1FBSA

Heat shock transcription factor dna binding domain containing the p237a mutation
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
87
structure length
87
Chain Sequence
PAFVNKLWSMVNDKSNEKFIHWSTSGESIVVPNRERFVQEVLAKYFKHSNFASFVRQLNMYGWHKVQDVKSGSMLSNNDSRWEFENE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords HEAT SHOCK FACTOR PROTEIN
publication title Proline in alpha-helical kink is required for folding kinetics but not for kinked structure, function, or stability of heat shock transcription factor.
pubmed rcsb
source organism Kluyveromyces lactis
molecule tags Transcription
total genus 25
structure length 87
sequence length 87
chains with identical sequence B
ec nomenclature
pdb deposition date 2000-07-16
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 1fbsA00
3WTXC 4BHCA 3M1EA 2O61A 3GEZA 3DF8A 1UCRA 4HX7A 5D8KB 1MD0A 2GXGA 2K7LA 2YSRA 1AOYA 1E17A 1OMIA 2L4AA 5HOOA 4UHTA 1OYYA 1XSXA 2R7FA 1SMYF 3R61A 3T8RA 5L3DA 4L0ZB 2IA1A 3GO5A 2B0LA 2UZKA 1TW2A 1HXDA 2Z3YA 4YIFA 5ILVA 5E1ZB 1PUEE 2EFWA 2BEOA 4L5JA 3GUDA 5K5RA 4L9NA 2L3DA 4KN7X 3RPUA 4G6DA 2RN7A 4MQ9F 4F7ZA 5L3CA 2WV0A 2RC4A 1DDNA 4JQFA 1J5YA 2HKXA 2MC3A 2XAGA 1AWCA 1KU2A 2W57A 2ISYA 1XMAA 3DFGA 2D1VA 4ESBA 2G7HA 1TLHB 4LLNA 2BGCA 3DV8A 3CTAA 4QWQA 3ZMZA 3GZ6A 3HHHA 1V4RA 1CF7A 1YIOA 4A12A 1WSUA 3I71A 3QP6A 1UB9A 4A2UA 5AONA 1FP1D 3CUOA 5JHUA 1LDJA 1W4MA 2HZTA 3HRMA 1YW8A 5LHHA 3FXUA 1IN7A 3ELKA 1B59A 1RNLA 3F8MA 5DV5A 4QLCU 3TDZC 1KYWA 2FE3A 3GFLA 4IRIA 1LJ9A 4G7ZF 5CVIA 2CW0F 2MD5A 1JHHA 1XSDA 5KK1A 4HQMA 1QPMA 2IT0A 4EJTA 4EJVA 3IKVA 4M72A 2K4JA 3U2RA 2V1DA 5DUKA 5DUIA 1MJ9A 2L02A 1ZG3A 3BPXA 3FZVA 3FX3A 3T8TA 3VFZA 2E1CA 4R79A 4RAYA 2KKOA 2W84A 5EEHA 4KMFA 4L5IA 2HFHA 1HKSA 4A6EA 1O3RA 4WK8F 1YO5C 4Y17A 1T0FA 1IAWA 4GO1A 1P6RA 4U0YA 3RPQA 3Q9VA 3FMQA 5HLGA 1IXCA 2V79A 2O8XA 5DCMB 5H6RA 2XIGA 2STTA 3JTHA 5ERIA 2XV4S 5CVVA 4Y13A 3E6CC 4Q5SF 4OIQF 2CYYA 3JSPA 3FXQA 1T2KA 3FXRA 3U1DA 3HUGA 1EH8A 1WQ2A 2VBXA 5HS9A 1UFMA 3GVAA 3I5UA 3VB2A 3ZQ7A 3SXYA 3J80K 5BPDA 2BE5F 1QZZA 2EB7A 1FSEA 2P6SA 2M30A 2W25A 2ZNYA 4ZYHA 3L7WA 2C6YA 2EWNA 1PP7U 2MH9A 5DEQA 2DLLA 5CJ9A 3KLNA 2M45A 2F2EA 4UVAA 3GW2A 1XCBA 4AIJA 3F6VA 3PQKA 3W6JB 2ZJ2A 2AS5F 2OZ6A 3ROUA 6PAXA 4ZYGA 3ZMUA 2ESNA 3J80Z 1BBYA 2MH2A 3HTSB 2FRHA 4FX4A 4HQEA 4G94A 2V1XA 1LQ1A 1F4KA 4BAYA 2GAUA 4U7BA 4N9HA 2HTJA 3E6MA 4EQQA 1R7JA 4O6JA 2O0YA 1MZBA 2NAZA 5ICFA 3QPHA 1TNSA 3KP3A 3P9IA 3SFZA 2H6CA 5HVQC 2G7UA 2VBZA 1LNWA 3DP7A 1W7PA 4LFUA 2QM3A 5L3EA 1J0RA 3F6OA 4UNOA 2H27A 2R7DA 3N97A 3AAFA 1K7AA 4ZZLA 4G7OF 2JPBA 2Z33A 3VEPA 2OU2A 5HDKA 2QLZA 3VOEA 1FYKA 3KP4A 1R22A 2XAFA 4CO8A 3BDDA 3HSEA 1LEAA 4ESJA 1K79A 4NQWA 1JHFA 3ISPA 4LG0B 5HDGA 4KN4X 3E5XA 3IWFA 4M6XA 2JZYA 1WRJA 2YX4A 3CLOA 3GFIA 4R1HA 5AIPA 2Q8KA 1XB4A 1DP7P 2JPCA 4AIKA 1IXSB 1B9NA 5LRRA 3DKWA 3RDIA 1T38A 4XSZF 1RUNA 4CZZA 2GXBA 2EK5A 2H09A 1OYIA 3ZMVA 2P5VA 4G9YA 2IPQX 3KETA 4ENKA 1MDMA 4L9VA 2G9WA 2L54A 2VE9A 2EFQA 3M8EA 3H92A 2A61A 1QNTA 5JVTA 1D8JA 3KEQA 3IWZA 1EH6A 3LQQA 2PFBA 5D4RA 4RS8A 1W7PD 4R8HA 5ILSA 3Q9SA 3VODA 2Q2EA 1J2XA 2NS0A 1SFUA 3BY6A 2QBYA 1RUOA 1YQAA 1Z7UA 3BJ6A 5FO5A 5FD6A 2QWWA 1OKRA 4LLGF 3F8NA 2X0LA 1KU9A 2KIFA 1G3SA 4GYGA 2ELHA 3BPVA 3GF2A 2E7XA 4EJOA 3DXJF 4HF2A 1O7LA 1XN7A 2PQ8A 1REPC 5ICEA 3O2PE 4YFKF 4I09A 3I59A 1U78A 2WTEA 4PCQA 1Z1DA 2DFIA 4M74A 1BI1A 1SFEA 1O57A 2CFXA 1LDDA 2RNJA 3K9TA 2DI3A 5D5WB 2A6HF 3FMRA 3MZYA 5JR3A 2PJPA 1DUXC 1ZRFA 2Y75A 1YS6A 2DK5A 1B4AA 5FLXK 2QQ9A 5E20A 2CQKA 2MLKA 1YG2A 2XHKA 2PG4A 3T5XA 1RIOH 1KQ0A 1LDKB 4EJUA 1HKQA 3E5QA 2GQQA 1B9MA 2GA2A 4ZZDA 1YTYA 2AXLA 1SAXA 2K4BA 4ON0A 2EJRA 2DTRA 1I5ZA 3DEUA 4GCVA 3JTGA 2VODA 2IVMA 2FOKA 4WWCA 2LKPA 3GWZA 4MHGA 2GIVA 5H20A 2KIMA 1O3TA 3F23A 3ZPLA 5FLXZ 2BV6A 4U7DA 3RKYA 1SD4A 5DDGA 3HSRA 2K86A 4L18B 1R1VA 1Y0UA 4WCGA 1B6AA 2IJLA 1U2WA 2LDUA 1SD7A 4Q4ZF 2FA5A 2DQRA 4OMYA 2V9VA 4S04A 5D8LB 5BPIA 1TNTA 1ZAOA 3GX4X 2STWA 3WG9A 2DT5A 3KFWX 4BYYA 1KQ9A 1HBXG 1R23A 4E70A 3WTSC 4OMZA 1TQIA 1Z6TA 4BHPA 5J6XA 2P6TA 1C0WA 5JI6A 5E1XA 2IW5A 4M71A 4U0WA 2DK8A 4IJAA 4ENJA 3V8KA 2A3SA 2XROA 2P8TA 3HRUA 4ENMA 4LK1F 4HW0A 5F6FA 3V7SA 3GZ5A 4I2OA 2VN2A 2COMA 4A5MA 4EJWA 2VC0A 2QVOA 2V6CA 2IRFG 4UXNA 4XLNF 1R1TA 3RYPA 2JSCA 4UUVA 1O3QA 3LA2A 2RDPA 2VOPA 4OIRF 1FZPB 4HF1A 5TRDA 1JGSA 1ZGAA 4G8XA 2PN6A 4EM2A 4HV6A 5D6FA 5DD4A 2WWYA 2R3SA 3M8FA 3QU3A 3K1MA 4CDGA 2KIUA 1OPCA 3L00A 5ED4A 1KGSA 1FLIA 1HSJA 4MTEA 3BZ6A 5FFXA 3E6BA 3BWGA 4XLPF 1ON2A 2O3FA 4YIIA 1ZRCA 1ONVA 5F64A 4MNUA 1NHAA 2MA3A 1IN8A 4BH9A 3ERED 3TO7A 1ZREA 2F5CA 3KLOA 4XRFA 2HQNA 3O6BB 4CYDA 4RB1A 5KVRA 5HLIA 4PZJA 5JFRA 1FT9A 3RI4A 4MTDA 1R5GA 4A0XA 3ZMSA 4XBFA 4Q48A 4P9UA 1JXSA 3HTUA 1R36A 4BXUA 2D1HA 2HQRA 2FBIA 3L09A 1OYWA 4M73A 4I0AA 4PGHA 2HYFA 2HKOA 2FF4A 3J81K 3MFKA 1L0OC 4EM1A 4LJZF 2F5DA 2P7VB 2OQRA 4HLYA 5HLHA 3KZYA 4JK1X 3REOA 5AIQA 2M1BA 2DQLA 3GXOA 4UV8A 3CJNA 3TO6A 1IN4A 2KRFA 1SFXA 5HDNA 2P5KA 2K02A 4WXCA 3FF5A 1S8NA 2ZXJA 3CO6C 1BI3A 3J81Z 4WXDA 1ZLKA 1P4XA 1U5TA 4KT5C 3FHZA 2PI0A 1CF7B 1F1ZA 4MGRA 3I4PA 4KICA 3TOAA 3IRRA 4GYIA 3EDPA 5D6EA 2IA0A 1WKMA 1L3LA 1FY7A 4NHJA 4RB0A 3LA7A 1USTA 1IUYA 1WI9A 5E8GA 2RKHA 3SHFA 3H3UA 4M9XA 1J7KA 4YFNF 3MAJA 3IRQA 3KP5A 1LVAA 1IZ1A 1QBJA 1R5HA 1EH7A 1UHWA 4I02A 3GFMA 4S05A 3LAPA 2NYXA 2OAZA 3SQNA 1P4WA 1YW7A 4A5NA 4BQAA 1BIAA 1EV7A 3C1DA 1P4AA 3KP7A 3NEUA 2RQPA 4KIFA 2FBKA 3BJOA 1H0MA 3ZP5A 5HS8A 2HDCA 4UVBA 3I58A 5IT9K 2LF8A 1MKMA 3QP5A 4PGGA 1GVJA 5CYVA 3QPTA 4NB5A 3W6KB 2FXAA 3BOQA 5ICGA 3K1NA 2RV8A 2XASA 2ZNZA 4ZYDA 2FSWA 1LEBA 2DAOA 4UVCA 1ON1A 2BBYA 4IRHA 2VE8A 4GXOA 5K5QA 3LFKA 3CUQA 1BJAA 1TBXA 4HA8A 2O6GE 1HKTA 4IXAA 2XAJA 2RVCA 3KP2A 5FGMA 3LAJA 5E17F 2Z99A 3E5UA 3P9KA 5IT9Z 4RB3C 1YW9A 2A6EF 3FM3A 2QYOA 3QU6A 4RAZA 3F22A 4U0VA 3E6DA 1IRGA 2FMLA 1ZYRF 2UXNA 3CDHA 4DQ2A 2CG4A 4OOIA 3WGIA 2E1NA 1D3YA 1KU7A 2UWMA 2DBBA 3SZPA 1YLFA 2Y0MA 2MLGA 3BP8A 3OV8A 5IT3A 1K78A 2PBIA 3J7AO 4RGXA 2J5PA 1G3TA 4JBAA 2XGXA 1TQMA 3ABTA 2WC2A 2ZMEA 2VONA 2EFNA 1SD6A 4Y15A 1FX7A 1S29A 2ZCWA 1HSTA 3R0AA 3K1PA 4RGRA 1KU3A 2EFPA 1MJAA 4KIBA 3S2WA 4FT8A 3HOSA 4BHBA 3TQNA 2ACJA 2H6BA 2CWEA 3RIRA 3F3XA 4ASNA 2A5YB 2W24A 1W7PB 1IXRC 1ZHFA 3C7JA 5J8FA 5LHGA 3L2CA 1FBUA 2ZO4A 3WE2A 1T39A 3ZMTA 3E3VA 5DYMA 3LWFA 5BOXA 4HOBA 3WTVC 1HW2A 4MQVA 3JAMK 1H9GA 1XDUA 2HS5A 2YX7A 5L3FA 1XMKA 2XAHA 2EV6A 4GGGA 1MJBA 4FHTA 1G3YA 1U6GA 3PQJA 3P7NA 5ICCA 3EYYA 3OOPA 1IF1A 3F21A 1F5TA 5E8IA 4HV5A 1A04A 2A69F 3TGNA 2F5EA 4U88A 2OD5A 3ULQB 1Q1HA 4EGYA 1HQCA 2FNPA 2IA2A 3EQLF 4WXHA 3DPTA 3JAMZ 3ZN1A 2CSOA 3M7GA 3HRSA 1PP8F 3ZN0A 2VOOA 1MGTA 4HZFA 1FOKA 4H0EA 1S7AA 4M6YA 4LD5A 1G6NA 4HBLA 4IVNA 1MDMB 1BC8C 1U5TC 1LB2A 1BOAA 3BROA 3D5LA 1STZA 3G73A 2P4WA 2V1UA 2FEZA 1ZGJA 1H9TA 1ULYA 3TO9A 1IW7F 4CHUA 2FBHA 2ESHA 3CO7C 2L01A 4I0BA 4B8XA 5E1WA 2M8EA 2QBYB 3MCZA 3FWEA 3L9FA 5TJJA 3DQVC 2XRNA 1HW5A 3EETA 5LRSA 4L0YB 4WX9A 2LF7A 4IRGA 1RZ4A 2TDXA 2CGPA 1TQPA 4RGSA 3QRFF 3K0LA 3RKWA 2PMHA 3K2ZA 2OBPA 4TV7A 1QZYA 4A6DA 5F1RA 5LGTA 5CVUA 1JE8A 4P55A 1TTYA 1BI2A 1IN5A 3I0TA 4LB6B 2DPUA 4YFXF 3I59B 3WTYC 1FWZA 1ZARA 4HX8A 4KNYA 2XUBA 3DPLC 4LLLA 1TW3A 1FP2A 3TDUC 2M87A 1OR7A 1YS7A 3E97A 5DCMA 4B09A 1E2XA 3R60A 3V7RA 3KE2A 3V7CA 4KDPA 4I01A 3U9GA 2XAQA 5DD8A 2F5FA 3IC7A 3MWMA 3CUQC 4Q47A 3I53A 2YPRA 4EVIA 1CGPA 1B1BA 2OA4A 1W5SA 3ZMDA 1O7FA 1XD7A 3EUHA 3F72A 3GFJA 3WTZA 1T6SA 5D5UB 1T98A 2HTSA 3O3KA 3RYRA 4KA4A 3QOPA 2GWRA 4D0PA 3IHUA 4EGZA 2EA2A 2VC1A 3RKXA 1QQIA 1UHMA 3NQOA 2Z9OA 1Z91A 1K6OA 1GXPA 1Z6RA 3I54A 4G7HF 2HYGD 4CXFA 2NNNA 4Z2YA 4HX4A 4KMUX 2QZ8A 3FM5A 4PDKA 5E18F 4LB5A 4LMYA 1VTNC 5DCFA 4MEXF 5D4SA 2RGVA 5D5VB 3C18A 2Z5UA 1Z05A 5ILUA 1GXQA 3SZTA 1ZG5A 3WTWC 3GLXA 2ZKZA 4XSXF 2KJBA 5BQTA 5FD5A 1KYZA 1R58A 3QAHA 1GHCA 5LEJA 3LA3A 1FNNA 3HOTA 3WGHA 4O3MA 4OINF 1PDNC 4MEYF 1RI7A 1SMTA 2ZFWA 1ZG1A 1XGSA 2FNAA 2HOEA 4K2EA 4EM0B 2A07F 1WWXA 1YFHA 1W5TA 1IN6A 3RJPA 2LSOA 1J59A 2LNBA 2O03A 3LQRA 2DU9A 1I6XA 1J75A 2JRTA 4I98B 1G4DA 3JW4A 4P9FA 5CVRA 1BC7C 4AVPA 3K69A 3KEOA 3HRTA 2FQ3A 2QUFA 2M5WA 4LG0A 3R4KA 3TKYA 3IKTA 3WODF 4P5OA 1FYMA 2JTVA 2NRAC 4IHSA 1X3UA 3F8BA 1HW1A 3M9AA 1ODDA 4LK0F 2YU3A 2VXZA 4FX0A 2W85A 3KP6A 5LGNA 4HDVA 1FPQA 3D0SA 2DW4A 4A0ZA 2Q0OA 1U8RA 2BYVE 3WE3A 4ZYEA 2EA4A 4HLXA 4EV0A 2E7WA 5L3BA 4KYWA 3KZZA 1S3JA 2QQBA 2QENA 4N0BA 3G3ZA 4I7HA 2PLYA 4O5VA 1S7OA 3N4MA 4RB2C 2DO7A 4M9ZA 2X4HA 4P96A 4KUMA 2ADUA 2NNYA 1BM9A 3WGGA 3WTTC 1FSHA 5K1YA 4AD9A 1D5VA 2L4MA 2JT1A 1V3FA 3R0JA 4EMSA 2IP2A 3R6SA 2VT2A 4N9IA 1ZLJA 1Z9CA 1BN5A 5EEGA 2DPDA 3ABUA 3B73A 5D5XB 3WU0A 2PMUA 3HIFA 4KFCA 3RTRA 3V8JA 5HS7A 5LEKA 2K27A 3F8CA 1XDSA 3C3WA 3H3ZA 1J9IA 4WF2A 3LSTA 3BJAA 1I1SA 3KCCA 2HWVA 1FYLA 5LGUA 3HYIA 1U5TB 1F9NA 4YG2F 1ZN2A 2VBYA 1IRFA 4HAMA 4ZH4F 3MQ0A 5BMZA 3P9CA 2Y48A 1YYVA 4HDUA 2VBWA 2HR3A 4AIHA 4HYEA 4L9JA 1XGOA 3V8LA 2EV5A 1ZRDA 1I27A 4OIPF 1D8KA 5K5OA 5CLSA 4IPAA 3ECOA 4KIGA 3MEXA 5BS6A 3FMSA 2VT3A 3F8FA 3IL2A 1ZH5A 1KQ8A 2FU4A 4HF0A 3T0YA 1KA8A 4ESFA 4BNCA 4CGZA 4IF4A 3JSOA 1P92A 5FB2A 5H6QA 4ETSA 1USSA 2XKOA 2GA1A 4M9SA 1XGMA 4ENNA 4L9TA 3T1BA 3V4GA 5A2QK 2GZWA 2YR2A 2KJCA 2HEOA 3I64A 2XKPA 1R00A 1XCVA 3MZHA 2XVCA 1R1UA 2P7CB 3B02A 4AWXB 3EYIA 2FMYA 1FC3A 3CUQB 4RGUA 2ZBKA 1S6LA 2EV0A 2UXXA 1DPUA 4CICA 2OQGA 4G6QA 5L3GA 2J5OA 1DPRA 2CO5A 1BI0A 3GYHX 1QGPA 5A2QZ 5LLQA 1I1GA 1FBSA 4LGWA 1FBQA 1QO0D 2P5LC 1SD5A 4OIOF 3NRVA 3Q5FA 1P2FA 2OZUA 2QQAA 2ISZA 3TOBA 4A0YA 5LHIA 3HSFA 2ETHA 4UV9A 4OU0A 3COAC 1XSVA 2D45A 1O3SA 2D2WA 5J8CA 2MBFA 2A68F 3ML6A 2H94A 3WTUC 4DNCA 3WU1B 1K78B 2PEXA 1BIBA 3ECHA 2HGCA 2ZMEB 4IHTA 1G3WA 2EFOA 5CVJA 5LBQA 3HHGA 3PFIA 1XGNA 5FFZA 1U3EM
chains in the Genus database with same CATH superfamily
3CD6I 3WTXC 3HG9A 4BHCA 4X6AJ 3M1EA 2Y0SN 3H5RA 2O61A 3GEZA 4UUTA 3DF8A 3FBIB 1UCRA 4HX7A 3S1NJ 5D8KB 3J7ZI 1MD0A 1WHUA 1WJDA 2GXGA 3VSLA 2K7LA 2YSRA 1AOYA 1MBFA 1WCMJ 1E17A 1OMIA 3B6AA 1IRXA 2L4AA 5K7ZA 5HOOA 4UHTA 1OYYA 5GAEJ 1XSXA 3VPRA 2R7FA 1SMYF 4DJAA 3R61A 4MFDA 1X2NA 3T8RA 4XM3A 5L3DA 2M0CA 4L0ZB 2IA1A 3GO5A 2B0LA 2UZKA 1TW2A 3GLLA 1HXDA 3IH2A 1YE9A 4DIQA 2M8GX 2VKDA 2Z3YA 3RQ4A 1K4SA 1WJ5A 4YIFA 5ILVA 1VNDA 1J09A 5E1ZB 1PUEE 2EFWA 4JX6A 1UJ8A 3QPLA 2BEOA 3I4MJ 5JVGF 3UR3C 4L5JA 3GUDA 2WAQN 5K5RA 2ZXIA 2XB5A 4NC7A 2WV1A 4L9NA 2K3PA 2L3DA 4KN7X 3RPUA 1MMNA 1Y1WJ 1N77A 1FJLA 3CCYA 4G6DA 2GIZA 1Y8QB 2K9MA 4IHWA 2X6YA 2RN7A 2QCOA 4B43A 2YUSA 3E0JB 4MQ9F 4F7ZA 1MBGA 4XN0A 2WV0A 2RC4A 5L3CA 1DDNA 4JQFA 1J5YA 1P7IA 2HKXA 2MC3A 2XAGA 1AWCA 3BR3A 1MW7A 3A1YA 1KU2A 2W57A 2ISYA 1XMAA 3W2VA 3DFGA 2LFBA 2D1VA 1ORKA 3OYGA 2EH3A 4F92B 2JK3A 4ESBA 3I56I 2G7HA 4D7MA 1TLHB 2AXTC 5E3LA 4LLNA 2BGCA 3DV8A 1Q1VA 3BR5A 2R7TA 3CTAA 2EPFA 2V4JC 1T95A 4QWQA 3TW7A 1A6QA 3JRHA 4M3EA 4XICA 3ZMZA 3GZ6A 3HHHA 1HLVA 3CCQI 2IS1A 3SDBA 2VQCA 5J1UA 2PMZN 3CDIA 1V4RA 2JUCA 1CF7A 1YIOA 2VKHA 3CP8A 4I99C 4A12A 1WSUA 3I71A 2XF6A 1QU3A 3QP6A 1UB9A 4A2UA 2JA5J 5AONA 1FP1D 2E1OA 2LBFA 3CUOA 5JHUA 1X19A 2XB0X 1LDJA 1W4MA 2HZTA 3DTKA 1GV2A 3HRMA 1YW8A 3FK6A 1MSEC 5LHHA 2HDDA 1JUSA 3FXUA 1IN7A 3NARA 4XKVA 3ELKA 3VYUB 1V54H 3ZQIA 1HOMA 1SANA 3GMEA 3A01A 1B59A 1YRNA 2ZSHB 1RNLA 2CQXA 3A4CA 1HA8A 4IQJA 3G4SI 1UZCA 2MFZA 3F8MA 5DV5A 3TDZC 4QLCU 3QODA 1KYWA 4YIRX 2FE3A 3GFLA 2JVGA 2H1KA 4IRIA 1LJ9A 3GTOJ 4G7ZF 5CVIA 2CW0F 1M1EB 1WJBA 2MD5A 3QYBA 1JHHA 1ZTRA 2EIKH 3LSMA 4DBRA 1XSDA 1JJ6C 3MVPA 1K6YA 2BXYA 4HQMA 1QPMA 5KK1A 2IT0A 4EJTA 4EJVA 4Z6YA 1SAUA 3AG1H 3IKVA 2E1MC 4M72A 2GBYA 2IS6A 3RZDJ 2MYSA 2K4JA 3U2RA 1ZR4A 2V1DA 5FLMJ 2XAUA 5IYDJ 5DUKA 1OJLA 2L7MP 5DUIA 1MJ9A 3AG3H 3RPUD 3BZKA 2L02A 1ZG3A 3BPXA 3MD2A 2CJJA 3FZVA 3FX3A 3T8TA 2ZJRF 5KHDA 1PJRA 3VFZA 2E1CA 5E3OA 4R79A 4RAYA 2KKOA 5FJ8J 2W84A 3NWTA 5EEHA 4JOMA 4KMFA 4L5IA 2HFHA 5DTDA 1HKSA 1ETOA 2CFOA 4A6EA 2IS2A 4B1RA 2LY1A 1O3RA 4WK8F 1YO5C 4Y17A 1R4MB 3HM5A 2KQRA 1RR8C 1T0FA 3UNGC 4ABZA 1RPWA 1IAWA 2QQ8A 2K5CA 1HDPA 4GO1A 1P6RA 4U0YA 4HNUA 3H9GA 3RPQA 3Q9VA 1LFUP 2NOGA 1X2MA 3S1MJ 3FMQA 1ETYA 3G1OA 4AYBN 5HLGA 1IXCA 3PNYA 4ZYAA 3MKLA 2V79A 2O8XA 3C2BA 4UY8I 1X1CA 5DCMB 3CDLA 5H6RA 2XIGA 2STTA 1MBHA 3K4BA 2W4SA 3JTHA 1NH3A 3CCUI 5ERIA 1PUFB 3GZNB 2XV4S 5GAGJ 5CVVA 4Y13A 3E6CC 4Q5SF 3H35A 1I50J 4OIQF 2CYYA 3JSPA 3FXQA 3OY9A 2HI3A 1T2KA 3FXRA 2JQ7A 3U1DA 3HUGA 4EEFG 1EH8A 1WQ2A 2VBXA 5EG0A 5HS9A 1UFMA 3S16J 3GVAA 3I5UA 3VB2A 1X1DA 2DFFA 3ZQ7A 3SXYA 2I5UA 1LKXA 4CCLA 3J80K 2XDVA 5BPDA 2BE5F 2EBIA 4IKFA 1QZZA 2EB7A 1FSEA 2P6SA 2M30A 2W25A 2F6CA 2ZNYA 2H1LA 2BHYA 5J4VA 4ZYHA 1JTYA 3L7WA 4N4NB 5JLWA 2C6YA 2EWNA 1PP7U 2MH9A 5DEQA 1VQ7I 2DLLA 5CJ9A 1AKHB 1CQTA 1LFPA 3EUKL 3KLNA 2M45A 2F2EA 4UVAA 3GW2A 2R7UA 2HOSA 1XCBA 4AIJA 3F6VA 2F5VA 3PQKA 1IC8A 3W6JB 2ZJ2A 3IH3A 2AS5F 2OZ6A 1ENHA 2Y69H 5C4JJ 3D5RC 1O4XA 2LP0A 2DT7B 3ROUA 1POGA 2E36A 1Y6IA 6PAXA 4ZYGA 1YITI 2JA2A 4YELA 3CMMA 3ZMUA 2ESNA 1R5ID 1JKRC 3J80Z 1BBYA 2KZGA 2LVSA 2MH2A 3BCBA 3HTSB 2FRHA 4FX4A 3QOEA 4HQEA 4G94A 2V1XA 2R7QA 3CMEI 1LQ1A 3IH4A 1ETKA 3FXKA 1F4KA 3CLQA 4ZC3A 4BAYA 1UG2A 2GAUA 4N9HA 4U7BA 4XLFA 2HTJA 3E6MA 4BU2A 4EQQA 3CJTB 2CV0A 1R7JA 4C3HJ 4O6JA 1EKEA 2O0YA 3BQYA 2HVRA 1MZBA 2NAZA 3HGYA 5ICFA 3QPHA 2DA3A 1TNSA 3KP3A 4IL6C 3SEZA 1D0XA 4V19K 3GTJJ 3P9IA 3SFZA 2H6CA 5HVQC 2G7UA 2LC2A 2VBZA 2K9SA 3OIQA 1LNWA 2KT0A 3DP7A 1W7PA 2X1CA 4LFUA 2QM3A 4F3QA 3TEDA 5L3EA 4IQ4A 3OSFA 1J0RA 3F6OA 4UNOA 3PO3J 5FKOA 2H27A 2R7DA 4KJZA 3N97A 3AAFA 1K7AA 4ZZLA 4IZZA 4PUSA 2LRDA 4AVZA 4G7OF 2JPBA 2MD0A 2Z33A 3DCFA 3VEPA 2OU2A 5HDKA 2QLZA 3VOEA 1FYKA 4IHXA 3KP4A 1B8IA 3HC7A 1R22A 2XAFA 4CO8A 2WB1A 3BDDA 3HSEA 3KYDB 5IOYA 1LEAA 4ESJA 1AU7A 3IV5A 1GV5A 3FK7A 2OUMA 1VF9A 1IDYA 5DM6F 5IY5H 2EINH 1K79A 3H36A 4NQWA 1JHFA 4CCJA 3ISPA 5LFAA 3CCSI 4LG0B 5HDGA 2NOJB 4KN4X 3E5XA 3IWFA 4M6XA 2JZYA 4BL0B 1WRJA 3A2KA 2YX4A 3CLOA 1FIPA 3BG3A 3GFIA 4IOAF 4G12A 4BJ6C 3RKQA 4R1HA 5AIPA 1X1PA 2Q8KA 2HNHA 1XB4A 3WHBA 2XC7A 2VXDA 1DP7P 1ITYA 2JPCA 3K2AA 4AIKA 4OAZA 2LD5A 3LSKA 1IXSB 1B9NA 5LRRA 3DKWA 1R4NB 5EZGA 2IGMA 2OJED 4HRIA 4XKCA 3RDIA 4XSZF 1T38A 1RUNA 4CZZA 3K10A 5HODA 3JRAA 2GXBA 2EK5A 2LKSA 3OS1A 1I3QJ 2H09A 3OL3A 5HNHA 1MNDA 3GBGA 4D9JA 1OYIA 3ZMVA 2P5VA 4G9YA 2IPQX 1R49A 3KETA 2XPUA 4ENKA 4J01A 1MDMA 4B47A 4L9VA 2W7NA 3GTKJ 5HLTA 2G9WA 2L54A 2CMPA 2VE9A 2EFQA 3EUHC 3M8EA 5B5EC 3H92A 4C30A 2A61A 1QNTA 3TW6A 2MW8A 5GP9A 5JVTA 3L2QA 1D8JA 3KEQA 3OSGA 3IWZA 1W0TA 2CUEA 1EH6A 2LMDA 5K7FA 3LQQA 3SJMA 2PFBA 2LK2A 4HG2A 1GVDA 4DZPA 5D4RA 4RS8A 1W7PD 4FETA 1Y39A 3H5AA 4R8HA 5ILSA 3H0DA 3Q9SA 3VODA 3S14J 4XLHA 2QSHX 2Q2EA 1J2XA 3L2UA 2NS0A 4XOTA 1SFUA 3BY6A 2QBYA 1RUOA 1YQAA 1Z7UA 3VYTB 3BJ6A 5FO5A 5FD6A 3S15J 2LKXA 2QWWA 4M6VA 3K6GA 1OKRA 4LLGF 3F8NA 2X0LA 1HF0A 3HKZN 5GTIC 1KU9A 3CP2A 3ZQQA 2KIFA 1G3SA 4GYGA 2EZLA 2ELHA 3BPVA 1HDDC 3ZCOA 3GF2A 2E7XA 3OIOA 5FLVA 2YS9A 4QTRA 4L5EA 3G1LA 4EJOA 2M0MA 1WVRA 1DQUA 5F0FA 3DXJF 4HF2A 1O7LA 1XN7A 5B66C 4XIDA 2HQAA 4B3XA 2PQ8A 1REPC 3TBIA 5ICEA 2E5NA 4CCKA 2OV7A 3O2PE 4UUSA 2CQNA 2X51A 3LFUA 4YFKF 1IRZA 3S3MA 4DYCA 4I09A 3I59A 1U78A 3KIOA 3LNQA 2WTEA 4PCQA 1Z1DA 2L7KA 2DFIA 4M74A 1BI1A 4XLAA 1SFEA 1E0EA 1B8IB 3CF2A 2V9PA 1O57A 1VQ8I 1HCRA 2CFXA 1LDDA 2RNJA 3K9TA 2DI3A 1E3OC 1RC9A 5D5WB 2F4MB 3ZRGA 2A6HF 1T0FC 2ZFUA 3MKWB 4C2MJ 5KAIC 3FMRA 3MZYA 5JR3A 2BW3B 2PJPA 2KPMA 1DUXC 3WHCA 4OAYA 1ZRFA 2Y75A 1YS6A 4V2FA 3GTQJ 1QHHD 1RETA 2DK5A 1RRJA 1B4AA 5FLXK 2QQ9A 5E20A 2CQKA 4BDYA 2MLKA 1YG2A 1TWGJ 2XHKA 2PG4A 3T5XA 3DLLF 1RIOH 1KQ0A 1LDKB 3HXLA 4EJUA 1HKQA 3KEYA 3E5QA 2GQQA 1B9MA 2OF7A 5C44J 3HOXJ 5H2FC 2GA2A 4ZZDA 2DA7A 2VJ4A 3ZGKA 4RMNA 2L0KA 1YTYA 2AXLA 2XPVA 1SAXA 4XRSG 5E3MA 1JJ8C 2K4BA 3K4CA 2NVTJ 4C2TA 2HYJA 4ON0A 2EJRA 4IX7A 2DTRA 1I5ZA 3DEUA 4GCVA 3JTGA 1ZGWA 2VODA 2IVMA 2IGOA 2HVSA 2FOKA 4WWCA 2E1MB 3A0HC 4BBRJ 4S0HB 2DXIA 2LKPA 1DGWY 3GWZA 4MHGA 1MNMC 5E79C 2GIVA 5H20A 3IAS2 2KIMA 1IGNA 1O3TA 1IUFA 3F23A 3FDYA 3ZPLA 1QZEA 5FLXZ 2BV6A 4U7DA 3RKYA 1SD4A 3Q0UA 4QIWN 5DDGA 3HSRA 3TL4X 3HB9A 2K86A 4L18B 1R1VA 1Z77A 1Y0UA 2BHZA 4ZDPA 4E7ZA 4WCGA 2F4OB 4FCYA 1B6AA 4U87A 5EGOB 4BS9A 2GM4A 2IJLA 2OCEA 1U2WA 2LDUA 1LE8A 3CC7I 1SD7A 4Q4ZF 2FA5A 4LITA 3X2QH 2DQRA 3JREA 2MSYA 4C3JJ 4GFBA 1YHQI 3BQZA 3BTCA 4OMYA 2IEKA 2V9VA 3DBRB 3B6CA 4G6TB 3KPHA 4LIVA 4S04A 5D8LB 5EDNA 5BPIA 1TNTA 1ZAOA 3UKGA 4BXFA 3Q0WA 2L5QA 4XQFA 3K7AJ 2L7FP 1QVTA 3CCLI 3GX4X 2KZVA 2STWA 3WG9A 2DT5A 3KFWX 1NK3P 1RESA 4AC0A 4IEJA 4B48A 4BYYA 1KQ9A 2HZDA 3P5JA 1HBXG 1R23A 1E3PA 2EIJH 3OWTA 4E70A 3WTSC 3JR9A 4OMZA 4A3CJ 2NVYJ 1TQIA 1Z6TA 4BHPA 5J6XA 2P6TA 1C0WA 5JI6A 5E1XA 2IW5A 4M71A 3CCJI 4U0WA 1F36A 2DK8A 4IJAA 4ENJA 1LVKA 3OYKA 3J7AY 3V8KA 3ZR8X 4DYRA 4XR6A 2VJ5A 2YU9J 2A3SA 2XROA 2P8TA 3HRUA 4LK1F 4ENMA 4HW0A 2OTJI 2AQFA 5F6FA 3O8GA 1JKQC 3V7SA 3GZ5A 4I2OA 2VN2A 1X1AA 4CH7A 5J1RA 2XSJC 3CJRB 2COMA 1EA3A 2K9NA 4A5MA 1D0YA 3DEWA 3M8JA 4EJWA 4Y7NJ 1Y56A 2VC0A 1TWAJ 3M1CA 2QVOA 2TCTA 2V6CA 2IRFG 1XC5A 4CCOA 3OS2A 4UXNA 1A31A 3PUBA 1XX5A 1MIJA 1R1TA 3ESWB 4XLNF 3RYPA 1U8BA 4E7JA 4XRMA 3CQZJ 1R6RA 2JSCA 4PFPA 3FXMA 4UUVA 2XF7A 3LA2A 1O3QA 2RDPA 2JA7J 2NXNB 1PVEA 2VOPA 4OIRF 4RBOA 1FZPB 2P0WA 2KDZA 4HF1A 5TRDA 1JGSA 2CU7A 3TP0A 1ZGAA 4G8XA 2PN6A 4EM2A 3PO2J 4HV6A 3SZGA 4CZCA 5D6FA 5DD4A 4M3DA 1DU6A 3OMYA 4KITB 2WWYA 2KISA 3L2WA 2R3SA 3M8FA 3OYLA 1TWCJ 3QU3A 3K1MA 2BY0A 2BVMA 4NC8A 4CDGA 2KIUA 1OPCA 3L00A 5ED4A 5JLXA 1TWFJ 1T8IA 1KGSA 3EPZA 4E7KA 1FLIA 1A35A 1HSJA 3D5SC 2VPRA 3DU5A 4MTEA 3JRGA 3BZ6A 3O8HA 5FFXA 1B72B 4BEHA 4BQNA 3E6BA 3RQIA 2E71A 3BWGA 3VSKA 4XLPF 1ON2A 1WFXA 2O3FA 4YIIA 1ZRCA 2PJRB 4F55A 3W6VA 1ONVA 5F64A 4MNUA 3ZQHA 1OCTC 1NHAA 2MA3A 1IN8A 5C3EJ 2QF7A 4BH9A 3EUAA 2Y9YA 2NVUB 2CQ7A 2IBDA 3TO7A 3ERED 2JA6J 2QKLB 2JRMA 2MG4A 4M3BA 1ZREA 2F5CA 2JN6A 3BG5A 3KLOA 4EATA 4XRFA 3JRDA 1HC8A 2HQNA 3O6BB 4CYDA 4RB1A 1VQOI 4BACA 1SEUA 4FQGA 5KVRA 1Z3XA 5HLIA 1APLC 4PZJA 5C4XJ 5JFRA 1W0UA 1FT9A 1FOWA 3RI4A 4MTDA 1R5GA 1R9TJ 4A0XA 3ZMSA 5KNLA 3ASNH 9ANTA 3HGGA 4CYCA 3HDDA 4XBFA 2XGDA 1OCZH 3DBHB 4Q48A 4P9UA 2KIQA 2V26A 1JXSA 3HTUA 1W36C 1U0JA 1R36A 3OR2C 4BJTA 2HQ5A 4BXUA 4Y52J 2D1HA 2WBMA 2HQRA 2FBIA 5CQEA 2ME6A 3W2AA 1SFKA 3L09A 5EEAA 1OYWA 1D1CA 2ICWG 2O7OA 4BKXA 1EJ9A 4A3JJ 3AG2H 2DDAA 4M73A 4I0AA 1IDZA 2M7AA 4B4CA 3MKYB 4A3FJ 3AFHA 1RKTA 4PGHA 3PIPF 3OYEA 3HPHA 4XRSA 2HYFA 2HKOA 2XGEA 2FF4A 3J81K 4Y4RA 3MFKA 3N05A 1VZ0A 3L2RA 2L7ZA 1S5LC 4PJJA 3L1PA 2HVQA 1DP3A 1L0OC 2BY1A 2GLOA 2H8WA 1ETXA 2Y0SA 4EM1A 4LJZF 2F5DA 3LSIA 1Z67A 2P7VB 2DMUA 2OQRA 4HLYA 2M34A 5HLHA 2CW7A 1YX3A 3KZYA 2QKMB 2JWTA 3BT9A 3BG6A 4JK1X 4RM3A 2JJ7A 3REOA 1A36A 4XK4A 5AIQA 2EZIA 2M1BA 2UUZA 2DQLA 3GXOA 4UV8A 4DOZA 3CJNA 3TO6A 1IN4A 2KRFA 3U1KA 1SFXA 5HDNA 4E7HA 2P5KA 2K02A 2MGQA 4HSTA 4WXCA 3V42A 1WJFA 3OYBA 3FXJA 3FF5A 1AHDP 1VQPI 1S8NA 2IGKA 3ZQFA 2CV1A 2ZXJA 3CO6C 2FD5A 1BI3A 3IUOA 2DA6A 3J81Z 4WXDA 1ZLKA 2LY9A 1P4XA 1U5TA 3I9V2 2WAQA 3JRBA 3MMYB 4KT5C 3FHZA 1FOXA 4AU7A 2PI0A 1CF7B 1F1ZA 2VQHA 4MGRA 4BBSJ 3I4PA 4KICA 1ETVA 3TOAA 5IPAA 2QSFX 3IRRA 2R7WA 2LBFB 4GYIA 4A69C 4BUPA 2E19A 3EDPA 2VL8A 2XSDC 5D6EA 2IA0A 4E4HA 2EILH 1VQ6I 2W00A 1WKMA 4PJ0C 1L3LA 1FY7A 3OIPA 4NHJA 3OOUA 4RB0A 1XTAA 3LA7A 1USTA 1IUYA 3A0BC 1WI9A 5E8GA 2ID3A 2RKHA 3SHFA 3A01B 2LG4A 3H3UA 3M3YJ 4JP0A 1YRNB 2B7EA 4M9XA 1I3AA 1J7KA 4CUGA 4D5FA 4YFNF 3MAJA 3IRQA 3KP5A 1H8AC 1LVAA 2DA1A 1IZ1A 4XKWA 4XLEA 1QBJA 4B44A 3Q0VA 2KL4A 3K4NA 3PSFA 2QEXI 1R5HA 1EH7A 1UHWA 2E34A 4I02A 3GFMA 2DDBA 2V6EA 2PMZA 4S05A 5CKTA 1RKWA 2KP6A 2NYXA 3LAPA 1PYVA 2R7VA 2OAZA 3SQNA 1VQMI 2RQQA 2FOWA 2COBA 1T33A 2EIMH 2M2EA 1P4WA 1YW7A 4A5NA 2LOOA 4BQAA 1VQ5I 1BIAA 3HOZJ 1FTTA 1EV7A 3C1DA 1U9OA 1P4AA 3BC8A 3KP7A 3NEUA 2RQPA 4KISA 4NNJA 4KIFA 2FBKA 1VQNI 4DW6A 2ZXWH 2DOEA 3BJOA 4RAFA 1H0MA 3ZP5A 5HS8A 2VPLA 2HDCA 2A05A 4UVBA 3I58A 5IT9K 4MFEA 4PSXA 2LF8A 3S2HJ 1G8XA 4C3IJ 3A02A 1MKMA 2AQEA 5CQGA 2KDOA 2LREA 3LL7A 3QP5A 1LPQA 4PGGA 1GVJA 1JGGA 5J40A 1X4OA 5CYVA 1X4PA 3QPTA 4NB5A 1TC3C 5F04A 3W6KB 2FXAA 3BOQA 1U9NA 5ICGA 2DJIA 3K1NA 2RV8A 2R0QC 2XASA 3AKZA 1MH4A 2R7XA 2ZNZA 1D1BA 4ZYDA 3BG7A 2FSWA 1LEBA 1SC7A 2DAOA 2EZKA 3K4MA 5EZHA 3ERMA 4UVCA 1ON1A 5FKKA 2BBYA 4IRHA 2VE8A 4GXOA 5K5QA 3LFKA 3CUQA 1BJAA 1MMGA 1A5JA 2DOAA 1TBXA 1V55H 4HA8A 2O6GE 2WAFA 2FJ1A 1HKTA 1MBJA 1JT6A 4IXAA 2JMWA 2XAJA 2RVCA 1S9HA 4XKBA 2B63J 2WY7Q 3KP2A 5FGMA 3LAJA 3G6EI 5E17F 5IOZA 2Z99A 4KT6A 2OCCH 3E5UA 4XNFA 2CS3A 2V1NA 2VI6A 1D1AA 2VJJA 4AM3A 3P9KA 2DT6A 3LSGA 5IT9Z 5B3SH 2TRTA 3HUGB 3FXOA 2HPIA 4RB3C 2CRGA 1ETWA 1YW9A 5EG0B 2A6EF 2RNGA 1WH7A 3FM3A 2QYOA 4BDZA 1TT5B 3QU6A 4RAZA 3F22A 4U0VA 2CUFA 3E6DA 1IRGA 2ZJQF 2FMLA 5M5WJ 1ZYRF 2UXNA 4AYBA 2X85A 3RSNA 3MKZA 2VQLA 3CDHA 4DQ2A 4XMYA 2CG4A 3ABKH 3BTJA 3DKYA 3OL4A 4OOIA 3OYNA 3WGIA 2LYCA 4HNVA 2DYSH 4II2A 1FEXA 2R5YA 3WG7H 2E1NA 2O8KA 1SVMA 2DMQA 3QYEA 2VLAA 5KCMA 1D3YA 1KU7A 2UWMA 2DBBA 2AHQA 3ZXSA 3SZPA 3HL2A 3H9JA 5IYBJ 1YLFA 2Y0MA 2MLGA 3PIOF 3BP8A 3OV8A 3DKXA 2KRCA 3FKJA 5IT3A 3ONQA 2MABA 1K78A 2PBIA 3ABMH 5CPRB 3CCEI 3J7AO 4F93B 4A93J 4A3MJ 4RGXA 4DBQA 2DA5A 2J5PA 3TP3A 1G3TA 4JBAA 2XGXA 4X1EA 1S72I 1TQMA 2R5ZA 3ABTA 2R7ZJ 1I39A 1FMVA 2WC2A 4DGWB 2ZMEA 1JKPC 2VONA 2DJNA 2EFNA 1NG7A 1SD6A 1FOYA 4C2UA 4Y15A 1FX7A 1S29A 4ZDLA 2ZCWA 1LUJB 1HSTA 1OCOH 4PFOA 4ZJZA 3R0AA 3K1PA 4RGRA 3F0CA 1KU3A 1FMWA 2EFPA 1MJAA 4KIBA 3S2WA 4FT8A 3HOSA 4BHBA 3FIWA 3K4KA 3TQNA 3FBNB 2D5VA 2ACJA 2H6BA 1MBEA 3WU2C 2CWEA 3RIRA 3F3XA 4ASNA 2A5YB 2NVXJ 1XS9A 2W24A 2G0EA 1W7PB 5JHFA 1IXRC 1ZHFA 1S7EA 3C7JA 2ECBA 2BOLA 1Z3YA 1OQYA 5J8FA 5LHGA 1V5EA 3L2CA 1NK2P 1ERDA 1FBUA 2ZO4A 2Y9ZA 3LOCA 3WE2A 1T39A 3ASOH 3ZMTA 3E3VA 5DYMA 3HZJA 3LWFA 3BTLA 5BOXA 1TWHJ 1UG0A 4HOBA 3WTVC 1HW2A 2VKEA 4MQVA 4NDLA 3JAMK 1K83J 1H9GA 1FTZA 1XDUA 2HS5A 3BR1A 2YX7A 5L3FA 3PUFA 4RA2A 2Y31A 1XMKA 2XAHA 3OYHA 4RM2A 4FE7A 2H8RA 1BR4A 2EV6A 4GGGA 1MJBA 4FHTA 1G3YA 2Y2ZA 4E7IA 5DM7F 1U6GA 3PQJA 2QA4I 4NQWB 1MH3A 3H9QA 3P7NA 5ICCA 3EYYA 3OOPA 1IF1A 3F21A 2B9SA 2X6OA 5DS9A 1BA5A 1F5TA 3FXLA 5E8IA 2X1DA 4HV5A 1A04A 2A69F 3TGNA 2DMNA 2F5EA 5BNGA 4U88A 2OD5A 3ULQB 1X1BA 1Q1HA 2R7RA 1P7JA 3PFYA 1YX5A 1HQCA 2FNPA 5IP7J 4EGYA 2IA2A 3IP4B 3HBLA 3EQLF 4WXHA 3DPTA 3L2VA 2ELJA 3JAMZ 1IV8A 3C2GA 3ZN1A 4XN3A 2CSOA 2EQRA 4BQQA 3M7GA 3HRSA 1PP8F 2K40A 2KLOA 2RREA 1MMAA 3ZN0A 4IOCF 3I55I 3KX2A 4IHVA 2VOOA 1MGTA 3GTLJ 4HZFA 3E7LA 1FOKA 1RR7A 4H0EA 1S7AA 4J19A 3RZOJ 4M6YA 3M4OJ 4LD5A 2DOFA 3OR1C 1G6NA 4HBLA 4IVNA 1MDMB 1BC8C 2KRHA 1U5TC 5J3LA 1LB2A 1BOAA 3BROA 3D5LA 1STZA 3G73A 2P4WA 2V1UA 2FEZA 1XG1A 1ZGJA 3D1NI 1H9TA 1P9QC 3S1RJ 1OFCX 2DYRH 4NC6A 1YJNI 3LSJA 1ULYA 1IJWC 3CZ6A 3TO9A 1IW7F 4CHUA 4RLFA 4LIUA 2FBHA 2ESHA 3CO7C 2L01A 1WPKA 4E6KG 1YIJI 4I0BA 4B8XA 5E1WA 2M8EA 2Q2EB 1KONA 2QBYB 4NUBA 4ITVA 3MCZA 3FWEA 2L2OA 3L9FA 4JX5A 3QPSA 3W2WA 5FKNA 5TJJA 1UELB 2WY8Q 3DQVC 2EZHA 2KFDA 1SVOA 2HPMA 2XRNA 1HW5A 3EETA 3G2BA 4CSWA 5LRSA 5LD2C 4L0YB 4WX9A 2XPWA 2M4GA 2HXIA 2LF7A 3BG9A 1RZ4A 4IRGA 1QHGA 4HNTA 5M3FJ 4BQOA 2TDXA 3FISA 5GPCA 1TQPA 2CGPA 4RGSA 4JYKA 3QRFF 3H3VK 2DODA 1SVLA 3K0LA 1GDTA 3W3CA 3NWSA 2DFHA 3RKWA 2PMHA 3K2ZA 2WAEA 2OBPA 2WA0A 2Y30A 2CUZA 1X3WB 4TV7A 1QZYA 4A6DA 3BTIA 4BJ5C 5F1RA 3H0GJ 5LGTA 1ZELA 4UB6C 4UUSB 5CVUA 3S2DJ 3HPGA 1XPXA 1JE8A 4P55A 1IN5A 1BI2A 1TTYA 2K3FA 3I0TA 4LB6B 2DPUA 4YFXF 3I59B 3E1SA 3WTYC 5M5YJ 2QSGX 1FWZA 1ZARA 4HX8A 4KNYA 2A6TA 3HKZA 2W48A 2XUBA 5K7HA 3DPLC 4LLLA 1D0ZA 1TW3A 3G1MA 1NTCA 1FP2A 4XOPA 4I6ZA 1GUUA 1MNEA 3AG4H 3TDUC 1D5YA 2M87A 5IYCJ 1OR7A 1YS7A 3E97A 4RLQA 3MN2A 5DCMA 4B09A 5HNFA 4A3IJ 3HOVJ 4A3LJ 1WJAA 4D7NA 4FE4A 1E2XA 2R4GA 3R60A 1JKOC 3LMMA 3JRFA 3V7RA 3KE2A 3V7CA 1ZQ3P 4KDPA 2W82A 1PUFA 4I01A 3U9GA 2XAQA 2VKVA 4AUXA 2XRLA 5DD8A 4A3GJ 2F5FA 3IC7A 3MWMA 2FQ4A 1QRYA 3CUQC 4Q47A 4CCMA 3I53A 4GRIA 2YPRA 2ZC2A 1Z21A 4EVIA 3BR2A 3JCUC 4A3EJ 1CGPA 1B1BA 3PL8A 1Z7LA 4A3BJ 1OCCH 1WZ2A 2OA4A 3ZQCA 1W5SA 5GTHC 3ZMDA 1WGXA 1W5CC 3S3OA 3GTGJ 1O7FA 1XD7A 3EUHA 3F72A 2V9KA 3GFJA 3WTZA 4OWRB 3GTMJ 1T6SA 5D5UB 1T98A 2HTSA 3O3KA 2ELKA 3RYRA 4KA4A 3QOPA 5FKLA 2GWRA 3CC4I 4D0PA 3IHUA 4QPQA 1V5FA 2M9HA 3VWBA 4EGZA 4CA0A 2EA2A 2VC1A 3RKXA 1QQIA 1UHMA 1AKHA 3NQOA 4BY1J 5F27A 2Z9OA 1Z91A 2VQGA 1K6OA 1GXPA 1Z6RA 2IXSA 3I54A 4GDFA 1I6HJ 2BVLA 2HU9A 2DMTA 4G7HF 2HYGD 2UV1A 2XF5A 4CXFA 2NNNA 4Z2YA 1Y8RB 4HX4A 4KMUX 2X9DA 1W1WE 2QZ8A 5F0CA 3FM5A 3K4LA 4PDKA 2K9QA 5E18F 4X0GA 1LE8B 4LB5A 4LMYA 2Z1DA 1VTNC 2X1EA 5DCFA 2RAEA 4MEXF 5D4SA 3OYAA 2RGVA 2ID6A 4PK4A 1BR1A 5D5VB 3C18A 3RCOA 2Z5UA 2CW8A 1Z05A 1WI3A 2LH9A 1IG7A 5ILUA 3SEQA 1GXQA 3S17J 3SZTA 1ZG5A 3K4JA 3WTWC 3GLXA 2ZKZA 3DWLE 3KYCB 4XSXF 2KJBA 5BQTA 3M07A 5FD5A 5TGTA 1KYZA 1BOBA 4NBQA 3S8PA 2F48A 2BY2A 1R58A 3QAHA 1GHCA 2WB1N 5LEJA 1N75A 1BR2A 5F08A 3S93A 3LA3A 1FNNA 3OYMA 2X48A 3HOTA 3WGHA 3CF5F 4O3MA 4OINF 1PDNC 2ZMEC 4M3GA 4MEYF 1RI7A 1KZHA 1AA7A 3HOYJ 1SMTA 2ZFWA 1ZG1A 1XGSA 3PSIA 4J00A 2FNAA 2E35A 1ZR2A 1Z0XA 2VB6A 2HOEA 4K2EA 4DZJA 4EM0B 3SDGA 2A07F 1WWXA 1YFHA 4FISA 4AIDA 3JRIA 2I10A 2JVHA 1W5TA 1IN6A 1OLTA 3RJPA 2LSOA 4C9YA 4PJNA 2DA4A 4PJLA 3CMAI 5EJCA 1J59A 1BW6A 2LNBA 2O03A 1XMXA 1TT0A 2DU9A 2NS7A 3DEEA 3FKIJ 3LQRA 1I6XA 1J75A 3H1CA 2JRTA 4I98B 2N8GA 1WJCA 1G4DA 3JW4A 3NAUA 4Y3OA 4P9FA 5CVRA 5F1JA 3GCMA 3OYCA 1BC7C 4AVPA 3K69A 1Y0NA 1DGRM 2FUG2 3KEOA 3HRTA 2FQ3A 2DCEA 2QUFA 2O9LA 2M5WA 2PX9A 4LG0A 3R4KA 3TKYA 3IKTA 1ETQA 3WODF 4P5OA 4IO9F 1FYMA 2JTVA 2NRAC 4IHSA 4II3A 1JT0A 3OYJA 1X3UA 2FX0A 5GADJ 2I8DA 3CC2I 1BJZA 2V7FA 2VASA 3F8BA 1HW1A 3M9AA 2HXOA 1ODDA 2DN0A 4LK0F 3HOUJ 2YU3A 3CCVI 1YJWI 1YOVB 2VXZA 2ZXHA 4FX0A 3CCRI 2W85A 4YRVA 2CUJA 3KP6A 3QYFA 5LGNA 2ZSIB 4HDVA 4ANJA 1FPQA 4BEHB 3CCMI 3D0SA 2DW4A 1VQLI 4PJMA 2OPTA 4E7LA 4A0ZA 2Q0OA 2L9VA 3JRCA 2K85A 2F4IA 1U8RA 2BYVE 2L9RA 2Q1ZB 3WE3A 4ZYEA 4JX4A 3A03A 2EA4A 4HLXA 4BGDA 5FRNA 1A6IA 3LSRA 4EV0A 3HEFA 1H88C 3PNTA 2E7WA 3CJQB 5L3BA 4BE1A 1IV6A 4QSHA 4KYWA 3Q3SA 3KZZA 3PM1A 1GT0C 3SYTA 3H5NA 1QPIA 2NVQJ 1S3JA 3K70D 2QQBA 2QENA 3ZQGA 4N0BA 4CYCB 3S3NA 3G3ZA 2HOTA 4I7HA 2CV2A 4FASD 2AO9A 1OCPA 2PLYA 3DU6A 4O5VA 1K4TA 2ZJPF 2R93J 1S7OA 3N4MA 1VQ9I 4P1WA 4RB2C 2GOXB 2DO7A 2E5ZA 4M9ZA 2X4HA 3F9KA 4MLOA 1WH5A 4HEA2 2WADA 5J1YA 4P96A 4KUMA 1QVUA 4N4OB 2BXZA 2ADUA 4Y33A 2NNYA 3QQAA 1BM9A 3WGGA 3WTTC 4E7SA 1FSHA 5K1YA 1MSFC 1ZK8A 5IP9J 3OYDA 3PJRA 1R71A 4M3FA 4AD9A 1N25A 1D5VA 2L4MA 2JT1A 2OC6A 1V3FA 1T56A 2VIXA 3R0JA 2E60A 4EMSA 2E2JJ 2IP2A 2OTLI 4V2GA 3R6SA 3BR0A 3OYFA 2VT2A 3AL0B 4N9IA 1ZLJA 4QPOA 1Z9CA 1BN5A 5EEGA 2DPDA 3ABUA 1Y1VJ 3B73A 2ZB9A 5D5XB 3WU0A 2PMUA 3HIFA 2BZTA 4KFCA 3RTRA 1T08B 2M3AA 3V8JA 5HS7A 5LEKA 2K27A 3F8CA 1XDSA 2MC4A 3C3WA 3H3ZA 1J9IA 4WF2A 1JUMA 3LSTA 3I3LA 3BJAA 1TL8A 1I1SA 2CH0A 4XL9A 2W1OA 3KCCA 2HWVA 1BL0A 2BW3A 1FYLA 5LGUA 3HYIA 3HJEA 1U5TB 1SFOJ 1F9NA 1TZLA 4YG2F 1ZN2A 1BW5A 2R7SA 5M3MJ 2VBYA 4YEJA 1IRFA 4HAMA 1QA6A 3DBLB 4ZH4F 4ZTFA 1OR7C 1NG6A 3MQ0A 5BMZA 3P9CA 4LG3A 4D1QA 2Y48A 1OCRH 1YYVA 1UMQA 5GAHJ 3OYIA 4HDUA 1X58A 2VBWA 2HR3A 3SFIA 3FHNA 4AIHA 4HYEA 1FIAA 4L9JA 1XGOA 2ME0A 3V8LA 2EV5A 1ZRDA 1I27A 1OISA 4OIPF 1D8KA 5K5OA 2P81A 5CLSA 4BE0A 4UB8C 5IP6A 4IPAA 3ECOA 4KIGA 5FROA 3MEXA 5BS6A 2O5RA 3FMSA 4LOCA 1WJEA 1ZKGA 2VUMJ 2VT3A 1MBKA 2JUGA 4ZTJA 3F8FA 3IL2A 2QGUA 2M4KA 1ZH5A 2KHMA 2HOAA 1KQ8A 1MMDA 4F52A 2FU4A 4HF0A 3T0YA 1N78A 3S1QJ 1JTXA 5EGOA 3TMOA 1KA8A 2LTPA 3QWLA 4ESFA 4BNCA 4CGZA 3ZOBA 3GTPJ 2M7BA 4A3DJ 4RDUA 4DYQA 4IF4A 3JSOA 1P92A 4CCNA 3S32A 1IO2A 5FB2A 5H6QA 3KZIC 4ETSA 4XORA 4D5CA 1K61A 4XLCA 1USSA 2XKOA 3HOWJ 2GA1A 2R7OA 1XGMA 4M9SA 1JUPA 4ENNA 1E3HA 3J7YJ 4L9TA 2VJIA 4RAGA 3T1BA 3V4GA 3LSPA 5A2QK 2ECCA 2GZWA 2YR2A 3I4NJ 4BY7J 4F91B 1EF4A 1G2HA 3ZQLA 2KJCA 4W1UA 5FRMA 3C2HA 2HEOA 3I64A 2XKPA 1R00A 4FTHA 1VFCA 1XCVA 3MZHA 5EYRA 2XVCA 2GXAA 1VI0A 1R1UA 2P7CB 2CQQA 2IGNA 3ABLH 3B02A 4XONA 4AWXB 4ZDOA 1JI8A 3VYRB 2DMPA 3EYIA 2R92J 1X3ZB 2FMYA 3VDXA 1FC3A 5F0HA 3CUQB 2Z16A 2ZBKA 3DPUA 4RGUA 1S6LA 5J47A 2EV0A 4HPQA 2IAIA 5TISC 2KMUA 2UXXA 1DPUA 2DFEA 2HDWA 1DU0A 4CICA 4MO7A 2OQGA 4G6QA 3BLYA 3PNVA 4B3AA 3K70C 3U21A 5L3GA 3KYLA 2J5OA 3G71I 1DPRA 2CO5A 2IS4A 2BY3A 5B1BH 4IHYA 1BI0A 1F43A 1LFBA 2K9LA 2L9SA 1QGPA 5A2QZ 3GYHX 3AL0C 2JSPA 5EF6A 1VQKI 1G59A 5LLQA 4I76A 3LSHA 2JA8J 4MIMA 1I1GA 1TP4A 1V5GA 1FBSA 4HSRA 4LGWA 3BZCA 1FBQA 1VQ4I 3BCAA 2E2IJ 1QO0D 3DTEA 2P5LC 1SD5A 1MMSA 4OIOF 2Z2SB 3NRVA 3Q5FA 1P2FA 5FKMA 3OS0A 2OZUA 2QQAA 2ISZA 3TOBA 2LR8A 1W36D 2GOMA 4A0YA 4BE2A 2NS8A 5LHIA 1UAAA 5M5XJ 3HSFA 1H89C 2ETHA 2A5WA 2DTZA 2L9NA 5GPAA 2R5YB 4A3KJ 2E2HJ 4UV9A 4OU0A 3COAC 2LY2A 2LLKA 1XSVA 3CMYA 2D45A 2X6WA 3DLAA 1YJ9I 4W97A 3MZ8A 1O3SA 1B72A 2D2WA 5J8CA 2MBFA 2PJRA 2A68F 1ACIA 5KAFC 1GLNA 3CESA 3ML6A 2H94A 5B1AH 3WTUC 3DTIA 4DNCA 3WU1B 1UHSA 1K78B 4H4KC 2XGCA 2PEXA 1BIBA 4BXXJ 2R5ZB 2DA2A 3ECHA 1YI2I 2HGCA 3BR6A 3IAM2 2ZMEB 4IHTA 1G3WA 2EFOA 5CVJA 5LBQA 5E3NA 2X6XA 4PSWA 3HHGA 3VYSB 5J4YA 3PFIA 1XGNA 5FFZA 1U3EM
chains in the Genus database with same CATH topology
3WTXC 4BHCA 3M1EA 2O61A 3GEZA 3DF8A 1UCRA 4HX7A 5D8KB 1MD0A 2GXGA 2K7LA 2YSRA 1AOYA 1E17A 1OMIA 2L4AA 5HOOA 4UHTA 1OYYA 1XSXA 2R7FA 1SMYF 3R61A 3T8RA 5L3DA 4L0ZB 2IA1A 3GO5A 2B0LA 2UZKA 1TW2A 1HXDA 2Z3YA 4YIFA 5ILVA 5E1ZB 1PUEE 2EFWA 2BEOA 4L5JA 3GUDA 5K5RA 4L9NA 2L3DA 4KN7X 3RPUA 4G6DA 2RN7A 4MQ9F 4F7ZA 5L3CA 2WV0A 2RC4A 1DDNA 4JQFA 1J5YA 2HKXA 2MC3A 2XAGA 1AWCA 1KU2A 2W57A 2ISYA 1XMAA 3DFGA 2D1VA 4ESBA 2G7HA 1TLHB 4LLNA 2BGCA 3DV8A 3CTAA 4QWQA 3ZMZA 3GZ6A 3HHHA 1V4RA 1CF7A 1YIOA 4A12A 1WSUA 3I71A 3QP6A 1UB9A 4A2UA 5AONA 1FP1D 3CUOA 5JHUA 1LDJA 1W4MA 2HZTA 3HRMA 1YW8A 5LHHA 3FXUA 1IN7A 3ELKA 1B59A 1RNLA 3F8MA 5DV5A 4QLCU 3TDZC 1KYWA 2FE3A 3GFLA 4IRIA 1LJ9A 4G7ZF 5CVIA 2CW0F 2MD5A 1JHHA 1XSDA 5KK1A 4HQMA 1QPMA 2IT0A 4EJTA 4EJVA 3IKVA 4M72A 2K4JA 3U2RA 2V1DA 5DUKA 5DUIA 1MJ9A 2L02A 1ZG3A 3BPXA 3FZVA 3FX3A 3T8TA 3VFZA 2E1CA 4R79A 4RAYA 2KKOA 2W84A 5EEHA 4KMFA 4L5IA 2HFHA 1HKSA 4A6EA 1O3RA 4WK8F 1YO5C 4Y17A 1T0FA 1IAWA 4GO1A 1P6RA 4U0YA 3RPQA 3Q9VA 3FMQA 5HLGA 1IXCA 2V79A 2O8XA 5DCMB 5H6RA 2XIGA 2STTA 3JTHA 5ERIA 2XV4S 5CVVA 4Y13A 3E6CC 4Q5SF 4OIQF 2CYYA 3JSPA 3FXQA 1T2KA 3FXRA 3U1DA 3HUGA 1EH8A 1WQ2A 2VBXA 5HS9A 1UFMA 3GVAA 3I5UA 3VB2A 3ZQ7A 3SXYA 3J80K 5BPDA 2BE5F 1QZZA 2EB7A 1FSEA 2P6SA 2M30A 2W25A 2ZNYA 4ZYHA 3L7WA 2C6YA 2EWNA 1PP7U 2MH9A 5DEQA 2DLLA 5CJ9A 3KLNA 2M45A 2F2EA 4UVAA 3GW2A 1XCBA 4AIJA 3F6VA 3PQKA 3W6JB 2ZJ2A 2AS5F 2OZ6A 3ROUA 6PAXA 4ZYGA 3ZMUA 2ESNA 3J80Z 1BBYA 2MH2A 3HTSB 2FRHA 4FX4A 4HQEA 4G94A 2V1XA 1LQ1A 1F4KA 4BAYA 2GAUA 4U7BA 4N9HA 2HTJA 3E6MA 4EQQA 1R7JA 4O6JA 2O0YA 1MZBA 2NAZA 5ICFA 3QPHA 1TNSA 3KP3A 3P9IA 3SFZA 2H6CA 5HVQC 2G7UA 2VBZA 1LNWA 3DP7A 1W7PA 4LFUA 2QM3A 5L3EA 1J0RA 3F6OA 4UNOA 2H27A 2R7DA 3N97A 3AAFA 1K7AA 4ZZLA 4G7OF 2JPBA 2Z33A 3VEPA 2OU2A 5HDKA 2QLZA 3VOEA 1FYKA 3KP4A 1R22A 2XAFA 4CO8A 3BDDA 3HSEA 1LEAA 4ESJA 1K79A 4NQWA 1JHFA 3ISPA 4LG0B 5HDGA 4KN4X 3E5XA 3IWFA 4M6XA 2JZYA 1WRJA 2YX4A 3CLOA 3GFIA 4R1HA 5AIPA 2Q8KA 1XB4A 1DP7P 2JPCA 4AIKA 1IXSB 1B9NA 5LRRA 3DKWA 3RDIA 1T38A 4XSZF 1RUNA 4CZZA 2GXBA 2EK5A 2H09A 1OYIA 3ZMVA 2P5VA 4G9YA 2IPQX 3KETA 4ENKA 1MDMA 4L9VA 2G9WA 2L54A 2VE9A 2EFQA 3M8EA 3H92A 2A61A 1QNTA 5JVTA 1D8JA 3KEQA 3IWZA 1EH6A 3LQQA 2PFBA 5D4RA 4RS8A 1W7PD 4R8HA 5ILSA 3Q9SA 3VODA 2Q2EA 1J2XA 2NS0A 1SFUA 3BY6A 2QBYA 1RUOA 1YQAA 1Z7UA 3BJ6A 5FO5A 5FD6A 2QWWA 1OKRA 4LLGF 3F8NA 2X0LA 1KU9A 2KIFA 1G3SA 4GYGA 2ELHA 3BPVA 3GF2A 2E7XA 4EJOA 3DXJF 4HF2A 1O7LA 1XN7A 2PQ8A 1REPC 5ICEA 3O2PE 4YFKF 4I09A 3I59A 1U78A 2WTEA 4PCQA 1Z1DA 2DFIA 4M74A 1BI1A 1SFEA 1O57A 2CFXA 1LDDA 2RNJA 3K9TA 2DI3A 5D5WB 2A6HF 3FMRA 3MZYA 5JR3A 2PJPA 1DUXC 1ZRFA 2Y75A 1YS6A 2DK5A 1B4AA 5FLXK 2QQ9A 5E20A 2CQKA 2MLKA 1YG2A 2XHKA 2PG4A 3T5XA 1RIOH 1KQ0A 1LDKB 4EJUA 1HKQA 3E5QA 2GQQA 1B9MA 2GA2A 4ZZDA 1YTYA 2AXLA 1SAXA 2K4BA 4ON0A 2EJRA 2DTRA 1I5ZA 3DEUA 4GCVA 3JTGA 2VODA 2IVMA 2FOKA 4WWCA 2LKPA 3GWZA 4MHGA 2GIVA 5H20A 2KIMA 1O3TA 3F23A 3ZPLA 5FLXZ 2BV6A 4U7DA 3RKYA 1SD4A 5DDGA 3HSRA 2K86A 4L18B 1R1VA 1Y0UA 4WCGA 1B6AA 2IJLA 1U2WA 2LDUA 1SD7A 4Q4ZF 2FA5A 2DQRA 4OMYA 2V9VA 4S04A 5D8LB 5BPIA 1TNTA 1ZAOA 3GX4X 2STWA 3WG9A 2DT5A 3KFWX 4BYYA 1KQ9A 1HBXG 1R23A 4E70A 3WTSC 4OMZA 1TQIA 1Z6TA 4BHPA 5J6XA 2P6TA 1C0WA 5JI6A 5E1XA 2IW5A 4M71A 4U0WA 2DK8A 4IJAA 4ENJA 3V8KA 2A3SA 2XROA 2P8TA 3HRUA 4ENMA 4LK1F 4HW0A 5F6FA 3V7SA 3GZ5A 4I2OA 2VN2A 2COMA 4A5MA 4EJWA 2VC0A 2QVOA 2V6CA 2IRFG 4UXNA 4XLNF 1R1TA 3RYPA 2JSCA 4UUVA 1O3QA 3LA2A 2RDPA 2VOPA 4OIRF 1FZPB 4HF1A 5TRDA 1JGSA 1ZGAA 4G8XA 2PN6A 4EM2A 4HV6A 5D6FA 5DD4A 2WWYA 2R3SA 3M8FA 3QU3A 3K1MA 4CDGA 2KIUA 1OPCA 3L00A 5ED4A 1KGSA 1FLIA 1HSJA 4MTEA 3BZ6A 5FFXA 3E6BA 3BWGA 4XLPF 1ON2A 2O3FA 4YIIA 1ZRCA 1ONVA 5F64A 4MNUA 1NHAA 2MA3A 1IN8A 4BH9A 3ERED 3TO7A 1ZREA 2F5CA 3KLOA 4XRFA 2HQNA 3O6BB 4CYDA 4RB1A 5KVRA 5HLIA 4PZJA 5JFRA 1FT9A 3RI4A 4MTDA 1R5GA 4A0XA 3ZMSA 4XBFA 4Q48A 4P9UA 1JXSA 3HTUA 1R36A 4BXUA 2D1HA 2HQRA 2FBIA 3L09A 1OYWA 4M73A 4I0AA 4PGHA 2HYFA 2HKOA 2FF4A 3J81K 3MFKA 1L0OC 4EM1A 4LJZF 2F5DA 2P7VB 2OQRA 4HLYA 5HLHA 3KZYA 4JK1X 3REOA 5AIQA 2M1BA 2DQLA 3GXOA 4UV8A 3CJNA 3TO6A 1IN4A 2KRFA 1SFXA 5HDNA 2P5KA 2K02A 4WXCA 3FF5A 1S8NA 2ZXJA 3CO6C 1BI3A 3J81Z 4WXDA 1ZLKA 1P4XA 1U5TA 4KT5C 3FHZA 2PI0A 1CF7B 1F1ZA 4MGRA 3I4PA 4KICA 3TOAA 3IRRA 4GYIA 3EDPA 5D6EA 2IA0A 1WKMA 1L3LA 1FY7A 4NHJA 4RB0A 3LA7A 1USTA 1IUYA 1WI9A 5E8GA 2RKHA 3SHFA 3H3UA 4M9XA 1J7KA 4YFNF 3MAJA 3IRQA 3KP5A 1LVAA 1IZ1A 1QBJA 1R5HA 1EH7A 1UHWA 4I02A 3GFMA 4S05A 3LAPA 2NYXA 2OAZA 3SQNA 1P4WA 1YW7A 4A5NA 4BQAA 1BIAA 1EV7A 3C1DA 1P4AA 3KP7A 3NEUA 2RQPA 4KIFA 2FBKA 3BJOA 1H0MA 3ZP5A 5HS8A 2HDCA 4UVBA 3I58A 5IT9K 2LF8A 1MKMA 3QP5A 4PGGA 1GVJA 5CYVA 3QPTA 4NB5A 3W6KB 2FXAA 3BOQA 5ICGA 3K1NA 2RV8A 2XASA 2ZNZA 4ZYDA 2FSWA 1LEBA 2DAOA 4UVCA 1ON1A 2BBYA 4IRHA 2VE8A 4GXOA 5K5QA 3LFKA 3CUQA 1BJAA 1TBXA 4HA8A 2O6GE 1HKTA 4IXAA 2XAJA 2RVCA 3KP2A 5FGMA 3LAJA 5E17F 2Z99A 3E5UA 3P9KA 5IT9Z 4RB3C 1YW9A 2A6EF 3FM3A 2QYOA 3QU6A 4RAZA 3F22A 4U0VA 3E6DA 1IRGA 2FMLA 1ZYRF 2UXNA 3CDHA 4DQ2A 2CG4A 4OOIA 3WGIA 2E1NA 1D3YA 1KU7A 2UWMA 2DBBA 3SZPA 1YLFA 2Y0MA 2MLGA 3BP8A 3OV8A 5IT3A 1K78A 2PBIA 3J7AO 4RGXA 2J5PA 1G3TA 4JBAA 2XGXA 1TQMA 3ABTA 2WC2A 2ZMEA 2VONA 2EFNA 1SD6A 4Y15A 1FX7A 1S29A 2ZCWA 1HSTA 3R0AA 3K1PA 4RGRA 1KU3A 2EFPA 1MJAA 4KIBA 3S2WA 4FT8A 3HOSA 4BHBA 3TQNA 2ACJA 2H6BA 2CWEA 3RIRA 3F3XA 4ASNA 2A5YB 2W24A 1W7PB 1IXRC 1ZHFA 3C7JA 5J8FA 5LHGA 3L2CA 1FBUA 2ZO4A 3WE2A 1T39A 3ZMTA 3E3VA 5DYMA 3LWFA 5BOXA 4HOBA 3WTVC 1HW2A 4MQVA 3JAMK 1H9GA 1XDUA 2HS5A 2YX7A 5L3FA 1XMKA 2XAHA 2EV6A 4GGGA 1MJBA 4FHTA 1G3YA 1U6GA 3PQJA 3P7NA 5ICCA 3EYYA 3OOPA 1IF1A 3F21A 1F5TA 5E8IA 4HV5A 1A04A 2A69F 3TGNA 2F5EA 4U88A 2OD5A 3ULQB 1Q1HA 4EGYA 1HQCA 2FNPA 2IA2A 3EQLF 4WXHA 3DPTA 3JAMZ 3ZN1A 2CSOA 3M7GA 3HRSA 1PP8F 3ZN0A 2VOOA 1MGTA 4HZFA 1FOKA 4H0EA 1S7AA 4M6YA 4LD5A 1G6NA 4HBLA 4IVNA 1MDMB 1BC8C 1U5TC 1LB2A 1BOAA 3BROA 3D5LA 1STZA 3G73A 2P4WA 2V1UA 2FEZA 1ZGJA 1H9TA 1ULYA 3TO9A 1IW7F 4CHUA 2FBHA 2ESHA 3CO7C 2L01A 4I0BA 4B8XA 5E1WA 2M8EA 2QBYB 3MCZA 3FWEA 3L9FA 5TJJA 3DQVC 2XRNA 1HW5A 3EETA 5LRSA 4L0YB 4WX9A 2LF7A 4IRGA 1RZ4A 2TDXA 2CGPA 1TQPA 4RGSA 3QRFF 3K0LA 3RKWA 2PMHA 3K2ZA 2OBPA 4TV7A 1QZYA 4A6DA 5F1RA 5LGTA 5CVUA 1JE8A 4P55A 1TTYA 1BI2A 1IN5A 3I0TA 4LB6B 2DPUA 4YFXF 3I59B 3WTYC 1FWZA 1ZARA 4HX8A 4KNYA 2XUBA 3DPLC 4LLLA 1TW3A 1FP2A 3TDUC 2M87A 1OR7A 1YS7A 3E97A 5DCMA 4B09A 1E2XA 3R60A 3V7RA 3KE2A 3V7CA 4KDPA 4I01A 3U9GA 2XAQA 5DD8A 2F5FA 3IC7A 3MWMA 3CUQC 4Q47A 3I53A 2YPRA 4EVIA 1CGPA 1B1BA 2OA4A 1W5SA 3ZMDA 1O7FA 1XD7A 3EUHA 3F72A 3GFJA 3WTZA 1T6SA 5D5UB 1T98A 2HTSA 3O3KA 3RYRA 4KA4A 3QOPA 2GWRA 4D0PA 3IHUA 4EGZA 2EA2A 2VC1A 3RKXA 1QQIA 1UHMA 3NQOA 2Z9OA 1Z91A 1K6OA 1GXPA 1Z6RA 3I54A 4G7HF 2HYGD 4CXFA 2NNNA 4Z2YA 4HX4A 4KMUX 2QZ8A 3FM5A 4PDKA 5E18F 4LB5A 4LMYA 1VTNC 5DCFA 4MEXF 5D4SA 2RGVA 5D5VB 3C18A 2Z5UA 1Z05A 5ILUA 1GXQA 3SZTA 1ZG5A 3WTWC 3GLXA 2ZKZA 4XSXF 2KJBA 5BQTA 5FD5A 1KYZA 1R58A 3QAHA 1GHCA 5LEJA 3LA3A 1FNNA 3HOTA 3WGHA 4O3MA 4OINF 1PDNC 4MEYF 1RI7A 1SMTA 2ZFWA 1ZG1A 1XGSA 2FNAA 2HOEA 4K2EA 4EM0B 2A07F 1WWXA 1YFHA 1W5TA 1IN6A 3RJPA 2LSOA 1J59A 2LNBA 2O03A 3LQRA 2DU9A 1I6XA 1J75A 2JRTA 4I98B 1G4DA 3JW4A 4P9FA 5CVRA 1BC7C 4AVPA 3K69A 3KEOA 3HRTA 2FQ3A 2QUFA 2M5WA 4LG0A 3R4KA 3TKYA 3IKTA 3WODF 4P5OA 1FYMA 2JTVA 2NRAC 4IHSA 1X3UA 3F8BA 1HW1A 3M9AA 1ODDA 4LK0F 2YU3A 2VXZA 4FX0A 2W85A 3KP6A 5LGNA 4HDVA 1FPQA 3D0SA 2DW4A 4A0ZA 2Q0OA 1U8RA 2BYVE 3WE3A 4ZYEA 2EA4A 4HLXA 4EV0A 2E7WA 5L3BA 4KYWA 3KZZA 1S3JA 2QQBA 2QENA 4N0BA 3G3ZA 4I7HA 2PLYA 4O5VA 1S7OA 3N4MA 4RB2C 2DO7A 4M9ZA 2X4HA 4P96A 4KUMA 2ADUA 2NNYA 1BM9A 3WGGA 3WTTC 1FSHA 5K1YA 4AD9A 1D5VA 2L4MA 2JT1A 1V3FA 3R0JA 4EMSA 2IP2A 3R6SA 2VT2A 4N9IA 1ZLJA 1Z9CA 1BN5A 5EEGA 2DPDA 3ABUA 3B73A 5D5XB 3WU0A 2PMUA 3HIFA 4KFCA 3RTRA 3V8JA 5HS7A 5LEKA 2K27A 3F8CA 1XDSA 3C3WA 3H3ZA 1J9IA 4WF2A 3LSTA 3BJAA 1I1SA 3KCCA 2HWVA 1FYLA 5LGUA 3HYIA 1U5TB 1F9NA 4YG2F 1ZN2A 2VBYA 1IRFA 4HAMA 4ZH4F 3MQ0A 5BMZA 3P9CA 2Y48A 1YYVA 4HDUA 2VBWA 2HR3A 4AIHA 4HYEA 4L9JA 1XGOA 3V8LA 2EV5A 1ZRDA 1I27A 4OIPF 1D8KA 5K5OA 5CLSA 4IPAA 3ECOA 4KIGA 3MEXA 5BS6A 3FMSA 2VT3A 3F8FA 3IL2A 1ZH5A 1KQ8A 2FU4A 4HF0A 3T0YA 1KA8A 4ESFA 4BNCA 4CGZA 4IF4A 3JSOA 1P92A 5FB2A 5H6QA 4ETSA 1USSA 2XKOA 2GA1A 4M9SA 1XGMA 4ENNA 4L9TA 3T1BA 3V4GA 5A2QK 2GZWA 2YR2A 2KJCA 2HEOA 3I64A 2XKPA 1R00A 1XCVA 3MZHA 2XVCA 1R1UA 2P7CB 3B02A 4AWXB 3EYIA 2FMYA 1FC3A 3CUQB 4RGUA 2ZBKA 1S6LA 2EV0A 2UXXA 1DPUA 4CICA 2OQGA 4G6QA 5L3GA 2J5OA 1DPRA 2CO5A 1BI0A 3GYHX 1QGPA 5A2QZ 5LLQA 1I1GA 1FBSA 4LGWA 1FBQA 1QO0D 2P5LC 1SD5A 4OIOF 3NRVA 3Q5FA 1P2FA 2OZUA 2QQAA 2ISZA 3TOBA 4A0YA 5LHIA 3HSFA 2ETHA 4UV9A 4OU0A 3COAC 1XSVA 2D45A 1O3SA 2D2WA 5J8CA 2MBFA 2A68F 3ML6A 2H94A 3WTUC 4DNCA 3WU1B 1K78B 2PEXA 1BIBA 3ECHA 2HGCA 2ZMEB 4IHTA 1G3WA 2EFOA 5CVJA 5LBQA 3HHGA 3PFIA 1XGNA 5FFZA 1U3EM
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3WTX C;  4BHC A;  3M1E A;  2O61 A;  3GEZ A;  3DF8 A;  1UCR A;  4HX7 A;  5D8K B;  1MD0 A;  2GXG A;  2K7L A;  2YSR A;  1AOY A;  1E17 A;  1OMI A;  2L4A A;  5HOO A;  4UHT A;  1OYY A;  1XSX A;  2R7F A;  1SMY F;  3R61 A;  3T8R A;  5L3D A;  4L0Z B;  2IA1 A;  3GO5 A;  2B0L A;  2UZK A;  1TW2 A;  1HXD A;  2Z3Y A;  4YIF A;  5ILV A;  5E1Z B;  1PUE E;  2EFW A;  2BEO A;  4L5J A;  3GUD A;  5K5R A;  4L9N A;  2L3D A;  4KN7 X;  3RPU A;  4G6D A;  2RN7 A;  4MQ9 F;  4F7Z A;  5L3C A;  2WV0 A;  2RC4 A;  1DDN A;  4JQF A;  1J5Y A;  2HKX A;  2MC3 A;  2XAG A;  1AWC A;  1KU2 A;  2W57 A;  2ISY A;  1XMA A;  3DFG A;  2D1V A;  4ESB A;  2G7H A;  1TLH B;  4LLN A;  2BGC A;  3DV8 A;  3CTA A;  4QWQ A;  3ZMZ A;  3GZ6 A;  3HHH A;  1V4R A;  1CF7 A;  1YIO A;  4A12 A;  1WSU A;  3I71 A;  3QP6 A;  1UB9 A;  4A2U A;  5AON A;  1FP1 D;  3CUO A;  5JHU A;  1LDJ A;  1W4M A;  2HZT A;  3HRM A;  1YW8 A;  5LHH A;  3FXU A;  1IN7 A;  3ELK A;  1B59 A;  1RNL A;  3F8M A;  5DV5 A;  4QLC U;  3TDZ C;  1KYW A;  2FE3 A;  3GFL A;  4IRI A;  1LJ9 A;  4G7Z F;  5CVI A;  2CW0 F;  2MD5 A;  1JHH A;  1XSD A;  5KK1 A;  4HQM A;  1QPM A;  2IT0 A;  4EJT A;  4EJV A;  3IKV A;  4M72 A;  2K4J A;  3U2R A;  2V1D A;  5DUK A;  5DUI A;  1MJ9 A;  2L02 A;  1ZG3 A;  3BPX A;  3FZV A;  3FX3 A;  3T8T A;  3VFZ A;  2E1C A;  4R79 A;  4RAY A;  2KKO A;  2W84 A;  5EEH A;  4KMF A;  4L5I A;  2HFH A;  1HKS A;  4A6E A;  1O3R A;  4WK8 F;  1YO5 C;  4Y17 A;  1T0F A;  1IAW A;  4GO1 A;  1P6R A;  4U0Y A;  3RPQ A;  3Q9V A;  3FMQ A;  5HLG A;  1IXC A;  2V79 A;  2O8X A;  5DCM B;  5H6R A;  2XIG A;  2STT A;  3JTH A;  5ERI A;  2XV4 S;  5CVV A;  4Y13 A;  3E6C C;  4Q5S F;  4OIQ F;  2CYY A;  3JSP A;  3FXQ A;  1T2K A;  3FXR A;  3U1D A;  3HUG A;  1EH8 A;  1WQ2 A;  2VBX A;  5HS9 A;  1UFM A;  3GVA A;  3I5U A;  3VB2 A;  3ZQ7 A;  3SXY A;  3J80 K;  5BPD A;  2BE5 F;  1QZZ A;  2EB7 A;  1FSE A;  2P6S A;  2M30 A;  2W25 A;  2ZNY A;  4ZYH A;  3L7W A;  2C6Y A;  2EWN A;  1PP7 U;  2MH9 A;  5DEQ A;  2DLL A;  5CJ9 A;  3KLN A;  2M45 A;  2F2E A;  4UVA A;  3GW2 A;  1XCB A;  4AIJ A;  3F6V A;  3PQK A;  3W6J B;  2ZJ2 A;  2AS5 F;  2OZ6 A;  3ROU A;  6PAX A;  4ZYG A;  3ZMU A;  2ESN A;  3J80 Z;  1BBY A;  2MH2 A;  3HTS B;  2FRH A;  4FX4 A;  4HQE A;  4G94 A;  2V1X A;  1LQ1 A;  1F4K A;  4BAY A;  2GAU A;  4U7B A;  4N9H A;  2HTJ A;  3E6M A;  4EQQ A;  1R7J A;  4O6J A;  2O0Y A;  1MZB A;  2NAZ A;  5ICF A;  3QPH A;  1TNS A;  3KP3 A;  3P9I A;  3SFZ A;  2H6C A;  5HVQ C;  2G7U A;  2VBZ A;  1LNW A;  3DP7 A;  1W7P A;  4LFU A;  2QM3 A;  5L3E A;  1J0R A;  3F6O A;  4UNO A;  2H27 A;  2R7D A;  3N97 A;  3AAF A;  1K7A A;  4ZZL A;  4G7O F;  2JPB A;  2Z33 A;  3VEP A;  2OU2 A;  5HDK A;  2QLZ A;  3VOE A;  1FYK A;  3KP4 A;  1R22 A;  2XAF A;  4CO8 A;  3BDD A;  3HSE A;  1LEA A;  4ESJ A;  1K79 A;  4NQW A;  1JHF A;  3ISP A;  4LG0 B;  5HDG A;  4KN4 X;  3E5X A;  3IWF A;  4M6X A;  2JZY A;  1WRJ A;  2YX4 A;  3CLO A;  3GFI A;  4R1H A;  5AIP A;  2Q8K A;  1XB4 A;  1DP7 P;  2JPC A;  4AIK A;  1IXS B;  1B9N A;  5LRR A;  3DKW A;  3RDI A;  1T38 A;  4XSZ F;  1RUN A;  4CZZ A;  2GXB A;  2EK5 A;  2H09 A;  1OYI A;  3ZMV A;  2P5V A;  4G9Y A;  2IPQ X;  3KET A;  4ENK A;  1MDM A;  4L9V A;  2G9W A;  2L54 A;  2VE9 A;  2EFQ A;  3M8E A;  3H92 A;  2A61 A;  1QNT A;  5JVT A;  1D8J A;  3KEQ A;  3IWZ A;  1EH6 A;  3LQQ A;  2PFB A;  5D4R A;  4RS8 A;  1W7P D;  4R8H A;  5ILS A;  3Q9S A;  3VOD A;  2Q2E A;  1J2X A;  2NS0 A;  1SFU A;  3BY6 A;  2QBY A;  1RUO A;  1YQA A;  1Z7U A;  3BJ6 A;  5FO5 A;  5FD6 A;  2QWW A;  1OKR A;  4LLG F;  3F8N A;  2X0L A;  1KU9 A;  2KIF A;  1G3S A;  4GYG A;  2ELH A;  3BPV A;  3GF2 A;  2E7X A;  4EJO A;  3DXJ F;  4HF2 A;  1O7L A;  1XN7 A;  2PQ8 A;  1REP C;  5ICE A;  3O2P E;  4YFK F;  4I09 A;  3I59 A;  1U78 A;  2WTE A;  4PCQ A;  1Z1D A;  2DFI A;  4M74 A;  1BI1 A;  1SFE A;  1O57 A;  2CFX A;  1LDD A;  2RNJ A;  3K9T A;  2DI3 A;  5D5W B;  2A6H F;  3FMR A;  3MZY A;  5JR3 A;  2PJP A;  1DUX C;  1ZRF A;  2Y75 A;  1YS6 A;  2DK5 A;  1B4A A;  5FLX K;  2QQ9 A;  5E20 A;  2CQK A;  2MLK A;  1YG2 A;  2XHK A;  2PG4 A;  3T5X A;  1RIO H;  1KQ0 A;  1LDK B;  4EJU A;  1HKQ A;  3E5Q A;  2GQQ A;  1B9M A;  2GA2 A;  4ZZD A;  1YTY A;  2AXL A;  1SAX A;  2K4B A;  4ON0 A;  2EJR A;  2DTR A;  1I5Z A;  3DEU A;  4GCV A;  3JTG A;  2VOD A;  2IVM A;  2FOK A;  4WWC A;  2LKP A;  3GWZ A;  4MHG A;  2GIV A;  5H20 A;  2KIM A;  1O3T A;  3F23 A;  3ZPL A;  5FLX Z;  2BV6 A;  4U7D A;  3RKY A;  1SD4 A;  5DDG A;  3HSR A;  2K86 A;  4L18 B;  1R1V A;  1Y0U A;  4WCG A;  1B6A A;  2IJL A;  1U2W A;  2LDU A;  1SD7 A;  4Q4Z F;  2FA5 A;  2DQR A;  4OMY A;  2V9V A;  4S04 A;  5D8L B;  5BPI A;  1TNT A;  1ZAO A;  3GX4 X;  2STW A;  3WG9 A;  2DT5 A;  3KFW X;  4BYY A;  1KQ9 A;  1HBX G;  1R23 A;  4E70 A;  3WTS C;  4OMZ A;  1TQI A;  1Z6T A;  4BHP A;  5J6X A;  2P6T A;  1C0W A;  5JI6 A;  5E1X A;  2IW5 A;  4M71 A;  4U0W A;  2DK8 A;  4IJA A;  4ENJ A;  3V8K A;  2A3S A;  2XRO A;  2P8T A;  3HRU A;  4ENM A;  4LK1 F;  4HW0 A;  5F6F A;  3V7S A;  3GZ5 A;  4I2O A;  2VN2 A;  2COM A;  4A5M A;  4EJW A;  2VC0 A;  2QVO A;  2V6C A;  2IRF G;  4UXN A;  4XLN F;  1R1T A;  3RYP A;  2JSC A;  4UUV A;  1O3Q A;  3LA2 A;  2RDP A;  2VOP A;  4OIR F;  1FZP B;  4HF1 A;  5TRD A;  1JGS A;  1ZGA A;  4G8X A;  2PN6 A;  4EM2 A;  4HV6 A;  5D6F A;  5DD4 A;  2WWY A;  2R3S A;  3M8F A;  3QU3 A;  3K1M A;  4CDG A;  2KIU A;  1OPC A;  3L00 A;  5ED4 A;  1KGS A;  1FLI A;  1HSJ A;  4MTE A;  3BZ6 A;  5FFX A;  3E6B A;  3BWG A;  4XLP F;  1ON2 A;  2O3F A;  4YII A;  1ZRC A;  1ONV A;  5F64 A;  4MNU A;  1NHA A;  2MA3 A;  1IN8 A;  4BH9 A;  3ERE D;  3TO7 A;  1ZRE A;  2F5C A;  3KLO A;  4XRF A;  2HQN A;  3O6B B;  4CYD A;  4RB1 A;  5KVR A;  5HLI A;  4PZJ A;  5JFR A;  1FT9 A;  3RI4 A;  4MTD A;  1R5G A;  4A0X A;  3ZMS A;  4XBF A;  4Q48 A;  4P9U A;  1JXS A;  3HTU A;  1R36 A;  4BXU A;  2D1H A;  2HQR A;  2FBI A;  3L09 A;  1OYW A;  4M73 A;  4I0A A;  4PGH A;  2HYF A;  2HKO A;  2FF4 A;  3J81 K;  3MFK A;  1L0O C;  4EM1 A;  4LJZ F;  2F5D A;  2P7V B;  2OQR A;  4HLY A;  5HLH A;  3KZY A;  4JK1 X;  3REO A;  5AIQ A;  2M1B A;  2DQL A;  3GXO A;  4UV8 A;  3CJN A;  3TO6 A;  1IN4 A;  2KRF A;  1SFX A;  5HDN A;  2P5K A;  2K02 A;  4WXC A;  3FF5 A;  1S8N A;  2ZXJ A;  3CO6 C;  1BI3 A;  3J81 Z;  4WXD A;  1ZLK A;  1P4X A;  1U5T A;  4KT5 C;  3FHZ A;  2PI0 A;  1CF7 B;  1F1Z A;  4MGR A;  3I4P A;  4KIC A;  3TOA A;  3IRR A;  4GYI A;  3EDP A;  5D6E A;  2IA0 A;  1WKM A;  1L3L A;  1FY7 A;  4NHJ A;  4RB0 A;  3LA7 A;  1UST A;  1IUY A;  1WI9 A;  5E8G A;  2RKH A;  3SHF A;  3H3U A;  4M9X A;  1J7K A;  4YFN F;  3MAJ A;  3IRQ A;  3KP5 A;  1LVA A;  1IZ1 A;  1QBJ A;  1R5H A;  1EH7 A;  1UHW A;  4I02 A;  3GFM A;  4S05 A;  3LAP A;  2NYX A;  2OAZ A;  3SQN A;  1P4W A;  1YW7 A;  4A5N A;  4BQA A;  1BIA A;  1EV7 A;  3C1D A;  1P4A A;  3KP7 A;  3NEU A;  2RQP A;  4KIF A;  2FBK A;  3BJO A;  1H0M A;  3ZP5 A;  5HS8 A;  2HDC A;  4UVB A;  3I58 A;  5IT9 K;  2LF8 A;  1MKM A;  3QP5 A;  4PGG A;  1GVJ A;  5CYV A;  3QPT A;  4NB5 A;  3W6K B;  2FXA A;  3BOQ A;  5ICG A;  3K1N A;  2RV8 A;  2XAS A;  2ZNZ A;  4ZYD A;  2FSW A;  1LEB A;  2DAO A;  4UVC A;  1ON1 A;  2BBY A;  4IRH A;  2VE8 A;  4GXO A;  5K5Q A;  3LFK A;  3CUQ A;  1BJA A;  1TBX A;  4HA8 A;  2O6G E;  1HKT A;  4IXA A;  2XAJ A;  2RVC A;  3KP2 A;  5FGM A;  3LAJ A;  5E17 F;  2Z99 A;  3E5U A;  3P9K A;  5IT9 Z;  4RB3 C;  1YW9 A;  2A6E F;  3FM3 A;  2QYO A;  3QU6 A;  4RAZ A;  3F22 A;  4U0V A;  3E6D A;  1IRG A;  2FML A;  1ZYR F;  2UXN A;  3CDH A;  4DQ2 A;  2CG4 A;  4OOI A;  3WGI A;  2E1N A;  1D3Y A;  1KU7 A;  2UWM A;  2DBB A;  3SZP A;  1YLF A;  2Y0M A;  2MLG A;  3BP8 A;  3OV8 A;  5IT3 A;  1K78 A;  2PBI A;  3J7A O;  4RGX A;  2J5P A;  1G3T A;  4JBA A;  2XGX A;  1TQM A;  3ABT A;  2WC2 A;  2ZME A;  2VON A;  2EFN A;  1SD6 A;  4Y15 A;  1FX7 A;  1S29 A;  2ZCW A;  1HST A;  3R0A A;  3K1P A;  4RGR A;  1KU3 A;  2EFP A;  1MJA A;  4KIB A;  3S2W A;  4FT8 A;  3HOS A;  4BHB A;  3TQN A;  2ACJ A;  2H6B A;  2CWE A;  3RIR A;  3F3X A;  4ASN A;  2A5Y B;  2W24 A;  1W7P B;  1IXR C;  1ZHF A;  3C7J A;  5J8F A;  5LHG A;  3L2C A;  1FBU A;  2ZO4 A;  3WE2 A;  1T39 A;  3ZMT A;  3E3V A;  5DYM A;  3LWF A;  5BOX A;  4HOB A;  3WTV C;  1HW2 A;  4MQV A;  3JAM K;  1H9G A;  1XDU A;  2HS5 A;  2YX7 A;  5L3F A;  1XMK A;  2XAH A;  2EV6 A;  4GGG A;  1MJB A;  4FHT A;  1G3Y A;  1U6G A;  3PQJ A;  3P7N A;  5ICC A;  3EYY A;  3OOP A;  1IF1 A;  3F21 A;  1F5T A;  5E8I A;  4HV5 A;  1A04 A;  2A69 F;  3TGN A;  2F5E A;  4U88 A;  2OD5 A;  3ULQ B;  1Q1H A;  4EGY A;  1HQC A;  2FNP A;  2IA2 A;  3EQL F;  4WXH A;  3DPT A;  3JAM Z;  3ZN1 A;  2CSO A;  3M7G A;  3HRS A;  1PP8 F;  3ZN0 A;  2VOO A;  1MGT A;  4HZF A;  1FOK A;  4H0E A;  1S7A A;  4M6Y A;  4LD5 A;  1G6N A;  4HBL A;  4IVN A;  1MDM B;  1BC8 C;  1U5T C;  1LB2 A;  1BOA A;  3BRO A;  3D5L A;  1STZ A;  3G73 A;  2P4W A;  2V1U A;  2FEZ A;  1ZGJ A;  1H9T A;  1ULY A;  3TO9 A;  1IW7 F;  4CHU A;  2FBH A;  2ESH A;  3CO7 C;  2L01 A;  4I0B A;  4B8X A;  5E1W A;  2M8E A;  2QBY B;  3MCZ A;  3FWE A;  3L9F A;  5TJJ A;  3DQV C;  2XRN A;  1HW5 A;  3EET A;  5LRS A;  4L0Y B;  4WX9 A;  2LF7 A;  4IRG A;  1RZ4 A;  2TDX A;  2CGP A;  1TQP A;  4RGS A;  3QRF F;  3K0L A;  3RKW A;  2PMH A;  3K2Z A;  2OBP A;  4TV7 A;  1QZY A;  4A6D A;  5F1R A;  5LGT A;  5CVU A;  1JE8 A;  4P55 A;  1TTY A;  1BI2 A;  1IN5 A;  3I0T A;  4LB6 B;  2DPU A;  4YFX F;  3I59 B;  3WTY C;  1FWZ A;  1ZAR A;  4HX8 A;  4KNY A;  2XUB A;  3DPL C;  4LLL A;  1TW3 A;  1FP2 A;  3TDU C;  2M87 A;  1OR7 A;  1YS7 A;  3E97 A;  5DCM A;  4B09 A;  1E2X A;  3R60 A;  3V7R A;  3KE2 A;  3V7C A;  4KDP A;  4I01 A;  3U9G A;  2XAQ A;  5DD8 A;  2F5F A;  3IC7 A;  3MWM A;  3CUQ C;  4Q47 A;  3I53 A;  2YPR A;  4EVI A;  1CGP A;  1B1B A;  2OA4 A;  1W5S A;  3ZMD A;  1O7F A;  1XD7 A;  3EUH A;  3F72 A;  3GFJ A;  3WTZ A;  1T6S A;  5D5U B;  1T98 A;  2HTS A;  3O3K A;  3RYR A;  4KA4 A;  3QOP A;  2GWR A;  4D0P A;  3IHU A;  4EGZ A;  2EA2 A;  2VC1 A;  3RKX A;  1QQI A;  1UHM A;  3NQO A;  2Z9O A;  1Z91 A;  1K6O A;  1GXP A;  1Z6R A;  3I54 A;  4G7H F;  2HYG D;  4CXF A;  2NNN A;  4Z2Y A;  4HX4 A;  4KMU X;  2QZ8 A;  3FM5 A;  4PDK A;  5E18 F;  4LB5 A;  4LMY A;  1VTN C;  5DCF A;  4MEX F;  5D4S A;  2RGV A;  5D5V B;  3C18 A;  2Z5U A;  1Z05 A;  5ILU A;  1GXQ A;  3SZT A;  1ZG5 A;  3WTW C;  3GLX A;  2ZKZ A;  4XSX F;  2KJB A;  5BQT A;  5FD5 A;  1KYZ A;  1R58 A;  3QAH A;  1GHC A;  5LEJ A;  3LA3 A;  1FNN A;  3HOT A;  3WGH A;  4O3M A;  4OIN F;  1PDN C;  4MEY F;  1RI7 A;  1SMT A;  2ZFW A;  1ZG1 A;  1XGS A;  2FNA A;  2HOE A;  4K2E A;  4EM0 B;  2A07 F;  1WWX A;  1YFH A;  1W5T A;  1IN6 A;  3RJP A;  2LSO A;  1J59 A;  2LNB A;  2O03 A;  3LQR A;  2DU9 A;  1I6X A;  1J75 A;  2JRT A;  4I98 B;  1G4D A;  3JW4 A;  4P9F A;  5CVR A;  1BC7 C;  4AVP A;  3K69 A;  3KEO A;  3HRT A;  2FQ3 A;  2QUF A;  2M5W A;  4LG0 A;  3R4K A;  3TKY A;  3IKT A;  3WOD F;  4P5O A;  1FYM A;  2JTV A;  2NRA C;  4IHS A;  1X3U A;  3F8B A;  1HW1 A;  3M9A A;  1ODD A;  4LK0 F;  2YU3 A;  2VXZ A;  4FX0 A;  2W85 A;  3KP6 A;  5LGN A;  4HDV A;  1FPQ A;  3D0S A;  2DW4 A;  4A0Z A;  2Q0O A;  1U8R A;  2BYV E;  3WE3 A;  4ZYE A;  2EA4 A;  4HLX A;  4EV0 A;  2E7W A;  5L3B A;  4KYW A;  3KZZ A;  1S3J A;  2QQB A;  2QEN A;  4N0B A;  3G3Z A;  4I7H A;  2PLY A;  4O5V A;  1S7O A;  3N4M A;  4RB2 C;  2DO7 A;  4M9Z A;  2X4H A;  4P96 A;  4KUM A;  2ADU A;  2NNY A;  1BM9 A;  3WGG A;  3WTT C;  1FSH A;  5K1Y A;  4AD9 A;  1D5V A;  2L4M A;  2JT1 A;  1V3F A;  3R0J A;  4EMS A;  2IP2 A;  3R6S A;  2VT2 A;  4N9I A;  1ZLJ A;  1Z9C A;  1BN5 A;  5EEG A;  2DPD A;  3ABU A;  3B73 A;  5D5X B;  3WU0 A;  2PMU A;  3HIF A;  4KFC A;  3RTR A;  3V8J A;  5HS7 A;  5LEK A;  2K27 A;  3F8C A;  1XDS A;  3C3W A;  3H3Z A;  1J9I A;  4WF2 A;  3LST A;  3BJA A;  1I1S A;  3KCC A;  2HWV A;  1FYL A;  5LGU A;  3HYI A;  1U5T B;  1F9N A;  4YG2 F;  1ZN2 A;  2VBY A;  1IRF A;  4HAM A;  4ZH4 F;  3MQ0 A;  5BMZ A;  3P9C A;  2Y48 A;  1YYV A;  4HDU A;  2VBW A;  2HR3 A;  4AIH A;  4HYE A;  4L9J A;  1XGO A;  3V8L A;  2EV5 A;  1ZRD A;  1I27 A;  4OIP F;  1D8K A;  5K5O A;  5CLS A;  4IPA A;  3ECO A;  4KIG A;  3MEX A;  5BS6 A;  3FMS A;  2VT3 A;  3F8F A;  3IL2 A;  1ZH5 A;  1KQ8 A;  2FU4 A;  4HF0 A;  3T0Y A;  1KA8 A;  4ESF A;  4BNC A;  4CGZ A;  4IF4 A;  3JSO A;  1P92 A;  5FB2 A;  5H6Q A;  4ETS A;  1USS A;  2XKO A;  2GA1 A;  4M9S A;  1XGM A;  4ENN A;  4L9T A;  3T1B A;  3V4G A;  5A2Q K;  2GZW A;  2YR2 A;  2KJC A;  2HEO A;  3I64 A;  2XKP A;  1R00 A;  1XCV A;  3MZH A;  2XVC A;  1R1U A;  2P7C B;  3B02 A;  4AWX B;  3EYI A;  2FMY A;  1FC3 A;  3CUQ B;  4RGU A;  2ZBK A;  1S6L A;  2EV0 A;  2UXX A;  1DPU A;  4CIC A;  2OQG A;  4G6Q A;  5L3G A;  2J5O A;  1DPR A;  2CO5 A;  1BI0 A;  3GYH X;  1QGP A;  5A2Q Z;  5LLQ A;  1I1G A;  1FBS A;  4LGW A;  1FBQ A;  1QO0 D;  2P5L C;  1SD5 A;  4OIO F;  3NRV A;  3Q5F A;  1P2F A;  2OZU A;  2QQA A;  2ISZ A;  3TOB A;  4A0Y A;  5LHI A;  3HSF A;  2ETH A;  4UV9 A;  4OU0 A;  3COA C;  1XSV A;  2D45 A;  1O3S A;  2D2W A;  5J8C A;  2MBF A;  2A68 F;  3ML6 A;  2H94 A;  3WTU C;  4DNC A;  3WU1 B;  1K78 B;  2PEX A;  1BIB A;  3ECH A;  2HGC A;  2ZME B;  4IHT A;  1G3W A;  2EFO A;  5CVJ A;  5LBQ A;  3HHG A;  3PFI A;  1XGN A;  5FFZ A;  1U3E M; 
#chains in the Genus database with same CATH topology
 3CD6 I;  3WTX C;  3HG9 A;  4BHC A;  4X6A J;  3M1E A;  2Y0S N;  3H5R A;  2O61 A;  3GEZ A;  4UUT A;  3DF8 A;  3FBI B;  1UCR A;  4HX7 A;  3S1N J;  5D8K B;  3J7Z I;  1MD0 A;  1WHU A;  1WJD A;  2GXG A;  3VSL A;  2K7L A;  2YSR A;  1AOY A;  1MBF A;  1WCM J;  1E17 A;  1OMI A;  3B6A A;  1IRX A;  2L4A A;  5K7Z A;  5HOO A;  4UHT A;  1OYY A;  5GAE J;  1XSX A;  3VPR A;  2R7F A;  1SMY F;  4DJA A;  3R61 A;  4MFD A;  1X2N A;  3T8R A;  4XM3 A;  5L3D A;  2M0C A;  4L0Z B;  2IA1 A;  3GO5 A;  2B0L A;  2UZK A;  1TW2 A;  3GLL A;  1HXD A;  3IH2 A;  1YE9 A;  4DIQ A;  2M8G X;  2VKD A;  2Z3Y A;  3RQ4 A;  1K4S A;  1WJ5 A;  4YIF A;  5ILV A;  1VND A;  1J09 A;  5E1Z B;  1PUE E;  2EFW A;  4JX6 A;  1UJ8 A;  3QPL A;  2BEO A;  3I4M J;  5JVG F;  3UR3 C;  4L5J A;  3GUD A;  2WAQ N;  5K5R A;  2ZXI A;  2XB5 A;  4NC7 A;  2WV1 A;  4L9N A;  2K3P A;  2L3D A;  4KN7 X;  3RPU A;  1MMN A;  1Y1W J;  1N77 A;  1FJL A;  3CCY A;  4G6D A;  2GIZ A;  1Y8Q B;  2K9M A;  4IHW A;  2X6Y A;  2RN7 A;  2QCO A;  4B43 A;  2YUS A;  3E0J B;  4MQ9 F;  4F7Z A;  1MBG A;  4XN0 A;  2WV0 A;  2RC4 A;  5L3C A;  1DDN A;  4JQF A;  1J5Y A;  1P7I A;  2HKX A;  2MC3 A;  2XAG A;  1AWC A;  3BR3 A;  1MW7 A;  3A1Y A;  1KU2 A;  2W57 A;  2ISY A;  1XMA A;  3W2V A;  3DFG A;  2LFB A;  2D1V A;  1ORK A;  3OYG A;  2EH3 A;  4F92 B;  2JK3 A;  4ESB A;  3I56 I;  2G7H A;  4D7M A;  1TLH B;  2AXT C;  5E3L A;  4LLN A;  2BGC A;  3DV8 A;  1Q1V A;  3BR5 A;  2R7T A;  3CTA A;  2EPF A;  2V4J C;  1T95 A;  4QWQ A;  3TW7 A;  1A6Q A;  3JRH A;  4M3E A;  4XIC A;  3ZMZ A;  3GZ6 A;  3HHH A;  1HLV A;  3CCQ I;  2IS1 A;  3SDB A;  2VQC A;  5J1U A;  2PMZ N;  3CDI A;  1V4R A;  2JUC A;  1CF7 A;  1YIO A;  2VKH A;  3CP8 A;  4I99 C;  4A12 A;  1WSU A;  3I71 A;  2XF6 A;  1QU3 A;  3QP6 A;  1UB9 A;  4A2U A;  2JA5 J;  5AON A;  1FP1 D;  2E1O A;  2LBF A;  3CUO A;  5JHU A;  1X19 A;  2XB0 X;  1LDJ A;  1W4M A;  2HZT A;  3DTK A;  1GV2 A;  3HRM A;  1YW8 A;  3FK6 A;  1MSE C;  5LHH A;  2HDD A;  1JUS A;  3FXU A;  1IN7 A;  3NAR A;  4XKV A;  3ELK A;  3VYU B;  1V54 H;  3ZQI A;  1HOM A;  1SAN A;  3GME A;  3A01 A;  1B59 A;  1YRN A;  2ZSH B;  1RNL A;  2CQX A;  3A4C A;  1HA8 A;  4IQJ A;  3G4S I;  1UZC A;  2MFZ A;  3F8M A;  5DV5 A;  3TDZ C;  4QLC U;  3QOD A;  1KYW A;  4YIR X;  2FE3 A;  3GFL A;  2JVG A;  2H1K A;  4IRI A;  1LJ9 A;  3GTO J;  4G7Z F;  5CVI A;  2CW0 F;  1M1E B;  1WJB A;  2MD5 A;  3QYB A;  1JHH A;  1ZTR A;  2EIK H;  3LSM A;  4DBR A;  1XSD A;  1JJ6 C;  3MVP A;  1K6Y A;  2BXY A;  4HQM A;  1QPM A;  5KK1 A;  2IT0 A;  4EJT A;  4EJV A;  4Z6Y A;  1SAU A;  3AG1 H;  3IKV A;  2E1M C;  4M72 A;  2GBY A;  2IS6 A;  3RZD J;  2MYS A;  2K4J A;  3U2R A;  1ZR4 A;  2V1D A;  5FLM J;  2XAU A;  5IYD J;  5DUK A;  1OJL A;  2L7M P;  5DUI A;  1MJ9 A;  3AG3 H;  3RPU D;  3BZK A;  2L02 A;  1ZG3 A;  3BPX A;  3MD2 A;  2CJJ A;  3FZV A;  3FX3 A;  3T8T A;  2ZJR F;  5KHD A;  1PJR A;  3VFZ A;  2E1C A;  5E3O A;  4R79 A;  4RAY A;  2KKO A;  5FJ8 J;  2W84 A;  3NWT A;  5EEH A;  4JOM A;  4KMF A;  4L5I A;  2HFH A;  5DTD A;  1HKS A;  1ETO A;  2CFO A;  4A6E A;  2IS2 A;  4B1R A;  2LY1 A;  1O3R A;  4WK8 F;  1YO5 C;  4Y17 A;  1R4M B;  3HM5 A;  2KQR A;  1RR8 C;  1T0F A;  3UNG C;  4ABZ A;  1RPW A;  1IAW A;  2QQ8 A;  2K5C A;  1HDP A;  4GO1 A;  1P6R A;  4U0Y A;  4HNU A;  3H9G A;  3RPQ A;  3Q9V A;  1LFU P;  2NOG A;  1X2M A;  3S1M J;  3FMQ A;  1ETY A;  3G1O A;  4AYB N;  5HLG A;  1IXC A;  3PNY A;  4ZYA A;  3MKL A;  2V79 A;  2O8X A;  3C2B A;  4UY8 I;  1X1C A;  5DCM B;  3CDL A;  5H6R A;  2XIG A;  2STT A;  1MBH A;  3K4B A;  2W4S A;  3JTH A;  1NH3 A;  3CCU I;  5ERI A;  1PUF B;  3GZN B;  2XV4 S;  5GAG J;  5CVV A;  4Y13 A;  3E6C C;  4Q5S F;  3H35 A;  1I50 J;  4OIQ F;  2CYY A;  3JSP A;  3FXQ A;  3OY9 A;  2HI3 A;  1T2K A;  3FXR A;  2JQ7 A;  3U1D A;  3HUG A;  4EEF G;  1EH8 A;  1WQ2 A;  2VBX A;  5EG0 A;  5HS9 A;  1UFM A;  3S16 J;  3GVA A;  3I5U A;  3VB2 A;  1X1D A;  2DFF A;  3ZQ7 A;  3SXY A;  2I5U A;  1LKX A;  4CCL A;  3J80 K;  2XDV A;  5BPD A;  2BE5 F;  2EBI A;  4IKF A;  1QZZ A;  2EB7 A;  1FSE A;  2P6S A;  2M30 A;  2W25 A;  2F6C A;  2ZNY A;  2H1L A;  2BHY A;  5J4V A;  4ZYH A;  1JTY A;  3L7W A;  4N4N B;  5JLW A;  2C6Y A;  2EWN A;  1PP7 U;  2MH9 A;  5DEQ A;  1VQ7 I;  2DLL A;  5CJ9 A;  1AKH B;  1CQT A;  1LFP A;  3EUK L;  3KLN A;  2M45 A;  2F2E A;  4UVA A;  3GW2 A;  2R7U A;  2HOS A;  1XCB A;  4AIJ A;  3F6V A;  2F5V A;  3PQK A;  1IC8 A;  3W6J B;  2ZJ2 A;  3IH3 A;  2AS5 F;  2OZ6 A;  1ENH A;  2Y69 H;  5C4J J;  3D5R C;  1O4X A;  2LP0 A;  2DT7 B;  3ROU A;  1POG A;  2E36 A;  1Y6I A;  6PAX A;  4ZYG A;  1YIT I;  2JA2 A;  4YEL A;  3CMM A;  3ZMU A;  2ESN A;  1R5I D;  1JKR C;  3J80 Z;  1BBY A;  2KZG A;  2LVS A;  2MH2 A;  3BCB A;  3HTS B;  2FRH A;  4FX4 A;  3QOE A;  4HQE A;  4G94 A;  2V1X A;  2R7Q A;  3CME I;  1LQ1 A;  3IH4 A;  1ETK A;  3FXK A;  1F4K A;  3CLQ A;  4ZC3 A;  4BAY A;  1UG2 A;  2GAU A;  4N9H A;  4U7B A;  4XLF A;  2HTJ A;  3E6M A;  4BU2 A;  4EQQ A;  3CJT B;  2CV0 A;  1R7J A;  4C3H J;  4O6J A;  1EKE A;  2O0Y A;  3BQY A;  2HVR A;  1MZB A;  2NAZ A;  3HGY A;  5ICF A;  3QPH A;  2DA3 A;  1TNS A;  3KP3 A;  4IL6 C;  3SEZ A;  1D0X A;  4V19 K;  3GTJ J;  3P9I A;  3SFZ A;  2H6C A;  5HVQ C;  2G7U A;  2LC2 A;  2VBZ A;  2K9S A;  3OIQ A;  1LNW A;  2KT0 A;  3DP7 A;  1W7P A;  2X1C A;  4LFU A;  2QM3 A;  4F3Q A;  3TED A;  5L3E A;  4IQ4 A;  3OSF A;  1J0R A;  3F6O A;  4UNO A;  3PO3 J;  5FKO A;  2H27 A;  2R7D A;  4KJZ A;  3N97 A;  3AAF A;  1K7A A;  4ZZL A;  4IZZ A;  4PUS A;  2LRD A;  4AVZ A;  4G7O F;  2JPB A;  2MD0 A;  2Z33 A;  3DCF A;  3VEP A;  2OU2 A;  5HDK A;  2QLZ A;  3VOE A;  1FYK A;  4IHX A;  3KP4 A;  1B8I A;  3HC7 A;  1R22 A;  2XAF A;  4CO8 A;  2WB1 A;  3BDD A;  3HSE A;  3KYD B;  5IOY A;  1LEA A;  4ESJ A;  1AU7 A;  3IV5 A;  1GV5 A;  3FK7 A;  2OUM A;  1VF9 A;  1IDY A;  5DM6 F;  5IY5 H;  2EIN H;  1K79 A;  3H36 A;  4NQW A;  1JHF A;  4CCJ A;  3ISP A;  5LFA A;  3CCS I;  4LG0 B;  5HDG A;  2NOJ B;  4KN4 X;  3E5X A;  3IWF A;  4M6X A;  2JZY A;  4BL0 B;  1WRJ A;  3A2K A;  2YX4 A;  3CLO A;  1FIP A;  3BG3 A;  3GFI A;  4IOA F;  4G12 A;  4BJ6 C;  3RKQ A;  4R1H A;  5AIP A;  1X1P A;  2Q8K A;  2HNH A;  1XB4 A;  3WHB A;  2XC7 A;  2VXD A;  1DP7 P;  1ITY A;  2JPC A;  3K2A A;  4AIK A;  4OAZ A;  2LD5 A;  3LSK A;  1IXS B;  1B9N A;  5LRR A;  3DKW A;  1R4N B;  5EZG A;  2IGM A;  2OJE D;  4HRI A;  4XKC A;  3RDI A;  4XSZ F;  1T38 A;  1RUN A;  4CZZ A;  3K10 A;  5HOD A;  3JRA A;  2GXB A;  2EK5 A;  2LKS A;  3OS1 A;  1I3Q J;  2H09 A;  3OL3 A;  5HNH A;  1MND A;  3GBG A;  4D9J A;  1OYI A;  3ZMV A;  2P5V A;  4G9Y A;  2IPQ X;  1R49 A;  3KET A;  2XPU A;  4ENK A;  4J01 A;  1MDM A;  4B47 A;  4L9V A;  2W7N A;  3GTK J;  5HLT A;  2G9W A;  2L54 A;  2CMP A;  2VE9 A;  2EFQ A;  3EUH C;  3M8E A;  5B5E C;  3H92 A;  4C30 A;  2A61 A;  1QNT A;  3TW6 A;  2MW8 A;  5GP9 A;  5JVT A;  3L2Q A;  1D8J A;  3KEQ A;  3OSG A;  3IWZ A;  1W0T A;  2CUE A;  1EH6 A;  2LMD A;  5K7F A;  3LQQ A;  3SJM A;  2PFB A;  2LK2 A;  4HG2 A;  1GVD A;  4DZP A;  5D4R A;  4RS8 A;  1W7P D;  4FET A;  1Y39 A;  3H5A A;  4R8H A;  5ILS A;  3H0D A;  3Q9S A;  3VOD A;  3S14 J;  4XLH A;  2QSH X;  2Q2E A;  1J2X A;  3L2U A;  2NS0 A;  4XOT A;  1SFU A;  3BY6 A;  2QBY A;  1RUO A;  1YQA A;  1Z7U A;  3VYT B;  3BJ6 A;  5FO5 A;  5FD6 A;  3S15 J;  2LKX A;  2QWW A;  4M6V A;  3K6G A;  1OKR A;  4LLG F;  3F8N A;  2X0L A;  1HF0 A;  3HKZ N;  5GTI C;  1KU9 A;  3CP2 A;  3ZQQ A;  2KIF A;  1G3S A;  4GYG A;  2EZL A;  2ELH A;  3BPV A;  1HDD C;  3ZCO A;  3GF2 A;  2E7X A;  3OIO A;  5FLV A;  2YS9 A;  4QTR A;  4L5E A;  3G1L A;  4EJO A;  2M0M A;  1WVR A;  1DQU A;  5F0F A;  3DXJ F;  4HF2 A;  1O7L A;  1XN7 A;  5B66 C;  4XID A;  2HQA A;  4B3X A;  2PQ8 A;  1REP C;  3TBI A;  5ICE A;  2E5N A;  4CCK A;  2OV7 A;  3O2P E;  4UUS A;  2CQN A;  2X51 A;  3LFU A;  4YFK F;  1IRZ A;  3S3M A;  4DYC A;  4I09 A;  3I59 A;  1U78 A;  3KIO A;  3LNQ A;  2WTE A;  4PCQ A;  1Z1D A;  2L7K A;  2DFI A;  4M74 A;  1BI1 A;  4XLA A;  1SFE A;  1E0E A;  1B8I B;  3CF2 A;  2V9P A;  1O57 A;  1VQ8 I;  1HCR A;  2CFX A;  1LDD A;  2RNJ A;  3K9T A;  2DI3 A;  1E3O C;  1RC9 A;  5D5W B;  2F4M B;  3ZRG A;  2A6H F;  1T0F C;  2ZFU A;  3MKW B;  4C2M J;  5KAI C;  3FMR A;  3MZY A;  5JR3 A;  2BW3 B;  2PJP A;  2KPM A;  1DUX C;  3WHC A;  4OAY A;  1ZRF A;  2Y75 A;  1YS6 A;  4V2F A;  3GTQ J;  1QHH D;  1RET A;  2DK5 A;  1RRJ A;  1B4A A;  5FLX K;  2QQ9 A;  5E20 A;  2CQK A;  4BDY A;  2MLK A;  1YG2 A;  1TWG J;  2XHK A;  2PG4 A;  3T5X A;  3DLL F;  1RIO H;  1KQ0 A;  1LDK B;  3HXL A;  4EJU A;  1HKQ A;  3KEY A;  3E5Q A;  2GQQ A;  1B9M A;  2OF7 A;  5C44 J;  3HOX J;  5H2F C;  2GA2 A;  4ZZD A;  2DA7 A;  2VJ4 A;  3ZGK A;  4RMN A;  2L0K A;  1YTY A;  2AXL A;  2XPV A;  1SAX A;  4XRS G;  5E3M A;  1JJ8 C;  2K4B A;  3K4C A;  2NVT J;  4C2T A;  2HYJ A;  4ON0 A;  2EJR A;  4IX7 A;  2DTR A;  1I5Z A;  3DEU A;  4GCV A;  3JTG A;  1ZGW A;  2VOD A;  2IVM A;  2IGO A;  2HVS A;  2FOK A;  4WWC A;  2E1M B;  3A0H C;  4BBR J;  4S0H B;  2DXI A;  2LKP A;  1DGW Y;  3GWZ A;  4MHG A;  1MNM C;  5E79 C;  2GIV A;  5H20 A;  3IAS 2;  2KIM A;  1IGN A;  1O3T A;  1IUF A;  3F23 A;  3FDY A;  3ZPL A;  1QZE A;  5FLX Z;  2BV6 A;  4U7D A;  3RKY A;  1SD4 A;  3Q0U A;  4QIW N;  5DDG A;  3HSR A;  3TL4 X;  3HB9 A;  2K86 A;  4L18 B;  1R1V A;  1Z77 A;  1Y0U A;  2BHZ A;  4ZDP A;  4E7Z A;  4WCG A;  2F4O B;  4FCY A;  1B6A A;  4U87 A;  5EGO B;  4BS9 A;  2GM4 A;  2IJL A;  2OCE A;  1U2W A;  2LDU A;  1LE8 A;  3CC7 I;  1SD7 A;  4Q4Z F;  2FA5 A;  4LIT A;  3X2Q H;  2DQR A;  3JRE A;  2MSY A;  4C3J J;  4GFB A;  1YHQ I;  3BQZ A;  3BTC A;  4OMY A;  2IEK A;  2V9V A;  3DBR B;  3B6C A;  4G6T B;  3KPH A;  4LIV A;  4S04 A;  5D8L B;  5EDN A;  5BPI A;  1TNT A;  1ZAO A;  3UKG A;  4BXF A;  3Q0W A;  2L5Q A;  4XQF A;  3K7A J;  2L7F P;  1QVT A;  3CCL I;  3GX4 X;  2KZV A;  2STW A;  3WG9 A;  2DT5 A;  3KFW X;  1NK3 P;  1RES A;  4AC0 A;  4IEJ A;  4B48 A;  4BYY A;  1KQ9 A;  2HZD A;  3P5J A;  1HBX G;  1R23 A;  1E3P A;  2EIJ H;  3OWT A;  4E70 A;  3WTS C;  3JR9 A;  4OMZ A;  4A3C J;  2NVY J;  1TQI A;  1Z6T A;  4BHP A;  5J6X A;  2P6T A;  1C0W A;  5JI6 A;  5E1X A;  2IW5 A;  4M71 A;  3CCJ I;  4U0W A;  1F36 A;  2DK8 A;  4IJA A;  4ENJ A;  1LVK A;  3OYK A;  3J7A Y;  3V8K A;  3ZR8 X;  4DYR A;  4XR6 A;  2VJ5 A;  2YU9 J;  2A3S A;  2XRO A;  2P8T A;  3HRU A;  4LK1 F;  4ENM A;  4HW0 A;  2OTJ I;  2AQF A;  5F6F A;  3O8G A;  1JKQ C;  3V7S A;  3GZ5 A;  4I2O A;  2VN2 A;  1X1A A;  4CH7 A;  5J1R A;  2XSJ C;  3CJR B;  2COM A;  1EA3 A;  2K9N A;  4A5M A;  1D0Y A;  3DEW A;  3M8J A;  4EJW A;  4Y7N J;  1Y56 A;  2VC0 A;  1TWA J;  3M1C A;  2QVO A;  2TCT A;  2V6C A;  2IRF G;  1XC5 A;  4CCO A;  3OS2 A;  4UXN A;  1A31 A;  3PUB A;  1XX5 A;  1MIJ A;  1R1T A;  3ESW B;  4XLN F;  3RYP A;  1U8B A;  4E7J A;  4XRM A;  3CQZ J;  1R6R A;  2JSC A;  4PFP A;  3FXM A;  4UUV A;  2XF7 A;  3LA2 A;  1O3Q A;  2RDP A;  2JA7 J;  2NXN B;  1PVE A;  2VOP A;  4OIR F;  4RBO A;  1FZP B;  2P0W A;  2KDZ A;  4HF1 A;  5TRD A;  1JGS A;  2CU7 A;  3TP0 A;  1ZGA A;  4G8X A;  2PN6 A;  4EM2 A;  3PO2 J;  4HV6 A;  3SZG A;  4CZC A;  5D6F A;  5DD4 A;  4M3D A;  1DU6 A;  3OMY A;  4KIT B;  2WWY A;  2KIS A;  3L2W A;  2R3S A;  3M8F A;  3OYL A;  1TWC J;  3QU3 A;  3K1M A;  2BY0 A;  2BVM A;  4NC8 A;  4CDG A;  2KIU A;  1OPC A;  3L00 A;  5ED4 A;  5JLX A;  1TWF J;  1T8I A;  1KGS A;  3EPZ A;  4E7K A;  1FLI A;  1A35 A;  1HSJ A;  3D5S C;  2VPR A;  3DU5 A;  4MTE A;  3JRG A;  3BZ6 A;  3O8H A;  5FFX A;  1B72 B;  4BEH A;  4BQN A;  3E6B A;  3RQI A;  2E71 A;  3BWG A;  3VSK A;  4XLP F;  1ON2 A;  1WFX A;  2O3F A;  4YII A;  1ZRC A;  2PJR B;  4F55 A;  3W6V A;  1ONV A;  5F64 A;  4MNU A;  3ZQH A;  1OCT C;  1NHA A;  2MA3 A;  1IN8 A;  5C3E J;  2QF7 A;  4BH9 A;  3EUA A;  2Y9Y A;  2NVU B;  2CQ7 A;  2IBD A;  3TO7 A;  3ERE D;  2JA6 J;  2QKL B;  2JRM A;  2MG4 A;  4M3B A;  1ZRE A;  2F5C A;  2JN6 A;  3BG5 A;  3KLO A;  4EAT A;  4XRF A;  3JRD A;  1HC8 A;  2HQN A;  3O6B B;  4CYD A;  4RB1 A;  1VQO I;  4BAC A;  1SEU A;  4FQG A;  5KVR A;  1Z3X A;  5HLI A;  1APL C;  4PZJ A;  5C4X J;  5JFR A;  1W0U A;  1FT9 A;  1FOW A;  3RI4 A;  4MTD A;  1R5G A;  1R9T J;  4A0X A;  3ZMS A;  5KNL A;  3ASN H;  9ANT A;  3HGG A;  4CYC A;  3HDD A;  4XBF A;  2XGD A;  1OCZ H;  3DBH B;  4Q48 A;  4P9U A;  2KIQ A;  2V26 A;  1JXS A;  3HTU A;  1W36 C;  1U0J A;  1R36 A;  3OR2 C;  4BJT A;  2HQ5 A;  4BXU A;  4Y52 J;  2D1H A;  2WBM A;  2HQR A;  2FBI A;  5CQE A;  2ME6 A;  3W2A A;  1SFK A;  3L09 A;  5EEA A;  1OYW A;  1D1C A;  2ICW G;  2O7O A;  4BKX A;  1EJ9 A;  4A3J J;  3AG2 H;  2DDA A;  4M73 A;  4I0A A;  1IDZ A;  2M7A A;  4B4C A;  3MKY B;  4A3F J;  3AFH A;  1RKT A;  4PGH A;  3PIP F;  3OYE A;  3HPH A;  4XRS A;  2HYF A;  2HKO A;  2XGE A;  2FF4 A;  3J81 K;  4Y4R A;  3MFK A;  3N05 A;  1VZ0 A;  3L2R A;  2L7Z A;  1S5L C;  4PJJ A;  3L1P A;  2HVQ A;  1DP3 A;  1L0O C;  2BY1 A;  2GLO A;  2H8W A;  1ETX A;  2Y0S A;  4EM1 A;  4LJZ F;  2F5D A;  3LSI A;  1Z67 A;  2P7V B;  2DMU A;  2OQR A;  4HLY A;  2M34 A;  5HLH A;  2CW7 A;  1YX3 A;  3KZY A;  2QKM B;  2JWT A;  3BT9 A;  3BG6 A;  4JK1 X;  4RM3 A;  2JJ7 A;  3REO A;  1A36 A;  4XK4 A;  5AIQ A;  2EZI A;  2M1B A;  2UUZ A;  2DQL A;  3GXO A;  4UV8 A;  4DOZ A;  3CJN A;  3TO6 A;  1IN4 A;  2KRF A;  3U1K A;  1SFX A;  5HDN A;  4E7H A;  2P5K A;  2K02 A;  2MGQ A;  4HST A;  4WXC A;  3V42 A;  1WJF A;  3OYB A;  3FXJ A;  3FF5 A;  1AHD P;  1VQP I;  1S8N A;  2IGK A;  3ZQF A;  2CV1 A;  2ZXJ A;  3CO6 C;  2FD5 A;  1BI3 A;  3IUO A;  2DA6 A;  3J81 Z;  4WXD A;  1ZLK A;  2LY9 A;  1P4X A;  1U5T A;  3I9V 2;  2WAQ A;  3JRB A;  3MMY B;  4KT5 C;  3FHZ A;  1FOX A;  4AU7 A;  2PI0 A;  1CF7 B;  1F1Z A;  2VQH A;  4MGR A;  4BBS J;  3I4P A;  4KIC A;  1ETV A;  3TOA A;  5IPA A;  2QSF X;  3IRR A;  2R7W A;  2LBF B;  4GYI A;  4A69 C;  4BUP A;  2E19 A;  3EDP A;  2VL8 A;  2XSD C;  5D6E A;  2IA0 A;  4E4H A;  2EIL H;  1VQ6 I;  2W00 A;  1WKM A;  4PJ0 C;  1L3L A;  1FY7 A;  3OIP A;  4NHJ A;  3OOU A;  4RB0 A;  1XTA A;  3LA7 A;  1UST A;  1IUY A;  3A0B C;  1WI9 A;  5E8G A;  2ID3 A;  2RKH A;  3SHF A;  3A01 B;  2LG4 A;  3H3U A;  3M3Y J;  4JP0 A;  1YRN B;  2B7E A;  4M9X A;  1I3A A;  1J7K A;  4CUG A;  4D5F A;  4YFN F;  3MAJ A;  3IRQ A;  3KP5 A;  1H8A C;  1LVA A;  2DA1 A;  1IZ1 A;  4XKW A;  4XLE A;  1QBJ A;  4B44 A;  3Q0V A;  2KL4 A;  3K4N A;  3PSF A;  2QEX I;  1R5H A;  1EH7 A;  1UHW A;  2E34 A;  4I02 A;  3GFM A;  2DDB A;  2V6E A;  2PMZ A;  4S05 A;  5CKT A;  1RKW A;  2KP6 A;  2NYX A;  3LAP A;  1PYV A;  2R7V A;  2OAZ A;  3SQN A;  1VQM I;  2RQQ A;  2FOW A;  2COB A;  1T33 A;  2EIM H;  2M2E A;  1P4W A;  1YW7 A;  4A5N A;  2LOO A;  4BQA A;  1VQ5 I;  1BIA A;  3HOZ J;  1FTT A;  1EV7 A;  3C1D A;  1U9O A;  1P4A A;  3BC8 A;  3KP7 A;  3NEU A;  2RQP A;  4KIS A;  4NNJ A;  4KIF A;  2FBK A;  1VQN I;  4DW6 A;  2ZXW H;  2DOE A;  3BJO A;  4RAF A;  1H0M A;  3ZP5 A;  5HS8 A;  2VPL A;  2HDC A;  2A05 A;  4UVB A;  3I58 A;  5IT9 K;  4MFE A;  4PSX A;  2LF8 A;  3S2H J;  1G8X A;  4C3I J;  3A02 A;  1MKM A;  2AQE A;  5CQG A;  2KDO A;  2LRE A;  3LL7 A;  3QP5 A;  1LPQ A;  4PGG A;  1GVJ A;  1JGG A;  5J40 A;  1X4O A;  5CYV A;  1X4P A;  3QPT A;  4NB5 A;  1TC3 C;  5F04 A;  3W6K B;  2FXA A;  3BOQ A;  1U9N A;  5ICG A;  2DJI A;  3K1N A;  2RV8 A;  2R0Q C;  2XAS A;  3AKZ A;  1MH4 A;  2R7X A;  2ZNZ A;  1D1B A;  4ZYD A;  3BG7 A;  2FSW A;  1LEB A;  1SC7 A;  2DAO A;  2EZK A;  3K4M A;  5EZH A;  3ERM A;  4UVC A;  1ON1 A;  5FKK A;  2BBY A;  4IRH A;  2VE8 A;  4GXO A;  5K5Q A;  3LFK A;  3CUQ A;  1BJA A;  1MMG A;  1A5J A;  2DOA A;  1TBX A;  1V55 H;  4HA8 A;  2O6G E;  2WAF A;  2FJ1 A;  1HKT A;  1MBJ A;  1JT6 A;  4IXA A;  2JMW A;  2XAJ A;  2RVC A;  1S9H A;  4XKB A;  2B63 J;  2WY7 Q;  3KP2 A;  5FGM A;  3LAJ A;  3G6E I;  5E17 F;  5IOZ A;  2Z99 A;  4KT6 A;  2OCC H;  3E5U A;  4XNF A;  2CS3 A;  2V1N A;  2VI6 A;  1D1A A;  2VJJ A;  4AM3 A;  3P9K A;  2DT6 A;  3LSG A;  5IT9 Z;  5B3S H;  2TRT A;  3HUG B;  3FXO A;  2HPI A;  4RB3 C;  2CRG A;  1ETW A;  1YW9 A;  5EG0 B;  2A6E F;  2RNG A;  1WH7 A;  3FM3 A;  2QYO A;  4BDZ A;  1TT5 B;  3QU6 A;  4RAZ A;  3F22 A;  4U0V A;  2CUF A;  3E6D A;  1IRG A;  2ZJQ F;  2FML A;  5M5W J;  1ZYR F;  2UXN A;  4AYB A;  2X85 A;  3RSN A;  3MKZ A;  2VQL A;  3CDH A;  4DQ2 A;  4XMY A;  2CG4 A;  3ABK H;  3BTJ A;  3DKY A;  3OL4 A;  4OOI A;  3OYN A;  3WGI A;  2LYC A;  4HNV A;  2DYS H;  4II2 A;  1FEX A;  2R5Y A;  3WG7 H;  2E1N A;  2O8K A;  1SVM A;  2DMQ A;  3QYE A;  2VLA A;  5KCM A;  1D3Y A;  1KU7 A;  2UWM A;  2DBB A;  2AHQ A;  3ZXS A;  3SZP A;  3HL2 A;  3H9J A;  5IYB J;  1YLF A;  2Y0M A;  2MLG A;  3PIO F;  3BP8 A;  3OV8 A;  3DKX A;  2KRC A;  3FKJ A;  5IT3 A;  3ONQ A;  2MAB A;  1K78 A;  2PBI A;  3ABM H;  5CPR B;  3CCE I;  3J7A O;  4F93 B;  4A93 J;  4A3M J;  4RGX A;  4DBQ A;  2DA5 A;  2J5P A;  3TP3 A;  1G3T A;  4JBA A;  2XGX A;  4X1E A;  1S72 I;  1TQM A;  2R5Z A;  3ABT A;  2R7Z J;  1I39 A;  1FMV A;  2WC2 A;  4DGW B;  2ZME A;  1JKP C;  2VON A;  2DJN A;  2EFN A;  1NG7 A;  1SD6 A;  1FOY A;  4C2U A;  4Y15 A;  1FX7 A;  1S29 A;  4ZDL A;  2ZCW A;  1LUJ B;  1HST A;  1OCO H;  4PFO A;  4ZJZ A;  3R0A A;  3K1P A;  4RGR A;  3F0C A;  1KU3 A;  1FMW A;  2EFP A;  1MJA A;  4KIB A;  3S2W A;  4FT8 A;  3HOS A;  4BHB A;  3FIW A;  3K4K A;  3TQN A;  3FBN B;  2D5V A;  2ACJ A;  2H6B A;  1MBE A;  3WU2 C;  2CWE A;  3RIR A;  3F3X A;  4ASN A;  2A5Y B;  2NVX J;  1XS9 A;  2W24 A;  2G0E A;  1W7P B;  5JHF A;  1IXR C;  1ZHF A;  1S7E A;  3C7J A;  2ECB A;  2BOL A;  1Z3Y A;  1OQY A;  5J8F A;  5LHG A;  1V5E A;  3L2C A;  1NK2 P;  1ERD A;  1FBU A;  2ZO4 A;  2Y9Z A;  3LOC A;  3WE2 A;  1T39 A;  3ASO H;  3ZMT A;  3E3V A;  5DYM A;  3HZJ A;  3LWF A;  3BTL A;  5BOX A;  1TWH J;  1UG0 A;  4HOB A;  3WTV C;  1HW2 A;  2VKE A;  4MQV A;  4NDL A;  3JAM K;  1K83 J;  1H9G A;  1FTZ A;  1XDU A;  2HS5 A;  3BR1 A;  2YX7 A;  5L3F A;  3PUF A;  4RA2 A;  2Y31 A;  1XMK A;  2XAH A;  3OYH A;  4RM2 A;  4FE7 A;  2H8R A;  1BR4 A;  2EV6 A;  4GGG A;  1MJB A;  4FHT A;  1G3Y A;  2Y2Z A;  4E7I A;  5DM7 F;  1U6G A;  3PQJ A;  2QA4 I;  4NQW B;  1MH3 A;  3H9Q A;  3P7N A;  5ICC A;  3EYY A;  3OOP A;  1IF1 A;  3F21 A;  2B9S A;  2X6O A;  5DS9 A;  1BA5 A;  1F5T A;  3FXL A;  5E8I A;  2X1D A;  4HV5 A;  1A04 A;  2A69 F;  3TGN A;  2DMN A;  2F5E A;  5BNG A;  4U88 A;  2OD5 A;  3ULQ B;  1X1B A;  1Q1H A;  2R7R A;  1P7J A;  3PFY A;  1YX5 A;  1HQC A;  2FNP A;  5IP7 J;  4EGY A;  2IA2 A;  3IP4 B;  3HBL A;  3EQL F;  4WXH A;  3DPT A;  3L2V A;  2ELJ A;  3JAM Z;  1IV8 A;  3C2G A;  3ZN1 A;  4XN3 A;  2CSO A;  2EQR A;  4BQQ A;  3M7G A;  3HRS A;  1PP8 F;  2K40 A;  2KLO A;  2RRE A;  1MMA A;  3ZN0 A;  4IOC F;  3I55 I;  3KX2 A;  4IHV A;  2VOO A;  1MGT A;  3GTL J;  4HZF A;  3E7L A;  1FOK A;  1RR7 A;  4H0E A;  1S7A A;  4J19 A;  3RZO J;  4M6Y A;  3M4O J;  4LD5 A;  2DOF A;  3OR1 C;  1G6N A;  4HBL A;  4IVN A;  1MDM B;  1BC8 C;  2KRH A;  1U5T C;  5J3L A;  1LB2 A;  1BOA A;  3BRO A;  3D5L A;  1STZ A;  3G73 A;  2P4W A;  2V1U A;  2FEZ A;  1XG1 A;  1ZGJ A;  3D1N I;  1H9T A;  1P9Q C;  3S1R J;  1OFC X;  2DYR H;  4NC6 A;  1YJN I;  3LSJ A;  1ULY A;  1IJW C;  3CZ6 A;  3TO9 A;  1IW7 F;  4CHU A;  4RLF A;  4LIU A;  2FBH A;  2ESH A;  3CO7 C;  2L01 A;  1WPK A;  4E6K G;  1YIJ I;  4I0B A;  4B8X A;  5E1W A;  2M8E A;  2Q2E B;  1KON A;  2QBY B;  4NUB A;  4ITV A;  3MCZ A;  3FWE A;  2L2O A;  3L9F A;  4JX5 A;  3QPS A;  3W2W A;  5FKN A;  5TJJ A;  1UEL B;  2WY8 Q;  3DQV C;  2EZH A;  2KFD A;  1SVO A;  2HPM A;  2XRN A;  1HW5 A;  3EET A;  3G2B A;  4CSW A;  5LRS A;  5LD2 C;  4L0Y B;  4WX9 A;  2XPW A;  2M4G A;  2HXI A;  2LF7 A;  3BG9 A;  1RZ4 A;  4IRG A;  1QHG A;  4HNT A;  5M3F J;  4BQO A;  2TDX A;  3FIS A;  5GPC A;  1TQP A;  2CGP A;  4RGS A;  4JYK A;  3QRF F;  3H3V K;  2DOD A;  1SVL A;  3K0L A;  1GDT A;  3W3C A;  3NWS A;  2DFH A;  3RKW A;  2PMH A;  3K2Z A;  2WAE A;  2OBP A;  2WA0 A;  2Y30 A;  2CUZ A;  1X3W B;  4TV7 A;  1QZY A;  4A6D A;  3BTI A;  4BJ5 C;  5F1R A;  3H0G J;  5LGT A;  1ZEL A;  4UB6 C;  4UUS B;  5CVU A;  3S2D J;  3HPG A;  1XPX A;  1JE8 A;  4P55 A;  1IN5 A;  1BI2 A;  1TTY A;  2K3F A;  3I0T A;  4LB6 B;  2DPU A;  4YFX F;  3I59 B;  3E1S A;  3WTY C;  5M5Y J;  2QSG X;  1FWZ A;  1ZAR A;  4HX8 A;  4KNY A;  2A6T A;  3HKZ A;  2W48 A;  2XUB A;  5K7H A;  3DPL C;  4LLL A;  1D0Z A;  1TW3 A;  3G1M A;  1NTC A;  1FP2 A;  4XOP A;  4I6Z A;  1GUU A;  1MNE A;  3AG4 H;  3TDU C;  1D5Y A;  2M87 A;  5IYC J;  1OR7 A;  1YS7 A;  3E97 A;  4RLQ A;  3MN2 A;  5DCM A;  4B09 A;  5HNF A;  4A3I J;  3HOV J;  4A3L J;  1WJA A;  4D7N A;  4FE4 A;  1E2X A;  2R4G A;  3R60 A;  1JKO C;  3LMM A;  3JRF A;  3V7R A;  3KE2 A;  3V7C A;  1ZQ3 P;  4KDP A;  2W82 A;  1PUF A;  4I01 A;  3U9G A;  2XAQ A;  2VKV A;  4AUX A;  2XRL A;  5DD8 A;  4A3G J;  2F5F A;  3IC7 A;  3MWM A;  2FQ4 A;  1QRY A;  3CUQ C;  4Q47 A;  4CCM A;  3I53 A;  4GRI A;  2YPR A;  2ZC2 A;  1Z21 A;  4EVI A;  3BR2 A;  3JCU C;  4A3E J;  1CGP A;  1B1B A;  3PL8 A;  1Z7L A;  4A3B J;  1OCC H;  1WZ2 A;  2OA4 A;  3ZQC A;  1W5S A;  5GTH C;  3ZMD A;  1WGX A;  1W5C C;  3S3O A;  3GTG J;  1O7F A;  1XD7 A;  3EUH A;  3F72 A;  2V9K A;  3GFJ A;  3WTZ A;  4OWR B;  3GTM J;  1T6S A;  5D5U B;  1T98 A;  2HTS A;  3O3K A;  2ELK A;  3RYR A;  4KA4 A;  3QOP A;  5FKL A;  2GWR A;  3CC4 I;  4D0P A;  3IHU A;  4QPQ A;  1V5F A;  2M9H A;  3VWB A;  4EGZ A;  4CA0 A;  2EA2 A;  2VC1 A;  3RKX A;  1QQI A;  1UHM A;  1AKH A;  3NQO A;  4BY1 J;  5F27 A;  2Z9O A;  1Z91 A;  2VQG A;  1K6O A;  1GXP A;  1Z6R A;  2IXS A;  3I54 A;  4GDF A;  1I6H J;  2BVL A;  2HU9 A;  2DMT A;  4G7H F;  2HYG D;  2UV1 A;  2XF5 A;  4CXF A;  2NNN A;  4Z2Y A;  1Y8R B;  4HX4 A;  4KMU X;  2X9D A;  1W1W E;  2QZ8 A;  5F0C A;  3FM5 A;  3K4L A;  4PDK A;  2K9Q A;  5E18 F;  4X0G A;  1LE8 B;  4LB5 A;  4LMY A;  2Z1D A;  1VTN C;  2X1E A;  5DCF A;  2RAE A;  4MEX F;  5D4S A;  3OYA A;  2RGV A;  2ID6 A;  4PK4 A;  1BR1 A;  5D5V B;  3C18 A;  3RCO A;  2Z5U A;  2CW8 A;  1Z05 A;  1WI3 A;  2LH9 A;  1IG7 A;  5ILU A;  3SEQ A;  1GXQ A;  3S17 J;  3SZT A;  1ZG5 A;  3K4J A;  3WTW C;  3GLX A;  2ZKZ A;  3DWL E;  3KYC B;  4XSX F;  2KJB A;  5BQT A;  3M07 A;  5FD5 A;  5TGT A;  1KYZ A;  1BOB A;  4NBQ A;  3S8P A;  2F48 A;  2BY2 A;  1R58 A;  3QAH A;  1GHC A;  2WB1 N;  5LEJ A;  1N75 A;  1BR2 A;  5F08 A;  3S93 A;  3LA3 A;  1FNN A;  3OYM A;  2X48 A;  3HOT A;  3WGH A;  3CF5 F;  4O3M A;  4OIN F;  1PDN C;  2ZME C;  4M3G A;  4MEY F;  1RI7 A;  1KZH A;  1AA7 A;  3HOY J;  1SMT A;  2ZFW A;  1ZG1 A;  1XGS A;  3PSI A;  4J00 A;  2FNA A;  2E35 A;  1ZR2 A;  1Z0X A;  2VB6 A;  2HOE A;  4K2E A;  4DZJ A;  4EM0 B;  3SDG A;  2A07 F;  1WWX A;  1YFH A;  4FIS A;  4AID A;  3JRI A;  2I10 A;  2JVH A;  1W5T A;  1IN6 A;  1OLT A;  3RJP A;  2LSO A;  4C9Y A;  4PJN A;  2DA4 A;  4PJL A;  3CMA I;  5EJC A;  1J59 A;  1BW6 A;  2LNB A;  2O03 A;  1XMX A;  1TT0 A;  2DU9 A;  2NS7 A;  3DEE A;  3FKI J;  3LQR A;  1I6X A;  1J75 A;  3H1C A;  2JRT A;  4I98 B;  2N8G A;  1WJC A;  1G4D A;  3JW4 A;  3NAU A;  4Y3O A;  4P9F A;  5CVR A;  5F1J A;  3GCM A;  3OYC A;  1BC7 C;  4AVP A;  3K69 A;  1Y0N A;  1DGR M;  2FUG 2;  3KEO A;  3HRT A;  2FQ3 A;  2DCE A;  2QUF A;  2O9L A;  2M5W A;  2PX9 A;  4LG0 A;  3R4K A;  3TKY A;  3IKT A;  1ETQ A;  3WOD F;  4P5O A;  4IO9 F;  1FYM A;  2JTV A;  2NRA C;  4IHS A;  4II3 A;  1JT0 A;  3OYJ A;  1X3U A;  2FX0 A;  5GAD J;  2I8D A;  3CC2 I;  1BJZ A;  2V7F A;  2VAS A;  3F8B A;  1HW1 A;  3M9A A;  2HXO A;  1ODD A;  2DN0 A;  4LK0 F;  3HOU J;  2YU3 A;  3CCV I;  1YJW I;  1YOV B;  2VXZ A;  2ZXH A;  4FX0 A;  3CCR I;  2W85 A;  4YRV A;  2CUJ A;  3KP6 A;  3QYF A;  5LGN A;  2ZSI B;  4HDV A;  4ANJ A;  1FPQ A;  4BEH B;  3CCM I;  3D0S A;  2DW4 A;  1VQL I;  4PJM A;  2OPT A;  4E7L A;  4A0Z A;  2Q0O A;  2L9V A;  3JRC A;  2K85 A;  2F4I A;  1U8R A;  2BYV E;  2L9R A;  2Q1Z B;  3WE3 A;  4ZYE A;  4JX4 A;  3A03 A;  2EA4 A;  4HLX A;  4BGD A;  5FRN A;  1A6I A;  3LSR A;  4EV0 A;  3HEF A;  1H88 C;  3PNT A;  2E7W A;  3CJQ B;  5L3B A;  4BE1 A;  1IV6 A;  4QSH A;  4KYW A;  3Q3S A;  3KZZ A;  3PM1 A;  1GT0 C;  3SYT A;  3H5N A;  1QPI A;  2NVQ J;  1S3J A;  3K70 D;  2QQB A;  2QEN A;  3ZQG A;  4N0B A;  4CYC B;  3S3N A;  3G3Z A;  2HOT A;  4I7H A;  2CV2 A;  4FAS D;  2AO9 A;  1OCP A;  2PLY A;  3DU6 A;  4O5V A;  1K4T A;  2ZJP F;  2R93 J;  1S7O A;  3N4M A;  1VQ9 I;  4P1W A;  4RB2 C;  2GOX B;  2DO7 A;  2E5Z A;  4M9Z A;  2X4H A;  3F9K A;  4MLO A;  1WH5 A;  4HEA 2;  2WAD A;  5J1Y A;  4P96 A;  4KUM A;  1QVU A;  4N4O B;  2BXZ A;  2ADU A;  4Y33 A;  2NNY A;  3QQA A;  1BM9 A;  3WGG A;  3WTT C;  4E7S A;  1FSH A;  5K1Y A;  1MSF C;  1ZK8 A;  5IP9 J;  3OYD A;  3PJR A;  1R71 A;  4M3F A;  4AD9 A;  1N25 A;  1D5V A;  2L4M A;  2JT1 A;  2OC6 A;  1V3F A;  1T56 A;  2VIX A;  3R0J A;  2E60 A;  4EMS A;  2E2J J;  2IP2 A;  2OTL I;  4V2G A;  3R6S A;  3BR0 A;  3OYF A;  2VT2 A;  3AL0 B;  4N9I A;  1ZLJ A;  4QPO A;  1Z9C A;  1BN5 A;  5EEG A;  2DPD A;  3ABU A;  1Y1V J;  3B73 A;  2ZB9 A;  5D5X B;  3WU0 A;  2PMU A;  3HIF A;  2BZT A;  4KFC A;  3RTR A;  1T08 B;  2M3A A;  3V8J A;  5HS7 A;  5LEK A;  2K27 A;  3F8C A;  1XDS A;  2MC4 A;  3C3W A;  3H3Z A;  1J9I A;  4WF2 A;  1JUM A;  3LST A;  3I3L A;  3BJA A;  1TL8 A;  1I1S A;  2CH0 A;  4XL9 A;  2W1O A;  3KCC A;  2HWV A;  1BL0 A;  2BW3 A;  1FYL A;  5LGU A;  3HYI A;  3HJE A;  1U5T B;  1SFO J;  1F9N A;  1TZL A;  4YG2 F;  1ZN2 A;  1BW5 A;  2R7S A;  5M3M J;  2VBY A;  4YEJ A;  1IRF A;  4HAM A;  1QA6 A;  3DBL B;  4ZH4 F;  4ZTF A;  1OR7 C;  1NG6 A;  3MQ0 A;  5BMZ A;  3P9C A;  4LG3 A;  4D1Q A;  2Y48 A;  1OCR H;  1YYV A;  1UMQ A;  5GAH J;  3OYI A;  4HDU A;  1X58 A;  2VBW A;  2HR3 A;  3SFI A;  3FHN A;  4AIH A;  4HYE A;  1FIA A;  4L9J A;  1XGO A;  2ME0 A;  3V8L A;  2EV5 A;  1ZRD A;  1I27 A;  1OIS A;  4OIP F;  1D8K A;  5K5O A;  2P81 A;  5CLS A;  4BE0 A;  4UB8 C;  5IP6 A;  4IPA A;  3ECO A;  4KIG A;  5FRO A;  3MEX A;  5BS6 A;  2O5R A;  3FMS A;  4LOC A;  1WJE A;  1ZKG A;  2VUM J;  2VT3 A;  1MBK A;  2JUG A;  4ZTJ A;  3F8F A;  3IL2 A;  2QGU A;  2M4K A;  1ZH5 A;  2KHM A;  2HOA A;  1KQ8 A;  1MMD A;  4F52 A;  2FU4 A;  4HF0 A;  3T0Y A;  1N78 A;  3S1Q J;  1JTX A;  5EGO A;  3TMO A;  1KA8 A;  2LTP A;  3QWL A;  4ESF A;  4BNC A;  4CGZ A;  3ZOB A;  3GTP J;  2M7B A;  4A3D J;  4RDU A;  4DYQ A;  4IF4 A;  3JSO A;  1P92 A;  4CCN A;  3S32 A;  1IO2 A;  5FB2 A;  5H6Q A;  3KZI C;  4ETS A;  4XOR A;  4D5C A;  1K61 A;  4XLC A;  1USS A;  2XKO A;  3HOW J;  2GA1 A;  2R7O A;  1XGM A;  4M9S A;  1JUP A;  4ENN A;  1E3H A;  3J7Y J;  4L9T A;  2VJI A;  4RAG A;  3T1B A;  3V4G A;  3LSP A;  5A2Q K;  2ECC A;  2GZW A;  2YR2 A;  3I4N J;  4BY7 J;  4F91 B;  1EF4 A;  1G2H A;  3ZQL A;  2KJC A;  4W1U A;  5FRM A;  3C2H A;  2HEO A;  3I64 A;  2XKP A;  1R00 A;  4FTH A;  1VFC A;  1XCV A;  3MZH A;  5EYR A;  2XVC A;  2GXA A;  1VI0 A;  1R1U A;  2P7C B;  2CQQ A;  2IGN A;  3ABL H;  3B02 A;  4XON A;  4AWX B;  4ZDO A;  1JI8 A;  3VYR B;  2DMP A;  3EYI A;  2R92 J;  1X3Z B;  2FMY A;  3VDX A;  1FC3 A;  5F0H A;  3CUQ B;  2Z16 A;  2ZBK A;  3DPU A;  4RGU A;  1S6L A;  5J47 A;  2EV0 A;  4HPQ A;  2IAI A;  5TIS C;  2KMU A;  2UXX A;  1DPU A;  2DFE A;  2HDW A;  1DU0 A;  4CIC A;  4MO7 A;  2OQG A;  4G6Q A;  3BLY A;  3PNV A;  4B3A A;  3K70 C;  3U21 A;  5L3G A;  3KYL A;  2J5O A;  3G71 I;  1DPR A;  2CO5 A;  2IS4 A;  2BY3 A;  5B1B H;  4IHY A;  1BI0 A;  1F43 A;  1LFB A;  2K9L A;  2L9S A;  1QGP A;  5A2Q Z;  3GYH X;  3AL0 C;  2JSP A;  5EF6 A;  1VQK I;  1G59 A;  5LLQ A;  4I76 A;  3LSH A;  2JA8 J;  4MIM A;  1I1G A;  1TP4 A;  1V5G A;  1FBS A;  4HSR A;  4LGW A;  3BZC A;  1FBQ A;  1VQ4 I;  3BCA A;  2E2I J;  1QO0 D;  3DTE A;  2P5L C;  1SD5 A;  1MMS A;  4OIO F;  2Z2S B;  3NRV A;  3Q5F A;  1P2F A;  5FKM A;  3OS0 A;  2OZU A;  2QQA A;  2ISZ A;  3TOB A;  2LR8 A;  1W36 D;  2GOM A;  4A0Y A;  4BE2 A;  2NS8 A;  5LHI A;  1UAA A;  5M5X J;  3HSF A;  1H89 C;  2ETH A;  2A5W A;  2DTZ A;  2L9N A;  5GPA A;  2R5Y B;  4A3K J;  2E2H J;  4UV9 A;  4OU0 A;  3COA C;  2LY2 A;  2LLK A;  1XSV A;  3CMY A;  2D45 A;  2X6W A;  3DLA A;  1YJ9 I;  4W97 A;  3MZ8 A;  1O3S A;  1B72 A;  2D2W A;  5J8C A;  2MBF A;  2PJR A;  2A68 F;  1ACI A;  5KAF C;  1GLN A;  3CES A;  3ML6 A;  2H94 A;  5B1A H;  3WTU C;  3DTI A;  4DNC A;  3WU1 B;  1UHS A;  1K78 B;  4H4K C;  2XGC A;  2PEX A;  1BIB A;  4BXX J;  2R5Z B;  2DA2 A;  3ECH A;  1YI2 I;  2HGC A;  3BR6 A;  3IAM 2;  2ZME B;  4IHT A;  1G3W A;  2EFO A;  5CVJ A;  5LBQ A;  5E3N A;  2X6X A;  4PSW A;  3HHG A;  3VYS B;  5J4Y A;  3PFI A;  1XGN A;  5FFZ A;  1U3E M; 
#chains in the Genus database with same CATH homology
 3WTX C;  4BHC A;  3M1E A;  2O61 A;  3GEZ A;  3DF8 A;  1UCR A;  4HX7 A;  5D8K B;  1MD0 A;  2GXG A;  2K7L A;  2YSR A;  1AOY A;  1E17 A;  1OMI A;  2L4A A;  5HOO A;  4UHT A;  1OYY A;  1XSX A;  2R7F A;  1SMY F;  3R61 A;  3T8R A;  5L3D A;  4L0Z B;  2IA1 A;  3GO5 A;  2B0L A;  2UZK A;  1TW2 A;  1HXD A;  2Z3Y A;  4YIF A;  5ILV A;  5E1Z B;  1PUE E;  2EFW A;  2BEO A;  4L5J A;  3GUD A;  5K5R A;  4L9N A;  2L3D A;  4KN7 X;  3RPU A;  4G6D A;  2RN7 A;  4MQ9 F;  4F7Z A;  5L3C A;  2WV0 A;  2RC4 A;  1DDN A;  4JQF A;  1J5Y A;  2HKX A;  2MC3 A;  2XAG A;  1AWC A;  1KU2 A;  2W57 A;  2ISY A;  1XMA A;  3DFG A;  2D1V A;  4ESB A;  2G7H A;  1TLH B;  4LLN A;  2BGC A;  3DV8 A;  3CTA A;  4QWQ A;  3ZMZ A;  3GZ6 A;  3HHH A;  1V4R A;  1CF7 A;  1YIO A;  4A12 A;  1WSU A;  3I71 A;  3QP6 A;  1UB9 A;  4A2U A;  5AON A;  1FP1 D;  3CUO A;  5JHU A;  1LDJ A;  1W4M A;  2HZT A;  3HRM A;  1YW8 A;  5LHH A;  3FXU A;  1IN7 A;  3ELK A;  1B59 A;  1RNL A;  3F8M A;  5DV5 A;  4QLC U;  3TDZ C;  1KYW A;  2FE3 A;  3GFL A;  4IRI A;  1LJ9 A;  4G7Z F;  5CVI A;  2CW0 F;  2MD5 A;  1JHH A;  1XSD A;  5KK1 A;  4HQM A;  1QPM A;  2IT0 A;  4EJT A;  4EJV A;  3IKV A;  4M72 A;  2K4J A;  3U2R A;  2V1D A;  5DUK A;  5DUI A;  1MJ9 A;  2L02 A;  1ZG3 A;  3BPX A;  3FZV A;  3FX3 A;  3T8T A;  3VFZ A;  2E1C A;  4R79 A;  4RAY A;  2KKO A;  2W84 A;  5EEH A;  4KMF A;  4L5I A;  2HFH A;  1HKS A;  4A6E A;  1O3R A;  4WK8 F;  1YO5 C;  4Y17 A;  1T0F A;  1IAW A;  4GO1 A;  1P6R A;  4U0Y A;  3RPQ A;  3Q9V A;  3FMQ A;  5HLG A;  1IXC A;  2V79 A;  2O8X A;  5DCM B;  5H6R A;  2XIG A;  2STT A;  3JTH A;  5ERI A;  2XV4 S;  5CVV A;  4Y13 A;  3E6C C;  4Q5S F;  4OIQ F;  2CYY A;  3JSP A;  3FXQ A;  1T2K A;  3FXR A;  3U1D A;  3HUG A;  1EH8 A;  1WQ2 A;  2VBX A;  5HS9 A;  1UFM A;  3GVA A;  3I5U A;  3VB2 A;  3ZQ7 A;  3SXY A;  3J80 K;  5BPD A;  2BE5 F;  1QZZ A;  2EB7 A;  1FSE A;  2P6S A;  2M30 A;  2W25 A;  2ZNY A;  4ZYH A;  3L7W A;  2C6Y A;  2EWN A;  1PP7 U;  2MH9 A;  5DEQ A;  2DLL A;  5CJ9 A;  3KLN A;  2M45 A;  2F2E A;  4UVA A;  3GW2 A;  1XCB A;  4AIJ A;  3F6V A;  3PQK A;  3W6J B;  2ZJ2 A;  2AS5 F;  2OZ6 A;  3ROU A;  6PAX A;  4ZYG A;  3ZMU A;  2ESN A;  3J80 Z;  1BBY A;  2MH2 A;  3HTS B;  2FRH A;  4FX4 A;  4HQE A;  4G94 A;  2V1X A;  1LQ1 A;  1F4K A;  4BAY A;  2GAU A;  4U7B A;  4N9H A;  2HTJ A;  3E6M A;  4EQQ A;  1R7J A;  4O6J A;  2O0Y A;  1MZB A;  2NAZ A;  5ICF A;  3QPH A;  1TNS A;  3KP3 A;  3P9I A;  3SFZ A;  2H6C A;  5HVQ C;  2G7U A;  2VBZ A;  1LNW A;  3DP7 A;  1W7P A;  4LFU A;  2QM3 A;  5L3E A;  1J0R A;  3F6O A;  4UNO A;  2H27 A;  2R7D A;  3N97 A;  3AAF A;  1K7A A;  4ZZL A;  4G7O F;  2JPB A;  2Z33 A;  3VEP A;  2OU2 A;  5HDK A;  2QLZ A;  3VOE A;  1FYK A;  3KP4 A;  1R22 A;  2XAF A;  4CO8 A;  3BDD A;  3HSE A;  1LEA A;  4ESJ A;  1K79 A;  4NQW A;  1JHF A;  3ISP A;  4LG0 B;  5HDG A;  4KN4 X;  3E5X A;  3IWF A;  4M6X A;  2JZY A;  1WRJ A;  2YX4 A;  3CLO A;  3GFI A;  4R1H A;  5AIP A;  2Q8K A;  1XB4 A;  1DP7 P;  2JPC A;  4AIK A;  1IXS B;  1B9N A;  5LRR A;  3DKW A;  3RDI A;  1T38 A;  4XSZ F;  1RUN A;  4CZZ A;  2GXB A;  2EK5 A;  2H09 A;  1OYI A;  3ZMV A;  2P5V A;  4G9Y A;  2IPQ X;  3KET A;  4ENK A;  1MDM A;  4L9V A;  2G9W A;  2L54 A;  2VE9 A;  2EFQ A;  3M8E A;  3H92 A;  2A61 A;  1QNT A;  5JVT A;  1D8J A;  3KEQ A;  3IWZ A;  1EH6 A;  3LQQ A;  2PFB A;  5D4R A;  4RS8 A;  1W7P D;  4R8H A;  5ILS A;  3Q9S A;  3VOD A;  2Q2E A;  1J2X A;  2NS0 A;  1SFU A;  3BY6 A;  2QBY A;  1RUO A;  1YQA A;  1Z7U A;  3BJ6 A;  5FO5 A;  5FD6 A;  2QWW A;  1OKR A;  4LLG F;  3F8N A;  2X0L A;  1KU9 A;  2KIF A;  1G3S A;  4GYG A;  2ELH A;  3BPV A;  3GF2 A;  2E7X A;  4EJO A;  3DXJ F;  4HF2 A;  1O7L A;  1XN7 A;  2PQ8 A;  1REP C;  5ICE A;  3O2P E;  4YFK F;  4I09 A;  3I59 A;  1U78 A;  2WTE A;  4PCQ A;  1Z1D A;  2DFI A;  4M74 A;  1BI1 A;  1SFE A;  1O57 A;  2CFX A;  1LDD A;  2RNJ A;  3K9T A;  2DI3 A;  5D5W B;  2A6H F;  3FMR A;  3MZY A;  5JR3 A;  2PJP A;  1DUX C;  1ZRF A;  2Y75 A;  1YS6 A;  2DK5 A;  1B4A A;  5FLX K;  2QQ9 A;  5E20 A;  2CQK A;  2MLK A;  1YG2 A;  2XHK A;  2PG4 A;  3T5X A;  1RIO H;  1KQ0 A;  1LDK B;  4EJU A;  1HKQ A;  3E5Q A;  2GQQ A;  1B9M A;  2GA2 A;  4ZZD A;  1YTY A;  2AXL A;  1SAX A;  2K4B A;  4ON0 A;  2EJR A;  2DTR A;  1I5Z A;  3DEU A;  4GCV A;  3JTG A;  2VOD A;  2IVM A;  2FOK A;  4WWC A;  2LKP A;  3GWZ A;  4MHG A;  2GIV A;  5H20 A;  2KIM A;  1O3T A;  3F23 A;  3ZPL A;  5FLX Z;  2BV6 A;  4U7D A;  3RKY A;  1SD4 A;  5DDG A;  3HSR A;  2K86 A;  4L18 B;  1R1V A;  1Y0U A;  4WCG A;  1B6A A;  2IJL A;  1U2W A;  2LDU A;  1SD7 A;  4Q4Z F;  2FA5 A;  2DQR A;  4OMY A;  2V9V A;  4S04 A;  5D8L B;  5BPI A;  1TNT A;  1ZAO A;  3GX4 X;  2STW A;  3WG9 A;  2DT5 A;  3KFW X;  4BYY A;  1KQ9 A;  1HBX G;  1R23 A;  4E70 A;  3WTS C;  4OMZ A;  1TQI A;  1Z6T A;  4BHP A;  5J6X A;  2P6T A;  1C0W A;  5JI6 A;  5E1X A;  2IW5 A;  4M71 A;  4U0W A;  2DK8 A;  4IJA A;  4ENJ A;  3V8K A;  2A3S A;  2XRO A;  2P8T A;  3HRU A;  4ENM A;  4LK1 F;  4HW0 A;  5F6F A;  3V7S A;  3GZ5 A;  4I2O A;  2VN2 A;  2COM A;  4A5M A;  4EJW A;  2VC0 A;  2QVO A;  2V6C A;  2IRF G;  4UXN A;  4XLN F;  1R1T A;  3RYP A;  2JSC A;  4UUV A;  1O3Q A;  3LA2 A;  2RDP A;  2VOP A;  4OIR F;  1FZP B;  4HF1 A;  5TRD A;  1JGS A;  1ZGA A;  4G8X A;  2PN6 A;  4EM2 A;  4HV6 A;  5D6F A;  5DD4 A;  2WWY A;  2R3S A;  3M8F A;  3QU3 A;  3K1M A;  4CDG A;  2KIU A;  1OPC A;  3L00 A;  5ED4 A;  1KGS A;  1FLI A;  1HSJ A;  4MTE A;  3BZ6 A;  5FFX A;  3E6B A;  3BWG A;  4XLP F;  1ON2 A;  2O3F A;  4YII A;  1ZRC A;  1ONV A;  5F64 A;  4MNU A;  1NHA A;  2MA3 A;  1IN8 A;  4BH9 A;  3ERE D;  3TO7 A;  1ZRE A;  2F5C A;  3KLO A;  4XRF A;  2HQN A;  3O6B B;  4CYD A;  4RB1 A;  5KVR A;  5HLI A;  4PZJ A;  5JFR A;  1FT9 A;  3RI4 A;  4MTD A;  1R5G A;  4A0X A;  3ZMS A;  4XBF A;  4Q48 A;  4P9U A;  1JXS A;  3HTU A;  1R36 A;  4BXU A;  2D1H A;  2HQR A;  2FBI A;  3L09 A;  1OYW A;  4M73 A;  4I0A A;  4PGH A;  2HYF A;  2HKO A;  2FF4 A;  3J81 K;  3MFK A;  1L0O C;  4EM1 A;  4LJZ F;  2F5D A;  2P7V B;  2OQR A;  4HLY A;  5HLH A;  3KZY A;  4JK1 X;  3REO A;  5AIQ A;  2M1B A;  2DQL A;  3GXO A;  4UV8 A;  3CJN A;  3TO6 A;  1IN4 A;  2KRF A;  1SFX A;  5HDN A;  2P5K A;  2K02 A;  4WXC A;  3FF5 A;  1S8N A;  2ZXJ A;  3CO6 C;  1BI3 A;  3J81 Z;  4WXD A;  1ZLK A;  1P4X A;  1U5T A;  4KT5 C;  3FHZ A;  2PI0 A;  1CF7 B;  1F1Z A;  4MGR A;  3I4P A;  4KIC A;  3TOA A;  3IRR A;  4GYI A;  3EDP A;  5D6E A;  2IA0 A;  1WKM A;  1L3L A;  1FY7 A;  4NHJ A;  4RB0 A;  3LA7 A;  1UST A;  1IUY A;  1WI9 A;  5E8G A;  2RKH A;  3SHF A;  3H3U A;  4M9X A;  1J7K A;  4YFN F;  3MAJ A;  3IRQ A;  3KP5 A;  1LVA A;  1IZ1 A;  1QBJ A;  1R5H A;  1EH7 A;  1UHW A;  4I02 A;  3GFM A;  4S05 A;  3LAP A;  2NYX A;  2OAZ A;  3SQN A;  1P4W A;  1YW7 A;  4A5N A;  4BQA A;  1BIA A;  1EV7 A;  3C1D A;  1P4A A;  3KP7 A;  3NEU A;  2RQP A;  4KIF A;  2FBK A;  3BJO A;  1H0M A;  3ZP5 A;  5HS8 A;  2HDC A;  4UVB A;  3I58 A;  5IT9 K;  2LF8 A;  1MKM A;  3QP5 A;  4PGG A;  1GVJ A;  5CYV A;  3QPT A;  4NB5 A;  3W6K B;  2FXA A;  3BOQ A;  5ICG A;  3K1N A;  2RV8 A;  2XAS A;  2ZNZ A;  4ZYD A;  2FSW A;  1LEB A;  2DAO A;  4UVC A;  1ON1 A;  2BBY A;  4IRH A;  2VE8 A;  4GXO A;  5K5Q A;  3LFK A;  3CUQ A;  1BJA A;  1TBX A;  4HA8 A;  2O6G E;  1HKT A;  4IXA A;  2XAJ A;  2RVC A;  3KP2 A;  5FGM A;  3LAJ A;  5E17 F;  2Z99 A;  3E5U A;  3P9K A;  5IT9 Z;  4RB3 C;  1YW9 A;  2A6E F;  3FM3 A;  2QYO A;  3QU6 A;  4RAZ A;  3F22 A;  4U0V A;  3E6D A;  1IRG A;  2FML A;  1ZYR F;  2UXN A;  3CDH A;  4DQ2 A;  2CG4 A;  4OOI A;  3WGI A;  2E1N A;  1D3Y A;  1KU7 A;  2UWM A;  2DBB A;  3SZP A;  1YLF A;  2Y0M A;  2MLG A;  3BP8 A;  3OV8 A;  5IT3 A;  1K78 A;  2PBI A;  3J7A O;  4RGX A;  2J5P A;  1G3T A;  4JBA A;  2XGX A;  1TQM A;  3ABT A;  2WC2 A;  2ZME A;  2VON A;  2EFN A;  1SD6 A;  4Y15 A;  1FX7 A;  1S29 A;  2ZCW A;  1HST A;  3R0A A;  3K1P A;  4RGR A;  1KU3 A;  2EFP A;  1MJA A;  4KIB A;  3S2W A;  4FT8 A;  3HOS A;  4BHB A;  3TQN A;  2ACJ A;  2H6B A;  2CWE A;  3RIR A;  3F3X A;  4ASN A;  2A5Y B;  2W24 A;  1W7P B;  1IXR C;  1ZHF A;  3C7J A;  5J8F A;  5LHG A;  3L2C A;  1FBU A;  2ZO4 A;  3WE2 A;  1T39 A;  3ZMT A;  3E3V A;  5DYM A;  3LWF A;  5BOX A;  4HOB A;  3WTV C;  1HW2 A;  4MQV A;  3JAM K;  1H9G A;  1XDU A;  2HS5 A;  2YX7 A;  5L3F A;  1XMK A;  2XAH A;  2EV6 A;  4GGG A;  1MJB A;  4FHT A;  1G3Y A;  1U6G A;  3PQJ A;  3P7N A;  5ICC A;  3EYY A;  3OOP A;  1IF1 A;  3F21 A;  1F5T A;  5E8I A;  4HV5 A;  1A04 A;  2A69 F;  3TGN A;  2F5E A;  4U88 A;  2OD5 A;  3ULQ B;  1Q1H A;  4EGY A;  1HQC A;  2FNP A;  2IA2 A;  3EQL F;  4WXH A;  3DPT A;  3JAM Z;  3ZN1 A;  2CSO A;  3M7G A;  3HRS A;  1PP8 F;  3ZN0 A;  2VOO A;  1MGT A;  4HZF A;  1FOK A;  4H0E A;  1S7A A;  4M6Y A;  4LD5 A;  1G6N A;  4HBL A;  4IVN A;  1MDM B;  1BC8 C;  1U5T C;  1LB2 A;  1BOA A;  3BRO A;  3D5L A;  1STZ A;  3G73 A;  2P4W A;  2V1U A;  2FEZ A;  1ZGJ A;  1H9T A;  1ULY A;  3TO9 A;  1IW7 F;  4CHU A;  2FBH A;  2ESH A;  3CO7 C;  2L01 A;  4I0B A;  4B8X A;  5E1W A;  2M8E A;  2QBY B;  3MCZ A;  3FWE A;  3L9F A;  5TJJ A;  3DQV C;  2XRN A;  1HW5 A;  3EET A;  5LRS A;  4L0Y B;  4WX9 A;  2LF7 A;  4IRG A;  1RZ4 A;  2TDX A;  2CGP A;  1TQP A;  4RGS A;  3QRF F;  3K0L A;  3RKW A;  2PMH A;  3K2Z A;  2OBP A;  4TV7 A;  1QZY A;  4A6D A;  5F1R A;  5LGT A;  5CVU A;  1JE8 A;  4P55 A;  1TTY A;  1BI2 A;  1IN5 A;  3I0T A;  4LB6 B;  2DPU A;  4YFX F;  3I59 B;  3WTY C;  1FWZ A;  1ZAR A;  4HX8 A;  4KNY A;  2XUB A;  3DPL C;  4LLL A;  1TW3 A;  1FP2 A;  3TDU C;  2M87 A;  1OR7 A;  1YS7 A;  3E97 A;  5DCM A;  4B09 A;  1E2X A;  3R60 A;  3V7R A;  3KE2 A;  3V7C A;  4KDP A;  4I01 A;  3U9G A;  2XAQ A;  5DD8 A;  2F5F A;  3IC7 A;  3MWM A;  3CUQ C;  4Q47 A;  3I53 A;  2YPR A;  4EVI A;  1CGP A;  1B1B A;  2OA4 A;  1W5S A;  3ZMD A;  1O7F A;  1XD7 A;  3EUH A;  3F72 A;  3GFJ A;  3WTZ A;  1T6S A;  5D5U B;  1T98 A;  2HTS A;  3O3K A;  3RYR A;  4KA4 A;  3QOP A;  2GWR A;  4D0P A;  3IHU A;  4EGZ A;  2EA2 A;  2VC1 A;  3RKX A;  1QQI A;  1UHM A;  3NQO A;  2Z9O A;  1Z91 A;  1K6O A;  1GXP A;  1Z6R A;  3I54 A;  4G7H F;  2HYG D;  4CXF A;  2NNN A;  4Z2Y A;  4HX4 A;  4KMU X;  2QZ8 A;  3FM5 A;  4PDK A;  5E18 F;  4LB5 A;  4LMY A;  1VTN C;  5DCF A;  4MEX F;  5D4S A;  2RGV A;  5D5V B;  3C18 A;  2Z5U A;  1Z05 A;  5ILU A;  1GXQ A;  3SZT A;  1ZG5 A;  3WTW C;  3GLX A;  2ZKZ A;  4XSX F;  2KJB A;  5BQT A;  5FD5 A;  1KYZ A;  1R58 A;  3QAH A;  1GHC A;  5LEJ A;  3LA3 A;  1FNN A;  3HOT A;  3WGH A;  4O3M A;  4OIN F;  1PDN C;  4MEY F;  1RI7 A;  1SMT A;  2ZFW A;  1ZG1 A;  1XGS A;  2FNA A;  2HOE A;  4K2E A;  4EM0 B;  2A07 F;  1WWX A;  1YFH A;  1W5T A;  1IN6 A;  3RJP A;  2LSO A;  1J59 A;  2LNB A;  2O03 A;  3LQR A;  2DU9 A;  1I6X A;  1J75 A;  2JRT A;  4I98 B;  1G4D A;  3JW4 A;  4P9F A;  5CVR A;  1BC7 C;  4AVP A;  3K69 A;  3KEO A;  3HRT A;  2FQ3 A;  2QUF A;  2M5W A;  4LG0 A;  3R4K A;  3TKY A;  3IKT A;  3WOD F;  4P5O A;  1FYM A;  2JTV A;  2NRA C;  4IHS A;  1X3U A;  3F8B A;  1HW1 A;  3M9A A;  1ODD A;  4LK0 F;  2YU3 A;  2VXZ A;  4FX0 A;  2W85 A;  3KP6 A;  5LGN A;  4HDV A;  1FPQ A;  3D0S A;  2DW4 A;  4A0Z A;  2Q0O A;  1U8R A;  2BYV E;  3WE3 A;  4ZYE A;  2EA4 A;  4HLX A;  4EV0 A;  2E7W A;  5L3B A;  4KYW A;  3KZZ A;  1S3J A;  2QQB A;  2QEN A;  4N0B A;  3G3Z A;  4I7H A;  2PLY A;  4O5V A;  1S7O A;  3N4M A;  4RB2 C;  2DO7 A;  4M9Z A;  2X4H A;  4P96 A;  4KUM A;  2ADU A;  2NNY A;  1BM9 A;  3WGG A;  3WTT C;  1FSH A;  5K1Y A;  4AD9 A;  1D5V A;  2L4M A;  2JT1 A;  1V3F A;  3R0J A;  4EMS A;  2IP2 A;  3R6S A;  2VT2 A;  4N9I A;  1ZLJ A;  1Z9C A;  1BN5 A;  5EEG A;  2DPD A;  3ABU A;  3B73 A;  5D5X B;  3WU0 A;  2PMU A;  3HIF A;  4KFC A;  3RTR A;  3V8J A;  5HS7 A;  5LEK A;  2K27 A;  3F8C A;  1XDS A;  3C3W A;  3H3Z A;  1J9I A;  4WF2 A;  3LST A;  3BJA A;  1I1S A;  3KCC A;  2HWV A;  1FYL A;  5LGU A;  3HYI A;  1U5T B;  1F9N A;  4YG2 F;  1ZN2 A;  2VBY A;  1IRF A;  4HAM A;  4ZH4 F;  3MQ0 A;  5BMZ A;  3P9C A;  2Y48 A;  1YYV A;  4HDU A;  2VBW A;  2HR3 A;  4AIH A;  4HYE A;  4L9J A;  1XGO A;  3V8L A;  2EV5 A;  1ZRD A;  1I27 A;  4OIP F;  1D8K A;  5K5O A;  5CLS A;  4IPA A;  3ECO A;  4KIG A;  3MEX A;  5BS6 A;  3FMS A;  2VT3 A;  3F8F A;  3IL2 A;  1ZH5 A;  1KQ8 A;  2FU4 A;  4HF0 A;  3T0Y A;  1KA8 A;  4ESF A;  4BNC A;  4CGZ A;  4IF4 A;  3JSO A;  1P92 A;  5FB2 A;  5H6Q A;  4ETS A;  1USS A;  2XKO A;  2GA1 A;  4M9S A;  1XGM A;  4ENN A;  4L9T A;  3T1B A;  3V4G A;  5A2Q K;  2GZW A;  2YR2 A;  2KJC A;  2HEO A;  3I64 A;  2XKP A;  1R00 A;  1XCV A;  3MZH A;  2XVC A;  1R1U A;  2P7C B;  3B02 A;  4AWX B;  3EYI A;  2FMY A;  1FC3 A;  3CUQ B;  4RGU A;  2ZBK A;  1S6L A;  2EV0 A;  2UXX A;  1DPU A;  4CIC A;  2OQG A;  4G6Q A;  5L3G A;  2J5O A;  1DPR A;  2CO5 A;  1BI0 A;  3GYH X;  1QGP A;  5A2Q Z;  5LLQ A;  1I1G A;  1FBS A;  4LGW A;  1FBQ A;  1QO0 D;  2P5L C;  1SD5 A;  4OIO F;  3NRV A;  3Q5F A;  1P2F A;  2OZU A;  2QQA A;  2ISZ A;  3TOB A;  4A0Y A;  5LHI A;  3HSF A;  2ETH A;  4UV9 A;  4OU0 A;  3COA C;  1XSV A;  2D45 A;  1O3S A;  2D2W A;  5J8C A;  2MBF A;  2A68 F;  3ML6 A;  2H94 A;  3WTU C;  4DNC A;  3WU1 B;  1K78 B;  2PEX A;  1BIB A;  3ECH A;  2HGC A;  2ZME B;  4IHT A;  1G3W A;  2EFO A;  5CVJ A;  5LBQ A;  3HHG A;  3PFI A;  1XGN A;  5FFZ A;  1U3E M; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...