4IRGA

Uninhibited dna-binding domain of the ets transcription factor erg
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
98
structure length
98
Chain Sequence
IQRPGSGQIQLWQFLLELLSDSSNSSCITWEGTNGEFKMTDPDEVARRWGERKSKPNMNYDKLSRALRYYYDKNIMTKVHGKRYAYKFDFHGIAQALQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Dna binding protein
molecule keywords Transcriptional regulator ERG
publication title Structural and dynamic studies of the transcription factor ERG reveal DNA binding is allosterically autoinhibited.
pubmed doi rcsb
source organism Homo sapiens
total genus 33
structure length 98
sequence length 98
ec nomenclature
pdb deposition date 2013-01-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00178 Ets Ets-domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 4irgA00
1SD4A 1GXQA 4I2OA 3M1EA 3M8FA 4KUMA 2XKOA 3OOPA 4KNYA 2M8EA 3K1MA 4R79A 1IUYA 2E7WA 2COMA 3P7NA 3JW4A 1UB9A 1T38A 1MZBA 5LEJA 1MJAA 2XGXA 5E17F 2FSWA 3R0JA 4LJZF 3GZ5A 1B6AA 3TO9A 5JHUA 2P6SA 4I01A 2IW5A 3R6SA 4YIIA 3FM5A 3JAMZ 3GZ6A 4G7ZF 3F6OA 1C0WA 2LSOA 2ACJA 2OD5A 2ESNA 2HYFA 5DD4A 1BI2A 1H0MA 2LF7A 3JTHA 2KIFA 4HLXA 4RGUA 4RB0A 4HQMA 4HZFA 4ZH4F 1B1BA 3VOEA 1UFMA 2O3FA 2ZNYA 3HRUA 3I5UA 5K5OA 3IL2A 2GXBA 2ZCWA 1XB4A 2KJBA 5FFZA 5CYVA 3F3XA 5DCMA 1YW8A 3GYHX 1KQ9A 2GXGA 2Q2EA 1JHHA 5FD5A 1BJAA 4ESFA 2QM3A 4AD9A 2HQRA 4FX4A 3M7GA 4U7BA 1GHCA 1O3TA 2RDPA 1JXSA 2RKHA 1T0FA 4ZYGA 4GYIA 2XRNA 4LGWA 4XSZF 3IWFA 4YG2F 4G7HF 4ENKA 1IRFA 2ELHA 2JPCA 3I0TA 2V9VA 1DPUA 3HSRA 5D6EA 2L4AA 2LKPA 2FE3A 3G3ZA 3P9IA 4E70A 2IP2A 1FP2A 1QZYA 2FMYA 4WWCA 1MD0A 1XMKA 3FMRA 4PGHA 1LDKB 1HW5A 4HF1A 1XSDA 2HQNA 2EFOA 1U5TA 2XKPA 2A61A 3KETA 1ZLJA 4FX0A 5H20A 1U2WA 1TQPA 2J5PA 2IVMA 2GZWA 4ESBA 1BOAA 4IRGA 4BHCA 3DV8A 2D1VA 3H92A 3SFZA 3T5XA 3TDZC 3K0LA 4LK1F 4KIFA 5JFRA 1LDDA 2CO5A 2MC3A 5E1XA 2Z3YA 3NRVA 4UXNA 2V1XA 2HYGD 2JZYA 2Z9OA 1XCBA 1MJBA 1O3SA 4EM1A 1QBJA 3EUHA 3L00A 2DQLA 1B4AA 1FBUA 2ESHA 2O8XA 3SZPA 5D8LB 5F64A 4Q48A 1IN6A 3FXQA 1E17A 1JE8A 2Z5UA 3Q9VA 3U9GA 3FWEA 3F8NA 3WGIA 2XROA 1EH6A 5BOXA 2OA4A 2HOEA 2A07F 4PGGA 1LVAA 3BROA 2BEOA 3V4GA 4AVPA 4AIKA 3RYRA 1K78B 3WU0A 3KP3A 2EA4A 2PJPA 3KP4A 4Y17A 1G3WA 2L54A 2GAUA 4BNCA 3QU6A 3C3WA 1P92A 4P55A 5L3FA 1DUXC 4WXDA 2R3SA 1ZHFA 2V79A 4Y15A 4KN4X 4IPAA 3V8JA 1J59A 1R5HA 1P2FA 2EFPA 1S7AA 1TQMA 4ZYDA 2Q0OA 2A69F 2OZUA 4UNOA 4HDVA 1SD5A 2HZTA 3BPVA 2DO7A 1L0OC 2W84A 3HOTA 4OOIA 3I58A 4A2UA 1MGTA 3ABUA 1HSJA 4O5VA 1F1ZA 1AOYA 2H6CA 4KIGA 1FZPB 3F8BA 4IJAA 5H6RA 5H6QA 5KVRA 3Q9SA 3O2PE 5AIPA 3L2CA 5HDKA 4HBLA 3F8MA 3IWZA 4A0XA 1I27A 1SMYF 3B02A 5J8CA 1I5ZA 1QPMA 4EGYA 5IT9K 4TV7A 5ILUA 2OQRA 1G6NA 4L9NA 3WE2A 3KP7A 4GYGA 3TQNA 2EK5A 1BBYA 3MEXA 1XGNA 2FXAA 5FLXK 2ISZA 1XMAA 3QP6A 2YU3A 1EH8A 1IW7F 4U7DA 3N4MA 5CVUA 1OKRA 5D5VB 3K69A 2DAOA 2RVCA 1QGPA 4IVNA 4IHSA 2CG4A 1O3QA 2A6HF 3J81K 3DEUA 2FRHA 2KRFA 4CDGA 1NHAA 2W57A 4OU0A 3GO5A 1D8JA 3R0AA 4OIRF 1Z7UA 3HRMA 4L18B 1B59A 4WK8F 1B9MA 4MQVA 2E7XA 3I4PA 3NEUA 2G7UA 2FBKA 3SHFA 2ZJ2A 4M6YA 1KA8A 4JBAA 4N9HA 2VONA 3PFIA 3K1PA 4G7OF 2XIGA 1KGSA 1YS6A 2RC4A 3WGGA 1ZGJA 1YW7A 3ZN0A 1FWZA 5E18F 2FA5A 2K4BA 4YFXF 3KZZA 2MH2A 1SFXA 3ZMSA 4L9TA 5HS9A 2UZKA 2QQ9A 2RN7A 5TJJA 5A2QK 3FMSA 3GLXA 2Q8KA 3TKYA 1R36A 2QZ8A 3BY6A 2XVCA 2NYXA 2DW4A 5HOOA 5IT9Z 3JSPA 4KMUX 3R4KA 2V1DA 1YS7A 4BAYA 2DBBA 4HDUA 4FHTA 1J2XA 3IHUA 4NB5A 4R1HA 3BP8A 3ZMZA 4PDKA 1FYKA 2EA2A 2PLYA 3CO6C 3E97A 5FLXZ 2Z99A 4ENJA 3QPTA 4P5OA 2ZO4A 5AIQA 2K27A 2P6TA 1P6RA 3DF8A 4UVBA 3GEZA 1S29A 3J7AO 1PUEE 1RUOA 4CXFA 3IKVA 3WTWC 3J81Z 2VBXA 1USTA 1U5TC 5HS8A 3P9KA 5EEHA 5DYMA 2DK8A 4U0VA 5HVQC 3VFZA 3J80K 1IZ1A 1HSTA 2AS5F 2Y48A 4CGZA 2GA2A 4Z2YA 1J75A 1X3UA 5ICFA 2VOOA 1FBQA 2VN2A 5D6FA 2HDCA 3FZVA 1XGSA 5DUIA 2FQ3A 1FLIA 1DDNA 2MA3A 3KP2A 3SZTA 3T8RA 2JTVA 3E5QA 1KU7A 1H9TA 4LK0F 1J9IA 1TW2A 5BQTA 4B09A 1FY7A 2L4MA 5FD6A 4ON0A 1KU3A 4RB1A 4L0ZB 2YR2A 2MBFA 4I98B 2DTRA 5A2QZ 2HTJA 2ZKZA 5BS6A 1ZG5A 4ZZLA 1ZAOA 2NRAC 2FOKA 1STZA 2XAQA 2PG4A 1XSVA 2R7DA 1R1UA 4XBFA 3HRTA 3IRQA 1IXRC 2E1NA 3KLNA 3ECHA 1YYVA 2B0LA 1FOKA 1ZREA 4M74A 2MD5A 5LHHA 3HYIA 2DQRA 4LLGF 5JR3A 4CYDA 3QRFF 2QQAA 1JHFA 3TOBA 1RI7A 3ISPA 4IXAA 3KEOA 3LFKA 1U6GA 4L9JA 2Z33A 2EFQA 2YSRA 2H09A 5CVRA 3RJPA 3J80Z 4GGGA 3WU1B 4HV5A 2ISYA 5D4RA 4CICA 3CUQB 3T0YA 1YG2A 1UHMA 1AWCA 1IF1A 5ICEA 2G7HA 4ESJA 4Q47A 4RB2C 1J7KA 5D5WB 3LAPA 2PFBA 4O3MA 3V8KA 5E1WA 3HIFA 4EGZA 2P5VA 4ZYHA 5CLSA 3I59A 3QOPA 1YFHA 4D0PA 5D5UB 3GX4X 5L3EA 1WI9A 1BI3A 3KFWX 5HDGA 2X4HA 1BIAA 4B8XA 5LRRA 2O61A 1LJ9A 4AIJA 2PN6A 2A6EF 2DI3A 1Z05A 2VXZA 4U0WA 1O7FA 2HTSA 3WTSC 3BZ6A 2HWVA 5K1YA 5DV5A 3ZP5A 4CZZA 3BPXA 3I59B 5ILSA 3L9FA 1KYZA 2HGCA 1R00A 4ZYEA 3DXJF 4EVIA 1RUNA 3CLOA 4I09A 4EJWA 4A0ZA 1TW3A 1R1TA 3BOQA 1IAWA 5ILVA 1R7JA 6PAXA 1T6SA 1IN4A 2M87A 4LG0B 5J6XA 3ZQ7A 2QUFA 2QENA 3BJAA 1BN5A 3LA7A 4M73A 2AXLA 4GCVA 1F4KA 3E3VA 2F5EA 5LGNA 1ZRFA 5BMZA 2BYVE 1MKMA 1K78A 2J5OA 1W7PD 1SD7A 2CYYA 3TO7A 2PMHA 4ASNA 2VE8A 3O3KA 3WODF 1WKMA 1WQ2A 3EETA 2RQPA 1PP7U 2Y75A 1OPCA 5L3CA 1KQ8A 1D5VA 1V3FA 3TGNA 1UCRA 5JI6A 2P5KA 4AWXB 3HUGA 3ZN1A 5FGMA 4LD5A 3K1NA 1FSHA 3F21A 1K79A 3HTSB 2NNYA 2LF8A 1USSA 2D45A 1HBXG 3MFKA 2GQQA 3ZMUA 1U3EM 4FT8A 2FBHA 4EMSA 3C18A 1Z6RA 3S2WA 4EQQA 2XAGA 1L3LA 1IRGA 2GA1A 2BBYA 4OIPF 1ZN2A 3E5XA 5K5RA 1O7LA 3M9AA 5CVJA 4BQAA 5DDGA 2M1BA 4EM0B 5EEGA 3DPLC 3FMQA 5DEQA 2YX7A 1T39A 5CJ9A 2TDXA 3GFIA 3GVAA 4HA8A 3IKTA 3FF5A 2W25A 1TBXA 3M8EA 2P7CB 1MDMB 4UV8A 4EJUA 2STTA 1QQIA 2XV4S 3R60A 4MNUA 3LWFA 2UXXA 4LB5A 1WRJA 1TTYA 3WGHA 3AAFA 4M6XA 4IRIA 3FXRA 3WG9A 3W6KB 2P7VB 3L7WA 2ZMEB 3MAJA 3V7SA 3T1BA 1YTYA 2VBZA 2NAZA 4BXUA 1B9NA 2VT2A 2XASA 1W7PB 1Z9CA 3ZMTA 3GFLA 3REOA 3GUDA 1RNLA 1IXSB 3KE2A 4HOBA 1A04A 3HSEA 2RV8A 2DLLA 1LQ1A 1ULYA 5LHGA 3NQOA 2NS0A 4P96A 2DK5A 3CTAA 1XN7A 4L5JA 4M71A 1R1VA 2L3DA 3V7RA 5E8GA 5LHIA 3I54A 3F6VA 3GFJA 1OMIA 3KP6A 4BHPA 4H0EA 2ZBKA 3WTZA 1EH7A 4WF2A 2EB7A 2OQGA 1FP1D 3DFGA 2HEOA 5E1ZB 4HV6A 3BJOA 3WTVC 1MJ9A 5L3DA 3V8LA 5HLHA 2H94A 2VT3A 3GXOA 3E6DA 1P4WA 3QAHA 4Q4ZF 1ZARA 2ZNZA 2QVOA 1ZG3A 3MQ0A 1W5SA 2CQKA 4MTDA 4IF4A 3RYPA 4K2EA 1FYLA 4R8HA 1WSUA 2D2WA 1ODDA 2UXNA 3HOSA 5LRSA 1G3SA 3EYYA 2O0YA 2OAZA 1W5TA 5CVIA 2P4WA 5TRDA 2EFWA 2CFXA 3HRSA 2FU4A 1F5TA 2XAFA 3U1DA 5LEKA 4N0BA 5ICCA 4DQ2A 3OV8A 1KU9A 3ROUA 3FXUA 1J5YA 2FEZA 3TO6A 2JSCA 5AONA 2PQ8A 1J0RA 1LNWA 4HQEA 4GXOA 3TOAA 4P9UA 4N9IA 1YW9A 5KK1A 3ML6A 1GVJA 1HXDA 3I64A 3QP5A 3QU3A 1E2XA 1IN8A 4EJOA 2KKOA 1Z6TA 3E6BA 4WXHA 4KT5C 2LDUA 4RGSA 1HKTA 2ETHA 2KIUA 3W6JB 4A5MA 2BGCA 3KCCA 1R5GA 4U0YA 3GFMA 1CF7B 2EJRA 1FT9A 4JK1X 2XUBA 1G4DA 2IA2A 4HF0A 3KLOA 1FSEA 1HW1A 5K5QA 2M30A 2O03A 2XAJA 1YLFA 1Y0UA 3TDUC 4KFCA 1XCVA 1I1GA 2CGPA 2M5WA 4L5IA 2QWWA 1OYIA 2KJCA 3CJNA 2OBPA 1TNSA 2FNAA 3HHHA 4ENMA 3RI4A 1REPC 1LEAA 3JTGA 2JPBA 3LSTA 2Y0MA 1H9GA 2E1CA 2F2EA 1ONVA 4A12A 5ERIA 2XHKA 2HR3A 2EFNA 2PEXA 4LFUA 4ETSA 3F72A 1IXCA 2A68F 4P9FA 2RNJA 4M9XA 1TQIA 2P5LC 3JSOA 1K7AA 2W85A 1R58A 3WE3A 4M9ZA 4NQWA 2F5CA 3H3ZA 1HKSA 3IRRA 1XD7A 1XDUA 2CSOA 2QBYB 2MLGA 4GO1A 4RS8A 2K7LA 2ZFWA 3COAC 1FX7A 3CUQA 2VOPA 4HX8A 3BWGA 2GIVA 3N97A 3DKWA 4MEYF 3FHZA 2IRFG 3WTYC 4A6EA 3QPHA 5E20A 1KU2A 4YFKF 4Q5SF 5LGTA 4RAYA 3DP7A 4NHJA 2EV6A 3F8FA 3E5UA 2OU2A 3SXYA 3EDPA 1I1SA 3F8CA 2DU9A 5D5XB 1QO0D 2JT1A 1ZRDA 3C7JA 5HS7A 3HSFA 4UVAA 1VTNC 1Q1HA 1T2KA 3B73A 3LQQA 1S8NA 3RTRA 2K4JA 1G3YA 4YFNF 4KICA 2H27A 2K02A 1JGSA 3RPUA 1OYYA 2FNPA 4LG0A 2MH9A 2LNBA 2M45A 4BHBA 4G9YA 3MZHA 1DP7P 2R7FA 4LLNA 1PP8F 1P4XA 5F6FA 5D4SA 2FF4A 4PCQA 3EQLF 1I6XA 2X0LA 4KIBA 1YQAA 3P9CA 4O6JA 3MZYA 3ZMDA 1HKQA 1FPQA 1UHWA 1ON2A 2D1HA 1ZRCA 2VBYA 2BE5F 1XGMA 4ZZDA 3BDDA 4YIFA 3LQRA 2HS5A 2ZXJA 5DCMB 1ZH5A 1FBSA 1YIOA 2F5DA 3CO7C 2FMLA 1CGPA 4Y13A 3CUOA 5L3BA 3VODA 1W4MA 2DT5A 4HLYA 1XGOA 1RZ4A 1O3RA 4HF2A 2QYOA 4ENNA 2NNNA 4UV9A 1PDNC 2V1UA 2GWRA 1G3TA 5FFXA 2CW0F 4RGRA 3SQNA 3ERED 2EV0A 5LGUA 3Q5FA 2VC0A 4WXCA 2WV0A 1U78A 1U5TB 4RB3C 2DPDA 4BYYA 4CHUA 1Z91A 3LA2A 2UWMA 1KQ0A 4S05A 4M72A 1TLHB 3I71A 4KYWA 3RKWA 4MEXF 3GW2A 3RKYA 1SD6A 3KEQA 2PBIA 2DPUA 3RIRA 1MDMA 1ZLKA 5HLIA 4HX7A 3E6CC 4IRHA 3RPQA 3HTUA 4XLPF 4HYEA 2ZMEA 3H3UA 2FBIA 2IJLA 4LLLA 2ADUA 1QZZA 4A5NA 2XAHA 1W7PA 2YX4A 3VB2A 2K86A 3RDIA 3D5LA 1LDJA 1V4RA 1FNNA 4DNCA 1OR7A 3KZYA 4OMZA 1SAXA 2HKOA 5E8IA 4U88A 3WTTC 1ZYRF 3HHGA 3E6MA 4I02A 4G6QA 2QLZA 1BI0A 3GF2A 5CVVA 2A5YB 4BH9A 4WCGA 3G73A 2RGVA 3T8TA 4XLNF 3RKXA 4CO8A 1TNTA 3PQJA 5J8FA 2F5FA 4OIOF 1D3YA 1Z1DA 2P8TA 2G9WA 5BPDA 4UHTA 4HAMA 1RIOH 4XRFA 5L3GA 1ZG1A 3K9TA 5FO5A 5ED4A 4RGXA 1XDSA 3D0SA 2WWYA 3CUQC 4HW0A 5IT3A 2O6GE 3FM3A 3O6BB 1SFUA 2IA0A 4I7HA 3DQVC 4EV0A 3ZMVA 2YPRA 1P4AA 4EM2A 1ZGAA 2HKXA 1U8RA 1HQCA 5D8KB 3ULQB 2STWA 2WC2A 3VEPA 4KA4A 1BIBA 5HLGA 4OIQF 1XSXA 2C6YA 4KN7X 1D8KA 5LBQA 2IA1A 3F22A 4MTEA 1O57A 4I0BA 3V7CA 4IHTA 4LMYA 1T98A 3WTUC 1R23A 4PZJA 2CWEA 3ECOA 4QWQA 2L01A 4L9VA 1LB2A 4KDPA 4UVCA 4S04A 1BI1A 4MQ9F 2JRTA 1BM9A 4I0AA 4EJTA 3IC7A 4G6DA 4WX9A 1IN7A 1S3JA 4JQFA 1R22A 3C1DA 3BJ6A 2EV5A 5DCFA 2H6BA 3U2RA 1IN5A 5ICGA 4G94A 3K2ZA 3KP5A 1F9NA 4XSXF 1SMTA 2VC1A 3LAJA 1CF7A 1KYWA 4A0YA 4HX4A 4AIHA 2IT0A 4UUVA 3I53A 4OMYA 2HFHA 3ELKA 2QQBA 1K6OA 2VE9A 1EV7A 3JAMK 1DPRA 1HW2A 1FC3A 2W24A 1BC8C 2MLKA 2VODA 4F7ZA 3R61A 2KIMA 3DPTA 5FB2A 1SFEA 2VBWA 2IPQX 2WTEA 4EJVA 1YO5C 4MHGA 4KMFA 3MCZA 3GWZA 4L0YB 3WTXC 1QNTA 1GXPA 1FYMA 5JVTA 4MGRA 4G8XA 1S7OA 5DUKA 5DD8A 2PMUA 2EWNA 2DFIA 3EYIA 1WWXA 5LLQA 1OYWA 1S6LA 3MWMA 4M9SA 2QBYA 3LA3A 3PQKA 2A3SA 2OZ6A 2L02A 4QLCU 1LEBA 2BV6A 3CDHA 4A6DA 3F23A 2V6CA 3ZPLA 4RAZA 5BPIA 3FX3A 5HDNA 4OINF 3ABTA 3L09A 4LB6B 2PI0A 1ON1A 5F1RA 1BC7C
chains in the Genus database with same CATH superfamily
1SD4A 1GXQA 2WAQA 2ZXWH 1ENHA 4I2OA 1TWCJ 3M1EA 3GZNB 3LSHA 3K70D 2ME0A 2DA7A 3M8FA 4KUMA 2R7OA 2XKOA 3OOPA 2KT0A 2NVQJ 4KNYA 2M8EA 3K1MA 4R79A 4IKFA 2E7WA 1IUYA 4UB8C 2COMA 4HPQA 2KRCA 4BU2A 3GTGJ 3Q0UA 3CZ6A 3P7NA 3JW4A 1UB9A 1T38A 1MZBA 5LEJA 1O4XA 5EJCA 4DBRA 1X19A 1MJAA 2XGXA 2RREA 5E3LA 5E17F 2FSWA 3R0JA 4LJZF 3GZ5A 4ZDPA 2ZMEC 1VFCA 1LE8A 1B6AA 1W0TA 3M8JA 3TP3A 3TO9A 1QVTA 5JHUA 2P6SA 4I01A 2IW5A 3R6SA 4CYCA 3ASNH 4XMYA 4YIIA 3FM5A 3JAMZ 3GZ6A 4G7ZF 3F6OA 2VKVA 4J00A 2LY2A 2WY7Q 3MZ8A 2F4MB 1C0WA 2Q1ZB 3FKJA 2LSOA 2ACJA 1WJAA 2OD5A 1Y1WJ 1FMVA 2ESNA 5FKOA 4ZJZA 4BQOA 2HYFA 5DD4A 5IP9J 1BI2A 1H0MA 2LF7A 2Y0SA 2F4IA 3JTHA 2KIFA 4HLXA 1N75A 4FETA 5GAGJ 4RGUA 3ERMA 4RB0A 4HQMA 4HZFA 4ZH4F 1B1BA 3BR1A 3VOEA 1UFMA 2O3FA 4XRMA 3RCOA 2ZNYA 3HRUA 3I5UA 3ZQGA 5K5OA 3IL2A 5GP9A 5GADJ 2KHMA 2ZSIB 5J4VA 1HA8A 4N4NB 4JOMA 3G4SI 2GXBA 2ZCWA 2ELKA 2Y9YA 1ZR4A 2V4JC 1IV6A 1XB4A 3JRIA 1FOYA 2HOSA 2KJBA 2W48A 1PYVA 5FFZA 3ZOBA 5CYVA 3F3XA 3CCQI 1EF4A 2W7NA 3OYLA 5DCMA 1YW8A 3VYRB 1D5YA 5CPRB 1AKHA 3GYHX 1KQ9A 2GXGA 2Q2EA 2QEXI 5EGOB 3C2HA 4PJ0C 1JHHA 3ZGKA 5FD5A 1BJAA 4ESFA 2QM3A 2GIZA 4AD9A 3OYEA 2H1LA 2HQRA 3VPRA 2KFDA 4FX4A 3M7GA 1K6YA 4JX6A 4U7BA 1GHCA 3HZJA 4XLAA 2O7OA 1O3TA 2O5RA 4E4HA 2RDPA 1IV8A 1JXSA 2RKHA 1AHDP 1T0FA 4ZYGA 4GYIA 2XRNA 3OY9A 1RC9A 4J01A 3QWLA 4LGWA 4BACA 4XSZF 2IEKA 2WB1N 2PX9A 3FK6A 3IWFA 3BG9A 2KLOA 5FRMA 4YG2F 2E1MC 4G7HF 4ENKA 1IRFA 2ELHA 3FXKA 2JPCA 2JN6A 4E7JA 1TC3C 3I0TA 2V9VA 3LSGA 3OYHA 1DPUA 3HSRA 5D6EA 2L4AA 4IL6C 2VPLA 2LKPA 2FE3A 2KL4A 4BKXA 3G3ZA 3P9IA 1LPQA 2VPRA 1OCRH 4E70A 2EBIA 4PSWA 2JA6J 3MKLA 1R4NB 2IP2A 1FP2A 1QZYA 2FMYA 3QYBA 4WWCA 1MD0A 1XMKA 3FMRA 2DFHA 4PGHA 1LDKB 1HW5A 5C3EJ 4HF1A 1XSDA 2HQNA 1YRNA 1A5JA 1IDZA 2EFOA 4X0GA 4BJ5C 1JT6A 3CDLA 2CQQA 1YE9A 1U5TA 2XKPA 3DTKA 1P7JA 2A61A 3K4JA 3KETA 2Z1DA 1ZLJA 3S1RJ 4FX0A 2MW8A 4ZTJA 4M3BA 1MIJA 5H20A 1U2WA 2LH9A 1OCTC 1TQPA 2D5VA 3C2GA 2UUZA 4D5CA 5JLXA 3O8GA 2R7VA 2J5PA 2HOAA 2IVMA 2MYSA 2GZWA 4A3FJ 3ZRGA 4ESBA 3QYFA 1BOAA 4IRGA 4BHCA 3TW6A 3DV8A 2D1VA 4YIRX 3H92A 3BLYA 3SFZA 3T5XA 3TDZC 3K0LA 4LK1F 4KIFA 5JFRA 1LDDA 2CO5A 5K7HA 2K3PA 2MC3A 2DOAA 5E1XA 5FJ8J 3HKZN 1XC5A 1SFKA 2Z3YA 3NRVA 4UXNA 2V1XA 2HYGD 3QQAA 3G1MA 2JZYA 2Z9OA 2R7ZJ 1YRNB 3CC2I 1XCBA 1MJBA 5FLVA 1O3SA 1R4MB 2CV0A 4EM1A 1QBJA 2L9RA 3EUHA 3L00A 2DQLA 1B4AA 3DCFA 1FBUA 2ESHA 2JSPA 3DEWA 1HOMA 4PJMA 2O8XA 3JRHA 3SZPA 2VB6A 5D8LB 5F64A 4Q48A 4RAFA 1IN6A 3FXQA 1E17A 4BEHB 2JVHA 2Z5UA 3Q9VA 1JE8A 3U9GA 3GTPJ 2NVUB 3FWEA 3F8NA 5EG0B 3WGIA 2XROA 5HNHA 1EH6A 5BOXA 2OA4A 2HOEA 2A07F 2X1DA 1R9TJ 4PGGA 1LVAA 1MNEA 3BROA 3VYTB 5EEAA 1NK2P 2BEOA 3V4GA 4AVPA 4AIKA 3RYRA 1K78B 3WU0A 3KP3A 2EA4A 3LSJA 2P81A 3ABLH 2PJPA 2FX0A 3KP4A 4Y17A 3CCRI 3KYDB 1G3WA 2L54A 2GAUA 4BNCA 1H88C 3PNTA 3BG7A 4M3EA 3QU6A 4Y4RA 3C3WA 3A02A 1P92A 4P55A 5L3FA 1DUXC 4WXDA 4UUSA 5B3SH 2R3SA 2LRDA 1ZHFA 2L2OA 5IP6A 1JGGA 2OUMA 2V79A 4Y15A 3BR2A 4KN4X 1XPXA 4IPAA 2JWTA 4H4KC 1OCPA 1Z3YA 3V8JA 4C2MJ 1J59A 1R5HA 1P2FA 5FKMA 2LMDA 2EFPA 4XOPA 1S7AA 1TQMA 4ZYDA 1OCZH 2Q0OA 3JCUC 1IGNA 2A69F 3S93A 2YUSA 3HUGB 2DYSH 4CZCA 2DTZA 2OZUA 2IGKA 4UNOA 4HDVA 3MD2A 1JKQC 1SD5A 2E1OA 2HZTA 2MFZA 2DO7A 3BPVA 5CQEA 3JRAA 3DU6A 1YJNI 1L0OC 1IG7A 4IHYA 4LITA 3BZKA 4UB6C 2W84A 3HOTA 5B5EC 2BY3A 4OOIA 2DDBA 3I58A 2XB0X 4A2UA 3DEEA 3PO2J 1MGTA 2H8RA 5F27A 1Y8QB 5GPCA 3ABUA 4EEFG 4A3EJ 1HSJA 4O5VA 1F1ZA 2VIXA 1AOYA 2X1EA 2H6CA 1N77A 4KIGA 4A3CJ 2E71A 1FZPB 3F8BA 4IJAA 5H6RA 3CC4I 2JA7J 3FXMA 5H6QA 5KVRA 1TWHJ 3Q9SA 3O2PE 5AIPA 2XAUA 3L2CA 5HDKA 2M9HA 4HBLA 4E7SA 3F8MA 3IWZA 4A0XA 4RLFA 1I27A 1E0EA 1SMYF 2LP0A 2IGMA 2GBYA 3B02A 5J8CA 1I5ZA 1QPMA 4EGYA 2DA4A 5IT9K 4TV7A 3VSLA 5FRNA 5ILUA 2OQRA 2OCCH 1G6NA 1Y39A 4L9NA 1QVUA 4C2TA 3SDGA 4ZTFA 3WE2A 3KP7A 4GYGA 3W2VA 2DJIA 1A31A 2BXZA 3TQNA 2EK5A 1OFCX 3ZQQA 3CCJI 1BBYA 3MEXA 1XGNA 2FXAA 4XNFA 5FLXK 2ISZA 1XMAA 1A35A 3QP6A 2YU3A 1EH8A 1UG0A 1IC8A 1IW7F 4U7DA 3CMYA 2XSJC 4DYCA 3N4MA 5CVUA 1OKRA 5B1BH 2PJRB 5H2FC 2XRLA 3K69A 3K10A 5D5VB 2DAOA 1N25A 2RVCA 1G8XA 1QGPA 4IVNA 4IHSA 2LFBA 2CG4A 2CRGA 3CCUI 3IP4B 1DU0A 1O3QA 4S0HB 2A6HF 2ID3A 3J81K 4A3DJ 3DEUA 2FRHA 1MNMC 2KRFA 4ITVA 1X4OA 4CDGA 1NHAA 2W57A 4OU0A 3CCMI 3GO5A 3SYTA 3G1LA 2DA3A 3PUFA 1D8JA 3R0AA 2LLKA 2M0CA 4OIRF 1Z7UA 2WAEA 2NS8A 3LFUA 3HRMA 4L18B 1B59A 3G6EI 2JA2A 4J19A 4WK8F 1B9MA 4MQVA 2E7XA 2VQLA 1SVOA 2XGCA 3I4PA 3NEUA 4BDZA 2G7UA 4C30A 2FBKA 3OWTA 2ZJ2A 4M6YA 3SHFA 1KA8A 1HDPA 3ZXSA 2JJ7A 4JBAA 4N9HA 3CCLI 1YITI 1PUFA 2VONA 3PFIA 3K1PA 4G7OF 2XIGA 2RAEA 1KGSA 1YS6A 2RC4A 2E2JJ 1VQKI 3WGGA 1ZGJA 3J7YJ 1YW7A 3ZN0A 1FWZA 1IJWC 2CU7A 5E18F 3A01A 2FA5A 2K4BA 1X2MA 4YFXF 3KZZA 2AO9A 2HQAA 2MH2A 1SANA 5J1UA 1SFXA 2CQNA 1Y1VJ 3ZMSA 2MG4A 1K4SA 4L9TA 5HS9A 2R7QA 4XK4A 2UZKA 3DKXA 3Q0VA 4V2FA 3IV5A 2QQ9A 2RN7A 5TJJA 4Y33A 3VSKA 5A2QK 2ELJA 3TW7A 4D7NA 3RQIA 3FK7A 3FMSA 3GLXA 2Q8KA 3TKYA 1R36A 2QZ8A 3BY6A 2XVCA 5M3FJ 3W2WA 2NYXA 2DW4A 2M7BA 5HOOA 5IT9Z 3PFYA 3JSPA 4KMUX 3A03A 3R4KA 1T0FC 2V1DA 1YS7A 4BAYA 4PK4A 2DBBA 4HDUA 2E60A 3F0CA 3OS1A 3HOUJ 4FHTA 2VLAA 1J2XA 3IHUA 4DJAA 4NB5A 4R1HA 2R7SA 3BP8A 4BUPA 1K61A 3ZMZA 4PDKA 1FYKA 2EA2A 2EPFA 2PLYA 2X6OA 3CO6C 1E3HA 3E97A 1XG1A 5FLXZ 1WJFA 2Z99A 3K6GA 1XX5A 4ENJA 4HNUA 3BQZA 2NOJB 3QPTA 2EZKA 2CJJA 1TZLA 1OLTA 3ABMH 2WA0A 4P5OA 2ZO4A 1WPKA 5AIQA 2K27A 2L9NA 2P6TA 3V42A 3UKGA 1P6RA 3DF8A 1V5GA 3GEZA 4UVBA 4A93J 1S29A 1QRYA 4CCJA 1PUEE 4IOCF 3J7AO 1QPIA 4PJJA 1RUOA 4CXFA 3IKVA 3WTWC 1UJ8A 4BXFA 4PSXA 1A6QA 3S1MJ 3J81Z 2VBXA 4M3FA 1USTA 1U5TC 1X3WB 5HS8A 3P9KA 5EEHA 5DYMA 2MGQA 3SDBA 2DK8A 4U0VA 5HVQC 3CMMA 3VFZA 1IZ1A 2TRTA 3J80K 1I3QJ 1ZTRA 4PJLA 1HSTA 4UUTA 2IS4A 2AS5F 2JVGA 3AKZA 2XGDA 3HEFA 2Y48A 2LKXA 4CGZA 2ECBA 2GA2A 4Z2YA 1J75A 2L0KA 1H8AC 2MSYA 4BGDA 2EQRA 1X3UA 3BG3A 4UY8I 1IUFA 5ICFA 4F52A 2DN0A 1Z7LA 3FXJA 2VOOA 1V5FA 4G6TB 3X2QH 5DM7F 4IHXA 1FBQA 2VN2A 2XC7A 1IDYA 1S7EA 5D6FA 2H8WA 1UELB 2HDCA 4C9YA 3FZVA 1XGSA 1JUMA 5DUIA 4XKWA 1ETVA 2FQ3A 1R49A 3B6AA 1FLIA 1DDNA 4HSTA 2CW8A 1IRXA 3GTMJ 2DA2A 3EUHC 2MA3A 2R4GA 3KP2A 1QU3A 3SZTA 3T8RA 2JTVA 3E5QA 3S3NA 2EINH 2NVYJ 4LK0F 1GT0C 1H9TA 1KU7A 1D1AA 3CP2A 1J9IA 5F0HA 4QPOA 1TW2A 2XDVA 3BCAA 1Q1VA 4B09A 5BQTA 1FY7A 2L4MA 2L5QA 5FD6A 4CH7A 2HVSA 4ON0A 1FOXA 1KU3A 4RB1A 3SEZA 4L0ZB 4U87A 2YR2A 2VQHA 2L9SA 1MMGA 2MBFA 2DMPA 2EILH 2L9VA 2DTRA 4I98B 5A2QZ 2RQQA 1HLVA 2K3FA 2HTJA 4M6VA 2VKHA 2ZKZA 3KYCB 4MFDA 5BS6A 4DIQA 1ZG5A 4ZZLA 1ZAOA 2NRAC 2E2IJ 2FOKA 1JJ8C 1BJZA 3HBLA 1JT0A 1STZA 4W1UA 3FHNA 4IHVA 2EIKH 1JKPC 2XAQA 4M3DA 2PG4A 1XSVA 5HLTA 2R7DA 2KP6A 1V55H 1LUJB 1JI8A 1WH7A 1R1UA 4XBFA 3HRTA 3BTCA 3RPUD 2V6EA 2AQFA 3IRQA 1IXRC 2E1NA 3KLNA 3JRGA 3ECHA 1YYVA 2B0LA 1FOKA 1ZREA 3NWSA 2GLOA 3W3CA 4M74A 2MD5A 5LHHA 2LK2A 2HYJA 3OYDA 1R71A 3HYIA 2BOLA 2DQRA 2I10A 2M7AA 4LLGF 1OR7C 5JR3A 3MKYB 4CYDA 2WBMA 1WH5A 2QQAA 3TEDA 3QRFF 1JHFA 3TOBA 3IAM2 4XKVA 1RI7A 3ISPA 4ZC3A 1KONA 2MD0A 4IXAA 3KEOA 3GTKJ 1RKWA 2HDWA 3LFKA 1U6GA 4L9JA 3M07A 2Z33A 3S8PA 4Y7NJ 5EGOA 2EFQA 2YSRA 1MBKA 2H09A 5CVRA 1VZ0A 1WVRA 3ASOH 4NQWB 3RJPA 3J80Z 3PIOF 5FLMJ 4GGGA 3BG5A 3WU1B 2KDOA 2BHYA 2ZC2A 3CCVI 4HV5A 2ISYA 4QTRA 4PJNA 5D4RA 4PFOA 4CICA 3CUQB 3T0YA 2CV1A 1YG2A 2WAQN 1UHMA 4NDLA 1AWCA 1IF1A 5ICEA 2G7HA 1F43A 1SVMA 4ESJA 3BZCA 1HC8A 4Q47A 4BBSJ 4RB2C 1J7KA 5KCMA 5D5WB 3LAPA 2PFBA 4O3MA 2DT6A 3E0JB 4IO9F 3V8KA 5E1WA 1Y6IA 2JRMA 3HIFA 4P1WA 2DT7B 4EGZA 1IO2A 2P5VA 4ZYHA 5CLSA 3I59A 1Z3XA 2F6CA 3QOPA 4D0PA 3OSGA 4NBQA 1YFHA 3LL7A 1A6IA 1OQYA 1LFBA 5D5UB 3GX4X 5L3EA 2ZJPF 1WI9A 1BI3A 5DS9A 5K7ZA 3KFWX 1OISA 5HDGA 2X4HA 4XN3A 1BIAA 5J1RA 4B8XA 5LRRA 2O61A 4B47A 1LJ9A 4AIJA 2PN6A 2VI6A 4FASD 1RKTA 2B63J 1A36A 4BY1J 2A6EF 2HOTA 3RZDJ 2M8GX 2DI3A 2H1KA 2GOXB 1Z05A 2NXNB 2VXZA 1X1DA 2KIQA 4IX7A 4U0WA 1O7FA 2HTSA 3WTSC 2Y30A 3S1NJ 4D5FA 3BZ6A 3BR6A 3S1QJ 2HWVA 5K1YA 3FDYA 2CW7A 5DV5A 3ZP5A 4CZZA 4KITB 3BPXA 3HGGA 2N8GA 3I59B 1ETOA 2F4OB 5ILSA 4G12A 3L9FA 2EH3A 1KYZA 2X51A 2HGCA 1R00A 3I9V2 3DLAA 2R0QC 4ZYEA 1VQ9I 2LTPA 2EZLA 4XORA 3QYEA 2GM4A 2NVTJ 3DXJF 4EVIA 1RUNA 5E3MA 3OIOA 3IUOA 3CLOA 2Y0SN 1YI2I 4I09A 1NTCA 3H0DA 4EJWA 5J47A 1FIAA 4A0ZA 3VYSB 2OV7A 4B1RA 1TW3A 1R1TA 3BOQA 3ONQA 5IPAA 2LR8A 5ILVA 1R7JA 4E7HA 1IAWA 2KQRA 4LIUA 2V7FA 6PAXA 1T6SA 2ZFUA 1IN4A 2M87A 4LG0B 5J6XA 2Z2SB 3ZQ7A 2QUFA 3S32A 4BEHA 2QENA 3BJAA 1BN5A 3LA7A 1HF0A 4M73A 5EG0A 2AXLA 4XN0A 4GCVA 1F4KA 3C2BA 3E3VA 2CMPA 2F5EA 5LGNA 4B43A 4B3XA 1ZRFA 1GLNA 1M1EB 5BMZA 2BYVE 1MKMA 1K78A 5GPAA 2KISA 4RLQA 2J5OA 1YX5A 2L7ZA 1RRJA 1W7PD 2DA5A 1SD7A 2CYYA 3TO7A 1X4PA 3H9JA 2PMHA 4ASNA 2VE8A 3O3KA 3PL8A 2VKDA 3CJTB 3WODF 1VQPI 5LD2C 1WKMA 2LY1A 1WQ2A 3EETA 1B8IB 3BTIA 2RQPA 1PP7U 2Y75A 1OPCA 2Y2ZA 1AA7A 5C44J 5L3CA 2QQ8A 3FISA 1KQ8A 1D5VA 1V3FA 3TGNA 1UCRA 3PO3J 2F5VA 5E79C 5CKTA 5JI6A 1B72B 2P5KA 2V26A 4AWXB 3HUGA 1PJRA 5FGMA 4LD5A 3K1NA 3ZN1A 1FSHA 3F21A 1ETYA 1K79A 3HTSB 4BY7J 2W4SA 2F48A 1W36C 3M4OJ 2NNYA 1J09A 2LF8A 3KIOA 1USSA 2D45A 1HBXG 3MFKA 4BE1A 1WJCA 3S16J 2GQQA 3ZMUA 1U3EM 1NG6A 2X6YA 4FT8A 3OYCA 2FBHA 2LVSA 4EMSA 2HVRA 4HNVA 3C18A 4MIMA 3K4BA 2ICWG 1Z6RA 3U21A 5KAIC 5B66C 3EPZA 3S2WA 4EQQA 2XAGA 3M1CA 3M3YJ 2IS6A 1L3LA 3OMYA 1IRGA 2GA1A 5IOYA 2BBYA 4OIPF 1ZN2A 3E5XA 4N4OB 5K5RA 3GTLJ 1O7LA 1TP4A 3M9AA 4QSHA 3NWTA 4LIVA 3LSMA 3QODA 5CVJA 4BQAA 5DDGA 4CSWA 2M1BA 4EM0B 5EEGA 3DPLC 3FMQA 2M34A 5DEQA 2YX7A 1OCOH 2LBFB 1T39A 5CJ9A 4A3KJ 2TDXA 3GFIA 3GVAA 4D1QA 5IOZA 3AL0B 4XL9A 2EZIA 3LSRA 2K40A 4HA8A 3SZGA 4NNJA 3IKTA 3DTEA 2KRHA 2XF5A 2QGUA 3FF5A 2MABA 4XIDA 2LKSA 1MH3A 4NUBA 3KYLA 2W25A 1VQLI 1TBXA 2JMWA 4CA0A 3ZQLA 3M8EA 2P7CB 1MDMB 2BW3B 2YS9A 2QSGX 4UV8A 4EJUA 3HB9A 2STTA 2HXIA 1QQIA 2HNHA 2XV4S 3R60A 4V2GA 2PJRA 1BA5A 4MNUA 2CUFA 2E5ZA 3LWFA 2UXXA 2MC4A 5GTHC 4LB5A 5EF6A 1WRJA 4AYBA 1UAAA 1TTYA 3RSNA 3WGHA 1P9QC 3AAFA 4M6XA 4IRIA 3DBLB 3FXRA 3W6KB 3WG9A 2M4GA 4XICA 2P7VB 3L7WA 2ZMEB 3MAJA 1WJBA 3MMYB 3V7SA 5M5YJ 3T1BA 1YTYA 2VBZA 2NAZA 5DM6F 4BXUA 3TP0A 1B9NA 2VT2A 5TGTA 1MBFA 1W7PB 2XASA 3IH3A 3ZMTA 1Z9CA 3GFLA 5C4XJ 3REOA 3GUDA 1RNLA 3QOEA 4LG3A 3BQYA 3ZR8X 1IXSB 3KE2A 2COBA 3FIWA 4HOBA 1A04A 3HSEA 5F0FA 3BT9A 2VXDA 2RV8A 1MMAA 2DLLA 4BS9A 1LQ1A 1ULYA 2OF7A 5LHGA 2CV2A 4BJ6C 3NQOA 4A3JJ 2NS0A 4P96A 2DK5A 3CTAA 1XN7A 4L5JA 4M71A 1R1VA 3S15J 2L3DA 3V7RA 5E8GA 5LHIA 2ZXHA 3TBIA 3BR5A 3DWLE 3I54A 3FXLA 3KEYA 2Y31A 3PSIA 1VNDA 5F08A 1RESA 3RKQA 3F6VA 3GFJA 1OMIA 3KP6A 2CUJA 4BHPA 5IP7J 4E7KA 2BVMA 3DKYA 1LKXA 4A3BJ 4CCMA 4H0EA 2DA1A 2K9NA 2ZBKA 3WTZA 2KPMA 4FISA 1E3PA 1EH7A 2R5ZB 4WF2A 2EB7A 2OQGA 1FP1D 2ECCA 3DFGA 2HEOA 5E1ZB 4HV6A 4YELA 3BJOA 2IGOA 3WTVC 3CD6I 1ETQA 1MJ9A 5L3DA 3V8LA 3CJRB 5HLHA 3DLLF 2H94A 4A3LJ 4CUGA 2DODA 3O8HA 2VUMJ 2FQ4A 2VT3A 3GXOA 3E6DA 1P4WA 3QAHA 4Q4ZF 4YEJA 4EATA 1ZARA 2VKEA 4NC8A 2ZXIA 3HOZJ 2ZNZA 1SAUA 2M4KA 3BTJA 3ZQIA 2QVOA 1JTXA 4Y3OA 1ZG3A 3MQ0A 1W5SA 1D1BA 2CQKA 4MTDA 4IF4A 2ID6A 5HODA 1NK3P 3RYPA 1N78A 4K2EA 4AVZA 4R8HA 1DQUA 1FYLA 1H89C 1VQ4I 1WSUA 1TWAJ 4IHWA 2D2WA 1Z0XA 1ODDA 3BTLA 3K70C 3H9GA 2UXNA 4XM3A 3HOSA 2IXSA 5LRSA 1G3SA 3EYYA 2O0YA 2E1MB 2OAZA 1W5TA 5CVIA 5M3MJ 2BY0A 3PJRA 2VASA 2P4WA 5TRDA 4A3GJ 2FD5A 3CJQB 2EFWA 2CFXA 3AG3H 3HRSA 5EZHA 4XR6A 1YX3A 3W6VA 3L2RA 3KZIC 2FU4A 2BY1A 2B9SA 3H35A 3WU2C 1F5TA 4ZDOA 1WJ5A 4DOZA 2LD5A 1BR2A 2XAFA 2E19A 3U1DA 5LEKA 4F55A 4LOCA 4XLHA 4N0BA 3CCEI 5ICCA 1BW5A 4DZPA 4XQFA 4DQ2A 3OV8A 1KU9A 3ROUA 3FXUA 1GV2A 1J5YA 2FEZA 3F9KA 3TO6A 3E1SA 2HVQA 5K7FA 3SEQA 4FTHA 2L7MP 2PMZA 2JSCA 5AONA 3OIPA 4DYRA 2PQ8A 2X85A 1J0RA 1XS9A 3GLLA 2ZB9A 1LNWA 4HQEA 3LSKA 4GXOA 2NS7A 3TOAA 2DFEA 3CF2A 4P9UA 2JUGA 4N9IA 1YW9A 5KK1A 3LOCA 3ML6A 2E5NA 1GVJA 1HXDA 3I64A 3QP5A 3QU3A 3VDXA 1E2XA 4DGWB 3JRCA 2R5YB 1IN8A 4EJOA 4X6AJ 5LFAA 2KKOA 1Z6TA 2K9LA 3E6BA 4MO7A 4WXHA 3SJMA 4KT5C 2LDUA 4RGSA 1MSEC 5J1YA 4D9JA 3DU5A 3G71I 3EUAA 5E3NA 4IQJA 1HKTA 2ETHA 2KIUA 4HEA2 2LY9A 5KAFC 3W6JB 2UV1A 1W5CC 1TT5B 4KJZA 4A5MA 5EDNA 2BGCA 4DW6A 3KCCA 2WY8Q 1UG2A 4FE7A 1R5GA 5F04A 4U0YA 3CCYA 3K4LA 3GFMA 4B48A 1S72I 3AG2H 4RMNA 1CF7B 4YRVA 5B1AH 1S9HA 3OR1C 1TL8A 3N05A 2EJRA 1FT9A 4JK1X 2XUBA 1G4DA 2IA2A 4HF0A 1CQTA 3KLOA 1BR1A 1GV5A 2M2EA 1FSEA 2DXIA 1ACIA 1X1AA 4IZZA 4F3QA 1HW1A 2CS3A 5K5QA 2M30A 2O03A 2XAJA 1YLFA 3LNQA 3A2KA 2X48A 1WI3A 1Y0UA 2QCOA 3TDUC 4KFCA 1XCVA 1I1GA 2CGPA 3MVPA 3L2WA 4GDFA 3OSFA 2M5WA 3SFIA 1SVLA 4L5IA 3GTOJ 2GXAA 2QWWA 3BC8A 3HOYJ 5EZGA 3S14J 1FMWA 1OYIA 2K9QA 4DYQA 2KJCA 3CJNA 2OBPA 1TNSA 4AUXA 2FNAA 3HHHA 4ENMA 1V5EA 3RI4A 1LEAA 1W1WE 2DMTA 3JTGA 1GDTA 2JPBA 1T56A 1REPC 1VI0A 3LSTA 2Y0MA 1H9GA 3DPUA 1I6HJ 1VQNI 2E1CA 2F2EA 1ONVA 3CP8A 4XONA 4A12A 5ERIA 2XHKA 2FOWA 2HR3A 2EFNA 2R7XA 2ZSHB 2PEXA 1TWFJ 4LFUA 2BVLA 4ETSA 1ZR2A 3OYGA 4BBRJ 3F72A 4BDYA 2DA6A 3PSFA 1QHHD 1K4TA 1IRZA 1IXCA 2A68F 3VYUB 4P9FA 2RNJA 4M9XA 1UMQA 1TQIA 2DOFA 2P5LC 3JSOA 3J7AY 1R6RA 1K7AA 2W85A 2JUCA 1D0XA 2RNGA 2QF7A 1R58A 3BR0A 3WE3A 3TMOA 4ANJA 1BL0A 1ETXA 4M9ZA 2I5UA 4NQWA 2F5CA 3H3ZA 1HKSA 1X1CA 1XD7A 1XDUA 3IRRA 2L7KA 2CSOA 2QBYB 2MLGA 4GO1A 4RS8A 2K7LA 1ZQ3P 2K9MA 2E36A 2ZFWA 5TISC 3COAC 3OYKA 1POGA 1FX7A 1PVEA 3CLQA 3CUQA 4I76A 2VOPA 1MW7A 4W97A 2X6WA 1I39A 4HX8A 3JREA 3BWGA 2XF6A 4A3IJ 3HC7A 3D5SC 1ZELA 3IH4A 2GIVA 3HXLA 3DKWA 3WHCA 3N97A 4MEYF 3BCBA 3FHZA 2JA8J 3H5AA 2IRFG 3WTYC 5KNLA 2K85A 4A6EA 3QPHA 1RETA 2JK3A 3NARA 1KU2A 5E20A 3JRDA 1SEUA 5J4YA 3A0HC 1ZK8A 2LREA 1SC7A 2WB1A 9ANTA 4YFKF 2ZJRF 2LOOA 2BY2A 3OL4A 4Q5SF 5GAHJ 2AXTC 3S3OA 3VWBA 1BW6A 4JX5A 5LGTA 3OS0A 4RAYA 5FKLA 3DP7A 4NHJA 2CFOA 3CCSI 1RR7A 2EV6A 3F8FA 5BNGA 3E5UA 4XLFA 2DOEA 2OU2A 2JA5J 1JTYA 3SXYA 3EDPA 2LC2A 1LE8B 2V9PA 3OS2A 3OYBA 1I1SA 3F8CA 3Q3SA 2DU9A 2LG4A 2W00A 5FKNA 5D5XB 1I3AA 4D7MA 1QO0D 3L2QA 3S3MA 2JT1A 2XPWA 3OYNA 1ZRDA 3C7JA 5HS7A 3GBGA 3HSFA 1VF9A 4UVAA 4CYCB 2M3AA 4CCKA 1Q1HA 3H5RA 2QA4I 1VTNC 4ZYAA 1T2KA 1OCCH 1VQ6I 3B73A 3LQQA 1S8NA 3RTRA 2K4JA 1G3YA 4YFNF 4KICA 3IH2A 4IQ4A 2H27A 1ORKA 3DBRB 4FQGA 4HRIA 2CQXA 2K02A 1JGSA 3RPUA 3HKZA 4OAZA 2DYRH 5GAEJ 1OYYA 1Z21A 2FNPA 2VJJA 4E6KG 4BE0A 4LG0A 2MH9A 2LNBA 3OYIA 2M45A 4BHBA 4G9YA 5CQGA 3MZHA 1DP7P 3CF5F 2R7FA 4LLNA 1PP8F 5HNFA 1MBJA 1P4XA 4CCOA 5F6FA 3S2DJ 5D4SA 2FF4A 1QA6A 4PCQA 3EQLF 1I6XA 2X0LA 4KIBA 4HNTA 3HOWJ 1YQAA 3P9CA 3KPHA 3HL2A 4O6JA 1G2HA 1FTZA 1VQMI 3MZYA 1LVKA 3ZMDA 1HKQA 2HDDA 2X1CA 1FPQA 1UHWA 1ON2A 2D1HA 2FJ1A 3BG6A 3UNGC 1ZRCA 2XF7A 2VBYA 2BE5F 2XSDC 1WJEA 3OOUA 1XGMA 4XKCA 4ZZDA 3BDDA 1QHGA 4YIFA 1JJ6C 3LQRA 5KHDA 2HS5A 2ZXJA 3HJEA 2XPVA 5DCMB 1MBHA 4NC7A 1EJ9A 3A0BC 1ZH5A 1FBSA 1AKHB 3MKZA 1YIOA 2Q2EB 2F5DA 3HPHA 1B8IA 3CO7C 1R5ID 2IS2A 1GUUA 1X3ZB 2FMLA 2DJNA 2DDAA 1Y56A 4L5EA 4Y13A 1CGPA 3CUOA 5L3BA 3VODA 2KDZA 3HGYA 2NOGA 1B72A 4XOTA 1W4MA 2DT5A 3HOVJ 2VQCA 4HLYA 1MSFC 4FCYA 4IOAF 1XGOA 3I4NJ 1RZ4A 1ETWA 4BJTA 2DMUA 1O3RA 1U0JA 2KZGA 2M0MA 3H1CA 4HF2A 4BXXJ 3FKIJ 2BZTA 2JQ7A 4F92B 5M5XJ 2OTJI 2QYOA 4ENNA 2NNNA 3I3LA 4UV9A 4C2UA 1PDNC 2V1UA 4BQQA 3UR3C 4OWRB 4RBOA 2GWRA 2OCEA 1G3TA 2E35A 3BR3A 1WZ2A 4I6ZA 5FFXA 2CW0F 2TCTA 2CUZA 4MLOA 4RGRA 1VQ7I 3L1PA 4C3HJ 3SQNA 3ERED 2EV0A 5LGUA 3Q5FA 2VC0A 4WXCA 2WV0A 3AG4H 4ZDLA 3ZQHA 1FOWA 2WV1A 1U78A 4AM3A 1APLC 2Z16A 3K4NA 1U5TB 4RB3C 4M3GA 3K4KA 1JKOC 2DCEA 2DPDA 4BQNA 4BYYA 2LYCA 2QKMB 4CHUA 1Z91A 3LA2A 2UWMA 1KQ0A 2LBFA 4S05A 4M72A 1TLHB 3GTQJ 3I71A 2V1NA 3OR2C 4KYWA 4AU7A 3PUBA 3L2VA 3E7LA 4OAYA 3RKWA 3WG7H 1MBGA 3PIPF 3IAS2 5JLWA 1YJWI 3GW2A 4MEXF 1FJLA 1HCRA 5IYDJ 3A4CA 3RKYA 4XLEA 3RZOJ 2WAFA 1SD6A 5IY5H 2W1OA 3KEQA 2PBIA 2DPUA 3HM5A 1D1CA 3CMEI 1GVDA 3RIRA 3PM1A 1MDMA 2BW3A 2HI3A 5HLIA 1ZLKA 3H5NA 4HX7A 3E6CC 4IRHA 1Y0NA 3RPQA 2K5CA 1JUSA 3KX2A 3HTUA 1EKEA 3W2AA 3LSPA 4XLPF 4HYEA 3TL4X 4A3MJ 1U8BA 1Z67A 4II2A 3CC7I 4B4CA 1YJ9I 4HSRA 2HPMA 2ZMEA 3H3UA 5F0CA 4FE4A 2FBIA 3QPSA 3CMAI 3I55I 2IJLA 4LLLA 2ADUA 2VJ4A 1YHQI 1LFPA 1QZZA 4E7LA 4A5NA 2Y69H 1F36A 2XAHA 3OIQA 1W7PA 2CUEA 2YX4A 3G2BA 3VB2A 3CESA 2K86A 3RDIA 3D5LA 1BOBA 2P0WA 2VQGA 2BHZA 1MNDA 1LDJA 1V4RA 1W0UA 4E7ZA 1DGRM 1FNNA 4DNCA 1OR7A 3KZYA 4OMZA 1SAXA 5FROA 2HKOA 5E8IA 3S17J 4U88A 3ZCOA 3WTTC 3LMMA 1ZYRF 4UUSB 3HDDA 3HHGA 3E6MA 2HZDA 3K4MA 3I56I 4I02A 2IBDA 4G6QA 2QLZA 1AU7A 2QSHX 1BI0A 4RA2A 1RPWA 3GF2A 3JR9A 5CVVA 2A5YB 4BH9A 1KZHA 4WCGA 3G73A 1DGWY 2HQ5A 1Z77A 4JYKA 3FBNB 1G59A 2RGVA 5DTDA 1T33A 4E7IA 2XB5A 3ZQFA 3CDIA 3T8TA 1MH4A 1MMSA 1EA3A 1FIPA 4XLNF 3RKXA 4CO8A 1TNTA 3PQJA 1T8IA 2R5ZA 5J8FA 2F5FA 2O9LA 4OIOF 3OYFA 1D3YA 1Z1DA 2IAIA 2P8TA 3H3VK 3GTJJ 1WFXA 2G9WA 5BPDA 4DBQA 1I50J 1UZCA 1WHUA 4UHTA 4B3AA 4HAMA 1RIOH 2KZVA 2XPUA 4XRFA 5L3GA 1X58A 2X9DA 2NVXJ 1ZG1A 3K9TA 3MN2A 5FO5A 5ED4A 3P5JA 3JRBA 1LFUP 4RGXA 1XDSA 3D0SA 4Z6YA 2WWYA 1JUPA 3RQ4A 1ERDA 3CUQC 3J7ZI 4HW0A 1UHSA 1X1BA 5IT3A 2O6GE 2HU9A 3K7AJ 3FM3A 2ZJQF 3O6BB 1SFUA 2IA0A 4I7HA 2R7UA 3DQVC 4EV0A 2K9SA 1V54H 1D0YA 4XLCA 3ZMVA 2YPRA 1P4AA 4EM2A 1ZGAA 2HKXA 1U8RA 1HQCA 4RAGA 5D8KB 3HPGA 3ULQB 1XTAA 4BL0B 3ESWB 2STWA 2WC2A 4I99C 4JP0A 1K83J 3VEPA 2OPTA 1W36D 3GCMA 2ME6A 4KA4A 1BIBA 1U9OA 2R92J 5HLGA 2E34A 4F91B 4F93B 4OIQF 1NG7A 3D1NI 4AYBN 2R93J 3DTIA 4CCNA 1XSXA 1YIJI 1U9NA 2C6YA 1X1PA 4KN7X 1D8KA 5LBQA 2IA1A 3D5RC 3OL3A 2A5WA 2CH0A 4C3IJ 3H0GJ 3F22A 4MTEA 1O57A 3AG1H 1JKRC 4A69C 4I0BA 3V7CA 5F1JA 4RM3A 4LMYA 4IHTA 1T98A 3FXOA 3WTUC 2GOMA 3K2AA 3CQZJ 3JRFA 3H9QA 2L7FP 1R23A 5IYBJ 2QKLB 4PZJA 2CQ7A 2XGEA 1FTTA 1OJLA 5E3OA 2CWEA 3ECOA 4QWQA 4HG2A 2L01A 4MFEA 4L9VA 4QIWN 1LB2A 4KDPA 2DMNA 2DFFA 4UVCA 1WGXA 1DP3A 4S04A 1BI1A 1WJDA 2JRTA 3LSIA 1BM9A 4I0AA 4MQ9F 4EJTA 3IC7A 2R5YA 4G6DA 4WX9A 1MMNA 2VJIA 2YU9J 2X6XA 4XRSA 2EIJH 1IN7A 3A1YA 1S3JA 4II3A 3U1KA 2B7EA 4IEJA 4JQFA 1R22A 3C1DA 2EIMH 2R7RA 3BJ6A 2EV5A 1ZKGA 1SFOJ 5GTIC 1ETKA 5EYRA 3I4MJ 1PUFB 5DCFA 2H6BA 3FBIB 3U2RA 2WADA 4XRSG 5M5WJ 1IN5A 4GRIA 2R7WA 4BE2A 5ICGA 4G94A 3K2ZA 3OYAA 3KP5A 3ZQCA 1F9NA 4QPQA 1D0ZA 4XSXF 2W82A 4AIDA 1SMTA 2VC1A 4V19K 4KISA 3LAJA 3WHBA 1KYWA 1WCMJ 1CF7A 4RM2A 1X2NA 5FKKA 3A01B 1MMDA 4XKBA 4A0YA 3PNYA 4HX4A 5J40A 4AIHA 2Y9ZA 2EZHA 2IT0A 4UUVA 3HG9A 4B44A 2A05A 3I53A 4RDUA 2I8DA 3NAUA 4X1EA 2V9KA 5JVGF 2HFHA 4OMYA 1TWGJ 2OC6A 3EUKL 2VJ5A 3ELKA 3K4CA 5C4JJ 2IGNA 2QQBA 3DBHB 1K6OA 1ITYA 2VE9A 1Y8RB 1EV7A 2AHQA 3JAMK 1DPRA 1E3OC 1HW2A 1VQ5I 1FC3A 2BXYA 2W24A 4PUSA 1BC8C 2MLKA 1VQ8I 2G0EA 1NH3A 2VODA 4F7ZA 2AQEA 3R61A 1MBEA 2KIMA 1VQOI 3H36A 3DPTA 1T95A 5FB2A 1SFEA 1ZGWA 2VBWA 2IPQX 2WTEA 4EJVA 4JX4A 4ABZA 3QPLA 1YO5C 2DMQA 4MHGA 2E2HJ 4C3JJ 1HDDC 4KMFA 5JHFA 3MCZA 3S2HJ 3GWZA 3HOXJ 4L0YB 5IYCJ 3WTXC 1QNTA 3L2UA 1GXPA 1FYMA 4DZJA 5JVTA 2OJED 3OYMA 4MGRA 1S5LC 1YOVB 4G8XA 1QZEA 1S7OA 5DUKA 2IS1A 1BR4A 4Y52J 3MKWB 5DD8A 2PMUA 2EWNA 2DFIA 3AFHA 3EYIA 3OYJA 2KMUA 1WWXA 3ABKH 5LLQA 2QSFX 3PNVA 1OYWA 1S6LA 3MWMA 2HPIA 4M9SA 2PMZN 3LA3A 2FUG2 2OTLI 2QBYA 3PQKA 2HXOA 3GMEA 2A3SA 2OZ6A 1DU6A 3G1OA 2L02A 4QLCU 1TT0A 4CCLA 1LEBA 2A6TA 2BV6A 2R7TA 1XMXA 3CDHA 4NC6A 4A6DA 3F23A 2V6CA 3ZPLA 4RAZA 5J3LA 3Q0WA 4PFPA 3B6CA 5BPIA 3FX3A 1P7IA 1RR8C 5HDNA 4KT6A 4OINF 4AC0A 1FEXA 3ABTA 3AL0C 3L09A 4LB6B 2PI0A 1ON1A 5F1RA 1BC7C 1T08B 2O8KA 4GFBA 2VL8A
chains in the Genus database with same CATH topology
1SD4A 1GXQA 4I2OA 3M1EA 3M8FA 4KUMA 2XKOA 3OOPA 4KNYA 2M8EA 3K1MA 4R79A 1IUYA 2E7WA 2COMA 3P7NA 3JW4A 1UB9A 1T38A 1MZBA 5LEJA 1MJAA 2XGXA 5E17F 2FSWA 3R0JA 4LJZF 3GZ5A 1B6AA 3TO9A 5JHUA 2P6SA 4I01A 2IW5A 3R6SA 4YIIA 3FM5A 3JAMZ 3GZ6A 4G7ZF 3F6OA 1C0WA 2LSOA 2ACJA 2OD5A 2ESNA 2HYFA 5DD4A 1BI2A 1H0MA 2LF7A 3JTHA 2KIFA 4HLXA 4RGUA 4RB0A 4HQMA 4HZFA 4ZH4F 1B1BA 3VOEA 1UFMA 2O3FA 2ZNYA 3HRUA 3I5UA 5K5OA 3IL2A 2GXBA 2ZCWA 1XB4A 2KJBA 5FFZA 5CYVA 3F3XA 5DCMA 1YW8A 3GYHX 1KQ9A 2GXGA 2Q2EA 1JHHA 5FD5A 1BJAA 4ESFA 2QM3A 4AD9A 2HQRA 4FX4A 3M7GA 4U7BA 1GHCA 1O3TA 2RDPA 1JXSA 2RKHA 1T0FA 4ZYGA 4GYIA 2XRNA 4LGWA 4XSZF 3IWFA 4YG2F 4G7HF 4ENKA 1IRFA 2ELHA 2JPCA 3I0TA 2V9VA 1DPUA 3HSRA 5D6EA 2L4AA 2LKPA 2FE3A 3G3ZA 3P9IA 4E70A 2IP2A 1FP2A 1QZYA 2FMYA 4WWCA 1MD0A 1XMKA 3FMRA 4PGHA 1LDKB 1HW5A 4HF1A 1XSDA 2HQNA 2EFOA 1U5TA 2XKPA 2A61A 3KETA 1ZLJA 4FX0A 5H20A 1U2WA 1TQPA 2J5PA 2IVMA 2GZWA 4ESBA 1BOAA 4IRGA 4BHCA 3DV8A 2D1VA 3H92A 3SFZA 3T5XA 3TDZC 3K0LA 4LK1F 4KIFA 5JFRA 1LDDA 2CO5A 2MC3A 5E1XA 2Z3YA 3NRVA 4UXNA 2V1XA 2HYGD 2JZYA 2Z9OA 1XCBA 1MJBA 1O3SA 4EM1A 1QBJA 3EUHA 3L00A 2DQLA 1B4AA 1FBUA 2ESHA 2O8XA 3SZPA 5D8LB 5F64A 4Q48A 1IN6A 3FXQA 1E17A 1JE8A 2Z5UA 3Q9VA 3U9GA 3FWEA 3F8NA 3WGIA 2XROA 1EH6A 5BOXA 2OA4A 2HOEA 2A07F 4PGGA 1LVAA 3BROA 2BEOA 3V4GA 4AVPA 4AIKA 3RYRA 1K78B 3WU0A 3KP3A 2EA4A 2PJPA 3KP4A 4Y17A 1G3WA 2L54A 2GAUA 4BNCA 3QU6A 3C3WA 1P92A 4P55A 5L3FA 1DUXC 4WXDA 2R3SA 1ZHFA 2V79A 4Y15A 4KN4X 4IPAA 3V8JA 1J59A 1R5HA 1P2FA 2EFPA 1S7AA 1TQMA 4ZYDA 2Q0OA 2A69F 2OZUA 4UNOA 4HDVA 1SD5A 2HZTA 3BPVA 2DO7A 1L0OC 2W84A 3HOTA 4OOIA 3I58A 4A2UA 1MGTA 3ABUA 1HSJA 4O5VA 1F1ZA 1AOYA 2H6CA 4KIGA 1FZPB 3F8BA 4IJAA 5H6RA 5H6QA 5KVRA 3Q9SA 3O2PE 5AIPA 3L2CA 5HDKA 4HBLA 3F8MA 3IWZA 4A0XA 1I27A 1SMYF 3B02A 5J8CA 1I5ZA 1QPMA 4EGYA 5IT9K 4TV7A 5ILUA 2OQRA 1G6NA 4L9NA 3WE2A 3KP7A 4GYGA 3TQNA 2EK5A 1BBYA 3MEXA 1XGNA 2FXAA 5FLXK 2ISZA 1XMAA 3QP6A 2YU3A 1EH8A 1IW7F 4U7DA 3N4MA 5CVUA 1OKRA 5D5VB 3K69A 2DAOA 2RVCA 1QGPA 4IVNA 4IHSA 2CG4A 1O3QA 2A6HF 3J81K 3DEUA 2FRHA 2KRFA 4CDGA 1NHAA 2W57A 4OU0A 3GO5A 1D8JA 3R0AA 4OIRF 1Z7UA 3HRMA 4L18B 1B59A 4WK8F 1B9MA 4MQVA 2E7XA 3I4PA 3NEUA 2G7UA 2FBKA 3SHFA 2ZJ2A 4M6YA 1KA8A 4JBAA 4N9HA 2VONA 3PFIA 3K1PA 4G7OF 2XIGA 1KGSA 1YS6A 2RC4A 3WGGA 1ZGJA 1YW7A 3ZN0A 1FWZA 5E18F 2FA5A 2K4BA 4YFXF 3KZZA 2MH2A 1SFXA 3ZMSA 4L9TA 5HS9A 2UZKA 2QQ9A 2RN7A 5TJJA 5A2QK 3FMSA 3GLXA 2Q8KA 3TKYA 1R36A 2QZ8A 3BY6A 2XVCA 2NYXA 2DW4A 5HOOA 5IT9Z 3JSPA 4KMUX 3R4KA 2V1DA 1YS7A 4BAYA 2DBBA 4HDUA 4FHTA 1J2XA 3IHUA 4NB5A 4R1HA 3BP8A 3ZMZA 4PDKA 1FYKA 2EA2A 2PLYA 3CO6C 3E97A 5FLXZ 2Z99A 4ENJA 3QPTA 4P5OA 2ZO4A 5AIQA 2K27A 2P6TA 1P6RA 3DF8A 4UVBA 3GEZA 1S29A 3J7AO 1PUEE 1RUOA 4CXFA 3IKVA 3WTWC 3J81Z 2VBXA 1USTA 1U5TC 5HS8A 3P9KA 5EEHA 5DYMA 2DK8A 4U0VA 5HVQC 3VFZA 3J80K 1IZ1A 1HSTA 2AS5F 2Y48A 4CGZA 2GA2A 4Z2YA 1J75A 1X3UA 5ICFA 2VOOA 1FBQA 2VN2A 5D6FA 2HDCA 3FZVA 1XGSA 5DUIA 2FQ3A 1FLIA 1DDNA 2MA3A 3KP2A 3SZTA 3T8RA 2JTVA 3E5QA 1KU7A 1H9TA 4LK0F 1J9IA 1TW2A 5BQTA 4B09A 1FY7A 2L4MA 5FD6A 4ON0A 1KU3A 4RB1A 4L0ZB 2YR2A 2MBFA 4I98B 2DTRA 5A2QZ 2HTJA 2ZKZA 5BS6A 1ZG5A 4ZZLA 1ZAOA 2NRAC 2FOKA 1STZA 2XAQA 2PG4A 1XSVA 2R7DA 1R1UA 4XBFA 3HRTA 3IRQA 1IXRC 2E1NA 3KLNA 3ECHA 1YYVA 2B0LA 1FOKA 1ZREA 4M74A 2MD5A 5LHHA 3HYIA 2DQRA 4LLGF 5JR3A 4CYDA 3QRFF 2QQAA 1JHFA 3TOBA 1RI7A 3ISPA 4IXAA 3KEOA 3LFKA 1U6GA 4L9JA 2Z33A 2EFQA 2YSRA 2H09A 5CVRA 3RJPA 3J80Z 4GGGA 3WU1B 4HV5A 2ISYA 5D4RA 4CICA 3CUQB 3T0YA 1YG2A 1UHMA 1AWCA 1IF1A 5ICEA 2G7HA 4ESJA 4Q47A 4RB2C 1J7KA 5D5WB 3LAPA 2PFBA 4O3MA 3V8KA 5E1WA 3HIFA 4EGZA 2P5VA 4ZYHA 5CLSA 3I59A 3QOPA 1YFHA 4D0PA 5D5UB 3GX4X 5L3EA 1WI9A 1BI3A 3KFWX 5HDGA 2X4HA 1BIAA 4B8XA 5LRRA 2O61A 1LJ9A 4AIJA 2PN6A 2A6EF 2DI3A 1Z05A 2VXZA 4U0WA 1O7FA 2HTSA 3WTSC 3BZ6A 2HWVA 5K1YA 5DV5A 3ZP5A 4CZZA 3BPXA 3I59B 5ILSA 3L9FA 1KYZA 2HGCA 1R00A 4ZYEA 3DXJF 4EVIA 1RUNA 3CLOA 4I09A 4EJWA 4A0ZA 1TW3A 1R1TA 3BOQA 1IAWA 5ILVA 1R7JA 6PAXA 1T6SA 1IN4A 2M87A 4LG0B 5J6XA 3ZQ7A 2QUFA 2QENA 3BJAA 1BN5A 3LA7A 4M73A 2AXLA 4GCVA 1F4KA 3E3VA 2F5EA 5LGNA 1ZRFA 5BMZA 2BYVE 1MKMA 1K78A 2J5OA 1W7PD 1SD7A 2CYYA 3TO7A 2PMHA 4ASNA 2VE8A 3O3KA 3WODF 1WKMA 1WQ2A 3EETA 2RQPA 1PP7U 2Y75A 1OPCA 5L3CA 1KQ8A 1D5VA 1V3FA 3TGNA 1UCRA 5JI6A 2P5KA 4AWXB 3HUGA 3ZN1A 5FGMA 4LD5A 3K1NA 1FSHA 3F21A 1K79A 3HTSB 2NNYA 2LF8A 1USSA 2D45A 1HBXG 3MFKA 2GQQA 3ZMUA 1U3EM 4FT8A 2FBHA 4EMSA 3C18A 1Z6RA 3S2WA 4EQQA 2XAGA 1L3LA 1IRGA 2GA1A 2BBYA 4OIPF 1ZN2A 3E5XA 5K5RA 1O7LA 3M9AA 5CVJA 4BQAA 5DDGA 2M1BA 4EM0B 5EEGA 3DPLC 3FMQA 5DEQA 2YX7A 1T39A 5CJ9A 2TDXA 3GFIA 3GVAA 4HA8A 3IKTA 3FF5A 2W25A 1TBXA 3M8EA 2P7CB 1MDMB 4UV8A 4EJUA 2STTA 1QQIA 2XV4S 3R60A 4MNUA 3LWFA 2UXXA 4LB5A 1WRJA 1TTYA 3WGHA 3AAFA 4M6XA 4IRIA 3FXRA 3WG9A 3W6KB 2P7VB 3L7WA 2ZMEB 3MAJA 3V7SA 3T1BA 1YTYA 2VBZA 2NAZA 4BXUA 1B9NA 2VT2A 2XASA 1W7PB 1Z9CA 3ZMTA 3GFLA 3REOA 3GUDA 1RNLA 1IXSB 3KE2A 4HOBA 1A04A 3HSEA 2RV8A 2DLLA 1LQ1A 1ULYA 5LHGA 3NQOA 2NS0A 4P96A 2DK5A 3CTAA 1XN7A 4L5JA 4M71A 1R1VA 2L3DA 3V7RA 5E8GA 5LHIA 3I54A 3F6VA 3GFJA 1OMIA 3KP6A 4BHPA 4H0EA 2ZBKA 3WTZA 1EH7A 4WF2A 2EB7A 2OQGA 1FP1D 3DFGA 2HEOA 5E1ZB 4HV6A 3BJOA 3WTVC 1MJ9A 5L3DA 3V8LA 5HLHA 2H94A 2VT3A 3GXOA 3E6DA 1P4WA 3QAHA 4Q4ZF 1ZARA 2ZNZA 2QVOA 1ZG3A 3MQ0A 1W5SA 2CQKA 4MTDA 4IF4A 3RYPA 4K2EA 1FYLA 4R8HA 1WSUA 2D2WA 1ODDA 2UXNA 3HOSA 5LRSA 1G3SA 3EYYA 2O0YA 2OAZA 1W5TA 5CVIA 2P4WA 5TRDA 2EFWA 2CFXA 3HRSA 2FU4A 1F5TA 2XAFA 3U1DA 5LEKA 4N0BA 5ICCA 4DQ2A 3OV8A 1KU9A 3ROUA 3FXUA 1J5YA 2FEZA 3TO6A 2JSCA 5AONA 2PQ8A 1J0RA 1LNWA 4HQEA 4GXOA 3TOAA 4P9UA 4N9IA 1YW9A 5KK1A 3ML6A 1GVJA 1HXDA 3I64A 3QP5A 3QU3A 1E2XA 1IN8A 4EJOA 2KKOA 1Z6TA 3E6BA 4WXHA 4KT5C 2LDUA 4RGSA 1HKTA 2ETHA 2KIUA 3W6JB 4A5MA 2BGCA 3KCCA 1R5GA 4U0YA 3GFMA 1CF7B 2EJRA 1FT9A 4JK1X 2XUBA 1G4DA 2IA2A 4HF0A 3KLOA 1FSEA 1HW1A 5K5QA 2M30A 2O03A 2XAJA 1YLFA 1Y0UA 3TDUC 4KFCA 1XCVA 1I1GA 2CGPA 2M5WA 4L5IA 2QWWA 1OYIA 2KJCA 3CJNA 2OBPA 1TNSA 2FNAA 3HHHA 4ENMA 3RI4A 1REPC 1LEAA 3JTGA 2JPBA 3LSTA 2Y0MA 1H9GA 2E1CA 2F2EA 1ONVA 4A12A 5ERIA 2XHKA 2HR3A 2EFNA 2PEXA 4LFUA 4ETSA 3F72A 1IXCA 2A68F 4P9FA 2RNJA 4M9XA 1TQIA 2P5LC 3JSOA 1K7AA 2W85A 1R58A 3WE3A 4M9ZA 4NQWA 2F5CA 3H3ZA 1HKSA 3IRRA 1XD7A 1XDUA 2CSOA 2QBYB 2MLGA 4GO1A 4RS8A 2K7LA 2ZFWA 3COAC 1FX7A 3CUQA 2VOPA 4HX8A 3BWGA 2GIVA 3N97A 3DKWA 4MEYF 3FHZA 2IRFG 3WTYC 4A6EA 3QPHA 5E20A 1KU2A 4YFKF 4Q5SF 5LGTA 4RAYA 3DP7A 4NHJA 2EV6A 3F8FA 3E5UA 2OU2A 3SXYA 3EDPA 1I1SA 3F8CA 2DU9A 5D5XB 1QO0D 2JT1A 1ZRDA 3C7JA 5HS7A 3HSFA 4UVAA 1VTNC 1Q1HA 1T2KA 3B73A 3LQQA 1S8NA 3RTRA 2K4JA 1G3YA 4YFNF 4KICA 2H27A 2K02A 1JGSA 3RPUA 1OYYA 2FNPA 4LG0A 2MH9A 2LNBA 2M45A 4BHBA 4G9YA 3MZHA 1DP7P 2R7FA 4LLNA 1PP8F 1P4XA 5F6FA 5D4SA 2FF4A 4PCQA 3EQLF 1I6XA 2X0LA 4KIBA 1YQAA 3P9CA 4O6JA 3MZYA 3ZMDA 1HKQA 1FPQA 1UHWA 1ON2A 2D1HA 1ZRCA 2VBYA 2BE5F 1XGMA 4ZZDA 3BDDA 4YIFA 3LQRA 2HS5A 2ZXJA 5DCMB 1ZH5A 1FBSA 1YIOA 2F5DA 3CO7C 2FMLA 1CGPA 4Y13A 3CUOA 5L3BA 3VODA 1W4MA 2DT5A 4HLYA 1XGOA 1RZ4A 1O3RA 4HF2A 2QYOA 4ENNA 2NNNA 4UV9A 1PDNC 2V1UA 2GWRA 1G3TA 5FFXA 2CW0F 4RGRA 3SQNA 3ERED 2EV0A 5LGUA 3Q5FA 2VC0A 4WXCA 2WV0A 1U78A 1U5TB 4RB3C 2DPDA 4BYYA 4CHUA 1Z91A 3LA2A 2UWMA 1KQ0A 4S05A 4M72A 1TLHB 3I71A 4KYWA 3RKWA 4MEXF 3GW2A 3RKYA 1SD6A 3KEQA 2PBIA 2DPUA 3RIRA 1MDMA 1ZLKA 5HLIA 4HX7A 3E6CC 4IRHA 3RPQA 3HTUA 4XLPF 4HYEA 2ZMEA 3H3UA 2FBIA 2IJLA 4LLLA 2ADUA 1QZZA 4A5NA 2XAHA 1W7PA 2YX4A 3VB2A 2K86A 3RDIA 3D5LA 1LDJA 1V4RA 1FNNA 4DNCA 1OR7A 3KZYA 4OMZA 1SAXA 2HKOA 5E8IA 4U88A 3WTTC 1ZYRF 3HHGA 3E6MA 4I02A 4G6QA 2QLZA 1BI0A 3GF2A 5CVVA 2A5YB 4BH9A 4WCGA 3G73A 2RGVA 3T8TA 4XLNF 3RKXA 4CO8A 1TNTA 3PQJA 5J8FA 2F5FA 4OIOF 1D3YA 1Z1DA 2P8TA 2G9WA 5BPDA 4UHTA 4HAMA 1RIOH 4XRFA 5L3GA 1ZG1A 3K9TA 5FO5A 5ED4A 4RGXA 1XDSA 3D0SA 2WWYA 3CUQC 4HW0A 5IT3A 2O6GE 3FM3A 3O6BB 1SFUA 2IA0A 4I7HA 3DQVC 4EV0A 3ZMVA 2YPRA 1P4AA 4EM2A 1ZGAA 2HKXA 1U8RA 1HQCA 5D8KB 3ULQB 2STWA 2WC2A 3VEPA 4KA4A 1BIBA 5HLGA 4OIQF 1XSXA 2C6YA 4KN7X 1D8KA 5LBQA 2IA1A 3F22A 4MTEA 1O57A 4I0BA 3V7CA 4IHTA 4LMYA 1T98A 3WTUC 1R23A 4PZJA 2CWEA 3ECOA 4QWQA 2L01A 4L9VA 1LB2A 4KDPA 4UVCA 4S04A 1BI1A 4MQ9F 2JRTA 1BM9A 4I0AA 4EJTA 3IC7A 4G6DA 4WX9A 1IN7A 1S3JA 4JQFA 1R22A 3C1DA 3BJ6A 2EV5A 5DCFA 2H6BA 3U2RA 1IN5A 5ICGA 4G94A 3K2ZA 3KP5A 1F9NA 4XSXF 1SMTA 2VC1A 3LAJA 1CF7A 1KYWA 4A0YA 4HX4A 4AIHA 2IT0A 4UUVA 3I53A 4OMYA 2HFHA 3ELKA 2QQBA 1K6OA 2VE9A 1EV7A 3JAMK 1DPRA 1HW2A 1FC3A 2W24A 1BC8C 2MLKA 2VODA 4F7ZA 3R61A 2KIMA 3DPTA 5FB2A 1SFEA 2VBWA 2IPQX 2WTEA 4EJVA 1YO5C 4MHGA 4KMFA 3MCZA 3GWZA 4L0YB 3WTXC 1QNTA 1GXPA 1FYMA 5JVTA 4MGRA 4G8XA 1S7OA 5DUKA 5DD8A 2PMUA 2EWNA 2DFIA 3EYIA 1WWXA 5LLQA 1OYWA 1S6LA 3MWMA 4M9SA 2QBYA 3LA3A 3PQKA 2A3SA 2OZ6A 2L02A 4QLCU 1LEBA 2BV6A 3CDHA 4A6DA 3F23A 2V6CA 3ZPLA 4RAZA 5BPIA 3FX3A 5HDNA 4OINF 3ABTA 3L09A 4LB6B 2PI0A 1ON1A 5F1RA 1BC7C
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1SD4 A;  1GXQ A;  4I2O A;  3M1E A;  3M8F A;  4KUM A;  2XKO A;  3OOP A;  4KNY A;  2M8E A;  3K1M A;  4R79 A;  1IUY A;  2E7W A;  2COM A;  3P7N A;  3JW4 A;  1UB9 A;  1T38 A;  1MZB A;  5LEJ A;  1MJA A;  2XGX A;  5E17 F;  2FSW A;  3R0J A;  4LJZ F;  3GZ5 A;  1B6A A;  3TO9 A;  5JHU A;  2P6S A;  4I01 A;  2IW5 A;  3R6S A;  4YII A;  3FM5 A;  3JAM Z;  3GZ6 A;  4G7Z F;  3F6O A;  1C0W A;  2LSO A;  2ACJ A;  2OD5 A;  2ESN A;  2HYF A;  5DD4 A;  1BI2 A;  1H0M A;  2LF7 A;  3JTH A;  2KIF A;  4HLX A;  4RGU A;  4RB0 A;  4HQM A;  4HZF A;  4ZH4 F;  1B1B A;  3VOE A;  1UFM A;  2O3F A;  2ZNY A;  3HRU A;  3I5U A;  5K5O A;  3IL2 A;  2GXB A;  2ZCW A;  1XB4 A;  2KJB A;  5FFZ A;  5CYV A;  3F3X A;  5DCM A;  1YW8 A;  3GYH X;  1KQ9 A;  2GXG A;  2Q2E A;  1JHH A;  5FD5 A;  1BJA A;  4ESF A;  2QM3 A;  4AD9 A;  2HQR A;  4FX4 A;  3M7G A;  4U7B A;  1GHC A;  1O3T A;  2RDP A;  1JXS A;  2RKH A;  1T0F A;  4ZYG A;  4GYI A;  2XRN A;  4LGW A;  4XSZ F;  3IWF A;  4YG2 F;  4G7H F;  4ENK A;  1IRF A;  2ELH A;  2JPC A;  3I0T A;  2V9V A;  1DPU A;  3HSR A;  5D6E A;  2L4A A;  2LKP A;  2FE3 A;  3G3Z A;  3P9I A;  4E70 A;  2IP2 A;  1FP2 A;  1QZY A;  2FMY A;  4WWC A;  1MD0 A;  1XMK A;  3FMR A;  4PGH A;  1LDK B;  1HW5 A;  4HF1 A;  1XSD A;  2HQN A;  2EFO A;  1U5T A;  2XKP A;  2A61 A;  3KET A;  1ZLJ A;  4FX0 A;  5H20 A;  1U2W A;  1TQP A;  2J5P A;  2IVM A;  2GZW A;  4ESB A;  1BOA A;  4IRG A;  4BHC A;  3DV8 A;  2D1V A;  3H92 A;  3SFZ A;  3T5X A;  3TDZ C;  3K0L A;  4LK1 F;  4KIF A;  5JFR A;  1LDD A;  2CO5 A;  2MC3 A;  5E1X A;  2Z3Y A;  3NRV A;  4UXN A;  2V1X A;  2HYG D;  2JZY A;  2Z9O A;  1XCB A;  1MJB A;  1O3S A;  4EM1 A;  1QBJ A;  3EUH A;  3L00 A;  2DQL A;  1B4A A;  1FBU A;  2ESH A;  2O8X A;  3SZP A;  5D8L B;  5F64 A;  4Q48 A;  1IN6 A;  3FXQ A;  1E17 A;  1JE8 A;  2Z5U A;  3Q9V A;  3U9G A;  3FWE A;  3F8N A;  3WGI A;  2XRO A;  1EH6 A;  5BOX A;  2OA4 A;  2HOE A;  2A07 F;  4PGG A;  1LVA A;  3BRO A;  2BEO A;  3V4G A;  4AVP A;  4AIK A;  3RYR A;  1K78 B;  3WU0 A;  3KP3 A;  2EA4 A;  2PJP A;  3KP4 A;  4Y17 A;  1G3W A;  2L54 A;  2GAU A;  4BNC A;  3QU6 A;  3C3W A;  1P92 A;  4P55 A;  5L3F A;  1DUX C;  4WXD A;  2R3S A;  1ZHF A;  2V79 A;  4Y15 A;  4KN4 X;  4IPA A;  3V8J A;  1J59 A;  1R5H A;  1P2F A;  2EFP A;  1S7A A;  1TQM A;  4ZYD A;  2Q0O A;  2A69 F;  2OZU A;  4UNO A;  4HDV A;  1SD5 A;  2HZT A;  3BPV A;  2DO7 A;  1L0O C;  2W84 A;  3HOT A;  4OOI A;  3I58 A;  4A2U A;  1MGT A;  3ABU A;  1HSJ A;  4O5V A;  1F1Z A;  1AOY A;  2H6C A;  4KIG A;  1FZP B;  3F8B A;  4IJA A;  5H6R A;  5H6Q A;  5KVR A;  3Q9S A;  3O2P E;  5AIP A;  3L2C A;  5HDK A;  4HBL A;  3F8M A;  3IWZ A;  4A0X A;  1I27 A;  1SMY F;  3B02 A;  5J8C A;  1I5Z A;  1QPM A;  4EGY A;  5IT9 K;  4TV7 A;  5ILU A;  2OQR A;  1G6N A;  4L9N A;  3WE2 A;  3KP7 A;  4GYG A;  3TQN A;  2EK5 A;  1BBY A;  3MEX A;  1XGN A;  2FXA A;  5FLX K;  2ISZ A;  1XMA A;  3QP6 A;  2YU3 A;  1EH8 A;  1IW7 F;  4U7D A;  3N4M A;  5CVU A;  1OKR A;  5D5V B;  3K69 A;  2DAO A;  2RVC A;  1QGP A;  4IVN A;  4IHS A;  2CG4 A;  1O3Q A;  2A6H F;  3J81 K;  3DEU A;  2FRH A;  2KRF A;  4CDG A;  1NHA A;  2W57 A;  4OU0 A;  3GO5 A;  1D8J A;  3R0A A;  4OIR F;  1Z7U A;  3HRM A;  4L18 B;  1B59 A;  4WK8 F;  1B9M A;  4MQV A;  2E7X A;  3I4P A;  3NEU A;  2G7U A;  2FBK A;  3SHF A;  2ZJ2 A;  4M6Y A;  1KA8 A;  4JBA A;  4N9H A;  2VON A;  3PFI A;  3K1P A;  4G7O F;  2XIG A;  1KGS A;  1YS6 A;  2RC4 A;  3WGG A;  1ZGJ A;  1YW7 A;  3ZN0 A;  1FWZ A;  5E18 F;  2FA5 A;  2K4B A;  4YFX F;  3KZZ A;  2MH2 A;  1SFX A;  3ZMS A;  4L9T A;  5HS9 A;  2UZK A;  2QQ9 A;  2RN7 A;  5TJJ A;  5A2Q K;  3FMS A;  3GLX A;  2Q8K A;  3TKY A;  1R36 A;  2QZ8 A;  3BY6 A;  2XVC A;  2NYX A;  2DW4 A;  5HOO A;  5IT9 Z;  3JSP A;  4KMU X;  3R4K A;  2V1D A;  1YS7 A;  4BAY A;  2DBB A;  4HDU A;  4FHT A;  1J2X A;  3IHU A;  4NB5 A;  4R1H A;  3BP8 A;  3ZMZ A;  4PDK A;  1FYK A;  2EA2 A;  2PLY A;  3CO6 C;  3E97 A;  5FLX Z;  2Z99 A;  4ENJ A;  3QPT A;  4P5O A;  2ZO4 A;  5AIQ A;  2K27 A;  2P6T A;  1P6R A;  3DF8 A;  4UVB A;  3GEZ A;  1S29 A;  3J7A O;  1PUE E;  1RUO A;  4CXF A;  3IKV A;  3WTW C;  3J81 Z;  2VBX A;  1UST A;  1U5T C;  5HS8 A;  3P9K A;  5EEH A;  5DYM A;  2DK8 A;  4U0V A;  5HVQ C;  3VFZ A;  3J80 K;  1IZ1 A;  1HST A;  2AS5 F;  2Y48 A;  4CGZ A;  2GA2 A;  4Z2Y A;  1J75 A;  1X3U A;  5ICF A;  2VOO A;  1FBQ A;  2VN2 A;  5D6F A;  2HDC A;  3FZV A;  1XGS A;  5DUI A;  2FQ3 A;  1FLI A;  1DDN A;  2MA3 A;  3KP2 A;  3SZT A;  3T8R A;  2JTV A;  3E5Q A;  1KU7 A;  1H9T A;  4LK0 F;  1J9I A;  1TW2 A;  5BQT A;  4B09 A;  1FY7 A;  2L4M A;  5FD6 A;  4ON0 A;  1KU3 A;  4RB1 A;  4L0Z B;  2YR2 A;  2MBF A;  4I98 B;  2DTR A;  5A2Q Z;  2HTJ A;  2ZKZ A;  5BS6 A;  1ZG5 A;  4ZZL A;  1ZAO A;  2NRA C;  2FOK A;  1STZ A;  2XAQ A;  2PG4 A;  1XSV A;  2R7D A;  1R1U A;  4XBF A;  3HRT A;  3IRQ A;  1IXR C;  2E1N A;  3KLN A;  3ECH A;  1YYV A;  2B0L A;  1FOK A;  1ZRE A;  4M74 A;  2MD5 A;  5LHH A;  3HYI A;  2DQR A;  4LLG F;  5JR3 A;  4CYD A;  3QRF F;  2QQA A;  1JHF A;  3TOB A;  1RI7 A;  3ISP A;  4IXA A;  3KEO A;  3LFK A;  1U6G A;  4L9J A;  2Z33 A;  2EFQ A;  2YSR A;  2H09 A;  5CVR A;  3RJP A;  3J80 Z;  4GGG A;  3WU1 B;  4HV5 A;  2ISY A;  5D4R A;  4CIC A;  3CUQ B;  3T0Y A;  1YG2 A;  1UHM A;  1AWC A;  1IF1 A;  5ICE A;  2G7H A;  4ESJ A;  4Q47 A;  4RB2 C;  1J7K A;  5D5W B;  3LAP A;  2PFB A;  4O3M A;  3V8K A;  5E1W A;  3HIF A;  4EGZ A;  2P5V A;  4ZYH A;  5CLS A;  3I59 A;  3QOP A;  1YFH A;  4D0P A;  5D5U B;  3GX4 X;  5L3E A;  1WI9 A;  1BI3 A;  3KFW X;  5HDG A;  2X4H A;  1BIA A;  4B8X A;  5LRR A;  2O61 A;  1LJ9 A;  4AIJ A;  2PN6 A;  2A6E F;  2DI3 A;  1Z05 A;  2VXZ A;  4U0W A;  1O7F A;  2HTS A;  3WTS C;  3BZ6 A;  2HWV A;  5K1Y A;  5DV5 A;  3ZP5 A;  4CZZ A;  3BPX A;  3I59 B;  5ILS A;  3L9F A;  1KYZ A;  2HGC A;  1R00 A;  4ZYE A;  3DXJ F;  4EVI A;  1RUN A;  3CLO A;  4I09 A;  4EJW A;  4A0Z A;  1TW3 A;  1R1T A;  3BOQ A;  1IAW A;  5ILV A;  1R7J A;  6PAX A;  1T6S A;  1IN4 A;  2M87 A;  4LG0 B;  5J6X A;  3ZQ7 A;  2QUF A;  2QEN A;  3BJA A;  1BN5 A;  3LA7 A;  4M73 A;  2AXL A;  4GCV A;  1F4K A;  3E3V A;  2F5E A;  5LGN A;  1ZRF A;  5BMZ A;  2BYV E;  1MKM A;  1K78 A;  2J5O A;  1W7P D;  1SD7 A;  2CYY A;  3TO7 A;  2PMH A;  4ASN A;  2VE8 A;  3O3K A;  3WOD F;  1WKM A;  1WQ2 A;  3EET A;  2RQP A;  1PP7 U;  2Y75 A;  1OPC A;  5L3C A;  1KQ8 A;  1D5V A;  1V3F A;  3TGN A;  1UCR A;  5JI6 A;  2P5K A;  4AWX B;  3HUG A;  3ZN1 A;  5FGM A;  4LD5 A;  3K1N A;  1FSH A;  3F21 A;  1K79 A;  3HTS B;  2NNY A;  2LF8 A;  1USS A;  2D45 A;  1HBX G;  3MFK A;  2GQQ A;  3ZMU A;  1U3E M;  4FT8 A;  2FBH A;  4EMS A;  3C18 A;  1Z6R A;  3S2W A;  4EQQ A;  2XAG A;  1L3L A;  1IRG A;  2GA1 A;  2BBY A;  4OIP F;  1ZN2 A;  3E5X A;  5K5R A;  1O7L A;  3M9A A;  5CVJ A;  4BQA A;  5DDG A;  2M1B A;  4EM0 B;  5EEG A;  3DPL C;  3FMQ A;  5DEQ A;  2YX7 A;  1T39 A;  5CJ9 A;  2TDX A;  3GFI A;  3GVA A;  4HA8 A;  3IKT A;  3FF5 A;  2W25 A;  1TBX A;  3M8E A;  2P7C B;  1MDM B;  4UV8 A;  4EJU A;  2STT A;  1QQI A;  2XV4 S;  3R60 A;  4MNU A;  3LWF A;  2UXX A;  4LB5 A;  1WRJ A;  1TTY A;  3WGH A;  3AAF A;  4M6X A;  4IRI A;  3FXR A;  3WG9 A;  3W6K B;  2P7V B;  3L7W A;  2ZME B;  3MAJ A;  3V7S A;  3T1B A;  1YTY A;  2VBZ A;  2NAZ A;  4BXU A;  1B9N A;  2VT2 A;  2XAS A;  1W7P B;  1Z9C A;  3ZMT A;  3GFL A;  3REO A;  3GUD A;  1RNL A;  1IXS B;  3KE2 A;  4HOB A;  1A04 A;  3HSE A;  2RV8 A;  2DLL A;  1LQ1 A;  1ULY A;  5LHG A;  3NQO A;  2NS0 A;  4P96 A;  2DK5 A;  3CTA A;  1XN7 A;  4L5J A;  4M71 A;  1R1V A;  2L3D A;  3V7R A;  5E8G A;  5LHI A;  3I54 A;  3F6V A;  3GFJ A;  1OMI A;  3KP6 A;  4BHP A;  4H0E A;  2ZBK A;  3WTZ A;  1EH7 A;  4WF2 A;  2EB7 A;  2OQG A;  1FP1 D;  3DFG A;  2HEO A;  5E1Z B;  4HV6 A;  3BJO A;  3WTV C;  1MJ9 A;  5L3D A;  3V8L A;  5HLH A;  2H94 A;  2VT3 A;  3GXO A;  3E6D A;  1P4W A;  3QAH A;  4Q4Z F;  1ZAR A;  2ZNZ A;  2QVO A;  1ZG3 A;  3MQ0 A;  1W5S A;  2CQK A;  4MTD A;  4IF4 A;  3RYP A;  4K2E A;  1FYL A;  4R8H A;  1WSU A;  2D2W A;  1ODD A;  2UXN A;  3HOS A;  5LRS A;  1G3S A;  3EYY A;  2O0Y A;  2OAZ A;  1W5T A;  5CVI A;  2P4W A;  5TRD A;  2EFW A;  2CFX A;  3HRS A;  2FU4 A;  1F5T A;  2XAF A;  3U1D A;  5LEK A;  4N0B A;  5ICC A;  4DQ2 A;  3OV8 A;  1KU9 A;  3ROU A;  3FXU A;  1J5Y A;  2FEZ A;  3TO6 A;  2JSC A;  5AON A;  2PQ8 A;  1J0R A;  1LNW A;  4HQE A;  4GXO A;  3TOA A;  4P9U A;  4N9I A;  1YW9 A;  5KK1 A;  3ML6 A;  1GVJ A;  1HXD A;  3I64 A;  3QP5 A;  3QU3 A;  1E2X A;  1IN8 A;  4EJO A;  2KKO A;  1Z6T A;  3E6B A;  4WXH A;  4KT5 C;  2LDU A;  4RGS A;  1HKT A;  2ETH A;  2KIU A;  3W6J B;  4A5M A;  2BGC A;  3KCC A;  1R5G A;  4U0Y A;  3GFM A;  1CF7 B;  2EJR A;  1FT9 A;  4JK1 X;  2XUB A;  1G4D A;  2IA2 A;  4HF0 A;  3KLO A;  1FSE A;  1HW1 A;  5K5Q A;  2M30 A;  2O03 A;  2XAJ A;  1YLF A;  1Y0U A;  3TDU C;  4KFC A;  1XCV A;  1I1G A;  2CGP A;  2M5W A;  4L5I A;  2QWW A;  1OYI A;  2KJC A;  3CJN A;  2OBP A;  1TNS A;  2FNA A;  3HHH A;  4ENM A;  3RI4 A;  1REP C;  1LEA A;  3JTG A;  2JPB A;  3LST A;  2Y0M A;  1H9G A;  2E1C A;  2F2E A;  1ONV A;  4A12 A;  5ERI A;  2XHK A;  2HR3 A;  2EFN A;  2PEX A;  4LFU A;  4ETS A;  3F72 A;  1IXC A;  2A68 F;  4P9F A;  2RNJ A;  4M9X A;  1TQI A;  2P5L C;  3JSO A;  1K7A A;  2W85 A;  1R58 A;  3WE3 A;  4M9Z A;  4NQW A;  2F5C A;  3H3Z A;  1HKS A;  3IRR A;  1XD7 A;  1XDU A;  2CSO A;  2QBY B;  2MLG A;  4GO1 A;  4RS8 A;  2K7L A;  2ZFW A;  3COA C;  1FX7 A;  3CUQ A;  2VOP A;  4HX8 A;  3BWG A;  2GIV A;  3N97 A;  3DKW A;  4MEY F;  3FHZ A;  2IRF G;  3WTY C;  4A6E A;  3QPH A;  5E20 A;  1KU2 A;  4YFK F;  4Q5S F;  5LGT A;  4RAY A;  3DP7 A;  4NHJ A;  2EV6 A;  3F8F A;  3E5U A;  2OU2 A;  3SXY A;  3EDP A;  1I1S A;  3F8C A;  2DU9 A;  5D5X B;  1QO0 D;  2JT1 A;  1ZRD A;  3C7J A;  5HS7 A;  3HSF A;  4UVA A;  1VTN C;  1Q1H A;  1T2K A;  3B73 A;  3LQQ A;  1S8N A;  3RTR A;  2K4J A;  1G3Y A;  4YFN F;  4KIC A;  2H27 A;  2K02 A;  1JGS A;  3RPU A;  1OYY A;  2FNP A;  4LG0 A;  2MH9 A;  2LNB A;  2M45 A;  4BHB A;  4G9Y A;  3MZH A;  1DP7 P;  2R7F A;  4LLN A;  1PP8 F;  1P4X A;  5F6F A;  5D4S A;  2FF4 A;  4PCQ A;  3EQL F;  1I6X A;  2X0L A;  4KIB A;  1YQA A;  3P9C A;  4O6J A;  3MZY A;  3ZMD A;  1HKQ A;  1FPQ A;  1UHW A;  1ON2 A;  2D1H A;  1ZRC A;  2VBY A;  2BE5 F;  1XGM A;  4ZZD A;  3BDD A;  4YIF A;  3LQR A;  2HS5 A;  2ZXJ A;  5DCM B;  1ZH5 A;  1FBS A;  1YIO A;  2F5D A;  3CO7 C;  2FML A;  1CGP A;  4Y13 A;  3CUO A;  5L3B A;  3VOD A;  1W4M A;  2DT5 A;  4HLY A;  1XGO A;  1RZ4 A;  1O3R A;  4HF2 A;  2QYO A;  4ENN A;  2NNN A;  4UV9 A;  1PDN C;  2V1U A;  2GWR A;  1G3T A;  5FFX A;  2CW0 F;  4RGR A;  3SQN A;  3ERE D;  2EV0 A;  5LGU A;  3Q5F A;  2VC0 A;  4WXC A;  2WV0 A;  1U78 A;  1U5T B;  4RB3 C;  2DPD A;  4BYY A;  4CHU A;  1Z91 A;  3LA2 A;  2UWM A;  1KQ0 A;  4S05 A;  4M72 A;  1TLH B;  3I71 A;  4KYW A;  3RKW A;  4MEX F;  3GW2 A;  3RKY A;  1SD6 A;  3KEQ A;  2PBI A;  2DPU A;  3RIR A;  1MDM A;  1ZLK A;  5HLI A;  4HX7 A;  3E6C C;  4IRH A;  3RPQ A;  3HTU A;  4XLP F;  4HYE A;  2ZME A;  3H3U A;  2FBI A;  2IJL A;  4LLL A;  2ADU A;  1QZZ A;  4A5N A;  2XAH A;  1W7P A;  2YX4 A;  3VB2 A;  2K86 A;  3RDI A;  3D5L A;  1LDJ A;  1V4R A;  1FNN A;  4DNC A;  1OR7 A;  3KZY A;  4OMZ A;  1SAX A;  2HKO A;  5E8I A;  4U88 A;  3WTT C;  1ZYR F;  3HHG A;  3E6M A;  4I02 A;  4G6Q A;  2QLZ A;  1BI0 A;  3GF2 A;  5CVV A;  2A5Y B;  4BH9 A;  4WCG A;  3G73 A;  2RGV A;  3T8T A;  4XLN F;  3RKX A;  4CO8 A;  1TNT A;  3PQJ A;  5J8F A;  2F5F A;  4OIO F;  1D3Y A;  1Z1D A;  2P8T A;  2G9W A;  5BPD A;  4UHT A;  4HAM A;  1RIO H;  4XRF A;  5L3G A;  1ZG1 A;  3K9T A;  5FO5 A;  5ED4 A;  4RGX A;  1XDS A;  3D0S A;  2WWY A;  3CUQ C;  4HW0 A;  5IT3 A;  2O6G E;  3FM3 A;  3O6B B;  1SFU A;  2IA0 A;  4I7H A;  3DQV C;  4EV0 A;  3ZMV A;  2YPR A;  1P4A A;  4EM2 A;  1ZGA A;  2HKX A;  1U8R A;  1HQC A;  5D8K B;  3ULQ B;  2STW A;  2WC2 A;  3VEP A;  4KA4 A;  1BIB A;  5HLG A;  4OIQ F;  1XSX A;  2C6Y A;  4KN7 X;  1D8K A;  5LBQ A;  2IA1 A;  3F22 A;  4MTE A;  1O57 A;  4I0B A;  3V7C A;  4IHT A;  4LMY A;  1T98 A;  3WTU C;  1R23 A;  4PZJ A;  2CWE A;  3ECO A;  4QWQ A;  2L01 A;  4L9V A;  1LB2 A;  4KDP A;  4UVC A;  4S04 A;  1BI1 A;  4MQ9 F;  2JRT A;  1BM9 A;  4I0A A;  4EJT A;  3IC7 A;  4G6D A;  4WX9 A;  1IN7 A;  1S3J A;  4JQF A;  1R22 A;  3C1D A;  3BJ6 A;  2EV5 A;  5DCF A;  2H6B A;  3U2R A;  1IN5 A;  5ICG A;  4G94 A;  3K2Z A;  3KP5 A;  1F9N A;  4XSX F;  1SMT A;  2VC1 A;  3LAJ A;  1CF7 A;  1KYW A;  4A0Y A;  4HX4 A;  4AIH A;  2IT0 A;  4UUV A;  3I53 A;  4OMY A;  2HFH A;  3ELK A;  2QQB A;  1K6O A;  2VE9 A;  1EV7 A;  3JAM K;  1DPR A;  1HW2 A;  1FC3 A;  2W24 A;  1BC8 C;  2MLK A;  2VOD A;  4F7Z A;  3R61 A;  2KIM A;  3DPT A;  5FB2 A;  1SFE A;  2VBW A;  2IPQ X;  2WTE A;  4EJV A;  1YO5 C;  4MHG A;  4KMF A;  3MCZ A;  3GWZ A;  4L0Y B;  3WTX C;  1QNT A;  1GXP A;  1FYM A;  5JVT A;  4MGR A;  4G8X A;  1S7O A;  5DUK A;  5DD8 A;  2PMU A;  2EWN A;  2DFI A;  3EYI A;  1WWX A;  5LLQ A;  1OYW A;  1S6L A;  3MWM A;  4M9S A;  2QBY A;  3LA3 A;  3PQK A;  2A3S A;  2OZ6 A;  2L02 A;  4QLC U;  1LEB A;  2BV6 A;  3CDH A;  4A6D A;  3F23 A;  2V6C A;  3ZPL A;  4RAZ A;  5BPI A;  3FX3 A;  5HDN A;  4OIN F;  3ABT A;  3L09 A;  4LB6 B;  2PI0 A;  1ON1 A;  5F1R A;  1BC7 C; 
#chains in the Genus database with same CATH topology
 1SD4 A;  1GXQ A;  2WAQ A;  2ZXW H;  1ENH A;  4I2O A;  1TWC J;  3M1E A;  3GZN B;  3LSH A;  3K70 D;  2ME0 A;  2DA7 A;  3M8F A;  4KUM A;  2R7O A;  2XKO A;  3OOP A;  2KT0 A;  2NVQ J;  4KNY A;  2M8E A;  3K1M A;  4R79 A;  4IKF A;  2E7W A;  1IUY A;  4UB8 C;  2COM A;  4HPQ A;  2KRC A;  4BU2 A;  3GTG J;  3Q0U A;  3CZ6 A;  3P7N A;  3JW4 A;  1UB9 A;  1T38 A;  1MZB A;  5LEJ A;  1O4X A;  5EJC A;  4DBR A;  1X19 A;  1MJA A;  2XGX A;  2RRE A;  5E3L A;  5E17 F;  2FSW A;  3R0J A;  4LJZ F;  3GZ5 A;  4ZDP A;  2ZME C;  1VFC A;  1LE8 A;  1B6A A;  1W0T A;  3M8J A;  3TP3 A;  3TO9 A;  1QVT A;  5JHU A;  2P6S A;  4I01 A;  2IW5 A;  3R6S A;  4CYC A;  3ASN H;  4XMY A;  4YII A;  3FM5 A;  3JAM Z;  3GZ6 A;  4G7Z F;  3F6O A;  2VKV A;  4J00 A;  2LY2 A;  2WY7 Q;  3MZ8 A;  2F4M B;  1C0W A;  2Q1Z B;  3FKJ A;  2LSO A;  2ACJ A;  1WJA A;  2OD5 A;  1Y1W J;  1FMV A;  2ESN A;  5FKO A;  4ZJZ A;  4BQO A;  2HYF A;  5DD4 A;  5IP9 J;  1BI2 A;  1H0M A;  2LF7 A;  2Y0S A;  2F4I A;  3JTH A;  2KIF A;  4HLX A;  1N75 A;  4FET A;  5GAG J;  4RGU A;  3ERM A;  4RB0 A;  4HQM A;  4HZF A;  4ZH4 F;  1B1B A;  3BR1 A;  3VOE A;  1UFM A;  2O3F A;  4XRM A;  3RCO A;  2ZNY A;  3HRU A;  3I5U A;  3ZQG A;  5K5O A;  3IL2 A;  5GP9 A;  5GAD J;  2KHM A;  2ZSI B;  5J4V A;  1HA8 A;  4N4N B;  4JOM A;  3G4S I;  2GXB A;  2ZCW A;  2ELK A;  2Y9Y A;  1ZR4 A;  2V4J C;  1IV6 A;  1XB4 A;  3JRI A;  1FOY A;  2HOS A;  2KJB A;  2W48 A;  1PYV A;  5FFZ A;  3ZOB A;  5CYV A;  3F3X A;  3CCQ I;  1EF4 A;  2W7N A;  3OYL A;  5DCM A;  1YW8 A;  3VYR B;  1D5Y A;  5CPR B;  1AKH A;  3GYH X;  1KQ9 A;  2GXG A;  2Q2E A;  2QEX I;  5EGO B;  3C2H A;  4PJ0 C;  1JHH A;  3ZGK A;  5FD5 A;  1BJA A;  4ESF A;  2QM3 A;  2GIZ A;  4AD9 A;  3OYE A;  2H1L A;  2HQR A;  3VPR A;  2KFD A;  4FX4 A;  3M7G A;  1K6Y A;  4JX6 A;  4U7B A;  1GHC A;  3HZJ A;  4XLA A;  2O7O A;  1O3T A;  2O5R A;  4E4H A;  2RDP A;  1IV8 A;  1JXS A;  2RKH A;  1AHD P;  1T0F A;  4ZYG A;  4GYI A;  2XRN A;  3OY9 A;  1RC9 A;  4J01 A;  3QWL A;  4LGW A;  4BAC A;  4XSZ F;  2IEK A;  2WB1 N;  2PX9 A;  3FK6 A;  3IWF A;  3BG9 A;  2KLO A;  5FRM A;  4YG2 F;  2E1M C;  4G7H F;  4ENK A;  1IRF A;  2ELH A;  3FXK A;  2JPC A;  2JN6 A;  4E7J A;  1TC3 C;  3I0T A;  2V9V A;  3LSG A;  3OYH A;  1DPU A;  3HSR A;  5D6E A;  2L4A A;  4IL6 C;  2VPL A;  2LKP A;  2FE3 A;  2KL4 A;  4BKX A;  3G3Z A;  3P9I A;  1LPQ A;  2VPR A;  1OCR H;  4E70 A;  2EBI A;  4PSW A;  2JA6 J;  3MKL A;  1R4N B;  2IP2 A;  1FP2 A;  1QZY A;  2FMY A;  3QYB A;  4WWC A;  1MD0 A;  1XMK A;  3FMR A;  2DFH A;  4PGH A;  1LDK B;  1HW5 A;  5C3E J;  4HF1 A;  1XSD A;  2HQN A;  1YRN A;  1A5J A;  1IDZ A;  2EFO A;  4X0G A;  4BJ5 C;  1JT6 A;  3CDL A;  2CQQ A;  1YE9 A;  1U5T A;  2XKP A;  3DTK A;  1P7J A;  2A61 A;  3K4J A;  3KET A;  2Z1D A;  1ZLJ A;  3S1R J;  4FX0 A;  2MW8 A;  4ZTJ A;  4M3B A;  1MIJ A;  5H20 A;  1U2W A;  2LH9 A;  1OCT C;  1TQP A;  2D5V A;  3C2G A;  2UUZ A;  4D5C A;  5JLX A;  3O8G A;  2R7V A;  2J5P A;  2HOA A;  2IVM A;  2MYS A;  2GZW A;  4A3F J;  3ZRG A;  4ESB A;  3QYF A;  1BOA A;  4IRG A;  4BHC A;  3TW6 A;  3DV8 A;  2D1V A;  4YIR X;  3H92 A;  3BLY A;  3SFZ A;  3T5X A;  3TDZ C;  3K0L A;  4LK1 F;  4KIF A;  5JFR A;  1LDD A;  2CO5 A;  5K7H A;  2K3P A;  2MC3 A;  2DOA A;  5E1X A;  5FJ8 J;  3HKZ N;  1XC5 A;  1SFK A;  2Z3Y A;  3NRV A;  4UXN A;  2V1X A;  2HYG D;  3QQA A;  3G1M A;  2JZY A;  2Z9O A;  2R7Z J;  1YRN B;  3CC2 I;  1XCB A;  1MJB A;  5FLV A;  1O3S A;  1R4M B;  2CV0 A;  4EM1 A;  1QBJ A;  2L9R A;  3EUH A;  3L00 A;  2DQL A;  1B4A A;  3DCF A;  1FBU A;  2ESH A;  2JSP A;  3DEW A;  1HOM A;  4PJM A;  2O8X A;  3JRH A;  3SZP A;  2VB6 A;  5D8L B;  5F64 A;  4Q48 A;  4RAF A;  1IN6 A;  3FXQ A;  1E17 A;  4BEH B;  2JVH A;  2Z5U A;  3Q9V A;  1JE8 A;  3U9G A;  3GTP J;  2NVU B;  3FWE A;  3F8N A;  5EG0 B;  3WGI A;  2XRO A;  5HNH A;  1EH6 A;  5BOX A;  2OA4 A;  2HOE A;  2A07 F;  2X1D A;  1R9T J;  4PGG A;  1LVA A;  1MNE A;  3BRO A;  3VYT B;  5EEA A;  1NK2 P;  2BEO A;  3V4G A;  4AVP A;  4AIK A;  3RYR A;  1K78 B;  3WU0 A;  3KP3 A;  2EA4 A;  3LSJ A;  2P81 A;  3ABL H;  2PJP A;  2FX0 A;  3KP4 A;  4Y17 A;  3CCR I;  3KYD B;  1G3W A;  2L54 A;  2GAU A;  4BNC A;  1H88 C;  3PNT A;  3BG7 A;  4M3E A;  3QU6 A;  4Y4R A;  3C3W A;  3A02 A;  1P92 A;  4P55 A;  5L3F A;  1DUX C;  4WXD A;  4UUS A;  5B3S H;  2R3S A;  2LRD A;  1ZHF A;  2L2O A;  5IP6 A;  1JGG A;  2OUM A;  2V79 A;  4Y15 A;  3BR2 A;  4KN4 X;  1XPX A;  4IPA A;  2JWT A;  4H4K C;  1OCP A;  1Z3Y A;  3V8J A;  4C2M J;  1J59 A;  1R5H A;  1P2F A;  5FKM A;  2LMD A;  2EFP A;  4XOP A;  1S7A A;  1TQM A;  4ZYD A;  1OCZ H;  2Q0O A;  3JCU C;  1IGN A;  2A69 F;  3S93 A;  2YUS A;  3HUG B;  2DYS H;  4CZC A;  2DTZ A;  2OZU A;  2IGK A;  4UNO A;  4HDV A;  3MD2 A;  1JKQ C;  1SD5 A;  2E1O A;  2HZT A;  2MFZ A;  2DO7 A;  3BPV A;  5CQE A;  3JRA A;  3DU6 A;  1YJN I;  1L0O C;  1IG7 A;  4IHY A;  4LIT A;  3BZK A;  4UB6 C;  2W84 A;  3HOT A;  5B5E C;  2BY3 A;  4OOI A;  2DDB A;  3I58 A;  2XB0 X;  4A2U A;  3DEE A;  3PO2 J;  1MGT A;  2H8R A;  5F27 A;  1Y8Q B;  5GPC A;  3ABU A;  4EEF G;  4A3E J;  1HSJ A;  4O5V A;  1F1Z A;  2VIX A;  1AOY A;  2X1E A;  2H6C A;  1N77 A;  4KIG A;  4A3C J;  2E71 A;  1FZP B;  3F8B A;  4IJA A;  5H6R A;  3CC4 I;  2JA7 J;  3FXM A;  5H6Q A;  5KVR A;  1TWH J;  3Q9S A;  3O2P E;  5AIP A;  2XAU A;  3L2C A;  5HDK A;  2M9H A;  4HBL A;  4E7S A;  3F8M A;  3IWZ A;  4A0X A;  4RLF A;  1I27 A;  1E0E A;  1SMY F;  2LP0 A;  2IGM A;  2GBY A;  3B02 A;  5J8C A;  1I5Z A;  1QPM A;  4EGY A;  2DA4 A;  5IT9 K;  4TV7 A;  3VSL A;  5FRN A;  5ILU A;  2OQR A;  2OCC H;  1G6N A;  1Y39 A;  4L9N A;  1QVU A;  4C2T A;  3SDG A;  4ZTF A;  3WE2 A;  3KP7 A;  4GYG A;  3W2V A;  2DJI A;  1A31 A;  2BXZ A;  3TQN A;  2EK5 A;  1OFC X;  3ZQQ A;  3CCJ I;  1BBY A;  3MEX A;  1XGN A;  2FXA A;  4XNF A;  5FLX K;  2ISZ A;  1XMA A;  1A35 A;  3QP6 A;  2YU3 A;  1EH8 A;  1UG0 A;  1IC8 A;  1IW7 F;  4U7D A;  3CMY A;  2XSJ C;  4DYC A;  3N4M A;  5CVU A;  1OKR A;  5B1B H;  2PJR B;  5H2F C;  2XRL A;  3K69 A;  3K10 A;  5D5V B;  2DAO A;  1N25 A;  2RVC A;  1G8X A;  1QGP A;  4IVN A;  4IHS A;  2LFB A;  2CG4 A;  2CRG A;  3CCU I;  3IP4 B;  1DU0 A;  1O3Q A;  4S0H B;  2A6H F;  2ID3 A;  3J81 K;  4A3D J;  3DEU A;  2FRH A;  1MNM C;  2KRF A;  4ITV A;  1X4O A;  4CDG A;  1NHA A;  2W57 A;  4OU0 A;  3CCM I;  3GO5 A;  3SYT A;  3G1L A;  2DA3 A;  3PUF A;  1D8J A;  3R0A A;  2LLK A;  2M0C A;  4OIR F;  1Z7U A;  2WAE A;  2NS8 A;  3LFU A;  3HRM A;  4L18 B;  1B59 A;  3G6E I;  2JA2 A;  4J19 A;  4WK8 F;  1B9M A;  4MQV A;  2E7X A;  2VQL A;  1SVO A;  2XGC A;  3I4P A;  3NEU A;  4BDZ A;  2G7U A;  4C30 A;  2FBK A;  3OWT A;  2ZJ2 A;  4M6Y A;  3SHF A;  1KA8 A;  1HDP A;  3ZXS A;  2JJ7 A;  4JBA A;  4N9H A;  3CCL I;  1YIT I;  1PUF A;  2VON A;  3PFI A;  3K1P A;  4G7O F;  2XIG A;  2RAE A;  1KGS A;  1YS6 A;  2RC4 A;  2E2J J;  1VQK I;  3WGG A;  1ZGJ A;  3J7Y J;  1YW7 A;  3ZN0 A;  1FWZ A;  1IJW C;  2CU7 A;  5E18 F;  3A01 A;  2FA5 A;  2K4B A;  1X2M A;  4YFX F;  3KZZ A;  2AO9 A;  2HQA A;  2MH2 A;  1SAN A;  5J1U A;  1SFX A;  2CQN A;  1Y1V J;  3ZMS A;  2MG4 A;  1K4S A;  4L9T A;  5HS9 A;  2R7Q A;  4XK4 A;  2UZK A;  3DKX A;  3Q0V A;  4V2F A;  3IV5 A;  2QQ9 A;  2RN7 A;  5TJJ A;  4Y33 A;  3VSK A;  5A2Q K;  2ELJ A;  3TW7 A;  4D7N A;  3RQI A;  3FK7 A;  3FMS A;  3GLX A;  2Q8K A;  3TKY A;  1R36 A;  2QZ8 A;  3BY6 A;  2XVC A;  5M3F J;  3W2W A;  2NYX A;  2DW4 A;  2M7B A;  5HOO A;  5IT9 Z;  3PFY A;  3JSP A;  4KMU X;  3A03 A;  3R4K A;  1T0F C;  2V1D A;  1YS7 A;  4BAY A;  4PK4 A;  2DBB A;  4HDU A;  2E60 A;  3F0C A;  3OS1 A;  3HOU J;  4FHT A;  2VLA A;  1J2X A;  3IHU A;  4DJA A;  4NB5 A;  4R1H A;  2R7S A;  3BP8 A;  4BUP A;  1K61 A;  3ZMZ A;  4PDK A;  1FYK A;  2EA2 A;  2EPF A;  2PLY A;  2X6O A;  3CO6 C;  1E3H A;  3E97 A;  1XG1 A;  5FLX Z;  1WJF A;  2Z99 A;  3K6G A;  1XX5 A;  4ENJ A;  4HNU A;  3BQZ A;  2NOJ B;  3QPT A;  2EZK A;  2CJJ A;  1TZL A;  1OLT A;  3ABM H;  2WA0 A;  4P5O A;  2ZO4 A;  1WPK A;  5AIQ A;  2K27 A;  2L9N A;  2P6T A;  3V42 A;  3UKG A;  1P6R A;  3DF8 A;  1V5G A;  3GEZ A;  4UVB A;  4A93 J;  1S29 A;  1QRY A;  4CCJ A;  1PUE E;  4IOC F;  3J7A O;  1QPI A;  4PJJ A;  1RUO A;  4CXF A;  3IKV A;  3WTW C;  1UJ8 A;  4BXF A;  4PSX A;  1A6Q A;  3S1M J;  3J81 Z;  2VBX A;  4M3F A;  1UST A;  1U5T C;  1X3W B;  5HS8 A;  3P9K A;  5EEH A;  5DYM A;  2MGQ A;  3SDB A;  2DK8 A;  4U0V A;  5HVQ C;  3CMM A;  3VFZ A;  1IZ1 A;  2TRT A;  3J80 K;  1I3Q J;  1ZTR A;  4PJL A;  1HST A;  4UUT A;  2IS4 A;  2AS5 F;  2JVG A;  3AKZ A;  2XGD A;  3HEF A;  2Y48 A;  2LKX A;  4CGZ A;  2ECB A;  2GA2 A;  4Z2Y A;  1J75 A;  2L0K A;  1H8A C;  2MSY A;  4BGD A;  2EQR A;  1X3U A;  3BG3 A;  4UY8 I;  1IUF A;  5ICF A;  4F52 A;  2DN0 A;  1Z7L A;  3FXJ A;  2VOO A;  1V5F A;  4G6T B;  3X2Q H;  5DM7 F;  4IHX A;  1FBQ A;  2VN2 A;  2XC7 A;  1IDY A;  1S7E A;  5D6F A;  2H8W A;  1UEL B;  2HDC A;  4C9Y A;  3FZV A;  1XGS A;  1JUM A;  5DUI A;  4XKW A;  1ETV A;  2FQ3 A;  1R49 A;  3B6A A;  1FLI A;  1DDN A;  4HST A;  2CW8 A;  1IRX A;  3GTM J;  2DA2 A;  3EUH C;  2MA3 A;  2R4G A;  3KP2 A;  1QU3 A;  3SZT A;  3T8R A;  2JTV A;  3E5Q A;  3S3N A;  2EIN H;  2NVY J;  4LK0 F;  1GT0 C;  1H9T A;  1KU7 A;  1D1A A;  3CP2 A;  1J9I A;  5F0H A;  4QPO A;  1TW2 A;  2XDV A;  3BCA A;  1Q1V A;  4B09 A;  5BQT A;  1FY7 A;  2L4M A;  2L5Q A;  5FD6 A;  4CH7 A;  2HVS A;  4ON0 A;  1FOX A;  1KU3 A;  4RB1 A;  3SEZ A;  4L0Z B;  4U87 A;  2YR2 A;  2VQH A;  2L9S A;  1MMG A;  2MBF A;  2DMP A;  2EIL H;  2L9V A;  2DTR A;  4I98 B;  5A2Q Z;  2RQQ A;  1HLV A;  2K3F A;  2HTJ A;  4M6V A;  2VKH A;  2ZKZ A;  3KYC B;  4MFD A;  5BS6 A;  4DIQ A;  1ZG5 A;  4ZZL A;  1ZAO A;  2NRA C;  2E2I J;  2FOK A;  1JJ8 C;  1BJZ A;  3HBL A;  1JT0 A;  1STZ A;  4W1U A;  3FHN A;  4IHV A;  2EIK H;  1JKP C;  2XAQ A;  4M3D A;  2PG4 A;  1XSV A;  5HLT A;  2R7D A;  2KP6 A;  1V55 H;  1LUJ B;  1JI8 A;  1WH7 A;  1R1U A;  4XBF A;  3HRT A;  3BTC A;  3RPU D;  2V6E A;  2AQF A;  3IRQ A;  1IXR C;  2E1N A;  3KLN A;  3JRG A;  3ECH A;  1YYV A;  2B0L A;  1FOK A;  1ZRE A;  3NWS A;  2GLO A;  3W3C A;  4M74 A;  2MD5 A;  5LHH A;  2LK2 A;  2HYJ A;  3OYD A;  1R71 A;  3HYI A;  2BOL A;  2DQR A;  2I10 A;  2M7A A;  4LLG F;  1OR7 C;  5JR3 A;  3MKY B;  4CYD A;  2WBM A;  1WH5 A;  2QQA A;  3TED A;  3QRF F;  1JHF A;  3TOB A;  3IAM 2;  4XKV A;  1RI7 A;  3ISP A;  4ZC3 A;  1KON A;  2MD0 A;  4IXA A;  3KEO A;  3GTK J;  1RKW A;  2HDW A;  3LFK A;  1U6G A;  4L9J A;  3M07 A;  2Z33 A;  3S8P A;  4Y7N J;  5EGO A;  2EFQ A;  2YSR A;  1MBK A;  2H09 A;  5CVR A;  1VZ0 A;  1WVR A;  3ASO H;  4NQW B;  3RJP A;  3J80 Z;  3PIO F;  5FLM J;  4GGG A;  3BG5 A;  3WU1 B;  2KDO A;  2BHY A;  2ZC2 A;  3CCV I;  4HV5 A;  2ISY A;  4QTR A;  4PJN A;  5D4R A;  4PFO A;  4CIC A;  3CUQ B;  3T0Y A;  2CV1 A;  1YG2 A;  2WAQ N;  1UHM A;  4NDL A;  1AWC A;  1IF1 A;  5ICE A;  2G7H A;  1F43 A;  1SVM A;  4ESJ A;  3BZC A;  1HC8 A;  4Q47 A;  4BBS J;  4RB2 C;  1J7K A;  5KCM A;  5D5W B;  3LAP A;  2PFB A;  4O3M A;  2DT6 A;  3E0J B;  4IO9 F;  3V8K A;  5E1W A;  1Y6I A;  2JRM A;  3HIF A;  4P1W A;  2DT7 B;  4EGZ A;  1IO2 A;  2P5V A;  4ZYH A;  5CLS A;  3I59 A;  1Z3X A;  2F6C A;  3QOP A;  4D0P A;  3OSG A;  4NBQ A;  1YFH A;  3LL7 A;  1A6I A;  1OQY A;  1LFB A;  5D5U B;  3GX4 X;  5L3E A;  2ZJP F;  1WI9 A;  1BI3 A;  5DS9 A;  5K7Z A;  3KFW X;  1OIS A;  5HDG A;  2X4H A;  4XN3 A;  1BIA A;  5J1R A;  4B8X A;  5LRR A;  2O61 A;  4B47 A;  1LJ9 A;  4AIJ A;  2PN6 A;  2VI6 A;  4FAS D;  1RKT A;  2B63 J;  1A36 A;  4BY1 J;  2A6E F;  2HOT A;  3RZD J;  2M8G X;  2DI3 A;  2H1K A;  2GOX B;  1Z05 A;  2NXN B;  2VXZ A;  1X1D A;  2KIQ A;  4IX7 A;  4U0W A;  1O7F A;  2HTS A;  3WTS C;  2Y30 A;  3S1N J;  4D5F A;  3BZ6 A;  3BR6 A;  3S1Q J;  2HWV A;  5K1Y A;  3FDY A;  2CW7 A;  5DV5 A;  3ZP5 A;  4CZZ A;  4KIT B;  3BPX A;  3HGG A;  2N8G A;  3I59 B;  1ETO A;  2F4O B;  5ILS A;  4G12 A;  3L9F A;  2EH3 A;  1KYZ A;  2X51 A;  2HGC A;  1R00 A;  3I9V 2;  3DLA A;  2R0Q C;  4ZYE A;  1VQ9 I;  2LTP A;  2EZL A;  4XOR A;  3QYE A;  2GM4 A;  2NVT J;  3DXJ F;  4EVI A;  1RUN A;  5E3M A;  3OIO A;  3IUO A;  3CLO A;  2Y0S N;  1YI2 I;  4I09 A;  1NTC A;  3H0D A;  4EJW A;  5J47 A;  1FIA A;  4A0Z A;  3VYS B;  2OV7 A;  4B1R A;  1TW3 A;  1R1T A;  3BOQ A;  3ONQ A;  5IPA A;  2LR8 A;  5ILV A;  1R7J A;  4E7H A;  1IAW A;  2KQR A;  4LIU A;  2V7F A;  6PAX A;  1T6S A;  2ZFU A;  1IN4 A;  2M87 A;  4LG0 B;  5J6X A;  2Z2S B;  3ZQ7 A;  2QUF A;  3S32 A;  4BEH A;  2QEN A;  3BJA A;  1BN5 A;  3LA7 A;  1HF0 A;  4M73 A;  5EG0 A;  2AXL A;  4XN0 A;  4GCV A;  1F4K A;  3C2B A;  3E3V A;  2CMP A;  2F5E A;  5LGN A;  4B43 A;  4B3X A;  1ZRF A;  1GLN A;  1M1E B;  5BMZ A;  2BYV E;  1MKM A;  1K78 A;  5GPA A;  2KIS A;  4RLQ A;  2J5O A;  1YX5 A;  2L7Z A;  1RRJ A;  1W7P D;  2DA5 A;  1SD7 A;  2CYY A;  3TO7 A;  1X4P A;  3H9J A;  2PMH A;  4ASN A;  2VE8 A;  3O3K A;  3PL8 A;  2VKD A;  3CJT B;  3WOD F;  1VQP I;  5LD2 C;  1WKM A;  2LY1 A;  1WQ2 A;  3EET A;  1B8I B;  3BTI A;  2RQP A;  1PP7 U;  2Y75 A;  1OPC A;  2Y2Z A;  1AA7 A;  5C44 J;  5L3C A;  2QQ8 A;  3FIS A;  1KQ8 A;  1D5V A;  1V3F A;  3TGN A;  1UCR A;  3PO3 J;  2F5V A;  5E79 C;  5CKT A;  5JI6 A;  1B72 B;  2P5K A;  2V26 A;  4AWX B;  3HUG A;  1PJR A;  5FGM A;  4LD5 A;  3K1N A;  3ZN1 A;  1FSH A;  3F21 A;  1ETY A;  1K79 A;  3HTS B;  4BY7 J;  2W4S A;  2F48 A;  1W36 C;  3M4O J;  2NNY A;  1J09 A;  2LF8 A;  3KIO A;  1USS A;  2D45 A;  1HBX G;  3MFK A;  4BE1 A;  1WJC A;  3S16 J;  2GQQ A;  3ZMU A;  1U3E M;  1NG6 A;  2X6Y A;  4FT8 A;  3OYC A;  2FBH A;  2LVS A;  4EMS A;  2HVR A;  4HNV A;  3C18 A;  4MIM A;  3K4B A;  2ICW G;  1Z6R A;  3U21 A;  5KAI C;  5B66 C;  3EPZ A;  3S2W A;  4EQQ A;  2XAG A;  3M1C A;  3M3Y J;  2IS6 A;  1L3L A;  3OMY A;  1IRG A;  2GA1 A;  5IOY A;  2BBY A;  4OIP F;  1ZN2 A;  3E5X A;  4N4O B;  5K5R A;  3GTL J;  1O7L A;  1TP4 A;  3M9A A;  4QSH A;  3NWT A;  4LIV A;  3LSM A;  3QOD A;  5CVJ A;  4BQA A;  5DDG A;  4CSW A;  2M1B A;  4EM0 B;  5EEG A;  3DPL C;  3FMQ A;  2M34 A;  5DEQ A;  2YX7 A;  1OCO H;  2LBF B;  1T39 A;  5CJ9 A;  4A3K J;  2TDX A;  3GFI A;  3GVA A;  4D1Q A;  5IOZ A;  3AL0 B;  4XL9 A;  2EZI A;  3LSR A;  2K40 A;  4HA8 A;  3SZG A;  4NNJ A;  3IKT A;  3DTE A;  2KRH A;  2XF5 A;  2QGU A;  3FF5 A;  2MAB A;  4XID A;  2LKS A;  1MH3 A;  4NUB A;  3KYL A;  2W25 A;  1VQL I;  1TBX A;  2JMW A;  4CA0 A;  3ZQL A;  3M8E A;  2P7C B;  1MDM B;  2BW3 B;  2YS9 A;  2QSG X;  4UV8 A;  4EJU A;  3HB9 A;  2STT A;  2HXI A;  1QQI A;  2HNH A;  2XV4 S;  3R60 A;  4V2G A;  2PJR A;  1BA5 A;  4MNU A;  2CUF A;  2E5Z A;  3LWF A;  2UXX A;  2MC4 A;  5GTH C;  4LB5 A;  5EF6 A;  1WRJ A;  4AYB A;  1UAA A;  1TTY A;  3RSN A;  3WGH A;  1P9Q C;  3AAF A;  4M6X A;  4IRI A;  3DBL B;  3FXR A;  3W6K B;  3WG9 A;  2M4G A;  4XIC A;  2P7V B;  3L7W A;  2ZME B;  3MAJ A;  1WJB A;  3MMY B;  3V7S A;  5M5Y J;  3T1B A;  1YTY A;  2VBZ A;  2NAZ A;  5DM6 F;  4BXU A;  3TP0 A;  1B9N A;  2VT2 A;  5TGT A;  1MBF A;  1W7P B;  2XAS A;  3IH3 A;  3ZMT A;  1Z9C A;  3GFL A;  5C4X J;  3REO A;  3GUD A;  1RNL A;  3QOE A;  4LG3 A;  3BQY A;  3ZR8 X;  1IXS B;  3KE2 A;  2COB A;  3FIW A;  4HOB A;  1A04 A;  3HSE A;  5F0F A;  3BT9 A;  2VXD A;  2RV8 A;  1MMA A;  2DLL A;  4BS9 A;  1LQ1 A;  1ULY A;  2OF7 A;  5LHG A;  2CV2 A;  4BJ6 C;  3NQO A;  4A3J J;  2NS0 A;  4P96 A;  2DK5 A;  3CTA A;  1XN7 A;  4L5J A;  4M71 A;  1R1V A;  3S15 J;  2L3D A;  3V7R A;  5E8G A;  5LHI A;  2ZXH A;  3TBI A;  3BR5 A;  3DWL E;  3I54 A;  3FXL A;  3KEY A;  2Y31 A;  3PSI A;  1VND A;  5F08 A;  1RES A;  3RKQ A;  3F6V A;  3GFJ A;  1OMI A;  3KP6 A;  2CUJ A;  4BHP A;  5IP7 J;  4E7K A;  2BVM A;  3DKY A;  1LKX A;  4A3B J;  4CCM A;  4H0E A;  2DA1 A;  2K9N A;  2ZBK A;  3WTZ A;  2KPM A;  4FIS A;  1E3P A;  1EH7 A;  2R5Z B;  4WF2 A;  2EB7 A;  2OQG A;  1FP1 D;  2ECC A;  3DFG A;  2HEO A;  5E1Z B;  4HV6 A;  4YEL A;  3BJO A;  2IGO A;  3WTV C;  3CD6 I;  1ETQ A;  1MJ9 A;  5L3D A;  3V8L A;  3CJR B;  5HLH A;  3DLL F;  2H94 A;  4A3L J;  4CUG A;  2DOD A;  3O8H A;  2VUM J;  2FQ4 A;  2VT3 A;  3GXO A;  3E6D A;  1P4W A;  3QAH A;  4Q4Z F;  4YEJ A;  4EAT A;  1ZAR A;  2VKE A;  4NC8 A;  2ZXI A;  3HOZ J;  2ZNZ A;  1SAU A;  2M4K A;  3BTJ A;  3ZQI A;  2QVO A;  1JTX A;  4Y3O A;  1ZG3 A;  3MQ0 A;  1W5S A;  1D1B A;  2CQK A;  4MTD A;  4IF4 A;  2ID6 A;  5HOD A;  1NK3 P;  3RYP A;  1N78 A;  4K2E A;  4AVZ A;  4R8H A;  1DQU A;  1FYL A;  1H89 C;  1VQ4 I;  1WSU A;  1TWA J;  4IHW A;  2D2W A;  1Z0X A;  1ODD A;  3BTL A;  3K70 C;  3H9G A;  2UXN A;  4XM3 A;  3HOS A;  2IXS A;  5LRS A;  1G3S A;  3EYY A;  2O0Y A;  2E1M B;  2OAZ A;  1W5T A;  5CVI A;  5M3M J;  2BY0 A;  3PJR A;  2VAS A;  2P4W A;  5TRD A;  4A3G J;  2FD5 A;  3CJQ B;  2EFW A;  2CFX A;  3AG3 H;  3HRS A;  5EZH A;  4XR6 A;  1YX3 A;  3W6V A;  3L2R A;  3KZI C;  2FU4 A;  2BY1 A;  2B9S A;  3H35 A;  3WU2 C;  1F5T A;  4ZDO A;  1WJ5 A;  4DOZ A;  2LD5 A;  1BR2 A;  2XAF A;  2E19 A;  3U1D A;  5LEK A;  4F55 A;  4LOC A;  4XLH A;  4N0B A;  3CCE I;  5ICC A;  1BW5 A;  4DZP A;  4XQF A;  4DQ2 A;  3OV8 A;  1KU9 A;  3ROU A;  3FXU A;  1GV2 A;  1J5Y A;  2FEZ A;  3F9K A;  3TO6 A;  3E1S A;  2HVQ A;  5K7F A;  3SEQ A;  4FTH A;  2L7M P;  2PMZ A;  2JSC A;  5AON A;  3OIP A;  4DYR A;  2PQ8 A;  2X85 A;  1J0R A;  1XS9 A;  3GLL A;  2ZB9 A;  1LNW A;  4HQE A;  3LSK A;  4GXO A;  2NS7 A;  3TOA A;  2DFE A;  3CF2 A;  4P9U A;  2JUG A;  4N9I A;  1YW9 A;  5KK1 A;  3LOC A;  3ML6 A;  2E5N A;  1GVJ A;  1HXD A;  3I64 A;  3QP5 A;  3QU3 A;  3VDX A;  1E2X A;  4DGW B;  3JRC A;  2R5Y B;  1IN8 A;  4EJO A;  4X6A J;  5LFA A;  2KKO A;  1Z6T A;  2K9L A;  3E6B A;  4MO7 A;  4WXH A;  3SJM A;  4KT5 C;  2LDU A;  4RGS A;  1MSE C;  5J1Y A;  4D9J A;  3DU5 A;  3G71 I;  3EUA A;  5E3N A;  4IQJ A;  1HKT A;  2ETH A;  2KIU A;  4HEA 2;  2LY9 A;  5KAF C;  3W6J B;  2UV1 A;  1W5C C;  1TT5 B;  4KJZ A;  4A5M A;  5EDN A;  2BGC A;  4DW6 A;  3KCC A;  2WY8 Q;  1UG2 A;  4FE7 A;  1R5G A;  5F04 A;  4U0Y A;  3CCY A;  3K4L A;  3GFM A;  4B48 A;  1S72 I;  3AG2 H;  4RMN A;  1CF7 B;  4YRV A;  5B1A H;  1S9H A;  3OR1 C;  1TL8 A;  3N05 A;  2EJR A;  1FT9 A;  4JK1 X;  2XUB A;  1G4D A;  2IA2 A;  4HF0 A;  1CQT A;  3KLO A;  1BR1 A;  1GV5 A;  2M2E A;  1FSE A;  2DXI A;  1ACI A;  1X1A A;  4IZZ A;  4F3Q A;  1HW1 A;  2CS3 A;  5K5Q A;  2M30 A;  2O03 A;  2XAJ A;  1YLF A;  3LNQ A;  3A2K A;  2X48 A;  1WI3 A;  1Y0U A;  2QCO A;  3TDU C;  4KFC A;  1XCV A;  1I1G A;  2CGP A;  3MVP A;  3L2W A;  4GDF A;  3OSF A;  2M5W A;  3SFI A;  1SVL A;  4L5I A;  3GTO J;  2GXA A;  2QWW A;  3BC8 A;  3HOY J;  5EZG A;  3S14 J;  1FMW A;  1OYI A;  2K9Q A;  4DYQ A;  2KJC A;  3CJN A;  2OBP A;  1TNS A;  4AUX A;  2FNA A;  3HHH A;  4ENM A;  1V5E A;  3RI4 A;  1LEA A;  1W1W E;  2DMT A;  3JTG A;  1GDT A;  2JPB A;  1T56 A;  1REP C;  1VI0 A;  3LST A;  2Y0M A;  1H9G A;  3DPU A;  1I6H J;  1VQN I;  2E1C A;  2F2E A;  1ONV A;  3CP8 A;  4XON A;  4A12 A;  5ERI A;  2XHK A;  2FOW A;  2HR3 A;  2EFN A;  2R7X A;  2ZSH B;  2PEX A;  1TWF J;  4LFU A;  2BVL A;  4ETS A;  1ZR2 A;  3OYG A;  4BBR J;  3F72 A;  4BDY A;  2DA6 A;  3PSF A;  1QHH D;  1K4T A;  1IRZ A;  1IXC A;  2A68 F;  3VYU B;  4P9F A;  2RNJ A;  4M9X A;  1UMQ A;  1TQI A;  2DOF A;  2P5L C;  3JSO A;  3J7A Y;  1R6R A;  1K7A A;  2W85 A;  2JUC A;  1D0X A;  2RNG A;  2QF7 A;  1R58 A;  3BR0 A;  3WE3 A;  3TMO A;  4ANJ A;  1BL0 A;  1ETX A;  4M9Z A;  2I5U A;  4NQW A;  2F5C A;  3H3Z A;  1HKS A;  1X1C A;  1XD7 A;  1XDU A;  3IRR A;  2L7K A;  2CSO A;  2QBY B;  2MLG A;  4GO1 A;  4RS8 A;  2K7L A;  1ZQ3 P;  2K9M A;  2E36 A;  2ZFW A;  5TIS C;  3COA C;  3OYK A;  1POG A;  1FX7 A;  1PVE A;  3CLQ A;  3CUQ A;  4I76 A;  2VOP A;  1MW7 A;  4W97 A;  2X6W A;  1I39 A;  4HX8 A;  3JRE A;  3BWG A;  2XF6 A;  4A3I J;  3HC7 A;  3D5S C;  1ZEL A;  3IH4 A;  2GIV A;  3HXL A;  3DKW A;  3WHC A;  3N97 A;  4MEY F;  3BCB A;  3FHZ A;  2JA8 J;  3H5A A;  2IRF G;  3WTY C;  5KNL A;  2K85 A;  4A6E A;  3QPH A;  1RET A;  2JK3 A;  3NAR A;  1KU2 A;  5E20 A;  3JRD A;  1SEU A;  5J4Y A;  3A0H C;  1ZK8 A;  2LRE A;  1SC7 A;  2WB1 A;  9ANT A;  4YFK F;  2ZJR F;  2LOO A;  2BY2 A;  3OL4 A;  4Q5S F;  5GAH J;  2AXT C;  3S3O A;  3VWB A;  1BW6 A;  4JX5 A;  5LGT A;  3OS0 A;  4RAY A;  5FKL A;  3DP7 A;  4NHJ A;  2CFO A;  3CCS I;  1RR7 A;  2EV6 A;  3F8F A;  5BNG A;  3E5U A;  4XLF A;  2DOE A;  2OU2 A;  2JA5 J;  1JTY A;  3SXY A;  3EDP A;  2LC2 A;  1LE8 B;  2V9P A;  3OS2 A;  3OYB A;  1I1S A;  3F8C A;  3Q3S A;  2DU9 A;  2LG4 A;  2W00 A;  5FKN A;  5D5X B;  1I3A A;  4D7M A;  1QO0 D;  3L2Q A;  3S3M A;  2JT1 A;  2XPW A;  3OYN A;  1ZRD A;  3C7J A;  5HS7 A;  3GBG A;  3HSF A;  1VF9 A;  4UVA A;  4CYC B;  2M3A A;  4CCK A;  1Q1H A;  3H5R A;  2QA4 I;  1VTN C;  4ZYA A;  1T2K A;  1OCC H;  1VQ6 I;  3B73 A;  3LQQ A;  1S8N A;  3RTR A;  2K4J A;  1G3Y A;  4YFN F;  4KIC A;  3IH2 A;  4IQ4 A;  2H27 A;  1ORK A;  3DBR B;  4FQG A;  4HRI A;  2CQX A;  2K02 A;  1JGS A;  3RPU A;  3HKZ A;  4OAZ A;  2DYR H;  5GAE J;  1OYY A;  1Z21 A;  2FNP A;  2VJJ A;  4E6K G;  4BE0 A;  4LG0 A;  2MH9 A;  2LNB A;  3OYI A;  2M45 A;  4BHB A;  4G9Y A;  5CQG A;  3MZH A;  1DP7 P;  3CF5 F;  2R7F A;  4LLN A;  1PP8 F;  5HNF A;  1MBJ A;  1P4X A;  4CCO A;  5F6F A;  3S2D J;  5D4S A;  2FF4 A;  1QA6 A;  4PCQ A;  3EQL F;  1I6X A;  2X0L A;  4KIB A;  4HNT A;  3HOW J;  1YQA A;  3P9C A;  3KPH A;  3HL2 A;  4O6J A;  1G2H A;  1FTZ A;  1VQM I;  3MZY A;  1LVK A;  3ZMD A;  1HKQ A;  2HDD A;  2X1C A;  1FPQ A;  1UHW A;  1ON2 A;  2D1H A;  2FJ1 A;  3BG6 A;  3UNG C;  1ZRC A;  2XF7 A;  2VBY A;  2BE5 F;  2XSD C;  1WJE A;  3OOU A;  1XGM A;  4XKC A;  4ZZD A;  3BDD A;  1QHG A;  4YIF A;  1JJ6 C;  3LQR A;  5KHD A;  2HS5 A;  2ZXJ A;  3HJE A;  2XPV A;  5DCM B;  1MBH A;  4NC7 A;  1EJ9 A;  3A0B C;  1ZH5 A;  1FBS A;  1AKH B;  3MKZ A;  1YIO A;  2Q2E B;  2F5D A;  3HPH A;  1B8I A;  3CO7 C;  1R5I D;  2IS2 A;  1GUU A;  1X3Z B;  2FML A;  2DJN A;  2DDA A;  1Y56 A;  4L5E A;  4Y13 A;  1CGP A;  3CUO A;  5L3B A;  3VOD A;  2KDZ A;  3HGY A;  2NOG A;  1B72 A;  4XOT A;  1W4M A;  2DT5 A;  3HOV J;  2VQC A;  4HLY A;  1MSF C;  4FCY A;  4IOA F;  1XGO A;  3I4N J;  1RZ4 A;  1ETW A;  4BJT A;  2DMU A;  1O3R A;  1U0J A;  2KZG A;  2M0M A;  3H1C A;  4HF2 A;  4BXX J;  3FKI J;  2BZT A;  2JQ7 A;  4F92 B;  5M5X J;  2OTJ I;  2QYO A;  4ENN A;  2NNN A;  3I3L A;  4UV9 A;  4C2U A;  1PDN C;  2V1U A;  4BQQ A;  3UR3 C;  4OWR B;  4RBO A;  2GWR A;  2OCE A;  1G3T A;  2E35 A;  3BR3 A;  1WZ2 A;  4I6Z A;  5FFX A;  2CW0 F;  2TCT A;  2CUZ A;  4MLO A;  4RGR A;  1VQ7 I;  3L1P A;  4C3H J;  3SQN A;  3ERE D;  2EV0 A;  5LGU A;  3Q5F A;  2VC0 A;  4WXC A;  2WV0 A;  3AG4 H;  4ZDL A;  3ZQH A;  1FOW A;  2WV1 A;  1U78 A;  4AM3 A;  1APL C;  2Z16 A;  3K4N A;  1U5T B;  4RB3 C;  4M3G A;  3K4K A;  1JKO C;  2DCE A;  2DPD A;  4BQN A;  4BYY A;  2LYC A;  2QKM B;  4CHU A;  1Z91 A;  3LA2 A;  2UWM A;  1KQ0 A;  2LBF A;  4S05 A;  4M72 A;  1TLH B;  3GTQ J;  3I71 A;  2V1N A;  3OR2 C;  4KYW A;  4AU7 A;  3PUB A;  3L2V A;  3E7L A;  4OAY A;  3RKW A;  3WG7 H;  1MBG A;  3PIP F;  3IAS 2;  5JLW A;  1YJW I;  3GW2 A;  4MEX F;  1FJL A;  1HCR A;  5IYD J;  3A4C A;  3RKY A;  4XLE A;  3RZO J;  2WAF A;  1SD6 A;  5IY5 H;  2W1O A;  3KEQ A;  2PBI A;  2DPU A;  3HM5 A;  1D1C A;  3CME I;  1GVD A;  3RIR A;  3PM1 A;  1MDM A;  2BW3 A;  2HI3 A;  5HLI A;  1ZLK A;  3H5N A;  4HX7 A;  3E6C C;  4IRH A;  1Y0N A;  3RPQ A;  2K5C A;  1JUS A;  3KX2 A;  3HTU A;  1EKE A;  3W2A A;  3LSP A;  4XLP F;  4HYE A;  3TL4 X;  4A3M J;  1U8B A;  1Z67 A;  4II2 A;  3CC7 I;  4B4C A;  1YJ9 I;  4HSR A;  2HPM A;  2ZME A;  3H3U A;  5F0C A;  4FE4 A;  2FBI A;  3QPS A;  3CMA I;  3I55 I;  2IJL A;  4LLL A;  2ADU A;  2VJ4 A;  1YHQ I;  1LFP A;  1QZZ A;  4E7L A;  4A5N A;  2Y69 H;  1F36 A;  2XAH A;  3OIQ A;  1W7P A;  2CUE A;  2YX4 A;  3G2B A;  3VB2 A;  3CES A;  2K86 A;  3RDI A;  3D5L A;  1BOB A;  2P0W A;  2VQG A;  2BHZ A;  1MND A;  1LDJ A;  1V4R A;  1W0U A;  4E7Z A;  1DGR M;  1FNN A;  4DNC A;  1OR7 A;  3KZY A;  4OMZ A;  1SAX A;  5FRO A;  2HKO A;  5E8I A;  3S17 J;  4U88 A;  3ZCO A;  3WTT C;  3LMM A;  1ZYR F;  4UUS B;  3HDD A;  3HHG A;  3E6M A;  2HZD A;  3K4M A;  3I56 I;  4I02 A;  2IBD A;  4G6Q A;  2QLZ A;  1AU7 A;  2QSH X;  1BI0 A;  4RA2 A;  1RPW A;  3GF2 A;  3JR9 A;  5CVV A;  2A5Y B;  4BH9 A;  1KZH A;  4WCG A;  3G73 A;  1DGW Y;  2HQ5 A;  1Z77 A;  4JYK A;  3FBN B;  1G59 A;  2RGV A;  5DTD A;  1T33 A;  4E7I A;  2XB5 A;  3ZQF A;  3CDI A;  3T8T A;  1MH4 A;  1MMS A;  1EA3 A;  1FIP A;  4XLN F;  3RKX A;  4CO8 A;  1TNT A;  3PQJ A;  1T8I A;  2R5Z A;  5J8F A;  2F5F A;  2O9L A;  4OIO F;  3OYF A;  1D3Y A;  1Z1D A;  2IAI A;  2P8T A;  3H3V K;  3GTJ J;  1WFX A;  2G9W A;  5BPD A;  4DBQ A;  1I50 J;  1UZC A;  1WHU A;  4UHT A;  4B3A A;  4HAM A;  1RIO H;  2KZV A;  2XPU A;  4XRF A;  5L3G A;  1X58 A;  2X9D A;  2NVX J;  1ZG1 A;  3K9T A;  3MN2 A;  5FO5 A;  5ED4 A;  3P5J A;  3JRB A;  1LFU P;  4RGX A;  1XDS A;  3D0S A;  4Z6Y A;  2WWY A;  1JUP A;  3RQ4 A;  1ERD A;  3CUQ C;  3J7Z I;  4HW0 A;  1UHS A;  1X1B A;  5IT3 A;  2O6G E;  2HU9 A;  3K7A J;  3FM3 A;  2ZJQ F;  3O6B B;  1SFU A;  2IA0 A;  4I7H A;  2R7U A;  3DQV C;  4EV0 A;  2K9S A;  1V54 H;  1D0Y A;  4XLC A;  3ZMV A;  2YPR A;  1P4A A;  4EM2 A;  1ZGA A;  2HKX A;  1U8R A;  1HQC A;  4RAG A;  5D8K B;  3HPG A;  3ULQ B;  1XTA A;  4BL0 B;  3ESW B;  2STW A;  2WC2 A;  4I99 C;  4JP0 A;  1K83 J;  3VEP A;  2OPT A;  1W36 D;  3GCM A;  2ME6 A;  4KA4 A;  1BIB A;  1U9O A;  2R92 J;  5HLG A;  2E34 A;  4F91 B;  4F93 B;  4OIQ F;  1NG7 A;  3D1N I;  4AYB N;  2R93 J;  3DTI A;  4CCN A;  1XSX A;  1YIJ I;  1U9N A;  2C6Y A;  1X1P A;  4KN7 X;  1D8K A;  5LBQ A;  2IA1 A;  3D5R C;  3OL3 A;  2A5W A;  2CH0 A;  4C3I J;  3H0G J;  3F22 A;  4MTE A;  1O57 A;  3AG1 H;  1JKR C;  4A69 C;  4I0B A;  3V7C A;  5F1J A;  4RM3 A;  4LMY A;  4IHT A;  1T98 A;  3FXO A;  3WTU C;  2GOM A;  3K2A A;  3CQZ J;  3JRF A;  3H9Q A;  2L7F P;  1R23 A;  5IYB J;  2QKL B;  4PZJ A;  2CQ7 A;  2XGE A;  1FTT A;  1OJL A;  5E3O A;  2CWE A;  3ECO A;  4QWQ A;  4HG2 A;  2L01 A;  4MFE A;  4L9V A;  4QIW N;  1LB2 A;  4KDP A;  2DMN A;  2DFF A;  4UVC A;  1WGX A;  1DP3 A;  4S04 A;  1BI1 A;  1WJD A;  2JRT A;  3LSI A;  1BM9 A;  4I0A A;  4MQ9 F;  4EJT A;  3IC7 A;  2R5Y A;  4G6D A;  4WX9 A;  1MMN A;  2VJI A;  2YU9 J;  2X6X A;  4XRS A;  2EIJ H;  1IN7 A;  3A1Y A;  1S3J A;  4II3 A;  3U1K A;  2B7E A;  4IEJ A;  4JQF A;  1R22 A;  3C1D A;  2EIM H;  2R7R A;  3BJ6 A;  2EV5 A;  1ZKG A;  1SFO J;  5GTI C;  1ETK A;  5EYR A;  3I4M J;  1PUF B;  5DCF A;  2H6B A;  3FBI B;  3U2R A;  2WAD A;  4XRS G;  5M5W J;  1IN5 A;  4GRI A;  2R7W A;  4BE2 A;  5ICG A;  4G94 A;  3K2Z A;  3OYA A;  3KP5 A;  3ZQC A;  1F9N A;  4QPQ A;  1D0Z A;  4XSX F;  2W82 A;  4AID A;  1SMT A;  2VC1 A;  4V19 K;  4KIS A;  3LAJ A;  3WHB A;  1KYW A;  1WCM J;  1CF7 A;  4RM2 A;  1X2N A;  5FKK A;  3A01 B;  1MMD A;  4XKB A;  4A0Y A;  3PNY A;  4HX4 A;  5J40 A;  4AIH A;  2Y9Z A;  2EZH A;  2IT0 A;  4UUV A;  3HG9 A;  4B44 A;  2A05 A;  3I53 A;  4RDU A;  2I8D A;  3NAU A;  4X1E A;  2V9K A;  5JVG F;  2HFH A;  4OMY A;  1TWG J;  2OC6 A;  3EUK L;  2VJ5 A;  3ELK A;  3K4C A;  5C4J J;  2IGN A;  2QQB A;  3DBH B;  1K6O A;  1ITY A;  2VE9 A;  1Y8R B;  1EV7 A;  2AHQ A;  3JAM K;  1DPR A;  1E3O C;  1HW2 A;  1VQ5 I;  1FC3 A;  2BXY A;  2W24 A;  4PUS A;  1BC8 C;  2MLK A;  1VQ8 I;  2G0E A;  1NH3 A;  2VOD A;  4F7Z A;  2AQE A;  3R61 A;  1MBE A;  2KIM A;  1VQO I;  3H36 A;  3DPT A;  1T95 A;  5FB2 A;  1SFE A;  1ZGW A;  2VBW A;  2IPQ X;  2WTE A;  4EJV A;  4JX4 A;  4ABZ A;  3QPL A;  1YO5 C;  2DMQ A;  4MHG A;  2E2H J;  4C3J J;  1HDD C;  4KMF A;  5JHF A;  3MCZ A;  3S2H J;  3GWZ A;  3HOX J;  4L0Y B;  5IYC J;  3WTX C;  1QNT A;  3L2U A;  1GXP A;  1FYM A;  4DZJ A;  5JVT A;  2OJE D;  3OYM A;  4MGR A;  1S5L C;  1YOV B;  4G8X A;  1QZE A;  1S7O A;  5DUK A;  2IS1 A;  1BR4 A;  4Y52 J;  3MKW B;  5DD8 A;  2PMU A;  2EWN A;  2DFI A;  3AFH A;  3EYI A;  3OYJ A;  2KMU A;  1WWX A;  3ABK H;  5LLQ A;  2QSF X;  3PNV A;  1OYW A;  1S6L A;  3MWM A;  2HPI A;  4M9S A;  2PMZ N;  3LA3 A;  2FUG 2;  2OTL I;  2QBY A;  3PQK A;  2HXO A;  3GME A;  2A3S A;  2OZ6 A;  1DU6 A;  3G1O A;  2L02 A;  4QLC U;  1TT0 A;  4CCL A;  1LEB A;  2A6T A;  2BV6 A;  2R7T A;  1XMX A;  3CDH A;  4NC6 A;  4A6D A;  3F23 A;  2V6C A;  3ZPL A;  4RAZ A;  5J3L A;  3Q0W A;  4PFP A;  3B6C A;  5BPI A;  3FX3 A;  1P7I A;  1RR8 C;  5HDN A;  4KT6 A;  4OIN F;  4AC0 A;  1FEX A;  3ABT A;  3AL0 C;  3L09 A;  4LB6 B;  2PI0 A;  1ON1 A;  5F1R A;  1BC7 C;  1T08 B;  2O8K A;  4GFB A;  2VL8 A; 
#chains in the Genus database with same CATH homology
 1SD4 A;  1GXQ A;  4I2O A;  3M1E A;  3M8F A;  4KUM A;  2XKO A;  3OOP A;  4KNY A;  2M8E A;  3K1M A;  4R79 A;  1IUY A;  2E7W A;  2COM A;  3P7N A;  3JW4 A;  1UB9 A;  1T38 A;  1MZB A;  5LEJ A;  1MJA A;  2XGX A;  5E17 F;  2FSW A;  3R0J A;  4LJZ F;  3GZ5 A;  1B6A A;  3TO9 A;  5JHU A;  2P6S A;  4I01 A;  2IW5 A;  3R6S A;  4YII A;  3FM5 A;  3JAM Z;  3GZ6 A;  4G7Z F;  3F6O A;  1C0W A;  2LSO A;  2ACJ A;  2OD5 A;  2ESN A;  2HYF A;  5DD4 A;  1BI2 A;  1H0M A;  2LF7 A;  3JTH A;  2KIF A;  4HLX A;  4RGU A;  4RB0 A;  4HQM A;  4HZF A;  4ZH4 F;  1B1B A;  3VOE A;  1UFM A;  2O3F A;  2ZNY A;  3HRU A;  3I5U A;  5K5O A;  3IL2 A;  2GXB A;  2ZCW A;  1XB4 A;  2KJB A;  5FFZ A;  5CYV A;  3F3X A;  5DCM A;  1YW8 A;  3GYH X;  1KQ9 A;  2GXG A;  2Q2E A;  1JHH A;  5FD5 A;  1BJA A;  4ESF A;  2QM3 A;  4AD9 A;  2HQR A;  4FX4 A;  3M7G A;  4U7B A;  1GHC A;  1O3T A;  2RDP A;  1JXS A;  2RKH A;  1T0F A;  4ZYG A;  4GYI A;  2XRN A;  4LGW A;  4XSZ F;  3IWF A;  4YG2 F;  4G7H F;  4ENK A;  1IRF A;  2ELH A;  2JPC A;  3I0T A;  2V9V A;  1DPU A;  3HSR A;  5D6E A;  2L4A A;  2LKP A;  2FE3 A;  3G3Z A;  3P9I A;  4E70 A;  2IP2 A;  1FP2 A;  1QZY A;  2FMY A;  4WWC A;  1MD0 A;  1XMK A;  3FMR A;  4PGH A;  1LDK B;  1HW5 A;  4HF1 A;  1XSD A;  2HQN A;  2EFO A;  1U5T A;  2XKP A;  2A61 A;  3KET A;  1ZLJ A;  4FX0 A;  5H20 A;  1U2W A;  1TQP A;  2J5P A;  2IVM A;  2GZW A;  4ESB A;  1BOA A;  4IRG A;  4BHC A;  3DV8 A;  2D1V A;  3H92 A;  3SFZ A;  3T5X A;  3TDZ C;  3K0L A;  4LK1 F;  4KIF A;  5JFR A;  1LDD A;  2CO5 A;  2MC3 A;  5E1X A;  2Z3Y A;  3NRV A;  4UXN A;  2V1X A;  2HYG D;  2JZY A;  2Z9O A;  1XCB A;  1MJB A;  1O3S A;  4EM1 A;  1QBJ A;  3EUH A;  3L00 A;  2DQL A;  1B4A A;  1FBU A;  2ESH A;  2O8X A;  3SZP A;  5D8L B;  5F64 A;  4Q48 A;  1IN6 A;  3FXQ A;  1E17 A;  1JE8 A;  2Z5U A;  3Q9V A;  3U9G A;  3FWE A;  3F8N A;  3WGI A;  2XRO A;  1EH6 A;  5BOX A;  2OA4 A;  2HOE A;  2A07 F;  4PGG A;  1LVA A;  3BRO A;  2BEO A;  3V4G A;  4AVP A;  4AIK A;  3RYR A;  1K78 B;  3WU0 A;  3KP3 A;  2EA4 A;  2PJP A;  3KP4 A;  4Y17 A;  1G3W A;  2L54 A;  2GAU A;  4BNC A;  3QU6 A;  3C3W A;  1P92 A;  4P55 A;  5L3F A;  1DUX C;  4WXD A;  2R3S A;  1ZHF A;  2V79 A;  4Y15 A;  4KN4 X;  4IPA A;  3V8J A;  1J59 A;  1R5H A;  1P2F A;  2EFP A;  1S7A A;  1TQM A;  4ZYD A;  2Q0O A;  2A69 F;  2OZU A;  4UNO A;  4HDV A;  1SD5 A;  2HZT A;  3BPV A;  2DO7 A;  1L0O C;  2W84 A;  3HOT A;  4OOI A;  3I58 A;  4A2U A;  1MGT A;  3ABU A;  1HSJ A;  4O5V A;  1F1Z A;  1AOY A;  2H6C A;  4KIG A;  1FZP B;  3F8B A;  4IJA A;  5H6R A;  5H6Q A;  5KVR A;  3Q9S A;  3O2P E;  5AIP A;  3L2C A;  5HDK A;  4HBL A;  3F8M A;  3IWZ A;  4A0X A;  1I27 A;  1SMY F;  3B02 A;  5J8C A;  1I5Z A;  1QPM A;  4EGY A;  5IT9 K;  4TV7 A;  5ILU A;  2OQR A;  1G6N A;  4L9N A;  3WE2 A;  3KP7 A;  4GYG A;  3TQN A;  2EK5 A;  1BBY A;  3MEX A;  1XGN A;  2FXA A;  5FLX K;  2ISZ A;  1XMA A;  3QP6 A;  2YU3 A;  1EH8 A;  1IW7 F;  4U7D A;  3N4M A;  5CVU A;  1OKR A;  5D5V B;  3K69 A;  2DAO A;  2RVC A;  1QGP A;  4IVN A;  4IHS A;  2CG4 A;  1O3Q A;  2A6H F;  3J81 K;  3DEU A;  2FRH A;  2KRF A;  4CDG A;  1NHA A;  2W57 A;  4OU0 A;  3GO5 A;  1D8J A;  3R0A A;  4OIR F;  1Z7U A;  3HRM A;  4L18 B;  1B59 A;  4WK8 F;  1B9M A;  4MQV A;  2E7X A;  3I4P A;  3NEU A;  2G7U A;  2FBK A;  3SHF A;  2ZJ2 A;  4M6Y A;  1KA8 A;  4JBA A;  4N9H A;  2VON A;  3PFI A;  3K1P A;  4G7O F;  2XIG A;  1KGS A;  1YS6 A;  2RC4 A;  3WGG A;  1ZGJ A;  1YW7 A;  3ZN0 A;  1FWZ A;  5E18 F;  2FA5 A;  2K4B A;  4YFX F;  3KZZ A;  2MH2 A;  1SFX A;  3ZMS A;  4L9T A;  5HS9 A;  2UZK A;  2QQ9 A;  2RN7 A;  5TJJ A;  5A2Q K;  3FMS A;  3GLX A;  2Q8K A;  3TKY A;  1R36 A;  2QZ8 A;  3BY6 A;  2XVC A;  2NYX A;  2DW4 A;  5HOO A;  5IT9 Z;  3JSP A;  4KMU X;  3R4K A;  2V1D A;  1YS7 A;  4BAY A;  2DBB A;  4HDU A;  4FHT A;  1J2X A;  3IHU A;  4NB5 A;  4R1H A;  3BP8 A;  3ZMZ A;  4PDK A;  1FYK A;  2EA2 A;  2PLY A;  3CO6 C;  3E97 A;  5FLX Z;  2Z99 A;  4ENJ A;  3QPT A;  4P5O A;  2ZO4 A;  5AIQ A;  2K27 A;  2P6T A;  1P6R A;  3DF8 A;  4UVB A;  3GEZ A;  1S29 A;  3J7A O;  1PUE E;  1RUO A;  4CXF A;  3IKV A;  3WTW C;  3J81 Z;  2VBX A;  1UST A;  1U5T C;  5HS8 A;  3P9K A;  5EEH A;  5DYM A;  2DK8 A;  4U0V A;  5HVQ C;  3VFZ A;  3J80 K;  1IZ1 A;  1HST A;  2AS5 F;  2Y48 A;  4CGZ A;  2GA2 A;  4Z2Y A;  1J75 A;  1X3U A;  5ICF A;  2VOO A;  1FBQ A;  2VN2 A;  5D6F A;  2HDC A;  3FZV A;  1XGS A;  5DUI A;  2FQ3 A;  1FLI A;  1DDN A;  2MA3 A;  3KP2 A;  3SZT A;  3T8R A;  2JTV A;  3E5Q A;  1KU7 A;  1H9T A;  4LK0 F;  1J9I A;  1TW2 A;  5BQT A;  4B09 A;  1FY7 A;  2L4M A;  5FD6 A;  4ON0 A;  1KU3 A;  4RB1 A;  4L0Z B;  2YR2 A;  2MBF A;  4I98 B;  2DTR A;  5A2Q Z;  2HTJ A;  2ZKZ A;  5BS6 A;  1ZG5 A;  4ZZL A;  1ZAO A;  2NRA C;  2FOK A;  1STZ A;  2XAQ A;  2PG4 A;  1XSV A;  2R7D A;  1R1U A;  4XBF A;  3HRT A;  3IRQ A;  1IXR C;  2E1N A;  3KLN A;  3ECH A;  1YYV A;  2B0L A;  1FOK A;  1ZRE A;  4M74 A;  2MD5 A;  5LHH A;  3HYI A;  2DQR A;  4LLG F;  5JR3 A;  4CYD A;  3QRF F;  2QQA A;  1JHF A;  3TOB A;  1RI7 A;  3ISP A;  4IXA A;  3KEO A;  3LFK A;  1U6G A;  4L9J A;  2Z33 A;  2EFQ A;  2YSR A;  2H09 A;  5CVR A;  3RJP A;  3J80 Z;  4GGG A;  3WU1 B;  4HV5 A;  2ISY A;  5D4R A;  4CIC A;  3CUQ B;  3T0Y A;  1YG2 A;  1UHM A;  1AWC A;  1IF1 A;  5ICE A;  2G7H A;  4ESJ A;  4Q47 A;  4RB2 C;  1J7K A;  5D5W B;  3LAP A;  2PFB A;  4O3M A;  3V8K A;  5E1W A;  3HIF A;  4EGZ A;  2P5V A;  4ZYH A;  5CLS A;  3I59 A;  3QOP A;  1YFH A;  4D0P A;  5D5U B;  3GX4 X;  5L3E A;  1WI9 A;  1BI3 A;  3KFW X;  5HDG A;  2X4H A;  1BIA A;  4B8X A;  5LRR A;  2O61 A;  1LJ9 A;  4AIJ A;  2PN6 A;  2A6E F;  2DI3 A;  1Z05 A;  2VXZ A;  4U0W A;  1O7F A;  2HTS A;  3WTS C;  3BZ6 A;  2HWV A;  5K1Y A;  5DV5 A;  3ZP5 A;  4CZZ A;  3BPX A;  3I59 B;  5ILS A;  3L9F A;  1KYZ A;  2HGC A;  1R00 A;  4ZYE A;  3DXJ F;  4EVI A;  1RUN A;  3CLO A;  4I09 A;  4EJW A;  4A0Z A;  1TW3 A;  1R1T A;  3BOQ A;  1IAW A;  5ILV A;  1R7J A;  6PAX A;  1T6S A;  1IN4 A;  2M87 A;  4LG0 B;  5J6X A;  3ZQ7 A;  2QUF A;  2QEN A;  3BJA A;  1BN5 A;  3LA7 A;  4M73 A;  2AXL A;  4GCV A;  1F4K A;  3E3V A;  2F5E A;  5LGN A;  1ZRF A;  5BMZ A;  2BYV E;  1MKM A;  1K78 A;  2J5O A;  1W7P D;  1SD7 A;  2CYY A;  3TO7 A;  2PMH A;  4ASN A;  2VE8 A;  3O3K A;  3WOD F;  1WKM A;  1WQ2 A;  3EET A;  2RQP A;  1PP7 U;  2Y75 A;  1OPC A;  5L3C A;  1KQ8 A;  1D5V A;  1V3F A;  3TGN A;  1UCR A;  5JI6 A;  2P5K A;  4AWX B;  3HUG A;  3ZN1 A;  5FGM A;  4LD5 A;  3K1N A;  1FSH A;  3F21 A;  1K79 A;  3HTS B;  2NNY A;  2LF8 A;  1USS A;  2D45 A;  1HBX G;  3MFK A;  2GQQ A;  3ZMU A;  1U3E M;  4FT8 A;  2FBH A;  4EMS A;  3C18 A;  1Z6R A;  3S2W A;  4EQQ A;  2XAG A;  1L3L A;  1IRG A;  2GA1 A;  2BBY A;  4OIP F;  1ZN2 A;  3E5X A;  5K5R A;  1O7L A;  3M9A A;  5CVJ A;  4BQA A;  5DDG A;  2M1B A;  4EM0 B;  5EEG A;  3DPL C;  3FMQ A;  5DEQ A;  2YX7 A;  1T39 A;  5CJ9 A;  2TDX A;  3GFI A;  3GVA A;  4HA8 A;  3IKT A;  3FF5 A;  2W25 A;  1TBX A;  3M8E A;  2P7C B;  1MDM B;  4UV8 A;  4EJU A;  2STT A;  1QQI A;  2XV4 S;  3R60 A;  4MNU A;  3LWF A;  2UXX A;  4LB5 A;  1WRJ A;  1TTY A;  3WGH A;  3AAF A;  4M6X A;  4IRI A;  3FXR A;  3WG9 A;  3W6K B;  2P7V B;  3L7W A;  2ZME B;  3MAJ A;  3V7S A;  3T1B A;  1YTY A;  2VBZ A;  2NAZ A;  4BXU A;  1B9N A;  2VT2 A;  2XAS A;  1W7P B;  1Z9C A;  3ZMT A;  3GFL A;  3REO A;  3GUD A;  1RNL A;  1IXS B;  3KE2 A;  4HOB A;  1A04 A;  3HSE A;  2RV8 A;  2DLL A;  1LQ1 A;  1ULY A;  5LHG A;  3NQO A;  2NS0 A;  4P96 A;  2DK5 A;  3CTA A;  1XN7 A;  4L5J A;  4M71 A;  1R1V A;  2L3D A;  3V7R A;  5E8G A;  5LHI A;  3I54 A;  3F6V A;  3GFJ A;  1OMI A;  3KP6 A;  4BHP A;  4H0E A;  2ZBK A;  3WTZ A;  1EH7 A;  4WF2 A;  2EB7 A;  2OQG A;  1FP1 D;  3DFG A;  2HEO A;  5E1Z B;  4HV6 A;  3BJO A;  3WTV C;  1MJ9 A;  5L3D A;  3V8L A;  5HLH A;  2H94 A;  2VT3 A;  3GXO A;  3E6D A;  1P4W A;  3QAH A;  4Q4Z F;  1ZAR A;  2ZNZ A;  2QVO A;  1ZG3 A;  3MQ0 A;  1W5S A;  2CQK A;  4MTD A;  4IF4 A;  3RYP A;  4K2E A;  1FYL A;  4R8H A;  1WSU A;  2D2W A;  1ODD A;  2UXN A;  3HOS A;  5LRS A;  1G3S A;  3EYY A;  2O0Y A;  2OAZ A;  1W5T A;  5CVI A;  2P4W A;  5TRD A;  2EFW A;  2CFX A;  3HRS A;  2FU4 A;  1F5T A;  2XAF A;  3U1D A;  5LEK A;  4N0B A;  5ICC A;  4DQ2 A;  3OV8 A;  1KU9 A;  3ROU A;  3FXU A;  1J5Y A;  2FEZ A;  3TO6 A;  2JSC A;  5AON A;  2PQ8 A;  1J0R A;  1LNW A;  4HQE A;  4GXO A;  3TOA A;  4P9U A;  4N9I A;  1YW9 A;  5KK1 A;  3ML6 A;  1GVJ A;  1HXD A;  3I64 A;  3QP5 A;  3QU3 A;  1E2X A;  1IN8 A;  4EJO A;  2KKO A;  1Z6T A;  3E6B A;  4WXH A;  4KT5 C;  2LDU A;  4RGS A;  1HKT A;  2ETH A;  2KIU A;  3W6J B;  4A5M A;  2BGC A;  3KCC A;  1R5G A;  4U0Y A;  3GFM A;  1CF7 B;  2EJR A;  1FT9 A;  4JK1 X;  2XUB A;  1G4D A;  2IA2 A;  4HF0 A;  3KLO A;  1FSE A;  1HW1 A;  5K5Q A;  2M30 A;  2O03 A;  2XAJ A;  1YLF A;  1Y0U A;  3TDU C;  4KFC A;  1XCV A;  1I1G A;  2CGP A;  2M5W A;  4L5I A;  2QWW A;  1OYI A;  2KJC A;  3CJN A;  2OBP A;  1TNS A;  2FNA A;  3HHH A;  4ENM A;  3RI4 A;  1REP C;  1LEA A;  3JTG A;  2JPB A;  3LST A;  2Y0M A;  1H9G A;  2E1C A;  2F2E A;  1ONV A;  4A12 A;  5ERI A;  2XHK A;  2HR3 A;  2EFN A;  2PEX A;  4LFU A;  4ETS A;  3F72 A;  1IXC A;  2A68 F;  4P9F A;  2RNJ A;  4M9X A;  1TQI A;  2P5L C;  3JSO A;  1K7A A;  2W85 A;  1R58 A;  3WE3 A;  4M9Z A;  4NQW A;  2F5C A;  3H3Z A;  1HKS A;  3IRR A;  1XD7 A;  1XDU A;  2CSO A;  2QBY B;  2MLG A;  4GO1 A;  4RS8 A;  2K7L A;  2ZFW A;  3COA C;  1FX7 A;  3CUQ A;  2VOP A;  4HX8 A;  3BWG A;  2GIV A;  3N97 A;  3DKW A;  4MEY F;  3FHZ A;  2IRF G;  3WTY C;  4A6E A;  3QPH A;  5E20 A;  1KU2 A;  4YFK F;  4Q5S F;  5LGT A;  4RAY A;  3DP7 A;  4NHJ A;  2EV6 A;  3F8F A;  3E5U A;  2OU2 A;  3SXY A;  3EDP A;  1I1S A;  3F8C A;  2DU9 A;  5D5X B;  1QO0 D;  2JT1 A;  1ZRD A;  3C7J A;  5HS7 A;  3HSF A;  4UVA A;  1VTN C;  1Q1H A;  1T2K A;  3B73 A;  3LQQ A;  1S8N A;  3RTR A;  2K4J A;  1G3Y A;  4YFN F;  4KIC A;  2H27 A;  2K02 A;  1JGS A;  3RPU A;  1OYY A;  2FNP A;  4LG0 A;  2MH9 A;  2LNB A;  2M45 A;  4BHB A;  4G9Y A;  3MZH A;  1DP7 P;  2R7F A;  4LLN A;  1PP8 F;  1P4X A;  5F6F A;  5D4S A;  2FF4 A;  4PCQ A;  3EQL F;  1I6X A;  2X0L A;  4KIB A;  1YQA A;  3P9C A;  4O6J A;  3MZY A;  3ZMD A;  1HKQ A;  1FPQ A;  1UHW A;  1ON2 A;  2D1H A;  1ZRC A;  2VBY A;  2BE5 F;  1XGM A;  4ZZD A;  3BDD A;  4YIF A;  3LQR A;  2HS5 A;  2ZXJ A;  5DCM B;  1ZH5 A;  1FBS A;  1YIO A;  2F5D A;  3CO7 C;  2FML A;  1CGP A;  4Y13 A;  3CUO A;  5L3B A;  3VOD A;  1W4M A;  2DT5 A;  4HLY A;  1XGO A;  1RZ4 A;  1O3R A;  4HF2 A;  2QYO A;  4ENN A;  2NNN A;  4UV9 A;  1PDN C;  2V1U A;  2GWR A;  1G3T A;  5FFX A;  2CW0 F;  4RGR A;  3SQN A;  3ERE D;  2EV0 A;  5LGU A;  3Q5F A;  2VC0 A;  4WXC A;  2WV0 A;  1U78 A;  1U5T B;  4RB3 C;  2DPD A;  4BYY A;  4CHU A;  1Z91 A;  3LA2 A;  2UWM A;  1KQ0 A;  4S05 A;  4M72 A;  1TLH B;  3I71 A;  4KYW A;  3RKW A;  4MEX F;  3GW2 A;  3RKY A;  1SD6 A;  3KEQ A;  2PBI A;  2DPU A;  3RIR A;  1MDM A;  1ZLK A;  5HLI A;  4HX7 A;  3E6C C;  4IRH A;  3RPQ A;  3HTU A;  4XLP F;  4HYE A;  2ZME A;  3H3U A;  2FBI A;  2IJL A;  4LLL A;  2ADU A;  1QZZ A;  4A5N A;  2XAH A;  1W7P A;  2YX4 A;  3VB2 A;  2K86 A;  3RDI A;  3D5L A;  1LDJ A;  1V4R A;  1FNN A;  4DNC A;  1OR7 A;  3KZY A;  4OMZ A;  1SAX A;  2HKO A;  5E8I A;  4U88 A;  3WTT C;  1ZYR F;  3HHG A;  3E6M A;  4I02 A;  4G6Q A;  2QLZ A;  1BI0 A;  3GF2 A;  5CVV A;  2A5Y B;  4BH9 A;  4WCG A;  3G73 A;  2RGV A;  3T8T A;  4XLN F;  3RKX A;  4CO8 A;  1TNT A;  3PQJ A;  5J8F A;  2F5F A;  4OIO F;  1D3Y A;  1Z1D A;  2P8T A;  2G9W A;  5BPD A;  4UHT A;  4HAM A;  1RIO H;  4XRF A;  5L3G A;  1ZG1 A;  3K9T A;  5FO5 A;  5ED4 A;  4RGX A;  1XDS A;  3D0S A;  2WWY A;  3CUQ C;  4HW0 A;  5IT3 A;  2O6G E;  3FM3 A;  3O6B B;  1SFU A;  2IA0 A;  4I7H A;  3DQV C;  4EV0 A;  3ZMV A;  2YPR A;  1P4A A;  4EM2 A;  1ZGA A;  2HKX A;  1U8R A;  1HQC A;  5D8K B;  3ULQ B;  2STW A;  2WC2 A;  3VEP A;  4KA4 A;  1BIB A;  5HLG A;  4OIQ F;  1XSX A;  2C6Y A;  4KN7 X;  1D8K A;  5LBQ A;  2IA1 A;  3F22 A;  4MTE A;  1O57 A;  4I0B A;  3V7C A;  4IHT A;  4LMY A;  1T98 A;  3WTU C;  1R23 A;  4PZJ A;  2CWE A;  3ECO A;  4QWQ A;  2L01 A;  4L9V A;  1LB2 A;  4KDP A;  4UVC A;  4S04 A;  1BI1 A;  4MQ9 F;  2JRT A;  1BM9 A;  4I0A A;  4EJT A;  3IC7 A;  4G6D A;  4WX9 A;  1IN7 A;  1S3J A;  4JQF A;  1R22 A;  3C1D A;  3BJ6 A;  2EV5 A;  5DCF A;  2H6B A;  3U2R A;  1IN5 A;  5ICG A;  4G94 A;  3K2Z A;  3KP5 A;  1F9N A;  4XSX F;  1SMT A;  2VC1 A;  3LAJ A;  1CF7 A;  1KYW A;  4A0Y A;  4HX4 A;  4AIH A;  2IT0 A;  4UUV A;  3I53 A;  4OMY A;  2HFH A;  3ELK A;  2QQB A;  1K6O A;  2VE9 A;  1EV7 A;  3JAM K;  1DPR A;  1HW2 A;  1FC3 A;  2W24 A;  1BC8 C;  2MLK A;  2VOD A;  4F7Z A;  3R61 A;  2KIM A;  3DPT A;  5FB2 A;  1SFE A;  2VBW A;  2IPQ X;  2WTE A;  4EJV A;  1YO5 C;  4MHG A;  4KMF A;  3MCZ A;  3GWZ A;  4L0Y B;  3WTX C;  1QNT A;  1GXP A;  1FYM A;  5JVT A;  4MGR A;  4G8X A;  1S7O A;  5DUK A;  5DD8 A;  2PMU A;  2EWN A;  2DFI A;  3EYI A;  1WWX A;  5LLQ A;  1OYW A;  1S6L A;  3MWM A;  4M9S A;  2QBY A;  3LA3 A;  3PQK A;  2A3S A;  2OZ6 A;  2L02 A;  4QLC U;  1LEB A;  2BV6 A;  3CDH A;  4A6D A;  3F23 A;  2V6C A;  3ZPL A;  4RAZ A;  5BPI A;  3FX3 A;  5HDN A;  4OIN F;  3ABT A;  3L09 A;  4LB6 B;  2PI0 A;  1ON1 A;  5F1R A;  1BC7 C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...