1K61A

Matalpha2 homeodomain bound to dna
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
60
structure length
60
Chain Sequence
RGHRFTKENVRILESWFAKNIENPYLDTKGLENLMKNTSLSRIQIKNWVSNRRRKEKTIT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title A Hoogsteen base pair embedded in undistorted B-DNA
pubmed doi rcsb
molecule tags Transcription/dna
molecule keywords 5'-D(*AP*CP*AP*TP*GP*TP*AP*AP*TP*TP*CP*AP*TP*TP*TP*AP*CP*AP*
total genus 22
structure length 60
sequence length 60
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2001-10-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00046 Homeodomain Homeodomain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.60 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Homeodomain-like 1k61A00
1ZQ3P 1LE8A 3HGGA 5E3LA 1A5JA 2ID6A 2ME6A 1VFCA 2O7OA 1LE8B 2O9LA 9ANTA 1FTZA 1VNDA 3GTQJ 3HB9A 4Y52J 4A3EJ 1JKPC 5J1UA 2DA5A 4CYCB 2GLOA 4UUSB 2M9HA 2OF7A 3LNQA 2IBDA 1QPIA 3HOWJ 2MW8A 4A3CJ 2LVSA 1ETWA 1X2NA 1FIAA 4JYKA 4D7MA 4MIMA 3BG9A 3TP3A 2R0QC 3FKIJ 5IOZA 1Z0XA 1AU7A 2XPVA 5C4XJ 1JTYA 5F1JA 3LSRA 1MBEA 3RKQA 5J1YA 4NDLA 5M5XJ 2O8KA 3A01A 1APLC 3NARA 4A3FJ 1HF0A 5EEAA 1E3OC 1NTCA 1JT6A 1BW5A 2K40A 3IH3A 3OSGA 5IPAA 3JRHA 5JLXA 5FJ8J 3A02A 3HOUJ 1U9NA 2NVQJ 3LSJA 4M3DA 2R5ZA 1RR7A 4FE4A 4BBRJ 2XPWA 1ENHA 4UUTA 5F04A 2NS8A 2KT0A 2VUMJ 2ECBA 1JKOC 3GTMJ 5J3LA 5BNGA 1IUFA 2HOSA 3M3YJ 3CDLA 4DZJA 3BR3A 3B6CA 3NAUA 2IAIA 3BR5A 2E2HJ 4A3IJ 2JA6J 3H0GJ 5F08A 1HOMA 1GV5A 3Q3SA 3ZQLA 2AHQA 1H88C 2R5YA 1S7EA 1IGNA 1SFOJ 2HQ5A 2R5ZB 1ETQA 1F36A 5E3NA 4J19A 1WI3A 3QPLA 5K7HA 2XPUA 3SDGA 1Y1WJ 2D5VA 1W0TA 3K7AJ 5IYBJ 4FCYA 4Y7NJ 2Y9ZA 5JLWA 2R7ZJ 1LFBA 1FTTA 5F0HA 2DJNA 5GPCA 2HXOA 1LFUP 3GBGA 4FISA 3FK7A 1TWGJ 3S2DJ 2JK3A 2MG4A 3RZDJ 2MSYA 5F0FA 2XB0X 2M2EA 4DYRA 4XIDA 1JJ8C 1GUUA 2TCTA 2CUFA 1ETYA 5FLVA 3JR9A 3JRIA 1PUFA 1NK3P 1MH3A 3LSPA 2R92J 4A3GJ 5EGOA 4FE7A 2HDDA 2HXIA 4A3BJ 1JKRC 2IEKA 1IJWC 5F0CA 2L9RA 1JUSA 2EZLA 3K2AA 4QTRA 5EGOB 4X1EA 1IRZA 1MBGA 5EG0B 2NOGA 4M6VA 1JUPA 3JRDA 3GTKJ 2ID3A 2VKVA 2P81A 5EF6A 1DU6A 3JRAA 3LSGA 5EG0A 4FTHA 1U78A 1Z77A 1VI0A 1ITYA 2CQQA 5DS9A 2CUEA 5IYCJ 5M5YJ 2E2JJ 3G1OA 4G12A 1P7JA 4M3BA 4IHVA 1MBKA 1GT0C 5GPAA 2DN0A 3WHCA 2LK2A 2M0CA 3IH4A 4S0HB 3G1LA 1I50J 1QRYA 2JJ7A 1T33A 1IDZA 2JA7J 1MH4A 5M5WJ 2HI3A 1OCPA 2GBYA 3RQIA 1JKQC 1WH5A 3OOUA 1K83J 1MSEC 3S1NJ 2CJJA 5EZGA 4MLOA 3BTJA 5J1RA 1ETOA 2XGCA 3FK6A 3HEFA 1RETA 1ETKA 3BTIA 3ZQHA 2NVTJ 3VPRA 4C3IJ 2JN6A 3IV5A 3HBLA 1I3QJ 3BTLA 5IP9J 2NS7A 3A01B 2K9NA 1WCMJ 5FLMJ 2EZIA 2Y9YA 2FD5A 1MBJA 2E2IJ 1MSFC 1X58A 1GV2A 4DYCA 1W0UA 3HOYJ 4A93J 4XRSG 1RESA 4JP0A 5EDNA 5FKKA 3BG3A 4UUSA 4QIWN 1FIPA 4JX6A 1G2HA 1HCRA 2ME0A 2N8GA 2EH3A 4DZPA 4XICA 2X6OA 3OSFA 5DTDA 4DW6A 1AKHA 1ETVA 2DA6A 5IP7J 3DCFA 2VKEA 1RKWA 2LFBA 4B1RA 1TWFJ 1GDTA 2QCOA 3TW7A 4XRMA 4C3HJ 2XRLA 2E1OA 2WV1A 3ZOBA 4JX5A 2LLKA 1POGA 3S1MJ 3PO3J 3PM1A 3B6AA 2JMWA 4M3GA 1F43A 2JWTA 2X48A 2M8GX 2XGDA 1FEXA 3BR1A 2DMPA 3BT9A 4XRSA 4MFDA 2DMUA 1JJ6C 1I6HJ 1T56A 5F27A 3IH2A 3CCYA 1ORKA 1ETXA 2I10A 2XSDC 2CQXA 2K9QA 2DMQA 1HLVA 2WAQN 3Q0UA 4MO7A 3JRFA 2JA5J 5K7ZA 1HDDC 3BR2A 2MGQA 4LOCA 1NK2P 1WH7A 2EQRA 3JRCA 1RPWA 3BQYA 2TRTA 3ZQGA 3O8HA 2X9DA 2ZB9A 4AUXA 3S17J 2LR8A 2DA7A 2DMNA 1PUFB 3GTJJ 1OJLA 2K9SA 3Q0VA 3TW6A 1MNMC 4BBSJ 2W48A 3A03A 3ZQFA 2DA2A 4A3KJ 1TC3C 1HDPA 2DA3A 2RAEA 1IG7A 1B8IA 2H1KA 3I4MJ 2Y31A 5FKMA 3F0CA 4DYQA 2R93J 3RZOJ 4W1UA 1B8IB 1TWCJ 3SJMA 1BJZA 2FJ1A 1JUMA 2ECCA 3W6VA 3S1RJ 2JA8J 5E3MA 1RKTA 3HOVJ 3LOCA 1Q1VA 2NVYJ 3G1MA 5C44J 3GTGJ 3GTOJ 3HKZN 4B4CA 2L7FP 4M3FA 1XC5A 4A3MJ 2GM4A 2DTZA 2DA1A 3JREA 4IHWA 1UG2A 2R5YB 2LTPA 5HODA 2AO9A 5M3FJ 3JRGA 2XB5A 3O8GA 3BR0A 3OIOA 4BKXA 1BL0A 2G0EA 1VF9A 2HYJA 3D1NI 2LKXA 1ZTRA 3TP0A 2COBA 4MFEA 4BY1J 3L1PA 2OPTA 4C3JJ 2YS9A 4A3DJ 3MKLA 3HDDA 5EZHA 2FX0A 3UKGA 2VPRA 4BY7J 1IDYA 3E7LA 1TWAJ 2QF7A 3GTLJ 3BR6A 2PMZN 4D7NA 3HOXJ 1ZR2A 3S1QJ 3ZQIA 2HOTA 2E19A 3CQZJ 3QPSA 2HOAA 3BQZA 2L7ZA 4JX4A 2LD5A 5FKLA 3TEDA 3H3VK 2CU7A 1OCTC 3HOZJ 3PO2J 5IYDJ 5C4JJ 1IC8A 4D5CA 1B72A 3S15J 5C3EJ 5IOYA 3M4OJ 3BTCA 4EEFG 4AYBN 4GFBA 4IEJA 2L7MP 4B3AA 2LP0A 1U8BA 1WGXA 3WHBA 1A6IA 4W97A 5EYRA 2M34A 1OFCX 5E3OA 1ZGWA 3DEWA 1YRNB 1H89C 1WPKA 1QVUA 1XG1A 5FKOA 3MN2A 1Y1VJ 1JGGA 1YRNA 2YUSA 3HM5A 2L0KA 2VI6A 3BG5A 2EBIA 3JRBA 3GTPJ 1QVTA 4QSHA 3CMYA 2Y0SN 5M3MJ 1EF4A 2ELKA 4BXXJ 4HNVA 3SFIA 4I6ZA 3ZQCA 1MBFA 3S14J 1XS9A 1B72B 3FISA 5K7FA 2H8RA 1AKHB 2NVXJ 4IHYA 1BA5A 4RDUA 1ZKGA 4X6AJ 2DA4A 4XK4A 1UHSA 2YU9J 1CQTA 1BW6A 4RBOA 1H8AC 1ZR4A 1MBHA 1ZK8A 4ABZA 1GVDA 3FIWA 5GP9A 2KDZA 4L5EA 4AC0A 3S16J 1P7IA 1SANA 2LY9A 4A3LJ 2WB1N 3I4NJ 1FJLA 1X2MA 4V2FA 4I76A 4CYCA 2DMTA 1U9OA 2B63J 3S2HJ 1AHDP 2Y30A 5IP6A 1JT0A 2EZHA 4A3JJ 1IV6A 5FKNA 3QQAA 2Y2ZA 1D5YA 1R9TJ 3C2BA 4D5FA 2XGEA 3MVPA 4C2MJ 4A69C 1DU0A 3Q0WA 4M3EA 3HGYA 1JTXA 4V2GA 2EZKA 1UMQA 2FQ4A 2CRGA 1O4XA 1TWHJ 4IHXA 1K61A
chains in the Genus database with same CATH superfamily
4KYWA 1LE8A 3HGGA 1WZ2A 2RNJA 2IVMA 3BWGA 4HLXA 2ID6A 2ME6A 2DPDA 5E1ZB 2V7FA 2P6TA 3FMRA 2A61A 1VNDA 3E5XA 1PJRA 5LFAA 4KFCA 2K5CA 3HB9A 4Q47A 1JKPC 1U2WA 4UUSB 1FOWA 2AQFA 2QEXI 3GCMA 3LNQA 4MQVA 4RGXA 4HYEA 2MW8A 5HVQC 2LVSA 5GAHJ 2HPIA 4AD9A 2BYVE 2KKOA 1OLTA 3F23A 4C30A 3IC7A 2ZJ2A 3RKWA 4MIMA 3BG9A 1D0ZA 4CXFA 4HA8A 4AIDA 2O6GE 5ILUA 4GDFA 3WTXC 2PG4A 4BQQA 1E17A 4A12A 4A6DA 1UCRA 5DYMA 2XPVA 1JTYA 4XKWA 5F1JA 2EWNA 3J81K 3R4KA 2DBBA 4PDKA 5J1YA 3I4PA 3ABMH 3ZMZA 4F3QA 2O8KA 4XLFA 2V6CA 4HRIA 2DFFA 1W7PD 1HF0A 4CCMA 4DOZA 3U9GA 4M9ZA 4IVNA 4OMZA 5FROA 1R1UA 3OSGA 4WF2A 1G3WA 4KIGA 1YS6A 3BJOA 2E7WA 1K7AA 1IXSB 3GLXA 3CCEI 3OYMA 3I71A 2M0MA 3KEYA 4Q4ZF 2A07F 4HX8A 2L01A 4FE4A 4O6JA 2XAGA 4BBRJ 5DCMA 4D0PA 3SZGA 5LLQA 2XAFA 5AIQA 2BXYA 2KT0A 2ECBA 2V1DA 1JKOC 4O5VA 3GTMJ 3CUQA 3CDLA 2FBIA 3ELKA 4ASNA 3K69A 3OYEA 5HS8A 5ICCA 2A6HF 1SD6A 3Q5FA 1FZPB 2E2HJ 3FXOA 3SDBA 4E7SA 1J0RA 3H1CA 3H0GJ 3E3VA 2V26A 4KT6A 1LPQA 1ZAOA 1RC9A 3C3WA 2BXZA 1QU3A 3FHNA 2VB6A 1DPRA 1HXDA 4HX7A 1HKSA 1I1GA 2K27A 4L9VA 2NXNB 3OMYA 2R5ZB 1I39A 3GUDA 4M9XA 2NNYA 2DFEA 5K7HA 3B02A 5GAEJ 3SDGA 3RQ4A 2D5VA 2ZXWH 3P9IA 2Z16A 3KLOA 3K7AJ 5J40A 4Y7NJ 2HTJA 3CUQB 3SFZA 1LFBA 1OR7C 3OIPA 5F0HA 4NHJA 4HOBA 3GBGA 2ZJQF 2R3SA 1DGRM 1LFUP 1T0FC 2VN2A 3F3XA 1BC8C 5J8FA 2Z1DA 3CCUI 3RZDJ 2MSYA 3UNGC 5F0FA 1W5TA 4DYRA 1YE9A 2K9LA 5JVTA 3OR1C 1K6OA 2TCTA 2DW4A 4OMYA 1ETYA 2H8WA 4IL6C 1FP1D 2K9MA 1GVJA 1NK3P 2R92J 1MH3A 4A3GJ 2E1MC 5EGOA 4FE7A 2HDDA 4JK1X 3M1EA 2VBXA 3LA7A 5HLIA 5F0CA 3CMEI 1JUSA 2P5LC 3E97A 3GZ6A 1IN4A 2NOGA 3VEPA 1CF7B 1JUPA 1B6AA 1FYKA 5EF6A 1QZYA 2P81A 3A4CA 4PCQA 3LSGA 3DLLF 3F8BA 1VI0A 1UG0A 4XN0A 4HF0A 4U88A 2Y0SA 5ICFA 2FUG2 2RV8A 5LGUA 2QLZA 3QRFF 1VZ0A 3G1OA 4NQWA 4CCNA 2R7RA 1P7JA 4M3BA 4M9SA 5GPAA 1RUNA 2KPMA 3WHCA 2LK2A 1K78B 5F6FA 2KDOA 2GXBA 1L3LA 4HW0A 1XSXA 2MA3A 3GFJA 5E8IA 1IDZA 2H09A 2MYSA 3GEZA 4A0YA 2HI3A 2QSFX 2RN7A 3ZN0A 2GBYA 3WTZA 3TO7A 2WAFA 3CESA 3HPHA 4N4OB 3CCRI 2PI0A 1IW7F 2K86A 1OCOH 1MSEC 1OYYA 3S1NJ 2RKHA 3IWFA 2ZXHA 3T8RA 2FSWA 4ON0A 4BAYA 5CYVA 2HFHA 1Z3YA 2L9VA 2WA0A 4IHSA 3RPUD 4KITB 2AS5F 3VB2A 1RETA 1ETKA 2EK5A 2DTRA 2BW3B 3AG2H 3ZQHA 3RTRA 2XASA 2OTLI 3JSPA 1LDJA 3IV5A 3LAPA 3KE2A 4JOMA 2KMUA 1PDNC 3BTLA 2XAHA 2QZ8A 1YTYA 4BH9A 3W2WA 1QQIA 2XDVA 1SAXA 2L9NA 3ROUA 2KIUA 5FLMJ 1KYWA 5L3DA 1KGSA 2FD5A 4E6KG 3DU6A 1ZYRF 3P5JA 3ONQA 3AKZA 2BZTA 4LJZF 1D1AA 4GRIA 1WJBA 4XRSG 4IOAF 3RYPA 1SAUA 4ZYGA 4WXDA 5GTIC 3HTUA 5K5OA 2ZMEB 2LDUA 1VQMI 1Z6RA 3HC7A 3LFUA 4YELA 3QYFA 1BOBA 1XD7A 2LNBA 3V7RA 3U1KA 3TKYA 2X6OA 2X1CA 3CF2A 4LB6B 3KP3A 1ETVA 4BHPA 5IP7J 3TOBA 4DJAA 2QCOA 4UVCA 2NAZA 4ZZLA 4XKVA 1WJDA 2BY3A 4C3HJ 1V5FA 2E1OA 2WV1A 4UUVA 3PL8A 4JX5A 2JRMA 1POGA 2EIJH 2V9KA 3COAC 4AYBA 4KN4X 3PO3J 2QQAA 2W1OA 2XGDA 3NQOA 4OIOF 3IL2A 1T0FA 2DMPA 2FRHA 1R5ID 1JJ6C 3BY6A 1I6HJ 4M71A 5BS6A 3CCYA 1J75A 1R4NB 4GYIA 4B3XA 2CQXA 4KISA 5LHIA 4I0BA 2B7EA 5K7ZA 1HDDC 1X3WB 4EVIA 4NUBA 1N77A 2HZDA 4OU0A 1XX5A 3TO6A 5CJ9A 2EQRA 1Z1DA 3BQYA 3N97A 1Z3XA 3RIRA 4CH7A 4YIIA 3K4KA 2VXDA 3M7GA 4L5JA 3J7AO 1TL8A 1MNMC 2K85A 2XKOA 3SXYA 4MEXF 1K6YA 3HYIA 1F4KA 5EEGA 4L18B 2OTJI 3DPUA 2NOJB 4XLEA 1K4TA 2ZNZA 2WBMA 2P8TA 3IKVA 4OAZA 1ZELA 3MKYB 1CGPA 2A6EF 1GHCA 5HS9A 3HOVJ 2ZKZA 2UXXA 2HDWA 4G6QA 3FM5A 1K79A 3HKZN 4M3FA 2LREA 4A3MJ 2GM4A 5FB2A 2DA1A 2Z5UA 4G7OF 5HODA 2AO9A 4EGZA 5LBQA 3OYDA 3HRMA 3W2AA 2KRCA 1A35A 4OAYA 1FYLA 4OWRB 1QBJA 3OIOA 2A5YB 2M7AA 5DV5A 3KP2A 3HSFA 3D1NI 3FBIB 4PSWA 2LMDA 1Y56A 5HOOA 1V3FA 2XUBA 4MFEA 4DNCA 4HAMA 1TLHB 1IV8A 4HBLA 4NB5A 3DKWA 3QYBA 3L1PA 3EYYA 2BGCA 1QHHD 2R7WA 1R1VA 2VJIA 1V54H 5E20A 3JCUC 2R7OA 1LJ9A 4BEHA 4F91B 3MZYA 3VYTB 4HF2A 2PMZN 1ZLJA 4D7NA 3HOXJ 2P4WA 3BG6A 4AWXB 1L0OC 3A0BC 1OR7A 1WJAA 4JX4A 5D8LB 3WTTC 5D4SA 3F6OA 2GXAA 2HQNA 2LD5A 1JGSA 3TEDA 4HSRA 2A05A 2CU7A 3PO2J 2VIXA 1B72A 1KU9A 3S15J 5HLTA 5LRRA 2V79A 3ABUA 4OIPF 3VYUB 3KCCA 4B3AA 3K0LA 2MH2A 1STZA 1U8BA 4W97A 1UJ8A 2STWA 3DEWA 1X1BA 3CC4I 1SEUA 1XG1A 3VWBA 2UWMA 1UFMA 3KYLA 4Y15A 2OV7A 2GWRA 3W3CA 5D5UB 4RMNA 3HSRA 1BBYA 2CV2A 1R1TA 4BXUA 2Y0SN 1D3YA 4CA0A 4ESBA 4HNVA 4CYDA 3I3LA 1VQ9I 3OS2A 3OV8A 1T38A 1RRJA 2H8RA 1USSA 3H92A 1YIOA 3FX3A 2QA4I 2V1UA 3OYHA 1ZKGA 1OCRH 4XK4A 3L00A 4PUSA 1MW7A 1CQTA 5CVIA 2G7UA 2VXZA 3FXRA 2L5QA 4XL9A 1ZK8A 4ABZA 4EJTA 2JUGA 5CQGA 2D2WA 2ZC2A 3S16J 1BI2A 1P7IA 4A3LJ 2WB1N 3O6BB 3I4NJ 4F92B 4I01A 2Z33A 4CYCA 2B63J 1BI1A 2NS0A 2IPQX 2OZ6A 3CCQI 4EM1A 2K4JA 2M87A 2EV5A 4KMUX 5D5VB 1BIBA 3DTKA 1MGTA 4C2MJ 1T39A 3HGYA 1JTXA 4H4KC 4CCLA 2XAQA 4WXHA 4HLYA 5CVUA 2EZKA 4IHXA 3ASOH 4LIUA 2Z3YA 4EJWA 5JFRA 4HZFA 4XKBA 2RDPA 1VFCA 3BOQA 2O7OA 3G3ZA 3IHUA 4BHBA 5DUIA 5ICGA 3GXOA 4A3EJ 4RGSA 4A5MA 3KEQA 2ZJRF 3WU0A 4CYCB 2IS1A 2OF7A 3GVAA 3I64A 4N0BA 2K02A 1ETWA 3KPHA 1X2NA 4FASD 1FIAA 2LC2A 3S2WA 3NEUA 4JYKA 5DD8A 4XSZF 2VL8A 4Z6YA 3TP3A 2R0QC 3G4SI 2XF7A 2DO7A 1Z0XA 1YOVB 2F5EA 3H5RA 2DCEA 2VKDA 1P92A 4GGGA 2R7TA 5C4XJ 1PP8F 4AVPA 2M1BA 4NDLA 1O7LA 4E70A 4EMSA 5M5XJ 3A01A 1MJ9A 1YW7A 2ZJPF 1HKTA 1YQAA 1E3OC 3HJEA 2KJBA 4XR6A 2MABA 1BW5A 2K40A 4B44A 1B1BA 1J09A 3JRHA 5JLXA 1QZEA 1U9NA 3HOUJ 1N78A 1IRXA 3JAMK 3RI4A 3CCLI 4CHUA 3CO7C 1TQIA 2JA2A 1PYVA 3U2RA 4CSWA 1RUOA 3N4MA 1Z21A 5F04A 3OYIA 2VUMJ 4Y33A 6PAXA 3TQNA 1X1AA 1LVKA 3K1PA 4F55A 3F72A 2UV1A 3BDDA 5BNGA 2HOSA 3M3YJ 2R7QA 3K9TA 2M8EA 2ZXJA 4ESJA 3BR5A 2BV6A 3WG9A 2QQ9A 3OS0A 3LFKA 5K5QA 4ZYDA 1HOMA 1GV5A 3Q3SA 4XN3A 2BY2A 1D1BA 2X6WA 1H88C 1ZGAA 1MNEA 2VQHA 4KIBA 1YJNI 1SFOJ 3D5SC 3LQQA 1IZ1A 2HQ5A 5JHFA 3IRRA 4J19A 5LGNA 2DFHA 4BL0B 3JSOA 2XPUA 5IYBJ 4FCYA 2MC4A 5LHGA 2Y9ZA 2R7ZJ 3LSKA 1H0MA 4HEA2 1FTTA 4RB0A 1E2XA 2ICWG 4YIFA 3NWSA 3C7JA 4I98B 3CUOA 5DD4A 5HNFA 4RGRA 2UXNA 1W5CC 4BS9A 4OINF 2XB0X 3KYCB 4Q48A 4EGYA 2XROA 4XSXF 4XIDA 1JJ8C 4L9TA 2E36A 2LG4A 3IAM2 4RB1A 2CYYA 3F8FA 3MD2A 2HKOA 1SFKA 2FOKA 4EATA 3OR2C 3LSPA 4A3BJ 2HXIA 1IUYA 4AU7A 1R23A 2MFZA 4BJTA 2QGUA 1YJ9I 4NBQA 4FQGA 3MWMA 4YRVA 1MBGA 4P9FA 4A2UA 2WWYA 3OYKA 3BCBA 2VKVA 3CLQA 3DTIA 4ENNA 2AXTC 3JRAA 1DPUA 1DU6A 5EG0A 3ZN1A 1U78A 1Z7UA 1AOYA 2PFBA 3CLOA 2GA1A 3VYRB 2HQAA 3FMQA 1A04A 4BEHB 2CQQA 5DS9A 3FMSA 4UB8C 5M5YJ 3QOEA 3ML6A 1TNTA 4DQ2A 3FZVA 1JE8A 2GQQA 2X6YA 1X1CA 2J5PA 2Q0OA 1O3TA 4WXCA 3K4MA 1S7OA 1ZLKA 2HVSA 3ABLH 3BJAA 2CUZA 4S0HB 1XCVA 3I0TA 1XCBA 4ZC3A 1D0XA 3OOPA 4MGRA 3WE2A 1TW2A 2FNAA 1OCCH 3JTHA 3FXKA 3LSIA 1YG2A 4D1QA 1OCPA 3ZMUA 2QKLB 1LQ1A 3MFKA 1WH5A 2DT7B 3OOUA 1K83J 4EJOA 2PJPA 4BYYA 1FMWA 2MBFA 4M72A 4B43A 3JAMZ 1MKMA 3H3UA 3ZQ7A 4MLOA 3RKYA 4PK4A 4LK1F 2FNPA 2QQ8A 2QUFA 4MHGA 2EIKH 1Z05A 1QO0D 3BTJA 2BW3A 2LOOA 4CZZA 2YX4A 4N9HA 1REPC 4WWCA 4U7DA 1EH6A 2NVTJ 4TV7A 4XQFA 2OCCH 3VPRA 4A6EA 3LMMA 3HBLA 2HYFA 2XKPA 2FEZA 4CGZA 3DLAA 4KT5C 2NS7A 5ICEA 1WCMJ 1BIAA 2K3FA 3KZIC 2Y0MA 3T0YA 4XNFA 2EZIA 2E5NA 2NNNA 3FXMA 4RM3A 5IY5H 4OIQF 1MSFC 1XDUA 3HSEA 3PIPF 4XBFA 2YSRA 1XMXA 1W0UA 3HOYJ 4J00A 2M45A 1KQ9A 2HOEA 1D1CA 4LITA 4ZDLA 4XLAA 4G6DA 2IP2A 2PN6A 4P1WA 5FKKA 1VQ4I 3BG3A 3VSLA 4UUSA 4JX6A 1HCRA 2VE8A 3BPVA 1P9QC 3HUGA 2HYGD 4CCKA 1VQ7I 4DZPA 2V1NA 1TW3A 3GF2A 1JHFA 2MD0A 5D4RA 1WJCA 4MQ9F 4ANJA 2DA6A 1R5GA 1X1PA 3DCFA 3MCZA 1Y39A 2VKEA 4ZZDA 2CV0A 1RKWA 2Q2EB 4B1RA 3UR3C 1GDTA 3QWLA 3TW7A 4IKFA 4G9YA 1P4WA 1NG6A 1M1EB 2AXLA 2LLKA 3LSMA 4E7ZA 1WSUA 3X2QH 3H36A 4M3GA 1G6NA 2LH9A 1V4RA 3JW4A 3BT9A 4XRSA 2E34A 5HDNA 1NH3A 3BLYA 1JHHA 1J9IA 1YJWI 4HPQA 2F2EA 3B73A 3IH2A 3TGNA 4U0VA 4RS8A 2M4GA 2OUMA 3ULQB 2XSDC 1B59A 3R0JA 4A0ZA 2K9QA 2DMQA 1U5TB 2BOLA 3I59A 2CFXA 1PUEE 3C2GA 2FU4A 1R49A 3EPZA 4KMFA 4PJNA 1ZGJA 2KQRA 2Q2EA 2ETHA 3FBNB 4R1HA 4LOCA 2STTA 1LDDA 1WH7A 3K6GA 3F8MA 3PIOF 3JRCA 2CW0F 1RPWA 4XMYA 2TRTA 2KRHA 3CJRB 1ZG1A 3ZQGA 2VOPA 3ESWB 4OOIA 2FMYA 2XF5A 2ZB9A 3FKJA 3SEZA 2LR8A 4BE2A 4LFUA 4XM3A 2OQRA 1OJLA 1IN8A 2A6TA 3GWZA 1FBSA 2IGOA 3ZQFA 3ERMA 3DF8A 1HDPA 4BJ5C 2RAEA 3K1MA 2X1EA 1XGMA 3CJNA 4HF1A 3I4MJ 3F0CA 4DYQA 2FOWA 3W6KB 4AVZA 4IO9F 1MDMA 1R36A 4W1UA 1DQUA 3GX4X 4EJVA 2EFWA 1B8IB 1TWCJ 3SJMA 1BJZA 3D5LA 2CSOA 2KP6A 1OMIA 4K2EA 2DDBA 5E8GA 3QYEA 2HTSA 3W6VA 4DBQA 2MLKA 2EFOA 3E6MA 4V19K 2Q8KA 5E79C 2VJJA 1XC5A 3H5AA 3BPXA 2DT5A 3JREA 2EIMH 5E17F 1QHGA 2WC2A 1R6RA 3V8KA 4PJJA 4WCGA 5M3FJ 2XB5A 4ZYEA 2XGXA 5FFZA 3DPTA 5KVRA 3GZ5A 2RVCA 1MD0A 1VF9A 2KHMA 1FBUA 4UY8I 2VJ5A 5EJCA 1ZG5A 2EV0A 3KFWX 5CVRA 4F52A 5LEJA 2FE3A 2HS5A 3TP0A 4BY1J 3ABTA 2P5KA 2O03A 1ERDA 1I6XA 3CMAI 2XAJA 2F4IA 4BQNA 2HQRA 3E0JB 3MKWB 3CDHA 4A0XA 3AAFA 1KQ8A 3HHGA 2W7NA 3HDDA 1BJAA 4M74A 2EINH 3UKGA 1ZG3A 4BY7J 1FWZA 1IDYA 4OIRF 3LWFA 3BR6A 3HRUA 3DBHB 2ISZA 2I8DA 2Y69H 1C0WA 2X1DA 3G2BA 1WHUA 2E19A 2DK5A 3HG9A 2EFQA 2HOAA 3V4GA 4RAZA 3WGIA 2I5UA 5FKLA 4IQ4A 3H3VK 1SD7A 2H94A 3HOZJ 5IYDJ 5C4JJ 4IXAA 4RM2A 4ITVA 2LKSA 4RAFA 1FSEA 4EEFG 4C2TA 3PNVA 1PP7U 2E7XA 1SVLA 1KU2A 3PFYA 3WHBA 5TISC 1OFCX 4ZH4F 4L5IA 1WPKA 2JVHA 2FMLA 1Y8QB 3M8FA 5FKOA 4KA4A 2QSGX 1T6SA 2VE9A 2KZVA 3S3NA 5KNLA 2ZBKA 4HNTA 2VI6A 3BG5A 4F93B 2Z99A 4LB5A 1B4AA 2EBIA 1KQ0A 4Y13A 2JPBA 3HZJA 4XRFA 3ZPLA 2VODA 5GAGJ 4E7HA 2Y75A 2KIMA 2ELKA 1X3ZB 3SFIA 3ZQCA 4LGWA 1LVAA 1FBQA 5B1AH 2NVXJ 2HZTA 4GO1A 1UHSA 4P9UA 1F9NA 3NWTA 4LIVA 3HOTA 1BW6A 3PUBA 5K1YA 3J7YJ 4IOCF 1CF7A 4RBOA 2IW5A 1ZR4A 2DU9A 1GVDA 3CMMA 4L5EA 1H9GA 1HQCA 4B47A 2DOEA 5LHHA 2L4MA 2JUCA 4I76A 2LF8A 4A3JJ 1Y0UA 1YS7A 1QZZA 2MD5A 5CLSA 3EUAA 1XB4A 2Y2ZA 5ILVA 1K78A 4FETA 4A69C 2W82A 3Q0WA 1DU0A 4F7ZA 4V2GA 2FQ4A 1S6LA 5HDKA 2YX7A 3ZQQA 2CUJA 1ZQ3P 5ILSA 4BDZA 3H3ZA 4UV9A 2FF4A 3REOA 4G8XA 1IN5A 5AIPA 2KLOA 2X4HA 2JVGA 3GO5A 3QPHA 2O9LA 9ANTA 3GTQJ 1U5TC 3PUFA 4BXFA 3C18A 1Y8RB 3ZCOA 2DA5A 3EDPA 1BR2A 1G3SA 3DXJF 3OL3A 2GLOA 1EA3A 2V9VA 4O3MA 1QPIA 3HOWJ 4M73A 4BDYA 4IHTA 3QU3A 2UUZA 3K1NA 2NVUB 5D5WB 1YITI 1FT9A 3CCJI 3PQKA 2IA2A 2OD5A 1WVRA 2ZNYA 2VBYA 3I9V2 3PFIA 2DI3A 2O61A 1ZRFA 2R7FA 3CC7I 3EUKL 2HVQA 3ZMDA 1W5SA 2DQRA 4Y3OA 3IP4B 1AU7A 1RR8C 2YU3A 1APLC 5EEAA 5DCFA 3WG7H 3GLLA 1JT6A 4XLCA 3FDYA 4XOTA 3MZHA 3AL0B 2OBPA 1U6GA 2DYSH 3IH3A 1MMGA 4IX7A 2WAEA 2RQQA 2C6YA 1Z6TA 1X1DA 1FYMA 1VQ8I 2NVQJ 3LSJA 1Q1HA 1XMAA 2R5ZA 1T98A 2F4MB 1RR7A 3MAJA 2M7BA 2F6CA 3KEOA 3K4NA 1TT0A 1R7JA 1MJAA 1ENHA 3FXLA 2ZMEA 1W7PA 1GLNA 1T95A 2NS8A 4YG2F 3L2QA 3L2VA 1R71A 4DZJA 2B9SA 3J80Z 2KRFA 3BR3A 3B6CA 5L3FA 1T08B 1SD4A 1B9MA 3I5UA 1G4DA 1D8JA 2IAIA 2R7DA 5KK1A 2DQLA 4ETSA 3DBRB 2DOAA 4A3IJ 5F08A 1J59A 3CJQB 5JR3A 5J4YA 2AHQA 1S7EA 1IGNA 1AWCA 2K3PA 2K7LA 4DGWB 5E3NA 4HDUA 4NNJA 3KZZA 2L02A 1WI3A 2QQBA 3CD6I 1HA8A 1Y1WJ 1A31A 1YFHA 1W0TA 1YYVA 3OYGA 4YFXF 3P9CA 4G6TB 3KZYA 3W6JB 2HWVA 2B0LA 2IXSA 3IAS2 5DUKA 4CICA 2LRDA 2IS2A 5TGTA 1E0EA 1F1ZA 4HX4A 5GPCA 2HXOA 3DPLC 2KIFA 4FISA 3FK7A 3S2DJ 4HG2A 2MG4A 1FP2A 3FM3A 4BACA 2D1HA 2M2EA 5ERIA 1DUXC 3T8TA 5J6XA 5FGMA 3V42A 3A0HC 3HRSA 3F22A 1W36D 2VQLA 1VQPI 2CUFA 2WY7Q 1XSDA 3L2CA 4U0WA 5FLVA 1ONVA 3JRIA 3I53A 4XLPF 1NHAA 1PUFA 1USTA 4RAYA 2EA2A 1JKRC 1T8IA 3V7SA 2IEKA 5GTHC 2A68F 2L9RA 2EZLA 5FD6A 4KJZA 3LA2A 4X1EA 1IRZA 5EG0B 2MC3A 3OYFA 4M6VA 5D6EA 3GTKJ 2PMZA 4FTHA 1PVEA 1R4MB 5JVGF 5B5EC 1ZHFA 3SQNA 1ITYA 2E1MB 1H9TA 5D8KB 2IS4A 1OKRA 4G12A 2CGPA 3PSIA 2PJRA 4PGHA 2VQCA 4IHVA 1MBKA 2OCEA 1G8XA 1DGWY 2EILH 1BM9A 2CV1A 4I09A 3IH4A 5IT3A 4BU2A 4CO8A 1WJEA 1XMKA 4PJLA 2JJ7A 4C9YA 1T33A 2DXIA 3ZRGA 2EFPA 1UAAA 2JA7J 1MH4A 1OPCA 1YX3A 3OYNA 2BE5F 4CDGA 2JQ7A 3S93A 3SHFA 4BE0A 2GXGA 3KP4A 3RQIA 1JKQC 4P5OA 2DFIA 2F5FA 3VDXA 1BI0A 5EZGA 3WTYC 1BR4A 2G9WA 1FPQA 3L9FA 1ZRDA 4S05A 3IUOA 4Z2YA 1Y6IA 3SZTA 1ETOA 3TO9A 3HEFA 1X4OA 2GIVA 1RZ4A 2FBHA 3BZ6A 3BTIA 2VBWA 1HKQA 1X3UA 4ENMA 3TDZC 5H2FC 3AG4H 1EKEA 1F5TA 4KDPA 2QVOA 3R60A 4XONA 1FSHA 2WB1A 4FHTA 3OL4A 3S3OA 2K9NA 5KAIC 1MMDA 3MQ0A 1S8NA 2ZMEC 3ECOA 2CW8A 1WWXA 1X58A 2OU2A 4A93J 1WKMA 2HU9A 3T5XA 3ZMVA 1OYIA 3P9KA 4QPOA 2VPLA 1RESA 1E3PA 3LA3A 3GZNB 1IXRC 5EDNA 2R7XA 1D5VA 2F5VA 4PSXA 1FIPA 2Y48A 3CP2A 3MEXA 2RC4A 4AIJA 2YPRA 1G2HA 3F8NA 3GFLA 3ASNH 4LG0A 2N8GA 1VQNI 2VT2A 4YEJA 5K5RA 4XICA 1IAWA 3CTAA 4KIFA 5DEQA 3HXLA 3A2KA 4PFPA 2VC0A 1AKHA 2V1XA 2DDAA 2LFBA 2HEOA 1TWFJ 4XRMA 1XTAA 2XRLA 3ZOBA 1EH7A 2EJRA 5E1WA 1RNLA 5BOXA 1V5GA 3PM1A 5DDGA 4A5NA 1F43A 1J7KA 2X48A 1IXCA 3CP8A 3RPQA 3F21A 3BR1A 2L3DA 2O5RA 4Q5SF 3SZPA 1I3AA 3K70D 4MFDA 4KUMA 3OYLA 1UB9A 1U5TA 1T56A 5F27A 1ORKA 3G6EI 1BC7C 1ETXA 3VYSB 1YIJI 2WAQN 3Q0UA 2A3SA 3ZMSA 3JRFA 1TNSA 2W85A 2V6EA 2O8XA 1N75A 1FOXA 2MH9A 4HNUA 3I59B 4EM0B 4YIRX 3L2WA 2JTVA 3BR2A 2MGQA 3FXJA 1BN5A 1NK2P 1YO5C 2GOMA 4IQJA 3EUHA 3H35A 4ENJA 1VQ6I 3DP7A 3FXUA 4IRHA 3PJRA 2DA7A 1UZCA 2DMNA 2ZFWA 2JSCA 2RNGA 3GTJJ 3R61A 1PUFB 1A36A 2W24A 3Q0VA 2DJIA 3TW6A 2GAUA 5B1BH 4BBSJ 1LB2A 1GXQA 4A3KJ 2DA3A 3QP6A 3QOPA 1V55H 1S72I 1YW9A 4XORA 1B8IA 2H1KA 4BQOA 1QGPA 1ZN2A 1WJFA 3L2RA 2YR2A 2JZYA 4HQEA 2F48A 3T1BA 4L9JA 1FC3A 5TJJA 2XF6A 1JUMA 2ECCA 3MMYB 4PZJA 1W36C 2X6XA 2E1NA 1TTYA 4S04A 4NQWB 3S1RJ 1HSJA 1RKTA 5E3MA 3KP7A 1SFEA 5C44J 3HPGA 3GTOJ 2JRTA 3G73A 2L7FP 2VKHA 5BMZA 2DTZA 3C2HA 2TDXA 2V9PA 3SEQA 3KETA 5BPIA 1I1SA 2CH0A 3WGGA 4U7BA 3JTGA 2PX9A 3O8GA 2LY2A 3BR0A 4BKXA 3E5UA 5CVVA 1BL0A 1KU7A 3P7NA 2HYJA 5BQTA 5E18F 2COBA 2A5WA 4Y17A 2OQGA 2IS6A 4C3JJ 1RI7A 4A3DJ 2XIGA 3MKLA 1S5LC 3K10A 4CCOA 4RB3C 2OAZA 3DTEA 1Z9CA 5EZHA 3J7AY 3GTLJ 2QF7A 2WADA 2DODA 3WE3A 3R0AA 1E3HA 3S1QJ 4IRIA 2FQ3A 2HOTA 3S32A 3CQZJ 1OQYA 3BQZA 2L7ZA 2QSHX 2XC7A 4WK8F 1TQPA 4IZZA 1IC8A 1VQ5I 4D5CA 2LSOA 1X19A 4QPQA 5C3EJ 2LBFB 1MZBA 3M4OJ 1U0JA 4U0YA 1BR1A 2W25A 4AYBN 4GFBA 2A69F 4YFNF 2LP0A 5LGTA 5LD2C 3V8JA 1WGXA 2CO5A 1ZGWA 5EYRA 2NRAC 5L3EA 1H89C 1G3TA 1LKXA 4UHTA 3MN2A 1VTNC 1YRNA 3WTUC 2KISA 3K4JA 2H27A 1IF1A 2L0KA 1VQKI 3WU1B 2PJRB 3F8CA 3HIFA 2ELHA 2M3AA 1WRJA 5B3SH 2P7VB 4QSHA 3TDUC 5ED4A 5BPDA 1XGOA 5M3MJ 1KYZA 2HR3A 4BXXJ 2R4GA 4I6ZA 2CS3A 1SC7A 1MBFA 2EV6A 2F4OB 3WTWC 3H0DA 1B72B 4GXOA 5FRMA 4E7IA 1O3RA 4R79A 4MTEA 1AKHB 4IHYA 1BA5A 3DKXA 2DA4A 4JBAA 4X6AJ 3HL2A 5HDGA 5L3CA 3QP5A 4U87A 5JI6A 2KDZA 5GP9A 1KZHA 4AC0A 2W00A 4NC6A 2VONA 5FRNA 1SANA 2LY9A 1SMTA 4KICA 1T2KA 1FJLA 2ZSIB 4V2FA 1MNDA 1U9OA 1HC8A 5CPRB 3OS1A 1MMNA 2H1LA 1YHQI 1AHDP 2Y30A 5IP6A 4PJMA 1U8RA 5LRSA 2LKPA 4C2UA 1WJ5A 2DT6A 2RGVA 3EUHC 3QODA 3QQAA 4RLFA 1DP7P 2ELJA 1D5YA 1R9TJ 2CQ7A 2MLGA 2XGEA 3MVPA 1W1WE 4FX0A 4LG3A 3SYTA 4M3EA 1UMQA 2CRGA 5F64A 4XOPA 1UHMA 1P2FA 2H6BA 2KFDA 3DEEA 1N25A 4XLHA 5J47A 4PJ0C 2DAOA 3TMOA 1ON1A 2EPFA 2IA0A 2IJLA 2OC6A 5E3LA 1A5JA 5F1RA 2CFOA 3DFGA 4UVAA 1HW1A 1MJBA 1LE8B 4UXNA 5CVJA 2WV0A 1FTZA 3PQJA 3ZP5A 1XDSA 4Y52J 2HPMA 2CMPA 5J1UA 3GYHX 2M9HA 2IBDA 3E6CC 3Q9VA 2E5ZA 2O3FA 2QM3A 2ZFUA 1QA6A 4A3CJ 2BVMA 1Z91A 3ZR8X 5L3GA 4D7MA 2GA2A 4L0YB 3FKIJ 3OY9A 4KN7X 5IOZA 4FX4A 3DU5A 1FOKA 1OCZH 1KONA 3LL7A 2IGMA 3Q9SA 3V8LA 3LSRA 3FHZA 1MBEA 3QAHA 3RKQA 4I99C 2HVRA 1FX7A 3RDIA 1S9HA 2X85A 3NARA 3ISPA 4A3FJ 2IT0A 1LEBA 1TT5B 2IGNA 4GYGA 1NTCA 2F5DA 2IGKA 3H9GA 4I2OA 4ENKA 5IPAA 1TBXA 3AG1H 5FJ8J 3A02A 5FFXA 3CCVI 2W84A 4N9IA 2BVLA 4M3DA 1W7PB 2XPWA 3KP6A 5H20A 3ABKH 3AFHA 3NRVA 2BY1A 4UUTA 1EV7A 2KJCA 2VBZA 3E6DA 2XRNA 2W4SA 3HUGB 5J3LA 3D5RC 1IUFA 5H6QA 2LYCA 2PQ8A 3HTSB 3NAUA 3BZCA 1O57A 2R7VA 1ODDA 3D0SA 1IO2A 4L9NA 3FWEA 4LLNA 2JA6J 4HDVA 5E1XA 3ZQLA 4LMYA 3M1CA 2R5YA 4MNUA 2JPCA 2NYXA 2CQNA 1IRGA 2WY8Q 3LSHA 4BGDA 3DQVC 3E5QA 1ZREA 1ETQA 1F36A 1O3QA 4BE1A 4H0EA 2PLYA 3RKXA 3QPLA 2ISYA 2J5OA 3I58A 3H5NA 1IN6A 1ZARA 2L2OA 1VQLI 3ZMTA 5JLWA 1JXSA 2F5CA 2DJNA 3RCOA 4BNCA 3DWLE 4CCJA 4RA2A 4ZTFA 1TWGJ 2JK3A 3K4CA 4ESFA 4LK0F 4NC8A 1GUUA 1ZRCA 3CF5F 4QWQA 3JR9A 4ZYHA 1B9NA 5D5XB 5JHUA 4P96A 5LEKA 1A6QA 1I27A 2COMA 3BP8A 1SD5A 3GMEA 1IJWC 2HDCA 3K2AA 5EGOB 4QTRA 2XVCA 2DPUA 1IRFA 3OYJA 3BC8A 4YFKF 3JRDA 4D9JA 2ID3A 1JI8A 1MDMB 3EQLF 5KHDA 2ZCWA 1QPMA 3RPUA 3RJPA 1Z77A 2W57A 2VJ4A 4IF4A 2EB7A 2FA5A 4M6XA 3DEUA 4XKCA 2CUEA 5IYCJ 4CUGA 2AQEA 1HW2A 2VQGA 4RB2C 4ZDOA 3M07A 4G94A 3IKTA 2E2JJ 5IT9Z 3C1DA 4EV0A 3CDIA 1SVOA 2GIZA 1LFPA 1P4AA 4UB6C 1RIOH 1GT0C 2DN0A 2M0CA 4ZYAA 2PEXA 2QBYA 3ZXSA 2VOOA 3G1LA 1I50J 1QRYA 1EJ9A 1G59A 1D8KA 3OIQA 5M5WJ 3R6SA 1ON2A 5H6RA 1QNTA 1KU3A 1TZLA 2M5WA 3MKZA 4Y4RA 2GZWA 4EQQA 3KLNA 2CJJA 3DV8A 3QPTA 3LAJA 3VFZA 5FLXZ 2XSJC 2ESHA 5J1RA 1SFXA 1W4MA 3CO6C 1KA8A 3CCSI 2UZKA 2XGCA 3WODF 3FK6A 1R5HA 3J80K 5D6FA 3GFMA 4C3IJ 2JN6A 5HLGA 1I5ZA 4CZCA 5AONA 1I3QJ 3PSFA 2P6SA 1K4SA 1OISA 2FXAA 2K4BA 2R7UA 5IP9J 1IN7A 2DYRH 2GOXB 5A2QZ 3A01B 2PMUA 2H6CA 4QLCU 4HV5A 4G7ZF 2CWEA 2Y9YA 1VQOI 4ZTJA 1MBJA 4M6YA 3WTSC 1DDNA 2E2IJ 2FBKA 2ESNA 2JSPA 1GV2A 3IRQA 1ZH5A 4DYCA 5IT9K 2QKMB 3L09A 2KL4A 2HGCA 4ZJZA 1FY7A 3BG7A 5CQEA 3LSTA 3M8JA 3CCMI 2P5VA 4JP0A 3L2UA 2QENA 2OZUA 4QIWN 2BY0A 5HS7A 2X0LA 3K2ZA 5FD5A 1J2XA 2ME0A 4AIHA 4WX9A 2VC1A 3CC2I 3BJ6A 2EH3A 4R8HA 4BUPA 1ULYA 5TRDA 1YW8A 1XSVA 1UHWA 1Z7LA 4RAGA 3BROA 1O7FA 3OSFA 4LG0B 4FT8A 5DTDA 4DW6A 2DOFA 2XHKA 1XGNA 4BQAA 3ZGKA 1BI3A 3PNYA 2WAQA 3J7ZI 1WQ2A 5HLHA 3WGHA 4E7JA 4E7KA 3K70C 1WFXA 3S1MJ 1YX5A 3B6AA 2ACJA 2JMWA 2JWTA 2M8GX 3KX2A 3I56I 1FEXA 5KAFC 2D45A 2IRFG 3M8EA 1SVMA 2DMUA 3ECHA 3OWTA 2QYOA 3S3MA 2CQKA 4GCVA 1J5YA 3F9KA 2I10A 2EA4A 4N4NB 3W2VA 4L0ZB 3TBIA 1HLVA 4MO7A 1FLIA 2JA5J 1FMVA 2LY1A 4PFOA 3V7CA 5L3BA 4J01A 4B09A 3OYAA 1MIJA 2CW7A 1Z67A 3FXQA 3GW2A 1R58A 3O8HA 2X9DA 4II2A 4AUXA 3S17J 1HW5A 3IWZA 4LD5A 1D0YA 1X4PA 4MTDA 3VODA 2JT1A 4HQMA 1HBXG 1UELB 4RGUA 2K9SA 1XPXA 2W48A 4HSTA 3A03A 4E4HA 2VLAA 2DA2A 1TC3C 1O3SA 2RREA 1FNNA 1YI2I 2IA1A 3H9JA 1IG7A 3J81Z 3WU2C 2Y31A 5FKMA 2L4AA 5A2QK 2R93J 2BHYA 3RZOJ 1TP4A 1ACIA 3AL0C 2M30A 3WTVC 4DBRA 2FJ1A 1S3JA 5CKTA 4EM2A 4KNYA 1HSTA 4UV8A 3FF5A 2JA8J 3N05A 3LOCA 2E71A 1Q1VA 2NVYJ 2DK8A 3G1MA 4I7HA 3U21A 3GTGJ 4B4CA 3DBLB 3HOSA 3MZ8A 5FLXK 4ZDPA 4PGGA 4IHWA 1UG2A 2R5YB 1Y0NA 4IRGA 5HNHA 2LTPA 3KIOA 4UVBA 1S29A 3G71I 2QBYB 1AA7A 3GFIA 3LQRA 3JRGA 3TL4X 4E7LA 2G0EA 3E6BA 3HHHA 4P55A 2O0YA 2OA4A 2BEOA 2X51A 2Z9OA 2E60A 2D1VA 3H9QA 2LKXA 5DCMB 1ZTRA 3I55I 3VSKA 1R00A 4AM3A 2OJED 4B48A 2VT3A 4IJAA 3HKZA 1LUJB 2OPTA 2YS9A 2KIQA 4UNOA 3EYIA 2ADUA 2FX0A 2DLLA 2VPRA 3AG3H 1P6RA 4B8XA 3E7LA 2LF7A 1TWAJ 4G7HF 1S7AA 1DP3A 4IPAA 5DM7F 5FO5A 2R7SA 2G7HA 1ZR2A 4JQFA 4X0GA 3ZQIA 3EETA 4MEYF 2ZXIA 1G3YA 3QPSA 1FOYA 1OCTC 3PNTA 3CUQC 3DKYA 1SMYF 2QWWA 3TOAA 5IOYA 2ZO4A 3BTCA 2WTEA 1MMSA 4NC7A 4IEJA 2L7MP 1TQMA 3K4BA 2LBFA 5DM6F 5E3OA 1A6IA 2M34A 2Q1ZB 1WI9A 4XLNF 1YRNB 2P7CB 3K4LA 4EJUA 1QVUA 5GADJ 1Y1VJ 1JGGA 2YUSA 3HM5A 3O2PE 3S8PA 1GXPA 5J4VA 2BBYA 1SFUA 2L54A 2PBIA 1NG7A 2RQPA 3JRBA 2ZSHB 2M4KA 3GTPJ 1QVTA 3RYRA 3VOEA 1LNWA 3U1DA 3CZ6A 3I54A 1MMAA 3M9AA 3CMYA 1EF4A 4HV6A 2Z2SB 2L7KA 2XV4S 1LDKB 2KZGA 3KP5A 2CG4A 3S14J 1XS9A 3FISA 4BHCA 5EEHA 5K7FA 3QU6A 2E35A 3KYDB 3ERED 4RDUA 4BJ6C 3HRTA 2PMHA 2YU9J 4RLQA 3O3KA 3BZKA 4II3A 3F6VA 2V4JC 1R22A 1EH8A 2XAUA 5J8CA 1H8AC 1MBHA 3FIWA 3OYBA 2L9SA 2P0WA 2BHZA 3A1YA 4I0AA 4LLGF 1X2MA 4I02A 4AIKA 3OYCA 2DMTA 1OYWA 2HNHA 3S2HJ 2HKXA 1U3EM 1JT0A 2EZHA 3RSNA 1IV6A 5FKNA 4DIQA 3CJTB 5B66C 3L7WA 2EFNA 1YLFA 3C2BA 4D5FA 4LLLA 1BOAA 1XN7A 2E1CA 5KCMA 1V5EA 1XGSA 1LEAA 3BCAA 3E1SA 1O4XA 1P4XA 1TWHJ 2VASA 1K61A
chains in the Genus database with same CATH topology
1ZQ3P 1LE8A 3HGGA 5E3LA 1A5JA 2ID6A 2ME6A 1VFCA 2O7OA 1LE8B 2O9LA 9ANTA 1FTZA 1VNDA 3GTQJ 3HB9A 4Y52J 4A3EJ 1JKPC 5J1UA 2DA5A 4CYCB 2GLOA 4UUSB 2M9HA 2OF7A 3LNQA 2IBDA 1QPIA 3HOWJ 2MW8A 4A3CJ 2LVSA 1ETWA 1X2NA 1FIAA 4JYKA 4D7MA 4MIMA 3BG9A 3TP3A 2R0QC 3FKIJ 5IOZA 1Z0XA 1AU7A 2XPVA 5C4XJ 1JTYA 5F1JA 3LSRA 1MBEA 3RKQA 5J1YA 4NDLA 5M5XJ 2O8KA 3A01A 1APLC 3NARA 4A3FJ 1HF0A 5EEAA 1E3OC 1NTCA 1JT6A 1BW5A 2K40A 3IH3A 3OSGA 5IPAA 3JRHA 5JLXA 5FJ8J 3A02A 3HOUJ 1U9NA 2NVQJ 3LSJA 4M3DA 2R5ZA 1RR7A 4FE4A 4BBRJ 2XPWA 1ENHA 4UUTA 5F04A 2NS8A 2KT0A 2VUMJ 2ECBA 1JKOC 3GTMJ 5J3LA 5BNGA 1IUFA 2HOSA 3M3YJ 3CDLA 4DZJA 3BR3A 3B6CA 3NAUA 2IAIA 3BR5A 2E2HJ 4A3IJ 2JA6J 3H0GJ 5F08A 1HOMA 1GV5A 3Q3SA 3ZQLA 2AHQA 1H88C 2R5YA 1S7EA 1IGNA 1SFOJ 2HQ5A 2R5ZB 1ETQA 1F36A 5E3NA 4J19A 1WI3A 3QPLA 5K7HA 2XPUA 3SDGA 1Y1WJ 2D5VA 1W0TA 3K7AJ 5IYBJ 4FCYA 4Y7NJ 2Y9ZA 5JLWA 2R7ZJ 1LFBA 1FTTA 5F0HA 2DJNA 5GPCA 2HXOA 1LFUP 3GBGA 4FISA 3FK7A 1TWGJ 3S2DJ 2JK3A 2MG4A 3RZDJ 2MSYA 5F0FA 2XB0X 2M2EA 4DYRA 4XIDA 1JJ8C 1GUUA 2TCTA 2CUFA 1ETYA 5FLVA 3JR9A 3JRIA 1PUFA 1NK3P 1MH3A 3LSPA 2R92J 4A3GJ 5EGOA 4FE7A 2HDDA 2HXIA 4A3BJ 1JKRC 2IEKA 1IJWC 5F0CA 2L9RA 1JUSA 2EZLA 3K2AA 4QTRA 5EGOB 4X1EA 1IRZA 1MBGA 5EG0B 2NOGA 4M6VA 1JUPA 3JRDA 3GTKJ 2ID3A 2VKVA 2P81A 5EF6A 1DU6A 3JRAA 3LSGA 5EG0A 4FTHA 1U78A 1Z77A 1VI0A 1ITYA 2CQQA 5DS9A 2CUEA 5IYCJ 5M5YJ 2E2JJ 3G1OA 4G12A 1P7JA 4M3BA 4IHVA 1MBKA 1GT0C 5GPAA 2DN0A 3WHCA 2LK2A 2M0CA 3IH4A 4S0HB 3G1LA 1I50J 1QRYA 2JJ7A 1T33A 1IDZA 2JA7J 1MH4A 5M5WJ 2HI3A 1OCPA 2GBYA 3RQIA 1JKQC 1WH5A 3OOUA 1K83J 1MSEC 3S1NJ 2CJJA 5EZGA 4MLOA 3BTJA 5J1RA 1ETOA 2XGCA 3FK6A 3HEFA 1RETA 1ETKA 3BTIA 3ZQHA 2NVTJ 3VPRA 4C3IJ 2JN6A 3IV5A 3HBLA 1I3QJ 3BTLA 5IP9J 2NS7A 3A01B 2K9NA 1WCMJ 5FLMJ 2EZIA 2Y9YA 2FD5A 1MBJA 2E2IJ 1MSFC 1X58A 1GV2A 4DYCA 1W0UA 3HOYJ 4A93J 4XRSG 1RESA 4JP0A 5EDNA 5FKKA 3BG3A 4UUSA 4QIWN 1FIPA 4JX6A 1G2HA 1HCRA 2ME0A 2N8GA 2EH3A 4DZPA 4XICA 2X6OA 3OSFA 5DTDA 4DW6A 1AKHA 1ETVA 2DA6A 5IP7J 3DCFA 2VKEA 1RKWA 2LFBA 4B1RA 1TWFJ 1GDTA 2QCOA 3TW7A 4XRMA 4C3HJ 2XRLA 2E1OA 2WV1A 3ZOBA 4JX5A 2LLKA 1POGA 3S1MJ 3PO3J 3PM1A 3B6AA 2JMWA 4M3GA 1F43A 2JWTA 2X48A 2M8GX 2XGDA 1FEXA 3BR1A 2DMPA 3BT9A 4XRSA 4MFDA 2DMUA 1JJ6C 1I6HJ 1T56A 5F27A 3IH2A 3CCYA 1ORKA 1ETXA 2I10A 2XSDC 2CQXA 2K9QA 2DMQA 1HLVA 2WAQN 3Q0UA 4MO7A 3JRFA 2JA5J 5K7ZA 1HDDC 3BR2A 2MGQA 4LOCA 1NK2P 1WH7A 2EQRA 3JRCA 1RPWA 3BQYA 2TRTA 3ZQGA 3O8HA 2X9DA 2ZB9A 4AUXA 3S17J 2LR8A 2DA7A 2DMNA 1PUFB 3GTJJ 1OJLA 2K9SA 3Q0VA 3TW6A 1MNMC 4BBSJ 2W48A 3A03A 3ZQFA 2DA2A 4A3KJ 1TC3C 1HDPA 2DA3A 2RAEA 1IG7A 1B8IA 2H1KA 3I4MJ 2Y31A 5FKMA 3F0CA 4DYQA 2R93J 3RZOJ 4W1UA 1B8IB 1TWCJ 3SJMA 1BJZA 2FJ1A 1JUMA 2ECCA 3W6VA 3S1RJ 2JA8J 5E3MA 1RKTA 3HOVJ 3LOCA 1Q1VA 2NVYJ 3G1MA 5C44J 3GTGJ 3GTOJ 3HKZN 4B4CA 2L7FP 4M3FA 1XC5A 4A3MJ 2GM4A 2DTZA 2DA1A 3JREA 4IHWA 1UG2A 2R5YB 2LTPA 5HODA 2AO9A 5M3FJ 3JRGA 2XB5A 3O8GA 3BR0A 3OIOA 4BKXA 1BL0A 2G0EA 1VF9A 2HYJA 3D1NI 2LKXA 1ZTRA 3TP0A 2COBA 4MFEA 4BY1J 3L1PA 2OPTA 4C3JJ 2YS9A 4A3DJ 3MKLA 3HDDA 5EZHA 2FX0A 3UKGA 2VPRA 4BY7J 1IDYA 3E7LA 1TWAJ 2QF7A 3GTLJ 3BR6A 2PMZN 4D7NA 3HOXJ 1ZR2A 3S1QJ 3ZQIA 2HOTA 2E19A 3CQZJ 3QPSA 2HOAA 3BQZA 2L7ZA 4JX4A 2LD5A 5FKLA 3TEDA 3H3VK 2CU7A 1OCTC 3HOZJ 3PO2J 5IYDJ 5C4JJ 1IC8A 4D5CA 1B72A 3S15J 5C3EJ 5IOYA 3M4OJ 3BTCA 4EEFG 4AYBN 4GFBA 4IEJA 2L7MP 4B3AA 2LP0A 1U8BA 1WGXA 3WHBA 1A6IA 4W97A 5EYRA 2M34A 1OFCX 5E3OA 1ZGWA 3DEWA 1YRNB 1H89C 1WPKA 1QVUA 1XG1A 5FKOA 3MN2A 1Y1VJ 1JGGA 1YRNA 2YUSA 3HM5A 2L0KA 2VI6A 3BG5A 2EBIA 3JRBA 3GTPJ 1QVTA 4QSHA 3CMYA 2Y0SN 5M3MJ 1EF4A 2ELKA 4BXXJ 4HNVA 3SFIA 4I6ZA 3ZQCA 1MBFA 3S14J 1XS9A 1B72B 3FISA 5K7FA 2H8RA 1AKHB 2NVXJ 4IHYA 1BA5A 4RDUA 1ZKGA 4X6AJ 2DA4A 4XK4A 1UHSA 2YU9J 1CQTA 1BW6A 4RBOA 1H8AC 1ZR4A 1MBHA 1ZK8A 4ABZA 1GVDA 3FIWA 5GP9A 2KDZA 4L5EA 4AC0A 3S16J 1P7IA 1SANA 2LY9A 4A3LJ 2WB1N 3I4NJ 1FJLA 1X2MA 4V2FA 4I76A 4CYCA 2DMTA 1U9OA 2B63J 3S2HJ 1AHDP 2Y30A 5IP6A 1JT0A 2EZHA 4A3JJ 1IV6A 5FKNA 3QQAA 2Y2ZA 1D5YA 1R9TJ 3C2BA 4D5FA 2XGEA 3MVPA 4C2MJ 4A69C 1DU0A 3Q0WA 4M3EA 3HGYA 1JTXA 4V2GA 2EZKA 1UMQA 2FQ4A 2CRGA 1O4XA 1TWHJ 4IHXA 1K61A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1ZQ3 P;  1LE8 A;  3HGG A;  5E3L A;  1A5J A;  2ID6 A;  2ME6 A;  1VFC A;  2O7O A;  1LE8 B;  2O9L A;  9ANT A;  1FTZ A;  1VND A;  3GTQ J;  3HB9 A;  4Y52 J;  4A3E J;  1JKP C;  5J1U A;  2DA5 A;  4CYC B;  2GLO A;  4UUS B;  2M9H A;  2OF7 A;  3LNQ A;  2IBD A;  1QPI A;  3HOW J;  2MW8 A;  4A3C J;  2LVS A;  1ETW A;  1X2N A;  1FIA A;  4JYK A;  4D7M A;  4MIM A;  3BG9 A;  3TP3 A;  2R0Q C;  3FKI J;  5IOZ A;  1Z0X A;  1AU7 A;  2XPV A;  5C4X J;  1JTY A;  5F1J A;  3LSR A;  1MBE A;  3RKQ A;  5J1Y A;  4NDL A;  5M5X J;  2O8K A;  3A01 A;  1APL C;  3NAR A;  4A3F J;  1HF0 A;  5EEA A;  1E3O C;  1NTC A;  1JT6 A;  1BW5 A;  2K40 A;  3IH3 A;  3OSG A;  5IPA A;  3JRH A;  5JLX A;  5FJ8 J;  3A02 A;  3HOU J;  1U9N A;  2NVQ J;  3LSJ A;  4M3D A;  2R5Z A;  1RR7 A;  4FE4 A;  4BBR J;  2XPW A;  1ENH A;  4UUT A;  5F04 A;  2NS8 A;  2KT0 A;  2VUM J;  2ECB A;  1JKO C;  3GTM J;  5J3L A;  5BNG A;  1IUF A;  2HOS A;  3M3Y J;  3CDL A;  4DZJ A;  3BR3 A;  3B6C A;  3NAU A;  2IAI A;  3BR5 A;  2E2H J;  4A3I J;  2JA6 J;  3H0G J;  5F08 A;  1HOM A;  1GV5 A;  3Q3S A;  3ZQL A;  2AHQ A;  1H88 C;  2R5Y A;  1S7E A;  1IGN A;  1SFO J;  2HQ5 A;  2R5Z B;  1ETQ A;  1F36 A;  5E3N A;  4J19 A;  1WI3 A;  3QPL A;  5K7H A;  2XPU A;  3SDG A;  1Y1W J;  2D5V A;  1W0T A;  3K7A J;  5IYB J;  4FCY A;  4Y7N J;  2Y9Z A;  5JLW A;  2R7Z J;  1LFB A;  1FTT A;  5F0H A;  2DJN A;  5GPC A;  2HXO A;  1LFU P;  3GBG A;  4FIS A;  3FK7 A;  1TWG J;  3S2D J;  2JK3 A;  2MG4 A;  3RZD J;  2MSY A;  5F0F A;  2XB0 X;  2M2E A;  4DYR A;  4XID A;  1JJ8 C;  1GUU A;  2TCT A;  2CUF A;  1ETY A;  5FLV A;  3JR9 A;  3JRI A;  1PUF A;  1NK3 P;  1MH3 A;  3LSP A;  2R92 J;  4A3G J;  5EGO A;  4FE7 A;  2HDD A;  2HXI A;  4A3B J;  1JKR C;  2IEK A;  1IJW C;  5F0C A;  2L9R A;  1JUS A;  2EZL A;  3K2A A;  4QTR A;  5EGO B;  4X1E A;  1IRZ A;  1MBG A;  5EG0 B;  2NOG A;  4M6V A;  1JUP A;  3JRD A;  3GTK J;  2ID3 A;  2VKV A;  2P81 A;  5EF6 A;  1DU6 A;  3JRA A;  3LSG A;  5EG0 A;  4FTH A;  1U78 A;  1Z77 A;  1VI0 A;  1ITY A;  2CQQ A;  5DS9 A;  2CUE A;  5IYC J;  5M5Y J;  2E2J J;  3G1O A;  4G12 A;  1P7J A;  4M3B A;  4IHV A;  1MBK A;  1GT0 C;  5GPA A;  2DN0 A;  3WHC A;  2LK2 A;  2M0C A;  3IH4 A;  4S0H B;  3G1L A;  1I50 J;  1QRY A;  2JJ7 A;  1T33 A;  1IDZ A;  2JA7 J;  1MH4 A;  5M5W J;  2HI3 A;  1OCP A;  2GBY A;  3RQI A;  1JKQ C;  1WH5 A;  3OOU A;  1K83 J;  1MSE C;  3S1N J;  2CJJ A;  5EZG A;  4MLO A;  3BTJ A;  5J1R A;  1ETO A;  2XGC A;  3FK6 A;  3HEF A;  1RET A;  1ETK A;  3BTI A;  3ZQH A;  2NVT J;  3VPR A;  4C3I J;  2JN6 A;  3IV5 A;  3HBL A;  1I3Q J;  3BTL A;  5IP9 J;  2NS7 A;  3A01 B;  2K9N A;  1WCM J;  5FLM J;  2EZI A;  2Y9Y A;  2FD5 A;  1MBJ A;  2E2I J;  1MSF C;  1X58 A;  1GV2 A;  4DYC A;  1W0U A;  3HOY J;  4A93 J;  4XRS G;  1RES A;  4JP0 A;  5EDN A;  5FKK A;  3BG3 A;  4UUS A;  4QIW N;  1FIP A;  4JX6 A;  1G2H A;  1HCR A;  2ME0 A;  2N8G A;  2EH3 A;  4DZP A;  4XIC A;  2X6O A;  3OSF A;  5DTD A;  4DW6 A;  1AKH A;  1ETV A;  2DA6 A;  5IP7 J;  3DCF A;  2VKE A;  1RKW A;  2LFB A;  4B1R A;  1TWF J;  1GDT A;  2QCO A;  3TW7 A;  4XRM A;  4C3H J;  2XRL A;  2E1O A;  2WV1 A;  3ZOB A;  4JX5 A;  2LLK A;  1POG A;  3S1M J;  3PO3 J;  3PM1 A;  3B6A A;  2JMW A;  4M3G A;  1F43 A;  2JWT A;  2X48 A;  2M8G X;  2XGD A;  1FEX A;  3BR1 A;  2DMP A;  3BT9 A;  4XRS A;  4MFD A;  2DMU A;  1JJ6 C;  1I6H J;  1T56 A;  5F27 A;  3IH2 A;  3CCY A;  1ORK A;  1ETX A;  2I10 A;  2XSD C;  2CQX A;  2K9Q A;  2DMQ A;  1HLV A;  2WAQ N;  3Q0U A;  4MO7 A;  3JRF A;  2JA5 J;  5K7Z A;  1HDD C;  3BR2 A;  2MGQ A;  4LOC A;  1NK2 P;  1WH7 A;  2EQR A;  3JRC A;  1RPW A;  3BQY A;  2TRT A;  3ZQG A;  3O8H A;  2X9D A;  2ZB9 A;  4AUX A;  3S17 J;  2LR8 A;  2DA7 A;  2DMN A;  1PUF B;  3GTJ J;  1OJL A;  2K9S A;  3Q0V A;  3TW6 A;  1MNM C;  4BBS J;  2W48 A;  3A03 A;  3ZQF A;  2DA2 A;  4A3K J;  1TC3 C;  1HDP A;  2DA3 A;  2RAE A;  1IG7 A;  1B8I A;  2H1K A;  3I4M J;  2Y31 A;  5FKM A;  3F0C A;  4DYQ A;  2R93 J;  3RZO J;  4W1U A;  1B8I B;  1TWC J;  3SJM A;  1BJZ A;  2FJ1 A;  1JUM A;  2ECC A;  3W6V A;  3S1R J;  2JA8 J;  5E3M A;  1RKT A;  3HOV J;  3LOC A;  1Q1V A;  2NVY J;  3G1M A;  5C44 J;  3GTG J;  3GTO J;  3HKZ N;  4B4C A;  2L7F P;  4M3F A;  1XC5 A;  4A3M J;  2GM4 A;  2DTZ A;  2DA1 A;  3JRE A;  4IHW A;  1UG2 A;  2R5Y B;  2LTP A;  5HOD A;  2AO9 A;  5M3F J;  3JRG A;  2XB5 A;  3O8G A;  3BR0 A;  3OIO A;  4BKX A;  1BL0 A;  2G0E A;  1VF9 A;  2HYJ A;  3D1N I;  2LKX A;  1ZTR A;  3TP0 A;  2COB A;  4MFE A;  4BY1 J;  3L1P A;  2OPT A;  4C3J J;  2YS9 A;  4A3D J;  3MKL A;  3HDD A;  5EZH A;  2FX0 A;  3UKG A;  2VPR A;  4BY7 J;  1IDY A;  3E7L A;  1TWA J;  2QF7 A;  3GTL J;  3BR6 A;  2PMZ N;  4D7N A;  3HOX J;  1ZR2 A;  3S1Q J;  3ZQI A;  2HOT A;  2E19 A;  3CQZ J;  3QPS A;  2HOA A;  3BQZ A;  2L7Z A;  4JX4 A;  2LD5 A;  5FKL A;  3TED A;  3H3V K;  2CU7 A;  1OCT C;  3HOZ J;  3PO2 J;  5IYD J;  5C4J J;  1IC8 A;  4D5C A;  1B72 A;  3S15 J;  5C3E J;  5IOY A;  3M4O J;  3BTC A;  4EEF G;  4AYB N;  4GFB A;  4IEJ A;  2L7M P;  4B3A A;  2LP0 A;  1U8B A;  1WGX A;  3WHB A;  1A6I A;  4W97 A;  5EYR A;  2M34 A;  1OFC X;  5E3O A;  1ZGW A;  3DEW A;  1YRN B;  1H89 C;  1WPK A;  1QVU A;  1XG1 A;  5FKO A;  3MN2 A;  1Y1V J;  1JGG A;  1YRN A;  2YUS A;  3HM5 A;  2L0K A;  2VI6 A;  3BG5 A;  2EBI A;  3JRB A;  3GTP J;  1QVT A;  4QSH A;  3CMY A;  2Y0S N;  5M3M J;  1EF4 A;  2ELK A;  4BXX J;  4HNV A;  3SFI A;  4I6Z A;  3ZQC A;  1MBF A;  3S14 J;  1XS9 A;  1B72 B;  3FIS A;  5K7F A;  2H8R A;  1AKH B;  2NVX J;  4IHY A;  1BA5 A;  4RDU A;  1ZKG A;  4X6A J;  2DA4 A;  4XK4 A;  1UHS A;  2YU9 J;  1CQT A;  1BW6 A;  4RBO A;  1H8A C;  1ZR4 A;  1MBH A;  1ZK8 A;  4ABZ A;  1GVD A;  3FIW A;  5GP9 A;  2KDZ A;  4L5E A;  4AC0 A;  3S16 J;  1P7I A;  1SAN A;  2LY9 A;  4A3L J;  2WB1 N;  3I4N J;  1FJL A;  1X2M A;  4V2F A;  4I76 A;  4CYC A;  2DMT A;  1U9O A;  2B63 J;  3S2H J;  1AHD P;  2Y30 A;  5IP6 A;  1JT0 A;  2EZH A;  4A3J J;  1IV6 A;  5FKN A;  3QQA A;  2Y2Z A;  1D5Y A;  1R9T J;  3C2B A;  4D5F A;  2XGE A;  3MVP A;  4C2M J;  4A69 C;  1DU0 A;  3Q0W A;  4M3E A;  3HGY A;  1JTX A;  4V2G A;  2EZK A;  1UMQ A;  2FQ4 A;  2CRG A;  1O4X A;  1TWH J;  4IHX A;  1K61 A; 
#chains in the Genus database with same CATH topology
 4KYW A;  1LE8 A;  3HGG A;  1WZ2 A;  2RNJ A;  2IVM A;  3BWG A;  4HLX A;  2ID6 A;  2ME6 A;  2DPD A;  5E1Z B;  2V7F A;  2P6T A;  3FMR A;  2A61 A;  1VND A;  3E5X A;  1PJR A;  5LFA A;  4KFC A;  2K5C A;  3HB9 A;  4Q47 A;  1JKP C;  1U2W A;  4UUS B;  1FOW A;  2AQF A;  2QEX I;  3GCM A;  3LNQ A;  4MQV A;  4RGX A;  4HYE A;  2MW8 A;  5HVQ C;  2LVS A;  5GAH J;  2HPI A;  4AD9 A;  2BYV E;  2KKO A;  1OLT A;  3F23 A;  4C30 A;  3IC7 A;  2ZJ2 A;  3RKW A;  4MIM A;  3BG9 A;  1D0Z A;  4CXF A;  4HA8 A;  4AID A;  2O6G E;  5ILU A;  4GDF A;  3WTX C;  2PG4 A;  4BQQ A;  1E17 A;  4A12 A;  4A6D A;  1UCR A;  5DYM A;  2XPV A;  1JTY A;  4XKW A;  5F1J A;  2EWN A;  3J81 K;  3R4K A;  2DBB A;  4PDK A;  5J1Y A;  3I4P A;  3ABM H;  3ZMZ A;  4F3Q A;  2O8K A;  4XLF A;  2V6C A;  4HRI A;  2DFF A;  1W7P D;  1HF0 A;  4CCM A;  4DOZ A;  3U9G A;  4M9Z A;  4IVN A;  4OMZ A;  5FRO A;  1R1U A;  3OSG A;  4WF2 A;  1G3W A;  4KIG A;  1YS6 A;  3BJO A;  2E7W A;  1K7A A;  1IXS B;  3GLX A;  3CCE I;  3OYM A;  3I71 A;  2M0M A;  3KEY A;  4Q4Z F;  2A07 F;  4HX8 A;  2L01 A;  4FE4 A;  4O6J A;  2XAG A;  4BBR J;  5DCM A;  4D0P A;  3SZG A;  5LLQ A;  2XAF A;  5AIQ A;  2BXY A;  2KT0 A;  2ECB A;  2V1D A;  1JKO C;  4O5V A;  3GTM J;  3CUQ A;  3CDL A;  2FBI A;  3ELK A;  4ASN A;  3K69 A;  3OYE A;  5HS8 A;  5ICC A;  2A6H F;  1SD6 A;  3Q5F A;  1FZP B;  2E2H J;  3FXO A;  3SDB A;  4E7S A;  1J0R A;  3H1C A;  3H0G J;  3E3V A;  2V26 A;  4KT6 A;  1LPQ A;  1ZAO A;  1RC9 A;  3C3W A;  2BXZ A;  1QU3 A;  3FHN A;  2VB6 A;  1DPR A;  1HXD A;  4HX7 A;  1HKS A;  1I1G A;  2K27 A;  4L9V A;  2NXN B;  3OMY A;  2R5Z B;  1I39 A;  3GUD A;  4M9X A;  2NNY A;  2DFE A;  5K7H A;  3B02 A;  5GAE J;  3SDG A;  3RQ4 A;  2D5V A;  2ZXW H;  3P9I A;  2Z16 A;  3KLO A;  3K7A J;  5J40 A;  4Y7N J;  2HTJ A;  3CUQ B;  3SFZ A;  1LFB A;  1OR7 C;  3OIP A;  5F0H A;  4NHJ A;  4HOB A;  3GBG A;  2ZJQ F;  2R3S A;  1DGR M;  1LFU P;  1T0F C;  2VN2 A;  3F3X A;  1BC8 C;  5J8F A;  2Z1D A;  3CCU I;  3RZD J;  2MSY A;  3UNG C;  5F0F A;  1W5T A;  4DYR A;  1YE9 A;  2K9L A;  5JVT A;  3OR1 C;  1K6O A;  2TCT A;  2DW4 A;  4OMY A;  1ETY A;  2H8W A;  4IL6 C;  1FP1 D;  2K9M A;  1GVJ A;  1NK3 P;  2R92 J;  1MH3 A;  4A3G J;  2E1M C;  5EGO A;  4FE7 A;  2HDD A;  4JK1 X;  3M1E A;  2VBX A;  3LA7 A;  5HLI A;  5F0C A;  3CME I;  1JUS A;  2P5L C;  3E97 A;  3GZ6 A;  1IN4 A;  2NOG A;  3VEP A;  1CF7 B;  1JUP A;  1B6A A;  1FYK A;  5EF6 A;  1QZY A;  2P81 A;  3A4C A;  4PCQ A;  3LSG A;  3DLL F;  3F8B A;  1VI0 A;  1UG0 A;  4XN0 A;  4HF0 A;  4U88 A;  2Y0S A;  5ICF A;  2FUG 2;  2RV8 A;  5LGU A;  2QLZ A;  3QRF F;  1VZ0 A;  3G1O A;  4NQW A;  4CCN A;  2R7R A;  1P7J A;  4M3B A;  4M9S A;  5GPA A;  1RUN A;  2KPM A;  3WHC A;  2LK2 A;  1K78 B;  5F6F A;  2KDO A;  2GXB A;  1L3L A;  4HW0 A;  1XSX A;  2MA3 A;  3GFJ A;  5E8I A;  1IDZ A;  2H09 A;  2MYS A;  3GEZ A;  4A0Y A;  2HI3 A;  2QSF X;  2RN7 A;  3ZN0 A;  2GBY A;  3WTZ A;  3TO7 A;  2WAF A;  3CES A;  3HPH A;  4N4O B;  3CCR I;  2PI0 A;  1IW7 F;  2K86 A;  1OCO H;  1MSE C;  1OYY A;  3S1N J;  2RKH A;  3IWF A;  2ZXH A;  3T8R A;  2FSW A;  4ON0 A;  4BAY A;  5CYV A;  2HFH A;  1Z3Y A;  2L9V A;  2WA0 A;  4IHS A;  3RPU D;  4KIT B;  2AS5 F;  3VB2 A;  1RET A;  1ETK A;  2EK5 A;  2DTR A;  2BW3 B;  3AG2 H;  3ZQH A;  3RTR A;  2XAS A;  2OTL I;  3JSP A;  1LDJ A;  3IV5 A;  3LAP A;  3KE2 A;  4JOM A;  2KMU A;  1PDN C;  3BTL A;  2XAH A;  2QZ8 A;  1YTY A;  4BH9 A;  3W2W A;  1QQI A;  2XDV A;  1SAX A;  2L9N A;  3ROU A;  2KIU A;  5FLM J;  1KYW A;  5L3D A;  1KGS A;  2FD5 A;  4E6K G;  3DU6 A;  1ZYR F;  3P5J A;  3ONQ A;  3AKZ A;  2BZT A;  4LJZ F;  1D1A A;  4GRI A;  1WJB A;  4XRS G;  4IOA F;  3RYP A;  1SAU A;  4ZYG A;  4WXD A;  5GTI C;  3HTU A;  5K5O A;  2ZME B;  2LDU A;  1VQM I;  1Z6R A;  3HC7 A;  3LFU A;  4YEL A;  3QYF A;  1BOB A;  1XD7 A;  2LNB A;  3V7R A;  3U1K A;  3TKY A;  2X6O A;  2X1C A;  3CF2 A;  4LB6 B;  3KP3 A;  1ETV A;  4BHP A;  5IP7 J;  3TOB A;  4DJA A;  2QCO A;  4UVC A;  2NAZ A;  4ZZL A;  4XKV A;  1WJD A;  2BY3 A;  4C3H J;  1V5F A;  2E1O A;  2WV1 A;  4UUV A;  3PL8 A;  4JX5 A;  2JRM A;  1POG A;  2EIJ H;  2V9K A;  3COA C;  4AYB A;  4KN4 X;  3PO3 J;  2QQA A;  2W1O A;  2XGD A;  3NQO A;  4OIO F;  3IL2 A;  1T0F A;  2DMP A;  2FRH A;  1R5I D;  1JJ6 C;  3BY6 A;  1I6H J;  4M71 A;  5BS6 A;  3CCY A;  1J75 A;  1R4N B;  4GYI A;  4B3X A;  2CQX A;  4KIS A;  5LHI A;  4I0B A;  2B7E A;  5K7Z A;  1HDD C;  1X3W B;  4EVI A;  4NUB A;  1N77 A;  2HZD A;  4OU0 A;  1XX5 A;  3TO6 A;  5CJ9 A;  2EQR A;  1Z1D A;  3BQY A;  3N97 A;  1Z3X A;  3RIR A;  4CH7 A;  4YII A;  3K4K A;  2VXD A;  3M7G A;  4L5J A;  3J7A O;  1TL8 A;  1MNM C;  2K85 A;  2XKO A;  3SXY A;  4MEX F;  1K6Y A;  3HYI A;  1F4K A;  5EEG A;  4L18 B;  2OTJ I;  3DPU A;  2NOJ B;  4XLE A;  1K4T A;  2ZNZ A;  2WBM A;  2P8T A;  3IKV A;  4OAZ A;  1ZEL A;  3MKY B;  1CGP A;  2A6E F;  1GHC A;  5HS9 A;  3HOV J;  2ZKZ A;  2UXX A;  2HDW A;  4G6Q A;  3FM5 A;  1K79 A;  3HKZ N;  4M3F A;  2LRE A;  4A3M J;  2GM4 A;  5FB2 A;  2DA1 A;  2Z5U A;  4G7O F;  5HOD A;  2AO9 A;  4EGZ A;  5LBQ A;  3OYD A;  3HRM A;  3W2A A;  2KRC A;  1A35 A;  4OAY A;  1FYL A;  4OWR B;  1QBJ A;  3OIO A;  2A5Y B;  2M7A A;  5DV5 A;  3KP2 A;  3HSF A;  3D1N I;  3FBI B;  4PSW A;  2LMD A;  1Y56 A;  5HOO A;  1V3F A;  2XUB A;  4MFE A;  4DNC A;  4HAM A;  1TLH B;  1IV8 A;  4HBL A;  4NB5 A;  3DKW A;  3QYB A;  3L1P A;  3EYY A;  2BGC A;  1QHH D;  2R7W A;  1R1V A;  2VJI A;  1V54 H;  5E20 A;  3JCU C;  2R7O A;  1LJ9 A;  4BEH A;  4F91 B;  3MZY A;  3VYT B;  4HF2 A;  2PMZ N;  1ZLJ A;  4D7N A;  3HOX J;  2P4W A;  3BG6 A;  4AWX B;  1L0O C;  3A0B C;  1OR7 A;  1WJA A;  4JX4 A;  5D8L B;  3WTT C;  5D4S A;  3F6O A;  2GXA A;  2HQN A;  2LD5 A;  1JGS A;  3TED A;  4HSR A;  2A05 A;  2CU7 A;  3PO2 J;  2VIX A;  1B72 A;  1KU9 A;  3S15 J;  5HLT A;  5LRR A;  2V79 A;  3ABU A;  4OIP F;  3VYU B;  3KCC A;  4B3A A;  3K0L A;  2MH2 A;  1STZ A;  1U8B A;  4W97 A;  1UJ8 A;  2STW A;  3DEW A;  1X1B A;  3CC4 I;  1SEU A;  1XG1 A;  3VWB A;  2UWM A;  1UFM A;  3KYL A;  4Y15 A;  2OV7 A;  2GWR A;  3W3C A;  5D5U B;  4RMN A;  3HSR A;  1BBY A;  2CV2 A;  1R1T A;  4BXU A;  2Y0S N;  1D3Y A;  4CA0 A;  4ESB A;  4HNV A;  4CYD A;  3I3L A;  1VQ9 I;  3OS2 A;  3OV8 A;  1T38 A;  1RRJ A;  2H8R A;  1USS A;  3H92 A;  1YIO A;  3FX3 A;  2QA4 I;  2V1U A;  3OYH A;  1ZKG A;  1OCR H;  4XK4 A;  3L00 A;  4PUS A;  1MW7 A;  1CQT A;  5CVI A;  2G7U A;  2VXZ A;  3FXR A;  2L5Q A;  4XL9 A;  1ZK8 A;  4ABZ A;  4EJT A;  2JUG A;  5CQG A;  2D2W A;  2ZC2 A;  3S16 J;  1BI2 A;  1P7I A;  4A3L J;  2WB1 N;  3O6B B;  3I4N J;  4F92 B;  4I01 A;  2Z33 A;  4CYC A;  2B63 J;  1BI1 A;  2NS0 A;  2IPQ X;  2OZ6 A;  3CCQ I;  4EM1 A;  2K4J A;  2M87 A;  2EV5 A;  4KMU X;  5D5V B;  1BIB A;  3DTK A;  1MGT A;  4C2M J;  1T39 A;  3HGY A;  1JTX A;  4H4K C;  4CCL A;  2XAQ A;  4WXH A;  4HLY A;  5CVU A;  2EZK A;  4IHX A;  3ASO H;  4LIU A;  2Z3Y A;  4EJW A;  5JFR A;  4HZF A;  4XKB A;  2RDP A;  1VFC A;  3BOQ A;  2O7O A;  3G3Z A;  3IHU A;  4BHB A;  5DUI A;  5ICG A;  3GXO A;  4A3E J;  4RGS A;  4A5M A;  3KEQ A;  2ZJR F;  3WU0 A;  4CYC B;  2IS1 A;  2OF7 A;  3GVA A;  3I64 A;  4N0B A;  2K02 A;  1ETW A;  3KPH A;  1X2N A;  4FAS D;  1FIA A;  2LC2 A;  3S2W A;  3NEU A;  4JYK A;  5DD8 A;  4XSZ F;  2VL8 A;  4Z6Y A;  3TP3 A;  2R0Q C;  3G4S I;  2XF7 A;  2DO7 A;  1Z0X A;  1YOV B;  2F5E A;  3H5R A;  2DCE A;  2VKD A;  1P92 A;  4GGG A;  2R7T A;  5C4X J;  1PP8 F;  4AVP A;  2M1B A;  4NDL A;  1O7L A;  4E70 A;  4EMS A;  5M5X J;  3A01 A;  1MJ9 A;  1YW7 A;  2ZJP F;  1HKT A;  1YQA A;  1E3O C;  3HJE A;  2KJB A;  4XR6 A;  2MAB A;  1BW5 A;  2K40 A;  4B44 A;  1B1B A;  1J09 A;  3JRH A;  5JLX A;  1QZE A;  1U9N A;  3HOU J;  1N78 A;  1IRX A;  3JAM K;  3RI4 A;  3CCL I;  4CHU A;  3CO7 C;  1TQI A;  2JA2 A;  1PYV A;  3U2R A;  4CSW A;  1RUO A;  3N4M A;  1Z21 A;  5F04 A;  3OYI A;  2VUM J;  4Y33 A;  6PAX A;  3TQN A;  1X1A A;  1LVK A;  3K1P A;  4F55 A;  3F72 A;  2UV1 A;  3BDD A;  5BNG A;  2HOS A;  3M3Y J;  2R7Q A;  3K9T A;  2M8E A;  2ZXJ A;  4ESJ A;  3BR5 A;  2BV6 A;  3WG9 A;  2QQ9 A;  3OS0 A;  3LFK A;  5K5Q A;  4ZYD A;  1HOM A;  1GV5 A;  3Q3S A;  4XN3 A;  2BY2 A;  1D1B A;  2X6W A;  1H88 C;  1ZGA A;  1MNE A;  2VQH A;  4KIB A;  1YJN I;  1SFO J;  3D5S C;  3LQQ A;  1IZ1 A;  2HQ5 A;  5JHF A;  3IRR A;  4J19 A;  5LGN A;  2DFH A;  4BL0 B;  3JSO A;  2XPU A;  5IYB J;  4FCY A;  2MC4 A;  5LHG A;  2Y9Z A;  2R7Z J;  3LSK A;  1H0M A;  4HEA 2;  1FTT A;  4RB0 A;  1E2X A;  2ICW G;  4YIF A;  3NWS A;  3C7J A;  4I98 B;  3CUO A;  5DD4 A;  5HNF A;  4RGR A;  2UXN A;  1W5C C;  4BS9 A;  4OIN F;  2XB0 X;  3KYC B;  4Q48 A;  4EGY A;  2XRO A;  4XSX F;  4XID A;  1JJ8 C;  4L9T A;  2E36 A;  2LG4 A;  3IAM 2;  4RB1 A;  2CYY A;  3F8F A;  3MD2 A;  2HKO A;  1SFK A;  2FOK A;  4EAT A;  3OR2 C;  3LSP A;  4A3B J;  2HXI A;  1IUY A;  4AU7 A;  1R23 A;  2MFZ A;  4BJT A;  2QGU A;  1YJ9 I;  4NBQ A;  4FQG A;  3MWM A;  4YRV A;  1MBG A;  4P9F A;  4A2U A;  2WWY A;  3OYK A;  3BCB A;  2VKV A;  3CLQ A;  3DTI A;  4ENN A;  2AXT C;  3JRA A;  1DPU A;  1DU6 A;  5EG0 A;  3ZN1 A;  1U78 A;  1Z7U A;  1AOY A;  2PFB A;  3CLO A;  2GA1 A;  3VYR B;  2HQA A;  3FMQ A;  1A04 A;  4BEH B;  2CQQ A;  5DS9 A;  3FMS A;  4UB8 C;  5M5Y J;  3QOE A;  3ML6 A;  1TNT A;  4DQ2 A;  3FZV A;  1JE8 A;  2GQQ A;  2X6Y A;  1X1C A;  2J5P A;  2Q0O A;  1O3T A;  4WXC A;  3K4M A;  1S7O A;  1ZLK A;  2HVS A;  3ABL H;  3BJA A;  2CUZ A;  4S0H B;  1XCV A;  3I0T A;  1XCB A;  4ZC3 A;  1D0X A;  3OOP A;  4MGR A;  3WE2 A;  1TW2 A;  2FNA A;  1OCC H;  3JTH A;  3FXK A;  3LSI A;  1YG2 A;  4D1Q A;  1OCP A;  3ZMU A;  2QKL B;  1LQ1 A;  3MFK A;  1WH5 A;  2DT7 B;  3OOU A;  1K83 J;  4EJO A;  2PJP A;  4BYY A;  1FMW A;  2MBF A;  4M72 A;  4B43 A;  3JAM Z;  1MKM A;  3H3U A;  3ZQ7 A;  4MLO A;  3RKY A;  4PK4 A;  4LK1 F;  2FNP A;  2QQ8 A;  2QUF A;  4MHG A;  2EIK H;  1Z05 A;  1QO0 D;  3BTJ A;  2BW3 A;  2LOO A;  4CZZ A;  2YX4 A;  4N9H A;  1REP C;  4WWC A;  4U7D A;  1EH6 A;  2NVT J;  4TV7 A;  4XQF A;  2OCC H;  3VPR A;  4A6E A;  3LMM A;  3HBL A;  2HYF A;  2XKP A;  2FEZ A;  4CGZ A;  3DLA A;  4KT5 C;  2NS7 A;  5ICE A;  1WCM J;  1BIA A;  2K3F A;  3KZI C;  2Y0M A;  3T0Y A;  4XNF A;  2EZI A;  2E5N A;  2NNN A;  3FXM A;  4RM3 A;  5IY5 H;  4OIQ F;  1MSF C;  1XDU A;  3HSE A;  3PIP F;  4XBF A;  2YSR A;  1XMX A;  1W0U A;  3HOY J;  4J00 A;  2M45 A;  1KQ9 A;  2HOE A;  1D1C A;  4LIT A;  4ZDL A;  4XLA A;  4G6D A;  2IP2 A;  2PN6 A;  4P1W A;  5FKK A;  1VQ4 I;  3BG3 A;  3VSL A;  4UUS A;  4JX6 A;  1HCR A;  2VE8 A;  3BPV A;  1P9Q C;  3HUG A;  2HYG D;  4CCK A;  1VQ7 I;  4DZP A;  2V1N A;  1TW3 A;  3GF2 A;  1JHF A;  2MD0 A;  5D4R A;  1WJC A;  4MQ9 F;  4ANJ A;  2DA6 A;  1R5G A;  1X1P A;  3DCF A;  3MCZ A;  1Y39 A;  2VKE A;  4ZZD A;  2CV0 A;  1RKW A;  2Q2E B;  4B1R A;  3UR3 C;  1GDT A;  3QWL A;  3TW7 A;  4IKF A;  4G9Y A;  1P4W A;  1NG6 A;  1M1E B;  2AXL A;  2LLK A;  3LSM A;  4E7Z A;  1WSU A;  3X2Q H;  3H36 A;  4M3G A;  1G6N A;  2LH9 A;  1V4R A;  3JW4 A;  3BT9 A;  4XRS A;  2E34 A;  5HDN A;  1NH3 A;  3BLY A;  1JHH A;  1J9I A;  1YJW I;  4HPQ A;  2F2E A;  3B73 A;  3IH2 A;  3TGN A;  4U0V A;  4RS8 A;  2M4G A;  2OUM A;  3ULQ B;  2XSD C;  1B59 A;  3R0J A;  4A0Z A;  2K9Q A;  2DMQ A;  1U5T B;  2BOL A;  3I59 A;  2CFX A;  1PUE E;  3C2G A;  2FU4 A;  1R49 A;  3EPZ A;  4KMF A;  4PJN A;  1ZGJ A;  2KQR A;  2Q2E A;  2ETH A;  3FBN B;  4R1H A;  4LOC A;  2STT A;  1LDD A;  1WH7 A;  3K6G A;  3F8M A;  3PIO F;  3JRC A;  2CW0 F;  1RPW A;  4XMY A;  2TRT A;  2KRH A;  3CJR B;  1ZG1 A;  3ZQG A;  2VOP A;  3ESW B;  4OOI A;  2FMY A;  2XF5 A;  2ZB9 A;  3FKJ A;  3SEZ A;  2LR8 A;  4BE2 A;  4LFU A;  4XM3 A;  2OQR A;  1OJL A;  1IN8 A;  2A6T A;  3GWZ A;  1FBS A;  2IGO A;  3ZQF A;  3ERM A;  3DF8 A;  1HDP A;  4BJ5 C;  2RAE A;  3K1M A;  2X1E A;  1XGM A;  3CJN A;  4HF1 A;  3I4M J;  3F0C A;  4DYQ A;  2FOW A;  3W6K B;  4AVZ A;  4IO9 F;  1MDM A;  1R36 A;  4W1U A;  1DQU A;  3GX4 X;  4EJV A;  2EFW A;  1B8I B;  1TWC J;  3SJM A;  1BJZ A;  3D5L A;  2CSO A;  2KP6 A;  1OMI A;  4K2E A;  2DDB A;  5E8G A;  3QYE A;  2HTS A;  3W6V A;  4DBQ A;  2MLK A;  2EFO A;  3E6M A;  4V19 K;  2Q8K A;  5E79 C;  2VJJ A;  1XC5 A;  3H5A A;  3BPX A;  2DT5 A;  3JRE A;  2EIM H;  5E17 F;  1QHG A;  2WC2 A;  1R6R A;  3V8K A;  4PJJ A;  4WCG A;  5M3F J;  2XB5 A;  4ZYE A;  2XGX A;  5FFZ A;  3DPT A;  5KVR A;  3GZ5 A;  2RVC A;  1MD0 A;  1VF9 A;  2KHM A;  1FBU A;  4UY8 I;  2VJ5 A;  5EJC A;  1ZG5 A;  2EV0 A;  3KFW X;  5CVR A;  4F52 A;  5LEJ A;  2FE3 A;  2HS5 A;  3TP0 A;  4BY1 J;  3ABT A;  2P5K A;  2O03 A;  1ERD A;  1I6X A;  3CMA I;  2XAJ A;  2F4I A;  4BQN A;  2HQR A;  3E0J B;  3MKW B;  3CDH A;  4A0X A;  3AAF A;  1KQ8 A;  3HHG A;  2W7N A;  3HDD A;  1BJA A;  4M74 A;  2EIN H;  3UKG A;  1ZG3 A;  4BY7 J;  1FWZ A;  1IDY A;  4OIR F;  3LWF A;  3BR6 A;  3HRU A;  3DBH B;  2ISZ A;  2I8D A;  2Y69 H;  1C0W A;  2X1D A;  3G2B A;  1WHU A;  2E19 A;  2DK5 A;  3HG9 A;  2EFQ A;  2HOA A;  3V4G A;  4RAZ A;  3WGI A;  2I5U A;  5FKL A;  4IQ4 A;  3H3V K;  1SD7 A;  2H94 A;  3HOZ J;  5IYD J;  5C4J J;  4IXA A;  4RM2 A;  4ITV A;  2LKS A;  4RAF A;  1FSE A;  4EEF G;  4C2T A;  3PNV A;  1PP7 U;  2E7X A;  1SVL A;  1KU2 A;  3PFY A;  3WHB A;  5TIS C;  1OFC X;  4ZH4 F;  4L5I A;  1WPK A;  2JVH A;  2FML A;  1Y8Q B;  3M8F A;  5FKO A;  4KA4 A;  2QSG X;  1T6S A;  2VE9 A;  2KZV A;  3S3N A;  5KNL A;  2ZBK A;  4HNT A;  2VI6 A;  3BG5 A;  4F93 B;  2Z99 A;  4LB5 A;  1B4A A;  2EBI A;  1KQ0 A;  4Y13 A;  2JPB A;  3HZJ A;  4XRF A;  3ZPL A;  2VOD A;  5GAG J;  4E7H A;  2Y75 A;  2KIM A;  2ELK A;  1X3Z B;  3SFI A;  3ZQC A;  4LGW A;  1LVA A;  1FBQ A;  5B1A H;  2NVX J;  2HZT A;  4GO1 A;  1UHS A;  4P9U A;  1F9N A;  3NWT A;  4LIV A;  3HOT A;  1BW6 A;  3PUB A;  5K1Y A;  3J7Y J;  4IOC F;  1CF7 A;  4RBO A;  2IW5 A;  1ZR4 A;  2DU9 A;  1GVD A;  3CMM A;  4L5E A;  1H9G A;  1HQC A;  4B47 A;  2DOE A;  5LHH A;  2L4M A;  2JUC A;  4I76 A;  2LF8 A;  4A3J J;  1Y0U A;  1YS7 A;  1QZZ A;  2MD5 A;  5CLS A;  3EUA A;  1XB4 A;  2Y2Z A;  5ILV A;  1K78 A;  4FET A;  4A69 C;  2W82 A;  3Q0W A;  1DU0 A;  4F7Z A;  4V2G A;  2FQ4 A;  1S6L A;  5HDK A;  2YX7 A;  3ZQQ A;  2CUJ A;  1ZQ3 P;  5ILS A;  4BDZ A;  3H3Z A;  4UV9 A;  2FF4 A;  3REO A;  4G8X A;  1IN5 A;  5AIP A;  2KLO A;  2X4H A;  2JVG A;  3GO5 A;  3QPH A;  2O9L A;  9ANT A;  3GTQ J;  1U5T C;  3PUF A;  4BXF A;  3C18 A;  1Y8R B;  3ZCO A;  2DA5 A;  3EDP A;  1BR2 A;  1G3S A;  3DXJ F;  3OL3 A;  2GLO A;  1EA3 A;  2V9V A;  4O3M A;  1QPI A;  3HOW J;  4M73 A;  4BDY A;  4IHT A;  3QU3 A;  2UUZ A;  3K1N A;  2NVU B;  5D5W B;  1YIT I;  1FT9 A;  3CCJ I;  3PQK A;  2IA2 A;  2OD5 A;  1WVR A;  2ZNY A;  2VBY A;  3I9V 2;  3PFI A;  2DI3 A;  2O61 A;  1ZRF A;  2R7F A;  3CC7 I;  3EUK L;  2HVQ A;  3ZMD A;  1W5S A;  2DQR A;  4Y3O A;  3IP4 B;  1AU7 A;  1RR8 C;  2YU3 A;  1APL C;  5EEA A;  5DCF A;  3WG7 H;  3GLL A;  1JT6 A;  4XLC A;  3FDY A;  4XOT A;  3MZH A;  3AL0 B;  2OBP A;  1U6G A;  2DYS H;  3IH3 A;  1MMG A;  4IX7 A;  2WAE A;  2RQQ A;  2C6Y A;  1Z6T A;  1X1D A;  1FYM A;  1VQ8 I;  2NVQ J;  3LSJ A;  1Q1H A;  1XMA A;  2R5Z A;  1T98 A;  2F4M B;  1RR7 A;  3MAJ A;  2M7B A;  2F6C A;  3KEO A;  3K4N A;  1TT0 A;  1R7J A;  1MJA A;  1ENH A;  3FXL A;  2ZME A;  1W7P A;  1GLN A;  1T95 A;  2NS8 A;  4YG2 F;  3L2Q A;  3L2V A;  1R71 A;  4DZJ A;  2B9S A;  3J80 Z;  2KRF A;  3BR3 A;  3B6C A;  5L3F A;  1T08 B;  1SD4 A;  1B9M A;  3I5U A;  1G4D A;  1D8J A;  2IAI A;  2R7D A;  5KK1 A;  2DQL A;  4ETS A;  3DBR B;  2DOA A;  4A3I J;  5F08 A;  1J59 A;  3CJQ B;  5JR3 A;  5J4Y A;  2AHQ A;  1S7E A;  1IGN A;  1AWC A;  2K3P A;  2K7L A;  4DGW B;  5E3N A;  4HDU A;  4NNJ A;  3KZZ A;  2L02 A;  1WI3 A;  2QQB A;  3CD6 I;  1HA8 A;  1Y1W J;  1A31 A;  1YFH A;  1W0T A;  1YYV A;  3OYG A;  4YFX F;  3P9C A;  4G6T B;  3KZY A;  3W6J B;  2HWV A;  2B0L A;  2IXS A;  3IAS 2;  5DUK A;  4CIC A;  2LRD A;  2IS2 A;  5TGT A;  1E0E A;  1F1Z A;  4HX4 A;  5GPC A;  2HXO A;  3DPL C;  2KIF A;  4FIS A;  3FK7 A;  3S2D J;  4HG2 A;  2MG4 A;  1FP2 A;  3FM3 A;  4BAC A;  2D1H A;  2M2E A;  5ERI A;  1DUX C;  3T8T A;  5J6X A;  5FGM A;  3V42 A;  3A0H C;  3HRS A;  3F22 A;  1W36 D;  2VQL A;  1VQP I;  2CUF A;  2WY7 Q;  1XSD A;  3L2C A;  4U0W A;  5FLV A;  1ONV A;  3JRI A;  3I53 A;  4XLP F;  1NHA A;  1PUF A;  1UST A;  4RAY A;  2EA2 A;  1JKR C;  1T8I A;  3V7S A;  2IEK A;  5GTH C;  2A68 F;  2L9R A;  2EZL A;  5FD6 A;  4KJZ A;  3LA2 A;  4X1E A;  1IRZ A;  5EG0 B;  2MC3 A;  3OYF A;  4M6V A;  5D6E A;  3GTK J;  2PMZ A;  4FTH A;  1PVE A;  1R4M B;  5JVG F;  5B5E C;  1ZHF A;  3SQN A;  1ITY A;  2E1M B;  1H9T A;  5D8K B;  2IS4 A;  1OKR A;  4G12 A;  2CGP A;  3PSI A;  2PJR A;  4PGH A;  2VQC A;  4IHV A;  1MBK A;  2OCE A;  1G8X A;  1DGW Y;  2EIL H;  1BM9 A;  2CV1 A;  4I09 A;  3IH4 A;  5IT3 A;  4BU2 A;  4CO8 A;  1WJE A;  1XMK A;  4PJL A;  2JJ7 A;  4C9Y A;  1T33 A;  2DXI A;  3ZRG A;  2EFP A;  1UAA A;  2JA7 J;  1MH4 A;  1OPC A;  1YX3 A;  3OYN A;  2BE5 F;  4CDG A;  2JQ7 A;  3S93 A;  3SHF A;  4BE0 A;  2GXG A;  3KP4 A;  3RQI A;  1JKQ C;  4P5O A;  2DFI A;  2F5F A;  3VDX A;  1BI0 A;  5EZG A;  3WTY C;  1BR4 A;  2G9W A;  1FPQ A;  3L9F A;  1ZRD A;  4S05 A;  3IUO A;  4Z2Y A;  1Y6I A;  3SZT A;  1ETO A;  3TO9 A;  3HEF A;  1X4O A;  2GIV A;  1RZ4 A;  2FBH A;  3BZ6 A;  3BTI A;  2VBW A;  1HKQ A;  1X3U A;  4ENM A;  3TDZ C;  5H2F C;  3AG4 H;  1EKE A;  1F5T A;  4KDP A;  2QVO A;  3R60 A;  4XON A;  1FSH A;  2WB1 A;  4FHT A;  3OL4 A;  3S3O A;  2K9N A;  5KAI C;  1MMD A;  3MQ0 A;  1S8N A;  2ZME C;  3ECO A;  2CW8 A;  1WWX A;  1X58 A;  2OU2 A;  4A93 J;  1WKM A;  2HU9 A;  3T5X A;  3ZMV A;  1OYI A;  3P9K A;  4QPO A;  2VPL A;  1RES A;  1E3P A;  3LA3 A;  3GZN B;  1IXR C;  5EDN A;  2R7X A;  1D5V A;  2F5V A;  4PSX A;  1FIP A;  2Y48 A;  3CP2 A;  3MEX A;  2RC4 A;  4AIJ A;  2YPR A;  1G2H A;  3F8N A;  3GFL A;  3ASN H;  4LG0 A;  2N8G A;  1VQN I;  2VT2 A;  4YEJ A;  5K5R A;  4XIC A;  1IAW A;  3CTA A;  4KIF A;  5DEQ A;  3HXL A;  3A2K A;  4PFP A;  2VC0 A;  1AKH A;  2V1X A;  2DDA A;  2LFB A;  2HEO A;  1TWF J;  4XRM A;  1XTA A;  2XRL A;  3ZOB A;  1EH7 A;  2EJR A;  5E1W A;  1RNL A;  5BOX A;  1V5G A;  3PM1 A;  5DDG A;  4A5N A;  1F43 A;  1J7K A;  2X48 A;  1IXC A;  3CP8 A;  3RPQ A;  3F21 A;  3BR1 A;  2L3D A;  2O5R A;  4Q5S F;  3SZP A;  1I3A A;  3K70 D;  4MFD A;  4KUM A;  3OYL A;  1UB9 A;  1U5T A;  1T56 A;  5F27 A;  1ORK A;  3G6E I;  1BC7 C;  1ETX A;  3VYS B;  1YIJ I;  2WAQ N;  3Q0U A;  2A3S A;  3ZMS A;  3JRF A;  1TNS A;  2W85 A;  2V6E A;  2O8X A;  1N75 A;  1FOX A;  2MH9 A;  4HNU A;  3I59 B;  4EM0 B;  4YIR X;  3L2W A;  2JTV A;  3BR2 A;  2MGQ A;  3FXJ A;  1BN5 A;  1NK2 P;  1YO5 C;  2GOM A;  4IQJ A;  3EUH A;  3H35 A;  4ENJ A;  1VQ6 I;  3DP7 A;  3FXU A;  4IRH A;  3PJR A;  2DA7 A;  1UZC A;  2DMN A;  2ZFW A;  2JSC A;  2RNG A;  3GTJ J;  3R61 A;  1PUF B;  1A36 A;  2W24 A;  3Q0V A;  2DJI A;  3TW6 A;  2GAU A;  5B1B H;  4BBS J;  1LB2 A;  1GXQ A;  4A3K J;  2DA3 A;  3QP6 A;  3QOP A;  1V55 H;  1S72 I;  1YW9 A;  4XOR A;  1B8I A;  2H1K A;  4BQO A;  1QGP A;  1ZN2 A;  1WJF A;  3L2R A;  2YR2 A;  2JZY A;  4HQE A;  2F48 A;  3T1B A;  4L9J A;  1FC3 A;  5TJJ A;  2XF6 A;  1JUM A;  2ECC A;  3MMY B;  4PZJ A;  1W36 C;  2X6X A;  2E1N A;  1TTY A;  4S04 A;  4NQW B;  3S1R J;  1HSJ A;  1RKT A;  5E3M A;  3KP7 A;  1SFE A;  5C44 J;  3HPG A;  3GTO J;  2JRT A;  3G73 A;  2L7F P;  2VKH A;  5BMZ A;  2DTZ A;  3C2H A;  2TDX A;  2V9P A;  3SEQ A;  3KET A;  5BPI A;  1I1S A;  2CH0 A;  3WGG A;  4U7B A;  3JTG A;  2PX9 A;  3O8G A;  2LY2 A;  3BR0 A;  4BKX A;  3E5U A;  5CVV A;  1BL0 A;  1KU7 A;  3P7N A;  2HYJ A;  5BQT A;  5E18 F;  2COB A;  2A5W A;  4Y17 A;  2OQG A;  2IS6 A;  4C3J J;  1RI7 A;  4A3D J;  2XIG A;  3MKL A;  1S5L C;  3K10 A;  4CCO A;  4RB3 C;  2OAZ A;  3DTE A;  1Z9C A;  5EZH A;  3J7A Y;  3GTL J;  2QF7 A;  2WAD A;  2DOD A;  3WE3 A;  3R0A A;  1E3H A;  3S1Q J;  4IRI A;  2FQ3 A;  2HOT A;  3S32 A;  3CQZ J;  1OQY A;  3BQZ A;  2L7Z A;  2QSH X;  2XC7 A;  4WK8 F;  1TQP A;  4IZZ A;  1IC8 A;  1VQ5 I;  4D5C A;  2LSO A;  1X19 A;  4QPQ A;  5C3E J;  2LBF B;  1MZB A;  3M4O J;  1U0J A;  4U0Y A;  1BR1 A;  2W25 A;  4AYB N;  4GFB A;  2A69 F;  4YFN F;  2LP0 A;  5LGT A;  5LD2 C;  3V8J A;  1WGX A;  2CO5 A;  1ZGW A;  5EYR A;  2NRA C;  5L3E A;  1H89 C;  1G3T A;  1LKX A;  4UHT A;  3MN2 A;  1VTN C;  1YRN A;  3WTU C;  2KIS A;  3K4J A;  2H27 A;  1IF1 A;  2L0K A;  1VQK I;  3WU1 B;  2PJR B;  3F8C A;  3HIF A;  2ELH A;  2M3A A;  1WRJ A;  5B3S H;  2P7V B;  4QSH A;  3TDU C;  5ED4 A;  5BPD A;  1XGO A;  5M3M J;  1KYZ A;  2HR3 A;  4BXX J;  2R4G A;  4I6Z A;  2CS3 A;  1SC7 A;  1MBF A;  2EV6 A;  2F4O B;  3WTW C;  3H0D A;  1B72 B;  4GXO A;  5FRM A;  4E7I A;  1O3R A;  4R79 A;  4MTE A;  1AKH B;  4IHY A;  1BA5 A;  3DKX A;  2DA4 A;  4JBA A;  4X6A J;  3HL2 A;  5HDG A;  5L3C A;  3QP5 A;  4U87 A;  5JI6 A;  2KDZ A;  5GP9 A;  1KZH A;  4AC0 A;  2W00 A;  4NC6 A;  2VON A;  5FRN A;  1SAN A;  2LY9 A;  1SMT A;  4KIC A;  1T2K A;  1FJL A;  2ZSI B;  4V2F A;  1MND A;  1U9O A;  1HC8 A;  5CPR B;  3OS1 A;  1MMN A;  2H1L A;  1YHQ I;  1AHD P;  2Y30 A;  5IP6 A;  4PJM A;  1U8R A;  5LRS A;  2LKP A;  4C2U A;  1WJ5 A;  2DT6 A;  2RGV A;  3EUH C;  3QOD A;  3QQA A;  4RLF A;  1DP7 P;  2ELJ A;  1D5Y A;  1R9T J;  2CQ7 A;  2MLG A;  2XGE A;  3MVP A;  1W1W E;  4FX0 A;  4LG3 A;  3SYT A;  4M3E A;  1UMQ A;  2CRG A;  5F64 A;  4XOP A;  1UHM A;  1P2F A;  2H6B A;  2KFD A;  3DEE A;  1N25 A;  4XLH A;  5J47 A;  4PJ0 C;  2DAO A;  3TMO A;  1ON1 A;  2EPF A;  2IA0 A;  2IJL A;  2OC6 A;  5E3L A;  1A5J A;  5F1R A;  2CFO A;  3DFG A;  4UVA A;  1HW1 A;  1MJB A;  1LE8 B;  4UXN A;  5CVJ A;  2WV0 A;  1FTZ A;  3PQJ A;  3ZP5 A;  1XDS A;  4Y52 J;  2HPM A;  2CMP A;  5J1U A;  3GYH X;  2M9H A;  2IBD A;  3E6C C;  3Q9V A;  2E5Z A;  2O3F A;  2QM3 A;  2ZFU A;  1QA6 A;  4A3C J;  2BVM A;  1Z91 A;  3ZR8 X;  5L3G A;  4D7M A;  2GA2 A;  4L0Y B;  3FKI J;  3OY9 A;  4KN7 X;  5IOZ A;  4FX4 A;  3DU5 A;  1FOK A;  1OCZ H;  1KON A;  3LL7 A;  2IGM A;  3Q9S A;  3V8L A;  3LSR A;  3FHZ A;  1MBE A;  3QAH A;  3RKQ A;  4I99 C;  2HVR A;  1FX7 A;  3RDI A;  1S9H A;  2X85 A;  3NAR A;  3ISP A;  4A3F J;  2IT0 A;  1LEB A;  1TT5 B;  2IGN A;  4GYG A;  1NTC A;  2F5D A;  2IGK A;  3H9G A;  4I2O A;  4ENK A;  5IPA A;  1TBX A;  3AG1 H;  5FJ8 J;  3A02 A;  5FFX A;  3CCV I;  2W84 A;  4N9I A;  2BVL A;  4M3D A;  1W7P B;  2XPW A;  3KP6 A;  5H20 A;  3ABK H;  3AFH A;  3NRV A;  2BY1 A;  4UUT A;  1EV7 A;  2KJC A;  2VBZ A;  3E6D A;  2XRN A;  2W4S A;  3HUG B;  5J3L A;  3D5R C;  1IUF A;  5H6Q A;  2LYC A;  2PQ8 A;  3HTS B;  3NAU A;  3BZC A;  1O57 A;  2R7V A;  1ODD A;  3D0S A;  1IO2 A;  4L9N A;  3FWE A;  4LLN A;  2JA6 J;  4HDV A;  5E1X A;  3ZQL A;  4LMY A;  3M1C A;  2R5Y A;  4MNU A;  2JPC A;  2NYX A;  2CQN A;  1IRG A;  2WY8 Q;  3LSH A;  4BGD A;  3DQV C;  3E5Q A;  1ZRE A;  1ETQ A;  1F36 A;  1O3Q A;  4BE1 A;  4H0E A;  2PLY A;  3RKX A;  3QPL A;  2ISY A;  2J5O A;  3I58 A;  3H5N A;  1IN6 A;  1ZAR A;  2L2O A;  1VQL I;  3ZMT A;  5JLW A;  1JXS A;  2F5C A;  2DJN A;  3RCO A;  4BNC A;  3DWL E;  4CCJ A;  4RA2 A;  4ZTF A;  1TWG J;  2JK3 A;  3K4C A;  4ESF A;  4LK0 F;  4NC8 A;  1GUU A;  1ZRC A;  3CF5 F;  4QWQ A;  3JR9 A;  4ZYH A;  1B9N A;  5D5X B;  5JHU A;  4P96 A;  5LEK A;  1A6Q A;  1I27 A;  2COM A;  3BP8 A;  1SD5 A;  3GME A;  1IJW C;  2HDC A;  3K2A A;  5EGO B;  4QTR A;  2XVC A;  2DPU A;  1IRF A;  3OYJ A;  3BC8 A;  4YFK F;  3JRD A;  4D9J A;  2ID3 A;  1JI8 A;  1MDM B;  3EQL F;  5KHD A;  2ZCW A;  1QPM A;  3RPU A;  3RJP A;  1Z77 A;  2W57 A;  2VJ4 A;  4IF4 A;  2EB7 A;  2FA5 A;  4M6X A;  3DEU A;  4XKC A;  2CUE A;  5IYC J;  4CUG A;  2AQE A;  1HW2 A;  2VQG A;  4RB2 C;  4ZDO A;  3M07 A;  4G94 A;  3IKT A;  2E2J J;  5IT9 Z;  3C1D A;  4EV0 A;  3CDI A;  1SVO A;  2GIZ A;  1LFP A;  1P4A A;  4UB6 C;  1RIO H;  1GT0 C;  2DN0 A;  2M0C A;  4ZYA A;  2PEX A;  2QBY A;  3ZXS A;  2VOO A;  3G1L A;  1I50 J;  1QRY A;  1EJ9 A;  1G59 A;  1D8K A;  3OIQ A;  5M5W J;  3R6S A;  1ON2 A;  5H6R A;  1QNT A;  1KU3 A;  1TZL A;  2M5W A;  3MKZ A;  4Y4R A;  2GZW A;  4EQQ A;  3KLN A;  2CJJ A;  3DV8 A;  3QPT A;  3LAJ A;  3VFZ A;  5FLX Z;  2XSJ C;  2ESH A;  5J1R A;  1SFX A;  1W4M A;  3CO6 C;  1KA8 A;  3CCS I;  2UZK A;  2XGC A;  3WOD F;  3FK6 A;  1R5H A;  3J80 K;  5D6F A;  3GFM A;  4C3I J;  2JN6 A;  5HLG A;  1I5Z A;  4CZC A;  5AON A;  1I3Q J;  3PSF A;  2P6S A;  1K4S A;  1OIS A;  2FXA A;  2K4B A;  2R7U A;  5IP9 J;  1IN7 A;  2DYR H;  2GOX B;  5A2Q Z;  3A01 B;  2PMU A;  2H6C A;  4QLC U;  4HV5 A;  4G7Z F;  2CWE A;  2Y9Y A;  1VQO I;  4ZTJ A;  1MBJ A;  4M6Y A;  3WTS C;  1DDN A;  2E2I J;  2FBK A;  2ESN A;  2JSP A;  1GV2 A;  3IRQ A;  1ZH5 A;  4DYC A;  5IT9 K;  2QKM B;  3L09 A;  2KL4 A;  2HGC A;  4ZJZ A;  1FY7 A;  3BG7 A;  5CQE A;  3LST A;  3M8J A;  3CCM I;  2P5V A;  4JP0 A;  3L2U A;  2QEN A;  2OZU A;  4QIW N;  2BY0 A;  5HS7 A;  2X0L A;  3K2Z A;  5FD5 A;  1J2X A;  2ME0 A;  4AIH A;  4WX9 A;  2VC1 A;  3CC2 I;  3BJ6 A;  2EH3 A;  4R8H A;  4BUP A;  1ULY A;  5TRD A;  1YW8 A;  1XSV A;  1UHW A;  1Z7L A;  4RAG A;  3BRO A;  1O7F A;  3OSF A;  4LG0 B;  4FT8 A;  5DTD A;  4DW6 A;  2DOF A;  2XHK A;  1XGN A;  4BQA A;  3ZGK A;  1BI3 A;  3PNY A;  2WAQ A;  3J7Z I;  1WQ2 A;  5HLH A;  3WGH A;  4E7J A;  4E7K A;  3K70 C;  1WFX A;  3S1M J;  1YX5 A;  3B6A A;  2ACJ A;  2JMW A;  2JWT A;  2M8G X;  3KX2 A;  3I56 I;  1FEX A;  5KAF C;  2D45 A;  2IRF G;  3M8E A;  1SVM A;  2DMU A;  3ECH A;  3OWT A;  2QYO A;  3S3M A;  2CQK A;  4GCV A;  1J5Y A;  3F9K A;  2I10 A;  2EA4 A;  4N4N B;  3W2V A;  4L0Z B;  3TBI A;  1HLV A;  4MO7 A;  1FLI A;  2JA5 J;  1FMV A;  2LY1 A;  4PFO A;  3V7C A;  5L3B A;  4J01 A;  4B09 A;  3OYA A;  1MIJ A;  2CW7 A;  1Z67 A;  3FXQ A;  3GW2 A;  1R58 A;  3O8H A;  2X9D A;  4II2 A;  4AUX A;  3S17 J;  1HW5 A;  3IWZ A;  4LD5 A;  1D0Y A;  1X4P A;  4MTD A;  3VOD A;  2JT1 A;  4HQM A;  1HBX G;  1UEL B;  4RGU A;  2K9S A;  1XPX A;  2W48 A;  4HST A;  3A03 A;  4E4H A;  2VLA A;  2DA2 A;  1TC3 C;  1O3S A;  2RRE A;  1FNN A;  1YI2 I;  2IA1 A;  3H9J A;  1IG7 A;  3J81 Z;  3WU2 C;  2Y31 A;  5FKM A;  2L4A A;  5A2Q K;  2R93 J;  2BHY A;  3RZO J;  1TP4 A;  1ACI A;  3AL0 C;  2M30 A;  3WTV C;  4DBR A;  2FJ1 A;  1S3J A;  5CKT A;  4EM2 A;  4KNY A;  1HST A;  4UV8 A;  3FF5 A;  2JA8 J;  3N05 A;  3LOC A;  2E71 A;  1Q1V A;  2NVY J;  2DK8 A;  3G1M A;  4I7H A;  3U21 A;  3GTG J;  4B4C A;  3DBL B;  3HOS A;  3MZ8 A;  5FLX K;  4ZDP A;  4PGG A;  4IHW A;  1UG2 A;  2R5Y B;  1Y0N A;  4IRG A;  5HNH A;  2LTP A;  3KIO A;  4UVB A;  1S29 A;  3G71 I;  2QBY B;  1AA7 A;  3GFI A;  3LQR A;  3JRG A;  3TL4 X;  4E7L A;  2G0E A;  3E6B A;  3HHH A;  4P55 A;  2O0Y A;  2OA4 A;  2BEO A;  2X51 A;  2Z9O A;  2E60 A;  2D1V A;  3H9Q A;  2LKX A;  5DCM B;  1ZTR A;  3I55 I;  3VSK A;  1R00 A;  4AM3 A;  2OJE D;  4B48 A;  2VT3 A;  4IJA A;  3HKZ A;  1LUJ B;  2OPT A;  2YS9 A;  2KIQ A;  4UNO A;  3EYI A;  2ADU A;  2FX0 A;  2DLL A;  2VPR A;  3AG3 H;  1P6R A;  4B8X A;  3E7L A;  2LF7 A;  1TWA J;  4G7H F;  1S7A A;  1DP3 A;  4IPA A;  5DM7 F;  5FO5 A;  2R7S A;  2G7H A;  1ZR2 A;  4JQF A;  4X0G A;  3ZQI A;  3EET A;  4MEY F;  2ZXI A;  1G3Y A;  3QPS A;  1FOY A;  1OCT C;  3PNT A;  3CUQ C;  3DKY A;  1SMY F;  2QWW A;  3TOA A;  5IOY A;  2ZO4 A;  3BTC A;  2WTE A;  1MMS A;  4NC7 A;  4IEJ A;  2L7M P;  1TQM A;  3K4B A;  2LBF A;  5DM6 F;  5E3O A;  1A6I A;  2M34 A;  2Q1Z B;  1WI9 A;  4XLN F;  1YRN B;  2P7C B;  3K4L A;  4EJU A;  1QVU A;  5GAD J;  1Y1V J;  1JGG A;  2YUS A;  3HM5 A;  3O2P E;  3S8P A;  1GXP A;  5J4V A;  2BBY A;  1SFU A;  2L54 A;  2PBI A;  1NG7 A;  2RQP A;  3JRB A;  2ZSH B;  2M4K A;  3GTP J;  1QVT A;  3RYR A;  3VOE A;  1LNW A;  3U1D A;  3CZ6 A;  3I54 A;  1MMA A;  3M9A A;  3CMY A;  1EF4 A;  4HV6 A;  2Z2S B;  2L7K A;  2XV4 S;  1LDK B;  2KZG A;  3KP5 A;  2CG4 A;  3S14 J;  1XS9 A;  3FIS A;  4BHC A;  5EEH A;  5K7F A;  3QU6 A;  2E35 A;  3KYD B;  3ERE D;  4RDU A;  4BJ6 C;  3HRT A;  2PMH A;  2YU9 J;  4RLQ A;  3O3K A;  3BZK A;  4II3 A;  3F6V A;  2V4J C;  1R22 A;  1EH8 A;  2XAU A;  5J8C A;  1H8A C;  1MBH A;  3FIW A;  3OYB A;  2L9S A;  2P0W A;  2BHZ A;  3A1Y A;  4I0A A;  4LLG F;  1X2M A;  4I02 A;  4AIK A;  3OYC A;  2DMT A;  1OYW A;  2HNH A;  3S2H J;  2HKX A;  1U3E M;  1JT0 A;  2EZH A;  3RSN A;  1IV6 A;  5FKN A;  4DIQ A;  3CJT B;  5B66 C;  3L7W A;  2EFN A;  1YLF A;  3C2B A;  4D5F A;  4LLL A;  1BOA A;  1XN7 A;  2E1C A;  5KCM A;  1V5E A;  1XGS A;  1LEA A;  3BCA A;  3E1S A;  1O4X A;  1P4X A;  1TWH J;  2VAS A;  1K61 A; 
#chains in the Genus database with same CATH homology
 1ZQ3 P;  1LE8 A;  3HGG A;  5E3L A;  1A5J A;  2ID6 A;  2ME6 A;  1VFC A;  2O7O A;  1LE8 B;  2O9L A;  9ANT A;  1FTZ A;  1VND A;  3GTQ J;  3HB9 A;  4Y52 J;  4A3E J;  1JKP C;  5J1U A;  2DA5 A;  4CYC B;  2GLO A;  4UUS B;  2M9H A;  2OF7 A;  3LNQ A;  2IBD A;  1QPI A;  3HOW J;  2MW8 A;  4A3C J;  2LVS A;  1ETW A;  1X2N A;  1FIA A;  4JYK A;  4D7M A;  4MIM A;  3BG9 A;  3TP3 A;  2R0Q C;  3FKI J;  5IOZ A;  1Z0X A;  1AU7 A;  2XPV A;  5C4X J;  1JTY A;  5F1J A;  3LSR A;  1MBE A;  3RKQ A;  5J1Y A;  4NDL A;  5M5X J;  2O8K A;  3A01 A;  1APL C;  3NAR A;  4A3F J;  1HF0 A;  5EEA A;  1E3O C;  1NTC A;  1JT6 A;  1BW5 A;  2K40 A;  3IH3 A;  3OSG A;  5IPA A;  3JRH A;  5JLX A;  5FJ8 J;  3A02 A;  3HOU J;  1U9N A;  2NVQ J;  3LSJ A;  4M3D A;  2R5Z A;  1RR7 A;  4FE4 A;  4BBR J;  2XPW A;  1ENH A;  4UUT A;  5F04 A;  2NS8 A;  2KT0 A;  2VUM J;  2ECB A;  1JKO C;  3GTM J;  5J3L A;  5BNG A;  1IUF A;  2HOS A;  3M3Y J;  3CDL A;  4DZJ A;  3BR3 A;  3B6C A;  3NAU A;  2IAI A;  3BR5 A;  2E2H J;  4A3I J;  2JA6 J;  3H0G J;  5F08 A;  1HOM A;  1GV5 A;  3Q3S A;  3ZQL A;  2AHQ A;  1H88 C;  2R5Y A;  1S7E A;  1IGN A;  1SFO J;  2HQ5 A;  2R5Z B;  1ETQ A;  1F36 A;  5E3N A;  4J19 A;  1WI3 A;  3QPL A;  5K7H A;  2XPU A;  3SDG A;  1Y1W J;  2D5V A;  1W0T A;  3K7A J;  5IYB J;  4FCY A;  4Y7N J;  2Y9Z A;  5JLW A;  2R7Z J;  1LFB A;  1FTT A;  5F0H A;  2DJN A;  5GPC A;  2HXO A;  1LFU P;  3GBG A;  4FIS A;  3FK7 A;  1TWG J;  3S2D J;  2JK3 A;  2MG4 A;  3RZD J;  2MSY A;  5F0F A;  2XB0 X;  2M2E A;  4DYR A;  4XID A;  1JJ8 C;  1GUU A;  2TCT A;  2CUF A;  1ETY A;  5FLV A;  3JR9 A;  3JRI A;  1PUF A;  1NK3 P;  1MH3 A;  3LSP A;  2R92 J;  4A3G J;  5EGO A;  4FE7 A;  2HDD A;  2HXI A;  4A3B J;  1JKR C;  2IEK A;  1IJW C;  5F0C A;  2L9R A;  1JUS A;  2EZL A;  3K2A A;  4QTR A;  5EGO B;  4X1E A;  1IRZ A;  1MBG A;  5EG0 B;  2NOG A;  4M6V A;  1JUP A;  3JRD A;  3GTK J;  2ID3 A;  2VKV A;  2P81 A;  5EF6 A;  1DU6 A;  3JRA A;  3LSG A;  5EG0 A;  4FTH A;  1U78 A;  1Z77 A;  1VI0 A;  1ITY A;  2CQQ A;  5DS9 A;  2CUE A;  5IYC J;  5M5Y J;  2E2J J;  3G1O A;  4G12 A;  1P7J A;  4M3B A;  4IHV A;  1MBK A;  1GT0 C;  5GPA A;  2DN0 A;  3WHC A;  2LK2 A;  2M0C A;  3IH4 A;  4S0H B;  3G1L A;  1I50 J;  1QRY A;  2JJ7 A;  1T33 A;  1IDZ A;  2JA7 J;  1MH4 A;  5M5W J;  2HI3 A;  1OCP A;  2GBY A;  3RQI A;  1JKQ C;  1WH5 A;  3OOU A;  1K83 J;  1MSE C;  3S1N J;  2CJJ A;  5EZG A;  4MLO A;  3BTJ A;  5J1R A;  1ETO A;  2XGC A;  3FK6 A;  3HEF A;  1RET A;  1ETK A;  3BTI A;  3ZQH A;  2NVT J;  3VPR A;  4C3I J;  2JN6 A;  3IV5 A;  3HBL A;  1I3Q J;  3BTL A;  5IP9 J;  2NS7 A;  3A01 B;  2K9N A;  1WCM J;  5FLM J;  2EZI A;  2Y9Y A;  2FD5 A;  1MBJ A;  2E2I J;  1MSF C;  1X58 A;  1GV2 A;  4DYC A;  1W0U A;  3HOY J;  4A93 J;  4XRS G;  1RES A;  4JP0 A;  5EDN A;  5FKK A;  3BG3 A;  4UUS A;  4QIW N;  1FIP A;  4JX6 A;  1G2H A;  1HCR A;  2ME0 A;  2N8G A;  2EH3 A;  4DZP A;  4XIC A;  2X6O A;  3OSF A;  5DTD A;  4DW6 A;  1AKH A;  1ETV A;  2DA6 A;  5IP7 J;  3DCF A;  2VKE A;  1RKW A;  2LFB A;  4B1R A;  1TWF J;  1GDT A;  2QCO A;  3TW7 A;  4XRM A;  4C3H J;  2XRL A;  2E1O A;  2WV1 A;  3ZOB A;  4JX5 A;  2LLK A;  1POG A;  3S1M J;  3PO3 J;  3PM1 A;  3B6A A;  2JMW A;  4M3G A;  1F43 A;  2JWT A;  2X48 A;  2M8G X;  2XGD A;  1FEX A;  3BR1 A;  2DMP A;  3BT9 A;  4XRS A;  4MFD A;  2DMU A;  1JJ6 C;  1I6H J;  1T56 A;  5F27 A;  3IH2 A;  3CCY A;  1ORK A;  1ETX A;  2I10 A;  2XSD C;  2CQX A;  2K9Q A;  2DMQ A;  1HLV A;  2WAQ N;  3Q0U A;  4MO7 A;  3JRF A;  2JA5 J;  5K7Z A;  1HDD C;  3BR2 A;  2MGQ A;  4LOC A;  1NK2 P;  1WH7 A;  2EQR A;  3JRC A;  1RPW A;  3BQY A;  2TRT A;  3ZQG A;  3O8H A;  2X9D A;  2ZB9 A;  4AUX A;  3S17 J;  2LR8 A;  2DA7 A;  2DMN A;  1PUF B;  3GTJ J;  1OJL A;  2K9S A;  3Q0V A;  3TW6 A;  1MNM C;  4BBS J;  2W48 A;  3A03 A;  3ZQF A;  2DA2 A;  4A3K J;  1TC3 C;  1HDP A;  2DA3 A;  2RAE A;  1IG7 A;  1B8I A;  2H1K A;  3I4M J;  2Y31 A;  5FKM A;  3F0C A;  4DYQ A;  2R93 J;  3RZO J;  4W1U A;  1B8I B;  1TWC J;  3SJM A;  1BJZ A;  2FJ1 A;  1JUM A;  2ECC A;  3W6V A;  3S1R J;  2JA8 J;  5E3M A;  1RKT A;  3HOV J;  3LOC A;  1Q1V A;  2NVY J;  3G1M A;  5C44 J;  3GTG J;  3GTO J;  3HKZ N;  4B4C A;  2L7F P;  4M3F A;  1XC5 A;  4A3M J;  2GM4 A;  2DTZ A;  2DA1 A;  3JRE A;  4IHW A;  1UG2 A;  2R5Y B;  2LTP A;  5HOD A;  2AO9 A;  5M3F J;  3JRG A;  2XB5 A;  3O8G A;  3BR0 A;  3OIO A;  4BKX A;  1BL0 A;  2G0E A;  1VF9 A;  2HYJ A;  3D1N I;  2LKX A;  1ZTR A;  3TP0 A;  2COB A;  4MFE A;  4BY1 J;  3L1P A;  2OPT A;  4C3J J;  2YS9 A;  4A3D J;  3MKL A;  3HDD A;  5EZH A;  2FX0 A;  3UKG A;  2VPR A;  4BY7 J;  1IDY A;  3E7L A;  1TWA J;  2QF7 A;  3GTL J;  3BR6 A;  2PMZ N;  4D7N A;  3HOX J;  1ZR2 A;  3S1Q J;  3ZQI A;  2HOT A;  2E19 A;  3CQZ J;  3QPS A;  2HOA A;  3BQZ A;  2L7Z A;  4JX4 A;  2LD5 A;  5FKL A;  3TED A;  3H3V K;  2CU7 A;  1OCT C;  3HOZ J;  3PO2 J;  5IYD J;  5C4J J;  1IC8 A;  4D5C A;  1B72 A;  3S15 J;  5C3E J;  5IOY A;  3M4O J;  3BTC A;  4EEF G;  4AYB N;  4GFB A;  4IEJ A;  2L7M P;  4B3A A;  2LP0 A;  1U8B A;  1WGX A;  3WHB A;  1A6I A;  4W97 A;  5EYR A;  2M34 A;  1OFC X;  5E3O A;  1ZGW A;  3DEW A;  1YRN B;  1H89 C;  1WPK A;  1QVU A;  1XG1 A;  5FKO A;  3MN2 A;  1Y1V J;  1JGG A;  1YRN A;  2YUS A;  3HM5 A;  2L0K A;  2VI6 A;  3BG5 A;  2EBI A;  3JRB A;  3GTP J;  1QVT A;  4QSH A;  3CMY A;  2Y0S N;  5M3M J;  1EF4 A;  2ELK A;  4BXX J;  4HNV A;  3SFI A;  4I6Z A;  3ZQC A;  1MBF A;  3S14 J;  1XS9 A;  1B72 B;  3FIS A;  5K7F A;  2H8R A;  1AKH B;  2NVX J;  4IHY A;  1BA5 A;  4RDU A;  1ZKG A;  4X6A J;  2DA4 A;  4XK4 A;  1UHS A;  2YU9 J;  1CQT A;  1BW6 A;  4RBO A;  1H8A C;  1ZR4 A;  1MBH A;  1ZK8 A;  4ABZ A;  1GVD A;  3FIW A;  5GP9 A;  2KDZ A;  4L5E A;  4AC0 A;  3S16 J;  1P7I A;  1SAN A;  2LY9 A;  4A3L J;  2WB1 N;  3I4N J;  1FJL A;  1X2M A;  4V2F A;  4I76 A;  4CYC A;  2DMT A;  1U9O A;  2B63 J;  3S2H J;  1AHD P;  2Y30 A;  5IP6 A;  1JT0 A;  2EZH A;  4A3J J;  1IV6 A;  5FKN A;  3QQA A;  2Y2Z A;  1D5Y A;  1R9T J;  3C2B A;  4D5F A;  2XGE A;  3MVP A;  4C2M J;  4A69 C;  1DU0 A;  3Q0W A;  4M3E A;  3HGY A;  1JTX A;  4V2G A;  2EZK A;  1UMQ A;  2FQ4 A;  2CRG A;  1O4X A;  1TWH J;  4IHX A;  1K61 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...