1UB9A

Structure of the transcriptional regulator homologue protein from pyrococcus horikoshii ot3
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
100
structure length
100
Chain Sequence
b'MEELKEIMKSHILGNPVRLGIMIFLLPRRKAPFSQIQKVLDLTPGNLDSHIRVLERNGLVKTYKVIADRPRTVVEITDFGMEEAKRFLSSLKAVIDGLDL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Hypothetical protein PH1061
publication title Structural analysis of the transcriptional regulator homolog protein from Pyrococcus horikoshii OT3.
pubmed doi rcsb
source organism Pyrococcus horikoshii
molecule tags Transcription
total genus 37
structure length 100
sequence length 100
ec nomenclature
pdb deposition date 2003-04-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13601 HTH_34 Winged helix DNA-binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 1ub9A00
1PDNC 3P9CA 5LHIA 2IA1A 2E1CA 2NS0A 1ULYA 5LHHA 3CO6C 4AWXB 4MHGA 1K78A 4A6DA 3V8JA 1O3RA 2X4HA 2HQNA 2V9VA 1Z05A 2F5EA 2DAOA 3QU6A 1G3TA 2EV5A 5BMZA 4LJZF 2V6CA 1FYMA 3COAC 2VC0A 1FP2A 3LAJA 4KA4A 1FWZA 4M6YA 4I0AA 2ZFWA 3R0AA 1BIAA 5E1XA 2M45A 2XAFA 5E17F 2DO7A 3HOSA 3RKYA 5E8IA 3SHFA 3VFZA 1Z6RA 5E8GA 1YW8A 2PMUA 3H3ZA 4HF0A 3O6BB 4KFCA 2P7VB 1GVJA 3ERED 3L2CA 2NAZA 5J8CA 2UXXA 3F3XA 2FE3A 5LRRA 4XBFA 4PZJA 2KJCA 4LK0F 4EVIA 1XGSA 4WCGA 3WTVC 3WE3A 5AIPA 1XDSA 3BJ6A 4L0YB 3R6SA 2JT1A 2AXLA 2Q0OA 5JI6A 4Y17A 4H0EA 1FLIA 1KGSA 5K5OA 1U5TC 4I2OA 4LB5A 3IWFA 1R58A 2MH2A 4MEXF 1J7KA 1USTA 1FSHA 4P5OA 2RVCA 2K02A 4YFKF 1ZAOA 4JBAA 3TDZC 3J7AO 4MNUA 2CG4A 4OU0A 4LG0A 4LLLA 2KIMA 5HS8A 1XSVA 1J9IA 4KYWA 5D5VB 2EV6A 1C0WA 3HRMA 4ESBA 2HYGD 2NRAC 1AWCA 4P9FA 5K1YA 1U5TA 1ZHFA 2EA2A 4L5JA 2ESNA 1KU3A 2PJPA 1FSEA 4ZYGA 4LLNA 4BQAA 1U78A 3LAPA 4M74A 5DCFA 4GXOA 1H0MA 2EFWA 5D8LB 5ED4A 1R22A 1L3LA 3IKVA 4UV8A 1R5GA 4KIGA 1R00A 3QP6A 3BROA 4ENJA 1OPCA 1XMKA 2Q8KA 3HIFA 3QOPA 4S04A 1S6LA 5DCMB 2Z3YA 4FX0A 3F8MA 1XGNA 5BPDA 5FFZA 2GA1A 1ON2A 1ZARA 4MEYF 3CO7C 3GZ5A 4HX7A 1YO5C 2X0LA 3ML6A 4EJVA 5D6FA 5DUKA 5DEQA 5L3GA 3ZQ7A 5ILSA 4O5VA 1G3SA 2EA4A 3KP7A 3EQLF 4M9SA 1HXDA 2ZMEA 4BHCA 4AD9A 1P2FA 1Z91A 2A6EF 4Y13A 5AONA 4EGZA 1G6NA 3P7NA 1LDKB 3I5UA 4NQWA 1W5SA 5DYMA 1XCVA 4M9ZA 1CF7A 1T0FA 2RN7A 1QQIA 2A69F 3RPUA 4A2UA 5A2QK 3JTHA 3R60A 4PCQA 2LF8A 1D5VA 3FM3A 2PQ8A 3Q5FA 1HW1A 3GZ6A 3TQNA 3QPHA 2F2EA 1S7OA 5IT9Z 2P6TA 1YW7A 1EH6A 3EETA 1BI1A 5F6FA 5LGTA 1RIOH 2M8EA 3GF2A 1JXSA 2IA2A 3L09A 1YLFA 3LSTA 4N9HA 3U2RA 4AIJA 4I0BA 1YQAA 2HOEA 2BYVE 4A5NA 3WGIA 3MZYA 3GFIA 1T39A 2QVOA 4AVPA 3HTUA 4ZH4F 2ISZA 5ILUA 2O61A 4CDGA 3H92A 3KP2A 1OYYA 3QPTA 3JTGA 2KRFA 4HLXA 5L3BA 4GCVA 4IVNA 3WTZA 2L4AA 4KMUX 4G7ZF 5E20A 3K1NA 1OMIA 2F5DA 2V1DA 2RNJA 1F1ZA 5HLHA 2EV0A 4RGXA 2D2WA 1YFHA 4EJWA 2QQ9A 2FBIA 1W5TA 4KMFA 2BBYA 5DD8A 1KQ0A 3GEZA 3WGGA 4EGYA 3PQJA 4HA8A 4FX4A 1R1VA 2DI3A 4Q47A 2QBYA 1QGPA 2PG4A 3HUGA 5E1ZB 2M30A 3FHZA 2K4JA 1W7PD 2ISYA 1HKTA 1KU7A 3JSOA 4U0VA 1S7AA 3I71A 3T1BA 5CVRA 4HX4A 5FLXZ 2WC2A 4ENMA 2R3SA 4PGGA 2QQAA 3WODF 1DPUA 3HRUA 2L01A 3D0SA 2J5PA 4BHBA 2OQRA 3RKXA 4OIRF 1J75A 4IPAA 2W25A 3J81K 4XLPF 4PDKA 1G4DA 1CGPA 1KA8A 4EJUA 3F8BA 2L3DA 1K7AA 1FBSA 4M9XA 2MA3A 3RIRA 2HS5A 4M73A 3OOPA 4FHTA 3SQNA 4G94A 2UWMA 3GUDA 2XUBA 4XRFA 3FM5A 2DLLA 1XGMA 1B9NA 5LBQA 2HYFA 4TV7A 4WF2A 1IRFA 4A0ZA 1E17A 1FX7A 2NNNA 4I09A 3GVAA 4ON0A 4OIPF 1MDMA 2ZXJA 5E1WA 1J5YA 2UXNA 4E70A 3RYPA 2CO5A 3GFLA 3ZN1A 3I0TA 1J2XA 2L54A 1ZG3A 2CSOA 3DEUA 5J8FA 3IHUA 2O3FA 4CGZA 3B73A 1IN8A 2IRFG 2R7FA 1ONVA 2ELHA 1R36A 1BIBA 1W7PB 4Q48A 1S8NA 3I59A 4A12A 1T98A 5CVUA 3REOA 4HQMA 5H20A 3OV8A 1JGSA 1ZH5A 3GLXA 2HFHA 1FYLA 1FP1D 3F8FA 1I6XA 2JPBA 1WRJA 2DTRA 2LDUA 1I1GA 4K2EA 4RAZA 5FGMA 1UHWA 3TGNA 2JPCA 1JHFA 2BGCA 1XDUA 2FBKA 2HKXA 3H3UA 3R61A 5HS9A 1TQMA 4KT5C 3LA3A 3CUQC 3LWFA 3TO7A 1EH7A 1ZN2A 3M7GA 1SD6A 3KETA 3C3WA 4IF4A 5L3EA 1KYZA 1HKSA 6PAXA 4KIFA 5D4RA 4DQ2A 4OMYA 1IUYA 3QRFF 2XRNA 2QLZA 2BV6A 1TQPA 2EB7A 5K5RA 1WWXA 2FSWA 2O8XA 2K27A 1D8KA 1XMAA 1IZ1A 4GO1A 4OIOF 2EJRA 2CYYA 2ESHA 3K1PA 2RQPA 2VN2A 3RI4A 3CUQA 2LNBA 2K86A 4LD5A 2VBWA 2WV0A 2FA5A 3HTSB 3WTUC 1LDDA 4EM1A 4I7HA 1ZRDA 2ETHA 3ECHA 3JSPA 1MGTA 1WSUA 3L7WA 3TKYA 1SAXA 4U0WA 1RI7A 1XGOA 3KZZA 1XSXA 2MC3A 1TBXA 1T6SA 3O3KA 2W57A 1V3FA 3WGHA 1BC8C 1G3WA 3FMQA 1DDNA 4EJTA 2O0YA 1GXQA 1IF1A 2XKPA 3LA7A 1S29A 1IN6A 1J59A 4LMYA 4YFXF 4LFUA 4N9IA 1BJAA 4N0BA 1BBYA 3EYYA 1S3JA 1FY7A 3VEPA 3WTWC 3ECOA 3E3VA 1QO0D 5ICEA 4OINF 3E6MA 4KN4X 3SFZA 3WTSC 2EFOA 2VOPA 5HS7A 4KICA 3ZN0A 2XIGA 2R7DA 2FMYA 2Z5UA 2PFBA 4RGRA 3T5XA 1STZA 1D8JA 4KN7X 5KK1A 3U1DA 3WU0A 5LGUA 4HLYA 3V7RA 5HDKA 3F22A 1HSJA 1L0OC 4P96A 4XSZF 2L02A 3E97A 2GXBA 1RNLA 3TDUC 1OR7A 2AS5F 2RKHA 2LF7A 1LNWA 2M1BA 2VODA 2GQQA 3VOEA 5ICCA 3Q9VA 1LJ9A 2BEOA 3BOQA 3C7JA 3T8TA 3FXQA 2NNYA 4Y15A 2C6YA 2ZKZA 1YS7A 2HTJA 1F4KA 1UHMA 2VXZA 4HQEA 2W85A 3GO5A 4XSXF 1TNTA 4RB3C 3RKWA 2H94A 1RUNA 2FEZA 3S2WA 2F5FA 4L5IA 1FNNA 4CZZA 3V8KA 3BDDA 5J6XA 4D0PA 1AOYA 4U7BA 3BJOA 5LHGA 4IRIA 5HOOA 3T0YA 3I59B 2ZNYA 3BP8A 5DDGA 2WWYA 3KCCA 1HSTA 1ZLJA 2Y0MA 4KDPA 3CTAA 4B8XA 3V7SA 3BPVA 5A2QZ 4GGGA 3Q9SA 1YIOA 2CW0F 1OKRA 1P4AA 1IRGA 5IT3A 1QZYA 4DNCA 4ZYEA 3BJAA 1FC3A 4R79A 2XAJA 2OU2A 3PQKA 5CVIA 3MEXA 3HHGA 3KLNA 4IXAA 4AIHA 1IXSB 2MLGA 2D45A 1YTYA 1K78B 2FOKA 1ZRFA 1BOAA 2V1XA 4GYIA 5K5QA 1R23A 2JTVA 1IXCA 3P9IA 3NQOA 2VE8A 3DF8A 3M9AA 4RAYA 4ENNA 4U88A 4R1HA 2FNAA 1YYVA 1ODDA 3I54A 4GYGA 5LEKA 5HVQC 2V1UA 3V4GA 2H6CA 4WXHA 3WG9A 3EYIA 2MH9A 2GZWA 3QAHA 4RB2C 1IAWA 2HDCA 2ZNZA 2J5OA 2OBPA 2WTEA 3VB2A 5L3FA 2STTA 2A68F 3R4KA 4BHPA 4S05A 1E2XA 4RGSA 4HV6A 3BPXA 1X3UA 2DBBA 2XHKA 2Y75A 1GXPA 2XAQA 2DQLA 3CLOA 2NYXA 1FOKA 4U0YA 4A6EA 1I5ZA 2B0LA 4ESJA 2CFXA 1PP7U 1Z9CA 4RS8A 5BPIA 5LRSA 2FMLA 2IA0A 1FZPB 1YS6A 1XB4A 5L3DA 2ZJ2A 5DV5A 1U2WA 4EQQA 3K9TA 4LK1F 4HZFA 1U3EM 1VTNC 2OZ6A 5H6QA 4NHJA 4A0XA 1V4RA 2FXAA 2QYOA 4CYDA 3B02A 3DPTA 3HSFA 4OOIA 2P4WA 4ESFA 4F7ZA 3E5UA 3L00A 2VT2A 3M8EA 2HKOA 3BZ6A 3LQRA 2G9WA 4BH9A 2DK8A 2K4BA 5HDNA 3EUHA 2VBYA 2FRHA 4LG0B 2LSOA 4UXNA 3J81Z 1RZ4A 5FD6A 1ZLKA 1ZG1A 4ETSA 3MCZA 2D1HA 1U5TB 2RGVA 1KU9A 4I02A 3K2ZA 5D5XB 3F8CA 1ZGAA 1HW2A 1WI9A 2FQ3A 1FT9A 1TNSA 3ABTA 3F23A 2HQRA 1I1SA 2BE5F 1R1UA 1Z7UA 3MFKA 3MZHA 3R0JA 2ADUA 1FYKA 1ZGJA 1P6RA 1HW5A 2F5CA 3ELKA 3CJNA 2RDPA 4YIIA 3KEQA 4QLCU 2VBZA 2XV4S 1ZYRF 3E6CC 3LFKA 2M5WA 3J80K 5D5WB 3I64A 3FX3A 4JQFA 1YW9A 2H27A 2H09A 4M6XA 2PMHA 4EV0A 1IW7F 1PP8F 2FBHA 1SFXA 3KP6A 2COMA 1RUOA 1KQ8A 5KVRA 2ZMEB 1O7FA 1LDJA 2MLKA 3GFMA 4IRHA 3ZMDA 4L9TA 2IT0A 3I53A 4UHTA 5DCMA 1CF7B 4IHSA 1B59A 2ZCWA 5F1RA 5DD4A 1O3SA 4JK1X 2STWA 4HYEA 5TJJA 1W4MA 2W84A 1DPRA 1IN5A 1BC7C 3TO6A 2P8TA 3D5LA 1XN7A 1BI0A 3DFGA 4YFNF 2CGPA 2HGCA 2ZBKA 4PGHA 1QNTA 2JRTA 3JAMK 1SMYF 4KIBA 1R7JA 4L0ZB 3WTYC 5LEJA 3MAJA 5JFRA 2TDXA 1LB2A 3ZMUA 2EFNA 1LQ1A 4CO8A 3ZMSA 5FFXA 2MD5A 2HEOA 2VE9A 2FNPA 2PN6A 2DPDA 5CJ9A 4MTEA 3MWMA 3F21A 1R1TA 3WE2A 5CVVA 3G73A 4O6JA 4HOBA 2YU3A 3N97A 4KNYA 1QBJA 1NHAA 3PFIA 1P92A 2EWNA 3KP4A 3RYRA 3ULQB 1GHCA 5JR3A 3IC7A 2IJLA 2IPQX 1OYWA 4G7OF 2IVMA 2OD5A 2QZ8A 5HLGA 1LEAA 4L9NA 3AAFA 4HBLA 5ERIA 2QQBA 1B4AA 1TW3A 3K69A 3M8FA 3IRRA 4BNCA 4UVAA 3DQVC 4UVCA 3L9FA 4U7DA 1MJBA 2P5KA 3FXUA 2HZTA 3BWGA 1J0RA 3MQ0A 1SD5A 4B09A 3ZP5A 1DUXC 2DW4A 2QBYB 4P55A 3IL2A 4G7HF 1G3YA 4CXFA 3CDHA 5CVJA 3WU1B 2A61A 1KQ9A 1TW2A 3K1MA 3ROUA 2OAZA 3EDPA 1IN4A 4MTDA 4FT8A 3W6KB 2GXGA 2P6SA 5L3CA 3E5QA 2VONA 4IHTA 4KUMA 5D4SA 4BAYA 1FBQA 4I01A 2L4MA 3NRVA 4ZZLA 5FO5A 1F9NA 1MZBA 2ZO4A 3QP5A 3CUOA 1DP7P 4RB0A 3E6BA 2HR3A 2P5VA 3DP7A 1T2KA 1H9TA 1QPMA 2DT5A 1K79A 4LB6B 3ZPLA 3WTXC 2DPUA 5E18F 3HRSA 5BQTA 2XKOA 2GA2A 5DUIA 1MJ9A 4HW0A 1F5TA 2GIVA 3ABUA 4G6DA 1MDMB 4Q5SF 1U8RA 3JW4A 4ENKA 4XLNF 3E6DA 2P5LC 4MGRA 3KZYA 1P4WA 2RV8A 1FPQA 4HAMA 1UB9A 2DQRA 3FZVA 1EV7A 3KFWX 5H6RA 4RB1A 3KP5A 1B9MA 1Y0UA 3ZMTA 1EH8A 2Z99A 4A0YA 1USSA 3TO9A 2Z33A 4WK8F 3M1EA 2KIUA 3DXJF 3I58A 1O7LA 1T38A 1Q1HA 1UFMA 3GYHX 2YR2A 1XD7A 4NB5A 1ZREA 1O57A 1R5HA 4ZYHA 1OYIA 2FU4A 4P9UA 2QM3A 4LGWA 4RGUA 2XAGA 2PBIA 3HYIA 1MJAA 1K6OA 2E7WA 5LGNA 2H6BA 4WX9A 3SXYA 1W7PA 4EM0B 5LLQA 3HSRA 1IXRC 4ZYDA 5ILVA 3QU3A 4BYYA 1BN5A 5D5UB 1SFUA 1FBUA 4EMSA 3TOBA 2W24A 3C1DA 2A07F 1Z6TA 4OIQF 4Z2YA 2VBXA 4BXUA 3CUQB 1BM9A 1JE8A 2OZUA 2KJBA 5EEHA 3O2PE 4L9VA 4MQ9F 5ICGA 3FF5A 2YPRA 3U9GA 5FB2A 4G8XA 4YIFA 2PLYA 4WWCA 5IT9K 1SMTA 2XASA 3I4PA 2IW5A 1ON1A 3K0LA 4O3MA 2V79A 3IWZA 3P9KA 1H9GA 1O3QA 3DPLC 3ISPA 3NEUA 4YG2F 3N4MA 1TTYA 1XSDA 3C18A 3V8LA 2JSCA 2ACJA 2KIFA 4HV5A 3GFJA 3KE2A 1SD4A 2MBFA 2G7HA 3WTTC 2E7XA 2IP2A 2K7LA 2EK5A 5HLIA 4M71A 3RDIA 2A6HF 2O6GE 3HHHA 2Y48A 1HQCA 4QWQA 1WQ2A 4LLGF 4HDVA 3GW2A 2FF4A 3ZMZA 3RJPA 1B1BA 3KEOA 2OQGA 3GXOA 1D3YA 3SZPA 4HF2A 4HF1A 4R8HA 4HDUA 2Q2EA 2XAHA 4OMZA 4CHUA 4I98B 3IRQA 2YX7A 1ZG5A 1P4XA 4UNOA 5D6EA 1PUEE 2M87A 1KYWA 2QWWA 4EM2A 5BOXA 3DKWA 1BI2A 5JHUA 2XGXA 5CYVA 2HTSA 2EFPA 2G7UA 5CLSA 1IN7A 2A3SA 2RC4A 4G6QA 5BS6A 5AIQA 3FXRA 3G3ZA 1LEBA 2QUFA 1BI3A 4L18B 4HX8A 3F6OA 4IJAA 5EEGA 3J80Z 5FLXK 3LQQA 2VOOA 4ASNA 4WXCA 5D8KB 3HSEA 4UVBA 3F72A 4A5MA 2DU9A 2XROA 4AIKA 3KLOA 1U6GA 1HBXG 1TLHB 1O3TA 1TQIA 2DFIA 3GWZA 5ICFA 2YSRA 3ZMVA 1WKMA 1YG2A 2A5YB 2QENA 3V7CA 2Z9OA 1A04A 4L9JA 5JVTA 3VODA 1KU2A 1REPC 1QZZA 3SZTA 1Z1DA 4EJOA 1HKQA 2VT3A 2PI0A 3E5XA 3HRTA 1B6AA 5FD5A 2XVCA 1LVAA 3T8RA 1XCBA 3W6JB 1SFEA 2PEXA 3DV8A 3HOTA 3JAMZ 4CICA 3LA2A 2CWEA 4M72A 3FMSA 5HDGA 2YX4A 1UCRA 1ZRCA 4WXDA 2HWVA 1SD7A 4UUVA 3RPQA 3FMRA 2EFQA 3TOAA 4IRGA 2KKOA 2P7CB 3BY6A 1I27A 5F64A 3FWEA 4MQVA 2VC1A 2JZYA 4G9YA 1MD0A 2GWRA 3IKTA 2O03A 4UV9A 3F8NA 1MKMA 4ZZDA 2DK5A 5TRDA 2LKPA 3KP3A 3F6VA 4Q4ZF 3GX4X 3RTRA 2CQKA 2UZKA 1JHHA 2E1NA 2OA4A 2D1VA 2GAUA
chains in the Genus database with same CATH superfamily
1PDNC 3P9CA 5LHIA 2IA1A 2E1CA 2NS0A 3W2VA 2M3AA 1ULYA 5LHHA 3CO6C 4AWXB 5IY5H 4MHGA 5DM6F 1ZGWA 1K78A 4B43A 4XRSG 3BQYA 2FQ4A 3K70C 4A6DA 3V8JA 4B1RA 1O3RA 3CCLI 2X4HA 2IS2A 2EZKA 2HQNA 2V9VA 1Z05A 2E36A 4M3DA 2F5EA 2L7FP 2DAOA 1X1BA 3QU6A 2R7QA 4ZDLA 1DQUA 1G3TA 2EV5A 5BMZA 4LJZF 2V6CA 4RBOA 1FYMA 3COAC 2VC0A 3N05A 5FJ8J 1FP2A 4JX4A 3LAJA 4KA4A 1FWZA 2XB0X 4M6YA 2E19A 2JN6A 2XB5A 4I0AA 5CKTA 2ZFWA 3R0AA 1BIAA 5E1XA 2JUGA 2M45A 2B63J 2XAFA 4C3JJ 5E17F 3QYFA 2DO7A 3HOSA 3RKYA 5E8IA 3SHFA 3VFZA 1VQ4I 2XSDC 1Z6RA 2CS3A 2O8KA 2PX9A 3FXOA 3S2HJ 5E8GA 1YW8A 2K9SA 2PMUA 3H3ZA 4HF0A 4CH7A 3WHCA 4PFPA 2ZJRF 1SC7A 4A3DJ 1SVLA 3O6BB 4IHVA 2HXIA 3DBHB 1U8BA 3GCMA 2OC6A 4KFCA 2P7VB 1GVJA 3S8PA 3ERED 3L2CA 2DDBA 2NAZA 4OAYA 5J8CA 2UXXA 2Z1DA 2XF7A 3F3XA 4F93B 5FLMJ 2FE3A 5LRRA 4XBFA 1X2MA 2QEXI 2PMZN 4HG2A 2W7NA 4PZJA 2KJCA 2JA6J 4LK0F 4EVIA 3G6EI 2DMNA 2Q2EB 1XGSA 4HNVA 3KYDB 4WCGA 1TWGJ 3WTVC 2FOWA 3WE3A 4BBRJ 2LRDA 2VL8A 4BY1J 4W97A 1K83J 5J40A 5AIPA 1MMDA 4X6AJ 3DBLB 1XDSA 3BJ6A 2NOJB 3HM5A 3DTKA 3VPRA 4L0YB 2DFEA 3H5NA 2E1MC 2WADA 2IBDA 3R6SA 2JT1A 2AXLA 2Q0OA 5JI6A 1GT0C 4Y17A 4RAFA 4H0EA 1FLIA 1KGSA 4CUGA 2AQFA 2KDZA 3SDGA 4XOTA 5K5OA 3CCJI 1U5TC 3HBLA 1HCRA 4I2OA 3S1NJ 2DMUA 3CMAI 4LB5A 1Y39A 4QPQA 3IWFA 3KYCB 3LSMA 3SJMA 4OAZA 1QVTA 4YELA 4XLCA 3DLAA 3L2UA 1R58A 1YJNI 2MH2A 3BG3A 2W1OA 4MEXF 1J7KA 1USTA 3ZQHA 1FSHA 1OQYA 3M8JA 4P5OA 2RVCA 2K02A 1HC8A 2XGDA 2XF5A 4YFKF 2HVSA 1D0XA 1ZAOA 3BR1A 2KQRA 3Q0UA 4JBAA 2R92J 3TDZC 4XQFA 3OYBA 3J7AO 5EF6A 4MNUA 2CG4A 3WHBA 2HDWA 1Y1VJ 4OU0A 5GAGJ 1X1PA 5F04A 4LG0A 1IC8A 4LLLA 2KIMA 5HS8A 1XSVA 3S16J 1TWFJ 1J9IA 4KYWA 5D5VB 3OWTA 1X2NA 2EV6A 3OYCA 1C0WA 3HRMA 4ESBA 3OYFA 1GLNA 2HYGD 2NRAC 1AWCA 4P9FA 5TGTA 2KHMA 5K1YA 1U5TA 1ZHFA 4BQOA 1HDPA 2EA2A 4L5JA 2ESNA 1KU3A 2PJPA 1FSEA 1YITI 3OY9A 4ZYGA 3DWLE 4LLNA 4BQAA 5IYBJ 1U78A 1B8IB 3M07A 3LAPA 4M74A 5CPRB 3OYEA 5DCFA 5IYCJ 2CFOA 4IQ4A 4GXOA 1H0MA 2EFWA 5GADJ 5D8LB 2LY9A 5EZHA 1R22A 5ED4A 5J47A 2ZMEC 3ABLH 1L3LA 3IKVA 4UV8A 1R5GA 1A5JA 4KIGA 1R00A 3QP6A 3BROA 3OS1A 5F0CA 2IGNA 4ENJA 1OPCA 1XMKA 2Q8KA 1K4TA 1MBKA 3HIFA 3QOPA 4S04A 1S6LA 5DCMB 2Z3YA 2OCEA 2PJRA 1IG7A 3CCUI 4FX0A 3F8MA 4NC7A 1XGNA 2AXTC 5BPDA 2EIJH 3HOUJ 2GA1A 5FFZA 1ON2A 3AL0B 3H1CA 1ZARA 4MEYF 1IJWC 3CO7C 4XORA 1QU3A 1PJRA 3GZ5A 4HX7A 1YO5C 2X0LA 1Z7LA 1NK3P 3ML6A 3WU2C 4EJVA 2YU9J 1A31A 5D6FA 5LD2C 1E0EA 5J3LA 2Y0SA 5DUKA 2OV7A 1WVRA 4FQGA 5DEQA 3K70D 1VFCA 5L3GA 4N4NB 3ZQ7A 3CCRI 1VI0A 5ILSA 4ZJZA 3JCUC 2Y2ZA 2DYRH 4O5VA 4IQJA 2B7EA 4BDZA 1G3SA 2EA4A 3VYTB 2JA8J 1LKXA 4ABZA 1WH5A 3W2AA 3J7AY 1VQ5I 3LFUA 5E3OA 3KP7A 3EQLF 4M9SA 3FK6A 3G71I 1HXDA 2ZMEA 4BHCA 5M5XJ 4AD9A 2X6XA 1P2FA 1Z91A 2A6EF 4BJ5C 1Z3XA 1Z77A 2WB1N 4W1UA 5AONA 4C30A 4EGZA 4XKWA 3HZJA 1G6NA 2WY8Q 5CQEA 4ANJA 3P7NA 1JKRC 1LDKB 3BLYA 3I5UA 4NQWA 1RR8C 1W5SA 3NWSA 5DYMA 1XCVA 2EBIA 2I8DA 4M9ZA 1DGRM 2IEKA 2LC2A 3G1MA 3O8GA 2Y31A 5M5WJ 1CF7A 3CMMA 2HOTA 1WJBA 1T0FA 1I3AA 2RN7A 4MIMA 1QQIA 2A69F 2OJED 3RPUA 4A2UA 5A2QK 3JRAA 3JTHA 3R60A 3DKXA 2CRGA 2LF8A 4PCQA 4UUSA 2X9DA 3ZQLA 1W0TA 1D5VA 3FM3A 2DA7A 1W36C 5B5EC 1R6RA 2PQ8A 3Q5FA 1HW1A 2EILH 3GZ6A 3G1OA 3TQNA 3QPHA 1X1AA 4PJMA 2DTZA 2LKSA 5IOZA 3M1CA 2F2EA 5GPCA 1S7OA 5IT9Z 2P6TA 1YW7A 3HOWJ 1EH6A 2R5YA 3EETA 1BI1A 5F6FA 5LGTA 1RIOH 4UB8C 2M8EA 3GF2A 1JXSA 3L2QA 3RZDJ 2IA2A 1LFPA 4XK4A 3K4LA 1ETWA 3L09A 1ZKGA 2X6YA 1YLFA 3LSTA 1H89C 4PJLA 4N9HA 3CMEI 2JA2A 2IS1A 3U2RA 5KNLA 2WBMA 2ELKA 4AIJA 4I0BA 4XN3A 3PIOF 1YQAA 4S0HB 2KLOA 2HOEA 2BXZA 2ZJPF 1HA8A 2BYVE 3OYJA 2TCTA 4A5NA 3WGIA 1ETXA 4DW6A 3MZYA 2YUSA 2L9VA 3GFIA 2KRHA 4D1QA 1T39A 2QVOA 4BQQA 3PNYA 1XPXA 4AVPA 3HTUA 4ZH4F 3IAS2 4E7JA 3UKGA 1D1AA 2JWTA 2KDOA 1ZR2A 4C2TA 1TWAJ 1FOXA 1J09A 4D9JA 2ISZA 1MNDA 4HSRA 4XM3A 5ILUA 2VPRA 4A3LJ 3ZCOA 2O61A 4CDGA 3DTEA 3H92A 3KP2A 3K7AJ 2Z2SB 4BDYA 1HDDC 5HLTA 1XX5A 1OYYA 1BA5A 4BU2A 3QPTA 3JTGA 2KRFA 4BJ6C 2IGOA 4HLXA 5FKOA 4DGWB 2V6EA 5L3BA 3CP8A 3HC7A 2BW3A 4GCVA 4IEJA 4IVNA 3WTZA 2L4AA 3ZQQA 4C3HJ 4KMUX 2V4JC 4ZTJA 1JTYA 4G7ZF 2E5ZA 4RM3A 5E20A 3K1NA 2LOOA 1UELB 1OMIA 2F5DA 2IXSA 2V1DA 1RC9A 4XRSA 2RNJA 3JR9A 3I56I 1F1ZA 5HLHA 2EV0A 4RGXA 1YRNB 2CQQA 1IUFA 2D2WA 3H5RA 1YFHA 3K4KA 4EJWA 3ZOBA 2QQ9A 2CU7A 2ZB9A 2FBIA 3H5AA 2M4GA 1W5TA 4KMFA 2BBYA 5F0HA 5DD8A 1LVKA 1KQ0A 2EPFA 3GEZA 3WGGA 4EGYA 3BCBA 1WJEA 4KISA 2K40A 4BGDA 3PQJA 1FOWA 2QF7A 2W4SA 4HA8A 3S17J 2O9LA 4QPOA 4FX4A 2VKDA 1R1VA 2D5VA 1Y8RB 1OCTC 3SEQA 2DI3A 4Q47A 2QBYA 1QGPA 2PG4A 3HUGA 5E1ZB 2M30A 3FHZA 2K4JA 1W7PD 2KZVA 2E60A 3GTJJ 2ISYA 4PJJA 1HKTA 1KU7A 3JSOA 2AHQA 4A3IJ 4U0VA 3FXJA 2CQXA 1S7AA 5B3SH 3I71A 4NC8A 3T1BA 2LREA 4CCNA 5CVRA 4DZJA 4HX4A 4V2FA 1QRYA 1AU7A 5FLXZ 5EJCA 2LLKA 2WC2A 4ENMA 2R3SA 4PGGA 2QQAA 1A36A 2MYSA 1WZ2A 3WODF 3PM1A 3LL7A 2DODA 1DPUA 3L2VA 3HRUA 1ETOA 4ITVA 3LSPA 2OUMA 4LIVA 2L01A 4YIRX 3GTQJ 1VF9A 4HNUA 3D0SA 2J5PA 3MKYB 4BS9A 4BHBA 2OQRA 4OIRF 3RKXA 1J75A 1TL8A 2DOAA 2M7BA 1Z21A 3SYTA 2BY0A 4BJTA 4IPAA 2KIQA 2W25A 3J81K 4BEHB 4XLPF 4PDKA 1G4DA 3LSKA 1CGPA 1KA8A 5FROA 3HDDA 4EJUA 3F8BA 2L3DA 3K4JA 3F0CA 1K7AA 1FBSA 1IRXA 2BY1A 4M9XA 1RRJA 3TW7A 1M1EB 2MA3A 2LTPA 3RIRA 4Y7NJ 5IPAA 2HS5A 4M73A 3UNGC 3OOPA 4FHTA 4E7LA 1AKHA 4H4KC 3CCEI 3SQNA 1FIPA 1JKOC 3NAUA 1VQ8I 4RDUA 4G94A 4E6KG 2UWMA 3GUDA 2LYCA 2NXNB 1GUUA 1QPIA 2XUBA 3A4CA 1W36D 4XRFA 4FCYA 4F55A 1JT6A 3FM5A 2V7FA 2DLLA 1XGMA 3OMYA 1EA3A 1H88C 2K9NA 1X3ZB 2ECBA 2X48A 1B9NA 5LBQA 2HYFA 4TV7A 4WF2A 1WCMJ 4P1WA 1IRFA 4A0ZA 1E17A 4FE4A 4HSTA 2R7XA 1FX7A 3BR0A 2NNNA 3CCQI 4I09A 3GVAA 4ON0A 3OYKA 4II2A 4X0GA 4OIPF 2R0QC 1HOMA 1MDMA 2ZXJA 5E1WA 1J5YA 2UXNA 5GP9A 3RYPA 2GOXB 4E70A 2CO5A 3GFLA 1S5LC 3ZN1A 3D5SC 5EG0A 1POGA 3I0TA 1J2XA 4EEFG 2L54A 1LPQA 4XLHA 1ZG3A 2CSOA 2ZC2A 3DEUA 5J8FA 3H35A 2JJ7A 3IHUA 1R4NB 4PK4A 2O3FA 4CGZA 2VKVA 3BTJA 2L7KA 3B73A 4E4HA 1KZHA 2FD5A 1IN8A 3KIOA 4PSWA 1X4OA 2Y30A 2IRFG 3MN2A 2DOFA 2KMUA 2R7FA 1RPWA 1F36A 3BZKA 3CJQB 1ONVA 2ELHA 1R36A 1BIBA 1W7PB 5HNHA 4Q48A 1S8NA 3I59A 4A12A 1T98A 5CVUA 3REOA 4HQMA 5H20A 3ZQIA 4BE0A 3OV8A 1JGSA 2COBA 1ZH5A 2V1NA 3GLXA 3UR3C 3CESA 2HFHA 4YRVA 1FYLA 1FP1D 3F8FA 1I6XA 3IV5A 1PUFA 2JPBA 1WRJA 2DTRA 1LUJB 2LDUA 4V19K 1I1GA 4K2EA 4RAZA 5FGMA 1UHWA 3TGNA 2JPCA 1IDZA 2OTLI 1FTZA 1MBGA 1JHFA 2BGCA 1XDUA 4HRIA 2FBKA 2HKXA 3H3UA 3R61A 4RAGA 5HS9A 4U87A 4GDFA 2GOMA 3BR2A 1TQMA 5EGOB 4KT5C 1ZTRA 3LA3A 3CUQC 3FXLA 1MBHA 1OCOH 5E3MA 1XG1A 4I76A 3LWFA 1WH7A 3TO7A 3U21A 1EH7A 1ZN2A 3M7GA 5JVGF 2LP0A 1SD6A 4LG3A 3ONQA 1YOVB 2DXIA 3KETA 3C3WA 4IF4A 1MMGA 1ZELA 2DA2A 2BHYA 5L3EA 1BJZA 1PVEA 1KYZA 5M3FJ 1HKSA 5FKLA 6PAXA 4KIFA 2JA7J 3QPLA 3A0HC 5D4RA 1YX5A 4DQ2A 4OMYA 1IUYA 3MZ8A 1D0ZA 2XRNA 3K4BA 2QLZA 3QRFF 2WB1A 4DBQA 1TP4A 2BV6A 2V9PA 1BL0A 4FISA 1TQPA 4GFBA 1Z0XA 3QWLA 9ANTA 3GTOJ 2EB7A 5K5RA 1WWXA 2FSWA 2O8XA 1Y1WJ 4UUTA 2M9HA 2K27A 2NVTJ 4QIWN 1D8KA 1HLVA 1XMAA 2O5RA 1IZ1A 4GO1A 2R7VA 4A3EJ 4Y33A 4OIOF 2EJRA 2CYYA 2ESHA 1UHSA 3K1PA 1ITYA 3SDBA 2RQPA 2VN2A 3RI4A 3OSGA 1TT0A 3CUQA 2LNBA 4GRIA 1UJ8A 3K4CA 2LBFB 3TW6A 2K86A 3CP2A 1A35A 3A01B 5B66C 1OCZH 4LD5A 1RESA 2VBWA 2WV0A 3W3CA 2FA5A 3HTSB 3WTUC 1MMAA 1LDDA 4EM1A 4I7HA 1ZRDA 2ETHA 3ECHA 4LIUA 3JSPA 3AKZA 1MGTA 1WSUA 3L7WA 4J19A 3TKYA 2VJ5A 1ZQ3P 1SAXA 4AC0A 4U0WA 1RI7A 1XGOA 2R7SA 3KZZA 1XSXA 1JUMA 3Q3SA 2MC3A 1TBXA 1T6SA 3FISA 3O3KA 2W57A 2DCEA 1V3FA 3WGHA 1BC8C 3CQZJ 1G3WA 5IP7J 3FMQA 1DDNA 1MMNA 4EJTA 5GTIC 2O0YA 3VYSB 5FKMA 2GM4A 1GXQA 3ZQFA 2HQAA 1IF1A 3BG9A 2XKPA 3LA7A 3H3VK 1S29A 2E35A 4ZTFA 1IN6A 1J59A 2VQLA 2M2EA 2F4IA 4LMYA 1JI8A 1WPKA 4LFUA 4YFXF 4N9IA 3NWTA 5EYRA 1BJAA 4N0BA 1BBYA 3EYYA 1S3JA 1FY7A 4PFOA 3VEPA 3WTWC 1ACIA 1G8XA 3ECOA 3E3VA 1QO0D 2CH0A 5ICEA 1SAUA 1OR7C 2OCCH 4OINF 3E6MA 1GV2A 1FMVA 1W5CC 4KN4X 3SFZA 3CCSI 2MGQA 3WTSC 2R7OA 3CDLA 3DBRB 1MNMC 3A03A 2EFOA 3KYLA 2VOPA 1UAAA 5HS7A 3SFIA 4KICA 3ZN0A 3PNTA 5C4JJ 2XIGA 2R7DA 2FMYA 2Z5UA 3I9V2 2PFBA 1X19A 3GTKJ 4RGRA 4XLAA 3T5XA 1STZA 3P5JA 2KISA 3S93A 2N8GA 2KP6A 1D8JA 4KN7X 5KK1A 4XONA 3U1DA 4Y13A 3O8HA 2ZJQF 3WU0A 4XIDA 2BY2A 3MKLA 4BKXA 4RLQA 3MD2A 5LGUA 3GLLA 4NDLA 1B72B 4HLYA 3V7RA 5HDKA 3X2QH 3MVPA 3CMYA 3F22A 1HSJA 5C3EJ 2OF7A 1L0OC 1ETQA 4P96A 4XSZF 2KRCA 2L02A 2L9SA 3E97A 2IGMA 1VQNI 2GXBA 2CUZA 4HNTA 4XICA 1FEXA 1WJ5A 1RNLA 3TDUC 1OR7A 2QKMB 2AS5F 3S1QJ 2YS9A 2RKHA 2LF7A 1LNWA 2L9RA 2M1BA 5J1YA 2VODA 1I6HJ 2LG4A 2GQQA 3QYBA 3VOEA 5ICCA 5K7HA 2OPTA 3DLLF 3KEYA 3Q9VA 1X1CA 1W1WE 1LJ9A 2BEOA 3BOQA 3ESWB 4DJAA 1T8IA 1H8AC 3C7JA 3JRCA 1ERDA 2QSGX 2LMDA 1GVDA 2O7OA 3T8TA 3PJRA 3FXQA 3OYDA 2NNYA 4Y15A 1IO2A 2C6YA 2L2OA 2ZKZA 2CUJA 2R7UA 1YS7A 2HTJA 4UB6C 4BUPA 1F4KA 2VJ4A 1UHMA 5F1JA 2VXZA 4HQEA 2M4KA 2W85A 2L5QA 3GO5A 3EPZA 4XSXF 1TNTA 4RB3C 4A3BJ 3VWBA 3RKWA 5J4VA 2MG4A 2H94A 1RUNA 2FEZA 2GXAA 3GMEA 3S2WA 4AIDA 2F5FA 4L5IA 1FNNA 3H9GA 3ZQCA 2ID6A 2F48A 2M8GX 4CZZA 2JQ7A 3V8KA 5EG0B 3GTGJ 3BDDA 4JX5A 4XKCA 3SZGA 5DTDA 4D0PA 4D5FA 5J6XA 4IKFA 4IX7A 2JA5J 1AOYA 4U7BA 3JRGA 3BJOA 5LHGA 1JTXA 4CCJA 4IRIA 5HOOA 4DYCA 3L2WA 1MNEA 1ETKA 2HVRA 3T0YA 1WHUA 3BG6A 2R5ZA 3I59B 1PYVA 2ZNYA 3JREA 3BP8A 3ZR8X 5DDGA 2WWYA 3KCCA 1V5GA 2LR8A 4IHWA 1HSTA 2XPUA 1ZLJA 3DEWA 2Y0MA 2XPWA 4KDPA 3CTAA 3TEDA 4B8XA 3V7SA 1OCCH 2BY3A 3BPVA 3PFYA 2VUMJ 5A2QZ 4GGGA 4II3A 5J4YA 3Q9SA 4E7IA 2HVQA 2GBYA 1W0UA 2P0WA 2H1KA 4ZC3A 5E3NA 3CJRB 1YIOA 2DT7B 2CW0F 4CA0A 1OKRA 1P4AA 1IRGA 5IT3A 1QZYA 4ZYAA 4DNCA 4ZYEA 3BR3A 5DS9A 2WAFA 3BJAA 2LY2A 1FC3A 4E7HA 3J7ZI 2JUCA 3WG7H 2ME6A 4F91B 4R79A 2XAJA 1RR7A 2E34A 2OU2A 3PQKA 3OIOA 5CVIA 3A0BC 3MEXA 3HHGA 1K61A 2VXDA 3KLNA 2CUFA 4IXAA 1T33A 4PUSA 4QSHA 3TP3A 4AIHA 2HZDA 4CYCA 1IXSB 2HOSA 2MLGA 2K3PA 3OYLA 2XDVA 2D45A 3JRIA 2BVLA 1YTYA 1K78B 2M0CA 1NTCA 2LD5A 1BOBA 1OCPA 2FOKA 2W82A 2X85A 1ZRFA 1BOAA 2V1XA 4GYIA 5K5QA 1R23A 2JTVA 3AG3H 2E5NA 1IXCA 2W48A 2CMPA 3NQOA 3P9IA 1YHQI 2VE8A 4A93J 3DF8A 2CQNA 3M9AA 4RAYA 4G6TB 4ENNA 4U88A 4R1HA 2FNAA 2W00A 1BW5A 3RSNA 1YYVA 1X1DA 1D1BA 2CW8A 1ODDA 3I54A 3QODA 3OL4A 4GYGA 4XKBA 1WJFA 5EZGA 5LEKA 5HVQC 2V1UA 3V4GA 2H6CA 4WXHA 3I4MJ 3H9QA 3WG9A 4BXXJ 3EYIA 2MH9A 5FRNA 2GZWA 3QAHA 1WGXA 4RB2C 1VQLI 3K10A 1IAWA 4JOMA 3PIPF 2HDCA 3LSRA 2ZNZA 4B48A 2J5OA 2OBPA 1JUPA 2DJNA 2RAEA 2WTEA 2VJJA 2KZGA 2HXOA 2FUG2 3VB2A 5L3FA 2L7MP 3GZNB 2STTA 2V9KA 2A68F 4B3XA 1S9HA 3R4KA 4BHPA 3OIPA 4S05A 1E2XA 2XGEA 4RGSA 4HV6A 3BPXA 1X3UA 2DBBA 3EUAA 2XHKA 1GV5A 2XPVA 2Y75A 3OSFA 1R4MB 1WJDA 3OR1C 1GXPA 2XAQA 2DQLA 3CLOA 2NYXA 1FOKA 4CCLA 2DOEA 3E7LA 4U0YA 3C2BA 2R7RA 4A6EA 1I5ZA 2DA1A 1WJAA 2B0LA 2DMTA 4ESJA 2CFXA 1JKPC 1IGNA 2VKEA 1PP7U 1T08B 1G59A 1Z9CA 2GLOA 2OTJI 3S1MJ 4RS8A 2Z16A 3BCAA 5EDNA 3IH3A 3HXLA 5BPIA 5LRSA 2LH9A 2ZXHA 3DKYA 3HKZA 3RQIA 3EUHC 2FMLA 2VQCA 2IA0A 3GTPJ 2HI3A 1FZPB 1YS6A 3U1KA 1XB4A 5L3DA 2ZJ2A 4DOZA 4M3EA 5DV5A 2IS4A 2R7TA 5KCMA 1U2WA 3HJEA 4EQQA 3K9TA 2ZSIB 4LK1F 4HZFA 1U3EM 4B47A 1MH4A 4IZZA 2CUEA 1VTNC 3CC4I 2OZ6A 3FXKA 5H6QA 4KITB 4NHJA 3HEFA 4A0XA 1OCRH 3BR6A 2DJIA 3PO3J 3VYRB 3OR2C 1V4RA 2FXAA 3BZCA 2MD0A 1JUSA 2QYOA 3RKQA 1UMQA 4CYDA 3F9KA 3B02A 3DPTA 3VSKA 2NOGA 3EUKL 1Z3YA 3HSFA 4OOIA 3K4MA 2P4WA 4ESFA 4F7ZA 3E5UA 3L00A 5GAEJ 3S3MA 2VT2A 3M8EA 2HKOA 1A6QA 3BZ6A 2F5VA 3W2WA 3LQRA 2G9WA 4BH9A 4RLFA 4BE1A 2F6CA 3RPUD 2DK8A 2K4BA 2VPLA 1V55H 5HDNA 3EUHA 1LFUP 2HPMA 2VBYA 2FRHA 4LG0B 2DMQA 3A1YA 1NH3A 2LSOA 4MO7A 4UXNA 3J81Z 3J7YJ 2DFHA 1RZ4A 2M0MA 2E1MB 1K4SA 3FBNB 5C44J 5M3MJ 5FD6A 2FJ1A 1ZLKA 1EKEA 5F27A 3ERMA 1ZG1A 1NG7A 5K7FA 4ETSA 3MCZA 2XGCA 2D1HA 1U5TB 2RGVA 1DP3A 1KU9A 2WV1A 3K2ZA 4I02A 5D5XB 4FTHA 1QZEA 3F8CA 1EJ9A 4YEJA 1ZGAA 2Y9ZA 3KZIC 1HW2A 1WI9A 2DA4A 1T95A 2FQ3A 1YJWI 4A3JJ 3BT9A 1ZR4A 4AVZA 1FT9A 1TNSA 2E2IJ 1ZK8A 3ABTA 3F23A 4IHXA 2HQRA 1I1SA 2BE5F 1SFKA 3FKJA 2LVSA 5FKKA 4NNJA 1X3WB 1TC3C 1R1UA 2XF6A 2PJRB 1Z7UA 3MFKA 3MZHA 3R0JA 5K7ZA 2DA5A 3ZXSA 1MSEC 2ADUA 1FYKA 1ZGJA 3AL0C 3LSJA 1Q1VA 1P6RA 1HW5A 2F5CA 4D7NA 4IOAF 1VQPI 3ELKA 3CJNA 3HB9A 2RDPA 1IV8A 2X1DA 4YIIA 3KEQA 3AG1H 2HDDA 4QLCU 2VBZA 2XV4S 2R93J 1ZYRF 3E6CC 3LFKA 2M5WA 3J80K 1ORKA 5D5WB 5B1AH 2VLAA 3GBGA 3I64A 3FX3A 4JQFA 1YW9A 5GPAA 2H09A 4M6XA 2H27A 4A3CJ 2PMHA 2KFDA 4EV0A 1IW7F 1PP8F 2FBHA 1B8IA 1SFXA 2DYSH 3KP6A 2M7AA 2COMA 1RUOA 1KQ8A 1MBJA 5KVRA 2ZMEB 4XR6A 1O7FA 1LDJA 2MLKA 3GFMA 1V54H 1DGWY 4IRHA 1P9QC 3ABKH 1ENHA 1WFXA 4I99C 2IAIA 4KJZA 2ID3A 4NQWB 3ZMDA 4L9TA 2EZLA 3BQZA 2IT0A 3I53A 2HU9A 4UHTA 5DCMA 1CF7B 2VIXA 4XKVA 4IHSA 2ZFUA 2QQ8A 1B59A 5KHDA 2ZCWA 3OS0A 4UUSB 5F1RA 3E1SA 5DD4A 3OOUA 3HPGA 1O3SA 4JK1X 5KAIC 2STWA 1FOYA 4HYEA 4BL0B 1NK2P 5TJJA 2X1CA 1W4MA 3CCVI 1FTTA 2LFBA 2V26A 2W84A 1FJLA 1DPRA 1IN5A 1BC7C 3CCYA 3VYUB 3TO6A 2P8TA 2QGUA 2R5YB 3D5LA 4RMNA 4EATA 1XN7A 4KT6A 1BI0A 3DFGA 5LFAA 1E3HA 4YFNF 2CGPA 3A2KA 1VQ9I 2HGCA 2ZBKA 4BE2A 3TBIA 4PGHA 3DTIA 1QNTA 3PO2J 2JRTA 3JAMK 1SMYF 3K6GA 4KIBA 1R7JA 2CV1A 2H1LA 4A3KJ 3BG5A 4L0ZB 2A5WA 3WTYC 5LEJA 3MAJA 1MW7A 3BTIA 2B9SA 1KONA 2DDAA 5JFRA 2TDXA 4ZDPA 1LB2A 1N25A 3ZMUA 2EFNA 1LQ1A 4CO8A 3LMMA 3ZMSA 5FFXA 1VQMI 1MH3A 2EIMH 2MD5A 4XLEA 2HEOA 2VE9A 3HKZN 3JRFA 1EF4A 2FNPA 4D7MA 2HQ5A 3VDXA 2WAQA 2PN6A 1VQ6I 5FLVA 2DPDA 5CJ9A 4MTEA 3V42A 1U9OA 3MWMA 4DIQA 3F21A 2EINH 1R1TA 3WE2A 2R7WA 2VQHA 5CVVA 3G73A 1MBEA 2A6TA 4O6JA 4HOBA 2R7ZJ 2RQQA 2H8WA 1JJ6C 2AQEA 2YU3A 3N97A 4KNYA 5C4XJ 1QBJA 1OISA 2JVGA 1XTAA 3KX2A 3QYEA 1NHAA 2BW3B 3PFIA 1P92A 4HPQA 5B1BH 2EWNA 3CF2A 3KP4A 3RYRA 3ULQB 2UV1A 4AUXA 5JR3A 4C2UA 1GHCA 3MMYB 4XL9A 3CJTB 1YX3A 2IJLA 3IC7A 4A69C 1NG6A 3IAM2 2IPQX 1OYWA 2AO9A 1LFBA 4G7OF 2IVMA 3GTLJ 2EH3A 2HYJA 1UG2A 2OD5A 4LITA 5HODA 4A3FJ 2QZ8A 5HLGA 2E71A 3DCFA 1JJ8C 1LEAA 4AU7A 3S3OA 1OLTA 4L9NA 2DMPA 3S3NA 3TL4X 2JSPA 2K3FA 4BQNA 4HBLA 1AA7A 3AAFA 3FK7A 1LE8A 2IS6A 5ERIA 2QQBA 1B4AA 1TW3A 3K69A 2KPMA 3LSIA 3M8FA 3IRRA 4BNCA 4UVAA 3DQVC 2E2JJ 4UVCA 2WY7Q 1MSFC 3I55I 3L9FA 1TT5B 4U7DA 2XSJC 1WI3A 3BG7A 4B44A 2MC4A 4D5CA 1MJBA 3L1PA 5KAFC 2IGKA 2P5KA 3FXUA 3ZGKA 1RKTA 2HZTA 3BWGA 1J0RA 3MQ0A 5F08A 1SD5A 1Y8QB 4B09A 3ZP5A 1DUXC 1GDTA 2DW4A 2QBYB 4P55A 3IL2A 4G7HF 3LSHA 5GTHC 3HUGB 3FXMA 1G3YA 1YE9A 2EIKH 4CXFA 3CDHA 1U9NA 5CVJA 3WU1B 3OYIA 2A61A 4CZCA 1KQ9A 1TW2A 1DU0A 4DBRA 3BC8A 5J1RA 3K1MA 4BACA 3ROUA 2OAZA 3PL8A 3S2DJ 1WJCA 3EDPA 1IN4A 1I50J 4MTDA 3CCMI 4XRMA 2QCOA 4FT8A 1TWCJ 3D5RC 3H0GJ 3RCOA 3K2AA 2JRMA 3W6KB 1XMXA 1YRNA 2GXGA 2P6SA 5L3CA 3E5QA 2VONA 3QPSA 2NVYJ 2XRLA 4IHTA 4KUMA 5D4SA 4BAYA 1FBQA 3G4SI 4I01A 5JHFA 2L4MA 3NRVA 4FASD 3DEEA 4ZZLA 3ASOH 5FO5A 1F9NA 1MZBA 2ZO4A 1UG0A 1X4PA 1VQKI 3QP5A 2LY1A 2UUZA 3CUOA 2ZXWH 1SFOJ 5BNGA 5JLXA 1DP7P 3MKWB 4NBQA 1QHHD 2KL4A 3G2BA 3OIQA 2NS7A 2JMWA 4J01A 4RB0A 3E6BA 5H2FC 2HR3A 2P5VA 3DP7A 1T2KA 3DU6A 1H9TA 2M34A 1I39A 4FE7A 1AKHB 1QPMA 3M3YJ 3S14J 3FHNA 2DT5A 1K79A 3B6CA 4OWRB 4LB6B 3RQ4A 3ZPLA 4XMYA 1SEUA 1QHGA 3WTXC 2DPUA 4PJNA 5E18F 3HRSA 5BQTA 2XKOA 2GA2A 5DUIA 1MJ9A 1APLC 4HW0A 4DYRA 1BR2A 1F5TA 2GIVA 3ABUA 3PUFA 4G6DA 2RREA 3ZRGA 4AYBN 3JRDA 1MDMB 4Q5SF 1U8RA 3JW4A 5E3LA 4N4OB 4XLNF 4ENKA 1IV6A 2I10A 3E6DA 1BR1A 2P5LC 4MGRA 4BEHA 3PSIA 1R71A 3KZYA 4M6VA 1P4WA 2RV8A 4MFDA 1FPQA 4HAMA 1UB9A 2DQRA 3HG9A 3FZVA 4A3MJ 2E2HJ 5IP9J 2KT0A 3PNVA 1EV7A 3KFWX 5M5YJ 4MLOA 3L2RA 5H6RA 4RB1A 2NVXJ 3KP5A 2HNHA 1B9MA 1Y0UA 2I5UA 2DN0A 3AG2H 3JRHA 3ZMTA 1D0YA 1EH8A 1T0FC 3KPHA 2Z99A 2QKLB 1QA6A 3HOVJ 4A0YA 5E79C 2MSYA 1USSA 3TO9A 1YJ9I 2Z33A 4WK8F 3M1EA 4I6ZA 1PUFB 4RM2A 5FRMA 2VI6A 4UY8I 2KIUA 3DXJF 4C3IJ 2QA4I 3I58A 1O7LA 1T38A 2WAQN 1Q1HA 1UFMA 1XS9A 3GYHX 2YR2A 5IYDJ 1XD7A 4NB5A 1ZREA 3IH2A 1O57A 4CCOA 1R5HA 4ZYHA 4M3BA 1OYIA 4XLFA 2FU4A 4P9UA 2QM3A 2X1EA 4MFEA 4LGWA 4RGUA 1MIJA 2XAGA 2PBIA 3HYIA 2DA6A 3S15J 1MJAA 4CCKA 1E3PA 3MKZA 1K6OA 2E7WA 3G1LA 2LKXA 3SEZA 4FETA 5LGNA 2H6BA 4WX9A 3CLQA 1Y0NA 1HF0A 3SXYA 1W7PA 2QSHX 3QQAA 1QVUA 4EM0B 3HL2A 3HPHA 5LLQA 3HSRA 4JYKA 2H8RA 1IXRC 4ZYDA 2R4GA 5ILVA 2NVUB 4E7SA 3M4OJ 3S1RJ 1P7JA 3QU3A 4BYYA 1BN5A 2EZHA 4F92B 4NC6A 5D5UB 4Y3OA 4L5EA 4Z6YA 1SFUA 5IOYA 4B3AA 2BHZA 2L9NA 2Q1ZB 1I3QJ 1FBUA 3OS2A 2Y69H 3TMOA 4EMSA 3ASNH 3TOBA 2W24A 5DM7F 3C1DA 3FKIJ 2A07F 1Z6TA 1SVOA 2L0KA 3S32A 4OIQF 3OYAA 4Z2YA 4AM3A 2VBXA 2BOLA 4BXUA 3JRBA 2F4MB 2CV0A 1SANA 3CUQB 3TP0A 5EGOA 4E7ZA 1BM9A 3LNQA 2VJIA 1JE8A 2OZUA 3LSGA 2KJBA 5EEHA 3O2PE 4L9VA 4MQ9F 5ICGA 3FF5A 4Y4RA 2YPRA 3HOYJ 3U9GA 5FB2A 2K5CA 4G8XA 4YIFA 1BR4A 2PLYA 4WWCA 1MMSA 4CSWA 5IT9K 1SMTA 1V5EA 1K6YA 2XASA 2QSFX 3I4PA 4XOPA 2IW5A 1ON1A 2CW7A 3H36A 2G0EA 3K0LA 4O3MA 2V79A 2FX0A 3IWZA 1E3OC 4G12A 3P9KA 4XNFA 2ICWG 1H9GA 2ME0A 2X51A 1LE8B 3BTCA 1O3QA 3DPLC 3ISPA 3NEUA 4YG2F 3N4MA 4LOCA 2BXYA 1TTYA 2VKHA 1XSDA 3C18A 3HGGA 3V8LA 2JSCA 1X58A 4X1EA 2ECCA 2ACJA 1CQTA 4QTRA 3A02A 2KIFA 5J1UA 4HV5A 3Q0VA 4C9YA 3GFJA 3KE2A 4BBSJ 1V5FA 1F43A 1SD4A 2MBFA 2L7ZA 1IRZA 2G7HA 3WTTC 1ETVA 2E7XA 2IP2A 2K7LA 3CC7I 5EEAA 1R5ID 2EK5A 2LBFA 3A01A 1S7EA 1FMWA 3B6AA 5HLIA 4M71A 3RDIA 2A6HF 4IHYA 2X6OA 2O6GE 3HHHA 2Y48A 3OYHA 3DPUA 4BY7J 1HQCA 2EQRA 2VASA 4PJ0C 4QWQA 1AHDP 4F3QA 1WQ2A 3IUOA 4LLGF 4HDVA 2ZXIA 3GW2A 3NARA 3ZQGA 2FF4A 4V2GA 3ZMZA 2K9QA 2K85A 1O4XA 1RKWA 3RJPA 1B1BA 1Y6IA 3KEOA 2OQGA 4B4CA 3GXOA 3H9JA 2JK3A 2K9LA 1D3YA 3SZPA 4IOCF 4HF2A 1VQ7I 4HF1A 3AG4H 4R8HA 4HDUA 2E1OA 2Q2EA 2XAHA 1N75A 2EZIA 3HOZJ 4OMZA 4Y52J 3FDYA 4CHUA 4I98B 2RNGA 3DU5A 5IP6A 3IRQA 2YX7A 1SVMA 3HOXJ 2P81A 5F0FA 1ZG5A 4BXFA 4M3FA 1P4XA 4NUBA 4CCMA 4UNOA 2CQ7A 4HEA2 5D6EA 1PUEE 2M87A 1KYWA 2QWWA 4EM2A 1OFCX 5BOXA 3LOCA 3DKWA 1Z67A 1BI2A 5JHUA 2CJJA 1R9TJ 2XGXA 1YI2I 5CYVA 2HTSA 4PSXA 2EFPA 2G7UA 1D5YA 2GIZA 2PMZA 5CLSA 3C2HA 1IN7A 2A3SA 2RC4A 4G6QA 5BS6A 2MABA 1N78A 5AIQA 3CDIA 3I4NJ 3FXRA 3G3ZA 3W6VA 1LEBA 4DYQA 3ABMH 4ZDOA 2QUFA 1R49A 4A3GJ 1BI3A 1MBFA 4L18B 1DU6A 1VZ0A 4HX8A 1B72A 3CF5F 3F6OA 4IJAA 5EEGA 4DZPA 3J80Z 2Y0SN 4E7KA 2NVQJ 2ELJA 5FLXK 3LQQA 1VNDA 3BTLA 2VOOA 4ASNA 4F52A 4WXCA 5D8KB 3OYGA 1JGGA 3HSEA 2DT6A 4UVBA 3F72A 4A5MA 1D1CA 2DU9A 1YIJI 3K4NA 2XROA 4J00A 3PSFA 2DFFA 4AIKA 3KLOA 1U6GA 2CV2A 3AFHA 1HBXG 1TLHB 3C2GA 2HOAA 2VQGA 1O3TA 1TQIA 2DFIA 3GWZA 4IL6C 4JX6A 1IDYA 3D1NI 5ICFA 3IP4B 2YSRA 3ZMVA 1G2HA 2R5ZB 1WKMA 1YG2A 3IH4A 2A5YB 2WA0A 2WAEA 3OYMA 1UZCA 5GAHJ 2QENA 3V7CA 2XC7A 2Z9OA 2F4OB 1A04A 3FBIB 4L9JA 2XAUA 5JVTA 1ETYA 3VODA 5CQGA 1KU2A 4C2MJ 2BZTA 1REPC 3GTMJ 1QZZA 3SZTA 3I3LA 1Z1DA 1U0JA 4EJOA 1HKQA 5JLWA 2A05A 2DA3A 2VT3A 5HNFA 1JT0A 2PI0A 3E5XA 3HRTA 1B6AA 1N77A 2X6WA 3H0DA 3FIWA 5FD5A 2XVCA 1LVAA 1S72I 4XN0A 3T8RA 1TWHJ 1XCBA 3W6JB 1SFEA 2K9MA 1JHHA 1TZLA 2PEXA 3DV8A 3HOTA 3JAMZ 4IO9F 2ZSHB 4AYBA 4CICA 2LK2A 3LA2A 2CWEA 1VQOI 4CYCB 1OJLA 4M72A 3QOEA 3FMSA 1FIAA 2TRTA 5HDGA 2HPIA 5FKNA 2YX4A 1UCRA 3CC2I 1A6IA 3PUBA 1ZRCA 4WXDA 3VSLA 3CD6I 2BVMA 2HWVA 1SD7A 2MW8A 4UUVA 5TISC 3RPQA 3FMRA 2EFQA 3TOAA 1JKQC 4IRGA 1BW6A 2KKOA 2P7CB 2Y9YA 3E0JB 3BY6A 1I27A 1RETA 5F64A 3FWEA 4MQVA 1Y56A 2MFZA 2VC1A 3BR5A 2NS8A 2JZYA 3HGYA 4G9YA 1MD0A 2GWRA 3IKTA 4JP0A 2O03A 3Q0WA 3OL3A 4UV9A 3F8NA 1MKMA 4RA2A 2VB6A 2DK5A 4ZZDA 5TRDA 1P7IA 2JVHA 2LKPA 3KP3A 3F6VA 3OYNA 4Q4ZF 1XC5A 3GX4X 1T56A 4M3GA 3RTRA 3RZOJ 2CQKA 2UZKA 3CZ6A 2E1NA 2OA4A 2D1VA 2GAUA
chains in the Genus database with same CATH topology
1PDNC 3P9CA 5LHIA 2IA1A 2E1CA 2NS0A 1ULYA 5LHHA 3CO6C 4AWXB 4MHGA 1K78A 4A6DA 3V8JA 1O3RA 2X4HA 2HQNA 2V9VA 1Z05A 2F5EA 2DAOA 3QU6A 1G3TA 2EV5A 5BMZA 4LJZF 2V6CA 1FYMA 3COAC 2VC0A 1FP2A 3LAJA 4KA4A 1FWZA 4M6YA 4I0AA 2ZFWA 3R0AA 1BIAA 5E1XA 2M45A 2XAFA 5E17F 2DO7A 3HOSA 3RKYA 5E8IA 3SHFA 3VFZA 1Z6RA 5E8GA 1YW8A 2PMUA 3H3ZA 4HF0A 3O6BB 4KFCA 2P7VB 1GVJA 3ERED 3L2CA 2NAZA 5J8CA 2UXXA 3F3XA 2FE3A 5LRRA 4XBFA 4PZJA 2KJCA 4LK0F 4EVIA 1XGSA 4WCGA 3WTVC 3WE3A 5AIPA 1XDSA 3BJ6A 4L0YB 3R6SA 2JT1A 2AXLA 2Q0OA 5JI6A 4Y17A 4H0EA 1FLIA 1KGSA 5K5OA 1U5TC 4I2OA 4LB5A 3IWFA 1R58A 2MH2A 4MEXF 1J7KA 1USTA 1FSHA 4P5OA 2RVCA 2K02A 4YFKF 1ZAOA 4JBAA 3TDZC 3J7AO 4MNUA 2CG4A 4OU0A 4LG0A 4LLLA 2KIMA 5HS8A 1XSVA 1J9IA 4KYWA 5D5VB 2EV6A 1C0WA 3HRMA 4ESBA 2HYGD 2NRAC 1AWCA 4P9FA 5K1YA 1U5TA 1ZHFA 2EA2A 4L5JA 2ESNA 1KU3A 2PJPA 1FSEA 4ZYGA 4LLNA 4BQAA 1U78A 3LAPA 4M74A 5DCFA 4GXOA 1H0MA 2EFWA 5D8LB 5ED4A 1R22A 1L3LA 3IKVA 4UV8A 1R5GA 4KIGA 1R00A 3QP6A 3BROA 4ENJA 1OPCA 1XMKA 2Q8KA 3HIFA 3QOPA 4S04A 1S6LA 5DCMB 2Z3YA 4FX0A 3F8MA 1XGNA 5BPDA 5FFZA 2GA1A 1ON2A 1ZARA 4MEYF 3CO7C 3GZ5A 4HX7A 1YO5C 2X0LA 3ML6A 4EJVA 5D6FA 5DUKA 5DEQA 5L3GA 3ZQ7A 5ILSA 4O5VA 1G3SA 2EA4A 3KP7A 3EQLF 4M9SA 1HXDA 2ZMEA 4BHCA 4AD9A 1P2FA 1Z91A 2A6EF 4Y13A 5AONA 4EGZA 1G6NA 3P7NA 1LDKB 3I5UA 4NQWA 1W5SA 5DYMA 1XCVA 4M9ZA 1CF7A 1T0FA 2RN7A 1QQIA 2A69F 3RPUA 4A2UA 5A2QK 3JTHA 3R60A 4PCQA 2LF8A 1D5VA 3FM3A 2PQ8A 3Q5FA 1HW1A 3GZ6A 3TQNA 3QPHA 2F2EA 1S7OA 5IT9Z 2P6TA 1YW7A 1EH6A 3EETA 1BI1A 5F6FA 5LGTA 1RIOH 2M8EA 3GF2A 1JXSA 2IA2A 3L09A 1YLFA 3LSTA 4N9HA 3U2RA 4AIJA 4I0BA 1YQAA 2HOEA 2BYVE 4A5NA 3WGIA 3MZYA 3GFIA 1T39A 2QVOA 4AVPA 3HTUA 4ZH4F 2ISZA 5ILUA 2O61A 4CDGA 3H92A 3KP2A 1OYYA 3QPTA 3JTGA 2KRFA 4HLXA 5L3BA 4GCVA 4IVNA 3WTZA 2L4AA 4KMUX 4G7ZF 5E20A 3K1NA 1OMIA 2F5DA 2V1DA 2RNJA 1F1ZA 5HLHA 2EV0A 4RGXA 2D2WA 1YFHA 4EJWA 2QQ9A 2FBIA 1W5TA 4KMFA 2BBYA 5DD8A 1KQ0A 3GEZA 3WGGA 4EGYA 3PQJA 4HA8A 4FX4A 1R1VA 2DI3A 4Q47A 2QBYA 1QGPA 2PG4A 3HUGA 5E1ZB 2M30A 3FHZA 2K4JA 1W7PD 2ISYA 1HKTA 1KU7A 3JSOA 4U0VA 1S7AA 3I71A 3T1BA 5CVRA 4HX4A 5FLXZ 2WC2A 4ENMA 2R3SA 4PGGA 2QQAA 3WODF 1DPUA 3HRUA 2L01A 3D0SA 2J5PA 4BHBA 2OQRA 3RKXA 4OIRF 1J75A 4IPAA 2W25A 3J81K 4XLPF 4PDKA 1G4DA 1CGPA 1KA8A 4EJUA 3F8BA 2L3DA 1K7AA 1FBSA 4M9XA 2MA3A 3RIRA 2HS5A 4M73A 3OOPA 4FHTA 3SQNA 4G94A 2UWMA 3GUDA 2XUBA 4XRFA 3FM5A 2DLLA 1XGMA 1B9NA 5LBQA 2HYFA 4TV7A 4WF2A 1IRFA 4A0ZA 1E17A 1FX7A 2NNNA 4I09A 3GVAA 4ON0A 4OIPF 1MDMA 2ZXJA 5E1WA 1J5YA 2UXNA 4E70A 3RYPA 2CO5A 3GFLA 3ZN1A 3I0TA 1J2XA 2L54A 1ZG3A 2CSOA 3DEUA 5J8FA 3IHUA 2O3FA 4CGZA 3B73A 1IN8A 2IRFG 2R7FA 1ONVA 2ELHA 1R36A 1BIBA 1W7PB 4Q48A 1S8NA 3I59A 4A12A 1T98A 5CVUA 3REOA 4HQMA 5H20A 3OV8A 1JGSA 1ZH5A 3GLXA 2HFHA 1FYLA 1FP1D 3F8FA 1I6XA 2JPBA 1WRJA 2DTRA 2LDUA 1I1GA 4K2EA 4RAZA 5FGMA 1UHWA 3TGNA 2JPCA 1JHFA 2BGCA 1XDUA 2FBKA 2HKXA 3H3UA 3R61A 5HS9A 1TQMA 4KT5C 3LA3A 3CUQC 3LWFA 3TO7A 1EH7A 1ZN2A 3M7GA 1SD6A 3KETA 3C3WA 4IF4A 5L3EA 1KYZA 1HKSA 6PAXA 4KIFA 5D4RA 4DQ2A 4OMYA 1IUYA 3QRFF 2XRNA 2QLZA 2BV6A 1TQPA 2EB7A 5K5RA 1WWXA 2FSWA 2O8XA 2K27A 1D8KA 1XMAA 1IZ1A 4GO1A 4OIOF 2EJRA 2CYYA 2ESHA 3K1PA 2RQPA 2VN2A 3RI4A 3CUQA 2LNBA 2K86A 4LD5A 2VBWA 2WV0A 2FA5A 3HTSB 3WTUC 1LDDA 4EM1A 4I7HA 1ZRDA 2ETHA 3ECHA 3JSPA 1MGTA 1WSUA 3L7WA 3TKYA 1SAXA 4U0WA 1RI7A 1XGOA 3KZZA 1XSXA 2MC3A 1TBXA 1T6SA 3O3KA 2W57A 1V3FA 3WGHA 1BC8C 1G3WA 3FMQA 1DDNA 4EJTA 2O0YA 1GXQA 1IF1A 2XKPA 3LA7A 1S29A 1IN6A 1J59A 4LMYA 4YFXF 4LFUA 4N9IA 1BJAA 4N0BA 1BBYA 3EYYA 1S3JA 1FY7A 3VEPA 3WTWC 3ECOA 3E3VA 1QO0D 5ICEA 4OINF 3E6MA 4KN4X 3SFZA 3WTSC 2EFOA 2VOPA 5HS7A 4KICA 3ZN0A 2XIGA 2R7DA 2FMYA 2Z5UA 2PFBA 4RGRA 3T5XA 1STZA 1D8JA 4KN7X 5KK1A 3U1DA 3WU0A 5LGUA 4HLYA 3V7RA 5HDKA 3F22A 1HSJA 1L0OC 4P96A 4XSZF 2L02A 3E97A 2GXBA 1RNLA 3TDUC 1OR7A 2AS5F 2RKHA 2LF7A 1LNWA 2M1BA 2VODA 2GQQA 3VOEA 5ICCA 3Q9VA 1LJ9A 2BEOA 3BOQA 3C7JA 3T8TA 3FXQA 2NNYA 4Y15A 2C6YA 2ZKZA 1YS7A 2HTJA 1F4KA 1UHMA 2VXZA 4HQEA 2W85A 3GO5A 4XSXF 1TNTA 4RB3C 3RKWA 2H94A 1RUNA 2FEZA 3S2WA 2F5FA 4L5IA 1FNNA 4CZZA 3V8KA 3BDDA 5J6XA 4D0PA 1AOYA 4U7BA 3BJOA 5LHGA 4IRIA 5HOOA 3T0YA 3I59B 2ZNYA 3BP8A 5DDGA 2WWYA 3KCCA 1HSTA 1ZLJA 2Y0MA 4KDPA 3CTAA 4B8XA 3V7SA 3BPVA 5A2QZ 4GGGA 3Q9SA 1YIOA 2CW0F 1OKRA 1P4AA 1IRGA 5IT3A 1QZYA 4DNCA 4ZYEA 3BJAA 1FC3A 4R79A 2XAJA 2OU2A 3PQKA 5CVIA 3MEXA 3HHGA 3KLNA 4IXAA 4AIHA 1IXSB 2MLGA 2D45A 1YTYA 1K78B 2FOKA 1ZRFA 1BOAA 2V1XA 4GYIA 5K5QA 1R23A 2JTVA 1IXCA 3P9IA 3NQOA 2VE8A 3DF8A 3M9AA 4RAYA 4ENNA 4U88A 4R1HA 2FNAA 1YYVA 1ODDA 3I54A 4GYGA 5LEKA 5HVQC 2V1UA 3V4GA 2H6CA 4WXHA 3WG9A 3EYIA 2MH9A 2GZWA 3QAHA 4RB2C 1IAWA 2HDCA 2ZNZA 2J5OA 2OBPA 2WTEA 3VB2A 5L3FA 2STTA 2A68F 3R4KA 4BHPA 4S05A 1E2XA 4RGSA 4HV6A 3BPXA 1X3UA 2DBBA 2XHKA 2Y75A 1GXPA 2XAQA 2DQLA 3CLOA 2NYXA 1FOKA 4U0YA 4A6EA 1I5ZA 2B0LA 4ESJA 2CFXA 1PP7U 1Z9CA 4RS8A 5BPIA 5LRSA 2FMLA 2IA0A 1FZPB 1YS6A 1XB4A 5L3DA 2ZJ2A 5DV5A 1U2WA 4EQQA 3K9TA 4LK1F 4HZFA 1U3EM 1VTNC 2OZ6A 5H6QA 4NHJA 4A0XA 1V4RA 2FXAA 2QYOA 4CYDA 3B02A 3DPTA 3HSFA 4OOIA 2P4WA 4ESFA 4F7ZA 3E5UA 3L00A 2VT2A 3M8EA 2HKOA 3BZ6A 3LQRA 2G9WA 4BH9A 2DK8A 2K4BA 5HDNA 3EUHA 2VBYA 2FRHA 4LG0B 2LSOA 4UXNA 3J81Z 1RZ4A 5FD6A 1ZLKA 1ZG1A 4ETSA 3MCZA 2D1HA 1U5TB 2RGVA 1KU9A 4I02A 3K2ZA 5D5XB 3F8CA 1ZGAA 1HW2A 1WI9A 2FQ3A 1FT9A 1TNSA 3ABTA 3F23A 2HQRA 1I1SA 2BE5F 1R1UA 1Z7UA 3MFKA 3MZHA 3R0JA 2ADUA 1FYKA 1ZGJA 1P6RA 1HW5A 2F5CA 3ELKA 3CJNA 2RDPA 4YIIA 3KEQA 4QLCU 2VBZA 2XV4S 1ZYRF 3E6CC 3LFKA 2M5WA 3J80K 5D5WB 3I64A 3FX3A 4JQFA 1YW9A 2H27A 2H09A 4M6XA 2PMHA 4EV0A 1IW7F 1PP8F 2FBHA 1SFXA 3KP6A 2COMA 1RUOA 1KQ8A 5KVRA 2ZMEB 1O7FA 1LDJA 2MLKA 3GFMA 4IRHA 3ZMDA 4L9TA 2IT0A 3I53A 4UHTA 5DCMA 1CF7B 4IHSA 1B59A 2ZCWA 5F1RA 5DD4A 1O3SA 4JK1X 2STWA 4HYEA 5TJJA 1W4MA 2W84A 1DPRA 1IN5A 1BC7C 3TO6A 2P8TA 3D5LA 1XN7A 1BI0A 3DFGA 4YFNF 2CGPA 2HGCA 2ZBKA 4PGHA 1QNTA 2JRTA 3JAMK 1SMYF 4KIBA 1R7JA 4L0ZB 3WTYC 5LEJA 3MAJA 5JFRA 2TDXA 1LB2A 3ZMUA 2EFNA 1LQ1A 4CO8A 3ZMSA 5FFXA 2MD5A 2HEOA 2VE9A 2FNPA 2PN6A 2DPDA 5CJ9A 4MTEA 3MWMA 3F21A 1R1TA 3WE2A 5CVVA 3G73A 4O6JA 4HOBA 2YU3A 3N97A 4KNYA 1QBJA 1NHAA 3PFIA 1P92A 2EWNA 3KP4A 3RYRA 3ULQB 1GHCA 5JR3A 3IC7A 2IJLA 2IPQX 1OYWA 4G7OF 2IVMA 2OD5A 2QZ8A 5HLGA 1LEAA 4L9NA 3AAFA 4HBLA 5ERIA 2QQBA 1B4AA 1TW3A 3K69A 3M8FA 3IRRA 4BNCA 4UVAA 3DQVC 4UVCA 3L9FA 4U7DA 1MJBA 2P5KA 3FXUA 2HZTA 3BWGA 1J0RA 3MQ0A 1SD5A 4B09A 3ZP5A 1DUXC 2DW4A 2QBYB 4P55A 3IL2A 4G7HF 1G3YA 4CXFA 3CDHA 5CVJA 3WU1B 2A61A 1KQ9A 1TW2A 3K1MA 3ROUA 2OAZA 3EDPA 1IN4A 4MTDA 4FT8A 3W6KB 2GXGA 2P6SA 5L3CA 3E5QA 2VONA 4IHTA 4KUMA 5D4SA 4BAYA 1FBQA 4I01A 2L4MA 3NRVA 4ZZLA 5FO5A 1F9NA 1MZBA 2ZO4A 3QP5A 3CUOA 1DP7P 4RB0A 3E6BA 2HR3A 2P5VA 3DP7A 1T2KA 1H9TA 1QPMA 2DT5A 1K79A 4LB6B 3ZPLA 3WTXC 2DPUA 5E18F 3HRSA 5BQTA 2XKOA 2GA2A 5DUIA 1MJ9A 4HW0A 1F5TA 2GIVA 3ABUA 4G6DA 1MDMB 4Q5SF 1U8RA 3JW4A 4ENKA 4XLNF 3E6DA 2P5LC 4MGRA 3KZYA 1P4WA 2RV8A 1FPQA 4HAMA 1UB9A 2DQRA 3FZVA 1EV7A 3KFWX 5H6RA 4RB1A 3KP5A 1B9MA 1Y0UA 3ZMTA 1EH8A 2Z99A 4A0YA 1USSA 3TO9A 2Z33A 4WK8F 3M1EA 2KIUA 3DXJF 3I58A 1O7LA 1T38A 1Q1HA 1UFMA 3GYHX 2YR2A 1XD7A 4NB5A 1ZREA 1O57A 1R5HA 4ZYHA 1OYIA 2FU4A 4P9UA 2QM3A 4LGWA 4RGUA 2XAGA 2PBIA 3HYIA 1MJAA 1K6OA 2E7WA 5LGNA 2H6BA 4WX9A 3SXYA 1W7PA 4EM0B 5LLQA 3HSRA 1IXRC 4ZYDA 5ILVA 3QU3A 4BYYA 1BN5A 5D5UB 1SFUA 1FBUA 4EMSA 3TOBA 2W24A 3C1DA 2A07F 1Z6TA 4OIQF 4Z2YA 2VBXA 4BXUA 3CUQB 1BM9A 1JE8A 2OZUA 2KJBA 5EEHA 3O2PE 4L9VA 4MQ9F 5ICGA 3FF5A 2YPRA 3U9GA 5FB2A 4G8XA 4YIFA 2PLYA 4WWCA 5IT9K 1SMTA 2XASA 3I4PA 2IW5A 1ON1A 3K0LA 4O3MA 2V79A 3IWZA 3P9KA 1H9GA 1O3QA 3DPLC 3ISPA 3NEUA 4YG2F 3N4MA 1TTYA 1XSDA 3C18A 3V8LA 2JSCA 2ACJA 2KIFA 4HV5A 3GFJA 3KE2A 1SD4A 2MBFA 2G7HA 3WTTC 2E7XA 2IP2A 2K7LA 2EK5A 5HLIA 4M71A 3RDIA 2A6HF 2O6GE 3HHHA 2Y48A 1HQCA 4QWQA 1WQ2A 4LLGF 4HDVA 3GW2A 2FF4A 3ZMZA 3RJPA 1B1BA 3KEOA 2OQGA 3GXOA 1D3YA 3SZPA 4HF2A 4HF1A 4R8HA 4HDUA 2Q2EA 2XAHA 4OMZA 4CHUA 4I98B 3IRQA 2YX7A 1ZG5A 1P4XA 4UNOA 5D6EA 1PUEE 2M87A 1KYWA 2QWWA 4EM2A 5BOXA 3DKWA 1BI2A 5JHUA 2XGXA 5CYVA 2HTSA 2EFPA 2G7UA 5CLSA 1IN7A 2A3SA 2RC4A 4G6QA 5BS6A 5AIQA 3FXRA 3G3ZA 1LEBA 2QUFA 1BI3A 4L18B 4HX8A 3F6OA 4IJAA 5EEGA 3J80Z 5FLXK 3LQQA 2VOOA 4ASNA 4WXCA 5D8KB 3HSEA 4UVBA 3F72A 4A5MA 2DU9A 2XROA 4AIKA 3KLOA 1U6GA 1HBXG 1TLHB 1O3TA 1TQIA 2DFIA 3GWZA 5ICFA 2YSRA 3ZMVA 1WKMA 1YG2A 2A5YB 2QENA 3V7CA 2Z9OA 1A04A 4L9JA 5JVTA 3VODA 1KU2A 1REPC 1QZZA 3SZTA 1Z1DA 4EJOA 1HKQA 2VT3A 2PI0A 3E5XA 3HRTA 1B6AA 5FD5A 2XVCA 1LVAA 3T8RA 1XCBA 3W6JB 1SFEA 2PEXA 3DV8A 3HOTA 3JAMZ 4CICA 3LA2A 2CWEA 4M72A 3FMSA 5HDGA 2YX4A 1UCRA 1ZRCA 4WXDA 2HWVA 1SD7A 4UUVA 3RPQA 3FMRA 2EFQA 3TOAA 4IRGA 2KKOA 2P7CB 3BY6A 1I27A 5F64A 3FWEA 4MQVA 2VC1A 2JZYA 4G9YA 1MD0A 2GWRA 3IKTA 2O03A 4UV9A 3F8NA 1MKMA 4ZZDA 2DK5A 5TRDA 2LKPA 3KP3A 3F6VA 4Q4ZF 3GX4X 3RTRA 2CQKA 2UZKA 1JHHA 2E1NA 2OA4A 2D1VA 2GAUA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1PDN C;  3P9C A;  5LHI A;  2IA1 A;  2E1C A;  2NS0 A;  1ULY A;  5LHH A;  3CO6 C;  4AWX B;  4MHG A;  1K78 A;  4A6D A;  3V8J A;  1O3R A;  2X4H A;  2HQN A;  2V9V A;  1Z05 A;  2F5E A;  2DAO A;  3QU6 A;  1G3T A;  2EV5 A;  5BMZ A;  4LJZ F;  2V6C A;  1FYM A;  3COA C;  2VC0 A;  1FP2 A;  3LAJ A;  4KA4 A;  1FWZ A;  4M6Y A;  4I0A A;  2ZFW A;  3R0A A;  1BIA A;  5E1X A;  2M45 A;  2XAF A;  5E17 F;  2DO7 A;  3HOS A;  3RKY A;  5E8I A;  3SHF A;  3VFZ A;  1Z6R A;  5E8G A;  1YW8 A;  2PMU A;  3H3Z A;  4HF0 A;  3O6B B;  4KFC A;  2P7V B;  1GVJ A;  3ERE D;  3L2C A;  2NAZ A;  5J8C A;  2UXX A;  3F3X A;  2FE3 A;  5LRR A;  4XBF A;  4PZJ A;  2KJC A;  4LK0 F;  4EVI A;  1XGS A;  4WCG A;  3WTV C;  3WE3 A;  5AIP A;  1XDS A;  3BJ6 A;  4L0Y B;  3R6S A;  2JT1 A;  2AXL A;  2Q0O A;  5JI6 A;  4Y17 A;  4H0E A;  1FLI A;  1KGS A;  5K5O A;  1U5T C;  4I2O A;  4LB5 A;  3IWF A;  1R58 A;  2MH2 A;  4MEX F;  1J7K A;  1UST A;  1FSH A;  4P5O A;  2RVC A;  2K02 A;  4YFK F;  1ZAO A;  4JBA A;  3TDZ C;  3J7A O;  4MNU A;  2CG4 A;  4OU0 A;  4LG0 A;  4LLL A;  2KIM A;  5HS8 A;  1XSV A;  1J9I A;  4KYW A;  5D5V B;  2EV6 A;  1C0W A;  3HRM A;  4ESB A;  2HYG D;  2NRA C;  1AWC A;  4P9F A;  5K1Y A;  1U5T A;  1ZHF A;  2EA2 A;  4L5J A;  2ESN A;  1KU3 A;  2PJP A;  1FSE A;  4ZYG A;  4LLN A;  4BQA A;  1U78 A;  3LAP A;  4M74 A;  5DCF A;  4GXO A;  1H0M A;  2EFW A;  5D8L B;  5ED4 A;  1R22 A;  1L3L A;  3IKV A;  4UV8 A;  1R5G A;  4KIG A;  1R00 A;  3QP6 A;  3BRO A;  4ENJ A;  1OPC A;  1XMK A;  2Q8K A;  3HIF A;  3QOP A;  4S04 A;  1S6L A;  5DCM B;  2Z3Y A;  4FX0 A;  3F8M A;  1XGN A;  5BPD A;  5FFZ A;  2GA1 A;  1ON2 A;  1ZAR A;  4MEY F;  3CO7 C;  3GZ5 A;  4HX7 A;  1YO5 C;  2X0L A;  3ML6 A;  4EJV A;  5D6F A;  5DUK A;  5DEQ A;  5L3G A;  3ZQ7 A;  5ILS A;  4O5V A;  1G3S A;  2EA4 A;  3KP7 A;  3EQL F;  4M9S A;  1HXD A;  2ZME A;  4BHC A;  4AD9 A;  1P2F A;  1Z91 A;  2A6E F;  4Y13 A;  5AON A;  4EGZ A;  1G6N A;  3P7N A;  1LDK B;  3I5U A;  4NQW A;  1W5S A;  5DYM A;  1XCV A;  4M9Z A;  1CF7 A;  1T0F A;  2RN7 A;  1QQI A;  2A69 F;  3RPU A;  4A2U A;  5A2Q K;  3JTH A;  3R60 A;  4PCQ A;  2LF8 A;  1D5V A;  3FM3 A;  2PQ8 A;  3Q5F A;  1HW1 A;  3GZ6 A;  3TQN A;  3QPH A;  2F2E A;  1S7O A;  5IT9 Z;  2P6T A;  1YW7 A;  1EH6 A;  3EET A;  1BI1 A;  5F6F A;  5LGT A;  1RIO H;  2M8E A;  3GF2 A;  1JXS A;  2IA2 A;  3L09 A;  1YLF A;  3LST A;  4N9H A;  3U2R A;  4AIJ A;  4I0B A;  1YQA A;  2HOE A;  2BYV E;  4A5N A;  3WGI A;  3MZY A;  3GFI A;  1T39 A;  2QVO A;  4AVP A;  3HTU A;  4ZH4 F;  2ISZ A;  5ILU A;  2O61 A;  4CDG A;  3H92 A;  3KP2 A;  1OYY A;  3QPT A;  3JTG A;  2KRF A;  4HLX A;  5L3B A;  4GCV A;  4IVN A;  3WTZ A;  2L4A A;  4KMU X;  4G7Z F;  5E20 A;  3K1N A;  1OMI A;  2F5D A;  2V1D A;  2RNJ A;  1F1Z A;  5HLH A;  2EV0 A;  4RGX A;  2D2W A;  1YFH A;  4EJW A;  2QQ9 A;  2FBI A;  1W5T A;  4KMF A;  2BBY A;  5DD8 A;  1KQ0 A;  3GEZ A;  3WGG A;  4EGY A;  3PQJ A;  4HA8 A;  4FX4 A;  1R1V A;  2DI3 A;  4Q47 A;  2QBY A;  1QGP A;  2PG4 A;  3HUG A;  5E1Z B;  2M30 A;  3FHZ A;  2K4J A;  1W7P D;  2ISY A;  1HKT A;  1KU7 A;  3JSO A;  4U0V A;  1S7A A;  3I71 A;  3T1B A;  5CVR A;  4HX4 A;  5FLX Z;  2WC2 A;  4ENM A;  2R3S A;  4PGG A;  2QQA A;  3WOD F;  1DPU A;  3HRU A;  2L01 A;  3D0S A;  2J5P A;  4BHB A;  2OQR A;  3RKX A;  4OIR F;  1J75 A;  4IPA A;  2W25 A;  3J81 K;  4XLP F;  4PDK A;  1G4D A;  1CGP A;  1KA8 A;  4EJU A;  3F8B A;  2L3D A;  1K7A A;  1FBS A;  4M9X A;  2MA3 A;  3RIR A;  2HS5 A;  4M73 A;  3OOP A;  4FHT A;  3SQN A;  4G94 A;  2UWM A;  3GUD A;  2XUB A;  4XRF A;  3FM5 A;  2DLL A;  1XGM A;  1B9N A;  5LBQ A;  2HYF A;  4TV7 A;  4WF2 A;  1IRF A;  4A0Z A;  1E17 A;  1FX7 A;  2NNN A;  4I09 A;  3GVA A;  4ON0 A;  4OIP F;  1MDM A;  2ZXJ A;  5E1W A;  1J5Y A;  2UXN A;  4E70 A;  3RYP A;  2CO5 A;  3GFL A;  3ZN1 A;  3I0T A;  1J2X A;  2L54 A;  1ZG3 A;  2CSO A;  3DEU A;  5J8F A;  3IHU A;  2O3F A;  4CGZ A;  3B73 A;  1IN8 A;  2IRF G;  2R7F A;  1ONV A;  2ELH A;  1R36 A;  1BIB A;  1W7P B;  4Q48 A;  1S8N A;  3I59 A;  4A12 A;  1T98 A;  5CVU A;  3REO A;  4HQM A;  5H20 A;  3OV8 A;  1JGS A;  1ZH5 A;  3GLX A;  2HFH A;  1FYL A;  1FP1 D;  3F8F A;  1I6X A;  2JPB A;  1WRJ A;  2DTR A;  2LDU A;  1I1G A;  4K2E A;  4RAZ A;  5FGM A;  1UHW A;  3TGN A;  2JPC A;  1JHF A;  2BGC A;  1XDU A;  2FBK A;  2HKX A;  3H3U A;  3R61 A;  5HS9 A;  1TQM A;  4KT5 C;  3LA3 A;  3CUQ C;  3LWF A;  3TO7 A;  1EH7 A;  1ZN2 A;  3M7G A;  1SD6 A;  3KET A;  3C3W A;  4IF4 A;  5L3E A;  1KYZ A;  1HKS A;  6PAX A;  4KIF A;  5D4R A;  4DQ2 A;  4OMY A;  1IUY A;  3QRF F;  2XRN A;  2QLZ A;  2BV6 A;  1TQP A;  2EB7 A;  5K5R A;  1WWX A;  2FSW A;  2O8X A;  2K27 A;  1D8K A;  1XMA A;  1IZ1 A;  4GO1 A;  4OIO F;  2EJR A;  2CYY A;  2ESH A;  3K1P A;  2RQP A;  2VN2 A;  3RI4 A;  3CUQ A;  2LNB A;  2K86 A;  4LD5 A;  2VBW A;  2WV0 A;  2FA5 A;  3HTS B;  3WTU C;  1LDD A;  4EM1 A;  4I7H A;  1ZRD A;  2ETH A;  3ECH A;  3JSP A;  1MGT A;  1WSU A;  3L7W A;  3TKY A;  1SAX A;  4U0W A;  1RI7 A;  1XGO A;  3KZZ A;  1XSX A;  2MC3 A;  1TBX A;  1T6S A;  3O3K A;  2W57 A;  1V3F A;  3WGH A;  1BC8 C;  1G3W A;  3FMQ A;  1DDN A;  4EJT A;  2O0Y A;  1GXQ A;  1IF1 A;  2XKP A;  3LA7 A;  1S29 A;  1IN6 A;  1J59 A;  4LMY A;  4YFX F;  4LFU A;  4N9I A;  1BJA A;  4N0B A;  1BBY A;  3EYY A;  1S3J A;  1FY7 A;  3VEP A;  3WTW C;  3ECO A;  3E3V A;  1QO0 D;  5ICE A;  4OIN F;  3E6M A;  4KN4 X;  3SFZ A;  3WTS C;  2EFO A;  2VOP A;  5HS7 A;  4KIC A;  3ZN0 A;  2XIG A;  2R7D A;  2FMY A;  2Z5U A;  2PFB A;  4RGR A;  3T5X A;  1STZ A;  1D8J A;  4KN7 X;  5KK1 A;  3U1D A;  3WU0 A;  5LGU A;  4HLY A;  3V7R A;  5HDK A;  3F22 A;  1HSJ A;  1L0O C;  4P96 A;  4XSZ F;  2L02 A;  3E97 A;  2GXB A;  1RNL A;  3TDU C;  1OR7 A;  2AS5 F;  2RKH A;  2LF7 A;  1LNW A;  2M1B A;  2VOD A;  2GQQ A;  3VOE A;  5ICC A;  3Q9V A;  1LJ9 A;  2BEO A;  3BOQ A;  3C7J A;  3T8T A;  3FXQ A;  2NNY A;  4Y15 A;  2C6Y A;  2ZKZ A;  1YS7 A;  2HTJ A;  1F4K A;  1UHM A;  2VXZ A;  4HQE A;  2W85 A;  3GO5 A;  4XSX F;  1TNT A;  4RB3 C;  3RKW A;  2H94 A;  1RUN A;  2FEZ A;  3S2W A;  2F5F A;  4L5I A;  1FNN A;  4CZZ A;  3V8K A;  3BDD A;  5J6X A;  4D0P A;  1AOY A;  4U7B A;  3BJO A;  5LHG A;  4IRI A;  5HOO A;  3T0Y A;  3I59 B;  2ZNY A;  3BP8 A;  5DDG A;  2WWY A;  3KCC A;  1HST A;  1ZLJ A;  2Y0M A;  4KDP A;  3CTA A;  4B8X A;  3V7S A;  3BPV A;  5A2Q Z;  4GGG A;  3Q9S A;  1YIO A;  2CW0 F;  1OKR A;  1P4A A;  1IRG A;  5IT3 A;  1QZY A;  4DNC A;  4ZYE A;  3BJA A;  1FC3 A;  4R79 A;  2XAJ A;  2OU2 A;  3PQK A;  5CVI A;  3MEX A;  3HHG A;  3KLN A;  4IXA A;  4AIH A;  1IXS B;  2MLG A;  2D45 A;  1YTY A;  1K78 B;  2FOK A;  1ZRF A;  1BOA A;  2V1X A;  4GYI A;  5K5Q A;  1R23 A;  2JTV A;  1IXC A;  3P9I A;  3NQO A;  2VE8 A;  3DF8 A;  3M9A A;  4RAY A;  4ENN A;  4U88 A;  4R1H A;  2FNA A;  1YYV A;  1ODD A;  3I54 A;  4GYG A;  5LEK A;  5HVQ C;  2V1U A;  3V4G A;  2H6C A;  4WXH A;  3WG9 A;  3EYI A;  2MH9 A;  2GZW A;  3QAH A;  4RB2 C;  1IAW A;  2HDC A;  2ZNZ A;  2J5O A;  2OBP A;  2WTE A;  3VB2 A;  5L3F A;  2STT A;  2A68 F;  3R4K A;  4BHP A;  4S05 A;  1E2X A;  4RGS A;  4HV6 A;  3BPX A;  1X3U A;  2DBB A;  2XHK A;  2Y75 A;  1GXP A;  2XAQ A;  2DQL A;  3CLO A;  2NYX A;  1FOK A;  4U0Y A;  4A6E A;  1I5Z A;  2B0L A;  4ESJ A;  2CFX A;  1PP7 U;  1Z9C A;  4RS8 A;  5BPI A;  5LRS A;  2FML A;  2IA0 A;  1FZP B;  1YS6 A;  1XB4 A;  5L3D A;  2ZJ2 A;  5DV5 A;  1U2W A;  4EQQ A;  3K9T A;  4LK1 F;  4HZF A;  1U3E M;  1VTN C;  2OZ6 A;  5H6Q A;  4NHJ A;  4A0X A;  1V4R A;  2FXA A;  2QYO A;  4CYD A;  3B02 A;  3DPT A;  3HSF A;  4OOI A;  2P4W A;  4ESF A;  4F7Z A;  3E5U A;  3L00 A;  2VT2 A;  3M8E A;  2HKO A;  3BZ6 A;  3LQR A;  2G9W A;  4BH9 A;  2DK8 A;  2K4B A;  5HDN A;  3EUH A;  2VBY A;  2FRH A;  4LG0 B;  2LSO A;  4UXN A;  3J81 Z;  1RZ4 A;  5FD6 A;  1ZLK A;  1ZG1 A;  4ETS A;  3MCZ A;  2D1H A;  1U5T B;  2RGV A;  1KU9 A;  4I02 A;  3K2Z A;  5D5X B;  3F8C A;  1ZGA A;  1HW2 A;  1WI9 A;  2FQ3 A;  1FT9 A;  1TNS A;  3ABT A;  3F23 A;  2HQR A;  1I1S A;  2BE5 F;  1R1U A;  1Z7U A;  3MFK A;  3MZH A;  3R0J A;  2ADU A;  1FYK A;  1ZGJ A;  1P6R A;  1HW5 A;  2F5C A;  3ELK A;  3CJN A;  2RDP A;  4YII A;  3KEQ A;  4QLC U;  2VBZ A;  2XV4 S;  1ZYR F;  3E6C C;  3LFK A;  2M5W A;  3J80 K;  5D5W B;  3I64 A;  3FX3 A;  4JQF A;  1YW9 A;  2H27 A;  2H09 A;  4M6X A;  2PMH A;  4EV0 A;  1IW7 F;  1PP8 F;  2FBH A;  1SFX A;  3KP6 A;  2COM A;  1RUO A;  1KQ8 A;  5KVR A;  2ZME B;  1O7F A;  1LDJ A;  2MLK A;  3GFM A;  4IRH A;  3ZMD A;  4L9T A;  2IT0 A;  3I53 A;  4UHT A;  5DCM A;  1CF7 B;  4IHS A;  1B59 A;  2ZCW A;  5F1R A;  5DD4 A;  1O3S A;  4JK1 X;  2STW A;  4HYE A;  5TJJ A;  1W4M A;  2W84 A;  1DPR A;  1IN5 A;  1BC7 C;  3TO6 A;  2P8T A;  3D5L A;  1XN7 A;  1BI0 A;  3DFG A;  4YFN F;  2CGP A;  2HGC A;  2ZBK A;  4PGH A;  1QNT A;  2JRT A;  3JAM K;  1SMY F;  4KIB A;  1R7J A;  4L0Z B;  3WTY C;  5LEJ A;  3MAJ A;  5JFR A;  2TDX A;  1LB2 A;  3ZMU A;  2EFN A;  1LQ1 A;  4CO8 A;  3ZMS A;  5FFX A;  2MD5 A;  2HEO A;  2VE9 A;  2FNP A;  2PN6 A;  2DPD A;  5CJ9 A;  4MTE A;  3MWM A;  3F21 A;  1R1T A;  3WE2 A;  5CVV A;  3G73 A;  4O6J A;  4HOB A;  2YU3 A;  3N97 A;  4KNY A;  1QBJ A;  1NHA A;  3PFI A;  1P92 A;  2EWN A;  3KP4 A;  3RYR A;  3ULQ B;  1GHC A;  5JR3 A;  3IC7 A;  2IJL A;  2IPQ X;  1OYW A;  4G7O F;  2IVM A;  2OD5 A;  2QZ8 A;  5HLG A;  1LEA A;  4L9N A;  3AAF A;  4HBL A;  5ERI A;  2QQB A;  1B4A A;  1TW3 A;  3K69 A;  3M8F A;  3IRR A;  4BNC A;  4UVA A;  3DQV C;  4UVC A;  3L9F A;  4U7D A;  1MJB A;  2P5K A;  3FXU A;  2HZT A;  3BWG A;  1J0R A;  3MQ0 A;  1SD5 A;  4B09 A;  3ZP5 A;  1DUX C;  2DW4 A;  2QBY B;  4P55 A;  3IL2 A;  4G7H F;  1G3Y A;  4CXF A;  3CDH A;  5CVJ A;  3WU1 B;  2A61 A;  1KQ9 A;  1TW2 A;  3K1M A;  3ROU A;  2OAZ A;  3EDP A;  1IN4 A;  4MTD A;  4FT8 A;  3W6K B;  2GXG A;  2P6S A;  5L3C A;  3E5Q A;  2VON A;  4IHT A;  4KUM A;  5D4S A;  4BAY A;  1FBQ A;  4I01 A;  2L4M A;  3NRV A;  4ZZL A;  5FO5 A;  1F9N A;  1MZB A;  2ZO4 A;  3QP5 A;  3CUO A;  1DP7 P;  4RB0 A;  3E6B A;  2HR3 A;  2P5V A;  3DP7 A;  1T2K A;  1H9T A;  1QPM A;  2DT5 A;  1K79 A;  4LB6 B;  3ZPL A;  3WTX C;  2DPU A;  5E18 F;  3HRS A;  5BQT A;  2XKO A;  2GA2 A;  5DUI A;  1MJ9 A;  4HW0 A;  1F5T A;  2GIV A;  3ABU A;  4G6D A;  1MDM B;  4Q5S F;  1U8R A;  3JW4 A;  4ENK A;  4XLN F;  3E6D A;  2P5L C;  4MGR A;  3KZY A;  1P4W A;  2RV8 A;  1FPQ A;  4HAM A;  1UB9 A;  2DQR A;  3FZV A;  1EV7 A;  3KFW X;  5H6R A;  4RB1 A;  3KP5 A;  1B9M A;  1Y0U A;  3ZMT A;  1EH8 A;  2Z99 A;  4A0Y A;  1USS A;  3TO9 A;  2Z33 A;  4WK8 F;  3M1E A;  2KIU A;  3DXJ F;  3I58 A;  1O7L A;  1T38 A;  1Q1H A;  1UFM A;  3GYH X;  2YR2 A;  1XD7 A;  4NB5 A;  1ZRE A;  1O57 A;  1R5H A;  4ZYH A;  1OYI A;  2FU4 A;  4P9U A;  2QM3 A;  4LGW A;  4RGU A;  2XAG A;  2PBI A;  3HYI A;  1MJA A;  1K6O A;  2E7W A;  5LGN A;  2H6B A;  4WX9 A;  3SXY A;  1W7P A;  4EM0 B;  5LLQ A;  3HSR A;  1IXR C;  4ZYD A;  5ILV A;  3QU3 A;  4BYY A;  1BN5 A;  5D5U B;  1SFU A;  1FBU A;  4EMS A;  3TOB A;  2W24 A;  3C1D A;  2A07 F;  1Z6T A;  4OIQ F;  4Z2Y A;  2VBX A;  4BXU A;  3CUQ B;  1BM9 A;  1JE8 A;  2OZU A;  2KJB A;  5EEH A;  3O2P E;  4L9V A;  4MQ9 F;  5ICG A;  3FF5 A;  2YPR A;  3U9G A;  5FB2 A;  4G8X A;  4YIF A;  2PLY A;  4WWC A;  5IT9 K;  1SMT A;  2XAS A;  3I4P A;  2IW5 A;  1ON1 A;  3K0L A;  4O3M A;  2V79 A;  3IWZ A;  3P9K A;  1H9G A;  1O3Q A;  3DPL C;  3ISP A;  3NEU A;  4YG2 F;  3N4M A;  1TTY A;  1XSD A;  3C18 A;  3V8L A;  2JSC A;  2ACJ A;  2KIF A;  4HV5 A;  3GFJ A;  3KE2 A;  1SD4 A;  2MBF A;  2G7H A;  3WTT C;  2E7X A;  2IP2 A;  2K7L A;  2EK5 A;  5HLI A;  4M71 A;  3RDI A;  2A6H F;  2O6G E;  3HHH A;  2Y48 A;  1HQC A;  4QWQ A;  1WQ2 A;  4LLG F;  4HDV A;  3GW2 A;  2FF4 A;  3ZMZ A;  3RJP A;  1B1B A;  3KEO A;  2OQG A;  3GXO A;  1D3Y A;  3SZP A;  4HF2 A;  4HF1 A;  4R8H A;  4HDU A;  2Q2E A;  2XAH A;  4OMZ A;  4CHU A;  4I98 B;  3IRQ A;  2YX7 A;  1ZG5 A;  1P4X A;  4UNO A;  5D6E A;  1PUE E;  2M87 A;  1KYW A;  2QWW A;  4EM2 A;  5BOX A;  3DKW A;  1BI2 A;  5JHU A;  2XGX A;  5CYV A;  2HTS A;  2EFP A;  2G7U A;  5CLS A;  1IN7 A;  2A3S A;  2RC4 A;  4G6Q A;  5BS6 A;  5AIQ A;  3FXR A;  3G3Z A;  1LEB A;  2QUF A;  1BI3 A;  4L18 B;  4HX8 A;  3F6O A;  4IJA A;  5EEG A;  3J80 Z;  5FLX K;  3LQQ A;  2VOO A;  4ASN A;  4WXC A;  5D8K B;  3HSE A;  4UVB A;  3F72 A;  4A5M A;  2DU9 A;  2XRO A;  4AIK A;  3KLO A;  1U6G A;  1HBX G;  1TLH B;  1O3T A;  1TQI A;  2DFI A;  3GWZ A;  5ICF A;  2YSR A;  3ZMV A;  1WKM A;  1YG2 A;  2A5Y B;  2QEN A;  3V7C A;  2Z9O A;  1A04 A;  4L9J A;  5JVT A;  3VOD A;  1KU2 A;  1REP C;  1QZZ A;  3SZT A;  1Z1D A;  4EJO A;  1HKQ A;  2VT3 A;  2PI0 A;  3E5X A;  3HRT A;  1B6A A;  5FD5 A;  2XVC A;  1LVA A;  3T8R A;  1XCB A;  3W6J B;  1SFE A;  2PEX A;  3DV8 A;  3HOT A;  3JAM Z;  4CIC A;  3LA2 A;  2CWE A;  4M72 A;  3FMS A;  5HDG A;  2YX4 A;  1UCR A;  1ZRC A;  4WXD A;  2HWV A;  1SD7 A;  4UUV A;  3RPQ A;  3FMR A;  2EFQ A;  3TOA A;  4IRG A;  2KKO A;  2P7C B;  3BY6 A;  1I27 A;  5F64 A;  3FWE A;  4MQV A;  2VC1 A;  2JZY A;  4G9Y A;  1MD0 A;  2GWR A;  3IKT A;  2O03 A;  4UV9 A;  3F8N A;  1MKM A;  4ZZD A;  2DK5 A;  5TRD A;  2LKP A;  3KP3 A;  3F6V A;  4Q4Z F;  3GX4 X;  3RTR A;  2CQK A;  2UZK A;  1JHH A;  2E1N A;  2OA4 A;  2D1V A;  2GAU A; 
#chains in the Genus database with same CATH topology
 1PDN C;  3P9C A;  5LHI A;  2IA1 A;  2E1C A;  2NS0 A;  3W2V A;  2M3A A;  1ULY A;  5LHH A;  3CO6 C;  4AWX B;  5IY5 H;  4MHG A;  5DM6 F;  1ZGW A;  1K78 A;  4B43 A;  4XRS G;  3BQY A;  2FQ4 A;  3K70 C;  4A6D A;  3V8J A;  4B1R A;  1O3R A;  3CCL I;  2X4H A;  2IS2 A;  2EZK A;  2HQN A;  2V9V A;  1Z05 A;  2E36 A;  4M3D A;  2F5E A;  2L7F P;  2DAO A;  1X1B A;  3QU6 A;  2R7Q A;  4ZDL A;  1DQU A;  1G3T A;  2EV5 A;  5BMZ A;  4LJZ F;  2V6C A;  4RBO A;  1FYM A;  3COA C;  2VC0 A;  3N05 A;  5FJ8 J;  1FP2 A;  4JX4 A;  3LAJ A;  4KA4 A;  1FWZ A;  2XB0 X;  4M6Y A;  2E19 A;  2JN6 A;  2XB5 A;  4I0A A;  5CKT A;  2ZFW A;  3R0A A;  1BIA A;  5E1X A;  2JUG A;  2M45 A;  2B63 J;  2XAF A;  4C3J J;  5E17 F;  3QYF A;  2DO7 A;  3HOS A;  3RKY A;  5E8I A;  3SHF A;  3VFZ A;  1VQ4 I;  2XSD C;  1Z6R A;  2CS3 A;  2O8K A;  2PX9 A;  3FXO A;  3S2H J;  5E8G A;  1YW8 A;  2K9S A;  2PMU A;  3H3Z A;  4HF0 A;  4CH7 A;  3WHC A;  4PFP A;  2ZJR F;  1SC7 A;  4A3D J;  1SVL A;  3O6B B;  4IHV A;  2HXI A;  3DBH B;  1U8B A;  3GCM A;  2OC6 A;  4KFC A;  2P7V B;  1GVJ A;  3S8P A;  3ERE D;  3L2C A;  2DDB A;  2NAZ A;  4OAY A;  5J8C A;  2UXX A;  2Z1D A;  2XF7 A;  3F3X A;  4F93 B;  5FLM J;  2FE3 A;  5LRR A;  4XBF A;  1X2M A;  2QEX I;  2PMZ N;  4HG2 A;  2W7N A;  4PZJ A;  2KJC A;  2JA6 J;  4LK0 F;  4EVI A;  3G6E I;  2DMN A;  2Q2E B;  1XGS A;  4HNV A;  3KYD B;  4WCG A;  1TWG J;  3WTV C;  2FOW A;  3WE3 A;  4BBR J;  2LRD A;  2VL8 A;  4BY1 J;  4W97 A;  1K83 J;  5J40 A;  5AIP A;  1MMD A;  4X6A J;  3DBL B;  1XDS A;  3BJ6 A;  2NOJ B;  3HM5 A;  3DTK A;  3VPR A;  4L0Y B;  2DFE A;  3H5N A;  2E1M C;  2WAD A;  2IBD A;  3R6S A;  2JT1 A;  2AXL A;  2Q0O A;  5JI6 A;  1GT0 C;  4Y17 A;  4RAF A;  4H0E A;  1FLI A;  1KGS A;  4CUG A;  2AQF A;  2KDZ A;  3SDG A;  4XOT A;  5K5O A;  3CCJ I;  1U5T C;  3HBL A;  1HCR A;  4I2O A;  3S1N J;  2DMU A;  3CMA I;  4LB5 A;  1Y39 A;  4QPQ A;  3IWF A;  3KYC B;  3LSM A;  3SJM A;  4OAZ A;  1QVT A;  4YEL A;  4XLC A;  3DLA A;  3L2U A;  1R58 A;  1YJN I;  2MH2 A;  3BG3 A;  2W1O A;  4MEX F;  1J7K A;  1UST A;  3ZQH A;  1FSH A;  1OQY A;  3M8J A;  4P5O A;  2RVC A;  2K02 A;  1HC8 A;  2XGD A;  2XF5 A;  4YFK F;  2HVS A;  1D0X A;  1ZAO A;  3BR1 A;  2KQR A;  3Q0U A;  4JBA A;  2R92 J;  3TDZ C;  4XQF A;  3OYB A;  3J7A O;  5EF6 A;  4MNU A;  2CG4 A;  3WHB A;  2HDW A;  1Y1V J;  4OU0 A;  5GAG J;  1X1P A;  5F04 A;  4LG0 A;  1IC8 A;  4LLL A;  2KIM A;  5HS8 A;  1XSV A;  3S16 J;  1TWF J;  1J9I A;  4KYW A;  5D5V B;  3OWT A;  1X2N A;  2EV6 A;  3OYC A;  1C0W A;  3HRM A;  4ESB A;  3OYF A;  1GLN A;  2HYG D;  2NRA C;  1AWC A;  4P9F A;  5TGT A;  2KHM A;  5K1Y A;  1U5T A;  1ZHF A;  4BQO A;  1HDP A;  2EA2 A;  4L5J A;  2ESN A;  1KU3 A;  2PJP A;  1FSE A;  1YIT I;  3OY9 A;  4ZYG A;  3DWL E;  4LLN A;  4BQA A;  5IYB J;  1U78 A;  1B8I B;  3M07 A;  3LAP A;  4M74 A;  5CPR B;  3OYE A;  5DCF A;  5IYC J;  2CFO A;  4IQ4 A;  4GXO A;  1H0M A;  2EFW A;  5GAD J;  5D8L B;  2LY9 A;  5EZH A;  1R22 A;  5ED4 A;  5J47 A;  2ZME C;  3ABL H;  1L3L A;  3IKV A;  4UV8 A;  1R5G A;  1A5J A;  4KIG A;  1R00 A;  3QP6 A;  3BRO A;  3OS1 A;  5F0C A;  2IGN A;  4ENJ A;  1OPC A;  1XMK A;  2Q8K A;  1K4T A;  1MBK A;  3HIF A;  3QOP A;  4S04 A;  1S6L A;  5DCM B;  2Z3Y A;  2OCE A;  2PJR A;  1IG7 A;  3CCU I;  4FX0 A;  3F8M A;  4NC7 A;  1XGN A;  2AXT C;  5BPD A;  2EIJ H;  3HOU J;  2GA1 A;  5FFZ A;  1ON2 A;  3AL0 B;  3H1C A;  1ZAR A;  4MEY F;  1IJW C;  3CO7 C;  4XOR A;  1QU3 A;  1PJR A;  3GZ5 A;  4HX7 A;  1YO5 C;  2X0L A;  1Z7L A;  1NK3 P;  3ML6 A;  3WU2 C;  4EJV A;  2YU9 J;  1A31 A;  5D6F A;  5LD2 C;  1E0E A;  5J3L A;  2Y0S A;  5DUK A;  2OV7 A;  1WVR A;  4FQG A;  5DEQ A;  3K70 D;  1VFC A;  5L3G A;  4N4N B;  3ZQ7 A;  3CCR I;  1VI0 A;  5ILS A;  4ZJZ A;  3JCU C;  2Y2Z A;  2DYR H;  4O5V A;  4IQJ A;  2B7E A;  4BDZ A;  1G3S A;  2EA4 A;  3VYT B;  2JA8 J;  1LKX A;  4ABZ A;  1WH5 A;  3W2A A;  3J7A Y;  1VQ5 I;  3LFU A;  5E3O A;  3KP7 A;  3EQL F;  4M9S A;  3FK6 A;  3G71 I;  1HXD A;  2ZME A;  4BHC A;  5M5X J;  4AD9 A;  2X6X A;  1P2F A;  1Z91 A;  2A6E F;  4BJ5 C;  1Z3X A;  1Z77 A;  2WB1 N;  4W1U A;  5AON A;  4C30 A;  4EGZ A;  4XKW A;  3HZJ A;  1G6N A;  2WY8 Q;  5CQE A;  4ANJ A;  3P7N A;  1JKR C;  1LDK B;  3BLY A;  3I5U A;  4NQW A;  1RR8 C;  1W5S A;  3NWS A;  5DYM A;  1XCV A;  2EBI A;  2I8D A;  4M9Z A;  1DGR M;  2IEK A;  2LC2 A;  3G1M A;  3O8G A;  2Y31 A;  5M5W J;  1CF7 A;  3CMM A;  2HOT A;  1WJB A;  1T0F A;  1I3A A;  2RN7 A;  4MIM A;  1QQI A;  2A69 F;  2OJE D;  3RPU A;  4A2U A;  5A2Q K;  3JRA A;  3JTH A;  3R60 A;  3DKX A;  2CRG A;  2LF8 A;  4PCQ A;  4UUS A;  2X9D A;  3ZQL A;  1W0T A;  1D5V A;  3FM3 A;  2DA7 A;  1W36 C;  5B5E C;  1R6R A;  2PQ8 A;  3Q5F A;  1HW1 A;  2EIL H;  3GZ6 A;  3G1O A;  3TQN A;  3QPH A;  1X1A A;  4PJM A;  2DTZ A;  2LKS A;  5IOZ A;  3M1C A;  2F2E A;  5GPC A;  1S7O A;  5IT9 Z;  2P6T A;  1YW7 A;  3HOW J;  1EH6 A;  2R5Y A;  3EET A;  1BI1 A;  5F6F A;  5LGT A;  1RIO H;  4UB8 C;  2M8E A;  3GF2 A;  1JXS A;  3L2Q A;  3RZD J;  2IA2 A;  1LFP A;  4XK4 A;  3K4L A;  1ETW A;  3L09 A;  1ZKG A;  2X6Y A;  1YLF A;  3LST A;  1H89 C;  4PJL A;  4N9H A;  3CME I;  2JA2 A;  2IS1 A;  3U2R A;  5KNL A;  2WBM A;  2ELK A;  4AIJ A;  4I0B A;  4XN3 A;  3PIO F;  1YQA A;  4S0H B;  2KLO A;  2HOE A;  2BXZ A;  2ZJP F;  1HA8 A;  2BYV E;  3OYJ A;  2TCT A;  4A5N A;  3WGI A;  1ETX A;  4DW6 A;  3MZY A;  2YUS A;  2L9V A;  3GFI A;  2KRH A;  4D1Q A;  1T39 A;  2QVO A;  4BQQ A;  3PNY A;  1XPX A;  4AVP A;  3HTU A;  4ZH4 F;  3IAS 2;  4E7J A;  3UKG A;  1D1A A;  2JWT A;  2KDO A;  1ZR2 A;  4C2T A;  1TWA J;  1FOX A;  1J09 A;  4D9J A;  2ISZ A;  1MND A;  4HSR A;  4XM3 A;  5ILU A;  2VPR A;  4A3L J;  3ZCO A;  2O61 A;  4CDG A;  3DTE A;  3H92 A;  3KP2 A;  3K7A J;  2Z2S B;  4BDY A;  1HDD C;  5HLT A;  1XX5 A;  1OYY A;  1BA5 A;  4BU2 A;  3QPT A;  3JTG A;  2KRF A;  4BJ6 C;  2IGO A;  4HLX A;  5FKO A;  4DGW B;  2V6E A;  5L3B A;  3CP8 A;  3HC7 A;  2BW3 A;  4GCV A;  4IEJ A;  4IVN A;  3WTZ A;  2L4A A;  3ZQQ A;  4C3H J;  4KMU X;  2V4J C;  4ZTJ A;  1JTY A;  4G7Z F;  2E5Z A;  4RM3 A;  5E20 A;  3K1N A;  2LOO A;  1UEL B;  1OMI A;  2F5D A;  2IXS A;  2V1D A;  1RC9 A;  4XRS A;  2RNJ A;  3JR9 A;  3I56 I;  1F1Z A;  5HLH A;  2EV0 A;  4RGX A;  1YRN B;  2CQQ A;  1IUF A;  2D2W A;  3H5R A;  1YFH A;  3K4K A;  4EJW A;  3ZOB A;  2QQ9 A;  2CU7 A;  2ZB9 A;  2FBI A;  3H5A A;  2M4G A;  1W5T A;  4KMF A;  2BBY A;  5F0H A;  5DD8 A;  1LVK A;  1KQ0 A;  2EPF A;  3GEZ A;  3WGG A;  4EGY A;  3BCB A;  1WJE A;  4KIS A;  2K40 A;  4BGD A;  3PQJ A;  1FOW A;  2QF7 A;  2W4S A;  4HA8 A;  3S17 J;  2O9L A;  4QPO A;  4FX4 A;  2VKD A;  1R1V A;  2D5V A;  1Y8R B;  1OCT C;  3SEQ A;  2DI3 A;  4Q47 A;  2QBY A;  1QGP A;  2PG4 A;  3HUG A;  5E1Z B;  2M30 A;  3FHZ A;  2K4J A;  1W7P D;  2KZV A;  2E60 A;  3GTJ J;  2ISY A;  4PJJ A;  1HKT A;  1KU7 A;  3JSO A;  2AHQ A;  4A3I J;  4U0V A;  3FXJ A;  2CQX A;  1S7A A;  5B3S H;  3I71 A;  4NC8 A;  3T1B A;  2LRE A;  4CCN A;  5CVR A;  4DZJ A;  4HX4 A;  4V2F A;  1QRY A;  1AU7 A;  5FLX Z;  5EJC A;  2LLK A;  2WC2 A;  4ENM A;  2R3S A;  4PGG A;  2QQA A;  1A36 A;  2MYS A;  1WZ2 A;  3WOD F;  3PM1 A;  3LL7 A;  2DOD A;  1DPU A;  3L2V A;  3HRU A;  1ETO A;  4ITV A;  3LSP A;  2OUM A;  4LIV A;  2L01 A;  4YIR X;  3GTQ J;  1VF9 A;  4HNU A;  3D0S A;  2J5P A;  3MKY B;  4BS9 A;  4BHB A;  2OQR A;  4OIR F;  3RKX A;  1J75 A;  1TL8 A;  2DOA A;  2M7B A;  1Z21 A;  3SYT A;  2BY0 A;  4BJT A;  4IPA A;  2KIQ A;  2W25 A;  3J81 K;  4BEH B;  4XLP F;  4PDK A;  1G4D A;  3LSK A;  1CGP A;  1KA8 A;  5FRO A;  3HDD A;  4EJU A;  3F8B A;  2L3D A;  3K4J A;  3F0C A;  1K7A A;  1FBS A;  1IRX A;  2BY1 A;  4M9X A;  1RRJ A;  3TW7 A;  1M1E B;  2MA3 A;  2LTP A;  3RIR A;  4Y7N J;  5IPA A;  2HS5 A;  4M73 A;  3UNG C;  3OOP A;  4FHT A;  4E7L A;  1AKH A;  4H4K C;  3CCE I;  3SQN A;  1FIP A;  1JKO C;  3NAU A;  1VQ8 I;  4RDU A;  4G94 A;  4E6K G;  2UWM A;  3GUD A;  2LYC A;  2NXN B;  1GUU A;  1QPI A;  2XUB A;  3A4C A;  1W36 D;  4XRF A;  4FCY A;  4F55 A;  1JT6 A;  3FM5 A;  2V7F A;  2DLL A;  1XGM A;  3OMY A;  1EA3 A;  1H88 C;  2K9N A;  1X3Z B;  2ECB A;  2X48 A;  1B9N A;  5LBQ A;  2HYF A;  4TV7 A;  4WF2 A;  1WCM J;  4P1W A;  1IRF A;  4A0Z A;  1E17 A;  4FE4 A;  4HST A;  2R7X A;  1FX7 A;  3BR0 A;  2NNN A;  3CCQ I;  4I09 A;  3GVA A;  4ON0 A;  3OYK A;  4II2 A;  4X0G A;  4OIP F;  2R0Q C;  1HOM A;  1MDM A;  2ZXJ A;  5E1W A;  1J5Y A;  2UXN A;  5GP9 A;  3RYP A;  2GOX B;  4E70 A;  2CO5 A;  3GFL A;  1S5L C;  3ZN1 A;  3D5S C;  5EG0 A;  1POG A;  3I0T A;  1J2X A;  4EEF G;  2L54 A;  1LPQ A;  4XLH A;  1ZG3 A;  2CSO A;  2ZC2 A;  3DEU A;  5J8F A;  3H35 A;  2JJ7 A;  3IHU A;  1R4N B;  4PK4 A;  2O3F A;  4CGZ A;  2VKV A;  3BTJ A;  2L7K A;  3B73 A;  4E4H A;  1KZH A;  2FD5 A;  1IN8 A;  3KIO A;  4PSW A;  1X4O A;  2Y30 A;  2IRF G;  3MN2 A;  2DOF A;  2KMU A;  2R7F A;  1RPW A;  1F36 A;  3BZK A;  3CJQ B;  1ONV A;  2ELH A;  1R36 A;  1BIB A;  1W7P B;  5HNH A;  4Q48 A;  1S8N A;  3I59 A;  4A12 A;  1T98 A;  5CVU A;  3REO A;  4HQM A;  5H20 A;  3ZQI A;  4BE0 A;  3OV8 A;  1JGS A;  2COB A;  1ZH5 A;  2V1N A;  3GLX A;  3UR3 C;  3CES A;  2HFH A;  4YRV A;  1FYL A;  1FP1 D;  3F8F A;  1I6X A;  3IV5 A;  1PUF A;  2JPB A;  1WRJ A;  2DTR A;  1LUJ B;  2LDU A;  4V19 K;  1I1G A;  4K2E A;  4RAZ A;  5FGM A;  1UHW A;  3TGN A;  2JPC A;  1IDZ A;  2OTL I;  1FTZ A;  1MBG A;  1JHF A;  2BGC A;  1XDU A;  4HRI A;  2FBK A;  2HKX A;  3H3U A;  3R61 A;  4RAG A;  5HS9 A;  4U87 A;  4GDF A;  2GOM A;  3BR2 A;  1TQM A;  5EGO B;  4KT5 C;  1ZTR A;  3LA3 A;  3CUQ C;  3FXL A;  1MBH A;  1OCO H;  5E3M A;  1XG1 A;  4I76 A;  3LWF A;  1WH7 A;  3TO7 A;  3U21 A;  1EH7 A;  1ZN2 A;  3M7G A;  5JVG F;  2LP0 A;  1SD6 A;  4LG3 A;  3ONQ A;  1YOV B;  2DXI A;  3KET A;  3C3W A;  4IF4 A;  1MMG A;  1ZEL A;  2DA2 A;  2BHY A;  5L3E A;  1BJZ A;  1PVE A;  1KYZ A;  5M3F J;  1HKS A;  5FKL A;  6PAX A;  4KIF A;  2JA7 J;  3QPL A;  3A0H C;  5D4R A;  1YX5 A;  4DQ2 A;  4OMY A;  1IUY A;  3MZ8 A;  1D0Z A;  2XRN A;  3K4B A;  2QLZ A;  3QRF F;  2WB1 A;  4DBQ A;  1TP4 A;  2BV6 A;  2V9P A;  1BL0 A;  4FIS A;  1TQP A;  4GFB A;  1Z0X A;  3QWL A;  9ANT A;  3GTO J;  2EB7 A;  5K5R A;  1WWX A;  2FSW A;  2O8X A;  1Y1W J;  4UUT A;  2M9H A;  2K27 A;  2NVT J;  4QIW N;  1D8K A;  1HLV A;  1XMA A;  2O5R A;  1IZ1 A;  4GO1 A;  2R7V A;  4A3E J;  4Y33 A;  4OIO F;  2EJR A;  2CYY A;  2ESH A;  1UHS A;  3K1P A;  1ITY A;  3SDB A;  2RQP A;  2VN2 A;  3RI4 A;  3OSG A;  1TT0 A;  3CUQ A;  2LNB A;  4GRI A;  1UJ8 A;  3K4C A;  2LBF B;  3TW6 A;  2K86 A;  3CP2 A;  1A35 A;  3A01 B;  5B66 C;  1OCZ H;  4LD5 A;  1RES A;  2VBW A;  2WV0 A;  3W3C A;  2FA5 A;  3HTS B;  3WTU C;  1MMA A;  1LDD A;  4EM1 A;  4I7H A;  1ZRD A;  2ETH A;  3ECH A;  4LIU A;  3JSP A;  3AKZ A;  1MGT A;  1WSU A;  3L7W A;  4J19 A;  3TKY A;  2VJ5 A;  1ZQ3 P;  1SAX A;  4AC0 A;  4U0W A;  1RI7 A;  1XGO A;  2R7S A;  3KZZ A;  1XSX A;  1JUM A;  3Q3S A;  2MC3 A;  1TBX A;  1T6S A;  3FIS A;  3O3K A;  2W57 A;  2DCE A;  1V3F A;  3WGH A;  1BC8 C;  3CQZ J;  1G3W A;  5IP7 J;  3FMQ A;  1DDN A;  1MMN A;  4EJT A;  5GTI C;  2O0Y A;  3VYS B;  5FKM A;  2GM4 A;  1GXQ A;  3ZQF A;  2HQA A;  1IF1 A;  3BG9 A;  2XKP A;  3LA7 A;  3H3V K;  1S29 A;  2E35 A;  4ZTF A;  1IN6 A;  1J59 A;  2VQL A;  2M2E A;  2F4I A;  4LMY A;  1JI8 A;  1WPK A;  4LFU A;  4YFX F;  4N9I A;  3NWT A;  5EYR A;  1BJA A;  4N0B A;  1BBY A;  3EYY A;  1S3J A;  1FY7 A;  4PFO A;  3VEP A;  3WTW C;  1ACI A;  1G8X A;  3ECO A;  3E3V A;  1QO0 D;  2CH0 A;  5ICE A;  1SAU A;  1OR7 C;  2OCC H;  4OIN F;  3E6M A;  1GV2 A;  1FMV A;  1W5C C;  4KN4 X;  3SFZ A;  3CCS I;  2MGQ A;  3WTS C;  2R7O A;  3CDL A;  3DBR B;  1MNM C;  3A03 A;  2EFO A;  3KYL A;  2VOP A;  1UAA A;  5HS7 A;  3SFI A;  4KIC A;  3ZN0 A;  3PNT A;  5C4J J;  2XIG A;  2R7D A;  2FMY A;  2Z5U A;  3I9V 2;  2PFB A;  1X19 A;  3GTK J;  4RGR A;  4XLA A;  3T5X A;  1STZ A;  3P5J A;  2KIS A;  3S93 A;  2N8G A;  2KP6 A;  1D8J A;  4KN7 X;  5KK1 A;  4XON A;  3U1D A;  4Y13 A;  3O8H A;  2ZJQ F;  3WU0 A;  4XID A;  2BY2 A;  3MKL A;  4BKX A;  4RLQ A;  3MD2 A;  5LGU A;  3GLL A;  4NDL A;  1B72 B;  4HLY A;  3V7R A;  5HDK A;  3X2Q H;  3MVP A;  3CMY A;  3F22 A;  1HSJ A;  5C3E J;  2OF7 A;  1L0O C;  1ETQ A;  4P96 A;  4XSZ F;  2KRC A;  2L02 A;  2L9S A;  3E97 A;  2IGM A;  1VQN I;  2GXB A;  2CUZ A;  4HNT A;  4XIC A;  1FEX A;  1WJ5 A;  1RNL A;  3TDU C;  1OR7 A;  2QKM B;  2AS5 F;  3S1Q J;  2YS9 A;  2RKH A;  2LF7 A;  1LNW A;  2L9R A;  2M1B A;  5J1Y A;  2VOD A;  1I6H J;  2LG4 A;  2GQQ A;  3QYB A;  3VOE A;  5ICC A;  5K7H A;  2OPT A;  3DLL F;  3KEY A;  3Q9V A;  1X1C A;  1W1W E;  1LJ9 A;  2BEO A;  3BOQ A;  3ESW B;  4DJA A;  1T8I A;  1H8A C;  3C7J A;  3JRC A;  1ERD A;  2QSG X;  2LMD A;  1GVD A;  2O7O A;  3T8T A;  3PJR A;  3FXQ A;  3OYD A;  2NNY A;  4Y15 A;  1IO2 A;  2C6Y A;  2L2O A;  2ZKZ A;  2CUJ A;  2R7U A;  1YS7 A;  2HTJ A;  4UB6 C;  4BUP A;  1F4K A;  2VJ4 A;  1UHM A;  5F1J A;  2VXZ A;  4HQE A;  2M4K A;  2W85 A;  2L5Q A;  3GO5 A;  3EPZ A;  4XSX F;  1TNT A;  4RB3 C;  4A3B J;  3VWB A;  3RKW A;  5J4V A;  2MG4 A;  2H94 A;  1RUN A;  2FEZ A;  2GXA A;  3GME A;  3S2W A;  4AID A;  2F5F A;  4L5I A;  1FNN A;  3H9G A;  3ZQC A;  2ID6 A;  2F48 A;  2M8G X;  4CZZ A;  2JQ7 A;  3V8K A;  5EG0 B;  3GTG J;  3BDD A;  4JX5 A;  4XKC A;  3SZG A;  5DTD A;  4D0P A;  4D5F A;  5J6X A;  4IKF A;  4IX7 A;  2JA5 J;  1AOY A;  4U7B A;  3JRG A;  3BJO A;  5LHG A;  1JTX A;  4CCJ A;  4IRI A;  5HOO A;  4DYC A;  3L2W A;  1MNE A;  1ETK A;  2HVR A;  3T0Y A;  1WHU A;  3BG6 A;  2R5Z A;  3I59 B;  1PYV A;  2ZNY A;  3JRE A;  3BP8 A;  3ZR8 X;  5DDG A;  2WWY A;  3KCC A;  1V5G A;  2LR8 A;  4IHW A;  1HST A;  2XPU A;  1ZLJ A;  3DEW A;  2Y0M A;  2XPW A;  4KDP A;  3CTA A;  3TED A;  4B8X A;  3V7S A;  1OCC H;  2BY3 A;  3BPV A;  3PFY A;  2VUM J;  5A2Q Z;  4GGG A;  4II3 A;  5J4Y A;  3Q9S A;  4E7I A;  2HVQ A;  2GBY A;  1W0U A;  2P0W A;  2H1K A;  4ZC3 A;  5E3N A;  3CJR B;  1YIO A;  2DT7 B;  2CW0 F;  4CA0 A;  1OKR A;  1P4A A;  1IRG A;  5IT3 A;  1QZY A;  4ZYA A;  4DNC A;  4ZYE A;  3BR3 A;  5DS9 A;  2WAF A;  3BJA A;  2LY2 A;  1FC3 A;  4E7H A;  3J7Z I;  2JUC A;  3WG7 H;  2ME6 A;  4F91 B;  4R79 A;  2XAJ A;  1RR7 A;  2E34 A;  2OU2 A;  3PQK A;  3OIO A;  5CVI A;  3A0B C;  3MEX A;  3HHG A;  1K61 A;  2VXD A;  3KLN A;  2CUF A;  4IXA A;  1T33 A;  4PUS A;  4QSH A;  3TP3 A;  4AIH A;  2HZD A;  4CYC A;  1IXS B;  2HOS A;  2MLG A;  2K3P A;  3OYL A;  2XDV A;  2D45 A;  3JRI A;  2BVL A;  1YTY A;  1K78 B;  2M0C A;  1NTC A;  2LD5 A;  1BOB A;  1OCP A;  2FOK A;  2W82 A;  2X85 A;  1ZRF A;  1BOA A;  2V1X A;  4GYI A;  5K5Q A;  1R23 A;  2JTV A;  3AG3 H;  2E5N A;  1IXC A;  2W48 A;  2CMP A;  3NQO A;  3P9I A;  1YHQ I;  2VE8 A;  4A93 J;  3DF8 A;  2CQN A;  3M9A A;  4RAY A;  4G6T B;  4ENN A;  4U88 A;  4R1H A;  2FNA A;  2W00 A;  1BW5 A;  3RSN A;  1YYV A;  1X1D A;  1D1B A;  2CW8 A;  1ODD A;  3I54 A;  3QOD A;  3OL4 A;  4GYG A;  4XKB A;  1WJF A;  5EZG A;  5LEK A;  5HVQ C;  2V1U A;  3V4G A;  2H6C A;  4WXH A;  3I4M J;  3H9Q A;  3WG9 A;  4BXX J;  3EYI A;  2MH9 A;  5FRN A;  2GZW A;  3QAH A;  1WGX A;  4RB2 C;  1VQL I;  3K10 A;  1IAW A;  4JOM A;  3PIP F;  2HDC A;  3LSR A;  2ZNZ A;  4B48 A;  2J5O A;  2OBP A;  1JUP A;  2DJN A;  2RAE A;  2WTE A;  2VJJ A;  2KZG A;  2HXO A;  2FUG 2;  3VB2 A;  5L3F A;  2L7M P;  3GZN B;  2STT A;  2V9K A;  2A68 F;  4B3X A;  1S9H A;  3R4K A;  4BHP A;  3OIP A;  4S05 A;  1E2X A;  2XGE A;  4RGS A;  4HV6 A;  3BPX A;  1X3U A;  2DBB A;  3EUA A;  2XHK A;  1GV5 A;  2XPV A;  2Y75 A;  3OSF A;  1R4M B;  1WJD A;  3OR1 C;  1GXP A;  2XAQ A;  2DQL A;  3CLO A;  2NYX A;  1FOK A;  4CCL A;  2DOE A;  3E7L A;  4U0Y A;  3C2B A;  2R7R A;  4A6E A;  1I5Z A;  2DA1 A;  1WJA A;  2B0L A;  2DMT A;  4ESJ A;  2CFX A;  1JKP C;  1IGN A;  2VKE A;  1PP7 U;  1T08 B;  1G59 A;  1Z9C A;  2GLO A;  2OTJ I;  3S1M J;  4RS8 A;  2Z16 A;  3BCA A;  5EDN A;  3IH3 A;  3HXL A;  5BPI A;  5LRS A;  2LH9 A;  2ZXH A;  3DKY A;  3HKZ A;  3RQI A;  3EUH C;  2FML A;  2VQC A;  2IA0 A;  3GTP J;  2HI3 A;  1FZP B;  1YS6 A;  3U1K A;  1XB4 A;  5L3D A;  2ZJ2 A;  4DOZ A;  4M3E A;  5DV5 A;  2IS4 A;  2R7T A;  5KCM A;  1U2W A;  3HJE A;  4EQQ A;  3K9T A;  2ZSI B;  4LK1 F;  4HZF A;  1U3E M;  4B47 A;  1MH4 A;  4IZZ A;  2CUE A;  1VTN C;  3CC4 I;  2OZ6 A;  3FXK A;  5H6Q A;  4KIT B;  4NHJ A;  3HEF A;  4A0X A;  1OCR H;  3BR6 A;  2DJI A;  3PO3 J;  3VYR B;  3OR2 C;  1V4R A;  2FXA A;  3BZC A;  2MD0 A;  1JUS A;  2QYO A;  3RKQ A;  1UMQ A;  4CYD A;  3F9K A;  3B02 A;  3DPT A;  3VSK A;  2NOG A;  3EUK L;  1Z3Y A;  3HSF A;  4OOI A;  3K4M A;  2P4W A;  4ESF A;  4F7Z A;  3E5U A;  3L00 A;  5GAE J;  3S3M A;  2VT2 A;  3M8E A;  2HKO A;  1A6Q A;  3BZ6 A;  2F5V A;  3W2W A;  3LQR A;  2G9W A;  4BH9 A;  4RLF A;  4BE1 A;  2F6C A;  3RPU D;  2DK8 A;  2K4B A;  2VPL A;  1V55 H;  5HDN A;  3EUH A;  1LFU P;  2HPM A;  2VBY A;  2FRH A;  4LG0 B;  2DMQ A;  3A1Y A;  1NH3 A;  2LSO A;  4MO7 A;  4UXN A;  3J81 Z;  3J7Y J;  2DFH A;  1RZ4 A;  2M0M A;  2E1M B;  1K4S A;  3FBN B;  5C44 J;  5M3M J;  5FD6 A;  2FJ1 A;  1ZLK A;  1EKE A;  5F27 A;  3ERM A;  1ZG1 A;  1NG7 A;  5K7F A;  4ETS A;  3MCZ A;  2XGC A;  2D1H A;  1U5T B;  2RGV A;  1DP3 A;  1KU9 A;  2WV1 A;  3K2Z A;  4I02 A;  5D5X B;  4FTH A;  1QZE A;  3F8C A;  1EJ9 A;  4YEJ A;  1ZGA A;  2Y9Z A;  3KZI C;  1HW2 A;  1WI9 A;  2DA4 A;  1T95 A;  2FQ3 A;  1YJW I;  4A3J J;  3BT9 A;  1ZR4 A;  4AVZ A;  1FT9 A;  1TNS A;  2E2I J;  1ZK8 A;  3ABT A;  3F23 A;  4IHX A;  2HQR A;  1I1S A;  2BE5 F;  1SFK A;  3FKJ A;  2LVS A;  5FKK A;  4NNJ A;  1X3W B;  1TC3 C;  1R1U A;  2XF6 A;  2PJR B;  1Z7U A;  3MFK A;  3MZH A;  3R0J A;  5K7Z A;  2DA5 A;  3ZXS A;  1MSE C;  2ADU A;  1FYK A;  1ZGJ A;  3AL0 C;  3LSJ A;  1Q1V A;  1P6R A;  1HW5 A;  2F5C A;  4D7N A;  4IOA F;  1VQP I;  3ELK A;  3CJN A;  3HB9 A;  2RDP A;  1IV8 A;  2X1D A;  4YII A;  3KEQ A;  3AG1 H;  2HDD A;  4QLC U;  2VBZ A;  2XV4 S;  2R93 J;  1ZYR F;  3E6C C;  3LFK A;  2M5W A;  3J80 K;  1ORK A;  5D5W B;  5B1A H;  2VLA A;  3GBG A;  3I64 A;  3FX3 A;  4JQF A;  1YW9 A;  5GPA A;  2H09 A;  4M6X A;  2H27 A;  4A3C J;  2PMH A;  2KFD A;  4EV0 A;  1IW7 F;  1PP8 F;  2FBH A;  1B8I A;  1SFX A;  2DYS H;  3KP6 A;  2M7A A;  2COM A;  1RUO A;  1KQ8 A;  1MBJ A;  5KVR A;  2ZME B;  4XR6 A;  1O7F A;  1LDJ A;  2MLK A;  3GFM A;  1V54 H;  1DGW Y;  4IRH A;  1P9Q C;  3ABK H;  1ENH A;  1WFX A;  4I99 C;  2IAI A;  4KJZ A;  2ID3 A;  4NQW B;  3ZMD A;  4L9T A;  2EZL A;  3BQZ A;  2IT0 A;  3I53 A;  2HU9 A;  4UHT A;  5DCM A;  1CF7 B;  2VIX A;  4XKV A;  4IHS A;  2ZFU A;  2QQ8 A;  1B59 A;  5KHD A;  2ZCW A;  3OS0 A;  4UUS B;  5F1R A;  3E1S A;  5DD4 A;  3OOU A;  3HPG A;  1O3S A;  4JK1 X;  5KAI C;  2STW A;  1FOY A;  4HYE A;  4BL0 B;  1NK2 P;  5TJJ A;  2X1C A;  1W4M A;  3CCV I;  1FTT A;  2LFB A;  2V26 A;  2W84 A;  1FJL A;  1DPR A;  1IN5 A;  1BC7 C;  3CCY A;  3VYU B;  3TO6 A;  2P8T A;  2QGU A;  2R5Y B;  3D5L A;  4RMN A;  4EAT A;  1XN7 A;  4KT6 A;  1BI0 A;  3DFG A;  5LFA A;  1E3H A;  4YFN F;  2CGP A;  3A2K A;  1VQ9 I;  2HGC A;  2ZBK A;  4BE2 A;  3TBI A;  4PGH A;  3DTI A;  1QNT A;  3PO2 J;  2JRT A;  3JAM K;  1SMY F;  3K6G A;  4KIB A;  1R7J A;  2CV1 A;  2H1L A;  4A3K J;  3BG5 A;  4L0Z B;  2A5W A;  3WTY C;  5LEJ A;  3MAJ A;  1MW7 A;  3BTI A;  2B9S A;  1KON A;  2DDA A;  5JFR A;  2TDX A;  4ZDP A;  1LB2 A;  1N25 A;  3ZMU A;  2EFN A;  1LQ1 A;  4CO8 A;  3LMM A;  3ZMS A;  5FFX A;  1VQM I;  1MH3 A;  2EIM H;  2MD5 A;  4XLE A;  2HEO A;  2VE9 A;  3HKZ N;  3JRF A;  1EF4 A;  2FNP A;  4D7M A;  2HQ5 A;  3VDX A;  2WAQ A;  2PN6 A;  1VQ6 I;  5FLV A;  2DPD A;  5CJ9 A;  4MTE A;  3V42 A;  1U9O A;  3MWM A;  4DIQ A;  3F21 A;  2EIN H;  1R1T A;  3WE2 A;  2R7W A;  2VQH A;  5CVV A;  3G73 A;  1MBE A;  2A6T A;  4O6J A;  4HOB A;  2R7Z J;  2RQQ A;  2H8W A;  1JJ6 C;  2AQE A;  2YU3 A;  3N97 A;  4KNY A;  5C4X J;  1QBJ A;  1OIS A;  2JVG A;  1XTA A;  3KX2 A;  3QYE A;  1NHA A;  2BW3 B;  3PFI A;  1P92 A;  4HPQ A;  5B1B H;  2EWN A;  3CF2 A;  3KP4 A;  3RYR A;  3ULQ B;  2UV1 A;  4AUX A;  5JR3 A;  4C2U A;  1GHC A;  3MMY B;  4XL9 A;  3CJT B;  1YX3 A;  2IJL A;  3IC7 A;  4A69 C;  1NG6 A;  3IAM 2;  2IPQ X;  1OYW A;  2AO9 A;  1LFB A;  4G7O F;  2IVM A;  3GTL J;  2EH3 A;  2HYJ A;  1UG2 A;  2OD5 A;  4LIT A;  5HOD A;  4A3F J;  2QZ8 A;  5HLG A;  2E71 A;  3DCF A;  1JJ8 C;  1LEA A;  4AU7 A;  3S3O A;  1OLT A;  4L9N A;  2DMP A;  3S3N A;  3TL4 X;  2JSP A;  2K3F A;  4BQN A;  4HBL A;  1AA7 A;  3AAF A;  3FK7 A;  1LE8 A;  2IS6 A;  5ERI A;  2QQB A;  1B4A A;  1TW3 A;  3K69 A;  2KPM A;  3LSI A;  3M8F A;  3IRR A;  4BNC A;  4UVA A;  3DQV C;  2E2J J;  4UVC A;  2WY7 Q;  1MSF C;  3I55 I;  3L9F A;  1TT5 B;  4U7D A;  2XSJ C;  1WI3 A;  3BG7 A;  4B44 A;  2MC4 A;  4D5C A;  1MJB A;  3L1P A;  5KAF C;  2IGK A;  2P5K A;  3FXU A;  3ZGK A;  1RKT A;  2HZT A;  3BWG A;  1J0R A;  3MQ0 A;  5F08 A;  1SD5 A;  1Y8Q B;  4B09 A;  3ZP5 A;  1DUX C;  1GDT A;  2DW4 A;  2QBY B;  4P55 A;  3IL2 A;  4G7H F;  3LSH A;  5GTH C;  3HUG B;  3FXM A;  1G3Y A;  1YE9 A;  2EIK H;  4CXF A;  3CDH A;  1U9N A;  5CVJ A;  3WU1 B;  3OYI A;  2A61 A;  4CZC A;  1KQ9 A;  1TW2 A;  1DU0 A;  4DBR A;  3BC8 A;  5J1R A;  3K1M A;  4BAC A;  3ROU A;  2OAZ A;  3PL8 A;  3S2D J;  1WJC A;  3EDP A;  1IN4 A;  1I50 J;  4MTD A;  3CCM I;  4XRM A;  2QCO A;  4FT8 A;  1TWC J;  3D5R C;  3H0G J;  3RCO A;  3K2A A;  2JRM A;  3W6K B;  1XMX A;  1YRN A;  2GXG A;  2P6S A;  5L3C A;  3E5Q A;  2VON A;  3QPS A;  2NVY J;  2XRL A;  4IHT A;  4KUM A;  5D4S A;  4BAY A;  1FBQ A;  3G4S I;  4I01 A;  5JHF A;  2L4M A;  3NRV A;  4FAS D;  3DEE A;  4ZZL A;  3ASO H;  5FO5 A;  1F9N A;  1MZB A;  2ZO4 A;  1UG0 A;  1X4P A;  1VQK I;  3QP5 A;  2LY1 A;  2UUZ A;  3CUO A;  2ZXW H;  1SFO J;  5BNG A;  5JLX A;  1DP7 P;  3MKW B;  4NBQ A;  1QHH D;  2KL4 A;  3G2B A;  3OIQ A;  2NS7 A;  2JMW A;  4J01 A;  4RB0 A;  3E6B A;  5H2F C;  2HR3 A;  2P5V A;  3DP7 A;  1T2K A;  3DU6 A;  1H9T A;  2M34 A;  1I39 A;  4FE7 A;  1AKH B;  1QPM A;  3M3Y J;  3S14 J;  3FHN A;  2DT5 A;  1K79 A;  3B6C A;  4OWR B;  4LB6 B;  3RQ4 A;  3ZPL A;  4XMY A;  1SEU A;  1QHG A;  3WTX C;  2DPU A;  4PJN A;  5E18 F;  3HRS A;  5BQT A;  2XKO A;  2GA2 A;  5DUI A;  1MJ9 A;  1APL C;  4HW0 A;  4DYR A;  1BR2 A;  1F5T A;  2GIV A;  3ABU A;  3PUF A;  4G6D A;  2RRE A;  3ZRG A;  4AYB N;  3JRD A;  1MDM B;  4Q5S F;  1U8R A;  3JW4 A;  5E3L A;  4N4O B;  4XLN F;  4ENK A;  1IV6 A;  2I10 A;  3E6D A;  1BR1 A;  2P5L C;  4MGR A;  4BEH A;  3PSI A;  1R71 A;  3KZY A;  4M6V A;  1P4W A;  2RV8 A;  4MFD A;  1FPQ A;  4HAM A;  1UB9 A;  2DQR A;  3HG9 A;  3FZV A;  4A3M J;  2E2H J;  5IP9 J;  2KT0 A;  3PNV A;  1EV7 A;  3KFW X;  5M5Y J;  4MLO A;  3L2R A;  5H6R A;  4RB1 A;  2NVX J;  3KP5 A;  2HNH A;  1B9M A;  1Y0U A;  2I5U A;  2DN0 A;  3AG2 H;  3JRH A;  3ZMT A;  1D0Y A;  1EH8 A;  1T0F C;  3KPH A;  2Z99 A;  2QKL B;  1QA6 A;  3HOV J;  4A0Y A;  5E79 C;  2MSY A;  1USS A;  3TO9 A;  1YJ9 I;  2Z33 A;  4WK8 F;  3M1E A;  4I6Z A;  1PUF B;  4RM2 A;  5FRM A;  2VI6 A;  4UY8 I;  2KIU A;  3DXJ F;  4C3I J;  2QA4 I;  3I58 A;  1O7L A;  1T38 A;  2WAQ N;  1Q1H A;  1UFM A;  1XS9 A;  3GYH X;  2YR2 A;  5IYD J;  1XD7 A;  4NB5 A;  1ZRE A;  3IH2 A;  1O57 A;  4CCO A;  1R5H A;  4ZYH A;  4M3B A;  1OYI A;  4XLF A;  2FU4 A;  4P9U A;  2QM3 A;  2X1E A;  4MFE A;  4LGW A;  4RGU A;  1MIJ A;  2XAG A;  2PBI A;  3HYI A;  2DA6 A;  3S15 J;  1MJA A;  4CCK A;  1E3P A;  3MKZ A;  1K6O A;  2E7W A;  3G1L A;  2LKX A;  3SEZ A;  4FET A;  5LGN A;  2H6B A;  4WX9 A;  3CLQ A;  1Y0N A;  1HF0 A;  3SXY A;  1W7P A;  2QSH X;  3QQA A;  1QVU A;  4EM0 B;  3HL2 A;  3HPH A;  5LLQ A;  3HSR A;  4JYK A;  2H8R A;  1IXR C;  4ZYD A;  2R4G A;  5ILV A;  2NVU B;  4E7S A;  3M4O J;  3S1R J;  1P7J A;  3QU3 A;  4BYY A;  1BN5 A;  2EZH A;  4F92 B;  4NC6 A;  5D5U B;  4Y3O A;  4L5E A;  4Z6Y A;  1SFU A;  5IOY A;  4B3A A;  2BHZ A;  2L9N A;  2Q1Z B;  1I3Q J;  1FBU A;  3OS2 A;  2Y69 H;  3TMO A;  4EMS A;  3ASN H;  3TOB A;  2W24 A;  5DM7 F;  3C1D A;  3FKI J;  2A07 F;  1Z6T A;  1SVO A;  2L0K A;  3S32 A;  4OIQ F;  3OYA A;  4Z2Y A;  4AM3 A;  2VBX A;  2BOL A;  4BXU A;  3JRB A;  2F4M B;  2CV0 A;  1SAN A;  3CUQ B;  3TP0 A;  5EGO A;  4E7Z A;  1BM9 A;  3LNQ A;  2VJI A;  1JE8 A;  2OZU A;  3LSG A;  2KJB A;  5EEH A;  3O2P E;  4L9V A;  4MQ9 F;  5ICG A;  3FF5 A;  4Y4R A;  2YPR A;  3HOY J;  3U9G A;  5FB2 A;  2K5C A;  4G8X A;  4YIF A;  1BR4 A;  2PLY A;  4WWC A;  1MMS A;  4CSW A;  5IT9 K;  1SMT A;  1V5E A;  1K6Y A;  2XAS A;  2QSF X;  3I4P A;  4XOP A;  2IW5 A;  1ON1 A;  2CW7 A;  3H36 A;  2G0E A;  3K0L A;  4O3M A;  2V79 A;  2FX0 A;  3IWZ A;  1E3O C;  4G12 A;  3P9K A;  4XNF A;  2ICW G;  1H9G A;  2ME0 A;  2X51 A;  1LE8 B;  3BTC A;  1O3Q A;  3DPL C;  3ISP A;  3NEU A;  4YG2 F;  3N4M A;  4LOC A;  2BXY A;  1TTY A;  2VKH A;  1XSD A;  3C18 A;  3HGG A;  3V8L A;  2JSC A;  1X58 A;  4X1E A;  2ECC A;  2ACJ A;  1CQT A;  4QTR A;  3A02 A;  2KIF A;  5J1U A;  4HV5 A;  3Q0V A;  4C9Y A;  3GFJ A;  3KE2 A;  4BBS J;  1V5F A;  1F43 A;  1SD4 A;  2MBF A;  2L7Z A;  1IRZ A;  2G7H A;  3WTT C;  1ETV A;  2E7X A;  2IP2 A;  2K7L A;  3CC7 I;  5EEA A;  1R5I D;  2EK5 A;  2LBF A;  3A01 A;  1S7E A;  1FMW A;  3B6A A;  5HLI A;  4M71 A;  3RDI A;  2A6H F;  4IHY A;  2X6O A;  2O6G E;  3HHH A;  2Y48 A;  3OYH A;  3DPU A;  4BY7 J;  1HQC A;  2EQR A;  2VAS A;  4PJ0 C;  4QWQ A;  1AHD P;  4F3Q A;  1WQ2 A;  3IUO A;  4LLG F;  4HDV A;  2ZXI A;  3GW2 A;  3NAR A;  3ZQG A;  2FF4 A;  4V2G A;  3ZMZ A;  2K9Q A;  2K85 A;  1O4X A;  1RKW A;  3RJP A;  1B1B A;  1Y6I A;  3KEO A;  2OQG A;  4B4C A;  3GXO A;  3H9J A;  2JK3 A;  2K9L A;  1D3Y A;  3SZP A;  4IOC F;  4HF2 A;  1VQ7 I;  4HF1 A;  3AG4 H;  4R8H A;  4HDU A;  2E1O A;  2Q2E A;  2XAH A;  1N75 A;  2EZI A;  3HOZ J;  4OMZ A;  4Y52 J;  3FDY A;  4CHU A;  4I98 B;  2RNG A;  3DU5 A;  5IP6 A;  3IRQ A;  2YX7 A;  1SVM A;  3HOX J;  2P81 A;  5F0F A;  1ZG5 A;  4BXF A;  4M3F A;  1P4X A;  4NUB A;  4CCM A;  4UNO A;  2CQ7 A;  4HEA 2;  5D6E A;  1PUE E;  2M87 A;  1KYW A;  2QWW A;  4EM2 A;  1OFC X;  5BOX A;  3LOC A;  3DKW A;  1Z67 A;  1BI2 A;  5JHU A;  2CJJ A;  1R9T J;  2XGX A;  1YI2 I;  5CYV A;  2HTS A;  4PSX A;  2EFP A;  2G7U A;  1D5Y A;  2GIZ A;  2PMZ A;  5CLS A;  3C2H A;  1IN7 A;  2A3S A;  2RC4 A;  4G6Q A;  5BS6 A;  2MAB A;  1N78 A;  5AIQ A;  3CDI A;  3I4N J;  3FXR A;  3G3Z A;  3W6V A;  1LEB A;  4DYQ A;  3ABM H;  4ZDO A;  2QUF A;  1R49 A;  4A3G J;  1BI3 A;  1MBF A;  4L18 B;  1DU6 A;  1VZ0 A;  4HX8 A;  1B72 A;  3CF5 F;  3F6O A;  4IJA A;  5EEG A;  4DZP A;  3J80 Z;  2Y0S N;  4E7K A;  2NVQ J;  2ELJ A;  5FLX K;  3LQQ A;  1VND A;  3BTL A;  2VOO A;  4ASN A;  4F52 A;  4WXC A;  5D8K B;  3OYG A;  1JGG A;  3HSE A;  2DT6 A;  4UVB A;  3F72 A;  4A5M A;  1D1C A;  2DU9 A;  1YIJ I;  3K4N A;  2XRO A;  4J00 A;  3PSF A;  2DFF A;  4AIK A;  3KLO A;  1U6G A;  2CV2 A;  3AFH A;  1HBX G;  1TLH B;  3C2G A;  2HOA A;  2VQG A;  1O3T A;  1TQI A;  2DFI A;  3GWZ A;  4IL6 C;  4JX6 A;  1IDY A;  3D1N I;  5ICF A;  3IP4 B;  2YSR A;  3ZMV A;  1G2H A;  2R5Z B;  1WKM A;  1YG2 A;  3IH4 A;  2A5Y B;  2WA0 A;  2WAE A;  3OYM A;  1UZC A;  5GAH J;  2QEN A;  3V7C A;  2XC7 A;  2Z9O A;  2F4O B;  1A04 A;  3FBI B;  4L9J A;  2XAU A;  5JVT A;  1ETY A;  3VOD A;  5CQG A;  1KU2 A;  4C2M J;  2BZT A;  1REP C;  3GTM J;  1QZZ A;  3SZT A;  3I3L A;  1Z1D A;  1U0J A;  4EJO A;  1HKQ A;  5JLW A;  2A05 A;  2DA3 A;  2VT3 A;  5HNF A;  1JT0 A;  2PI0 A;  3E5X A;  3HRT A;  1B6A A;  1N77 A;  2X6W A;  3H0D A;  3FIW A;  5FD5 A;  2XVC A;  1LVA A;  1S72 I;  4XN0 A;  3T8R A;  1TWH J;  1XCB A;  3W6J B;  1SFE A;  2K9M A;  1JHH A;  1TZL A;  2PEX A;  3DV8 A;  3HOT A;  3JAM Z;  4IO9 F;  2ZSH B;  4AYB A;  4CIC A;  2LK2 A;  3LA2 A;  2CWE A;  1VQO I;  4CYC B;  1OJL A;  4M72 A;  3QOE A;  3FMS A;  1FIA A;  2TRT A;  5HDG A;  2HPI A;  5FKN A;  2YX4 A;  1UCR A;  3CC2 I;  1A6I A;  3PUB A;  1ZRC A;  4WXD A;  3VSL A;  3CD6 I;  2BVM A;  2HWV A;  1SD7 A;  2MW8 A;  4UUV A;  5TIS C;  3RPQ A;  3FMR A;  2EFQ A;  3TOA A;  1JKQ C;  4IRG A;  1BW6 A;  2KKO A;  2P7C B;  2Y9Y A;  3E0J B;  3BY6 A;  1I27 A;  1RET A;  5F64 A;  3FWE A;  4MQV A;  1Y56 A;  2MFZ A;  2VC1 A;  3BR5 A;  2NS8 A;  2JZY A;  3HGY A;  4G9Y A;  1MD0 A;  2GWR A;  3IKT A;  4JP0 A;  2O03 A;  3Q0W A;  3OL3 A;  4UV9 A;  3F8N A;  1MKM A;  4RA2 A;  2VB6 A;  2DK5 A;  4ZZD A;  5TRD A;  1P7I A;  2JVH A;  2LKP A;  3KP3 A;  3F6V A;  3OYN A;  4Q4Z F;  1XC5 A;  3GX4 X;  1T56 A;  4M3G A;  3RTR A;  3RZO J;  2CQK A;  2UZK A;  3CZ6 A;  2E1N A;  2OA4 A;  2D1V A;  2GAU A; 
#chains in the Genus database with same CATH homology
 1PDN C;  3P9C A;  5LHI A;  2IA1 A;  2E1C A;  2NS0 A;  1ULY A;  5LHH A;  3CO6 C;  4AWX B;  4MHG A;  1K78 A;  4A6D A;  3V8J A;  1O3R A;  2X4H A;  2HQN A;  2V9V A;  1Z05 A;  2F5E A;  2DAO A;  3QU6 A;  1G3T A;  2EV5 A;  5BMZ A;  4LJZ F;  2V6C A;  1FYM A;  3COA C;  2VC0 A;  1FP2 A;  3LAJ A;  4KA4 A;  1FWZ A;  4M6Y A;  4I0A A;  2ZFW A;  3R0A A;  1BIA A;  5E1X A;  2M45 A;  2XAF A;  5E17 F;  2DO7 A;  3HOS A;  3RKY A;  5E8I A;  3SHF A;  3VFZ A;  1Z6R A;  5E8G A;  1YW8 A;  2PMU A;  3H3Z A;  4HF0 A;  3O6B B;  4KFC A;  2P7V B;  1GVJ A;  3ERE D;  3L2C A;  2NAZ A;  5J8C A;  2UXX A;  3F3X A;  2FE3 A;  5LRR A;  4XBF A;  4PZJ A;  2KJC A;  4LK0 F;  4EVI A;  1XGS A;  4WCG A;  3WTV C;  3WE3 A;  5AIP A;  1XDS A;  3BJ6 A;  4L0Y B;  3R6S A;  2JT1 A;  2AXL A;  2Q0O A;  5JI6 A;  4Y17 A;  4H0E A;  1FLI A;  1KGS A;  5K5O A;  1U5T C;  4I2O A;  4LB5 A;  3IWF A;  1R58 A;  2MH2 A;  4MEX F;  1J7K A;  1UST A;  1FSH A;  4P5O A;  2RVC A;  2K02 A;  4YFK F;  1ZAO A;  4JBA A;  3TDZ C;  3J7A O;  4MNU A;  2CG4 A;  4OU0 A;  4LG0 A;  4LLL A;  2KIM A;  5HS8 A;  1XSV A;  1J9I A;  4KYW A;  5D5V B;  2EV6 A;  1C0W A;  3HRM A;  4ESB A;  2HYG D;  2NRA C;  1AWC A;  4P9F A;  5K1Y A;  1U5T A;  1ZHF A;  2EA2 A;  4L5J A;  2ESN A;  1KU3 A;  2PJP A;  1FSE A;  4ZYG A;  4LLN A;  4BQA A;  1U78 A;  3LAP A;  4M74 A;  5DCF A;  4GXO A;  1H0M A;  2EFW A;  5D8L B;  5ED4 A;  1R22 A;  1L3L A;  3IKV A;  4UV8 A;  1R5G A;  4KIG A;  1R00 A;  3QP6 A;  3BRO A;  4ENJ A;  1OPC A;  1XMK A;  2Q8K A;  3HIF A;  3QOP A;  4S04 A;  1S6L A;  5DCM B;  2Z3Y A;  4FX0 A;  3F8M A;  1XGN A;  5BPD A;  5FFZ A;  2GA1 A;  1ON2 A;  1ZAR A;  4MEY F;  3CO7 C;  3GZ5 A;  4HX7 A;  1YO5 C;  2X0L A;  3ML6 A;  4EJV A;  5D6F A;  5DUK A;  5DEQ A;  5L3G A;  3ZQ7 A;  5ILS A;  4O5V A;  1G3S A;  2EA4 A;  3KP7 A;  3EQL F;  4M9S A;  1HXD A;  2ZME A;  4BHC A;  4AD9 A;  1P2F A;  1Z91 A;  2A6E F;  4Y13 A;  5AON A;  4EGZ A;  1G6N A;  3P7N A;  1LDK B;  3I5U A;  4NQW A;  1W5S A;  5DYM A;  1XCV A;  4M9Z A;  1CF7 A;  1T0F A;  2RN7 A;  1QQI A;  2A69 F;  3RPU A;  4A2U A;  5A2Q K;  3JTH A;  3R60 A;  4PCQ A;  2LF8 A;  1D5V A;  3FM3 A;  2PQ8 A;  3Q5F A;  1HW1 A;  3GZ6 A;  3TQN A;  3QPH A;  2F2E A;  1S7O A;  5IT9 Z;  2P6T A;  1YW7 A;  1EH6 A;  3EET A;  1BI1 A;  5F6F A;  5LGT A;  1RIO H;  2M8E A;  3GF2 A;  1JXS A;  2IA2 A;  3L09 A;  1YLF A;  3LST A;  4N9H A;  3U2R A;  4AIJ A;  4I0B A;  1YQA A;  2HOE A;  2BYV E;  4A5N A;  3WGI A;  3MZY A;  3GFI A;  1T39 A;  2QVO A;  4AVP A;  3HTU A;  4ZH4 F;  2ISZ A;  5ILU A;  2O61 A;  4CDG A;  3H92 A;  3KP2 A;  1OYY A;  3QPT A;  3JTG A;  2KRF A;  4HLX A;  5L3B A;  4GCV A;  4IVN A;  3WTZ A;  2L4A A;  4KMU X;  4G7Z F;  5E20 A;  3K1N A;  1OMI A;  2F5D A;  2V1D A;  2RNJ A;  1F1Z A;  5HLH A;  2EV0 A;  4RGX A;  2D2W A;  1YFH A;  4EJW A;  2QQ9 A;  2FBI A;  1W5T A;  4KMF A;  2BBY A;  5DD8 A;  1KQ0 A;  3GEZ A;  3WGG A;  4EGY A;  3PQJ A;  4HA8 A;  4FX4 A;  1R1V A;  2DI3 A;  4Q47 A;  2QBY A;  1QGP A;  2PG4 A;  3HUG A;  5E1Z B;  2M30 A;  3FHZ A;  2K4J A;  1W7P D;  2ISY A;  1HKT A;  1KU7 A;  3JSO A;  4U0V A;  1S7A A;  3I71 A;  3T1B A;  5CVR A;  4HX4 A;  5FLX Z;  2WC2 A;  4ENM A;  2R3S A;  4PGG A;  2QQA A;  3WOD F;  1DPU A;  3HRU A;  2L01 A;  3D0S A;  2J5P A;  4BHB A;  2OQR A;  3RKX A;  4OIR F;  1J75 A;  4IPA A;  2W25 A;  3J81 K;  4XLP F;  4PDK A;  1G4D A;  1CGP A;  1KA8 A;  4EJU A;  3F8B A;  2L3D A;  1K7A A;  1FBS A;  4M9X A;  2MA3 A;  3RIR A;  2HS5 A;  4M73 A;  3OOP A;  4FHT A;  3SQN A;  4G94 A;  2UWM A;  3GUD A;  2XUB A;  4XRF A;  3FM5 A;  2DLL A;  1XGM A;  1B9N A;  5LBQ A;  2HYF A;  4TV7 A;  4WF2 A;  1IRF A;  4A0Z A;  1E17 A;  1FX7 A;  2NNN A;  4I09 A;  3GVA A;  4ON0 A;  4OIP F;  1MDM A;  2ZXJ A;  5E1W A;  1J5Y A;  2UXN A;  4E70 A;  3RYP A;  2CO5 A;  3GFL A;  3ZN1 A;  3I0T A;  1J2X A;  2L54 A;  1ZG3 A;  2CSO A;  3DEU A;  5J8F A;  3IHU A;  2O3F A;  4CGZ A;  3B73 A;  1IN8 A;  2IRF G;  2R7F A;  1ONV A;  2ELH A;  1R36 A;  1BIB A;  1W7P B;  4Q48 A;  1S8N A;  3I59 A;  4A12 A;  1T98 A;  5CVU A;  3REO A;  4HQM A;  5H20 A;  3OV8 A;  1JGS A;  1ZH5 A;  3GLX A;  2HFH A;  1FYL A;  1FP1 D;  3F8F A;  1I6X A;  2JPB A;  1WRJ A;  2DTR A;  2LDU A;  1I1G A;  4K2E A;  4RAZ A;  5FGM A;  1UHW A;  3TGN A;  2JPC A;  1JHF A;  2BGC A;  1XDU A;  2FBK A;  2HKX A;  3H3U A;  3R61 A;  5HS9 A;  1TQM A;  4KT5 C;  3LA3 A;  3CUQ C;  3LWF A;  3TO7 A;  1EH7 A;  1ZN2 A;  3M7G A;  1SD6 A;  3KET A;  3C3W A;  4IF4 A;  5L3E A;  1KYZ A;  1HKS A;  6PAX A;  4KIF A;  5D4R A;  4DQ2 A;  4OMY A;  1IUY A;  3QRF F;  2XRN A;  2QLZ A;  2BV6 A;  1TQP A;  2EB7 A;  5K5R A;  1WWX A;  2FSW A;  2O8X A;  2K27 A;  1D8K A;  1XMA A;  1IZ1 A;  4GO1 A;  4OIO F;  2EJR A;  2CYY A;  2ESH A;  3K1P A;  2RQP A;  2VN2 A;  3RI4 A;  3CUQ A;  2LNB A;  2K86 A;  4LD5 A;  2VBW A;  2WV0 A;  2FA5 A;  3HTS B;  3WTU C;  1LDD A;  4EM1 A;  4I7H A;  1ZRD A;  2ETH A;  3ECH A;  3JSP A;  1MGT A;  1WSU A;  3L7W A;  3TKY A;  1SAX A;  4U0W A;  1RI7 A;  1XGO A;  3KZZ A;  1XSX A;  2MC3 A;  1TBX A;  1T6S A;  3O3K A;  2W57 A;  1V3F A;  3WGH A;  1BC8 C;  1G3W A;  3FMQ A;  1DDN A;  4EJT A;  2O0Y A;  1GXQ A;  1IF1 A;  2XKP A;  3LA7 A;  1S29 A;  1IN6 A;  1J59 A;  4LMY A;  4YFX F;  4LFU A;  4N9I A;  1BJA A;  4N0B A;  1BBY A;  3EYY A;  1S3J A;  1FY7 A;  3VEP A;  3WTW C;  3ECO A;  3E3V A;  1QO0 D;  5ICE A;  4OIN F;  3E6M A;  4KN4 X;  3SFZ A;  3WTS C;  2EFO A;  2VOP A;  5HS7 A;  4KIC A;  3ZN0 A;  2XIG A;  2R7D A;  2FMY A;  2Z5U A;  2PFB A;  4RGR A;  3T5X A;  1STZ A;  1D8J A;  4KN7 X;  5KK1 A;  3U1D A;  3WU0 A;  5LGU A;  4HLY A;  3V7R A;  5HDK A;  3F22 A;  1HSJ A;  1L0O C;  4P96 A;  4XSZ F;  2L02 A;  3E97 A;  2GXB A;  1RNL A;  3TDU C;  1OR7 A;  2AS5 F;  2RKH A;  2LF7 A;  1LNW A;  2M1B A;  2VOD A;  2GQQ A;  3VOE A;  5ICC A;  3Q9V A;  1LJ9 A;  2BEO A;  3BOQ A;  3C7J A;  3T8T A;  3FXQ A;  2NNY A;  4Y15 A;  2C6Y A;  2ZKZ A;  1YS7 A;  2HTJ A;  1F4K A;  1UHM A;  2VXZ A;  4HQE A;  2W85 A;  3GO5 A;  4XSX F;  1TNT A;  4RB3 C;  3RKW A;  2H94 A;  1RUN A;  2FEZ A;  3S2W A;  2F5F A;  4L5I A;  1FNN A;  4CZZ A;  3V8K A;  3BDD A;  5J6X A;  4D0P A;  1AOY A;  4U7B A;  3BJO A;  5LHG A;  4IRI A;  5HOO A;  3T0Y A;  3I59 B;  2ZNY A;  3BP8 A;  5DDG A;  2WWY A;  3KCC A;  1HST A;  1ZLJ A;  2Y0M A;  4KDP A;  3CTA A;  4B8X A;  3V7S A;  3BPV A;  5A2Q Z;  4GGG A;  3Q9S A;  1YIO A;  2CW0 F;  1OKR A;  1P4A A;  1IRG A;  5IT3 A;  1QZY A;  4DNC A;  4ZYE A;  3BJA A;  1FC3 A;  4R79 A;  2XAJ A;  2OU2 A;  3PQK A;  5CVI A;  3MEX A;  3HHG A;  3KLN A;  4IXA A;  4AIH A;  1IXS B;  2MLG A;  2D45 A;  1YTY A;  1K78 B;  2FOK A;  1ZRF A;  1BOA A;  2V1X A;  4GYI A;  5K5Q A;  1R23 A;  2JTV A;  1IXC A;  3P9I A;  3NQO A;  2VE8 A;  3DF8 A;  3M9A A;  4RAY A;  4ENN A;  4U88 A;  4R1H A;  2FNA A;  1YYV A;  1ODD A;  3I54 A;  4GYG A;  5LEK A;  5HVQ C;  2V1U A;  3V4G A;  2H6C A;  4WXH A;  3WG9 A;  3EYI A;  2MH9 A;  2GZW A;  3QAH A;  4RB2 C;  1IAW A;  2HDC A;  2ZNZ A;  2J5O A;  2OBP A;  2WTE A;  3VB2 A;  5L3F A;  2STT A;  2A68 F;  3R4K A;  4BHP A;  4S05 A;  1E2X A;  4RGS A;  4HV6 A;  3BPX A;  1X3U A;  2DBB A;  2XHK A;  2Y75 A;  1GXP A;  2XAQ A;  2DQL A;  3CLO A;  2NYX A;  1FOK A;  4U0Y A;  4A6E A;  1I5Z A;  2B0L A;  4ESJ A;  2CFX A;  1PP7 U;  1Z9C A;  4RS8 A;  5BPI A;  5LRS A;  2FML A;  2IA0 A;  1FZP B;  1YS6 A;  1XB4 A;  5L3D A;  2ZJ2 A;  5DV5 A;  1U2W A;  4EQQ A;  3K9T A;  4LK1 F;  4HZF A;  1U3E M;  1VTN C;  2OZ6 A;  5H6Q A;  4NHJ A;  4A0X A;  1V4R A;  2FXA A;  2QYO A;  4CYD A;  3B02 A;  3DPT A;  3HSF A;  4OOI A;  2P4W A;  4ESF A;  4F7Z A;  3E5U A;  3L00 A;  2VT2 A;  3M8E A;  2HKO A;  3BZ6 A;  3LQR A;  2G9W A;  4BH9 A;  2DK8 A;  2K4B A;  5HDN A;  3EUH A;  2VBY A;  2FRH A;  4LG0 B;  2LSO A;  4UXN A;  3J81 Z;  1RZ4 A;  5FD6 A;  1ZLK A;  1ZG1 A;  4ETS A;  3MCZ A;  2D1H A;  1U5T B;  2RGV A;  1KU9 A;  4I02 A;  3K2Z A;  5D5X B;  3F8C A;  1ZGA A;  1HW2 A;  1WI9 A;  2FQ3 A;  1FT9 A;  1TNS A;  3ABT A;  3F23 A;  2HQR A;  1I1S A;  2BE5 F;  1R1U A;  1Z7U A;  3MFK A;  3MZH A;  3R0J A;  2ADU A;  1FYK A;  1ZGJ A;  1P6R A;  1HW5 A;  2F5C A;  3ELK A;  3CJN A;  2RDP A;  4YII A;  3KEQ A;  4QLC U;  2VBZ A;  2XV4 S;  1ZYR F;  3E6C C;  3LFK A;  2M5W A;  3J80 K;  5D5W B;  3I64 A;  3FX3 A;  4JQF A;  1YW9 A;  2H27 A;  2H09 A;  4M6X A;  2PMH A;  4EV0 A;  1IW7 F;  1PP8 F;  2FBH A;  1SFX A;  3KP6 A;  2COM A;  1RUO A;  1KQ8 A;  5KVR A;  2ZME B;  1O7F A;  1LDJ A;  2MLK A;  3GFM A;  4IRH A;  3ZMD A;  4L9T A;  2IT0 A;  3I53 A;  4UHT A;  5DCM A;  1CF7 B;  4IHS A;  1B59 A;  2ZCW A;  5F1R A;  5DD4 A;  1O3S A;  4JK1 X;  2STW A;  4HYE A;  5TJJ A;  1W4M A;  2W84 A;  1DPR A;  1IN5 A;  1BC7 C;  3TO6 A;  2P8T A;  3D5L A;  1XN7 A;  1BI0 A;  3DFG A;  4YFN F;  2CGP A;  2HGC A;  2ZBK A;  4PGH A;  1QNT A;  2JRT A;  3JAM K;  1SMY F;  4KIB A;  1R7J A;  4L0Z B;  3WTY C;  5LEJ A;  3MAJ A;  5JFR A;  2TDX A;  1LB2 A;  3ZMU A;  2EFN A;  1LQ1 A;  4CO8 A;  3ZMS A;  5FFX A;  2MD5 A;  2HEO A;  2VE9 A;  2FNP A;  2PN6 A;  2DPD A;  5CJ9 A;  4MTE A;  3MWM A;  3F21 A;  1R1T A;  3WE2 A;  5CVV A;  3G73 A;  4O6J A;  4HOB A;  2YU3 A;  3N97 A;  4KNY A;  1QBJ A;  1NHA A;  3PFI A;  1P92 A;  2EWN A;  3KP4 A;  3RYR A;  3ULQ B;  1GHC A;  5JR3 A;  3IC7 A;  2IJL A;  2IPQ X;  1OYW A;  4G7O F;  2IVM A;  2OD5 A;  2QZ8 A;  5HLG A;  1LEA A;  4L9N A;  3AAF A;  4HBL A;  5ERI A;  2QQB A;  1B4A A;  1TW3 A;  3K69 A;  3M8F A;  3IRR A;  4BNC A;  4UVA A;  3DQV C;  4UVC A;  3L9F A;  4U7D A;  1MJB A;  2P5K A;  3FXU A;  2HZT A;  3BWG A;  1J0R A;  3MQ0 A;  1SD5 A;  4B09 A;  3ZP5 A;  1DUX C;  2DW4 A;  2QBY B;  4P55 A;  3IL2 A;  4G7H F;  1G3Y A;  4CXF A;  3CDH A;  5CVJ A;  3WU1 B;  2A61 A;  1KQ9 A;  1TW2 A;  3K1M A;  3ROU A;  2OAZ A;  3EDP A;  1IN4 A;  4MTD A;  4FT8 A;  3W6K B;  2GXG A;  2P6S A;  5L3C A;  3E5Q A;  2VON A;  4IHT A;  4KUM A;  5D4S A;  4BAY A;  1FBQ A;  4I01 A;  2L4M A;  3NRV A;  4ZZL A;  5FO5 A;  1F9N A;  1MZB A;  2ZO4 A;  3QP5 A;  3CUO A;  1DP7 P;  4RB0 A;  3E6B A;  2HR3 A;  2P5V A;  3DP7 A;  1T2K A;  1H9T A;  1QPM A;  2DT5 A;  1K79 A;  4LB6 B;  3ZPL A;  3WTX C;  2DPU A;  5E18 F;  3HRS A;  5BQT A;  2XKO A;  2GA2 A;  5DUI A;  1MJ9 A;  4HW0 A;  1F5T A;  2GIV A;  3ABU A;  4G6D A;  1MDM B;  4Q5S F;  1U8R A;  3JW4 A;  4ENK A;  4XLN F;  3E6D A;  2P5L C;  4MGR A;  3KZY A;  1P4W A;  2RV8 A;  1FPQ A;  4HAM A;  1UB9 A;  2DQR A;  3FZV A;  1EV7 A;  3KFW X;  5H6R A;  4RB1 A;  3KP5 A;  1B9M A;  1Y0U A;  3ZMT A;  1EH8 A;  2Z99 A;  4A0Y A;  1USS A;  3TO9 A;  2Z33 A;  4WK8 F;  3M1E A;  2KIU A;  3DXJ F;  3I58 A;  1O7L A;  1T38 A;  1Q1H A;  1UFM A;  3GYH X;  2YR2 A;  1XD7 A;  4NB5 A;  1ZRE A;  1O57 A;  1R5H A;  4ZYH A;  1OYI A;  2FU4 A;  4P9U A;  2QM3 A;  4LGW A;  4RGU A;  2XAG A;  2PBI A;  3HYI A;  1MJA A;  1K6O A;  2E7W A;  5LGN A;  2H6B A;  4WX9 A;  3SXY A;  1W7P A;  4EM0 B;  5LLQ A;  3HSR A;  1IXR C;  4ZYD A;  5ILV A;  3QU3 A;  4BYY A;  1BN5 A;  5D5U B;  1SFU A;  1FBU A;  4EMS A;  3TOB A;  2W24 A;  3C1D A;  2A07 F;  1Z6T A;  4OIQ F;  4Z2Y A;  2VBX A;  4BXU A;  3CUQ B;  1BM9 A;  1JE8 A;  2OZU A;  2KJB A;  5EEH A;  3O2P E;  4L9V A;  4MQ9 F;  5ICG A;  3FF5 A;  2YPR A;  3U9G A;  5FB2 A;  4G8X A;  4YIF A;  2PLY A;  4WWC A;  5IT9 K;  1SMT A;  2XAS A;  3I4P A;  2IW5 A;  1ON1 A;  3K0L A;  4O3M A;  2V79 A;  3IWZ A;  3P9K A;  1H9G A;  1O3Q A;  3DPL C;  3ISP A;  3NEU A;  4YG2 F;  3N4M A;  1TTY A;  1XSD A;  3C18 A;  3V8L A;  2JSC A;  2ACJ A;  2KIF A;  4HV5 A;  3GFJ A;  3KE2 A;  1SD4 A;  2MBF A;  2G7H A;  3WTT C;  2E7X A;  2IP2 A;  2K7L A;  2EK5 A;  5HLI A;  4M71 A;  3RDI A;  2A6H F;  2O6G E;  3HHH A;  2Y48 A;  1HQC A;  4QWQ A;  1WQ2 A;  4LLG F;  4HDV A;  3GW2 A;  2FF4 A;  3ZMZ A;  3RJP A;  1B1B A;  3KEO A;  2OQG A;  3GXO A;  1D3Y A;  3SZP A;  4HF2 A;  4HF1 A;  4R8H A;  4HDU A;  2Q2E A;  2XAH A;  4OMZ A;  4CHU A;  4I98 B;  3IRQ A;  2YX7 A;  1ZG5 A;  1P4X A;  4UNO A;  5D6E A;  1PUE E;  2M87 A;  1KYW A;  2QWW A;  4EM2 A;  5BOX A;  3DKW A;  1BI2 A;  5JHU A;  2XGX A;  5CYV A;  2HTS A;  2EFP A;  2G7U A;  5CLS A;  1IN7 A;  2A3S A;  2RC4 A;  4G6Q A;  5BS6 A;  5AIQ A;  3FXR A;  3G3Z A;  1LEB A;  2QUF A;  1BI3 A;  4L18 B;  4HX8 A;  3F6O A;  4IJA A;  5EEG A;  3J80 Z;  5FLX K;  3LQQ A;  2VOO A;  4ASN A;  4WXC A;  5D8K B;  3HSE A;  4UVB A;  3F72 A;  4A5M A;  2DU9 A;  2XRO A;  4AIK A;  3KLO A;  1U6G A;  1HBX G;  1TLH B;  1O3T A;  1TQI A;  2DFI A;  3GWZ A;  5ICF A;  2YSR A;  3ZMV A;  1WKM A;  1YG2 A;  2A5Y B;  2QEN A;  3V7C A;  2Z9O A;  1A04 A;  4L9J A;  5JVT A;  3VOD A;  1KU2 A;  1REP C;  1QZZ A;  3SZT A;  1Z1D A;  4EJO A;  1HKQ A;  2VT3 A;  2PI0 A;  3E5X A;  3HRT A;  1B6A A;  5FD5 A;  2XVC A;  1LVA A;  3T8R A;  1XCB A;  3W6J B;  1SFE A;  2PEX A;  3DV8 A;  3HOT A;  3JAM Z;  4CIC A;  3LA2 A;  2CWE A;  4M72 A;  3FMS A;  5HDG A;  2YX4 A;  1UCR A;  1ZRC A;  4WXD A;  2HWV A;  1SD7 A;  4UUV A;  3RPQ A;  3FMR A;  2EFQ A;  3TOA A;  4IRG A;  2KKO A;  2P7C B;  3BY6 A;  1I27 A;  5F64 A;  3FWE A;  4MQV A;  2VC1 A;  2JZY A;  4G9Y A;  1MD0 A;  2GWR A;  3IKT A;  2O03 A;  4UV9 A;  3F8N A;  1MKM A;  4ZZD A;  2DK5 A;  5TRD A;  2LKP A;  3KP3 A;  3F6V A;  4Q4Z F;  3GX4 X;  3RTR A;  2CQK A;  2UZK A;  1JHH A;  2E1N A;  2OA4 A;  2D1V A;  2GAU A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...