1QZZA

Crystal structure of aclacinomycin-10-hydroxylase (rdmb) in complex with s-adenosyl-l-methionine (sam)
Total Genus 111
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
111
sequence length
348
structure length
340
Chain Sequence
LEPTDQDLDVLLKNLGNLVTPMALRVAATLRLVDHLLAGADTLAGLADRTDTHPQALSRLVRHLTVVGVLEGGEKGRPLRPTRLGMLLADGHPAQQRAWLDLNGAVSHADLAFTGLLDVVRTGRPAYAGRYGRPFWEDLSADVALADSFDALMSCDEDLAYEAPADAYDWSAVRHVLDVGGGNGGMLAAIALRAPHLRGTLVELAGPAERARRRFADAGLADRVTVAEGDFFKPLPVTADVVLLSFVLLNWSDEDALTILRGCVRALEPGGRLLVLDRADRFFSTLLDLRMLTFMGGRVRTRDEVVDLAGSAGLALASERTSGSTTLPFDFSILEFTAVS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords aclacinomycin-10-hydroxylase
publication title Crystal Structure of Aclacinomycin-10-Hydroxylase, a S-Adenosyl-L-Methionine-dependent Methyltransferase Homolog Involved in Anthracycline Biosynthesis in Streptomyces purpurascens.
pubmed doi rcsb
source organism Streptomyces purpurascens
molecule tags Oxidoreductase, transferase
total genus 111
structure length 340
sequence length 348
ec nomenclature
pdb deposition date 2003-09-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00891 Methyltransf_2 O-methyltransferase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 1qzzA01
3.40.50.150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Vaccinia Virus protein VP39 1qzzA03
3CUQB 5FLXK 2Y1WA 5K0GA 3V8LA 3I0TA 2WA1A 5DX1A 3F3XA 2Z99A 2BM9A 3P9CA 3M6VA 3JWHA 2NNWB 4ER3A 1W7PB 3GJYA 2ZCWA 1ZH5A 1BI3A 3TMAA 4XBFA 1T43A 3KKZA 5E1OA 5HLIA 3KR0A 1IN4A 1YIOA 3GUDA 3RODA 1NW3A 1UCRA 4GOND 2H94A 5L3EA 5GOZA 2P5LC 3JAMZ 1ZKDA 3GFLA 4RAZA 2HTJA 2PMUA 2GIVA 3BPVA 5ICEA 3VOEA 1XD7A 2AVDA 3G73A 3SR4A 4OIOF 2XVAA 3EUHA 3GVAA 4EJOA 2A69F 3KQWA 4LG1A 3ZPLA 3G7UA 5E8RA 2EFNA 4TV7A 1UFKA 5L3DA 3RYPA 3FPHA 4BYYA 5C0OE 3LA3A 1RI1A 4NB5A 2I7CA 3QP5A 3R24A 1UB9A 4M6XA 4M71A 3FRIA 2GB4A 4AZVA 2FXAA 4KNYA 2HWVA 2B0LA 5HLGA 2IH4A 4QVKA 3FXRA 4YFNF 3RKXA 3MZHA 2OYRA 2V9VA 3VC1A 3HSRA 1J59A 2JSCA 3QU6A 4LG0B 4G7OF 2OAZA 3DPTA 2QRVB 3RPQA 3KPVA 2HR3A 4PIMA 2QVOA 5FHQA 5LEKA 4EJTA 4WXCA 3T0IA 4C4AA 4NECA 2GQQA 3B3JA 4LWOA 4M38A 2HTSA 2G7HA 3LBYA 1L3BA 3B5IA 1T6SA 2XVCA 4ESBA 2H27A 1CF7A 5C1IA 5EHGA 4ER6A 1XDZA 1JG3A 1K6OA 2KIUA 4WXHA 1HQCA 3VYWA 4QDJA 1N7IA 5CVVA 2PBFA 3WGGA 3ER9A 1YG2A 2PN6A 3WTZA 2ZWVA 4HX8A 2XKOA 2RDPA 1JTEA 4ASNA 3ZN0A 4P9UA 2HNKA 4KDRA 3M1EA 2P5VA 1SD5A 2ZW9A 1AV6A 3BOQA 1NE2A 3KQYA 5D8KB 1IZ1A 3EVDA 1R22A 1B1BA 3S68A 5FHRA 2OKCA 1KQ9A 4UV9A 2EJTA 4IWNA 3GRYA 2DFIA 2CG4A 1X19A 3KQSA 4OOIA 4LB5A 3LPMA 5U4XA 2MLKA 4XSXF 4FT2A 3BWMA 3NRVA 3NW9A 1G3SA 1FNNA 2PQ8A 1K7AA 5ICGA 3ELYA 1OYWA 4ZYEA 1BIBA 1ZAOA 4IPAA 4FSDA 2VE8A 4ENNA 2H09A 3FUTA 1YW8A 5LQRA 1QANA 3SSOA 4LECA 4P7FA 5E1XA 2VDUE 1LNWA 1SD7A 1JXSA 4A0XA 2LF7A 3BWBA 1MJBA 5DM0A 5BS6A 3VC2A 3Q87B 5IT3A 4EJWA 4BLUA 1J0RA 2BV6A 1H9GA 2DK8A 3T7TA 1IM8A 2HTEA 4IKPA 4GYGA 4UNOA 3HCFA 4PYLA 2NNYA 1WRJA 1BI0A 1BM9A 5BQTA 2AN5A 1I5ZA 4N9HA 1ZLKA 2Z6QA 2UYCA 2L4MA 5L3BA 3RI4A 3R60A 3KP4A 4CKCA 3QPTA 1IUYA 3HHHA 2FCAA 1OYYA 3UBTA 3P9IA 4I0AA 1I1GA 1GXQA 3TM5A 2A6EF 3GF2A 4R1HA 3BWYA 3MTIA 2A14A 3BZBA 4HGZA 5ERGB 1MJFA 4PYKA 1W4MA 1BHJA 4L18B 5CVRA 2LNBA 1R18A 2B9EA 1BOAA 4R8RA 1ZARA 2FK7A 5E1BA 4OU0A 3R9XB 3G2OA 3QOWA 1BIAA 3O4FA 4HQEA 5E8GA 1SMTA 3EVAA 1LEAA 4KMFA 3KZZA 1X1DA 1V4RA 1BI1A 3PFHA 3MCTA 3GFMA 3DF8A 2M5WA 1HKSA 3MCZA 5DD8A 5KS2A 2QYOA 3HRTA 2FMLA 1EJ0A 2O0LA 1W5TA 4IRIA 3BPXA 1O3SA 3WTYC 1QBJA 4FX4A 3HTXA 3KETA 4PGGA 4RB0A 2D1HA 5EKUA 4HDVA 4HOBA 1I27A 5B1SA 5GWXA 2DQLA 1DPUA 4CYDA 1U5TB 4P7KA 3UJ8A 4LGWA 4I2OA 2O0YA 5EEHA 2V6CA 4BXUA 5E18F 1N2XA 4PGHA 4CWAA 1W5SA 1B42A 1IW7F 3B02A 4EJUA 1NBHA 2LF8A 3R0JA 3OFJA 2NXNA 4UVBA 1L1EA 3I54A 5D4SA 3MWMA 4G94A 4DKJA 2I62A 2IW5A 5ILVA 2PLWA 5AONA 1ZGAA 1HNNA 2QBYB 1FJXA 2LKPA 4ETSA 2EX4A 2PFBA 4CKEA 3C6KA 4U7DA 3UJCA 1R00A 3TO6A 1G8AA 2PWYA 2YVLA 4QPNA 2Y48A 3NEUA 5EVJA 3FM5A 4E32A 2P40A 4M9XA 1FBSA 4CTJA 3IC7A 5LQCA 5CIYA 2FSWA 1J75A 2YXEA 5IKMA 2L02A 4HYEA 3HP7A 2M1BA 2QZ8A 1W7PA 1X1CA 3GYHX 3KQOA 3FZGA 3T1BA 1RJFA 2GLUA 2JHPA 2M45A 3HRUA 3GRUA 5DTQA 1D2GA 2OBFA 3GFIA 3GO4A 1QAOA 4YIFA 3I71A 5D5UB 2KKOA 3BP8A 2PV0A 2OPBA 5EC8A 4GGGA 1XMKA 3E6DA 3UJ6A 4C04A 4QWQA 4A6EA 3CJTA 4HGYA 4RGRA 3E05A 3DXZA 4CXMA 5E9WA 4I02A 4IF4A 4RTMA 2DI3A 4KICA 3A27A 4OMZA 2P41A 1ONVA 3ML6A 2CO5A 4D0PA 2JH8A 4QLCU 3ME5A 4RVDA 5D6EA 1STZA 3G5LA 2V1DA 2PBIA 3QAHA 4RB2C 5J8CA 2BZGA 2Q0OA 5IH3A 2ERCA 3TM4A 4HF1A 4KMUX 4ZZLA 3RIRA 1HMYA 1P92A 4GOOD 1ON2A 3HRMA 3KP3A 2DPDA 3F8FA 4P5OA 2BEOA 5K0BA 4CZZA 5K03A 4ENKA 1I9GA 1CGPA 1WXWA 4WF2A 2OB2A 2CKDA 4PYIA 2MA3A 4E2XA 3AXTA 1BC8C 3K6RA 2Z6AA 2HQNA 2PY6A 3HOTA 4AVPA 3CO7C 4OQEA 5K01A 1GXPA 3WU1B 5BW4A 2LDUA 1E17A 3UWPA 3E5XA 3G8AA 1TQPA 2B3TA 2AXLA 3C7JA 2G1PA 2P1DA 1E2XA 3JWGA 1CF7B 3H2BA 3TLJA 1P6RA 3HCEA 4I98B 3BROA 3TR6A 1YLFA 3QOPA 3V8VA 2VDWA 10MHA 5F64A 3MHTA 4R05A 3NVKI 2FYTA 4HA8A 3G89A 2FRHA 4WX9A 4JQFA 2IGTA 3KPJA 1VE3A 1SAXA 4Y15A 4G56A 2ZBKA 2PXAA 5DCFA 5LHHA 1VPTA 4NHJA 2DBBA 3EGVA 4PYQA 3GO5A 1JHHA 3LAJA 3BUSA 3EMBA 3EVEA 3HVHA 4P7GA 2RKHA 5CJ9A 1Q0SA 2OZ6A 3WTSC 4RVFA 2MBFA 5F1RA 2QE6A 3OOPA 3M70A 2CGPA 1AQIA 1L0OC 3SZTA 1WS6A 3SSMA 3M6UA 1PRYA 4MEXF 1G6NA 1INLA 1L3CA 1ZYRF 5HDNA 5D1NA 3ROUA 3EDPA 1SFUA 1MZBA 4OBWA 1XB4A 3FXUA 3LA2A 2EG5A 2GH1A 1TLHB 3C1DA 3BKXA 3LCUA 4U88A 3M8FA 3T8RA 5J6XA 5GINE 5E20A 3CO6C 1KYZA 4IRGA 2MLGA 2N47A 3CBGA 4M73A 3UJ7A 4CXFA 3I58A 5FQOA 5J8FA 4KYWA 1YUBA 2I6GA 4RTQA 2VT2A 3KP6A 3HCAA 4Y2HA 2Y1XA 3KR2A 2FPOA 4GC9A 1O54A 1LEBA 5DYMA 4CTKA 5LR6A 2CWEA 4ER0A 1O3QA 3V7RA 3TO9A 2EV5A 4GUAA 3BGVA 3R6TA 3F8NA 4HSGA 3O6BB 2V1XA 2GAFA 4RSRA 2FEZA 3BJAA 1FOKA 3TOBA 3HSEA 1FBUA 1V3FA 2VXZA 5BPDA 4CO8A 2YPRA 5CLSA 1YS6A 4E2WA 5EMLA 4BHCA 2ACJA 5D5XB 4MHGA 4K6MA 3OE4A 5AIPA 1WSUA 2ZNYA 5A2QZ 3IYLW 4EQQA 2MH9A 2NS0A 1SQGA 2VC1A 2HGCA 3ULQB 2ZBPA 1YZ3A 2O07A 3O7WA 5EMJA 3GCZA 2VE9A 3WTXC 1VQ1A 1QAQA 4CGZA 2P35A 3NVMB 3SHFA 2AOXA 4QDKA 3LL7A 5DUKA 2P7CB 3J80K 3ID6C 2M8EA 3I4PA 3CJQA 2MC3A 2RVCA 2J5OA 3RKWA 3D0SA 1M0EA 3NMUF 2A07F 3GU3A 3KQQA 2IVMA 3I53A 4YFXF 2RN7A 1D3YA 1NHAA 3GXOA 2AOUA 4KDCA 4L0ZB 2OY0A 2TDXA 1RJDA 5EOVA 3L8DA 3K0BA 3NTVA 5CCBA 1H0MA 2A6HF 5FLXZ 4ISCA 3U2RA 3HEMA 1XCJA 4PIPA 1A04A 2DPMA 4PYJA 1VTNC 2D45A 5D4RA 5DV5A 3I64A 4Q48A 1XVAA 2YTZA 2IH2A 1F1ZA 1G3WA 4ER5A 3SVZA 3L09A 1FYMA 5CM2Z 2XIGA 4KDPA 5K09A 3WTUC 5CVDA 3DMFA 2FE3A 5LSAA 3HVKA 1ZLJA 5H6RA 1XXLA 3B3FA 2VODA 3FTDA 2XAFA 1LB2A 3MTEA 2PT9A 2P4WA 2ZIEA 4PONA 3Q9VA 3ECHA 1PP8F 2ONZA 3V8JA 1ODDA 2VZ9A 4RWZA 4OIQF 3DPLC 3I9FA 1R1VA 3G8BA 3VFZA 1P1CA 2NYUA 4HLYA 4Q5SF 5HFJA 4KVZA 2XYQA 1DDNA 1P4AA 1L9KA 2VBXA 4LFUA 4K2EA 2PX5A 1HW1A 4YUWA 1WXXA 3LDFA 4XUCA 3BGDA 2K27A 2XHKA 1ON1A 5H20A 4E2ZA 3AAFA 2F2EA 5DX0A 3MZYA 5HIJA 5FB2A 5FULA 1S6LA 1XDSA 2OZVA 3ELUA 2OQGA 3HA5A 2PMHA 5HOOA 2A68F 4GOLD 1RI7A 3L9FA 1WY7A 2HV9A 5FFZA 2G70A 2UYOA 2XROA 3C3WA 5LQUA 5E8JA 4OINF 4XCXA 1EV7A 2JT1A 4HLXA 4F7ZA 5FGMA 1ZRDA 3CUOA 3REOA 3FMSA 3C18A 4DCMA 5ERIA 2NXJA 4M37A 2BR3A 3R0QA 4L9NA 4X1OA 4X61A 5ICFA 1T2KA 4L5JA 1TNTA 3TOSA 7MHTA 3LQQA 2W57A 4GBED 2BR4A 4CDGA 1RJEA 1ZQ9A 3GWZA 2P3OA 5DD4A 4HZFA 5D8LB 1IN5A 1MDMA 3SM3A 4I01A 2YR0A 1XSDA 2O8XA 3HRSA 2R6ZA 5K5QA 4M6YA 3JWJA 1QAMA 4KIGA 2K4MA 4E2YA 3CGGA 1B9MA 1KQ8A 3EGIA 5P8WA 5K8VA 4FT8A 2AN4A 2YX4A 2KJBA 2ZXJA 3MAJA 3MB5A 4FSXA 1F38A 2PVCA 5KQRA 3M4XA 5E1MA 5CUQA 5ICCA 5EKXA 1OR8A 5DRYA 3PFIA 3P71T 4C03A 4A0ZA 2F5EA 4FX0A 3FUVA 5FA8A 1TW3A 5E1ZB 5K05A 3WSTA 1TQIA 1YW7A 5G02A 1NT2A 3HNRA 2ZO4A 3H92A 5T64A 4RTPA 3BKWA 4BH9A 1QZYA 3C6MA 4G7ZF 6PAXA 3BWCA 4AWXB 3WTWC 1R1UA 3EVCA 2OO3A 2IJLA 2STWA 4HTFA 2ZZMA 2CWWA 2GZWA 4G9YA 4RTSA 1XDUA 4Z2YA 2K7LA 4ZTBA 1Y8CA 5DXAA 3FUWA 1UIRA 3GIWA 4PCQA 3BDDA 1J2XA 1LDJA 3PS9A 1EH7A 5L3CA 4IRHA 5E1WA 2LD4A 2FA5A 4HX7A 4GQBA 3P9NA 4EKGA 5LRSA 2IIPA 2ESRA 3RYRA 1G6Q1 3FPEA 2UZKA 1XJ5A 1PJZA 2RNJA 2M87A 1U6GA 3PQJA 1DP7P 3RJPA 3OE5A 1EH8A 3CKKA 5DPMA 2F8LA 4RB1A 1BC5A 2V1UA 3FPGA 1Q1HA 1NW7A 4LLNA 2QWWA 3A26A 3DLIA 3RIEA 3JTGA 5TRDA 4BP1A 2HR1A 3FTFA 2UXNA 1BBYA 1VBFA 3SXJA 5BW5A 2F5FA 4AZTA 3QRFF 3DKWA 4RGSA 2ZWAA 3F21A 2X4HA 3TQNA 1XSVA 3A25A 1GVJA 2XYRA 3DXXA 5F6FA 3CUQC 1TPYA 3K1NA 4O6JA 2GWRA 2YX1A 4MQ4A 5BPIA 1DUSA 1Z3CA 3MQ2A 1M6YA 2YR2A 4MIKA 1H1DA 4AUKA 2P8JA 1UFMA 4N9IA 3HYIA 2GS9A 3ZMVA 2FBKA 3O3KA 1JQEA 4PYMA 4XUEA 5KQSA 3L00A 1FBQA 4YV1A 2H6CA 4UOEA 2GA1A 4LD5A 2W24A 2DO7A 4ATNA 3WGHA 5JVTA 1LDDA 2CYYA 1T38A 5HIKA 2C7RA 3WODF 1TTYA 1OKRA 4U7TB 4CHUA 1KPIA 2UXXA 3M6XA 4RTNA 3FUUA 2AOUB 2IA2A 1R8XA 2IH5A 2E1NA 2NNNA 4PZJA 4XRFA 2KW5A 4QQKA 4C05A 4LLLA 4YFKF 2IT0A 4E33A 3SX0A 1KP9A 1IN8A 1HKQA 1HW2A 3KCCA 4DM3A 3BJOA 2H6BA 1XGMA 2EFPA 1B59A 3F4KA 2A5YB 1FYLA 4Y17A 5DDGA 4R8HA 1ORHA 5LGTA 5LQJA 1G8SA 3R4KA 1RNLA 2O61A 5F2KA 5FD5A 1RI4A 4DQ2A 3BT7A 1NV9A 2FBHA 1H9TA 4UVAA 4LWPA 1JSZA 1U8RA 3QV2A 4H0NA 2W84A 4RVGA 4JXJA 2P3LA 2PX8A 3KEQA 2PEXA 1OYIA 3HSFA 1RI2A 3ELKA 4ER7A 4NQWA 1IXRC 2XAJA 2STTA 4ENJA 4WWCA 3MAGA 4FT4A 2BE5F 4HX4A 1O3TA 1S7OA 3QOXA 4PINA 4YV0A 3NWBA 4MGRA 1R6AA 4UV8A 1RJGA 4BHPA 2HYFA 4RYLA 3P7NA 1P91A 1PP7U 4RGXA 4KA4A 4YMGA 1S7AA 1G60A 3R61A 4OX9Y 2PJPA 4AX8A 4P96A 5ED4A 3EGEA 3EEYA 1YQAA 1F9NA 3NQOA 2EA2A 5H6QA 3ZP5A 2P3QA 3DMGA 3IEIA 3CJNA 3LAPA 1K79A 1JQ3A 1OR7A 2B25A 2CL5A 2EV0A 3E97A 2F5CA 3CC8A 2XUBA 4L5IA 5JFRA 5D5VB 2Z3YA 3J7AO 2OZUA 4M72A 2AZTA 2P7IA 3BXOA 2CFXA 2Z33A 4AIKA 1YF3A 2PG4A 4POOA 3PB3A 3P8ZA 3R3HA 3UJBA 2P8TA 3GEZA 2UYHA 1J9IA 1RIOH 5E9JA 1B6AA 4AZWA 2DTRA 2ZIFA 2JHAA 2PLYA 4IV8A 3UFBA 3VSEA 2PSSA 2HFHA 5EG5A 3TPZA 2VT3A 5E9QA 3F8MA 3DQVC 3SZPA 2P7HA 2BBYA 1KU3A 1AQJA 3GZ6A 2V79A 5HVQC 2H00A 2OU2A 3WTTC 2W85A 2P5KA 1MDMB 3GX4X 1J7KA 4Q4ZF 3AXSA 3QPHA 5JR3A 4Y13A 4LLGF 2CMHA 4EM2A 3M7GA 2YXLA 4Y30A 2YUIA 3EMDA 2O03A 3KLNA 3FPFA 4BHBA 1Z6RA 2KJCA 1SUIA 5EPEA 2ZSUA 1EAMA 4B09A 1U3EM 1T39A 2DAOA 1I6XA 4HDUA 1FYKA 2EWNA 4HBLA 4RTLA 2ZMEA 1SUSA 3BY6A 3FHZA 3PFGA 3BWGA 2HQRA 3IRQA 3CTAA 2QQ9A 4IHTA 4YUZA 4RS8A 1JG1A 4IV0A 4EQZA 2YSRA 4WXDA 4MTLA 4RTRA 3FYDA 5CVIA 4KRGA 3ANXA 4YV2A 3TFWA 4HTFB 5FADA 3HCCA 1HSTA 4G6DA 3Q7EA 1PDNC 3J81K 1O7FA 4U0VA 1YFLA 1U5TC 4F84A 1YS7A 3TQSA 2ZZNA 2WV0A 3KU1A 2DW4A 4I09A 4QPPA 1XSXA 2ESNA 5FD6A 1JE8A 1KPGA 5FTWA 2XVMA 3KEOA 2WA2A 5IT9K 2AOVA 4YUXA 5GM2A 2E7WA 3DH0A 2G71A 4X63A 3C0KA 1KA8A 2CSOA 3OU2A 2O05A 2EA4A 4E70A 2JH9A 2A61A 3IRRA 4HAMA 2QLZA 2EV6A 4U0YA 2KIFA 1U2ZA 2AVNA 4RX1A 3OZTA 2KRFA 2XAHA 4X60A 3J80Z 3A7DA 3E6MA 1G3YA 3THSA 1M6EX 2DU9A 3IHTA 3TO7A 3LCCA 4C06A 4R8SA 4N0BA 3U1DA 2BH2A 1AOYA 1U78A 4GOMD 3EETA 1WWXA 2XAQA 4IVNA 2ADMA 2Q41A 5DM2A 4BY9E 3DMHA 4FR0A 5FWDA 1QO0D 1MKMA 3GGDA 3ISPA 3CJRA 2Q8KA 3RW9A 4KW7A 4OA5A 3M33A 1PUEE 4EV0A 3GLXA 1I1NA 2KIMA 1VLMA 3NDJA 2CW0F 4DMGA 2L01A 3DUWA 2P6SA 4UUVA 3HA3A 3JSOA 3MEXA 2HDCA 1BC7C 5DEQA 3GDHA 1Z9CA 3DOUA 2HWKA 2ZLBA 1UHMA 2PGXA 3E7PA 3H3ZA 3DXYA 3X0DA 5BP7A 4GYIA 4XLNF 4BNCA 4S04A 4ZH4F 1C0WA 3SMQA 2ZCJA 1T98A 2AS5F 5LRRA 2JRTA 1FP1D 3B7PA 3FUXA 4YUVA 2AS0A 3QP6A 1NW8A 4QTTB 4GCVA 1LQ1A 4RAYA 4DCGA 2QQBA 1XTPA 2QUFA 5CVJA 4RTOA 2VN2A 2EJUA 4G8XA 2K02A 5HIMA 3WU0A 1QGPA 1I1SA 3OU6A 1EH6A 2BM8A 5E2AA 2Z5UA 2DT5A 1J5YA 1USSA 3KE2A 5CVUA 2GA9A 3P2IA 4DZRA 5DCMA 2XRNA 3K9TA 4HF2A 3PX3A 1ORIA 4A0YA 3F23A 2C6YA 1KR5A 1RI3A 3LDGA 4G6QA 1UHWA 1I4WA 2QY6A 2VOPA 3PQKA 4RTKA 1JQDA 4CKBA 3SXYA 2XV4S 4PWYA 3G3ZA 1N7JA 2D2WA 2GXBA 3T8TA 4BP3A 4M9ZA 4RB3C 5EMKA 2EFJA 3DV8A 4I7HA 3LA7A 4EMSA 3FYCA 3RDIA 4MHTA 3HA7A 4ZYDA 2ZTHA 2JTVA 2IPQX 2K4BA 1Q0TA 3HM2A 2Z6UA 1BKYA 1FSEA 5HDGA 2ZVJA 3ZN1A 2XKPA 4PYOA 3RKYA 3IKTA 2E5WA 2ZBRA 1VP9A 3W6JB 4ZYHA 5D1HA 2Q2EA 3ZMSA 4FGZA 3NWEA 1XCLA 1JR4A 3G88A 4XUDA 2P7VB 2PJDA 4EM1A 2FU4A 3KP2A 4KT5C 5TJJA 1O3RA 4GO1A 4PCLA 1R5HA 8MHTA 2WK1A 4MQ9F 3EYYA 2HKXA 3IWZA 3KQMA 4A5NA 4ESFA 2WTEA 2NXEA 2EJRA 2PX4A 1O7LA 2VBZA 3M6WA 2VONA 1R23A 5K0CA 2ZKZA 5HILA 4ENMA 1O9HA 3E5UA 3WGIA 3SSNA 5L3GA 1YFHA 4EKIA 3L2CA 5BOXA 3P97A 4KWCA 2FNAA 4I0BA 2NYXA 5K0FA 3NJRA 3O2PE 2IA1A 1D2CA 3LSTA 5D6FA 1B4AA 4PNEA 4YUYA 1YW9A 3LECA 3TDUC 5EIFA 2NP7A 1ZRFA 1FSHA 1LVAA 5FUBA 5LBQA 3IV6A 1FC3A 3WTVC 1SFXA 2BGCA 2DQRA 2HZTA 1DL5A 1R8YA 2ZNZA 4L7VA 1AWCA 3G2QA 2XYVA 1IN6A 5HOQA 5E8IA 2VOOA 3MERA 5EZQA 2EK5A 2B2CA 2JHCA 3C3PA 5EZSA 3CVOA 4R6WA 5EIWA 5EEGA 4ESJA 3LCVB 2ISZA 4C08A 1KU7A 1HXDA 5BXYA 5DUIA 3LDUA 2R7FA 2IA0A 3KQTA 3D2LA 2WC2A 2PXXA 3HVJA 3FWEA 3JWIA 4LK1F 4YG2F 3BJ6A 2ZMEB 2OQRA 3LGAA 2DULA 3FXQA 3HVIA 4BAYA 3OV8A 1FP2A 2M30A 2IDKA 3PT9A 3KR9A 3B89A 1LJ9A 1S3JA 3JTHA 1SD6A 4BQAA 4OIRF 3OPNA 4EVIA 5DSTA 3JAMK 1KGSA 1AF7A 4ZZDA 5EHIA 2RV8A 1YFJA 3LHDA 4OBXA 2QQAA 1T0FA 4U0WA 2Y75A 4WK8F 3PTAA 4LK0F 4ON0A 1F3LA 2E7XA 1BI2A 3KZYA 3LKDA 1KYWA 1USTA 3FMRA 1V39A 4EGYA 1L3IA 1ZREA 3ZMZA 3K1MA 2BYVE 3P2EA 1F5TA 3S2WA 2ETHA 2LSOA 3R0AA 5KVRA 2RC4A 3B3GA 4MTEA 1XGNA 1ZN2A 1WI9A 4PCAA 5LGNA 1P1BA 1SMYF 1ZG3A 1K78A 3M9AA 2D1VA 5EQJB 2NAZA 1VL5A 3UZUA 3K0LA 3U9GA 2PX2A 5LQNA 3P9KA 5HS7A 2XASA 1SG9A 5HLHA 4QQNA 5FWAA 3THRA 3G2PA 3BZ6A 2NRAC 4G7HF 1JG4A 5LLQA 2GA2A 4MQVA 3ZMUA 1Z05A 1G4DA 4UXNA 5DRTA 3H3UA 4S05A 1XCVA 1QNTA 2V74B 5KK1A 3KQVA 4KUMA 4M74A 3ECOA 3FPJA 2EFQA 2YU3A 2C7OA 1FPQA 1EIZA 3B73A 5CYVA 3KLOA 5E2BA 5D5WB 3EPPA 1HSJA 3LKZA 1JSXA 1P2FA 5CD1A 3VODA 2DK5A 4KN7X 3AWIA 2I9KA 4B17A 2F5DA 1UWVA 2UYQA 3NDIA 4YMHA 1JTFA 5T67A 3ELDA 1IRFA 1XCBA 3MQ0A 5EMMA 4OQDA 2CQKA 4GF5A 1YO5C 1QPMA 3K1PA 4BLWA 1YTYA 2G7UA 2XGXA 4LJZF 4FS8A 1SKMA 4KFCA 3HCDA 3W6KB 1R5GA 1ZG5A 2VC0A 3C3YA 5HZMA 4JBAA 3V8KA 2O57A 4IHSA 3I59B 4FP9A 5ILSA 2FQ3A 2P6TA 3UJ9A 5FQNA 1FWZA 1MD0A 4E31A 5K5RA 3TOAA 5ILUA 2FK8A 2AR0A 3V7CA 5CCXA 3LBFA 3DLCA 5LQKA 2R3SA 5DXJA 4JK1X 3V97A 3TRKA 3SQNA 1G38A 4UVCA 2IP2A 3KPYA 5K0EA 1TBXA 2G8NA 1FY7A 3GRRA 3UJAA 1GHCA 3P2KA 3HHGA 3HCBA 4P58A 3R6SA 5DTMA 4A5MA 5C9ZA 5DCMB 3EYIA 1Z6TA 1IRGA 3KP7A 4MNUA 4DNCA 1D8JA 5DX8A 1IY9A 2ZIGA 3GRZA 1FT9A 2O3FA 2ONYA 2ZBQA 3TDZC 1R58A 5DWQA 2IBSA 3F6VA 4O5VA 2Y0MA 3M8EA 3IKVA 5GIPE 3ZMTA 3DP7A 3WE3A 5K1YA 2HOEA 4HV5A 1LDKB 2W25A 4L9VA 3IWFA 5M5BA 3N4MA 4LB6B 3KFWX 2IPXA 1G55A 2C7PA 2FBIA 1SVUA 3GZ5A 2K4JA 2VDVE 3V7SA 2MD5A 1QQIA 4MTDA 3DFGA 2WWYA 3A4TA 1DUXC 1P4WA 4X41A 1X1AA 5T6BA 3Q9SA 4XSZF 3OZRA 4DF3A 4C07A 1HBXG 4M36A 2GPYA 1YYVA 4OIPF 2DLLA 2OB1A 2FF4A 2AOTA 4MEYF 2VBYA 2AOWA 2BR5A 5HIIA 2ZZKA 3AJDA 3ERED 2B78A 1BN5A 3FX3A 1KPHA 3SFZA 4YIIA 3D5LA 4AZSA 1SFEA 4OA8A 2YXDA 3T5XA 3CDHA 2YQZA 1KHHA 3KR1A 4F85A 3EQLF 1FX7A 1BJAA 3LWFA 2QM3A 3G5TA 3CUQA 2OD5A 3CCFA 3EVBA 3T7SA 1ZG1A 3KHKA 4RVHA 1IXCA 1REPC 3ORHA 5FO5A 3G2MA 3VEPA 5DTRA 3FMQA 3DULA 1Z7UA 1O9GA 2JZYA 2EFWA 4EJVA 4ZYGA 4IJAA 3ERCA 4HRAA 5BMZA 4HG2A 1WKMA 2ZFWA 2MH2A 1ULYA 3OCJA 3OU7A 3VB2A 1EJ6A 2NXCA 3DR5A 2JJQA 3PX2A 5DSXA 3L7WA 1D2HA 1Z1DA 3CLOA 3FTEA 3V4GA 4IXAA 5LQAA 4HW0A 1FLIA 3E5QA 3KPWA 2O6GE 3J81Z 2CMGA 1SD4A 2VP3A 5DM4A 2YX7A 2ZJ2A 3T0YA 5F2OA 1WG8A 2H1RA 4WVLA 4V0QA 1P4XA 3EVFA 2NP6A 3T7RA 2EB7A 2UWMA 1R1TA 1KIAA 4DA4A 2ADUA 1WZNA 4RGUA 4HH4A 3UA3A 4KIBA 5LHIA 2H11A 3COAC 3KPUA 5KYGA 2PKWA 5K5OA 3EVZA 4HC4A 5IT9Z 5GM1A 1TW2A 4BLVA 4HF0A 5LGUA 1MJ9A 1RUOA 1G3TA 4XLPF 1ZHFA 1Y0UA 1HW5A 1DPRA 2R7DA 4RV9A 2ELHA 3OFKA 4A12A 4EM0B 5H02A 1HKTA 5FCDA 4LG0A 1KXZA 5L3FA 3TKYA 2QRVA 1XGOA 3KP5A 3DTNA 3EVGA 1SQFA 4R6XA 1F4KA 5F2NA 2OXTA 1EG2A 3I5UA 1ZGJA 3JW4A 5DT2A 3F6OA 2HYGD 1KU9A 1MHTA 3GRVA 1D5VA 4EGZA 2HS5A 2COMA 1VIDA 2K86A 3FTCA 4AIJA 5CVEA 1JG2A 4V0RA 2ZFUA 2OBPA 2ESHA 4HQMA 2Z9OA 2ORED 5EGSA 1NW5A 2L4AA 4PYNA 1NW6A 4F86A 4HV6A 3EEOA 3SGLA 4Q47A 2RGVA 2IRFG 3UA4A 2QENA 3MGGA 4R79A 5JI6A 2E1CA 2HEOA 4O29A 4GC5A 1S8NA 3F72A 1W7PD 3RPUA 2RQPA 4B8XA 4O3MA 1XMAA 1TQMA 3UJDA 2OA4A 3F8BA 4WCGA 5HS8A 5DLYA 4L9TA 2ISYA 5LEJA 2EFOA 2X0LA 2FMYA 4PDKA 1K78B 4AIHA 4LMYA 4U7PB 4EK9A 4H0EA 1MGTA 1WQ2A 1NBIA 2ZULA 4GXOA 3E8SA 3HIFA 1XN7A 1BOOA 5JHUA 1IXSB 1JGSA 3MFKA 1O57A 4KN4X 4A2UA 3ELWA 1KU2A 1TNSA 4QTUB 3KQPA 2G9WA 4AD9A 1X3UA 3E6CC 1KQ0A 4KIFA 3RTRA 3PVCA 2UZ4A 3TKAA 2PXCA 2GAUA 5FFXA 4MWZA 5E1DA 4P7JA 4DQ0A 2C7QA 1FZPB 3ZQ7A 1JHFA 4U7BA 3HUGA 1IAWA 3FRHA 1R74A 3LQRA 1YB2A 2V7EA 2PWPA 1IF1A 1ZRCA 4GEKA 3F8CA 2FOKA 3PLAE 3FF5A 1DCTA 3GW2A 3WE2A 1QZZA 3GFJA 3IL2A 1RUNA 3DXJF 1R7JA 3I59A 3BGIA 3K2ZA 1NV8A 3Q5FA 3AY0A 2FHPA 4FZVA 5HEKA 1D8KA 4M9SA 5K0LA 1OPCA 3ZMDA 9MHTA 4UHTA 1Z91A 5K0NA 3A7EA 2A3SA 5GP1A 5K0JA 4E30A 3JSPA 5MHTA 3ABUA 3IHUA 2JPCA 3ABTA 2AN3A 3FM3A 4QVGA 5JUWA 3QU3A 5HS9A 3F22A 4P9FA 2IBTA 5DM1A 1FBNA 4P55A 1RI5A 1MJAA 3LX6A 5KVAA 5LHGA 1QYRA 1XGSA 2XAGA 1IN7A 4L9JA 1S29A 3DEUA 1U5TA 3GNLA 3LFKA 4A6DA 1R36A 3HTUA 4RTJA 1VP3A 1OMIA 4OMYA 2GXGA 3E3VA 5AIQA 3K69A 3OZSA 5A2QK 1B9NA 2HMYB 1U2WA 5HDKA 2XBMA 3N97A 1L3LA 3E6BA 3ER8A 3TGNA 3HOSA 2J5PA 4L0YB 5E17F 3U81A 2QBYA 3HTSB 2O06A 5FA5A 3WG9A 2FRXA 2L54A 2AOTB 1RZ4A 1NKVA 4CICA 3FZVA 2IDJA 2L3DA 1EQAA 2FNPA 3E23A 1IXKA 2PT6A 2VBWA 4FHTA 2HKOA 2IFTA 2JG3A 1YZHA 2JPBA 4M7RA 2DPUA 1P39A 1X1BA 3O31A 2PI0A 5GIOE 2G72A 2VS1A
chains in the Genus database with same CATH superfamily
4QNMA 3PNMA 3P9CA 4US0R 4K6CA 5I9IA 1UC9A 4JLDA 3ZV4A 2HK8A 3GGPA 5NULA 5DBOA 2IXDA 3MWDB 1MBEA 3IH4A 3UANA 3HY3A 4AY5A 1NY5A 3ZV7A 5H2FC 1W19A 3IKJA 2ZVDA 3HKEB 1E6EA 5CM8B 5M5WJ 2VHWA 4F5ZA 5JNVA 5JO0A 1Y7TA 1AXGA 2FMFA 2QVXX 5HKKA 3V9AA 3LNTA 5AMXA 2IPMA 2B0LA 4FGLA 3CVVA 1HGXA 3WGNA 3T0IA 2L2QA 1CRLA 2HTSA 3CONA 5DW3A 4W1SA 4ZODA 1QHEA 2CL6X 3B1FA 5M5XJ 3AVXA 2QXTA 3WTZA 1H8AC 5EYPA 1AZWA 5DLPA 2HNKA 3TMYA 3G68A 2IZ7A 3RZDJ 5LC1A 1W35A 2OXCA 4MA0A 1O0BA 4ZI7A 5AHXA 1FP7A 1KQ9A 3DE4X 3MA0A 3VWBA 3T3HA 3ZLVA 3VPCA 4LB5A 3K5PA 3RKUA 2P9TA 2H09A 1YW8A 3PE4A 3VPDA 4XQ0A 4ITVA 2R1TB 1JXSA 4CMKA 1OU4A 2ZXEA 3BWBA 5BS6A 1AGPA 5C2JB 1XVTA 2VPRA 4N47A 1SVIA 4CMIA 1WRJA 4MRRA 1Y1PA 5FKKA 1JTYA 5BQTA 1U4NA 2MG4A 2H1HA 3OLVA 3CTPA 4CKCA 2PKQO 2G77B 4XVRA 3P9IA 1I1GA 1ORWA 3TSZA 4ZJPA 1RWBA 1XQYA 1DG1G 2OCPA 1M2KA 1BOAA 1B7GO 4QO8A 2R4TA 3K9LA 3DAGA 4LTMA 1LEAA 1KZ9A 3KZZA 2P77A 1R4ZA 5EJ9A 3KKEA 4L3VA 1R16A 1RBMA 1O5TA 1U9NA 3HTXA 4LE0A 4N9WA 4HNTA 2R6FA 3JQAB 4ZCTA 2MOKA 3JCUC 4OFWA 4MPPA 2I87A 4OI1A 5PNTA 2C5BA 3RT9A 2VSOA 1B4DA 4CCYB 1FSPA 1YVPA 2Q2WA 1BZYA 4AMUA 3SHQA 2PBLA 1R9MA 3AJEA 4KQ2A 2PLWA 3ZGLA 1FTQA 5IP5A 1K6MA 4CKEA 3E22B 3RVJA 1S2OA 1GPYA 1L5ZA 1EP3B 2X13A 3E4CA 4NMXB 3OYNA 1C3OB 4CTJA 5LQCA 3GDOA 5CIYA 3LPCA 2XUAA 3DAYA 2V4MA 4CA0A 2PZMA 4WRRA 1KZ4A 4Q3EA 4JP3A 4RGQA 1W7PA 3KQOA 3IULA 1KMCA 5TS2A 1U8ZA 5GV7A 2M32A 2JA8J 2GPNA 2OM2A 1FXWF 1QFYA 4BMPB 2ZQ5A 3LF2A 2LR8A 3LDAA 1WI3A 4CUZA 1PJ2A 5GVSA 4QJBA 4A6EA 5H68A 5HRAA 2FZKA 3WIEA 4V1CA 2A9JA 1EWQA 4JT8A 2XUGA 2GAOA 1C0PA 5EGOA 3U13A 1NG7A 3FFTA 1ZK0A 1VBKA 2JAWA 5KJ1A 4ENKA 1WXWA 1UJ5A 1RABA 3BGOS 4DNXA 2QKYA 3LK7A 3K6RA 3HZJA 5EIAA 3J81k 1HE5A 2QORA 1TQPA 1WPKA 4EHKA 2CT8A 3VPXA 1IGNA 1RWPA 1NOIA 3V8VA 1ZS9A 1KJNA 2FYTA 3CH6A 1EA7A 2HDHA 3G89A 4DT1A 5D01A 2I4IA 4Y15A 1QTNA 1PR4A 2J7PD 2A9RA 5LZ2A 4BQFA 4E5MA 3QYPA 1EZZA 1JHHA 3ZDBA 1Q0SA 4XTCS 2QE6A 3GCXA 3M70A 1GTZA 1WS6A 3SS9X 1YJCA 5AHOA 3F7NA 1D0XA 2D5VA 1INLA 1JB1A 4E2FA 4R3NA 1CY7A 1MZBA 1NVMB 3RT7A 5IDXA 2I91A 1SA0B 1K08A 2MLGA 2NU6A 2N47A 2DMQA 2ZXFA 4JC5A 3JPWA 3IQGX 2J30A 1PQPA 4TLAA 3ZCOA 4PVDA 3U39A 3JATB 2Q3DA 3FMPB 4MFEA 5KBYA 5J3LA 3ZHYA 4JNCA 4XRGA 3K0CC 1J0AA 3RI3A 1H2BA 1NHGA 3R6GA 5KCMA 3LPNA 1CPYA 4HSRA 3BZCA 3AKZA 1HY3A 2ZBPA 2B4KA 5CYOA 4A2WA 3K2BA 1AKWA 2CDCA 3ZWXA 4BU0A 2ZT8A 5BRJA 3LL7A 3FX2A 3EGCA 1VSVA 4BKPA 2J5OA 4UM7A 2YJZA 2D1TA 2WI8A 1YX3A 1N6OA 4JI0B 3LDHA 4WK0B 1NQUA 4EGQA 4Z4CA 2AG1A 4W7HA 1NHWA 4Y2RA 1YIJI 1WUTA 1XVAA 2IH2A 1AZTA 4MS1A 1P3JA 4ER5A 4P82A 1OI7A 4F1KA 5CLLA 4QYTA 4AP5A 2IDZA 3U4MA 1IOWA 3FTDA 4MZXA 1QF6A 4ARZA 5JCJD 4EMUA 4NARA 4QJ3A 4GW3A 4RWZA 4NBTA 3DNFA 4Q9IA 4RORA 4F4FA 3PNKA 3OYCA 1UK8A 1E5LA 2I2AA 1RQNA 4KACA 5L51A 3E1KA 1TMOA 3PUWA 1KR2A 4K2EA 2PX5A 1GV1A 1RLMA 2CMDA 1TUBB 1NYLA 2EFEB 2L18A 3CY6A 2YV4A 3JXEA 2BDUA 4KUHA 4NIMA 2DMRA 4J4HA 1Y1TA 2OZVA 1MBGA 4O3FA 3MTGA 3WAJA 1LK0A 2BP7A 4D3XA 3C3WA 3C2HA 3TS1A 1TJNA 4LJ5A 5FGMA 4LSWA 3H9QA 2NU8A 3G8DA 3K6SA 1LFDB 3H0CA 3N5KA 2C61A 1C4XA 1SHZA 4W7IA 3V46A 2W7NA 2Y1DA 4WOJA 2WD7A 1V96A 4C6HA 2K4MA 4GI7A 1KQ8A 3KYJB 1E58A 2ENWA 4FSXA 1FSZA 3AESA 3L7OA 4W9RA 1SCUA 3ZW9A 1G8XA 2FWPA 5FPTA 1MEOA 3N5CA 3R7LA 2ZI9A 3DMTA 1X7DA 2QIPA 2JQ7A 2F4NA 3EVCA 1HWYA 3EOBI 4PN3A 3R7SA 1U5AA 4BKQA 3ZDEA 1EX9A 3KDSE 3KX2A 2BGLA 7AT1A 4LE1A 2VJBA 2F48A 1J2XA 1P4HA 1L0BA 3P9NA 4BX3A 3SYLA 3T6KA 1DP7P 2M1XA 5LU9A 1NX9A 4RKFA 5F4BA 3L0DA 2GK3A 3G6WA 2R8BA 3FYUC 4JBYA 4U0KA 1CETA 3SXJA 1HK7A 4D80A 1GVJA 4B85A 5F6FA 4WACA 1B93A 1CDOA 2G0NA 4TMKA 3DCIA 3NIBA 4FZ5A 3TLZA 1HDYA 2E49A 5TEWA 3GCWA 4DIKA 3UHFA 1QOQB 4Y1FA 5JZVA 4J1NA 4EYKA 1QYCA 2PWZA 4QDZA 3GGOA 1HL7A 2HSDA 2XJ4A 1J42A 3NTXA 4AVZA 3U44A 4EHFA 2W24A 3IDFA 4RHTA 3G0OA 5HODA 1QM5A 4IQGA 1UMBB 4WDQA 5KNCA 4TZKA 4MW4A 4RTNA 4ADSG 1L8QA 3JQFC 2A0UA 4ZVOA 2OBMA 4LLLA 4TTSA 1SG6A 1D2EA 1G17A 2H3HA 4Z9FA 4MWBA 4GP7A 3QLJA 3B6AA 2FN7A 4JCOA 3ZU2A 4G4IA 2GBCA 3OY2A 4CQLA 3GJ5A 4ZC3A 2I4TA 5JZ9A 1KO8A 5MF6A 1FRQA 1XNRB 2PX8A 3KEQA 2YZGA 3R7FA 1YH3A 2OJED 1DADA 4L16A 4WN9B 2XAJA 3H8WA 3AEKB 2GD2A 2EIHA 4OAPA 1JE1A 1ZNWA 4U6SA 2ZITA 3TCXB 1E77A 2IXGA 1SMKA 3VZDA 5EKDA 4B82A 3SC2A 3RSLA 4TVKA 3N58A 5AQEA 2CE2X 4AX8A 4XM2A 3OPYA 2D0DA 3NQOA 2EA2A 4AXBA 3LAPA 3IS3A 1JDZA 3ET5A 2Z3YA 5T4EA 5FLMJ 3B3AA 3N0TA 2P0EA 1YRBA 2FW7A 3FA2A 1MRNA 2AMLA 4E11A 1UDBA 3SOPA 1BWRA 1DBPA 2HFHA 5EG5A 4RH1A 1H8HA 3GZ6A 2XAUA 2W85A 2XRZA 3HHEA 1PZFA 2C5EA 5JR3A 2L9SA 1N5LA 3QE2A 2Q7DA 5JH7F 2QE7D 2GYYA 3K6JA 1I80A 3S7TA 2GRJA 4NZ9A 3A6DA 1GV5A 2EWNA 4P38A 5AJYA 4GLOA 3PSIA 5JS7A 3RS7A 1R0XA 1IUOA 1VLQA 5JBIA 4RULA 4RDXA 2Q6OA 3WLHA 2P1RA 3IAM1 3ANXA 1W1WE 4YV2A 2V98A 1RE1A 2J31A 1I7NA 3HCCA 1E7RA 4BBAA 4Q7QA 2HT1A 3MXTA 4UHEA 2WJHA 1F4PA 3PUJA 2LTPA 5FWXA 3T5AA 5BSUA 3ZKWA 2RHMA 1B1CA 2HXYA 4YUXA 2OCYC 3KB6A 2HA0A 2WKQA 2J5RA 1D7AA 3HOUJ 4OJMX 1BGWA 1U2ZA 1CUCA 2AVNA 4YJ2A 3E3NA 4A3SA 2VN8A 4GMGA 4R2LA 1E0AA 1M6EX 4DLTA 3ZK7A 2IYXA 1OF1A 2VSYA 3GLIE 2ZJ7A 4KO8A 4O4LF 3M33A 1Z16A 1LU9A 2FR8C 4XM1A 2HF8A 1AB5A 1VLMA 3BLYA 3A4IA 1YE3A 1ZZGA 4ZT2A 3GJXC 5H3CA 1HDCA 4JBWA 4RPIA 1NSYA 1YVEI 2BE9A 1VGRA 3ABIA 4J90A 1M8KA 3HXOA 4DJTA 1N36B 5L3RA 1B0AA 1ICEA 3LY7A 4QTTB 1QG0A 2CXSA 5JD6A 3G2JA 3V1UA 2QUFA 2XTAA 3ZWNA 3IIKA 4HUQA 1U1FA 4DR7B 1GPWB 4LG3A 3QX9A 3QE9Y 3KSAC 5DULA 2RI6A 2XCSB 4DEYA 4A0YA 4RF3A 2OT3B 5JD4A 1FX1A 4HX9A 2XV4S 1WSAA 4O1IA 1GUAA 3VKHA 3JQ8B 2F43A 2BHNA 4M9ZA 2NUTA 4LKOA 4LMPA 5LYJF 2JTVA 1PFGA 4HF7A 3WLMA 3HVRA 2LLKA 2Z2SB 2PGDA 2XA9A 1T10A 3SR3A 3H35A 4XFKA 5B3KA 4DR4B 1VJDA 2BMDA 3FYUB 3RV4A 3W6JB 4FD2A 3LQKA 3R5SA 3V4PB 1XJQA 1TK9A 2GOYA 1W0UA 4Q34A 3ZJ5A 2E4YA 5IDVA 5K45A 4KT5C 1W0KD 2ACKA 4PCLA 2ZYTX 1RFGE 2KFDA 4JSTA 3TAHA 4BE7B 4LDRA 3SJBA 3TRDA 2EJRA 3KKKA 3TGPA 4BNXA 2YV3A 5HILA 3GTMJ 3TLBA 3VC7A 1VQ4I 3E5UA 1VLVA 3SZRA 4HWGA 4FGWA 3MT7A 3SK0A 4MI9A 1WPQA 1CXZA 2P0WA 2I78A 3TYXA 4BPBA 4W5JA 4KXMA 1XZAA 3UMSA 1HTWA 3EF3A 4Y3UA 1LVAA 3K2EA 5FUBA 1UMCB 4O1MA 4JQSA 4FGUA 3WTVC 4ZYVA 4PV7A 5BN4B 3IBCA 4XYLA 2ZOSA 3KZVA 5ENDA 2AYXA 2EZ9A 1NVUQ 3HOVJ 1G20E 1HXDA 1GWNA 3D2LA 1ZC3A 3AO0B 2PXXA 2GN9A 2DCEA 3MUOA 4L4SA 5DBEX 2ZUDA 1N2GA 3M9XA 5IUKC 2ODNA 3C2GA 4XLAA 5DSTA 1DQSA 1WXFA 2Z95A 1AF7A 4TV9F 1MX1A 3F67A 4YIRX 1RBZA 4ARSA 3RIMA 1OLOA 3NNSA 1FP6A 4XMYA 4QYMA 3FMRA 3TNDA 3H2GA 1TVKA 5JC8A 3R0AA 5CURA 5EUQB 1XGNA 3B36A 1LLFA 1OAKA 3ZW8A 3E5HA 2RKOA 3LCMA 4NG4A 4NZZA 1VL5A 2UDPA 1L7VC 4KN9S 4CMJA 5FWAA 1XU4A 2Z9CA 4WCDA 2I34A 3HEFA 2BBSA 5DNEA 3E48A 1QA6A 5TPZD 3GXBA 2Z9BA 3KQVA 1TADA 4YQYA 4IOAF 4JASB 1V6SA 1JIKA 2CU7A 4MULA 4MYSA 1Z36A 1KEPA 5IT9A 2QA4I 2P6OA 1NLFA 3NVAA 5FEMA 3LVRE 4CEHB 3JD4A 4F4CA 5EMMA 4OQDA 3K1PA 5A4IS 1Y5MA 4R7TA 4Y0NA 3OOUA 4LJZF 4AF8A 4G5SA 5KU7A 5ENVA 1YK0A 1R5GA 4TOIA 3RO7A 4BZWA 1MIOA 5IWCA 4R3UC 4KLAA 2X19A 3U3ZA 1T9GS 2VHCA 1LGYA 1COZA 1NDQA 2XF5A 2BUCA 3O4GA 1SOAA 4NXNB 1WBDA 3A10A 1DLJA 5E2IA 4UVCA 3KPYA 5KNDA 5JWOA 2PUDA 4P58A 4A82A 1TF7A 1SG0A 1IRGA 4ARCA 3OYFA 4MNUA 2IBSA 4C6TB 2QZ9A 4I0WB 2J3KA 5C1PA 5M5BA 5C7LO 2IPXA 1G55A 3FISA 2RHOA 4RJTA 4JVMA 4F52A 1B72B 3RYFB 2WWRA 5T6BA 4XSZF 2CMKA 1NR5A 1UJ8A 2V0GA 2JB9A 2FUCA 3EGOA 4WBNA 2PZFA 2ZZKA 4DARA 5LBUA 2GD6A 4XKWA 3EQ8A 1KQNA 1IY8A 3FOBA 1ZMRA 4IKOA 2BGRA 1A9TA 4LITA 1EVKA 4W8GA 1IXCA 1JDBB 3FMQA 1T9GR 1DFHA 4MMXB 2EFWA 1VKNA 3BFPA 4OQZA 3VB2A 3L7WA 2Z56A 3PC4A 3KJHA 1E0EA 1YNOA 4CIYA 1REQB 4K87A 1W0TA 5HLTA 3KPWA 1KMNA 2X2EA 2YX7A 1T4BA 3T0YA 3GPLA 2H1RA 4MO2A 4AJPA 2UWMA 3QWBA 4K0RA 5IVPA 1QP4A 3A2LA 5KYGA 4TPKA 1TW2A 5KYTA 2HJSA 1HW5A 2CZGA 4UY8I 3VR6H 1QP7A 3KSRA 3HRKA 1W85A 3QLUA 5IY5H 2HYGD 2COMA 1JG2A 4WLUA 4ZCPA 4MVCA 4PYNA 1JR3A 3NZEA 1YGPA 3K6GA 4BO3A 1WHTB 2XTNA 3AONB 1GRRA 2HQOA 1GPAA 4O3MA 2GTPA 1TQMA 1CSEE 1XN1A 1P2BA 4BEHB 3WLSA 2OHVA 1H6BA 3L43A 2I22A 2Y2UA 1AY0A 1OXKB 1V6AA 3KIPA 4I9HA 3MFKA 3KKLA 3KQPA 1VCIA 2FMHA 4JT9A 1IC8A 1UADA 2YRFA 4BIMA 3BMQB 5EGNA 2RG1A 4KQFA 2GN4A 4B84A 1SVKA 3KSBC 3BE6A 3UICA 3TBHA 3AC0A 2H9AA 2BXYA 1IG0A 2QYTA 2P4HX 1KFEB 3T9AA 1VXRA 3MBKA 2IYQA 4B47A 2C3OA 3SXUA 2LRDA 4TTTS 4UJ5A 5AI0A 2W8BB 1YMVA 2WHEA 3AI1A 4H08A 2XGCA 1HEYA 4NOKA 1EINA 1IM5A 3KUUA 4Q3LA 2B7EA 2YDXA 2ZTLA 4P9FA 1FBNA 2B8WA 1C30A 1V8ZA 1H9BA 5KVAA 5BSWA 1QB8A 1J0DA 4YRKA 3WDLA 5EJ7A 1POGA 4BVHA 1UJ6A 1ELOA 2PUVA 3D64A 1MJHA 4IH1A 4RPLA 4MPDA 4J7UA 2BBWA 4DREA 2X2PA 4CT0A 3N97A 1KWKA 1YKGA 1Y7PA 2K87A 5JRZA 3X2EA 4NBNA 7MDHA 1ZRMA 3MD0A 5HW0A 3ZJ4A 4N3NA 4ZCLA 3R0ZA 5IYDJ 2PT6A 2PZJA 3WADA 5DLEA 4D81A 1MOSA 3O31A 3M5WA 3S14J 2HA7A 3WX0A 2GXUA 2WA1A 3F3KA 1TZLA 3R77A 3EZNA 4RZSA 4XIFA 4PE5B 4KBFA 4MEJA 1YBHA 3SJCA 4W5OA 3U1VA 5JY1A 1KAEA 2JL1A 3BL8A 4QBFA 3K0FA 3ZDYB 2PD3A 3JZAA 2P5LC 3A9RA 1QYWA 4I50A 1U0BB 1O97C 2YWDA 4YAKA 4UMDA 2PPVA 2RD2A 1PG0A 5AW9A 3OO0A 2FUG2 3FPHA 4TMVA 3QY9A 2Q9BA 3BICA 3DOFA 4OHVA 4D1YA 1UPCA 3R09A 2IUTA 4KNYA 3O8GA 4Q39A 2VYFA 2DFEA 1VI2A 2NV0A 2HYIC 1HE4A 3LXRA 1DJLA 3N1UA 1FEXA 3OCVA 3RR2A 2GQQA 2EHJA 1PJQA 2YZ7A 4PBTA 1K6OA 3MJHA 3TQRA 5E0OA 1WXIA 4RMGA 4B6GA 1NMZA 3SEQA 4KFRA 5DXFA 3VNQA 3JR9A 3UKJA 2RDPA 2B82A 4JWTA 5CYGA 5C8YA 3IQHX 3OX3A 1L1FA 1AV6A 5GTHC 1A77A 3CHYA 4ND3A 3AFMA 1DAFA 1SKBA 5HF9A 3PNVA 5FFMA 3EQZA 3QJ5A 3D2AA 1Z6QA 2QQ0A 1N1EA 4COKA 4FT2A 1MKYA 4JLMA 3IPYA 3I6ZA 3VU9A 4A03A 3PEUA 2X1HA 2ZRQA 1SZJG 5KI6A 3A1SA 1QU2A 5E1XA 3G2IA 3NC0C 2O8BB 1PR9A 2Y1LA 1J0RA 1K6IA 2BI4A 5JWRA 1UFOA 4TL6A 5NLLA 3QOYA 3MXOA 1E62A 3AV3A 5JS2A 2WIJA 5IPAA 3TECE 4C7OA 3RFTA 1OYYA 3C48A 1A2BA 2X1EA 1J0BA 3NHKA 4HGZA 1OR7C 5ERGB 1MJFA 3MQ4A 5DNWA 2BGWA 1PL7A 5JDIC 4CEIA 1N8TA 4H77A 3AR9A 2JJ2D 4A8PA 1XZQA 2QZSA 1M74A 5KYXB 4AJLA 1BR4A 3FVTA 3M4ZA 2M5WA 2FMLA 2QRLA 4GD3Q 4IJ5A 1WXHA 5DEIA 3AM5A 4TSFA 4J1TC 5T3YA 3NBXX 4EO4A 5GWXA 4LX8A 1AN9A 4I2OA 1C1XA 4NYIR 2DMNA 4HEHA 2WJIA 4LJ6A 2ZRIA 4J03A 4BZZA 2KLBA 1KMQA 3I0MA 3QPDA 3V3TA 1E99A 4KYVA 2LKPA 1T5DX 2EX4A 1JLHA 3ZLTA 1OYOA 3K92A 1TYBE 4R7GA 1WX1A 3F49S 1FYWA 4YT8A 3JALA 1A88A 1O97D 2HPIA 2B6NA 2Q2OA 2OV4A 4L6IA 3PLNA 1TEXA 5JNTA 4JOMA 2QTVA 5B5SA 3A3KA 3UNXA 2ID7A 3GFIA 2DA2A 5JJBA 1QAOA 5HNFA 3T0GA 4POAA 1VL6A 4MJLA 2ZIXB 4OM8A 5LCXA 1B8VA 1XTTA 4YEJA 3WXMA 5J43A 3MLAA 3A27A 4JQZA 3I42A 3OYJA 4GRIA 1PFVA 5J8CA 2CXOA 1RWNA 3FXJA 4DV2B 3RV3A 4MYHA 2DPDA 3UT0A 2BEOA 3N6RA 1QZ3A 3QA3E 1T4MA 4PTZA 2IZZA 4G65A 1E0SA 4I9NA 5EY5B 2R8OA 1MC5A 3CO7C 3REQB 5BW4A 1KEWA 3G8AA 1RXVA 2JBHA 3OUTA 2B3TA 4M88A 2MD0A 4RV4A 1CF7B 3ZK8A 4BKXA 2QLJA 3LC0A 2FRHA 1SAXA 4INZA 3UMFA 4L95C 3OLCX 2PXAA 2DOEA 1EU1A 2GHTA 1VPTA 3T1YB 3OQVA 3LAJA 3ET4A 4F8JA 5KAMA 4I55A 3PRHA 3WV5A 4D82A 3S2FA 2AQFA 4D98A 1TLHB 5C4IA 1MO6A 2G9ZA 2P9EA 3RB8A 1K2WA 2Q4BA 4IIUA 3ZX5A 1E2PA 1N32B 4AJ9A 2GDJA 4GM4A 1V11A 1J5EB 4G89A 2GM4A 2JSPA 1LEBA 5DYMA 2EZKA 3NT2A 4CTKA 3QYFA 4UOQA 5JALA 5IFLA 2ZSAA 3R6TA 1JZTA 5ESDA 4QVIA 2ZM5A 2V1XA 2Q1ZB 4LY3A 5BOSA 2IZOA 4CO8A 3H99A 5DHTA 2DLNA 4KXQA 3OE4A 5JAPA 4CLXA 1GNRA 1X2MA 2CXUA 3W2EA 3KZCA 1SQGA 3RSGA 4DW6A 1MAAA 1I30A 3HMQA 3PA8A 3C85A 4RZXA 3MUNA 4PFOA 3NVMB 1J22A 1XDGA 3PKZA 3QIAA 2J9FB 3D0SA 2VJMA 3ITNA 4IQFA 4H31A 1S1CA 3EDQA 4ZOLB 4CV3A 5BR4A 2K9QA 2GN6A 1X58A 3BX1A 3D6UA 4ON9A 2XUFA 5K3OA 3A1VA 5D4RA 4OXRA 3LF1A 4UPVA 3CPEA 4DBZA 1W52X 4LXGA 4H1UA 3S1SA 1Z2OX 5J3JA 3TP0A 3JVIA 3F3MA 3GEBA 1XHFA 3B3FA 4OAOA 3FDJA 5EJCA 2VDNB 4ZMSA 5FKJA 4ZV9A 5HJ7A 3AIKA 1JA1A 4KWEA 3I9FA 4GX0A 1QNFA 3HCOA 3AERB 1PF7E 2NSHA 4HLYA 2VNKA 1ML3A 1DDNA 1P4AA 1YJAA 4LFUA 1UIMA 1L5LA 2FSUA 3L5KA 3PUVA 2K27A 3DDOA 4NCNA 5E3OA 4OHCA 2J6IA 2OQGA 2Z8XA 1LDGA 4S0HB 2JCBA 1STOA 5ECGC 1NZJA 4HLXA 4UQPA 4Z49A 2FPWA 3BSYA 1ODKA 2NZ2A 4TYYA 3F78A 7MHTA 4GI2A 4FE7A 2DLCX 2VBIA 4G5FA 4BE1A 4OG2A 4XYMA 5TT0A 2JIRA 1X70A 4Q6BA 4OKIA 1ZQ9A 2RGNC 4QAQA 5GADl 1S3SA 4BQNA 3WLTA 2QRQA 5J23A 5B1AH 1LBEA 4KIGA 1XHLA 4G5HA 4E2YA 1RDFA 4GU5A 4EO9A 2YXNA 3M4XA 3GZNA 1TLFA 3H1BA 4ZRMA 2ABWA 4RH0A 2C4HA 4IOCF 4UM8B 4JKYA 2E6KA 2CN1A 3VZBA 1QFMA 3IT1A 3M1CA 1UK7A 2A5JA 1AUVA 1D1SA 1N5MA 2BHYA 4O02B 1U28A 1ZD9A 1QFSA 2AR9A 1H23A 2F4MB 3M9WA 4ZIRA 4K6OA 1VOTA 3NHBA 1XJ0A 1EK2A 1H93A 2FA5A 3VR6A 1B6SA 4JI2B 4UUSA 3EIHA 2IIPA 3CUVA 5DM6F 1DHTA 3CKKA 3T5BA 2F8LA 1KS2A 5I6DA 3K94A 1XBTA 2G1UA 1WDLA 1YQWA 2I5PO 2L69A 2QK4A 4COOA 3BGWA 2HMVA 5F98A 3AB3A 4IEJA 3WC4A 3DKWA 2OV2A 3DXXA 2VJOA 4ALNA 4LWQA 1JB9A 4V02A 3R75A 4E15A 1TPYA 3GJ6A 3U3RA 2MINA 4HWKA 2GWRA 1D03A 2UVQA 2OHXA 1Z3CA 3B2QA 5KZMB 3GFSA 4YCCA 3TI9A 2AE2A 4IYJA 3BQNB 2WDZA 2O1WA 2I7TA 2PUTA 4LZAA 1MV8A 2H6CA 2QWXA 4KR7A 1JUDA 4MR7B 4LHSA 4JJ6A 2RI0A 1JFFB 1OC2A 3RSZA 3H8VA 1DT3A 2GCIA 4XKBA 3TTSA 2O1SA 4CHUA 4MOWA 2F6CA 3A3YA 5K2MA 2V55B 1K8ZB 2IT0A 4MK4A 2JCYA 3TXAA 1YR1A 1GN8A 5JDCA 4RIHA 2UXDB 1X3ZB 1O03A 3JY6A 3Q3CA 3HHPA 5K3SA 1NLUA 4PLTA 2WLSA 1BJZA 1PJRA 3J80A 3IEPA 2I7XA 1A8SA 3QXGA 4B7UA 1H9TA 4H0NA 1QE5A 1R50A 1OZFA 1C3EA 3AUXA 221PA 2PZ8A 4HX4A 1M2VA 3K72B 3NFRA 3A28A 3MS2A 2PANA 4MB2A 1RJGA 2VS1A 5FOXA 3H17A 2R79A 2HRCA 3TJMA 4AN0A 3CLUC 2G0TA 1YR9A 5I7FA 2HHCA 3EGEA 4KTVE 1SCBA 1YQAA 3ABSB 3L05A 4AO6A 3THXA 3EWIA 3TAUA 5IX8A 2EV0A 5FX2A 1CS0B 1JV2B 1S96A 5DLQC 3NHMA 1X38A 5FPSA 1ISIA 1UC8A 4L8LA 2BF4A 3C98A 2ROQA 2DTRA 2GVZC 3FJOA 2BGTA 3VSEA 3CT6A 1NRWA 1Z6ZA 2FN3A 4CFYA 5J1TB 1X3WB 1QCCA 1FNSA 1J90A 3GZJA 3O2SB 2OUMA 3FBGA 3VR5H 4ESHA 1SXGA 1IZ8A 3OKFA 1UBCA 3PK0A 5KJEA 3K05A 4DY4A 2ZSUA 3O8QB 3WSVA 1IATA 1R0ZA 3V55A 3OR1C 1T33A 3R6DA 3W7BA 2Q0SA 4KXVA 1J5PA 5FLVA 3TQQA 3TZEA 4RTRA 3GBPA 4B3HA 3RRBA 3HYTA 1EQUA 2QSJA 2IPLA 1HSTA 1O3YA 2RMKA 2PMFA 4U0VA 5G0VA 1NAIA 3OM1A 4F84A 1SNYA 5CNIA 1OSNA 5DKFA 1T4CA 2XQVA 1H85A 4DV4B 3OS2A 5EIHA 1DOZA 1XSXA 1K2VN 2FJ1A 3JQ6A 1JE8A 4DLWA 3EDCA 3WRYA 1PO7A 1UBTS 4YP7A 3HJNA 3B9RA 5IT9K 4PJMA 4GLBA 4Y9UA 3CCYA 1P0PA 2NZ8A 2R00A 2UVPA 4OJNA 5A3QA 5GOTA 4NPHA 5B4VA 2OC4A 1VJ0A 1G3YA 2O7OA 4MVJG 2BH2A 3GCGA 3EETA 1XX5A 3IVCA 3EW7A 2XAQA 3OZFA 1SY7A 1MKMA 2Q5LA 1DUVG 2QB5A 1I2DA 3GLXA 3RC1A 5IZ4A 1EE2A 1VCMA 3EUAA 4OM7A 3K2QA 3WB1A 2HMUA 3TEFA 2HWKA 3M4NA 5T6MA 4GYIA 1X7XA 4ZH4F 1EWVA 4ZV4A 2MCFA 2ZCJA 3FUXA 4PTYA 4AJ1A 4YUVA 3EZLA 4J91A 2GTIA 1ISRA 4H7FA 2JRMA 2K02A 5IZCC 2ZRDA 2E21A 4IGIA 5TQ0A 1W4CA 3I9NA 2HAEA 4BBRJ 2EAUA 1OCEA 1C0EA 5KTRA 3DOEA 3TVTA 4EFDA 3IVMA 3PX3A 4E14A 4AYXA 4RFVA 1MO4A 2HMAA 4EL5A 1RRMA 3KB1A 2ZDHA 5AESA 4CKBA 4PWYA 1N7JA 3GMTA 2K6GA 4PXSA 1SKAA 2QZPA 3CEJA 4DB4A 3O93A 3W6NA 3I76A 3SQXA 3LA7A 5KWIA 2CDBA 2WYOA 4EW3A 3ETEA 3BE5A 3BWDD 4J7XA 2Z3ZA 1P44A 3GPBA 4WFIA 2II6A 2RGDA 1RPAA 5HDGA 2HDNB 2MSLA 4JP1A 2GLOA 4KPFC 2VXOA 2X6OA 2LW7A 3FDZB 2UKDA 3LT5A 3PU6A 1N0IA 1Z5WA 5DSZA 5E4YA 2FU4A 3MYYA 2VJAA 1PJSA 5CITA 4IIBA 2BMAA 3OC0A 4L3WA 1C3VA 5JD3A 5ALOA 2E1MC 1KHTA 3QM1A 4LHYA 3ONNA 1U2QA 1UPXA 4D6XA 2HRRA 2NV2B 3P97A 1UG2A 4FFBA 4X20B 4US1R 4AURA 1CIPA 5D6FA 3FVWA 4YUYA 2AYZA 4CN8A 3U3DA 5F08A 1I6LA 3JQAD 3FGPA 2WT9A 1WDWB 2FZ5A 4KKVA 4PFKA 5JECA 1AWCA 5HOQA 5E8IA 1KJYA 2G5TA 1R0YA 2YFYA 3TTVA 2XHZA 3E7XA 1X1PA 2V1NA 4F5WA 4HVLA 2QJFA 5D2CA 3DOOA 3TLGA 3AY6A 3EN0A 4ZTJA 4ZHQA 4U7FA 2LY2A 3I45A 1KEZA 1D1PA 3LUPA 1CDDA 3PT9A 2ZUCA 2DOAA 4GBGA 3PDCA 2GCNA 4FFNA 1T0FA 2R7MA 1CJCA 2Y75A 1F3LA 3LHFA 4D4MA 1K5DA 3HKDB 1V39A 1DKQA 5CDTA 3CX4A 1B14A 1HE1C 2LSOA 3N6XA 3K9CA 5T4BA 4LA4A 1PVVA 5LOVB 1URPA 4WKOA 2XWQA 3F1KA 5MN5A 3G9XA 3G2HA 2Q27A 1ZH4A 4DMUB 4D25A 5LLQA 4GRDA 1Z05A 1R27A 4XUGB 1PUIA 3EMVA 1XTVA 2NADA 1QUEA 3HUTA 3JRGA 4IGFA 2EFQA 3O92A 4Z1MA 2OV3A 3OPQA 2BFMA 2CD7A 1AVTA 5IXJA 5T67A 1SKQA 5IBQA 5KREA 3P4XA 4FGKA 1I24A 5B6IA 3U7QB 4FS8A 1NWHA 3ZXXA 4NJEB 2OSVA 3OTHA 4LOAA 2O57A 3BMNB 4WI1A 4XQCA 1SVMA 5K5RA 2AR0A 5CCXA 3LBFA 1Q77A 5T8KA 3IQDB 2IP2A 1TBXA 4ZU3A 3AM1A 3UJAA 2C03A 4JT2A 4LIPD 1ZGCA 5DTMA 2QD5A 1E61A 4XB6B 1CKEA 1N57A 2DFLA 1P5ZB 1IY9A 1XROA 2ZBQA 3W5IA 2HNHA 4G0PA 3VAAA 3ZMTA 2HOEA 2WHYA 4EJ6A 4LE2A 1LDKB 1I01A 3RVMA 3O03A 1XYYA 2C7PA 4C87A 1QQIA 4MTDA 1LLDA 3LWDA 1BMDA 2CLLB 2HRZA 1P2GA 1UKEA 3NYQA 3Q8XB 3DJYA 3NRCA 2GILA 2M2IA 2IHBA 5JNUA 1ZJJA 3EFHA 2QMHA 2B78A 3R4VA 3SYNA 3HUFA 2Q2EB 2J4FA 4F85A 3R6LA 3HU5A 2W00A 2H0RA 4P5EA 1ZG1A 4Y6PA 3QE4A 3U60B 1YRAA 2R7KA 2IU3A 4Q7LA 2X3UA 4ZYGA 3ERCA 4Q9DA 5HIAA 1Q1GA 2VRBA 4DG8A 2JJQA 2EQRA 2JLCA 2TRTA 3CLOA 4PYRA 2R7XA 3H5WA 4HW0A 4XE5A 5F5XA 5EJ5A 2ZRKA 1FDTA 3PFWO 2EW1A 3QSYA 3HH8A 1F14A 2D00A 2VTDA 2PVPA 3EVFA 3K9QO 5LHIA 1E8DA 4UE2A 2OBYA 1X1SA 1NF3A 4OEHA 4TWJA 4PN7A 3D7SA 4NU6A 3LVBA 4AUMA 4KN6A 4H4CA 4Q1FA 1LPNA 2Y0PA 1SXJB 2BL4A 2PIAA 3AHEA 4PC1A 3AF6A 1N1DA 2MMCA 4B4WA 3S2YA 3K10A 4EGZA 2RBKA 4Y2VA 1VIDA 4WXPA 5LXTA 1OI4A 9ATCA 1NPDA 3NFYA 2L4AA 1CUIA 3SBXA 5TF0A 4WJKB 2KB0A 3MGGA 2EGHA 2L7FP 1RHQA 2VUMJ 1LVKA 1CLUA 4L8YA 1NATA 4M8SA 4B8XA 1ZZEA 2DMTA 5EE3A 1TMKA 1B0UA 4MKIA 1MIHA 4L9TA 1P72A 2C2OA 4OHMA 3NGLA 3TW8B 1VGQA 3NJ4A 4TKUA 2ZXHA 4DMCA 2QG6A 2RHRA 1C9KA 4NBLA 1N1MA 2A94A 1L8AA 4FI3C 4WLEA 5CDGA 5ALJA 2E1MB 2BW3B 2DT8A 1YU6A 3U7RA 1S1MA 1HRKA 5GPCA 4R0VA 5E1DA 1F2UA 5A6SB 1EKEA 1M10A 4HN4B 3BG7A 2ZBEA 1E6WA 5IOYA 4ZDWA 1KEVA 2X6RA 5KNDH 1NDUA 2WILA 1JUPA 2R62A 3A9VA 3OE7A 3DE1X 3GW2A 3UAZA 1QZZA 3G1UA 3BD9A 1E4YA 2G25A 4DCTA 2HNAA 3EXIB 3RUAA 1TC3C 5JHHB 5GP1A 5H9VA 3UM9A 2ME6A 2C9CA 1K7CA 3T95A 4V2IA 1RKWA 3LX6A 1UBSB 1I5EA 4C0KA 4R83A 1ZK4A 2MW8A 3TQIA 2JI4A 1SURA 4MV1A 1CZKA 5K8LA 3D4OA 4KQMA 2GXGA 1SO8A 2AEMA 5AIQA 4MA5A 2JI7A 4BNMA 3RTGA 3U1BA 3GOHA 3I2GA 4Z7QB 3CPHA 1U2WA 4R40A 4ASUA 3C39A 3ICCA 2H7YA 2OD7A 1OW3B 2F5VA 5JXJA 1TAUA 1LKZA 4LYGA 5LL6P 4L51A 4D26A 1TTQB 2BMJA 4I6ZA 1KH2A 3QQPA 1FTYA 4M7RA 3HOXJ 3EXG1 3MCVA 2G72A 4P80A 3WIBA 3FNRA 3OECA 2AJ8A 4XGIA 3U7FB 3BXFA 3IJRA 2BM0A 2F6RA 2V6IA 3G1OA 2ZDQA 4AU1A 4WBNF 3C8DA 2J8ZA 4RSGA 3NHZA 1KC1A 1G5TA 4QE3A 3GJRA 2IEIA 2DEUA 2QHXA 5GOZA 4DTIA 3P5BA 3F6PA 3ETLA 2PMUA 3BPVA 2Q28A 1KJWA 2BSXA 3N2EA 2ZE6A 2ZSHB 1G8GA 1X7WA 1BHO1 2XVAA 3GVAA 4YP6A 3G7UA 3AVUA 4M6WB 4PCVA 4BYYA 2P30A 3OCCA 1QHFA 5C0OE 2I7CA 2HK7A 4JLUA 3SKYA 5J5CA 4C01A 1YQTA 3GEMA 3BM5A 1BVYF 2IEGA 4AY4A 4L3OA 3OD1A 4PIMA 1GZ6A 2XOXA 1T8YA 3PC2A 3UK6A 3QMWA 4E6PA 1U0HC 1AK1A 2G9VA 5SY4A 2JK3A 2HMWA 4EHBA 3ZJTA 4CG0A 2PBFA 3V1KA 2ZWVA 2AUMA 4ASNA 4H17A 4P9NA 5JS1A 3IQWA 3VR5A 4NENB 1C8BA 4IWNA 2DFIA 1AKTA 4YJGB 3FWHA 2XMPA 1QV7A 4OOIA 4MDYA 2MLKA 3Q5DA 4B5KA 5CPRB 1FNDA 1SU6A 3OZDA 4AI6A 1EFPB 1ZAOA 4CM8A 1U2DC 3TEJA 1GPMA 4BFCA 1SD7A 5A0FA 4JL5A 5TLSA 2QL5A 4KO1S 1H9GA 4G2NA 4UTRA 4AUXA 2BLNA 4Q3NA 2FWNA 5B1DA 1Z6AA 4RGYA 1Q0LA 3UBTA 5EE1A 2A6EF 3F0TA 4NDLA 2HK9A 4TQAA 4TWBA 3CLVA 1E32A 1W4MA 2YNMA 3EXEB 4L18B 4N5MA 5I51A 1KVQA 4DJEC 3CZRA 4K8OA 5T41A 1YDMA 2VKTA 5JCZA 3T3OA 2FMUA 3DO6A 3DKXA 5C37A 3OFVA 2UYYA 3RD5A 3KNZA 4CCJA 2VAVA 2CEAA 1QQBA 4GWGA 5KS2A 4PR3A 2CLHB 4TUYB 3VI3B 5GJBA 4BKRA 1UKZA 2JVJA 4I2NA 3E9DA 2ODBA 2XDAA 2VYVD 2G1AA 2UUPA 3IPXA 1NP3A 1IQPA 1FFBA 1ONNA 3OOYA 1TA0A 4B3FX 2L17A 1P0IA 2PJRB 1GADO 3KOWA 5D4SA 4G5XA 3BOSA 2RHTA 2VTVA 4F46A 4EUNA 4AF6A 5B64A 2YOHA 1XEWY 1PJ3A 3LSPA 5DOVA 2YY6A 4EYQA 1Z38A 4KQKA 3AUJB 2L02A 5DI9A 5A5GA 3CUEF 2R68A 3D3JA 2NPOA 3DNPA 3HB7A 4LHEA 3DEWA 1ZSNA 4Q4HA 4YIFA 3GV0A 3H86A 2KKOA 1ONPA 3U0BA 1HL3A 5K9ZA 5E9WA 3FSEA 1CBUA 2JH8A 4KXUA 2BFCB 1A9RA 5J63A 5JFOA 3D43A 3QAHA 3I62A 4DILA 1NOJA 2QQEA 4HKTA 2C9ZA 2ERCA 1EVJA 3THYA 3IALA 1O8BA 5DVZA 1PUFB 1UMKA 3QFCA 2J3QA 1I9GA 4MIYA 4WF2A 2OB2A 2VZEA 2QSFX 3Q8LA 3KJFA 3MPOA 4XW2A 3DZIA 4I50F 4PBSA 1PWYE 2VTEA 4BRSA 3EZ6A 2XNDD 4ZQIA 5LLTA 3NAZA 1PGOA 2UUCB 2IHZA 3GTKJ 5HXAA 10MHA 2UVDA 3O1LA 3MHTA 4E51A 2LNDA 2IIBA 4R05A 3UT5B 4B76A 3W8RA 3TGLA 1BGVA 2DWCA 4AWXA 2VF2A 1D2MA 4RF5A 2X77A 1OAOC 4OYHA 3DHYA 3UTCA 3RT1A 4NHJA 1F9EA 2J3DA 1NU6A 1WHSB 3BUSA 1Z34A 2QTFA 4TKLA 1GGVA 3FWYA 3U09A 3UTDA 4KEAA 1S2LA 2BH9A 4D74A 3CYFA 3C5CA 3WNVA 3BDIA 4N3BA 2GXSA 3KKPA 2GH1A 1VSBA 4KYTA 2FAXA 3TSAA 2R11A 3BR5A 4BVBA 4IRGA 3R5HA 3C3EA 3AEUB 5C81A 4JYPA 1FNCA 4LJ4A 5C8YF 3I58A 1KORA 1C1DA 4CM6A 3T5MA 7YASA 3H5RA 3MT8A 1ISPA 4P36A 1V41E 4NFSA 2A9VA 9ABPA 1P18A 2RGRA 1VE1A 4YREA 1BDHA 1JDBC 4DIFA 1OLXB 2QKLB 2PMBA 3FXMA 4ZVSA 3ZH2A 2IT1A 3WNCA 5AUPB 1QH1B 4RD1A 3HB1A 5CVTA 3W6OA 3E9RA 3OOJA 1KEEA 3GC6A 5CNKA 1NVKA 4P33A 3G5MA 3I37X 2FLKA 2IUSA 4QOEA 4UARA 4KBYA 3J80K 2BV3A 4RKWA 2M8EA 3CJQA 2MC3A 2RVCA 3W9YA 3DFMA 4FDLA 4MI1A 3TSOA 1DZIA 4A92A 3R20A 3SWWA 3HJEA 4I66A 3LD9A 4YFXF 5B2FA 1IWBB 5MGBA 4LYEA 2ORIA 1RXWA 3S2SA 1S4MA 3HEMA 2CW5A 3FLMA 1MNAA 4KITB 3FF4A 3I64A 1RXYA 4R69A 5DYTA 1XTIA 3SM9A 1IOLA 2WU4A 2FE3A 5LSAA 3LZDA 3SR0A 1N3LA 4JUDX 1BDJA 4JI5B 4L9RA 1PIWA 5JFGA 1YCGA 2ZUTA 1Z68A 1R1VA 4ZYAA 5JADA 3Q7SA 3GY0A 5KKNB 1QHXA 4NS4A 3E8MA 4M86A 1F2TB 3SHWA 1H66A 1HW1A 5JAUA 4YUWA 1V1MA 1UAAA 5JVDF 3N7AA 4C88A 1M1YE 1RQPA 1GDHA 1UOQA 3OQJA 3IMGA 3ELUA 5AW1A 4YDHB 2PMHA 4IR7A 3AP2A 3L77A 2PVSA 2AQEA 3VQTA 4DAEA 1QIDA 2G36A 3O75A 1J1ZA 2J5BA 2AX4A 2JFXA 2I7VA 5DN6A 3R0QA 3R7WB 2ASEA 1E2NA 1YI8A 3K09A 3ZQJA 1ADBA 4N7RA 5EZ6B 3ZWVA 3HKCA 4H6VA 1T35A 2JAUA 1VGVA 1N9GA 3SE0A 4BV2A 3GT7A 5TPWA 2R6ZA 2JAHA 1UXKA 2AUNA 4RVSA 1KE2A 2BEVB 3LTNC 2BOLA 2ZXJA 1BYIA 1UXJA 3LY5A 2GEKA 3NORA 2JLSA 3G6EI 5HQTA 4MNTA 1QIFA 3BKWA 1OLSA 1FMWA 1ZP6A 4X1IB 1UUFA 1QQTA 2QTMA 4MQBA 1LDEA 4QQRA 1XDUA 1JWAB 4Q01A 2K7LA 3GG2A 4HEQA 1FYDA 4KSYA 4N3GA 1R8SA 2O7QA 1VFPA 3O9ZA 4XDZA 4DIOA 1CF9A 2IKQA 3K53A 4ZAZA 3FFAA 1WB5A 2UZKA 2E85A 3IJPA 4IKFA 5DHPA 2QRGA 4IDEA 1E1YA 3JVEA 1XS9A 1WJGA 1BC5A 1EFAA 4D9JA 3EFOA 2R6GA 4PZEA 3L7NA 2YL2A 3A2KA 3RTDA 5CXQA 1TT5A 3B78A 3D0QA 4N5HX 5HUJA 2JAPA 4YV7A 1AA9A 5K4HA 3HMKA 3FHOA 4I55F 1GA1A 3HXKA 4WT7A 3K1NA 1N78A 2PAAA 4OOEA 4XWWA 1GPNA 3QPVA 3COJA 1YHZA 4JB0A 3O3KA 3FTQA 1AIPA 2C97A 4FJ0A 4YP5A 5KQSA 4R2XA 1ZDMA 1M0WA 4EGCB 2DECA 3ZQFA 5JVTA 5KX5A 2QTBA 5J5AA 3W2GA 3PC8A 1HFKA 4HQNA 1KPIA 2UXXA 1AF4A 2CVPA 5FRDA 2N3ZA 1Y1SA 2E1NA 3U9TA 2RC5A 2DUMA 5JAZA 1K83J 1KO7A 4QQKA 3WVNA 4PG6A 2O2SA 1DCKA 4QDXA 3A4NA 1IPFA 4QUEA 4FJ2A 4DLPA 3OT4A 3VVCA 4Y17A 1QH8A 1ZM4A 2HEIA 4YFVA 4ME6A 4C1BA 2A6TA 4N76A 2CNOA 2B99A 3GJQA 4H35A 4QLBA 2W84A 1FNMA 3D8SA 3HBJA 4M7OA 3NC4A 1Q3TA 3GTPJ 1YVDA 1NRXA 3DJFA 4KLRA 1D7OA 2DMPA 5DO9A 1A36A 1ZXBA 3C70A 1JT0A 2W83A 4NJOA 4YV0A 3IBFA 2O59A 4EAQA 1R6AA 4CDRA 2HYFA 2XCRB 5DCUA 1UXOA 1SANA 3EULA 2OOSA 3EAFA 3ZNNA 3FPCA 1XO1A 3CC8A 4DIEA 4ID9A 3CC2I 2OZUA 1Z6YA 2X5KO 1CE8A 2CFXA 4U1RA 3P8ZA 3IUQA 1AS2A 4QGSA 3STUA 1DTEA 5AVUA 4D45A 1RYMA 1B6AA 5DASA 1JL3A 5AD1A 1AKVA 2WSMA 5EWJA 4YMWA 3RQIA 3SZPA 1FLDA 1RQ7A 3RC8A 2QR5A 3C7AA 1CQJA 1T0BA 1PCXA 4YO7A 4UU0A 5A5EA 1FW6A 1T5BA 2CMHA 3LBNA 2YXLA 4DQXA 5HNKA 2IHTA 1ES9A 1QK5A 2VHXA 2KJCA 4B73A 1B76A 1OI3A 1J23A 2ENUA 4F2PA 3JV7A 1G98A 4EUSA 4LGCA 2SCUB 3T1HB 4HGNA 5B4TA 3ISJA 1YRNB 1FIUA 4QDUA 1I4TD 4HZIA 4WMLA 1Z6GA 1OVGA 1SELA 5C7YA 1YR2A 3ADBA 3MKLA 3P9YA 3NKFA 2IUFA 3QQ5A 3KZXA 3VR2A 3KBOA 1PJLA 4B3DA 2Q3HA 1DKPA 5FR1A 3ZXUB 4IXMA 4O2RA 1CUGA 2B4RO 2X0JA 3IRRA 5F7JA 4NZNA 4UUBA 1GRCA 3GLUA 2XMBA 1P9RA 1Z2NX 3R6WA 4IIDA 2OV7A 1YMUA 3A0RB 3PDJA 1PJ8A 2OV1A 1GZDA 4GPEA 5CH8A 1GPH1 4GR5A 2PS1A 1R49A 2B7LA 3B20A 3PI6A 3I23A 1S5PA 3DE7X 2KIMA 3H2IA 3NDJA 4MV0A 4HQLA 3B6JA 3LJKA 2R7TA 4MAFA 1K5PA 4C3HJ 5ALVA 4DBLE 1ADGA 1A72A 1U8AA 5DEQA 5F73A 1TQHA 5BP7A 5ESRA 5ALEA 3GX1A 3MFYA 4MQFB 1AM4D 5KQLA 1FQWA 2WJJA 3WKAA 4G8XA 3N2ZB 2PAFA 1SXIA 3F6RA 1RHKA 3U6BA 1J70A 4HDNA 2H59A 3WLAA 4ZYXA 5A0TA 1H2AS 1XRNA 3UEOA 2VP5A 3RYHB 3EPHA 3LDGA 1I4WA 2O8FA 5C7IO 4C20A 5KHDA 3GFTA 1TUEA 3CWZA 1A50B 2B36A 3A4CA 2R8PA 1YJQA 3RRXA 2OTCA 4JN6B 3DUFA 2V0NA 1CEQA 1TWAJ 3ORSA 3OURA 2X6TA 2ZBRA 2YIVX 5SZHB 1EQ2A 4ALMA 4L0CA 1IBMB 4HH0A 4C2AA 1L4NA 1WZUA 2ELKA 1Z5OA 3BG3A 2WTEA 2NVUA 4OSOA 1O7LA 1IMOA 1IEWA 1HETA 3HR4A 4QNNA 1HSOA 1MABB 1YFHA 1EFRD 5EZHA 3V4SA 1RRFA 3Q1LA 5IK2A 3JD2A 1V95A 2WAXA 2QTRA 2CHQA 1L4BA 4KK4A 1E9FA 1FC3A 4HDKA 4IRXA 4FFMA 1NVVR 2P5YA 5E4TA 2XDQB 5EZQA 2B2CA 1XEXA 3GLSA 1AV7A 4N8SA 2YS7A 1NUHA 2OOKA 4UXJA 1OMOA 4N41A 3OKPA 4QOSA 3JWIA 3EPJA 2OQRA 1TM2A 3OV8A 2E4ZA 4LOKA 2H8KA 2P6MA 3A2NA 1GRNA 5D6OA 4WZAA 4DAOA 4YCMA 2IEBA 3RDPA 3U7EB 1OBFO 2GKSA 2QQAA 2YMMA 4LK0F 4CH7A 1ISSA 2AFHE 4OB6A 1IIRA 1FRFS 4UD2A 3FIWA 4WJZA 2IU6A 2NUBA 1P62B 3QY0A 2YJ5A 1F4LA 2V45A 3BD7A 1XU9A 3ZN2A 3MC1A 1ODTC 1P31A 2IXBA 3H11B 4Z4QA 5EQJB 3SS8A 2I7DA 4QQNA 3THRA 4YP9A 1WBBA 3H9JA 3ZMUA 2W9XA 4B3TB 5DRTA 3ACCA 4TZ0A 1KGDA 4M1SA 4MUIA 4C78A 5BY2A 5KPDA 1SIBE 1TFUA 2A0WA 3B73A 4OXQA 5J1SB 1T95A 4MUXA 2OQVA 3T3MB 2Q4EA 4OQLA 3ELDA 3SIRA 1HFWA 5F0HA