1QZZA

Crystal structure of aclacinomycin-10-hydroxylase (rdmb) in complex with s-adenosyl-l-methionine (sam)
Total Genus 111
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
111
sequence length
348
structure length
340
Chain Sequence
LEPTDQDLDVLLKNLGNLVTPMALRVAATLRLVDHLLAGADTLAGLADRTDTHPQALSRLVRHLTVVGVLEGGEKGRPLRPTRLGMLLADGHPAQQRAWLDLNGAVSHADLAFTGLLDVVRTGRPAYAGRYGRPFWEDLSADVALADSFDALMSCDEDLAYEAPADAYDWSAVRHVLDVGGGNGGMLAAIALRAPHLRGTLVELAGPAERARRRFADAGLADRVTVAEGDFFKPLPVTADVVLLSFVLLNWSDEDALTILRGCVRALEPGGRLLVLDRADRFFSTLLDLRMLTFMGGRVRTRDEVVDLAGSAGLALASERTSGSTTLPFDFSILEFTAVS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structure of Aclacinomycin-10-Hydroxylase, a S-Adenosyl-L-Methionine-dependent Methyltransferase Homolog Involved in Anthracycline Biosynthesis in Streptomyces purpurascens.
pubmed doi rcsb
source organism Streptomyces purpurascens
molecule tags Oxidoreductase, transferase
molecule keywords aclacinomycin-10-hydroxylase
total genus 111
structure length 340
sequence length 348
ec nomenclature
pdb deposition date 2003-09-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00891 Methyltransf_2 O-methyltransferase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 1qzzA01
3.40.50.150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Vaccinia Virus protein VP39 1qzzA03
5F2NA 2VXZA 2PBIA 4E32A 3AAFA 5BP7A 3MAGA 4LD5A 3BDDA 3FTFA 1IF1A 4A0XA 2VONA 3IV6A 3Q9SA 3JTHA 2JSCA 3ME5A 4PIMA 3E6CC 4X63A 3Q9VA 2A3SA 4GUAA 5HIKA 2HNKA 2WWYA 3BUSA 2CGPA 2AVNA 3OFJA 4U7BA 1EH6A 1ZG3A 2P5KA 2Z6AA 4C07A 5E9QA 2V9VA 2YXLA 4YG2F 1SKMA 1BIAA 4GXOA 4BYYA 1SQGA 4ER6A 3OZTA 4MQ9F 4KYWA 3W6JB 3HOTA 4FX0A 1AF7A 3LX6A 3L9FA 4XLNF 2GA1A 2IA2A 2AS5F 2KRFA 2VOOA 4RB3C 3MAJA 1X1AA 1MJAA 2YR2A 1TW3A 5KQRA 3H3UA 1B6AA 4EQZA 2IW5A 4CXMA 2EA4A 4KN4X 2NNYA 2JJQA 1XCJA 2FYTA 4AIJA 5D5WB 5MHTA 1WS6A 3DXJF 2GA2A 1YUBA 1ORHA 3BXOA 4KUMA 3CO7C 2JHPA 5EZQA 3CUOA 3QPHA 4RB2C 1OPCA 3OCJA 3B3GA 1G6Q1 1EG2A 3QOXA 4PNEA 5BOXA 2OPBA 2IA1A 1P2FA 1BM9A 3PS9A 3TO7A 4YV2A 1YS7A 3BZ6A 4EJWA 4LB5A 3KZZA 3P2IA 2FF4A 2VBZA 1LNWA 1XN7A 1WXXA 1VE3A 3EYIA 5GINE 4RTJA 1XB4A 4U7PB 4WXDA 5DRYA 5DLYA 3G2PA 3IWFA 1NE2A 1R7JA 1FP2A 3KP7A 1BIBA 3HCAA 1IM8A 1SUIA 3DFGA 3H2BA 2O07A 2A5YB 3QP5A 3F23A 1YW7A 3LA7A 3EVDA 1SMYF 2STTA 5TRDA 4DF3A 2P3QA 5FA5A 3MTEA 2J5PA 3HCFA 5DD8A 3M6WA 1FT9A 2LKPA 3TPZA 2E7WA 2ZNZA 3G2QA 2V79A 3MCZA 2A6EF 1TNTA 3B02A 4EQQA 3R0JA 2AOUB 3LSTA 3JWHA 1AQJA 2DPUA 3W6KB 3GFMA 4E70A 1XDZA 2XAQA 1REPC 4I0AA 1IY9A 3LWFA 1O54A 2Q41A 4ER5A 2AN3A 1HXDA 3N97A 4IKPA 1YYVA 2XAHA 1O3SA 1IXSB 3F8CA 1PJZA 5EMKA 1J75A 2WA2A 4B8XA 3C3WA 3J7AO 4M36A 2PLYA 5HDGA 1L0OC 5CM2Z 3CJNA 2IDKA 5CLSA 3KHKA 3WTTC 3FWEA 4ZZDA 3GJYA 4JQFA 3F6OA 1IRGA 1LEBA 3LDFA 1XGNA 2FRXA 5EHIA 5FCDA 1YB2A 9MHTA 2QVOA 4I0BA 5D8LB 4HX8A 3GLXA 4L5JA 4G56A 4CKBA 2PWYA 1UB9A 3PT9A 3FMRA 4M9ZA 1OR8A 3VC2A 3OE4A 3PFGA 3R9XB 4RVDA 5KK1A 1EJ0A 2CYYA 3BWMA 1G6NA 4KW7A 1MGTA 5DDGA 1KU9A 5ERIA 3EVGA 1Z05A 1L3BA 4GCVA 5DCMA 5FHRA 5DXJA 2PGXA 3BWBA 3EDPA 2FPOA 5L3EA 2VBXA 2PT6A 4RSRA 2OBPA 1ZG5A 4F86A 3WGHA 3CVOA 3GRZA 3KPWA 2UYQA 3HEMA 1HNNA 1A04A 3EMDA 2XVCA 4L9TA 3G5LA 3SX0A 2MC3A 1JQ3A 3C0KA 1R6AA 4AZWA 2OY0A 2PX8A 4NB5A 5DUKA 2O0LA 3GRYA 5LHHA 1S7OA 3DLCA 2ZIFA 4BHBA 4GC9A 1X3UA 4HQEA 1U5TC 2W57A 4BAYA 2DULA 2AOTA 2K02A 4RTOA 3KCCA 2ZFUA 3UA3A 2ZWAA 5LQAA 1QQIA 2ZKZA 4H0EA 5GIPE 1BKYA 5EGSA 5DM1A 1ZGAA 3ZMTA 5EQJB 2FXAA 1Z1DA 3I4PA 4HW0A 4AX8A 2IIPA 2ESRA 2XBMA 7MHTA 5DCFA 5HOOA 2G9WA 2IPQX 5F1RA 4N0BA 3K1PA 1NW8A 1YLFA 3RYRA 3Q5FA 1I27A 3X0DA 1IN5A 1GXPA 5HZMA 5C9ZA 4X1OA 2W25A 1VP3A 5K0EA 4LG0B 4RTPA 5EEHA 5KVAA 1LVAA 3T5XA 2JTVA 4IXAA 4MQ4A 4HRAA 3LA3A 3FRHA 2B78A 3L00A 1VTNC 3CUQB 1FOKA 2C7RA 4CKEA 3FUTA 2VODA 4LGWA 4U88A 1ON1A 5GWXA 3LAJA 1RI5A 4HLYA 5GM1A 1B9MA 4KRGA 5HS7A 3L09A 3I0TA 5FQOA 8MHTA 5E1BA 3LECA 5ILVA 2VDVE 1XXLA 3U2RA 2BZGA 3QAHA 1CF7B 4ZYGA 2O8XA 1JQDA 4IHSA 4E30A 2I7CA 1BHJA 1R00A 1MHTA 1KPIA 2NP6A 1Y8CA 3DXZA 1XMKA 1F38A 2Y1XA 2IGTA 3JWIA 4BP1A 1T6SA 3CUQC 2HMYB 5DTMA 3I59A 3DUWA 3G8BA 3UA4A 1YFLA 1FLIA 5CVIA 1DPRA 1VQ1A 2P8JA 4DZRA 4RTNA 4Q47A 2RDPA 1YW9A 2CSOA 4IRGA 2F2EA 5IT9K 4KVZA 2ZNYA 1FYKA 5CYVA 1IAWA 2LF8A 1SFXA 2PLWA 2D2WA 4C03A 3DTNA 2LNBA 4YFNF 1RJFA 3B3FA 3F21A 4HA8A 3WG9A 1ZYRF 2NRAC 3DMHA 1FBQA 4G7HF 4NHJA 3HHHA 1MD0A 2K4MA 3LFKA 2VDWA 2OKCA 2PJPA 4I09A 1NW5A 3FYDA 3WTUC 3MZHA 3A7EA 5KVRA 3I54A 3EPPA 4OMYA 1OYYA 2YX7A 2GWRA 4WCGA 1WG8A 4RGXA 3F8MA 4KMUX 4GQBA 5FFXA 2UYOA 3O7WA 4HLXA 2QQBA 3OOPA 3MFKA 3AXSA 4KWCA 2B9EA 1DDNA 3EVBA 4ZTBA 5BPDA 2N47A 3VEPA 1S8NA 3DXYA 2M87A 3R0AA 2DW4A 1U2ZA 3CUQA 3UJ7A 5DSXA 2QRVB 3FUXA 5DV5A 3QOWA 2FA5A 1JTFA 2RGVA 3KZYA 4R79A 4M9XA 3TDZC 2HR3A 4M73A 2HS5A 4RVHA 1RUNA 3KEQA 1H9TA 1R5HA 4OA8A 2AXLA 1QZYA 1E17A 4Y15A 4C08A 3RKYA 2VP3A 2ZWVA 3SSNA 3CCFA 1ONVA 1R1UA 1SD7A 4QWQA 1M6EX 1U3EM 4A0ZA 2P7IA 1IN6A 2PFBA 5G02A 1QAQA 1XGOA 4M9SA 1BJAA 2QZ8A 1CF7A 4QQKA 2Z33A 3SQNA 2FBKA 2DPDA 4WF2A 3LBFA 1DPUA 1BC5A 1WKMA 5EOVA 2FK7A 2GXBA 3C3PA 4JBAA 4KIGA 2WK1A 1NW3A 4MGRA 3OU6A 2A07F 3KQMA 3I59B 3V8VA 4YUZA 3KQTA 2OYRA 1M6YA 3F3XA 3WTZA 4I2OA 1HW5A 2RC4A 3UJDA 1FSEA 1FZPB 4C05A 2XYRA 4MEXF 2QBYA 1T98A 3DPLC 4LLLA 4EJOA 2B3TA 5LGUA 3FPFA 2ZULA 1BI0A 2EFOA 2AN5A 3SMQA 5D4RA 5C1IA 4MNUA 2EJUA 2BBYA 1KPGA 1PP8F 3WU1B 3R60A 3T1BA 2EB7A 3KQVA 4DMGA 4U0WA 2YVLA 5IT3A 2EV0A 4DNCA 1T38A 3UJAA 3E7PA 4M7RA 3NW9A 5HEKA 5LBQA 1UFKA 2AS0A 1R23A 1S29A 5HS8A 1P39A 5FHQA 4LMYA 3NVKI 3C7JA 1ZRFA 3QV2A 4KT5C 2XV4S 3B89A 2ZJ2A 2CG4A 1OKRA 4KN7X 1KPHA 3M33A 3OE5A 4QTUB 1R18A 2JT1A 1JSXA 1P1CA 2KW5A 3HTXA 4GOMD 5B1SA 2DLLA 2P4WA 4OOIA 2ZCJA 2NXEA 5EC8A 1BI2A 3E5QA 2AZTA 3KPUA 4WWCA 3ZN1A 3GRVA 3LKDA 5HIJA 3M8EA 3FPHA 5DM4A 4XUCA 3R3HA 2VS1A 1ZAOA 4CTJA 1BI1A 5DTRA 1KQ0A 5K0GA 5K05A 2Z3YA 4O29A 2C7QA 1UCRA 2FNPA 4PCLA 1HQCA 3EEOA 4P9UA 2PI0A 5A2QK 3GRUA 4AZVA 3KQOA 3EEYA 1W4MA 2ZW9A 3FF5A 3D2LA 1UHMA 1RI4A 3NDIA 1YF3A 3HCDA 3ECOA 1TTYA 3JTGA 3WGGA 4EJTA 2K4BA 1WWXA 1RUOA 2YTZA 1AWCA 3R6TA 2L54A 2IH2A 1KU2A 5H6RA 3GCZA 5FD5A 5FULA 1FPQA 5TJJA 1K7AA 3FRIA 4Y2HA 2QUFA 3KLNA 3GNLA 1JGSA 5KYGA 1QO0D 2DK8A 2DTRA 1J2XA 3BP8A 3WE3A 4HDUA 1H1DA 4XUDA 1SFEA 3UBTA 1VBFA 3TO9A 2X0LA 4HC4A 3BROA 5LHIA 3EVCA 5F2OA 4I02A 2IRFG 3EQLF 4BHCA 1ON2A 4KICA 3FZGA 3V8KA 1T43A 1IXCA 5E1OA 4QVKA 5IT9Z 3BKWA 5HLHA 4U7DA 2PMUA 3WTXC 1ORIA 4PCAA 5DT2A 3K69A 1UIRA 3P8ZA 3AY0A 4ER0A 3UZUA 5FB2A 1BC8C 2OZVA 4YUYA 2MA3A 4PGHA 1W5TA 3E3VA 3B73A 4ON0A 3M7GA 4AD9A 2MBFA 5LQNA 4V0RA 1B9NA 4X60A 2AOWA 3R6SA 2ZCWA 3LDUA 3SXJA 1YFHA 5K03A 4KDRA 2PT9A 1PP7U 5DRTA 1WRJA 3EVFA 5CVVA 3QU3A 1B4AA 3HRUA 2HEOA 3BJ6A 3BWGA 3CDHA 4ESBA 4BP3A 4RGUA 5H02A 4CHUA 2RV8A 4Y17A 2KJCA 1I9GA 2ADMA 3D5LA 2PKWA 1R8YA 3HA7A 4CDGA 2OO3A 1ZHFA 3CJQA 3B7PA 4XRFA 3GVAA 5EIFA 4ZYEA 1YO5C 5E20A 3GF2A 4QPNA 2PG4A 2OU2A 2JHAA 5EKXA 2GPYA 3ORHA 2PEXA 2EV6A 3B3JA 2GS9A 4EVIA 1P1BA 4E2XA 1R5GA 4FX4A 2VT2A 3VFZA 2P7HA 4P7KA 4H0NA 3MQ0A 3GXOA 3P9KA 3TLJA 3NTVA 3MGGA 2JH9A 3A7DA 4BNCA 4ATNA 4GF5A 5A2QZ 3ZMSA 3RKWA 3FUVA 2QE6A 1R58A 1R36A 4E33A 3D0SA 4L5IA 2VN2A 1N7JA 1B42A 1JG3A 1OR7A 2ERCA 4M38A 3FXQA 1KYWA 2VZ9A 4U7TB 1Z7UA 1DP7P 4PYIA 5FA8A 3VOEA 4IV8A 3ZP5A 2VT3A 4R6XA 4GEKA 1TQPA 2XROA 3QPTA 4RVFA 1QPMA 4HV6A 3GRRA 3PX3A 2HKOA 1LDDA 4YMGA 4HDVA 2Z5UA 1KU3A 4WK8F 2AOUA 4PGGA 5ERGB 4RTSA 3FUWA 1OYIA 2NYXA 4G94A 2STWA 1X1CA 3KP5A 4E2YA 4UVAA 3HVJA 4HH4A 3EGIA 4OX9Y 2XYVA 3QP6A 2HYFA 3N4MA 5C0OE 1KU7A 4A0YA 2PWPA 3M6UA 2IBTA 3QOPA 3T7RA 3FXRA 3SZPA 2QQ9A 1HMYA 4D0PA 2KIUA 3IWZA 2AVDA 1W7PA 3LDGA 2JG3A 4Z2YA 2E5WA 1XSXA 3FMSA 3IYLW 3ZMVA 1EV7A 3VODA 5T6BA 2HTEA 3GUDA 2FQ3A 1G8SA 1IN8A 3KPJA 4C4AA 4A6DA 2XKOA 4PYKA 3KFWX 1U8RA 2EFPA 2XYQA 4RTQA 3KE2A 4MWZA 2V7EA 5EMJA 4YV0A 4Q5SF 1LDKB 3ELWA 1TPYA 5J6XA 2CMHA 3E97A 1FBNA 2EFWA 1BC7C 2LD4A 3KQSA 4IRIA 3R61A 1ZREA 3C18A 1EJ6A 5GM2A 3K2ZA 1L3LA 4ETSA 1RJEA 3BKXA 1O3RA 4KNYA 1O9HA 4UV8A 1HSJA 2G7UA 4JK1X 4UUVA 5CVEA 4R8RA 2O61A 5L3DA 4Q48A 2P6TA 1SD5A 2UYHA 5CVDA 1I1SA 3GZ5A 1LEAA 4CGZA 1KQ9A 5ILSA 3LQRA 4HSGA 2HZTA 1XCLA 2R7DA 2ZIGA 1G55A 2F8LA 1INLA 4PONA 1MJBA 2FE3A 3OPNA 4L9NA 2FCAA 3EVEA 4OINF 2VE8A 5AIPA 4HV5A 3G73A 1RI3A 3EGEA 3G8AA 5K0FA 3E23A 5CUQA 3MQ2A 4PYNA 3BZBA 4A6EA 3OU7A 1I1NA 3T7SA 1Z6TA 5FO5A 2IDJA 1UHWA 2IP2A 2F5CA 3T7TA 4ZZLA 4OBXA 5T67A 5D4SA 5DX1A 1TBXA 3DMGA 5IH3A 1J59A 1SFUA 2HFHA 2MH2A 3HOSA 1LJ9A 2BH2A 5EMMA 4OIPF 3SHFA 4IRHA 2V1UA 1SUSA 1XTPA 5EIWA 3ZQ7A 3FX3A 2B0LA 3V7SA 2ONYA 4RYLA 1P4XA 2VC1A 2H27A 1NHAA 1BOOA 1XGMA 1J9IA 4BH9A 3KPYA 1O7LA 5LGNA 2WV0A 3LQQA 3U1DA 1VLMA 1IZ1A 1S7AA 1D5VA 2WTEA 4E2ZA 4V0QA 3M9AA 2G1PA 4EJUA 1YZHA 2GB4A 1G4DA 3J81K 4MIKA 2FRHA 3OV8A 2VBYA 4PDKA 2PXAA 3HTSB 1X1BA 1O7FA 2XAGA 3DP7A 4FP9A 4A12A 1XSVA 2P5VA 4E31A 1ZRDA 3WTYC 1R74A 2HDCA 1XCVA 4ENMA 2NNNA 1LQ1A 2IFTA 1DL5A 1R1VA 3SGLA 6PAXA 1JG4A 4PZJA 2V1DA 3FMQA 2IVMA 3RI4A 2G71A 1QAOA 2P3OA 3KKZA 2AOVA 2AOTB 2IA0A 3UJ8A 2WA1A 5E9WA 1X19A 2LF7A 1QAMA 2B25A 3T8RA 4OQDA 5D1HA 3TM4A 4B17A 4KFCA 3O2PE 3COAC 4YMHA 1ZRCA 5FLXK 1SVUA 4OQEA 3M4XA 5HIMA 5DEQA 2F5EA 2IH4A 2I6GA 2QRVA 3HIFA 4AUKA 2FOKA 1HW1A 3GYHX 2XGXA 4XSXF 4PWYA 3VC1A 2BR5A 2W24A 2KJBA 3RIRA 1W7PD 3GFJA 1VP9A 2FHPA 3IEIA 1Z9CA 2ZXJA 1P4AA 4FT4A 4QQNA 4RX1A 5DM0A 3ULQB 5CJ9A 4O3MA 2P6SA 3ECHA 4AVPA 5K0BA 3ZMDA 4ENJA 3PVCA 1XDUA 1U78A 5E17F 2PJDA 4R8SA 2ACJA 5BW5A 2ZBKA 3TM5A 3ELKA 4X61A 3M6VA 1XCBA 1IW7F 1U6GA 2OQRA 4OBWA 2HQNA 1UFMA 1JR4A 3HA5A 2GAFA 5EG5A 1HKQA 4RB1A 3AXTA 2OBFA 4TV7A 3IC7A 4WXHA 1ULYA 3NQOA 3HSRA 1YS6A 3BPXA 2G70A 2BYVE 1NKVA 1WSUA 3WSTA 3S2WA 2KIFA 1WXWA 4LECA 4QVGA 5LQUA 2EJTA 4LLNA 1H9GA 2BR3A 2W84A 2ONZA 4FT2A 3ML6A 3LA2A 3DQVC 3SVZA 4IHTA 1IXRC 1P92A 2O06A 4Q4ZF 4I98B 5CCBA 3HHGA 3PFIA 3KQYA 1ZARA 1U5TB 5JUWA 5FD6A 1ZKDA 2HWVA 1G60A 4N9IA 3NWEA 1MJ9A 1BI3A 2G7HA 2YR0A 1IN4A 4UNOA 4P7JA 3FUUA 2ELHA 1FWZA 4CO8A 2IH5A 3GX4X 3NMUF 4UVCA 2W85A 1P4WA 3O31A 1XGSA 3A26A 2NP7A 4U0YA 1IRFA 3CBGA 4LFUA 3ISPA 4P5OA 5EEGA 3RW9A 4IF4A 3EVAA 3FPEA 4HYEA 2AOXA 1FY7A 2HV9A 3ROUA 4O5VA 1IUYA 4FSXA 2O57A 4CTKA 5HS9A 4RGSA 4G8XA 2H1RA 3SSMA 4RGRA 4G6DA 3TR6A 3K0BA 2M45A 2ZSUA 2BR4A 2GA9A 1Z3CA 4N9HA 4ZYHA 3TOAA 5E8GA 2ISZA 5E9JA 4FZVA 5DTQA 2F5FA 3A4TA 4HTFA 1EH8A 4KMFA 5FTWA 2HYGD 1VIDA 2FK8A 4YIIA 2K4JA 4PINA 4UVBA 4XCXA 4ENNA 3HNRA 3TKAA 1G3WA 2ZBPA 5AONA 3TKYA 5ILUA 4HF2A 2HTJA 3GZ6A 4R8HA 2YSRA 1EH7A 5LQKA 4WX9A 5K5OA 4LWPA 1TQIA 3GIWA 1RI1A 4GO1A 2YU3A 5BQTA 5BPIA 4BLWA 3KR2A 4U0VA 4LG1A 3IHTA 2CWWA 1FYMA 2FNAA 5K0LA 2XVAA 2DPMA 3KQPA 5K5QA 1AOYA 4JXJA 2K7LA 3RDIA 4DA4A 3J80K 3ELYA 3HCEA 4POOA 5LHGA 2OXTA 5DPMA 4C06A 2PXXA 5KS2A 3P2KA 3IKTA 1B1BA 5K1YA 3WE2A 4HZFA 2D1HA 1SAXA 1EIZA 2OA4A 4E2WA 2IPXA 3BT7A 3GO4A 5LEJA 5DWQA 3PX2A 2GXGA 3HCBA 4RB0A 2RQPA 4HF1A 1EAMA 4M6XA 3NDJA 1J5YA 1KA8A 2I62A 5ICGA 1C0WA 4EJVA 2ZZNA 4FT8A 3B5IA 5DX8A 3WTVC 3E5XA 3FPGA 5ICEA 2V1XA 5ED4A 3G7UA 1BOAA 3QRFF 5LRSA 2A69F 2XKPA 5E8JA 4OIQF 5JVTA 3NRVA 2PX4A 2M30A 2JRTA 1F3LA 1ZGJA 2QBYB 2JZYA 4ESJA 2K27A 4FHTA 3JWJA 3IRRA 3GDHA 1YW8A 2Z6QA 4ER3A 4B09A 5LSAA 2D1VA 3I9FA 1G38A 2QYOA 4R05A 5EHGA 3DR5A 2H94A 5HIIA 2R7FA 2H6BA 3AJDA 5CIYA 4YUVA 2E1CA 4Y13A 4O6JA 1Q0SA 3EYYA 1K78A 3G3ZA 5HFJA 4UV9A 3EVZA 3EGVA 4IV0A 2BE5F 3IHUA 4GGGA 1BN5A 1L3CA 4XUEA 4LG0A 4HX7A 3CO6C 3HYIA 2M5WA 3KPVA 2P8TA 2LSOA 4HQMA 3CGGA 4L0YB 3LBYA 1Q0TA 5K01A 3KETA 3DF8A 4MHTA 2DBBA 3PLAE 3HCCA 1KYZA 1V3FA 4EM2A 3DEUA 3NJRA 2PX2A 3KR9A 3GFLA 5J8FA 5L3FA 3KLOA 3HSFA 3M70A 4FS8A 2Z99A 5D8KB 1O3TA 2BEOA 2GQQA 1P6RA 3V4GA 4EGYA 3KR1A 3DLIA 5FWDA 3HM2A 4PYLA 1K79A 2ZZKA 2HR1A 1HKSA 4L9JA 1WZNA 4HX4A 2F5DA 2MLKA 1FBSA 2A68F 4GYIA 3BWYA 3F8BA 5EMLA 3GGDA 2BGCA 2ESNA 4EM1A 3ANXA 4I7HA 2RNJA 2JPCA 1L9KA 3KP3A 1QGPA 1QNTA 1GXQA 2I9KA 5L3CA 2CW0F 3O6BB 3PB3A 4NECA 2E1NA 3ZN0A 2X4HA 3KP4A 3GEZA 4MQVA 5E1WA 2P40A 4OA5A 4MTDA 5J8CA 1KQ8A 2Z6UA 3A27A 2GAUA 2XUBA 2M1BA 2ZZMA 1AV6A 4P55A 4RWZA 1U5TA 1GVJA 3HVHA 5FFZA 1ZH5A 3KQQA 2FBIA 5H20A 4RVGA 1JHHA 3GU3A 1NW7A 5BXYA 3GO5A 2P7VB 3KU1A 3WTSC 1R22A 1QZZA 1PUEE 5F6FA 4FGZA 5DD4A 5HLGA 1CGPA 1AQIA 3LL7A 1G3SA 4P7FA 1T2KA 3LHDA 1M0EA 4C04A 2PMHA 3BWCA 5L3GA 1W7PB 3DV8A 4WXCA 1H0MA 3UWPA 4CZZA 3FTEA 3GFIA 1RI2A 1HSTA 2V74B 4GOND 3I53A 1I5ZA 2C7OA 2EX4A 4A2UA 4EGZA 2GIVA 3T0YA 2P7CB 2HGCA 4YIFA 4DQ2A 4HTFB 4ZH4F 5D5UB 2Y0MA 4M71A 4QLCU 3HUGA 3FPJA 2DU9A 3I71A 2O6GE 5JR3A 3C6KA 2HWKA 4LJZF 1S6LA 5T64A 2XASA 2A6HF 1G3YA 3TFWA 2ORED 5BW4A 3PFHA 2PV0A 1HBXG 2L4AA 5P8WA 2L3DA 4CKCA 3K9TA 2PSSA 2CWEA 1QBJA 4XSZF 1SG9A 1W5SA 1KR5A 1WI9A 3MTIA 3BJOA 4CICA 3HRTA 3G5TA 3JSPA 3FZVA 3WTWC 3LCUA 2XHKA 1XSDA 4YFXF 2P3LA 4M74A 1PDNC 5F2KA 3DPTA 5E8IA 2FBHA 2NAZA 1S3JA 2OB1A 3KR0A 3P9NA 2Y75A 5CD1A 5LLQA 1J0RA 4RTRA 5FLXZ 2ISYA 2ZFWA 5HOQA 4BQAA 4ISCA 2P41A 2MLGA 3CLOA 3BJAA 3U9GA 4BHPA 3L2CA 3DULA 2NXNA 5E1MA 5EVJA 4AIHA 5HILA 3E6BA 5DYMA 4KA4A 1L1EA 4MTLA 1IXKA 5E8RA 3SSOA 5LQRA 3HTUA 5E2AA 3LCVB 4M72A 5DCMB 4R6WA 4KDCA 3I64A 5LGTA 2NS0A 1V39A 3CC8A 4A5NA 2PN6A 2MD5A 3GW2A 1YTYA 3F8NA 3K1MA 1F4KA 3U81A 3F22A 3TDUC 3ABTA 5BS6A 3NVMB 4RV9A 3H92A 5E18F 4DCMA 5M5BA 3RTRA 1TW2A 3RPQA 1SQFA 5FQNA 2CFXA 3OZRA 2R3SA 1LDJA 2XIGA 1K78B 1ODDA 2AR0A 4S05A 2EWNA 4RTKA 4MTEA 4LB6B 2KIMA 2FMYA 1I1GA 4EKIA 3F4KA 2VE9A 4RAYA 3SZTA 3V8JA 4LK1F 3WGIA 4AIKA 1YIOA 3ER9A 4S04A 4YV1A 3TRKA 3IL2A 1QYRA 5CCXA 2EFQA 1NV9A 1VL5A 5LRRA 4P58A 2UXNA 1UWVA 5FADA 2UZKA 2DQRA 3LPMA 3SFZA 2ZO4A 2LDUA 3E6DA 1OMIA 2YXEA 3LGAA 5D1NA 2ETHA 1B59A 4HF0A 1NBIA 2OB2A 3MHTA 3KP6A 4AWXB 1ZQ9A 4DKJA 2QQAA 2IBSA 5D6FA 4FSDA 4K6MA 5LR6A 3BPVA 3P7NA 3F72A 3ERCA 2DQLA 1RZ4A 2ZIEA 5GIOE 4HGYA 3T0IA 4GBED 2A14A 2GZWA 2EA2A 4KIFA 3OZSA 1STZA 1E2XA 4ZYDA 3G89A 3E5UA 4G7OF 2GH1A 3G88A 3V7CA 4OMZA 2ZMEB 4GYGA 2YXDA 4UOEA 3TOBA 5GOZA 1U2WA 3K1NA 1ZN2A 3T8TA 5CVJA 1ZLKA 3ZPLA 3P71T 1Q1HA 3WODF 3R0QA 2IT0A 2JH8A 1F9NA 2PQ8A 1BBYA 2NNWB 1D3YA 2XRNA 4ER7A 3KP2A 4DM3A 1YFJA 3BY6A 3H3ZA 5HDNA 3RYPA 2UYCA 2Q0OA 3ZMUA 4DQ0A 3J80Z 2L4MA 4OIRF 5K0JA 2HTSA 1O3QA 3FTCA 1SD4A 4I01A 3ELDA 3FYCA 3JAMK 1NBHA 4BLVA 2Y1WA 1N7IA 2YX1A 2ESHA 3V97A 2ZLBA 2MH9A 1USTA 3LKZA 3Q87B 4EKGA 3IRQA 1R1TA 1P91A 4G7ZF 4HG2A 3P9CA 1FP1D 4HBLA 3E8SA 3P97A 4PYJA 2O03A 1XD7A 1KXZA 2YX4A 1D2GA 3FXUA 1SMTA 3KQWA 1PRYA 1D2CA 4QTTB 4RS8A 1JHFA 5FUBA 3FHZA 2QWWA 1YZ3A 3IKVA 2BV6A 1FYLA 3O4FA 4M37A 5LQCA 5IKMA 4IJAA 1EQAA 1N2XA 4BY9E 3CTAA 3HA3A 1XVAA 3TO6A 5FWAA 2VBWA 3KEOA 5D5XB 2FEZA 1XDSA 1FX7A 2ZTHA 3M8FA 1USSA 1KHHA 2NXCA 3CJRA 3THSA 1VPTA 2C6YA 1R8XA 2CKDA 1X1DA 3ERED 1G3TA 2P35A 3G2OA 4M6YA 1RNLA 2QY6A 5DX0A 4G6QA 3WU0A 2PX5A 2EJRA 5EPEA 3NEUA 3O3KA 3VYWA 3VSEA 4L0ZB 1FSHA 4XBFA 2NYUA 2RN7A 4OU0A 1F5TA 2RVCA 1ZG1A 3BOQA 5LQJA 2L02A 3R24A 4HOBA 3A25A 2XAFA 1KGSA 1LB2A 1OYWA 5KQSA 4PCQA 2Q2EA 3K6RA 3OU2A 2FMLA 5DSTA 4CXFA 2YPRA 5HLIA 5E1XA 3FTDA 1L3IA 1MKMA 2JPBA 3E6MA 1T39A 1Z91A 3V8LA 1DUSA 4GC5A 3UJ9A 3EMBA 4OIOF 1RI7A 3RODA 1Y0UA 2GLUA 5D6EA 4YUWA 3MCTA 1JG2A 2G8NA 4EK9A 2V6CA 4AZSA 2EK5A 3P2EA 2HOEA 1JQEA 2BM8A 3SR4A 3DXXA 3MERA 4A5MA 3RPUA 4G9YA 3TQNA 2OQGA 5DM2A 4RAZA 2RKHA 5K09A 4GOLD 4XLPF 3EUHA 1RJGA 2JHCA 5K0CA 2J5OA 3JSOA 1IN7A 5ICFA 5K8VA 4RTLA 3PQJA 1I6XA 3L7WA 4EMSA 4EM0B 2VC0A 2ZMEA 2P5LC 1O57A 2M8EA 1RIOH 2CQKA 4FR0A 1MDMB 3HVKA 4PIPA 4BLUA 3C3YA 3P9IA 5U4XA 3TQSA 1YQAA 2ZVJA 3DH0A 3JAMZ 3J81Z 1FC3A 3TMAA 2P1DA 4NQWA 5HDKA 4HAMA 10MHA 3R4KA 1Z6RA 5JFRA 2DI3A 3EETA 3HRSA 3LAPA 3TOSA 3REOA 3C1DA 3RJPA 5BMZA 1O9GA 2EFNA 3NWBA 2WC2A 4DCGA 2QM3A 1WY7A 1KP9A 2O0YA 3UJCA 1J7KA 2Y48A 2HQRA 5JHUA 3DMFA 4WVLA 3UFBA 3V7RA 2PVCA 3PTAA 5K0NA 5ICCA 1NW6A 2UZ4A 3I58A 4ESFA 1RJDA 4Y30A 3JWGA 4LWOA 2H6CA 3MWMA 2K86A 3C6MA 1XMAA 2O05A 4QPPA 3DOUA 2ADUA 4YUXA 2Z9OA 3L8DA 1G8AA 3UJ6A 3F6VA 2EFJA 1XJ5A 1TNSA 4IPAA 5L3BA 2ZBRA 3HP7A 4AZTA 3M1EA 2VOPA 2Q8KA 3CJTA 2YQZA 4F85A 3AWIA 3SXYA 5DXAA 5K5RA 3BGDA 2QLZA 3FM3A 4YFKF 1NT2A 4QDKA 2PY6A 3HSEA 2YUIA 1FBUA 2PXCA 1D8JA 4ASNA 3THRA 2DO7A 3S68A 2AN4A 2FU4A 1I4WA 3FM5A 2OD5A 2TDXA 4UXNA 3MEXA 1JSZA 5JI6A 1WQ2A 2DFIA 2CL5A 4P7GA 4X41A 3HRMA 3HVIA 1D8KA 4P96A 2KKOA 3SM3A 5D5VB 4IWNA 4MHGA 3ZMZA 2H00A 4L9VA 5LEKA 5EKUA 5CVUA 4F7ZA 5E1DA 2PBFA 3K0LA 1MDMA 3ABUA 3LCCA 1FJXA 4GOOD 2IJLA 2D45A 1D2HA 2OZ6A 2EG5A 3RKXA 3Q7EA 1TQMA 2C7PA 1ZLJA 3G2MA 3MB5A 2UXXA 2COMA 2E7XA 3PQKA 2H09A 3TGNA 1JTEA 5CVRA 2XAJA 1K6OA 1HKTA 2O3FA 4IVNA 4EV0A 5H6QA 3E05A 1QANA 2B2CA 1HW2A 3OFKA 2FSWA 4ENKA 2A61A 1NV8A 2L01A 3JW4A 3BGIA 1JE8A 4R1HA 1TLHB 4CWAA 4BXUA 1F1ZA 1KIAA 4KIBA 3DKWA 2CO5A 3ER8A 1MJFA 1DCTA 4RTMA 3ELUA 1GHCA 2QENA 3I5UA 2UWMA 3RIEA 3MZYA 4MEYF 4PYQA 2DAOA 5F64A 2OAZA 1V4RA 1FNNA 3GWZA 2HKXA 2G72A 1JG1A 3CKKA 4HGZA 5E1ZB 2DT5A 1MZBA 4PYOA 4LK0F 1DUXC 2BM9A 2NXJA 3F8FA 3QU6A 4CYDA 2ZBQA 2VDUE 5DUIA 1JXSA 2EV5A 4LLGF 4P9FA 5E2BA 3ID6C 5HVQC 4L7VA 1YG2A 5GP1A 3BGVA 2R6ZA 3UJBA 4QDJA 4K2EA 4F84A 3M6XA 2XVMA 1SD6A 3VB2A 2CMGA 5EZSA 2H11A 4PYMA 2DK5A 1T0FA 2OZUA 4L18B 5AIQA 5FGMA 4KDPA 4UHTA
chains in the Genus database with same CATH superfamily
1NLYA 5IPFA 3GLGE 2R7ZJ 2H5IA 5JH7F 1LNSA 2AN9A 1TXGA 1M9NA 1PV1A 2JC3A 2VXZA 2PBIA 4JKIA 1UPUA 2PS9A 3CBQA 3GJ8A 3HLKA 4CV2A 4KIJA 5BP7A 5IHPA 5ESWA 4BMZA 1MC8A 4H1HA 4HQOA 4JLUA 4IR7A 2UUAB 3NC4A 3HB1A 5B3KA 2AXTC 5E3OA 4DVJA 4DDMA 5F3DA 2EG9A 3OAAA 4O1MA 4ID9A 5REQA 1T1JA 3ZBPA 4TMFA 2O2DA 4K87A 4XIYA 3GTGJ 1B8UA 2R1UA 3FPBA 5JJBA 4ID3A 3D02A 3C7TA 4MWEA 5HE9A 5EE0A 5EUBA 1L4FA 2OCGA 3E1SA 2FG5A 3OWHA 4U7BA 1X9IA 4MULA 1LWNA 3ZV7A 4DQKA 4NCKA 4BRZA 3F0CA 2P5KA 1YRWA 2UUZA 1CQTA 3SC2B 3MRTA 1IIBA 4KBGA 1R4AA 5E9QA 1ESNA 4R71A 3HG7A 2ZKIA 2ME6A 2ZTUA 4YG2F 3RPEA 4ZHQB 5FO0A 3ENWA 4RETA 4P2BA 4Q9DA 1VF9A 1KMHA 1XTRA 4KJZA 3BTLA 3Q12A 3TDKA 3VNQA 3TZQA 1TU3A 5J9FA 4BYYA 4NS4A 3V7FA 5I8WA 3L7MA 1X7HA 3VHXB 3WADA 2FSSA 4EYKA 4N3CA 3LC2O 3ITKA 1SGWA 4KYWA 1TAHA 1DAHA 2VDMB 3F5DA 3GJ3A 1HNZB 2QG6A 5K6RA 3HOTA 1VBKA 3IDZA 1G17A 5ALLA 1YL6A 3QPAA 1AF7A 4D9BA 1PV2A 1G7TA 3ZHTA 4XLNF 3KZ1E 5A9SA 2IA2A 2AS5F 2JEOA 4XDHA 3OEWA 4EW6A 4REOA 1M0SA 4RS3A 4MYDA 4AD8A 1CY8A 2Q8QA 3VOTA 3HS3A 3GEPA 1QR6A 5D3MB 2IH5A 1UJBA 4EVQA 2GJSA 3A37A 3PPXA 1TW3A 1Y6RA 3NHRA 4QE3A 4A10A 3N59A 4AECA 5A0FA 1VECA 2IW5A 5JV5A 3AI1A 1XDDA 2HTFA 2IYZA 2QMEA 4IIJB 4KN4X 2B7LA 3X44A 2JJQA 4S0XA 2FYTA 5DXFA 4TL8A 2ZJZA 1QCDA 2OWDA 2ID8A 1FS4A 1CEEA 3QM1A 1Q1GA 5K3DA 2PQMA 3G1MA 1U1CA 3WHBA 1WS6A 3DXJF 2GA2A 4JY7A 1YZQA 4RJTA 1G291 1AN9A 1MFZA 4M1EA 4TQUS 3W3CA 3JQRA 2Z04A 3BQ9A 3D4NA 3I76A 4GR4A 5B5SA 4OHYA 5E6RB 4HDMA 3Q8MA 2JK0A 3VNRA 2WOOA 4EKEA 3A1TA 5EZQA 2V8BA 3KVOA 4C3IJ 1EDDA 4Z6YA 1EUDA 2G4LA 2QTRA 4RAOA 4BTEA 1E5LA 2X1MA 5EYPB 4C4XA 2AFHA 2Z5FA 4FZ3A 2JIPA 4CN9A 1OGJA 2JCYA 4S1OA 1FFYA 2UDPA 2EKDA 3GEDA 2TCTA 1P2FA 1S3SA 1XYGA 2HCRA 3TO7A 3DVAB 1FVFA 3IH5A 4MIEA 1QK3A 3T3OA 1VQLI 3QSYA 2A9JA 4FFLA 4LSGA 5LCXA 4YYEA 5BT8A 1U11A 3TLGB 5JAPA 1XTIA 1FMFA 4KYVA 4R9UC 4J0HA 1IQRA 3K2QA 4AJ9A 3EA4A 4M8KA 5GINE 5EWJA 3VRHA 3VUEA 4AKEA 3VV2A 1EEXB 3NHFA 3G9ZA 3KWFA 1S7GA 2ZUUA 5E3IA 1FP2A 1WDLA 2GEVA 2NU7A 4NZYA 5BSEA 3KP7A 1IPFA 2M4KA 1BVYF 1Y82A 3H2BA 1NLZA 3DFGA 4DZPA 1NK3P 2R6JA 4AN0A 4EW2A 3RAFC 1NZFA 1C3JA 2ASEA 4KLZA 3F23A 1JDJA 2DMUA 4JHXA 4ZT7A 5J43A 1YR7A 4EI9A 3WGZA 2STTA 3H97A 3V48A 2QDXA 4HP8A 3MTEA 2J5PA 3R0ZA 2JAWA 4YRRA 5J4YA 2IUFA 4PPQA 1MNMC 3H7AA 1C3LA 1IU9A 3DOFA 1X2EA 3EF0A 3N2GA 4JSYA 5AM3A 5FPKA 2V79A 3O4HA 2XT9A 1MCZA 4MMXB 4PAGA 3I3SR 1JEQB 2G5GX 2AOUB 2E1PA 1W4ZA 1WEHA 3CZAA 3KXDA 3C1OA 4I1UA 3LBAA 1CUAA 3GFMA 1XDZA 1HT2E 2KLHA 2XAQA 2FDCA 4MGZR 3TW4A 2OBLA 4LI0A 1O54A 3L2VA 3ZHRA 1VJGA 4EJSB 2Z2YA 5DLPA 3BX1A 4KNVA 2NP7A 4QBIA 1YYVA 2XAHA 5DTMA 1J2RA 3IV7A 2MG4A 1IXSB 1X4OA 1FFCA 2J3MA 4U7FA 5G41A 3ZX4A 3DD1A 3JAKA 4DLLA 1OJ7A 4ZEVA 1H4SA 2WA2A 1N2SA 2QLNA 1JDPA 1YKGA 3TBHA 1QHEA 1FVHA 3PXGA 4B9AA 5HDGA 1L0OC 1XVLA 1VHWA 1J99A 1T9GR 2IYXA 2VT7A 4IQ8A 3L7DA 1QX3A 5CM2Z 5JY1A 1PUXA 1ZU5A 3AETB 5CLSA 1PFWA 3GJZA 4NG5A 5JNRA 3GJTA 3BB3A 3OCWA 3OLZA 2DVMA 4MWDA 4J19A 1EE9A 3PNLA 4ZZDA 2VTBA 3QI7A 1US8A 1FPMA 4XLCA 1IRGA 1QJ4A 3I4CA 3TSCA 1LEBA 3LDFA 4BEWA 4ZICA 1AB5A 5FR2A 4KO4S 4LV5B 3L7KA 3ZUGA 2L2OA 1YB2A 3B1ZA 2QVOA 3H11A 5FCDA 9MHTA 1KKMA 3NUZA 3P7MA 1UOOA 2VNIA 4A16A 4CDRA 4OBBA 4L5JA 1DDIA 3B7GA 2OV6A 2XPCA 1CFJA 3G82C 1V3UA 5AOVA 4EJ2A 4C01A 2RHLA 4F55A 2YYSA 3KELA 3PT9A 2ZYSA 5AXBA 5IAJA 1ITZA 1GAWA 2DUNA 1YZKA 1A6QA 3NXKA 2NO7A 4I4CA 3SHOA 5KK1A 1JHVA 2C9CA 4XCVA 3X3HA 3I55I 5ERYA 1QE0A 4QTXA 3N76A 2F64A 4U00A 1Z4JA 2YRFA 4QLAA 3HPQA 2A9KA 4RKFA 4WDQA 3RV4A 2HQAA 2WWRA 4FIZA 4RY8A 2PMCA 4UPVA 1GL3A 1MGTA 2Q1ZB 2P9JA 4IW3B 2YWXA 4B1FA 1X7XB 3EVGA 4Z1OA 5IG2A 1DJMA 5DCMA 5FI3A 4Y1GA 1KKUA 3PIOF 2PGXA 3K9HA 3PFYA 2NO5A 4L1KA 3THXB 2NU6B 1RADA 3M4JA 4I3FA 2GTIA 5L3EA 4XKWA 1ACMA 2Q5CA 4GLBA 1C7QA 4L0QA 5T7BA 2DGDA 3QHAA 1AS2A 2D2EA 4QJ4A 1NU6A 4U63A 4C4YA 1P9NA 2OA0A 3GRZA 2XVXA 3BH0A 1I1QB 1VG9B 2BCGY 4US1R 1F7UA 1D7OA 4FZ5A 2DZDA 2RHTA 3DBHB 1RHKA 2CK3D 1RLMA 2JGMA 4FR5A 4Q18A 3TLMA 2Y6VA 1WCWA 4REQA 4DV3B 3B82A 1SXIA 1KC3A 4BMDA 3RUHA 3U9SA 3GJ7A 4KE7A 4DNOA 1FNSA 3RANA 4CDNA 2RGNC 1S7OA 2H7CA 3DLCA 4G1CA 2V6IA 5HJ5A 2XPUA 1OFUA 4J0EA 5EHXA 4RGVA 4D74A 3NNSA 1U5TC 2GHTA 4MKXA 2DULA 1CEQA 4Q9HA 1PJRA 3DTVB 2AOTA 5HK8A 4DMCA 1FL9A 1D0IA 3GZNB 1YDFA 2EKQA 4JOSA 5FUWA 2QU8A 5LZ5A 3OIGA 2C03A 1RRMA 1SC3A 1M2OA 1IONA 4PQEA 2CV0A 5LQAA 3FR7A 4DV4B 3LA8A 1MMAA 3I6MA 1KQGA 1BKYA 5GIPE 5JECA 1ZGAA 3S8YA 3UKJA 2ZQ5A 1IY8A 4A3CJ 1PFKA 1RXSA 2ESRA 2IYWA 2Q50A 3LS2A 4J8PA 5DCFA 1UJ6A 4NAUA 3SZMA 4BUZA 1A71A 2IPQX 3K1PA 4LIPD 3JVUA 1TT5A 2XLBA 2HU7A 1YLFA 3ZR4B 4ZI7B 2R7QA 1P62B 3RYRA 3AEXA 2JBWA 3LUBA 1DRVA 4X8HA 1J9EA 1YVDA 2YCLA 2GKSA 2FWJA 1I27A 5CNKA 5E6UA 4DJDC 3IBCA 2C59A 1SU4A 4ZDWA 2FPRA 4O4JA 4OLHA 5HZMA 1QPIA 3EMVA 4XICA 4FFRA 4BBAA 1VP3A 2ZYUX 5HQ3B 4DA0A 3C1UA 2R6R1 5CDSA 5JDCA 1XRSB 5DBEX 4I1VA 4PSDA 2POQX 5KVQA 5HQJA 5EEHA 4LYJA 1OXVA 3WK4A 1Z2AA 1E9BA 1LVAA 4YK7A 4G0WA 3AL0B 1NXWA 1PN3A 4EFLA 1MJ5A 4I5EA 1UC5B 4QXPA 3L06A 3RV3A 3ZWQA 2G1UA 3U4QB 4MQ4A 1Z15A 5J4KA 2JF0A 2ZUFA 4N48A 1TVMA 2P2ZA 3LA3A 2GRJA 2IPAB 4PR3A 3OF3A 3EGCA 2OAQ1 4ZAXA 2IUUA 2QF7A 1Z68A 3SQDA 4J16A 3SZ3A 1R5BA 2CJPA 2OG2A 1YB7A 2VKDA 3HDYA 1VTNC 3CUQB 3AEUB 3KG2A 4KQGA 5KX5A 4KR0A 1QVRA 3W6PA 4UDNA 1FOYA 2P6UA 2DUJA 2ZANA 5AM5A 1U28A 5IK2A 4YX9A 1VSBA 3ROMA 2YN4A 3LPDA 4LS3A 3TL6A 1OE0A 3VI3B 1LLUA 1KY2A 5GWXA 5KBYA 4I4NA 4EPVA 4OK3A 1AHHA 4BHTA 1LI5A 4C4RA 3AEKB 1SCUB 1JXAA 3MJSA 4UXJA 3WDMA 5MN5A 3WL7A 4HLYA 1PJLA 1GQSA 4L5AA 4E3ZA 1O0BA 3GFPA 4OHBA 5GM1A 3NHPA 4KO8A 4KRGA 4QUGA 4BO5A 3FDIA 5FKLA 1Q1AA 3JQ7A 1ONPA 1V3QE 1CLUA 4YEJA 2QX8A 2Q8NA 4PQRA 2PTHA 2PMEA 8MHTA 2X6OA 5TR9A 4BNZA 4M54A 1JEAA 4PHCA 3LECA 1HY3A 2CN1A 2D06A 2Y3IA 1CIVA 4GM0A 3SQOA 2VDVE 2W2TA 2ES4A 4W4TA 3WHKA 1XNHA 2BZGA 3EA5A 3PXEA 3QAHA 2IXSA 2BFEA 3FTNA 4ZYGA 4C3OB 1XRLA 2VRCA 4NEGA 2AEFA 2H2DA 2DF8A 3DFFA 1H3NA 4UM8B 1JIUA 1TTPB 3L41A 4D56A 4IUDS 1TCBA 4UBIA 1KPIA 1UAGA 2NP6A 1Y8CA 3DXZA 4MSUA 5EYRA 1XRPA 3EPZA 3FE2A 2B21A 4YDSA 4OAYA 4K8OA 3CKYA 5KQMA 2VJPA 1EDOA 4XM3A 2EZKA 2IGTA 2IYEA 2YRXA 2HO5A 3KZVA 1XQ1A 2O6LA 3E03A 5J3LA 3QEMA 4RYDA 4C7BA 4LQLA 2QG9A 2CHEA 2RBKA 2O8KA 3I9NA 1H4QA 2NZXA 2VB6A 1Y1LA 1E6KA 2QQ0A 3GRCA 2EBIA 2EP5A 3H1GA 4O2LA 4QYMA 4BUJA 1YFLA 3DZDA 3KBBA 3IE0A 5LD2B 3GAFA 1VQ1A 1RLOA 1SBIA 3ER6A 1WMEA 4RUKA 1W36D 4U6QA 4ENUA 1E6MA 2R9VA 2VUUA 1YW9A 4IRGA 5TV2A 3WYBA 1IDZA 2WSLA 5IT9K 1XGKA 2EPFA 3PGJA 4O2BA 5CYVA 1IAWA 2RH8A 4HEA1 4X1IB 4IILA 5KYXB 1OWNA 2IV7A 1NVEA 3OYKA 1DTEA 1ZRMA 1B76A 2WR8A 2WNSA 3CRQA 3HWSA 1OAKA 4KBFA 1QCZA 2FPXA 1KFBB 1M2HA 1E8NA 4R1NA 4OBEA 4D8YA 2UUOA 2WEKA 1GNTA 2PZAA 2B7CA 2Q49A 1YJWI 3CXRA 1FBQA 3DMHA 4G7HF 3LQ4A 2FEOA 1OD6A 4D7AA 1TQ4A 3DMTA 3K1YA 2PJPA 2HSGA 4GQIA 2Y2ZA 5DLQC 3E6AA 2NTVA 4UUMA 4KWTA 5F23A 2VJCA 1FDWA 4GFBA 3GGSA 2WPNA 3IAS6 1ECPA 4CCYB 4PN7A 4J9VA 4AFNA 5JNSA 1L5SA 1UBCA 4O2RA 7GPBA 2V9PA 4RH3A 4D9JA 3E70C 1WPKA 2RARA 3PQ3A 2BV3A 5FLYA 5HCUA 4XPIB 3TX2A 3IKLA 4JEMA 2AHOA 3GLFA 2QQBA 4DEVA 2W4IA 1CQXA 1S9DA 5EJFA 1U1DA 4A0GA 4ND1A 2QTCA 1JL3A 2C2HA 2R85A 3BCUA 4KQMA 3ZDXB 4ZYXA 4EEKA 1FSPA 1S8NA 2D5LA 3MF4A 5B6IA 1G20B 1II0A 2GDJA 1RAEA 2ZJOA 3HU5A 5BSFA 2W6OA 1VBNA 1N2CB 1FCJA 1CQJA 2H06A 1N2OA 2M1XA 3ZQLA 3GT7A 3WDLA 2Y6UA 5TMPA 5DSXA 3QA9A 4P2GA 4X66B 2FA5A 2QSHX 2DR3A 2BVMA 2WWXA 1DT3A 3B1XA 5EJAA 4KRXA 3NV7A 5AKJA 4F2HA 3OYGA 1M8JA 2VH5R 1IL0A 1XZLA 5IYBJ 4IRMA 1V95A 3RLIA 4BLRA 4DXDA 5LWHA 3JS5A 4P93A 1GV5A 5YASA 3RVSA 1PJ3A 2IV3A 4EVSA 2EFGA 1KOLA 4GGMX 3MTGA 4BOYA 2K7FA 3DFUA 1JWLA 4F4FA 3MWKA 2WHYA 2R8XA 4CMIB 3RKYA 4JVMA 1QF7A 2ZWVA 2KMUA 2YWDA 4XTRA 1OHHA 2GIZA 3C8DA 3K8YA 1EGMB 1N0UA 2WHRA 5HKLA 4DWWA 2QDKA 5C8DA 1T08B 3JRIA 1KYXA 5GPCA 1O8CA 1RPNA 2BGLA 3LVQE 1G42A 4KLCA 3SSNA 1SD7A 2DPLA 4QWQA 2OUIA 5ALUA 2HXGA 4GL2A 2RONA 4A0ZA 3X1WA 1KJJA 2ADFA 4BE2A 1IN6A 4DABA 2FEWB 5FNVB 2VXOA 5G02A 4M9SA 1E3OC 3RSFA 2FOWA 3PFNA 4AN1A 2WT9A 4B6RA 4JVLA 1X15A 4JLVA 1QG0A 2FBKA 4EI8A 3BSWA 2OFPA 3LBFA 4KPFC 3D0RA 1BC5A 1XMQB 3D0OA 3CCSI 1OAAA 1V8OA 1U4SA 4FUTA 3WMWA 2GXBA 3C3PA 4ESVA 2JD2A 4O4HA 4HNAA 4LZZA 2H07A 2BZTA 1L5ZA 3ZQHA 3L4SO 3LA6A 3OQBA 9ABPA 5HUJA 3E48A 5JC1A 1Y7HA 5D5HA 3R6DA 3U7HB 3ZDYB 3CB4A 5C8VA 1T2EA 5IYZB 4JLAA 2YOGA 4MQFA 4D44A 4CH7A 3PUFA 4KC0A 2OXIA 4LWQA 1TQDA 1HV8A 4UJ3A 1PJ2A 2WE8A 3CX8A 1D09A 3H65A 4D6YA 3JD4A 3HOWJ 4U9HS 4B2PA 1MBFA 1FZPB 2WJ4A 4HFRA 5TDHA 2XYRA 2NVYJ 4ALMA 4NF2A 5IC4A 4NUBA 2HW8A 4ZZ0A 4OF4A 5H3CA 1HTBA 4OXKA 4BZZA 1T98A 4LLLA 2DUMA 2OSVA 2Z8XA 2QVZX 1XZHA 4CODB 3KLMX 1CUGA 1FQJA 1LS6A 3T9DA 1J2TA 2N3ZA 1VE7A 2AN5A 1G9TA 3HBNA 1M2GA 1TVCA 2BP7B 2J87A 4U7JA 1PVVA 2AG6A 5C3EJ 3AL3A 3LC1O 4D9CA 5KQGA 2O19A 4RK1A 4BZXA 2HQBA 1D6SA 1I80A 4K6HA 1KMCA 3VAZA 1XEXA 5KWSA 1QVTA 2DB3A 1W0JA 1MB2A 3T1BA 5AI6A 2EB7A 2INGX 4LRWA 4DMGA 2AQKA 1NSTA 4O4IB 9GPBA 1R15A 3Q8XB 1AG9A 3CQ9A 3OOYA 3L4JA 4ZCMA 4Z4IA 3MG9A 3U7RA 3QBEA 4DLRA 1BO6A 1TRHA 2LKSA 1XZDA 3E7PA 3LM8A 3NW9A 5LBQA 2ZSKA 4GYYA 1UFKA 3PCRB 4NI5A 1U98A 5I45A 3WIDA 1R23A 1S29A 9ATCA 3K09C 2C54A 4B1RA 2R7NA 1Q15A 3FW1A 4V02A 2K6GA 3OFNA 3QV2A 3F3MA 1ECCA 4KT5C 3HA2A 3M33A 2ZJ2A 4GVXA 2WJZB 1KPHA 3SI7A 2V9ZA 4QTUB 1SUBA 2KLBA 1R18A 3O2JA 1FTYA 3HJCA 2Y68A 3NTXA 4ZCRA 5JAOA 2C42A 2G0NA 2I3AA 2HPMA 4BWGA 4GSKA 1HFJA 1UBGA 5DHFA 2ZCJA 4JGBA 4YY3B 4R69A 4LVCA 4PSAA 4C21A 5EC8A 3ACDA 3PHIA 5KYXA 2Q4TA 3KPUA 1DC5A 5F5XA 4NBRA 3W5UA 3ZN1A 2JCXA 4N5LA 1TL8A 3WIEA 4C78A 2ZC2A 2KRHA 4ZYYA 5B30A 2IHJA 1X2BA 5LA6B 1TF5A 4IVQA 2XYPA 4CM8B 1ZAOA 2G5TA 4MEBA 2G9NA 5JADA 5KYKA 1P7IA 2V5AA 3OEED 2A35A 2EX1A 3U49A 5DTRA 2E2HJ 4WKPA 2PQ6A 3PGKA 3EAGA 5CEJA 2MSEB 5K0GA 1D6JA 2M0MA 2V7XA 5IOYA 2QRJA 4TWZA 1KJNA 2ODEA 4MW4A 2O9JA 1OLXA 4NABA 1CUUA 2RHCA 4OQFA 4Y52J 4P9UA 3O90A 5EE1A 5A2QK 3SPXA 2HBRA 4GD3Q 2DPYA 3MCUA 4J0JA 3VH4A 1DKPA 1X7GA 1P2BA 3C3KA 3EGXA 2WM3A 4NAHA 3DTKA 3LT4A 2ZW9A 3OECA 1KAOA 4C7OB 3UFXA 1UHMA 2V8OA 3D3NA 4A1OA 1MB3A 1IBCA 4CF4A 1YF3A 2CVPA 3HCDA 2I29A 3NU1A 3FYSA 2H2HA 1R6VA 3JTGA 4TZ0A 4QODA 2K4BA 4KCGA 3E9CA 1WWXA 1RUOA 2J41A 5BSTA 3SIRA 1WNTA 4F2PA 1NTOA 3FMIA 4B81A 3O8CA 4DV1B 4HQLA 5EP1A 2ZSHB 5LKAA 2C3YA 3M1AA 3VSLA 3PUBA 1QIKA 2W8BB 4BB0A 4X3OA 2Y9YA 4Q21A 1MDBA 2HK6A 3BXZA 1QO0D 1LQUA 1TA9A 1UMCB 1XWFA 2Z5VA 3WE3A 1DFHA 1H1DA 4KXMA 4HDUA 3RU7A 1QCYA 5AHXA 3QKRB 3ZBQA 3JR3A 4JUDX 16PKA 1ZK0A 3RPUD 1JQ5A 3ESDA 2JI6A 1ULZA 5D7NA 4TYWA 4KTTE 4I6ZA 3TO9A 2X0LA 3BZUA 3ZR8X 2NV2B 2VQSA 1D2MA 4IKEA 5F2OA 5G53C 2IRFG 4JV5B 3L7BA 4N03A 4AP6A 4O02B 1WHUA 4PM4A 3AF6A 5IDVA 1ZEJA 4OU4A 3K0HA 4BE9A 2AIRA 3K4BA 3VU1A 2Q3BA 5JNLA 1YE8A 2CVHA 1PDVA 3V8KA 2BOLA 1VCHA 1T43A 1BXKA 5FBRB 5FA6A 4DBVO 5COQA 1FDUA 5IT9Z 3PFKA 3TLKA 3DONA 4U7DA 2PMUA 4CCNA 4PCAA 1G59A 5KNLA 5BNWA 1UIRA 3P8ZA 4ER0A 1ZOPA 3GVHA 4FW9A 1D1AA 2AGVA 2UKDA 1BC8C 1FRVA 1JYFA 2XRYA 2MA3A 4HDRB 4PC6A 4YCDA 3CR7A 1W5TA 3E3VA 3B73A 1N5JA 2ECQA 2MSCB 2OGSA 3GBPA 4LMRA 5HGXA 6AT1A 2AI3A 2VTVA 2DQZA 2PT5A 2WSIA 3MTQA 2IAIA 2RHGB 3HHEA 1W49A 3E84A 1W85A 3JQCA 1D9ZA 1LUJB 1UBHS 4QXMA 4JOQA 4X60A 1JMKC 2PX9A 2XGDA 3R6SA 2AOWA 1HURA 2R7XA 4RHXA 3SXJA 5LXTF 2UU9B 1PVOA 2HA3A 1Z6GA 2ETVA 1U0SY 4IDAA 4UU0A 3ESAA 5HIKA 4BVAA 1AX9A 4RQBA 2E4ZA 4UD2A 5BPFA 4KDRA 3M8JA 1KSFX 2E49A 3TRDA 2PT9A 1WRJA 1L8LA 3EVFA 1XLWA 3BR2A 4L3VA 1UT5A 5CR9A 5F5LA 5I7VA 4P83A 3ENNA 1WJFA 1I2BA 3U13A 1LNQA 3SYMA 5IT4A 3BWGA 1GFZA 2B37A 3C98A 2YWJA 5CFPA 5T4HA 4URUR 4BO8A 4YXWD 5AVYA 4Q00A 3IQZA 1QFJA 3BMOA 4WK2B 4KXYA 5B4TA 3L49A 4FE4A 1GGHA 3H3VK 2RV8A 3D6AA 5CXQA 4N65A 1Q11A 4ZT2A 1HLFA 3IQEA 1M75A 1RRKA 3AWDA 3ODGA 1BWPA 2ZPAA 1YOBA 2ADMA 4HUQB 4E1VA 5KU1A 5AJHA 3WHCA 1BU8A 3GEHA 4YMIA 4EP1A 5K8TA 3BIWA 3A06A 1R8YA 2FZVA 4NZZA 2IEYA 3OIQA 2GBPA 3FYUC 4H7FA 5F7ZA 2Z56A 1SOVA 3MRSA 2OO3A 4QYWA 4EITA 4TGLA 5FBLB 5DNCA 3PQFA 5EVCA 4I76A 2VHEA 4XRFA 3GBSA 2CXUA 4L4SA 5EIFA 4UTRA 3ESQA 5TX7A 3V4VB 5CDFE 1SHJA 3SIPA 2PG4A 5L40A 1EK6A 2P9YA 2OU2A 2R87A 4RFSA 1G6HA 3NJ4A 3OMYA 2X19A 4M9RA 1MKYA 1P2VA 2JHAA 4Q4AA 3ZGLA 1C0LA 2GPYA 1JFFA 2DHEA 1PJQA 1TYEB 1LGYA 1V45E 1V96A 3B3JA 4JB3A 3KKQA 4EVIA 2PLFA 3I73A 4MQFB 4E2XA 1R5GA 2OTJI 2C2WA 2HN9A 2QRUA 1PEYA 3C4QA 3QU2A 4H0NA 5CTAA 2VQLA 4UHCA 1QWOA 2IYLD 2OVBA 4N49A 3RGGA 3VZQA 3WO0A 4D3DA 3P9KA 3TLJA 2R00A 3K70C 4F0JA 2A3NA 3A7DA 4BNCA 1G21E 3K31A 3S6JA 3Q7QA 4GF5A 4ATNA 2BJVA 3K9WA 3BWEA 3MLBA 2QJTA 1DO2A 1M2JA 4PN3A 3NAQA 1TZJA 4DLKA 2OCIA 1P5FA 3GD7A 4E33A 1XVVA 5KU7A 1C9NA 1N7JA 2VN2A 3EF3A 1B42A 1LJLA 3KSRA 3O9ZA 4R8KA 3V8EA 4IUCS 3AETA 1APLC 3BIJA 4M38A 3FXQA 1D03A 2AHQA 1KYWA 1XRRA 2BFFB 1Q3TA 2P9BA 1N3BA 3P9YA 4H0FA 3BAFA 4DANA 3LE8A 4W97A 3WYEA 1P61B 1DP7P 1RZ3A 3LZ6A 1HC8A 3P2IA 4KTVE 3PRKE 2LV8A 4X62B 3MTAA 3OOJA 4IYRA 2CFIA 1DPGA 2QMOA 2DA7A 1XAGA 1AMUA 2X2OA 3OY2A 3ZP5A 2VT3A 2BY2A 4I2VA 1LKZA 1OFIA 3FM9A 3FOBA 3BC8A 1E60A 5CM9C 2FWPA 4RAQA 2XROA 3I3OA 3NTQA 4JP3A 1LX6A 4RVFA 1VCNA 1QPMA 1C81A 3D6HA 1W96A 3FPAA 4HV6A 2VF5X 2B4AA 3COPA 3EDRA 4MI9A 2HPZA 4KWIA 1DIOB 4RPGA 1F8UA 2HKOA 1VQNI 1LDDA 1GRQA 1MTOA 2WWGA 3MMSA 4BV2A 5BORA 1QIDA 2IPLA 4HDVA 3STUA 2GM9A 4JJKA 3EBOA 5EXDA 5C7IO 4WK8F 1EHYA 1Y4AE 3OEHD 5AYVA 3KC2A 4B3DA 1XLUA 1ZDMA 3NHUA 3DTYA 2NYXA 2DFVA 4IIDA 4DC1A 3ZHBA 1T36B 1X1CA 2STWA 1XQVA 3KP5A 1SC4A 1Z2OX 1I5EA 2J46A 2OXFA 3D8TA 4UVAA 4WXRA 4DXAA 5C7OO 1XEFA 4YC7A 4N6GA 5JSKA 4IS3A 3FXMA 2O5CA 2PAFA 3FBWA 2VQ6A 2R7WA 3N4MA 3PXXA 3R40A 3R7WB 3U62A 3V2IA 3PYMA 4JLKA 3WYCA 1N6PA 1W52X 1UZCA 1KU7A 1W44A 2WYWA 4F97A 5LLDA 1J1UA 2PWPA 3PGLA 3F2VA 3S2HJ 3Q7IA 1JDBC 3HV0A 1VSQA 1TZKA 2JGNA 1ZUWA 2ONKA 4RD4A 3ZGOA 1C7IA 1HMYA 1R27A 1GFWA 2QAGA 4GX1A 1JI0A 3D2BA 5DVZA 2FPKA 1W7PA 4WKBA 5AJTA 4ZVKA 3D0QA 2CLKB 2OTCA 3EUEA 4Z2YA 2PEYA 1Z5VA 5I7OA 1D1SA 3TL3A 2OCKA 1XSXA 3FMSA 5EG0A 1F8YA 1Z33A 2PS3A 1OX6A 2RGAA 3IYLW 3QYPA 4CV3A 2I1WA 4D8XA 4D1QA 4O4JF 2FR1A 3RUFA 1RHRA 3KEMA 1EV7A 2JLQA 5JJ5A 1O5OA 4YQEA 5JSZB 4C4SA 3IXLA 3GUDA 3R0XA 4KR2A 4R2XA 1YX5A 1HM5A 1JUDA 2FQ3A 1VL6A 1WB6A 4RVUA 3HUUA 1X3WB 1EVIA 1WULS 1NBWB 2AXNA 4PYKA 2HWUA 4RK5A 3MCVA 2JA5J 3R3YA 3SBEA 1HFEL 4RTQA 2IS4A 1DAMA 1IAQA 1ZVKA 3EXFA 1ZM3A 3M4YA 3KE2A 5EERA 3ZJYA 4G5FA 4PHGA 4MS3B 4TZ6A 1QFZA 4LGCA 1ZJJA 4N41A 3S1MJ 1WRBA 3ELWA 5JCJA 1Z0XA 5J6XA 2D5IA 2FUEA 1NQVA 5CM8B 4E7JA 1NF8A 1Q19A 1HYHA 1TI7A 2CMHA 3L0YA 5IVPA 1FBNA 2XQKA 2DECA 1EGVB 3HMQA 4WV3A 3DBOB 1EDBA 3DOCA 2EFWA 4B8YA 1TD1A 4RY2A 4B47A 1BC7C 2LD4A 2HOAA 2H1IA 3EZFA 3FOAA 1J0XO 2I2FA 1N2GA 2VSQA 3KQSA 3IVMA 4RH1A 4M22A 3T38A 4FYKA 3R3WA 4G9BA 4RKQA 4E3WA 3K2ZA 1GPUA 1BVRA 3DNFA 3R5SA 1T2FA 4RK0A 4F4JA 2O0HA 3SJBA 3PSIA 3T7AA 5CXSA 5JS8A 2B8TA 3Q6IA 2DYSH 4LYEA 2KRCA 1U31A 2VWPA 3GYGA 4JELA 4IDDA 4B5KA 3W8DA 2QYSA 2EL7A 4Y67A 4JK1X 2AFVA 2JA8J 1VSTA 2RK3A 2WHXA 5BWBA 4IL6C 2ZM5A 3CVVA 1Y48E 2QSFX 2P6TA 1FMCA 1QH0A 1O94C 3CKLA 4U9UA 2M32A 5CVDA 4BNUA 4UOZA 3OURA 2GZDA 3HOYJ 5IVHA 1P7YA 2NZVG 4CGZA 1SUWA 1SXJB 3PXCX 4U39A 3WJ1A 1VQ4I 2XWJI 3TIVA 2RHOA 2I7DA 4I1IA 3MB8A 2E5ZA 1IHDA 1ND5A 3LQRA 1PR2A 1XRMA 4OHRA 5IBPA 1QH9A 2IXFA 3WNQA 2HZTA 1XCLA 2R7DA 3RYIA 2BSQA 3BTIA 4YI5A 2OAP1 4HXFB 2XLCA 2FE3A 1KEUA 4QOFA 1FOWA 5JBQA 3BMQB 2WHPA 1K6EA 4TX1A 4EZIA 4F9EA 2H6EA 2IOQA 5B2ZA 3U3JA 1AKHA 4BB6A 3KXLA 3NHAA 1WSBA 4R1QA 3JRAA 2NU9B 1K0UA 5AIPA 3TCKA 3G73A 4F12A 4AG6A 5AJUA 2FUG6 3SG0A 1D1CA 1D4ZA 2H1FA 1X7DA 2J4CA 1ST3A 3E23A 4P08A 3AP1A 3HU2A 4OEHA 4QGGA 4QU8A 4TTQA 4E5MA 1P4SA 3LSMA 1Q57A 4TPKA 3WRXC 1PZMA 1U2GA 1UJNA 1V1RA 2WU0A 2XMBA 3BZBA 4JX4A 1ZCAA 2KSQA 3IKMB 4NMMA 4TS1A 5H5JA 4TS3A 2O2HA 2BJHA 2IIBA 3RUIA 4EG4A 1BN6A 4FFSA 5JDIA 3S2FA 2XGSA 3ZVKA 5EJCA 1AURA 1UHWA 1ZK2A 1QGUA 3FBTA 2Q0QA 4QBHA 2F5CA 2C7OA 3BFKA 3T7TA 4OBXA 4LOCA 4ZO7A 4MW2A 3FOZA 1Q20A 5T8KA 1XVIA 2ZPUA 3DMGA 2HU8A 4H1UA 4Y2QA 4A0RA 2HFHA 4OU5A 2K9NA 5U4QA 1MOSA 4R84A 4KN8A 5TLSA 2HRBA 1Y56A 2R97A 5EMMA 3WHIA 2BKVA 2CNWA 4OOEA 1E6UA 3HI4A 5FOWA 3VKWA 4DCUA 1XTPA 5EIWA 4Z7OB 3SM9A 4AUMA 2B0LA 3RUCA 4I5GA 1E1QD 3OE1A 4RYLA 2PKRA 1SAYA 1ZWLA 1Y6IA 2L9NA 2HPIA 4Q3NA 4JYZA 2VC1A 2IX9A 2OD7A 2GEBA 4NCNA 2DKOA 5IDWA 5FAXA 1XGMA 5CDFA 1TMKA 3NOOA 4JC0A 3RFTA 1ORRA 1MGPA 5LGNA 1F0KA 2PD3A 2D5CA 4KLNA 5NLLA 1FTWA 2ERYA 3RJMA 4ZKEA 4JSTA 4JHLA 3IA7A 3LCMA 5JYEA 2AQIA 2E2JJ 1S7AA 3D4IA 2WTEA 3NHSA 3T9BA 1IATA 3ZH2A 2F4NA 1I0IA 2XODA 1JA1A 1Y5IA 4ZVPA 4UKDA 1CDEA 3K10A 3F71A 3MD0A 3VR5D 1EK1A 4DYCA 2FRHA 2X6WA 1YRAA 4J4BA 4ZEMA 1PW7A 5CNJA 2VBYA 4PDKA 2JFGA 2PXAA 5DHSA 1RKBA 1Y80A 3REFA 3UUWA 1TIPA 1SCNE 2CE7A 4D5EA 5DISB 3DC2A 4LC9A 1MA3A 2E87A 2Z3VA 1ZRDA 2ROQA 5JASA 4TROA 1A88A 2XT0A 3WGLA 3JZFA 2IU4A 2HDCA 3DBHA 1CT9A 2I7VA 3C48A 2VN8A 5C5CA 1RKWA 1HLGA 2IFTA 2LDXA 2NACA 4LJ7A 1V9LA 4OB6A 2OV7A 5EGOA 6PAXA 2FWIA 4R9SA 3IOMA 4CCAA 2MGQA 3VYRB 1V16A 5DHRA 2X22A 4FILA 3OPYB 5HSGA 2FW7A 2X9DA 2HA7A 2DR2A 1SFOJ 2A1TS 2EU8A 4PPYA 2AOVA 1HH4A 2XGOA 4RHFA 2AOTB 4X54A 2C2BA 2PUHA 2WA1A 1YGPA 2FN8A 4LNHA 2H63A 1HDDC 3D9QX 1WDWB 4LHWA 1JHPA 2LF7A 1MOQA 4R1OA 3T4UA 1RFLA 4AWBA 4DY6A 2B25A 1BXRA 4MRSA 1SO8A 4W8GA 4LVNA 4ZKDA 4HF7A 4B17A 3FMVA 3A9UA 3O2PE 4PXAA 3U2QA 5FLXK 1T9KA 1W88A 1N2CA 2OLEA 3M4XA 2VDLB 4LE2A 4ZVQA 1CQJB 1X7ZB 6GPBA 2IH4A 3VU9B 2XMCA 4HMPA 3STYA 1QVZA 2YINC 3HIFA 2GJAA 1MNQA 4WDRA 4E0BA 5HM8A 4IOJA 1LEHA 2QP4A 2WF5A 2CMDA 2HGZA 2ZYIA 4GBGA 3RC7A 4GI1A 3U9TA 1H9AA 4XSXF 1ZGWA 1CK4A 4NP6A 2BR5A 3FCUB 3M5DA 2OVFA 5FI5A 2KJBA 3LD9A 1TK2A 4DJ5X 1TKAA 1Q0ZA 3LP8A 5IC5A 1W7PD 1TAGA 3GQBB 2FHPA 4MS3A 3OCCA 4M6WB 2DA6A 1TMGE 4H4KC 2CZCA 2WZDA 3DAHA 1EA7A 1KEZA 3CZQA 3OIFA 3WBBA 4K9RA 2QTLA 5A7HA 4W1QA 5I9MA 3ULQB 4JBWA 3LOCA 2Y9MB 3ZY3A 1WTCA 3JQ6A 1B2RA 5ALPA 3SX4A 1QRTA 3A70A 1VKHA 4AVPA 2B4KA 4EATA 3SXUA 3PNQA 4WGFA 1KO5A 5TGDA 5HFAA 5EFOA 1Y9ZA 2HNBA 3E4CA 1JUPA 1AGRA 3KB8A 3WL4A 3I1FA 3CWQA 4R8SA 2LP4Y 2OC9A 4IGFA 2FRVA 5LUAA 1J5PA 4KSYA 4HDKA 1L8OA 4RJLA 1DC4A 4X61A 3TM5A 3M6VA 5ENDA 4NPHA 4CKEB 3INRA 4BS9A 3LL4A 2BMVA 5IT9A 4OBWA 4UVIA 1T9HA 5KMGA 2V97A 2BMWA 4TLMB 2OHGA 1JR4A 3C8HA 4V24A 4JOMA 3OX1A 2DERA 4DR7B 4RB1A 2GXSA 2VYVD 1L7VC 2FWMX 3C7CB 3IC7A 1NXSA 1U9YA 3N87A 1UMQA 3UTDA 1ULYA 3D8SA 4RLHA 2I9PA 3PQDA 2I99A 3NQOA 3LC7O 1YS6A 1H0SA 3BPXA 3S1NJ 3O0DA 1T0IA 1FTNA 4FCWA 2AG8A 2R5NA 1NMXA 2OQVA 4AL4A 2BYVE 2WSSA 3R5XA 5IHXA 3S2WA 1E2LA 1WXWA 1V1MB 1C4WA 4LECA 2WV7A 3A11A 2EJTA 1ZD8A 1Q44A 3LLUA 1ZA2A 5B64A 2XMPA 1I0LA 3AT1A 2W84A 2ONZA 3EUWA 3HKEA 4GM1A 3NKLA 3UMMA 3K0FB 4FT2A 4GT1A 4XD7A 3ZDDA 2VYVA 3ZXYA 1S2NA 3WB0A 4BPBA 3DQVC 1WETA 4IHTA 1N3YA 5JROA 1OVMA 1NRIA 4M1MA 3WRYC 3ZWBA 4I98B 1NF3A 4I9NA 5L3ZA 1GV2A 2HBZA 4UCFA 3LZCA 3I2HA 4EHNA 5IYDJ 1UM9A 4BBPA 1VMAA 1U5TB 1V8DA 2I7TA 5FD6A 3T9AA 2I6TA 1JKQC 3RTGA 2D0IA 3WYNA 5JQGF 4ZIRA 1ZIPA 3PSHA 4IXMA 3JALA 4AS2A 2XCQA 2BBTA 2ZE7A 4FBGA 3A4VA 3TB6A 4BFCA 4CCJA 4UNOA 4NXNB 4P7JA 5LP6C 1FVXA 5IVIA 4IX7A 1NQOA 1L8QA 2GQ0A 4QHTA 4PHTA 1ZJ4A 1QRDA 4DR1B 3NMUF 4JNCA 1I2MA 3ZDAA 1K66A 3SS7X 1GVDA 4I4IA 1UBLS 1USVA 1E59A 1C30A 4JENA 4EO7A 2HRZA 1QC5A 1AA7A 3WTCA 3H05A 4XQFA 2PMFA 4YB8A 1H2WA 3A4CA 1LQ2A 3CUUA 4LGMA 5EHNA 2P2SA 5CH3A 3RBZA 4FINA 4BEVA 3DSRA 3CNBA 5DYTA 5DNYB 2P0EA 1V5FA 2GVDC 4TKLA 4YAEA 5I7FA 1UBOS 4ZQEA 5ESDA 4PZCA 1R4MA 4QG7A 3U4AA 1ZKGA 4Z4EA 1X6VA 4JBHA 4KFUA 2O57A 2WF9A 4KJXA 4CTKA 3VO8A 1VSUA 2C8KA 1EE2A 1JSCA 4NULA 4F3QA 1EFCA 5F1YA 3SSMA 1N9GB 1M7GA 2XXJA 2VRBA 4QLOA 2ZSUA 5B7GA 1NUSA 4YJFA 1QUFA 3HOXJ 3NUGA 3EAFA 1TQHA 2JGIA 2E85A 5TQ0B 2ISZA 3UPTA 1RWVA 4COOA 2RKWA 2IUEA 4FZVA 3C6ZA 3ND7A 3P5JA 4HTFA 1EH8A 2HCBA 4HNUA 1M2VB 4CKXA 4DLXA 2K4JA 4GZLA 2VSYA 2RQQA 5CNMA 4CM8A 4DCJA 1EF4A 2XGMA 3HNRA 3TKAA 5L53A 1UJ4A 2VWGA 4YLGA 1PWHA 5AONA 1HE8B 3G79A 4QAJA 1KONA 2FE4A 3HN7A 5TF0A 1NVTA 4I1PA 4R8HA 3I2JA 4Q1DA 2QJFA 1EH7A 1MMDA 3CGWA 5GQSA 3C41J 2VP4A 3ZE6A 3G0GA 4A5OA 4GYKA 1JKFA 4NNPA 4DMFA 2UVPB 3CH7A 3A6LA 3T1QA 1OPRA 2YU3A 3W8EA 4BLWA 2FQ1A 1OLUB 3KR2A 3L5OA 2XCRB 1Z6QA 3P2YA 2BHYA 1E4OA 1XPXA 2IODA 3C5CA 4N4AA 4YJGB 1JFTA 5CITA 1W9MA 2E2IJ 1IBRA 2A0KA 4CIVA 1I32A 1PNVA 5I7WA 3KQPA 3QQ5A 5BN1A 2DY0A 1WOYA 2O3TA 5EDNA 1K7EB 4XR4A 1GYRA 4MPDA 5J59A 4HS9A 3C3XA 3EOBI 4GOJA 3TDNA 4QJ3A 5HPYB 2AHRA 2O1WA 3QVUA 2OXTA 4MEAA 1E9AA 3IOYA 5DPMA 13PKA 3RVKA 3TOXA 4EUEA 2YU9J 1DP4A 1B72A 1MO2A 1OOEA 2D74A 3HO8A 3TH5A 4JZKA 2JIRA 5L3VA 3IKTA 3J81k 1PEKE 2GPTA 4V0OA 1B1BA 2XUGA 4YRFA 1VJ5A 1GGEA 1U7WA 3ASZA 3QXJA 1BA2A 1O4WA 3PQ7A 4IHJA 4MHOA 5F78A 2X51A 2X8AA 1QXSA 2E2WA 4UMDA 4XIJA 3UK0A 3WMFA 1OX5A 3EXG2 4RZQA 1AGNA 4ITRC 1W4BA 1RCUA 3GO4A 2JLUA 3LOUA 2XSZD 4I36A 1SZCA 1VGQA 3WKEA 5L9AA 4FKMA 5F7XA 3PX2A 4HAVA 3HCBA 4RB0A 4RA6B 3VZCA 3GC6A 4YP0A 4HF1A 3X2SA 3TW8A 3SBOA 2CCJA 3NDJA 2DFLA 4LZWA 2WJ3A 1HQDA 3KXIA 2Q8PA 1HDRA 3L07A 2JI4A 4UM9D 2AX3A 5DHUA 1QP0A 5JJIA 1I8TA 2ZZNA 3WTVC 5DHQA 5DMHA 1WJGA 4ME6A 2WE7A 5ED4A 5EUCA 2PGLA 2WQ6A 3AZOA 3KLBA 2A69F 2XKPA 1ZOSA 4JROA 5E8JA 4OIQF 1N5IA 3T3HA 4AUEA 1MMFB 3NRVA 2RJ3A 5KTTA 2BGWA 3ETGA 2JATA 3S1AB 2ZTSA 3NASA 2R7LA 2DHCA 3PNSA 4UUPA 4B3CA 1ZGJA 1QYVA 5EP4A 1HETA 1RQXA 2QBYB 2JZYA 1KH2A 2VSNA 1B0AA 3C2QA 3CG0A 2PQ0A 3OCZA 2L7KA 1DCKA 3KFVA 2Z2ZA 4OG2A 4TTAA 3VR4D 3K9GA 2LUOA 3ZWXA 5KSOA 2GN0A 3ZHYA 1XOIA 2D1VA 3E3NA 3I9FA 1OH5A 5EIBD 5J1SB 3MFYA 3DR5A 1UH5A 2F6RA 3FWPA 3TGLA 2O9LA 1CV2A 3TAHA 2WILA 4ZOLB 5JWHA 4B2IA 5AVWA 3V1UA 1LD3A 3BT9A 2E1CA 1P18A 5L7YA 3ABZA 4BKUA 621PA 2YJ3A 3SJZA 4EPWA 1ANKA 4B3GA 2C2GA 3JSXA 3EVZA 2Q5HA 1UDAA 2BE5F 2GEDA 4N8EA 1AKYA 5K8CA 1KDVA 3SQXA 1BN5A 4D9NA 1L3CA 5KOJB 3KTFA 2HWXA 1B1CA 4AMZA 4M0DA 2J85A 2ZPTX 4K6FA 3TZLA 4LG0A 1G5HA 3OFND 5ICSA 1GNPA 2BTQB 2G80A 2LNDA 4QDXA 3V00A 1ZW1A 5MGBA 4AU7A 2HM7A 1IVNA 2CF6A 3CO6C 2QN3A 3IE2A 2M5WA 4K86A 3U44B 1ND6A 1W46A 3WGYA 3ORFA 3OQHA 4QQFA 3DQZA 4UHFA 4HQMA 1SCJA 3WKDA 3Q3SA 2QY9A 4K6KA 1AU7A 5HK9A 4H7HA 1W1WA 5EXSA 3BLYA 3LDAA 4ZT3A 4L0YB 2FSHA 2OBBA 4NBWA 4V0LA 4DA9A 4JLJA 4B4DA 4GZ3A 1A4UA 4KR7A 3KUXA 2AG0A 2GZHA 1C2TA 3WWOA 5IN4A 4OP3A 4P1WA 1J21A 1W76A 4I5IA 2XJ9A 3K96A 3H2SA 2L7ZA 3HCCA 3L43A 3PHHA 4LI3X 4LV8B 4UFOA 4E15A 1BCSB 2HF7A 4Z86A 1D5WA 3CX3A 3I4FA 2O5EA 3L6RA 4I0WB 4EM2A 1NRWA 1IRXA 1QGAA 4JLMA 4PZZA 5LUBA 2W42A 1Q22A 2VP6A 4O59O 3AVYA 3GFLA 3AO0B 3MWDA 5J8FA 4A3DJ 4PX9A 3UVEA 3AVVA 2AR9A 1ORWA 4TLEA 3KLOA 4WNYA 5DTEA 3HSFA 3M70A 2Z99A 2R5WA 1VFPA 3PIDA 1CCWA 2VPZA 5JRJA 5K8UA 2MU1A 2YV4A 5D8KB 2GQQA 2LR8A 1P6RA 1BS1A 1HG1A 3HADA 3LWNA 4AG3A 1G8KA 4CKCB 4PYLA 1K79A 2ZEJA 1R5OA 3A32A 3FX2A 1ZMXA 3FG9A 2YXNA 3X43A 4E6EA 4PBTA 1NL3A 4A69C 5EAIA 4KE9A 3TRFA 4ZCLA 1ADCA 3E3MA 1NNSA 3ZDQA 3BWYA 3HY3A 4KQKA 1NXVA 5KJ6A 4ND3A 1JHAA 3JYHA 1R0WA 4BACA 1XKLA 2WY2D 4MRVA 2BGCA 1AVTA 4L0MA 1P77A 1HDEA 4EM1A 1YV9A 1C7RA 2R66A 2X3UA 3Q0IA 2ZSHA 4KIUA 5CAEB 4BQIA 3SKYA 4I7HA 1UKAA 2AUMA 3DE6X 3VOSA 2NMVA 4HRXA 4P81A 3TD9A 2IYNA 3NHZA 1QGPA 1QNTA 4E7KA 2XE8A 1FXUA 3TMYA 2CW0F 2NVUB 1WF6A 1R0RE 2PWAA 3FXAA 3U09A 3ZKAA 1GPMA 3N07A 2IKSA 1Y8AA 3KP4A 3CCEI 1YR3A 1NM5C 1YU6A 2C4WA 2QLTA 4MQVA 1J00A 2O20A 3Q5EA 4FFNA 4BZWA 4MTDA 1K7YA 2KZGA 2C5GA 3JV7A 4UPDA 1ATIA 1RRVA 2XUBA 2BFWA 2BHTA 3LUCA 4Z8XA 1NT4A 2PKCA 3EDMA 4MS4B 4BLOA 1GKUB 5GONF 4H3HB 1HOXA 1TL7C 3ZV3A 3OP4A 1C3VA 2ZB2A 3JQDA 3PENA 4RVGA 4TT8A 5T3UA 4LFCB 3GU3A 4AY5A 3GTJJ 1YJ8A 4S24A 2NSYA 1L5MA 2AWNA 2BKUA 3PWSA 4NU8X 3LFTA 4RW0A 1N0HA 1QBKC 1SHZA 3GO5A 2FSPA 4ZALA 3CLUC 1PS8A 3KU1A 3WYGA 5EJ6A 3IFSA 2GK7A 4RDIA 1J8DA 4L9RA 2NUPA 5HWSA 1QZZA 3KOZA 5J2UA 2BEUA 1PUEE 1MOPA 5IP7J 1BH6A 1ESCA 4MOWA 3M3PA 1C9JA 1WTAA 1YA8A 4UAUA 1BA3A 1M1XB 1ZL0A 4M7PA 1KS9A 2CQXA 1EINA 3REQA 1LKXA 5CFLA 2MD0A 4OGKA 5MDHA 3LSRA 1G3SA 1LBIA 1T35A 3ABLH 3IPYA 2DBYA 4IDEA 4KPUB 4YAJA 4LY6A 1M0EA 4IO1A 1L4KA 5L3GA 3DD5A 1GZHB 3ANYB 4WXCA 1H0MA 3UWPA 1TFUA 2I33A 4Q02A 4DXHA 1DC3A 1GLNA 1A2BA 1UAAA 1N2BA 2JGLA 2QTHA 4LYYA 2ZB4A 5M3MJ 1L4HA 3BM5A 1JEYB 1Q0UA 2YZNA 4E22A 3COYA 3VC7A 1MPTA 4FD3A 1FMJA 1S3GA 3L8CA 1FU8A 5A1TA 5K5EA 1I5ZA 1T2UA 2ZIZA 2OCXA 2W6PA 2ZDQA 1GAJA 4MRPA 1LZKA 4L9AA 2B8NA 4OMCA 4TL9A 3S1AA 4DNXA 3OZAA 2GIVA 1Y5MA 3CSDA 3DAPA 4ECEA 2ID3A 2ZRKA 4JP1A 4DQ2A 2UXDB 4ZH4F 3O8LA 3KIPA 3RASA 4B31A 2PZLA 2DT6A 1ELOA 1MX1A 4NFHA 1SC1A 3HUGA 4H6WA 5AKEA 1KJYA 1NG6A 4N76A 1QO9A 4GI3A 2C98A 3ASYA 1RXYA 2AC2A 3PUJA 4RL6A 4DAEA 2HWKA 5JAIA 4LJ8A 2XASA 3BMOB 3D0KA 3MMPA 3EZNA 2ZI4A 2DFEA 3PZBA 1EXMA 3EGOA 1N8TA 3J7AY 2JFHA 3GT3A 3KXKA 3N74A 1E3SA 3NLLA 1U9IC 4NYJR 2XVYA 1CWUA 3THWB 3D1NI 2L3DA 4QQRA 2JCBA 2EHDA 1GT6A 4NNJA 1GV0A 3KS9A 4YASA 4JEHA 3Q0EA 4OUDA 3BCAA 2XGEA 1XAHA 1E3WA