4IRGA

Uninhibited dna-binding domain of the ets transcription factor erg
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
98
structure length
98
Chain Sequence
IQRPGSGQIQLWQFLLELLSDSSNSSCITWEGTNGEFKMTDPDEVARRWGERKSKPNMNYDKLSRALRYYYDKNIMTKVHGKRYAYKFDFHGIAQALQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structural and dynamic studies of the transcription factor ERG reveal DNA binding is allosterically autoinhibited.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Dna binding protein
molecule keywords Transcriptional regulator ERG
total genus 33
structure length 98
sequence length 98
ec nomenclature
pdb deposition date 2013-01-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00178 Ets Ets-domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 4irgA00
1FOKA 4CO8A 2FU4A 3WE3A 4CGZA 3QPTA 1P92A 1I5ZA 1ODDA 4OOIA 2D1HA 4N9IA 4KIBA 1OR7A 3CTAA 3ZMUA 4UUVA 5FB2A 1YTYA 1LEAA 3IKTA 3E6BA 1PP8F 2QQBA 1FBSA 1XSVA 3ZN0A 2KJBA 1T6SA 3Q9SA 3DQVC 2GQQA 3RDIA 1XGNA 2E1NA 4L5JA 4G6DA 2IA2A 3DPLC 1IZ1A 1HW2A 4EJVA 2NNNA 3TDZC 1SD4A 1DUXC 1XMAA 2OU2A 5FFZA 4AWXB 4G9YA 2UZKA 5DD8A 2LKPA 1ZYRF 5JVTA 4AIKA 2NRAC 4P96A 3T8RA 2ACJA 1SFUA 3HTSB 4HF1A 4HOBA 3FXUA 2DU9A 2W85A 2W25A 1KQ8A 5ICFA 5L3BA 4KYWA 1H0MA 3QRFF 1OMIA 2HKOA 5IT9K 4EMSA 2COMA 3VFZA 5HLHA 5LEJA 4GO1A 1IXCA 4AIHA 1YLFA 1YO5C 4EM1A 2YPRA 3FM3A 4RB0A 1BC8C 1S7AA 3PFIA 5FO5A 1J5YA 1MJAA 2XV4S 3K69A 2H94A 4YFXF 4WWCA 1IUYA 2RGVA 1W7PD 3BJOA 2EA4A 1R1UA 5E1WA 2K4BA 1LB2A 2ESHA 1L3LA 4U0WA 3OV8A 3FXRA 3I5UA 4AIJA 5DD4A 4YFKF 2HR3A 2HKXA 1FYKA 4F7ZA 1XCVA 4M73A 2VE9A 4YIFA 3FMSA 1SFXA 1U5TA 3CUQB 1FSEA 2CQKA 1QO0D 2FRHA 4CZZA 4ZYDA 1PP7U 3GLXA 1NHAA 3HHHA 3ISPA 4IJAA 1K79A 1ZG5A 4HLXA 1GVJA 4NHJA 2ZNYA 3I0TA 1YFHA 3RPUA 3NRVA 3RIRA 2EWNA 4XRFA 2IW5A 3RI4A 4IXAA 1CGPA 2QBYA 5H20A 4DQ2A 4IHTA 2K7LA 1FBQA 3T0YA 3J7AO 1Z6TA 1JXSA 1ZH5A 1W5TA 3KP5A 4A0ZA 4RAYA 2GXBA 3SZPA 1ZARA 2QQ9A 1Z7UA 4BXUA 1S3JA 1XCBA 1Q1HA 3GZ5A 2VC1A 2V6CA 2NNYA 3KP3A 1TW3A 3GFMA 3TO6A 3JAMK 1G3TA 3WODF 5HDGA 2G7HA 4A5NA 3SZTA 2ADUA 1SD6A 5EEHA 5A2QK 4Y13A 1QNTA 1YYVA 4I0AA 1SFEA 2VOPA 1MD0A 4A12A 3OOPA 1ZRFA 4KICA 2XAJA 3DPTA 1ZN2A 2GA1A 3TO9A 4WXHA 3R6SA 2CGPA 2PI0A 3HRTA 1YIOA 3L00A 5D4SA 5BS6A 4HX7A 1DPRA 1JHHA 2F5DA 1FP1D 1UHWA 2V1UA 2M87A 3T8TA 4P9FA 4Q47A 1TBXA 3ZMSA 3FF5A 3C1DA 4FHTA 3KE2A 1I1GA 5HDKA 3KEQA 4EJWA 3ABTA 1IXSB 3RTRA 2R3SA 4LLNA 3KZYA 4O6JA 1OYIA 5D5VB 2BBYA 2YR2A 5IT9Z 3I58A 3KLOA 4HX8A 4G94A 3F3XA 4L0YB 3QP5A 3KP2A 4A2UA 3C18A 4GYGA 2D2WA 3WTSC 4M6YA 1U78A 3JSOA 1MJBA 2EV6A 5LHIA 2XAQA 4P55A 4ON0A 3VODA 4BHPA 2JPCA 3EUHA 3JW4A 2Y0MA 3V8KA 3U9GA 5FFXA 4AD9A 3D0SA 1BIAA 2DPUA 5FGMA 4ESFA 4LK1F 1IN6A 1XDUA 3K1NA 4IRIA 1STZA 4HV5A 1LJ9A 3IWZA 3MFKA 1IN7A 1BI2A 1IW7F 1JHFA 2EFNA 1WSUA 3MWMA 2IA0A 1B59A 2GA2A 4HA8A 1REPC 5D8LB 1DDNA 1HQCA 3D5LA 2QBYB 2W57A 2WWYA 3LAJA 2ETHA 4EJTA 3I4PA 3CJNA 5KK1A 2P7CB 3IRRA 1TLHB 1MZBA 1T2KA 3BROA 2OQRA 3WTXC 3VEPA 3WU0A 4KA4A 3MZHA 3BJAA 1S7OA 3HOSA 1BI1A 2Z9OA 4L0ZB 1A04A 4UVBA 1D8KA 4ZZLA 2UXNA 3COAC 4S05A 6PAXA 2O8XA 2DFIA 5J6XA 4N9HA 2HFHA 1C0WA 4EVIA 4R79A 1G3YA 1HKSA 2MA3A 1KQ0A 3FM5A 1RZ4A 2K4JA 2VBZA 2EV5A 5KVRA 1RI7A 3G3ZA 2J5OA 2KIUA 4ENKA 1JGSA 4MEYF 1MDMB 2XAGA 3I53A 3V7CA 1U5TC 3FWEA 2XKPA 2YX4A 5L3FA 3WTZA 2FEZA 3BP8A 2NAZA 3KFWX 1I27A 1YG2A 2DQRA 1V3FA 5DCMB 2MD5A 1BJAA 3E5QA 4EGZA 2ESNA 3QU6A 1P4XA 2RNJA 3L2CA 4HAMA 2LDUA 2BE5F 1FWZA 2GZWA 3JAMZ 3E97A 3G73A 1O3RA 4EM2A 2FNPA 5A2QZ 2Z3YA 3M7GA 5D6EA 2DK5A 4PGGA 2VT3A 3TKYA 1ZAOA 4HDUA 4D0PA 4ENMA 1W7PA 3CLOA 2O3FA 3WU1B 3EYIA 2OA4A 5L3EA 1QGPA 5DCMA 5JFRA 5DDGA 2M5WA 4XBFA 2OD5A 1SMYF 2A6EF 4HF0A 4I02A 4U88A 2VT2A 3ZMTA 1R7JA 1R36A 3O2PE 4U7DA 3F8FA 3BDDA 4L9JA 3WGIA 2K27A 2MC3A 4RGUA 4HLYA 1F5TA 3E6MA 4OIPF 2QQAA 5H6RA 5LGUA 3DKWA 3HRUA 3F8BA 4KUMA 1XN7A 1O7FA 2WV0A 3O6BB 3CO6C 3BOQA 1HBXG 3RYPA 3MAJA 2XHKA 3TDUC 2K86A 4EGYA 4G7ZF 1FZPB 1U2WA 2EK5A 1ZGJA 1D8JA 3KP7A 1KU2A 3I71A 1B6AA 1ZRCA 1PUEE 3SFZA 4WXCA 4BHBA 1BIBA 5JR3A 1ZLKA 4M72A 2A68F 3LQQA 2AS5F 1QZZA 4I01A 3CUQC 4YIIA 3M9AA 2HEOA 2YU3A 3NQOA 4OIQF 1HKQA 2BV6A 4LGWA 2A3SA 2PQ8A 5LEKA 2DPDA 1R5GA 5DYMA 5DUIA 3K9TA 3C7JA 3ELKA 2JZYA 4LK0F 2FXAA 3MQ0A 3IKVA 4IPAA 4L9NA 4RGRA 5D5WB 3ZPLA 4MGRA 3QPHA 1G3WA 2DQLA 4U0YA 1HSJA 3FZVA 4EQQA 3VOEA 5HOOA 2XASA 3QAHA 1GHCA 1OYWA 4DNCA 1ZHFA 1B9NA 2DT5A 1R5HA 4MTDA 4IRGA 4HW0A 4XLNF 3V7RA 5BQTA 1UB9A 2XUBA 4HX4A 3WTUC 2PFBA 4KFCA 2ZBKA 2KJCA 1XGOA 5E8GA 1O7LA 3BPXA 3KP4A 4RGSA 4OMZA 2IT0A 4XSZF 3SQNA 4HBLA 1JE8A 1D3YA 3GW2A 1Y0UA 2Y48A 2ZCWA 2QLZA 3RKWA 3DFGA 3HYIA 4FT8A 1ZGAA 3P7NA 1EH6A 2K02A 4KN4X 4JBAA 5TJJA 4H0EA 3Q5FA 4M74A 4G8XA 4I98B 5CVJA 2HYFA 5LHHA 2EB7A 1GXQA 1LDKB 5J8FA 2IVMA 3BWGA 4A6DA 2M1BA 3N4MA 1FYLA 4K2EA 3KLNA 5BMZA 4LB6B 1ZREA 1U6GA 2DAOA 3TO7A 2VC0A 1LQ1A 4XLPF 3F8NA 2L3DA 1RUOA 1J0RA 2DLLA 3F23A 2EV0A 2ZMEB 5DUKA 1BM9A 3NEUA 2KRFA 3DP7A 5BOXA 4WK8F 4MEXF 2P5LC 3TOAA 5K1YA 1KU9A 2HGCA 2V9VA 5EEGA 2O61A 3ZMVA 4L18B 1I6XA 2DI3A 1AOYA 2L01A 4Y17A 2HWVA 5D8KB 1HW5A 3RYRA 1F9NA 4EJUA 3V4GA 1EV7A 1XD7A 2V1DA 2P7VB 1HW1A 2VBXA 1XSDA 4G7OF 1BOAA 1W5SA 3EYYA 3J81K 1YQAA 3HUGA 2QVOA 2A61A 5ICEA 3EQLF 4UNOA 3GWZA 4PDKA 3BJ6A 1P4WA 1T98A 4I09A 4RB1A 2YSRA 3CUQA 2JTVA 5D6FA 4CXFA 1XSXA 3GO5A 5E1ZB 1H9TA 2UXXA 3IL2A 5ILSA 4E70A 1G3SA 2QENA 1YW8A 1F1ZA 1KQ9A 3EDPA 4MTEA 1UFMA 2STTA 4IVNA 3PQKA 3RJPA 1F4KA 2FBHA 4Z2YA 1WI9A 2V1XA 1QZYA 5IT3A 3H92A 2JT1A 2CSOA 3BY6A 3B73A 2LF8A 3DV8A 1L0OC 4ETSA 5AIQA 4S04A 4MHGA 5K5QA 2D1VA 5ERIA 2P4WA 1ON1A 1OKRA 2Z5UA 2HQNA 4YFNF 1XMKA 4XSXF 4MQ9F 1R1TA 2ZMEA 4CYDA 4HDVA 4WX9A 3KP6A 4M9ZA 1MGTA 3GUDA 3ZMZA 4GYIA 4NB5A 1H9GA 4HQEA 4RB3C 1S6LA 3WE2A 5E1XA 3HRSA 2XVCA 1QPMA 1O3SA 3GXOA 3ULQB 2VONA 3WGGA 1B1BA 4M6XA 2B0LA 1KYZA 5AIPA 2HS5A 3K2ZA 5H6QA 3HSRA 3ECHA 2QWWA 4I2OA 4HV6A 4KMFA 5HLGA 2STWA 5F6FA 3CDHA 4OIOF 2FF4A 2PLYA 1Z6RA 2HTJA 1XDSA 2MLKA 4CICA 3F22A 4PGHA 2MH2A 1G6NA 1ZLJA 1HSTA 3H3UA 1UCRA 4FX0A 3MEXA 5E20A 4BYYA 4LJZF 3M8FA 3ML6A 4JQFA 2GWRA 3ZN1A 2ELHA 2C6YA 1RUNA 3IRQA 3K1PA 1Z05A 4I7HA 2VBWA 3FMRA 4HYEA 2E1CA 1W4MA 1TQIA 3J81Z 3F8CA 3WTYC 4LMYA 3HOTA 1HXDA 2Q0OA 2RV8A 2XRNA 3E6CC 1S8NA 2JRTA 4NQWA 2RDPA 2P6TA 1SD5A 3LFKA 2KKOA 1LDJA 5HDNA 5JI6A 1BC7C 2AXLA 3SXYA 4KDPA 3V7SA 5CVRA 2XAFA 2BGCA 4TV7A 2CG4A 5DEQA 2R7DA 4AVPA 4ZH4F 3ZP5A 1K78A 4GXOA 1O3TA 3I54A 1V4RA 3IHUA 2L4MA 1IXRC 3WTWC 3F21A 3Q9VA 1O57A 4L9TA 2CO5A 1MDMA 1XGMA 1T39A 4BHCA 1ZG1A 3RPQA 1Z91A 1J59A 1I1SA 1ONVA 3LA3A 3LQRA 4A0YA 1Z9CA 4O3MA 4LB5A 2P5KA 3REOA 4JK1X 2XROA 3GZ6A 4A5MA 4RS8A 3VB2A 2M45A 4QWQA 2HQRA 1ON2A 3HSEA 1KU3A 1FX7A 3V8JA 3FX3A 2QUFA 1T0FA 4ENNA 2LSOA 3I59A 2LF7A 2ZO4A 2VBYA 2Z99A 2BEOA 5FD6A 5ICGA 1OPCA 2PMUA 2IRFG 3H3ZA 3TGNA 3HHGA 2DW4A 1YW7A 3O3KA 1SD7A 1XB4A 1GXPA 2JPBA 4LD5A 2EFOA 3LWFA 3E6DA 5HS7A 2BYVE 1J75A 3N97A 3R61A 2F5FA 1CF7A 4Y15A 2ISYA 3F6VA 1WKMA 2A69F 5CLSA 1LVAA 2NS0A 4ZYHA 4GCVA 5CVVA 1B4AA 3TOBA 2KIFA 4LFUA 4WCGA 3E5UA 2P8TA 1ULYA 1K78B 1TQPA 2FQ3A 3T1BA 2M8EA 2FSWA 3KZZA 5FD5A 3U2RA 5HVQC 1Z1DA 4O5VA 3QU3A 2DO7A 3K1MA 3ZMDA 1OYYA 1R00A 1P2FA 1KU7A 2XKOA 3LA2A 2FA5A 4G7HF 1KGSA 3MCZA 4ZYEA 3HSFA 3J80K 2ZXJA 1WWXA 3HRMA 1IRGA 1QQIA 4A6EA 4G6QA 2VE8A 4IF4A 2D45A 5LRSA 5K5OA 4MQVA 4ESJA 4U7BA 4UV8A 5BPIA 3F8MA 4RGXA 1E17A 3I64A 3M1EA 5D5UB 1FC3A 4U0VA 2VOOA 5LGTA 2HDCA 2EA2A 4CDGA 3I59B 3KCCA 3LSTA 3HIFA 2OZUA 4R8HA 4EM0B 2YX7A 1FNNA 2A6HF 2PG4A 3V8LA 1VTNC 1YS6A 2G7UA 3FHZA 2R7FA 1MKMA 1FPQA 3SHFA 2J5PA 4PCQA 4L5IA 2FMLA 3K0LA 1D5VA 3KETA 2A07F 5E8IA 1W7PB 4PZJA 1J7KA 5LGNA 5ED4A 1KA8A 2G9WA 3QOPA 2LNBA 4KIFA 1FSHA 5HS9A 5K5RA 1R58A 1J2XA 2PN6A 3DXJF 1J9IA 2TDXA 4B09A 1FBUA 5DCFA 2P5VA 3F72A 1G4DA 2DTRA 4GGGA 1BBYA 2CWEA 5L3GA 5FLXZ 2GIVA 4IRHA 4QLCU 1BI0A 2CFXA 2XIGA 1FLIA 4CHUA 1CF7B 1U3EM 4B8XA 2L54A 4UVCA 1K6OA 1DP7P 5AONA 1ZG3A 2CW0F 1P4AA 3T5XA 5E18F 3GYHX 3P9KA 5ILVA 3WTVC 1EH8A 1TNSA 3EETA 2H6CA 2H09A 4A0XA 2Y75A 3E3VA 3HTUA 1X3UA 4BNCA 2PMHA 2Q2EA 2XAHA 2F2EA 3BPVA 5BPDA 2FMYA 1U5TB 5L3DA 4LG0A 3P9IA 3ROUA 2WTEA 3GF2A 3M8EA 3PQJA 4BAYA 3GX4X 2E7WA 3WG9A 3GFLA 1IN4A 5LLQA 5DV5A 2Q8KA 5LBQA 1XGSA 2V79A 4ASNA 5HS8A 2RC4A 3J80Z 2UWMA 2RVCA 1BI3A 3GFIA 3P9CA 3W6JB 1AWCA 3GFJA 3ECOA 2O6GE 2EJRA 3JSPA 2F5CA 1TNTA 1R22A 3BZ6A 2E7XA 4UVAA 1FP2A 4OINF 1WQ2A 2QM3A 3FMQA 4ZZDA 2OBPA 4MNUA 2HTSA 4LLLA 1LNWA 1T38A 4EV0A 1RIOH 3QP6A 4I0BA 2ZKZA 2IPQX 2OAZA 1HKTA 4UXNA 1USSA 3IC7A 2RKHA 4LG0B 4KMUX 3MZYA 3W6KB 3JTGA 2ZNZA 2FBKA 2RQPA 4EJOA 4HZFA 1IN8A 3U1DA 4FX4A 5ILUA 2VN2A 4ZYGA 1P6RA 2FOKA 2F5EA 1K7AA 5CYVA 3B02A 4M9XA 3RKYA 1E2XA 4RB2C 2VODA 3C3WA 4P9UA 1IN5A 2GAUA 2ZFWA 2Z33A 3R0AA 5CJ9A 2L4AA 4Q48A 3LAPA 2HOEA 3ABUA 2VXZA 3AAFA 5LRRA 2MH9A 1USTA 4Q5SF 2X4HA 3DF8A 3RKXA 5JHUA 1LDDA 2O0YA 1LEBA 4R1HA 1BN5A 1RNLA 4LLGF 1FYMA 2QYOA 5L3CA 4UV9A 5F1RA 3S2WA 1TTYA 3TQNA 2EFWA 5ICCA 4ESBA 4UHTA 4P5OA 2EFPA 2PJPA 3LA7A 4OMYA 1TW2A 3R60A 1S29A 2EFQA 3L9FA 1SAXA 1IF1A 1EH7A 4WF2A 4N0BA 2ZJ2A 3CO7C 1KYWA 2PBIA 1UHMA 2CYYA 3E5XA 3KEOA 3ERED 1B9MA 1WRJA 2OZ6A 5HLIA 4KIGA 2W24A 1U8RA 3WTTC 2DK8A 2H27A 4IHSA 4HQMA 1SMTA 4Q4ZF 1DPUA 4HF2A 1MJ9A 2ISZA 3F6OA 2M30A 2NYXA 3IWFA 4KN7X 3CUOA 3L09A 1QBJA 3R4KA 4BQAA 3JTHA 1R1VA 3FXQA 2OQGA 2GXGA 1R23A 2KIMA 2HZTA 2H6BA 2A5YB 4RAZA 1ZRDA 5D5XB 4BH9A 1IAWA 4ENJA 2QZ8A 5J8CA 2IJLA 4M9SA 2L02A 4WXDA 2JSCA 5TRDA 3GVAA 3R0JA 4M71A 5E17F 5FLXK 3ZQ7A 1IRFA 4KT5C 1TQMA 4OU0A 2XGXA 5CVUA 2PEXA 5LHGA 1YS7A 5F64A 2IA1A 1FY7A 2MLGA 3WGHA 1O3QA 2P6SA 1PDNC 1YW9A 5D4RA 2X0LA 4OIRF 2RN7A 3GEZA 2IP2A 2FNAA 2HYGD 3L7WA 2DBBA 5CVIA 2WC2A 3DEUA 4KNYA 2MBFA 4L9VA 2O03A 4YG2F 2FE3A 2W84A 2FBIA 1FT9A
chains in the Genus database with same CATH superfamily
1FOKA 2NVYJ 5GP9A 3UKGA 3CDLA 3PSFA 2X6WA 3BCBA 4CO8A 4E4HA 2FU4A 3WE3A 4CGZA 3O8GA 3QPTA 1P92A 1I5ZA 2HPIA 3BC8A 1ODDA 4OOIA 2D1HA 4N9IA 4KIBA 1ITYA 3SEZA 3CZ6A 3HPGA 1ZELA 1OR7A 4M6VA 4ANJA 3CTAA 2VASA 3ZMUA 4UUVA 3TP0A 5FB2A 1YTYA 1LEAA 3IKTA 3E6BA 1PP8F 4A3MJ 4QPOA 5J47A 2QQBA 2JA2A 1FBSA 1XSVA 2Y69H 2R7TA 3ZN0A 2HDWA 2KJBA 1T6SA 3Q9SA 3DQVC 1TT0A 2GQQA 2XB5A 3DEWA 3RDIA 1XGNA 2E1NA 3HC7A 4G6DA 2IA2A 4L5JA 3KPHA 4XIDA 3DPLC 1IZ1A 1HW2A 4BQQA 1B72B 4EJVA 5B1BH 2NNNA 1MIJA 3TDZC 2JA5J 2CUZA 3ZQHA 1SD4A 1DUXC 2DFFA 5TGTA 3EUKL 1XMAA 3HEFA 3U21A 2OU2A 2X85A 1V5FA 5FFZA 4AWXB 1RPWA 4ZDOA 2KIQA 4G9YA 2UZKA 5DD8A 2LKPA 1QPIA 1OCZH 1ZYRF 5JVTA 4AIKA 4C2MJ 2NRAC 5F08A 2DOAA 4P96A 3X2QH 2EH3A 4RDUA 3T8RA 2ACJA 1SFUA 3HTSB 4HF1A 4HOBA 1OISA 2CQQA 3DBRB 3FXUA 1S9HA 2DU9A 3JRCA 1WGXA 3TMOA 2TRTA 4RAGA 2W85A 3FXJA 2W25A 1KQ8A 5ICFA 5L3BA 4KYWA 2W82A 1H0MA 3QRFF 1OMIA 2HKOA 2VPLA 5IT9K 5FKKA 1JTYA 3PNTA 4XLEA 4EMSA 1V5EA 4L5EA 2I5UA 2COMA 3MD2A 5C4JJ 3VFZA 5HLHA 2Y0SN 5LEJA 4C9YA 4GO1A 4IZZA 1IJWC 1IXCA 1LVKA 2JK3A 4C3JJ 3LSJA 4Y33A 2TCTA 1GV5A 4YRVA 4B3AA 4AIHA 4CYCB 2KLOA 1YLFA 1YO5C 1OQYA 2Y9ZA 3A02A 4BS9A 3A01A 1ETVA 2R7VA 2VIXA 1Y39A 1N77A 4EM1A 2B9SA 3HL2A 2YPRA 3FM3A 3PSIA 4RB0A 1BC8C 1S7AA 3PFIA 5FO5A 1J5YA 1MJAA 2XV4S 2AQEA 2WAEA 4V19K 3FK7A 1A36A 2M34A 3K69A 2H94A 4YFXF 3V42A 4WWCA 1IUYA 2RGVA 1B8IA 4PJ0C 1JI8A 4D5FA 1W7PD 3BJOA 2DMUA 2IEKA 2M0CA 1ETXA 2EA4A 1R1UA 2Y30A 5E1WA 2AHQA 2K4BA 1Z77A 2KT0A 5HNHA 5E3MA 1LB2A 2ESHA 1L3LA 3Q0VA 4U0WA 2CS3A 1WFXA 1V55H 2DMTA 3OV8A 3FXRA 3I5UA 4AIJA 5DD4A 4C3HJ 4YFKF 2HR3A 2HKXA 2JVHA 4PJMA 2GM4A 1FYKA 4F7ZA 1XCVA 4MO7A 2E5NA 4M73A 2VE9A 1X4OA 4YIFA 4IHVA 3FMSA 1SFXA 4DW6A 1U5TA 3DCFA 3CUQB 1FSEA 2CQKA 4PSXA 1QO0D 4A3CJ 3A0BC 2FRHA 2OPTA 4CZZA 4NC8A 4ZYDA 1PP7U 2LBFB 1DU6A 2E35A 4MLOA 3GLXA 3A2KA 4I76A 1NHAA 2FQ4A 5GTHC 1X19A 2JVGA 2LOOA 2R5YA 4BE2A 2EZIA 2DOFA 2K9LA 3HHHA 3K4JA 3ISPA 4IJAA 2R93J 3Q0UA 1K79A 1ZG5A 3H5NA 4HLXA 1GVJA 4NHJA 2ZNYA 3I0TA 1X4PA 3GBGA 1YFHA 2CV0A 1OR7C 2M7AA 4QSHA 3NRVA 3RPUA 3RIRA 2EWNA 4BEHA 3JRBA 4XRFA 2DMQA 2HYJA 2IW5A 2IBDA 1X3WB 3RI4A 4GFBA 2EZHA 4BDYA 4CCMA 2RNGA 4IXAA 4FE4A 1CGPA 3LSIA 4GRIA 4RM3A 4F92B 2QBYA 3PJRA 5H20A 1QRYA 4DQ2A 3GTMJ 4IHTA 2OTJI 1P7IA 2K7LA 3GTJJ 1FBQA 1PVEA 3BZCA 3T0YA 3QPSA 4RBOA 1VQPI 3J7AO 2HVRA 2HQAA 5HODA 1JT6A 1Z6TA 2VQGA 2OCEA 1JXSA 1ZH5A 2QQ8A 2O9LA 3HZJA 1W5TA 2F6CA 3KP5A 4A0ZA 4RAYA 1BR1A 2GXBA 3SZPA 1ZARA 2QQ9A 3OR1C 1Z7UA 4BXUA 3F9KA 3MKWB 1NK3P 1JUPA 1S3JA 1XCBA 4BQNA 1Q1HA 3TBIA 2O5RA 2VJ4A 3GZ5A 3VSLA 2VC1A 3EUHC 3OS1A 2V6CA 2NNYA 3KP3A 1TW3A 5GTIC 3VYTB 3GFMA 1T95A 3TO6A 4CYCA 3JAMK 1G3TA 2XSDC 3WODF 4M3GA 5HDGA 3CF2A 2G7HA 4JYKA 4A5NA 3ABKH 3SZTA 3U1KA 3S8PA 3JRDA 4XOPA 2ADUA 1SD6A 3A03A 5EEHA 5A2QK 5B1AH 1HLVA 1G59A 4Y13A 1QNTA 1BOBA 1XMXA 1YYVA 2E1MC 4I0AA 3BTCA 1SFEA 3OYLA 2VOPA 1MD0A 1A31A 4A12A 3OOPA 1TWGJ 1ZRFA 2FUG2 4KICA 2JMWA 1E3HA 2XAJA 3OYKA 3DPTA 1ZN2A 2GA1A 1TZLA 4IHXA 1EJ9A 3TO9A 1LE8A 2K9QA 4WXHA 3R6SA 2L9VA 2CGPA 2PI0A 3HRTA 1V5GA 3RSNA 1YIOA 3L00A 2QF7A 5CQGA 5D4SA 1R4MB 4BBRJ 2I8DA 5BS6A 2R5ZB 1UMQA 4IHYA 3QQAA 4HX7A 1DPRA 1JHHA 5J3LA 2F5DA 3S2HJ 5J1RA 1FP1D 1UHWA 1GV2A 2XPVA 2M87A 2V1UA 3T8TA 3OR2C 4JX4A 2N8GA 2MYSA 4P9FA 5KAIC 3OL4A 3IV5A 4Q47A 5C44J 1TBXA 4B1RA 3ZMSA 3FF5A 3C1DA 4FHTA 3KE2A 3SFIA 1I1GA 5HDKA 3KEQA 2F48A 3K7AJ 4EJWA 3ABTA 2ICWG 1IXSB 3RTRA 1RKWA 2R3SA 4LLNA 3KZYA 2R7XA 4O6JA 1OYIA 3DKXA 5D5VB 2BBYA 2YR2A 1AKHA 1VQLI 3LFUA 5IT9Z 3I58A 1D1AA 3LSMA 3KLOA 4HX8A 2CQXA 2DMPA 3HOUJ 2KP6A 4G94A 3F3XA 3K4KA 4L0YB 3QP5A 3KP2A 1Z21A 3A0HC 4A2UA 1K6YA 1WJFA 3MKLA 3C18A 4BGDA 4J01A 2BXYA 2QGUA 4GYGA 2D2WA 3DLAA 5FLVA 3WTSC 1SVMA 5DS9A 3NARA 1JJ8C 4M6YA 1U78A 3BG6A 2PJRA 3JSOA 1MJBA 2EV6A 5LHIA 2XAQA 4P55A 4GDFA 1X1BA 2BVLA 4ON0A 3VODA 1I3AA 2Q2EB 4BHPA 2JPCA 4HNUA 2WB1N 2H8RA 2K9NA 5EZHA 4IOCF 3EUHA 3JW4A 2Y0MA 3V8KA 3CDIA 3U9GA 3VYRB 1S7EA 5FFXA 3IH3A 4AD9A 3MMYB 3D0SA 1BIAA 2DPUA 3PUFA 3FIWA 5FGMA 4CCKA 1D5YA 3BG9A 4ESFA 5M3FJ 3EPZA 4LK1F 1IN6A 4IHWA 1XDUA 3H5AA 3GZNB 2JJ7A 2LH9A 3K1NA 4IRIA 2V4JC 2QSHX 1STZA 4HV5A 1LJ9A 3IWZA 4YEJA 3MFKA 1VQ7I 1IN7A 1POGA 2IAIA 1BI2A 1IW7F 2BY3A 1JHFA 2EFNA 1WSUA 2DT6A 3PFYA 1VQ6I 4DYQA 1LFBA 2A5WA 3MWMA 2IA0A 1B59A 2XGCA 2GA2A 4HA8A 4BJ6C 5CKTA 1FOWA 4I99C 1OCCH 2LVSA 4XONA 5D8LB 1DDNA 1REPC 1D1BA 1HQCA 4E7HA 4JP0A 3D5LA 2QBYB 2W57A 4IL6C 2ME6A 3LAJA 2ETHA 2WWYA 4EJTA 3I4PA 3CJNA 1HCRA 5KK1A 1WJEA 3SDGA 2UUZA 5DM6F 3J7ZI 2P7CB 3K4CA 3IRRA 1TLHB 1OLTA 4D5CA 2BY2A 3OYEA 1MZBA 3VYSB 4XOTA 5EJCA 1YJNI 1T2KA 4XKCA 3RQ4A 3BROA 2OQRA 5GPCA 4F52A 3WTXC 2HOAA 3VEPA 3QOEA 3WU0A 4ZJZA 3W6VA 4KA4A 3MZHA 1VNDA 3BJAA 1S7OA 3LOCA 3M07A 4J19A 2YUSA 5F0CA 1BI1A 3HOSA 2Z9OA 5EG0A 2Z16A 4L0ZB 1A04A 2GOXB 4FE7A 1D8KA 4UVBA 4ZZLA 2UXNA 3COAC 1ZR2A 3BR3A 4S05A 3HKZN 6PAXA 2O8XA 2DFIA 1LUJB 2O8KA 3M4OJ 4AU7A 5FRMA 5J6XA 3IAM2 1Y0NA 4N9HA 2ME0A 2PJRB 1Y8RB 2HFHA 1C0WA 4ZDLA 4EVIA 4R79A 2JA6J 1G3YA 1HKSA 2MA3A 3OYHA 1KQ0A 4IQ4A 4KJZA 3TL4X 1U9OA 4II3A 3K4NA 3FM5A 4A3BJ 1RZ4A 2K4JA 2JUCA 3K10A 2VBZA 2EV5A 5KVRA 1RI7A 3KEYA 3OL3A 3G3ZA 3ABLH 4M3EA 4IQJA 2RQQA 2J5OA 2KIUA 2VL8A 4ENKA 1JGSA 4MEYF 1MDMB 2XAGA 3C2HA 3JRIA 2E5ZA 1J09A 3GTGJ 3S2DJ 1YJ9I 2CV2A 1FMVA 3Q0WA 3I53A 3WHCA 2R7WA 3V7CA 2LLKA 3IH2A 3GTKJ 2K9MA 1U5TC 1JJ6C 3FWEA 1MMDA 2XKPA 3NWTA 3OSFA 1NG7A 2JQ7A 4ITVA 2YX4A 5L3FA 1X1PA 5EDNA 2ZB9A 3WTZA 4W1UA 2BHYA 3S17J 2FEZA 3BP8A 2NAZA 3IH4A 4Z6YA 3KFWX 4IX7A 1I27A 2LYCA 1YG2A 2DQRA 3UR3C 5B66C 3AKZA 2CMPA 1FTZA 1V3FA 5DCMB 3W2AA 3HGYA 5F0HA 2MD5A 3LSPA 1N78A 2LFBA 1BW6A 2Y0SA 1H88C 1BJAA 3E5QA 4EGZA 2ESNA 3QU6A 4CA0A 1KZHA 1P4XA 2RNJA 3L2CA 4HAMA 2LDUA 4BU2A 1FOXA 2BE5F 4OAYA 1VF9A 1FWZA 2DODA 2GZWA 1NK2P 2DT7B 2AO9A 3JAMZ 3E97A 2A6TA 4A69C 3G73A 3BG7A 4LITA 2DA1A 1O3RA 4EM2A 1D0YA 2FNPA 2LY2A 2CU7A 5A2QZ 4RMNA 2LK2A 2Z3YA 4H4KC 5F1JA 2ZXWH 2ZJRF 3OYJA 1IG7A 3M7GA 2R4GA 5D6EA 2DK5A 2WAFA 4PGGA 2VT3A 3TKYA 2E34A 2QSFX 3G1MA 1Z3XA 2GXAA 3C2GA 1DGWY 1ZAOA 1WJAA 1GLNA 4HDUA 1VQ9I 1XG1A 3CCLI 5J4VA 4D0PA 1LE8B 1W7PA 3CLOA 2O3FA 4ENMA 3OIQA 3DLLF 4A3LJ 2ZFUA 3WU1B 2IS6A 1QHHD 1D0ZA 1GDTA 3EYIA 2OA4A 2E71A 4M3DA 2BVMA 5L3EA 1QGPA 5DCMA 5JFRA 5DDGA 2M5WA 2IS1A 4XBFA 3GLLA 2Y2ZA 2DJIA 1QVUA 2BY0A 2OD5A 3ZCOA 1SMYF 2L2OA 2LG4A 3BTLA 2A6EF 4HF0A 4I02A 2H8WA 4U88A 4XLFA 4BL0B 5M5XJ 2VT2A 3ZMTA 1R7JA 3OYNA 3QYBA 1R36A 3O2PE 1VQ5I 4U7DA 3F8FA 2XF6A 1GUUA 3BDDA 1H89C 3OIPA 4L9JA 3WGIA 1DP3A 1X2MA 2LBFA 2K27A 2MC3A 4RGUA 1NG6A 2JRMA 3QPLA 5B3SH 1S5LC 1ZK8A 3E6MA 4HLYA 1F5TA 4IKFA 4OIPF 2LY1A 2QQAA 3H5RA 5H6RA 5LGUA 3HDDA 3OMYA 3CMYA 3DKWA 2LY9A 3HRUA 3F8BA 4KUMA 1XN7A 1O7FA 1YJWI 2WV0A 3O6BB 2MFZA 1TWAJ 3BOQA 3OS2A 3CO6C 1HBXG 2OJED 3HPHA 3RYPA 1M1EB 1HC8A 5IPAA 2ID6A 3MAJA 2NVTJ 2XHKA 3TDUC 2K86A 4EGYA 4P1WA 4G7ZF 3BZKA 3L2QA 1FZPB 1U2WA 4Y7NJ 1SC7A 2EK5A 2ZC2A 1ZGJA 1D8JA 3KP7A 1TT5B 1KU2A 4E7JA 3I71A 1B6AA 3RCOA 1ZRCA 1PUEE 1YRNA 4PFPA 2CV1A 3SFZA 2PX9A 1VQOI 4WXCA 4BHBA 1BIBA 5JR3A 1HOMA 3PO3J 1XPXA 1ZLKA 4M72A 2D5VA 2CW8A 2A68F 2GBYA 1T33A 3LSRA 5K7HA 1X3ZB 4E7ZA 3LQQA 4W97A 1QZZA 1SEUA 4JOMA 2AS5F 4I01A 3CUQC 4YIIA 3FDYA 2XPWA 3M9AA 3ESWB 2HEOA 1MBKA 2YU3A 4G6TB 4M3FA 3BLYA 3PIOF 2L9RA 3NQOA 3JRHA 4OIQF 4MFEA 1HKQA 2BV6A 4LGWA 4HG2A 3L2WA 2A3SA 2PQ8A 5FKOA 3DU6A 4C2UA 3S1RJ 5LEKA 2DPDA 4UB6C 4D7MA 1R5GA 5DYMA 3ASNH 5DUIA 3K9TA 3C7JA 2XF7A 3BTJA 5K7ZA 3ELKA 1MSFC 4Y4RA 2JZYA 4XK4A 1VZ0A 1YE9A 2FXAA 2KZGA 4LK0F 3MQ0A 3IKVA 1TWFJ 2DMNA 2KQRA 3H9QA 4IPAA 4L9NA 3CCRI 3E0JB 4IO9F 4RGRA 5D5WB 1APLC 3ZPLA 4MGRA 4FTHA 1IC8A 3QPHA 1G3WA 3WU2C 2DQLA 5DTDA 4U0YA 1HSJA 3FZVA 4EQQA 3VOEA 5HOOA 2VKEA 2XASA 3QAHA 1GHCA 1OYWA 2E2IJ 1UAAA 4DNCA 1ZHFA 1B9NA 2DT5A 1SVOA 1R5HA 4MTDA 1VQKI 4IRGA 4HW0A 2OUMA 4XLNF 3V7RA 5BQTA 3H1CA 1UB9A 2XUBA 1MSEC 4HX4A 3WTUC 2ZJQF 2V7FA 5IYDJ 4MFDA 4JX6A 2PFBA 4KFCA 1T0FC 2I10A 4N4NB 1R71A 3CCEI 4RLQA 2ZBKA 2KJCA 2XRLA 1XGOA 3D5SC 1G2HA 1BR2A 1OJLA 3BQZA 5E8GA 1WJDA 3CCSI 1O7LA 4UY8I 3BPXA 3KP4A 4RGSA 4OMZA 1DQUA 2IT0A 4XSZF 3SQNA 1JUMA 4HBLA 2F5VA 1JE8A 1D3YA 3GW2A 3GTLJ 1UG2A 1PUFB 1OFCX 1Y0UA 2Y48A 4DYCA 2ZCWA 2WAQA 2QLZA 3K4BA 2DA5A 3RKWA 3DFGA 3HYIA 4XL9A 2DA4A 1MBEA 2NS7A 3S3MA 4FT8A 1ZGAA 3BR2A 3P7NA 1EH6A 3HOZJ 3G4SI 3FXKA 1ETWA 2K02A 3FHNA 4KN4X 2ZMEC 4JBAA 2K3FA 5TJJA 4H0EA 3Q5FA 4M74A 4G8XA 4I98B 5CVJA 2HYFA 3CQZJ 5LHHA 2EB7A 1GXQA 1LDKB 3CMAI 1F43A 5J8FA 1RC9A 2IVMA 3BWGA 5FRNA 4A6DA 2M1BA 2NOJB 4CCJA 3N4MA 5TISC 4K2EA 1FYLA 2YU9J 3KLNA 5BMZA 1EKEA 1ETQA 1X1AA 3GCMA 4LB6B 3SEQA 5JLWA 2X51A 1ZREA 1U6GA 4B47A 2DAOA 2L7MP 1WVRA 2R7RA 3TO7A 2VC0A 1LQ1A 3HBLA 4XLPF 5KAFC 2R5ZA 3F8NA 2V26A 2L3DA 2MABA 5CPRB 2W7NA 4RAFA 3OYBA 3OWTA 2OC6A 1JKQC 1J0RA 1RUOA 2DLLA 3F23A 2EV0A 2ZMEB 5DUKA 1BM9A 3PO2J 1W0UA 3NEUA 2KRFA 3DP7A 1JKRC 4NC6A 1A6QA 5BOXA 4WK8F 3AFHA 1MH3A 4MEXF 2P5LC 3TOAA 5K1YA 3ZR8X 3K4MA 1KU9A 2HGCA 4CUGA 2V9VA 5EEGA 4D7NA 4E7KA 2DA7A 2O61A 2V9KA 3KYCB 1RESA 1IRXA 2AXTC 3PUBA 3ZMVA 4AUXA 3D1NI 4L18B 2XGDA 3MVPA 1TWHJ 5E79C 1EA3A 4F91B 3K6GA 4FETA 2DI3A 1I6XA 1SVLA 2E60A 1AOYA 2L01A 3PL8A 2HWVA 4Y17A 4C3IJ 2E19A 3M1CA 2DDBA 5D8KB 2BW3B 1HW5A 3HJEA 2HOSA 3RYRA 3OOUA 4FQGA 1F9NA 2M3AA 2VQLA 4EJUA 3V4GA 1EV7A 1XD7A 2V1DA 2P7VB 1A5JA 1HW1A 2VBXA 1XSDA 4A3JJ 1DU0A 4G7OF 1BOAA 3S3OA 3QODA 1OCTC 1W5SA 4EATA 3EYYA 2OCCH 1MNMC 3J81K 1YQAA 3HUGA 2QVOA 2A61A 5ICEA 2JSPA 2DA3A 1Z7LA 3EQLF 3CCYA 4UNOA 5KNLA 3GWZA 2E2HJ 2R5YB 4HEA2 2WY8Q 4PDKA 2HQ5A 3BJ6A 1P4WA 1T98A 4I09A 2BOLA 4RB1A 4F93B 2YSRA 3CUQA 2DFEA 2JTVA 3ZQFA 1IGNA 3HOWJ 3GMEA 5D6FA 4CXFA 1TL8A 1QHGA 1XSXA 3GO5A 4XRSG 5E1ZB 4I6ZA 4BJTA 1H9TA 4XKVA 4PSWA 2KMUA 2UXXA 2XSJC 3DU5A 3CP8A 3IL2A 1QZEA 4XM3A 1MH4A 5ILSA 4E70A 3MKZA 1G3SA 2QENA 1YW8A 4E7IA 1F1ZA 5KHDA 1ZR4A 1BA5A 1KQ9A 4A3FJ 3EDPA 4MTEA 2HDDA 4ZYAA 1UFMA 2HNHA 2JWTA 4IVNA 4F55A 2STTA 3HGGA 3PQKA 3RJPA 3CJQB 3SZGA 2K85A 3B6CA 1F4KA 1R6RA 2BZTA 2FBHA 3KIOA 1Q1VA 5M5YJ 1W36D 3CC4I 2KISA 4Z2YA 1WI9A 3L2UA 1ZGWA 1ZQ3P 3IUOA 3RPUD 4Y3OA 2V1XA 2VI6A 1ETYA 1QZYA 5IT3A 3H92A 2JT1A 2CSOA 3BY6A 3HOVJ 2X9DA 3BR1A 2IGOA 3B73A 2LF8A 2X1CA 3DV8A 1L0OC 4XMYA 4ETSA 5AIQA 4XQFA 4S04A 4MHGA 5K5QA 4LIUA 2D1VA 4DBQA 5ERIA 2P4WA 1I39A 1ON1A 3H9JA 1OKRA 2VQCA 2Z5UA 1PYVA 2HQNA 1X1DA 4YFNF 1XMKA 4XSXF 3DBHB 1R9TJ 4MQ9F 4ZDPA 1MNDA 1R1TA 2ZMEA 5BNGA 4CYDA 4HDVA 4WX9A 4B44A 3KP6A 2EPFA 4BDZA 3BT9A 4M9ZA 4X6AJ 2V9PA 1MGTA 3GUDA 1IV8A 3ZMZA 4GYIA 4NB5A 1H9GA 5IP9J 1RR8C 3HB9A 4HQEA 1YITI 5C4XJ 1YX5A 1JTXA 4DGWB 4RB3C 1WJ5A 1S6LA 3WE2A 3G6EI 2X48A 1R5ID 5E1XA 3HRSA 4XN3A 2EIJH 3H36A 2KRCA 2XVCA 3DBLB 3UNGC 1QPMA 1O3SA 3GXOA 4HPQA 3ULQB 3BQYA 2MGQA 3G1LA 5B5EC 2VONA 3WGGA 1B1BA 1BJZA 3DWLE 4M6XA 2B0LA 2HPMA 1KYZA 4D9JA 5AIPA 2HS5A 3K2ZA 5H6QA 1IV6A 3HSRA 4CCLA 1HDPA 2M8GX 1K4SA 3ECHA 2QWWA 5J4YA 4I2OA 4NQWB 4HV6A 5F04A 1FIPA 5IYCJ 1RETA 4KMFA 2EINH 4A3IJ 5HLGA 2STWA 5F6FA 3CDHA 4XKBA 4OIOF 2FF4A 1T56A 3KX2A 2PLYA 3J7YJ 1Z6RA 3OYFA 2HTJA 1K83J 1XDSA 2MLKA 4CICA 4BBSJ 2BW3A 3F22A 4PGHA 2MH2A 1G6NA 3H3VK 2KFDA 1ZLJA 1HSTA 2KZVA 5K7FA 3CESA 3GTQJ 3H3UA 1UCRA 1OCPA 3MEXA 4FX0A 1UZCA 5E20A 1XX5A 4LJZF 4BYYA 3M8FA 3ML6A 2W48A 2JN6A 4JQFA 2ELJA 3W2VA 2GWRA 3JRGA 5FKLA 3ZN1A 2L5QA 2ELHA 1AU7A 2C6YA 2P0WA 1RUNA 4D1QA 3IRQA 1OCRH 2FX0A 3H0DA 5KCMA 2KDOA 1AHDP 3K1PA 1Z05A 4I7HA 1FTTA 3RKQA 2VBWA 1I6HJ 3FMRA 4HYEA 4AM3A 3AG4H 2QA4I 2E1CA 1W4MA 2VKVA 1TQIA 3M8JA 5HNFA 3J81Z 3F8CA 1LFUP 2W00A 4LMYA 3WTYC 3HOTA 1HXDA 1MW7A 3HOXJ 1T08B 2NVQJ 2Q0OA 2RV8A 2XRNA 3E6CC 1S8NA 1WHUA 3HKZA 3LL7A 2JRTA 4NQWA 4BACA 2RDPA 2P6TA 1SD5A 3LFKA 2KKOA 1LDJA 1QU3A 3CCMI 2DOEA 4NBQA 3JREA 5HDNA 5JI6A 1N25A 1TP4A 4AIDA 1BC7C 2AXLA 3SXYA 4KDPA 2BY1A 4PJLA 3V7SA 9ANTA 5CVRA 2XAFA 2BGCA 1FOYA 4TV7A 3E1SA 1X1CA 4XLCA 2XC7A 1Y56A 2CG4A 1BL0A 2PMZN 5DEQA 2R7DA 3AG2H 4AVPA 1MBGA 4ZH4F 4A3DJ 4AYBA 3ZP5A 1K78A 1IDYA 4GXOA 1O3TA 3I54A 5EGOB 1V4RA 3IHUA 1ORKA 2L4MA 1IXRC 4U87A 3WTWC 4KT6A 4LG3A 3F21A 3Q9VA 2CRGA 3MKYB 4A3EJ 2HVSA 1VI0A 1S72I 1ETKA 4J00A 1O57A 4L9TA 1WI3A 2CO5A 1XGMA 3FISA 3VDXA 2K40A 1T39A 1MDMA 2OTLI 4BHCA 2H1KA 5E3NA 1ZG1A 1W1WE 1YX3A 5J1YA 2ECBA 2EQRA 3RPQA 4BQOA 1Z91A 4HNTA 3S93A 4BUPA 1J59A 1I1SA 2M4KA 3L2RA 3A4CA 2NVXJ 1ONVA 1GVDA 3LA3A 3W3CA 3OYGA 4XRMA 3KYDB 3LQRA 4A0YA 3AG3H 2PMZA 1Z9CA 4O3MA 4CCOA 4LB5A 2P5KA 3REOA 2BHZA 4JK1X 2XROA 2WA0A 1PJRA 3GZ6A 4A5MA 1WCMJ 4RS8A 3VB2A 1ENHA 1DGRM 2M45A 4QWQA 2HQRA 1ON2A 3HSEA 1KU3A 1FX7A 3V8JA 1MBHA 2L7KA 3FX3A 3TW6A 2QUFA 3N05A 4UB8C 3K70C 1T0FA 1QVTA 2F4IA 4ZTJA 4ENNA 2HVQA 2WADA 4JX5A 2KPMA 2LSOA 3I59A 2LF7A 2ZO4A 5GAEJ 2VBYA 2E1MB 3CF5F 3DPUA 2Z99A 2BEOA 1A6IA 5FD6A 5ICGA 1MMSA 1D1CA 2DCEA 1OPCA 4XLAA 4AYBN 2PMUA 2IRFG 3BTIA 4CSWA 3H3ZA 3TGNA 4DOZA 3HHGA 4DJAA 3VWBA 3P5JA 2DW4A 1FEXA 1WPKA 1YW7A 2IS4A 2ZSIB 5IP7J 4PK4A 3LSKA 3O3KA 3S1NJ 3G71I 2XGEA 2XF5A 1SD7A 2M7BA 1XB4A 1GXPA 2JPBA 4LD5A 2EFOA 4B4CA 3LWFA 3E6DA 5HS7A 1BR4A 2BYVE 1H8AC 3KZIC 1J75A 5IY5H 3N97A 3K2AA 3FXLA 4ZTFA 1U9NA 2EZLA 3R61A 2F5FA 1CF7A 2R92J 2QSGX 3AL0B 4Y15A 3NAUA 2ISYA 4RLFA 2FJ1A 3F6VA 1HA8A 3HM5A 1WKMA 2B63J 3I4NJ 2A69F 5CLSA 3OY9A 1LVAA 2VJ5A 2NS0A 4ZYHA 2ID3A 1B8IB 1UG0A 4GCVA 1B4AA 2KL4A 5CVVA 2KIFA 4LFUA 3TOBA 4WCGA 3E5UA 2P8TA 3I55I 1ULYA 4Y52J 1Y1WJ 2B7EA 3ZQLA 3MZ8A 2LTPA 4F3QA 2AQFA 1K78B 3JRAA 4IEJA 4RA2A 2QKLB 2LC2A 1TQPA 4QPQA 2WV1A 2FQ3A 5GAHJ 4V2FA 3T1BA 2M8EA 4KISA 2FSWA 3KZZA 5FD5A 3U2RA 5HVQC 3VPRA 1Z1DA 4O5VA 3QU3A 2DO7A 3A1YA 1P7JA 3K1MA 3ZMDA 1OYYA 1R00A 1P2FA 3O8HA 1ERDA 1YIJI 3H0GJ 1KU7A 5DM7F 5GAGJ 2XKOA 5EYRA 3LA2A 2O7OA 1IUFA 1IDZA 3JR9A 2FA5A 4G7HF 5J1UA 1KGSA 3MCZA 2JA7J 2CQNA 4ZYEA 3HSFA 3J80K 2ZXJA 4B43A 1WWXA 3HRMA 4S0HB 1IRGA 2X6XA 2ELKA 2L9NA 3BCAA 4DZPA 1QQIA 3QYFA 5IYBJ 3FKJA 4A6EA 4G6QA 2VE8A 1VQMI 4IF4A 1R4NB 2D45A 5LRSA 5K5OA 3M3YJ 4MQVA 1NTCA 1EF4A 4ESJA 1WZ2A 4U7BA 4UV8A 2X6OA 5BPIA 3FKIJ 3F8MA 4RGXA 3EUAA 1E17A 2LKSA 3K4LA 1JKPC 2IGNA 3I64A 4B48A 3M1EA 5D5UB 1FC3A 4U0VA 2VOOA 5LGTA 4BKXA 2EA2A 4CDGA 2HDCA 3I59B 1W0TA 4NC7A 3RZDJ 3KCCA 3LSTA 1CQTA 3H9GA 2EIKH 3HIFA 5EF6A 2OZUA 4R8HA 2WBMA 4OAZA 5GADJ 2DN0A 2WAQN 4EM0B 2YX7A 1FNNA 2A6HF 2PG4A 3F0CA 3HG9A 3V8LA 4XRSA 3ABMH 3DKYA 1VTNC 1V54H 1YS6A 2G7UA 4E7SA 1OCOH 3FHZA 2LP0A 5HLTA 1U0JA 2VKDA 2R7FA 1MKMA 2DYSH 1FPQA 2RAEA 1O4XA 1U8BA 3SHFA 2J5PA 4PCQA 4L5IA 1XTAA 3BR6A 2FMLA 3K0LA 3ZOBA 4BXFA 1D5VA 1Z67A 3KETA 3PNVA 2A07F 5E8IA 4DYRA 1W7PB 2Z2SB 3DTKA 4BE0A 4PZJA 1J7KA 3AL0C 3FBIB 1LFPA 5LGNA 4AC0A 2CQ7A 5ED4A 1ETOA 1KA8A 3BR0A 2G9WA 3I3LA 3QOPA 2LNBA 4KIFA 2XPUA 1FSHA 5HS9A 5K5RA 3CCVI 2IS2A 1R58A 1J2XA 2PN6A 3DXJF 1J9IA 2TDXA 2GOMA 4B09A 3ERMA 1FBUA 5DCFA 2P5VA 3F72A 2WB1A 3PIPF 2ZJPF 1G4DA 2DTRA 2LD5A 4GGGA 3NWSA 1BBYA 4N4OB 3S1QJ 4CH7A 2CWEA 3H35A 5L3GA 2YS9A 5FLXZ 1TC3C 1YOVB 1W36C 2GIVA 4XORA 2R7ZJ 2EZKA 3SYTA 4IRHA 4QLCU 3G1OA 1BI0A 2CFXA 2G0EA 2XIGA 1FLIA 4CHUA 4A3GJ 1CF7B 3Q3SA 4HSTA 1U3EM 4B8XA 5EZGA 3BG5A 2L54A 4UVCA 1P9QC 1LPQA 3C2BA 1K6OA 1DP7P 5AONA 3ZQGA 1ZG3A 4BE1A 2CW0F 4PUSA 1P4AA 3T5XA 5E18F 3TEDA 2A05A 4HRIA 3RZOJ 3AG1H 2M0MA 4AVZA 2HZDA 4UUSB 3P9KA 3PM1A 3GYHX 2K5CA 5ILVA 5EG0B 2HXIA 1BW5A 3WTVC 1EH8A 3CCQI 1YRNB 1TNSA 3EETA 3FK6A 4CCNA 3CCUI 2EIMH 2H6CA 3ZXSA 2H09A 1WJCA 4XKWA 1XC5A 4A0XA 3L2VA 2R7UA 2LR8A 2IXSA 2BXZA 2Y75A 4NNJA 3ASOH 3BR5A 3IAS2 3SDBA 3OSGA 3E3VA 3HTUA 1X3UA 2X1EA 5E3LA 4DIQA 2DA2A 4BNCA 2PMHA 2Q2EA 1AA7A 2XAHA 2F2EA 3BPVA 4E6KG 5BPDA 3CLQA 2DDAA 2L7ZA 2DXIA 2CFOA 2FMYA 1U5TB 4OWRB 5L3DA 1VQ4I 4LG0A 3P9IA 4XICA 2L0KA 3ROUA 2WTEA 3GF2A 3M8EA 3PQJA 5FROA 2GIZA 4BXXJ 4BAYA 2VUMJ 2OV7A 3GX4X 1FMWA 5GPAA 3ONQA 2MG4A 2E7WA 2E36A 4HNVA 3WG9A 5C3EJ 2L7FP 1F36A 5FLMJ 3GFLA 1IN4A 5LLQA 3A01B 2KRHA 5DV5A 2COBA 3LSHA 2Q8KA 3LMMA 5LBQA 2VXDA 3ZRGA 2LRDA 1YHQI 1XGSA 2LMDA 2HXOA 4QTRA 2V79A 4ASNA 5HS8A 2OF7A 3K70D 2HI3A 2RC4A 3J80Z 2K3PA 4DBRA 2UWMA 1X2NA 2RVCA 4KITB 3CC7I 1BI3A 3GFIA 3P9CA 3W6JB 3FXMA 1AWCA 2IGMA 3GFJA 1ZKGA 3CJTB 3ECOA 4BY7J 2VPRA 2O6GE 2EJRA 1KONA 5H2FC 3FBNB 1VQ8I 4FASD 3JSPA 2NXNB 1VFCA 5M3MJ 1SFOJ 2F5CA 2KHMA 3BG3A 3OIOA 1TNTA 3G2BA 4XN0A 1R22A 3OYDA 1XS9A 3BZ6A 2HU9A 4II2A 2E7XA 4C30A 4UVAA 1FP2A 4OINF 1WQ2A 2QM3A 4PFOA 3PNYA 3S3NA 2Y31A 1RR7A 4A3KJ 3FMQA 2CUJA 2X1DA 4ZZDA 1E3PA 2OBPA 4MNUA 2HTSA 5LFAA 4LLLA 3DEEA 2H1LA 1LNWA 1K61A 1T38A 1IRZA 3I56I 4EV0A 2VQHA 1RIOH 4QIWN 3QP6A 3QYEA 2FD5A 2M9HA 4B3XA 4A93J 4I0BA 2ZKZA 4BY1J 4FCYA 2IPQX 4NUBA 3LNQA 5LD2C 2OAZA 1HKTA 2F4OB 4UXNA 1E0EA 1USSA 3IC7A 2RKHA 3CMMA 3CMEI 4LG0B 4KMUX 3MZYA 3W6KB 3JTGA 5M5WJ 2DJNA 2ZNZA 1Y1VJ 2FBKA 1LKXA 2RQPA 4EJOA 2GLOA 4HZFA 1IN8A 3U1DA 5JLXA 4G12A 1N75A 2CJJA 1SFKA 1HF0A 3RQIA 2Z1DA 4FX4A 5ILUA 2M2EA 2VN2A 2Y9YA 1P6RA 4ZYGA 2FOKA 2F5EA 1K7AA 1I50J 5CYVA 2LKXA 2ZSHB 3B02A 4E7LA 4M9XA 3RKYA 2DYRH 1E2XA 2WY7Q 4YELA 3JRFA 4RB2C 1TWCJ 3OYMA 2NVUB 1HDDC 2XB0X 2VODA 3C3WA 4P9UA 1IN5A 2QEXI 1GT0C 1D0XA 2F4MB 2QKMB 1YI2I 1B72A 2GAUA 1Y8QB 5FKMA 3IP4B 1WJBA 2VJJA 2ZFWA 4X1EA 2Z33A 3R0AA 5CJ9A 2L4AA 4Q48A 1WH7A 2W4SA 2MSYA 4MIMA 3LAPA 2HOEA 3ABUA 1Y6IA 3OYIA 3DTIA 2VXZA 3AAFA 3TW7A 5LRRA 2MH9A 2NOGA 3D5RC 1G8XA 3TP3A 1USTA 4Q5SF 2LREA 2X4HA 3DF8A 4FISA 3RKXA 5JHUA 5FKNA 1LDDA 2UV1A 1VQNI 2O0YA 4NDLA 3OS0A 5EGOA 1LEBA 4HSRA 3CD6I 3HUGB 2W1OA 3I4MJ 2R0QC 5IOYA 3CCJI 2RREA 2K9SA 3GTPJ 1MBJA 1MNEA 4R1HA 1BN5A 1RNLA 4LLGF 1FYMA 2R7QA 2QCOA 2P81A 2HOTA 3WHBA 2V6EA 2QYOA 4X0GA 1RKTA 5L3CA 3ZGKA 5JHFA 2ZXHA 3OYCA 5J40A 5F27A 4UV9A 1SAUA 3S2WA 1TTYA 5F1RA 4V2GA 1ACIA 1UELB 4PJJA 3TQNA 1FIAA 2EFWA 5ICCA 3ZQQA 4LIVA 4ESBA 1FJLA 3DTEA 4UHTA 4P5OA 2EFPA 2PJPA 3LA7A 4OMYA 2ECCA 1TW2A 3R60A 1PUFA 1S29A 2EFQA 3CP2A 3L9FA 1SAXA 1IF1A 1EH7A 2XAUA 4WF2A 4N0BA 4C2TA 2R7SA 3E7LA 2ZJ2A 2DA6A 2E1OA 2FOWA 3CO7C 1KYWA 2CUEA 3QWLA 4DZJA 1W5CC 2PBIA 3SJMA 1UHMA 2CYYA 3E5XA 3KEOA 3L1PA 1AKHB 3ERED 1B9MA 1WRJA 4RM2A 2OZ6A 5HLIA 4KIGA 5E3OA 1JT0A 4XNFA 2E2JJ 3S16J 2W24A 1U8RA 3WTTC 2DK8A 1NH3A 2H27A 4IHSA 4HQMA 1SMTA 4Q4ZF 3KYLA 1DPUA 2M4GA 2CW7A 2VKHA 4HF2A 1MJ9A 2EILH 2ISZA 3F6OA 1SANA 2M30A 1T8IA 2NYXA 3IWFA 4KN7X 4UUTA 3CUOA 4XR6A 4ABZA 4PJNA 3L09A 1UHSA 3R4KA 1MMNA 1QBJA 3HOYJ 3J7AY 1RRJA 4BQAA 2JA8J 5EEAA 3JTHA 3WG7H 4YIRX 1R1VA 3FXQA 1E3OC 2OQGA 1I3QJ 4CZCA 5IOZA 1IO2A 2GXGA 1R23A 2KIMA 1Z0XA 2H6BA 2HZTA 2A5YB 4RAZA 1ZRDA 2EBIA 5D5XB 3ZQCA 3VYUB 4LOCA 4BH9A 1IAWA 1QA6A 4ENJA 2IGKA 4UUSA 1MMAA 2QZ8A 5J8CA 2IJLA 4M9SA 1ZTRA 3GTOJ 2L02A 4WXDA 4EEFG 2JSCA 3B6AA 5TRDA 1R49A 3GVAA 3R0JA 4M71A 5E17F 2Q1ZB 5FLXK 2DTZA 3ZQ7A 2MW8A 3FXOA 4ZC3A 1IRFA 2VB6A 4KT5C 4IOAF 1TQMA 2DFHA 4OU0A 3S1MJ 3W2WA 2CUFA 2XGXA 5CVUA 2CH0A 2PEXA 1MMGA 3CJRB 5LHGA 1YS7A 5F64A 3I9V2 2IA1A 1FY7A 2MLGA 3HXLA 4XLHA 2X6YA 2MC4A 3WGHA 3LSGA 1O3QA 2P6SA 2NS8A 2KDZA 3S32A 1Z3YA 4M3BA 1PDNC 2V1NA 1MBFA 1JUSA 5FJ8J 2XDVA 1K4TA 1YW9A 3MN2A 5D4RA 2X0LA 1A35A 4OIRF 2RN7A 3VSKA 3GEZA 2IP2A 5JVGF 1UJ8A 2MD0A 5CQEA 1JGGA 1JKOC 2FNAA 2HYGD 2L9SA 3L7WA 2DBBA 3ZQIA 3S15J 1WH5A 5CVIA 2VLAA 2WC2A 5F0FA 2ZXIA 2VJIA 3S14J 3CC2I 4BEHB 2JUGA 3DEUA 3JCUC 4KNYA 2MBFA 4L9VA 2O03A 1X58A 4YG2F 2FE3A 2R7OA 4BJ5C 3OYAA 2W84A 2FBIA 5IP6A 1FT9A
chains in the Genus database with same CATH topology
1FOKA 4CO8A 2FU4A 3WE3A 4CGZA 3QPTA 1P92A 1I5ZA 1ODDA 4OOIA 2D1HA 4N9IA 4KIBA 1OR7A 3CTAA 3ZMUA 4UUVA 5FB2A 1YTYA 1LEAA 3IKTA 3E6BA 1PP8F 2QQBA 1FBSA 1XSVA 3ZN0A 2KJBA 1T6SA 3Q9SA 3DQVC 2GQQA 3RDIA 1XGNA 2E1NA 4L5JA 4G6DA 2IA2A 3DPLC 1IZ1A 1HW2A 4EJVA 2NNNA 3TDZC 1SD4A 1DUXC 1XMAA 2OU2A 5FFZA 4AWXB 4G9YA 2UZKA 5DD8A 2LKPA 1ZYRF 5JVTA 4AIKA 2NRAC 4P96A 3T8RA 2ACJA 1SFUA 3HTSB 4HF1A 4HOBA 3FXUA 2DU9A 2W85A 2W25A 1KQ8A 5ICFA 5L3BA 4KYWA 1H0MA 3QRFF 1OMIA 2HKOA 5IT9K 4EMSA 2COMA 3VFZA 5HLHA 5LEJA 4GO1A 1IXCA 4AIHA 1YLFA 1YO5C 4EM1A 2YPRA 3FM3A 4RB0A 1BC8C 1S7AA 3PFIA 5FO5A 1J5YA 1MJAA 2XV4S 3K69A 2H94A 4YFXF 4WWCA 1IUYA 2RGVA 1W7PD 3BJOA 2EA4A 1R1UA 5E1WA 2K4BA 1LB2A 2ESHA 1L3LA 4U0WA 3OV8A 3FXRA 3I5UA 4AIJA 5DD4A 4YFKF 2HR3A 2HKXA 1FYKA 4F7ZA 1XCVA 4M73A 2VE9A 4YIFA 3FMSA 1SFXA 1U5TA 3CUQB 1FSEA 2CQKA 1QO0D 2FRHA 4CZZA 4ZYDA 1PP7U 3GLXA 1NHAA 3HHHA 3ISPA 4IJAA 1K79A 1ZG5A 4HLXA 1GVJA 4NHJA 2ZNYA 3I0TA 1YFHA 3RPUA 3NRVA 3RIRA 2EWNA 4XRFA 2IW5A 3RI4A 4IXAA 1CGPA 2QBYA 5H20A 4DQ2A 4IHTA 2K7LA 1FBQA 3T0YA 3J7AO 1Z6TA 1JXSA 1ZH5A 1W5TA 3KP5A 4A0ZA 4RAYA 2GXBA 3SZPA 1ZARA 2QQ9A 1Z7UA 4BXUA 1S3JA 1XCBA 1Q1HA 3GZ5A 2VC1A 2V6CA 2NNYA 3KP3A 1TW3A 3GFMA 3TO6A 3JAMK 1G3TA 3WODF 5HDGA 2G7HA 4A5NA 3SZTA 2ADUA 1SD6A 5EEHA 5A2QK 4Y13A 1QNTA 1YYVA 4I0AA 1SFEA 2VOPA 1MD0A 4A12A 3OOPA 1ZRFA 4KICA 2XAJA 3DPTA 1ZN2A 2GA1A 3TO9A 4WXHA 3R6SA 2CGPA 2PI0A 3HRTA 1YIOA 3L00A 5D4SA 5BS6A 4HX7A 1DPRA 1JHHA 2F5DA 1FP1D 1UHWA 2V1UA 2M87A 3T8TA 4P9FA 4Q47A 1TBXA 3ZMSA 3FF5A 3C1DA 4FHTA 3KE2A 1I1GA 5HDKA 3KEQA 4EJWA 3ABTA 1IXSB 3RTRA 2R3SA 4LLNA 3KZYA 4O6JA 1OYIA 5D5VB 2BBYA 2YR2A 5IT9Z 3I58A 3KLOA 4HX8A 4G94A 3F3XA 4L0YB 3QP5A 3KP2A 4A2UA 3C18A 4GYGA 2D2WA 3WTSC 4M6YA 1U78A 3JSOA 1MJBA 2EV6A 5LHIA 2XAQA 4P55A 4ON0A 3VODA 4BHPA 2JPCA 3EUHA 3JW4A 2Y0MA 3V8KA 3U9GA 5FFXA 4AD9A 3D0SA 1BIAA 2DPUA 5FGMA 4ESFA 4LK1F 1IN6A 1XDUA 3K1NA 4IRIA 1STZA 4HV5A 1LJ9A 3IWZA 3MFKA 1IN7A 1BI2A 1IW7F 1JHFA 2EFNA 1WSUA 3MWMA 2IA0A 1B59A 2GA2A 4HA8A 1REPC 5D8LB 1DDNA 1HQCA 3D5LA 2QBYB 2W57A 2WWYA 3LAJA 2ETHA 4EJTA 3I4PA 3CJNA 5KK1A 2P7CB 3IRRA 1TLHB 1MZBA 1T2KA 3BROA 2OQRA 3WTXC 3VEPA 3WU0A 4KA4A 3MZHA 3BJAA 1S7OA 3HOSA 1BI1A 2Z9OA 4L0ZB 1A04A 4UVBA 1D8KA 4ZZLA 2UXNA 3COAC 4S05A 6PAXA 2O8XA 2DFIA 5J6XA 4N9HA 2HFHA 1C0WA 4EVIA 4R79A 1G3YA 1HKSA 2MA3A 1KQ0A 3FM5A 1RZ4A 2K4JA 2VBZA 2EV5A 5KVRA 1RI7A 3G3ZA 2J5OA 2KIUA 4ENKA 1JGSA 4MEYF 1MDMB 2XAGA 3I53A 3V7CA 1U5TC 3FWEA 2XKPA 2YX4A 5L3FA 3WTZA 2FEZA 3BP8A 2NAZA 3KFWX 1I27A 1YG2A 2DQRA 1V3FA 5DCMB 2MD5A 1BJAA 3E5QA 4EGZA 2ESNA 3QU6A 1P4XA 2RNJA 3L2CA 4HAMA 2LDUA 2BE5F 1FWZA 2GZWA 3JAMZ 3E97A 3G73A 1O3RA 4EM2A 2FNPA 5A2QZ 2Z3YA 3M7GA 5D6EA 2DK5A 4PGGA 2VT3A 3TKYA 1ZAOA 4HDUA 4D0PA 4ENMA 1W7PA 3CLOA 2O3FA 3WU1B 3EYIA 2OA4A 5L3EA 1QGPA 5DCMA 5JFRA 5DDGA 2M5WA 4XBFA 2OD5A 1SMYF 2A6EF 4HF0A 4I02A 4U88A 2VT2A 3ZMTA 1R7JA 1R36A 3O2PE 4U7DA 3F8FA 3BDDA 4L9JA 3WGIA 2K27A 2MC3A 4RGUA 4HLYA 1F5TA 3E6MA 4OIPF 2QQAA 5H6RA 5LGUA 3DKWA 3HRUA 3F8BA 4KUMA 1XN7A 1O7FA 2WV0A 3O6BB 3CO6C 3BOQA 1HBXG 3RYPA 3MAJA 2XHKA 3TDUC 2K86A 4EGYA 4G7ZF 1FZPB 1U2WA 2EK5A 1ZGJA 1D8JA 3KP7A 1KU2A 3I71A 1B6AA 1ZRCA 1PUEE 3SFZA 4WXCA 4BHBA 1BIBA 5JR3A 1ZLKA 4M72A 2A68F 3LQQA 2AS5F 1QZZA 4I01A 3CUQC 4YIIA 3M9AA 2HEOA 2YU3A 3NQOA 4OIQF 1HKQA 2BV6A 4LGWA 2A3SA 2PQ8A 5LEKA 2DPDA 1R5GA 5DYMA 5DUIA 3K9TA 3C7JA 3ELKA 2JZYA 4LK0F 2FXAA 3MQ0A 3IKVA 4IPAA 4L9NA 4RGRA 5D5WB 3ZPLA 4MGRA 3QPHA 1G3WA 2DQLA 4U0YA 1HSJA 3FZVA 4EQQA 3VOEA 5HOOA 2XASA 3QAHA 1GHCA 1OYWA 4DNCA 1ZHFA 1B9NA 2DT5A 1R5HA 4MTDA 4IRGA 4HW0A 4XLNF 3V7RA 5BQTA 1UB9A 2XUBA 4HX4A 3WTUC 2PFBA 4KFCA 2ZBKA 2KJCA 1XGOA 5E8GA 1O7LA 3BPXA 3KP4A 4RGSA 4OMZA 2IT0A 4XSZF 3SQNA 4HBLA 1JE8A 1D3YA 3GW2A 1Y0UA 2Y48A 2ZCWA 2QLZA 3RKWA 3DFGA 3HYIA 4FT8A 1ZGAA 3P7NA 1EH6A 2K02A 4KN4X 4JBAA 5TJJA 4H0EA 3Q5FA 4M74A 4G8XA 4I98B 5CVJA 2HYFA 5LHHA 2EB7A 1GXQA 1LDKB 5J8FA 2IVMA 3BWGA 4A6DA 2M1BA 3N4MA 1FYLA 4K2EA 3KLNA 5BMZA 4LB6B 1ZREA 1U6GA 2DAOA 3TO7A 2VC0A 1LQ1A 4XLPF 3F8NA 2L3DA 1RUOA 1J0RA 2DLLA 3F23A 2EV0A 2ZMEB 5DUKA 1BM9A 3NEUA 2KRFA 3DP7A 5BOXA 4WK8F 4MEXF 2P5LC 3TOAA 5K1YA 1KU9A 2HGCA 2V9VA 5EEGA 2O61A 3ZMVA 4L18B 1I6XA 2DI3A 1AOYA 2L01A 4Y17A 2HWVA 5D8KB 1HW5A 3RYRA 1F9NA 4EJUA 3V4GA 1EV7A 1XD7A 2V1DA 2P7VB 1HW1A 2VBXA 1XSDA 4G7OF 1BOAA 1W5SA 3EYYA 3J81K 1YQAA 3HUGA 2QVOA 2A61A 5ICEA 3EQLF 4UNOA 3GWZA 4PDKA 3BJ6A 1P4WA 1T98A 4I09A 4RB1A 2YSRA 3CUQA 2JTVA 5D6FA 4CXFA 1XSXA 3GO5A 5E1ZB 1H9TA 2UXXA 3IL2A 5ILSA 4E70A 1G3SA 2QENA 1YW8A 1F1ZA 1KQ9A 3EDPA 4MTEA 1UFMA 2STTA 4IVNA 3PQKA 3RJPA 1F4KA 2FBHA 4Z2YA 1WI9A 2V1XA 1QZYA 5IT3A 3H92A 2JT1A 2CSOA 3BY6A 3B73A 2LF8A 3DV8A 1L0OC 4ETSA 5AIQA 4S04A 4MHGA 5K5QA 2D1VA 5ERIA 2P4WA 1ON1A 1OKRA 2Z5UA 2HQNA 4YFNF 1XMKA 4XSXF 4MQ9F 1R1TA 2ZMEA 4CYDA 4HDVA 4WX9A 3KP6A 4M9ZA 1MGTA 3GUDA 3ZMZA 4GYIA 4NB5A 1H9GA 4HQEA 4RB3C 1S6LA 3WE2A 5E1XA 3HRSA 2XVCA 1QPMA 1O3SA 3GXOA 3ULQB 2VONA 3WGGA 1B1BA 4M6XA 2B0LA 1KYZA 5AIPA 2HS5A 3K2ZA 5H6QA 3HSRA 3ECHA 2QWWA 4I2OA 4HV6A 4KMFA 5HLGA 2STWA 5F6FA 3CDHA 4OIOF 2FF4A 2PLYA 1Z6RA 2HTJA 1XDSA 2MLKA 4CICA 3F22A 4PGHA 2MH2A 1G6NA 1ZLJA 1HSTA 3H3UA 1UCRA 4FX0A 3MEXA 5E20A 4BYYA 4LJZF 3M8FA 3ML6A 4JQFA 2GWRA 3ZN1A 2ELHA 2C6YA 1RUNA 3IRQA 3K1PA 1Z05A 4I7HA 2VBWA 3FMRA 4HYEA 2E1CA 1W4MA 1TQIA 3J81Z 3F8CA 3WTYC 4LMYA 3HOTA 1HXDA 2Q0OA 2RV8A 2XRNA 3E6CC 1S8NA 2JRTA 4NQWA 2RDPA 2P6TA 1SD5A 3LFKA 2KKOA 1LDJA 5HDNA 5JI6A 1BC7C 2AXLA 3SXYA 4KDPA 3V7SA 5CVRA 2XAFA 2BGCA 4TV7A 2CG4A 5DEQA 2R7DA 4AVPA 4ZH4F 3ZP5A 1K78A 4GXOA 1O3TA 3I54A 1V4RA 3IHUA 2L4MA 1IXRC 3WTWC 3F21A 3Q9VA 1O57A 4L9TA 2CO5A 1MDMA 1XGMA 1T39A 4BHCA 1ZG1A 3RPQA 1Z91A 1J59A 1I1SA 1ONVA 3LA3A 3LQRA 4A0YA 1Z9CA 4O3MA 4LB5A 2P5KA 3REOA 4JK1X 2XROA 3GZ6A 4A5MA 4RS8A 3VB2A 2M45A 4QWQA 2HQRA 1ON2A 3HSEA 1KU3A 1FX7A 3V8JA 3FX3A 2QUFA 1T0FA 4ENNA 2LSOA 3I59A 2LF7A 2ZO4A 2VBYA 2Z99A 2BEOA 5FD6A 5ICGA 1OPCA 2PMUA 2IRFG 3H3ZA 3TGNA 3HHGA 2DW4A 1YW7A 3O3KA 1SD7A 1XB4A 1GXPA 2JPBA 4LD5A 2EFOA 3LWFA 3E6DA 5HS7A 2BYVE 1J75A 3N97A 3R61A 2F5FA 1CF7A 4Y15A 2ISYA 3F6VA 1WKMA 2A69F 5CLSA 1LVAA 2NS0A 4ZYHA 4GCVA 5CVVA 1B4AA 3TOBA 2KIFA 4LFUA 4WCGA 3E5UA 2P8TA 1ULYA 1K78B 1TQPA 2FQ3A 3T1BA 2M8EA 2FSWA 3KZZA 5FD5A 3U2RA 5HVQC 1Z1DA 4O5VA 3QU3A 2DO7A 3K1MA 3ZMDA 1OYYA 1R00A 1P2FA 1KU7A 2XKOA 3LA2A 2FA5A 4G7HF 1KGSA 3MCZA 4ZYEA 3HSFA 3J80K 2ZXJA 1WWXA 3HRMA 1IRGA 1QQIA 4A6EA 4G6QA 2VE8A 4IF4A 2D45A 5LRSA 5K5OA 4MQVA 4ESJA 4U7BA 4UV8A 5BPIA 3F8MA 4RGXA 1E17A 3I64A 3M1EA 5D5UB 1FC3A 4U0VA 2VOOA 5LGTA 2HDCA 2EA2A 4CDGA 3I59B 3KCCA 3LSTA 3HIFA 2OZUA 4R8HA 4EM0B 2YX7A 1FNNA 2A6HF 2PG4A 3V8LA 1VTNC 1YS6A 2G7UA 3FHZA 2R7FA 1MKMA 1FPQA 3SHFA 2J5PA 4PCQA 4L5IA 2FMLA 3K0LA 1D5VA 3KETA 2A07F 5E8IA 1W7PB 4PZJA 1J7KA 5LGNA 5ED4A 1KA8A 2G9WA 3QOPA 2LNBA 4KIFA 1FSHA 5HS9A 5K5RA 1R58A 1J2XA 2PN6A 3DXJF 1J9IA 2TDXA 4B09A 1FBUA 5DCFA 2P5VA 3F72A 1G4DA 2DTRA 4GGGA 1BBYA 2CWEA 5L3GA 5FLXZ 2GIVA 4IRHA 4QLCU 1BI0A 2CFXA 2XIGA 1FLIA 4CHUA 1CF7B 1U3EM 4B8XA 2L54A 4UVCA 1K6OA 1DP7P 5AONA 1ZG3A 2CW0F 1P4AA 3T5XA 5E18F 3GYHX 3P9KA 5ILVA 3WTVC 1EH8A 1TNSA 3EETA 2H6CA 2H09A 4A0XA 2Y75A 3E3VA 3HTUA 1X3UA 4BNCA 2PMHA 2Q2EA 2XAHA 2F2EA 3BPVA 5BPDA 2FMYA 1U5TB 5L3DA 4LG0A 3P9IA 3ROUA 2WTEA 3GF2A 3M8EA 3PQJA 4BAYA 3GX4X 2E7WA 3WG9A 3GFLA 1IN4A 5LLQA 5DV5A 2Q8KA 5LBQA 1XGSA 2V79A 4ASNA 5HS8A 2RC4A 3J80Z 2UWMA 2RVCA 1BI3A 3GFIA 3P9CA 3W6JB 1AWCA 3GFJA 3ECOA 2O6GE 2EJRA 3JSPA 2F5CA 1TNTA 1R22A 3BZ6A 2E7XA 4UVAA 1FP2A 4OINF 1WQ2A 2QM3A 3FMQA 4ZZDA 2OBPA 4MNUA 2HTSA 4LLLA 1LNWA 1T38A 4EV0A 1RIOH 3QP6A 4I0BA 2ZKZA 2IPQX 2OAZA 1HKTA 4UXNA 1USSA 3IC7A 2RKHA 4LG0B 4KMUX 3MZYA 3W6KB 3JTGA 2ZNZA 2FBKA 2RQPA 4EJOA 4HZFA 1IN8A 3U1DA 4FX4A 5ILUA 2VN2A 4ZYGA 1P6RA 2FOKA 2F5EA 1K7AA 5CYVA 3B02A 4M9XA 3RKYA 1E2XA 4RB2C 2VODA 3C3WA 4P9UA 1IN5A 2GAUA 2ZFWA 2Z33A 3R0AA 5CJ9A 2L4AA 4Q48A 3LAPA 2HOEA 3ABUA 2VXZA 3AAFA 5LRRA 2MH9A 1USTA 4Q5SF 2X4HA 3DF8A 3RKXA 5JHUA 1LDDA 2O0YA 1LEBA 4R1HA 1BN5A 1RNLA 4LLGF 1FYMA 2QYOA 5L3CA 4UV9A 5F1RA 3S2WA 1TTYA 3TQNA 2EFWA 5ICCA 4ESBA 4UHTA 4P5OA 2EFPA 2PJPA 3LA7A 4OMYA 1TW2A 3R60A 1S29A 2EFQA 3L9FA 1SAXA 1IF1A 1EH7A 4WF2A 4N0BA 2ZJ2A 3CO7C 1KYWA 2PBIA 1UHMA 2CYYA 3E5XA 3KEOA 3ERED 1B9MA 1WRJA 2OZ6A 5HLIA 4KIGA 2W24A 1U8RA 3WTTC 2DK8A 2H27A 4IHSA 4HQMA 1SMTA 4Q4ZF 1DPUA 4HF2A 1MJ9A 2ISZA 3F6OA 2M30A 2NYXA 3IWFA 4KN7X 3CUOA 3L09A 1QBJA 3R4KA 4BQAA 3JTHA 1R1VA 3FXQA 2OQGA 2GXGA 1R23A 2KIMA 2HZTA 2H6BA 2A5YB 4RAZA 1ZRDA 5D5XB 4BH9A 1IAWA 4ENJA 2QZ8A 5J8CA 2IJLA 4M9SA 2L02A 4WXDA 2JSCA 5TRDA 3GVAA 3R0JA 4M71A 5E17F 5FLXK 3ZQ7A 1IRFA 4KT5C 1TQMA 4OU0A 2XGXA 5CVUA 2PEXA 5LHGA 1YS7A 5F64A 2IA1A 1FY7A 2MLGA 3WGHA 1O3QA 2P6SA 1PDNC 1YW9A 5D4RA 2X0LA 4OIRF 2RN7A 3GEZA 2IP2A 2FNAA 2HYGD 3L7WA 2DBBA 5CVIA 2WC2A 3DEUA 4KNYA 2MBFA 4L9VA 2O03A 4YG2F 2FE3A 2W84A 2FBIA 1FT9A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1FOK A;  4CO8 A;  2FU4 A;  3WE3 A;  4CGZ A;  3QPT A;  1P92 A;  1I5Z A;  1ODD A;  4OOI A;  2D1H A;  4N9I A;  4KIB A;  1OR7 A;  3CTA A;  3ZMU A;  4UUV A;  5FB2 A;  1YTY A;  1LEA A;  3IKT A;  3E6B A;  1PP8 F;  2QQB A;  1FBS A;  1XSV A;  3ZN0 A;  2KJB A;  1T6S A;  3Q9S A;  3DQV C;  2GQQ A;  3RDI A;  1XGN A;  2E1N A;  4L5J A;  4G6D A;  2IA2 A;  3DPL C;  1IZ1 A;  1HW2 A;  4EJV A;  2NNN A;  3TDZ C;  1SD4 A;  1DUX C;  1XMA A;  2OU2 A;  5FFZ A;  4AWX B;  4G9Y A;  2UZK A;  5DD8 A;  2LKP A;  1ZYR F;  5JVT A;  4AIK A;  2NRA C;  4P96 A;  3T8R A;  2ACJ A;  1SFU A;  3HTS B;  4HF1 A;  4HOB A;  3FXU A;  2DU9 A;  2W85 A;  2W25 A;  1KQ8 A;  5ICF A;  5L3B A;  4KYW A;  1H0M A;  3QRF F;  1OMI A;  2HKO A;  5IT9 K;  4EMS A;  2COM A;  3VFZ A;  5HLH A;  5LEJ A;  4GO1 A;  1IXC A;  4AIH A;  1YLF A;  1YO5 C;  4EM1 A;  2YPR A;  3FM3 A;  4RB0 A;  1BC8 C;  1S7A A;  3PFI A;  5FO5 A;  1J5Y A;  1MJA A;  2XV4 S;  3K69 A;  2H94 A;  4YFX F;  4WWC A;  1IUY A;  2RGV A;  1W7P D;  3BJO A;  2EA4 A;  1R1U A;  5E1W A;  2K4B A;  1LB2 A;  2ESH A;  1L3L A;  4U0W A;  3OV8 A;  3FXR A;  3I5U A;  4AIJ A;  5DD4 A;  4YFK F;  2HR3 A;  2HKX A;  1FYK A;  4F7Z A;  1XCV A;  4M73 A;  2VE9 A;  4YIF A;  3FMS A;  1SFX A;  1U5T A;  3CUQ B;  1FSE A;  2CQK A;  1QO0 D;  2FRH A;  4CZZ A;  4ZYD A;  1PP7 U;  3GLX A;  1NHA A;  3HHH A;  3ISP A;  4IJA A;  1K79 A;  1ZG5 A;  4HLX A;  1GVJ A;  4NHJ A;  2ZNY A;  3I0T A;  1YFH A;  3RPU A;  3NRV A;  3RIR A;  2EWN A;  4XRF A;  2IW5 A;  3RI4 A;  4IXA A;  1CGP A;  2QBY A;  5H20 A;  4DQ2 A;  4IHT A;  2K7L A;  1FBQ A;  3T0Y A;  3J7A O;  1Z6T A;  1JXS A;  1ZH5 A;  1W5T A;  3KP5 A;  4A0Z A;  4RAY A;  2GXB A;  3SZP A;  1ZAR A;  2QQ9 A;  1Z7U A;  4BXU A;  1S3J A;  1XCB A;  1Q1H A;  3GZ5 A;  2VC1 A;  2V6C A;  2NNY A;  3KP3 A;  1TW3 A;  3GFM A;  3TO6 A;  3JAM K;  1G3T A;  3WOD F;  5HDG A;  2G7H A;  4A5N A;  3SZT A;  2ADU A;  1SD6 A;  5EEH A;  5A2Q K;  4Y13 A;  1QNT A;  1YYV A;  4I0A A;  1SFE A;  2VOP A;  1MD0 A;  4A12 A;  3OOP A;  1ZRF A;  4KIC A;  2XAJ A;  3DPT A;  1ZN2 A;  2GA1 A;  3TO9 A;  4WXH A;  3R6S A;  2CGP A;  2PI0 A;  3HRT A;  1YIO A;  3L00 A;  5D4S A;  5BS6 A;  4HX7 A;  1DPR A;  1JHH A;  2F5D A;  1FP1 D;  1UHW A;  2V1U A;  2M87 A;  3T8T A;  4P9F A;  4Q47 A;  1TBX A;  3ZMS A;  3FF5 A;  3C1D A;  4FHT A;  3KE2 A;  1I1G A;  5HDK A;  3KEQ A;  4EJW A;  3ABT A;  1IXS B;  3RTR A;  2R3S A;  4LLN A;  3KZY A;  4O6J A;  1OYI A;  5D5V B;  2BBY A;  2YR2 A;  5IT9 Z;  3I58 A;  3KLO A;  4HX8 A;  4G94 A;  3F3X A;  4L0Y B;  3QP5 A;  3KP2 A;  4A2U A;  3C18 A;  4GYG A;  2D2W A;  3WTS C;  4M6Y A;  1U78 A;  3JSO A;  1MJB A;  2EV6 A;  5LHI A;  2XAQ A;  4P55 A;  4ON0 A;  3VOD A;  4BHP A;  2JPC A;  3EUH A;  3JW4 A;  2Y0M A;  3V8K A;  3U9G A;  5FFX A;  4AD9 A;  3D0S A;  1BIA A;  2DPU A;  5FGM A;  4ESF A;  4LK1 F;  1IN6 A;  1XDU A;  3K1N A;  4IRI A;  1STZ A;  4HV5 A;  1LJ9 A;  3IWZ A;  3MFK A;  1IN7 A;  1BI2 A;  1IW7 F;  1JHF A;  2EFN A;  1WSU A;  3MWM A;  2IA0 A;  1B59 A;  2GA2 A;  4HA8 A;  1REP C;  5D8L B;  1DDN A;  1HQC A;  3D5L A;  2QBY B;  2W57 A;  2WWY A;  3LAJ A;  2ETH A;  4EJT A;  3I4P A;  3CJN A;  5KK1 A;  2P7C B;  3IRR A;  1TLH B;  1MZB A;  1T2K A;  3BRO A;  2OQR A;  3WTX C;  3VEP A;  3WU0 A;  4KA4 A;  3MZH A;  3BJA A;  1S7O A;  3HOS A;  1BI1 A;  2Z9O A;  4L0Z B;  1A04 A;  4UVB A;  1D8K A;  4ZZL A;  2UXN A;  3COA C;  4S05 A;  6PAX A;  2O8X A;  2DFI A;  5J6X A;  4N9H A;  2HFH A;  1C0W A;  4EVI A;  4R79 A;  1G3Y A;  1HKS A;  2MA3 A;  1KQ0 A;  3FM5 A;  1RZ4 A;  2K4J A;  2VBZ A;  2EV5 A;  5KVR A;  1RI7 A;  3G3Z A;  2J5O A;  2KIU A;  4ENK A;  1JGS A;  4MEY F;  1MDM B;  2XAG A;  3I53 A;  3V7C A;  1U5T C;  3FWE A;  2XKP A;  2YX4 A;  5L3F A;  3WTZ A;  2FEZ A;  3BP8 A;  2NAZ A;  3KFW X;  1I27 A;  1YG2 A;  2DQR A;  1V3F A;  5DCM B;  2MD5 A;  1BJA A;  3E5Q A;  4EGZ A;  2ESN A;  3QU6 A;  1P4X A;  2RNJ A;  3L2C A;  4HAM A;  2LDU A;  2BE5 F;  1FWZ A;  2GZW A;  3JAM Z;  3E97 A;  3G73 A;  1O3R A;  4EM2 A;  2FNP A;  5A2Q Z;  2Z3Y A;  3M7G A;  5D6E A;  2DK5 A;  4PGG A;  2VT3 A;  3TKY A;  1ZAO A;  4HDU A;  4D0P A;  4ENM A;  1W7P A;  3CLO A;  2O3F A;  3WU1 B;  3EYI A;  2OA4 A;  5L3E A;  1QGP A;  5DCM A;  5JFR A;  5DDG A;  2M5W A;  4XBF A;  2OD5 A;  1SMY F;  2A6E F;  4HF0 A;  4I02 A;  4U88 A;  2VT2 A;  3ZMT A;  1R7J A;  1R36 A;  3O2P E;  4U7D A;  3F8F A;  3BDD A;  4L9J A;  3WGI A;  2K27 A;  2MC3 A;  4RGU A;  4HLY A;  1F5T A;  3E6M A;  4OIP F;  2QQA A;  5H6R A;  5LGU A;  3DKW A;  3HRU A;  3F8B A;  4KUM A;  1XN7 A;  1O7F A;  2WV0 A;  3O6B B;  3CO6 C;  3BOQ A;  1HBX G;  3RYP A;  3MAJ A;  2XHK A;  3TDU C;  2K86 A;  4EGY A;  4G7Z F;  1FZP B;  1U2W A;  2EK5 A;  1ZGJ A;  1D8J A;  3KP7 A;  1KU2 A;  3I71 A;  1B6A A;  1ZRC A;  1PUE E;  3SFZ A;  4WXC A;  4BHB A;  1BIB A;  5JR3 A;  1ZLK A;  4M72 A;  2A68 F;  3LQQ A;  2AS5 F;  1QZZ A;  4I01 A;  3CUQ C;  4YII A;  3M9A A;  2HEO A;  2YU3 A;  3NQO A;  4OIQ F;  1HKQ A;  2BV6 A;  4LGW A;  2A3S A;  2PQ8 A;  5LEK A;  2DPD A;  1R5G A;  5DYM A;  5DUI A;  3K9T A;  3C7J A;  3ELK A;  2JZY A;  4LK0 F;  2FXA A;  3MQ0 A;  3IKV A;  4IPA A;  4L9N A;  4RGR A;  5D5W B;  3ZPL A;  4MGR A;  3QPH A;  1G3W A;  2DQL A;  4U0Y A;  1HSJ A;  3FZV A;  4EQQ A;  3VOE A;  5HOO A;  2XAS A;  3QAH A;  1GHC A;  1OYW A;  4DNC A;  1ZHF A;  1B9N A;  2DT5 A;  1R5H A;  4MTD A;  4IRG A;  4HW0 A;  4XLN F;  3V7R A;  5BQT A;  1UB9 A;  2XUB A;  4HX4 A;  3WTU C;  2PFB A;  4KFC A;  2ZBK A;  2KJC A;  1XGO A;  5E8G A;  1O7L A;  3BPX A;  3KP4 A;  4RGS A;  4OMZ A;  2IT0 A;  4XSZ F;  3SQN A;  4HBL A;  1JE8 A;  1D3Y A;  3GW2 A;  1Y0U A;  2Y48 A;  2ZCW A;  2QLZ A;  3RKW A;  3DFG A;  3HYI A;  4FT8 A;  1ZGA A;  3P7N A;  1EH6 A;  2K02 A;  4KN4 X;  4JBA A;  5TJJ A;  4H0E A;  3Q5F A;  4M74 A;  4G8X A;  4I98 B;  5CVJ A;  2HYF A;  5LHH A;  2EB7 A;  1GXQ A;  1LDK B;  5J8F A;  2IVM A;  3BWG A;  4A6D A;  2M1B A;  3N4M A;  1FYL A;  4K2E A;  3KLN A;  5BMZ A;  4LB6 B;  1ZRE A;  1U6G A;  2DAO A;  3TO7 A;  2VC0 A;  1LQ1 A;  4XLP F;  3F8N A;  2L3D A;  1RUO A;  1J0R A;  2DLL A;  3F23 A;  2EV0 A;  2ZME B;  5DUK A;  1BM9 A;  3NEU A;  2KRF A;  3DP7 A;  5BOX A;  4WK8 F;  4MEX F;  2P5L C;  3TOA A;  5K1Y A;  1KU9 A;  2HGC A;  2V9V A;  5EEG A;  2O61 A;  3ZMV A;  4L18 B;  1I6X A;  2DI3 A;  1AOY A;  2L01 A;  4Y17 A;  2HWV A;  5D8K B;  1HW5 A;  3RYR A;  1F9N A;  4EJU A;  3V4G A;  1EV7 A;  1XD7 A;  2V1D A;  2P7V B;  1HW1 A;  2VBX A;  1XSD A;  4G7O F;  1BOA A;  1W5S A;  3EYY A;  3J81 K;  1YQA A;  3HUG A;  2QVO A;  2A61 A;  5ICE A;  3EQL F;  4UNO A;  3GWZ A;  4PDK A;  3BJ6 A;  1P4W A;  1T98 A;  4I09 A;  4RB1 A;  2YSR A;  3CUQ A;  2JTV A;  5D6F A;  4CXF A;  1XSX A;  3GO5 A;  5E1Z B;  1H9T A;  2UXX A;  3IL2 A;  5ILS A;  4E70 A;  1G3S A;  2QEN A;  1YW8 A;  1F1Z A;  1KQ9 A;  3EDP A;  4MTE A;  1UFM A;  2STT A;  4IVN A;  3PQK A;  3RJP A;  1F4K A;  2FBH A;  4Z2Y A;  1WI9 A;  2V1X A;  1QZY A;  5IT3 A;  3H92 A;  2JT1 A;  2CSO A;  3BY6 A;  3B73 A;  2LF8 A;  3DV8 A;  1L0O C;  4ETS A;  5AIQ A;  4S04 A;  4MHG A;  5K5Q A;  2D1V A;  5ERI A;  2P4W A;  1ON1 A;  1OKR A;  2Z5U A;  2HQN A;  4YFN F;  1XMK A;  4XSX F;  4MQ9 F;  1R1T A;  2ZME A;  4CYD A;  4HDV A;  4WX9 A;  3KP6 A;  4M9Z A;  1MGT A;  3GUD A;  3ZMZ A;  4GYI A;  4NB5 A;  1H9G A;  4HQE A;  4RB3 C;  1S6L A;  3WE2 A;  5E1X A;  3HRS A;  2XVC A;  1QPM A;  1O3S A;  3GXO A;  3ULQ B;  2VON A;  3WGG A;  1B1B A;  4M6X A;  2B0L A;  1KYZ A;  5AIP A;  2HS5 A;  3K2Z A;  5H6Q A;  3HSR A;  3ECH A;  2QWW A;  4I2O A;  4HV6 A;  4KMF A;  5HLG A;  2STW A;  5F6F A;  3CDH A;  4OIO F;  2FF4 A;  2PLY A;  1Z6R A;  2HTJ A;  1XDS A;  2MLK A;  4CIC A;  3F22 A;  4PGH A;  2MH2 A;  1G6N A;  1ZLJ A;  1HST A;  3H3U A;  1UCR A;  4FX0 A;  3MEX A;  5E20 A;  4BYY A;  4LJZ F;  3M8F A;  3ML6 A;  4JQF A;  2GWR A;  3ZN1 A;  2ELH A;  2C6Y A;  1RUN A;  3IRQ A;  3K1P A;  1Z05 A;  4I7H A;  2VBW A;  3FMR A;  4HYE A;  2E1C A;  1W4M A;  1TQI A;  3J81 Z;  3F8C A;  3WTY C;  4LMY A;  3HOT A;  1HXD A;  2Q0O A;  2RV8 A;  2XRN A;  3E6C C;  1S8N A;  2JRT A;  4NQW A;  2RDP A;  2P6T A;  1SD5 A;  3LFK A;  2KKO A;  1LDJ A;  5HDN A;  5JI6 A;  1BC7 C;  2AXL A;  3SXY A;  4KDP A;  3V7S A;  5CVR A;  2XAF A;  2BGC A;  4TV7 A;  2CG4 A;  5DEQ A;  2R7D A;  4AVP A;  4ZH4 F;  3ZP5 A;  1K78 A;  4GXO A;  1O3T A;  3I54 A;  1V4R A;  3IHU A;  2L4M A;  1IXR C;  3WTW C;  3F21 A;  3Q9V A;  1O57 A;  4L9T A;  2CO5 A;  1MDM A;  1XGM A;  1T39 A;  4BHC A;  1ZG1 A;  3RPQ A;  1Z91 A;  1J59 A;  1I1S A;  1ONV A;  3LA3 A;  3LQR A;  4A0Y A;  1Z9C A;  4O3M A;  4LB5 A;  2P5K A;  3REO A;  4JK1 X;  2XRO A;  3GZ6 A;  4A5M A;  4RS8 A;  3VB2 A;  2M45 A;  4QWQ A;  2HQR A;  1ON2 A;  3HSE A;  1KU3 A;  1FX7 A;  3V8J A;  3FX3 A;  2QUF A;  1T0F A;  4ENN A;  2LSO A;  3I59 A;  2LF7 A;  2ZO4 A;  2VBY A;  2Z99 A;  2BEO A;  5FD6 A;  5ICG A;  1OPC A;  2PMU A;  2IRF G;  3H3Z A;  3TGN A;  3HHG A;  2DW4 A;  1YW7 A;  3O3K A;  1SD7 A;  1XB4 A;  1GXP A;  2JPB A;  4LD5 A;  2EFO A;  3LWF A;  3E6D A;  5HS7 A;  2BYV E;  1J75 A;  3N97 A;  3R61 A;  2F5F A;  1CF7 A;  4Y15 A;  2ISY A;  3F6V A;  1WKM A;  2A69 F;  5CLS A;  1LVA A;  2NS0 A;  4ZYH A;  4GCV A;  5CVV A;  1B4A A;  3TOB A;  2KIF A;  4LFU A;  4WCG A;  3E5U A;  2P8T A;  1ULY A;  1K78 B;  1TQP A;  2FQ3 A;  3T1B A;  2M8E A;  2FSW A;  3KZZ A;  5FD5 A;  3U2R A;  5HVQ C;  1Z1D A;  4O5V A;  3QU3 A;  2DO7 A;  3K1M A;  3ZMD A;  1OYY A;  1R00 A;  1P2F A;  1KU7 A;  2XKO A;  3LA2 A;  2FA5 A;  4G7H F;  1KGS A;  3MCZ A;  4ZYE A;  3HSF A;  3J80 K;  2ZXJ A;  1WWX A;  3HRM A;  1IRG A;  1QQI A;  4A6E A;  4G6Q A;  2VE8 A;  4IF4 A;  2D45 A;  5LRS A;  5K5O A;  4MQV A;  4ESJ A;  4U7B A;  4UV8 A;  5BPI A;  3F8M A;  4RGX A;  1E17 A;  3I64 A;  3M1E A;  5D5U B;  1FC3 A;  4U0V A;  2VOO A;  5LGT A;  2HDC A;  2EA2 A;  4CDG A;  3I59 B;  3KCC A;  3LST A;  3HIF A;  2OZU A;  4R8H A;  4EM0 B;  2YX7 A;  1FNN A;  2A6H F;  2PG4 A;  3V8L A;  1VTN C;  1YS6 A;  2G7U A;  3FHZ A;  2R7F A;  1MKM A;  1FPQ A;  3SHF A;  2J5P A;  4PCQ A;  4L5I A;  2FML A;  3K0L A;  1D5V A;  3KET A;  2A07 F;  5E8I A;  1W7P B;  4PZJ A;  1J7K A;  5LGN A;  5ED4 A;  1KA8 A;  2G9W A;  3QOP A;  2LNB A;  4KIF A;  1FSH A;  5HS9 A;  5K5R A;  1R58 A;  1J2X A;  2PN6 A;  3DXJ F;  1J9I A;  2TDX A;  4B09 A;  1FBU A;  5DCF A;  2P5V A;  3F72 A;  1G4D A;  2DTR A;  4GGG A;  1BBY A;  2CWE A;  5L3G A;  5FLX Z;  2GIV A;  4IRH A;  4QLC U;  1BI0 A;  2CFX A;  2XIG A;  1FLI A;  4CHU A;  1CF7 B;  1U3E M;  4B8X A;  2L54 A;  4UVC A;  1K6O A;  1DP7 P;  5AON A;  1ZG3 A;  2CW0 F;  1P4A A;  3T5X A;  5E18 F;  3GYH X;  3P9K A;  5ILV A;  3WTV C;  1EH8 A;  1TNS A;  3EET A;  2H6C A;  2H09 A;  4A0X A;  2Y75 A;  3E3V A;  3HTU A;  1X3U A;  4BNC A;  2PMH A;  2Q2E A;  2XAH A;  2F2E A;  3BPV A;  5BPD A;  2FMY A;  1U5T B;  5L3D A;  4LG0 A;  3P9I A;  3ROU A;  2WTE A;  3GF2 A;  3M8E A;  3PQJ A;  4BAY A;  3GX4 X;  2E7W A;  3WG9 A;  3GFL A;  1IN4 A;  5LLQ A;  5DV5 A;  2Q8K A;  5LBQ A;  1XGS A;  2V79 A;  4ASN A;  5HS8 A;  2RC4 A;  3J80 Z;  2UWM A;  2RVC A;  1BI3 A;  3GFI A;  3P9C A;  3W6J B;  1AWC A;  3GFJ A;  3ECO A;  2O6G E;  2EJR A;  3JSP A;  2F5C A;  1TNT A;  1R22 A;  3BZ6 A;  2E7X A;  4UVA A;  1FP2 A;  4OIN F;  1WQ2 A;  2QM3 A;  3FMQ A;  4ZZD A;  2OBP A;  4MNU A;  2HTS A;  4LLL A;  1LNW A;  1T38 A;  4EV0 A;  1RIO H;  3QP6 A;  4I0B A;  2ZKZ A;  2IPQ X;  2OAZ A;  1HKT A;  4UXN A;  1USS A;  3IC7 A;  2RKH A;  4LG0 B;  4KMU X;  3MZY A;  3W6K B;  3JTG A;  2ZNZ A;  2FBK A;  2RQP A;  4EJO A;  4HZF A;  1IN8 A;  3U1D A;  4FX4 A;  5ILU A;  2VN2 A;  4ZYG A;  1P6R A;  2FOK A;  2F5E A;  1K7A A;  5CYV A;  3B02 A;  4M9X A;  3RKY A;  1E2X A;  4RB2 C;  2VOD A;  3C3W A;  4P9U A;  1IN5 A;  2GAU A;  2ZFW A;  2Z33 A;  3R0A A;  5CJ9 A;  2L4A A;  4Q48 A;  3LAP A;  2HOE A;  3ABU A;  2VXZ A;  3AAF A;  5LRR A;  2MH9 A;  1UST A;  4Q5S F;  2X4H A;  3DF8 A;  3RKX A;  5JHU A;  1LDD A;  2O0Y A;  1LEB A;  4R1H A;  1BN5 A;  1RNL A;  4LLG F;  1FYM A;  2QYO A;  5L3C A;  4UV9 A;  5F1R A;  3S2W A;  1TTY A;  3TQN A;  2EFW A;  5ICC A;  4ESB A;  4UHT A;  4P5O A;  2EFP A;  2PJP A;  3LA7 A;  4OMY A;  1TW2 A;  3R60 A;  1S29 A;  2EFQ A;  3L9F A;  1SAX A;  1IF1 A;  1EH7 A;  4WF2 A;  4N0B A;  2ZJ2 A;  3CO7 C;  1KYW A;  2PBI A;  1UHM A;  2CYY A;  3E5X A;  3KEO A;  3ERE D;  1B9M A;  1WRJ A;  2OZ6 A;  5HLI A;  4KIG A;  2W24 A;  1U8R A;  3WTT C;  2DK8 A;  2H27 A;  4IHS A;  4HQM A;  1SMT A;  4Q4Z F;  1DPU A;  4HF2 A;  1MJ9 A;  2ISZ A;  3F6O A;  2M30 A;  2NYX A;  3IWF A;  4KN7 X;  3CUO A;  3L09 A;  1QBJ A;  3R4K A;  4BQA A;  3JTH A;  1R1V A;  3FXQ A;  2OQG A;  2GXG A;  1R23 A;  2KIM A;  2HZT A;  2H6B A;  2A5Y B;  4RAZ A;  1ZRD A;  5D5X B;  4BH9 A;  1IAW A;  4ENJ A;  2QZ8 A;  5J8C A;  2IJL A;  4M9S A;  2L02 A;  4WXD A;  2JSC A;  5TRD A;  3GVA A;  3R0J A;  4M71 A;  5E17 F;  5FLX K;  3ZQ7 A;  1IRF A;  4KT5 C;  1TQM A;  4OU0 A;  2XGX A;  5CVU A;  2PEX A;  5LHG A;  1YS7 A;  5F64 A;  2IA1 A;  1FY7 A;  2MLG A;  3WGH A;  1O3Q A;  2P6S A;  1PDN C;  1YW9 A;  5D4R A;  2X0L A;  4OIR F;  2RN7 A;  3GEZ A;  2IP2 A;  2FNA A;  2HYG D;  3L7W A;  2DBB A;  5CVI A;  2WC2 A;  3DEU A;  4KNY A;  2MBF A;  4L9V A;  2O03 A;  4YG2 F;  2FE3 A;  2W84 A;  2FBI A;  1FT9 A; 
#chains in the Genus database with same CATH topology
 1FOK A;  2NVY J;  5GP9 A;  3UKG A;  3CDL A;  3PSF A;  2X6W A;  3BCB A;  4CO8 A;  4E4H A;  2FU4 A;  3WE3 A;  4CGZ A;  3O8G A;  3QPT A;  1P92 A;  1I5Z A;  2HPI A;  3BC8 A;  1ODD A;  4OOI A;  2D1H A;  4N9I A;  4KIB A;  1ITY A;  3SEZ A;  3CZ6 A;  3HPG A;  1ZEL A;  1OR7 A;  4M6V A;  4ANJ A;  3CTA A;  2VAS A;  3ZMU A;  4UUV A;  3TP0 A;  5FB2 A;  1YTY A;  1LEA A;  3IKT A;  3E6B A;  1PP8 F;  4A3M J;  4QPO A;  5J47 A;  2QQB A;  2JA2 A;  1FBS A;  1XSV A;  2Y69 H;  2R7T A;  3ZN0 A;  2HDW A;  2KJB A;  1T6S A;  3Q9S A;  3DQV C;  1TT0 A;  2GQQ A;  2XB5 A;  3DEW A;  3RDI A;  1XGN A;  2E1N A;  3HC7 A;  4G6D A;  2IA2 A;  4L5J A;  3KPH A;  4XID A;  3DPL C;  1IZ1 A;  1HW2 A;  4BQQ A;  1B72 B;  4EJV A;  5B1B H;  2NNN A;  1MIJ A;  3TDZ C;  2JA5 J;  2CUZ A;  3ZQH A;  1SD4 A;  1DUX C;  2DFF A;  5TGT A;  3EUK L;  1XMA A;  3HEF A;  3U21 A;  2OU2 A;  2X85 A;  1V5F A;  5FFZ A;  4AWX B;  1RPW A;  4ZDO A;  2KIQ A;  4G9Y A;  2UZK A;  5DD8 A;  2LKP A;  1QPI A;  1OCZ H;  1ZYR F;  5JVT A;  4AIK A;  4C2M J;  2NRA C;  5F08 A;  2DOA A;  4P96 A;  3X2Q H;  2EH3 A;  4RDU A;  3T8R A;  2ACJ A;  1SFU A;  3HTS B;  4HF1 A;  4HOB A;  1OIS A;  2CQQ A;  3DBR B;  3FXU A;  1S9H A;  2DU9 A;  3JRC A;  1WGX A;  3TMO A;  2TRT A;  4RAG A;  2W85 A;  3FXJ A;  2W25 A;  1KQ8 A;  5ICF A;  5L3B A;  4KYW A;  2W82 A;  1H0M A;  3QRF F;  1OMI A;  2HKO A;  2VPL A;  5IT9 K;  5FKK A;  1JTY A;  3PNT A;  4XLE A;  4EMS A;  1V5E A;  4L5E A;  2I5U A;  2COM A;  3MD2 A;  5C4J J;  3VFZ A;  5HLH A;  2Y0S N;  5LEJ A;  4C9Y A;  4GO1 A;  4IZZ A;  1IJW C;  1IXC A;  1LVK A;  2JK3 A;  4C3J J;  3LSJ A;  4Y33 A;  2TCT A;  1GV5 A;  4YRV A;  4B3A A;  4AIH A;  4CYC B;  2KLO A;  1YLF A;  1YO5 C;  1OQY A;  2Y9Z A;  3A02 A;  4BS9 A;  3A01 A;  1ETV A;  2R7V A;  2VIX A;  1Y39 A;  1N77 A;  4EM1 A;  2B9S A;  3HL2 A;  2YPR A;  3FM3 A;  3PSI A;  4RB0 A;  1BC8 C;  1S7A A;  3PFI A;  5FO5 A;  1J5Y A;  1MJA A;  2XV4 S;  2AQE A;  2WAE A;  4V19 K;  3FK7 A;  1A36 A;  2M34 A;  3K69 A;  2H94 A;  4YFX F;  3V42 A;  4WWC A;  1IUY A;  2RGV A;  1B8I A;  4PJ0 C;  1JI8 A;  4D5F A;  1W7P D;  3BJO A;  2DMU A;  2IEK A;  2M0C A;  1ETX A;  2EA4 A;  1R1U A;  2Y30 A;  5E1W A;  2AHQ A;  2K4B A;  1Z77 A;  2KT0 A;  5HNH A;  5E3M A;  1LB2 A;  2ESH A;  1L3L A;  3Q0V A;  4U0W A;  2CS3 A;  1WFX A;  1V55 H;  2DMT A;  3OV8 A;  3FXR A;  3I5U A;  4AIJ A;  5DD4 A;  4C3H J;  4YFK F;  2HR3 A;  2HKX A;  2JVH A;  4PJM A;  2GM4 A;  1FYK A;  4F7Z A;  1XCV A;  4MO7 A;  2E5N A;  4M73 A;  2VE9 A;  1X4O A;  4YIF A;  4IHV A;  3FMS A;  1SFX A;  4DW6 A;  1U5T A;  3DCF A;  3CUQ B;  1FSE A;  2CQK A;  4PSX A;  1QO0 D;  4A3C J;  3A0B C;  2FRH A;  2OPT A;  4CZZ A;  4NC8 A;  4ZYD A;  1PP7 U;  2LBF B;  1DU6 A;  2E35 A;  4MLO A;  3GLX A;  3A2K A;  4I76 A;  1NHA A;  2FQ4 A;  5GTH C;  1X19 A;  2JVG A;  2LOO A;  2R5Y A;  4BE2 A;  2EZI A;  2DOF A;  2K9L A;  3HHH A;  3K4J A;  3ISP A;  4IJA A;  2R93 J;  3Q0U A;  1K79 A;  1ZG5 A;  3H5N A;  4HLX A;  1GVJ A;  4NHJ A;  2ZNY A;  3I0T A;  1X4P A;  3GBG A;  1YFH A;  2CV0 A;  1OR7 C;  2M7A A;  4QSH A;  3NRV A;  3RPU A;  3RIR A;  2EWN A;  4BEH A;  3JRB A;  4XRF A;  2DMQ A;  2HYJ A;  2IW5 A;  2IBD A;  1X3W B;  3RI4 A;  4GFB A;  2EZH A;  4BDY A;  4CCM A;  2RNG A;  4IXA A;  4FE4 A;  1CGP A;  3LSI A;  4GRI A;  4RM3 A;  4F92 B;  2QBY A;  3PJR A;  5H20 A;  1QRY A;  4DQ2 A;  3GTM J;  4IHT A;  2OTJ I;  1P7I A;  2K7L A;  3GTJ J;  1FBQ A;  1PVE A;  3BZC A;  3T0Y A;  3QPS A;  4RBO A;  1VQP I;  3J7A O;  2HVR A;  2HQA A;  5HOD A;  1JT6 A;  1Z6T A;  2VQG A;  2OCE A;  1JXS A;  1ZH5 A;  2QQ8 A;  2O9L A;  3HZJ A;  1W5T A;  2F6C A;  3KP5 A;  4A0Z A;  4RAY A;  1BR1 A;  2GXB A;  3SZP A;  1ZAR A;  2QQ9 A;  3OR1 C;  1Z7U A;  4BXU A;  3F9K A;  3MKW B;  1NK3 P;  1JUP A;  1S3J A;  1XCB A;  4BQN A;  1Q1H A;  3TBI A;  2O5R A;  2VJ4 A;  3GZ5 A;  3VSL A;  2VC1 A;  3EUH C;  3OS1 A;  2V6C A;  2NNY A;  3KP3 A;  1TW3 A;  5GTI C;  3VYT B;  3GFM A;  1T95 A;  3TO6 A;  4CYC A;  3JAM K;  1G3T A;  2XSD C;  3WOD F;  4M3G A;  5HDG A;  3CF2 A;  2G7H A;  4JYK A;  4A5N A;  3ABK H;  3SZT A;  3U1K A;  3S8P A;  3JRD A;  4XOP A;  2ADU A;  1SD6 A;  3A03 A;  5EEH A;  5A2Q K;  5B1A H;  1HLV A;  1G59 A;  4Y13 A;  1QNT A;  1BOB A;  1XMX A;  1YYV A;  2E1M C;  4I0A A;  3BTC A;  1SFE A;  3OYL A;  2VOP A;  1MD0 A;  1A31 A;  4A12 A;  3OOP A;  1TWG J;  1ZRF A;  2FUG 2;  4KIC A;  2JMW A;  1E3H A;  2XAJ A;  3OYK A;  3DPT A;  1ZN2 A;  2GA1 A;  1TZL A;  4IHX A;  1EJ9 A;  3TO9 A;  1LE8 A;  2K9Q A;  4WXH A;  3R6S A;  2L9V A;  2CGP A;  2PI0 A;  3HRT A;  1V5G A;  3RSN A;  1YIO A;  3L00 A;  2QF7 A;  5CQG A;  5D4S A;  1R4M B;  4BBR J;  2I8D A;  5BS6 A;  2R5Z B;  1UMQ A;  4IHY A;  3QQA A;  4HX7 A;  1DPR A;  1JHH A;  5J3L A;  2F5D A;  3S2H J;  5J1R A;  1FP1 D;  1UHW A;  1GV2 A;  2XPV A;  2M87 A;  2V1U A;  3T8T A;  3OR2 C;  4JX4 A;  2N8G A;  2MYS A;  4P9F A;  5KAI C;  3OL4 A;  3IV5 A;  4Q47 A;  5C44 J;  1TBX A;  4B1R A;  3ZMS A;  3FF5 A;  3C1D A;  4FHT A;  3KE2 A;  3SFI A;  1I1G A;  5HDK A;  3KEQ A;  2F48 A;  3K7A J;  4EJW A;  3ABT A;  2ICW G;  1IXS B;  3RTR A;  1RKW A;  2R3S A;  4LLN A;  3KZY A;  2R7X A;  4O6J A;  1OYI A;  3DKX A;  5D5V B;  2BBY A;  2YR2 A;  1AKH A;  1VQL I;  3LFU A;  5IT9 Z;  3I58 A;  1D1A A;  3LSM A;  3KLO A;  4HX8 A;  2CQX A;  2DMP A;  3HOU J;  2KP6 A;  4G94 A;  3F3X A;  3K4K A;  4L0Y B;  3QP5 A;  3KP2 A;  1Z21 A;  3A0H C;  4A2U A;  1K6Y A;  1WJF A;  3MKL A;  3C18 A;  4BGD A;  4J01 A;  2BXY A;  2QGU A;  4GYG A;  2D2W A;  3DLA A;  5FLV A;  3WTS C;  1SVM A;  5DS9 A;  3NAR A;  1JJ8 C;  4M6Y A;  1U78 A;  3BG6 A;  2PJR A;  3JSO A;  1MJB A;  2EV6 A;  5LHI A;  2XAQ A;  4P55 A;  4GDF A;  1X1B A;  2BVL A;  4ON0 A;  3VOD A;  1I3A A;  2Q2E B;  4BHP A;  2JPC A;  4HNU A;  2WB1 N;  2H8R A;  2K9N A;  5EZH A;  4IOC F;  3EUH A;  3JW4 A;  2Y0M A;  3V8K A;  3CDI A;  3U9G A;  3VYR B;  1S7E A;  5FFX A;  3IH3 A;  4AD9 A;  3MMY B;  3D0S A;  1BIA A;  2DPU A;  3PUF A;  3FIW A;  5FGM A;  4CCK A;  1D5Y A;  3BG9 A;  4ESF A;  5M3F J;  3EPZ A;  4LK1 F;  1IN6 A;  4IHW A;  1XDU A;  3H5A A;  3GZN B;  2JJ7 A;  2LH9 A;  3K1N A;  4IRI A;  2V4J C;  2QSH X;  1STZ A;  4HV5 A;  1LJ9 A;  3IWZ A;  4YEJ A;  3MFK A;  1VQ7 I;  1IN7 A;  1POG A;  2IAI A;  1BI2 A;  1IW7 F;  2BY3 A;  1JHF A;  2EFN A;  1WSU A;  2DT6 A;  3PFY A;  1VQ6 I;  4DYQ A;  1LFB A;  2A5W A;  3MWM A;  2IA0 A;  1B59 A;  2XGC A;  2GA2 A;  4HA8 A;  4BJ6 C;  5CKT A;  1FOW A;  4I99 C;  1OCC H;  2LVS A;  4XON A;  5D8L B;  1DDN A;  1REP C;  1D1B A;  1HQC A;  4E7H A;  4JP0 A;  3D5L A;  2QBY B;  2W57 A;  4IL6 C;  2ME6 A;  3LAJ A;  2ETH A;  2WWY A;  4EJT A;  3I4P A;  3CJN A;  1HCR A;  5KK1 A;  1WJE A;  3SDG A;  2UUZ A;  5DM6 F;  3J7Z I;  2P7C B;  3K4C A;  3IRR A;  1TLH B;  1OLT A;  4D5C A;  2BY2 A;  3OYE A;  1MZB A;  3VYS B;  4XOT A;  5EJC A;  1YJN I;  1T2K A;  4XKC A;  3RQ4 A;  3BRO A;  2OQR A;  5GPC A;  4F52 A;  3WTX C;  2HOA A;  3VEP A;  3QOE A;  3WU0 A;  4ZJZ A;  3W6V A;  4KA4 A;  3MZH A;  1VND A;  3BJA A;  1S7O A;  3LOC A;  3M07 A;  4J19 A;  2YUS A;  5F0C A;  1BI1 A;  3HOS A;  2Z9O A;  5EG0 A;  2Z16 A;  4L0Z B;  1A04 A;  2GOX B;  4FE7 A;  1D8K A;  4UVB A;  4ZZL A;  2UXN A;  3COA C;  1ZR2 A;  3BR3 A;  4S05 A;  3HKZ N;  6PAX A;  2O8X A;  2DFI A;  1LUJ B;  2O8K A;  3M4O J;  4AU7 A;  5FRM A;  5J6X A;  3IAM 2;  1Y0N A;  4N9H A;  2ME0 A;  2PJR B;  1Y8R B;  2HFH A;  1C0W A;  4ZDL A;  4EVI A;  4R79 A;  2JA6 J;  1G3Y A;  1HKS A;  2MA3 A;  3OYH A;  1KQ0 A;  4IQ4 A;  4KJZ A;  3TL4 X;  1U9O A;  4II3 A;  3K4N A;  3FM5 A;  4A3B J;  1RZ4 A;  2K4J A;  2JUC A;  3K10 A;  2VBZ A;  2EV5 A;  5KVR A;  1RI7 A;  3KEY A;  3OL3 A;  3G3Z A;  3ABL H;  4M3E A;  4IQJ A;  2RQQ A;  2J5O A;  2KIU A;  2VL8 A;  4ENK A;  1JGS A;  4MEY F;  1MDM B;  2XAG A;  3C2H A;  3JRI A;  2E5Z A;  1J09 A;  3GTG J;  3S2D J;  1YJ9 I;  2CV2 A;  1FMV A;  3Q0W A;  3I53 A;  3WHC A;  2R7W A;  3V7C A;  2LLK A;  3IH2 A;  3GTK J;  2K9M A;  1U5T C;  1JJ6 C;  3FWE A;  1MMD A;  2XKP A;  3NWT A;  3OSF A;  1NG7 A;  2JQ7 A;  4ITV A;  2YX4 A;  5L3F A;  1X1P A;  5EDN A;  2ZB9 A;  3WTZ A;  4W1U A;  2BHY A;  3S17 J;  2FEZ A;  3BP8 A;  2NAZ A;  3IH4 A;  4Z6Y A;  3KFW X;  4IX7 A;  1I27 A;  2LYC A;  1YG2 A;  2DQR A;  3UR3 C;  5B66 C;  3AKZ A;  2CMP A;  1FTZ A;  1V3F A;  5DCM B;  3W2A A;  3HGY A;  5F0H A;  2MD5 A;  3LSP A;  1N78 A;  2LFB A;  1BW6 A;  2Y0S A;  1H88 C;  1BJA A;  3E5Q A;  4EGZ A;  2ESN A;  3QU6 A;  4CA0 A;  1KZH A;  1P4X A;  2RNJ A;  3L2C A;  4HAM A;  2LDU A;  4BU2 A;  1FOX A;  2BE5 F;  4OAY A;  1VF9 A;  1FWZ A;  2DOD A;  2GZW A;  1NK2 P;  2DT7 B;  2AO9 A;  3JAM Z;  3E97 A;  2A6T A;  4A69 C;  3G73 A;  3BG7 A;  4LIT A;  2DA1 A;  1O3R A;  4EM2 A;  1D0Y A;  2FNP A;  2LY2 A;  2CU7 A;  5A2Q Z;  4RMN A;  2LK2 A;  2Z3Y A;  4H4K C;  5F1J A;  2ZXW H;  2ZJR F;  3OYJ A;  1IG7 A;  3M7G A;  2R4G A;  5D6E A;  2DK5 A;  2WAF A;  4PGG A;  2VT3 A;  3TKY A;  2E34 A;  2QSF X;  3G1M A;  1Z3X A;  2GXA A;  3C2G A;  1DGW Y;  1ZAO A;  1WJA A;  1GLN A;  4HDU A;  1VQ9 I;  1XG1 A;  3CCL I;  5J4V A;  4D0P A;  1LE8 B;  1W7P A;  3CLO A;  2O3F A;  4ENM A;  3OIQ A;  3DLL F;  4A3L J;  2ZFU A;  3WU1 B;  2IS6 A;  1QHH D;  1D0Z A;  1GDT A;  3EYI A;  2OA4 A;  2E71 A;  4M3D A;  2BVM A;  5L3E A;  1QGP A;  5DCM A;  5JFR A;  5DDG A;  2M5W A;  2IS1 A;  4XBF A;  3GLL A;  2Y2Z A;  2DJI A;  1QVU A;  2BY0 A;  2OD5 A;  3ZCO A;  1SMY F;  2L2O A;  2LG4 A;  3BTL A;  2A6E F;  4HF0 A;  4I02 A;  2H8W A;  4U88 A;  4XLF A;  4BL0 B;  5M5X J;  2VT2 A;  3ZMT A;  1R7J A;  3OYN A;  3QYB A;  1R36 A;  3O2P E;  1VQ5 I;  4U7D A;  3F8F A;  2XF6 A;  1GUU A;  3BDD A;  1H89 C;  3OIP A;  4L9J A;  3WGI A;  1DP3 A;  1X2M A;  2LBF A;  2K27 A;  2MC3 A;  4RGU A;  1NG6 A;  2JRM A;  3QPL A;  5B3S H;  1S5L C;  1ZK8 A;  3E6M A;  4HLY A;  1F5T A;  4IKF A;  4OIP F;  2LY1 A;  2QQA A;  3H5R A;  5H6R A;  5LGU A;  3HDD A;  3OMY A;  3CMY A;  3DKW A;  2LY9 A;  3HRU A;  3F8B A;  4KUM A;  1XN7 A;  1O7F A;  1YJW I;  2WV0 A;  3O6B B;  2MFZ A;  1TWA J;  3BOQ A;  3OS2 A;  3CO6 C;  1HBX G;  2OJE D;  3HPH A;  3RYP A;  1M1E B;  1HC8 A;  5IPA A;  2ID6 A;  3MAJ A;  2NVT J;  2XHK A;  3TDU C;  2K86 A;  4EGY A;  4P1W A;  4G7Z F;  3BZK A;  3L2Q A;  1FZP B;  1U2W A;  4Y7N J;  1SC7 A;  2EK5 A;  2ZC2 A;  1ZGJ A;  1D8J A;  3KP7 A;  1TT5 B;  1KU2 A;  4E7J A;  3I71 A;  1B6A A;  3RCO A;  1ZRC A;  1PUE E;  1YRN A;  4PFP A;  2CV1 A;  3SFZ A;  2PX9 A;  1VQO I;  4WXC A;  4BHB A;  1BIB A;  5JR3 A;  1HOM A;  3PO3 J;  1XPX A;  1ZLK A;  4M72 A;  2D5V A;  2CW8 A;  2A68 F;  2GBY A;  1T33 A;  3LSR A;  5K7H A;  1X3Z B;  4E7Z A;  3LQQ A;  4W97 A;  1QZZ A;  1SEU A;  4JOM A;  2AS5 F;  4I01 A;  3CUQ C;  4YII A;  3FDY A;  2XPW A;  3M9A A;  3ESW B;  2HEO A;  1MBK A;  2YU3 A;  4G6T B;  4M3F A;  3BLY A;  3PIO F;  2L9R A;  3NQO A;  3JRH A;  4OIQ F;  4MFE A;  1HKQ A;  2BV6 A;  4LGW A;  4HG2 A;  3L2W A;  2A3S A;  2PQ8 A;  5FKO A;  3DU6 A;  4C2U A;  3S1R J;  5LEK A;  2DPD A;  4UB6 C;  4D7M A;  1R5G A;  5DYM A;  3ASN H;  5DUI A;  3K9T A;  3C7J A;  2XF7 A;  3BTJ A;  5K7Z A;  3ELK A;  1MSF C;  4Y4R A;  2JZY A;  4XK4 A;  1VZ0 A;  1YE9 A;  2FXA A;  2KZG A;  4LK0 F;  3MQ0 A;  3IKV A;  1TWF J;  2DMN A;  2KQR A;  3H9Q A;  4IPA A;  4L9N A;  3CCR I;  3E0J B;  4IO9 F;  4RGR A;  5D5W B;  1APL C;  3ZPL A;  4MGR A;  4FTH A;  1IC8 A;  3QPH A;  1G3W A;  3WU2 C;  2DQL A;  5DTD A;  4U0Y A;  1HSJ A;  3FZV A;  4EQQ A;  3VOE A;  5HOO A;  2VKE A;  2XAS A;  3QAH A;  1GHC A;  1OYW A;  2E2I J;  1UAA A;  4DNC A;  1ZHF A;  1B9N A;  2DT5 A;  1SVO A;  1R5H A;  4MTD A;  1VQK I;  4IRG A;  4HW0 A;  2OUM A;  4XLN F;  3V7R A;  5BQT A;  3H1C A;  1UB9 A;  2XUB A;  1MSE C;  4HX4 A;  3WTU C;  2ZJQ F;  2V7F A;  5IYD J;  4MFD A;  4JX6 A;  2PFB A;  4KFC A;  1T0F C;  2I10 A;  4N4N B;  1R71 A;  3CCE I;  4RLQ A;  2ZBK A;  2KJC A;  2XRL A;  1XGO A;  3D5S C;  1G2H A;  1BR2 A;  1OJL A;  3BQZ A;  5E8G A;  1WJD A;  3CCS I;  1O7L A;  4UY8 I;  3BPX A;  3KP4 A;  4RGS A;  4OMZ A;  1DQU A;  2IT0 A;  4XSZ F;  3SQN A;  1JUM A;  4HBL A;  2F5V A;  1JE8 A;  1D3Y A;  3GW2 A;  3GTL J;  1UG2 A;  1PUF B;  1OFC X;  1Y0U A;  2Y48 A;  4DYC A;  2ZCW A;  2WAQ A;  2QLZ A;  3K4B A;  2DA5 A;  3RKW A;  3DFG A;  3HYI A;  4XL9 A;  2DA4 A;  1MBE A;  2NS7 A;  3S3M A;  4FT8 A;  1ZGA A;  3BR2 A;  3P7N A;  1EH6 A;  3HOZ J;  3G4S I;  3FXK A;  1ETW A;  2K02 A;  3FHN A;  4KN4 X;  2ZME C;  4JBA A;  2K3F A;  5TJJ A;  4H0E A;  3Q5F A;  4M74 A;  4G8X A;  4I98 B;  5CVJ A;  2HYF A;  3CQZ J;  5LHH A;  2EB7 A;  1GXQ A;  1LDK B;  3CMA I;  1F43 A;  5J8F A;  1RC9 A;  2IVM A;  3BWG A;  5FRN A;  4A6D A;  2M1B A;  2NOJ B;  4CCJ A;  3N4M A;  5TIS C;  4K2E A;  1FYL A;  2YU9 J;  3KLN A;  5BMZ A;  1EKE A;  1ETQ A;  1X1A A;  3GCM A;  4LB6 B;  3SEQ A;  5JLW A;  2X51 A;  1ZRE A;  1U6G A;  4B47 A;  2DAO A;  2L7M P;  1WVR A;  2R7R A;  3TO7 A;  2VC0 A;  1LQ1 A;  3HBL A;  4XLP F;  5KAF C;  2R5Z A;  3F8N A;  2V26 A;  2L3D A;  2MAB A;  5CPR B;  2W7N A;  4RAF A;  3OYB A;  3OWT A;  2OC6 A;  1JKQ C;  1J0R A;  1RUO A;  2DLL A;  3F23 A;  2EV0 A;  2ZME B;  5DUK A;  1BM9 A;  3PO2 J;  1W0U A;  3NEU A;  2KRF A;  3DP7 A;  1JKR C;  4NC6 A;  1A6Q A;  5BOX A;  4WK8 F;  3AFH A;  1MH3 A;  4MEX F;  2P5L C;  3TOA A;  5K1Y A;  3ZR8 X;  3K4M A;  1KU9 A;  2HGC A;  4CUG A;  2V9V A;  5EEG A;  4D7N A;  4E7K A;  2DA7 A;  2O61 A;  2V9K A;  3KYC B;  1RES A;  1IRX A;  2AXT C;  3PUB A;  3ZMV A;  4AUX A;  3D1N I;  4L18 B;  2XGD A;  3MVP A;  1TWH J;  5E79 C;  1EA3 A;  4F91 B;  3K6G A;  4FET A;  2DI3 A;  1I6X A;  1SVL A;  2E60 A;  1AOY A;  2L01 A;  3PL8 A;  2HWV A;  4Y17 A;  4C3I J;  2E19 A;  3M1C A;  2DDB A;  5D8K B;  2BW3 B;  1HW5 A;  3HJE A;  2HOS A;  3RYR A;  3OOU A;  4FQG A;  1F9N A;  2M3A A;  2VQL A;  4EJU A;  3V4G A;  1EV7 A;  1XD7 A;  2V1D A;  2P7V B;  1A5J A;  1HW1 A;  2VBX A;  1XSD A;  4A3J J;  1DU0 A;  4G7O F;  1BOA A;  3S3O A;  3QOD A;  1OCT C;  1W5S A;  4EAT A;  3EYY A;  2OCC H;  1MNM C;  3J81 K;  1YQA A;  3HUG A;  2QVO A;  2A61 A;  5ICE A;  2JSP A;  2DA3 A;  1Z7L A;  3EQL F;  3CCY A;  4UNO A;  5KNL A;  3GWZ A;  2E2H J;  2R5Y B;  4HEA 2;  2WY8 Q;  4PDK A;  2HQ5 A;  3BJ6 A;  1P4W A;  1T98 A;  4I09 A;  2BOL A;  4RB1 A;  4F93 B;  2YSR A;  3CUQ A;  2DFE A;  2JTV A;  3ZQF A;  1IGN A;  3HOW J;  3GME A;  5D6F A;  4CXF A;  1TL8 A;  1QHG A;  1XSX A;  3GO5 A;  4XRS G;  5E1Z B;  4I6Z A;  4BJT A;  1H9T A;  4XKV A;  4PSW A;  2KMU A;  2UXX A;  2XSJ C;  3DU5 A;  3CP8 A;  3IL2 A;  1QZE A;  4XM3 A;  1MH4 A;  5ILS A;  4E70 A;  3MKZ A;  1G3S A;  2QEN A;  1YW8 A;  4E7I A;  1F1Z A;  5KHD A;  1ZR4 A;  1BA5 A;  1KQ9 A;  4A3F J;  3EDP A;  4MTE A;  2HDD A;  4ZYA A;  1UFM A;  2HNH A;  2JWT A;  4IVN A;  4F55 A;  2STT A;  3HGG A;  3PQK A;  3RJP A;  3CJQ B;  3SZG A;  2K85 A;  3B6C A;  1F4K A;  1R6R A;  2BZT A;  2FBH A;  3KIO A;  1Q1V A;  5M5Y J;  1W36 D;  3CC4 I;  2KIS A;  4Z2Y A;  1WI9 A;  3L2U A;  1ZGW A;  1ZQ3 P;  3IUO A;  3RPU D;  4Y3O A;  2V1X A;  2VI6 A;  1ETY A;  1QZY A;  5IT3 A;  3H92 A;  2JT1 A;  2CSO A;  3BY6 A;  3HOV J;  2X9D A;  3BR1 A;  2IGO A;  3B73 A;  2LF8 A;  2X1C A;  3DV8 A;  1L0O C;  4XMY A;  4ETS A;  5AIQ A;  4XQF A;  4S04 A;  4MHG A;  5K5Q A;  4LIU A;  2D1V A;  4DBQ A;  5ERI A;  2P4W A;  1I39 A;  1ON1 A;  3H9J A;  1OKR A;  2VQC A;  2Z5U A;  1PYV A;  2HQN A;  1X1D A;  4YFN F;  1XMK A;  4XSX F;  3DBH B;  1R9T J;  4MQ9 F;  4ZDP A;  1MND A;  1R1T A;  2ZME A;  5BNG A;  4CYD A;  4HDV A;  4WX9 A;  4B44 A;  3KP6 A;  2EPF A;  4BDZ A;  3BT9 A;  4M9Z A;  4X6A J;  2V9P A;  1MGT A;  3GUD A;  1IV8 A;  3ZMZ A;  4GYI A;  4NB5 A;  1H9G A;  5IP9 J;  1RR8 C;  3HB9 A;  4HQE A;  1YIT I;  5C4X J;  1YX5 A;  1JTX A;  4DGW B;  4RB3 C;  1WJ5 A;  1S6L A;  3WE2 A;  3G6E I;  2X48 A;  1R5I D;  5E1X A;  3HRS A;  4XN3 A;  2EIJ H;  3H36 A;  2KRC A;  2XVC A;  3DBL B;  3UNG C;  1QPM A;  1O3S A;  3GXO A;  4HPQ A;  3ULQ B;  3BQY A;  2MGQ A;  3G1L A;  5B5E C;  2VON A;  3WGG A;  1B1B A;  1BJZ A;  3DWL E;  4M6X A;  2B0L A;  2HPM A;  1KYZ A;  4D9J A;  5AIP A;  2HS5 A;  3K2Z A;  5H6Q A;  1IV6 A;  3HSR A;  4CCL A;  1HDP A;  2M8G X;  1K4S A;  3ECH A;  2QWW A;  5J4Y A;  4I2O A;  4NQW B;  4HV6 A;  5F04 A;  1FIP A;  5IYC J;  1RET A;  4KMF A;  2EIN H;  4A3I J;  5HLG A;  2STW A;  5F6F A;  3CDH A;  4XKB A;  4OIO F;  2FF4 A;  1T56 A;  3KX2 A;  2PLY A;  3J7Y J;  1Z6R A;  3OYF A;  2HTJ A;  1K83 J;  1XDS A;  2MLK A;  4CIC A;  4BBS J;  2BW3 A;  3F22 A;  4PGH A;  2MH2 A;  1G6N A;  3H3V K;  2KFD A;  1ZLJ A;  1HST A;  2KZV A;  5K7F A;  3CES A;  3GTQ J;  3H3U A;  1UCR A;  1OCP A;  3MEX A;  4FX0 A;  1UZC A;  5E20 A;  1XX5 A;  4LJZ F;  4BYY A;  3M8F A;  3ML6 A;  2W48 A;  2JN6 A;  4JQF A;  2ELJ A;  3W2V A;  2GWR A;  3JRG A;  5FKL A;  3ZN1 A;  2L5Q A;  2ELH A;  1AU7 A;  2C6Y A;  2P0W A;  1RUN A;  4D1Q A;  3IRQ A;  1OCR H;  2FX0 A;  3H0D A;  5KCM A;  2KDO A;  1AHD P;  3K1P A;  1Z05 A;  4I7H A;  1FTT A;  3RKQ A;  2VBW A;  1I6H J;  3FMR A;  4HYE A;  4AM3 A;  3AG4 H;  2QA4 I;  2E1C A;  1W4M A;  2VKV A;  1TQI A;  3M8J A;  5HNF A;  3J81 Z;  3F8C A;  1LFU P;  2W00 A;  4LMY A;  3WTY C;  3HOT A;  1HXD A;  1MW7 A;  3HOX J;  1T08 B;  2NVQ J;  2Q0O A;  2RV8 A;  2XRN A;  3E6C C;  1S8N A;  1WHU A;  3HKZ A;  3LL7 A;  2JRT A;  4NQW A;  4BAC A;  2RDP A;  2P6T A;  1SD5 A;  3LFK A;  2KKO A;  1LDJ A;  1QU3 A;  3CCM I;  2DOE A;  4NBQ A;  3JRE A;  5HDN A;  5JI6 A;  1N25 A;  1TP4 A;  4AID A;  1BC7 C;  2AXL A;  3SXY A;  4KDP A;  2BY1 A;  4PJL A;  3V7S A;  9ANT A;  5CVR A;  2XAF A;  2BGC A;  1FOY A;  4TV7 A;  3E1S A;  1X1C A;  4XLC A;  2XC7 A;  1Y56 A;  2CG4 A;  1BL0 A;  2PMZ N;  5DEQ A;  2R7D A;  3AG2 H;  4AVP A;  1MBG A;  4ZH4 F;  4A3D J;  4AYB A;  3ZP5 A;  1K78 A;  1IDY A;  4GXO A;  1O3T A;  3I54 A;  5EGO B;  1V4R A;  3IHU A;  1ORK A;  2L4M A;  1IXR C;  4U87 A;  3WTW C;  4KT6 A;  4LG3 A;  3F21 A;  3Q9V A;  2CRG A;  3MKY B;  4A3E J;  2HVS A;  1VI0 A;  1S72 I;  1ETK A;  4J00 A;  1O57 A;  4L9T A;  1WI3 A;  2CO5 A;  1XGM A;  3FIS A;  3VDX A;  2K40 A;  1T39 A;  1MDM A;  2OTL I;  4BHC A;  2H1K A;  5E3N A;  1ZG1 A;  1W1W E;  1YX3 A;  5J1Y A;  2ECB A;  2EQR A;  3RPQ A;  4BQO A;  1Z91 A;  4HNT A;  3S93 A;  4BUP A;  1J59 A;  1I1S A;  2M4K A;  3L2R A;  3A4C A;  2NVX J;  1ONV A;  1GVD A;  3LA3 A;  3W3C A;  3OYG A;  4XRM A;  3KYD B;  3LQR A;  4A0Y A;  3AG3 H;  2PMZ A;  1Z9C A;  4O3M A;  4CCO A;  4LB5 A;  2P5K A;  3REO A;  2BHZ A;  4JK1 X;  2XRO A;  2WA0 A;  1PJR A;  3GZ6 A;  4A5M A;  1WCM J;  4RS8 A;  3VB2 A;  1ENH A;  1DGR M;  2M45 A;  4QWQ A;  2HQR A;  1ON2 A;  3HSE A;  1KU3 A;  1FX7 A;  3V8J A;  1MBH A;  2L7K A;  3FX3 A;  3TW6 A;  2QUF A;  3N05 A;  4UB8 C;  3K70 C;  1T0F A;  1QVT A;  2F4I A;  4ZTJ A;  4ENN A;  2HVQ A;  2WAD A;  4JX5 A;  2KPM A;  2LSO A;  3I59 A;  2LF7 A;  2ZO4 A;  5GAE J;  2VBY A;  2E1M B;  3CF5 F;  3DPU A;  2Z99 A;  2BEO A;  1A6I A;  5FD6 A;  5ICG A;  1MMS A;  1D1C A;  2DCE A;  1OPC A;  4XLA A;  4AYB N;  2PMU A;  2IRF G;  3BTI A;  4CSW A;  3H3Z A;  3TGN A;  4DOZ A;  3HHG A;  4DJA A;  3VWB A;  3P5J A;  2DW4 A;  1FEX A;  1WPK A;  1YW7 A;  2IS4 A;  2ZSI B;  5IP7 J;  4PK4 A;  3LSK A;  3O3K A;  3S1N J;  3G71 I;  2XGE A;  2XF5 A;  1SD7 A;  2M7B A;  1XB4 A;  1GXP A;  2JPB A;  4LD5 A;  2EFO A;  4B4C A;  3LWF A;  3E6D A;  5HS7 A;  1BR4 A;  2BYV E;  1H8A C;  3KZI C;  1J75 A;  5IY5 H;  3N97 A;  3K2A A;  3FXL A;  4ZTF A;  1U9N A;  2EZL A;  3R61 A;  2F5F A;  1CF7 A;  2R92 J;  2QSG X;  3AL0 B;  4Y15 A;  3NAU A;  2ISY A;  4RLF A;  2FJ1 A;  3F6V A;  1HA8 A;  3HM5 A;  1WKM A;  2B63 J;  3I4N J;  2A69 F;  5CLS A;  3OY9 A;  1LVA A;  2VJ5 A;  2NS0 A;  4ZYH A;  2ID3 A;  1B8I B;  1UG0 A;  4GCV A;  1B4A A;  2KL4 A;  5CVV A;  2KIF A;  4LFU A;  3TOB A;  4WCG A;  3E5U A;  2P8T A;  3I55 I;  1ULY A;  4Y52 J;  1Y1W J;  2B7E A;  3ZQL A;  3MZ8 A;  2LTP A;  4F3Q A;  2AQF A;  1K78 B;  3JRA A;  4IEJ A;  4RA2 A;  2QKL B;  2LC2 A;  1TQP A;  4QPQ A;  2WV1 A;  2FQ3 A;  5GAH J;  4V2F A;  3T1B A;  2M8E A;  4KIS A;  2FSW A;  3KZZ A;  5FD5 A;  3U2R A;  5HVQ C;  3VPR A;  1Z1D A;  4O5V A;  3QU3 A;  2DO7 A;  3A1Y A;  1P7J A;  3K1M A;  3ZMD A;  1OYY A;  1R00 A;  1P2F A;  3O8H A;  1ERD A;  1YIJ I;  3H0G J;  1KU7 A;  5DM7 F;  5GAG J;  2XKO A;  5EYR A;  3LA2 A;  2O7O A;  1IUF A;  1IDZ A;  3JR9 A;  2FA5 A;  4G7H F;  5J1U A;  1KGS A;  3MCZ A;  2JA7 J;  2CQN A;  4ZYE A;  3HSF A;  3J80 K;  2ZXJ A;  4B43 A;  1WWX A;  3HRM A;  4S0H B;  1IRG A;  2X6X A;  2ELK A;  2L9N A;  3BCA A;  4DZP A;  1QQI A;  3QYF A;  5IYB J;  3FKJ A;  4A6E A;  4G6Q A;  2VE8 A;  1VQM I;  4IF4 A;  1R4N B;  2D45 A;  5LRS A;  5K5O A;  3M3Y J;  4MQV A;  1NTC A;  1EF4 A;  4ESJ A;  1WZ2 A;  4U7B A;  4UV8 A;  2X6O A;  5BPI A;  3FKI J;  3F8M A;  4RGX A;  3EUA A;  1E17 A;  2LKS A;  3K4L A;  1JKP C;  2IGN A;  3I64 A;  4B48 A;  3M1E A;  5D5U B;  1FC3 A;  4U0V A;  2VOO A;  5LGT A;  4BKX A;  2EA2 A;  4CDG A;  2HDC A;  3I59 B;  1W0T A;  4NC7 A;  3RZD J;  3KCC A;  3LST A;  1CQT A;  3H9G A;  2EIK H;  3HIF A;  5EF6 A;  2OZU A;  4R8H A;  2WBM A;  4OAZ A;  5GAD J;  2DN0 A;  2WAQ N;  4EM0 B;  2YX7 A;  1FNN A;  2A6H F;  2PG4 A;  3F0C A;  3HG9 A;  3V8L A;  4XRS A;  3ABM H;  3DKY A;  1VTN C;  1V54 H;  1YS6 A;  2G7U A;  4E7S A;  1OCO H;  3FHZ A;  2LP0 A;  5HLT A;  1U0J A;  2VKD A;  2R7F A;  1MKM A;  2DYS H;  1FPQ A;  2RAE A;  1O4X A;  1U8B A;  3SHF A;  2J5P A;  4PCQ A;  4L5I A;  1XTA A;  3BR6 A;  2FML A;  3K0L A;  3ZOB A;  4BXF A;  1D5V A;  1Z67 A;  3KET A;  3PNV A;  2A07 F;  5E8I A;  4DYR A;  1W7P B;  2Z2S B;  3DTK A;  4BE0 A;  4PZJ A;  1J7K A;  3AL0 C;  3FBI B;  1LFP A;  5LGN A;  4AC0 A;  2CQ7 A;  5ED4 A;  1ETO A;  1KA8 A;  3BR0 A;  2G9W A;  3I3L A;  3QOP A;  2LNB A;  4KIF A;  2XPU A;  1FSH A;  5HS9 A;  5K5R A;  3CCV I;  2IS2 A;  1R58 A;  1J2X A;  2PN6 A;  3DXJ F;  1J9I A;  2TDX A;  2GOM A;  4B09 A;  3ERM A;  1FBU A;  5DCF A;  2P5V A;  3F72 A;  2WB1 A;  3PIP F;  2ZJP F;  1G4D A;  2DTR A;  2LD5 A;  4GGG A;  3NWS A;  1BBY A;  4N4O B;  3S1Q J;  4CH7 A;  2CWE A;  3H35 A;  5L3G A;  2YS9 A;  5FLX Z;  1TC3 C;  1YOV B;  1W36 C;  2GIV A;  4XOR A;  2R7Z J;  2EZK A;  3SYT A;  4IRH A;  4QLC U;  3G1O A;  1BI0 A;  2CFX A;  2G0E A;  2XIG A;  1FLI A;  4CHU A;  4A3G J;  1CF7 B;  3Q3S A;  4HST A;  1U3E M;  4B8X A;  5EZG A;  3BG5 A;  2L54 A;  4UVC A;  1P9Q C;  1LPQ A;  3C2B A;  1K6O A;  1DP7 P;  5AON A;  3ZQG A;  1ZG3 A;  4BE1 A;  2CW0 F;  4PUS A;  1P4A A;  3T5X A;  5E18 F;  3TED A;  2A05 A;  4HRI A;  3RZO J;  3AG1 H;  2M0M A;  4AVZ A;  2HZD A;  4UUS B;  3P9K A;  3PM1 A;  3GYH X;  2K5C A;  5ILV A;  5EG0 B;  2HXI A;  1BW5 A;  3WTV C;  1EH8 A;  3CCQ I;  1YRN B;  1TNS A;  3EET A;  3FK6 A;  4CCN A;  3CCU I;  2EIM H;  2H6C A;  3ZXS A;  2H09 A;  1WJC A;  4XKW A;  1XC5 A;  4A0X A;  3L2V A;  2R7U A;  2LR8 A;  2IXS A;  2BXZ A;  2Y75 A;  4NNJ A;  3ASO H;  3BR5 A;  3IAS 2;  3SDB A;  3OSG A;  3E3V A;  3HTU A;  1X3U A;  2X1E A;  5E3L A;  4DIQ A;  2DA2 A;  4BNC A;  2PMH A;  2Q2E A;  1AA7 A;  2XAH A;  2F2E A;  3BPV A;  4E6K G;  5BPD A;  3CLQ A;  2DDA A;  2L7Z A;  2DXI A;  2CFO A;  2FMY A;  1U5T B;  4OWR B;  5L3D A;  1VQ4 I;  4LG0 A;  3P9I A;  4XIC A;  2L0K A;  3ROU A;  2WTE A;  3GF2 A;  3M8E A;  3PQJ A;  5FRO A;  2GIZ A;  4BXX J;  4BAY A;  2VUM J;  2OV7 A;  3GX4 X;  1FMW A;  5GPA A;  3ONQ A;  2MG4 A;  2E7W A;  2E36 A;  4HNV A;  3WG9 A;  5C3E J;  2L7F P;  1F36 A;  5FLM J;  3GFL A;  1IN4 A;  5LLQ A;  3A01 B;  2KRH A;  5DV5 A;  2COB A;  3LSH A;  2Q8K A;  3LMM A;  5LBQ A;  2VXD A;  3ZRG A;  2LRD A;  1YHQ I;  1XGS A;  2LMD A;  2HXO A;  4QTR A;  2V79 A;  4ASN A;  5HS8 A;  2OF7 A;  3K70 D;  2HI3 A;  2RC4 A;  3J80 Z;  2K3P A;  4DBR A;  2UWM A;  1X2N A;  2RVC A;  4KIT B;  3CC7 I;  1BI3 A;  3GFI A;  3P9C A;  3W6J B;  3FXM A;  1AWC A;  2IGM A;  3GFJ A;  1ZKG A;  3CJT B;  3ECO A;  4BY7 J;  2VPR A;  2O6G E;  2EJR A;  1KON A;  5H2F C;  3FBN B;  1VQ8 I;  4FAS D;  3JSP A;  2NXN B;  1VFC A;  5M3M J;  1SFO J;  2F5C A;  2KHM A;  3BG3 A;  3OIO A;  1TNT A;  3G2B A;  4XN0 A;  1R22 A;  3OYD A;  1XS9 A;  3BZ6 A;  2HU9 A;  4II2 A;  2E7X A;  4C30 A;  4UVA A;  1FP2 A;  4OIN F;  1WQ2 A;  2QM3 A;  4PFO A;  3PNY A;  3S3N A;  2Y31 A;  1RR7 A;  4A3K J;  3FMQ A;  2CUJ A;  2X1D A;  4ZZD A;  1E3P A;  2OBP A;  4MNU A;  2HTS A;  5LFA A;  4LLL A;  3DEE A;  2H1L A;  1LNW A;  1K61 A;  1T38 A;  1IRZ A;  3I56 I;  4EV0 A;  2VQH A;  1RIO H;  4QIW N;  3QP6 A;  3QYE A;  2FD5 A;  2M9H A;  4B3X A;  4A93 J;  4I0B A;  2ZKZ A;  4BY1 J;  4FCY A;  2IPQ X;  4NUB A;  3LNQ A;  5LD2 C;  2OAZ A;  1HKT A;  2F4O B;  4UXN A;  1E0E A;  1USS A;  3IC7 A;  2RKH A;  3CMM A;  3CME I;  4LG0 B;  4KMU X;  3MZY A;  3W6K B;  3JTG A;  5M5W J;  2DJN A;  2ZNZ A;  1Y1V J;  2FBK A;  1LKX A;  2RQP A;  4EJO A;  2GLO A;  4HZF A;  1IN8 A;  3U1D A;  5JLX A;  4G12 A;  1N75 A;  2CJJ A;  1SFK A;  1HF0 A;  3RQI A;  2Z1D A;  4FX4 A;  5ILU A;  2M2E A;  2VN2 A;  2Y9Y A;  1P6R A;  4ZYG A;  2FOK A;  2F5E A;  1K7A A;  1I50 J;  5CYV A;  2LKX A;  2ZSH B;  3B02 A;  4E7L A;  4M9X A;  3RKY A;  2DYR H;  1E2X A;  2WY7 Q;  4YEL A;  3JRF A;  4RB2 C;  1TWC J;  3OYM A;  2NVU B;  1HDD C;  2XB0 X;  2VOD A;  3C3W A;  4P9U A;  1IN5 A;  2QEX I;  1GT0 C;  1D0X A;  2F4M B;  2QKM B;  1YI2 I;  1B72 A;  2GAU A;  1Y8Q B;  5FKM A;  3IP4 B;  1WJB A;  2VJJ A;  2ZFW A;  4X1E A;  2Z33 A;  3R0A A;  5CJ9 A;  2L4A A;  4Q48 A;  1WH7 A;  2W4S A;  2MSY A;  4MIM A;  3LAP A;  2HOE A;  3ABU A;  1Y6I A;  3OYI A;  3DTI A;  2VXZ A;  3AAF A;  3TW7 A;  5LRR A;  2MH9 A;  2NOG A;  3D5R C;  1G8X A;  3TP3 A;  1UST A;  4Q5S F;  2LRE A;  2X4H A;  3DF8 A;  4FIS A;  3RKX A;  5JHU A;  5FKN A;  1LDD A;  2UV1 A;  1VQN I;  2O0Y A;  4NDL A;  3OS0 A;  5EGO A;  1LEB A;  4HSR A;  3CD6 I;  3HUG B;  2W1O A;  3I4M J;  2R0Q C;  5IOY A;  3CCJ I;  2RRE A;  2K9S A;  3GTP J;  1MBJ A;  1MNE A;  4R1H A;  1BN5 A;  1RNL A;  4LLG F;  1FYM A;  2R7Q A;  2QCO A;  2P81 A;  2HOT A;  3WHB A;  2V6E A;  2QYO A;  4X0G A;  1RKT A;  5L3C A;  3ZGK A;  5JHF A;  2ZXH A;  3OYC A;  5J40 A;  5F27 A;  4UV9 A;  1SAU A;  3S2W A;  1TTY A;  5F1R A;  4V2G A;  1ACI A;  1UEL B;  4PJJ A;  3TQN A;  1FIA A;  2EFW A;  5ICC A;  3ZQQ A;  4LIV A;  4ESB A;  1FJL A;  3DTE A;  4UHT A;  4P5O A;  2EFP A;  2PJP A;  3LA7 A;  4OMY A;  2ECC A;  1TW2 A;  3R60 A;  1PUF A;  1S29 A;  2EFQ A;  3CP2 A;  3L9F A;  1SAX A;  1IF1 A;  1EH7 A;  2XAU A;  4WF2 A;  4N0B A;  4C2T A;  2R7S A;  3E7L A;  2ZJ2 A;  2DA6 A;  2E1O A;  2FOW A;  3CO7 C;  1KYW A;  2CUE A;  3QWL A;  4DZJ A;  1W5C C;  2PBI A;  3SJM A;  1UHM A;  2CYY A;  3E5X A;  3KEO A;  3L1P A;  1AKH B;  3ERE D;  1B9M A;  1WRJ A;  4RM2 A;  2OZ6 A;  5HLI A;  4KIG A;  5E3O A;  1JT0 A;  4XNF A;  2E2J J;  3S16 J;  2W24 A;  1U8R A;  3WTT C;  2DK8 A;  1NH3 A;  2H27 A;  4IHS A;  4HQM A;  1SMT A;  4Q4Z F;  3KYL A;  1DPU A;  2M4G A;  2CW7 A;  2VKH A;  4HF2 A;  1MJ9 A;  2EIL H;  2ISZ A;  3F6O A;  1SAN A;  2M30 A;  1T8I A;  2NYX A;  3IWF A;  4KN7 X;  4UUT A;  3CUO A;  4XR6 A;  4ABZ A;  4PJN A;  3L09 A;  1UHS A;  3R4K A;  1MMN A;  1QBJ A;  3HOY J;  3J7A Y;  1RRJ A;  4BQA A;  2JA8 J;  5EEA A;  3JTH A;  3WG7 H;  4YIR X;  1R1V A;  3FXQ A;  1E3O C;  2OQG A;  1I3Q J;  4CZC A;  5IOZ A;  1IO2 A;  2GXG A;  1R23 A;  2KIM A;  1Z0X A;  2H6B A;  2HZT A;  2A5Y B;  4RAZ A;  1ZRD A;  2EBI A;  5D5X B;  3ZQC A;  3VYU B;  4LOC A;  4BH9 A;  1IAW A;  1QA6 A;  4ENJ A;  2IGK A;  4UUS A;  1MMA A;  2QZ8 A;  5J8C A;  2IJL A;  4M9S A;  1ZTR A;  3GTO J;  2L02 A;  4WXD A;  4EEF G;  2JSC A;  3B6A A;  5TRD A;  1R49 A;  3GVA A;  3R0J A;  4M71 A;  5E17 F;  2Q1Z B;  5FLX K;  2DTZ A;  3ZQ7 A;  2MW8 A;  3FXO A;  4ZC3 A;  1IRF A;  2VB6 A;  4KT5 C;  4IOA F;  1TQM A;  2DFH A;  4OU0 A;  3S1M J;  3W2W A;  2CUF A;  2XGX A;  5CVU A;  2CH0 A;  2PEX A;  1MMG A;  3CJR B;  5LHG A;  1YS7 A;  5F64 A;  3I9V 2;  2IA1 A;  1FY7 A;  2MLG A;  3HXL A;  4XLH A;  2X6Y A;  2MC4 A;  3WGH A;  3LSG A;  1O3Q A;  2P6S A;  2NS8 A;  2KDZ A;  3S32 A;  1Z3Y A;  4M3B A;  1PDN C;  2V1N A;  1MBF A;  1JUS A;  5FJ8 J;  2XDV A;  1K4T A;  1YW9 A;  3MN2 A;  5D4R A;  2X0L A;  1A35 A;  4OIR F;  2RN7 A;  3VSK A;  3GEZ A;  2IP2 A;  5JVG F;  1UJ8 A;  2MD0 A;  5CQE A;  1JGG A;  1JKO C;  2FNA A;  2HYG D;  2L9S A;  3L7W A;  2DBB A;  3ZQI A;  3S15 J;  1WH5 A;  5CVI A;  2VLA A;  2WC2 A;  5F0F A;  2ZXI A;  2VJI A;  3S14 J;  3CC2 I;  4BEH B;  2JUG A;  3DEU A;  3JCU C;  4KNY A;  2MBF A;  4L9V A;  2O03 A;  1X58 A;  4YG2 F;  2FE3 A;  2R7O A;  4BJ5 C;  3OYA A;  2W84 A;  2FBI A;  5IP6 A;  1FT9 A; 
#chains in the Genus database with same CATH homology
 1FOK A;  4CO8 A;  2FU4 A;  3WE3 A;  4CGZ A;  3QPT A;  1P92 A;  1I5Z A;  1ODD A;  4OOI A;  2D1H A;  4N9I A;  4KIB A;  1OR7 A;  3CTA A;  3ZMU A;  4UUV A;  5FB2 A;  1YTY A;  1LEA A;  3IKT A;  3E6B A;  1PP8 F;  2QQB A;  1FBS A;  1XSV A;  3ZN0 A;  2KJB A;  1T6S A;  3Q9S A;  3DQV C;  2GQQ A;  3RDI A;  1XGN A;  2E1N A;  4L5J A;  4G6D A;  2IA2 A;  3DPL C;  1IZ1 A;  1HW2 A;  4EJV A;  2NNN A;  3TDZ C;  1SD4 A;  1DUX C;  1XMA A;  2OU2 A;  5FFZ A;  4AWX B;  4G9Y A;  2UZK A;  5DD8 A;  2LKP A;  1ZYR F;  5JVT A;  4AIK A;  2NRA C;  4P96 A;  3T8R A;  2ACJ A;  1SFU A;  3HTS B;  4HF1 A;  4HOB A;  3FXU A;  2DU9 A;  2W85 A;  2W25 A;  1KQ8 A;  5ICF A;  5L3B A;  4KYW A;  1H0M A;  3QRF F;  1OMI A;  2HKO A;  5IT9 K;  4EMS A;  2COM A;  3VFZ A;  5HLH A;  5LEJ A;  4GO1 A;  1IXC A;  4AIH A;  1YLF A;  1YO5 C;  4EM1 A;  2YPR A;  3FM3 A;  4RB0 A;  1BC8 C;  1S7A A;  3PFI A;  5FO5 A;  1J5Y A;  1MJA A;  2XV4 S;  3K69 A;  2H94 A;  4YFX F;  4WWC A;  1IUY A;  2RGV A;  1W7P D;  3BJO A;  2EA4 A;  1R1U A;  5E1W A;  2K4B A;  1LB2 A;  2ESH A;  1L3L A;  4U0W A;  3OV8 A;  3FXR A;  3I5U A;  4AIJ A;  5DD4 A;  4YFK F;  2HR3 A;  2HKX A;  1FYK A;  4F7Z A;  1XCV A;  4M73 A;  2VE9 A;  4YIF A;  3FMS A;  1SFX A;  1U5T A;  3CUQ B;  1FSE A;  2CQK A;  1QO0 D;  2FRH A;  4CZZ A;  4ZYD A;  1PP7 U;  3GLX A;  1NHA A;  3HHH A;  3ISP A;  4IJA A;  1K79 A;  1ZG5 A;  4HLX A;  1GVJ A;  4NHJ A;  2ZNY A;  3I0T A;  1YFH A;  3RPU A;  3NRV A;  3RIR A;  2EWN A;  4XRF A;  2IW5 A;  3RI4 A;  4IXA A;  1CGP A;  2QBY A;  5H20 A;  4DQ2 A;  4IHT A;  2K7L A;  1FBQ A;  3T0Y A;  3J7A O;  1Z6T A;  1JXS A;  1ZH5 A;  1W5T A;  3KP5 A;  4A0Z A;  4RAY A;  2GXB A;  3SZP A;  1ZAR A;  2QQ9 A;  1Z7U A;  4BXU A;  1S3J A;  1XCB A;  1Q1H A;  3GZ5 A;  2VC1 A;  2V6C A;  2NNY A;  3KP3 A;  1TW3 A;  3GFM A;  3TO6 A;  3JAM K;  1G3T A;  3WOD F;  5HDG A;  2G7H A;  4A5N A;  3SZT A;  2ADU A;  1SD6 A;  5EEH A;  5A2Q K;  4Y13 A;  1QNT A;  1YYV A;  4I0A A;  1SFE A;  2VOP A;  1MD0 A;  4A12 A;  3OOP A;  1ZRF A;  4KIC A;  2XAJ A;  3DPT A;  1ZN2 A;  2GA1 A;  3TO9 A;  4WXH A;  3R6S A;  2CGP A;  2PI0 A;  3HRT A;  1YIO A;  3L00 A;  5D4S A;  5BS6 A;  4HX7 A;  1DPR A;  1JHH A;  2F5D A;  1FP1 D;  1UHW A;  2V1U A;  2M87 A;  3T8T A;  4P9F A;  4Q47 A;  1TBX A;  3ZMS A;  3FF5 A;  3C1D A;  4FHT A;  3KE2 A;  1I1G A;  5HDK A;  3KEQ A;  4EJW A;  3ABT A;  1IXS B;  3RTR A;  2R3S A;  4LLN A;  3KZY A;  4O6J A;  1OYI A;  5D5V B;  2BBY A;  2YR2 A;  5IT9 Z;  3I58 A;  3KLO A;  4HX8 A;  4G94 A;  3F3X A;  4L0Y B;  3QP5 A;  3KP2 A;  4A2U A;  3C18 A;  4GYG A;  2D2W A;  3WTS C;  4M6Y A;  1U78 A;  3JSO A;  1MJB A;  2EV6 A;  5LHI A;  2XAQ A;  4P55 A;  4ON0 A;  3VOD A;  4BHP A;  2JPC A;  3EUH A;  3JW4 A;  2Y0M A;  3V8K A;  3U9G A;  5FFX A;  4AD9 A;  3D0S A;  1BIA A;  2DPU A;  5FGM A;  4ESF A;  4LK1 F;  1IN6 A;  1XDU A;  3K1N A;  4IRI A;  1STZ A;  4HV5 A;  1LJ9 A;  3IWZ A;  3MFK A;  1IN7 A;  1BI2 A;  1IW7 F;  1JHF A;  2EFN A;  1WSU A;  3MWM A;  2IA0 A;  1B59 A;  2GA2 A;  4HA8 A;  1REP C;  5D8L B;  1DDN A;  1HQC A;  3D5L A;  2QBY B;  2W57 A;  2WWY A;  3LAJ A;  2ETH A;  4EJT A;  3I4P A;  3CJN A;  5KK1 A;  2P7C B;  3IRR A;  1TLH B;  1MZB A;  1T2K A;  3BRO A;  2OQR A;  3WTX C;  3VEP A;  3WU0 A;  4KA4 A;  3MZH A;  3BJA A;  1S7O A;  3HOS A;  1BI1 A;  2Z9O A;  4L0Z B;  1A04 A;  4UVB A;  1D8K A;  4ZZL A;  2UXN A;  3COA C;  4S05 A;  6PAX A;  2O8X A;  2DFI A;  5J6X A;  4N9H A;  2HFH A;  1C0W A;  4EVI A;  4R79 A;  1G3Y A;  1HKS A;  2MA3 A;  1KQ0 A;  3FM5 A;  1RZ4 A;  2K4J A;  2VBZ A;  2EV5 A;  5KVR A;  1RI7 A;  3G3Z A;  2J5O A;  2KIU A;  4ENK A;  1JGS A;  4MEY F;  1MDM B;  2XAG A;  3I53 A;  3V7C A;  1U5T C;  3FWE A;  2XKP A;  2YX4 A;  5L3F A;  3WTZ A;  2FEZ A;  3BP8 A;  2NAZ A;  3KFW X;  1I27 A;  1YG2 A;  2DQR A;  1V3F A;  5DCM B;  2MD5 A;  1BJA A;  3E5Q A;  4EGZ A;  2ESN A;  3QU6 A;  1P4X A;  2RNJ A;  3L2C A;  4HAM A;  2LDU A;  2BE5 F;  1FWZ A;  2GZW A;  3JAM Z;  3E97 A;  3G73 A;  1O3R A;  4EM2 A;  2FNP A;  5A2Q Z;  2Z3Y A;  3M7G A;  5D6E A;  2DK5 A;  4PGG A;  2VT3 A;  3TKY A;  1ZAO A;  4HDU A;  4D0P A;  4ENM A;  1W7P A;  3CLO A;  2O3F A;  3WU1 B;  3EYI A;  2OA4 A;  5L3E A;  1QGP A;  5DCM A;  5JFR A;  5DDG A;  2M5W A;  4XBF A;  2OD5 A;  1SMY F;  2A6E F;  4HF0 A;  4I02 A;  4U88 A;  2VT2 A;  3ZMT A;  1R7J A;  1R36 A;  3O2P E;  4U7D A;  3F8F A;  3BDD A;  4L9J A;  3WGI A;  2K27 A;  2MC3 A;  4RGU A;  4HLY A;  1F5T A;  3E6M A;  4OIP F;  2QQA A;  5H6R A;  5LGU A;  3DKW A;  3HRU A;  3F8B A;  4KUM A;  1XN7 A;  1O7F A;  2WV0 A;  3O6B B;  3CO6 C;  3BOQ A;  1HBX G;  3RYP A;  3MAJ A;  2XHK A;  3TDU C;  2K86 A;  4EGY A;  4G7Z F;  1FZP B;  1U2W A;  2EK5 A;  1ZGJ A;  1D8J A;  3KP7 A;  1KU2 A;  3I71 A;  1B6A A;  1ZRC A;  1PUE E;  3SFZ A;  4WXC A;  4BHB A;  1BIB A;  5JR3 A;  1ZLK A;  4M72 A;  2A68 F;  3LQQ A;  2AS5 F;  1QZZ A;  4I01 A;  3CUQ C;  4YII A;  3M9A A;  2HEO A;  2YU3 A;  3NQO A;  4OIQ F;  1HKQ A;  2BV6 A;  4LGW A;  2A3S A;  2PQ8 A;  5LEK A;  2DPD A;  1R5G A;  5DYM A;  5DUI A;  3K9T A;  3C7J A;  3ELK A;  2JZY A;  4LK0 F;  2FXA A;  3MQ0 A;  3IKV A;  4IPA A;  4L9N A;  4RGR A;  5D5W B;  3ZPL A;  4MGR A;  3QPH A;  1G3W A;  2DQL A;  4U0Y A;  1HSJ A;  3FZV A;  4EQQ A;  3VOE A;  5HOO A;  2XAS A;  3QAH A;  1GHC A;  1OYW A;  4DNC A;  1ZHF A;  1B9N A;  2DT5 A;  1R5H A;  4MTD A;  4IRG A;  4HW0 A;  4XLN F;  3V7R A;  5BQT A;  1UB9 A;  2XUB A;  4HX4 A;  3WTU C;  2PFB A;  4KFC A;  2ZBK A;  2KJC A;  1XGO A;  5E8G A;  1O7L A;  3BPX A;  3KP4 A;  4RGS A;  4OMZ A;  2IT0 A;  4XSZ F;  3SQN A;  4HBL A;  1JE8 A;  1D3Y A;  3GW2 A;  1Y0U A;  2Y48 A;  2ZCW A;  2QLZ A;  3RKW A;  3DFG A;  3HYI A;  4FT8 A;  1ZGA A;  3P7N A;  1EH6 A;  2K02 A;  4KN4 X;  4JBA A;  5TJJ A;  4H0E A;  3Q5F A;  4M74 A;  4G8X A;  4I98 B;  5CVJ A;  2HYF A;  5LHH A;  2EB7 A;  1GXQ A;  1LDK B;  5J8F A;  2IVM A;  3BWG A;  4A6D A;  2M1B A;  3N4M A;  1FYL A;  4K2E A;  3KLN A;  5BMZ A;  4LB6 B;  1ZRE A;  1U6G A;  2DAO A;  3TO7 A;  2VC0 A;  1LQ1 A;  4XLP F;  3F8N A;  2L3D A;  1RUO A;  1J0R A;  2DLL A;  3F23 A;  2EV0 A;  2ZME B;  5DUK A;  1BM9 A;  3NEU A;  2KRF A;  3DP7 A;  5BOX A;  4WK8 F;  4MEX F;  2P5L C;  3TOA A;  5K1Y A;  1KU9 A;  2HGC A;  2V9V A;  5EEG A;  2O61 A;  3ZMV A;  4L18 B;  1I6X A;  2DI3 A;  1AOY A;  2L01 A;  4Y17 A;  2HWV A;  5D8K B;  1HW5 A;  3RYR A;  1F9N A;  4EJU A;  3V4G A;  1EV7 A;  1XD7 A;  2V1D A;  2P7V B;  1HW1 A;  2VBX A;  1XSD A;  4G7O F;  1BOA A;  1W5S A;  3EYY A;  3J81 K;  1YQA A;  3HUG A;  2QVO A;  2A61 A;  5ICE A;  3EQL F;  4UNO A;  3GWZ A;  4PDK A;  3BJ6 A;  1P4W A;  1T98 A;  4I09 A;  4RB1 A;  2YSR A;  3CUQ A;  2JTV A;  5D6F A;  4CXF A;  1XSX A;  3GO5 A;  5E1Z B;  1H9T A;  2UXX A;  3IL2 A;  5ILS A;  4E70 A;  1G3S A;  2QEN A;  1YW8 A;  1F1Z A;  1KQ9 A;  3EDP A;  4MTE A;  1UFM A;  2STT A;  4IVN A;  3PQK A;  3RJP A;  1F4K A;  2FBH A;  4Z2Y A;  1WI9 A;  2V1X A;  1QZY A;  5IT3 A;  3H92 A;  2JT1 A;  2CSO A;  3BY6 A;  3B73 A;  2LF8 A;  3DV8 A;  1L0O C;  4ETS A;  5AIQ A;  4S04 A;  4MHG A;  5K5Q A;  2D1V A;  5ERI A;  2P4W A;  1ON1 A;  1OKR A;  2Z5U A;  2HQN A;  4YFN F;  1XMK A;  4XSX F;  4MQ9 F;  1R1T A;  2ZME A;  4CYD A;  4HDV A;  4WX9 A;  3KP6 A;  4M9Z A;  1MGT A;  3GUD A;  3ZMZ A;  4GYI A;  4NB5 A;  1H9G A;  4HQE A;  4RB3 C;  1S6L A;  3WE2 A;  5E1X A;  3HRS A;  2XVC A;  1QPM A;  1O3S A;  3GXO A;  3ULQ B;  2VON A;  3WGG A;  1B1B A;  4M6X A;  2B0L A;  1KYZ A;  5AIP A;  2HS5 A;  3K2Z A;  5H6Q A;  3HSR A;  3ECH A;  2QWW A;  4I2O A;  4HV6 A;  4KMF A;  5HLG A;  2STW A;  5F6F A;  3CDH A;  4OIO F;  2FF4 A;  2PLY A;  1Z6R A;  2HTJ A;  1XDS A;  2MLK A;  4CIC A;  3F22 A;  4PGH A;  2MH2 A;  1G6N A;  1ZLJ A;  1HST A;  3H3U A;  1UCR A;  4FX0 A;  3MEX A;  5E20 A;  4BYY A;  4LJZ F;  3M8F A;  3ML6 A;  4JQF A;  2GWR A;  3ZN1 A;  2ELH A;  2C6Y A;  1RUN A;  3IRQ A;  3K1P A;  1Z05 A;  4I7H A;  2VBW A;  3FMR A;  4HYE A;  2E1C A;  1W4M A;  1TQI A;  3J81 Z;  3F8C A;  3WTY C;  4LMY A;  3HOT A;  1HXD A;  2Q0O A;  2RV8 A;  2XRN A;  3E6C C;  1S8N A;  2JRT A;  4NQW A;  2RDP A;  2P6T A;  1SD5 A;  3LFK A;  2KKO A;  1LDJ A;  5HDN A;  5JI6 A;  1BC7 C;  2AXL A;  3SXY A;  4KDP A;  3V7S A;  5CVR A;  2XAF A;  2BGC A;  4TV7 A;  2CG4 A;  5DEQ A;  2R7D A;  4AVP A;  4ZH4 F;  3ZP5 A;  1K78 A;  4GXO A;  1O3T A;  3I54 A;  1V4R A;  3IHU A;  2L4M A;  1IXR C;  3WTW C;  3F21 A;  3Q9V A;  1O57 A;  4L9T A;  2CO5 A;  1MDM A;  1XGM A;  1T39 A;  4BHC A;  1ZG1 A;  3RPQ A;  1Z91 A;  1J59 A;  1I1S A;  1ONV A;  3LA3 A;  3LQR A;  4A0Y A;  1Z9C A;  4O3M A;  4LB5 A;  2P5K A;  3REO A;  4JK1 X;  2XRO A;  3GZ6 A;  4A5M A;  4RS8 A;  3VB2 A;  2M45 A;  4QWQ A;  2HQR A;  1ON2 A;  3HSE A;  1KU3 A;  1FX7 A;  3V8J A;  3FX3 A;  2QUF A;  1T0F A;  4ENN A;  2LSO A;  3I59 A;  2LF7 A;  2ZO4 A;  2VBY A;  2Z99 A;  2BEO A;  5FD6 A;  5ICG A;  1OPC A;  2PMU A;  2IRF G;  3H3Z A;  3TGN A;  3HHG A;  2DW4 A;  1YW7 A;  3O3K A;  1SD7 A;  1XB4 A;  1GXP A;  2JPB A;  4LD5 A;  2EFO A;  3LWF A;  3E6D A;  5HS7 A;  2BYV E;  1J75 A;  3N97 A;  3R61 A;  2F5F A;  1CF7 A;  4Y15 A;  2ISY A;  3F6V A;  1WKM A;  2A69 F;  5CLS A;  1LVA A;  2NS0 A;  4ZYH A;  4GCV A;  5CVV A;  1B4A A;  3TOB A;  2KIF A;  4LFU A;  4WCG A;  3E5U A;  2P8T A;  1ULY A;  1K78 B;  1TQP A;  2FQ3 A;  3T1B A;  2M8E A;  2FSW A;  3KZZ A;  5FD5 A;  3U2R A;  5HVQ C;  1Z1D A;  4O5V A;  3QU3 A;  2DO7 A;  3K1M A;  3ZMD A;  1OYY A;  1R00 A;  1P2F A;  1KU7 A;  2XKO A;  3LA2 A;  2FA5 A;  4G7H F;  1KGS A;  3MCZ A;  4ZYE A;  3HSF A;  3J80 K;  2ZXJ A;  1WWX A;  3HRM A;  1IRG A;  1QQI A;  4A6E A;  4G6Q A;  2VE8 A;  4IF4 A;  2D45 A;  5LRS A;  5K5O A;  4MQV A;  4ESJ A;  4U7B A;  4UV8 A;  5BPI A;  3F8M A;  4RGX A;  1E17 A;  3I64 A;  3M1E A;  5D5U B;  1FC3 A;  4U0V A;  2VOO A;  5LGT A;  2HDC A;  2EA2 A;  4CDG A;  3I59 B;  3KCC A;  3LST A;  3HIF A;  2OZU A;  4R8H A;  4EM0 B;  2YX7 A;  1FNN A;  2A6H F;  2PG4 A;  3V8L A;  1VTN C;  1YS6 A;  2G7U A;  3FHZ A;  2R7F A;  1MKM A;  1FPQ A;  3SHF A;  2J5P A;  4PCQ A;  4L5I A;  2FML A;  3K0L A;  1D5V A;  3KET A;  2A07 F;  5E8I A;  1W7P B;  4PZJ A;  1J7K A;  5LGN A;  5ED4 A;  1KA8 A;  2G9W A;  3QOP A;  2LNB A;  4KIF A;  1FSH A;  5HS9 A;  5K5R A;  1R58 A;  1J2X A;  2PN6 A;  3DXJ F;  1J9I A;  2TDX A;  4B09 A;  1FBU A;  5DCF A;  2P5V A;  3F72 A;  1G4D A;  2DTR A;  4GGG A;  1BBY A;  2CWE A;  5L3G A;  5FLX Z;  2GIV A;  4IRH A;  4QLC U;  1BI0 A;  2CFX A;  2XIG A;  1FLI A;  4CHU A;  1CF7 B;  1U3E M;  4B8X A;  2L54 A;  4UVC A;  1K6O A;  1DP7 P;  5AON A;  1ZG3 A;  2CW0 F;  1P4A A;  3T5X A;  5E18 F;  3GYH X;  3P9K A;  5ILV A;  3WTV C;  1EH8 A;  1TNS A;  3EET A;  2H6C A;  2H09 A;  4A0X A;  2Y75 A;  3E3V A;  3HTU A;  1X3U A;  4BNC A;  2PMH A;  2Q2E A;  2XAH A;  2F2E A;  3BPV A;  5BPD A;  2FMY A;  1U5T B;  5L3D A;  4LG0 A;  3P9I A;  3ROU A;  2WTE A;  3GF2 A;  3M8E A;  3PQJ A;  4BAY A;  3GX4 X;  2E7W A;  3WG9 A;  3GFL A;  1IN4 A;  5LLQ A;  5DV5 A;  2Q8K A;  5LBQ A;  1XGS A;  2V79 A;  4ASN A;  5HS8 A;  2RC4 A;  3J80 Z;  2UWM A;  2RVC A;  1BI3 A;  3GFI A;  3P9C A;  3W6J B;  1AWC A;  3GFJ A;  3ECO A;  2O6G E;  2EJR A;  3JSP A;  2F5C A;  1TNT A;  1R22 A;  3BZ6 A;  2E7X A;  4UVA A;  1FP2 A;  4OIN F;  1WQ2 A;  2QM3 A;  3FMQ A;  4ZZD A;  2OBP A;  4MNU A;  2HTS A;  4LLL A;  1LNW A;  1T38 A;  4EV0 A;  1RIO H;  3QP6 A;  4I0B A;  2ZKZ A;  2IPQ X;  2OAZ A;  1HKT A;  4UXN A;  1USS A;  3IC7 A;  2RKH A;  4LG0 B;  4KMU X;  3MZY A;  3W6K B;  3JTG A;  2ZNZ A;  2FBK A;  2RQP A;  4EJO A;  4HZF A;  1IN8 A;  3U1D A;  4FX4 A;  5ILU A;  2VN2 A;  4ZYG A;  1P6R A;  2FOK A;  2F5E A;  1K7A A;  5CYV A;  3B02 A;  4M9X A;  3RKY A;  1E2X A;  4RB2 C;  2VOD A;  3C3W A;  4P9U A;  1IN5 A;  2GAU A;  2ZFW A;  2Z33 A;  3R0A A;  5CJ9 A;  2L4A A;  4Q48 A;  3LAP A;  2HOE A;  3ABU A;  2VXZ A;  3AAF A;  5LRR A;  2MH9 A;  1UST A;  4Q5S F;  2X4H A;  3DF8 A;  3RKX A;  5JHU A;  1LDD A;  2O0Y A;  1LEB A;  4R1H A;  1BN5 A;  1RNL A;  4LLG F;  1FYM A;  2QYO A;  5L3C A;  4UV9 A;  5F1R A;  3S2W A;  1TTY A;  3TQN A;  2EFW A;  5ICC A;  4ESB A;  4UHT A;  4P5O A;  2EFP A;  2PJP A;  3LA7 A;  4OMY A;  1TW2 A;  3R60 A;  1S29 A;  2EFQ A;  3L9F A;  1SAX A;  1IF1 A;  1EH7 A;  4WF2 A;  4N0B A;  2ZJ2 A;  3CO7 C;  1KYW A;  2PBI A;  1UHM A;  2CYY A;  3E5X A;  3KEO A;  3ERE D;  1B9M A;  1WRJ A;  2OZ6 A;  5HLI A;  4KIG A;  2W24 A;  1U8R A;  3WTT C;  2DK8 A;  2H27 A;  4IHS A;  4HQM A;  1SMT A;  4Q4Z F;  1DPU A;  4HF2 A;  1MJ9 A;  2ISZ A;  3F6O A;  2M30 A;  2NYX A;  3IWF A;  4KN7 X;  3CUO A;  3L09 A;  1QBJ A;  3R4K A;  4BQA A;  3JTH A;  1R1V A;  3FXQ A;  2OQG A;  2GXG A;  1R23 A;  2KIM A;  2HZT A;  2H6B A;  2A5Y B;  4RAZ A;  1ZRD A;  5D5X B;  4BH9 A;  1IAW A;  4ENJ A;  2QZ8 A;  5J8C A;  2IJL A;  4M9S A;  2L02 A;  4WXD A;  2JSC A;  5TRD A;  3GVA A;  3R0J A;  4M71 A;  5E17 F;  5FLX K;  3ZQ7 A;  1IRF A;  4KT5 C;  1TQM A;  4OU0 A;  2XGX A;  5CVU A;  2PEX A;  5LHG A;  1YS7 A;  5F64 A;  2IA1 A;  1FY7 A;  2MLG A;  3WGH A;  1O3Q A;  2P6S A;  1PDN C;  1YW9 A;  5D4R A;  2X0L A;  4OIR F;  2RN7 A;  3GEZ A;  2IP2 A;  2FNA A;  2HYG D;  3L7W A;  2DBB A;  5CVI A;  2WC2 A;  3DEU A;  4KNY A;  2MBF A;  4L9V A;  2O03 A;  4YG2 F;  2FE3 A;  2W84 A;  2FBI A;  1FT9 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...