1QZZA

Crystal structure of aclacinomycin-10-hydroxylase (rdmb) in complex with s-adenosyl-l-methionine (sam)
Total Genus 111
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
111
sequence length
348
structure length
340
Chain Sequence
LEPTDQDLDVLLKNLGNLVTPMALRVAATLRLVDHLLAGADTLAGLADRTDTHPQALSRLVRHLTVVGVLEGGEKGRPLRPTRLGMLLADGHPAQQRAWLDLNGAVSHADLAFTGLLDVVRTGRPAYAGRYGRPFWEDLSADVALADSFDALMSCDEDLAYEAPADAYDWSAVRHVLDVGGGNGGMLAAIALRAPHLRGTLVELAGPAERARRRFADAGLADRVTVAEGDFFKPLPVTADVVLLSFVLLNWSDEDALTILRGCVRALEPGGRLLVLDRADRFFSTLLDLRMLTFMGGRVRTRDEVVDLAGSAGLALASERTSGSTTLPFDFSILEFTAVS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structure of Aclacinomycin-10-Hydroxylase, a S-Adenosyl-L-Methionine-dependent Methyltransferase Homolog Involved in Anthracycline Biosynthesis in Streptomyces purpurascens.
pubmed doi rcsb
source organism Streptomyces purpurascens
molecule tags Oxidoreductase, transferase
molecule keywords aclacinomycin-10-hydroxylase
total genus 111
structure length 340
sequence length 348
ec nomenclature
pdb deposition date 2003-09-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00891 Methyltransf_2 O-methyltransferase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 1qzzA01
3.40.50.150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Vaccinia Virus protein VP39 1qzzA03
4K2EA 1RIOH 5K5OA 1F3LA 4RTSA 2HYFA 3WTYC 1O9HA 4GUAA 4GO1A 1B9MA 2XROA 4XUCA 1R5GA 1HSTA 3BP8A 4L9TA 4OIQF 1W7PB 3F8CA 2G70A 3BPVA 3V8KA 4KN4X 4Y30A 2R7DA 3E6MA 3FMQA 2UXNA 3E6CC 5FADA 2NYXA 3MZYA 3SZTA 3QRFF 1OYIA 2FQ3A 4AUKA 1OYYA 1EH6A 3J7AO 3I53A 3U2RA 2AOXA 4M71A 3B3GA 2QVOA 3HVHA 1U5TB 3WTTC 3AXTA 2XVCA 3UZUA 4CXMA 1XSDA 5DEQA 4LLGF 2DULA 3HVIA 4YFKF 4RTRA 2QQAA 5FD5A 5HLIA 1ZARA 4FHTA 5IT9Z 2AOVA 3ZN0A 1EJ6A 1XXLA 5D1HA 2K7LA 1XDUA 4G94A 4MEYF 3K1NA 3ZMUA 2RQPA 4IV0A 4XUDA 3WU0A 1SD4A 3W6JB 4MHGA 1LB2A 1CF7A 4RTJA 1O9GA 2BZGA 4HF0A 4C4AA 4H0NA 1L0OC 1RNLA 2B78A 3PVCA 1TNSA 4BP3A 5KVRA 3PQJA 2DAOA 3Q9SA 4WXHA 2PFBA 5FTWA 1HXDA 1DDNA 1EQAA 1KHHA 4X1OA 4M9SA 1XN7A 5EG5A 3RPUA 3HCEA 3KPVA 2PJDA 3WTXC 1JHHA 3SX0A 4MTEA 2W85A 2XYRA 2MH9A 4KN7X 2PT6A 2YX1A 4QVGA 5D8LB 1TW3A 3G2QA 2RV8A 2FK7A 4ER3A 2QM3A 5FO5A 1JTEA 2HQNA 1BN5A 4JK1X 2GXBA 4EM2A 3F8FA 4RTQA 1EIZA 5E2BA 4WX9A 3JWHA 4FZVA 4HBLA 1BOAA 4YMGA 2P40A 3I59A 5H6QA 4QWQA 5EMLA 3CUQA 3NQOA 3T1BA 4MTDA 3MEXA 5L3DA 3T0IA 4RTPA 3CTAA 3LAJA 2Z6UA 1W7PD 4LMYA 1T6SA 2HGCA 1VLMA 4MNUA 1XSXA 4CKCA 1UHMA 2O03A 4LG0A 1K79A 4HX4A 5P8WA 3L2CA 2XBMA 3WE2A 4FX0A 2L4AA 4PCLA 3FM3A 4RVHA 2IJLA 2ADUA 5GP1A 4AX8A 5F2NA 2IPXA 4UHTA 3P2KA 1WKMA 2AXLA 1L3LA 3R0AA 2PLYA 3RPQA 2DPDA 4YFXF 3K9TA 3ER8A 2P6TA 4LK1F 1PUEE 1STZA 5K05A 5JFRA 3D5LA 4FSXA 1Y0UA 1UIRA 5FHQA 2Z99A 1KU2A 3BUSA 1Q0TA 1WSUA 4OA5A 1SUSA 3FUUA 3V4GA 5LQAA 1KU3A 1G3YA 2WK1A 3OZSA 3CKKA 1CGPA 1VQ1A 2QY6A 3ELYA 3P9IA 4PGGA 1PP8F 1Z1DA 5KS2A 4M38A 2L54A 4DNCA 4D0PA 5DLYA 3RYRA 3K69A 1X1CA 1AF7A 2P8TA 1VBFA 4V0QA 5CVDA 1B4AA 2XUBA 3ELWA 3UJ8A 3A27A 1O7LA 4TV7A 3ZN1A 4A5MA 3LHDA 1ORHA 2IGTA 3IEIA 3UJCA 3BGDA 4R8SA 3NWEA 3ISPA 5DTQA 1KYZA 3PFGA 4XBFA 2BH2A 4GF5A 1G3WA 2JHAA 3KLNA 4HX8A 3P9CA 2L4MA 5EIWA 2FOKA 5K0GA 2JHCA 1IXKA 4HV5A 4E70A 2ZSUA 3EGIA 3P2IA 1I27A 1QAOA 4YUXA 2GPYA 5LRSA 4RTKA 1FOKA 1R1VA 4X41A 5EOVA 5BMZA 4L9JA 4A0ZA 4EJVA 4HGZA 1YFJA 1DL5A 1FT9A 5K0JA 1IN7A 1LDDA 2K86A 2JZYA 2BBYA 1P2FA 3E8SA 1G6Q1 1V39A 1YZ3A 1MKMA 2K4BA 1H0MA 4RVFA 4IF4A 2ZVJA 1FSEA 3IRQA 1XCJA 1OKRA 2P8JA 1VP9A 3SSNA 1HQCA 4FSDA 5ILVA 3TFWA 2V79A 3ERED 3HVKA 4BLUA 3M1EA 3NWBA 3DUWA 1R5HA 2H11A 4ER7A 5GWXA 4CWAA 3VOEA 1TQIA 4FT2A 2FNAA 3EVCA 2OYRA 1ZN2A 2YXDA 4UVAA 1XD7A 5CVIA 5H20A 4MIKA 3ABUA 3GCZA 2YX4A 2L02A 4KMUX 3KPJA 1YW9A 4RTNA 2PXXA 3BWBA 1TBXA 5T64A 2C7OA 2YX7A 5FA8A 3PB3A 3BGVA 3MCTA 4FT8A 4GOLD 5BXYA 1RZ4A 1WG8A 2GA9A 3PQKA 3ELKA 4XLNF 5K1YA 3VODA 1NW7A 2FF4A 2FBHA 4ESFA 1YS7A 3GNLA 3FRHA 4DM3A 2G71A 4RYLA 5KK1A 3R60A 4MEXF 2STTA 1SFXA 4ENJA 3F6OA 3BT7A 4YIFA 1T98A 4RB3C 4ESJA 2CW0F 3T0YA 3EYIA 1FZPB 4L7VA 5HS8A 5BOXA 3WTWC 3F4KA 3ZPLA 5BPDA 4Q4ZF 5D8KB 5C0OE 2FU4A 2G9WA 2WWYA 5CVVA 4YUYA 3NTVA 2F8LA 5LQNA 3M7GA 2H09A 5IH3A 3G8BA 2ZIEA 2JTVA 2HTEA 1HKTA 3GFJA 4Y15A 5LHGA 2OZVA 5DCMA 1SAXA 2CWEA 4I7HA 2JH8A 2E1CA 2IH2A 3T8RA 1ON2A 4LFUA 2H94A 3FMRA 3CUQB 4IRHA 1R6AA 3OFKA 5E1DA 2OO3A 3SGLA 4AZVA 1BC5A 3QU6A 1I1NA 3IL2A 5D1NA 4RGRA 3MQ0A 2OXTA 4KDPA 1UFKA 1JSXA 5HIMA 3GRVA 2NP6A 1UFMA 3KQOA 3FWEA 2F5CA 3GGDA 1O3RA 4G6QA 3MAGA 3RKYA 1ZYRF 1SUIA 3TDZC 3JAMK 1FLIA 5HFJA 5MHTA 4U0YA 2I7CA 2OKCA 5L3EA 4B17A 3HRSA 2HWVA 1HKQA 3LDUA 1WWXA 3GDHA 4PYLA 3P71T 3FXQA 2DQRA 2PQ8A 5K0LA 4UUVA 3HRTA 3SVZA 3SXJA 4CDGA 1LQ1A 4XLPF 3OU2A 5L3BA 3IWFA 3CLOA 3J81Z 2Z9OA 1J7KA 4AVPA 2AZTA 4CYDA 5HDKA 2UYOA 3CVOA 1JQEA 5LSAA 4HH4A 3SQNA 1S7OA 2ORED 1L3BA 4X63A 2CGPA 2HNKA 5DRTA 3UJ7A 4LWOA 5BP7A 4CTKA 5HZMA 3O2PE 2ZXJA 3DEUA 5DCMB 2VT2A 1AV6A 2DK5A 5EGSA 3DLIA 4MHTA 1FY7A 3KQSA 5E8RA 4G9YA 3M6WA 3MQ2A 1TW2A 1NT2A 3EEOA 1XDSA 4I02A 2M8EA 4CZZA 2VZ9A 4ATNA 3OZRA 2FHPA 1TLHB 4PIPA 3A4TA 2RVCA 4RVGA 1Z9CA 2PX5A 4NECA 1ZG1A 1WZNA 1K78B 5DX0A 2GIVA 4M7RA 5EMJA 4RVDA 3MWMA 4DCGA 3C7JA 2Y0MA 2NRAC 4PYQA 2K02A 5LEKA 1ZREA 1I1SA 2XAHA 4Q5SF 3HTUA 3NJRA 1L3CA 2JH9A 2ESNA 2IRFG 3E6BA 2EX4A 4IV8A 3ZQ7A 2PBFA 3UA4A 3TRKA 3G5LA 5DUKA 2PSSA 1LJ9A 2H6BA 1U5TA 5HLHA 4I0BA 1NW3A 4R79A 3RTRA 5DRYA 2AN3A 1ODDA 1Z91A 4Q48A 4P5OA 1BBYA 2R6ZA 4OBWA 4YUVA 1OR7A 3IV6A 2XIGA 5HOQA 3ER9A 2UYHA 2QZ8A 1YIOA 5E1BA 1SFEA 3IC7A 2J5OA 3KQPA 4GOMD 2PI0A 4U7PB 2HR3A 3DXJF 2QRVB 1D2GA 3CJNA 3IKVA 4KRGA 5AONA 3A25A 3UFBA 4RAZA 4YUWA 5HS9A 2GA2A 1ZG3A 5E1OA 4WCGA 4KT5C 5HVQC 1MJAA 4ZYGA 2MC3A 3OU6A 1SFUA 3K1PA 2XAFA 1RUOA 3GRRA 1B59A 2P4WA 2YR2A 5HIJA 4AIHA 1F4KA 3EMDA 3FUTA 2VBXA 3RJPA 1H9GA 5JVTA 1YYVA 4Y13A 1MDMA 5AIQA 1H1DA 1F5TA 3LKDA 3KR9A 2IPQX 4FGZA 4QVKA 3TOSA 3UA3A 5J8CA 3TM4A 2Z6AA 2M5WA 5LQRA 3IYLW 3MCZA 3TQNA 1XGOA 3THRA 3MAJA 4X61A 2FCAA 2ACJA 1MHTA 3KZZA 4HA8A 1IN4A 4EKGA 1IUYA 3M6VA 3NEUA 1IRFA 2QE6A 2V6CA 2CQKA 3FM5A 2P7HA 1G8SA 2OZUA 3M6XA 4QPPA 5H02A 4ZZLA 2EB7A 5E9WA 1YQAA 2E7XA 1SG9A 5ICEA 3CO6C 3ABTA 3I4PA 3OCJA 4P9UA 3PFHA 3QV2A 5FULA 3GRZA 1ZHFA 1FJXA 4AD9A 2VOPA 1X19A 5DD4A 3SFZA 4Y17A 3U81A 4C04A 2QENA 3C3WA 4FS8A 1EAMA 1QAMA 3K0LA 3HHGA 2HS5A 4EGYA 3JSPA 4L9NA 4L5JA 4P7KA 1N7IA 1D3YA 2EJTA 2F5FA 2AVNA 5BPIA 2FRHA 3ID6C 2HR1A 3HRUA 3AWIA 1L1EA 1P39A 5EEGA 3SXYA 2CMGA 3FMSA 3LWFA 1R74A 1QQIA 2FA5A 3MB5A 2XV4S 4CO8A 4E32A 3I5UA 2ZNZA 2PY6A 1C0WA 4GOOD 1TNTA 1P91A 4HV6A 3TO6A 3ERCA 3S2WA 4XSXF 1HNNA 2P5KA 3M6UA 2HOEA 1XGSA 3DULA 5FLXZ 3F21A 4G7HF 5LGUA 2OZ6A 5EQJB 2VN2A 3T7RA 1AWCA 2PMUA 2ZKZA 1QO0D 2BR4A 1WS6A 5HDGA 2CO5A 1O3SA 4CKEA 1SMYF 4UVBA 2O0YA 3GZ6A 3LCCA 2GAUA 2IFTA 3RKXA 2C7QA 5DM4A 4I98B 3O4FA 1M6YA 3PS9A 3AAFA 2WTEA 2N47A 3G2PA 4AIJA 3FPHA 3UJ9A 5GINE 2LKPA 3HCDA 2Z3YA 1P1CA 3LAPA 4U7BA 1IZ1A 5D6EA 1NBIA 4XUEA 1Q0SA 1KQ9A 3WGGA 8MHTA 5LRRA 4BLWA 5DYMA 2PXAA 1RUNA 3KQQA 3MTIA 1FYLA 2KRFA 5LQUA 2A3SA 4M9ZA 1EV7A 4K6MA 3E6DA 2ZMEA 4EGZA 1QZZA 3GYHX 3ME5A 3I71A 3G7UA 3KR1A 2FRXA 5J8FA 3OPNA 4MTLA 2V9VA 2HQRA 3NDIA 2ETHA 4GYIA 5IT3A 1U3EM 4P7JA 4ASNA 5K0BA 3R0JA 2BM9A 4O5VA 2W24A 4DQ0A 3F22A 1WXWA 2K4MA 3M9AA 1G6NA 3TR6A 3F8BA 2M30A 1XCBA 3E3VA 5FA5A 2CL5A 3R0QA 4KVZA 5E9JA 2GLUA 4DMGA 4PCAA 2PXCA 4P7GA 1T39A 3G88A 4KDCA 1Z05A 1XSVA 3DMGA 3HSFA 3J80K 2NXNA 3KP7A 2AS5F 4PONA 4P9FA 5E1MA 5ICFA 1XJ5A 10MHA 3G5TA 2EJRA 5KVAA 3LBYA 1BIBA 2I9KA 2I6GA 1YTYA 1H9TA 3BXOA 3CJRA 4JBAA 1K78A 3G3ZA 1D8KA 1I4WA 4YMHA 1XMKA 3QPHA 1J59A 3GRYA 3UBTA 3BKXA 3DH0A 3NDJA 1SQGA 4L0ZB 3L9FA 4AZWA 4M6XA 5LHIA 3LA7A 3GF2A 2O6GE 1D2CA 5D5VB 3EVFA 3DXXA 3OE4A 4WWCA 2W25A 2OQRA 4HTFB 3GEZA 3HTXA 3UJDA 1EJ0A 1AOYA 5E20A 3KR0A 3RKWA 3REOA 4OOIA 5HDNA 1OR8A 5D4SA 1ZLKA 2QBYA 3HM2A 1YUBA 3IHTA 2FPOA 5DXAA 2P6SA 1DPRA 3KR2A 5FWAA 3VYWA 1J0RA 3CBGA 2D1HA 2Q8KA 2QUFA 2IW5A 3R9XB 2G8NA 4LB6B 4UV8A 4C05A 1YS6A 2OY0A 2PVCA 2UYCA 2XVAA 3T7SA 3UJAA 2FE3A 1USTA 4RSRA 1EH7A 4MWZA 5K0NA 5L3CA 2EK5A 2DO7A 2VBYA 1BC8C 1JHFA 1U6GA 5DDGA 2A61A 1LEAA 2ISYA 4F84A 3HNRA 2WV0A 3A26A 3GRUA 3O6BB 2PN6A 3HTSB 3ROUA 3ZMZA 1FP2A 1FWZA 2ZULA 3CJQA 3KP2A 2BV6A 3M4XA 5ERIA 1JG4A 2LF8A 2Z6QA 1GXPA 1REPC 1KPHA 3CCFA 1TQMA 4ESBA 2XVMA 3H2BA 2DPMA 2VOOA 2A5YB 3DMHA 5EZQA 4BAYA 3TMAA 4QLCU 4RWZA 2VE8A 1P1BA 1U5TC 2VT3A 2IDKA 4FT4A 2P5VA 1XGNA 3FXUA 3DR5A 2XHKA 3NRVA 4OMZA 4EJWA 5T6BA 1KYWA 4QTUB 3R3HA 1IF1A 4HRAA 3F72A 2OAZA 1R18A 1LDJA 2O06A 3HA7A 2JJQA 5E8JA 2ZW9A 2AOUB 3EDPA 3QP5A 4GOND 4CHUA 2HFHA 2QYOA 5TJJA 4HDVA 1B6AA 5EHIA 3PTAA 3V8LA 2EG5A 3C6MA 1JE8A 2HWKA 5LQKA 4OX9Y 3HOTA 3ZMVA 4EJTA 2ZIGA 5J6XA 3MZHA 1BM9A 1D5VA 5GIOE 3FPJA 3KP5A 3JWGA 2R3SA 4L0YB 3EGVA 3KZYA 3C18A 2OU2A 1GVJA 3B3JA 5DM2A 3PLAE 1QAQA 5FQNA 3JWJA 4OINF 1B1BA 3B7PA 4UNOA 1G8AA 1PP7U 4M72A 2IH4A 1O7FA 5FFXA 3G89A 3MGGA 1NW5A 2OB1A 4GYGA 3SHFA 5M5BA 5ICGA 2H00A 4RGUA 2Y1WA 3E05A 4R1HA 4RAYA 4B09A 4KMFA 4DQ2A 2ELHA 3P9NA 3BOQA 4E31A 5CVUA 1BJAA 4QQKA 3CC8A 2KKOA 1T0FA 1RI1A 1QYRA 5DD8A 2I62A 4PGHA 3LDFA 5DM0A 3VC2A 4PZJA 1DCTA 3JW4A 3CJTA 5GM1A 2MBFA 2FMYA 2DPUA 2ERCA 3SR4A 4RS8A 5E17F 3BY6A 1JG1A 5CVRA 4RB1A 1IXCA 1HW5A 4KIFA 2AR0A 3DV8A 1KP9A 5EHGA 4I01A 4XRFA 3LKZA 2B2CA 5EEHA 3AXSA 1K6OA 2PWPA 1VIDA 1B42A 3C0KA 3O3KA 1NE2A 4MQ4A 4G7OF 3MTEA 4LK0F 5U4XA 4IHSA 2HZTA 5K8VA 3SSOA 3FF5A 3C3PA 3EPPA 2EFOA 3HHHA 2YVLA 2K4JA 3DFGA 2COMA 4EJUA 3E23A 2BR3A 3R61A 1HW1A 2JG3A 3ORHA 3GLXA 3CDHA 3F3XA 4PCQA 3BWMA 2PLWA 1IN8A 4RX1A 3KHKA 1UWVA 2IIPA 3OFJA 2NYUA 3U1DA 3HOSA 4KW7A 1GXQA 2MLGA 1R1UA 2ZFWA 3WU1B 5DWQA 2RGVA 2PBIA 4LG0B 1XGMA 1INLA 3NVKI 4ER0A 1QGPA 2BGCA 1I1GA 3IHUA 3J80Z 4HGYA 3WTSC 3KP3A 4KYWA 3V7SA 3KCCA 2PKWA 4U7DA 3BJ6A 1YLFA 4ON0A 3U9GA 2YXEA 4P96A 4OIOF 3P9KA 1SKMA 4YV0A 4AWXB 5IKMA 3KU1A 3LQRA 2W57A 2FBKA 3LSTA 1FNNA 1ON1A 1SMTA 1RJGA 1R7JA 3V7RA 2O61A 3F8NA 2H27A 2EA2A 4A6EA 4CKBA 1J75A 4PWYA 2B25A 2NS0A 2DU9A 3RI4A 1D2HA 2O57A 3I64A 2CKDA 1F9NA 3KKZA 4M9XA 2ZZNA 4GQBA 3FPGA 5JI6A 4IXAA 4UVCA 1ZKDA 5JR3A 4HTFA 2PX8A 3SSMA 3GIWA 1VL5A 3SZPA 3G2MA 1XCLA 4QDJA 2RN7A 2HMYB 1FX7A 5B1SA 2ISZA 2L01A 2IA0A 4R8RA 1FBNA 1TPYA 1VPTA 1Q1HA 3S68A 2GQQA 1I6XA 4L5IA 3FTDA 1QPMA 1DUXC 5CCBA 4ZH4F 2OA4A 3HSEA 2MA3A 2FXAA 2BYVE 1EH8A 4F86A 1KQ0A 1YW7A 1ZGAA 1EG2A 4IRIA 2AOWA 4CXFA 3JSOA 3C6KA 3R24A 1M0EA 4G6DA 2GH1A 5KQSA 3LCUA 3GX4X 1PJZA 4PYOA 3HA5A 3IRRA 4PNEA 2IA1A 4M6YA 1BC7C 2ADMA 1G4DA 1G60A 4LLLA 3BZ6A 3THSA 4KNYA 4E2ZA 1G55A 2FNPA 2PG4A 4RTMA 2LDUA 2ZJ2A 1BHJA 3O31A 2EA4A 4GC5A 3GFLA 1ZG5A 3B89A 1W4MA 2OPBA 2MLKA 2OQGA 2X0LA 3E5XA 5E9QA 3I58A 3RW9A 3E5UA 1NKVA 3T8TA 1G38A 1P6RA 5EPEA 1R00A 5KYGA 3VB2A 2CMHA 2P5LC 3EVDA 5CM2Z 1LNWA 1U2ZA 1IN6A 4F85A 1Y8CA 4IRGA 2DFIA 1IXSB 4KA4A 5F6FA 4MQ9F 5FLXK 3X0DA 3FYDA 5JUWA 1R58A 3TGNA 3Q87B 1P4XA 5DV5A 3OOPA 3HA3A 3K0BA 5DSXA 2WC2A 2VXZA 4DA4A 2LNBA 3FXRA 4PYNA 1MJ9A 2Z33A 4OQEA 5FD6A 4EM1A 2ZIFA 3P8ZA 1SQFA 3LGAA 1HMYA 3WSTA 3MFKA 3GFIA 1IN5A 4RB2C 1E2XA 5D4RA 1S6LA 5FWDA 3OU7A 1V3FA 3FUVA 3HEMA 3KPUA 4MGRA 5GOZA 4RTOA 3T7TA 1S7AA 2O3FA 3RODA 2D1VA 4YUZA 5E8IA 2VP3A 2R7FA 3I59B 4HOBA 3AY0A 3HCFA 1FYMA 3Q7EA 2F5EA 2G7HA 2DTRA 2EFJA 2NNNA 3GJYA 1ZQ9A 5L3GA 3QOXA 2M87A 5FGMA 1FBQA 5FB2A 5L3FA 4FP9A 1HKSA 1YG2A 3VFZA 3V8JA 4OA8A 2ZLBA 2DLLA 5HEKA 4C07A 3GUDA 3WE3A 2EV6A 2AS0A 2ZZKA 4HQMA 2RC4A 1VP3A 3BWCA 5LGTA 5LEJA 4HW0A 5LQJA 1BI0A 2BM8A 1KU7A 2C6YA 3GW2A 3K2ZA 1WY7A 4U0WA 3KPWA 4HLYA 4UOEA 1U2WA 5EC8A 4FR0A 2D2WA 1BI3A 1WQ2A 2L3DA 1XTPA 2JT1A 3ZMDA 1T43A 1JXSA 2RKHA 3HUGA 5JHUA 1U8RA 5DX1A 2G1PA 2DT5A 2FBIA 1BI1A 3EVZA 4DZRA 1IW7F 3R6TA 3TDUC 4AIKA 1AQJA 2E1NA 2EFQA 2PGXA 3HP7A 3CUQC 2NAZA 3EUHA 2Q0OA 5CIYA 1LEBA 2AVDA 2LD4A 3UJ6A 4F7ZA 3ZMTA 2Q41A 1QZYA 1FSHA 3GWZA 4C03A 1FYKA 4L9VA 2YR0A 5BW5A 2ZNYA 1DPUA 4WVLA 2XAJA 2E5WA 3BZBA 2EJUA 1ZRDA 4JXJA 1WRJA 4RB0A 3KQVA 3ML6A 1NHAA 1Z6RA 3LPMA 2DK8A 1CF7B 1O57A 3ANXA 2DW4A 5CJ9A 3KQYA 1I9GA 3TLJA 3B5IA 1RJEA 4HZFA 1R8XA 5C1IA 4R6WA 3QP6A 3Q9VA 1ZRCA 2D45A 5DUIA 2O05A 4I2OA 2JPCA 1PDNC 1RJFA 4ETSA 5CVJA 4GGGA 4G7ZF 2DBBA 3BJOA 2YU3A 3E97A 1XMAA 4WXCA 3Q5FA 2WA1A 3E5QA 5FHRA 2KW5A 5E1WA 4BH9A 1JTFA 1JG3A 2BE5F 3BWYA 1YB2A 3M33A 5DTRA 1NV8A 5HS7A 2NNWB 4YV1A 1IRGA 1NV9A 2RDPA 1MZBA 3KP4A 3MHTA 3EVAA 4BLVA 3VSEA 3DPLC 1ZLJA 5CVEA 3I9FA 5HLGA 1R36A 1J5YA 2HYGD 2KIFA 1QANA 4PDKA 4E2WA 3WGHA 2HKXA 2QLZA 4ISCA 1BI2A 4BHCA 4QPNA 3ELDA 2VDWA 3K6RA 4M74A 2DI3A 2QQBA 3UJBA 2H6CA 4R8HA 5K0EA 2A6HF 4PIMA 4G8XA 2P41A 2PT9A 1D8JA 2Q2EA 4EQZA 2P1DA 4AZSA 3KEOA 1ZRFA 2HKOA 3N4MA 3R6SA 4IJAA 3SM3A 5DX8A 4ENMA 2P3QA 1KIAA 2EFNA 5ILSA 2XGXA 3LX6A 4LLNA 4PYIA 2MH2A 5CD1A 3EETA 2F5DA 2RNJA 3GU3A 4WXDA 2YXLA 1BIAA 2G7UA 2UXXA 5FFZA 3HSRA 4R05A 1W5SA 2B9EA 3J81K 2VC0A 2NNYA 2LSOA 4M36A 1KR5A 2IT0A 3GO5A 1ZH5A 3F6VA 4M37A 4RGXA 1R23A 5F64A 2K27A 4A5NA 3V97A 3GZ5A 1U78A 2CSOA 3DPTA 1N2XA 2QRVA 1QNTA 2ONZA 2KJBA 4KFCA 2YUIA 5DTMA 2AOTA 3JAMZ 5K5RA 2PEXA 2ZO4A 4PYKA 3RIEA 2XASA 1YFHA 2ZFUA 1IAWA 5LHHA 4DF3A 4E2YA 2NXEA 3WTVC 4UV9A 4KIGA 3HVJA 4IPAA 3TO7A 4RGSA 1RI4A 3TOBA 1ULYA 1IM8A 1JQ3A 4OIRF 1X1DA 4GEKA 2C7RA 4IHTA 3DLCA 4E30A 1UCRA 2ZBPA 4N0BA 3HIFA 1NBHA 3DXZA 3PFIA 1QBJA 5G02A 2VDVE 3IWZA 3I0TA 1KPGA 1Z3CA 3KETA 2QQ9A 3FPFA 1KGSA 1V4RA 5CYVA 3LDGA 2ESHA 2O8XA 4ZYEA 1YW8A 3BROA 4I0AA 4QDKA 3CO7C 1T38A 5KQRA 5GIPE 1OPCA 4S05A 4HX7A 3F8MA 3JWIA 5FCDA 4BY9E 2EV5A 3D2LA 4LGWA 2GAFA 5E1XA 1M6EX 4JQFA 4HQEA 4ZYDA 4AZTA 5HOOA 2HTJA 4BYYA 3WTZA 1J2XA 3KPYA 4LG1A 2OB2A 4A2UA 5EZSA 5BW4A 1VE3A 4KWCA 3RDIA 2KIMA 1O3QA 2WA2A 5EMKA 1FBSA 1O3TA 5LLQA 5C9ZA 2P3OA 3KQWA 3QU3A 1PRYA 1VTNC 2NXJA 2ZBRA 3LA2A 3TPZA 3KFWX 3TO9A 4B8XA 3G73A 4PINA 4HF2A 3FPEA 3HRMA 4E33A 5K03A 3V7CA 3LCVB 5E18F 4I09A 2Y1XA 3L7WA 5FUBA 1BOOA 4NB5A 5K5QA 1J9IA 3DP7A 2A69F 3ULQB 4O29A 4YG2F 3LBFA 2KJCA 5CUQA 2IDJA 9MHTA 2IA2A 2VBZA 2A07F 3EGEA 2VBWA 3OE5A 3DKWA 3WG9A 3QOPA 1MJFA 2P7IA 2HV9A 3CUOA 2XRNA 1RI5A 1Z6TA 2Z5UA 1N7JA 4IVNA 7MHTA 1ORIA 4OMYA 2IBSA 3HYIA 3FZVA 2UYQA 3DQVC 2GXGA 4P58A 2FYTA 4BHBA 3JTHA 3HCCA 2MD5A 3TM5A 2JRTA 2GWRA 2HDCA 3TQSA 1ZAOA 3BPXA 3QPTA 3BKWA 2F2EA 3EVEA 3TKYA 2EFPA 4H0EA 2P7VB 2X4HA 3RIRA 4LD5A 5DSTA 2YPRA 4HYEA 4P55A 5F2KA 1KA8A 4GBED 1Z7UA 4HC4A 4FX4A 3EQLF 4M73A 2VDUE 4HDUA 1YO5C 3A7EA 2CYYA 2PX4A 2ZCWA 2YSRA 1S29A 4YFNF 2CWWA 1SVUA 2GZWA 5EKUA 4E2XA 3B3FA 4U0VA 1OYWA 1HBXG 1HW2A 3PT9A 5T67A 1WI9A 1SD7A 5TRDA 1BKYA 1UHWA 3ZP5A 2PWYA 2O0LA 5ICCA 4WK8F 2STWA 3RYPA 4QQNA 3FRIA 5GM2A 3V8VA 2BR5A 1KU9A 4UXNA 4GXOA 4NHJA 1TQPA 2CG4A 2DQLA 3G2OA 3HCBA 4LJZF 3DTNA 2ZWVA 5DM1A 1JGSA 2NXCA 2XYVA 4G56A 1S3JA 4YIIA 4OU0A 3C3YA 3M70A 2PV0A 4L18B 3R4KA 4HF1A 5K01A 3WODF 3EEYA 3H3ZA 1YF3A 5HIKA 1FBUA 5ILUA 2A6EF 4ZYHA 1RI2A 4C06A 1LVAA 3E7PA 1NW6A 4U88A 5E8GA 3NVMB 5LR6A 4ENKA 1A04A 3ECOA 6PAXA 2IP2A 2C7PA 4ZTBA 3CGGA 5H6RA 3P2EA 5EMMA 4GCVA 3IKTA 2P35A 1UB9A 2AOTB 3D0SA 4KUMA 2J5PA 3FTEA 2XAGA 5CLSA 1YFLA 1XCVA 3OV8A 4WF2A 5D5WB 1F38A 4N9IA 3L09A 1TTYA 3LECA 2V7EA 2E7WA 5AIPA 2EWNA 2FSWA 2OD5A 4A0XA 3ELUA 4POOA 3L00A 2UZKA 4O3MA 4BP1A 4EM0B 3EVGA 3BWGA 4HSGA 4DCMA 4N9HA 2H1RA 3LL7A 2ZMEB 3DF8A 2ZWAA 2PJPA 2AN4A 4DKJA 3KQMA 2FEZA 5K0FA 3DOUA 3I54A 3P97A 3FZGA 3F23A 2YTZA 2VS1A 1F1ZA 3BGIA 3FYCA 4OBXA 4NQWA 1G3TA 4U7TB 3LQQA 1R1TA 3ECHA 1IXRC 2V74B 2M1BA 3MERA 3BJAA 1X3UA 1JR4A 1FPQA 1WXXA 3T5XA 5CCXA 1L3IA 3AJDA 3EMBA 1RJDA 2XKPA 4O6JA 3KP6A 3UWPA 1KXZA 4PYMA 1DUSA 1OMIA 2ZBKA 4A0YA 3LA3A 2YQZA 5E1ZB 2OBFA 4LECA 2P3LA 3FUXA 5ED4A 2ZZMA 2O07A 4LB5A 2ZCJA 3WTUC 1USSA 2ESRA 5D6FA 4P7FA 4HAMA 2B3TA 1ZGJA 1R22A 3COAC 4EV0A 2Y75A 2OBPA 5K09A 4PYJA 4EJOA 2IVMA 2QWWA 5IT9K 5LBQA 2UZ4A 3M8EA 1I5ZA 4KDRA 4BHPA 2GA1A 4BXUA 3L8DA 4CICA 1XDZA 1HSJA 5HILA 4IWNA 3VC1A 3EVBA 4BQAA 2G72A 5EVJA 1SD6A 1IY9A 5F1RA 1RI3A 3TKAA 4S04A 3B02A 2UWMA 2VODA 3H92A 5BS6A 1DP7P 1E17A 2GS9A 5E2AA 3VEPA 3FTFA 3QOWA 1XB4A 4Y2HA 2GB4A 1JSZA 1P4AA 1JG2A 5ERGB 2VC1A 3WGIA 4ER6A 4HLXA 3KLOA 4IKPA 5BQTA 5K0CA 1SD5A 1FP1D 2FMLA 5EIFA 1T2KA 3ZMSA 3PX2A 3EYYA 2V1XA 2W84A 1JQDA 4RV9A 4XSZF 2LF7A 2FK8A 3O7WA 5D5UB 2JHPA 1MJBA 4LWPA 4BNCA 2JSCA 3FUWA 2ZTHA 5F2OA 2BEOA 4Q47A 1B9NA 2V1DA 1X1BA 3KE2A 4YV2A 1P4WA 5DPMA 4Z2YA 3KQTA 2JPBA 1S8NA 2P7CB 3NMUF 1W7PA 2XKOA 4XCXA 1KPIA 4R6XA 3FHZA 1K7AA 1MDMB 2CFXA 4MQVA 3DMFA 1AQIA 2XAQA 1W5TA 2ZBQA 4RTLA 4ENNA 3GVAA 5DT2A 3C1DA 4ER5A 1KQ8A 5A2QZ 4OQDA 2PX2A 5DXJA 3H3UA 2IH5A 1YZHA 5EKXA 4QTTB 2PMHA 3TOAA 2IBTA 3BDDA 4OIPF 1RI7A 3PX3A 4CGZA 2VE9A 2ONYA 2Y48A 3N97A 3FTCA 4EK9A 1L9KA 1NW8A 5LGNA 2HTSA 1X1AA 3HCAA 5LQCA 5DCFA 4HG2A 4EKIA 1P92A 1GHCA 4GC9A 1FC3A 3K1MA 5FQOA 2V1UA 3JTGA 4A12A 3A7DA 3M8FA 4KICA 2AN5A 3OZTA 4EMSA 2EFWA 2NP7A 3QAHA 3NW9A 4ZZDA 2B0LA 5D5XB 3P7NA 1XVAA 2QBYB 4KIBA 4V0RA 3B73A 3LFKA 1R8YA 2A14A 3GO4A 3DXYA 5A2QK 4C08A 1O54A 2M45A 1MGTA 1MD0A 4A6DA 2EV0A 3W6KB 4EVIA 1LDKB 4X60A 3GFMA 1G3SA 3SMQA 3KEQA 2A68F 3GXOA 2XYQA 1ONVA 2TDXA 2AOUA 4EQQA 4CTJA 2VONA 5HIIA 2HEOA 3FX3A 3G8AA 2KIUA
chains in the Genus database with same CATH superfamily
2QMEA 4ALJA 2CFOA 2BW3A 4RKFA 1DXYA 5CKTA 1RIOH 1F3LA 1RYYA 2HYFA 1O9HA 2B7CA 1J8DA 3E7FA 3NT2A 4GUAA 4V39A 2I4OA 5ALTA 5HG0A 5KSYA 2DETA 3R75A 1B9MA 3RWBA 3E9ZA 4N3CA 4TUYF 5C35A 4EA9A 5BR4A 4Q9NA 1R5GA 1HSTA 4DYRA 3VTAA 1QRYA 4FFPA 5HKKD 5HZKA 3M5DA 1Q0LA 4OIQF 3F8CA 5I7WA 4JYAB 2QMOA 1FF9A 1KAOA 2QAJA 3QPUA 3KKEA 3BPVA 5HGJA 1B8VA 3LKBA 4IQGA 4B81A 2GCOB 3GGSA 3SHTA 3E6MA 3GQVA 4LGCA 4ZAWA 4ZI7F 1N92A 2UXNA 3E6CC 3OY9A 2V45A 4MLOA 1NMZA 1PWEA 4D82A 4HGRA 1Y5MA 2XCTB 1V45E 1E9RA 3FLMA 2HGSA 4CI0B 1CEXA 3RC1A 5BR1A 4AUKA 4KREA 4W1SA 1JPVA 3J7AO 2PYZA 2AOXA 3PD1A 5DCUA 5CFMA 2QVOA 1X15A 3N74A 5DB4A 3WTTC 1EFRD 2HSDA 2W8BB 3O2NA 4EMTA 3DEIA 4WNAB 1XSDA 2G09A 3E70C 4LLGF 4Y7NJ 1U7HA 1W1WA 3HVIA 4HUTA 4RTRA 1XK6A 5K1ZA 4ZTJA 1X7GA 4HNUA 1XVIA 4QGHA 2GPJA 1WU8A 2HRCA 2Q9BA 2JFHA 3AHJA 3C4QA 2DWUA 3IMCA 3N3BC 4RFLA 5E3LA 4AUXA 1Z37A 2AOVA 2HSJA 3E82A 4QOIA 1EJ6A 1XXLA 5D1HA 5EN4A 4G94A 1XDUA 1G98A 1Y8QA 2I6XA 5GGXA 3K1NA 3UGTA 2ADOA 2ZJAA 3PHJA 4MULA 2I1LA 16PKA 2ZBFA 5FTNA 4E2FA 2VP9A 4EELA 1CF7A 4TS4A 1DEHA 4K81B 1VYUA 1EJ2A 3ZKAA 3HY4A 2BZGA 4HF0A 2A9FA 2PHZA 3WMWA 2PUTA 1DAPA 1FS6A 2Q8NA 1ZD2P 2QIOA 1O6ZA 4H0NA 3WL3A 1XEWX 3T3NA 1RNLA 2AFVA 2Y2ZA 4J8PA 1WQ1R 4O4HF 2XJ4A 2B78A 4Y2UA 5REQB 4N76A 2IYAA 4YPVA 2OF7A 3H36A 1F9EA 1N3YA 1P8AA 4DSUA 5L9AA 1TNSA 3AFGA 4BP3A 4CF5A 3PQJA 1KEWA 3NANA 1TQDA 5GP1A 5J2TB 5CK4A 2OTJI 3EZGA 4PRYA 3RRFA 3UWMA 4FZJA 5IP6A 2ZROA 2IYNA 1U1IA 1HXDA 1VLJA 5CDTA 5F0HA 1FJ2A 4DA6A 1KZ1A 1OPRA 2PSDA 5HW0A 1JJIA 5FLKA 3RPUA 5GAJA 3WV4A 4B2PA 1A6QA 1QX3A 1N6LA 4IJMA 1S1MA 4NFYA 4DA0A 1C1YA 1N1GA 2QMQA 2W6ZA 4WASA 4LV5B 5ALJA 3ZH2A 3SI7A 2CXNA 3D4PA 5TE9A 4XCVA 3ZNOA 2VJLA 4QVGA 1IHDA 1FP4A 1HDDC 5D8LB 1TW3A 4GLBA 3G2QA 1R5BA 1B93A 4GI5A 4XXHA 5DLQC 1W5BA 1FFHA 4DLUA 5E38A 4V2GA 2EKBA 2HQNA 2GM9A 4JK1X 2GXBA 1T1GA 3A9WA 4QULA 3T5TA 4CT5A 3OJOA 4JP5A 3ITKA 3D5QA 3GRFA 3LY7A 1CIPA 5EIBC 1APLC 4A5SA 1TRHA 3GBSA 1XRQA 1BOFA 1P2SA 4WX9A 1I2ZA 1W48A 4FZ3A 4W8GA 5TV2A 3W3AA 4BO6A 1GZ5A 1BOAA 4XOPA 4GXQA 4YMGA 2BEUA 1YDEA 4KWEA 3ZHRA 2QB5A 3BWDD 1TU4A 1G2OA 1FU7A 3VZSA 1JFSA 4LHEA 4HPWA 4NC6A 1U7WA 1Y3CE 1XPOA 1VBKA 3CUQA 4XPIA 5K0ZA 1OFTA 4MTDA 1KU0A 1V3TA 1Z0FA 4IZZA 2PZFA 3CVUA 3IIJA 2DA3A 3CTAA 1K8RA 1JQBA 3ZU5A 3SE7A 3F3SA 4GP7A 3ZIUA 5HVNA 4K9LA 3QEMB 4HZIA 4MNUA 1XSXA 1QH1A 4R5MA 4XVUA 2Q6VA 2YV5A 1SKAA 3GDGA 5P8WA 3AILA 3L2CA 2IYQA 5GAGJ 3A2LA 3C8DA 4FX0A 3H6GA 4M99A 3ZGXA 2XBMA 2IJLA 2ADUA 2RI1A 2L7MP 2AUMA 3A1FA 4U6QA 5L3RA 2IPXA 4AX8A 1JMYA 4LVCA 5CJ2A 4NAVA 3D9QX 5CRIA 2AR7A 1GARA 3P2KA 3WGMA 1WKMA 1LRJA 2W2QA 1L3LA 3HU3A 3LYUA 1HUQA 1XTSA 2PMEA 3U5ZB 4YMWA 1AA9A 1KH3A 3K9LA 4DMMA 3UUWA 3RPQA 4C01A 5LD2B 4YFXF 2NVXJ 1D4FA 2BFDB 3TX6A 1C8VB 1N2BA 1CUUA 2C4HA 2P6TA 4LK1F 2JRCA 2AG8A 2YIMA 3OPXA 3U7GA 4HFNA 1TKAA 3A1VA 1UADA 3DT6A 1TWAJ 1Y0UA 3OYDA 1UIRA 2EQBA 3MUNA 4IVRA 1ML4A 2WA0A 2WKPA 1L5KA 3LW8A 4N0DA 4UFPA 4B4CA 2KLOA 4H16A 4N8DA 4W5QA 3DD5A 1X0VA 4F3QA 2IXEA 1GKYA 3DQQA 3E9QA 3HCWA 3C48A 3M89A 3GGOA 3PZBA 4FILA 3QFTA 5CYOA 5H68A 1U8ZA 2DEUA 1X2MA 3OPYA 1XZIA 4BNYA 2WWFA 1BN7A 3CKKA 4INJA 1GPBA 1CGPA 1U8XX 3AVOA 1S9DA 3ELYA 5D6NA 2BFOA 3P9IA 1PP8F 4TTJA 1Z1DA 3R8CA 3HWX1 4M38A 4O2RA 4BS9A 2ZTVA 3GEHA 4UPVA 2L54A 3EG9B 3ZE0B 4IXNA 4UB6C 4DR6B 2CD7A 4U7JA 3TGPA 4EY7A 4UUTA 1X1CA 1KSJA 1XXHA 2XKBA 3JZAA 2GJKA 2QGFA 1JGGA 1II8A 3X1JA 3ENQA 1PLLA 1KP2A 2BW3B 1DKRA 2XUBA 3E9MA 2QSUA 1W19A 4ENRA 4ZEVA 1T0UA 2JIBA 3C41J 4O2AB 5HKAA 4FWTA 2BW0A 2YJGA 1NFRA 3OIUA 1E94E 3KB1A 3O94A 1CZOA 1FDUA 1RHMA 4A5MA 1TA4A 1V55H 5JS1A 4RAQA 4AJLA 3M83A 3I6BA 1LFDB 1ORHA 3LFUA 2I3DA 2IGTA 3GB9A 4IIDA 5IAJA 3UJCA 4E08A 5CAEA 3O3NB 3MQ4A 4DR2B 2J85A 4JUAA 3NWEA 1GAQA 5JLXA 4YX9A 1GG2A 3S16J 3BMNA 1ZY2A 2IV3A 4BTVA 2EGGA 3ZR8X 1QHFA 2RGNC 2FLWA 3DS8A 4GF5A 3UXEA 1OE0A 3HBFA 4CG1A 2YWJA 4FCCA 3LC1O 2ZYIA 4PG4A 1YR2A 2DKOA 3HGMA 3L6EA 2BHTA 2IYZA 3DW1X 1WP9A 4YAUA 5KTSA 2FOKA 1X1RA 2ZAMA 3EAFA 1E9VA 3QE4A 1VLVA 1YK1A 2HU7A 4RF2A 4OHXA 5JVDA 2I3ZA 3B3AA 4PR0A 4HV5A 2QN6A 2P0WA 4E70A 4Q4AA 3RSCA 1Y1TA 1W4LA 1E63A 3DBHA 4J76A 3RWOA 1QAOA 3HKCA 3W8RA 2E49A 3RAJA 1LKXA 4GP9A 4HP8A 4CMBA 3RPEA 4X41A 3WYEA 4X00A 5BMZA 1MAUA 4BN5A 2TMGA 4A0ZA 2FX5A 1JH9A 5J2UA 1AS3A 1EK5A 1RQPA 5K0JA 2UUBB 1LDDA 2K86A 4P31A 4C7XA 5I7SA 6REQA 3LG2A 3E8SA 3UHOA 5IVPA 3BS4A 2BV3A 1GRRA 4YYZA 3FNHA 3ZV7A 1ULSA 4D4LA 5AW0A 1H3NA 2E48A 3M9LA 2CHEA 3MFYA 2J0QA 4XDHA 5ER6A 1EP1B 4IF4A 1A9XB 2NYRA 2OO5C 4L51A 4XIDA 2FN3A 4M6WB 3ZVRA 1RXVA 1KDPA 2AUTA 1U63A 3T3HA 4TWJA 1ETWA 5CCDA 2OPTA 1VP9A 3AZPA 3IQIX 3SSNA 4F1WA 1TQHA 1YOBA 2H2AA 1O5TA 4KYVA 2LH9A 2WY8Q 4MV9A 2Q1XA 2E4VA 3V34A 3LBHA 3M3HA 1D7AA 5B3SH 3BMOB 3LRTA 4BB0A 3JVUA 4MI1A 4DV1B 4NOJA 1KDVA 1U5AA 1BR1A 2JKZA 1OX6A 4YRDA 1LTHR 3B53X 3CA8A 5AW7A 5TPWB 3KG2A 1NVVR 3OY7A 4K88A 2V98A 4TKVA 4CWAA 3QE9Y 3VOEA 2WUWE 4FT2A 5T7BA 1H8AC 3KOYA 4YCLA 3AESA 3EVCA 3F9KA 2WPDD 2XRYA 3TB4A 4UVAA 4RORA 4O4IF 3UW3A 1XD7A 3E3NA 3MB8A 3ABUA 2XUHA 4M1EA 3U0BA 3EIUA 3TEJA 4MO7A 5JWRA 3K9WA 2LP4Y 3PKIA 3Q2OA 3WLFA 1H5QA 2O0JA 4WBSA 1Q6ZA 2NO0A 3NHAA 3SYKA 4RVOA 4DXHA 3BWEA 1IUOA 2X0NA 2J30A 5KBYA 1PR2A 5T8KC 5ALUA 3L8FA 2YX7A 2YOHA 3K4NA 1RM5A 2DA6A 4KVGA 5FA8A 3PB3A 3BGVA 5E9AA 2ELJA 1M76A 1QV9A 2O2IA 2R68A 2PPVA 3N3AC 3TQIA 1TFUA 2Z56A 5A5EA 3DFKA 3GLIE 2C61A 3QFHA 4RK7A 2A78A 4M0KA 3IP5A 2GN4A 4TVBA 1KAMA 2D6FA 4M1QA 1QXSA 4TKZA 2X2OA 5I9IA 1K9SA 2O8NA 4WEQA 2AK3A 3T7CA 2P0YA 3PIRA 3X44A 4AVYA 3ELKA 1SZJG 5EZYB 1JILA 3SQDA 2WB2A 2HYIC 2I4LA 3W6VA 5K1YA 2O54A 1L7MA 3EODA 2O7VA 4BECA 1B4DA 2GEKA 3Q5EA 3VSBA 3GNLA 4JA2A 4I19A 1G20B 2G71A 3AR5A 4JH0A 4L78A 5FYDA 4RYLA 1PJ8A 4YRAA 4LIUA 1VJRA 2F3RA 3R60A 2VBGA 3JCZA 1R8SA 4MTCA 5JANA 1NBAA 4MKHA 4JI4B 1TWCJ 3G9TA 1SFXA 5B58C 5IANA 1PQUA 4LF4B 1XNJA 2GFIA 3PCXA 1BE0A 3LD9A 3OCXA 1T98A 5FPPA 1BHO1 4ESJA 2IA5A 2JD2A 1O9BA 3RU2A 1A35A 1OIVA 4CF4A 5BXQC 4DV4B 3Q12A 3BR3A 4PSWA 2BBSA 3FGPA 2FU4A 1D6SA 2PSJA 1X2NA 4LS3A 5DYTA 5C0OE 4EECA 2VUUA 2V3WA 3UM9A 1LRKA 3ICWA 2X76A 3H5VA 4CMIB 4OPMA 2J6IA 3LJKA 3O4GA 1PBTA 1STOA 4KQJA 3E58A 4TSFD 1FRVA 2H09A 4OYLA 3HCNA 5IH3A 2AQFA 3J81A 2BBOA 2WVJA 2IYLD 4DCSA 2YV3A 1ESZA 4JP8A 5LHGA 2RI0A 1HFEL 3L82B 5DCMA 1TC2A 5KNDA 1ZL2A 2HW8A 5DJ5A 2DBVO 5IKEA 1W1IA 3I12A 2ZAGA 3JYNA 5SYAA 4LRTB 1SU4A 1B2RA 2EG9A 3E84A 2IH2A 2FWJA 1ON2A 4BJ3A 2HZDA 4LFUA 3BAZA 2H94A 3FMRA 3CESA 1L8LA 5M3FJ 1Q91A 1DUVG 2IEYA 3BN3A 1A96A 3OFKA 4G5SA 4OQFA 2SICE 2XUPA 3S2GA 4ALMA 5H9WA 4YHHB 1TYDE 1G5RA 2YN0A 1CUCA 1H9CA 3A3PA 2FDXA 4KGDA 1NR7A 1BC5A 4BMOB 2J9RA 3KOWA 3I34X 3VU1A 3IL2A 5BUSA 7AT1A 4RNCA 5IWCA 3B2EA 3FHCB 2GAIA 2L9RA 1RRJA 1Z4OA 2ZS9A 5EWMA 3RRBA 5EJFA 3U49A 5L3ZA 2AHQA 1TD9A 2DQKA 4HNQA 4PLGA 1A1SA 4QYXA 1YOVB 3GRVA 2KLBA 3FWEA 4MKRA 5KJFA 1W6UA 3GGDA 1YJ8A 4OLJA 4EM6A 2P2NA 3I6MA 4NULA 2I9KA 3CLQA 2ZVQX 3PL1A 1AU9A 3ZHUA 1BKDR 5HFJA 1VA5A 2H4WA 1Q74A 4IJQA 3UMRA 1XNRB 1G0NA 1Z7BA 2OKCA 4B17A 3R7BA 4MQFA 1O6CA 2HWVA 4TKMA 3ZW9A 4W8HA 2X19A 5ALFA 3P71T 1XA3A 5CBPB 1YRNA 3FXQA 1PFYA 2RFLA 5DM60 2PQ8A 5JRDS 2XCRB 1Z35A 4MR9A 3COJA 1B23P 1SCNE 3SXJA 4CDGA 3D5TA 4YLGA 1MMSA 3OU2A 2XY4A 5L3BA 1YE8A 2JJ1D 3CLOA 1FLNA 3HSYA 4RFSB 5LL6P 2Z9OA 2QRPA 2CUNA 5EERA 4N7JA 1EXWA 3OF3A 4P22A 2Y9MB 3WI7A 5K5EA 2CNOA 3SF8A 3C4VA 4D4IA 1Q7EA 3CVOA 4FFDA 5AW3A 2I22A 1AK2A 1KYVA 1YRHA 1KBQA 3M6FA 4OY3A 3WU2C 2WWVD 3CV3A 3MT9A 1XLWA 3TBHA 2ORED 1L3BA 2CGPA 4XSGA 5BV8A 4K1LA 5J4YA 3UJ7A 1B26A 2VPYA 1P7PA 1UDCA 2BTOA 4LWOA 2IS4A 4NC9A 4Z9BA 4CTKA 4X62B 2PH7A 3H1TA 5GPAA 3BREA 3WNZA 2A0XA 3I9LA 4FUQA 1ZN9A 2HF7A 3DJFA 2ZUFA 3LNQA 2HBZA 5EGSA 2AFIE 3UY4A 3ZE7A 4DWOA 3DLIA 4M0DA 4MHTA 4MUAA 3MXTA 4MA5A 6LDHA 2HMTA 5E8RA 1ZJYA 4JL8A 1Q11A 1O94A 1U0HC 2C98A 3GVCA 5H4HA 3WNCA 3OZIA 3JAKA 3CZQA 3L0ZA 3EEOA 1XDSA 3DZIA 3QW2A 5K3CA 4XLCA 4N40A 4JU9A 4CZZA 4W7IA 5A6SA 2GBFA 3OZRA 2FHPA 2HWYA 4PIPA 2PKRA 3OJEA 4WCVA 4ZCPA 3PSHA 5HP4A 4JBLA 1T0HB 3EZ2A 1QGUA 1PZFA 5JZVA 3PGMA 3RSSA 1V1JA 4NYJQ 3PI6A 4AN0A 1P3DA 2PRJA 1CY1A 5AHWA 3S8EA 3MBIA 3BIOA 3ZC3A 1FFAA 1HNXB 1IUFA 1IONA 2PO7A 2FF5A 4M7RA 4YRTA 3MWMA 1N2CB 3Q8KA 1QVUA 4EPVA 4EG8A 4E7ZA 5B1HA 1ZEJA 4QJ3A 4JJGA 4LSGA 4ZT7A 1I1OA 1CC1S 1RRMA 4FZRA 4PEVA 3JQ9A 3U4QA 2M3AA 5IUJC 1E2EA 4F6CA 5EP3A 1AQ6A 3U3ZA 4ZXFA 3ZHZA 2JH9A 1LPQA 4BKRA 3DT9A 2ZTLA 4ZGBA 2IRFG 2FUNB 3PQEA 3OFVA 2JAPA 3ZK7A 1JI0A 3UA4A 4O2BB 5FNVB 5IDWA 1HF3A 2DMNA 3QA3E 4N3AA 2RB5A 4AS3A 5A3JA 3FDFA 4Y2PA 1U5TA 3OSGA 1QVRA 3LHKA 3T5BA 5ALWA 4BC0A 3HOYJ 5JQGF 2HVRA 3S1QJ 4HDCA 5JH7F 4U3JB 2VDLB 3LNCA 4R79A 1Z34A 3BXHA 4TTRA 2A5GA 2FMXA 1ZDMA 3IAAA 2IYOA 4GVXA 1X7DA 3VO9A 5A03A 4L0QA 2RGCA 3LQYA 1UMKA 2DBZA 4JBWA 4HBGA 4PG8A 1NZDA 1BBYA 4HN2A 4RMHA 4EUSA 2BMAA 2Z2XA 4OBWA 3QODA 3RU7A 3P96A 4G5OA 3VQTA 4YUVA 1XG1A 1RWQA 2AI1A 3UWKA 3VISA 3CMAI 4ZDJA 2R7VA 2ME0A 4IH1A 2XIGA 2F3QA 5AIAA 1GUAA 3GT3A 3ER9A 1O96B 3PFCA 5IBPA 3S8YA 4ZVLA 4KQKA 3C4JA 3CZ9A 1HQDA 3HACA 1PFWA 1Q2XA 3FMFA 3DUFB 3IUNA 4NSNA 4F3TA 2ID3A 1V5WA 3RFCA 3ZOZA 2FF7A 1QGAA 1O94D 2PI0A 2GRJA 2QX4A 3DXJF 3BL5A 2W37A 3V4RA 3B6JA 3LVFO 3IKVA 3GR6A 1NQWA 1FTSA 2WSSD 1YRWA 3DM9B 4A3DJ 3E0XA 4FI3C 4CMHA 2EWVA 3LY8A 3UFBA 3V2HA 4EZBA 5TISC 5K3SA 5I4IA 4FBLA 5HS9A 3BJMA 1JFFA 5L3QB 3K35A 1IWBB 1SEPA 1T26A 2UVPB 3PNSA 4WCGA 3NV7A 3PA6A 3E4DA 3Q2IA 4CMEA 2RKBA 3RU3A 1LDNA 4LV6A 5B5SA 2GRUA 3FE2A 2R6JA 5A5VA 2XI4A 2BCJQ 1DFIA 2QR2A 2YC2C 3L7JA 1KTIA 1J9GA 1QGED 1VHDA 3O9MA 4M98A 1FIPA 3R0VA 1LLCA 2RGBA 3V4SA 3ZWQA 4CMGA 5TJ9A 5KYXA 1D1CA 4UEJA 2PWZA 3JV7A 1TE2A 4TXHA 4LITA 3R9XA 2XAFA 3CURA 3F97A 3GRRA 2VH2A 3OLXA 2Q2EB 2WYHA 3FUTA 1UDBA 4MMXB 3VAZA 1N3LA 4YACA 2ZQZA 4R1PA 4W5RA 3CY6A 3QPCA 4B85A 3GMSA 1H9GA 4HQ0A 4P38A 3A0HC 1FOXA 2RGEA 3LKDA 4D4GA 5BT8A 4UQLA 3MN2A 3EXEA 4MDYA 5AFSA 2H1FA 4REOA 5HYVA 3TM4A 3GJ7A 3NBYC 3PC3A 3CZ6A 2BSXA 2CZCA 1FVFA 1XTVA 3TQNA 3CTMA 4H7FA 1XGOA 4N5LA 5DFAA 4AF7A 4EVRA 5IK2D 5HUQA 4R83A 3LHSA 1VG8A 2I78A 2FCAA 3HKDB 1F8FA 3F8TA 3KZZA 3EQZA 1DEOA 3Q40A 4RVCA 4DC9A 4R71A 4DB4A 4AC9A 2QQFA 4GKBA 1BMFA 3IVGA 5GZ3A 1GAEO 2AMFA 3WGQA 4DN6A 1V9LA 2XITA 2CQKA 2P7HA 3C8ZA 4I50A 1GPWB 2XB8A 2I8CA 2XXAA 3M6XA 3PYLA 2GEDA 3MWLA 5H02A 4CKWB 1WMEA 3SIXA 2NO9A 2EB7A 3OS2A 2VDWB 2ZIVB 2X4DA 5JD3A 5EJMA 2IF2A 3PXCX 2VK2A 2E7XA 1SG9A 4BN0A 5HK8A 1HMPA 1OZ0A 5ICEA 3F47A 2O8DA 1E3EA 3EQ8A 4DLSA 4JELA 2Z98A 3BXFA 3K8OE 2EFDB 3EIQA 4MRMA 3MKYB 1TYAE 2I66A 3O4VA 5FULA 4BNGA 5JAZA 3LT5A 2IUUA 3NT4A 4RDIA 3DLBA 4AD9A 4D9JA 1T8TA 2PRIA 2XVXA 3AV3A 3BD9A 4GDFA 3E81A 4RNDB 3U81A 2QENA 1FMFA 3QTBA 4ZCIA 4LBYA 3FW1A 3EFOA 1KBZA 1NXPA 3LUPA 3PUWA 1LX6A 1S2OA 3IR6A 1PJLA 2IZ0A 4Q34A 2FE4A 1LBTA 1ZMBA 4OHMA 3AM1A 4EGYA 1TECE 2FZ4A 4P7KA 4U6SA 1EFTA 1N7IA 2JZCA 1VL0A 3W8FA 2WINI 2X4GA 3R3SA 3GV0A 4MW9A 1UQTA 3FCXA 3RK0A 5C7OO 5HPYB 5LIPA 5LDDC 1EJBA 4U63A 2I65A 5HS4A 4RMIA 5DT9A 5DNAA 1BW9B 1TGYA 1WUKS 1YR3A 2D54A 1QYCA 2J0EA 2IEIA 1R7RA 1JDVA 1ZXXA 2J07A 2R7RA 2GHRA 3COWA 4OHFA 2EF0A 3ZHBA 5E6SB 3MGBA 3GZ4A 1YZFA 3QFSA 1R74A 3LWFA 1PTJA 3G4SI 1U0SY 1UKEA 2AMVA 3IAS6 3LH5A 3MB5A 1PUJA 2DUWA 2TS1A 4V2FA 4MWGA 4MVWA 3UOWA 3JALB 1XZAA 3VWBA 3EDOA 2FZEA 1Y63A 1I4DD 4HNRA 5JPCA 2P4UA 3HJUA 4O1HA 1GNSA 1TNTA 1J56A 1U1CA 1YCGA 2N46A 5JBIA 3ERCA 4R2WA 4G9EA 4YFVA 4RLFA 4XSXF 4IJUA 4RSGA 4E94A 1U90A 3U3MA 1XRSB 1FXWA 4Z3DA 2Y66A 5EIBD 4O4LB 1ZD9A 1IO2A 3DULA 4RK4A 5FBVB 1K6EA 1JL3A 3HO8A 2GM3A 2OZ6A 3JQAA 4I81A 4LRUA 4LYEA 3VSDA 2E6KA 1O95D 3MWKA 1VG1A 4LKRA 1ST2A 1SBZA 5TY0A 1BD3A 3CC7I 2BR4A 1H0RA 2PH3A 3DBVO 5AK5A 2QVBA 3KYJB 5F7XA 3A0BC 1O3SA 1OFHA 5DI3B 1WJCA 4CKEA 4UVBA 1IK6A 4JJ8A 2BY4A 1YZGA 1DINA 1SR8A 3NNNA 3TRFA 1THTA 3GLGB 3TD6A 2V7VA 3N2KA 5BSHA 2WAQA 1DTWA 4WAUA 5DM4A 1AC5A 1GVHA 2IOFK 4FONA 3Q3SA 4WKCA 3UK7A 1PWHA 1OFUA 4ETMA 2WTEA 1VYHA 2GMWA 3F67A 1AKQA 3FPHA 3UJ9A 2COEA 3CZRA 4FTHA 3RSOA 3QLEA 3VJMA 3MOIA 2Z3YA 1KI9A 1M6VB 1P1CA 1V9SA 4M7PA 3A4IA 3PIOF 2PSEA 1E4VA 4DNPA 4ZKDA 1R1DA 5K4AA 2JFGA 1SPXA 3DBOB 4LJSA 1NBIA 1RKQA 1II9A 1YR6A 2GLXA 4AG6A 1YHZA 4G85A 2Q6TA 4LXGA 5D86A 1PUFB 2PKCA 3R40A 4E5SA 1IATA 3WLAA 5HEKA 3KSRA 4BLWA 1P8JA 4NMMA 4O59O 1ZK3A 3GJ3A 5DYMA 3JAWB 3L18A 1WH5A 3TLMA 3VH1A 5JTUA 2RE8A 4A15A 2JAHA 3QWAA 4D5FA 1FRFS 3KQQA 4G2TA 3VR6D 1JHAA 3EVTA 3AY6A 2ODEA 4NEQA 4ALIA 4ETWA 4ZN6A 5LQUA 2A3SA 5LC1A 2DH6A 4F8JA 4ZVPA 2WJPA 4X8LA 2H1CA 3T3OA 1IL0A 3PUKA 4UHKA 1W35A 5HGXA 3N05A 4INPA 2HX1A 5FL3A 3U4HA 3GFQA 1DQSA 1HORA 1ODJA 1EE1A 2FW7A 2Q9CA 1NBMA 2IT1A 3KR1A 4NBVA 2FRXA 5JFOA 3GTQJ 1FY2A 4TMFA 5H83A 2FUCA 4LDQA 4MTLA 2V9VA 2Q49A 1Q14A 3D8TA 1XC7A 2AWNA 2OQ2A 1MAHA 1F4LA 5HWSA 5I4BA 2NP6A 2Z5FA 1T1SA 3A6PC 1V1RA 2ETHA 1JHYA 3W5SA 2EP8A 1WR8A 1U3EM 4FCWA 2L82A 4NH0A 4G0QA 4P7JA 3S15J 1AUOA 1W0JD 4RABA 3R0ZA 1GKLA 3OO0A 3NEPX 5BVHA 1NPYA 4LJ6A 2WW8A 2BM9A 2OORA 4BXOA 1FSSA 2GETA 4HMOA 5K0TA 1E0KA 4RE5A 2YHBA 1E6WA 4J00A 1LBQA 4HUQB 3STWA 3TR6A 3G49A 1S2GA 1UCFA 4BDYA 1Y9DA 2B37A 4QRIA 3PBKA 4M83A 3S4YA 2HR1A 4IKFA 2MC4A 1W0KA 5A02A 1MRZA 1QE5A 3WKDA 2ZXIA 2IHUA 2R6DA 3KKKA 5CIQA 3LF2A 5AJYA 1MW8X 2FRVA 1MABA 1NONA 2BGTA 3B7GA 2AA3A 2DFFA 3FM9A 1P2DA 2VF7A 3KE9A 2CL5A 3H1CA 5FA5A 2HFKA 4NZPA 2GTIA 4NI5A 1NR1A 1QB7A 2BBWA 1RTTA 3K20A 1MNEA 2H6EA 4KVZA 1JEQA 1BYUA 4NCJA 4Q1DA 4U2FA 2V6IA 5E9JA 1X9GA 2G76A 1GUFA 1IG7A 2H0RA 4DMGA 4PCAA 4PSCA 2RGUA 4P7GA 4IIJF 2Y1LA 4RD2A 2GK4A 1OLTA 1QMPA 2V7UA 1BVRA 4OGWA 1H65A 1N1EA 3ZHSA 3TL4X 5FAKA 2I2DA 3DMGA 3PJDA 3WBFA 4F1JA 2ACVA 4NU8X 4DRYA 2J0SA 1I7NA 4TYPA 3UMJA 3U56A 2WIKA 5J58A 5AVUA 1I3LA 2IOYA 1GR0A 3AEKB 4Z86A 1AIPA 3GA0A 1J4AA 3TO5A 2EJBA 3K8QA 1DAIA 4DOMA 5K51A 4EMUA 4MS1A 2O4UX 1BGWA 3T41A 2EJRA 2CNWA 1MB0A 2MSEB 5K4HA 3K7AJ 1DIHA 2YYSA 1E3IA 2VZ8A 3KO8A 2CCKA 2EV9A 4WN3A 4NCAA 3FMOB 3FWNA 2CVPA 1JKRC 1MOSA 3H1BA 3OEHD 2O52A 5GVSA 2V26A 5BN5B 4E14A 3HPQA 3D0OA 1K78A 2O3SA 2YWBA 1J7JA 1PAUA 3AEUB 3R44A 2LMDA 4B31A 1T6NA 2NU8A 2DOAA 5FROA 1I10A 1Z7GA 3AESB 3UBTA 5EXDA 2VL8A 2WPNA 3DH0A 1XZQA 2I6SA 3TJMA 5CT4A 4N0MA 1XTAA 1FFXA 3GOQA 1ZK1A 4R2HA 1HLPA 4V03A 5EVCA 1YQ9A 2HOAA 4L0ZB 3MZ8A 4OIMA 4D81A 3T9CA 1HA8A 4AZWA 2P4QA 2NG1A 4ZEWA 1EXMA 2EEZA 3ZNQA 3DU6A 5LHIA 5HZHA 3M9XA 4U2DA 4G5GA 1SCUB 4GVLA 4PQGA 2MYUA 2PUCA 3RCOA 1NL3A 1V8ZA 3F0CA 3ND9A 4PS1A 2EIJH 4D99A 3BQZA 3FPKA 4I6JA 2OWEA 3KT0A 3VYUB 3DE5X 3LWNA 1JIIA 2Y6UA 1SUAA 4PXSA 3V2UA 4Z7OB 3O4JA 1FOEB 3EVFA 4AMGA 5LLDA 3JAKB 3V7NA 4C0JA 2Y9PB 2GYWA 2GFHA 4WWCA 5CFQA 1QP4A 3ACBA 3LP6A 3UVEA 4XRMA 5CCEA 3HTXA 5JH7B 2XWPA 1P31A 1LS6A 1RYHA 1BR2A 5I4CA 1SUWA 4G0UA 4PSXA 5BSTA 3Q6IA 1MTZA 3DF9A 4JEIA 4UUBA 4OOIA 1OR8A 3S5JA 2QEXI 2QUBA 2UVPA 4LF6B 2QBYA 4ZQEA 2VPWA 2C4KA 3IDAA 4HGPA 1POXA 3LA6A 4CMAA 1WPKA 1WEKA 1KY3A 4UM9B 4FE7A 3UJHA 1DC4A 4U9UA 2V8BA 5D5PA 4CF7A 5DBGA 1H1LA 1LVHA 2K9SA 2HPVA 1PVOA 2JRMA 4E5YA 1J0RA 3U6KA 2JCBA 1J1UA 3O84A 5F2EA 3A1UA 4ZYAA 1YT5A 5DK6A 5IVIA 2QUFA 3FDIA 3FKQA 2VZLA 3R9XB 2G8NA 2WG0A 3HH8A 3PEFA 4NCIA 1EDBA 4WNIA 5H0IA 2Y31A 3LNTA 3PE3A 3RS9A 3ZUGA 1YS6A 2OY0A 2PVCA 2R751 5BNZA 1ZCZA 3FYUA 1FYDA 2UYCA 2V5VA 3HOVJ 1NJGA 3JVDA 1CP3A 4NMWA 4P83A 5TQVA 4C6TB 5I4KA 2FPXA 3OJFA 3WDKA 4MV7A 4MWZA 3L6CA 1LV8A 4TV9F 5K0NA 1DT5A 4X92A 4XKBA 3C8MA 1M6VA 4UM8B 2IYVA 4IL6C 3X1WA 2IPLA 3MJFA 4PSVA 3TSOA 3BSFA 1AXEA 1HE5A 3VV3A 5DDGA 2A61A 4ZOLF 3A6LA 2AJBA 3HJGA 1JAZA 1JNXX 1UFQA 2I6UA 3JRAA 1DKPA 1QIHA 1R88A 1Y8AA 2X2FA 1LY1A 3JPYA 1V54H 1YIJI 3P9PA 4E6PA 1EFPA 1ICIA 1XQ9A 1MX3A 4Z4IA 5EI5A 2DYSH 3CW2A 5K3DA 2GERA 1FWZA 4A3CJ 2ZIXB 3CSUA 3W6UA 3Q9NA 3KP2A 4IZOA 4D4MA 1RLTA 4F7DA 1ZD4A 1Z6AA 3D2AA 3OX2A 3BMQA 4YREA 1JG4A 4UVIA 2DR2A 3GZTB 1T9DA 3S70A 2PKYX 1GXPA 3QUCA 3QXGA 4MYRA 4MLDA 3RC3A 4ZI3A 3CCFA 2W0MA 1YWGO 2A05A 1IMJA 3C6YA 3H2BA 3A37A 3PENA 4X8OA 2WJHA 1U9NA 2DHRA 4RKQA 5EESA 5EKTA 5EE1A 2A5YB 1YHYA 3DA8A 1ISGA 1ESNA 5EZQA 5SY4A 1GNLA 4JLMA 2WYWA 2VE8A 4RWZA 4YJ3B 3V6LA 4X65B 4CEIB 3H8VA 4RD4A 5F0CA 3QTLA 2H8RA 3EPKA 1Y1QA 3FJYA 1GLNA 3LDAA 4TMWA 3SM9A 4BBZA 4D5EA 3DR5A 3WXBA 4F60A 5LQAA 2Y6VA 2I2FA 4JMLA 1XTJA 3K4KA 1MEJA 2XHKA 1E3PA 4BJTA 2WKSA 4X1YA 4EJWA 4BPBA 4RJTA 2I5UA 4E5VA 3Q7TA 2G28A 2XA2A 3C15C 3R3HA 5CT5A 4HRAA 4MYHA 4D9GA 3QGMA 3ADKA 2OAZA 3SF0A 2IBDA 1A8UA 1D07A 2GZ1A 3VR5D 2O06A 4QEZA 2FG5A 3MLAA 5SZKB 2JJQA 4I5GA 1BW9A 3GP3A 5G0UA 3D1JA 4CCKA 2BD0A 1FJHA 2FX2A 2AOUB 2ZW9A 3TW7A 1U9CA 2LKSA 2R6GA 2AB0A 4L85A 1UDRA 1H4SA 2C2YA 3LMKA 4Q01A 3FZNA 2AZMA 3JZFA 3VC3A 4DBLC 1J24A 2EG5A 3ANLA 4D5GA 2HWKA 3CNOA 1QTIA 1WBJB 3PA8A 2ZOSA 4XWGA 5CIWA 4BO9A 4OX9Y 2XNSA 4PVCA 2M4KA 2FJ1A 4M53A 4ZO8A 4L6AA 1GZUA 4AY5A 2O2JA 1IQPA 3QPBA 1OTYA 1Y9ZA 2Q5CA 3QJYA 1EP3B 4RQTA 3PRYA 4LFBB 4P34A 3C6BA 4A0FA 1LC0A 3NBUA 4TUYA 1M9NA 2XGEA 3RW9A 4DUGA 5IXYA 1JF8A 4RZSA 2OV7A 4FK8A 1HLDA 3TLBA 1ISJA 3UXMA 4EUNA 2VVTA 2HI3A 1GAXA 2AJTA 2GVZC 1YA8A 5JC8A 3PLAE 4XLHA 2W00A 4E1BA 2QPOA 3ZCXA 2QD3A 3JWJA 2X6OA 1CQIB 4FDTA 1OX4B 3NTXA 2XUZA 3B7PA 4ZI7A 3CLRC 1G8AA 2QSGX 4AMZA 4CKWA 4FIZA 3DKKA 1Q3TA 1MOPA 2IEAA 4YPOA 3L7LA 1GPYA 4YMLA 2ZBDA 3HI4A 5DYIA 4HF7A 2FEKA 3QW4B 4GYGA 3PO3J 1VRWA 3SHFA 1R4MA 1UODA 4FHZA 1RLJA 2H00A 2Z58A 4NFHA 1Q6YA 2Y1WA 1V3QE 1IM5A 3E05A 1I6KA 3OMLA 3PPVA 3E3MA 3S44A 1NK3P 4B09A 4KMFA 2C0QA 3MHPA 5KNBD 3OYMA 3K5WA 1AN9A 2XAUA 1WKCA 2OEPA 2OTCA 3HABA 1TT5A 1KFBB 3PSAA 4KSCA 2IZOA 4KWTA 3JZIA 4LQCA 4QQKA 1N57A 2CQ7A 1TVEA 4L9AA 1PUIA 5CR9A 3AF1A 3QF7A 1A9PA 2OV2A 3BTSA 4G8BA 5HTKA 1E59A 1QYRA 4BLPA 1WNFA 4OXKA 1XNHA 2WAQN 1RAGA 2FMIA 4BB5A 1QFMA 5DN6A 4EENA 5T3UA 3TE6A 4DCUA 4MKGA 3W04A 2D5VA 2Z1NA 2FGJA 4Q9KA 3VC2A 1SFRA 5KJEA 1X9IA 3E4CA 2YYYA 3FXMA 3OLWA 3UV3A 1B73A 3JW4A 1RXUA 4CCYA 1TZLA 4G84A 3R23A 4ILEA 4QAJA 5LP1A 3FG9A 1O0CA 2MU1A 2GYVA 3BR2A 3SR4A 1G2PA 1UF9A 1Z4QA 1KO5A 2HHLA 4XWYA 4RS8A 3MJVA 3L04A 3ESQA 3NKFA 5E17F 3UT0A 1W1WE 2VHVA 1KRXA 3HZZA 5CW1A 4N41A 1RPJA 2GXUA 3ZWXA 1KI2A 3DO8A 3BG7A 2ZJ1A 1GT91 1MBFA 2AR0A 3G9UA 3IJEB 4R7ZA 3ZQUA 4CM4B 5B30A 4IZHA 5AI9A 2LREA 3HDDA 4GX5A 5JAUA 3LKZA 1IBCA 2PANA 2WPDA 1K6OA 2PWPA 4XGKA 3U7QA 2O6LA 1NVFA 3CLTC 5F7OA 1UJ2A 2WJGA 4NZ9A 1WB4A 2B7EA 2EJVA 2H1VA 4AG5A 3PX7A 3ILHA 5AMXA 4ENPA 4QG3A 1FSZA 1KU6A 1Z13A 4F5EA 3O3KA 4XWKA 3RGGA 3B1WA 4MS1B 3MMZA 1UWLA 2J3IA 4H60A 1E92A 1APBA 2JLYA 1J0DA 4NP6A 1PV4A 1M7HA 5U4XA 1YZYA 2X2EA 2HZTA 2V9PA 3E0JB 3GDFA 5K8VA 3STVA 4QDTA 4MVXA 2DWQA 3D4LA 3HHEA 4LVOA 3ORSA 2YVLA 3K1JA 3ABQB 4OXYA 3DFGA 3HJAA 3DEZA 2F43A 3H42B 1YTUA 4ZV4A 1QE0A 4G65A 3CS3A 4FW8A 1RRGA 3CUEF 4D43A 2C2XA 3P9YA 4EJUA 3HXPA 2RKWA 2FV8A 5EIHA 1CHDA 1HV8A 4MS4B 1WP4A 3PPXA 4C43A 5FO0A 5KU7A 4H15A 1D9XA 1MP0A 1E3HA 3BWMA 1A82A 1M10A 1I2BA 4XVHA 2VBFA 4CYMA 3PQ8A 2WAFA 1LJ8A 2IIPA 2BVNA 1YVPA 2Q4OA 2NYUA 3ZGNA 3WGLA 3HOSA 3I01M 4RQBA 3CPJB 2HZ7A 2RAVA 4NBWA 1GNVA 2YUTA 3MD9A 1DQNA 3JQCA 1G5FA 3HVUA 3ND5A 1J49A 1QQ5A 1SULA 3JSXA 3GTKJ 4UOQA 4KUHA 4BMVA 1GEEA 1HT1E 3K4JA 3BMQB 3WU1B 1MH4A 4YWHA 5IJ0B 4BBPA 1K8QA 2PBIA 3IV9A 3OL3A 3B9QA 2QLFA 4JSRA 4CIAA 5I7EA 1BVHA 3FZQA 3GLHE 1YUNA 4UU1A 3OQMA 1RLUA 2PUWA 1XSEA 3PPIA 3IHUA 2XE7A 1ZH8A 4M9QA 5IF9A 4FUTA 1DHRA 1WIWA 3WTSC 1VZ3A 3FCYA 1EK6A 1ZMXA 3V7SA 3O9VA 4EB6A 3COPA 2ME6A 3IT0A 4U7DA 4KR3A 2O8EB 1YJ5A 1FU4A 3BJ6A 3GZNB 1YLFA 4D5CA 1X8XA 3GZJA 2DKFA 3QHAA 5CNMA 2WWWA 3TBFA 1HCRA 5KTYA 1KP3A 2QMUA 1EGMB 1SCIA 1I7SB 2KIQA 1G2QA 3ZJYA 2WTUA 2G3YA 1CUDA 2OCIA 2C7GA 4YV0A 1B3RA 2P9JA 4UMDA 1RXYA 2FBKA 2OFPA 4JZKA 4R0VA 3LSTA 4LE1A 1IU9A 3I4NJ 3V7RA 2R7TA 2O61A 4ZEMA 3F8NA 1EUCB 2VNKA 4KWHA 1NATA 3V2IA 5J4KA 4XMYA 1REQA 4GAEA 4WD3A 2AD5A 3RYCB 2A33A 2QP9X 4PWYA 2NS0A 2WAAA 3FWPA 2DU9A 4LXHA 4PGFA 2FR8A 2YV1A 1TK9A 2ENUA 3MTJA 3NAQA 5AHOA 4EYOA 4ZZIA 1D2HA 1QO9A 2HSEA 3DQPA 2WI8A 1F9NA 1R3UA 3FTPA 3KXDA 3ZD7A 4QDZA 2IYTA 3P9XA 4X6UA 5JI6A 4IXAA 2C0CA 1X1EA 4QEKA 1U2GA 3JQ7A 1ZKDA 3RG8A 3OC6A 2Q0SA 5IPAA 1T0FC 1JDNA 2R1ZA 4AYBA 3BC1A 3QM1A 3GCXA 4UE2A 3S5UA 4CUZA 1CUAA 3WS7A 1M1YB 1ZA1A 2C7VA 4CMEC 1GV2A 1GCOA 1VSQA 1V4BA 1XCLA 1QKJA 1Z2OX 3EXHB 3G2MA 4X54A 3VPHA 4JV5B 4GRDA 2FUKA 2L19A 2L01A 4ZYWA 4IOCF 2IA0A 1CVIA 1NJSA 1PZHA 1Y1SA 2WTXA 1ZXBA 1Z9BA 3I1JA 4OKIA 4RPCA 1YRAA 4UBMA 3WOHA 4ZYYA 4S1PA 3AZQA 2IAIA 4L5IA 1C80A 1OA1A 3FTDA 3QWHA 1CS0B 4YP1A 4CM9D 3VKUA 4RVNA 3N7TA 1SOWA 4A2QA 3HSEA 2AN1A 1M3SA 1YO6A 2VKQA 3RJ9A 1TA0A 1Q1GA 3GHYA 2WFZA 2BMFA 4M1OA 5REQA 3VNSA 5LXTB 3QUSA 1NJ5A 2PM8A 1XKLA 4CXFA 1PQPA 2AOWA 4TLDA 5TRTA 1QH8A 3HJTA 1YA6A 3JSOA 1R4MB 2B35A 1N1DA 3GN2A 3HC7A 3NC0C 1CLUA 4J0FA 3VOAA 1G21A 3KQKA 1YVRA 1PR0A 3HA5A 1ZUD1 1XQXA 1FMLA 3EA4A 2REOA 1Y0NA 2HHJA 2QZSA 2ADMA 4H7JA 4QUBA 4LAFA 4DAEA 1E3JA 3TQRA 1G4DA 3I9V6 1VFCA 3KAJA 4LLLA 3C24A 4IPTA 4KQXA 4W1PA 4ZO4A 2OGTA 3WMRA 2PA0A 3AK4A 4E2ZA 2G83A 3F5MA 3LBNA 4PLHA 3W77A 4OHPA 3HLTA 1BHJA 2ORVA 1C8BA 3O31A 1GR1A 3GLFB 3AVVA 1Y6JA 5ENVA 4DLPA 5JD5A 2JAUA 1MOZA 4QU0A 1GPH1 4KFTA 2MLKA 4PO3X 2FN8A 3REQA 2PMDA 3CG0A 4W1UA 2F64A 2A5WA 1M2VA 1J23A 2IYXA 2XXBA 1NKVA 3UAVA 3T8TA 2J8ZA 2R1TB 3VB2A 1IRIA 1JHUA 2CMHA 3F6PA 3N5KA 4ZU6X 4FC6A 5CM2Z 1XMVA 2FSVA 1GPMA 3C5VA 1SO8A 3PLNA 5TMPA 1Z74A 3AHGA 3MK31 3MTQA 4D8WA 3FMIA 1FYXA 1W93A 3OA2A 1CZLA 1UBEA 4BRWA 1LUJB 2JIRA 3I2YX 3MINA 3W5VA 2KHMA 1HZZC 1R58A 2GASA 1V8BA 1QVAA 2NYVA 3LRPA 5EE5B 2M34A 1YS1X 2VRWA 5ELMA 3VU8A 1NXSA 3ESWB 3PPWA 4FEAA 2EZ8A 2HADA 3QXCA 7GPBA 3GMTA 4CF3A 1CQZA 1SA0B 3EHDA 3KXKA 4O4IA 3T7AA 3ZXUB 2VDKB 3W0LB 1QPBA 3UG7A 1IULA 1WDMA 1T2AA 3G0DA 3FYTA 5EE3A 4D9EA 2LNBA 3FXRA 2VTEA 1IB0A 3UB3A 2N1MA 2X0RA 5KYVA 1ETYA 2VYFA 2A86A 4GOJA 3S27A 4AJPA 1OAAA 2GCIA 1VIYA 3ZNPA 4LZZA 4YEDA 1LQUA 3VPDA 1IC6A 2G9QA 4GS5A 4P3PA 5B57C 1S5LC 4BDSA 3BC8A 1JDSA 1PKEA 5KYKA 3GFIA 3TIVA 1IN5A 1ABBA 1CR6A 1J5EB 4YCNA 4DUZB 3S2YA 3EZ9A 4JOBA 1USIA 1IEXA 1ZK4A 2QUKA 3IIKA 4MYSA 4LCBA 1V3FA 2BY2A 2CLDX 3HEMA 3KPUA 4FOLA 1Z0AA 3VDRA 5GOZA 1M8KA 2IHTA 3EXFB 3RUEA 3EAQA 5HCUA 5C4GB 4RTOA 4UHFA 5IHXA 1PEYA 1ZWKA 2D1VA 5AXCA 4BWVA 5FI0B 3IEMA 3LXRA 3GQBB 4LI0A 5DIFA 3SNKA 4YUZA 4HZUB 5J4LA 1J8MF 2WNHA 4JR0A 1I3MA 3DDHA 3MTBA 1PYDA 4OP2A 4P4SA 4HOBA 3JD4A 3OSUA 2R7MA 1CJKC 5GPBA 5K8IA 3MWEA 5GZ6A 2J9YB 2JJYA 3BOSA 2Y0PA 3PWTA 1C4KA 4FDVA 1CQJA 3ETLA 1NI4A 4EO7A 1D8TA 4KJZA 4ZV7A 1Q50A 3D7NA 2C99A 3CUKA 1Z4PX 3HMQA 3A06A 1E8MA 2VR1A 4M0LA 2CXQA 2M87A 5FB2A 1FBQA 5L3FA 1J09A 4F92B 2GZ3A 2IHJA 3LHIA 4JS0A 4LOHA 2YWEA 5FXMA 3W5UA 4A26A 3D0QA 5B2EA 4WBXC 2AJ8A 3QVTA 5COBA 4AECA 3I8XA 3PUHA 3WE3A 4O4JB 4KAAA 5LUAA 2FDCA 2VKTA 2R5WA 1WNTA 2R5YA 1WHTB 5AH0A 4A0QA 1E6UA 2FR8C 4X8MA 2FW0A 2I8AA 3T1TA 3OIFA 3BWCA 2Q3BA 1EBFA 3A3NA 4MQLA 2DR3A 4A91A 4C0XA 1ADFA 4L9SA 4AS1A 3N2IA 1Z0IA 4OQPA 4PRLA 4RIFA 3RB8A 2O5RA 3ETNA 2RHRA 2C5SA 3RPUD 3GW2A 3K2ZA 2L2QA 3OOHA 3HNOA 3ANNA 5KSPA 4BGUA 4U0WA 1U2GC 3ODGA 5TJHA 3KPWA 2H2HA 1Y82A 3KNZA 5G41A 1KJ8A 2B30A 5EC8A 2HVSA 2D2WA 2BC9A 3I2HA 1KI6B 1WQ2A 2L3DA 3FXJA 2J1LA 4GQIA 4DC0A 3PCRB 1HFWA 4B0OA 2X9LA 1NF3A 3VC1A 1JIQA 2NO4A 3HUGA 3G9XA 5DX1A 1GO2A 3N0XA 2G1PA 2DT5A 3NIBA 3O4RA 4GGPA 2LDBA 2R6FA 1L4HA 4W63A 4R3NA 4IQFA 4DZRA 4CCYB 3R6TA 1Z3IX 4MVJE 4BLQA 3TDUC 1WETA 1YD7A 5BMVF 2PGXA 5CBKA 3FWYA 3WRVA 4M0EA 3R77A 1OASA 3L8MA 5CFOA 1FUUA 4DDTA 2PRKA 2ZZNA 1XF9A 2JD1A 1PX0A 2Q0OA 4RHUA 1FTYA 3AUSA 3AX6A 3NAMA 4KEAA 4F7ZA 2GN6A 1LF0A 2KBEA 3VH3A 1KEUA 3WGUA 4KTVE 4Q3OA 1W4ZA 2YR0A 2VHZA 2C2HA 1CUJA 1K97A 3H0KA 4RA9A 4XD2A 3I01A 4WLVA 4CCJA 2C9YA 2X6QA 5K3FA 5G0VA 5M5XJ 1UANA 2D5CA 2EJUA 5LBIA 1WRJA 1LPNA 3KZKA 4DLKA 1LVGA 4JGBA 4QUKA 3SIRA 5EIXA 4DDKA 4YIHA 1ZNZA 1ADBA 5M5YJ 2O7SA 4QGBA 2XVZA 4IDQA 3OYEA 1V7ZA 1JGTA 1LK5A 3B7WA 1US8B 2VQ3A 1LBEA 2GUGA 3RVNA 1SVKA 1JFFB 3HSSA 3B9RA 2A57A 5AXAA 2HQBA 4HZFA 1N6NA 4L3WA 3SU8A 4B4DA 2NTYC 2WZDA 2R65A 3QBEA 2ACKA 1GQFA 3M1LA 2JARA 3DZGA 3FNIA 1PNOA 3OCVA 2HY7A 3QXSA 4W9NA 5ADVA 4V0MA 3BAFA 3MUOA 1KZGB 3KSBC 5DUIA 2O05A 3B3QA 2Z2YA 4J6EA 4LQDA 2ZC2A 4OATA 4CM3A 3N86A 1M2OB 2FJPA 3NEYA 1N2ZA 4ETSA 1RJFA 5CVJA 4Y2XA 4GGGA 4RMNA 1NMXA 2EJWA 3NOXA 4KU4A 4LK2A 4OD0A 2OCDA 4FFRA 3K6SA 4J1NA 3C97A 2YU3A 1G5PA 1H05A 3E97A 2AQHA 2DRIA 1ZX1A 1XD9A 4KAXA 3WDSA 4TLAA 2C2GA 4UBIA 1Z33A 1BDMA 1DTEA 3OQHA 4KE7A 2LGJA 3ETCA 3U19A 1ZD5A 1XZGA 4XLEA 1F5SA 2QSYA 5E1WA 2RC6A 3CNQS 2Z9DA 5BUQA 1Z26A 4UNNA 2Y1DA 2O2GA 3DLTA 1P75A 3DMPA 3STYA 3C14C 3BG5A 2R0QC 1IJEA 3OM0A 1EVYA 2J0VA 4ZRDA 4K0KB 4AMYA 2WUEA 5TIIA 2R8RA 5ALMA 1QH0A 1AKEA 1RXCA 2GEJA 2WIFA 5HS7A 2B1RA 4GR5A 4XVQA 1XP8A 1NV9A 1NUSA 2WHPB 2RDPA 1XLTC 3H5IA 1OCZH 2MR6A 5JCPA 1K8XB 3F73A 4D2IA 5FLVA 1L8AA 5LZ7A