1FBSA

Heat shock transcription factor dna binding domain containing the p237a mutation
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
87
structure length
87
Chain Sequence
PAFVNKLWSMVNDKSNEKFIHWSTSGESIVVPNRERFVQEVLAKYFKHSNFASFVRQLNMYGWHKVQDVKSGSMLSNNDSRWEFENE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Transcription
molecule keywords HEAT SHOCK FACTOR PROTEIN
publication title Proline in alpha-helical kink is required for folding kinetics but not for kinked structure, function, or stability of heat shock transcription factor.
pubmed rcsb
source organism Kluyveromyces lactis
total genus 25
structure length 87
sequence length 87
chains with identical sequence B
ec nomenclature
pdb deposition date 2000-07-16
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 1fbsA00
4WXHA 3E6CC 3TOAA 3HRUA 4OIQF 1IAWA 1STZA 1LDDA 1WQ2A 3WTWC 2PJPA 3DP7A 1SD6A 3MQ0A 3REOA 4M6XA 3CJNA 5AIPA 1B6AA 3I54A 1DPUA 3D5LA 3QRFF 3GF2A 2JPBA 1RI7A 3GZ6A 4IRGA 2PI0A 1FX7A 3WE3A 2VOPA 1K79A 4FT8A 5JFRA 1TQMA 1DDNA 3ML6A 3DF8A 5HS7A 4M6YA 3BWGA 4KUMA 2QQBA 2GXBA 4RAZA 1I27A 1SFXA 1HSJA 3KE2A 1NHAA 2FU4A 2ZCWA 1O7FA 1OPCA 5K5QA 4I02A 4KT5C 4ESFA 1F4KA 1J0RA 1U5TA 3P9KA 3V4GA 2ZO4A 4HX4A 2NNYA 1UFMA 3J81Z 3EYIA 4CGZA 4WX9A 1F1ZA 2DLLA 3HSFA 3F8BA 4I0BA 2BV6A 1Z7UA 2STTA 3SZTA 2CW0F 1KQ8A 2EV0A 4ENJA 3FM5A 4BHBA 3C1DA 4UVCA 3BJ6A 3WU0A 2F2EA 2M45A 3E97A 4HF1A 3MEXA 1H9TA 3C3WA 2WV0A 4IVNA 3SXYA 1ODDA 2GQQA 1FBQA 1G3TA 1HW2A 2XRNA 4G6DA 4BXUA 4I01A 3IRRA 4KIBA 1YO5C 3BPXA 4O6JA 1ZG1A 3F23A 3TO9A 4OU0A 4N9IA 2V1DA 1XGNA 4CICA 2O8XA 3MCZA 5D8KB 2VBYA 2PG4A 3JTHA 1WRJA 4KA4A 2UXXA 1I6XA 5AIQA 2KIUA 2X4HA 4OINF 5DUKA 2FXAA 1F9NA 2NYXA 2GA2A 4ZZLA 4AIJA 4U0VA 3GVAA 1LVAA 3K1NA 2IA0A 3BP8A 4RGUA 3KFWX 3WGGA 1ZLJA 1LJ9A 4HOBA 3I4PA 1K78B 5LGNA 1ZG5A 1XSXA 1BIAA 1G3SA 2OZ6A 1SD7A 4G94A 3RYRA 1AOYA 5E8GA 3Q9SA 1FBUA 2PQ8A 5FB2A 2RDPA 1O3RA 1XDUA 3WE2A 4G7OF 1BI0A 2VBWA 2M1BA 5JR3A 2RN7A 1KYWA 1JGSA 1BJAA 1PUEE 1VTNC 4RB1A 3M1EA 3T8RA 1Z05A 1IUYA 3F6VA 2JPCA 4UHTA 2D1HA 3K9TA 5L3BA 3BJOA 3I5UA 1RNLA 1YFHA 4EQQA 5FLXZ 4NHJA 4G7ZF 3QPHA 1D3YA 5D6EA 1FBSA 2V6CA 2P5LC 2E7XA 2NNNA 1LDKB 4G6QA 2QWWA 3TDZC 4EVIA 3RDIA 1WWXA 1W4MA 1XCVA 3QPTA 1O7LA 3HIFA 3DPTA 4HQMA 3EETA 3B73A 1BI3A 1U6GA 1TLHB 3C18A 2CSOA 4IRIA 1BI2A 4ESBA 4M9SA 1FSHA 1OMIA 1BC7C 1HKQA 4LFUA 2EA4A 3ABUA 2HEOA 3MAJA 1OR7A 4OIRF 1IXCA 3NEUA 3L7WA 1LB2A 1IXSB 2EA2A 1B59A 1XSVA 1ZRCA 1BBYA 3E3VA 4FHTA 1DP7P 2LNBA 1EH7A 4EM1A 4AWXB 3K69A 4O5VA 2RGVA 2RKHA 4NQWA 2H6CA 3JAMZ 5LHGA 5D4RA 3M8FA 4I09A 3RKXA 4D0PA 5HVQC 1Y0UA 5D5VB 3MFKA 2HTSA 3JSOA 1G4DA 2XROA 2C6YA 3R61A 4Q48A 5E8IA 1DPRA 4LLNA 5FD6A 4OIPF 1R22A 1UHMA 4R79A 2HTJA 3LSTA 4CYDA 3I59A 4GGGA 4GYIA 3ZMVA 2DPDA 3WTZA 4HDUA 4GCVA 4WWCA 5H6RA 1BI1A 2OD5A 4LLGF 3CO7C 1BOAA 2E1NA 3DV8A 1P6RA 4A6DA 1YW7A 3GLXA 3PQKA 5CVIA 4CZZA 1FP1D 2FSWA 4PGGA 3T0YA 4UNOA 5BOXA 4RAYA 2EK5A 1MJBA 2J5PA 4AD9A 1E2XA 4CXFA 1IZ1A 3KP7A 2AS5F 2Z33A 2M30A 1ULYA 2HGCA 3HTSB 5LRSA 1SD5A 1R5GA 4EGZA 3V7SA 2P6SA 3BJAA 4HX8A 5CLSA 1XMKA 3GFMA 1XB4A 1QQIA 1QO0D 4PZJA 4A12A 1O3TA 4M73A 2OU2A 1H9GA 4MTEA 2TDXA 1K78A 2CG4A 4XLNF 2VOOA 3RPQA 5LHHA 4L0YB 3JAMK 2VN2A 4L5JA 2FOKA 3K1PA 5ILUA 3LA7A 4KMFA 1Z1DA 1QZYA 2P7CB 2Y48A 2DU9A 4YIIA 1KU3A 3BROA 1R36A 4ZZDA 2XKOA 3HOSA 2FMLA 4Q5SF 1KA8A 1WSUA 4IF4A 1O57A 2IVMA 1HKSA 3QP5A 1HKTA 1QNTA 3I64A 4KFCA 1XMAA 2FBHA 3CDHA 4IPAA 3IWZA 3KP4A 4LJZF 5ERIA 2DQLA 4EMSA 4P9UA 1JE8A 2PN6A 1G3YA 4RB2C 2R3SA 3HSRA 4I7HA 2DI3A 3TGNA 1USTA 5LLQA 4KIGA 3K0LA 4HV6A 5DCMB 5CVRA 5LGTA 1T39A 3I53A 1FC3A 3E5UA 5CVUA 1FYLA 1R7JA 4LMYA 1KQ9A 2VT3A 3H3UA 1W5SA 4F7ZA 1Z9CA 4NB5A 2KIFA 1BIBA 1Z6TA 2QQ9A 3F3XA 3QP6A 2K86A 2DT5A 4L0ZB 4ASNA 3O3KA 2R7FA 3HOTA 2VBXA 3C7JA 5LBQA 1XDSA 1W7PD 1UHWA 3IKVA 2K27A 2CWEA 3IKTA 2MLGA 2A69F 4Y17A 2XIGA 2Q2EA 5D5WB 3KZYA 2G9WA 3Q9VA 5DUIA 3ZMTA 5JHUA 4Y15A 1I1SA 2L3DA 2YPRA 4P5OA 4JQFA 2DFIA 2ELHA 2O6GE 5BMZA 3ZMUA 3RIRA 4AIHA 2GAUA 5L3EA 2DPUA 1OYWA 2FBIA 2BGCA 4U88A 1S7OA 4LLLA 2EFWA 4XRFA 2ADUA 1QPMA 4UV9A 1S29A 3PFIA 1R5HA 2DBBA 1U2WA 2F5CA 1XN7A 3EYYA 2Z3YA 1TBXA 4UVBA 4E70A 3ELKA 4AVPA 4IHTA 2HKOA 1J75A 2V79A 2HS5A 3L09A 1REPC 1WKMA 3DPLC 2GXGA 1LEAA 2ZNZA 2NRAC 3BY6A 3HHGA 5A2QZ 1W5TA 1P92A 4WCGA 1QBJA 2IPQX 1CGPA 1JHHA 3V8KA 4I2OA 3F72A 1HSTA 3P7NA 3NQOA 2MD5A 4XSZF 2HYFA 4MNUA 4HZFA 5H20A 2PMHA 1W7PA 1H0MA 3CLOA 3ZP5A 4BHPA 3MWMA 4EM0B 3I59B 4A2UA 2FQ3A 3ECOA 5ICCA 3FZVA 5HDGA 2A61A 3JSPA 2KRFA 5F1RA 4BHCA 2MH2A 1IW7F 4L9VA 1U78A 2K4JA 3QU3A 4LB6B 4RGXA 3WG9A 4RB3C 3QU6A 3I71A 3F22A 3R6SA 2MH9A 2GIVA 2LF7A 2OQGA 4HF2A 1FLIA 2XAHA 3HRSA 3MZHA 4LB5A 1J9IA 4L9JA 3ZPLA 3TOBA 2Q0OA 5CYVA 4MGRA 3RKWA 2WWYA 3I58A 3ZMSA 4EJTA 1PP8F 2Q8KA 1KGSA 1XGOA 2OAZA 3V7RA 5BS6A 2B0LA 2ZKZA 2CGPA 5DCMA 1LNWA 2F5FA 2DAOA 3HRMA 4JBAA 3LA3A 5HS8A 4ZYGA 2M87A 2ETHA 3ZQ7A 1S7AA 1SD4A 5CJ9A 1HW1A 1TTYA 3ERED 3KLNA 3WTSC 3VODA 3J81K 2UXNA 1P2FA 3DQVC 2MLKA 1ZRDA 1RUNA 2UWMA 2MC3A 1HBXG 3M9AA 2QYOA 2RVCA 4WXCA 1I5ZA 2JRTA 3CUOA 2P4WA 2O3FA 5LRRA 1YG2A 2FNPA 3HTUA 4YIFA 4Z2YA 3TDUC 3H3ZA 3H92A 2HWVA 2OQRA 5HDNA 1S8NA 2QM3A 4CDGA 1E17A 4KYWA 5DD8A 2BEOA 3S2WA 2HQNA 2PEXA 1S6LA 3T1BA 3RI4A 4ENKA 1O3SA 3J80Z 3E5QA 1EH8A 1TW2A 1B1BA 3ULQB 4EJUA 3LWFA 2ISZA 1MGTA 3KLOA 3DXJF 3N4MA 4MHGA 2VC1A 4KNYA 5DCFA 2FF4A 2IA1A 4Q47A 2XGXA 2ZFWA 2J5OA 3COAC 4PCQA 1RUOA 3VFZA 3W6KB 4HLXA 1TNSA 5J8FA 1IN8A 3KZZA 2QVOA 4BNCA 2FRHA 3P9CA 3U2RA 2VE8A 1ZARA 3CUQC 1QGPA 4IXAA 2L02A 4KIFA 4G8XA 1CF7B 2A07F 4K2EA 4U0YA 5J6XA 2YX4A 5ICFA 2XV4S 5IT9Z 4HF0A 2FMYA 2FA5A 4B09A 4A0ZA 4UUVA 3E5XA 3WGHA 3V8LA 4RGRA 5EEGA 3OOPA 3T8TA 1A04A 2GZWA 4IHSA 2QQAA 1G3WA 4QLCU 3WGIA 4JK1X 4ZYEA 4Y13A 4ZYHA 1HQCA 3KP5A 4LK1F 1HXDA 2G7UA 5FLXK 1R58A 2XAJA 3CUQA 4Q4ZF 1HW5A 1L3LA 3GFIA 1FYMA 5D4SA 3PQJA 1TQPA 4M74A 2A3SA 3GFLA 2HKXA 2RNJA 4B8XA 4HA8A 5E1ZB 1KU9A 1I1GA 4A5MA 4XBFA 4MEXF 3VOEA 3NRVA 2XKPA 4HV5A 1ZGJA 1FYKA 1P4XA 1KYZA 3LA2A 4S05A 4XLPF 2DK8A 1W7PB 2DK5A 1PP7U 1ON1A 5D8LB 1MZBA 2VONA 1GVJA 3R0AA 5L3GA 2P8TA 5DV5A 2O61A 4UVAA 2D45A 5E20A 3FM3A 4P96A 1YW9A 1Q1HA 2EWNA 2MA3A 3WTVC 4XSXF 2FNAA 4WF2A 4A0YA 2AXLA 2EV6A 1PDNC 3WTUC 3G73A 2KIMA 3V7CA 2L4MA 2RV8A 1MDMA 2RC4A 4YFNF 5DD4A 5FD5A 3L9FA 2HOEA 3JTGA 1IN6A 5E1WA 2LSOA 3I0TA 1J7KA 5FO5A 2PFBA 1FY7A 5F64A 5BPIA 4HBLA 1EV7A 4HQEA 3E6BA 3ZN1A 2VXZA 5IT3A 4M72A 3Q5FA 5D6FA 2W85A 3G3ZA 1T98A 1KQ0A 2EJRA 3O6BB 1IN5A 4M9XA 4L9TA 5HS9A 5AONA 2FEZA 3R60A 3BOQA 1B9MA 3GX4X 2A6HF 2HFHA 2Z99A 1XSDA 3IWFA 2W24A 4KMUX 4HW0A 1BC8C 3SQNA 3JW4A 2HDCA 4RB0A 3LAPA 3OV8A 2IA2A 1YS7A 2F5EA 3B02A 3RJPA 1ZN2A 5J8CA 1MD0A 2M5WA 5HLIA 5HLGA 1GXQA 4RGSA 2W84A 3BPVA 2O03A 4DQ2A 2VC0A 1FSEA 4OMZA 4U7DA 5ICGA 2LKPA 1XD7A 4FX4A 3DEUA 3FXQA 3L00A 1KU2A 1FPQA 3D0SA 3ECHA 1CF7A 4ESJA 4EGYA 1OKRA 3IHUA 1EH6A 2DW4A 5F6FA 1U8RA 1L0OC 2IW5A 2QBYB 2ZMEB 4FX0A 1R00A 5ILSA 4LGWA 2DO7A 1XGMA 1OYYA 2COMA 3QAHA 3V8JA 1P4WA 2EFQA 4P9FA 4O3MA 1U5TC 2XAGA 4U0WA 3ZN0A 3HRTA 3SFZA 3VEPA 3TO6A 1K6OA 2X0LA 2D1VA 2FE3A 3MZYA 1Z91A 5DYMA 1B9NA 2Y0MA 2EFOA 4R1HA 3QOPA 1XGSA 2M8EA 3LQRA 1BN5A 5JI6A 3HSEA 4CHUA 3GEZA 4ENNA 2CYYA 1X3UA 4G9YA 2HYGD 2PBIA 2G7HA 3FF5A 1RIOH 1IN7A 2A68F 2ZJ2A 2Y75A 1FT9A 1FZPB 5HOOA 5D5XB 2XUBA 3TO7A 1TNTA 2BYVE 4HLYA 2EFNA 1DUXC 3R0JA 3TKYA 3BDDA 3EQLF 1T38A 5E17F 4OIOF 3E6MA 2BE5F 3FXRA 3CUQB 3LQQA 3L2CA 5HLHA 1QZZA 5DDGA 3GYHX 1GXPA 3K1MA 5L3CA 3FXUA 2YSRA 2ESNA 1D5VA 2V1XA 3FMQA 3GW2A 1JXSA 4HYEA 3WTYC 1FNNA 4GYGA 4MTDA 4TV7A 3WTTC 2JSCA 2QENA 2JT1A 3RYPA 2A5YB 2VT2A 4DNCA 1ZGAA 1LDJA 2P5VA 1KU7A 4BAYA 4YG2F 4ZYDA 1UCRA 2L4AA 2GA1A 2JZYA 4KN4X 5E1XA 4AIKA 1SAXA 2YU3A 5A2QK 3ROUA 2XHKA 1WI9A 2YR2A 3U9GA 1RZ4A 3W6JB 1D8KA 3R4KA 2ACJA 3HUGA 4ENMA 4ETSA 3KETA 5CVJA 3F21A 2VODA 2K4BA 4GXOA 1T2KA 1MDMB 1T6SA 2P6TA 2IJLA 1ZYRF 2BBYA 2PMUA 3T5XA 4A0XA 1SFUA 2ZXJA 3F8NA 2RQPA 2NAZA 4L9NA 1YYVA 4BQAA 1P4AA 1USSA 2NS0A 5TRDA 2E1CA 3IC7A 3CTAA 3IRQA 2H27A 1J5YA 1XCBA 5TJJA 4MQ9F 1S3JA 4ZH4F 3LAJA 4RS8A 1ZH5A 4KICA 4MQVA 2IT0A 2IP2A 2CQKA 1SMYF 3GZ5A 1G6NA 4LD5A 3M8EA 3GXOA 4CO8A 3WODF 2JTVA 4IRHA 4BH9A 2A6EF 3FHZA 1YQAA 2QBYA 2ZMEA 4OOIA 1MJAA 1T0FA 1Z6RA 1C0WA 5BQTA 3WU1B 4UV8A 4N0BA 1UB9A 4A5NA 4M71A 3J7AO 1ON2A 4PGHA 2V9VA 1IRFA 3KP6A 2CO5A 1R1UA 1OYIA 2V1UA 3ABTA 2K02A 3GUDA 4U7BA 2Z9OA 1YIOA 4UXNA 2H09A 3F8CA 3U1DA 2L54A 3IL2A 4ON0A 3RPUA 4LG0B 3GFJA 1J2XA 5LGUA 6PAXA 3LFKA 4QWQA 2KKOA 1TQIA 3BZ6A 4LK0F 2ZNYA 2E7WA 2WC2A 1ZLKA 4S04A 2DTRA 2FBKA 5CVVA 1ZRFA 3E6DA 4EM2A 2D2WA 3GWZA 3FX3A 2LF8A 4OMYA 3FWEA 5K5RA 1TW3A 2L01A 3F6OA 3J80K 4KDPA 4A6EA 1IN4A 4IJAA 2R7DA 4M9ZA 1U3EM 3M7GA 4EJWA 1K7AA 5LHIA 2ESHA 2W25A 1BM9A 2CFXA 1MJ9A 2Z5UA 1U5TB 2O0YA 2HZTA 3KEOA 4I98B 5E18F 2DQRA 2KJCA 4HAMA 2H6BA 2PLYA 2W57A 4I0AA 3VB2A 3F8FA 1F5TA 3SZPA 3KP3A 2QLZA 2EV5A 2P7VB 2XAFA 5LEJA 3KCCA 5DEQA 4HDVA 2UZKA 1V3FA 5IT9K 2ISYA 2YX7A 5L3DA 1YS6A 4GO1A 5FFZA 1AWCA 2H94A 3EDPA 5L3FA 3N97A 1YW8A 2STWA 4YFXF 1ZREA 1O3QA 2VE9A 4KN7X 2VBZA 1ZAOA 4YFKF 5H6QA 1YLFA 1SFEA 2K7LA 4EJVA 3ZMDA 3WTXC 3KP2A 1D8JA 1ONVA 4L5IA 2QUFA 1YTYA 3RTRA 2OZUA 2LDUA 2XAQA 3P9IA 4H0EA 3HHHA 3O2PE 4R8HA 3CO6C 2OBPA 1FP2A 1SMTA 4L18B 5FGMA 2GWRA 1R1VA 4BYYA 1FOKA 5LEKA 2OA4A 2KJBA 4P55A 2WTEA 3TQNA 4MEYF 3RKYA 5KVRA 1LQ1A 1MKMA 3DFGA 3KEQA 5K5OA 2ZBKA 1ZHFA 3HYIA 4G7HF 3K2ZA 1GHCA 3FMRA 5JVTA 1LEBA 5BPDA 4EV0A 1FWZA 5HDKA 2HR3A 4EJOA 4WXDA 5KK1A 2HQRA 1R1TA 2EFPA 1IRGA 3ZMZA 3ISPA 3GO5A 2QZ8A 4HX7A 2P5KA 4WK8F 5K1YA 5ICEA 4PDKA 5ILVA 3FMSA 5D5UB 4LG0A 1ZG3A 5EEHA 3SHFA 1J59A 2IRFG 5FFXA 2XASA 1B4AA 3DKWA 1R23A 1JHFA 3AAFA 3EUHA 2MBFA 4N9HA 1IXRC 2XVCA 2EB7A 3F8MA 5ED4A 2F5DA 1V4RA 1IF1A
chains in the Genus database with same CATH superfamily
4WXHA 3E6CC 3TOAA 3HRUA 5K7FA 4OIQF 3BZKA 1IAWA 4XL9A 4ZC3A 4B43A 1STZA 3HOYJ 1LDDA 1WQ2A 1TT5B 3WTWC 2PJPA 2OPTA 3DP7A 3ASNH 2HOTA 2M3AA 1SD6A 1XPXA 3MQ0A 3REOA 4M6XA 3S8PA 5B1AH 3UKGA 3CJNA 2VKDA 5AIPA 5CQGA 3D1NI 1B6AA 3ZQQA 3BR3A 3I54A 1DPUA 1BR2A 3D5LA 4HNUA 3QRFF 3DKXA 3GF2A 3HBLA 2JPBA 1RI7A 3GZ6A 4IRGA 1WJEA 4NNJA 2PI0A 3DPUA 1FX7A 2CU7A 3WE3A 2VOPA 1K79A 2LY1A 2IGOA 4FT8A 5JFRA 2R7OA 1TC3C 1TQMA 4HNTA 1LFUP 3ML6A 1DDNA 3DF8A 5HS7A 2M9HA 4PJNA 4M6YA 1T95A 3BWGA 1OCCH 4BQQA 2KMUA 4KUMA 1OCZH 3H5AA 2QQBA 1IG7A 2GXBA 3JRFA 4RAZA 4IO9F 3H9QA 1I27A 1SFXA 4U87A 1MNDA 1HSJA 3KE2A 1NHAA 2FU4A 2ZCWA 1D1AA 1O7FA 4FTHA 1OPCA 2E2IJ 5K5QA 4I02A 1WFXA 4KT5C 4NQWB 3TW7A 4ESFA 3S17J 1F4KA 1MMDA 2VKEA 1J0RA 1U5TA 4PSWA 4QSHA 3P9KA 3CCJI 3I3LA 3V4GA 1WI3A 2ZO4A 4HX4A 3H3VK 2CUFA 2NNYA 1UFMA 3J81Z 3CC4I 3EYIA 2M7BA 4CGZA 4WX9A 1WH5A 1F1ZA 2DLLA 3HSFA 3F8BA 4I0BA 2BV6A 1Z7UA 4BY1J 2STTA 3K4LA 2M4KA 1WCMJ 2Z2SB 1V54H 3HOXJ 3SZTA 2CW0F 4M3EA 1A36A 5FJ8J 1SFOJ 1ETQA 4M3BA 1VZ0A 1KQ8A 2EV0A 3AG4H 4ENJA 3FM5A 1X3ZB 4A3IJ 4BHBA 3G2BA 2CV0A 3HM5A 3C1DA 4UVCA 3BJ6A 3S93A 3BR6A 3WU0A 2FJ1A 2PX9A 2F2EA 2H8WA 1VNDA 2M45A 3E97A 1QRYA 4HF1A 3MEXA 1H9TA 1MMNA 3C3WA 3UR3C 3OYGA 2WV0A 4M3FA 1EKEA 2XSJC 4IVNA 5CQEA 3SXYA 3LMMA 1ODDA 4MFDA 2GQQA 4CCJA 1FBQA 2R5YB 1ACIA 1G3TA 1HW2A 2GBYA 2XRNA 3RSNA 4G6DA 3OR2C 4BXUA 3IUOA 3K2AA 4I01A 3IRRA 4KIBA 4B44A 2E2JJ 1BA5A 1YO5C 3BPXA 4O6JA 2L9SA 1ZG1A 5FLVA 4W1UA 4QPOA 3F23A 1OCTC 3TO9A 3S1NJ 4OU0A 4N9IA 1OQYA 2V1DA 1HF0A 1NK2P 2KLOA 3K70D 1XGNA 4CICA 2O8XA 3MCZA 5D8KB 1RETA 4MO7A 4BKXA 5B3SH 1FJLA 2VBYA 2PG4A 3JTHA 1WRJA 4DIQA 4KA4A 2IS2A 3TL4X 2UXXA 4PSXA 4ZTFA 1I6XA 3FDYA 2FX0A 1BR1A 5KNLA 1W36C 4A3BJ 5AIQA 5F0CA 5M5XJ 2KIUA 2X4HA 1MW7A 4GDFA 4OINF 5FRMA 5DUKA 1X1AA 1YX3A 2FXAA 1F9NA 4XLCA 1OLTA 2NYXA 3BTIA 1GDTA 2GA2A 3DLLF 4ZZLA 4AIJA 4LITA 2BZTA 4U0VA 3GVAA 2B7EA 2L9VA 1LVAA 3K1NA 2Z16A 2IA0A 2A6TA 3BP8A 4RGUA 4A3CJ 3KFWX 5E3LA 3WGGA 1ZLJA 3CCMI 2GXAA 3EPZA 1LJ9A 4HOBA 3I4PA 1VQOI 2ME6A 1K78B 4QPQA 5LGNA 2M8GX 1ZG5A 1XSXA 4BQNA 2FQ4A 1BIAA 1G3SA 2OZ6A 4P1WA 1SD7A 2Y9YA 3M4OJ 2M7AA 4G94A 3RYRA 1AOYA 5E8GA 2CQQA 2CFOA 3Q9SA 1FBUA 2PQ8A 5FB2A 2RDPA 4RAGA 1WVRA 3K7AJ 1XDUA 3A01B 1O3RA 3WE2A 4G7OF 1BI0A 2VBWA 2M1BA 5JR3A 2RN7A 3AG3H 1KYWA 3PIOF 5GP9A 1JGSA 1U9OA 2COBA 1BJAA 4BQOA 1PUEE 1UJ8A 1VTNC 3BR1A 4RB1A 3M1EA 2VUMJ 3T8RA 3AFHA 1AU7A 2NVYJ 1R4MB 1Z05A 1IUYA 3F6VA 2X51A 3K70C 2JPCA 4UHTA 2X6YA 4AM3A 2D1HA 3K9TA 1S7EA 5L3BA 3BJOA 3I5UA 1RNLA 1WPKA 4D1QA 4XLEA 1YFHA 4EQQA 5FLXZ 4XRMA 4NHJA 4A3DJ 4DBQA 4G7ZF 3QPHA 4XM3A 3A2KA 1D3YA 3BTCA 5D6EA 1FBSA 5IPAA 2V6CA 1JKQC 1OR7C 2M0CA 2P5LC 2E7XA 2NNNA 1LDKB 3OYMA 3S1QJ 3QQAA 4G6QA 2QWWA 3TDZC 1IUFA 2O5RA 3OYNA 2JVHA 4EVIA 3RDIA 1WWXA 3CDLA 3SDBA 1W4MA 1X19A 1X1PA 1XCVA 3W6VA 3LSKA 2PMZA 3QPTA 1O7LA 3HIFA 3K4NA 5DS9A 4BS9A 2LREA 3DPTA 4HRIA 2AXTC 4HQMA 3J7YJ 2VJ4A 2V6EA 5J47A 2JJ7A 3EETA 3B73A 1ZQ3P 4CA0A 1BI3A 2QKLB 1U6GA 1TLHB 2G0EA 3C18A 4BUPA 2JN6A 2KPMA 2CSOA 3BG5A 1FMVA 4IRIA 1BI2A 4ESBA 4M9SA 1VQ4I 1OMIA 1BC7C 1FSHA 5IYDJ 2CUEA 1HKQA 4LIVA 3IH2A 2EPFA 1W1WE 4LFUA 2EA4A 3ABUA 2HEOA 3HKZN 3MAJA 1E3PA 5J4YA 3MKYB 1OR7A 1LVKA 1PYVA 4OIRF 4PJJA 1IXCA 3NEUA 2MGQA 3L7WA 1LB2A 2VIXA 1YJWI 1IXSB 5CPRB 5EZHA 2EA2A 1B59A 1XSVA 4DJAA 1ZRCA 1BBYA 3HOWJ 3E3VA 4FHTA 1DP7P 3JRCA 4Y52J 2FD5A 2LNBA 1EH7A 4EM1A 4AWXB 4HEA2 3K69A 4O5VA 4CYCB 2R0QC 2RGVA 1Y1VJ 2RKHA 4NQWA 3W3CA 3OYHA 1VQLI 2H6CA 3JAMZ 1UG0A 3H9GA 5LHGA 5D4RA 1YIJI 3M8FA 4I09A 3RKXA 2MD0A 4D0PA 5IP9J 5HVQC 1Y0UA 5D5VB 3RZOJ 3MFKA 5GAHJ 2HTSA 2OTJI 3JSOA 1YJNI 3OIOA 1G4DA 1TWHJ 2XROA 2C6YA 2X48A 3R61A 3CMMA 3B6AA 4Q48A 1T8IA 2DMTA 5E8IA 1DPRA 2V9PA 3I55I 3KIOA 4LLNA 4DW6A 4A3MJ 5FD6A 3SEQA 4OIPF 3OYKA 1R22A 1UHMA 4XN3A 4R79A 1IV6A 1E0EA 2ME0A 2CS3A 3ZQFA 2BY2A 4AIDA 2HTJA 3LSTA 4CYDA 3I59A 4GGGA 2QEXI 4GYIA 1MNMC 3BG6A 3ZMVA 2DPDA 2R93J 1FOXA 3WTZA 1E3HA 4HDUA 1I50J 1V5EA 4GCVA 4WWCA 2CMPA 5H6RA 3VDXA 1BI1A 2OD5A 4LLGF 3CO7C 1BOAA 2E1NA 3DV8A 1IO2A 2PMZN 1H89C 1P6RA 5IY5H 2IXSA 3BCAA 4BE2A 4A6DA 1YW7A 3QYBA 3GLXA 3CMYA 3PQKA 5CVIA 4CZZA 3TP0A 1FP1D 2FSWA 4PGGA 4CCNA 3T0YA 2HXIA 5TGTA 4UNOA 2HZDA 5BOXA 1YRNB 4RAYA 2NVUB 4RMNA 3C2HA 2JVGA 3M1CA 4XQFA 2EK5A 1MJBA 2J5PA 1AHDP 1DP3A 3BR2A 4AD9A 3A03A 3OIQA 2XPWA 1E2XA 3B6CA 1XX5A 4CXFA 1IZ1A 2W82A 3KP7A 3VWBA 3KEYA 2DN0A 2Z33A 2M30A 2AS5F 2FUG2 1ULYA 3C2BA 2HGCA 1EF4A 3HTSB 1T56A 5LRSA 1SD5A 1R5GA 4EGZA 3V7SA 2M0MA 2P6SA 1JKPC 3BJAA 2E1MC 4HX8A 5CLSA 4E7SA 2LTPA 3LSMA 5HLTA 2F48A 1K4TA 1XMKA 1BOBA 2L7KA 3GFMA 1XB4A 3GCMA 1K4SA 1QQIA 1X2MA 1QO0D 3P5JA 4PZJA 2EINH 4A12A 2B63J 5C44J 4M73A 1O3TA 2OU2A 4XNFA 1MBKA 1H9GA 3DTEA 2F5VA 4MTEA 3HOVJ 1T08B 2TDXA 2CG4A 4XLNF 1K78A 1PUFA 2VOOA 3RPQA 5LHHA 1CQTA 2WAEA 4L0YB 3JAMK 2VN2A 3ZRGA 4L5JA 2FOKA 2R7UA 3K1PA 5ILUA 3HB9A 3LA7A 1R71A 4KMFA 2K3PA 1Z1DA 1QZYA 2P7CB 2Y48A 3ERMA 3A01A 2DU9A 1SVOA 4YIIA 1VQPI 1KU3A 3BROA 1R36A 4ZZDA 2WAQN 2XKOA 1MMAA 3HOSA 3RQIA 2FMLA 4Q5SF 3V42A 1KA8A 2IEKA 1WSUA 3W2WA 2RNGA 2XF5A 4IF4A 1JGGA 1O57A 2X6WA 3MN2A 3D5RC 1BR4A 2IVMA 2KQRA 1HKSA 2DDBA 4F92B 4RDUA 3QP5A 1D0XA 1HKTA 4LIUA 1QNTA 3I64A 4KFCA 3VPRA 2OTLI 1XMAA 2FBHA 3CDHA 4IPAA 3IWZA 3KP4A 2QGUA 5C3EJ 4LJZF 1YJ9I 5ERIA 3MKZA 1G59A 3OYDA 2DQLA 4EMSA 4P9UA 1P9QC 1JE8A 3BQZA 2PN6A 2DA3A 1G3YA 2QF7A 1ETWA 4RB2C 2R3SA 3HSRA 1O4XA 4I7HA 4KISA 2DI3A 4NC7A 3TGNA 1USTA 1GV5A 3S2HJ 3GTLJ 5LLQA 4KIGA 5GTIC 3K0LA 4HV6A 5DCMB 5CVRA 5LGTA 1T39A 3I53A 1D1CA 4DYQA 1RESA 1FC3A 3E5UA 4D7NA 2ECCA 5CVUA 2LFBA 1FYLA 1R7JA 4LMYA 2H1LA 1KQ9A 2VT3A 3H3UA 2R7WA 3K10A 2KRHA 1W5SA 2E1OA 3M8JA 4F7ZA 1Z9CA 4NB5A 3ZQLA 2KIFA 3EUKL 2BHZA 3Q0VA 1BIBA 1Z6TA 2QQ9A 2L9RA 3E0JB 4C3IJ 3F3XA 3GBGA 2K86A 3FXLA 3QP6A 2DT5A 4L0ZB 1DU0A 1VQ9I 2LVSA 4ASNA 2GOMA 3O3KA 2R7FA 3HOTA 2VBXA 2X85A 3BQYA 3C7JA 1XDSA 1W7PD 2GOXB 5LBQA 1QVTA 2HOSA 3RCOA 3OSGA 1P7JA 3OYEA 1UHWA 3IKVA 2K27A 1MH3A 1ENHA 2HQ5A 1U9NA 2CWEA 1S5LC 4PK4A 3IKTA 2V26A 4CCKA 2MLGA 1X3WB 2HNHA 2L5QA 3BC8A 2A69F 4Y17A 2XIGA 1WJAA 2N8GA 4IHYA 3HOZJ 2Q2EA 5D5WB 2LG4A 2DT6A 3KZYA 1TWCJ 2G9WA 3Q9VA 5DUIA 3ZMTA 2RREA 5JHUA 4Y15A 4I99C 1I1SA 2L3DA 3ZCOA 1M1EB 2YPRA 2QQ8A 4P5OA 2MABA 4JQFA 3FXJA 1UMQA 2E35A 2HI3A 2DFIA 5FROA 2ELHA 2O6GE 5BMZA 3DU6A 3ZMUA 3GTQJ 3RIRA 4AIHA 2GAUA 5L3EA 2XGDA 1W0TA 2DPUA 1OYWA 2FBIA 3PM1A 2BGCA 5JLXA 1V5FA 4U88A 1S7OA 4LLLA 2EFWA 4XRFA 2ADUA 1LFBA 2XB5A 1IDYA 1QPMA 4UV9A 1S29A 1QU3A 3PFIA 4JYKA 3VSKA 1VQ8I 1Z21A 3LSHA 3S1MJ 1R5HA 2DBBA 4XLFA 4A3GJ 1U2WA 2CQXA 2LD5A 2F5CA 1XN7A 3EYYA 2HQAA 4XKWA 2WV1A 3OOUA 4G12A 1AKHB 2Z3YA 1TBXA 3AKZA 2MG4A 1AA7A 4UVBA 4E70A 1A6IA 1TP4A 3ELKA 1W5CC 4AVPA 4IHTA 3C2GA 3H1CA 2MW8A 2HKOA 1J75A 2V79A 1W0UA 4BL0B 3OL4A 2HS5A 5EZGA 3NAUA 3L09A 2DJIA 1REPC 1TZLA 1WKMA 2ZFUA 1F36A 1VQ7I 3DPLC 2Y30A 2GXGA 1LEAA 3QOEA 2ZNZA 5JHFA 2NRAC 3BY6A 3HHGA 5A2QZ 2E71A 3L2UA 1W5TA 3CMAI 1P92A 1TWFJ 4WCGA 1X4OA 1QBJA 3L2VA 2IPQX 4FE7A 1RKWA 1YRNA 2VQCA 2WY8Q 2DJNA 1CGPA 1JHHA 2DA5A 3HPHA 3V8KA 3F72A 4I2OA 1N77A 1HSTA 3P7NA 3NQOA 2MD5A 3ZGKA 1NH3A 4ZDOA 3EUAA 3DBRB 3PJRA 4XSZF 3PO3J 4W97A 2HYFA 5GADJ 1W36D 2YUSA 4MNUA 4XONA 5CKTA 4HZFA 5H20A 1LUJB 2PMHA 1W7PA 3KYDB 1E3OC 1H0MA 3CLOA 3ZP5A 4BHPA 1X1BA 3MWMA 4EM0B 4UB8C 1D5YA 3JRGA 1YOVB 4BDYA 1DQUA 1RR7A 3QPSA 3I59B 4A2UA 2FQ3A 2DOEA 3ECOA 3GTMJ 1H8AC 5ICCA 3FZVA 5HDGA 4C3HJ 3ZQHA 3PL8A 3KYLA 4BEHB 2GIZA 1RPWA 2AHQA 4BU2A 2A61A 3JSPA 1SANA 2KRFA 1RRJA 5F1RA 4BHCA 3TW6A 3S2DJ 2W48A 4NC6A 2MH2A 1IW7F 3PNYA 4L9VA 1WJ5A 1U78A 2R7RA 2K4JA 3OIPA 3QU3A 4LB6B 4LOCA 4RGXA 3WG9A 4RB3C 3QU6A 1G8XA 2ZSIB 3NWTA 1WJFA 3I71A 3F22A 1JT0A 3R6SA 2MH9A 2LK2A 3BG3A 2GIVA 2LF7A 2OQGA 4HF2A 1FLIA 2XAHA 3HRSA 3MZHA 1WZ2A 4LB5A 1J9IA 4L9JA 3ZPLA 4BXFA 4B3AA 3TOBA 2Q0OA 3JRAA 5CYVA 5EEAA 2DYRH 4MGRA 3RKWA 3JRIA 5LFAA 2WWYA 3OSFA 2IS1A 1XC5A 3I58A 3LFUA 3ZMSA 2Y2ZA 2LBFB 4EJTA 5GAEJ 5HNFA 3L1PA 1ZR4A 2Q8KA 1KGSA 3TP3A 1PP8F 5GPCA 2W1OA 1XGOA 3S32A 1Z0XA 3CESA 2DODA 2OAZA 3V7RA 3BG9A 2IS4A 4B47A 3H5RA 2JUCA 5BS6A 1TWAJ 2B0LA 1IV8A 1FTZA 2ZKZA 1FIAA 1ZR2A 1MSFC 2CGPA 2F4IA 2DT7B 1PVEA 2DA7A 3LSJA 2EZKA 4BDZA 3ABKH 1LNWA 5DCMA 2XC7A 2LKSA 3CJRB 3PUBA 3E1SA 3HGYA 1OCRH 2F5FA 2DAOA 3HRMA 4JBAA 3LA3A 5HS8A 3CCEI 3HKZA 1FMWA 2KFDA 4XR6A 3DU5A 4ZYGA 1PUFB 4F93B 2E34A 2ETHA 2M87A 1S7AA 3BCBA 4PJ0C 1SD4A 5CJ9A 4YELA 3ZQ7A 1VQKI 2DYSH 1RR8C 3CCRI 1HW1A 4I6ZA 1TTYA 3SYTA 4FCYA 2LKXA 3L2WA 3CCQI 3VYUB 3O8HA 3KLNA 4KJZA 3ERED 1SVMA 3WTSC 3VODA 3J81K 2UXNA 1P2FA 3DQVC 2MLKA 4CSWA 2L2OA 1ZRDA 4C2TA 1Y1WJ 1RUNA 4B1RA 1QHGA 2UWMA 4ZTJA 2MC3A 1HBXG 4EEFG 1D0ZA 1FOYA 3M9AA 2CV1A 2QYOA 3MZ8A 2RVCA 2ZMEC 3OYCA 4ITVA 4WXCA 1I5ZA 2JRTA 3CUOA 2P4WA 2E1MB 2O3FA 1DGWY 4QIWN 1T0FC 5LRRA 2WBMA 1YG2A 2BY1A 2CUZA 2FNPA 3HTUA 1EA3A 4YIFA 3OS1A 2E5NA 3FBNB 4RM3A 4Z2YA 3TDUC 2LLKA 3H3ZA 3H92A 5EJCA 2HWVA 2OQRA 3DLAA 5HDNA 1S8NA 2QM3A 4CDGA 1E17A 4KYWA 5DD8A 2BEOA 2JUGA 1ZK8A 3S2WA 1YX5A 2HQNA 2XB0X 1VQNI 2ZJPF 2VQGA 4MLOA 2CRGA 1DU6A 2PEXA 1S6LA 3T1BA 1ZGWA 2O8KA 3RI4A 1SAUA 2IAIA 4ENKA 4PJLA 1O3SA 3ZQCA 3J80Z 3E5QA 2H1KA 3G71I 1EH8A 1TW2A 1B1BA 2L9NA 3ULQB 4EJUA 2JA2A 3LWFA 5FRNA 2ISZA 1MGTA 4AC0A 4E6KG 3KLOA 1LPQA 4D5FA 1A31A 4FASD 3DXJF 4J01A 2DDAA 3ZXSA 3N4MA 4RLFA 4MHGA 2KIQA 5FKKA 2X1EA 2VC1A 2R7TA 2TRTA 4DZJA 2ZXHA 4KNYA 2BW3B 5DCFA 1D1BA 2FF4A 3JCUC 3ZQIA 2VPLA 2JWTA 2JA5J 1Y8RB 2LOOA 1QVUA 3BTJA 2IA1A 4Q47A 2XGXA 2ZFWA 2J5OA 4V2GA 1LKXA 3ESWB 1AKHA 3COAC 5IOYA 5EDNA 4PCQA 1JJ6C 4JX6A 1RUOA 2DXIA 4AU7A 3VFZA 3W6KB 1YHQI 3H35A 4HLXA 1TNSA 1QHHD 5J8FA 2HDWA 1IN8A 2HU9A 1OCOH 3KZZA 3G1LA 2QVOA 2ELJA 4BNCA 3BR5A 1BW5A 2FRHA 2Q2EB 3TMOA 1UHSA 3P9CA 2YS9A 2WAFA 3U2RA 1VI0A 2VE8A 4KT6A 1ZARA 3CUQC 1I39A 5EGOB 1QGPA 2ZC2A 4IXAA 3JREA 3HGGA 1IC8A 2K9SA 4Y4RA 2L02A 4KIFA 1ERDA 4G8XA 1CF7B 2A07F 4K2EA 3A4CA 4U0YA 4A3JJ 4M3GA 5J6XA 2YX4A 5ICFA 2XV4S 5IT9Z 4HF0A 2FMYA 2FA5A 2K3FA 3F9KA 4B09A 4A0ZA 4UUVA 4D9JA 3E5XA 3PUFA 3WGHA 3V8LA 3KZIC 4RGRA 5EEGA 3OOPA 1Q1VA 3T8TA 1A04A 2GZWA 4IHSA 2QQAA 4FISA 5TISC 2M34A 1G3WA 1LFPA 4QLCU 1K6YA 4JK1X 1Z3YA 3WGIA 4ZYEA 4Y13A 2LY9A 3ASOH 4ZYHA 1HQCA 3KP5A 2WAQA 1X1CA 4LK1F 4DBRA 1HXDA 5IOZA 4XOPA 2G7UA 3BG7A 5FLXK 3G1OA 1R58A 2CH0A 3MVPA 1KZHA 4UUTA 2XAJA 2OJED 3CUQA 4Q4ZF 3WHBA 3LSPA 4BEHA 1HW5A 2JRMA 1L3LA 4C9YA 2EZLA 4CCOA 4XRSG 5B66C 3GFIA 5FKOA 1GVDA 2Y69H 1FYMA 4CCLA 3DTIA 5D4SA 3PQJA 2NVXJ 4RBOA 1TQPA 4M74A 2A3SA 3GFLA 2HKXA 2RNJA 4B8XA 2YU9J 4HA8A 4FETA 1KU9A 5E1ZB 2DOAA 4CUGA 5E3OA 3HDDA 3PNTA 1I1GA 2ZSHB 3DKYA 4IX7A 4A5MA 3BR0A 4XBFA 4MEXF 3VOEA 3NRVA 2XKPA 4HV5A 3SJMA 4DZPA 1ZGJA 1FYKA 1ETXA 1P4XA 4RA2A 2WY7Q 1KYZA 3GTJJ 3LA2A 1SVLA 4S05A 2LMDA 3OYFA 3VYTB 5F0FA 2L0KA 5LD2C 4XLPF 2DK8A 1W7PB 2DK5A 1PP7U 1ON1A 2LBFA 5D8LB 3HOUJ 4X6AJ 4BE0A 1MZBA 1XMXA 1B8IB 2KL4A 2BOLA 4PFPA 2VONA 2EIMH 1GVJA 3OL3A 3R0AA 5L3GA 2P8TA 2MC4A 4N4OB 5DV5A 2IGMA 2GLOA 2VPRA 1MMGA 2O61A 4UVAA 2D45A 5E20A 3FK6A 3FM3A 4P96A 4RM2A 1YW9A 4A69C 1OISA 1Q1HA 2VL8A 2EWNA 4JOMA 3I9V2 2LR8A 4E4HA 2CUJA 2MA3A 3CCSI 4M6VA 4XICA 3G6EI 3WTVC 5EYRA 2IS6A 4XSXF 2Z1DA 1X58A 3O8GA 2FNAA 4WF2A 4A0YA 9ANTA 2AXLA 2EV6A 3TEDA 1PDNC 3D5SC 1UZCA 3WTUC 3G73A 1GV2A 1K61A 2KIMA 3V7CA 3I4NJ 2L4MA 2UV1A 2RV8A 1MDMA 2RC4A 4YFNF 3WU2C 3RZDJ 5DD4A 1MH4A 1WJCA 5FD5A 4FE4A 4C30A 4IEJA 2RAEA 3L9FA 5F04A 2HOEA 2XGCA 3JTGA 3CP8A 2VXDA 2VLAA 1IN6A 5E1WA 2LSOA 5F08A 3GTKJ 3I0TA 1J7KA 2XGEA 2Y31A 3K4JA 5FO5A 5IYBJ 1R49A 3CC7I 1BJZA 2PFBA 1FY7A 5F64A 5BPIA 4HBLA 3G1MA 3FISA 1EV7A 4HQEA 3DTKA 3E6BA 1ITYA 3A02A 3ZN1A 2VXZA 1J09A 2M2EA 5IT3A 1POGA 4M72A 3Q5FA 3IV5A 5D6FA 2QSHX 2DA2A 2W85A 3G3ZA 1T98A 2P0WA 1KQ0A 2EJRA 4ZYAA 3O6BB 4IHWA 1FTTA 1IN5A 2XPUA 4HNVA 3H5NA 4M9XA 1JUMA 4L9TA 3ABMH 3TBIA 1I3QJ 3OYBA 1QA6A 1HCRA 5HS9A 3JRHA 5AONA 1IGNA 4BBSJ 2FEZA 2KZGA 3R60A 3S15J 3BOQA 1B9MA 5FKMA 3CJTB 4UUSA 3GX4X 2A6HF 2W7NA 2HFHA 2Z99A 1XSDA 3IWFA 2ZJRF 2W24A 4KMUX 4A3EJ 4A3KJ 3X2QH 4HW0A 1BC8C 2BW3A 4AYBA 5IP6A 3SQNA 4IL6C 1FOWA 3JW4A 1Y6IA 2DFFA 2JMWA 1V5GA 2H8RA 3JRBA 2OC6A 2HDCA 2NVQJ 4RB0A 3LAPA 3M07A 3OV8A 2IA2A 3S14J 1YS7A 4RAFA 2OCCH 3DCFA 2F5EA 3B02A 4HSTA 3RJPA 1ZN2A 4BBRJ 1TL8A 3FXKA 3FXMA 3KX2A 2XDVA 5J1UA 5J8CA 3IAM2 2DFHA 1MD0A 5JVGF 2M5WA 5HLIA 5HLGA 1GXQA 1P7IA 3CCVI 4RGSA 2W84A 3BPVA 2O03A 4DQ2A 2VC0A 3IAS2 2DFEA 2UUZA 4DYCA 2R7XA 1FSEA 3OYLA 4IHVA 3MD2A 3OS0A 4OMZA 1R4NB 2IGKA 5H2FC 4U7DA 1XS9A 5ICGA 1Z67A 2LKPA 4II3A 1XD7A 4FX4A 5EGOA 3DEUA 2OF7A 3FXQA 1FEXA 3L00A 1KU2A 1FPQA 4C2UA 4LG3A 3K4CA 2VKVA 3D0SA 3ECHA 1CF7A 4ESJA 4EGYA 1OKRA 3SZGA 3IHUA 1EH6A 2DW4A 3PNVA 5F6FA 1U8RA 1L0OC 2IW5A 2QBYB 4V2FA 2ZMEB 1HLVA 4FX0A 5E3MA 2I10A 3CZ6A 1R00A 1Y8QB 2VJJA 2DA1A 3LL7A 2BVMA 4LGWA 2DO7A 5ILSA 5K7ZA 2DMNA 4IQ4A 5HNHA 1XGMA 3U21A 3PO2J 1OYYA 5K7HA 2COMA 2V7FA 3QAHA 2NS8A 3V8JA 2F6CA 2P81A 1P4WA 2EFQA 4P9FA 2K9NA 5FLMJ 3LSRA 5F1JA 1Y0NA 3H0DA 3VSLA 4O3MA 1U5TC 4A93J 3FK7A 2XAGA 4U0WA 3ZN0A 3HRTA 1IRZA 3SFZA 3VEPA 4YIRX 3TO6A 2NOJB 3K4BA 3MKWB 4XK4A 3G4SI 3FKIJ 1UELB 1K6OA 4DOZA 2X0LA 5M5WJ 2D1VA 2FE3A 3MZYA 2KDZA 2QSFX 1Z91A 3GMEA 5DYMA 4Y3OA 1B9NA 2VJIA 1LE8B 2NS7A 2Y0MA 2EFOA 2F4OB 4R1HA 3QOPA 1PJRA 1XGSA 2M8EA 4AYBN 4E7IA 4B48A 3LQRA 4BE1A 1BN5A 5JI6A 3HSEA 4CHUA 3GEZA 2X1DA 3CC2I 2EBIA 4B3XA 4ENNA 2CYYA 1X3UA 3HEFA 4G9YA 4XLHA 1TWGJ 2HYGD 2PBIA 2OUMA 2G7HA 3FF5A 1RIOH 1IN7A 2M4GA 1KONA 2HXOA 4GFBA 2A68F 3E7LA 2ZJ2A 2Y75A 1QPIA 1FT9A 2VI6A 1FZPB 5HOOA 4E7ZA 1VF9A 2DTZA 2KRCA 4II2A 5D5XB 1Z7LA 2JSPA 2XUBA 4FQGA 1ZKGA 3TO7A 2XSDC 5DTDA 1I6HJ 5M5YJ 1OJLA 1TNTA 1RC9A 2BYVE 4HLYA 5C4JJ 2EFNA 1DUXC 3R0JA 1ZELA 2X1CA 1B8IA 3TKYA 3BDDA 1U8BA 3EQLF 1T38A 1MMSA 4Z6YA 5E17F 1R6RA 4OIOF 3E6MA 2E5ZA 2BE5F 1Y39A 3HXLA 2ZXWH 3FXRA 3CUQB 3LQQA 4XORA 3L2CA 3AL0C 4NUBA 1D0YA 4NDLA 5HLHA 1QZZA 5DDGA 2VB6A 4BGDA 3GYHX 2A5WA 1GXPA 1G2HA 4XLAA 3K1MA 5L3CA 5C4XJ 3FXUA 5KHDA 2KZVA 2XRLA 2YSRA 3S16J 2ESNA 1D5VA 2V1XA 3FMQA 3GW2A 1JXSA 2BY3A 4HYEA 2W00A 3WTYC 1A35A 1A5JA 1FNNA 2JA7J 3SFIA 4GYGA 4MTDA 3Q0WA 4TV7A 3WTTC 2CQNA 2BXYA 1JKRC 1B72B 2JSCA 2QENA 1GLNA 1JJ8C 1GT0C 1HA8A 4XKBA 3IP4B 2I5UA 1X1DA 2JT1A 3RYPA 2LYCA 2A5YB 2ZXIA 3CLQA 2VT2A 5F0HA 4UY8I 2XF6A 4DNCA 1ZGAA 2R4GA 3OR1C 1LDJA 2P5VA 5J4VA 2DMUA 1X4PA 4BAYA 4XMYA 1KU7A 5DM7F 2O7OA 2R7ZJ 1R5ID 3L2QA 4Y7NJ 3BTLA 4YG2F 4E7JA 1DGRM 3GZNB 4XRSA 3HZJA 3MMYB 3NWSA 4BACA 4XIDA 3W2VA 4HSRA 4ZYDA 3FXOA 1UCRA 3J7AY 1NTCA 2L4AA 2L7MP 2HPIA 4XKVA 2GA1A 2JZYA 4KN4X 5E1XA 2AQFA 3NARA 2D5VA 4AIKA 1U0JA 1SAXA 2YU3A 5A2QK 3ROUA 2XHKA 3RPUD 3KPHA 1WI9A 2YR2A 3QODA 3U9GA 1RZ4A 3FBIB 3W6JB 4F52A 2HPMA 1D8KA 3CDIA 5EG0B 3R4KA 3GTOJ 2ACJA 3HUGA 4ENMA 1S72I 1NK3P 4ETSA 2WADA 5DM6F 3CCLI 3KETA 2CW7A 5CVJA 2V9KA 3CF5F 5FKNA 4OAZA 2JQ7A 3GTGJ 1MBJA 5M3MJ 3F21A 4D7MA 1HDDC 1JUPA 2VODA 2HOAA 2K4BA 3J7ZI 4CZCA 4Y33A 4GXOA 5KAIC 1T2KA 1MDMB 1T6SA 2P6TA 2IJLA 1ZYRF 4CH7A 2BBYA 2PMUA 3A0BC 4C3JJ 3T5XA 4A0XA 1SFUA 1EJ9A 3WG7H 2ZXJA 2DCEA 4OAYA 2LH9A 3F8NA 2RQPA 2ZJQF 2NAZA 1MBFA 3OMYA 4PUSA 5J1RA 3RKQA 3VYSB 4E7HA 2LY2A 4IZZA 4L9NA 1YYVA 2EIKH 4BQAA 3CF2A 1P4AA 1USSA 2NS0A 5TRDA 2E1CA 3IC7A 2X6XA 3CTAA 2XPVA 1JI8A 3IRQA 1R9TJ 1Z3XA 2H27A 3KYCB 3F0CA 1J5YA 1XCBA 5TJJA 2BVLA 4MQ9F 1S9HA 1S3JA 5FKLA 4ZH4F 3LAJA 4RS8A 4HG2A 2DMPA 1ZH5A 4KICA 4MQVA 4IOCF 1APLC 2IT0A 1IDZA 2MSYA 2IP2A 1SEUA 2CQKA 4BJ6C 1SMYF 3GZ5A 3K4MA 1G6NA 5GTHC 4LD5A 3M8EA 3GXOA 3ZR8X 5IP7J 4CO8A 3WODF 4F3QA 4IOAF 2HVQA 2JTVA 4IRHA 3JRDA 2LRDA 4CCMA 4GRIA 2K85A 4QTRA 4BH9A 2A6EF 3FHZA 1YQAA 2RQQA 2X6OA 5E3NA 2QBYA 1JTXA 1ZTRA 1IRXA 2ZMEA 4IHXA 3AG1H 4OOIA 4UUSB 2XF7A 1MJAA 5JLWA 4OWRB 4EATA 2E2HJ 5B5EC 4AVZA 1T0FA 1N25A 1Z6RA 1C0WA 3GTPJ 5BQTA 4A3LJ 2CJJA 3HG9A 2EZIA 3WU1B 4UV8A 4N0BA 2R5ZA 2WA0A 4IQJA 2F4MB 1UB9A 2L7FP 3BZCA 1IJWC 4A5NA 2WB1A 4KITB 1VFCA 4M71A 3M3YJ 5GAGJ 3J7AO 1ON2A 1QZEA 4PGHA 4XKCA 2V9VA 2PJRB 4XN0A 2IBDA 1IRFA 3KP6A 3OYJA 2CO5A 1R1UA 1OYIA 2V1UA 3ABTA 3BT9A 2K02A 2XAUA 3GUDA 3RQ4A 4U7BA 2MYSA 3N05A 1YIOA 2CQ7A 4UXNA 2Z9OA 2H09A 1SC7A 4JX5A 3F8CA 3U1DA 3QYEA 2HVSA 2R92J 2ECBA 1LE8A 2L54A 3Q3SA 1MBHA 3IL2A 3CCUI 4ON0A 3RPUA 3JR9A 4LG0B 3L2RA 4HPQA 3GFJA 4M3DA 1JTYA 1ETKA 1J2XA 4AUXA 5LGUA 2KP6A 4BY7J 1MNEA 2VQHA 2HDDA 1NG7A 4ANJA 2KHMA 1X2NA 1MBGA 3DBLB 2EIJH 3FIWA 1ORKA 3DWLE 2O9LA 6PAXA 3LFKA 2A05A 3CCYA 2QCOA 1XG1A 4QWQA 2KKOA 1TQIA 3BZ6A 4LK0F 2ELKA 2DOFA 4MFEA 4D5CA 3H9JA 1HDPA 1WJDA 2FOWA 2ZNYA 2E7WA 2WC2A 1ZLKA 4BJ5C 2OCEA 3QWLA 4S04A 2DTRA 2FBKA 5CVVA 1GUUA 1ZRFA 2QA4I 3E6DA 4EM2A 2D2WA 1N75A 3GWZA 3FX3A 3QPLA 3S3NA 4F55A 1OCPA 2LF8A 3SEZA 4YEJA 3DEEA 1YITI 5BNGA 4F91B 3S3OA 1WHUA 4OMYA 3LSIA 3FWEA 5K5RA 1TW3A 5KAFC 2KT0A 2L01A 2EILH 1A6QA 3F6OA 3LSGA 3OY9A 3J80K 4KDPA 4A6EA 3CJQB 1IN4A 3VYRB 1WGXA 4IJAA 2R7DA 4PFOA 2R7QA 4M9ZA 4MIMA 1Y56A 4NC8A 5HODA 5IYCJ 1MBEA 2HVRA 2WB1N 1K83J 1T33A 2VASA 1U3EM 3M7GA 1B72A 2NXNB 3I56I 4E7KA 2R5YA 4EJWA 2E19A 3PSFA 1K7AA 3ONQA 1MIJA 5LHIA 2ID6A 2ESHA 2W25A 1BM9A 2CFXA 1MJ9A 3ZQGA 2Z5UA 1MSEC 2MFZA 1U5TB 3K4KA 1N78A 2O0YA 2ID3A 2HZTA 3S1RJ 4X0GA 2QKMB 3CMEI 1UG2A 1YI2I 3KEOA 4I98B 4ZJZA 1SFKA 5E18F 4H4KC 2LC2A 2DQRA 3ABLH 1TT0A 2KJCA 2K9MA 4X1EA 2BHYA 4HAMA 3OYIA 2E60A 2H6BA 2QSGX 5E79C 2PLYA 2W57A 2IGNA 2Y0SA 4XOTA 1YE9A 4I0AA 3VB2A 3F8FA 4DGWB 1F5TA 3SZPA 3U1KA 3KP3A 5EG0A 2NVTJ 2QLZA 5EF6A 2EV5A 2P7VB 2W4SA 2XAFA 2VJ5A 4YRVA 1NG6A 5LEJA 4B4CA 1VQMI 3KCCA 5DEQA 4HDVA 2UZKA 1V3FA 5IT9K 2ISYA 2YX7A 5L3DA 1YS6A 4GO1A 2ICWG 1ETOA 2TCTA 1VQ6I 5FFZA 2AO9A 1AWCA 2JA8J 2KDOA 2H94A 3FHNA 4J00A 3EDPA 3I4MJ 5L3FA 3N97A 1YW8A 1WJBA 3H0GJ 2STWA 2L7ZA 4YFXF 3AG2H 1O3QA 1ZREA 2VE9A 2R7VA 4KN7X 4ABZA 2AQEA 2VBZA 1ZAOA 4YFKF 3PSIA 1HOMA 5J3LA 2KISA 4S0HB 3HL2A 5H6QA 5J1YA 2EZHA 4G6TB 1YLFA 1SFEA 3LOCA 3DBHB 2K7LA 4EJVA 3ZMDA 3SDGA 3WTXC 4ZDLA 3AL0B 2DA6A 1Z77A 3KP2A 4JP0A 1D8JA 3HC7A 1ONVA 4V19K 3CD6I 5GPAA 3OYAA 4L5IA 2QUFA 3CQZJ 1WH7A 3QYFA 1YTYA 4C2MJ 3DEWA 3RTRA 2OZUA 3HJEA 2JA6J 2LDUA 2XAQA 3P9IA 4H0EA 3ZOBA 3HHHA 2K9QA 2OV7A 1H88C 3O2PE 4R8HA 3CO6C 2OBPA 1FP2A 2V4JC 3WHCA 1SMTA 5M3FJ 5FGMA 4L18B 2GWRA 3HUGB 3PFYA 3OS2A 2CV2A 1R1VA 4N4NB 4BYYA 4RLQA 1FOKA 5LEKA 4J19A 2OA4A 2K5CA 2KJBA 1ETVA 5B1BH 1OFCX 4P55A 2WTEA 3TQNA 4MEYF 3RKYA 5KVRA 1LQ1A 1MKMA 3DFGA 2JK3A 3KEQA 5K5OA 2I8DA 2ZBKA 2K9LA 1ZHFA 3BLYA 3A1YA 3HYIA 3Q0UA 2BXZA 4G7HF 3K2ZA 1V55H 2EQRA 2BY0A 1GHCA 3FMRA 5JVTA 4BJTA 3IH4A 3EUHC 1LEBA 2EH3A 4UB6C 5BPDA 4EV0A 2DMQA 1FWZA 2Y0SN 5HDKA 1HC8A 2HR3A 4EJOA 4WXDA 5KK1A 2PJRA 1I3AA 2VKHA 2HQRA 1R1TA 2EFPA 1IRGA 5J40A 3K6GA 3ZMZA 2R7SA 1JUSA 3A0HC 4DYRA 1BL0A 3ISPA 3UNGC 1F43A 3GO5A 2QZ8A 3OWTA 4HX7A 4IKFA 2P5KA 2ZB9A 4WK8F 2K40A 5K1YA 3PIPF 2Q1ZB 5ICEA 4PDKA 5ILVA 4NBQA 3FMSA 5D5UB 1JKOC 4LG0A 1ZG3A 4JX4A 5EEHA 2Y9ZA 3W2AA 3SHFA 4BXXJ 3MKLA 3HPGA 1RKTA 1J59A 3LNQA 3FKJA 3H36A 5F27A 2IRFG 2E36A 5FFXA 1UAAA 2XASA 1B4AA 3DKWA 1BW6A 1R23A 4PJMA 2HYJA 2X9DA 1JHFA 3AAFA 1XTAA 4L5EA 4A3FJ 4I76A 2CW8A 3EUHA 2MBFA 4CYCA 2LP0A 2VQLA 2V1NA 4N9HA 1IXRC 2XVCA 3IH3A 1ETYA 2DA4A 2EB7A 5KCMA 4ZDPA 4E7LA 2NOGA 1JT6A 1FIPA 2R5ZB 2B9SA 3F8MA 5ED4A 3CP2A 3GLLA 1VQ5I 2F5DA 1V4RA 3S3MA 2GM4A 1IF1A
chains in the Genus database with same CATH topology
4WXHA 3E6CC 3TOAA 3HRUA 4OIQF 1IAWA 1STZA 1LDDA 1WQ2A 3WTWC 2PJPA 3DP7A 1SD6A 3MQ0A 3REOA 4M6XA 3CJNA 5AIPA 1B6AA 3I54A 1DPUA 3D5LA 3QRFF 3GF2A 2JPBA 1RI7A 3GZ6A 4IRGA 2PI0A 1FX7A 3WE3A 2VOPA 1K79A 4FT8A 5JFRA 1TQMA 1DDNA 3ML6A 3DF8A 5HS7A 4M6YA 3BWGA 4KUMA 2QQBA 2GXBA 4RAZA 1I27A 1SFXA 1HSJA 3KE2A 1NHAA 2FU4A 2ZCWA 1O7FA 1OPCA 5K5QA 4I02A 4KT5C 4ESFA 1F4KA 1J0RA 1U5TA 3P9KA 3V4GA 2ZO4A 4HX4A 2NNYA 1UFMA 3J81Z 3EYIA 4CGZA 4WX9A 1F1ZA 2DLLA 3HSFA 3F8BA 4I0BA 2BV6A 1Z7UA 2STTA 3SZTA 2CW0F 1KQ8A 2EV0A 4ENJA 3FM5A 4BHBA 3C1DA 4UVCA 3BJ6A 3WU0A 2F2EA 2M45A 3E97A 4HF1A 3MEXA 1H9TA 3C3WA 2WV0A 4IVNA 3SXYA 1ODDA 2GQQA 1FBQA 1G3TA 1HW2A 2XRNA 4G6DA 4BXUA 4I01A 3IRRA 4KIBA 1YO5C 3BPXA 4O6JA 1ZG1A 3F23A 3TO9A 4OU0A 4N9IA 2V1DA 1XGNA 4CICA 2O8XA 3MCZA 5D8KB 2VBYA 2PG4A 3JTHA 1WRJA 4KA4A 2UXXA 1I6XA 5AIQA 2KIUA 2X4HA 4OINF 5DUKA 2FXAA 1F9NA 2NYXA 2GA2A 4ZZLA 4AIJA 4U0VA 3GVAA 1LVAA 3K1NA 2IA0A 3BP8A 4RGUA 3KFWX 3WGGA 1ZLJA 1LJ9A 4HOBA 3I4PA 1K78B 5LGNA 1ZG5A 1XSXA 1BIAA 1G3SA 2OZ6A 1SD7A 4G94A 3RYRA 1AOYA 5E8GA 3Q9SA 1FBUA 2PQ8A 5FB2A 2RDPA 1O3RA 1XDUA 3WE2A 4G7OF 1BI0A 2VBWA 2M1BA 5JR3A 2RN7A 1KYWA 1JGSA 1BJAA 1PUEE 1VTNC 4RB1A 3M1EA 3T8RA 1Z05A 1IUYA 3F6VA 2JPCA 4UHTA 2D1HA 3K9TA 5L3BA 3BJOA 3I5UA 1RNLA 1YFHA 4EQQA 5FLXZ 4NHJA 4G7ZF 3QPHA 1D3YA 5D6EA 1FBSA 2V6CA 2P5LC 2E7XA 2NNNA 1LDKB 4G6QA 2QWWA 3TDZC 4EVIA 3RDIA 1WWXA 1W4MA 1XCVA 3QPTA 1O7LA 3HIFA 3DPTA 4HQMA 3EETA 3B73A 1BI3A 1U6GA 1TLHB 3C18A 2CSOA 4IRIA 1BI2A 4ESBA 4M9SA 1FSHA 1OMIA 1BC7C 1HKQA 4LFUA 2EA4A 3ABUA 2HEOA 3MAJA 1OR7A 4OIRF 1IXCA 3NEUA 3L7WA 1LB2A 1IXSB 2EA2A 1B59A 1XSVA 1ZRCA 1BBYA 3E3VA 4FHTA 1DP7P 2LNBA 1EH7A 4EM1A 4AWXB 3K69A 4O5VA 2RGVA 2RKHA 4NQWA 2H6CA 3JAMZ 5LHGA 5D4RA 3M8FA 4I09A 3RKXA 4D0PA 5HVQC 1Y0UA 5D5VB 3MFKA 2HTSA 3JSOA 1G4DA 2XROA 2C6YA 3R61A 4Q48A 5E8IA 1DPRA 4LLNA 5FD6A 4OIPF 1R22A 1UHMA 4R79A 2HTJA 3LSTA 4CYDA 3I59A 4GGGA 4GYIA 3ZMVA 2DPDA 3WTZA 4HDUA 4GCVA 4WWCA 5H6RA 1BI1A 2OD5A 4LLGF 3CO7C 1BOAA 2E1NA 3DV8A 1P6RA 4A6DA 1YW7A 3GLXA 3PQKA 5CVIA 4CZZA 1FP1D 2FSWA 4PGGA 3T0YA 4UNOA 5BOXA 4RAYA 2EK5A 1MJBA 2J5PA 4AD9A 1E2XA 4CXFA 1IZ1A 3KP7A 2AS5F 2Z33A 2M30A 1ULYA 2HGCA 3HTSB 5LRSA 1SD5A 1R5GA 4EGZA 3V7SA 2P6SA 3BJAA 4HX8A 5CLSA 1XMKA 3GFMA 1XB4A 1QQIA 1QO0D 4PZJA 4A12A 1O3TA 4M73A 2OU2A 1H9GA 4MTEA 2TDXA 1K78A 2CG4A 4XLNF 2VOOA 3RPQA 5LHHA 4L0YB 3JAMK 2VN2A 4L5JA 2FOKA 3K1PA 5ILUA 3LA7A 4KMFA 1Z1DA 1QZYA 2P7CB 2Y48A 2DU9A 4YIIA 1KU3A 3BROA 1R36A 4ZZDA 2XKOA 3HOSA 2FMLA 4Q5SF 1KA8A 1WSUA 4IF4A 1O57A 2IVMA 1HKSA 3QP5A 1HKTA 1QNTA 3I64A 4KFCA 1XMAA 2FBHA 3CDHA 4IPAA 3IWZA 3KP4A 4LJZF 5ERIA 2DQLA 4EMSA 4P9UA 1JE8A 2PN6A 1G3YA 4RB2C 2R3SA 3HSRA 4I7HA 2DI3A 3TGNA 1USTA 5LLQA 4KIGA 3K0LA 4HV6A 5DCMB 5CVRA 5LGTA 1T39A 3I53A 1FC3A 3E5UA 5CVUA 1FYLA 1R7JA 4LMYA 1KQ9A 2VT3A 3H3UA 1W5SA 4F7ZA 1Z9CA 4NB5A 2KIFA 1BIBA 1Z6TA 2QQ9A 3F3XA 3QP6A 2K86A 2DT5A 4L0ZB 4ASNA 3O3KA 2R7FA 3HOTA 2VBXA 3C7JA 5LBQA 1XDSA 1W7PD 1UHWA 3IKVA 2K27A 2CWEA 3IKTA 2MLGA 2A69F 4Y17A 2XIGA 2Q2EA 5D5WB 3KZYA 2G9WA 3Q9VA 5DUIA 3ZMTA 5JHUA 4Y15A 1I1SA 2L3DA 2YPRA 4P5OA 4JQFA 2DFIA 2ELHA 2O6GE 5BMZA 3ZMUA 3RIRA 4AIHA 2GAUA 5L3EA 2DPUA 1OYWA 2FBIA 2BGCA 4U88A 1S7OA 4LLLA 2EFWA 4XRFA 2ADUA 1QPMA 4UV9A 1S29A 3PFIA 1R5HA 2DBBA 1U2WA 2F5CA 1XN7A 3EYYA 2Z3YA 1TBXA 4UVBA 4E70A 3ELKA 4AVPA 4IHTA 2HKOA 1J75A 2V79A 2HS5A 3L09A 1REPC 1WKMA 3DPLC 2GXGA 1LEAA 2ZNZA 2NRAC 3BY6A 3HHGA 5A2QZ 1W5TA 1P92A 4WCGA 1QBJA 2IPQX 1CGPA 1JHHA 3V8KA 4I2OA 3F72A 1HSTA 3P7NA 3NQOA 2MD5A 4XSZF 2HYFA 4MNUA 4HZFA 5H20A 2PMHA 1W7PA 1H0MA 3CLOA 3ZP5A 4BHPA 3MWMA 4EM0B 3I59B 4A2UA 2FQ3A 3ECOA 5ICCA 3FZVA 5HDGA 2A61A 3JSPA 2KRFA 5F1RA 4BHCA 2MH2A 1IW7F 4L9VA 1U78A 2K4JA 3QU3A 4LB6B 4RGXA 3WG9A 4RB3C 3QU6A 3I71A 3F22A 3R6SA 2MH9A 2GIVA 2LF7A 2OQGA 4HF2A 1FLIA 2XAHA 3HRSA 3MZHA 4LB5A 1J9IA 4L9JA 3ZPLA 3TOBA 2Q0OA 5CYVA 4MGRA 3RKWA 2WWYA 3I58A 3ZMSA 4EJTA 1PP8F 2Q8KA 1KGSA 1XGOA 2OAZA 3V7RA 5BS6A 2B0LA 2ZKZA 2CGPA 5DCMA 1LNWA 2F5FA 2DAOA 3HRMA 4JBAA 3LA3A 5HS8A 4ZYGA 2M87A 2ETHA 3ZQ7A 1S7AA 1SD4A 5CJ9A 1HW1A 1TTYA 3ERED 3KLNA 3WTSC 3VODA 3J81K 2UXNA 1P2FA 3DQVC 2MLKA 1ZRDA 1RUNA 2UWMA 2MC3A 1HBXG 3M9AA 2QYOA 2RVCA 4WXCA 1I5ZA 2JRTA 3CUOA 2P4WA 2O3FA 5LRRA 1YG2A 2FNPA 3HTUA 4YIFA 4Z2YA 3TDUC 3H3ZA 3H92A 2HWVA 2OQRA 5HDNA 1S8NA 2QM3A 4CDGA 1E17A 4KYWA 5DD8A 2BEOA 3S2WA 2HQNA 2PEXA 1S6LA 3T1BA 3RI4A 4ENKA 1O3SA 3J80Z 3E5QA 1EH8A 1TW2A 1B1BA 3ULQB 4EJUA 3LWFA 2ISZA 1MGTA 3KLOA 3DXJF 3N4MA 4MHGA 2VC1A 4KNYA 5DCFA 2FF4A 2IA1A 4Q47A 2XGXA 2ZFWA 2J5OA 3COAC 4PCQA 1RUOA 3VFZA 3W6KB 4HLXA 1TNSA 5J8FA 1IN8A 3KZZA 2QVOA 4BNCA 2FRHA 3P9CA 3U2RA 2VE8A 1ZARA 3CUQC 1QGPA 4IXAA 2L02A 4KIFA 4G8XA 1CF7B 2A07F 4K2EA 4U0YA 5J6XA 2YX4A 5ICFA 2XV4S 5IT9Z 4HF0A 2FMYA 2FA5A 4B09A 4A0ZA 4UUVA 3E5XA 3WGHA 3V8LA 4RGRA 5EEGA 3OOPA 3T8TA 1A04A 2GZWA 4IHSA 2QQAA 1G3WA 4QLCU 3WGIA 4JK1X 4ZYEA 4Y13A 4ZYHA 1HQCA 3KP5A 4LK1F 1HXDA 2G7UA 5FLXK 1R58A 2XAJA 3CUQA 4Q4ZF 1HW5A 1L3LA 3GFIA 1FYMA 5D4SA 3PQJA 1TQPA 4M74A 2A3SA 3GFLA 2HKXA 2RNJA 4B8XA 4HA8A 5E1ZB 1KU9A 1I1GA 4A5MA 4XBFA 4MEXF 3VOEA 3NRVA 2XKPA 4HV5A 1ZGJA 1FYKA 1P4XA 1KYZA 3LA2A 4S05A 4XLPF 2DK8A 1W7PB 2DK5A 1PP7U 1ON1A 5D8LB 1MZBA 2VONA 1GVJA 3R0AA 5L3GA 2P8TA 5DV5A 2O61A 4UVAA 2D45A 5E20A 3FM3A 4P96A 1YW9A 1Q1HA 2EWNA 2MA3A 3WTVC 4XSXF 2FNAA 4WF2A 4A0YA 2AXLA 2EV6A 1PDNC 3WTUC 3G73A 2KIMA 3V7CA 2L4MA 2RV8A 1MDMA 2RC4A 4YFNF 5DD4A 5FD5A 3L9FA 2HOEA 3JTGA 1IN6A 5E1WA 2LSOA 3I0TA 1J7KA 5FO5A 2PFBA 1FY7A 5F64A 5BPIA 4HBLA 1EV7A 4HQEA 3E6BA 3ZN1A 2VXZA 5IT3A 4M72A 3Q5FA 5D6FA 2W85A 3G3ZA 1T98A 1KQ0A 2EJRA 3O6BB 1IN5A 4M9XA 4L9TA 5HS9A 5AONA 2FEZA 3R60A 3BOQA 1B9MA 3GX4X 2A6HF 2HFHA 2Z99A 1XSDA 3IWFA 2W24A 4KMUX 4HW0A 1BC8C 3SQNA 3JW4A 2HDCA 4RB0A 3LAPA 3OV8A 2IA2A 1YS7A 2F5EA 3B02A 3RJPA 1ZN2A 5J8CA 1MD0A 2M5WA 5HLIA 5HLGA 1GXQA 4RGSA 2W84A 3BPVA 2O03A 4DQ2A 2VC0A 1FSEA 4OMZA 4U7DA 5ICGA 2LKPA 1XD7A 4FX4A 3DEUA 3FXQA 3L00A 1KU2A 1FPQA 3D0SA 3ECHA 1CF7A 4ESJA 4EGYA 1OKRA 3IHUA 1EH6A 2DW4A 5F6FA 1U8RA 1L0OC 2IW5A 2QBYB 2ZMEB 4FX0A 1R00A 5ILSA 4LGWA 2DO7A 1XGMA 1OYYA 2COMA 3QAHA 3V8JA 1P4WA 2EFQA 4P9FA 4O3MA 1U5TC 2XAGA 4U0WA 3ZN0A 3HRTA 3SFZA 3VEPA 3TO6A 1K6OA 2X0LA 2D1VA 2FE3A 3MZYA 1Z91A 5DYMA 1B9NA 2Y0MA 2EFOA 4R1HA 3QOPA 1XGSA 2M8EA 3LQRA 1BN5A 5JI6A 3HSEA 4CHUA 3GEZA 4ENNA 2CYYA 1X3UA 4G9YA 2HYGD 2PBIA 2G7HA 3FF5A 1RIOH 1IN7A 2A68F 2ZJ2A 2Y75A 1FT9A 1FZPB 5HOOA 5D5XB 2XUBA 3TO7A 1TNTA 2BYVE 4HLYA 2EFNA 1DUXC 3R0JA 3TKYA 3BDDA 3EQLF 1T38A 5E17F 4OIOF 3E6MA 2BE5F 3FXRA 3CUQB 3LQQA 3L2CA 5HLHA 1QZZA 5DDGA 3GYHX 1GXPA 3K1MA 5L3CA 3FXUA 2YSRA 2ESNA 1D5VA 2V1XA 3FMQA 3GW2A 1JXSA 4HYEA 3WTYC 1FNNA 4GYGA 4MTDA 4TV7A 3WTTC 2JSCA 2QENA 2JT1A 3RYPA 2A5YB 2VT2A 4DNCA 1ZGAA 1LDJA 2P5VA 1KU7A 4BAYA 4YG2F 4ZYDA 1UCRA 2L4AA 2GA1A 2JZYA 4KN4X 5E1XA 4AIKA 1SAXA 2YU3A 5A2QK 3ROUA 2XHKA 1WI9A 2YR2A 3U9GA 1RZ4A 3W6JB 1D8KA 3R4KA 2ACJA 3HUGA 4ENMA 4ETSA 3KETA 5CVJA 3F21A 2VODA 2K4BA 4GXOA 1T2KA 1MDMB 1T6SA 2P6TA 2IJLA 1ZYRF 2BBYA 2PMUA 3T5XA 4A0XA 1SFUA 2ZXJA 3F8NA 2RQPA 2NAZA 4L9NA 1YYVA 4BQAA 1P4AA 1USSA 2NS0A 5TRDA 2E1CA 3IC7A 3CTAA 3IRQA 2H27A 1J5YA 1XCBA 5TJJA 4MQ9F 1S3JA 4ZH4F 3LAJA 4RS8A 1ZH5A 4KICA 4MQVA 2IT0A 2IP2A 2CQKA 1SMYF 3GZ5A 1G6NA 4LD5A 3M8EA 3GXOA 4CO8A 3WODF 2JTVA 4IRHA 4BH9A 2A6EF 3FHZA 1YQAA 2QBYA 2ZMEA 4OOIA 1MJAA 1T0FA 1Z6RA 1C0WA 5BQTA 3WU1B 4UV8A 4N0BA 1UB9A 4A5NA 4M71A 3J7AO 1ON2A 4PGHA 2V9VA 1IRFA 3KP6A 2CO5A 1R1UA 1OYIA 2V1UA 3ABTA 2K02A 3GUDA 4U7BA 2Z9OA 1YIOA 4UXNA 2H09A 3F8CA 3U1DA 2L54A 3IL2A 4ON0A 3RPUA 4LG0B 3GFJA 1J2XA 5LGUA 6PAXA 3LFKA 4QWQA 2KKOA 1TQIA 3BZ6A 4LK0F 2ZNYA 2E7WA 2WC2A 1ZLKA 4S04A 2DTRA 2FBKA 5CVVA 1ZRFA 3E6DA 4EM2A 2D2WA 3GWZA 3FX3A 2LF8A 4OMYA 3FWEA 5K5RA 1TW3A 2L01A 3F6OA 3J80K 4KDPA 4A6EA 1IN4A 4IJAA 2R7DA 4M9ZA 1U3EM 3M7GA 4EJWA 1K7AA 5LHIA 2ESHA 2W25A 1BM9A 2CFXA 1MJ9A 2Z5UA 1U5TB 2O0YA 2HZTA 3KEOA 4I98B 5E18F 2DQRA 2KJCA 4HAMA 2H6BA 2PLYA 2W57A 4I0AA 3VB2A 3F8FA 1F5TA 3SZPA 3KP3A 2QLZA 2EV5A 2P7VB 2XAFA 5LEJA 3KCCA 5DEQA 4HDVA 2UZKA 1V3FA 5IT9K 2ISYA 2YX7A 5L3DA 1YS6A 4GO1A 5FFZA 1AWCA 2H94A 3EDPA 5L3FA 3N97A 1YW8A 2STWA 4YFXF 1ZREA 1O3QA 2VE9A 4KN7X 2VBZA 1ZAOA 4YFKF 5H6QA 1YLFA 1SFEA 2K7LA 4EJVA 3ZMDA 3WTXC 3KP2A 1D8JA 1ONVA 4L5IA 2QUFA 1YTYA 3RTRA 2OZUA 2LDUA 2XAQA 3P9IA 4H0EA 3HHHA 3O2PE 4R8HA 3CO6C 2OBPA 1FP2A 1SMTA 4L18B 5FGMA 2GWRA 1R1VA 4BYYA 1FOKA 5LEKA 2OA4A 2KJBA 4P55A 2WTEA 3TQNA 4MEYF 3RKYA 5KVRA 1LQ1A 1MKMA 3DFGA 3KEQA 5K5OA 2ZBKA 1ZHFA 3HYIA 4G7HF 3K2ZA 1GHCA 3FMRA 5JVTA 1LEBA 5BPDA 4EV0A 1FWZA 5HDKA 2HR3A 4EJOA 4WXDA 5KK1A 2HQRA 1R1TA 2EFPA 1IRGA 3ZMZA 3ISPA 3GO5A 2QZ8A 4HX7A 2P5KA 4WK8F 5K1YA 5ICEA 4PDKA 5ILVA 3FMSA 5D5UB 4LG0A 1ZG3A 5EEHA 3SHFA 1J59A 2IRFG 5FFXA 2XASA 1B4AA 3DKWA 1R23A 1JHFA 3AAFA 3EUHA 2MBFA 4N9HA 1IXRC 2XVCA 2EB7A 3F8MA 5ED4A 2F5DA 1V4RA 1IF1A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4WXH A;  3E6C C;  3TOA A;  3HRU A;  4OIQ F;  1IAW A;  1STZ A;  1LDD A;  1WQ2 A;  3WTW C;  2PJP A;  3DP7 A;  1SD6 A;  3MQ0 A;  3REO A;  4M6X A;  3CJN A;  5AIP A;  1B6A A;  3I54 A;  1DPU A;  3D5L A;  3QRF F;  3GF2 A;  2JPB A;  1RI7 A;  3GZ6 A;  4IRG A;  2PI0 A;  1FX7 A;  3WE3 A;  2VOP A;  1K79 A;  4FT8 A;  5JFR A;  1TQM A;  1DDN A;  3ML6 A;  3DF8 A;  5HS7 A;  4M6Y A;  3BWG A;  4KUM A;  2QQB A;  2GXB A;  4RAZ A;  1I27 A;  1SFX A;  1HSJ A;  3KE2 A;  1NHA A;  2FU4 A;  2ZCW A;  1O7F A;  1OPC A;  5K5Q A;  4I02 A;  4KT5 C;  4ESF A;  1F4K A;  1J0R A;  1U5T A;  3P9K A;  3V4G A;  2ZO4 A;  4HX4 A;  2NNY A;  1UFM A;  3J81 Z;  3EYI A;  4CGZ A;  4WX9 A;  1F1Z A;  2DLL A;  3HSF A;  3F8B A;  4I0B A;  2BV6 A;  1Z7U A;  2STT A;  3SZT A;  2CW0 F;  1KQ8 A;  2EV0 A;  4ENJ A;  3FM5 A;  4BHB A;  3C1D A;  4UVC A;  3BJ6 A;  3WU0 A;  2F2E A;  2M45 A;  3E97 A;  4HF1 A;  3MEX A;  1H9T A;  3C3W A;  2WV0 A;  4IVN A;  3SXY A;  1ODD A;  2GQQ A;  1FBQ A;  1G3T A;  1HW2 A;  2XRN A;  4G6D A;  4BXU A;  4I01 A;  3IRR A;  4KIB A;  1YO5 C;  3BPX A;  4O6J A;  1ZG1 A;  3F23 A;  3TO9 A;  4OU0 A;  4N9I A;  2V1D A;  1XGN A;  4CIC A;  2O8X A;  3MCZ A;  5D8K B;  2VBY A;  2PG4 A;  3JTH A;  1WRJ A;  4KA4 A;  2UXX A;  1I6X A;  5AIQ A;  2KIU A;  2X4H A;  4OIN F;  5DUK A;  2FXA A;  1F9N A;  2NYX A;  2GA2 A;  4ZZL A;  4AIJ A;  4U0V A;  3GVA A;  1LVA A;  3K1N A;  2IA0 A;  3BP8 A;  4RGU A;  3KFW X;  3WGG A;  1ZLJ A;  1LJ9 A;  4HOB A;  3I4P A;  1K78 B;  5LGN A;  1ZG5 A;  1XSX A;  1BIA A;  1G3S A;  2OZ6 A;  1SD7 A;  4G94 A;  3RYR A;  1AOY A;  5E8G A;  3Q9S A;  1FBU A;  2PQ8 A;  5FB2 A;  2RDP A;  1O3R A;  1XDU A;  3WE2 A;  4G7O F;  1BI0 A;  2VBW A;  2M1B A;  5JR3 A;  2RN7 A;  1KYW A;  1JGS A;  1BJA A;  1PUE E;  1VTN C;  4RB1 A;  3M1E A;  3T8R A;  1Z05 A;  1IUY A;  3F6V A;  2JPC A;  4UHT A;  2D1H A;  3K9T A;  5L3B A;  3BJO A;  3I5U A;  1RNL A;  1YFH A;  4EQQ A;  5FLX Z;  4NHJ A;  4G7Z F;  3QPH A;  1D3Y A;  5D6E A;  1FBS A;  2V6C A;  2P5L C;  2E7X A;  2NNN A;  1LDK B;  4G6Q A;  2QWW A;  3TDZ C;  4EVI A;  3RDI A;  1WWX A;  1W4M A;  1XCV A;  3QPT A;  1O7L A;  3HIF A;  3DPT A;  4HQM A;  3EET A;  3B73 A;  1BI3 A;  1U6G A;  1TLH B;  3C18 A;  2CSO A;  4IRI A;  1BI2 A;  4ESB A;  4M9S A;  1FSH A;  1OMI A;  1BC7 C;  1HKQ A;  4LFU A;  2EA4 A;  3ABU A;  2HEO A;  3MAJ A;  1OR7 A;  4OIR F;  1IXC A;  3NEU A;  3L7W A;  1LB2 A;  1IXS B;  2EA2 A;  1B59 A;  1XSV A;  1ZRC A;  1BBY A;  3E3V A;  4FHT A;  1DP7 P;  2LNB A;  1EH7 A;  4EM1 A;  4AWX B;  3K69 A;  4O5V A;  2RGV A;  2RKH A;  4NQW A;  2H6C A;  3JAM Z;  5LHG A;  5D4R A;  3M8F A;  4I09 A;  3RKX A;  4D0P A;  5HVQ C;  1Y0U A;  5D5V B;  3MFK A;  2HTS A;  3JSO A;  1G4D A;  2XRO A;  2C6Y A;  3R61 A;  4Q48 A;  5E8I A;  1DPR A;  4LLN A;  5FD6 A;  4OIP F;  1R22 A;  1UHM A;  4R79 A;  2HTJ A;  3LST A;  4CYD A;  3I59 A;  4GGG A;  4GYI A;  3ZMV A;  2DPD A;  3WTZ A;  4HDU A;  4GCV A;  4WWC A;  5H6R A;  1BI1 A;  2OD5 A;  4LLG F;  3CO7 C;  1BOA A;  2E1N A;  3DV8 A;  1P6R A;  4A6D A;  1YW7 A;  3GLX A;  3PQK A;  5CVI A;  4CZZ A;  1FP1 D;  2FSW A;  4PGG A;  3T0Y A;  4UNO A;  5BOX A;  4RAY A;  2EK5 A;  1MJB A;  2J5P A;  4AD9 A;  1E2X A;  4CXF A;  1IZ1 A;  3KP7 A;  2AS5 F;  2Z33 A;  2M30 A;  1ULY A;  2HGC A;  3HTS B;  5LRS A;  1SD5 A;  1R5G A;  4EGZ A;  3V7S A;  2P6S A;  3BJA A;  4HX8 A;  5CLS A;  1XMK A;  3GFM A;  1XB4 A;  1QQI A;  1QO0 D;  4PZJ A;  4A12 A;  1O3T A;  4M73 A;  2OU2 A;  1H9G A;  4MTE A;  2TDX A;  1K78 A;  2CG4 A;  4XLN F;  2VOO A;  3RPQ A;  5LHH A;  4L0Y B;  3JAM K;  2VN2 A;  4L5J A;  2FOK A;  3K1P A;  5ILU A;  3LA7 A;  4KMF A;  1Z1D A;  1QZY A;  2P7C B;  2Y48 A;  2DU9 A;  4YII A;  1KU3 A;  3BRO A;  1R36 A;  4ZZD A;  2XKO A;  3HOS A;  2FML A;  4Q5S F;  1KA8 A;  1WSU A;  4IF4 A;  1O57 A;  2IVM A;  1HKS A;  3QP5 A;  1HKT A;  1QNT A;  3I64 A;  4KFC A;  1XMA A;  2FBH A;  3CDH A;  4IPA A;  3IWZ A;  3KP4 A;  4LJZ F;  5ERI A;  2DQL A;  4EMS A;  4P9U A;  1JE8 A;  2PN6 A;  1G3Y A;  4RB2 C;  2R3S A;  3HSR A;  4I7H A;  2DI3 A;  3TGN A;  1UST A;  5LLQ A;  4KIG A;  3K0L A;  4HV6 A;  5DCM B;  5CVR A;  5LGT A;  1T39 A;  3I53 A;  1FC3 A;  3E5U A;  5CVU A;  1FYL A;  1R7J A;  4LMY A;  1KQ9 A;  2VT3 A;  3H3U A;  1W5S A;  4F7Z A;  1Z9C A;  4NB5 A;  2KIF A;  1BIB A;  1Z6T A;  2QQ9 A;  3F3X A;  3QP6 A;  2K86 A;  2DT5 A;  4L0Z B;  4ASN A;  3O3K A;  2R7F A;  3HOT A;  2VBX A;  3C7J A;  5LBQ A;  1XDS A;  1W7P D;  1UHW A;  3IKV A;  2K27 A;  2CWE A;  3IKT A;  2MLG A;  2A69 F;  4Y17 A;  2XIG A;  2Q2E A;  5D5W B;  3KZY A;  2G9W A;  3Q9V A;  5DUI A;  3ZMT A;  5JHU A;  4Y15 A;  1I1S A;  2L3D A;  2YPR A;  4P5O A;  4JQF A;  2DFI A;  2ELH A;  2O6G E;  5BMZ A;  3ZMU A;  3RIR A;  4AIH A;  2GAU A;  5L3E A;  2DPU A;  1OYW A;  2FBI A;  2BGC A;  4U88 A;  1S7O A;  4LLL A;  2EFW A;  4XRF A;  2ADU A;  1QPM A;  4UV9 A;  1S29 A;  3PFI A;  1R5H A;  2DBB A;  1U2W A;  2F5C A;  1XN7 A;  3EYY A;  2Z3Y A;  1TBX A;  4UVB A;  4E70 A;  3ELK A;  4AVP A;  4IHT A;  2HKO A;  1J75 A;  2V79 A;  2HS5 A;  3L09 A;  1REP C;  1WKM A;  3DPL C;  2GXG A;  1LEA A;  2ZNZ A;  2NRA C;  3BY6 A;  3HHG A;  5A2Q Z;  1W5T A;  1P92 A;  4WCG A;  1QBJ A;  2IPQ X;  1CGP A;  1JHH A;  3V8K A;  4I2O A;  3F72 A;  1HST A;  3P7N A;  3NQO A;  2MD5 A;  4XSZ F;  2HYF A;  4MNU A;  4HZF A;  5H20 A;  2PMH A;  1W7P A;  1H0M A;  3CLO A;  3ZP5 A;  4BHP A;  3MWM A;  4EM0 B;  3I59 B;  4A2U A;  2FQ3 A;  3ECO A;  5ICC A;  3FZV A;  5HDG A;  2A61 A;  3JSP A;  2KRF A;  5F1R A;  4BHC A;  2MH2 A;  1IW7 F;  4L9V A;  1U78 A;  2K4J A;  3QU3 A;  4LB6 B;  4RGX A;  3WG9 A;  4RB3 C;  3QU6 A;  3I71 A;  3F22 A;  3R6S A;  2MH9 A;  2GIV A;  2LF7 A;  2OQG A;  4HF2 A;  1FLI A;  2XAH A;  3HRS A;  3MZH A;  4LB5 A;  1J9I A;  4L9J A;  3ZPL A;  3TOB A;  2Q0O A;  5CYV A;  4MGR A;  3RKW A;  2WWY A;  3I58 A;  3ZMS A;  4EJT A;  1PP8 F;  2Q8K A;  1KGS A;  1XGO A;  2OAZ A;  3V7R A;  5BS6 A;  2B0L A;  2ZKZ A;  2CGP A;  5DCM A;  1LNW A;  2F5F A;  2DAO A;  3HRM A;  4JBA A;  3LA3 A;  5HS8 A;  4ZYG A;  2M87 A;  2ETH A;  3ZQ7 A;  1S7A A;  1SD4 A;  5CJ9 A;  1HW1 A;  1TTY A;  3ERE D;  3KLN A;  3WTS C;  3VOD A;  3J81 K;  2UXN A;  1P2F A;  3DQV C;  2MLK A;  1ZRD A;  1RUN A;  2UWM A;  2MC3 A;  1HBX G;  3M9A A;  2QYO A;  2RVC A;  4WXC A;  1I5Z A;  2JRT A;  3CUO A;  2P4W A;  2O3F A;  5LRR A;  1YG2 A;  2FNP A;  3HTU A;  4YIF A;  4Z2Y A;  3TDU C;  3H3Z A;  3H92 A;  2HWV A;  2OQR A;  5HDN A;  1S8N A;  2QM3 A;  4CDG A;  1E17 A;  4KYW A;  5DD8 A;  2BEO A;  3S2W A;  2HQN A;  2PEX A;  1S6L A;  3T1B A;  3RI4 A;  4ENK A;  1O3S A;  3J80 Z;  3E5Q A;  1EH8 A;  1TW2 A;  1B1B A;  3ULQ B;  4EJU A;  3LWF A;  2ISZ A;  1MGT A;  3KLO A;  3DXJ F;  3N4M A;  4MHG A;  2VC1 A;  4KNY A;  5DCF A;  2FF4 A;  2IA1 A;  4Q47 A;  2XGX A;  2ZFW A;  2J5O A;  3COA C;  4PCQ A;  1RUO A;  3VFZ A;  3W6K B;  4HLX A;  1TNS A;  5J8F A;  1IN8 A;  3KZZ A;  2QVO A;  4BNC A;  2FRH A;  3P9C A;  3U2R A;  2VE8 A;  1ZAR A;  3CUQ C;  1QGP A;  4IXA A;  2L02 A;  4KIF A;  4G8X A;  1CF7 B;  2A07 F;  4K2E A;  4U0Y A;  5J6X A;  2YX4 A;  5ICF A;  2XV4 S;  5IT9 Z;  4HF0 A;  2FMY A;  2FA5 A;  4B09 A;  4A0Z A;  4UUV A;  3E5X A;  3WGH A;  3V8L A;  4RGR A;  5EEG A;  3OOP A;  3T8T A;  1A04 A;  2GZW A;  4IHS A;  2QQA A;  1G3W A;  4QLC U;  3WGI A;  4JK1 X;  4ZYE A;  4Y13 A;  4ZYH A;  1HQC A;  3KP5 A;  4LK1 F;  1HXD A;  2G7U A;  5FLX K;  1R58 A;  2XAJ A;  3CUQ A;  4Q4Z F;  1HW5 A;  1L3L A;  3GFI A;  1FYM A;  5D4S A;  3PQJ A;  1TQP A;  4M74 A;  2A3S A;  3GFL A;  2HKX A;  2RNJ A;  4B8X A;  4HA8 A;  5E1Z B;  1KU9 A;  1I1G A;  4A5M A;  4XBF A;  4MEX F;  3VOE A;  3NRV A;  2XKP A;  4HV5 A;  1ZGJ A;  1FYK A;  1P4X A;  1KYZ A;  3LA2 A;  4S05 A;  4XLP F;  2DK8 A;  1W7P B;  2DK5 A;  1PP7 U;  1ON1 A;  5D8L B;  1MZB A;  2VON A;  1GVJ A;  3R0A A;  5L3G A;  2P8T A;  5DV5 A;  2O61 A;  4UVA A;  2D45 A;  5E20 A;  3FM3 A;  4P96 A;  1YW9 A;  1Q1H A;  2EWN A;  2MA3 A;  3WTV C;  4XSX F;  2FNA A;  4WF2 A;  4A0Y A;  2AXL A;  2EV6 A;  1PDN C;  3WTU C;  3G73 A;  2KIM A;  3V7C A;  2L4M A;  2RV8 A;  1MDM A;  2RC4 A;  4YFN F;  5DD4 A;  5FD5 A;  3L9F A;  2HOE A;  3JTG A;  1IN6 A;  5E1W A;  2LSO A;  3I0T A;  1J7K A;  5FO5 A;  2PFB A;  1FY7 A;  5F64 A;  5BPI A;  4HBL A;  1EV7 A;  4HQE A;  3E6B A;  3ZN1 A;  2VXZ A;  5IT3 A;  4M72 A;  3Q5F A;  5D6F A;  2W85 A;  3G3Z A;  1T98 A;  1KQ0 A;  2EJR A;  3O6B B;  1IN5 A;  4M9X A;  4L9T A;  5HS9 A;  5AON A;  2FEZ A;  3R60 A;  3BOQ A;  1B9M A;  3GX4 X;  2A6H F;  2HFH A;  2Z99 A;  1XSD A;  3IWF A;  2W24 A;  4KMU X;  4HW0 A;  1BC8 C;  3SQN A;  3JW4 A;  2HDC A;  4RB0 A;  3LAP A;  3OV8 A;  2IA2 A;  1YS7 A;  2F5E A;  3B02 A;  3RJP A;  1ZN2 A;  5J8C A;  1MD0 A;  2M5W A;  5HLI A;  5HLG A;  1GXQ A;  4RGS A;  2W84 A;  3BPV A;  2O03 A;  4DQ2 A;  2VC0 A;  1FSE A;  4OMZ A;  4U7D A;  5ICG A;  2LKP A;  1XD7 A;  4FX4 A;  3DEU A;  3FXQ A;  3L00 A;  1KU2 A;  1FPQ A;  3D0S A;  3ECH A;  1CF7 A;  4ESJ A;  4EGY A;  1OKR A;  3IHU A;  1EH6 A;  2DW4 A;  5F6F A;  1U8R A;  1L0O C;  2IW5 A;  2QBY B;  2ZME B;  4FX0 A;  1R00 A;  5ILS A;  4LGW A;  2DO7 A;  1XGM A;  1OYY A;  2COM A;  3QAH A;  3V8J A;  1P4W A;  2EFQ A;  4P9F A;  4O3M A;  1U5T C;  2XAG A;  4U0W A;  3ZN0 A;  3HRT A;  3SFZ A;  3VEP A;  3TO6 A;  1K6O A;  2X0L A;  2D1V A;  2FE3 A;  3MZY A;  1Z91 A;  5DYM A;  1B9N A;  2Y0M A;  2EFO A;  4R1H A;  3QOP A;  1XGS A;  2M8E A;  3LQR A;  1BN5 A;  5JI6 A;  3HSE A;  4CHU A;  3GEZ A;  4ENN A;  2CYY A;  1X3U A;  4G9Y A;  2HYG D;  2PBI A;  2G7H A;  3FF5 A;  1RIO H;  1IN7 A;  2A68 F;  2ZJ2 A;  2Y75 A;  1FT9 A;  1FZP B;  5HOO A;  5D5X B;  2XUB A;  3TO7 A;  1TNT A;  2BYV E;  4HLY A;  2EFN A;  1DUX C;  3R0J A;  3TKY A;  3BDD A;  3EQL F;  1T38 A;  5E17 F;  4OIO F;  3E6M A;  2BE5 F;  3FXR A;  3CUQ B;  3LQQ A;  3L2C A;  5HLH A;  1QZZ A;  5DDG A;  3GYH X;  1GXP A;  3K1M A;  5L3C A;  3FXU A;  2YSR A;  2ESN A;  1D5V A;  2V1X A;  3FMQ A;  3GW2 A;  1JXS A;  4HYE A;  3WTY C;  1FNN A;  4GYG A;  4MTD A;  4TV7 A;  3WTT C;  2JSC A;  2QEN A;  2JT1 A;  3RYP A;  2A5Y B;  2VT2 A;  4DNC A;  1ZGA A;  1LDJ A;  2P5V A;  1KU7 A;  4BAY A;  4YG2 F;  4ZYD A;  1UCR A;  2L4A A;  2GA1 A;  2JZY A;  4KN4 X;  5E1X A;  4AIK A;  1SAX A;  2YU3 A;  5A2Q K;  3ROU A;  2XHK A;  1WI9 A;  2YR2 A;  3U9G A;  1RZ4 A;  3W6J B;  1D8K A;  3R4K A;  2ACJ A;  3HUG A;  4ENM A;  4ETS A;  3KET A;  5CVJ A;  3F21 A;  2VOD A;  2K4B A;  4GXO A;  1T2K A;  1MDM B;  1T6S A;  2P6T A;  2IJL A;  1ZYR F;  2BBY A;  2PMU A;  3T5X A;  4A0X A;  1SFU A;  2ZXJ A;  3F8N A;  2RQP A;  2NAZ A;  4L9N A;  1YYV A;  4BQA A;  1P4A A;  1USS A;  2NS0 A;  5TRD A;  2E1C A;  3IC7 A;  3CTA A;  3IRQ A;  2H27 A;  1J5Y A;  1XCB A;  5TJJ A;  4MQ9 F;  1S3J A;  4ZH4 F;  3LAJ A;  4RS8 A;  1ZH5 A;  4KIC A;  4MQV A;  2IT0 A;  2IP2 A;  2CQK A;  1SMY F;  3GZ5 A;  1G6N A;  4LD5 A;  3M8E A;  3GXO A;  4CO8 A;  3WOD F;  2JTV A;  4IRH A;  4BH9 A;  2A6E F;  3FHZ A;  1YQA A;  2QBY A;  2ZME A;  4OOI A;  1MJA A;  1T0F A;  1Z6R A;  1C0W A;  5BQT A;  3WU1 B;  4UV8 A;  4N0B A;  1UB9 A;  4A5N A;  4M71 A;  3J7A O;  1ON2 A;  4PGH A;  2V9V A;  1IRF A;  3KP6 A;  2CO5 A;  1R1U A;  1OYI A;  2V1U A;  3ABT A;  2K02 A;  3GUD A;  4U7B A;  2Z9O A;  1YIO A;  4UXN A;  2H09 A;  3F8C A;  3U1D A;  2L54 A;  3IL2 A;  4ON0 A;  3RPU A;  4LG0 B;  3GFJ A;  1J2X A;  5LGU A;  6PAX A;  3LFK A;  4QWQ A;  2KKO A;  1TQI A;  3BZ6 A;  4LK0 F;  2ZNY A;  2E7W A;  2WC2 A;  1ZLK A;  4S04 A;  2DTR A;  2FBK A;  5CVV A;  1ZRF A;  3E6D A;  4EM2 A;  2D2W A;  3GWZ A;  3FX3 A;  2LF8 A;  4OMY A;  3FWE A;  5K5R A;  1TW3 A;  2L01 A;  3F6O A;  3J80 K;  4KDP A;  4A6E A;  1IN4 A;  4IJA A;  2R7D A;  4M9Z A;  1U3E M;  3M7G A;  4EJW A;  1K7A A;  5LHI A;  2ESH A;  2W25 A;  1BM9 A;  2CFX A;  1MJ9 A;  2Z5U A;  1U5T B;  2O0Y A;  2HZT A;  3KEO A;  4I98 B;  5E18 F;  2DQR A;  2KJC A;  4HAM A;  2H6B A;  2PLY A;  2W57 A;  4I0A A;  3VB2 A;  3F8F A;  1F5T A;  3SZP A;  3KP3 A;  2QLZ A;  2EV5 A;  2P7V B;  2XAF A;  5LEJ A;  3KCC A;  5DEQ A;  4HDV A;  2UZK A;  1V3F A;  5IT9 K;  2ISY A;  2YX7 A;  5L3D A;  1YS6 A;  4GO1 A;  5FFZ A;  1AWC A;  2H94 A;  3EDP A;  5L3F A;  3N97 A;  1YW8 A;  2STW A;  4YFX F;  1ZRE A;  1O3Q A;  2VE9 A;  4KN7 X;  2VBZ A;  1ZAO A;  4YFK F;  5H6Q A;  1YLF A;  1SFE A;  2K7L A;  4EJV A;  3ZMD A;  3WTX C;  3KP2 A;  1D8J A;  1ONV A;  4L5I A;  2QUF A;  1YTY A;  3RTR A;  2OZU A;  2LDU A;  2XAQ A;  3P9I A;  4H0E A;  3HHH A;  3O2P E;  4R8H A;  3CO6 C;  2OBP A;  1FP2 A;  1SMT A;  4L18 B;  5FGM A;  2GWR A;  1R1V A;  4BYY A;  1FOK A;  5LEK A;  2OA4 A;  2KJB A;  4P55 A;  2WTE A;  3TQN A;  4MEY F;  3RKY A;  5KVR A;  1LQ1 A;  1MKM A;  3DFG A;  3KEQ A;  5K5O A;  2ZBK A;  1ZHF A;  3HYI A;  4G7H F;  3K2Z A;  1GHC A;  3FMR A;  5JVT A;  1LEB A;  5BPD A;  4EV0 A;  1FWZ A;  5HDK A;  2HR3 A;  4EJO A;  4WXD A;  5KK1 A;  2HQR A;  1R1T A;  2EFP A;  1IRG A;  3ZMZ A;  3ISP A;  3GO5 A;  2QZ8 A;  4HX7 A;  2P5K A;  4WK8 F;  5K1Y A;  5ICE A;  4PDK A;  5ILV A;  3FMS A;  5D5U B;  4LG0 A;  1ZG3 A;  5EEH A;  3SHF A;  1J59 A;  2IRF G;  5FFX A;  2XAS A;  1B4A A;  3DKW A;  1R23 A;  1JHF A;  3AAF A;  3EUH A;  2MBF A;  4N9H A;  1IXR C;  2XVC A;  2EB7 A;  3F8M A;  5ED4 A;  2F5D A;  1V4R A;  1IF1 A; 
#chains in the Genus database with same CATH topology
 4WXH A;  3E6C C;  3TOA A;  3HRU A;  5K7F A;  4OIQ F;  3BZK A;  1IAW A;  4XL9 A;  4ZC3 A;  4B43 A;  1STZ A;  3HOY J;  1LDD A;  1WQ2 A;  1TT5 B;  3WTW C;  2PJP A;  2OPT A;  3DP7 A;  3ASN H;  2HOT A;  2M3A A;  1SD6 A;  1XPX A;  3MQ0 A;  3REO A;  4M6X A;  3S8P A;  5B1A H;  3UKG A;  3CJN A;  2VKD A;  5AIP A;  5CQG A;  3D1N I;  1B6A A;  3ZQQ A;  3BR3 A;  3I54 A;  1DPU A;  1BR2 A;  3D5L A;  4HNU A;  3QRF F;  3DKX A;  3GF2 A;  3HBL A;  2JPB A;  1RI7 A;  3GZ6 A;  4IRG A;  1WJE A;  4NNJ A;  2PI0 A;  3DPU A;  1FX7 A;  2CU7 A;  3WE3 A;  2VOP A;  1K79 A;  2LY1 A;  2IGO A;  4FT8 A;  5JFR A;  2R7O A;  1TC3 C;  1TQM A;  4HNT A;  1LFU P;  3ML6 A;  1DDN A;  3DF8 A;  5HS7 A;  2M9H A;  4PJN A;  4M6Y A;  1T95 A;  3BWG A;  1OCC H;  4BQQ A;  2KMU A;  4KUM A;  1OCZ H;  3H5A A;  2QQB A;  1IG7 A;  2GXB A;  3JRF A;  4RAZ A;  4IO9 F;  3H9Q A;  1I27 A;  1SFX A;  4U87 A;  1MND A;  1HSJ A;  3KE2 A;  1NHA A;  2FU4 A;  2ZCW A;  1D1A A;  1O7F A;  4FTH A;  1OPC A;  2E2I J;  5K5Q A;  4I02 A;  1WFX A;  4KT5 C;  4NQW B;  3TW7 A;  4ESF A;  3S17 J;  1F4K A;  1MMD A;  2VKE A;  1J0R A;  1U5T A;  4PSW A;  4QSH A;  3P9K A;  3CCJ I;  3I3L A;  3V4G A;  1WI3 A;  2ZO4 A;  4HX4 A;  3H3V K;  2CUF A;  2NNY A;  1UFM A;  3J81 Z;  3CC4 I;  3EYI A;  2M7B A;  4CGZ A;  4WX9 A;  1WH5 A;  1F1Z A;  2DLL A;  3HSF A;  3F8B A;  4I0B A;  2BV6 A;  1Z7U A;  4BY1 J;  2STT A;  3K4L A;  2M4K A;  1WCM J;  2Z2S B;  1V54 H;  3HOX J;  3SZT A;  2CW0 F;  4M3E A;  1A36 A;  5FJ8 J;  1SFO J;  1ETQ A;  4M3B A;  1VZ0 A;  1KQ8 A;  2EV0 A;  3AG4 H;  4ENJ A;  3FM5 A;  1X3Z B;  4A3I J;  4BHB A;  3G2B A;  2CV0 A;  3HM5 A;  3C1D A;  4UVC A;  3BJ6 A;  3S93 A;  3BR6 A;  3WU0 A;  2FJ1 A;  2PX9 A;  2F2E A;  2H8W A;  1VND A;  2M45 A;  3E97 A;  1QRY A;  4HF1 A;  3MEX A;  1H9T A;  1MMN A;  3C3W A;  3UR3 C;  3OYG A;  2WV0 A;  4M3F A;  1EKE A;  2XSJ C;  4IVN A;  5CQE A;  3SXY A;  3LMM A;  1ODD A;  4MFD A;  2GQQ A;  4CCJ A;  1FBQ A;  2R5Y B;  1ACI A;  1G3T A;  1HW2 A;  2GBY A;  2XRN A;  3RSN A;  4G6D A;  3OR2 C;  4BXU A;  3IUO A;  3K2A A;  4I01 A;  3IRR A;  4KIB A;  4B44 A;  2E2J J;  1BA5 A;  1YO5 C;  3BPX A;  4O6J A;  2L9S A;  1ZG1 A;  5FLV A;  4W1U A;  4QPO A;  3F23 A;  1OCT C;  3TO9 A;  3S1N J;  4OU0 A;  4N9I A;  1OQY A;  2V1D A;  1HF0 A;  1NK2 P;  2KLO A;  3K70 D;  1XGN A;  4CIC A;  2O8X A;  3MCZ A;  5D8K B;  1RET A;  4MO7 A;  4BKX A;  5B3S H;  1FJL A;  2VBY A;  2PG4 A;  3JTH A;  1WRJ A;  4DIQ A;  4KA4 A;  2IS2 A;  3TL4 X;  2UXX A;  4PSX A;  4ZTF A;  1I6X A;  3FDY A;  2FX0 A;  1BR1 A;  5KNL A;  1W36 C;  4A3B J;  5AIQ A;  5F0C A;  5M5X J;  2KIU A;  2X4H A;  1MW7 A;  4GDF A;  4OIN F;  5FRM A;  5DUK A;  1X1A A;  1YX3 A;  2FXA A;  1F9N A;  4XLC A;  1OLT A;  2NYX A;  3BTI A;  1GDT A;  2GA2 A;  3DLL F;  4ZZL A;  4AIJ A;  4LIT A;  2BZT A;  4U0V A;  3GVA A;  2B7E A;  2L9V A;  1LVA A;  3K1N A;  2Z16 A;  2IA0 A;  2A6T A;  3BP8 A;  4RGU A;  4A3C J;  3KFW X;  5E3L A;  3WGG A;  1ZLJ A;  3CCM I;  2GXA A;  3EPZ A;  1LJ9 A;  4HOB A;  3I4P A;  1VQO I;  2ME6 A;  1K78 B;  4QPQ A;  5LGN A;  2M8G X;  1ZG5 A;  1XSX A;  4BQN A;  2FQ4 A;  1BIA A;  1G3S A;  2OZ6 A;  4P1W A;  1SD7 A;  2Y9Y A;  3M4O J;  2M7A A;  4G94 A;  3RYR A;  1AOY A;  5E8G A;  2CQQ A;  2CFO A;  3Q9S A;  1FBU A;  2PQ8 A;  5FB2 A;  2RDP A;  4RAG A;  1WVR A;  3K7A J;  1XDU A;  3A01 B;  1O3R A;  3WE2 A;  4G7O F;  1BI0 A;  2VBW A;  2M1B A;  5JR3 A;  2RN7 A;  3AG3 H;  1KYW A;  3PIO F;  5GP9 A;  1JGS A;  1U9O A;  2COB A;  1BJA A;  4BQO A;  1PUE E;  1UJ8 A;  1VTN C;  3BR1 A;  4RB1 A;  3M1E A;  2VUM J;  3T8R A;  3AFH A;  1AU7 A;  2NVY J;  1R4M B;  1Z05 A;  1IUY A;  3F6V A;  2X51 A;  3K70 C;  2JPC A;  4UHT A;  2X6Y A;  4AM3 A;  2D1H A;  3K9T A;  1S7E A;  5L3B A;  3BJO A;  3I5U A;  1RNL A;  1WPK A;  4D1Q A;  4XLE A;  1YFH A;  4EQQ A;  5FLX Z;  4XRM A;  4NHJ A;  4A3D J;  4DBQ A;  4G7Z F;  3QPH A;  4XM3 A;  3A2K A;  1D3Y A;  3BTC A;  5D6E A;  1FBS A;  5IPA A;  2V6C A;  1JKQ C;  1OR7 C;  2M0C A;  2P5L C;  2E7X A;  2NNN A;  1LDK B;  3OYM A;  3S1Q J;  3QQA A;  4G6Q A;  2QWW A;  3TDZ C;  1IUF A;  2O5R A;  3OYN A;  2JVH A;  4EVI A;  3RDI A;  1WWX A;  3CDL A;  3SDB A;  1W4M A;  1X19 A;  1X1P A;  1XCV A;  3W6V A;  3LSK A;  2PMZ A;  3QPT A;  1O7L A;  3HIF A;  3K4N A;  5DS9 A;  4BS9 A;  2LRE A;  3DPT A;  4HRI A;  2AXT C;  4HQM A;  3J7Y J;  2VJ4 A;  2V6E A;  5J47 A;  2JJ7 A;  3EET A;  3B73 A;  1ZQ3 P;  4CA0 A;  1BI3 A;  2QKL B;  1U6G A;  1TLH B;  2G0E A;  3C18 A;  4BUP A;  2JN6 A;  2KPM A;  2CSO A;  3BG5 A;  1FMV A;  4IRI A;  1BI2 A;  4ESB A;  4M9S A;  1VQ4 I;  1OMI A;  1BC7 C;  1FSH A;  5IYD J;  2CUE A;  1HKQ A;  4LIV A;  3IH2 A;  2EPF A;  1W1W E;  4LFU A;  2EA4 A;  3ABU A;  2HEO A;  3HKZ N;  3MAJ A;  1E3P A;  5J4Y A;  3MKY B;  1OR7 A;  1LVK A;  1PYV A;  4OIR F;  4PJJ A;  1IXC A;  3NEU A;  2MGQ A;  3L7W A;  1LB2 A;  2VIX A;  1YJW I;  1IXS B;  5CPR B;  5EZH A;  2EA2 A;  1B59 A;  1XSV A;  4DJA A;  1ZRC A;  1BBY A;  3HOW J;  3E3V A;  4FHT A;  1DP7 P;  3JRC A;  4Y52 J;  2FD5 A;  2LNB A;  1EH7 A;  4EM1 A;  4AWX B;  4HEA 2;  3K69 A;  4O5V A;  4CYC B;  2R0Q C;  2RGV A;  1Y1V J;  2RKH A;  4NQW A;  3W3C A;  3OYH A;  1VQL I;  2H6C A;  3JAM Z;  1UG0 A;  3H9G A;  5LHG A;  5D4R A;  1YIJ I;  3M8F A;  4I09 A;  3RKX A;  2MD0 A;  4D0P A;  5IP9 J;  5HVQ C;  1Y0U A;  5D5V B;  3RZO J;  3MFK A;  5GAH J;  2HTS A;  2OTJ I;  3JSO A;  1YJN I;  3OIO A;  1G4D A;  1TWH J;  2XRO A;  2C6Y A;  2X48 A;  3R61 A;  3CMM A;  3B6A A;  4Q48 A;  1T8I A;  2DMT A;  5E8I A;  1DPR A;  2V9P A;  3I55 I;  3KIO A;  4LLN A;  4DW6 A;  4A3M J;  5FD6 A;  3SEQ A;  4OIP F;  3OYK A;  1R22 A;  1UHM A;  4XN3 A;  4R79 A;  1IV6 A;  1E0E A;  2ME0 A;  2CS3 A;  3ZQF A;  2BY2 A;  4AID A;  2HTJ A;  3LST A;  4CYD A;  3I59 A;  4GGG A;  2QEX I;  4GYI A;  1MNM C;  3BG6 A;  3ZMV A;  2DPD A;  2R93 J;  1FOX A;  3WTZ A;  1E3H A;  4HDU A;  1I50 J;  1V5E A;  4GCV A;  4WWC A;  2CMP A;  5H6R A;  3VDX A;  1BI1 A;  2OD5 A;  4LLG F;  3CO7 C;  1BOA A;  2E1N A;  3DV8 A;  1IO2 A;  2PMZ N;  1H89 C;  1P6R A;  5IY5 H;  2IXS A;  3BCA A;  4BE2 A;  4A6D A;  1YW7 A;  3QYB A;  3GLX A;  3CMY A;  3PQK A;  5CVI A;  4CZZ A;  3TP0 A;  1FP1 D;  2FSW A;  4PGG A;  4CCN A;  3T0Y A;  2HXI A;  5TGT A;  4UNO A;  2HZD A;  5BOX A;  1YRN B;  4RAY A;  2NVU B;  4RMN A;  3C2H A;  2JVG A;  3M1C A;  4XQF A;  2EK5 A;  1MJB A;  2J5P A;  1AHD P;  1DP3 A;  3BR2 A;  4AD9 A;  3A03 A;  3OIQ A;  2XPW A;  1E2X A;  3B6C A;  1XX5 A;  4CXF A;  1IZ1 A;  2W82 A;  3KP7 A;  3VWB A;  3KEY A;  2DN0 A;  2Z33 A;  2M30 A;  2AS5 F;  2FUG 2;  1ULY A;  3C2B A;  2HGC A;  1EF4 A;  3HTS B;  1T56 A;  5LRS A;  1SD5 A;  1R5G A;  4EGZ A;  3V7S A;  2M0M A;  2P6S A;  1JKP C;  3BJA A;  2E1M C;  4HX8 A;  5CLS A;  4E7S A;  2LTP A;  3LSM A;  5HLT A;  2F48 A;  1K4T A;  1XMK A;  1BOB A;  2L7K A;  3GFM A;  1XB4 A;  3GCM A;  1K4S A;  1QQI A;  1X2M A;  1QO0 D;  3P5J A;  4PZJ A;  2EIN H;  4A12 A;  2B63 J;  5C44 J;  4M73 A;  1O3T A;  2OU2 A;  4XNF A;  1MBK A;  1H9G A;  3DTE A;  2F5V A;  4MTE A;  3HOV J;  1T08 B;  2TDX A;  2CG4 A;  4XLN F;  1K78 A;  1PUF A;  2VOO A;  3RPQ A;  5LHH A;  1CQT A;  2WAE A;  4L0Y B;  3JAM K;  2VN2 A;  3ZRG A;  4L5J A;  2FOK A;  2R7U A;  3K1P A;  5ILU A;  3HB9 A;  3LA7 A;  1R71 A;  4KMF A;  2K3P A;  1Z1D A;  1QZY A;  2P7C B;  2Y48 A;  3ERM A;  3A01 A;  2DU9 A;  1SVO A;  4YII A;  1VQP I;  1KU3 A;  3BRO A;  1R36 A;  4ZZD A;  2WAQ N;  2XKO A;  1MMA A;  3HOS A;  3RQI A;  2FML A;  4Q5S F;  3V42 A;  1KA8 A;  2IEK A;  1WSU A;  3W2W A;  2RNG A;  2XF5 A;  4IF4 A;  1JGG A;  1O57 A;  2X6W A;  3MN2 A;  3D5R C;  1BR4 A;  2IVM A;  2KQR A;  1HKS A;  2DDB A;  4F92 B;  4RDU A;  3QP5 A;  1D0X A;  1HKT A;  4LIU A;  1QNT A;  3I64 A;  4KFC A;  3VPR A;  2OTL I;  1XMA A;  2FBH A;  3CDH A;  4IPA A;  3IWZ A;  3KP4 A;  2QGU A;  5C3E J;  4LJZ F;  1YJ9 I;  5ERI A;  3MKZ A;  1G59 A;  3OYD A;  2DQL A;  4EMS A;  4P9U A;  1P9Q C;  1JE8 A;  3BQZ A;  2PN6 A;  2DA3 A;  1G3Y A;  2QF7 A;  1ETW A;  4RB2 C;  2R3S A;  3HSR A;  1O4X A;  4I7H A;  4KIS A;  2DI3 A;  4NC7 A;  3TGN A;  1UST A;  1GV5 A;  3S2H J;  3GTL J;  5LLQ A;  4KIG A;  5GTI C;  3K0L A;  4HV6 A;  5DCM B;  5CVR A;  5LGT A;  1T39 A;  3I53 A;  1D1C A;  4DYQ A;  1RES A;  1FC3 A;  3E5U A;  4D7N A;  2ECC A;  5CVU A;  2LFB A;  1FYL A;  1R7J A;  4LMY A;  2H1L A;  1KQ9 A;  2VT3 A;  3H3U A;  2R7W A;  3K10 A;  2KRH A;  1W5S A;  2E1O A;  3M8J A;  4F7Z A;  1Z9C A;  4NB5 A;  3ZQL A;  2KIF A;  3EUK L;  2BHZ A;  3Q0V A;  1BIB A;  1Z6T A;  2QQ9 A;  2L9R A;  3E0J B;  4C3I J;  3F3X A;  3GBG A;  2K86 A;  3FXL A;  3QP6 A;  2DT5 A;  4L0Z B;  1DU0 A;  1VQ9 I;  2LVS A;  4ASN A;  2GOM A;  3O3K A;  2R7F A;  3HOT A;  2VBX A;  2X85 A;  3BQY A;  3C7J A;  1XDS A;  1W7P D;  2GOX B;  5LBQ A;  1QVT A;  2HOS A;  3RCO A;  3OSG A;  1P7J A;  3OYE A;  1UHW A;  3IKV A;  2K27 A;  1MH3 A;  1ENH A;  2HQ5 A;  1U9N A;  2CWE A;  1S5L C;  4PK4 A;  3IKT A;  2V26 A;  4CCK A;  2MLG A;  1X3W B;  2HNH A;  2L5Q A;  3BC8 A;  2A69 F;  4Y17 A;  2XIG A;  1WJA A;  2N8G A;  4IHY A;  3HOZ J;  2Q2E A;  5D5W B;  2LG4 A;  2DT6 A;  3KZY A;  1TWC J;  2G9W A;  3Q9V A;  5DUI A;  3ZMT A;  2RRE A;  5JHU A;  4Y15 A;  4I99 C;  1I1S A;  2L3D A;  3ZCO A;  1M1E B;  2YPR A;  2QQ8 A;  4P5O A;  2MAB A;  4JQF A;  3FXJ A;  1UMQ A;  2E35 A;  2HI3 A;  2DFI A;  5FRO A;  2ELH A;  2O6G E;  5BMZ A;  3DU6 A;  3ZMU A;  3GTQ J;  3RIR A;  4AIH A;  2GAU A;  5L3E A;  2XGD A;  1W0T A;  2DPU A;  1OYW A;  2FBI A;  3PM1 A;  2BGC A;  5JLX A;  1V5F A;  4U88 A;  1S7O A;  4LLL A;  2EFW A;  4XRF A;  2ADU A;  1LFB A;  2XB5 A;  1IDY A;  1QPM A;  4UV9 A;  1S29 A;  1QU3 A;  3PFI A;  4JYK A;  3VSK A;  1VQ8 I;  1Z21 A;  3LSH A;  3S1M J;  1R5H A;  2DBB A;  4XLF A;  4A3G J;  1U2W A;  2CQX A;  2LD5 A;  2F5C A;  1XN7 A;  3EYY A;  2HQA A;  4XKW A;  2WV1 A;  3OOU A;  4G12 A;  1AKH B;  2Z3Y A;  1TBX A;  3AKZ A;  2MG4 A;  1AA7 A;  4UVB A;  4E70 A;  1A6I A;  1TP4 A;  3ELK A;  1W5C C;  4AVP A;  4IHT A;  3C2G A;  3H1C A;  2MW8 A;  2HKO A;  1J75 A;  2V79 A;  1W0U A;  4BL0 B;  3OL4 A;  2HS5 A;  5EZG A;  3NAU A;  3L09 A;  2DJI A;  1REP C;  1TZL A;  1WKM A;  2ZFU A;  1F36 A;  1VQ7 I;  3DPL C;  2Y30 A;  2GXG A;  1LEA A;  3QOE A;  2ZNZ A;  5JHF A;  2NRA C;  3BY6 A;  3HHG A;  5A2Q Z;  2E71 A;  3L2U A;  1W5T A;  3CMA I;  1P92 A;  1TWF J;  4WCG A;  1X4O A;  1QBJ A;  3L2V A;  2IPQ X;  4FE7 A;  1RKW A;  1YRN A;  2VQC A;  2WY8 Q;  2DJN A;  1CGP A;  1JHH A;  2DA5 A;  3HPH A;  3V8K A;  3F72 A;  4I2O A;  1N77 A;  1HST A;  3P7N A;  3NQO A;  2MD5 A;  3ZGK A;  1NH3 A;  4ZDO A;  3EUA A;  3DBR B;  3PJR A;  4XSZ F;  3PO3 J;  4W97 A;  2HYF A;  5GAD J;  1W36 D;  2YUS A;  4MNU A;  4XON A;  5CKT A;  4HZF A;  5H20 A;  1LUJ B;  2PMH A;  1W7P A;  3KYD B;  1E3O C;  1H0M A;  3CLO A;  3ZP5 A;  4BHP A;  1X1B A;  3MWM A;  4EM0 B;  4UB8 C;  1D5Y A;  3JRG A;  1YOV B;  4BDY A;  1DQU A;  1RR7 A;  3QPS A;  3I59 B;  4A2U A;  2FQ3 A;  2DOE A;  3ECO A;  3GTM J;  1H8A C;  5ICC A;  3FZV A;  5HDG A;  4C3H J;  3ZQH A;  3PL8 A;  3KYL A;  4BEH B;  2GIZ A;  1RPW A;  2AHQ A;  4BU2 A;  2A61 A;  3JSP A;  1SAN A;  2KRF A;  1RRJ A;  5F1R A;  4BHC A;  3TW6 A;  3S2D J;  2W48 A;  4NC6 A;  2MH2 A;  1IW7 F;  3PNY A;  4L9V A;  1WJ5 A;  1U78 A;  2R7R A;  2K4J A;  3OIP A;  3QU3 A;  4LB6 B;  4LOC A;  4RGX A;  3WG9 A;  4RB3 C;  3QU6 A;  1G8X A;  2ZSI B;  3NWT A;  1WJF A;  3I71 A;  3F22 A;  1JT0 A;  3R6S A;  2MH9 A;  2LK2 A;  3BG3 A;  2GIV A;  2LF7 A;  2OQG A;  4HF2 A;  1FLI A;  2XAH A;  3HRS A;  3MZH A;  1WZ2 A;  4LB5 A;  1J9I A;  4L9J A;  3ZPL A;  4BXF A;  4B3A A;  3TOB A;  2Q0O A;  3JRA A;  5CYV A;  5EEA A;  2DYR H;  4MGR A;  3RKW A;  3JRI A;  5LFA A;  2WWY A;  3OSF A;  2IS1 A;  1XC5 A;  3I58 A;  3LFU A;  3ZMS A;  2Y2Z A;  2LBF B;  4EJT A;  5GAE J;  5HNF A;  3L1P A;  1ZR4 A;  2Q8K A;  1KGS A;  3TP3 A;  1PP8 F;  5GPC A;  2W1O A;  1XGO A;  3S32 A;  1Z0X A;  3CES A;  2DOD A;  2OAZ A;  3V7R A;  3BG9 A;  2IS4 A;  4B47 A;  3H5R A;  2JUC A;  5BS6 A;  1TWA J;  2B0L A;  1IV8 A;  1FTZ A;  2ZKZ A;  1FIA A;  1ZR2 A;  1MSF C;  2CGP A;  2F4I A;  2DT7 B;  1PVE A;  2DA7 A;  3LSJ A;  2EZK A;  4BDZ A;  3ABK H;  1LNW A;  5DCM A;  2XC7 A;  2LKS A;  3CJR B;  3PUB A;  3E1S A;  3HGY A;  1OCR H;  2F5F A;  2DAO A;  3HRM A;  4JBA A;  3LA3 A;  5HS8 A;  3CCE I;  3HKZ A;  1FMW A;  2KFD A;  4XR6 A;  3DU5 A;  4ZYG A;  1PUF B;  4F93 B;  2E34 A;  2ETH A;  2M87 A;  1S7A A;  3BCB A;  4PJ0 C;  1SD4 A;  5CJ9 A;  4YEL A;  3ZQ7 A;  1VQK I;  2DYS H;  1RR8 C;  3CCR I;  1HW1 A;  4I6Z A;  1TTY A;  3SYT A;  4FCY A;  2LKX A;  3L2W A;  3CCQ I;  3VYU B;  3O8H A;  3KLN A;  4KJZ A;  3ERE D;  1SVM A;  3WTS C;  3VOD A;  3J81 K;  2UXN A;  1P2F A;  3DQV C;  2MLK A;  4CSW A;  2L2O A;  1ZRD A;  4C2T A;  1Y1W J;  1RUN A;  4B1R A;  1QHG A;  2UWM A;  4ZTJ A;  2MC3 A;  1HBX G;  4EEF G;  1D0Z A;  1FOY A;  3M9A A;  2CV1 A;  2QYO A;  3MZ8 A;  2RVC A;  2ZME C;  3OYC A;  4ITV A;  4WXC A;  1I5Z A;  2JRT A;  3CUO A;  2P4W A;  2E1M B;  2O3F A;  1DGW Y;  4QIW N;  1T0F C;  5LRR A;  2WBM A;  1YG2 A;  2BY1 A;  2CUZ A;  2FNP A;  3HTU A;  1EA3 A;  4YIF A;  3OS1 A;  2E5N A;  3FBN B;  4RM3 A;  4Z2Y A;  3TDU C;  2LLK A;  3H3Z A;  3H92 A;  5EJC A;  2HWV A;  2OQR A;  3DLA A;  5HDN A;  1S8N A;  2QM3 A;  4CDG A;  1E17 A;  4KYW A;  5DD8 A;  2BEO A;  2JUG A;  1ZK8 A;  3S2W A;  1YX5 A;  2HQN A;  2XB0 X;  1VQN I;  2ZJP F;  2VQG A;  4MLO A;  2CRG A;  1DU6 A;  2PEX A;  1S6L A;  3T1B A;  1ZGW A;  2O8K A;  3RI4 A;  1SAU A;  2IAI A;  4ENK A;  4PJL A;  1O3S A;  3ZQC A;  3J80 Z;  3E5Q A;  2H1K A;  3G71 I;  1EH8 A;  1TW2 A;  1B1B A;  2L9N A;  3ULQ B;  4EJU A;  2JA2 A;  3LWF A;  5FRN A;  2ISZ A;  1MGT A;  4AC0 A;  4E6K G;  3KLO A;  1LPQ A;  4D5F A;  1A31 A;  4FAS D;  3DXJ F;  4J01 A;  2DDA A;  3ZXS A;  3N4M A;  4RLF A;  4MHG A;  2KIQ A;  5FKK A;  2X1E A;  2VC1 A;  2R7T A;  2TRT A;  4DZJ A;  2ZXH A;  4KNY A;  2BW3 B;  5DCF A;  1D1B A;  2FF4 A;  3JCU C;  3ZQI A;  2VPL A;  2JWT A;  2JA5 J;  1Y8R B;  2LOO A;  1QVU A;  3BTJ A;  2IA1 A;  4Q47 A;  2XGX A;  2ZFW A;  2J5O A;  4V2G A;  1LKX A;  3ESW B;  1AKH A;  3COA C;  5IOY A;  5EDN A;  4PCQ A;  1JJ6 C;  4JX6 A;  1RUO A;  2DXI A;  4AU7 A;  3VFZ A;  3W6K B;  1YHQ I;  3H35 A;  4HLX A;  1TNS A;  1QHH D;  5J8F A;  2HDW A;  1IN8 A;  2HU9 A;  1OCO H;  3KZZ A;  3G1L A;  2QVO A;  2ELJ A;  4BNC A;  3BR5 A;  1BW5 A;  2FRH A;  2Q2E B;  3TMO A;  1UHS A;  3P9C A;  2YS9 A;  2WAF A;  3U2R A;  1VI0 A;  2VE8 A;  4KT6 A;  1ZAR A;  3CUQ C;  1I39 A;  5EGO B;  1QGP A;  2ZC2 A;  4IXA A;  3JRE A;  3HGG A;  1IC8 A;  2K9S A;  4Y4R A;  2L02 A;  4KIF A;  1ERD A;  4G8X A;  1CF7 B;  2A07 F;  4K2E A;  3A4C A;  4U0Y A;  4A3J J;  4M3G A;  5J6X A;  2YX4 A;  5ICF A;  2XV4 S;  5IT9 Z;  4HF0 A;  2FMY A;  2FA5 A;  2K3F A;  3F9K A;  4B09 A;  4A0Z A;  4UUV A;  4D9J A;  3E5X A;  3PUF A;  3WGH A;  3V8L A;  3KZI C;  4RGR A;  5EEG A;  3OOP A;  1Q1V A;  3T8T A;  1A04 A;  2GZW A;  4IHS A;  2QQA A;  4FIS A;  5TIS C;  2M34 A;  1G3W A;  1LFP A;  4QLC U;  1K6Y A;  4JK1 X;  1Z3Y A;  3WGI A;  4ZYE A;  4Y13 A;  2LY9 A;  3ASO H;  4ZYH A;  1HQC A;  3KP5 A;  2WAQ A;  1X1C A;  4LK1 F;  4DBR A;  1HXD A;  5IOZ A;  4XOP A;  2G7U A;  3BG7 A;  5FLX K;  3G1O A;  1R58 A;  2CH0 A;  3MVP A;  1KZH A;  4UUT A;  2XAJ A;  2OJE D;  3CUQ A;  4Q4Z F;  3WHB A;  3LSP A;  4BEH A;  1HW5 A;  2JRM A;  1L3L A;  4C9Y A;  2EZL A;  4CCO A;  4XRS G;  5B66 C;  3GFI A;  5FKO A;  1GVD A;  2Y69 H;  1FYM A;  4CCL A;  3DTI A;  5D4S A;  3PQJ A;  2NVX J;  4RBO A;  1TQP A;  4M74 A;  2A3S A;  3GFL A;  2HKX A;  2RNJ A;  4B8X A;  2YU9 J;  4HA8 A;  4FET A;  1KU9 A;  5E1Z B;  2DOA A;  4CUG A;  5E3O A;  3HDD A;  3PNT A;  1I1G A;  2ZSH B;  3DKY A;  4IX7 A;  4A5M A;  3BR0 A;  4XBF A;  4MEX F;  3VOE A;  3NRV A;  2XKP A;  4HV5 A;  3SJM A;  4DZP A;  1ZGJ A;  1FYK A;  1ETX A;  1P4X A;  4RA2 A;  2WY7 Q;  1KYZ A;  3GTJ J;  3LA2 A;  1SVL A;  4S05 A;  2LMD A;  3OYF A;  3VYT B;  5F0F A;  2L0K A;  5LD2 C;  4XLP F;  2DK8 A;  1W7P B;  2DK5 A;  1PP7 U;  1ON1 A;  2LBF A;  5D8L B;  3HOU J;  4X6A J;  4BE0 A;  1MZB A;  1XMX A;  1B8I B;  2KL4 A;  2BOL A;  4PFP A;  2VON A;  2EIM H;  1GVJ A;  3OL3 A;  3R0A A;  5L3G A;  2P8T A;  2MC4 A;  4N4O B;  5DV5 A;  2IGM A;  2GLO A;  2VPR A;  1MMG A;  2O61 A;  4UVA A;  2D45 A;  5E20 A;  3FK6 A;  3FM3 A;  4P96 A;  4RM2 A;  1YW9 A;  4A69 C;  1OIS A;  1Q1H A;  2VL8 A;  2EWN A;  4JOM A;  3I9V 2;  2LR8 A;  4E4H A;  2CUJ A;  2MA3 A;  3CCS I;  4M6V A;  4XIC A;  3G6E I;  3WTV C;  5EYR A;  2IS6 A;  4XSX F;  2Z1D A;  1X58 A;  3O8G A;  2FNA A;  4WF2 A;  4A0Y A;  9ANT A;  2AXL A;  2EV6 A;  3TED A;  1PDN C;  3D5S C;  1UZC A;  3WTU C;  3G73 A;  1GV2 A;  1K61 A;  2KIM A;  3V7C A;  3I4N J;  2L4M A;  2UV1 A;  2RV8 A;  1MDM A;  2RC4 A;  4YFN F;  3WU2 C;  3RZD J;  5DD4 A;  1MH4 A;  1WJC A;  5FD5 A;  4FE4 A;  4C30 A;  4IEJ A;  2RAE A;  3L9F A;  5F04 A;  2HOE A;  2XGC A;  3JTG A;  3CP8 A;  2VXD A;  2VLA A;  1IN6 A;  5E1W A;  2LSO A;  5F08 A;  3GTK J;  3I0T A;  1J7K A;  2XGE A;  2Y31 A;  3K4J A;  5FO5 A;  5IYB J;  1R49 A;  3CC7 I;  1BJZ A;  2PFB A;  1FY7 A;  5F64 A;  5BPI A;  4HBL A;  3G1M A;  3FIS A;  1EV7 A;  4HQE A;  3DTK A;  3E6B A;  1ITY A;  3A02 A;  3ZN1 A;  2VXZ A;  1J09 A;  2M2E A;  5IT3 A;  1POG A;  4M72 A;  3Q5F A;  3IV5 A;  5D6F A;  2QSH X;  2DA2 A;  2W85 A;  3G3Z A;  1T98 A;  2P0W A;  1KQ0 A;  2EJR A;  4ZYA A;  3O6B B;  4IHW A;  1FTT A;  1IN5 A;  2XPU A;  4HNV A;  3H5N A;  4M9X A;  1JUM A;  4L9T A;  3ABM H;  3TBI A;  1I3Q J;  3OYB A;  1QA6 A;  1HCR A;  5HS9 A;  3JRH A;  5AON A;  1IGN A;  4BBS J;  2FEZ A;  2KZG A;  3R60 A;  3S15 J;  3BOQ A;  1B9M A;  5FKM A;  3CJT B;  4UUS A;  3GX4 X;  2A6H F;  2W7N A;  2HFH A;  2Z99 A;  1XSD A;  3IWF A;  2ZJR F;  2W24 A;  4KMU X;  4A3E J;  4A3K J;  3X2Q H;  4HW0 A;  1BC8 C;  2BW3 A;  4AYB A;  5IP6 A;  3SQN A;  4IL6 C;  1FOW A;  3JW4 A;  1Y6I A;  2DFF A;  2JMW A;  1V5G A;  2H8R A;  3JRB A;  2OC6 A;  2HDC A;  2NVQ J;  4RB0 A;  3LAP A;  3M07 A;  3OV8 A;  2IA2 A;  3S14 J;  1YS7 A;  4RAF A;  2OCC H;  3DCF A;  2F5E A;  3B02 A;  4HST A;  3RJP A;  1ZN2 A;  4BBR J;  1TL8 A;  3FXK A;  3FXM A;  3KX2 A;  2XDV A;  5J1U A;  5J8C A;  3IAM 2;  2DFH A;  1MD0 A;  5JVG F;  2M5W A;  5HLI A;  5HLG A;  1GXQ A;  1P7I A;  3CCV I;  4RGS A;  2W84 A;  3BPV A;  2O03 A;  4DQ2 A;  2VC0 A;  3IAS 2;  2DFE A;  2UUZ A;  4DYC A;  2R7X A;  1FSE A;  3OYL A;  4IHV A;  3MD2 A;  3OS0 A;  4OMZ A;  1R4N B;  2IGK A;  5H2F C;  4U7D A;  1XS9 A;  5ICG A;  1Z67 A;  2LKP A;  4II3 A;  1XD7 A;  4FX4 A;  5EGO A;  3DEU A;  2OF7 A;  3FXQ A;  1FEX A;  3L00 A;  1KU2 A;  1FPQ A;  4C2U A;  4LG3 A;  3K4C A;  2VKV A;  3D0S A;  3ECH A;  1CF7 A;  4ESJ A;  4EGY A;  1OKR A;  3SZG A;  3IHU A;  1EH6 A;  2DW4 A;  3PNV A;  5F6F A;  1U8R A;  1L0O C;  2IW5 A;  2QBY B;  4V2F A;  2ZME B;  1HLV A;  4FX0 A;  5E3M A;  2I10 A;  3CZ6 A;  1R00 A;  1Y8Q B;  2VJJ A;  2DA1 A;  3LL7 A;  2BVM A;  4LGW A;  2DO7 A;  5ILS A;  5K7Z A;  2DMN A;  4IQ4 A;  5HNH A;  1XGM A;  3U21 A;  3PO2 J;  1OYY A;  5K7H A;  2COM A;  2V7F A;  3QAH A;  2NS8 A;  3V8J A;  2F6C A;  2P81 A;  1P4W A;  2EFQ A;  4P9F A;  2K9N A;  5FLM J;  3LSR A;  5F1J A;  1Y0N A;  3H0D A;  3VSL A;  4O3M A;  1U5T C;  4A93 J;  3FK7 A;  2XAG A;  4U0W A;  3ZN0 A;  3HRT A;  1IRZ A;  3SFZ A;  3VEP A;  4YIR X;  3TO6 A;  2NOJ B;  3K4B A;  3MKW B;  4XK4 A;  3G4S I;  3FKI J;  1UEL B;  1K6O A;  4DOZ A;  2X0L A;  5M5W J;  2D1V A;  2FE3 A;  3MZY A;  2KDZ A;  2QSF X;  1Z91 A;  3GME A;  5DYM A;  4Y3O A;  1B9N A;  2VJI A;  1LE8 B;  2NS7 A;  2Y0M A;  2EFO A;  2F4O B;  4R1H A;  3QOP A;  1PJR A;  1XGS A;  2M8E A;  4AYB N;  4E7I A;  4B48 A;  3LQR A;  4BE1 A;  1BN5 A;  5JI6 A;  3HSE A;  4CHU A;  3GEZ A;  2X1D A;  3CC2 I;  2EBI A;  4B3X A;  4ENN A;  2CYY A;  1X3U A;  3HEF A;  4G9Y A;  4XLH A;  1TWG J;  2HYG D;  2PBI A;  2OUM A;  2G7H A;  3FF5 A;  1RIO H;  1IN7 A;  2M4G A;  1KON A;  2HXO A;  4GFB A;  2A68 F;  3E7L A;  2ZJ2 A;  2Y75 A;  1QPI A;  1FT9 A;  2VI6 A;  1FZP B;  5HOO A;  4E7Z A;  1VF9 A;  2DTZ A;  2KRC A;  4II2 A;  5D5X B;  1Z7L A;  2JSP A;  2XUB A;  4FQG A;  1ZKG A;  3TO7 A;  2XSD C;  5DTD A;  1I6H J;  5M5Y J;  1OJL A;  1TNT A;  1RC9 A;  2BYV E;  4HLY A;  5C4J J;  2EFN A;  1DUX C;  3R0J A;  1ZEL A;  2X1C A;  1B8I A;  3TKY A;  3BDD A;  1U8B A;  3EQL F;  1T38 A;  1MMS A;  4Z6Y A;  5E17 F;  1R6R A;  4OIO F;  3E6M A;  2E5Z A;  2BE5 F;  1Y39 A;  3HXL A;  2ZXW H;  3FXR A;  3CUQ B;  3LQQ A;  4XOR A;  3L2C A;  3AL0 C;  4NUB A;  1D0Y A;  4NDL A;  5HLH A;  1QZZ A;  5DDG A;  2VB6 A;  4BGD A;  3GYH X;  2A5W A;  1GXP A;  1G2H A;  4XLA A;  3K1M A;  5L3C A;  5C4X J;  3FXU A;  5KHD A;  2KZV A;  2XRL A;  2YSR A;  3S16 J;  2ESN A;  1D5V A;  2V1X A;  3FMQ A;  3GW2 A;  1JXS A;  2BY3 A;  4HYE A;  2W00 A;  3WTY C;  1A35 A;  1A5J A;  1FNN A;  2JA7 J;  3SFI A;  4GYG A;  4MTD A;  3Q0W A;  4TV7 A;  3WTT C;  2CQN A;  2BXY A;  1JKR C;  1B72 B;  2JSC A;  2QEN A;  1GLN A;  1JJ8 C;  1GT0 C;  1HA8 A;  4XKB A;  3IP4 B;  2I5U A;  1X1D A;  2JT1 A;  3RYP A;  2LYC A;  2A5Y B;  2ZXI A;  3CLQ A;  2VT2 A;  5F0H A;  4UY8 I;  2XF6 A;  4DNC A;  1ZGA A;  2R4G A;  3OR1 C;  1LDJ A;  2P5V A;  5J4V A;  2DMU A;  1X4P A;  4BAY A;  4XMY A;  1KU7 A;  5DM7 F;  2O7O A;  2R7Z J;  1R5I D;  3L2Q A;  4Y7N J;  3BTL A;  4YG2 F;  4E7J A;  1DGR M;  3GZN B;  4XRS A;  3HZJ A;  3MMY B;  3NWS A;  4BAC A;  4XID A;  3W2V A;  4HSR A;  4ZYD A;  3FXO A;  1UCR A;  3J7A Y;  1NTC A;  2L4A A;  2L7M P;  2HPI A;  4XKV A;  2GA1 A;  2JZY A;  4KN4 X;  5E1X A;  2AQF A;  3NAR A;  2D5V A;  4AIK A;  1U0J A;  1SAX A;  2YU3 A;  5A2Q K;  3ROU A;  2XHK A;  3RPU D;  3KPH A;  1WI9 A;  2YR2 A;  3QOD A;  3U9G A;  1RZ4 A;  3FBI B;  3W6J B;  4F52 A;  2HPM A;  1D8K A;  3CDI A;  5EG0 B;  3R4K A;  3GTO J;  2ACJ A;  3HUG A;  4ENM A;  1S72 I;  1NK3 P;  4ETS A;  2WAD A;  5DM6 F;  3CCL I;  3KET A;  2CW7 A;  5CVJ A;  2V9K A;  3CF5 F;  5FKN A;  4OAZ A;  2JQ7 A;  3GTG J;  1MBJ A;  5M3M J;  3F21 A;  4D7M A;  1HDD C;  1JUP A;  2VOD A;  2HOA A;  2K4B A;  3J7Z I;  4CZC A;  4Y33 A;  4GXO A;  5KAI C;  1T2K A;  1MDM B;  1T6S A;  2P6T A;  2IJL A;  1ZYR F;  4CH7 A;  2BBY A;  2PMU A;  3A0B C;  4C3J J;  3T5X A;  4A0X A;  1SFU A;  1EJ9 A;  3WG7 H;  2ZXJ A;  2DCE A;  4OAY A;  2LH9 A;  3F8N A;  2RQP A;  2ZJQ F;  2NAZ A;  1MBF A;  3OMY A;  4PUS A;  5J1R A;  3RKQ A;  3VYS B;  4E7H A;  2LY2 A;  4IZZ A;  4L9N A;  1YYV A;  2EIK H;  4BQA A;  3CF2 A;  1P4A A;  1USS A;  2NS0 A;  5TRD A;  2E1C A;  3IC7 A;  2X6X A;  3CTA A;  2XPV A;  1JI8 A;  3IRQ A;  1R9T J;  1Z3X A;  2H27 A;  3KYC B;  3F0C A;  1J5Y A;  1XCB A;  5TJJ A;  2BVL A;  4MQ9 F;  1S9H A;  1S3J A;  5FKL A;  4ZH4 F;  3LAJ A;  4RS8 A;  4HG2 A;  2DMP A;  1ZH5 A;  4KIC A;  4MQV A;  4IOC F;  1APL C;  2IT0 A;  1IDZ A;  2MSY A;  2IP2 A;  1SEU A;  2CQK A;  4BJ6 C;  1SMY F;  3GZ5 A;  3K4M A;  1G6N A;  5GTH C;  4LD5 A;  3M8E A;  3GXO A;  3ZR8 X;  5IP7 J;  4CO8 A;  3WOD F;  4F3Q A;  4IOA F;  2HVQ A;  2JTV A;  4IRH A;  3JRD A;  2LRD A;  4CCM A;  4GRI A;  2K85 A;  4QTR A;  4BH9 A;  2A6E F;  3FHZ A;  1YQA A;  2RQQ A;  2X6O A;  5E3N A;  2QBY A;  1JTX A;  1ZTR A;  1IRX A;  2ZME A;  4IHX A;  3AG1 H;  4OOI A;  4UUS B;  2XF7 A;  1MJA A;  5JLW A;  4OWR B;  4EAT A;  2E2H J;  5B5E C;  4AVZ A;  1T0F A;  1N25 A;  1Z6R A;  1C0W A;  3GTP J;  5BQT A;  4A3L J;  2CJJ A;  3HG9 A;  2EZI A;  3WU1 B;  4UV8 A;  4N0B A;  2R5Z A;  2WA0 A;  4IQJ A;  2F4M B;  1UB9 A;  2L7F P;  3BZC A;  1IJW C;  4A5N A;  2WB1 A;  4KIT B;  1VFC A;  4M71 A;  3M3Y J;  5GAG J;  3J7A O;  1ON2 A;  1QZE A;  4PGH A;  4XKC A;  2V9V A;  2PJR B;  4XN0 A;  2IBD A;  1IRF A;  3KP6 A;  3OYJ A;  2CO5 A;  1R1U A;  1OYI A;  2V1U A;  3ABT A;  3BT9 A;  2K02 A;  2XAU A;  3GUD A;  3RQ4 A;  4U7B A;  2MYS A;  3N05 A;  1YIO A;  2CQ7 A;  4UXN A;  2Z9O A;  2H09 A;  1SC7 A;  4JX5 A;  3F8C A;  3U1D A;  3QYE A;  2HVS A;  2R92 J;  2ECB A;  1LE8 A;  2L54 A;  3Q3S A;  1MBH A;  3IL2 A;  3CCU I;  4ON0 A;  3RPU A;  3JR9 A;  4LG0 B;  3L2R A;  4HPQ A;  3GFJ A;  4M3D A;  1JTY A;  1ETK A;  1J2X A;  4AUX A;  5LGU A;  2KP6 A;  4BY7 J;  1MNE A;  2VQH A;  2HDD A;  1NG7 A;  4ANJ A;  2KHM A;  1X2N A;  1MBG A;  3DBL B;  2EIJ H;  3FIW A;  1ORK A;  3DWL E;  2O9L A;  6PAX A;  3LFK A;  2A05 A;  3CCY A;  2QCO A;  1XG1 A;  4QWQ A;  2KKO A;  1TQI A;  3BZ6 A;  4LK0 F;  2ELK A;  2DOF A;  4MFE A;  4D5C A;  3H9J A;  1HDP A;  1WJD A;  2FOW A;  2ZNY A;  2E7W A;  2WC2 A;  1ZLK A;  4BJ5 C;  2OCE A;  3QWL A;  4S04 A;  2DTR A;  2FBK A;  5CVV A;  1GUU A;  1ZRF A;  2QA4 I;  3E6D A;  4EM2 A;  2D2W A;  1N75 A;  3GWZ A;  3FX3 A;  3QPL A;  3S3N A;  4F55 A;  1OCP A;  2LF8 A;  3SEZ A;  4YEJ A;  3DEE A;  1YIT I;  5BNG A;  4F91 B;  3S3O A;  1WHU A;  4OMY A;  3LSI A;  3FWE A;  5K5R A;  1TW3 A;  5KAF C;  2KT0 A;  2L01 A;  2EIL H;  1A6Q A;  3F6O A;  3LSG A;  3OY9 A;  3J80 K;  4KDP A;  4A6E A;  3CJQ B;  1IN4 A;  3VYR B;  1WGX A;  4IJA A;  2R7D A;  4PFO A;  2R7Q A;  4M9Z A;  4MIM A;  1Y56 A;  4NC8 A;  5HOD A;  5IYC J;  1MBE A;  2HVR A;  2WB1 N;  1K83 J;  1T33 A;  2VAS A;  1U3E M;  3M7G A;  1B72 A;  2NXN B;  3I56 I;  4E7K A;  2R5Y A;  4EJW A;  2E19 A;  3PSF A;  1K7A A;  3ONQ A;  1MIJ A;  5LHI A;  2ID6 A;  2ESH A;  2W25 A;  1BM9 A;  2CFX A;  1MJ9 A;  3ZQG A;  2Z5U A;  1MSE C;  2MFZ A;  1U5T B;  3K4K A;  1N78 A;  2O0Y A;  2ID3 A;  2HZT A;  3S1R J;  4X0G A;  2QKM B;  3CME I;  1UG2 A;  1YI2 I;  3KEO A;  4I98 B;  4ZJZ A;  1SFK A;  5E18 F;  4H4K C;  2LC2 A;  2DQR A;  3ABL H;  1TT0 A;  2KJC A;  2K9M A;  4X1E A;  2BHY A;  4HAM A;  3OYI A;  2E60 A;  2H6B A;  2QSG X;  5E79 C;  2PLY A;  2W57 A;  2IGN A;  2Y0S A;  4XOT A;  1YE9 A;  4I0A A;  3VB2 A;  3F8F A;  4DGW B;  1F5T A;  3SZP A;  3U1K A;  3KP3 A;  5EG0 A;  2NVT J;  2QLZ A;  5EF6 A;  2EV5 A;  2P7V B;  2W4S A;  2XAF A;  2VJ5 A;  4YRV A;  1NG6 A;  5LEJ A;  4B4C A;  1VQM I;  3KCC A;  5DEQ A;  4HDV A;  2UZK A;  1V3F A;  5IT9 K;  2ISY A;  2YX7 A;  5L3D A;  1YS6 A;  4GO1 A;  2ICW G;  1ETO A;  2TCT A;  1VQ6 I;  5FFZ A;  2AO9 A;  1AWC A;  2JA8 J;  2KDO A;  2H94 A;  3FHN A;  4J00 A;  3EDP A;  3I4M J;  5L3F A;  3N97 A;  1YW8 A;  1WJB A;  3H0G J;  2STW A;  2L7Z A;  4YFX F;  3AG2 H;  1O3Q A;  1ZRE A;  2VE9 A;  2R7V A;  4KN7 X;  4ABZ A;  2AQE A;  2VBZ A;  1ZAO A;  4YFK F;  3PSI A;  1HOM A;  5J3L A;  2KIS A;  4S0H B;  3HL2 A;  5H6Q A;  5J1Y A;  2EZH A;  4G6T B;  1YLF A;  1SFE A;  3LOC A;  3DBH B;  2K7L A;  4EJV A;  3ZMD A;  3SDG A;  3WTX C;  4ZDL A;  3AL0 B;  2DA6 A;  1Z77 A;  3KP2 A;  4JP0 A;  1D8J A;  3HC7 A;  1ONV A;  4V19 K;  3CD6 I;  5GPA A;  3OYA A;  4L5I A;  2QUF A;  3CQZ J;  1WH7 A;  3QYF A;  1YTY A;  4C2M J;  3DEW A;  3RTR A;  2OZU A;  3HJE A;  2JA6 J;  2LDU A;  2XAQ A;  3P9I A;  4H0E A;  3ZOB A;  3HHH A;  2K9Q A;  2OV7 A;  1H88 C;  3O2P E;  4R8H A;  3CO6 C;  2OBP A;  1FP2 A;  2V4J C;  3WHC A;  1SMT A;  5M3F J;  5FGM A;  4L18 B;  2GWR A;  3HUG B;  3PFY A;  3OS2 A;  2CV2 A;  1R1V A;  4N4N B;  4BYY A;  4RLQ A;  1FOK A;  5LEK A;  4J19 A;  2OA4 A;  2K5C A;  2KJB A;  1ETV A;  5B1B H;  1OFC X;  4P55 A;  2WTE A;  3TQN A;  4MEY F;  3RKY A;  5KVR A;  1LQ1 A;  1MKM A;  3DFG A;  2JK3 A;  3KEQ A;  5K5O A;  2I8D A;  2ZBK A;  2K9L A;  1ZHF A;  3BLY A;  3A1Y A;  3HYI A;  3Q0U A;  2BXZ A;  4G7H F;  3K2Z A;  1V55 H;  2EQR A;  2BY0 A;  1GHC A;  3FMR A;  5JVT A;  4BJT A;  3IH4 A;  3EUH C;  1LEB A;  2EH3 A;  4UB6 C;  5BPD A;  4EV0 A;  2DMQ A;  1FWZ A;  2Y0S N;  5HDK A;  1HC8 A;  2HR3 A;  4EJO A;  4WXD A;  5KK1 A;  2PJR A;  1I3A A;  2VKH A;  2HQR A;  1R1T A;  2EFP A;  1IRG A;  5J40 A;  3K6G A;  3ZMZ A;  2R7S A;  1JUS A;  3A0H C;  4DYR A;  1BL0 A;  3ISP A;  3UNG C;  1F43 A;  3GO5 A;  2QZ8 A;  3OWT A;  4HX7 A;  4IKF A;  2P5K A;  2ZB9 A;  4WK8 F;  2K40 A;  5K1Y A;  3PIP F;  2Q1Z B;  5ICE A;  4PDK A;  5ILV A;  4NBQ A;  3FMS A;  5D5U B;  1JKO C;  4LG0 A;  1ZG3 A;  4JX4 A;  5EEH A;  2Y9Z A;  3W2A A;  3SHF A;  4BXX J;  3MKL A;  3HPG A;  1RKT A;  1J59 A;  3LNQ A;  3FKJ A;  3H36 A;  5F27 A;  2IRF G;  2E36 A;  5FFX A;  1UAA A;  2XAS A;  1B4A A;  3DKW A;  1BW6 A;  1R23 A;  4PJM A;  2HYJ A;  2X9D A;  1JHF A;  3AAF A;  1XTA A;  4L5E A;  4A3F J;  4I76 A;  2CW8 A;  3EUH A;  2MBF A;  4CYC A;  2LP0 A;  2VQL A;  2V1N A;  4N9H A;  1IXR C;  2XVC A;  3IH3 A;  1ETY A;  2DA4 A;  2EB7 A;  5KCM A;  4ZDP A;  4E7L A;  2NOG A;  1JT6 A;  1FIP A;  2R5Z B;  2B9S A;  3F8M A;  5ED4 A;  3CP2 A;  3GLL A;  1VQ5 I;  2F5D A;  1V4R A;  3S3M A;  2GM4 A;  1IF1 A; 
#chains in the Genus database with same CATH homology
 4WXH A;  3E6C C;  3TOA A;  3HRU A;  4OIQ F;  1IAW A;  1STZ A;  1LDD A;  1WQ2 A;  3WTW C;  2PJP A;  3DP7 A;  1SD6 A;  3MQ0 A;  3REO A;  4M6X A;  3CJN A;  5AIP A;  1B6A A;  3I54 A;  1DPU A;  3D5L A;  3QRF F;  3GF2 A;  2JPB A;  1RI7 A;  3GZ6 A;  4IRG A;  2PI0 A;  1FX7 A;  3WE3 A;  2VOP A;  1K79 A;  4FT8 A;  5JFR A;  1TQM A;  1DDN A;  3ML6 A;  3DF8 A;  5HS7 A;  4M6Y A;  3BWG A;  4KUM A;  2QQB A;  2GXB A;  4RAZ A;  1I27 A;  1SFX A;  1HSJ A;  3KE2 A;  1NHA A;  2FU4 A;  2ZCW A;  1O7F A;  1OPC A;  5K5Q A;  4I02 A;  4KT5 C;  4ESF A;  1F4K A;  1J0R A;  1U5T A;  3P9K A;  3V4G A;  2ZO4 A;  4HX4 A;  2NNY A;  1UFM A;  3J81 Z;  3EYI A;  4CGZ A;  4WX9 A;  1F1Z A;  2DLL A;  3HSF A;  3F8B A;  4I0B A;  2BV6 A;  1Z7U A;  2STT A;  3SZT A;  2CW0 F;  1KQ8 A;  2EV0 A;  4ENJ A;  3FM5 A;  4BHB A;  3C1D A;  4UVC A;  3BJ6 A;  3WU0 A;  2F2E A;  2M45 A;  3E97 A;  4HF1 A;  3MEX A;  1H9T A;  3C3W A;  2WV0 A;  4IVN A;  3SXY A;  1ODD A;  2GQQ A;  1FBQ A;  1G3T A;  1HW2 A;  2XRN A;  4G6D A;  4BXU A;  4I01 A;  3IRR A;  4KIB A;  1YO5 C;  3BPX A;  4O6J A;  1ZG1 A;  3F23 A;  3TO9 A;  4OU0 A;  4N9I A;  2V1D A;  1XGN A;  4CIC A;  2O8X A;  3MCZ A;  5D8K B;  2VBY A;  2PG4 A;  3JTH A;  1WRJ A;  4KA4 A;  2UXX A;  1I6X A;  5AIQ A;  2KIU A;  2X4H A;  4OIN F;  5DUK A;  2FXA A;  1F9N A;  2NYX A;  2GA2 A;  4ZZL A;  4AIJ A;  4U0V A;  3GVA A;  1LVA A;  3K1N A;  2IA0 A;  3BP8 A;  4RGU A;  3KFW X;  3WGG A;  1ZLJ A;  1LJ9 A;  4HOB A;  3I4P A;  1K78 B;  5LGN A;  1ZG5 A;  1XSX A;  1BIA A;  1G3S A;  2OZ6 A;  1SD7 A;  4G94 A;  3RYR A;  1AOY A;  5E8G A;  3Q9S A;  1FBU A;  2PQ8 A;  5FB2 A;  2RDP A;  1O3R A;  1XDU A;  3WE2 A;  4G7O F;  1BI0 A;  2VBW A;  2M1B A;  5JR3 A;  2RN7 A;  1KYW A;  1JGS A;  1BJA A;  1PUE E;  1VTN C;  4RB1 A;  3M1E A;  3T8R A;  1Z05 A;  1IUY A;  3F6V A;  2JPC A;  4UHT A;  2D1H A;  3K9T A;  5L3B A;  3BJO A;  3I5U A;  1RNL A;  1YFH A;  4EQQ A;  5FLX Z;  4NHJ A;  4G7Z F;  3QPH A;  1D3Y A;  5D6E A;  1FBS A;  2V6C A;  2P5L C;  2E7X A;  2NNN A;  1LDK B;  4G6Q A;  2QWW A;  3TDZ C;  4EVI A;  3RDI A;  1WWX A;  1W4M A;  1XCV A;  3QPT A;  1O7L A;  3HIF A;  3DPT A;  4HQM A;  3EET A;  3B73 A;  1BI3 A;  1U6G A;  1TLH B;  3C18 A;  2CSO A;  4IRI A;  1BI2 A;  4ESB A;  4M9S A;  1FSH A;  1OMI A;  1BC7 C;  1HKQ A;  4LFU A;  2EA4 A;  3ABU A;  2HEO A;  3MAJ A;  1OR7 A;  4OIR F;  1IXC A;  3NEU A;  3L7W A;  1LB2 A;  1IXS B;  2EA2 A;  1B59 A;  1XSV A;  1ZRC A;  1BBY A;  3E3V A;  4FHT A;  1DP7 P;  2LNB A;  1EH7 A;  4EM1 A;  4AWX B;  3K69 A;  4O5V A;  2RGV A;  2RKH A;  4NQW A;  2H6C A;  3JAM Z;  5LHG A;  5D4R A;  3M8F A;  4I09 A;  3RKX A;  4D0P A;  5HVQ C;  1Y0U A;  5D5V B;  3MFK A;  2HTS A;  3JSO A;  1G4D A;  2XRO A;  2C6Y A;  3R61 A;  4Q48 A;  5E8I A;  1DPR A;  4LLN A;  5FD6 A;  4OIP F;  1R22 A;  1UHM A;  4R79 A;  2HTJ A;  3LST A;  4CYD A;  3I59 A;  4GGG A;  4GYI A;  3ZMV A;  2DPD A;  3WTZ A;  4HDU A;  4GCV A;  4WWC A;  5H6R A;  1BI1 A;  2OD5 A;  4LLG F;  3CO7 C;  1BOA A;  2E1N A;  3DV8 A;  1P6R A;  4A6D A;  1YW7 A;  3GLX A;  3PQK A;  5CVI A;  4CZZ A;  1FP1 D;  2FSW A;  4PGG A;  3T0Y A;  4UNO A;  5BOX A;  4RAY A;  2EK5 A;  1MJB A;  2J5P A;  4AD9 A;  1E2X A;  4CXF A;  1IZ1 A;  3KP7 A;  2AS5 F;  2Z33 A;  2M30 A;  1ULY A;  2HGC A;  3HTS B;  5LRS A;  1SD5 A;  1R5G A;  4EGZ A;  3V7S A;  2P6S A;  3BJA A;  4HX8 A;  5CLS A;  1XMK A;  3GFM A;  1XB4 A;  1QQI A;  1QO0 D;  4PZJ A;  4A12 A;  1O3T A;  4M73 A;  2OU2 A;  1H9G A;  4MTE A;  2TDX A;  1K78 A;  2CG4 A;  4XLN F;  2VOO A;  3RPQ A;  5LHH A;  4L0Y B;  3JAM K;  2VN2 A;  4L5J A;  2FOK A;  3K1P A;  5ILU A;  3LA7 A;  4KMF A;  1Z1D A;  1QZY A;  2P7C B;  2Y48 A;  2DU9 A;  4YII A;  1KU3 A;  3BRO A;  1R36 A;  4ZZD A;  2XKO A;  3HOS A;  2FML A;  4Q5S F;  1KA8 A;  1WSU A;  4IF4 A;  1O57 A;  2IVM A;  1HKS A;  3QP5 A;  1HKT A;  1QNT A;  3I64 A;  4KFC A;  1XMA A;  2FBH A;  3CDH A;  4IPA A;  3IWZ A;  3KP4 A;  4LJZ F;  5ERI A;  2DQL A;  4EMS A;  4P9U A;  1JE8 A;  2PN6 A;  1G3Y A;  4RB2 C;  2R3S A;  3HSR A;  4I7H A;  2DI3 A;  3TGN A;  1UST A;  5LLQ A;  4KIG A;  3K0L A;  4HV6 A;  5DCM B;  5CVR A;  5LGT A;  1T39 A;  3I53 A;  1FC3 A;  3E5U A;  5CVU A;  1FYL A;  1R7J A;  4LMY A;  1KQ9 A;  2VT3 A;  3H3U A;  1W5S A;  4F7Z A;  1Z9C A;  4NB5 A;  2KIF A;  1BIB A;  1Z6T A;  2QQ9 A;  3F3X A;  3QP6 A;  2K86 A;  2DT5 A;  4L0Z B;  4ASN A;  3O3K A;  2R7F A;  3HOT A;  2VBX A;  3C7J A;  5LBQ A;  1XDS A;  1W7P D;  1UHW A;  3IKV A;  2K27 A;  2CWE A;  3IKT A;  2MLG A;  2A69 F;  4Y17 A;  2XIG A;  2Q2E A;  5D5W B;  3KZY A;  2G9W A;  3Q9V A;  5DUI A;  3ZMT A;  5JHU A;  4Y15 A;  1I1S A;  2L3D A;  2YPR A;  4P5O A;  4JQF A;  2DFI A;  2ELH A;  2O6G E;  5BMZ A;  3ZMU A;  3RIR A;  4AIH A;  2GAU A;  5L3E A;  2DPU A;  1OYW A;  2FBI A;  2BGC A;  4U88 A;  1S7O A;  4LLL A;  2EFW A;  4XRF A;  2ADU A;  1QPM A;  4UV9 A;  1S29 A;  3PFI A;  1R5H A;  2DBB A;  1U2W A;  2F5C A;  1XN7 A;  3EYY A;  2Z3Y A;  1TBX A;  4UVB A;  4E70 A;  3ELK A;  4AVP A;  4IHT A;  2HKO A;  1J75 A;  2V79 A;  2HS5 A;  3L09 A;  1REP C;  1WKM A;  3DPL C;  2GXG A;  1LEA A;  2ZNZ A;  2NRA C;  3BY6 A;  3HHG A;  5A2Q Z;  1W5T A;  1P92 A;  4WCG A;  1QBJ A;  2IPQ X;  1CGP A;  1JHH A;  3V8K A;  4I2O A;  3F72 A;  1HST A;  3P7N A;  3NQO A;  2MD5 A;  4XSZ F;  2HYF A;  4MNU A;  4HZF A;  5H20 A;  2PMH A;  1W7P A;  1H0M A;  3CLO A;  3ZP5 A;  4BHP A;  3MWM A;  4EM0 B;  3I59 B;  4A2U A;  2FQ3 A;  3ECO A;  5ICC A;  3FZV A;  5HDG A;  2A61 A;  3JSP A;  2KRF A;  5F1R A;  4BHC A;  2MH2 A;  1IW7 F;  4L9V A;  1U78 A;  2K4J A;  3QU3 A;  4LB6 B;  4RGX A;  3WG9 A;  4RB3 C;  3QU6 A;  3I71 A;  3F22 A;  3R6S A;  2MH9 A;  2GIV A;  2LF7 A;  2OQG A;  4HF2 A;  1FLI A;  2XAH A;  3HRS A;  3MZH A;  4LB5 A;  1J9I A;  4L9J A;  3ZPL A;  3TOB A;  2Q0O A;  5CYV A;  4MGR A;  3RKW A;  2WWY A;  3I58 A;  3ZMS A;  4EJT A;  1PP8 F;  2Q8K A;  1KGS A;  1XGO A;  2OAZ A;  3V7R A;  5BS6 A;  2B0L A;  2ZKZ A;  2CGP A;  5DCM A;  1LNW A;  2F5F A;  2DAO A;  3HRM A;  4JBA A;  3LA3 A;  5HS8 A;  4ZYG A;  2M87 A;  2ETH A;  3ZQ7 A;  1S7A A;  1SD4 A;  5CJ9 A;  1HW1 A;  1TTY A;  3ERE D;  3KLN A;  3WTS C;  3VOD A;  3J81 K;  2UXN A;  1P2F A;  3DQV C;  2MLK A;  1ZRD A;  1RUN A;  2UWM A;  2MC3 A;  1HBX G;  3M9A A;  2QYO A;  2RVC A;  4WXC A;  1I5Z A;  2JRT A;  3CUO A;  2P4W A;  2O3F A;  5LRR A;  1YG2 A;  2FNP A;  3HTU A;  4YIF A;  4Z2Y A;  3TDU C;  3H3Z A;  3H92 A;  2HWV A;  2OQR A;  5HDN A;  1S8N A;  2QM3 A;  4CDG A;  1E17 A;  4KYW A;  5DD8 A;  2BEO A;  3S2W A;  2HQN A;  2PEX A;  1S6L A;  3T1B A;  3RI4 A;  4ENK A;  1O3S A;  3J80 Z;  3E5Q A;  1EH8 A;  1TW2 A;  1B1B A;  3ULQ B;  4EJU A;  3LWF A;  2ISZ A;  1MGT A;  3KLO A;  3DXJ F;  3N4M A;  4MHG A;  2VC1 A;  4KNY A;  5DCF A;  2FF4 A;  2IA1 A;  4Q47 A;  2XGX A;  2ZFW A;  2J5O A;  3COA C;  4PCQ A;  1RUO A;  3VFZ A;  3W6K B;  4HLX A;  1TNS A;  5J8F A;  1IN8 A;  3KZZ A;  2QVO A;  4BNC A;  2FRH A;  3P9C A;  3U2R A;  2VE8 A;  1ZAR A;  3CUQ C;  1QGP A;  4IXA A;  2L02 A;  4KIF A;  4G8X A;  1CF7 B;  2A07 F;  4K2E A;  4U0Y A;  5J6X A;  2YX4 A;  5ICF A;  2XV4 S;  5IT9 Z;  4HF0 A;  2FMY A;  2FA5 A;  4B09 A;  4A0Z A;  4UUV A;  3E5X A;  3WGH A;  3V8L A;  4RGR A;  5EEG A;  3OOP A;  3T8T A;  1A04 A;  2GZW A;  4IHS A;  2QQA A;  1G3W A;  4QLC U;  3WGI A;  4JK1 X;  4ZYE A;  4Y13 A;  4ZYH A;  1HQC A;  3KP5 A;  4LK1 F;  1HXD A;  2G7U A;  5FLX K;  1R58 A;  2XAJ A;  3CUQ A;  4Q4Z F;  1HW5 A;  1L3L A;  3GFI A;  1FYM A;  5D4S A;  3PQJ A;  1TQP A;  4M74 A;  2A3S A;  3GFL A;  2HKX A;  2RNJ A;  4B8X A;  4HA8 A;  5E1Z B;  1KU9 A;  1I1G A;  4A5M A;  4XBF A;  4MEX F;  3VOE A;  3NRV A;  2XKP A;  4HV5 A;  1ZGJ A;  1FYK A;  1P4X A;  1KYZ A;  3LA2 A;  4S05 A;  4XLP F;  2DK8 A;  1W7P B;  2DK5 A;  1PP7 U;  1ON1 A;  5D8L B;  1MZB A;  2VON A;  1GVJ A;  3R0A A;  5L3G A;  2P8T A;  5DV5 A;  2O61 A;  4UVA A;  2D45 A;  5E20 A;  3FM3 A;  4P96 A;  1YW9 A;  1Q1H A;  2EWN A;  2MA3 A;  3WTV C;  4XSX F;  2FNA A;  4WF2 A;  4A0Y A;  2AXL A;  2EV6 A;  1PDN C;  3WTU C;  3G73 A;  2KIM A;  3V7C A;  2L4M A;  2RV8 A;  1MDM A;  2RC4 A;  4YFN F;  5DD4 A;  5FD5 A;  3L9F A;  2HOE A;  3JTG A;  1IN6 A;  5E1W A;  2LSO A;  3I0T A;  1J7K A;  5FO5 A;  2PFB A;  1FY7 A;  5F64 A;  5BPI A;  4HBL A;  1EV7 A;  4HQE A;  3E6B A;  3ZN1 A;  2VXZ A;  5IT3 A;  4M72 A;  3Q5F A;  5D6F A;  2W85 A;  3G3Z A;  1T98 A;  1KQ0 A;  2EJR A;  3O6B B;  1IN5 A;  4M9X A;  4L9T A;  5HS9 A;  5AON A;  2FEZ A;  3R60 A;  3BOQ A;  1B9M A;  3GX4 X;  2A6H F;  2HFH A;  2Z99 A;  1XSD A;  3IWF A;  2W24 A;  4KMU X;  4HW0 A;  1BC8 C;  3SQN A;  3JW4 A;  2HDC A;  4RB0 A;  3LAP A;  3OV8 A;  2IA2 A;  1YS7 A;  2F5E A;  3B02 A;  3RJP A;  1ZN2 A;  5J8C A;  1MD0 A;  2M5W A;  5HLI A;  5HLG A;  1GXQ A;  4RGS A;  2W84 A;  3BPV A;  2O03 A;  4DQ2 A;  2VC0 A;  1FSE A;  4OMZ A;  4U7D A;  5ICG A;  2LKP A;  1XD7 A;  4FX4 A;  3DEU A;  3FXQ A;  3L00 A;  1KU2 A;  1FPQ A;  3D0S A;  3ECH A;  1CF7 A;  4ESJ A;  4EGY A;  1OKR A;  3IHU A;  1EH6 A;  2DW4 A;  5F6F A;  1U8R A;  1L0O C;  2IW5 A;  2QBY B;  2ZME B;  4FX0 A;  1R00 A;  5ILS A;  4LGW A;  2DO7 A;  1XGM A;  1OYY A;  2COM A;  3QAH A;  3V8J A;  1P4W A;  2EFQ A;  4P9F A;  4O3M A;  1U5T C;  2XAG A;  4U0W A;  3ZN0 A;  3HRT A;  3SFZ A;  3VEP A;  3TO6 A;  1K6O A;  2X0L A;  2D1V A;  2FE3 A;  3MZY A;  1Z91 A;  5DYM A;  1B9N A;  2Y0M A;  2EFO A;  4R1H A;  3QOP A;  1XGS A;  2M8E A;  3LQR A;  1BN5 A;  5JI6 A;  3HSE A;  4CHU A;  3GEZ A;  4ENN A;  2CYY A;  1X3U A;  4G9Y A;  2HYG D;  2PBI A;  2G7H A;  3FF5 A;  1RIO H;  1IN7 A;  2A68 F;  2ZJ2 A;  2Y75 A;  1FT9 A;  1FZP B;  5HOO A;  5D5X B;  2XUB A;  3TO7 A;  1TNT A;  2BYV E;  4HLY A;  2EFN A;  1DUX C;  3R0J A;  3TKY A;  3BDD A;  3EQL F;  1T38 A;  5E17 F;  4OIO F;  3E6M A;  2BE5 F;  3FXR A;  3CUQ B;  3LQQ A;  3L2C A;  5HLH A;  1QZZ A;  5DDG A;  3GYH X;  1GXP A;  3K1M A;  5L3C A;  3FXU A;  2YSR A;  2ESN A;  1D5V A;  2V1X A;  3FMQ A;  3GW2 A;  1JXS A;  4HYE A;  3WTY C;  1FNN A;  4GYG A;  4MTD A;  4TV7 A;  3WTT C;  2JSC A;  2QEN A;  2JT1 A;  3RYP A;  2A5Y B;  2VT2 A;  4DNC A;  1ZGA A;  1LDJ A;  2P5V A;  1KU7 A;  4BAY A;  4YG2 F;  4ZYD A;  1UCR A;  2L4A A;  2GA1 A;  2JZY A;  4KN4 X;  5E1X A;  4AIK A;  1SAX A;  2YU3 A;  5A2Q K;  3ROU A;  2XHK A;  1WI9 A;  2YR2 A;  3U9G A;  1RZ4 A;  3W6J B;  1D8K A;  3R4K A;  2ACJ A;  3HUG A;  4ENM A;  4ETS A;  3KET A;  5CVJ A;  3F21 A;  2VOD A;  2K4B A;  4GXO A;  1T2K A;  1MDM B;  1T6S A;  2P6T A;  2IJL A;  1ZYR F;  2BBY A;  2PMU A;  3T5X A;  4A0X A;  1SFU A;  2ZXJ A;  3F8N A;  2RQP A;  2NAZ A;  4L9N A;  1YYV A;  4BQA A;  1P4A A;  1USS A;  2NS0 A;  5TRD A;  2E1C A;  3IC7 A;  3CTA A;  3IRQ A;  2H27 A;  1J5Y A;  1XCB A;  5TJJ A;  4MQ9 F;  1S3J A;  4ZH4 F;  3LAJ A;  4RS8 A;  1ZH5 A;  4KIC A;  4MQV A;  2IT0 A;  2IP2 A;  2CQK A;  1SMY F;  3GZ5 A;  1G6N A;  4LD5 A;  3M8E A;  3GXO A;  4CO8 A;  3WOD F;  2JTV A;  4IRH A;  4BH9 A;  2A6E F;  3FHZ A;  1YQA A;  2QBY A;  2ZME A;  4OOI A;  1MJA A;  1T0F A;  1Z6R A;  1C0W A;  5BQT A;  3WU1 B;  4UV8 A;  4N0B A;  1UB9 A;  4A5N A;  4M71 A;  3J7A O;  1ON2 A;  4PGH A;  2V9V A;  1IRF A;  3KP6 A;  2CO5 A;  1R1U A;  1OYI A;  2V1U A;  3ABT A;  2K02 A;  3GUD A;  4U7B A;  2Z9O A;  1YIO A;  4UXN A;  2H09 A;  3F8C A;  3U1D A;  2L54 A;  3IL2 A;  4ON0 A;  3RPU A;  4LG0 B;  3GFJ A;  1J2X A;  5LGU A;  6PAX A;  3LFK A;  4QWQ A;  2KKO A;  1TQI A;  3BZ6 A;  4LK0 F;  2ZNY A;  2E7W A;  2WC2 A;  1ZLK A;  4S04 A;  2DTR A;  2FBK A;  5CVV A;  1ZRF A;  3E6D A;  4EM2 A;  2D2W A;  3GWZ A;  3FX3 A;  2LF8 A;  4OMY A;  3FWE A;  5K5R A;  1TW3 A;  2L01 A;  3F6O A;  3J80 K;  4KDP A;  4A6E A;  1IN4 A;  4IJA A;  2R7D A;  4M9Z A;  1U3E M;  3M7G A;  4EJW A;  1K7A A;  5LHI A;  2ESH A;  2W25 A;  1BM9 A;  2CFX A;  1MJ9 A;  2Z5U A;  1U5T B;  2O0Y A;  2HZT A;  3KEO A;  4I98 B;  5E18 F;  2DQR A;  2KJC A;  4HAM A;  2H6B A;  2PLY A;  2W57 A;  4I0A A;  3VB2 A;  3F8F A;  1F5T A;  3SZP A;  3KP3 A;  2QLZ A;  2EV5 A;  2P7V B;  2XAF A;  5LEJ A;  3KCC A;  5DEQ A;  4HDV A;  2UZK A;  1V3F A;  5IT9 K;  2ISY A;  2YX7 A;  5L3D A;  1YS6 A;  4GO1 A;  5FFZ A;  1AWC A;  2H94 A;  3EDP A;  5L3F A;  3N97 A;  1YW8 A;  2STW A;  4YFX F;  1ZRE A;  1O3Q A;  2VE9 A;  4KN7 X;  2VBZ A;  1ZAO A;  4YFK F;  5H6Q A;  1YLF A;  1SFE A;  2K7L A;  4EJV A;  3ZMD A;  3WTX C;  3KP2 A;  1D8J A;  1ONV A;  4L5I A;  2QUF A;  1YTY A;  3RTR A;  2OZU A;  2LDU A;  2XAQ A;  3P9I A;  4H0E A;  3HHH A;  3O2P E;  4R8H A;  3CO6 C;  2OBP A;  1FP2 A;  1SMT A;  4L18 B;  5FGM A;  2GWR A;  1R1V A;  4BYY A;  1FOK A;  5LEK A;  2OA4 A;  2KJB A;  4P55 A;  2WTE A;  3TQN A;  4MEY F;  3RKY A;  5KVR A;  1LQ1 A;  1MKM A;  3DFG A;  3KEQ A;  5K5O A;  2ZBK A;  1ZHF A;  3HYI A;  4G7H F;  3K2Z A;  1GHC A;  3FMR A;  5JVT A;  1LEB A;  5BPD A;  4EV0 A;  1FWZ A;  5HDK A;  2HR3 A;  4EJO A;  4WXD A;  5KK1 A;  2HQR A;  1R1T A;  2EFP A;  1IRG A;  3ZMZ A;  3ISP A;  3GO5 A;  2QZ8 A;  4HX7 A;  2P5K A;  4WK8 F;  5K1Y A;  5ICE A;  4PDK A;  5ILV A;  3FMS A;  5D5U B;  4LG0 A;  1ZG3 A;  5EEH A;  3SHF A;  1J59 A;  2IRF G;  5FFX A;  2XAS A;  1B4A A;  3DKW A;  1R23 A;  1JHF A;  3AAF A;  3EUH A;  2MBF A;  4N9H A;  1IXR C;  2XVC A;  2EB7 A;  3F8M A;  5ED4 A;  2F5D A;  1V4R A;  1IF1 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...