1K61A

Matalpha2 homeodomain bound to dna
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
60
structure length
60
Chain Sequence
RGHRFTKENVRILESWFAKNIENPYLDTKGLENLMKNTSLSRIQIKNWVSNRRRKEKTIT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Transcription/dna
molecule keywords 5'-D(*AP*CP*AP*TP*GP*TP*AP*AP*TP*TP*CP*AP*TP*TP*TP*AP*CP*AP*
publication title A Hoogsteen base pair embedded in undistorted B-DNA
pubmed doi rcsb
total genus 22
structure length 60
sequence length 60
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2001-10-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00046 Homeodomain Homeodomain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.60 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Homeodomain-like 1k61A00
1TC3C 1ZR4A 2E19A 2L9RA 2XB5A 5J3LA 1T33A 2HQ5A 3ZQGA 1NK3P 4A3DJ 4A3CJ 3G1LA 3IH3A 3BR6A 1HDDC 2TRTA 2NVYJ 2YUSA 1MBGA 1ORKA 3HBLA 3JREA 3S1RJ 4MFEA 2DTZA 1GT0C 4BBSJ 5F08A 3G1OA 3JRBA 2H8RA 1BJZA 4S0HB 4A3KJ 2DMUA 2DA5A 2CRGA 5FKNA 4EEFG 5F0FA 4DYQA 1WGXA 4AYBN 2ECBA 3PO2J 2L7FP 2ME6A 1MNMC 5FKOA 2M0CA 1ITYA 4CYCA 1B72B 1VNDA 1G2HA 1W0UA 2EZIA 5EG0B 2Y0SN 3IV5A 2M9HA 1ZK8A 2Y31A 5M3FJ 5IP6A 3RKQA 1UG2A 1FJLA 3IH4A 2DMTA 3G1MA 4AUXA 1JGGA 2R92J 1OJLA 4UUSA 2VI6A 3D1NI 1JKRC 4A3IJ 2HXOA 1VI0A 3BR0A 1JT0A 3GTPJ 3GBGA 3DCFA 2DMQA 2DA3A 1UMQA 2DA1A 3GTOJ 1ZKGA 3HB9A 1B8IB 4D5CA 4M3FA 1GVDA 1QVUA 2COBA 5FJ8J 2XRLA 4A3MJ 4JX6A 2LD5A 3S16J 1RKWA 2E2IJ 5JLWA 5IYCJ 3RZDJ 1IJWC 1YRNA 2VPRA 2MG4A 2NVTJ 1A5JA 1I3QJ 5IP9J 4C3JJ 2VKEA 3MN2A 4B3AA 3TP3A 3BG3A 4A93J 3RZOJ 2HOSA 3LSPA 4M3GA 2DA6A 1WPKA 5K7FA 2LFBA 1Z77A 4G12A 2LK2A 1BW5A 1ETQA 1JKOC 4M3EA 5C44J 2HDDA 3MKLA 2VKVA 2Y9ZA 3OIOA 5M5WJ 2K9NA 1S7EA 4JP0A 1EF4A 4QTRA 1F36A 1TWAJ 2EZLA 2DA2A 3QQAA 1B72A 5C4JJ 1VF9A 4JX4A 5EG0A 1GUUA 3QPLA 4CYCB 2ELKA 1NK2P 1FEXA 4A3EJ 1GDTA 4X1EA 2W48A 2LLKA 2K9QA 1IV6A 3A01B 1MBKA 3K2AA 4B4CA 4M3DA 2EQRA 2H1KA 2ZB9A 1K83J 2HOAA 1BA5A 3FK6A 3O8GA 4MFDA 3Q0WA 2GLOA 4M6VA 1DU0A 5IYDJ 3W6VA 3CMYA 3ZQHA 3I4MJ 3PM1A 4IHWA 2DJNA 4L5EA 1B8IA 4LOCA 1X2MA 3CDLA 4XK4A 4I76A 2X9DA 1UHSA 2CQXA 1W0TA 1HOMA 3FISA 2LVSA 2AO9A 2K9SA 1I50J 1QVTA 1YRNB 1H88C 3JRIA 1P7IA 1DU6A 2CUFA 2NS8A 4JX5A 2XPWA 4XRMA 1X2NA 1ZQ3P 9ANTA 2LR8A 3WHCA 4V2FA 2E1OA 3RQIA 2IEKA 1IDYA 3MVPA 4XRSG 2I10A 1ZGWA 3HGYA 2GBYA 3BTCA 1LFUP 1R9TJ 3GTQJ 2WB1N 3SFIA 5IPAA 1RR7A 4M3BA 5IOYA 3ZQFA 4DZJA 3S1NJ 3C2BA 2MW8A 3HDDA 1O4XA 4A3GJ 4FISA 1WH7A 1QPIA 3M4OJ 4DW6A 1F43A 2WAQN 5FKKA 3I4NJ 3A01A 1JJ8C 2YU9J 1T56A 3TP0A 5K7ZA 3L1PA 3LSRA 5EZHA 4DZPA 1IDZA 1FTZA 1IGNA 5IOZA 2XPUA 3S2HJ 2O9LA 1D5YA 5EEAA 3GTJJ 4BBRJ 3S14J 1ETOA 3JR9A 1TWCJ 1MSEC 2WV1A 1RPWA 4Y52J 3NARA 2DMNA 5M5YJ 2JA7J 4FE4A 5DS9A 1MBJA 3F0CA 2B63J 2P81A 2NVQJ 3S17J 4AC0A 2N8GA 1PUFB 3IH2A 1ETVA 5J1RA 3JRDA 3JRFA 3HOXJ 2M8GX 1WH5A 5HODA 1IC8A 1FIAA 3BQZA 3DEWA 1OFCX 1E3OC 1AKHB 1WI3A 4UUTA 1HF0A 1POGA 2Y9YA 3SDGA 1SANA 2D5VA 4DYRA 3LNQA 2RAEA 2OF7A 1BW6A 3LSGA 3CQZJ 2DA7A 4IHYA 3QPSA 5EDNA 1U8BA 2DN0A 4D7NA 3S2DJ 3OOUA 2MGQA 1RKTA 1U78A 1RESA 3HOZJ 1HLVA 4Y7NJ 4I6ZA 1TWFJ 5M5XJ 2K40A 2HOTA 1ETYA 4B1RA 3HOVJ 2PMZN 2Y30A 1FTTA 1QRYA 1MBFA 2R5ZB 4BY7J 1HCRA 5GPCA 3K7AJ 4IHVA 4V2GA 3LSJA 4XIDA 2NS7A 1XG1A 4IHXA 4A3BJ 1JTYA 2TCTA 4MLOA 3O8HA 4D5FA 5EZGA 3GTGJ 2X48A 3B6AA 3ZQCA 3BTJA 5F1JA 4FTHA 3M3YJ 2L7MP 5FKMA 4MIMA 3GTLJ 1GV5A 1PUFA 3BTIA 4W1UA 1K61A 2L7ZA 3S1QJ 1HDPA 1APLC 5JLXA 1IUFA 3GTKJ 1GV2A 4DYCA 1WCMJ 2ID6A 1AKHA 4GFBA 3OSFA 3PO3J 5M3MJ 1XC5A 2G0EA 5IP7J 1BL0A 4BY1J 1JTXA 4J19A 2NOGA 1SFOJ 1H89C 1U9OA 4A3LJ 3H3VK 5FKLA 2XGDA 3S1MJ 2ID3A 3Q0UA 5E3MA 1TWGJ 3BT9A 1OCTC 1JUSA 2JA8J 2CU7A 2YS9A 5J1YA 2HI3A 2HYJA 3ZQIA 4D7MA 2LTPA 1LE8B 1XS9A 1CQTA 4MO7A 1ZR2A 3FK7A 5BNGA 2R5YA 1JJ6C 2IBDA 2R5ZA 3BQYA 2XB0X 3HM5A 3HOUJ 3WHBA 3A02A 2LKXA 1LFBA 1ETWA 1Y1VJ 2EZKA 1P7JA 2JWTA 1MSFC 4JYKA 4X6AJ 4FE7A 5J1UA 2ME0A 1MH4A 1ETKA 1U9NA 2CQQA 3TW7A 2JN6A 2R93J 2FJ1A 3NAUA 1JUMA 3H0GJ 3BR1A 3CCYA 3ZQLA 2QCOA 2JJ7A 3E7LA 3HKZN 5E3LA 5FLVA 3BR5A 2M2EA 2JA6J 2FD5A 2XGCA 2L0KA 3TW6A 3Q0VA 5E3OA 2CUEA 2ECCA 4BXXJ 2JK3A 5EYRA 3FKIJ 5EF6A 4W97A 1MBEA 5EGOB 2DA4A 1ETXA 3BR3A 2O8KA 3HGGA 4HNVA 3BR2A 2GM4A 3JRGA 5IYBJ 2E2HJ 3JRHA 2JA5J 1Z0XA 5GPAA 2XSDC 1IG7A 2Y2ZA 2NVXJ 3HOWJ 1FIPA 3OSGA 4RBOA 1Q1VA 1JT6A 1ZTRA 2DMPA 2EH3A 3JRCA 4IEJA 1JKQC 2CJJA 3SJMA 1LE8A 2MSYA 3GTMJ 1ENHA 3A03A 1TWHJ 2HXIA 3BTLA 1NTCA 4C3IJ 2R0QC 2KDZA 2R5YB 5E3NA 2FX0A 5F04A 4C2MJ 3B6CA 2KT0A 4NDLA 3UKGA 5FLMJ 3HOYJ 2E2JJ 1RETA 3BG5A 5DTDA 1Y1WJ 2XPVA 1MBHA 3BG9A 4BKXA 4A3JJ 4QIWN 4A69C 2EZHA 3TEDA 1JKPC 4FCYA 3FIWA 5C4XJ 3VPRA 1H8AC 3S15J 4C3HJ 2QF7A 1VFCA 2X6OA 3Q3SA 1X58A 4UUSB 3HEFA 5C3EJ 2FQ4A 1AU7A 2VUMJ 4A3FJ 2LP0A 2OPTA 4XICA 2O7OA 1JUPA 1IRZA 1OCPA 2JMWA 3JRAA 1A6IA 4XRSA 2EBIA 4RDUA 1MH3A 2XGEA 5GP9A 5K7HA 5EGOA 1I6HJ 1AHDP 2LY9A 2AHQA 2IAIA 5F0HA 5F0CA 4QSHA 2M34A 5F27A 4ABZA 3ZOBA 3LOCA 2R7ZJ
chains in the Genus database with same CATH superfamily
4U7DA 3KPHA 2Q8KA 4BEHA 3IUOA 1NK3P 3KLNA 4UNOA 5LBQA 1GVJA 2A5YB 3K6GA 4LIVA 1WZ2A 1MBGA 1ORKA 3D5SC 3OL4A 2BV6A 2ZC2A 5L3DA 2ZMEA 3JRBA 2H8RA 3M1CA 4Q48A 4A3KJ 2W24A 3I58A 1X1CA 2ECBA 2EFPA 2X6XA 4CH7A 2PEXA 5DEQA 2KP6A 4S04A 4BJ6C 3PJRA 2XSJC 3FMQA 5F1RA 4Z6YA 2EZIA 2F5VA 1D8KA 5EG0B 2CFOA 2M9HA 3CCJI 5IP6A 2WB1A 2K02A 5FGMA 2O0YA 2FMYA 4LK1F 1TNTA 1IRXA 3C2GA 3PSFA 5ILSA 2IGKA 1Y8QB 2K4JA 2DTRA 2VI6A 1FYKA 1EV7A 3D1NI 1ULYA 4RAFA 5E17F 4XLFA 1VI0A 4PFPA 2MH9A 2R7QA 2DO7A 2F4MB 3DCFA 4C2TA 2FOKA 2DA3A 1UMQA 2ZJ2A 3FM3A 3GTOJ 3RPQA 4G7HF 1ZKGA 3HB9A 5LGUA 1DPUA 4WWCA 2VL8A 4E7HA 2W84A 2X6YA 3CF2A 3GO5A 4BQAA 1IN4A 5FJ8J 4XKVA 1Q1HA 2L7KA 3SZTA 1RKWA 4J00A 3TL4X 5IYCJ 3HPGA 4XMYA 1I3QJ 4C3JJ 3MN2A 2CQ7A 1RI7A 2QLZA 3BG3A 4I7HA 2CW7A 1S72I 1J9IA 1VQ9I 5CVUA 1BW5A 2LK2A 1XDSA 1BR1A 4M3EA 4XOTA 5C44J 2HDDA 2EV5A 2VKVA 2Y9ZA 3OIOA 5E8GA 3WG7H 4GDFA 1W4MA 4KUMA 1S7EA 4JP0A 1O57A 3HHGA 3HIFA 1BC8C 2KIUA 1IZ1A 1T0FA 1B72A 5FD6A 3PNTA 2EA4A 3QPLA 4CYCB 1N25A 1FMVA 3FXJA 3F8NA 5D5XB 2E36A 5LHHA 2EIJH 4Y4RA 1P6RA 2LKPA 3UNGC 4HF2A 1R49A 4B48A 4RLQA 1WJEA 2K9QA 3ZMDA 2M4GA 2ZXWH 2F48A 3K2AA 1ZLJA 3QWLA 3Q9VA 4QPOA 4A6DA 1BA5A 3K1MA 4ZYEA 2R7DA 4PZJA 3H9JA 3RJPA 5B1BH 1WQ2A 4HX7A 2VBXA 4L5JA 4CYDA 2EJRA 3W3CA 2E1MB 2EPFA 1P9QC 1DU0A 3H5AA 4ZTJA 3PM1A 4KIBA 2DJNA 1B8IA 2OBPA 2EFOA 2DT5A 3K4NA 4BJTA 2E1NA 2WAEA 2K9LA 2R4GA 4I76A 4ZDLA 2X9DA 2DFIA 2CQXA 1O3SA 4M74A 3TGNA 1Z3YA 3ZQQA 3QU6A 3BJOA 2K9SA 2CUZA 4QLCU 1QVTA 2IS6A 1R36A 5IY5H 1R4MB 4XQFA 3QU3A 4JX5A 2A3SA 2E7XA 3VEPA 2VLAA 2ACJA 1XGOA 5LD2C 1U2WA 4XLNF 1ZQ3P 4XLEA 2CV2A 9ANTA 4DBQA 2P7CB 1B4AA 3WHCA 4DGWB 2ZCWA 3VSKA 1O3RA 3TO7A 3RQIA 4RM3A 5D6FA 1R5ID 1IDYA 3CJNA 3QP5A 2VJ4A 3U2RA 3V7SA 3A4CA 2L4MA 2GBYA 5H2FC 5DD4A 1LFUP 2DXIA 3M07A 2TDXA 3RYRA 2PJRB 3SFIA 3OYLA 1MNDA 2L9VA 1J0RA 4M3BA 3ZQFA 2P8TA 2XAQA 3MKZA 1WH7A 3GZ5A 4MGRA 4G7OF 2WAQN 2QA4I 1TNSA 4IRHA 3BCAA 2YU9J 1T56A 4BAYA 1IDZA 2Z9OA 5IOZA 5KCMA 5ERIA 1BR4A 4N9IA 3EETA 3ASNH 3GTJJ 1BOBA 3RPUD 1MGTA 3OYIA 4RGXA 5CQGA 2P6TA 1Y39A 1HW1A 2E1CA 5E8IA 1E0EA 2FEZA 2JRMA 3P9KA 2FXAA 4FASD 2HKXA 2GAUA 2JA7J 3IKTA 3G4SI 5CPRB 1SD4A 2XKOA 3CP2A 1FP2A 1ZHFA 4KITB 4AC0A 3IH2A 1ETVA 2DPUA 3JRDA 2M8GX 2R7SA 3GLXA 4E7LA 3FKJA 4ESFA 1V5EA 3BQZA 3VYSB 2XAHA 1QQIA 3DEWA 2RREA 2E5ZA 1WI3A 3KP7A 2KFDA 3M8JA 1S8NA 1SFKA 3MD2A 3SDGA 3F72A 2D5VA 4DYRA 3HC7A 2C6YA 1FSHA 3CQZJ 2DA7A 1YIOA 4IHYA 3DTKA 2LRDA 2VQHA 3DF8A 3DLAA 4EV0A 5FLXZ 1LQ1A 3OOUA 2FE3A 1X4PA 1RESA 2FBKA 4UB8C 1J2XA 4Y7NJ 3AG4H 3OYBA 3HOVJ 2VXZA 3MFKA 2Y30A 1P4WA 4CSWA 3GMEA 4A0XA 3JAMZ 1VQ5I 1Y6IA 5DCMA 4OIQF 2DU9A 1ON1A 2K9MA 1MBFA 1XTAA 4HBLA 2R5ZB 4HDUA 3I59A 3KP5A 4HA8A 3WE3A 3BCBA 1QHGA 1X1DA 2Z1DA 3GUDA 4IHXA 3F8BA 3V8LA 3I54A 4EM0B 3RPUA 3KX2A 1KU3A 3BROA 1T98A 4MEYF 4AM3A 3KP2A 3B02A 1N77A 5LHIA 5BMZA 5GTIC 3QPTA 2G7HA 4RLFA 2V26A 3ROUA 5FKMA 5HS7A 4I0AA 3KP3A 2Z99A 1KGSA 3HJEA 2L7ZA 2VJIA 3LWFA 3WE2A 3S1QJ 4KMUX 2QGUA 2ISZA 1HDPA 2ISYA 3VB2A 1XDUA 1GV2A 4CCNA 2QEXI 2ID6A 2BW3B 2HWVA 3GFIA 1V5FA 4PSXA 4HV5A 1LDKB 4AVZA 3QYFA 5IP7J 1BOAA 4KFCA 1SMTA 2OA4A 3G2BA 1BI2A 2X85A 3CUQB 3D5LA 1SFOJ 1S9HA 2G7UA 2PFBA 3DV8A 3HOTA 5L3EA 3I64A 3LSIA 3VFZA 1D3YA 3DQVC 4PFOA 4HPQA 4LD5A 3QPHA 4XKCA 4MTEA 3CDHA 3S1MJ 1OYIA 2UXXA 4B44A 3F8CA 2JVHA 2CU7A 1QZZA 3IAM2 1G6NA 1XB4A 3K2ZA 2K86A 4UVAA 2RVCA 3TDZC 1ZR2A 2ZO4A 4L9NA 3L2CA 4BJ5C 5BNGA 1JJ6C 2IS4A 2IBDA 3BQYA 2XUBA 2DQRA 3HM5A 4KN7X 1G3TA 4PDKA 1V4RA 4Y17A 4A0ZA 4D9JA 2LF8A 3OYFA 4E4HA 3JSPA 3A02A 4HNTA 3J7ZI 1QHHD 5F6FA 1Z1DA 4ZH4F 2QENA 5KAIC 1XMXA 4ZYHA 2VE8A 5KVRA 1J5YA 2GA1A 2P4WA 4CZCA 2VKHA 3AKZA 2GA2A 1MH4A 2LOOA 4QPQA 3PNVA 1ETKA 3MKYB 1U9NA 3OYGA 3QODA 2FMLA 4U87A 5KNLA 2FJ1A 1QPMA 2VBWA 3H0GJ 4ZC3A 1STZA 5DM7F 2L4AA 3BR1A 3MKWB 1IRGA 3DWLE 4ZYAA 3HKZN 5E3LA 5FLVA 1W5CC 2M2EA 2HPIA 5KAFC 1SD5A 2ZSHB 4BQNA 3TW6A 4YFNF 4OIRF 2CUEA 3LFKA 2HS5A 4HF1A 1YJNI 4F7ZA 4M73A 3BR3A 3T5XA 1VTNC 2JA5J 4F92B 2WV0A 2A68F 2YSRA 1X1BA 1ZTRA 2EH3A 4IEJA 2LMDA 3FXKA 1O3TA 5GADJ 1DGRM 3WTVC 3GTMJ 1R1VA 4IO9F 4KA4A 1XMAA 4BH9A 4XSZF 1TWHJ 4DOZA 2H94A 2XAUA 4AVPA 3OYMA 2EK5A 4C3IJ 2LC2A 2BZTA 3OV8A 4XKWA 3UKGA 4DQ2A 4OINF 4JBAA 1X1AA 3K4MA 4LFUA 2QM3A 4ZTFA 3JTHA 4P5OA 4OMYA 5DTDA 3PSIA 5KK1A 3BG9A 4BKXA 4QIWN 3PIOF 2EILH 4RM2A 3U9GA 2MLKA 5LGNA 2DLLA 2BYVE 4XLAA 3CC4I 2W4SA 3P7NA 3VPRA 1RNLA 1H8AC 2PN6A 2MBFA 3J7YJ 2L9NA 2V9PA 2PJPA 4NUBA 1TTYA 4ZDPA 3FXUA 4L0YB 4UUSB 2F4IA 4YIFA 1IN5A 3EUHC 3MMYB 3M8EA 2O7OA 2LKSA 2PMUA 3S32A 1IN8A 1FBUA 2VB6A 3V7CA 1MKMA 3VOEA 2UZKA 2KRCA 2VXDA 2V6EA 3HUGA 2R7XA 2EBIA 1GXQA 2RNJA 3ZR8X 2O61A 4E6KG 2HDWA 2XGEA 5GP9A 5K7HA 1A31A 1I6HJ 5LEJA 1OMIA 3ZPLA 2RV8A 2FBIA 3SDBA 2XROA 4ABZA 1OCRH 2KIQA 1G8XA 1SAXA 2QKLB 1ZR4A 3EYIA 2XB5A 4EJOA 2PLYA 1UHMA 4B3XA 4CUGA 4I2OA 4A3DJ 4BUPA 3DBLB 3HBLA 2RDPA 3S1RJ 2M45A 3SZPA 1VQ4I 5HLHA 3HRMA 3KEQA 1GT0C 4BDZA 3E6BA 4HOBA 2IGOA 4PGHA 1BJZA 2M7AA 3CUQC 1YE9A 2DMUA 1RUOA 1XGMA 2KZVA 5FKNA 3EDPA 1WGXA 2Q1ZB 3TO6A 2ZFUA 3DTEA 2GXBA 2P5LC 4CYCA 2Q2EB 1VNDA 4KICA 1G2HA 3F21A 3J7AO 3IV5A 5M3FJ 2MH2A 1UG2A 3IH4A 2M0MA 4N9HA 4IF4A 1VQPI 1G4DA 1UJ8A 2R92J 4IX7A 3M7GA 3J81Z 2ZFWA 1SVLA 2BEOA 1OJLA 6PAXA 3QP6A 5A2QZ 1VQOI 5IT9K 3RDIA 5J4VA 2HQNA 1JKRC 2HFHA 3LSKA 4A3IJ 2HXOA 3A0HC 3I56I 3CLOA 1T0FC 3GTPJ 1LB2A 3BC8A 3PQKA 3ULQB 4RGUA 3WGIA 2DMQA 4HLXA 2Y75A 4I98B 3HRSA 3DBRB 3CCRI 3QYBA 2A6HF 4M3FA 3OYHA 4BE2A 3K9TA 2XRLA 2L9SA 1ON2A 3S16J 1DDNA 3H36A 3RZDJ 4RB3C 4Q47A 3W2AA 2VKEA 3Q5FA 4A93J 1HKTA 5AONA 3L7WA 5LGTA 3O6BB 2DA6A 1TQIA 3LA3A 1L0OC 1I6XA 1ETQA 2ZBKA 5ILVA 5M5WJ 2JQ7A 1VQ7I 3ASOH 2EINH 1FOYA 2EZLA 4L5IA 1LDDA 1R1UA 1H9GA 3BY6A 4MTDA 1FOXA 5C4JJ 1VF9A 2L01A 2F5FA 1R00A 1GUUA 2V7FA 2IT0A 1FSEA 2F6CA 1NK2P 3KP4A 1FEXA 4A3EJ 4XNFA 1NHAA 1QBJA 2DYRH 4LB6B 1IV6A 3A1YA 1ZG1A 4LJZF 2CO5A 2H1KA 1K83J 3H3ZA 3HOSA 4CZZA 3CCMI 3LFUA 4NHJA 4GO1A 3CCVI 2QKMB 2OTLI 4M6VA 2IS1A 1A36A 2IGNA 4CGZA 4U88A 3W6VA 5IYDJ 5HLGA 4IHWA 2GZWA 2FF4A 2LG4A 4Y13A 4G8XA 3R0AA 4RAGA 4LOCA 2FA5A 1X2MA 2AQEA 2Y0MA 1UHSA 2XF6A 2ZNZA 4BHCA 1BC7C 1W0TA 1HOMA 2HTSA 1I39A 4O5VA 3HSFA 3VSLA 2BHYA 3W2WA 3VYTB 2KDOA 2AO9A 2M7BA 1SD6A 3BPVA 1ZREA 1OYWA 3CJTB 2VPLA 1TLHB 2OUMA 4RB1A 1D0YA 2F5EA 1DU6A 2QQ8A 3KYCB 4UHTA 1D0ZA 5H20A 2NYXA 2XKPA 1X2NA 2M30A 2HOEA 2KKOA 4PJLA 2B9SA 4QWQA 2E1OA 2W82A 2FBHA 2I10A 3OYKA 3BTCA 3FHNA 1YITI 3ZMTA 1R9TJ 1Z21A 4XKBA 4FETA 3G3ZA 3S1NJ 1HW5A 3HDDA 2DAOA 2VQLA 3LA2A 3M4OJ 3ECHA 3MWMA 4ESBA 1UFMA 2M8EA 4EJTA 3I4NJ 2HQAA 1U6GA 3A01A 2LH9A 1NG6A 3TP0A 3LSRA 5TRDA 4LITA 4M72A 4NQWB 2WAFA 1J7KA 4BU2A 1ZRDA 4Y3OA 2NNNA 3E6MA 2O9LA 1MW7A 1CF7A 4PSWA 3HL2A 4BBRJ 4RA2A 1OR7A 3H5NA 4ESJA 5GAHJ 3RTRA 5AIPA 3ZMUA 1MZBA 2DI3A 2EFQA 4F55A 5B1AH 2OCCH 2K3PA 3AG3H 3RSNA 2DMNA 3SQNA 4KMFA 4LGWA 1KA8A 3OS1A 5DS9A 2R7TA 2B63J 1BI0A 3LQRA 3S17J 4RAZA 1B9NA 4MNUA 1O7LA 1PUFB 3HOXJ 5J1RA 2KISA 2BW3A 4OAYA 1WH5A 1D5VA 1XD7A 5E20A 1U3EM 5D5VB 1OFCX 1E3OC 3K4JA 4UUTA 1POGA 2ZXHA 1L3LA 2DDAA 1SANA 2KPMA 2IJLA 2FQ3A 1JE8A 4HLYA 1B1BA 1QU3A 1T2KA 3ABTA 1LVAA 1YTYA 4UB6C 3KETA 2YPRA 2DN0A 4D7NA 4S05A 2QSFX 4HV6A 3FDYA 4AIKA 2EV0A 4CDGA 3IC7A 1D1BA 2LBFA 3F8FA 2OC6A 2XHKA 3SFZA 4ETSA 1DP7P 2QQ9A 5M5XJ 2WA0A 5B3SH 3OYAA 1ETYA 1D1AA 4C30A 3F3XA 1I1SA 3ZP5A 2PMZN 1FTTA 3WTXC 2YX7A 1TW3A 3IWFA 1IO2A 1UB9A 4YEJA 3BZ6A 3CCLI 3LSJA 4NC8A 2NS7A 2WY7Q 1SD7A 2K85A 1E17A 2NAZA 2V1XA 1WFXA 5B66C 3RIRA 5EZGA 3GTGJ 2B0LA 4J01A 1R4NB 3FF5A 2KHMA 3BTJA 2VT2A 5JVTA 4FTHA 1MMGA 1X19A 1LEBA 4P9UA 4RGSA 4KIFA 1OQYA 3BTIA 1K61A 2JUCA 1A6QA 5FRMA 3I53A 1WJDA 2GQQA 2NS0A 2IA1A 2KQRA 3C3WA 3GLLA 1AKHA 4N4NB 1PJRA 3OSFA 2ESHA 5M3MJ 4LG0B 3ZCOA 4CCOA 1VZ0A 3U21A 1BL0A 4U0VA 3M1EA 1MDMA 1IUYA 3IRQA 4J19A 2NOGA 3BWGA 3CZ6A 1PP7U 1FZPB 1U9OA 5FB2A 1YI2I 3H3VK 3FX3A 3K70C 1WVRA 3JW4A 2PQ8A 3KE2A 3AFHA 3LL7A 4LLGF 1U5TB 2YU3A 2ID3A 3CLQA 3Q0UA 5D8KB 4B43A 5HVQC 1OCTC 1R1TA 3AG1H 3REOA 1CGPA 2ZJPF 5J1YA 1QZEA 1FBQA 4M9SA 4ZZLA 2HI3A 4BNCA 3ZQIA 1R71A 2LTPA 1E2XA 4XN3A 4IOCF 1LE8B 1AOYA 4MO7A 3HG9A 5EJCA 1X3WB 3KP6A 1OCOH 3CMMA 3HOUJ 4F3QA 2H09A 4G6QA 3B73A 5D5WB 1LFBA 1ETWA 1Y1VJ 5HDNA 3DFGA 1P7JA 4ASNA 1MSFC 1E3PA 1KQ0A 2GOXB 2DBBA 4X6AJ 3AG2H 1HBXG 1UELB 4R8HA 5LLQA 4EGZA 4UXNA 4HSTA 2CQQA 4KIGA 2E60A 1W1WE 3SHFA 2JN6A 3HRTA 3I9V2 2DJIA 2VT3A 3NAUA 1R7JA 2R7UA 2DQLA 3CCYA 3ZQLA 3I5UA 2JJ7A 3ISPA 4NC7A 4YIRX 2BXYA 2XASA 3GZNB 1TP4A 4BE0A 1IRFA 1TT0A 1YIJI 2XGCA 4IQ4A 1KZHA 4JOMA 2L0KA 4A2UA 5FLXK 2BOLA 3TBIA 5CVVA 2DOEA 2JK3A 5EYRA 5EF6A 4II3A 3F9KA 2DOFA 2L54A 4P1WA 4UVCA 2MLGA 1ZARA 2LY2A 4L9JA 2CS3A 3JRGA 3JRHA 2E2HJ 1Z0XA 4R79A 2XSDC 2Y2ZA 3HOWJ 3JAMK 1JT6A 2QVOA 3I4PA 2A69F 3JRCA 2CWEA 4BEHB 1MMAA 5HLIA 3SJMA 4M9XA 2R7VA 4I01A 5JHFA 1GLNA 2M1BA 2LY1A 4LG3A 1U0JA 4HSRA 4PGGA 3BTLA 4UUVA 1FOWA 2WC2A 4HEA2 1USTA 2XVCA 2QBYA 2KRHA 2FX0A 2O03A 3B6CA 4NDLA 1BM9A 3KYLA 2ELHA 4CCMA 1RUNA 3F6OA 2HEOA 1T39A 1EH6A 1KU7A 2E2JJ 2BY1A 5DUKA 4BQOA 2D1VA 3BG5A 1XSXA 2COMA 2PI0A 2NNYA 2JPCA 2QQBA 2EZHA 1N78A 4L9VA 4WK8F 2XF5A 1JKPC 4M71A 4IHTA 2P5VA 3V8KA 3OY9A 2X6OA 3ZN1A 1UAAA 2DYSH 5EEHA 2A6TA 5ICGA 1AU7A 2HKOA 4EJVA 4F91B 2VOPA 1IRZA 4FX0A 1OKRA 3VYRB 2IS2A 1OCPA 3K70D 3HSRA 4E70A 4JQFA 4F93B 1MH3A 3DPUA 4WXHA 5EGOA 3WGHA 1AHDP 2IAIA 4E7SA 1WRJA 2M34A 5F27A 3BPXA 3GYHX 2R7ZJ 1KQ8A 2A6EF 2BVMA 2E19A 4RAYA 5J3LA 3F6VA 2E35A 3IH3A 1HDDC 2TRTA 2GIVA 5FRNA 2NVYJ 2YUSA 2JTVA 4MFEA 4ENNA 3G73A 4BBSJ 5F08A 2CFXA 3G1OA 3KYDB 4GCVA 1TT5B 1JHHA 2V79A 3E0JB 4N4OB 2CW8A 5DM6F 4M6YA 1QNTA 3E97A 4XLCA 4EEFG 5F0FA 4DYQA 4AYBN 2CQNA 1WKMA 2L7FP 2BHZA 5JFRA 2OJED 3D5RC 1H9TA 3WTSC 3FHZA 1U5TC 1DGWY 1ITYA 1B72B 4U0WA 3WG9A 2DCEA 4GYGA 3RKXA 3RCOA 1SFUA 1W0UA 3RI4A 2Y0SN 1YW7A 2E71A 2OCEA 1E3HA 2AXLA 3RKQA 2QSGX 1FJLA 1FT9A 2Q0OA 2VIXA 4AUXA 5B5EC 1JGGA 3BJ6A 2A5WA 3MZHA 1YX3A 4X0GA 1ZGAA 3NWTA 2WAQA 4LIUA 1YO5C 1H0MA 3HXLA 2AXTC 1UHWA 2RNGA 1F5TA 1JT0A 4DNCA 3GBGA 3Q9SA 3DU6A 2DA1A 2V1NA 1R5HA 4EM1A 4CICA 3DTIA 4BQQA 2Y48A 1IN7A 3L00A 2OTJI 1ONVA 4A12A 5BPIA 4L18B 2NXNB 3K4KA 1B8IB 2DPDA 4MHGA 1GVDA 1LDJA 2Z16A 5JVGF 2KL4A 3IWZA 3PL8A 4AIDA 4JX6A 2LD5A 4G9YA 2E2IJ 5JLWA 3CCEI 2XV4S 2M5WA 3R4KA 2VPRA 2MG4A 2XAJA 4PJ0C 4IZZA 1A5JA 5IP9J 4B3AA 3R6SA 1MD0A 3TP3A 3RZOJ 2EV6A 3LSPA 4IJAA 4M3GA 1WPKA 3ERED 2JA2A 1R23A 3EUKL 4LB5A 3WTTC 1HSTA 2CQKA 3HPHA 3DP7A 2EIMH 1HXDA 3J80Z 3CCSI 1ZG3A 4YG2F 3C1DA 1IN6A 1LUJB 4HZFA 4XORA 4UV9A 4JX4A 5EG0A 3PUBA 3V8JA 3E1SA 3EYYA 2ZJQF 4P9FA 1MMDA 1M1EB 2BXZA 2MYSA 2CMPA 2UXNA 1P4XA 2V1DA 3ABUA 4BE1A 3V7RA 4X1EA 2W48A 1GDTA 3K4BA 2M4KA 4KJZA 3LAPA 3ELKA 2ZMEC 1FP1D 3RYPA 1Z7UA 2L5QA 3BZKA 1GXPA 2ZB9A 2HOAA 3KEOA 3AL0C 1V54H 3SXYA 3O8GA 4MFDA 1MJ9A 1WJ5A 3HTUA 3ML6A 4CCLA 3EUAA 1XCBA 3OYJA 2EFWA 1USSA 2W00A 1RR8C 3U1KA 4O3MA 1WI9A 1YQAA 4V19K 5ILUA 1HA8A 4KT5C 3ZQHA 4BHPA 4HNUA 3CMYA 2GXAA 3OYDA 1R58A 3OYCA 2VOOA 1VQ8I 1F4KA 3HTSB 4I0BA 3IRRA 1I3AA 4XK4A 1YOVB 3GX4X 2Z3YA 1YHQI 4HAMA 1NG7A 1TZLA 2LVSA 2JT1A 3FWEA 4OAZA 4UV8A 2LSOA 3CMAI 3OIPA 1K6OA 1LKXA 1YRNB 3ABMH 2ZXIA 3VODA 5H6RA 1X4OA 1P7IA 2NS8A 3VDXA 2WBMA 5ED4A 3NQOA 3WTYC 3L2UA 3FZVA 2VBZA 3FM5A 5AIQA 5HOOA 3EQLF 4CA0A 2QUFA 3H5RA 1OCCH 2VJJA 3HZJA 1S7AA 2WTEA 3DKYA 4GRIA 4AWXB 2IEKA 1EA3A 3MVPA 4XRSG 1ZGWA 3HGYA 3R61A 1MIJA 3SEQA 4ENMA 1JHFA 1W36C 3J81K 2WB1N 3R60A 5E1ZB 3GTQJ 5FFXA 1DP3A 2K4BA 1G3SA 5IPAA 1RR7A 3WTUC 5A2QK 3C2BA 2MW8A 3WU2C 4HW0A 4FISA 2CV1A 4DW6A 2JSCA 3ABKH 4HRIA 1KYZA 3P5JA 3DLLF 1REPC 3ZRGA 2BBYA 3G71I 3IKVA 4WCGA 3CP8A 1PP8F 3L1PA 4DZPA 1OLTA 1FTZA 4HX4A 3FMRA 3FXOA 5DCMB 1SAUA 3S2HJ 1TW2A 1Z6TA 2VBYA 2P7VB 1D5YA 3MAJA 5EEAA 5EEGA 1FX7A 1G3WA 2X1CA 2ZNYA 2DK8A 1S5LC 3I59B 2QSHX 4MEXF 2JSPA 1MSEC 2OQRA 2IPQX 3A0BC 3DU5A 4ANJA 3E5QA 3S3OA 2V4JC 2L2OA 4AIHA 4Y52J 3ZXSA 2DFFA 3DKXA 3NARA 3F8MA 4G6TB 4E7ZA 2HZDA 5HS9A 5M5YJ 4IRGA 4BGDA 5DUIA 4H4KC 1ERDA 2IRFG 4KISA 1DQUA 3F0CA 2P81A 3H0DA 1Z9CA 4MQVA 4N0BA 3C7JA 4BS9A 3SEZA 5HODA 3X2QH 1IC8A 2PMHA 1FIAA 1OYYA 1YX5A 3TO9A 2X51A 4A0YA 2MFZA 2HPMA 4U7BA 3HKZA 2EB7A 2P0WA 3QOEA 3V4GA 2VQGA 3LA7A 4A5NA 1U8RA 3OR2C 3LNQA 3ZMVA 4AU7A 2OF7A 1BW6A 2W57A 3LSGA 2OU2A 2I8DA 2HYFA 1A35A 1HC8A 3QPSA 2CYYA 2PJRA 2VONA 2FRHA 2DK5A 2MGQA 1RKTA 2QQAA 3HYIA 2F4OB 2BGCA 3VWBA 3M8FA 1Y0UA 1HLVA 4KYWA 1TWFJ 3N05A 2KLOA 1WHUA 5HDGA 5E18F 1W5TA 1ZELA 2KIFA 1FNNA 4E7IA 5L3BA 1MMNA 1QRYA 2RQPA 1I27A 1HCRA 5GPCA 3K7AJ 4V2GA 4YELA 3MZYA 5CJ9A 4B8XA 5J6XA 2E34A 1K7AA 2KRFA 2BY0A 1JTYA 4BL0B 1ZG5A 4D5FA 3B6AA 3NRVA 3OIQA 1XGNA 5TJJA 3H92A 5F1JA 3S2WA 1FYLA 3M3YJ 2L7MP 4OOIA 1UZCA 4MIMA 2MC3A 5DDGA 3C2HA 1TQMA 1FWZA 3O2PE 2H6CA 2ZXJA 3BP8A 4XONA 4YIIA 3HHHA 4HDVA 4I09A 3GTKJ 1IUFA 3KLOA 4I02A 5L3FA 4GFBA 3PO3J 1Z05A 2X0LA 1RIOH 3RQ4A 4BY1J 1W36D 1XCVA 1O7FA 1JTXA 4FT8A 4XRFA 3CO6C 4XOPA 4CO8A 5L3GA 3IL2A 2DOAA 2K5CA 3O3KA 2F5CA 2XGDA 1T8IA 1WJFA 3QYEA 2XF7A 1V3FA 2YX4A 5E3MA 2O6GE 2XRNA 2W7NA 2ADUA 3BT9A 2DFEA 4U0YA 5K5RA 3MEXA 3KFWX 2HYJA 4D7MA 3WTWC 1XS9A 2VASA 2HVRA 2HVQA 2O3FA 5HLTA 3GFMA 1XSVA 3IP4B 2R5ZA 2XB0X 2DFHA 4PJNA 3CCQI 3EUHA 3FXMA 5FFZA 2LKXA 1MNEA 2RQQA 2P6SA 1PVEA 1TBXA 1X1PA 2MD0A 5CQEA 2GOMA 5HS8A 1WJBA 3RKWA 1B9MA 1MJBA 3RKYA 5FROA 3TW7A 3H9QA 4WX9A 3CCUI 4ON0A 1JUMA 1ODDA 1R22A 1ZAOA 2QCOA 2VJ5A 3DBHB 2H1LA 5DYMA 4M6XA 4TV7A 3FXQA 3BR5A 1XMKA 1IV8A 1YJ9I 1C0WA 4RB2C 3JCUC 4WXCA 1FMWA 2FD5A 5TGTA 4C9YA 3Q0VA 3SYTA 5E3OA 3CUQA 3HUGB 3OWTA 1MJAA 3FKIJ 5H6QA 1MBEA 3LSMA 2DA4A 1Z3XA 4WXDA 3LAJA 3BLYA 1OCZH 2O8KA 3HGGA 3W6JB 3BR2A 4R1HA 2GM4A 1SFEA 3I71A 5IYBJ 4CCJA 5E1WA 3TDUC 2NVXJ 2R7OA 1YS6A 1SEUA 4XR6A 1FIPA 2BY2A 4HG2A 3WODF 4RBOA 2XGXA 2UWMA 2DMPA 5CYVA 4IPAA 3H3UA 3GZ6A 2V6CA 1XPXA 2CJJA 1UG0A 3UR3C 4ITVA 5K1YA 2CSOA 3NWSA 3A03A 1PYVA 2ZJRF 4YFKF 4OWRB 1K78A 3I3LA 4HQEA 2HXIA 1EH7A 1W7PB 4KT6A 4PUSA 2R0QC 4RB0A 3K0LA 2R5YB 1LFPA 4C2MJ 1AWCA 2KT0A 3HOYJ 2B7EA 4AIJA 2XAGA 1P2FA 2QYOA 1ZLKA 1RETA 2E5NA 1Y1WJ 4KN4X 4B09A 1D8JA 2XPVA 1VQNI 5GTHC 2HQRA 4A69C 5J4YA 3BJAA 1HKSA 3TKYA 3TEDA 3FIWA 4D0PA 5C4XJ 3PQJA 3IHUA 2E7WA 3S15J 3QAHA 4C3HJ 1HW2A 3CC7I 2QF7A 5GAGJ 5FD5A 1VFCA 1ZH5A 1FC3A 3E5XA 1FBSA 3E6CC 4MQ9F 1X58A 3F22A 3GF2A 5C3EJ 2CGPA 1Y0NA 2VUMJ 4A3FJ 2LP0A 2HZTA 4DBRA 2ICWG 4XICA 1A04A 4BDYA 2FSWA 2STWA 2JMWA 4LLNA 1A6IA 4XRSA 3FBNB 2KJCA 3W2VA 1I1GA 1B59A 4G6DA 3CF5F 1BIAA 4A5MA 2GWRA 1VQKI 2AHQA 1JGSA 2K3FA 1Z67A 2G9WA 4EMSA 5F0HA 3P9CA 2ESNA 3W6KB 1KU2A 1NH3A 1LVKA 3WU1B 1YYVA 1BI3A 3ZOBA 2X1EA 3LOCA 1TC3C 2L9RA 5J8FA 2F5DA 3CO7C 1T33A 2HQ5A 4NB5A 3ZQGA 4A3CJ 3G1LA 3BR6A 2PBIA 3JREA 1O3QA 2HGCA 5D5UB 1IXSB 4XM3A 4Y33A 3L2RA 3PFIA 2DTZA 1BN5A 3WU0A 5JR3A 1JXSA 4ZZDA 1DUXC 4S0HB 4P96A 4HQMA 3LSHA 2DA5A 2CRGA 2BY3A 2YR2A 4ENKA 1EH8A 3FXRA 3PO2J 5D8LB 3WTZA 2ME6A 3GVAA 3OOPA 4FX4A 1MNMC 1WSUA 5FKOA 4BYYA 2M0CA 1SFXA 2FOWA 2AQFA 2K27A 3DXJF 3CUOA 4E7KA 3H35A 3L09A 2A61A 2JZYA 5D6EA 1ZK8A 2Y31A 5D4SA 4O6JA 2DMTA 3G1MA 1AA7A 3JTGA 2X1DA 5ICEA 1DPRA 4UUSA 3OS0A 1ACIA 4OIOF 5HNFA 2CG4A 2JVGA 3BR0A 1QGPA 4ZDOA 2VE9A 2K7LA 4YRVA 1FPQA 4RMNA 4Z2YA 4D5CA 4M9ZA 1S29A 2J5OA 1SMYF 2VKDA 4IL6C 1QVUA 4XL9A 2HDCA 5ICCA 4BACA 2COBA 4A3MJ 2VODA 3ZN0A 3FBIB 3J7AY 3ECOA 4BXFA 4GYIA 5LEKA 1I5ZA 1YRNA 3ABLH 1IJWC 4EGYA 4XBFA 1D0XA 2QZ8A 3QOPA 2NVTJ 2VN2A 4H0EA 4Y15A 4CCKA 4XN0A 3GW2A 3LQQA 4IHSA 2HOSA 5K7FA 2LFBA 1Z77A 4G12A 2WADA 1JKOC 1TQPA 4AD9A 2OZUA 4L0ZB 3BZCA 3MKLA 2K9NA 2ZMEB 1RC9A 1J59A 1EF4A 3AL0B 4IXAA 4QTRA 1F36A 1TWAJ 2P5KA 3K4CA 2DA2A 3QQAA 2Q2EA 3GCMA 4EM2A 4NNJA 2R7FA 2IXSA 1BI1A 3DPTA 3MZ8A 3KZIC 1ZN2A 3CD6I 2H6BA 2UUZA 2ELKA 1QA6A 2VC0A 1FLIA 2HNHA 2LLKA 3A01B 3R0JA 1MBKA 2MC4A 2CUJA 3LSTA 4JK1X 4M3DA 4B4CA 2EQRA 2O5RA 4HF0A 3ZQ7A 3MQ0A 3GWZA 3NEUA 3FK6A 5DV5A 1CF7B 2PMZA 3Q0WA 1T08B 5LFAA 3CJRB 5CVIA 1S6LA 1WJCA 1N75A 2GLOA 1FYMA 2MABA 3L2VA 3I4MJ 5J8CA 3G6EI 5CVJA 4L5EA 2IW5A 1IAWA 3SZGA 2W25A 2L3DA 3CDLA 1FY7A 4PK4A 5F64A 2V9VA 4FHTA 3A2KA 3IAS2 5L3CA 3FISA 4CXFA 1JI8A 3PUFA 4B47A 1I50J 3PNYA 1H88C 3JRIA 2IVMA 2HTJA 3GXOA 1Z91A 2CUFA 1J09A 4ZYDA 1KQ9A 2E1MC 2HVSA 4A6EA 3E6DA 2XPWA 4XRMA 1BIBA 3HRUA 1V55H 4C2UA 4RGRA 2LR8A 5CLSA 4V2FA 1PDNC 3KZYA 1F9NA 3DKWA 4IOAF 2X6WA 2XAFA 1KONA 2LNBA 3I55I 2CH0A 4UY8I 5IOYA 2BE5F 4DZJA 1O4XA 4A3GJ 1QPIA 2LBFB 1F43A 3M9AA 5FKKA 1ZGJA 2KMUA 2ZKZA 1JJ8C 2RGVA 5K7ZA 5ICFA 5EZHA 1K78B 2EA2A 4IRIA 3N97A 1IGNA 2XPUA 2STTA 1YG2A 2PG4A 2Z33A 1VQMI 2V9KA 3BOQA 2JRTA 2Z5UA 3MCZA 3PFYA 3E3VA 3PIPF 3S14J 5HDKA 4G7ZF 1ETOA 3JR9A 1HQCA 1TWCJ 2WV1A 3CJQB 1IXRC 3L2WA 1YJWI 3KEYA 1RPWA 2ETHA 1P92A 1QO0D 1D1CA 1P4AA 4DJAA 3CTAA 5D4RA 3P9IA 4F52A 2RN7A 2DT6A 2XDVA 2VC1A 2W1OA 4HX8A 2PX9A 4FE4A 1RRJA 3DEEA 1K4SA 1T38A 1MBJA 2NVQJ 1LPQA 2N8GA 2X4HA 4CHUA 3JRFA 2LYCA 4KNYA 2HYGD 2W85A 3TQNA 1HSJA 3J80K 4K2EA 2NRAC 1GHCA 4NBQA 5LRSA 2QWWA 1AKHB 1HF0A 2Y9YA 5J40A 4WF2A 3TOBA 4YFXF 1MDMB 1EJ9A 5BS6A 3LMMA 2JUGA 2O8XA 3CDIA 3T1BA 2RAEA 4OU0A 3DPLC 5EDNA 1U8BA 2EIKH 3S2DJ 1U78A 1B6AA 5CVRA 1J75A 1W7PD 4XLHA 5DD8A 2R7RA 3HOZJ 4I6ZA 2K40A 3S93A 2HOTA 2IP2A 3OYNA 4B1RA 5HNHA 1EKEA 4NQWA 1VQ6I 2NVUB 5FO5A 4OMZA 2AS5F 3C18A 2OAZA 1X3ZB 4LLLA 3EPZA 4BY7J 1MMSA 4L9TA 4IHVA 1LNWA 2M87A 3S8PA 5K5OA 1R6RA 4XIDA 4NC6A 1XG1A 3ZGKA 2OV7A 4DIQA 2KZGA 4A3BJ 2TCTA 4MLOA 3O8HA 2WWYA 1KYWA 2EFNA 5J47A 1F1ZA 3E5UA 1VQLI 2X48A 1HKQA 5GAEJ 1IXCA 1KU9A 1UCRA 2DW4A 2VQCA 3GFJA 3ZQCA 3BG6A 2NOJB 1XSDA 2D1HA 3ESWB 3H9GA 1G59A 1ZYRF 5LRRA 4GXOA 3GTLJ 1GV5A 1BBYA 2KIMA 1PUFA 1LJ9A 2FNPA 4W1UA 5E79C 2CW0F 1APLC 5JLXA 5JI6A 1W5SA 1SC7A 4DYCA 3OYEA 1WCMJ 3KCCA 2R3SA 1T6SA 1OISA 2DT7B 1OR7C 3QRFF 3GEZA 1Z6RA 1XC5A 3BG7A 2G0EA 1BJAA 2KJBA 4FQGA 1YW9A 2IA0A 3L2QA 4KDPA 1YW8A 1ZRCA 3U1DA 1H89C 4A3LJ 4P55A 4PJMA 1XX5A 5E1XA 5FKLA 3CMEI 1XN7A 3WGGA 1LEAA 1OPCA 1X3UA 3S3MA 1TWGJ 2JA8J 1JUSA 4XSXF 2YS9A 1S3JA 3N4MA 5BPDA 2Y69H 1CQTA 1IW7F 4EATA 2BVLA 2A07F 1W7PA 3FK7A 2LREA 2ELJA 3HSEA 3VYUB 3L9FA 2R5YA 3K4LA 4UVBA 5KHDA 3K10A 3WHBA 2QBYB 1PUEE 3BDDA 3CESA 4EJUA 3FMSA 2WY8Q 4LK0F 2D2WA 2D45A 3FXLA 2EZKA 2RKHA 2JWTA 4IVNA 2HR3A 1RZ4A 2F2EA 4AYBA 1TL8A 4JYKA 4E7JA 4EQQA 2DDBA 4FE7A 5J1UA 2ME0A 2H8WA 3D0SA 4OIPF 5LHGA 5CKTA 2GIZA 2JPBA 2Y0SA 3OL3A 4ZYGA 4ENJA 2FUG2 2R93J 4PJJA 4I99C 1K79A 3KZZA 4II2A 2R7WA 2EWNA 3E7LA 2HU9A 4BHBA 5K5QA 3T8TA 3H1CA 4LG0A 4Q5SF 2JA6J 2OD5A 5BQTA 4GGGA 2ECCA 5IT9Z 4BXXJ 1R5GA 4W97A 5EGOB 1YFHA 1ETXA 4XLPF 3OS2A 2FNAA 4Q4ZF 4HNVA 5TISC 3ZMSA 1U5TA 5GPAA 3OR1C 1G3YA 1IG7A 3OSGA 1Q1VA 1QZYA 5DCFA 1SVOA 1XGSA 1JKQC 3JSOA 4RS8A 1LE8A 2MSYA 3TMOA 1ENHA 4D1QA 3AAFA 3KIOA 1YS7A 4LMYA 3T0YA 1IF1A 1NTCA 3I0TA 3ONQA 2KDZA 4PCQA 5E3NA 2CV0A 5F04A 2MA3A 2M3AA 3T8RA 2L02A 3V42A 1WJAA 5FLMJ 2OZ6A 4EJWA 1V5GA 1Y56A 2I5UA 3S3NA 2UV1A 1MBHA 2LDUA 2XC7A 4A3JJ 2LF7A 4EVIA 1T95A 4FCYA 3TOAA 1Y8RB 2DODA 2ZSIB 1WWXA 1K4TA 2A05A 1YLFA 2XIGA 3Q3SA 4BXUA 3HEFA 2FQ4A 2GXGA 1ZRFA 5IT3A 4G94A 1Z7LA 2IGMA 3COAC 3K69A 2IA2A 5BOXA 2OPTA 1FOKA 1JUPA 1BR2A 3JRAA 2OQGA 4RDUA 3ZMZA 4ZJZA 3DEUA 4HYEA 3K1NA 1S7OA 2LY9A 5JHUA 3CC2I 2Z2SB 3F23A 1SVMA 1K6YA 5F0CA 3K1PA 2V1UA 3OMYA 4IQJA 2MD5A 4QSHA 4IKFA 2FU4A 3GFLA 2RC4A 2H27A 3ERMA 2J5PA
chains in the Genus database with same CATH topology
1TC3C 1ZR4A 2E19A 2L9RA 2XB5A 5J3LA 1T33A 2HQ5A 3ZQGA 1NK3P 4A3DJ 4A3CJ 3G1LA 3IH3A 3BR6A 1HDDC 2TRTA 2NVYJ 2YUSA 1MBGA 1ORKA 3HBLA 3JREA 3S1RJ 4MFEA 2DTZA 1GT0C 4BBSJ 5F08A 3G1OA 3JRBA 2H8RA 1BJZA 4S0HB 4A3KJ 2DMUA 2DA5A 2CRGA 5FKNA 4EEFG 5F0FA 4DYQA 1WGXA 4AYBN 2ECBA 3PO2J 2L7FP 2ME6A 1MNMC 5FKOA 2M0CA 1ITYA 4CYCA 1B72B 1VNDA 1G2HA 1W0UA 2EZIA 5EG0B 2Y0SN 3IV5A 2M9HA 1ZK8A 2Y31A 5M3FJ 5IP6A 3RKQA 1UG2A 1FJLA 3IH4A 2DMTA 3G1MA 4AUXA 1JGGA 2R92J 1OJLA 4UUSA 2VI6A 3D1NI 1JKRC 4A3IJ 2HXOA 1VI0A 3BR0A 1JT0A 3GTPJ 3GBGA 3DCFA 2DMQA 2DA3A 1UMQA 2DA1A 3GTOJ 1ZKGA 3HB9A 1B8IB 4D5CA 4M3FA 1GVDA 1QVUA 2COBA 5FJ8J 2XRLA 4A3MJ 4JX6A 2LD5A 3S16J 1RKWA 2E2IJ 5JLWA 5IYCJ 3RZDJ 1IJWC 1YRNA 2VPRA 2MG4A 2NVTJ 1A5JA 1I3QJ 5IP9J 4C3JJ 2VKEA 3MN2A 4B3AA 3TP3A 3BG3A 4A93J 3RZOJ 2HOSA 3LSPA 4M3GA 2DA6A 1WPKA 5K7FA 2LFBA 1Z77A 4G12A 2LK2A 1BW5A 1ETQA 1JKOC 4M3EA 5C44J 2HDDA 3MKLA 2VKVA 2Y9ZA 3OIOA 5M5WJ 2K9NA 1S7EA 4JP0A 1EF4A 4QTRA 1F36A 1TWAJ 2EZLA 2DA2A 3QQAA 1B72A 5C4JJ 1VF9A 4JX4A 5EG0A 1GUUA 3QPLA 4CYCB 2ELKA 1NK2P 1FEXA 4A3EJ 1GDTA 4X1EA 2W48A 2LLKA 2K9QA 1IV6A 3A01B 1MBKA 3K2AA 4B4CA 4M3DA 2EQRA 2H1KA 2ZB9A 1K83J 2HOAA 1BA5A 3FK6A 3O8GA 4MFDA 3Q0WA 2GLOA 4M6VA 1DU0A 5IYDJ 3W6VA 3CMYA 3ZQHA 3I4MJ 3PM1A 4IHWA 2DJNA 4L5EA 1B8IA 4LOCA 1X2MA 3CDLA 4XK4A 4I76A 2X9DA 1UHSA 2CQXA 1W0TA 1HOMA 3FISA 2LVSA 2AO9A 2K9SA 1I50J 1QVTA 1YRNB 1H88C 3JRIA 1P7IA 1DU6A 2CUFA 2NS8A 4JX5A 2XPWA 4XRMA 1X2NA 1ZQ3P 9ANTA 2LR8A 3WHCA 4V2FA 2E1OA 3RQIA 2IEKA 1IDYA 3MVPA 4XRSG 2I10A 1ZGWA 3HGYA 2GBYA 3BTCA 1LFUP 1R9TJ 3GTQJ 2WB1N 3SFIA 5IPAA 1RR7A 4M3BA 5IOYA 3ZQFA 4DZJA 3S1NJ 3C2BA 2MW8A 3HDDA 1O4XA 4A3GJ 4FISA 1WH7A 1QPIA 3M4OJ 4DW6A 1F43A 2WAQN 5FKKA 3I4NJ 3A01A 1JJ8C 2YU9J 1T56A 3TP0A 5K7ZA 3L1PA 3LSRA 5EZHA 4DZPA 1IDZA 1FTZA 1IGNA 5IOZA 2XPUA 3S2HJ 2O9LA 1D5YA 5EEAA 3GTJJ 4BBRJ 3S14J 1ETOA 3JR9A 1TWCJ 1MSEC 2WV1A 1RPWA 4Y52J 3NARA 2DMNA 5M5YJ 2JA7J 4FE4A 5DS9A 1MBJA 3F0CA 2B63J 2P81A 2NVQJ 3S17J 4AC0A 2N8GA 1PUFB 3IH2A 1ETVA 5J1RA 3JRDA 3JRFA 3HOXJ 2M8GX 1WH5A 5HODA 1IC8A 1FIAA 3BQZA 3DEWA 1OFCX 1E3OC 1AKHB 1WI3A 4UUTA 1HF0A 1POGA 2Y9YA 3SDGA 1SANA 2D5VA 4DYRA 3LNQA 2RAEA 2OF7A 1BW6A 3LSGA 3CQZJ 2DA7A 4IHYA 3QPSA 5EDNA 1U8BA 2DN0A 4D7NA 3S2DJ 3OOUA 2MGQA 1RKTA 1U78A 1RESA 3HOZJ 1HLVA 4Y7NJ 4I6ZA 1TWFJ 5M5XJ 2K40A 2HOTA 1ETYA 4B1RA 3HOVJ 2PMZN 2Y30A 1FTTA 1QRYA 1MBFA 2R5ZB 4BY7J 1HCRA 5GPCA 3K7AJ 4IHVA 4V2GA 3LSJA 4XIDA 2NS7A 1XG1A 4IHXA 4A3BJ 1JTYA 2TCTA 4MLOA 3O8HA 4D5FA 5EZGA 3GTGJ 2X48A 3B6AA 3ZQCA 3BTJA 5F1JA 4FTHA 3M3YJ 2L7MP 5FKMA 4MIMA 3GTLJ 1GV5A 1PUFA 3BTIA 4W1UA 1K61A 2L7ZA 3S1QJ 1HDPA 1APLC 5JLXA 1IUFA 3GTKJ 1GV2A 4DYCA 1WCMJ 2ID6A 1AKHA 4GFBA 3OSFA 3PO3J 5M3MJ 1XC5A 2G0EA 5IP7J 1BL0A 4BY1J 1JTXA 4J19A 2NOGA 1SFOJ 1H89C 1U9OA 4A3LJ 3H3VK 5FKLA 2XGDA 3S1MJ 2ID3A 3Q0UA 5E3MA 1TWGJ 3BT9A 1OCTC 1JUSA 2JA8J 2CU7A 2YS9A 5J1YA 2HI3A 2HYJA 3ZQIA 4D7MA 2LTPA 1LE8B 1XS9A 1CQTA 4MO7A 1ZR2A 3FK7A 5BNGA 2R5YA 1JJ6C 2IBDA 2R5ZA 3BQYA 2XB0X 3HM5A 3HOUJ 3WHBA 3A02A 2LKXA 1LFBA 1ETWA 1Y1VJ 2EZKA 1P7JA 2JWTA 1MSFC 4JYKA 4X6AJ 4FE7A 5J1UA 2ME0A 1MH4A 1ETKA 1U9NA 2CQQA 3TW7A 2JN6A 2R93J 2FJ1A 3NAUA 1JUMA 3H0GJ 3BR1A 3CCYA 3ZQLA 2QCOA 2JJ7A 3E7LA 3HKZN 5E3LA 5FLVA 3BR5A 2M2EA 2JA6J 2FD5A 2XGCA 2L0KA 3TW6A 3Q0VA 5E3OA 2CUEA 2ECCA 4BXXJ 2JK3A 5EYRA 3FKIJ 5EF6A 4W97A 1MBEA 5EGOB 2DA4A 1ETXA 3BR3A 2O8KA 3HGGA 4HNVA 3BR2A 2GM4A 3JRGA 5IYBJ 2E2HJ 3JRHA 2JA5J 1Z0XA 5GPAA 2XSDC 1IG7A 2Y2ZA 2NVXJ 3HOWJ 1FIPA 3OSGA 4RBOA 1Q1VA 1JT6A 1ZTRA 2DMPA 2EH3A 3JRCA 4IEJA 1JKQC 2CJJA 3SJMA 1LE8A 2MSYA 3GTMJ 1ENHA 3A03A 1TWHJ 2HXIA 3BTLA 1NTCA 4C3IJ 2R0QC 2KDZA 2R5YB 5E3NA 2FX0A 5F04A 4C2MJ 3B6CA 2KT0A 4NDLA 3UKGA 5FLMJ 3HOYJ 2E2JJ 1RETA 3BG5A 5DTDA 1Y1WJ 2XPVA 1MBHA 3BG9A 4BKXA 4A3JJ 4QIWN 4A69C 2EZHA 3TEDA 1JKPC 4FCYA 3FIWA 5C4XJ 3VPRA 1H8AC 3S15J 4C3HJ 2QF7A 1VFCA 2X6OA 3Q3SA 1X58A 4UUSB 3HEFA 5C3EJ 2FQ4A 1AU7A 2VUMJ 4A3FJ 2LP0A 2OPTA 4XICA 2O7OA 1JUPA 1IRZA 1OCPA 2JMWA 3JRAA 1A6IA 4XRSA 2EBIA 4RDUA 1MH3A 2XGEA 5GP9A 5K7HA 5EGOA 1I6HJ 1AHDP 2LY9A 2AHQA 2IAIA 5F0HA 5F0CA 4QSHA 2M34A 5F27A 4ABZA 3ZOBA 3LOCA 2R7ZJ
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1TC3 C;  1ZR4 A;  2E19 A;  2L9R A;  2XB5 A;  5J3L A;  1T33 A;  2HQ5 A;  3ZQG A;  1NK3 P;  4A3D J;  4A3C J;  3G1L A;  3IH3 A;  3BR6 A;  1HDD C;  2TRT A;  2NVY J;  2YUS A;  1MBG A;  1ORK A;  3HBL A;  3JRE A;  3S1R J;  4MFE A;  2DTZ A;  1GT0 C;  4BBS J;  5F08 A;  3G1O A;  3JRB A;  2H8R A;  1BJZ A;  4S0H B;  4A3K J;  2DMU A;  2DA5 A;  2CRG A;  5FKN A;  4EEF G;  5F0F A;  4DYQ A;  1WGX A;  4AYB N;  2ECB A;  3PO2 J;  2L7F P;  2ME6 A;  1MNM C;  5FKO A;  2M0C A;  1ITY A;  4CYC A;  1B72 B;  1VND A;  1G2H A;  1W0U A;  2EZI A;  5EG0 B;  2Y0S N;  3IV5 A;  2M9H A;  1ZK8 A;  2Y31 A;  5M3F J;  5IP6 A;  3RKQ A;  1UG2 A;  1FJL A;  3IH4 A;  2DMT A;  3G1M A;  4AUX A;  1JGG A;  2R92 J;  1OJL A;  4UUS A;  2VI6 A;  3D1N I;  1JKR C;  4A3I J;  2HXO A;  1VI0 A;  3BR0 A;  1JT0 A;  3GTP J;  3GBG A;  3DCF A;  2DMQ A;  2DA3 A;  1UMQ A;  2DA1 A;  3GTO J;  1ZKG A;  3HB9 A;  1B8I B;  4D5C A;  4M3F A;  1GVD A;  1QVU A;  2COB A;  5FJ8 J;  2XRL A;  4A3M J;  4JX6 A;  2LD5 A;  3S16 J;  1RKW A;  2E2I J;  5JLW A;  5IYC J;  3RZD J;  1IJW C;  1YRN A;  2VPR A;  2MG4 A;  2NVT J;  1A5J A;  1I3Q J;  5IP9 J;  4C3J J;  2VKE A;  3MN2 A;  4B3A A;  3TP3 A;  3BG3 A;  4A93 J;  3RZO J;  2HOS A;  3LSP A;  4M3G A;  2DA6 A;  1WPK A;  5K7F A;  2LFB A;  1Z77 A;  4G12 A;  2LK2 A;  1BW5 A;  1ETQ A;  1JKO C;  4M3E A;  5C44 J;  2HDD A;  3MKL A;  2VKV A;  2Y9Z A;  3OIO A;  5M5W J;  2K9N A;  1S7E A;  4JP0 A;  1EF4 A;  4QTR A;  1F36 A;  1TWA J;  2EZL A;  2DA2 A;  3QQA A;  1B72 A;  5C4J J;  1VF9 A;  4JX4 A;  5EG0 A;  1GUU A;  3QPL A;  4CYC B;  2ELK A;  1NK2 P;  1FEX A;  4A3E J;  1GDT A;  4X1E A;  2W48 A;  2LLK A;  2K9Q A;  1IV6 A;  3A01 B;  1MBK A;  3K2A A;  4B4C A;  4M3D A;  2EQR A;  2H1K A;  2ZB9 A;  1K83 J;  2HOA A;  1BA5 A;  3FK6 A;  3O8G A;  4MFD A;  3Q0W A;  2GLO A;  4M6V A;  1DU0 A;  5IYD J;  3W6V A;  3CMY A;  3ZQH A;  3I4M J;  3PM1 A;  4IHW A;  2DJN A;  4L5E A;  1B8I A;  4LOC A;  1X2M A;  3CDL A;  4XK4 A;  4I76 A;  2X9D A;  1UHS A;  2CQX A;  1W0T A;  1HOM A;  3FIS A;  2LVS A;  2AO9 A;  2K9S A;  1I50 J;  1QVT A;  1YRN B;  1H88 C;  3JRI A;  1P7I A;  1DU6 A;  2CUF A;  2NS8 A;  4JX5 A;  2XPW A;  4XRM A;  1X2N A;  1ZQ3 P;  9ANT A;  2LR8 A;  3WHC A;  4V2F A;  2E1O A;  3RQI A;  2IEK A;  1IDY A;  3MVP A;  4XRS G;  2I10 A;  1ZGW A;  3HGY A;  2GBY A;  3BTC A;  1LFU P;  1R9T J;  3GTQ J;  2WB1 N;  3SFI A;  5IPA A;  1RR7 A;  4M3B A;  5IOY A;  3ZQF A;  4DZJ A;  3S1N J;  3C2B A;  2MW8 A;  3HDD A;  1O4X A;  4A3G J;  4FIS A;  1WH7 A;  1QPI A;  3M4O J;  4DW6 A;  1F43 A;  2WAQ N;  5FKK A;  3I4N J;  3A01 A;  1JJ8 C;  2YU9 J;  1T56 A;  3TP0 A;  5K7Z A;  3L1P A;  3LSR A;  5EZH A;  4DZP A;  1IDZ A;  1FTZ A;  1IGN A;  5IOZ A;  2XPU A;  3S2H J;  2O9L A;  1D5Y A;  5EEA A;  3GTJ J;  4BBR J;  3S14 J;  1ETO A;  3JR9 A;  1TWC J;  1MSE C;  2WV1 A;  1RPW A;  4Y52 J;  3NAR A;  2DMN A;  5M5Y J;  2JA7 J;  4FE4 A;  5DS9 A;  1MBJ A;  3F0C A;  2B63 J;  2P81 A;  2NVQ J;  3S17 J;  4AC0 A;  2N8G A;  1PUF B;  3IH2 A;  1ETV A;  5J1R A;  3JRD A;  3JRF A;  3HOX J;  2M8G X;  1WH5 A;  5HOD A;  1IC8 A;  1FIA A;  3BQZ A;  3DEW A;  1OFC X;  1E3O C;  1AKH B;  1WI3 A;  4UUT A;  1HF0 A;  1POG A;  2Y9Y A;  3SDG A;  1SAN A;  2D5V A;  4DYR A;  3LNQ A;  2RAE A;  2OF7 A;  1BW6 A;  3LSG A;  3CQZ J;  2DA7 A;  4IHY A;  3QPS A;  5EDN A;  1U8B A;  2DN0 A;  4D7N A;  3S2D J;  3OOU A;  2MGQ A;  1RKT A;  1U78 A;  1RES A;  3HOZ J;  1HLV A;  4Y7N J;  4I6Z A;  1TWF J;  5M5X J;  2K40 A;  2HOT A;  1ETY A;  4B1R A;  3HOV J;  2PMZ N;  2Y30 A;  1FTT A;  1QRY A;  1MBF A;  2R5Z B;  4BY7 J;  1HCR A;  5GPC A;  3K7A J;  4IHV A;  4V2G A;  3LSJ A;  4XID A;  2NS7 A;  1XG1 A;  4IHX A;  4A3B J;  1JTY A;  2TCT A;  4MLO A;  3O8H A;  4D5F A;  5EZG A;  3GTG J;  2X48 A;  3B6A A;  3ZQC A;  3BTJ A;  5F1J A;  4FTH A;  3M3Y J;  2L7M P;  5FKM A;  4MIM A;  3GTL J;  1GV5 A;  1PUF A;  3BTI A;  4W1U A;  1K61 A;  2L7Z A;  3S1Q J;  1HDP A;  1APL C;  5JLX A;  1IUF A;  3GTK J;  1GV2 A;  4DYC A;  1WCM J;  2ID6 A;  1AKH A;  4GFB A;  3OSF A;  3PO3 J;  5M3M J;  1XC5 A;  2G0E A;  5IP7 J;  1BL0 A;  4BY1 J;  1JTX A;  4J19 A;  2NOG A;  1SFO J;  1H89 C;  1U9O A;  4A3L J;  3H3V K;  5FKL A;  2XGD A;  3S1M J;  2ID3 A;  3Q0U A;  5E3M A;  1TWG J;  3BT9 A;  1OCT C;  1JUS A;  2JA8 J;  2CU7 A;  2YS9 A;  5J1Y A;  2HI3 A;  2HYJ A;  3ZQI A;  4D7M A;  2LTP A;  1LE8 B;  1XS9 A;  1CQT A;  4MO7 A;  1ZR2 A;  3FK7 A;  5BNG A;  2R5Y A;  1JJ6 C;  2IBD A;  2R5Z A;  3BQY A;  2XB0 X;  3HM5 A;  3HOU J;  3WHB A;  3A02 A;  2LKX A;  1LFB A;  1ETW A;  1Y1V J;  2EZK A;  1P7J A;  2JWT A;  1MSF C;  4JYK A;  4X6A J;  4FE7 A;  5J1U A;  2ME0 A;  1MH4 A;  1ETK A;  1U9N A;  2CQQ A;  3TW7 A;  2JN6 A;  2R93 J;  2FJ1 A;  3NAU A;  1JUM A;  3H0G J;  3BR1 A;  3CCY A;  3ZQL A;  2QCO A;  2JJ7 A;  3E7L A;  3HKZ N;  5E3L A;  5FLV A;  3BR5 A;  2M2E A;  2JA6 J;  2FD5 A;  2XGC A;  2L0K A;  3TW6 A;  3Q0V A;  5E3O A;  2CUE A;  2ECC A;  4BXX J;  2JK3 A;  5EYR A;  3FKI J;  5EF6 A;  4W97 A;  1MBE A;  5EGO B;  2DA4 A;  1ETX A;  3BR3 A;  2O8K A;  3HGG A;  4HNV A;  3BR2 A;  2GM4 A;  3JRG A;  5IYB J;  2E2H J;  3JRH A;  2JA5 J;  1Z0X A;  5GPA A;  2XSD C;  1IG7 A;  2Y2Z A;  2NVX J;  3HOW J;  1FIP A;  3OSG A;  4RBO A;  1Q1V A;  1JT6 A;  1ZTR A;  2DMP A;  2EH3 A;  3JRC A;  4IEJ A;  1JKQ C;  2CJJ A;  3SJM A;  1LE8 A;  2MSY A;  3GTM J;  1ENH A;  3A03 A;  1TWH J;  2HXI A;  3BTL A;  1NTC A;  4C3I J;  2R0Q C;  2KDZ A;  2R5Y B;  5E3N A;  2FX0 A;  5F04 A;  4C2M J;  3B6C A;  2KT0 A;  4NDL A;  3UKG A;  5FLM J;  3HOY J;  2E2J J;  1RET A;  3BG5 A;  5DTD A;  1Y1W J;  2XPV A;  1MBH A;  3BG9 A;  4BKX A;  4A3J J;  4QIW N;  4A69 C;  2EZH A;  3TED A;  1JKP C;  4FCY A;  3FIW A;  5C4X J;  3VPR A;  1H8A C;  3S15 J;  4C3H J;  2QF7 A;  1VFC A;  2X6O A;  3Q3S A;  1X58 A;  4UUS B;  3HEF A;  5C3E J;  2FQ4 A;  1AU7 A;  2VUM J;  4A3F J;  2LP0 A;  2OPT A;  4XIC A;  2O7O A;  1JUP A;  1IRZ A;  1OCP A;  2JMW A;  3JRA A;  1A6I A;  4XRS A;  2EBI A;  4RDU A;  1MH3 A;  2XGE A;  5GP9 A;  5K7H A;  5EGO A;  1I6H J;  1AHD P;  2LY9 A;  2AHQ A;  2IAI A;  5F0H A;  5F0C A;  4QSH A;  2M34 A;  5F27 A;  4ABZ A;  3ZOB A;  3LOC A;  2R7Z J; 
#chains in the Genus database with same CATH topology
 4U7D A;  3KPH A;  2Q8K A;  4BEH A;  3IUO A;  1NK3 P;  3KLN A;  4UNO A;  5LBQ A;  1GVJ A;  2A5Y B;  3K6G A;  4LIV A;  1WZ2 A;  1MBG A;  1ORK A;  3D5S C;  3OL4 A;  2BV6 A;  2ZC2 A;  5L3D A;  2ZME A;  3JRB A;  2H8R A;  3M1C A;  4Q48 A;  4A3K J;  2W24 A;  3I58 A;  1X1C A;  2ECB A;  2EFP A;  2X6X A;  4CH7 A;  2PEX A;  5DEQ A;  2KP6 A;  4S04 A;  4BJ6 C;  3PJR A;  2XSJ C;  3FMQ A;  5F1R A;  4Z6Y A;  2EZI A;  2F5V A;  1D8K A;  5EG0 B;  2CFO A;  2M9H A;  3CCJ I;  5IP6 A;  2WB1 A;  2K02 A;  5FGM A;  2O0Y A;  2FMY A;  4LK1 F;  1TNT A;  1IRX A;  3C2G A;  3PSF A;  5ILS A;  2IGK A;  1Y8Q B;  2K4J A;  2DTR A;  2VI6 A;  1FYK A;  1EV7 A;  3D1N I;  1ULY A;  4RAF A;  5E17 F;  4XLF A;  1VI0 A;  4PFP A;  2MH9 A;  2R7Q A;  2DO7 A;  2F4M B;  3DCF A;  4C2T A;  2FOK A;  2DA3 A;  1UMQ A;  2ZJ2 A;  3FM3 A;  3GTO J;  3RPQ A;  4G7H F;  1ZKG A;  3HB9 A;  5LGU A;  1DPU A;  4WWC A;  2VL8 A;  4E7H A;  2W84 A;  2X6Y A;  3CF2 A;  3GO5 A;  4BQA A;  1IN4 A;  5FJ8 J;  4XKV A;  1Q1H A;  2L7K A;  3SZT A;  1RKW A;  4J00 A;  3TL4 X;  5IYC J;  3HPG A;  4XMY A;  1I3Q J;  4C3J J;  3MN2 A;  2CQ7 A;  1RI7 A;  2QLZ A;  3BG3 A;  4I7H A;  2CW7 A;  1S72 I;  1J9I A;  1VQ9 I;  5CVU A;  1BW5 A;  2LK2 A;  1XDS A;  1BR1 A;  4M3E A;  4XOT A;  5C44 J;  2HDD A;  2EV5 A;  2VKV A;  2Y9Z A;  3OIO A;  5E8G A;  3WG7 H;  4GDF A;  1W4M A;  4KUM A;  1S7E A;  4JP0 A;  1O57 A;  3HHG A;  3HIF A;  1BC8 C;  2KIU A;  1IZ1 A;  1T0F A;  1B72 A;  5FD6 A;  3PNT A;  2EA4 A;  3QPL A;  4CYC B;  1N25 A;  1FMV A;  3FXJ A;  3F8N A;  5D5X B;  2E36 A;  5LHH A;  2EIJ H;  4Y4R A;  1P6R A;  2LKP A;  3UNG C;  4HF2 A;  1R49 A;  4B48 A;  4RLQ A;  1WJE A;  2K9Q A;  3ZMD A;  2M4G A;  2ZXW H;  2F48 A;  3K2A A;  1ZLJ A;  3QWL A;  3Q9V A;  4QPO A;  4A6D A;  1BA5 A;  3K1M A;  4ZYE A;  2R7D A;  4PZJ A;  3H9J A;  3RJP A;  5B1B H;  1WQ2 A;  4HX7 A;  2VBX A;  4L5J A;  4CYD A;  2EJR A;  3W3C A;  2E1M B;  2EPF A;  1P9Q C;  1DU0 A;  3H5A A;  4ZTJ A;  3PM1 A;  4KIB A;  2DJN A;  1B8I A;  2OBP A;  2EFO A;  2DT5 A;  3K4N A;  4BJT A;  2E1N A;  2WAE A;  2K9L A;  2R4G A;  4I76 A;  4ZDL A;  2X9D A;  2DFI A;  2CQX A;  1O3S A;  4M74 A;  3TGN A;  1Z3Y A;  3ZQQ A;  3QU6 A;  3BJO A;  2K9S A;  2CUZ A;  4QLC U;  1QVT A;  2IS6 A;  1R36 A;  5IY5 H;  1R4M B;  4XQF A;  3QU3 A;  4JX5 A;  2A3S A;  2E7X A;  3VEP A;  2VLA A;  2ACJ A;  1XGO A;  5LD2 C;  1U2W A;  4XLN F;  1ZQ3 P;  4XLE A;  2CV2 A;  9ANT A;  4DBQ A;  2P7C B;  1B4A A;  3WHC A;  4DGW B;  2ZCW A;  3VSK A;  1O3R A;  3TO7 A;  3RQI A;  4RM3 A;  5D6F A;  1R5I D;  1IDY A;  3CJN A;  3QP5 A;  2VJ4 A;  3U2R A;  3V7S A;  3A4C A;  2L4M A;  2GBY A;  5H2F C;  5DD4 A;  1LFU P;  2DXI A;  3M07 A;  2TDX A;  3RYR A;  2PJR B;  3SFI A;  3OYL A;  1MND A;  2L9V A;  1J0R A;  4M3B A;  3ZQF A;  2P8T A;  2XAQ A;  3MKZ A;  1WH7 A;  3GZ5 A;  4MGR A;  4G7O F;  2WAQ N;  2QA4 I;  1TNS A;  4IRH A;  3BCA A;  2YU9 J;  1T56 A;  4BAY A;  1IDZ A;  2Z9O A;  5IOZ A;  5KCM A;  5ERI A;  1BR4 A;  4N9I A;  3EET A;  3ASN H;  3GTJ J;  1BOB A;  3RPU D;  1MGT A;  3OYI A;  4RGX A;  5CQG A;  2P6T A;  1Y39 A;  1HW1 A;  2E1C A;  5E8I A;  1E0E A;  2FEZ A;  2JRM A;  3P9K A;  2FXA A;  4FAS D;  2HKX A;  2GAU A;  2JA7 J;  3IKT A;  3G4S I;  5CPR B;  1SD4 A;  2XKO A;  3CP2 A;  1FP2 A;  1ZHF A;  4KIT B;  4AC0 A;  3IH2 A;  1ETV A;  2DPU A;  3JRD A;  2M8G X;  2R7S A;  3GLX A;  4E7L A;  3FKJ A;  4ESF A;  1V5E A;  3BQZ A;  3VYS B;  2XAH A;  1QQI A;  3DEW A;  2RRE A;  2E5Z A;  1WI3 A;  3KP7 A;  2KFD A;  3M8J A;  1S8N A;  1SFK A;  3MD2 A;  3SDG A;  3F72 A;  2D5V A;  4DYR A;  3HC7 A;  2C6Y A;  1FSH A;  3CQZ J;  2DA7 A;  1YIO A;  4IHY A;  3DTK A;  2LRD A;  2VQH A;  3DF8 A;  3DLA A;  4EV0 A;  5FLX Z;  1LQ1 A;  3OOU A;  2FE3 A;  1X4P A;  1RES A;  2FBK A;  4UB8 C;  1J2X A;  4Y7N J;  3AG4 H;  3OYB A;  3HOV J;  2VXZ A;  3MFK A;  2Y30 A;  1P4W A;  4CSW A;  3GME A;  4A0X A;  3JAM Z;  1VQ5 I;  1Y6I A;  5DCM A;  4OIQ F;  2DU9 A;  1ON1 A;  2K9M A;  1MBF A;  1XTA A;  4HBL A;  2R5Z B;  4HDU A;  3I59 A;  3KP5 A;  4HA8 A;  3WE3 A;  3BCB A;  1QHG A;  1X1D A;  2Z1D A;  3GUD A;  4IHX A;  3F8B A;  3V8L A;  3I54 A;  4EM0 B;  3RPU A;  3KX2 A;  1KU3 A;  3BRO A;  1T98 A;  4MEY F;  4AM3 A;  3KP2 A;  3B02 A;  1N77 A;  5LHI A;  5BMZ A;  5GTI C;  3QPT A;  2G7H A;  4RLF A;  2V26 A;  3ROU A;  5FKM A;  5HS7 A;  4I0A A;  3KP3 A;  2Z99 A;  1KGS A;  3HJE A;  2L7Z A;  2VJI A;  3LWF A;  3WE2 A;  3S1Q J;  4KMU X;  2QGU A;  2ISZ A;  1HDP A;  2ISY A;  3VB2 A;  1XDU A;  1GV2 A;  4CCN A;  2QEX I;  2ID6 A;  2BW3 B;  2HWV A;  3GFI A;  1V5F A;  4PSX A;  4HV5 A;  1LDK B;  4AVZ A;  3QYF A;  5IP7 J;  1BOA A;  4KFC A;  1SMT A;  2OA4 A;  3G2B A;  1BI2 A;  2X85 A;  3CUQ B;  3D5L A;  1SFO J;  1S9H A;  2G7U A;  2PFB A;  3DV8 A;  3HOT A;  5L3E A;  3I64 A;  3LSI A;  3VFZ A;  1D3Y A;  3DQV C;  4PFO A;  4HPQ A;  4LD5 A;  3QPH A;  4XKC A;  4MTE A;  3CDH A;  3S1M J;  1OYI A;  2UXX A;  4B44 A;  3F8C A;  2JVH A;  2CU7 A;  1QZZ A;  3IAM 2;  1G6N A;  1XB4 A;  3K2Z A;  2K86 A;  4UVA A;  2RVC A;  3TDZ C;  1ZR2 A;  2ZO4 A;  4L9N A;  3L2C A;  4BJ5 C;  5BNG A;  1JJ6 C;  2IS4 A;  2IBD A;  3BQY A;  2XUB A;  2DQR A;  3HM5 A;  4KN7 X;  1G3T A;  4PDK A;  1V4R A;  4Y17 A;  4A0Z A;  4D9J A;  2LF8 A;  3OYF A;  4E4H A;  3JSP A;  3A02 A;  4HNT A;  3J7Z I;  1QHH D;  5F6F A;  1Z1D A;  4ZH4 F;  2QEN A;  5KAI C;  1XMX A;  4ZYH A;  2VE8 A;  5KVR A;  1J5Y A;  2GA1 A;  2P4W A;  4CZC A;  2VKH A;  3AKZ A;  2GA2 A;  1MH4 A;  2LOO A;  4QPQ A;  3PNV A;  1ETK A;  3MKY B;  1U9N A;  3OYG A;  3QOD A;  2FML A;  4U87 A;  5KNL A;  2FJ1 A;  1QPM A;  2VBW A;  3H0G J;  4ZC3 A;  1STZ A;  5DM7 F;  2L4A A;  3BR1 A;  3MKW B;  1IRG A;  3DWL E;  4ZYA A;  3HKZ N;  5E3L A;  5FLV A;  1W5C C;  2M2E A;  2HPI A;  5KAF C;  1SD5 A;  2ZSH B;  4BQN A;  3TW6 A;  4YFN F;  4OIR F;  2CUE A;  3LFK A;  2HS5 A;  4HF1 A;  1YJN I;  4F7Z A;  4M73 A;  3BR3 A;  3T5X A;  1VTN C;  2JA5 J;  4F92 B;  2WV0 A;  2A68 F;  2YSR A;  1X1B A;  1ZTR A;  2EH3 A;  4IEJ A;  2LMD A;  3FXK A;  1O3T A;  5GAD J;  1DGR M;  3WTV C;  3GTM J;  1R1V A;  4IO9 F;  4KA4 A;  1XMA A;  4BH9 A;  4XSZ F;  1TWH J;  4DOZ A;  2H94 A;  2XAU A;  4AVP A;  3OYM A;  2EK5 A;  4C3I J;  2LC2 A;  2BZT A;  3OV8 A;  4XKW A;  3UKG A;  4DQ2 A;  4OIN F;  4JBA A;  1X1A A;  3K4M A;  4LFU A;  2QM3 A;  4ZTF A;  3JTH A;  4P5O A;  4OMY A;  5DTD A;  3PSI A;  5KK1 A;  3BG9 A;  4BKX A;  4QIW N;  3PIO F;  2EIL H;  4RM2 A;  3U9G A;  2MLK A;  5LGN A;  2DLL A;  2BYV E;  4XLA A;  3CC4 I;  2W4S A;  3P7N A;  3VPR A;  1RNL A;  1H8A C;  2PN6 A;  2MBF A;  3J7Y J;  2L9N A;  2V9P A;  2PJP A;  4NUB A;  1TTY A;  4ZDP A;  3FXU A;  4L0Y B;  4UUS B;  2F4I A;  4YIF A;  1IN5 A;  3EUH C;  3MMY B;  3M8E A;  2O7O A;  2LKS A;  2PMU A;  3S32 A;  1IN8 A;  1FBU A;  2VB6 A;  3V7C A;  1MKM A;  3VOE A;  2UZK A;  2KRC A;  2VXD A;  2V6E A;  3HUG A;  2R7X A;  2EBI A;  1GXQ A;  2RNJ A;  3ZR8 X;  2O61 A;  4E6K G;  2HDW A;  2XGE A;  5GP9 A;  5K7H A;  1A31 A;  1I6H J;  5LEJ A;  1OMI A;  3ZPL A;  2RV8 A;  2FBI A;  3SDB A;  2XRO A;  4ABZ A;  1OCR H;  2KIQ A;  1G8X A;  1SAX A;  2QKL B;  1ZR4 A;  3EYI A;  2XB5 A;  4EJO A;  2PLY A;  1UHM A;  4B3X A;  4CUG A;  4I2O A;  4A3D J;  4BUP A;  3DBL B;  3HBL A;  2RDP A;  3S1R J;  2M45 A;  3SZP A;  1VQ4 I;  5HLH A;  3HRM A;  3KEQ A;  1GT0 C;  4BDZ A;  3E6B A;  4HOB A;  2IGO A;  4PGH A;  1BJZ A;  2M7A A;  3CUQ C;  1YE9 A;  2DMU A;  1RUO A;  1XGM A;  2KZV A;  5FKN A;  3EDP A;  1WGX A;  2Q1Z B;  3TO6 A;  2ZFU A;  3DTE A;  2GXB A;  2P5L C;  4CYC A;  2Q2E B;  1VND A;  4KIC A;  1G2H A;  3F21 A;  3J7A O;  3IV5 A;  5M3F J;  2MH2 A;  1UG2 A;  3IH4 A;  2M0M A;  4N9H A;  4IF4 A;  1VQP I;  1G4D A;  1UJ8 A;  2R92 J;  4IX7 A;  3M7G A;  3J81 Z;  2ZFW A;  1SVL A;  2BEO A;  1OJL A;  6PAX A;  3QP6 A;  5A2Q Z;  1VQO I;  5IT9 K;  3RDI A;  5J4V A;  2HQN A;  1JKR C;  2HFH A;  3LSK A;  4A3I J;  2HXO A;  3A0H C;  3I56 I;  3CLO A;  1T0F C;  3GTP J;  1LB2 A;  3BC8 A;  3PQK A;  3ULQ B;  4RGU A;  3WGI A;  2DMQ A;  4HLX A;  2Y75 A;  4I98 B;  3HRS A;  3DBR B;  3CCR I;  3QYB A;  2A6H F;  4M3F A;  3OYH A;  4BE2 A;  3K9T A;  2XRL A;  2L9S A;  1ON2 A;  3S16 J;  1DDN A;  3H36 A;  3RZD J;  4RB3 C;  4Q47 A;  3W2A A;  2VKE A;  3Q5F A;  4A93 J;  1HKT A;  5AON A;  3L7W A;  5LGT A;  3O6B B;  2DA6 A;  1TQI A;  3LA3 A;  1L0O C;  1I6X A;  1ETQ A;  2ZBK A;  5ILV A;  5M5W J;  2JQ7 A;  1VQ7 I;  3ASO H;  2EIN H;  1FOY A;  2EZL A;  4L5I A;  1LDD A;  1R1U A;  1H9G A;  3BY6 A;  4MTD A;  1FOX A;  5C4J J;  1VF9 A;  2L01 A;  2F5F A;  1R00 A;  1GUU A;  2V7F A;  2IT0 A;  1FSE A;  2F6C A;  1NK2 P;  3KP4 A;  1FEX A;  4A3E J;  4XNF A;  1NHA A;  1QBJ A;  2DYR H;  4LB6 B;  1IV6 A;  3A1Y A;  1ZG1 A;  4LJZ F;  2CO5 A;  2H1K A;  1K83 J;  3H3Z A;  3HOS A;  4CZZ A;  3CCM I;  3LFU A;  4NHJ A;  4GO1 A;  3CCV I;  2QKM B;  2OTL I;  4M6V A;  2IS1 A;  1A36 A;  2IGN A;  4CGZ A;  4U88 A;  3W6V A;  5IYD J;  5HLG A;  4IHW A;  2GZW A;  2FF4 A;  2LG4 A;  4Y13 A;  4G8X A;  3R0A A;  4RAG A;  4LOC A;  2FA5 A;  1X2M A;  2AQE A;  2Y0M A;  1UHS A;  2XF6 A;  2ZNZ A;  4BHC A;  1BC7 C;  1W0T A;  1HOM A;  2HTS A;  1I39 A;  4O5V A;  3HSF A;  3VSL A;  2BHY A;  3W2W A;  3VYT B;  2KDO A;  2AO9 A;  2M7B A;  1SD6 A;  3BPV A;  1ZRE A;  1OYW A;  3CJT B;  2VPL A;  1TLH B;  2OUM A;  4RB1 A;  1D0Y A;  2F5E A;  1DU6 A;  2QQ8 A;  3KYC B;  4UHT A;  1D0Z A;  5H20 A;  2NYX A;  2XKP A;  1X2N A;  2M30 A;  2HOE A;  2KKO A;  4PJL A;  2B9S A;  4QWQ A;  2E1O A;  2W82 A;  2FBH A;  2I10 A;  3OYK A;  3BTC A;  3FHN A;  1YIT I;  3ZMT A;  1R9T J;  1Z21 A;  4XKB A;  4FET A;  3G3Z A;  3S1N J;  1HW5 A;  3HDD A;  2DAO A;  2VQL A;  3LA2 A;  3M4O J;  3ECH A;  3MWM A;  4ESB A;  1UFM A;  2M8E A;  4EJT A;  3I4N J;  2HQA A;  1U6G A;  3A01 A;  2LH9 A;  1NG6 A;  3TP0 A;  3LSR A;  5TRD A;  4LIT A;  4M72 A;  4NQW B;  2WAF A;  1J7K A;  4BU2 A;  1ZRD A;  4Y3O A;  2NNN A;  3E6M A;  2O9L A;  1MW7 A;  1CF7 A;  4PSW A;  3HL2 A;  4BBR J;  4RA2 A;  1OR7 A;  3H5N A;  4ESJ A;  5GAH J;  3RTR A;  5AIP A;  3ZMU A;  1MZB A;  2DI3 A;  2EFQ A;  4F55 A;  5B1A H;  2OCC H;  2K3P A;  3AG3 H;  3RSN A;  2DMN A;  3SQN A;  4KMF A;  4LGW A;  1KA8 A;  3OS1 A;  5DS9 A;  2R7T A;  2B63 J;  1BI0 A;  3LQR A;  3S17 J;  4RAZ A;  1B9N A;  4MNU A;  1O7L A;  1PUF B;  3HOX J;  5J1R A;  2KIS A;  2BW3 A;  4OAY A;  1WH5 A;  1D5V A;  1XD7 A;  5E20 A;  1U3E M;  5D5V B;  1OFC X;  1E3O C;  3K4J A;  4UUT A;  1POG A;  2ZXH A;  1L3L A;  2DDA A;  1SAN A;  2KPM A;  2IJL A;  2FQ3 A;  1JE8 A;  4HLY A;  1B1B A;  1QU3 A;  1T2K A;  3ABT A;  1LVA A;  1YTY A;  4UB6 C;  3KET A;  2YPR A;  2DN0 A;  4D7N A;  4S05 A;  2QSF X;  4HV6 A;  3FDY A;  4AIK A;  2EV0 A;  4CDG A;  3IC7 A;  1D1B A;  2LBF A;  3F8F A;  2OC6 A;  2XHK A;  3SFZ A;  4ETS A;  1DP7 P;  2QQ9 A;  5M5X J;  2WA0 A;  5B3S H;  3OYA A;  1ETY A;  1D1A A;  4C30 A;  3F3X A;  1I1S A;  3ZP5 A;  2PMZ N;  1FTT A;  3WTX C;  2YX7 A;  1TW3 A;  3IWF A;  1IO2 A;  1UB9 A;  4YEJ A;  3BZ6 A;  3CCL I;  3LSJ A;  4NC8 A;  2NS7 A;  2WY7 Q;  1SD7 A;  2K85 A;  1E17 A;  2NAZ A;  2V1X A;  1WFX A;  5B66 C;  3RIR A;  5EZG A;  3GTG J;  2B0L A;  4J01 A;  1R4N B;  3FF5 A;  2KHM A;  3BTJ A;  2VT2 A;  5JVT A;  4FTH A;  1MMG A;  1X19 A;  1LEB A;  4P9U A;  4RGS A;  4KIF A;  1OQY A;  3BTI A;  1K61 A;  2JUC A;  1A6Q A;  5FRM A;  3I53 A;  1WJD A;  2GQQ A;  2NS0 A;  2IA1 A;  2KQR A;  3C3W A;  3GLL A;  1AKH A;  4N4N B;  1PJR A;  3OSF A;  2ESH A;  5M3M J;  4LG0 B;  3ZCO A;  4CCO A;  1VZ0 A;  3U21 A;  1BL0 A;  4U0V A;  3M1E A;  1MDM A;  1IUY A;  3IRQ A;  4J19 A;  2NOG A;  3BWG A;  3CZ6 A;  1PP7 U;  1FZP B;  1U9O A;  5FB2 A;  1YI2 I;  3H3V K;  3FX3 A;  3K70 C;  1WVR A;  3JW4 A;  2PQ8 A;  3KE2 A;  3AFH A;  3LL7 A;  4LLG F;  1U5T B;  2YU3 A;  2ID3 A;  3CLQ A;  3Q0U A;  5D8K B;  4B43 A;  5HVQ C;  1OCT C;  1R1T A;  3AG1 H;  3REO A;  1CGP A;  2ZJP F;  5J1Y A;  1QZE A;  1FBQ A;  4M9S A;  4ZZL A;  2HI3 A;  4BNC A;  3ZQI A;  1R71 A;  2LTP A;  1E2X A;  4XN3 A;  4IOC F;  1LE8 B;  1AOY A;  4MO7 A;  3HG9 A;  5EJC A;  1X3W B;  3KP6 A;  1OCO H;  3CMM A;  3HOU J;  4F3Q A;  2H09 A;  4G6Q A;  3B73 A;  5D5W B;  1LFB A;  1ETW A;  1Y1V J;  5HDN A;  3DFG A;  1P7J A;  4ASN A;  1MSF C;  1E3P A;  1KQ0 A;  2GOX B;  2DBB A;  4X6A J;  3AG2 H;  1HBX G;  1UEL B;  4R8H A;  5LLQ A;  4EGZ A;  4UXN A;  4HST A;  2CQQ A;  4KIG A;  2E60 A;  1W1W E;  3SHF A;  2JN6 A;  3HRT A;  3I9V 2;  2DJI A;  2VT3 A;  3NAU A;  1R7J A;  2R7U A;  2DQL A;  3CCY A;  3ZQL A;  3I5U A;  2JJ7 A;  3ISP A;  4NC7 A;  4YIR X;  2BXY A;  2XAS A;  3GZN B;  1TP4 A;  4BE0 A;  1IRF A;  1TT0 A;  1YIJ I;  2XGC A;  4IQ4 A;  1KZH A;  4JOM A;  2L0K A;  4A2U A;  5FLX K;  2BOL A;  3TBI A;  5CVV A;  2DOE A;  2JK3 A;  5EYR A;  5EF6 A;  4II3 A;  3F9K A;  2DOF A;  2L54 A;  4P1W A;  4UVC A;  2MLG A;  1ZAR A;  2LY2 A;  4L9J A;  2CS3 A;  3JRG A;  3JRH A;  2E2H J;  1Z0X A;  4R79 A;  2XSD C;  2Y2Z A;  3HOW J;  3JAM K;  1JT6 A;  2QVO A;  3I4P A;  2A69 F;  3JRC A;  2CWE A;  4BEH B;  1MMA A;  5HLI A;  3SJM A;  4M9X A;  2R7V A;  4I01 A;  5JHF A;  1GLN A;  2M1B A;  2LY1 A;  4LG3 A;  1U0J A;  4HSR A;  4PGG A;  3BTL A;  4UUV A;  1FOW A;  2WC2 A;  4HEA 2;  1UST A;  2XVC A;  2QBY A;  2KRH A;  2FX0 A;  2O03 A;  3B6C A;  4NDL A;  1BM9 A;  3KYL A;  2ELH A;  4CCM A;  1RUN A;  3F6O A;  2HEO A;  1T39 A;  1EH6 A;  1KU7 A;  2E2J J;  2BY1 A;  5DUK A;  4BQO A;  2D1V A;  3BG5 A;  1XSX A;  2COM A;  2PI0 A;  2NNY A;  2JPC A;  2QQB A;  2EZH A;  1N78 A;  4L9V A;  4WK8 F;  2XF5 A;  1JKP C;  4M71 A;  4IHT A;  2P5V A;  3V8K A;  3OY9 A;  2X6O A;  3ZN1 A;  1UAA A;  2DYS H;  5EEH A;  2A6T A;  5ICG A;  1AU7 A;  2HKO A;  4EJV A;  4F91 B;  2VOP A;  1IRZ A;  4FX0 A;  1OKR A;  3VYR B;  2IS2 A;  1OCP A;  3K70 D;  3HSR A;  4E70 A;  4JQF A;  4F93 B;  1MH3 A;  3DPU A;  4WXH A;  5EGO A;  3WGH A;  1AHD P;  2IAI A;  4E7S A;  1WRJ A;  2M34 A;  5F27 A;  3BPX A;  3GYH X;  2R7Z J;  1KQ8 A;  2A6E F;  2BVM A;  2E19 A;  4RAY A;  5J3L A;  3F6V A;  2E35 A;  3IH3 A;  1HDD C;  2TRT A;  2GIV A;  5FRN A;  2NVY J;  2YUS A;  2JTV A;  4MFE A;  4ENN A;  3G73 A;  4BBS J;  5F08 A;  2CFX A;  3G1O A;  3KYD B;  4GCV A;  1TT5 B;  1JHH A;  2V79 A;  3E0J B;  4N4O B;  2CW8 A;  5DM6 F;  4M6Y A;  1QNT A;  3E97 A;  4XLC A;  4EEF G;  5F0F A;  4DYQ A;  4AYB N;  2CQN A;  1WKM A;  2L7F P;  2BHZ A;  5JFR A;  2OJE D;  3D5R C;  1H9T A;  3WTS C;  3FHZ A;  1U5T C;  1DGW Y;  1ITY A;  1B72 B;  4U0W A;  3WG9 A;  2DCE A;  4GYG A;  3RKX A;  3RCO A;  1SFU A;  1W0U A;  3RI4 A;  2Y0S N;  1YW7 A;  2E71 A;  2OCE A;  1E3H A;  2AXL A;  3RKQ A;  2QSG X;  1FJL A;  1FT9 A;  2Q0O A;  2VIX A;  4AUX A;  5B5E C;  1JGG A;  3BJ6 A;  2A5W A;  3MZH A;  1YX3 A;  4X0G A;  1ZGA A;  3NWT A;  2WAQ A;  4LIU A;  1YO5 C;  1H0M A;  3HXL A;  2AXT C;  1UHW A;  2RNG A;  1F5T A;  1JT0 A;  4DNC A;  3GBG A;  3Q9S A;  3DU6 A;  2DA1 A;  2V1N A;  1R5H A;  4EM1 A;  4CIC A;  3DTI A;  4BQQ A;  2Y48 A;  1IN7 A;  3L00 A;  2OTJ I;  1ONV A;  4A12 A;  5BPI A;  4L18 B;  2NXN B;  3K4K A;  1B8I B;  2DPD A;  4MHG A;  1GVD A;  1LDJ A;  2Z16 A;  5JVG F;  2KL4 A;  3IWZ A;  3PL8 A;  4AID A;  4JX6 A;  2LD5 A;  4G9Y A;  2E2I J;  5JLW A;  3CCE I;  2XV4 S;  2M5W A;  3R4K A;  2VPR A;  2MG4 A;  2XAJ A;  4PJ0 C;  4IZZ A;  1A5J A;  5IP9 J;  4B3A A;  3R6S A;  1MD0 A;  3TP3 A;  3RZO J;  2EV6 A;  3LSP A;  4IJA A;  4M3G A;  1WPK A;  3ERE D;  2JA2 A;  1R23 A;  3EUK L;  4LB5 A;  3WTT C;  1HST A;  2CQK A;  3HPH A;  3DP7 A;  2EIM H;  1HXD A;  3J80 Z;  3CCS I;  1ZG3 A;  4YG2 F;  3C1D A;  1IN6 A;  1LUJ B;  4HZF A;  4XOR A;  4UV9 A;  4JX4 A;  5EG0 A;  3PUB A;  3V8J A;  3E1S A;  3EYY A;  2ZJQ F;  4P9F A;  1MMD A;  1M1E B;  2BXZ A;  2MYS A;  2CMP A;  2UXN A;  1P4X A;  2V1D A;  3ABU A;  4BE1 A;  3V7R A;  4X1E A;  2W48 A;  1GDT A;  3K4B A;  2M4K A;  4KJZ A;  3LAP A;  3ELK A;  2ZME C;  1FP1 D;  3RYP A;  1Z7U A;  2L5Q A;  3BZK A;  1GXP A;  2ZB9 A;  2HOA A;  3KEO A;  3AL0 C;  1V54 H;  3SXY A;  3O8G A;  4MFD A;  1MJ9 A;  1WJ5 A;  3HTU A;  3ML6 A;  4CCL A;  3EUA A;  1XCB A;  3OYJ A;  2EFW A;  1USS A;  2W00 A;  1RR8 C;  3U1K A;  4O3M A;  1WI9 A;  1YQA A;  4V19 K;  5ILU A;  1HA8 A;  4KT5 C;  3ZQH A;  4BHP A;  4HNU A;  3CMY A;  2GXA A;  3OYD A;  1R58 A;  3OYC A;  2VOO A;  1VQ8 I;  1F4K A;  3HTS B;  4I0B A;  3IRR A;  1I3A A;  4XK4 A;  1YOV B;  3GX4 X;  2Z3Y A;  1YHQ I;  4HAM A;  1NG7 A;  1TZL A;  2LVS A;  2JT1 A;  3FWE A;  4OAZ A;  4UV8 A;  2LSO A;  3CMA I;  3OIP A;  1K6O A;  1LKX A;  1YRN B;  3ABM H;  2ZXI A;  3VOD A;  5H6R A;  1X4O A;  1P7I A;  2NS8 A;  3VDX A;  2WBM A;  5ED4 A;  3NQO A;  3WTY C;  3L2U A;  3FZV A;  2VBZ A;  3FM5 A;  5AIQ A;  5HOO A;  3EQL F;  4CA0 A;  2QUF A;  3H5R A;  1OCC H;  2VJJ A;  3HZJ A;  1S7A A;  2WTE A;  3DKY A;  4GRI A;  4AWX B;  2IEK A;  1EA3 A;  3MVP A;  4XRS G;  1ZGW A;  3HGY A;  3R61 A;  1MIJ A;  3SEQ A;  4ENM A;  1JHF A;  1W36 C;  3J81 K;  2WB1 N;  3R60 A;  5E1Z B;  3GTQ J;  5FFX A;  1DP3 A;  2K4B A;  1G3S A;  5IPA A;  1RR7 A;  3WTU C;  5A2Q K;  3C2B A;  2MW8 A;  3WU2 C;  4HW0 A;  4FIS A;  2CV1 A;  4DW6 A;  2JSC A;  3ABK H;  4HRI A;  1KYZ A;  3P5J A;  3DLL F;  1REP C;  3ZRG A;  2BBY A;  3G71 I;  3IKV A;  4WCG A;  3CP8 A;  1PP8 F;  3L1P A;  4DZP A;  1OLT A;  1FTZ A;  4HX4 A;  3FMR A;  3FXO A;  5DCM B;  1SAU A;  3S2H J;  1TW2 A;  1Z6T A;  2VBY A;  2P7V B;  1D5Y A;  3MAJ A;  5EEA A;  5EEG A;  1FX7 A;  1G3W A;  2X1C A;  2ZNY A;  2DK8 A;  1S5L C;  3I59 B;  2QSH X;  4MEX F;  2JSP A;  1MSE C;  2OQR A;  2IPQ X;  3A0B C;  3DU5 A;  4ANJ A;  3E5Q A;  3S3O A;  2V4J C;  2L2O A;  4AIH A;  4Y52 J;  3ZXS A;  2DFF A;  3DKX A;  3NAR A;  3F8M A;  4G6T B;  4E7Z A;  2HZD A;  5HS9 A;  5M5Y J;  4IRG A;  4BGD A;  5DUI A;  4H4K C;  1ERD A;  2IRF G;  4KIS A;  1DQU A;  3F0C A;  2P81 A;  3H0D A;  1Z9C A;  4MQV A;  4N0B A;  3C7J A;  4BS9 A;  3SEZ A;  5HOD A;  3X2Q H;  1IC8 A;  2PMH A;  1FIA A;  1OYY A;  1YX5 A;  3TO9 A;  2X51 A;  4A0Y A;  2MFZ A;  2HPM A;  4U7B A;  3HKZ A;  2EB7 A;  2P0W A;  3QOE A;  3V4G A;  2VQG A;  3LA7 A;  4A5N A;  1U8R A;  3OR2 C;  3LNQ A;  3ZMV A;  4AU7 A;  2OF7 A;  1BW6 A;  2W57 A;  3LSG A;  2OU2 A;  2I8D A;  2HYF A;  1A35 A;  1HC8 A;  3QPS A;  2CYY A;  2PJR A;  2VON A;  2FRH A;  2DK5 A;  2MGQ A;  1RKT A;  2QQA A;  3HYI A;  2F4O B;  2BGC A;  3VWB A;  3M8F A;  1Y0U A;  1HLV A;  4KYW A;  1TWF J;  3N05 A;  2KLO A;  1WHU A;  5HDG A;  5E18 F;  1W5T A;  1ZEL A;  2KIF A;  1FNN A;  4E7I A;  5L3B A;  1MMN A;  1QRY A;  2RQP A;  1I27 A;  1HCR A;  5GPC A;  3K7A J;  4V2G A;  4YEL A;  3MZY A;  5CJ9 A;  4B8X A;  5J6X A;  2E34 A;  1K7A A;  2KRF A;  2BY0 A;  1JTY A;  4BL0 B;  1ZG5 A;  4D5F A;  3B6A A;  3NRV A;  3OIQ A;  1XGN A;  5TJJ A;  3H92 A;  5F1J A;  3S2W A;  1FYL A;  3M3Y J;  2L7M P;  4OOI A;  1UZC A;  4MIM A;  2MC3 A;  5DDG A;  3C2H A;  1TQM A;  1FWZ A;  3O2P E;  2H6C A;  2ZXJ A;  3BP8 A;  4XON A;  4YII A;  3HHH A;  4HDV A;  4I09 A;  3GTK J;  1IUF A;  3KLO A;  4I02 A;  5L3F A;  4GFB A;  3PO3 J;  1Z05 A;  2X0L A;  1RIO H;  3RQ4 A;  4BY1 J;  1W36 D;  1XCV A;  1O7F A;  1JTX A;  4FT8 A;  4XRF A;  3CO6 C;  4XOP A;  4CO8 A;  5L3G A;  3IL2 A;  2DOA A;  2K5C A;  3O3K A;  2F5C A;  2XGD A;  1T8I A;  1WJF A;  3QYE A;  2XF7 A;  1V3F A;  2YX4 A;  5E3M A;  2O6G E;  2XRN A;  2W7N A;  2ADU A;  3BT9 A;  2DFE A;  4U0Y A;  5K5R A;  3MEX A;  3KFW X;  2HYJ A;  4D7M A;  3WTW C;  1XS9 A;  2VAS A;  2HVR A;  2HVQ A;  2O3F A;  5HLT A;  3GFM A;  1XSV A;  3IP4 B;  2R5Z A;  2XB0 X;  2DFH A;  4PJN A;  3CCQ I;  3EUH A;  3FXM A;  5FFZ A;  2LKX A;  1MNE A;  2RQQ A;  2P6S A;  1PVE A;  1TBX A;  1X1P A;  2MD0 A;  5CQE A;  2GOM A;  5HS8 A;  1WJB A;  3RKW A;  1B9M A;  1MJB A;  3RKY A;  5FRO A;  3TW7 A;  3H9Q A;  4WX9 A;  3CCU I;  4ON0 A;  1JUM A;  1ODD A;  1R22 A;  1ZAO A;  2QCO A;  2VJ5 A;  3DBH B;  2H1L A;  5DYM A;  4M6X A;  4TV7 A;  3FXQ A;  3BR5 A;  1XMK A;  1IV8 A;  1YJ9 I;  1C0W A;  4RB2 C;  3JCU C;  4WXC A;  1FMW A;  2FD5 A;  5TGT A;  4C9Y A;  3Q0V A;  3SYT A;  5E3O A;  3CUQ A;  3HUG B;  3OWT A;  1MJA A;  3FKI J;  5H6Q A;  1MBE A;  3LSM A;  2DA4 A;  1Z3X A;  4WXD A;  3LAJ A;  3BLY A;  1OCZ H;  2O8K A;  3HGG A;  3W6J B;  3BR2 A;  4R1H A;  2GM4 A;  1SFE A;  3I71 A;  5IYB J;  4CCJ A;  5E1W A;  3TDU C;  2NVX J;  2R7O A;  1YS6 A;  1SEU A;  4XR6 A;  1FIP A;  2BY2 A;  4HG2 A;  3WOD F;  4RBO A;  2XGX A;  2UWM A;  2DMP A;  5CYV A;  4IPA A;  3H3U A;  3GZ6 A;  2V6C A;  1XPX A;  2CJJ A;  1UG0 A;  3UR3 C;  4ITV A;  5K1Y A;  2CSO A;  3NWS A;  3A03 A;  1PYV A;  2ZJR F;  4YFK F;  4OWR B;  1K78 A;  3I3L A;  4HQE A;  2HXI A;  1EH7 A;  1W7P B;  4KT6 A;  4PUS A;  2R0Q C;  4RB0 A;  3K0L A;  2R5Y B;  1LFP A;  4C2M J;  1AWC A;  2KT0 A;  3HOY J;  2B7E A;  4AIJ A;  2XAG A;  1P2F A;  2QYO A;  1ZLK A;  1RET A;  2E5N A;  1Y1W J;  4KN4 X;  4B09 A;  1D8J A;  2XPV A;  1VQN I;  5GTH C;  2HQR A;  4A69 C;  5J4Y A;  3BJA A;  1HKS A;  3TKY A;  3TED A;  3FIW A;  4D0P A;  5C4X J;  3PQJ A;  3IHU A;  2E7W A;  3S15 J;  3QAH A;  4C3H J;  1HW2 A;  3CC7 I;  2QF7 A;  5GAG J;  5FD5 A;  1VFC A;  1ZH5 A;  1FC3 A;  3E5X A;  1FBS A;  3E6C C;  4MQ9 F;  1X58 A;  3F22 A;  3GF2 A;  5C3E J;  2CGP A;  1Y0N A;  2VUM J;  4A3F J;  2LP0 A;  2HZT A;  4DBR A;  2ICW G;  4XIC A;  1A04 A;  4BDY A;  2FSW A;  2STW A;  2JMW A;  4LLN A;  1A6I A;  4XRS A;  3FBN B;  2KJC A;  3W2V A;  1I1G A;  1B59 A;  4G6D A;  3CF5 F;  1BIA A;  4A5M A;  2GWR A;  1VQK I;  2AHQ A;  1JGS A;  2K3F A;  1Z67 A;  2G9W A;  4EMS A;  5F0H A;  3P9C A;  2ESN A;  3W6K B;  1KU2 A;  1NH3 A;  1LVK A;  3WU1 B;  1YYV A;  1BI3 A;  3ZOB A;  2X1E A;  3LOC A;  1TC3 C;  2L9R A;  5J8F A;  2F5D A;  3CO7 C;  1T33 A;  2HQ5 A;  4NB5 A;  3ZQG A;  4A3C J;  3G1L A;  3BR6 A;  2PBI A;  3JRE A;  1O3Q A;  2HGC A;  5D5U B;  1IXS B;  4XM3 A;  4Y33 A;  3L2R A;  3PFI A;  2DTZ A;  1BN5 A;  3WU0 A;  5JR3 A;  1JXS A;  4ZZD A;  1DUX C;  4S0H B;  4P96 A;  4HQM A;  3LSH A;  2DA5 A;  2CRG A;  2BY3 A;  2YR2 A;  4ENK A;  1EH8 A;  3FXR A;  3PO2 J;  5D8L B;  3WTZ A;  2ME6 A;  3GVA A;  3OOP A;  4FX4 A;  1MNM C;  1WSU A;  5FKO A;  4BYY A;  2M0C A;  1SFX A;  2FOW A;  2AQF A;  2K27 A;  3DXJ F;  3CUO A;  4E7K A;  3H35 A;  3L09 A;  2A61 A;  2JZY A;  5D6E A;  1ZK8 A;  2Y31 A;  5D4S A;  4O6J A;  2DMT A;  3G1M A;  1AA7 A;  3JTG A;  2X1D A;  5ICE A;  1DPR A;  4UUS A;  3OS0 A;  1ACI A;  4OIO F;  5HNF A;  2CG4 A;  2JVG A;  3BR0 A;  1QGP A;  4ZDO A;  2VE9 A;  2K7L A;  4YRV A;  1FPQ A;  4RMN A;  4Z2Y A;  4D5C A;  4M9Z A;  1S29 A;  2J5O A;  1SMY F;  2VKD A;  4IL6 C;  1QVU A;  4XL9 A;  2HDC A;  5ICC A;  4BAC A;  2COB A;  4A3M J;  2VOD A;  3ZN0 A;  3FBI B;  3J7A Y;  3ECO A;  4BXF A;  4GYI A;  5LEK A;  1I5Z A;  1YRN A;  3ABL H;  1IJW C;  4EGY A;  4XBF A;  1D0X A;  2QZ8 A;  3QOP A;  2NVT J;  2VN2 A;  4H0E A;  4Y15 A;  4CCK A;  4XN0 A;  3GW2 A;  3LQQ A;  4IHS A;  2HOS A;  5K7F A;  2LFB A;  1Z77 A;  4G12 A;  2WAD A;  1JKO C;  1TQP A;  4AD9 A;  2OZU A;  4L0Z B;  3BZC A;  3MKL A;  2K9N A;  2ZME B;  1RC9 A;  1J59 A;  1EF4 A;  3AL0 B;  4IXA A;  4QTR A;  1F36 A;  1TWA J;  2P5K A;  3K4C A;  2DA2 A;  3QQA A;  2Q2E A;  3GCM A;  4EM2 A;  4NNJ A;  2R7F A;  2IXS A;  1BI1 A;  3DPT A;  3MZ8 A;  3KZI C;  1ZN2 A;  3CD6 I;  2H6B A;  2UUZ A;  2ELK A;  1QA6 A;  2VC0 A;  1FLI A;  2HNH A;  2LLK A;  3A01 B;  3R0J A;  1MBK A;  2MC4 A;  2CUJ A;  3LST A;  4JK1 X;  4M3D A;  4B4C A;  2EQR A;  2O5R A;  4HF0 A;  3ZQ7 A;  3MQ0 A;  3GWZ A;  3NEU A;  3FK6 A;  5DV5 A;  1CF7 B;  2PMZ A;  3Q0W A;  1T08 B;  5LFA A;  3CJR B;  5CVI A;  1S6L A;  1WJC A;  1N75 A;  2GLO A;  1FYM A;  2MAB A;  3L2V A;  3I4M J;  5J8C A;  3G6E I;  5CVJ A;  4L5E A;  2IW5 A;  1IAW A;  3SZG A;  2W25 A;  2L3D A;  3CDL A;  1FY7 A;  4PK4 A;  5F64 A;  2V9V A;  4FHT A;  3A2K A;  3IAS 2;  5L3C A;  3FIS A;  4CXF A;  1JI8 A;  3PUF A;  4B47 A;  1I50 J;  3PNY A;  1H88 C;  3JRI A;  2IVM A;  2HTJ A;  3GXO A;  1Z91 A;  2CUF A;  1J09 A;  4ZYD A;  1KQ9 A;  2E1M C;  2HVS A;  4A6E A;  3E6D A;  2XPW A;  4XRM A;  1BIB A;  3HRU A;  1V55 H;  4C2U A;  4RGR A;  2LR8 A;  5CLS A;  4V2F A;  1PDN C;  3KZY A;  1F9N A;  3DKW A;  4IOA F;  2X6W A;  2XAF A;  1KON A;  2LNB A;  3I55 I;  2CH0 A;  4UY8 I;  5IOY A;  2BE5 F;  4DZJ A;  1O4X A;  4A3G J;  1QPI A;  2LBF B;  1F43 A;  3M9A A;  5FKK A;  1ZGJ A;  2KMU A;  2ZKZ A;  1JJ8 C;  2RGV A;  5K7Z A;  5ICF A;  5EZH A;  1K78 B;  2EA2 A;  4IRI A;  3N97 A;  1IGN A;  2XPU A;  2STT A;  1YG2 A;  2PG4 A;  2Z33 A;  1VQM I;  2V9K A;  3BOQ A;  2JRT A;  2Z5U A;  3MCZ A;  3PFY A;  3E3V A;  3PIP F;  3S14 J;  5HDK A;  4G7Z F;  1ETO A;  3JR9 A;  1HQC A;  1TWC J;  2WV1 A;  3CJQ B;  1IXR C;  3L2W A;  1YJW I;  3KEY A;  1RPW A;  2ETH A;  1P92 A;  1QO0 D;  1D1C A;  1P4A A;  4DJA A;  3CTA A;  5D4R A;  3P9I A;  4F52 A;  2RN7 A;  2DT6 A;  2XDV A;  2VC1 A;  2W1O A;  4HX8 A;  2PX9 A;  4FE4 A;  1RRJ A;  3DEE A;  1K4S A;  1T38 A;  1MBJ A;  2NVQ J;  1LPQ A;  2N8G A;  2X4H A;  4CHU A;  3JRF A;  2LYC A;  4KNY A;  2HYG D;  2W85 A;  3TQN A;  1HSJ A;  3J80 K;  4K2E A;  2NRA C;  1GHC A;  4NBQ A;  5LRS A;  2QWW A;  1AKH B;  1HF0 A;  2Y9Y A;  5J40 A;  4WF2 A;  3TOB A;  4YFX F;  1MDM B;  1EJ9 A;  5BS6 A;  3LMM A;  2JUG A;  2O8X A;  3CDI A;  3T1B A;  2RAE A;  4OU0 A;  3DPL C;  5EDN A;  1U8B A;  2EIK H;  3S2D J;  1U78 A;  1B6A A;  5CVR A;  1J75 A;  1W7P D;  4XLH A;  5DD8 A;  2R7R A;  3HOZ J;  4I6Z A;  2K40 A;  3S93 A;  2HOT A;  2IP2 A;  3OYN A;  4B1R A;  5HNH A;  1EKE A;  4NQW A;  1VQ6 I;  2NVU B;  5FO5 A;  4OMZ A;  2AS5 F;  3C18 A;  2OAZ A;  1X3Z B;  4LLL A;  3EPZ A;  4BY7 J;  1MMS A;  4L9T A;  4IHV A;  1LNW A;  2M87 A;  3S8P A;  5K5O A;  1R6R A;  4XID A;  4NC6 A;  1XG1 A;  3ZGK A;  2OV7 A;  4DIQ A;  2KZG A;  4A3B J;  2TCT A;  4MLO A;  3O8H A;  2WWY A;  1KYW A;  2EFN A;  5J47 A;  1F1Z A;  3E5U A;  1VQL I;  2X48 A;  1HKQ A;  5GAE J;  1IXC A;  1KU9 A;  1UCR A;  2DW4 A;  2VQC A;  3GFJ A;  3ZQC A;  3BG6 A;  2NOJ B;  1XSD A;  2D1H A;  3ESW B;  3H9G A;  1G59 A;  1ZYR F;  5LRR A;  4GXO A;  3GTL J;  1GV5 A;  1BBY A;  2KIM A;  1PUF A;  1LJ9 A;  2FNP A;  4W1U A;  5E79 C;  2CW0 F;  1APL C;  5JLX A;  5JI6 A;  1W5S A;  1SC7 A;  4DYC A;  3OYE A;  1WCM J;  3KCC A;  2R3S A;  1T6S A;  1OIS A;  2DT7 B;  1OR7 C;  3QRF F;  3GEZ A;  1Z6R A;  1XC5 A;  3BG7 A;  2G0E A;  1BJA A;  2KJB A;  4FQG A;  1YW9 A;  2IA0 A;  3L2Q A;  4KDP A;  1YW8 A;  1ZRC A;  3U1D A;  1H89 C;  4A3L J;  4P55 A;  4PJM A;  1XX5 A;  5E1X A;  5FKL A;  3CME I;  1XN7 A;  3WGG A;  1LEA A;  1OPC A;  1X3U A;  3S3M A;  1TWG J;  2JA8 J;  1JUS A;  4XSX F;  2YS9 A;  1S3J A;  3N4M A;  5BPD A;  2Y69 H;  1CQT A;  1IW7 F;  4EAT A;  2BVL A;  2A07 F;  1W7P A;  3FK7 A;  2LRE A;  2ELJ A;  3HSE A;  3VYU B;  3L9F A;  2R5Y A;  3K4L A;  4UVB A;  5KHD A;  3K10 A;  3WHB A;  2QBY B;  1PUE E;  3BDD A;  3CES A;  4EJU A;  3FMS A;  2WY8 Q;  4LK0 F;  2D2W A;  2D45 A;  3FXL A;  2EZK A;  2RKH A;  2JWT A;  4IVN A;  2HR3 A;  1RZ4 A;  2F2E A;  4AYB A;  1TL8 A;  4JYK A;  4E7J A;  4EQQ A;  2DDB A;  4FE7 A;  5J1U A;  2ME0 A;  2H8W A;  3D0S A;  4OIP F;  5LHG A;  5CKT A;  2GIZ A;  2JPB A;  2Y0S A;  3OL3 A;  4ZYG A;  4ENJ A;  2FUG 2;  2R93 J;  4PJJ A;  4I99 C;  1K79 A;  3KZZ A;  4II2 A;  2R7W A;  2EWN A;  3E7L A;  2HU9 A;  4BHB A;  5K5Q A;  3T8T A;  3H1C A;  4LG0 A;  4Q5S F;  2JA6 J;  2OD5 A;  5BQT A;  4GGG A;  2ECC A;  5IT9 Z;  4BXX J;  1R5G A;  4W97 A;  5EGO B;  1YFH A;  1ETX A;  4XLP F;  3OS2 A;  2FNA A;  4Q4Z F;  4HNV A;  5TIS C;  3ZMS A;  1U5T A;  5GPA A;  3OR1 C;  1G3Y A;  1IG7 A;  3OSG A;  1Q1V A;  1QZY A;  5DCF A;  1SVO A;  1XGS A;  1JKQ C;  3JSO A;  4RS8 A;  1LE8 A;  2MSY A;  3TMO A;  1ENH A;  4D1Q A;  3AAF A;  3KIO A;  1YS7 A;  4LMY A;  3T0Y A;  1IF1 A;  1NTC A;  3I0T A;  3ONQ A;  2KDZ A;  4PCQ A;  5E3N A;  2CV0 A;  5F04 A;  2MA3 A;  2M3A A;  3T8R A;  2L02 A;  3V42 A;  1WJA A;  5FLM J;  2OZ6 A;  4EJW A;  1V5G A;  1Y56 A;  2I5U A;  3S3N A;  2UV1 A;  1MBH A;  2LDU A;  2XC7 A;  4A3J J;  2LF7 A;  4EVI A;  1T95 A;  4FCY A;  3TOA A;  1Y8R B;  2DOD A;  2ZSI B;  1WWX A;  1K4T A;  2A05 A;  1YLF A;  2XIG A;  3Q3S A;  4BXU A;  3HEF A;  2FQ4 A;  2GXG A;  1ZRF A;  5IT3 A;  4G94 A;  1Z7L A;  2IGM A;  3COA C;  3K69 A;  2IA2 A;  5BOX A;  2OPT A;  1FOK A;  1JUP A;  1BR2 A;  3JRA A;  2OQG A;  4RDU A;  3ZMZ A;  4ZJZ A;  3DEU A;  4HYE A;  3K1N A;  1S7O A;  2LY9 A;  5JHU A;  3CC2 I;  2Z2S B;  3F23 A;  1SVM A;  1K6Y A;  5F0C A;  3K1P A;  2V1U A;  3OMY A;  4IQJ A;  2MD5 A;  4QSH A;  4IKF A;  2FU4 A;  3GFL A;  2RC4 A;  2H27 A;  3ERM A;  2J5P A; 
#chains in the Genus database with same CATH homology
 1TC3 C;  1ZR4 A;  2E19 A;  2L9R A;  2XB5 A;  5J3L A;  1T33 A;  2HQ5 A;  3ZQG A;  1NK3 P;  4A3D J;  4A3C J;  3G1L A;  3IH3 A;  3BR6 A;  1HDD C;  2TRT A;  2NVY J;  2YUS A;  1MBG A;  1ORK A;  3HBL A;  3JRE A;  3S1R J;  4MFE A;  2DTZ A;  1GT0 C;  4BBS J;  5F08 A;  3G1O A;  3JRB A;  2H8R A;  1BJZ A;  4S0H B;  4A3K J;  2DMU A;  2DA5 A;  2CRG A;  5FKN A;  4EEF G;  5F0F A;  4DYQ A;  1WGX A;  4AYB N;  2ECB A;  3PO2 J;  2L7F P;  2ME6 A;  1MNM C;  5FKO A;  2M0C A;  1ITY A;  4CYC A;  1B72 B;  1VND A;  1G2H A;  1W0U A;  2EZI A;  5EG0 B;  2Y0S N;  3IV5 A;  2M9H A;  1ZK8 A;  2Y31 A;  5M3F J;  5IP6 A;  3RKQ A;  1UG2 A;  1FJL A;  3IH4 A;  2DMT A;  3G1M A;  4AUX A;  1JGG A;  2R92 J;  1OJL A;  4UUS A;  2VI6 A;  3D1N I;  1JKR C;  4A3I J;  2HXO A;  1VI0 A;  3BR0 A;  1JT0 A;  3GTP J;  3GBG A;  3DCF A;  2DMQ A;  2DA3 A;  1UMQ A;  2DA1 A;  3GTO J;  1ZKG A;  3HB9 A;  1B8I B;  4D5C A;  4M3F A;  1GVD A;  1QVU A;  2COB A;  5FJ8 J;  2XRL A;  4A3M J;  4JX6 A;  2LD5 A;  3S16 J;  1RKW A;  2E2I J;  5JLW A;  5IYC J;  3RZD J;  1IJW C;  1YRN A;  2VPR A;  2MG4 A;  2NVT J;  1A5J A;  1I3Q J;  5IP9 J;  4C3J J;  2VKE A;  3MN2 A;  4B3A A;  3TP3 A;  3BG3 A;  4A93 J;  3RZO J;  2HOS A;  3LSP A;  4M3G A;  2DA6 A;  1WPK A;  5K7F A;  2LFB A;  1Z77 A;  4G12 A;  2LK2 A;  1BW5 A;  1ETQ A;  1JKO C;  4M3E A;  5C44 J;  2HDD A;  3MKL A;  2VKV A;  2Y9Z A;  3OIO A;  5M5W J;  2K9N A;  1S7E A;  4JP0 A;  1EF4 A;  4QTR A;  1F36 A;  1TWA J;  2EZL A;  2DA2 A;  3QQA A;  1B72 A;  5C4J J;  1VF9 A;  4JX4 A;  5EG0 A;  1GUU A;  3QPL A;  4CYC B;  2ELK A;  1NK2 P;  1FEX A;  4A3E J;  1GDT A;  4X1E A;  2W48 A;  2LLK A;  2K9Q A;  1IV6 A;  3A01 B;  1MBK A;  3K2A A;  4B4C A;  4M3D A;  2EQR A;  2H1K A;  2ZB9 A;  1K83 J;  2HOA A;  1BA5 A;  3FK6 A;  3O8G A;  4MFD A;  3Q0W A;  2GLO A;  4M6V A;  1DU0 A;  5IYD J;  3W6V A;  3CMY A;  3ZQH A;  3I4M J;  3PM1 A;  4IHW A;  2DJN A;  4L5E A;  1B8I A;  4LOC A;  1X2M A;  3CDL A;  4XK4 A;  4I76 A;  2X9D A;  1UHS A;  2CQX A;  1W0T A;  1HOM A;  3FIS A;  2LVS A;  2AO9 A;  2K9S A;  1I50 J;  1QVT A;  1YRN B;  1H88 C;  3JRI A;  1P7I A;  1DU6 A;  2CUF A;  2NS8 A;  4JX5 A;  2XPW A;  4XRM A;  1X2N A;  1ZQ3 P;  9ANT A;  2LR8 A;  3WHC A;  4V2F A;  2E1O A;  3RQI A;  2IEK A;  1IDY A;  3MVP A;  4XRS G;  2I10 A;  1ZGW A;  3HGY A;  2GBY A;  3BTC A;  1LFU P;  1R9T J;  3GTQ J;  2WB1 N;  3SFI A;  5IPA A;  1RR7 A;  4M3B A;  5IOY A;  3ZQF A;  4DZJ A;  3S1N J;  3C2B A;  2MW8 A;  3HDD A;  1O4X A;  4A3G J;  4FIS A;  1WH7 A;  1QPI A;  3M4O J;  4DW6 A;  1F43 A;  2WAQ N;  5FKK A;  3I4N J;  3A01 A;  1JJ8 C;  2YU9 J;  1T56 A;  3TP0 A;  5K7Z A;  3L1P A;  3LSR A;  5EZH A;  4DZP A;  1IDZ A;  1FTZ A;  1IGN A;  5IOZ A;  2XPU A;  3S2H J;  2O9L A;  1D5Y A;  5EEA A;  3GTJ J;  4BBR J;  3S14 J;  1ETO A;  3JR9 A;  1TWC J;  1MSE C;  2WV1 A;  1RPW A;  4Y52 J;  3NAR A;  2DMN A;  5M5Y J;  2JA7 J;  4FE4 A;  5DS9 A;  1MBJ A;  3F0C A;  2B63 J;  2P81 A;  2NVQ J;  3S17 J;  4AC0 A;  2N8G A;  1PUF B;  3IH2 A;  1ETV A;  5J1R A;  3JRD A;  3JRF A;  3HOX J;  2M8G X;  1WH5 A;  5HOD A;  1IC8 A;  1FIA A;  3BQZ A;  3DEW A;  1OFC X;  1E3O C;  1AKH B;  1WI3 A;  4UUT A;  1HF0 A;  1POG A;  2Y9Y A;  3SDG A;  1SAN A;  2D5V A;  4DYR A;  3LNQ A;  2RAE A;  2OF7 A;  1BW6 A;  3LSG A;  3CQZ J;  2DA7 A;  4IHY A;  3QPS A;  5EDN A;  1U8B A;  2DN0 A;  4D7N A;  3S2D J;  3OOU A;  2MGQ A;  1RKT A;  1U78 A;  1RES A;  3HOZ J;  1HLV A;  4Y7N J;  4I6Z A;  1TWF J;  5M5X J;  2K40 A;  2HOT A;  1ETY A;  4B1R A;  3HOV J;  2PMZ N;  2Y30 A;  1FTT A;  1QRY A;  1MBF A;  2R5Z B;  4BY7 J;  1HCR A;  5GPC A;  3K7A J;  4IHV A;  4V2G A;  3LSJ A;  4XID A;  2NS7 A;  1XG1 A;  4IHX A;  4A3B J;  1JTY A;  2TCT A;  4MLO A;  3O8H A;  4D5F A;  5EZG A;  3GTG J;  2X48 A;  3B6A A;  3ZQC A;  3BTJ A;  5F1J A;  4FTH A;  3M3Y J;  2L7M P;  5FKM A;  4MIM A;  3GTL J;  1GV5 A;  1PUF A;  3BTI A;  4W1U A;  1K61 A;  2L7Z A;  3S1Q J;  1HDP A;  1APL C;  5JLX A;  1IUF A;  3GTK J;  1GV2 A;  4DYC A;  1WCM J;  2ID6 A;  1AKH A;  4GFB A;  3OSF A;  3PO3 J;  5M3M J;  1XC5 A;  2G0E A;  5IP7 J;  1BL0 A;  4BY1 J;  1JTX A;  4J19 A;  2NOG A;  1SFO J;  1H89 C;  1U9O A;  4A3L J;  3H3V K;  5FKL A;  2XGD A;  3S1M J;  2ID3 A;  3Q0U A;  5E3M A;  1TWG J;  3BT9 A;  1OCT C;  1JUS A;  2JA8 J;  2CU7 A;  2YS9 A;  5J1Y A;  2HI3 A;  2HYJ A;  3ZQI A;  4D7M A;  2LTP A;  1LE8 B;  1XS9 A;  1CQT A;  4MO7 A;  1ZR2 A;  3FK7 A;  5BNG A;  2R5Y A;  1JJ6 C;  2IBD A;  2R5Z A;  3BQY A;  2XB0 X;  3HM5 A;  3HOU J;  3WHB A;  3A02 A;  2LKX A;  1LFB A;  1ETW A;  1Y1V J;  2EZK A;  1P7J A;  2JWT A;  1MSF C;  4JYK A;  4X6A J;  4FE7 A;  5J1U A;  2ME0 A;  1MH4 A;  1ETK A;  1U9N A;  2CQQ A;  3TW7 A;  2JN6 A;  2R93 J;  2FJ1 A;  3NAU A;  1JUM A;  3H0G J;  3BR1 A;  3CCY A;  3ZQL A;  2QCO A;  2JJ7 A;  3E7L A;  3HKZ N;  5E3L A;  5FLV A;  3BR5 A;  2M2E A;  2JA6 J;  2FD5 A;  2XGC A;  2L0K A;  3TW6 A;  3Q0V A;  5E3O A;  2CUE A;  2ECC A;  4BXX J;  2JK3 A;  5EYR A;  3FKI J;  5EF6 A;  4W97 A;  1MBE A;  5EGO B;  2DA4 A;  1ETX A;  3BR3 A;  2O8K A;  3HGG A;  4HNV A;  3BR2 A;  2GM4 A;  3JRG A;  5IYB J;  2E2H J;  3JRH A;  2JA5 J;  1Z0X A;  5GPA A;  2XSD C;  1IG7 A;  2Y2Z A;  2NVX J;  3HOW J;  1FIP A;  3OSG A;  4RBO A;  1Q1V A;  1JT6 A;  1ZTR A;  2DMP A;  2EH3 A;  3JRC A;  4IEJ A;  1JKQ C;  2CJJ A;  3SJM A;  1LE8 A;  2MSY A;  3GTM J;  1ENH A;  3A03 A;  1TWH J;  2HXI A;  3BTL A;  1NTC A;  4C3I J;  2R0Q C;  2KDZ A;  2R5Y B;  5E3N A;  2FX0 A;  5F04 A;  4C2M J;  3B6C A;  2KT0 A;  4NDL A;  3UKG A;  5FLM J;  3HOY J;  2E2J J;  1RET A;  3BG5 A;  5DTD A;  1Y1W J;  2XPV A;  1MBH A;  3BG9 A;  4BKX A;  4A3J J;  4QIW N;  4A69 C;  2EZH A;  3TED A;  1JKP C;  4FCY A;  3FIW A;  5C4X J;  3VPR A;  1H8A C;  3S15 J;  4C3H J;  2QF7 A;  1VFC A;  2X6O A;  3Q3S A;  1X58 A;  4UUS B;  3HEF A;  5C3E J;  2FQ4 A;  1AU7 A;  2VUM J;  4A3F J;  2LP0 A;  2OPT A;  4XIC A;  2O7O A;  1JUP A;  1IRZ A;  1OCP A;  2JMW A;  3JRA A;  1A6I A;  4XRS A;  2EBI A;  4RDU A;  1MH3 A;  2XGE A;  5GP9 A;  5K7H A;  5EGO A;  1I6H J;  1AHD P;  2LY9 A;  2AHQ A;  2IAI A;  5F0H A;  5F0C A;  4QSH A;  2M34 A;  5F27 A;  4ABZ A;  3ZOB A;  3LOC A;  2R7Z J; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...