  1WI9 A;  2CH0 A;  2HVQ A;  3CD6 I;  1SFU A;  1HW5 A;  1IRF A;  2P7C B;  2X1E A;  5E18 F;  3OOP A;  4CCO A;  4BEH B;  1FOK A;  5CVR A;  3K69 A;  2IGO A;  2K9L A;  3V8L A;  2DA6 A;  1OPC A;  2DA1 A;  2EV0 A;  2QCO A;  3HM5 A;  3NAR A;  4OIR F;  2DXI A;  1SAN A;  1JT6 A;  2W82 A;  4JX4 A;  1UHS A;  2PMH A;  3OYG A;  2CU7 A;  4AYB A;  2DOD A;  4OAZ A;  5M5W J;  4WF2 A;  2Y0S N;  3EUA A;  3VEP A;  3K2Z A;  2HS5 A;  2I5U A;  4RAF A;  3VPR A;  2H94 A;  3H5A A;  4X1E A;  5FD6 A;  1R36 A;  4MEX F;  2LF7 A;  4N9H A;  4EM1 A;  1ZTR A;  2CV1 A;  2BBY A;  2CGP A;  2IAI A;  4RGX A;  2L0K A;  4PSW A;  1OCC H;  2X1C A;  4D5C A;  2NYX A;  3LST A;  2M4K A;  3CO6 C;  3TL4 X;  4UB8 C;  2FOK A;  2Y75 A;  3K4L A;  2F5E A;  2Z1D A;  3BJO A;  3GME A;  1YS6 A;  1WJC A;  3O3K A;  2JA2 A;  3CF5 F;  2CW0 F;  2A6H F;  2PMZ A;  3GW2 A;  3BR5 A;  5JLX A;  3GFM A;  2DOF A;  5LHI A;  1G59 A;  3CCS I;  1RI7 A;  2PX9 A;  4NC8 A;  1JGG A;  1FSE A;  1X4O A;  2BHY A;  5D8L B;  5DCF A;  2O03 A;  3V8K A;  4J00 A;  3FKI J;  2EZL A;  3K6G A;  4Q47 A;  1FIA A;  2M8E A;  4A3E J;  1YW8 A;  5DEQ A;  1GXQ A;  5JR3 A;  1AA7 A;  1R6R A;  2JUC A;  1BC7 C;  1B8I A;  2DT7 B;  2M0C A;  2RGV A;  3JAM Z;  4QLC U;  1W4M A;  2ZKZ A;  1YLF A;  5GAG J;  4YG2 F;  3S3N A;  2YX4 A;  3BLY A;  4EM2 A;  2Y31 A;  2VQG A;  2OQG A;  2V9P A;  1SVO A;  1K79 A;  3KPH A;  4Y33 A;  5KNL A;  1OKR A;  3OOU A;  1ZAO A;  2ZC2 A;  5JVT A;  3CDI A;  2KJB A;  3DQV C;  3ECO A;  4RGS A;  5J8F A;  1PP8 F;  2R7O A;  4XRF A;  2ETH A;  2O9L A;  4YII A;  4D7M A;  5F04 A;  3R61 A;  3G73 A;  5DS9 A;  3CDL A;  1XGM A;  3L2R A;  5FLX K;  3Q0V A;  2QVO A;  1U5T C;  2V6C A;  4KMF A;  1IZ1 A;  2K86 A;  3OYK A;  1VQ9 I;  1ONV A;  4G12 A;  4A3C J;  2P81 A;  1DDN A;  2HZD A;  5FLM J;  2LMD A;  5EG0 B;  3PO3 J;  3RKX A;  4XRS A;  4Q4Z F;  4PZJ A;  2RNG A;  1QU3 A;  1FIP A;  5FFX A;  2AQE A;  2FBK A;  4DGW B;  1VF9 A;  2RAE A;  2XHK A;  2HQR A;  5E8I A;  4I6Z A;  4C2U A;  2M1B A;  1X1C A;  3Q0U A;  1UMQ A;  2JSC A;  4DYR A;  3LA3 A;  4EMS A;  2XIG A;  4BHP A;  2ESN A;  4LIV A;  2GQQ A;  1LNW A;  1E0E A;  4FTH A;  2WAD A;  4P5O A;  2IBD A;  5B5E C;  5GTH C;  2FA5 A;  1KZH A;  1GDT A;  3A0B C;  1FMV A;  1VFC A;  1W36 D;  3OYA A;  2E1M C;  3WU1 B;  4HNV A;  5A2Q Z;  2EK5 A;  2FU4 A;  1W5C C;  3M9A A;  4ASN A;  3K2A A;  1BR2 A;  1WJ5 A;  2V7F A;  4QPO A;  5TGT A;  3SFI A;  3S17 J;  1W7P B;  5ILU A;  2ZXJ A;  5J3L A;  4BBR J;  2O3F A;  1ZGJ A;  2VXD A;  1MMA A;  2AQF A;  1H0M A;  1Z7U A;  1J59 A;  1Y56 A;  1HDP A;  2STT A;  1DUX C;  1RRJ A;  3VYR B;  1YIT I;  4XID A;  1KU9 A;  4I98 B;  4LOC A;  3E6D A;  2DTZ A;  1TP4 A;  2EJR A;  3K1P A;  3P5J A;  2VJ5 A;  2Y0M A;  3PUB A;  3PSI A;  3QOD A;  2P7V B;  2Z16 A;  2HR3 A;  2EIN H;  4BH9 A;  3DLL F;  3AAF A;  3PUF A;  2EWN A;  1OCO H;  1A5J A;  2VKV A;  1G3Y A;  4LGW A;  2QSF X;  3AG2 H;  3U1D A;  3JRH A;  3IWF A;  1AU7 A;  2XAJ A;  1KON A;  3BR1 A;  3D5L A;  4PGH A;  3FZV A;  1SD6 A;  2K4J A;  2HWV A;  2R93 J;  3RYP A;  4HZF A;  1N78 A;  1T6S A;  1VI0 A;  2OF7 A;  3IP4 B;  4XL9 A;  3K10 A;  3KCC A;  2EFN A;  2VQH A;  2DYR H;  1LE8 B;  5K7F A;  4JX6 A;  3O2P E;  3V7C A;  1F5T A;  4F3Q A;  4WX9 A;  3EYY A;  3S3M A;  2R7Z J;  3CP8 A;  3A1Y A;  1YFH A;  1GT0 C;  4KDP A;  1QO0 D;  2FJ1 A;  2LBF A;  3ZQQ A;  2L9N A;  3JRD A;  2M9H A;  4MFE A;  2NNN A;  3DTK A;  3EET A;  2KMU A;  3L9F A;  2QQB A;  2L5Q A;  4M3F A;  5J8C A;  3F6O A;  2RRE A;  1WI3 A;  1MGT A;  2NXN B;  2XPV A;  3JTG A;  2Q2E A;  3OYL A;  1MNE A;  4L9N A;  4HDV A;  1WSU A;  5CVU A;  3J7A O;  3ULQ B;  5FD5 A;  2GLO A;  2BEO A;  1BM9 A;  1IDZ A;  5C4X J;  3FMQ A;  5IT3 A;  2MH2 A;  1KQ8 A;  4NQW B;  5E3O A;  3IC7 A;  3WTT C;  1FYM A;  2LOO A;  3A01 B;  2WC2 A;  3KLO A;  3OYM A;  3PIO F;  2EZK A;  4IPA A;  3F6V A;  2Y69 H;  2E1O A;  1S6L A;  2UUZ A;  2X51 A;  1FJL A;  3ABL H;  3CCL I;  1WH7 A;  3L2C A;  1TQM A;  2DT6 A;  2E7X A;  2H8R A;  1PP7 U;  2HVS A;  4C2M J;  1S3J A;  1GLN A;  3A03 A;  5ILS A;  2HFH A;  2NVQ J;  4IL6 C;  4M74 A;  5FJ8 J;  1R4N B;  1FNN A;  2X4H A;  2XAG A;  1R1V A;  2BE5 F;  3ZQL A;  3E5X A;  2HOE A;  5J4V A;  5B3S H;  2WV0 A;  2LKS A;  3BTC A;  4HQE A;  2DPU A;  2LYC A;  2XF7 A;  2MBF A;  4KT6 A;  3CJN A;  3OMY A;  2K5C A;  2XGD A;  1USS A;  3QPL A;  2EA4 A;  2EPF A;  3GUD A;  2DMP A;  4ITV A;  4EAT A;  4MQ9 F;  3RKY A;  2DMQ A;  2HOT A;  2QUF A;  4XMY A;  1SVM A;  2DQR A;  5E20 A;  1JKO C;  1XCB A;  4DYC A;  3ZMZ A;  1TWG J;  1IN8 A;  1CQT A;  3H0D A;  1HQC A;  4I99 C;  3FK7 A;  2HTS A;  5L3C A;  1YYV A;  5JHF A;  2V6E A;  2X6W A;  1XTA A;  2JJ7 A;  4BNC A;  4YRV A;  3DLA A;  2OBP A;  4AIJ A;  3AL0 C;  4FQG A;  5DUI A;  3OS0 A;  2CWE A;  2PG4 A;  4CYD A;  3C3W A;  3FMR A;  1UZC A;  2AXL A;  2PJR A;  1ZG3 A;  1CF7 B;  2DFH A;  4GDF A;  2R7R A;  4MNU A;  1UCR A;  3FIS A;  4ESB A;  4G6Q A;  5ICF A;  2ESH A;  4L9T A;  2OC6 A;  2F4I A;  1LDJ A;  2UV1 A;  2LTP A;  3BDD A;  2HDD A;  2ZME A;  3R6S A;  1YOV B;  1AKH B;  2JA6 J;  1QZZ A;  1WVR A;  4B09 A;  5C4J J;  2FQ4 A;  2HU9 A;  4Y15 A;  2EA2 A;  3L2Q A;  4FCY A;  1D3Y A;  4BQO A;  3OL4 A;  5ICC A;  4D9J A;  4YFX F;  4EGZ A;  1PUF A;  3GBG A;  3IL2 A;  1MZB A;  2MC4 A;  3F8C A;  2JA5 J;  4UUS B;  1UFM A;  2H09 A;  3F9K A;  3MZY A;  5DDG A;  3CF2 A;  3H0G J;  5DM6 F;  2R5Y A;  2CV2 A;  4NC7 A;  5E79 C;  4FAS D;  3LSM A;  2LRE A;  1XPX A;  2HPI A;  1BR4 A;  3OYN A;  2CQN A;  2IPQ X;  4F93 B;  2K4B A;  1IXS B;  3ELK A;  1G3S A;  4AYB N;  2R7W A;  1R58 A;  2A61 A;  3VOD A;  1VQN I;  1G8X A;  2ECB A;  2HTJ A;  3PJR A;  1K4S A;  1TW3 A;  1I3Q J;  2LH9 A;  2AS5 F;  4HYE A;  3H3V K;  5D4S A;  5CYV A;  4A5N A;  2Y2Z A;  3O8G A;  5LGU A;  1A04 A;  4QPQ A;  2P4W A;  4E7L A;  2MA3 A;  4Z2Y A;  1ETY A;  3CC4 I;  2YU3 A;  3WTS C;  1FSH A;  1J5Y A;  1S7O A;  4RS8 A;  2MD0 A;  3JW4 A;  1MMS A;  4IJA A;  2DJN A;  1XMA A;  4HQM A;  1XC5 A;  4A3B J;  2RKH A;  3REO A;  5DD8 A;  3S32 A;  3H35 A;  4HST A;  2NVX J;  3ERE D;  2KKO A;  2BW3 A;  1W7P D;  2PMZ N;  2O0Y A;  1MSF C;  1JT0 A;  3LSR A;  3S15 J;  2CG4 A;  1V55 H;  3RZD J;  5AIP A;  4ZYD A;  1IUY A;  4D5F A;  3HOX J;  1ZK8 A;  3MMY B;  2IEK A;  3RPU D;  1OCP A;  1RNL A;  3KFW X;  1K61 A;  1TNS A;  2XF6 A;  5FLX Z;  2FF4 A;  2VOP A;  2DTR A;  5D5X B;  2A69 F;  1O4X A;  1R1T A;  4LG3 A;  3FIW A;  1QZE A;  2JTV A;  4FT8 A;  2JVG A;  4L9V A;  1ORK A;  1MMG A;  5HOO A;  2HVR A;  4C9Y A;  1FBQ A;  3LOC A;  2IS6 A;  4CYC A;  5HDK A;  5K5R A;  3HG9 A;  1N75 A;  2OUM A;  4FIS A;  3JR9 A;  1UB9 A;  3J80 K;  1I39 A;  4BQQ A;  5HLH A;  1BW6 A;  3LAJ A;  4ZH4 F;  3JRC A;  3G1L A;  1E3P A;  5IP7 J;  3DPL C;  3ZQH A;  2E5N A;  2NVU B;  1IN7 A;  2V1X A;  2F4O B;  1XSX A;  2OV7 A;  3IH3 A;  1FZP B;  1J2X A;  1B9N A;  3A02 A;  5LD2 C;  4RLQ A;  1REP C;  2J5O A;  4XOT A;  1G2H A;  2W25 A;  5CKT A;  1J0R A;  3DKX A;  4UNO A;  4JQF A;  5HNF A;  3FXU A;  4O5V A;  3HTU A;  5M5Y J;  2FNA A;  4YEL A;  3WHB A;  1Z05 A;  3DTI A;  1JTY A;  3HUG B;  3MD2 A;  3R0A A;  4XKC A;  4O3M A;  4AUX A;  2KHM A;  4N9I A;  1B1B A;  1VZ0 A;  1D1B A;  4A0Z A;  2VKE A;  4BEH A;  4P55 A;  2O7O A;  4LJZ F;  3ZMU A;  4LK0 F;  2XGC A;  4A3M J;  3I3L A;  4QSH A;  3WHC A;  1OLT A;  1YRN B;  3ZMS A;  3TBI A;  1YI2 I;  3TQN A;  1WHU A;  3V7S A;  1RUN A;  2L3D A;  3EPZ A;  3TDU C;  3K4B A;  3Q9S A;  1U5T B;  2X6X A;  2A68 F;  1YW7 A;  3N4M A;  5H2F C;  4HBL A;  1X1B A;  3LSH A;  1Z3Y A;  5LBQ A;  4A3L J;  2K3P A;  2KQR A;  4IOC F;  2JVH A;  2LFB A;  4GO1 A;  4UUT A;  3E97 A;  3F22 A;  1J9I A;  2DN0 A;  3WE3 A;  2V1D A;  1NHA A;  4HEA 2;  3D1N I;  3GTG J;  4S05 A;  5KK1 A;  3N05 A;  2M34 A;  2RDP A;  2ME0 A;  5DD4 A;  3BOQ A;  1ETO A;  2ZSH B;  3P9C A;  3BTJ A;  3R60 A;  2ZXW H;  4E7J A;  2EFQ A;  2EIM H;  1BBY A;  2LC2 A;  3KP3 A;  2K9Q A;  2XB0 X;  3JRI A;  2FD5 A;  4XK4 A;  2LKX A;  3GFJ A;  4A3K J;  4B3A A;  3CUQ A;  2L4M A;  2CW8 A;  4GFB A;  1ZKG A;  4F55 A;  2X1D A;  3HOS A;  3HRS A;  2ZB9 A;  1LEB A;  2VJ4 A;  4U87 A;  4RB0 A;  2DA7 A;  3BP8 A;  5F0H A;  3H9Q A;  1LEA A;  2XAS A;  3QU3 A;  4S04 A;  1BJA A;  1JJ8 C;  4I02 A;  4LIT A;  5F0F A;  4BKX A;  5LGT A;  2IA0 A;  1K6Y A;  3AG4 H;  4DOZ A;  4BUP A;  4V19 K;  2JQ7 A;  5L3G A;  3IRR A;  5CJ9 A;  1TQI A;  3ISP A;  3WGH A;  3KP7 A;  1BR1 A;  1BL0 A;  3SZG A;  4Y7N J;  5GAE J;  1JTX A;  1TT0 A;  1H9T A;  3KYL A;  1MND A;  2GZW A;  2BXZ A;  4UVB A;  3HYI A;  3HOV J;  3RI4 A;  1TWF J;  3M07 A;  1Z77 A;  3W2V A;  1FLI A;  4XLA A;  3PO2 J;  4LLG F;  3FXM A;  1ETV A;  2E36 A;  2L7F P;  1QVU A;  2F5D A;  2ICW G;  1R5I D;  4XN0 A;  1KU7 A;  1LDK B;  4EV0 A;  1B72 A;  1P9Q C;  1LQ1 A;  3O6B B;  1TWC J;  4IHY A;  3PIP F;  1BIA A;  2MLG A;  2B7E A;  4A0X A;  4XSX F;  1LKX A;  1OFC X;  3T8R A;  1T08 B;  4AU7 A;  2CQK A;  1Y1W J;  1H88 C;  2Z5U A;  3OL3 A;  3WTZ A;  4E7Z A;  3JCU C;  3V4G A;  4P9F A;  3OYB A;  1YQA A;  2XGX A;  2Q8K A;  2XUB A;  5EG0 A;  4Q48 A;  2DA3 A;  2JPB A;  4J01 A;  3FXL A;  4IRG A;  3M7G A;  1D1A A;  3ABU A;  3Q9V A;  3GXO A;  2CUJ A;  1BIB A;  1SC7 A;  2JUG A;  4WXH A;  1YO5 C;  1VTN C;  2MG4 A;  3GFI A;  5IP6 A;  4GRI A;  1O7F A;  2ME6 A;  5FO5 A;  4BDY A;  1FPQ A;  1QHH D;  2G7H A;  2Z3Y A;  3GF2 A;  3OWT A;  4IHX A;  3W2W A;  3TGN A;  4J19 A;  1BA5 A;  1MMN A;  4BQN A;  4XIC A;  5TJJ A;  1FOW A;  2JN6 A;  2GXB A;  3QOE A;  4JBA A;  3B6C A;  3MKL A;  2ZO4 A;  3QP6 A;  1XB4 A;  3CES A;  2NS0 A;  4HX4 A;  2PJP A;  1A31 A;  3QPS A;  1H9G A;  2BY0 A;  1LFP A;  1O7L A;  1SMY F;  3LMM A;  4HF0 A;  3WTY C;  2GOX B;  2ADU A;  1O3R A;  3RPU A;  1OJL A;  4A5M A;  4KUM A;  1T95 A;  3TOA A;  4CZZ A;  2CSO A;  2CS3 A;  5JHU A;  4XLF A;  1ZEL A;  3M8F A;  1V5F A;  4V2G A;  1P6R A;  1J7K A;  2PI0 A;  5GPC A;  2DO7 A;  3S1M J;  2N8G A;  3E7L A;  2RN7 A;  3CMA I;  3MVP A;  3FXO A;  3NWT A;  5J4Y A;  4EVI A;  2LR8 A;  2ACJ A;  3S14 J;  3FXK A;  5IOZ A;  1ZAR A;  2A3S A;  2CO5 A;  4E6K G;  4YIF A;  3HDD A;  2JT1 A;  4G6T B;  2M0M A;  2D1V A;  1HC8 A;  4OU0 A;  3S93 A;  2RVC A;  4MTD A;  1OR7 A;  2KRF A;  3KLN A;  4UV8 A;  5FKM A;  3S2H J;  1FMW A;  4EJW A;  3C2B A;  3WTU C;  1WJF A;  2AO9 A;  2KFD A;  3TED A;  2XRL A;  2HYF A;  4FHT A;  1U8R A;  1T0F C;  2Y9Y A;  4XOP A;  3IUO A;  1GHC A;  1YIJ I;  2OTJ I;  1HXD A;  3Q0W A;  1LE8 A;  3CC2 I;  3MZ8 A;  4F52 A;  4RLF A;  1MBJ A;  4ZC3 A;  3CUO A;  4ETS A;  4PFP A;  4I0A A;  1XDS A;  2VPR A;  5DCM B;  1FTZ A;  4HA8 A;  2FML A;  1A6Q A;  4WWC A;  3AL0 B;  4PK4 A;  2M87 A;  4PDK A;  3CCQ I;  4CZC A;  2E1C A;  1VQ6 I;  3WTW C;  3RYR A;  3PM1 A;  2MD5 A;  1S7A A;  2PQ8 A;  4U0Y A;  4FE7 A;  4MIM A;  5L3E A;  1W5T A;  2EIJ H;  2YSR A;  3IHU A;  1BJZ A;  3HXL A;  4BDZ A;  2BYV E;  2NS8 A;  3OS1 A;  3CCM I;  1JJ6 C;  4PSX A;  3GO5 A;  1UG2 A;  4Q5S F;  1T98 A;  3UR3 C;  5D4R A;  2VT3 A;  3S1Q J;  2QF7 A;  3B6A A;  2R7X A;  1TLH B;  4XR6 A;  4ZYH A;  2V1U A;  3RQ4 A;  3RIR A;  4GXO A;  4NQW A;  3MKZ A;  4G9Y A;  4MO7 A;  5LLQ A;  4RA2 A;  2K9N A;  5KAI C;  2PEX A;  3P9K A;  4LFU A;  1MSE C;  3CCE I;  2QKM B;  2K40 A;  1MDM A;  5FRN A;  2A6T A;  2CUZ A;  4HRI A;  2QQ8 A;  2E60 A;  4U0V A;  4AVZ A;  9ANT A;  3JRA A;  4BXU A;  3TW6 A;  5H6R A;  5D5U B;  3QP5 A;  2KDZ A;  2VN2 A;  2DA4 A;  4IOA F;  2XDV A;  2CFX A;  3T5X A;  3I54 A;  4YFK F;  4XLP F;  2COM A;  5CPR B;  4CCJ A;  3J80 Z;  1U2W A;  3QYF A;  1ON1 A;  2BY3 A;  5C3E J;  2KLO A;  4QWQ A;  4BY1 J;  1Z91 A;  1GXP A;  3LNQ A;  3F8F A;  5ILV A;  1ZH5 A;  3QYE A;  3CCU I;  2KIF A;  4H4K C;  4PJJ A;  3BR3 A;  3WE2 A;  1Y39 A;  2VE9 A;  1SAU A;  1WJB A;  3D5R C;  1MJB A;  3KE2 A;  1S7E A;  2QGU A;  3BCA A;  3A0H C;  4JK1 X;  4D7N A;  4BE2 A;  5GPA A;  1RZ4 A;  2F4M B;  1IG7 A;  3HRU A;  2KJC A;  3DFG A;  3AFH A;  2E2J J;  2B63 J;  2K27 A;  2FE3 A;  2X6Y A;  5LRS A;  1J09 A;  3BG3 A;  5D8K B;  3HGY A;  5CVV A;  1K6O A;  3IRQ A;  3LFU A;  2CJJ A;  4ABZ A;  5BS6 A;  4GCV A;  2BGC A;  2P6S A;  5FRM A;  3E0J B;  3K1N A;  3TP0 A;  3L2U A;  2MGQ A;  3GVA A;  4RM2 A;  1RPW A;  5BPI A;  5BMZ A;  4HV6 A;  4HG2 A;  5KHD A;  4KJZ A;  2PN6 A;  4L0Y B;  3DKW A;  1F9N A;  3I4N J;  4ON0 A;  3WOD F;  1QA6 A;  1TTY A;  3JRB A;  4P96 A;  4H0E A;  1CF7 A;  3OIO A;  3HKZ A;  1Z3X A;  3K4N A;  4XM3 A;  4A2U A;  1PDN C;  3G4S I;  1ZQ3 P;  1SFK A;  3NRV A;  3VYU B;  5FFZ A;  1AKH A;  5IT9 Z;  2DDA A;  2DK5 A;  2GIZ A;  4M6Y A;  1RES A;  2EZH A;  3NEU A;  4RAZ A;  4Y3O A;  1YTY A;  2BY2 A;  3KX2 A;  4EJV A;  4B48 A;  2DBB A;  2IW5 A;  5F08 A;  3WTV C;  1FC3 A;  4N0B A;  3H1C A;  5K7H A;  1MBG A;  2EBI A;  2ZFW A;  2R7T A;  3LSJ A;  4XRM A;  1ON2 A;  2E2H J;  4UUS A;  3BG9 A;  4P1W A;  2LY1 A;  3TO7 A;  4WCG A;  3L7W A;  2WTE A;  3I56 I;  2OZU A;  1RKT A;  2W48 A;  2QBY B;  4OMY A;  3RDI A;  2TCT A;  5GTI C;  1ZHF A;  3K9T A;  3G1O A;  2BHZ A;  4HF1 A;  2EZI A;  4BQA A;  4K2E A;  1DPU A;  3MCZ A;  1V3F A;  2VAS A;  4KYW A;  1WQ2 A;  1UHM A;  2OU2 A;  4MEY F;  4BHB A;  2MLK A;  2FEZ A;  3KP2 A;  2ID3 A;  3J81 K;  2BZT A;  3E1S A;  4AC0 A;  1W0U A;  2QSH X;  3QOP A;  4AID A;  1X2N A;  4XNF A;  2VI6 A;  2CV0 A;  1XG1 A;  3V7R A;  2GXA A;  1FOX A;  3VSL A;  1QRY A;  5E3N A;  2QQA A;  2PLY A;  1JHF A;  3PQJ A;  2WAF A;  2CUE A;  4X0G A;  4AIH A;  1STZ A;  3H9G A;  1GVJ A;  3ZPL A;  4CDG A;  4A3G J;  3GTP J;  2YS9 A;  3H5R A;  3OSG A;  2M8G X;  4E4H A;  2KZV A;  1HLV A;  1D0X A;  1MH4 A;  2CQX A;  5E1W A;  5CVJ A;  4E7H A;  3OYI A;  2IP2 A;  1D0Z A;  2VBY A;  1IN6 A;  3EQL F;  2XAH A;  2FXA A;  1KU2 A;  4ESJ A;  4A12 A;  4IZZ A;  3DWL E;  4RB3 C;  4JX5 A;  1EF4 A;  4IRI A;  1H8A C;  3S2W A;  4A6E A;  1I6X A;  1JUS A;  2D2W A;  3WTX C;  3ZQC A;  1BI0 A;  4ENM A;  4QTR A;  5FGM A;  3KZZ A;  2VBW A;  3ASN H;  4OOI A;  1PUE E;  2VC0 A;  1IW7 F;  3I0T A;  2E1N A;  4RGU A;  3LA7 A;  2XRN A;  3I4P A;  2XAU A;  2QLZ A;  1YJ9 I;  3C2H A;  3CQZ J;  3KET A;  1H89 C;  2MSY A;  2IJL A;  2YR2 A;  4ZYA A;  4M72 A;  1ZRD A;  2CMP A;  3HIF A;  2ELJ A;  5DTD A;  1UHW A;  5E3L A;  4DNC A;  3QYB A;  2DU9 A;  3HZJ A;  4OWR B;  2R7S A;  1E17 A;  5LHH A;  1GV5 A;  3CMY A;  5FKK A;  2ZJP F;  3BWG A;  3E6C C;  4CUG A;  2JPC A;  5DM7 F;  1MMD A;  2E19 A;  2IXS A;  2VIX A;  4EQQ A;  2DPD A;  2GAU A;  1ETK A;  3DCF A;  4KIF A;  1QVT A;  3CTA A;  2VC1 A;  1IGN A;  4JP0 A;  1ZRE A;  2H1K A;  1E2X A;  5BPD A;  2G0E A;  1G4D A;  4BXX J;  2BV6 A;  1BW5 A;  4L5J A;  3E5Q A;  4NB5 A;  3HUG A;  1O3S A;  4OMZ A;  2F5V A;  5F64 A;  4PJN A;  2MFZ A;  4KA4 A;  1D0Y A;  4BY7 J;  4HAM A;  2VB6 A;  3PSF A;  4LK1 F;  2CUF A;  4BE1 A;  2LK2 A;  1T39 A;  2E5Z A;  2LSO A;  4BHC A;  2R4G A;  2TRT A;  2KP6 A;  1YRN A;  3E5U A;  2IRF G;  2LKP A;  1XMX A;  3VOE A;  1ZLJ A;  3AKZ A;  4ZJZ A;  4XKB A;  1TC3 C;  2FQ3 A;  1TZL A;  5FKO A;  2VJJ A;  3BJA A;  1U5T A;  2V4J C;  1OCZ H;  1IXC A;  5IY5 H;  3GTJ J;  2DA2 A;  4Y52 J;  5IP9 J;  1MJA A;  1T2K A;  3OYF A;  4HV5 A;  4KT5 C;  4DQ2 A;  3VYT B;  1PJR A;  4BJ5 C;  3HJE A;  1KU3 A;  2CRG A;  5ICG A;  3B02 A;  4P9U A;  1LPQ A;  4IQ4 A;  2H6B A;  4ENK A;  1T33 A;  2NAZ A;  2V1N A;  4MQV A;  2A5Y B;  1JE8 A;  5K1Y A;  1XX5 A;  4RAG A;  2GA1 A;  3RSN A;  4XN3 A;  2O61 A;  3ZQI A;  5JI6 A;  2KIM A;  3FWE A;  3IWZ A;  2QKL B;  2M4G A;  3OYD A;  3CJT B;  2R5Z A;  5HS7 A;  1XSV A;  5LEJ A;  2XVC A;  5ERI A;  1I3A A;  2KL4 A;  1GV2 A;  5AIQ A;  2WV1 A;  4HW0 A;  2LBF B;  3FMS A;  1VQP I;  3ML6 A;  2VUM J;  3RCO A;  4A6D A;  2GWR A;  2A5W A;  2VOO A;  4MGR A;  2GM4 A;  2DOE A;  4G8X A;  1VQL I;  2JA8 J;  4V2F A;  4BL0 B;  4X6A J;  2HKO A;  2O5R A;  3I53 A;  5F1R A;  1DGW Y;  4DYQ A;  2R7D A;  4EJO A;  1S72 I;  4UVC A;  4C3H J;  5K5Q A;  4II2 A;  3T1B A;  2X85 A;  5FLV A;  1E3H A;  2LRD A;  2HXI A;  2QZ8 A;  2TDX A;  3I58 A;  4EGY A;  5BOX A;  2L01 A;  4HNT A;  2Y30 A;  2CQ7 A;  2P8T A;  2ZXH A;  2VQL A;  3WGG A;  2HXO A;  2WAQ A;  3RKQ A;  3U9G A;  2W84 A;  3GLX A;  1SFX A;  3OS2 A;  3HB9 A;  1IRX A;  1TWA J;  4RM3 A;  2HQ5 A;  5LGN A;  5E3M A;  3HOU J;  4A3F J;  4ANJ A;  4IX7 A;  2HQN A;  3ZRG A;  3FKJ A;  4YEJ A;  3N97 A;  1FBU A;  1KQ9 A;  2X0L A;  5JVG F;  3IKV A;  2IGN A;  3BRO A;  4LMY A;  5HDN A;  3ONQ A;  4ZYE A;  3BY6 A;  1CGP A;  2HZT A;  3K4M A;  1ZN2 A;  1I50 J;  3V8J A;  2V9K A;  4M3D A;  1WCM J;  3ABT A;  1OYY A;  1W1W E;  5GAH J;  3U21 A;  1V54 H;  1DGR M;  3E6B A;  3W2A A;  3E3V A;  3SHF A;  3E6M A;  2ELK A;  3ZR8 X;  3DPT A;  1JI8 A;  3AG1 H;  1POG A;  2HDW A;  3BZ6 A;  3WU2 C;  1F43 A;  2K85 A;  1JKR C;  4ESF A;  3IH4 A;  3FDY A;  2HI3 A;  3B73 A;  1TT5 B;  3G3Z A;  2OD5 A;  3BC8 A;  2VT2 A;  2VL8 A;  3KEY A;  2UZK A;  2WA0 A;  4U88 A;  5F1J A;  3MWM A;  1B59 A;  2WB1 N;  3L2W A;  3DEU A;  3Q5F A;  2HQA A;  1XS9 A;  1Z6R A;  3FM5 A;  4C3I J;  1F36 A;  1IC8 A;  3QPH A;  2XC7 A;  4BAC A;  2LNB A;  5A2Q K;  3FK6 A;  4OIN F;  2R7F A;  1QGP A;  2L7Z A;  1BC8 C;  1TNT A;  3GTQ J;  5ED4 A;  1HF0 A;  3JSO A;  1R7J A;  2D1H A;  1NK3 P;  3HRM A;  1FBS A;  1IN4 A;  3M8E A;  5H6Q A;  3SDB A;  2DFE A;  3DBH B;  4NHJ A;  3OYH A;  3GTO J;  4KIT B;  1LFU P;  5B1B H;  3S1N J;  5D5V B;  3COA C;  2LG4 A;  3ZOB A;  1OYI A;  2CYY A;  4AWX B;  5EEH A;  1K4T A;  3ZQ7 A;  1DU6 A;  2L54 A;  3QRF F;  1G3T A;  1G3W A;  5DUK A;  1N77 A;  4KIS A;  2UXN A;  4JOM A;  3KP5 A;  1UJ8 A;  1HSJ A;  4ZDO A;  1VQ7 I;  3GZ5 A;  4HOB A;  3EUH C;  1DU0 A;  3BJ6 A;  3IAS 2;  1TBX A;  1PUF B;  4M71 A;  5K7Z A;  3FXJ A;  4R79 A;  1IUF A;  2RV8 A;  3IKT A;  1DPR A;  4N4O B;  2OAZ A;  3GZN B;  2R5Y B;  1NK2 P;  1XGS A;  2QYO A;  3RZO J;  1NTC A;  3GEZ A;  5EGO B;  2OCE A;  1YE9 A;  1Q1H A;  1R1U A;  3TMO A;  2VE8 A;  1V5G A;  1WFX A;  4M9X A;  1QBJ A;  1PVE A;  2Q1Z B;  3HHG A;  3LQQ A;  1FYL A;  4G94 A;  3DP7 A;  4EEF G;  4IEJ A;  3RKW A;  2EH3 A;  2FOW A;  2VOD A;  3IAM 2;  1HW1 A;  3HKZ N;  2F5C A;  3U1K A;  4BJ6 C;  1MD0 A;  1RET A;  3J81 Z;  2EFW A;  4XLH A;  2XF5 A;  1MJ9 A;  4L18 B;  3F72 A;  2NVT J;  5F27 A;  1UST A;  5CVI A;  1X19 A;  3NQO A;  5DCM A;  2NS7 A;  5HVQ C;  2DT5 A;  2EIK H;  4B4C A;  3BTL A;  5J1R A;  1ZRC A;  4A3J J;  1U8B A;  3ABK H;  1YJN I;  3D0S A;  2ELH A;  2DMU A;  1B6A A;  2DFF A;  2EQR A;  4RB1 A;  1Z21 A;  2KIU A;  2BW3 B;  2IGK A;  3TP3 A;  4NNJ A;  1N25 A;  2W7N A;  2HYG D;  3L09 A;  3WU0 A;  2FMY A;  3OYE A;  1D8J A;  3VB2 A;  2BVM A;  3ZMT A;  3ERM A;  1RR7 A;  4MFD A;  4M3B A;  1K83 J;  4RDU A;  2L4A A;  2MYS A;  4M9Z A;  4S0H B;  1LB2 A;  1LDD A;  1IRZ A;  4AIK A;  1AHD P;  3I5U A;  4ENJ A;  1OQY A;  3BG7 A;  1WWX A;  4F91 B;  1S8N A;  3DEW A;  4II3 A;  2LF8 A;  1YW9 A;  5F6F A;  4UB6 C;  1IO2 A;  3S2D J;  1SD5 A;  2L7K A;  4E7K A;  1YS7 A;  4CYC B;  3QQA A;  1ACI A;  1FOY A;  1MBK A;  3LSK A;  4CXF A;  1VQ5 I;  3T8T A;  4L0Z B;  3I9V 2;  3FHZ A;  4G7H F;  1HCR A;  4ZZD A;  3LSP A;  3RJP A;  3DU6 A;  4C30 A;  4HLX A;  1OCT C;  2D5V A;  1JUM A;  3P7N A;  4B8X A;  4OIP F;  4PJ0 C;  4OIO F;  5EZH A;  3PFY A;  3SEQ A;  3SEZ A;  5E1X A;  4GGG A;  1R00 A;  1R22 A;  1BOA A;  3ZQG A;  4M3E A;  3LSI A;  2HOA A;  2FRH A;  3TW7 A;  4XSZ F;  2K7L A;  1XN7 A;  3OIQ A;  2KRH A;  4YFN F;  1T38 A;  2DMN A;  2K9M A;  5LFA A;  1R9T J;  1MNM C;  5EDN A;  1W7P A;  2LD5 A;  3F0C A;  4BJT A;  1A36 A;  1Z1D A;  3OR2 C;  1P7J A;  2R7U A;  3JRG A;  4XKW A;  2VLA A;  5L3D A;  4U0W A;  5IYB J;  1HOM A;  5IOY A;  4I09 A;  3HPH A;  3I64 A;  3Q3S A;  4WXD A;  3H3U A;  2BOL A;  1FYK A;  2LY9 A;  1FWZ A;  5AON A;  1QZY A;  1MH3 A;  3DKY A;  2HEO A;  2PBI A;  3CJQ B;  3CC7 I;  3EYI A;  1X3U A;  2E71 A;  2K02 A;  3GX4 X;  3SJM A;  3FHN A;  2FSW A;  4WXC A;  2EFO A;  3KEQ A;  3NAU A;  4LB6 B;  5J40 A;  1FEX A;  3BCB A;  3HRT A;  3H5N A;  5KCM A;  1ZG5 A;  3R0J A;  2MC3 A;  3BTI A;  3O8H A;  4HDU A;  3HGG A;  3JRF A;  4IKF A;  3FBI B;  4CCM A;  3MKY B;  2XAQ A;  4XOR A;  2GA2 A;  3VWB A;  3CUQ B;  3JTH A;  5GAD J;  2ZXI A;  3HHH A;  2QBY A;  4I7H A;  4LG0 B;  1LVK A;  2W1O A;  1I5Z A;  3LA2 A;  2A6E F;  3OYJ A;  4XRS G;  1Y6I A;  2DJI A;  4KIG A;  3I59 B;  1EH6 A;  2P6T A;  1IV8 A;  4OAY A;  5BQT A;  2YPR A;  3G71 I;  3ECH A;  1X3W B;  1T56 A;  4KMU X;  2BXY A;  3K70 C;  4FET A;  2JWT A;  1SEU A;  3GTM J;  5FKL A;  4R1H A;  4BBS J;  1NH3 A;  2DMT A;  2FUG 2;  3K1M A;  3P9I A;  1IDY A;  3CZ6 A;  3CCR I;  2L9R A;  2JA7 J;  2WB1 A;  1WH5 A;  3DV8 A;  3K0L A;  4RAY A;  3C1D A;  2NNY A;  3BG5 A;  1F4K A;  2OZ6 A;  3LL7 A;  3GFL A;  1VQ4 I;  1P7I A;  2CQQ A;  1JXS A;  3K70 D;  1U9O A;  3A01 A;  3W6J B;  1ODD A;  1SD7 A;  2XPU A;  3BPV A;  3MKW B;  2ZME C;  5HS8 A;  3MFK A;  1WJA A;  3VFZ A;  1X4P A;  4DBR A;  3MQ0 A;  3KP4 A;  1HKQ A;  3JSP A;  1V5E A;  1R5H A;  2NOJ B;  2M2E A;  2OA4 A;  1D5Y A;  1U0J A;  4PGG A;  5HLG A;  4EJU A;  1MBH A;  2M3A A;  5CQE A;  4ZTJ A;  1B72 B;  4EJT A;  1ENH A;  2JRM A;  2A07 F;  2J5P A;  3HSF A;  4I2O A;  2GXG A;  3M1C A;  3RPQ A;  3GCM A;  4BAY A;  4PJL A;  1SD4 A;  3I55 I;  2KT0 A;  4BE0 A;  4Y4R A;  1EH7 A;  5DYM A;  2H1L A;  1X1D A;  3EUH A;  1XDU A;  2IA1 A;  2M45 A;  4NC6 A;  1HDD C;  2ZSI B;  2B0L A;  2DK8 A;  4Y13 A;  4BXF A;  3HBL A;  2WBM A;  1WJD A;  3PNY A;  3F8N A;  4UV9 A;  5BNG A;  3HOT A;  1W36 C;  1Z67 A;  3OV8 A;  1MIJ A;  2M7B A;  3H92 A;  4GYI A;  3J7Z I;  1BI3 A;  1EA3 A;  2WAQ N;  1K78 B;  2HYJ A;  1OIS A;  3S3O A;  1ERD A;  1TQP A;  2XKO A;  3DEE A;  3K4K A;  2RQP A;  2FX0 A;  4HSR A;  4XKV A;  2NOG A;  5F0C A;  3V42 A;  4I76 A;  1SFE A;  1D5V A;  4B3X A;  1UEL B;  3ZP5 A;  4KN4 X;  1QPM A;  5ICE A;  1C0W A;  5GP9 A;  4ENN A;  4KN7 X;  3C7J A;  3QWL A;  3CMM A;  3OR1 C;  2VQC A;  2DCE A;  3QPT A;  3CLO A;  1U78 A;  1OCR H;  3SZT A;  3BG6 A;  1ZYR F;  4NDL A;  3HSR A;  3NWS A;  3DF8 A;  4DBQ A;  1TW2 A;  2OPT A;  4ZZL A;  5TRD A;  2GOM A;  1JGS A;  1HW2 A;  4AVP A;  4RBO A;  2Z99 A;  1FX7 A;  2JMW A;  3CJR B;  4HPQ A;  4LLN A;  3KYC B;  4CCK A;  3CME I;  1MBF A;  1AOY A;  3GZ6 A;  3BQZ A;  2VJI A;  3W6V A;  4YIR X;  3FXR A;  1HKT A;  1KYW A;  3G1M A;  2X9D A;  2WY7 Q;  1KA8 A;  2IA2 A;  3CCV I;  5HS9 A;  1YIO A;  2GIV A;  2B9S A;  2L2O A;  1IRG A;  1HST A;  3KYD B;  2RC4 A;  3F8B A;  1Z7L A;  2VKD A;  4QIW N;  5HNH A;  4M6X A;  4XON A;  1X58 A;  2IVM A;  3T0Y A;  4CCL A;  3DTE A;  3M8J A;  4M3G A;  5EEG A;  1YJW I;  1UAA A;  1Y0N A;  1YX5 A;  3SDG A;  1XD7 A;  2FBI A;  4LIU A;  1D1C A;  3EDP A;  1XCV A;  5IYD J;  2L7M P;  2FBH A;  3FXQ A;  2VXZ A;  2QA4 I;  1B8I B;  3BZK A;  1IF1 A;  2MAB A;  2W00 A;  2P0W A;  3G6E I;  2MH9 A;  1Z6T A;  2Z33 A;  3TKY A;  1UG0 A;  5CQG A;  5J1U A;  4IHV A;  1BOB A;  2UWM A;  5DV5 A;  5J6X A;  4HNU A;  3BR0 A;  4CO8 A;  4DZP A;  4DJA A;  4CGZ A;  1VQK I;  4RGR A;  2A05 A;  2DYS H;  3GTK J;  2QSG X;  1Y8Q B;  4E7I A;  2IS4 A;  5EF6 A;  2KRC A;  2STW A;  2DQL A;  2QM3 A;  4IHT A;  3DBR B;  1P2F A;  1GVD A;  2JZY A;  3ABM H;  5EYR A;  1JKQ C;  2G9W A;  2IGM A;  1K7A A;  3GLL A;  2DI3 A;  1QNT A;  3FX3 A;  3KP6 A;  2Z9O A;  1I1S A;  3J7Y J;  1IXR C;  1MDM B;  2LLK A;  4M73 A;  3ZXS A;  1BI1 A;  2X6O A;  4HX8 A;  2F5F A;  3L00 A;  2QQ9 A;  1M1E B;  4NBQ A;  5B1A H;  1R23 A;  1I1G A;  4MHG A;  3HEF A;  4E7S A;  4MTE A;  3CCJ I;  2O8K A;  1EKE A;  2BY1 A;  2XAF A;  2WAE A;  3GTL J;  3QU6 A;  5HDG A;  1XSD A;  1ULY A;  3MZH A;  1WJE A;  3K4C A;  2HKX A;  3S16 J;  4XLE A;  3HOY J;  1IJW C;  1L3L A;  3CUQ C;  3F8M A;  4L5I A;  4G7Z F;  2ID6 A;  1WZ2 A;  4CHU A;  1DP3 A;  2Y0S A;  2VKH A;  2QEX I;  1IN5 A;  1T0F A;  3WG9 A;  3L1P A;  1TL8 A;  1FY7 A;  3PNV A;  5H20 A;  3LQR A;  2ECC A;  2V9V A;  3HSE A;  3PFI A;  3K4J A;  2K3F A;  2XSD C;  3HL2 A;  2YUS A;  3VYS B;  2CW7 A;  2M5W A;  2XPW A;  2I8D A;  2V26 A;  4IQJ A;  2ZJR F;  3ESW B;  4LD5 A;  4ZYG A;  2G7U A;  1D8K A;  1L0O C;  1KGS A;  2DW4 A;  3H3Z A;  3HOZ J;  4ZDP A;  4W97 A;  3OSF A;  4Z6Y A;  2E2I J;  5E17 F;  2W24 A;  2R3S A;  4KIB A;  4U7B A;  1HA8 A;  1R4M B;  4TV7 A;  2W85 A;  3RTR A;  4PFO A;  4A3I J;  1ZLK A;  2ZCW A;  2R7V A;  3F23 A;  1T8I A;  5HLI A;  4U7D A;  3CCY A;  4A93 J;  3BT9 A;  2F2E A;  1P4X A;  5JFR A;  4DW6 A;  2GBY A;  2F48 A;  2P5V A;  5J1Y A;  1WPK A;  3UNG C;  2XGE A;  1S9H A;  3W3C A;  5B66 C;  4RMN A;  1ETW A;  3KZI C;  1QPI A;  4PCQ A;  1R5G A;  4ZTF A;  4HX7 A;  3TDZ C;  2VBX A;  3DXJ F;  4L9J A;  1O3Q A;  1EJ9 A;  2VON A;  5C44 J;  3M1E A;  4B43 A;  4N4N B;  1XGO A;  2WY8 Q;  2OTL I;  3BR6 A;  3I71 A;  1YX3 A;  1KQ0 A;  1B4A A;  2UXX A;  1O3T A;  4M6V A;  3A2K A;  5FB2 A;  4G7O F;  3DPU A;  1O57 A;  2H6C A;  3PL8 A;  1ITY A;  1YG2 A;  3X2Q H;  5E8G A;  1V4R A;  3IV5 A;  2L02 A;  3BR2 A;  5D5W B;  4DIQ A;  3HTS B;  2BVL A;  1MW7 A;  1BI2 A;  3H36 A;  1NG7 A;  5E1Z B;  2H27 A;  4NUB A;  2VBZ A;  3ZN0 A;  5EGO A;  3I4M J;  1G6N A;  2COB A;  1I27 A;  5EJC A;  5K5O A;  1E3O C;  2IS1 A;  1X1P A;  1LJ9 A;  4OIQ F;  5L3F A;  1GUU A;  4L5E A;  5FKN A;  3MAJ A;  1XGN A;  2Q2E B;  3JAM K;  1XMK A;  4IRH A;  1SMT A;  3CP2 A;  4DZJ A;  3HOW J;  2QEN A;  4A3D J;  1ZRF A;  1DQU A;  2KDO A;  4BS9 A;  3KEO A;  3SZP A;  4EM0 B;  1MBE A;  1Q1V A;  1RR8 C;  2D45 A;  1P4A A;  2PFB A;  1RUO A;  2EFP A;  2JRT A;  5EZG A;  4UHT A;  1LFB A;  3LAP A;  1TWH J;  1YHQ I;  3S1R J;  5TIS C;  3GWZ A;  3ASO H;  1R49 A;  2EB7 A;  4JYK A;  3OY9 A;  2EV5 A;  2OQR A;  2DA5 A;  4C3J J;  2HPM A;  2P5L C;  1EH8 A;  4IHS A;  3ZCO A;  5HOD A;  5HLT A;  1W0T A;  1WGX A;  2KZG A;  3UKG A;  1RIO H;  1A6I A;  1FP1 D;  1X3Z B;  3F21 A;  4PJM A;  1W5S A;  4UXN A;  1Y8R B;  1QQI A;  2FNP A;  2EV6 A;  1JHH A;  2ZFU A;  3DBL B;  3GYH X;  1SFO J;  1IV6 A;  4UY8 I;  3SFZ A;  4MLO A;  2I10 A;  2LDU A;  1Y0U A;  1U3E M;  1OR7 C;  1KYZ A;  2ISY A;  2OJE D;  1X2M A;  2DOA A;  2YX7 A;  2O6G E;  5LEK A;  2RNJ A;  4CH7 A;  4XQF A;  3M4O J;  2W4S A;  4D1Q A;  3SQN A;  2E34 A;  3CO7 C;  1SVL A;  4O6J A;  2R7Q A;  3L2V A;  3TO9 A;  1X1A A;  1BN5 A;  1VQO I;  1ZG1 A;  1ZGW A;  1VQ8 I;  2MW8 A;  3QAH A;  2Z2S B;  4HLY A;  4IXA A;  3VDX A;  3F3X A;  5EEA A;  5M5X J;  3BPX A;  1S29 A;  1LUJ B;  3ZQF A;  3KZY A;  3FBN B;  3OIP A;  4I01 A;  4XLC A;  2YU9 J;  3IH2 A;  4PUS A;  1EV7 A;  1F1Z A;  1RC9 A;  3C18 A;  2PJR B;  3AG3 H;  1ZGA A;  3MN2 A;  2XRO A;  1WRJ A;  1ZR4 A;  3ZMV A;  3ZGK A;  1VND A;  4FX0 A;  3DU5 A;  3LWF A;  4IO9 F;  5LRR A;  4GYG A;  5LHG A;  2ZME B;  4W1U A;  3HC7 A;  1Z0X A;  4AD9 A;  5L3B A;  4D0P A;  2DDB A;  4KFC A;  4B47 A;  2WWY A;  1A35 A;  3VSK A;  2AHQ A;  5IPA A;  4LB5 A;  1IAW A;  5IT9 K;  1P4W A;  2LVS A;  2ZJ2 A;  4G6D A;  4UVA A;  2E35 A;  2O8X A;  3LFK A;  5D6E A;  1HBX G;  2KIQ A;  2VPL A;  2RQQ A;  4RB2 C;  4IF4 A;  1RKW A;  4CA0 A;  4F92 B;  2KIS A;  1FTT A;  4F7Z A;  1JKP C;  4I0B A;  1LVA A;  4A0Y A;  4WK8 F;  1R71 A;  2AXT C;  3J7A Y;  2JSP A;  1OYW A;  3ZN1 A;  3BQY A;  2XV4 S;  4B44 A;  3S8P A;  3OYC A;  1PYV A;  1FP2 A;  2C6Y A;  2X48 A;  3CLQ A;  4A69 C;  1P92 A;  2NVY J;  2XKP A;  3D5S C;  2ZBK A;  5FRO A;  3MEX A;  1JUP A;  2R5Z B;  4Y17 A;  3A4C A;  1U6G A;  5M3M J;  4HF2 A;  2V79 A;  5KAF C;  2E1M B;  4LG0 A;  4LLL A;  1APL C;  1FT9 A;  4UUV A;  3CDH A;  3HPG A;  5JLW A;  3U2R A;  2R0Q C;  3SYT A;  2F6C A;  4CIC A;  5D6F A;  2Y48 A;  2HDC A;  2EIL H;  3EUK L;  3I59 A;  4R8H A;  3PNT A;  2DFI A;  4C2T A; 
#chains in the Genus database with same CATH homology
 1J75 A;  2ZNZ A;  2ISZ A;  4KNY A;  1MKM A;  2E7W A;  3SXY A;  2DAO A;  4E70 A;  1B9M A;  1WKM A;  5CLS A;  2HGC A;  2Q0O A;  3R4K A;  4KIC A;  4IVN A;  6PAX A;  1OMI A;  3FF5 A;  2PMU A;  1AWC A;  3ZMD A;  2QWW A;  3FM3 A;  4M9S A;  2NRA C;  4BYY A;  2DLL A;  1SAX A;  3WGI A;  3PQK A;  1DP7 P;  1Z9C A;  2M30 A;  4XBF A;  3TO6 A;  2P5K A;  3TOB A;  3ROU A;  2W57 A;  1K78 A;  4FX4 A;  4XLN F;  5KVR A;  1HKS A;  3W6K B;  2ZNY A;  2IT0 A;  1WI9 A;  1SFU A;  1HW5 A;  1IRF A;  2P7C B;  5E18 F;  3OOP A;  1FOK A;  5CVR A;  3K69 A;  3V8L A;  1OPC A;  2EV0 A;  4OIR F;  2PMH A;  4WF2 A;  3VEP A;  3K2Z A;  2HS5 A;  2H94 A;  5FD6 A;  1R36 A;  4MEX F;  2LF7 A;  4N9H A;  4EM1 A;  2BBY A;  2CGP A;  4RGX A;  2NYX A;  3LST A;  3CO6 C;  2FOK A;  2Y75 A;  2F5E A;  3BJO A;  1YS6 A;  3O3K A;  2CW0 F;  2A6H F;  3GW2 A;  3GFM A;  5LHI A;  1RI7 A;  1FSE A;  5D8L B;  5DCF A;  2O03 A;  3V8K A;  4Q47 A;  2M8E A;  1YW8 A;  5DEQ A;  1GXQ A;  5JR3 A;  1BC7 C;  4QLC U;  2RGV A;  3JAM Z;  1W4M A;  2ZKZ A;  1YLF A;  4YG2 F;  2YX4 A;  4EM2 A;  2OQG A;  1K79 A;  1OKR A;  1ZAO A;  5JVT A;  2KJB A;  3DQV C;  3ECO A;  4RGS A;  5J8F A;  1PP8 F;  4XRF A;  2ETH A;  4YII A;  3G73 A;  3R61 A;  1XGM A;  5FLX K;  2QVO A;  1U5T C;  2V6C A;  4KMF A;  1IZ1 A;  2K86 A;  1ONV A;  1DDN A;  3RKX A;  4Q4Z F;  4PZJ A;  5FFX A;  2FBK A;  2XHK A;  2HQR A;  5E8I A;  2M1B A;  2JSC A;  3LA3 A;  4EMS A;  2XIG A;  4BHP A;  2ESN A;  2GQQ A;  1LNW A;  4P5O A;  2FA5 A;  3WU1 B;  5A2Q Z;  2EK5 A;  2FU4 A;  3M9A A;  4ASN A;  1W7P B;  5ILU A;  2ZXJ A;  2O3F A;  1ZGJ A;  1H0M A;  1Z7U A;  1J59 A;  2STT A;  1DUX C;  1KU9 A;  4I98 B;  3E6D A;  2EJR A;  3K1P A;  2Y0M A;  2P7V B;  2HR3 A;  4BH9 A;  3AAF A;  2EWN A;  1G3Y A;  4LGW A;  3U1D A;  3IWF A;  2XAJ A;  3D5L A;  4PGH A;  3FZV A;  1SD6 A;  2K4J A;  2HWV A;  3RYP A;  4HZF A;  1T6S A;  3KCC A;  2EFN A;  3O2P E;  3V7C A;  1F5T A;  4WX9 A;  3EYY A;  1YFH A;  4KDP A;  1QO0 D;  2NNN A;  3EET A;  5J8C A;  3L9F A;  2QQB A;  3F6O A;  1MGT A;  3JTG A;  2Q2E A;  4L9N A;  4HDV A;  1WSU A;  5CVU A;  3J7A O;  3ULQ B;  5FD5 A;  2BEO A;  1BM9 A;  3FMQ A;  5IT3 A;  2MH2 A;  1KQ8 A;  3IC7 A;  3WTT C;  1FYM A;  2WC2 A;  3KLO A;  4IPA A;  3F6V A;  1S6L A;  3L2C A;  1TQM A;  2E7X A;  1PP7 U;  1S3J A;  5ILS A;  2HFH A;  4M74 A;  1FNN A;  2X4H A;  2XAG A;  1R1V A;  2BE5 F;  3E5X A;  2HOE A;  2WV0 A;  4HQE A;  2DPU A;  2MBF A;  3CJN A;  1USS A;  2EA4 A;  3GUD A;  4MQ9 F;  3RKY A;  2QUF A;  2DQR A;  5E20 A;  1XCB A;  3ZMZ A;  1IN8 A;  1HQC A;  2HTS A;  5L3C A;  1YYV A;  4BNC A;  2OBP A;  4AIJ A;  5DUI A;  2CWE A;  2PG4 A;  4CYD A;  3C3W A;  3FMR A;  2AXL A;  1ZG3 A;  1CF7 B;  4MNU A;  1UCR A;  4ESB A;  4G6Q A;  5ICF A;  2ESH A;  4L9T A;  1LDJ A;  3BDD A;  2ZME A;  3R6S A;  1QZZ A;  4B09 A;  4Y15 A;  2EA2 A;  1D3Y A;  5ICC A;  4YFX F;  4EGZ A;  3IL2 A;  1MZB A;  3F8C A;  1UFM A;  2H09 A;  3MZY A;  5DDG A;  2IPQ X;  2K4B A;  1IXS B;  3ELK A;  1G3S A;  1R58 A;  2A61 A;  3VOD A;  2HTJ A;  1TW3 A;  2AS5 F;  4HYE A;  5D4S A;  5CYV A;  4A5N A;  5LGU A;  1A04 A;  2P4W A;  2MA3 A;  4Z2Y A;  3WTS C;  2YU3 A;  1FSH A;  1J5Y A;  1S7O A;  4RS8 A;  3JW4 A;  4IJA A;  1XMA A;  4HQM A;  2RKH A;  3REO A;  5DD8 A;  3ERE D;  2KKO A;  1W7P D;  2O0Y A;  2CG4 A;  5AIP A;  4ZYD A;  1IUY A;  1RNL A;  3KFW X;  1TNS A;  5FLX Z;  2FF4 A;  2VOP A;  2DTR A;  5D5X B;  2A69 F;  1R1T A;  2JTV A;  4FT8 A;  4L9V A;  5HOO A;  1FBQ A;  5HDK A;  5K5R A;  1UB9 A;  3J80 K;  5HLH A;  3LAJ A;  4ZH4 F;  3DPL C;  1IN7 A;  2V1X A;  1XSX A;  1FZP B;  1J2X A;  1B9N A;  1REP C;  2J5O A;  2W25 A;  1J0R A;  4UNO A;  4JQF A;  3FXU A;  4O5V A;  3HTU A;  2FNA A;  1Z05 A;  3R0A A;  4O3M A;  4N9I A;  1B1B A;  4A0Z A;  4P55 A;  4LJZ F;  3ZMU A;  4LK0 F;  3ZMS A;  3TQN A;  3V7S A;  1RUN A;  2L3D A;  3TDU C;  3Q9S A;  1U5T B;  2A68 F;  1YW7 A;  3N4M A;  4HBL A;  5LBQ A;  4GO1 A;  3E97 A;  3F22 A;  1J9I A;  3WE3 A;  2V1D A;  1NHA A;  4S05 A;  5KK1 A;  2RDP A;  5DD4 A;  3BOQ A;  3P9C A;  3R60 A;  2EFQ A;  1BBY A;  3KP3 A;  3GFJ A;  3CUQ A;  2L4M A;  3HOS A;  3HRS A;  1LEB A;  4RB0 A;  3BP8 A;  1LEA A;  2XAS A;  3QU3 A;  4S04 A;  1BJA A;  4I02 A;  5LGT A;  2IA0 A;  5L3G A;  3IRR A;  5CJ9 A;  1TQI A;  3ISP A;  3WGH A;  3KP7 A;  1H9T A;  2GZW A;  4UVB A;  3HYI A;  3RI4 A;  1FLI A;  4LLG F;  2F5D A;  1KU7 A;  1LDK B;  4EV0 A;  1LQ1 A;  3O6B B;  1BIA A;  2MLG A;  4A0X A;  4XSX F;  3T8R A;  2CQK A;  2Z5U A;  3WTZ A;  3V4G A;  4P9F A;  1YQA A;  2XGX A;  2Q8K A;  2XUB A;  4Q48 A;  2JPB A;  4IRG A;  3M7G A;  3ABU A;  3Q9V A;  3GXO A;  1BIB A;  4WXH A;  1YO5 C;  1VTN C;  3GFI A;  1O7F A;  5FO5 A;  1FPQ A;  2G7H A;  2Z3Y A;  3GF2 A;  3TGN A;  5TJJ A;  2GXB A;  4JBA A;  2ZO4 A;  3QP6 A;  1XB4 A;  2NS0 A;  4HX4 A;  2PJP A;  1H9G A;  1O7L A;  1SMY F;  3WTY C;  4HF0 A;  2ADU A;  1O3R A;  3RPU A;  4A5M A;  4KUM A;  3TOA A;  4CZZ A;  2CSO A;  5JHU A;  3M8F A;  2PI0 A;  1P6R A;  1J7K A;  2DO7 A;  2RN7 A;  4EVI A;  2ACJ A;  1ZAR A;  2A3S A;  2CO5 A;  4YIF A;  2JT1 A;  2D1V A;  4OU0 A;  4MTD A;  2RVC A;  1OR7 A;  2KRF A;  3KLN A;  4UV8 A;  4EJW A;  3WTU C;  2HYF A;  4FHT A;  1U8R A;  1GHC A;  1HXD A;  3CUO A;  4ETS A;  4I0A A;  1XDS A;  5DCM B;  4HA8 A;  2FML A;  4WWC A;  2M87 A;  4PDK A;  2E1C A;  3WTW C;  3RYR A;  2MD5 A;  1S7A A;  2PQ8 A;  4U0Y A;  5L3E A;  1W5T A;  2YSR A;  3IHU A;  2BYV E;  3GO5 A;  4Q5S F;  1T98 A;  5D4R A;  2VT3 A;  1TLH B;  4ZYH A;  2V1U A;  3RIR A;  4GXO A;  4NQW A;  4G9Y A;  5LLQ A;  2PEX A;  3P9K A;  4LFU A;  1MDM A;  4U0V A;  4BXU A;  5D5U B;  5H6R A;  3QP5 A;  2VN2 A;  2CFX A;  3T5X A;  3I54 A;  4YFK F;  4XLP F;  2COM A;  3J80 Z;  1U2W A;  1ON1 A;  4QWQ A;  1Z91 A;  1GXP A;  3F8F A;  5ILV A;  1ZH5 A;  2KIF A;  3WE2 A;  2VE9 A;  1MJB A;  3KE2 A;  4JK1 X;  1RZ4 A;  3HRU A;  2KJC A;  3DFG A;  2K27 A;  2FE3 A;  5LRS A;  5D8K B;  5CVV A;  1K6O A;  3IRQ A;  5BS6 A;  4GCV A;  2BGC A;  2P6S A;  3K1N A;  3GVA A;  5BPI A;  5BMZ A;  4HV6 A;  2PN6 A;  4L0Y B;  3DKW A;  1F9N A;  4ON0 A;  3WOD F;  1TTY A;  4P96 A;  4H0E A;  1CF7 A;  1PDN C;  4A2U A;  3NRV A;  5FFZ A;  5IT9 Z;  2DK5 A;  4M6Y A;  3NEU A;  4RAZ A;  1YTY A;  4EJV A;  2DBB A;  2IW5 A;  3WTV C;  1FC3 A;  4N0B A;  2ZFW A;  1ON2 A;  4WCG A;  3TO7 A;  3L7W A;  2WTE A;  2OZU A;  2QBY B;  4OMY A;  3RDI A;  1ZHF A;  3K9T A;  4HF1 A;  4BQA A;  4K2E A;  1DPU A;  3MCZ A;  1V3F A;  4KYW A;  1WQ2 A;  1UHM A;  2OU2 A;  4MEY F;  4BHB A;  2MLK A;  2FEZ A;  3KP2 A;  3J81 K;  3QOP A;  3V7R A;  2QQA A;  2PLY A;  1JHF A;  3PQJ A;  4AIH A;  1STZ A;  1GVJ A;  3ZPL A;  4CDG A;  5E1W A;  5CVJ A;  2IP2 A;  2VBY A;  1IN6 A;  3EQL F;  2XAH A;  2FXA A;  1KU2 A;  4ESJ A;  4A12 A;  4RB3 C;  4IRI A;  3S2W A;  4A6E A;  1I6X A;  3WTX C;  2D2W A;  1BI0 A;  4ENM A;  5FGM A;  3KZZ A;  2VBW A;  4OOI A;  1PUE E;  2VC0 A;  1IW7 F;  3I0T A;  2E1N A;  4RGU A;  3LA7 A;  2XRN A;  3I4P A;  2QLZ A;  3KET A;  2IJL A;  2YR2 A;  4M72 A;  1ZRD A;  3HIF A;  1UHW A;  4DNC A;  2DU9 A;  1E17 A;  5LHH A;  3BWG A;  3E6C C;  2JPC A;  2DPD A;  4EQQ A;  2GAU A;  4KIF A;  3CTA A;  2VC1 A;  1ZRE A;  1E2X A;  5BPD A;  1G4D A;  2BV6 A;  4L5J A;  3E5Q A;  4NB5 A;  3HUG A;  1O3S A;  4OMZ A;  5F64 A;  4KA4 A;  4HAM A;  4LK1 F;  1T39 A;  2LSO A;  4BHC A;  2IRF G;  3E5U A;  2LKP A;  3VOE A;  1ZLJ A;  2FQ3 A;  3BJA A;  1U5T A;  1IXC A;  1MJA A;  1T2K A;  4HV5 A;  4KT5 C;  4DQ2 A;  1KU3 A;  5ICG A;  3B02 A;  4P9U A;  2H6B A;  4ENK A;  2NAZ A;  4MQV A;  2A5Y B;  1JE8 A;  5K1Y A;  2GA1 A;  2O61 A;  5JI6 A;  2KIM A;  3FWE A;  3IWZ A;  5HS7 A;  1XSV A;  5LEJ A;  2XVC A;  5ERI A;  5AIQ A;  4HW0 A;  3FMS A;  3ML6 A;  4A6D A;  2GWR A;  2VOO A;  4MGR A;  4G8X A;  2HKO A;  3I53 A;  5F1R A;  2R7D A;  4EJO A;  4UVC A;  5K5Q A;  3T1B A;  4EGY A;  2QZ8 A;  2TDX A;  3I58 A;  5BOX A;  2L01 A;  2P8T A;  3WGG A;  3U9G A;  2W84 A;  3GLX A;  1SFX A;  5LGN A;  2HQN A;  3N97 A;  1FBU A;  1KQ9 A;  2X0L A;  3IKV A;  3BRO A;  4LMY A;  5HDN A;  4ZYE A;  3BY6 A;  1CGP A;  2HZT A;  1ZN2 A;  3V8J A;  3ABT A;  1OYY A;  3E6B A;  3E3V A;  3SHF A;  3E6M A;  3DPT A;  3BZ6 A;  4ESF A;  3B73 A;  3G3Z A;  2OD5 A;  2VT2 A;  2UZK A;  4U88 A;  3MWM A;  1B59 A;  3DEU A;  3Q5F A;  1Z6R A;  3FM5 A;  3QPH A;  2LNB A;  5A2Q K;  4OIN F;  2R7F A;  1QGP A;  1BC8 C;  1TNT A;  5ED4 A;  3JSO A;  1R7J A;  2D1H A;  3HRM A;  1FBS A;  1IN4 A;  3M8E A;  5H6Q A;  4NHJ A;  5D5V B;  3COA C;  1OYI A;  2CYY A;  4AWX B;  5EEH A;  3ZQ7 A;  2L54 A;  3QRF F;  1G3T A;  1G3W A;  5DUK A;  2UXN A;  3KP5 A;  1HSJ A;  3GZ5 A;  4HOB A;  3BJ6 A;  1TBX A;  4M71 A;  4R79 A;  2RV8 A;  3IKT A;  1DPR A;  2OAZ A;  1XGS A;  2QYO A;  3GEZ A;  1Q1H A;  1R1U A;  2VE8 A;  4M9X A;  1QBJ A;  3LQQ A;  3HHG A;  1FYL A;  4G94 A;  3DP7 A;  3RKW A;  2VOD A;  1HW1 A;  2F5C A;  3J81 Z;  1MD0 A;  2EFW A;  1MJ9 A;  4L18 B;  3F72 A;  1UST A;  5CVI A;  3NQO A;  5DCM A;  5HVQ C;  2DT5 A;  1ZRC A;  3D0S A;  2ELH A;  1B6A A;  4RB1 A;  2KIU A;  2HYG D;  3L09 A;  3WU0 A;  2FMY A;  1D8J A;  3VB2 A;  3ZMT A;  2L4A A;  4M9Z A;  1LB2 A;  1LDD A;  4AIK A;  3I5U A;  4ENJ A;  1WWX A;  1S8N A;  2LF8 A;  1YW9 A;  5F6F A;  1SD5 A;  1YS7 A;  4CXF A;  3T8T A;  4L0Z B;  3FHZ A;  4G7H F;  4ZZD A;  3RJP A;  4HLX A;  3P7N A;  4B8X A;  4OIP F;  4OIO F;  5E1X A;  4GGG A;  1R00 A;  1R22 A;  1BOA A;  2FRH A;  4XSZ F;  2K7L A;  1XN7 A;  4YFN F;  1T38 A;  1W7P A;  1Z1D A;  5L3D A;  4U0W A;  4I09 A;  3I64 A;  4WXD A;  3H3U A;  1FYK A;  1FWZ A;  5AON A;  1QZY A;  2HEO A;  2PBI A;  3EYI A;  1X3U A;  2K02 A;  3GX4 X;  2FSW A;  4WXC A;  2EFO A;  3KEQ A;  4LB6 B;  3HRT A;  1ZG5 A;  3R0J A;  2MC3 A;  4HDU A;  2XAQ A;  2GA2 A;  3CUQ B;  3JTH A;  3HHH A;  2QBY A;  4I7H A;  4LG0 B;  1I5Z A;  3LA2 A;  2A6E F;  4KIG A;  3I59 B;  1EH6 A;  2P6T A;  5BQT A;  2YPR A;  3ECH A;  4KMU X;  4R1H A;  3K1M A;  3P9I A;  3DV8 A;  3K0L A;  4RAY A;  3C1D A;  2NNY A;  1F4K A;  2OZ6 A;  3GFL A;  1JXS A;  3W6J B;  1ODD A;  1SD7 A;  3BPV A;  5HS8 A;  3MFK A;  3VFZ A;  3MQ0 A;  3KP4 A;  1HKQ A;  3JSP A;  1R5H A;  2OA4 A;  4PGG A;  5HLG A;  4EJU A;  4EJT A;  2A07 F;  2J5P A;  3HSF A;  4I2O A;  2GXG A;  3RPQ A;  4BAY A;  1SD4 A;  1EH7 A;  5DYM A;  3EUH A;  1XDU A;  2IA1 A;  2M45 A;  2B0L A;  2DK8 A;  4Y13 A;  4UV9 A;  3F8N A;  3HOT A;  3OV8 A;  4GYI A;  3H92 A;  1K78 B;  1BI3 A;  1TQP A;  2XKO A;  2RQP A;  1SFE A;  1D5V A;  3ZP5 A;  4KN4 X;  1QPM A;  5ICE A;  1C0W A;  4ENN A;  4KN7 X;  3C7J A;  3QPT A;  3CLO A;  1U78 A;  3SZT A;  1ZYR F;  3HSR A;  3DF8 A;  1TW2 A;  4ZZL A;  5TRD A;  1JGS A;  1HW2 A;  4AVP A;  2Z99 A;  1FX7 A;  4LLN A;  1AOY A;  3GZ6 A;  3FXR A;  1HKT A;  1KYW A;  1KA8 A;  2IA2 A;  5HS9 A;  1YIO A;  2GIV A;  1IRG A;  1HST A;  2RC4 A;  3F8B A;  4M6X A;  2IVM A;  3T0Y A;  5EEG A;  1XD7 A;  2FBI A;  3EDP A;  1XCV A;  2FBH A;  3FXQ A;  2VXZ A;  1IF1 A;  2MH9 A;  1Z6T A;  2Z33 A;  3TKY A;  2UWM A;  5DV5 A;  5J6X A;  4CO8 A;  4CGZ A;  4RGR A;  2STW A;  2DQL A;  2QM3 A;  4IHT A;  1P2F A;  2JZY A;  2G9W A;  1K7A A;  2DI3 A;  1QNT A;  3FX3 A;  3KP6 A;  2Z9O A;  1I1S A;  1IXR C;  1MDM B;  4M73 A;  1BI1 A;  4HX8 A;  2F5F A;  3L00 A;  2QQ9 A;  1R23 A;  1I1G A;  4MHG A;  4MTE A;  2XAF A;  3QU6 A;  5HDG A;  1XSD A;  1ULY A;  3MZH A;  2HKX A;  1L3L A;  3CUQ C;  3F8M A;  4L5I A;  4G7Z F;  4CHU A;  1IN5 A;  1T0F A;  3WG9 A;  1FY7 A;  5H20 A;  3LQR A;  2V9V A;  3HSE A;  3PFI A;  2M5W A;  4LD5 A;  4ZYG A;  2G7U A;  1D8K A;  1L0O C;  1KGS A;  2DW4 A;  3H3Z A;  5E17 F;  2W24 A;  2R3S A;  4KIB A;  4U7B A;  4TV7 A;  2W85 A;  3RTR A;  1ZLK A;  2ZCW A;  3F23 A;  5HLI A;  4U7D A;  2F2E A;  1P4X A;  5JFR A;  2P5V A;  4PCQ A;  1R5G A;  4HX7 A;  3TDZ C;  2VBX A;  3DXJ F;  4L9J A;  1O3Q A;  2VON A;  3M1E A;  1XGO A;  3I71 A;  1KQ0 A;  1B4A A;  2UXX A;  1O3T A;  5FB2 A;  4G7O F;  1O57 A;  2H6C A;  1YG2 A;  5E8G A;  1V4R A;  3HTS B;  2L02 A;  5D5W B;  1BI2 A;  5E1Z B;  2H27 A;  2VBZ A;  3ZN0 A;  1G6N A;  1I27 A;  5K5O A;  4OIQ F;  1LJ9 A;  5L3F A;  3MAJ A;  1XGN A;  3JAM K;  1XMK A;  4IRH A;  1SMT A;  2QEN A;  1ZRF A;  3KEO A;  3SZP A;  4EM0 B;  2D45 A;  1P4A A;  2PFB A;  1RUO A;  2EFP A;  2JRT A;  4UHT A;  3LAP A;  3GWZ A;  2EB7 A;  2EV5 A;  2OQR A;  2P5L C;  1EH8 A;  4IHS A;  1RIO H;  1FP1 D;  3F21 A;  4UXN A;  1W5S A;  1QQI A;  2FNP A;  2EV6 A;  1JHH A;  3GYH X;  3SFZ A;  2LDU A;  1Y0U A;  1U3E M;  1KYZ A;  2ISY A;  2YX7 A;  2O6G E;  5LEK A;  2RNJ A;  3SQN A;  3CO7 C;  4O6J A;  3TO9 A;  1BN5 A;  1ZG1 A;  3QAH A;  4HLY A;  4IXA A;  3F3X A;  3BPX A;  1S29 A;  3KZY A;  4I01 A;  1EV7 A;  1F1Z A;  3C18 A;  1ZGA A;  2XRO A;  1WRJ A;  3ZMV A;  4FX0 A;  3LWF A;  5LRR A;  4GYG A;  5LHG A;  2ZME B;  4AD9 A;  5L3B A;  4D0P A;  4KFC A;  2WWY A;  4LB5 A;  1IAW A;  5IT9 K;  1P4W A;  2ZJ2 A;  4G6D A;  4UVA A;  5D6E A;  2O8X A;  3LFK A;  1HBX G;  4RB2 C;  4IF4 A;  4F7Z A;  4I0B A;  1LVA A;  4A0Y A;  4WK8 F;  1OYW A;  3ZN1 A;  2XV4 S;  1FP2 A;  2C6Y A;  1P92 A;  2XKP A;  2ZBK A;  3MEX A;  4Y17 A;  1U6G A;  4HF2 A;  2V79 A;  4LG0 A;  4LLL A;  1FT9 A;  4UUV A;  3CDH A;  3U2R A;  4CIC A;  5D6F A;  2Y48 A;  2HDC A;  3I59 A;  4R8H A;  2DFI A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...