2DK8A

Solution structure of rpc34 subunit in rna polymerase iii from mouse
Total Genus 16
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
16
sequence length
81
structure length
81
Chain Sequence
GSSGSSGPDADPVEIENRIIELCHQFPHGITDQVIQNEMPHIEAQQRAVAINRLLSMGQLDLLRSNTGLLYRIKDSGPSSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Translation
molecule keywords DNA-directed RNA polymerase III 39 kDa polypeptide
publication title Solution structure of rpc34 subunit in RNA polymerase III from mouse
rcsb
source organism Mus musculus
total genus 16
structure length 81
sequence length 81
ec nomenclature ec 2.7.7.6: DNA-directed RNA polymerase.
pdb deposition date 2006-04-06
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 2dk8A01
1UB9A 4ESFA 3V8LA 2ZMEA 2A6EF 4Q47A 1R00A 2DW4A 3TO9A 2QBYA 3TKYA 3MQ0A 1IZ1A 1DPRA 5JHUA 3LQQA 5HLHA 3E6BA 2QQ9A 5IT9K 3R0AA 1FBQA 1ZHFA 1YFHA 3EUHA 3ZMDA 3BWGA 2XKPA 2YX7A 1YLFA 2FEZA 3CUQB 2F2EA 3F3XA 4A6DA 3C18A 3WTXC 4MNUA 3KETA 1HKQA 2DLLA 1QGPA 1QNTA 3U1DA 3V8JA 2LSOA 3FWEA 4UV8A 5D8KB 1ZH5A 1Z6TA 2EB7A 3WU0A 5FLXK 2ZFWA 4LB5A 1WQ2A 5D5XB 1QZZA 3VFZA 2GZWA 2A6HF 1DP7P 5LHGA 2QUFA 3BPXA 5DDGA 1CF7B 4FT8A 1HW5A 3ZMUA 1OR7A 4IRIA 3ML6A 4BHPA 4ZH4F 3IWZA 1HXDA 2GAUA 1BI1A 2MBFA 3FMQA 1UFMA 3VB2A 1FBSA 2ADUA 1XSDA 3JTHA 3BZ6A 2RNJA 4OMYA 2EFQA 2V1DA 4G6DA 4R8HA 3SQNA 2IA0A 2DO7A 2Y48A 1L3LA 3IRQA 5DD8A 5JI6A 1KQ0A 1JHHA 5DD4A 4G7OF 2A5YB 1I6XA 1LEAA 4Y15A 1FSEA 3IRRA 3WE2A 1R1VA 1HKSA 3F6VA 4ON0A 1MD0A 3EYYA 3RPUA 3Q9SA 4L5IA 3KP2A 1YW7A 3JSOA 3JSPA 4L0ZB 5A2QK 4EGZA 1BM9A 3HRTA 3E3VA 3F22A 1NHAA 2K7LA 1YS7A 4ENMA 2QZ8A 2O61A 3CUOA 5FB2A 2XAHA 1EH6A 2YR2A 3CO7C 1Z9CA 4M9ZA 1SFXA 4Y17A 4HLXA 2GIVA 2FNAA 2OZUA 1Z91A 2XUBA 1G3WA 5E1WA 4JQFA 2H27A 1XSVA 2C6YA 3O3KA 2RV8A 3ZQ7A 2BE5F 2KJBA 5ICFA 3IC7A 1O3QA 5DUKA 1IF1A 2WWYA 4LGWA 5DCFA 2CO5A 1HW2A 5CVJA 2LDUA 2L02A 5DUIA 3BROA 2PJPA 2L01A 3K9TA 3P9CA 4HQMA 5HLIA 1BIBA 1WWXA 4KFCA 2ISZA 2M1BA 1O3TA 1LEBA 1SD5A 3ERED 2NNNA 2HEOA 4KYWA 4QLCU 3E97A 2V1UA 3JAMZ 1E17A 5DV5A 5D5VB 2E1NA 4LFUA 3ABUA 5EEHA 4IHTA 4CICA 3BJOA 2G7HA 2VONA 3T1BA 2Y75A 5K5RA 4EM1A 4UVCA 1ZGJA 4HBLA 4A6EA 1W7PA 2FU4A 4RAYA 4XSZF 2DFIA 2L3DA 4IPAA 1OYIA 2VBYA 3S2WA 3JW4A 4HF1A 4I0AA 1SAXA 1U5TB 3ISPA 4MEYF 4U88A 2RC4A 3HYIA 1SMTA 4CHUA 3HOTA 1S3JA 2DAOA 4P5OA 2QLZA 1O7LA 4L0YB 1TTYA 3CJNA 1P6RA 1FBUA 2CSOA 2XV4S 4KIGA 2HR3A 3GZ6A 3GYHX 1ZAOA 2HS5A 3GXOA 4GGGA 1OYWA 3K1NA 4K2EA 1FP1D 5E18F 1LJ9A 1CGPA 2FMLA 5BOXA 5HLGA 4EJOA 1O7FA 3Q9VA 3L7WA 3FX3A 1Z1DA 1A04A 4OIRF 3RI4A 3RKXA 3VEPA 4EM0B 2JPCA 1TQMA 3QAHA 2NYXA 3QOPA 3BY6A 3KLOA 2XIGA 4LK0F 3HRUA 1QPMA 4UVBA 4BHCA 3M8EA 1DPUA 2E7XA 3MZHA 2M5WA 1TQPA 2ZMEB 3V7CA 4WX9A 2XAJA 2W24A 3FF5A 3ZN0A 1ZREA 2QBYB 4RGXA 5J6XA 2STWA 1YW9A 5JR3A 2FE3A 1ULYA 1ZRFA 3RYPA 2JRTA 5ICGA 5CVRA 3BP8A 4MGRA 4M9SA 1UHWA 2JT1A 3ZMTA 5DEQA 3DQVC 3LQRA 2VE8A 4FX4A 1FWZA 4HW0A 3TDZC 2F5FA 3MZYA 2DK8A 3QRFF 1YW8A 1FYMA 2QQBA 4KIBA 1HW1A 2ZNYA 5HS9A 2O03A 3GLXA 4OOIA 4L9NA 1FSHA 1BIAA 3LAPA 2FBKA 4LLLA 1IXSB 3F8NA 1XMAA 1K79A 4LG0B 3DFGA 3COAC 1YYVA 1MJ9A 4ZYEA 3QPHA 2AS5F 4KDPA 5LEJA 4KIFA 4P9FA 4M72A 2DI3A 5J8FA 2GXBA 4HX8A 3KE2A 2RQPA 3FM5A 1B6AA 2J5PA 5E1XA 3CO6C 4PGHA 2NS0A 3GUDA 1YTYA 1Q1HA 5EEGA 2JPBA 2CQKA 4HLYA 2QM3A 5FD5A 3ZMSA 4ESBA 1T2KA 2M45A 2HDCA 1S7AA 3W6JB 1X3UA 2DQLA 5DCMB 1B9MA 2DT5A 1ZN2A 2EV0A 2Z3YA 2IA1A 4IF4A 3HRMA 3HSRA 2IA2A 3RTRA 3F8CA 3GZ5A 3I4PA 2RN7A 1FT9A 4BNCA 2ELHA 4QWQA 2ACJA 2PG4A 1G3TA 1F1ZA 5CJ9A 5ERIA 5ILSA 4ZZDA 2Z5UA 1YIOA 4I2OA 1S6LA 3RKWA 3WG9A 1QO0D 4B8XA 2X4HA 2ZKZA 2HTJA 1ON2A 2JZYA 3ZMZA 1LVAA 4RB3C 3GX4X 5CVVA 5D8LB 2R7DA 1KQ8A 5HVQC 1H9TA 3V7SA 1OKRA 2DQRA 1O57A 2GA1A 2XHKA 2W57A 3HTSB 1KQ9A 3WTYC 4AIKA 3K0LA 2A61A 3DPTA 1W5SA 3K1PA 2Q0OA 2HZTA 2DK5A 1IAWA 5E8GA 2K86A 4HF0A 3BJAA 4M9XA 4LLGF 2WC2A 4P9UA 5L3CA 1TLHB 1XSXA 4KMFA 2VODA 5F64A 2PMUA 4U0YA 2VT3A 4ZZLA 1WRJA 4KN4X 2P5LC 3SFZA 2IP2A 3R0JA 5ICCA 5E20A 3M8FA 1LNWA 5FGMA 1O3SA 1H9GA 3HHGA 1J75A 2H6CA 1J59A 2XVCA 2ZNZA 4M73A 5L3FA 3D5LA 2KIUA 5H6QA 3RKYA 2V9VA 3M9AA 3T0YA 4MTEA 1P92A 4HQEA 3H3UA 1B59A 5LRRA 2ZBKA 1MGTA 4N9IA 1JXSA 2EJRA 4OIPF 5H20A 4G6QA 3TQNA 2ZCWA 2EFNA 3MFKA 2VBWA 5K5QA 4HYEA 4XSXF 3KZZA 2FNPA 2P6SA 4EJUA 3E5XA 2NAZA 4P96A 3TGNA 3N97A 1F5TA 2P8TA 1P4AA 1C0WA 1W7PB 4HDVA 2UWMA 1XGSA 4IRGA 2QVOA 1RI7A 4LB6B 4OIQF 2KJCA 1I1SA 4LMYA 4L9TA 1EV7A 1TW2A 1D8JA 3I58A 2F5CA 5LGNA 1U78A 2K27A 5LHHA 4HV5A 2P7CB 4B09A 1K78B 3GWZA 4EJWA 5K1YA 3J80Z 2D1VA 2XKOA 1FYLA 3RDIA 1R23A 2YX4A 2W85A 3P9KA 1B4AA 3FMSA 4BYYA 1XB4A 2HGCA 3R60A 2QWWA 6PAXA 4CYDA 4N0BA 3LSTA 1MJBA 5CYVA 4HV6A 3E5QA 5L3BA 1ZARA 4PZJA 5D6EA 3LFKA 4I98B 1OPCA 2F5DA 2RKHA 3IHUA 4NHJA 4YFXF 3IKVA 2HFHA 1KU9A 5L3DA 3L2CA 2MH9A 3IWFA 3I71A 4EV0A 1RNLA 3RPQA 1R58A 1JGSA 1SD6A 1IUYA 2PN6A 3P7NA 4XBFA 2UXXA 5TJJA 3DF8A 2L54A 1AOYA 2GA2A 2PQ8A 2GXGA 3DPLC 4FHTA 2M8EA 2OD5A 3DKWA 2AXLA 1YQAA 2DPDA 4CDGA 5D5WB 1PP8F 2ZO4A 1PUEE 1XGNA 3MEXA 2VBXA 5LGUA 5HOOA 2OQGA 4IHSA 1DDNA 4KUMA 2O8XA 4U0WA 2K4JA 3R4KA 4I09A 1FZPB 4OIOF 1HBXG 3KP5A 2VC1A 4OMZA 2IVMA 2MLGA 1J2XA 1W5TA 5F6FA 4I02A 3V4GA 5BS6A 1YO5C 1TW3A 3BPVA 4LD5A 1TBXA 4HAMA 3FXQA 2FA5A 3OV8A 1HKTA 1Z05A 3L09A 4EJTA 5CVUA 2UZKA 2XROA 2O0YA 3AAFA 2EA4A 3ABTA 2H09A 1HSJA 2J5OA 1BBYA 3GO5A 3FHZA 4EJVA 1QZYA 2L4AA 2O3FA 2P7VB 2ESHA 4DQ2A 2Y0MA 2FSWA 2BBYA 3VODA 4G94A 3F8BA 2H6BA 3Q5FA 1FLIA 2CG4A 3WTZA 4CO8A 3FXRA 1BOAA 5FFZA 4A0ZA 5BPDA 1R1UA 1LDJA 2HKXA 4RGRA 4RB0A 2IPQX 1YS6A 4WCGA 1OYYA 3F21A 1UHMA 1UCRA 4GYIA 4UNOA 1SD7A 2HQNA 1RIOH 3JAMK 3V8KA 5D4RA 4ESJA 2VOPA 1MDMA 3G73A 4UXNA 4YIIA 4OU0A 3GVAA 4L18B 4PCQA 4UVAA 4LK1F 4IXAA 4R1HA 4UV9A 2WTEA 1F4KA 4I0BA 3TOBA 5LEKA 1I1GA 1KU3A 2MH2A 3J7AO 3EDPA 4UUVA 4CXFA 1PP7U 3KP4A 2HKOA 3TOAA 3F23A 3F72A 4MQVA 1VTNC 4NB5A 2UXNA 2XAFA 3ZP5A 4ENNA 1B1BA 3WE3A 4S05A 2WV0A 4HDUA 3EYIA 3ULQB 2ZXJA 1F9NA 3QU3A 3REOA 1U8RA 1D5VA 2COMA 2W25A 4A5NA 2V1XA 5D4SA 3MAJA 2HYFA 2FXAA 5FO5A 1LB2A 3C7JA 2R7FA 2IT0A 3NEUA 3BOQA 3RYRA 1B9NA 2B0LA 4ETSA 4RGUA 2M30A 2OA4A 2M87A 2P6TA 2Q2EA 3N4MA 3K69A 1T6SA 1P2FA 5IT3A 3QP6A 4RAZA 2Z9OA 3GEZA 4EM2A 2HWVA 1G4DA 2KKOA 2BGCA 3LAJA 4YIFA 3HRSA 1IW7F 4P55A 3DP7A 3KEOA 2EV6A 2FOKA 1P4XA 3I53A 2XGXA 4OINF 4M6YA 1SD4A 3MCZA 1WI9A 1J9IA 3I0TA 2PFBA 5E17F 2KRFA 3GF2A 3J81K 5ED4A 2Q8KA 3R6SA 1OMIA 1Z7UA 4YFNF 5BPIA 2QYOA 3R61A 3CLOA 2MLKA 5DYMA 2P4WA 4XLNF 3ROUA 3WTWC 4WWCA 3KP7A 4MHGA 2E7WA 3DEUA 2BEOA 5IT9Z 2A68F 3HHHA 3GFLA 1XD7A 5ILUA 1GXPA 3CTAA 4CZZA 2Z33A 3FZVA 3KCCA 1R22A 3LWFA 2OQRA 2A69F 2IJLA 1ODDA 4Q48A 3ZN1A 3WTVC 3V7RA 2W84A 3ECOA 4KT5C 1S29A 4R79A 1XDUA 4YG2F 2IRFG 1MZBA 4G7ZF 1JHFA 1IN7A 3WTTC 3KP6A 3M7GA 1J7KA 2DTRA 4U7BA 4CGZA 3T5XA 3B02A 3I59A 5FLXZ 2CGPA 3M1EA 1G3SA 1YG2A 4BAYA 2D2WA 3T8TA 1ZRCA 1R5HA 3IKTA 4N9HA 1ZLKA 4A0XA 4IJAA 2Z99A 1LQ1A 3ELKA 5FFXA 2VE9A 1WSUA 2RDPA 2HTSA 5D6FA 5AIQA 2K4BA 3CUQC 4G9YA 3LA3A 1ZYRF 2R3SA 4G7HF 2F5EA 2KIFA 2EFPA 3SZPA 1S8NA 4EGYA 4M71A 3WTUC 4L9JA 5LGTA 1ZG5A 4TV7A 4E70A 4RS8A 1O3RA 2K02A 1P4WA 1TNSA 1PDNC 4IRHA 4WXHA 4LLNA 1FC3A 5KK1A 2V79A 1IXCA 1JE8A 3BJ6A 4G8XA 2OZ6A 5TRDA 3TO7A 4LG0A 3H92A 3HSEA 1BC8C 4RB2C 5CLSA 1I27A 1BN5A 5A2QZ 2GQQA 4AWXB 1IN8A 2LF7A 4BHBA 2KIMA 4AIHA 2FRHA 4BQAA 1IXRC 2DPUA 1KYWA 4I7HA 3GFJA 4YFKF 3RIRA 1R5GA 4LJZF 5ILVA 3HUGA 4EVIA 4HX7A 5ICEA 2E1CA 2XRNA 2VXZA 3LA7A 5DCMA 3FMRA 2D1HA 4L5JA 1IRFA 3HIFA 2PI0A 1G3YA 1T0FA 1XCVA 1BI2A 1TNTA 2V6CA 1U2WA 5HS7A 1W4MA 5BQTA 2ESNA 1MDMB 3QP5A 2NNYA 4XRFA 1KU2A 3W6KB 3WGHA 1R36A 4A2UA 2CFXA 5HDGA 5LBQA 1AWCA 1U3EM 3RJPA 1T38A 1MKMA 4Y13A 1FX7A 2CW0F 3WGIA 4H0EA 2VN2A 5HDKA 3SHFA 4KA4A 3ECHA 3GFIA 4Q5SF 3U9GA 1BI0A 2EV5A 2STTA 1KGSA 4F7ZA 2QQAA 3DXJF 4KNYA 3J80K 4GO1A 2OBPA 2ETHA 2ZJ2A 4O3MA 1ONVA 4HX4A 4A5MA 4BH9A 1ZG3A 4GYGA 2XAGA 2EK5A 2FQ3A 1I5ZA 2NRAC 1Z6RA 1QBJA 2HYGD 3MWMA 2P5VA 3T8RA 5J8CA 4PGGA 1XGOA 2DU9A 1W7PD 3DV8A 1ZG1A 1R1TA 1FNNA 1MJAA 5LLQA 1SFEA 3F6OA 1ZGAA 4I01A 3WU1B 2FMYA 4KMUX 4M74A 3IL2A 2VC0A 1USTA 3SZTA 5BMZA 2JTVA 2QENA 1HQCA 1WKMA 1ON1A 1IN4A 4WK8F 3ZMVA 3BDDA 1ZRDA 1XDSA 3CUQA 5L3EA 5L3GA 3K1MA 1FYKA 2YU3A 2EWNA 3WTSC 3KEQA 3PQKA 2P5KA 1KA8A 1GXQA 1U5TC 2EFOA 2PMHA 1RUNA 4AVPA 1V4RA 5FD6A 3P9IA 1REPC 4KICA 3I64A 2X0LA 2DBBA 3NQOA 2MC3A 2G7UA 3G3ZA 3L9FA 1RUOA 2O6GE 1CF7A 4HA8A 5LRSA 4RGSA 3PFIA 3I54A 4NQWA 4FX0A 4KN7X 2LNBA 1BI3A 5E8IA 1Y0UA 4AD9A 1L0OC 3HOSA 2MA3A 4ZYGA 5JFRA 5LHIA 3WODF 4O6JA 2PEXA 1K78A 1TQIA 3QPTA 4WF2A 1HSTA 3EETA 1USSA 4MEXF 5H6RA 3E6DA 4O5VA 4ENJA 5HDNA 1FP2A 5JVTA 3I59B 2YPRA 3F8MA 2VBZA 1XGMA 3B73A 2A3SA 2BV6A 2CWEA 1V3FA 1STZA 2LKPA 4Z2YA 1J0RA 1RZ4A 3WGGA 3KLNA 5AIPA 2EA2A 2OU2A 3GW2A 2YSRA 4PDKA 2BYVE 4ZYHA 3F8FA 3CDHA 4WXCA 3C1DA 4GCVA 4EQQA 1EH8A 2PBIA 1D3YA 3E5UA 3KFWX 1FY7A 4JBAA 4MTDA 3TO6A 3NRVA 2H94A 1E2XA 2VOOA 4S04A 1LDDA 1IRGA 1BJAA 2XASA 1IN6A 1SFUA 2FBIA 2FBHA 1R7JA 4BXUA 2D45A 2IW5A 4A0YA 3J81Z 2RGVA 4D0PA 4HF2A 3L00A 2PLYA 4Q4ZF 1SMYF 2FF4A 2EFWA 3D0SA 3OOPA 1S7OA 2TDXA 4ASNA 3SXYA 1U6GA 1IN5A 4GXOA 3E6CC 1K6OA 5HS8A 1J5YA 3HSFA 3O2PE 3H3ZA 4JK1X 2ISYA 3TDUC 2LF8A 4U0VA 1GHCA 5CVIA 1BC7C 3PQJA 4ZYDA 5KVRA 1H0MA 2MD5A 1T39A 1XCBA 1XMKA 3KZYA 4A12A 5D5UB 3HTUA 4DNCA 3FM3A 1EH7A 5K5OA 3QU6A 3C3WA 1T98A 2OAZA 4MQ9F 3GFMA 2A07F 4UHTA 1G6NA 4RB1A 4XLPF 4ENKA 3K2ZA 1FPQA 4HZFA 5E1ZB 3U2RA 4EMSA 1XN7A 1D8KA 3LA2A 1U5TA 1K7AA 2RVCA 1FOKA 1KYZA 3KP3A 2VT2A 4HOBA 1KU7A 3VOEA 2XAQA 3EQLF 4AIJA 2L4MA 1LDKB 5AONA 2CYYA 2HQRA 1GVJA 3O6BB 4U7DA 4L9VA 4WXDA 2JSCA 2GWRA 4M6XA 5F1RA 3I5UA 1DUXC 3ZPLA 2G9WA 2HOEA 3FXUA 1ZLJA 4IVNA 1QQIA 3E6MA 3JTGA
chains in the Genus database with same CATH superfamily
1DU0A 2ZSIB 1UB9A 2IS4A 2CS3A 3V8LA 4ESFA 3K4CA 1V55H 2VPRA 2ZMEA 2A6EF 1P7IA 4IHXA 1W5CC 4Q47A 1YOVB 4BEHB 2M4GA 2I8DA 2XDVA 2BVMA 1KZHA 3CQZJ 1R00A 2DW4A 3GZNB 2Y30A 3TO9A 3FXKA 4QTRA 2NVYJ 2QBYA 3TKYA 4IHVA 3MQ0A 5GADJ 2ZXHA 1IZ1A 5M3MJ 1OQYA 3ZQLA 4GFBA 3OYNA 1DPRA 5JHUA 1J09A 3ZGKA 3A0HC 3LQQA 5HLHA 3N05A 3E6BA 4DBQA 2QQ9A 2PMZA 3DEWA 5IT9K 3R0AA 1Z0XA 1FBQA 1V5FA 1ZHFA 1YFHA 3EUHA 4DJAA 4C2UA 4YELA 2E60A 3ZMDA 4B3AA 1WJBA 3HKZN 3BWGA 5BNGA 4U87A 2Y31A 2XKPA 4BUPA 1RRJA 5CQEA 2YX7A 1OCPA 2XF7A 1SAUA 2ZC2A 1IUFA 1YLFA 5CPRB 4QSHA 2FEZA 3BR1A 3CUQB 2F2EA 2V1NA 3F3XA 3AKZA 1GT0C 4A6DA 3C18A 3WTXC 4MNUA 3KETA 2VJ5A 1HKQA 1MMAA 1MNEA 3C2BA 1TWGJ 2DLLA 1QGPA 1QNTA 1UAAA 3U1DA 4CCJA 3V8JA 5EGOA 2LSOA 3FWEA 4JX4A 4UV8A 3PIPF 1MBJA 5D8KB 1ZH5A 3KPHA 5EJCA 1Z6TA 2EB7A 5J40A 1SC7A 4E7KA 1T56A 3WU0A 2L9NA 2ZFWA 2DA2A 5FLXK 2A6TA 1Y8RB 5EDNA 4LB5A 4ZJZA 1WQ2A 5D5XB 1QZZA 2RREA 3CESA 1QRYA 3VFZA 2GZWA 2A6HF 1DP7P 2HNHA 5LHGA 2QUFA 1MSEC 3MZ8A 3BPXA 1JGGA 4DYQA 2QF7A 5DDGA 1CF7B 1X2NA 1Z3XA 3OS1A 3RPUD 4FT8A 1E3PA 5JLWA 1ETYA 3OYFA 1HW5A 3ZMUA 3GTOJ 2EZLA 1OR7A 4I6ZA 4NQWB 4IRIA 1U0JA 3ML6A 4BHPA 4ZH4F 1VZ0A 3IWZA 1HXDA 2GAUA 3O8HA 1BI1A 2MBFA 3FMQA 1UFMA 5E3NA 3H0DA 1A6QA 3DTKA 3VB2A 1FBSA 2ADUA 1QHGA 2VKEA 5C4XJ 4ZYAA 2CUJA 1XSDA 1Y0NA 3F9KA 4RLFA 4UUSB 3JTHA 3MD2A 3BZ6A 2RNJA 1D0XA 4OMYA 2EFQA 4HG2A 2E2HJ 1QU3A 1SFKA 2DDBA 2V1DA 4G6DA 4R8HA 4XOTA 3SQNA 4M3FA 2IA0A 2DO7A 2Y48A 4JX5A 4LG3A 1L3LA 3IRQA 3OMYA 2IGKA 3OYEA 3WHCA 3OYHA 5DD8A 5JI6A 4E7HA 4B47A 1KQ0A 1JHHA 2WY8Q 2IGMA 2FX0A 5DD4A 4G7OF 2A5YB 1I6XA 4CH7A 1LEAA 1AKHA 4Y15A 1FSEA 3IRRA 4DYCA 2IGNA 2ME0A 3WE2A 1R1VA 2CJJA 2XSDC 1HKSA 2M2EA 3F6VA 3I55I 3ESWB 4ON0A 3GTJJ 1MD0A 5J1UA 3EYYA 3E0JB 3RPUA 2BHYA 3Q9SA 4L5IA 3KP2A 3L1PA 4CUGA 2XGCA 1YW7A 3JSOA 3C2GA 2M8GX 3JSPA 4DBRA 1UG0A 1Y56A 4L0ZB 5A2QK 4EGZA 2JUGA 5J1RA 4IKFA 1BM9A 4XK4A 3FXOA 5LD2C 3HRTA 4E6KG 3E3VA 3F22A 2X1EA 1NHAA 1JTXA 2K7LA 1YS7A 3FHNA 5HODA 4ENMA 1I50J 2QZ8A 2O61A 3Q0UA 4PSWA 3CUOA 1Z3YA 2ELKA 5FKOA 2XAHA 1EH6A 5FB2A 2YR2A 3MVPA 3RSNA 3CO7C 1Z9CA 2CQXA 4RM2A 4M9ZA 1SFXA 1R4MB 2CUEA 4Y17A 4HLXA 3GMEA 2GIVA 2FNAA 2OZUA 2LRDA 1Z91A 2XUBA 1VF9A 2IXSA 1G3WA 5E1WA 1RR7A 4JQFA 2K85A 2H27A 4D5CA 3GTQJ 1XSVA 2LKSA 3TL4X 1V5EA 1VQKI 2JVGA 4PJMA 2F48A 2C6YA 3O3KA 2RV8A 3RQ4A 3ZQ7A 2BE5F 5EZGA 1ACIA 1BL0A 2KJBA 3SEZA 3WG7H 4DZPA 5ICFA 3IC7A 3ZR8X 4BJ6C 1O3QA 3VYRB 4HNVA 2LYCA 5DUKA 1IF1A 2WWYA 2DYRH 3CP8A 4LGWA 4BQOA 5DCFA 5DM7F 3MN2A 2CO5A 3CCYA 1HW2A 2Q2EB 5CVJA 2KLOA 1WFXA 1SEUA 4BL0B 2DOAA 2LDUA 2R7ZJ 2L02A 5DUIA 3BROA 2PJPA 2L01A 3K9TA 1WGXA 3P9CA 4KT6A 4HQMA 1OJLA 2VI6A 3HL2A 2M3AA 3PNTA 2TCTA 5HLIA 1BIBA 1GV5A 2E35A 1WWXA 4KFCA 2ISZA 2M1BA 1O3TA 2DA6A 2QSGX 1LEBA 3UR3C 1SD5A 2L7MP 3HJEA 3ERED 3G4SI 2NNNA 2MYSA 2HEOA 4KYWA 4QLCU 3E97A 2V1UA 2JA8J 5F27A 3GTKJ 2CH0A 2G0EA 3JAMZ 1E17A 4BDYA 5DV5A 4AIDA 2K9LA 5D5VB 1JKRC 1XTAA 2E1NA 1K61A 1W36C 5HNHA 3CC7I 4LFUA 3B6AA 1AHDP 3ABUA 5EEHA 4AYBA 2QSHX 3MKWB 2EIKH 1TWHJ 4IHTA 2VB6A 4CICA 4RDUA 3BJOA 2G7HA 2VONA 4Z6YA 3T1BA 3G71I 4UY8I 2A5WA 1MIJA 2Y75A 3PNYA 4XONA 2NVUB 1Z7LA 5K5RA 4EM1A 4UVCA 1QVUA 1ZGJA 4HBLA 1MH3A 4BQQA 4A6EA 3M4OJ 1W7PA 2FU4A 1VQ8I 1YITI 3W6VA 4RAYA 4XSZF 2DFIA 2L3DA 4IPAA 3S1QJ 1OYIA 2VBYA 3S2WA 3JW4A 4HF1A 4BJ5C 4F52A 4I0AA 2I5UA 1SAXA 1U5TB 3ISPA 4MEYF 2JWTA 1Z67A 2YS9A 4QPQA 5KCMA 4U88A 2W1OA 2X85A 1JKQC 4AM3A 1MBFA 2RC4A 3HYIA 1S9HA 1SMTA 1RPWA 3EPZA 4CHUA 5FKLA 3HOTA 1S3JA 2DAOA 1ETXA 4P5OA 2JK3A 2QLZA 1O7LA 1U8BA 4L0YB 1TTYA 4XKCA 3CJNA 2R5YB 2E1MB 1P6RA 1FBUA 2CSOA 2E5ZA 3K4NA 2XV4S 3OR1C 3VSLA 4KIGA 2HR3A 3GZ6A 1NG6A 4RAFA 2M0MA 1ZAOA 2HS5A 3GYHX 1VQOI 3GXOA 3OL4A 4GGGA 1OYWA 1Q1VA 3K1NA 3A2KA 3CF2A 1FP1D 4K2EA 1LJ9A 5E18F 1CGPA 2FMLA 5BOXA 4A3DJ 4X1EA 5HLGA 4EJOA 1O7FA 3Q9VA 3L7WA 3FX3A 5F0CA 3GTMJ 5KAFC 1Z1DA 1A04A 4OIRF 1I3QJ 3RI4A 2PMZN 4D7NA 3RKXA 1K83J 3ZQFA 2EQRA 2BXZA 1TT5B 3VEPA 4EM0B 2K5CA 2JUCA 2JPCA 3IAM2 1TQMA 2NS7A 3QAHA 4ABZA 2NYXA 3QOPA 3BY6A 1LE8A 2VUMJ 4M6VA 1BR1A 3KLOA 2XIGA 5H2FC 4LK0F 3HRUA 1QPMA 4UVBA 4BHCA 1OCTC 4HPQA 3M8EA 1DPUA 2E7XA 2WADA 4AVZA 3S32A 3OYMA 4J19A 3CLQA 3MZHA 2M5WA 4IOCF 1DP3A 1TQPA 2ZMEB 3V7CA 1A5JA 4WX9A 5IOYA 2XAJA 4ZDLA 3HOVJ 2W24A 3JRGA 3FF5A 3ZN0A 1YHQI 3QYEA 1ZREA 2QBYB 4RGXA 5J6XA 3CDIA 2DFHA 2STWA 3I3LA 3CC4I 1YW9A 2L9SA 5JR3A 2FE3A 1ULYA 2ZXWH 3BG6A 4ZTJA 1ZRFA 3CJRB 2P0WA 2JRTA 3RYPA 5ICGA 2LKXA 5CVRA 3BP8A 5GPCA 4MGRA 1XS9A 4M9SA 1UHWA 2JT1A 3ZMTA 4A3CJ 5DEQA 1X1CA 3DQVC 1ETOA 4XRSA 3AG2H 3LQRA 2VQHA 5DM6F 1HCRA 2VE8A 1VQ9I 4FX4A 5FRNA 3HOYJ 2DA4A 1FWZA 4HW0A 3TDZC 2F5FA 4Y33A 1QHHD 3K7AJ 4C3HJ 3MZYA 2E71A 3TW6A 2DK8A 3QRFF 3BCBA 4BJTA 1YW8A 3E1SA 4MFDA 4AU7A 1FYMA 2QQBA 2WB1N 1JI8A 1D1BA 4KIBA 1HW1A 2ZNYA 4ANJA 2KRHA 2XPWA 3BQYA 5HS9A 1D5YA 1RC9A 2O03A 3GLXA 4OOIA 4L9NA 4M3DA 1FSHA 1IRXA 2COBA 1YJ9I 1TWCJ 2KMUA 1BIAA 3LAPA 2FBKA 4FASD 4LLLA 1IXSB 3F8NA 1XMAA 1K79A 3WHBA 2MGQA 2L9VA 4LG0B 3DFGA 1OCZH 2IGOA 2LC2A 1YYVA 2FJ1A 4CYCA 1MJ9A 3COAC 4IZZA 1TZLA 4ZYEA 3QPHA 2AS5F 3S3MA 4CCKA 3BTJA 4KDPA 2RNGA 2KL4A 3G1MA 5LEJA 3TMOA 4KIFA 3AL0C 4P9FA 4M72A 3ABMH 2DI3A 1YE9A 2DXIA 5J8FA 2GXBA 4HX8A 3KE2A 1G2HA 4M3GA 1X3ZB 2RQPA 3FM5A 1B6AA 2J5PA 1ZR4A 3IAS2 5E1XA 1X3WB 3CO6C 3HM5A 4PGHA 2NS0A 3ZQGA 3BT9A 3GUDA 1Q1HA 4XOPA 2JPBA 5EEGA 1YTYA 1IC8A 3BQZA 3HUGB 2CQKA 4HLYA 2QM3A 5FD5A 3ZMSA 4ESBA 1T2KA 2M45A 2HDCA 1S7AA 3W6JB 1PJRA 3I4MJ 1X3UA 2DQLA 4V19K 5DCMB 1B9MA 4XORA 2DT5A 1ZN2A 2EV0A 4IQ4A 4XKBA 1SVMA 2HVRA 3OSGA 2LY9A 2Z3YA 2KZGA 1U9OA 2IA1A 2V26A 1P7JA 4IF4A 3HRMA 3HSRA 2IA2A 3WU2C 3RTRA 3F8CA 3GZ5A 1FJLA 3I4PA 2RN7A 4PFPA 3JREA 1FT9A 3FXJA 4BNCA 4E7LA 2ELHA 4QWQA 3K4BA 2ACJA 2PG4A 1G3TA 3HDDA 1F1ZA 5CJ9A 5ERIA 5ILSA 3CJQB 5M5YJ 3Q0VA 4ZZDA 1AKHB 2Z5UA 1YIOA 3FBNB 3VYTB 1F36A 5IY5H 2CW7A 1S6LA 3RKWA 4I2OA 3WG9A 1QO0D 2JN6A 1CQTA 4RAGA 3PUBA 4B8XA 2X4HA 1IV8A 2VKDA 2ZKZA 2HTJA 1ON2A 2JZYA 4YIRX 3JRBA 5FRMA 1LFUP 3ZMZA 1LVAA 2NVTJ 3ZOBA 4CCLA 3MKYB 2X48A 3DWLE 3SDBA 1IRZA 1N77A 1D0ZA 4RB3C 3GX4X 4F55A 5CVVA 4LIVA 1MBEA 5D8LB 2R7DA 1KQ8A 5HVQC 1H9TA 4CA0A 1TT0A 1OKRA 3V7SA 2DQRA 4CCMA 4XM3A 1O57A 2JA2A 2GA1A 2HDDA 2XHKA 2W57A 3ASOH 1KQ9A 3HTSB 3WTYC 4AIKA 3K0LA 2A61A 2MW8A 1H88C 3DPTA 2P81A 5EG0A 1W5SA 1T8IA 3K1PA 2Q0OA 5IYBJ 2HZTA 2DFEA 1FTZA 4A3BJ 2DK5A 1IAWA 5E8GA 2K86A 4HF0A 3BJAA 4M9XA 4X6AJ 3PO2J 4LLGF 2WC2A 2L7KA 4Y4RA 5B3SH 3JRFA 4P9UA 5L3CA 1TLHB 1Y1WJ 1G59A 2B63J 2ICWG 1XSXA 3LSPA 4KMFA 2VODA 5FJ8J 3AG3H 5F64A 4BDZA 2IS6A 2PMUA 4U0YA 2X1CA 4RMNA 5DTDA 2VT3A 4ZZLA 1WRJA 4KN4X 3G6EI 2P5LC 3SFZA 2IP2A 3SYTA 1NK2P 3R0JA 5ICCA 3K2AA 2NOJB 5CQGA 5E20A 1ZR2A 1FOXA 3M8FA 1LNWA 2R7VA 1HA8A 3DBHB 1LVKA 5FGMA 4JOMA 1O3SA 2M0CA 1H9GA 3A1YA 3H5AA 2RAEA 3IUOA 3HHGA 2CV0A 2R5ZB 1J75A 3TW7A 2H6CA 2LD5A 4IHWA 1MBGA 3JRIA 2BY1A 1HDPA 3W3CA 1J59A 2BY0A 2XVCA 4XRMA 2ZNZA 2AQEA 2OPTA 4M73A 5EF6A 2CV1A 5L3FA 3D5LA 2KIUA 3LSJA 4N4OB 2DJNA 1MMDA 5H6QA 3RKYA 3DLLF 1WJDA 2CRGA 2V9VA 3M9AA 3T0YA 3H1CA 4MTEA 5C3EJ 1DU6A 1P92A 4D1QA 4HEA2 2XPUA 3ERMA 4HQEA 2EILH 3H3UA 1B59A 5LRRA 2ZBKA 1MGTA 3KEYA 4W97A 4N9IA 1JXSA 3LSHA 1X4OA 2Y2ZA 2LH9A 2EJRA 1IV6A 1ZK8A 5E3OA 2V9KA 2DOEA 4OIPF 5H20A 1VFCA 4G6QA 3TQNA 2ZCWA 2EFNA 3MFKA 2VBWA 4IL6C 5FLVA 5K5QA 3C2HA 4HYEA 3H35A 4XSXF 2H1KA 5IOZA 3KZZA 2FNPA 2P6SA 4EJUA 3E5XA 2NAZA 4P96A 3TGNA 3N97A 1F5TA 2VJIA 2P8TA 2ECCA 4HNTA 3K4KA 1P4AA 3HXLA 1C0WA 1W7PB 4HDVA 1ZGWA 3CMYA 2OCCH 3CMMA 5FKKA 2UWMA 1XGSA 1PUFA 4IRGA 3D5RC 2XGDA 2HOTA 5GPAA 3PO3J 2QVOA 1RI7A 4LB6B 4OIQF 4EATA 2KJCA 4H4KC 1MW7A 1I1SA 3H5RA 4LMYA 4L9TA 1EV7A 1TW2A 1O4XA 1D8JA 3W2VA 4J01A 1DGRM 2F5CA 3HEFA 3I58A 1A35A 5LGNA 1U78A 2K9NA 4NUBA 2K27A 5LHHA 4HV5A 2P7CB 2CV2A 4B09A 4A3MJ 1K78B 3GWZA 4EJWA 5K1YA 3J80Z 3QYBA 2D1VA 2DFFA 2XKOA 1FYLA 3RDIA 1R23A 2QGUA 2YX4A 4G12A 4BY7J 2W85A 3P9KA 1B4AA 2QKLB 3FMSA 2NVQJ 4BYYA 1XB4A 2XGEA 1OCOH 2YUSA 2HGCA 1S72I 3R60A 2QWWA 6PAXA 1VQ5I 2ZB9A 4LITA 3OOUA 4CYDA 1FOYA 4N0BA 3LSTA 2O7OA 2H8RA 2HOSA 2LLKA 1B8IB 1MJBA 2K9SA 5CYVA 4HV6A 3E5QA 2XB0X 5L3BA 1ZARA 2DOFA 1V5GA 3S3NA 4PZJA 2QCOA 5D6EA 3LFKA 4I98B 1R49A 3M07A 1VQ6I 4A3IJ 1YIJI 1OPCA 2F5DA 2RKHA 3A01B 1F43A 1OCCH 3ABLH 2KISA 2MFZA 3IHUA 3SDGA 4NHJA 4YFXF 3IKVA 2HFHA 3ZQCA 1KU9A 5L3DA 3L2CA 2MH9A 3IWFA 5HNFA 3FDYA 3LSMA 3I71A 1BW6A 3OIOA 4EV0A 2KQRA 1RNLA 1LFPA 2CQQA 4JYKA 1N75A 4NC8A 3RPQA 1R58A 1QA6A 1JGSA 1SD6A 3ZQIA 3H3VK 1IUYA 3LFUA 2PN6A 2W7NA 3P7NA 3JRCA 3BTCA 4XBFA 2UXXA 2XF6A 5TJJA 2Y0SN 3DF8A 5M5XJ 2L54A 2JA7J 3QQAA 3DBRB 1AOYA 2ZXIA 3G1LA 3S1RJ 1YRNA 4GRIA 2GA2A 2PQ8A 2GXGA 3DPLC 2WAFA 3ZQQA 4FHTA 2M8EA 2OD5A 3DKWA 2VQCA 2IEKA 5JHFA 2HYJA 2AXLA 3FISA 3H0GJ 1YQAA 2DPDA 4M3BA 3GTLJ 4I76A 4CDGA 2OUMA 5D5WB 4CCNA 4BE0A 5C44J 3IH3A 2IS1A 2R7UA 1PP8F 4RBOA 2ZO4A 4BBRJ 1PUEE 3CCMI 1XGNA 1ENHA 3MEXA 2RQQA 4HSRA 2VBXA 4NBQA 2Z1DA 3CCUI 3S1MJ 3S2HJ 2HZDA 5LGUA 4BKXA 5HOOA 2IBDA 2XPVA 2ID3A 3DTIA 2OQGA 4IHSA 1JUSA 2ZFUA 3DPUA 1DDNA 4KUMA 2HPIA 2O8XA 4U0WA 4B4CA 2K4JA 4L5EA 3BC8A 5B1AH 3R4KA 4BE2A 5IYDJ 4I09A 1FZPB 4BEHA 4OIOF 5GAGJ 1HBXG 3QOEA 3KP5A 1UELB 2VC1A 2ECBA 1M1EB 4OMZA 2IVMA 3HC7A 2MLGA 4XLEA 1J2XA 4MIMA 1W5TA 4IEJA 5F6FA 4I02A 3V4GA 5BS6A 1EKEA 1LKXA 1TW3A 1YO5C 3BPVA 2OJED 4LD5A 4A3FJ 3QPSA 2BXYA 2R4GA 1TBXA 2L7ZA 4HAMA 1GLNA 3FXQA 1OLTA 2FA5A 3EUKL 3OV8A 3CMAI 1HKTA 3DKYA 1Z05A 3TBIA 3L09A 4EJTA 5CVUA 1A36A 2CQNA 3CDLA 2UZKA 4PFOA 2XROA 3I4NJ 2AQFA 2O0YA 3AAFA 2EA4A 1FOWA 2AHQA 4BBSJ 3ABTA 2H09A 3HPGA 3TEDA 1HSJA 2J5OA 1BBYA 3GO5A 3RQIA 2KIQA 3FHZA 2R0QC 4EJVA 1B72A 1FMVA 1QZYA 2L4AA 4HRIA 2H8WA 2O3FA 2X6OA 2MSYA 2P7VB 2ESHA 4DQ2A 1R6RA 2Y0MA 2DT7B 2JRMA 2FSWA 4OAZA 2BBYA 1VI0A 3H9JA 3VODA 3G2BA 4II3A 2O9LA 4G94A 3F8BA 2H6BA 2L2OA 3Q5FA 1FLIA 3HGGA 2KFDA 4CSWA 2CG4A 1S7EA 3WTZA 4CO8A 2E36A 3FXRA 1JUMA 1BOAA 5FFZA 4A0ZA 1AU7A 2N8GA 1MSFC 2UV1A 2QA4I 5BPDA 3I56I 1R1UA 1LDJA 1MNMC 2HKXA 4RGRA 3K6GA 4RB0A 2IPQX 1YS6A 2LTPA 2DN0A 4WCGA 4C3IJ 4BGDA 4KJZA 1OYYA 3F21A 1UHMA 4RLQA 2HQ5A 2ZJRF 5KNLA 2FUG2 1UCRA 4GYIA 4MFEA 3LL7A 4UNOA 3QWLA 1SD7A 4AUXA 3Q0WA 3K4MA 2CW8A 5FKMA 4BE1A 1RKTA 3ZXSA 2KZVA 2HQNA 1VQ4I 4G6TB 2CUZA 1RIOH 3BR3A 3JAMK 4IQJA 3V8KA 5D4RA 4ESJA 2VOPA 2XF5A 3TP3A 2WBMA 3G73A 1MDMA 4UXNA 1ETQA 4ITVA 1H8AC 1VNDA 2X51A 2LG4A 4LIUA 2LY2A 4YIIA 4OU0A 2YU9J 4BXXJ 3CZ6A 4PSXA 1MBKA 3GVAA 5FROA 4L18B 4PCQA 1YI2I 3D5SC 4UVAA 4LK1F 4IXAA 3K70C 5B5EC 1ERDA 4R1HA 3BG5A 4UV9A 2HXOA 2WTEA 1W1WE 1DGWY 1F4KA 4I0BA 1BA5A 4KITB 3TOBA 4XL9A 5LEKA 1I1GA 1ETKA 1KU3A 5F1JA 4FQGA 2MH2A 1U9NA 3OYBA 3J7AO 3EDPA 4UUVA 4CXFA 2WA0A 5IP9J 2W82A 1ETWA 1PP7U 3KP4A 3S1NJ 3L2WA 2HKOA 1R71A 3TOAA 2I10A 3F23A 1ZTRA 2BVLA 3HB9A 3F72A 1PVEA 1QVTA 4MQVA 4X0GA 1VTNC 4A93J 1JT0A 3BLYA 4NB5A 3GTPJ 1UG2A 2UXNA 3HBLA 2XAFA 1I39A 3ZP5A 4ENNA 1B1BA 3WE3A 4S05A 2O5RA 2WV0A 4FISA 2DA1A 4HDUA 3EYIA 3ULQB 2ZXJA 1F9NA 3QU3A 3REOA 4BY1J 3AG4H 5EGOB 2DMTA 1U8RA 1D5VA 2COMA 1XPXA 2FOWA 4XMYA 4B3XA 2W25A 4A5NA 3HOZJ 3PM1A 3RKQA 2V1XA 1I6HJ 5D4SA 3MAJA 2HYFA 5F0FA 4W1UA 2FXAA 5FO5A 1LB2A 3C7JA 3DTEA 2R7FA 2IT0A 3NEUA 1E0EA 1ORKA 3BOQA 3RYRA 5J4YA 5GAHJ 1Y1VJ 1B9NA 1WJ5A 3E7LA 2R7SA 2B0LA 3ASNH 4ETSA 4RGUA 1Z21A 3G1OA 1WH5A 2MD0A 2KDZA 1EA3A 2M30A 2GLOA 1FTTA 2BY3A 3JR9A 1JKPC 3FKJA 2OA4A 2LY1A 1WJAA 3FXLA 2M87A 1BJZA 2P6TA 2Q2EA 3N4MA 3K69A 2NVXJ 1T6SA 1P2FA 1NK3P 5IT3A 3QP6A 4RAZA 4F92B 2Z9OA 1ETVA 3GEZA 4EM2A 2HWVA 5EYRA 4V2GA 1G4DA 2KKOA 2BGCA 3FK7A 2OF7A 3LAJA 4YIFA 1ZELA 3HRSA 3SEQA 1BOBA 1I3AA 4FTHA 5FLMJ 5K7FA 1IW7F 4P55A 1T0FC 3DP7A 1JTYA 3KEOA 2EV6A 1K4SA 2FOKA 3VWBA 1P4XA 3I53A 2EZIA 1MMGA 3CP2A 2XGXA 1UMQA 4OINF 4M6YA 1LUJB 3RZOJ 2KP6A 4EEFG 1SD4A 3MCZA 1WI9A 3QYFA 3FK6A 4A3JJ 2KT0A 2F4MB 4IX7A 1J9IA 1Y39A 2M7AA 1MH4A 3I0TA 5M3FJ 3D1NI 1UHSA 2PFBA 2W4SA 4D5FA 5E17F 2KRFA 3GF2A 3J81K 1VQNI 5ED4A 2LP0A 2Q8KA 3R6SA 3OYGA 1OMIA 1Y8QB 1Z7UA 4B44A 3BG7A 4YFNF 5BPIA 2QYOA 3R61A 3CLOA 2DT6A 3IP4B 2MLKA 5DYMA 1HF0A 2P4WA 3LMMA 4XLNF 3DCFA 1TC3C 3ROUA 3WTWC 4WWCA 2R7WA 3KP7A 4MHGA 4PUSA 2E7WA 3DEUA 3S93A 1TWFJ 2CQ7A 4XQFA 2BEOA 5IT9Z 1GV2A 1TL8A 2A68F 1Z77A 3HHHA 3X2QH 3GFLA 1XD7A 5ILUA 4XIDA 1GXPA 3CTAA 2LOOA 3JRDA 4CZZA 2Z33A 3FZVA 3SZGA 3ZCOA 3LSRA 3KCCA 1R22A 3LWFA 1RKWA 2OQRA 2A69F 4OAYA 1RESA 3K70D 2IJLA 1IDZA 1ODDA 4Q48A 3ZN1A 3WTVC 3V7RA 2X6WA 1T08B 2WY7Q 3KX2A 2W84A 3ECOA 4KT5C 2H1LA 1S29A 4R79A 3L2VA 1XDUA 4YG2F 2IRFG 3PUFA 1YRNB 4A69C 2MG4A 1MZBA 4C3JJ 4G7ZF 4N4NB 1JHFA 3IV5A 4NC7A 1IN7A 3WTTC 2L0KA 3KP6A 1X1PA 1DQUA 3M7GA 5E3MA 1J7KA 2DTRA 2Q1ZB 4U7BA 4CGZA 2HVSA 4D7MA 3T5XA 4FCYA 3B02A 2EIMH 3I59A 5FLXZ 2CGPA 3M1EA 1A6IA 1G3SA 1RR8C 3OIPA 4FE4A 2R92J 1GUUA 2R7OA 5IP6A 3L2QA 2IS2A 1YG2A 4BAYA 2D2WA 4IHYA 3T8TA 1ZRCA 2IAIA 1R5HA 3IKTA 4N9HA 1JT6A 1ZLKA 1E3HA 4A0XA 4AYBN 1R5ID 4IJAA 3GTGJ 2Z99A 4BQNA 1LQ1A 2B9SA 3ELKA 2O8KA 5FFXA 1K4TA 1X4PA 2VE9A 1WSUA 2RDPA 2HTSA 3S14J 2L7FP 5D6FA 5AIQA 2K3PA 2DMNA 2DTZA 2K4BA 3LSKA 2BY2A 3CUQC 4RA2A 4G9YA 3S15J 3LA3A 3MMYB 2Y9ZA 1ZYRF 1NH3A 1K6YA 4E4HA 4E7ZA 3A02A 1XC5A 1BW5A 3DEEA 2R3SA 2HU9A 3PFYA 2CFOA 2EH3A 2K40A 4G7HF 2F5EA 2DMPA 2KIFA 2EFPA 4YEJA 1LFBA 1MMSA 2GOXB 4XLAA 1S8NA 4PJLA 3SZPA 4XRSG 3L2RA 2HPMA 4EGYA 4PJNA 1R4NB 4M71A 1X58A 4AC0A 3WTUC 4L9JA 4UB6C 3UKGA 4A3EJ 2KPMA 5LGTA 1ZG5A 4TV7A 4E70A 2F5VA 3OWTA 4RS8A 1O3RA 3PIOF 2K02A 4KISA 1P4WA 2AXTC 4NNJA 2OCEA 2BW3A 1TNSA 1PDNC 4IRHA 4WXHA 4LLNA 2M4KA 1FC3A 2VL8A 4C9YA 3DKXA 5KK1A 2V79A 3S2DJ 3LNQA 4A3KJ 3BG3A 1IXCA 1JE8A 2LBFA 3BJ6A 1B72B 3FIWA 3M3YJ 4G8XA 2OZ6A 5TRDA 1X1DA 5K7ZA 3LOCA 4E7IA 1BR2A 1OISA 3TO7A 2MC4A 3KIOA 4ZC3A 4LG0A 4C2MJ 3PJRA 3H92A 3HSEA 1BC8C 4RB2C 3M1CA 5CLSA 3SFIA 1I27A 3HPHA 4J00A 1BN5A 5A2QZ 2GQQA 3CC2I 2DCEA 2ZJQF 4AWXB 1IN8A 3Q3SA 2DA7A 1APLC 2OC6A 3A03A 2LF7A 4BHBA 1KONA 2KIMA 3GLLA 4AIHA 4QPOA 2FRHA 3A4CA 4BQAA 1IXRC 2WB1A 2DPUA 1KYWA 4ZTFA 1HLVA 2R7XA 3NWTA 4I7HA 3PSFA 3GFJA 4YFKF 3RIRA 1R5GA 4LJZF 3ZQHA 5ILVA 1N78A 1JUPA 3HUGA 4EVIA 5J4VA 3QODA 4LOCA 4HX7A 3FKIJ 2LR8A 3HZJA 5ICEA 2WAEA 2XC7A 2E1CA 1SVOA 2XRNA 2VXZA 3LA7A 5DCMA 1RETA 3FMRA 4P1WA 2D1HA 4BACA 1YJWI 3KYCB 4F93B 3H9QA 3VDXA 4L5JA 5B66C 3BTIA 1LE8B 2MABA 1IRFA 3HIFA 2PI0A 1WI3A 1G3YA 4V2FA 1T0FA 1XCVA 2ID6A 3W2WA 4ZDPA 2DODA 1BI2A 1TNTA 3A0BC 4PJ0C 2V6CA 1VQPI 2D5VA 1U2WA 2EBIA 1FMWA 1TWAJ 3MKLA 5HS7A 1W4MA 1X1AA 1MNDA 5BQTA 1IJWC 2OTJI 2ESNA 1MDMB 4PK4A 4DYRA 1OFCX 3QP5A 2NNYA 3DU5A 2DJIA 4XRFA 3ABKH 2OV7A 1KU2A 1T33A 3W6KB 1AA7A 1POGA 3WGHA 1R36A 4A2UA 3CMEI 2CFXA 5HDGA 5LBQA 1AWCA 1U3EM 3RJPA 4M3EA 3PSIA 1T38A 5KAIC 1MKMA 1WVRA 5JVGF 4Y13A 3W2AA 3P5JA 3LSIA 1FX7A 2CW0F 3WGIA 4Y7NJ 4H0EA 2VN2A 2X6YA 4XKVA 2KHMA 1SVLA 1HDDC 5HDKA 3SHFA 4KA4A 3ECHA 3L2UA 2PX9A 3OYLA 4II2A 3GFIA 4Q5SF 2EIJH 3U9GA 4NDLA 5GAEJ 1WCMJ 5JLXA 2VLAA 1BI0A 2X6XA 1XX5A 2XRLA 5GP9A 2EV5A 1JKOC 4C2TA 2Z2SB 2E2JJ 3BZKA 2STTA 1KGSA 4F7ZA 5F04A 2QQAA 3DXJF 4KNYA 3BR0A 2LMDA 3J80K 4GO1A 2JVHA 2OBPA 2ETHA 2ZJ2A 4O3MA 1ONVA 2PJRA 2BZTA 4HX4A 3ONQA 4A5MA 1E3OC 2NOGA 5EZHA 3SJMA 2NS8A 5GTIC 2XAUA 4BH9A 2K3FA 2HXIA 1FIPA 1ZG3A 4GYGA 1V54H 2XAGA 2EK5A 1HC8A 4CYCB 2LREA 2FQ3A 1I5ZA 2R7QA 2NRAC 2V4JC 2X1DA 5CKTA 1Z6RA 1QBJA 2HYGD 3MWMA 5IYCJ 2P5VA 3T8RA 5J8CA 4PGGA 1XGOA 2DU9A 2E5NA 2V6EA 1W7PD 3DV8A 3CCRI 1ZG1A 1R1TA 3H5NA 1S5LC 2WV1A 1FNNA 1MJAA 2VQGA 1SFEA 5LLQA 3F6OA 3CCVI 3OYIA 1ZGAA 4I01A 3WU1B 4UB8C 2FMYA 2WAQA 3H9GA 2DDAA 4KMUX 4M74A 4HNUA 3IL2A 2VC0A 2F4OB 3DBLB 3J7AY 1USTA 2QSFX 3SZTA 4F91B 5BMZA 2JTVA 2QENA 4F3QA 1HQCA 1WKMA 3VPRA 1ON1A 2R5ZA 2FQ4A 1IN4A 4WK8F 4Y52J 2Y69H 3BTLA 3FXMA 1WJCA 3ZMVA 3S16J 2ZSHB 3BDDA 3CCLI 1X1BA 1ZRDA 1D0YA 3LSGA 4BS9A 2K9QA 4FETA 1XDSA 3CUQA 5L3EA 5J3LA 1ZKGA 5TGTA 5L3GA 3K1MA 3OY9A 1VQLI 3OYKA 1VQMI 1WZ2A 1FYKA 2YU3A 1Y6IA 2X9DA 2EWNA 4GDFA 3QPLA 3WTSC 2VPLA 3KEQA 2FD5A 3PQKA 4JP0A 2P5KA 1KA8A 4MO7A 2GM4A 3H36A 1GXQA 1U5TC 2VKHA 2EFOA 2PMHA 5DS9A 1RUNA 2E2IJ 4AVPA 1V4RA 3HGYA 5FD6A 3P9IA 3JCUC 4DGWB 1A31A 1REPC 2VQLA 4KICA 3I64A 1WH7A 2GOMA 2DBBA 2X0LA 3BR2A 3NQOA 3EUAA 2MC3A 2B7EA 4DIQA 2G7UA 3PL8A 3G3ZA 3L9FA 1RUOA 2E1MC 3BZCA 1XG1A 2A05A 2JQ7A 4CZCA 2O6GE 3HKZA 1CF7A 5EEAA 1YX5A 2HVQA 4HA8A 5LRSA 3OYDA 2DA3A 3HOXJ 2R93J 4RGSA 3B6CA 3PFIA 3I54A 4NQWA 4BXFA 4FX0A 4KN7X 2LNBA 4ZDOA 1BI3A 1P9QC 5E8IA 4B1RA 1Y0UA 2VKVA 4AD9A 5K7HA 3KYLA 1GDTA 1L0OC 3HOSA 1JJ8C 2R7TA 2MA3A 4ZYGA 1QPIA 5JFRA 1R9TJ 5EG0B 2HDWA 2E19A 5LHIA 3WODF 5F0HA 4O6JA 2PEXA 1K78A 1VQ7I 3ZRGA 1TQIA 3QPTA 4WF2A 4UUTA 3CCQI 4UUSA 1HOMA 1WJEA 1HSTA 3OL3A 3EETA 2VXDA 1USSA 2DMUA 4MEXF 1GVDA 3S3OA 1OCRH 1D1AA 3DLAA 2ME6A 2XB5A 2ZMEC 3IH4A 5H6RA 5E79C 3E6DA 1MBHA 4O5VA 5KHDA 4ENJA 5HDNA 3CCJI 1FP2A 3AFHA 5JVTA 3I59B 2YPRA 3F8MA 2VBZA 1XGMA 3HG9A 3B73A 3OSFA 1YJNI 2GXAA 3O8GA 3FBIB 1B8IA 2A3SA 2M9HA 5FKNA 2BV6A 2CWEA 3HOWJ 1V3FA 2R7RA 2CMPA 2ZJPF 1STZA 2LKPA 4Z2YA 4S0HB 1J0RA 1RZ4A 4FE7A 3WGGA 4XLCA 4DZJA 3MKZA 3A01A 3KLNA 5AIPA 2VASA 2CU7A 2EA2A 2OU2A 3EUHC 2LK2A 3GW2A 4Y3OA 2YSRA 4PDKA 2JJ7A 1W0TA 3GCMA 2BYVE 2V9PA 4XLHA 4ZYHA 4DOZA 3F8FA 3OS2A 3CDHA 4WXCA 3BCAA 3C1DA 4XN3A 2HQAA 3PNVA 3U1KA 4GCVA 4EQQA 4XNFA 1TP4A 2E34A 1N25A 2DA5A 1EH8A 1SFOJ 5B1BH 2PBIA 3CCEI 1D3YA 3E5UA 1UJ8A 1FIAA 1EF4A 1BR4A 2NXNB 1FEXA 3KFWX 1FY7A 4JBAA 2JA5J 4E7SA 3JRHA 4MTDA 3TO6A 3NRVA 3S8PA 1UZCA 1E2XA 2H94A 4S04A 2VOOA 1LDDA 1IRGA 4C30A 1BJAA 3OR2C 2XASA 1WPKA 1IN6A 1SFUA 2FBIA 2FBHA 2L5QA 2GIZA 1R7JA 4CCOA 3BR5A 4BXUA 2D45A 1W0UA 2IW5A 2HI3A 4A0YA 3J81Z 2W00A 1IO2A 2RGVA 2TRTA 3UNGC 2BW3B 4D0PA 5IP7J 4HF2A 3L00A 2M34A 4XLFA 2PLYA 3CF5F 3BR6A 1X19A 4BU2A 4XR6A 4Q4ZF 2KRCA 1SMYF 2K9MA 2FF4A 4QIWN 5LFAA 2EFWA 2LVSA 2DYSH 2LBFB 3U21A 1OR7C 3D0SA 3OOPA 3J7ZI 3OIQA 1S7OA 1IGNA 3KYDB 1PUFB 1XMXA 2TDXA 4ASNA 2VJJA 2EINH 3SXYA 1U6GA 1IN5A 1IDYA 2QEXI 4GXOA 2OTLI 1W36D 2Y0SA 3E6CC 2EZKA 4OWRB 2EPFA 1K6OA 3F0CA 5HS8A 1J5YA 3HSFA 3O2PE 3H3ZA 4JK1X 4E7JA 9ANTA 2ISYA 5GTHC 3TDUC 2LF8A 3K10A 4U0VA 2KDOA 3OYJA 1EJ9A 2Y9YA 2EZHA 5E3LA 1GHCA 5CVIA 1H89C 3RZDJ 4JX6A 1BC7C 1X2MA 1D1CA 3PQJA 4MLOA 5KVRA 2V7FA 4ZYDA 3AL0B 1H0MA 2MD5A 3BG9A 4D9JA 1T39A 1XCBA 1XMKA 3KZYA 3OS0A 4A12A 3AG1H 5D5UB 2DMQA 3HTUA 4XKWA 4DNCA 2JA6J 1YX3A 2JSPA 3FM3A 4HSTA 5J47A 1SANA 2CUFA 3RCOA 1EH7A 3OYCA 3NARA 2UUZA 4I99C 5K5OA 3QU6A 3C3WA 5J1YA 3DU6A 3GBGA 2HOAA 3V42A 1T98A 2OAZA 5C4JJ 1WJFA 3CCSI 4MQ9F 1WHUA 3GFMA 2A07F 4UHTA 2BHZA 1G6NA 4B43A 2AO9A 1ZQ3P 4RB1A 3JRAA 4XLPF 4ENKA 3K2ZA 1FPQA 3M8JA 4RM3A 2LFBA 4HZFA 5E1ZB 3VYUB 1ITYA 4B48A 4DW6A 3NAUA 1NTCA 3U2RA 4EMSA 3IH2A 3OYAA 3S17J 1XN7A 1D8KA 3LA2A 1U5TA 2M7BA 1K7AA 2RVCA 1FOKA 2VIXA 3VYSB 3CD6I 2QQ8A 5TISC 3J7YJ 1KYZA 3KP3A 1T95A 2VT2A 2QKMB 3I9V2 2R5YA 4HOBA 2ELJA 1KU7A 4NC6A 2L9RA 3CJTB 4A3GJ 3VOEA 3VSKA 2XAQA 2E1OA 1G8XA 3EQLF 3HOUJ 4AIJA 2L4MA 2JMWA 4PJJA 1LDKB 4XN0A 1LPQA 5AONA 3KZIC 2CYYA 4IOAF 3NWSA 4YRVA 2WAQN 1QZEA 3K4LA 2XSJC 2HQRA 1GVJA 2GBYA 2Z16A 2W48A 5M5WJ 3O6BB 4U7DA 4L9VA 4WXDA 1IG7A 2BOLA 5IPAA 1JJ6C 4A3LJ 1NG7A 2JSCA 2F6CA 2GWRA 4M6XA 3TP0A 3I5UA 5F1RA 2PJRB 5HLTA 1DUXC 4XICA 3ZPLA 1MMNA 2G9WA 2HOEA 3FXUA 4IO9F 1PYVA 1ZLJA 2F4IA 5F08A 2VJ4A 4IVNA 1QQIA 3E6MA 3K4JA 3JTGA
chains in the Genus database with same CATH topology
1UB9A 4ESFA 3V8LA 2ZMEA 2A6EF 4Q47A 1R00A 2DW4A 3TO9A 2QBYA 3TKYA 3MQ0A 1IZ1A 1DPRA 5JHUA 3LQQA 5HLHA 3E6BA 2QQ9A 5IT9K 3R0AA 1FBQA 1ZHFA 1YFHA 3EUHA 3ZMDA 3BWGA 2XKPA 2YX7A 1YLFA 2FEZA 3CUQB 2F2EA 3F3XA 4A6DA 3C18A 3WTXC 4MNUA 3KETA 1HKQA 2DLLA 1QGPA 1QNTA 3U1DA 3V8JA 2LSOA 3FWEA 4UV8A 5D8KB 1ZH5A 1Z6TA 2EB7A 3WU0A 5FLXK 2ZFWA 4LB5A 1WQ2A 5D5XB 1QZZA 3VFZA 2GZWA 2A6HF 1DP7P 5LHGA 2QUFA 3BPXA 5DDGA 1CF7B 4FT8A 1HW5A 3ZMUA 1OR7A 4IRIA 3ML6A 4BHPA 4ZH4F 3IWZA 1HXDA 2GAUA 1BI1A 2MBFA 3FMQA 1UFMA 3VB2A 1FBSA 2ADUA 1XSDA 3JTHA 3BZ6A 2RNJA 4OMYA 2EFQA 2V1DA 4G6DA 4R8HA 3SQNA 2IA0A 2DO7A 2Y48A 1L3LA 3IRQA 5DD8A 5JI6A 1KQ0A 1JHHA 5DD4A 4G7OF 2A5YB 1I6XA 1LEAA 4Y15A 1FSEA 3IRRA 3WE2A 1R1VA 1HKSA 3F6VA 4ON0A 1MD0A 3EYYA 3RPUA 3Q9SA 4L5IA 3KP2A 1YW7A 3JSOA 3JSPA 4L0ZB 5A2QK 4EGZA 1BM9A 3HRTA 3E3VA 3F22A 1NHAA 2K7LA 1YS7A 4ENMA 2QZ8A 2O61A 3CUOA 5FB2A 2XAHA 1EH6A 2YR2A 3CO7C 1Z9CA 4M9ZA 1SFXA 4Y17A 4HLXA 2GIVA 2FNAA 2OZUA 1Z91A 2XUBA 1G3WA 5E1WA 4JQFA 2H27A 1XSVA 2C6YA 3O3KA 2RV8A 3ZQ7A 2BE5F 2KJBA 5ICFA 3IC7A 1O3QA 5DUKA 1IF1A 2WWYA 4LGWA 5DCFA 2CO5A 1HW2A 5CVJA 2LDUA 2L02A 5DUIA 3BROA 2PJPA 2L01A 3K9TA 3P9CA 4HQMA 5HLIA 1BIBA 1WWXA 4KFCA 2ISZA 2M1BA 1O3TA 1LEBA 1SD5A 3ERED 2NNNA 2HEOA 4KYWA 4QLCU 3E97A 2V1UA 3JAMZ 1E17A 5DV5A 5D5VB 2E1NA 4LFUA 3ABUA 5EEHA 4IHTA 4CICA 3BJOA 2G7HA 2VONA 3T1BA 2Y75A 5K5RA 4EM1A 4UVCA 1ZGJA 4HBLA 4A6EA 1W7PA 2FU4A 4RAYA 4XSZF 2DFIA 2L3DA 4IPAA 1OYIA 2VBYA 3S2WA 3JW4A 4HF1A 4I0AA 1SAXA 1U5TB 3ISPA 4MEYF 4U88A 2RC4A 3HYIA 1SMTA 4CHUA 3HOTA 1S3JA 2DAOA 4P5OA 2QLZA 1O7LA 4L0YB 1TTYA 3CJNA 1P6RA 1FBUA 2CSOA 2XV4S 4KIGA 2HR3A 3GZ6A 3GYHX 1ZAOA 2HS5A 3GXOA 4GGGA 1OYWA 3K1NA 4K2EA 1FP1D 5E18F 1LJ9A 1CGPA 2FMLA 5BOXA 5HLGA 4EJOA 1O7FA 3Q9VA 3L7WA 3FX3A 1Z1DA 1A04A 4OIRF 3RI4A 3RKXA 3VEPA 4EM0B 2JPCA 1TQMA 3QAHA 2NYXA 3QOPA 3BY6A 3KLOA 2XIGA 4LK0F 3HRUA 1QPMA 4UVBA 4BHCA 3M8EA 1DPUA 2E7XA 3MZHA 2M5WA 1TQPA 2ZMEB 3V7CA 4WX9A 2XAJA 2W24A 3FF5A 3ZN0A 1ZREA 2QBYB 4RGXA 5J6XA 2STWA 1YW9A 5JR3A 2FE3A 1ULYA 1ZRFA 3RYPA 2JRTA 5ICGA 5CVRA 3BP8A 4MGRA 4M9SA 1UHWA 2JT1A 3ZMTA 5DEQA 3DQVC 3LQRA 2VE8A 4FX4A 1FWZA 4HW0A 3TDZC 2F5FA 3MZYA 2DK8A 3QRFF 1YW8A 1FYMA 2QQBA 4KIBA 1HW1A 2ZNYA 5HS9A 2O03A 3GLXA 4OOIA 4L9NA 1FSHA 1BIAA 3LAPA 2FBKA 4LLLA 1IXSB 3F8NA 1XMAA 1K79A 4LG0B 3DFGA 3COAC 1YYVA 1MJ9A 4ZYEA 3QPHA 2AS5F 4KDPA 5LEJA 4KIFA 4P9FA 4M72A 2DI3A 5J8FA 2GXBA 4HX8A 3KE2A 2RQPA 3FM5A 1B6AA 2J5PA 5E1XA 3CO6C 4PGHA 2NS0A 3GUDA 1YTYA 1Q1HA 5EEGA 2JPBA 2CQKA 4HLYA 2QM3A 5FD5A 3ZMSA 4ESBA 1T2KA 2M45A 2HDCA 1S7AA 3W6JB 1X3UA 2DQLA 5DCMB 1B9MA 2DT5A 1ZN2A 2EV0A 2Z3YA 2IA1A 4IF4A 3HRMA 3HSRA 2IA2A 3RTRA 3F8CA 3GZ5A 3I4PA 2RN7A 1FT9A 4BNCA 2ELHA 4QWQA 2ACJA 2PG4A 1G3TA 1F1ZA 5CJ9A 5ERIA 5ILSA 4ZZDA 2Z5UA 1YIOA 4I2OA 1S6LA 3RKWA 3WG9A 1QO0D 4B8XA 2X4HA 2ZKZA 2HTJA 1ON2A 2JZYA 3ZMZA 1LVAA 4RB3C 3GX4X 5CVVA 5D8LB 2R7DA 1KQ8A 5HVQC 1H9TA 3V7SA 1OKRA 2DQRA 1O57A 2GA1A 2XHKA 2W57A 3HTSB 1KQ9A 3WTYC 4AIKA 3K0LA 2A61A 3DPTA 1W5SA 3K1PA 2Q0OA 2HZTA 2DK5A 1IAWA 5E8GA 2K86A 4HF0A 3BJAA 4M9XA 4LLGF 2WC2A 4P9UA 5L3CA 1TLHB 1XSXA 4KMFA 2VODA 5F64A 2PMUA 4U0YA 2VT3A 4ZZLA 1WRJA 4KN4X 2P5LC 3SFZA 2IP2A 3R0JA 5ICCA 5E20A 3M8FA 1LNWA 5FGMA 1O3SA 1H9GA 3HHGA 1J75A 2H6CA 1J59A 2XVCA 2ZNZA 4M73A 5L3FA 3D5LA 2KIUA 5H6QA 3RKYA 2V9VA 3M9AA 3T0YA 4MTEA 1P92A 4HQEA 3H3UA 1B59A 5LRRA 2ZBKA 1MGTA 4N9IA 1JXSA 2EJRA 4OIPF 5H20A 4G6QA 3TQNA 2ZCWA 2EFNA 3MFKA 2VBWA 5K5QA 4HYEA 4XSXF 3KZZA 2FNPA 2P6SA 4EJUA 3E5XA 2NAZA 4P96A 3TGNA 3N97A 1F5TA 2P8TA 1P4AA 1C0WA 1W7PB 4HDVA 2UWMA 1XGSA 4IRGA 2QVOA 1RI7A 4LB6B 4OIQF 2KJCA 1I1SA 4LMYA 4L9TA 1EV7A 1TW2A 1D8JA 3I58A 2F5CA 5LGNA 1U78A 2K27A 5LHHA 4HV5A 2P7CB 4B09A 1K78B 3GWZA 4EJWA 5K1YA 3J80Z 2D1VA 2XKOA 1FYLA 3RDIA 1R23A 2YX4A 2W85A 3P9KA 1B4AA 3FMSA 4BYYA 1XB4A 2HGCA 3R60A 2QWWA 6PAXA 4CYDA 4N0BA 3LSTA 1MJBA 5CYVA 4HV6A 3E5QA 5L3BA 1ZARA 4PZJA 5D6EA 3LFKA 4I98B 1OPCA 2F5DA 2RKHA 3IHUA 4NHJA 4YFXF 3IKVA 2HFHA 1KU9A 5L3DA 3L2CA 2MH9A 3IWFA 3I71A 4EV0A 1RNLA 3RPQA 1R58A 1JGSA 1SD6A 1IUYA 2PN6A 3P7NA 4XBFA 2UXXA 5TJJA 3DF8A 2L54A 1AOYA 2GA2A 2PQ8A 2GXGA 3DPLC 4FHTA 2M8EA 2OD5A 3DKWA 2AXLA 1YQAA 2DPDA 4CDGA 5D5WB 1PP8F 2ZO4A 1PUEE 1XGNA 3MEXA 2VBXA 5LGUA 5HOOA 2OQGA 4IHSA 1DDNA 4KUMA 2O8XA 4U0WA 2K4JA 3R4KA 4I09A 1FZPB 4OIOF 1HBXG 3KP5A 2VC1A 4OMZA 2IVMA 2MLGA 1J2XA 1W5TA 5F6FA 4I02A 3V4GA 5BS6A 1YO5C 1TW3A 3BPVA 4LD5A 1TBXA 4HAMA 3FXQA 2FA5A 3OV8A 1HKTA 1Z05A 3L09A 4EJTA 5CVUA 2UZKA 2XROA 2O0YA 3AAFA 2EA4A 3ABTA 2H09A 1HSJA 2J5OA 1BBYA 3GO5A 3FHZA 4EJVA 1QZYA 2L4AA 2O3FA 2P7VB 2ESHA 4DQ2A 2Y0MA 2FSWA 2BBYA 3VODA 4G94A 3F8BA 2H6BA 3Q5FA 1FLIA 2CG4A 3WTZA 4CO8A 3FXRA 1BOAA 5FFZA 4A0ZA 5BPDA 1R1UA 1LDJA 2HKXA 4RGRA 4RB0A 2IPQX 1YS6A 4WCGA 1OYYA 3F21A 1UHMA 1UCRA 4GYIA 4UNOA 1SD7A 2HQNA 1RIOH 3JAMK 3V8KA 5D4RA 4ESJA 2VOPA 1MDMA 3G73A 4UXNA 4YIIA 4OU0A 3GVAA 4L18B 4PCQA 4UVAA 4LK1F 4IXAA 4R1HA 4UV9A 2WTEA 1F4KA 4I0BA 3TOBA 5LEKA 1I1GA 1KU3A 2MH2A 3J7AO 3EDPA 4UUVA 4CXFA 1PP7U 3KP4A 2HKOA 3TOAA 3F23A 3F72A 4MQVA 1VTNC 4NB5A 2UXNA 2XAFA 3ZP5A 4ENNA 1B1BA 3WE3A 4S05A 2WV0A 4HDUA 3EYIA 3ULQB 2ZXJA 1F9NA 3QU3A 3REOA 1U8RA 1D5VA 2COMA 2W25A 4A5NA 2V1XA 5D4SA 3MAJA 2HYFA 2FXAA 5FO5A 1LB2A 3C7JA 2R7FA 2IT0A 3NEUA 3BOQA 3RYRA 1B9NA 2B0LA 4ETSA 4RGUA 2M30A 2OA4A 2M87A 2P6TA 2Q2EA 3N4MA 3K69A 1T6SA 1P2FA 5IT3A 3QP6A 4RAZA 2Z9OA 3GEZA 4EM2A 2HWVA 1G4DA 2KKOA 2BGCA 3LAJA 4YIFA 3HRSA 1IW7F 4P55A 3DP7A 3KEOA 2EV6A 2FOKA 1P4XA 3I53A 2XGXA 4OINF 4M6YA 1SD4A 3MCZA 1WI9A 1J9IA 3I0TA 2PFBA 5E17F 2KRFA 3GF2A 3J81K 5ED4A 2Q8KA 3R6SA 1OMIA 1Z7UA 4YFNF 5BPIA 2QYOA 3R61A 3CLOA 2MLKA 5DYMA 2P4WA 4XLNF 3ROUA 3WTWC 4WWCA 3KP7A 4MHGA 2E7WA 3DEUA 2BEOA 5IT9Z 2A68F 3HHHA 3GFLA 1XD7A 5ILUA 1GXPA 3CTAA 4CZZA 2Z33A 3FZVA 3KCCA 1R22A 3LWFA 2OQRA 2A69F 2IJLA 1ODDA 4Q48A 3ZN1A 3WTVC 3V7RA 2W84A 3ECOA 4KT5C 1S29A 4R79A 1XDUA 4YG2F 2IRFG 1MZBA 4G7ZF 1JHFA 1IN7A 3WTTC 3KP6A 3M7GA 1J7KA 2DTRA 4U7BA 4CGZA 3T5XA 3B02A 3I59A 5FLXZ 2CGPA 3M1EA 1G3SA 1YG2A 4BAYA 2D2WA 3T8TA 1ZRCA 1R5HA 3IKTA 4N9HA 1ZLKA 4A0XA 4IJAA 2Z99A 1LQ1A 3ELKA 5FFXA 2VE9A 1WSUA 2RDPA 2HTSA 5D6FA 5AIQA 2K4BA 3CUQC 4G9YA 3LA3A 1ZYRF 2R3SA 4G7HF 2F5EA 2KIFA 2EFPA 3SZPA 1S8NA 4EGYA 4M71A 3WTUC 4L9JA 5LGTA 1ZG5A 4TV7A 4E70A 4RS8A 1O3RA 2K02A 1P4WA 1TNSA 1PDNC 4IRHA 4WXHA 4LLNA 1FC3A 5KK1A 2V79A 1IXCA 1JE8A 3BJ6A 4G8XA 2OZ6A 5TRDA 3TO7A 4LG0A 3H92A 3HSEA 1BC8C 4RB2C 5CLSA 1I27A 1BN5A 5A2QZ 2GQQA 4AWXB 1IN8A 2LF7A 4BHBA 2KIMA 4AIHA 2FRHA 4BQAA 1IXRC 2DPUA 1KYWA 4I7HA 3GFJA 4YFKF 3RIRA 1R5GA 4LJZF 5ILVA 3HUGA 4EVIA 4HX7A 5ICEA 2E1CA 2XRNA 2VXZA 3LA7A 5DCMA 3FMRA 2D1HA 4L5JA 1IRFA 3HIFA 2PI0A 1G3YA 1T0FA 1XCVA 1BI2A 1TNTA 2V6CA 1U2WA 5HS7A 1W4MA 5BQTA 2ESNA 1MDMB 3QP5A 2NNYA 4XRFA 1KU2A 3W6KB 3WGHA 1R36A 4A2UA 2CFXA 5HDGA 5LBQA 1AWCA 1U3EM 3RJPA 1T38A 1MKMA 4Y13A 1FX7A 2CW0F 3WGIA 4H0EA 2VN2A 5HDKA 3SHFA 4KA4A 3ECHA 3GFIA 4Q5SF 3U9GA 1BI0A 2EV5A 2STTA 1KGSA 4F7ZA 2QQAA 3DXJF 4KNYA 3J80K 4GO1A 2OBPA 2ETHA 2ZJ2A 4O3MA 1ONVA 4HX4A 4A5MA 4BH9A 1ZG3A 4GYGA 2XAGA 2EK5A 2FQ3A 1I5ZA 2NRAC 1Z6RA 1QBJA 2HYGD 3MWMA 2P5VA 3T8RA 5J8CA 4PGGA 1XGOA 2DU9A 1W7PD 3DV8A 1ZG1A 1R1TA 1FNNA 1MJAA 5LLQA 1SFEA 3F6OA 1ZGAA 4I01A 3WU1B 2FMYA 4KMUX 4M74A 3IL2A 2VC0A 1USTA 3SZTA 5BMZA 2JTVA 2QENA 1HQCA 1WKMA 1ON1A 1IN4A 4WK8F 3ZMVA 3BDDA 1ZRDA 1XDSA 3CUQA 5L3EA 5L3GA 3K1MA 1FYKA 2YU3A 2EWNA 3WTSC 3KEQA 3PQKA 2P5KA 1KA8A 1GXQA 1U5TC 2EFOA 2PMHA 1RUNA 4AVPA 1V4RA 5FD6A 3P9IA 1REPC 4KICA 3I64A 2X0LA 2DBBA 3NQOA 2MC3A 2G7UA 3G3ZA 3L9FA 1RUOA 2O6GE 1CF7A 4HA8A 5LRSA 4RGSA 3PFIA 3I54A 4NQWA 4FX0A 4KN7X 2LNBA 1BI3A 5E8IA 1Y0UA 4AD9A 1L0OC 3HOSA 2MA3A 4ZYGA 5JFRA 5LHIA 3WODF 4O6JA 2PEXA 1K78A 1TQIA 3QPTA 4WF2A 1HSTA 3EETA 1USSA 4MEXF 5H6RA 3E6DA 4O5VA 4ENJA 5HDNA 1FP2A 5JVTA 3I59B 2YPRA 3F8MA 2VBZA 1XGMA 3B73A 2A3SA 2BV6A 2CWEA 1V3FA 1STZA 2LKPA 4Z2YA 1J0RA 1RZ4A 3WGGA 3KLNA 5AIPA 2EA2A 2OU2A 3GW2A 2YSRA 4PDKA 2BYVE 4ZYHA 3F8FA 3CDHA 4WXCA 3C1DA 4GCVA 4EQQA 1EH8A 2PBIA 1D3YA 3E5UA 3KFWX 1FY7A 4JBAA 4MTDA 3TO6A 3NRVA 2H94A 1E2XA 2VOOA 4S04A 1LDDA 1IRGA 1BJAA 2XASA 1IN6A 1SFUA 2FBIA 2FBHA 1R7JA 4BXUA 2D45A 2IW5A 4A0YA 3J81Z 2RGVA 4D0PA 4HF2A 3L00A 2PLYA 4Q4ZF 1SMYF 2FF4A 2EFWA 3D0SA 3OOPA 1S7OA 2TDXA 4ASNA 3SXYA 1U6GA 1IN5A 4GXOA 3E6CC 1K6OA 5HS8A 1J5YA 3HSFA 3O2PE 3H3ZA 4JK1X 2ISYA 3TDUC 2LF8A 4U0VA 1GHCA 5CVIA 1BC7C 3PQJA 4ZYDA 5KVRA 1H0MA 2MD5A 1T39A 1XCBA 1XMKA 3KZYA 4A12A 5D5UB 3HTUA 4DNCA 3FM3A 1EH7A 5K5OA 3QU6A 3C3WA 1T98A 2OAZA 4MQ9F 3GFMA 2A07F 4UHTA 1G6NA 4RB1A 4XLPF 4ENKA 3K2ZA 1FPQA 4HZFA 5E1ZB 3U2RA 4EMSA 1XN7A 1D8KA 3LA2A 1U5TA 1K7AA 2RVCA 1FOKA 1KYZA 3KP3A 2VT2A 4HOBA 1KU7A 3VOEA 2XAQA 3EQLF 4AIJA 2L4MA 1LDKB 5AONA 2CYYA 2HQRA 1GVJA 3O6BB 4U7DA 4L9VA 4WXDA 2JSCA 2GWRA 4M6XA 5F1RA 3I5UA 1DUXC 3ZPLA 2G9WA 2HOEA 3FXUA 1ZLJA 4IVNA 1QQIA 3E6MA 3JTGA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1UB9 A;  4ESF A;  3V8L A;  2ZME A;  2A6E F;  4Q47 A;  1R00 A;  2DW4 A;  3TO9 A;  2QBY A;  3TKY A;  3MQ0 A;  1IZ1 A;  1DPR A;  5JHU A;  3LQQ A;  5HLH A;  3E6B A;  2QQ9 A;  5IT9 K;  3R0A A;  1FBQ A;  1ZHF A;  1YFH A;  3EUH A;  3ZMD A;  3BWG A;  2XKP A;  2YX7 A;  1YLF A;  2FEZ A;  3CUQ B;  2F2E A;  3F3X A;  4A6D A;  3C18 A;  3WTX C;  4MNU A;  3KET A;  1HKQ A;  2DLL A;  1QGP A;  1QNT A;  3U1D A;  3V8J A;  2LSO A;  3FWE A;  4UV8 A;  5D8K B;  1ZH5 A;  1Z6T A;  2EB7 A;  3WU0 A;  5FLX K;  2ZFW A;  4LB5 A;  1WQ2 A;  5D5X B;  1QZZ A;  3VFZ A;  2GZW A;  2A6H F;  1DP7 P;  5LHG A;  2QUF A;  3BPX A;  5DDG A;  1CF7 B;  4FT8 A;  1HW5 A;  3ZMU A;  1OR7 A;  4IRI A;  3ML6 A;  4BHP A;  4ZH4 F;  3IWZ A;  1HXD A;  2GAU A;  1BI1 A;  2MBF A;  3FMQ A;  1UFM A;  3VB2 A;  1FBS A;  2ADU A;  1XSD A;  3JTH A;  3BZ6 A;  2RNJ A;  4OMY A;  2EFQ A;  2V1D A;  4G6D A;  4R8H A;  3SQN A;  2IA0 A;  2DO7 A;  2Y48 A;  1L3L A;  3IRQ A;  5DD8 A;  5JI6 A;  1KQ0 A;  1JHH A;  5DD4 A;  4G7O F;  2A5Y B;  1I6X A;  1LEA A;  4Y15 A;  1FSE A;  3IRR A;  3WE2 A;  1R1V A;  1HKS A;  3F6V A;  4ON0 A;  1MD0 A;  3EYY A;  3RPU A;  3Q9S A;  4L5I A;  3KP2 A;  1YW7 A;  3JSO A;  3JSP A;  4L0Z B;  5A2Q K;  4EGZ A;  1BM9 A;  3HRT A;  3E3V A;  3F22 A;  1NHA A;  2K7L A;  1YS7 A;  4ENM A;  2QZ8 A;  2O61 A;  3CUO A;  5FB2 A;  2XAH A;  1EH6 A;  2YR2 A;  3CO7 C;  1Z9C A;  4M9Z A;  1SFX A;  4Y17 A;  4HLX A;  2GIV A;  2FNA A;  2OZU A;  1Z91 A;  2XUB A;  1G3W A;  5E1W A;  4JQF A;  2H27 A;  1XSV A;  2C6Y A;  3O3K A;  2RV8 A;  3ZQ7 A;  2BE5 F;  2KJB A;  5ICF A;  3IC7 A;  1O3Q A;  5DUK A;  1IF1 A;  2WWY A;  4LGW A;  5DCF A;  2CO5 A;  1HW2 A;  5CVJ A;  2LDU A;  2L02 A;  5DUI A;  3BRO A;  2PJP A;  2L01 A;  3K9T A;  3P9C A;  4HQM A;  5HLI A;  1BIB A;  1WWX A;  4KFC A;  2ISZ A;  2M1B A;  1O3T A;  1LEB A;  1SD5 A;  3ERE D;  2NNN A;  2HEO A;  4KYW A;  4QLC U;  3E97 A;  2V1U A;  3JAM Z;  1E17 A;  5DV5 A;  5D5V B;  2E1N A;  4LFU A;  3ABU A;  5EEH A;  4IHT A;  4CIC A;  3BJO A;  2G7H A;  2VON A;  3T1B A;  2Y75 A;  5K5R A;  4EM1 A;  4UVC A;  1ZGJ A;  4HBL A;  4A6E A;  1W7P A;  2FU4 A;  4RAY A;  4XSZ F;  2DFI A;  2L3D A;  4IPA A;  1OYI A;  2VBY A;  3S2W A;  3JW4 A;  4HF1 A;  4I0A A;  1SAX A;  1U5T B;  3ISP A;  4MEY F;  4U88 A;  2RC4 A;  3HYI A;  1SMT A;  4CHU A;  3HOT A;  1S3J A;  2DAO A;  4P5O A;  2QLZ A;  1O7L A;  4L0Y B;  1TTY A;  3CJN A;  1P6R A;  1FBU A;  2CSO A;  2XV4 S;  4KIG A;  2HR3 A;  3GZ6 A;  3GYH X;  1ZAO A;  2HS5 A;  3GXO A;  4GGG A;  1OYW A;  3K1N A;  4K2E A;  1FP1 D;  5E18 F;  1LJ9 A;  1CGP A;  2FML A;  5BOX A;  5HLG A;  4EJO A;  1O7F A;  3Q9V A;  3L7W A;  3FX3 A;  1Z1D A;  1A04 A;  4OIR F;  3RI4 A;  3RKX A;  3VEP A;  4EM0 B;  2JPC A;  1TQM A;  3QAH A;  2NYX A;  3QOP A;  3BY6 A;  3KLO A;  2XIG A;  4LK0 F;  3HRU A;  1QPM A;  4UVB A;  4BHC A;  3M8E A;  1DPU A;  2E7X A;  3MZH A;  2M5W A;  1TQP A;  2ZME B;  3V7C A;  4WX9 A;  2XAJ A;  2W24 A;  3FF5 A;  3ZN0 A;  1ZRE A;  2QBY B;  4RGX A;  5J6X A;  2STW A;  1YW9 A;  5JR3 A;  2FE3 A;  1ULY A;  1ZRF A;  3RYP A;  2JRT A;  5ICG A;  5CVR A;  3BP8 A;  4MGR A;  4M9S A;  1UHW A;  2JT1 A;  3ZMT A;  5DEQ A;  3DQV C;  3LQR A;  2VE8 A;  4FX4 A;  1FWZ A;  4HW0 A;  3TDZ C;  2F5F A;  3MZY A;  2DK8 A;  3QRF F;  1YW8 A;  1FYM A;  2QQB A;  4KIB A;  1HW1 A;  2ZNY A;  5HS9 A;  2O03 A;  3GLX A;  4OOI A;  4L9N A;  1FSH A;  1BIA A;  3LAP A;  2FBK A;  4LLL A;  1IXS B;  3F8N A;  1XMA A;  1K79 A;  4LG0 B;  3DFG A;  3COA C;  1YYV A;  1MJ9 A;  4ZYE A;  3QPH A;  2AS5 F;  4KDP A;  5LEJ A;  4KIF A;  4P9F A;  4M72 A;  2DI3 A;  5J8F A;  2GXB A;  4HX8 A;  3KE2 A;  2RQP A;  3FM5 A;  1B6A A;  2J5P A;  5E1X A;  3CO6 C;  4PGH A;  2NS0 A;  3GUD A;  1YTY A;  1Q1H A;  5EEG A;  2JPB A;  2CQK A;  4HLY A;  2QM3 A;  5FD5 A;  3ZMS A;  4ESB A;  1T2K A;  2M45 A;  2HDC A;  1S7A A;  3W6J B;  1X3U A;  2DQL A;  5DCM B;  1B9M A;  2DT5 A;  1ZN2 A;  2EV0 A;  2Z3Y A;  2IA1 A;  4IF4 A;  3HRM A;  3HSR A;  2IA2 A;  3RTR A;  3F8C A;  3GZ5 A;  3I4P A;  2RN7 A;  1FT9 A;  4BNC A;  2ELH A;  4QWQ A;  2ACJ A;  2PG4 A;  1G3T A;  1F1Z A;  5CJ9 A;  5ERI A;  5ILS A;  4ZZD A;  2Z5U A;  1YIO A;  4I2O A;  1S6L A;  3RKW A;  3WG9 A;  1QO0 D;  4B8X A;  2X4H A;  2ZKZ A;  2HTJ A;  1ON2 A;  2JZY A;  3ZMZ A;  1LVA A;  4RB3 C;  3GX4 X;  5CVV A;  5D8L B;  2R7D A;  1KQ8 A;  5HVQ C;  1H9T A;  3V7S A;  1OKR A;  2DQR A;  1O57 A;  2GA1 A;  2XHK A;  2W57 A;  3HTS B;  1KQ9 A;  3WTY C;  4AIK A;  3K0L A;  2A61 A;  3DPT A;  1W5S A;  3K1P A;  2Q0O A;  2HZT A;  2DK5 A;  1IAW A;  5E8G A;  2K86 A;  4HF0 A;  3BJA A;  4M9X A;  4LLG F;  2WC2 A;  4P9U A;  5L3C A;  1TLH B;  1XSX A;  4KMF A;  2VOD A;  5F64 A;  2PMU A;  4U0Y A;  2VT3 A;  4ZZL A;  1WRJ A;  4KN4 X;  2P5L C;  3SFZ A;  2IP2 A;  3R0J A;  5ICC A;  5E20 A;  3M8F A;  1LNW A;  5FGM A;  1O3S A;  1H9G A;  3HHG A;  1J75 A;  2H6C A;  1J59 A;  2XVC A;  2ZNZ A;  4M73 A;  5L3F A;  3D5L A;  2KIU A;  5H6Q A;  3RKY A;  2V9V A;  3M9A A;  3T0Y A;  4MTE A;  1P92 A;  4HQE A;  3H3U A;  1B59 A;  5LRR A;  2ZBK A;  1MGT A;  4N9I A;  1JXS A;  2EJR A;  4OIP F;  5H20 A;  4G6Q A;  3TQN A;  2ZCW A;  2EFN A;  3MFK A;  2VBW A;  5K5Q A;  4HYE A;  4XSX F;  3KZZ A;  2FNP A;  2P6S A;  4EJU A;  3E5X A;  2NAZ A;  4P96 A;  3TGN A;  3N97 A;  1F5T A;  2P8T A;  1P4A A;  1C0W A;  1W7P B;  4HDV A;  2UWM A;  1XGS A;  4IRG A;  2QVO A;  1RI7 A;  4LB6 B;  4OIQ F;  2KJC A;  1I1S A;  4LMY A;  4L9T A;  1EV7 A;  1TW2 A;  1D8J A;  3I58 A;  2F5C A;  5LGN A;  1U78 A;  2K27 A;  5LHH A;  4HV5 A;  2P7C B;  4B09 A;  1K78 B;  3GWZ A;  4EJW A;  5K1Y A;  3J80 Z;  2D1V A;  2XKO A;  1FYL A;  3RDI A;  1R23 A;  2YX4 A;  2W85 A;  3P9K A;  1B4A A;  3FMS A;  4BYY A;  1XB4 A;  2HGC A;  3R60 A;  2QWW A;  6PAX A;  4CYD A;  4N0B A;  3LST A;  1MJB A;  5CYV A;  4HV6 A;  3E5Q A;  5L3B A;  1ZAR A;  4PZJ A;  5D6E A;  3LFK A;  4I98 B;  1OPC A;  2F5D A;  2RKH A;  3IHU A;  4NHJ A;  4YFX F;  3IKV A;  2HFH A;  1KU9 A;  5L3D A;  3L2C A;  2MH9 A;  3IWF A;  3I71 A;  4EV0 A;  1RNL A;  3RPQ A;  1R58 A;  1JGS A;  1SD6 A;  1IUY A;  2PN6 A;  3P7N A;  4XBF A;  2UXX A;  5TJJ A;  3DF8 A;  2L54 A;  1AOY A;  2GA2 A;  2PQ8 A;  2GXG A;  3DPL C;  4FHT A;  2M8E A;  2OD5 A;  3DKW A;  2AXL A;  1YQA A;  2DPD A;  4CDG A;  5D5W B;  1PP8 F;  2ZO4 A;  1PUE E;  1XGN A;  3MEX A;  2VBX A;  5LGU A;  5HOO A;  2OQG A;  4IHS A;  1DDN A;  4KUM A;  2O8X A;  4U0W A;  2K4J A;  3R4K A;  4I09 A;  1FZP B;  4OIO F;  1HBX G;  3KP5 A;  2VC1 A;  4OMZ A;  2IVM A;  2MLG A;  1J2X A;  1W5T A;  5F6F A;  4I02 A;  3V4G A;  5BS6 A;  1YO5 C;  1TW3 A;  3BPV A;  4LD5 A;  1TBX A;  4HAM A;  3FXQ A;  2FA5 A;  3OV8 A;  1HKT A;  1Z05 A;  3L09 A;  4EJT A;  5CVU A;  2UZK A;  2XRO A;  2O0Y A;  3AAF A;  2EA4 A;  3ABT A;  2H09 A;  1HSJ A;  2J5O A;  1BBY A;  3GO5 A;  3FHZ A;  4EJV A;  1QZY A;  2L4A A;  2O3F A;  2P7V B;  2ESH A;  4DQ2 A;  2Y0M A;  2FSW A;  2BBY A;  3VOD A;  4G94 A;  3F8B A;  2H6B A;  3Q5F A;  1FLI A;  2CG4 A;  3WTZ A;  4CO8 A;  3FXR A;  1BOA A;  5FFZ A;  4A0Z A;  5BPD A;  1R1U A;  1LDJ A;  2HKX A;  4RGR A;  4RB0 A;  2IPQ X;  1YS6 A;  4WCG A;  1OYY A;  3F21 A;  1UHM A;  1UCR A;  4GYI A;  4UNO A;  1SD7 A;  2HQN A;  1RIO H;  3JAM K;  3V8K A;  5D4R A;  4ESJ A;  2VOP A;  1MDM A;  3G73 A;  4UXN A;  4YII A;  4OU0 A;  3GVA A;  4L18 B;  4PCQ A;  4UVA A;  4LK1 F;  4IXA A;  4R1H A;  4UV9 A;  2WTE A;  1F4K A;  4I0B A;  3TOB A;  5LEK A;  1I1G A;  1KU3 A;  2MH2 A;  3J7A O;  3EDP A;  4UUV A;  4CXF A;  1PP7 U;  3KP4 A;  2HKO A;  3TOA A;  3F23 A;  3F72 A;  4MQV A;  1VTN C;  4NB5 A;  2UXN A;  2XAF A;  3ZP5 A;  4ENN A;  1B1B A;  3WE3 A;  4S05 A;  2WV0 A;  4HDU A;  3EYI A;  3ULQ B;  2ZXJ A;  1F9N A;  3QU3 A;  3REO A;  1U8R A;  1D5V A;  2COM A;  2W25 A;  4A5N A;  2V1X A;  5D4S A;  3MAJ A;  2HYF A;  2FXA A;  5FO5 A;  1LB2 A;  3C7J A;  2R7F A;  2IT0 A;  3NEU A;  3BOQ A;  3RYR A;  1B9N A;  2B0L A;  4ETS A;  4RGU A;  2M30 A;  2OA4 A;  2M87 A;  2P6T A;  2Q2E A;  3N4M A;  3K69 A;  1T6S A;  1P2F A;  5IT3 A;  3QP6 A;  4RAZ A;  2Z9O A;  3GEZ A;  4EM2 A;  2HWV A;  1G4D A;  2KKO A;  2BGC A;  3LAJ A;  4YIF A;  3HRS A;  1IW7 F;  4P55 A;  3DP7 A;  3KEO A;  2EV6 A;  2FOK A;  1P4X A;  3I53 A;  2XGX A;  4OIN F;  4M6Y A;  1SD4 A;  3MCZ A;  1WI9 A;  1J9I A;  3I0T A;  2PFB A;  5E17 F;  2KRF A;  3GF2 A;  3J81 K;  5ED4 A;  2Q8K A;  3R6S A;  1OMI A;  1Z7U A;  4YFN F;  5BPI A;  2QYO A;  3R61 A;  3CLO A;  2MLK A;  5DYM A;  2P4W A;  4XLN F;  3ROU A;  3WTW C;  4WWC A;  3KP7 A;  4MHG A;  2E7W A;  3DEU A;  2BEO A;  5IT9 Z;  2A68 F;  3HHH A;  3GFL A;  1XD7 A;  5ILU A;  1GXP A;  3CTA A;  4CZZ A;  2Z33 A;  3FZV A;  3KCC A;  1R22 A;  3LWF A;  2OQR A;  2A69 F;  2IJL A;  1ODD A;  4Q48 A;  3ZN1 A;  3WTV C;  3V7R A;  2W84 A;  3ECO A;  4KT5 C;  1S29 A;  4R79 A;  1XDU A;  4YG2 F;  2IRF G;  1MZB A;  4G7Z F;  1JHF A;  1IN7 A;  3WTT C;  3KP6 A;  3M7G A;  1J7K A;  2DTR A;  4U7B A;  4CGZ A;  3T5X A;  3B02 A;  3I59 A;  5FLX Z;  2CGP A;  3M1E A;  1G3S A;  1YG2 A;  4BAY A;  2D2W A;  3T8T A;  1ZRC A;  1R5H A;  3IKT A;  4N9H A;  1ZLK A;  4A0X A;  4IJA A;  2Z99 A;  1LQ1 A;  3ELK A;  5FFX A;  2VE9 A;  1WSU A;  2RDP A;  2HTS A;  5D6F A;  5AIQ A;  2K4B A;  3CUQ C;  4G9Y A;  3LA3 A;  1ZYR F;  2R3S A;  4G7H F;  2F5E A;  2KIF A;  2EFP A;  3SZP A;  1S8N A;  4EGY A;  4M71 A;  3WTU C;  4L9J A;  5LGT A;  1ZG5 A;  4TV7 A;  4E70 A;  4RS8 A;  1O3R A;  2K02 A;  1P4W A;  1TNS A;  1PDN C;  4IRH A;  4WXH A;  4LLN A;  1FC3 A;  5KK1 A;  2V79 A;  1IXC A;  1JE8 A;  3BJ6 A;  4G8X A;  2OZ6 A;  5TRD A;  3TO7 A;  4LG0 A;  3H92 A;  3HSE A;  1BC8 C;  4RB2 C;  5CLS A;  1I27 A;  1BN5 A;  5A2Q Z;  2GQQ A;  4AWX B;  1IN8 A;  2LF7 A;  4BHB A;  2KIM A;  4AIH A;  2FRH A;  4BQA A;  1IXR C;  2DPU A;  1KYW A;  4I7H A;  3GFJ A;  4YFK F;  3RIR A;  1R5G A;  4LJZ F;  5ILV A;  3HUG A;  4EVI A;  4HX7 A;  5ICE A;  2E1C A;  2XRN A;  2VXZ A;  3LA7 A;  5DCM A;  3FMR A;  2D1H A;  4L5J A;  1IRF A;  3HIF A;  2PI0 A;  1G3Y A;  1T0F A;  1XCV A;  1BI2 A;  1TNT A;  2V6C A;  1U2W A;  5HS7 A;  1W4M A;  5BQT A;  2ESN A;  1MDM B;  3QP5 A;  2NNY A;  4XRF A;  1KU2 A;  3W6K B;  3WGH A;  1R36 A;  4A2U A;  2CFX A;  5HDG A;  5LBQ A;  1AWC A;  1U3E M;  3RJP A;  1T38 A;  1MKM A;  4Y13 A;  1FX7 A;  2CW0 F;  3WGI A;  4H0E A;  2VN2 A;  5HDK A;  3SHF A;  4KA4 A;  3ECH A;  3GFI A;  4Q5S F;  3U9G A;  1BI0 A;  2EV5 A;  2STT A;  1KGS A;  4F7Z A;  2QQA A;  3DXJ F;  4KNY A;  3J80 K;  4GO1 A;  2OBP A;  2ETH A;  2ZJ2 A;  4O3M A;  1ONV A;  4HX4 A;  4A5M A;  4BH9 A;  1ZG3 A;  4GYG A;  2XAG A;  2EK5 A;  2FQ3 A;  1I5Z A;  2NRA C;  1Z6R A;  1QBJ A;  2HYG D;  3MWM A;  2P5V A;  3T8R A;  5J8C A;  4PGG A;  1XGO A;  2DU9 A;  1W7P D;  3DV8 A;  1ZG1 A;  1R1T A;  1FNN A;  1MJA A;  5LLQ A;  1SFE A;  3F6O A;  1ZGA A;  4I01 A;  3WU1 B;  2FMY A;  4KMU X;  4M74 A;  3IL2 A;  2VC0 A;  1UST A;  3SZT A;  5BMZ A;  2JTV A;  2QEN A;  1HQC A;  1WKM A;  1ON1 A;  1IN4 A;  4WK8 F;  3ZMV A;  3BDD A;  1ZRD A;  1XDS A;  3CUQ A;  5L3E A;  5L3G A;  3K1M A;  1FYK A;  2YU3 A;  2EWN A;  3WTS C;  3KEQ A;  3PQK A;  2P5K A;  1KA8 A;  1GXQ A;  1U5T C;  2EFO A;  2PMH A;  1RUN A;  4AVP A;  1V4R A;  5FD6 A;  3P9I A;  1REP C;  4KIC A;  3I64 A;  2X0L A;  2DBB A;  3NQO A;  2MC3 A;  2G7U A;  3G3Z A;  3L9F A;  1RUO A;  2O6G E;  1CF7 A;  4HA8 A;  5LRS A;  4RGS A;  3PFI A;  3I54 A;  4NQW A;  4FX0 A;  4KN7 X;  2LNB A;  1BI3 A;  5E8I A;  1Y0U A;  4AD9 A;  1L0O C;  3HOS A;  2MA3 A;  4ZYG A;  5JFR A;  5LHI A;  3WOD F;  4O6J A;  2PEX A;  1K78 A;  1TQI A;  3QPT A;  4WF2 A;  1HST A;  3EET A;  1USS A;  4MEX F;  5H6R A;  3E6D A;  4O5V A;  4ENJ A;  5HDN A;  1FP2 A;  5JVT A;  3I59 B;  2YPR A;  3F8M A;  2VBZ A;  1XGM A;  3B73 A;  2A3S A;  2BV6 A;  2CWE A;  1V3F A;  1STZ A;  2LKP A;  4Z2Y A;  1J0R A;  1RZ4 A;  3WGG A;  3KLN A;  5AIP A;  2EA2 A;  2OU2 A;  3GW2 A;  2YSR A;  4PDK A;  2BYV E;  4ZYH A;  3F8F A;  3CDH A;  4WXC A;  3C1D A;  4GCV A;  4EQQ A;  1EH8 A;  2PBI A;  1D3Y A;  3E5U A;  3KFW X;  1FY7 A;  4JBA A;  4MTD A;  3TO6 A;  3NRV A;  2H94 A;  1E2X A;  2VOO A;  4S04 A;  1LDD A;  1IRG A;  1BJA A;  2XAS A;  1IN6 A;  1SFU A;  2FBI A;  2FBH A;  1R7J A;  4BXU A;  2D45 A;  2IW5 A;  4A0Y A;  3J81 Z;  2RGV A;  4D0P A;  4HF2 A;  3L00 A;  2PLY A;  4Q4Z F;  1SMY F;  2FF4 A;  2EFW A;  3D0S A;  3OOP A;  1S7O A;  2TDX A;  4ASN A;  3SXY A;  1U6G A;  1IN5 A;  4GXO A;  3E6C C;  1K6O A;  5HS8 A;  1J5Y A;  3HSF A;  3O2P E;  3H3Z A;  4JK1 X;  2ISY A;  3TDU C;  2LF8 A;  4U0V A;  1GHC A;  5CVI A;  1BC7 C;  3PQJ A;  4ZYD A;  5KVR A;  1H0M A;  2MD5 A;  1T39 A;  1XCB A;  1XMK A;  3KZY A;  4A12 A;  5D5U B;  3HTU A;  4DNC A;  3FM3 A;  1EH7 A;  5K5O A;  3QU6 A;  3C3W A;  1T98 A;  2OAZ A;  4MQ9 F;  3GFM A;  2A07 F;  4UHT A;  1G6N A;  4RB1 A;  4XLP F;  4ENK A;  3K2Z A;  1FPQ A;  4HZF A;  5E1Z B;  3U2R A;  4EMS A;  1XN7 A;  1D8K A;  3LA2 A;  1U5T A;  1K7A A;  2RVC A;  1FOK A;  1KYZ A;  3KP3 A;  2VT2 A;  4HOB A;  1KU7 A;  3VOE A;  2XAQ A;  3EQL F;  4AIJ A;  2L4M A;  1LDK B;  5AON A;  2CYY A;  2HQR A;  1GVJ A;  3O6B B;  4U7D A;  4L9V A;  4WXD A;  2JSC A;  2GWR A;  4M6X A;  5F1R A;  3I5U A;  1DUX C;  3ZPL A;  2G9W A;  2HOE A;  3FXU A;  1ZLJ A;  4IVN A;  1QQI A;  3E6M A;  3JTG A; 
#chains in the Genus database with same CATH topology
 1DU0 A;  2ZSI B;  1UB9 A;  2IS4 A;  2CS3 A;  3V8L A;  4ESF A;  3K4C A;  1V55 H;  2VPR A;  2ZME A;  2A6E F;  1P7I A;  4IHX A;  1W5C C;  4Q47 A;  1YOV B;  4BEH B;  2M4G A;  2I8D A;  2XDV A;  2BVM A;  1KZH A;  3CQZ J;  1R00 A;  2DW4 A;  3GZN B;  2Y30 A;  3TO9 A;  3FXK A;  4QTR A;  2NVY J;  2QBY A;  3TKY A;  4IHV A;  3MQ0 A;  5GAD J;  2ZXH A;  1IZ1 A;  5M3M J;  1OQY A;  3ZQL A;  4GFB A;  3OYN A;  1DPR A;  5JHU A;  1J09 A;  3ZGK A;  3A0H C;  3LQQ A;  5HLH A;  3N05 A;  3E6B A;  4DBQ A;  2QQ9 A;  2PMZ A;  3DEW A;  5IT9 K;  3R0A A;  1Z0X A;  1FBQ A;  1V5F A;  1ZHF A;  1YFH A;  3EUH A;  4DJA A;  4C2U A;  4YEL A;  2E60 A;  3ZMD A;  4B3A A;  1WJB A;  3HKZ N;  3BWG A;  5BNG A;  4U87 A;  2Y31 A;  2XKP A;  4BUP A;  1RRJ A;  5CQE A;  2YX7 A;  1OCP A;  2XF7 A;  1SAU A;  2ZC2 A;  1IUF A;  1YLF A;  5CPR B;  4QSH A;  2FEZ A;  3BR1 A;  3CUQ B;  2F2E A;  2V1N A;  3F3X A;  3AKZ A;  1GT0 C;  4A6D A;  3C18 A;  3WTX C;  4MNU A;  3KET A;  2VJ5 A;  1HKQ A;  1MMA A;  1MNE A;  3C2B A;  1TWG J;  2DLL A;  1QGP A;  1QNT A;  1UAA A;  3U1D A;  4CCJ A;  3V8J A;  5EGO A;  2LSO A;  3FWE A;  4JX4 A;  4UV8 A;  3PIP F;  1MBJ A;  5D8K B;  1ZH5 A;  3KPH A;  5EJC A;  1Z6T A;  2EB7 A;  5J40 A;  1SC7 A;  4E7K A;  1T56 A;  3WU0 A;  2L9N A;  2ZFW A;  2DA2 A;  5FLX K;  2A6T A;  1Y8R B;  5EDN A;  4LB5 A;  4ZJZ A;  1WQ2 A;  5D5X B;  1QZZ A;  2RRE A;  3CES A;  1QRY A;  3VFZ A;  2GZW A;  2A6H F;  1DP7 P;  2HNH A;  5LHG A;  2QUF A;  1MSE C;  3MZ8 A;  3BPX A;  1JGG A;  4DYQ A;  2QF7 A;  5DDG A;  1CF7 B;  1X2N A;  1Z3X A;  3OS1 A;  3RPU D;  4FT8 A;  1E3P A;  5JLW A;  1ETY A;  3OYF A;  1HW5 A;  3ZMU A;  3GTO J;  2EZL A;  1OR7 A;  4I6Z A;  4NQW B;  4IRI A;  1U0J A;  3ML6 A;  4BHP A;  4ZH4 F;  1VZ0 A;  3IWZ A;  1HXD A;  2GAU A;  3O8H A;  1BI1 A;  2MBF A;  3FMQ A;  1UFM A;  5E3N A;  3H0D A;  1A6Q A;  3DTK A;  3VB2 A;  1FBS A;  2ADU A;  1QHG A;  2VKE A;  5C4X J;  4ZYA A;  2CUJ A;  1XSD A;  1Y0N A;  3F9K A;  4RLF A;  4UUS B;  3JTH A;  3MD2 A;  3BZ6 A;  2RNJ A;  1D0X A;  4OMY A;  2EFQ A;  4HG2 A;  2E2H J;  1QU3 A;  1SFK A;  2DDB A;  2V1D A;  4G6D A;  4R8H A;  4XOT A;  3SQN A;  4M3F A;  2IA0 A;  2DO7 A;  2Y48 A;  4JX5 A;  4LG3 A;  1L3L A;  3IRQ A;  3OMY A;  2IGK A;  3OYE A;  3WHC A;  3OYH A;  5DD8 A;  5JI6 A;  4E7H A;  4B47 A;  1KQ0 A;  1JHH A;  2WY8 Q;  2IGM A;  2FX0 A;  5DD4 A;  4G7O F;  2A5Y B;  1I6X A;  4CH7 A;  1LEA A;  1AKH A;  4Y15 A;  1FSE A;  3IRR A;  4DYC A;  2IGN A;  2ME0 A;  3WE2 A;  1R1V A;  2CJJ A;  2XSD C;  1HKS A;  2M2E A;  3F6V A;  3I55 I;  3ESW B;  4ON0 A;  3GTJ J;  1MD0 A;  5J1U A;  3EYY A;  3E0J B;  3RPU A;  2BHY A;  3Q9S A;  4L5I A;  3KP2 A;  3L1P A;  4CUG A;  2XGC A;  1YW7 A;  3JSO A;  3C2G A;  2M8G X;  3JSP A;  4DBR A;  1UG0 A;  1Y56 A;  4L0Z B;  5A2Q K;  4EGZ A;  2JUG A;  5J1R A;  4IKF A;  1BM9 A;  4XK4 A;  3FXO A;  5LD2 C;  3HRT A;  4E6K G;  3E3V A;  3F22 A;  2X1E A;  1NHA A;  1JTX A;  2K7L A;  1YS7 A;  3FHN A;  5HOD A;  4ENM A;  1I50 J;  2QZ8 A;  2O61 A;  3Q0U A;  4PSW A;  3CUO A;  1Z3Y A;  2ELK A;  5FKO A;  2XAH A;  1EH6 A;  5FB2 A;  2YR2 A;  3MVP A;  3RSN A;  3CO7 C;  1Z9C A;  2CQX A;  4RM2 A;  4M9Z A;  1SFX A;  1R4M B;  2CUE A;  4Y17 A;  4HLX A;  3GME A;  2GIV A;  2FNA A;  2OZU A;  2LRD A;  1Z91 A;  2XUB A;  1VF9 A;  2IXS A;  1G3W A;  5E1W A;  1RR7 A;  4JQF A;  2K85 A;  2H27 A;  4D5C A;  3GTQ J;  1XSV A;  2LKS A;  3TL4 X;  1V5E A;  1VQK I;  2JVG A;  4PJM A;  2F48 A;  2C6Y A;  3O3K A;  2RV8 A;  3RQ4 A;  3ZQ7 A;  2BE5 F;  5EZG A;  1ACI A;  1BL0 A;  2KJB A;  3SEZ A;  3WG7 H;  4DZP A;  5ICF A;  3IC7 A;  3ZR8 X;  4BJ6 C;  1O3Q A;  3VYR B;  4HNV A;  2LYC A;  5DUK A;  1IF1 A;  2WWY A;  2DYR H;  3CP8 A;  4LGW A;  4BQO A;  5DCF A;  5DM7 F;  3MN2 A;  2CO5 A;  3CCY A;  1HW2 A;  2Q2E B;  5CVJ A;  2KLO A;  1WFX A;  1SEU A;  4BL0 B;  2DOA A;  2LDU A;  2R7Z J;  2L02 A;  5DUI A;  3BRO A;  2PJP A;  2L01 A;  3K9T A;  1WGX A;  3P9C A;  4KT6 A;  4HQM A;  1OJL A;  2VI6 A;  3HL2 A;  2M3A A;  3PNT A;  2TCT A;  5HLI A;  1BIB A;  1GV5 A;  2E35 A;  1WWX A;  4KFC A;  2ISZ A;  2M1B A;  1O3T A;  2DA6 A;  2QSG X;  1LEB A;  3UR3 C;  1SD5 A;  2L7M P;  3HJE A;  3ERE D;  3G4S I;  2NNN A;  2MYS A;  2HEO A;  4KYW A;  4QLC U;  3E97 A;  2V1U A;  2JA8 J;  5F27 A;  3GTK J;  2CH0 A;  2G0E A;  3JAM Z;  1E17 A;  4BDY A;  5DV5 A;  4AID A;  2K9L A;  5D5V B;  1JKR C;  1XTA A;  2E1N A;  1K61 A;  1W36 C;  5HNH A;  3CC7 I;  4LFU A;  3B6A A;  1AHD P;  3ABU A;  5EEH A;  4AYB A;  2QSH X;  3MKW B;  2EIK H;  1TWH J;  4IHT A;  2VB6 A;  4CIC A;  4RDU A;  3BJO A;  2G7H A;  2VON A;  4Z6Y A;  3T1B A;  3G71 I;  4UY8 I;  2A5W A;  1MIJ A;  2Y75 A;  3PNY A;  4XON A;  2NVU B;  1Z7L A;  5K5R A;  4EM1 A;  4UVC A;  1QVU A;  1ZGJ A;  4HBL A;  1MH3 A;  4BQQ A;  4A6E A;  3M4O J;  1W7P A;  2FU4 A;  1VQ8 I;  1YIT I;  3W6V A;  4RAY A;  4XSZ F;  2DFI A;  2L3D A;  4IPA A;  3S1Q J;  1OYI A;  2VBY A;  3S2W A;  3JW4 A;  4HF1 A;  4BJ5 C;  4F52 A;  4I0A A;  2I5U A;  1SAX A;  1U5T B;  3ISP A;  4MEY F;  2JWT A;  1Z67 A;  2YS9 A;  4QPQ A;  5KCM A;  4U88 A;  2W1O A;  2X85 A;  1JKQ C;  4AM3 A;  1MBF A;  2RC4 A;  3HYI A;  1S9H A;  1SMT A;  1RPW A;  3EPZ A;  4CHU A;  5FKL A;  3HOT A;  1S3J A;  2DAO A;  1ETX A;  4P5O A;  2JK3 A;  2QLZ A;  1O7L A;  1U8B A;  4L0Y B;  1TTY A;  4XKC A;  3CJN A;  2R5Y B;  2E1M B;  1P6R A;  1FBU A;  2CSO A;  2E5Z A;  3K4N A;  2XV4 S;  3OR1 C;  3VSL A;  4KIG A;  2HR3 A;  3GZ6 A;  1NG6 A;  4RAF A;  2M0M A;  1ZAO A;  2HS5 A;  3GYH X;  1VQO I;  3GXO A;  3OL4 A;  4GGG A;  1OYW A;  1Q1V A;  3K1N A;  3A2K A;  3CF2 A;  1FP1 D;  4K2E A;  1LJ9 A;  5E18 F;  1CGP A;  2FML A;  5BOX A;  4A3D J;  4X1E A;  5HLG A;  4EJO A;  1O7F A;  3Q9V A;  3L7W A;  3FX3 A;  5F0C A;  3GTM J;  5KAF C;  1Z1D A;  1A04 A;  4OIR F;  1I3Q J;  3RI4 A;  2PMZ N;  4D7N A;  3RKX A;  1K83 J;  3ZQF A;  2EQR A;  2BXZ A;  1TT5 B;  3VEP A;  4EM0 B;  2K5C A;  2JUC A;  2JPC A;  3IAM 2;  1TQM A;  2NS7 A;  3QAH A;  4ABZ A;  2NYX A;  3QOP A;  3BY6 A;  1LE8 A;  2VUM J;  4M6V A;  1BR1 A;  3KLO A;  2XIG A;  5H2F C;  4LK0 F;  3HRU A;  1QPM A;  4UVB A;  4BHC A;  1OCT C;  4HPQ A;  3M8E A;  1DPU A;  2E7X A;  2WAD A;  4AVZ A;  3S32 A;  3OYM A;  4J19 A;  3CLQ A;  3MZH A;  2M5W A;  4IOC F;  1DP3 A;  1TQP A;  2ZME B;  3V7C A;  1A5J A;  4WX9 A;  5IOY A;  2XAJ A;  4ZDL A;  3HOV J;  2W24 A;  3JRG A;  3FF5 A;  3ZN0 A;  1YHQ I;  3QYE A;  1ZRE A;  2QBY B;  4RGX A;  5J6X A;  3CDI A;  2DFH A;  2STW A;  3I3L A;  3CC4 I;  1YW9 A;  2L9S A;  5JR3 A;  2FE3 A;  1ULY A;  2ZXW H;  3BG6 A;  4ZTJ A;  1ZRF A;  3CJR B;  2P0W A;  2JRT A;  3RYP A;  5ICG A;  2LKX A;  5CVR A;  3BP8 A;  5GPC A;  4MGR A;  1XS9 A;  4M9S A;  1UHW A;  2JT1 A;  3ZMT A;  4A3C J;  5DEQ A;  1X1C A;  3DQV C;  1ETO A;  4XRS A;  3AG2 H;  3LQR A;  2VQH A;  5DM6 F;  1HCR A;  2VE8 A;  1VQ9 I;  4FX4 A;  5FRN A;  3HOY J;  2DA4 A;  1FWZ A;  4HW0 A;  3TDZ C;  2F5F A;  4Y33 A;  1QHH D;  3K7A J;  4C3H J;  3MZY A;  2E71 A;  3TW6 A;  2DK8 A;  3QRF F;  3BCB A;  4BJT A;  1YW8 A;  3E1S A;  4MFD A;  4AU7 A;  1FYM A;  2QQB A;  2WB1 N;  1JI8 A;  1D1B A;  4KIB A;  1HW1 A;  2ZNY A;  4ANJ A;  2KRH A;  2XPW A;  3BQY A;  5HS9 A;  1D5Y A;  1RC9 A;  2O03 A;  3GLX A;  4OOI A;  4L9N A;  4M3D A;  1FSH A;  1IRX A;  2COB A;  1YJ9 I;  1TWC J;  2KMU A;  1BIA A;  3LAP A;  2FBK A;  4FAS D;  4LLL A;  1IXS B;  3F8N A;  1XMA A;  1K79 A;  3WHB A;  2MGQ A;  2L9V A;  4LG0 B;  3DFG A;  1OCZ H;  2IGO A;  2LC2 A;  1YYV A;  2FJ1 A;  4CYC A;  1MJ9 A;  3COA C;  4IZZ A;  1TZL A;  4ZYE A;  3QPH A;  2AS5 F;  3S3M A;  4CCK A;  3BTJ A;  4KDP A;  2RNG A;  2KL4 A;  3G1M A;  5LEJ A;  3TMO A;  4KIF A;  3AL0 C;  4P9F A;  4M72 A;  3ABM H;  2DI3 A;  1YE9 A;  2DXI A;  5J8F A;  2GXB A;  4HX8 A;  3KE2 A;  1G2H A;  4M3G A;  1X3Z B;  2RQP A;  3FM5 A;  1B6A A;  2J5P A;  1ZR4 A;  3IAS 2;  5E1X A;  1X3W B;  3CO6 C;  3HM5 A;  4PGH A;  2NS0 A;  3ZQG A;  3BT9 A;  3GUD A;  1Q1H A;  4XOP A;  2JPB A;  5EEG A;  1YTY A;  1IC8 A;  3BQZ A;  3HUG B;  2CQK A;  4HLY A;  2QM3 A;  5FD5 A;  3ZMS A;  4ESB A;  1T2K A;  2M45 A;  2HDC A;  1S7A A;  3W6J B;  1PJR A;  3I4M J;  1X3U A;  2DQL A;  4V19 K;  5DCM B;  1B9M A;  4XOR A;  2DT5 A;  1ZN2 A;  2EV0 A;  4IQ4 A;  4XKB A;  1SVM A;  2HVR A;  3OSG A;  2LY9 A;  2Z3Y A;  2KZG A;  1U9O A;  2IA1 A;  2V26 A;  1P7J A;  4IF4 A;  3HRM A;  3HSR A;  2IA2 A;  3WU2 C;  3RTR A;  3F8C A;  3GZ5 A;  1FJL A;  3I4P A;  2RN7 A;  4PFP A;  3JRE A;  1FT9 A;  3FXJ A;  4BNC A;  4E7L A;  2ELH A;  4QWQ A;  3K4B A;  2ACJ A;  2PG4 A;  1G3T A;  3HDD A;  1F1Z A;  5CJ9 A;  5ERI A;  5ILS A;  3CJQ B;  5M5Y J;  3Q0V A;  4ZZD A;  1AKH B;  2Z5U A;  1YIO A;  3FBN B;  3VYT B;  1F36 A;  5IY5 H;  2CW7 A;  1S6L A;  3RKW A;  4I2O A;  3WG9 A;  1QO0 D;  2JN6 A;  1CQT A;  4RAG A;  3PUB A;  4B8X A;  2X4H A;  1IV8 A;  2VKD A;  2ZKZ A;  2HTJ A;  1ON2 A;  2JZY A;  4YIR X;  3JRB A;  5FRM A;  1LFU P;  3ZMZ A;  1LVA A;  2NVT J;  3ZOB A;  4CCL A;  3MKY B;  2X48 A;  3DWL E;  3SDB A;  1IRZ A;  1N77 A;  1D0Z A;  4RB3 C;  3GX4 X;  4F55 A;  5CVV A;  4LIV A;  1MBE A;  5D8L B;  2R7D A;  1KQ8 A;  5HVQ C;  1H9T A;  4CA0 A;  1TT0 A;  1OKR A;  3V7S A;  2DQR A;  4CCM A;  4XM3 A;  1O57 A;  2JA2 A;  2GA1 A;  2HDD A;  2XHK A;  2W57 A;  3ASO H;  1KQ9 A;  3HTS B;  3WTY C;  4AIK A;  3K0L A;  2A61 A;  2MW8 A;  1H88 C;  3DPT A;  2P81 A;  5EG0 A;  1W5S A;  1T8I A;  3K1P A;  2Q0O A;  5IYB J;  2HZT A;  2DFE A;  1FTZ A;  4A3B J;  2DK5 A;  1IAW A;  5E8G A;  2K86 A;  4HF0 A;  3BJA A;  4M9X A;  4X6A J;  3PO2 J;  4LLG F;  2WC2 A;  2L7K A;  4Y4R A;  5B3S H;  3JRF A;  4P9U A;  5L3C A;  1TLH B;  1Y1W J;  1G59 A;  2B63 J;  2ICW G;  1XSX A;  3LSP A;  4KMF A;  2VOD A;  5FJ8 J;  3AG3 H;  5F64 A;  4BDZ A;  2IS6 A;  2PMU A;  4U0Y A;  2X1C A;  4RMN A;  5DTD A;  2VT3 A;  4ZZL A;  1WRJ A;  4KN4 X;  3G6E I;  2P5L C;  3SFZ A;  2IP2 A;  3SYT A;  1NK2 P;  3R0J A;  5ICC A;  3K2A A;  2NOJ B;  5CQG A;  5E20 A;  1ZR2 A;  1FOX A;  3M8F A;  1LNW A;  2R7V A;  1HA8 A;  3DBH B;  1LVK A;  5FGM A;  4JOM A;  1O3S A;  2M0C A;  1H9G A;  3A1Y A;  3H5A A;  2RAE A;  3IUO A;  3HHG A;  2CV0 A;  2R5Z B;  1J75 A;  3TW7 A;  2H6C A;  2LD5 A;  4IHW A;  1MBG A;  3JRI A;  2BY1 A;  1HDP A;  3W3C A;  1J59 A;  2BY0 A;  2XVC A;  4XRM A;  2ZNZ A;  2AQE A;  2OPT A;  4M73 A;  5EF6 A;  2CV1 A;  5L3F A;  3D5L A;  2KIU A;  3LSJ A;  4N4O B;  2DJN A;  1MMD A;  5H6Q A;  3RKY A;  3DLL F;  1WJD A;  2CRG A;  2V9V A;  3M9A A;  3T0Y A;  3H1C A;  4MTE A;  5C3E J;  1DU6 A;  1P92 A;  4D1Q A;  4HEA 2;  2XPU A;  3ERM A;  4HQE A;  2EIL H;  3H3U A;  1B59 A;  5LRR A;  2ZBK A;  1MGT A;  3KEY A;  4W97 A;  4N9I A;  1JXS A;  3LSH A;  1X4O A;  2Y2Z A;  2LH9 A;  2EJR A;  1IV6 A;  1ZK8 A;  5E3O A;  2V9K A;  2DOE A;  4OIP F;  5H20 A;  1VFC A;  4G6Q A;  3TQN A;  2ZCW A;  2EFN A;  3MFK A;  2VBW A;  4IL6 C;  5FLV A;  5K5Q A;  3C2H A;  4HYE A;  3H35 A;  4XSX F;  2H1K A;  5IOZ A;  3KZZ A;  2FNP A;  2P6S A;  4EJU A;  3E5X A;  2NAZ A;  4P96 A;  3TGN A;  3N97 A;  1F5T A;  2VJI A;  2P8T A;  2ECC A;  4HNT A;  3K4K A;  1P4A A;  3HXL A;  1C0W A;  1W7P B;  4HDV A;  1ZGW A;  3CMY A;  2OCC H;  3CMM A;  5FKK A;  2UWM A;  1XGS A;  1PUF A;  4IRG A;  3D5R C;  2XGD A;  2HOT A;  5GPA A;  3PO3 J;  2QVO A;  1RI7 A;  4LB6 B;  4OIQ F;  4EAT A;  2KJC A;  4H4K C;  1MW7 A;  1I1S A;  3H5R A;  4LMY A;  4L9T A;  1EV7 A;  1TW2 A;  1O4X A;  1D8J A;  3W2V A;  4J01 A;  1DGR M;  2F5C A;  3HEF A;  3I58 A;  1A35 A;  5LGN A;  1U78 A;  2K9N A;  4NUB A;  2K27 A;  5LHH A;  4HV5 A;  2P7C B;  2CV2 A;  4B09 A;  4A3M J;  1K78 B;  3GWZ A;  4EJW A;  5K1Y A;  3J80 Z;  3QYB A;  2D1V A;  2DFF A;  2XKO A;  1FYL A;  3RDI A;  1R23 A;  2QGU A;  2YX4 A;  4G12 A;  4BY7 J;  2W85 A;  3P9K A;  1B4A A;  2QKL B;  3FMS A;  2NVQ J;  4BYY A;  1XB4 A;  2XGE A;  1OCO H;  2YUS A;  2HGC A;  1S72 I;  3R60 A;  2QWW A;  6PAX A;  1VQ5 I;  2ZB9 A;  4LIT A;  3OOU A;  4CYD A;  1FOY A;  4N0B A;  3LST A;  2O7O A;  2H8R A;  2HOS A;  2LLK A;  1B8I B;  1MJB A;  2K9S A;  5CYV A;  4HV6 A;  3E5Q A;  2XB0 X;  5L3B A;  1ZAR A;  2DOF A;  1V5G A;  3S3N A;  4PZJ A;  2QCO A;  5D6E A;  3LFK A;  4I98 B;  1R49 A;  3M07 A;  1VQ6 I;  4A3I J;  1YIJ I;  1OPC A;  2F5D A;  2RKH A;  3A01 B;  1F43 A;  1OCC H;  3ABL H;  2KIS A;  2MFZ A;  3IHU A;  3SDG A;  4NHJ A;  4YFX F;  3IKV A;  2HFH A;  3ZQC A;  1KU9 A;  5L3D A;  3L2C A;  2MH9 A;  3IWF A;  5HNF A;  3FDY A;  3LSM A;  3I71 A;  1BW6 A;  3OIO A;  4EV0 A;  2KQR A;  1RNL A;  1LFP A;  2CQQ A;  4JYK A;  1N75 A;  4NC8 A;  3RPQ A;  1R58 A;  1QA6 A;  1JGS A;  1SD6 A;  3ZQI A;  3H3V K;  1IUY A;  3LFU A;  2PN6 A;  2W7N A;  3P7N A;  3JRC A;  3BTC A;  4XBF A;  2UXX A;  2XF6 A;  5TJJ A;  2Y0S N;  3DF8 A;  5M5X J;  2L54 A;  2JA7 J;  3QQA A;  3DBR B;  1AOY A;  2ZXI A;  3G1L A;  3S1R J;  1YRN A;  4GRI A;  2GA2 A;  2PQ8 A;  2GXG A;  3DPL C;  2WAF A;  3ZQQ A;  4FHT A;  2M8E A;  2OD5 A;  3DKW A;  2VQC A;  2IEK A;  5JHF A;  2HYJ A;  2AXL A;  3FIS A;  3H0G J;  1YQA A;  2DPD A;  4M3B A;  3GTL J;  4I76 A;  4CDG A;  2OUM A;  5D5W B;  4CCN A;  4BE0 A;  5C44 J;  3IH3 A;  2IS1 A;  2R7U A;  1PP8 F;  4RBO A;  2ZO4 A;  4BBR J;  1PUE E;  3CCM I;  1XGN A;  1ENH A;  3MEX A;  2RQQ A;  4HSR A;  2VBX A;  4NBQ A;  2Z1D A;  3CCU I;  3S1M J;  3S2H J;  2HZD A;  5LGU A;  4BKX A;  5HOO A;  2IBD A;  2XPV A;  2ID3 A;  3DTI A;  2OQG A;  4IHS A;  1JUS A;  2ZFU A;  3DPU A;  1DDN A;  4KUM A;  2HPI A;  2O8X A;  4U0W A;  4B4C A;  2K4J A;  4L5E A;  3BC8 A;  5B1A H;  3R4K A;  4BE2 A;  5IYD J;  4I09 A;  1FZP B;  4BEH A;  4OIO F;  5GAG J;  1HBX G;  3QOE A;  3KP5 A;  1UEL B;  2VC1 A;  2ECB A;  1M1E B;  4OMZ A;  2IVM A;  3HC7 A;  2MLG A;  4XLE A;  1J2X A;  4MIM A;  1W5T A;  4IEJ A;  5F6F A;  4I02 A;  3V4G A;  5BS6 A;  1EKE A;  1LKX A;  1TW3 A;  1YO5 C;  3BPV A;  2OJE D;  4LD5 A;  4A3F J;  3QPS A;  2BXY A;  2R4G A;  1TBX A;  2L7Z A;  4HAM A;  1GLN A;  3FXQ A;  1OLT A;  2FA5 A;  3EUK L;  3OV8 A;  3CMA I;  1HKT A;  3DKY A;  1Z05 A;  3TBI A;  3L09 A;  4EJT A;  5CVU A;  1A36 A;  2CQN A;  3CDL A;  2UZK A;  4PFO A;  2XRO A;  3I4N J;  2AQF A;  2O0Y A;  3AAF A;  2EA4 A;  1FOW A;  2AHQ A;  4BBS J;  3ABT A;  2H09 A;  3HPG A;  3TED A;  1HSJ A;  2J5O A;  1BBY A;  3GO5 A;  3RQI A;  2KIQ A;  3FHZ A;  2R0Q C;  4EJV A;  1B72 A;  1FMV A;  1QZY A;  2L4A A;  4HRI A;  2H8W A;  2O3F A;  2X6O A;  2MSY A;  2P7V B;  2ESH A;  4DQ2 A;  1R6R A;  2Y0M A;  2DT7 B;  2JRM A;  2FSW A;  4OAZ A;  2BBY A;  1VI0 A;  3H9J A;  3VOD A;  3G2B A;  4II3 A;  2O9L A;  4G94 A;  3F8B A;  2H6B A;  2L2O A;  3Q5F A;  1FLI A;  3HGG A;  2KFD A;  4CSW A;  2CG4 A;  1S7E A;  3WTZ A;  4CO8 A;  2E36 A;  3FXR A;  1JUM A;  1BOA A;  5FFZ A;  4A0Z A;  1AU7 A;  2N8G A;  1MSF C;  2UV1 A;  2QA4 I;  5BPD A;  3I56 I;  1R1U A;  1LDJ A;  1MNM C;  2HKX A;  4RGR A;  3K6G A;  4RB0 A;  2IPQ X;  1YS6 A;  2LTP A;  2DN0 A;  4WCG A;  4C3I J;  4BGD A;  4KJZ A;  1OYY A;  3F21 A;  1UHM A;  4RLQ A;  2HQ5 A;  2ZJR F;  5KNL A;  2FUG 2;  1UCR A;  4GYI A;  4MFE A;  3LL7 A;  4UNO A;  3QWL A;  1SD7 A;  4AUX A;  3Q0W A;  3K4M A;  2CW8 A;  5FKM A;  4BE1 A;  1RKT A;  3ZXS A;  2KZV A;  2HQN A;  1VQ4 I;  4G6T B;  2CUZ A;  1RIO H;  3BR3 A;  3JAM K;  4IQJ A;  3V8K A;  5D4R A;  4ESJ A;  2VOP A;  2XF5 A;  3TP3 A;  2WBM A;  3G73 A;  1MDM A;  4UXN A;  1ETQ A;  4ITV A;  1H8A C;  1VND A;  2X51 A;  2LG4 A;  4LIU A;  2LY2 A;  4YII A;  4OU0 A;  2YU9 J;  4BXX J;  3CZ6 A;  4PSX A;  1MBK A;  3GVA A;  5FRO A;  4L18 B;  4PCQ A;  1YI2 I;  3D5S C;  4UVA A;  4LK1 F;  4IXA A;  3K70 C;  5B5E C;  1ERD A;  4R1H A;  3BG5 A;  4UV9 A;  2HXO A;  2WTE A;  1W1W E;  1DGW Y;  1F4K A;  4I0B A;  1BA5 A;  4KIT B;  3TOB A;  4XL9 A;  5LEK A;  1I1G A;  1ETK A;  1KU3 A;  5F1J A;  4FQG A;  2MH2 A;  1U9N A;  3OYB A;  3J7A O;  3EDP A;  4UUV A;  4CXF A;  2WA0 A;  5IP9 J;  2W82 A;  1ETW A;  1PP7 U;  3KP4 A;  3S1N J;  3L2W A;  2HKO A;  1R71 A;  3TOA A;  2I10 A;  3F23 A;  1ZTR A;  2BVL A;  3HB9 A;  3F72 A;  1PVE A;  1QVT A;  4MQV A;  4X0G A;  1VTN C;  4A93 J;  1JT0 A;  3BLY A;  4NB5 A;  3GTP J;  1UG2 A;  2UXN A;  3HBL A;  2XAF A;  1I39 A;  3ZP5 A;  4ENN A;  1B1B A;  3WE3 A;  4S05 A;  2O5R A;  2WV0 A;  4FIS A;  2DA1 A;  4HDU A;  3EYI A;  3ULQ B;  2ZXJ A;  1F9N A;  3QU3 A;  3REO A;  4BY1 J;  3AG4 H;  5EGO B;  2DMT A;  1U8R A;  1D5V A;  2COM A;  1XPX A;  2FOW A;  4XMY A;  4B3X A;  2W25 A;  4A5N A;  3HOZ J;  3PM1 A;  3RKQ A;  2V1X A;  1I6H J;  5D4S A;  3MAJ A;  2HYF A;  5F0F A;  4W1U A;  2FXA A;  5FO5 A;  1LB2 A;  3C7J A;  3DTE A;  2R7F A;  2IT0 A;  3NEU A;  1E0E A;  1ORK A;  3BOQ A;  3RYR A;  5J4Y A;  5GAH J;  1Y1V J;  1B9N A;  1WJ5 A;  3E7L A;  2R7S A;  2B0L A;  3ASN H;  4ETS A;  4RGU A;  1Z21 A;  3G1O A;  1WH5 A;  2MD0 A;  2KDZ A;  1EA3 A;  2M30 A;  2GLO A;  1FTT A;  2BY3 A;  3JR9 A;  1JKP C;  3FKJ A;  2OA4 A;  2LY1 A;  1WJA A;  3FXL A;  2M87 A;  1BJZ A;  2P6T A;  2Q2E A;  3N4M A;  3K69 A;  2NVX J;  1T6S A;  1P2F A;  1NK3 P;  5IT3 A;  3QP6 A;  4RAZ A;  4F92 B;  2Z9O A;  1ETV A;  3GEZ A;  4EM2 A;  2HWV A;  5EYR A;  4V2G A;  1G4D A;  2KKO A;  2BGC A;  3FK7 A;  2OF7 A;  3LAJ A;  4YIF A;  1ZEL A;  3HRS A;  3SEQ A;  1BOB A;  1I3A A;  4FTH A;  5FLM J;  5K7F A;  1IW7 F;  4P55 A;  1T0F C;  3DP7 A;  1JTY A;  3KEO A;  2EV6 A;  1K4S A;  2FOK A;  3VWB A;  1P4X A;  3I53 A;  2EZI A;  1MMG A;  3CP2 A;  2XGX A;  1UMQ A;  4OIN F;  4M6Y A;  1LUJ B;  3RZO J;  2KP6 A;  4EEF G;  1SD4 A;  3MCZ A;  1WI9 A;  3QYF A;  3FK6 A;  4A3J J;  2KT0 A;  2F4M B;  4IX7 A;  1J9I A;  1Y39 A;  2M7A A;  1MH4 A;  3I0T A;  5M3F J;  3D1N I;  1UHS A;  2PFB A;  2W4S A;  4D5F A;  5E17 F;  2KRF A;  3GF2 A;  3J81 K;  1VQN I;  5ED4 A;  2LP0 A;  2Q8K A;  3R6S A;  3OYG A;  1OMI A;  1Y8Q B;  1Z7U A;  4B44 A;  3BG7 A;  4YFN F;  5BPI A;  2QYO A;  3R61 A;  3CLO A;  2DT6 A;  3IP4 B;  2MLK A;  5DYM A;  1HF0 A;  2P4W A;  3LMM A;  4XLN F;  3DCF A;  1TC3 C;  3ROU A;  3WTW C;  4WWC A;  2R7W A;  3KP7 A;  4MHG A;  4PUS A;  2E7W A;  3DEU A;  3S93 A;  1TWF J;  2CQ7 A;  4XQF A;  2BEO A;  5IT9 Z;  1GV2 A;  1TL8 A;  2A68 F;  1Z77 A;  3HHH A;  3X2Q H;  3GFL A;  1XD7 A;  5ILU A;  4XID A;  1GXP A;  3CTA A;  2LOO A;  3JRD A;  4CZZ A;  2Z33 A;  3FZV A;  3SZG A;  3ZCO A;  3LSR A;  3KCC A;  1R22 A;  3LWF A;  1RKW A;  2OQR A;  2A69 F;  4OAY A;  1RES A;  3K70 D;  2IJL A;  1IDZ A;  1ODD A;  4Q48 A;  3ZN1 A;  3WTV C;  3V7R A;  2X6W A;  1T08 B;  2WY7 Q;  3KX2 A;  2W84 A;  3ECO A;  4KT5 C;  2H1L A;  1S29 A;  4R79 A;  3L2V A;  1XDU A;  4YG2 F;  2IRF G;  3PUF A;  1YRN B;  4A69 C;  2MG4 A;  1MZB A;  4C3J J;  4G7Z F;  4N4N B;  1JHF A;  3IV5 A;  4NC7 A;  1IN7 A;  3WTT C;  2L0K A;  3KP6 A;  1X1P A;  1DQU A;  3M7G A;  5E3M A;  1J7K A;  2DTR A;  2Q1Z B;  4U7B A;  4CGZ A;  2HVS A;  4D7M A;  3T5X A;  4FCY A;  3B02 A;  2EIM H;  3I59 A;  5FLX Z;  2CGP A;  3M1E A;  1A6I A;  1G3S A;  1RR8 C;  3OIP A;  4FE4 A;  2R92 J;  1GUU A;  2R7O A;  5IP6 A;  3L2Q A;  2IS2 A;  1YG2 A;  4BAY A;  2D2W A;  4IHY A;  3T8T A;  1ZRC A;  2IAI A;  1R5H A;  3IKT A;  4N9H A;  1JT6 A;  1ZLK A;  1E3H A;  4A0X A;  4AYB N;  1R5I D;  4IJA A;  3GTG J;  2Z99 A;  4BQN A;  1LQ1 A;  2B9S A;  3ELK A;  2O8K A;  5FFX A;  1K4T A;  1X4P A;  2VE9 A;  1WSU A;  2RDP A;  2HTS A;  3S14 J;  2L7F P;  5D6F A;  5AIQ A;  2K3P A;  2DMN A;  2DTZ A;  2K4B A;  3LSK A;  2BY2 A;  3CUQ C;  4RA2 A;  4G9Y A;  3S15 J;  3LA3 A;  3MMY B;  2Y9Z A;  1ZYR F;  1NH3 A;  1K6Y A;  4E4H A;  4E7Z A;  3A02 A;  1XC5 A;  1BW5 A;  3DEE A;  2R3S A;  2HU9 A;  3PFY A;  2CFO A;  2EH3 A;  2K40 A;  4G7H F;  2F5E A;  2DMP A;  2KIF A;  2EFP A;  4YEJ A;  1LFB A;  1MMS A;  2GOX B;  4XLA A;  1S8N A;  4PJL A;  3SZP A;  4XRS G;  3L2R A;  2HPM A;  4EGY A;  4PJN A;  1R4N B;  4M71 A;  1X58 A;  4AC0 A;  3WTU C;  4L9J A;  4UB6 C;  3UKG A;  4A3E J;  2KPM A;  5LGT A;  1ZG5 A;  4TV7 A;  4E70 A;  2F5V A;  3OWT A;  4RS8 A;  1O3R A;  3PIO F;  2K02 A;  4KIS A;  1P4W A;  2AXT C;  4NNJ A;  2OCE A;  2BW3 A;  1TNS A;  1PDN C;  4IRH A;  4WXH A;  4LLN A;  2M4K A;  1FC3 A;  2VL8 A;  4C9Y A;  3DKX A;  5KK1 A;  2V79 A;  3S2D J;  3LNQ A;  4A3K J;  3BG3 A;  1IXC A;  1JE8 A;  2LBF A;  3BJ6 A;  1B72 B;  3FIW A;  3M3Y J;  4G8X A;  2OZ6 A;  5TRD A;  1X1D A;  5K7Z A;  3LOC A;  4E7I A;  1BR2 A;  1OIS A;  3TO7 A;  2MC4 A;  3KIO A;  4ZC3 A;  4LG0 A;  4C2M J;  3PJR A;  3H92 A;  3HSE A;  1BC8 C;  4RB2 C;  3M1C A;  5CLS A;  3SFI A;  1I27 A;  3HPH A;  4J00 A;  1BN5 A;  5A2Q Z;  2GQQ A;  3CC2 I;  2DCE A;  2ZJQ F;  4AWX B;  1IN8 A;  3Q3S A;  2DA7 A;  1APL C;  2OC6 A;  3A03 A;  2LF7 A;  4BHB A;  1KON A;  2KIM A;  3GLL A;  4AIH A;  4QPO A;  2FRH A;  3A4C A;  4BQA A;  1IXR C;  2WB1 A;  2DPU A;  1KYW A;  4ZTF A;  1HLV A;  2R7X A;  3NWT A;  4I7H A;  3PSF A;  3GFJ A;  4YFK F;  3RIR A;  1R5G A;  4LJZ F;  3ZQH A;  5ILV A;  1N78 A;  1JUP A;  3HUG A;  4EVI A;  5J4V A;  3QOD A;  4LOC A;  4HX7 A;  3FKI J;  2LR8 A;  3HZJ A;  5ICE A;  2WAE A;  2XC7 A;  2E1C A;  1SVO A;  2XRN A;  2VXZ A;  3LA7 A;  5DCM A;  1RET A;  3FMR A;  4P1W A;  2D1H A;  4BAC A;  1YJW I;  3KYC B;  4F93 B;  3H9Q A;  3VDX A;  4L5J A;  5B66 C;  3BTI A;  1LE8 B;  2MAB A;  1IRF A;  3HIF A;  2PI0 A;  1WI3 A;  1G3Y A;  4V2F A;  1T0F A;  1XCV A;  2ID6 A;  3W2W A;  4ZDP A;  2DOD A;  1BI2 A;  1TNT A;  3A0B C;  4PJ0 C;  2V6C A;  1VQP I;  2D5V A;  1U2W A;  2EBI A;  1FMW A;  1TWA J;  3MKL A;  5HS7 A;  1W4M A;  1X1A A;  1MND A;  5BQT A;  1IJW C;  2OTJ I;  2ESN A;  1MDM B;  4PK4 A;  4DYR A;  1OFC X;  3QP5 A;  2NNY A;  3DU5 A;  2DJI A;  4XRF A;  3ABK H;  2OV7 A;  1KU2 A;  1T33 A;  3W6K B;  1AA7 A;  1POG A;  3WGH A;  1R36 A;  4A2U A;  3CME I;  2CFX A;  5HDG A;  5LBQ A;  1AWC A;  1U3E M;  3RJP A;  4M3E A;  3PSI A;  1T38 A;  5KAI C;  1MKM A;  1WVR A;  5JVG F;  4Y13 A;  3W2A A;  3P5J A;  3LSI A;  1FX7 A;  2CW0 F;  3WGI A;  4Y7N J;  4H0E A;  2VN2 A;  2X6Y A;  4XKV A;  2KHM A;  1SVL A;  1HDD C;  5HDK A;  3SHF A;  4KA4 A;  3ECH A;  3L2U A;  2PX9 A;  3OYL A;  4II2 A;  3GFI A;  4Q5S F;  2EIJ H;  3U9G A;  4NDL A;  5GAE J;  1WCM J;  5JLX A;  2VLA A;  1BI0 A;  2X6X A;  1XX5 A;  2XRL A;  5GP9 A;  2EV5 A;  1JKO C;  4C2T A;  2Z2S B;  2E2J J;  3BZK A;  2STT A;  1KGS A;  4F7Z A;  5F04 A;  2QQA A;  3DXJ F;  4KNY A;  3BR0 A;  2LMD A;  3J80 K;  4GO1 A;  2JVH A;  2OBP A;  2ETH A;  2ZJ2 A;  4O3M A;  1ONV A;  2PJR A;  2BZT A;  4HX4 A;  3ONQ A;  4A5M A;  1E3O C;  2NOG A;  5EZH A;  3SJM A;  2NS8 A;  5GTI C;  2XAU A;  4BH9 A;  2K3F A;  2HXI A;  1FIP A;  1ZG3 A;  4GYG A;  1V54 H;  2XAG A;  2EK5 A;  1HC8 A;  4CYC B;  2LRE A;  2FQ3 A;  1I5Z A;  2R7Q A;  2NRA C;  2V4J C;  2X1D A;  5CKT A;  1Z6R A;  1QBJ A;  2HYG D;  3MWM A;  5IYC J;  2P5V A;  3T8R A;  5J8C A;  4PGG A;  1XGO A;  2DU9 A;  2E5N A;  2V6E A;  1W7P D;  3DV8 A;  3CCR I;  1ZG1 A;  1R1T A;  3H5N A;  1S5L C;  2WV1 A;  1FNN A;  1MJA A;  2VQG A;  1SFE A;  5LLQ A;  3F6O A;  3CCV I;  3OYI A;  1ZGA A;  4I01 A;  3WU1 B;  4UB8 C;  2FMY A;  2WAQ A;  3H9G A;  2DDA A;  4KMU X;  4M74 A;  4HNU A;  3IL2 A;  2VC0 A;  2F4O B;  3DBL B;  3J7A Y;  1UST A;  2QSF X;  3SZT A;  4F91 B;  5BMZ A;  2JTV A;  2QEN A;  4F3Q A;  1HQC A;  1WKM A;  3VPR A;  1ON1 A;  2R5Z A;  2FQ4 A;  1IN4 A;  4WK8 F;  4Y52 J;  2Y69 H;  3BTL A;  3FXM A;  1WJC A;  3ZMV A;  3S16 J;  2ZSH B;  3BDD A;  3CCL I;  1X1B A;  1ZRD A;  1D0Y A;  3LSG A;  4BS9 A;  2K9Q A;  4FET A;  1XDS A;  3CUQ A;  5L3E A;  5J3L A;  1ZKG A;  5TGT A;  5L3G A;  3K1M A;  3OY9 A;  1VQL I;  3OYK A;  1VQM I;  1WZ2 A;  1FYK A;  2YU3 A;  1Y6I A;  2X9D A;  2EWN A;  4GDF A;  3QPL A;  3WTS C;  2VPL A;  3KEQ A;  2FD5 A;  3PQK A;  4JP0 A;  2P5K A;  1KA8 A;  4MO7 A;  2GM4 A;  3H36 A;  1GXQ A;  1U5T C;  2VKH A;  2EFO A;  2PMH A;  5DS9 A;  1RUN A;  2E2I J;  4AVP A;  1V4R A;  3HGY A;  5FD6 A;  3P9I A;  3JCU C;  4DGW B;  1A31 A;  1REP C;  2VQL A;  4KIC A;  3I64 A;  1WH7 A;  2GOM A;  2DBB A;  2X0L A;  3BR2 A;  3NQO A;  3EUA A;  2MC3 A;  2B7E A;  4DIQ A;  2G7U A;  3PL8 A;  3G3Z A;  3L9F A;  1RUO A;  2E1M C;  3BZC A;  1XG1 A;  2A05 A;  2JQ7 A;  4CZC A;  2O6G E;  3HKZ A;  1CF7 A;  5EEA A;  1YX5 A;  2HVQ A;  4HA8 A;  5LRS A;  3OYD A;  2DA3 A;  3HOX J;  2R93 J;  4RGS A;  3B6C A;  3PFI A;  3I54 A;  4NQW A;  4BXF A;  4FX0 A;  4KN7 X;  2LNB A;  4ZDO A;  1BI3 A;  1P9Q C;  5E8I A;  4B1R A;  1Y0U A;  2VKV A;  4AD9 A;  5K7H A;  3KYL A;  1GDT A;  1L0O C;  3HOS A;  1JJ8 C;  2R7T A;  2MA3 A;  4ZYG A;  1QPI A;  5JFR A;  1R9T J;  5EG0 B;  2HDW A;  2E19 A;  5LHI A;  3WOD F;  5F0H A;  4O6J A;  2PEX A;  1K78 A;  1VQ7 I;  3ZRG A;  1TQI A;  3QPT A;  4WF2 A;  4UUT A;  3CCQ I;  4UUS A;  1HOM A;  1WJE A;  1HST A;  3OL3 A;  3EET A;  2VXD A;  1USS A;  2DMU A;  4MEX F;  1GVD A;  3S3O A;  1OCR H;  1D1A A;  3DLA A;  2ME6 A;  2XB5 A;  2ZME C;  3IH4 A;  5H6R A;  5E79 C;  3E6D A;  1MBH A;  4O5V A;  5KHD A;  4ENJ A;  5HDN A;  3CCJ I;  1FP2 A;  3AFH A;  5JVT A;  3I59 B;  2YPR A;  3F8M A;  2VBZ A;  1XGM A;  3HG9 A;  3B73 A;  3OSF A;  1YJN I;  2GXA A;  3O8G A;  3FBI B;  1B8I A;  2A3S A;  2M9H A;  5FKN A;  2BV6 A;  2CWE A;  3HOW J;  1V3F A;  2R7R A;  2CMP A;  2ZJP F;  1STZ A;  2LKP A;  4Z2Y A;  4S0H B;  1J0R A;  1RZ4 A;  4FE7 A;  3WGG A;  4XLC A;  4DZJ A;  3MKZ A;  3A01 A;  3KLN A;  5AIP A;  2VAS A;  2CU7 A;  2EA2 A;  2OU2 A;  3EUH C;  2LK2 A;  3GW2 A;  4Y3O A;  2YSR A;  4PDK A;  2JJ7 A;  1W0T A;  3GCM A;  2BYV E;  2V9P A;  4XLH A;  4ZYH A;  4DOZ A;  3F8F A;  3OS2 A;  3CDH A;  4WXC A;  3BCA A;  3C1D A;  4XN3 A;  2HQA A;  3PNV A;  3U1K A;  4GCV A;  4EQQ A;  4XNF A;  1TP4 A;  2E34 A;  1N25 A;  2DA5 A;  1EH8 A;  1SFO J;  5B1B H;  2PBI A;  3CCE I;  1D3Y A;  3E5U A;  1UJ8 A;  1FIA A;  1EF4 A;  1BR4 A;  2NXN B;  1FEX A;  3KFW X;  1FY7 A;  4JBA A;  2JA5 J;  4E7S A;  3JRH A;  4MTD A;  3TO6 A;  3NRV A;  3S8P A;  1UZC A;  1E2X A;  2H94 A;  4S04 A;  2VOO A;  1LDD A;  1IRG A;  4C30 A;  1BJA A;  3OR2 C;  2XAS A;  1WPK A;  1IN6 A;  1SFU A;  2FBI A;  2FBH A;  2L5Q A;  2GIZ A;  1R7J A;  4CCO A;  3BR5 A;  4BXU A;  2D45 A;  1W0U A;  2IW5 A;  2HI3 A;  4A0Y A;  3J81 Z;  2W00 A;  1IO2 A;  2RGV A;  2TRT A;  3UNG C;  2BW3 B;  4D0P A;  5IP7 J;  4HF2 A;  3L00 A;  2M34 A;  4XLF A;  2PLY A;  3CF5 F;  3BR6 A;  1X19 A;  4BU2 A;  4XR6 A;  4Q4Z F;  2KRC A;  1SMY F;  2K9M A;  2FF4 A;  4QIW N;  5LFA A;  2EFW A;  2LVS A;  2DYS H;  2LBF B;  3U21 A;  1OR7 C;  3D0S A;  3OOP A;  3J7Z I;  3OIQ A;  1S7O A;  1IGN A;  3KYD B;  1PUF B;  1XMX A;  2TDX A;  4ASN A;  2VJJ A;  2EIN H;  3SXY A;  1U6G A;  1IN5 A;  1IDY A;  2QEX I;  4GXO A;  2OTL I;  1W36 D;  2Y0S A;  3E6C C;  2EZK A;  4OWR B;  2EPF A;  1K6O A;  3F0C A;  5HS8 A;  1J5Y A;  3HSF A;  3O2P E;  3H3Z A;  4JK1 X;  4E7J A;  9ANT A;  2ISY A;  5GTH C;  3TDU C;  2LF8 A;  3K10 A;  4U0V A;  2KDO A;  3OYJ A;  1EJ9 A;  2Y9Y A;  2EZH A;  5E3L A;  1GHC A;  5CVI A;  1H89 C;  3RZD J;  4JX6 A;  1BC7 C;  1X2M A;  1D1C A;  3PQJ A;  4MLO A;  5KVR A;  2V7F A;  4ZYD A;  3AL0 B;  1H0M A;  2MD5 A;  3BG9 A;  4D9J A;  1T39 A;  1XCB A;  1XMK A;  3KZY A;  3OS0 A;  4A12 A;  3AG1 H;  5D5U B;  2DMQ A;  3HTU A;  4XKW A;  4DNC A;  2JA6 J;  1YX3 A;  2JSP A;  3FM3 A;  4HST A;  5J47 A;  1SAN A;  2CUF A;  3RCO A;  1EH7 A;  3OYC A;  3NAR A;  2UUZ A;  4I99 C;  5K5O A;  3QU6 A;  3C3W A;  5J1Y A;  3DU6 A;  3GBG A;  2HOA A;  3V42 A;  1T98 A;  2OAZ A;  5C4J J;  1WJF A;  3CCS I;  4MQ9 F;  1WHU A;  3GFM A;  2A07 F;  4UHT A;  2BHZ A;  1G6N A;  4B43 A;  2AO9 A;  1ZQ3 P;  4RB1 A;  3JRA A;  4XLP F;  4ENK A;  3K2Z A;  1FPQ A;  3M8J A;  4RM3 A;  2LFB A;  4HZF A;  5E1Z B;  3VYU B;  1ITY A;  4B48 A;  4DW6 A;  3NAU A;  1NTC A;  3U2R A;  4EMS A;  3IH2 A;  3OYA A;  3S17 J;  1XN7 A;  1D8K A;  3LA2 A;  1U5T A;  2M7B A;  1K7A A;  2RVC A;  1FOK A;  2VIX A;  3VYS B;  3CD6 I;  2QQ8 A;  5TIS C;  3J7Y J;  1KYZ A;  3KP3 A;  1T95 A;  2VT2 A;  2QKM B;  3I9V 2;  2R5Y A;  4HOB A;  2ELJ A;  1KU7 A;  4NC6 A;  2L9R A;  3CJT B;  4A3G J;  3VOE A;  3VSK A;  2XAQ A;  2E1O A;  1G8X A;  3EQL F;  3HOU J;  4AIJ A;  2L4M A;  2JMW A;  4PJJ A;  1LDK B;  4XN0 A;  1LPQ A;  5AON A;  3KZI C;  2CYY A;  4IOA F;  3NWS A;  4YRV A;  2WAQ N;  1QZE A;  3K4L A;  2XSJ C;  2HQR A;  1GVJ A;  2GBY A;  2Z16 A;  2W48 A;  5M5W J;  3O6B B;  4U7D A;  4L9V A;  4WXD A;  1IG7 A;  2BOL A;  5IPA A;  1JJ6 C;  4A3L J;  1NG7 A;  2JSC A;  2F6C A;  2GWR A;  4M6X A;  3TP0 A;  3I5U A;  5F1R A;  2PJR B;  5HLT A;  1DUX C;  4XIC A;  3ZPL A;  1MMN A;  2G9W A;  2HOE A;  3FXU A;  4IO9 F;  1PYV A;  1ZLJ A;  2F4I A;  5F08 A;  2VJ4 A;  4IVN A;  1QQI A;  3E6M A;  3K4J A;  3JTG A; 
#chains in the Genus database with same CATH homology
 1UB9 A;  4ESF A;  3V8L A;  2ZME A;  2A6E F;  4Q47 A;  1R00 A;  2DW4 A;  3TO9 A;  2QBY A;  3TKY A;  3MQ0 A;  1IZ1 A;  1DPR A;  5JHU A;  3LQQ A;  5HLH A;  3E6B A;  2QQ9 A;  5IT9 K;  3R0A A;  1FBQ A;  1ZHF A;  1YFH A;  3EUH A;  3ZMD A;  3BWG A;  2XKP A;  2YX7 A;  1YLF A;  2FEZ A;  3CUQ B;  2F2E A;  3F3X A;  4A6D A;  3C18 A;  3WTX C;  4MNU A;  3KET A;  1HKQ A;  2DLL A;  1QGP A;  1QNT A;  3U1D A;  3V8J A;  2LSO A;  3FWE A;  4UV8 A;  5D8K B;  1ZH5 A;  1Z6T A;  2EB7 A;  3WU0 A;  5FLX K;  2ZFW A;  4LB5 A;  1WQ2 A;  5D5X B;  1QZZ A;  3VFZ A;  2GZW A;  2A6H F;  1DP7 P;  5LHG A;  2QUF A;  3BPX A;  5DDG A;  1CF7 B;  4FT8 A;  1HW5 A;  3ZMU A;  1OR7 A;  4IRI A;  3ML6 A;  4BHP A;  4ZH4 F;  3IWZ A;  1HXD A;  2GAU A;  1BI1 A;  2MBF A;  3FMQ A;  1UFM A;  3VB2 A;  1FBS A;  2ADU A;  1XSD A;  3JTH A;  3BZ6 A;  2RNJ A;  4OMY A;  2EFQ A;  2V1D A;  4G6D A;  4R8H A;  3SQN A;  2IA0 A;  2DO7 A;  2Y48 A;  1L3L A;  3IRQ A;  5DD8 A;  5JI6 A;  1KQ0 A;  1JHH A;  5DD4 A;  4G7O F;  2A5Y B;  1I6X A;  1LEA A;  4Y15 A;  1FSE A;  3IRR A;  3WE2 A;  1R1V A;  1HKS A;  3F6V A;  4ON0 A;  1MD0 A;  3EYY A;  3RPU A;  3Q9S A;  4L5I A;  3KP2 A;  1YW7 A;  3JSO A;  3JSP A;  4L0Z B;  5A2Q K;  4EGZ A;  1BM9 A;  3HRT A;  3E3V A;  3F22 A;  1NHA A;  2K7L A;  1YS7 A;  4ENM A;  2QZ8 A;  2O61 A;  3CUO A;  5FB2 A;  2XAH A;  1EH6 A;  2YR2 A;  3CO7 C;  1Z9C A;  4M9Z A;  1SFX A;  4Y17 A;  4HLX A;  2GIV A;  2FNA A;  2OZU A;  1Z91 A;  2XUB A;  1G3W A;  5E1W A;  4JQF A;  2H27 A;  1XSV A;  2C6Y A;  3O3K A;  2RV8 A;  3ZQ7 A;  2BE5 F;  2KJB A;  5ICF A;  3IC7 A;  1O3Q A;  5DUK A;  1IF1 A;  2WWY A;  4LGW A;  5DCF A;  2CO5 A;  1HW2 A;  5CVJ A;  2LDU A;  2L02 A;  5DUI A;  3BRO A;  2PJP A;  2L01 A;  3K9T A;  3P9C A;  4HQM A;  5HLI A;  1BIB A;  1WWX A;  4KFC A;  2ISZ A;  2M1B A;  1O3T A;  1LEB A;  1SD5 A;  3ERE D;  2NNN A;  2HEO A;  4KYW A;  4QLC U;  3E97 A;  2V1U A;  3JAM Z;  1E17 A;  5DV5 A;  5D5V B;  2E1N A;  4LFU A;  3ABU A;  5EEH A;  4IHT A;  4CIC A;  3BJO A;  2G7H A;  2VON A;  3T1B A;  2Y75 A;  5K5R A;  4EM1 A;  4UVC A;  1ZGJ A;  4HBL A;  4A6E A;  1W7P A;  2FU4 A;  4RAY A;  4XSZ F;  2DFI A;  2L3D A;  4IPA A;  1OYI A;  2VBY A;  3S2W A;  3JW4 A;  4HF1 A;  4I0A A;  1SAX A;  1U5T B;  3ISP A;  4MEY F;  4U88 A;  2RC4 A;  3HYI A;  1SMT A;  4CHU A;  3HOT A;  1S3J A;  2DAO A;  4P5O A;  2QLZ A;  1O7L A;  4L0Y B;  1TTY A;  3CJN A;  1P6R A;  1FBU A;  2CSO A;  2XV4 S;  4KIG A;  2HR3 A;  3GZ6 A;  3GYH X;  1ZAO A;  2HS5 A;  3GXO A;  4GGG A;  1OYW A;  3K1N A;  4K2E A;  1FP1 D;  5E18 F;  1LJ9 A;  1CGP A;  2FML A;  5BOX A;  5HLG A;  4EJO A;  1O7F A;  3Q9V A;  3L7W A;  3FX3 A;  1Z1D A;  1A04 A;  4OIR F;  3RI4 A;  3RKX A;  3VEP A;  4EM0 B;  2JPC A;  1TQM A;  3QAH A;  2NYX A;  3QOP A;  3BY6 A;  3KLO A;  2XIG A;  4LK0 F;  3HRU A;  1QPM A;  4UVB A;  4BHC A;  3M8E A;  1DPU A;  2E7X A;  3MZH A;  2M5W A;  1TQP A;  2ZME B;  3V7C A;  4WX9 A;  2XAJ A;  2W24 A;  3FF5 A;  3ZN0 A;  1ZRE A;  2QBY B;  4RGX A;  5J6X A;  2STW A;  1YW9 A;  5JR3 A;  2FE3 A;  1ULY A;  1ZRF A;  3RYP A;  2JRT A;  5ICG A;  5CVR A;  3BP8 A;  4MGR A;  4M9S A;  1UHW A;  2JT1 A;  3ZMT A;  5DEQ A;  3DQV C;  3LQR A;  2VE8 A;  4FX4 A;  1FWZ A;  4HW0 A;  3TDZ C;  2F5F A;  3MZY A;  2DK8 A;  3QRF F;  1YW8 A;  1FYM A;  2QQB A;  4KIB A;  1HW1 A;  2ZNY A;  5HS9 A;  2O03 A;  3GLX A;  4OOI A;  4L9N A;  1FSH A;  1BIA A;  3LAP A;  2FBK A;  4LLL A;  1IXS B;  3F8N A;  1XMA A;  1K79 A;  4LG0 B;  3DFG A;  3COA C;  1YYV A;  1MJ9 A;  4ZYE A;  3QPH A;  2AS5 F;  4KDP A;  5LEJ A;  4KIF A;  4P9F A;  4M72 A;  2DI3 A;  5J8F A;  2GXB A;  4HX8 A;  3KE2 A;  2RQP A;  3FM5 A;  1B6A A;  2J5P A;  5E1X A;  3CO6 C;  4PGH A;  2NS0 A;  3GUD A;  1YTY A;  1Q1H A;  5EEG A;  2JPB A;  2CQK A;  4HLY A;  2QM3 A;  5FD5 A;  3ZMS A;  4ESB A;  1T2K A;  2M45 A;  2HDC A;  1S7A A;  3W6J B;  1X3U A;  2DQL A;  5DCM B;  1B9M A;  2DT5 A;  1ZN2 A;  2EV0 A;  2Z3Y A;  2IA1 A;  4IF4 A;  3HRM A;  3HSR A;  2IA2 A;  3RTR A;  3F8C A;  3GZ5 A;  3I4P A;  2RN7 A;  1FT9 A;  4BNC A;  2ELH A;  4QWQ A;  2ACJ A;  2PG4 A;  1G3T A;  1F1Z A;  5CJ9 A;  5ERI A;  5ILS A;  4ZZD A;  2Z5U A;  1YIO A;  4I2O A;  1S6L A;  3RKW A;  3WG9 A;  1QO0 D;  4B8X A;  2X4H A;  2ZKZ A;  2HTJ A;  1ON2 A;  2JZY A;  3ZMZ A;  1LVA A;  4RB3 C;  3GX4 X;  5CVV A;  5D8L B;  2R7D A;  1KQ8 A;  5HVQ C;  1H9T A;  3V7S A;  1OKR A;  2DQR A;  1O57 A;  2GA1 A;  2XHK A;  2W57 A;  3HTS B;  1KQ9 A;  3WTY C;  4AIK A;  3K0L A;  2A61 A;  3DPT A;  1W5S A;  3K1P A;  2Q0O A;  2HZT A;  2DK5 A;  1IAW A;  5E8G A;  2K86 A;  4HF0 A;  3BJA A;  4M9X A;  4LLG F;  2WC2 A;  4P9U A;  5L3C A;  1TLH B;  1XSX A;  4KMF A;  2VOD A;  5F64 A;  2PMU A;  4U0Y A;  2VT3 A;  4ZZL A;  1WRJ A;  4KN4 X;  2P5L C;  3SFZ A;  2IP2 A;  3R0J A;  5ICC A;  5E20 A;  3M8F A;  1LNW A;  5FGM A;  1O3S A;  1H9G A;  3HHG A;  1J75 A;  2H6C A;  1J59 A;  2XVC A;  2ZNZ A;  4M73 A;  5L3F A;  3D5L A;  2KIU A;  5H6Q A;  3RKY A;  2V9V A;  3M9A A;  3T0Y A;  4MTE A;  1P92 A;  4HQE A;  3H3U A;  1B59 A;  5LRR A;  2ZBK A;  1MGT A;  4N9I A;  1JXS A;  2EJR A;  4OIP F;  5H20 A;  4G6Q A;  3TQN A;  2ZCW A;  2EFN A;  3MFK A;  2VBW A;  5K5Q A;  4HYE A;  4XSX F;  3KZZ A;  2FNP A;  2P6S A;  4EJU A;  3E5X A;  2NAZ A;  4P96 A;  3TGN A;  3N97 A;  1F5T A;  2P8T A;  1P4A A;  1C0W A;  1W7P B;  4HDV A;  2UWM A;  1XGS A;  4IRG A;  2QVO A;  1RI7 A;  4LB6 B;  4OIQ F;  2KJC A;  1I1S A;  4LMY A;  4L9T A;  1EV7 A;  1TW2 A;  1D8J A;  3I58 A;  2F5C A;  5LGN A;  1U78 A;  2K27 A;  5LHH A;  4HV5 A;  2P7C B;  4B09 A;  1K78 B;  3GWZ A;  4EJW A;  5K1Y A;  3J80 Z;  2D1V A;  2XKO A;  1FYL A;  3RDI A;  1R23 A;  2YX4 A;  2W85 A;  3P9K A;  1B4A A;  3FMS A;  4BYY A;  1XB4 A;  2HGC A;  3R60 A;  2QWW A;  6PAX A;  4CYD A;  4N0B A;  3LST A;  1MJB A;  5CYV A;  4HV6 A;  3E5Q A;  5L3B A;  1ZAR A;  4PZJ A;  5D6E A;  3LFK A;  4I98 B;  1OPC A;  2F5D A;  2RKH A;  3IHU A;  4NHJ A;  4YFX F;  3IKV A;  2HFH A;  1KU9 A;  5L3D A;  3L2C A;  2MH9 A;  3IWF A;  3I71 A;  4EV0 A;  1RNL A;  3RPQ A;  1R58 A;  1JGS A;  1SD6 A;  1IUY A;  2PN6 A;  3P7N A;  4XBF A;  2UXX A;  5TJJ A;  3DF8 A;  2L54 A;  1AOY A;  2GA2 A;  2PQ8 A;  2GXG A;  3DPL C;  4FHT A;  2M8E A;  2OD5 A;  3DKW A;  2AXL A;  1YQA A;  2DPD A;  4CDG A;  5D5W B;  1PP8 F;  2ZO4 A;  1PUE E;  1XGN A;  3MEX A;  2VBX A;  5LGU A;  5HOO A;  2OQG A;  4IHS A;  1DDN A;  4KUM A;  2O8X A;  4U0W A;  2K4J A;  3R4K A;  4I09 A;  1FZP B;  4OIO F;  1HBX G;  3KP5 A;  2VC1 A;  4OMZ A;  2IVM A;  2MLG A;  1J2X A;  1W5T A;  5F6F A;  4I02 A;  3V4G A;  5BS6 A;  1YO5 C;  1TW3 A;  3BPV A;  4LD5 A;  1TBX A;  4HAM A;  3FXQ A;  2FA5 A;  3OV8 A;  1HKT A;  1Z05 A;  3L09 A;  4EJT A;  5CVU A;  2UZK A;  2XRO A;  2O0Y A;  3AAF A;  2EA4 A;  3ABT A;  2H09 A;  1HSJ A;  2J5O A;  1BBY A;  3GO5 A;  3FHZ A;  4EJV A;  1QZY A;  2L4A A;  2O3F A;  2P7V B;  2ESH A;  4DQ2 A;  2Y0M A;  2FSW A;  2BBY A;  3VOD A;  4G94 A;  3F8B A;  2H6B A;  3Q5F A;  1FLI A;  2CG4 A;  3WTZ A;  4CO8 A;  3FXR A;  1BOA A;  5FFZ A;  4A0Z A;  5BPD A;  1R1U A;  1LDJ A;  2HKX A;  4RGR A;  4RB0 A;  2IPQ X;  1YS6 A;  4WCG A;  1OYY A;  3F21 A;  1UHM A;  1UCR A;  4GYI A;  4UNO A;  1SD7 A;  2HQN A;  1RIO H;  3JAM K;  3V8K A;  5D4R A;  4ESJ A;  2VOP A;  1MDM A;  3G73 A;  4UXN A;  4YII A;  4OU0 A;  3GVA A;  4L18 B;  4PCQ A;  4UVA A;  4LK1 F;  4IXA A;  4R1H A;  4UV9 A;  2WTE A;  1F4K A;  4I0B A;  3TOB A;  5LEK A;  1I1G A;  1KU3 A;  2MH2 A;  3J7A O;  3EDP A;  4UUV A;  4CXF A;  1PP7 U;  3KP4 A;  2HKO A;  3TOA A;  3F23 A;  3F72 A;  4MQV A;  1VTN C;  4NB5 A;  2UXN A;  2XAF A;  3ZP5 A;  4ENN A;  1B1B A;  3WE3 A;  4S05 A;  2WV0 A;  4HDU A;  3EYI A;  3ULQ B;  2ZXJ A;  1F9N A;  3QU3 A;  3REO A;  1U8R A;  1D5V A;  2COM A;  2W25 A;  4A5N A;  2V1X A;  5D4S A;  3MAJ A;  2HYF A;  2FXA A;  5FO5 A;  1LB2 A;  3C7J A;  2R7F A;  2IT0 A;  3NEU A;  3BOQ A;  3RYR A;  1B9N A;  2B0L A;  4ETS A;  4RGU A;  2M30 A;  2OA4 A;  2M87 A;  2P6T A;  2Q2E A;  3N4M A;  3K69 A;  1T6S A;  1P2F A;  5IT3 A;  3QP6 A;  4RAZ A;  2Z9O A;  3GEZ A;  4EM2 A;  2HWV A;  1G4D A;  2KKO A;  2BGC A;  3LAJ A;  4YIF A;  3HRS A;  1IW7 F;  4P55 A;  3DP7 A;  3KEO A;  2EV6 A;  2FOK A;  1P4X A;  3I53 A;  2XGX A;  4OIN F;  4M6Y A;  1SD4 A;  3MCZ A;  1WI9 A;  1J9I A;  3I0T A;  2PFB A;  5E17 F;  2KRF A;  3GF2 A;  3J81 K;  5ED4 A;  2Q8K A;  3R6S A;  1OMI A;  1Z7U A;  4YFN F;  5BPI A;  2QYO A;  3R61 A;  3CLO A;  2MLK A;  5DYM A;  2P4W A;  4XLN F;  3ROU A;  3WTW C;  4WWC A;  3KP7 A;  4MHG A;  2E7W A;  3DEU A;  2BEO A;  5IT9 Z;  2A68 F;  3HHH A;  3GFL A;  1XD7 A;  5ILU A;  1GXP A;  3CTA A;  4CZZ A;  2Z33 A;  3FZV A;  3KCC A;  1R22 A;  3LWF A;  2OQR A;  2A69 F;  2IJL A;  1ODD A;  4Q48 A;  3ZN1 A;  3WTV C;  3V7R A;  2W84 A;  3ECO A;  4KT5 C;  1S29 A;  4R79 A;  1XDU A;  4YG2 F;  2IRF G;  1MZB A;  4G7Z F;  1JHF A;  1IN7 A;  3WTT C;  3KP6 A;  3M7G A;  1J7K A;  2DTR A;  4U7B A;  4CGZ A;  3T5X A;  3B02 A;  3I59 A;  5FLX Z;  2CGP A;  3M1E A;  1G3S A;  1YG2 A;  4BAY A;  2D2W A;  3T8T A;  1ZRC A;  1R5H A;  3IKT A;  4N9H A;  1ZLK A;  4A0X A;  4IJA A;  2Z99 A;  1LQ1 A;  3ELK A;  5FFX A;  2VE9 A;  1WSU A;  2RDP A;  2HTS A;  5D6F A;  5AIQ A;  2K4B A;  3CUQ C;  4G9Y A;  3LA3 A;  1ZYR F;  2R3S A;  4G7H F;  2F5E A;  2KIF A;  2EFP A;  3SZP A;  1S8N A;  4EGY A;  4M71 A;  3WTU C;  4L9J A;  5LGT A;  1ZG5 A;  4TV7 A;  4E70 A;  4RS8 A;  1O3R A;  2K02 A;  1P4W A;  1TNS A;  1PDN C;  4IRH A;  4WXH A;  4LLN A;  1FC3 A;  5KK1 A;  2V79 A;  1IXC A;  1JE8 A;  3BJ6 A;  4G8X A;  2OZ6 A;  5TRD A;  3TO7 A;  4LG0 A;  3H92 A;  3HSE A;  1BC8 C;  4RB2 C;  5CLS A;  1I27 A;  1BN5 A;  5A2Q Z;  2GQQ A;  4AWX B;  1IN8 A;  2LF7 A;  4BHB A;  2KIM A;  4AIH A;  2FRH A;  4BQA A;  1IXR C;  2DPU A;  1KYW A;  4I7H A;  3GFJ A;  4YFK F;  3RIR A;  1R5G A;  4LJZ F;  5ILV A;  3HUG A;  4EVI A;  4HX7 A;  5ICE A;  2E1C A;  2XRN A;  2VXZ A;  3LA7 A;  5DCM A;  3FMR A;  2D1H A;  4L5J A;  1IRF A;  3HIF A;  2PI0 A;  1G3Y A;  1T0F A;  1XCV A;  1BI2 A;  1TNT A;  2V6C A;  1U2W A;  5HS7 A;  1W4M A;  5BQT A;  2ESN A;  1MDM B;  3QP5 A;  2NNY A;  4XRF A;  1KU2 A;  3W6K B;  3WGH A;  1R36 A;  4A2U A;  2CFX A;  5HDG A;  5LBQ A;  1AWC A;  1U3E M;  3RJP A;  1T38 A;  1MKM A;  4Y13 A;  1FX7 A;  2CW0 F;  3WGI A;  4H0E A;  2VN2 A;  5HDK A;  3SHF A;  4KA4 A;  3ECH A;  3GFI A;  4Q5S F;  3U9G A;  1BI0 A;  2EV5 A;  2STT A;  1KGS A;  4F7Z A;  2QQA A;  3DXJ F;  4KNY A;  3J80 K;  4GO1 A;  2OBP A;  2ETH A;  2ZJ2 A;  4O3M A;  1ONV A;  4HX4 A;  4A5M A;  4BH9 A;  1ZG3 A;  4GYG A;  2XAG A;  2EK5 A;  2FQ3 A;  1I5Z A;  2NRA C;  1Z6R A;  1QBJ A;  2HYG D;  3MWM A;  2P5V A;  3T8R A;  5J8C A;  4PGG A;  1XGO A;  2DU9 A;  1W7P D;  3DV8 A;  1ZG1 A;  1R1T A;  1FNN A;  1MJA A;  5LLQ A;  1SFE A;  3F6O A;  1ZGA A;  4I01 A;  3WU1 B;  2FMY A;  4KMU X;  4M74 A;  3IL2 A;  2VC0 A;  1UST A;  3SZT A;  5BMZ A;  2JTV A;  2QEN A;  1HQC A;  1WKM A;  1ON1 A;  1IN4 A;  4WK8 F;  3ZMV A;  3BDD A;  1ZRD A;  1XDS A;  3CUQ A;  5L3E A;  5L3G A;  3K1M A;  1FYK A;  2YU3 A;  2EWN A;  3WTS C;  3KEQ A;  3PQK A;  2P5K A;  1KA8 A;  1GXQ A;  1U5T C;  2EFO A;  2PMH A;  1RUN A;  4AVP A;  1V4R A;  5FD6 A;  3P9I A;  1REP C;  4KIC A;  3I64 A;  2X0L A;  2DBB A;  3NQO A;  2MC3 A;  2G7U A;  3G3Z A;  3L9F A;  1RUO A;  2O6G E;  1CF7 A;  4HA8 A;  5LRS A;  4RGS A;  3PFI A;  3I54 A;  4NQW A;  4FX0 A;  4KN7 X;  2LNB A;  1BI3 A;  5E8I A;  1Y0U A;  4AD9 A;  1L0O C;  3HOS A;  2MA3 A;  4ZYG A;  5JFR A;  5LHI A;  3WOD F;  4O6J A;  2PEX A;  1K78 A;  1TQI A;  3QPT A;  4WF2 A;  1HST A;  3EET A;  1USS A;  4MEX F;  5H6R A;  3E6D A;  4O5V A;  4ENJ A;  5HDN A;  1FP2 A;  5JVT A;  3I59 B;  2YPR A;  3F8M A;  2VBZ A;  1XGM A;  3B73 A;  2A3S A;  2BV6 A;  2CWE A;  1V3F A;  1STZ A;  2LKP A;  4Z2Y A;  1J0R A;  1RZ4 A;  3WGG A;  3KLN A;  5AIP A;  2EA2 A;  2OU2 A;  3GW2 A;  2YSR A;  4PDK A;  2BYV E;  4ZYH A;  3F8F A;  3CDH A;  4WXC A;  3C1D A;  4GCV A;  4EQQ A;  1EH8 A;  2PBI A;  1D3Y A;  3E5U A;  3KFW X;  1FY7 A;  4JBA A;  4MTD A;  3TO6 A;  3NRV A;  2H94 A;  1E2X A;  2VOO A;  4S04 A;  1LDD A;  1IRG A;  1BJA A;  2XAS A;  1IN6 A;  1SFU A;  2FBI A;  2FBH A;  1R7J A;  4BXU A;  2D45 A;  2IW5 A;  4A0Y A;  3J81 Z;  2RGV A;  4D0P A;  4HF2 A;  3L00 A;  2PLY A;  4Q4Z F;  1SMY F;  2FF4 A;  2EFW A;  3D0S A;  3OOP A;  1S7O A;  2TDX A;  4ASN A;  3SXY A;  1U6G A;  1IN5 A;  4GXO A;  3E6C C;  1K6O A;  5HS8 A;  1J5Y A;  3HSF A;  3O2P E;  3H3Z A;  4JK1 X;  2ISY A;  3TDU C;  2LF8 A;  4U0V A;  1GHC A;  5CVI A;  1BC7 C;  3PQJ A;  4ZYD A;  5KVR A;  1H0M A;  2MD5 A;  1T39 A;  1XCB A;  1XMK A;  3KZY A;  4A12 A;  5D5U B;  3HTU A;  4DNC A;  3FM3 A;  1EH7 A;  5K5O A;  3QU6 A;  3C3W A;  1T98 A;  2OAZ A;  4MQ9 F;  3GFM A;  2A07 F;  4UHT A;  1G6N A;  4RB1 A;  4XLP F;  4ENK A;  3K2Z A;  1FPQ A;  4HZF A;  5E1Z B;  3U2R A;  4EMS A;  1XN7 A;  1D8K A;  3LA2 A;  1U5T A;  1K7A A;  2RVC A;  1FOK A;  1KYZ A;  3KP3 A;  2VT2 A;  4HOB A;  1KU7 A;  3VOE A;  2XAQ A;  3EQL F;  4AIJ A;  2L4M A;  1LDK B;  5AON A;  2CYY A;  2HQR A;  1GVJ A;  3O6B B;  4U7D A;  4L9V A;  4WXD A;  2JSC A;  2GWR A;  4M6X A;  5F1R A;  3I5U A;  1DUX C;  3ZPL A;  2G9W A;  2HOE A;  3FXU A;  1ZLJ A;  4IVN A;  1QQI A;  3E6M A;  3JTG A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...