1K61A

Matalpha2 homeodomain bound to dna
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
60
structure length
60
Chain Sequence
b'RGHRFTKENVRILESWFAKNIENPYLDTKGLENLMKNTSLSRIQIKNWVSNRRRKEKTIT'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords 5'-D(*AP*CP*AP*TP*GP*TP*AP*AP*TP*TP*CP*AP*TP*TP*TP*AP*CP*AP*
publication title A Hoogsteen base pair embedded in undistorted B-DNA
pubmed doi rcsb
molecule tags Transcription/dna
total genus 22
structure length 60
sequence length 60
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2001-10-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00046 Homeodomain Homeodomain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.60 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Homeodomain-like 1k61A00
1ETXA 3S15J 3C2BA 3ZOBA 3JRGA 4UUSB 2K40A 2M2EA 2XRLA 3ZQHA 4A93J 1ZTRA 3QQAA 1FEXA 1QVUA 1BW5A 2NVYJ 4W97A 3IH4A 1FIPA 2ECCA 1RESA 3LSPA 2Y2ZA 4V2GA 3SDGA 2JWTA 3Q0WA 1SANA 3CCYA 4AYBN 2EZHA 3JRDA 1ZKGA 3UKGA 5EGOB 4UUSA 2MGQA 4HNVA 1VFCA 1MH4A 1IUFA 5C4XJ 1BJZA 1ZGWA 5EDNA 3SJMA 1HDPA 2R5YA 4X6AJ 2LLKA 1CQTA 5GPCA 1GV5A 1OCTC 1AKHB 4XK4A 1IV6A 3F0CA 5EG0B 5IYCJ 2OPTA 4JX4A 5F08A 1JKRC 2YU9J 2XGDA 2LK2A 1LFBA 5EGOA 3O8HA 2GLOA 1F43A 1UHSA 2XGEA 2DA6A 1HLVA 2HXOA 3Q3SA 4MFDA 5K7HA 2XB0X 1AKHA 3S17J 5EG0A 1UG2A 1U78A 2W48A 5GP9A 1IDYA 2HXIA 3TP0A 1X2NA 4MIMA 5F0CA 4G12A 4XRMA 2NVXJ 4BKXA 2ID6A 3GTLJ 4C3HJ 2LY9A 1I50J 2FD5A 4XICA 2MG4A 2DA3A 2JN6A 2M0CA 1FTZA 2N8GA 1IGNA 3JRAA 4BXXJ 4DZPA 3BG9A 3H3VK 1QPIA 2HOAA 2DN0A 2HYJA 2R92J 4X1EA 1ETOA 1PUFB 3TP3A 3HOYJ 3HB9A 4MFEA 1WH7A 5M5YJ 2DMUA 1T56A 3JRHA 1AHDP 1GUUA 2P81A 4DYRA 2H1KA 3A02A 3E7LA 4A3LJ 2XPWA 4J19A 2K9QA 3RQIA 2CUFA 1OJLA 2DMNA 3WHCA 1MBEA 3B6AA 2XGCA 1JUMA 1PUFA 4FE4A 3ZQIA 1Z77A 4CYCB 3HDDA 4A3KJ 3S2HJ 3HEFA 3IH3A 1IG7A 2D5VA 3PO3J 1VNDA 3A01B 3G1LA 2WV1A 2R5ZB 4BY7J 5M3FJ 5C44J 3O8GA 1P7JA 4LOCA 4B4CA 1GT0C 2LP0A 4M3FA 4DYQA 1RPWA 1ENHA 2ECBA 4CYCA 1TC3C 4V2FA 1P7IA 1ETQA 1TWCJ 5FKMA 3BQZA 3A01A 2DA1A 2LVSA 1QRYA 2R5ZA 1RKTA 3HOUJ 2R7ZJ 4D7MA 2O8KA 2PMZN 3Q0VA 2R5YB 3OSFA 1XG1A 3BTJA 2ZB9A 4D7NA 3S1RJ 2YS9A 2NS7A 1K83J 3CDLA 3ZQGA 4A3CJ 4JX5A 1Y1VJ 2FQ4A 4C3JJ 3LNQA 1U9NA 2L7FP 5IP7J 3LOCA 1ETYA 2QCOA 2L7ZA 4A3IJ 1POGA 4W1UA 2VKEA 1ZK8A 3RZOJ 3OSGA 5IPAA 4A3GJ 1XC5A 1X2MA 3CMYA 3G1OA 3K2AA 5M5XJ 3TW6A 4BBRJ 1Y1WJ 1AU7A 2FX0A 3S1NJ 3B6CA 4C3IJ 3GTPJ 1JJ6C 2R0QC 1XS9A 2E2JJ 3JRBA 5IOYA 1VI0A 5JLXA 3DEWA 5EF6A 2L7MP 5M3MJ 2K9NA 4AUXA 4MLOA 4QIWN 2Y9YA 1WCMJ 2EZKA 1MSFC 2HDDA 4FTHA 5FKKA 1JUSA 4A3EJ 2XSDC 1YRNB 1IC8A 4DZJA 3JREA 2HI3A 3A03A 5F0HA 5IYDJ 5K7ZA 1FIAA 2E19A 2NVTJ 2TCTA 1WPKA 5EZGA 2DA4A 2AO9A 4D5FA 2ID3A 2KDZA 1VF9A 1X58A 2G0EA 2RAEA 2Y9ZA 4Y52J 1Q1VA 2CRGA 3RKQA 2QF7A 2L9RA 5FJ8J 3MVPA 3TW7A 3G1MA 2HQ5A 1YRNA 4IHXA 4B3AA 2JA7J 2R93J 3WHBA 5FKOA 2DTZA 1DU0A 1GDTA 3GTJJ 5K7FA 4IHWA 5HODA 5E3LA 2L0KA 4IHVA 4BY1J 5C4JJ 5IOZA 1DU6A 4M3BA 4EEFG 3MN2A 5C3EJ 3FIWA 3DCFA 1U8BA 4S0HB 3TEDA 3BR6A 3S1QJ 3FK6A 3FISA 1HDDC 1JKOC 1JKQC 5EYRA 1I3QJ 3ZQFA 4IEJA 2HOSA 1E3OC 4NDLA 2VKVA 2JA8J 2GM4A 3PM1A 1ZR2A 4I6ZA 1H88C 4FCYA 2ME6A 1LFUP 5E3MA 2COBA 1MSEC 3LSJA 1HCRA 2MSYA 3W6VA 2DA7A 1QVTA 1IJWC 1MBKA 2IEKA 1BL0A 2NVQJ 2EH3A 5F27A 2DMQA 3HGGA 2CUEA 2DMPA 2XPVA 5F0FA 1O4XA 2M8GX 3BR5A 1ITYA 3HKZN 3MKLA 3VPRA 2EQRA 2X9DA 1ETVA 2I10A 2LKXA 3HOXJ 1JGGA 4A69C 2FJ1A 2XPUA 1Z0XA 1A6IA 5J1UA 1RKWA 4GFBA 2E1OA 5FKLA 3ZQLA 2CQQA 4B1RA 4ABZA 1EF4A 2DMTA 3FK7A 3BR3A 1HF0A 4JYKA 1WGXA 2OF7A 3Q0UA 2VI6A 4M3EA 3BTIA 1BW6A 2JMWA 2E2IJ 3QPLA 4C2MJ 4Y7NJ 2E2HJ 1FJLA 3PO2J 2LR8A 2XB5A 1GV2A 2LTPA 4IHYA 3S2DJ 1IRZA 2WAQN 3NARA 4FISA 2VUMJ 3GTOJ 1HOMA 1SFOJ 3JRCA 2MW8A 4UUTA 1R9TJ 2H8RA 1RETA 3CQZJ 5IP9J 2AHQA 4DYCA 2LFBA 2X6OA 3IH2A 4D5CA 5M5WJ 1ETKA 3GTMJ 2M9HA 4RBOA 2IAIA 3SFIA 2ELKA 2YUSA 4DW6A 3HM5A 2TRTA 2JA5J 3BR2A 5J1YA 1W0TA 3FKIJ 3H0GJ 5JLWA 5E3OA 1IDZA 4MO7A 4A3FJ 2JK3A 1B72B 1MH3A 3BT9A 3BG3A 5BNGA 3S1MJ 1T33A 3HOZJ 3NAUA 2ME0A 3OOUA 2GBYA 4QTRA 3BR1A 1MBGA 2NS8A 5J3LA 3S14J 1G2HA 4RDUA 5DS9A 1MBFA 2HOTA 1ETWA 1ORKA 4JX6A 2LD5A 1S7EA 4M3DA 4XRSG 1JT6A 3HGYA 1H89C 1B72A 1ZQ3P 1OCPA 1NK2P 5F04A 2KT0A 4AC0A 3LSRA 3BQYA 3HOVJ 3BR0A 1H8AC 1A5JA 5IYBJ 5GPAA 1TWGJ 5DTDA 1OFCX 1NK3P 3OIOA 3GTGJ 2CU7A 2JA6J 1MNMC 4M6VA 1APLC 2WB1N 2EBIA 3IV5A 2Y30A 1D5YA 1JUPA 4XIDA 3QPSA 3ZQCA 1WH5A 1TWHJ 3JRIA 2IBDA 3JRFA 1JTXA 1F36A 3GBGA 3D1NI 2DJNA 5EZHA 3M4OJ 2EZLA 4A3DJ 2O7OA 3S16J 1NTCA 2X48A 1GVDA 3K7AJ 3GTKJ 1MBHA 1TWAJ 2CQXA 5FLMJ 5J1RA 1K61A 3RZDJ 1MBJA 2M34A 3LSGA 1ZR4A 1I6HJ 3BTCA 4A3BJ 3M3YJ 3JR9A 5EEAA 4JP0A 2DA5A 5E3NA 1JTYA 1LE8B 1JKPC 4M3GA 2NOGA 1JJ8C 1BA5A 4L5EA 4FE7A 1UMQA 4BBSJ 9ANTA 5F1JA 3HOWJ 5IP6A 1B8IB 3HBLA 1RR7A 4A3MJ 2O9LA 2JJ7A 3I4NJ 2Y0SN 1JT0A 2B63J 3I4MJ 1W0UA 1LE8A 4QSHA 1FTTA 1WI3A 2VPRA 2CJJA 3L1PA 3BG5A 3BTLA 2Y31A 2K9SA 2DA2A 3GTQJ 4I76A 4XRSA 5FLVA 1B8IA 5FKNA 4A3JJ 2EZIA 1TWFJ 1U9OA
chains in the Genus database with same CATH superfamily
3WG9A 4XONA 1V54H 3S15J 4HV6A 4FT8A 3C2BA 3LSHA 3P9IA 3ZOBA 2K40A 1Z05A 1OR7C 1QVUA 4I02A 5DEQA 5F6FA 4Q5SF 2NVYJ 3ZR8X 4FQGA 1MMSA 2ECCA 1WHUA 2X6YA 1RZ4A 2HYFA 2J5PA 2Y2ZA 5DDGA 1X1CA 3Q0WA 3KLOA 3EYIA 3CCYA 5L3GA 3VOEA 3ZQ7A 2R7UA 2M3AA 3PNVA 2E5ZA 3LSIA 3JRDA 2HR3A 4LITA 4DNCA 3H1CA 4BJ6C 2VC1A 4HNVA 1VFCA 4NC8A 2WTEA 1IUFA 3ASOH 3EUAA 2OZ6A 1YIOA 1WJBA 1XSDA 2KKOA 3IP4B 2X6WA 4LB5A 4LFUA 4LLGF 2VIXA 1CQTA 2D1HA 4RMNA 1OCTC 1L3LA 1UJ8A 2CQNA 2MH9A 2NVUB 5EG0B 3KP6A 4MEYF 4JX4A 2ETHA 2H1LA 3H9QA 1S8NA 2XROA 2KZVA 1J2XA 3OYDA 3U9GA 2L9VA 2M45A 4PUSA 2QKLB 2GLOA 3K4KA 2DA6A 3JAMZ 3KPHA 3UR3C 2QM3A 3OYIA 3V8JA 2IGOA 4UB8C 1SD7A 3S17J 5EG0A 1ZG1A 2VJJA 2BBYA 4RB2C 1VTNC 2K02A 3RSNA 2FE3A 2WC2A 3GF2A 5F0CA 1RC9A 4G12A 3IRQA 5J40A 4BKXA 3F22A 1KU2A 4BACA 3H35A 2WBMA 1YI2I 3GZ6A 2VONA 2E36A 3HG9A 4HDVA 1N75A 1IZ1A 2JN6A 4XORA 4PJLA 1W5CC 2O6GE 3A1YA 4G6TB 1HA8A 2N8GA 3IL2A 5E1XA 1XCVA 4HZFA 2IXSA 3BG9A 4A5MA 5D5UB 2KRHA 3N97A 1S3JA 2HYJA 2R92J 4E7HA 4H0EA 3HB9A 4WK8F 2CV1A 1AHDP 2MFZA 1GUUA 2P81A 4DYRA 4IRHA 4MQVA 2Z9OA 2H1KA 3A02A 3OL3A 4HPQA 4J19A 1TP4A 5LBQA 3MZYA 4P96A 2Y0MA 3FXUA 2DMNA 2RC4A 3EUHA 2QKMB 4G7ZF 1I5ZA 5IT9K 5L3DA 2ZJQF 4KT6A 1FOWA 5CPRB 5JI6A 3OYAA 1R1VA 2BXYA 4XLEA 3L2CA 2IGNA 4M9ZA 4PFOA 2DPDA 3HDDA 3KYDB 3WTTC 4A3KJ 2GXBA 3S2HJ 4NB5A 3IH3A 3KP3A 4UHTA 3CDHA 1VNDA 1XMAA 1Y39A 1XCBA 5C44J 4G8XA 2Y75A 3CMEI 2CV0A 4BE2A 4M3FA 2JPCA 4DYQA 1RPWA 2GOXB 3U2RA 2M8EA 4HNUA 1QO0D 2ECBA 3QOPA 4L5IA 2M5WA 4FX0A 2BEOA 3RJPA 2WAFA 3QPTA 1YIJI 2B0LA 2LVSA 1BC7C 4MTEA 2R7ZJ 1H9GA 2PMZN 1D1CA 1R1UA 3NRVA 2HYGD 3AKZA 2R5YB 3OSFA 1S29A 4KUMA 2NS7A 4G94A 2K86A 4RAFA 3QODA 2MLGA 1O3RA 4P55A 4A3CJ 3ROUA 3ZN1A 2UUZA 4JX5A 4XKCA 1OKRA 2IA2A 1S72I 1ETYA 5JHUA 3RZOJ 4F93B 1FP1D 5GTIC 4EM0B 4O6JA 3WU1B 2FUG2 1FYMA 5IPAA 3H36A 4A3GJ 2P5LC 1GLNA 1I6XA 4QPQA 4HDUA 2P5KA 3OV8A 4TV7A 2OU2A 2W84A 3WODF 3TO7A 1IN4A 4BBRJ 2RDPA 2WV0A 5J4VA 5IT3A 3B6CA 5ICCA 1B9MA 1G4DA 3WTVC 4IO9F 4MGRA 2R0QC 4EVIA 1BI2A 3WE2A 5JLXA 3HRSA 1WVRA 1T2KA 3AL0C 5M3MJ 1WWXA 1ZN2A 3C1DA 4XKVA 1C0WA 3CF2A 4AUXA 2MBFA 4MLOA 1IV8A 4PK4A 4FTHA 2DTRA 2Q0OA 4EM2A 4A3EJ 3ECOA 3GXOA 2DPUA 1IC8A 3JREA 5H20A 2QSGX 4IOCF 1KQ0A 2NVTJ 2TCTA 3AG4H 4WF2A 1WFXA 2DA4A 5EZGA 4YIRX 4PGHA 4YIFA 1USTA 2ACJA 3DPTA 1KZHA 2ID3A 4GDFA 1VF9A 1X58A 3H9JA 1B9NA 3JTHA 1D5VA 5E17F 2XGXA 3MVPA 3NWTA 3F23A 1HSTA 2FXAA 3G1MA 1G59A 4B3AA 3WGGA 3HHHA 4OMYA 4RB0A 1T08B 2K4BA 3ZPLA 3HL2A 4XLCA 1G3YA 1FZPB 2UXNA 1U3EM 2MA3A 5LEKA 1VQ7I 4IHWA 2EJRA 2L0KA 2VT3A 2LH9A 1R23A 5AONA 2IT0A 1AOYA 1V5EA 4G6DA 3RCOA 3DCFA 2FBHA 4ETSA 3BR6A 3O3KA 1Y0NA 1HDDC 2W7NA 3M1EA 1JKQC 5EYRA 1IRFA 4IEJA 3ZQFA 5B3SH 1F4KA 2HDCA 2A5YB 3CJNA 2VKVA 4XQFA 5HVQC 4YFKF 2LYCA 2RQPA 4HX7A 1YFHA 5DD4A 5E3MA 1YE9A 1MD0A 4PSWA 4L18B 3H9GA 3IC7A 3DBHB 4ZYAA 1IJWC 2EH3A 1UAAA 5ICGA 3SFZA 4L0ZB 2EFWA 5E8GA 2QQAA 2XPVA 1ON1A 5DCMB 4EMSA 1MW7A 3HC7A 3GZNB 1VQLI 2QUFA 2X9DA 2EQRA 1MJ9A 2AQEA 2HGCA 3IUOA 3N05A 2LKXA 4I0BA 4A69C 3HRUA 2GA2A 5J1UA 1A6IA 1TW3A 4E7JA 4BEHB 3Q9VA 2V1XA 4GFBA 4PJJA 4M71A 5DV5A 1IRXA 1QZZA 3DBLB 3ZQLA 4U0VA 5D4RA 2R3SA 5D5XB 1V5GA 2F4MB 2IGKA 3FK7A 5DCMA 2DT7B 4A0XA 1HW2A 2IP2A 2XF5A 4BXFA 1HF0A 4DBRA 1G6NA 2E1NA 2I5UA 1SVLA 3CD6I 1IUYA 4H4KC 1DPUA 1N25A 3KE2A 1IXSB 5HLTA 2KRFA 4IHYA 3S2DJ 3DKWA 2WAQN 1VQKI 1SD5A 3MKWB 4LMYA 1SFOJ 1T95A 4OU0A 1N78A 2L7KA 1UZCA 5B1BH 2H8RA 1PP7U 1FNNA 1T6SA 5IP9J 2W85A 3GTMJ 2Q1ZB 2FOKA 2X4HA 1A36A 2RVCA 3TBIA 1QBJA 2JA5J 3E6BA 5GADJ 3BR2A 4A6DA 5J1YA 3H0GJ 5KNLA 4F55A 3CUQA 1IDZA 2ESHA 2DO7A 2JK3A 1KU3A 1B72B 1Y8QB 4ZJZA 2R7XA 4BU2A 4EV0A 1FLIA 4A0ZA 3OOUA 2MD0A 1MKMA 2ZFUA 1E17A 3M8EA 2LY1A 1RIOH 4QTRA 3JTGA 2DODA 1MBGA 2NS8A 2E34A 3TDUC 3I56I 2X85A 4R79A 3S14J 3FZVA 1OYIA 2XAHA 4XSXF 1S7EA 2L3DA 2P7VB 4XRSG 1FBUA 4Z6YA 1B72A 1OCPA 2O3FA 4G9YA 3FM5A 1NK2P 3BQYA 3QWLA 2KIUA 4KFCA 5GPAA 2WWYA 1TWGJ 3GO5A 3V4GA 2R7QA 4GCVA 3A2KA 5FROA 1S9HA 1MNMC 3M8JA 1X1PA 1HSJA 3H92A 4HOBA 3ZMZA 1TWHJ 2LOOA 1SD6A 4BYYA 4D1QA 4KIFA 5EZHA 1Y6IA 5EEHA 2V26A 4DJAA 3DQVC 1NTCA 4RGXA 1I27A 2DFFA 1GVDA 5D8KB 3DP7A 1UHMA 5JVGF 3ABKH 4PZJA 4NNJA 5HS8A 2KMUA 5J1RA 3WGHA 1FOKA 2IS1A 4U7DA 1ZR4A 3L00A 5H6QA 3V7CA 2KDOA 4HBLA 2A05A 3M3YJ 3J7ZI 3JR9A 5EEAA 4CCLA 2DFIA 4JP0A 1LE8B 3TQNA 2LREA 3PQKA 2E71A 4LK0F 2Q8KA 2FQ3A 3V7SA 1JJ8C 1YG2A 2IS4A 1TNSA 1DP7P 2WA0A 2DK5A 5K5RA 1KA8A 1EV7A 5ILUA 4BBSJ 9ANTA 2BZTA 5F1JA 1SFEA 2VJ5A 3LQRA 4NUBA 4OAZA 2IRFG 4G7OF 2EB7A 3HBLA 2PJRB 3I4NJ 2Y0SN 1BOAA 3HSRA 1JT0A 2IGMA 2QGUA 3I4MJ 1TL8A 1LE8A 2W1OA 2KISA 2W82A 4UVBA 1TQPA 2VPRA 4M6XA 2RGVA 3BG5A 3BTLA 4RGSA 2HDWA 2JA2A 2K9SA 4OOIA 4RM2A 3BG6A 3MEXA 6PAXA 2M4KA 2RNJA 3W6KB 2PJRA 2Z33A 2VKDA 2KP6A 1D8KA 2VE9A 4ZTFA 2PLYA 4KYWA 3G3ZA 3JRGA 4Z2YA 1YITI 2M2EA 3K69A 3QQAA 4XN3A 2F4IA 3CTAA 2HVSA 2CW8A 1LFPA 4W97A 1G3WA 1FIPA 1RESA 4PSXA 3IKTA 4RAYA 1SC7A 3P9CA 4HSRA 4HV5A 1D0XA 1SANA 2FSWA 1F1ZA 4B8XA 3ZCOA 1MJBA 3ABLH 4WX9A 4ENMA 3COAC 1IN8A 1ZKGA 3UKGA 4EGYA 3W3CA 4AD9A 2MGQA 5C4XJ 1BJZA 4LG3A 4G6QA 5EDNA 1M1EB 3SJMA 2F6CA 4X6AJ 2LLKA 4FX4A 4IVNA 4BHBA 3D5SC 1MMDA 2ICWG 3NEUA 2WAEA 3QYBA 5GPCA 1SVMA 1GV5A 2AQFA 2XDVA 1BM9A 1IXRC 1W7PB 4FETA 4X0GA 1AKHB 3F0CA 2VOPA 3KP5A 4BQNA 3DWLE 1D0YA 4NHJA 1ODDA 1ZG3A 4IRGA 2NNYA 1JKRC 2XGDA 2YU9J 2LK2A 3CCRI 1W4MA 2L4MA 2EFPA 1MNEA 2K27A 2ZCWA 2VXZA 3BJAA 1FWZA 1FX7A 1B6AA 1HLVA 4EJTA 2R7FA 2HXOA 2XAQA 4MFDA 5K7HA 3JAMK 2XRNA 5FB2A 2PBIA 4J01A 2GQQA 1W7PA 1AKHA 1FOYA 4C2TA 1UG2A 1U78A 2W48A 4A5NA 4PGGA 3PSIA 4UB6C 2OA4A 5ILVA 4XRMA 2DOEA 1F9NA 4II3A 3H0DA 3W2AA 4B44A 2VE8A 4KT5C 2DAOA 3REOA 2FD5A 2M0CA 3J7AY 2BXZA 4ZC3A 3LL7A 3CMMA 1FTZA 1WSUA 1HKSA 4PJMA 3JRAA 4BXXJ 4DZPA 2ZBKA 1OCOH 2WY7Q 4KMUX 3LA7A 2GXAA 2Q2EB 2KIQA 5DYMA 2K9LA 1GHCA 1PUFB 1LDJA 3HOYJ 4U0YA 3GFLA 4IJAA 1T56A 3QYEA 2L9NA 4HF1A 4XLFA 2XPWA 2DDAA 2V6CA 1KYWA 1Z67A 1ERDA 1X3UA 2CFOA 2JRMA 3QOEA 1W36D 2K3PA 5B5EC 2DLLA 1W5TA 2E7WA 1MBEA 2A5WA 2ZMEB 3GLXA 4II2A 3I58A 4IRIA 1PUFA 2GIVA 4ON0A 5DD8A 2VBWA 3WTUC 3K1NA 2E35A 2P6SA 2UWMA 4HYEA 3HEFA 2XHKA 2CW0F 1IG7A 2QLZA 3S8PA 3PO3J 3HTUA 3A01B 3I9V2 4E7ZA 3HZJA 3DBRB 4BY7J 3U1DA 1BN5A 1TBXA 1IRGA 1TZLA 4LIUA 4AM3A 1P7JA 2ZMEA 4LOCA 4HEA2 3TGNA 4B3XA 1JGSA 4WWCA 3CF5F 4WXCA 1ZH5A 3AG1H 4KMFA 2HQAA 1SFUA 4V2FA 1WJEA 3IWZA 1VQOI 2FBKA 1P7IA 1WJDA 1FYKA 2BV6A 1J09A 1ETQA 1ZARA 1TWCJ 2IPQX 5FKMA 1R71A 4LLNA 1LB2A 3A01A 3GLLA 1GXPA 4M9SA 1RKTA 1BI3A 4D7MA 2O8KA 1DGWY 1XG1A 4D7NA 5L3CA 3S1RJ 1QZEA 3MKYB 2JVGA 5DM7F 1K83J 4OIRF 1OPCA 3M07A 2P7CB 3L09A 1Y1VJ 1MMAA 1OCZH 4GYIA 2ZMEC 3LWFA 4CUGA 3LNQA 3F21A 2Z3YA 1U9NA 1LQ1A 2HZDA 2WB1A 1POGA 4W1UA 2MC3A 2VKEA 3ZXSA 1XGSA 4CO8A 3K4LA 3D5RC 2HTSA 3SYTA 4I2OA 3TW6A 2EA4A 2PN6A 2NAZA 3NWSA 2F48A 4MHGA 5IOYA 4IX7A 1HKQA 1LUJB 3PNTA 1U8RA 3FDYA 2H09A 2EK5A 2XF6A 1S6LA 2L7MP 2VJIA 4XKWA 5LRRA 4DOZA 4IXAA 1WCMJ 2M1BA 3CJRB 5FKKA 2HVRA 4M74A 2YX4A 2ISZA 2XSDC 2W57A 1YRNB 1B4AA 3H5RA 3F8FA 3MCZA 1P4XA 2F5FA 2O0YA 4IOAF 3OL4A 4ZZDA 4BHCA 4AU7A 4D5FA 4OIQF 4MQ9F 4L5JA 4XKBA 2KDZA 3G71I 4Y52J 2VJ4A 2QSHX 2CRGA 2V9PA 1BIAA 1EH6A 3HIFA 3ELKA 5LRSA 2HQ5A 1YRNA 2V1NA 5TISC 4L9NA 3WHBA 4CH7A 4CGZA 4CDGA 2LSOA 1K6OA 2DTZA 2X1EA 1UG0A 1MJAA 3T8RA 5CVRA 2AS5F 5F1RA 4IHVA 3CLQA 1K79A 3MN2A 5C3EJ 4S0HB 3I55I 3HUGB 3BROA 3FK6A 2CYYA 3FISA 2QYOA 3PIPF 4HLYA 1LDKB 2QQ9A 3BJOA 3DPUA 1SAUA 1I3QJ 3BOQA 3DU6A 2HOSA 4BGDA 4AYBA 3GZ5A 4ESFA 1O57A 1TQMA 4P1WA 3MZ8A 1NH3A 3ZMDA 2V1DA 5CVUA 3CCUI 1LFUP 2X6XA 3BG7A 1MSEC 1EKEA 2CMPA 2R7DA 3RPUA 3HUGA 2KPMA 3MKZA 3W6VA 2DT5A 2DA7A 2R7RA 4E7SA 4IQ4A 1QVTA 1MBKA 2ZKZA 2IVMA 4ZDOA 2CUEA 1P92A 4UNOA 3BC8A 3A0HC 2VQLA 2RN7A 4GGGA 1IXCA 2OQRA 5EJCA 3EUHC 2CG4A 4HF2A 1O4XA 2M87A 2EV6A 3BR5A 3BLYA 3UNGC 3DLLF 3MKLA 3WTSC 3VPRA 3LAPA 2DCEA 1FBSA 1QHHD 2FJ1A 1B1BA 4HSTA 3TOBA 3ZP5A 2KL4A 4P9FA 3CCMI 4G7HF 2V6EA 3ZRGA 4AIHA 3V42A 4GO1A 3BPXA 2LNBA 2K9MA 4NC7A 2OZUA 4B1RA 4ABZA 3RI4A 1FMVA 3HSEA 1DUXC 1EF4A 2DMTA 2EIKH 1OCRH 4C9YA 4E4HA 2L02A 3ABTA 1WGXA 3Q0UA 2R7VA 3IWFA 4M3EA 1BW6A 2JMWA 1T39A 2EWNA 3DPLC 2E2HJ 4UV9A 3PO2J 2LR8A 2LTPA 2QA4I 5DCFA 2DJIA 3K70C 2LF7A 3GTOJ 4FISA 5L3EA 1MMNA 1Y0UA 2OCEA 2P6TA 1HOMA 1O7FA 3JRCA 3K1PA 5JR3A 1XTAA 1X3ZB 3CQZJ 2AHQA 4DYCA 2LFBA 3IH2A 4U87A 4D5CA 3FMRA 4R8HA 2HFHA 3OIPA 1RUOA 4E70A 4XN0A 3K4NA 3SFIA 2Z16A 3K4BA 4ENJA 2JTVA 4DQ2A 2BVMA 2FNPA 1ZLJA 4CYDA 1W0TA 3FKIJ 2CO5A 4LJZF 3MWMA 2OV7A 5DUKA 3ZN0A 2O8XA 3FKJA 2DOFA 3BG3A 2CFXA 4PJNA 2E60A 1J75A 4UXNA 4D0PA 4P9UA 1QGPA 2KQRA 5K1YA 2F4OB 2GBYA 1RI7A 3BR1A 1CF7B 3ONQA 5J3LA 4RDUA 5BS6A 3OYKA 2ZJPF 1ETWA 1ORKA 3CC4I 4JX6A 2LD5A 1SEUA 3CLOA 4KNYA 2OTLI 4HA8A 4O5VA 2W25A 4KDPA 1H89C 1I3AA 3CCEI 5F04A 2KT0A 4AC0A 2HQRA 4B43A 1ZAOA 4S05A 3KZZA 2KLOA 4N0BA 5A2QZ 4IPAA 2STWA 5DTDA 3OYBA 4K2EA 3OIOA 1CF7A 3GTGJ 3ECHA 2CU7A 2KZGA 4AIDA 5L3FA 3M8FA 1APLC 3IV5A 2Y30A 1D5YA 1X4OA 1TNTA 2A6EF 1WH5A 3K2ZA 1A35A 2H6CA 1JTXA 3I64A 1ZRFA 1WKMA 2R7WA 1F36A 3GBGA 3J80K 1IN7A 3F8BA 3GFMA 3OOPA 1OISA 3PUBA 5KCMA 2X48A 4A3DJ 1V4RA 1EJ9A 1Y8RB 3K9TA 1R00A 5FLMJ 2PMHA 1K61A 4XLPF 3RZDJ 2QBYB 2M34A 3LSGA 3DV8A 3VYTB 1IAWA 4HLXA 1JE8A 2Z5UA 3J7AO 3P9KA 3PIOF 5E3NA 1JTYA 1EH8A 3ZQQA 4MTDA 4M3GA 1JI8A 2XKPA 1XB4A 4M73A 1KQ8A 1U5TB 2E1CA 4FE7A 1UMQA 1IN5A 3S2WA 4BJTA 3GYHX 1MGTA 1Q1HA 4JBAA 2V9KA 5BPDA 2O9LA 2QBYA 2JJ7A 2DFHA 1VQ8I 3OYJA 3VFZA 2B63J 1V3FA 2KHMA 5CVJA 3PSFA 5BOXA 2V4JC 4RAZA 4FASD 4S04A 1O7LA 1FC3A 1U5TA 3EYYA 4XRFA 2DA2A 3G2BA 3ML6A 4A3JJ 1TW2A 2EZIA 3FX3A 3M9AA 3QAHA 2HKOA 2OCCH 3OYFA 3CCQI 4NBQA 1ETXA 4Y3OA 4IL6C 1OYWA 2JVHA 3MQ0A 2XRLA 3R0AA 5JHFA 4U0WA 4A93J 1FEXA 3W6JB 1BW5A 2FRHA 4U88A 2K85A 3IAS2 3VWBA 1BIBA 3OYNA 1N77A 3HRMA 5CVVA 4A2UA 3CUQB 3K70D 5J6XA 3LSPA 3EUKL 1HW5A 4HRIA 2HTJA 2XIGA 1IN6A 1G3TA 3SDGA 1JHFA 1SFKA 1U5TC 1S7AA 3R61A 4I01A 2EZHA 2ZJRF 3LQQA 4ENKA 1UHWA 3PFYA 3OYMA 2BY1A 4DIQA 1MH4A 5GAGJ 3TDZC 1OMIA 3CJTB 3GUDA 1HDPA 3BPVA 1T38A 5E18F 2WADA 4HNTA 2ZXIA 3ZGKA 1R6RA 4XK4A 1YS7A 3VSLA 3K4JA 3KYCB 5IYCJ 3ESWB 5E79C 5F08A 3WG7H 2ADUA 4OMZA 5B66C 3PJRA 4LG0B 1LKXA 3R6SA 4C2UA 1R22A 4N9IA 1Z7LA 5D5VB 1T8IA 2DT6A 1F43A 1UHSA 4BHPA 1FY7A 2X1DA 3GMEA 3Q3SA 3F6VA 4NC6A 2XB0X 2M7AA 2CSOA 3KEOA 4EQQA 4F3QA 1X19A 5TJJA 5L3BA 3CUQC 1IDYA 2HXIA 2DXIA 1X2NA 4LG0A 4Y15A 3RYPA 2ZXHA 5BPIA 1FSHA 3B02A 3HKZA 4RB3C 2HWVA 3EETA 2LY9A 2RQQA 1I50J 2BYVE 1VQPI 3P5JA 2CQKA 2MG4A 4N4OB 2DA3A 5ICFA 3CUOA 4ENNA 1KONA 1L0OC 3J80Z 1D1AA 4HAMA 3C7JA 2IS2A 3O2PE 3FMQA 3FXOA 2HKXA 2QQBA 1R5HA 2DN0A 4X1EA 1ETOA 1Z91A 5M5YJ 4Y33A 2F5EA 1J9IA 4CICA 5J8CA 5D6EA 5BQTA 2LMDA 3KP4A 3VYRB 2K9QA 3RQIA 2BGCA 2CUFA 5E1WA 1OJLA 2RKHA 4OAYA 2FEZA 4BDYA 2H8WA 4N9HA 4YRVA 1D8JA 3B6AA 2JT1A 2XGCA 3HRTA 3JCUC 4UVAA 1O3SA 3ZQIA 1J7KA 1J0RA 3E6MA 3S93A 2DFEA 3LSKA 3QYFA 3RIRA 2D45A 1SD4A 1VQ4I 2XF7A 2D5VA 1DDNA 3W2VA 3LA2A 1ZYRF 1LVAA 1A6QA 2WV1A 2OJED 2R5ZB 1XDSA 2ZSHB 1XMKA 3X2QH 3IHUA 2JRTA 2EV5A 2Z99A 3ABUA 4B4CA 2R7SA 1PJRA 4I0AA 2LP0A 2EINH 2DQLA 5LGTA 1V5FA 1TQIA 1ENHA 3F8MA 5ICEA 1TC3C 5DM6F 2CH0A 3W2WA 4XNFA 2LKPA 2H94A 1FBQA 4U7BA 3H5AA 1Z9CA 2HEOA 1RNLA 4BL0B 2R5ZA 5GAHJ 1ZREA 3Q0VA 3CP2A 2HS5A 3BTJA 5J4YA 2RREA 1K6YA 2OAZA 3CDLA 3ZQGA 5TRDA 2PI0A 3L9FA 1FMWA 3K4MA 1I1GA 2ZNZA 3MFKA 2FQ4A 2L4AA 4HG2A 3P7NA 2W4SA 2L7FP 5IP7J 2MYSA 2L2OA 3OSGA 3SQNA 2DOAA 4LLLA 1XGOA 1YX5A 1XC5A 3CESA 1KU7A 3OY9A 3CO7C 3G1OA 1DQUA 1E0EA 2A07F 3K10A 1K4TA 3HOSA 3R4KA 3MMYB 2PX9A 3TO9A 1AU7A 4HX4A 3S1NJ 2DDBA 4I99C 3WE3A 4C3IJ 1JJ6C 1VQ9I 3KZIC 1XS9A 1Z6TA 3JRBA 3AG3H 1VI0A 2BE5F 2AXLA 3DEWA 5EF6A 1U2WA 1ZLKA 2VASA 3OYLA 4QIWN 2Y9YA 4XOTA 3HSFA 2HZTA 1MSFC 2KJCA 4EJUA 2PQ8A 4ZYGA 1OQYA 3OYGA 1H0MA 4WXDA 2HNHA 5FD6A 1VZ0A 2FF4A 3FXLA 3A03A 2DQRA 5IYDJ 2PJPA 5K7ZA 1FIAA 2A68F 2E19A 2JQ7A 2E1MB 1WPKA 1Z7UA 2AO9A 3SDBA 4IF4A 4ZDPA 4IKFA 2G0EA 3D0SA 2RAEA 2EV0A 3SEQA 1R4NB 2Y9ZA 1XN7A 2MLKA 2L9RA 2L9SA 2P8TA 1YS6A 4CCNA 2H6BA 2A61A 4GRIA 4F91B 3TW7A 1TT5B 2VN2A 2BY3A 2L54A 2R93J 2CWEA 3ASNH 5HLIA 1WJ5A 2D2WA 2EFOA 2L01A 3CZ6A 2AXTC 4AIKA 3GVAA 1DU0A 2EFNA 4XLHA 4L0YB 1KQ9A 3SHFA 1GDTA 2GWRA 5K7FA 5HODA 3T5XA 1K4SA 2QSFX 2BY0A 3FXJA 4BY1J 5C4JJ 5IOZA 3OYHA 1NG7A 4Y17A 2X51A 2UV1A 3TEDA 2HPMA 1LNWA 3WU0A 2IA0A 4IHTA 1JKOC 3ZMVA 2Z2SB 3KEYA 3DTIA 4CCJA 3VB2A 4EJWA 1VQNI 2MD5A 2FMLA 5CLSA 3L2VA 1E3OC 2OTJI 4NDLA 2V9VA 2JA8J 2ELHA 2VXDA 2OUMA 1ZR2A 5AIQA 3DXJF 4L9TA 2ZXJA 1P6RA 3GW2A 2E1MC 3FWEA 4YEJA 4I6ZA 1QQIA 4FCYA 2XKOA 3OWTA 4KJZA 2COBA 4CXFA 2HPIA 4ITVA 3LSJA 4BXUA 2MSYA 3RKYA 1WI9A 2MABA 1E3HA 5KVRA 4A6EA 1U6GA 2M30A 1P9QC 2COMA 1HBXG 1BL0A 3C2HA 1Z3XA 5LHHA 3M7GA 2NVQJ 2Y69H 2F5CA 3HGGA 2DMPA 3A4CA 1T98A 4YG2F 3I4PA 2V7FA 5F0FA 5D8LB 2W00A 3L2QA 3OS2A 2LY2A 1FT9A 1ETVA 1ZHFA 3CCSI 5FRNA 1QA6A 4KISA 3HOXJ 1JGGA 3FBNB 1XMXA 4HQMA 1RKWA 3K1MA 3O6BB 2DI3A 3E6CC 2XVCA 3SZGA 2ZJ2A 2KIFA 2CQQA 1SFXA 2IS6A 5HDGA 2OBPA 4BS9A 3RKWA 3EQLF 4KIBA 2DYSH 3KP2A 3LFUA 4I98B 4P5OA 4UV8A 2OF7A 4WCGA 1LEAA 1WQ2A 5B1AH 3BTIA 1BBYA 3DKXA 3QPLA 2E2IJ 4C2MJ 2CUJA 5JVTA 5FGMA 3TOAA 1FJLA 4XR6A 2XB5A 3S32A 1ULYA 3E6DA 1IRZA 1YW7A 3NARA 2VUMJ 4J00A 3DLAA 1V55H 3BDDA 2OC6A 4F52A 1R9TJ 4UUTA 3GX4X 3ULQB 2EPFA 1ZRDA 4IHSA 3GFIA 1ETKA 2M9HA 4RBOA 5FLXK 1XX5A 2IAIA 1X1BA 2YUSA 1O3QA 3HM5A 3I59B 2TRTA 4I09A 3I71A 3KZYA 1YOVB 3V7RA 3CO6C 1NHAA 4NQWB 5JLWA 1BR4A 1X3WB 3PFIA 2M7BA 4MO7A 2LDUA 4A3FJ 3F9KA 3E3VA 2B9SA 4ZDLA 4L9JA 4OIOF 3BT9A 1OLTA 2VQCA 1T33A 2BY2A 3HOZJ 3NAUA 2ME0A 4BDZA 4HQEA 1BR1A 3JW4A 2K4JA 3I59A 4PJ0C 2BVLA 5K5QA 1USSA 2IW5A 4O3MA 5DS9A 4NQWA 1PUEE 1MBFA 2O03A 2HOTA 2EA2A 1YW8A 2ZC2A 1QPMA 4OINF 5FFXA 1JT6A 3HGYA 4ZYDA 2XAJA 3H5NA 1KU9A 1ZQ3P 2DK8A 4YFXF 1P4AA 3BR0A 2CS3A 5CKTA 5KAIC 5IY5H 1H8AC 5IYBJ 2JUCA 1A5JA 1DP3A 3PNYA 4RGRA 2LG4A 3F3XA 4E6KG 1OFCX 1W7PD 2GA1A 1YJ9I 5A2QK 3ISPA 4BJ5C 2XAGA 4M6VA 4WXHA 2WB1N 2EBIA 1I39A 1SMYF 1S5LC 4XIDA 2PMZA 2FMYA 3JRIA 2IBDA 3OR1C 2YR2A 3GWZA 1HQCA 1D3YA 1MIJA 5AIPA 2O7OA 5KHDA 2YX7A 2V1UA 3DU5A 2VODA 3RYRA 5F64A 2JUGA 3K7AJ 2E5NA 1R5ID 1MBHA 1TWAJ 2CQXA 3GTKJ 1LVKA 1HXDA 4Y13A 2B7EA 4A3BJ 4YIIA 2XAFA 5H6RA 4C30A 2C6YA 1JKPC 2DBBA 2NOGA 2K5CA 2P5VA 5FFZA 1LPQA 4M6YA 2A3SA 2O61A 1STZA 1BA5A 4L5EA 3PL8A 4JOMA 4BQAA 1X4PA 4F92B 1IO2A 3JSPA 2KIMA 4CCOA 2VBZA 4A3MJ 2BHZA 3ZMSA 1R49A 4ZH4F 1Z3YA 1XD7A 3FHZA 2GIZA 1W0UA 3DFGA 4QSHA 1WI3A 2CJJA 3L1PA 1E2XA 2NYXA 3FF5A 2ZXWH 1VQ6I 2QWWA 1WJCA 3GTQJ 3I3LA 5FO5A 4I76A 2VL8A 1GVJA 3H3ZA 1P2FA 1B59A 1X1DA 3KFWX 4RLFA 4Y4RA 3AL0B 5E8IA 1IW7F 1SVOA 2RNGA 1U0JA 4UUSB 2K3FA 3ZQHA 3KCCA 4EGZA 1ZTRA 1QZYA 1G3SA 3TO6A 2P4WA 1PDNC 3IH4A 5J47A 1DGRM 3LMMA 1UB9A 1G8XA 2VPLA 4V2GA 2JWTA 5FLXZ 4AYBN 4EJVA 3FXKA 2NOJB 2DU9A 3HHGA 5HDNA 3GEZA 5EGOB 1RR8C 4CCMA 4UUSA 1ZG5A 1RRJA 1ZGWA 1R58A 4UVCA 1FPQA 3ERMA 3E5QA 2R5YA 1S7OA 2NS0A 4LGWA 4XLNF 1BI0A 2EIMH 3G4SI 1R7JA 4RS8A 1IV6A 2L5QA 2LKSA 2OPTA 2VBYA 2ELJA 5CJ9A 2O5RA 2IJLA 2XV4S 1MMGA 1QU3A 2G7HA 1LFBA 5EGOA 1SAXA 3O8HA 2QENA 2R4GA 3WTZA 1FP2A 2XGEA 1ONVA 2HOEA 4BE1A 2VLAA 2PG4A 2EILH 3E1SA 3IRRA 3S3NA 1HC8A 1D0ZA 5LGNA 3LFKA 2F5VA 3MZHA 2FBIA 3E5UA 2PMUA 1REPC 5GP9A 3A0BC 4RA2A 3TP0A 4V19K 2VT2A 4MIMA 2STTA 3DEEA 3DTKA 3WTYC 3L2RA 2NVXJ 2ID6A 4XL9A 3S3OA 3GTLJ 3OR2C 4C3HJ 4ZYHA 4KN4X 4XSZF 3VYUB 4F7ZA 3HOTA 2FU4A 1XDUA 3F6OA 2P0WA 4XICA 1W5SA 3HJEA 3BZCA 1AA7A 1DPRA 1FSEA 1GXQA 3T1BA 4KICA 2NRAC 1JHHA 5E1ZB 3WU2C 1IGNA 1HKTA 3EPZA 1YO5C 4RM3A 2XUBA 3TKYA 2ZNYA 3EDPA 3CCLI 3BZ6A 3DTEA 3DEUA 3H3VK 1QPIA 2HOAA 3FXMA 2W24A 5FRMA 2A6TA 3U1KA 3KLNA 3TP3A 4MFEA 1OCCH 2VQGA 1WH7A 1WZ2A 2DMUA 1MNDA 4PDKA 1WRJA 3JRHA 2WAQA 5D4SA 4XOPA 3E7LA 4A3LJ 4LB6B 1D1BA 5IT9Z 3L2UA 3S3MA 3LSMA 3WHCA 2X0LA 3V8KA 5LHGA 3KIOA 4XBFA 5D5WB 1JUMA 3CC2I 4HW0A 2XAUA 4FE4A 3RPQA 4EM1A 1Z77A 4CYCB 2M4GA 3PUFA 4KA4A 1UELB 1W1WE 2ISYA 1OYYA 3AFHA 2JPBA 3H3UA 3IAM2 3G1LA 3BJ6A 2OQGA 3R60A 1J5YA 5M3FJ 1MDMB 1PVEA 4CHUA 2F2EA 3O8GA 3V8LA 1O3TA 2XC7A 1WJAA 5CVIA 1GT0C 2VKHA 4Q48A 1PYVA 3RPUD 1E3PA 2GOMA 3QP6A 4CYCA 2G7UA 3VODA 4RLQA 2UXXA 3MD2A 1NG6A 3BQZA 2DA1A 3JSOA 2JZYA 2YU3A 1TT0A 4A3IJ 1QRYA 3FHNA 3BY6A 5LGUA 3HOUJ 1LDDA 3I53A 3IKVA 1VQ5I 2EFQA 1MDMA 1A31A 2ZB9A 4BQOA 2YS9A 1BI1A 2VBXA 3GCMA 1K78B 4KITB 3F72A 2G9WA 4E7IA 3HPHA 1FOXA 4C3JJ 3DF8A 5EEGA 4QLCU 3LOCA 2QCOA 2L7ZA 1BJAA 5ERIA 3U21A 3FXQA 4BUPA 1ZK8A 3G73A 3OMYA 1IF1A 4EJOA 1CGPA 1YW9A 5HOOA 2RV8A 2OD5A 4BEHA 2ZFWA 1X2MA 5HLGA 3CMYA 3OYCA 2K7LA 2J5OA 4MNUA 3K2AA 1BR2A 5M5XJ 3RQ4A 5HNFA 3D5LA 1Y1WJ 2FX0A 1K78A 3OS1A 1ZELA 5ED4A 3GTPJ 3VDXA 2E2JJ 3CCVI 3R0JA 4BAYA 2UZKA 2ZSIB 3QPHA 4L9VA 2FOWA 2Y48A 3HPGA 5HS9A 2K9NA 4DBQA 1YJWI 1PP8F 4HX8A 1QNTA 3B73A 4KN7X 2EZKA 2HDDA 3VYSB 1JUSA 2VOOA 3TL4X 4ESJA 2JSPA 1HW1A 4DZJA 4M72A 2HI3A 5F0HA 3BP8A 3J81K 3BZKA 3LSTA 3N4MA 2YSRA 4Q47A 1YTYA 4B48A 2Y0SA 5LLQA 3WGIA 3OIQA 1Q1VA 2XASA 2F5DA 3RKQA 2QF7A 1BC8C 3L7WA 3FM3A 4BH9A 5FJ8J 4AVPA 3WTWC 4KIGA 2BW3B 2QEXI 5CYVA 4IHXA 2JA7J 3AAFA 3ABMH 1F5TA 3HYIA 4E7LA 4A12A 3ERED 2ZO4A 4I7HA 3Q9SA 5FKOA 4RGUA 3GTJJ 2R7OA 4RAGA 5E3LA 2NXNB 4E7KA 3E0JB 2WY8Q 3BWGA 4AWXB 3E97A 1DU6A 2GZWA 4M3BA 3FXRA 4XLAA 4EEFG 5LHIA 3FIWA 1EA3A 2BW3A 2ESNA 3K6GA 3PQJA 1U8BA 3S1QJ 5E20A 3CC7I 4IZZA 4HF0A 3J7YJ 5HLHA 2GAUA 4OIPF 4DGWB 2GM4A 3PM1A 3L2WA 3I5UA 2BOLA 1H88C 2ME6A 1YHQI 5HNHA 3I54A 3ZMTA 1HCRA 2V79A 4GXOA 4CZZA 1W36C 3TMOA 1ACIA 1LEBA 4AIJA 5TGTA 3KEQA 2M0MA 2IEKA 3WTXC 1JXSA 2VB6A 3C3WA 5F27A 2DMQA 1FYLA 2PFBA 3CP8A 1UFMA 4EATA 1VQMI 1LJ9A 2PEXA 1SMTA 1XGNA 1XGMA 3CJQB 4PFPA 3SXYA 5LEJA 5BMZA 1Y56A 2M8GX 1ITYA 1R5GA 4PCQA 3HKZN 2CW7A 2I10A 1ON2A 4QPOA 2X1CA 1ZGJA 3G6EI 2XPUA 1Z0XA 3BCAA 1P4WA 4B09A 5HDKA 5KAFC 4R1HA 4XM3A 1I1SA 3SZPA 2E1OA 5FKLA 5LFAA 3HXLA 3KP7A 1YLFA 1UCRA 4CCKA 4LD5A 3BR3A 4JYKA 1RUNA 3SZTA 2VI6A 2VC0A 4Y7NJ 3AG2H 1T0FA 1GV2A 3Q5FA 3OS0A 2HVQA 4GYGA 1TTYA 2MW8A 2CGPA 1RETA 3MAJA 3K0LA 2X6OA 3QU6A 5M5WJ 3ZMUA 2DW4A 4A0YA 5H2FC 3FBIB 3SEZA 1XSXA 3GFJA 2ELKA 3C2GA 4ASNA 4DW6A 3HTSB 1KGSA 2QQ8A 3FMSA 4Q4ZF 2LRDA 4M9XA 3RTRA 5E3OA 4BNCA 1T0FC 4MEXF 1YJNI 1XSVA 3LAJA 3BCBA 2I8DA 2HQNA 2E7XA 1MH3A 5FD5A 3J81Z 3C18A 5LD2C 5BNGA 4CSWA 3S1MJ 4RB1A 4D9JA 3CMAI 4CZCA 2H27A 2JSCA 2KRCA 2IA1A 1R36A 2GXGA 2QVOA 1G2HA 4AVZA 5GTHC 2CQ7A 1QHGA 1J59A 3KX2A 4BQQA 5GAEJ 1A04A 4M3DA 2KFDA 3QU3A 4QWQA 2D1VA 2HU9A 2VQHA 2LBFB 3LSRA 3HOVJ 1XPXA 4UY8I 2DYRH 5KK1A 1ZRCA 1NK3P 3RDIA 2MH2A 5CQGA 2CUZA 1ZGAA 1YX3A 2JA6J 2Z1DA 1Z21A 1JUPA 3T0YA 1Z1DA 4ZZLA 3QPSA 2XSJC 3ZQCA 3QP5A 1YQAA 3JRFA 2TDXA 2A69F 1R1TA 2LBFA 3M4OJ 3D1NI 1MZBA 2DJNA 3F8CA 2EZLA 2R7TA 2EIJH 3S16J 4ANJA 1K7AA 5J8FA 5JFRA 2LF8A 1H9TA 4UUVA 3KETA 2LC2A 1MBJA 1I6HJ 2A6HF 1WJFA 5D6FA 3BTCA 1Z6RA 2KJBA 1X1AA 4FHTA 4OWRB 2YPRA 4B47A 2DA5A 2NNNA 1EH7A 3OYEA 4XMYA 5HS7A 5K5OA 2FNAA 4JQFA 2QZ8A 3K4CA 3VEPA 2Q2EA 4ZTJA 2CV2A 3CDIA 5IP6A 3HOWJ 2FA5A 4LK1F 3QRFF 4BE0A 1B8IB 1RR7A 4YFNF 3KYLA 3T8TA 3VSKA 1TLHB 1KYZA 1OR7A 4YELA 5DUIA 4LIVA 4ESBA 5ILSA 2BHYA 3CCJI 3M1CA 4IQJA 1YYVA 1FTTA 3F8NA 3RKXA 1AWCA 1R4MB 3LA3A 2Y31A 4N4NB 4ZYEA 4CA0A 4XRSA 5FLVA 1BOBA 5CQEA 3NQOA 1B8IA 3I0TA 5FKNA 4JK1X 3E5XA 1TWFJ 3DKYA 2MC4A 1U9OA
chains in the Genus database with same CATH topology
1ETXA 3S15J 3C2BA 3ZOBA 3JRGA 4UUSB 2K40A 2M2EA 2XRLA 3ZQHA 4A93J 1ZTRA 3QQAA 1FEXA 1QVUA 1BW5A 2NVYJ 4W97A 3IH4A 1FIPA 2ECCA 1RESA 3LSPA 2Y2ZA 4V2GA 3SDGA 2JWTA 3Q0WA 1SANA 3CCYA 4AYBN 2EZHA 3JRDA 1ZKGA 3UKGA 5EGOB 4UUSA 2MGQA 4HNVA 1VFCA 1MH4A 1IUFA 5C4XJ 1BJZA 1ZGWA 5EDNA 3SJMA 1HDPA 2R5YA 4X6AJ 2LLKA 1CQTA 5GPCA 1GV5A 1OCTC 1AKHB 4XK4A 1IV6A 3F0CA 5EG0B 5IYCJ 2OPTA 4JX4A 5F08A 1JKRC 2YU9J 2XGDA 2LK2A 1LFBA 5EGOA 3O8HA 2GLOA 1F43A 1UHSA 2XGEA 2DA6A 1HLVA 2HXOA 3Q3SA 4MFDA 5K7HA 2XB0X 1AKHA 3S17J 5EG0A 1UG2A 1U78A 2W48A 5GP9A 1IDYA 2HXIA 3TP0A 1X2NA 4MIMA 5F0CA 4G12A 4XRMA 2NVXJ 4BKXA 2ID6A 3GTLJ 4C3HJ 2LY9A 1I50J 2FD5A 4XICA 2MG4A 2DA3A 2JN6A 2M0CA 1FTZA 2N8GA 1IGNA 3JRAA 4BXXJ 4DZPA 3BG9A 3H3VK 1QPIA 2HOAA 2DN0A 2HYJA 2R92J 4X1EA 1ETOA 1PUFB 3TP3A 3HOYJ 3HB9A 4MFEA 1WH7A 5M5YJ 2DMUA 1T56A 3JRHA 1AHDP 1GUUA 2P81A 4DYRA 2H1KA 3A02A 3E7LA 4A3LJ 2XPWA 4J19A 2K9QA 3RQIA 2CUFA 1OJLA 2DMNA 3WHCA 1MBEA 3B6AA 2XGCA 1JUMA 1PUFA 4FE4A 3ZQIA 1Z77A 4CYCB 3HDDA 4A3KJ 3S2HJ 3HEFA 3IH3A 1IG7A 2D5VA 3PO3J 1VNDA 3A01B 3G1LA 2WV1A 2R5ZB 4BY7J 5M3FJ 5C44J 3O8GA 1P7JA 4LOCA 4B4CA 1GT0C 2LP0A 4M3FA 4DYQA 1RPWA 1ENHA 2ECBA 4CYCA 1TC3C 4V2FA 1P7IA 1ETQA 1TWCJ 5FKMA 3BQZA 3A01A 2DA1A 2LVSA 1QRYA 2R5ZA 1RKTA 3HOUJ 2R7ZJ 4D7MA 2O8KA 2PMZN 3Q0VA 2R5YB 3OSFA 1XG1A 3BTJA 2ZB9A 4D7NA 3S1RJ 2YS9A 2NS7A 1K83J 3CDLA 3ZQGA 4A3CJ 4JX5A 1Y1VJ 2FQ4A 4C3JJ 3LNQA 1U9NA 2L7FP 5IP7J 3LOCA 1ETYA 2QCOA 2L7ZA 4A3IJ 1POGA 4W1UA 2VKEA 1ZK8A 3RZOJ 3OSGA 5IPAA 4A3GJ 1XC5A 1X2MA 3CMYA 3G1OA 3K2AA 5M5XJ 3TW6A 4BBRJ 1Y1WJ 1AU7A 2FX0A 3S1NJ 3B6CA 4C3IJ 3GTPJ 1JJ6C 2R0QC 1XS9A 2E2JJ 3JRBA 5IOYA 1VI0A 5JLXA 3DEWA 5EF6A 2L7MP 5M3MJ 2K9NA 4AUXA 4MLOA 4QIWN 2Y9YA 1WCMJ 2EZKA 1MSFC 2HDDA 4FTHA 5FKKA 1JUSA 4A3EJ 2XSDC 1YRNB 1IC8A 4DZJA 3JREA 2HI3A 3A03A 5F0HA 5IYDJ 5K7ZA 1FIAA 2E19A 2NVTJ 2TCTA 1WPKA 5EZGA 2DA4A 2AO9A 4D5FA 2ID3A 2KDZA 1VF9A 1X58A 2G0EA 2RAEA 2Y9ZA 4Y52J 1Q1VA 2CRGA 3RKQA 2QF7A 2L9RA 5FJ8J 3MVPA 3TW7A 3G1MA 2HQ5A 1YRNA 4IHXA 4B3AA 2JA7J 2R93J 3WHBA 5FKOA 2DTZA 1DU0A 1GDTA 3GTJJ 5K7FA 4IHWA 5HODA 5E3LA 2L0KA 4IHVA 4BY1J 5C4JJ 5IOZA 1DU6A 4M3BA 4EEFG 3MN2A 5C3EJ 3FIWA 3DCFA 1U8BA 4S0HB 3TEDA 3BR6A 3S1QJ 3FK6A 3FISA 1HDDC 1JKOC 1JKQC 5EYRA 1I3QJ 3ZQFA 4IEJA 2HOSA 1E3OC 4NDLA 2VKVA 2JA8J 2GM4A 3PM1A 1ZR2A 4I6ZA 1H88C 4FCYA 2ME6A 1LFUP 5E3MA 2COBA 1MSEC 3LSJA 1HCRA 2MSYA 3W6VA 2DA7A 1QVTA 1IJWC 1MBKA 2IEKA 1BL0A 2NVQJ 2EH3A 5F27A 2DMQA 3HGGA 2CUEA 2DMPA 2XPVA 5F0FA 1O4XA 2M8GX 3BR5A 1ITYA 3HKZN 3MKLA 3VPRA 2EQRA 2X9DA 1ETVA 2I10A 2LKXA 3HOXJ 1JGGA 4A69C 2FJ1A 2XPUA 1Z0XA 1A6IA 5J1UA 1RKWA 4GFBA 2E1OA 5FKLA 3ZQLA 2CQQA 4B1RA 4ABZA 1EF4A 2DMTA 3FK7A 3BR3A 1HF0A 4JYKA 1WGXA 2OF7A 3Q0UA 2VI6A 4M3EA 3BTIA 1BW6A 2JMWA 2E2IJ 3QPLA 4C2MJ 4Y7NJ 2E2HJ 1FJLA 3PO2J 2LR8A 2XB5A 1GV2A 2LTPA 4IHYA 3S2DJ 1IRZA 2WAQN 3NARA 4FISA 2VUMJ 3GTOJ 1HOMA 1SFOJ 3JRCA 2MW8A 4UUTA 1R9TJ 2H8RA 1RETA 3CQZJ 5IP9J 2AHQA 4DYCA 2LFBA 2X6OA 3IH2A 4D5CA 5M5WJ 1ETKA 3GTMJ 2M9HA 4RBOA 2IAIA 3SFIA 2ELKA 2YUSA 4DW6A 3HM5A 2TRTA 2JA5J 3BR2A 5J1YA 1W0TA 3FKIJ 3H0GJ 5JLWA 5E3OA 1IDZA 4MO7A 4A3FJ 2JK3A 1B72B 1MH3A 3BT9A 3BG3A 5BNGA 3S1MJ 1T33A 3HOZJ 3NAUA 2ME0A 3OOUA 2GBYA 4QTRA 3BR1A 1MBGA 2NS8A 5J3LA 3S14J 1G2HA 4RDUA 5DS9A 1MBFA 2HOTA 1ETWA 1ORKA 4JX6A 2LD5A 1S7EA 4M3DA 4XRSG 1JT6A 3HGYA 1H89C 1B72A 1ZQ3P 1OCPA 1NK2P 5F04A 2KT0A 4AC0A 3LSRA 3BQYA 3HOVJ 3BR0A 1H8AC 1A5JA 5IYBJ 5GPAA 1TWGJ 5DTDA 1OFCX 1NK3P 3OIOA 3GTGJ 2CU7A 2JA6J 1MNMC 4M6VA 1APLC 2WB1N 2EBIA 3IV5A 2Y30A 1D5YA 1JUPA 4XIDA 3QPSA 3ZQCA 1WH5A 1TWHJ 3JRIA 2IBDA 3JRFA 1JTXA 1F36A 3GBGA 3D1NI 2DJNA 5EZHA 3M4OJ 2EZLA 4A3DJ 2O7OA 3S16J 1NTCA 2X48A 1GVDA 3K7AJ 3GTKJ 1MBHA 1TWAJ 2CQXA 5FLMJ 5J1RA 1K61A 3RZDJ 1MBJA 2M34A 3LSGA 1ZR4A 1I6HJ 3BTCA 4A3BJ 3M3YJ 3JR9A 5EEAA 4JP0A 2DA5A 5E3NA 1JTYA 1LE8B 1JKPC 4M3GA 2NOGA 1JJ8C 1BA5A 4L5EA 4FE7A 1UMQA 4BBSJ 9ANTA 5F1JA 3HOWJ 5IP6A 1B8IB 3HBLA 1RR7A 4A3MJ 2O9LA 2JJ7A 3I4NJ 2Y0SN 1JT0A 2B63J 3I4MJ 1W0UA 1LE8A 4QSHA 1FTTA 1WI3A 2VPRA 2CJJA 3L1PA 3BG5A 3BTLA 2Y31A 2K9SA 2DA2A 3GTQJ 4I76A 4XRSA 5FLVA 1B8IA 5FKNA 4A3JJ 2EZIA 1TWFJ 1U9OA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1ETX A;  3S15 J;  3C2B A;  3ZOB A;  3JRG A;  4UUS B;  2K40 A;  2M2E A;  2XRL A;  3ZQH A;  4A93 J;  1ZTR A;  3QQA A;  1FEX A;  1QVU A;  1BW5 A;  2NVY J;  4W97 A;  3IH4 A;  1FIP A;  2ECC A;  1RES A;  3LSP A;  2Y2Z A;  4V2G A;  3SDG A;  2JWT A;  3Q0W A;  1SAN A;  3CCY A;  4AYB N;  2EZH A;  3JRD A;  1ZKG A;  3UKG A;  5EGO B;  4UUS A;  2MGQ A;  4HNV A;  1VFC A;  1MH4 A;  1IUF A;  5C4X J;  1BJZ A;  1ZGW A;  5EDN A;  3SJM A;  1HDP A;  2R5Y A;  4X6A J;  2LLK A;  1CQT A;  5GPC A;  1GV5 A;  1OCT C;  1AKH B;  4XK4 A;  1IV6 A;  3F0C A;  5EG0 B;  5IYC J;  2OPT A;  4JX4 A;  5F08 A;  1JKR C;  2YU9 J;  2XGD A;  2LK2 A;  1LFB A;  5EGO A;  3O8H A;  2GLO A;  1F43 A;  1UHS A;  2XGE A;  2DA6 A;  1HLV A;  2HXO A;  3Q3S A;  4MFD A;  5K7H A;  2XB0 X;  1AKH A;  3S17 J;  5EG0 A;  1UG2 A;  1U78 A;  2W48 A;  5GP9 A;  1IDY A;  2HXI A;  3TP0 A;  1X2N A;  4MIM A;  5F0C A;  4G12 A;  4XRM A;  2NVX J;  4BKX A;  2ID6 A;  3GTL J;  4C3H J;  2LY9 A;  1I50 J;  2FD5 A;  4XIC A;  2MG4 A;  2DA3 A;  2JN6 A;  2M0C A;  1FTZ A;  2N8G A;  1IGN A;  3JRA A;  4BXX J;  4DZP A;  3BG9 A;  3H3V K;  1QPI A;  2HOA A;  2DN0 A;  2HYJ A;  2R92 J;  4X1E A;  1ETO A;  1PUF B;  3TP3 A;  3HOY J;  3HB9 A;  4MFE A;  1WH7 A;  5M5Y J;  2DMU A;  1T56 A;  3JRH A;  1AHD P;  1GUU A;  2P81 A;  4DYR A;  2H1K A;  3A02 A;  3E7L A;  4A3L J;  2XPW A;  4J19 A;  2K9Q A;  3RQI A;  2CUF A;  1OJL A;  2DMN A;  3WHC A;  1MBE A;  3B6A A;  2XGC A;  1JUM A;  1PUF A;  4FE4 A;  3ZQI A;  1Z77 A;  4CYC B;  3HDD A;  4A3K J;  3S2H J;  3HEF A;  3IH3 A;  1IG7 A;  2D5V A;  3PO3 J;  1VND A;  3A01 B;  3G1L A;  2WV1 A;  2R5Z B;  4BY7 J;  5M3F J;  5C44 J;  3O8G A;  1P7J A;  4LOC A;  4B4C A;  1GT0 C;  2LP0 A;  4M3F A;  4DYQ A;  1RPW A;  1ENH A;  2ECB A;  4CYC A;  1TC3 C;  4V2F A;  1P7I A;  1ETQ A;  1TWC J;  5FKM A;  3BQZ A;  3A01 A;  2DA1 A;  2LVS A;  1QRY A;  2R5Z A;  1RKT A;  3HOU J;  2R7Z J;  4D7M A;  2O8K A;  2PMZ N;  3Q0V A;  2R5Y B;  3OSF A;  1XG1 A;  3BTJ A;  2ZB9 A;  4D7N A;  3S1R J;  2YS9 A;  2NS7 A;  1K83 J;  3CDL A;  3ZQG A;  4A3C J;  4JX5 A;  1Y1V J;  2FQ4 A;  4C3J J;  3LNQ A;  1U9N A;  2L7F P;  5IP7 J;  3LOC A;  1ETY A;  2QCO A;  2L7Z A;  4A3I J;  1POG A;  4W1U A;  2VKE A;  1ZK8 A;  3RZO J;  3OSG A;  5IPA A;  4A3G J;  1XC5 A;  1X2M A;  3CMY A;  3G1O A;  3K2A A;  5M5X J;  3TW6 A;  4BBR J;  1Y1W J;  1AU7 A;  2FX0 A;  3S1N J;  3B6C A;  4C3I J;  3GTP J;  1JJ6 C;  2R0Q C;  1XS9 A;  2E2J J;  3JRB A;  5IOY A;  1VI0 A;  5JLX A;  3DEW A;  5EF6 A;  2L7M P;  5M3M J;  2K9N A;  4AUX A;  4MLO A;  4QIW N;  2Y9Y A;  1WCM J;  2EZK A;  1MSF C;  2HDD A;  4FTH A;  5FKK A;  1JUS A;  4A3E J;  2XSD C;  1YRN B;  1IC8 A;  4DZJ A;  3JRE A;  2HI3 A;  3A03 A;  5F0H A;  5IYD J;  5K7Z A;  1FIA A;  2E19 A;  2NVT J;  2TCT A;  1WPK A;  5EZG A;  2DA4 A;  2AO9 A;  4D5F A;  2ID3 A;  2KDZ A;  1VF9 A;  1X58 A;  2G0E A;  2RAE A;  2Y9Z A;  4Y52 J;  1Q1V A;  2CRG A;  3RKQ A;  2QF7 A;  2L9R A;  5FJ8 J;  3MVP A;  3TW7 A;  3G1M A;  2HQ5 A;  1YRN A;  4IHX A;  4B3A A;  2JA7 J;  2R93 J;  3WHB A;  5FKO A;  2DTZ A;  1DU0 A;  1GDT A;  3GTJ J;  5K7F A;  4IHW A;  5HOD A;  5E3L A;  2L0K A;  4IHV A;  4BY1 J;  5C4J J;  5IOZ A;  1DU6 A;  4M3B A;  4EEF G;  3MN2 A;  5C3E J;  3FIW A;  3DCF A;  1U8B A;  4S0H B;  3TED A;  3BR6 A;  3S1Q J;  3FK6 A;  3FIS A;  1HDD C;  1JKO C;  1JKQ C;  5EYR A;  1I3Q J;  3ZQF A;  4IEJ A;  2HOS A;  1E3O C;  4NDL A;  2VKV A;  2JA8 J;  2GM4 A;  3PM1 A;  1ZR2 A;  4I6Z A;  1H88 C;  4FCY A;  2ME6 A;  1LFU P;  5E3M A;  2COB A;  1MSE C;  3LSJ A;  1HCR A;  2MSY A;  3W6V A;  2DA7 A;  1QVT A;  1IJW C;  1MBK A;  2IEK A;  1BL0 A;  2NVQ J;  2EH3 A;  5F27 A;  2DMQ A;  3HGG A;  2CUE A;  2DMP A;  2XPV A;  5F0F A;  1O4X A;  2M8G X;  3BR5 A;  1ITY A;  3HKZ N;  3MKL A;  3VPR A;  2EQR A;  2X9D A;  1ETV A;  2I10 A;  2LKX A;  3HOX J;  1JGG A;  4A69 C;  2FJ1 A;  2XPU A;  1Z0X A;  1A6I A;  5J1U A;  1RKW A;  4GFB A;  2E1O A;  5FKL A;  3ZQL A;  2CQQ A;  4B1R A;  4ABZ A;  1EF4 A;  2DMT A;  3FK7 A;  3BR3 A;  1HF0 A;  4JYK A;  1WGX A;  2OF7 A;  3Q0U A;  2VI6 A;  4M3E A;  3BTI A;  1BW6 A;  2JMW A;  2E2I J;  3QPL A;  4C2M J;  4Y7N J;  2E2H J;  1FJL A;  3PO2 J;  2LR8 A;  2XB5 A;  1GV2 A;  2LTP A;  4IHY A;  3S2D J;  1IRZ A;  2WAQ N;  3NAR A;  4FIS A;  2VUM J;  3GTO J;  1HOM A;  1SFO J;  3JRC A;  2MW8 A;  4UUT A;  1R9T J;  2H8R A;  1RET A;  3CQZ J;  5IP9 J;  2AHQ A;  4DYC A;  2LFB A;  2X6O A;  3IH2 A;  4D5C A;  5M5W J;  1ETK A;  3GTM J;  2M9H A;  4RBO A;  2IAI A;  3SFI A;  2ELK A;  2YUS A;  4DW6 A;  3HM5 A;  2TRT A;  2JA5 J;  3BR2 A;  5J1Y A;  1W0T A;  3FKI J;  3H0G J;  5JLW A;  5E3O A;  1IDZ A;  4MO7 A;  4A3F J;  2JK3 A;  1B72 B;  1MH3 A;  3BT9 A;  3BG3 A;  5BNG A;  3S1M J;  1T33 A;  3HOZ J;  3NAU A;  2ME0 A;  3OOU A;  2GBY A;  4QTR A;  3BR1 A;  1MBG A;  2NS8 A;  5J3L A;  3S14 J;  1G2H A;  4RDU A;  5DS9 A;  1MBF A;  2HOT A;  1ETW A;  1ORK A;  4JX6 A;  2LD5 A;  1S7E A;  4M3D A;  4XRS G;  1JT6 A;  3HGY A;  1H89 C;  1B72 A;  1ZQ3 P;  1OCP A;  1NK2 P;  5F04 A;  2KT0 A;  4AC0 A;  3LSR A;  3BQY A;  3HOV J;  3BR0 A;  1H8A C;  1A5J A;  5IYB J;  5GPA A;  1TWG J;  5DTD A;  1OFC X;  1NK3 P;  3OIO A;  3GTG J;  2CU7 A;  2JA6 J;  1MNM C;  4M6V A;  1APL C;  2WB1 N;  2EBI A;  3IV5 A;  2Y30 A;  1D5Y A;  1JUP A;  4XID A;  3QPS A;  3ZQC A;  1WH5 A;  1TWH J;  3JRI A;  2IBD A;  3JRF A;  1JTX A;  1F36 A;  3GBG A;  3D1N I;  2DJN A;  5EZH A;  3M4O J;  2EZL A;  4A3D J;  2O7O A;  3S16 J;  1NTC A;  2X48 A;  1GVD A;  3K7A J;  3GTK J;  1MBH A;  1TWA J;  2CQX A;  5FLM J;  5J1R A;  1K61 A;  3RZD J;  1MBJ A;  2M34 A;  3LSG A;  1ZR4 A;  1I6H J;  3BTC A;  4A3B J;  3M3Y J;  3JR9 A;  5EEA A;  4JP0 A;  2DA5 A;  5E3N A;  1JTY A;  1LE8 B;  1JKP C;  4M3G A;  2NOG A;  1JJ8 C;  1BA5 A;  4L5E A;  4FE7 A;  1UMQ A;  4BBS J;  9ANT A;  5F1J A;  3HOW J;  5IP6 A;  1B8I B;  3HBL A;  1RR7 A;  4A3M J;  2O9L A;  2JJ7 A;  3I4N J;  2Y0S N;  1JT0 A;  2B63 J;  3I4M J;  1W0U A;  1LE8 A;  4QSH A;  1FTT A;  1WI3 A;  2VPR A;  2CJJ A;  3L1P A;  3BG5 A;  3BTL A;  2Y31 A;  2K9S A;  2DA2 A;  3GTQ J;  4I76 A;  4XRS A;  5FLV A;  1B8I A;  5FKN A;  4A3J J;  2EZI A;  1TWF J;  1U9O A; 
#chains in the Genus database with same CATH topology
 3WG9 A;  4XON A;  1V54 H;  3S15 J;  4HV6 A;  4FT8 A;  3C2B A;  3LSH A;  3P9I A;  3ZOB A;  2K40 A;  1Z05 A;  1OR7 C;  1QVU A;  4I02 A;  5DEQ A;  5F6F A;  4Q5S F;  2NVY J;  3ZR8 X;  4FQG A;  1MMS A;  2ECC A;  1WHU A;  2X6Y A;  1RZ4 A;  2HYF A;  2J5P A;  2Y2Z A;  5DDG A;  1X1C A;  3Q0W A;  3KLO A;  3EYI A;  3CCY A;  5L3G A;  3VOE A;  3ZQ7 A;  2R7U A;  2M3A A;  3PNV A;  2E5Z A;  3LSI A;  3JRD A;  2HR3 A;  4LIT A;  4DNC A;  3H1C A;  4BJ6 C;  2VC1 A;  4HNV A;  1VFC A;  4NC8 A;  2WTE A;  1IUF A;  3ASO H;  3EUA A;  2OZ6 A;  1YIO A;  1WJB A;  1XSD A;  2KKO A;  3IP4 B;  2X6W A;  4LB5 A;  4LFU A;  4LLG F;  2VIX A;  1CQT A;  2D1H A;  4RMN A;  1OCT C;  1L3L A;  1UJ8 A;  2CQN A;  2MH9 A;  2NVU B;  5EG0 B;  3KP6 A;  4MEY F;  4JX4 A;  2ETH A;  2H1L A;  3H9Q A;  1S8N A;  2XRO A;  2KZV A;  1J2X A;  3OYD A;  3U9G A;  2L9V A;  2M45 A;  4PUS A;  2QKL B;  2GLO A;  3K4K A;  2DA6 A;  3JAM Z;  3KPH A;  3UR3 C;  2QM3 A;  3OYI A;  3V8J A;  2IGO A;  4UB8 C;  1SD7 A;  3S17 J;  5EG0 A;  1ZG1 A;  2VJJ A;  2BBY A;  4RB2 C;  1VTN C;  2K02 A;  3RSN A;  2FE3 A;  2WC2 A;  3GF2 A;  5F0C A;  1RC9 A;  4G12 A;  3IRQ A;  5J40 A;  4BKX A;  3F22 A;  1KU2 A;  4BAC A;  3H35 A;  2WBM A;  1YI2 I;  3GZ6 A;  2VON A;  2E36 A;  3HG9 A;  4HDV A;  1N75 A;  1IZ1 A;  2JN6 A;  4XOR A;  4PJL A;  1W5C C;  2O6G E;  3A1Y A;  4G6T B;  1HA8 A;  2N8G A;  3IL2 A;  5E1X A;  1XCV A;  4HZF A;  2IXS A;  3BG9 A;  4A5M A;  5D5U B;  2KRH A;  3N97 A;  1S3J A;  2HYJ A;  2R92 J;  4E7H A;  4H0E A;  3HB9 A;  4WK8 F;  2CV1 A;  1AHD P;  2MFZ A;  1GUU A;  2P81 A;  4DYR A;  4IRH A;  4MQV A;  2Z9O A;  2H1K A;  3A02 A;  3OL3 A;  4HPQ A;  4J19 A;  1TP4 A;  5LBQ A;  3MZY A;  4P96 A;  2Y0M A;  3FXU A;  2DMN A;  2RC4 A;  3EUH A;  2QKM B;  4G7Z F;  1I5Z A;  5IT9 K;  5L3D A;  2ZJQ F;  4KT6 A;  1FOW A;  5CPR B;  5JI6 A;  3OYA A;  1R1V A;  2BXY A;  4XLE A;  3L2C A;  2IGN A;  4M9Z A;  4PFO A;  2DPD A;  3HDD A;  3KYD B;  3WTT C;  4A3K J;  2GXB A;  3S2H J;  4NB5 A;  3IH3 A;  3KP3 A;  4UHT A;  3CDH A;  1VND A;  1XMA A;  1Y39 A;  1XCB A;  5C44 J;  4G8X A;  2Y75 A;  3CME I;  2CV0 A;  4BE2 A;  4M3F A;  2JPC A;  4DYQ A;  1RPW A;  2GOX B;  3U2R A;  2M8E A;  4HNU A;  1QO0 D;  2ECB A;  3QOP A;  4L5I A;  2M5W A;  4FX0 A;  2BEO A;  3RJP A;  2WAF A;  3QPT A;  1YIJ I;  2B0L A;  2LVS A;  1BC7 C;  4MTE A;  2R7Z J;  1H9G A;  2PMZ N;  1D1C A;  1R1U A;  3NRV A;  2HYG D;  3AKZ A;  2R5Y B;  3OSF A;  1S29 A;  4KUM A;  2NS7 A;  4G94 A;  2K86 A;  4RAF A;  3QOD A;  2MLG A;  1O3R A;  4P55 A;  4A3C J;  3ROU A;  3ZN1 A;  2UUZ A;  4JX5 A;  4XKC A;  1OKR A;  2IA2 A;  1S72 I;  1ETY A;  5JHU A;  3RZO J;  4F93 B;  1FP1 D;  5GTI C;  4EM0 B;  4O6J A;  3WU1 B;  2FUG 2;  1FYM A;  5IPA A;  3H36 A;  4A3G J;  2P5L C;  1GLN A;  1I6X A;  4QPQ A;  4HDU A;  2P5K A;  3OV8 A;  4TV7 A;  2OU2 A;  2W84 A;  3WOD F;  3TO7 A;  1IN4 A;  4BBR J;  2RDP A;  2WV0 A;  5J4V A;  5IT3 A;  3B6C A;  5ICC A;  1B9M A;  1G4D A;  3WTV C;  4IO9 F;  4MGR A;  2R0Q C;  4EVI A;  1BI2 A;  3WE2 A;  5JLX A;  3HRS A;  1WVR A;  1T2K A;  3AL0 C;  5M3M J;  1WWX A;  1ZN2 A;  3C1D A;  4XKV A;  1C0W A;  3CF2 A;  4AUX A;  2MBF A;  4MLO A;  1IV8 A;  4PK4 A;  4FTH A;  2DTR A;  2Q0O A;  4EM2 A;  4A3E J;  3ECO A;  3GXO A;  2DPU A;  1IC8 A;  3JRE A;  5H20 A;  2QSG X;  4IOC F;  1KQ0 A;  2NVT J;  2TCT A;  3AG4 H;  4WF2 A;  1WFX A;  2DA4 A;  5EZG A;  4YIR X;  4PGH A;  4YIF A;  1UST A;  2ACJ A;  3DPT A;  1KZH A;  2ID3 A;  4GDF A;  1VF9 A;  1X58 A;  3H9J A;  1B9N A;  3JTH A;  1D5V A;  5E17 F;  2XGX A;  3MVP A;  3NWT A;  3F23 A;  1HST A;  2FXA A;  3G1M A;  1G59 A;  4B3A A;  3WGG A;  3HHH A;  4OMY A;  4RB0 A;  1T08 B;  2K4B A;  3ZPL A;  3HL2 A;  4XLC A;  1G3Y A;  1FZP B;  2UXN A;  1U3E M;  2MA3 A;  5LEK A;  1VQ7 I;  4IHW A;  2EJR A;  2L0K A;  2VT3 A;  2LH9 A;  1R23 A;  5AON A;  2IT0 A;  1AOY A;  1V5E A;  4G6D A;  3RCO A;  3DCF A;  2FBH A;  4ETS A;  3BR6 A;  3O3K A;  1Y0N A;  1HDD C;  2W7N A;  3M1E A;  1JKQ C;  5EYR A;  1IRF A;  4IEJ A;  3ZQF A;  5B3S H;  1F4K A;  2HDC A;  2A5Y B;  3CJN A;  2VKV A;  4XQF A;  5HVQ C;  4YFK F;  2LYC A;  2RQP A;  4HX7 A;  1YFH A;  5DD4 A;  5E3M A;  1YE9 A;  1MD0 A;  4PSW A;  4L18 B;  3H9G A;  3IC7 A;  3DBH B;  4ZYA A;  1IJW C;  2EH3 A;  1UAA A;  5ICG A;  3SFZ A;  4L0Z B;  2EFW A;  5E8G A;  2QQA A;  2XPV A;  1ON1 A;  5DCM B;  4EMS A;  1MW7 A;  3HC7 A;  3GZN B;  1VQL I;  2QUF A;  2X9D A;  2EQR A;  1MJ9 A;  2AQE A;  2HGC A;  3IUO A;  3N05 A;  2LKX A;  4I0B A;  4A69 C;  3HRU A;  2GA2 A;  5J1U A;  1A6I A;  1TW3 A;  4E7J A;  4BEH B;  3Q9V A;  2V1X A;  4GFB A;  4PJJ A;  4M71 A;  5DV5 A;  1IRX A;  1QZZ A;  3DBL B;  3ZQL A;  4U0V A;  5D4R A;  2R3S A;  5D5X B;  1V5G A;  2F4M B;  2IGK A;  3FK7 A;  5DCM A;  2DT7 B;  4A0X A;  1HW2 A;  2IP2 A;  2XF5 A;  4BXF A;  1HF0 A;  4DBR A;  1G6N A;  2E1N A;  2I5U A;  1SVL A;  3CD6 I;  1IUY A;  4H4K C;  1DPU A;  1N25 A;  3KE2 A;  1IXS B;  5HLT A;  2KRF A;  4IHY A;  3S2D J;  3DKW A;  2WAQ N;  1VQK I;  1SD5 A;  3MKW B;  4LMY A;  1SFO J;  1T95 A;  4OU0 A;  1N78 A;  2L7K A;  1UZC A;  5B1B H;  2H8R A;  1PP7 U;  1FNN A;  1T6S A;  5IP9 J;  2W85 A;  3GTM J;  2Q1Z B;  2FOK A;  2X4H A;  1A36 A;  2RVC A;  3TBI A;  1QBJ A;  2JA5 J;  3E6B A;  5GAD J;  3BR2 A;  4A6D A;  5J1Y A;  3H0G J;  5KNL A;  4F55 A;  3CUQ A;  1IDZ A;  2ESH A;  2DO7 A;  2JK3 A;  1KU3 A;  1B72 B;  1Y8Q B;  4ZJZ A;  2R7X A;  4BU2 A;  4EV0 A;  1FLI A;  4A0Z A;  3OOU A;  2MD0 A;  1MKM A;  2ZFU A;  1E17 A;  3M8E A;  2LY1 A;  1RIO H;  4QTR A;  3JTG A;  2DOD A;  1MBG A;  2NS8 A;  2E34 A;  3TDU C;  3I56 I;  2X85 A;  4R79 A;  3S14 J;  3FZV A;  1OYI A;  2XAH A;  4XSX F;  1S7E A;  2L3D A;  2P7V B;  4XRS G;  1FBU A;  4Z6Y A;  1B72 A;  1OCP A;  2O3F A;  4G9Y A;  3FM5 A;  1NK2 P;  3BQY A;  3QWL A;  2KIU A;  4KFC A;  5GPA A;  2WWY A;  1TWG J;  3GO5 A;  3V4G A;  2R7Q A;  4GCV A;  3A2K A;  5FRO A;  1S9H A;  1MNM C;  3M8J A;  1X1P A;  1HSJ A;  3H92 A;  4HOB A;  3ZMZ A;  1TWH J;  2LOO A;  1SD6 A;  4BYY A;  4D1Q A;  4KIF A;  5EZH A;  1Y6I A;  5EEH A;  2V26 A;  4DJA A;  3DQV C;  1NTC A;  4RGX A;  1I27 A;  2DFF A;  1GVD A;  5D8K B;  3DP7 A;  1UHM A;  5JVG F;  3ABK H;  4PZJ A;  4NNJ A;  5HS8 A;  2KMU A;  5J1R A;  3WGH A;  1FOK A;  2IS1 A;  4U7D A;  1ZR4 A;  3L00 A;  5H6Q A;  3V7C A;  2KDO A;  4HBL A;  2A05 A;  3M3Y J;  3J7Z I;  3JR9 A;  5EEA A;  4CCL A;  2DFI A;  4JP0 A;  1LE8 B;  3TQN A;  2LRE A;  3PQK A;  2E71 A;  4LK0 F;  2Q8K A;  2FQ3 A;  3V7S A;  1JJ8 C;  1YG2 A;  2IS4 A;  1TNS A;  1DP7 P;  2WA0 A;  2DK5 A;  5K5R A;  1KA8 A;  1EV7 A;  5ILU A;  4BBS J;  9ANT A;  2BZT A;  5F1J A;  1SFE A;  2VJ5 A;  3LQR A;  4NUB A;  4OAZ A;  2IRF G;  4G7O F;  2EB7 A;  3HBL A;  2PJR B;  3I4N J;  2Y0S N;  1BOA A;  3HSR A;  1JT0 A;  2IGM A;  2QGU A;  3I4M J;  1TL8 A;  1LE8 A;  2W1O A;  2KIS A;  2W82 A;  4UVB A;  1TQP A;  2VPR A;  4M6X A;  2RGV A;  3BG5 A;  3BTL A;  4RGS A;  2HDW A;  2JA2 A;  2K9S A;  4OOI A;  4RM2 A;  3BG6 A;  3MEX A;  6PAX A;  2M4K A;  2RNJ A;  3W6K B;  2PJR A;  2Z33 A;  2VKD A;  2KP6 A;  1D8K A;  2VE9 A;  4ZTF A;  2PLY A;  4KYW A;  3G3Z A;  3JRG A;  4Z2Y A;  1YIT I;  2M2E A;  3K69 A;  3QQA A;  4XN3 A;  2F4I A;  3CTA A;  2HVS A;  2CW8 A;  1LFP A;  4W97 A;  1G3W A;  1FIP A;  1RES A;  4PSX A;  3IKT A;  4RAY A;  1SC7 A;  3P9C A;  4HSR A;  4HV5 A;  1D0X A;  1SAN A;  2FSW A;  1F1Z A;  4B8X A;  3ZCO A;  1MJB A;  3ABL H;  4WX9 A;  4ENM A;  3COA C;  1IN8 A;  1ZKG A;  3UKG A;  4EGY A;  3W3C A;  4AD9 A;  2MGQ A;  5C4X J;  1BJZ A;  4LG3 A;  4G6Q A;  5EDN A;  1M1E B;  3SJM A;  2F6C A;  4X6A J;  2LLK A;  4FX4 A;  4IVN A;  4BHB A;  3D5S C;  1MMD A;  2ICW G;  3NEU A;  2WAE A;  3QYB A;  5GPC A;  1SVM A;  1GV5 A;  2AQF A;  2XDV A;  1BM9 A;  1IXR C;  1W7P B;  4FET A;  4X0G A;  1AKH B;  3F0C A;  2VOP A;  3KP5 A;  4BQN A;  3DWL E;  1D0Y A;  4NHJ A;  1ODD A;  1ZG3 A;  4IRG A;  2NNY A;  1JKR C;  2XGD A;  2YU9 J;  2LK2 A;  3CCR I;  1W4M A;  2L4M A;  2EFP A;  1MNE A;  2K27 A;  2ZCW A;  2VXZ A;  3BJA A;  1FWZ A;  1FX7 A;  1B6A A;  1HLV A;  4EJT A;  2R7F A;  2HXO A;  2XAQ A;  4MFD A;  5K7H A;  3JAM K;  2XRN A;  5FB2 A;  2PBI A;  4J01 A;  2GQQ A;  1W7P A;  1AKH A;  1FOY A;  4C2T A;  1UG2 A;  1U78 A;  2W48 A;  4A5N A;  4PGG A;  3PSI A;  4UB6 C;  2OA4 A;  5ILV A;  4XRM A;  2DOE A;  1F9N A;  4II3 A;  3H0D A;  3W2A A;  4B44 A;  2VE8 A;  4KT5 C;  2DAO A;  3REO A;  2FD5 A;  2M0C A;  3J7A Y;  2BXZ A;  4ZC3 A;  3LL7 A;  3CMM A;  1FTZ A;  1WSU A;  1HKS A;  4PJM A;  3JRA A;  4BXX J;  4DZP A;  2ZBK A;  1OCO H;  2WY7 Q;  4KMU X;  3LA7 A;  2GXA A;  2Q2E B;  2KIQ A;  5DYM A;  2K9L A;  1GHC A;  1PUF B;  1LDJ A;  3HOY J;  4U0Y A;  3GFL A;  4IJA A;  1T56 A;  3QYE A;  2L9N A;  4HF1 A;  4XLF A;  2XPW A;  2DDA A;  2V6C A;  1KYW A;  1Z67 A;  1ERD A;  1X3U A;  2CFO A;  2JRM A;  3QOE A;  1W36 D;  2K3P A;  5B5E C;  2DLL A;  1W5T A;  2E7W A;  1MBE A;  2A5W A;  2ZME B;  3GLX A;  4II2 A;  3I58 A;  4IRI A;  1PUF A;  2GIV A;  4ON0 A;  5DD8 A;  2VBW A;  3WTU C;  3K1N A;  2E35 A;  2P6S A;  2UWM A;  4HYE A;  3HEF A;  2XHK A;  2CW0 F;  1IG7 A;  2QLZ A;  3S8P A;  3PO3 J;  3HTU A;  3A01 B;  3I9V 2;  4E7Z A;  3HZJ A;  3DBR B;  4BY7 J;  3U1D A;  1BN5 A;  1TBX A;  1IRG A;  1TZL A;  4LIU A;  4AM3 A;  1P7J A;  2ZME A;  4LOC A;  4HEA 2;  3TGN A;  4B3X A;  1JGS A;  4WWC A;  3CF5 F;  4WXC A;  1ZH5 A;  3AG1 H;  4KMF A;  2HQA A;  1SFU A;  4V2F A;  1WJE A;  3IWZ A;  1VQO I;  2FBK A;  1P7I A;  1WJD A;  1FYK A;  2BV6 A;  1J09 A;  1ETQ A;  1ZAR A;  1TWC J;  2IPQ X;  5FKM A;  1R71 A;  4LLN A;  1LB2 A;  3A01 A;  3GLL A;  1GXP A;  4M9S A;  1RKT A;  1BI3 A;  4D7M A;  2O8K A;  1DGW Y;  1XG1 A;  4D7N A;  5L3C A;  3S1R J;  1QZE A;  3MKY B;  2JVG A;  5DM7 F;  1K83 J;  4OIR F;  1OPC A;  3M07 A;  2P7C B;  3L09 A;  1Y1V J;  1MMA A;  1OCZ H;  4GYI A;  2ZME C;  3LWF A;  4CUG A;  3LNQ A;  3F21 A;  2Z3Y A;  1U9N A;  1LQ1 A;  2HZD A;  2WB1 A;  1POG A;  4W1U A;  2MC3 A;  2VKE A;  3ZXS A;  1XGS A;  4CO8 A;  3K4L A;  3D5R C;  2HTS A;  3SYT A;  4I2O A;  3TW6 A;  2EA4 A;  2PN6 A;  2NAZ A;  3NWS A;  2F48 A;  4MHG A;  5IOY A;  4IX7 A;  1HKQ A;  1LUJ B;  3PNT A;  1U8R A;  3FDY A;  2H09 A;  2EK5 A;  2XF6 A;  1S6L A;  2L7M P;  2VJI A;  4XKW A;  5LRR A;  4DOZ A;  4IXA A;  1WCM J;  2M1B A;  3CJR B;  5FKK A;  2HVR A;  4M74 A;  2YX4 A;  2ISZ A;  2XSD C;  2W57 A;  1YRN B;  1B4A A;  3H5R A;  3F8F A;  3MCZ A;  1P4X A;  2F5F A;  2O0Y A;  4IOA F;  3OL4 A;  4ZZD A;  4BHC A;  4AU7 A;  4D5F A;  4OIQ F;  4MQ9 F;  4L5J A;  4XKB A;  2KDZ A;  3G71 I;  4Y52 J;  2VJ4 A;  2QSH X;  2CRG A;  2V9P A;  1BIA A;  1EH6 A;  3HIF A;  3ELK A;  5LRS A;  2HQ5 A;  1YRN A;  2V1N A;  5TIS C;  4L9N A;  3WHB A;  4CH7 A;  4CGZ A;  4CDG A;  2LSO A;  1K6O A;  2DTZ A;  2X1E A;  1UG0 A;  1MJA A;  3T8R A;  5CVR A;  2AS5 F;  5F1R A;  4IHV A;  3CLQ A;  1K79 A;  3MN2 A;  5C3E J;  4S0H B;  3I55 I;  3HUG B;  3BRO A;  3FK6 A;  2CYY A;  3FIS A;  2QYO A;  3PIP F;  4HLY A;  1LDK B;  2QQ9 A;  3BJO A;  3DPU A;  1SAU A;  1I3Q J;  3BOQ A;  3DU6 A;  2HOS A;  4BGD A;  4AYB A;  3GZ5 A;  4ESF A;  1O57 A;  1TQM A;  4P1W A;  3MZ8 A;  1NH3 A;  3ZMD A;  2V1D A;  5CVU A;  3CCU I;  1LFU P;  2X6X A;  3BG7 A;  1MSE C;  1EKE A;  2CMP A;  2R7D A;  3RPU A;  3HUG A;  2KPM A;  3MKZ A;  3W6V A;  2DT5 A;  2DA7 A;  2R7R A;  4E7S A;  4IQ4 A;  1QVT A;  1MBK A;  2ZKZ A;  2IVM A;  4ZDO A;  2CUE A;  1P92 A;  4UNO A;  3BC8 A;  3A0H C;  2VQL A;  2RN7 A;  4GGG A;  1IXC A;  2OQR A;  5EJC A;  3EUH C;  2CG4 A;  4HF2 A;  1O4X A;  2M87 A;  2EV6 A;  3BR5 A;  3BLY A;  3UNG C;  3DLL F;  3MKL A;  3WTS C;  3VPR A;  3LAP A;  2DCE A;  1FBS A;  1QHH D;  2FJ1 A;  1B1B A;  4HST A;  3TOB A;  3ZP5 A;  2KL4 A;  4P9F A;  3CCM I;  4G7H F;  2V6E A;  3ZRG A;  4AIH A;  3V42 A;  4GO1 A;  3BPX A;  2LNB A;  2K9M A;  4NC7 A;  2OZU A;  4B1R A;  4ABZ A;  3RI4 A;  1FMV A;  3HSE A;  1DUX C;  1EF4 A;  2DMT A;  2EIK H;  1OCR H;  4C9Y A;  4E4H A;  2L02 A;  3ABT A;  1WGX A;  3Q0U A;  2R7V A;  3IWF A;  4M3E A;  1BW6 A;  2JMW A;  1T39 A;  2EWN A;  3DPL C;  2E2H J;  4UV9 A;  3PO2 J;  2LR8 A;  2LTP A;  2QA4 I;  5DCF A;  2DJI A;  3K70 C;  2LF7 A;  3GTO J;  4FIS A;  5L3E A;  1MMN A;  1Y0U A;  2OCE A;  2P6T A;  1HOM A;  1O7F A;  3JRC A;  3K1P A;  5JR3 A;  1XTA A;  1X3Z B;  3CQZ J;  2AHQ A;  4DYC A;  2LFB A;  3IH2 A;  4U87 A;  4D5C A;  3FMR A;  4R8H A;  2HFH A;  3OIP A;  1RUO A;  4E70 A;  4XN0 A;  3K4N A;  3SFI A;  2Z16 A;  3K4B A;  4ENJ A;  2JTV A;  4DQ2 A;  2BVM A;  2FNP A;  1ZLJ A;  4CYD A;  1W0T A;  3FKI J;  2CO5 A;  4LJZ F;  3MWM A;  2OV7 A;  5DUK A;  3ZN0 A;  2O8X A;  3FKJ A;  2DOF A;  3BG3 A;  2CFX A;  4PJN A;  2E60 A;  1J75 A;  4UXN A;  4D0P A;  4P9U A;  1QGP A;  2KQR A;  5K1Y A;  2F4O B;  2GBY A;  1RI7 A;  3BR1 A;  1CF7 B;  3ONQ A;  5J3L A;  4RDU A;  5BS6 A;  3OYK A;  2ZJP F;  1ETW A;  1ORK A;  3CC4 I;  4JX6 A;  2LD5 A;  1SEU A;  3CLO A;  4KNY A;  2OTL I;  4HA8 A;  4O5V A;  2W25 A;  4KDP A;  1H89 C;  1I3A A;  3CCE I;  5F04 A;  2KT0 A;  4AC0 A;  2HQR A;  4B43 A;  1ZAO A;  4S05 A;  3KZZ A;  2KLO A;  4N0B A;  5A2Q Z;  4IPA A;  2STW A;  5DTD A;  3OYB A;  4K2E A;  3OIO A;  1CF7 A;  3GTG J;  3ECH A;  2CU7 A;  2KZG A;  4AID A;  5L3F A;  3M8F A;  1APL C;  3IV5 A;  2Y30 A;  1D5Y A;  1X4O A;  1TNT A;  2A6E F;  1WH5 A;  3K2Z A;  1A35 A;  2H6C A;  1JTX A;  3I64 A;  1ZRF A;  1WKM A;  2R7W A;  1F36 A;  3GBG A;  3J80 K;  1IN7 A;  3F8B A;  3GFM A;  3OOP A;  1OIS A;  3PUB A;  5KCM A;  2X48 A;  4A3D J;  1V4R A;  1EJ9 A;  1Y8R B;  3K9T A;  1R00 A;  5FLM J;  2PMH A;  1K61 A;  4XLP F;  3RZD J;  2QBY B;  2M34 A;  3LSG A;  3DV8 A;  3VYT B;  1IAW A;  4HLX A;  1JE8 A;  2Z5U A;  3J7A O;  3P9K A;  3PIO F;  5E3N A;  1JTY A;  1EH8 A;  3ZQQ A;  4MTD A;  4M3G A;  1JI8 A;  2XKP A;  1XB4 A;  4M73 A;  1KQ8 A;  1U5T B;  2E1C A;  4FE7 A;  1UMQ A;  1IN5 A;  3S2W A;  4BJT A;  3GYH X;  1MGT A;  1Q1H A;  4JBA A;  2V9K A;  5BPD A;  2O9L A;  2QBY A;  2JJ7 A;  2DFH A;  1VQ8 I;  3OYJ A;  3VFZ A;  2B63 J;  1V3F A;  2KHM A;  5CVJ A;  3PSF A;  5BOX A;  2V4J C;  4RAZ A;  4FAS D;  4S04 A;  1O7L A;  1FC3 A;  1U5T A;  3EYY A;  4XRF A;  2DA2 A;  3G2B A;  3ML6 A;  4A3J J;  1TW2 A;  2EZI A;  3FX3 A;  3M9A A;  3QAH A;  2HKO A;  2OCC H;  3OYF A;  3CCQ I;  4NBQ A;  1ETX A;  4Y3O A;  4IL6 C;  1OYW A;  2JVH A;  3MQ0 A;  2XRL A;  3R0A A;  5JHF A;  4U0W A;  4A93 J;  1FEX A;  3W6J B;  1BW5 A;  2FRH A;  4U88 A;  2K85 A;  3IAS 2;  3VWB A;  1BIB A;  3OYN A;  1N77 A;  3HRM A;  5CVV A;  4A2U A;  3CUQ B;  3K70 D;  5J6X A;  3LSP A;  3EUK L;  1HW5 A;  4HRI A;  2HTJ A;  2XIG A;  1IN6 A;  1G3T A;  3SDG A;  1JHF A;  1SFK A;  1U5T C;  1S7A A;  3R61 A;  4I01 A;  2EZH A;  2ZJR F;  3LQQ A;  4ENK A;  1UHW A;  3PFY A;  3OYM A;  2BY1 A;  4DIQ A;  1MH4 A;  5GAG J;  3TDZ C;  1OMI A;  3CJT B;  3GUD A;  1HDP A;  3BPV A;  1T38 A;  5E18 F;  2WAD A;  4HNT A;  2ZXI A;  3ZGK A;  1R6R A;  4XK4 A;  1YS7 A;  3VSL A;  3K4J A;  3KYC B;  5IYC J;  3ESW B;  5E79 C;  5F08 A;  3WG7 H;  2ADU A;  4OMZ A;  5B66 C;  3PJR A;  4LG0 B;  1LKX A;  3R6S A;  4C2U A;  1R22 A;  4N9I A;  1Z7L A;  5D5V B;  1T8I A;  2DT6 A;  1F43 A;  1UHS A;  4BHP A;  1FY7 A;  2X1D A;  3GME A;  3Q3S A;  3F6V A;  4NC6 A;  2XB0 X;  2M7A A;  2CSO A;  3KEO A;  4EQQ A;  4F3Q A;  1X19 A;  5TJJ A;  5L3B A;  3CUQ C;  1IDY A;  2HXI A;  2DXI A;  1X2N A;  4LG0 A;  4Y15 A;  3RYP A;  2ZXH A;  5BPI A;  1FSH A;  3B02 A;  3HKZ A;  4RB3 C;  2HWV A;  3EET A;  2LY9 A;  2RQQ A;  1I50 J;  2BYV E;  1VQP I;  3P5J A;  2CQK A;  2MG4 A;  4N4O B;  2DA3 A;  5ICF A;  3CUO A;  4ENN A;  1KON A;  1L0O C;  3J80 Z;  1D1A A;  4HAM A;  3C7J A;  2IS2 A;  3O2P E;  3FMQ A;  3FXO A;  2HKX A;  2QQB A;  1R5H A;  2DN0 A;  4X1E A;  1ETO A;  1Z91 A;  5M5Y J;  4Y33 A;  2F5E A;  1J9I A;  4CIC A;  5J8C A;  5D6E A;  5BQT A;  2LMD A;  3KP4 A;  3VYR B;  2K9Q A;  3RQI A;  2BGC A;  2CUF A;  5E1W A;  1OJL A;  2RKH A;  4OAY A;  2FEZ A;  4BDY A;  2H8W A;  4N9H A;  4YRV A;  1D8J A;  3B6A A;  2JT1 A;  2XGC A;  3HRT A;  3JCU C;  4UVA A;  1O3S A;  3ZQI A;  1J7K A;  1J0R A;  3E6M A;  3S93 A;  2DFE A;  3LSK A;  3QYF A;  3RIR A;  2D45 A;  1SD4 A;  1VQ4 I;  2XF7 A;  2D5V A;  1DDN A;  3W2V A;  3LA2 A;  1ZYR F;  1LVA A;  1A6Q A;  2WV1 A;  2OJE D;  2R5Z B;  1XDS A;  2ZSH B;  1XMK A;  3X2Q H;  3IHU A;  2JRT A;  2EV5 A;  2Z99 A;  3ABU A;  4B4C A;  2R7S A;  1PJR A;  4I0A A;  2LP0 A;  2EIN H;  2DQL A;  5LGT A;  1V5F A;  1TQI A;  1ENH A;  3F8M A;  5ICE A;  1TC3 C;  5DM6 F;  2CH0 A;  3W2W A;  4XNF A;  2LKP A;  2H94 A;  1FBQ A;  4U7B A;  3H5A A;  1Z9C A;  2HEO A;  1RNL A;  4BL0 B;  2R5Z A;  5GAH J;  1ZRE A;  3Q0V A;  3CP2 A;  2HS5 A;  3BTJ A;  5J4Y A;  2RRE A;  1K6Y A;  2OAZ A;  3CDL A;  3ZQG A;  5TRD A;  2PI0 A;  3L9F A;  1FMW A;  3K4M A;  1I1G A;  2ZNZ A;  3MFK A;  2FQ4 A;  2L4A A;  4HG2 A;  3P7N A;  2W4S A;  2L7F P;  5IP7 J;  2MYS A;  2L2O A;  3OSG A;  3SQN A;  2DOA A;  4LLL A;  1XGO A;  1YX5 A;  1XC5 A;  3CES A;  1KU7 A;  3OY9 A;  3CO7 C;  3G1O A;  1DQU A;  1E0E A;  2A07 F;  3K10 A;  1K4T A;  3HOS A;  3R4K A;  3MMY B;  2PX9 A;  3TO9 A;  1AU7 A;  4HX4 A;  3S1N J;  2DDB A;  4I99 C;  3WE3 A;  4C3I J;  1JJ6 C;  1VQ9 I;  3KZI C;  1XS9 A;  1Z6T A;  3JRB A;  3AG3 H;  1VI0 A;  2BE5 F;  2AXL A;  3DEW A;  5EF6 A;  1U2W A;  1ZLK A;  2VAS A;  3OYL A;  4QIW N;  2Y9Y A;  4XOT A;  3HSF A;  2HZT A;  1MSF C;  2KJC A;  4EJU A;  2PQ8 A;  4ZYG A;  1OQY A;  3OYG A;  1H0M A;  4WXD A;  2HNH A;  5FD6 A;  1VZ0 A;  2FF4 A;  3FXL A;  3A03 A;  2DQR A;  5IYD J;  2PJP A;  5K7Z A;  1FIA A;  2A68 F;  2E19 A;  2JQ7 A;  2E1M B;  1WPK A;  1Z7U A;  2AO9 A;  3SDB A;  4IF4 A;  4ZDP A;  4IKF A;  2G0E A;  3D0S A;  2RAE A;  2EV0 A;  3SEQ A;  1R4N B;  2Y9Z A;  1XN7 A;  2MLK A;  2L9R A;  2L9S A;  2P8T A;  1YS6 A;  4CCN A;  2H6B A;  2A61 A;  4GRI A;  4F91 B;  3TW7 A;  1TT5 B;  2VN2 A;  2BY3 A;  2L54 A;  2R93 J;  2CWE A;  3ASN H;  5HLI A;  1WJ5 A;  2D2W A;  2EFO A;  2L01 A;  3CZ6 A;  2AXT C;  4AIK A;  3GVA A;  1DU0 A;  2EFN A;  4XLH A;  4L0Y B;  1KQ9 A;  3SHF A;  1GDT A;  2GWR A;  5K7F A;  5HOD A;  3T5X A;  1K4S A;  2QSF X;  2BY0 A;  3FXJ A;  4BY1 J;  5C4J J;  5IOZ A;  3OYH A;  1NG7 A;  4Y17 A;  2X51 A;  2UV1 A;  3TED A;  2HPM A;  1LNW A;  3WU0 A;  2IA0 A;  4IHT A;  1JKO C;  3ZMV A;  2Z2S B;  3KEY A;  3DTI A;  4CCJ A;  3VB2 A;  4EJW A;  1VQN I;  2MD5 A;  2FML A;  5CLS A;  3L2V A;  1E3O C;  2OTJ I;  4NDL A;  2V9V A;  2JA8 J;  2ELH A;  2VXD A;  2OUM A;  1ZR2 A;  5AIQ A;  3DXJ F;  4L9T A;  2ZXJ A;  1P6R A;  3GW2 A;  2E1M C;  3FWE A;  4YEJ A;  4I6Z A;  1QQI A;  4FCY A;  2XKO A;  3OWT A;  4KJZ A;  2COB A;  4CXF A;  2HPI A;  4ITV A;  3LSJ A;  4BXU A;  2MSY A;  3RKY A;  1WI9 A;  2MAB A;  1E3H A;  5KVR A;  4A6E A;  1U6G A;  2M30 A;  1P9Q C;  2COM A;  1HBX G;  1BL0 A;  3C2H A;  1Z3X A;  5LHH A;  3M7G A;  2NVQ J;  2Y69 H;  2F5C A;  3HGG A;  2DMP A;  3A4C A;  1T98 A;  4YG2 F;  3I4P A;  2V7F A;  5F0F A;  5D8L B;  2W00 A;  3L2Q A;  3OS2 A;  2LY2 A;  1FT9 A;  1ETV A;  1ZHF A;  3CCS I;  5FRN A;  1QA6 A;  4KIS A;  3HOX J;  1JGG A;  3FBN B;  1XMX A;  4HQM A;  1RKW A;  3K1M A;  3O6B B;  2DI3 A;  3E6C C;  2XVC A;  3SZG A;  2ZJ2 A;  2KIF A;  2CQQ A;  1SFX A;  2IS6 A;  5HDG A;  2OBP A;  4BS9 A;  3RKW A;  3EQL F;  4KIB A;  2DYS H;  3KP2 A;  3LFU A;  4I98 B;  4P5O A;  4UV8 A;  2OF7 A;  4WCG A;  1LEA A;  1WQ2 A;  5B1A H;  3BTI A;  1BBY A;  3DKX A;  3QPL A;  2E2I J;  4C2M J;  2CUJ A;  5JVT A;  5FGM A;  3TOA A;  1FJL A;  4XR6 A;  2XB5 A;  3S32 A;  1ULY A;  3E6D A;  1IRZ A;  1YW7 A;  3NAR A;  2VUM J;  4J00 A;  3DLA A;  1V55 H;  3BDD A;  2OC6 A;  4F52 A;  1R9T J;  4UUT A;  3GX4 X;  3ULQ B;  2EPF A;  1ZRD A;  4IHS A;  3GFI A;  1ETK A;  2M9H A;  4RBO A;  5FLX K;  1XX5 A;  2IAI A;  1X1B A;  2YUS A;  1O3Q A;  3HM5 A;  3I59 B;  2TRT A;  4I09 A;  3I71 A;  3KZY A;  1YOV B;  3V7R A;  3CO6 C;  1NHA A;  4NQW B;  5JLW A;  1BR4 A;  1X3W B;  3PFI A;  2M7B A;  4MO7 A;  2LDU A;  4A3F J;  3F9K A;  3E3V A;  2B9S A;  4ZDL A;  4L9J A;  4OIO F;  3BT9 A;  1OLT A;  2VQC A;  1T33 A;  2BY2 A;  3HOZ J;  3NAU A;  2ME0 A;  4BDZ A;  4HQE A;  1BR1 A;  3JW4 A;  2K4J A;  3I59 A;  4PJ0 C;  2BVL A;  5K5Q A;  1USS A;  2IW5 A;  4O3M A;  5DS9 A;  4NQW A;  1PUE E;  1MBF A;  2O03 A;  2HOT A;  2EA2 A;  1YW8 A;  2ZC2 A;  1QPM A;  4OIN F;  5FFX A;  1JT6 A;  3HGY A;  4ZYD A;  2XAJ A;  3H5N A;  1KU9 A;  1ZQ3 P;  2DK8 A;  4YFX F;  1P4A A;  3BR0 A;  2CS3 A;  5CKT A;  5KAI C;  5IY5 H;  1H8A C;  5IYB J;  2JUC A;  1A5J A;  1DP3 A;  3PNY A;  4RGR A;  2LG4 A;  3F3X A;  4E6K G;  1OFC X;  1W7P D;  2GA1 A;  1YJ9 I;  5A2Q K;  3ISP A;  4BJ5 C;  2XAG A;  4M6V A;  4WXH A;  2WB1 N;  2EBI A;  1I39 A;  1SMY F;  1S5L C;  4XID A;  2PMZ A;  2FMY A;  3JRI A;  2IBD A;  3OR1 C;  2YR2 A;  3GWZ A;  1HQC A;  1D3Y A;  1MIJ A;  5AIP A;  2O7O A;  5KHD A;  2YX7 A;  2V1U A;  3DU5 A;  2VOD A;  3RYR A;  5F64 A;  2JUG A;  3K7A J;  2E5N A;  1R5I D;  1MBH A;  1TWA J;  2CQX A;  3GTK J;  1LVK A;  1HXD A;  4Y13 A;  2B7E A;  4A3B J;  4YII A;  2XAF A;  5H6R A;  4C30 A;  2C6Y A;  1JKP C;  2DBB A;  2NOG A;  2K5C A;  2P5V A;  5FFZ A;  1LPQ A;  4M6Y A;  2A3S A;  2O61 A;  1STZ A;  1BA5 A;  4L5E A;  3PL8 A;  4JOM A;  4BQA A;  1X4P A;  4F92 B;  1IO2 A;  3JSP A;  2KIM A;  4CCO A;  2VBZ A;  4A3M J;  2BHZ A;  3ZMS A;  1R49 A;  4ZH4 F;  1Z3Y A;  1XD7 A;  3FHZ A;  2GIZ A;  1W0U A;  3DFG A;  4QSH A;  1WI3 A;  2CJJ A;  3L1P A;  1E2X A;  2NYX A;  3FF5 A;  2ZXW H;  1VQ6 I;  2QWW A;  1WJC A;  3GTQ J;  3I3L A;  5FO5 A;  4I76 A;  2VL8 A;  1GVJ A;  3H3Z A;  1P2F A;  1B59 A;  1X1D A;  3KFW X;  4RLF A;  4Y4R A;  3AL0 B;  5E8I A;  1IW7 F;  1SVO A;  2RNG A;  1U0J A;  4UUS B;  2K3F A;  3ZQH A;  3KCC A;  4EGZ A;  1ZTR A;  1QZY A;  1G3S A;  3TO6 A;  2P4W A;  1PDN C;  3IH4 A;  5J47 A;  1DGR M;  3LMM A;  1UB9 A;  1G8X A;  2VPL A;  4V2G A;  2JWT A;  5FLX Z;  4AYB N;  4EJV A;  3FXK A;  2NOJ B;  2DU9 A;  3HHG A;  5HDN A;  3GEZ A;  5EGO B;  1RR8 C;  4CCM A;  4UUS A;  1ZG5 A;  1RRJ A;  1ZGW A;  1R58 A;  4UVC A;  1FPQ A;  3ERM A;  3E5Q A;  2R5Y A;  1S7O A;  2NS0 A;  4LGW A;  4XLN F;  1BI0 A;  2EIM H;  3G4S I;  1R7J A;  4RS8 A;  1IV6 A;  2L5Q A;  2LKS A;  2OPT A;  2VBY A;  2ELJ A;  5CJ9 A;  2O5R A;  2IJL A;  2XV4 S;  1MMG A;  1QU3 A;  2G7H A;  1LFB A;  5EGO A;  1SAX A;  3O8H A;  2QEN A;  2R4G A;  3WTZ A;  1FP2 A;  2XGE A;  1ONV A;  2HOE A;  4BE1 A;  2VLA A;  2PG4 A;  2EIL H;  3E1S A;  3IRR A;  3S3N A;  1HC8 A;  1D0Z A;  5LGN A;  3LFK A;  2F5V A;  3MZH A;  2FBI A;  3E5U A;  2PMU A;  1REP C;  5GP9 A;  3A0B C;  4RA2 A;  3TP0 A;  4V19 K;  2VT2 A;  4MIM A;  2STT A;  3DEE A;  3DTK A;  3WTY C;  3L2R A;  2NVX J;  2ID6 A;  4XL9 A;  3S3O A;  3GTL J;  3OR2 C;  4C3H J;  4ZYH A;  4KN4 X;  4XSZ F;  3VYU B;  4F7Z A;  3HOT A;  2FU4 A;  1XDU A;  3F6O A;  2P0W A;  4XIC A;  1W5S A;  3HJE A;  3BZC A;  1AA7 A;  1DPR A;  1FSE A;  1GXQ A;  3T1B A;  4KIC A;  2NRA C;  1JHH A;  5E1Z B;  3WU2 C;  1IGN A;  1HKT A;  3EPZ A;  1YO5 C;  4RM3 A;  2XUB A;  3TKY A;  2ZNY A;  3EDP A;  3CCL I;  3BZ6 A;  3DTE A;  3DEU A;  3H3V K;  1QPI A;  2HOA A;  3FXM A;  2W24 A;  5FRM A;  2A6T A;  3U1K A;  3KLN A;  3TP3 A;  4MFE A;  1OCC H;  2VQG A;  1WH7 A;  1WZ2 A;  2DMU A;  1MND A;  4PDK A;  1WRJ A;  3JRH A;  2WAQ A;  5D4S A;  4XOP A;  3E7L A;  4A3L J;  4LB6 B;  1D1B A;  5IT9 Z;  3L2U A;  3S3M A;  3LSM A;  3WHC A;  2X0L A;  3V8K A;  5LHG A;  3KIO A;  4XBF A;  5D5W B;  1JUM A;  3CC2 I;  4HW0 A;  2XAU A;  4FE4 A;  3RPQ A;  4EM1 A;  1Z77 A;  4CYC B;  2M4G A;  3PUF A;  4KA4 A;  1UEL B;  1W1W E;  2ISY A;  1OYY A;  3AFH A;  2JPB A;  3H3U A;  3IAM 2;  3G1L A;  3BJ6 A;  2OQG A;  3R60 A;  1J5Y A;  5M3F J;  1MDM B;  1PVE A;  4CHU A;  2F2E A;  3O8G A;  3V8L A;  1O3T A;  2XC7 A;  1WJA A;  5CVI A;  1GT0 C;  2VKH A;  4Q48 A;  1PYV A;  3RPU D;  1E3P A;  2GOM A;  3QP6 A;  4CYC A;  2G7U A;  3VOD A;  4RLQ A;  2UXX A;  3MD2 A;  1NG6 A;  3BQZ A;  2DA1 A;  3JSO A;  2JZY A;  2YU3 A;  1TT0 A;  4A3I J;  1QRY A;  3FHN A;  3BY6 A;  5LGU A;  3HOU J;  1LDD A;  3I53 A;  3IKV A;  1VQ5 I;  2EFQ A;  1MDM A;  1A31 A;  2ZB9 A;  4BQO A;  2YS9 A;  1BI1 A;  2VBX A;  3GCM A;  1K78 B;  4KIT B;  3F72 A;  2G9W A;  4E7I A;  3HPH A;  1FOX A;  4C3J J;  3DF8 A;  5EEG A;  4QLC U;  3LOC A;  2QCO A;  2L7Z A;  1BJA A;  5ERI A;  3U21 A;  3FXQ A;  4BUP A;  1ZK8 A;  3G73 A;  3OMY A;  1IF1 A;  4EJO A;  1CGP A;  1YW9 A;  5HOO A;  2RV8 A;  2OD5 A;  4BEH A;  2ZFW A;  1X2M A;  5HLG A;  3CMY A;  3OYC A;  2K7L A;  2J5O A;  4MNU A;  3K2A A;  1BR2 A;  5M5X J;  3RQ4 A;  5HNF A;  3D5L A;  1Y1W J;  2FX0 A;  1K78 A;  3OS1 A;  1ZEL A;  5ED4 A;  3GTP J;  3VDX A;  2E2J J;  3CCV I;  3R0J A;  4BAY A;  2UZK A;  2ZSI B;  3QPH A;  4L9V A;  2FOW A;  2Y48 A;  3HPG A;  5HS9 A;  2K9N A;  4DBQ A;  1YJW I;  1PP8 F;  4HX8 A;  1QNT A;  3B73 A;  4KN7 X;  2EZK A;  2HDD A;  3VYS B;  1JUS A;  2VOO A;  3TL4 X;  4ESJ A;  2JSP A;  1HW1 A;  4DZJ A;  4M72 A;  2HI3 A;  5F0H A;  3BP8 A;  3J81 K;  3BZK A;  3LST A;  3N4M A;  2YSR A;  4Q47 A;  1YTY A;  4B48 A;  2Y0S A;  5LLQ A;  3WGI A;  3OIQ A;  1Q1V A;  2XAS A;  2F5D A;  3RKQ A;  2QF7 A;  1BC8 C;  3L7W A;  3FM3 A;  4BH9 A;  5FJ8 J;  4AVP A;  3WTW C;  4KIG A;  2BW3 B;  2QEX I;  5CYV A;  4IHX A;  2JA7 J;  3AAF A;  3ABM H;  1F5T A;  3HYI A;  4E7L A;  4A12 A;  3ERE D;  2ZO4 A;  4I7H A;  3Q9S A;  5FKO A;  4RGU A;  3GTJ J;  2R7O A;  4RAG A;  5E3L A;  2NXN B;  4E7K A;  3E0J B;  2WY8 Q;  3BWG A;  4AWX B;  3E97 A;  1DU6 A;  2GZW A;  4M3B A;  3FXR A;  4XLA A;  4EEF G;  5LHI A;  3FIW A;  1EA3 A;  2BW3 A;  2ESN A;  3K6G A;  3PQJ A;  1U8B A;  3S1Q J;  5E20 A;  3CC7 I;  4IZZ A;  4HF0 A;  3J7Y J;  5HLH A;  2GAU A;  4OIP F;  4DGW B;  2GM4 A;  3PM1 A;  3L2W A;  3I5U A;  2BOL A;  1H88 C;  2ME6 A;  1YHQ I;  5HNH A;  3I54 A;  3ZMT A;  1HCR A;  2V79 A;  4GXO A;  4CZZ A;  1W36 C;  3TMO A;  1ACI A;  1LEB A;  4AIJ A;  5TGT A;  3KEQ A;  2M0M A;  2IEK A;  3WTX C;  1JXS A;  2VB6 A;  3C3W A;  5F27 A;  2DMQ A;  1FYL A;  2PFB A;  3CP8 A;  1UFM A;  4EAT A;  1VQM I;  1LJ9 A;  2PEX A;  1SMT A;  1XGN A;  1XGM A;  3CJQ B;  4PFP A;  3SXY A;  5LEJ A;  5BMZ A;  1Y56 A;  2M8G X;  1ITY A;  1R5G A;  4PCQ A;  3HKZ N;  2CW7 A;  2I10 A;  1ON2 A;  4QPO A;  2X1C A;  1ZGJ A;  3G6E I;  2XPU A;  1Z0X A;  3BCA A;  1P4W A;  4B09 A;  5HDK A;  5KAF C;  4R1H A;  4XM3 A;  1I1S A;  3SZP A;  2E1O A;  5FKL A;  5LFA A;  3HXL A;  3KP7 A;  1YLF A;  1UCR A;  4CCK A;  4LD5 A;  3BR3 A;  4JYK A;  1RUN A;  3SZT A;  2VI6 A;  2VC0 A;  4Y7N J;  3AG2 H;  1T0F A;  1GV2 A;  3Q5F A;  3OS0 A;  2HVQ A;  4GYG A;  1TTY A;  2MW8 A;  2CGP A;  1RET A;  3MAJ A;  3K0L A;  2X6O A;  3QU6 A;  5M5W J;  3ZMU A;  2DW4 A;  4A0Y A;  5H2F C;  3FBI B;  3SEZ A;  1XSX A;  3GFJ A;  2ELK A;  3C2G A;  4ASN A;  4DW6 A;  3HTS B;  1KGS A;  2QQ8 A;  3FMS A;  4Q4Z F;  2LRD A;  4M9X A;  3RTR A;  5E3O A;  4BNC A;  1T0F C;  4MEX F;  1YJN I;  1XSV A;  3LAJ A;  3BCB A;  2I8D A;  2HQN A;  2E7X A;  1MH3 A;  5FD5 A;  3J81 Z;  3C18 A;  5LD2 C;  5BNG A;  4CSW A;  3S1M J;  4RB1 A;  4D9J A;  3CMA I;  4CZC A;  2H27 A;  2JSC A;  2KRC A;  2IA1 A;  1R36 A;  2GXG A;  2QVO A;  1G2H A;  4AVZ A;  5GTH C;  2CQ7 A;  1QHG A;  1J59 A;  3KX2 A;  4BQQ A;  5GAE J;  1A04 A;  4M3D A;  2KFD A;  3QU3 A;  4QWQ A;  2D1V A;  2HU9 A;  2VQH A;  2LBF B;  3LSR A;  3HOV J;  1XPX A;  4UY8 I;  2DYR H;  5KK1 A;  1ZRC A;  1NK3 P;  3RDI A;  2MH2 A;  5CQG A;  2CUZ A;  1ZGA A;  1YX3 A;  2JA6 J;  2Z1D A;  1Z21 A;  1JUP A;  3T0Y A;  1Z1D A;  4ZZL A;  3QPS A;  2XSJ C;  3ZQC A;  3QP5 A;  1YQA A;  3JRF A;  2TDX A;  2A69 F;  1R1T A;  2LBF A;  3M4O J;  3D1N I;  1MZB A;  2DJN A;  3F8C A;  2EZL A;  2R7T A;  2EIJ H;  3S16 J;  4ANJ A;  1K7A A;  5J8F A;  5JFR A;  2LF8 A;  1H9T A;  4UUV A;  3KET A;  2LC2 A;  1MBJ A;  1I6H J;  2A6H F;  1WJF A;  5D6F A;  3BTC A;  1Z6R A;  2KJB A;  1X1A A;  4FHT A;  4OWR B;  2YPR A;  4B47 A;  2DA5 A;  2NNN A;  1EH7 A;  3OYE A;  4XMY A;  5HS7 A;  5K5O A;  2FNA A;  4JQF A;  2QZ8 A;  3K4C A;  3VEP A;  2Q2E A;  4ZTJ A;  2CV2 A;  3CDI A;  5IP6 A;  3HOW J;  2FA5 A;  4LK1 F;  3QRF F;  4BE0 A;  1B8I B;  1RR7 A;  4YFN F;  3KYL A;  3T8T A;  3VSK A;  1TLH B;  1KYZ A;  1OR7 A;  4YEL A;  5DUI A;  4LIV A;  4ESB A;  5ILS A;  2BHY A;  3CCJ I;  3M1C A;  4IQJ A;  1YYV A;  1FTT A;  3F8N A;  3RKX A;  1AWC A;  1R4M B;  3LA3 A;  2Y31 A;  4N4N B;  4ZYE A;  4CA0 A;  4XRS A;  5FLV A;  1BOB A;  5CQE A;  3NQO A;  1B8I A;  3I0T A;  5FKN A;  4JK1 X;  3E5X A;  1TWF J;  3DKY A;  2MC4 A;  1U9O A; 
#chains in the Genus database with same CATH homology
 1ETX A;  3S15 J;  3C2B A;  3ZOB A;  3JRG A;  4UUS B;  2K40 A;  2M2E A;  2XRL A;  3ZQH A;  4A93 J;  1ZTR A;  3QQA A;  1FEX A;  1QVU A;  1BW5 A;  2NVY J;  4W97 A;  3IH4 A;  1FIP A;  2ECC A;  1RES A;  3LSP A;  2Y2Z A;  4V2G A;  3SDG A;  2JWT A;  3Q0W A;  1SAN A;  3CCY A;  4AYB N;  2EZH A;  3JRD A;  1ZKG A;  3UKG A;  5EGO B;  4UUS A;  2MGQ A;  4HNV A;  1VFC A;  1MH4 A;  1IUF A;  5C4X J;  1BJZ A;  1ZGW A;  5EDN A;  3SJM A;  1HDP A;  2R5Y A;  4X6A J;  2LLK A;  1CQT A;  5GPC A;  1GV5 A;  1OCT C;  1AKH B;  4XK4 A;  1IV6 A;  3F0C A;  5EG0 B;  5IYC J;  2OPT A;  4JX4 A;  5F08 A;  1JKR C;  2YU9 J;  2XGD A;  2LK2 A;  1LFB A;  5EGO A;  3O8H A;  2GLO A;  1F43 A;  1UHS A;  2XGE A;  2DA6 A;  1HLV A;  2HXO A;  3Q3S A;  4MFD A;  5K7H A;  2XB0 X;  1AKH A;  3S17 J;  5EG0 A;  1UG2 A;  1U78 A;  2W48 A;  5GP9 A;  1IDY A;  2HXI A;  3TP0 A;  1X2N A;  4MIM A;  5F0C A;  4G12 A;  4XRM A;  2NVX J;  4BKX A;  2ID6 A;  3GTL J;  4C3H J;  2LY9 A;  1I50 J;  2FD5 A;  4XIC A;  2MG4 A;  2DA3 A;  2JN6 A;  2M0C A;  1FTZ A;  2N8G A;  1IGN A;  3JRA A;  4BXX J;  4DZP A;  3BG9 A;  3H3V K;  1QPI A;  2HOA A;  2DN0 A;  2HYJ A;  2R92 J;  4X1E A;  1ETO A;  1PUF B;  3TP3 A;  3HOY J;  3HB9 A;  4MFE A;  1WH7 A;  5M5Y J;  2DMU A;  1T56 A;  3JRH A;  1AHD P;  1GUU A;  2P81 A;  4DYR A;  2H1K A;  3A02 A;  3E7L A;  4A3L J;  2XPW A;  4J19 A;  2K9Q A;  3RQI A;  2CUF A;  1OJL A;  2DMN A;  3WHC A;  1MBE A;  3B6A A;  2XGC A;  1JUM A;  1PUF A;  4FE4 A;  3ZQI A;  1Z77 A;  4CYC B;  3HDD A;  4A3K J;  3S2H J;  3HEF A;  3IH3 A;  1IG7 A;  2D5V A;  3PO3 J;  1VND A;  3A01 B;  3G1L A;  2WV1 A;  2R5Z B;  4BY7 J;  5M3F J;  5C44 J;  3O8G A;  1P7J A;  4LOC A;  4B4C A;  1GT0 C;  2LP0 A;  4M3F A;  4DYQ A;  1RPW A;  1ENH A;  2ECB A;  4CYC A;  1TC3 C;  4V2F A;  1P7I A;  1ETQ A;  1TWC J;  5FKM A;  3BQZ A;  3A01 A;  2DA1 A;  2LVS A;  1QRY A;  2R5Z A;  1RKT A;  3HOU J;  2R7Z J;  4D7M A;  2O8K A;  2PMZ N;  3Q0V A;  2R5Y B;  3OSF A;  1XG1 A;  3BTJ A;  2ZB9 A;  4D7N A;  3S1R J;  2YS9 A;  2NS7 A;  1K83 J;  3CDL A;  3ZQG A;  4A3C J;  4JX5 A;  1Y1V J;  2FQ4 A;  4C3J J;  3LNQ A;  1U9N A;  2L7F P;  5IP7 J;  3LOC A;  1ETY A;  2QCO A;  2L7Z A;  4A3I J;  1POG A;  4W1U A;  2VKE A;  1ZK8 A;  3RZO J;  3OSG A;  5IPA A;  4A3G J;  1XC5 A;  1X2M A;  3CMY A;  3G1O A;  3K2A A;  5M5X J;  3TW6 A;  4BBR J;  1Y1W J;  1AU7 A;  2FX0 A;  3S1N J;  3B6C A;  4C3I J;  3GTP J;  1JJ6 C;  2R0Q C;  1XS9 A;  2E2J J;  3JRB A;  5IOY A;  1VI0 A;  5JLX A;  3DEW A;  5EF6 A;  2L7M P;  5M3M J;  2K9N A;  4AUX A;  4MLO A;  4QIW N;  2Y9Y A;  1WCM J;  2EZK A;  1MSF C;  2HDD A;  4FTH A;  5FKK A;  1JUS A;  4A3E J;  2XSD C;  1YRN B;  1IC8 A;  4DZJ A;  3JRE A;  2HI3 A;  3A03 A;  5F0H A;  5IYD J;  5K7Z A;  1FIA A;  2E19 A;  2NVT J;  2TCT A;  1WPK A;  5EZG A;  2DA4 A;  2AO9 A;  4D5F A;  2ID3 A;  2KDZ A;  1VF9 A;  1X58 A;  2G0E A;  2RAE A;  2Y9Z A;  4Y52 J;  1Q1V A;  2CRG A;  3RKQ A;  2QF7 A;  2L9R A;  5FJ8 J;  3MVP A;  3TW7 A;  3G1M A;  2HQ5 A;  1YRN A;  4IHX A;  4B3A A;  2JA7 J;  2R93 J;  3WHB A;  5FKO A;  2DTZ A;  1DU0 A;  1GDT A;  3GTJ J;  5K7F A;  4IHW A;  5HOD A;  5E3L A;  2L0K A;  4IHV A;  4BY1 J;  5C4J J;  5IOZ A;  1DU6 A;  4M3B A;  4EEF G;  3MN2 A;  5C3E J;  3FIW A;  3DCF A;  1U8B A;  4S0H B;  3TED A;  3BR6 A;  3S1Q J;  3FK6 A;  3FIS A;  1HDD C;  1JKO C;  1JKQ C;  5EYR A;  1I3Q J;  3ZQF A;  4IEJ A;  2HOS A;  1E3O C;  4NDL A;  2VKV A;  2JA8 J;  2GM4 A;  3PM1 A;  1ZR2 A;  4I6Z A;  1H88 C;  4FCY A;  2ME6 A;  1LFU P;  5E3M A;  2COB A;  1MSE C;  3LSJ A;  1HCR A;  2MSY A;  3W6V A;  2DA7 A;  1QVT A;  1IJW C;  1MBK A;  2IEK A;  1BL0 A;  2NVQ J;  2EH3 A;  5F27 A;  2DMQ A;  3HGG A;  2CUE A;  2DMP A;  2XPV A;  5F0F A;  1O4X A;  2M8G X;  3BR5 A;  1ITY A;  3HKZ N;  3MKL A;  3VPR A;  2EQR A;  2X9D A;  1ETV A;  2I10 A;  2LKX A;  3HOX J;  1JGG A;  4A69 C;  2FJ1 A;  2XPU A;  1Z0X A;  1A6I A;  5J1U A;  1RKW A;  4GFB A;  2E1O A;  5FKL A;  3ZQL A;  2CQQ A;  4B1R A;  4ABZ A;  1EF4 A;  2DMT A;  3FK7 A;  3BR3 A;  1HF0 A;  4JYK A;  1WGX A;  2OF7 A;  3Q0U A;  2VI6 A;  4M3E A;  3BTI A;  1BW6 A;  2JMW A;  2E2I J;  3QPL A;  4C2M J;  4Y7N J;  2E2H J;  1FJL A;  3PO2 J;  2LR8 A;  2XB5 A;  1GV2 A;  2LTP A;  4IHY A;  3S2D J;  1IRZ A;  2WAQ N;  3NAR A;  4FIS A;  2VUM J;  3GTO J;  1HOM A;  1SFO J;  3JRC A;  2MW8 A;  4UUT A;  1R9T J;  2H8R A;  1RET A;  3CQZ J;  5IP9 J;  2AHQ A;  4DYC A;  2LFB A;  2X6O A;  3IH2 A;  4D5C A;  5M5W J;  1ETK A;  3GTM J;  2M9H A;  4RBO A;  2IAI A;  3SFI A;  2ELK A;  2YUS A;  4DW6 A;  3HM5 A;  2TRT A;  2JA5 J;  3BR2 A;  5J1Y A;  1W0T A;  3FKI J;  3H0G J;  5JLW A;  5E3O A;  1IDZ A;  4MO7 A;  4A3F J;  2JK3 A;  1B72 B;  1MH3 A;  3BT9 A;  3BG3 A;  5BNG A;  3S1M J;  1T33 A;  3HOZ J;  3NAU A;  2ME0 A;  3OOU A;  2GBY A;  4QTR A;  3BR1 A;  1MBG A;  2NS8 A;  5J3L A;  3S14 J;  1G2H A;  4RDU A;  5DS9 A;  1MBF A;  2HOT A;  1ETW A;  1ORK A;  4JX6 A;  2LD5 A;  1S7E A;  4M3D A;  4XRS G;  1JT6 A;  3HGY A;  1H89 C;  1B72 A;  1ZQ3 P;  1OCP A;  1NK2 P;  5F04 A;  2KT0 A;  4AC0 A;  3LSR A;  3BQY A;  3HOV J;  3BR0 A;  1H8A C;  1A5J A;  5IYB J;  5GPA A;  1TWG J;  5DTD A;  1OFC X;  1NK3 P;  3OIO A;  3GTG J;  2CU7 A;  2JA6 J;  1MNM C;  4M6V A;  1APL C;  2WB1 N;  2EBI A;  3IV5 A;  2Y30 A;  1D5Y A;  1JUP A;  4XID A;  3QPS A;  3ZQC A;  1WH5 A;  1TWH J;  3JRI A;  2IBD A;  3JRF A;  1JTX A;  1F36 A;  3GBG A;  3D1N I;  2DJN A;  5EZH A;  3M4O J;  2EZL A;  4A3D J;  2O7O A;  3S16 J;  1NTC A;  2X48 A;  1GVD A;  3K7A J;  3GTK J;  1MBH A;  1TWA J;  2CQX A;  5FLM J;  5J1R A;  1K61 A;  3RZD J;  1MBJ A;  2M34 A;  3LSG A;  1ZR4 A;  1I6H J;  3BTC A;  4A3B J;  3M3Y J;  3JR9 A;  5EEA A;  4JP0 A;  2DA5 A;  5E3N A;  1JTY A;  1LE8 B;  1JKP C;  4M3G A;  2NOG A;  1JJ8 C;  1BA5 A;  4L5E A;  4FE7 A;  1UMQ A;  4BBS J;  9ANT A;  5F1J A;  3HOW J;  5IP6 A;  1B8I B;  3HBL A;  1RR7 A;  4A3M J;  2O9L A;  2JJ7 A;  3I4N J;  2Y0S N;  1JT0 A;  2B63 J;  3I4M J;  1W0U A;  1LE8 A;  4QSH A;  1FTT A;  1WI3 A;  2VPR A;  2CJJ A;  3L1P A;  3BG5 A;  3BTL A;  2Y31 A;  2K9S A;  2DA2 A;  3GTQ J;  4I76 A;  4XRS A;  5FLV A;  1B8I A;  5FKN A;  4A3J J;  2EZI A;  1TWF J;  1U9O A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...