4IRGA

Uninhibited dna-binding domain of the ets transcription factor erg
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
98
structure length
98
Chain Sequence
IQRPGSGQIQLWQFLLELLSDSSNSSCITWEGTNGEFKMTDPDEVARRWGERKSKPNMNYDKLSRALRYYYDKNIMTKVHGKRYAYKFDFHGIAQALQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Transcriptional regulator ERG
publication title Structural and dynamic studies of the transcription factor ERG reveal DNA binding is allosterically autoinhibited.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Dna binding protein
total genus 33
structure length 98
sequence length 98
ec nomenclature
pdb deposition date 2013-01-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00178 Ets Ets-domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 4irgA00
2DPUA 1LDJA 4Q48A 4BH9A 2CQKA 2FOKA 3WGIA 3GFJA 3NRVA 1MJAA 2IA2A 5L3EA 3EYYA 1GXPA 4L5IA 1BJAA 5JR3A 3SFZA 4I01A 5JVTA 3KP7A 1B1BA 1P4WA 3N4MA 3JTHA 1FBQA 1P4AA 3IRQA 3GZ6A 3QU3A 3FMQA 1SD6A 2NNYA 3E3VA 3CTAA 4O6JA 4ESBA 2ZBKA 3KFWX 5CVRA 3LA2A 4HF2A 2XROA 4HF0A 2JRTA 1RUOA 3GO5A 1LJ9A 3F8MA 1U5TC 2YPRA 1YO5C 4MGRA 1LVAA 1OMIA 4ZZLA 1F5TA 3ZQ7A 4EGYA 4ESJA 3ECOA 3VOEA 2KJCA 1R5GA 3QRFF 1KU9A 5DUIA 4OOIA 5CVIA 1HSJA 1FP1D 2HFHA 5LRRA 2P7VB 5ICCA 1FYKA 2D45A 4LG0A 2ZO4A 4RB2C 1FOKA 5ICFA 1FBUA 3V7RA 3F3XA 4M9XA 1U5TA 2ZMEA 1L3LA 1YS7A 3CLOA 2OA4A 2IW5A 5BPDA 3I5UA 3V7SA 2GIVA 3J80K 3EDPA 3CUOA 5DUKA 3IKVA 2M8EA 3K0LA 2DAOA 3P9IA 2MLKA 4A2UA 4LK1F 1GHCA 3MCZA 2AXLA 5L3CA 6PAXA 4PGHA 4IPAA 3BPXA 1O3QA 2KIMA 4O3MA 3I59A 1B9NA 1SFEA 1XDSA 4YFXF 4HAMA 2B0LA 5JI6A 1CF7A 5DCMA 3E6DA 4IHTA 2V1XA 2FBIA 3ZMUA 1S7AA 3FF5A 5HS8A 5J6XA 2FRHA 3MWMA 2CGPA 1JHHA 1C0WA 2QUFA 3GUDA 3WGHA 2M1BA 1O7FA 3QOPA 1R7JA 4A5MA 2HDCA 1Z1DA 1DP7P 4R8HA 5D8KB 4ENJA 1S7OA 5BQTA 2BBYA 4LK0F 3RKXA 4GYIA 5BMZA 5D5UB 1SFXA 1USTA 4HF1A 5ICEA 3WTWC 1T2KA 1ZG3A 2VONA 1NHAA 1EH7A 4ASNA 1REPC 3E5XA 3PQKA 1ZG1A 1XGSA 3RKWA 1YG2A 2P5KA 4I0AA 2W84A 2ZFWA 2ZCWA 4Y17A 1D8JA 2Y48A 4HX4A 2QVOA 3N97A 4CXFA 1QZZA 2FNAA 1TQIA 2WC2A 3K69A 1WRJA 1XCVA 4L9VA 2X0LA 4EM1A 4LJZF 1I5ZA 5CJ9A 1SFUA 4MNUA 2L54A 1FX7A 1DUXC 2CYYA 2IA0A 4ESFA 1YTYA 2BV6A 4GYGA 3BP8A 4K2EA 4RB3C 3ELKA 4ZH4F 2O3FA 1IRFA 2PMUA 3WU0A 3HIFA 3RYPA 1PP8F 1A04A 1FSEA 4A6EA 3E6BA 4G6DA 1T6SA 3LAJA 4BHPA 3IWZA 3ML6A 5LEKA 2V1UA 1KU2A 3VB2A 1R58A 1J9IA 1R1VA 1YW9A 3TOAA 2HKXA 2D1HA 1TLHB 1ULYA 1BM9A 4MTEA 4WK8F 5H6QA 3TO9A 2CG4A 4QLCU 2LF8A 3HSRA 4EJVA 4GGGA 1HW5A 4BXUA 3IRRA 3T8RA 2MH2A 2A3SA 3WTYC 1I27A 2PG4A 3KP5A 4CICA 2F5CA 5BS6A 5D4SA 4L9TA 5FB2A 2O0YA 4XSXF 1D5VA 3RDIA 2F5FA 3RTRA 4HX7A 4A6DA 5CVJA 2KIFA 2XAQA 4ZYEA 2FE3A 4LMYA 4AWXB 3ERED 4CHUA 2K7LA 3HSEA 3DPTA 3PFIA 1S29A 3I71A 2P4WA 3QPHA 3HHHA 2VT3A 3WODF 3J80Z 4KICA 4ON0A 3IHUA 1Z6TA 2A61A 4BYYA 1EH6A 5FD5A 3QPTA 3CUQB 2VODA 2W25A 3K1NA 2WV0A 2QBYA 3IC7A 4EMSA 1YYVA 1IN6A 1IXCA 3O3KA 1HXDA 3VODA 4KN4X 3F8NA 3TKYA 1TNTA 3CDHA 3D0SA 3KLOA 3K2ZA 2PJPA 2CO5A 2RKHA 5DYMA 1TQMA 1JHFA 1MGTA 3R6SA 4OINF 3W6JB 1RUNA 3W6KB 2DI3A 4U0YA 2QM3A 4R1HA 3EYIA 3ZMDA 4L0YB 2TDXA 3J81K 4G8XA 4ZYHA 1IN5A 2Y75A 3HRUA 5E1ZB 2UWMA 1SMTA 1GVJA 2KIUA 2M45A 3DFGA 2CSOA 1J75A 4RGRA 3ZP5A 1TNSA 3RYRA 3LSTA 3KCCA 4UVBA 2IRFG 3OV8A 1FZPB 2H6CA 2MH9A 2GA1A 4U0WA 3IKTA 1Q1HA 2FA5A 3I0TA 5H20A 3M9AA 2F5EA 1KU7A 2P5VA 3SZTA 1O7LA 2ADUA 4OIOF 3HUGA 4Y13A 4L18B 3KZYA 4HW0A 2EFNA 2JTVA 1SD5A 3FMSA 1T39A 1WSUA 1QNTA 5LGTA 4EV0A 1R5HA 1D8KA 5DD8A 2LKPA 3GLXA 3Q9VA 5E18F 2QQBA 3BOQA 2EV0A 1YQAA 2DLLA 3P9KA 3FM5A 4A12A 2GWRA 2ELHA 2K4JA 3BROA 4I02A 2O03A 1MKMA 4U88A 2VC0A 3U2RA 1WKMA 3CJNA 3QU6A 1XSXA 4KIFA 2MBFA 4EM2A 1OYWA 3KZZA 2XRNA 4IJAA 2DO7A 5E20A 2OQGA 3P7NA 2PFBA 3I53A 1ODDA 1EV7A 5CLSA 2DQRA 4I2OA 5FO5A 1J7KA 1KQ8A 3WE3A 2VBXA 3MEXA 3JAMK 4DNCA 1ZH5A 5HDGA 2DW4A 3E5UA 4KYWA 5K5QA 4GCVA 2L4AA 3JSPA 1S8NA 5ERIA 4RGXA 5L3DA 5K5RA 5HVQC 3GFIA 3BPVA 3U9GA 1IN4A 4H0EA 4ENNA 1TBXA 3SZPA 1ZN2A 2HS5A 2GA2A 2HKOA 4PDKA 3ZN1A 4XBFA 3F23A 1MD0A 2QQ9A 2XKOA 2DK5A 3HSFA 5IT9K 2MD5A 3FX3A 2E7XA 2YSRA 5EEGA 1B6AA 1ZGJA 2BYVE 3CUQC 2P6TA 3V7CA 1O3SA 1J2XA 2P8TA 1DPUA 1IXSB 2FQ3A 3KE2A 2XUBA 3MZHA 3WE2A 2LNBA 3C7JA 2J5PA 2E7WA 2EB7A 4G9YA 1T38A 1P92A 3CO6C 3H3ZA 4M9ZA 3TOBA 3CUQA 1GXQA 2CW0F 2VBWA 5F64A 1G6NA 1U3EM 1VTNC 2FF4A 1XSDA 4MEXF 1FBSA 1TW3A 3G3ZA 5HS9A 1AOYA 2OZ6A 3FXUA 1G3TA 3V8JA 3KLNA 5LRSA 3B73A 4RGUA 1S6LA 1LNWA 4UXNA 4UVCA 4UHTA 1MJBA 2D2WA 3E6MA 3WTVC 1SMYF 1ZYRF 4GXOA 4MTDA 2PLYA 2IPQX 4S04A 1UB9A 2PEXA 1F4KA 2IA1A 2PN6A 5AIQA 3RI4A 4FT8A 3FHZA 2OU2A 2RDPA 1FYLA 4AIHA 1KYWA 3J7AO 2E1CA 1HKQA 1UHMA 4EQQA 4LD5A 4LFUA 1YLFA 2V1DA 1H9TA 1RI7A 5L3BA 3KP6A 1F9NA 3EUHA 1MDMA 1XN7A 1W4MA 4OMZA 2YU3A 4RS8A 4KIGA 2DBBA 3GXOA 3ZN0A 1OR7A 1ZHFA 1BIAA 3L9FA 1OPCA 3KEQA 3ZMSA 5HLHA 3ZMTA 4KFCA 4F7ZA 4U0VA 3F8BA 2DU9A 1K79A 3GF2A 2OBPA 2BEOA 1Z7UA 1W7PB 2O61A 1XMAA 3T8TA 3JTGA 3R0JA 2V6CA 2LDUA 1KQ0A 3REOA 3ISPA 4A0XA 4WXHA 5AIPA 5DEQA 4UUVA 2HZTA 2M30A 3DPLC 1E17A 4WWCA 4O5VA 3FXRA 1H9GA 4IRGA 3RKYA 1W7PD 3KP2A 3NEUA 4NHJA 3TO6A 1XD7A 2FBKA 1U6GA 3GEZA 1HSTA 4G7HF 2EWNA 2EA4A 2W57A 3GVAA 3I54A 1BI3A 3K1MA 2IP2A 4U7DA 2ESNA 3F21A 5E8GA 4EJOA 4M9SA 1SD7A 4WX9A 4P9FA 5E17F 2PQ8A 2XAGA 4MHGA 3H3UA 4BNCA 3MAJA 4HQEA 1J5YA 2Q2EA 4P5OA 2XASA 1IRGA 2VT2A 4RAYA 1SAXA 1DDNA 4ZYDA 2H94A 5LHIA 3WTUC 2A6EF 1KQ9A 2YR2A 2H09A 4FX0A 3ABTA 2XGXA 3F6OA 4FHTA 3Q9SA 3TGNA 4ZZDA 1E2XA 1Y0UA 2QZ8A 1HBXG 2COMA 3F8CA 3B02A 2A69F 5KK1A 2K02A 1IZ1A 2FXAA 4EJWA 1IN7A 5HDKA 1R23A 2XHKA 1B59A 1YS6A 4JK1X 1XGMA 3L00A 2RQPA 5LLQA 1WQ2A 3FZVA 5E1WA 3KP3A 3P9CA 3KP4A 3WG9A 2JT1A 1ZRDA 1MJ9A 1ZAOA 3MZYA 4I09A 3T0YA 2NRAC 2Z3YA 3V8KA 2Q8KA 3GFLA 2NS0A 4OMYA 1G3WA 4XSZF 4A0YA 2G9WA 3COAC 2MA3A 4PCQA 1G3YA 2K4BA 1R36A 4G7OF 3R0AA 5A2QK 1BI2A 4DQ2A 4M74A 2AS5F 1XGOA 2ZMEB 1BC8C 1YIOA 2VBYA 2L02A 1O57A 2ZKZA 4HYEA 2EFQA 2R7DA 2NNNA 4Z2YA 5D8LB 3E5QA 3HRMA 1BI1A 5ILVA 1RNLA 4BHCA 4L9NA 2RV8A 4EJTA 1LDDA 1CGPA 2VBZA 3DP7A 4IVNA 4WCGA 4Q5SF 4HLYA 2R7FA 3I59B 5LHGA 5D5VB 1TW2A 3RIRA 1XMKA 1K78B 4N9IA 5LHHA 1HKSA 3HRSA 4EGZA 4EM0B 3WU1B 1ZARA 1W7PA 2FBHA 3QAHA 1AWCA 1QGPA 3BY6A 1ZLKA 5HOOA 1SD4A 2FNPA 1QQIA 2K86A 1D3YA 1ZG5A 3GFMA 1ON2A 1ZRFA 4KT5C 3HOTA 4KMUX 2NAZA 3I58A 3DQVC 4CDGA 5CVVA 3JW4A 1K7AA 3ECHA 4OIRF 3SHFA 3WTSC 2MC3A 3K1PA 3DXJF 2F2EA 5FD6A 2VE9A 4P9UA 2KJBA 2RNJA 3M1EA 1IXRC 3LWFA 5D5XB 1UCRA 5ICGA 4ENKA 2HYGD 1FYMA 3ZMZA 3LA7A 3LFKA 4WF2A 1G4DA 4AD9A 2QQAA 3BZ6A 4B8XA 3BJOA 3VEPA 2L4MA 3ULQB 4UV9A 3DEUA 3C1DA 4RAZA 1FPQA 4RB1A 2Z33A 2CFXA 3F6VA 1R1UA 2EFWA 2H27A 4L0ZB 3FWEA 3TQNA 4OIQF 4D0PA 3LQQA 1LEAA 2O6GE 4NQWA 4N0BA 2YX7A 5LBQA 2UZKA 3WGGA 4NB5A 4B09A 1BOAA 2HR3A 5E1XA 4BHBA 3DKWA 1B9MA 1FWZA 4E70A 5J8FA 3M8EA 4CO8A 4OU0A 3GWZA 1HKTA 5BPIA 1BI0A 4QWQA 1BIBA 2XIGA 4IF4A 1HW1A 3HTSB 3QP6A 4YIFA 1FNNA 2JZYA 2XAHA 3NQOA 5D6FA 5TRDA 1OKRA 1ZGAA 3MQ0A 4GO1A 1LDKB 2L3DA 3U1DA 4ENMA 2P7CB 3AAFA 2XKPA 2VOOA 4IHSA 1U8RA 1Z05A 3O2PE 1QZYA 1ZREA 4BQAA 3JSOA 2XAJA 5LGUA 1FC3A 2EJRA 3K9TA 5FGMA 4HZFA 3EQLF 3GX4X 1MZBA 2OZUA 4HX8A 1XCBA 2LF7A 1X3UA 3M7GA 4U7BA 5CYVA 5LGNA 2PI0A 1XB4A 3G73A 3C3WA 2YX4A 5K5OA 1KYZA 4XRFA 4CGZA 4PGGA 2HQRA 2LSOA 4M6XA 1R22A 5A2QZ 2VC1A 1S3JA 4I7HA 4M71A 3GW2A 3WTXC 2RVCA 2Z99A 1JE8A 1EH8A 4A0ZA 1QPMA 3J81Z 1T98A 1KU3A 1DPRA 1HW2A 4XLNF 5J8CA 4N9HA 3IWFA 3TDUC 2DTRA 1R1TA 2WWYA 2QBYB 2H6BA 2VXZA 2ISZA 1JXSA 3L7WA 1W5SA 5F1RA 2HOEA 4Q47A 1IN8A 1R00A 1F1ZA 3CO7C 3VFZA 4JQFA 1J0RA 5KVRA 3I64A 2A07F 2RC4A 2ISYA 5D6EA 2KRFA 2F5DA 1K78A 1WWXA 2EV6A 4I0BA 4LB5A 5JHUA 4HLXA 3I4PA 1I1GA 1FT9A 4S05A 1OYIA 4G94A 4AIJA 2EA2A 2GAUA 4TV7A 2STWA 2PMHA 3OOPA 1FLIA 2UXXA 2FU4A 3RJPA 1BBYA 1BN5A 3LAPA 2C6YA 5LEJA 1FY7A 2ESHA 3BJAA 5D4RA 2ETHA 2D1VA 1P4XA 2VE8A 5HLIA 2EFOA 1ZRCA 5FLXK 5AONA 3JAMZ 1BC7C 5JFRA 3C18A 2Y0MA 2ZXJA 1FSHA 3HTUA 3R61A 2JPBA 1PP7U 3LQRA 2DQLA 3TDZC 4L5JA 2NYXA 4ETSA 1IAWA 4P96A 3R60A 4KMFA 2PBIA 5L3GA 4HV5A 3E6CC 3HOSA 1T0FA 3PQJA 5ILSA 5FFXA 5H6RA 1O3TA 3O6BB 3BJ6A 1K6OA 4Y15A 5BOXA 2JPCA 2OQRA 3DV8A 5IT9Z 2ZNYA 2DFIA 3WTZA 2EV5A 2MLGA 1Z9CA 1QO0D 1XGNA 1JGSA 1KA8A 2GZWA 4HV6A 3E97A 2VN2A 2FEZA 1PUEE 4EVIA 4AIKA 3DF8A 4BAYA 1USSA 3BDDA 4FX4A 1I1SA 2ZNZA 2G7UA 4MQ9F 3GYHX 4LLNA 1UHWA 4MEYF 1FP2A 4G6QA 4LLGF 2XAFA 1RZ4A 2OAZA 1TQPA 3L09A 3F72A 4MQVA 3ROUA 2BE5F 2FMYA 2EK5A 2W24A 1J59A 4HBLA 4ZYGA 3V8LA 1YW8A 1H0MA 4IXAA 4IRIA 1TTYA 4XLPF 1XDUA 2P6SA 3SXYA 2GQQA 3ZMVA 4KA4A 2V9VA 3TO7A 3FMRA 2Z5UA 5FFZA 5K1YA 3V4GA 2QLZA 3H92A 2E1NA 4M73A 2QYOA 2HWVA 2ZJ2A 2VOPA 1UFMA 4KDPA 3FXQA 4PZJA 2P5LC 5ED4A 4I98B 4RGSA 5D5WB 1V3FA 3EETA 2Z9OA 3T1BA 1IW7F 1PDNC 1P6RA 1G3SA 5DCFA 4G7ZF 1LB2A 3IL2A 1B4AA 2A6HF 3ABUA 2K27A 4KN7X 4OIPF 3KEOA 3RPQA 4LG0B 4YFNF 4HDUA 5DD4A 5HLGA 2GXGA 2X4HA 4EJUA 4P55A 5HDNA 2UXNA 1U5TB 2A68F 2DPDA 4UNOA 5TJJA 1U2WA 2DK8A 5DV5A 2A5YB 4LGWA 3HRTA 3RPUA 2WTEA 3F8FA 4HDVA 2IJLA 1OYYA 3L2CA 1YFHA 2STTA 3F22A 2BGCA 5ILUA 1YW7A 4CZZA 1Z91A 1U78A 2FMLA 2JSCA 5F6FA 1IUYA 3BWGA 1IF1A 4HOBA 4M6YA 3Q5FA 5E8IA 4KUMA 4LB6B 4HQMA 2HEOA 1W5TA 2QWWA 1CF7B 5DCMB 2DT5A 2L01A 3S2WA 3HHGA 5IT3A 3FM3A 3KETA 2RN7A 1L0OC 4AVPA 5DDGA 2J5OA 3R4KA 3MFKA 4JBAA 4WXDA 2IT0A 5L3FA 2XVCA 2W85A 1MDMB 5FLXZ 3GZ5A 1LEBA 2GXBA 1ONVA 2R3SA 4M72A 4KIBA 1O3RA 2KKOA 4RB0A 3LA3A 1ZLJA 4Q4ZF 4KNYA 2XV4S 1V4RA 2RGVA 2Q0OA 2M87A 1P2FA 1WI9A 1ON1A 3SQNA 2G7HA 3HYIA 2FSWA 4UVAA 1I6XA 2OD5A 3QP5A 2IVMA 2O8XA 4A5NA 4YFKF 3T5XA 1XSVA 2HQNA 2HTJA 3D5LA 1KGSA 5CVUA 3ZPLA 2ACJA 2V79A 1STZA 4WXCA 3M8FA 2HYFA 4LLLA 4YIIA 4YG2F 1HQCA 2EFPA 2HTSA 5EEHA 1LQ1A 3WTTC 4L9JA 2CWEA 1RIOH 4HA8A 4IRHA 2M5WA 4R79A 2HGCA 5HS7A 4CYDA 4UV8A 2QENA 1QBJA 1Z6RA
chains in the Genus database with same CATH superfamily
5GAGJ 2DPUA 1LDJA 1FJLA 4Q48A 4DJAA 3H9JA 4BH9A 5JHFA 2CQKA 5HNFA 2FOKA 3WGIA 3GFJA 3NRVA 1SVMA 1K4SA 3ZOBA 1MJAA 2IA2A 2LC2A 2L7FP 3DPUA 5L3EA 3EYYA 4HNUA 3G6EI 1GXPA 2DT6A 4L5IA 1BJAA 5JR3A 3SFZA 4I01A 4PJJA 3KP7A 5JVTA 5C3EJ 4RLQA 2DFEA 1B1BA 1HCRA 1P4WA 2BHYA 3N4MA 3JTHA 1D1CA 2L2OA 4FE4A 5CQGA 1FBQA 1P4AA 1NK2P 2JVGA 3IRQA 3GZ6A 4A3LJ 2HOAA 3QU3A 2IAIA 1W0UA 3FMQA 1GV2A 1SD6A 5J4YA 2NNYA 3E3VA 3CTAA 4O6JA 1A5JA 4ESBA 1LFUP 4DZJA 2ZBKA 2R7TA 3KFWX 5CVRA 2BY3A 3LA2A 1R4NB 4HF2A 2XROA 4HF0A 5M5YJ 3MVPA 1WZ2A 4E7HA 4CCLA 2JRTA 1KZHA 1RUOA 3GO5A 1Y8RB 1LJ9A 2M0MA 1OISA 1SANA 3F8MA 1U5TC 2YPRA 1YO5C 1W36C 3A2KA 4MGRA 2XPVA 1LVAA 1OMIA 1MW7A 4ZZLA 2K85A 1F5TA 3FK7A 2DYSH 1F43A 3ZQ7A 2OTJI 4YELA 1A6QA 4EGYA 4ESJA 3ECOA 4XLHA 3VOEA 2W48A 3DEWA 3K6GA 2KJCA 1R5GA 3QRFF 1KU9A 5DUIA 4OOIA 5CVIA 1X1AA 1HSJA 4FCYA 1FP1D 2HFHA 1W5CC 4ZDOA 5LRRA 2IGOA 2P7VB 5ICCA 1FYKA 2D45A 1JUMA 2ZJPF 4LG0A 2E2JJ 2ZO4A 2W82A 4RB2C 3FKIJ 2VJJA 1FOKA 3WU2C 2F6CA 5ICFA 5FLMJ 1FBUA 4BS9A 5GP9A 1QVTA 3V7RA 3F3XA 4IQJA 4M9XA 1U5TA 2ZMEA 2EIKH 1L3LA 1YS7A 3CLOA 2OA4A 2OCCH 3K4KA 5LFAA 2IW5A 5BPDA 1R6RA 2QF7A 3CF2A 3I5UA 3CP8A 2HVRA 3V7SA 2GIVA 1WPKA 3L1PA 3J80K 1MMDA 3EDPA 1VQ8I 3CUOA 3IH2A 4PJNA 2QA4I 2CUJA 3IKVA 5DUKA 2O5RA 2M8EA 3K10A 3AG4H 5EEAA 3K0LA 2DAOA 3P9IA 2MLKA 4A2UA 3PNVA 4LK1F 4CCOA 1GHCA 2ELJA 1TWGJ 3MCZA 2AXLA 4HSTA 5L3CA 2ZFUA 3VSLA 2Y2ZA 2VIXA 6PAXA 4BQQA 3K2AA 3CC7I 4NC7A 4PGHA 4A3BJ 3PSFA 2JN6A 2XGEA 3HJEA 4IPAA 3SYTA 3BPXA 2MGQA 1OFCX 1O3QA 2KIMA 4O3MA 3I59A 1WI3A 3PM1A 1B9NA 1SFEA 4XK4A 4B48A 3I4MJ 1XDSA 5K7ZA 1FMWA 1T95A 1Z21A 4YFXF 4HAMA 2B0LA 4J01A 2M7AA 4XORA 5JI6A 1CF7A 5DCMA 3E6DA 4GFBA 2XF6A 4IHTA 2V1XA 2L9SA 2FBIA 2FQ4A 3ZMUA 1S7AA 1X1DA 3FF5A 4Z6YA 5HS8A 5J6XA 2FRHA 2MD0A 3X2QH 3JR9A 3OYEA 2WAQA 3MWMA 2UUZA 4BL0B 2XC7A 4KITB 4XOTA 2ICWG 4PFOA 1V5FA 2CGPA 5LD2C 1JHHA 2LKXA 1C0WA 3GTQJ 2Y31A 2QUFA 2Y9YA 3GUDA 3HKZA 5EYRA 3WGHA 1WH7A 4HG2A 3S1QJ 4IKFA 1YJWI 2M1BA 1O7FA 2CFOA 3QOPA 1R7JA 4A5MA 3W6VA 2HDCA 2JK3A 1Z1DA 3WHCA 1DP7P 5HLTA 4R8HA 5D8KB 5B3SH 4ENJA 4P1WA 1S7OA 2DMNA 2R7RA 3B6AA 5BQTA 2VLAA 3L2VA 2BBYA 4LK0F 5DTDA 5F0FA 3TP3A 2K3PA 1HDPA 4GYIA 3RKXA 4BQOA 5BMZA 5D5UB 2HDDA 2OCEA 1SFXA 1K83J 1USTA 4HF1A 5ICEA 2E5ZA 2E36A 3WTWC 2O7OA 1ETKA 1VQNI 4CH7A 1T2KA 1ZG3A 2VONA 1NHAA 1XTAA 4HEA2 5EGOB 3HUGB 1X1CA 2KRHA 1EH7A 4ASNA 2CJJA 2WBMA 4F92B 1REPC 3H3VK 3E5XA 2K9SA 3PQKA 4QSHA 3S1RJ 1XGSA 1ZG1A 3RKWA 3ZQLA 1YG2A 2P5KA 4FQGA 4I0AA 2W84A 2VJ4A 5M3MJ 2ZFWA 2LY1A 2ZCWA 3DTEA 2R7UA 4D7MA 4Y17A 3IP4B 2K9QA 2Y48A 4HX4A 2QVOA 3N97A 1IV8A 4CXFA 1D8JA 2AHQA 1QZZA 2FNAA 1TQIA 1VI0A 2WC2A 1Y8QB 3SJMA 1BW6A 3K69A 1DQUA 5F08A 1WRJA 1XCVA 1RKTA 2KT0A 3RQ4A 4L9VA 1F36A 2X0LA 4EM1A 4E7KA 5CKTA 2EPFA 4LJZF 4YEJA 3AG1H 1I5ZA 2HVQA 5CJ9A 1E3PA 2HPIA 1SFUA 3RCOA 3M3YJ 1IUFA 4MNUA 2L54A 1FX7A 4BXFA 3SEZA 3K4MA 5DM6F 2M3AA 1DUXC 2CYYA 2IA0A 3ESWB 5IOYA 3S3MA 4ESFA 2HI3A 1YTYA 2BV6A 3DCFA 4ZC3A 2X51A 2DMQA 4GYGA 3TL4X 2ZB9A 3BP8A 5EG0B 4K2EA 4RB3C 3ELKA 4ZH4F 5K7HA 2ZJRF 3JRDA 2O3FA 1IRFA 3MKZA 2PMUA 4JOMA 1VQKI 3WU0A 3VDXA 3HIFA 3RYPA 1PP8F 3CC4I 1A04A 3HOZJ 1FSEA 3J7AY 4A6EA 3AG2H 3E6BA 4G6DA 3QODA 2M4KA 3JRHA 1T6SA 3OL4A 3LAJA 4NQWB 2LBFB 5GPCA 1IRXA 4B1RA 4BHPA 1MMAA 1OCZH 2E1OA 3IWZA 4Y3OA 3W3CA 4MIMA 2VJIA 3ML6A 3PJRA 5LEKA 2V1UA 1MMNA 3V42A 1KU2A 1SVOA 5FKNA 1X58A 3VB2A 1R58A 1YIJI 1J9IA 1R1VA 3BC8A 1YW9A 3TOAA 2HKXA 2E5NA 2D1HA 1TLHB 1ULYA 4B47A 1BM9A 1EKEA 2A6TA 1IRZA 4MTEA 4WK8F 3M8JA 5H6QA 3TO9A 2CG4A 2VKEA 4QLCU 3M4OJ 4XQFA 4X1EA 3ZQGA 4HRIA 2LF8A 3HSRA 1VZ0A 3TW7A 2O8KA 2CH0A 4EJVA 2LK2A 4GGGA 1HW5A 4BXUA 2VJ5A 2XSDC 3IRRA 3T8RA 4DYRA 2MH2A 2A3SA 3HXLA 3WTYC 1I27A 2PG4A 3BG9A 2CU7A 3KP5A 4CICA 1Z67A 4B3XA 2F5CA 5BS6A 5D4SA 4L9TA 5FB2A 2O0YA 2VKDA 4XSXF 1D5VA 3RDIA 2F5FA 3CMMA 3RTRA 1VQ5I 4HX7A 4A6DA 3G1OA 3IH3A 3VYSB 5CVJA 2KIFA 3PNYA 2VB6A 3PL8A 2XAQA 4ZYEA 2KDZA 2LH9A 4E7LA 2FE3A 3VYRB 4LMYA 4AWXB 5M3FJ 3QYBA 3ERED 4CHUA 2K7LA 1UG2A 3HSEA 3DPTA 4MFDA 3PFIA 1S29A 3I71A 2P4WA 1TC3C 3QPHA 5FKMA 3HHHA 2VT3A 3WODF 2FD5A 4JP0A 3J80Z 4KICA 5HNHA 4ON0A 3IHUA 1Z6TA 2A61A 2D5VA 4BYYA 1XPXA 2NOGA 2DFFA 1EH6A 5FD5A 2NVUB 3L2RA 4FISA 2KIQA 1ZQ3P 3GLLA 3QPTA 1Y1VJ 3CUQB 3JCUC 2VODA 3G1LA 4OAZA 1LKXA 2W25A 4XLEA 3K1NA 3DEEA 2WV0A 2QBYA 2X6YA 1MNEA 5IP9J 3IC7A 3JRAA 4EMSA 1YYVA 2L0KA 1IN6A 2JRMA 1HA8A 1RPWA 1IXCA 3O3KA 1ETWA 3GTPJ 1OLTA 3DKYA 1HXDA 1ETVA 2GBYA 3VODA 4GDFA 4KN4X 2K5CA 3F8NA 3TKYA 3PIPF 5IPAA 2KP6A 1TNTA 3BR2A 1QVUA 3CDHA 3D0SA 3KLOA 5HODA 2X1CA 3K2ZA 2PJPA 2CO5A 2RKHA 1MBKA 5DYMA 1TQMA 3S93A 1JHFA 4OAYA 4XL9A 3PUFA 2GM4A 1MGTA 1HOMA 4PJMA 3R6SA 4OINF 2DOFA 2L9VA 2P81A 3W6JB 3FBIB 3MKLA 2R4GA 1RUNA 2UV1A 3W6KB 2DI3A 4U0YA 2L7KA 2QM3A 4R1HA 3EYIA 3ZMDA 2ZC2A 4L0YB 2TDXA 3J81K 4XLFA 4G8XA 5TISC 1YI2I 4ZYHA 3N05A 1IN5A 1R5ID 4X0GA 2Y75A 3HRUA 5E1ZB 2UWMA 4XKWA 3SFIA 1SMTA 1GVJA 2KIUA 2M45A 3DFGA 2CSOA 1J75A 3GTGJ 4RGRA 3ZP5A 1TNSA 1R71A 1MBEA 3RYRA 3LSTA 1Q1VA 2DA1A 2HZDA 3LSHA 2R7SA 3LSGA 2DOEA 3KCCA 2NS7A 4BJTA 4UVBA 2EINH 2IRFG 3OV8A 2ZSHB 1FZPB 2H6CA 2EZIA 1WJDA 2MH9A 1RETA 3S32A 2GA1A 4U0WA 1GUUA 2WADA 2WA0A 3IKTA 3Q0WA 1Q1HA 2FA5A 3I0TA 1QPIA 2RNGA 5H20A 3M9AA 4C3HJ 2F5EA 1KU7A 2E1MB 1OCTC 2X1EA 4V19K 2JUCA 2A5WA 2P5VA 5J1RA 2QSHX 1JTXA 3SZTA 2DA3A 1O7LA 2ADUA 4OIOF 3HUGA 2EIJH 2KMUA 4Y13A 1JUPA 4L18B 1MNMC 3KZYA 4HW0A 2EFNA 1LUJB 2JTVA 1NTCA 1SD5A 2QCOA 2DDBA 3H5RA 3ZGKA 3FMSA 3MKWB 1T39A 1WSUA 3F0CA 1QNTA 5LGTA 4EV0A 1R5HA 3HB9A 1D8KA 1ETYA 5DD8A 2LKPA 3GLXA 2B63J 3S3OA 3Q9VA 5E18F 2QQBA 3BOQA 2EV0A 1SC7A 1AKHB 2AXTC 3ONQA 2COBA 1YQAA 3G1MA 1PVEA 4N4NB 1B8IB 2DLLA 1HF0A 3P9KA 3FM5A 3JRGA 3CF5F 1YRNB 4A12A 2M2EA 2GWRA 4CCNA 3S1MJ 1X19A 2ELHA 2K4JA 3BROA 4I02A 4LOCA 2O03A 3ZCOA 4BY7J 2VXDA 2WB1A 1MKMA 4U88A 2VC0A 1R49A 3U2RA 1WKMA 3D5RC 3A0HC 4CYCB 3CJNA 3QU6A 1XSXA 4FASD 4KIFA 2MBFA 4EM2A 1SVLA 2N8GA 3H0DA 1OYWA 3HOXJ 1G8XA 3D5SC 3KZZA 2XRNA 2MC4A 4IJAA 2KFDA 2DO7A 5E20A 2OQGA 3P7NA 1TWCJ 1U9NA 2PFBA 5EG0A 4C2UA 3I53A 4BE1A 1ODDA 4BUPA 2HPMA 1EV7A 2DA4A 4B3AA 5CLSA 4A3IJ 1VQOI 2DQRA 4A3FJ 4I2OA 2EZLA 1J7KA 5FO5A 4RM3A 1KQ8A 3WE3A 3BR6A 4PFPA 4RBOA 2VBXA 2VQGA 3MEXA 4W97A 2V6EA 3JAMK 2IS6A 4DNCA 1X2NA 5HDGA 2DW4A 1ZH5A 1JT6A 3CCYA 3E5UA 3FK6A 3DLAA 2BHZA 3UR3C 4KYWA 2TCTA 2LBFA 5K5QA 1ZKGA 4GCVA 2L4AA 2AQEA 1S8NA 1AA7A 3JSPA 5ERIA 1JKOC 4RGXA 5L3DA 4AYBN 5K5RA 5HVQC 4RDUA 3GFIA 1S9HA 3BPVA 2EQRA 3U9GA 1IN4A 3DBHB 4J19A 3OYGA 4BDYA 4H0EA 2A05A 4ENNA 1TBXA 2LREA 3CESA 3SZPA 1ZN2A 3DTKA 2HS5A 2GA2A 2HKOA 4PDKA 3ZN1A 3VYUB 1NG7A 2CMPA 4XBFA 4XIDA 2DT7B 4CCKA 2ZSIB 3F23A 1IGNA 1MD0A 1XG1A 1H8AC 2QQ9A 1DU6A 2XKOA 5IYBJ 2RAEA 3SDGA 2DK5A 3HSFA 2DN0A 4M3BA 5IT9K 2MD5A 3FX3A 1IDZA 2E2HJ 1LPQA 2E7XA 2YSRA 2QGUA 2YUSA 5EEGA 1SAUA 2JA8J 3KPHA 1B6AA 4F55A 4PUSA 1ZGJA 5F0HA 2BYVE 3CUQC 5FRNA 2P6TA 3V7CA 4B4CA 3BZCA 1MBJA 1O3SA 2XGDA 1J2XA 1YOVB 2P8TA 2Q2EB 1DPUA 5B5EC 1IXSB 2PMZA 2GOXB 2FQ3A 1W1WE 1ZTRA 2HOSA 3KE2A 2XUBA 2I8DA 3MZHA 3WE2A 2JA2A 2LNBA 4IL6C 2BVMA 3C7JA 2J5PA 2E7WA 2EB7A 2FOWA 2M9HA 4G9YA 1T38A 1P92A 4XLAA 2E19A 3BTLA 3CO6C 3QQAA 3H3ZA 4XRMA 5EZHA 4M9ZA 2QSFX 3TOBA 4FTHA 2VL8A 3CUQA 1GXQA 4LIUA 1RC9A 2CW0F 1JGGA 2VBWA 5F64A 3QPLA 2CV0A 4Y33A 1G6NA 1U3EM 1VTNC 2FF4A 1XSDA 3RSNA 4MEXF 4DYQA 1H89C 3C2GA 4V2GA 4BJ6C 1FBSA 1TW3A 3G3ZA 5HS9A 1AOYA 1K6YA 2BY2A 3IV5A 2OZ6A 3FXUA 1G3TA 3V8JA 2ZXHA 1A35A 4GRIA 3KLNA 1BR2A 2R7OA 2R5ZB 4I76A 5LRSA 3B73A 4RGUA 4BU2A 1S6LA 3GBGA 2VQLA 1LNWA 4UXNA 4UVCA 4EATA 4NC8A 1U0JA 4UHTA 5JLWA 1MJBA 2NXNB 3I55I 3QYEA 2D2WA 3FDYA 4ITVA 3E6MA 3WTVC 4QTRA 1SMYF 1UELB 2LY2A 4M3FA 4N4OB 4L5EA 4XMYA 1ZYRF 2DMPA 2E1MC 4GXOA 2V26A 5KAIC 1JTYA 2IGNA 3TW6A 4MTDA 2NVYJ 3PSIA 2X85A 2PLYA 3EUHC 1WGXA 2KQRA 1VQ6I 3W2VA 2IPQX 4S04A 1UB9A 4KT6A 1UAAA 5BNGA 3LSMA 2PEXA 2XAUA 2EIMH 1F4KA 2M7BA 2IA1A 2PN6A 5AIQA 1OR7C 3HL2A 3RI4A 4FT8A 3FHZA 2OU2A 2RDPA 3OL3A 1FYLA 4AIHA 1HDDC 3DLLF 3TBIA 1V55H 1KYWA 2KZVA 2X1DA 3AFHA 4XRSG 3J7AO 1VQ4I 2OUMA 9ANTA 2E1CA 1HKQA 3FXMA 1G2HA 1QRYA 2Q1ZB 1UHMA 3DU6A 4LD5A 4EQQA 3GTMJ 4LFUA 3HPGA 1MSEC 3TP0A 1YLFA 2PJRB 2V1DA 1X2MA 1H9TA 1RI7A 5L3BA 1AHDP 2WAFA 2NVXJ 3KP6A 1F9NA 1W0TA 1LFPA 3EUHA 5IYDJ 1MBFA 4S0HB 3CCEI 2M34A 1XN7A 1MDMA 1W4MA 4RA2A 2CQ7A 1YE9A 4OMZA 2YU3A 2V1NA 2YS9A 2KLOA 4KIGA 4RS8A 2DBBA 3GXOA 3ZN0A 4LIVA 1OR7A 1ZHFA 3VSKA 3RKQA 1BIAA 3L9FA 1WJ5A 1IG7A 3A01B 2KHMA 1E3OC 2XDVA 1OPCA 3BR1A 1VQLI 3KEQA 3LSJA 3ZMSA 5HLHA 2OTLI 2IXSA 4BBRJ 1P7IA 1FIAA 2V4JC 1X4PA 4IEJA 3ZMTA 1PUFB 1PJRA 4KFCA 4BEHB 4ZDPA 2HU9A 4F7ZA 3OS2A 2WAQN 1B8IA 4U0VA 3F8BA 2DU9A 4BE2A 1K79A 1VQ9I 3GF2A 3CC2I 2OBPA 3HKZN 2HOTA 2BEOA 1Z7UA 1W7PB 4Y4RA 2O61A 4U87A 1XMAA 3T8TA 5J1UA 4CYCA 5IOZA 3JTGA 4NUBA 2CW7A 3R0JA 3CCSI 2V6CA 3FISA 2EZKA 3H5AA 2LDUA 3B6CA 1KQ0A 3REOA 3E0JB 2LD5A 3L2QA 3ISPA 2JMWA 2M0CA 1ERDA 4C3IJ 1HLVA 3DKXA 3U21A 1T0FC 4A0XA 1WJFA 4WXHA 3QOEA 4LG3A 5AIPA 5DEQA 4UUVA 1FOWA 4A3GJ 1POGA 2HZTA 2M30A 3DPLC 1E17A 4WWCA 3H1CA 4F52A 4O5VA 3FXRA 4ZDLA 4F93B 3NARA 5M5WJ 1H9GA 4IRGA 3RKYA 2XB0X 4XKBA 1SFKA 1W7PD 2B9SA 3KP2A 3HEFA 3NEUA 4NHJA 3TO6A 1XD7A 2BW3B 2FBKA 1U6GA 2IGMA 3GEZA 1HSTA 4E7ZA 4G7HF 5KCMA 2R0QC 1UG0A 2EWNA 1E3HA 4C9YA 4BACA 1K61A 5FLVA 2JJ7A 2EA4A 1X3ZB 2HXIA 2W57A 2BOLA 1A31A 1TP4A 3GVAA 1DGWY 3C2BA 3I54A 4UB8C 3OSFA 4C3JJ 1BI3A 2F48A 4UUSB 4E7SA 2NS8A 3K1MA 4ABZA 4V2FA 2IP2A 4B43A 4U7DA 2ESNA 3F21A 5E8GA 2HQ5A 3S1NJ 4ZYAA 4EJOA 2WY8Q 4M9SA 5B1AH 4PJ0C 1Y6IA 1SD7A 2F4MB 4WX9A 3E7LA 1IJWC 4P9FA 5E17F 1RRJA 2PQ8A 1GLNA 5GPAA 1OCPA 1QU3A 2HYJA 2PX9A 5KNLA 2XAGA 4MHGA 4DW6A 1JUSA 3H3UA 5KAFC 2MFZA 3S3NA 4BNCA 3OIPA 3MAJA 4HQEA 1J5YA 3VPRA 2Q2EA 2B7EA 4P5OA 2XASA 4JX6A 1IRGA 2VT2A 4RAYA 1SAXA 3NAUA 4XOPA 1DDNA 1VQPI 4ZYDA 2H94A 3D1NI 3S2DJ 5LHIA 3WTUC 2A6EF 4XNFA 1KQ9A 2Y0SA 2YR2A 3VWBA 1ETOA 2H09A 4FX0A 2L7ZA 3ABTA 2XGXA 3F6OA 1LE8B 4FHTA 1D1BA 5IP6A 3BR0A 3Q9SA 3TGNA 5FJ8J 1BW5A 4ZZDA 1E2XA 3H9QA 3HM5A 3DTIA 2JUGA 1Y0UA 3PUBA 4XR6A 2QZ8A 1HBXG 2COMA 2LOOA 3F8CA 1BR4A 1TWFJ 2R5YB 1ORKA 3B02A 2QEXI 2A69F 2DA5A 2H1LA 5KK1A 3K4CA 2K02A 1IZ1A 2X6OA 2JA7J 2FXAA 1PYVA 4FE7A 1IN7A 4PK4A 4EJWA 5B66C 2DODA 5HDKA 2L7MP 2JQ7A 1R23A 2XHKA 1B59A 1YS6A 2K9LA 4JK1X 2XB5A 1XGMA 3L00A 2RQPA 5LLQA 1WQ2A 3K4BA 2VI6A 2M8GX 5J1YA 2H8RA 3FZVA 5E1WA 3KP3A 3P9CA 2X9DA 3KP4A 1UZCA 4C2TA 2VKHA 2JT1A 3WG9A 1ZRDA 1UMQA 2WAEA 3G71I 1MJ9A 1ZAOA 3GTOJ 3MZYA 4I09A 3T0YA 3WG7H 4DGWB 2NRAC 2Z3YA 3QWLA 3V8KA 2Q8KA 1XMXA 4CUGA 4Y52J 3GFLA 5K7FA 3OYMA 1X1PA 2NS0A 1ITYA 4OMYA 5FRMA 1G3WA 4XSZF 4A0YA 3UKGA 1WFXA 2ZXIA 3MKYB 4OWRB 2GOMA 2G9WA 3COAC 2MA3A 4PCQA 1G3YA 2K3FA 2K4BA 1R36A 4XKCA 3P5JA 4G7OF 3R0AA 1EJ9A 3BR5A 3OYCA 2ID3A 1JKQC 4XM3A 5A2QK 3K4JA 1BI2A 4DQ2A 1U9OA 4M74A 2AS5F 5F27A 1TT5B 1XGOA 2ZMEB 1BC8C 2ZXWH 3I3LA 1KONA 1YIOA 2VBYA 2L02A 1O57A 3QPSA 2XF7A 2ZKZA 4HYEA 3OYHA 5EDNA 4IHXA 4LITA 2EFQA 2R7DA 3OIQA 2NNNA 2PJRA 4Z2YA 5D8LB 3E5QA 3HRMA 5CQEA 5J47A 4IHYA 1YJ9I 1BI1A 5ILVA 1RNLA 3DBLB 2L9NA 4BHCA 1MBHA 4L9NA 2RV8A 2X6XA 4EJTA 1LDDA 3CZ6A 3CJRB 3F9KA 1CGPA 2VBZA 3DP7A 4IVNA 4DIQA 3MN2A 1HC8A 4WCGA 3LSRA 3OWTA 4Q5SF 3A01A 1OCOH 4BY1J 3M1CA 1JKPC 2W1OA 3OS0A 2GXAA 5F0CA 4HLYA 2R7FA 2JA6J 3I59B 3FXJA 3LMMA 5LHGA 4XICA 5D5VB 3JREA 4F3QA 1PUFA 3A0BC 4X6AJ 2IEKA 1QZEA 1TW2A 1JJ8C 3CCRI 3RIRA 1XMKA 2DJNA 1K78B 1XC5A 4N9IA 2CUFA 4DOZA 5LHHA 2W7NA 1HKSA 3HRSA 4EGZA 5EGOA 4EM0B 3WU1B 1ZARA 1W7PA 2FBHA 3QAHA 1AWCA 1D0ZA 4G6TB 3BLYA 1QGPA 3IH4A 2E35A 1NH3A 3BY6A 1ZLKA 5HOOA 4IZZA 2R7XA 1SD4A 4D1QA 2FNPA 4NNJA 1QQIA 3KYCB 2K86A 1D3YA 1ZG5A 3GFMA 1ON2A 1ZRFA 4KT5C 3HOTA 3AKZA 4KMUX 2NAZA 3BCAA 3BR3A 3I58A 3UNGC 3DQVC 4CDGA 1IC8A 2R93J 3CMEI 5CVVA 3JW4A 3OMYA 4YIRX 3GTKJ 2NVTJ 1K7AA 2EZHA 3HPHA 3DBRB 3KZIC 3ECHA 4OIRF 3SHFA 2FUG2 3WTSC 3HGYA 2MC3A 1TL8A 3K1PA 3DU5A 4E4HA 4G12A 3DXJF 3OY9A 2F2EA 5FD6A 4AC0A 2VE9A 4XONA 4P9UA 2KJBA 4BDZA 2RNJA 3M1EA 1IXRC 1MMSA 3LWFA 5D5XB 1UCRA 5ICGA 2E60A 3ZQHA 4ENKA 2HYGD 3KX2A 3I9V2 2MG4A 5E3MA 3J7ZI 1FYMA 4RAFA 3ZMZA 2BW3A 3LA7A 3LFKA 4WF2A 1JI8A 4IX7A 1G4DA 4AD9A 2QQAA 3BZ6A 4B8XA 3J7YJ 5CPRB 3BJOA 3VEPA 2BZTA 2EBIA 2L4MA 3OYNA 2GIZA 2KZGA 2L9RA 3BQYA 1WCMJ 3K7AJ 3ULQB 4UV9A 1ZELA 1JKRC 3DEUA 2JWTA 5EF6A 1E0EA 3C1DA 2IS2A 4RAZA 4IHWA 3RZDJ 5J4VA 3MMYB 1FPQA 4RB1A 4UUSA 2CUZA 2AQFA 2Z33A 2CFXA 3OSGA 3BZKA 3F6VA 4BJ5C 1R1UA 2EFWA 1ZK8A 2WB1N 4QIWN 3AL0B 2H27A 4L0ZB 5H2FC 3FWEA 4M3DA 3TQNA 4E6KG 1WHUA 4OIQF 4D0PA 3LQQA 1LEAA 2O6GE 4NQWA 1YJNI 2DMUA 3EUAA 4N0BA 3SZGA 3BT9A 2YX7A 4HPQA 5LBQA 2UZKA 3WGGA 4BBSJ 2QQ8A 3CLQA 4NB5A 4D5FA 3EPZA 4B09A 2CUEA 3CCUI 3TEDA 4KISA 1BOAA 2HR3A 4XKVA 1N75A 5E1XA 4BHBA 3KYDB 2HVSA 3DKWA 3GX4X 1B9MA 1FWZA 1FTTA 1FMVA 2EILH 3ERMA 4J00A 3L2UA 4E70A 1Z77A 5IP7J 5J8FA 3M8EA 4AIDA 1Y39A 4CO8A 4OU0A 3GWZA 2WY7Q 2X6WA 1WJEA 5J3LA 1HKTA 2NVQJ 1NG6A 1LE8A 3OYJA 5BPIA 4IQ4A 3CMYA 1BI0A 1O4XA 1JT0A 4QWQA 3OYBA 1BIBA 2XIGA 4IF4A 1HW1A 3HTSB 3QP6A 4YIFA 4M3EA 2R5YA 2JA5J 1FNNA 3OYKA 2OJED 1BOBA 2JZYA 1A6IA 2XAHA 3S17J 3NQOA 3CCLI 2LY9A 1CQTA 5D6FA 5TRDA 1OKRA 1WJBA 2LKSA 2R7QA 1ZGAA 3MQ0A 4GO1A 1LDKB 3HOWJ 2L3DA 2Y69H 4BXXJ 3U1DA 4ENMA 3LFUA 2P7CB 3AAFA 2XKPA 2VQHA 2DJIA 2VOOA 4NDLA 2IS1A 3O8GA 3PFYA 4A3MJ 4IHSA 2DA2A 1U8RA 1Z05A 3FHNA 2X48A 3O2PE 1MBGA 1QZYA 3ASNH 4A3KJ 1ZREA 5B1BH 4BQAA 4RM2A 2XGCA 3JSOA 2O9LA 2WV1A 1VQ7I 2XAJA 2ZMEC 4DBQA 5LGUA 3HZJA 2BXZA 1FC3A 1XX5A 2DMTA 2LYCA 2EJRA 3K9TA 3VYTB 3JRIA 3EQLF 4HZFA 5FGMA 2PMZN 1MZBA 2H8WA 2OZUA 1XCBA 2V7FA 1ETXA 4HX8A 3PIOF 2LF7A 1YITI 2QKLB 1X3UA 2DYRH 3M7GA 1T33A 2W00A 5CYVA 5LGNA 4U7BA 1VQMI 2PI0A 1XB4A 3G73A 3C3WA 2YX4A 3FXLA 5K5OA 1KYZA 1OCCH 3CDIA 3BTJA 4XRFA 4CGZA 4PGGA 2HQRA 2LSOA 4M6XA 1R22A 4XLCA 5A2QZ 3PNTA 4JYKA 2VC1A 2IBDA 1S3JA 1MMGA 1IO2A 1WVRA 4I7HA 4M71A 3GW2A 1TWAJ 3WTXC 3BG3A 4AVZA 3WHBA 2RVCA 1APLC 3HOVJ 4M6VA 2Z99A 1JE8A 3ABKH 1I50J 3RZOJ 1RESA 4XRSA 3CCVI 1WJCA 1EH8A 4A0ZA 1QPMA 3L2WA 3LSIA 3C2HA 4II2A 3J81Z 4UUTA 2ME6A 2IGKA 2DA6A 1D1AA 1T98A 3MZ8A 4AU7A 3H35A 1KU3A 3ZRGA 1I39A 1DPRA 1HW2A 4XLNF 3OYAA 2CRGA 5J8CA 4N9HA 2NOJB 5E79C 3IWFA 3TDUC 2DTRA 2VPRA 1FEXA 3FBNB 1R1TA 3JRFA 2WWYA 1MIJA 2QBYB 2H6BA 2VXZA 2ISZA 2Z2SB 1JXSA 1S5LC 3L7WA 1P9QC 1W5SA 4BE0A 5F1RA 2HOEA 4Q47A 1IN8A 3S8PA 1R00A 3I4NJ 1F1ZA 3CO7C 2VPLA 3ABMH 4JQFA 3VFZA 1GV5A 2CQQA 1J0RA 4XN0A 5KVRA 3I64A 2A07F 2RC4A 3HBLA 2LLKA 1B72B 2ISYA 5D6EA 2KRFA 2KPMA 3FIWA 2F5DA 1MNDA 2E71A 3PO3J 1K78A 1WWXA 2XF5A 1OQYA 2EV6A 1BJZA 5M5XJ 4MFEA 4I0BA 1ACIA 3IAM2 4LB5A 3Q0VA 1VNDA 5JHUA 4HLXA 3I4PA 2XRLA 1I1GA 3FXOA 1FOXA 2Z1DA 1FTZA 1FT9A 2LTPA 1TT0A 4PSXA 4S05A 2OF7A 1OYIA 4G94A 2Z16A 4AIJA 2EA2A 4AUXA 2GAUA 2VQCA 1AKHA 2BY1A 3LSPA 4TV7A 2STWA 5FKOA 1Z3XA 3BCBA 3GMEA 3JRCA 2PMHA 2LP0A 1FOYA 1LVKA 3RPUD 4RLFA 3OOPA 5C4JJ 1YRNA 4BKXA 5F1JA 1FLIA 3ZQIA 1JJ6C 3AL0C 3G2BA 5J40A 3HOYJ 3ZQFA 2UXXA 3CCJI 1RR7A 2FU4A 2YU9J 3RJPA 1TWHJ 3CP2A 1ETQA 1BBYA 1BN5A 3LAPA 2C6YA 2BVLA 3ZR8X 3QYFA 3OR2C 3OS1A 5LEJA 3E1SA 5FKLA 3LL7A 1FY7A 2ESHA 3ZXSA 3S15J 3BJAA 5D4RA 4A93J 2ETHA 2CQXA 2VASA 2D1VA 1P4XA 1T08B 2VE8A 5HLIA 5GTIC 3KYLA 2EFOA 3TMOA 1ZRCA 1I3QJ 5FLXK 2OPTA 1D5YA 1T56A 1X1BA 2I10A 5AONA 3JAMZ 1BC7C 1A36A 5JFRA 1N78A 1V54H 3C18A 3CJTB 1M1EB 1Y56A 2Y0MA 4QPQA 2ZXJA 2DDAA 3CDLA 1FSHA 3HTUA 1QHHD 3R61A 3KEYA 2JPBA 1DU0A 1PP7U 3LQRA 2DQLA 3TDZC 4L5JA 1Y0NA 1MH3A 1UHSA 4CCMA 2CW8A 5DM7F 4MO7A 2NYXA 2BXYA 4ETSA 5KHDA 1IAWA 4P96A 2E2IJ 2ID6A 3BTCA 2Y30A 3R60A 4KMFA 4ZJZA 2PBIA 1QHGA 2EH3A 5L3GA 1SEUA 1N25A 4HV5A 5TGTA 3E6CC 3HOSA 2JVHA 1VFCA 1T0FA 3M07A 3PQJA 1TZLA 5ILSA 5FFXA 1GVDA 5H6RA 2XSJC 4CA0A 1O3TA 3KIOA 3O6BB 3W2AA 3BJ6A 1K6OA 1G59A 4Y15A 5BOXA 2JPCA 1FIPA 2OQRA 3HG9A 3OYDA 3DV8A 3HC7A 3GTLJ 2ZNYA 5IT9Z 2HQAA 2XPWA 5E3OA 2DFIA 2K40A 3WTZA 2EV5A 2CS3A 2MLGA 1Z7LA 1Z9CA 1QO0D 1YX3A 3HDDA 1XGNA 4D9JA 1IDYA 1JGSA 1KA8A 2GZWA 4HV6A 2OV7A 3E97A 2RREA 2VN2A 2FEZA 3CQZJ 1PUEE 2OC6A 3ABLH 4EVIA 4AIKA 4M3GA 2MABA 4C30A 3DF8A 5E3NA 2ECCA 4PJLA 1N77A 4BAYA 1USSA 2MSYA 3BDDA 3OR1C 4A3JJ 4DBRA 4FX4A 3K70D 1I1SA 2ELKA 2ZNZA 2G7UA 2JSPA 4MQ9F 2DCEA 4EEFG 1D0XA 4QPOA 3GYHX 2I5UA 4LLNA 4A3DJ 4PSWA 3ZQCA 4II3A 1UHWA 4ZTJA 4MEYF 3NWTA 1FP2A 4G6QA 5JLXA 4LLGF 2R92J 3BQZA 1OCRH 2V9PA 1RZ4A 2XAFA 3H36A 2OAZA 4RMNA 4JX4A 3SEQA 1TQPA 3LOCA 4HSRA 3L09A 2KRCA 3F72A 5FROA 3CJQB 4MQVA 3ROUA 2BE5F 3DWLE 2FMYA 2EK5A 2W24A 1J59A 1DP3A 4HBLA 4ZYGA 2LMDA 3V8LA 1YW8A 1OJLA 3NWSA 1H0MA 1RR8C 4IXAA 1D0YA 4IRIA 1TTYA 4XLPF 1XDUA 3OYLA 2DA7A 2F4OB 2DOAA 2P6SA 1GDTA 3HOUJ 3SXYA 2GQQA 3ZMVA 4KA4A 2Y0SN 2V9VA 2V9KA 3TO7A 4ZTFA 3FMRA 1S7EA 2Z5UA 5FFZA 5K1YA 2R5ZA 2VKVA 2RQQA 3V4GA 1SFOJ 2M4GA 2QLZA 3H92A 5EJCA 3S2HJ 2E1NA 4M73A 2QYOA 4ANJA 2HWVA 2LFBA 2ZJ2A 3IAS2 2VOPA 1UFMA 1ZGWA 4KDPA 4YRVA 3FXQA 4PZJA 2P5LC 3GCMA 2R7VA 5ED4A 4I98B 4NC6A 2KL4A 4RGSA 2ECBA 5D5WB 1V3FA 3A4CA 2MW8A 3EETA 2LG4A 2Z9OA 3T1BA 1J09A 3CCQI 3RQIA 4UB6C 1IW7F 4RAGA 1PDNC 1P6RA 1G3SA 1V5GA 5DCFA 4G7ZF 1LB2A 3HGGA 3I56I 4C2MJ 3IL2A 1B4AA 3W2WA 5GTHC 2A6HF 2K9NA 3ABUA 1WJAA 2K27A 4FETA 4KN7X 3KEOA 2ZJQF 4OIPF 1BA5A 1YHQI 3ASOH 1EF4A 3U1KA 2F4IA 3MD2A 3RPQA 4MLOA 4LG0B 1QA6A 4YFNF 4HDUA 5DD4A 5HLGA 2QSGX 2GXGA 1ENHA 2X4HA 4EJUA 3JRBA 4P55A 1T8IA 5HDNA 2XPUA 2UXNA 4CCJA 1U5TB 1X3WB 2A68F 5GAHJ 2DPDA 4UNOA 5TJJA 5E3LA 1P7JA 1U2WA 1V5EA 1ZR4A 2DK8A 4A3CJ 5DV5A 5C4XJ 1GT0C 1B72A 1IV6A 2A5YB 4LGWA 4UY8I 3A1YA 3GZNB 3HRTA 1X4OA 1H88C 1BR1A 2HNHA 3RPUA 2DTZA 1Z3YA 2WTEA 3F8FA 2DFHA 3BG7A 2KISA 2IJLA 1OYYA 5DS9A 4HDVA 2AO9A 4HNVA 3L2CA 1R9TJ 1YFHA 3BG6A 2STTA 2BY0A 5IY5H 3F22A 2BGCA 3SDBA 1BL0A 1YX5A 2F5VA 5ILUA 1I6HJ 2IS4A 1Y1WJ 1YW7A 2LVSA 4CZZA 2P0WA 2L5QA 1Z91A 1U78A 3CCMI 3GTJJ 2FJ1A 2FMLA 4I6ZA 2GLOA 2JSCA 4W1UA 5F6FA 5C44J 4NBQA 1IUYA 1W36D 3BWGA 1IF1A 2ME0A 4H4KC 4A3EJ 4HOBA 4M6YA 3Q5FA 5E8IA 2G0EA 4BEHA 3CD6I 4KUMA 1ZR2A 4LB6B 4HQMA 2HEOA 1W5TA 2Y9ZA 3G4SI 1VF9A 2E34A 2QWWA 4Y7NJ 2DXIA 1CF7B 2VUMJ 5DCMB 2DT5A 4JX5A 4HNTA 2L01A 3FXKA 3S2WA 3HHGA 5IT3A 3FM3A 5EZGA 4BQNA 3KETA 2RN7A 1L0OC 4IO9F 3FKJA 4AVPA 3Q3SA 5DDGA 2H1KA 2FX0A 2J5OA 3R4KA 3H0GJ 3A02A 5GAEJ 2K9MA 3CMAI 3MFKA 3LNQA 3AG3H 4JBAA 2CV2A 4WXDA 4D5CA 3OYIA 1AU7A 2IT0A 4A69C 2XVCA 3K4NA 5L3FA 4IOAF 3A03A 2W85A 1MDMB 5FLXZ 3GZ5A 4XN3A 1S72I 1LEBA 2GXBA 5F04A 3K70C 1ONVA 1RKWA 2R3SA 3Q0UA 2R7WA 4M72A 4E7IA 5IYCJ 4KIBA 1O3RA 2KKOA 4RB0A 3LA3A 3OYFA 1ZLJA 4Q4ZF 4KNYA 2LRDA 2XV4S 1V4RA 1EA3A 1NK3P 1UJ8A 2RGVA 2Q0OA 2M87A 3H5NA 1P2FA 2HXOA 1WI9A 1ON1A 4E7JA 3SQNA 2G7HA 2LR8A 3HYIA 2FSWA 4UVAA 1I6XA 2OD5A 3QP5A 2IVMA 4F91B 4IHVA 2O8XA 4A5NA 4YFKF 3T5XA 1XS9A 2TRTA 3BTIA 5GADJ 3O8HA 1XSVA 1Z0XA 3ZQQA 2HQNA 3H9GA 2HTJA 1DGRM 4D7NA 3D5LA 1KGSA 5CVUA 2W4SA 3ZPLA 2CV1A 2ACJA 2V79A 2HDWA 4CSWA 1LFBA 1U8BA 3BG5A 1STZA 2KDOA 4AYBA 4WXCA 4CZCA 1K4TA 5FKKA 3M8FA 4IOCF 2HYFA 4LLLA 4YIIA 3EUKL 4YG2F 1HQCA 1MSFC 4DZPA 4DYCA 2EFPA 2HTSA 5EEHA 3OIOA 3S16J 1LQ1A 2R7ZJ 3WTTC 4L9JA 2CWEA 4BGDA 1R4MB 3PO2J 4B44A 1RIOH 4AM3A 4HA8A 4IRHA 2M5WA 1MH4A 1I3AA 1WH5A 4I99C 3S14J 4R79A 3LSKA 3IUOA 2HGCA 3OOUA 5HS7A 2CQNA 2MYSA 4CYDA 4UV8A 2QENA 2QKMB 1QBJA 5JVGF 4KJZA 1Z6RA 3K4LA
chains in the Genus database with same CATH topology
2DPUA 1LDJA 4Q48A 4BH9A 2CQKA 2FOKA 3WGIA 3GFJA 3NRVA 1MJAA 2IA2A 5L3EA 3EYYA 1GXPA 4L5IA 1BJAA 5JR3A 3SFZA 4I01A 5JVTA 3KP7A 1B1BA 1P4WA 3N4MA 3JTHA 1FBQA 1P4AA 3IRQA 3GZ6A 3QU3A 3FMQA 1SD6A 2NNYA 3E3VA 3CTAA 4O6JA 4ESBA 2ZBKA 3KFWX 5CVRA 3LA2A 4HF2A 2XROA 4HF0A 2JRTA 1RUOA 3GO5A 1LJ9A 3F8MA 1U5TC 2YPRA 1YO5C 4MGRA 1LVAA 1OMIA 4ZZLA 1F5TA 3ZQ7A 4EGYA 4ESJA 3ECOA 3VOEA 2KJCA 1R5GA 3QRFF 1KU9A 5DUIA 4OOIA 5CVIA 1HSJA 1FP1D 2HFHA 5LRRA 2P7VB 5ICCA 1FYKA 2D45A 4LG0A 2ZO4A 4RB2C 1FOKA 5ICFA 1FBUA 3V7RA 3F3XA 4M9XA 1U5TA 2ZMEA 1L3LA 1YS7A 3CLOA 2OA4A 2IW5A 5BPDA 3I5UA 3V7SA 2GIVA 3J80K 3EDPA 3CUOA 5DUKA 3IKVA 2M8EA 3K0LA 2DAOA 3P9IA 2MLKA 4A2UA 4LK1F 1GHCA 3MCZA 2AXLA 5L3CA 6PAXA 4PGHA 4IPAA 3BPXA 1O3QA 2KIMA 4O3MA 3I59A 1B9NA 1SFEA 1XDSA 4YFXF 4HAMA 2B0LA 5JI6A 1CF7A 5DCMA 3E6DA 4IHTA 2V1XA 2FBIA 3ZMUA 1S7AA 3FF5A 5HS8A 5J6XA 2FRHA 3MWMA 2CGPA 1JHHA 1C0WA 2QUFA 3GUDA 3WGHA 2M1BA 1O7FA 3QOPA 1R7JA 4A5MA 2HDCA 1Z1DA 1DP7P 4R8HA 5D8KB 4ENJA 1S7OA 5BQTA 2BBYA 4LK0F 3RKXA 4GYIA 5BMZA 5D5UB 1SFXA 1USTA 4HF1A 5ICEA 3WTWC 1T2KA 1ZG3A 2VONA 1NHAA 1EH7A 4ASNA 1REPC 3E5XA 3PQKA 1ZG1A 1XGSA 3RKWA 1YG2A 2P5KA 4I0AA 2W84A 2ZFWA 2ZCWA 4Y17A 1D8JA 2Y48A 4HX4A 2QVOA 3N97A 4CXFA 1QZZA 2FNAA 1TQIA 2WC2A 3K69A 1WRJA 1XCVA 4L9VA 2X0LA 4EM1A 4LJZF 1I5ZA 5CJ9A 1SFUA 4MNUA 2L54A 1FX7A 1DUXC 2CYYA 2IA0A 4ESFA 1YTYA 2BV6A 4GYGA 3BP8A 4K2EA 4RB3C 3ELKA 4ZH4F 2O3FA 1IRFA 2PMUA 3WU0A 3HIFA 3RYPA 1PP8F 1A04A 1FSEA 4A6EA 3E6BA 4G6DA 1T6SA 3LAJA 4BHPA 3IWZA 3ML6A 5LEKA 2V1UA 1KU2A 3VB2A 1R58A 1J9IA 1R1VA 1YW9A 3TOAA 2HKXA 2D1HA 1TLHB 1ULYA 1BM9A 4MTEA 4WK8F 5H6QA 3TO9A 2CG4A 4QLCU 2LF8A 3HSRA 4EJVA 4GGGA 1HW5A 4BXUA 3IRRA 3T8RA 2MH2A 2A3SA 3WTYC 1I27A 2PG4A 3KP5A 4CICA 2F5CA 5BS6A 5D4SA 4L9TA 5FB2A 2O0YA 4XSXF 1D5VA 3RDIA 2F5FA 3RTRA 4HX7A 4A6DA 5CVJA 2KIFA 2XAQA 4ZYEA 2FE3A 4LMYA 4AWXB 3ERED 4CHUA 2K7LA 3HSEA 3DPTA 3PFIA 1S29A 3I71A 2P4WA 3QPHA 3HHHA 2VT3A 3WODF 3J80Z 4KICA 4ON0A 3IHUA 1Z6TA 2A61A 4BYYA 1EH6A 5FD5A 3QPTA 3CUQB 2VODA 2W25A 3K1NA 2WV0A 2QBYA 3IC7A 4EMSA 1YYVA 1IN6A 1IXCA 3O3KA 1HXDA 3VODA 4KN4X 3F8NA 3TKYA 1TNTA 3CDHA 3D0SA 3KLOA 3K2ZA 2PJPA 2CO5A 2RKHA 5DYMA 1TQMA 1JHFA 1MGTA 3R6SA 4OINF 3W6JB 1RUNA 3W6KB 2DI3A 4U0YA 2QM3A 4R1HA 3EYIA 3ZMDA 4L0YB 2TDXA 3J81K 4G8XA 4ZYHA 1IN5A 2Y75A 3HRUA 5E1ZB 2UWMA 1SMTA 1GVJA 2KIUA 2M45A 3DFGA 2CSOA 1J75A 4RGRA 3ZP5A 1TNSA 3RYRA 3LSTA 3KCCA 4UVBA 2IRFG 3OV8A 1FZPB 2H6CA 2MH9A 2GA1A 4U0WA 3IKTA 1Q1HA 2FA5A 3I0TA 5H20A 3M9AA 2F5EA 1KU7A 2P5VA 3SZTA 1O7LA 2ADUA 4OIOF 3HUGA 4Y13A 4L18B 3KZYA 4HW0A 2EFNA 2JTVA 1SD5A 3FMSA 1T39A 1WSUA 1QNTA 5LGTA 4EV0A 1R5HA 1D8KA 5DD8A 2LKPA 3GLXA 3Q9VA 5E18F 2QQBA 3BOQA 2EV0A 1YQAA 2DLLA 3P9KA 3FM5A 4A12A 2GWRA 2ELHA 2K4JA 3BROA 4I02A 2O03A 1MKMA 4U88A 2VC0A 3U2RA 1WKMA 3CJNA 3QU6A 1XSXA 4KIFA 2MBFA 4EM2A 1OYWA 3KZZA 2XRNA 4IJAA 2DO7A 5E20A 2OQGA 3P7NA 2PFBA 3I53A 1ODDA 1EV7A 5CLSA 2DQRA 4I2OA 5FO5A 1J7KA 1KQ8A 3WE3A 2VBXA 3MEXA 3JAMK 4DNCA 1ZH5A 5HDGA 2DW4A 3E5UA 4KYWA 5K5QA 4GCVA 2L4AA 3JSPA 1S8NA 5ERIA 4RGXA 5L3DA 5K5RA 5HVQC 3GFIA 3BPVA 3U9GA 1IN4A 4H0EA 4ENNA 1TBXA 3SZPA 1ZN2A 2HS5A 2GA2A 2HKOA 4PDKA 3ZN1A 4XBFA 3F23A 1MD0A 2QQ9A 2XKOA 2DK5A 3HSFA 5IT9K 2MD5A 3FX3A 2E7XA 2YSRA 5EEGA 1B6AA 1ZGJA 2BYVE 3CUQC 2P6TA 3V7CA 1O3SA 1J2XA 2P8TA 1DPUA 1IXSB 2FQ3A 3KE2A 2XUBA 3MZHA 3WE2A 2LNBA 3C7JA 2J5PA 2E7WA 2EB7A 4G9YA 1T38A 1P92A 3CO6C 3H3ZA 4M9ZA 3TOBA 3CUQA 1GXQA 2CW0F 2VBWA 5F64A 1G6NA 1U3EM 1VTNC 2FF4A 1XSDA 4MEXF 1FBSA 1TW3A 3G3ZA 5HS9A 1AOYA 2OZ6A 3FXUA 1G3TA 3V8JA 3KLNA 5LRSA 3B73A 4RGUA 1S6LA 1LNWA 4UXNA 4UVCA 4UHTA 1MJBA 2D2WA 3E6MA 3WTVC 1SMYF 1ZYRF 4GXOA 4MTDA 2PLYA 2IPQX 4S04A 1UB9A 2PEXA 1F4KA 2IA1A 2PN6A 5AIQA 3RI4A 4FT8A 3FHZA 2OU2A 2RDPA 1FYLA 4AIHA 1KYWA 3J7AO 2E1CA 1HKQA 1UHMA 4EQQA 4LD5A 4LFUA 1YLFA 2V1DA 1H9TA 1RI7A 5L3BA 3KP6A 1F9NA 3EUHA 1MDMA 1XN7A 1W4MA 4OMZA 2YU3A 4RS8A 4KIGA 2DBBA 3GXOA 3ZN0A 1OR7A 1ZHFA 1BIAA 3L9FA 1OPCA 3KEQA 3ZMSA 5HLHA 3ZMTA 4KFCA 4F7ZA 4U0VA 3F8BA 2DU9A 1K79A 3GF2A 2OBPA 2BEOA 1Z7UA 1W7PB 2O61A 1XMAA 3T8TA 3JTGA 3R0JA 2V6CA 2LDUA 1KQ0A 3REOA 3ISPA 4A0XA 4WXHA 5AIPA 5DEQA 4UUVA 2HZTA 2M30A 3DPLC 1E17A 4WWCA 4O5VA 3FXRA 1H9GA 4IRGA 3RKYA 1W7PD 3KP2A 3NEUA 4NHJA 3TO6A 1XD7A 2FBKA 1U6GA 3GEZA 1HSTA 4G7HF 2EWNA 2EA4A 2W57A 3GVAA 3I54A 1BI3A 3K1MA 2IP2A 4U7DA 2ESNA 3F21A 5E8GA 4EJOA 4M9SA 1SD7A 4WX9A 4P9FA 5E17F 2PQ8A 2XAGA 4MHGA 3H3UA 4BNCA 3MAJA 4HQEA 1J5YA 2Q2EA 4P5OA 2XASA 1IRGA 2VT2A 4RAYA 1SAXA 1DDNA 4ZYDA 2H94A 5LHIA 3WTUC 2A6EF 1KQ9A 2YR2A 2H09A 4FX0A 3ABTA 2XGXA 3F6OA 4FHTA 3Q9SA 3TGNA 4ZZDA 1E2XA 1Y0UA 2QZ8A 1HBXG 2COMA 3F8CA 3B02A 2A69F 5KK1A 2K02A 1IZ1A 2FXAA 4EJWA 1IN7A 5HDKA 1R23A 2XHKA 1B59A 1YS6A 4JK1X 1XGMA 3L00A 2RQPA 5LLQA 1WQ2A 3FZVA 5E1WA 3KP3A 3P9CA 3KP4A 3WG9A 2JT1A 1ZRDA 1MJ9A 1ZAOA 3MZYA 4I09A 3T0YA 2NRAC 2Z3YA 3V8KA 2Q8KA 3GFLA 2NS0A 4OMYA 1G3WA 4XSZF 4A0YA 2G9WA 3COAC 2MA3A 4PCQA 1G3YA 2K4BA 1R36A 4G7OF 3R0AA 5A2QK 1BI2A 4DQ2A 4M74A 2AS5F 1XGOA 2ZMEB 1BC8C 1YIOA 2VBYA 2L02A 1O57A 2ZKZA 4HYEA 2EFQA 2R7DA 2NNNA 4Z2YA 5D8LB 3E5QA 3HRMA 1BI1A 5ILVA 1RNLA 4BHCA 4L9NA 2RV8A 4EJTA 1LDDA 1CGPA 2VBZA 3DP7A 4IVNA 4WCGA 4Q5SF 4HLYA 2R7FA 3I59B 5LHGA 5D5VB 1TW2A 3RIRA 1XMKA 1K78B 4N9IA 5LHHA 1HKSA 3HRSA 4EGZA 4EM0B 3WU1B 1ZARA 1W7PA 2FBHA 3QAHA 1AWCA 1QGPA 3BY6A 1ZLKA 5HOOA 1SD4A 2FNPA 1QQIA 2K86A 1D3YA 1ZG5A 3GFMA 1ON2A 1ZRFA 4KT5C 3HOTA 4KMUX 2NAZA 3I58A 3DQVC 4CDGA 5CVVA 3JW4A 1K7AA 3ECHA 4OIRF 3SHFA 3WTSC 2MC3A 3K1PA 3DXJF 2F2EA 5FD6A 2VE9A 4P9UA 2KJBA 2RNJA 3M1EA 1IXRC 3LWFA 5D5XB 1UCRA 5ICGA 4ENKA 2HYGD 1FYMA 3ZMZA 3LA7A 3LFKA 4WF2A 1G4DA 4AD9A 2QQAA 3BZ6A 4B8XA 3BJOA 3VEPA 2L4MA 3ULQB 4UV9A 3DEUA 3C1DA 4RAZA 1FPQA 4RB1A 2Z33A 2CFXA 3F6VA 1R1UA 2EFWA 2H27A 4L0ZB 3FWEA 3TQNA 4OIQF 4D0PA 3LQQA 1LEAA 2O6GE 4NQWA 4N0BA 2YX7A 5LBQA 2UZKA 3WGGA 4NB5A 4B09A 1BOAA 2HR3A 5E1XA 4BHBA 3DKWA 1B9MA 1FWZA 4E70A 5J8FA 3M8EA 4CO8A 4OU0A 3GWZA 1HKTA 5BPIA 1BI0A 4QWQA 1BIBA 2XIGA 4IF4A 1HW1A 3HTSB 3QP6A 4YIFA 1FNNA 2JZYA 2XAHA 3NQOA 5D6FA 5TRDA 1OKRA 1ZGAA 3MQ0A 4GO1A 1LDKB 2L3DA 3U1DA 4ENMA 2P7CB 3AAFA 2XKPA 2VOOA 4IHSA 1U8RA 1Z05A 3O2PE 1QZYA 1ZREA 4BQAA 3JSOA 2XAJA 5LGUA 1FC3A 2EJRA 3K9TA 5FGMA 4HZFA 3EQLF 3GX4X 1MZBA 2OZUA 4HX8A 1XCBA 2LF7A 1X3UA 3M7GA 4U7BA 5CYVA 5LGNA 2PI0A 1XB4A 3G73A 3C3WA 2YX4A 5K5OA 1KYZA 4XRFA 4CGZA 4PGGA 2HQRA 2LSOA 4M6XA 1R22A 5A2QZ 2VC1A 1S3JA 4I7HA 4M71A 3GW2A 3WTXC 2RVCA 2Z99A 1JE8A 1EH8A 4A0ZA 1QPMA 3J81Z 1T98A 1KU3A 1DPRA 1HW2A 4XLNF 5J8CA 4N9HA 3IWFA 3TDUC 2DTRA 1R1TA 2WWYA 2QBYB 2H6BA 2VXZA 2ISZA 1JXSA 3L7WA 1W5SA 5F1RA 2HOEA 4Q47A 1IN8A 1R00A 1F1ZA 3CO7C 3VFZA 4JQFA 1J0RA 5KVRA 3I64A 2A07F 2RC4A 2ISYA 5D6EA 2KRFA 2F5DA 1K78A 1WWXA 2EV6A 4I0BA 4LB5A 5JHUA 4HLXA 3I4PA 1I1GA 1FT9A 4S05A 1OYIA 4G94A 4AIJA 2EA2A 2GAUA 4TV7A 2STWA 2PMHA 3OOPA 1FLIA 2UXXA 2FU4A 3RJPA 1BBYA 1BN5A 3LAPA 2C6YA 5LEJA 1FY7A 2ESHA 3BJAA 5D4RA 2ETHA 2D1VA 1P4XA 2VE8A 5HLIA 2EFOA 1ZRCA 5FLXK 5AONA 3JAMZ 1BC7C 5JFRA 3C18A 2Y0MA 2ZXJA 1FSHA 3HTUA 3R61A 2JPBA 1PP7U 3LQRA 2DQLA 3TDZC 4L5JA 2NYXA 4ETSA 1IAWA 4P96A 3R60A 4KMFA 2PBIA 5L3GA 4HV5A 3E6CC 3HOSA 1T0FA 3PQJA 5ILSA 5FFXA 5H6RA 1O3TA 3O6BB 3BJ6A 1K6OA 4Y15A 5BOXA 2JPCA 2OQRA 3DV8A 5IT9Z 2ZNYA 2DFIA 3WTZA 2EV5A 2MLGA 1Z9CA 1QO0D 1XGNA 1JGSA 1KA8A 2GZWA 4HV6A 3E97A 2VN2A 2FEZA 1PUEE 4EVIA 4AIKA 3DF8A 4BAYA 1USSA 3BDDA 4FX4A 1I1SA 2ZNZA 2G7UA 4MQ9F 3GYHX 4LLNA 1UHWA 4MEYF 1FP2A 4G6QA 4LLGF 2XAFA 1RZ4A 2OAZA 1TQPA 3L09A 3F72A 4MQVA 3ROUA 2BE5F 2FMYA 2EK5A 2W24A 1J59A 4HBLA 4ZYGA 3V8LA 1YW8A 1H0MA 4IXAA 4IRIA 1TTYA 4XLPF 1XDUA 2P6SA 3SXYA 2GQQA 3ZMVA 4KA4A 2V9VA 3TO7A 3FMRA 2Z5UA 5FFZA 5K1YA 3V4GA 2QLZA 3H92A 2E1NA 4M73A 2QYOA 2HWVA 2ZJ2A 2VOPA 1UFMA 4KDPA 3FXQA 4PZJA 2P5LC 5ED4A 4I98B 4RGSA 5D5WB 1V3FA 3EETA 2Z9OA 3T1BA 1IW7F 1PDNC 1P6RA 1G3SA 5DCFA 4G7ZF 1LB2A 3IL2A 1B4AA 2A6HF 3ABUA 2K27A 4KN7X 4OIPF 3KEOA 3RPQA 4LG0B 4YFNF 4HDUA 5DD4A 5HLGA 2GXGA 2X4HA 4EJUA 4P55A 5HDNA 2UXNA 1U5TB 2A68F 2DPDA 4UNOA 5TJJA 1U2WA 2DK8A 5DV5A 2A5YB 4LGWA 3HRTA 3RPUA 2WTEA 3F8FA 4HDVA 2IJLA 1OYYA 3L2CA 1YFHA 2STTA 3F22A 2BGCA 5ILUA 1YW7A 4CZZA 1Z91A 1U78A 2FMLA 2JSCA 5F6FA 1IUYA 3BWGA 1IF1A 4HOBA 4M6YA 3Q5FA 5E8IA 4KUMA 4LB6B 4HQMA 2HEOA 1W5TA 2QWWA 1CF7B 5DCMB 2DT5A 2L01A 3S2WA 3HHGA 5IT3A 3FM3A 3KETA 2RN7A 1L0OC 4AVPA 5DDGA 2J5OA 3R4KA 3MFKA 4JBAA 4WXDA 2IT0A 5L3FA 2XVCA 2W85A 1MDMB 5FLXZ 3GZ5A 1LEBA 2GXBA 1ONVA 2R3SA 4M72A 4KIBA 1O3RA 2KKOA 4RB0A 3LA3A 1ZLJA 4Q4ZF 4KNYA 2XV4S 1V4RA 2RGVA 2Q0OA 2M87A 1P2FA 1WI9A 1ON1A 3SQNA 2G7HA 3HYIA 2FSWA 4UVAA 1I6XA 2OD5A 3QP5A 2IVMA 2O8XA 4A5NA 4YFKF 3T5XA 1XSVA 2HQNA 2HTJA 3D5LA 1KGSA 5CVUA 3ZPLA 2ACJA 2V79A 1STZA 4WXCA 3M8FA 2HYFA 4LLLA 4YIIA 4YG2F 1HQCA 2EFPA 2HTSA 5EEHA 1LQ1A 3WTTC 4L9JA 2CWEA 1RIOH 4HA8A 4IRHA 2M5WA 4R79A 2HGCA 5HS7A 4CYDA 4UV8A 2QENA 1QBJA 1Z6RA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2DPU A;  1LDJ A;  4Q48 A;  4BH9 A;  2CQK A;  2FOK A;  3WGI A;  3GFJ A;  3NRV A;  1MJA A;  2IA2 A;  5L3E A;  3EYY A;  1GXP A;  4L5I A;  1BJA A;  5JR3 A;  3SFZ A;  4I01 A;  5JVT A;  3KP7 A;  1B1B A;  1P4W A;  3N4M A;  3JTH A;  1FBQ A;  1P4A A;  3IRQ A;  3GZ6 A;  3QU3 A;  3FMQ A;  1SD6 A;  2NNY A;  3E3V A;  3CTA A;  4O6J A;  4ESB A;  2ZBK A;  3KFW X;  5CVR A;  3LA2 A;  4HF2 A;  2XRO A;  4HF0 A;  2JRT A;  1RUO A;  3GO5 A;  1LJ9 A;  3F8M A;  1U5T C;  2YPR A;  1YO5 C;  4MGR A;  1LVA A;  1OMI A;  4ZZL A;  1F5T A;  3ZQ7 A;  4EGY A;  4ESJ A;  3ECO A;  3VOE A;  2KJC A;  1R5G A;  3QRF F;  1KU9 A;  5DUI A;  4OOI A;  5CVI A;  1HSJ A;  1FP1 D;  2HFH A;  5LRR A;  2P7V B;  5ICC A;  1FYK A;  2D45 A;  4LG0 A;  2ZO4 A;  4RB2 C;  1FOK A;  5ICF A;  1FBU A;  3V7R A;  3F3X A;  4M9X A;  1U5T A;  2ZME A;  1L3L A;  1YS7 A;  3CLO A;  2OA4 A;  2IW5 A;  5BPD A;  3I5U A;  3V7S A;  2GIV A;  3J80 K;  3EDP A;  3CUO A;  5DUK A;  3IKV A;  2M8E A;  3K0L A;  2DAO A;  3P9I A;  2MLK A;  4A2U A;  4LK1 F;  1GHC A;  3MCZ A;  2AXL A;  5L3C A;  6PAX A;  4PGH A;  4IPA A;  3BPX A;  1O3Q A;  2KIM A;  4O3M A;  3I59 A;  1B9N A;  1SFE A;  1XDS A;  4YFX F;  4HAM A;  2B0L A;  5JI6 A;  1CF7 A;  5DCM A;  3E6D A;  4IHT A;  2V1X A;  2FBI A;  3ZMU A;  1S7A A;  3FF5 A;  5HS8 A;  5J6X A;  2FRH A;  3MWM A;  2CGP A;  1JHH A;  1C0W A;  2QUF A;  3GUD A;  3WGH A;  2M1B A;  1O7F A;  3QOP A;  1R7J A;  4A5M A;  2HDC A;  1Z1D A;  1DP7 P;  4R8H A;  5D8K B;  4ENJ A;  1S7O A;  5BQT A;  2BBY A;  4LK0 F;  3RKX A;  4GYI A;  5BMZ A;  5D5U B;  1SFX A;  1UST A;  4HF1 A;  5ICE A;  3WTW C;  1T2K A;  1ZG3 A;  2VON A;  1NHA A;  1EH7 A;  4ASN A;  1REP C;  3E5X A;  3PQK A;  1ZG1 A;  1XGS A;  3RKW A;  1YG2 A;  2P5K A;  4I0A A;  2W84 A;  2ZFW A;  2ZCW A;  4Y17 A;  1D8J A;  2Y48 A;  4HX4 A;  2QVO A;  3N97 A;  4CXF A;  1QZZ A;  2FNA A;  1TQI A;  2WC2 A;  3K69 A;  1WRJ A;  1XCV A;  4L9V A;  2X0L A;  4EM1 A;  4LJZ F;  1I5Z A;  5CJ9 A;  1SFU A;  4MNU A;  2L54 A;  1FX7 A;  1DUX C;  2CYY A;  2IA0 A;  4ESF A;  1YTY A;  2BV6 A;  4GYG A;  3BP8 A;  4K2E A;  4RB3 C;  3ELK A;  4ZH4 F;  2O3F A;  1IRF A;  2PMU A;  3WU0 A;  3HIF A;  3RYP A;  1PP8 F;  1A04 A;  1FSE A;  4A6E A;  3E6B A;  4G6D A;  1T6S A;  3LAJ A;  4BHP A;  3IWZ A;  3ML6 A;  5LEK A;  2V1U A;  1KU2 A;  3VB2 A;  1R58 A;  1J9I A;  1R1V A;  1YW9 A;  3TOA A;  2HKX A;  2D1H A;  1TLH B;  1ULY A;  1BM9 A;  4MTE A;  4WK8 F;  5H6Q A;  3TO9 A;  2CG4 A;  4QLC U;  2LF8 A;  3HSR A;  4EJV A;  4GGG A;  1HW5 A;  4BXU A;  3IRR A;  3T8R A;  2MH2 A;  2A3S A;  3WTY C;  1I27 A;  2PG4 A;  3KP5 A;  4CIC A;  2F5C A;  5BS6 A;  5D4S A;  4L9T A;  5FB2 A;  2O0Y A;  4XSX F;  1D5V A;  3RDI A;  2F5F A;  3RTR A;  4HX7 A;  4A6D A;  5CVJ A;  2KIF A;  2XAQ A;  4ZYE A;  2FE3 A;  4LMY A;  4AWX B;  3ERE D;  4CHU A;  2K7L A;  3HSE A;  3DPT A;  3PFI A;  1S29 A;  3I71 A;  2P4W A;  3QPH A;  3HHH A;  2VT3 A;  3WOD F;  3J80 Z;  4KIC A;  4ON0 A;  3IHU A;  1Z6T A;  2A61 A;  4BYY A;  1EH6 A;  5FD5 A;  3QPT A;  3CUQ B;  2VOD A;  2W25 A;  3K1N A;  2WV0 A;  2QBY A;  3IC7 A;  4EMS A;  1YYV A;  1IN6 A;  1IXC A;  3O3K A;  1HXD A;  3VOD A;  4KN4 X;  3F8N A;  3TKY A;  1TNT A;  3CDH A;  3D0S A;  3KLO A;  3K2Z A;  2PJP A;  2CO5 A;  2RKH A;  5DYM A;  1TQM A;  1JHF A;  1MGT A;  3R6S A;  4OIN F;  3W6J B;  1RUN A;  3W6K B;  2DI3 A;  4U0Y A;  2QM3 A;  4R1H A;  3EYI A;  3ZMD A;  4L0Y B;  2TDX A;  3J81 K;  4G8X A;  4ZYH A;  1IN5 A;  2Y75 A;  3HRU A;  5E1Z B;  2UWM A;  1SMT A;  1GVJ A;  2KIU A;  2M45 A;  3DFG A;  2CSO A;  1J75 A;  4RGR A;  3ZP5 A;  1TNS A;  3RYR A;  3LST A;  3KCC A;  4UVB A;  2IRF G;  3OV8 A;  1FZP B;  2H6C A;  2MH9 A;  2GA1 A;  4U0W A;  3IKT A;  1Q1H A;  2FA5 A;  3I0T A;  5H20 A;  3M9A A;  2F5E A;  1KU7 A;  2P5V A;  3SZT A;  1O7L A;  2ADU A;  4OIO F;  3HUG A;  4Y13 A;  4L18 B;  3KZY A;  4HW0 A;  2EFN A;  2JTV A;  1SD5 A;  3FMS A;  1T39 A;  1WSU A;  1QNT A;  5LGT A;  4EV0 A;  1R5H A;  1D8K A;  5DD8 A;  2LKP A;  3GLX A;  3Q9V A;  5E18 F;  2QQB A;  3BOQ A;  2EV0 A;  1YQA A;  2DLL A;  3P9K A;  3FM5 A;  4A12 A;  2GWR A;  2ELH A;  2K4J A;  3BRO A;  4I02 A;  2O03 A;  1MKM A;  4U88 A;  2VC0 A;  3U2R A;  1WKM A;  3CJN A;  3QU6 A;  1XSX A;  4KIF A;  2MBF A;  4EM2 A;  1OYW A;  3KZZ A;  2XRN A;  4IJA A;  2DO7 A;  5E20 A;  2OQG A;  3P7N A;  2PFB A;  3I53 A;  1ODD A;  1EV7 A;  5CLS A;  2DQR A;  4I2O A;  5FO5 A;  1J7K A;  1KQ8 A;  3WE3 A;  2VBX A;  3MEX A;  3JAM K;  4DNC A;  1ZH5 A;  5HDG A;  2DW4 A;  3E5U A;  4KYW A;  5K5Q A;  4GCV A;  2L4A A;  3JSP A;  1S8N A;  5ERI A;  4RGX A;  5L3D A;  5K5R A;  5HVQ C;  3GFI A;  3BPV A;  3U9G A;  1IN4 A;  4H0E A;  4ENN A;  1TBX A;  3SZP A;  1ZN2 A;  2HS5 A;  2GA2 A;  2HKO A;  4PDK A;  3ZN1 A;  4XBF A;  3F23 A;  1MD0 A;  2QQ9 A;  2XKO A;  2DK5 A;  3HSF A;  5IT9 K;  2MD5 A;  3FX3 A;  2E7X A;  2YSR A;  5EEG A;  1B6A A;  1ZGJ A;  2BYV E;  3CUQ C;  2P6T A;  3V7C A;  1O3S A;  1J2X A;  2P8T A;  1DPU A;  1IXS B;  2FQ3 A;  3KE2 A;  2XUB A;  3MZH A;  3WE2 A;  2LNB A;  3C7J A;  2J5P A;  2E7W A;  2EB7 A;  4G9Y A;  1T38 A;  1P92 A;  3CO6 C;  3H3Z A;  4M9Z A;  3TOB A;  3CUQ A;  1GXQ A;  2CW0 F;  2VBW A;  5F64 A;  1G6N A;  1U3E M;  1VTN C;  2FF4 A;  1XSD A;  4MEX F;  1FBS A;  1TW3 A;  3G3Z A;  5HS9 A;  1AOY A;  2OZ6 A;  3FXU A;  1G3T A;  3V8J A;  3KLN A;  5LRS A;  3B73 A;  4RGU A;  1S6L A;  1LNW A;  4UXN A;  4UVC A;  4UHT A;  1MJB A;  2D2W A;  3E6M A;  3WTV C;  1SMY F;  1ZYR F;  4GXO A;  4MTD A;  2PLY A;  2IPQ X;  4S04 A;  1UB9 A;  2PEX A;  1F4K A;  2IA1 A;  2PN6 A;  5AIQ A;  3RI4 A;  4FT8 A;  3FHZ A;  2OU2 A;  2RDP A;  1FYL A;  4AIH A;  1KYW A;  3J7A O;  2E1C A;  1HKQ A;  1UHM A;  4EQQ A;  4LD5 A;  4LFU A;  1YLF A;  2V1D A;  1H9T A;  1RI7 A;  5L3B A;  3KP6 A;  1F9N A;  3EUH A;  1MDM A;  1XN7 A;  1W4M A;  4OMZ A;  2YU3 A;  4RS8 A;  4KIG A;  2DBB A;  3GXO A;  3ZN0 A;  1OR7 A;  1ZHF A;  1BIA A;  3L9F A;  1OPC A;  3KEQ A;  3ZMS A;  5HLH A;  3ZMT A;  4KFC A;  4F7Z A;  4U0V A;  3F8B A;  2DU9 A;  1K79 A;  3GF2 A;  2OBP A;  2BEO A;  1Z7U A;  1W7P B;  2O61 A;  1XMA A;  3T8T A;  3JTG A;  3R0J A;  2V6C A;  2LDU A;  1KQ0 A;  3REO A;  3ISP A;  4A0X A;  4WXH A;  5AIP A;  5DEQ A;  4UUV A;  2HZT A;  2M30 A;  3DPL C;  1E17 A;  4WWC A;  4O5V A;  3FXR A;  1H9G A;  4IRG A;  3RKY A;  1W7P D;  3KP2 A;  3NEU A;  4NHJ A;  3TO6 A;  1XD7 A;  2FBK A;  1U6G A;  3GEZ A;  1HST A;  4G7H F;  2EWN A;  2EA4 A;  2W57 A;  3GVA A;  3I54 A;  1BI3 A;  3K1M A;  2IP2 A;  4U7D A;  2ESN A;  3F21 A;  5E8G A;  4EJO A;  4M9S A;  1SD7 A;  4WX9 A;  4P9F A;  5E17 F;  2PQ8 A;  2XAG A;  4MHG A;  3H3U A;  4BNC A;  3MAJ A;  4HQE A;  1J5Y A;  2Q2E A;  4P5O A;  2XAS A;  1IRG A;  2VT2 A;  4RAY A;  1SAX A;  1DDN A;  4ZYD A;  2H94 A;  5LHI A;  3WTU C;  2A6E F;  1KQ9 A;  2YR2 A;  2H09 A;  4FX0 A;  3ABT A;  2XGX A;  3F6O A;  4FHT A;  3Q9S A;  3TGN A;  4ZZD A;  1E2X A;  1Y0U A;  2QZ8 A;  1HBX G;  2COM A;  3F8C A;  3B02 A;  2A69 F;  5KK1 A;  2K02 A;  1IZ1 A;  2FXA A;  4EJW A;  1IN7 A;  5HDK A;  1R23 A;  2XHK A;  1B59 A;  1YS6 A;  4JK1 X;  1XGM A;  3L00 A;  2RQP A;  5LLQ A;  1WQ2 A;  3FZV A;  5E1W A;  3KP3 A;  3P9C A;  3KP4 A;  3WG9 A;  2JT1 A;  1ZRD A;  1MJ9 A;  1ZAO A;  3MZY A;  4I09 A;  3T0Y A;  2NRA C;  2Z3Y A;  3V8K A;  2Q8K A;  3GFL A;  2NS0 A;  4OMY A;  1G3W A;  4XSZ F;  4A0Y A;  2G9W A;  3COA C;  2MA3 A;  4PCQ A;  1G3Y A;  2K4B A;  1R36 A;  4G7O F;  3R0A A;  5A2Q K;  1BI2 A;  4DQ2 A;  4M74 A;  2AS5 F;  1XGO A;  2ZME B;  1BC8 C;  1YIO A;  2VBY A;  2L02 A;  1O57 A;  2ZKZ A;  4HYE A;  2EFQ A;  2R7D A;  2NNN A;  4Z2Y A;  5D8L B;  3E5Q A;  3HRM A;  1BI1 A;  5ILV A;  1RNL A;  4BHC A;  4L9N A;  2RV8 A;  4EJT A;  1LDD A;  1CGP A;  2VBZ A;  3DP7 A;  4IVN A;  4WCG A;  4Q5S F;  4HLY A;  2R7F A;  3I59 B;  5LHG A;  5D5V B;  1TW2 A;  3RIR A;  1XMK A;  1K78 B;  4N9I A;  5LHH A;  1HKS A;  3HRS A;  4EGZ A;  4EM0 B;  3WU1 B;  1ZAR A;  1W7P A;  2FBH A;  3QAH A;  1AWC A;  1QGP A;  3BY6 A;  1ZLK A;  5HOO A;  1SD4 A;  2FNP A;  1QQI A;  2K86 A;  1D3Y A;  1ZG5 A;  3GFM A;  1ON2 A;  1ZRF A;  4KT5 C;  3HOT A;  4KMU X;  2NAZ A;  3I58 A;  3DQV C;  4CDG A;  5CVV A;  3JW4 A;  1K7A A;  3ECH A;  4OIR F;  3SHF A;  3WTS C;  2MC3 A;  3K1P A;  3DXJ F;  2F2E A;  5FD6 A;  2VE9 A;  4P9U A;  2KJB A;  2RNJ A;  3M1E A;  1IXR C;  3LWF A;  5D5X B;  1UCR A;  5ICG A;  4ENK A;  2HYG D;  1FYM A;  3ZMZ A;  3LA7 A;  3LFK A;  4WF2 A;  1G4D A;  4AD9 A;  2QQA A;  3BZ6 A;  4B8X A;  3BJO A;  3VEP A;  2L4M A;  3ULQ B;  4UV9 A;  3DEU A;  3C1D A;  4RAZ A;  1FPQ A;  4RB1 A;  2Z33 A;  2CFX A;  3F6V A;  1R1U A;  2EFW A;  2H27 A;  4L0Z B;  3FWE A;  3TQN A;  4OIQ F;  4D0P A;  3LQQ A;  1LEA A;  2O6G E;  4NQW A;  4N0B A;  2YX7 A;  5LBQ A;  2UZK A;  3WGG A;  4NB5 A;  4B09 A;  1BOA A;  2HR3 A;  5E1X A;  4BHB A;  3DKW A;  1B9M A;  1FWZ A;  4E70 A;  5J8F A;  3M8E A;  4CO8 A;  4OU0 A;  3GWZ A;  1HKT A;  5BPI A;  1BI0 A;  4QWQ A;  1BIB A;  2XIG A;  4IF4 A;  1HW1 A;  3HTS B;  3QP6 A;  4YIF A;  1FNN A;  2JZY A;  2XAH A;  3NQO A;  5D6F A;  5TRD A;  1OKR A;  1ZGA A;  3MQ0 A;  4GO1 A;  1LDK B;  2L3D A;  3U1D A;  4ENM A;  2P7C B;  3AAF A;  2XKP A;  2VOO A;  4IHS A;  1U8R A;  1Z05 A;  3O2P E;  1QZY A;  1ZRE A;  4BQA A;  3JSO A;  2XAJ A;  5LGU A;  1FC3 A;  2EJR A;  3K9T A;  5FGM A;  4HZF A;  3EQL F;  3GX4 X;  1MZB A;  2OZU A;  4HX8 A;  1XCB A;  2LF7 A;  1X3U A;  3M7G A;  4U7B A;  5CYV A;  5LGN A;  2PI0 A;  1XB4 A;  3G73 A;  3C3W A;  2YX4 A;  5K5O A;  1KYZ A;  4XRF A;  4CGZ A;  4PGG A;  2HQR A;  2LSO A;  4M6X A;  1R22 A;  5A2Q Z;  2VC1 A;  1S3J A;  4I7H A;  4M71 A;  3GW2 A;  3WTX C;  2RVC A;  2Z99 A;  1JE8 A;  1EH8 A;  4A0Z A;  1QPM A;  3J81 Z;  1T98 A;  1KU3 A;  1DPR A;  1HW2 A;  4XLN F;  5J8C A;  4N9H A;  3IWF A;  3TDU C;  2DTR A;  1R1T A;  2WWY A;  2QBY B;  2H6B A;  2VXZ A;  2ISZ A;  1JXS A;  3L7W A;  1W5S A;  5F1R A;  2HOE A;  4Q47 A;  1IN8 A;  1R00 A;  1F1Z A;  3CO7 C;  3VFZ A;  4JQF A;  1J0R A;  5KVR A;  3I64 A;  2A07 F;  2RC4 A;  2ISY A;  5D6E A;  2KRF A;  2F5D A;  1K78 A;  1WWX A;  2EV6 A;  4I0B A;  4LB5 A;  5JHU A;  4HLX A;  3I4P A;  1I1G A;  1FT9 A;  4S05 A;  1OYI A;  4G94 A;  4AIJ A;  2EA2 A;  2GAU A;  4TV7 A;  2STW A;  2PMH A;  3OOP A;  1FLI A;  2UXX A;  2FU4 A;  3RJP A;  1BBY A;  1BN5 A;  3LAP A;  2C6Y A;  5LEJ A;  1FY7 A;  2ESH A;  3BJA A;  5D4R A;  2ETH A;  2D1V A;  1P4X A;  2VE8 A;  5HLI A;  2EFO A;  1ZRC A;  5FLX K;  5AON A;  3JAM Z;  1BC7 C;  5JFR A;  3C18 A;  2Y0M A;  2ZXJ A;  1FSH A;  3HTU A;  3R61 A;  2JPB A;  1PP7 U;  3LQR A;  2DQL A;  3TDZ C;  4L5J A;  2NYX A;  4ETS A;  1IAW A;  4P96 A;  3R60 A;  4KMF A;  2PBI A;  5L3G A;  4HV5 A;  3E6C C;  3HOS A;  1T0F A;  3PQJ A;  5ILS A;  5FFX A;  5H6R A;  1O3T A;  3O6B B;  3BJ6 A;  1K6O A;  4Y15 A;  5BOX A;  2JPC A;  2OQR A;  3DV8 A;  5IT9 Z;  2ZNY A;  2DFI A;  3WTZ A;  2EV5 A;  2MLG A;  1Z9C A;  1QO0 D;  1XGN A;  1JGS A;  1KA8 A;  2GZW A;  4HV6 A;  3E97 A;  2VN2 A;  2FEZ A;  1PUE E;  4EVI A;  4AIK A;  3DF8 A;  4BAY A;  1USS A;  3BDD A;  4FX4 A;  1I1S A;  2ZNZ A;  2G7U A;  4MQ9 F;  3GYH X;  4LLN A;  1UHW A;  4MEY F;  1FP2 A;  4G6Q A;  4LLG F;  2XAF A;  1RZ4 A;  2OAZ A;  1TQP A;  3L09 A;  3F72 A;  4MQV A;  3ROU A;  2BE5 F;  2FMY A;  2EK5 A;  2W24 A;  1J59 A;  4HBL A;  4ZYG A;  3V8L A;  1YW8 A;  1H0M A;  4IXA A;  4IRI A;  1TTY A;  4XLP F;  1XDU A;  2P6S A;  3SXY A;  2GQQ A;  3ZMV A;  4KA4 A;  2V9V A;  3TO7 A;  3FMR A;  2Z5U A;  5FFZ A;  5K1Y A;  3V4G A;  2QLZ A;  3H92 A;  2E1N A;  4M73 A;  2QYO A;  2HWV A;  2ZJ2 A;  2VOP A;  1UFM A;  4KDP A;  3FXQ A;  4PZJ A;  2P5L C;  5ED4 A;  4I98 B;  4RGS A;  5D5W B;  1V3F A;  3EET A;  2Z9O A;  3T1B A;  1IW7 F;  1PDN C;  1P6R A;  1G3S A;  5DCF A;  4G7Z F;  1LB2 A;  3IL2 A;  1B4A A;  2A6H F;  3ABU A;  2K27 A;  4KN7 X;  4OIP F;  3KEO A;  3RPQ A;  4LG0 B;  4YFN F;  4HDU A;  5DD4 A;  5HLG A;  2GXG A;  2X4H A;  4EJU A;  4P55 A;  5HDN A;  2UXN A;  1U5T B;  2A68 F;  2DPD A;  4UNO A;  5TJJ A;  1U2W A;  2DK8 A;  5DV5 A;  2A5Y B;  4LGW A;  3HRT A;  3RPU A;  2WTE A;  3F8F A;  4HDV A;  2IJL A;  1OYY A;  3L2C A;  1YFH A;  2STT A;  3F22 A;  2BGC A;  5ILU A;  1YW7 A;  4CZZ A;  1Z91 A;  1U78 A;  2FML A;  2JSC A;  5F6F A;  1IUY A;  3BWG A;  1IF1 A;  4HOB A;  4M6Y A;  3Q5F A;  5E8I A;  4KUM A;  4LB6 B;  4HQM A;  2HEO A;  1W5T A;  2QWW A;  1CF7 B;  5DCM B;  2DT5 A;  2L01 A;  3S2W A;  3HHG A;  5IT3 A;  3FM3 A;  3KET A;  2RN7 A;  1L0O C;  4AVP A;  5DDG A;  2J5O A;  3R4K A;  3MFK A;  4JBA A;  4WXD A;  2IT0 A;  5L3F A;  2XVC A;  2W85 A;  1MDM B;  5FLX Z;  3GZ5 A;  1LEB A;  2GXB A;  1ONV A;  2R3S A;  4M72 A;  4KIB A;  1O3R A;  2KKO A;  4RB0 A;  3LA3 A;  1ZLJ A;  4Q4Z F;  4KNY A;  2XV4 S;  1V4R A;  2RGV A;  2Q0O A;  2M87 A;  1P2F A;  1WI9 A;  1ON1 A;  3SQN A;  2G7H A;  3HYI A;  2FSW A;  4UVA A;  1I6X A;  2OD5 A;  3QP5 A;  2IVM A;  2O8X A;  4A5N A;  4YFK F;  3T5X A;  1XSV A;  2HQN A;  2HTJ A;  3D5L A;  1KGS A;  5CVU A;  3ZPL A;  2ACJ A;  2V79 A;  1STZ A;  4WXC A;  3M8F A;  2HYF A;  4LLL A;  4YII A;  4YG2 F;  1HQC A;  2EFP A;  2HTS A;  5EEH A;  1LQ1 A;  3WTT C;  4L9J A;  2CWE A;  1RIO H;  4HA8 A;  4IRH A;  2M5W A;  4R79 A;  2HGC A;  5HS7 A;  4CYD A;  4UV8 A;  2QEN A;  1QBJ A;  1Z6R A; 
#chains in the Genus database with same CATH topology
 5GAG J;  2DPU A;  1LDJ A;  1FJL A;  4Q48 A;  4DJA A;  3H9J A;  4BH9 A;  5JHF A;  2CQK A;  5HNF A;  2FOK A;  3WGI A;  3GFJ A;  3NRV A;  1SVM A;  1K4S A;  3ZOB A;  1MJA A;  2IA2 A;  2LC2 A;  2L7F P;  3DPU A;  5L3E A;  3EYY A;  4HNU A;  3G6E I;  1GXP A;  2DT6 A;  4L5I A;  1BJA A;  5JR3 A;  3SFZ A;  4I01 A;  4PJJ A;  3KP7 A;  5JVT A;  5C3E J;  4RLQ A;  2DFE A;  1B1B A;  1HCR A;  1P4W A;  2BHY A;  3N4M A;  3JTH A;  1D1C A;  2L2O A;  4FE4 A;  5CQG A;  1FBQ A;  1P4A A;  1NK2 P;  2JVG A;  3IRQ A;  3GZ6 A;  4A3L J;  2HOA A;  3QU3 A;  2IAI A;  1W0U A;  3FMQ A;  1GV2 A;  1SD6 A;  5J4Y A;  2NNY A;  3E3V A;  3CTA A;  4O6J A;  1A5J A;  4ESB A;  1LFU P;  4DZJ A;  2ZBK A;  2R7T A;  3KFW X;  5CVR A;  2BY3 A;  3LA2 A;  1R4N B;  4HF2 A;  2XRO A;  4HF0 A;  5M5Y J;  3MVP A;  1WZ2 A;  4E7H A;  4CCL A;  2JRT A;  1KZH A;  1RUO A;  3GO5 A;  1Y8R B;  1LJ9 A;  2M0M A;  1OIS A;  1SAN A;  3F8M A;  1U5T C;  2YPR A;  1YO5 C;  1W36 C;  3A2K A;  4MGR A;  2XPV A;  1LVA A;  1OMI A;  1MW7 A;  4ZZL A;  2K85 A;  1F5T A;  3FK7 A;  2DYS H;  1F43 A;  3ZQ7 A;  2OTJ I;  4YEL A;  1A6Q A;  4EGY A;  4ESJ A;  3ECO A;  4XLH A;  3VOE A;  2W48 A;  3DEW A;  3K6G A;  2KJC A;  1R5G A;  3QRF F;  1KU9 A;  5DUI A;  4OOI A;  5CVI A;  1X1A A;  1HSJ A;  4FCY A;  1FP1 D;  2HFH A;  1W5C C;  4ZDO A;  5LRR A;  2IGO A;  2P7V B;  5ICC A;  1FYK A;  2D45 A;  1JUM A;  2ZJP F;  4LG0 A;  2E2J J;  2ZO4 A;  2W82 A;  4RB2 C;  3FKI J;  2VJJ A;  1FOK A;  3WU2 C;  2F6C A;  5ICF A;  5FLM J;  1FBU A;  4BS9 A;  5GP9 A;  1QVT A;  3V7R A;  3F3X A;  4IQJ A;  4M9X A;  1U5T A;  2ZME A;  2EIK H;  1L3L A;  1YS7 A;  3CLO A;  2OA4 A;  2OCC H;  3K4K A;  5LFA A;  2IW5 A;  5BPD A;  1R6R A;  2QF7 A;  3CF2 A;  3I5U A;  3CP8 A;  2HVR A;  3V7S A;  2GIV A;  1WPK A;  3L1P A;  3J80 K;  1MMD A;  3EDP A;  1VQ8 I;  3CUO A;  3IH2 A;  4PJN A;  2QA4 I;  2CUJ A;  3IKV A;  5DUK A;  2O5R A;  2M8E A;  3K10 A;  3AG4 H;  5EEA A;  3K0L A;  2DAO A;  3P9I A;  2MLK A;  4A2U A;  3PNV A;  4LK1 F;  4CCO A;  1GHC A;  2ELJ A;  1TWG J;  3MCZ A;  2AXL A;  4HST A;  5L3C A;  2ZFU A;  3VSL A;  2Y2Z A;  2VIX A;  6PAX A;  4BQQ A;  3K2A A;  3CC7 I;  4NC7 A;  4PGH A;  4A3B J;  3PSF A;  2JN6 A;  2XGE A;  3HJE A;  4IPA A;  3SYT A;  3BPX A;  2MGQ A;  1OFC X;  1O3Q A;  2KIM A;  4O3M A;  3I59 A;  1WI3 A;  3PM1 A;  1B9N A;  1SFE A;  4XK4 A;  4B48 A;  3I4M J;  1XDS A;  5K7Z A;  1FMW A;  1T95 A;  1Z21 A;  4YFX F;  4HAM A;  2B0L A;  4J01 A;  2M7A A;  4XOR A;  5JI6 A;  1CF7 A;  5DCM A;  3E6D A;  4GFB A;  2XF6 A;  4IHT A;  2V1X A;  2L9S A;  2FBI A;  2FQ4 A;  3ZMU A;  1S7A A;  1X1D A;  3FF5 A;  4Z6Y A;  5HS8 A;  5J6X A;  2FRH A;  2MD0 A;  3X2Q H;  3JR9 A;  3OYE A;  2WAQ A;  3MWM A;  2UUZ A;  4BL0 B;  2XC7 A;  4KIT B;  4XOT A;  2ICW G;  4PFO A;  1V5F A;  2CGP A;  5LD2 C;  1JHH A;  2LKX A;  1C0W A;  3GTQ J;  2Y31 A;  2QUF A;  2Y9Y A;  3GUD A;  3HKZ A;  5EYR A;  3WGH A;  1WH7 A;  4HG2 A;  3S1Q J;  4IKF A;  1YJW I;  2M1B A;  1O7F A;  2CFO A;  3QOP A;  1R7J A;  4A5M A;  3W6V A;  2HDC A;  2JK3 A;  1Z1D A;  3WHC A;  1DP7 P;  5HLT A;  4R8H A;  5D8K B;  5B3S H;  4ENJ A;  4P1W A;  1S7O A;  2DMN A;  2R7R A;  3B6A A;  5BQT A;  2VLA A;  3L2V A;  2BBY A;  4LK0 F;  5DTD A;  5F0F A;  3TP3 A;  2K3P A;  1HDP A;  4GYI A;  3RKX A;  4BQO A;  5BMZ A;  5D5U B;  2HDD A;  2OCE A;  1SFX A;  1K83 J;  1UST A;  4HF1 A;  5ICE A;  2E5Z A;  2E36 A;  3WTW C;  2O7O A;  1ETK A;  1VQN I;  4CH7 A;  1T2K A;  1ZG3 A;  2VON A;  1NHA A;  1XTA A;  4HEA 2;  5EGO B;  3HUG B;  1X1C A;  2KRH A;  1EH7 A;  4ASN A;  2CJJ A;  2WBM A;  4F92 B;  1REP C;  3H3V K;  3E5X A;  2K9S A;  3PQK A;  4QSH A;  3S1R J;  1XGS A;  1ZG1 A;  3RKW A;  3ZQL A;  1YG2 A;  2P5K A;  4FQG A;  4I0A A;  2W84 A;  2VJ4 A;  5M3M J;  2ZFW A;  2LY1 A;  2ZCW A;  3DTE A;  2R7U A;  4D7M A;  4Y17 A;  3IP4 B;  2K9Q A;  2Y48 A;  4HX4 A;  2QVO A;  3N97 A;  1IV8 A;  4CXF A;  1D8J A;  2AHQ A;  1QZZ A;  2FNA A;  1TQI A;  1VI0 A;  2WC2 A;  1Y8Q B;  3SJM A;  1BW6 A;  3K69 A;  1DQU A;  5F08 A;  1WRJ A;  1XCV A;  1RKT A;  2KT0 A;  3RQ4 A;  4L9V A;  1F36 A;  2X0L A;  4EM1 A;  4E7K A;  5CKT A;  2EPF A;  4LJZ F;  4YEJ A;  3AG1 H;  1I5Z A;  2HVQ A;  5CJ9 A;  1E3P A;  2HPI A;  1SFU A;  3RCO A;  3M3Y J;  1IUF A;  4MNU A;  2L54 A;  1FX7 A;  4BXF A;  3SEZ A;  3K4M A;  5DM6 F;  2M3A A;  1DUX C;  2CYY A;  2IA0 A;  3ESW B;  5IOY A;  3S3M A;  4ESF A;  2HI3 A;  1YTY A;  2BV6 A;  3DCF A;  4ZC3 A;  2X51 A;  2DMQ A;  4GYG A;  3TL4 X;  2ZB9 A;  3BP8 A;  5EG0 B;  4K2E A;  4RB3 C;  3ELK A;  4ZH4 F;  5K7H A;  2ZJR F;  3JRD A;  2O3F A;  1IRF A;  3MKZ A;  2PMU A;  4JOM A;  1VQK I;  3WU0 A;  3VDX A;  3HIF A;  3RYP A;  1PP8 F;  3CC4 I;  1A04 A;  3HOZ J;  1FSE A;  3J7A Y;  4A6E A;  3AG2 H;  3E6B A;  4G6D A;  3QOD A;  2M4K A;  3JRH A;  1T6S A;  3OL4 A;  3LAJ A;  4NQW B;  2LBF B;  5GPC A;  1IRX A;  4B1R A;  4BHP A;  1MMA A;  1OCZ H;  2E1O A;  3IWZ A;  4Y3O A;  3W3C A;  4MIM A;  2VJI A;  3ML6 A;  3PJR A;  5LEK A;  2V1U A;  1MMN A;  3V42 A;  1KU2 A;  1SVO A;  5FKN A;  1X58 A;  3VB2 A;  1R58 A;  1YIJ I;  1J9I A;  1R1V A;  3BC8 A;  1YW9 A;  3TOA A;  2HKX A;  2E5N A;  2D1H A;  1TLH B;  1ULY A;  4B47 A;  1BM9 A;  1EKE A;  2A6T A;  1IRZ A;  4MTE A;  4WK8 F;  3M8J A;  5H6Q A;  3TO9 A;  2CG4 A;  2VKE A;  4QLC U;  3M4O J;  4XQF A;  4X1E A;  3ZQG A;  4HRI A;  2LF8 A;  3HSR A;  1VZ0 A;  3TW7 A;  2O8K A;  2CH0 A;  4EJV A;  2LK2 A;  4GGG A;  1HW5 A;  4BXU A;  2VJ5 A;  2XSD C;  3IRR A;  3T8R A;  4DYR A;  2MH2 A;  2A3S A;  3HXL A;  3WTY C;  1I27 A;  2PG4 A;  3BG9 A;  2CU7 A;  3KP5 A;  4CIC A;  1Z67 A;  4B3X A;  2F5C A;  5BS6 A;  5D4S A;  4L9T A;  5FB2 A;  2O0Y A;  2VKD A;  4XSX F;  1D5V A;  3RDI A;  2F5F A;  3CMM A;  3RTR A;  1VQ5 I;  4HX7 A;  4A6D A;  3G1O A;  3IH3 A;  3VYS B;  5CVJ A;  2KIF A;  3PNY A;  2VB6 A;  3PL8 A;  2XAQ A;  4ZYE A;  2KDZ A;  2LH9 A;  4E7L A;  2FE3 A;  3VYR B;  4LMY A;  4AWX B;  5M3F J;  3QYB A;  3ERE D;  4CHU A;  2K7L A;  1UG2 A;  3HSE A;  3DPT A;  4MFD A;  3PFI A;  1S29 A;  3I71 A;  2P4W A;  1TC3 C;  3QPH A;  5FKM A;  3HHH A;  2VT3 A;  3WOD F;  2FD5 A;  4JP0 A;  3J80 Z;  4KIC A;  5HNH A;  4ON0 A;  3IHU A;  1Z6T A;  2A61 A;  2D5V A;  4BYY A;  1XPX A;  2NOG A;  2DFF A;  1EH6 A;  5FD5 A;  2NVU B;  3L2R A;  4FIS A;  2KIQ A;  1ZQ3 P;  3GLL A;  3QPT A;  1Y1V J;  3CUQ B;  3JCU C;  2VOD A;  3G1L A;  4OAZ A;  1LKX A;  2W25 A;  4XLE A;  3K1N A;  3DEE A;  2WV0 A;  2QBY A;  2X6Y A;  1MNE A;  5IP9 J;  3IC7 A;  3JRA A;  4EMS A;  1YYV A;  2L0K A;  1IN6 A;  2JRM A;  1HA8 A;  1RPW A;  1IXC A;  3O3K A;  1ETW A;  3GTP J;  1OLT A;  3DKY A;  1HXD A;  1ETV A;  2GBY A;  3VOD A;  4GDF A;  4KN4 X;  2K5C A;  3F8N A;  3TKY A;  3PIP F;  5IPA A;  2KP6 A;  1TNT A;  3BR2 A;  1QVU A;  3CDH A;  3D0S A;  3KLO A;  5HOD A;  2X1C A;  3K2Z A;  2PJP A;  2CO5 A;  2RKH A;  1MBK A;  5DYM A;  1TQM A;  3S93 A;  1JHF A;  4OAY A;  4XL9 A;  3PUF A;  2GM4 A;  1MGT A;  1HOM A;  4PJM A;  3R6S A;  4OIN F;  2DOF A;  2L9V A;  2P81 A;  3W6J B;  3FBI B;  3MKL A;  2R4G A;  1RUN A;  2UV1 A;  3W6K B;  2DI3 A;  4U0Y A;  2L7K A;  2QM3 A;  4R1H A;  3EYI A;  3ZMD A;  2ZC2 A;  4L0Y B;  2TDX A;  3J81 K;  4XLF A;  4G8X A;  5TIS C;  1YI2 I;  4ZYH A;  3N05 A;  1IN5 A;  1R5I D;  4X0G A;  2Y75 A;  3HRU A;  5E1Z B;  2UWM A;  4XKW A;  3SFI A;  1SMT A;  1GVJ A;  2KIU A;  2M45 A;  3DFG A;  2CSO A;  1J75 A;  3GTG J;  4RGR A;  3ZP5 A;  1TNS A;  1R71 A;  1MBE A;  3RYR A;  3LST A;  1Q1V A;  2DA1 A;  2HZD A;  3LSH A;  2R7S A;  3LSG A;  2DOE A;  3KCC A;  2NS7 A;  4BJT A;  4UVB A;  2EIN H;  2IRF G;  3OV8 A;  2ZSH B;  1FZP B;  2H6C A;  2EZI A;  1WJD A;  2MH9 A;  1RET A;  3S32 A;  2GA1 A;  4U0W A;  1GUU A;  2WAD A;  2WA0 A;  3IKT A;  3Q0W A;  1Q1H A;  2FA5 A;  3I0T A;  1QPI A;  2RNG A;  5H20 A;  3M9A A;  4C3H J;  2F5E A;  1KU7 A;  2E1M B;  1OCT C;  2X1E A;  4V19 K;  2JUC A;  2A5W A;  2P5V A;  5J1R A;  2QSH X;  1JTX A;  3SZT A;  2DA3 A;  1O7L A;  2ADU A;  4OIO F;  3HUG A;  2EIJ H;  2KMU A;  4Y13 A;  1JUP A;  4L18 B;  1MNM C;  3KZY A;  4HW0 A;  2EFN A;  1LUJ B;  2JTV A;  1NTC A;  1SD5 A;  2QCO A;  2DDB A;  3H5R A;  3ZGK A;  3FMS A;  3MKW B;  1T39 A;  1WSU A;  3F0C A;  1QNT A;  5LGT A;  4EV0 A;  1R5H A;  3HB9 A;  1D8K A;  1ETY A;  5DD8 A;  2LKP A;  3GLX A;  2B63 J;  3S3O A;  3Q9V A;  5E18 F;  2QQB A;  3BOQ A;  2EV0 A;  1SC7 A;  1AKH B;  2AXT C;  3ONQ A;  2COB A;  1YQA A;  3G1M A;  1PVE A;  4N4N B;  1B8I B;  2DLL A;  1HF0 A;  3P9K A;  3FM5 A;  3JRG A;  3CF5 F;  1YRN B;  4A12 A;  2M2E A;  2GWR A;  4CCN A;  3S1M J;  1X19 A;  2ELH A;  2K4J A;  3BRO A;  4I02 A;  4LOC A;  2O03 A;  3ZCO A;  4BY7 J;  2VXD A;  2WB1 A;  1MKM A;  4U88 A;  2VC0 A;  1R49 A;  3U2R A;  1WKM A;  3D5R C;  3A0H C;  4CYC B;  3CJN A;  3QU6 A;  1XSX A;  4FAS D;  4KIF A;  2MBF A;  4EM2 A;  1SVL A;  2N8G A;  3H0D A;  1OYW A;  3HOX J;  1G8X A;  3D5S C;  3KZZ A;  2XRN A;  2MC4 A;  4IJA A;  2KFD A;  2DO7 A;  5E20 A;  2OQG A;  3P7N A;  1TWC J;  1U9N A;  2PFB A;  5EG0 A;  4C2U A;  3I53 A;  4BE1 A;  1ODD A;  4BUP A;  2HPM A;  1EV7 A;  2DA4 A;  4B3A A;  5CLS A;  4A3I J;  1VQO I;  2DQR A;  4A3F J;  4I2O A;  2EZL A;  1J7K A;  5FO5 A;  4RM3 A;  1KQ8 A;  3WE3 A;  3BR6 A;  4PFP A;  4RBO A;  2VBX A;  2VQG A;  3MEX A;  4W97 A;  2V6E A;  3JAM K;  2IS6 A;  4DNC A;  1X2N A;  5HDG A;  2DW4 A;  1ZH5 A;  1JT6 A;  3CCY A;  3E5U A;  3FK6 A;  3DLA A;  2BHZ A;  3UR3 C;  4KYW A;  2TCT A;  2LBF A;  5K5Q A;  1ZKG A;  4GCV A;  2L4A A;  2AQE A;  1S8N A;  1AA7 A;  3JSP A;  5ERI A;  1JKO C;  4RGX A;  5L3D A;  4AYB N;  5K5R A;  5HVQ C;  4RDU A;  3GFI A;  1S9H A;  3BPV A;  2EQR A;  3U9G A;  1IN4 A;  3DBH B;  4J19 A;  3OYG A;  4BDY A;  4H0E A;  2A05 A;  4ENN A;  1TBX A;  2LRE A;  3CES A;  3SZP A;  1ZN2 A;  3DTK A;  2HS5 A;  2GA2 A;  2HKO A;  4PDK A;  3ZN1 A;  3VYU B;  1NG7 A;  2CMP A;  4XBF A;  4XID A;  2DT7 B;  4CCK A;  2ZSI B;  3F23 A;  1IGN A;  1MD0 A;  1XG1 A;  1H8A C;  2QQ9 A;  1DU6 A;  2XKO A;  5IYB J;  2RAE A;  3SDG A;  2DK5 A;  3HSF A;  2DN0 A;  4M3B A;  5IT9 K;  2MD5 A;  3FX3 A;  1IDZ A;  2E2H J;  1LPQ A;  2E7X A;  2YSR A;  2QGU A;  2YUS A;  5EEG A;  1SAU A;  2JA8 J;  3KPH A;  1B6A A;  4F55 A;  4PUS A;  1ZGJ A;  5F0H A;  2BYV E;  3CUQ C;  5FRN A;  2P6T A;  3V7C A;  4B4C A;  3BZC A;  1MBJ A;  1O3S A;  2XGD A;  1J2X A;  1YOV B;  2P8T A;  2Q2E B;  1DPU A;  5B5E C;  1IXS B;  2PMZ A;  2GOX B;  2FQ3 A;  1W1W E;  1ZTR A;  2HOS A;  3KE2 A;  2XUB A;  2I8D A;  3MZH A;  3WE2 A;  2JA2 A;  2LNB A;  4IL6 C;  2BVM A;  3C7J A;  2J5P A;  2E7W A;  2EB7 A;  2FOW A;  2M9H A;  4G9Y A;  1T38 A;  1P92 A;  4XLA A;  2E19 A;  3BTL A;  3CO6 C;  3QQA A;  3H3Z A;  4XRM A;  5EZH A;  4M9Z A;  2QSF X;  3TOB A;  4FTH A;  2VL8 A;  3CUQ A;  1GXQ A;  4LIU A;  1RC9 A;  2CW0 F;  1JGG A;  2VBW A;  5F64 A;  3QPL A;  2CV0 A;  4Y33 A;  1G6N A;  1U3E M;  1VTN C;  2FF4 A;  1XSD A;  3RSN A;  4MEX F;  4DYQ A;  1H89 C;  3C2G A;  4V2G A;  4BJ6 C;  1FBS A;  1TW3 A;  3G3Z A;  5HS9 A;  1AOY A;  1K6Y A;  2BY2 A;  3IV5 A;  2OZ6 A;  3FXU A;  1G3T A;  3V8J A;  2ZXH A;  1A35 A;  4GRI A;  3KLN A;  1BR2 A;  2R7O A;  2R5Z B;  4I76 A;  5LRS A;  3B73 A;  4RGU A;  4BU2 A;  1S6L A;  3GBG A;  2VQL A;  1LNW A;  4UXN A;  4UVC A;  4EAT A;  4NC8 A;  1U0J A;  4UHT A;  5JLW A;  1MJB A;  2NXN B;  3I55 I;  3QYE A;  2D2W A;  3FDY A;  4ITV A;  3E6M A;  3WTV C;  4QTR A;  1SMY F;  1UEL B;  2LY2 A;  4M3F A;  4N4O B;  4L5E A;  4XMY A;  1ZYR F;  2DMP A;  2E1M C;  4GXO A;  2V26 A;  5KAI C;  1JTY A;  2IGN A;  3TW6 A;  4MTD A;  2NVY J;  3PSI A;  2X85 A;  2PLY A;  3EUH C;  1WGX A;  2KQR A;  1VQ6 I;  3W2V A;  2IPQ X;  4S04 A;  1UB9 A;  4KT6 A;  1UAA A;  5BNG A;  3LSM A;  2PEX A;  2XAU A;  2EIM H;  1F4K A;  2M7B A;  2IA1 A;  2PN6 A;  5AIQ A;  1OR7 C;  3HL2 A;  3RI4 A;  4FT8 A;  3FHZ A;  2OU2 A;  2RDP A;  3OL3 A;  1FYL A;  4AIH A;  1HDD C;  3DLL F;  3TBI A;  1V55 H;  1KYW A;  2KZV A;  2X1D A;  3AFH A;  4XRS G;  3J7A O;  1VQ4 I;  2OUM A;  9ANT A;  2E1C A;  1HKQ A;  3FXM A;  1G2H A;  1QRY A;  2Q1Z B;  1UHM A;  3DU6 A;  4LD5 A;  4EQQ A;  3GTM J;  4LFU A;  3HPG A;  1MSE C;  3TP0 A;  1YLF A;  2PJR B;  2V1D A;  1X2M A;  1H9T A;  1RI7 A;  5L3B A;  1AHD P;  2WAF A;  2NVX J;  3KP6 A;  1F9N A;  1W0T A;  1LFP A;  3EUH A;  5IYD J;  1MBF A;  4S0H B;  3CCE I;  2M34 A;  1XN7 A;  1MDM A;  1W4M A;  4RA2 A;  2CQ7 A;  1YE9 A;  4OMZ A;  2YU3 A;  2V1N A;  2YS9 A;  2KLO A;  4KIG A;  4RS8 A;  2DBB A;  3GXO A;  3ZN0 A;  4LIV A;  1OR7 A;  1ZHF A;  3VSK A;  3RKQ A;  1BIA A;  3L9F A;  1WJ5 A;  1IG7 A;  3A01 B;  2KHM A;  1E3O C;  2XDV A;  1OPC A;  3BR1 A;  1VQL I;  3KEQ A;  3LSJ A;  3ZMS A;  5HLH A;  2OTL I;  2IXS A;  4BBR J;  1P7I A;  1FIA A;  2V4J C;  1X4P A;  4IEJ A;  3ZMT A;  1PUF B;  1PJR A;  4KFC A;  4BEH B;  4ZDP A;  2HU9 A;  4F7Z A;  3OS2 A;  2WAQ N;  1B8I A;  4U0V A;  3F8B A;  2DU9 A;  4BE2 A;  1K79 A;  1VQ9 I;  3GF2 A;  3CC2 I;  2OBP A;  3HKZ N;  2HOT A;  2BEO A;  1Z7U A;  1W7P B;  4Y4R A;  2O61 A;  4U87 A;  1XMA A;  3T8T A;  5J1U A;  4CYC A;  5IOZ A;  3JTG A;  4NUB A;  2CW7 A;  3R0J A;  3CCS I;  2V6C A;  3FIS A;  2EZK A;  3H5A A;  2LDU A;  3B6C A;  1KQ0 A;  3REO A;  3E0J B;  2LD5 A;  3L2Q A;  3ISP A;  2JMW A;  2M0C A;  1ERD A;  4C3I J;  1HLV A;  3DKX A;  3U21 A;  1T0F C;  4A0X A;  1WJF A;  4WXH A;  3QOE A;  4LG3 A;  5AIP A;  5DEQ A;  4UUV A;  1FOW A;  4A3G J;  1POG A;  2HZT A;  2M30 A;  3DPL C;  1E17 A;  4WWC A;  3H1C A;  4F52 A;  4O5V A;  3FXR A;  4ZDL A;  4F93 B;  3NAR A;  5M5W J;  1H9G A;  4IRG A;  3RKY A;  2XB0 X;  4XKB A;  1SFK A;  1W7P D;  2B9S A;  3KP2 A;  3HEF A;  3NEU A;  4NHJ A;  3TO6 A;  1XD7 A;  2BW3 B;  2FBK A;  1U6G A;  2IGM A;  3GEZ A;  1HST A;  4E7Z A;  4G7H F;  5KCM A;  2R0Q C;  1UG0 A;  2EWN A;  1E3H A;  4C9Y A;  4BAC A;  1K61 A;  5FLV A;  2JJ7 A;  2EA4 A;  1X3Z B;  2HXI A;  2W57 A;  2BOL A;  1A31 A;  1TP4 A;  3GVA A;  1DGW Y;  3C2B A;  3I54 A;  4UB8 C;  3OSF A;  4C3J J;  1BI3 A;  2F48 A;  4UUS B;  4E7S A;  2NS8 A;  3K1M A;  4ABZ A;  4V2F A;  2IP2 A;  4B43 A;  4U7D A;  2ESN A;  3F21 A;  5E8G A;  2HQ5 A;  3S1N J;  4ZYA A;  4EJO A;  2WY8 Q;  4M9S A;  5B1A H;  4PJ0 C;  1Y6I A;  1SD7 A;  2F4M B;  4WX9 A;  3E7L A;  1IJW C;  4P9F A;  5E17 F;  1RRJ A;  2PQ8 A;  1GLN A;  5GPA A;  1OCP A;  1QU3 A;  2HYJ A;  2PX9 A;  5KNL A;  2XAG A;  4MHG A;  4DW6 A;  1JUS A;  3H3U A;  5KAF C;  2MFZ A;  3S3N A;  4BNC A;  3OIP A;  3MAJ A;  4HQE A;  1J5Y A;  3VPR A;  2Q2E A;  2B7E A;  4P5O A;  2XAS A;  4JX6 A;  1IRG A;  2VT2 A;  4RAY A;  1SAX A;  3NAU A;  4XOP A;  1DDN A;  1VQP I;  4ZYD A;  2H94 A;  3D1N I;  3S2D J;  5LHI A;  3WTU C;  2A6E F;  4XNF A;  1KQ9 A;  2Y0S A;  2YR2 A;  3VWB A;  1ETO A;  2H09 A;  4FX0 A;  2L7Z A;  3ABT A;  2XGX A;  3F6O A;  1LE8 B;  4FHT A;  1D1B A;  5IP6 A;  3BR0 A;  3Q9S A;  3TGN A;  5FJ8 J;  1BW5 A;  4ZZD A;  1E2X A;  3H9Q A;  3HM5 A;  3DTI A;  2JUG A;  1Y0U A;  3PUB A;  4XR6 A;  2QZ8 A;  1HBX G;  2COM A;  2LOO A;  3F8C A;  1BR4 A;  1TWF J;  2R5Y B;  1ORK A;  3B02 A;  2QEX I;  2A69 F;  2DA5 A;  2H1L A;  5KK1 A;  3K4C A;  2K02 A;  1IZ1 A;  2X6O A;  2JA7 J;  2FXA A;  1PYV A;  4FE7 A;  1IN7 A;  4PK4 A;  4EJW A;  5B66 C;  2DOD A;  5HDK A;  2L7M P;  2JQ7 A;  1R23 A;  2XHK A;  1B59 A;  1YS6 A;  2K9L A;  4JK1 X;  2XB5 A;  1XGM A;  3L00 A;  2RQP A;  5LLQ A;  1WQ2 A;  3K4B A;  2VI6 A;  2M8G X;  5J1Y A;  2H8R A;  3FZV A;  5E1W A;  3KP3 A;  3P9C A;  2X9D A;  3KP4 A;  1UZC A;  4C2T A;  2VKH A;  2JT1 A;  3WG9 A;  1ZRD A;  1UMQ A;  2WAE A;  3G71 I;  1MJ9 A;  1ZAO A;  3GTO J;  3MZY A;  4I09 A;  3T0Y A;  3WG7 H;  4DGW B;  2NRA C;  2Z3Y A;  3QWL A;  3V8K A;  2Q8K A;  1XMX A;  4CUG A;  4Y52 J;  3GFL A;  5K7F A;  3OYM A;  1X1P A;  2NS0 A;  1ITY A;  4OMY A;  5FRM A;  1G3W A;  4XSZ F;  4A0Y A;  3UKG A;  1WFX A;  2ZXI A;  3MKY B;  4OWR B;  2GOM A;  2G9W A;  3COA C;  2MA3 A;  4PCQ A;  1G3Y A;  2K3F A;  2K4B A;  1R36 A;  4XKC A;  3P5J A;  4G7O F;  3R0A A;  1EJ9 A;  3BR5 A;  3OYC A;  2ID3 A;  1JKQ C;  4XM3 A;  5A2Q K;  3K4J A;  1BI2 A;  4DQ2 A;  1U9O A;  4M74 A;  2AS5 F;  5F27 A;  1TT5 B;  1XGO A;  2ZME B;  1BC8 C;  2ZXW H;  3I3L A;  1KON A;  1YIO A;  2VBY A;  2L02 A;  1O57 A;  3QPS A;  2XF7 A;  2ZKZ A;  4HYE A;  3OYH A;  5EDN A;  4IHX A;  4LIT A;  2EFQ A;  2R7D A;  3OIQ A;  2NNN A;  2PJR A;  4Z2Y A;  5D8L B;  3E5Q A;  3HRM A;  5CQE A;  5J47 A;  4IHY A;  1YJ9 I;  1BI1 A;  5ILV A;  1RNL A;  3DBL B;  2L9N A;  4BHC A;  1MBH A;  4L9N A;  2RV8 A;  2X6X A;  4EJT A;  1LDD A;  3CZ6 A;  3CJR B;  3F9K A;  1CGP A;  2VBZ A;  3DP7 A;  4IVN A;  4DIQ A;  3MN2 A;  1HC8 A;  4WCG A;  3LSR A;  3OWT A;  4Q5S F;  3A01 A;  1OCO H;  4BY1 J;  3M1C A;  1JKP C;  2W1O A;  3OS0 A;  2GXA A;  5F0C A;  4HLY A;  2R7F A;  2JA6 J;  3I59 B;  3FXJ A;  3LMM A;  5LHG A;  4XIC A;  5D5V B;  3JRE A;  4F3Q A;  1PUF A;  3A0B C;  4X6A J;  2IEK A;  1QZE A;  1TW2 A;  1JJ8 C;  3CCR I;  3RIR A;  1XMK A;  2DJN A;  1K78 B;  1XC5 A;  4N9I A;  2CUF A;  4DOZ A;  5LHH A;  2W7N A;  1HKS A;  3HRS A;  4EGZ A;  5EGO A;  4EM0 B;  3WU1 B;  1ZAR A;  1W7P A;  2FBH A;  3QAH A;  1AWC A;  1D0Z A;  4G6T B;  3BLY A;  1QGP A;  3IH4 A;  2E35 A;  1NH3 A;  3BY6 A;  1ZLK A;  5HOO A;  4IZZ A;  2R7X A;  1SD4 A;  4D1Q A;  2FNP A;  4NNJ A;  1QQI A;  3KYC B;  2K86 A;  1D3Y A;  1ZG5 A;  3GFM A;  1ON2 A;  1ZRF A;  4KT5 C;  3HOT A;  3AKZ A;  4KMU X;  2NAZ A;  3BCA A;  3BR3 A;  3I58 A;  3UNG C;  3DQV C;  4CDG A;  1IC8 A;  2R93 J;  3CME I;  5CVV A;  3JW4 A;  3OMY A;  4YIR X;  3GTK J;  2NVT J;  1K7A A;  2EZH A;  3HPH A;  3DBR B;  3KZI C;  3ECH A;  4OIR F;  3SHF A;  2FUG 2;  3WTS C;  3HGY A;  2MC3 A;  1TL8 A;  3K1P A;  3DU5 A;  4E4H A;  4G12 A;  3DXJ F;  3OY9 A;  2F2E A;  5FD6 A;  4AC0 A;  2VE9 A;  4XON A;  4P9U A;  2KJB A;  4BDZ A;  2RNJ A;  3M1E A;  1IXR C;  1MMS A;  3LWF A;  5D5X B;  1UCR A;  5ICG A;  2E60 A;  3ZQH A;  4ENK A;  2HYG D;  3KX2 A;  3I9V 2;  2MG4 A;  5E3M A;  3J7Z I;  1FYM A;  4RAF A;  3ZMZ A;  2BW3 A;  3LA7 A;  3LFK A;  4WF2 A;  1JI8 A;  4IX7 A;  1G4D A;  4AD9 A;  2QQA A;  3BZ6 A;  4B8X A;  3J7Y J;  5CPR B;  3BJO A;  3VEP A;  2BZT A;  2EBI A;  2L4M A;  3OYN A;  2GIZ A;  2KZG A;  2L9R A;  3BQY A;  1WCM J;  3K7A J;  3ULQ B;  4UV9 A;  1ZEL A;  1JKR C;  3DEU A;  2JWT A;  5EF6 A;  1E0E A;  3C1D A;  2IS2 A;  4RAZ A;  4IHW A;  3RZD J;  5J4V A;  3MMY B;  1FPQ A;  4RB1 A;  4UUS A;  2CUZ A;  2AQF A;  2Z33 A;  2CFX A;  3OSG A;  3BZK A;  3F6V A;  4BJ5 C;  1R1U A;  2EFW A;  1ZK8 A;  2WB1 N;  4QIW N;  3AL0 B;  2H27 A;  4L0Z B;  5H2F C;  3FWE A;  4M3D A;  3TQN A;  4E6K G;  1WHU A;  4OIQ F;  4D0P A;  3LQQ A;  1LEA A;  2O6G E;  4NQW A;  1YJN I;  2DMU A;  3EUA A;  4N0B A;  3SZG A;  3BT9 A;  2YX7 A;  4HPQ A;  5LBQ A;  2UZK A;  3WGG A;  4BBS J;  2QQ8 A;  3CLQ A;  4NB5 A;  4D5F A;  3EPZ A;  4B09 A;  2CUE A;  3CCU I;  3TED A;  4KIS A;  1BOA A;  2HR3 A;  4XKV A;  1N75 A;  5E1X A;  4BHB A;  3KYD B;  2HVS A;  3DKW A;  3GX4 X;  1B9M A;  1FWZ A;  1FTT A;  1FMV A;  2EIL H;  3ERM A;  4J00 A;  3L2U A;  4E70 A;  1Z77 A;  5IP7 J;  5J8F A;  3M8E A;  4AID A;  1Y39 A;  4CO8 A;  4OU0 A;  3GWZ A;  2WY7 Q;  2X6W A;  1WJE A;  5J3L A;  1HKT A;  2NVQ J;  1NG6 A;  1LE8 A;  3OYJ A;  5BPI A;  4IQ4 A;  3CMY A;  1BI0 A;  1O4X A;  1JT0 A;  4QWQ A;  3OYB A;  1BIB A;  2XIG A;  4IF4 A;  1HW1 A;  3HTS B;  3QP6 A;  4YIF A;  4M3E A;  2R5Y A;  2JA5 J;  1FNN A;  3OYK A;  2OJE D;  1BOB A;  2JZY A;  1A6I A;  2XAH A;  3S17 J;  3NQO A;  3CCL I;  2LY9 A;  1CQT A;  5D6F A;  5TRD A;  1OKR A;  1WJB A;  2LKS A;  2R7Q A;  1ZGA A;  3MQ0 A;  4GO1 A;  1LDK B;  3HOW J;  2L3D A;  2Y69 H;  4BXX J;  3U1D A;  4ENM A;  3LFU A;  2P7C B;  3AAF A;  2XKP A;  2VQH A;  2DJI A;  2VOO A;  4NDL A;  2IS1 A;  3O8G A;  3PFY A;  4A3M J;  4IHS A;  2DA2 A;  1U8R A;  1Z05 A;  3FHN A;  2X48 A;  3O2P E;  1MBG A;  1QZY A;  3ASN H;  4A3K J;  1ZRE A;  5B1B H;  4BQA A;  4RM2 A;  2XGC A;  3JSO A;  2O9L A;  2WV1 A;  1VQ7 I;  2XAJ A;  2ZME C;  4DBQ A;  5LGU A;  3HZJ A;  2BXZ A;  1FC3 A;  1XX5 A;  2DMT A;  2LYC A;  2EJR A;  3K9T A;  3VYT B;  3JRI A;  3EQL F;  4HZF A;  5FGM A;  2PMZ N;  1MZB A;  2H8W A;  2OZU A;  1XCB A;  2V7F A;  1ETX A;  4HX8 A;  3PIO F;  2LF7 A;  1YIT I;  2QKL B;  1X3U A;  2DYR H;  3M7G A;  1T33 A;  2W00 A;  5CYV A;  5LGN A;  4U7B A;  1VQM I;  2PI0 A;  1XB4 A;  3G73 A;  3C3W A;  2YX4 A;  3FXL A;  5K5O A;  1KYZ A;  1OCC H;  3CDI A;  3BTJ A;  4XRF A;  4CGZ A;  4PGG A;  2HQR A;  2LSO A;  4M6X A;  1R22 A;  4XLC A;  5A2Q Z;  3PNT A;  4JYK A;  2VC1 A;  2IBD A;  1S3J A;  1MMG A;  1IO2 A;  1WVR A;  4I7H A;  4M71 A;  3GW2 A;  1TWA J;  3WTX C;  3BG3 A;  4AVZ A;  3WHB A;  2RVC A;  1APL C;  3HOV J;  4M6V A;  2Z99 A;  1JE8 A;  3ABK H;  1I50 J;  3RZO J;  1RES A;  4XRS A;  3CCV I;  1WJC A;  1EH8 A;  4A0Z A;  1QPM A;  3L2W A;  3LSI A;  3C2H A;  4II2 A;  3J81 Z;  4UUT A;  2ME6 A;  2IGK A;  2DA6 A;  1D1A A;  1T98 A;  3MZ8 A;  4AU7 A;  3H35 A;  1KU3 A;  3ZRG A;  1I39 A;  1DPR A;  1HW2 A;  4XLN F;  3OYA A;  2CRG A;  5J8C A;  4N9H A;  2NOJ B;  5E79 C;  3IWF A;  3TDU C;  2DTR A;  2VPR A;  1FEX A;  3FBN B;  1R1T A;  3JRF A;  2WWY A;  1MIJ A;  2QBY B;  2H6B A;  2VXZ A;  2ISZ A;  2Z2S B;  1JXS A;  1S5L C;  3L7W A;  1P9Q C;  1W5S A;  4BE0 A;  5F1R A;  2HOE A;  4Q47 A;  1IN8 A;  3S8P A;  1R00 A;  3I4N J;  1F1Z A;  3CO7 C;  2VPL A;  3ABM H;  4JQF A;  3VFZ A;  1GV5 A;  2CQQ A;  1J0R A;  4XN0 A;  5KVR A;  3I64 A;  2A07 F;  2RC4 A;  3HBL A;  2LLK A;  1B72 B;  2ISY A;  5D6E A;  2KRF A;  2KPM A;  3FIW A;  2F5D A;  1MND A;  2E71 A;  3PO3 J;  1K78 A;  1WWX A;  2XF5 A;  1OQY A;  2EV6 A;  1BJZ A;  5M5X J;  4MFE A;  4I0B A;  1ACI A;  3IAM 2;  4LB5 A;  3Q0V A;  1VND A;  5JHU A;  4HLX A;  3I4P A;  2XRL A;  1I1G A;  3FXO A;  1FOX A;  2Z1D A;  1FTZ A;  1FT9 A;  2LTP A;  1TT0 A;  4PSX A;  4S05 A;  2OF7 A;  1OYI A;  4G94 A;  2Z16 A;  4AIJ A;  2EA2 A;  4AUX A;  2GAU A;  2VQC A;  1AKH A;  2BY1 A;  3LSP A;  4TV7 A;  2STW A;  5FKO A;  1Z3X A;  3BCB A;  3GME A;  3JRC A;  2PMH A;  2LP0 A;  1FOY A;  1LVK A;  3RPU D;  4RLF A;  3OOP A;  5C4J J;  1YRN A;  4BKX A;  5F1J A;  1FLI A;  3ZQI A;  1JJ6 C;  3AL0 C;  3G2B A;  5J40 A;  3HOY J;  3ZQF A;  2UXX A;  3CCJ I;  1RR7 A;  2FU4 A;  2YU9 J;  3RJP A;  1TWH J;  3CP2 A;  1ETQ A;  1BBY A;  1BN5 A;  3LAP A;  2C6Y A;  2BVL A;  3ZR8 X;  3QYF A;  3OR2 C;  3OS1 A;  5LEJ A;  3E1S A;  5FKL A;  3LL7 A;  1FY7 A;  2ESH A;  3ZXS A;  3S15 J;  3BJA A;  5D4R A;  4A93 J;  2ETH A;  2CQX A;  2VAS A;  2D1V A;  1P4X A;  1T08 B;  2VE8 A;  5HLI A;  5GTI C;  3KYL A;  2EFO A;  3TMO A;  1ZRC A;  1I3Q J;  5FLX K;  2OPT A;  1D5Y A;  1T56 A;  1X1B A;  2I10 A;  5AON A;  3JAM Z;  1BC7 C;  1A36 A;  5JFR A;  1N78 A;  1V54 H;  3C18 A;  3CJT B;  1M1E B;  1Y56 A;  2Y0M A;  4QPQ A;  2ZXJ A;  2DDA A;  3CDL A;  1FSH A;  3HTU A;  1QHH D;  3R61 A;  3KEY A;  2JPB A;  1DU0 A;  1PP7 U;  3LQR A;  2DQL A;  3TDZ C;  4L5J A;  1Y0N A;  1MH3 A;  1UHS A;  4CCM A;  2CW8 A;  5DM7 F;  4MO7 A;  2NYX A;  2BXY A;  4ETS A;  5KHD A;  1IAW A;  4P96 A;  2E2I J;  2ID6 A;  3BTC A;  2Y30 A;  3R60 A;  4KMF A;  4ZJZ A;  2PBI A;  1QHG A;  2EH3 A;  5L3G A;  1SEU A;  1N25 A;  4HV5 A;  5TGT A;  3E6C C;  3HOS A;  2JVH A;  1VFC A;  1T0F A;  3M07 A;  3PQJ A;  1TZL A;  5ILS A;  5FFX A;  1GVD A;  5H6R A;  2XSJ C;  4CA0 A;  1O3T A;  3KIO A;  3O6B B;  3W2A A;  3BJ6 A;  1K6O A;  1G59 A;  4Y15 A;  5BOX A;  2JPC A;  1FIP A;  2OQR A;  3HG9 A;  3OYD A;  3DV8 A;  3HC7 A;  3GTL J;  2ZNY A;  5IT9 Z;  2HQA A;  2XPW A;  5E3O A;  2DFI A;  2K40 A;  3WTZ A;  2EV5 A;  2CS3 A;  2MLG A;  1Z7L A;  1Z9C A;  1QO0 D;  1YX3 A;  3HDD A;  1XGN A;  4D9J A;  1IDY A;  1JGS A;  1KA8 A;  2GZW A;  4HV6 A;  2OV7 A;  3E97 A;  2RRE A;  2VN2 A;  2FEZ A;  3CQZ J;  1PUE E;  2OC6 A;  3ABL H;  4EVI A;  4AIK A;  4M3G A;  2MAB A;  4C30 A;  3DF8 A;  5E3N A;  2ECC A;  4PJL A;  1N77 A;  4BAY A;  1USS A;  2MSY A;  3BDD A;  3OR1 C;  4A3J J;  4DBR A;  4FX4 A;  3K70 D;  1I1S A;  2ELK A;  2ZNZ A;  2G7U A;  2JSP A;  4MQ9 F;  2DCE A;  4EEF G;  1D0X A;  4QPO A;  3GYH X;  2I5U A;  4LLN A;  4A3D J;  4PSW A;  3ZQC A;  4II3 A;  1UHW A;  4ZTJ A;  4MEY F;  3NWT A;  1FP2 A;  4G6Q A;  5JLX A;  4LLG F;  2R92 J;  3BQZ A;  1OCR H;  2V9P A;  1RZ4 A;  2XAF A;  3H36 A;  2OAZ A;  4RMN A;  4JX4 A;  3SEQ A;  1TQP A;  3LOC A;  4HSR A;  3L09 A;  2KRC A;  3F72 A;  5FRO A;  3CJQ B;  4MQV A;  3ROU A;  2BE5 F;  3DWL E;  2FMY A;  2EK5 A;  2W24 A;  1J59 A;  1DP3 A;  4HBL A;  4ZYG A;  2LMD A;  3V8L A;  1YW8 A;  1OJL A;  3NWS A;  1H0M A;  1RR8 C;  4IXA A;  1D0Y A;  4IRI A;  1TTY A;  4XLP F;  1XDU A;  3OYL A;  2DA7 A;  2F4O B;  2DOA A;  2P6S A;  1GDT A;  3HOU J;  3SXY A;  2GQQ A;  3ZMV A;  4KA4 A;  2Y0S N;  2V9V A;  2V9K A;  3TO7 A;  4ZTF A;  3FMR A;  1S7E A;  2Z5U A;  5FFZ A;  5K1Y A;  2R5Z A;  2VKV A;  2RQQ A;  3V4G A;  1SFO J;  2M4G A;  2QLZ A;  3H92 A;  5EJC A;  3S2H J;  2E1N A;  4M73 A;  2QYO A;  4ANJ A;  2HWV A;  2LFB A;  2ZJ2 A;  3IAS 2;  2VOP A;  1UFM A;  1ZGW A;  4KDP A;  4YRV A;  3FXQ A;  4PZJ A;  2P5L C;  3GCM A;  2R7V A;  5ED4 A;  4I98 B;  4NC6 A;  2KL4 A;  4RGS A;  2ECB A;  5D5W B;  1V3F A;  3A4C A;  2MW8 A;  3EET A;  2LG4 A;  2Z9O A;  3T1B A;  1J09 A;  3CCQ I;  3RQI A;  4UB6 C;  1IW7 F;  4RAG A;  1PDN C;  1P6R A;  1G3S A;  1V5G A;  5DCF A;  4G7Z F;  1LB2 A;  3HGG A;  3I56 I;  4C2M J;  3IL2 A;  1B4A A;  3W2W A;  5GTH C;  2A6H F;  2K9N A;  3ABU A;  1WJA A;  2K27 A;  4FET A;  4KN7 X;  3KEO A;  2ZJQ F;  4OIP F;  1BA5 A;  1YHQ I;  3ASO H;  1EF4 A;  3U1K A;  2F4I A;  3MD2 A;  3RPQ A;  4MLO A;  4LG0 B;  1QA6 A;  4YFN F;  4HDU A;  5DD4 A;  5HLG A;  2QSG X;  2GXG A;  1ENH A;  2X4H A;  4EJU A;  3JRB A;  4P55 A;  1T8I A;  5HDN A;  2XPU A;  2UXN A;  4CCJ A;  1U5T B;  1X3W B;  2A68 F;  5GAH J;  2DPD A;  4UNO A;  5TJJ A;  5E3L A;  1P7J A;  1U2W A;  1V5E A;  1ZR4 A;  2DK8 A;  4A3C J;  5DV5 A;  5C4X J;  1GT0 C;  1B72 A;  1IV6 A;  2A5Y B;  4LGW A;  4UY8 I;  3A1Y A;  3GZN B;  3HRT A;  1X4O A;  1H88 C;  1BR1 A;  2HNH A;  3RPU A;  2DTZ A;  1Z3Y A;  2WTE A;  3F8F A;  2DFH A;  3BG7 A;  2KIS A;  2IJL A;  1OYY A;  5DS9 A;  4HDV A;  2AO9 A;  4HNV A;  3L2C A;  1R9T J;  1YFH A;  3BG6 A;  2STT A;  2BY0 A;  5IY5 H;  3F22 A;  2BGC A;  3SDB A;  1BL0 A;  1YX5 A;  2F5V A;  5ILU A;  1I6H J;  2IS4 A;  1Y1W J;  1YW7 A;  2LVS A;  4CZZ A;  2P0W A;  2L5Q A;  1Z91 A;  1U78 A;  3CCM I;  3GTJ J;  2FJ1 A;  2FML A;  4I6Z A;  2GLO A;  2JSC A;  4W1U A;  5F6F A;  5C44 J;  4NBQ A;  1IUY A;  1W36 D;  3BWG A;  1IF1 A;  2ME0 A;  4H4K C;  4A3E J;  4HOB A;  4M6Y A;  3Q5F A;  5E8I A;  2G0E A;  4BEH A;  3CD6 I;  4KUM A;  1ZR2 A;  4LB6 B;  4HQM A;  2HEO A;  1W5T A;  2Y9Z A;  3G4S I;  1VF9 A;  2E34 A;  2QWW A;  4Y7N J;  2DXI A;  1CF7 B;  2VUM J;  5DCM B;  2DT5 A;  4JX5 A;  4HNT A;  2L01 A;  3FXK A;  3S2W A;  3HHG A;  5IT3 A;  3FM3 A;  5EZG A;  4BQN A;  3KET A;  2RN7 A;  1L0O C;  4IO9 F;  3FKJ A;  4AVP A;  3Q3S A;  5DDG A;  2H1K A;  2FX0 A;  2J5O A;  3R4K A;  3H0G J;  3A02 A;  5GAE J;  2K9M A;  3CMA I;  3MFK A;  3LNQ A;  3AG3 H;  4JBA A;  2CV2 A;  4WXD A;  4D5C A;  3OYI A;  1AU7 A;  2IT0 A;  4A69 C;  2XVC A;  3K4N A;  5L3F A;  4IOA F;  3A03 A;  2W85 A;  1MDM B;  5FLX Z;  3GZ5 A;  4XN3 A;  1S72 I;  1LEB A;  2GXB A;  5F04 A;  3K70 C;  1ONV A;  1RKW A;  2R3S A;  3Q0U A;  2R7W A;  4M72 A;  4E7I A;  5IYC J;  4KIB A;  1O3R A;  2KKO A;  4RB0 A;  3LA3 A;  3OYF A;  1ZLJ A;  4Q4Z F;  4KNY A;  2LRD A;  2XV4 S;  1V4R A;  1EA3 A;  1NK3 P;  1UJ8 A;  2RGV A;  2Q0O A;  2M87 A;  3H5N A;  1P2F A;  2HXO A;  1WI9 A;  1ON1 A;  4E7J A;  3SQN A;  2G7H A;  2LR8 A;  3HYI A;  2FSW A;  4UVA A;  1I6X A;  2OD5 A;  3QP5 A;  2IVM A;  4F91 B;  4IHV A;  2O8X A;  4A5N A;  4YFK F;  3T5X A;  1XS9 A;  2TRT A;  3BTI A;  5GAD J;  3O8H A;  1XSV A;  1Z0X A;  3ZQQ A;  2HQN A;  3H9G A;  2HTJ A;  1DGR M;  4D7N A;  3D5L A;  1KGS A;  5CVU A;  2W4S A;  3ZPL A;  2CV1 A;  2ACJ A;  2V79 A;  2HDW A;  4CSW A;  1LFB A;  1U8B A;  3BG5 A;  1STZ A;  2KDO A;  4AYB A;  4WXC A;  4CZC A;  1K4T A;  5FKK A;  3M8F A;  4IOC F;  2HYF A;  4LLL A;  4YII A;  3EUK L;  4YG2 F;  1HQC A;  1MSF C;  4DZP A;  4DYC A;  2EFP A;  2HTS A;  5EEH A;  3OIO A;  3S16 J;  1LQ1 A;  2R7Z J;  3WTT C;  4L9J A;  2CWE A;  4BGD A;  1R4M B;  3PO2 J;  4B44 A;  1RIO H;  4AM3 A;  4HA8 A;  4IRH A;  2M5W A;  1MH4 A;  1I3A A;  1WH5 A;  4I99 C;  3S14 J;  4R79 A;  3LSK A;  3IUO A;  2HGC A;  3OOU A;  5HS7 A;  2CQN A;  2MYS A;  4CYD A;  4UV8 A;  2QEN A;  2QKM B;  1QBJ A;  5JVG F;  4KJZ A;  1Z6R A;  3K4L A; 
#chains in the Genus database with same CATH homology
 2DPU A;  1LDJ A;  4Q48 A;  4BH9 A;  2CQK A;  2FOK A;  3WGI A;  3GFJ A;  3NRV A;  1MJA A;  2IA2 A;  5L3E A;  3EYY A;  1GXP A;  4L5I A;  1BJA A;  5JR3 A;  3SFZ A;  4I01 A;  5JVT A;  3KP7 A;  1B1B A;  1P4W A;  3N4M A;  3JTH A;  1FBQ A;  1P4A A;  3IRQ A;  3GZ6 A;  3QU3 A;  3FMQ A;  1SD6 A;  2NNY A;  3E3V A;  3CTA A;  4O6J A;  4ESB A;  2ZBK A;  3KFW X;  5CVR A;  3LA2 A;  4HF2 A;  2XRO A;  4HF0 A;  2JRT A;  1RUO A;  3GO5 A;  1LJ9 A;  3F8M A;  1U5T C;  2YPR A;  1YO5 C;  4MGR A;  1LVA A;  1OMI A;  4ZZL A;  1F5T A;  3ZQ7 A;  4EGY A;  4ESJ A;  3ECO A;  3VOE A;  2KJC A;  1R5G A;  3QRF F;  1KU9 A;  5DUI A;  4OOI A;  5CVI A;  1HSJ A;  1FP1 D;  2HFH A;  5LRR A;  2P7V B;  5ICC A;  1FYK A;  2D45 A;  4LG0 A;  2ZO4 A;  4RB2 C;  1FOK A;  5ICF A;  1FBU A;  3V7R A;  3F3X A;  4M9X A;  1U5T A;  2ZME A;  1L3L A;  1YS7 A;  3CLO A;  2OA4 A;  2IW5 A;  5BPD A;  3I5U A;  3V7S A;  2GIV A;  3J80 K;  3EDP A;  3CUO A;  5DUK A;  3IKV A;  2M8E A;  3K0L A;  2DAO A;  3P9I A;  2MLK A;  4A2U A;  4LK1 F;  1GHC A;  3MCZ A;  2AXL A;  5L3C A;  6PAX A;  4PGH A;  4IPA A;  3BPX A;  1O3Q A;  2KIM A;  4O3M A;  3I59 A;  1B9N A;  1SFE A;  1XDS A;  4YFX F;  4HAM A;  2B0L A;  5JI6 A;  1CF7 A;  5DCM A;  3E6D A;  4IHT A;  2V1X A;  2FBI A;  3ZMU A;  1S7A A;  3FF5 A;  5HS8 A;  5J6X A;  2FRH A;  3MWM A;  2CGP A;  1JHH A;  1C0W A;  2QUF A;  3GUD A;  3WGH A;  2M1B A;  1O7F A;  3QOP A;  1R7J A;  4A5M A;  2HDC A;  1Z1D A;  1DP7 P;  4R8H A;  5D8K B;  4ENJ A;  1S7O A;  5BQT A;  2BBY A;  4LK0 F;  3RKX A;  4GYI A;  5BMZ A;  5D5U B;  1SFX A;  1UST A;  4HF1 A;  5ICE A;  3WTW C;  1T2K A;  1ZG3 A;  2VON A;  1NHA A;  1EH7 A;  4ASN A;  1REP C;  3E5X A;  3PQK A;  1ZG1 A;  1XGS A;  3RKW A;  1YG2 A;  2P5K A;  4I0A A;  2W84 A;  2ZFW A;  2ZCW A;  4Y17 A;  1D8J A;  2Y48 A;  4HX4 A;  2QVO A;  3N97 A;  4CXF A;  1QZZ A;  2FNA A;  1TQI A;  2WC2 A;  3K69 A;  1WRJ A;  1XCV A;  4L9V A;  2X0L A;  4EM1 A;  4LJZ F;  1I5Z A;  5CJ9 A;  1SFU A;  4MNU A;  2L54 A;  1FX7 A;  1DUX C;  2CYY A;  2IA0 A;  4ESF A;  1YTY A;  2BV6 A;  4GYG A;  3BP8 A;  4K2E A;  4RB3 C;  3ELK A;  4ZH4 F;  2O3F A;  1IRF A;  2PMU A;  3WU0 A;  3HIF A;  3RYP A;  1PP8 F;  1A04 A;  1FSE A;  4A6E A;  3E6B A;  4G6D A;  1T6S A;  3LAJ A;  4BHP A;  3IWZ A;  3ML6 A;  5LEK A;  2V1U A;  1KU2 A;  3VB2 A;  1R58 A;  1J9I A;  1R1V A;  1YW9 A;  3TOA A;  2HKX A;  2D1H A;  1TLH B;  1ULY A;  1BM9 A;  4MTE A;  4WK8 F;  5H6Q A;  3TO9 A;  2CG4 A;  4QLC U;  2LF8 A;  3HSR A;  4EJV A;  4GGG A;  1HW5 A;  4BXU A;  3IRR A;  3T8R A;  2MH2 A;  2A3S A;  3WTY C;  1I27 A;  2PG4 A;  3KP5 A;  4CIC A;  2F5C A;  5BS6 A;  5D4S A;  4L9T A;  5FB2 A;  2O0Y A;  4XSX F;  1D5V A;  3RDI A;  2F5F A;  3RTR A;  4HX7 A;  4A6D A;  5CVJ A;  2KIF A;  2XAQ A;  4ZYE A;  2FE3 A;  4LMY A;  4AWX B;  3ERE D;  4CHU A;  2K7L A;  3HSE A;  3DPT A;  3PFI A;  1S29 A;  3I71 A;  2P4W A;  3QPH A;  3HHH A;  2VT3 A;  3WOD F;  3J80 Z;  4KIC A;  4ON0 A;  3IHU A;  1Z6T A;  2A61 A;  4BYY A;  1EH6 A;  5FD5 A;  3QPT A;  3CUQ B;  2VOD A;  2W25 A;  3K1N A;  2WV0 A;  2QBY A;  3IC7 A;  4EMS A;  1YYV A;  1IN6 A;  1IXC A;  3O3K A;  1HXD A;  3VOD A;  4KN4 X;  3F8N A;  3TKY A;  1TNT A;  3CDH A;  3D0S A;  3KLO A;  3K2Z A;  2PJP A;  2CO5 A;  2RKH A;  5DYM A;  1TQM A;  1JHF A;  1MGT A;  3R6S A;  4OIN F;  3W6J B;  1RUN A;  3W6K B;  2DI3 A;  4U0Y A;  2QM3 A;  4R1H A;  3EYI A;  3ZMD A;  4L0Y B;  2TDX A;  3J81 K;  4G8X A;  4ZYH A;  1IN5 A;  2Y75 A;  3HRU A;  5E1Z B;  2UWM A;  1SMT A;  1GVJ A;  2KIU A;  2M45 A;  3DFG A;  2CSO A;  1J75 A;  4RGR A;  3ZP5 A;  1TNS A;  3RYR A;  3LST A;  3KCC A;  4UVB A;  2IRF G;  3OV8 A;  1FZP B;  2H6C A;  2MH9 A;  2GA1 A;  4U0W A;  3IKT A;  1Q1H A;  2FA5 A;  3I0T A;  5H20 A;  3M9A A;  2F5E A;  1KU7 A;  2P5V A;  3SZT A;  1O7L A;  2ADU A;  4OIO F;  3HUG A;  4Y13 A;  4L18 B;  3KZY A;  4HW0 A;  2EFN A;  2JTV A;  1SD5 A;  3FMS A;  1T39 A;  1WSU A;  1QNT A;  5LGT A;  4EV0 A;  1R5H A;  1D8K A;  5DD8 A;  2LKP A;  3GLX A;  3Q9V A;  5E18 F;  2QQB A;  3BOQ A;  2EV0 A;  1YQA A;  2DLL A;  3P9K A;  3FM5 A;  4A12 A;  2GWR A;  2ELH A;  2K4J A;  3BRO A;  4I02 A;  2O03 A;  1MKM A;  4U88 A;  2VC0 A;  3U2R A;  1WKM A;  3CJN A;  3QU6 A;  1XSX A;  4KIF A;  2MBF A;  4EM2 A;  1OYW A;  3KZZ A;  2XRN A;  4IJA A;  2DO7 A;  5E20 A;  2OQG A;  3P7N A;  2PFB A;  3I53 A;  1ODD A;  1EV7 A;  5CLS A;  2DQR A;  4I2O A;  5FO5 A;  1J7K A;  1KQ8 A;  3WE3 A;  2VBX A;  3MEX A;  3JAM K;  4DNC A;  1ZH5 A;  5HDG A;  2DW4 A;  3E5U A;  4KYW A;  5K5Q A;  4GCV A;  2L4A A;  3JSP A;  1S8N A;  5ERI A;  4RGX A;  5L3D A;  5K5R A;  5HVQ C;  3GFI A;  3BPV A;  3U9G A;  1IN4 A;  4H0E A;  4ENN A;  1TBX A;  3SZP A;  1ZN2 A;  2HS5 A;  2GA2 A;  2HKO A;  4PDK A;  3ZN1 A;  4XBF A;  3F23 A;  1MD0 A;  2QQ9 A;  2XKO A;  2DK5 A;  3HSF A;  5IT9 K;  2MD5 A;  3FX3 A;  2E7X A;  2YSR A;  5EEG A;  1B6A A;  1ZGJ A;  2BYV E;  3CUQ C;  2P6T A;  3V7C A;  1O3S A;  1J2X A;  2P8T A;  1DPU A;  1IXS B;  2FQ3 A;  3KE2 A;  2XUB A;  3MZH A;  3WE2 A;  2LNB A;  3C7J A;  2J5P A;  2E7W A;  2EB7 A;  4G9Y A;  1T38 A;  1P92 A;  3CO6 C;  3H3Z A;  4M9Z A;  3TOB A;  3CUQ A;  1GXQ A;  2CW0 F;  2VBW A;  5F64 A;  1G6N A;  1U3E M;  1VTN C;  2FF4 A;  1XSD A;  4MEX F;  1FBS A;  1TW3 A;  3G3Z A;  5HS9 A;  1AOY A;  2OZ6 A;  3FXU A;  1G3T A;  3V8J A;  3KLN A;  5LRS A;  3B73 A;  4RGU A;  1S6L A;  1LNW A;  4UXN A;  4UVC A;  4UHT A;  1MJB A;  2D2W A;  3E6M A;  3WTV C;  1SMY F;  1ZYR F;  4GXO A;  4MTD A;  2PLY A;  2IPQ X;  4S04 A;  1UB9 A;  2PEX A;  1F4K A;  2IA1 A;  2PN6 A;  5AIQ A;  3RI4 A;  4FT8 A;  3FHZ A;  2OU2 A;  2RDP A;  1FYL A;  4AIH A;  1KYW A;  3J7A O;  2E1C A;  1HKQ A;  1UHM A;  4EQQ A;  4LD5 A;  4LFU A;  1YLF A;  2V1D A;  1H9T A;  1RI7 A;  5L3B A;  3KP6 A;  1F9N A;  3EUH A;  1MDM A;  1XN7 A;  1W4M A;  4OMZ A;  2YU3 A;  4RS8 A;  4KIG A;  2DBB A;  3GXO A;  3ZN0 A;  1OR7 A;  1ZHF A;  1BIA A;  3L9F A;  1OPC A;  3KEQ A;  3ZMS A;  5HLH A;  3ZMT A;  4KFC A;  4F7Z A;  4U0V A;  3F8B A;  2DU9 A;  1K79 A;  3GF2 A;  2OBP A;  2BEO A;  1Z7U A;  1W7P B;  2O61 A;  1XMA A;  3T8T A;  3JTG A;  3R0J A;  2V6C A;  2LDU A;  1KQ0 A;  3REO A;  3ISP A;  4A0X A;  4WXH A;  5AIP A;  5DEQ A;  4UUV A;  2HZT A;  2M30 A;  3DPL C;  1E17 A;  4WWC A;  4O5V A;  3FXR A;  1H9G A;  4IRG A;  3RKY A;  1W7P D;  3KP2 A;  3NEU A;  4NHJ A;  3TO6 A;  1XD7 A;  2FBK A;  1U6G A;  3GEZ A;  1HST A;  4G7H F;  2EWN A;  2EA4 A;  2W57 A;  3GVA A;  3I54 A;  1BI3 A;  3K1M A;  2IP2 A;  4U7D A;  2ESN A;  3F21 A;  5E8G A;  4EJO A;  4M9S A;  1SD7 A;  4WX9 A;  4P9F A;  5E17 F;  2PQ8 A;  2XAG A;  4MHG A;  3H3U A;  4BNC A;  3MAJ A;  4HQE A;  1J5Y A;  2Q2E A;  4P5O A;  2XAS A;  1IRG A;  2VT2 A;  4RAY A;  1SAX A;  1DDN A;  4ZYD A;  2H94 A;  5LHI A;  3WTU C;  2A6E F;  1KQ9 A;  2YR2 A;  2H09 A;  4FX0 A;  3ABT A;  2XGX A;  3F6O A;  4FHT A;  3Q9S A;  3TGN A;  4ZZD A;  1E2X A;  1Y0U A;  2QZ8 A;  1HBX G;  2COM A;  3F8C A;  3B02 A;  2A69 F;  5KK1 A;  2K02 A;  1IZ1 A;  2FXA A;  4EJW A;  1IN7 A;  5HDK A;  1R23 A;  2XHK A;  1B59 A;  1YS6 A;  4JK1 X;  1XGM A;  3L00 A;  2RQP A;  5LLQ A;  1WQ2 A;  3FZV A;  5E1W A;  3KP3 A;  3P9C A;  3KP4 A;  3WG9 A;  2JT1 A;  1ZRD A;  1MJ9 A;  1ZAO A;  3MZY A;  4I09 A;  3T0Y A;  2NRA C;  2Z3Y A;  3V8K A;  2Q8K A;  3GFL A;  2NS0 A;  4OMY A;  1G3W A;  4XSZ F;  4A0Y A;  2G9W A;  3COA C;  2MA3 A;  4PCQ A;  1G3Y A;  2K4B A;  1R36 A;  4G7O F;  3R0A A;  5A2Q K;  1BI2 A;  4DQ2 A;  4M74 A;  2AS5 F;  1XGO A;  2ZME B;  1BC8 C;  1YIO A;  2VBY A;  2L02 A;  1O57 A;  2ZKZ A;  4HYE A;  2EFQ A;  2R7D A;  2NNN A;  4Z2Y A;  5D8L B;  3E5Q A;  3HRM A;  1BI1 A;  5ILV A;  1RNL A;  4BHC A;  4L9N A;  2RV8 A;  4EJT A;  1LDD A;  1CGP A;  2VBZ A;  3DP7 A;  4IVN A;  4WCG A;  4Q5S F;  4HLY A;  2R7F A;  3I59 B;  5LHG A;  5D5V B;  1TW2 A;  3RIR A;  1XMK A;  1K78 B;  4N9I A;  5LHH A;  1HKS A;  3HRS A;  4EGZ A;  4EM0 B;  3WU1 B;  1ZAR A;  1W7P A;  2FBH A;  3QAH A;  1AWC A;  1QGP A;  3BY6 A;  1ZLK A;  5HOO A;  1SD4 A;  2FNP A;  1QQI A;  2K86 A;  1D3Y A;  1ZG5 A;  3GFM A;  1ON2 A;  1ZRF A;  4KT5 C;  3HOT A;  4KMU X;  2NAZ A;  3I58 A;  3DQV C;  4CDG A;  5CVV A;  3JW4 A;  1K7A A;  3ECH A;  4OIR F;  3SHF A;  3WTS C;  2MC3 A;  3K1P A;  3DXJ F;  2F2E A;  5FD6 A;  2VE9 A;  4P9U A;  2KJB A;  2RNJ A;  3M1E A;  1IXR C;  3LWF A;  5D5X B;  1UCR A;  5ICG A;  4ENK A;  2HYG D;  1FYM A;  3ZMZ A;  3LA7 A;  3LFK A;  4WF2 A;  1G4D A;  4AD9 A;  2QQA A;  3BZ6 A;  4B8X A;  3BJO A;  3VEP A;  2L4M A;  3ULQ B;  4UV9 A;  3DEU A;  3C1D A;  4RAZ A;  1FPQ A;  4RB1 A;  2Z33 A;  2CFX A;  3F6V A;  1R1U A;  2EFW A;  2H27 A;  4L0Z B;  3FWE A;  3TQN A;  4OIQ F;  4D0P A;  3LQQ A;  1LEA A;  2O6G E;  4NQW A;  4N0B A;  2YX7 A;  5LBQ A;  2UZK A;  3WGG A;  4NB5 A;  4B09 A;  1BOA A;  2HR3 A;  5E1X A;  4BHB A;  3DKW A;  1B9M A;  1FWZ A;  4E70 A;  5J8F A;  3M8E A;  4CO8 A;  4OU0 A;  3GWZ A;  1HKT A;  5BPI A;  1BI0 A;  4QWQ A;  1BIB A;  2XIG A;  4IF4 A;  1HW1 A;  3HTS B;  3QP6 A;  4YIF A;  1FNN A;  2JZY A;  2XAH A;  3NQO A;  5D6F A;  5TRD A;  1OKR A;  1ZGA A;  3MQ0 A;  4GO1 A;  1LDK B;  2L3D A;  3U1D A;  4ENM A;  2P7C B;  3AAF A;  2XKP A;  2VOO A;  4IHS A;  1U8R A;  1Z05 A;  3O2P E;  1QZY A;  1ZRE A;  4BQA A;  3JSO A;  2XAJ A;  5LGU A;  1FC3 A;  2EJR A;  3K9T A;  5FGM A;  4HZF A;  3EQL F;  3GX4 X;  1MZB A;  2OZU A;  4HX8 A;  1XCB A;  2LF7 A;  1X3U A;  3M7G A;  4U7B A;  5CYV A;  5LGN A;  2PI0 A;  1XB4 A;  3G73 A;  3C3W A;  2YX4 A;  5K5O A;  1KYZ A;  4XRF A;  4CGZ A;  4PGG A;  2HQR A;  2LSO A;  4M6X A;  1R22 A;  5A2Q Z;  2VC1 A;  1S3J A;  4I7H A;  4M71 A;  3GW2 A;  3WTX C;  2RVC A;  2Z99 A;  1JE8 A;  1EH8 A;  4A0Z A;  1QPM A;  3J81 Z;  1T98 A;  1KU3 A;  1DPR A;  1HW2 A;  4XLN F;  5J8C A;  4N9H A;  3IWF A;  3TDU C;  2DTR A;  1R1T A;  2WWY A;  2QBY B;  2H6B A;  2VXZ A;  2ISZ A;  1JXS A;  3L7W A;  1W5S A;  5F1R A;  2HOE A;  4Q47 A;  1IN8 A;  1R00 A;  1F1Z A;  3CO7 C;  3VFZ A;  4JQF A;  1J0R A;  5KVR A;  3I64 A;  2A07 F;  2RC4 A;  2ISY A;  5D6E A;  2KRF A;  2F5D A;  1K78 A;  1WWX A;  2EV6 A;  4I0B A;  4LB5 A;  5JHU A;  4HLX A;  3I4P A;  1I1G A;  1FT9 A;  4S05 A;  1OYI A;  4G94 A;  4AIJ A;  2EA2 A;  2GAU A;  4TV7 A;  2STW A;  2PMH A;  3OOP A;  1FLI A;  2UXX A;  2FU4 A;  3RJP A;  1BBY A;  1BN5 A;  3LAP A;  2C6Y A;  5LEJ A;  1FY7 A;  2ESH A;  3BJA A;  5D4R A;  2ETH A;  2D1V A;  1P4X A;  2VE8 A;  5HLI A;  2EFO A;  1ZRC A;  5FLX K;  5AON A;  3JAM Z;  1BC7 C;  5JFR A;  3C18 A;  2Y0M A;  2ZXJ A;  1FSH A;  3HTU A;  3R61 A;  2JPB A;  1PP7 U;  3LQR A;  2DQL A;  3TDZ C;  4L5J A;  2NYX A;  4ETS A;  1IAW A;  4P96 A;  3R60 A;  4KMF A;  2PBI A;  5L3G A;  4HV5 A;  3E6C C;  3HOS A;  1T0F A;  3PQJ A;  5ILS A;  5FFX A;  5H6R A;  1O3T A;  3O6B B;  3BJ6 A;  1K6O A;  4Y15 A;  5BOX A;  2JPC A;  2OQR A;  3DV8 A;  5IT9 Z;  2ZNY A;  2DFI A;  3WTZ A;  2EV5 A;  2MLG A;  1Z9C A;  1QO0 D;  1XGN A;  1JGS A;  1KA8 A;  2GZW A;  4HV6 A;  3E97 A;  2VN2 A;  2FEZ A;  1PUE E;  4EVI A;  4AIK A;  3DF8 A;  4BAY A;  1USS A;  3BDD A;  4FX4 A;  1I1S A;  2ZNZ A;  2G7U A;  4MQ9 F;  3GYH X;  4LLN A;  1UHW A;  4MEY F;  1FP2 A;  4G6Q A;  4LLG F;  2XAF A;  1RZ4 A;  2OAZ A;  1TQP A;  3L09 A;  3F72 A;  4MQV A;  3ROU A;  2BE5 F;  2FMY A;  2EK5 A;  2W24 A;  1J59 A;  4HBL A;  4ZYG A;  3V8L A;  1YW8 A;  1H0M A;  4IXA A;  4IRI A;  1TTY A;  4XLP F;  1XDU A;  2P6S A;  3SXY A;  2GQQ A;  3ZMV A;  4KA4 A;  2V9V A;  3TO7 A;  3FMR A;  2Z5U A;  5FFZ A;  5K1Y A;  3V4G A;  2QLZ A;  3H92 A;  2E1N A;  4M73 A;  2QYO A;  2HWV A;  2ZJ2 A;  2VOP A;  1UFM A;  4KDP A;  3FXQ A;  4PZJ A;  2P5L C;  5ED4 A;  4I98 B;  4RGS A;  5D5W B;  1V3F A;  3EET A;  2Z9O A;  3T1B A;  1IW7 F;  1PDN C;  1P6R A;  1G3S A;  5DCF A;  4G7Z F;  1LB2 A;  3IL2 A;  1B4A A;  2A6H F;  3ABU A;  2K27 A;  4KN7 X;  4OIP F;  3KEO A;  3RPQ A;  4LG0 B;  4YFN F;  4HDU A;  5DD4 A;  5HLG A;  2GXG A;  2X4H A;  4EJU A;  4P55 A;  5HDN A;  2UXN A;  1U5T B;  2A68 F;  2DPD A;  4UNO A;  5TJJ A;  1U2W A;  2DK8 A;  5DV5 A;  2A5Y B;  4LGW A;  3HRT A;  3RPU A;  2WTE A;  3F8F A;  4HDV A;  2IJL A;  1OYY A;  3L2C A;  1YFH A;  2STT A;  3F22 A;  2BGC A;  5ILU A;  1YW7 A;  4CZZ A;  1Z91 A;  1U78 A;  2FML A;  2JSC A;  5F6F A;  1IUY A;  3BWG A;  1IF1 A;  4HOB A;  4M6Y A;  3Q5F A;  5E8I A;  4KUM A;  4LB6 B;  4HQM A;  2HEO A;  1W5T A;  2QWW A;  1CF7 B;  5DCM B;  2DT5 A;  2L01 A;  3S2W A;  3HHG A;  5IT3 A;  3FM3 A;  3KET A;  2RN7 A;  1L0O C;  4AVP A;  5DDG A;  2J5O A;  3R4K A;  3MFK A;  4JBA A;  4WXD A;  2IT0 A;  5L3F A;  2XVC A;  2W85 A;  1MDM B;  5FLX Z;  3GZ5 A;  1LEB A;  2GXB A;  1ONV A;  2R3S A;  4M72 A;  4KIB A;  1O3R A;  2KKO A;  4RB0 A;  3LA3 A;  1ZLJ A;  4Q4Z F;  4KNY A;  2XV4 S;  1V4R A;  2RGV A;  2Q0O A;  2M87 A;  1P2F A;  1WI9 A;  1ON1 A;  3SQN A;  2G7H A;  3HYI A;  2FSW A;  4UVA A;  1I6X A;  2OD5 A;  3QP5 A;  2IVM A;  2O8X A;  4A5N A;  4YFK F;  3T5X A;  1XSV A;  2HQN A;  2HTJ A;  3D5L A;  1KGS A;  5CVU A;  3ZPL A;  2ACJ A;  2V79 A;  1STZ A;  4WXC A;  3M8F A;  2HYF A;  4LLL A;  4YII A;  4YG2 F;  1HQC A;  2EFP A;  2HTS A;  5EEH A;  1LQ1 A;  3WTT C;  4L9J A;  2CWE A;  1RIO H;  4HA8 A;  4IRH A;  2M5W A;  4R79 A;  2HGC A;  5HS7 A;  4CYD A;  4UV8 A;  2QEN A;  1QBJ A;  1Z6R A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...