2DK8A

Solution structure of rpc34 subunit in rna polymerase iii from mouse
Total Genus 16
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
16
sequence length
81
structure length
81
Chain Sequence
GSSGSSGPDADPVEIENRIIELCHQFPHGITDQVIQNEMPHIEAQQRAVAINRLLSMGQLDLLRSNTGLLYRIKDSGPSSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Solution structure of rpc34 subunit in RNA polymerase III from mouse
rcsb
source organism Mus musculus
molecule tags Translation
molecule keywords DNA-directed RNA polymerase III 39 kDa polypeptide
total genus 16
structure length 81
sequence length 81
ec nomenclature ec 2.7.7.6: DNA-directed RNA polymerase.
pdb deposition date 2006-04-06
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 2dk8A01
2V79A 4HX4A 3F21A 2FBKA 4M74A 5ICGA 2X4HA 3P9KA 5CVIA 4LB5A 1OYIA 4WXHA 4Z2YA 5HS9A 2KIMA 2QQBA 2J5OA 2FF4A 1KA8A 5FGMA 1G3SA 3RYRA 5E1XA 4DNCA 2R3SA 4UNOA 1ZGJA 4L9VA 4HF1A 4WCGA 5BPDA 3L7WA 3Q9VA 5E18F 2HQRA 2XAGA 1IRFA 2QWWA 4IPAA 1EH8A 3MFKA 2Z5UA 1ZRDA 2FNAA 4LLLA 3M8EA 1MJBA 4KA4A 1J7KA 3FXRA 4ESFA 1OKRA 3G73A 3K69A 3F22A 2IJLA 3K1MA 3TDUC 1AOYA 4CO8A 1FWZA 2HOEA 1XN7A 4HQMA 1USTA 1EH7A 4I98B 3H3UA 3J81K 3K2ZA 3QU6A 3K0LA 4N9HA 4OMZA 4KICA 4LJZF 1HW2A 4PCQA 2XV4S 3T0YA 3DPLC 3AAFA 1I27A 3R0JA 3E5XA 3DP7A 4G7HF 1XCVA 2H6BA 5AIQA 5IT9Z 5KK1A 4ETSA 1T6SA 2F5EA 3R0AA 5JFRA 3IRRA 3WE2A 2VBZA 2G7HA 2RGVA 5F1RA 3CO6C 3HHGA 4ZYDA 3WTYC 3GFJA 5E8GA 3TOBA 2ZNYA 5CJ9A 1J5YA 3F3XA 4JQFA 3LWFA 4KUMA 2DAOA 5E20A 3ERED 3ULQB 1A04A 1U8RA 2HGCA 5E1ZB 2DQRA 2Z3YA 2VODA 4LD5A 4L9NA 1LJ9A 4PZJA 5DYMA 1ONVA 5AIPA 2EB7A 3V4GA 1E17A 3K1PA 3R4KA 3HIFA 4HAMA 4QWQA 1QNTA 3H3ZA 5HLGA 2ELHA 2DTRA 3ISPA 1J0RA 3LA3A 3F6VA 1W5SA 2P5KA 1IXCA 4I0BA 5DUIA 5BMZA 2WV0A 3QP6A 3MQ0A 1PP8F 4XSXF 3U9GA 2Y48A 3JSOA 2EFPA 5D8KB 2QQ9A 1AWCA 4YIIA 4WXCA 4RB2C 1BIAA 1RUOA 1O3SA 1K78B 3EQLF 4IVNA 3LFKA 4EVIA 1KU7A 3BWGA 3F8CA 1FYLA 1K6OA 4M9SA 3GW2A 1S7AA 4ENKA 2LF7A 3CLOA 2MA3A 1J9IA 1YYVA 2M1BA 4M9XA 2K86A 3VEPA 1QGPA 2EFOA 2OD5A 3QPTA 4O5VA 5LEJA 1FC3A 3I54A 4HX7A 4CYDA 4R1HA 4RB0A 3RKXA 5BOXA 3BP8A 1O3QA 1I1GA 2A68F 1KQ0A 3EETA 1HXDA 1OMIA 2FE3A 1ODDA 1V3FA 5A2QZ 4L18B 1XDUA 3F72A 2V1DA 5HVQC 2JT1A 1ZHFA 2DLLA 3FXQA 2MC3A 2JRTA 2VOPA 3J80K 4LLNA 3LAPA 2W25A 4BHBA 1O3RA 1SD5A 4MEXF 4Q5SF 2HKXA 1IZ1A 3V7SA 1BI3A 4MTEA 1JHFA 3L9FA 1TBXA 4BXUA 1QO0D 2A3SA 4A2UA 1YFHA 1HSTA 3E5QA 4RGSA 1LEAA 4XBFA 3JAMZ 4PDKA 2A5YB 5HDNA 5DD4A 3ZMZA 2EV5A 3WGHA 4ZH4F 1T39A 1R7JA 5H6QA 1PUEE 3FX3A 5FLXZ 2ESNA 2HZTA 3HSFA 3F8MA 1NHAA 5FFZA 4KDPA 2A07F 4EJWA 1UFMA 3NRVA 1G4DA 2Y0MA 1FBUA 3JSPA 2HDCA 5L3CA 3ZN0A 1ON2A 1SD7A 1G3TA 1Q1HA 4HDUA 2DK8A 3W6KB 1O7FA 1IXRC 3RTRA 2DQLA 3RKWA 3EYIA 1Z05A 1Z7UA 1F9NA 4GYIA 5HOOA 1LDKB 2HS5A 5D5WB 1O3TA 2ZXJA 4LK1F 1FNNA 3B73A 2IA0A 2MD5A 4RB1A 2IW5A 5D5UB 4ZZLA 2VT3A 3O3KA 1F5TA 4FT8A 4L5JA 2P6SA 5DD8A 5DUKA 2VBXA 4G9YA 1B9NA 2M5WA 2NNNA 3C3WA 4EGZA 3FHZA 3N97A 1P4WA 3EYYA 2J5PA 2ADUA 3LQQA 3B02A 2P4WA 2XHKA 3KP2A 1EH6A 3HRMA 4OIQF 5ILVA 3WTSC 3WTTC 3JW4A 2P6TA 2XAFA 1U5TC 2F5DA 5K5QA 3CTAA 2EV6A 2DI3A 1ZG5A 2A6EF 3D5LA 2P5LC 1ZARA 3F23A 4R79A 1FPQA 5EEHA 2UXXA 2RV8A 4WXDA 3GFLA 3L00A 5H20A 5DCMA 4U7DA 4EM1A 1ZN2A 4HW0A 1Y0UA 1P4XA 3M8FA 2JSCA 3CO7C 3I64A 2M30A 1LB2A 1KGSA 4HV6A 1XGSA 3CUOA 3J7AO 4ESJA 3SZTA 2K27A 1RI7A 6PAXA 5J8CA 4U7BA 1BC8C 3I0TA 4AD9A 4MHGA 4P5OA 1TNSA 3MZHA 3WU1B 1IXSB 3FMRA 2Z9OA 2ZMEA 2ZFWA 2STWA 1S7OA 3IL2A 5CVRA 1XSDA 2KIFA 1XB4A 4HA8A 5HDGA 1SMYF 2PMHA 2FNPA 1R22A 3FXUA 4MQVA 2Q8KA 2P8TA 2OAZA 2GQQA 3KP4A 1P2FA 1QQIA 1YS6A 2NRAC 1S3JA 3KE2A 3TOAA 2EFWA 3TO6A 3ECOA 5L3FA 4MNUA 5ILUA 4L5IA 1B4AA 4A5NA 2A61A 4G8XA 3WTWC 3FF5A 3QPHA 1GVJA 4Q48A 4IJAA 2PEXA 2QLZA 3WTVC 3HYIA 3HSRA 2YSRA 1WKMA 1R36A 2UXNA 1YLFA 4N9IA 4YFXF 5ICCA 1FOKA 4NQWA 3CJNA 3GLXA 3KLNA 5K1YA 4YFKF 1W7PB 2WWYA 3QAHA 3TDZC 2FXAA 1JE8A 4OINF 4NHJA 3DKWA 3SHFA 4KMUX 3BY6A 1ZRCA 1SFUA 1R23A 4A0XA 2H09A 2ZJ2A 1GHCA 1HQCA 2L01A 1W4MA 2JTVA 3WTUC 4A5MA 1J59A 2DBBA 4G6QA 4FHTA 4H0EA 4LLGF 1R5GA 3CUQA 2Z33A 3WODF 2F2EA 2ZNZA 3E3VA 2EA2A 1TQPA 1UHWA 1QPMA 2ACJA 1TW3A 2PN6A 5HLIA 3SZPA 2M87A 4HDVA 2HYGD 4K2EA 2NAZA 2VE8A 2IPQX 4I7HA 1IN4A 4RGXA 3ZPLA 2KIUA 2XRNA 1XD7A 4UV9A 4LK0F 4LGWA 4KT5C 1IUYA 3MZYA 4U0VA 4M71A 4P9FA 1HKSA 2R7FA 2OQRA 2CWEA 2FOKA 2RKHA 2UWMA 4GCVA 4HYEA 4HOBA 4OU0A 1S29A 3GFIA 1OPCA 2X0LA 5E8IA 2EWNA 2DFIA 5EEGA 1TQIA 3ABTA 3DFGA 3ZMTA 5J6XA 3V8KA 3C18A 1MJ9A 1YS7A 1U5TA 1G3WA 3F6OA 3KFWX 4I2OA 2EJRA 4GO1A 4EQQA 1YW8A 1K78A 1Z1DA 2XUBA 2GIVA 1RNLA 2VC0A 2IA2A 4I0AA 4ESBA 2JPBA 2WC2A 4ASNA 4BHCA 3CUQC 2W24A 3KP6A 3V8JA 3I5UA 4RS8A 3VOEA 2V9VA 1WI9A 1J75A 4U0WA 2RVCA 1D3YA 5LHGA 2Z99A 2HKOA 4P96A 3I53A 2VOOA 4L9JA 2FQ3A 2P7VB 2XAQA 4G6DA 4I02A 3F8FA 2LNBA 3U1DA 1L3LA 3KEOA 1B59A 1KU2A 4OMYA 4IHSA 2XAJA 1D8JA 3L2CA 1IN8A 1LNWA 2L54A 3I59B 1EV7A 4EV0A 4CHUA 3D0SA 4BQAA 2HFHA 1MZBA 2A6HF 4AIKA 2H6CA 1KYZA 3BZ6A 5BS6A 3GEZA 3DV8A 4CDGA 3ML6A 3HTUA 3R6SA 4BHPA 4CICA 4EGYA 4G7ZF 3KCCA 4XLPF 2M8EA 4S05A 4AIJA 1FSEA 3KETA 1WWXA 2QBYA 2VXZA 1QZYA 4A12A 3SFZA 1HKTA 3M9AA 3ABUA 1S8NA 4EJUA 2CSOA 1R58A 5ILSA 2GXGA 4ON0A 1H9GA 4BYYA 5A2QK 1FLIA 2K7LA 2G7UA 3RYPA 3MAJA 1KQ8A 1Z6TA 2QZ8A 3FWEA 3WTXC 3G3ZA 2GWRA 1B9MA 3QOPA 1D8KA 4DQ2A 1FYKA 3GXOA 2XGXA 1FYMA 1I5ZA 3RJPA 1IN5A 2K4BA 2E7XA 1YW7A 2HTJA 5L3EA 1SD6A 2BYVE 4YG2F 5H6RA 3ECHA 1C0WA 2VBWA 2HQNA 1X3UA 5D4SA 4GYGA 4AIHA 4E70A 4MTDA 4I01A 1XMAA 1D5VA 3GO5A 4FX4A 4EJOA 1HW1A 3KP3A 3GVAA 4P55A 1F4KA 1SFXA 1MDMA 1REPC 5F64A 3REOA 4PGHA 3F8NA 2XIGA 2O3FA 2CQKA 2VN2A 2HWVA 2AS5F 3J80Z 3ZQ7A 1K79A 3I59A 2GA1A 4B8XA 4B09A 1MDMB 2PG4A 3EDPA 4N0BA 4ZYEA 4LG0A 3GYHX 4Q47A 5CLSA 3ELKA 5LGUA 1MGTA 4RAYA 5LGNA 3LQRA 5JR3A 5D8LB 3JAMK 4ENNA 2BBYA 3GF2A 3ZMUA 4G94A 3FMQA 5K5RA 2MBFA 1GXPA 2OZ6A 2CG4A 2E1NA 2EFNA 1USSA 1F1ZA 2P7CB 1BIBA 2QYOA 4RGRA 3NQOA 2XASA 3CUQB 4YIFA 2NS0A 4AWXB 2IRFG 1IW7F 2D2WA 1FBQA 2VT2A 2PQ8A 4IRGA 4CZZA 2V6CA 4A0ZA 1R00A 2BGCA 1YTYA 3CDHA 1KYWA 1P4AA 4IF4A 2HYFA 5L3DA 5HDKA 1WQ2A 2GAUA 3R60A 4XRFA 1HSJA 1SAXA 1U5TB 2MLKA 3WTZA 4O6JA 5BQTA 3WGGA 1ZGAA 3Q9SA 4L0ZB 2DK5A 3JTGA 1CF7A 4UV8A 1DUXC 3DEUA 3N4MA 3T8RA 5LHHA 4M73A 2AXLA 2JZYA 2QQAA 2VC1A 5FD6A 1I6XA 3MCZA 1YG2A 4BNCA 4OIOF 2FMLA 3K9TA 3BROA 2O03A 1DDNA 2C6YA 4BAYA 1H0MA 1YIOA 3O6BB 4KIBA 4EM2A 1FSHA 4A6DA 3HRTA 3GWZA 3C1DA 2YR2A 3HOSA 5CVUA 3WU0A 1FX7A 5F6FA 3E6CC 4HX8A 3VB2A 3HOTA 1DPUA 5ICFA 4ENJA 2L3DA 4PGGA 2D1HA 3LAJA 4HV5A 1QBJA 2YX7A 3GX4X 1BC7C 1JHHA 2G9WA 1KU9A 2OZUA 3O2PE 4TV7A 1SD4A 2W84A 2B0LA 4NB5A 3JTHA 1XGNA 2CO5A 3E97A 3U2RA 2PLYA 2BEOA 3BOQA 3Q5FA 1ZAOA 3TO9A 5L3BA 4G7OF 1TTYA 3FMSA 5D4RA 2NNYA 2PJPA 5LHIA 5LBQA 1IAWA 3BDDA 2F5CA 5ERIA 5FD5A 1J2XA 1W7PD 2UZKA 3HTSB 1ZLKA 1UB9A 4KFCA 1Z6RA 3I4PA 4OIRF 2RNJA 3P9CA 1TQMA 1RUNA 2DT5A 5IT9K 4M6YA 5LGTA 1LDJA 1OYYA 1P92A 4RAZA 4MGRA 5LLQA 1T0FA 3R61A 4M72A 4KIGA 4Y15A 2HEOA 1XGOA 3ZMSA 1PP7U 1BI0A 3DF8A 3S2WA 3P9IA 2Q2EA 1BN5A 5DV5A 5LRSA 3DXJF 1T38A 1B6AA 2FSWA 3TKYA 1QZZA 2ETHA 5JHUA 4M9ZA 2STTA 5J8FA 2COMA 2OA4A 2ISZA 4IRIA 3KP5A 3MWMA 1ZG3A 5DEQA 4UVAA 1I1SA 2XVCA 1ON1A 4RB3C 2A69F 4RGUA 2RC4A 1BOAA 2V1UA 3L09A 3T8TA 1TNTA 1UHMA 4Q4ZF 2V1XA 2H27A 2Y75A 5D5VB 4XSZF 1ZYRF 5E1WA 5L3GA 3LSTA 5HS8A 4WK8F 2FRHA 5BPIA 2IA1A 4UHTA 4D0PA 1R1UA 2QBYB 2FU4A 2EA4A 3FM5A 3GZ5A 5CVJA 3OOPA 1P6RA 3KLOA 2PBIA 4LMYA 1MKMA 2OBPA 3IKTA 1R5HA 4I09A 1IN6A 1O7LA 5IT3A 3LA2A 4HLYA 1RZ4A 2CYYA 1MD0A 3ZN1A 2LKPA 3DPTA 4L0YB 3LA7A 2EK5A 2E7WA 4HF2A 1YO5C 4Y13A 2DU9A 2L4MA 1OR7A 2IT0A 3QP5A 2FEZA 3F8BA 4HF0A 3KP7A 3BJ6A 2XAHA 4L9TA 2DW4A 1STZA 1FY7A 2FBHA 2QVOA 3WG9A 1XSXA 2JPCA 4IHTA 2GA2A 1DPRA 1ULYA 3BJAA 1T2KA 3RPQA 2LSOA 1SMTA 3GUDA 5HS7A 3RDIA 4KIFA 4ZYGA 1YW9A 5DCMB 4GXOA 2TDXA 2CW0F 1VTNC 2EV0A 4P9UA 2RDPA 4M6XA 3T5XA 2ZKZA 3TO7A 4UVBA 3BPVA 1HKQA 3GZ6A 3FZVA 2R7DA 5FLXK 3HHHA 1LDDA 1XGMA 3PQJA 2ZCWA 3V8LA 1Z91A 4BH9A 4R8HA 1FP1D 2O8XA 3I58A 4LG0B 5DDGA 5HLHA 3ROUA 1YQAA 1ZREA 2D1VA 3KZYA 3EUHA 3SXYA 2DPDA 5D6FA 1G6NA 2MH2A 3ZP5A 4KN4X 1O57A 2PFBA 4HLXA 2NYXA 5TRDA 2L02A 2KJBA 3QU3A 4U88A 3C7JA 1R1TA 3PQKA 2ESHA 5KVRA 1U78A 3IWZA 1ZLJA 3KZZA 4QLCU 3M7GA 4GGGA 1KU3A 1W5TA 1BM9A 3HRUA 2GXBA 4OIPF 2O6GE 2RQPA 4KN7X 1ZG1A 3IWFA 3E6DA 5D6EA 3DQVC 5D5XB 4IRHA 4Y17A 3W6JB 1BBYA 2CFXA 2OU2A 2ZMEB 4YFNF 4EM0B 5K5OA 1XCBA 2E1CA 1S6LA 4ENMA 1TLHB 4JBAA 3IRQA 2RN7A 1CF7B 5E17F 3PFIA 2QM3A 2O61A 3RPUA 2QUFA 1HBXG 2PMUA 3OV8A 4F7ZA 1FT9A 4WF2A 2LDUA 3K1NA 4LB6B 1FZPB 1KQ9A 1IF1A 2OQGA 5ICEA 3WGIA 1XMKA 4HBLA 1G3YA 1RIOH 4A0YA 1FBSA 3V7RA 3T1BA 1JXSA 1TW2A 3ZMVA 3E6MA 4AVPA 3WE3A 4EJVA 3IHUA 1BI1A 3J81Z 5CYVA 2Q0OA 1B1BA 2ZO4A 2DO7A 2VONA 3TGNA 4O3MA 1U3EM 2K02A 1HW5A 5ED4A 1JGSA 3RIRA 2W85A 4WWCA 1W7PA 4U0YA 2CGPA 1IN7A 1U6GA 3FM3A 3QRFF 4HQEA 1DP7P 2K4JA 5LRRA 4UVCA 3E6BA 4UUVA 4MEYF 4CGZA 4ZZDA 3I71A 2KKOA 4CXFA 1U2WA 2YX4A 3VFZA 3ZMDA 4EMSA 3GFMA 3HRSA 2DPUA 1ZH5A 2BE5F 2HTSA 2IVMA 1WRJA 1LQ1A 2QENA 2IP2A 3H92A 1UCRA 3SQNA 3TQNA 3HUGA 4XLNF 4KMFA 3NEUA 2O0YA 1V4RA 2HR3A 1L0OC 3RI4A 1PDNC 2BV6A 4JK1X 4HZFA 2ZBKA 2VBYA 1H9TA 3HSEA 5LEKA 2XROA 1BJAA 2YPRA 5JVTA 2EFQA 3KEQA 3BPXA 4KYWA 3E5UA 4OOIA 1XDSA 5FB2A 5FFXA 2W57A 2XKPA 1LVAA 1ZRFA 4EJTA 3IC7A 3MEXA 4KNYA 2FBIA 1BI2A 4A6EA 1WSUA 3COAC 2PI0A 1LEBA 5DCFA 1SFEA 2XKOA 4UXNA 4MQ9F 2P5VA 3RKYA 1GXQA 3VODA 5JI6A 3P7NA 1OYWA 1Z9CA 1R1VA 2FA5A 3BJOA 2MH9A 1K7AA 3IKVA 2YU3A 2D45A 1E2XA 4S04A 2KRFA 2ISYA 1CGPA 5FO5A 5AONA 2F5FA 3V7CA 3M1EA 1IRGA 4WX9A 4IXAA 4LFUA 2KJCA 2M45A 1XSVA 1T98A 4ZYHA 5TJJA 5CVVA 2L4AA 1MJAA 2H94A 4FX0A 1FP2A 2WTEA 2GZWA 2VE9A 2LF8A 2FMYA 2MLGA
chains in the Genus database with same CATH superfamily
1X2MA 2GLOA 2V79A 5E3MA 4HX4A 2LH9A 1ZR4A 2VJIA 3I4MJ 3F21A 2FBKA 4XM3A 4M74A 1WCMJ 3CLQA 1UAAA 3HOWJ 5ICGA 1XG1A 2X4HA 2XPUA 3P9KA 5CVIA 4PJLA 3PFYA 4LB5A 1OYIA 4WXHA 2VJ5A 4Z2YA 5HS9A 2KIMA 2QQBA 4AIDA 1YRNB 3WHCA 2DMNA 2J5OA 2FF4A 5M5WJ 3KYCB 3L2QA 2JA8J 1KA8A 5FGMA 1G3SA 4HPQA 3RYRA 5E1XA 1WJEA 5E3NA 4ZJZA 4DNCA 3OYFA 4IQJA 2R3SA 1DGWY 4UNOA 1ZGJA 4L9VA 4HF1A 1W1WE 1BR2A 1UHSA 1JGGA 1RRJA 4WCGA 2LKXA 4OAZA 5BPDA 3L7WA 3Q9VA 5E18F 2HQRA 3G2BA 3ZQIA 4XKVA 3DU6A 2XAGA 2HZDA 3OYCA 1IRFA 2QWWA 4IPAA 1EH8A 2PMZA 3KIOA 3KEYA 5C4JJ 3CP8A 3MFKA 1ETWA 2AQEA 2Z5UA 3LSRA 1ZRDA 1IO2A 1TWFJ 1N25A 4ZDPA 1D1CA 5M5YJ 2Y2ZA 1D1AA 2DA2A 2FNAA 3DTEA 4LLLA 3M8EA 1MJBA 4KA4A 1RR8C 1J7KA 2EBIA 3FXRA 4ESFA 4NBQA 2DFFA 1OKRA 3G73A 3I4NJ 2XPVA 4ZTFA 3GTMJ 3K69A 3F22A 2IJLA 3D1NI 3K1MA 3TDUC 4XKWA 1AOYA 1P7JA 1FWZA 4CO8A 3OYJA 2VKEA 5E3OA 2HOEA 1XN7A 4HQMA 1USTA 3DCFA 1EH7A 2N8GA 2VIXA 3H3UA 4I98B 4HNTA 5GTHC 3H35A 3K2ZA 3QU6A 3J81K 3K0LA 3RZDJ 4RDUA 2LREA 4X1EA 4N9HA 4OMZA 4KICA 4LJZF 4I76A 3K70C 1HW2A 3FIWA 3OR1C 4PCQA 3OSGA 3TBIA 2XV4S 3LSHA 3DPLC 3T0YA 2H8RA 2M7AA 5EJCA 3OY9A 3AAFA 1I27A 3R0JA 3IH3A 3E5XA 4PSXA 3DP7A 4G7HF 1XCVA 2H6BA 2H8WA 1Y8RB 5AIQA 5IT9Z 3BG3A 5KK1A 2JUCA 4ETSA 1T6SA 3OL4A 1EJ9A 2DA7A 4EATA 1TWAJ 1VQOI 2BXYA 2F5EA 3R0AA 5JFRA 5JLWA 3IRRA 3WE2A 3AG2H 2VBZA 2QSGX 2I8DA 3BR3A 2G7HA 2RGVA 5F1RA 3CO6C 3HHGA 4ZYDA 3WTYC 2Q2EB 3GFJA 3BR1A 5E8GA 2DMPA 3TOBA 3FKIJ 2ZNYA 5CJ9A 1J5YA 3F3XA 4JQFA 3OS1A 3LWFA 2HI3A 4KUMA 2O7OA 2DAOA 2I10A 1E0EA 2R5YA 5E20A 4W97A 3ERED 5IPAA 2OCEA 3HPHA 2B7EA 2CU7A 3ULQB 5DM6F 1A04A 2DA6A 1FOWA 2LY2A 4II2A 1FIPA 1U8RA 2E36A 2HGCA 5E1ZB 2DQRA 4DYQA 1AA7A 3HJEA 3GTOJ 2Z3YA 4XN0A 1T8IA 2VODA 4MFEA 4LD5A 3A4CA 4L9NA 1K83J 1LJ9A 5DTDA 4PZJA 1T56A 5DYMA 1ONVA 4CSWA 5AIPA 4ANJA 2EB7A 3V4GA 1E17A 3K1PA 4C2TA 4E7HA 2WB1N 3R4KA 3HIFA 1S7EA 1NK2P 4HAMA 4X6AJ 4QWQA 1LFUP 1QNTA 3H3ZA 5HLGA 2ELHA 3RKQA 3CCLI 1D1BA 2DTRA 2MFZA 3ISPA 1J0RA 3LA3A 2CJJA 3ZQQA 3VDXA 2PMZN 4LIVA 5M3MJ 3L2RA 3F6VA 1W5SA 2P5KA 4E6KG 3CCVI 1RPWA 2EPFA 5IYBJ 1ETKA 1IXCA 4I0BA 5HNHA 3MKLA 5DUIA 5BMZA 2WV0A 3QP6A 3MQ0A 2E71A 1PP8F 4XSXF 2XF6A 4G6TB 3U9GA 3S1RJ 2Y48A 2JA5J 3K4BA 3JSOA 2EFPA 3CCRI 5GP9A 5D8KB 2QQ9A 1AWCA 4YIIA 1MMAA 4WXCA 3CCJI 4DIQA 4RB2C 2M7BA 3CD6I 5H2FC 1BIAA 1UJ8A 1RUOA 4UB8C 1O3SA 1K78B 4ZC3A 4EEFG 1TWHJ 4CUGA 4QPOA 2XSDC 3EQLF 4IVNA 3CMMA 2E5NA 4C2UA 3LFKA 1SFOJ 1N77A 4EVIA 2WY8Q 4IQ4A 1KU7A 3BWGA 3F8CA 4UUSA 1FYLA 1K6OA 4M9SA 3ZCOA 3GW2A 1X4OA 1S7AA 4ENKA 3A01B 2IEKA 2LF7A 3EUHC 3CLOA 3S2HJ 1NTCA 5FKNA 5F27A 2GM4A 2MA3A 4RLFA 3GTPJ 1J9IA 1YYVA 1A6IA 2M1BA 1V5GA 4M9XA 5F04A 2K86A 3VEPA 3CCMI 1MH4A 2VASA 1QGPA 4XOPA 5B3SH 3A03A 1EKEA 2EFOA 2OD5A 3QPTA 1B72B 4O5VA 5LEJA 2OPTA 1FC3A 3I54A 4HX7A 1T0FC 3OOUA 1W0UA 4CYDA 2M9HA 4XLFA 4R1HA 4BY1J 4RB0A 3RKXA 5BOXA 2KZGA 3BP8A 1O3QA 1I1GA 2A68F 3TP3A 5J4VA 1KQ0A 3EETA 1HXDA 3DBRB 1OISA 1OMIA 3VYUB 2FE3A 2OTJI 4CCNA 1ODDA 1V3FA 5A2QZ 1FEXA 3IP4B 4L18B 4DYRA 3PNTA 1XDUA 2IAIA 4E7LA 3F72A 2V1DA 3BR6A 1WGXA 2OV7A 2DMUA 2JT1A 1ZHFA 5HVQC 2DLLA 4V19K 3FXQA 2MC3A 2JRTA 2VOPA 3ZQHA 3J80K 2NVUB 4LLNA 4L5EA 3OYAA 3LAPA 2W25A 4BHBA 2DFEA 4IO9F 1O3RA 1SD5A 3ZR8X 4MEXF 3L2WA 2M4KA 4Q5SF 2AQFA 1IZ1A 2HKXA 3V7SA 1BI3A 1WPKA 4MTEA 4YIRX 1JHFA 3L9FA 4BY7J 1TBXA 4BXUA 3A01A 1QO0D 4MLOA 2A3SA 4XKBA 4A2UA 1YFHA 3JRIA 5LD2C 1DGRM 2W82A 2BZTA 1HSTA 3SDBA 1OCRH 3CCQI 1G8XA 3E5QA 3P5JA 3I3LA 4B44A 2ID3A 3ASNH 2JVGA 4RGSA 1B8IB 1LEAA 4G12A 4BACA 4XBFA 3JAMZ 4PDKA 2A5YB 5HDNA 2K3FA 3S14J 4C9YA 2CQNA 4E7SA 5DD4A 4CCKA 1LUJB 1T33A 3ZMZA 4F93B 1LVKA 2EV5A 3WGHA 4ZH4F 1T39A 2X9DA 2NVXJ 1MBFA 2BY3A 2L9NA 1R7JA 5H6QA 1PUEE 3FX3A 5FLXZ 3MKWB 2ESNA 2K5CA 3K70D 2F5VA 2LBFA 2HZTA 3HSFA 2K9LA 1NHAA 2Y69H 3F8MA 4ITVA 5FFZA 4AYBA 4E4HA 4KDPA 2A07F 4EJWA 1WJ5A 4RLQA 1UFMA 3NRVA 3J7ZI 1G4DA 2KP6A 4F55A 1JKPC 3PM1A 4A93J 2Y0MA 3BQZA 3H1CA 1FBUA 3BZKA 3JSPA 2HDCA 1RKTA 3ZN0A 5L3CA 1SD7A 1ON2A 1QRYA 1G3TA 1Q1HA 1Z7LA 2KQRA 2L0KA 5IY5H 4HDUA 1VQKI 2DK8A 4B4CA 3W6KB 2DOFA 1O7FA 1IXRC 3RTRA 2DQLA 4C3IJ 4F91B 1TWCJ 3RKWA 4B47A 1R5ID 5JHFA 2VQHA 3EYIA 1Z05A 1VQ5I 1Z7UA 1F9NA 5DM7F 4GYIA 2E2JJ 5HOOA 1LDKB 3K4MA 1OR7C 2HS5A 2VJ4A 5D5WB 1FMWA 1R4MB 2X51A 1O3TA 2ZXJA 1PUFB 4C30A 4LK1F 1FNNA 3B73A 2XGCA 2IA0A 2JWTA 3QPLA 2MD5A 4RB1A 2IW5A 4BXFA 2DYSH 1SVOA 5D5UB 4IKFA 1JJ8C 4ZZLA 2VT3A 3O3KA 1YX5A 2F4MB 1R49A 2E1MB 1AHDP 1F5TA 3FHNA 4FT8A 4L5JA 3CJQB 2P6SA 2V4JC 4RMNA 5DD8A 5DUKA 2ZFUA 3HXLA 3PIOF 4GFBA 2LKSA 2VBXA 3QYFA 4G9YA 2JVHA 4QIWN 1B9NA 1Y1VJ 1Z21A 4PJ0C 3ERMA 2M5WA 2NNNA 2RNGA 3C3WA 4EGZA 3FHZA 4E7JA 3HUGB 2JMWA 3OS0A 2WV1A 5F0FA 3N97A 2Z2SB 1ETVA 1P4WA 2H1KA 3EYYA 2ZXIA 2J5PA 2ADUA 3LQQA 1I3AA 1YIJI 3B02A 1P7IA 2P4WA 1N75A 2L7MP 4XKCA 4XLCA 2XHKA 3KP2A 1EH6A 3JRAA 4FISA 2EZLA 2BHYA 3HRMA 4OIQF 5ILVA 3WTSC 2R7SA 3WTTC 1Y6IA 5F0CA 3JW4A 1MBGA 2P6TA 2XAFA 1JUPA 1U5TC 2F5DA 2R7WA 3FXOA 5K5QA 3BTLA 3CTAA 2EV6A 3DBLB 3CC7I 2DI3A 2HYJA 4Z6YA 1ZG5A 2A6EF 4YRVA 2XPWA 4BQQA 3D5LA 3S16J 2P5LC 4LIUA 1JTYA 1X19A 4BL0B 1ZARA 2Z1DA 1I39A 4R79A 3F23A 2JRMA 1FPQA 1X58A 5EEHA 2UXXA 1D0XA 2RV8A 2Y9YA 4WXDA 3GFLA 3L00A 4M3FA 5H20A 5DCMA 4U7DA 4EM1A 1JT6A 5GAHJ 1GT0C 2XB0X 1ZN2A 4HW0A 1Y0UA 1P4XA 3M8FA 2JSCA 3CO7C 3I64A 4FETA 1V5FA 1O4XA 5IP9J 3HEFA 1QU3A 2M30A 3DEWA 1LB2A 1KGSA 4HV6A 4BGDA 1MNMC 2X1DA 1XGSA 1JTXA 1JJ6C 1FJLA 1IJWC 1HC8A 4A3DJ 1R6RA 3Q0WA 4JP0A 2DTZA 3CUOA 3J7AO 3HOVJ 1GUUA 4ESJA 3SZTA 1K4SA 2JN6A 2CUJA 2K27A 2E5ZA 4A3KJ 1RI7A 4A3JJ 2ZB9A 3M4OJ 4IHYA 6PAXA 5J8CA 1GV5A 4U7BA 1BC8C 3I0TA 4BEHA 4AD9A 1WI3A 4MHGA 4PJNA 4P5OA 5J1YA 1FMVA 3FISA 1TNSA 4MIMA 3UR3C 3MZHA 1FTZA 3WU1B 2VQCA 1IXSB 3FMRA 1ZQ3P 4DW6A 2Z9OA 2ZMEA 3HC7A 2ZFWA 2STWA 3S1QJ 1OLTA 1S7OA 2VKHA 3IL2A 3PJRA 5CVRA 4IHVA 3DTIA 3IUOA 1XSDA 2XRLA 2KIFA 1OQYA 1XB4A 3FDYA 4HA8A 2X6OA 3ZRGA 5C4XJ 5HDGA 1SMYF 2PMHA 3NAUA 2FNPA 1R22A 3FXKA 3FXUA 4MQVA 2Q8KA 1Y0NA 2P8TA 2OAZA 2DODA 2X6YA 2JK3A 2GQQA 3KP4A 2M3AA 1P2FA 4D5FA 1QQIA 1YS6A 2NRAC 2WBMA 4CA0A 3G1OA 1S3JA 3KE2A 3TOAA 2EFWA 3TO6A 1JT0A 3ECOA 1X1PA 3MVPA 5L3FA 4MNUA 3ZQLA 5ILUA 4L5IA 1B4AA 4A5NA 4A3EJ 4NC7A 1TT5B 1X3ZB 2A61A 4G8XA 3WTWC 2A6TA 3FF5A 4Y52J 2CQQA 1ZTRA 5C3EJ 3QPHA 3LSJA 3NWTA 4BEHB 4Y7NJ 1GVJA 5B66C 4PJJA 3OIQA 1VQ6I 4Q48A 3OWTA 3OYHA 3E0JB 4IJAA 4ZYAA 2PEXA 4NDLA 2QLZA 3WTVC 1JKOC 3JR9A 3HYIA 1RC9A 3HSRA 2YSRA 5EG0A 1WKMA 1R36A 5JLXA 2UXNA 2DOAA 1YLFA 2L7ZA 4N9IA 4YFXF 2VPLA 5ICCA 2VLAA 3WU2C 1IRXA 1FOKA 4NQWA 3GLXA 3CJNA 1MNDA 2ZSHB 3KLNA 5K1YA 3BTJA 1K6YA 4IZZA 4YFKF 2MABA 1R71A 1W7PB 4BBSJ 2WWYA 1RKWA 3OIPA 3QAHA 2KRHA 3TDZC 1VQ4I 2FXAA 1JE8A 3BCBA 4OINF 4NHJA 2AHQA 1TT0A 3DKWA 3H9QA 3SHFA 2CQXA 4KMUX 2WAFA 3BY6A 3N05A 3GTGJ 1ZRCA 1SFUA 3QYEA 1SVLA 1LFPA 2VI6A 2QCOA 2EINH 2X6WA 3WG7H 2LC2A 1R23A 2QKLB 4A0XA 3RZOJ 2ZC2A 2H09A 3HOXJ 2ZJ2A 4FE7A 1GHCA 1HQCA 3GBGA 2L01A 1W4MA 2JTVA 3WTUC 2R7TA 2CUEA 4A5MA 1J59A 4FQGA 5B1AH 1D5YA 3C2HA 2NOGA 1Y1WJ 1ORKA 2DBBA 4G6QA 4FHTA 4A3IJ 1GV2A 4H0EA 4LLGF 1VQ9I 1R5GA 3CUQA 2Z33A 3WODF 2F2EA 1WJDA 2ZNZA 2LD5A 2G0EA 1VNDA 2LLKA 3E3VA 2MG4A 2EA2A 1TQPA 1UHWA 1QPMA 2TCTA 5LFAA 2ACJA 2OUMA 1TW3A 2BHZA 2DJIA 2PN6A 5HLIA 3SZPA 3FBIB 2DT6A 3HDDA 2R7QA 2M87A 4HDVA 2HYGD 1HCRA 2L7FP 3QQAA 3EUAA 2RQQA 4K2EA 2NOJB 2NAZA 2M8GX 2VE8A 2IPQX 1HDPA 4I7HA 1IN4A 3CDLA 4RGXA 3ZPLA 2KIUA 1IV6A 4LG3A 5CQEA 1J09A 3BG5A 2XRNA 1XD7A 2X85A 3K7AJ 4UV9A 4LK0F 4LGWA 2ME6A 3QODA 3D5SC 4KT5C 1IUYA 4CYCA 3MZYA 4U0VA 4M71A 1YJNI 2LFBA 3GZNB 4P9FA 2Z16A 1HKSA 2R7FA 2R7OA 2OQRA 4B3XA 1MW7A 1NK3P 2CWEA 4U87A 3BZCA 2Y9ZA 2K9SA 2GXAA 1ZKGA 2FOKA 2CUFA 4XRSG 4XQFA 3S2DJ 2RKHA 2UWMA 4GCVA 4IOCF 5KAIC 1V55H 4HYEA 4HOBA 4OU0A 5C44J 1S29A 2V26A 1U9OA 3GFIA 1OPCA 2YS9A 2X0LA 3K4JA 2EWNA 5E8IA 3CC2I 2DFIA 3OYNA 5EEGA 4CZCA 1TQIA 3ABTA 3HZJA 3CF2A 3DFGA 3OYKA 3IV5A 3ZMTA 1JUSA 5J6XA 2WAEA 3V8KA 3C18A 1MJ9A 4II3A 1YS7A 1U5TA 2UV1A 1G3WA 4JX5A 3O8HA 3F6OA 3KFWX 5F08A 4I2OA 3MKZA 3C2BA 2EJRA 4GO1A 4EQQA 1YW8A 1K78A 4J19A 1Z1DA 2XUBA 2GIVA 3H36A 1RNLA 3S3OA 2VC0A 5B5EC 1JI8A 3M1CA 2IA2A 4I0AA 4ESBA 2JPBA 2LMDA 2WC2A 4ASNA 1PVEA 4BHCA 1T08B 3CUQC 2W24A 3PO3J 3KP6A 4BDYA 1YI2I 3U1KA 5GAGJ 3L2VA 2R92J 4UUSB 2YUSA 2VB6A 3V8JA 1U0JA 4BS9A 4KJZA 3I5UA 4RS8A 2M34A 2R4GA 2V9VA 3VOEA 1WI9A 1LE8B 5IYDJ 4S0HB 1J75A 4U0WA 1BW6A 2RVCA 2R0QC 4BJTA 5M3FJ 1TL8A 1D3YA 2X1CA 3CCYA 5LHGA 2Z99A 2HKOA 5HLTA 4P96A 3I53A 2VOOA 4L9JA 2FQ3A 2P7VB 2IS4A 3AL0C 2GBYA 2XAQA 1M1EB 2A5WA 4G6DA 1KZHA 4I02A 3F8FA 1MMSA 5EGOA 2QF7A 2CQ7A 2DJNA 3DBHB 2LNBA 3U1DA 1H89C 4BQOA 1L3LA 3KEOA 2IGOA 1B59A 2CV2A 1KU2A 3H0DA 1VI0A 4OMYA 4IHSA 1FTTA 2R5ZB 2XAJA 1D8JA 3VPRA 3L2CA 3Q0VA 3M3YJ 1IN8A 1N78A 1LNWA 2L54A 3A2KA 1HF0A 1EF4A 2CUZA 5CPRB 4NC6A 3VSKA 2ECBA 2GIZA 3I59B 2QSFX 2X6XA 1EV7A 4EV0A 1Y56A 2B9SA 4ABZA 4CHUA 5IYCJ 3D0SA 2HQAA 3BTIA 2QA4I 4BQAA 2DN0A 2HFHA 1WJFA 1MZBA 2A6HF 4AIKA 5EZGA 2H6CA 1KYZA 2DOEA 3BZ6A 5BS6A 1APLC 3GEZA 3CZ6A 3DV8A 4CDGA 3LOCA 4I6ZA 1IUFA 3ML6A 4N4OB 3HTUA 3VYTB 3NARA 5FKMA 3R6SA 1R4NB 3HB9A 3K4CA 4BHPA 4CICA 4EGYA 2F6CA 4G7ZF 2Y30A 3GTQJ 3KCCA 4XLPF 2IS1A 2A05A 2M8EA 5EEAA 4BQNA 4S05A 5FROA 4AIJA 1WJBA 1FSEA 4D7NA 3KETA 2I5UA 4FASD 1WWXA 1GVDA 5E3LA 2QBYA 2VXZA 5KHDA 1QZYA 4A12A 3SFZA 1HKTA 4D9JA 3NWSA 3M9AA 1MH3A 3DU5A 1V5EA 3ABUA 1S8NA 4EJUA 1B72A 2R7XA 3K6GA 3OYDA 3VSLA 2CSOA 2HVSA 1BJZA 1R58A 2JA2A 4D7MA 1U8BA 5ILSA 2GXGA 1A35A 3SJMA 3J7YJ 4ON0A 3LSPA 1H8AC 1H9GA 4UY8I 2EQRA 3TP0A 4BYYA 5A2QK 4D5CA 1FLIA 2K7LA 2G7UA 3RYPA 3MAJA 3HL2A 1KQ8A 3AL0B 1Z6TA 3AG1H 2QZ8A 5B1BH 3FWEA 3WTXC 3G3ZA 2K85A 3VYRB 1MMGA 2GWRA 4W1UA 1B9MA 1XC5A 3QOPA 2EILH 1D8KA 2ZMEC 4DZJA 3SFIA 1X1BA 4DQ2A 1FYKA 3GXOA 2XGXA 1FYMA 2V9PA 1IDZA 1P9QC 1I5ZA 3RJPA 1IN5A 4A3FJ 3CMEI 1DU6A 3VYSB 2K4BA 2LY9A 2E7XA 1YW7A 2HTJA 2KISA 5L3EA 1SD6A 4F3QA 3MZ8A 2BYVE 2R7RA 2BVMA 2KDZA 4IHWA 4YG2F 5H6RA 1GLNA 3ECHA 1E3PA 1C0WA 2VBWA 2XAUA 2QQ8A 1MMNA 3AG4H 2X48A 2HQNA 1X3UA 3CJTB 1BOBA 2R93J 5D4SA 5EDNA 4GYGA 5GPCA 1SAUA 2NS7A 4AIHA 4E70A 4MTDA 1H88C 4I01A 1S72I 1XMAA 1OCCH 3GO5A 3RCOA 1D5VA 5FJ8J 1V54H 4FX4A 4EJOA 1SFKA 1HW1A 2TRTA 4P1WA 3H9JA 3KP3A 3GVAA 4P55A 3JREA 2EIKH 1IGNA 4HNUA 3AKZA 1F4KA 2JJ7A 1SFXA 4KT6A 5EZHA 2EH3A 4BU2A 4DBQA 1MDMA 2DA5A 1REPC 5F64A 2MYSA 3REOA 4PGHA 3F8NA 2XIGA 1A36A 2O3FA 2CQKA 2VN2A 2HWVA 4OWRB 2AS5F 3J80Z 4HRIA 3ZQ7A 2V6EA 3GTKJ 1K79A 3I59A 1MBEA 2GA1A 4B8XA 5K7FA 4B09A 1MDMB 2PG4A 3EDPA 4N0BA 1PYVA 2KZVA 4ZYEA 4LG0A 1ETQA 3I9V2 5CKTA 3GYHX 4Q47A 2WY7Q 2Y0SA 1HLVA 1IG7A 3K4LA 3L1PA 1VZ0A 5CLSA 3OSFA 3ELKA 3OL3A 5LGUA 1MGTA 4RAYA 5LGNA 3LQRA 5JR3A 5D8LB 4XOTA 4FCYA 1WJCA 3JAMK 4RBOA 4ENNA 2MC4A 5FRNA 2BBYA 3GF2A 3ZMUA 4G94A 3FMQA 5K5RA 3LMMA 2MBFA 4D1QA 2XB5A 1GXPA 2OZ6A 4BUPA 1BW5A 3EUKL 4FTHA 2CG4A 2VQGA 3DWLE 5F0HA 2E1NA 4XICA 4BDZA 2CMPA 2F4OB 1G59A 1TWGJ 1USSA 2EFNA 1F1ZA 2P7CB 1BIBA 2QYOA 3OYMA 3S93A 3SEZA 4RGRA 3NQOA 2XASA 3CUQB 4YIFA 2DDBA 2NS0A 4AWXB 2IRFG 1IW7F 2D2WA 1FBQA 5BNGA 2VT2A 2PQ8A 4IRGA 4CZZA 2CRGA 1YHQI 3G1LA 4RA2A 2BY0A 4B3AA 1LKXA 2V6CA 4A0ZA 1R00A 2BGCA 4PK4A 3DLLF 1YTYA 1WFXA 3CDHA 1KYWA 1I3QJ 2JQ7A 2HQ5A 3I55I 3AFHA 1I50J 1P4AA 4IF4A 2HYFA 5L3DA 3W2WA 5HDKA 1WQ2A 2GAUA 4PFPA 2HVRA 3R60A 2M4GA 2CW8A 1B8IA 4XRFA 1HSJA 3TL4X 1SAXA 3BTCA 1X4PA 1U5TB 4X0GA 1ZELA 2MLKA 3D5RC 3WTZA 2R5YB 4O6JA 5BQTA 3WGGA 1ZGAA 1U9NA 3Q9SA 2JUGA 5KNLA 4L0ZB 2DK5A 3ZQCA 2DA3A 2LY1A 3JTGA 1CF7A 1YRNA 1E3HA 1QVTA 1WHUA 2NXNB 4UV8A 1DUXC 3DEUA 3S3NA 4GDFA 3ESWB 3CCSI 3N4MA 3T8RA 1TP4A 5LHHA 4M73A 1ENHA 2AXLA 2JZYA 2QQAA 2IS6A 5HODA 2VC1A 5FD6A 1I6XA 4XNFA 1QHHD 3MCZA 1YG2A 1MNEA 4BNCA 4OIOF 2K3PA 2KT0A 3A02A 2FMLA 3K9TA 3BROA 2O03A 3HKZA 2R7ZJ 2AXTC 1DDNA 3H5AA 2C6YA 5TGTA 4BAYA 4Y3OA 2FQ4A 2MGQA 1H0MA 1VQ7I 3K2AA 3A1YA 5GADJ 1YIOA 3BR0A 3O6BB 4KIBA 4EM2A 4NNJA 2PJRB 1XMXA 2E60A 1FSHA 4A6DA 2K9QA 2QSHX 1JKQC 2COBA 3HRTA 4RM2A 3FXLA 3GWZA 2WAQA 4BBRJ 2HNHA 3C1DA 1WH5A 2W1OA 2YR2A 4BE0A 3HOSA 3QPSA 3KYDB 1FOXA 4E7ZA 2L9RA 4ZDOA 5CVUA 3WU0A 4AUXA 2IS2A 1OCOH 1FX7A 1YJ9I 5F6FA 1OCZH 3E6CC 4HX8A 3VB2A 3JRDA 3HOTA 5ICFA 1DPUA 3IH2A 2E1MC 4J01A 4BE2A 1X1AA 4HG2A 4ENJA 2L3DA 4PGGA 2E1OA 4KITB 3ZQFA 4MFDA 3W2VA 2D1HA 4DBRA 3LAJA 4HV5A 2RAEA 1QBJA 5GAEJ 2ZXHA 3TMOA 2EIJH 1NG6A 3MN2A 2DFHA 2EZHA 2YX7A 3GLLA 3FBNB 4NQWB 4LOCA 3GX4X 1BC7C 3BG7A 1ETXA 1JHHA 2G9WA 1KU9A 2OZUA 2W48A 4A3CJ 3O2PE 5J47A 5TISC 2MW8A 2M0CA 1SD4A 2DDAA 3MMYB 4TV7A 4A3MJ 1UELB 2W84A 2B0LA 3O8GA 4NB5A 3JTHA 1CQTA 1XGNA 2GOMA 3CJRB 2XSJC 3GTLJ 1ACIA 2KFDA 3QWLA 2BY1A 2OTLI 2CO5A 3E97A 3U2RA 2PLYA 2BEOA 3BOQA 4C3JJ 3Q5FA 4E7IA 1ZAOA 4AU7A 3TO9A 4HEA2 5L3BA 3H5RA 4G7OF 3SDGA 3ABKH 4QPQA 1TTYA 3FMSA 5D4RA 3TW7A 5J1RA 1X2NA 3CP2A 2NNYA 2PJPA 1YITI 5LHIA 9ANTA 5LBQA 1IAWA 3BDDA 2F5CA 2HDDA 5ERIA 5FD5A 1J2XA 1W7PD 4UUTA 2UZKA 3HTSB 1ZLKA 1MBKA 1UB9A 4KFCA 1HA8A 1Z6RA 3I4PA 4OIRF 3S8PA 2RNJA 3RQ4A 1VQLI 2PJRA 3P9CA 3DPUA 1TQMA 1RUNA 2DT5A 5IT9K 4M6YA 5LGTA 1LDJA 1OYYA 1P92A 2X1EA 2OC6A 4RAZA 4JX6A 3H0GJ 4MGRA 1IV8A 5LLQA 3OYBA 1T0FA 3R61A 3HOUJ 4M72A 4KIGA 2HOAA 4F92B 4Y15A 2HEOA 3JRCA 1XGOA 3ZGKA 3S1MJ 1BA5A 3ZMSA 1PP7U 1BI0A 2KHMA 3DF8A 1YOVB 1DQUA 5F1JA 3BCAA 1ITYA 3S2WA 3C2GA 3LFUA 3P9IA 2V7FA 3PIPF 4F52A 5J1UA 1XS9A 2Q2EA 1BN5A 2E35A 2LOOA 5DV5A 5LRSA 1D0YA 1JUMA 1UG2A 4CCOA 3DXJF 4DJAA 1T38A 3ONQA 3G4SI 2LRDA 1B6AA 2FSWA 1S9HA 3L2UA 4XORA 3TKYA 2P0WA 1QZZA 3JRFA 2ETHA 5JHUA 3CF5F 2FOWA 4M9ZA 2STTA 2V1NA 5J8FA 1XTAA 2COMA 2OA4A 4PUSA 2BVLA 1T95A 3EPZA 2ISZA 4IRIA 1GDTA 2IGMA 4IX7A 4N4NB 3KP5A 3MWMA 2LVSA 1ZG3A 5DEQA 2O8KA 1A5JA 1AKHB 2OJED 2OF7A 4UVAA 1I1SA 2XVCA 1TC3C 1Y39A 1ON1A 4RB3C 1SANA 2A69F 4RGUA 2RC4A 4Y4RA 3JRGA 3QYBA 3JRHA 3A0HC 1BOAA 2VJJA 2ZXWH 3S15J 2V1UA 2W00A 3L09A 3T8TA 1TNTA 1MSFC 2Q1ZB 1OCTC 2KPMA 3BG6A 4A69C 1EA3A 1IDYA 1X1DA 1UHMA 2XC7A 5EYRA 4Q4ZF 3CCEI 2V1XA 2EIMH 4YEJA 2H27A 2B63J 2Y75A 3J7AY 1RETA 2XGEA 2ZSIB 2O9LA 5D5VB 4HNVA 2VXDA 5EG0B 2R7UA 4XSZF 1ZYRF 5E1WA 5L3GA 2L9VA 3MD2A 2K9MA 2ZJRF 3LSTA 2HXIA 2F48A 5HS8A 4WK8F 2FRHA 2QKMB 5BPIA 3BR5A 2IA1A 2ZJPF 4UHTA 4D0PA 1R1UA 1ETYA 2ELKA 3LSGA 4QTRA 2BW3A 2QBYB 2FU4A 1QZEA 2EA4A 1MMDA 3FM5A 3GZ5A 1UZCA 5CVJA 4DOZA 3OOPA 4XN3A 1P6RA 3KLOA 2PBIA 4LMYA 4JOMA 1MKMA 2OBPA 3IKTA 1S5LC 1MBJA 2LR8A 1R5HA 4I09A 2E19A 5FLVA 2M0MA 1IN6A 4NC8A 1IRZA 3PSIA 1O7LA 5IP6A 5IT3A 3CCUI 3LA2A 4HLYA 2E2HJ 3ZOBA 4H4KC 2VPRA 1RZ4A 1VQMI 2CYYA 3HBLA 1MD0A 1R9TJ 4Y33A 3ZN1A 2LKPA 3DPTA 1ZR2A 4L0YB 3BC8A 4V2FA 3LA7A 2EK5A 2E7WA 3IH4A 1YO5C 4ZDLA 4Y13A 2DU9A 4HF2A 2L4MA 1MBHA 1OR7A 3B6CA 2IT0A 4C3HJ 3BT9A 3I56I 3OIOA 3QP5A 4J00A 2HOSA 1OCPA 2FEZA 4BJ5C 5EF6A 5K7ZA 3CESA 2VUMJ 5K7HA 1NG7A 3F8BA 4HF0A 4XMYA 3KP7A 3BJ6A 4XIDA 2XAHA 2JA6J 2IGNA 3DTKA 4L9TA 2DW4A 4DYCA 3TEDA 1STZA 3ZXSA 1FY7A 2D5VA 2MD0A 2FBHA 2CFOA 2QVOA 2NVYJ 3WG9A 2W7NA 2O5RA 3OR2C 1XSXA 2LYCA 2JPCA 4IHTA 2DCEA 2GA2A 1DPRA 1BR1A 1ULYA 3ABLH 3BJAA 1PUFA 1X3WB 4CCJA 1T2KA 1A31A 4AYBN 4M3GA 3RPQA 2NVQJ 2E34A 2LSOA 1SMTA 3GUDA 4A3GJ 4BXXJ 1KONA 2WB1A 5HS7A 2F4IA 3RDIA 2QEXI 3Q3SA 2DYRH 4KIFA 5DS9A 2XGDA 3A0BC 4DGWB 3CQZJ 1BR4A 4QSHA 4ZYGA 4JYKA 4PSWA 1YJWI 2R7VA 3ASOH 3HKZN 3K10A 2W4SA 4AVZA 2DT7B 1AU7A 1YW9A 5DCMB 2FX0A 4GXOA 1WVRA 4UB6C 3OYLA 2TDXA 2CW0F 3HOZJ 1ZGWA 4PFOA 1UG0A 5GTIC 1Z3YA 1VTNC 1ETOA 4M3EA 4IHXA 2CW7A 1SVMA 2EV0A 4P9UA 2RDPA 4M6XA 3T5XA 1Z77A 2ZKZA 3VWBA 1WJAA 1FOYA 3TO7A 3E7LA 4UVBA 2K9NA 3GCMA 3BPVA 4PJMA 1VQPI 5FRMA 1HKQA 3AG3H 3GZ6A 1A6QA 3FZVA 2R7DA 4CCLA 3CC4I 5FLXK 2EZIA 4E7KA 3HHHA 2ZJQF 4IOAF 1LDDA 1W5CC 2L7KA 1XGMA 3PQJA 2YU9J 4IEJA 2ZCWA 3V8LA 2Y0SN 1IC8A 1Z91A 4BH9A 2DXIA 4R8HA 1FP1D 3OYGA 1VF9A 4B1RA 4GRIA 1G2HA 2XF7A 2O8XA 3I58A 4AM3A 4LG0B 2LBFB 5DDGA 1W36C 3K4KA 3KZIC 3W3CA 5HLHA 3ROUA 1YQAA 3K4NA 1ZREA 2D1VA 3KZYA 2DA1A 3EUHA 5FKOA 3SXYA 2DPDA 5D6FA 1G6NA 2CV1A 2MH2A 3ZP5A 4KN4X 1O57A 2PFBA 2BOLA 4HLXA 3G1MA 2KDOA 2NYXA 4XRMA 2KL4A 3UNGC 5TRDA 2IGKA 2KJBA 2ELJA 2L02A 3QU3A 4U88A 4HSRA 3C7JA 1R1TA 3IAS2 3PQKA 2ESHA 5KVRA 4RM3A 3IWZA 1U78A 1Y8QB 1ZLJA 1RESA 2WADA 3CDIA 3FXMA 4M3DA 3KZZA 2KLOA 5E79C 4QLCU 3M7GA 4GGGA 2DMTA 5KAFC 1KU3A 1W5TA 1BM9A 3SZGA 1Z0XA 3HRUA 3SYTA 2ICWG 2L2OA 2GXBA 4OIPF 2O6GE 3QOEA 2RQPA 4KN7X 4BJ6C 1ZG1A 3IWFA 4M6VA 2L9SA 3E6DA 5D6EA 3DQVC 5D5XB 4XK4A 4IRHA 1JKRC 3BR2A 4Y17A 3W6JB 1BBYA 2CFXA 2OU2A 2ZMEB 3S32A 1D0ZA 4XONA 4YFNF 5M5XJ 3CMAI 4EM0B 3LNQA 2XF5A 2HU9A 1DU0A 1W0TA 5K5OA 4ZTJA 1HOMA 1XCBA 2DMQA 3V42A 3S3MA 3M8JA 5FKLA 4RAFA 3DEEA 2E1CA 2R5ZA 2RREA 1S6LA 4ENMA 1TLHB 4JBAA 3IRQA 2ME0A 2RN7A 2FD5A 1CF7B 3OYEA 3IAM2 5E17F 4AC0A 2GOXB 2JSPA 1LE8A 3PFIA 2QM3A 1QHGA 5EGOB 2CS3A 1XX5A 2O61A 3RPUA 2QUFA 3PNYA 2LTPA 2PMUA 3FXJA 1HBXG 1WH7A 3OV8A 2WA0A 3RPUD 1VFCA 4F7ZA 1FT9A 2AO9A 4WF2A 2LDUA 2IXSA 3K1NA 4LB6B 4B48A 1FZPB 2E2IJ 1KQ9A 1IF1A 4CH7A 2OQGA 5ICEA 3LSMA 3WGIA 1XMKA 4HBLA 2BW3B 1G3YA 4B43A 1FIAA 2H1LA 2KRCA 3ABMH 2PX9A 5KCMA 3DLAA 3KPHA 3Q0UA 3E1SA 1RIOH 3HOYJ 3BLYA 5GPAA 2JA7J 3U21A 4A0YA 1F36A 1FBSA 3V7RA 4XLHA 1SC7A 3T1BA 4YELA 1YE9A 1JXSA 1OJLA 1TW2A 5FLMJ 3ZMVA 3E6MA 3FKJA 4AVPA 3WE3A 4MO7A 1XPXA 4EJVA 2LP0A 3IHUA 2KIQA 2HPIA 3PNVA 3HGGA 1BI1A 1K61A 3J81Z 5CYVA 1RR7A 2Q0OA 3TW6A 1LFBA 2FUG2 1B1BA 2HDWA 3F9KA 2ZO4A 2HPMA 2LG4A 4NUBA 2DO7A 1WZ2A 2ECCA 3MKYB 2VONA 1I6HJ 5HNFA 3TGNA 1U3EM 2K02A 4O3MA 3B6AA 2VKDA 1HW5A 4V2GA 3HG9A 5ED4A 1JGSA 3HGYA 3RIRA 1SEUA 2UUZA 2W85A 3G6EI 4BE1A 4WWCA 5IOZA 3X2QH 1W7PA 4U0YA 3F0CA 2CGPA 1IN7A 1U6GA 2M2EA 3FM3A 2BY2A 3QRFF 1UMQA 4HQEA 1DP7P 2K4JA 5LRRA 1Z3XA 3GMEA 3DKYA 4UVCA 3E6BA 4UUVA 1ERDA 4MEYF 4XLEA 4CGZA 5J40A 2XDVA 3PSFA 4ZZDA 3I71A 2KKOA 1F43A 4CXFA 1U2WA 2YX4A 3VFZA 3ZMDA 4EMSA 4A3BJ 2DA4A 3GFMA 3HRSA 3ZQGA 2DPUA 1ZH5A 2BE5F 2HTSA 2IVMA 1WRJA 3PUFA 1Q1VA 3HPGA 1LQ1A 2QENA 2IP2A 3H92A 1UCRA 3SQNA 3LL7A 1DP3A 4M3BA 3TQNA 3GTJJ 4XLAA 4CCMA 2BXZA 5J3LA 3HUGA 4XLNF 4KMFA 2L5QA 3NEUA 3WHBA 1OFCX 2K40A 2O0YA 2LK2A 3UKGA 4RAGA 1V4RA 3H9GA 2HR3A 1L0OC 2VQLA 1MIJA 3KX2A 3JRBA 3RI4A 1W36D 1PDNC 2BV6A 4JK1X 4HZFA 3DKXA 3S17J 2ZBKA 2VBYA 1H9TA 3HSEA 5FKKA 5LEKA 2XROA 1BJAA 2YPRA 5JVTA 1X1CA 1PJRA 2EFQA 4KISA 2MSYA 2V9KA 3KEQA 3BPXA 4KYWA 1YX3A 3M07A 2Y31A 3OYIA 3E5UA 1Z67A 1QVUA 5CQGA 4BKXA 3OS2A 2HVQA 2EZKA 4OOIA 5J4YA 4XR6A 3H5NA 1XDSA 4LITA 5FB2A 5FFXA 4A3LJ 2W57A 2XKPA 3RQIA 1LVAA 2HXOA 1K4TA 1ZRFA 4EJTA 3OMYA 3HM5A 3IC7A 2WAQN 3MEXA 3CMYA 2FJ1A 4C2MJ 2FBIA 4KNYA 1BL0A 1BI2A 4A6EA 4I99C 1WSUA 3COAC 1QA6A 2PI0A 1LEBA 4OAYA 4IL6C 2CH0A 5DCFA 1SFEA 5IOYA 1NH3A 2XKOA 2VL8A 2ID6A 3KYLA 2IBDA 4UXNA 4MQ9F 2KMUA 2P5VA 3LSIA 3BQYA 3RKYA 1VQNI 1GXQA 3VODA 5JI6A 2CV0A 1VQ8I 3PL8A 3P7NA 3RSNA 1OYWA 5JVGF 3FK7A 1Z9CA 3H3VK 1R1VA 2FA5A 3BJOA 4FE4A 2HOTA 1TZLA 1POGA 2VKVA 3G71I 2MH9A 2NVTJ 2OCCH 2NS8A 3SEQA 1K7AA 3IKVA 2YU3A 2D45A 1E2XA 4S04A 2KRFA 2ISYA 1CGPA 5FO5A 5AONA 1QPIA 3S1NJ 2F5FA 1AKHA 4XRSA 3V7CA 3M1EA 1IRGA 4WX9A 3PUBA 4HSTA 3LSKA 4IXAA 4LFUA 1ZK8A 2KJCA 2P81A 2M45A 1XSVA 1T98A 1LPQA 4ZYHA 1E3OC 2QGUA 1HDDC 5TJJA 5CVVA 4CYCB 2L4AA 1MJAA 3PO2J 3W6VA 5IP7J 2H94A 3JCUC 4FX0A 1FP2A 4XL9A 2WTEA 1MSEC 2GZWA 3W2AA 3BG9A 2VE9A 4DZPA 4JX4A 2LF8A 3FK6A 2FMYA 2MLGA
chains in the Genus database with same CATH topology
2V79A 4HX4A 3F21A 2FBKA 4M74A 5ICGA 2X4HA 3P9KA 5CVIA 4LB5A 1OYIA 4WXHA 4Z2YA 5HS9A 2KIMA 2QQBA 2J5OA 2FF4A 1KA8A 5FGMA 1G3SA 3RYRA 5E1XA 4DNCA 2R3SA 4UNOA 1ZGJA 4L9VA 4HF1A 4WCGA 5BPDA 3L7WA 3Q9VA 5E18F 2HQRA 2XAGA 1IRFA 2QWWA 4IPAA 1EH8A 3MFKA 2Z5UA 1ZRDA 2FNAA 4LLLA 3M8EA 1MJBA 4KA4A 1J7KA 3FXRA 4ESFA 1OKRA 3G73A 3K69A 3F22A 2IJLA 3K1MA 3TDUC 1AOYA 4CO8A 1FWZA 2HOEA 1XN7A 4HQMA 1USTA 1EH7A 4I98B 3H3UA 3J81K 3K2ZA 3QU6A 3K0LA 4N9HA 4OMZA 4KICA 4LJZF 1HW2A 4PCQA 2XV4S 3T0YA 3DPLC 3AAFA 1I27A 3R0JA 3E5XA 3DP7A 4G7HF 1XCVA 2H6BA 5AIQA 5IT9Z 5KK1A 4ETSA 1T6SA 2F5EA 3R0AA 5JFRA 3IRRA 3WE2A 2VBZA 2G7HA 2RGVA 5F1RA 3CO6C 3HHGA 4ZYDA 3WTYC 3GFJA 5E8GA 3TOBA 2ZNYA 5CJ9A 1J5YA 3F3XA 4JQFA 3LWFA 4KUMA 2DAOA 5E20A 3ERED 3ULQB 1A04A 1U8RA 2HGCA 5E1ZB 2DQRA 2Z3YA 2VODA 4LD5A 4L9NA 1LJ9A 4PZJA 5DYMA 1ONVA 5AIPA 2EB7A 3V4GA 1E17A 3K1PA 3R4KA 3HIFA 4HAMA 4QWQA 1QNTA 3H3ZA 5HLGA 2ELHA 2DTRA 3ISPA 1J0RA 3LA3A 3F6VA 1W5SA 2P5KA 1IXCA 4I0BA 5DUIA 5BMZA 2WV0A 3QP6A 3MQ0A 1PP8F 4XSXF 3U9GA 2Y48A 3JSOA 2EFPA 5D8KB 2QQ9A 1AWCA 4YIIA 4WXCA 4RB2C 1BIAA 1RUOA 1O3SA 1K78B 3EQLF 4IVNA 3LFKA 4EVIA 1KU7A 3BWGA 3F8CA 1FYLA 1K6OA 4M9SA 3GW2A 1S7AA 4ENKA 2LF7A 3CLOA 2MA3A 1J9IA 1YYVA 2M1BA 4M9XA 2K86A 3VEPA 1QGPA 2EFOA 2OD5A 3QPTA 4O5VA 5LEJA 1FC3A 3I54A 4HX7A 4CYDA 4R1HA 4RB0A 3RKXA 5BOXA 3BP8A 1O3QA 1I1GA 2A68F 1KQ0A 3EETA 1HXDA 1OMIA 2FE3A 1ODDA 1V3FA 5A2QZ 4L18B 1XDUA 3F72A 2V1DA 5HVQC 2JT1A 1ZHFA 2DLLA 3FXQA 2MC3A 2JRTA 2VOPA 3J80K 4LLNA 3LAPA 2W25A 4BHBA 1O3RA 1SD5A 4MEXF 4Q5SF 2HKXA 1IZ1A 3V7SA 1BI3A 4MTEA 1JHFA 3L9FA 1TBXA 4BXUA 1QO0D 2A3SA 4A2UA 1YFHA 1HSTA 3E5QA 4RGSA 1LEAA 4XBFA 3JAMZ 4PDKA 2A5YB 5HDNA 5DD4A 3ZMZA 2EV5A 3WGHA 4ZH4F 1T39A 1R7JA 5H6QA 1PUEE 3FX3A 5FLXZ 2ESNA 2HZTA 3HSFA 3F8MA 1NHAA 5FFZA 4KDPA 2A07F 4EJWA 1UFMA 3NRVA 1G4DA 2Y0MA 1FBUA 3JSPA 2HDCA 5L3CA 3ZN0A 1ON2A 1SD7A 1G3TA 1Q1HA 4HDUA 2DK8A 3W6KB 1O7FA 1IXRC 3RTRA 2DQLA 3RKWA 3EYIA 1Z05A 1Z7UA 1F9NA 4GYIA 5HOOA 1LDKB 2HS5A 5D5WB 1O3TA 2ZXJA 4LK1F 1FNNA 3B73A 2IA0A 2MD5A 4RB1A 2IW5A 5D5UB 4ZZLA 2VT3A 3O3KA 1F5TA 4FT8A 4L5JA 2P6SA 5DD8A 5DUKA 2VBXA 4G9YA 1B9NA 2M5WA 2NNNA 3C3WA 4EGZA 3FHZA 3N97A 1P4WA 3EYYA 2J5PA 2ADUA 3LQQA 3B02A 2P4WA 2XHKA 3KP2A 1EH6A 3HRMA 4OIQF 5ILVA 3WTSC 3WTTC 3JW4A 2P6TA 2XAFA 1U5TC 2F5DA 5K5QA 3CTAA 2EV6A 2DI3A 1ZG5A 2A6EF 3D5LA 2P5LC 1ZARA 3F23A 4R79A 1FPQA 5EEHA 2UXXA 2RV8A 4WXDA 3GFLA 3L00A 5H20A 5DCMA 4U7DA 4EM1A 1ZN2A 4HW0A 1Y0UA 1P4XA 3M8FA 2JSCA 3CO7C 3I64A 2M30A 1LB2A 1KGSA 4HV6A 1XGSA 3CUOA 3J7AO 4ESJA 3SZTA 2K27A 1RI7A 6PAXA 5J8CA 4U7BA 1BC8C 3I0TA 4AD9A 4MHGA 4P5OA 1TNSA 3MZHA 3WU1B 1IXSB 3FMRA 2Z9OA 2ZMEA 2ZFWA 2STWA 1S7OA 3IL2A 5CVRA 1XSDA 2KIFA 1XB4A 4HA8A 5HDGA 1SMYF 2PMHA 2FNPA 1R22A 3FXUA 4MQVA 2Q8KA 2P8TA 2OAZA 2GQQA 3KP4A 1P2FA 1QQIA 1YS6A 2NRAC 1S3JA 3KE2A 3TOAA 2EFWA 3TO6A 3ECOA 5L3FA 4MNUA 5ILUA 4L5IA 1B4AA 4A5NA 2A61A 4G8XA 3WTWC 3FF5A 3QPHA 1GVJA 4Q48A 4IJAA 2PEXA 2QLZA 3WTVC 3HYIA 3HSRA 2YSRA 1WKMA 1R36A 2UXNA 1YLFA 4N9IA 4YFXF 5ICCA 1FOKA 4NQWA 3CJNA 3GLXA 3KLNA 5K1YA 4YFKF 1W7PB 2WWYA 3QAHA 3TDZC 2FXAA 1JE8A 4OINF 4NHJA 3DKWA 3SHFA 4KMUX 3BY6A 1ZRCA 1SFUA 1R23A 4A0XA 2H09A 2ZJ2A 1GHCA 1HQCA 2L01A 1W4MA 2JTVA 3WTUC 4A5MA 1J59A 2DBBA 4G6QA 4FHTA 4H0EA 4LLGF 1R5GA 3CUQA 2Z33A 3WODF 2F2EA 2ZNZA 3E3VA 2EA2A 1TQPA 1UHWA 1QPMA 2ACJA 1TW3A 2PN6A 5HLIA 3SZPA 2M87A 4HDVA 2HYGD 4K2EA 2NAZA 2VE8A 2IPQX 4I7HA 1IN4A 4RGXA 3ZPLA 2KIUA 2XRNA 1XD7A 4UV9A 4LK0F 4LGWA 4KT5C 1IUYA 3MZYA 4U0VA 4M71A 4P9FA 1HKSA 2R7FA 2OQRA 2CWEA 2FOKA 2RKHA 2UWMA 4GCVA 4HYEA 4HOBA 4OU0A 1S29A 3GFIA 1OPCA 2X0LA 5E8IA 2EWNA 2DFIA 5EEGA 1TQIA 3ABTA 3DFGA 3ZMTA 5J6XA 3V8KA 3C18A 1MJ9A 1YS7A 1U5TA 1G3WA 3F6OA 3KFWX 4I2OA 2EJRA 4GO1A 4EQQA 1YW8A 1K78A 1Z1DA 2XUBA 2GIVA 1RNLA 2VC0A 2IA2A 4I0AA 4ESBA 2JPBA 2WC2A 4ASNA 4BHCA 3CUQC 2W24A 3KP6A 3V8JA 3I5UA 4RS8A 3VOEA 2V9VA 1WI9A 1J75A 4U0WA 2RVCA 1D3YA 5LHGA 2Z99A 2HKOA 4P96A 3I53A 2VOOA 4L9JA 2FQ3A 2P7VB 2XAQA 4G6DA 4I02A 3F8FA 2LNBA 3U1DA 1L3LA 3KEOA 1B59A 1KU2A 4OMYA 4IHSA 2XAJA 1D8JA 3L2CA 1IN8A 1LNWA 2L54A 3I59B 1EV7A 4EV0A 4CHUA 3D0SA 4BQAA 2HFHA 1MZBA 2A6HF 4AIKA 2H6CA 1KYZA 3BZ6A 5BS6A 3GEZA 3DV8A 4CDGA 3ML6A 3HTUA 3R6SA 4BHPA 4CICA 4EGYA 4G7ZF 3KCCA 4XLPF 2M8EA 4S05A 4AIJA 1FSEA 3KETA 1WWXA 2QBYA 2VXZA 1QZYA 4A12A 3SFZA 1HKTA 3M9AA 3ABUA 1S8NA 4EJUA 2CSOA 1R58A 5ILSA 2GXGA 4ON0A 1H9GA 4BYYA 5A2QK 1FLIA 2K7LA 2G7UA 3RYPA 3MAJA 1KQ8A 1Z6TA 2QZ8A 3FWEA 3WTXC 3G3ZA 2GWRA 1B9MA 3QOPA 1D8KA 4DQ2A 1FYKA 3GXOA 2XGXA 1FYMA 1I5ZA 3RJPA 1IN5A 2K4BA 2E7XA 1YW7A 2HTJA 5L3EA 1SD6A 2BYVE 4YG2F 5H6RA 3ECHA 1C0WA 2VBWA 2HQNA 1X3UA 5D4SA 4GYGA 4AIHA 4E70A 4MTDA 4I01A 1XMAA 1D5VA 3GO5A 4FX4A 4EJOA 1HW1A 3KP3A 3GVAA 4P55A 1F4KA 1SFXA 1MDMA 1REPC 5F64A 3REOA 4PGHA 3F8NA 2XIGA 2O3FA 2CQKA 2VN2A 2HWVA 2AS5F 3J80Z 3ZQ7A 1K79A 3I59A 2GA1A 4B8XA 4B09A 1MDMB 2PG4A 3EDPA 4N0BA 4ZYEA 4LG0A 3GYHX 4Q47A 5CLSA 3ELKA 5LGUA 1MGTA 4RAYA 5LGNA 3LQRA 5JR3A 5D8LB 3JAMK 4ENNA 2BBYA 3GF2A 3ZMUA 4G94A 3FMQA 5K5RA 2MBFA 1GXPA 2OZ6A 2CG4A 2E1NA 2EFNA 1USSA 1F1ZA 2P7CB 1BIBA 2QYOA 4RGRA 3NQOA 2XASA 3CUQB 4YIFA 2NS0A 4AWXB 2IRFG 1IW7F 2D2WA 1FBQA 2VT2A 2PQ8A 4IRGA 4CZZA 2V6CA 4A0ZA 1R00A 2BGCA 1YTYA 3CDHA 1KYWA 1P4AA 4IF4A 2HYFA 5L3DA 5HDKA 1WQ2A 2GAUA 3R60A 4XRFA 1HSJA 1SAXA 1U5TB 2MLKA 3WTZA 4O6JA 5BQTA 3WGGA 1ZGAA 3Q9SA 4L0ZB 2DK5A 3JTGA 1CF7A 4UV8A 1DUXC 3DEUA 3N4MA 3T8RA 5LHHA 4M73A 2AXLA 2JZYA 2QQAA 2VC1A 5FD6A 1I6XA 3MCZA 1YG2A 4BNCA 4OIOF 2FMLA 3K9TA 3BROA 2O03A 1DDNA 2C6YA 4BAYA 1H0MA 1YIOA 3O6BB 4KIBA 4EM2A 1FSHA 4A6DA 3HRTA 3GWZA 3C1DA 2YR2A 3HOSA 5CVUA 3WU0A 1FX7A 5F6FA 3E6CC 4HX8A 3VB2A 3HOTA 1DPUA 5ICFA 4ENJA 2L3DA 4PGGA 2D1HA 3LAJA 4HV5A 1QBJA 2YX7A 3GX4X 1BC7C 1JHHA 2G9WA 1KU9A 2OZUA 3O2PE 4TV7A 1SD4A 2W84A 2B0LA 4NB5A 3JTHA 1XGNA 2CO5A 3E97A 3U2RA 2PLYA 2BEOA 3BOQA 3Q5FA 1ZAOA 3TO9A 5L3BA 4G7OF 1TTYA 3FMSA 5D4RA 2NNYA 2PJPA 5LHIA 5LBQA 1IAWA 3BDDA 2F5CA 5ERIA 5FD5A 1J2XA 1W7PD 2UZKA 3HTSB 1ZLKA 1UB9A 4KFCA 1Z6RA 3I4PA 4OIRF 2RNJA 3P9CA 1TQMA 1RUNA 2DT5A 5IT9K 4M6YA 5LGTA 1LDJA 1OYYA 1P92A 4RAZA 4MGRA 5LLQA 1T0FA 3R61A 4M72A 4KIGA 4Y15A 2HEOA 1XGOA 3ZMSA 1PP7U 1BI0A 3DF8A 3S2WA 3P9IA 2Q2EA 1BN5A 5DV5A 5LRSA 3DXJF 1T38A 1B6AA 2FSWA 3TKYA 1QZZA 2ETHA 5JHUA 4M9ZA 2STTA 5J8FA 2COMA 2OA4A 2ISZA 4IRIA 3KP5A 3MWMA 1ZG3A 5DEQA 4UVAA 1I1SA 2XVCA 1ON1A 4RB3C 2A69F 4RGUA 2RC4A 1BOAA 2V1UA 3L09A 3T8TA 1TNTA 1UHMA 4Q4ZF 2V1XA 2H27A 2Y75A 5D5VB 4XSZF 1ZYRF 5E1WA 5L3GA 3LSTA 5HS8A 4WK8F 2FRHA 5BPIA 2IA1A 4UHTA 4D0PA 1R1UA 2QBYB 2FU4A 2EA4A 3FM5A 3GZ5A 5CVJA 3OOPA 1P6RA 3KLOA 2PBIA 4LMYA 1MKMA 2OBPA 3IKTA 1R5HA 4I09A 1IN6A 1O7LA 5IT3A 3LA2A 4HLYA 1RZ4A 2CYYA 1MD0A 3ZN1A 2LKPA 3DPTA 4L0YB 3LA7A 2EK5A 2E7WA 4HF2A 1YO5C 4Y13A 2DU9A 2L4MA 1OR7A 2IT0A 3QP5A 2FEZA 3F8BA 4HF0A 3KP7A 3BJ6A 2XAHA 4L9TA 2DW4A 1STZA 1FY7A 2FBHA 2QVOA 3WG9A 1XSXA 2JPCA 4IHTA 2GA2A 1DPRA 1ULYA 3BJAA 1T2KA 3RPQA 2LSOA 1SMTA 3GUDA 5HS7A 3RDIA 4KIFA 4ZYGA 1YW9A 5DCMB 4GXOA 2TDXA 2CW0F 1VTNC 2EV0A 4P9UA 2RDPA 4M6XA 3T5XA 2ZKZA 3TO7A 4UVBA 3BPVA 1HKQA 3GZ6A 3FZVA 2R7DA 5FLXK 3HHHA 1LDDA 1XGMA 3PQJA 2ZCWA 3V8LA 1Z91A 4BH9A 4R8HA 1FP1D 2O8XA 3I58A 4LG0B 5DDGA 5HLHA 3ROUA 1YQAA 1ZREA 2D1VA 3KZYA 3EUHA 3SXYA 2DPDA 5D6FA 1G6NA 2MH2A 3ZP5A 4KN4X 1O57A 2PFBA 4HLXA 2NYXA 5TRDA 2L02A 2KJBA 3QU3A 4U88A 3C7JA 1R1TA 3PQKA 2ESHA 5KVRA 1U78A 3IWZA 1ZLJA 3KZZA 4QLCU 3M7GA 4GGGA 1KU3A 1W5TA 1BM9A 3HRUA 2GXBA 4OIPF 2O6GE 2RQPA 4KN7X 1ZG1A 3IWFA 3E6DA 5D6EA 3DQVC 5D5XB 4IRHA 4Y17A 3W6JB 1BBYA 2CFXA 2OU2A 2ZMEB 4YFNF 4EM0B 5K5OA 1XCBA 2E1CA 1S6LA 4ENMA 1TLHB 4JBAA 3IRQA 2RN7A 1CF7B 5E17F 3PFIA 2QM3A 2O61A 3RPUA 2QUFA 1HBXG 2PMUA 3OV8A 4F7ZA 1FT9A 4WF2A 2LDUA 3K1NA 4LB6B 1FZPB 1KQ9A 1IF1A 2OQGA 5ICEA 3WGIA 1XMKA 4HBLA 1G3YA 1RIOH 4A0YA 1FBSA 3V7RA 3T1BA 1JXSA 1TW2A 3ZMVA 3E6MA 4AVPA 3WE3A 4EJVA 3IHUA 1BI1A 3J81Z 5CYVA 2Q0OA 1B1BA 2ZO4A 2DO7A 2VONA 3TGNA 4O3MA 1U3EM 2K02A 1HW5A 5ED4A 1JGSA 3RIRA 2W85A 4WWCA 1W7PA 4U0YA 2CGPA 1IN7A 1U6GA 3FM3A 3QRFF 4HQEA 1DP7P 2K4JA 5LRRA 4UVCA 3E6BA 4UUVA 4MEYF 4CGZA 4ZZDA 3I71A 2KKOA 4CXFA 1U2WA 2YX4A 3VFZA 3ZMDA 4EMSA 3GFMA 3HRSA 2DPUA 1ZH5A 2BE5F 2HTSA 2IVMA 1WRJA 1LQ1A 2QENA 2IP2A 3H92A 1UCRA 3SQNA 3TQNA 3HUGA 4XLNF 4KMFA 3NEUA 2O0YA 1V4RA 2HR3A 1L0OC 3RI4A 1PDNC 2BV6A 4JK1X 4HZFA 2ZBKA 2VBYA 1H9TA 3HSEA 5LEKA 2XROA 1BJAA 2YPRA 5JVTA 2EFQA 3KEQA 3BPXA 4KYWA 3E5UA 4OOIA 1XDSA 5FB2A 5FFXA 2W57A 2XKPA 1LVAA 1ZRFA 4EJTA 3IC7A 3MEXA 4KNYA 2FBIA 1BI2A 4A6EA 1WSUA 3COAC 2PI0A 1LEBA 5DCFA 1SFEA 2XKOA 4UXNA 4MQ9F 2P5VA 3RKYA 1GXQA 3VODA 5JI6A 3P7NA 1OYWA 1Z9CA 1R1VA 2FA5A 3BJOA 2MH9A 1K7AA 3IKVA 2YU3A 2D45A 1E2XA 4S04A 2KRFA 2ISYA 1CGPA 5FO5A 5AONA 2F5FA 3V7CA 3M1EA 1IRGA 4WX9A 4IXAA 4LFUA 2KJCA 2M45A 1XSVA 1T98A 4ZYHA 5TJJA 5CVVA 2L4AA 1MJAA 2H94A 4FX0A 1FP2A 2WTEA 2GZWA 2VE9A 2LF8A 2FMYA 2MLGA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2V79 A;  4HX4 A;  3F21 A;  2FBK A;  4M74 A;  5ICG A;  2X4H A;  3P9K A;  5CVI A;  4LB5 A;  1OYI A;  4WXH A;  4Z2Y A;  5HS9 A;  2KIM A;  2QQB A;  2J5O A;  2FF4 A;  1KA8 A;  5FGM A;  1G3S A;  3RYR A;  5E1X A;  4DNC A;  2R3S A;  4UNO A;  1ZGJ A;  4L9V A;  4HF1 A;  4WCG A;  5BPD A;  3L7W A;  3Q9V A;  5E18 F;  2HQR A;  2XAG A;  1IRF A;  2QWW A;  4IPA A;  1EH8 A;  3MFK A;  2Z5U A;  1ZRD A;  2FNA A;  4LLL A;  3M8E A;  1MJB A;  4KA4 A;  1J7K A;  3FXR A;  4ESF A;  1OKR A;  3G73 A;  3K69 A;  3F22 A;  2IJL A;  3K1M A;  3TDU C;  1AOY A;  4CO8 A;  1FWZ A;  2HOE A;  1XN7 A;  4HQM A;  1UST A;  1EH7 A;  4I98 B;  3H3U A;  3J81 K;  3K2Z A;  3QU6 A;  3K0L A;  4N9H A;  4OMZ A;  4KIC A;  4LJZ F;  1HW2 A;  4PCQ A;  2XV4 S;  3T0Y A;  3DPL C;  3AAF A;  1I27 A;  3R0J A;  3E5X A;  3DP7 A;  4G7H F;  1XCV A;  2H6B A;  5AIQ A;  5IT9 Z;  5KK1 A;  4ETS A;  1T6S A;  2F5E A;  3R0A A;  5JFR A;  3IRR A;  3WE2 A;  2VBZ A;  2G7H A;  2RGV A;  5F1R A;  3CO6 C;  3HHG A;  4ZYD A;  3WTY C;  3GFJ A;  5E8G A;  3TOB A;  2ZNY A;  5CJ9 A;  1J5Y A;  3F3X A;  4JQF A;  3LWF A;  4KUM A;  2DAO A;  5E20 A;  3ERE D;  3ULQ B;  1A04 A;  1U8R A;  2HGC A;  5E1Z B;  2DQR A;  2Z3Y A;  2VOD A;  4LD5 A;  4L9N A;  1LJ9 A;  4PZJ A;  5DYM A;  1ONV A;  5AIP A;  2EB7 A;  3V4G A;  1E17 A;  3K1P A;  3R4K A;  3HIF A;  4HAM A;  4QWQ A;  1QNT A;  3H3Z A;  5HLG A;  2ELH A;  2DTR A;  3ISP A;  1J0R A;  3LA3 A;  3F6V A;  1W5S A;  2P5K A;  1IXC A;  4I0B A;  5DUI A;  5BMZ A;  2WV0 A;  3QP6 A;  3MQ0 A;  1PP8 F;  4XSX F;  3U9G A;  2Y48 A;  3JSO A;  2EFP A;  5D8K B;  2QQ9 A;  1AWC A;  4YII A;  4WXC A;  4RB2 C;  1BIA A;  1RUO A;  1O3S A;  1K78 B;  3EQL F;  4IVN A;  3LFK A;  4EVI A;  1KU7 A;  3BWG A;  3F8C A;  1FYL A;  1K6O A;  4M9S A;  3GW2 A;  1S7A A;  4ENK A;  2LF7 A;  3CLO A;  2MA3 A;  1J9I A;  1YYV A;  2M1B A;  4M9X A;  2K86 A;  3VEP A;  1QGP A;  2EFO A;  2OD5 A;  3QPT A;  4O5V A;  5LEJ A;  1FC3 A;  3I54 A;  4HX7 A;  4CYD A;  4R1H A;  4RB0 A;  3RKX A;  5BOX A;  3BP8 A;  1O3Q A;  1I1G A;  2A68 F;  1KQ0 A;  3EET A;  1HXD A;  1OMI A;  2FE3 A;  1ODD A;  1V3F A;  5A2Q Z;  4L18 B;  1XDU A;  3F72 A;  2V1D A;  5HVQ C;  2JT1 A;  1ZHF A;  2DLL A;  3FXQ A;  2MC3 A;  2JRT A;  2VOP A;  3J80 K;  4LLN A;  3LAP A;  2W25 A;  4BHB A;  1O3R A;  1SD5 A;  4MEX F;  4Q5S F;  2HKX A;  1IZ1 A;  3V7S A;  1BI3 A;  4MTE A;  1JHF A;  3L9F A;  1TBX A;  4BXU A;  1QO0 D;  2A3S A;  4A2U A;  1YFH A;  1HST A;  3E5Q A;  4RGS A;  1LEA A;  4XBF A;  3JAM Z;  4PDK A;  2A5Y B;  5HDN A;  5DD4 A;  3ZMZ A;  2EV5 A;  3WGH A;  4ZH4 F;  1T39 A;  1R7J A;  5H6Q A;  1PUE E;  3FX3 A;  5FLX Z;  2ESN A;  2HZT A;  3HSF A;  3F8M A;  1NHA A;  5FFZ A;  4KDP A;  2A07 F;  4EJW A;  1UFM A;  3NRV A;  1G4D A;  2Y0M A;  1FBU A;  3JSP A;  2HDC A;  5L3C A;  3ZN0 A;  1ON2 A;  1SD7 A;  1G3T A;  1Q1H A;  4HDU A;  2DK8 A;  3W6K B;  1O7F A;  1IXR C;  3RTR A;  2DQL A;  3RKW A;  3EYI A;  1Z05 A;  1Z7U A;  1F9N A;  4GYI A;  5HOO A;  1LDK B;  2HS5 A;  5D5W B;  1O3T A;  2ZXJ A;  4LK1 F;  1FNN A;  3B73 A;  2IA0 A;  2MD5 A;  4RB1 A;  2IW5 A;  5D5U B;  4ZZL A;  2VT3 A;  3O3K A;  1F5T A;  4FT8 A;  4L5J A;  2P6S A;  5DD8 A;  5DUK A;  2VBX A;  4G9Y A;  1B9N A;  2M5W A;  2NNN A;  3C3W A;  4EGZ A;  3FHZ A;  3N97 A;  1P4W A;  3EYY A;  2J5P A;  2ADU A;  3LQQ A;  3B02 A;  2P4W A;  2XHK A;  3KP2 A;  1EH6 A;  3HRM A;  4OIQ F;  5ILV A;  3WTS C;  3WTT C;  3JW4 A;  2P6T A;  2XAF A;  1U5T C;  2F5D A;  5K5Q A;  3CTA A;  2EV6 A;  2DI3 A;  1ZG5 A;  2A6E F;  3D5L A;  2P5L C;  1ZAR A;  3F23 A;  4R79 A;  1FPQ A;  5EEH A;  2UXX A;  2RV8 A;  4WXD A;  3GFL A;  3L00 A;  5H20 A;  5DCM A;  4U7D A;  4EM1 A;  1ZN2 A;  4HW0 A;  1Y0U A;  1P4X A;  3M8F A;  2JSC A;  3CO7 C;  3I64 A;  2M30 A;  1LB2 A;  1KGS A;  4HV6 A;  1XGS A;  3CUO A;  3J7A O;  4ESJ A;  3SZT A;  2K27 A;  1RI7 A;  6PAX A;  5J8C A;  4U7B A;  1BC8 C;  3I0T A;  4AD9 A;  4MHG A;  4P5O A;  1TNS A;  3MZH A;  3WU1 B;  1IXS B;  3FMR A;  2Z9O A;  2ZME A;  2ZFW A;  2STW A;  1S7O A;  3IL2 A;  5CVR A;  1XSD A;  2KIF A;  1XB4 A;  4HA8 A;  5HDG A;  1SMY F;  2PMH A;  2FNP A;  1R22 A;  3FXU A;  4MQV A;  2Q8K A;  2P8T A;  2OAZ A;  2GQQ A;  3KP4 A;  1P2F A;  1QQI A;  1YS6 A;  2NRA C;  1S3J A;  3KE2 A;  3TOA A;  2EFW A;  3TO6 A;  3ECO A;  5L3F A;  4MNU A;  5ILU A;  4L5I A;  1B4A A;  4A5N A;  2A61 A;  4G8X A;  3WTW C;  3FF5 A;  3QPH A;  1GVJ A;  4Q48 A;  4IJA A;  2PEX A;  2QLZ A;  3WTV C;  3HYI A;  3HSR A;  2YSR A;  1WKM A;  1R36 A;  2UXN A;  1YLF A;  4N9I A;  4YFX F;  5ICC A;  1FOK A;  4NQW A;  3CJN A;  3GLX A;  3KLN A;  5K1Y A;  4YFK F;  1W7P B;  2WWY A;  3QAH A;  3TDZ C;  2FXA A;  1JE8 A;  4OIN F;  4NHJ A;  3DKW A;  3SHF A;  4KMU X;  3BY6 A;  1ZRC A;  1SFU A;  1R23 A;  4A0X A;  2H09 A;  2ZJ2 A;  1GHC A;  1HQC A;  2L01 A;  1W4M A;  2JTV A;  3WTU C;  4A5M A;  1J59 A;  2DBB A;  4G6Q A;  4FHT A;  4H0E A;  4LLG F;  1R5G A;  3CUQ A;  2Z33 A;  3WOD F;  2F2E A;  2ZNZ A;  3E3V A;  2EA2 A;  1TQP A;  1UHW A;  1QPM A;  2ACJ A;  1TW3 A;  2PN6 A;  5HLI A;  3SZP A;  2M87 A;  4HDV A;  2HYG D;  4K2E A;  2NAZ A;  2VE8 A;  2IPQ X;  4I7H A;  1IN4 A;  4RGX A;  3ZPL A;  2KIU A;  2XRN A;  1XD7 A;  4UV9 A;  4LK0 F;  4LGW A;  4KT5 C;  1IUY A;  3MZY A;  4U0V A;  4M71 A;  4P9F A;  1HKS A;  2R7F A;  2OQR A;  2CWE A;  2FOK A;  2RKH A;  2UWM A;  4GCV A;  4HYE A;  4HOB A;  4OU0 A;  1S29 A;  3GFI A;  1OPC A;  2X0L A;  5E8I A;  2EWN A;  2DFI A;  5EEG A;  1TQI A;  3ABT A;  3DFG A;  3ZMT A;  5J6X A;  3V8K A;  3C18 A;  1MJ9 A;  1YS7 A;  1U5T A;  1G3W A;  3F6O A;  3KFW X;  4I2O A;  2EJR A;  4GO1 A;  4EQQ A;  1YW8 A;  1K78 A;  1Z1D A;  2XUB A;  2GIV A;  1RNL A;  2VC0 A;  2IA2 A;  4I0A A;  4ESB A;  2JPB A;  2WC2 A;  4ASN A;  4BHC A;  3CUQ C;  2W24 A;  3KP6 A;  3V8J A;  3I5U A;  4RS8 A;  3VOE A;  2V9V A;  1WI9 A;  1J75 A;  4U0W A;  2RVC A;  1D3Y A;  5LHG A;  2Z99 A;  2HKO A;  4P96 A;  3I53 A;  2VOO A;  4L9J A;  2FQ3 A;  2P7V B;  2XAQ A;  4G6D A;  4I02 A;  3F8F A;  2LNB A;  3U1D A;  1L3L A;  3KEO A;  1B59 A;  1KU2 A;  4OMY A;  4IHS A;  2XAJ A;  1D8J A;  3L2C A;  1IN8 A;  1LNW A;  2L54 A;  3I59 B;  1EV7 A;  4EV0 A;  4CHU A;  3D0S A;  4BQA A;  2HFH A;  1MZB A;  2A6H F;  4AIK A;  2H6C A;  1KYZ A;  3BZ6 A;  5BS6 A;  3GEZ A;  3DV8 A;  4CDG A;  3ML6 A;  3HTU A;  3R6S A;  4BHP A;  4CIC A;  4EGY A;  4G7Z F;  3KCC A;  4XLP F;  2M8E A;  4S05 A;  4AIJ A;  1FSE A;  3KET A;  1WWX A;  2QBY A;  2VXZ A;  1QZY A;  4A12 A;  3SFZ A;  1HKT A;  3M9A A;  3ABU A;  1S8N A;  4EJU A;  2CSO A;  1R58 A;  5ILS A;  2GXG A;  4ON0 A;  1H9G A;  4BYY A;  5A2Q K;  1FLI A;  2K7L A;  2G7U A;  3RYP A;  3MAJ A;  1KQ8 A;  1Z6T A;  2QZ8 A;  3FWE A;  3WTX C;  3G3Z A;  2GWR A;  1B9M A;  3QOP A;  1D8K A;  4DQ2 A;  1FYK A;  3GXO A;  2XGX A;  1FYM A;  1I5Z A;  3RJP A;  1IN5 A;  2K4B A;  2E7X A;  1YW7 A;  2HTJ A;  5L3E A;  1SD6 A;  2BYV E;  4YG2 F;  5H6R A;  3ECH A;  1C0W A;  2VBW A;  2HQN A;  1X3U A;  5D4S A;  4GYG A;  4AIH A;  4E70 A;  4MTD A;  4I01 A;  1XMA A;  1D5V A;  3GO5 A;  4FX4 A;  4EJO A;  1HW1 A;  3KP3 A;  3GVA A;  4P55 A;  1F4K A;  1SFX A;  1MDM A;  1REP C;  5F64 A;  3REO A;  4PGH A;  3F8N A;  2XIG A;  2O3F A;  2CQK A;  2VN2 A;  2HWV A;  2AS5 F;  3J80 Z;  3ZQ7 A;  1K79 A;  3I59 A;  2GA1 A;  4B8X A;  4B09 A;  1MDM B;  2PG4 A;  3EDP A;  4N0B A;  4ZYE A;  4LG0 A;  3GYH X;  4Q47 A;  5CLS A;  3ELK A;  5LGU A;  1MGT A;  4RAY A;  5LGN A;  3LQR A;  5JR3 A;  5D8L B;  3JAM K;  4ENN A;  2BBY A;  3GF2 A;  3ZMU A;  4G94 A;  3FMQ A;  5K5R A;  2MBF A;  1GXP A;  2OZ6 A;  2CG4 A;  2E1N A;  2EFN A;  1USS A;  1F1Z A;  2P7C B;  1BIB A;  2QYO A;  4RGR A;  3NQO A;  2XAS A;  3CUQ B;  4YIF A;  2NS0 A;  4AWX B;  2IRF G;  1IW7 F;  2D2W A;  1FBQ A;  2VT2 A;  2PQ8 A;  4IRG A;  4CZZ A;  2V6C A;  4A0Z A;  1R00 A;  2BGC A;  1YTY A;  3CDH A;  1KYW A;  1P4A A;  4IF4 A;  2HYF A;  5L3D A;  5HDK A;  1WQ2 A;  2GAU A;  3R60 A;  4XRF A;  1HSJ A;  1SAX A;  1U5T B;  2MLK A;  3WTZ A;  4O6J A;  5BQT A;  3WGG A;  1ZGA A;  3Q9S A;  4L0Z B;  2DK5 A;  3JTG A;  1CF7 A;  4UV8 A;  1DUX C;  3DEU A;  3N4M A;  3T8R A;  5LHH A;  4M73 A;  2AXL A;  2JZY A;  2QQA A;  2VC1 A;  5FD6 A;  1I6X A;  3MCZ A;  1YG2 A;  4BNC A;  4OIO F;  2FML A;  3K9T A;  3BRO A;  2O03 A;  1DDN A;  2C6Y A;  4BAY A;  1H0M A;  1YIO A;  3O6B B;  4KIB A;  4EM2 A;  1FSH A;  4A6D A;  3HRT A;  3GWZ A;  3C1D A;  2YR2 A;  3HOS A;  5CVU A;  3WU0 A;  1FX7 A;  5F6F A;  3E6C C;  4HX8 A;  3VB2 A;  3HOT A;  1DPU A;  5ICF A;  4ENJ A;  2L3D A;  4PGG A;  2D1H A;  3LAJ A;  4HV5 A;  1QBJ A;  2YX7 A;  3GX4 X;  1BC7 C;  1JHH A;  2G9W A;  1KU9 A;  2OZU A;  3O2P E;  4TV7 A;  1SD4 A;  2W84 A;  2B0L A;  4NB5 A;  3JTH A;  1XGN A;  2CO5 A;  3E97 A;  3U2R A;  2PLY A;  2BEO A;  3BOQ A;  3Q5F A;  1ZAO A;  3TO9 A;  5L3B A;  4G7O F;  1TTY A;  3FMS A;  5D4R A;  2NNY A;  2PJP A;  5LHI A;  5LBQ A;  1IAW A;  3BDD A;  2F5C A;  5ERI A;  5FD5 A;  1J2X A;  1W7P D;  2UZK A;  3HTS B;  1ZLK A;  1UB9 A;  4KFC A;  1Z6R A;  3I4P A;  4OIR F;  2RNJ A;  3P9C A;  1TQM A;  1RUN A;  2DT5 A;  5IT9 K;  4M6Y A;  5LGT A;  1LDJ A;  1OYY A;  1P92 A;  4RAZ A;  4MGR A;  5LLQ A;  1T0F A;  3R61 A;  4M72 A;  4KIG A;  4Y15 A;  2HEO A;  1XGO A;  3ZMS A;  1PP7 U;  1BI0 A;  3DF8 A;  3S2W A;  3P9I A;  2Q2E A;  1BN5 A;  5DV5 A;  5LRS A;  3DXJ F;  1T38 A;  1B6A A;  2FSW A;  3TKY A;  1QZZ A;  2ETH A;  5JHU A;  4M9Z A;  2STT A;  5J8F A;  2COM A;  2OA4 A;  2ISZ A;  4IRI A;  3KP5 A;  3MWM A;  1ZG3 A;  5DEQ A;  4UVA A;  1I1S A;  2XVC A;  1ON1 A;  4RB3 C;  2A69 F;  4RGU A;  2RC4 A;  1BOA A;  2V1U A;  3L09 A;  3T8T A;  1TNT A;  1UHM A;  4Q4Z F;  2V1X A;  2H27 A;  2Y75 A;  5D5V B;  4XSZ F;  1ZYR F;  5E1W A;  5L3G A;  3LST A;  5HS8 A;  4WK8 F;  2FRH A;  5BPI A;  2IA1 A;  4UHT A;  4D0P A;  1R1U A;  2QBY B;  2FU4 A;  2EA4 A;  3FM5 A;  3GZ5 A;  5CVJ A;  3OOP A;  1P6R A;  3KLO A;  2PBI A;  4LMY A;  1MKM A;  2OBP A;  3IKT A;  1R5H A;  4I09 A;  1IN6 A;  1O7L A;  5IT3 A;  3LA2 A;  4HLY A;  1RZ4 A;  2CYY A;  1MD0 A;  3ZN1 A;  2LKP A;  3DPT A;  4L0Y B;  3LA7 A;  2EK5 A;  2E7W A;  4HF2 A;  1YO5 C;  4Y13 A;  2DU9 A;  2L4M A;  1OR7 A;  2IT0 A;  3QP5 A;  2FEZ A;  3F8B A;  4HF0 A;  3KP7 A;  3BJ6 A;  2XAH A;  4L9T A;  2DW4 A;  1STZ A;  1FY7 A;  2FBH A;  2QVO A;  3WG9 A;  1XSX A;  2JPC A;  4IHT A;  2GA2 A;  1DPR A;  1ULY A;  3BJA A;  1T2K A;  3RPQ A;  2LSO A;  1SMT A;  3GUD A;  5HS7 A;  3RDI A;  4KIF A;  4ZYG A;  1YW9 A;  5DCM B;  4GXO A;  2TDX A;  2CW0 F;  1VTN C;  2EV0 A;  4P9U A;  2RDP A;  4M6X A;  3T5X A;  2ZKZ A;  3TO7 A;  4UVB A;  3BPV A;  1HKQ A;  3GZ6 A;  3FZV A;  2R7D A;  5FLX K;  3HHH A;  1LDD A;  1XGM A;  3PQJ A;  2ZCW A;  3V8L A;  1Z91 A;  4BH9 A;  4R8H A;  1FP1 D;  2O8X A;  3I58 A;  4LG0 B;  5DDG A;  5HLH A;  3ROU A;  1YQA A;  1ZRE A;  2D1V A;  3KZY A;  3EUH A;  3SXY A;  2DPD A;  5D6F A;  1G6N A;  2MH2 A;  3ZP5 A;  4KN4 X;  1O57 A;  2PFB A;  4HLX A;  2NYX A;  5TRD A;  2L02 A;  2KJB A;  3QU3 A;  4U88 A;  3C7J A;  1R1T A;  3PQK A;  2ESH A;  5KVR A;  1U78 A;  3IWZ A;  1ZLJ A;  3KZZ A;  4QLC U;  3M7G A;  4GGG A;  1KU3 A;  1W5T A;  1BM9 A;  3HRU A;  2GXB A;  4OIP F;  2O6G E;  2RQP A;  4KN7 X;  1ZG1 A;  3IWF A;  3E6D A;  5D6E A;  3DQV C;  5D5X B;  4IRH A;  4Y17 A;  3W6J B;  1BBY A;  2CFX A;  2OU2 A;  2ZME B;  4YFN F;  4EM0 B;  5K5O A;  1XCB A;  2E1C A;  1S6L A;  4ENM A;  1TLH B;  4JBA A;  3IRQ A;  2RN7 A;  1CF7 B;  5E17 F;  3PFI A;  2QM3 A;  2O61 A;  3RPU A;  2QUF A;  1HBX G;  2PMU A;  3OV8 A;  4F7Z A;  1FT9 A;  4WF2 A;  2LDU A;  3K1N A;  4LB6 B;  1FZP B;  1KQ9 A;  1IF1 A;  2OQG A;  5ICE A;  3WGI A;  1XMK A;  4HBL A;  1G3Y A;  1RIO H;  4A0Y A;  1FBS A;  3V7R A;  3T1B A;  1JXS A;  1TW2 A;  3ZMV A;  3E6M A;  4AVP A;  3WE3 A;  4EJV A;  3IHU A;  1BI1 A;  3J81 Z;  5CYV A;  2Q0O A;  1B1B A;  2ZO4 A;  2DO7 A;  2VON A;  3TGN A;  4O3M A;  1U3E M;  2K02 A;  1HW5 A;  5ED4 A;  1JGS A;  3RIR A;  2W85 A;  4WWC A;  1W7P A;  4U0Y A;  2CGP A;  1IN7 A;  1U6G A;  3FM3 A;  3QRF F;  4HQE A;  1DP7 P;  2K4J A;  5LRR A;  4UVC A;  3E6B A;  4UUV A;  4MEY F;  4CGZ A;  4ZZD A;  3I71 A;  2KKO A;  4CXF A;  1U2W A;  2YX4 A;  3VFZ A;  3ZMD A;  4EMS A;  3GFM A;  3HRS A;  2DPU A;  1ZH5 A;  2BE5 F;  2HTS A;  2IVM A;  1WRJ A;  1LQ1 A;  2QEN A;  2IP2 A;  3H92 A;  1UCR A;  3SQN A;  3TQN A;  3HUG A;  4XLN F;  4KMF A;  3NEU A;  2O0Y A;  1V4R A;  2HR3 A;  1L0O C;  3RI4 A;  1PDN C;  2BV6 A;  4JK1 X;  4HZF A;  2ZBK A;  2VBY A;  1H9T A;  3HSE A;  5LEK A;  2XRO A;  1BJA A;  2YPR A;  5JVT A;  2EFQ A;  3KEQ A;  3BPX A;  4KYW A;  3E5U A;  4OOI A;  1XDS A;  5FB2 A;  5FFX A;  2W57 A;  2XKP A;  1LVA A;  1ZRF A;  4EJT A;  3IC7 A;  3MEX A;  4KNY A;  2FBI A;  1BI2 A;  4A6E A;  1WSU A;  3COA C;  2PI0 A;  1LEB A;  5DCF A;  1SFE A;  2XKO A;  4UXN A;  4MQ9 F;  2P5V A;  3RKY A;  1GXQ A;  3VOD A;  5JI6 A;  3P7N A;  1OYW A;  1Z9C A;  1R1V A;  2FA5 A;  3BJO A;  2MH9 A;  1K7A A;  3IKV A;  2YU3 A;  2D45 A;  1E2X A;  4S04 A;  2KRF A;  2ISY A;  1CGP A;  5FO5 A;  5AON A;  2F5F A;  3V7C A;  3M1E A;  1IRG A;  4WX9 A;  4IXA A;  4LFU A;  2KJC A;  2M45 A;  1XSV A;  1T98 A;  4ZYH A;  5TJJ A;  5CVV A;  2L4A A;  1MJA A;  2H94 A;  4FX0 A;  1FP2 A;  2WTE A;  2GZW A;  2VE9 A;  2LF8 A;  2FMY A;  2MLG A; 
#chains in the Genus database with same CATH topology
 1X2M A;  2GLO A;  2V79 A;  5E3M A;  4HX4 A;  2LH9 A;  1ZR4 A;  2VJI A;  3I4M J;  3F21 A;  2FBK A;  4XM3 A;  4M74 A;  1WCM J;  3CLQ A;  1UAA A;  3HOW J;  5ICG A;  1XG1 A;  2X4H A;  2XPU A;  3P9K A;  5CVI A;  4PJL A;  3PFY A;  4LB5 A;  1OYI A;  4WXH A;  2VJ5 A;  4Z2Y A;  5HS9 A;  2KIM A;  2QQB A;  4AID A;  1YRN B;  3WHC A;  2DMN A;  2J5O A;  2FF4 A;  5M5W J;  3KYC B;  3L2Q A;  2JA8 J;  1KA8 A;  5FGM A;  1G3S A;  4HPQ A;  3RYR A;  5E1X A;  1WJE A;  5E3N A;  4ZJZ A;  4DNC A;  3OYF A;  4IQJ A;  2R3S A;  1DGW Y;  4UNO A;  1ZGJ A;  4L9V A;  4HF1 A;  1W1W E;  1BR2 A;  1UHS A;  1JGG A;  1RRJ A;  4WCG A;  2LKX A;  4OAZ A;  5BPD A;  3L7W A;  3Q9V A;  5E18 F;  2HQR A;  3G2B A;  3ZQI A;  4XKV A;  3DU6 A;  2XAG A;  2HZD A;  3OYC A;  1IRF A;  2QWW A;  4IPA A;  1EH8 A;  2PMZ A;  3KIO A;  3KEY A;  5C4J J;  3CP8 A;  3MFK A;  1ETW A;  2AQE A;  2Z5U A;  3LSR A;  1ZRD A;  1IO2 A;  1TWF J;  1N25 A;  4ZDP A;  1D1C A;  5M5Y J;  2Y2Z A;  1D1A A;  2DA2 A;  2FNA A;  3DTE A;  4LLL A;  3M8E A;  1MJB A;  4KA4 A;  1RR8 C;  1J7K A;  2EBI A;  3FXR A;  4ESF A;  4NBQ A;  2DFF A;  1OKR A;  3G73 A;  3I4N J;  2XPV A;  4ZTF A;  3GTM J;  3K69 A;  3F22 A;  2IJL A;  3D1N I;  3K1M A;  3TDU C;  4XKW A;  1AOY A;  1P7J A;  1FWZ A;  4CO8 A;  3OYJ A;  2VKE A;  5E3O A;  2HOE A;  1XN7 A;  4HQM A;  1UST A;  3DCF A;  1EH7 A;  2N8G A;  2VIX A;  3H3U A;  4I98 B;  4HNT A;  5GTH C;  3H35 A;  3K2Z A;  3QU6 A;  3J81 K;  3K0L A;  3RZD J;  4RDU A;  2LRE A;  4X1E A;  4N9H A;  4OMZ A;  4KIC A;  4LJZ F;  4I76 A;  3K70 C;  1HW2 A;  3FIW A;  3OR1 C;  4PCQ A;  3OSG A;  3TBI A;  2XV4 S;  3LSH A;  3DPL C;  3T0Y A;  2H8R A;  2M7A A;  5EJC A;  3OY9 A;  3AAF A;  1I27 A;  3R0J A;  3IH3 A;  3E5X A;  4PSX A;  3DP7 A;  4G7H F;  1XCV A;  2H6B A;  2H8W A;  1Y8R B;  5AIQ A;  5IT9 Z;  3BG3 A;  5KK1 A;  2JUC A;  4ETS A;  1T6S A;  3OL4 A;  1EJ9 A;  2DA7 A;  4EAT A;  1TWA J;  1VQO I;  2BXY A;  2F5E A;  3R0A A;  5JFR A;  5JLW A;  3IRR A;  3WE2 A;  3AG2 H;  2VBZ A;  2QSG X;  2I8D A;  3BR3 A;  2G7H A;  2RGV A;  5F1R A;  3CO6 C;  3HHG A;  4ZYD A;  3WTY C;  2Q2E B;  3GFJ A;  3BR1 A;  5E8G A;  2DMP A;  3TOB A;  3FKI J;  2ZNY A;  5CJ9 A;  1J5Y A;  3F3X A;  4JQF A;  3OS1 A;  3LWF A;  2HI3 A;  4KUM A;  2O7O A;  2DAO A;  2I10 A;  1E0E A;  2R5Y A;  5E20 A;  4W97 A;  3ERE D;  5IPA A;  2OCE A;  3HPH A;  2B7E A;  2CU7 A;  3ULQ B;  5DM6 F;  1A04 A;  2DA6 A;  1FOW A;  2LY2 A;  4II2 A;  1FIP A;  1U8R A;  2E36 A;  2HGC A;  5E1Z B;  2DQR A;  4DYQ A;  1AA7 A;  3HJE A;  3GTO J;  2Z3Y A;  4XN0 A;  1T8I A;  2VOD A;  4MFE A;  4LD5 A;  3A4C A;  4L9N A;  1K83 J;  1LJ9 A;  5DTD A;  4PZJ A;  1T56 A;  5DYM A;  1ONV A;  4CSW A;  5AIP A;  4ANJ A;  2EB7 A;  3V4G A;  1E17 A;  3K1P A;  4C2T A;  4E7H A;  2WB1 N;  3R4K A;  3HIF A;  1S7E A;  1NK2 P;  4HAM A;  4X6A J;  4QWQ A;  1LFU P;  1QNT A;  3H3Z A;  5HLG A;  2ELH A;  3RKQ A;  3CCL I;  1D1B A;  2DTR A;  2MFZ A;  3ISP A;  1J0R A;  3LA3 A;  2CJJ A;  3ZQQ A;  3VDX A;  2PMZ N;  4LIV A;  5M3M J;  3L2R A;  3F6V A;  1W5S A;  2P5K A;  4E6K G;  3CCV I;  1RPW A;  2EPF A;  5IYB J;  1ETK A;  1IXC A;  4I0B A;  5HNH A;  3MKL A;  5DUI A;  5BMZ A;  2WV0 A;  3QP6 A;  3MQ0 A;  2E71 A;  1PP8 F;  4XSX F;  2XF6 A;  4G6T B;  3U9G A;  3S1R J;  2Y48 A;  2JA5 J;  3K4B A;  3JSO A;  2EFP A;  3CCR I;  5GP9 A;  5D8K B;  2QQ9 A;  1AWC A;  4YII A;  1MMA A;  4WXC A;  3CCJ I;  4DIQ A;  4RB2 C;  2M7B A;  3CD6 I;  5H2F C;  1BIA A;  1UJ8 A;  1RUO A;  4UB8 C;  1O3S A;  1K78 B;  4ZC3 A;  4EEF G;  1TWH J;  4CUG A;  4QPO A;  2XSD C;  3EQL F;  4IVN A;  3CMM A;  2E5N A;  4C2U A;  3LFK A;  1SFO J;  1N77 A;  4EVI A;  2WY8 Q;  4IQ4 A;  1KU7 A;  3BWG A;  3F8C A;  4UUS A;  1FYL A;  1K6O A;  4M9S A;  3ZCO A;  3GW2 A;  1X4O A;  1S7A A;  4ENK A;  3A01 B;  2IEK A;  2LF7 A;  3EUH C;  3CLO A;  3S2H J;  1NTC A;  5FKN A;  5F27 A;  2GM4 A;  2MA3 A;  4RLF A;  3GTP J;  1J9I A;  1YYV A;  1A6I A;  2M1B A;  1V5G A;  4M9X A;  5F04 A;  2K86 A;  3VEP A;  3CCM I;  1MH4 A;  2VAS A;  1QGP A;  4XOP A;  5B3S H;  3A03 A;  1EKE A;  2EFO A;  2OD5 A;  3QPT A;  1B72 B;  4O5V A;  5LEJ A;  2OPT A;  1FC3 A;  3I54 A;  4HX7 A;  1T0F C;  3OOU A;  1W0U A;  4CYD A;  2M9H A;  4XLF A;  4R1H A;  4BY1 J;  4RB0 A;  3RKX A;  5BOX A;  2KZG A;  3BP8 A;  1O3Q A;  1I1G A;  2A68 F;  3TP3 A;  5J4V A;  1KQ0 A;  3EET A;  1HXD A;  3DBR B;  1OIS A;  1OMI A;  3VYU B;  2FE3 A;  2OTJ I;  4CCN A;  1ODD A;  1V3F A;  5A2Q Z;  1FEX A;  3IP4 B;  4L18 B;  4DYR A;  3PNT A;  1XDU A;  2IAI A;  4E7L A;  3F72 A;  2V1D A;  3BR6 A;  1WGX A;  2OV7 A;  2DMU A;  2JT1 A;  1ZHF A;  5HVQ C;  2DLL A;  4V19 K;  3FXQ A;  2MC3 A;  2JRT A;  2VOP A;  3ZQH A;  3J80 K;  2NVU B;  4LLN A;  4L5E A;  3OYA A;  3LAP A;  2W25 A;  4BHB A;  2DFE A;  4IO9 F;  1O3R A;  1SD5 A;  3ZR8 X;  4MEX F;  3L2W A;  2M4K A;  4Q5S F;  2AQF A;  1IZ1 A;  2HKX A;  3V7S A;  1BI3 A;  1WPK A;  4MTE A;  4YIR X;  1JHF A;  3L9F A;  4BY7 J;  1TBX A;  4BXU A;  3A01 A;  1QO0 D;  4MLO A;  2A3S A;  4XKB A;  4A2U A;  1YFH A;  3JRI A;  5LD2 C;  1DGR M;  2W82 A;  2BZT A;  1HST A;  3SDB A;  1OCR H;  3CCQ I;  1G8X A;  3E5Q A;  3P5J A;  3I3L A;  4B44 A;  2ID3 A;  3ASN H;  2JVG A;  4RGS A;  1B8I B;  1LEA A;  4G12 A;  4BAC A;  4XBF A;  3JAM Z;  4PDK A;  2A5Y B;  5HDN A;  2K3F A;  3S14 J;  4C9Y A;  2CQN A;  4E7S A;  5DD4 A;  4CCK A;  1LUJ B;  1T33 A;  3ZMZ A;  4F93 B;  1LVK A;  2EV5 A;  3WGH A;  4ZH4 F;  1T39 A;  2X9D A;  2NVX J;  1MBF A;  2BY3 A;  2L9N A;  1R7J A;  5H6Q A;  1PUE E;  3FX3 A;  5FLX Z;  3MKW B;  2ESN A;  2K5C A;  3K70 D;  2F5V A;  2LBF A;  2HZT A;  3HSF A;  2K9L A;  1NHA A;  2Y69 H;  3F8M A;  4ITV A;  5FFZ A;  4AYB A;  4E4H A;  4KDP A;  2A07 F;  4EJW A;  1WJ5 A;  4RLQ A;  1UFM A;  3NRV A;  3J7Z I;  1G4D A;  2KP6 A;  4F55 A;  1JKP C;  3PM1 A;  4A93 J;  2Y0M A;  3BQZ A;  3H1C A;  1FBU A;  3BZK A;  3JSP A;  2HDC A;  1RKT A;  3ZN0 A;  5L3C A;  1SD7 A;  1ON2 A;  1QRY A;  1G3T A;  1Q1H A;  1Z7L A;  2KQR A;  2L0K A;  5IY5 H;  4HDU A;  1VQK I;  2DK8 A;  4B4C A;  3W6K B;  2DOF A;  1O7F A;  1IXR C;  3RTR A;  2DQL A;  4C3I J;  4F91 B;  1TWC J;  3RKW A;  4B47 A;  1R5I D;  5JHF A;  2VQH A;  3EYI A;  1Z05 A;  1VQ5 I;  1Z7U A;  1F9N A;  5DM7 F;  4GYI A;  2E2J J;  5HOO A;  1LDK B;  3K4M A;  1OR7 C;  2HS5 A;  2VJ4 A;  5D5W B;  1FMW A;  1R4M B;  2X51 A;  1O3T A;  2ZXJ A;  1PUF B;  4C30 A;  4LK1 F;  1FNN A;  3B73 A;  2XGC A;  2IA0 A;  2JWT A;  3QPL A;  2MD5 A;  4RB1 A;  2IW5 A;  4BXF A;  2DYS H;  1SVO A;  5D5U B;  4IKF A;  1JJ8 C;  4ZZL A;  2VT3 A;  3O3K A;  1YX5 A;  2F4M B;  1R49 A;  2E1M B;  1AHD P;  1F5T A;  3FHN A;  4FT8 A;  4L5J A;  3CJQ B;  2P6S A;  2V4J C;  4RMN A;  5DD8 A;  5DUK A;  2ZFU A;  3HXL A;  3PIO F;  4GFB A;  2LKS A;  2VBX A;  3QYF A;  4G9Y A;  2JVH A;  4QIW N;  1B9N A;  1Y1V J;  1Z21 A;  4PJ0 C;  3ERM A;  2M5W A;  2NNN A;  2RNG A;  3C3W A;  4EGZ A;  3FHZ A;  4E7J A;  3HUG B;  2JMW A;  3OS0 A;  2WV1 A;  5F0F A;  3N97 A;  2Z2S B;  1ETV A;  1P4W A;  2H1K A;  3EYY A;  2ZXI A;  2J5P A;  2ADU A;  3LQQ A;  1I3A A;  1YIJ I;  3B02 A;  1P7I A;  2P4W A;  1N75 A;  2L7M P;  4XKC A;  4XLC A;  2XHK A;  3KP2 A;  1EH6 A;  3JRA A;  4FIS A;  2EZL A;  2BHY A;  3HRM A;  4OIQ F;  5ILV A;  3WTS C;  2R7S A;  3WTT C;  1Y6I A;  5F0C A;  3JW4 A;  1MBG A;  2P6T A;  2XAF A;  1JUP A;  1U5T C;  2F5D A;  2R7W A;  3FXO A;  5K5Q A;  3BTL A;  3CTA A;  2EV6 A;  3DBL B;  3CC7 I;  2DI3 A;  2HYJ A;  4Z6Y A;  1ZG5 A;  2A6E F;  4YRV A;  2XPW A;  4BQQ A;  3D5L A;  3S16 J;  2P5L C;  4LIU A;  1JTY A;  1X19 A;  4BL0 B;  1ZAR A;  2Z1D A;  1I39 A;  4R79 A;  3F23 A;  2JRM A;  1FPQ A;  1X58 A;  5EEH A;  2UXX A;  1D0X A;  2RV8 A;  2Y9Y A;  4WXD A;  3GFL A;  3L00 A;  4M3F A;  5H20 A;  5DCM A;  4U7D A;  4EM1 A;  1JT6 A;  5GAH J;  1GT0 C;  2XB0 X;  1ZN2 A;  4HW0 A;  1Y0U A;  1P4X A;  3M8F A;  2JSC A;  3CO7 C;  3I64 A;  4FET A;  1V5F A;  1O4X A;  5IP9 J;  3HEF A;  1QU3 A;  2M30 A;  3DEW A;  1LB2 A;  1KGS A;  4HV6 A;  4BGD A;  1MNM C;  2X1D A;  1XGS A;  1JTX A;  1JJ6 C;  1FJL A;  1IJW C;  1HC8 A;  4A3D J;  1R6R A;  3Q0W A;  4JP0 A;  2DTZ A;  3CUO A;  3J7A O;  3HOV J;  1GUU A;  4ESJ A;  3SZT A;  1K4S A;  2JN6 A;  2CUJ A;  2K27 A;  2E5Z A;  4A3K J;  1RI7 A;  4A3J J;  2ZB9 A;  3M4O J;  4IHY A;  6PAX A;  5J8C A;  1GV5 A;  4U7B A;  1BC8 C;  3I0T A;  4BEH A;  4AD9 A;  1WI3 A;  4MHG A;  4PJN A;  4P5O A;  5J1Y A;  1FMV A;  3FIS A;  1TNS A;  4MIM A;  3UR3 C;  3MZH A;  1FTZ A;  3WU1 B;  2VQC A;  1IXS B;  3FMR A;  1ZQ3 P;  4DW6 A;  2Z9O A;  2ZME A;  3HC7 A;  2ZFW A;  2STW A;  3S1Q J;  1OLT A;  1S7O A;  2VKH A;  3IL2 A;  3PJR A;  5CVR A;  4IHV A;  3DTI A;  3IUO A;  1XSD A;  2XRL A;  2KIF A;  1OQY A;  1XB4 A;  3FDY A;  4HA8 A;  2X6O A;  3ZRG A;  5C4X J;  5HDG A;  1SMY F;  2PMH A;  3NAU A;  2FNP A;  1R22 A;  3FXK A;  3FXU A;  4MQV A;  2Q8K A;  1Y0N A;  2P8T A;  2OAZ A;  2DOD A;  2X6Y A;  2JK3 A;  2GQQ A;  3KP4 A;  2M3A A;  1P2F A;  4D5F A;  1QQI A;  1YS6 A;  2NRA C;  2WBM A;  4CA0 A;  3G1O A;  1S3J A;  3KE2 A;  3TOA A;  2EFW A;  3TO6 A;  1JT0 A;  3ECO A;  1X1P A;  3MVP A;  5L3F A;  4MNU A;  3ZQL A;  5ILU A;  4L5I A;  1B4A A;  4A5N A;  4A3E J;  4NC7 A;  1TT5 B;  1X3Z B;  2A61 A;  4G8X A;  3WTW C;  2A6T A;  3FF5 A;  4Y52 J;  2CQQ A;  1ZTR A;  5C3E J;  3QPH A;  3LSJ A;  3NWT A;  4BEH B;  4Y7N J;  1GVJ A;  5B66 C;  4PJJ A;  3OIQ A;  1VQ6 I;  4Q48 A;  3OWT A;  3OYH A;  3E0J B;  4IJA A;  4ZYA A;  2PEX A;  4NDL A;  2QLZ A;  3WTV C;  1JKO C;  3JR9 A;  3HYI A;  1RC9 A;  3HSR A;  2YSR A;  5EG0 A;  1WKM A;  1R36 A;  5JLX A;  2UXN A;  2DOA A;  1YLF A;  2L7Z A;  4N9I A;  4YFX F;  2VPL A;  5ICC A;  2VLA A;  3WU2 C;  1IRX A;  1FOK A;  4NQW A;  3GLX A;  3CJN A;  1MND A;  2ZSH B;  3KLN A;  5K1Y A;  3BTJ A;  1K6Y A;  4IZZ A;  4YFK F;  2MAB A;  1R71 A;  1W7P B;  4BBS J;  2WWY A;  1RKW A;  3OIP A;  3QAH A;  2KRH A;  3TDZ C;  1VQ4 I;  2FXA A;  1JE8 A;  3BCB A;  4OIN F;  4NHJ A;  2AHQ A;  1TT0 A;  3DKW A;  3H9Q A;  3SHF A;  2CQX A;  4KMU X;  2WAF A;  3BY6 A;  3N05 A;  3GTG J;  1ZRC A;  1SFU A;  3QYE A;  1SVL A;  1LFP A;  2VI6 A;  2QCO A;  2EIN H;  2X6W A;  3WG7 H;  2LC2 A;  1R23 A;  2QKL B;  4A0X A;  3RZO J;  2ZC2 A;  2H09 A;  3HOX J;  2ZJ2 A;  4FE7 A;  1GHC A;  1HQC A;  3GBG A;  2L01 A;  1W4M A;  2JTV A;  3WTU C;  2R7T A;  2CUE A;  4A5M A;  1J59 A;  4FQG A;  5B1A H;  1D5Y A;  3C2H A;  2NOG A;  1Y1W J;  1ORK A;  2DBB A;  4G6Q A;  4FHT A;  4A3I J;  1GV2 A;  4H0E A;  4LLG F;  1VQ9 I;  1R5G A;  3CUQ A;  2Z33 A;  3WOD F;  2F2E A;  1WJD A;  2ZNZ A;  2LD5 A;  2G0E A;  1VND A;  2LLK A;  3E3V A;  2MG4 A;  2EA2 A;  1TQP A;  1UHW A;  1QPM A;  2TCT A;  5LFA A;  2ACJ A;  2OUM A;  1TW3 A;  2BHZ A;  2DJI A;  2PN6 A;  5HLI A;  3SZP A;  3FBI B;  2DT6 A;  3HDD A;  2R7Q A;  2M87 A;  4HDV A;  2HYG D;  1HCR A;  2L7F P;  3QQA A;  3EUA A;  2RQQ A;  4K2E A;  2NOJ B;  2NAZ A;  2M8G X;  2VE8 A;  2IPQ X;  1HDP A;  4I7H A;  1IN4 A;  3CDL A;  4RGX A;  3ZPL A;  2KIU A;  1IV6 A;  4LG3 A;  5CQE A;  1J09 A;  3BG5 A;  2XRN A;  1XD7 A;  2X85 A;  3K7A J;  4UV9 A;  4LK0 F;  4LGW A;  2ME6 A;  3QOD A;  3D5S C;  4KT5 C;  1IUY A;  4CYC A;  3MZY A;  4U0V A;  4M71 A;  1YJN I;  2LFB A;  3GZN B;  4P9F A;  2Z16 A;  1HKS A;  2R7F A;  2R7O A;  2OQR A;  4B3X A;  1MW7 A;  1NK3 P;  2CWE A;  4U87 A;  3BZC A;  2Y9Z A;  2K9S A;  2GXA A;  1ZKG A;  2FOK A;  2CUF A;  4XRS G;  4XQF A;  3S2D J;  2RKH A;  2UWM A;  4GCV A;  4IOC F;  5KAI C;  1V55 H;  4HYE A;  4HOB A;  4OU0 A;  5C44 J;  1S29 A;  2V26 A;  1U9O A;  3GFI A;  1OPC A;  2YS9 A;  2X0L A;  3K4J A;  2EWN A;  5E8I A;  3CC2 I;  2DFI A;  3OYN A;  5EEG A;  4CZC A;  1TQI A;  3ABT A;  3HZJ A;  3CF2 A;  3DFG A;  3OYK A;  3IV5 A;  3ZMT A;  1JUS A;  5J6X A;  2WAE A;  3V8K A;  3C18 A;  1MJ9 A;  4II3 A;  1YS7 A;  1U5T A;  2UV1 A;  1G3W A;  4JX5 A;  3O8H A;  3F6O A;  3KFW X;  5F08 A;  4I2O A;  3MKZ A;  3C2B A;  2EJR A;  4GO1 A;  4EQQ A;  1YW8 A;  1K78 A;  4J19 A;  1Z1D A;  2XUB A;  2GIV A;  3H36 A;  1RNL A;  3S3O A;  2VC0 A;  5B5E C;  1JI8 A;  3M1C A;  2IA2 A;  4I0A A;  4ESB A;  2JPB A;  2LMD A;  2WC2 A;  4ASN A;  1PVE A;  4BHC A;  1T08 B;  3CUQ C;  2W24 A;  3PO3 J;  3KP6 A;  4BDY A;  1YI2 I;  3U1K A;  5GAG J;  3L2V A;  2R92 J;  4UUS B;  2YUS A;  2VB6 A;  3V8J A;  1U0J A;  4BS9 A;  4KJZ A;  3I5U A;  4RS8 A;  2M34 A;  2R4G A;  2V9V A;  3VOE A;  1WI9 A;  1LE8 B;  5IYD J;  4S0H B;  1J75 A;  4U0W A;  1BW6 A;  2RVC A;  2R0Q C;  4BJT A;  5M3F J;  1TL8 A;  1D3Y A;  2X1C A;  3CCY A;  5LHG A;  2Z99 A;  2HKO A;  5HLT A;  4P96 A;  3I53 A;  2VOO A;  4L9J A;  2FQ3 A;  2P7V B;  2IS4 A;  3AL0 C;  2GBY A;  2XAQ A;  1M1E B;  2A5W A;  4G6D A;  1KZH A;  4I02 A;  3F8F A;  1MMS A;  5EGO A;  2QF7 A;  2CQ7 A;  2DJN A;  3DBH B;  2LNB A;  3U1D A;  1H89 C;  4BQO A;  1L3L A;  3KEO A;  2IGO A;  1B59 A;  2CV2 A;  1KU2 A;  3H0D A;  1VI0 A;  4OMY A;  4IHS A;  1FTT A;  2R5Z B;  2XAJ A;  1D8J A;  3VPR A;  3L2C A;  3Q0V A;  3M3Y J;  1IN8 A;  1N78 A;  1LNW A;  2L54 A;  3A2K A;  1HF0 A;  1EF4 A;  2CUZ A;  5CPR B;  4NC6 A;  3VSK A;  2ECB A;  2GIZ A;  3I59 B;  2QSF X;  2X6X A;  1EV7 A;  4EV0 A;  1Y56 A;  2B9S A;  4ABZ A;  4CHU A;  5IYC J;  3D0S A;  2HQA A;  3BTI A;  2QA4 I;  4BQA A;  2DN0 A;  2HFH A;  1WJF A;  1MZB A;  2A6H F;  4AIK A;  5EZG A;  2H6C A;  1KYZ A;  2DOE A;  3BZ6 A;  5BS6 A;  1APL C;  3GEZ A;  3CZ6 A;  3DV8 A;  4CDG A;  3LOC A;  4I6Z A;  1IUF A;  3ML6 A;  4N4O B;  3HTU A;  3VYT B;  3NAR A;  5FKM A;  3R6S A;  1R4N B;  3HB9 A;  3K4C A;  4BHP A;  4CIC A;  4EGY A;  2F6C A;  4G7Z F;  2Y30 A;  3GTQ J;  3KCC A;  4XLP F;  2IS1 A;  2A05 A;  2M8E A;  5EEA A;  4BQN A;  4S05 A;  5FRO A;  4AIJ A;  1WJB A;  1FSE A;  4D7N A;  3KET A;  2I5U A;  4FAS D;  1WWX A;  1GVD A;  5E3L A;  2QBY A;  2VXZ A;  5KHD A;  1QZY A;  4A12 A;  3SFZ A;  1HKT A;  4D9J A;  3NWS A;  3M9A A;  1MH3 A;  3DU5 A;  1V5E A;  3ABU A;  1S8N A;  4EJU A;  1B72 A;  2R7X A;  3K6G A;  3OYD A;  3VSL A;  2CSO A;  2HVS A;  1BJZ A;  1R58 A;  2JA2 A;  4D7M A;  1U8B A;  5ILS A;  2GXG A;  1A35 A;  3SJM A;  3J7Y J;  4ON0 A;  3LSP A;  1H8A C;  1H9G A;  4UY8 I;  2EQR A;  3TP0 A;  4BYY A;  5A2Q K;  4D5C A;  1FLI A;  2K7L A;  2G7U A;  3RYP A;  3MAJ A;  3HL2 A;  1KQ8 A;  3AL0 B;  1Z6T A;  3AG1 H;  2QZ8 A;  5B1B H;  3FWE A;  3WTX C;  3G3Z A;  2K85 A;  3VYR B;  1MMG A;  2GWR A;  4W1U A;  1B9M A;  1XC5 A;  3QOP A;  2EIL H;  1D8K A;  2ZME C;  4DZJ A;  3SFI A;  1X1B A;  4DQ2 A;  1FYK A;  3GXO A;  2XGX A;  1FYM A;  2V9P A;  1IDZ A;  1P9Q C;  1I5Z A;  3RJP A;  1IN5 A;  4A3F J;  3CME I;  1DU6 A;  3VYS B;  2K4B A;  2LY9 A;  2E7X A;  1YW7 A;  2HTJ A;  2KIS A;  5L3E A;  1SD6 A;  4F3Q A;  3MZ8 A;  2BYV E;  2R7R A;  2BVM A;  2KDZ A;  4IHW A;  4YG2 F;  5H6R A;  1GLN A;  3ECH A;  1E3P A;  1C0W A;  2VBW A;  2XAU A;  2QQ8 A;  1MMN A;  3AG4 H;  2X48 A;  2HQN A;  1X3U A;  3CJT B;  1BOB A;  2R93 J;  5D4S A;  5EDN A;  4GYG A;  5GPC A;  1SAU A;  2NS7 A;  4AIH A;  4E70 A;  4MTD A;  1H88 C;  4I01 A;  1S72 I;  1XMA A;  1OCC H;  3GO5 A;  3RCO A;  1D5V A;  5FJ8 J;  1V54 H;  4FX4 A;  4EJO A;  1SFK A;  1HW1 A;  2TRT A;  4P1W A;  3H9J A;  3KP3 A;  3GVA A;  4P55 A;  3JRE A;  2EIK H;  1IGN A;  4HNU A;  3AKZ A;  1F4K A;  2JJ7 A;  1SFX A;  4KT6 A;  5EZH A;  2EH3 A;  4BU2 A;  4DBQ A;  1MDM A;  2DA5 A;  1REP C;  5F64 A;  2MYS A;  3REO A;  4PGH A;  3F8N A;  2XIG A;  1A36 A;  2O3F A;  2CQK A;  2VN2 A;  2HWV A;  4OWR B;  2AS5 F;  3J80 Z;  4HRI A;  3ZQ7 A;  2V6E A;  3GTK J;  1K79 A;  3I59 A;  1MBE A;  2GA1 A;  4B8X A;  5K7F A;  4B09 A;  1MDM B;  2PG4 A;  3EDP A;  4N0B A;  1PYV A;  2KZV A;  4ZYE A;  4LG0 A;  1ETQ A;  3I9V 2;  5CKT A;  3GYH X;  4Q47 A;  2WY7 Q;  2Y0S A;  1HLV A;  1IG7 A;  3K4L A;  3L1P A;  1VZ0 A;  5CLS A;  3OSF A;  3ELK A;  3OL3 A;  5LGU A;  1MGT A;  4RAY A;  5LGN A;  3LQR A;  5JR3 A;  5D8L B;  4XOT A;  4FCY A;  1WJC A;  3JAM K;  4RBO A;  4ENN A;  2MC4 A;  5FRN A;  2BBY A;  3GF2 A;  3ZMU A;  4G94 A;  3FMQ A;  5K5R A;  3LMM A;  2MBF A;  4D1Q A;  2XB5 A;  1GXP A;  2OZ6 A;  4BUP A;  1BW5 A;  3EUK L;  4FTH A;  2CG4 A;  2VQG A;  3DWL E;  5F0H A;  2E1N A;  4XIC A;  4BDZ A;  2CMP A;  2F4O B;  1G59 A;  1TWG J;  1USS A;  2EFN A;  1F1Z A;  2P7C B;  1BIB A;  2QYO A;  3OYM A;  3S93 A;  3SEZ A;  4RGR A;  3NQO A;  2XAS A;  3CUQ B;  4YIF A;  2DDB A;  2NS0 A;  4AWX B;  2IRF G;  1IW7 F;  2D2W A;  1FBQ A;  5BNG A;  2VT2 A;  2PQ8 A;  4IRG A;  4CZZ A;  2CRG A;  1YHQ I;  3G1L A;  4RA2 A;  2BY0 A;  4B3A A;  1LKX A;  2V6C A;  4A0Z A;  1R00 A;  2BGC A;  4PK4 A;  3DLL F;  1YTY A;  1WFX A;  3CDH A;  1KYW A;  1I3Q J;  2JQ7 A;  2HQ5 A;  3I55 I;  3AFH A;  1I50 J;  1P4A A;  4IF4 A;  2HYF A;  5L3D A;  3W2W A;  5HDK A;  1WQ2 A;  2GAU A;  4PFP A;  2HVR A;  3R60 A;  2M4G A;  2CW8 A;  1B8I A;  4XRF A;  1HSJ A;  3TL4 X;  1SAX A;  3BTC A;  1X4P A;  1U5T B;  4X0G A;  1ZEL A;  2MLK A;  3D5R C;  3WTZ A;  2R5Y B;  4O6J A;  5BQT A;  3WGG A;  1ZGA A;  1U9N A;  3Q9S A;  2JUG A;  5KNL A;  4L0Z B;  2DK5 A;  3ZQC A;  2DA3 A;  2LY1 A;  3JTG A;  1CF7 A;  1YRN A;  1E3H A;  1QVT A;  1WHU A;  2NXN B;  4UV8 A;  1DUX C;  3DEU A;  3S3N A;  4GDF A;  3ESW B;  3CCS I;  3N4M A;  3T8R A;  1TP4 A;  5LHH A;  4M73 A;  1ENH A;  2AXL A;  2JZY A;  2QQA A;  2IS6 A;  5HOD A;  2VC1 A;  5FD6 A;  1I6X A;  4XNF A;  1QHH D;  3MCZ A;  1YG2 A;  1MNE A;  4BNC A;  4OIO F;  2K3P A;  2KT0 A;  3A02 A;  2FML A;  3K9T A;  3BRO A;  2O03 A;  3HKZ A;  2R7Z J;  2AXT C;  1DDN A;  3H5A A;  2C6Y A;  5TGT A;  4BAY A;  4Y3O A;  2FQ4 A;  2MGQ A;  1H0M A;  1VQ7 I;  3K2A A;  3A1Y A;  5GAD J;  1YIO A;  3BR0 A;  3O6B B;  4KIB A;  4EM2 A;  4NNJ A;  2PJR B;  1XMX A;  2E60 A;  1FSH A;  4A6D A;  2K9Q A;  2QSH X;  1JKQ C;  2COB A;  3HRT A;  4RM2 A;  3FXL A;  3GWZ A;  2WAQ A;  4BBR J;  2HNH A;  3C1D A;  1WH5 A;  2W1O A;  2YR2 A;  4BE0 A;  3HOS A;  3QPS A;  3KYD B;  1FOX A;  4E7Z A;  2L9R A;  4ZDO A;  5CVU A;  3WU0 A;  4AUX A;  2IS2 A;  1OCO H;  1FX7 A;  1YJ9 I;  5F6F A;  1OCZ H;  3E6C C;  4HX8 A;  3VB2 A;  3JRD A;  3HOT A;  5ICF A;  1DPU A;  3IH2 A;  2E1M C;  4J01 A;  4BE2 A;  1X1A A;  4HG2 A;  4ENJ A;  2L3D A;  4PGG A;  2E1O A;  4KIT B;  3ZQF A;  4MFD A;  3W2V A;  2D1H A;  4DBR A;  3LAJ A;  4HV5 A;  2RAE A;  1QBJ A;  5GAE J;  2ZXH A;  3TMO A;  2EIJ H;  1NG6 A;  3MN2 A;  2DFH A;  2EZH A;  2YX7 A;  3GLL A;  3FBN B;  4NQW B;  4LOC A;  3GX4 X;  1BC7 C;  3BG7 A;  1ETX A;  1JHH A;  2G9W A;  1KU9 A;  2OZU A;  2W48 A;  4A3C J;  3O2P E;  5J47 A;  5TIS C;  2MW8 A;  2M0C A;  1SD4 A;  2DDA A;  3MMY B;  4TV7 A;  4A3M J;  1UEL B;  2W84 A;  2B0L A;  3O8G A;  4NB5 A;  3JTH A;  1CQT A;  1XGN A;  2GOM A;  3CJR B;  2XSJ C;  3GTL J;  1ACI A;  2KFD A;  3QWL A;  2BY1 A;  2OTL I;  2CO5 A;  3E97 A;  3U2R A;  2PLY A;  2BEO A;  3BOQ A;  4C3J J;  3Q5F A;  4E7I A;  1ZAO A;  4AU7 A;  3TO9 A;  4HEA 2;  5L3B A;  3H5R A;  4G7O F;  3SDG A;  3ABK H;  4QPQ A;  1TTY A;  3FMS A;  5D4R A;  3TW7 A;  5J1R A;  1X2N A;  3CP2 A;  2NNY A;  2PJP A;  1YIT I;  5LHI A;  9ANT A;  5LBQ A;  1IAW A;  3BDD A;  2F5C A;  2HDD A;  5ERI A;  5FD5 A;  1J2X A;  1W7P D;  4UUT A;  2UZK A;  3HTS B;  1ZLK A;  1MBK A;  1UB9 A;  4KFC A;  1HA8 A;  1Z6R A;  3I4P A;  4OIR F;  3S8P A;  2RNJ A;  3RQ4 A;  1VQL I;  2PJR A;  3P9C A;  3DPU A;  1TQM A;  1RUN A;  2DT5 A;  5IT9 K;  4M6Y A;  5LGT A;  1LDJ A;  1OYY A;  1P92 A;  2X1E A;  2OC6 A;  4RAZ A;  4JX6 A;  3H0G J;  4MGR A;  1IV8 A;  5LLQ A;  3OYB A;  1T0F A;  3R61 A;  3HOU J;  4M72 A;  4KIG A;  2HOA A;  4F92 B;  4Y15 A;  2HEO A;  3JRC A;  1XGO A;  3ZGK A;  3S1M J;  1BA5 A;  3ZMS A;  1PP7 U;  1BI0 A;  2KHM A;  3DF8 A;  1YOV B;  1DQU A;  5F1J A;  3BCA A;  1ITY A;  3S2W A;  3C2G A;  3LFU A;  3P9I A;  2V7F A;  3PIP F;  4F52 A;  5J1U A;  1XS9 A;  2Q2E A;  1BN5 A;  2E35 A;  2LOO A;  5DV5 A;  5LRS A;  1D0Y A;  1JUM A;  1UG2 A;  4CCO A;  3DXJ F;  4DJA A;  1T38 A;  3ONQ A;  3G4S I;  2LRD A;  1B6A A;  2FSW A;  1S9H A;  3L2U A;  4XOR A;  3TKY A;  2P0W A;  1QZZ A;  3JRF A;  2ETH A;  5JHU A;  3CF5 F;  2FOW A;  4M9Z A;  2STT A;  2V1N A;  5J8F A;  1XTA A;  2COM A;  2OA4 A;  4PUS A;  2BVL A;  1T95 A;  3EPZ A;  2ISZ A;  4IRI A;  1GDT A;  2IGM A;  4IX7 A;  4N4N B;  3KP5 A;  3MWM A;  2LVS A;  1ZG3 A;  5DEQ A;  2O8K A;  1A5J A;  1AKH B;  2OJE D;  2OF7 A;  4UVA A;  1I1S A;  2XVC A;  1TC3 C;  1Y39 A;  1ON1 A;  4RB3 C;  1SAN A;  2A69 F;  4RGU A;  2RC4 A;  4Y4R A;  3JRG A;  3QYB A;  3JRH A;  3A0H C;  1BOA A;  2VJJ A;  2ZXW H;  3S15 J;  2V1U A;  2W00 A;  3L09 A;  3T8T A;  1TNT A;  1MSF C;  2Q1Z B;  1OCT C;  2KPM A;  3BG6 A;  4A69 C;  1EA3 A;  1IDY A;  1X1D A;  1UHM A;  2XC7 A;  5EYR A;  4Q4Z F;  3CCE I;  2V1X A;  2EIM H;  4YEJ A;  2H27 A;  2B63 J;  2Y75 A;  3J7A Y;  1RET A;  2XGE A;  2ZSI B;  2O9L A;  5D5V B;  4HNV A;  2VXD A;  5EG0 B;  2R7U A;  4XSZ F;  1ZYR F;  5E1W A;  5L3G A;  2L9V A;  3MD2 A;  2K9M A;  2ZJR F;  3LST A;  2HXI A;  2F48 A;  5HS8 A;  4WK8 F;  2FRH A;  2QKM B;  5BPI A;  3BR5 A;  2IA1 A;  2ZJP F;  4UHT A;  4D0P A;  1R1U A;  1ETY A;  2ELK A;  3LSG A;  4QTR A;  2BW3 A;  2QBY B;  2FU4 A;  1QZE A;  2EA4 A;  1MMD A;  3FM5 A;  3GZ5 A;  1UZC A;  5CVJ A;  4DOZ A;  3OOP A;  4XN3 A;  1P6R A;  3KLO A;  2PBI A;  4LMY A;  4JOM A;  1MKM A;  2OBP A;  3IKT A;  1S5L C;  1MBJ A;  2LR8 A;  1R5H A;  4I09 A;  2E19 A;  5FLV A;  2M0M A;  1IN6 A;  4NC8 A;  1IRZ A;  3PSI A;  1O7L A;  5IP6 A;  5IT3 A;  3CCU I;  3LA2 A;  4HLY A;  2E2H J;  3ZOB A;  4H4K C;  2VPR A;  1RZ4 A;  1VQM I;  2CYY A;  3HBL A;  1MD0 A;  1R9T J;  4Y33 A;  3ZN1 A;  2LKP A;  3DPT A;  1ZR2 A;  4L0Y B;  3BC8 A;  4V2F A;  3LA7 A;  2EK5 A;  2E7W A;  3IH4 A;  1YO5 C;  4ZDL A;  4Y13 A;  2DU9 A;  4HF2 A;  2L4M A;  1MBH A;  1OR7 A;  3B6C A;  2IT0 A;  4C3H J;  3BT9 A;  3I56 I;  3OIO A;  3QP5 A;  4J00 A;  2HOS A;  1OCP A;  2FEZ A;  4BJ5 C;  5EF6 A;  5K7Z A;  3CES A;  2VUM J;  5K7H A;  1NG7 A;  3F8B A;  4HF0 A;  4XMY A;  3KP7 A;  3BJ6 A;  4XID A;  2XAH A;  2JA6 J;  2IGN A;  3DTK A;  4L9T A;  2DW4 A;  4DYC A;  3TED A;  1STZ A;  3ZXS A;  1FY7 A;  2D5V A;  2MD0 A;  2FBH A;  2CFO A;  2QVO A;  2NVY J;  3WG9 A;  2W7N A;  2O5R A;  3OR2 C;  1XSX A;  2LYC A;  2JPC A;  4IHT A;  2DCE A;  2GA2 A;  1DPR A;  1BR1 A;  1ULY A;  3ABL H;  3BJA A;  1PUF A;  1X3W B;  4CCJ A;  1T2K A;  1A31 A;  4AYB N;  4M3G A;  3RPQ A;  2NVQ J;  2E34 A;  2LSO A;  1SMT A;  3GUD A;  4A3G J;  4BXX J;  1KON A;  2WB1 A;  5HS7 A;  2F4I A;  3RDI A;  2QEX I;  3Q3S A;  2DYR H;  4KIF A;  5DS9 A;  2XGD A;  3A0B C;  4DGW B;  3CQZ J;  1BR4 A;  4QSH A;  4ZYG A;  4JYK A;  4PSW A;  1YJW I;  2R7V A;  3ASO H;  3HKZ N;  3K10 A;  2W4S A;  4AVZ A;  2DT7 B;  1AU7 A;  1YW9 A;  5DCM B;  2FX0 A;  4GXO A;  1WVR A;  4UB6 C;  3OYL A;  2TDX A;  2CW0 F;  3HOZ J;  1ZGW A;  4PFO A;  1UG0 A;  5GTI C;  1Z3Y A;  1VTN C;  1ETO A;  4M3E A;  4IHX A;  2CW7 A;  1SVM A;  2EV0 A;  4P9U A;  2RDP A;  4M6X A;  3T5X A;  1Z77 A;  2ZKZ A;  3VWB A;  1WJA A;  1FOY A;  3TO7 A;  3E7L A;  4UVB A;  2K9N A;  3GCM A;  3BPV A;  4PJM A;  1VQP I;  5FRM A;  1HKQ A;  3AG3 H;  3GZ6 A;  1A6Q A;  3FZV A;  2R7D A;  4CCL A;  3CC4 I;  5FLX K;  2EZI A;  4E7K A;  3HHH A;  2ZJQ F;  4IOA F;  1LDD A;  1W5C C;  2L7K A;  1XGM A;  3PQJ A;  2YU9 J;  4IEJ A;  2ZCW A;  3V8L A;  2Y0S N;  1IC8 A;  1Z91 A;  4BH9 A;  2DXI A;  4R8H A;  1FP1 D;  3OYG A;  1VF9 A;  4B1R A;  4GRI A;  1G2H A;  2XF7 A;  2O8X A;  3I58 A;  4AM3 A;  4LG0 B;  2LBF B;  5DDG A;  1W36 C;  3K4K A;  3KZI C;  3W3C A;  5HLH A;  3ROU A;  1YQA A;  3K4N A;  1ZRE A;  2D1V A;  3KZY A;  2DA1 A;  3EUH A;  5FKO A;  3SXY A;  2DPD A;  5D6F A;  1G6N A;  2CV1 A;  2MH2 A;  3ZP5 A;  4KN4 X;  1O57 A;  2PFB A;  2BOL A;  4HLX A;  3G1M A;  2KDO A;  2NYX A;  4XRM A;  2KL4 A;  3UNG C;  5TRD A;  2IGK A;  2KJB A;  2ELJ A;  2L02 A;  3QU3 A;  4U88 A;  4HSR A;  3C7J A;  1R1T A;  3IAS 2;  3PQK A;  2ESH A;  5KVR A;  4RM3 A;  3IWZ A;  1U78 A;  1Y8Q B;  1ZLJ A;  1RES A;  2WAD A;  3CDI A;  3FXM A;  4M3D A;  3KZZ A;  2KLO A;  5E79 C;  4QLC U;  3M7G A;  4GGG A;  2DMT A;  5KAF C;  1KU3 A;  1W5T A;  1BM9 A;  3SZG A;  1Z0X A;  3HRU A;  3SYT A;  2ICW G;  2L2O A;  2GXB A;  4OIP F;  2O6G E;  3QOE A;  2RQP A;  4KN7 X;  4BJ6 C;  1ZG1 A;  3IWF A;  4M6V A;  2L9S A;  3E6D A;  5D6E A;  3DQV C;  5D5X B;  4XK4 A;  4IRH A;  1JKR C;  3BR2 A;  4Y17 A;  3W6J B;  1BBY A;  2CFX A;  2OU2 A;  2ZME B;  3S32 A;  1D0Z A;  4XON A;  4YFN F;  5M5X J;  3CMA I;  4EM0 B;  3LNQ A;  2XF5 A;  2HU9 A;  1DU0 A;  1W0T A;  5K5O A;  4ZTJ A;  1HOM A;  1XCB A;  2DMQ A;  3V42 A;  3S3M A;  3M8J A;  5FKL A;  4RAF A;  3DEE A;  2E1C A;  2R5Z A;  2RRE A;  1S6L A;  4ENM A;  1TLH B;  4JBA A;  3IRQ A;  2ME0 A;  2RN7 A;  2FD5 A;  1CF7 B;  3OYE A;  3IAM 2;  5E17 F;  4AC0 A;  2GOX B;  2JSP A;  1LE8 A;  3PFI A;  2QM3 A;  1QHG A;  5EGO B;  2CS3 A;  1XX5 A;  2O61 A;  3RPU A;  2QUF A;  3PNY A;  2LTP A;  2PMU A;  3FXJ A;  1HBX G;  1WH7 A;  3OV8 A;  2WA0 A;  3RPU D;  1VFC A;  4F7Z A;  1FT9 A;  2AO9 A;  4WF2 A;  2LDU A;  2IXS A;  3K1N A;  4LB6 B;  4B48 A;  1FZP B;  2E2I J;  1KQ9 A;  1IF1 A;  4CH7 A;  2OQG A;  5ICE A;  3LSM A;  3WGI A;  1XMK A;  4HBL A;  2BW3 B;  1G3Y A;  4B43 A;  1FIA A;  2H1L A;  2KRC A;  3ABM H;  2PX9 A;  5KCM A;  3DLA A;  3KPH A;  3Q0U A;  3E1S A;  1RIO H;  3HOY J;  3BLY A;  5GPA A;  2JA7 J;  3U21 A;  4A0Y A;  1F36 A;  1FBS A;  3V7R A;  4XLH A;  1SC7 A;  3T1B A;  4YEL A;  1YE9 A;  1JXS A;  1OJL A;  1TW2 A;  5FLM J;  3ZMV A;  3E6M A;  3FKJ A;  4AVP A;  3WE3 A;  4MO7 A;  1XPX A;  4EJV A;  2LP0 A;  3IHU A;  2KIQ A;  2HPI A;  3PNV A;  3HGG A;  1BI1 A;  1K61 A;  3J81 Z;  5CYV A;  1RR7 A;  2Q0O A;  3TW6 A;  1LFB A;  2FUG 2;  1B1B A;  2HDW A;  3F9K A;  2ZO4 A;  2HPM A;  2LG4 A;  4NUB A;  2DO7 A;  1WZ2 A;  2ECC A;  3MKY B;  2VON A;  1I6H J;  5HNF A;  3TGN A;  1U3E M;  2K02 A;  4O3M A;  3B6A A;  2VKD A;  1HW5 A;  4V2G A;  3HG9 A;  5ED4 A;  1JGS A;  3HGY A;  3RIR A;  1SEU A;  2UUZ A;  2W85 A;  3G6E I;  4BE1 A;  4WWC A;  5IOZ A;  3X2Q H;  1W7P A;  4U0Y A;  3F0C A;  2CGP A;  1IN7 A;  1U6G A;  2M2E A;  3FM3 A;  2BY2 A;  3QRF F;  1UMQ A;  4HQE A;  1DP7 P;  2K4J A;  5LRR A;  1Z3X A;  3GME A;  3DKY A;  4UVC A;  3E6B A;  4UUV A;  1ERD A;  4MEY F;  4XLE A;  4CGZ A;  5J40 A;  2XDV A;  3PSF A;  4ZZD A;  3I71 A;  2KKO A;  1F43 A;  4CXF A;  1U2W A;  2YX4 A;  3VFZ A;  3ZMD A;  4EMS A;  4A3B J;  2DA4 A;  3GFM A;  3HRS A;  3ZQG A;  2DPU A;  1ZH5 A;  2BE5 F;  2HTS A;  2IVM A;  1WRJ A;  3PUF A;  1Q1V A;  3HPG A;  1LQ1 A;  2QEN A;  2IP2 A;  3H92 A;  1UCR A;  3SQN A;  3LL7 A;  1DP3 A;  4M3B A;  3TQN A;  3GTJ J;  4XLA A;  4CCM A;  2BXZ A;  5J3L A;  3HUG A;  4XLN F;  4KMF A;  2L5Q A;  3NEU A;  3WHB A;  1OFC X;  2K40 A;  2O0Y A;  2LK2 A;  3UKG A;  4RAG A;  1V4R A;  3H9G A;  2HR3 A;  1L0O C;  2VQL A;  1MIJ A;  3KX2 A;  3JRB A;  3RI4 A;  1W36 D;  1PDN C;  2BV6 A;  4JK1 X;  4HZF A;  3DKX A;  3S17 J;  2ZBK A;  2VBY A;  1H9T A;  3HSE A;  5FKK A;  5LEK A;  2XRO A;  1BJA A;  2YPR A;  5JVT A;  1X1C A;  1PJR A;  2EFQ A;  4KIS A;  2MSY A;  2V9K A;  3KEQ A;  3BPX A;  4KYW A;  1YX3 A;  3M07 A;  2Y31 A;  3OYI A;  3E5U A;  1Z67 A;  1QVU A;  5CQG A;  4BKX A;  3OS2 A;  2HVQ A;  2EZK A;  4OOI A;  5J4Y A;  4XR6 A;  3H5N A;  1XDS A;  4LIT A;  5FB2 A;  5FFX A;  4A3L J;  2W57 A;  2XKP A;  3RQI A;  1LVA A;  2HXO A;  1K4T A;  1ZRF A;  4EJT A;  3OMY A;  3HM5 A;  3IC7 A;  2WAQ N;  3MEX A;  3CMY A;  2FJ1 A;  4C2M J;  2FBI A;  4KNY A;  1BL0 A;  1BI2 A;  4A6E A;  4I99 C;  1WSU A;  3COA C;  1QA6 A;  2PI0 A;  1LEB A;  4OAY A;  4IL6 C;  2CH0 A;  5DCF A;  1SFE A;  5IOY A;  1NH3 A;  2XKO A;  2VL8 A;  2ID6 A;  3KYL A;  2IBD A;  4UXN A;  4MQ9 F;  2KMU A;  2P5V A;  3LSI A;  3BQY A;  3RKY A;  1VQN I;  1GXQ A;  3VOD A;  5JI6 A;  2CV0 A;  1VQ8 I;  3PL8 A;  3P7N A;  3RSN A;  1OYW A;  5JVG F;  3FK7 A;  1Z9C A;  3H3V K;  1R1V A;  2FA5 A;  3BJO A;  4FE4 A;  2HOT A;  1TZL A;  1POG A;  2VKV A;  3G71 I;  2MH9 A;  2NVT J;  2OCC H;  2NS8 A;  3SEQ A;  1K7A A;  3IKV A;  2YU3 A;  2D45 A;  1E2X A;  4S04 A;  2KRF A;  2ISY A;  1CGP A;  5FO5 A;  5AON A;  1QPI A;  3S1N J;  2F5F A;  1AKH A;  4XRS A;  3V7C A;  3M1E A;  1IRG A;  4WX9 A;  3PUB A;  4HST A;  3LSK A;  4IXA A;  4LFU A;  1ZK8 A;  2KJC A;  2P81 A;  2M45 A;  1XSV A;  1T98 A;  1LPQ A;  4ZYH A;  1E3O C;  2QGU A;  1HDD C;  5TJJ A;  5CVV A;  4CYC B;  2L4A A;  1MJA A;  3PO2 J;  3W6V A;  5IP7 J;  2H94 A;  3JCU C;  4FX0 A;  1FP2 A;  4XL9 A;  2WTE A;  1MSE C;  2GZW A;  3W2A A;  3BG9 A;  2VE9 A;  4DZP A;  4JX4 A;  2LF8 A;  3FK6 A;  2FMY A;  2MLG A; 
#chains in the Genus database with same CATH homology
 2V79 A;  4HX4 A;  3F21 A;  2FBK A;  4M74 A;  5ICG A;  2X4H A;  3P9K A;  5CVI A;  4LB5 A;  1OYI A;  4WXH A;  4Z2Y A;  5HS9 A;  2KIM A;  2QQB A;  2J5O A;  2FF4 A;  1KA8 A;  5FGM A;  1G3S A;  3RYR A;  5E1X A;  4DNC A;  2R3S A;  4UNO A;  1ZGJ A;  4L9V A;  4HF1 A;  4WCG A;  5BPD A;  3L7W A;  3Q9V A;  5E18 F;  2HQR A;  2XAG A;  1IRF A;  2QWW A;  4IPA A;  1EH8 A;  3MFK A;  2Z5U A;  1ZRD A;  2FNA A;  4LLL A;  3M8E A;  1MJB A;  4KA4 A;  1J7K A;  3FXR A;  4ESF A;  1OKR A;  3G73 A;  3K69 A;  3F22 A;  2IJL A;  3K1M A;  3TDU C;  1AOY A;  4CO8 A;  1FWZ A;  2HOE A;  1XN7 A;  4HQM A;  1UST A;  1EH7 A;  4I98 B;  3H3U A;  3J81 K;  3K2Z A;  3QU6 A;  3K0L A;  4N9H A;  4OMZ A;  4KIC A;  4LJZ F;  1HW2 A;  4PCQ A;  2XV4 S;  3T0Y A;  3DPL C;  3AAF A;  1I27 A;  3R0J A;  3E5X A;  3DP7 A;  4G7H F;  1XCV A;  2H6B A;  5AIQ A;  5IT9 Z;  5KK1 A;  4ETS A;  1T6S A;  2F5E A;  3R0A A;  5JFR A;  3IRR A;  3WE2 A;  2VBZ A;  2G7H A;  2RGV A;  5F1R A;  3CO6 C;  3HHG A;  4ZYD A;  3WTY C;  3GFJ A;  5E8G A;  3TOB A;  2ZNY A;  5CJ9 A;  1J5Y A;  3F3X A;  4JQF A;  3LWF A;  4KUM A;  2DAO A;  5E20 A;  3ERE D;  3ULQ B;  1A04 A;  1U8R A;  2HGC A;  5E1Z B;  2DQR A;  2Z3Y A;  2VOD A;  4LD5 A;  4L9N A;  1LJ9 A;  4PZJ A;  5DYM A;  1ONV A;  5AIP A;  2EB7 A;  3V4G A;  1E17 A;  3K1P A;  3R4K A;  3HIF A;  4HAM A;  4QWQ A;  1QNT A;  3H3Z A;  5HLG A;  2ELH A;  2DTR A;  3ISP A;  1J0R A;  3LA3 A;  3F6V A;  1W5S A;  2P5K A;  1IXC A;  4I0B A;  5DUI A;  5BMZ A;  2WV0 A;  3QP6 A;  3MQ0 A;  1PP8 F;  4XSX F;  3U9G A;  2Y48 A;  3JSO A;  2EFP A;  5D8K B;  2QQ9 A;  1AWC A;  4YII A;  4WXC A;  4RB2 C;  1BIA A;  1RUO A;  1O3S A;  1K78 B;  3EQL F;  4IVN A;  3LFK A;  4EVI A;  1KU7 A;  3BWG A;  3F8C A;  1FYL A;  1K6O A;  4M9S A;  3GW2 A;  1S7A A;  4ENK A;  2LF7 A;  3CLO A;  2MA3 A;  1J9I A;  1YYV A;  2M1B A;  4M9X A;  2K86 A;  3VEP A;  1QGP A;  2EFO A;  2OD5 A;  3QPT A;  4O5V A;  5LEJ A;  1FC3 A;  3I54 A;  4HX7 A;  4CYD A;  4R1H A;  4RB0 A;  3RKX A;  5BOX A;  3BP8 A;  1O3Q A;  1I1G A;  2A68 F;  1KQ0 A;  3EET A;  1HXD A;  1OMI A;  2FE3 A;  1ODD A;  1V3F A;  5A2Q Z;  4L18 B;  1XDU A;  3F72 A;  2V1D A;  5HVQ C;  2JT1 A;  1ZHF A;  2DLL A;  3FXQ A;  2MC3 A;  2JRT A;  2VOP A;  3J80 K;  4LLN A;  3LAP A;  2W25 A;  4BHB A;  1O3R A;  1SD5 A;  4MEX F;  4Q5S F;  2HKX A;  1IZ1 A;  3V7S A;  1BI3 A;  4MTE A;  1JHF A;  3L9F A;  1TBX A;  4BXU A;  1QO0 D;  2A3S A;  4A2U A;  1YFH A;  1HST A;  3E5Q A;  4RGS A;  1LEA A;  4XBF A;  3JAM Z;  4PDK A;  2A5Y B;  5HDN A;  5DD4 A;  3ZMZ A;  2EV5 A;  3WGH A;  4ZH4 F;  1T39 A;  1R7J A;  5H6Q A;  1PUE E;  3FX3 A;  5FLX Z;  2ESN A;  2HZT A;  3HSF A;  3F8M A;  1NHA A;  5FFZ A;  4KDP A;  2A07 F;  4EJW A;  1UFM A;  3NRV A;  1G4D A;  2Y0M A;  1FBU A;  3JSP A;  2HDC A;  5L3C A;  3ZN0 A;  1ON2 A;  1SD7 A;  1G3T A;  1Q1H A;  4HDU A;  2DK8 A;  3W6K B;  1O7F A;  1IXR C;  3RTR A;  2DQL A;  3RKW A;  3EYI A;  1Z05 A;  1Z7U A;  1F9N A;  4GYI A;  5HOO A;  1LDK B;  2HS5 A;  5D5W B;  1O3T A;  2ZXJ A;  4LK1 F;  1FNN A;  3B73 A;  2IA0 A;  2MD5 A;  4RB1 A;  2IW5 A;  5D5U B;  4ZZL A;  2VT3 A;  3O3K A;  1F5T A;  4FT8 A;  4L5J A;  2P6S A;  5DD8 A;  5DUK A;  2VBX A;  4G9Y A;  1B9N A;  2M5W A;  2NNN A;  3C3W A;  4EGZ A;  3FHZ A;  3N97 A;  1P4W A;  3EYY A;  2J5P A;  2ADU A;  3LQQ A;  3B02 A;  2P4W A;  2XHK A;  3KP2 A;  1EH6 A;  3HRM A;  4OIQ F;  5ILV A;  3WTS C;  3WTT C;  3JW4 A;  2P6T A;  2XAF A;  1U5T C;  2F5D A;  5K5Q A;  3CTA A;  2EV6 A;  2DI3 A;  1ZG5 A;  2A6E F;  3D5L A;  2P5L C;  1ZAR A;  3F23 A;  4R79 A;  1FPQ A;  5EEH A;  2UXX A;  2RV8 A;  4WXD A;  3GFL A;  3L00 A;  5H20 A;  5DCM A;  4U7D A;  4EM1 A;  1ZN2 A;  4HW0 A;  1Y0U A;  1P4X A;  3M8F A;  2JSC A;  3CO7 C;  3I64 A;  2M30 A;  1LB2 A;  1KGS A;  4HV6 A;  1XGS A;  3CUO A;  3J7A O;  4ESJ A;  3SZT A;  2K27 A;  1RI7 A;  6PAX A;  5J8C A;  4U7B A;  1BC8 C;  3I0T A;  4AD9 A;  4MHG A;  4P5O A;  1TNS A;  3MZH A;  3WU1 B;  1IXS B;  3FMR A;  2Z9O A;  2ZME A;  2ZFW A;  2STW A;  1S7O A;  3IL2 A;  5CVR A;  1XSD A;  2KIF A;  1XB4 A;  4HA8 A;  5HDG A;  1SMY F;  2PMH A;  2FNP A;  1R22 A;  3FXU A;  4MQV A;  2Q8K A;  2P8T A;  2OAZ A;  2GQQ A;  3KP4 A;  1P2F A;  1QQI A;  1YS6 A;  2NRA C;  1S3J A;  3KE2 A;  3TOA A;  2EFW A;  3TO6 A;  3ECO A;  5L3F A;  4MNU A;  5ILU A;  4L5I A;  1B4A A;  4A5N A;  2A61 A;  4G8X A;  3WTW C;  3FF5 A;  3QPH A;  1GVJ A;  4Q48 A;  4IJA A;  2PEX A;  2QLZ A;  3WTV C;  3HYI A;  3HSR A;  2YSR A;  1WKM A;  1R36 A;  2UXN A;  1YLF A;  4N9I A;  4YFX F;  5ICC A;  1FOK A;  4NQW A;  3CJN A;  3GLX A;  3KLN A;  5K1Y A;  4YFK F;  1W7P B;  2WWY A;  3QAH A;  3TDZ C;  2FXA A;  1JE8 A;  4OIN F;  4NHJ A;  3DKW A;  3SHF A;  4KMU X;  3BY6 A;  1ZRC A;  1SFU A;  1R23 A;  4A0X A;  2H09 A;  2ZJ2 A;  1GHC A;  1HQC A;  2L01 A;  1W4M A;  2JTV A;  3WTU C;  4A5M A;  1J59 A;  2DBB A;  4G6Q A;  4FHT A;  4H0E A;  4LLG F;  1R5G A;  3CUQ A;  2Z33 A;  3WOD F;  2F2E A;  2ZNZ A;  3E3V A;  2EA2 A;  1TQP A;  1UHW A;  1QPM A;  2ACJ A;  1TW3 A;  2PN6 A;  5HLI A;  3SZP A;  2M87 A;  4HDV A;  2HYG D;  4K2E A;  2NAZ A;  2VE8 A;  2IPQ X;  4I7H A;  1IN4 A;  4RGX A;  3ZPL A;  2KIU A;  2XRN A;  1XD7 A;  4UV9 A;  4LK0 F;  4LGW A;  4KT5 C;  1IUY A;  3MZY A;  4U0V A;  4M71 A;  4P9F A;  1HKS A;  2R7F A;  2OQR A;  2CWE A;  2FOK A;  2RKH A;  2UWM A;  4GCV A;  4HYE A;  4HOB A;  4OU0 A;  1S29 A;  3GFI A;  1OPC A;  2X0L A;  5E8I A;  2EWN A;  2DFI A;  5EEG A;  1TQI A;  3ABT A;  3DFG A;  3ZMT A;  5J6X A;  3V8K A;  3C18 A;  1MJ9 A;  1YS7 A;  1U5T A;  1G3W A;  3F6O A;  3KFW X;  4I2O A;  2EJR A;  4GO1 A;  4EQQ A;  1YW8 A;  1K78 A;  1Z1D A;  2XUB A;  2GIV A;  1RNL A;  2VC0 A;  2IA2 A;  4I0A A;  4ESB A;  2JPB A;  2WC2 A;  4ASN A;  4BHC A;  3CUQ C;  2W24 A;  3KP6 A;  3V8J A;  3I5U A;  4RS8 A;  3VOE A;  2V9V A;  1WI9 A;  1J75 A;  4U0W A;  2RVC A;  1D3Y A;  5LHG A;  2Z99 A;  2HKO A;  4P96 A;  3I53 A;  2VOO A;  4L9J A;  2FQ3 A;  2P7V B;  2XAQ A;  4G6D A;  4I02 A;  3F8F A;  2LNB A;  3U1D A;  1L3L A;  3KEO A;  1B59 A;  1KU2 A;  4OMY A;  4IHS A;  2XAJ A;  1D8J A;  3L2C A;  1IN8 A;  1LNW A;  2L54 A;  3I59 B;  1EV7 A;  4EV0 A;  4CHU A;  3D0S A;  4BQA A;  2HFH A;  1MZB A;  2A6H F;  4AIK A;  2H6C A;  1KYZ A;  3BZ6 A;  5BS6 A;  3GEZ A;  3DV8 A;  4CDG A;  3ML6 A;  3HTU A;  3R6S A;  4BHP A;  4CIC A;  4EGY A;  4G7Z F;  3KCC A;  4XLP F;  2M8E A;  4S05 A;  4AIJ A;  1FSE A;  3KET A;  1WWX A;  2QBY A;  2VXZ A;  1QZY A;  4A12 A;  3SFZ A;  1HKT A;  3M9A A;  3ABU A;  1S8N A;  4EJU A;  2CSO A;  1R58 A;  5ILS A;  2GXG A;  4ON0 A;  1H9G A;  4BYY A;  5A2Q K;  1FLI A;  2K7L A;  2G7U A;  3RYP A;  3MAJ A;  1KQ8 A;  1Z6T A;  2QZ8 A;  3FWE A;  3WTX C;  3G3Z A;  2GWR A;  1B9M A;  3QOP A;  1D8K A;  4DQ2 A;  1FYK A;  3GXO A;  2XGX A;  1FYM A;  1I5Z A;  3RJP A;  1IN5 A;  2K4B A;  2E7X A;  1YW7 A;  2HTJ A;  5L3E A;  1SD6 A;  2BYV E;  4YG2 F;  5H6R A;  3ECH A;  1C0W A;  2VBW A;  2HQN A;  1X3U A;  5D4S A;  4GYG A;  4AIH A;  4E70 A;  4MTD A;  4I01 A;  1XMA A;  1D5V A;  3GO5 A;  4FX4 A;  4EJO A;  1HW1 A;  3KP3 A;  3GVA A;  4P55 A;  1F4K A;  1SFX A;  1MDM A;  1REP C;  5F64 A;  3REO A;  4PGH A;  3F8N A;  2XIG A;  2O3F A;  2CQK A;  2VN2 A;  2HWV A;  2AS5 F;  3J80 Z;  3ZQ7 A;  1K79 A;  3I59 A;  2GA1 A;  4B8X A;  4B09 A;  1MDM B;  2PG4 A;  3EDP A;  4N0B A;  4ZYE A;  4LG0 A;  3GYH X;  4Q47 A;  5CLS A;  3ELK A;  5LGU A;  1MGT A;  4RAY A;  5LGN A;  3LQR A;  5JR3 A;  5D8L B;  3JAM K;  4ENN A;  2BBY A;  3GF2 A;  3ZMU A;  4G94 A;  3FMQ A;  5K5R A;  2MBF A;  1GXP A;  2OZ6 A;  2CG4 A;  2E1N A;  2EFN A;  1USS A;  1F1Z A;  2P7C B;  1BIB A;  2QYO A;  4RGR A;  3NQO A;  2XAS A;  3CUQ B;  4YIF A;  2NS0 A;  4AWX B;  2IRF G;  1IW7 F;  2D2W A;  1FBQ A;  2VT2 A;  2PQ8 A;  4IRG A;  4CZZ A;  2V6C A;  4A0Z A;  1R00 A;  2BGC A;  1YTY A;  3CDH A;  1KYW A;  1P4A A;  4IF4 A;  2HYF A;  5L3D A;  5HDK A;  1WQ2 A;  2GAU A;  3R60 A;  4XRF A;  1HSJ A;  1SAX A;  1U5T B;  2MLK A;  3WTZ A;  4O6J A;  5BQT A;  3WGG A;  1ZGA A;  3Q9S A;  4L0Z B;  2DK5 A;  3JTG A;  1CF7 A;  4UV8 A;  1DUX C;  3DEU A;  3N4M A;  3T8R A;  5LHH A;  4M73 A;  2AXL A;  2JZY A;  2QQA A;  2VC1 A;  5FD6 A;  1I6X A;  3MCZ A;  1YG2 A;  4BNC A;  4OIO F;  2FML A;  3K9T A;  3BRO A;  2O03 A;  1DDN A;  2C6Y A;  4BAY A;  1H0M A;  1YIO A;  3O6B B;  4KIB A;  4EM2 A;  1FSH A;  4A6D A;  3HRT A;  3GWZ A;  3C1D A;  2YR2 A;  3HOS A;  5CVU A;  3WU0 A;  1FX7 A;  5F6F A;  3E6C C;  4HX8 A;  3VB2 A;  3HOT A;  1DPU A;  5ICF A;  4ENJ A;  2L3D A;  4PGG A;  2D1H A;  3LAJ A;  4HV5 A;  1QBJ A;  2YX7 A;  3GX4 X;  1BC7 C;  1JHH A;  2G9W A;  1KU9 A;  2OZU A;  3O2P E;  4TV7 A;  1SD4 A;  2W84 A;  2B0L A;  4NB5 A;  3JTH A;  1XGN A;  2CO5 A;  3E97 A;  3U2R A;  2PLY A;  2BEO A;  3BOQ A;  3Q5F A;  1ZAO A;  3TO9 A;  5L3B A;  4G7O F;  1TTY A;  3FMS A;  5D4R A;  2NNY A;  2PJP A;  5LHI A;  5LBQ A;  1IAW A;  3BDD A;  2F5C A;  5ERI A;  5FD5 A;  1J2X A;  1W7P D;  2UZK A;  3HTS B;  1ZLK A;  1UB9 A;  4KFC A;  1Z6R A;  3I4P A;  4OIR F;  2RNJ A;  3P9C A;  1TQM A;  1RUN A;  2DT5 A;  5IT9 K;  4M6Y A;  5LGT A;  1LDJ A;  1OYY A;  1P92 A;  4RAZ A;  4MGR A;  5LLQ A;  1T0F A;  3R61 A;  4M72 A;  4KIG A;  4Y15 A;  2HEO A;  1XGO A;  3ZMS A;  1PP7 U;  1BI0 A;  3DF8 A;  3S2W A;  3P9I A;  2Q2E A;  1BN5 A;  5DV5 A;  5LRS A;  3DXJ F;  1T38 A;  1B6A A;  2FSW A;  3TKY A;  1QZZ A;  2ETH A;  5JHU A;  4M9Z A;  2STT A;  5J8F A;  2COM A;  2OA4 A;  2ISZ A;  4IRI A;  3KP5 A;  3MWM A;  1ZG3 A;  5DEQ A;  4UVA A;  1I1S A;  2XVC A;  1ON1 A;  4RB3 C;  2A69 F;  4RGU A;  2RC4 A;  1BOA A;  2V1U A;  3L09 A;  3T8T A;  1TNT A;  1UHM A;  4Q4Z F;  2V1X A;  2H27 A;  2Y75 A;  5D5V B;  4XSZ F;  1ZYR F;  5E1W A;  5L3G A;  3LST A;  5HS8 A;  4WK8 F;  2FRH A;  5BPI A;  2IA1 A;  4UHT A;  4D0P A;  1R1U A;  2QBY B;  2FU4 A;  2EA4 A;  3FM5 A;  3GZ5 A;  5CVJ A;  3OOP A;  1P6R A;  3KLO A;  2PBI A;  4LMY A;  1MKM A;  2OBP A;  3IKT A;  1R5H A;  4I09 A;  1IN6 A;  1O7L A;  5IT3 A;  3LA2 A;  4HLY A;  1RZ4 A;  2CYY A;  1MD0 A;  3ZN1 A;  2LKP A;  3DPT A;  4L0Y B;  3LA7 A;  2EK5 A;  2E7W A;  4HF2 A;  1YO5 C;  4Y13 A;  2DU9 A;  2L4M A;  1OR7 A;  2IT0 A;  3QP5 A;  2FEZ A;  3F8B A;  4HF0 A;  3KP7 A;  3BJ6 A;  2XAH A;  4L9T A;  2DW4 A;  1STZ A;  1FY7 A;  2FBH A;  2QVO A;  3WG9 A;  1XSX A;  2JPC A;  4IHT A;  2GA2 A;  1DPR A;  1ULY A;  3BJA A;  1T2K A;  3RPQ A;  2LSO A;  1SMT A;  3GUD A;  5HS7 A;  3RDI A;  4KIF A;  4ZYG A;  1YW9 A;  5DCM B;  4GXO A;  2TDX A;  2CW0 F;  1VTN C;  2EV0 A;  4P9U A;  2RDP A;  4M6X A;  3T5X A;  2ZKZ A;  3TO7 A;  4UVB A;  3BPV A;  1HKQ A;  3GZ6 A;  3FZV A;  2R7D A;  5FLX K;  3HHH A;  1LDD A;  1XGM A;  3PQJ A;  2ZCW A;  3V8L A;  1Z91 A;  4BH9 A;  4R8H A;  1FP1 D;  2O8X A;  3I58 A;  4LG0 B;  5DDG A;  5HLH A;  3ROU A;  1YQA A;  1ZRE A;  2D1V A;  3KZY A;  3EUH A;  3SXY A;  2DPD A;  5D6F A;  1G6N A;  2MH2 A;  3ZP5 A;  4KN4 X;  1O57 A;  2PFB A;  4HLX A;  2NYX A;  5TRD A;  2L02 A;  2KJB A;  3QU3 A;  4U88 A;  3C7J A;  1R1T A;  3PQK A;  2ESH A;  5KVR A;  1U78 A;  3IWZ A;  1ZLJ A;  3KZZ A;  4QLC U;  3M7G A;  4GGG A;  1KU3 A;  1W5T A;  1BM9 A;  3HRU A;  2GXB A;  4OIP F;  2O6G E;  2RQP A;  4KN7 X;  1ZG1 A;  3IWF A;  3E6D A;  5D6E A;  3DQV C;  5D5X B;  4IRH A;  4Y17 A;  3W6J B;  1BBY A;  2CFX A;  2OU2 A;  2ZME B;  4YFN F;  4EM0 B;  5K5O A;  1XCB A;  2E1C A;  1S6L A;  4ENM A;  1TLH B;  4JBA A;  3IRQ A;  2RN7 A;  1CF7 B;  5E17 F;  3PFI A;  2QM3 A;  2O61 A;  3RPU A;  2QUF A;  1HBX G;  2PMU A;  3OV8 A;  4F7Z A;  1FT9 A;  4WF2 A;  2LDU A;  3K1N A;  4LB6 B;  1FZP B;  1KQ9 A;  1IF1 A;  2OQG A;  5ICE A;  3WGI A;  1XMK A;  4HBL A;  1G3Y A;  1RIO H;  4A0Y A;  1FBS A;  3V7R A;  3T1B A;  1JXS A;  1TW2 A;  3ZMV A;  3E6M A;  4AVP A;  3WE3 A;  4EJV A;  3IHU A;  1BI1 A;  3J81 Z;  5CYV A;  2Q0O A;  1B1B A;  2ZO4 A;  2DO7 A;  2VON A;  3TGN A;  4O3M A;  1U3E M;  2K02 A;  1HW5 A;  5ED4 A;  1JGS A;  3RIR A;  2W85 A;  4WWC A;  1W7P A;  4U0Y A;  2CGP A;  1IN7 A;  1U6G A;  3FM3 A;  3QRF F;  4HQE A;  1DP7 P;  2K4J A;  5LRR A;  4UVC A;  3E6B A;  4UUV A;  4MEY F;  4CGZ A;  4ZZD A;  3I71 A;  2KKO A;  4CXF A;  1U2W A;  2YX4 A;  3VFZ A;  3ZMD A;  4EMS A;  3GFM A;  3HRS A;  2DPU A;  1ZH5 A;  2BE5 F;  2HTS A;  2IVM A;  1WRJ A;  1LQ1 A;  2QEN A;  2IP2 A;  3H92 A;  1UCR A;  3SQN A;  3TQN A;  3HUG A;  4XLN F;  4KMF A;  3NEU A;  2O0Y A;  1V4R A;  2HR3 A;  1L0O C;  3RI4 A;  1PDN C;  2BV6 A;  4JK1 X;  4HZF A;  2ZBK A;  2VBY A;  1H9T A;  3HSE A;  5LEK A;  2XRO A;  1BJA A;  2YPR A;  5JVT A;  2EFQ A;  3KEQ A;  3BPX A;  4KYW A;  3E5U A;  4OOI A;  1XDS A;  5FB2 A;  5FFX A;  2W57 A;  2XKP A;  1LVA A;  1ZRF A;  4EJT A;  3IC7 A;  3MEX A;  4KNY A;  2FBI A;  1BI2 A;  4A6E A;  1WSU A;  3COA C;  2PI0 A;  1LEB A;  5DCF A;  1SFE A;  2XKO A;  4UXN A;  4MQ9 F;  2P5V A;  3RKY A;  1GXQ A;  3VOD A;  5JI6 A;  3P7N A;  1OYW A;  1Z9C A;  1R1V A;  2FA5 A;  3BJO A;  2MH9 A;  1K7A A;  3IKV A;  2YU3 A;  2D45 A;  1E2X A;  4S04 A;  2KRF A;  2ISY A;  1CGP A;  5FO5 A;  5AON A;  2F5F A;  3V7C A;  3M1E A;  1IRG A;  4WX9 A;  4IXA A;  4LFU A;  2KJC A;  2M45 A;  1XSV A;  1T98 A;  4ZYH A;  5TJJ A;  5CVV A;  2L4A A;  1MJA A;  2H94 A;  4FX0 A;  1FP2 A;  2WTE A;  2GZW A;  2VE9 A;  2LF8 A;  2FMY A;  2MLG A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...