1K61A

Matalpha2 homeodomain bound to dna
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
60
structure length
60
Chain Sequence
RGHRFTKENVRILESWFAKNIENPYLDTKGLENLMKNTSLSRIQIKNWVSNRRRKEKTIT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title A Hoogsteen base pair embedded in undistorted B-DNA
pubmed doi rcsb
molecule tags Transcription/dna
molecule keywords 5'-D(*AP*CP*AP*TP*GP*TP*AP*AP*TP*TP*CP*AP*TP*TP*TP*AP*CP*AP*
total genus 22
structure length 60
sequence length 60
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2001-10-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00046 Homeodomain Homeodomain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.60 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Homeodomain-like 1k61A00
2NVYJ 2JA5J 1GDTA 2E2HJ 3BT9A 3JRIA 5BNGA 1U78A 4D5CA 3QPLA 1NK3P 1TC3C 3OSFA 2E19A 1OCTC 2VKVA 1GT0C 2QF7A 3BQZA 2DA4A 2QCOA 1B72B 2DTZA 2X6OA 3I4MJ 3GTMJ 3BR3A 1LE8A 2CQQA 2Y31A 2LK2A 4RBOA 1FTTA 1ETQA 2E2JJ 2LVSA 2VPRA 1G2HA 3SFIA 1I3QJ 4CYCB 2HYJA 2LD5A 1UHSA 3H3VK 3GTOJ 5JLWA 2EZHA 5IYDJ 1WH7A 3HM5A 1Q1VA 1HOMA 1QRYA 1BW5A 2B63J 3MKLA 2IEKA 4IEJA 4LOCA 4CYCA 3D1NI 3GBGA 3FISA 1X2MA 4I76A 3HOXJ 3QPSA 1IV6A 3RZDJ 1AKHB 4JX4A 1W0TA 3A01B 1B72A 5C4XJ 2R0QC 3BR2A 3VPRA 3F0CA 2HQ5A 1X2NA 3JRBA 1IDYA 1ZR4A 4AYBN 4BBSJ 2JA8J 4BKXA 5F1JA 4BBRJ 1MBKA 2HI3A 3M3YJ 2JWTA 2YUSA 3GTJJ 3A01A 1AKHA 3HOUJ 4C3JJ 3BTCA 3NARA 2M9HA 1H8AC 4Y52J 3BTIA 2Y0SN 1XC5A 1QVUA 2M34A 1APLC 3JRHA 4BY7J 3QQAA 5J1RA 5FKKA 3LSPA 2N8GA 2DA2A 3S17J 3FIWA 1ETKA 3SJMA 1XS9A 1ENHA 3G1MA 1HDPA 4L5EA 1LE8B 1FIPA 1TWGJ 1IRZA 3SDGA 4D7MA 2ECBA 3WHBA 2R93J 5E3NA 1JUPA 2DMNA 2FQ4A 3JRGA 3S15J 4XK4A 3PO3J 1UG2A 5J1YA 4A3DJ 5FLMJ 4M3GA 4QSHA 1ZQ3P 1Y1WJ 1RR7A 2PMZN 2DA3A 4A3CJ 1WH5A 3LOCA 1MNMC 2DMPA 5E3LA 3MVPA 1VNDA 1YRNA 3O8HA 1I6HJ 2MGQA 4AUXA 1QPIA 1GVDA 2LLKA 3RZOJ 2XB0X 1JTXA 3JRFA 2I10A 5IP9J 1O4XA 5EF6A 4RDUA 2K9NA 5M3FJ 9ANTA 2IBDA 2EH3A 2L7FP 3Q0WA 2DA5A 4X6AJ 3S14J 4ABZA 4A3GJ 3FKIJ 1ZGWA 1WI3A 4A3JJ 4A3MJ 2R92J 5IOYA 2R5YB 1MH4A 5GPAA 2DN0A 3Q0VA 2EQRA 5EGOA 4AC0A 1FEXA 2CUFA 5EYRA 5GP9A 3K2AA 3PO2J 1ZTRA 2G0EA 2M0CA 5DTDA 2CUEA 1ETVA 2DMTA 2LFBA 4MFDA 1WPKA 3OOUA 3TW7A 5F27A 3NAUA 4DYCA 1SFOJ 1EF4A 1Z77A 2JK3A 4MLOA 4HNVA 2Y9YA 3LNQA 1ZK8A 4MO7A 3PM1A 1PUFB 1POGA 4XIDA 4A3FJ 1Z0XA 1IUFA 2VKEA 4JX6A 4M3BA 2R5ZA 1HDDC 2LKXA 3C2BA 1TWAJ 2CJJA 1BJZA 2KDZA 3B6AA 1H88C 1MBJA 5IYBJ 1W0UA 4IHXA 3I4NJ 3JREA 1JUSA 2O7OA 4JP0A 4XICA 1JT0A 1RESA 5IYCJ 2VUMJ 2XPVA 2CQXA 1JKQC 2OPTA 5EG0B 3ZQGA 1K61A 4M3FA 5F0HA 2H1KA 5FKNA 4D5FA 5E3OA 1B8IB 5C44J 5HODA 1WCMJ 2E1OA 4QTRA 2NVXJ 2EZIA 3ZQHA 1JTYA 4A3EJ 2CRGA 4A93J 1H89C 2D5VA 4DYQA 4UUSA 1E3OC 5E3MA 2LR8A 4IHYA 2JMWA 1JKRC 1TWFJ 2HXOA 1S7EA 2O9LA 1MBEA 1MSFC 4A69C 2GBYA 5M5XJ 3HKZN 1OCPA 3WHCA 4V2FA 1BL0A 2M2EA 4MIMA 1A6IA 2EZLA 3H0GJ 4FCYA 1LFBA 2XPUA 1VFCA 2GM4A 5F0FA 3CCYA 4A3BJ 1DU6A 5EDNA 5J3LA 4B3AA 4DYRA 1U9OA 3S1MJ 2K9QA 5JLXA 2LY9A 2TRTA 5K7FA 4C3HJ 4S0HB 2MG4A 1HCRA 2EBIA 1ETOA 1JGGA 2CU7A 2HXIA 2E2IJ 4GFBA 3HBLA 3RKQA 3S2HJ 4B1RA 2Y9ZA 2AO9A 2K40A 5M5WJ 1RETA 1MBHA 3O8GA 1MSEC 3S1RJ 3B6CA 5F08A 1T56A 3ZQCA 3IH2A 4Y7NJ 1MH3A 3L1PA 2XPWA 4XRSG 2COBA 4QIWN 2M8GX 2H8RA 1ETXA 2IAIA 2L9RA 3TP0A 4BXXJ 2ECCA 3BTLA 3DCFA 3CDLA 1MBGA 4W97A 4UUTA 3OIOA 2NS7A 3BG9A 3K7AJ 1U8BA 2P81A 3GTKJ 1NTCA 1JUMA 4M3EA 4A3IJ 3CQZJ 5FLVA 1BA5A 3ZOBA 4DZJA 1TWCJ 1CQTA 5K7ZA 3MN2A 1WGXA 3IH4A 3ZQFA 3LSRA 1HLVA 2JA6J 2OF7A 3HOWJ 1IDZA 3G1OA 4M3DA 3G1LA 2DA1A 1OJLA 3FK6A 2HOTA 2R7ZJ 4UUSB 4MFEA 4V2GA 4FTHA 4C2MJ 3JR9A 2KT0A 3S2DJ 4EEFG 1D5YA 1GV5A 1JKOC 4DZPA 3RQIA 4NDLA 2W48A 2EZKA 3JRCA 1IC8A 3HOVJ 1HF0A 2WB1N 3BG3A 1JJ6C 2DMQA 1FIAA 2DMUA 1ZKGA 1SANA 2WAQN 1FTZA 2ID6A 4I6ZA 1IGNA 2MSYA 4JX5A 2ZB9A 1JKPC 3TW6A 5IP7J 3GTQJ 3HGYA 5EG0A 4M6VA 2FJ1A 1LFUP 2NS8A 3BR0A 5F0CA 2XGEA 2TCTA 5IP6A 2DA7A 5IPAA 1T33A 2WV1A 1ITYA 2LP0A 2O8KA 2XRLA 1VI0A 3IH3A 2Y30A 2X9DA 5K7HA 1PUFA 2AHQA 4IHVA 1AHDP 2MW8A 1TWHJ 3BR1A 3HGGA 5J1UA 1ORKA 2K9SA 5C4JJ 4G12A 5M5YJ 1F36A 1MBFA 2X48A 1X58A 2JJ7A 3BTJA 1RKWA 4W1UA 5EZGA 1UMQA 5GPCA 3JRAA 2NVQJ 3IV5A 1GUUA 1JJ8C 3HB9A 3BQYA 2DJNA 2XGDA 2ME6A 2Y2ZA 2NOGA 3S16J 2HOAA 1NK2P 3HEFA 1BW6A 1B8IA 2FD5A 3GTLJ 1OFCX 1U9NA 4D7NA 5EGOB 3E7LA 3LSJA 1ZR2A 4FISA 3ZQLA 2FX0A 2JA7J 3GTPJ 5FKLA 3HOZJ 3BG5A 1DU0A 3LSGA 4XRMA 2R5ZB 1R9TJ 1P7IA 3A02A 2GLOA 2HOSA 3HDDA 5C3EJ 3CMYA 5EEAA 1ETWA 2L7MP 2DA6A 4A3LJ 2ELKA 3HOYJ 5FKMA 5F04A 3GTGJ 1VF9A 4DW6A 2YS9A 1YRNB 2XSDC 1AU7A 1IG7A 5FKOA 3S1NJ 4C3IJ 2XB5A 1GV2A 3OSGA 1RPWA 1QVTA 5DS9A 3UKGA 4XRSA 4JYKA 4J19A 2XGCA 1RKTA 3BR6A 2ME0A 5IOZA 2R5YA 3Q0UA 2L0KA 3ZQIA 1Y1VJ 4BY1J 5EZHA 2ID3A 3A03A 3Q3SA 1P7JA 5M3MJ 2VI6A 4FE4A 3TEDA 2JN6A 1K83J 1JT6A 1FJLA 4X1EA 3W6VA 1ETYA 3TP3A 3BR5A 2YU9J 3M4OJ 3DEWA 4FE7A 4A3KJ 2RAEA 5FJ8J 1XG1A 2NVTJ 3S1QJ 1I50J 1F43A 2LTPA 1A5JA 2HDDA 4IHWA 3JRDA 4B4CA 2L7ZA 3FK7A 1IJWC
chains in the Genus database with same CATH superfamily
1X4PA 4FQGA 2IPQX 1GDTA 1OYYA 2XAUA 1U78A 1TC3C 1B1BA 4Z2YA 2EK5A 2Z1DA 1V5GA 3BQZA 2V1NA 2DA4A 2F4MB 2X6OA 5JVGF 3GTMJ 1IN8A 3H0DA 4GYIA 4A6EA 1STZA 4R79A 2H27A 2XDVA 3IRQA 2LD5A 3MEXA 1UHSA 3ECOA 1ERDA 3GTOJ 2BY2A 3M7GA 3V42A 1HOMA 3M8FA 4RLQA 1BW5A 3MKLA 4IEJA 3IWFA 4NQWB 4CYCA 2FU4A 3FISA 4J01A 3QPSA 2OV7A 3RZDJ 1AKHB 1W0TA 3KP4A 2O61A 3G3ZA 3OYAA 4N0BA 4KMUX 1YX3A 3T0YA 3CCQI 2VJIA 2VBXA 1UFMA 2EFOA 2Y75A 4BQQA 1X2NA 2HVQA 2KMUA 1IDYA 4BXUA 3K4CA 3K4JA 3JW4A 1D8JA 1H9GA 1YIJI 4BKXA 5EJCA 5HS9A 2B9SA 2DPUA 1XN7A 1P4WA 5DD8A 2YUSA 2Z33A 4L18B 4EJTA 1D0ZA 4LFUA 1RZ4A 4Y52J 3BTIA 2Y0SN 3RKYA 3EETA 1QVUA 3WGGA 4K2EA 2M34A 3WU0A 4AIKA 2BOLA 1UJ8A 4OIQF 2RQPA 2DA2A 1KQ9A 2CW7A 2MFZA 3CDIA 1ETKA 1OR7A 3SJMA 1F4KA 4OMYA 1ENHA 4ENKA 1K78A 2HEOA 1HDPA 2DK5A 2VXZA 4D7MA 2Z5UA 3SZGA 3WHBA 3ABUA 1FZPB 2DMNA 2B0LA 2QQBA 3OR2C 4E70A 3CO6C 4XK4A 1YTYA 2X6XA 4A3DJ 4U0YA 5FLMJ 3V7RA 3OWTA 4M3GA 4BE1A 2PMZN 1Z6RA 3HPGA 3N97A 1NG7A 3K10A 2BV6A 3Q9VA 1SFEA 3E6CC 3W2AA 2DW4A 4UHTA 1NH3A 2XIGA 4Q47A 2HNHA 2KIUA 1JTXA 1DUXC 3LSTA 1Z3YA 2I10A 4ZYDA 4RLFA 3W3CA 3E97A 2LMDA 3FXRA 4XOPA 2YSRA 9ANTA 2HPIA 2IBDA 2K9LA 3CJRB 3Q0WA 3A4CA 3OYIA 2ELJA 3WE3A 2IP2A 3GLLA 3ABKH 1HKTA 2DDBA 4CXFA 2ACJA 4U0VA 1GLNA 1IN7A 1XB4A 2JVHA 2XF5A 4BACA 3MKYB 4FX0A 2HR3A 2ZSHB 5DYMA 2OC6A 4KA4A 1USTA 2K4JA 4EGYA 1BI2A 1QZEA 1XX5A 3SEQA 2CUFA 4XLPF 3HRUA 3TGNA 2CWEA 2R7TA 3E0JB 2A68F 1YJ9I 5DTDA 3KP3A 2Z9OA 3EPZA 3KPHA 1XDSA 1S72I 2V1DA 1VQ6I 2FNAA 3HRTA 2A5YB 4LIVA 4DYCA 4KDPA 1SFOJ 3HUGB 2CGPA 2VT3A 5B1AH 4IQJA 2QVOA 3OYGA 1G8XA 2BZTA 4HEA2 3MKZA 1S6LA 4MO7A 4NNJA 4XQFA 4M3BA 3EUHA 4F52A 4RAFA 1Y0UA 1MBJA 3CZ6A 4AIHA 1JUSA 2O7OA 4CCMA 1RESA 2KL4A 4YIIA 2VUMJ 3H9QA 1KU7A 2KLOA 1B4AA 3ZQGA 3ZMZA 1WJDA 4M3FA 1XGMA 3R0JA 1P9QC 4ZC3A 1VTNC 5C44J 2VC0A 5HODA 1D3YA 2ZXWH 2L02A 2R7SA 4OINF 4QTRA 2LY1A 4HF0A 4G7HF 5J8CA 1LPQA 3ZQQA 4A3EJ 4PJNA 3OYBA 3WTXC 4MHGA 3P7NA 3LSHA 3KZZA 2VQCA 1U5TC 5EEHA 2M5WA 4PSXA 3KZYA 1VQKI 4BHCA 5D4SA 1JKRC 1G4DA 3BCBA 2HXOA 4EJVA 4WXCA 3V8LA 1MBEA 3K1PA 4A69C 2OZUA 5M5XJ 1FLIA 2ETHA 3BOQA 1YW7A 2CQ7A 2F2EA 3SQNA 3HKZN 2L01A 1ZHFA 3WU2C 3QPHA 1MMAA 2MC3A 2Q2EB 4MIMA 4CYDA 2A61A 4IJAA 2ZBKA 1E3PA 1R1TA 1XPXA 1LFBA 1R00A 1J59A 1LDJA 5F0FA 5FRMA 1DU6A 2KIMA 5F6FA 5J3LA 3W2VA 4A5NA 4HOBA 2YPRA 2DYSH 2LDUA 3TDZC 3I56I 1EA3A 1LDKB 4N4OB 5BPDA 4C3HJ 4S0HB 1TQIA 2Y48A 1HCRA 2EBIA 2ELHA 2ESNA 2L3DA 3NWSA 5HLTA 3Q5FA 3LWFA 3HBLA 5H20A 3TKYA 1G3SA 5DV5A 1BIAA 2MA3A 3GMEA 4NUBA 1H9TA 2JSPA 5ILVA 1MBHA 3LSKA 5F08A 4HRIA 2JUGA 3R6SA 3S32A 2E7XA 2CV1A 5L3FA 3QP6A 4BJTA 4XRSG 1JGSA 2CO5A 1QZYA 5D6EA 5B5EC 1TBXA 2COBA 1KYZA 2OA4A 4QIWN 1FYLA 4BUPA 4CCOA 3KEOA 2L9RA 3TP0A 4XLHA 2FSWA 1ZN2A 4W97A 4OAYA 1MBGA 1PYVA 3HIFA 3LSIA 4UUTA 3OIOA 4MTDA 2NXNB 4UV8A 1T8IA 4XN0A 2AXTC 3FBNB 2QSGX 2GXGA 2VLAA 1U8BA 3JSPA 1OKRA 5ED4A 5LHGA 1REPC 3ZXSA 4C9YA 4CZZA 3PJRA 4NBQA 4A3IJ 3VWBA 4L0YB 2IJLA 1HW1A 3LFUA 1BA5A 4BHPA 1TW2A 4GO1A 2VBYA 1R49A 1HLVA 3WE2A 4I99C 1YITI 4RA2A 5LHHA 2R7WA 3OR1C 1E2XA 3GZ6A 3TO7A 2HU9A 4UB8C 1OJLA 2HOTA 1Q1HA 4C2MJ 3H92A 1O7FA 3U1DA 1JKOC 2AS5F 5E18F 3HOVJ 3K4LA 1HF0A 3ESWB 4DBRA 4G6TB 3VB2A 4S05A 2V1UA 2DMUA 3EYYA 1SANA 1MMDA 1FTZA 4L9JA 1VQ4I 3T5XA 4JX5A 3HOTA 1FC3A 1SVOA 3OL4A 3GTQJ 2HQNA 5EG0A 5BS6A 1LFUP 2F5FA 3CLOA 3J80Z 3DBLB 4ITVA 4PJJA 5F0CA 4RB3C 2M45A 2RGVA 3HTSB 4IL6C 2ZC2A 2TCTA 1T6SA 2OTJI 3DBRB 2HVRA 3MAJA 3MMYB 1T33A 1S29A 3G73A 3E1SA 3MZHA 2MH9A 2Y30A 2H8WA 5K7HA 1P4XA 3GF2A 3KP2A 3QWLA 3F6OA 4X0GA 1ORKA 2A69F 1Y8RB 3BY6A 4HX7A 1MBFA 2CH0A 3CCMI 1IXSB 2OUMA 3BTJA 4BEHB 1TW3A 2LKPA 5IY5H 5EZGA 1D5VA 2D1VA 3JRAA 5D5WB 2R7VA 4KN7X 2KJBA 4B8XA 4DQ2A 1V55H 2LG4A 1JJ8C 2OQGA 3HB9A 3HTUA 2XGDA 5E1ZB 3UR3C 3S16J 4IOAF 2HOAA 4HG2A 3HEFA 3IAM2 3FM5A 4U87A 1U9NA 5EGOB 2CS3A 3ONQA 1GVJA 2QKMB 5J4YA 3CMAI 1FWZA 3FDYA 1KU2A 2WV0A 4MTEA 3HOZJ 4BU2A 1D1CA 1P7IA 3CJNA 3HHGA 2Q1ZB 5J40A 1OYWA 2VE8A 5C3EJ 2O03A 3PUBA 2PMZA 2BE5F 5EEAA 2JA2A 2CFOA 3AG2H 1VQOI 1IW7F 4IX7A 1QPMA 2L7MP 3RYRA 4A3LJ 2HKOA 5FKMA 5F04A 2NS0A 2D45A 3GTGJ 1VF9A 3DLAA 3PFIA 3GEZA 1VQLI 1MMGA 2E5NA 2XAHA 2MD5A 3A0HC 1MW7A 3O2PE 1JHFA 3F6VA 1AU7A 5CLSA 2GIVA 2ZNZA 3QYEA 1IG7A 1FMVA 3E5QA 4I09A 1GV2A 1HXDA 1RPWA 1G3YA 3AAFA 1QVTA 3G6EI 4CZCA 1MJ9A 4I01A 3ULQB 3KLOA 1R6RA 2KJCA 2E1MB 1S5LC 2L0KA 3ZQIA 2K85A 1Y1VJ 5EZHA 1TT0A 4DBQA 1B6AA 2V7FA 1WKMA 3W6KB 2COMA 3Q3SA 1P7JA 4I02A 2IGKA 3TEDA 2HQAA 2JN6A 3VEPA 1R7JA 1SFXA 4CHUA 1W7PA 2RAEA 3FXUA 1UB9A 2DCEA 2A6HF 3PNVA 4IRIA 2NVTJ 3S1QJ 2D1HA 2L5QA 5JHUA 1Y0NA 3ZPLA 4ZDOA 3K70C 1A5JA 5L3DA 3KX2A 1DDNA 2CV0A 3SFZA 3LAPA 3FK7A 3RKXA 4LLNA 2E2HJ 4RAYA 2VPLA 1S8NA 4BXFA 2E19A 2VJJA 2VKVA 4G8XA 1RUOA 2BVLA 3FZVA 2QKLB 1GT0C 5D6FA 2F5EA 1WVRA 4I98B 1TZLA 1B72B 3J7YJ 2DQLA 2H6BA 3DKXA 4UY8I 1ONVA 4RBOA 1FTTA 1ETQA 2LF7A 2M1BA 3ML6A 2VPRA 4UB6C 2E2JJ 3M8JA 3PNTA 3OY9A 3SFIA 4E7IA 1P4AA 1I3QJ 2WA0A 2VC1A 1WHUA 1TQPA 2WB1A 1DGRM 2P5LC 4XSXF 4B3XA 4B44A 3H5AA 1ZAOA 1X3UA 2EZHA 5JLWA 1V5EA 4R8HA 1WH7A 3BWGA 5FGMA 2IS1A 1QRYA 2R7RA 2B63J 3C2GA 2M4GA 5D5UB 2ADUA 5JHFA 3GBGA 2ICWG 1F5TA 3HOXJ 1IV6A 1MKMA 2DOAA 4JX4A 1ZLJA 2RNJA 1VQ7I 2OBPA 1I1SA 1FX7A 2E71A 3VYSB 2LKSA 4G7OF 2R0QC 2BY3A 1PP7U 3VPRA 2PI0A 3E5UA 1NG6A 4ESBA 2DQRA 4BBSJ 1I39A 4I0BA 2JA8J 1R71A 2Q0OA 2QWWA 4JQFA 3H9JA 3M1CA 2VB6A 3PUFA 2JWTA 3ROUA 4XONA 3A01A 1K6OA 2KIQA 3ZR8X 1AKHA 5E8GA 3K1NA 4V19K 2QQ9A 1WJBA 3NARA 1A04A 2QA4I 4XLCA 4NQWA 1FP2A 3OYJA 4DJAA 2PLYA 1APLC 3FXOA 1ZELA 3S8PA 1WSUA 2FEZA 1VQ9I 1YX5A 4BY7J 2BXZA 3DBHB 2JPBA 3QQAA 2OAZA 3I71A 3BPVA 4O6JA 2ISZA 1AOYA 2YX7A 3G1MA 4YEJA 4WXHA 1IN6A 3SYTA 1Y6IA 4KNYA 5D4RA 1ZRCA 5K1YA 2ECBA 5E3NA 5K5QA 4M73A 5CVVA 5JFRA 4S04A 4XRFA 1B59A 1ZG3A 5CYVA 2MD0A 5KAIC 4QSHA 1EH8A 4AYBA 1P92A 5LEKA 3RDIA 2DA3A 1W7PD 2VOOA 4U7BA 1LVAA 2V9VA 3PIPF 1VNDA 2JZYA 3BC8A 1XMXA 3O8HA 4IZZA 1I6HJ 5IT3A 4AUXA 2O8XA 1QPIA 3RZOJ 2LLKA 3LQRA 4OMZA 3JRFA 4N9IA 3T8TA 5EF6A 1O4XA 2K9NA 1ODDA 4WX9A 3PFYA 2EH3A 2L7FP 3SZPA 1LJ9A 3DPTA 2H09A 3TO9A 4M71A 2A6TA 4HSTA 2UZKA 1RUNA 3G4SI 2BW3A 4A0XA 1ULYA 4A3GJ 4G94A 4A3MJ 4P9FA 3SZTA 1XMAA 2ZXIA 4HX4A 4A3JJ 1T0FC 2PJRA 3HJEA 4BYYA 2MABA 1N75A 3Q0VA 2BEOA 5EGOA 1Z05A 1YHQI 1O3SA 5EYRA 4I2OA 3K2AA 2JVGA 1ON2A 4CA0A 1ZTRA 2M0CA 4DIQA 2IT0A 2CUEA 1ETVA 2LFBA 4H4KC 2JRTA 5CVRA 2EINH 4IHTA 3TW7A 3NAUA 5CQGA 4BQOA 1Z3XA 3CCSI 2X1DA 2JPCA 4MLOA 3ZMDA 4HNVA 2Y9YA 2XVCA 2DODA 4HF1A 1R36A 1ZK8A 4KMFA 2RKHA 4HDUA 1POGA 1DQUA 4A3FJ 1RR8C 5DUKA 4B48A 2R5ZA 2R7XA 2XASA 2K5CA 2RVCA 1BJZA 4RAGA 3B6AA 5DDGA 1H88C 5IYBJ 1WJCA 2L54A 3A2KA 4XICA 1JT0A 1Z21A 2LYCA 3OYCA 5IYCJ 1L0OC 2CQXA 1T38A 1UELB 3FMQA 3HXLA 4Y3OA 1JKQC 2W24A 1VQNI 2BGCA 2FOKA 1HC8A 5E3OA 2WAFA 1HA8A 4RS8A 3OYHA 3M1EA 3RSNA 2E36A 3QPTA 2NVXJ 4L9NA 2PMHA 4UVCA 3FKJA 2P5VA 1S7OA 1BOBA 2CRGA 2DOEA 2F6CA 5D8KB 3FWEA 2LBFA 4A93J 1R5HA 1H89C 1QZZA 1R5GA 5CVJA 5K5RA 1MGTA 1OCZH 2KRCA 4CCJA 2D5VA 3OV8A 2JQ7A 3LAJA 1E3OC 2STWA 1R5ID 2KIFA 3CTAA 1K7AA 3GFIA 4PSWA 4XORA 4LG0A 2EB7A 1TWFJ 3DXJF 4CCKA 1KQ0A 3DU6A 1S7EA 1MJBA 5BQTA 3LA7A 1MSFC 1WJEA 3QP5A 5CVIA 1OCPA 3WHCA 3KETA 3QYFA 4YFXF 1A6IA 5L3EA 1SFUA 1DGWY 3H0GJ 2QSFX 2ZJQF 3WG7H 5KHDA 5CJ9A 3ABLH 5EDNA 3AL0C 4B3AA 1FBUA 3MZYA 4AVZA 1IXCA 1YS7A 2K9QA 5JLXA 1IRGA 3OYEA 3QAHA 5HLGA 1U8RA 1ZGJA 4IO9F 1ETOA 2G9WA 3I4PA 5TJJA 4LITA 2CU7A 2DT6A 5ICCA 1KGSA 2JTVA 3L2QA 2E2IJ 4ENJA 4XLEA 1ZREA 4B1RA 4BQNA 3ZGKA 5M5WJ 1RETA 3S1RJ 1M1EB 4OIPF 3RJPA 3ZQCA 1WI9A 3IH2A 1SEUA 3HRMA 1MH3A 4Y4RA 4EGZA 1FSEA 3RTRA 2OQRA 5JR3A 4LB6B 4JK1X 4BAYA 2HTSA 3DTKA 4IRGA 2ZMEC 5J6XA 2DJIA 5D5XB 1ETXA 4Y33A 1LEBA 3KCCA 4M9XA 2F48A 3BTLA 1OCRH 4HW0A 3W6JB 2TDXA 3OYKA 4OWRB 2PN6A 4EM2A 3PSIA 4YG2F 2L2OA 3K7AJ 2EFNA 2HDWA 1R4MB 2VN2A 2HKXA 1BR4A 1J09A 5IT9K 1X3WB 3CQZJ 4II2A 2IS2A 5FLVA 3ZMVA 1EH7A 2EIMH 1F1ZA 1SVLA 3K70D 4DZJA 1CQTA 5LGNA 2Z99A 2A5WA 2IXSA 2NYXA 4XN3A 1WGXA 3AKZA 3QU6A 2ZXHA 1S9HA 1IF1A 3HOWJ 4EM1A 4F92B 2X6YA 2HYFA 2HFHA 4D0PA 4Y17A 4L5IA 2GQQA 1SD5A 4V2GA 2LY2A 4FTHA 5DM6F 4PFPA 3JR9A 2KT0A 4ZDPA 2W25A 2HZTA 4AD9A 4KFCA 4DZPA 1SFKA 1BI1A 5DUIA 2W48A 2EZKA 4NC7A 5TGTA 1IRFA 3BCAA 2WB1N 1WJAA 4MNUA 4LGWA 1U6GA 4KITB 3DLLF 1JJ6C 3MWMA 1FIAA 1ZKGA 5LRRA 2RC4A 2IGMA 1UHWA 4WWCA 4E7HA 1IGNA 3I59A 1ZYRF 2IA1A 1W36D 3CLQA 2P5KA 4HPQA 3KP5A 5IP7J 2RDPA 2W4SA 2P6SA 4MGRA 3K4BA 1KA8A 2FJ1A 2L4MA 2W57A 2NS8A 1EJ9A 4OIOF 4ZYGA 2HGCA 5H6QA 1TNTA 5LBQA 3O6BB 3L2UA 5IP6A 2E5ZA 1BJAA 2VL8A 3KZIC 1FSHA 5IPAA 2XAFA 3C2HA 3GVAA 2LP0A 5DCMB 3F21A 5TRDA 2O8KA 2EA4A 1PUFA 2NRAC 3S2WA 2AHQA 4IHVA 4LIUA 2MW8A 1TWHJ 3J7AY 5J1UA 2K9SA 4WK8F 2M7AA 5M5YJ 4XOTA 3GUDA 3HC7A 3KYCB 3I3LA 3E3VA 2ZCWA 1VZ0A 4FHTA 3TDUC 3FM3A 1GUUA 3DKWA 3DF8A 1V4RA 3MKWB 2XC7A 3P9KA 1YYVA 3DV8A 3HKZA 1OFCX 3R4KA 1W36C 2CG4A 2R7DA 1ZR2A 2FNPA 4AWXB 4B47A 4EQQA 1W4MA 2BHYA 3ZQLA 2V1XA 2ZJRF 5TISC 2JA7J 4D9JA 5BOXA 2IA0A 4LK1F 2R5ZB 1PDNC 2BHZA 4LG3A 2EIJH 4M72A 5ICFA 3BDDA 4GGGA 5L3BA 4O3MA 1O3TA 4ZTFA 4OOIA 2QBYA 3G2BA 1C0WA 2VXDA 3AG1H 4TV7A 3CCEI 1SMTA 2XF6A 5ERIA 1R4NB 3SDBA 2M87A 2DT7B 1N78A 4RMNA 5FKOA 2QQ8A 2PBIA 1FYMA 4UXNA 1V3FA 3GW2A 4HAMA 4ZYAA 1D0XA 1BI0A 3IUOA 3CP2A 4ZH4F 2E1NA 1YS6A 1U2WA 1RKTA 4RGRA 5IOZA 5FO5A 4A0YA 2CW0F 4OAZA 3VYUB 2KPMA 2M4KA 4G6QA 3TMOA 3HG9A 4LLGF 3EUAA 4FASD 5M3MJ 1O3RA 3QODA 4CICA 2P7VB 1CGPA 2LF8A 2FBIA 2PQ8A 3FHZA 4XMYA 4P96A 4X1EA 1OCOH 3TP3A 3CC7I 3M4OJ 4FE7A 3WTYC 2DFIA 2HS5A 3MQ0A 2J5OA 4BE0A 1I50J 3WTTC 1F43A 1K4SA 2DFHA 3CF2A 1Z1DA 5KVRA 3OYNA 3OYFA 1ZG1A 2HDDA 4IHWA 4B4CA 1LEAA 2KQRA 4A6DA 1XTAA 4NC6A 2NVYJ 3DFGA 4XBFA 3CO7C 2ZFWA 3WTSC 3BT9A 3CC2I 3RKWA 4KIGA 2MYSA 1NK3P 4D5CA 3PSFA 2CUJA 3OSFA 3OS2A 3CJTB 1PP8F 3JAMK 2QF7A 3WG9A 2VBWA 3GWZA 4RB2C 2EWNA 2DTZA 2VKHA 2CV2A 3I4MJ 1YE9A 1P6RA 4IKFA 3FXMA 1ON1A 2K3PA 5H6RA 2LVSA 1O3QA 3D5RC 2MH2A 1G2HA 3LA3A 2OCEA 3RI4A 3EDPA 1R58A 2HWVA 4CYCB 5ICEA 4CGZA 3H3VK 4ESJA 5HNFA 3F8MA 5BMZA 2M3AA 4GDFA 3HM5A 1Q1VA 1YJWI 2DFEA 2IEKA 3S3NA 4E7JA 4LOCA 1YQAA 1W1WE 1X2MA 4I76A 1WFXA 1B9NA 4CDGA 1HW5A 3CMEI 3A01B 4ZTJA 1G3WA 2Z16A 1X1BA 2VKDA 3C7JA 1JE8A 1IV8A 2Z2SB 1H0MA 1EKEA 4MQ9F 3KYDB 4JOMA 3HL2A 4WXDA 1ZR4A 4AYBN 1BOAA 1RRJA 4G6DA 5F1JA 3JAMZ 3L2VA 1MBKA 2DT5A 3M3YJ 1HKQA 1I3AA 1J2XA 2K27A 2FOWA 3RQ4A 3RIRA 2QUFA 1YJNI 3HOUJ 4PZJA 4C3JJ 2NNNA 1H8AC 1QNTA 1XGNA 3ASOH 2O5RA 2EFWA 1TT5B 5FFZA 3JRHA 3I9V2 2E34A 3ISPA 3ECHA 3U21A 1D1AA 2N8GA 4A2UA 3LSPA 2ZO4A 2RNGA 3DPLC 1T0FA 4ZJZA 2CQNA 4L5EA 1LE8B 3H35A 3ZMTA 2OD5A 1TWGJ 3ZMSA 1K4TA 4U88A 1LNWA 1JUPA 2ISYA 3GFMA 2IS4A 2FQ4A 3KP7A 3JRGA 1IO2A 3S15J 3TOBA 3IP4B 4Q4ZF 1UG2A 4UUVA 5J1YA 3PO3J 5J47A 5CVUA 2X4HA 2HQRA 2IVMA 1FT9A 4R1HA 1ZQ3P 3JTHA 2VOPA 2XF7A 4A3CJ 2W84A 4P9UA 3LOCA 1MNMC 4IVNA 4XLNF 3ZRGA 4KIBA 5AIPA 1G59A 4BDYA 2EJRA 4AU7A 5FRNA 2FQ3A 1W7PB 2XB0X 4XL9A 2RQQA 5IP9J 1E3HA 3P9CA 4RDUA 2QBYB 5FLXZ 4HZFA 3SEZA 4FT8A 3M8EA 1X1PA 3BROA 2DA5A 2X1CA 4F91B 1ACIA 2X85A 1IXRC 4AVPA 4HDVA 4X6AJ 3S14J 1V5FA 3L7WA 4KN4X 3FKIJ 2MLKA 1ZGWA 5CQEA 2R92J 5IOYA 2I5UA 3K6GA 2R5YB 3CMMA 1VQ8I 3HYIA 2DN0A 3LFKA 4AC0A 1ZG5A 1FEXA 4KJZA 2DLLA 3BG7A 4RGSA 3E5XA 3AG4H 4BJ6C 3CF5F 4LJZF 2R3SA 3E6BA 2H94A 2V26A 4G9YA 5FD5A 1WPKA 3OOUA 3BZKA 1EF4A 4XKCA 3KEQA 2KISA 3KLNA 5FLXK 3DU5A 3LNQA 3L00A 3PM1A 5GAEJ 1PUFB 4XIDA 3F8FA 1Z0XA 1IUFA 2VKEA 4PJ0C 2JUCA 1BM9A 1RC9A 2P0WA 1B9MA 3TL4X 3CCVI 1HDDC 1TWAJ 2CJJA 2KDZA 4UNOA 3BJ6A 3I4NJ 3EUKL 2FA5A 2VONA 2QLZA 4YFKF 4JP0A 3UNGC 4Q48A 3R60A 2R7QA 2OPTA 3HSRA 4BE2A 3C1DA 5F0HA 1XSXA 4D5FA 5LGTA 3TQNA 5LHIA 3I59B 1J7KA 3HPHA 4UVAA 2FUG2 2HZDA 3KFWX 4BS9A 3IKVA 2E1OA 3K0LA 3L2RA 3WGHA 5AIQA 2F4OB 4YRVA 4Y13A 2PJPA 2EZIA 3ZQHA 1QHGA 4FETA 4A12A 3FF5A 5DCFA 2AQFA 3AG3H 5HDNA 2DAOA 4BEHA 4GYGA 4HBLA 3CUQA 2XUBA 2LH9A 3FXJA 2VQHA 5GTIC 5E3MA 2LR8A 3ASNH 5CKTA 1PUEE 4C2UA 2DU9A 2QM3A 4IHYA 4QWQA 2XKOA 3DP7A 1T95A 2Z3YA 2LOOA 2G7HA 3CESA 4L9VA 3EUHC 2O9LA 2X1EA 5LD2C 2GBYA 2EFQA 2ZMEB 1XMKA 2L7KA 1DP7P 2LSOA 3EYIA 1KYWA 2XGXA 1J5YA 2M2EA 2M30A 3F8NA 2EZLA 3QYBA 4FCYA 1XD7A 3ZN0A 1BR2A 4F3QA 4A3BJ 4HA8A 3Q9SA 2GWRA 2PMUA 2QEXI 1U9OA 4KIFA 2R4GA 3S1MJ 4BL0B 2ZSIB 2CFXA 5K7FA 2Q8KA 1A31A 2NOJB 2F4IA 2D2WA 2MG4A 3NWTA 4IPAA 2YU3A 4HV5A 1JGGA 4IRHA 3FMRA 2HXIA 2L9SA 3RKQA 3MD2A 5KAFC 1YFHA 4LLLA 2IGNA 2Y9ZA 3OS1A 3G71I 1IUYA 2GOMA 1MSEC 3B6CA 1T56A 4O5VA 4M9SA 2ZXJA 3H3UA 5D5VB 3OYLA 5GAHJ 4AM3A 2XPWA 3DEEA 2PG4A 2VE9A 4EJOA 2M8GX 3BZ6A 1LDDA 3J7AO 2W7NA 3DCFA 3CDLA 3VFZA 2DXIA 3V8KA 1QO0D 2NS7A 4QLCU 3IC7A 5A2QK 3AL0B 3BG9A 3H36A 2DDAA 1TQMA 2CW8A 2P81A 4KUMA 1HBXG 2M7BA 3LA2A 5DD4A 1NTCA 2QYOA 4M3EA 3I55I 2UXNA 1QQIA 2P8TA 1SVMA 2QENA 1R1VA 2UUZA 3N4MA 4E6KG 4I7HA 1N77A 5K7ZA 3ABMH 3MN2A 2GXAA 2DBBA 3ZQFA 3LSRA 3COAC 1LVKA 4J00A 2OF7A 3LSMA 1J75A 2A3SA 1IDZA 3FK6A 1Z9CA 2R7ZJ 4UUSB 1FBQA 3OMYA 4XSZF 3S2DJ 3P9IA 1MMSA 2XAJA 4EEFG 1D5YA 3QU3A 1GV5A 3C18A 2GA2A 4NDLA 3RQIA 3JRCA 2VQLA 2LBFB 3V7SA 2XAQA 4NB5A 3BG3A 5K5OA 2GZWA 1X4OA 2DMQA 4KICA 2ID6A 4M6YA 2PX9A 2W82A 5A2QZ 3OS0A 4I6ZA 2UWMA 2ZB9A 3OIPA 3C3WA 1JKPC 3PQKA 4QPOA 3HGYA 4PJLA 1QBJA 3B73A 1OQYA 1E0EA 4PDKA 2LNBA 2H6CA 1S3JA 3JSOA 2IA2A 4C2TA 1T98A 2IW5A 2W1OA 1Z7LA 4C30A 2KFDA 4RGUA 2DA7A 1RIOH 2WV1A 1ITYA 1FY7A 1VI0A 3IH3A 2X9DA 4LMYA 2V9PA 3MFKA 4ZYHA 4ZDLA 2X0LA 3HGGA 5HVQC 3M07A 1TLHB 2WTEA 3CUQB 1UG0A 2K9MA 1RKWA 3CCLI 1U0JA 1UMQA 1LUJB 1LKXA 3IV5A 2NVQJ 4EV0A 3K4KA 2DJNA 3TO6A 3K1MA 5BPIA 4ZZLA 3F8CA 1K79A 3SXYA 1NK2P 1BW6A 1RNLA 3GTLJ 2FMLA 1X3ZB 3I54A 3ZN1A 4HLXA 4M9ZA 5JI6A 3NEUA 4D7NA 2FBHA 4KT5C 3GLXA 1TNSA 3J80K 3FMSA 3LSJA 2XKPA 3CUQC 5F1RA 1MD0A 5FKLA 4QPQA 3BG5A 4GRIA 4XRMA 4CCNA 3A02A 3BJAA 2GLOA 2HOSA 2XSJC 4HF2A 5D8LB 2L9VA 2F5VA 3ZCOA 5ILUA 2O6GE 2DA6A 3OYMA 2ELKA 1U5TB 3HOSA 1GXPA 2EFPA 3IWZA 2MLGA 1YRNB 3FXLA 1MNDA 2NAZA 3VYTB 4P1WA 5J8FA 1LFPA 3S1NJ 2EPFA 2XB5A 3OSGA 2VODA 1IN5A 3CUOA 3UKGA 1UCRA 1TTYA 4JYKA 3L9FA 1OPCA 2EV5A 2VJ5A 2ME0A 2R5YA 3CD6I 2XV4S 1MZBA 1DPUA 4OU0A 2HPMA 3ZP5A 2ID3A 3A03A 3GFJA 3A0BC 3GO5A 3ZMUA 4KYWA 2ESHA 1ZLKA 4Q5SF 2VBZA 2E7WA 3IRRA 1JT6A 4NHJA 1JXSA 1BI3A 1HSTA 5KNLA 3BG6A 3W6VA 2XAGA 1ETYA 3JTGA 2YU9J 3BR5A 4EJUA 3DEWA 2EV0A 4IF4A 5FJ8J 3CJQB 3I64A 1XG1A 2V79A 3E6MA 1G6NA 1HSJA 3RPUA 2STTA 1SAUA 1FPQA 2L4AA 2LTPA 4HV6A 4Z6YA 4ZZDA 3HRSA 2GAUA 4FE4A 1ZRFA 1IJWC 1D0YA 1EH6A 2E1MC 5F64A 2JA5J 1BR1A 3OOPA 4BJ5C 3JRIA 5BNGA 3QPLA 1MDMA 2DTRA 1OCTC 4ENNA 1V54H 3CCUI 2O0YA 3GX4X 2QCOA 3H5NA 3ABTA 3BR3A 1OCCH 1LE8A 2CQQA 2Y31A 4YIFA 2LK2A 1AA7A 1MJAA 2FF4A 1K78B 2WAQA 1A6QA 2UXXA 2HYJA 4WF2A 2DO7A 4RM3A 1JI8A 5IYDJ 3I53A 3EQLF 2OU2A 3LL7A 1OISA 3D1NI 4HQMA 3KE2A 2ZJPF 4XKWA 1YW8A 2QGUA 2DPDA 2QZ8A 1FMWA 2K4BA 4PFOA 1B72A 1GXQA 5C4XJ 2ZKZA 3BR2A 3GZNB 3F0CA 2HQ5A 2KHMA 2QQAA 3JRBA 3KP6A 5B3SH 4XLAA 2RV8A 1MDMB 4E7LA 4BBRJ 2GIZA 5B1BH 3N05A 2HI3A 5DM7F 3FHNA 3HHHA 2J5PA 1XDUA 3GTJJ 3BTCA 2G7UA 2M9HA 3DWLE 3DEUA 4P55A 3GYHX 3LQQA 2JT1A 2IRFG 1XC5A 1Y56A 1YO5C 2KP6A 2VIXA 1W5SA 4ZYEA 4RB1A 1UZCA 1G3TA 2KRFA 3DKYA 5FKKA 5J1RA 5E79C 1X1DA 3S17J 3FIWA 4UV9A 3CCJI 1XS9A 4XM3A 2BVMA 3GCMA 1FIPA 1VQMI 1IRZA 3SDGA 2R93J 4N4NB 2NVUB 3WU1B 5HDKA 4PK4A 4PUSA 2WWYA 3VODA 2KRHA 1ZRDA 4OIRF 2R7UA 1Y1WJ 2LC2A 1RR7A 3ERMA 1HKSA 4YELA 4RGXA 1WH5A 2RREA 2DMPA 5E3LA 3MVPA 3WODF 1YRNA 2KZVA 2MGQA 3SHFA 2XROA 1GVDA 3R0AA 1U5TA 4ETSA 2WY8Q 2F5CA 2V4JC 4ENMA 4BNCA 5M3FJ 5B66C 2MBFA 1W5TA 4XNFA 3K4MA 1X19A 2KZGA 1CF7A 3T8RA 4N9HA 4E4HA 2HDCA 1X1AA 2CYYA 3L2WA 1W5CC 4ABZA 1WI3A 3U9GA 3WTWC 2XRNA 2AXLA 1MH4A 1O7LA 4IOCF 1YI2I 5GPAA 1HQCA 2UV1A 4HX8A 1FBSA 1YOVB 2EQRA 2Y0MA 3H5RA 4NC8A 3QRFF 1I5ZA 5L3GA 5HOOA 3VSLA 2BY1A 5GP9A 5JVTA 2F5DA 2FE3A 3PO2J 1FOYA 2G0EA 1FOWA 1VQPI 2DMTA 4F93B 1SC7A 1K6YA 1OYIA 4MFDA 4KISA 4IXAA 3CDHA 5F27A 2B7EA 1BBYA 3H9GA 2P4WA 1Z77A 2JK3A 5HDGA 1OMIA 4YIRX 3RPUD 1J0RA 4RAZA 2CSOA 3S3OA 2MC4A 3WTUC 2VJ4A 1WZ2A 1R1UA 4II3A 4JX6A 1YLFA 2DFFA 1P2FA 3AFHA 1O57A 5LEJA 5ILSA 3C2BA 2LKXA 3PNYA 4IHXA 3F23A 1QA6A 4BGDA 1W0UA 3JREA 3L2CA 2WY7Q 1KZHA 1I6XA 3FXKA 2CMPA 2XPVA 2CQKA 4H0EA 2KDOA 2O3FA 5EG0B 4Y15A 2CUZA 3D5LA 5GAGJ 1K61A 2H1KA 5FKNA 3GFLA 1B8IB 4XKBA 4I0AA 2P7CB 1WCMJ 3B02A 3VSKA 1T39A 3PQJA 3H3ZA 4B09A 1JTYA 2HYGD 2X6WA 3FX3A 4ESFA 2ZJ2A 4WCGA 1XGSA 4DYQA 3K9TA 4UUSA 4CSWA 1KQ8A 4LB5A 4UVBA 2JMWA 3HSFA 3M9AA 1AWCA 3OIQA 1A35A 2GA1A 6PAXA 3HZJA 5DCMA 4A5MA 1F9NA 2OJED 5KK1A 1ZGAA 5FFXA 1S7AA 2V9KA 3K69A 1USSA 2DYRH 3VDXA 5E17F 3FBIB 4V2FA 3GZ5A 1BL0A 3DTEA 3MZ8A 2L9NA 4IQ4A 2K7LA 3TOAA 2HVSA 1WJFA 1TP4A 3BZCA 1VFCA 2XPUA 2ZNYA 2GM4A 3K4NA 3CCYA 2WC2A 4PJMA 1BN5A 3DPUA 4DYRA 4HNTA 2A6EF 3FXQA 4E7SA 5E20A 3I0TA 2YR2A 2LY9A 3CC4I 4BH9A 2TRTA 2V6CA 3RPQA 4XKVA 2E1CA 1SD4A 1D1BA 3GXOA 3IHUA 1J9IA 1FYKA 2GXBA 2K3FA 4U0WA 4HYEA 4GFBA 5IT9Z 1L3LA 2JSCA 3KYLA 5E8IA 4DGWB 3S2HJ 1QHHD 3REOA 3F3XA 2AO9A 5E1WA 5HNHA 2K40A 1OR7C 4BQAA 2VASA 4CH7A 3O8GA 5LRSA 4XR6A 1XSDA 4MEYF 1YW9A 3PL8A 4Y7NJ 4JBAA 4DOZA 3L1PA 3QOEA 4YFNF 4PGGA 1FOKA 3H1CA 1KONA 1FOXA 4LK0F 3RYPA 4RM2A 5FD6A 4AIJA 3HSEA 4ASNA 1IAWA 2H8RA 2FBKA 2R7OA 5FB2A 2IAIA 3IL2A 4BXXJ 4L0ZB 2ECCA 4E7ZA 1IZ1A 4CCLA 2RN7A 1Z91A 2JRMA 5H2FC 5ICGA 1MMNA 2M8EA 3QOPA 3V8JA 2OTLI 3A1YA 4F7ZA 4L9TA 3V4GA 2H1LA 4EVIA 2IGOA 4P5OA 1U3EM 3GTKJ 3J81K 3VOEA 3J7ZI 1Z7UA 2C6YA 2Q2EA 5CPRB 1JUMA 4ANJA 3F8BA 3OYDA 2BXYA 2NNYA 1IRXA 4XLFA 1SAXA 2ZMEA 3ZOBA 2I8DA 2LREA 2QSHX 1TWCJ 3L09A 4AIDA 3V7CA 2X51A 1VQ5I 3IH4A 5E1XA 2JA6J 1LB2A 4B43A 1QU3A 1Y8QB 2V6EA 3G1OA 1T08B 3G1LA 2DA1A 3MCZA 4M3DA 5HLIA 3T1BA 4L5JA 4MFEA 4HQEA 3BJOA 1QGPA 1OLTA 2PFBA 1ZARA 3JCUC 3BLYA 1IC8A 2W00A 3F72A 3CCRI 1EV7A 2M0MA 2YX4A 1FP1D 1R23A 1Z67A 3D5SC 3K2ZA 4D1QA 1Y39A 1PVEA 2WAQN 3D0SA 4LD5A 3NRVA 2EA2A 2MSYA 1DP3A 2DK8A 3RCOA 4U7DA 3TW6A 3J81Z 2BYVE 5HS8A 4M6VA 4ON0A 4A0ZA 3BR0A 1NHAA 4CUGA 2XGEA 1I27A 2A05A 1XGOA 3BP8A 5L3CA 3I58A 3ZQ7A 1Z6TA 4BHBA 5DEQA 2XRLA 4DNCA 2W85A 2HTJA 4HSRA 1E17A 2FRHA 2WAEA 4LG0B 2IS6A 1MNEA 5LLQA 2WADA 2VQGA 1AHDP 4IHSA 3BR1A 3S3MA 2R7FA 5EEGA 5C4JJ 4G12A 1F36A 2X48A 2Y0SA 3HUGA 1X58A 3LMMA 2JJ7A 3TBIA 1LQ1A 3R61A 4W1UA 3O3KA 1XCVA 5GPCA 3U2RA 1TL8A 4M74A 1ZH5A 3S93A 3ERED 2Y69H 3BQYA 4CO8A 3WTVC 2ME6A 2Y2ZA 1WQ2A 2NOGA 3WTZA 2E35A 1B8IA 2FD5A 5HS7A 4M6XA 4EJWA 2HOEA 3IKTA 1BC8C 1SD6A 2EV6A 3E7LA 3PIOF 3ELKA 1WWXA 3P5JA 4FISA 2OZ6A 4FX4A 2FX0A 1XSVA 5LFAA 3IAS2 1KU9A 1UHMA 2GOXB 3VYRB 1FNNA 3GTPJ 3I5UA 1DU0A 3LSGA 1R9TJ 2OCCH 3W2WA 3KIOA 3HDDA 3CMYA 1KU3A 2PEXA 1T2KA 2BBYA 1SD7A 1ETWA 1D8KA 1YG2A 4MQVA 5GADJ 1BC7C 3HOYJ 1A36A 4EATA 4DW6A 2YS9A 1DPRA 1BIBA 1R22A 2ZFUA 1WJ5A 1PJRA 2EIKH 2KKOA 2E60A 2XSDC 1UAAA 4HNUA 4C3IJ 5HLHA 5AONA 4EMSA 4BDZA 1WRJA 5GTHC 4G7ZF 3CP8A 4EM0B 3U1KA 5KCMA 2VT2A 1N25A 5DS9A 1JHHA 3DQVC 1XCBA 4PCQA 5FROA 3BPXA 4XRSA 4MEXF 3NQOA 5LGUA 5J4VA 4J19A 2XGCA 2PJRB 3BR6A 1HW2A 4HLYA 2FMYA 3DTIA 2LRDA 3Q0UA 2DI3A 4BY1J 1SMYF 2BW3B 3KEYA 1YIOA 3OL3A 4F55A 2FXAA 1GHCA 4KT6A 3F22A 2VI6A 4PGHA 1K83J 3WGIA 2WBMA 1CF7B 1FJLA 1I1GA 2DOFA 3E6DA 2K02A 4GCVA 2EILH 1IN4A 2AQEA 4RB0A 1RI7A 4A3KJ 3F9KA 3X2QH 2XHKA 1X1CA 4GXOA 2A07F 2P6TA 2BY0A 1MIJA 3JRDA 2K86A 4E7KA 2L7ZA
chains in the Genus database with same CATH topology
2NVYJ 2JA5J 1GDTA 2E2HJ 3BT9A 3JRIA 5BNGA 1U78A 4D5CA 3QPLA 1NK3P 1TC3C 3OSFA 2E19A 1OCTC 2VKVA 1GT0C 2QF7A 3BQZA 2DA4A 2QCOA 1B72B 2DTZA 2X6OA 3I4MJ 3GTMJ 3BR3A 1LE8A 2CQQA 2Y31A 2LK2A 4RBOA 1FTTA 1ETQA 2E2JJ 2LVSA 2VPRA 1G2HA 3SFIA 1I3QJ 4CYCB 2HYJA 2LD5A 1UHSA 3H3VK 3GTOJ 5JLWA 2EZHA 5IYDJ 1WH7A 3HM5A 1Q1VA 1HOMA 1QRYA 1BW5A 2B63J 3MKLA 2IEKA 4IEJA 4LOCA 4CYCA 3D1NI 3GBGA 3FISA 1X2MA 4I76A 3HOXJ 3QPSA 1IV6A 3RZDJ 1AKHB 4JX4A 1W0TA 3A01B 1B72A 5C4XJ 2R0QC 3BR2A 3VPRA 3F0CA 2HQ5A 1X2NA 3JRBA 1IDYA 1ZR4A 4AYBN 4BBSJ 2JA8J 4BKXA 5F1JA 4BBRJ 1MBKA 2HI3A 3M3YJ 2JWTA 2YUSA 3GTJJ 3A01A 1AKHA 3HOUJ 4C3JJ 3BTCA 3NARA 2M9HA 1H8AC 4Y52J 3BTIA 2Y0SN 1XC5A 1QVUA 2M34A 1APLC 3JRHA 4BY7J 3QQAA 5J1RA 5FKKA 3LSPA 2N8GA 2DA2A 3S17J 3FIWA 1ETKA 3SJMA 1XS9A 1ENHA 3G1MA 1HDPA 4L5EA 1LE8B 1FIPA 1TWGJ 1IRZA 3SDGA 4D7MA 2ECBA 3WHBA 2R93J 5E3NA 1JUPA 2DMNA 2FQ4A 3JRGA 3S15J 4XK4A 3PO3J 1UG2A 5J1YA 4A3DJ 5FLMJ 4M3GA 4QSHA 1ZQ3P 1Y1WJ 1RR7A 2PMZN 2DA3A 4A3CJ 1WH5A 3LOCA 1MNMC 2DMPA 5E3LA 3MVPA 1VNDA 1YRNA 3O8HA 1I6HJ 2MGQA 4AUXA 1QPIA 1GVDA 2LLKA 3RZOJ 2XB0X 1JTXA 3JRFA 2I10A 5IP9J 1O4XA 5EF6A 4RDUA 2K9NA 5M3FJ 9ANTA 2IBDA 2EH3A 2L7FP 3Q0WA 2DA5A 4X6AJ 3S14J 4ABZA 4A3GJ 3FKIJ 1ZGWA 1WI3A 4A3JJ 4A3MJ 2R92J 5IOYA 2R5YB 1MH4A 5GPAA 2DN0A 3Q0VA 2EQRA 5EGOA 4AC0A 1FEXA 2CUFA 5EYRA 5GP9A 3K2AA 3PO2J 1ZTRA 2G0EA 2M0CA 5DTDA 2CUEA 1ETVA 2DMTA 2LFBA 4MFDA 1WPKA 3OOUA 3TW7A 5F27A 3NAUA 4DYCA 1SFOJ 1EF4A 1Z77A 2JK3A 4MLOA 4HNVA 2Y9YA 3LNQA 1ZK8A 4MO7A 3PM1A 1PUFB 1POGA 4XIDA 4A3FJ 1Z0XA 1IUFA 2VKEA 4JX6A 4M3BA 2R5ZA 1HDDC 2LKXA 3C2BA 1TWAJ 2CJJA 1BJZA 2KDZA 3B6AA 1H88C 1MBJA 5IYBJ 1W0UA 4IHXA 3I4NJ 3JREA 1JUSA 2O7OA 4JP0A 4XICA 1JT0A 1RESA 5IYCJ 2VUMJ 2XPVA 2CQXA 1JKQC 2OPTA 5EG0B 3ZQGA 1K61A 4M3FA 5F0HA 2H1KA 5FKNA 4D5FA 5E3OA 1B8IB 5C44J 5HODA 1WCMJ 2E1OA 4QTRA 2NVXJ 2EZIA 3ZQHA 1JTYA 4A3EJ 2CRGA 4A93J 1H89C 2D5VA 4DYQA 4UUSA 1E3OC 5E3MA 2LR8A 4IHYA 2JMWA 1JKRC 1TWFJ 2HXOA 1S7EA 2O9LA 1MBEA 1MSFC 4A69C 2GBYA 5M5XJ 3HKZN 1OCPA 3WHCA 4V2FA 1BL0A 2M2EA 4MIMA 1A6IA 2EZLA 3H0GJ 4FCYA 1LFBA 2XPUA 1VFCA 2GM4A 5F0FA 3CCYA 4A3BJ 1DU6A 5EDNA 5J3LA 4B3AA 4DYRA 1U9OA 3S1MJ 2K9QA 5JLXA 2LY9A 2TRTA 5K7FA 4C3HJ 4S0HB 2MG4A 1HCRA 2EBIA 1ETOA 1JGGA 2CU7A 2HXIA 2E2IJ 4GFBA 3HBLA 3RKQA 3S2HJ 4B1RA 2Y9ZA 2AO9A 2K40A 5M5WJ 1RETA 1MBHA 3O8GA 1MSEC 3S1RJ 3B6CA 5F08A 1T56A 3ZQCA 3IH2A 4Y7NJ 1MH3A 3L1PA 2XPWA 4XRSG 2COBA 4QIWN 2M8GX 2H8RA 1ETXA 2IAIA 2L9RA 3TP0A 4BXXJ 2ECCA 3BTLA 3DCFA 3CDLA 1MBGA 4W97A 4UUTA 3OIOA 2NS7A 3BG9A 3K7AJ 1U8BA 2P81A 3GTKJ 1NTCA 1JUMA 4M3EA 4A3IJ 3CQZJ 5FLVA 1BA5A 3ZOBA 4DZJA 1TWCJ 1CQTA 5K7ZA 3MN2A 1WGXA 3IH4A 3ZQFA 3LSRA 1HLVA 2JA6J 2OF7A 3HOWJ 1IDZA 3G1OA 4M3DA 3G1LA 2DA1A 1OJLA 3FK6A 2HOTA 2R7ZJ 4UUSB 4MFEA 4V2GA 4FTHA 4C2MJ 3JR9A 2KT0A 3S2DJ 4EEFG 1D5YA 1GV5A 1JKOC 4DZPA 3RQIA 4NDLA 2W48A 2EZKA 3JRCA 1IC8A 3HOVJ 1HF0A 2WB1N 3BG3A 1JJ6C 2DMQA 1FIAA 2DMUA 1ZKGA 1SANA 2WAQN 1FTZA 2ID6A 4I6ZA 1IGNA 2MSYA 4JX5A 2ZB9A 1JKPC 3TW6A 5IP7J 3GTQJ 3HGYA 5EG0A 4M6VA 2FJ1A 1LFUP 2NS8A 3BR0A 5F0CA 2XGEA 2TCTA 5IP6A 2DA7A 5IPAA 1T33A 2WV1A 1ITYA 2LP0A 2O8KA 2XRLA 1VI0A 3IH3A 2Y30A 2X9DA 5K7HA 1PUFA 2AHQA 4IHVA 1AHDP 2MW8A 1TWHJ 3BR1A 3HGGA 5J1UA 1ORKA 2K9SA 5C4JJ 4G12A 5M5YJ 1F36A 1MBFA 2X48A 1X58A 2JJ7A 3BTJA 1RKWA 4W1UA 5EZGA 1UMQA 5GPCA 3JRAA 2NVQJ 3IV5A 1GUUA 1JJ8C 3HB9A 3BQYA 2DJNA 2XGDA 2ME6A 2Y2ZA 2NOGA 3S16J 2HOAA 1NK2P 3HEFA 1BW6A 1B8IA 2FD5A 3GTLJ 1OFCX 1U9NA 4D7NA 5EGOB 3E7LA 3LSJA 1ZR2A 4FISA 3ZQLA 2FX0A 2JA7J 3GTPJ 5FKLA 3HOZJ 3BG5A 1DU0A 3LSGA 4XRMA 2R5ZB 1R9TJ 1P7IA 3A02A 2GLOA 2HOSA 3HDDA 5C3EJ 3CMYA 5EEAA 1ETWA 2L7MP 2DA6A 4A3LJ 2ELKA 3HOYJ 5FKMA 5F04A 3GTGJ 1VF9A 4DW6A 2YS9A 1YRNB 2XSDC 1AU7A 1IG7A 5FKOA 3S1NJ 4C3IJ 2XB5A 1GV2A 3OSGA 1RPWA 1QVTA 5DS9A 3UKGA 4XRSA 4JYKA 4J19A 2XGCA 1RKTA 3BR6A 2ME0A 5IOZA 2R5YA 3Q0UA 2L0KA 3ZQIA 1Y1VJ 4BY1J 5EZHA 2ID3A 3A03A 3Q3SA 1P7JA 5M3MJ 2VI6A 4FE4A 3TEDA 2JN6A 1K83J 1JT6A 1FJLA 4X1EA 3W6VA 1ETYA 3TP3A 3BR5A 2YU9J 3M4OJ 3DEWA 4FE7A 4A3KJ 2RAEA 5FJ8J 1XG1A 2NVTJ 3S1QJ 1I50J 1F43A 2LTPA 1A5JA 2HDDA 4IHWA 3JRDA 4B4CA 2L7ZA 3FK7A 1IJWC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2NVY J;  2JA5 J;  1GDT A;  2E2H J;  3BT9 A;  3JRI A;  5BNG A;  1U78 A;  4D5C A;  3QPL A;  1NK3 P;  1TC3 C;  3OSF A;  2E19 A;  1OCT C;  2VKV A;  1GT0 C;  2QF7 A;  3BQZ A;  2DA4 A;  2QCO A;  1B72 B;  2DTZ A;  2X6O A;  3I4M J;  3GTM J;  3BR3 A;  1LE8 A;  2CQQ A;  2Y31 A;  2LK2 A;  4RBO A;  1FTT A;  1ETQ A;  2E2J J;  2LVS A;  2VPR A;  1G2H A;  3SFI A;  1I3Q J;  4CYC B;  2HYJ A;  2LD5 A;  1UHS A;  3H3V K;  3GTO J;  5JLW A;  2EZH A;  5IYD J;  1WH7 A;  3HM5 A;  1Q1V A;  1HOM A;  1QRY A;  1BW5 A;  2B63 J;  3MKL A;  2IEK A;  4IEJ A;  4LOC A;  4CYC A;  3D1N I;  3GBG A;  3FIS A;  1X2M A;  4I76 A;  3HOX J;  3QPS A;  1IV6 A;  3RZD J;  1AKH B;  4JX4 A;  1W0T A;  3A01 B;  1B72 A;  5C4X J;  2R0Q C;  3BR2 A;  3VPR A;  3F0C A;  2HQ5 A;  1X2N A;  3JRB A;  1IDY A;  1ZR4 A;  4AYB N;  4BBS J;  2JA8 J;  4BKX A;  5F1J A;  4BBR J;  1MBK A;  2HI3 A;  3M3Y J;  2JWT A;  2YUS A;  3GTJ J;  3A01 A;  1AKH A;  3HOU J;  4C3J J;  3BTC A;  3NAR A;  2M9H A;  1H8A C;  4Y52 J;  3BTI A;  2Y0S N;  1XC5 A;  1QVU A;  2M34 A;  1APL C;  3JRH A;  4BY7 J;  3QQA A;  5J1R A;  5FKK A;  3LSP A;  2N8G A;  2DA2 A;  3S17 J;  3FIW A;  1ETK A;  3SJM A;  1XS9 A;  1ENH A;  3G1M A;  1HDP A;  4L5E A;  1LE8 B;  1FIP A;  1TWG J;  1IRZ A;  3SDG A;  4D7M A;  2ECB A;  3WHB A;  2R93 J;  5E3N A;  1JUP A;  2DMN A;  2FQ4 A;  3JRG A;  3S15 J;  4XK4 A;  3PO3 J;  1UG2 A;  5J1Y A;  4A3D J;  5FLM J;  4M3G A;  4QSH A;  1ZQ3 P;  1Y1W J;  1RR7 A;  2PMZ N;  2DA3 A;  4A3C J;  1WH5 A;  3LOC A;  1MNM C;  2DMP A;  5E3L A;  3MVP A;  1VND A;  1YRN A;  3O8H A;  1I6H J;  2MGQ A;  4AUX A;  1QPI A;  1GVD A;  2LLK A;  3RZO J;  2XB0 X;  1JTX A;  3JRF A;  2I10 A;  5IP9 J;  1O4X A;  5EF6 A;  4RDU A;  2K9N A;  5M3F J;  9ANT A;  2IBD A;  2EH3 A;  2L7F P;  3Q0W A;  2DA5 A;  4X6A J;  3S14 J;  4ABZ A;  4A3G J;  3FKI J;  1ZGW A;  1WI3 A;  4A3J J;  4A3M J;  2R92 J;  5IOY A;  2R5Y B;  1MH4 A;  5GPA A;  2DN0 A;  3Q0V A;  2EQR A;  5EGO A;  4AC0 A;  1FEX A;  2CUF A;  5EYR A;  5GP9 A;  3K2A A;  3PO2 J;  1ZTR A;  2G0E A;  2M0C A;  5DTD A;  2CUE A;  1ETV A;  2DMT A;  2LFB A;  4MFD A;  1WPK A;  3OOU A;  3TW7 A;  5F27 A;  3NAU A;  4DYC A;  1SFO J;  1EF4 A;  1Z77 A;  2JK3 A;  4MLO A;  4HNV A;  2Y9Y A;  3LNQ A;  1ZK8 A;  4MO7 A;  3PM1 A;  1PUF B;  1POG A;  4XID A;  4A3F J;  1Z0X A;  1IUF A;  2VKE A;  4JX6 A;  4M3B A;  2R5Z A;  1HDD C;  2LKX A;  3C2B A;  1TWA J;  2CJJ A;  1BJZ A;  2KDZ A;  3B6A A;  1H88 C;  1MBJ A;  5IYB J;  1W0U A;  4IHX A;  3I4N J;  3JRE A;  1JUS A;  2O7O A;  4JP0 A;  4XIC A;  1JT0 A;  1RES A;  5IYC J;  2VUM J;  2XPV A;  2CQX A;  1JKQ C;  2OPT A;  5EG0 B;  3ZQG A;  1K61 A;  4M3F A;  5F0H A;  2H1K A;  5FKN A;  4D5F A;  5E3O A;  1B8I B;  5C44 J;  5HOD A;  1WCM J;  2E1O A;  4QTR A;  2NVX J;  2EZI A;  3ZQH A;  1JTY A;  4A3E J;  2CRG A;  4A93 J;  1H89 C;  2D5V A;  4DYQ A;  4UUS A;  1E3O C;  5E3M A;  2LR8 A;  4IHY A;  2JMW A;  1JKR C;  1TWF J;  2HXO A;  1S7E A;  2O9L A;  1MBE A;  1MSF C;  4A69 C;  2GBY A;  5M5X J;  3HKZ N;  1OCP A;  3WHC A;  4V2F A;  1BL0 A;  2M2E A;  4MIM A;  1A6I A;  2EZL A;  3H0G J;  4FCY A;  1LFB A;  2XPU A;  1VFC A;  2GM4 A;  5F0F A;  3CCY A;  4A3B J;  1DU6 A;  5EDN A;  5J3L A;  4B3A A;  4DYR A;  1U9O A;  3S1M J;  2K9Q A;  5JLX A;  2LY9 A;  2TRT A;  5K7F A;  4C3H J;  4S0H B;  2MG4 A;  1HCR A;  2EBI A;  1ETO A;  1JGG A;  2CU7 A;  2HXI A;  2E2I J;  4GFB A;  3HBL A;  3RKQ A;  3S2H J;  4B1R A;  2Y9Z A;  2AO9 A;  2K40 A;  5M5W J;  1RET A;  1MBH A;  3O8G A;  1MSE C;  3S1R J;  3B6C A;  5F08 A;  1T56 A;  3ZQC A;  3IH2 A;  4Y7N J;  1MH3 A;  3L1P A;  2XPW A;  4XRS G;  2COB A;  4QIW N;  2M8G X;  2H8R A;  1ETX A;  2IAI A;  2L9R A;  3TP0 A;  4BXX J;  2ECC A;  3BTL A;  3DCF A;  3CDL A;  1MBG A;  4W97 A;  4UUT A;  3OIO A;  2NS7 A;  3BG9 A;  3K7A J;  1U8B A;  2P81 A;  3GTK J;  1NTC A;  1JUM A;  4M3E A;  4A3I J;  3CQZ J;  5FLV A;  1BA5 A;  3ZOB A;  4DZJ A;  1TWC J;  1CQT A;  5K7Z A;  3MN2 A;  1WGX A;  3IH4 A;  3ZQF A;  3LSR A;  1HLV A;  2JA6 J;  2OF7 A;  3HOW J;  1IDZ A;  3G1O A;  4M3D A;  3G1L A;  2DA1 A;  1OJL A;  3FK6 A;  2HOT A;  2R7Z J;  4UUS B;  4MFE A;  4V2G A;  4FTH A;  4C2M J;  3JR9 A;  2KT0 A;  3S2D J;  4EEF G;  1D5Y A;  1GV5 A;  1JKO C;  4DZP A;  3RQI A;  4NDL A;  2W48 A;  2EZK A;  3JRC A;  1IC8 A;  3HOV J;  1HF0 A;  2WB1 N;  3BG3 A;  1JJ6 C;  2DMQ A;  1FIA A;  2DMU A;  1ZKG A;  1SAN A;  2WAQ N;  1FTZ A;  2ID6 A;  4I6Z A;  1IGN A;  2MSY A;  4JX5 A;  2ZB9 A;  1JKP C;  3TW6 A;  5IP7 J;  3GTQ J;  3HGY A;  5EG0 A;  4M6V A;  2FJ1 A;  1LFU P;  2NS8 A;  3BR0 A;  5F0C A;  2XGE A;  2TCT A;  5IP6 A;  2DA7 A;  5IPA A;  1T33 A;  2WV1 A;  1ITY A;  2LP0 A;  2O8K A;  2XRL A;  1VI0 A;  3IH3 A;  2Y30 A;  2X9D A;  5K7H A;  1PUF A;  2AHQ A;  4IHV A;  1AHD P;  2MW8 A;  1TWH J;  3BR1 A;  3HGG A;  5J1U A;  1ORK A;  2K9S A;  5C4J J;  4G12 A;  5M5Y J;  1F36 A;  1MBF A;  2X48 A;  1X58 A;  2JJ7 A;  3BTJ A;  1RKW A;  4W1U A;  5EZG A;  1UMQ A;  5GPC A;  3JRA A;  2NVQ J;  3IV5 A;  1GUU A;  1JJ8 C;  3HB9 A;  3BQY A;  2DJN A;  2XGD A;  2ME6 A;  2Y2Z A;  2NOG A;  3S16 J;  2HOA A;  1NK2 P;  3HEF A;  1BW6 A;  1B8I A;  2FD5 A;  3GTL J;  1OFC X;  1U9N A;  4D7N A;  5EGO B;  3E7L A;  3LSJ A;  1ZR2 A;  4FIS A;  3ZQL A;  2FX0 A;  2JA7 J;  3GTP J;  5FKL A;  3HOZ J;  3BG5 A;  1DU0 A;  3LSG A;  4XRM A;  2R5Z B;  1R9T J;  1P7I A;  3A02 A;  2GLO A;  2HOS A;  3HDD A;  5C3E J;  3CMY A;  5EEA A;  1ETW A;  2L7M P;  2DA6 A;  4A3L J;  2ELK A;  3HOY J;  5FKM A;  5F04 A;  3GTG J;  1VF9 A;  4DW6 A;  2YS9 A;  1YRN B;  2XSD C;  1AU7 A;  1IG7 A;  5FKO A;  3S1N J;  4C3I J;  2XB5 A;  1GV2 A;  3OSG A;  1RPW A;  1QVT A;  5DS9 A;  3UKG A;  4XRS A;  4JYK A;  4J19 A;  2XGC A;  1RKT A;  3BR6 A;  2ME0 A;  5IOZ A;  2R5Y A;  3Q0U A;  2L0K A;  3ZQI A;  1Y1V J;  4BY1 J;  5EZH A;  2ID3 A;  3A03 A;  3Q3S A;  1P7J A;  5M3M J;  2VI6 A;  4FE4 A;  3TED A;  2JN6 A;  1K83 J;  1JT6 A;  1FJL A;  4X1E A;  3W6V A;  1ETY A;  3TP3 A;  3BR5 A;  2YU9 J;  3M4O J;  3DEW A;  4FE7 A;  4A3K J;  2RAE A;  5FJ8 J;  1XG1 A;  2NVT J;  3S1Q J;  1I50 J;  1F43 A;  2LTP A;  1A5J A;  2HDD A;  4IHW A;  3JRD A;  4B4C A;  2L7Z A;  3FK7 A;  1IJW C; 
#chains in the Genus database with same CATH topology
 1X4P A;  4FQG A;  2IPQ X;  1GDT A;  1OYY A;  2XAU A;  1U78 A;  1TC3 C;  1B1B A;  4Z2Y A;  2EK5 A;  2Z1D A;  1V5G A;  3BQZ A;  2V1N A;  2DA4 A;  2F4M B;  2X6O A;  5JVG F;  3GTM J;  1IN8 A;  3H0D A;  4GYI A;  4A6E A;  1STZ A;  4R79 A;  2H27 A;  2XDV A;  3IRQ A;  2LD5 A;  3MEX A;  1UHS A;  3ECO A;  1ERD A;  3GTO J;  2BY2 A;  3M7G A;  3V42 A;  1HOM A;  3M8F A;  4RLQ A;  1BW5 A;  3MKL A;  4IEJ A;  3IWF A;  4NQW B;  4CYC A;  2FU4 A;  3FIS A;  4J01 A;  3QPS A;  2OV7 A;  3RZD J;  1AKH B;  1W0T A;  3KP4 A;  2O61 A;  3G3Z A;  3OYA A;  4N0B A;  4KMU X;  1YX3 A;  3T0Y A;  3CCQ I;  2VJI A;  2VBX A;  1UFM A;  2EFO A;  2Y75 A;  4BQQ A;  1X2N A;  2HVQ A;  2KMU A;  1IDY A;  4BXU A;  3K4C A;  3K4J A;  3JW4 A;  1D8J A;  1H9G A;  1YIJ I;  4BKX A;  5EJC A;  5HS9 A;  2B9S A;  2DPU A;  1XN7 A;  1P4W A;  5DD8 A;  2YUS A;  2Z33 A;  4L18 B;  4EJT A;  1D0Z A;  4LFU A;  1RZ4 A;  4Y52 J;  3BTI A;  2Y0S N;  3RKY A;  3EET A;  1QVU A;  3WGG A;  4K2E A;  2M34 A;  3WU0 A;  4AIK A;  2BOL A;  1UJ8 A;  4OIQ F;  2RQP A;  2DA2 A;  1KQ9 A;  2CW7 A;  2MFZ A;  3CDI A;  1ETK A;  1OR7 A;  3SJM A;  1F4K A;  4OMY A;  1ENH A;  4ENK A;  1K78 A;  2HEO A;  1HDP A;  2DK5 A;  2VXZ A;  4D7M A;  2Z5U A;  3SZG A;  3WHB A;  3ABU A;  1FZP B;  2DMN A;  2B0L A;  2QQB A;  3OR2 C;  4E70 A;  3CO6 C;  4XK4 A;  1YTY A;  2X6X A;  4A3D J;  4U0Y A;  5FLM J;  3V7R A;  3OWT A;  4M3G A;  4BE1 A;  2PMZ N;  1Z6R A;  3HPG A;  3N97 A;  1NG7 A;  3K10 A;  2BV6 A;  3Q9V A;  1SFE A;  3E6C C;  3W2A A;  2DW4 A;  4UHT A;  1NH3 A;  2XIG A;  4Q47 A;  2HNH A;  2KIU A;  1JTX A;  1DUX C;  3LST A;  1Z3Y A;  2I10 A;  4ZYD A;  4RLF A;  3W3C A;  3E97 A;  2LMD A;  3FXR A;  4XOP A;  2YSR A;  9ANT A;  2HPI A;  2IBD A;  2K9L A;  3CJR B;  3Q0W A;  3A4C A;  3OYI A;  2ELJ A;  3WE3 A;  2IP2 A;  3GLL A;  3ABK H;  1HKT A;  2DDB A;  4CXF A;  2ACJ A;  4U0V A;  1GLN A;  1IN7 A;  1XB4 A;  2JVH A;  2XF5 A;  4BAC A;  3MKY B;  4FX0 A;  2HR3 A;  2ZSH B;  5DYM A;  2OC6 A;  4KA4 A;  1UST A;  2K4J A;  4EGY A;  1BI2 A;  1QZE A;  1XX5 A;  3SEQ A;  2CUF A;  4XLP F;  3HRU A;  3TGN A;  2CWE A;  2R7T A;  3E0J B;  2A68 F;  1YJ9 I;  5DTD A;  3KP3 A;  2Z9O A;  3EPZ A;  3KPH A;  1XDS A;  1S72 I;  2V1D A;  1VQ6 I;  2FNA A;  3HRT A;  2A5Y B;  4LIV A;  4DYC A;  4KDP A;  1SFO J;  3HUG B;  2CGP A;  2VT3 A;  5B1A H;  4IQJ A;  2QVO A;  3OYG A;  1G8X A;  2BZT A;  4HEA 2;  3MKZ A;  1S6L A;  4MO7 A;  4NNJ A;  4XQF A;  4M3B A;  3EUH A;  4F52 A;  4RAF A;  1Y0U A;  1MBJ A;  3CZ6 A;  4AIH A;  1JUS A;  2O7O A;  4CCM A;  1RES A;  2KL4 A;  4YII A;  2VUM J;  3H9Q A;  1KU7 A;  2KLO A;  1B4A A;  3ZQG A;  3ZMZ A;  1WJD A;  4M3F A;  1XGM A;  3R0J A;  1P9Q C;  4ZC3 A;  1VTN C;  5C44 J;  2VC0 A;  5HOD A;  1D3Y A;  2ZXW H;  2L02 A;  2R7S A;  4OIN F;  4QTR A;  2LY1 A;  4HF0 A;  4G7H F;  5J8C A;  1LPQ A;  3ZQQ A;  4A3E J;  4PJN A;  3OYB A;  3WTX C;  4MHG A;  3P7N A;  3LSH A;  3KZZ A;  2VQC A;  1U5T C;  5EEH A;  2M5W A;  4PSX A;  3KZY A;  1VQK I;  4BHC A;  5D4S A;  1JKR C;  1G4D A;  3BCB A;  2HXO A;  4EJV A;  4WXC A;  3V8L A;  1MBE A;  3K1P A;  4A69 C;  2OZU A;  5M5X J;  1FLI A;  2ETH A;  3BOQ A;  1YW7 A;  2CQ7 A;  2F2E A;  3SQN A;  3HKZ N;  2L01 A;  1ZHF A;  3WU2 C;  3QPH A;  1MMA A;  2MC3 A;  2Q2E B;  4MIM A;  4CYD A;  2A61 A;  4IJA A;  2ZBK A;  1E3P A;  1R1T A;  1XPX A;  1LFB A;  1R00 A;  1J59 A;  1LDJ A;  5F0F A;  5FRM A;  1DU6 A;  2KIM A;  5F6F A;  5J3L A;  3W2V A;  4A5N A;  4HOB A;  2YPR A;  2DYS H;  2LDU A;  3TDZ C;  3I56 I;  1EA3 A;  1LDK B;  4N4O B;  5BPD A;  4C3H J;  4S0H B;  1TQI A;  2Y48 A;  1HCR A;  2EBI A;  2ELH A;  2ESN A;  2L3D A;  3NWS A;  5HLT A;  3Q5F A;  3LWF A;  3HBL A;  5H20 A;  3TKY A;  1G3S A;  5DV5 A;  1BIA A;  2MA3 A;  3GME A;  4NUB A;  1H9T A;  2JSP A;  5ILV A;  1MBH A;  3LSK A;  5F08 A;  4HRI A;  2JUG A;  3R6S A;  3S32 A;  2E7X A;  2CV1 A;  5L3F A;  3QP6 A;  4BJT A;  4XRS G;  1JGS A;  2CO5 A;  1QZY A;  5D6E A;  5B5E C;  1TBX A;  2COB A;  1KYZ A;  2OA4 A;  4QIW N;  1FYL A;  4BUP A;  4CCO A;  3KEO A;  2L9R A;  3TP0 A;  4XLH A;  2FSW A;  1ZN2 A;  4W97 A;  4OAY A;  1MBG A;  1PYV A;  3HIF A;  3LSI A;  4UUT A;  3OIO A;  4MTD A;  2NXN B;  4UV8 A;  1T8I A;  4XN0 A;  2AXT C;  3FBN B;  2QSG X;  2GXG A;  2VLA A;  1U8B A;  3JSP A;  1OKR A;  5ED4 A;  5LHG A;  1REP C;  3ZXS A;  4C9Y A;  4CZZ A;  3PJR A;  4NBQ A;  4A3I J;  3VWB A;  4L0Y B;  2IJL A;  1HW1 A;  3LFU A;  1BA5 A;  4BHP A;  1TW2 A;  4GO1 A;  2VBY A;  1R49 A;  1HLV A;  3WE2 A;  4I99 C;  1YIT I;  4RA2 A;  5LHH A;  2R7W A;  3OR1 C;  1E2X A;  3GZ6 A;  3TO7 A;  2HU9 A;  4UB8 C;  1OJL A;  2HOT A;  1Q1H A;  4C2M J;  3H92 A;  1O7F A;  3U1D A;  1JKO C;  2AS5 F;  5E18 F;  3HOV J;  3K4L A;  1HF0 A;  3ESW B;  4DBR A;  4G6T B;  3VB2 A;  4S05 A;  2V1U A;  2DMU A;  3EYY A;  1SAN A;  1MMD A;  1FTZ A;  4L9J A;  1VQ4 I;  3T5X A;  4JX5 A;  3HOT A;  1FC3 A;  1SVO A;  3OL4 A;  3GTQ J;  2HQN A;  5EG0 A;  5BS6 A;  1LFU P;  2F5F A;  3CLO A;  3J80 Z;  3DBL B;  4ITV A;  4PJJ A;  5F0C A;  4RB3 C;  2M45 A;  2RGV A;  3HTS B;  4IL6 C;  2ZC2 A;  2TCT A;  1T6S A;  2OTJ I;  3DBR B;  2HVR A;  3MAJ A;  3MMY B;  1T33 A;  1S29 A;  3G73 A;  3E1S A;  3MZH A;  2MH9 A;  2Y30 A;  2H8W A;  5K7H A;  1P4X A;  3GF2 A;  3KP2 A;  3QWL A;  3F6O A;  4X0G A;  1ORK A;  2A69 F;  1Y8R B;  3BY6 A;  4HX7 A;  1MBF A;  2CH0 A;  3CCM I;  1IXS B;  2OUM A;  3BTJ A;  4BEH B;  1TW3 A;  2LKP A;  5IY5 H;  5EZG A;  1D5V A;  2D1V A;  3JRA A;  5D5W B;  2R7V A;  4KN7 X;  2KJB A;  4B8X A;  4DQ2 A;  1V55 H;  2LG4 A;  1JJ8 C;  2OQG A;  3HB9 A;  3HTU A;  2XGD A;  5E1Z B;  3UR3 C;  3S16 J;  4IOA F;  2HOA A;  4HG2 A;  3HEF A;  3IAM 2;  3FM5 A;  4U87 A;  1U9N A;  5EGO B;  2CS3 A;  3ONQ A;  1GVJ A;  2QKM B;  5J4Y A;  3CMA I;  1FWZ A;  3FDY A;  1KU2 A;  2WV0 A;  4MTE A;  3HOZ J;  4BU2 A;  1D1C A;  1P7I A;  3CJN A;  3HHG A;  2Q1Z B;  5J40 A;  1OYW A;  2VE8 A;  5C3E J;  2O03 A;  3PUB A;  2PMZ A;  2BE5 F;  5EEA A;  2JA2 A;  2CFO A;  3AG2 H;  1VQO I;  1IW7 F;  4IX7 A;  1QPM A;  2L7M P;  3RYR A;  4A3L J;  2HKO A;  5FKM A;  5F04 A;  2NS0 A;  2D45 A;  3GTG J;  1VF9 A;  3DLA A;  3PFI A;  3GEZ A;  1VQL I;  1MMG A;  2E5N A;  2XAH A;  2MD5 A;  3A0H C;  1MW7 A;  3O2P E;  1JHF A;  3F6V A;  1AU7 A;  5CLS A;  2GIV A;  2ZNZ A;  3QYE A;  1IG7 A;  1FMV A;  3E5Q A;  4I09 A;  1GV2 A;  1HXD A;  1RPW A;  1G3Y A;  3AAF A;  1QVT A;  3G6E I;  4CZC A;  1MJ9 A;  4I01 A;  3ULQ B;  3KLO A;  1R6R A;  2KJC A;  2E1M B;  1S5L C;  2L0K A;  3ZQI A;  2K85 A;  1Y1V J;  5EZH A;  1TT0 A;  4DBQ A;  1B6A A;  2V7F A;  1WKM A;  3W6K B;  2COM A;  3Q3S A;  1P7J A;  4I02 A;  2IGK A;  3TED A;  2HQA A;  2JN6 A;  3VEP A;  1R7J A;  1SFX A;  4CHU A;  1W7P A;  2RAE A;  3FXU A;  1UB9 A;  2DCE A;  2A6H F;  3PNV A;  4IRI A;  2NVT J;  3S1Q J;  2D1H A;  2L5Q A;  5JHU A;  1Y0N A;  3ZPL A;  4ZDO A;  3K70 C;  1A5J A;  5L3D A;  3KX2 A;  1DDN A;  2CV0 A;  3SFZ A;  3LAP A;  3FK7 A;  3RKX A;  4LLN A;  2E2H J;  4RAY A;  2VPL A;  1S8N A;  4BXF A;  2E19 A;  2VJJ A;  2VKV A;  4G8X A;  1RUO A;  2BVL A;  3FZV A;  2QKL B;  1GT0 C;  5D6F A;  2F5E A;  1WVR A;  4I98 B;  1TZL A;  1B72 B;  3J7Y J;  2DQL A;  2H6B A;  3DKX A;  4UY8 I;  1ONV A;  4RBO A;  1FTT A;  1ETQ A;  2LF7 A;  2M1B A;  3ML6 A;  2VPR A;  4UB6 C;  2E2J J;  3M8J A;  3PNT A;  3OY9 A;  3SFI A;  4E7I A;  1P4A A;  1I3Q J;  2WA0 A;  2VC1 A;  1WHU A;  1TQP A;  2WB1 A;  1DGR M;  2P5L C;  4XSX F;  4B3X A;  4B44 A;  3H5A A;  1ZAO A;  1X3U A;  2EZH A;  5JLW A;  1V5E A;  4R8H A;  1WH7 A;  3BWG A;  5FGM A;  2IS1 A;  1QRY A;  2R7R A;  2B63 J;  3C2G A;  2M4G A;  5D5U B;  2ADU A;  5JHF A;  3GBG A;  2ICW G;  1F5T A;  3HOX J;  1IV6 A;  1MKM A;  2DOA A;  4JX4 A;  1ZLJ A;  2RNJ A;  1VQ7 I;  2OBP A;  1I1S A;  1FX7 A;  2E71 A;  3VYS B;  2LKS A;  4G7O F;  2R0Q C;  2BY3 A;  1PP7 U;  3VPR A;  2PI0 A;  3E5U A;  1NG6 A;  4ESB A;  2DQR A;  4BBS J;  1I39 A;  4I0B A;  2JA8 J;  1R71 A;  2Q0O A;  2QWW A;  4JQF A;  3H9J A;  3M1C A;  2VB6 A;  3PUF A;  2JWT A;  3ROU A;  4XON A;  3A01 A;  1K6O A;  2KIQ A;  3ZR8 X;  1AKH A;  5E8G A;  3K1N A;  4V19 K;  2QQ9 A;  1WJB A;  3NAR A;  1A04 A;  2QA4 I;  4XLC A;  4NQW A;  1FP2 A;  3OYJ A;  4DJA A;  2PLY A;  1APL C;  3FXO A;  1ZEL A;  3S8P A;  1WSU A;  2FEZ A;  1VQ9 I;  1YX5 A;  4BY7 J;  2BXZ A;  3DBH B;  2JPB A;  3QQA A;  2OAZ A;  3I71 A;  3BPV A;  4O6J A;  2ISZ A;  1AOY A;  2YX7 A;  3G1M A;  4YEJ A;  4WXH A;  1IN6 A;  3SYT A;  1Y6I A;  4KNY A;  5D4R A;  1ZRC A;  5K1Y A;  2ECB A;  5E3N A;  5K5Q A;  4M73 A;  5CVV A;  5JFR A;  4S04 A;  4XRF A;  1B59 A;  1ZG3 A;  5CYV A;  2MD0 A;  5KAI C;  4QSH A;  1EH8 A;  4AYB A;  1P92 A;  5LEK A;  3RDI A;  2DA3 A;  1W7P D;  2VOO A;  4U7B A;  1LVA A;  2V9V A;  3PIP F;  1VND A;  2JZY A;  3BC8 A;  1XMX A;  3O8H A;  4IZZ A;  1I6H J;  5IT3 A;  4AUX A;  2O8X A;  1QPI A;  3RZO J;  2LLK A;  3LQR A;  4OMZ A;  3JRF A;  4N9I A;  3T8T A;  5EF6 A;  1O4X A;  2K9N A;  1ODD A;  4WX9 A;  3PFY A;  2EH3 A;  2L7F P;  3SZP A;  1LJ9 A;  3DPT A;  2H09 A;  3TO9 A;  4M71 A;  2A6T A;  4HST A;  2UZK A;  1RUN A;  3G4S I;  2BW3 A;  4A0X A;  1ULY A;  4A3G J;  4G94 A;  4A3M J;  4P9F A;  3SZT A;  1XMA A;  2ZXI A;  4HX4 A;  4A3J J;  1T0F C;  2PJR A;  3HJE A;  4BYY A;  2MAB A;  1N75 A;  3Q0V A;  2BEO A;  5EGO A;  1Z05 A;  1YHQ I;  1O3S A;  5EYR A;  4I2O A;  3K2A A;  2JVG A;  1ON2 A;  4CA0 A;  1ZTR A;  2M0C A;  4DIQ A;  2IT0 A;  2CUE A;  1ETV A;  2LFB A;  4H4K C;  2JRT A;  5CVR A;  2EIN H;  4IHT A;  3TW7 A;  3NAU A;  5CQG A;  4BQO A;  1Z3X A;  3CCS I;  2X1D A;  2JPC A;  4MLO A;  3ZMD A;  4HNV A;  2Y9Y A;  2XVC A;  2DOD A;  4HF1 A;  1R36 A;  1ZK8 A;  4KMF A;  2RKH A;  4HDU A;  1POG A;  1DQU A;  4A3F J;  1RR8 C;  5DUK A;  4B48 A;  2R5Z A;  2R7X A;  2XAS A;  2K5C A;  2RVC A;  1BJZ A;  4RAG A;  3B6A A;  5DDG A;  1H88 C;  5IYB J;  1WJC A;  2L54 A;  3A2K A;  4XIC A;  1JT0 A;  1Z21 A;  2LYC A;  3OYC A;  5IYC J;  1L0O C;  2CQX A;  1T38 A;  1UEL B;  3FMQ A;  3HXL A;  4Y3O A;  1JKQ C;  2W24 A;  1VQN I;  2BGC A;  2FOK A;  1HC8 A;  5E3O A;  2WAF A;  1HA8 A;  4RS8 A;  3OYH A;  3M1E A;  3RSN A;  2E36 A;  3QPT A;  2NVX J;  4L9N A;  2PMH A;  4UVC A;  3FKJ A;  2P5V A;  1S7O A;  1BOB A;  2CRG A;  2DOE A;  2F6C A;  5D8K B;  3FWE A;  2LBF A;  4A93 J;  1R5H A;  1H89 C;  1QZZ A;  1R5G A;  5CVJ A;  5K5R A;  1MGT A;  1OCZ H;  2KRC A;  4CCJ A;  2D5V A;  3OV8 A;  2JQ7 A;  3LAJ A;  1E3O C;  2STW A;  1R5I D;  2KIF A;  3CTA A;  1K7A A;  3GFI A;  4PSW A;  4XOR A;  4LG0 A;  2EB7 A;  1TWF J;  3DXJ F;  4CCK A;  1KQ0 A;  3DU6 A;  1S7E A;  1MJB A;  5BQT A;  3LA7 A;  1MSF C;  1WJE A;  3QP5 A;  5CVI A;  1OCP A;  3WHC A;  3KET A;  3QYF A;  4YFX F;  1A6I A;  5L3E A;  1SFU A;  1DGW Y;  3H0G J;  2QSF X;  2ZJQ F;  3WG7 H;  5KHD A;  5CJ9 A;  3ABL H;  5EDN A;  3AL0 C;  4B3A A;  1FBU A;  3MZY A;  4AVZ A;  1IXC A;  1YS7 A;  2K9Q A;  5JLX A;  1IRG A;  3OYE A;  3QAH A;  5HLG A;  1U8R A;  1ZGJ A;  4IO9 F;  1ETO A;  2G9W A;  3I4P A;  5TJJ A;  4LIT A;  2CU7 A;  2DT6 A;  5ICC A;  1KGS A;  2JTV A;  3L2Q A;  2E2I J;  4ENJ A;  4XLE A;  1ZRE A;  4B1R A;  4BQN A;  3ZGK A;  5M5W J;  1RET A;  3S1R J;  1M1E B;  4OIP F;  3RJP A;  3ZQC A;  1WI9 A;  3IH2 A;  1SEU A;  3HRM A;  1MH3 A;  4Y4R A;  4EGZ A;  1FSE A;  3RTR A;  2OQR A;  5JR3 A;  4LB6 B;  4JK1 X;  4BAY A;  2HTS A;  3DTK A;  4IRG A;  2ZME C;  5J6X A;  2DJI A;  5D5X B;  1ETX A;  4Y33 A;  1LEB A;  3KCC A;  4M9X A;  2F48 A;  3BTL A;  1OCR H;  4HW0 A;  3W6J B;  2TDX A;  3OYK A;  4OWR B;  2PN6 A;  4EM2 A;  3PSI A;  4YG2 F;  2L2O A;  3K7A J;  2EFN A;  2HDW A;  1R4M B;  2VN2 A;  2HKX A;  1BR4 A;  1J09 A;  5IT9 K;  1X3W B;  3CQZ J;  4II2 A;  2IS2 A;  5FLV A;  3ZMV A;  1EH7 A;  2EIM H;  1F1Z A;  1SVL A;  3K70 D;  4DZJ A;  1CQT A;  5LGN A;  2Z99 A;  2A5W A;  2IXS A;  2NYX A;  4XN3 A;  1WGX A;  3AKZ A;  3QU6 A;  2ZXH A;  1S9H A;  1IF1 A;  3HOW J;  4EM1 A;  4F92 B;  2X6Y A;  2HYF A;  2HFH A;  4D0P A;  4Y17 A;  4L5I A;  2GQQ A;  1SD5 A;  4V2G A;  2LY2 A;  4FTH A;  5DM6 F;  4PFP A;  3JR9 A;  2KT0 A;  4ZDP A;  2W25 A;  2HZT A;  4AD9 A;  4KFC A;  4DZP A;  1SFK A;  1BI1 A;  5DUI A;  2W48 A;  2EZK A;  4NC7 A;  5TGT A;  1IRF A;  3BCA A;  2WB1 N;  1WJA A;  4MNU A;  4LGW A;  1U6G A;  4KIT B;  3DLL F;  1JJ6 C;  3MWM A;  1FIA A;  1ZKG A;  5LRR A;  2RC4 A;  2IGM A;  1UHW A;  4WWC A;  4E7H A;  1IGN A;  3I59 A;  1ZYR F;  2IA1 A;  1W36 D;  3CLQ A;  2P5K A;  4HPQ A;  3KP5 A;  5IP7 J;  2RDP A;  2W4S A;  2P6S A;  4MGR A;  3K4B A;  1KA8 A;  2FJ1 A;  2L4M A;  2W57 A;  2NS8 A;  1EJ9 A;  4OIO F;  4ZYG A;  2HGC A;  5H6Q A;  1TNT A;  5LBQ A;  3O6B B;  3L2U A;  5IP6 A;  2E5Z A;  1BJA A;  2VL8 A;  3KZI C;  1FSH A;  5IPA A;  2XAF A;  3C2H A;  3GVA A;  2LP0 A;  5DCM B;  3F21 A;  5TRD A;  2O8K A;  2EA4 A;  1PUF A;  2NRA C;  3S2W A;  2AHQ A;  4IHV A;  4LIU A;  2MW8 A;  1TWH J;  3J7A Y;  5J1U A;  2K9S A;  4WK8 F;  2M7A A;  5M5Y J;  4XOT A;  3GUD A;  3HC7 A;  3KYC B;  3I3L A;  3E3V A;  2ZCW A;  1VZ0 A;  4FHT A;  3TDU C;  3FM3 A;  1GUU A;  3DKW A;  3DF8 A;  1V4R A;  3MKW B;  2XC7 A;  3P9K A;  1YYV A;  3DV8 A;  3HKZ A;  1OFC X;  3R4K A;  1W36 C;  2CG4 A;  2R7D A;  1ZR2 A;  2FNP A;  4AWX B;  4B47 A;  4EQQ A;  1W4M A;  2BHY A;  3ZQL A;  2V1X A;  2ZJR F;  5TIS C;  2JA7 J;  4D9J A;  5BOX A;  2IA0 A;  4LK1 F;  2R5Z B;  1PDN C;  2BHZ A;  4LG3 A;  2EIJ H;  4M72 A;  5ICF A;  3BDD A;  4GGG A;  5L3B A;  4O3M A;  1O3T A;  4ZTF A;  4OOI A;  2QBY A;  3G2B A;  1C0W A;  2VXD A;  3AG1 H;  4TV7 A;  3CCE I;  1SMT A;  2XF6 A;  5ERI A;  1R4N B;  3SDB A;  2M87 A;  2DT7 B;  1N78 A;  4RMN A;  5FKO A;  2QQ8 A;  2PBI A;  1FYM A;  4UXN A;  1V3F A;  3GW2 A;  4HAM A;  4ZYA A;  1D0X A;  1BI0 A;  3IUO A;  3CP2 A;  4ZH4 F;  2E1N A;  1YS6 A;  1U2W A;  1RKT A;  4RGR A;  5IOZ A;  5FO5 A;  4A0Y A;  2CW0 F;  4OAZ A;  3VYU B;  2KPM A;  2M4K A;  4G6Q A;  3TMO A;  3HG9 A;  4LLG F;  3EUA A;  4FAS D;  5M3M J;  1O3R A;  3QOD A;  4CIC A;  2P7V B;  1CGP A;  2LF8 A;  2FBI A;  2PQ8 A;  3FHZ A;  4XMY A;  4P96 A;  4X1E A;  1OCO H;  3TP3 A;  3CC7 I;  3M4O J;  4FE7 A;  3WTY C;  2DFI A;  2HS5 A;  3MQ0 A;  2J5O A;  4BE0 A;  1I50 J;  3WTT C;  1F43 A;  1K4S A;  2DFH A;  3CF2 A;  1Z1D A;  5KVR A;  3OYN A;  3OYF A;  1ZG1 A;  2HDD A;  4IHW A;  4B4C A;  1LEA A;  2KQR A;  4A6D A;  1XTA A;  4NC6 A;  2NVY J;  3DFG A;  4XBF A;  3CO7 C;  2ZFW A;  3WTS C;  3BT9 A;  3CC2 I;  3RKW A;  4KIG A;  2MYS A;  1NK3 P;  4D5C A;  3PSF A;  2CUJ A;  3OSF A;  3OS2 A;  3CJT B;  1PP8 F;  3JAM K;  2QF7 A;  3WG9 A;  2VBW A;  3GWZ A;  4RB2 C;  2EWN A;  2DTZ A;  2VKH A;  2CV2 A;  3I4M J;  1YE9 A;  1P6R A;  4IKF A;  3FXM A;  1ON1 A;  2K3P A;  5H6R A;  2LVS A;  1O3Q A;  3D5R C;  2MH2 A;  1G2H A;  3LA3 A;  2OCE A;  3RI4 A;  3EDP A;  1R58 A;  2HWV A;  4CYC B;  5ICE A;  4CGZ A;  3H3V K;  4ESJ A;  5HNF A;  3F8M A;  5BMZ A;  2M3A A;  4GDF A;  3HM5 A;  1Q1V A;  1YJW I;  2DFE A;  2IEK A;  3S3N A;  4E7J A;  4LOC A;  1YQA A;  1W1W E;  1X2M A;  4I76 A;  1WFX A;  1B9N A;  4CDG A;  1HW5 A;  3CME I;  3A01 B;  4ZTJ A;  1G3W A;  2Z16 A;  1X1B A;  2VKD A;  3C7J A;  1JE8 A;  1IV8 A;  2Z2S B;  1H0M A;  1EKE A;  4MQ9 F;  3KYD B;  4JOM A;  3HL2 A;  4WXD A;  1ZR4 A;  4AYB N;  1BOA A;  1RRJ A;  4G6D A;  5F1J A;  3JAM Z;  3L2V A;  1MBK A;  2DT5 A;  3M3Y J;  1HKQ A;  1I3A A;  1J2X A;  2K27 A;  2FOW A;  3RQ4 A;  3RIR A;  2QUF A;  1YJN I;  3HOU J;  4PZJ A;  4C3J J;  2NNN A;  1H8A C;  1QNT A;  1XGN A;  3ASO H;  2O5R A;  2EFW A;  1TT5 B;  5FFZ A;  3JRH A;  3I9V 2;  2E34 A;  3ISP A;  3ECH A;  3U21 A;  1D1A A;  2N8G A;  4A2U A;  3LSP A;  2ZO4 A;  2RNG A;  3DPL C;  1T0F A;  4ZJZ A;  2CQN A;  4L5E A;  1LE8 B;  3H35 A;  3ZMT A;  2OD5 A;  1TWG J;  3ZMS A;  1K4T A;  4U88 A;  1LNW A;  1JUP A;  2ISY A;  3GFM A;  2IS4 A;  2FQ4 A;  3KP7 A;  3JRG A;  1IO2 A;  3S15 J;  3TOB A;  3IP4 B;  4Q4Z F;  1UG2 A;  4UUV A;  5J1Y A;  3PO3 J;  5J47 A;  5CVU A;  2X4H A;  2HQR A;  2IVM A;  1FT9 A;  4R1H A;  1ZQ3 P;  3JTH A;  2VOP A;  2XF7 A;  4A3C J;  2W84 A;  4P9U A;  3LOC A;  1MNM C;  4IVN A;  4XLN F;  3ZRG A;  4KIB A;  5AIP A;  1G59 A;  4BDY A;  2EJR A;  4AU7 A;  5FRN A;  2FQ3 A;  1W7P B;  2XB0 X;  4XL9 A;  2RQQ A;  5IP9 J;  1E3H A;  3P9C A;  4RDU A;  2QBY B;  5FLX Z;  4HZF A;  3SEZ A;  4FT8 A;  3M8E A;  1X1P A;  3BRO A;  2DA5 A;  2X1C A;  4F91 B;  1ACI A;  2X85 A;  1IXR C;  4AVP A;  4HDV A;  4X6A J;  3S14 J;  1V5F A;  3L7W A;  4KN4 X;  3FKI J;  2MLK A;  1ZGW A;  5CQE A;  2R92 J;  5IOY A;  2I5U A;  3K6G A;  2R5Y B;  3CMM A;  1VQ8 I;  3HYI A;  2DN0 A;  3LFK A;  4AC0 A;  1ZG5 A;  1FEX A;  4KJZ A;  2DLL A;  3BG7 A;  4RGS A;  3E5X A;  3AG4 H;  4BJ6 C;  3CF5 F;  4LJZ F;  2R3S A;  3E6B A;  2H94 A;  2V26 A;  4G9Y A;  5FD5 A;  1WPK A;  3OOU A;  3BZK A;  1EF4 A;  4XKC A;  3KEQ A;  2KIS A;  3KLN A;  5FLX K;  3DU5 A;  3LNQ A;  3L00 A;  3PM1 A;  5GAE J;  1PUF B;  4XID A;  3F8F A;  1Z0X A;  1IUF A;  2VKE A;  4PJ0 C;  2JUC A;  1BM9 A;  1RC9 A;  2P0W A;  1B9M A;  3TL4 X;  3CCV I;  1HDD C;  1TWA J;  2CJJ A;  2KDZ A;  4UNO A;  3BJ6 A;  3I4N J;  3EUK L;  2FA5 A;  2VON A;  2QLZ A;  4YFK F;  4JP0 A;  3UNG C;  4Q48 A;  3R60 A;  2R7Q A;  2OPT A;  3HSR A;  4BE2 A;  3C1D A;  5F0H A;  1XSX A;  4D5F A;  5LGT A;  3TQN A;  5LHI A;  3I59 B;  1J7K A;  3HPH A;  4UVA A;  2FUG 2;  2HZD A;  3KFW X;  4BS9 A;  3IKV A;  2E1O A;  3K0L A;  3L2R A;  3WGH A;  5AIQ A;  2F4O B;  4YRV A;  4Y13 A;  2PJP A;  2EZI A;  3ZQH A;  1QHG A;  4FET A;  4A12 A;  3FF5 A;  5DCF A;  2AQF A;  3AG3 H;  5HDN A;  2DAO A;  4BEH A;  4GYG A;  4HBL A;  3CUQ A;  2XUB A;  2LH9 A;  3FXJ A;  2VQH A;  5GTI C;  5E3M A;  2LR8 A;  3ASN H;  5CKT A;  1PUE E;  4C2U A;  2DU9 A;  2QM3 A;  4IHY A;  4QWQ A;  2XKO A;  3DP7 A;  1T95 A;  2Z3Y A;  2LOO A;  2G7H A;  3CES A;  4L9V A;  3EUH C;  2O9L A;  2X1E A;  5LD2 C;  2GBY A;  2EFQ A;  2ZME B;  1XMK A;  2L7K A;  1DP7 P;  2LSO A;  3EYI A;  1KYW A;  2XGX A;  1J5Y A;  2M2E A;  2M30 A;  3F8N A;  2EZL A;  3QYB A;  4FCY A;  1XD7 A;  3ZN0 A;  1BR2 A;  4F3Q A;  4A3B J;  4HA8 A;  3Q9S A;  2GWR A;  2PMU A;  2QEX I;  1U9O A;  4KIF A;  2R4G A;  3S1M J;  4BL0 B;  2ZSI B;  2CFX A;  5K7F A;  2Q8K A;  1A31 A;  2NOJ B;  2F4I A;  2D2W A;  2MG4 A;  3NWT A;  4IPA A;  2YU3 A;  4HV5 A;  1JGG A;  4IRH A;  3FMR A;  2HXI A;  2L9S A;  3RKQ A;  3MD2 A;  5KAF C;  1YFH A;  4LLL A;  2IGN A;  2Y9Z A;  3OS1 A;  3G71 I;  1IUY A;  2GOM A;  1MSE C;  3B6C A;  1T56 A;  4O5V A;  4M9S A;  2ZXJ A;  3H3U A;  5D5V B;  3OYL A;  5GAH J;  4AM3 A;  2XPW A;  3DEE A;  2PG4 A;  2VE9 A;  4EJO A;  2M8G X;  3BZ6 A;  1LDD A;  3J7A O;  2W7N A;  3DCF A;  3CDL A;  3VFZ A;  2DXI A;  3V8K A;  1QO0 D;  2NS7 A;  4QLC U;  3IC7 A;  5A2Q K;  3AL0 B;  3BG9 A;  3H36 A;  2DDA A;  1TQM A;  2CW8 A;  2P81 A;  4KUM A;  1HBX G;  2M7B A;  3LA2 A;  5DD4 A;  1NTC A;  2QYO A;  4M3E A;  3I55 I;  2UXN A;  1QQI A;  2P8T A;  1SVM A;  2QEN A;  1R1V A;  2UUZ A;  3N4M A;  4E6K G;  4I7H A;  1N77 A;  5K7Z A;  3ABM H;  3MN2 A;  2GXA A;  2DBB A;  3ZQF A;  3LSR A;  3COA C;  1LVK A;  4J00 A;  2OF7 A;  3LSM A;  1J75 A;  2A3S A;  1IDZ A;  3FK6 A;  1Z9C A;  2R7Z J;  4UUS B;  1FBQ A;  3OMY A;  4XSZ F;  3S2D J;  3P9I A;  1MMS A;  2XAJ A;  4EEF G;  1D5Y A;  3QU3 A;  1GV5 A;  3C18 A;  2GA2 A;  4NDL A;  3RQI A;  3JRC A;  2VQL A;  2LBF B;  3V7S A;  2XAQ A;  4NB5 A;  3BG3 A;  5K5O A;  2GZW A;  1X4O A;  2DMQ A;  4KIC A;  2ID6 A;  4M6Y A;  2PX9 A;  2W82 A;  5A2Q Z;  3OS0 A;  4I6Z A;  2UWM A;  2ZB9 A;  3OIP A;  3C3W A;  1JKP C;  3PQK A;  4QPO A;  3HGY A;  4PJL A;  1QBJ A;  3B73 A;  1OQY A;  1E0E A;  4PDK A;  2LNB A;  2H6C A;  1S3J A;  3JSO A;  2IA2 A;  4C2T A;  1T98 A;  2IW5 A;  2W1O A;  1Z7L A;  4C30 A;  2KFD A;  4RGU A;  2DA7 A;  1RIO H;  2WV1 A;  1ITY A;  1FY7 A;  1VI0 A;  3IH3 A;  2X9D A;  4LMY A;  2V9P A;  3MFK A;  4ZYH A;  4ZDL A;  2X0L A;  3HGG A;  5HVQ C;  3M07 A;  1TLH B;  2WTE A;  3CUQ B;  1UG0 A;  2K9M A;  1RKW A;  3CCL I;  1U0J A;  1UMQ A;  1LUJ B;  1LKX A;  3IV5 A;  2NVQ J;  4EV0 A;  3K4K A;  2DJN A;  3TO6 A;  3K1M A;  5BPI A;  4ZZL A;  3F8C A;  1K79 A;  3SXY A;  1NK2 P;  1BW6 A;  1RNL A;  3GTL J;  2FML A;  1X3Z B;  3I54 A;  3ZN1 A;  4HLX A;  4M9Z A;  5JI6 A;  3NEU A;  4D7N A;  2FBH A;  4KT5 C;  3GLX A;  1TNS A;  3J80 K;  3FMS A;  3LSJ A;  2XKP A;  3CUQ C;  5F1R A;  1MD0 A;  5FKL A;  4QPQ A;  3BG5 A;  4GRI A;  4XRM A;  4CCN A;  3A02 A;  3BJA A;  2GLO A;  2HOS A;  2XSJ C;  4HF2 A;  5D8L B;  2L9V A;  2F5V A;  3ZCO A;  5ILU A;  2O6G E;  2DA6 A;  3OYM A;  2ELK A;  1U5T B;  3HOS A;  1GXP A;  2EFP A;  3IWZ A;  2MLG A;  1YRN B;  3FXL A;  1MND A;  2NAZ A;  3VYT B;  4P1W A;  5J8F A;  1LFP A;  3S1N J;  2EPF A;  2XB5 A;  3OSG A;  2VOD A;  1IN5 A;  3CUO A;  3UKG A;  1UCR A;  1TTY A;  4JYK A;  3L9F A;  1OPC A;  2EV5 A;  2VJ5 A;  2ME0 A;  2R5Y A;  3CD6 I;  2XV4 S;  1MZB A;  1DPU A;  4OU0 A;  2HPM A;  3ZP5 A;  2ID3 A;  3A03 A;  3GFJ A;  3A0B C;  3GO5 A;  3ZMU A;  4KYW A;  2ESH A;  1ZLK A;  4Q5S F;  2VBZ A;  2E7W A;  3IRR A;  1JT6 A;  4NHJ A;  1JXS A;  1BI3 A;  1HST A;  5KNL A;  3BG6 A;  3W6V A;  2XAG A;  1ETY A;  3JTG A;  2YU9 J;  3BR5 A;  4EJU A;  3DEW A;  2EV0 A;  4IF4 A;  5FJ8 J;  3CJQ B;  3I64 A;  1XG1 A;  2V79 A;  3E6M A;  1G6N A;  1HSJ A;  3RPU A;  2STT A;  1SAU A;  1FPQ A;  2L4A A;  2LTP A;  4HV6 A;  4Z6Y A;  4ZZD A;  3HRS A;  2GAU A;  4FE4 A;  1ZRF A;  1IJW C;  1D0Y A;  1EH6 A;  2E1M C;  5F64 A;  2JA5 J;  1BR1 A;  3OOP A;  4BJ5 C;  3JRI A;  5BNG A;  3QPL A;  1MDM A;  2DTR A;  1OCT C;  4ENN A;  1V54 H;  3CCU I;  2O0Y A;  3GX4 X;  2QCO A;  3H5N A;  3ABT A;  3BR3 A;  1OCC H;  1LE8 A;  2CQQ A;  2Y31 A;  4YIF A;  2LK2 A;  1AA7 A;  1MJA A;  2FF4 A;  1K78 B;  2WAQ A;  1A6Q A;  2UXX A;  2HYJ A;  4WF2 A;  2DO7 A;  4RM3 A;  1JI8 A;  5IYD J;  3I53 A;  3EQL F;  2OU2 A;  3LL7 A;  1OIS A;  3D1N I;  4HQM A;  3KE2 A;  2ZJP F;  4XKW A;  1YW8 A;  2QGU A;  2DPD A;  2QZ8 A;  1FMW A;  2K4B A;  4PFO A;  1B72 A;  1GXQ A;  5C4X J;  2ZKZ A;  3BR2 A;  3GZN B;  3F0C A;  2HQ5 A;  2KHM A;  2QQA A;  3JRB A;  3KP6 A;  5B3S H;  4XLA A;  2RV8 A;  1MDM B;  4E7L A;  4BBR J;  2GIZ A;  5B1B H;  3N05 A;  2HI3 A;  5DM7 F;  3FHN A;  3HHH A;  2J5P A;  1XDU A;  3GTJ J;  3BTC A;  2G7U A;  2M9H A;  3DWL E;  3DEU A;  4P55 A;  3GYH X;  3LQQ A;  2JT1 A;  2IRF G;  1XC5 A;  1Y56 A;  1YO5 C;  2KP6 A;  2VIX A;  1W5S A;  4ZYE A;  4RB1 A;  1UZC A;  1G3T A;  2KRF A;  3DKY A;  5FKK A;  5J1R A;  5E79 C;  1X1D A;  3S17 J;  3FIW A;  4UV9 A;  3CCJ I;  1XS9 A;  4XM3 A;  2BVM A;  3GCM A;  1FIP A;  1VQM I;  1IRZ A;  3SDG A;  2R93 J;  4N4N B;  2NVU B;  3WU1 B;  5HDK A;  4PK4 A;  4PUS A;  2WWY A;  3VOD A;  2KRH A;  1ZRD A;  4OIR F;  2R7U A;  1Y1W J;  2LC2 A;  1RR7 A;  3ERM A;  1HKS A;  4YEL A;  4RGX A;  1WH5 A;  2RRE A;  2DMP A;  5E3L A;  3MVP A;  3WOD F;  1YRN A;  2KZV A;  2MGQ A;  3SHF A;  2XRO A;  1GVD A;  3R0A A;  1U5T A;  4ETS A;  2WY8 Q;  2F5C A;  2V4J C;  4ENM A;  4BNC A;  5M3F J;  5B66 C;  2MBF A;  1W5T A;  4XNF A;  3K4M A;  1X19 A;  2KZG A;  1CF7 A;  3T8R A;  4N9H A;  4E4H A;  2HDC A;  1X1A A;  2CYY A;  3L2W A;  1W5C C;  4ABZ A;  1WI3 A;  3U9G A;  3WTW C;  2XRN A;  2AXL A;  1MH4 A;  1O7L A;  4IOC F;  1YI2 I;  5GPA A;  1HQC A;  2UV1 A;  4HX8 A;  1FBS A;  1YOV B;  2EQR A;  2Y0M A;  3H5R A;  4NC8 A;  3QRF F;  1I5Z A;  5L3G A;  5HOO A;  3VSL A;  2BY1 A;  5GP9 A;  5JVT A;  2F5D A;  2FE3 A;  3PO2 J;  1FOY A;  2G0E A;  1FOW A;  1VQP I;  2DMT A;  4F93 B;  1SC7 A;  1K6Y A;  1OYI A;  4MFD A;  4KIS A;  4IXA A;  3CDH A;  5F27 A;  2B7E A;  1BBY A;  3H9G A;  2P4W A;  1Z77 A;  2JK3 A;  5HDG A;  1OMI A;  4YIR X;  3RPU D;  1J0R A;  4RAZ A;  2CSO A;  3S3O A;  2MC4 A;  3WTU C;  2VJ4 A;  1WZ2 A;  1R1U A;  4II3 A;  4JX6 A;  1YLF A;  2DFF A;  1P2F A;  3AFH A;  1O57 A;  5LEJ A;  5ILS A;  3C2B A;  2LKX A;  3PNY A;  4IHX A;  3F23 A;  1QA6 A;  4BGD A;  1W0U A;  3JRE A;  3L2C A;  2WY7 Q;  1KZH A;  1I6X A;  3FXK A;  2CMP A;  2XPV A;  2CQK A;  4H0E A;  2KDO A;  2O3F A;  5EG0 B;  4Y15 A;  2CUZ A;  3D5L A;  5GAG J;  1K61 A;  2H1K A;  5FKN A;  3GFL A;  1B8I B;  4XKB A;  4I0A A;  2P7C B;  1WCM J;  3B02 A;  3VSK A;  1T39 A;  3PQJ A;  3H3Z A;  4B09 A;  1JTY A;  2HYG D;  2X6W A;  3FX3 A;  4ESF A;  2ZJ2 A;  4WCG A;  1XGS A;  4DYQ A;  3K9T A;  4UUS A;  4CSW A;  1KQ8 A;  4LB5 A;  4UVB A;  2JMW A;  3HSF A;  3M9A A;  1AWC A;  3OIQ A;  1A35 A;  2GA1 A;  6PAX A;  3HZJ A;  5DCM A;  4A5M A;  1F9N A;  2OJE D;  5KK1 A;  1ZGA A;  5FFX A;  1S7A A;  2V9K A;  3K69 A;  1USS A;  2DYR H;  3VDX A;  5E17 F;  3FBI B;  4V2F A;  3GZ5 A;  1BL0 A;  3DTE A;  3MZ8 A;  2L9N A;  4IQ4 A;  2K7L A;  3TOA A;  2HVS A;  1WJF A;  1TP4 A;  3BZC A;  1VFC A;  2XPU A;  2ZNY A;  2GM4 A;  3K4N A;  3CCY A;  2WC2 A;  4PJM A;  1BN5 A;  3DPU A;  4DYR A;  4HNT A;  2A6E F;  3FXQ A;  4E7S A;  5E20 A;  3I0T A;  2YR2 A;  2LY9 A;  3CC4 I;  4BH9 A;  2TRT A;  2V6C A;  3RPQ A;  4XKV A;  2E1C A;  1SD4 A;  1D1B A;  3GXO A;  3IHU A;  1J9I A;  1FYK A;  2GXB A;  2K3F A;  4U0W A;  4HYE A;  4GFB A;  5IT9 Z;  1L3L A;  2JSC A;  3KYL A;  5E8I A;  4DGW B;  3S2H J;  1QHH D;  3REO A;  3F3X A;  2AO9 A;  5E1W A;  5HNH A;  2K40 A;  1OR7 C;  4BQA A;  2VAS A;  4CH7 A;  3O8G A;  5LRS A;  4XR6 A;  1XSD A;  4MEY F;  1YW9 A;  3PL8 A;  4Y7N J;  4JBA A;  4DOZ A;  3L1P A;  3QOE A;  4YFN F;  4PGG A;  1FOK A;  3H1C A;  1KON A;  1FOX A;  4LK0 F;  3RYP A;  4RM2 A;  5FD6 A;  4AIJ A;  3HSE A;  4ASN A;  1IAW A;  2H8R A;  2FBK A;  2R7O A;  5FB2 A;  2IAI A;  3IL2 A;  4BXX J;  4L0Z B;  2ECC A;  4E7Z A;  1IZ1 A;  4CCL A;  2RN7 A;  1Z91 A;  2JRM A;  5H2F C;  5ICG A;  1MMN A;  2M8E A;  3QOP A;  3V8J A;  2OTL I;  3A1Y A;  4F7Z A;  4L9T A;  3V4G A;  2H1L A;  4EVI A;  2IGO A;  4P5O A;  1U3E M;  3GTK J;  3J81 K;  3VOE A;  3J7Z I;  1Z7U A;  2C6Y A;  2Q2E A;  5CPR B;  1JUM A;  4ANJ A;  3F8B A;  3OYD A;  2BXY A;  2NNY A;  1IRX A;  4XLF A;  1SAX A;  2ZME A;  3ZOB A;  2I8D A;  2LRE A;  2QSH X;  1TWC J;  3L09 A;  4AID A;  3V7C A;  2X51 A;  1VQ5 I;  3IH4 A;  5E1X A;  2JA6 J;  1LB2 A;  4B43 A;  1QU3 A;  1Y8Q B;  2V6E A;  3G1O A;  1T08 B;  3G1L A;  2DA1 A;  3MCZ A;  4M3D A;  5HLI A;  3T1B A;  4L5J A;  4MFE A;  4HQE A;  3BJO A;  1QGP A;  1OLT A;  2PFB A;  1ZAR A;  3JCU C;  3BLY A;  1IC8 A;  2W00 A;  3F72 A;  3CCR I;  1EV7 A;  2M0M A;  2YX4 A;  1FP1 D;  1R23 A;  1Z67 A;  3D5S C;  3K2Z A;  4D1Q A;  1Y39 A;  1PVE A;  2WAQ N;  3D0S A;  4LD5 A;  3NRV A;  2EA2 A;  2MSY A;  1DP3 A;  2DK8 A;  3RCO A;  4U7D A;  3TW6 A;  3J81 Z;  2BYV E;  5HS8 A;  4M6V A;  4ON0 A;  4A0Z A;  3BR0 A;  1NHA A;  4CUG A;  2XGE A;  1I27 A;  2A05 A;  1XGO A;  3BP8 A;  5L3C A;  3I58 A;  3ZQ7 A;  1Z6T A;  4BHB A;  5DEQ A;  2XRL A;  4DNC A;  2W85 A;  2HTJ A;  4HSR A;  1E17 A;  2FRH A;  2WAE A;  4LG0 B;  2IS6 A;  1MNE A;  5LLQ A;  2WAD A;  2VQG A;  1AHD P;  4IHS A;  3BR1 A;  3S3M A;  2R7F A;  5EEG A;  5C4J J;  4G12 A;  1F36 A;  2X48 A;  2Y0S A;  3HUG A;  1X58 A;  3LMM A;  2JJ7 A;  3TBI A;  1LQ1 A;  3R61 A;  4W1U A;  3O3K A;  1XCV A;  5GPC A;  3U2R A;  1TL8 A;  4M74 A;  1ZH5 A;  3S93 A;  3ERE D;  2Y69 H;  3BQY A;  4CO8 A;  3WTV C;  2ME6 A;  2Y2Z A;  1WQ2 A;  2NOG A;  3WTZ A;  2E35 A;  1B8I A;  2FD5 A;  5HS7 A;  4M6X A;  4EJW A;  2HOE A;  3IKT A;  1BC8 C;  1SD6 A;  2EV6 A;  3E7L A;  3PIO F;  3ELK A;  1WWX A;  3P5J A;  4FIS A;  2OZ6 A;  4FX4 A;  2FX0 A;  1XSV A;  5LFA A;  3IAS 2;  1KU9 A;  1UHM A;  2GOX B;  3VYR B;  1FNN A;  3GTP J;  3I5U A;  1DU0 A;  3LSG A;  1R9T J;  2OCC H;  3W2W A;  3KIO A;  3HDD A;  3CMY A;  1KU3 A;  2PEX A;  1T2K A;  2BBY A;  1SD7 A;  1ETW A;  1D8K A;  1YG2 A;  4MQV A;  5GAD J;  1BC7 C;  3HOY J;  1A36 A;  4EAT A;  4DW6 A;  2YS9 A;  1DPR A;  1BIB A;  1R22 A;  2ZFU A;  1WJ5 A;  1PJR A;  2EIK H;  2KKO A;  2E60 A;  2XSD C;  1UAA A;  4HNU A;  4C3I J;  5HLH A;  5AON A;  4EMS A;  4BDZ A;  1WRJ A;  5GTH C;  4G7Z F;  3CP8 A;  4EM0 B;  3U1K A;  5KCM A;  2VT2 A;  1N25 A;  5DS9 A;  1JHH A;  3DQV C;  1XCB A;  4PCQ A;  5FRO A;  3BPX A;  4XRS A;  4MEX F;  3NQO A;  5LGU A;  5J4V A;  4J19 A;  2XGC A;  2PJR B;  3BR6 A;  1HW2 A;  4HLY A;  2FMY A;  3DTI A;  2LRD A;  3Q0U A;  2DI3 A;  4BY1 J;  1SMY F;  2BW3 B;  3KEY A;  1YIO A;  3OL3 A;  4F55 A;  2FXA A;  1GHC A;  4KT6 A;  3F22 A;  2VI6 A;  4PGH A;  1K83 J;  3WGI A;  2WBM A;  1CF7 B;  1FJL A;  1I1G A;  2DOF A;  3E6D A;  2K02 A;  4GCV A;  2EIL H;  1IN4 A;  2AQE A;  4RB0 A;  1RI7 A;  4A3K J;  3F9K A;  3X2Q H;  2XHK A;  1X1C A;  4GXO A;  2A07 F;  2P6T A;  2BY0 A;  1MIJ A;  3JRD A;  2K86 A;  4E7K A;  2L7Z A; 
#chains in the Genus database with same CATH homology
 2NVY J;  2JA5 J;  1GDT A;  2E2H J;  3BT9 A;  3JRI A;  5BNG A;  1U78 A;  4D5C A;  3QPL A;  1NK3 P;  1TC3 C;  3OSF A;  2E19 A;  1OCT C;  2VKV A;  1GT0 C;  2QF7 A;  3BQZ A;  2DA4 A;  2QCO A;  1B72 B;  2DTZ A;  2X6O A;  3I4M J;  3GTM J;  3BR3 A;  1LE8 A;  2CQQ A;  2Y31 A;  2LK2 A;  4RBO A;  1FTT A;  1ETQ A;  2E2J J;  2LVS A;  2VPR A;  1G2H A;  3SFI A;  1I3Q J;  4CYC B;  2HYJ A;  2LD5 A;  1UHS A;  3H3V K;  3GTO J;  5JLW A;  2EZH A;  5IYD J;  1WH7 A;  3HM5 A;  1Q1V A;  1HOM A;  1QRY A;  1BW5 A;  2B63 J;  3MKL A;  2IEK A;  4IEJ A;  4LOC A;  4CYC A;  3D1N I;  3GBG A;  3FIS A;  1X2M A;  4I76 A;  3HOX J;  3QPS A;  1IV6 A;  3RZD J;  1AKH B;  4JX4 A;  1W0T A;  3A01 B;  1B72 A;  5C4X J;  2R0Q C;  3BR2 A;  3VPR A;  3F0C A;  2HQ5 A;  1X2N A;  3JRB A;  1IDY A;  1ZR4 A;  4AYB N;  4BBS J;  2JA8 J;  4BKX A;  5F1J A;  4BBR J;  1MBK A;  2HI3 A;  3M3Y J;  2JWT A;  2YUS A;  3GTJ J;  3A01 A;  1AKH A;  3HOU J;  4C3J J;  3BTC A;  3NAR A;  2M9H A;  1H8A C;  4Y52 J;  3BTI A;  2Y0S N;  1XC5 A;  1QVU A;  2M34 A;  1APL C;  3JRH A;  4BY7 J;  3QQA A;  5J1R A;  5FKK A;  3LSP A;  2N8G A;  2DA2 A;  3S17 J;  3FIW A;  1ETK A;  3SJM A;  1XS9 A;  1ENH A;  3G1M A;  1HDP A;  4L5E A;  1LE8 B;  1FIP A;  1TWG J;  1IRZ A;  3SDG A;  4D7M A;  2ECB A;  3WHB A;  2R93 J;  5E3N A;  1JUP A;  2DMN A;  2FQ4 A;  3JRG A;  3S15 J;  4XK4 A;  3PO3 J;  1UG2 A;  5J1Y A;  4A3D J;  5FLM J;  4M3G A;  4QSH A;  1ZQ3 P;  1Y1W J;  1RR7 A;  2PMZ N;  2DA3 A;  4A3C J;  1WH5 A;  3LOC A;  1MNM C;  2DMP A;  5E3L A;  3MVP A;  1VND A;  1YRN A;  3O8H A;  1I6H J;  2MGQ A;  4AUX A;  1QPI A;  1GVD A;  2LLK A;  3RZO J;  2XB0 X;  1JTX A;  3JRF A;  2I10 A;  5IP9 J;  1O4X A;  5EF6 A;  4RDU A;  2K9N A;  5M3F J;  9ANT A;  2IBD A;  2EH3 A;  2L7F P;  3Q0W A;  2DA5 A;  4X6A J;  3S14 J;  4ABZ A;  4A3G J;  3FKI J;  1ZGW A;  1WI3 A;  4A3J J;  4A3M J;  2R92 J;  5IOY A;  2R5Y B;  1MH4 A;  5GPA A;  2DN0 A;  3Q0V A;  2EQR A;  5EGO A;  4AC0 A;  1FEX A;  2CUF A;  5EYR A;  5GP9 A;  3K2A A;  3PO2 J;  1ZTR A;  2G0E A;  2M0C A;  5DTD A;  2CUE A;  1ETV A;  2DMT A;  2LFB A;  4MFD A;  1WPK A;  3OOU A;  3TW7 A;  5F27 A;  3NAU A;  4DYC A;  1SFO J;  1EF4 A;  1Z77 A;  2JK3 A;  4MLO A;  4HNV A;  2Y9Y A;  3LNQ A;  1ZK8 A;  4MO7 A;  3PM1 A;  1PUF B;  1POG A;  4XID A;  4A3F J;  1Z0X A;  1IUF A;  2VKE A;  4JX6 A;  4M3B A;  2R5Z A;  1HDD C;  2LKX A;  3C2B A;  1TWA J;  2CJJ A;  1BJZ A;  2KDZ A;  3B6A A;  1H88 C;  1MBJ A;  5IYB J;  1W0U A;  4IHX A;  3I4N J;  3JRE A;  1JUS A;  2O7O A;  4JP0 A;  4XIC A;  1JT0 A;  1RES A;  5IYC J;  2VUM J;  2XPV A;  2CQX A;  1JKQ C;  2OPT A;  5EG0 B;  3ZQG A;  1K61 A;  4M3F A;  5F0H A;  2H1K A;  5FKN A;  4D5F A;  5E3O A;  1B8I B;  5C44 J;  5HOD A;  1WCM J;  2E1O A;  4QTR A;  2NVX J;  2EZI A;  3ZQH A;  1JTY A;  4A3E J;  2CRG A;  4A93 J;  1H89 C;  2D5V A;  4DYQ A;  4UUS A;  1E3O C;  5E3M A;  2LR8 A;  4IHY A;  2JMW A;  1JKR C;  1TWF J;  2HXO A;  1S7E A;  2O9L A;  1MBE A;  1MSF C;  4A69 C;  2GBY A;  5M5X J;  3HKZ N;  1OCP A;  3WHC A;  4V2F A;  1BL0 A;  2M2E A;  4MIM A;  1A6I A;  2EZL A;  3H0G J;  4FCY A;  1LFB A;  2XPU A;  1VFC A;  2GM4 A;  5F0F A;  3CCY A;  4A3B J;  1DU6 A;  5EDN A;  5J3L A;  4B3A A;  4DYR A;  1U9O A;  3S1M J;  2K9Q A;  5JLX A;  2LY9 A;  2TRT A;  5K7F A;  4C3H J;  4S0H B;  2MG4 A;  1HCR A;  2EBI A;  1ETO A;  1JGG A;  2CU7 A;  2HXI A;  2E2I J;  4GFB A;  3HBL A;  3RKQ A;  3S2H J;  4B1R A;  2Y9Z A;  2AO9 A;  2K40 A;  5M5W J;  1RET A;  1MBH A;  3O8G A;  1MSE C;  3S1R J;  3B6C A;  5F08 A;  1T56 A;  3ZQC A;  3IH2 A;  4Y7N J;  1MH3 A;  3L1P A;  2XPW A;  4XRS G;  2COB A;  4QIW N;  2M8G X;  2H8R A;  1ETX A;  2IAI A;  2L9R A;  3TP0 A;  4BXX J;  2ECC A;  3BTL A;  3DCF A;  3CDL A;  1MBG A;  4W97 A;  4UUT A;  3OIO A;  2NS7 A;  3BG9 A;  3K7A J;  1U8B A;  2P81 A;  3GTK J;  1NTC A;  1JUM A;  4M3E A;  4A3I J;  3CQZ J;  5FLV A;  1BA5 A;  3ZOB A;  4DZJ A;  1TWC J;  1CQT A;  5K7Z A;  3MN2 A;  1WGX A;  3IH4 A;  3ZQF A;  3LSR A;  1HLV A;  2JA6 J;  2OF7 A;  3HOW J;  1IDZ A;  3G1O A;  4M3D A;  3G1L A;  2DA1 A;  1OJL A;  3FK6 A;  2HOT A;  2R7Z J;  4UUS B;  4MFE A;  4V2G A;  4FTH A;  4C2M J;  3JR9 A;  2KT0 A;  3S2D J;  4EEF G;  1D5Y A;  1GV5 A;  1JKO C;  4DZP A;  3RQI A;  4NDL A;  2W48 A;  2EZK A;  3JRC A;  1IC8 A;  3HOV J;  1HF0 A;  2WB1 N;  3BG3 A;  1JJ6 C;  2DMQ A;  1FIA A;  2DMU A;  1ZKG A;  1SAN A;  2WAQ N;  1FTZ A;  2ID6 A;  4I6Z A;  1IGN A;  2MSY A;  4JX5 A;  2ZB9 A;  1JKP C;  3TW6 A;  5IP7 J;  3GTQ J;  3HGY A;  5EG0 A;  4M6V A;  2FJ1 A;  1LFU P;  2NS8 A;  3BR0 A;  5F0C A;  2XGE A;  2TCT A;  5IP6 A;  2DA7 A;  5IPA A;  1T33 A;  2WV1 A;  1ITY A;  2LP0 A;  2O8K A;  2XRL A;  1VI0 A;  3IH3 A;  2Y30 A;  2X9D A;  5K7H A;  1PUF A;  2AHQ A;  4IHV A;  1AHD P;  2MW8 A;  1TWH J;  3BR1 A;  3HGG A;  5J1U A;  1ORK A;  2K9S A;  5C4J J;  4G12 A;  5M5Y J;  1F36 A;  1MBF A;  2X48 A;  1X58 A;  2JJ7 A;  3BTJ A;  1RKW A;  4W1U A;  5EZG A;  1UMQ A;  5GPC A;  3JRA A;  2NVQ J;  3IV5 A;  1GUU A;  1JJ8 C;  3HB9 A;  3BQY A;  2DJN A;  2XGD A;  2ME6 A;  2Y2Z A;  2NOG A;  3S16 J;  2HOA A;  1NK2 P;  3HEF A;  1BW6 A;  1B8I A;  2FD5 A;  3GTL J;  1OFC X;  1U9N A;  4D7N A;  5EGO B;  3E7L A;  3LSJ A;  1ZR2 A;  4FIS A;  3ZQL A;  2FX0 A;  2JA7 J;  3GTP J;  5FKL A;  3HOZ J;  3BG5 A;  1DU0 A;  3LSG A;  4XRM A;  2R5Z B;  1R9T J;  1P7I A;  3A02 A;  2GLO A;  2HOS A;  3HDD A;  5C3E J;  3CMY A;  5EEA A;  1ETW A;  2L7M P;  2DA6 A;  4A3L J;  2ELK A;  3HOY J;  5FKM A;  5F04 A;  3GTG J;  1VF9 A;  4DW6 A;  2YS9 A;  1YRN B;  2XSD C;  1AU7 A;  1IG7 A;  5FKO A;  3S1N J;  4C3I J;  2XB5 A;  1GV2 A;  3OSG A;  1RPW A;  1QVT A;  5DS9 A;  3UKG A;  4XRS A;  4JYK A;  4J19 A;  2XGC A;  1RKT A;  3BR6 A;  2ME0 A;  5IOZ A;  2R5Y A;  3Q0U A;  2L0K A;  3ZQI A;  1Y1V J;  4BY1 J;  5EZH A;  2ID3 A;  3A03 A;  3Q3S A;  1P7J A;  5M3M J;  2VI6 A;  4FE4 A;  3TED A;  2JN6 A;  1K83 J;  1JT6 A;  1FJL A;  4X1E A;  3W6V A;  1ETY A;  3TP3 A;  3BR5 A;  2YU9 J;  3M4O J;  3DEW A;  4FE7 A;  4A3K J;  2RAE A;  5FJ8 J;  1XG1 A;  2NVT J;  3S1Q J;  1I50 J;  1F43 A;  2LTP A;  1A5J A;  2HDD A;  4IHW A;  3JRD A;  4B4C A;  2L7Z A;  3FK7 A;  1IJW C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...