1FBSA

Heat shock transcription factor dna binding domain containing the p237a mutation
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
87
structure length
87
Chain Sequence
PAFVNKLWSMVNDKSNEKFIHWSTSGESIVVPNRERFVQEVLAKYFKHSNFASFVRQLNMYGWHKVQDVKSGSMLSNNDSRWEFENE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords HEAT SHOCK FACTOR PROTEIN
publication title Proline in alpha-helical kink is required for folding kinetics but not for kinked structure, function, or stability of heat shock transcription factor.
pubmed rcsb
source organism Kluyveromyces lactis
molecule tags Transcription
total genus 25
structure length 87
sequence length 87
chains with identical sequence B
ec nomenclature
pdb deposition date 2000-07-16
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 1fbsA00
1G3SA 3WE3A 1UFMA 4HV6A 1WI9A 3LAJA 4BHCA 2CG4A 4CO8A 1Z1DA 3RPUA 4OIPF 4A12A 4A5MA 2XROA 5E8GA 2HGCA 2HQRA 4P96A 3LFKA 3G73A 2VBXA 3WODF 3D5LA 4ZZLA 5CVJA 3CUQA 4IRHA 3RPQA 3EETA 3H92A 3VEPA 1O3SA 1S7AA 2LSOA 4CDGA 3J81K 1UCRA 2R7FA 2BE5F 1IN8A 4N0BA 3WGHA 4PGHA 1FYMA 2FF4A 1EV7A 1LJ9A 1T38A 3GUDA 4ENKA 1SD5A 2FA5A 1Z05A 4HLXA 4A5NA 1A04A 4G9YA 2V1UA 3O6BB 4HX8A 2H6CA 4FX4A 4RGSA 4AD9A 3I59A 1HQCA 2GQQA 1FX7A 1J9IA 2ZO4A 2EV0A 5A2QZ 2CW0F 2MBFA 1KU9A 4OMZA 1FYLA 2J5PA 2L4MA 2MC3A 3CTAA 5IT9K 3V8LA 3V4GA 3KFWX 1DPUA 3F22A 3WTUC 1EH6A 3L7WA 3V8KA 3K1MA 1LDKB 1MKMA 4GGGA 1WQ2A 1OR7A 2F5DA 4R79A 3GXOA 3KP7A 3ZPLA 1R1VA 3EQLF 3GVAA 5HDNA 2COMA 2EB7A 3NRVA 3V8JA 3MQ0A 1FWZA 1MD0A 1U5TB 2ELHA 3MFKA 5D8LB 2DW4A 3WG9A 1GHCA 4NHJA 2BYVE 4L9TA 1J2XA 1B6AA 4JBAA 1Z6TA 3SXYA 1QGPA 4Q47A 4ESFA 1KYZA 3HHGA 3F23A 1SFUA 4I09A 5BS6A 1SD4A 2W57A 2QQ9A 3M9AA 3HOSA 1LDDA 1C0WA 4EJTA 3S2WA 3U9GA 3ELKA 1YFHA 4KIGA 1JHFA 4LB6B 3LA7A 2E1NA 1O7LA 2P5KA 4Q48A 3J80K 2L02A 3T8RA 2HYGD 3ML6A 2PFBA 1FSEA 2UXNA 1H9TA 1FP1D 5JHUA 2JRTA 4CGZA 2ISYA 4Q5SF 2TDXA 3VB2A 3DF8A 3NEUA 4GO1A 5LEKA 4U0YA 2FNAA 1DDNA 3K2ZA 3FXRA 4I01A 1ZG3A 3GX4X 3M8EA 4LMYA 3Q9SA 3T1BA 2QM3A 4EGZA 1IAWA 3F72A 3WTTC 1O3TA 3P9KA 2ETHA 1XCBA 3KP4A 2MD5A 3FF5A 2XV4S 2RV8A 3HSRA 3RIRA 1F5TA 3CUOA 2V9VA 3P9IA 4KA4A 4IHTA 4A2UA 4LD5A 2J5OA 4EJVA 4IJAA 4FX0A 3WTVC 3CO6C 4RS8A 2KJCA 2MLGA 1WSUA 2X4HA 4H0EA 1BBYA 1W5TA 1OYWA 5TRDA 1SMTA 3DKWA 5LRSA 2ESNA 3KP3A 2FEZA 5J6XA 1SFXA 1K78B 3R60A 3E3VA 2EWNA 5CLSA 2FOKA 2O8XA 3EDPA 1ON2A 5L3BA 2OQGA 1ZLJA 1ZRCA 4UXNA 2JPCA 2VE9A 4ZYGA 2WWYA 3JAMZ 2QQBA 4N9HA 4WXHA 4HF2A 4AIJA 4P5OA 5F64A 2PMHA 5HS7A 3TO6A 3FMSA 3ZMDA 2L4AA 2XAJA 3EUHA 2ZFWA 4LLLA 5ICGA 3ISPA 4LJZF 2DTRA 4I0BA 2IW5A 1FBSA 4LLNA 2CGPA 3J7AO 4L9JA 3OV8A 4KYWA 1FP2A 2R3SA 3GEZA 1TTYA 2OD5A 5D5XB 2P8TA 3BJ6A 1YS7A 4Y17A 2XVCA 2F2EA 1P92A 2K27A 2P7VB 3ECOA 5D5WB 1L0OC 5BPIA 1IN7A 4KDPA 1MJAA 1ZGAA 4G6QA 1AOYA 2XHKA 3I5UA 2HEOA 3QU3A 2QBYB 1EH8A 2Q2EA 2W25A 1LVAA 1IXSB 4P9FA 1ZREA 2O61A 2P6TA 3F6OA 2FBKA 4M6XA 3WGIA 3LA2A 3EYYA 1GXPA 4AIHA 2VOOA 1G3TA 2OZUA 5L3FA 4HF0A 3LWFA 2F5CA 2IRFG 4U88A 4A6DA 2E7WA 1BI1A 3HOTA 4UVCA 3RKYA 5CVVA 3BWGA 3C18A 3HTSB 4R1HA 4FHTA 4KFCA 3DPLC 1O57A 4I7HA 3HRMA 4KMUX 3E6MA 3RYPA 3R6SA 1O3RA 1BC8C 1LEBA 2EFPA 1REPC 1MJBA 1HSJA 4YFNF 4Z2YA 3D0SA 3I0TA 2M1BA 1W5SA 2M30A 3ZMZA 5E1XA 4O3MA 1R1UA 5CJ9A 2HS5A 3I71A 3TDZC 1K78A 3KP5A 2HR3A 5ICEA 1XCVA 1K7AA 4IPAA 2BEOA 2RNJA 4RB0A 2E1CA 4XLPF 3K9TA 5LGNA 2BGCA 3L2CA 2G7HA 2YX4A 2LF8A 4M72A 3CLOA 2FQ3A 2EFOA 1R23A 5FFZA 1QPMA 4OOIA 4G6DA 5TJJA 4NB5A 3F8FA 3CUQC 2OQRA 3RI4A 5DCMA 5HDKA 1J75A 2QENA 5E17F 3FM5A 1NHAA 3ZMSA 5LLQA 4EGYA 4HQMA 4HX7A 4I02A 5LHGA 4UV8A 5KVRA 3BDDA 3ULQB 4B09A 3MZYA 4IRIA 4YIIA 4PGGA 2XAQA 2PMUA 1XDSA 3P7NA 3QPHA 2K7LA 4BHPA 2GIVA 1TBXA 1ULYA 1R00A 4EJWA 2L54A 2KIUA 5ILVA 3FMQA 2KKOA 3QPTA 4YFKF 1HKSA 3PFIA 2HQNA 2UZKA 2QBYA 4HX4A 3TDUC 2QZ8A 2JTVA 1FNNA 4UUVA 1FBQA 2NYXA 2PG4A 4L18B 2DO7A 2V1XA 5L3DA 5J8CA 1USSA 2NRAC 3JAMK 1QBJA 1S29A 5ERIA 1B1BA 4EM0B 2NNNA 2OBPA 3M8FA 4MEYF 2VODA 5LBQA 5D5VB 2XRNA 5DD4A 4ENJA 4HDVA 1FOKA 1TQMA 1WKMA 1MDMB 4G7HF 2VBYA 2FMYA 4FT8A 2K02A 2D1HA 4L0YB 3ZMUA 1CF7B 3ZMVA 4XSXF 3F8CA 1YW7A 4RGRA 4WXCA 4MGRA 4HA8A 5BMZA 2PBIA 2W85A 4OIQF 4M74A 1RZ4A 1UB9A 1TNTA 1HBXG 2A6HF 4BNCA 4WWCA 2ADUA 4BYYA 3R0JA 3HUGA 4KN7X 3T8TA 1ONVA 1TLHB 1RUOA 3I54A 4ETSA 5HS9A 1R5GA 4CZZA 4KN4X 1D8JA 2A6EF 1R36A 3FMRA 2MH2A 1QZZA 4WCGA 4EV0A 2V1DA 2P5LC 4BXUA 3JW4A 2FRHA 4ZZDA 3WU1B 5D4RA 4N9IA 1KU3A 1RIOH 2PJPA 3KZZA 2GAUA 4U7BA 5CYVA 1Z7UA 1ODDA 4HBLA 3R61A 2LNBA 1P2FA 3ABTA 4GCVA 2EV6A 4AIKA 1X3UA 2R7DA 1XGSA 1TQIA 2XKOA 5HDGA 3HRTA 3KP2A 2ZCWA 3KETA 3RKWA 3ROUA 4KMFA 5F1RA 1B59A 1BJAA 1BN5A 1I1GA 1RNLA 2W24A 2O3FA 3E97A 1R22A 3HRUA 2L01A 1KQ8A 2VT3A 1J59A 5LGUA 1BIBA 3FXQA 4ZYDA 1JGSA 1O7FA 2O0YA 4GYGA 5LEJA 4B8XA 2ZMEB 3OOPA 1HXDA 4PZJA 5CVUA 4XRFA 4Y15A 2JSCA 2JT1A 4HW0A 2L3DA 1W4MA 2HYFA 2IJLA 1ZN2A 3JTGA 5IT3A 3V7SA 2YX7A 4IXAA 1D5VA 4S04A 1Y0UA 1FSHA 1ON1A 2A3SA 2GXGA 2ZNYA 3EYIA 1R1TA 2NS0A 1H9GA 5L3GA 1TNSA 1G4DA 1MDMA 1U5TC 1U3EM 2DK8A 1W7PD 2EK5A 4BAYA 4RB1A 1QZYA 3FZVA 1W7PB 2OZ6A 4R8HA 1GXQA 3O3KA 3BOQA 3REOA 2M45A 2QWWA 2YSRA 1XGOA 1SD6A 2Z99A 3GZ5A 4MTEA 2QVOA 5JI6A 5ILSA 3RTRA 1XMKA 1JE8A 2EJRA 1ZHFA 1YYVA 4OINF 4O6JA 1H0MA 2A5YB 1TW2A 2D1VA 1K79A 2FSWA 3KZYA 3WTZA 1TW3A 3BPXA 1PDNC 3DQVC 1DPRA 2H6BA 1SFEA 1U6GA 1GVJA 1FY7A 3J81Z 1OYIA 4E70A 4LB5A 2GA2A 1ZYRF 1XMAA 1U5TA 5D6EA 2DPUA 1Q1HA 2QUFA 3HSEA 2DPDA 4GXOA 3SFZA 2LDUA 3TO7A 3JSPA 2P6SA 2O03A 3V7RA 4M9XA 3CO7C 2VT2A 5H6RA 1L3LA 2K86A 5BQTA 3W6JB 2EFWA 5KK1A 2JZYA 5K5OA 3GZ6A 2RGVA 2K4BA 2VN2A 1FC3A 4F7ZA 5FGMA 5HLIA 5A2QK 4U0VA 4UVBA 4HAMA 1XD7A 2F5FA 3HYIA 1Z9CA 2RVCA 5HLHA 3G3ZA 4MHGA 3IHUA 2DQRA 4HF1A 3KLOA 3LA3A 3IL2A 1I5ZA 5JFRA 3GO5A 4XBFA 3E6DA 2HKXA 4A0YA 3K1PA 3N97A 3DFGA 2ZMEA 2UXXA 5FLXZ 1SD7A 4GYIA 4HLYA 2ZXJA 3F6VA 3KP6A 5EEHA 3L00A 1QO0D 3IKVA 3QP6A 1IW7F 4UV9A 2M5WA 2M8EA 4MQVA 1QQIA 1WWXA 1YS6A 3IRRA 4DNCA 2IA0A 2RQPA 2Z33A 1R5HA 1B9MA 2CFXA 2XIGA 5F6FA 2A07F 1BM9A 4PCQA 3BZ6A 1KQ9A 1JXSA 4G8XA 1AWCA 1IRGA 3I59B 3PQKA 3WTXC 3F8NA 1W7PA 2Z3YA 2VXZA 2FE3A 4PDKA 1YW8A 4TV7A 2AS5F 2ESHA 2PLYA 1OKRA 3H3UA 5JR3A 4RGUA 3R0AA 3U2RA 3J80Z 4DQ2A 1KQ0A 2P4WA 1F1ZA 1RUNA 4HOBA 3DV8A 3GYHX 1S6LA 1IXRC 2DFIA 2IA1A 5FD5A 3GWZA 1PP8F 2PEXA 2PQ8A 2DU9A 3GLXA 1FPQA 4L5IA 4IHSA 5DEQA 4OIRF 2DK5A 2NAZA 5D8KB 3TO9A 3GFMA 1D3YA 1R58A 2EA2A 4QWQA 2HTJA 4LG0B 5FD6A 1J0RA 4CICA 5LRRA 2D2WA 4L0ZB 3WE2A 1ZRDA 1XDUA 3I53A 3R4KA 1ZAOA 1IN5A 3VFZA 4UNOA 2A68F 1BC7C 3MEXA 3M7GA 3B02A 4A0ZA 2XGXA 4ZYEA 3LQRA 4Q4ZF 1E2XA 5K5RA 4HV5A 5EEGA 1I1SA 3LSTA 1STZA 5L3EA 5LHHA 3DXJF 3B73A 3U1DA 2LKPA 4EQQA 1I27A 4RB2C 2V6CA 5K5QA 3HSFA 1OPCA 1S3JA 4MTDA 2DAOA 2HOEA 1MJ9A 1P4AA 2FNPA 2H94A 1CGPA 2ZBKA 2GA1A 3HIFA 3SHFA 4RAZA 2VONA 3BY6A 3I4PA 4L5JA 4IRGA 4BH9A 3GFIA 2JPBA 1YO5C 5K1YA 3FXUA 3SQNA 1J5YA 5D6FA 5FO5A 3BROA 4OU0A 5J8FA 3AAFA 5DUKA 3HTUA 1BI0A 1FT9A 1K6OA 2H27A 5H6QA 4ENNA 2XAHA 1R7JA 2O6GE 2KJBA 4L9VA 3KCCA 3I58A 2XASA 1BI3A 4M9SA 3IKTA 2H09A 4WK8F 2QLZA 4HDUA 1LEAA 1VTNC 1RI7A 2OAZA 3LQQA 3E6BA 3QOPA 3F21A 3BPVA 4M71A 2P5VA 2QYOA 1I6XA 1FBUA 3F3XA 1XSVA 5L3CA 2YU3A 2XAGA 1XN7A 2RN7A 4YG2F 4YIFA 3BJOA 4LGWA 2E7XA 3N4MA 2RC4A 3KEOA 2FBHA 2Z9OA 5E8IA 1HW2A 3TGNA 1HSTA 3DEUA 2OU2A 5D5UB 3L09A 3I64A 5ICCA 1IZ1A 4ESJA 3TQNA 1LDJA 3M1EA 4NQWA 4M6YA 2EFNA 2EFQA 5JVTA 4WF2A 5FLXK 3ZQ7A 1FLIA 1ZG5A 5E18F 1B4AA 1HKQA 3DPTA 1HW5A 4AWXB 2CYYA 1J7KA 5BOXA 5E1WA 4LG0A 2ZKZA 2Y0MA 3T0YA 3TOAA 5H20A 1XSXA 1G3YA 2ISZA 3K0LA 3TOBA 5ICFA 3P9CA 2HTSA 3QRFF 3WGGA 3WTSC 3GFLA 1DUXC 4CHUA 4I0AA 1B9NA 4Y13A 2ZJ2A 2FU4A 2ZNZA 1KU7A 3NQOA 3Q9VA 2GXBA 1EH7A 2G7UA 4XLNF 3IRQA 3FHZA 2HWVA 3IC7A 4XSZF 4A6EA 2XKPA 4KT5C 1SMYF 1ZH5A 2STWA 3ZMTA 1YQAA 2GZWA 3BP8A 5HVQC 3SZPA 3ZN0A 1IN4A 2X0LA 4UHTA 4KICA 3RJPA 2VC1A 3K1NA 4HYEA 1OYYA 1KA8A 4EM1A 4ZH4F 3QU6A 4ENMA 4OIOF 5FB2A 4ON0A 2KIFA 1MZBA 5DD8A 4M9ZA 4M73A 3E5UA 2CQKA 4G7ZF 3IWFA 1QNTA 1T98A 2HZTA 3GF2A 1MGTA 3DP7A 5DDGA 3RKXA 3E5XA 2A69F 1UHWA 2RKHA 6PAXA 1IUYA 1CF7A 1P4XA 4MNUA 4U7DA 2MLKA 2UWMA 5AIQA 5AONA 2P7CB 2Y48A 1FZPB 1E17A 1YG2A 3T5XA 1SAXA 2VC0A 3GW2A 3MZHA 1ZLKA 2IT0A 3ZP5A 2CWEA 3H3ZA 2KRFA 5DUIA 3JTHA 2ACJA 1O3QA 3KLNA 1G3WA 2PI0A 2D45A 1HKTA 2Z5UA 2DLLA 4G94A 4KNYA 2PN6A 1HW1A 2QQAA 2FXAA 3E6CC 2MA3A 4LK0F 1YTYA 3MCZA 1IN6A 4YFXF 5BPDA 1DP7P 2VE8A 2C6YA 1WRJA 2WTEA 1T6SA 1IRFA 1BOAA 3BJAA 3VODA 1S8NA 3IWZA 2W84A 2CSOA 1XGMA 1XSDA 1D8KA 3K69A 1USTA 5DCMB 5AIPA 3E5QA 1T2KA 2WV0A 4A0XA 4ZYHA 5HS8A 2STTA 4G7OF 1KU2A 4KIBA 3WU0A 3ECHA 4WXDA 2G9WA 3GFJA 5LGTA 2FMLA 2RDPA 4RB3C 2NNYA 3KEQA 1UHMA 2Q8KA 5DYMA 3C7JA 1JHHA 5HLGA 3MAJA 2B0LA 4EVIA 5FFXA 2XUBA 5DV5A 4QLCU 4HZFA 2OA4A 5DCFA 1IXCA 2FBIA 2HKOA 4ASNA 2DI3A 5IT9Z 1ZRFA 4U0WA 1V4RA 1FYKA 5CVRA 1F4KA 4HQEA 3COAC 4IF4A 3SZTA 3CUQB 1BI2A 2WC2A 2HFHA 4CYDA 2YR2A 3W6KB 3ABUA 3PQJA 3RYRA 2CO5A 2LF7A 4MQ9F 4CXFA 1Z91A 2VBZA 1OMIA 4K2EA 5ED4A 3WTYC 1PP7U 2BBYA 4JK1X 1ZG1A 3HHHA 3MWMA 3WTWC 4EMSA 2IA2A 4EJUA 2BV6A 1F9NA 2VBWA 4RAYA 4S05A 4I98B 2M87A 5CVIA 1T39A 3JSOA 3VOEA 4EM2A 4UVAA 3CJNA 2Y75A 1PUEE 3ZN1A 3Q5FA 4LK1F 1TQPA 4KIFA 2GWRA 3L9FA 1IF1A 1YW9A 2F5EA 2HDCA 3LAPA 1YIOA 1P4WA 4RGXA 4BHBA 4JQFA 5E20A 3F8MA 3C1DA 4MEXF 1LNWA 2AXLA 3FWEA 1XB4A 1BIAA 2VOPA 4KUMA 1V3FA 2KIMA 3QAHA 4I2OA 1G6NA 2MH9A 2IP2A 3KE2A 3FM3A 1ZGJA 4WX9A 4LLGF 4BQAA 3ERED 1T0FA 2EA4A 5D4SA 3FX3A 1S7OA 3QP5A 3V7CA 4ESBA 1Z6RA 5HOOA 2YPRA 3O2PE 3HRSA 2IVMA 3C3WA 2XAFA 1U2WA 4IVNA 4D0PA 2Q0OA 1LQ1A 1U8RA 2K4JA 5LHIA 1XGNA 4OMYA 1ZARA 5E1ZB 3TKYA 4AVPA 1KYWA 2DBBA 2A61A 2DT5A 4L9NA 3CDHA 2V79A 1U78A 2IPQX 2EV5A 4LFUA 5ILUA 1KGSA 4P55A 4EJOA 1YLFA 3F8BA 3RDIA 4O5VA 1P6RA 1LB2A 4P9UA 2DQLA
chains in the Genus database with same CATH superfamily
2O8KA 1R9TJ 1G3SA 2NXNB 3WE3A 3DKXA 1UFMA 4HV6A 1WI9A 3LAJA 1FTZA 4F93B 4B43A 2CG4A 4BHCA 1FMWA 2XGEA 1W1WE 5HNFA 3GTPJ 1UZCA 1OFCX 3NARA 2L7MP 3TW7A 4CO8A 4DOZA 3GTJJ 1Z1DA 3M3YJ 2OJED 3IH4A 3RPUA 4OIPF 2ZSHB 2LVSA 4A12A 4B3XA 2DMNA 4A5MA 2XROA 2CRGA 2JWTA 5E8GA 2HGCA 2HQRA 2R92J 5K7ZA 2RAEA 4P96A 3LFKA 3G73A 4XOTA 4DGWB 2VBXA 3WODF 3D5LA 4ZZLA 4RMNA 5CVJA 3S1QJ 3CUQA 4IRHA 3RPQA 3EETA 4QIWN 3H92A 2BZTA 3VEPA 3RZDJ 1S7AA 2LSOA 4B48A 1O3SA 2BVMA 4C2TA 4CDGA 3SEQA 1N78A 3J81K 1Z67A 1UCRA 1DQUA 3CP2A 4XL9A 2R7FA 1VQLI 5EGOB 2BE5F 1IN8A 2CS3A 4N0BA 3CCUI 3PM1A 3WGHA 4PGHA 4W1UA 1FYMA 4XQFA 2FF4A 1EV7A 2KP6A 1LJ9A 5B5EC 1T38A 3GUDA 4ENKA 1SD5A 2FA5A 1Z05A 4HLXA 5B1BH 2M8GX 2KRCA 4A5NA 1A04A 5EZHA 2IGMA 4DZJA 1ZR2A 2K85A 2ZJQF 3H1CA 4G9YA 3MD2A 3IAM2 2V1UA 2E1MB 3O6BB 1BR4A 1I3QJ 2X85A 4HX8A 2H6CA 4HG2A 1Z3XA 1ITYA 2WADA 4FX4A 3GTQJ 4RGSA 4AD9A 3I59A 2JA8J 1HQCA 2IAIA 2GQQA 3KYLA 1FX7A 3FKJA 1BL0A 4BGDA 1J9IA 3NWTA 4PSWA 3H5NA 3RQIA 2LC2A 2ZO4A 3GCMA 2ME6A 3BC8A 4XM3A 2R5ZA 3MVPA 1JUPA 2EV0A 5A2QZ 2CW0F 2MBFA 2BXZA 1KU9A 4OMZA 4ABZA 1FYLA 2J5PA 5GAGJ 2L4MA 2MC3A 2LY2A 2Z1DA 3CTAA 3OYDA 4XR6A 1Z3YA 5EDNA 5IT9K 5GTHC 4IOCF 2M0MA 3V8LA 3V4GA 3KFWX 1QPIA 1DPUA 3F22A 2R7SA 3WTUC 3WHCA 4A69C 1EH6A 2LH9A 1Y8QB 3HEFA 3L7WA 3V8KA 3K1MA 4A3DJ 1LDKB 1MKMA 4GGGA 1WQ2A 1OR7A 2F5DA 4R79A 1JKRC 3GXOA 3JCUC 1S72I 1MNMC 3KP7A 2M34A 1R1VA 3HBLA 3CCVI 3ZPLA 3EQLF 3GVAA 2I5UA 3ZQGA 1HF0A 1SVMA 5HDNA 2COMA 4C3JJ 2EB7A 3NRVA 1WCMJ 3V8JA 3MQ0A 3GTKJ 1FWZA 5FJ8J 1UG0A 2R7TA 1MD0A 1U5TB 2ELHA 3OYCA 3MFKA 5D8LB 2DW4A 3O8HA 4FQGA 3WG9A 2W4SA 1GHCA 4NHJA 3TBIA 2BYVE 1JKOC 4L9TA 1HDPA 1J2XA 2OCEA 1B6AA 1OCOH 4JBAA 4E7HA 1A31A 2NVTJ 1Z6TA 3SXYA 1QGPA 5JVGF 4Q47A 4ESFA 1KYZA 3HHGA 2Y9YA 2F4MB 4I09A 3F23A 1SFUA 3GTMJ 5BS6A 1SD4A 2W57A 2QQ9A 3IP4B 3M9AA 3HOSA 1LDDA 1C0WA 4A3KJ 2K3PA 3S16J 3DKYA 3FKIJ 4EJTA 4BEHB 3S2WA 3SFIA 3U9GA 1QVTA 2A5WA 1WJFA 3OMYA 3ELKA 1YFHA 4KIGA 1JHFA 4LB6B 3KIOA 3LA7A 3HGGA 2E1NA 1O7LA 2P5KA 4Q48A 3W2AA 2E1OA 1WJCA 2JK3A 4J01A 2HVRA 4OAZA 3J80K 2XDVA 2E2JJ 4S0HB 2E5NA 2DCEA 2L7KA 2L02A 3T8RA 2HYGD 3ML6A 2WB1A 2PFBA 5JHFA 2O7OA 3VYSB 3O8GA 1A6QA 1FSEA 1Y0NA 2VKVA 2UXNA 3PL8A 1H9TA 1FP1D 5JHUA 2JRTA 4CGZA 3BR1A 1YOVB 2ISYA 3CC4I 5EF6A 1YITI 2Y0SN 4Q5SF 2KDZA 3FHNA 2TDXA 5GPCA 3VB2A 3DF8A 3NEUA 5EG0B 4GO1A 3OS2A 5LEKA 4U0YA 2FNAA 1DDNA 1H88C 3K2ZA 1IG7A 2MC4A 3FXRA 4I01A 1ZG3A 3GX4X 3M8EA 4LMYA 2PJRB 2L0KA 3H5RA 3Q9SA 2FQ4A 3OL3A 3T1BA 2QM3A 4EGZA 1IAWA 3F72A 4XKWA 4L5EA 3WTTC 3H9QA 5EGOA 1O3TA 5HODA 2DT7B 3P9KA 2VIXA 4FCYA 2RNGA 2ETHA 1XCBA 5J40A 3KP4A 2MD5A 3FF5A 1TT0A 1LPQA 4FTHA 2JUCA 2XV4S 2RV8A 2GOMA 3HSRA 3RIRA 1F5TA 1JGGA 4BJ5C 1X3WB 4QPOA 1X1PA 3CUOA 2V9VA 3DEWA 3P9IA 3K4BA 2PMZA 3HOVJ 4KA4A 4D7MA 4IHTA 1VQ6I 2YUSA 4A2UA 4LD5A 2J5OA 4CUGA 4EJVA 4FE4A 4IJAA 1ACIA 1IUFA 4FX0A 3OYLA 3WTVC 3CO6C 4RS8A 4HEA2 2JVGA 3EUHC 1PVEA 2KJCA 2LG4A 2LYCA 2MLGA 3BQYA 3KYCB 3OR2C 4XLAA 1WSUA 2X4HA 4H0EA 2W7NA 1BBYA 1W5TA 1OYWA 1SMTA 3E1SA 5TRDA 3DKWA 5LRSA 1YJ9I 1H89C 4C9YA 1MH4A 5IOZA 2VB6A 2ESNA 1VFCA 1OISA 3KP3A 3M4OJ 3TL4X 2DFFA 4UB6C 2FEZA 1S7EA 2K9MA 2XB0X 5J6XA 3OYHA 1SFXA 3QYFA 1OCCH 5C3EJ 1SC7A 1K78B 4X6AJ 3R60A 3E3VA 2EWNA 5CLSA 4XLEA 3QODA 2FOKA 1XTAA 2W00A 2VXDA 1MBHA 4HRIA 2O8XA 2M4KA 2QF7A 3EDPA 4XK4A 1ON2A 5L3BA 2VI6A 3CF5F 2MD0A 2OQGA 1ZLJA 1ZRCA 4UXNA 2JPCA 2HPIA 3BTJA 1X1DA 2ELJA 2VE9A 4ZYGA 3G6EI 2K5CA 2WWYA 3KPHA 1D1AA 3JAMZ 3OSFA 2QQBA 3ABKH 2VLAA 3CP8A 4N9HA 4WXHA 2LY9A 4HF2A 4AIJA 4II3A 4P5OA 1EJ9A 3OOUA 5F64A 2PMHA 5HS7A 3TO6A 4NC7A 2H8WA 1K6YA 3FMSA 2QA4I 3ZMDA 2ICWG 2L4AA 2XAJA 4I6ZA 3EUHA 2ZFWA 4LLLA 5ICGA 2L5QA 3HOWJ 1RR8C 3ISPA 4LJZF 2DTRA 4I0BA 2IW5A 2F4IA 1FBSA 2HDDA 4LLNA 2CGPA 2Y69H 3LFUA 3J7AO 2DFEA 4L9JA 2EIKH 3OV8A 3HZJA 4LG3A 3LSHA 2FX0A 4KT6A 4KYWA 1FP2A 2BXYA 2R3SA 1TTYA 2OD5A 3GEZA 3RSNA 5D5XB 3LSGA 2P81A 2P8TA 1A5JA 3BJ6A 1YS7A 4Y17A 1UJ8A 2XVCA 1POGA 2F2EA 1P92A 3BG9A 2K27A 4BEHA 2P7VB 4E7JA 3ECOA 1JTXA 3H0DA 3IH2A 2B9SA 5D5WB 1L0OC 5BPIA 1NG6A 1IN7A 1GV5A 4KDPA 2R7ZJ 1MJAA 4XLHA 1ZGAA 3J7AY 4G6QA 1AOYA 2QSGX 2XHKA 3X2QH 3I5UA 4JOMA 2HEOA 5M3MJ 3RQ4A 3QU3A 3W2WA 2QBYB 2V1NA 3ZQLA 1EH8A 2Q2EA 2W25A 2E19A 4A3IJ 1LVAA 2XPUA 5F1JA 4NDLA 4U87A 1IXSB 4P9FA 1ZREA 3OSGA 2O61A 1PUFB 3MKZA 2X1DA 2WAQN 3LSPA 2P6TA 1W0UA 2QQ8A 5DM6F 3CCQI 3BCBA 4CCMA 3F6OA 1FOYA 2PX9A 4V2FA 2FBKA 4M6XA 3WGIA 5KNLA 3LA2A 3EYYA 3K4CA 3S1RJ 4CCNA 3SDBA 1AKHB 3K4MA 1GXPA 2CUEA 3M07A 5EG0A 4AIHA 4IX7A 3CMEI 1G3TA 2VOOA 5IYBJ 2HPMA 2W48A 2OZUA 5L3FA 2KISA 3A4CA 4HF0A 2PJRA 3LWFA 2F5CA 4ZDOA 2IRFG 4U88A 4A6DA 2E7WA 1BI1A 2LRDA 2DMUA 4UVCA 3HOTA 1X2NA 1JKQC 3RKYA 3CCMI 4BXFA 1LFBA 1TP4A 5CVVA 3BWGA 2LTPA 1X1BA 1JJ8C 2KHMA 1MMNA 3C18A 1SEUA 3CQZJ 3HTSB 4R1HA 4FHTA 2E2IJ 3FBNB 4KFCA 3CCYA 1O57A 3DPLC 4I7HA 3HRMA 4KMUX 1Y6IA 3M8JA 3E6MA 3JRIA 3RYPA 3R6SA 2I8DA 1O3RA 3KYDB 2K9NA 1BC8C 1LEBA 2F48A 1DP3A 2EFPA 1REPC 1MJBA 1HSJA 1WJ5A 1VI0A 4YFNF 3AG3H 4Z2YA 4AYBA 3D0SA 2L9VA 3I0TA 2JVHA 2M1BA 3BR3A 3JR9A 1HOMA 1W5SA 5TISC 2M30A 3ZMZA 5E1XA 4Y33A 1Y1VJ 3WHBA 1ETWA 1W0TA 5FKLA 4O3MA 1R1UA 2CUFA 2XB5A 3SDGA 4DYQA 2CV2A 1N75A 5CJ9A 2HS5A 3OIQA 1V55H 1ETYA 2JRMA 3I71A 3OR1C 4IQJA 3TDZC 1QRYA 3A03A 1K78A 3KP5A 1YRNB 2LK2A 2CW8A 2HR3A 1X1AA 3HUGB 2OCCH 5FKMA 1XCVA 5ICEA 4J19A 2E2HJ 1K7AA 4QPQA 4IPAA 2BEOA 2RNJA 4RB0A 2CQXA 3L2QA 4J00A 2E1CA 4XLPF 2HXOA 1UELB 3K9TA 5LGNA 4IKFA 3OYAA 2BGCA 3DBHB 2Q1ZB 1D1CA 3F9KA 3L2CA 4GRIA 4BKXA 2G7HA 2YX4A 3RZOJ 2LF8A 4M72A 3CLOA 2NVXJ 3CCRI 1R49A 2FQ3A 2EFOA 2MG4A 1R23A 2R7QA 4BJ6C 3NWSA 3H3VK 5FFZA 1ETKA 3DWLE 1QPMA 4OOIA 2R0QC 2OV7A 4G6DA 5TJJA 2GLOA 4GDFA 4NB5A 2H1KA 3F8FA 3CUQC 4DBRA 2OQRA 3A0HC 3RI4A 4IEJA 3HM5A 5DCMA 5HDKA 1J75A 1AA7A 2QENA 5E17F 3FM5A 1NHAA 3ZMSA 2VJJA 3UNGC 5LLQA 4JX4A 4EGYA 3K10A 4HQMA 2MSYA 4HX7A 1JUMA 4I02A 5LHGA 3L2UA 4UV8A 2AXTC 2KPMA 2WY7Q 3BDDA 5KVRA 3ULQB 3MZYA 4B09A 1W5CC 5B66C 5J4VA 3G71I 2D5VA 4IRIA 1K4TA 4YIIA 3DBRB 4PGGA 2XAQA 2PMUA 1XDSA 3P7NA 3QPHA 1ZK8A 2K7LA 4BHPA 2GIVA 4CZCA 4V2GA 1TBXA 2JUGA 1ULYA 1R00A 2NS7A 4EJWA 3CJQB 2L54A 2KIUA 4JYKA 5ILVA 3FMQA 2KKOA 3L2VA 4PJNA 3QPTA 4YFKF 4UUSB 3QYBA 2VJIA 4CCJA 4RAGA 5C44J 2DJNA 2OF7A 1HKSA 3KX2A 4M3GA 2HYJA 3PFIA 2HQNA 1WFXA 2UZKA 1RR7A 2KIQA 5GP9A 2QBYA 3AL0B 3HPGA 4HX4A 3TDUC 2QZ8A 2JTVA 2X51A 5IOYA 1ZGWA 3H5AA 2XF7A 3CF2A 4QTRA 1ETXA 4B3AA 4CA0A 1FNNA 2FUG2 1OCPA 2DA5A 4UUVA 1FBQA 1PUFA 3OYEA 1FTTA 1V54H 2NYXA 2PG4A 5E3MA 4L18B 4BL0B 1Y1WJ 2DO7A 2LBFB 2IS4A 1F36A 2V1XA 2VKDA 2TCTA 1WJEA 4XLFA 2O9LA 2R4GA 4KITB 2VQHA 5L3DA 1YHQI 5J8CA 4I76A 1MBFA 2WY8Q 3CJTB 3CZ6A 1USSA 4IZZA 4BQQA 2XAUA 2DMPA 2NRAC 3JAMK 1QBJA 1S29A 2E35A 2HNHA 5ERIA 1B1BA 4EM0B 5DS9A 1A36A 2NNNA 4D1QA 2L9NA 3ZQCA 1OR7C 4M6VA 2OBPA 3M8FA 4MEYF 2VODA 2V7FA 5LBQA 5D5VB 2XRNA 5DD4A 4ENJA 2V26A 2E36A 4HDVA 3JRHA 1TQMA 1FOKA 1WKMA 1MDMB 4F91B 4G7HF 2VBYA 2FMYA 4FT8A 4PK4A 1R71A 2K02A 2D1HA 4L0YB 3ZMUA 1CF7B 4IHVA 1WH7A 4XSXF 3ZMVA 1VQOI 3F8CA 2A6TA 2EIMH 2M0CA 2LD5A 1YW7A 4RGRA 3I55I 4WXCA 2V6EA 2W82A 4MGRA 3OYMA 4HA8A 2LKSA 5BMZA 1OCZH 2PBIA 1VZ0A 4BE1A 4BDYA 2W85A 1TWAJ 4OIQF 4ANJA 3W2VA 1IGNA 3ZQHA 1XMXA 1XS9A 3B6CA 1A35A 4M74A 2DA6A 1RZ4A 3CJRB 1UB9A 4LIUA 1TNTA 1QU3A 2DA1A 1HBXG 2A6HF 3IV5A 4BNCA 3F0CA 1RETA 4WWCA 2ADUA 1FJLA 4GFBA 2NOGA 3UKGA 2B7EA 3LNQA 3HOYJ 1JI8A 4BYYA 3R0JA 2F5VA 4G12A 3HUGA 3K4KA 4KN7X 3T8TA 1OCTC 1ONVA 5KCMA 1B8IB 1N77A 3BG5A 1TLHB 4II2A 1RUOA 3ASNH 2L7FP 3I54A 4ETSA 5HS9A 4XICA 3BLYA 3KEYA 1R5GA 1YJNI 2X6YA 4CZZA 1IDZA 3EPZA 4KN4X 1D8JA 1DGRM 2A6EF 1IV6A 1R36A 1SVLA 2MH2A 3FMRA 4E7IA 2COBA 1V5EA 1QZZA 2ID3A 4WCGA 4Y52J 2LY1A 3CESA 4EV0A 2V1DA 4CSWA 2EH3A 3JRBA 4IHYA 2P5LC 4BXUA 1MBEA 3JW4A 2FRHA 4ZZDA 3WU1B 2IS1A 5D4RA 3H35A 4N9IA 2ZXWH 1KU3A 2XC7A 3OIOA 2DDBA 1RIOH 2PJPA 3KZZA 2ECBA 2VJ5A 2GAUA 4U7BA 5CYVA 4DJAA 1F43A 1Z7UA 1MMAA 4RDUA 3LSRA 3MN2A 1ODDA 1FEXA 4HBLA 3R61A 2LNBA 2W1OA 3OYGA 3A1YA 3AFHA 1P2FA 3ABTA 4A93J 2ID6A 4GCVA 2NVQJ 3BZKA 2EV6A 5E3LA 3GLLA 3S8PA 4AIKA 4BE0A 2M4GA 2Y9ZA 4DYRA 1X3UA 2R7DA 1XGSA 3QWLA 1IRXA 1TQIA 3K4NA 3SJMA 2XKOA 1JT6A 2KZGA 2AO9A 2E1MC 5HDGA 3JRAA 3HRTA 1R4MB 2IGKA 3KP2A 1JJ6C 2ZCWA 1WJBA 3KETA 3RKWA 3ROUA 4KMFA 3AG2H 3BQZA 2IEKA 1MW7A 5F1RA 4UUSA 3C2GA 2V9PA 1B59A 1BJAA 4N4OB 4PJMA 3GTOJ 1BN5A 5JLWA 1I1GA 3K2AA 2CQNA 1FIAA 1OCRH 3ZR8X 2IXSA 4PJLA 4HNVA 1RNLA 2W24A 2VASA 4I99C 2O3FA 3E97A 1W36D 3HPHA 1R22A 5F0FA 3HRUA 3OS1A 2L01A 4HNUA 3OYBA 1KQ8A 4XOPA 2VT3A 1J59A 1HLVA 5LGUA 1BIBA 2N8GA 3FXQA 4MIMA 4ZYDA 1UHSA 2EIJH 1JGSA 1S5LC 2BY1A 1N25A 1O7FA 1NG7A 3FISA 2O0YA 4GYGA 1APLC 4XRSG 5LEJA 2XPWA 3BR6A 1WZ2A 4B8XA 2HQAA 1RRJA 2ZMEB 3OOPA 1LFUP 2LBFA 4BBRJ 1HXDA 4PZJA 5IPAA 5CVUA 5IYDJ 2MYSA 4XRFA 4Y15A 2JSCA 3OYIA 2JT1A 3Q0UA 2L3DA 4HW0A 1W4MA 4CH7A 1K4SA 4X0GA 2KRHA 2HYFA 5EEAA 3HG9A 3FK6A 2IJLA 3H36A 1ZN2A 3ERMA 3JTGA 3FXOA 5IT3A 3V7SA 4YRVA 1VQ5I 2YX7A 3PNTA 4IXAA 4Y4RA 3UR3C 1Z21A 3PFYA 4MFDA 4RA2A 4D7NA 2ECCA 5KHDA 1D5VA 1UMQA 5EYRA 4FASD 2IS2A 4S04A 1Y0UA 1FSHA 1ON1A 2A3SA 2AHQA 2GXGA 5J1RA 3OWTA 2GM4A 1T33A 2P0WA 2ZNYA 3EYIA 3G4SI 3TW6A 1YI2I 1R1TA 2NS0A 4A3CJ 1GLNA 1H9GA 1SANA 4PSXA 5L3GA 1LVKA 1TNSA 1G4DA 1MDMA 3BCAA 1TWGJ 2HVSA 1MBGA 4LITA 2DTZA 1U5TC 1U3EM 2DK8A 1W7PD 3C2HA 5F0CA 2EK5A 1MNDA 4BAYA 4RB1A 1QZYA 1WJDA 2HQ5A 3FZVA 1W7PB 2OZ6A 1PJRA 4R8HA 4UY8I 1GXQA 3O3KA 1LE8B 1CQTA 3BOQA 4ZTFA 3REOA 2KFDA 2MW8A 1EF4A 2M45A 2BHZA 1DU6A 2QWWA 3S32A 2L7ZA 2YSRA 4XN3A 1XGOA 1SD6A 3RCOA 2Z99A 3GZ5A 5IYCJ 4BQOA 4MTEA 2DMQA 5M5YJ 2QVOA 4PFOA 5ILSA 5JI6A 4MLOA 5E79C 3RTRA 1XMKA 1JE8A 1FOWA 3K4LA 2EJRA 2WB1N 2DA3A 1ZHFA 1YYVA 4OINF 2DOAA 2LMDA 3DLAA 3AKZA 2HU9A 3LOCA 3PNVA 1BJZA 4O6JA 1H0MA 1VQ9I 2A5YB 3OY9A 4BY7J 1TW2A 2D1VA 1BR2A 3ABMH 2IGNA 3PSIA 1K79A 2FSWA 3KZYA 3WTZA 1WI3A 1TW3A 2EQRA 3BPXA 1R4NB 1PDNC 3DQVC 1Y39A 1DPRA 2H6BA 1SFEA 1U6GA 1GVJA 2DMTA 2BY3A 1FY7A 4PJ0C 3J81Z 1ETOA 1W36C 1OYIA 3ONQA 9ANTA 4E70A 1T8IA 2R7RA 2GA2A 4LB5A 2QSFX 1I3AA 1ZYRF 1XMAA 5BNGA 2JN6A 1U5TA 5D6EA 3A2KA 2DPUA 1Q1HA 2JA7J 2QUFA 3HSEA 4Y3OA 2ZMEC 2RQQA 1WVRA 1WHUA 2DPDA 3S1NJ 1X1CA 3VSKA 2MABA 1NK3P 4GXOA 3SFZA 2R7XA 5FKNA 1IDYA 2LDUA 4Z6YA 2NOJB 3TO7A 3JSPA 1JT0A 3HKZN 3OS0A 2P6SA 2O03A 3V7RA 4M9XA 3A02A 3CO7C 2VT2A 5EZGA 3DTIA 3H9GA 1MH3A 2PMZN 1VQPI 5H6RA 2K3FA 4ZJZA 3DLLF 1L3LA 2K86A 5BQTA 3W6JB 2EFWA 5KK1A 3BG7A 2JZYA 3M1CA 5K5OA 3GZ6A 2RGVA 2YU9J 2K4BA 2VN2A 1FC3A 4F7ZA 3J7YJ 5FGMA 5HLIA 2ELKA 2L2OA 5A2QK 4E7ZA 2L9SA 4U0VA 4UVBA 2OTLI 4HAMA 1LUJB 1XD7A 2XPVA 5F08A 2HI3A 4MO7A 2F5FA 2XSJC 4F92B 1ZELA 3BTCA 3HYIA 1Z9CA 2RVCA 5HLHA 3PO2J 4NC8A 3G3ZA 3MKWB 4MHGA 3IHUA 2DQRA 3D5SC 4HF1A 3KLOA 4BDZA 3LA3A 3U21A 1I5ZA 2MFZA 3IL2A 2DT6A 4RLFA 4M3BA 1R6RA 5C4XJ 3WU2C 2KLOA 5JFRA 1QHHD 3GO5A 4XBFA 3E6DA 2HKXA 4YELA 4A0YA 5KAFC 3K1PA 1LFPA 1P7JA 2ZMEA 3DFGA 5GPAA 3N97A 2UXXA 4UB8C 5FLXZ 1SD7A 3DCFA 4GYIA 5KAIC 3ZCOA 5B1AH 2ZXJA 4HLYA 1MMGA 3F6VA 3KP6A 5EEHA 2EPFA 3L00A 1QO0D 5CQGA 3AG4H 3CCEI 3IKVA 3QP6A 1IW7F 1AU7A 4UV9A 1K83J 2K9SA 2M5WA 2JQ7A 2M8EA 4MQVA 3PIPF 3LSMA 2XGDA 1QQIA 3FK7A 3A01B 5M5WJ 2ZJPF 1WWXA 5HNHA 1YS6A 3IRRA 4DNCA 2IA0A 2RQPA 4E4HA 3IUOA 1R5HA 2Z33A 1B9MA 2CFXA 1HCRA 2IS6A 4DIQA 2XIGA 1X19A 3GBGA 5F6FA 1Z7LA 2A07F 1BM9A 4PCQA 3BZ6A 1KQ9A 1JXSA 4G8XA 2R7VA 3CMMA 4BACA 4IOAF 1AWCA 1RC9A 4A3BJ 3OYNA 1YJWI 1IRGA 1FOXA 3I59B 3PQKA 3LSJA 2V4JC 3WTXC 3QYEA 1E3HA 3F8NA 4PFPA 1W7PA 3S3NA 2DYRH 2Z3YA 2VXZA 4BY1J 4G6TB 2FE3A 4PDKA 5C4JJ 1LE8A 1YW8A 4TV7A 2AS5F 2ESHA 2PLYA 1OKRA 4ZDPA 1YIJI 4XORA 3H3UA 5JR3A 4RGUA 3DBLB 3R0AA 3BT9A 3L2RA 3U2RA 1WGXA 3J80Z 3CCLI 4DQ2A 2R5ZB 1KQ0A 4C30A 2R93J 3HGYA 2LLKA 2P4WA 3VSLA 4B1RA 1F1ZA 1RUNA 2KDOA 4HOBA 3DV8A 2X48A 1S6LA 2ZSIB 3GYHX 3CDIA 4E7LA 1XPXA 2WAFA 1NK2P 1IXRC 2DFIA 2IA1A 1G2HA 4XKCA 5FD5A 3GWZA 2E5ZA 1PP8F 2PEXA 2PQ8A 2DU9A 3GLXA 4XMYA 5GAEJ 1P9QC 3DEEA 1FPQA 3FXMA 4L5IA 5FRMA 2FD5A 4IHSA 5DEQA 3CCSI 4NQWB 2X1CA 4OIRF 1H8AC 2DK5A 1XC5A 2NAZA 3S3MA 5D8KB 2IGOA 3TO9A 2DA7A 2DFHA 3GFMA 1D3YA 1R58A 3Q3SA 1D1BA 2EA2A 5HLTA 3S2DJ 2ZJRF 3JRGA 3LL7A 4QWQA 1HDDC 2HTJA 1JUSA 4LG0B 5FD6A 3MKYB 1J0RA 3CMYA 1U9OA 3G2BA 2E34A 5FROA 4CICA 1P7IA 2DXIA 5LRRA 5GAHJ 2D2WA 4L0ZB 3B6AA 5FKOA 3WE2A 4AU7A 1XDUA 3I53A 1A6IA 3QPLA 4D9JA 4E7SA 4A3JJ 1ZRDA 3S17J 3R4KA 1ZAOA 1IN5A 1ZTRA 3VFZA 2R7WA 3ZXSA 4UNOA 2A68F 1BC7C 3MEXA 3M7GA 3B02A 4A0ZA 4YIRX 4F3QA 2WV1A 1D0XA 1NTCA 2XGXA 4ZYEA 3LQRA 4Q4ZF 4E7KA 1TWFJ 1E2XA 1GDTA 1QA6A 3GTLJ 5K5RA 4HV5A 2CH0A 4XNFA 2R7UA 5EEGA 2Y30A 2CQQA 2JA5J 1I1SA 3LSTA 1STZA 5L3EA 2CMPA 5E3OA 1Z77A 2GBYA 3CMAI 5LHHA 3G1LA 4HPQA 3DXJF 1WJAA 3B73A 1MBKA 3E0JB 3U1DA 4AYBN 1B72B 2LKPA 4EQQA 1I27A 3BR5A 4RB2C 2V6CA 3CC2I 5K5QA 3HSFA 1OPCA 1S3JA 4MTDA 2DAOA 3GZNB 3BR0A 2HOEA 3V42A 5K7FA 1MJ9A 1P4AA 1GVDA 2FNPA 3BTIA 2H94A 1CGPA 2GIZA 2KZVA 2NVYJ 2F6CA 2ZBKA 2XF5A 2G0EA 2BOLA 2GA1A 4BJTA 3HIFA 5J1YA 3D5RC 3SHFA 4RAZA 2VONA 3FDYA 1K61A 3BY6A 3I4PA 2X6WA 1AKHA 4L5JA 4IRGA 4BH9A 3GFIA 3TEDA 2VUMJ 1Q1VA 3HOUJ 4C2MJ 1FMVA 2JPBA 5CKTA 3OYKA 1YO5C 2K9LA 5K1YA 3G1MA 2BW3B 3FXUA 3LSKA 1J5YA 4M3DA 3SQNA 4YEJA 5D6FA 2B63J 1SFKA 1SAUA 5FO5A 3BROA 4OU0A 5J8FA 3AAFA 1TWCJ 5DUKA 3HTUA 2WBMA 3CLQA 2O5RA 1BI0A 1FT9A 1T95A 5F0HA 2VKHA 3IH3A 1K6OA 4HSRA 2H27A 3FBIB 3K70D 1ZR4A 4A3MJ 1WH5A 5H6QA 3U1KA 4ENNA 3A01A 2XAHA 1R7JA 2O6GE 2H8RA 2KJBA 4L9VA 3KCCA 3JREA 3I58A 3MKLA 2XASA 1BI3A 4M9SA 5IP9J 3IKTA 1JTYA 2H09A 3P5JA 4WK8F 2K9QA 4A3GJ 2QLZA 4HDUA 1LEAA 1VTNC 1RI7A 2OAZA 2UUZA 3LQQA 2KL4A 3CC7I 3DU6A 2UV1A 1DU0A 3E6BA 5F27A 3QOPA 3F21A 3BPVA 5F04A 4M71A 2R5YB 3LSIA 1I50J 2P5VA 2QYOA 1I6XA 2I10A 3H0GJ 3HC7A 1FBUA 3F3XA 2F4OB 3RKQA 1XSVA 5L3CA 1I6HJ 4RLQA 3TMOA 2YU3A 2HOTA 4BUPA 2XAGA 5LD2C 1V5GA 1XN7A 3DTEA 2RN7A 3CD6I 3S15J 4YG2F 4YIFA 3BJOA 4LGWA 1YRNA 2VPRA 2E7XA 3FIWA 3N4MA 2RC4A 3KEOA 2Y0SA 1Y8RB 2JA6J 3S2HJ 2FBHA 1Y56A 2Z9OA 5E8IA 4NC6A 1HW2A 3TGNA 1BR1A 4OWRB 1HSTA 1TL8A 3DEUA 1EA3A 2OU2A 3ESWB 2VQGA 5D5UB 3L09A 4JX5A 4H4KC 3I64A 5ICCA 3BZCA 3AL0C 1IZ1A 4ESJA 1E3PA 3TQNA 3I3LA 4M3EA 2AQFA 3SEZA 1LDJA 2VKEA 3M1EA 4NQWA 2CW7A 4M6YA 2EFNA 4B44A 4E6KG 2EFQA 1BW5A 5JVTA 1ETQA 4WF2A 5FLXK 1GUUA 3ZQ7A 3GTGJ 1IC8A 1FLIA 1ZG5A 5E18F 4C3IJ 2QEXI 1B4AA 1EKEA 1HKQA 1OJLA 3DPTA 1HW5A 1TC3C 2QKMB 3EUAA 1X3ZB 4AWXB 4CCKA 2CYYA 1J7KA 5BOXA 5E1WA 4LG0A 3JRFA 3I4MJ 3ZQFA 2DJIA 4HNTA 2ZKZA 1G8XA 3FXKA 2Y0MA 3NAUA 1SVOA 3T0YA 3TOAA 2EZLA 5H20A 3E7LA 4MFEA 2VQLA 2QSHX 2ZFUA 2JJ7A 1XSXA 1G3YA 1OLTA 1D0YA 4CYCB 3PJRA 3SZGA 2VJ4A 4XN0A 2ISZA 1FIPA 3FXJA 3K0LA 3TOBA 5ICFA 5J3LA 1IRZA 2LFBA 3P9CA 2HTSA 3QRFF 4IHXA 1O4XA 3WGGA 3WTSC 5M3FJ 2BHYA 3GFLA 1DUXC 4CHUA 1IV8A 3I9V2 4I0AA 1ZKGA 2QCOA 3PUFA 5K7HA 4AUXA 1ENHA 1B9NA 3FXLA 3CCJI 2CUZA 2OTJI 3K70C 2NS8A 3QPSA 1ZQ3P 1M1EB 2AQEA 4Y13A 2ZJ2A 3ASOH 2FU4A 2ZNZA 2EZIA 1KU7A 3NQOA 2CV0A 3S1MJ 3Q9VA 2GXBA 5J47A 1B72A 2CUJA 4BU2A 1EH7A 3MZ8A 2X6XA 4B47A 2G7UA 4XLNF 1D5YA 4JP0A 3ZRGA 1RKTA 2Q2EB 5J1UA 3IRQA 3FHZA 1MSEC 1LKXA 2HWVA 3C2BA 3IC7A 1DGWY 4XSZF 4A6EA 2CFOA 2XKPA 3DU5A 5M5XJ 4KT5C 5CPRB 1SMYF 2V9KA 2A05A 2WA0A 2ZC2A 2M7BA 1ZH5A 2DN0A 2STWA 4X1EA 3ZMTA 3HDDA 1YQAA 2YS9A 2GZWA 4A3EJ 3ZOBA 3BP8A 2BY2A 4BXXJ 5HVQC 3SZPA 1RKWA 2DA2A 3ZN0A 2BW3A 1IN4A 2X0LA 4UHTA 4KICA 4RM2A 3RJPA 2VC1A 3HOXJ 1J09A 3K1NA 4HYEA 1OYYA 1U8BA 1KA8A 4ZYAA 4EM1A 4ZH4F 3QU6A 4N4NB 1Z0XA 4XKVA 4ENMA 4OIOF 3I4NJ 5FB2A 3PNYA 4ON0A 5DM7F 2KIFA 1MZBA 5FLMJ 4KISA 5DD8A 4M9ZA 4M73A 3E5UA 2CQKA 4W97A 3PUBA 2DA4A 3TP3A 4G7ZF 1ERDA 3IWFA 2HDWA 1QNTA 1T98A 2KT0A 2HZTA 3GF2A 1MGTA 1SFOJ 3DP7A 5DDGA 3RKXA 3HL2A 3E5XA 2A69F 4BQNA 1BOBA 2L9RA 3HKZA 4XONA 1VF9A 1UHWA 2RKHA 6PAXA 1IUYA 1CF7A 4JX6A 1MMSA 3VYUB 1P4XA 3K4JA 4MNUA 3W3CA 2E71A 2KQRA 2HOSA 4DBQA 4U7DA 4A3FJ 2M7AA 3OIPA 2JA2A 2MLKA 2UWMA 5AIQA 2R5YA 1GV2A 5AONA 2QKLB 2P7CB 4KJZA 4AIDA 2Y48A 1XG1A 1FZPB 1E17A 2H1LA 2CJJA 1YG2A 3T5XA 1PYVA 2R7OA 1TWHJ 1SAXA 2CV1A 2VC0A 3GW2A 3MZHA 1ZLKA 3GMEA 1VQ7I 3A0BC 4ZC3A 2IT0A 1I39A 2M2EA 3ZP5A 3HOZJ 2CWEA 2WAQA 3H3ZA 2KRFA 5DUIA 3JTHA 2ACJA 1O3QA 3KLNA 1G3WA 3J7ZI 1B8IA 3Q0WA 3QQAA 5IY5H 2PI0A 2D45A 1HKTA 2Z5UA 1QVUA 2DLLA 4G94A 4HSTA 5FKKA 4KNYA 1VQNI 2PN6A 1HW1A 3H9JA 2QQAA 2FXAA 3E6CC 4F52A 5FRNA 3BTLA 1X58A 2MA3A 2HOAA 4ZDLA 1XX5A 3S14J 2LR8A 4LK0F 1YTYA 2M3AA 4IL6C 4RBOA 2LOOA 3MCZA 1KZHA 3OL4A 1IN6A 1QZEA 2CQ7A 1VQ8I 1BW6A 4YFXF 5BPDA 2VE8A 1DP7P 2C6YA 1WRJA 3JRDA 2WTEA 1T6SA 1IRFA 1BOAA 3BJAA 3VWBA 3VODA 1X4PA 2FJ1A 2ZB9A 1S8NA 3IWZA 2W84A 2CSOA 4M3FA 1XGMA 4B4CA 1XSDA 2DDAA 1D8KA 3K69A 2ME0A 1IO2A 1USTA 2TRTA 5DCMB 1UAAA 4FISA 4NBQA 5AIPA 3E5QA 1BA5A 4AVZA 1T56A 1T2KA 2WV0A 3VDXA 4A0XA 4ZYHA 5HS8A 2XGCA 2STTA 4G7OF 1KU2A 4KIBA 1QHGA 3WU0A 4CYCA 3ECHA 4WXDA 1R5ID 5TGTA 2G9WA 5E3NA 3GFJA 5LGTA 2FMLA 2RDPA 4RB3C 2NNYA 3KEQA 1UHMA 5JLXA 4BE2A 1U0JA 2Q8KA 5DYMA 3C7JA 1JHHA 5HLGA 2WAEA 3MAJA 1VQKI 4EEFG 2B0LA 4EVIA 3OYJA 3BR2A 5FFXA 3ZQIA 1MMDA 1UG2A 1MBJA 2XUBA 5DV5A 3HJEA 3K6GA 4QLCU 3QOEA 4HZFA 2OA4A 4DYCA 5DCFA 1IXCA 2FBIA 1S9HA 2HKOA 4ASNA 3RPUD 2DI3A 5IT9Z 1ZRFA 3DPUA 3TP0A 2FOWA 1V4RA 4U0WA 4F55A 1FYKA 4C2UA 4BBSJ 1D0ZA 3G1OA 5CVRA 1F4KA 1HC8A 1MSFC 4IO9F 1TZLA 2GXAA 2DOFA 4HQEA 2Z16A 3PIOF 3OYFA 3COAC 4IF4A 2ZXHA 3SZTA 2VL8A 2EBIA 1U9NA 1IJWC 4XIDA 3CUQB 3DTKA 1YX5A 1BI2A 4ITVA 4C3HJ 2WC2A 2HXIA 2HFHA 4CYDA 2M9HA 3S93A 5EJCA 3PO3J 4PUSA 2BVLA 2YR2A 3W6KB 3CDLA 3ABUA 2DYSH 3PQJA 3RYRA 1YX3A 4Y7NJ 2CO5A 2LF7A 3HB9A 4XRMA 1ORKA 4MQ9F 5GTIC 4CXFA 1Z91A 3N05A 2VBZA 5LFAA 1OMIA 2OPTA 2Y31A 4K2EA 3JRCA 1TT5B 4OAYA 5ED4A 5IP7J 3WTYC 3D1NI 1PP7U 4LIVA 2BBYA 4JK1X 2MGQA 1ZG1A 2VQCA 3BG3A 3HHHA 3MWMA 1T0FC 3WTWC 4EMSA 2IA2A 4EJUA 1YE9A 2BV6A 4DW6A 1MIJA 1F9NA 2VBWA 4RAYA 4S05A 1VNDA 2HZDA 2RREA 4I98B 3VPRA 2M87A 5CVIA 3S3OA 1T39A 3JSOA 3HXLA 3VOEA 4EM2A 4UVAA 3CJNA 2QGUA 3ZQQA 2Y75A 1PUEE 2NVUB 3ZN1A 3Q5FA 2XF6A 2KMUA 1JKPC 4LK1F 2IBDA 2BY0A 1TQPA 1RESA 4KIFA 2GWRA 3L9FA 3KZIC 4LOCA 3VYRB 1YW9A 4EATA 5IP6A 1IF1A 2F5EA 2HDCA 4QSHA 3LAPA 1YIOA 1P4WA 4RGXA 2DODA 4BHBA 4JQFA 2VPLA 5E20A 4BS9A 3F8MA 4AC0A 4DZPA 5CQEA 1ETVA 1VQMI 3WG7H 3SYTA 3C1DA 2LKXA 4MEXF 1LNWA 1T08B 2AXLA 2X1EA 1G59A 3FWEA 4D5FA 1XB4A 3ZGKA 1BIAA 5GADJ 2VOPA 1X4OA 4KUMA 2DOEA 3BG6A 1V3FA 5DTDA 1MNEA 3EUKL 2KIMA 3QAHA 5J4YA 4I2OA 1G6NA 4UUTA 2MH9A 2IP2A 1OQYA 3I56I 1NH3A 3ABLH 3KE2A 4P1WA 2JMWA 3FM3A 5FLVA 1ZGJA 5B3SH 4FE7A 4LLGF 4WX9A 3W6VA 4BQAA 1WPKA 3Q0VA 3ERED 1T0FA 2OUMA 2LP0A 2EA4A 3VYTB 5D4SA 1X2MA 1S7OA 3FX3A 3L1PA 3QP5A 3V7CA 4RM3A 3PSFA 2OC6A 1V5FA 4D5CA 2XRLA 4ESBA 1Z6RA 2YPRA 5HOOA 3O2PE 3HRSA 4CCLA 2IVMA 5H2FC 3AG1H 3C3WA 4CCOA 2XAFA 4IQ4A 1U2WA 2EINH 4IVNA 4XLCA 4D0PA 2Q0OA 1LQ1A 2ZXIA 1U8RA 2K4JA 5LHIA 1XGNA 2EILH 4FETA 4NNJA 4OMYA 3K7AJ 1E3OC 1ZARA 2K40A 4NUBA 5E1ZB 4RAFA 3TKYA 4ZTJA 2GOXB 1KYWA 2LREA 4AVPA 2DBBA 2A61A 2DT5A 2E60A 2HVQA 2Y2ZA 1GT0C 4IHWA 4L9NA 2EZKA 2JSPA 3CDHA 2V79A 4A3LJ 3LMMA 1E0EA 1U78A 2IPQX 4XKBA 2EV5A 4LFUA 3IAS2 2XSDC 3L2WA 5ILUA 1KGSA 4P55A 4EJOA 4AM3A 1HA8A 2EZHA 1YLFA 3F8BA 3MMYB 3RDIA 4XRSA 1AHDP 1RPWA 2Z2SB 4V19K 4O5VA 4PJJA 2X9DA 1KONA 1P6RA 1LB2A 4P9UA 1VQ4I 2DQLA 2X6OA 2CU7A
chains in the Genus database with same CATH topology
1G3SA 3WE3A 1UFMA 4HV6A 1WI9A 3LAJA 4BHCA 2CG4A 4CO8A 1Z1DA 3RPUA 4OIPF 4A12A 4A5MA 2XROA 5E8GA 2HGCA 2HQRA 4P96A 3LFKA 3G73A 2VBXA 3WODF 3D5LA 4ZZLA 5CVJA 3CUQA 4IRHA 3RPQA 3EETA 3H92A 3VEPA 1O3SA 1S7AA 2LSOA 4CDGA 3J81K 1UCRA 2R7FA 2BE5F 1IN8A 4N0BA 3WGHA 4PGHA 1FYMA 2FF4A 1EV7A 1LJ9A 1T38A 3GUDA 4ENKA 1SD5A 2FA5A 1Z05A 4HLXA 4A5NA 1A04A 4G9YA 2V1UA 3O6BB 4HX8A 2H6CA 4FX4A 4RGSA 4AD9A 3I59A 1HQCA 2GQQA 1FX7A 1J9IA 2ZO4A 2EV0A 5A2QZ 2CW0F 2MBFA 1KU9A 4OMZA 1FYLA 2J5PA 2L4MA 2MC3A 3CTAA 5IT9K 3V8LA 3V4GA 3KFWX 1DPUA 3F22A 3WTUC 1EH6A 3L7WA 3V8KA 3K1MA 1LDKB 1MKMA 4GGGA 1WQ2A 1OR7A 2F5DA 4R79A 3GXOA 3KP7A 3ZPLA 1R1VA 3EQLF 3GVAA 5HDNA 2COMA 2EB7A 3NRVA 3V8JA 3MQ0A 1FWZA 1MD0A 1U5TB 2ELHA 3MFKA 5D8LB 2DW4A 3WG9A 1GHCA 4NHJA 2BYVE 4L9TA 1J2XA 1B6AA 4JBAA 1Z6TA 3SXYA 1QGPA 4Q47A 4ESFA 1KYZA 3HHGA 3F23A 1SFUA 4I09A 5BS6A 1SD4A 2W57A 2QQ9A 3M9AA 3HOSA 1LDDA 1C0WA 4EJTA 3S2WA 3U9GA 3ELKA 1YFHA 4KIGA 1JHFA 4LB6B 3LA7A 2E1NA 1O7LA 2P5KA 4Q48A 3J80K 2L02A 3T8RA 2HYGD 3ML6A 2PFBA 1FSEA 2UXNA 1H9TA 1FP1D 5JHUA 2JRTA 4CGZA 2ISYA 4Q5SF 2TDXA 3VB2A 3DF8A 3NEUA 4GO1A 5LEKA 4U0YA 2FNAA 1DDNA 3K2ZA 3FXRA 4I01A 1ZG3A 3GX4X 3M8EA 4LMYA 3Q9SA 3T1BA 2QM3A 4EGZA 1IAWA 3F72A 3WTTC 1O3TA 3P9KA 2ETHA 1XCBA 3KP4A 2MD5A 3FF5A 2XV4S 2RV8A 3HSRA 3RIRA 1F5TA 3CUOA 2V9VA 3P9IA 4KA4A 4IHTA 4A2UA 4LD5A 2J5OA 4EJVA 4IJAA 4FX0A 3WTVC 3CO6C 4RS8A 2KJCA 2MLGA 1WSUA 2X4HA 4H0EA 1BBYA 1W5TA 1OYWA 5TRDA 1SMTA 3DKWA 5LRSA 2ESNA 3KP3A 2FEZA 5J6XA 1SFXA 1K78B 3R60A 3E3VA 2EWNA 5CLSA 2FOKA 2O8XA 3EDPA 1ON2A 5L3BA 2OQGA 1ZLJA 1ZRCA 4UXNA 2JPCA 2VE9A 4ZYGA 2WWYA 3JAMZ 2QQBA 4N9HA 4WXHA 4HF2A 4AIJA 4P5OA 5F64A 2PMHA 5HS7A 3TO6A 3FMSA 3ZMDA 2L4AA 2XAJA 3EUHA 2ZFWA 4LLLA 5ICGA 3ISPA 4LJZF 2DTRA 4I0BA 2IW5A 1FBSA 4LLNA 2CGPA 3J7AO 4L9JA 3OV8A 4KYWA 1FP2A 2R3SA 3GEZA 1TTYA 2OD5A 5D5XB 2P8TA 3BJ6A 1YS7A 4Y17A 2XVCA 2F2EA 1P92A 2K27A 2P7VB 3ECOA 5D5WB 1L0OC 5BPIA 1IN7A 4KDPA 1MJAA 1ZGAA 4G6QA 1AOYA 2XHKA 3I5UA 2HEOA 3QU3A 2QBYB 1EH8A 2Q2EA 2W25A 1LVAA 1IXSB 4P9FA 1ZREA 2O61A 2P6TA 3F6OA 2FBKA 4M6XA 3WGIA 3LA2A 3EYYA 1GXPA 4AIHA 2VOOA 1G3TA 2OZUA 5L3FA 4HF0A 3LWFA 2F5CA 2IRFG 4U88A 4A6DA 2E7WA 1BI1A 3HOTA 4UVCA 3RKYA 5CVVA 3BWGA 3C18A 3HTSB 4R1HA 4FHTA 4KFCA 3DPLC 1O57A 4I7HA 3HRMA 4KMUX 3E6MA 3RYPA 3R6SA 1O3RA 1BC8C 1LEBA 2EFPA 1REPC 1MJBA 1HSJA 4YFNF 4Z2YA 3D0SA 3I0TA 2M1BA 1W5SA 2M30A 3ZMZA 5E1XA 4O3MA 1R1UA 5CJ9A 2HS5A 3I71A 3TDZC 1K78A 3KP5A 2HR3A 5ICEA 1XCVA 1K7AA 4IPAA 2BEOA 2RNJA 4RB0A 2E1CA 4XLPF 3K9TA 5LGNA 2BGCA 3L2CA 2G7HA 2YX4A 2LF8A 4M72A 3CLOA 2FQ3A 2EFOA 1R23A 5FFZA 1QPMA 4OOIA 4G6DA 5TJJA 4NB5A 3F8FA 3CUQC 2OQRA 3RI4A 5DCMA 5HDKA 1J75A 2QENA 5E17F 3FM5A 1NHAA 3ZMSA 5LLQA 4EGYA 4HQMA 4HX7A 4I02A 5LHGA 4UV8A 5KVRA 3BDDA 3ULQB 4B09A 3MZYA 4IRIA 4YIIA 4PGGA 2XAQA 2PMUA 1XDSA 3P7NA 3QPHA 2K7LA 4BHPA 2GIVA 1TBXA 1ULYA 1R00A 4EJWA 2L54A 2KIUA 5ILVA 3FMQA 2KKOA 3QPTA 4YFKF 1HKSA 3PFIA 2HQNA 2UZKA 2QBYA 4HX4A 3TDUC 2QZ8A 2JTVA 1FNNA 4UUVA 1FBQA 2NYXA 2PG4A 4L18B 2DO7A 2V1XA 5L3DA 5J8CA 1USSA 2NRAC 3JAMK 1QBJA 1S29A 5ERIA 1B1BA 4EM0B 2NNNA 2OBPA 3M8FA 4MEYF 2VODA 5LBQA 5D5VB 2XRNA 5DD4A 4ENJA 4HDVA 1FOKA 1TQMA 1WKMA 1MDMB 4G7HF 2VBYA 2FMYA 4FT8A 2K02A 2D1HA 4L0YB 3ZMUA 1CF7B 3ZMVA 4XSXF 3F8CA 1YW7A 4RGRA 4WXCA 4MGRA 4HA8A 5BMZA 2PBIA 2W85A 4OIQF 4M74A 1RZ4A 1UB9A 1TNTA 1HBXG 2A6HF 4BNCA 4WWCA 2ADUA 4BYYA 3R0JA 3HUGA 4KN7X 3T8TA 1ONVA 1TLHB 1RUOA 3I54A 4ETSA 5HS9A 1R5GA 4CZZA 4KN4X 1D8JA 2A6EF 1R36A 3FMRA 2MH2A 1QZZA 4WCGA 4EV0A 2V1DA 2P5LC 4BXUA 3JW4A 2FRHA 4ZZDA 3WU1B 5D4RA 4N9IA 1KU3A 1RIOH 2PJPA 3KZZA 2GAUA 4U7BA 5CYVA 1Z7UA 1ODDA 4HBLA 3R61A 2LNBA 1P2FA 3ABTA 4GCVA 2EV6A 4AIKA 1X3UA 2R7DA 1XGSA 1TQIA 2XKOA 5HDGA 3HRTA 3KP2A 2ZCWA 3KETA 3RKWA 3ROUA 4KMFA 5F1RA 1B59A 1BJAA 1BN5A 1I1GA 1RNLA 2W24A 2O3FA 3E97A 1R22A 3HRUA 2L01A 1KQ8A 2VT3A 1J59A 5LGUA 1BIBA 3FXQA 4ZYDA 1JGSA 1O7FA 2O0YA 4GYGA 5LEJA 4B8XA 2ZMEB 3OOPA 1HXDA 4PZJA 5CVUA 4XRFA 4Y15A 2JSCA 2JT1A 4HW0A 2L3DA 1W4MA 2HYFA 2IJLA 1ZN2A 3JTGA 5IT3A 3V7SA 2YX7A 4IXAA 1D5VA 4S04A 1Y0UA 1FSHA 1ON1A 2A3SA 2GXGA 2ZNYA 3EYIA 1R1TA 2NS0A 1H9GA 5L3GA 1TNSA 1G4DA 1MDMA 1U5TC 1U3EM 2DK8A 1W7PD 2EK5A 4BAYA 4RB1A 1QZYA 3FZVA 1W7PB 2OZ6A 4R8HA 1GXQA 3O3KA 3BOQA 3REOA 2M45A 2QWWA 2YSRA 1XGOA 1SD6A 2Z99A 3GZ5A 4MTEA 2QVOA 5JI6A 5ILSA 3RTRA 1XMKA 1JE8A 2EJRA 1ZHFA 1YYVA 4OINF 4O6JA 1H0MA 2A5YB 1TW2A 2D1VA 1K79A 2FSWA 3KZYA 3WTZA 1TW3A 3BPXA 1PDNC 3DQVC 1DPRA 2H6BA 1SFEA 1U6GA 1GVJA 1FY7A 3J81Z 1OYIA 4E70A 4LB5A 2GA2A 1ZYRF 1XMAA 1U5TA 5D6EA 2DPUA 1Q1HA 2QUFA 3HSEA 2DPDA 4GXOA 3SFZA 2LDUA 3TO7A 3JSPA 2P6SA 2O03A 3V7RA 4M9XA 3CO7C 2VT2A 5H6RA 1L3LA 2K86A 5BQTA 3W6JB 2EFWA 5KK1A 2JZYA 5K5OA 3GZ6A 2RGVA 2K4BA 2VN2A 1FC3A 4F7ZA 5FGMA 5HLIA 5A2QK 4U0VA 4UVBA 4HAMA 1XD7A 2F5FA 3HYIA 1Z9CA 2RVCA 5HLHA 3G3ZA 4MHGA 3IHUA 2DQRA 4HF1A 3KLOA 3LA3A 3IL2A 1I5ZA 5JFRA 3GO5A 4XBFA 3E6DA 2HKXA 4A0YA 3K1PA 3N97A 3DFGA 2ZMEA 2UXXA 5FLXZ 1SD7A 4GYIA 4HLYA 2ZXJA 3F6VA 3KP6A 5EEHA 3L00A 1QO0D 3IKVA 3QP6A 1IW7F 4UV9A 2M5WA 2M8EA 4MQVA 1QQIA 1WWXA 1YS6A 3IRRA 4DNCA 2IA0A 2RQPA 2Z33A 1R5HA 1B9MA 2CFXA 2XIGA 5F6FA 2A07F 1BM9A 4PCQA 3BZ6A 1KQ9A 1JXSA 4G8XA 1AWCA 1IRGA 3I59B 3PQKA 3WTXC 3F8NA 1W7PA 2Z3YA 2VXZA 2FE3A 4PDKA 1YW8A 4TV7A 2AS5F 2ESHA 2PLYA 1OKRA 3H3UA 5JR3A 4RGUA 3R0AA 3U2RA 3J80Z 4DQ2A 1KQ0A 2P4WA 1F1ZA 1RUNA 4HOBA 3DV8A 3GYHX 1S6LA 1IXRC 2DFIA 2IA1A 5FD5A 3GWZA 1PP8F 2PEXA 2PQ8A 2DU9A 3GLXA 1FPQA 4L5IA 4IHSA 5DEQA 4OIRF 2DK5A 2NAZA 5D8KB 3TO9A 3GFMA 1D3YA 1R58A 2EA2A 4QWQA 2HTJA 4LG0B 5FD6A 1J0RA 4CICA 5LRRA 2D2WA 4L0ZB 3WE2A 1ZRDA 1XDUA 3I53A 3R4KA 1ZAOA 1IN5A 3VFZA 4UNOA 2A68F 1BC7C 3MEXA 3M7GA 3B02A 4A0ZA 2XGXA 4ZYEA 3LQRA 4Q4ZF 1E2XA 5K5RA 4HV5A 5EEGA 1I1SA 3LSTA 1STZA 5L3EA 5LHHA 3DXJF 3B73A 3U1DA 2LKPA 4EQQA 1I27A 4RB2C 2V6CA 5K5QA 3HSFA 1OPCA 1S3JA 4MTDA 2DAOA 2HOEA 1MJ9A 1P4AA 2FNPA 2H94A 1CGPA 2ZBKA 2GA1A 3HIFA 3SHFA 4RAZA 2VONA 3BY6A 3I4PA 4L5JA 4IRGA 4BH9A 3GFIA 2JPBA 1YO5C 5K1YA 3FXUA 3SQNA 1J5YA 5D6FA 5FO5A 3BROA 4OU0A 5J8FA 3AAFA 5DUKA 3HTUA 1BI0A 1FT9A 1K6OA 2H27A 5H6QA 4ENNA 2XAHA 1R7JA 2O6GE 2KJBA 4L9VA 3KCCA 3I58A 2XASA 1BI3A 4M9SA 3IKTA 2H09A 4WK8F 2QLZA 4HDUA 1LEAA 1VTNC 1RI7A 2OAZA 3LQQA 3E6BA 3QOPA 3F21A 3BPVA 4M71A 2P5VA 2QYOA 1I6XA 1FBUA 3F3XA 1XSVA 5L3CA 2YU3A 2XAGA 1XN7A 2RN7A 4YG2F 4YIFA 3BJOA 4LGWA 2E7XA 3N4MA 2RC4A 3KEOA 2FBHA 2Z9OA 5E8IA 1HW2A 3TGNA 1HSTA 3DEUA 2OU2A 5D5UB 3L09A 3I64A 5ICCA 1IZ1A 4ESJA 3TQNA 1LDJA 3M1EA 4NQWA 4M6YA 2EFNA 2EFQA 5JVTA 4WF2A 5FLXK 3ZQ7A 1FLIA 1ZG5A 5E18F 1B4AA 1HKQA 3DPTA 1HW5A 4AWXB 2CYYA 1J7KA 5BOXA 5E1WA 4LG0A 2ZKZA 2Y0MA 3T0YA 3TOAA 5H20A 1XSXA 1G3YA 2ISZA 3K0LA 3TOBA 5ICFA 3P9CA 2HTSA 3QRFF 3WGGA 3WTSC 3GFLA 1DUXC 4CHUA 4I0AA 1B9NA 4Y13A 2ZJ2A 2FU4A 2ZNZA 1KU7A 3NQOA 3Q9VA 2GXBA 1EH7A 2G7UA 4XLNF 3IRQA 3FHZA 2HWVA 3IC7A 4XSZF 4A6EA 2XKPA 4KT5C 1SMYF 1ZH5A 2STWA 3ZMTA 1YQAA 2GZWA 3BP8A 5HVQC 3SZPA 3ZN0A 1IN4A 2X0LA 4UHTA 4KICA 3RJPA 2VC1A 3K1NA 4HYEA 1OYYA 1KA8A 4EM1A 4ZH4F 3QU6A 4ENMA 4OIOF 5FB2A 4ON0A 2KIFA 1MZBA 5DD8A 4M9ZA 4M73A 3E5UA 2CQKA 4G7ZF 3IWFA 1QNTA 1T98A 2HZTA 3GF2A 1MGTA 3DP7A 5DDGA 3RKXA 3E5XA 2A69F 1UHWA 2RKHA 6PAXA 1IUYA 1CF7A 1P4XA 4MNUA 4U7DA 2MLKA 2UWMA 5AIQA 5AONA 2P7CB 2Y48A 1FZPB 1E17A 1YG2A 3T5XA 1SAXA 2VC0A 3GW2A 3MZHA 1ZLKA 2IT0A 3ZP5A 2CWEA 3H3ZA 2KRFA 5DUIA 3JTHA 2ACJA 1O3QA 3KLNA 1G3WA 2PI0A 2D45A 1HKTA 2Z5UA 2DLLA 4G94A 4KNYA 2PN6A 1HW1A 2QQAA 2FXAA 3E6CC 2MA3A 4LK0F 1YTYA 3MCZA 1IN6A 4YFXF 5BPDA 1DP7P 2VE8A 2C6YA 1WRJA 2WTEA 1T6SA 1IRFA 1BOAA 3BJAA 3VODA 1S8NA 3IWZA 2W84A 2CSOA 1XGMA 1XSDA 1D8KA 3K69A 1USTA 5DCMB 5AIPA 3E5QA 1T2KA 2WV0A 4A0XA 4ZYHA 5HS8A 2STTA 4G7OF 1KU2A 4KIBA 3WU0A 3ECHA 4WXDA 2G9WA 3GFJA 5LGTA 2FMLA 2RDPA 4RB3C 2NNYA 3KEQA 1UHMA 2Q8KA 5DYMA 3C7JA 1JHHA 5HLGA 3MAJA 2B0LA 4EVIA 5FFXA 2XUBA 5DV5A 4QLCU 4HZFA 2OA4A 5DCFA 1IXCA 2FBIA 2HKOA 4ASNA 2DI3A 5IT9Z 1ZRFA 4U0WA 1V4RA 1FYKA 5CVRA 1F4KA 4HQEA 3COAC 4IF4A 3SZTA 3CUQB 1BI2A 2WC2A 2HFHA 4CYDA 2YR2A 3W6KB 3ABUA 3PQJA 3RYRA 2CO5A 2LF7A 4MQ9F 4CXFA 1Z91A 2VBZA 1OMIA 4K2EA 5ED4A 3WTYC 1PP7U 2BBYA 4JK1X 1ZG1A 3HHHA 3MWMA 3WTWC 4EMSA 2IA2A 4EJUA 2BV6A 1F9NA 2VBWA 4RAYA 4S05A 4I98B 2M87A 5CVIA 1T39A 3JSOA 3VOEA 4EM2A 4UVAA 3CJNA 2Y75A 1PUEE 3ZN1A 3Q5FA 4LK1F 1TQPA 4KIFA 2GWRA 3L9FA 1IF1A 1YW9A 2F5EA 2HDCA 3LAPA 1YIOA 1P4WA 4RGXA 4BHBA 4JQFA 5E20A 3F8MA 3C1DA 4MEXF 1LNWA 2AXLA 3FWEA 1XB4A 1BIAA 2VOPA 4KUMA 1V3FA 2KIMA 3QAHA 4I2OA 1G6NA 2MH9A 2IP2A 3KE2A 3FM3A 1ZGJA 4WX9A 4LLGF 4BQAA 3ERED 1T0FA 2EA4A 5D4SA 3FX3A 1S7OA 3QP5A 3V7CA 4ESBA 1Z6RA 5HOOA 2YPRA 3O2PE 3HRSA 2IVMA 3C3WA 2XAFA 1U2WA 4IVNA 4D0PA 2Q0OA 1LQ1A 1U8RA 2K4JA 5LHIA 1XGNA 4OMYA 1ZARA 5E1ZB 3TKYA 4AVPA 1KYWA 2DBBA 2A61A 2DT5A 4L9NA 3CDHA 2V79A 1U78A 2IPQX 2EV5A 4LFUA 5ILUA 1KGSA 4P55A 4EJOA 1YLFA 3F8BA 3RDIA 4O5VA 1P6RA 1LB2A 4P9UA 2DQLA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1G3S A;  3WE3 A;  1UFM A;  4HV6 A;  1WI9 A;  3LAJ A;  4BHC A;  2CG4 A;  4CO8 A;  1Z1D A;  3RPU A;  4OIP F;  4A12 A;  4A5M A;  2XRO A;  5E8G A;  2HGC A;  2HQR A;  4P96 A;  3LFK A;  3G73 A;  2VBX A;  3WOD F;  3D5L A;  4ZZL A;  5CVJ A;  3CUQ A;  4IRH A;  3RPQ A;  3EET A;  3H92 A;  3VEP A;  1O3S A;  1S7A A;  2LSO A;  4CDG A;  3J81 K;  1UCR A;  2R7F A;  2BE5 F;  1IN8 A;  4N0B A;  3WGH A;  4PGH A;  1FYM A;  2FF4 A;  1EV7 A;  1LJ9 A;  1T38 A;  3GUD A;  4ENK A;  1SD5 A;  2FA5 A;  1Z05 A;  4HLX A;  4A5N A;  1A04 A;  4G9Y A;  2V1U A;  3O6B B;  4HX8 A;  2H6C A;  4FX4 A;  4RGS A;  4AD9 A;  3I59 A;  1HQC A;  2GQQ A;  1FX7 A;  1J9I A;  2ZO4 A;  2EV0 A;  5A2Q Z;  2CW0 F;  2MBF A;  1KU9 A;  4OMZ A;  1FYL A;  2J5P A;  2L4M A;  2MC3 A;  3CTA A;  5IT9 K;  3V8L A;  3V4G A;  3KFW X;  1DPU A;  3F22 A;  3WTU C;  1EH6 A;  3L7W A;  3V8K A;  3K1M A;  1LDK B;  1MKM A;  4GGG A;  1WQ2 A;  1OR7 A;  2F5D A;  4R79 A;  3GXO A;  3KP7 A;  3ZPL A;  1R1V A;  3EQL F;  3GVA A;  5HDN A;  2COM A;  2EB7 A;  3NRV A;  3V8J A;  3MQ0 A;  1FWZ A;  1MD0 A;  1U5T B;  2ELH A;  3MFK A;  5D8L B;  2DW4 A;  3WG9 A;  1GHC A;  4NHJ A;  2BYV E;  4L9T A;  1J2X A;  1B6A A;  4JBA A;  1Z6T A;  3SXY A;  1QGP A;  4Q47 A;  4ESF A;  1KYZ A;  3HHG A;  3F23 A;  1SFU A;  4I09 A;  5BS6 A;  1SD4 A;  2W57 A;  2QQ9 A;  3M9A A;  3HOS A;  1LDD A;  1C0W A;  4EJT A;  3S2W A;  3U9G A;  3ELK A;  1YFH A;  4KIG A;  1JHF A;  4LB6 B;  3LA7 A;  2E1N A;  1O7L A;  2P5K A;  4Q48 A;  3J80 K;  2L02 A;  3T8R A;  2HYG D;  3ML6 A;  2PFB A;  1FSE A;  2UXN A;  1H9T A;  1FP1 D;  5JHU A;  2JRT A;  4CGZ A;  2ISY A;  4Q5S F;  2TDX A;  3VB2 A;  3DF8 A;  3NEU A;  4GO1 A;  5LEK A;  4U0Y A;  2FNA A;  1DDN A;  3K2Z A;  3FXR A;  4I01 A;  1ZG3 A;  3GX4 X;  3M8E A;  4LMY A;  3Q9S A;  3T1B A;  2QM3 A;  4EGZ A;  1IAW A;  3F72 A;  3WTT C;  1O3T A;  3P9K A;  2ETH A;  1XCB A;  3KP4 A;  2MD5 A;  3FF5 A;  2XV4 S;  2RV8 A;  3HSR A;  3RIR A;  1F5T A;  3CUO A;  2V9V A;  3P9I A;  4KA4 A;  4IHT A;  4A2U A;  4LD5 A;  2J5O A;  4EJV A;  4IJA A;  4FX0 A;  3WTV C;  3CO6 C;  4RS8 A;  2KJC A;  2MLG A;  1WSU A;  2X4H A;  4H0E A;  1BBY A;  1W5T A;  1OYW A;  5TRD A;  1SMT A;  3DKW A;  5LRS A;  2ESN A;  3KP3 A;  2FEZ A;  5J6X A;  1SFX A;  1K78 B;  3R60 A;  3E3V A;  2EWN A;  5CLS A;  2FOK A;  2O8X A;  3EDP A;  1ON2 A;  5L3B A;  2OQG A;  1ZLJ A;  1ZRC A;  4UXN A;  2JPC A;  2VE9 A;  4ZYG A;  2WWY A;  3JAM Z;  2QQB A;  4N9H A;  4WXH A;  4HF2 A;  4AIJ A;  4P5O A;  5F64 A;  2PMH A;  5HS7 A;  3TO6 A;  3FMS A;  3ZMD A;  2L4A A;  2XAJ A;  3EUH A;  2ZFW A;  4LLL A;  5ICG A;  3ISP A;  4LJZ F;  2DTR A;  4I0B A;  2IW5 A;  1FBS A;  4LLN A;  2CGP A;  3J7A O;  4L9J A;  3OV8 A;  4KYW A;  1FP2 A;  2R3S A;  3GEZ A;  1TTY A;  2OD5 A;  5D5X B;  2P8T A;  3BJ6 A;  1YS7 A;  4Y17 A;  2XVC A;  2F2E A;  1P92 A;  2K27 A;  2P7V B;  3ECO A;  5D5W B;  1L0O C;  5BPI A;  1IN7 A;  4KDP A;  1MJA A;  1ZGA A;  4G6Q A;  1AOY A;  2XHK A;  3I5U A;  2HEO A;  3QU3 A;  2QBY B;  1EH8 A;  2Q2E A;  2W25 A;  1LVA A;  1IXS B;  4P9F A;  1ZRE A;  2O61 A;  2P6T A;  3F6O A;  2FBK A;  4M6X A;  3WGI A;  3LA2 A;  3EYY A;  1GXP A;  4AIH A;  2VOO A;  1G3T A;  2OZU A;  5L3F A;  4HF0 A;  3LWF A;  2F5C A;  2IRF G;  4U88 A;  4A6D A;  2E7W A;  1BI1 A;  3HOT A;  4UVC A;  3RKY A;  5CVV A;  3BWG A;  3C18 A;  3HTS B;  4R1H A;  4FHT A;  4KFC A;  3DPL C;  1O57 A;  4I7H A;  3HRM A;  4KMU X;  3E6M A;  3RYP A;  3R6S A;  1O3R A;  1BC8 C;  1LEB A;  2EFP A;  1REP C;  1MJB A;  1HSJ A;  4YFN F;  4Z2Y A;  3D0S A;  3I0T A;  2M1B A;  1W5S A;  2M30 A;  3ZMZ A;  5E1X A;  4O3M A;  1R1U A;  5CJ9 A;  2HS5 A;  3I71 A;  3TDZ C;  1K78 A;  3KP5 A;  2HR3 A;  5ICE A;  1XCV A;  1K7A A;  4IPA A;  2BEO A;  2RNJ A;  4RB0 A;  2E1C A;  4XLP F;  3K9T A;  5LGN A;  2BGC A;  3L2C A;  2G7H A;  2YX4 A;  2LF8 A;  4M72 A;  3CLO A;  2FQ3 A;  2EFO A;  1R23 A;  5FFZ A;  1QPM A;  4OOI A;  4G6D A;  5TJJ A;  4NB5 A;  3F8F A;  3CUQ C;  2OQR A;  3RI4 A;  5DCM A;  5HDK A;  1J75 A;  2QEN A;  5E17 F;  3FM5 A;  1NHA A;  3ZMS A;  5LLQ A;  4EGY A;  4HQM A;  4HX7 A;  4I02 A;  5LHG A;  4UV8 A;  5KVR A;  3BDD A;  3ULQ B;  4B09 A;  3MZY A;  4IRI A;  4YII A;  4PGG A;  2XAQ A;  2PMU A;  1XDS A;  3P7N A;  3QPH A;  2K7L A;  4BHP A;  2GIV A;  1TBX A;  1ULY A;  1R00 A;  4EJW A;  2L54 A;  2KIU A;  5ILV A;  3FMQ A;  2KKO A;  3QPT A;  4YFK F;  1HKS A;  3PFI A;  2HQN A;  2UZK A;  2QBY A;  4HX4 A;  3TDU C;  2QZ8 A;  2JTV A;  1FNN A;  4UUV A;  1FBQ A;  2NYX A;  2PG4 A;  4L18 B;  2DO7 A;  2V1X A;  5L3D A;  5J8C A;  1USS A;  2NRA C;  3JAM K;  1QBJ A;  1S29 A;  5ERI A;  1B1B A;  4EM0 B;  2NNN A;  2OBP A;  3M8F A;  4MEY F;  2VOD A;  5LBQ A;  5D5V B;  2XRN A;  5DD4 A;  4ENJ A;  4HDV A;  1FOK A;  1TQM A;  1WKM A;  1MDM B;  4G7H F;  2VBY A;  2FMY A;  4FT8 A;  2K02 A;  2D1H A;  4L0Y B;  3ZMU A;  1CF7 B;  3ZMV A;  4XSX F;  3F8C A;  1YW7 A;  4RGR A;  4WXC A;  4MGR A;  4HA8 A;  5BMZ A;  2PBI A;  2W85 A;  4OIQ F;  4M74 A;  1RZ4 A;  1UB9 A;  1TNT A;  1HBX G;  2A6H F;  4BNC A;  4WWC A;  2ADU A;  4BYY A;  3R0J A;  3HUG A;  4KN7 X;  3T8T A;  1ONV A;  1TLH B;  1RUO A;  3I54 A;  4ETS A;  5HS9 A;  1R5G A;  4CZZ A;  4KN4 X;  1D8J A;  2A6E F;  1R36 A;  3FMR A;  2MH2 A;  1QZZ A;  4WCG A;  4EV0 A;  2V1D A;  2P5L C;  4BXU A;  3JW4 A;  2FRH A;  4ZZD A;  3WU1 B;  5D4R A;  4N9I A;  1KU3 A;  1RIO H;  2PJP A;  3KZZ A;  2GAU A;  4U7B A;  5CYV A;  1Z7U A;  1ODD A;  4HBL A;  3R61 A;  2LNB A;  1P2F A;  3ABT A;  4GCV A;  2EV6 A;  4AIK A;  1X3U A;  2R7D A;  1XGS A;  1TQI A;  2XKO A;  5HDG A;  3HRT A;  3KP2 A;  2ZCW A;  3KET A;  3RKW A;  3ROU A;  4KMF A;  5F1R A;  1B59 A;  1BJA A;  1BN5 A;  1I1G A;  1RNL A;  2W24 A;  2O3F A;  3E97 A;  1R22 A;  3HRU A;  2L01 A;  1KQ8 A;  2VT3 A;  1J59 A;  5LGU A;  1BIB A;  3FXQ A;  4ZYD A;  1JGS A;  1O7F A;  2O0Y A;  4GYG A;  5LEJ A;  4B8X A;  2ZME B;  3OOP A;  1HXD A;  4PZJ A;  5CVU A;  4XRF A;  4Y15 A;  2JSC A;  2JT1 A;  4HW0 A;  2L3D A;  1W4M A;  2HYF A;  2IJL A;  1ZN2 A;  3JTG A;  5IT3 A;  3V7S A;  2YX7 A;  4IXA A;  1D5V A;  4S04 A;  1Y0U A;  1FSH A;  1ON1 A;  2A3S A;  2GXG A;  2ZNY A;  3EYI A;  1R1T A;  2NS0 A;  1H9G A;  5L3G A;  1TNS A;  1G4D A;  1MDM A;  1U5T C;  1U3E M;  2DK8 A;  1W7P D;  2EK5 A;  4BAY A;  4RB1 A;  1QZY A;  3FZV A;  1W7P B;  2OZ6 A;  4R8H A;  1GXQ A;  3O3K A;  3BOQ A;  3REO A;  2M45 A;  2QWW A;  2YSR A;  1XGO A;  1SD6 A;  2Z99 A;  3GZ5 A;  4MTE A;  2QVO A;  5JI6 A;  5ILS A;  3RTR A;  1XMK A;  1JE8 A;  2EJR A;  1ZHF A;  1YYV A;  4OIN F;  4O6J A;  1H0M A;  2A5Y B;  1TW2 A;  2D1V A;  1K79 A;  2FSW A;  3KZY A;  3WTZ A;  1TW3 A;  3BPX A;  1PDN C;  3DQV C;  1DPR A;  2H6B A;  1SFE A;  1U6G A;  1GVJ A;  1FY7 A;  3J81 Z;  1OYI A;  4E70 A;  4LB5 A;  2GA2 A;  1ZYR F;  1XMA A;  1U5T A;  5D6E A;  2DPU A;  1Q1H A;  2QUF A;  3HSE A;  2DPD A;  4GXO A;  3SFZ A;  2LDU A;  3TO7 A;  3JSP A;  2P6S A;  2O03 A;  3V7R A;  4M9X A;  3CO7 C;  2VT2 A;  5H6R A;  1L3L A;  2K86 A;  5BQT A;  3W6J B;  2EFW A;  5KK1 A;  2JZY A;  5K5O A;  3GZ6 A;  2RGV A;  2K4B A;  2VN2 A;  1FC3 A;  4F7Z A;  5FGM A;  5HLI A;  5A2Q K;  4U0V A;  4UVB A;  4HAM A;  1XD7 A;  2F5F A;  3HYI A;  1Z9C A;  2RVC A;  5HLH A;  3G3Z A;  4MHG A;  3IHU A;  2DQR A;  4HF1 A;  3KLO A;  3LA3 A;  3IL2 A;  1I5Z A;  5JFR A;  3GO5 A;  4XBF A;  3E6D A;  2HKX A;  4A0Y A;  3K1P A;  3N97 A;  3DFG A;  2ZME A;  2UXX A;  5FLX Z;  1SD7 A;  4GYI A;  4HLY A;  2ZXJ A;  3F6V A;  3KP6 A;  5EEH A;  3L00 A;  1QO0 D;  3IKV A;  3QP6 A;  1IW7 F;  4UV9 A;  2M5W A;  2M8E A;  4MQV A;  1QQI A;  1WWX A;  1YS6 A;  3IRR A;  4DNC A;  2IA0 A;  2RQP A;  2Z33 A;  1R5H A;  1B9M A;  2CFX A;  2XIG A;  5F6F A;  2A07 F;  1BM9 A;  4PCQ A;  3BZ6 A;  1KQ9 A;  1JXS A;  4G8X A;  1AWC A;  1IRG A;  3I59 B;  3PQK A;  3WTX C;  3F8N A;  1W7P A;  2Z3Y A;  2VXZ A;  2FE3 A;  4PDK A;  1YW8 A;  4TV7 A;  2AS5 F;  2ESH A;  2PLY A;  1OKR A;  3H3U A;  5JR3 A;  4RGU A;  3R0A A;  3U2R A;  3J80 Z;  4DQ2 A;  1KQ0 A;  2P4W A;  1F1Z A;  1RUN A;  4HOB A;  3DV8 A;  3GYH X;  1S6L A;  1IXR C;  2DFI A;  2IA1 A;  5FD5 A;  3GWZ A;  1PP8 F;  2PEX A;  2PQ8 A;  2DU9 A;  3GLX A;  1FPQ A;  4L5I A;  4IHS A;  5DEQ A;  4OIR F;  2DK5 A;  2NAZ A;  5D8K B;  3TO9 A;  3GFM A;  1D3Y A;  1R58 A;  2EA2 A;  4QWQ A;  2HTJ A;  4LG0 B;  5FD6 A;  1J0R A;  4CIC A;  5LRR A;  2D2W A;  4L0Z B;  3WE2 A;  1ZRD A;  1XDU A;  3I53 A;  3R4K A;  1ZAO A;  1IN5 A;  3VFZ A;  4UNO A;  2A68 F;  1BC7 C;  3MEX A;  3M7G A;  3B02 A;  4A0Z A;  2XGX A;  4ZYE A;  3LQR A;  4Q4Z F;  1E2X A;  5K5R A;  4HV5 A;  5EEG A;  1I1S A;  3LST A;  1STZ A;  5L3E A;  5LHH A;  3DXJ F;  3B73 A;  3U1D A;  2LKP A;  4EQQ A;  1I27 A;  4RB2 C;  2V6C A;  5K5Q A;  3HSF A;  1OPC A;  1S3J A;  4MTD A;  2DAO A;  2HOE A;  1MJ9 A;  1P4A A;  2FNP A;  2H94 A;  1CGP A;  2ZBK A;  2GA1 A;  3HIF A;  3SHF A;  4RAZ A;  2VON A;  3BY6 A;  3I4P A;  4L5J A;  4IRG A;  4BH9 A;  3GFI A;  2JPB A;  1YO5 C;  5K1Y A;  3FXU A;  3SQN A;  1J5Y A;  5D6F A;  5FO5 A;  3BRO A;  4OU0 A;  5J8F A;  3AAF A;  5DUK A;  3HTU A;  1BI0 A;  1FT9 A;  1K6O A;  2H27 A;  5H6Q A;  4ENN A;  2XAH A;  1R7J A;  2O6G E;  2KJB A;  4L9V A;  3KCC A;  3I58 A;  2XAS A;  1BI3 A;  4M9S A;  3IKT A;  2H09 A;  4WK8 F;  2QLZ A;  4HDU A;  1LEA A;  1VTN C;  1RI7 A;  2OAZ A;  3LQQ A;  3E6B A;  3QOP A;  3F21 A;  3BPV A;  4M71 A;  2P5V A;  2QYO A;  1I6X A;  1FBU A;  3F3X A;  1XSV A;  5L3C A;  2YU3 A;  2XAG A;  1XN7 A;  2RN7 A;  4YG2 F;  4YIF A;  3BJO A;  4LGW A;  2E7X A;  3N4M A;  2RC4 A;  3KEO A;  2FBH A;  2Z9O A;  5E8I A;  1HW2 A;  3TGN A;  1HST A;  3DEU A;  2OU2 A;  5D5U B;  3L09 A;  3I64 A;  5ICC A;  1IZ1 A;  4ESJ A;  3TQN A;  1LDJ A;  3M1E A;  4NQW A;  4M6Y A;  2EFN A;  2EFQ A;  5JVT A;  4WF2 A;  5FLX K;  3ZQ7 A;  1FLI A;  1ZG5 A;  5E18 F;  1B4A A;  1HKQ A;  3DPT A;  1HW5 A;  4AWX B;  2CYY A;  1J7K A;  5BOX A;  5E1W A;  4LG0 A;  2ZKZ A;  2Y0M A;  3T0Y A;  3TOA A;  5H20 A;  1XSX A;  1G3Y A;  2ISZ A;  3K0L A;  3TOB A;  5ICF A;  3P9C A;  2HTS A;  3QRF F;  3WGG A;  3WTS C;  3GFL A;  1DUX C;  4CHU A;  4I0A A;  1B9N A;  4Y13 A;  2ZJ2 A;  2FU4 A;  2ZNZ A;  1KU7 A;  3NQO A;  3Q9V A;  2GXB A;  1EH7 A;  2G7U A;  4XLN F;  3IRQ A;  3FHZ A;  2HWV A;  3IC7 A;  4XSZ F;  4A6E A;  2XKP A;  4KT5 C;  1SMY F;  1ZH5 A;  2STW A;  3ZMT A;  1YQA A;  2GZW A;  3BP8 A;  5HVQ C;  3SZP A;  3ZN0 A;  1IN4 A;  2X0L A;  4UHT A;  4KIC A;  3RJP A;  2VC1 A;  3K1N A;  4HYE A;  1OYY A;  1KA8 A;  4EM1 A;  4ZH4 F;  3QU6 A;  4ENM A;  4OIO F;  5FB2 A;  4ON0 A;  2KIF A;  1MZB A;  5DD8 A;  4M9Z A;  4M73 A;  3E5U A;  2CQK A;  4G7Z F;  3IWF A;  1QNT A;  1T98 A;  2HZT A;  3GF2 A;  1MGT A;  3DP7 A;  5DDG A;  3RKX A;  3E5X A;  2A69 F;  1UHW A;  2RKH A;  6PAX A;  1IUY A;  1CF7 A;  1P4X A;  4MNU A;  4U7D A;  2MLK A;  2UWM A;  5AIQ A;  5AON A;  2P7C B;  2Y48 A;  1FZP B;  1E17 A;  1YG2 A;  3T5X A;  1SAX A;  2VC0 A;  3GW2 A;  3MZH A;  1ZLK A;  2IT0 A;  3ZP5 A;  2CWE A;  3H3Z A;  2KRF A;  5DUI A;  3JTH A;  2ACJ A;  1O3Q A;  3KLN A;  1G3W A;  2PI0 A;  2D45 A;  1HKT A;  2Z5U A;  2DLL A;  4G94 A;  4KNY A;  2PN6 A;  1HW1 A;  2QQA A;  2FXA A;  3E6C C;  2MA3 A;  4LK0 F;  1YTY A;  3MCZ A;  1IN6 A;  4YFX F;  5BPD A;  1DP7 P;  2VE8 A;  2C6Y A;  1WRJ A;  2WTE A;  1T6S A;  1IRF A;  1BOA A;  3BJA A;  3VOD A;  1S8N A;  3IWZ A;  2W84 A;  2CSO A;  1XGM A;  1XSD A;  1D8K A;  3K69 A;  1UST A;  5DCM B;  5AIP A;  3E5Q A;  1T2K A;  2WV0 A;  4A0X A;  4ZYH A;  5HS8 A;  2STT A;  4G7O F;  1KU2 A;  4KIB A;  3WU0 A;  3ECH A;  4WXD A;  2G9W A;  3GFJ A;  5LGT A;  2FML A;  2RDP A;  4RB3 C;  2NNY A;  3KEQ A;  1UHM A;  2Q8K A;  5DYM A;  3C7J A;  1JHH A;  5HLG A;  3MAJ A;  2B0L A;  4EVI A;  5FFX A;  2XUB A;  5DV5 A;  4QLC U;  4HZF A;  2OA4 A;  5DCF A;  1IXC A;  2FBI A;  2HKO A;  4ASN A;  2DI3 A;  5IT9 Z;  1ZRF A;  4U0W A;  1V4R A;  1FYK A;  5CVR A;  1F4K A;  4HQE A;  3COA C;  4IF4 A;  3SZT A;  3CUQ B;  1BI2 A;  2WC2 A;  2HFH A;  4CYD A;  2YR2 A;  3W6K B;  3ABU A;  3PQJ A;  3RYR A;  2CO5 A;  2LF7 A;  4MQ9 F;  4CXF A;  1Z91 A;  2VBZ A;  1OMI A;  4K2E A;  5ED4 A;  3WTY C;  1PP7 U;  2BBY A;  4JK1 X;  1ZG1 A;  3HHH A;  3MWM A;  3WTW C;  4EMS A;  2IA2 A;  4EJU A;  2BV6 A;  1F9N A;  2VBW A;  4RAY A;  4S05 A;  4I98 B;  2M87 A;  5CVI A;  1T39 A;  3JSO A;  3VOE A;  4EM2 A;  4UVA A;  3CJN A;  2Y75 A;  1PUE E;  3ZN1 A;  3Q5F A;  4LK1 F;  1TQP A;  4KIF A;  2GWR A;  3L9F A;  1IF1 A;  1YW9 A;  2F5E A;  2HDC A;  3LAP A;  1YIO A;  1P4W A;  4RGX A;  4BHB A;  4JQF A;  5E20 A;  3F8M A;  3C1D A;  4MEX F;  1LNW A;  2AXL A;  3FWE A;  1XB4 A;  1BIA A;  2VOP A;  4KUM A;  1V3F A;  2KIM A;  3QAH A;  4I2O A;  1G6N A;  2MH9 A;  2IP2 A;  3KE2 A;  3FM3 A;  1ZGJ A;  4WX9 A;  4LLG F;  4BQA A;  3ERE D;  1T0F A;  2EA4 A;  5D4S A;  3FX3 A;  1S7O A;  3QP5 A;  3V7C A;  4ESB A;  1Z6R A;  5HOO A;  2YPR A;  3O2P E;  3HRS A;  2IVM A;  3C3W A;  2XAF A;  1U2W A;  4IVN A;  4D0P A;  2Q0O A;  1LQ1 A;  1U8R A;  2K4J A;  5LHI A;  1XGN A;  4OMY A;  1ZAR A;  5E1Z B;  3TKY A;  4AVP A;  1KYW A;  2DBB A;  2A61 A;  2DT5 A;  4L9N A;  3CDH A;  2V79 A;  1U78 A;  2IPQ X;  2EV5 A;  4LFU A;  5ILU A;  1KGS A;  4P55 A;  4EJO A;  1YLF A;  3F8B A;  3RDI A;  4O5V A;  1P6R A;  1LB2 A;  4P9U A;  2DQL A; 
#chains in the Genus database with same CATH topology
 2O8K A;  1R9T J;  1G3S A;  2NXN B;  3WE3 A;  3DKX A;  1UFM A;  4HV6 A;  1WI9 A;  3LAJ A;  1FTZ A;  4F93 B;  4B43 A;  2CG4 A;  4BHC A;  1FMW A;  2XGE A;  1W1W E;  5HNF A;  3GTP J;  1UZC A;  1OFC X;  3NAR A;  2L7M P;  3TW7 A;  4CO8 A;  4DOZ A;  3GTJ J;  1Z1D A;  3M3Y J;  2OJE D;  3IH4 A;  3RPU A;  4OIP F;  2ZSH B;  2LVS A;  4A12 A;  4B3X A;  2DMN A;  4A5M A;  2XRO A;  2CRG A;  2JWT A;  5E8G A;  2HGC A;  2HQR A;  2R92 J;  5K7Z A;  2RAE A;  4P96 A;  3LFK A;  3G73 A;  4XOT A;  4DGW B;  2VBX A;  3WOD F;  3D5L A;  4ZZL A;  4RMN A;  5CVJ A;  3S1Q J;  3CUQ A;  4IRH A;  3RPQ A;  3EET A;  4QIW N;  3H92 A;  2BZT A;  3VEP A;  3RZD J;  1S7A A;  2LSO A;  4B48 A;  1O3S A;  2BVM A;  4C2T A;  4CDG A;  3SEQ A;  1N78 A;  3J81 K;  1Z67 A;  1UCR A;  1DQU A;  3CP2 A;  4XL9 A;  2R7F A;  1VQL I;  5EGO B;  2BE5 F;  1IN8 A;  2CS3 A;  4N0B A;  3CCU I;  3PM1 A;  3WGH A;  4PGH A;  4W1U A;  1FYM A;  4XQF A;  2FF4 A;  1EV7 A;  2KP6 A;  1LJ9 A;  5B5E C;  1T38 A;  3GUD A;  4ENK A;  1SD5 A;  2FA5 A;  1Z05 A;  4HLX A;  5B1B H;  2M8G X;  2KRC A;  4A5N A;  1A04 A;  5EZH A;  2IGM A;  4DZJ A;  1ZR2 A;  2K85 A;  2ZJQ F;  3H1C A;  4G9Y A;  3MD2 A;  3IAM 2;  2V1U A;  2E1M B;  3O6B B;  1BR4 A;  1I3Q J;  2X85 A;  4HX8 A;  2H6C A;  4HG2 A;  1Z3X A;  1ITY A;  2WAD A;  4FX4 A;  3GTQ J;  4RGS A;  4AD9 A;  3I59 A;  2JA8 J;  1HQC A;  2IAI A;  2GQQ A;  3KYL A;  1FX7 A;  3FKJ A;  1BL0 A;  4BGD A;  1J9I A;  3NWT A;  4PSW A;  3H5N A;  3RQI A;  2LC2 A;  2ZO4 A;  3GCM A;  2ME6 A;  3BC8 A;  4XM3 A;  2R5Z A;  3MVP A;  1JUP A;  2EV0 A;  5A2Q Z;  2CW0 F;  2MBF A;  2BXZ A;  1KU9 A;  4OMZ A;  4ABZ A;  1FYL A;  2J5P A;  5GAG J;  2L4M A;  2MC3 A;  2LY2 A;  2Z1D A;  3CTA A;  3OYD A;  4XR6 A;  1Z3Y A;  5EDN A;  5IT9 K;  5GTH C;  4IOC F;  2M0M A;  3V8L A;  3V4G A;  3KFW X;  1QPI A;  1DPU A;  3F22 A;  2R7S A;  3WTU C;  3WHC A;  4A69 C;  1EH6 A;  2LH9 A;  1Y8Q B;  3HEF A;  3L7W A;  3V8K A;  3K1M A;  4A3D J;  1LDK B;  1MKM A;  4GGG A;  1WQ2 A;  1OR7 A;  2F5D A;  4R79 A;  1JKR C;  3GXO A;  3JCU C;  1S72 I;  1MNM C;  3KP7 A;  2M34 A;  1R1V A;  3HBL A;  3CCV I;  3ZPL A;  3EQL F;  3GVA A;  2I5U A;  3ZQG A;  1HF0 A;  1SVM A;  5HDN A;  2COM A;  4C3J J;  2EB7 A;  3NRV A;  1WCM J;  3V8J A;  3MQ0 A;  3GTK J;  1FWZ A;  5FJ8 J;  1UG0 A;  2R7T A;  1MD0 A;  1U5T B;  2ELH A;  3OYC A;  3MFK A;  5D8L B;  2DW4 A;  3O8H A;  4FQG A;  3WG9 A;  2W4S A;  1GHC A;  4NHJ A;  3TBI A;  2BYV E;  1JKO C;  4L9T A;  1HDP A;  1J2X A;  2OCE A;  1B6A A;  1OCO H;  4JBA A;  4E7H A;  1A31 A;  2NVT J;  1Z6T A;  3SXY A;  1QGP A;  5JVG F;  4Q47 A;  4ESF A;  1KYZ A;  3HHG A;  2Y9Y A;  2F4M B;  4I09 A;  3F23 A;  1SFU A;  3GTM J;  5BS6 A;  1SD4 A;  2W57 A;  2QQ9 A;  3IP4 B;  3M9A A;  3HOS A;  1LDD A;  1C0W A;  4A3K J;  2K3P A;  3S16 J;  3DKY A;  3FKI J;  4EJT A;  4BEH B;  3S2W A;  3SFI A;  3U9G A;  1QVT A;  2A5W A;  1WJF A;  3OMY A;  3ELK A;  1YFH A;  4KIG A;  1JHF A;  4LB6 B;  3KIO A;  3LA7 A;  3HGG A;  2E1N A;  1O7L A;  2P5K A;  4Q48 A;  3W2A A;  2E1O A;  1WJC A;  2JK3 A;  4J01 A;  2HVR A;  4OAZ A;  3J80 K;  2XDV A;  2E2J J;  4S0H B;  2E5N A;  2DCE A;  2L7K A;  2L02 A;  3T8R A;  2HYG D;  3ML6 A;  2WB1 A;  2PFB A;  5JHF A;  2O7O A;  3VYS B;  3O8G A;  1A6Q A;  1FSE A;  1Y0N A;  2VKV A;  2UXN A;  3PL8 A;  1H9T A;  1FP1 D;  5JHU A;  2JRT A;  4CGZ A;  3BR1 A;  1YOV B;  2ISY A;  3CC4 I;  5EF6 A;  1YIT I;  2Y0S N;  4Q5S F;  2KDZ A;  3FHN A;  2TDX A;  5GPC A;  3VB2 A;  3DF8 A;  3NEU A;  5EG0 B;  4GO1 A;  3OS2 A;  5LEK A;  4U0Y A;  2FNA A;  1DDN A;  1H88 C;  3K2Z A;  1IG7 A;  2MC4 A;  3FXR A;  4I01 A;  1ZG3 A;  3GX4 X;  3M8E A;  4LMY A;  2PJR B;  2L0K A;  3H5R A;  3Q9S A;  2FQ4 A;  3OL3 A;  3T1B A;  2QM3 A;  4EGZ A;  1IAW A;  3F72 A;  4XKW A;  4L5E A;  3WTT C;  3H9Q A;  5EGO A;  1O3T A;  5HOD A;  2DT7 B;  3P9K A;  2VIX A;  4FCY A;  2RNG A;  2ETH A;  1XCB A;  5J40 A;  3KP4 A;  2MD5 A;  3FF5 A;  1TT0 A;  1LPQ A;  4FTH A;  2JUC A;  2XV4 S;  2RV8 A;  2GOM A;  3HSR A;  3RIR A;  1F5T A;  1JGG A;  4BJ5 C;  1X3W B;  4QPO A;  1X1P A;  3CUO A;  2V9V A;  3DEW A;  3P9I A;  3K4B A;  2PMZ A;  3HOV J;  4KA4 A;  4D7M A;  4IHT A;  1VQ6 I;  2YUS A;  4A2U A;  4LD5 A;  2J5O A;  4CUG A;  4EJV A;  4FE4 A;  4IJA A;  1ACI A;  1IUF A;  4FX0 A;  3OYL A;  3WTV C;  3CO6 C;  4RS8 A;  4HEA 2;  2JVG A;  3EUH C;  1PVE A;  2KJC A;  2LG4 A;  2LYC A;  2MLG A;  3BQY A;  3KYC B;  3OR2 C;  4XLA A;  1WSU A;  2X4H A;  4H0E A;  2W7N A;  1BBY A;  1W5T A;  1OYW A;  1SMT A;  3E1S A;  5TRD A;  3DKW A;  5LRS A;  1YJ9 I;  1H89 C;  4C9Y A;  1MH4 A;  5IOZ A;  2VB6 A;  2ESN A;  1VFC A;  1OIS A;  3KP3 A;  3M4O J;  3TL4 X;  2DFF A;  4UB6 C;  2FEZ A;  1S7E A;  2K9M A;  2XB0 X;  5J6X A;  3OYH A;  1SFX A;  3QYF A;  1OCC H;  5C3E J;  1SC7 A;  1K78 B;  4X6A J;  3R60 A;  3E3V A;  2EWN A;  5CLS A;  4XLE A;  3QOD A;  2FOK A;  1XTA A;  2W00 A;  2VXD A;  1MBH A;  4HRI A;  2O8X A;  2M4K A;  2QF7 A;  3EDP A;  4XK4 A;  1ON2 A;  5L3B A;  2VI6 A;  3CF5 F;  2MD0 A;  2OQG A;  1ZLJ A;  1ZRC A;  4UXN A;  2JPC A;  2HPI A;  3BTJ A;  1X1D A;  2ELJ A;  2VE9 A;  4ZYG A;  3G6E I;  2K5C A;  2WWY A;  3KPH A;  1D1A A;  3JAM Z;  3OSF A;  2QQB A;  3ABK H;  2VLA A;  3CP8 A;  4N9H A;  4WXH A;  2LY9 A;  4HF2 A;  4AIJ A;  4II3 A;  4P5O A;  1EJ9 A;  3OOU A;  5F64 A;  2PMH A;  5HS7 A;  3TO6 A;  4NC7 A;  2H8W A;  1K6Y A;  3FMS A;  2QA4 I;  3ZMD A;  2ICW G;  2L4A A;  2XAJ A;  4I6Z A;  3EUH A;  2ZFW A;  4LLL A;  5ICG A;  2L5Q A;  3HOW J;  1RR8 C;  3ISP A;  4LJZ F;  2DTR A;  4I0B A;  2IW5 A;  2F4I A;  1FBS A;  2HDD A;  4LLN A;  2CGP A;  2Y69 H;  3LFU A;  3J7A O;  2DFE A;  4L9J A;  2EIK H;  3OV8 A;  3HZJ A;  4LG3 A;  3LSH A;  2FX0 A;  4KT6 A;  4KYW A;  1FP2 A;  2BXY A;  2R3S A;  1TTY A;  2OD5 A;  3GEZ A;  3RSN A;  5D5X B;  3LSG A;  2P81 A;  2P8T A;  1A5J A;  3BJ6 A;  1YS7 A;  4Y17 A;  1UJ8 A;  2XVC A;  1POG A;  2F2E A;  1P92 A;  3BG9 A;  2K27 A;  4BEH A;  2P7V B;  4E7J A;  3ECO A;  1JTX A;  3H0D A;  3IH2 A;  2B9S A;  5D5W B;  1L0O C;  5BPI A;  1NG6 A;  1IN7 A;  1GV5 A;  4KDP A;  2R7Z J;  1MJA A;  4XLH A;  1ZGA A;  3J7A Y;  4G6Q A;  1AOY A;  2QSG X;  2XHK A;  3X2Q H;  3I5U A;  4JOM A;  2HEO A;  5M3M J;  3RQ4 A;  3QU3 A;  3W2W A;  2QBY B;  2V1N A;  3ZQL A;  1EH8 A;  2Q2E A;  2W25 A;  2E19 A;  4A3I J;  1LVA A;  2XPU A;  5F1J A;  4NDL A;  4U87 A;  1IXS B;  4P9F A;  1ZRE A;  3OSG A;  2O61 A;  1PUF B;  3MKZ A;  2X1D A;  2WAQ N;  3LSP A;  2P6T A;  1W0U A;  2QQ8 A;  5DM6 F;  3CCQ I;  3BCB A;  4CCM A;  3F6O A;  1FOY A;  2PX9 A;  4V2F A;  2FBK A;  4M6X A;  3WGI A;  5KNL A;  3LA2 A;  3EYY A;  3K4C A;  3S1R J;  4CCN A;  3SDB A;  1AKH B;  3K4M A;  1GXP A;  2CUE A;  3M07 A;  5EG0 A;  4AIH A;  4IX7 A;  3CME I;  1G3T A;  2VOO A;  5IYB J;  2HPM A;  2W48 A;  2OZU A;  5L3F A;  2KIS A;  3A4C A;  4HF0 A;  2PJR A;  3LWF A;  2F5C A;  4ZDO A;  2IRF G;  4U88 A;  4A6D A;  2E7W A;  1BI1 A;  2LRD A;  2DMU A;  4UVC A;  3HOT A;  1X2N A;  1JKQ C;  3RKY A;  3CCM I;  4BXF A;  1LFB A;  1TP4 A;  5CVV A;  3BWG A;  2LTP A;  1X1B A;  1JJ8 C;  2KHM A;  1MMN A;  3C18 A;  1SEU A;  3CQZ J;  3HTS B;  4R1H A;  4FHT A;  2E2I J;  3FBN B;  4KFC A;  3CCY A;  1O57 A;  3DPL C;  4I7H A;  3HRM A;  4KMU X;  1Y6I A;  3M8J A;  3E6M A;  3JRI A;  3RYP A;  3R6S A;  2I8D A;  1O3R A;  3KYD B;  2K9N A;  1BC8 C;  1LEB A;  2F48 A;  1DP3 A;  2EFP A;  1REP C;  1MJB A;  1HSJ A;  1WJ5 A;  1VI0 A;  4YFN F;  3AG3 H;  4Z2Y A;  4AYB A;  3D0S A;  2L9V A;  3I0T A;  2JVH A;  2M1B A;  3BR3 A;  3JR9 A;  1HOM A;  1W5S A;  5TIS C;  2M30 A;  3ZMZ A;  5E1X A;  4Y33 A;  1Y1V J;  3WHB A;  1ETW A;  1W0T A;  5FKL A;  4O3M A;  1R1U A;  2CUF A;  2XB5 A;  3SDG A;  4DYQ A;  2CV2 A;  1N75 A;  5CJ9 A;  2HS5 A;  3OIQ A;  1V55 H;  1ETY A;  2JRM A;  3I71 A;  3OR1 C;  4IQJ A;  3TDZ C;  1QRY A;  3A03 A;  1K78 A;  3KP5 A;  1YRN B;  2LK2 A;  2CW8 A;  2HR3 A;  1X1A A;  3HUG B;  2OCC H;  5FKM A;  1XCV A;  5ICE A;  4J19 A;  2E2H J;  1K7A A;  4QPQ A;  4IPA A;  2BEO A;  2RNJ A;  4RB0 A;  2CQX A;  3L2Q A;  4J00 A;  2E1C A;  4XLP F;  2HXO A;  1UEL B;  3K9T A;  5LGN A;  4IKF A;  3OYA A;  2BGC A;  3DBH B;  2Q1Z B;  1D1C A;  3F9K A;  3L2C A;  4GRI A;  4BKX A;  2G7H A;  2YX4 A;  3RZO J;  2LF8 A;  4M72 A;  3CLO A;  2NVX J;  3CCR I;  1R49 A;  2FQ3 A;  2EFO A;  2MG4 A;  1R23 A;  2R7Q A;  4BJ6 C;  3NWS A;  3H3V K;  5FFZ A;  1ETK A;  3DWL E;  1QPM A;  4OOI A;  2R0Q C;  2OV7 A;  4G6D A;  5TJJ A;  2GLO A;  4GDF A;  4NB5 A;  2H1K A;  3F8F A;  3CUQ C;  4DBR A;  2OQR A;  3A0H C;  3RI4 A;  4IEJ A;  3HM5 A;  5DCM A;  5HDK A;  1J75 A;  1AA7 A;  2QEN A;  5E17 F;  3FM5 A;  1NHA A;  3ZMS A;  2VJJ A;  3UNG C;  5LLQ A;  4JX4 A;  4EGY A;  3K10 A;  4HQM A;  2MSY A;  4HX7 A;  1JUM A;  4I02 A;  5LHG A;  3L2U A;  4UV8 A;  2AXT C;  2KPM A;  2WY7 Q;  3BDD A;  5KVR A;  3ULQ B;  3MZY A;  4B09 A;  1W5C C;  5B66 C;  5J4V A;  3G71 I;  2D5V A;  4IRI A;  1K4T A;  4YII A;  3DBR B;  4PGG A;  2XAQ A;  2PMU A;  1XDS A;  3P7N A;  3QPH A;  1ZK8 A;  2K7L A;  4BHP A;  2GIV A;  4CZC A;  4V2G A;  1TBX A;  2JUG A;  1ULY A;  1R00 A;  2NS7 A;  4EJW A;  3CJQ B;  2L54 A;  2KIU A;  4JYK A;  5ILV A;  3FMQ A;  2KKO A;  3L2V A;  4PJN A;  3QPT A;  4YFK F;  4UUS B;  3QYB A;  2VJI A;  4CCJ A;  4RAG A;  5C44 J;  2DJN A;  2OF7 A;  1HKS A;  3KX2 A;  4M3G A;  2HYJ A;  3PFI A;  2HQN A;  1WFX A;  2UZK A;  1RR7 A;  2KIQ A;  5GP9 A;  2QBY A;  3AL0 B;  3HPG A;  4HX4 A;  3TDU C;  2QZ8 A;  2JTV A;  2X51 A;  5IOY A;  1ZGW A;  3H5A A;  2XF7 A;  3CF2 A;  4QTR A;  1ETX A;  4B3A A;  4CA0 A;  1FNN A;  2FUG 2;  1OCP A;  2DA5 A;  4UUV A;  1FBQ A;  1PUF A;  3OYE A;  1FTT A;  1V54 H;  2NYX A;  2PG4 A;  5E3M A;  4L18 B;  4BL0 B;  1Y1W J;  2DO7 A;  2LBF B;  2IS4 A;  1F36 A;  2V1X A;  2VKD A;  2TCT A;  1WJE A;  4XLF A;  2O9L A;  2R4G A;  4KIT B;  2VQH A;  5L3D A;  1YHQ I;  5J8C A;  4I76 A;  1MBF A;  2WY8 Q;  3CJT B;  3CZ6 A;  1USS A;  4IZZ A;  4BQQ A;  2XAU A;  2DMP A;  2NRA C;  3JAM K;  1QBJ A;  1S29 A;  2E35 A;  2HNH A;  5ERI A;  1B1B A;  4EM0 B;  5DS9 A;  1A36 A;  2NNN A;  4D1Q A;  2L9N A;  3ZQC A;  1OR7 C;  4M6V A;  2OBP A;  3M8F A;  4MEY F;  2VOD A;  2V7F A;  5LBQ A;  5D5V B;  2XRN A;  5DD4 A;  4ENJ A;  2V26 A;  2E36 A;  4HDV A;  3JRH A;  1TQM A;  1FOK A;  1WKM A;  1MDM B;  4F91 B;  4G7H F;  2VBY A;  2FMY A;  4FT8 A;  4PK4 A;  1R71 A;  2K02 A;  2D1H A;  4L0Y B;  3ZMU A;  1CF7 B;  4IHV A;  1WH7 A;  4XSX F;  3ZMV A;  1VQO I;  3F8C A;  2A6T A;  2EIM H;  2M0C A;  2LD5 A;  1YW7 A;  4RGR A;  3I55 I;  4WXC A;  2V6E A;  2W82 A;  4MGR A;  3OYM A;  4HA8 A;  2LKS A;  5BMZ A;  1OCZ H;  2PBI A;  1VZ0 A;  4BE1 A;  4BDY A;  2W85 A;  1TWA J;  4OIQ F;  4ANJ A;  3W2V A;  1IGN A;  3ZQH A;  1XMX A;  1XS9 A;  3B6C A;  1A35 A;  4M74 A;  2DA6 A;  1RZ4 A;  3CJR B;  1UB9 A;  4LIU A;  1TNT A;  1QU3 A;  2DA1 A;  1HBX G;  2A6H F;  3IV5 A;  4BNC A;  3F0C A;  1RET A;  4WWC A;  2ADU A;  1FJL A;  4GFB A;  2NOG A;  3UKG A;  2B7E A;  3LNQ A;  3HOY J;  1JI8 A;  4BYY A;  3R0J A;  2F5V A;  4G12 A;  3HUG A;  3K4K A;  4KN7 X;  3T8T A;  1OCT C;  1ONV A;  5KCM A;  1B8I B;  1N77 A;  3BG5 A;  1TLH B;  4II2 A;  1RUO A;  3ASN H;  2L7F P;  3I54 A;  4ETS A;  5HS9 A;  4XIC A;  3BLY A;  3KEY A;  1R5G A;  1YJN I;  2X6Y A;  4CZZ A;  1IDZ A;  3EPZ A;  4KN4 X;  1D8J A;  1DGR M;  2A6E F;  1IV6 A;  1R36 A;  1SVL A;  2MH2 A;  3FMR A;  4E7I A;  2COB A;  1V5E A;  1QZZ A;  2ID3 A;  4WCG A;  4Y52 J;  2LY1 A;  3CES A;  4EV0 A;  2V1D A;  4CSW A;  2EH3 A;  3JRB A;  4IHY A;  2P5L C;  4BXU A;  1MBE A;  3JW4 A;  2FRH A;  4ZZD A;  3WU1 B;  2IS1 A;  5D4R A;  3H35 A;  4N9I A;  2ZXW H;  1KU3 A;  2XC7 A;  3OIO A;  2DDB A;  1RIO H;  2PJP A;  3KZZ A;  2ECB A;  2VJ5 A;  2GAU A;  4U7B A;  5CYV A;  4DJA A;  1F43 A;  1Z7U A;  1MMA A;  4RDU A;  3LSR A;  3MN2 A;  1ODD A;  1FEX A;  4HBL A;  3R61 A;  2LNB A;  2W1O A;  3OYG A;  3A1Y A;  3AFH A;  1P2F A;  3ABT A;  4A93 J;  2ID6 A;  4GCV A;  2NVQ J;  3BZK A;  2EV6 A;  5E3L A;  3GLL A;  3S8P A;  4AIK A;  4BE0 A;  2M4G A;  2Y9Z A;  4DYR A;  1X3U A;  2R7D A;  1XGS A;  3QWL A;  1IRX A;  1TQI A;  3K4N A;  3SJM A;  2XKO A;  1JT6 A;  2KZG A;  2AO9 A;  2E1M C;  5HDG A;  3JRA A;  3HRT A;  1R4M B;  2IGK A;  3KP2 A;  1JJ6 C;  2ZCW A;  1WJB A;  3KET A;  3RKW A;  3ROU A;  4KMF A;  3AG2 H;  3BQZ A;  2IEK A;  1MW7 A;  5F1R A;  4UUS A;  3C2G A;  2V9P A;  1B59 A;  1BJA A;  4N4O B;  4PJM A;  3GTO J;  1BN5 A;  5JLW A;  1I1G A;  3K2A A;  2CQN A;  1FIA A;  1OCR H;  3ZR8 X;  2IXS A;  4PJL A;  4HNV A;  1RNL A;  2W24 A;  2VAS A;  4I99 C;  2O3F A;  3E97 A;  1W36 D;  3HPH A;  1R22 A;  5F0F A;  3HRU A;  3OS1 A;  2L01 A;  4HNU A;  3OYB A;  1KQ8 A;  4XOP A;  2VT3 A;  1J59 A;  1HLV A;  5LGU A;  1BIB A;  2N8G A;  3FXQ A;  4MIM A;  4ZYD A;  1UHS A;  2EIJ H;  1JGS A;  1S5L C;  2BY1 A;  1N25 A;  1O7F A;  1NG7 A;  3FIS A;  2O0Y A;  4GYG A;  1APL C;  4XRS G;  5LEJ A;  2XPW A;  3BR6 A;  1WZ2 A;  4B8X A;  2HQA A;  1RRJ A;  2ZME B;  3OOP A;  1LFU P;  2LBF A;  4BBR J;  1HXD A;  4PZJ A;  5IPA A;  5CVU A;  5IYD J;  2MYS A;  4XRF A;  4Y15 A;  2JSC A;  3OYI A;  2JT1 A;  3Q0U A;  2L3D A;  4HW0 A;  1W4M A;  4CH7 A;  1K4S A;  4X0G A;  2KRH A;  2HYF A;  5EEA A;  3HG9 A;  3FK6 A;  2IJL A;  3H36 A;  1ZN2 A;  3ERM A;  3JTG A;  3FXO A;  5IT3 A;  3V7S A;  4YRV A;  1VQ5 I;  2YX7 A;  3PNT A;  4IXA A;  4Y4R A;  3UR3 C;  1Z21 A;  3PFY A;  4MFD A;  4RA2 A;  4D7N A;  2ECC A;  5KHD A;  1D5V A;  1UMQ A;  5EYR A;  4FAS D;  2IS2 A;  4S04 A;  1Y0U A;  1FSH A;  1ON1 A;  2A3S A;  2AHQ A;  2GXG A;  5J1R A;  3OWT A;  2GM4 A;  1T33 A;  2P0W A;  2ZNY A;  3EYI A;  3G4S I;  3TW6 A;  1YI2 I;  1R1T A;  2NS0 A;  4A3C J;  1GLN A;  1H9G A;  1SAN A;  4PSX A;  5L3G A;  1LVK A;  1TNS A;  1G4D A;  1MDM A;  3BCA A;  1TWG J;  2HVS A;  1MBG A;  4LIT A;  2DTZ A;  1U5T C;  1U3E M;  2DK8 A;  1W7P D;  3C2H A;  5F0C A;  2EK5 A;  1MND A;  4BAY A;  4RB1 A;  1QZY A;  1WJD A;  2HQ5 A;  3FZV A;  1W7P B;  2OZ6 A;  1PJR A;  4R8H A;  4UY8 I;  1GXQ A;  3O3K A;  1LE8 B;  1CQT A;  3BOQ A;  4ZTF A;  3REO A;  2KFD A;  2MW8 A;  1EF4 A;  2M45 A;  2BHZ A;  1DU6 A;  2QWW A;  3S32 A;  2L7Z A;  2YSR A;  4XN3 A;  1XGO A;  1SD6 A;  3RCO A;  2Z99 A;  3GZ5 A;  5IYC J;  4BQO A;  4MTE A;  2DMQ A;  5M5Y J;  2QVO A;  4PFO A;  5ILS A;  5JI6 A;  4MLO A;  5E79 C;  3RTR A;  1XMK A;  1JE8 A;  1FOW A;  3K4L A;  2EJR A;  2WB1 N;  2DA3 A;  1ZHF A;  1YYV A;  4OIN F;  2DOA A;  2LMD A;  3DLA A;  3AKZ A;  2HU9 A;  3LOC A;  3PNV A;  1BJZ A;  4O6J A;  1H0M A;  1VQ9 I;  2A5Y B;  3OY9 A;  4BY7 J;  1TW2 A;  2D1V A;  1BR2 A;  3ABM H;  2IGN A;  3PSI A;  1K79 A;  2FSW A;  3KZY A;  3WTZ A;  1WI3 A;  1TW3 A;  2EQR A;  3BPX A;  1R4N B;  1PDN C;  3DQV C;  1Y39 A;  1DPR A;  2H6B A;  1SFE A;  1U6G A;  1GVJ A;  2DMT A;  2BY3 A;  1FY7 A;  4PJ0 C;  3J81 Z;  1ETO A;  1W36 C;  1OYI A;  3ONQ A;  9ANT A;  4E70 A;  1T8I A;  2R7R A;  2GA2 A;  4LB5 A;  2QSF X;  1I3A A;  1ZYR F;  1XMA A;  5BNG A;  2JN6 A;  1U5T A;  5D6E A;  3A2K A;  2DPU A;  1Q1H A;  2JA7 J;  2QUF A;  3HSE A;  4Y3O A;  2ZME C;  2RQQ A;  1WVR A;  1WHU A;  2DPD A;  3S1N J;  1X1C A;  3VSK A;  2MAB A;  1NK3 P;  4GXO A;  3SFZ A;  2R7X A;  5FKN A;  1IDY A;  2LDU A;  4Z6Y A;  2NOJ B;  3TO7 A;  3JSP A;  1JT0 A;  3HKZ N;  3OS0 A;  2P6S A;  2O03 A;  3V7R A;  4M9X A;  3A02 A;  3CO7 C;  2VT2 A;  5EZG A;  3DTI A;  3H9G A;  1MH3 A;  2PMZ N;  1VQP I;  5H6R A;  2K3F A;  4ZJZ A;  3DLL F;  1L3L A;  2K86 A;  5BQT A;  3W6J B;  2EFW A;  5KK1 A;  3BG7 A;  2JZY A;  3M1C A;  5K5O A;  3GZ6 A;  2RGV A;  2YU9 J;  2K4B A;  2VN2 A;  1FC3 A;  4F7Z A;  3J7Y J;  5FGM A;  5HLI A;  2ELK A;  2L2O A;  5A2Q K;  4E7Z A;  2L9S A;  4U0V A;  4UVB A;  2OTL I;  4HAM A;  1LUJ B;  1XD7 A;  2XPV A;  5F08 A;  2HI3 A;  4MO7 A;  2F5F A;  2XSJ C;  4F92 B;  1ZEL A;  3BTC A;  3HYI A;  1Z9C A;  2RVC A;  5HLH A;  3PO2 J;  4NC8 A;  3G3Z A;  3MKW B;  4MHG A;  3IHU A;  2DQR A;  3D5S C;  4HF1 A;  3KLO A;  4BDZ A;  3LA3 A;  3U21 A;  1I5Z A;  2MFZ A;  3IL2 A;  2DT6 A;  4RLF A;  4M3B A;  1R6R A;  5C4X J;  3WU2 C;  2KLO A;  5JFR A;  1QHH D;  3GO5 A;  4XBF A;  3E6D A;  2HKX A;  4YEL A;  4A0Y A;  5KAF C;  3K1P A;  1LFP A;  1P7J A;  2ZME A;  3DFG A;  5GPA A;  3N97 A;  2UXX A;  4UB8 C;  5FLX Z;  1SD7 A;  3DCF A;  4GYI A;  5KAI C;  3ZCO A;  5B1A H;  2ZXJ A;  4HLY A;  1MMG A;  3F6V A;  3KP6 A;  5EEH A;  2EPF A;  3L00 A;  1QO0 D;  5CQG A;  3AG4 H;  3CCE I;  3IKV A;  3QP6 A;  1IW7 F;  1AU7 A;  4UV9 A;  1K83 J;  2K9S A;  2M5W A;  2JQ7 A;  2M8E A;  4MQV A;  3PIP F;  3LSM A;  2XGD A;  1QQI A;  3FK7 A;  3A01 B;  5M5W J;  2ZJP F;  1WWX A;  5HNH A;  1YS6 A;  3IRR A;  4DNC A;  2IA0 A;  2RQP A;  4E4H A;  3IUO A;  1R5H A;  2Z33 A;  1B9M A;  2CFX A;  1HCR A;  2IS6 A;  4DIQ A;  2XIG A;  1X19 A;  3GBG A;  5F6F A;  1Z7L A;  2A07 F;  1BM9 A;  4PCQ A;  3BZ6 A;  1KQ9 A;  1JXS A;  4G8X A;  2R7V A;  3CMM A;  4BAC A;  4IOA F;  1AWC A;  1RC9 A;  4A3B J;  3OYN A;  1YJW I;  1IRG A;  1FOX A;  3I59 B;  3PQK A;  3LSJ A;  2V4J C;  3WTX C;  3QYE A;  1E3H A;  3F8N A;  4PFP A;  1W7P A;  3S3N A;  2DYR H;  2Z3Y A;  2VXZ A;  4BY1 J;  4G6T B;  2FE3 A;  4PDK A;  5C4J J;  1LE8 A;  1YW8 A;  4TV7 A;  2AS5 F;  2ESH A;  2PLY A;  1OKR A;  4ZDP A;  1YIJ I;  4XOR A;  3H3U A;  5JR3 A;  4RGU A;  3DBL B;  3R0A A;  3BT9 A;  3L2R A;  3U2R A;  1WGX A;  3J80 Z;  3CCL I;  4DQ2 A;  2R5Z B;  1KQ0 A;  4C30 A;  2R93 J;  3HGY A;  2LLK A;  2P4W A;  3VSL A;  4B1R A;  1F1Z A;  1RUN A;  2KDO A;  4HOB A;  3DV8 A;  2X48 A;  1S6L A;  2ZSI B;  3GYH X;  3CDI A;  4E7L A;  1XPX A;  2WAF A;  1NK2 P;  1IXR C;  2DFI A;  2IA1 A;  1G2H A;  4XKC A;  5FD5 A;  3GWZ A;  2E5Z A;  1PP8 F;  2PEX A;  2PQ8 A;  2DU9 A;  3GLX A;  4XMY A;  5GAE J;  1P9Q C;  3DEE A;  1FPQ A;  3FXM A;  4L5I A;  5FRM A;  2FD5 A;  4IHS A;  5DEQ A;  3CCS I;  4NQW B;  2X1C A;  4OIR F;  1H8A C;  2DK5 A;  1XC5 A;  2NAZ A;  3S3M A;  5D8K B;  2IGO A;  3TO9 A;  2DA7 A;  2DFH A;  3GFM A;  1D3Y A;  1R58 A;  3Q3S A;  1D1B A;  2EA2 A;  5HLT A;  3S2D J;  2ZJR F;  3JRG A;  3LL7 A;  4QWQ A;  1HDD C;  2HTJ A;  1JUS A;  4LG0 B;  5FD6 A;  3MKY B;  1J0R A;  3CMY A;  1U9O A;  3G2B A;  2E34 A;  5FRO A;  4CIC A;  1P7I A;  2DXI A;  5LRR A;  5GAH J;  2D2W A;  4L0Z B;  3B6A A;  5FKO A;  3WE2 A;  4AU7 A;  1XDU A;  3I53 A;  1A6I A;  3QPL A;  4D9J A;  4E7S A;  4A3J J;  1ZRD A;  3S17 J;  3R4K A;  1ZAO A;  1IN5 A;  1ZTR A;  3VFZ A;  2R7W A;  3ZXS A;  4UNO A;  2A68 F;  1BC7 C;  3MEX A;  3M7G A;  3B02 A;  4A0Z A;  4YIR X;  4F3Q A;  2WV1 A;  1D0X A;  1NTC A;  2XGX A;  4ZYE A;  3LQR A;  4Q4Z F;  4E7K A;  1TWF J;  1E2X A;  1GDT A;  1QA6 A;  3GTL J;  5K5R A;  4HV5 A;  2CH0 A;  4XNF A;  2R7U A;  5EEG A;  2Y30 A;  2CQQ A;  2JA5 J;  1I1S A;  3LST A;  1STZ A;  5L3E A;  2CMP A;  5E3O A;  1Z77 A;  2GBY A;  3CMA I;  5LHH A;  3G1L A;  4HPQ A;  3DXJ F;  1WJA A;  3B73 A;  1MBK A;  3E0J B;  3U1D A;  4AYB N;  1B72 B;  2LKP A;  4EQQ A;  1I27 A;  3BR5 A;  4RB2 C;  2V6C A;  3CC2 I;  5K5Q A;  3HSF A;  1OPC A;  1S3J A;  4MTD A;  2DAO A;  3GZN B;  3BR0 A;  2HOE A;  3V42 A;  5K7F A;  1MJ9 A;  1P4A A;  1GVD A;  2FNP A;  3BTI A;  2H94 A;  1CGP A;  2GIZ A;  2KZV A;  2NVY J;  2F6C A;  2ZBK A;  2XF5 A;  2G0E A;  2BOL A;  2GA1 A;  4BJT A;  3HIF A;  5J1Y A;  3D5R C;  3SHF A;  4RAZ A;  2VON A;  3FDY A;  1K61 A;  3BY6 A;  3I4P A;  2X6W A;  1AKH A;  4L5J A;  4IRG A;  4BH9 A;  3GFI A;  3TED A;  2VUM J;  1Q1V A;  3HOU J;  4C2M J;  1FMV A;  2JPB A;  5CKT A;  3OYK A;  1YO5 C;  2K9L A;  5K1Y A;  3G1M A;  2BW3 B;  3FXU A;  3LSK A;  1J5Y A;  4M3D A;  3SQN A;  4YEJ A;  5D6F A;  2B63 J;  1SFK A;  1SAU A;  5FO5 A;  3BRO A;  4OU0 A;  5J8F A;  3AAF A;  1TWC J;  5DUK A;  3HTU A;  2WBM A;  3CLQ A;  2O5R A;  1BI0 A;  1FT9 A;  1T95 A;  5F0H A;  2VKH A;  3IH3 A;  1K6O A;  4HSR A;  2H27 A;  3FBI B;  3K70 D;  1ZR4 A;  4A3M J;  1WH5 A;  5H6Q A;  3U1K A;  4ENN A;  3A01 A;  2XAH A;  1R7J A;  2O6G E;  2H8R A;  2KJB A;  4L9V A;  3KCC A;  3JRE A;  3I58 A;  3MKL A;  2XAS A;  1BI3 A;  4M9S A;  5IP9 J;  3IKT A;  1JTY A;  2H09 A;  3P5J A;  4WK8 F;  2K9Q A;  4A3G J;  2QLZ A;  4HDU A;  1LEA A;  1VTN C;  1RI7 A;  2OAZ A;  2UUZ A;  3LQQ A;  2KL4 A;  3CC7 I;  3DU6 A;  2UV1 A;  1DU0 A;  3E6B A;  5F27 A;  3QOP A;  3F21 A;  3BPV A;  5F04 A;  4M71 A;  2R5Y B;  3LSI A;  1I50 J;  2P5V A;  2QYO A;  1I6X A;  2I10 A;  3H0G J;  3HC7 A;  1FBU A;  3F3X A;  2F4O B;  3RKQ A;  1XSV A;  5L3C A;  1I6H J;  4RLQ A;  3TMO A;  2YU3 A;  2HOT A;  4BUP A;  2XAG A;  5LD2 C;  1V5G A;  1XN7 A;  3DTE A;  2RN7 A;  3CD6 I;  3S15 J;  4YG2 F;  4YIF A;  3BJO A;  4LGW A;  1YRN A;  2VPR A;  2E7X A;  3FIW A;  3N4M A;  2RC4 A;  3KEO A;  2Y0S A;  1Y8R B;  2JA6 J;  3S2H J;  2FBH A;  1Y56 A;  2Z9O A;  5E8I A;  4NC6 A;  1HW2 A;  3TGN A;  1BR1 A;  4OWR B;  1HST A;  1TL8 A;  3DEU A;  1EA3 A;  2OU2 A;  3ESW B;  2VQG A;  5D5U B;  3L09 A;  4JX5 A;  4H4K C;  3I64 A;  5ICC A;  3BZC A;  3AL0 C;  1IZ1 A;  4ESJ A;  1E3P A;  3TQN A;  3I3L A;  4M3E A;  2AQF A;  3SEZ A;  1LDJ A;  2VKE A;  3M1E A;  4NQW A;  2CW7 A;  4M6Y A;  2EFN A;  4B44 A;  4E6K G;  2EFQ A;  1BW5 A;  5JVT A;  1ETQ A;  4WF2 A;  5FLX K;  1GUU A;  3ZQ7 A;  3GTG J;  1IC8 A;  1FLI A;  1ZG5 A;  5E18 F;  4C3I J;  2QEX I;  1B4A A;  1EKE A;  1HKQ A;  1OJL A;  3DPT A;  1HW5 A;  1TC3 C;  2QKM B;  3EUA A;  1X3Z B;  4AWX B;  4CCK A;  2CYY A;  1J7K A;  5BOX A;  5E1W A;  4LG0 A;  3JRF A;  3I4M J;  3ZQF A;  2DJI A;  4HNT A;  2ZKZ A;  1G8X A;  3FXK A;  2Y0M A;  3NAU A;  1SVO A;  3T0Y A;  3TOA A;  2EZL A;  5H20 A;  3E7L A;  4MFE A;  2VQL A;  2QSH X;  2ZFU A;  2JJ7 A;  1XSX A;  1G3Y A;  1OLT A;  1D0Y A;  4CYC B;  3PJR A;  3SZG A;  2VJ4 A;  4XN0 A;  2ISZ A;  1FIP A;  3FXJ A;  3K0L A;  3TOB A;  5ICF A;  5J3L A;  1IRZ A;  2LFB A;  3P9C A;  2HTS A;  3QRF F;  4IHX A;  1O4X A;  3WGG A;  3WTS C;  5M3F J;  2BHY A;  3GFL A;  1DUX C;  4CHU A;  1IV8 A;  3I9V 2;  4I0A A;  1ZKG A;  2QCO A;  3PUF A;  5K7H A;  4AUX A;  1ENH A;  1B9N A;  3FXL A;  3CCJ I;  2CUZ A;  2OTJ I;  3K70 C;  2NS8 A;  3QPS A;  1ZQ3 P;  1M1E B;  2AQE A;  4Y13 A;  2ZJ2 A;  3ASO H;  2FU4 A;  2ZNZ A;  2EZI A;  1KU7 A;  3NQO A;  2CV0 A;  3S1M J;  3Q9V A;  2GXB A;  5J47 A;  1B72 A;  2CUJ A;  4BU2 A;  1EH7 A;  3MZ8 A;  2X6X A;  4B47 A;  2G7U A;  4XLN F;  1D5Y A;  4JP0 A;  3ZRG A;  1RKT A;  2Q2E B;  5J1U A;  3IRQ A;  3FHZ A;  1MSE C;  1LKX A;  2HWV A;  3C2B A;  3IC7 A;  1DGW Y;  4XSZ F;  4A6E A;  2CFO A;  2XKP A;  3DU5 A;  5M5X J;  4KT5 C;  5CPR B;  1SMY F;  2V9K A;  2A05 A;  2WA0 A;  2ZC2 A;  2M7B A;  1ZH5 A;  2DN0 A;  2STW A;  4X1E A;  3ZMT A;  3HDD A;  1YQA A;  2YS9 A;  2GZW A;  4A3E J;  3ZOB A;  3BP8 A;  2BY2 A;  4BXX J;  5HVQ C;  3SZP A;  1RKW A;  2DA2 A;  3ZN0 A;  2BW3 A;  1IN4 A;  2X0L A;  4UHT A;  4KIC A;  4RM2 A;  3RJP A;  2VC1 A;  3HOX J;  1J09 A;  3K1N A;  4HYE A;  1OYY A;  1U8B A;  1KA8 A;  4ZYA A;  4EM1 A;  4ZH4 F;  3QU6 A;  4N4N B;  1Z0X A;  4XKV A;  4ENM A;  4OIO F;  3I4N J;  5FB2 A;  3PNY A;  4ON0 A;  5DM7 F;  2KIF A;  1MZB A;  5FLM J;  4KIS A;  5DD8 A;  4M9Z A;  4M73 A;  3E5U A;  2CQK A;  4W97 A;  3PUB A;  2DA4 A;  3TP3 A;  4G7Z F;  1ERD A;  3IWF A;  2HDW A;  1QNT A;  1T98 A;  2KT0 A;  2HZT A;  3GF2 A;  1MGT A;  1SFO J;  3DP7 A;  5DDG A;  3RKX A;  3HL2 A;  3E5X A;  2A69 F;  4BQN A;  1BOB A;  2L9R A;  3HKZ A;  4XON A;  1VF9 A;  1UHW A;  2RKH A;  6PAX A;  1IUY A;  1CF7 A;  4JX6 A;  1MMS A;  3VYU B;  1P4X A;  3K4J A;  4MNU A;  3W3C A;  2E71 A;  2KQR A;  2HOS A;  4DBQ A;  4U7D A;  4A3F J;  2M7A A;  3OIP A;  2JA2 A;  2MLK A;  2UWM A;  5AIQ A;  2R5Y A;  1GV2 A;  5AON A;  2QKL B;  2P7C B;  4KJZ A;  4AID A;  2Y48 A;  1XG1 A;  1FZP B;  1E17 A;  2H1L A;  2CJJ A;  1YG2 A;  3T5X A;  1PYV A;  2R7O A;  1TWH J;  1SAX A;  2CV1 A;  2VC0 A;  3GW2 A;  3MZH A;  1ZLK A;  3GME A;  1VQ7 I;  3A0B C;  4ZC3 A;  2IT0 A;  1I39 A;  2M2E A;  3ZP5 A;  3HOZ J;  2CWE A;  2WAQ A;  3H3Z A;  2KRF A;  5DUI A;  3JTH A;  2ACJ A;  1O3Q A;  3KLN A;  1G3W A;  3J7Z I;  1B8I A;  3Q0W A;  3QQA A;  5IY5 H;  2PI0 A;  2D45 A;  1HKT A;  2Z5U A;  1QVU A;  2DLL A;  4G94 A;  4HST A;  5FKK A;  4KNY A;  1VQN I;  2PN6 A;  1HW1 A;  3H9J A;  2QQA A;  2FXA A;  3E6C C;  4F52 A;  5FRN A;  3BTL A;  1X58 A;  2MA3 A;  2HOA A;  4ZDL A;  1XX5 A;  3S14 J;  2LR8 A;  4LK0 F;  1YTY A;  2M3A A;  4IL6 C;  4RBO A;  2LOO A;  3MCZ A;  1KZH A;  3OL4 A;  1IN6 A;  1QZE A;  2CQ7 A;  1VQ8 I;  1BW6 A;  4YFX F;  5BPD A;  2VE8 A;  1DP7 P;  2C6Y A;  1WRJ A;  3JRD A;  2WTE A;  1T6S A;  1IRF A;  1BOA A;  3BJA A;  3VWB A;  3VOD A;  1X4P A;  2FJ1 A;  2ZB9 A;  1S8N A;  3IWZ A;  2W84 A;  2CSO A;  4M3F A;  1XGM A;  4B4C A;  1XSD A;  2DDA A;  1D8K A;  3K69 A;  2ME0 A;  1IO2 A;  1UST A;  2TRT A;  5DCM B;  1UAA A;  4FIS A;  4NBQ A;  5AIP A;  3E5Q A;  1BA5 A;  4AVZ A;  1T56 A;  1T2K A;  2WV0 A;  3VDX A;  4A0X A;  4ZYH A;  5HS8 A;  2XGC A;  2STT A;  4G7O F;  1KU2 A;  4KIB A;  1QHG A;  3WU0 A;  4CYC A;  3ECH A;  4WXD A;  1R5I D;  5TGT A;  2G9W A;  5E3N A;  3GFJ A;  5LGT A;  2FML A;  2RDP A;  4RB3 C;  2NNY A;  3KEQ A;  1UHM A;  5JLX A;  4BE2 A;  1U0J A;  2Q8K A;  5DYM A;  3C7J A;  1JHH A;  5HLG A;  2WAE A;  3MAJ A;  1VQK I;  4EEF G;  2B0L A;  4EVI A;  3OYJ A;  3BR2 A;  5FFX A;  3ZQI A;  1MMD A;  1UG2 A;  1MBJ A;  2XUB A;  5DV5 A;  3HJE A;  3K6G A;  4QLC U;  3QOE A;  4HZF A;  2OA4 A;  4DYC A;  5DCF A;  1IXC A;  2FBI A;  1S9H A;  2HKO A;  4ASN A;  3RPU D;  2DI3 A;  5IT9 Z;  1ZRF A;  3DPU A;  3TP0 A;  2FOW A;  1V4R A;  4U0W A;  4F55 A;  1FYK A;  4C2U A;  4BBS J;  1D0Z A;  3G1O A;  5CVR A;  1F4K A;  1HC8 A;  1MSF C;  4IO9 F;  1TZL A;  2GXA A;  2DOF A;  4HQE A;  2Z16 A;  3PIO F;  3OYF A;  3COA C;  4IF4 A;  2ZXH A;  3SZT A;  2VL8 A;  2EBI A;  1U9N A;  1IJW C;  4XID A;  3CUQ B;  3DTK A;  1YX5 A;  1BI2 A;  4ITV A;  4C3H J;  2WC2 A;  2HXI A;  2HFH A;  4CYD A;  2M9H A;  3S93 A;  5EJC A;  3PO3 J;  4PUS A;  2BVL A;  2YR2 A;  3W6K B;  3CDL A;  3ABU A;  2DYS H;  3PQJ A;  3RYR A;  1YX3 A;  4Y7N J;  2CO5 A;  2LF7 A;  3HB9 A;  4XRM A;  1ORK A;  4MQ9 F;  5GTI C;  4CXF A;  1Z91 A;  3N05 A;  2VBZ A;  5LFA A;  1OMI A;  2OPT A;  2Y31 A;  4K2E A;  3JRC A;  1TT5 B;  4OAY A;  5ED4 A;  5IP7 J;  3WTY C;  3D1N I;  1PP7 U;  4LIV A;  2BBY A;  4JK1 X;  2MGQ A;  1ZG1 A;  2VQC A;  3BG3 A;  3HHH A;  3MWM A;  1T0F C;  3WTW C;  4EMS A;  2IA2 A;  4EJU A;  1YE9 A;  2BV6 A;  4DW6 A;  1MIJ A;  1F9N A;  2VBW A;  4RAY A;  4S05 A;  1VND A;  2HZD A;  2RRE A;  4I98 B;  3VPR A;  2M87 A;  5CVI A;  3S3O A;  1T39 A;  3JSO A;  3HXL A;  3VOE A;  4EM2 A;  4UVA A;  3CJN A;  2QGU A;  3ZQQ A;  2Y75 A;  1PUE E;  2NVU B;  3ZN1 A;  3Q5F A;  2XF6 A;  2KMU A;  1JKP C;  4LK1 F;  2IBD A;  2BY0 A;  1TQP A;  1RES A;  4KIF A;  2GWR A;  3L9F A;  3KZI C;  4LOC A;  3VYR B;  1YW9 A;  4EAT A;  5IP6 A;  1IF1 A;  2F5E A;  2HDC A;  4QSH A;  3LAP A;  1YIO A;  1P4W A;  4RGX A;  2DOD A;  4BHB A;  4JQF A;  2VPL A;  5E20 A;  4BS9 A;  3F8M A;  4AC0 A;  4DZP A;  5CQE A;  1ETV A;  1VQM I;  3WG7 H;  3SYT A;  3C1D A;  2LKX A;  4MEX F;  1LNW A;  1T08 B;  2AXL A;  2X1E A;  1G59 A;  3FWE A;  4D5F A;  1XB4 A;  3ZGK A;  1BIA A;  5GAD J;  2VOP A;  1X4O A;  4KUM A;  2DOE A;  3BG6 A;  1V3F A;  5DTD A;  1MNE A;  3EUK L;  2KIM A;  3QAH A;  5J4Y A;  4I2O A;  1G6N A;  4UUT A;  2MH9 A;  2IP2 A;  1OQY A;  3I56 I;  1NH3 A;  3ABL H;  3KE2 A;  4P1W A;  2JMW A;  3FM3 A;  5FLV A;  1ZGJ A;  5B3S H;  4FE7 A;  4LLG F;  4WX9 A;  3W6V A;  4BQA A;  1WPK A;  3Q0V A;  3ERE D;  1T0F A;  2OUM A;  2LP0 A;  2EA4 A;  3VYT B;  5D4S A;  1X2M A;  1S7O A;  3FX3 A;  3L1P A;  3QP5 A;  3V7C A;  4RM3 A;  3PSF A;  2OC6 A;  1V5F A;  4D5C A;  2XRL A;  4ESB A;  1Z6R A;  2YPR A;  5HOO A;  3O2P E;  3HRS A;  4CCL A;  2IVM A;  5H2F C;  3AG1 H;  3C3W A;  4CCO A;  2XAF A;  4IQ4 A;  1U2W A;  2EIN H;  4IVN A;  4XLC A;  4D0P A;  2Q0O A;  1LQ1 A;  2ZXI A;  1U8R A;  2K4J A;  5LHI A;  1XGN A;  2EIL H;  4FET A;  4NNJ A;  4OMY A;  3K7A J;  1E3O C;  1ZAR A;  2K40 A;  4NUB A;  5E1Z B;  4RAF A;  3TKY A;  4ZTJ A;  2GOX B;  1KYW A;  2LRE A;  4AVP A;  2DBB A;  2A61 A;  2DT5 A;  2E60 A;  2HVQ A;  2Y2Z A;  1GT0 C;  4IHW A;  4L9N A;  2EZK A;  2JSP A;  3CDH A;  2V79 A;  4A3L J;  3LMM A;  1E0E A;  1U78 A;  2IPQ X;  4XKB A;  2EV5 A;  4LFU A;  3IAS 2;  2XSD C;  3L2W A;  5ILU A;  1KGS A;  4P55 A;  4EJO A;  4AM3 A;  1HA8 A;  2EZH A;  1YLF A;  3F8B A;  3MMY B;  3RDI A;  4XRS A;  1AHD P;  1RPW A;  2Z2S B;  4V19 K;  4O5V A;  4PJJ A;  2X9D A;  1KON A;  1P6R A;  1LB2 A;  4P9U A;  1VQ4 I;  2DQL A;  2X6O A;  2CU7 A; 
#chains in the Genus database with same CATH homology
 1G3S A;  3WE3 A;  1UFM A;  4HV6 A;  1WI9 A;  3LAJ A;  4BHC A;  2CG4 A;  4CO8 A;  1Z1D A;  3RPU A;  4OIP F;  4A12 A;  4A5M A;  2XRO A;  5E8G A;  2HGC A;  2HQR A;  4P96 A;  3LFK A;  3G73 A;  2VBX A;  3WOD F;  3D5L A;  4ZZL A;  5CVJ A;  3CUQ A;  4IRH A;  3RPQ A;  3EET A;  3H92 A;  3VEP A;  1O3S A;  1S7A A;  2LSO A;  4CDG A;  3J81 K;  1UCR A;  2R7F A;  2BE5 F;  1IN8 A;  4N0B A;  3WGH A;  4PGH A;  1FYM A;  2FF4 A;  1EV7 A;  1LJ9 A;  1T38 A;  3GUD A;  4ENK A;  1SD5 A;  2FA5 A;  1Z05 A;  4HLX A;  4A5N A;  1A04 A;  4G9Y A;  2V1U A;  3O6B B;  4HX8 A;  2H6C A;  4FX4 A;  4RGS A;  4AD9 A;  3I59 A;  1HQC A;  2GQQ A;  1FX7 A;  1J9I A;  2ZO4 A;  2EV0 A;  5A2Q Z;  2CW0 F;  2MBF A;  1KU9 A;  4OMZ A;  1FYL A;  2J5P A;  2L4M A;  2MC3 A;  3CTA A;  5IT9 K;  3V8L A;  3V4G A;  3KFW X;  1DPU A;  3F22 A;  3WTU C;  1EH6 A;  3L7W A;  3V8K A;  3K1M A;  1LDK B;  1MKM A;  4GGG A;  1WQ2 A;  1OR7 A;  2F5D A;  4R79 A;  3GXO A;  3KP7 A;  3ZPL A;  1R1V A;  3EQL F;  3GVA A;  5HDN A;  2COM A;  2EB7 A;  3NRV A;  3V8J A;  3MQ0 A;  1FWZ A;  1MD0 A;  1U5T B;  2ELH A;  3MFK A;  5D8L B;  2DW4 A;  3WG9 A;  1GHC A;  4NHJ A;  2BYV E;  4L9T A;  1J2X A;  1B6A A;  4JBA A;  1Z6T A;  3SXY A;  1QGP A;  4Q47 A;  4ESF A;  1KYZ A;  3HHG A;  3F23 A;  1SFU A;  4I09 A;  5BS6 A;  1SD4 A;  2W57 A;  2QQ9 A;  3M9A A;  3HOS A;  1LDD A;  1C0W A;  4EJT A;  3S2W A;  3U9G A;  3ELK A;  1YFH A;  4KIG A;  1JHF A;  4LB6 B;  3LA7 A;  2E1N A;  1O7L A;  2P5K A;  4Q48 A;  3J80 K;  2L02 A;  3T8R A;  2HYG D;  3ML6 A;  2PFB A;  1FSE A;  2UXN A;  1H9T A;  1FP1 D;  5JHU A;  2JRT A;  4CGZ A;  2ISY A;  4Q5S F;  2TDX A;  3VB2 A;  3DF8 A;  3NEU A;  4GO1 A;  5LEK A;  4U0Y A;  2FNA A;  1DDN A;  3K2Z A;  3FXR A;  4I01 A;  1ZG3 A;  3GX4 X;  3M8E A;  4LMY A;  3Q9S A;  3T1B A;  2QM3 A;  4EGZ A;  1IAW A;  3F72 A;  3WTT C;  1O3T A;  3P9K A;  2ETH A;  1XCB A;  3KP4 A;  2MD5 A;  3FF5 A;  2XV4 S;  2RV8 A;  3HSR A;  3RIR A;  1F5T A;  3CUO A;  2V9V A;  3P9I A;  4KA4 A;  4IHT A;  4A2U A;  4LD5 A;  2J5O A;  4EJV A;  4IJA A;  4FX0 A;  3WTV C;  3CO6 C;  4RS8 A;  2KJC A;  2MLG A;  1WSU A;  2X4H A;  4H0E A;  1BBY A;  1W5T A;  1OYW A;  5TRD A;  1SMT A;  3DKW A;  5LRS A;  2ESN A;  3KP3 A;  2FEZ A;  5J6X A;  1SFX A;  1K78 B;  3R60 A;  3E3V A;  2EWN A;  5CLS A;  2FOK A;  2O8X A;  3EDP A;  1ON2 A;  5L3B A;  2OQG A;  1ZLJ A;  1ZRC A;  4UXN A;  2JPC A;  2VE9 A;  4ZYG A;  2WWY A;  3JAM Z;  2QQB A;  4N9H A;  4WXH A;  4HF2 A;  4AIJ A;  4P5O A;  5F64 A;  2PMH A;  5HS7 A;  3TO6 A;  3FMS A;  3ZMD A;  2L4A A;  2XAJ A;  3EUH A;  2ZFW A;  4LLL A;  5ICG A;  3ISP A;  4LJZ F;  2DTR A;  4I0B A;  2IW5 A;  1FBS A;  4LLN A;  2CGP A;  3J7A O;  4L9J A;  3OV8 A;  4KYW A;  1FP2 A;  2R3S A;  3GEZ A;  1TTY A;  2OD5 A;  5D5X B;  2P8T A;  3BJ6 A;  1YS7 A;  4Y17 A;  2XVC A;  2F2E A;  1P92 A;  2K27 A;  2P7V B;  3ECO A;  5D5W B;  1L0O C;  5BPI A;  1IN7 A;  4KDP A;  1MJA A;  1ZGA A;  4G6Q A;  1AOY A;  2XHK A;  3I5U A;  2HEO A;  3QU3 A;  2QBY B;  1EH8 A;  2Q2E A;  2W25 A;  1LVA A;  1IXS B;  4P9F A;  1ZRE A;  2O61 A;  2P6T A;  3F6O A;  2FBK A;  4M6X A;  3WGI A;  3LA2 A;  3EYY A;  1GXP A;  4AIH A;  2VOO A;  1G3T A;  2OZU A;  5L3F A;  4HF0 A;  3LWF A;  2F5C A;  2IRF G;  4U88 A;  4A6D A;  2E7W A;  1BI1 A;  3HOT A;  4UVC A;  3RKY A;  5CVV A;  3BWG A;  3C18 A;  3HTS B;  4R1H A;  4FHT A;  4KFC A;  3DPL C;  1O57 A;  4I7H A;  3HRM A;  4KMU X;  3E6M A;  3RYP A;  3R6S A;  1O3R A;  1BC8 C;  1LEB A;  2EFP A;  1REP C;  1MJB A;  1HSJ A;  4YFN F;  4Z2Y A;  3D0S A;  3I0T A;  2M1B A;  1W5S A;  2M30 A;  3ZMZ A;  5E1X A;  4O3M A;  1R1U A;  5CJ9 A;  2HS5 A;  3I71 A;  3TDZ C;  1K78 A;  3KP5 A;  2HR3 A;  5ICE A;  1XCV A;  1K7A A;  4IPA A;  2BEO A;  2RNJ A;  4RB0 A;  2E1C A;  4XLP F;  3K9T A;  5LGN A;  2BGC A;  3L2C A;  2G7H A;  2YX4 A;  2LF8 A;  4M72 A;  3CLO A;  2FQ3 A;  2EFO A;  1R23 A;  5FFZ A;  1QPM A;  4OOI A;  4G6D A;  5TJJ A;  4NB5 A;  3F8F A;  3CUQ C;  2OQR A;  3RI4 A;  5DCM A;  5HDK A;  1J75 A;  2QEN A;  5E17 F;  3FM5 A;  1NHA A;  3ZMS A;  5LLQ A;  4EGY A;  4HQM A;  4HX7 A;  4I02 A;  5LHG A;  4UV8 A;  5KVR A;  3BDD A;  3ULQ B;  4B09 A;  3MZY A;  4IRI A;  4YII A;  4PGG A;  2XAQ A;  2PMU A;  1XDS A;  3P7N A;  3QPH A;  2K7L A;  4BHP A;  2GIV A;  1TBX A;  1ULY A;  1R00 A;  4EJW A;  2L54 A;  2KIU A;  5ILV A;  3FMQ A;  2KKO A;  3QPT A;  4YFK F;  1HKS A;  3PFI A;  2HQN A;  2UZK A;  2QBY A;  4HX4 A;  3TDU C;  2QZ8 A;  2JTV A;  1FNN A;  4UUV A;  1FBQ A;  2NYX A;  2PG4 A;  4L18 B;  2DO7 A;  2V1X A;  5L3D A;  5J8C A;  1USS A;  2NRA C;  3JAM K;  1QBJ A;  1S29 A;  5ERI A;  1B1B A;  4EM0 B;  2NNN A;  2OBP A;  3M8F A;  4MEY F;  2VOD A;  5LBQ A;  5D5V B;  2XRN A;  5DD4 A;  4ENJ A;  4HDV A;  1FOK A;  1TQM A;  1WKM A;  1MDM B;  4G7H F;  2VBY A;  2FMY A;  4FT8 A;  2K02 A;  2D1H A;  4L0Y B;  3ZMU A;  1CF7 B;  3ZMV A;  4XSX F;  3F8C A;  1YW7 A;  4RGR A;  4WXC A;  4MGR A;  4HA8 A;  5BMZ A;  2PBI A;  2W85 A;  4OIQ F;  4M74 A;  1RZ4 A;  1UB9 A;  1TNT A;  1HBX G;  2A6H F;  4BNC A;  4WWC A;  2ADU A;  4BYY A;  3R0J A;  3HUG A;  4KN7 X;  3T8T A;  1ONV A;  1TLH B;  1RUO A;  3I54 A;  4ETS A;  5HS9 A;  1R5G A;  4CZZ A;  4KN4 X;  1D8J A;  2A6E F;  1R36 A;  3FMR A;  2MH2 A;  1QZZ A;  4WCG A;  4EV0 A;  2V1D A;  2P5L C;  4BXU A;  3JW4 A;  2FRH A;  4ZZD A;  3WU1 B;  5D4R A;  4N9I A;  1KU3 A;  1RIO H;  2PJP A;  3KZZ A;  2GAU A;  4U7B A;  5CYV A;  1Z7U A;  1ODD A;  4HBL A;  3R61 A;  2LNB A;  1P2F A;  3ABT A;  4GCV A;  2EV6 A;  4AIK A;  1X3U A;  2R7D A;  1XGS A;  1TQI A;  2XKO A;  5HDG A;  3HRT A;  3KP2 A;  2ZCW A;  3KET A;  3RKW A;  3ROU A;  4KMF A;  5F1R A;  1B59 A;  1BJA A;  1BN5 A;  1I1G A;  1RNL A;  2W24 A;  2O3F A;  3E97 A;  1R22 A;  3HRU A;  2L01 A;  1KQ8 A;  2VT3 A;  1J59 A;  5LGU A;  1BIB A;  3FXQ A;  4ZYD A;  1JGS A;  1O7F A;  2O0Y A;  4GYG A;  5LEJ A;  4B8X A;  2ZME B;  3OOP A;  1HXD A;  4PZJ A;  5CVU A;  4XRF A;  4Y15 A;  2JSC A;  2JT1 A;  4HW0 A;  2L3D A;  1W4M A;  2HYF A;  2IJL A;  1ZN2 A;  3JTG A;  5IT3 A;  3V7S A;  2YX7 A;  4IXA A;  1D5V A;  4S04 A;  1Y0U A;  1FSH A;  1ON1 A;  2A3S A;  2GXG A;  2ZNY A;  3EYI A;  1R1T A;  2NS0 A;  1H9G A;  5L3G A;  1TNS A;  1G4D A;  1MDM A;  1U5T C;  1U3E M;  2DK8 A;  1W7P D;  2EK5 A;  4BAY A;  4RB1 A;  1QZY A;  3FZV A;  1W7P B;  2OZ6 A;  4R8H A;  1GXQ A;  3O3K A;  3BOQ A;  3REO A;  2M45 A;  2QWW A;  2YSR A;  1XGO A;  1SD6 A;  2Z99 A;  3GZ5 A;  4MTE A;  2QVO A;  5JI6 A;  5ILS A;  3RTR A;  1XMK A;  1JE8 A;  2EJR A;  1ZHF A;  1YYV A;  4OIN F;  4O6J A;  1H0M A;  2A5Y B;  1TW2 A;  2D1V A;  1K79 A;  2FSW A;  3KZY A;  3WTZ A;  1TW3 A;  3BPX A;  1PDN C;  3DQV C;  1DPR A;  2H6B A;  1SFE A;  1U6G A;  1GVJ A;  1FY7 A;  3J81 Z;  1OYI A;  4E70 A;  4LB5 A;  2GA2 A;  1ZYR F;  1XMA A;  1U5T A;  5D6E A;  2DPU A;  1Q1H A;  2QUF A;  3HSE A;  2DPD A;  4GXO A;  3SFZ A;  2LDU A;  3TO7 A;  3JSP A;  2P6S A;  2O03 A;  3V7R A;  4M9X A;  3CO7 C;  2VT2 A;  5H6R A;  1L3L A;  2K86 A;  5BQT A;  3W6J B;  2EFW A;  5KK1 A;  2JZY A;  5K5O A;  3GZ6 A;  2RGV A;  2K4B A;  2VN2 A;  1FC3 A;  4F7Z A;  5FGM A;  5HLI A;  5A2Q K;  4U0V A;  4UVB A;  4HAM A;  1XD7 A;  2F5F A;  3HYI A;  1Z9C A;  2RVC A;  5HLH A;  3G3Z A;  4MHG A;  3IHU A;  2DQR A;  4HF1 A;  3KLO A;  3LA3 A;  3IL2 A;  1I5Z A;  5JFR A;  3GO5 A;  4XBF A;  3E6D A;  2HKX A;  4A0Y A;  3K1P A;  3N97 A;  3DFG A;  2ZME A;  2UXX A;  5FLX Z;  1SD7 A;  4GYI A;  4HLY A;  2ZXJ A;  3F6V A;  3KP6 A;  5EEH A;  3L00 A;  1QO0 D;  3IKV A;  3QP6 A;  1IW7 F;  4UV9 A;  2M5W A;  2M8E A;  4MQV A;  1QQI A;  1WWX A;  1YS6 A;  3IRR A;  4DNC A;  2IA0 A;  2RQP A;  2Z33 A;  1R5H A;  1B9M A;  2CFX A;  2XIG A;  5F6F A;  2A07 F;  1BM9 A;  4PCQ A;  3BZ6 A;  1KQ9 A;  1JXS A;  4G8X A;  1AWC A;  1IRG A;  3I59 B;  3PQK A;  3WTX C;  3F8N A;  1W7P A;  2Z3Y A;  2VXZ A;  2FE3 A;  4PDK A;  1YW8 A;  4TV7 A;  2AS5 F;  2ESH A;  2PLY A;  1OKR A;  3H3U A;  5JR3 A;  4RGU A;  3R0A A;  3U2R A;  3J80 Z;  4DQ2 A;  1KQ0 A;  2P4W A;  1F1Z A;  1RUN A;  4HOB A;  3DV8 A;  3GYH X;  1S6L A;  1IXR C;  2DFI A;  2IA1 A;  5FD5 A;  3GWZ A;  1PP8 F;  2PEX A;  2PQ8 A;  2DU9 A;  3GLX A;  1FPQ A;  4L5I A;  4IHS A;  5DEQ A;  4OIR F;  2DK5 A;  2NAZ A;  5D8K B;  3TO9 A;  3GFM A;  1D3Y A;  1R58 A;  2EA2 A;  4QWQ A;  2HTJ A;  4LG0 B;  5FD6 A;  1J0R A;  4CIC A;  5LRR A;  2D2W A;  4L0Z B;  3WE2 A;  1ZRD A;  1XDU A;  3I53 A;  3R4K A;  1ZAO A;  1IN5 A;  3VFZ A;  4UNO A;  2A68 F;  1BC7 C;  3MEX A;  3M7G A;  3B02 A;  4A0Z A;  2XGX A;  4ZYE A;  3LQR A;  4Q4Z F;  1E2X A;  5K5R A;  4HV5 A;  5EEG A;  1I1S A;  3LST A;  1STZ A;  5L3E A;  5LHH A;  3DXJ F;  3B73 A;  3U1D A;  2LKP A;  4EQQ A;  1I27 A;  4RB2 C;  2V6C A;  5K5Q A;  3HSF A;  1OPC A;  1S3J A;  4MTD A;  2DAO A;  2HOE A;  1MJ9 A;  1P4A A;  2FNP A;  2H94 A;  1CGP A;  2ZBK A;  2GA1 A;  3HIF A;  3SHF A;  4RAZ A;  2VON A;  3BY6 A;  3I4P A;  4L5J A;  4IRG A;  4BH9 A;  3GFI A;  2JPB A;  1YO5 C;  5K1Y A;  3FXU A;  3SQN A;  1J5Y A;  5D6F A;  5FO5 A;  3BRO A;  4OU0 A;  5J8F A;  3AAF A;  5DUK A;  3HTU A;  1BI0 A;  1FT9 A;  1K6O A;  2H27 A;  5H6Q A;  4ENN A;  2XAH A;  1R7J A;  2O6G E;  2KJB A;  4L9V A;  3KCC A;  3I58 A;  2XAS A;  1BI3 A;  4M9S A;  3IKT A;  2H09 A;  4WK8 F;  2QLZ A;  4HDU A;  1LEA A;  1VTN C;  1RI7 A;  2OAZ A;  3LQQ A;  3E6B A;  3QOP A;  3F21 A;  3BPV A;  4M71 A;  2P5V A;  2QYO A;  1I6X A;  1FBU A;  3F3X A;  1XSV A;  5L3C A;  2YU3 A;  2XAG A;  1XN7 A;  2RN7 A;  4YG2 F;  4YIF A;  3BJO A;  4LGW A;  2E7X A;  3N4M A;  2RC4 A;  3KEO A;  2FBH A;  2Z9O A;  5E8I A;  1HW2 A;  3TGN A;  1HST A;  3DEU A;  2OU2 A;  5D5U B;  3L09 A;  3I64 A;  5ICC A;  1IZ1 A;  4ESJ A;  3TQN A;  1LDJ A;  3M1E A;  4NQW A;  4M6Y A;  2EFN A;  2EFQ A;  5JVT A;  4WF2 A;  5FLX K;  3ZQ7 A;  1FLI A;  1ZG5 A;  5E18 F;  1B4A A;  1HKQ A;  3DPT A;  1HW5 A;  4AWX B;  2CYY A;  1J7K A;  5BOX A;  5E1W A;  4LG0 A;  2ZKZ A;  2Y0M A;  3T0Y A;  3TOA A;  5H20 A;  1XSX A;  1G3Y A;  2ISZ A;  3K0L A;  3TOB A;  5ICF A;  3P9C A;  2HTS A;  3QRF F;  3WGG A;  3WTS C;  3GFL A;  1DUX C;  4CHU A;  4I0A A;  1B9N A;  4Y13 A;  2ZJ2 A;  2FU4 A;  2ZNZ A;  1KU7 A;  3NQO A;  3Q9V A;  2GXB A;  1EH7 A;  2G7U A;  4XLN F;  3IRQ A;  3FHZ A;  2HWV A;  3IC7 A;  4XSZ F;  4A6E A;  2XKP A;  4KT5 C;  1SMY F;  1ZH5 A;  2STW A;  3ZMT A;  1YQA A;  2GZW A;  3BP8 A;  5HVQ C;  3SZP A;  3ZN0 A;  1IN4 A;  2X0L A;  4UHT A;  4KIC A;  3RJP A;  2VC1 A;  3K1N A;  4HYE A;  1OYY A;  1KA8 A;  4EM1 A;  4ZH4 F;  3QU6 A;  4ENM A;  4OIO F;  5FB2 A;  4ON0 A;  2KIF A;  1MZB A;  5DD8 A;  4M9Z A;  4M73 A;  3E5U A;  2CQK A;  4G7Z F;  3IWF A;  1QNT A;  1T98 A;  2HZT A;  3GF2 A;  1MGT A;  3DP7 A;  5DDG A;  3RKX A;  3E5X A;  2A69 F;  1UHW A;  2RKH A;  6PAX A;  1IUY A;  1CF7 A;  1P4X A;  4MNU A;  4U7D A;  2MLK A;  2UWM A;  5AIQ A;  5AON A;  2P7C B;  2Y48 A;  1FZP B;  1E17 A;  1YG2 A;  3T5X A;  1SAX A;  2VC0 A;  3GW2 A;  3MZH A;  1ZLK A;  2IT0 A;  3ZP5 A;  2CWE A;  3H3Z A;  2KRF A;  5DUI A;  3JTH A;  2ACJ A;  1O3Q A;  3KLN A;  1G3W A;  2PI0 A;  2D45 A;  1HKT A;  2Z5U A;  2DLL A;  4G94 A;  4KNY A;  2PN6 A;  1HW1 A;  2QQA A;  2FXA A;  3E6C C;  2MA3 A;  4LK0 F;  1YTY A;  3MCZ A;  1IN6 A;  4YFX F;  5BPD A;  1DP7 P;  2VE8 A;  2C6Y A;  1WRJ A;  2WTE A;  1T6S A;  1IRF A;  1BOA A;  3BJA A;  3VOD A;  1S8N A;  3IWZ A;  2W84 A;  2CSO A;  1XGM A;  1XSD A;  1D8K A;  3K69 A;  1UST A;  5DCM B;  5AIP A;  3E5Q A;  1T2K A;  2WV0 A;  4A0X A;  4ZYH A;  5HS8 A;  2STT A;  4G7O F;  1KU2 A;  4KIB A;  3WU0 A;  3ECH A;  4WXD A;  2G9W A;  3GFJ A;  5LGT A;  2FML A;  2RDP A;  4RB3 C;  2NNY A;  3KEQ A;  1UHM A;  2Q8K A;  5DYM A;  3C7J A;  1JHH A;  5HLG A;  3MAJ A;  2B0L A;  4EVI A;  5FFX A;  2XUB A;  5DV5 A;  4QLC U;  4HZF A;  2OA4 A;  5DCF A;  1IXC A;  2FBI A;  2HKO A;  4ASN A;  2DI3 A;  5IT9 Z;  1ZRF A;  4U0W A;  1V4R A;  1FYK A;  5CVR A;  1F4K A;  4HQE A;  3COA C;  4IF4 A;  3SZT A;  3CUQ B;  1BI2 A;  2WC2 A;  2HFH A;  4CYD A;  2YR2 A;  3W6K B;  3ABU A;  3PQJ A;  3RYR A;  2CO5 A;  2LF7 A;  4MQ9 F;  4CXF A;  1Z91 A;  2VBZ A;  1OMI A;  4K2E A;  5ED4 A;  3WTY C;  1PP7 U;  2BBY A;  4JK1 X;  1ZG1 A;  3HHH A;  3MWM A;  3WTW C;  4EMS A;  2IA2 A;  4EJU A;  2BV6 A;  1F9N A;  2VBW A;  4RAY A;  4S05 A;  4I98 B;  2M87 A;  5CVI A;  1T39 A;  3JSO A;  3VOE A;  4EM2 A;  4UVA A;  3CJN A;  2Y75 A;  1PUE E;  3ZN1 A;  3Q5F A;  4LK1 F;  1TQP A;  4KIF A;  2GWR A;  3L9F A;  1IF1 A;  1YW9 A;  2F5E A;  2HDC A;  3LAP A;  1YIO A;  1P4W A;  4RGX A;  4BHB A;  4JQF A;  5E20 A;  3F8M A;  3C1D A;  4MEX F;  1LNW A;  2AXL A;  3FWE A;  1XB4 A;  1BIA A;  2VOP A;  4KUM A;  1V3F A;  2KIM A;  3QAH A;  4I2O A;  1G6N A;  2MH9 A;  2IP2 A;  3KE2 A;  3FM3 A;  1ZGJ A;  4WX9 A;  4LLG F;  4BQA A;  3ERE D;  1T0F A;  2EA4 A;  5D4S A;  3FX3 A;  1S7O A;  3QP5 A;  3V7C A;  4ESB A;  1Z6R A;  5HOO A;  2YPR A;  3O2P E;  3HRS A;  2IVM A;  3C3W A;  2XAF A;  1U2W A;  4IVN A;  4D0P A;  2Q0O A;  1LQ1 A;  1U8R A;  2K4J A;  5LHI A;  1XGN A;  4OMY A;  1ZAR A;  5E1Z B;  3TKY A;  4AVP A;  1KYW A;  2DBB A;  2A61 A;  2DT5 A;  4L9N A;  3CDH A;  2V79 A;  1U78 A;  2IPQ X;  2EV5 A;  4LFU A;  5ILU A;  1KGS A;  4P55 A;  4EJO A;  1YLF A;  3F8B A;  3RDI A;  4O5V A;  1P6R A;  1LB2 A;  4P9U A;  2DQL A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...