2DK8A

Solution structure of rpc34 subunit in rna polymerase iii from mouse
Total Genus 16
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
16
sequence length
81
structure length
81
Chain Sequence
b'GSSGSSGPDADPVEIENRIIELCHQFPHGITDQVIQNEMPHIEAQQRAVAINRLLSMGQLDLLRSNTGLLYRIKDSGPSSG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA-directed RNA polymerase III 39 kDa polypeptide
publication title Solution structure of rpc34 subunit in RNA polymerase III from mouse
rcsb
source organism Mus musculus
molecule tags Translation
total genus 16
structure length 81
sequence length 81
ec nomenclature ec 2.7.7.6: DNA-directed RNA polymerase.
pdb deposition date 2006-04-06
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 2dk8A01
1QZYA 3BZ6A 4I98B 1R1TA 3F72A 1XGNA 3CUQB 2LKPA 4HV5A 3RYPA 4HZFA 1JHFA 1ZYRF 1ZRCA 2PQ8A 2A6EF 4NQWA 1W5TA 3C18A 3PFIA 2KJBA 3WE2A 3BPVA 4L5JA 3FXQA 3MZYA 1UCRA 3P9CA 5H20A 3M8EA 2OZ6A 4IHSA 1FX7A 4KA4A 4FHTA 2Y48A 5KK1A 2KIFA 3C7JA 3ECHA 1Z6TA 3KZZA 5HLGA 3BPXA 4ETSA 3ZMUA 2PBIA 5L3BA 1O3SA 1WSUA 2HFHA 4HV6A 1MDMB 3KP5A 4Z2YA 3FXUA 1Z9CA 3GWZA 2H6CA 4JBAA 3Q5FA 3R4KA 4RGRA 3RIRA 4WF2A 3ZMZA 1ZRFA 3TQNA 1FSHA 2HGCA 1YW7A 4EM2A 4BHPA 2CGPA 2A69F 2VC1A 2P7VB 2JPCA 1D8KA 2E7XA 3MCZA 4OIRF 2V9VA 3R0AA 3P7NA 5ICCA 2XAHA 4I0BA 1TW3A 3GXOA 1U8RA 4L9TA 1YLFA 1TQMA 3P9KA 2Z3YA 1FWZA 2G7HA 1DUXC 3E6MA 4ESJA 1XGMA 2F5DA 3TOBA 4MGRA 3OOPA 4CO8A 1XCBA 3FMRA 1V3FA 1G3YA 3KLOA 3M8FA 1YTYA 4KDPA 3RTRA 2JT1A 3ULQB 1ZH5A 1R1VA 1ZG3A 2P6TA 1YW8A 3F8BA 4KIBA 5ICFA 1B9NA 1KQ0A 2EFPA 5LHIA 2UXXA 1ZN2A 1KYZA 2JTVA 4P9UA 3BY6A 3DF8A 1GVJA 4KIFA 2HYGD 1W4MA 3DP7A 2ZMEA 5LGTA 4HX8A 1ZGAA 1JXSA 5CVVA 2IT0A 1IN4A 5HVQC 1LQ1A 4L5IA 2J5PA 1ZG5A 5IT9Z 4RGXA 3J81K 2BYVE 1BOAA 2BV6A 2KKOA 2A68F 5JVTA 3VODA 4M73A 1XMAA 5LBQA 3GLXA 2F5FA 2GIVA 3SZPA 1YFHA 4OINF 4AIKA 5FFXA 3QPTA 2E1NA 4U7BA 3E5UA 1IN5A 3WGGA 2O03A 5CVUA 2VOOA 2EFOA 3MEXA 3ZMSA 5D6EA 4U0WA 3REOA 1TBXA 3WG9A 4Q4ZF 1Y0UA 2D1HA 3DEUA 3ERED 1MJBA 2CG4A 2LNBA 3KP6A 4ESFA 1T0FA 2EJRA 2HZTA 4KN7X 4MEXF 3LQRA 4RS8A 2KJCA 2EWNA 3IWFA 5E18F 3LA2A 5L3EA 1RIOH 2JRTA 4OU0A 3F3XA 2XRNA 4QWQA 4EGYA 2W25A 3IC7A 1WI9A 4R79A 4RB3C 2FA5A 3R0JA 4IVNA 1Z05A 1S29A 2X0LA 2IJLA 4UXNA 5J6XA 1J7KA 2QUFA 3FZVA 1IRFA 2D1VA 3G3ZA 1P4XA 2ZMEB 1R1UA 4RAYA 4UNOA 3RKYA 2A07F 1MZBA 1L0OC 4U0YA 5D5XB 1IN7A 5FO5A 1QQIA 5FD6A 1EV7A 2HWVA 5FB2A 1Z7UA 4M9SA 1ON2A 2UWMA 3C3WA 3RKWA 1IF1A 4OMYA 4G94A 2VE8A 4GGGA 3FHZA 1DDNA 4ZZDA 2MLGA 2VBZA 3H3ZA 2O0YA 2Z99A 1FPQA 1YYVA 2LSOA 4EV0A 2TDXA 4WXDA 3LA7A 4L18B 3V7RA 1Z91A 2XASA 1ZGJA 2NAZA 1I1GA 4H0EA 1BIAA 1U6GA 2FOKA 2Q8KA 1MKMA 3K1PA 5HS9A 4EVIA 3N97A 3GEZA 3O2PE 4KT5C 1EH7A 1KQ8A 2GAUA 1B1BA 5F64A 3JAMZ 5D5WB 1T38A 4AWXB 2L3DA 4WXCA 4UUVA 1PDNC 4HQMA 1RNLA 2OA4A 3GUDA 3E6CC 4RB0A 2ISZA 1MGTA 3WGIA 3RDIA 1U5TB 1ZAOA 2FMLA 4F7ZA 2VBXA 3TOAA 3GZ6A 2HKXA 5A2QK 5D5UB 3QOPA 1IXCA 1ZARA 4LK1F 2STWA 1MJ9A 5D6FA 4ON0A 2NNYA 3HSEA 1GXPA 1JGSA 2ESHA 2VT2A 2P8TA 1SD7A 2HEOA 4R1HA 1HKTA 1SD4A 3J80Z 2IA2A 4KUMA 1O3QA 3CO6C 3WTXC 1FNNA 3MWMA 1BN5A 2Y0MA 2VODA 1HSTA 1PP8F 3GVAA 2ACJA 2QZ8A 4KYWA 1K6OA 4IRHA 4GXOA 2QQBA 3CJNA 2CW0F 4M71A 4IRIA 1U3EM 4P55A 4HQEA 1LJ9A 4OOIA 2D45A 3RJPA 2R7FA 1P92A 4LFUA 4OMZA 2K7LA 3E3VA 2FRHA 4CGZA 5ILVA 3BOQA 3M7GA 5TJJA 4YG2F 5TRDA 1FYMA 2JPBA 1IXRC 2QVOA 2V79A 4LK0F 5FLXK 1QO0D 3I59B 5LEJA 1ONVA 1KU7A 1XGOA 2ZNZA 4Y15A 4BHCA 4G7OF 1FYKA 2NYXA 2MH9A 3I64A 1R36A 2Q0OA 1OR7A 2RV8A 4EJOA 1IAWA 4LMYA 1R00A 3F8MA 3MQ0A 1EH6A 4LG0A 4XLNF 2W24A 3JTHA 2D2WA 1ZLKA 2XHKA 1TLHB 1LDKB 2EA2A 2VBWA 5HDGA 1S6LA 3QP6A 5DCMA 5HLHA 5FD5A 4G9YA 4ZZLA 5LRSA 2QBYA 4XLPF 2PLYA 3DQVC 1IRGA 3DFGA 1T6SA 4Q5SF 3IHUA 2Y75A 4HF0A 4BQAA 3U1DA 1HBXG 3WU0A 5HS8A 2H94A 4KFCA 3IKVA 1GXQA 4NHJA 1SMYF 3QU6A 1W7PB 2M5WA 4BXUA 1K78A 1HW5A 3WU1B 4GYGA 3L2CA 1QPMA 4PCQA 1FBSA 1FSEA 5EEGA 3FX3A 1UHWA 2NNNA 4O6JA 1RUOA 4OIPF 5CVJA 3WGHA 4PDKA 1R5HA 3GO5A 3T5XA 3SZTA 3FMQA 2QM3A 2CQKA 5CJ9A 2PJPA 5E8IA 5ICGA 3MZHA 4HDVA 4CZZA 1HW2A 4MTEA 1QNTA 1O3RA 4EM1A 1USTA 2FNPA 2ESNA 1BM9A 2UZKA 2STTA 2YU3A 3HIFA 5CLSA 4EJVA 1OYYA 1FBQA 2IA0A 2H27A 4KIGA 2DO7A 2L4MA 1YIOA 3WTZA 2W85A 2EA4A 5DV5A 5FFZA 2QBYB 2BBYA 5FGMA 2ZJ2A 1FC3A 4XBFA 4IRGA 2GZWA 4PGHA 1V4RA 2WC2A 4UHTA 4M6XA 4I02A 1L3LA 2IPQX 1KQ9A 5J8CA 4NB5A 3ZP5A 4EJTA 2QENA 2IVMA 3E6BA 3K2ZA 2KRFA 1JE8A 3VB2A 2QQ9A 4IJAA 2EFNA 1K78B 1TQPA 2W57A 3JW4A 1B6AA 4BAYA 2FNAA 2P5KA 5CVIA 4RB1A 2VONA 1RZ4A 2HR3A 2ETHA 1S7AA 2DW4A 4G8XA 1CF7A 1YW9A 3I5UA 3MAJA 2E1CA 3ABUA 1LEBA 1DP7P 4HX4A 2Z33A 3K0LA 5CVRA 2ISYA 4WK8F 1I6XA 4A6DA 4HAMA 1F9NA 3GW2A 3TO7A 2EV0A 1K7AA 1LDJA 4G6QA 4YFXF 3HSRA 5BMZA 3FM5A 4AIHA 2OQRA 2DBBA 4LJZF 2EV6A 1HXDA 2CO5A 1B4AA 1J59A 4ZYGA 1SD5A 5L3FA 1ON1A 4HOBA 4CXFA 3T1BA 5E8GA 2DQLA 4RAZA 3S2WA 3SFZA 1U78A 4WWCA 1IUYA 1IN8A 2FBHA 1LDDA 1J75A 3NQOA 4KMFA 4YIIA 4G6DA 2HQRA 2H6BA 5H6RA 2X4HA 3F21A 4GCVA 3WTUC 4DQ2A 1HQCA 3L9FA 4U88A 5DEQA 5LGUA 1O3TA 3GYHX 1OPCA 4Y17A 2HOEA 3H3UA 4YIFA 3EUHA 3E97A 3IRQA 1YG2A 5JR3A 4UVBA 1OKRA 4IPAA 3CUQC 3HRUA 5HOOA 4UV8A 1R7JA 2LF8A 2FBIA 1ZREA 4A0XA 3I71A 1G3WA 1XN7A 4L0ZB 3C1DA 1CF7B 2VN2A 3I53A 4WX9A 4D0PA 2A5YB 3R61A 1T39A 1UHMA 4LLNA 4HYEA 2YX7A 2EB7A 2P5LC 3DKWA 3HUGA 2HS5A 3K1MA 4Q47A 3KCCA 1SFXA 2KIUA 1MJAA 3KEQA 4EJUA 5DUKA 5L3CA 3GFLA 1BC7C 2ZBKA 4YFKF 1IW7F 5JI6A 2DK8A 4ESBA 3CTAA 2L01A 2OQGA 2PN6A 2P5VA 3NEUA 3W6JB 3EYIA 4AD9A 5E20A 1Z6RA 1WKMA 3E6DA 5D5VB 3ELKA 2K86A 1REPC 3F6OA 2HDCA 1D3YA 1P2FA 6PAXA 1HKQA 4DNCA 3HOSA 1BI3A 3Q9VA 4Y13A 2ZFWA 5LRRA 2F2EA 2IW5A 1LB2A 2FE3A 4ENJA 1XB4A 1FT9A 2NRAC 2COMA 4O5VA 3HRTA 4HBLA 4PGGA 1F1ZA 1XCVA 1AWCA 1TTYA 3T8TA 5AIPA 4HA8A 1YQAA 3V8LA 4G7ZF 3GFJA 2WWYA 1QBJA 3V7CA 1Z1DA 5AONA 1BBYA 2ADUA 4KMUX 4FX0A 4KNYA 1ZRDA 4A0ZA 3LWFA 2PG4A 2R7DA 3M9AA 2RGVA 1A04A 4XRFA 5K5OA 4A12A 4I7HA 2M1BA 1J2XA 2VOPA 4M74A 2XKPA 2MH2A 1HKSA 1R5GA 3O6BB 4R8HA 3IKTA 4OIQF 4LB5A 1STZA 4ZYDA 5BOXA 3WE3A 1F4KA 2O3FA 4ASNA 5F1RA 3OV8A 1ODDA 4PZJA 2CFXA 2MBFA 1J9IA 1R23A 5BPDA 3J7AO 2V6CA 3CLOA 3KLNA 2ZXJA 2PFBA 3LQQA 4U0VA 1USSA 3L09A 5DCFA 3RPUA 4LB6B 5K5QA 2DQRA 3F6VA 3MFKA 4JK1X 3QPHA 3IL2A 1RI7A 4MEYF 1ZLJA 1S8NA 2RC4A 3PQJA 2LDUA 1Q1HA 5JHUA 1H9GA 3P9IA 3K9TA 5H6QA 2QWWA 3KP7A 3ABTA 3F8NA 2O61A 4LGWA 1XSDA 2PMHA 5KVRA 2L02A 3VOEA 2IRFG 2GWRA 3U2RA 1TNSA 2VC0A 4XSZF 3CDHA 3JAMK 4JQFA 3BROA 3KZYA 3K1NA 2GXGA 1MDMA 5J8FA 2R3SA 3VFZA 4IF4A 2A6HF 3COAC 2M45A 3I4PA 2Q2EA 3H92A 3KFWX 1KGSA 1BI0A 3HOTA 2KIMA 2ZKZA 4M6YA 2RVCA 4HF2A 3LFKA 1F5TA 4OIOF 5BPIA 3BJ6A 4CICA 1FOKA 3HRSA 1ZHFA 4I2OA 2RKHA 3KP4A 2MC3A 1RUNA 3QU3A 5LEKA 1BJAA 3VEPA 3BP8A 3W6KB 2IA1A 4A2UA 4B09A 3V8JA 3CO7C 2EK5A 4MQ9F 2ZO4A 3DPLC 2EV5A 1FY7A 4AVPA 1C0WA 3Q9SA 2WTEA 3U9GA 3J80K 4XSXF 1QZZA 5LLQA 1O57A 4HLYA 3F22A 2AS5F 2PMUA 5E17F 4A5MA 1MD0A 3I54A 1O7FA 3WTTC 2XUBA 4U7DA 2OZUA 1EH8A 3SQNA 4E70A 3NRVA 5L3GA 3KETA 2AXLA 1B59A 2OD5A 5BS6A 4MNUA 2M30A 2CWEA 3HHGA 3KE2A 2XROA 2K4BA 3J81Z 4UV9A 5HDNA 2FSWA 3KEOA 1W5SA 3TKYA 2W84A 2DPUA 1G3TA 4L9JA 1PP7U 3GF2A 4KICA 3T0YA 5K1YA 1DPUA 2JSCA 4L0YB 3BJOA 5CYVA 1CGPA 1HSJA 4LG0B 3DV8A 1G6NA 4CDGA 2GXBA 3FM3A 2HTJA 3LSTA 3F23A 1XMKA 3GZ5A 4N9IA 1U5TC 4GO1A 4M9XA 2F5CA 2RDPA 3F8CA 4P96A 3JTGA 5HS7A 3FF5A 4FT8A 1FP2A 1YO5C 4HF1A 2M8EA 5DCMB 3TO9A 2WV0A 2DLLA 2FBKA 2K02A 1OYIA 3ZQ7A 2RQPA 3RYRA 1FZPB 2QYOA 1KYWA 1J0RA 4AIJA 1IN6A 3BJAA 3IWZA 3FWEA 2UXNA 5ERIA 2MLKA 1VTNC 3EQLF 2YSRA 3ZMVA 5D4SA 4RGSA 3TDUC 5BQTA 3HRMA 3JSPA 3GFMA 2P6SA 3L00A 2RN7A 2B0LA 4YFNF 4I01A 5LHGA 1SAXA 3SXYA 3L7WA 2DK5A 2HTSA 2FEZA 5AIQA 1I27A 3SHFA 1XD7A 1FBUA 2EFWA 2G7UA 3ZMDA 4O3MA 5EEHA 5D4RA 3ROUA 1TQIA 3RI4A 1ULYA 4A6EA 2DPDA 3HTUA 3B73A 3G73A 2LF7A 1PUEE 2FQ3A 3ZN0A 4ZYEA 5DUIA 2A3SA 2C6YA 2QQAA 5D8LB 2O6GE 4EMSA 4BNCA 2HQNA 4G7HF 1H0MA 4I0AA 3TGNA 1S7OA 2YPRA 4WXHA 1LEAA 1E2XA 2XAJA 2DAOA 1UB9A 3B02A 1KU9A 3HTSB 2CSOA 1D5VA 2RNJA 1G3SA 4I09A 4B8XA 4RB2C 5LHHA 2DU9A 3IRRA 4N9HA 1NHAA 1DPRA 4HX7A 4EGZA 1P4WA 4ENMA 1P6RA 1I5ZA 3AAFA 3BWGA 1WRJA 3ISPA 4EQQA 3ZPLA 2A61A 2MD5A 3RPQA 1X3UA 3BDDA 2ELHA 3WTVC 1HW1A 5L3DA 3EETA 2XGXA 2DT5A 4L9NA 2YR2A 1XSXA 2V1DA 2XKOA 5A2QZ 3I0TA 3V7SA 1WQ2A 2HYFA 4MHGA 1ZG1A 4IXAA 3WTSC 2V1XA 4A0YA 2Z9OA 1AOYA 2FMYA 1U5TA 4BHBA 4HW0A 1T2KA 2NS0A 3M1EA 5E1ZB 3E5QA 3V4GA 3GX4X 3HHHA 4CHUA 4UVAA 1TW2A 2BGCA 1SFEA 2YX4A 1O7LA 5DD4A 1IXSB 3E5XA 4LLGF 1FP1D 2XAGA 3WODF 5IT9K 1FYLA 5LGNA 1KU2A 3ML6A 4BH9A 2QLZA 1W7PD 3GFIA 2FXAA 2IP2A 3PQKA 2GA1A 4S04A 1QGPA 3LAPA 3QP5A 1K79A 1YS6A 3K69A 1R58A 2ZCWA 3D0SA 2CYYA 3FMSA 2FF4A 2J5OA 2XIGA 1E17A 4GYIA 1WWXA 5ILSA 1BIBA 1FLIA 5K5RA 1T98A 1R22A 2BEOA 1XSVA 3T8RA 4N0BA 4RGUA 4QLCU 1G4DA 4MTDA 5HLIA 2G9WA 4UVCA 5F6FA 3ZMTA 1B9MA 5ILUA 1KA8A 2M87A 3O3KA 5FLXZ 3RKXA 4M72A 2GQQA 3R60A 1LNWA 4LD5A 2DTRA 2XAFA 1IZ1A 2GA2A 2MA3A 2ZNYA 2F5EA 2VXZA 5D8KB 3LA3A 2P4WA 3WTYC 1U2WA 3I58A 4L9VA 4P9FA 2P7CB 2XAQA 1BI2A 2K27A 3EYYA 3HSFA 3I59A 5JFRA 5DYMA 3ZN1A 3ECOA 2OU2A 4EM0B 2E7WA 4TV7A 4K2EA 1XDSA 1BC8C 2Z5UA 3DXJF 5ICEA 3TO6A 4BYYA 1SD6A 2JZYA 2VE9A 4CYDA 4EJWA 2L4AA 2K4JA 1OMIA 1I1SA 3KP2A 3TDZC 5E1WA 4ENNA 1SFUA 1UFMA 5E1XA 1GHCA 2V1UA 3R6SA 1D8JA 1OYWA 3CUQA 1JHHA 3QRFF 3V8KA 2EFQA 1XGSA 3WTWC 4S05A 1SMTA 4LLLA 1XDUA 1J5YA 4M9ZA 2PI0A 2FU4A 2H09A 3DPTA 3EDPA 4Q48A 1KU3A 3QAHA 5DD8A 1W7PA 4P5OA 4A5NA 2VBYA 1H9TA 2OAZA 5IT3A 4MQVA 2BE5F 2DI3A 3HYIA 4ZYHA 3F8FA 3LAJA 1S3JA 3FXRA 3KP3A 1YS7A 4HDUA 3JSOA 5DDGA 4KN4X 2L54A 2O8XA 2XVCA 2OBPA 2XV4S 4ZH4F 1P4AA 3CUOA 4FX4A 3N4MA 2HKOA 1BI1A 5HDKA 4HLXA 4WCGA 4ENKA 2VT3A 2PEXA 1LVAA 3D5LA 2DFIA 4IHTA 5ED4A 1TNTA
chains in the Genus database with same CATH superfamily
2ZJQF 1QZYA 3BZ6A 3OYNA 2E71A 4CSWA 4ZYAA 3GLLA 4I98B 2VJIA 1R1TA 1GDTA 3AL0B 3F72A 1XGNA 3CUQB 3OY9A 2LKPA 3MKZA 4HV5A 3RYPA 4H4KC 2JA7J 4HZFA 5M3FJ 1JHFA 1ZYRF 1ZRCA 2ZFUA 2PQ8A 2A6EF 2V4JC 4NQWA 1W5TA 3BG7A 3C18A 3PFIA 2KJBA 3WE2A 3BPVA 2KIQA 2XPWA 5J3LA 1YJ9I 1HF0A 2XGEA 3EUAA 4E7SA 2R92J 4L5JA 1FIAA 3FXQA 3MZYA 1Z7LA 1UCRA 1QRYA 2Y9YA 3P9CA 3TL4X 5H20A 2Y0SA 1B8IA 5E3NA 1VQ4I 2ICWG 3M8EA 4V2GA 4BE0A 2OZ6A 5IOZA 4B3XA 3GTPJ 4IHSA 1FX7A 3O8HA 4KA4A 4E7ZA 4FHTA 2Y48A 1X19A 5KK1A 2KIFA 1LE8A 1VI0A 3DCFA 3C7JA 2QSFX 3H9JA 3ECHA 2DDBA 1Z6TA 3KZZA 5HLGA 3QPSA 1VQOI 4V2FA 2X6WA 5FLMJ 3BPXA 3GTKJ 1DQUA 2PMZN 2XRLA 4ETSA 3ZMUA 4AUXA 2PBIA 2VI6A 3SZGA 5L3BA 5F27A 1O3SA 5HNHA 1IG7A 1WSUA 2HFHA 2EIJH 2L9NA 3OYHA 4A3DJ 4HV6A 3SEZA 1MDMB 3KP5A 4Z2YA 3FXUA 4IEJA 3GWZA 2H6CA 1Z9CA 4JBAA 5JLXA 3Q5FA 2BVLA 3R4KA 4RGRA 3RIRA 2X6OA 4RLFA 4WF2A 2Q2EB 1I3QJ 1Z0XA 3ZMZA 5E3LA 1ZRFA 3EUHC 2OTLI 2NVYJ 1KZHA 3TQNA 4B48A 1FSHA 2ZJRF 2HGCA 2QKLB 1GV5A 1YW7A 2QGUA 4EM2A 2M7BA 3WHBA 4BHPA 2VPRA 2CGPA 4FASD 1X1PA 2A69F 2VC1A 2P7VB 3ZRGA 1MMGA 5GP9A 2JPCA 4J00A 1D8KA 2E7XA 2XB0X 2R7ZJ 3MCZA 4OIRF 1NG6A 2V9VA 2AXTC 1HDPA 1BW6A 3H9GA 2ECBA 3R0AA 3P7NA 2ZXIA 2XAHA 4I0BA 5ICCA 1TW3A 5KAIC 3GXOA 4CA0A 1U8RA 2ZJPF 4L9TA 1YLFA 1TQMA 1WCMJ 3BT9A 3LSHA 3P9KA 1TWHJ 5IPAA 3PO3J 2Q1ZB 1D1BA 2NOGA 1P7JA 2Z3YA 1YRNB 2VASA 1FWZA 2G7HA 3FISA 5GAEJ 2CUZA 3TMOA 1DUXC 3KX2A 5CPRB 3E6MA 2A6TA 4ESJA 1XGMA 2DCEA 2F5DA 3TOBA 4AYBA 5H2FC 1YJWI 4MGRA 4KISA 4C2MJ 3OOPA 4CO8A 5FKNA 1XCBA 3FMRA 2K3FA 1V3FA 1G3YA 3E1SA 3KLOA 3M8FA 2WY8Q 1YTYA 2OJED 4XKCA 2W48A 4DBRA 1R4NB 4KDPA 3RTRA 2JT1A 3ULQB 2LP0A 3S3OA 1ZH5A 3JCUC 4I99C 1R1VA 2YUSA 3ZQFA 4XORA 2W7NA 1ZG3A 2JK3A 2P6TA 1YW8A 2BOLA 3F8BA 2VXDA 5EYRA 1BJZA 2DFFA 2CUFA 2XF5A 4KIBA 1PJRA 4LIVA 1YJNI 5ICFA 1B9NA 3UKGA 4OAYA 1KQ0A 1ZK8A 2IGKA 3DBRB 2EFPA 5J1UA 5LHIA 2UXXA 1ZN2A 1KYZA 2JTVA 3BY6A 3DF8A 3HG9A 1XTAA 1GVJA 4BQQA 4P9UA 1X1AA 2YU9J 1IRXA 4BGDA 4KIFA 2HYGD 1W4MA 2L7ZA 3DP7A 2VQCA 2ZMEA 5LGTA 5GPAA 4HX8A 3CDLA 1ZGAA 3PJRA 2HVRA 1RKWA 3RQIA 1JXSA 4GFBA 5CVVA 2IT0A 1IN4A 5HVQC 1LQ1A 1HCRA 3DBLB 4L5IA 2J5PA 1ZG5A 1DGWY 2YS9A 2WAFA 5EG0B 3PIOF 5IT9Z 4RGXA 1G2HA 2XB5A 3BR5A 1SANA 3A0BC 3J81K 3K4CA 4HG2A 4CCNA 5IP6A 2BYVE 5IP7J 1IC8A 4BACA 1BOAA 4DYQA 2BV6A 4M3FA 2KKOA 2A68F 3K4KA 4C3IJ 2H8WA 1R6RA 5JVTA 2NVQJ 3VODA 3HBLA 4M73A 1XMAA 1LFBA 4EATA 5LBQA 3GLXA 3CCYA 2F5FA 2GIVA 2AO9A 3SZPA 1LKXA 1J09A 2TRTA 2VIXA 5EDNA 1Z77A 3M8JA 5EF6A 1LVKA 1YFHA 4OINF 4AIKA 5FFXA 5CQGA 3QPTA 1GV2A 2E1NA 4U7BA 1X1BA 3E5UA 1IN5A 1D1AA 3WGGA 1XPXA 2LYCA 1X3ZB 2O03A 5CVUA 2VOOA 2QQ8A 2EFOA 2VJJA 3MEXA 2EIKH 4E7IA 3ZMSA 5D6EA 4U0WA 3REOA 2NOJB 1JT6A 1TBXA 4ZDOA 3BR3A 3WG9A 4Q4ZF 1AHDP 1Y0UA 2D1HA 3DEUA 1K4TA 3ERED 1MJBA 1W5CC 2CG4A 2VQHA 4BJ6C 5E3OA 3ZQCA 3A2KA 2LNBA 4IOAF 2FX0A 4Z6YA 3KP6A 4ESFA 1T0FA 3TW7A 2EJRA 2HZTA 4KN7X 2PJRA 4MEXF 3LQRA 4RS8A 2KJCA 3BR1A 1VQLI 2EWNA 2R5YA 4M3EA 4RBOA 1X2MA 3IWFA 5E18F 3LA2A 3GTQJ 3LSGA 2RAEA 5L3EA 3L2VA 2COBA 4Y4RA 2LG4A 1RIOH 3DTEA 1ETVA 2JRTA 3H0GJ 4OU0A 1DU0A 1E3OC 4JOMA 2DMTA 3F3XA 2XRNA 4QWQA 4EGYA 2BHZA 2O5RA 3P5JA 4I6ZA 1VQPI 2W25A 1MNEA 3IC7A 1WI9A 3B6CA 4R79A 4RB3C 3JRIA 1TWGJ 2FA5A 3ERMA 3VYRB 1R71A 3R0JA 1MH3A 1KONA 1Z05A 4IVNA 3LSPA 5M5YJ 1S29A 1OLTA 2X0LA 3Q0WA 2IJLA 4UXNA 3LMMA 5J6XA 2KZGA 3ZQLA 1J7KA 2QUFA 3A1YA 3FZVA 2ZC2A 1IRFA 1HDDC 2D1VA 3G3ZA 1P4XA 2ZMEB 4F52A 1R1UA 4RAYA 3FKJA 4UNOA 3RKYA 2A07F 3SFIA 3MN2A 1UG0A 1S7EA 4BS9A 1MZBA 1L0OC 3F0CA 4HPQA 3RPUD 1AKHA 1MSFC 2R0QC 1A5JA 4U0YA 2MW8A 2CU7A 4YRVA 3AG2H 5D5XB 1IN7A 1WJAA 5FO5A 1QQIA 4KT6A 5FD6A 1EV7A 2HWVA 4XRMA 3QYBA 5FB2A 3S1RJ 1Y1VJ 1Z7UA 4M9SA 2LTPA 1ON2A 4PJ0C 2Y69H 2UWMA 3C3WA 2B9SA 3RKWA 1HA8A 2K3PA 1IF1A 4OMYA 3KYDB 4G94A 2VE8A 2QF7A 4BEHA 1F36A 5J1RA 4GGGA 1XS9A 3FHZA 4M6VA 2DTZA 2RREA 1DDNA 1BOBA 4ZZDA 1VQ5I 2MLGA 2O9LA 2VBZA 3JRHA 3H3ZA 2EIMH 2OF7A 1MIJA 2LH9A 4L5EA 2O0YA 3NWTA 2Z99A 1FPQA 1YYVA 2LSOA 4EV0A 2TDXA 4ABZA 3FXJA 4WXDA 3VYTB 3W2WA 2Y30A 2W1OA 1MNDA 3G2BA 2DT7B 3LA7A 1JJ8C 4L18B 3V7RA 3KYCB 3OYMA 1GLNA 1Z91A 2XASA 3DEWA 3OWTA 1ZGJA 2NAZA 1IO2A 1IDZA 2HI3A 1I1GA 4H0EA 1BIAA 1JKRC 3JRGA 3IH4A 2W4SA 3BCAA 4UUSB 1U6GA 2L0KA 5KCMA 1ACIA 5C44J 1IV6A 2A05A 2R7VA 2FOKA 1SVLA 2Q8KA 1MKMA 3U1KA 2QEXI 3K1PA 5HS9A 2K9NA 4EVIA 3N97A 1RRJA 3GEZA 3W6VA 5C3EJ 3O2PE 4KT5C 1EH7A 2MD0A 1H88C 5J4YA 3C2GA 1WJDA 3G1MA 4QPOA 1KQ8A 1T08B 2GAUA 1B1BA 2E19A 5F64A 3JAMZ 5D5WB 2GLOA 2M7AA 1T38A 4AWXB 2L3DA 4XLHA 4WXCA 4XNFA 4UUVA 1PDNC 1W36C 3KZIC 4HQMA 1RNLA 2OA4A 3GUDA 5B5EC 3E6CC 4RB0A 4C3JJ 4M3DA 2ISZA 3EPZA 1MGTA 1UAAA 1FMWA 2R4GA 2EH3A 3WGIA 3RDIA 1U5TB 4G6TB 1ZAOA 2KMUA 2FMLA 4CYCB 1SVOA 3ABLH 4F7ZA 4E7LA 2VBXA 1TZLA 3TOAA 3GZ6A 2HKXA 3ABMH 3K4JA 5A2QK 1Q1VA 2OCCH 5D5UB 2XGDA 2I5UA 5HODA 3QOPA 3CJRB 1W36D 1IXCA 1ZARA 3BZKA 3A01A 4LK1F 2CQ7A 2IGOA 2STWA 3EUKL 1MJ9A 5D6FA 3DTIA 4IO9F 1OCOH 4XN0A 3IH3A 4XKBA 1EA3A 4ON0A 3I9V2 5GADJ 3BR0A 2EINH 2NNYA 1V5EA 3HSEA 1GXPA 1JGSA 1NK2P 1WJBA 4IHWA 2ESHA 2VT2A 2P8TA 4DYRA 4QTRA 1ERDA 3QQAA 3VYSB 2E34A 2JQ7A 1WHUA 4BEHB 3MD2A 1ETWA 1SD7A 2HEOA 3WG7H 2CW8A 1FTZA 2MGQA 4R1HA 1HKTA 1SC7A 3OIOA 3CCQI 1ETYA 1SFOJ 1SD4A 3CCEI 4GDFA 3J80Z 3J7YJ 2IA2A 4KUMA 4JX5A 3IH2A 2E2HJ 3BC8A 1O3QA 5IP9J 4DOZA 2KHMA 2A5WA 2R7RA 2DDAA 3CO6C 2FJ1A 3WTXC 5IYCJ 1FNNA 1T33A 1ZTRA 3MWMA 1BN5A 2EZHA 2Y0MA 2VODA 1HSTA 2R5ZA 1PP8F 5CQEA 3GVAA 1ZR4A 2ACJA 2E5NA 2XGCA 2E1OA 2QZ8A 2KT0A 4N4NB 2E1MB 2X9DA 4II3A 4KYWA 5GAHJ 1K6OA 4IRHA 4GXOA 2QQBA 3CJNA 3DEEA 2P81A 1JUMA 1JGGA 2CW0F 2X6YA 4M71A 4IRIA 4FE7A 1GT0C 3TEDA 2BY0A 1U3EM 2DOAA 4P55A 4HQEA 1V54H 1LJ9A 3VSKA 1A6IA 2G0EA 4OOIA 5F1JA 2D45A 2LBFB 2R7FA 3RJPA 1RR8C 2L7FP 2WBMA 1P92A 4LFUA 2VJ4A 1WH5A 4OMZA 2K7LA 3E3VA 2FRHA 3DBHB 4CGZA 2GOXB 5ILVA 3BOQA 3M7GA 5TJJA 4YG2F 2XSDC 1RC9A 1YHQI 2EZIA 3V42A 5TRDA 1FYMA 2JPBA 2XF7A 1IXRC 1K4SA 2QVOA 2V79A 1Y8QB 4LK0F 2F4MB 5FLXK 4FISA 1QO0D 1JTXA 3I59B 4V19K 2JMWA 5LEJA 1ONVA 1KU7A 1XGOA 2ZNZA 4Y15A 4BHCA 4G7OF 3CDIA 1FYKA 2NYXA 1UJ8A 2MH9A 3I64A 2O8KA 1R36A 2Q0OA 3M4OJ 3FBNB 1FEXA 4A93J 1OR7A 3J7AY 3PUFA 2X85A 1S5LC 2RV8A 4MO7A 3ZQQA 4EJOA 4XKWA 5K7FA 1IAWA 4LMYA 1R00A 3F8MA 3MQ0A 1EH6A 1BL0A 3OL4A 3FIWA 4LG0A 2DA7A 4XLNF 2ELJA 2W24A 3KYLA 3HOZJ 3CLQA 4D1QA 3JTHA 2BW3A 4IQJA 1ZQ3P 2D2WA 1ZLKA 2XHKA 5FKMA 2PX9A 1TLHB 2L5QA 2JSPA 3KPHA 3DWLE 4CCLA 4XLFA 1LDKB 4GRIA 2EA2A 5M5XJ 2LREA 5FJ8J 2BZTA 2VBWA 5HDGA 1B72A 4XL9A 1S6LA 1QVTA 2JRMA 2WB1A 3VPRA 3QP6A 5DCMA 5IOYA 5HLHA 1DP3A 1IDYA 5FD5A 3RZOJ 4G9YA 4B47A 4ZZLA 5LRSA 2E2JJ 3CESA 2QBYA 2OC6A 1V5FA 4XLPF 2PLYA 3DQVC 1IRGA 3DFGA 4XR6A 2Y0SN 1T6SA 1K61A 5IYDJ 4BU2A 4Q5SF 3IHUA 1T95A 2Y75A 4NUBA 2Y2ZA 2DOEA 5B66C 1T56A 4HF0A 4A3JJ 4BQAA 3U1DA 2WA0A 1HBXG 2DA1A 3WU0A 2R5ZB 5HS8A 3K4LA 2H94A 4Y7NJ 3HB9A 1PUFA 3I4NJ 4KFCA 1JTYA 3IKVA 4RDUA 1GXQA 1JI8A 4NHJA 1SMYF 3QU6A 1W7PB 2EZLA 3D5SC 2M5WA 4BXUA 5DM7F 2E35A 4DZJA 2IBDA 5LFAA 1K78A 2DA5A 1HW5A 1U9NA 4D5FA 1IUFA 2K9SA 3WU1B 4PJNA 3QWLA 3PM1A 4GYGA 3CJQB 4FQGA 1QPMA 3L2CA 4PCQA 1FBSA 1FSEA 4X6AJ 5EEGA 3FX3A 1UHWA 2NNNA 4O6JA 4W97A 2BHYA 1RUOA 4OIPF 2M0MA 3HC7A 3JRBA 1JKQC 3KIOA 3S2HJ 5CVJA 3WGHA 1FOYA 4PDKA 4BE1A 1R5HA 2R7QA 2L2OA 3GO5A 3T5XA 2BXYA 3SZTA 2W00A 3FMQA 3S1MJ 1AU7A 4AVZA 2QM3A 2CQKA 5CJ9A 2PJPA 5E8IA 3CCMI 5ICGA 1OCPA 4X1EA 1FOXA 2VLAA 2BXZA 3JRFA 3MZHA 4HDVA 1MBFA 1VQMI 5TISC 3AG3H 3D5RC 1YITI 4CZZA 1HW2A 3FBIB 4C30A 2BY1A 4MTEA 1Z21A 2DA2A 1QNTA 1O3RA 2MABA 4EM1A 1USTA 2FNPA 3CMYA 2ESNA 1BM9A 2UZKA 2STTA 1OQYA 2DFEA 2YU3A 1X2NA 5EZHA 2BW3B 1ETOA 3HIFA 1SAUA 5JVGF 1Y8RB 2I10A 1A31A 5CLSA 3PFYA 4DGWB 4AYBN 4EJVA 1YOVB 1OYYA 1FBQA 2IA0A 2H8RA 3OYKA 2H27A 4KIGA 5B3SH 2DO7A 2L4MA 1YIOA 2ZSHB 3WTZA 3S3MA 4F55A 2HDWA 2LKSA 3TP0A 9ANTA 2W85A 2EA4A 5DV5A 2DODA 2ME0A 5FFZA 1YIJI 3OMYA 2QBYB 2BBYA 4FTHA 2LY2A 3H36A 5FGMA 1UZCA 2ZJ2A 4NQWB 1FC3A 3GTJJ 4XBFA 1U0JA 4IRGA 2GZWA 4PGHA 1V4RA 2WC2A 4UHTA 3HEFA 4DZPA 1YE9A 2F5VA 1YI2I 4M6XA 4I02A 2B7EA 1L3LA 2IPQX 3E7LA 1KQ9A 3HOXJ 4A3IJ 1QVUA 5J8CA 4NB5A 3ZP5A 4EJTA 2QENA 3W2AA 4FETA 2IVMA 1B8IB 3E6BA 3K2ZA 3PNYA 2KRFA 5GTIC 2L9VA 5K7HA 1JE8A 2IAIA 3VB2A 2QQ9A 2F4OB 3H9QA 3CCJI 1S72I 2LR8A 4IJAA 2HPMA 1D1CA 4X0GA 2EFNA 1K78B 1TQPA 3MVPA 2W57A 3JW4A 4BBRJ 3PO2J 1B6AA 1LE8B 4BAYA 2FNAA 1RR7A 1Y56A 2P5KA 5CVIA 4RB1A 2VONA 2EPFA 1RZ4A 2OV7A 2HR3A 2ETHA 1S7AA 2QSGX 2DW4A 4G8XA 1VNDA 2W82A 4BXFA 1CF7A 1UHSA 1YW9A 2CUJA 1I39A 3I5UA 3SEQA 3MAJA 2E1CA 3ABUA 3CC2I 3GZNB 1LEBA 3CMAI 3AG1H 5GPCA 2VJ5A 1DP7P 4HX4A 2Z33A 3JRAA 3K0LA 5CVRA 2ISYA 3H3VK 1QPIA 2LVSA 4BL0B 4WK8F 2D5VA 2XF6A 3OIPA 1I6XA 3BTLA 4A6DA 4HAMA 1F9NA 3GW2A 1RKTA 3UNGC 1H8AC 3TO7A 3L2UA 2RNGA 2EV0A 1K7AA 1X1DA 4J19A 1LDJA 4G6QA 4YFXF 3HSRA 5BMZA 1N75A 3FM5A 3QYEA 1FIPA 4AIHA 4ZC3A 2OQRA 5TGTA 3FK6A 2CH0A 2DBBA 4LJZF 2EV6A 3LSMA 1HXDA 1X4OA 2CO5A 2CS3A 1B4AA 1WPKA 3S8PA 1SD5A 4ZYGA 1J59A 2IS6A 2GM4A 4XK4A 1RPWA 5L3FA 1ON1A 4HOBA 1W1WE 4CXFA 1NK3P 3T1BA 3HKZA 4PSXA 5E8GA 3BTJA 2DQLA 3HZJA 4RA2A 4RAZA 3S2WA 1Y1WJ 1BA5A 3SFZA 1U78A 4E7JA 3DLLF 1RESA 4WWCA 3D1NI 1QA6A 1ZR2A 3I55I 4DBQA 1XX5A 4XM3A 4BDZA 1IUYA 1IN8A 2FBHA 2JWTA 1LDDA 1ITYA 4W1UA 1J75A 3NQOA 4KMFA 4YIIA 4G6DA 2HQRA 2H6BA 4D7NA 4HRIA 5H6RA 1NTCA 2X4HA 3S1NJ 3F21A 4GCVA 3HDDA 1QU3A 4PJMA 2L7KA 3WTUC 3MZ8A 1R5ID 3MMYB 3OYCA 3HPHA 4DQ2A 2F48A 1D0XA 1HQCA 3L9FA 4U88A 5DEQA 5LGUA 3ZQHA 1O3TA 3GYHX 4XOPA 1OPCA 4Y17A 2HOEA 1JKPC 3CMMA 2O7OA 3H3UA 4YIFA 3EUHA 5DM6F 4BUPA 3E97A 2LC2A 4YELA 3IRQA 1YG2A 1OCTC 5JR3A 4UVBA 2K40A 1OKRA 4IPAA 1LFUP 3AL0C 3CUQC 3HRUA 2KL4A 3BQYA 5HOOA 4UV8A 1R7JA 2LF8A 2VKVA 3CD6I 2FBIA 2IS4A 1SEUA 1ZREA 4A0XA 1MMSA 1DU6A 3I71A 1G3WA 4PFPA 2UV1A 3SJMA 2HXIA 1XN7A 3K10A 4L0ZB 3C1DA 1CF7B 2V9PA 2JA6J 5E79C 2HOSA 2VN2A 3I53A 4WX9A 4D0PA 3FKIJ 2A5YB 3HGGA 3R61A 1T39A 5B1BH 1UHMA 2JVHA 4LLNA 4HYEA 2YX7A 2E60A 2EB7A 2I8DA 4HNVA 2P5LC 1GUUA 3DKWA 3HUGA 2HS5A 3K1MA 4Q47A 4KITB 3KCCA 1PYVA 3U21A 4HNTA 1SFXA 2KIUA 3PNVA 1P7IA 1MJAA 3KEQA 1TWFJ 2M4KA 3ZQIA 4EJUA 5DUKA 5L3CA 3GFLA 3OYDA 2ZBKA 1BC7C 2XAUA 4YFKF 4ZDLA 3IAS2 4Y52J 5CKTA 3G4SI 1IW7F 5JI6A 2DK8A 4ESBA 2DFHA 3CTAA 2IEKA 5HLTA 1ETXA 2L01A 2OQGA 2PN6A 2VQLA 3SYTA 3OYFA 2P5VA 3NEUA 3W6JB 3VWBA 3EYIA 4AD9A 4DYCA 1BW5A 5JLWA 5E20A 1JJ6C 1Z6RA 3OYJA 3FXMA 3BTIA 1WKMA 3E6DA 5D5VB 3ELKA 2E36A 3I4MJ 4ZTFA 3BR2A 1VQNI 3L1PA 2K86A 1REPC 3F6OA 2HDCA 2NXNB 2VQGA 1D3YA 4XIDA 4UY8I 2CRGA 1G59A 1P2FA 3IV5A 6PAXA 1HKQA 4DNCA 3HOSA 1BI3A 2WY7Q 3Q9VA 2PJRB 3C2BA 4CZCA 1G8XA 1X3WB 2DA4A 1IJWC 4Y13A 2R5YB 2ZFWA 5LRRA 1TP4A 2F2EA 2IW5A 1LB2A 2FE3A 2ZSIB 4ENJA 1XB4A 3Q0UA 1FT9A 1WVRA 2NRAC 2EQRA 4LOCA 3K70C 2COMA 3OS2A 4O5VA 3HRTA 4HBLA 2QSHX 4PGGA 3CCSI 1F1ZA 1WI3A 1OCCH 1XCVA 3S16J 1AWCA 1CQTA 3FHNA 5FLVA 3HOVJ 2IS1A 1TTYA 4CUGA 3H35A 3OR2C 3T8TA 5AIPA 4HA8A 1TL8A 1YQAA 2V6EA 3V8LA 5M3MJ 5K7ZA 4G7ZF 4XOTA 3GFJA 4RM2A 4A3GJ 2HYJA 2WWYA 1OJLA 2JA8J 2V7FA 3LSKA 4A3EJ 1QBJA 1T8IA 2DMQA 1XMXA 1OFCX 3V7CA 2EBIA 1Z1DA 5AONA 4DJAA 4BJTA 2GIZA 1JKOC 1AKHB 3HL2A 1BBYA 2ADUA 4KMUX 1A35A 4FX0A 4KNYA 1ZRDA 2OTJI 4A0ZA 3CJTB 4A3FJ 3LWFA 2PG4A 2R7DA 3M9AA 3WU2C 2RGVA 1A04A 3I3LA 4XRFA 5K5OA 4A12A 2CQQA 4I7HA 2M1BA 4E7HA 1J2XA 1D0YA 3ZXSA 4CCKA 2VOPA 4F3QA 1W0UA 4M74A 2ID3A 2XKPA 2MH2A 1HKSA 1K83J 1R5GA 3O6BB 4R8HA 3TBIA 3IKTA 3VDXA 4OIQF 1ZGWA 4LB5A 2KZVA 4JYKA 3JREA 1STZA 3ZGKA 2BVMA 4ZYDA 5J1YA 5BOXA 3WE3A 1F4KA 3DPUA 2O3FA 5EJCA 3DKYA 4ASNA 1W0TA 5F1RA 3OV8A 1ODDA 2QA4I 4PZJA 2CFXA 3S17J 2MBFA 1J9IA 4XRSA 1R23A 4XQFA 1H89C 1Z3XA 5BPDA 3M1CA 3J7AO 4A3KJ 2V6CA 3CLOA 2KDZA 3KLNA 2KRHA 3DKXA 2ZXJA 2PFBA 3LQQA 4U0VA 3TW6A 3MKWB 2R7XA 1USSA 2XPUA 3L09A 1JUSA 1FTTA 5C4XJ 1QHHD 5DCFA 3RPUA 4LB6B 3BG9A 4BY1J 5K5QA 2DQRA 3F6VA 1RETA 3MFKA 4JK1X 3QPHA 3IL2A 3VSLA 1RI7A 4CCOA 1OCZH 4MEYF 3OSFA 1ZLJA 2VB6A 1VQ6I 3LSRA 1S8NA 2RC4A 3PQJA 5EGOA 2EZKA 2LDUA 1Q1HA 5JHUA 4ANJA 1N78A 1H9GA 3K6GA 3P9IA 4ZJZA 5JHFA 3K9TA 5H6QA 2QWWA 3TP3A 3KP7A 4OWRB 4RAFA 3ABTA 3F8NA 2O61A 4LGWA 3UR3C 1XSDA 1N77A 2PMHA 5M5WJ 1BR4A 5KVRA 2L02A 3VOEA 2IRFG 2GWRA 3U2RA 1TNSA 2VC0A 4XSZF 3BR6A 5BNGA 3CDHA 3JAMK 1MBGA 4JQFA 2VL8A 2V26A 3JRDA 3BROA 3KZYA 4B4CA 2HPIA 4PJLA 3HJEA 3K1NA 1VQ7I 2GXGA 5J4VA 1MDMA 5J8FA 3A01B 3PNTA 1OCRH 2X51A 2R3SA 3VFZA 3Q3SA 4IF4A 3HPGA 2A6HF 3COAC 2M45A 2VKHA 3I4PA 2Q2EA 1QZEA 3H92A 1VQKI 3KFWX 2B63J 3OOUA 1KGSA 1BI0A 3HOTA 2KIMA 4XRSG 1R9TJ 2ZKZA 4N4OB 4M6YA 2WB1N 2RVCA 4HF2A 3LFKA 4BY7J 1F5TA 4OIOF 3LL7A 1TWCJ 5BPIA 3BJ6A 1U9OA 4QSHA 3OYLA 4B1RA 4CICA 1FOKA 3HRSA 1ZHFA 4XN3A 2WAQA 2JA2A 4I2OA 4NNJA 2RKHA 2JUCA 2M4GA 4IOCF 5J47A 3KP4A 2ZMEC 2ELKA 3S32A 2R93J 2MC3A 2LFBA 1RUNA 2H1KA 3NAUA 3QU3A 5LEKA 4A3CJ 1BJAA 2L7MP 3IP4B 3VEPA 2AQFA 2X1EA 3W2VA 3S2DJ 3BP8A 4DW6A 3W6KB 2IA1A 4A2UA 4B09A 3V8JA 3BCBA 3CO7C 2EK5A 3JRCA 3A4CA 4MQ9F 4AIDA 1MBJA 1TT0A 3L2QA 2ZO4A 1R49A 4XICA 1YRNA 3DPLC 2KISA 2EV5A 1FY7A 2WV1A 4AVPA 1C0WA 3Q9SA 1ETQA 2WTEA 3U9GA 3J80K 1Y0NA 4XSXF 1QZZA 3G1LA 3OYBA 2JVGA 5LLQA 3H5NA 1O57A 2CV1A 4FCYA 1UELB 2ZB9A 1WJ5A 3DTKA 4HLYA 1VZ0A 3F22A 3ONQA 2AS5F 5EGOB 3S93A 5HNFA 2PMUA 5E17F 4A5MA 4YIRX 1MD0A 3N05A 3I54A 3BG6A 1F43A 3FDYA 1O7FA 3AG4H 1N25A 4PFOA 4IQ4A 1JT0A 3WTTC 2XUBA 4U7DA 4J01A 2BY2A 2OZUA 1EH8A 2FQ4A 3SQNA 4E70A 3NRVA 5L3GA 3KETA 2AXLA 1B59A 2OD5A 5BS6A 4MNUA 2M30A 2CWEA 1T0FC 4G12A 1EKEA 5LD2C 3HHGA 3KE2A 2XROA 4DIQA 2K4BA 4IHVA 3J81Z 4UV9A 5F0HA 5HDNA 3HOWJ 3VYUB 2FSWA 2LY9A 2JN6A 3KEOA 4BDYA 1W5SA 3TKYA 5EZGA 2W84A 2DPUA 1G3TA 1P9QC 4L9JA 1PP7U 3GF2A 5KHDA 4KICA 3T0YA 2FD5A 5K1YA 5E3MA 1MH4A 2LK2A 3QODA 1DPUA 2JSCA 2M9HA 2PMZA 1K6YA 4L0YB 1ENHA 3BJOA 5CYVA 5EG0A 1CGPA 1HSJA 3OR1C 4LG0B 3DV8A 1G6NA 3Q0VA 1MMDA 4PJJA 4CDGA 2GXBA 3ASNH 4B3AA 3PL8A 3FM3A 2HTJA 3LSTA 2VKEA 2ZXHA 3F23A 2VUMJ 1JUPA 1XMKA 3GZ5A 4CCJA 1VF9A 2HZDA 1U5TC 4GO1A 4N9IA 2XC7A 1ORKA 1Y6IA 4M9XA 2F5CA 2RDPA 3F8CA 4P96A 1A6QA 1NH3A 4HNUA 3NWSA 5HS7A 4U87A 3JTGA 1HLVA 3FF5A 4JX4A 1B72B 4FT8A 1FP2A 1YO5C 3CCUI 1R4MB 1X58A 4HF1A 2M8EA 5DCMB 4ITVA 3TO9A 2WV0A 4XKVA 2ME6A 3GTLJ 3DLAA 2DLLA 2FBKA 4EEFG 2K02A 1OYIA 2DA6A 3ZQ7A 2RQPA 1UG2A 5GTHC 3GBGA 3RYRA 1FZPB 3G71I 3ZCOA 2DOFA 3BLYA 2QYOA 4XLCA 1KYWA 2NVTJ 3OS1A 1J0RA 4AIJA 1IN6A 4CCMA 2K9LA 3BJAA 3IWZA 3FWEA 2XPVA 2UXNA 5ERIA 3GMEA 2MLKA 1V5GA 1APLC 1VTNC 1PUFB 1QHGA 3KEYA 4KJZA 3EQLF 4B44A 5EEAA 3M07A 3OYEA 2YSRA 3ZMVA 5D4SA 4RGSA 3TDUC 2UUZA 5BQTA 1HC8A 2R7TA 3HRMA 4D9JA 1BR2A 3JSPA 3GFMA 2P6SA 3L00A 2RN7A 2B0LA 3AFHA 3HM5A 4YFNF 4I01A 5LHGA 2KRCA 1SAXA 3CC7I 3SXYA 3L2RA 3LSIA 2L9RA 3L7WA 2DMNA 2VKDA 2XDVA 2DK5A 3O8GA 3GCMA 2HTSA 2FEZA 5AIQA 1I27A 3SHFA 1ETKA 1XD7A 1FBUA 2EFWA 2G7UA 2MG4A 3ZMDA 1LUJB 4O3MA 3QOEA 1MMAA 5EEHA 5D4RA 3ROUA 2E1MC 1TQIA 3OYAA 4BQNA 2CFOA 1WFXA 3RI4A 1ULYA 2AHQA 1TC3C 3IAM2 4A6EA 3CMEI 2DJIA 1I50J 1SVMA 3CQZJ 1MNMC 2LOOA 3G1OA 5FKOA 2DPDA 3HTUA 3B73A 3G73A 2LF7A 1PUEE 1Y39A 2FQ3A 3ZN0A 1FJLA 3H0DA 4ZYEA 4IHYA 5DUIA 2A3SA 4C2UA 4I76A 5F0CA 5DS9A 3HKZN 1D0ZA 2C6YA 2QKMB 2CMPA 2QQAA 5D8LB 2O6GE 4EMSA 4BNCA 3OYIA 2HQNA 4G7HF 2JA5J 1H0MA 4I0AA 3HGYA 3TGNA 1S7OA 4F93B 3CP2A 4RMNA 3HOYJ 2YPRA 4WXHA 1LEAA 1E2XA 4IHXA 4E6KG 3K4BA 2XAJA 1WJFA 2DAOA 3X2QH 1UB9A 3B02A 2AQEA 1KU9A 3HTSB 1IRZA 4NC8A 2CSOA 4ZDPA 1IV8A 2CQXA 1D5VA 2RNJA 4HEA2 3G6EI 1G3SA 2LLKA 4I09A 4B8XA 1D5YA 4RB2C 5LHHA 3PIPF 2DU9A 2HOAA 3IRRA 4N9HA 2M8GX 1NHAA 1O4XA 1DPRA 2TCTA 4YEJA 4HX7A 4EGZA 5FRNA 3RZDJ 4UB8C 1P4WA 4ENMA 1P6RA 4AM3A 1I5ZA 3AAFA 4BQOA 4UUSA 3BWGA 4MFEA 2HVQA 1WRJA 2K9MA 2V9KA 1YX3A 3ISPA 4EQQA 3ZPLA 2DN0A 3F9KA 1BR1A 2A61A 3FXOA 4F92B 3S3NA 4BBSJ 2MD5A 3RPQA 4B43A 2WAEA 1X3UA 3BDDA 2KP6A 5F0FA 4RM3A 3ZOBA 1EF4A 2ELHA 3WTVC 1HW1A 3QPLA 5L3DA 1Z3YA 5KAFC 3S14J 2NS8A 1E0EA 3EETA 2K85A 2CUEA 2XGXA 5F04A 2DT5A 4L9NA 1PVEA 2YR2A 1XSXA 4NC7A 1E3PA 2V1DA 2XKOA 5A2QZ 2X48A 4XONA 3I0TA 3S15J 1V55H 2N8GA 3V7SA 4D7MA 1WQ2A 1TWAJ 2HYFA 4MHGA 1S9HA 1ZG1A 4IXAA 3WTSC 4BE2A 2X1DA 2KDOA 2V1XA 3SDGA 4A0YA 1ZKGA 2Z9OA 1AOYA 2CQNA 2FMYA 1U5TA 4A3LJ 4BHBA 4HW0A 4CYCA 2NS0A 4M3GA 1T2KA 1FMVA 3M1EA 1OISA 5E1ZB 2KLOA 2LD5A 3E5QA 4NBQA 3HXLA 3V4GA 2DT6A 2LRDA 3H1CA 3GX4X 3HHHA 4II2A 2M3AA 2R7UA 2HQ5A 4CHUA 4MIMA 2MSYA 4BKXA 4UVAA 4PK4A 4UB6C 1TW2A 2BY3A 3PUBA 4RLQA 2BGCA 4OAZA 2EILH 1SFEA 2YX4A 5FROA 1O7LA 5DTDA 1UMQA 1ZELA 1IXSB 5DD4A 3CF2A 3E5XA 4LLGF 1FP1D 2XAGA 4S0HB 2LKXA 1GVDA 3WODF 1WJEA 5IT9K 1U8BA 1NG7A 2Y31A 1FYLA 3S1QJ 3BZCA 4C3HJ 5LGNA 1KU2A 3SDBA 2NS7A 3ML6A 4BH9A 4XLAA 3HOUJ 2QLZA 3OYGA 4E4HA 3OIQA 4RAGA 1W7PD 3GFIA 1LPQA 2IS2A 3ZR8X 2FXAA 4JX6A 2GXAA 2IP2A 5B1AH 4FE4A 2H1LA 3PQKA 1HOMA 5FRMA 3GTOJ 2GA1A 3IUOA 2M34A 4S04A 1MSEC 1QGPA 3LAPA 2OUMA 3QP5A 1K79A 2CJJA 1YS6A 1AA7A 3K69A 3LNQA 1R58A 2ZCWA 3D0SA 2CYYA 3FMSA 2FF4A 4HSTA 1M1EB 4P1WA 2J5OA 2XIGA 1OR7C 1WH7A 4A69C 2FOWA 3PSFA 2IGMA 1E17A 2CW7A 4GYIA 3J7ZI 1SFKA 3WHCA 1WWXA 5ILSA 3A03A 1MBHA 4PSWA 3MKYB 1BIBA 3CC4I 1VFCA 2HQAA 2JUGA 3CZ6A 1T98A 4NDLA 2KQRA 5K5RA 1R22A 5GAGJ 1FLIA 2BEOA 1XSVA 3T8RA 2DXIA 1WZ2A 4N0BA 4Y3OA 3K4NA 4RGUA 4QLCU 1G4DA 4A3MJ 4MTDA 2DMPA 5HLIA 2G9WA 2DMUA 4UVCA 5F6FA 3ZMTA 4C2TA 1XC5A 1B9MA 5ILUA 1KA8A 2M87A 3OS0A 2LY1A 4BXXJ 3O3KA 1I6HJ 4M3BA 3C2HA 2LBFA 4Y33A 5FLXZ 2K9QA 3RKXA 4M72A 3K7AJ 2GQQA 3R60A 1LNWA 4LD5A 2DTRA 2XAFA 2MA3A 1IZ1A 2GA2A 2ZNYA 2F5EA 2VXZA 1POGA 2WADA 3AKZA 2HVSA 3H5AA 4IL6C 5D8KB 2E5ZA 4CH7A 3PSIA 3LA3A 2P4WA 1E3HA 3FXKA 3WTYC 1DGRM 3K70D 1U2WA 3I58A 4L9VA 4P9FA 1A36A 2HOTA 2P7CB 2XAQA 2R7SA 1EJ9A 3CCVI 1BI2A 2K27A 2XSJC 3EYYA 3H5RA 3HSFA 4BJ5C 4UUTA 3I59A 3JR9A 1X4PA 5JFRA 2M0CA 3HUGB 5DYMA 3ZN1A 3ECOA 2Z2SB 2OU2A 4NC6A 4EM0B 3BG3A 3OL3A 2K5CA 2E7WA 4TV7A 1MMNA 2F6CA 3A0HC 4K2EA 1XDSA 2HU9A 1BC8C 3RQ4A 3I56I 3LFUA 2LMDA 2Z5UA 3DXJF 2KPMA 5ICEA 3TO6A 4D5CA 4BYYA 1SD6A 2JZYA 4IKFA 3M3YJ 2VE9A 4JP0A 4CYDA 4EJWA 3B6AA 4QIWN 3CF5F 2L4AA 2K4JA 1OMIA 1I1SA 3KP2A 3TDZC 3K2AA 5E1WA 3BTCA 4ENNA 1SFUA 4ZTJA 1UFMA 5E1XA 4A3BJ 1GHCA 2E2IJ 1VQ8I 4AU7A 2KFDA 1Z67A 2QCOA 2CV0A 2HNHA 2V1UA 3R6SA 1D8JA 1OYWA 3CUQA 3FXLA 1JHHA 4IZZA 3QRFF 2OPTA 1VQ9I 2ID6A 3V8KA 2V1NA 2EFQA 3LOCA 3DU5A 2IGNA 2IXSA 2R7OA 1FOWA 3CCLI 1TT5B 3W3CA 2MFZA 2F4IA 5FKKA 1XGSA 3WTWC 4S05A 3RCOA 4QPQA 3CCRI 1SMTA 4LLLA 1XDUA 1J5YA 4M9ZA 4C9YA 2DYSH 1XG1A 2PI0A 2FU4A 3BQZA 2JJ7A 2DJNA 2H09A 4XMYA 4LIUA 3DPTA 3EDPA 3ABKH 4Q48A 4LITA 1KU3A 3QAHA 4XLEA 5DD8A 1W7PA 4PUSA 3GTMJ 4P5OA 4A5NA 2ZXWH 2VBYA 1MW7A 2X1CA 2ECCA 1H9TA 2OAZA 3CP8A 5J40A 5IT3A 4MQVA 3QYFA 5C4JJ 2BE5F 4MFDA 3RKQA 2FUG2 2NVUB 2NVXJ 3LSJA 2OCEA 5IYBJ 2DI3A 1WGXA 2DA3A 4E7KA 3HYIA 3E0JB 4ZYHA 2Z16A 1YX5A 3F8FA 3LAJA 1S3JA 1WJCA 3FXRA 3KP3A 1YS7A 1IGNA 5FKLA 4HDUA 5IY5H 3JSOA 5DDGA 1LFPA 4KN4X 2L54A 2L9SA 2O8XA 2WAQN 2XVCA 4LG3A 2OBPA 2MYSA 2XV4S 4ZH4F 4IX7A 1P4AA 3CUOA 3RSNA 4FX4A 4F91B 3ZQGA 1I3AA 2R7WA 3FK7A 3N4MA 3GTGJ 1X1CA 2VPLA 2X6XA 2GOMA 3NARA 3K4MA 2GBYA 2RQQA 2MC4A 2HKOA 5F08A 1MBEA 1BI1A 2M2EA 5HDKA 3BG5A 4HLXA 5KNLA 4WCGA 4ENKA 2VT3A 3OSGA 2Z1DA 4AC0A 2PEXA 2Y9ZA 1LVAA 1MBKA 4MLOA 3ASOH 3D5LA 2DFIA 3MKLA 3L2WA 3ESWB 3DU6A 2P0WA 2DYRH 4IHTA 5ED4A 3A02A 4HSRA 2HXOA 2CV2A 1TNTA 2HDDA
chains in the Genus database with same CATH topology
1QZYA 3BZ6A 4I98B 1R1TA 3F72A 1XGNA 3CUQB 2LKPA 4HV5A 3RYPA 4HZFA 1JHFA 1ZYRF 1ZRCA 2PQ8A 2A6EF 4NQWA 1W5TA 3C18A 3PFIA 2KJBA 3WE2A 3BPVA 4L5JA 3FXQA 3MZYA 1UCRA 3P9CA 5H20A 3M8EA 2OZ6A 4IHSA 1FX7A 4KA4A 4FHTA 2Y48A 5KK1A 2KIFA 3C7JA 3ECHA 1Z6TA 3KZZA 5HLGA 3BPXA 4ETSA 3ZMUA 2PBIA 5L3BA 1O3SA 1WSUA 2HFHA 4HV6A 1MDMB 3KP5A 4Z2YA 3FXUA 1Z9CA 3GWZA 2H6CA 4JBAA 3Q5FA 3R4KA 4RGRA 3RIRA 4WF2A 3ZMZA 1ZRFA 3TQNA 1FSHA 2HGCA 1YW7A 4EM2A 4BHPA 2CGPA 2A69F 2VC1A 2P7VB 2JPCA 1D8KA 2E7XA 3MCZA 4OIRF 2V9VA 3R0AA 3P7NA 5ICCA 2XAHA 4I0BA 1TW3A 3GXOA 1U8RA 4L9TA 1YLFA 1TQMA 3P9KA 2Z3YA 1FWZA 2G7HA 1DUXC 3E6MA 4ESJA 1XGMA 2F5DA 3TOBA 4MGRA 3OOPA 4CO8A 1XCBA 3FMRA 1V3FA 1G3YA 3KLOA 3M8FA 1YTYA 4KDPA 3RTRA 2JT1A 3ULQB 1ZH5A 1R1VA 1ZG3A 2P6TA 1YW8A 3F8BA 4KIBA 5ICFA 1B9NA 1KQ0A 2EFPA 5LHIA 2UXXA 1ZN2A 1KYZA 2JTVA 4P9UA 3BY6A 3DF8A 1GVJA 4KIFA 2HYGD 1W4MA 3DP7A 2ZMEA 5LGTA 4HX8A 1ZGAA 1JXSA 5CVVA 2IT0A 1IN4A 5HVQC 1LQ1A 4L5IA 2J5PA 1ZG5A 5IT9Z 4RGXA 3J81K 2BYVE 1BOAA 2BV6A 2KKOA 2A68F 5JVTA 3VODA 4M73A 1XMAA 5LBQA 3GLXA 2F5FA 2GIVA 3SZPA 1YFHA 4OINF 4AIKA 5FFXA 3QPTA 2E1NA 4U7BA 3E5UA 1IN5A 3WGGA 2O03A 5CVUA 2VOOA 2EFOA 3MEXA 3ZMSA 5D6EA 4U0WA 3REOA 1TBXA 3WG9A 4Q4ZF 1Y0UA 2D1HA 3DEUA 3ERED 1MJBA 2CG4A 2LNBA 3KP6A 4ESFA 1T0FA 2EJRA 2HZTA 4KN7X 4MEXF 3LQRA 4RS8A 2KJCA 2EWNA 3IWFA 5E18F 3LA2A 5L3EA 1RIOH 2JRTA 4OU0A 3F3XA 2XRNA 4QWQA 4EGYA 2W25A 3IC7A 1WI9A 4R79A 4RB3C 2FA5A 3R0JA 4IVNA 1Z05A 1S29A 2X0LA 2IJLA 4UXNA 5J6XA 1J7KA 2QUFA 3FZVA 1IRFA 2D1VA 3G3ZA 1P4XA 2ZMEB 1R1UA 4RAYA 4UNOA 3RKYA 2A07F 1MZBA 1L0OC 4U0YA 5D5XB 1IN7A 5FO5A 1QQIA 5FD6A 1EV7A 2HWVA 5FB2A 1Z7UA 4M9SA 1ON2A 2UWMA 3C3WA 3RKWA 1IF1A 4OMYA 4G94A 2VE8A 4GGGA 3FHZA 1DDNA 4ZZDA 2MLGA 2VBZA 3H3ZA 2O0YA 2Z99A 1FPQA 1YYVA 2LSOA 4EV0A 2TDXA 4WXDA 3LA7A 4L18B 3V7RA 1Z91A 2XASA 1ZGJA 2NAZA 1I1GA 4H0EA 1BIAA 1U6GA 2FOKA 2Q8KA 1MKMA 3K1PA 5HS9A 4EVIA 3N97A 3GEZA 3O2PE 4KT5C 1EH7A 1KQ8A 2GAUA 1B1BA 5F64A 3JAMZ 5D5WB 1T38A 4AWXB 2L3DA 4WXCA 4UUVA 1PDNC 4HQMA 1RNLA 2OA4A 3GUDA 3E6CC 4RB0A 2ISZA 1MGTA 3WGIA 3RDIA 1U5TB 1ZAOA 2FMLA 4F7ZA 2VBXA 3TOAA 3GZ6A 2HKXA 5A2QK 5D5UB 3QOPA 1IXCA 1ZARA 4LK1F 2STWA 1MJ9A 5D6FA 4ON0A 2NNYA 3HSEA 1GXPA 1JGSA 2ESHA 2VT2A 2P8TA 1SD7A 2HEOA 4R1HA 1HKTA 1SD4A 3J80Z 2IA2A 4KUMA 1O3QA 3CO6C 3WTXC 1FNNA 3MWMA 1BN5A 2Y0MA 2VODA 1HSTA 1PP8F 3GVAA 2ACJA 2QZ8A 4KYWA 1K6OA 4IRHA 4GXOA 2QQBA 3CJNA 2CW0F 4M71A 4IRIA 1U3EM 4P55A 4HQEA 1LJ9A 4OOIA 2D45A 3RJPA 2R7FA 1P92A 4LFUA 4OMZA 2K7LA 3E3VA 2FRHA 4CGZA 5ILVA 3BOQA 3M7GA 5TJJA 4YG2F 5TRDA 1FYMA 2JPBA 1IXRC 2QVOA 2V79A 4LK0F 5FLXK 1QO0D 3I59B 5LEJA 1ONVA 1KU7A 1XGOA 2ZNZA 4Y15A 4BHCA 4G7OF 1FYKA 2NYXA 2MH9A 3I64A 1R36A 2Q0OA 1OR7A 2RV8A 4EJOA 1IAWA 4LMYA 1R00A 3F8MA 3MQ0A 1EH6A 4LG0A 4XLNF 2W24A 3JTHA 2D2WA 1ZLKA 2XHKA 1TLHB 1LDKB 2EA2A 2VBWA 5HDGA 1S6LA 3QP6A 5DCMA 5HLHA 5FD5A 4G9YA 4ZZLA 5LRSA 2QBYA 4XLPF 2PLYA 3DQVC 1IRGA 3DFGA 1T6SA 4Q5SF 3IHUA 2Y75A 4HF0A 4BQAA 3U1DA 1HBXG 3WU0A 5HS8A 2H94A 4KFCA 3IKVA 1GXQA 4NHJA 1SMYF 3QU6A 1W7PB 2M5WA 4BXUA 1K78A 1HW5A 3WU1B 4GYGA 3L2CA 1QPMA 4PCQA 1FBSA 1FSEA 5EEGA 3FX3A 1UHWA 2NNNA 4O6JA 1RUOA 4OIPF 5CVJA 3WGHA 4PDKA 1R5HA 3GO5A 3T5XA 3SZTA 3FMQA 2QM3A 2CQKA 5CJ9A 2PJPA 5E8IA 5ICGA 3MZHA 4HDVA 4CZZA 1HW2A 4MTEA 1QNTA 1O3RA 4EM1A 1USTA 2FNPA 2ESNA 1BM9A 2UZKA 2STTA 2YU3A 3HIFA 5CLSA 4EJVA 1OYYA 1FBQA 2IA0A 2H27A 4KIGA 2DO7A 2L4MA 1YIOA 3WTZA 2W85A 2EA4A 5DV5A 5FFZA 2QBYB 2BBYA 5FGMA 2ZJ2A 1FC3A 4XBFA 4IRGA 2GZWA 4PGHA 1V4RA 2WC2A 4UHTA 4M6XA 4I02A 1L3LA 2IPQX 1KQ9A 5J8CA 4NB5A 3ZP5A 4EJTA 2QENA 2IVMA 3E6BA 3K2ZA 2KRFA 1JE8A 3VB2A 2QQ9A 4IJAA 2EFNA 1K78B 1TQPA 2W57A 3JW4A 1B6AA 4BAYA 2FNAA 2P5KA 5CVIA 4RB1A 2VONA 1RZ4A 2HR3A 2ETHA 1S7AA 2DW4A 4G8XA 1CF7A 1YW9A 3I5UA 3MAJA 2E1CA 3ABUA 1LEBA 1DP7P 4HX4A 2Z33A 3K0LA 5CVRA 2ISYA 4WK8F 1I6XA 4A6DA 4HAMA 1F9NA 3GW2A 3TO7A 2EV0A 1K7AA 1LDJA 4G6QA 4YFXF 3HSRA 5BMZA 3FM5A 4AIHA 2OQRA 2DBBA 4LJZF 2EV6A 1HXDA 2CO5A 1B4AA 1J59A 4ZYGA 1SD5A 5L3FA 1ON1A 4HOBA 4CXFA 3T1BA 5E8GA 2DQLA 4RAZA 3S2WA 3SFZA 1U78A 4WWCA 1IUYA 1IN8A 2FBHA 1LDDA 1J75A 3NQOA 4KMFA 4YIIA 4G6DA 2HQRA 2H6BA 5H6RA 2X4HA 3F21A 4GCVA 3WTUC 4DQ2A 1HQCA 3L9FA 4U88A 5DEQA 5LGUA 1O3TA 3GYHX 1OPCA 4Y17A 2HOEA 3H3UA 4YIFA 3EUHA 3E97A 3IRQA 1YG2A 5JR3A 4UVBA 1OKRA 4IPAA 3CUQC 3HRUA 5HOOA 4UV8A 1R7JA 2LF8A 2FBIA 1ZREA 4A0XA 3I71A 1G3WA 1XN7A 4L0ZB 3C1DA 1CF7B 2VN2A 3I53A 4WX9A 4D0PA 2A5YB 3R61A 1T39A 1UHMA 4LLNA 4HYEA 2YX7A 2EB7A 2P5LC 3DKWA 3HUGA 2HS5A 3K1MA 4Q47A 3KCCA 1SFXA 2KIUA 1MJAA 3KEQA 4EJUA 5DUKA 5L3CA 3GFLA 1BC7C 2ZBKA 4YFKF 1IW7F 5JI6A 2DK8A 4ESBA 3CTAA 2L01A 2OQGA 2PN6A 2P5VA 3NEUA 3W6JB 3EYIA 4AD9A 5E20A 1Z6RA 1WKMA 3E6DA 5D5VB 3ELKA 2K86A 1REPC 3F6OA 2HDCA 1D3YA 1P2FA 6PAXA 1HKQA 4DNCA 3HOSA 1BI3A 3Q9VA 4Y13A 2ZFWA 5LRRA 2F2EA 2IW5A 1LB2A 2FE3A 4ENJA 1XB4A 1FT9A 2NRAC 2COMA 4O5VA 3HRTA 4HBLA 4PGGA 1F1ZA 1XCVA 1AWCA 1TTYA 3T8TA 5AIPA 4HA8A 1YQAA 3V8LA 4G7ZF 3GFJA 2WWYA 1QBJA 3V7CA 1Z1DA 5AONA 1BBYA 2ADUA 4KMUX 4FX0A 4KNYA 1ZRDA 4A0ZA 3LWFA 2PG4A 2R7DA 3M9AA 2RGVA 1A04A 4XRFA 5K5OA 4A12A 4I7HA 2M1BA 1J2XA 2VOPA 4M74A 2XKPA 2MH2A 1HKSA 1R5GA 3O6BB 4R8HA 3IKTA 4OIQF 4LB5A 1STZA 4ZYDA 5BOXA 3WE3A 1F4KA 2O3FA 4ASNA 5F1RA 3OV8A 1ODDA 4PZJA 2CFXA 2MBFA 1J9IA 1R23A 5BPDA 3J7AO 2V6CA 3CLOA 3KLNA 2ZXJA 2PFBA 3LQQA 4U0VA 1USSA 3L09A 5DCFA 3RPUA 4LB6B 5K5QA 2DQRA 3F6VA 3MFKA 4JK1X 3QPHA 3IL2A 1RI7A 4MEYF 1ZLJA 1S8NA 2RC4A 3PQJA 2LDUA 1Q1HA 5JHUA 1H9GA 3P9IA 3K9TA 5H6QA 2QWWA 3KP7A 3ABTA 3F8NA 2O61A 4LGWA 1XSDA 2PMHA 5KVRA 2L02A 3VOEA 2IRFG 2GWRA 3U2RA 1TNSA 2VC0A 4XSZF 3CDHA 3JAMK 4JQFA 3BROA 3KZYA 3K1NA 2GXGA 1MDMA 5J8FA 2R3SA 3VFZA 4IF4A 2A6HF 3COAC 2M45A 3I4PA 2Q2EA 3H92A 3KFWX 1KGSA 1BI0A 3HOTA 2KIMA 2ZKZA 4M6YA 2RVCA 4HF2A 3LFKA 1F5TA 4OIOF 5BPIA 3BJ6A 4CICA 1FOKA 3HRSA 1ZHFA 4I2OA 2RKHA 3KP4A 2MC3A 1RUNA 3QU3A 5LEKA 1BJAA 3VEPA 3BP8A 3W6KB 2IA1A 4A2UA 4B09A 3V8JA 3CO7C 2EK5A 4MQ9F 2ZO4A 3DPLC 2EV5A 1FY7A 4AVPA 1C0WA 3Q9SA 2WTEA 3U9GA 3J80K 4XSXF 1QZZA 5LLQA 1O57A 4HLYA 3F22A 2AS5F 2PMUA 5E17F 4A5MA 1MD0A 3I54A 1O7FA 3WTTC 2XUBA 4U7DA 2OZUA 1EH8A 3SQNA 4E70A 3NRVA 5L3GA 3KETA 2AXLA 1B59A 2OD5A 5BS6A 4MNUA 2M30A 2CWEA 3HHGA 3KE2A 2XROA 2K4BA 3J81Z 4UV9A 5HDNA 2FSWA 3KEOA 1W5SA 3TKYA 2W84A 2DPUA 1G3TA 4L9JA 1PP7U 3GF2A 4KICA 3T0YA 5K1YA 1DPUA 2JSCA 4L0YB 3BJOA 5CYVA 1CGPA 1HSJA 4LG0B 3DV8A 1G6NA 4CDGA 2GXBA 3FM3A 2HTJA 3LSTA 3F23A 1XMKA 3GZ5A 4N9IA 1U5TC 4GO1A 4M9XA 2F5CA 2RDPA 3F8CA 4P96A 3JTGA 5HS7A 3FF5A 4FT8A 1FP2A 1YO5C 4HF1A 2M8EA 5DCMB 3TO9A 2WV0A 2DLLA 2FBKA 2K02A 1OYIA 3ZQ7A 2RQPA 3RYRA 1FZPB 2QYOA 1KYWA 1J0RA 4AIJA 1IN6A 3BJAA 3IWZA 3FWEA 2UXNA 5ERIA 2MLKA 1VTNC 3EQLF 2YSRA 3ZMVA 5D4SA 4RGSA 3TDUC 5BQTA 3HRMA 3JSPA 3GFMA 2P6SA 3L00A 2RN7A 2B0LA 4YFNF 4I01A 5LHGA 1SAXA 3SXYA 3L7WA 2DK5A 2HTSA 2FEZA 5AIQA 1I27A 3SHFA 1XD7A 1FBUA 2EFWA 2G7UA 3ZMDA 4O3MA 5EEHA 5D4RA 3ROUA 1TQIA 3RI4A 1ULYA 4A6EA 2DPDA 3HTUA 3B73A 3G73A 2LF7A 1PUEE 2FQ3A 3ZN0A 4ZYEA 5DUIA 2A3SA 2C6YA 2QQAA 5D8LB 2O6GE 4EMSA 4BNCA 2HQNA 4G7HF 1H0MA 4I0AA 3TGNA 1S7OA 2YPRA 4WXHA 1LEAA 1E2XA 2XAJA 2DAOA 1UB9A 3B02A 1KU9A 3HTSB 2CSOA 1D5VA 2RNJA 1G3SA 4I09A 4B8XA 4RB2C 5LHHA 2DU9A 3IRRA 4N9HA 1NHAA 1DPRA 4HX7A 4EGZA 1P4WA 4ENMA 1P6RA 1I5ZA 3AAFA 3BWGA 1WRJA 3ISPA 4EQQA 3ZPLA 2A61A 2MD5A 3RPQA 1X3UA 3BDDA 2ELHA 3WTVC 1HW1A 5L3DA 3EETA 2XGXA 2DT5A 4L9NA 2YR2A 1XSXA 2V1DA 2XKOA 5A2QZ 3I0TA 3V7SA 1WQ2A 2HYFA 4MHGA 1ZG1A 4IXAA 3WTSC 2V1XA 4A0YA 2Z9OA 1AOYA 2FMYA 1U5TA 4BHBA 4HW0A 1T2KA 2NS0A 3M1EA 5E1ZB 3E5QA 3V4GA 3GX4X 3HHHA 4CHUA 4UVAA 1TW2A 2BGCA 1SFEA 2YX4A 1O7LA 5DD4A 1IXSB 3E5XA 4LLGF 1FP1D 2XAGA 3WODF 5IT9K 1FYLA 5LGNA 1KU2A 3ML6A 4BH9A 2QLZA 1W7PD 3GFIA 2FXAA 2IP2A 3PQKA 2GA1A 4S04A 1QGPA 3LAPA 3QP5A 1K79A 1YS6A 3K69A 1R58A 2ZCWA 3D0SA 2CYYA 3FMSA 2FF4A 2J5OA 2XIGA 1E17A 4GYIA 1WWXA 5ILSA 1BIBA 1FLIA 5K5RA 1T98A 1R22A 2BEOA 1XSVA 3T8RA 4N0BA 4RGUA 4QLCU 1G4DA 4MTDA 5HLIA 2G9WA 4UVCA 5F6FA 3ZMTA 1B9MA 5ILUA 1KA8A 2M87A 3O3KA 5FLXZ 3RKXA 4M72A 2GQQA 3R60A 1LNWA 4LD5A 2DTRA 2XAFA 1IZ1A 2GA2A 2MA3A 2ZNYA 2F5EA 2VXZA 5D8KB 3LA3A 2P4WA 3WTYC 1U2WA 3I58A 4L9VA 4P9FA 2P7CB 2XAQA 1BI2A 2K27A 3EYYA 3HSFA 3I59A 5JFRA 5DYMA 3ZN1A 3ECOA 2OU2A 4EM0B 2E7WA 4TV7A 4K2EA 1XDSA 1BC8C 2Z5UA 3DXJF 5ICEA 3TO6A 4BYYA 1SD6A 2JZYA 2VE9A 4CYDA 4EJWA 2L4AA 2K4JA 1OMIA 1I1SA 3KP2A 3TDZC 5E1WA 4ENNA 1SFUA 1UFMA 5E1XA 1GHCA 2V1UA 3R6SA 1D8JA 1OYWA 3CUQA 1JHHA 3QRFF 3V8KA 2EFQA 1XGSA 3WTWC 4S05A 1SMTA 4LLLA 1XDUA 1J5YA 4M9ZA 2PI0A 2FU4A 2H09A 3DPTA 3EDPA 4Q48A 1KU3A 3QAHA 5DD8A 1W7PA 4P5OA 4A5NA 2VBYA 1H9TA 2OAZA 5IT3A 4MQVA 2BE5F 2DI3A 3HYIA 4ZYHA 3F8FA 3LAJA 1S3JA 3FXRA 3KP3A 1YS7A 4HDUA 3JSOA 5DDGA 4KN4X 2L54A 2O8XA 2XVCA 2OBPA 2XV4S 4ZH4F 1P4AA 3CUOA 4FX4A 3N4MA 2HKOA 1BI1A 5HDKA 4HLXA 4WCGA 4ENKA 2VT3A 2PEXA 1LVAA 3D5LA 2DFIA 4IHTA 5ED4A 1TNTA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1QZY A;  3BZ6 A;  4I98 B;  1R1T A;  3F72 A;  1XGN A;  3CUQ B;  2LKP A;  4HV5 A;  3RYP A;  4HZF A;  1JHF A;  1ZYR F;  1ZRC A;  2PQ8 A;  2A6E F;  4NQW A;  1W5T A;  3C18 A;  3PFI A;  2KJB A;  3WE2 A;  3BPV A;  4L5J A;  3FXQ A;  3MZY A;  1UCR A;  3P9C A;  5H20 A;  3M8E A;  2OZ6 A;  4IHS A;  1FX7 A;  4KA4 A;  4FHT A;  2Y48 A;  5KK1 A;  2KIF A;  3C7J A;  3ECH A;  1Z6T A;  3KZZ A;  5HLG A;  3BPX A;  4ETS A;  3ZMU A;  2PBI A;  5L3B A;  1O3S A;  1WSU A;  2HFH A;  4HV6 A;  1MDM B;  3KP5 A;  4Z2Y A;  3FXU A;  1Z9C A;  3GWZ A;  2H6C A;  4JBA A;  3Q5F A;  3R4K A;  4RGR A;  3RIR A;  4WF2 A;  3ZMZ A;  1ZRF A;  3TQN A;  1FSH A;  2HGC A;  1YW7 A;  4EM2 A;  4BHP A;  2CGP A;  2A69 F;  2VC1 A;  2P7V B;  2JPC A;  1D8K A;  2E7X A;  3MCZ A;  4OIR F;  2V9V A;  3R0A A;  3P7N A;  5ICC A;  2XAH A;  4I0B A;  1TW3 A;  3GXO A;  1U8R A;  4L9T A;  1YLF A;  1TQM A;  3P9K A;  2Z3Y A;  1FWZ A;  2G7H A;  1DUX C;  3E6M A;  4ESJ A;  1XGM A;  2F5D A;  3TOB A;  4MGR A;  3OOP A;  4CO8 A;  1XCB A;  3FMR A;  1V3F A;  1G3Y A;  3KLO A;  3M8F A;  1YTY A;  4KDP A;  3RTR A;  2JT1 A;  3ULQ B;  1ZH5 A;  1R1V A;  1ZG3 A;  2P6T A;  1YW8 A;  3F8B A;  4KIB A;  5ICF A;  1B9N A;  1KQ0 A;  2EFP A;  5LHI A;  2UXX A;  1ZN2 A;  1KYZ A;  2JTV A;  4P9U A;  3BY6 A;  3DF8 A;  1GVJ A;  4KIF A;  2HYG D;  1W4M A;  3DP7 A;  2ZME A;  5LGT A;  4HX8 A;  1ZGA A;  1JXS A;  5CVV A;  2IT0 A;  1IN4 A;  5HVQ C;  1LQ1 A;  4L5I A;  2J5P A;  1ZG5 A;  5IT9 Z;  4RGX A;  3J81 K;  2BYV E;  1BOA A;  2BV6 A;  2KKO A;  2A68 F;  5JVT A;  3VOD A;  4M73 A;  1XMA A;  5LBQ A;  3GLX A;  2F5F A;  2GIV A;  3SZP A;  1YFH A;  4OIN F;  4AIK A;  5FFX A;  3QPT A;  2E1N A;  4U7B A;  3E5U A;  1IN5 A;  3WGG A;  2O03 A;  5CVU A;  2VOO A;  2EFO A;  3MEX A;  3ZMS A;  5D6E A;  4U0W A;  3REO A;  1TBX A;  3WG9 A;  4Q4Z F;  1Y0U A;  2D1H A;  3DEU A;  3ERE D;  1MJB A;  2CG4 A;  2LNB A;  3KP6 A;  4ESF A;  1T0F A;  2EJR A;  2HZT A;  4KN7 X;  4MEX F;  3LQR A;  4RS8 A;  2KJC A;  2EWN A;  3IWF A;  5E18 F;  3LA2 A;  5L3E A;  1RIO H;  2JRT A;  4OU0 A;  3F3X A;  2XRN A;  4QWQ A;  4EGY A;  2W25 A;  3IC7 A;  1WI9 A;  4R79 A;  4RB3 C;  2FA5 A;  3R0J A;  4IVN A;  1Z05 A;  1S29 A;  2X0L A;  2IJL A;  4UXN A;  5J6X A;  1J7K A;  2QUF A;  3FZV A;  1IRF A;  2D1V A;  3G3Z A;  1P4X A;  2ZME B;  1R1U A;  4RAY A;  4UNO A;  3RKY A;  2A07 F;  1MZB A;  1L0O C;  4U0Y A;  5D5X B;  1IN7 A;  5FO5 A;  1QQI A;  5FD6 A;  1EV7 A;  2HWV A;  5FB2 A;  1Z7U A;  4M9S A;  1ON2 A;  2UWM A;  3C3W A;  3RKW A;  1IF1 A;  4OMY A;  4G94 A;  2VE8 A;  4GGG A;  3FHZ A;  1DDN A;  4ZZD A;  2MLG A;  2VBZ A;  3H3Z A;  2O0Y A;  2Z99 A;  1FPQ A;  1YYV A;  2LSO A;  4EV0 A;  2TDX A;  4WXD A;  3LA7 A;  4L18 B;  3V7R A;  1Z91 A;  2XAS A;  1ZGJ A;  2NAZ A;  1I1G A;  4H0E A;  1BIA A;  1U6G A;  2FOK A;  2Q8K A;  1MKM A;  3K1P A;  5HS9 A;  4EVI A;  3N97 A;  3GEZ A;  3O2P E;  4KT5 C;  1EH7 A;  1KQ8 A;  2GAU A;  1B1B A;  5F64 A;  3JAM Z;  5D5W B;  1T38 A;  4AWX B;  2L3D A;  4WXC A;  4UUV A;  1PDN C;  4HQM A;  1RNL A;  2OA4 A;  3GUD A;  3E6C C;  4RB0 A;  2ISZ A;  1MGT A;  3WGI A;  3RDI A;  1U5T B;  1ZAO A;  2FML A;  4F7Z A;  2VBX A;  3TOA A;  3GZ6 A;  2HKX A;  5A2Q K;  5D5U B;  3QOP A;  1IXC A;  1ZAR A;  4LK1 F;  2STW A;  1MJ9 A;  5D6F A;  4ON0 A;  2NNY A;  3HSE A;  1GXP A;  1JGS A;  2ESH A;  2VT2 A;  2P8T A;  1SD7 A;  2HEO A;  4R1H A;  1HKT A;  1SD4 A;  3J80 Z;  2IA2 A;  4KUM A;  1O3Q A;  3CO6 C;  3WTX C;  1FNN A;  3MWM A;  1BN5 A;  2Y0M A;  2VOD A;  1HST A;  1PP8 F;  3GVA A;  2ACJ A;  2QZ8 A;  4KYW A;  1K6O A;  4IRH A;  4GXO A;  2QQB A;  3CJN A;  2CW0 F;  4M71 A;  4IRI A;  1U3E M;  4P55 A;  4HQE A;  1LJ9 A;  4OOI A;  2D45 A;  3RJP A;  2R7F A;  1P92 A;  4LFU A;  4OMZ A;  2K7L A;  3E3V A;  2FRH A;  4CGZ A;  5ILV A;  3BOQ A;  3M7G A;  5TJJ A;  4YG2 F;  5TRD A;  1FYM A;  2JPB A;  1IXR C;  2QVO A;  2V79 A;  4LK0 F;  5FLX K;  1QO0 D;  3I59 B;  5LEJ A;  1ONV A;  1KU7 A;  1XGO A;  2ZNZ A;  4Y15 A;  4BHC A;  4G7O F;  1FYK A;  2NYX A;  2MH9 A;  3I64 A;  1R36 A;  2Q0O A;  1OR7 A;  2RV8 A;  4EJO A;  1IAW A;  4LMY A;  1R00 A;  3F8M A;  3MQ0 A;  1EH6 A;  4LG0 A;  4XLN F;  2W24 A;  3JTH A;  2D2W A;  1ZLK A;  2XHK A;  1TLH B;  1LDK B;  2EA2 A;  2VBW A;  5HDG A;  1S6L A;  3QP6 A;  5DCM A;  5HLH A;  5FD5 A;  4G9Y A;  4ZZL A;  5LRS A;  2QBY A;  4XLP F;  2PLY A;  3DQV C;  1IRG A;  3DFG A;  1T6S A;  4Q5S F;  3IHU A;  2Y75 A;  4HF0 A;  4BQA A;  3U1D A;  1HBX G;  3WU0 A;  5HS8 A;  2H94 A;  4KFC A;  3IKV A;  1GXQ A;  4NHJ A;  1SMY F;  3QU6 A;  1W7P B;  2M5W A;  4BXU A;  1K78 A;  1HW5 A;  3WU1 B;  4GYG A;  3L2C A;  1QPM A;  4PCQ A;  1FBS A;  1FSE A;  5EEG A;  3FX3 A;  1UHW A;  2NNN A;  4O6J A;  1RUO A;  4OIP F;  5CVJ A;  3WGH A;  4PDK A;  1R5H A;  3GO5 A;  3T5X A;  3SZT A;  3FMQ A;  2QM3 A;  2CQK A;  5CJ9 A;  2PJP A;  5E8I A;  5ICG A;  3MZH A;  4HDV A;  4CZZ A;  1HW2 A;  4MTE A;  1QNT A;  1O3R A;  4EM1 A;  1UST A;  2FNP A;  2ESN A;  1BM9 A;  2UZK A;  2STT A;  2YU3 A;  3HIF A;  5CLS A;  4EJV A;  1OYY A;  1FBQ A;  2IA0 A;  2H27 A;  4KIG A;  2DO7 A;  2L4M A;  1YIO A;  3WTZ A;  2W85 A;  2EA4 A;  5DV5 A;  5FFZ A;  2QBY B;  2BBY A;  5FGM A;  2ZJ2 A;  1FC3 A;  4XBF A;  4IRG A;  2GZW A;  4PGH A;  1V4R A;  2WC2 A;  4UHT A;  4M6X A;  4I02 A;  1L3L A;  2IPQ X;  1KQ9 A;  5J8C A;  4NB5 A;  3ZP5 A;  4EJT A;  2QEN A;  2IVM A;  3E6B A;  3K2Z A;  2KRF A;  1JE8 A;  3VB2 A;  2QQ9 A;  4IJA A;  2EFN A;  1K78 B;  1TQP A;  2W57 A;  3JW4 A;  1B6A A;  4BAY A;  2FNA A;  2P5K A;  5CVI A;  4RB1 A;  2VON A;  1RZ4 A;  2HR3 A;  2ETH A;  1S7A A;  2DW4 A;  4G8X A;  1CF7 A;  1YW9 A;  3I5U A;  3MAJ A;  2E1C A;  3ABU A;  1LEB A;  1DP7 P;  4HX4 A;  2Z33 A;  3K0L A;  5CVR A;  2ISY A;  4WK8 F;  1I6X A;  4A6D A;  4HAM A;  1F9N A;  3GW2 A;  3TO7 A;  2EV0 A;  1K7A A;  1LDJ A;  4G6Q A;  4YFX F;  3HSR A;  5BMZ A;  3FM5 A;  4AIH A;  2OQR A;  2DBB A;  4LJZ F;  2EV6 A;  1HXD A;  2CO5 A;  1B4A A;  1J59 A;  4ZYG A;  1SD5 A;  5L3F A;  1ON1 A;  4HOB A;  4CXF A;  3T1B A;  5E8G A;  2DQL A;  4RAZ A;  3S2W A;  3SFZ A;  1U78 A;  4WWC A;  1IUY A;  1IN8 A;  2FBH A;  1LDD A;  1J75 A;  3NQO A;  4KMF A;  4YII A;  4G6D A;  2HQR A;  2H6B A;  5H6R A;  2X4H A;  3F21 A;  4GCV A;  3WTU C;  4DQ2 A;  1HQC A;  3L9F A;  4U88 A;  5DEQ A;  5LGU A;  1O3T A;  3GYH X;  1OPC A;  4Y17 A;  2HOE A;  3H3U A;  4YIF A;  3EUH A;  3E97 A;  3IRQ A;  1YG2 A;  5JR3 A;  4UVB A;  1OKR A;  4IPA A;  3CUQ C;  3HRU A;  5HOO A;  4UV8 A;  1R7J A;  2LF8 A;  2FBI A;  1ZRE A;  4A0X A;  3I71 A;  1G3W A;  1XN7 A;  4L0Z B;  3C1D A;  1CF7 B;  2VN2 A;  3I53 A;  4WX9 A;  4D0P A;  2A5Y B;  3R61 A;  1T39 A;  1UHM A;  4LLN A;  4HYE A;  2YX7 A;  2EB7 A;  2P5L C;  3DKW A;  3HUG A;  2HS5 A;  3K1M A;  4Q47 A;  3KCC A;  1SFX A;  2KIU A;  1MJA A;  3KEQ A;  4EJU A;  5DUK A;  5L3C A;  3GFL A;  1BC7 C;  2ZBK A;  4YFK F;  1IW7 F;  5JI6 A;  2DK8 A;  4ESB A;  3CTA A;  2L01 A;  2OQG A;  2PN6 A;  2P5V A;  3NEU A;  3W6J B;  3EYI A;  4AD9 A;  5E20 A;  1Z6R A;  1WKM A;  3E6D A;  5D5V B;  3ELK A;  2K86 A;  1REP C;  3F6O A;  2HDC A;  1D3Y A;  1P2F A;  6PAX A;  1HKQ A;  4DNC A;  3HOS A;  1BI3 A;  3Q9V A;  4Y13 A;  2ZFW A;  5LRR A;  2F2E A;  2IW5 A;  1LB2 A;  2FE3 A;  4ENJ A;  1XB4 A;  1FT9 A;  2NRA C;  2COM A;  4O5V A;  3HRT A;  4HBL A;  4PGG A;  1F1Z A;  1XCV A;  1AWC A;  1TTY A;  3T8T A;  5AIP A;  4HA8 A;  1YQA A;  3V8L A;  4G7Z F;  3GFJ A;  2WWY A;  1QBJ A;  3V7C A;  1Z1D A;  5AON A;  1BBY A;  2ADU A;  4KMU X;  4FX0 A;  4KNY A;  1ZRD A;  4A0Z A;  3LWF A;  2PG4 A;  2R7D A;  3M9A A;  2RGV A;  1A04 A;  4XRF A;  5K5O A;  4A12 A;  4I7H A;  2M1B A;  1J2X A;  2VOP A;  4M74 A;  2XKP A;  2MH2 A;  1HKS A;  1R5G A;  3O6B B;  4R8H A;  3IKT A;  4OIQ F;  4LB5 A;  1STZ A;  4ZYD A;  5BOX A;  3WE3 A;  1F4K A;  2O3F A;  4ASN A;  5F1R A;  3OV8 A;  1ODD A;  4PZJ A;  2CFX A;  2MBF A;  1J9I A;  1R23 A;  5BPD A;  3J7A O;  2V6C A;  3CLO A;  3KLN A;  2ZXJ A;  2PFB A;  3LQQ A;  4U0V A;  1USS A;  3L09 A;  5DCF A;  3RPU A;  4LB6 B;  5K5Q A;  2DQR A;  3F6V A;  3MFK A;  4JK1 X;  3QPH A;  3IL2 A;  1RI7 A;  4MEY F;  1ZLJ A;  1S8N A;  2RC4 A;  3PQJ A;  2LDU A;  1Q1H A;  5JHU A;  1H9G A;  3P9I A;  3K9T A;  5H6Q A;  2QWW A;  3KP7 A;  3ABT A;  3F8N A;  2O61 A;  4LGW A;  1XSD A;  2PMH A;  5KVR A;  2L02 A;  3VOE A;  2IRF G;  2GWR A;  3U2R A;  1TNS A;  2VC0 A;  4XSZ F;  3CDH A;  3JAM K;  4JQF A;  3BRO A;  3KZY A;  3K1N A;  2GXG A;  1MDM A;  5J8F A;  2R3S A;  3VFZ A;  4IF4 A;  2A6H F;  3COA C;  2M45 A;  3I4P A;  2Q2E A;  3H92 A;  3KFW X;  1KGS A;  1BI0 A;  3HOT A;  2KIM A;  2ZKZ A;  4M6Y A;  2RVC A;  4HF2 A;  3LFK A;  1F5T A;  4OIO F;  5BPI A;  3BJ6 A;  4CIC A;  1FOK A;  3HRS A;  1ZHF A;  4I2O A;  2RKH A;  3KP4 A;  2MC3 A;  1RUN A;  3QU3 A;  5LEK A;  1BJA A;  3VEP A;  3BP8 A;  3W6K B;  2IA1 A;  4A2U A;  4B09 A;  3V8J A;  3CO7 C;  2EK5 A;  4MQ9 F;  2ZO4 A;  3DPL C;  2EV5 A;  1FY7 A;  4AVP A;  1C0W A;  3Q9S A;  2WTE A;  3U9G A;  3J80 K;  4XSX F;  1QZZ A;  5LLQ A;  1O57 A;  4HLY A;  3F22 A;  2AS5 F;  2PMU A;  5E17 F;  4A5M A;  1MD0 A;  3I54 A;  1O7F A;  3WTT C;  2XUB A;  4U7D A;  2OZU A;  1EH8 A;  3SQN A;  4E70 A;  3NRV A;  5L3G A;  3KET A;  2AXL A;  1B59 A;  2OD5 A;  5BS6 A;  4MNU A;  2M30 A;  2CWE A;  3HHG A;  3KE2 A;  2XRO A;  2K4B A;  3J81 Z;  4UV9 A;  5HDN A;  2FSW A;  3KEO A;  1W5S A;  3TKY A;  2W84 A;  2DPU A;  1G3T A;  4L9J A;  1PP7 U;  3GF2 A;  4KIC A;  3T0Y A;  5K1Y A;  1DPU A;  2JSC A;  4L0Y B;  3BJO A;  5CYV A;  1CGP A;  1HSJ A;  4LG0 B;  3DV8 A;  1G6N A;  4CDG A;  2GXB A;  3FM3 A;  2HTJ A;  3LST A;  3F23 A;  1XMK A;  3GZ5 A;  4N9I A;  1U5T C;  4GO1 A;  4M9X A;  2F5C A;  2RDP A;  3F8C A;  4P96 A;  3JTG A;  5HS7 A;  3FF5 A;  4FT8 A;  1FP2 A;  1YO5 C;  4HF1 A;  2M8E A;  5DCM B;  3TO9 A;  2WV0 A;  2DLL A;  2FBK A;  2K02 A;  1OYI A;  3ZQ7 A;  2RQP A;  3RYR A;  1FZP B;  2QYO A;  1KYW A;  1J0R A;  4AIJ A;  1IN6 A;  3BJA A;  3IWZ A;  3FWE A;  2UXN A;  5ERI A;  2MLK A;  1VTN C;  3EQL F;  2YSR A;  3ZMV A;  5D4S A;  4RGS A;  3TDU C;  5BQT A;  3HRM A;  3JSP A;  3GFM A;  2P6S A;  3L00 A;  2RN7 A;  2B0L A;  4YFN F;  4I01 A;  5LHG A;  1SAX A;  3SXY A;  3L7W A;  2DK5 A;  2HTS A;  2FEZ A;  5AIQ A;  1I27 A;  3SHF A;  1XD7 A;  1FBU A;  2EFW A;  2G7U A;  3ZMD A;  4O3M A;  5EEH A;  5D4R A;  3ROU A;  1TQI A;  3RI4 A;  1ULY A;  4A6E A;  2DPD A;  3HTU A;  3B73 A;  3G73 A;  2LF7 A;  1PUE E;  2FQ3 A;  3ZN0 A;  4ZYE A;  5DUI A;  2A3S A;  2C6Y A;  2QQA A;  5D8L B;  2O6G E;  4EMS A;  4BNC A;  2HQN A;  4G7H F;  1H0M A;  4I0A A;  3TGN A;  1S7O A;  2YPR A;  4WXH A;  1LEA A;  1E2X A;  2XAJ A;  2DAO A;  1UB9 A;  3B02 A;  1KU9 A;  3HTS B;  2CSO A;  1D5V A;  2RNJ A;  1G3S A;  4I09 A;  4B8X A;  4RB2 C;  5LHH A;  2DU9 A;  3IRR A;  4N9H A;  1NHA A;  1DPR A;  4HX7 A;  4EGZ A;  1P4W A;  4ENM A;  1P6R A;  1I5Z A;  3AAF A;  3BWG A;  1WRJ A;  3ISP A;  4EQQ A;  3ZPL A;  2A61 A;  2MD5 A;  3RPQ A;  1X3U A;  3BDD A;  2ELH A;  3WTV C;  1HW1 A;  5L3D A;  3EET A;  2XGX A;  2DT5 A;  4L9N A;  2YR2 A;  1XSX A;  2V1D A;  2XKO A;  5A2Q Z;  3I0T A;  3V7S A;  1WQ2 A;  2HYF A;  4MHG A;  1ZG1 A;  4IXA A;  3WTS C;  2V1X A;  4A0Y A;  2Z9O A;  1AOY A;  2FMY A;  1U5T A;  4BHB A;  4HW0 A;  1T2K A;  2NS0 A;  3M1E A;  5E1Z B;  3E5Q A;  3V4G A;  3GX4 X;  3HHH A;  4CHU A;  4UVA A;  1TW2 A;  2BGC A;  1SFE A;  2YX4 A;  1O7L A;  5DD4 A;  1IXS B;  3E5X A;  4LLG F;  1FP1 D;  2XAG A;  3WOD F;  5IT9 K;  1FYL A;  5LGN A;  1KU2 A;  3ML6 A;  4BH9 A;  2QLZ A;  1W7P D;  3GFI A;  2FXA A;  2IP2 A;  3PQK A;  2GA1 A;  4S04 A;  1QGP A;  3LAP A;  3QP5 A;  1K79 A;  1YS6 A;  3K69 A;  1R58 A;  2ZCW A;  3D0S A;  2CYY A;  3FMS A;  2FF4 A;  2J5O A;  2XIG A;  1E17 A;  4GYI A;  1WWX A;  5ILS A;  1BIB A;  1FLI A;  5K5R A;  1T98 A;  1R22 A;  2BEO A;  1XSV A;  3T8R A;  4N0B A;  4RGU A;  4QLC U;  1G4D A;  4MTD A;  5HLI A;  2G9W A;  4UVC A;  5F6F A;  3ZMT A;  1B9M A;  5ILU A;  1KA8 A;  2M87 A;  3O3K A;  5FLX Z;  3RKX A;  4M72 A;  2GQQ A;  3R60 A;  1LNW A;  4LD5 A;  2DTR A;  2XAF A;  1IZ1 A;  2GA2 A;  2MA3 A;  2ZNY A;  2F5E A;  2VXZ A;  5D8K B;  3LA3 A;  2P4W A;  3WTY C;  1U2W A;  3I58 A;  4L9V A;  4P9F A;  2P7C B;  2XAQ A;  1BI2 A;  2K27 A;  3EYY A;  3HSF A;  3I59 A;  5JFR A;  5DYM A;  3ZN1 A;  3ECO A;  2OU2 A;  4EM0 B;  2E7W A;  4TV7 A;  4K2E A;  1XDS A;  1BC8 C;  2Z5U A;  3DXJ F;  5ICE A;  3TO6 A;  4BYY A;  1SD6 A;  2JZY A;  2VE9 A;  4CYD A;  4EJW A;  2L4A A;  2K4J A;  1OMI A;  1I1S A;  3KP2 A;  3TDZ C;  5E1W A;  4ENN A;  1SFU A;  1UFM A;  5E1X A;  1GHC A;  2V1U A;  3R6S A;  1D8J A;  1OYW A;  3CUQ A;  1JHH A;  3QRF F;  3V8K A;  2EFQ A;  1XGS A;  3WTW C;  4S05 A;  1SMT A;  4LLL A;  1XDU A;  1J5Y A;  4M9Z A;  2PI0 A;  2FU4 A;  2H09 A;  3DPT A;  3EDP A;  4Q48 A;  1KU3 A;  3QAH A;  5DD8 A;  1W7P A;  4P5O A;  4A5N A;  2VBY A;  1H9T A;  2OAZ A;  5IT3 A;  4MQV A;  2BE5 F;  2DI3 A;  3HYI A;  4ZYH A;  3F8F A;  3LAJ A;  1S3J A;  3FXR A;  3KP3 A;  1YS7 A;  4HDU A;  3JSO A;  5DDG A;  4KN4 X;  2L54 A;  2O8X A;  2XVC A;  2OBP A;  2XV4 S;  4ZH4 F;  1P4A A;  3CUO A;  4FX4 A;  3N4M A;  2HKO A;  1BI1 A;  5HDK A;  4HLX A;  4WCG A;  4ENK A;  2VT3 A;  2PEX A;  1LVA A;  3D5L A;  2DFI A;  4IHT A;  5ED4 A;  1TNT A; 
#chains in the Genus database with same CATH topology
 2ZJQ F;  1QZY A;  3BZ6 A;  3OYN A;  2E71 A;  4CSW A;  4ZYA A;  3GLL A;  4I98 B;  2VJI A;  1R1T A;  1GDT A;  3AL0 B;  3F72 A;  1XGN A;  3CUQ B;  3OY9 A;  2LKP A;  3MKZ A;  4HV5 A;  3RYP A;  4H4K C;  2JA7 J;  4HZF A;  5M3F J;  1JHF A;  1ZYR F;  1ZRC A;  2ZFU A;  2PQ8 A;  2A6E F;  2V4J C;  4NQW A;  1W5T A;  3BG7 A;  3C18 A;  3PFI A;  2KJB A;  3WE2 A;  3BPV A;  2KIQ A;  2XPW A;  5J3L A;  1YJ9 I;  1HF0 A;  2XGE A;  3EUA A;  4E7S A;  2R92 J;  4L5J A;  1FIA A;  3FXQ A;  3MZY A;  1Z7L A;  1UCR A;  1QRY A;  2Y9Y A;  3P9C A;  3TL4 X;  5H20 A;  2Y0S A;  1B8I A;  5E3N A;  1VQ4 I;  2ICW G;  3M8E A;  4V2G A;  4BE0 A;  2OZ6 A;  5IOZ A;  4B3X A;  3GTP J;  4IHS A;  1FX7 A;  3O8H A;  4KA4 A;  4E7Z A;  4FHT A;  2Y48 A;  1X19 A;  5KK1 A;  2KIF A;  1LE8 A;  1VI0 A;  3DCF A;  3C7J A;  2QSF X;  3H9J A;  3ECH A;  2DDB A;  1Z6T A;  3KZZ A;  5HLG A;  3QPS A;  1VQO I;  4V2F A;  2X6W A;  5FLM J;  3BPX A;  3GTK J;  1DQU A;  2PMZ N;  2XRL A;  4ETS A;  3ZMU A;  4AUX A;  2PBI A;  2VI6 A;  3SZG A;  5L3B A;  5F27 A;  1O3S A;  5HNH A;  1IG7 A;  1WSU A;  2HFH A;  2EIJ H;  2L9N A;  3OYH A;  4A3D J;  4HV6 A;  3SEZ A;  1MDM B;  3KP5 A;  4Z2Y A;  3FXU A;  4IEJ A;  3GWZ A;  2H6C A;  1Z9C A;  4JBA A;  5JLX A;  3Q5F A;  2BVL A;  3R4K A;  4RGR A;  3RIR A;  2X6O A;  4RLF A;  4WF2 A;  2Q2E B;  1I3Q J;  1Z0X A;  3ZMZ A;  5E3L A;  1ZRF A;  3EUH C;  2OTL I;  2NVY J;  1KZH A;  3TQN A;  4B48 A;  1FSH A;  2ZJR F;  2HGC A;  2QKL B;  1GV5 A;  1YW7 A;  2QGU A;  4EM2 A;  2M7B A;  3WHB A;  4BHP A;  2VPR A;  2CGP A;  4FAS D;  1X1P A;  2A69 F;  2VC1 A;  2P7V B;  3ZRG A;  1MMG A;  5GP9 A;  2JPC A;  4J00 A;  1D8K A;  2E7X A;  2XB0 X;  2R7Z J;  3MCZ A;  4OIR F;  1NG6 A;  2V9V A;  2AXT C;  1HDP A;  1BW6 A;  3H9G A;  2ECB A;  3R0A A;  3P7N A;  2ZXI A;  2XAH A;  4I0B A;  5ICC A;  1TW3 A;  5KAI C;  3GXO A;  4CA0 A;  1U8R A;  2ZJP F;  4L9T A;  1YLF A;  1TQM A;  1WCM J;  3BT9 A;  3LSH A;  3P9K A;  1TWH J;  5IPA A;  3PO3 J;  2Q1Z B;  1D1B A;  2NOG A;  1P7J A;  2Z3Y A;  1YRN B;  2VAS A;  1FWZ A;  2G7H A;  3FIS A;  5GAE J;  2CUZ A;  3TMO A;  1DUX C;  3KX2 A;  5CPR B;  3E6M A;  2A6T A;  4ESJ A;  1XGM A;  2DCE A;  2F5D A;  3TOB A;  4AYB A;  5H2F C;  1YJW I;  4MGR A;  4KIS A;  4C2M J;  3OOP A;  4CO8 A;  5FKN A;  1XCB A;  3FMR A;  2K3F A;  1V3F A;  1G3Y A;  3E1S A;  3KLO A;  3M8F A;  2WY8 Q;  1YTY A;  2OJE D;  4XKC A;  2W48 A;  4DBR A;  1R4N B;  4KDP A;  3RTR A;  2JT1 A;  3ULQ B;  2LP0 A;  3S3O A;  1ZH5 A;  3JCU C;  4I99 C;  1R1V A;  2YUS A;  3ZQF A;  4XOR A;  2W7N A;  1ZG3 A;  2JK3 A;  2P6T A;  1YW8 A;  2BOL A;  3F8B A;  2VXD A;  5EYR A;  1BJZ A;  2DFF A;  2CUF A;  2XF5 A;  4KIB A;  1PJR A;  4LIV A;  1YJN I;  5ICF A;  1B9N A;  3UKG A;  4OAY A;  1KQ0 A;  1ZK8 A;  2IGK A;  3DBR B;  2EFP A;  5J1U A;  5LHI A;  2UXX A;  1ZN2 A;  1KYZ A;  2JTV A;  3BY6 A;  3DF8 A;  3HG9 A;  1XTA A;  1GVJ A;  4BQQ A;  4P9U A;  1X1A A;  2YU9 J;  1IRX A;  4BGD A;  4KIF A;  2HYG D;  1W4M A;  2L7Z A;  3DP7 A;  2VQC A;  2ZME A;  5LGT A;  5GPA A;  4HX8 A;  3CDL A;  1ZGA A;  3PJR A;  2HVR A;  1RKW A;  3RQI A;  1JXS A;  4GFB A;  5CVV A;  2IT0 A;  1IN4 A;  5HVQ C;  1LQ1 A;  1HCR A;  3DBL B;  4L5I A;  2J5P A;  1ZG5 A;  1DGW Y;  2YS9 A;  2WAF A;  5EG0 B;  3PIO F;  5IT9 Z;  4RGX A;  1G2H A;  2XB5 A;  3BR5 A;  1SAN A;  3A0B C;  3J81 K;  3K4C A;  4HG2 A;  4CCN A;  5IP6 A;  2BYV E;  5IP7 J;  1IC8 A;  4BAC A;  1BOA A;  4DYQ A;  2BV6 A;  4M3F A;  2KKO A;  2A68 F;  3K4K A;  4C3I J;  2H8W A;  1R6R A;  5JVT A;  2NVQ J;  3VOD A;  3HBL A;  4M73 A;  1XMA A;  1LFB A;  4EAT A;  5LBQ A;  3GLX A;  3CCY A;  2F5F A;  2GIV A;  2AO9 A;  3SZP A;  1LKX A;  1J09 A;  2TRT A;  2VIX A;  5EDN A;  1Z77 A;  3M8J A;  5EF6 A;  1LVK A;  1YFH A;  4OIN F;  4AIK A;  5FFX A;  5CQG A;  3QPT A;  1GV2 A;  2E1N A;  4U7B A;  1X1B A;  3E5U A;  1IN5 A;  1D1A A;  3WGG A;  1XPX A;  2LYC A;  1X3Z B;  2O03 A;  5CVU A;  2VOO A;  2QQ8 A;  2EFO A;  2VJJ A;  3MEX A;  2EIK H;  4E7I A;  3ZMS A;  5D6E A;  4U0W A;  3REO A;  2NOJ B;  1JT6 A;  1TBX A;  4ZDO A;  3BR3 A;  3WG9 A;  4Q4Z F;  1AHD P;  1Y0U A;  2D1H A;  3DEU A;  1K4T A;  3ERE D;  1MJB A;  1W5C C;  2CG4 A;  2VQH A;  4BJ6 C;  5E3O A;  3ZQC A;  3A2K A;  2LNB A;  4IOA F;  2FX0 A;  4Z6Y A;  3KP6 A;  4ESF A;  1T0F A;  3TW7 A;  2EJR A;  2HZT A;  4KN7 X;  2PJR A;  4MEX F;  3LQR A;  4RS8 A;  2KJC A;  3BR1 A;  1VQL I;  2EWN A;  2R5Y A;  4M3E A;  4RBO A;  1X2M A;  3IWF A;  5E18 F;  3LA2 A;  3GTQ J;  3LSG A;  2RAE A;  5L3E A;  3L2V A;  2COB A;  4Y4R A;  2LG4 A;  1RIO H;  3DTE A;  1ETV A;  2JRT A;  3H0G J;  4OU0 A;  1DU0 A;  1E3O C;  4JOM A;  2DMT A;  3F3X A;  2XRN A;  4QWQ A;  4EGY A;  2BHZ A;  2O5R A;  3P5J A;  4I6Z A;  1VQP I;  2W25 A;  1MNE A;  3IC7 A;  1WI9 A;  3B6C A;  4R79 A;  4RB3 C;  3JRI A;  1TWG J;  2FA5 A;  3ERM A;  3VYR B;  1R71 A;  3R0J A;  1MH3 A;  1KON A;  1Z05 A;  4IVN A;  3LSP A;  5M5Y J;  1S29 A;  1OLT A;  2X0L A;  3Q0W A;  2IJL A;  4UXN A;  3LMM A;  5J6X A;  2KZG A;  3ZQL A;  1J7K A;  2QUF A;  3A1Y A;  3FZV A;  2ZC2 A;  1IRF A;  1HDD C;  2D1V A;  3G3Z A;  1P4X A;  2ZME B;  4F52 A;  1R1U A;  4RAY A;  3FKJ A;  4UNO A;  3RKY A;  2A07 F;  3SFI A;  3MN2 A;  1UG0 A;  1S7E A;  4BS9 A;  1MZB A;  1L0O C;  3F0C A;  4HPQ A;  3RPU D;  1AKH A;  1MSF C;  2R0Q C;  1A5J A;  4U0Y A;  2MW8 A;  2CU7 A;  4YRV A;  3AG2 H;  5D5X B;  1IN7 A;  1WJA A;  5FO5 A;  1QQI A;  4KT6 A;  5FD6 A;  1EV7 A;  2HWV A;  4XRM A;  3QYB A;  5FB2 A;  3S1R J;  1Y1V J;  1Z7U A;  4M9S A;  2LTP A;  1ON2 A;  4PJ0 C;  2Y69 H;  2UWM A;  3C3W A;  2B9S A;  3RKW A;  1HA8 A;  2K3P A;  1IF1 A;  4OMY A;  3KYD B;  4G94 A;  2VE8 A;  2QF7 A;  4BEH A;  1F36 A;  5J1R A;  4GGG A;  1XS9 A;  3FHZ A;  4M6V A;  2DTZ A;  2RRE A;  1DDN A;  1BOB A;  4ZZD A;  1VQ5 I;  2MLG A;  2O9L A;  2VBZ A;  3JRH A;  3H3Z A;  2EIM H;  2OF7 A;  1MIJ A;  2LH9 A;  4L5E A;  2O0Y A;  3NWT A;  2Z99 A;  1FPQ A;  1YYV A;  2LSO A;  4EV0 A;  2TDX A;  4ABZ A;  3FXJ A;  4WXD A;  3VYT B;  3W2W A;  2Y30 A;  2W1O A;  1MND A;  3G2B A;  2DT7 B;  3LA7 A;  1JJ8 C;  4L18 B;  3V7R A;  3KYC B;  3OYM A;  1GLN A;  1Z91 A;  2XAS A;  3DEW A;  3OWT A;  1ZGJ A;  2NAZ A;  1IO2 A;  1IDZ A;  2HI3 A;  1I1G A;  4H0E A;  1BIA A;  1JKR C;  3JRG A;  3IH4 A;  2W4S A;  3BCA A;  4UUS B;  1U6G A;  2L0K A;  5KCM A;  1ACI A;  5C44 J;  1IV6 A;  2A05 A;  2R7V A;  2FOK A;  1SVL A;  2Q8K A;  1MKM A;  3U1K A;  2QEX I;  3K1P A;  5HS9 A;  2K9N A;  4EVI A;  3N97 A;  1RRJ A;  3GEZ A;  3W6V A;  5C3E J;  3O2P E;  4KT5 C;  1EH7 A;  2MD0 A;  1H88 C;  5J4Y A;  3C2G A;  1WJD A;  3G1M A;  4QPO A;  1KQ8 A;  1T08 B;  2GAU A;  1B1B A;  2E19 A;  5F64 A;  3JAM Z;  5D5W B;  2GLO A;  2M7A A;  1T38 A;  4AWX B;  2L3D A;  4XLH A;  4WXC A;  4XNF A;  4UUV A;  1PDN C;  1W36 C;  3KZI C;  4HQM A;  1RNL A;  2OA4 A;  3GUD A;  5B5E C;  3E6C C;  4RB0 A;  4C3J J;  4M3D A;  2ISZ A;  3EPZ A;  1MGT A;  1UAA A;  1FMW A;  2R4G A;  2EH3 A;  3WGI A;  3RDI A;  1U5T B;  4G6T B;  1ZAO A;  2KMU A;  2FML A;  4CYC B;  1SVO A;  3ABL H;  4F7Z A;  4E7L A;  2VBX A;  1TZL A;  3TOA A;  3GZ6 A;  2HKX A;  3ABM H;  3K4J A;  5A2Q K;  1Q1V A;  2OCC H;  5D5U B;  2XGD A;  2I5U A;  5HOD A;  3QOP A;  3CJR B;  1W36 D;  1IXC A;  1ZAR A;  3BZK A;  3A01 A;  4LK1 F;  2CQ7 A;  2IGO A;  2STW A;  3EUK L;  1MJ9 A;  5D6F A;  3DTI A;  4IO9 F;  1OCO H;  4XN0 A;  3IH3 A;  4XKB A;  1EA3 A;  4ON0 A;  3I9V 2;  5GAD J;  3BR0 A;  2EIN H;  2NNY A;  1V5E A;  3HSE A;  1GXP A;  1JGS A;  1NK2 P;  1WJB A;  4IHW A;  2ESH A;  2VT2 A;  2P8T A;  4DYR A;  4QTR A;  1ERD A;  3QQA A;  3VYS B;  2E34 A;  2JQ7 A;  1WHU A;  4BEH B;  3MD2 A;  1ETW A;  1SD7 A;  2HEO A;  3WG7 H;  2CW8 A;  1FTZ A;  2MGQ A;  4R1H A;  1HKT A;  1SC7 A;  3OIO A;  3CCQ I;  1ETY A;  1SFO J;  1SD4 A;  3CCE I;  4GDF A;  3J80 Z;  3J7Y J;  2IA2 A;  4KUM A;  4JX5 A;  3IH2 A;  2E2H J;  3BC8 A;  1O3Q A;  5IP9 J;  4DOZ A;  2KHM A;  2A5W A;  2R7R A;  2DDA A;  3CO6 C;  2FJ1 A;  3WTX C;  5IYC J;  1FNN A;  1T33 A;  1ZTR A;  3MWM A;  1BN5 A;  2EZH A;  2Y0M A;  2VOD A;  1HST A;  2R5Z A;  1PP8 F;  5CQE A;  3GVA A;  1ZR4 A;  2ACJ A;  2E5N A;  2XGC A;  2E1O A;  2QZ8 A;  2KT0 A;  4N4N B;  2E1M B;  2X9D A;  4II3 A;  4KYW A;  5GAH J;  1K6O A;  4IRH A;  4GXO A;  2QQB A;  3CJN A;  3DEE A;  2P81 A;  1JUM A;  1JGG A;  2CW0 F;  2X6Y A;  4M71 A;  4IRI A;  4FE7 A;  1GT0 C;  3TED A;  2BY0 A;  1U3E M;  2DOA A;  4P55 A;  4HQE A;  1V54 H;  1LJ9 A;  3VSK A;  1A6I A;  2G0E A;  4OOI A;  5F1J A;  2D45 A;  2LBF B;  2R7F A;  3RJP A;  1RR8 C;  2L7F P;  2WBM A;  1P92 A;  4LFU A;  2VJ4 A;  1WH5 A;  4OMZ A;  2K7L A;  3E3V A;  2FRH A;  3DBH B;  4CGZ A;  2GOX B;  5ILV A;  3BOQ A;  3M7G A;  5TJJ A;  4YG2 F;  2XSD C;  1RC9 A;  1YHQ I;  2EZI A;  3V42 A;  5TRD A;  1FYM A;  2JPB A;  2XF7 A;  1IXR C;  1K4S A;  2QVO A;  2V79 A;  1Y8Q B;  4LK0 F;  2F4M B;  5FLX K;  4FIS A;  1QO0 D;  1JTX A;  3I59 B;  4V19 K;  2JMW A;  5LEJ A;  1ONV A;  1KU7 A;  1XGO A;  2ZNZ A;  4Y15 A;  4BHC A;  4G7O F;  3CDI A;  1FYK A;  2NYX A;  1UJ8 A;  2MH9 A;  3I64 A;  2O8K A;  1R36 A;  2Q0O A;  3M4O J;  3FBN B;  1FEX A;  4A93 J;  1OR7 A;  3J7A Y;  3PUF A;  2X85 A;  1S5L C;  2RV8 A;  4MO7 A;  3ZQQ A;  4EJO A;  4XKW A;  5K7F A;  1IAW A;  4LMY A;  1R00 A;  3F8M A;  3MQ0 A;  1EH6 A;  1BL0 A;  3OL4 A;  3FIW A;  4LG0 A;  2DA7 A;  4XLN F;  2ELJ A;  2W24 A;  3KYL A;  3HOZ J;  3CLQ A;  4D1Q A;  3JTH A;  2BW3 A;  4IQJ A;  1ZQ3 P;  2D2W A;  1ZLK A;  2XHK A;  5FKM A;  2PX9 A;  1TLH B;  2L5Q A;  2JSP A;  3KPH A;  3DWL E;  4CCL A;  4XLF A;  1LDK B;  4GRI A;  2EA2 A;  5M5X J;  2LRE A;  5FJ8 J;  2BZT A;  2VBW A;  5HDG A;  1B72 A;  4XL9 A;  1S6L A;  1QVT A;  2JRM A;  2WB1 A;  3VPR A;  3QP6 A;  5DCM A;  5IOY A;  5HLH A;  1DP3 A;  1IDY A;  5FD5 A;  3RZO J;  4G9Y A;  4B47 A;  4ZZL A;  5LRS A;  2E2J J;  3CES A;  2QBY A;  2OC6 A;  1V5F A;  4XLP F;  2PLY A;  3DQV C;  1IRG A;  3DFG A;  4XR6 A;  2Y0S N;  1T6S A;  1K61 A;  5IYD J;  4BU2 A;  4Q5S F;  3IHU A;  1T95 A;  2Y75 A;  4NUB A;  2Y2Z A;  2DOE A;  5B66 C;  1T56 A;  4HF0 A;  4A3J J;  4BQA A;  3U1D A;  2WA0 A;  1HBX G;  2DA1 A;  3WU0 A;  2R5Z B;  5HS8 A;  3K4L A;  2H94 A;  4Y7N J;  3HB9 A;  1PUF A;  3I4N J;  4KFC A;  1JTY A;  3IKV A;  4RDU A;  1GXQ A;  1JI8 A;  4NHJ A;  1SMY F;  3QU6 A;  1W7P B;  2EZL A;  3D5S C;  2M5W A;  4BXU A;  5DM7 F;  2E35 A;  4DZJ A;  2IBD A;  5LFA A;  1K78 A;  2DA5 A;  1HW5 A;  1U9N A;  4D5F A;  1IUF A;  2K9S A;  3WU1 B;  4PJN A;  3QWL A;  3PM1 A;  4GYG A;  3CJQ B;  4FQG A;  1QPM A;  3L2C A;  4PCQ A;  1FBS A;  1FSE A;  4X6A J;  5EEG A;  3FX3 A;  1UHW A;  2NNN A;  4O6J A;  4W97 A;  2BHY A;  1RUO A;  4OIP F;  2M0M A;  3HC7 A;  3JRB A;  1JKQ C;  3KIO A;  3S2H J;  5CVJ A;  3WGH A;  1FOY A;  4PDK A;  4BE1 A;  1R5H A;  2R7Q A;  2L2O A;  3GO5 A;  3T5X A;  2BXY A;  3SZT A;  2W00 A;  3FMQ A;  3S1M J;  1AU7 A;  4AVZ A;  2QM3 A;  2CQK A;  5CJ9 A;  2PJP A;  5E8I A;  3CCM I;  5ICG A;  1OCP A;  4X1E A;  1FOX A;  2VLA A;  2BXZ A;  3JRF A;  3MZH A;  4HDV A;  1MBF A;  1VQM I;  5TIS C;  3AG3 H;  3D5R C;  1YIT I;  4CZZ A;  1HW2 A;  3FBI B;  4C30 A;  2BY1 A;  4MTE A;  1Z21 A;  2DA2 A;  1QNT A;  1O3R A;  2MAB A;  4EM1 A;  1UST A;  2FNP A;  3CMY A;  2ESN A;  1BM9 A;  2UZK A;  2STT A;  1OQY A;  2DFE A;  2YU3 A;  1X2N A;  5EZH A;  2BW3 B;  1ETO A;  3HIF A;  1SAU A;  5JVG F;  1Y8R B;  2I10 A;  1A31 A;  5CLS A;  3PFY A;  4DGW B;  4AYB N;  4EJV A;  1YOV B;  1OYY A;  1FBQ A;  2IA0 A;  2H8R A;  3OYK A;  2H27 A;  4KIG A;  5B3S H;  2DO7 A;  2L4M A;  1YIO A;  2ZSH B;  3WTZ A;  3S3M A;  4F55 A;  2HDW A;  2LKS A;  3TP0 A;  9ANT A;  2W85 A;  2EA4 A;  5DV5 A;  2DOD A;  2ME0 A;  5FFZ A;  1YIJ I;  3OMY A;  2QBY B;  2BBY A;  4FTH A;  2LY2 A;  3H36 A;  5FGM A;  1UZC A;  2ZJ2 A;  4NQW B;  1FC3 A;  3GTJ J;  4XBF A;  1U0J A;  4IRG A;  2GZW A;  4PGH A;  1V4R A;  2WC2 A;  4UHT A;  3HEF A;  4DZP A;  1YE9 A;  2F5V A;  1YI2 I;  4M6X A;  4I02 A;  2B7E A;  1L3L A;  2IPQ X;  3E7L A;  1KQ9 A;  3HOX J;  4A3I J;  1QVU A;  5J8C A;  4NB5 A;  3ZP5 A;  4EJT A;  2QEN A;  3W2A A;  4FET A;  2IVM A;  1B8I B;  3E6B A;  3K2Z A;  3PNY A;  2KRF A;  5GTI C;  2L9V A;  5K7H A;  1JE8 A;  2IAI A;  3VB2 A;  2QQ9 A;  2F4O B;  3H9Q A;  3CCJ I;  1S72 I;  2LR8 A;  4IJA A;  2HPM A;  1D1C A;  4X0G A;  2EFN A;  1K78 B;  1TQP A;  3MVP A;  2W57 A;  3JW4 A;  4BBR J;  3PO2 J;  1B6A A;  1LE8 B;  4BAY A;  2FNA A;  1RR7 A;  1Y56 A;  2P5K A;  5CVI A;  4RB1 A;  2VON A;  2EPF A;  1RZ4 A;  2OV7 A;  2HR3 A;  2ETH A;  1S7A A;  2QSG X;  2DW4 A;  4G8X A;  1VND A;  2W82 A;  4BXF A;  1CF7 A;  1UHS A;  1YW9 A;  2CUJ A;  1I39 A;  3I5U A;  3SEQ A;  3MAJ A;  2E1C A;  3ABU A;  3CC2 I;  3GZN B;  1LEB A;  3CMA I;  3AG1 H;  5GPC A;  2VJ5 A;  1DP7 P;  4HX4 A;  2Z33 A;  3JRA A;  3K0L A;  5CVR A;  2ISY A;  3H3V K;  1QPI A;  2LVS A;  4BL0 B;  4WK8 F;  2D5V A;  2XF6 A;  3OIP A;  1I6X A;  3BTL A;  4A6D A;  4HAM A;  1F9N A;  3GW2 A;  1RKT A;  3UNG C;  1H8A C;  3TO7 A;  3L2U A;  2RNG A;  2EV0 A;  1K7A A;  1X1D A;  4J19 A;  1LDJ A;  4G6Q A;  4YFX F;  3HSR A;  5BMZ A;  1N75 A;  3FM5 A;  3QYE A;  1FIP A;  4AIH A;  4ZC3 A;  2OQR A;  5TGT A;  3FK6 A;  2CH0 A;  2DBB A;  4LJZ F;  2EV6 A;  3LSM A;  1HXD A;  1X4O A;  2CO5 A;  2CS3 A;  1B4A A;  1WPK A;  3S8P A;  1SD5 A;  4ZYG A;  1J59 A;  2IS6 A;  2GM4 A;  4XK4 A;  1RPW A;  5L3F A;  1ON1 A;  4HOB A;  1W1W E;  4CXF A;  1NK3 P;  3T1B A;  3HKZ A;  4PSX A;  5E8G A;  3BTJ A;  2DQL A;  3HZJ A;  4RA2 A;  4RAZ A;  3S2W A;  1Y1W J;  1BA5 A;  3SFZ A;  1U78 A;  4E7J A;  3DLL F;  1RES A;  4WWC A;  3D1N I;  1QA6 A;  1ZR2 A;  3I55 I;  4DBQ A;  1XX5 A;  4XM3 A;  4BDZ A;  1IUY A;  1IN8 A;  2FBH A;  2JWT A;  1LDD A;  1ITY A;  4W1U A;  1J75 A;  3NQO A;  4KMF A;  4YII A;  4G6D A;  2HQR A;  2H6B A;  4D7N A;  4HRI A;  5H6R A;  1NTC A;  2X4H A;  3S1N J;  3F21 A;  4GCV A;  3HDD A;  1QU3 A;  4PJM A;  2L7K A;  3WTU C;  3MZ8 A;  1R5I D;  3MMY B;  3OYC A;  3HPH A;  4DQ2 A;  2F48 A;  1D0X A;  1HQC A;  3L9F A;  4U88 A;  5DEQ A;  5LGU A;  3ZQH A;  1O3T A;  3GYH X;  4XOP A;  1OPC A;  4Y17 A;  2HOE A;  1JKP C;  3CMM A;  2O7O A;  3H3U A;  4YIF A;  3EUH A;  5DM6 F;  4BUP A;  3E97 A;  2LC2 A;  4YEL A;  3IRQ A;  1YG2 A;  1OCT C;  5JR3 A;  4UVB A;  2K40 A;  1OKR A;  4IPA A;  1LFU P;  3AL0 C;  3CUQ C;  3HRU A;  2KL4 A;  3BQY A;  5HOO A;  4UV8 A;  1R7J A;  2LF8 A;  2VKV A;  3CD6 I;  2FBI A;  2IS4 A;  1SEU A;  1ZRE A;  4A0X A;  1MMS A;  1DU6 A;  3I71 A;  1G3W A;  4PFP A;  2UV1 A;  3SJM A;  2HXI A;  1XN7 A;  3K10 A;  4L0Z B;  3C1D A;  1CF7 B;  2V9P A;  2JA6 J;  5E79 C;  2HOS A;  2VN2 A;  3I53 A;  4WX9 A;  4D0P A;  3FKI J;  2A5Y B;  3HGG A;  3R61 A;  1T39 A;  5B1B H;  1UHM A;  2JVH A;  4LLN A;  4HYE A;  2YX7 A;  2E60 A;  2EB7 A;  2I8D A;  4HNV A;  2P5L C;  1GUU A;  3DKW A;  3HUG A;  2HS5 A;  3K1M A;  4Q47 A;  4KIT B;  3KCC A;  1PYV A;  3U21 A;  4HNT A;  1SFX A;  2KIU A;  3PNV A;  1P7I A;  1MJA A;  3KEQ A;  1TWF J;  2M4K A;  3ZQI A;  4EJU A;  5DUK A;  5L3C A;  3GFL A;  3OYD A;  2ZBK A;  1BC7 C;  2XAU A;  4YFK F;  4ZDL A;  3IAS 2;  4Y52 J;  5CKT A;  3G4S I;  1IW7 F;  5JI6 A;  2DK8 A;  4ESB A;  2DFH A;  3CTA A;  2IEK A;  5HLT A;  1ETX A;  2L01 A;  2OQG A;  2PN6 A;  2VQL A;  3SYT A;  3OYF A;  2P5V A;  3NEU A;  3W6J B;  3VWB A;  3EYI A;  4AD9 A;  4DYC A;  1BW5 A;  5JLW A;  5E20 A;  1JJ6 C;  1Z6R A;  3OYJ A;  3FXM A;  3BTI A;  1WKM A;  3E6D A;  5D5V B;  3ELK A;  2E36 A;  3I4M J;  4ZTF A;  3BR2 A;  1VQN I;  3L1P A;  2K86 A;  1REP C;  3F6O A;  2HDC A;  2NXN B;  2VQG A;  1D3Y A;  4XID A;  4UY8 I;  2CRG A;  1G59 A;  1P2F A;  3IV5 A;  6PAX A;  1HKQ A;  4DNC A;  3HOS A;  1BI3 A;  2WY7 Q;  3Q9V A;  2PJR B;  3C2B A;  4CZC A;  1G8X A;  1X3W B;  2DA4 A;  1IJW C;  4Y13 A;  2R5Y B;  2ZFW A;  5LRR A;  1TP4 A;  2F2E A;  2IW5 A;  1LB2 A;  2FE3 A;  2ZSI B;  4ENJ A;  1XB4 A;  3Q0U A;  1FT9 A;  1WVR A;  2NRA C;  2EQR A;  4LOC A;  3K70 C;  2COM A;  3OS2 A;  4O5V A;  3HRT A;  4HBL A;  2QSH X;  4PGG A;  3CCS I;  1F1Z A;  1WI3 A;  1OCC H;  1XCV A;  3S16 J;  1AWC A;  1CQT A;  3FHN A;  5FLV A;  3HOV J;  2IS1 A;  1TTY A;  4CUG A;  3H35 A;  3OR2 C;  3T8T A;  5AIP A;  4HA8 A;  1TL8 A;  1YQA A;  2V6E A;  3V8L A;  5M3M J;  5K7Z A;  4G7Z F;  4XOT A;  3GFJ A;  4RM2 A;  4A3G J;  2HYJ A;  2WWY A;  1OJL A;  2JA8 J;  2V7F A;  3LSK A;  4A3E J;  1QBJ A;  1T8I A;  2DMQ A;  1XMX A;  1OFC X;  3V7C A;  2EBI A;  1Z1D A;  5AON A;  4DJA A;  4BJT A;  2GIZ A;  1JKO C;  1AKH B;  3HL2 A;  1BBY A;  2ADU A;  4KMU X;  1A35 A;  4FX0 A;  4KNY A;  1ZRD A;  2OTJ I;  4A0Z A;  3CJT B;  4A3F J;  3LWF A;  2PG4 A;  2R7D A;  3M9A A;  3WU2 C;  2RGV A;  1A04 A;  3I3L A;  4XRF A;  5K5O A;  4A12 A;  2CQQ A;  4I7H A;  2M1B A;  4E7H A;  1J2X A;  1D0Y A;  3ZXS A;  4CCK A;  2VOP A;  4F3Q A;  1W0U A;  4M74 A;  2ID3 A;  2XKP A;  2MH2 A;  1HKS A;  1K83 J;  1R5G A;  3O6B B;  4R8H A;  3TBI A;  3IKT A;  3VDX A;  4OIQ F;  1ZGW A;  4LB5 A;  2KZV A;  4JYK A;  3JRE A;  1STZ A;  3ZGK A;  2BVM A;  4ZYD A;  5J1Y A;  5BOX A;  3WE3 A;  1F4K A;  3DPU A;  2O3F A;  5EJC A;  3DKY A;  4ASN A;  1W0T A;  5F1R A;  3OV8 A;  1ODD A;  2QA4 I;  4PZJ A;  2CFX A;  3S17 J;  2MBF A;  1J9I A;  4XRS A;  1R23 A;  4XQF A;  1H89 C;  1Z3X A;  5BPD A;  3M1C A;  3J7A O;  4A3K J;  2V6C A;  3CLO A;  2KDZ A;  3KLN A;  2KRH A;  3DKX A;  2ZXJ A;  2PFB A;  3LQQ A;  4U0V A;  3TW6 A;  3MKW B;  2R7X A;  1USS A;  2XPU A;  3L09 A;  1JUS A;  1FTT A;  5C4X J;  1QHH D;  5DCF A;  3RPU A;  4LB6 B;  3BG9 A;  4BY1 J;  5K5Q A;  2DQR A;  3F6V A;  1RET A;  3MFK A;  4JK1 X;  3QPH A;  3IL2 A;  3VSL A;  1RI7 A;  4CCO A;  1OCZ H;  4MEY F;  3OSF A;  1ZLJ A;  2VB6 A;  1VQ6 I;  3LSR A;  1S8N A;  2RC4 A;  3PQJ A;  5EGO A;  2EZK A;  2LDU A;  1Q1H A;  5JHU A;  4ANJ A;  1N78 A;  1H9G A;  3K6G A;  3P9I A;  4ZJZ A;  5JHF A;  3K9T A;  5H6Q A;  2QWW A;  3TP3 A;  3KP7 A;  4OWR B;  4RAF A;  3ABT A;  3F8N A;  2O61 A;  4LGW A;  3UR3 C;  1XSD A;  1N77 A;  2PMH A;  5M5W J;  1BR4 A;  5KVR A;  2L02 A;  3VOE A;  2IRF G;  2GWR A;  3U2R A;  1TNS A;  2VC0 A;  4XSZ F;  3BR6 A;  5BNG A;  3CDH A;  3JAM K;  1MBG A;  4JQF A;  2VL8 A;  2V26 A;  3JRD A;  3BRO A;  3KZY A;  4B4C A;  2HPI A;  4PJL A;  3HJE A;  3K1N A;  1VQ7 I;  2GXG A;  5J4V A;  1MDM A;  5J8F A;  3A01 B;  3PNT A;  1OCR H;  2X51 A;  2R3S A;  3VFZ A;  3Q3S A;  4IF4 A;  3HPG A;  2A6H F;  3COA C;  2M45 A;  2VKH A;  3I4P A;  2Q2E A;  1QZE A;  3H92 A;  1VQK I;  3KFW X;  2B63 J;  3OOU A;  1KGS A;  1BI0 A;  3HOT A;  2KIM A;  4XRS G;  1R9T J;  2ZKZ A;  4N4O B;  4M6Y A;  2WB1 N;  2RVC A;  4HF2 A;  3LFK A;  4BY7 J;  1F5T A;  4OIO F;  3LL7 A;  1TWC J;  5BPI A;  3BJ6 A;  1U9O A;  4QSH A;  3OYL A;  4B1R A;  4CIC A;  1FOK A;  3HRS A;  1ZHF A;  4XN3 A;  2WAQ A;  2JA2 A;  4I2O A;  4NNJ A;  2RKH A;  2JUC A;  2M4G A;  4IOC F;  5J47 A;  3KP4 A;  2ZME C;  2ELK A;  3S32 A;  2R93 J;  2MC3 A;  2LFB A;  1RUN A;  2H1K A;  3NAU A;  3QU3 A;  5LEK A;  4A3C J;  1BJA A;  2L7M P;  3IP4 B;  3VEP A;  2AQF A;  2X1E A;  3W2V A;  3S2D J;  3BP8 A;  4DW6 A;  3W6K B;  2IA1 A;  4A2U A;  4B09 A;  3V8J A;  3BCB A;  3CO7 C;  2EK5 A;  3JRC A;  3A4C A;  4MQ9 F;  4AID A;  1MBJ A;  1TT0 A;  3L2Q A;  2ZO4 A;  1R49 A;  4XIC A;  1YRN A;  3DPL C;  2KIS A;  2EV5 A;  1FY7 A;  2WV1 A;  4AVP A;  1C0W A;  3Q9S A;  1ETQ A;  2WTE A;  3U9G A;  3J80 K;  1Y0N A;  4XSX F;  1QZZ A;  3G1L A;  3OYB A;  2JVG A;  5LLQ A;  3H5N A;  1O57 A;  2CV1 A;  4FCY A;  1UEL B;  2ZB9 A;  1WJ5 A;  3DTK A;  4HLY A;  1VZ0 A;  3F22 A;  3ONQ A;  2AS5 F;  5EGO B;  3S93 A;  5HNF A;  2PMU A;  5E17 F;  4A5M A;  4YIR X;  1MD0 A;  3N05 A;  3I54 A;  3BG6 A;  1F43 A;  3FDY A;  1O7F A;  3AG4 H;  1N25 A;  4PFO A;  4IQ4 A;  1JT0 A;  3WTT C;  2XUB A;  4U7D A;  4J01 A;  2BY2 A;  2OZU A;  1EH8 A;  2FQ4 A;  3SQN A;  4E70 A;  3NRV A;  5L3G A;  3KET A;  2AXL A;  1B59 A;  2OD5 A;  5BS6 A;  4MNU A;  2M30 A;  2CWE A;  1T0F C;  4G12 A;  1EKE A;  5LD2 C;  3HHG A;  3KE2 A;  2XRO A;  4DIQ A;  2K4B A;  4IHV A;  3J81 Z;  4UV9 A;  5F0H A;  5HDN A;  3HOW J;  3VYU B;  2FSW A;  2LY9 A;  2JN6 A;  3KEO A;  4BDY A;  1W5S A;  3TKY A;  5EZG A;  2W84 A;  2DPU A;  1G3T A;  1P9Q C;  4L9J A;  1PP7 U;  3GF2 A;  5KHD A;  4KIC A;  3T0Y A;  2FD5 A;  5K1Y A;  5E3M A;  1MH4 A;  2LK2 A;  3QOD A;  1DPU A;  2JSC A;  2M9H A;  2PMZ A;  1K6Y A;  4L0Y B;  1ENH A;  3BJO A;  5CYV A;  5EG0 A;  1CGP A;  1HSJ A;  3OR1 C;  4LG0 B;  3DV8 A;  1G6N A;  3Q0V A;  1MMD A;  4PJJ A;  4CDG A;  2GXB A;  3ASN H;  4B3A A;  3PL8 A;  3FM3 A;  2HTJ A;  3LST A;  2VKE A;  2ZXH A;  3F23 A;  2VUM J;  1JUP A;  1XMK A;  3GZ5 A;  4CCJ A;  1VF9 A;  2HZD A;  1U5T C;  4GO1 A;  4N9I A;  2XC7 A;  1ORK A;  1Y6I A;  4M9X A;  2F5C A;  2RDP A;  3F8C A;  4P96 A;  1A6Q A;  1NH3 A;  4HNU A;  3NWS A;  5HS7 A;  4U87 A;  3JTG A;  1HLV A;  3FF5 A;  4JX4 A;  1B72 B;  4FT8 A;  1FP2 A;  1YO5 C;  3CCU I;  1R4M B;  1X58 A;  4HF1 A;  2M8E A;  5DCM B;  4ITV A;  3TO9 A;  2WV0 A;  4XKV A;  2ME6 A;  3GTL J;  3DLA A;  2DLL A;  2FBK A;  4EEF G;  2K02 A;  1OYI A;  2DA6 A;  3ZQ7 A;  2RQP A;  1UG2 A;  5GTH C;  3GBG A;  3RYR A;  1FZP B;  3G71 I;  3ZCO A;  2DOF A;  3BLY A;  2QYO A;  4XLC A;  1KYW A;  2NVT J;  3OS1 A;  1J0R A;  4AIJ A;  1IN6 A;  4CCM A;  2K9L A;  3BJA A;  3IWZ A;  3FWE A;  2XPV A;  2UXN A;  5ERI A;  3GME A;  2MLK A;  1V5G A;  1APL C;  1VTN C;  1PUF B;  1QHG A;  3KEY A;  4KJZ A;  3EQL F;  4B44 A;  5EEA A;  3M07 A;  3OYE A;  2YSR A;  3ZMV A;  5D4S A;  4RGS A;  3TDU C;  2UUZ A;  5BQT A;  1HC8 A;  2R7T A;  3HRM A;  4D9J A;  1BR2 A;  3JSP A;  3GFM A;  2P6S A;  3L00 A;  2RN7 A;  2B0L A;  3AFH A;  3HM5 A;  4YFN F;  4I01 A;  5LHG A;  2KRC A;  1SAX A;  3CC7 I;  3SXY A;  3L2R A;  3LSI A;  2L9R A;  3L7W A;  2DMN A;  2VKD A;  2XDV A;  2DK5 A;  3O8G A;  3GCM A;  2HTS A;  2FEZ A;  5AIQ A;  1I27 A;  3SHF A;  1ETK A;  1XD7 A;  1FBU A;  2EFW A;  2G7U A;  2MG4 A;  3ZMD A;  1LUJ B;  4O3M A;  3QOE A;  1MMA A;  5EEH A;  5D4R A;  3ROU A;  2E1M C;  1TQI A;  3OYA A;  4BQN A;  2CFO A;  1WFX A;  3RI4 A;  1ULY A;  2AHQ A;  1TC3 C;  3IAM 2;  4A6E A;  3CME I;  2DJI A;  1I50 J;  1SVM A;  3CQZ J;  1MNM C;  2LOO A;  3G1O A;  5FKO A;  2DPD A;  3HTU A;  3B73 A;  3G73 A;  2LF7 A;  1PUE E;  1Y39 A;  2FQ3 A;  3ZN0 A;  1FJL A;  3H0D A;  4ZYE A;  4IHY A;  5DUI A;  2A3S A;  4C2U A;  4I76 A;  5F0C A;  5DS9 A;  3HKZ N;  1D0Z A;  2C6Y A;  2QKM B;  2CMP A;  2QQA A;  5D8L B;  2O6G E;  4EMS A;  4BNC A;  3OYI A;  2HQN A;  4G7H F;  2JA5 J;  1H0M A;  4I0A A;  3HGY A;  3TGN A;  1S7O A;  4F93 B;  3CP2 A;  4RMN A;  3HOY J;  2YPR A;  4WXH A;  1LEA A;  1E2X A;  4IHX A;  4E6K G;  3K4B A;  2XAJ A;  1WJF A;  2DAO A;  3X2Q H;  1UB9 A;  3B02 A;  2AQE A;  1KU9 A;  3HTS B;  1IRZ A;  4NC8 A;  2CSO A;  4ZDP A;  1IV8 A;  2CQX A;  1D5V A;  2RNJ A;  4HEA 2;  3G6E I;  1G3S A;  2LLK A;  4I09 A;  4B8X A;  1D5Y A;  4RB2 C;  5LHH A;  3PIP F;  2DU9 A;  2HOA A;  3IRR A;  4N9H A;  2M8G X;  1NHA A;  1O4X A;  1DPR A;  2TCT A;  4YEJ A;  4HX7 A;  4EGZ A;  5FRN A;  3RZD J;  4UB8 C;  1P4W A;  4ENM A;  1P6R A;  4AM3 A;  1I5Z A;  3AAF A;  4BQO A;  4UUS A;  3BWG A;  4MFE A;  2HVQ A;  1WRJ A;  2K9M A;  2V9K A;  1YX3 A;  3ISP A;  4EQQ A;  3ZPL A;  2DN0 A;  3F9K A;  1BR1 A;  2A61 A;  3FXO A;  4F92 B;  3S3N A;  4BBS J;  2MD5 A;  3RPQ A;  4B43 A;  2WAE A;  1X3U A;  3BDD A;  2KP6 A;  5F0F A;  4RM3 A;  3ZOB A;  1EF4 A;  2ELH A;  3WTV C;  1HW1 A;  3QPL A;  5L3D A;  1Z3Y A;  5KAF C;  3S14 J;  2NS8 A;  1E0E A;  3EET A;  2K85 A;  2CUE A;  2XGX A;  5F04 A;  2DT5 A;  4L9N A;  1PVE A;  2YR2 A;  1XSX A;  4NC7 A;  1E3P A;  2V1D A;  2XKO A;  5A2Q Z;  2X48 A;  4XON A;  3I0T A;  3S15 J;  1V55 H;  2N8G A;  3V7S A;  4D7M A;  1WQ2 A;  1TWA J;  2HYF A;  4MHG A;  1S9H A;  1ZG1 A;  4IXA A;  3WTS C;  4BE2 A;  2X1D A;  2KDO A;  2V1X A;  3SDG A;  4A0Y A;  1ZKG A;  2Z9O A;  1AOY A;  2CQN A;  2FMY A;  1U5T A;  4A3L J;  4BHB A;  4HW0 A;  4CYC A;  2NS0 A;  4M3G A;  1T2K A;  1FMV A;  3M1E A;  1OIS A;  5E1Z B;  2KLO A;  2LD5 A;  3E5Q A;  4NBQ A;  3HXL A;  3V4G A;  2DT6 A;  2LRD A;  3H1C A;  3GX4 X;  3HHH A;  4II2 A;  2M3A A;  2R7U A;  2HQ5 A;  4CHU A;  4MIM A;  2MSY A;  4BKX A;  4UVA A;  4PK4 A;  4UB6 C;  1TW2 A;  2BY3 A;  3PUB A;  4RLQ A;  2BGC A;  4OAZ A;  2EIL H;  1SFE A;  2YX4 A;  5FRO A;  1O7L A;  5DTD A;  1UMQ A;  1ZEL A;  1IXS B;  5DD4 A;  3CF2 A;  3E5X A;  4LLG F;  1FP1 D;  2XAG A;  4S0H B;  2LKX A;  1GVD A;  3WOD F;  1WJE A;  5IT9 K;  1U8B A;  1NG7 A;  2Y31 A;  1FYL A;  3S1Q J;  3BZC A;  4C3H J;  5LGN A;  1KU2 A;  3SDB A;  2NS7 A;  3ML6 A;  4BH9 A;  4XLA A;  3HOU J;  2QLZ A;  3OYG A;  4E4H A;  3OIQ A;  4RAG A;  1W7P D;  3GFI A;  1LPQ A;  2IS2 A;  3ZR8 X;  2FXA A;  4JX6 A;  2GXA A;  2IP2 A;  5B1A H;  4FE4 A;  2H1L A;  3PQK A;  1HOM A;  5FRM A;  3GTO J;  2GA1 A;  3IUO A;  2M34 A;  4S04 A;  1MSE C;  1QGP A;  3LAP A;  2OUM A;  3QP5 A;  1K79 A;  2CJJ A;  1YS6 A;  1AA7 A;  3K69 A;  3LNQ A;  1R58 A;  2ZCW A;  3D0S A;  2CYY A;  3FMS A;  2FF4 A;  4HST A;  1M1E B;  4P1W A;  2J5O A;  2XIG A;  1OR7 C;  1WH7 A;  4A69 C;  2FOW A;  3PSF A;  2IGM A;  1E17 A;  2CW7 A;  4GYI A;  3J7Z I;  1SFK A;  3WHC A;  1WWX A;  5ILS A;  3A03 A;  1MBH A;  4PSW A;  3MKY B;  1BIB A;  3CC4 I;  1VFC A;  2HQA A;  2JUG A;  3CZ6 A;  1T98 A;  4NDL A;  2KQR A;  5K5R A;  1R22 A;  5GAG J;  1FLI A;  2BEO A;  1XSV A;  3T8R A;  2DXI A;  1WZ2 A;  4N0B A;  4Y3O A;  3K4N A;  4RGU A;  4QLC U;  1G4D A;  4A3M J;  4MTD A;  2DMP A;  5HLI A;  2G9W A;  2DMU A;  4UVC A;  5F6F A;  3ZMT A;  4C2T A;  1XC5 A;  1B9M A;  5ILU A;  1KA8 A;  2M87 A;  3OS0 A;  2LY1 A;  4BXX J;  3O3K A;  1I6H J;  4M3B A;  3C2H A;  2LBF A;  4Y33 A;  5FLX Z;  2K9Q A;  3RKX A;  4M72 A;  3K7A J;  2GQQ A;  3R60 A;  1LNW A;  4LD5 A;  2DTR A;  2XAF A;  2MA3 A;  1IZ1 A;  2GA2 A;  2ZNY A;  2F5E A;  2VXZ A;  1POG A;  2WAD A;  3AKZ A;  2HVS A;  3H5A A;  4IL6 C;  5D8K B;  2E5Z A;  4CH7 A;  3PSI A;  3LA3 A;  2P4W A;  1E3H A;  3FXK A;  3WTY C;  1DGR M;  3K70 D;  1U2W A;  3I58 A;  4L9V A;  4P9F A;  1A36 A;  2HOT A;  2P7C B;  2XAQ A;  2R7S A;  1EJ9 A;  3CCV I;  1BI2 A;  2K27 A;  2XSJ C;  3EYY A;  3H5R A;  3HSF A;  4BJ5 C;  4UUT A;  3I59 A;  3JR9 A;  1X4P A;  5JFR A;  2M0C A;  3HUG B;  5DYM A;  3ZN1 A;  3ECO A;  2Z2S B;  2OU2 A;  4NC6 A;  4EM0 B;  3BG3 A;  3OL3 A;  2K5C A;  2E7W A;  4TV7 A;  1MMN A;  2F6C A;  3A0H C;  4K2E A;  1XDS A;  2HU9 A;  1BC8 C;  3RQ4 A;  3I56 I;  3LFU A;  2LMD A;  2Z5U A;  3DXJ F;  2KPM A;  5ICE A;  3TO6 A;  4D5C A;  4BYY A;  1SD6 A;  2JZY A;  4IKF A;  3M3Y J;  2VE9 A;  4JP0 A;  4CYD A;  4EJW A;  3B6A A;  4QIW N;  3CF5 F;  2L4A A;  2K4J A;  1OMI A;  1I1S A;  3KP2 A;  3TDZ C;  3K2A A;  5E1W A;  3BTC A;  4ENN A;  1SFU A;  4ZTJ A;  1UFM A;  5E1X A;  4A3B J;  1GHC A;  2E2I J;  1VQ8 I;  4AU7 A;  2KFD A;  1Z67 A;  2QCO A;  2CV0 A;  2HNH A;  2V1U A;  3R6S A;  1D8J A;  1OYW A;  3CUQ A;  3FXL A;  1JHH A;  4IZZ A;  3QRF F;  2OPT A;  1VQ9 I;  2ID6 A;  3V8K A;  2V1N A;  2EFQ A;  3LOC A;  3DU5 A;  2IGN A;  2IXS A;  2R7O A;  1FOW A;  3CCL I;  1TT5 B;  3W3C A;  2MFZ A;  2F4I A;  5FKK A;  1XGS A;  3WTW C;  4S05 A;  3RCO A;  4QPQ A;  3CCR I;  1SMT A;  4LLL A;  1XDU A;  1J5Y A;  4M9Z A;  4C9Y A;  2DYS H;  1XG1 A;  2PI0 A;  2FU4 A;  3BQZ A;  2JJ7 A;  2DJN A;  2H09 A;  4XMY A;  4LIU A;  3DPT A;  3EDP A;  3ABK H;  4Q48 A;  4LIT A;  1KU3 A;  3QAH A;  4XLE A;  5DD8 A;  1W7P A;  4PUS A;  3GTM J;  4P5O A;  4A5N A;  2ZXW H;  2VBY A;  1MW7 A;  2X1C A;  2ECC A;  1H9T A;  2OAZ A;  3CP8 A;  5J40 A;  5IT3 A;  4MQV A;  3QYF A;  5C4J J;  2BE5 F;  4MFD A;  3RKQ A;  2FUG 2;  2NVU B;  2NVX J;  3LSJ A;  2OCE A;  5IYB J;  2DI3 A;  1WGX A;  2DA3 A;  4E7K A;  3HYI A;  3E0J B;  4ZYH A;  2Z16 A;  1YX5 A;  3F8F A;  3LAJ A;  1S3J A;  1WJC A;  3FXR A;  3KP3 A;  1YS7 A;  1IGN A;  5FKL A;  4HDU A;  5IY5 H;  3JSO A;  5DDG A;  1LFP A;  4KN4 X;  2L54 A;  2L9S A;  2O8X A;  2WAQ N;  2XVC A;  4LG3 A;  2OBP A;  2MYS A;  2XV4 S;  4ZH4 F;  4IX7 A;  1P4A A;  3CUO A;  3RSN A;  4FX4 A;  4F91 B;  3ZQG A;  1I3A A;  2R7W A;  3FK7 A;  3N4M A;  3GTG J;  1X1C A;  2VPL A;  2X6X A;  2GOM A;  3NAR A;  3K4M A;  2GBY A;  2RQQ A;  2MC4 A;  2HKO A;  5F08 A;  1MBE A;  1BI1 A;  2M2E A;  5HDK A;  3BG5 A;  4HLX A;  5KNL A;  4WCG A;  4ENK A;  2VT3 A;  3OSG A;  2Z1D A;  4AC0 A;  2PEX A;  2Y9Z A;  1LVA A;  1MBK A;  4MLO A;  3ASO H;  3D5L A;  2DFI A;  3MKL A;  3L2W A;  3ESW B;  3DU6 A;  2P0W A;  2DYR H;  4IHT A;  5ED4 A;  3A02 A;  4HSR A;  2HXO A;  2CV2 A;  1TNT A;  2HDD A; 
#chains in the Genus database with same CATH homology
 1QZY A;  3BZ6 A;  4I98 B;  1R1T A;  3F72 A;  1XGN A;  3CUQ B;  2LKP A;  4HV5 A;  3RYP A;  4HZF A;  1JHF A;  1ZYR F;  1ZRC A;  2PQ8 A;  2A6E F;  4NQW A;  1W5T A;  3C18 A;  3PFI A;  2KJB A;  3WE2 A;  3BPV A;  4L5J A;  3FXQ A;  3MZY A;  1UCR A;  3P9C A;  5H20 A;  3M8E A;  2OZ6 A;  4IHS A;  1FX7 A;  4KA4 A;  4FHT A;  2Y48 A;  5KK1 A;  2KIF A;  3C7J A;  3ECH A;  1Z6T A;  3KZZ A;  5HLG A;  3BPX A;  4ETS A;  3ZMU A;  2PBI A;  5L3B A;  1O3S A;  1WSU A;  2HFH A;  4HV6 A;  1MDM B;  3KP5 A;  4Z2Y A;  3FXU A;  1Z9C A;  3GWZ A;  2H6C A;  4JBA A;  3Q5F A;  3R4K A;  4RGR A;  3RIR A;  4WF2 A;  3ZMZ A;  1ZRF A;  3TQN A;  1FSH A;  2HGC A;  1YW7 A;  4EM2 A;  4BHP A;  2CGP A;  2A69 F;  2VC1 A;  2P7V B;  2JPC A;  1D8K A;  2E7X A;  3MCZ A;  4OIR F;  2V9V A;  3R0A A;  3P7N A;  5ICC A;  2XAH A;  4I0B A;  1TW3 A;  3GXO A;  1U8R A;  4L9T A;  1YLF A;  1TQM A;  3P9K A;  2Z3Y A;  1FWZ A;  2G7H A;  1DUX C;  3E6M A;  4ESJ A;  1XGM A;  2F5D A;  3TOB A;  4MGR A;  3OOP A;  4CO8 A;  1XCB A;  3FMR A;  1V3F A;  1G3Y A;  3KLO A;  3M8F A;  1YTY A;  4KDP A;  3RTR A;  2JT1 A;  3ULQ B;  1ZH5 A;  1R1V A;  1ZG3 A;  2P6T A;  1YW8 A;  3F8B A;  4KIB A;  5ICF A;  1B9N A;  1KQ0 A;  2EFP A;  5LHI A;  2UXX A;  1ZN2 A;  1KYZ A;  2JTV A;  4P9U A;  3BY6 A;  3DF8 A;  1GVJ A;  4KIF A;  2HYG D;  1W4M A;  3DP7 A;  2ZME A;  5LGT A;  4HX8 A;  1ZGA A;  1JXS A;  5CVV A;  2IT0 A;  1IN4 A;  5HVQ C;  1LQ1 A;  4L5I A;  2J5P A;  1ZG5 A;  5IT9 Z;  4RGX A;  3J81 K;  2BYV E;  1BOA A;  2BV6 A;  2KKO A;  2A68 F;  5JVT A;  3VOD A;  4M73 A;  1XMA A;  5LBQ A;  3GLX A;  2F5F A;  2GIV A;  3SZP A;  1YFH A;  4OIN F;  4AIK A;  5FFX A;  3QPT A;  2E1N A;  4U7B A;  3E5U A;  1IN5 A;  3WGG A;  2O03 A;  5CVU A;  2VOO A;  2EFO A;  3MEX A;  3ZMS A;  5D6E A;  4U0W A;  3REO A;  1TBX A;  3WG9 A;  4Q4Z F;  1Y0U A;  2D1H A;  3DEU A;  3ERE D;  1MJB A;  2CG4 A;  2LNB A;  3KP6 A;  4ESF A;  1T0F A;  2EJR A;  2HZT A;  4KN7 X;  4MEX F;  3LQR A;  4RS8 A;  2KJC A;  2EWN A;  3IWF A;  5E18 F;  3LA2 A;  5L3E A;  1RIO H;  2JRT A;  4OU0 A;  3F3X A;  2XRN A;  4QWQ A;  4EGY A;  2W25 A;  3IC7 A;  1WI9 A;  4R79 A;  4RB3 C;  2FA5 A;  3R0J A;  4IVN A;  1Z05 A;  1S29 A;  2X0L A;  2IJL A;  4UXN A;  5J6X A;  1J7K A;  2QUF A;  3FZV A;  1IRF A;  2D1V A;  3G3Z A;  1P4X A;  2ZME B;  1R1U A;  4RAY A;  4UNO A;  3RKY A;  2A07 F;  1MZB A;  1L0O C;  4U0Y A;  5D5X B;  1IN7 A;  5FO5 A;  1QQI A;  5FD6 A;  1EV7 A;  2HWV A;  5FB2 A;  1Z7U A;  4M9S A;  1ON2 A;  2UWM A;  3C3W A;  3RKW A;  1IF1 A;  4OMY A;  4G94 A;  2VE8 A;  4GGG A;  3FHZ A;  1DDN A;  4ZZD A;  2MLG A;  2VBZ A;  3H3Z A;  2O0Y A;  2Z99 A;  1FPQ A;  1YYV A;  2LSO A;  4EV0 A;  2TDX A;  4WXD A;  3LA7 A;  4L18 B;  3V7R A;  1Z91 A;  2XAS A;  1ZGJ A;  2NAZ A;  1I1G A;  4H0E A;  1BIA A;  1U6G A;  2FOK A;  2Q8K A;  1MKM A;  3K1P A;  5HS9 A;  4EVI A;  3N97 A;  3GEZ A;  3O2P E;  4KT5 C;  1EH7 A;  1KQ8 A;  2GAU A;  1B1B A;  5F64 A;  3JAM Z;  5D5W B;  1T38 A;  4AWX B;  2L3D A;  4WXC A;  4UUV A;  1PDN C;  4HQM A;  1RNL A;  2OA4 A;  3GUD A;  3E6C C;  4RB0 A;  2ISZ A;  1MGT A;  3WGI A;  3RDI A;  1U5T B;  1ZAO A;  2FML A;  4F7Z A;  2VBX A;  3TOA A;  3GZ6 A;  2HKX A;  5A2Q K;  5D5U B;  3QOP A;  1IXC A;  1ZAR A;  4LK1 F;  2STW A;  1MJ9 A;  5D6F A;  4ON0 A;  2NNY A;  3HSE A;  1GXP A;  1JGS A;  2ESH A;  2VT2 A;  2P8T A;  1SD7 A;  2HEO A;  4R1H A;  1HKT A;  1SD4 A;  3J80 Z;  2IA2 A;  4KUM A;  1O3Q A;  3CO6 C;  3WTX C;  1FNN A;  3MWM A;  1BN5 A;  2Y0M A;  2VOD A;  1HST A;  1PP8 F;  3GVA A;  2ACJ A;  2QZ8 A;  4KYW A;  1K6O A;  4IRH A;  4GXO A;  2QQB A;  3CJN A;  2CW0 F;  4M71 A;  4IRI A;  1U3E M;  4P55 A;  4HQE A;  1LJ9 A;  4OOI A;  2D45 A;  3RJP A;  2R7F A;  1P92 A;  4LFU A;  4OMZ A;  2K7L A;  3E3V A;  2FRH A;  4CGZ A;  5ILV A;  3BOQ A;  3M7G A;  5TJJ A;  4YG2 F;  5TRD A;  1FYM A;  2JPB A;  1IXR C;  2QVO A;  2V79 A;  4LK0 F;  5FLX K;  1QO0 D;  3I59 B;  5LEJ A;  1ONV A;  1KU7 A;  1XGO A;  2ZNZ A;  4Y15 A;  4BHC A;  4G7O F;  1FYK A;  2NYX A;  2MH9 A;  3I64 A;  1R36 A;  2Q0O A;  1OR7 A;  2RV8 A;  4EJO A;  1IAW A;  4LMY A;  1R00 A;  3F8M A;  3MQ0 A;  1EH6 A;  4LG0 A;  4XLN F;  2W24 A;  3JTH A;  2D2W A;  1ZLK A;  2XHK A;  1TLH B;  1LDK B;  2EA2 A;  2VBW A;  5HDG A;  1S6L A;  3QP6 A;  5DCM A;  5HLH A;  5FD5 A;  4G9Y A;  4ZZL A;  5LRS A;  2QBY A;  4XLP F;  2PLY A;  3DQV C;  1IRG A;  3DFG A;  1T6S A;  4Q5S F;  3IHU A;  2Y75 A;  4HF0 A;  4BQA A;  3U1D A;  1HBX G;  3WU0 A;  5HS8 A;  2H94 A;  4KFC A;  3IKV A;  1GXQ A;  4NHJ A;  1SMY F;  3QU6 A;  1W7P B;  2M5W A;  4BXU A;  1K78 A;  1HW5 A;  3WU1 B;  4GYG A;  3L2C A;  1QPM A;  4PCQ A;  1FBS A;  1FSE A;  5EEG A;  3FX3 A;  1UHW A;  2NNN A;  4O6J A;  1RUO A;  4OIP F;  5CVJ A;  3WGH A;  4PDK A;  1R5H A;  3GO5 A;  3T5X A;  3SZT A;  3FMQ A;  2QM3 A;  2CQK A;  5CJ9 A;  2PJP A;  5E8I A;  5ICG A;  3MZH A;  4HDV A;  4CZZ A;  1HW2 A;  4MTE A;  1QNT A;  1O3R A;  4EM1 A;  1UST A;  2FNP A;  2ESN A;  1BM9 A;  2UZK A;  2STT A;  2YU3 A;  3HIF A;  5CLS A;  4EJV A;  1OYY A;  1FBQ A;  2IA0 A;  2H27 A;  4KIG A;  2DO7 A;  2L4M A;  1YIO A;  3WTZ A;  2W85 A;  2EA4 A;  5DV5 A;  5FFZ A;  2QBY B;  2BBY A;  5FGM A;  2ZJ2 A;  1FC3 A;  4XBF A;  4IRG A;  2GZW A;  4PGH A;  1V4R A;  2WC2 A;  4UHT A;  4M6X A;  4I02 A;  1L3L A;  2IPQ X;  1KQ9 A;  5J8C A;  4NB5 A;  3ZP5 A;  4EJT A;  2QEN A;  2IVM A;  3E6B A;  3K2Z A;  2KRF A;  1JE8 A;  3VB2 A;  2QQ9 A;  4IJA A;  2EFN A;  1K78 B;  1TQP A;  2W57 A;  3JW4 A;  1B6A A;  4BAY A;  2FNA A;  2P5K A;  5CVI A;  4RB1 A;  2VON A;  1RZ4 A;  2HR3 A;  2ETH A;  1S7A A;  2DW4 A;  4G8X A;  1CF7 A;  1YW9 A;  3I5U A;  3MAJ A;  2E1C A;  3ABU A;  1LEB A;  1DP7 P;  4HX4 A;  2Z33 A;  3K0L A;  5CVR A;  2ISY A;  4WK8 F;  1I6X A;  4A6D A;  4HAM A;  1F9N A;  3GW2 A;  3TO7 A;  2EV0 A;  1K7A A;  1LDJ A;  4G6Q A;  4YFX F;  3HSR A;  5BMZ A;  3FM5 A;  4AIH A;  2OQR A;  2DBB A;  4LJZ F;  2EV6 A;  1HXD A;  2CO5 A;  1B4A A;  1J59 A;  4ZYG A;  1SD5 A;  5L3F A;  1ON1 A;  4HOB A;  4CXF A;  3T1B A;  5E8G A;  2DQL A;  4RAZ A;  3S2W A;  3SFZ A;  1U78 A;  4WWC A;  1IUY A;  1IN8 A;  2FBH A;  1LDD A;  1J75 A;  3NQO A;  4KMF A;  4YII A;  4G6D A;  2HQR A;  2H6B A;  5H6R A;  2X4H A;  3F21 A;  4GCV A;  3WTU C;  4DQ2 A;  1HQC A;  3L9F A;  4U88 A;  5DEQ A;  5LGU A;  1O3T A;  3GYH X;  1OPC A;  4Y17 A;  2HOE A;  3H3U A;  4YIF A;  3EUH A;  3E97 A;  3IRQ A;  1YG2 A;  5JR3 A;  4UVB A;  1OKR A;  4IPA A;  3CUQ C;  3HRU A;  5HOO A;  4UV8 A;  1R7J A;  2LF8 A;  2FBI A;  1ZRE A;  4A0X A;  3I71 A;  1G3W A;  1XN7 A;  4L0Z B;  3C1D A;  1CF7 B;  2VN2 A;  3I53 A;  4WX9 A;  4D0P A;  2A5Y B;  3R61 A;  1T39 A;  1UHM A;  4LLN A;  4HYE A;  2YX7 A;  2EB7 A;  2P5L C;  3DKW A;  3HUG A;  2HS5 A;  3K1M A;  4Q47 A;  3KCC A;  1SFX A;  2KIU A;  1MJA A;  3KEQ A;  4EJU A;  5DUK A;  5L3C A;  3GFL A;  1BC7 C;  2ZBK A;  4YFK F;  1IW7 F;  5JI6 A;  2DK8 A;  4ESB A;  3CTA A;  2L01 A;  2OQG A;  2PN6 A;  2P5V A;  3NEU A;  3W6J B;  3EYI A;  4AD9 A;  5E20 A;  1Z6R A;  1WKM A;  3E6D A;  5D5V B;  3ELK A;  2K86 A;  1REP C;  3F6O A;  2HDC A;  1D3Y A;  1P2F A;  6PAX A;  1HKQ A;  4DNC A;  3HOS A;  1BI3 A;  3Q9V A;  4Y13 A;  2ZFW A;  5LRR A;  2F2E A;  2IW5 A;  1LB2 A;  2FE3 A;  4ENJ A;  1XB4 A;  1FT9 A;  2NRA C;  2COM A;  4O5V A;  3HRT A;  4HBL A;  4PGG A;  1F1Z A;  1XCV A;  1AWC A;  1TTY A;  3T8T A;  5AIP A;  4HA8 A;  1YQA A;  3V8L A;  4G7Z F;  3GFJ A;  2WWY A;  1QBJ A;  3V7C A;  1Z1D A;  5AON A;  1BBY A;  2ADU A;  4KMU X;  4FX0 A;  4KNY A;  1ZRD A;  4A0Z A;  3LWF A;  2PG4 A;  2R7D A;  3M9A A;  2RGV A;  1A04 A;  4XRF A;  5K5O A;  4A12 A;  4I7H A;  2M1B A;  1J2X A;  2VOP A;  4M74 A;  2XKP A;  2MH2 A;  1HKS A;  1R5G A;  3O6B B;  4R8H A;  3IKT A;  4OIQ F;  4LB5 A;  1STZ A;  4ZYD A;  5BOX A;  3WE3 A;  1F4K A;  2O3F A;  4ASN A;  5F1R A;  3OV8 A;  1ODD A;  4PZJ A;  2CFX A;  2MBF A;  1J9I A;  1R23 A;  5BPD A;  3J7A O;  2V6C A;  3CLO A;  3KLN A;  2ZXJ A;  2PFB A;  3LQQ A;  4U0V A;  1USS A;  3L09 A;  5DCF A;  3RPU A;  4LB6 B;  5K5Q A;  2DQR A;  3F6V A;  3MFK A;  4JK1 X;  3QPH A;  3IL2 A;  1RI7 A;  4MEY F;  1ZLJ A;  1S8N A;  2RC4 A;  3PQJ A;  2LDU A;  1Q1H A;  5JHU A;  1H9G A;  3P9I A;  3K9T A;  5H6Q A;  2QWW A;  3KP7 A;  3ABT A;  3F8N A;  2O61 A;  4LGW A;  1XSD A;  2PMH A;  5KVR A;  2L02 A;  3VOE A;  2IRF G;  2GWR A;  3U2R A;  1TNS A;  2VC0 A;  4XSZ F;  3CDH A;  3JAM K;  4JQF A;  3BRO A;  3KZY A;  3K1N A;  2GXG A;  1MDM A;  5J8F A;  2R3S A;  3VFZ A;  4IF4 A;  2A6H F;  3COA C;  2M45 A;  3I4P A;  2Q2E A;  3H92 A;  3KFW X;  1KGS A;  1BI0 A;  3HOT A;  2KIM A;  2ZKZ A;  4M6Y A;  2RVC A;  4HF2 A;  3LFK A;  1F5T A;  4OIO F;  5BPI A;  3BJ6 A;  4CIC A;  1FOK A;  3HRS A;  1ZHF A;  4I2O A;  2RKH A;  3KP4 A;  2MC3 A;  1RUN A;  3QU3 A;  5LEK A;  1BJA A;  3VEP A;  3BP8 A;  3W6K B;  2IA1 A;  4A2U A;  4B09 A;  3V8J A;  3CO7 C;  2EK5 A;  4MQ9 F;  2ZO4 A;  3DPL C;  2EV5 A;  1FY7 A;  4AVP A;  1C0W A;  3Q9S A;  2WTE A;  3U9G A;  3J80 K;  4XSX F;  1QZZ A;  5LLQ A;  1O57 A;  4HLY A;  3F22 A;  2AS5 F;  2PMU A;  5E17 F;  4A5M A;  1MD0 A;  3I54 A;  1O7F A;  3WTT C;  2XUB A;  4U7D A;  2OZU A;  1EH8 A;  3SQN A;  4E70 A;  3NRV A;  5L3G A;  3KET A;  2AXL A;  1B59 A;  2OD5 A;  5BS6 A;  4MNU A;  2M30 A;  2CWE A;  3HHG A;  3KE2 A;  2XRO A;  2K4B A;  3J81 Z;  4UV9 A;  5HDN A;  2FSW A;  3KEO A;  1W5S A;  3TKY A;  2W84 A;  2DPU A;  1G3T A;  4L9J A;  1PP7 U;  3GF2 A;  4KIC A;  3T0Y A;  5K1Y A;  1DPU A;  2JSC A;  4L0Y B;  3BJO A;  5CYV A;  1CGP A;  1HSJ A;  4LG0 B;  3DV8 A;  1G6N A;  4CDG A;  2GXB A;  3FM3 A;  2HTJ A;  3LST A;  3F23 A;  1XMK A;  3GZ5 A;  4N9I A;  1U5T C;  4GO1 A;  4M9X A;  2F5C A;  2RDP A;  3F8C A;  4P96 A;  3JTG A;  5HS7 A;  3FF5 A;  4FT8 A;  1FP2 A;  1YO5 C;  4HF1 A;  2M8E A;  5DCM B;  3TO9 A;  2WV0 A;  2DLL A;  2FBK A;  2K02 A;  1OYI A;  3ZQ7 A;  2RQP A;  3RYR A;  1FZP B;  2QYO A;  1KYW A;  1J0R A;  4AIJ A;  1IN6 A;  3BJA A;  3IWZ A;  3FWE A;  2UXN A;  5ERI A;  2MLK A;  1VTN C;  3EQL F;  2YSR A;  3ZMV A;  5D4S A;  4RGS A;  3TDU C;  5BQT A;  3HRM A;  3JSP A;  3GFM A;  2P6S A;  3L00 A;  2RN7 A;  2B0L A;  4YFN F;  4I01 A;  5LHG A;  1SAX A;  3SXY A;  3L7W A;  2DK5 A;  2HTS A;  2FEZ A;  5AIQ A;  1I27 A;  3SHF A;  1XD7 A;  1FBU A;  2EFW A;  2G7U A;  3ZMD A;  4O3M A;  5EEH A;  5D4R A;  3ROU A;  1TQI A;  3RI4 A;  1ULY A;  4A6E A;  2DPD A;  3HTU A;  3B73 A;  3G73 A;  2LF7 A;  1PUE E;  2FQ3 A;  3ZN0 A;  4ZYE A;  5DUI A;  2A3S A;  2C6Y A;  2QQA A;  5D8L B;  2O6G E;  4EMS A;  4BNC A;  2HQN A;  4G7H F;  1H0M A;  4I0A A;  3TGN A;  1S7O A;  2YPR A;  4WXH A;  1LEA A;  1E2X A;  2XAJ A;  2DAO A;  1UB9 A;  3B02 A;  1KU9 A;  3HTS B;  2CSO A;  1D5V A;  2RNJ A;  1G3S A;  4I09 A;  4B8X A;  4RB2 C;  5LHH A;  2DU9 A;  3IRR A;  4N9H A;  1NHA A;  1DPR A;  4HX7 A;  4EGZ A;  1P4W A;  4ENM A;  1P6R A;  1I5Z A;  3AAF A;  3BWG A;  1WRJ A;  3ISP A;  4EQQ A;  3ZPL A;  2A61 A;  2MD5 A;  3RPQ A;  1X3U A;  3BDD A;  2ELH A;  3WTV C;  1HW1 A;  5L3D A;  3EET A;  2XGX A;  2DT5 A;  4L9N A;  2YR2 A;  1XSX A;  2V1D A;  2XKO A;  5A2Q Z;  3I0T A;  3V7S A;  1WQ2 A;  2HYF A;  4MHG A;  1ZG1 A;  4IXA A;  3WTS C;  2V1X A;  4A0Y A;  2Z9O A;  1AOY A;  2FMY A;  1U5T A;  4BHB A;  4HW0 A;  1T2K A;  2NS0 A;  3M1E A;  5E1Z B;  3E5Q A;  3V4G A;  3GX4 X;  3HHH A;  4CHU A;  4UVA A;  1TW2 A;  2BGC A;  1SFE A;  2YX4 A;  1O7L A;  5DD4 A;  1IXS B;  3E5X A;  4LLG F;  1FP1 D;  2XAG A;  3WOD F;  5IT9 K;  1FYL A;  5LGN A;  1KU2 A;  3ML6 A;  4BH9 A;  2QLZ A;  1W7P D;  3GFI A;  2FXA A;  2IP2 A;  3PQK A;  2GA1 A;  4S04 A;  1QGP A;  3LAP A;  3QP5 A;  1K79 A;  1YS6 A;  3K69 A;  1R58 A;  2ZCW A;  3D0S A;  2CYY A;  3FMS A;  2FF4 A;  2J5O A;  2XIG A;  1E17 A;  4GYI A;  1WWX A;  5ILS A;  1BIB A;  1FLI A;  5K5R A;  1T98 A;  1R22 A;  2BEO A;  1XSV A;  3T8R A;  4N0B A;  4RGU A;  4QLC U;  1G4D A;  4MTD A;  5HLI A;  2G9W A;  4UVC A;  5F6F A;  3ZMT A;  1B9M A;  5ILU A;  1KA8 A;  2M87 A;  3O3K A;  5FLX Z;  3RKX A;  4M72 A;  2GQQ A;  3R60 A;  1LNW A;  4LD5 A;  2DTR A;  2XAF A;  1IZ1 A;  2GA2 A;  2MA3 A;  2ZNY A;  2F5E A;  2VXZ A;  5D8K B;  3LA3 A;  2P4W A;  3WTY C;  1U2W A;  3I58 A;  4L9V A;  4P9F A;  2P7C B;  2XAQ A;  1BI2 A;  2K27 A;  3EYY A;  3HSF A;  3I59 A;  5JFR A;  5DYM A;  3ZN1 A;  3ECO A;  2OU2 A;  4EM0 B;  2E7W A;  4TV7 A;  4K2E A;  1XDS A;  1BC8 C;  2Z5U A;  3DXJ F;  5ICE A;  3TO6 A;  4BYY A;  1SD6 A;  2JZY A;  2VE9 A;  4CYD A;  4EJW A;  2L4A A;  2K4J A;  1OMI A;  1I1S A;  3KP2 A;  3TDZ C;  5E1W A;  4ENN A;  1SFU A;  1UFM A;  5E1X A;  1GHC A;  2V1U A;  3R6S A;  1D8J A;  1OYW A;  3CUQ A;  1JHH A;  3QRF F;  3V8K A;  2EFQ A;  1XGS A;  3WTW C;  4S05 A;  1SMT A;  4LLL A;  1XDU A;  1J5Y A;  4M9Z A;  2PI0 A;  2FU4 A;  2H09 A;  3DPT A;  3EDP A;  4Q48 A;  1KU3 A;  3QAH A;  5DD8 A;  1W7P A;  4P5O A;  4A5N A;  2VBY A;  1H9T A;  2OAZ A;  5IT3 A;  4MQV A;  2BE5 F;  2DI3 A;  3HYI A;  4ZYH A;  3F8F A;  3LAJ A;  1S3J A;  3FXR A;  3KP3 A;  1YS7 A;  4HDU A;  3JSO A;  5DDG A;  4KN4 X;  2L54 A;  2O8X A;  2XVC A;  2OBP A;  2XV4 S;  4ZH4 F;  1P4A A;  3CUO A;  4FX4 A;  3N4M A;  2HKO A;  1BI1 A;  5HDK A;  4HLX A;  4WCG A;  4ENK A;  2VT3 A;  2PEX A;  1LVA A;  3D5L A;  2DFI A;  4IHT A;  5ED4 A;  1TNT A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...