1QZZA

Crystal structure of aclacinomycin-10-hydroxylase (rdmb) in complex with s-adenosyl-l-methionine (sam)
Total Genus 111
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
111
sequence length
348
structure length
340
Chain Sequence
LEPTDQDLDVLLKNLGNLVTPMALRVAATLRLVDHLLAGADTLAGLADRTDTHPQALSRLVRHLTVVGVLEGGEKGRPLRPTRLGMLLADGHPAQQRAWLDLNGAVSHADLAFTGLLDVVRTGRPAYAGRYGRPFWEDLSADVALADSFDALMSCDEDLAYEAPADAYDWSAVRHVLDVGGGNGGMLAAIALRAPHLRGTLVELAGPAERARRRFADAGLADRVTVAEGDFFKPLPVTADVVLLSFVLLNWSDEDALTILRGCVRALEPGGRLLVLDRADRFFSTLLDLRMLTFMGGRVRTRDEVVDLAGSAGLALASERTSGSTTLPFDFSILEFTAVS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structure of Aclacinomycin-10-Hydroxylase, a S-Adenosyl-L-Methionine-dependent Methyltransferase Homolog Involved in Anthracycline Biosynthesis in Streptomyces purpurascens.
pubmed doi rcsb
source organism Streptomyces purpurascens
molecule tags Oxidoreductase, transferase
molecule keywords aclacinomycin-10-hydroxylase
total genus 111
structure length 340
sequence length 348
ec nomenclature
pdb deposition date 2003-09-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00891 Methyltransf_2 O-methyltransferase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 1qzzA01
3.40.50.150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Vaccinia Virus protein VP39 1qzzA03
3CBGA 3ECHA 1TLHB 2ZCWA 3K1PA 5DWQA 3KFWX 1YLFA 3BWGA 3HTSB 3L09A 4A5MA 2H11A 2GA1A 4HV5A 3B3JA 3P8ZA 4AZTA 1Z9CA 2EFWA 4IF4A 2QWWA 1IF1A 1TNTA 3CJRA 1KU3A 4IJAA 2IGTA 1S3JA 2OZUA 1XGSA 1TQMA 2PY6A 1TTYA 5L3FA 4ASNA 5EIFA 4PCQA 4O29A 3GVAA 2KJBA 2P5VA 4B17A 1KU9A 2RV8A 4IV0A 4P55A 4KA4A 5FFZA 3JAMZ 2PLYA 2KJCA 3L00A 4A6DA 2HWVA 1ZQ9A 2XBMA 3BT7A 1WWXA 2HZTA 4S04A 1YS7A 4PZJA 1TW2A 1B4AA 3KCCA 4CTJA 1I4WA 3SM3A 5F6FA 5FULA 2EFJA 2BR3A 2KRFA 5FD5A 2L02A 3BGIA 1RJFA 2PJPA 1RI7A 3J81K 4L9JA 1JQ3A 5K5OA 3EDPA 1UFKA 1HBXG 1RI5A 5LHIA 5CVRA 3TLJA 5GWXA 4E30A 3TRKA 4M71A 3DXJF 2VC1A 3EYYA 1IUYA 3EVCA 4FX4A 3CCFA 1O7LA 2P3LA 1JG4A 3O7WA 3AXSA 3WTVC 2CSOA 4YIFA 4OQEA 5K01A 2GQQA 4ZYDA 4X1OA 3TOAA 5K0JA 2LKPA 3UJ7A 1R00A 4ON0A 3WGIA 1FSHA 2GZWA 4GF5A 2IDJA 4LGWA 1J9IA 4P9UA 2A3SA 4LWOA 3LX6A 2C6YA 3KP5A 1XD7A 1MD0A 1DPUA 3M33A 4HLXA 1O3RA 4BP3A 4ENNA 5EGSA 2ZLBA 4XRFA 1G8AA 4LB6B 2PWPA 3P2KA 5E1WA 1OYIA 1SFXA 4A0ZA 3M6UA 1DPRA 2NNYA 1BC8C 4M9ZA 3ZMTA 1ZN2A 3FXQA 3O3KA 5D5XB 4BY9E 4HQEA 2XYRA 4LLGF 3C6KA 2ZJ2A 1QQIA 2VE9A 1F1ZA 1FSEA 2IH4A 3HIFA 2XKOA 4LK1F 5E2AA 1W5TA 2R7FA 2EFPA 2XASA 4EMSA 1ON2A 3EEYA 2EV6A 2C7OA 1INLA 5CUQA 5P8WA 5E18F 1P92A 2ZMEA 1R18A 3LKDA 2P1DA 3LA7A 4PYJA 2LDUA 2OPBA 1EH6A 3QPHA 3DXXA 4PIPA 3FXUA 3HM2A 4E31A 4ISCA 3R4KA 5B1SA 1O7FA 5A2QK 1K78A 1KYWA 1Z6TA 3F6VA 2IA1A 1BI0A 4R05A 1P39A 2PN6A 1ZG5A 2PG4A 5G02A 3AAFA 3LCCA 4KDRA 3KP4A 4YV2A 1YG2A 4UXNA 1ODDA 4R79A 1WZNA 1VQ1A 3UJBA 3QU3A 4RB2C 4LD5A 2ONYA 3P97A 3B3GA 3RDIA 3OU2A 4GOOD 4HGYA 3IV6A 5E9QA 4GYGA 4EKIA 2VP3A 4EJUA 1R5HA 2XRNA 3A27A 5BW4A 3OOPA 4DKJA 2FSWA 2VBWA 2ZO4A 1SD4A 1R1VA 5HDGA 5E8IA 3KQQA 2IH5A 5DCMA 2L3DA 2A6HF 1AQIA 5EC8A 4LJZF 2VOPA 2BM9A 2UXXA 4M37A 2ADUA 1D2HA 1JGSA 1K6OA 4YMGA 1KU2A 2OA4A 3DFGA 2MBFA 5LQAA 1T43A 5L3DA 1P4AA 2Z5UA 4X61A 4IXAA 1YYVA 5CJ9A 4RVHA 2EG5A 3HCDA 1BHJA 1FBUA 3OU7A 3GRUA 5DCMB 2VBZA 4PNEA 1B6AA 3V4GA 3QRFF 3P2IA 1G8SA 1RUNA 5HEKA 5HILA 1UCRA 5D1HA 2BH2A 1GVJA 1ZARA 4G6QA 3J80Z 1DP7P 5E1BA 4RTMA 5DEQA 2QRVB 1XN7A 5JVTA 3ELUA 4A12A 5DD8A 3G73A 4C03A 1ZRFA 3MQ0A 3LCVB 3R6SA 3N4MA 1BI3A 3N97A 2G72A 1VE3A 4EM0B 4HX8A 2N47A 4F86A 1A04A 3HCBA 5J8CA 2DPUA 3HA7A 4Q48A 4CTKA 1MDMB 3V97A 4KIBA 1RUOA 3C18A 1FYMA 3I64A 3LWFA 3DMFA 4FHTA 3ZN1A 4B8XA 4LG0A 4I0BA 5JFRA 2VBYA 4OIPF 1FLIA 2DFIA 5DTQA 2FMYA 3M8EA 3K9TA 3M4XA 2ZBKA 1ON1A 5K09A 4MTLA 3HVIA 3L8DA 4LECA 4OINF 2CO5A 4M9SA 4HBLA 3FZGA 2P41A 2OYRA 3BOQA 1XMKA 2GLUA 4LG0B 4OBXA 1W7PD 4EV0A 2STWA 3EPPA 2OZ6A 2G7HA 4KN7X 2Y48A 3CJNA 3DXZA 3G2MA 1YB2A 4ER5A 4PCAA 2AOVA 1K7AA 3BY6A 3CVOA 4RB1A 1JQDA 3ZMVA 2FK8A 4GOLD 3HSFA 3OE5A 1T39A 3A25A 1U78A 2G71A 4IPAA 4Y2HA 3U2RA 2W24A 3DMHA 2K02A 3HRUA 4YIIA 3FPJA 5HIMA 5K0CA 4M7RA 3W6JB 3PX3A 5FHQA 4WXDA 1XDZA 2E5WA 1L0OC 4U7TB 2R3SA 1MJ9A 5H20A 3HCCA 1RI4A 5E1MA 1MJAA 1F4KA 3MB5A 2YVLA 3V8VA 1SFEA 1G38A 2PI0A 4GO1A 1QAQA 3HRMA 3NWBA 3TM4A 3Q9VA 4M6YA 2OZVA 1G6NA 3ORHA 2GPYA 2JSCA 4I98B 2IT0A 3A4TA 5DTMA 3TO7A 4UHTA 4ENJA 4PGGA 3KR9A 3ELDA 1WRJA 3FMRA 1MJFA 3LCUA 2O57A 3BDDA 3P71T 1NBHA 1IXCA 2LSOA 1FNNA 4ZZLA 2B25A 5FWAA 5HOQA 2BEOA 1UWVA 3O6BB 4UVBA 4FGZA 1D8JA 4U0WA 4L9TA 3VFZA 3K6RA 3GO4A 5KVRA 2PV0A 2WK1A 2FXAA 4HW0A 3EGVA 1OKRA 1SFUA 5E8JA 5U4XA 3IYLW 4HDUA 1U6GA 2EV0A 2XAJA 5TJJA 3WE3A 1S7AA 3CUOA 3SXYA 1QNTA 5CVUA 3GW2A 1MZBA 3F4KA 2FMLA 2H27A 4CHUA 5GIOE 4P96A 4YFKF 3KU1A 1YW7A 2WA2A 5L3GA 4GYIA 1KU7A 1T98A 3K69A 1HQCA 1SG9A 2H1RA 2FEZA 4Q4ZF 1SUSA 1U5TC 5FGMA 1U5TB 3E7PA 4U7BA 2F5DA 4F7ZA 2O8XA 5JUWA 2PBFA 1CF7B 5CVEA 2WA1A 2ZVJA 3SR4A 4EK9A 1PDNC 5HOOA 1QAMA 1C0WA 5LQUA 5D1NA 4DZRA 2IJLA 3F21A 3TR6A 2P6TA 5E8GA 4EM1A 5DT2A 1HKTA 1J2XA 1O3SA 1E2XA 2O3FA 3R6TA 2VN2A 1NE2A 4MIKA 5CLSA 1XXLA 5E9JA 3KQMA 2C7RA 1CF7A 2XAFA 2Y75A 3EVAA 3BUSA 3X0DA 4ESJA 2UYQA 4LFUA 3GXOA 1OR8A 1PP8F 4KVZA 1I1NA 5H02A 3G7UA 3GCZA 2WWYA 2OAZA 5EMJA 1XSXA 1YZHA 3CJTA 3QU6A 5GP1A 2FNAA 2VOOA 3PVCA 2P3QA 3JTGA 2O05A 4RVGA 4RVDA 3QAHA 5LGTA 1T2KA 1M6YA 4QWQA 4A0YA 4OIOF 1D3YA 3Q9SA 3KQVA 2QQAA 4ESBA 3E6MA 1B42A 3IHTA 2K86A 5ICEA 1XCLA 2YXEA 3B5IA 2GXGA 4UVAA 5KQRA 4FP9A 1JXSA 5FQNA 1VP9A 1T6SA 1DUXC 3F8FA 5F2NA 1L3BA 2CWEA 3H3ZA 3VSEA 3KQYA 1O9GA 2V6CA 3HNRA 2AN4A 1O9HA 3A7DA 4HGZA 1ULYA 2UZKA 5DCFA 5H6RA 2R6ZA 2FA5A 1R1UA 1BIBA 3F23A 1H9TA 2PX4A 3ZP5A 2RGVA 1FX7A 3ER9A 1Q0TA 1KPIA 3BWMA 5FADA 1W7PA 4OX9Y 4OMZA 2BR4A 3WTXC 3L9FA 5LSAA 5TRDA 1QGPA 2QBYA 4E2ZA 5K5QA 2IIPA 1G60A 4BNCA 2C7QA 2K7LA 4KIFA 3G88A 4R8HA 3K0BA 2WV0A 3O4FA 3C3PA 3F8CA 3GWZA 1BIAA 5LGUA 3KR2A 4R6WA 1IN7A 3BZ6A 4G56A 3SXJA 5E17F 2HTSA 2V1DA 2W25A 2ACJA 3E6DA 3HYIA 3ELYA 2OD5A 1ZRDA 4ATNA 5T6BA 2IH2A 2IPQX 2ZXJA 3ABTA 4G7OF 2XYQA 2UYHA 4FS8A 3UJ8A 2M30A 1YQAA 5D6EA 1ZRCA 1YW8A 3J81Z 4F84A 1F38A 3WSTA 2YX4A 1X1DA 4PYOA 4PYNA 2MH2A 5MHTA 3EVEA 2DQRA 2WC2A 3A26A 5FTWA 2CL5A 1JG1A 4KIGA 4B09A 3HA3A 4KMFA 2JHPA 1TQPA 2VS1A 4YG2F 4WCGA 2PEXA 1EQAA 3O2PE 1HSJA 1Y8CA 3IRRA 2KIMA 2AS0A 2KIUA 1ONVA 4BH9A 4ER3A 1V3FA 3HCFA 2EFOA 1XCVA 3ABUA 5BQTA 1UIRA 2HQRA 1NV8A 4X63A 1T0FA 1YIOA 3K0LA 2OBFA 4E2WA 2PX8A 4BHPA 1JR4A 2AOXA 3KPUA 3HRTA 5EKUA 5LRRA 2ZBPA 3KE2A 2Z6QA 5D8LB 3M9AA 4Q5SF 2PQ8A 2AOUA 4L9VA 2OB2A 2H94A 2K27A 1F9NA 1V39A 4MQVA 3OE4A 4EGZA 1I1SA 2FCAA 5HLIA 4RTSA 2PLWA 5DX1A 3T7RA 3EYIA 3FRHA 3GLXA 5F2OA 1HKQA 3DR5A 3FUVA 1SUIA 5BP7A 3T7TA 1F5TA 3DV8A 2CWWA 1P2FA 2P40A 2X0LA 3UA4A 3V7CA 4IKPA 3MTIA 2D2WA 5F2KA 1FYLA 1JTFA 4XCXA 1EJ0A 3MWMA 5D5VB 4M9XA 1FPQA 2MH9A 4G8XA 3LDUA 3TFWA 1LNWA 5GINE 5FFXA 4P58A 3LA3A 2CMGA 1KIAA 1G6Q1 5LBQA 4CWAA 1K79A 2B78A 5EOVA 2DAOA 3KR0A 4EJVA 1LEBA 3LPMA 5EMKA 3HVJA 2Z33A 1DUSA 1Y0UA 2P7VB 1L9KA 3BKWA 2G9WA 3D5LA 3Q5FA 5CCXA 3NDIA 3DPLC 4LWPA 2A61A 3J80K 1G3WA 2H00A 5HZMA 1ORHA 1V4RA 2M8EA 2JHAA 2QY6A 4MEYF 3HTUA 2ZFUA 2NNWB 4WK8F 3CUQB 1FWZA 3NQOA 3R0QA 2V74B 1KYZA 1WXXA 3NRVA 3F3XA 1OR7A 3O31A 5DM2A 5DRYA 1L3IA 5EPEA 4M73A 4NB5A 4G7ZF 2C7PA 3RODA 2ZBQA 3V7SA 4M38A 1SMYF 1RJGA 3L2CA 4IVNA 1WY7A 1DL5A 3KKZA 1QPMA 4A5NA 2YR2A 2QYOA 2AR0A 1LEAA 1YFHA 5EMLA 2BZGA 2HYFA 3HVKA 3FUUA 4H0NA 2HGCA 4L9NA 5DM4A 2A6EF 1N7JA 1B9MA 2A14A 3ERED 5EMMA 4YMHA 3CJQA 2LF8A 5LEKA 3WE2A 1S8NA 4MQ4A 1W4MA 1NW8A 3C7JA 3T8TA 3GUDA 4PYKA 3QP5A 2EA2A 1SKMA 5FA5A 1Z05A 1H0MA 4RTOA 1O54A 2NYUA 3BWYA 4P7FA 2FK7A 2YUIA 3UFBA 4YUYA 2AOTA 3GEZA 2NXEA 4AIKA 2P6SA 2DPDA 4ZYEA 4Y13A 2P4WA 2ISZA 3HEMA 4RAYA 3GFMA 5BW5A 3CTAA 3LA2A 3RKYA 4AD9A 5K05A 2OXTA 4EQQA 5CCBA 1FP1D 1YFJA 4EQZA 2MC3A 3GF2A 4UVCA 5D8KB 5DD4A 1JG3A 1S6LA 2FBIA 4I09A 1SD7A 3DKWA 2PX5A 4DCMA 3UJ9A 5DUIA 2HR1A 5ILVA 4WWCA 1EAMA 3KQSA 3GRVA 2V1XA 3P9NA 1HXDA 3QP6A 1LB2A 3NDJA 5DX0A 3RJPA 4OIQF 3P7NA 5FD6A 5EIWA 2ZSUA 3RKWA 3E5QA 4XLNF 5K0BA 3NJRA 1DDNA 4HAMA 5HIJA 3ELKA 5DSTA 3EGEA 5KVAA 4ENKA 1YO5C 3KHKA 4P7JA 7MHTA 2EV5A 2VXZA 5EQJB 2JTVA 4OA5A 4Y17A 3Q7EA 4YUZA 4RS8A 2CGPA 1RNLA 3FYDA 1O3TA 2KKOA 1ZREA 3LAJA 1NW3A 1TBXA 1AOYA 3KP2A 3MQ2A 2EJRA 1OMIA 4BLWA 1P1CA 1D2CA 1JG2A 2ZIGA 2ZZKA 1BJAA 1O3QA 2DBBA 1NV9A 10MHA 3FTCA 2YR0A 3EGIA 3SQNA 3ZN0A 3EQLF 1ZLJA 1IN5A 1XVAA 4YUVA 2V1UA 2YXDA 3LL7A 2QENA 4CICA 3P9KA 2DT5A 3PFGA 1Z1DA 1LDDA 5LHGA 3LQQA 3CUQC 4I7HA 3KEOA 5FLXZ 3EVFA 1BM9A 1Z7UA 1XDSA 5D6FA 3E6BA 3SHFA 5FQOA 1G3TA 2DW4A 2ZNZA 3R9XB 2YSRA 2NNNA 4O6JA 2YTZA 4HRAA 4PGHA 2NRAC 4C08A 3FF5A 3I59A 2HMYB 2A07F 1VBFA 3QV2A 5HFJA 5FO5A 1IN8A 4RGSA 4LLLA 2QUFA 4IRHA 5KQSA 3PFIA 3ROUA 4QLCU 2ADMA 4KICA 2ZZMA 1JHHA 2VT2A 3ZQ7A 1RIOH 2ZZNA 3SSMA 5FHRA 3MHTA 3FTFA 4A0XA 2PJDA 5K0NA 4RWZA 4ER0A 2JJQA 4AWXB 1ORIA 2ETHA 5DUKA 2D1HA 3WTTC 1ZAOA 3B3FA 4MGRA 2HKOA 4WX9A 3MFKA 2K4BA 2BM8A 3FPGA 1OYYA 2XVCA 2P5KA 3FMQA 4BYYA 4HYEA 2DTRA 3F72A 3TDUC 4OMYA 5HIKA 5A2QZ 3MCTA 3PQKA 2DPMA 3BROA 4QPPA 1XB4A 1G4DA 3PX2A 2CW0F 3RIRA 1EV7A 3TDZC 2PXAA 3VEPA 3BWCA 3TGNA 3P9IA 4HF0A 4RB3C 4RTLA 5LQRA 2PXCA 2BYVE 1HW2A 3C0KA 3R0JA 4C05A 3VC2A 3M1EA 4RSRA 3V7RA 4IHTA 1L1EA 5DXJA 1IN6A 5T67A 5KYGA 4EJWA 1Q1HA 3WGHA 5EHIA 3LBFA 4QQKA 2F5FA 1JQEA 2Z3YA 4AZVA 3KETA 3DQVC 2XUBA 1WKMA 3QPTA 4N9HA 3FMSA 2XGXA 2XYVA 3IKTA 3ZMSA 3UA3A 4AZSA 4P7GA 3F22A 5E1OA 2ZW9A 4GQBA 1J75A 3BGVA 1IM8A 5AIQA 4CGZA 1JSZA 2PWYA 3LSTA 3FYCA 4XUCA 2QE6A 1NKVA 3G2OA 4PYQA 2KIFA 2P8TA 3AXTA 2EX4A 3PFHA 5FUBA 4RTJA 1FJXA 2GAFA 3E8SA 2VE8A 3JWJA 3GFLA 2UZ4A 1P1BA 1EH8A 3LAPA 2YU3A 2YPRA 1RJEA 2P3OA 3UWPA 3KPWA 5FB2A 2PT9A 4ESFA 2YX7A 2VC0A 2GAUA 2DQLA 4YUXA 3DMGA 2QRVA 1BI2A 4AIHA 5LQKA 4M6XA 5IT9Z 2Z9OA 3FPHA 5C0OE 1MJBA 4QVGA 4MHGA 2GS9A 1PUEE 3I5UA 3NWEA 2UWMA 5ED4A 4XSXF 2Z6AA 4CO8A 5HDKA 3BPVA 6PAXA 4DNCA 5DTRA 4UV9A 3TKYA 4G6DA 3UZUA 1X1CA 2NXCA 2G7UA 4JBAA 2CYYA 1U8RA 4I2OA 3ZMZA 5HVQC 2EK5A 2OKCA 4L18B 3R3HA 1XDUA 2VZ9A 2BV6A 2IDKA 3EEOA 2ESHA 4K2EA 2PMHA 1BC7C 2AN3A 5LQCA 2PVCA 4PWYA 3IRQA 5DPMA 3NEUA 1LJ9A 3HRSA 5GIPE 1ZHFA 3FZVA 2EJUA 2HOEA 4M74A 1QZZA 2JRTA 3UBTA 3AY0A 3KP7A 2ORED 1HKSA 5JI6A 5ICGA 3DTNA 1J59A 3MEXA 3GRYA 3LHDA 4V0RA 3HHGA 3D0SA 5FLXK 1FBQA 3TQNA 5DXAA 5ERIA 3SGLA 4NECA 3JAMK 3WGGA 3GX4X 2W57A 3RPUA 3S2WA 2I62A 1QYRA 3RKXA 1VIDA 4MWZA 3JW4A 4G9YA 1N2XA 1LDKB 3GYHX 4R8RA 1AQJA 3LDGA 3E23A 1R22A 2O07A 5CVIA 4L5IA 2YX1A 4E33A 3WTSC 2Q0OA 5T64A 1FYKA 2P7HA 4EGYA 3I59B 3M6XA 2UXNA 4PYLA 2EJTA 1O57A 3BP8A 3GFIA 2G8NA 2EWNA 2OBPA 4XBFA 5BXYA 1QZYA 2H6CA 1RI2A 2Y1XA 5M5BA 1IW7F 3GNLA 3FWEA 4BXUA 1L3CA 5LR6A 4XSZF 1XTPA 2NXJA 4HH4A 4PIMA 1SVUA 2FU4A 2V79A 3MZYA 3DF8A 3R61A 2FRXA 1NW6A 3MAGA 2O61A 2ZWAA 5DDGA 1JE8A 4LG1A 3B73A 3KLOA 2D45A 4HA8A 4FT8A 3EVDA 3F8BA 2PBIA 1UHMA 2M5WA 2ESNA 5ERGB 1WSUA 5L3EA 2FHPA 1NW5A 2MLGA 2B3TA 1P6RA 4EVIA 5LRSA 1ZH5A 3Q87B 3ZPLA 1USTA 3VC1A 1N7IA 1R8XA 4C06A 3QOWA 1TNSA 3NVKI 1H1DA 1KGSA 2H6BA 3BKXA 2AVDA 1IZ1A 3OCJA 2CFXA 2A5YB 4I0AA 5H6QA 4FT4A 4KT5C 3COAC 3U81A 4RX1A 4QTTB 4ZTBA 3UJCA 3DULA 3JWGA 4HF2A 4HTFA 4XUEA 2G70A 2OU2A 4Y15A 2HFHA 4AUKA 4WXCA 2WTEA 4HC4A 1NBIA 2IW5A 1X19A 5E1DA 3T7SA 3FM5A 3GJYA 3HTXA 4DQ0A 2CG4A 2ZIFA 1T38A 5IH3A 1J7KA 1IXKA 3BPXA 4M36A 4XUDA 3NMUF 3ISPA 4RGRA 3FPEA 2BR5A 3BZBA 2ISYA 3IL2A 3LQRA 3V8KA 4HTFB 4OOIA 2ZWVA 1YUBA 3EUHA 2W84A 1XSVA 1B9NA 5E8RA 1L3LA 2NP6A 2GH1A 4UNOA 4IRGA 1WI9A 4NHJA 4I01A 1FC3A 2GA2A 4OIRF 4PYMA 4TV7A 1P4WA 2F5CA 3IWFA 3OFJA 5L3CA 4A2UA 1J5YA 4HX4A 3WODF 3GO5A 2RC4A 4RTPA 4AIJA 3D2LA 3WG9A 2HR3A 2HTJA 5HDNA 1MGTA 5EZSA 2COMA 4RVFA 3EMBA 3VYWA 5E1XA 3M6VA 5K5RA 2MLKA 4WXHA 1HNNA 3GZ6A 4DQ2A 2Y1WA 3T0YA 3I0TA 1D5VA 5DX8A 5EVJA 1W5SA 4HV6A 2I9KA 3KLNA 2DK5A 2QM3A 3QOXA 2P35A 4X60A 4ER6A 3SSNA 1R6AA 4P9FA 1QBJA 4YFXF 3SX0A 2IBTA 4GUAA 2YXLA 4NQWA 4EKGA 4FZVA 2IPXA 2PX2A 5E2BA 1XMAA 4HQMA 4RV9A 1KA8A 4BQAA 3MAJA 4QVKA 3GRRA 2VODA 2ZNYA 1YFLA 2HKXA 3P2EA 2J5PA 3CO7C 3HP7A 1UFMA 1HMYA 4FT2A 5DLYA 3G5TA 3TKAA 4UUVA 1AF7A 3RIEA 1WQ2A 2LNBA 5ICFA 1TW3A 4XLPF 3FRIA 1W7PB 2MA3A 3F6OA 3OV8A 5LLQA 2VDWA 4C04A 3E3VA 3HOTA 4L0ZB 5DM1A 5GOZA 3OZSA 4MNUA 2L54A 2LF7A 3CDHA 4RGXA 3TOBA 2IP2A 3F8MA 3H92A 3M8FA 2ZIEA 2ZMEB 4ENMA 1KQ8A 2IA2A 3DPTA 3RPQA 3FUWA 3EMDA 3W6KB 3OZTA 1LQ1A 1G3YA 3GGDA 5F1RA 1G3SA 2PT6A 4CYDA 1K78B 1PRYA 1WS6A 1IXRC 1F3LA 1MKMA 2HDCA 3UJAA 1KR5A 2EA4A 3M7GA 3KQOA 3G5LA 4V0QA 4PCLA 3ME5A 2HV9A 2XVMA 2HS5A 4GGGA 5HS8A 4CXFA 1GXQA 3ELWA 3OZRA 3FUTA 3LFKA 4AX8A 2JPCA 2JPBA 4CZZA 3HCEA 5EHGA 2ONZA 4C4AA 2CQKA 2AOWA 3ZMUA 1ZLKA 1SD5A 4MTDA 4HZFA 4HSGA 4QPNA 4DA4A 1YF3A 4Y30A 5HIIA 5EKXA 5EG5A 4CKBA 3E6CC 4LK0F 2Z6UA 1FBSA 1FY7A 4LLNA 1BOAA 2AXLA 3HVHA 3REOA 2QQBA 4HG2A 1D8KA 2L4AA 2PKWA 2UYCA 9MHTA 5K0FA 5GM1A 4YV0A 3E5XA 1R5GA 2JT1A 4MQ9F 5K0EA 3DLCA 4U0YA 5HLGA 3WU0A 3WTZA 2I6GA 2P5LC 3LDFA 1KQ9A 3I4PA 2CMHA 2F8LA 3KQWA 4K6MA 4RTKA 4A6EA 4AVPA 1X1AA 3K2ZA 3TM5A 4C07A 1YS6A 3EVGA 3FTEA 4R1HA 1TQIA 2ZFWA 3C1DA 3JTHA 2PSSA 1KP9A 2O0LA 1SAXA 3KPJA 3AWIA 1ZGJA 5C9ZA 3IHUA 3I54A 5E20A 3G2QA 3ANXA 1ZGAA 1YZ3A 1RI1A 4U0VA 4IWNA 4U88A 4HLYA 5FWDA 3GDHA 4S05A 3IKVA 5L3BA 2RQPA 2IVMA 3NTVA 2D1VA 5DM0A 2F5EA 2ELHA 1U2ZA 4N0BA 1GHCA 5J6XA 5EZQA 5D5UB 1I5ZA 1USSA 1KQ0A 2JH8A 3RTRA 4KRGA 4H0EA 4GC9A 1MDMA 4BLVA 2V9VA 2STTA 3T0IA 1G55A 3KPVA 4DMGA 4RTQA 5EEGA 2O03A 4CKCA 1MHTA 3KP3A 4KNYA 2ZCJA 3TOSA 4YV1A 4MHTA 4BHCA 2AS5F 3SSOA 1REPC 2AVNA 2BBYA 1VPTA 1P91A 2YQZA 2RNJA 1M6EX 4MTEA 3EETA 4CDGA 3PTAA 4IHSA 2ESRA 5K03A 4OA8A 2QBYB 2I7CA 3OPNA 4ZYHA 3K1NA 4KFCA 5BOXA 5J8FA 2IRFG 1XJ5A 3JSOA 1SMTA 1ZG1A 2OY0A 1FBNA 3PLAE 4IRIA 4GXOA 4M72A 4OBWA 4PINA 1FZPB 4POOA 2EFNA 5LEJA 5ILSA 4FR0A 1SQFA 3T1BA 1XGMA 2VT3A 3GFJA 5FCDA 1NT2A 4E32A 3PS9A 1CGPA 3MGGA 3THSA 2RVCA 3R0AA 2FF4A 2ZTHA 1IAWA 3LGAA 3H3UA 2XVAA 1S29A 2L01A 2PGXA 2IBSA 1Z91A 3HCAA 2DU9A 2AOTB 2O6GE 2A68F 1RI3A 3BJOA 3VODA 4QTUB 1XGOA 3C3WA 2HTEA 5EEHA 3KZYA 4CXMA 3NVMB 2NS0A 1VP3A 2GXBA 1ZG3A 4RTNA 2Q8KA 3B7PA 3ULQB 5AONA 1IY9A 4G7HF 2GWRA 4KW7A 1KPHA 8MHTA 3E97A 3FHZA 1SQGA 3DP7A 2AN5A 1I6XA 3ERCA 5D4RA 3I58A 5KK1A 2XROA 2ZBRA 1YW9A 2OO3A 1OYWA 5C1IA 2HQNA 3C3YA 1IXSB 5IKMA 2XHKA 2F2EA 1X3UA 2E7XA 1WXWA 4Z2YA 3RYRA 2A69F 2CKDA 1RJDA 2FE3A 2W85A 2P7CB 1AV6A 1OPCA 3M6WA 3GZ5A 3FXRA 2OB1A 4EM2A 4FSDA 4ETSA 4LMYA 2PFBA 4U7PB 1Q0SA 3PB3A 3V8LA 3JWHA 1KPGA 2K4MA 2HNKA 2EFQA 3MERA 1XCBA 3G3ZA 4HF1A 2DULA 5JHUA 3HA5A 4PDKA 2B9EA 2ERCA 3I53A 1M0EA 4DF3A 1DCTA 4O3MA 4FSXA 3J7AO 1B1BA 3BJAA 1LDJA 1S7OA 4KDCA 1U5TA 4KYWA 3QOPA 5K0LA 3ML6A 4O5VA 3BJ6A 2B2CA 4L7VA 1KHHA 2DO7A 3DEUA 1JSXA 3I71A 2VONA 2AZTA 3DOUA 2TDXA 1R8YA 2AOUB 3GRZA 3TPZA 2L4MA 2G1PA 4YUWA 1RZ4A 2JG3A 2P7IA 4ZH4F 2DLLA 4LB5A 3MCZA 2M87A 3KZZA 5HLHA 3WU1B 2E1CA 3RW9A 2XIGA 2HEOA 2PXXA 4ZYGA 4GOND 1BOOA 2E7WA 2QZ8A 1HSTA 1EIZA 2RKHA 5DRTA 3GU3A 3CUQA 5CVDA 3B02A 3WTWC 5HS7A 2QVOA 1IRGA 2X4HA 1I1GA 4KDPA 2JH9A 2IFTA 3BWBA 2QQ9A 4G94A 2ZULA 4N9IA 5CIYA 3E5UA 3VB2A 3UJDA 1ZKDA 5BPDA 3K1MA 3U9GA 2VDUE 3G8BA 1IRFA 2Q41A 4U7DA 2O06A 4GBED 4DCGA 3P9CA 4OU0A 4ZZDA 2EB7A 4P7KA 2M1BA 2Y0MA 2QLZA 5LGNA 4UOEA 3TO6A 3I9FA 1VLMA 2OQGA 2R7DA 5HS9A 3TQSA 2XAHA 3RI4A 4IV8A 3UJ6A 1XSDA 1NHAA 2V7EA 3KPYA 2XAQA 5AIPA 1J0RA 2FBKA 3HSRA 3PT9A 2FYTA 3VOEA 4F85A 3JWIA 2FBHA 1Z6RA 3CC8A 3DH0A 5KS2A 1NW7A 3M70A 4QDKA 4DM3A 3ECOA 5E1ZB 2NP7A 5FA8A 1FP2A 1YTYA 1VTNC 2VBXA 3BGDA 3SZPA 2HWKA 2P8JA 5CYVA 2FPOA 4R8SA 2Z99A 5BS6A 5K1YA 3HUGA 1EH7A 3OU6A 1R7JA 1VL5A 2MD5A 4FX0A 3NW9A 1R36A 2RN7A 5IT9K 3V8JA 2H09A 3G8AA 5CVVA 3KQPA 2RDPA 4WVLA 1WG8A 2XKPA 1XCJA 3T5XA 3TMAA 4L0YB 4RTRA 1P4XA 4D0PA 3R24A 2DI3A 4E70A 1BC5A 4GEKA 3HSEA 5JR3A 4GCVA 1KXZA 3IEIA 3TO9A 4GOMD 1HW1A 2HYGD 1ZYRF 1E17A 1SD6A 1BBYA 3DUWA 4BLUA 4HOBA 2FQ3A 5D4SA 2BE5F 3A7EA 4OQDA 5D5WB 3R60A 3CLOA 1R23A 3RYPA 2NXNA 1FT9A 3WTYC 4ER7A 2GA9A 4Q47A 1UB9A 4I02A 2PMUA 5GM2A 4BP1A 3B89A 3FM3A 3GIWA 4KN4X 3ZMDA 2M45A 3LBYA 4R6XA 4RB0A 1GXPA 3IC7A 1JHFA 3FX3A 4UV8A 3SVZA 3KQTA 1BI1A 4E2XA 3C6MA 4L5JA 3FPFA 2DK8A 4YFNF 4PONA 5F64A 2ZKZA 1U3EM 4EJTA 3MZHA 2UYOA 2OQRA 2IA0A 2KW5A 3FUXA 3T8RA 1X1BA 1AWCA 1QO0D 2E1NA 5E9WA 5CVJA 3JSPA 4QDJA 4JK1X 5ILUA 2Q2EA 3KR1A 2FNPA 4HX7A 4WF2A 5LQJA 3G89A 5DYMA 2LD4A 1I27A 3WTUC 1XGNA 3HOSA 3MTEA 1R58A 2JHCA 5CD1A 3CKKA 1I9GA 5K0GA 2B0LA 1PJZA 4CKEA 2NYXA 5IT3A 3FTDA 3PQJA 3DXYA 3ER8A 3HHHA 5K8VA 2NAZA 3OFKA 4P5OA 1PP7U 1U2WA 3F8NA 3L7WA 1BKYA 4BAYA 3U1DA 1UHWA 3KP6A 2GIVA 4JXJA 5BPIA 3G2PA 1LVAA 4PYIA 4BHBA 4AZWA 1R1TA 3LECA 1TPYA 4QQNA 1FOKA 3IWZA 5DV5A 1HW5A 1R74A 4KWCA 4GC5A 4HDVA 3CO6C 1BN5A 5CM2Z 3THRA 3SZTA 5LQNA 5LHHA 3EVZA 3AJDA 1B59A 3SFZA 2XAGA 1H9GA 3BXOA 2FOKA 1Z3CA 4MEXF 2BGCA 3H2BA 3EVBA 4E2YA 1D2GA 2VDVE 1JTEA 1QAOA 2FRHA 3LKZA 1QANA 4EJOA 3S68A 3ID6C 2JZYA 2K4JA 1EG2A 1STZA 4RYLA 3SMQA 2GB4A 4KMUX 4RAZA 3CGGA 1IN4A 5ICCA 5BMZA 2O0YA 5DSXA 1EJ6A 4KUMA 4X41A 3DLIA 4RGUA 3E05A 2J5OA 2XV4S 4JQFA 3KEQA
chains in the Genus database with same CATH superfamily
1M6WA 1I6HJ 1Y7HA 4QOJA 2QN2A 5A3SA 3GLIB 1K89A 2J1LA 1D5WA 1KQNA 2ZCWA 4IJWA 3RTDA 5T4HA 3K4BA 3KFWX 1E3TA 2R6R1 3EY9A 3K96A 2H11A 4KQFA 4UTZA 2R7MA 4FDTA 4A0RA 1JDBB 3FZNA 1QVVA 2Z4SA 5COQA 1USWA 5FL3A 3BIXA 4L7QA 4C0QC 2EFWA 2EL9A 3PDWA 3T7JA 2PSJA 4AMVA 1SOAA 5LM3A 5DM60 1GEGA 1OI7A 2XBUA 1B8IA 2DA5A 3CJRA 1FW8A 1U11A 4HLQB 3QXXA 2WWVD 1IBLB 4JHXA 2DAPA 4CYCB 3DVQX 2I1QA 1GFZA 1W1IA 1SK8A 3WNBA 4UEWA 1DIOB 1S3JA 3LBIA 4YAEA 5JANA 2OZUA 5L40A 4DABA 1DV2A 3KYCA 3R5FA 3Q8MA 4J0EA 4NNJA 5L3FA 1U0SY 2HWXA 3VSAA 3PQFA 4TWIA 3GVAA 2J8ZA 5I7FA 5F12A 2ZXWH 5EQFA 4B17A 1KU9A 2XWBF 4H7PA 2RV8A 4GKBA 1CP2A 3PIDA 4YRTA 4P55A 5KNBA 3SQWA 3JAMZ 1EPUA 2PLYA 5GPBA 2CQXA 1N5OX 1NUPA 1JTYA 2BMDA 1PHRA 2VQSA 4A6DA 3MILA 1ZQ9A 3IKLA 4KMOA 1DAPA 4G5QA 4PO8A 4UNQA 2FMUA 2O9JA 3IOEA 3QPDA 4C7XA 3BT7A 1WWXA 1XZLA 4CMKA 4GYWA 2JJ1D 5F1JA 2XQGA 1TECE 4D8YA 4EG8A 1B4AA 3DBOB 1Y9AA 2O2IA 5EJ8A 1VE7A 1P18A 3NTXA 1TGYA 3SKYA 3F0TA 1VCHA 3D4BA 2XCTB 2AHQA 2E4YA 3LQ2A 1JU9A 1YR6A 3J7AC 4CEIA 2WJGA 4O5AA 1ZU5A 3I8XA 2I7TA 4MRNA 4CN9A 1FTNA 3LBHA 2H3HA 3PUKA 3QHPA 3CWZA 1BA2A 2XF8A 2VASA 1LFDB 2VJNA 1WMEA 2JIOA 2B4AA 2PGDA 3IQHX 3G7SA 3PQEA 3SIRA 4AWBA 3HKDA 2V3VA 2WPDD 2CNKA 2WMDA 2KRFA 5FD5A 3SYTA 3M3HA 3M8KA 1E69A 3QUTA 2DUWA 4AJ2A 2XPCA 3ICWA 3JD1A 4YP7A 4ZJUA 3D8SA 3A70A 1RI7A 3IVRA 5JTUA 4P36A 1JQ3A 4XD7D 4EYSA 2C2WA 5IH7A 5K5OA 3RAFC 1IY2A 1UFKA 3WQHA 1RI5A 3AF2A 2RH5A 2QRJA 1AUQA 2HK7A 4EA6A 3DEYX 4MRMA 3KSAC 2HSEA 4QASA 4QOEA 1EFDN 4W8HA 3DXJF 3RD5A 4LTNA 3LUPA 1IUYA 3TMOA 2PKEA 1GT6A 5JDIA 1N6KA 2NXNB 4HNAA 3TXXA 4C4ZA 2HRDA 3JQ9A 3JATA 4FGKA 5JYDA 3EASA 2Q5OA 4GX5A 4PJJA 1JG4A 1K3UB 1KMHB 3CTMA 3AXSA 3WTVC 3O7WA 3OY7A 3PQ4A 4HWRA 3KNZA 4EDFA 2IEZA 3PI7A 3JZFA 3V4RA 2CCGA 3A6GA 2IHVA 3K09A 3MMNA 4UFOA 3T61A 4ZHQF 1YUNA 3IE1A 3EFEA 1TWFJ 2LKPA 4QDOA 3K70B 1IPEA 5DXFA 4BKOA 4ZCSA 1Z0UA 1DARA 4ON0A 2XOXA 2E7ZA 1NOKA 2GZWA 2GILA 3C7DB 3NAUA 3QFTA 5JJIA 3IVAA 2X13A 1W1WA 3BK1A 1FRVA 2QUBA 1PUFB 2CFCA 1UC4B 3LX6A 4LOCA 4AJOA 4EFDA 4UTOA 3TTSA 5I48A 4MP6A 3D7SA 1XD7A 1YDHA 4MYRA 4NYMQ 3B6KA 4R98A 3MKLA 3ZK8A 1EI9A 2DPGA 4MGEA 1OYVA 3ZGYA 1A4XA 2HJVA 1WSAA 4LG3A 1DRVA 2BW0A 3HRKA 1HH4A 2J07A 3MUNA 3O0DA 4GQAA 3WIDA 5ITZA 3P2KA 1VQMI 3IEXA 1T5BA 2WAQN 2G82A 1MVLA 2NX2A 2ZB3A 3FTNA 1JMKC 1FTSA 5E1WA 1XRLA 1KJQA 2W71A 1UFVA 3QVJA 3QW4B 3WTBA 4DBVO 2ODPA 4A0ZA 5H68A 5KOIA 4J3NA 3UGTA 1T2FA 2DP4E 1DPRA 3REGA 2GAJA 3D8RA 3ESQA 4D26A 1ZN2A 2J9XB 3FMPB 5D5XB 1KF0A 2NVTJ 1IE3A 4PWZA 5B6IA 2GIZA 4M6VA 1GL3A 1GZ5A 4DWWA 4L5EA 5C3UA 1CUSA 1TTQB 3HN6A 3PPYA 5J4KA 3FGOA 2HQ1A 4GOXA 3SP1A 16PKA 4KBYA 4KT6A 3G2HA 1VMDA 4I50F 1V4NA 3AL2A 3N5KA 1SUDA 1TYCA 4PC6A 1XZMA 4HVAA 4QHSA 2CT8A 5ECYA 3DTYA 1T9BA 4F3RA 4LK1F 4ALNA 4F9EA 4PXAA 2OXIA 3W77A 1W5TA 3AUFA 2GN2A 1T1EA 2OR3A 2JUCA 4EMSA 2ZIVB 4O4IA 3GMIA 1ON2A 2ZUWA 3AG1H 3FSGA 4FLEA 4PNPA 2X8BA 1K6YA 1AA7A 4L4YA 4JUFA 2FE4A 1QG2A 1J21A 1XN1A 4JFAA 5D5PA 3QLVA 1X74A 1FFXA 3GBVA 5E18F 5TISC 2HL6A 5H3HA 5E3MA 1ZH6A 2Z98A 2P9QA 3LKDA 2GVNA 2P1DA 1I7PA 1Q1NA 1XU7A 3AV3A 3RPEA 5C5DA 3H9UA 1EH6A 2A9OA 2C9DA 2W8BA 3DO8A 4D9NA 1LRKA 4A3LJ 1FSPA 3UPTA 3X2QH 3MWJA 2BXYA 1XA3A 2CBXA 3IQWA 3K0AB 3REFA 3OUZA 4YP5A 4Q1CA 1U98A 5B1SA 1O7FA 1DO0A 1S7EA 1NQUA 1XEFA 4BNMA 2ZDHA 5K8JB 4LHZA 1KYWA 1DBQA 1VHLA 4RDXA 1IJEA 4WLNA 4NHOA 2IA1A 1K4YA 5F9FA 4DUPA 2PGOA 4DDWA 5MDHA 2G9VA 2R8EA 1QR2A 3A2KA 2QGNA 2GZ1A 1ZK4A 5T3UA 4H60A 2A9PA 3BF7A 5B3SH 4HI0E 5G02A 1P7WA 3W7VA 2EJBA 4C5CA 1C9DB 2NUAA 3L0PA 4QOFA 1GV0A 2HDNB 4KDRA 4BB9A 1I10A 1HF3A 1OFHA 3P45A 4HLCA 3AF6A 4Z54A 4Q4CA 2F64A 1XA4A 3AINA 4UXNA 2VZLA 2XAUA 3FGNA 3HOWJ 1ODDA 2KJQA 2EIJH 2Q2OA 4MICA 3S4YA 2XRZA 1WZNA 3SJBA 4MW1A 4D9KA 4C1NA 4F71A 1M6VB 3NEPX 3VO2A 3QU3A 3O6VA 1RZ3A 2ONYA 3IJRA 4JBLA 3IULA 4DGQA 4DDHA 3RYIA 3A2MA 1PDVA 2ZDQA 4Q3KA 4XEUA 3BMNA 1G19A 5CJPA 5C1DA 3F1KA 4EG7A 1QLJA 4IFIA 1UKYA 4EKIA 3NLLA 3A27A 3WNCA 4WJKB 1ZUNB 4YRNA 3B8EA 2MYNA 4RV5A 1PGPA 1OCTC 3AR8A 5TARA 1WCWA 2P0AA 4CMCA 2J9FB 2CEAA 1IL0A 3L7KA 3LC7O 3K30A 5B3AA 4XMYA 4Y6SA 1RCFA 4LJZF 2BHSA 4ERXA 4M37A 3CVYA 2ADUA 2DXIA 1D2HA 4E5KA 1Y1RA 2ZG6A 2KB0A 5TPZD 4TS1A 5J1UA 1LX7A 2XGGA 3IP1A 1JHYA 4TVOA 1EP2B 4QXRA 3TD6A 4E14A 1EMDA 3EXG2 3N75A 3KYDB 1RMTA 1UZAA 1T5SA 4R2WA 5IAJA 3DZHA 1GG9A 3SFTA 1Z17A 4CFZA 5DTJA 1D6NA 3B6CA 1B23P 2F48A 1FQJA 4JOCA 3LZDA 1Q7BA 3U40A 2MBFA 3BICA 1T43A 1FE8A 1ZW1A 2P2NA 4FI3F 4OSOA 5JNWA 3CY6A 1W8IA 4IZIA 3NKLA 4NY1A 1ZUNA 4TTRA 1F7UA 3WJAA 1KP3A 5CJ9A 4RVHA 1Q74A 3DMTC 3RUCA 4DV4B 1XAIA 2VHCA 2Z6VA 4NICA 3OWTA 2J9FA 4AMZA 4UAVA 3ZU5A 1JG6A 1QV7A 9LDBA 4PQRA 1T3GA 5DCMB 5KYXB 1OCZH 2VBZA 2EZLA 2VK4A 4BNWA 2DUMA 4K3VA 4WADA 4PNEA 4U9HS 4QUDA 2QMHA 3QWAA 4R41A 3QRFF 1MH9A 2WJJA 2JASA 3QYPA 1TTPB 3WVNA 2UDPA 3LWNA 4DMRA 1CSEE 3MAAC 2M7BA 2NVQJ 4RW0A 3SEFA 3UG7A 5IN4A 3CG0A 3OR2C 1U0NA 1ZARA 2ZXIA 2FF5A 2RIPA 3L1UA 4EF6A 5CP8A 2ZBGA 4V0LA 3RFTA 1OJ7A 1Q91A 3BFPA 4CM3A 3DBHA 4NENA 2M2EA 3S2FA 1PVVA 4X93A 2H48A 4BJ6C 3WWOA 1A7JA 3BMCB 1D1PA 2YXPX 4V1CB 1IWBB 1PG2A 2QRVB 2ZRFA 4Z4GA 1JHZA 5AW4A 3ELUA 4CEJB 2JLWA 5ALNA 5LZ4A 5DS9A 3DDUA 3FCUB 4NAUA 2KQUA 1Z13A 4G9GA 3THWB 2DWOA 2JFHA 1XLTC 4XM1A 3LCVB 1B00A 1EZ1A 1Y33E 1I4EB 4I14A 1ZCJA 5CXUA 3N97A 1QZTA 2W98A 3W2HA 2RMKA 4BBPA 2VKHA 1XTJA 1WJGA 3G6WA 3V4SA 4F52A 3C4VA 3HJHA 4NQZA 3OOHA 4WFKA 3NU1A 5DYYA 2W2VA 4YMTA 2TMDA 3PR2B 4I1SA 1CZLA 2GEUA 1J56A 1ZINA 2ZCVA 1S2NA 5GONA 3UCXA 3R7FA 2DPUA 1N2ZA 3AK4A 2MSLA 1UPXA 2YC4C 1MDMB 3HR4A 1VRWA 1RUOA 1T0HB 2R6JA 2FPGA 4HDMB 1D1BA 4V2UA 4YCSA 9ANTA 1NNI1 3LA6A 1IY0A 4HWOA 2IPLA 4J9VA 1M2NA 3EEIA 1WBBA 3KFLA 2ZB8A 3OM9A 3DMFA 3NV7A 1HUQA 4FHTA 3V8BA 4LG0A 1AHHA 2R5NA 5F04A 3DPUA 5KJCA 1D5CA 3KQKA 5JFRA 4C1BA 2VBYA 1JI8A 4Y6RA 3UMBA 4A26A 5TE9A 1TIPA 4M6WB 2DFIA 2WJ3A 4PLPA 4ZO7A 2FMYA 5DBEX 2DA2A 1Q1BA 4OHOA 5TJHA 3DM5A 2OHIA 3ADKA 3DE1X 4QUBA 4R2XA 2NVOA 4YIKA 1ON1A 3RIGA 1ZH2A 3GL9A 1G7RA 5T8KC 2YWBA 3HVIA 3GLSA 1GG2A 4I81A 4EGSA 3L8DA 4LECA 3VR6H 3BD9A 4X65B 1RQLA 4KGZA 2AFIB 1CR2A 5EZ6B 3HPHA 4B3SB 5LA6F 1G18A 1KO4A 4HBLA 4KQ6A 4FBMA 4HGNA 3O90A 3IBGA 3N0VA 3W8RA 1EX1A 2QTMA 2B8NA 4L5BA 1VDMA 3BOQA 1X8KA 2F9LA 1FMVA 2H7VA 4PTLA 4LG0B 2VBGA 2FOIA 1W7PD 1N5DA 3ORFA 3WL4A 3LD9A 1JA0A 2STWA 4ITRC 3WGVA 5HZGA 4C6SA 5KOHA 1H2BA 2I80A 4HR7A 1FDIA 1G21B 4JU8A 4NBSA 3UPUA 3DQZA 2CV0A 5BV2P 2G7HA 4KN7X 3RRYA 5EZHA 3DXZA 3IA2A 2ZTMA 3Q6IA 4FDVA 2L82A 1P29A 3I0NA 5ECDA 2WKWA 4CJXA 2FZVA 1RVDA 3DL2A 3UMYA 2R8OA 1JQDA 2ORYA 3RVNA 3DL7A 2Q6OA 2ZXUA 4XWAA 4NQWB 2QRMA 1OLSB 1YHQI 2I1WA 2ZSJA 3UCEA 3AVTA 1COWD 4ZJYA 1FJ2A 3VPFA 1U99A 2F3UA 5DBIA 3QFHA 3AIKA 4JWTA 1HG1A 1U78A 2BGKA 2G71A 1VYTA 3DZGA 3HJGA 5AH0A 5AKXA 2VJKA 2B99A 3FPJA 3CF4G 3UT5A 2NO1A 3D3WB 2QX6A 2OQVA 5HIMA 2W9XA 1UF9A 4ZU1X 2XT0A 3RT7A 2X51A 4L0QA 2NN3C 3W6JB 4OM7A 4TVBA 4EUHA 4WXDA 4TT3D 5CDHA 4V2FA 3IHLA 2XPVA 3ZLUA 1NL3A 1JFFB 3LPCA 3JRNA 1ECCA 2ODEA 2V4JC 3V48A 3KWMA 2R3SA 4I4TA 1MJ9A 2XSJC 2DT6A 1I8TA 1T9CA 2EKBA 4GWKA 2VSNA 4TXNA 3K9WA 3HCCA 1L8LA 4GX1A 4LXGA 4RA6B 3IERA 1V2GA 1RI4A 5BNGA 5T8KA 3MB5A 2CSXA 2P4QA 4V1CI 3RTCA 3S2GA 3K71B 2AXEA 2P0EA 2YWXA 2PI0A 2K2WA 4JCOA 1P2VA 1G38A 3K1JA 3UHAA 3FFAA 3HKEA 4Y1RB 4GO1A 1G5IA 1WPKA 1QAQA 5FOQA 4JL8A 3KSDO 2BGWA 1R0KA 3M81A 1JEYA 4KVGA 2XECA 4PIVA 2OZVA 3ORHA 1G6NA 3PSIA 4GL4A 2GT1A 3OQHA 4FYMA 4JLJA 3F78A 2POQX 5AUQA 1CLEA 2VJIA 1E59A 4Q00A 4P4SB 5CVCA 1J5EB 2UUZA 2G9UA 4LITA 2OBMA 2QLJA 3WB1A 1KMQA 2EJWA 4UHTA 2BELA 2WBLC 1ZNZA 2R79A 2WYWA 1A88A 3KR9A 1WRJA 4B43A 3PNQA 4MW5A 3CLUC 4R9UC 4HDOB 2XNJA 4IIXA 4XRSA 5AW0A 1MJFA 3BD8A 2I4TA 3DO6A 1UBMS 1K75A 4J00A 1MVOA 4RA6A 1QUEA 2H08A 2PS9A 4P54A 3TCNA 4XLLA 2J7PA 4F3TA 1IXCA 2VSQA 5GPAA 1EGHA 2ORWA 3A58B 2B69A 1DO2A 2VP4A 1JPNA 3QI2A 1FNNA 5HLTA 3HKCA 4LVNA 4TL6A 2O3SA 3DGEC 4GR9A 4QYWA 4Y1RA 1LPOA 1JXQA 2OLKA 2PUCA 3OPYA 1Q21A 2KDOA 2WY2D 3FCYA 4FGZA 4S1TA 1QFZA 1T15A 4TM8A 4L9TA 5CHYA 5HE9A 3DNPA 1QH1A 3FNHA 3RFVA 1QXSA 2PV0A 4FHZA 5ALGA 1E4VA 4M3GA 2FXAA 1XZCA 2QIPA 2QTFA 1OKRA 1NVBA 1V1MA 2OK7A 2WHEA 3OLXA 4B9EA 5U4XA 2PIDA 4AKHA 2EFEB 3F3KA 4ZMRA 2P2YA 1MX9A 1BYUA 2BL4A 4W1SA 5CYPA 1JB1A 1KOJA 4H7IA 3CUOA 1S7AA 3OEYA 5KWVA 1G5TA 3TIIA 1T9AA 3T1HB 3ZDXB 3GW2A 2YRWA 3UWSA 3F4KA 5GIOE 5IBRA 2JF0A 2V58A 4EX6A 3EDQA 3EXG1 2ZUTA 3BTLA 5L3GA 3RC3A 4I76A 1KU7A 3G0DA 2C82A 1CC1S 1ZHOA 4JSRA 1VG1A 4ZHSA 4YP0A 4DIUA 3VR4D 2H1RA 1H0RA 2C42A 2OAEA 4B81A 2Q49A 1EWRA 1ZUWA 1ZK3A 5TF0A 3OJLA 3H5LA 2JGAA 2P2LA 5F7JA 2EEPA 3DKVA 5CVEA 5F7ZA 3T7AA 4ZDOA 1S9HA 4N3BA 3ZBUA 2JAUA 3LOQA 2X8LA 5BSWA 3VVBA 3PUYA 3W6ZA 1LBHA 1NLMA 1Z21A 4ABZA 3C14C 1C0WA 3GRCA 3JQFA 4MYCA 4X90A 2VF4X 4MV7A 3R0XA 4XFJA 4ENUA 3KTFA 5KEIA 3EWSA 4YQZA 5IUNC 1T4MA 4EPTA 1B4DA 2B4TO 3WGTA 3O2JA 3F21A 5I01A 2HF9A 4NAHA 2P6TA 1MLDA 4EM1A 3H2ZA 4IHAA 4TTIA 1JPUA 1ENOA 3IV7A 1BJRE 2MW8A 2O3FA 2XIQA 3N70A 1PNRA 3ULKA 3LY5A 3DFKA 1U3UA 4K1LA 3WHPA 4CUJA 5AVRA 4KPGA 3F71A 3LVBA 1GG5A 4G5OA 4H7JA 4UZFA 4PJ0C 3X2FA 3GLGE 2ZTVA 3TW0A 2PKXA 3UAXA 2XAFA 1F1JA 3KVOA 1CRZA 2Y75A 4FASD 2Y2UA 2YH2A 4ZXFA 4LDAA 4HEQA 4PSDA 2OXFA 1SCBA 4M8LA 4G5FA 5GZ6A 4BE7B 3X0DA 1R0YA 1EIWA 3L92A 1YU6A 1EP1B 4OHCA 2GHIA 4IIYA 1KR2A 2M0MA 3FTPA 2RAEA 5BUZA 3FIUA 3OLCX 1I1NA 3B1JA 1K0UA 1XKXA 4LRUA 5EMJA 2WWYA 4ECEA 1QM5A 1XSXA 1YZHA 3CJTA 4GSKA 1PJ8A 3T3HA 1VCOA 2FNAA 3IUJA 1L9XA 2H63A 4Q7JB 3WMFA 2W2QA 5B7GA 3M3YJ 1VL1A 2A1TS 2XMCA 3MTQA 3PVCA 4L22A 2P3QA 4PY2A 5E4FA 5FXMA 5BWMA 2OHVA 5KTKA 2FN8A 3HRHA 3PIOF 3ILSA 4HNGA 1UBGA 1FNBA 3P4UA 4YCBA 4A0FA 2O05A 1JQBA 2OBLA 2VPWA 2O0HA 4ESEA 2O2JA 2X3UA 3QE0A 5LGTA 1BS9A 1GU0A 1HM5A 1M6YA 2GK7A 3ND8A 4FQ7A 4A0YA 1V55H 3KQVA 5KINB 4W97A 5AJTA 1ADJA 5NLLA 3V6MA 2ORVA 5JHGB 5KHOC 4ESBA 1MC1A 1NN3A 4GICA 4U0JA 4YCJA 3HOVJ 4HMOA 1HDZA 1VE1A 3OIVA 2K86A 5ICEA 1XCLA 2A33A 3LSPA 2GXGA 4UVAA 3W6VA 2XB4A 2YXEA 3LY7A 3NZEA 3QQPA 3O2SB 4FEEA 4O02B 3ZWWA 4NCIA 1GSOA 1VP9A 1TCBA 2CXNA 2QPOA 5LDDC 2BSQA 2R7AA 4IIJA 2J33A 4MKXA 4RESA 3H3ZA 1H4VB 1V1RB 3VSEA 1DG3A 1O9GA 2EFHB 3IDOA 2C95A 5JASA 1CQJA 3HNRA 1R6UA 5ICMA 3GBSA 4CF5A 5GY7A 3A7DA 5JXWA 1SXHA 3ACCA 2UZKA 4TMXA 3TAXA 3CN9A 3MHTA 1NI4B 5FTMA 1DCMA 1GZ3A 4L73A 4JBWA 4C2MJ 2R68A 1BIBA 1OILA 3I92A 3MTBA 2C2ZA 5KPJA 5HGJA 1U2EA 2I6QA 1FX7A 4WNAA 2MMGA 2Y6UA 3BLYA 1RR7A 1ZUHA 1XLUA 3BWMA 3K9HA 5EXSA 5F5LA 1DX4A 2C3MA 4KLZA 1W7PA 2Y1KA 2QN7A 2FMFA 4A4DA 4LZLA 1XALA 2BTQA 2QKMB 2CJWA 1PR9A 2I2BA 5TRDA 1E32A 2BBTA 3H13A 1EE2A 1F9AA 2QR5A 4QOHA 4G84A 5D6OA 1OZAA 4AZ3B 5GZ1A 4RHFA 2ZUSA 2C7QA 3L1KA 3G88A 1SZJG 3IAM2 3VH3A 3VU9A 1JT6A 1W5EA 3K0BA 1X7XA 1EDZA 2BIFA 1PWZA 1KTVA 1SU4A 3HUGB 1SQSA 1Q7EA 2HBRA 1GLGA 1K5HA 3T1VA 2O59A 1RLJA 3NI2A 4I4CA 3KR2A 4CKZA 4C3IJ 2C0PA 3AI3A 3F97A 3BZ6A 2BI8A 4PFJA 1HTWA 1C9YA 2NUPB 3E6DA 3ELYA 2W4SA 5BSKA 1MABA 4C7OA 2WOOA 2XVXA 2K5UA 4EVSA 4D4KA 1P2TA 2OT3B 4KR6A 2XTNA 1BXZA 2BI7A 2OO5C 3UJ8A 1KYVA 4ZVMA 3H9CA 5ADWA 3A1TA 5AVSA 5JBNA 1NY5A 5DI3B 5KDLA 9GPBA 1ZRCA 4AJLA 2JLBA 4MB2A 4GZ3A 1HA8A 2B21A 2ZJRF 1HCRA 2FCRA 2C3UA 4QECA 2IRWA 1MBEA 4Y52J 3JARA 4IFEA 1XC5A 4TQUS 3F9RA 4XB6B 4AP5A 3AMVA 1F38A 4HATA 4F9GA 7ABPA 2NG1A 4HH0A 2WW8A 4N9WA 3HJRA 2ICWG 5EF6A 3MNFA 2I7XA 2QL7A 4PYNA 4MDYA 4XVQA 1I5RA 5DYGA 5FUQA 5K4GA 4MV1A 1PR0A 1OBVA 1WXFA 3C3JA 5BW6B 1IG7A 2UUCB 3EVEA 1GKLA 3AM5A 3PGVA 1WKCA 3OIFA 4FYXA 3D2CA 1ZD1A 2HRBA 2EQAA 1D3AA 4W5NA 1JG1A 2JIMA 2VP2A 5U4QA 2J6HA 4H7HA 2J5KA 4KMFA 1YI1A 3IUBA 2IZ7A 1CJSA 1NJ1A 4G0NA 4K2HA 3TQTA 4C7JA 3RU7A 3F46A 3FDJA 2PWAA 3JQGB 1GXSA 1ZWKA 3GTPJ 3G2NA 1VG8A 2BE9A 2CE2X 4MAFA 1EQAA 2QX8A 4M53A 4P3PA 1LFUP 4E0BA 3HXQA 2HXOA 4B5LA 1WXQA 5DM6F 3HC7A 3IRRA 1F4LA 1Y89A 3SSAA 1SUCA 4F2PA 3FIWA 1EVQA 4B35A 4BH9A 1VI5A 2G4CA 2H6EA 2G0AA 4JJFA 3RFCA 4BFCA 4ER3A 7GPBA 1U9JA 3EZYA 3HCFA 3V1NA 5IVPA 2XPWA 3ZCPA 4Y2SA 2CW5A 3U37A 3MINA 3THRA 4I08A 1YIOA 3K0LA 3AUTA 3HJAA 4E2WA 1YRQA 2PX8A 1JPJA 2D54A 1JR4A 3K73O 1TMKA 2OMEA 2CFRA 4B2IA 3KPUA 4YJFA 2ON6A 4C22A 2XWPA 4L50A 1T2CA 4MWTA 2I3GA 5ER6A 1P4HA 1CUYA 3GLGA 5LRRA 4XSGA 2GNOA 3CF5F 4IZOA 4LOLA 2NIPA 1UEIA 2ZBPA 4HFMA 4NCNA 4KL8S 3SZRA 5D8LB 4R71A 5C4JJ 1T33A 2PQ8A 2AOUA 4ZXPA 4QREA 2OB2A 4RK7A 2Z5VA 3SZUA 1NVFA 3V46A 4MGYR 4AYTA 2NU6B 3L6UA 3G9QA 3GCXA 1F9NA 4QFBA 3GDOA 2KT0A 4MQVA 1OAOC 4HZUA 4YFVA 2G07A 5FD8A 3SICE 4EGZA 2XZPA 3NNNA 5JWRA 2R5FA 1VQ4I 1UZNA 2FMIA 2XUIA 4O2BB 4REQA 4RTSA 2NVXJ 3RRMA 2UUOA 4OWRB 3CVUA 3FRHA 1TU0A 2QVLA 4YPVA 5F2OA 1Z2NX 3UGJA 3OEEA 4BNVA 3DR5A 2GHTA 3FUVA 2Y1OA 3MXOA 1A76A 1ZK1A 1L7AA 2P9FA 3EIHA 3IGFA 2A8YA 2X1VA 4FI3C 2BT4A 1U28A 5AESA 4DRXA 1K5DA 3GZ4A 3ZQLA 3M5WA 2C00A 4JLUA 5CU7A 4FGJA 1DINA 4MI1A 3F2VA 5BWCA 1PZGA 2Q7XA 3RDPA 4MJLA 4U00A 3C1TA 5CT5A 1FYLA 3BD6A 1XD9A 4E5VA 1WVMA 4XAQA 2O0JA 5IHPA 4XKWA 1IMJA 3DJYA 3FW1A 1DQSA 1N2SA 3ZCQA 4N03A 4M9XA 1KYXA 3OOJA 3EG9B 4G8XA 3AGQA 4AO8A 1S0UA 2VP6A 3CLRD 1DGWY 1GGVA 4TYQA 2H2WA 2VNHA 2O14A 2E1PA 5DGIA 2AZ4A 5KO2A 2R1TB 3L46A 3ONFA 1M1ZA 3VKGA 5EIOA 1JJ7A 2FA9A 2MHCA 2DOKA 4JLPA 2VYCA 3BMOB 4D6YA 1FDSA 3R9XA 3PICA 1YACA 4DIBA 2IH5A 3GEBA 1OT5A 1U3WA 1QP4A 3RTBA 1YZFA 2IYWA 4CDMA 1WCIB 2AFIE 4Z8XA 3ZY2A 4YRZA 2CV2A 1HKHA 2J3DA 1SHUX 3KDAA 2FPWA 4WY5A 1LEBA 4L9RA 2ZP1A 2L7FP 5EKTA 3VI4B 2WU3A 3LPLA 1Y0UA 1RQXA 1Z2EA 2D8AA 2XCUA 2MSCB 2X0KA 2ZIUB 3BKWA 3NDIA 1KFBB 3DPLC 3IT2A 4NG5A 2A61A 4AJNA 3J80K 1HZZA 2Z2YA 2WJVA 3H75A 3TQHA 3DUFB 4C2UA 6Q21A 2ZM5A 1E79D 1E58A 2D5AA 2ATVA 1Z0IA 3EZFA 1B73A 4ZICA 3QVGA 1XZ8A 3O3NB 3IAFA 5FBWB 1A35A 3ETJA 1XTAA 1PLJA 3NQOA 1LDGA 1YJAA 2RIRA 3P96A 4OMFG 4YRPA 3ZGLA 1Q0QA 5JAPA 1KYZA 1KY5A 1WXXA 2QP9X 3A3PA 3AFGA 1C4WA 2ZTUA 2PQ2A 3F3XA 1JHOA 1KYQA 2LIVA 4LX8A 2DBRA 4E03A 2W2LD 4LQDA 2FPIA 1V5WA 4BY1J 4UE6A 3HU3A 2ZI5A 3L4KA 2PUEA 5DM2A 4AY2A 3DYVA 2H8WA 1NUQA 5DRYA 1R4AA 3KX2A 4I6EA 4PGFA 1QYXA 3CX8A 1SUBA 3QKUA 2L7MP 4HDNA 2PBZA 5EPEA 3E53A 4UBMA 1Y9JA 4NMXB 1DAIA 1T56A 3C3DA 4D3FA 2AFRA 2ZBQA 1NULA 2REQB 3C1AA 3FPSA 1PV2A 4YAWA 2JVIA 3UPDA 2C54A 4R5MA 2PZEA 3L2CA 3ZI4A 2HO5A 4WGGA 4OQ4A 4URFA 3UFXA 1DL5A 3KKZA 3HYTA 2OUMA 2RK3A 4DANA 4KQCA 2WV7A 2HPZA 1ILEA 2QYOA 1C1DB 4PO9A 5H4HA 3ZTTA 1LEAA 3RWBA 4G0UA 2WAXA 5K6AC 1QHFA 2BZGA 1M1YA 2FPPA 3LQKA 4AS3A 3I0MA 1SRRA 2Q0QA 3FUUA 3I55I 3HOYJ 4IEIA 3TKLA 4M8KA 3ZDRA 4ES6A 3FPKA 1B9MA 1S2OA 2A14A 5CAEB 2PLNA 3K35A 5KWIA 3DS8A 5FWXA 5HF9A 5BQXA 5D3QA 1LLCA 3ISVA 3H87A 4KFRA 5LB2A 1KGDA 4MQ4A 5J1TB 1W4MA 5A4FS 3C7JA 4OMCA 5H9WA 5IEBA 3A11A 4C3OB 1O6GA 1XJQA 4DV7B 3FSJX 1GQOA 1T91A 5I7EA 4KK4A 3AOGA 2PZLA 1V7ZA 3FWHA 3M83A 1CF4A 3WDMA 4X5OA 3BTVA 1DWPA 3M3DA 2PRSA 1O54A 4RTOA 3IOMA 2FK7A 4OK3A 1QUFA 1E3WA 1U9NA 4CA0A 1EHYA 5IKEA 1P73A 4KR7A 1EXVA 2P6SA 4BNXA 5L45A 3WLQA 1MRZA 2H5EA 2VDMB 3I4CA 4BVGA 2K2QB 4DCVA 1GRNA 1EH5A 4RAYA 1YQDA 5BV1A 4BN5A 1KKMA 1SXGA 5BW5A 1RWKA 2X6XA 4HJXA 1R15A 4DVJA 3HADA 3ZJVA 1NM5A 4AD9A 3GROA 3DYIA 3AL0C 4Y4RA 1IC6A 3I72A 3CJQB 3KZ1E 1FP1D 1DCKA 3VU3A 5CCBA 4QZVA 9ABPA 5LBIA 1SVOA 2ZUFA 4UVCA 1L4FA 2B6NA 4HAVA 4IHJB 1T8UA 4MWEA 2DEUA 3KO8A 3JPYA 1IPFA 1A71A 1F43A 2ET6A 4YMUA 3E7WA 4A0QA 4QUEA 2FBIA 4LC9A 1IBSA 4I09A 2E1MC 5E4TA 1K86A 1PT6A 2YBEA 4O08A 3DKWA 3Q4GA 4QXOA 4UE2A 1HLPA 1JLSA 3CU5A 3O92A 2OTCA 2NNLD 2XA9A 3QPWA 1T2UA 4KQGA 2P65A 4WLFA 4DDKA 2I6SA 4F38A 5KYYA 1LRJA 4WESA 1Z22A 3PC8A 2QU7A 1APLC 2VTBA 1H69A 5G41A 5TXGA 4I9FA 2V1XA 1NDUA 3JAKB 1J5XA 5HF5A 5SZIA 2PYDA 3K6JA 4L9AA 4PZAA 2PS3A 4A6XA 4O4IF 5DOVA 1FQKA 1H8HA 1F0KA 1AM4D 2GPBA 5DX0A 3VGJA 2MTBA 2VPTA 4V3CA 2ZPUA 5C4MA 3LRXA 4HB4A 1Y8RA 3E5QA 1AKHA 2YIVX 3FI9A 3PC6A 4QBFA 2CFSA 5K0BA 4KN9S 4Z9BA 4J29A 4JMPA 4KO2S 1BQEA 1EXMA 2Q0SA 4P8RA 4ETMA 4ENKA 1JXMA 2XTZA 3UG6A 3R3XA 4FOTA 3B52X 5F3RA 4D81A 2EV5A 1V8DA 2R00A 5KOJA 3BQZA 2I4NA 4UBIA 2CGPA 3FYDA 5DYIA 1KIMA 3OZXA 3RR2A 4CNBA 1A9XA 1T8TA 1CQXA 1Y4DE 4I2NA 1OH5A 3CRVA 4FCVA 2DPLA 1RWVA 2HFJA 2NUTA 4KUEA 4I3GA 1OWPA 1REQB 4JSYA 3KP2A 3MQ2A 1PG5A 2EJRA 1IZYA 1IVNA 2NO4A 2WIFA 3EGDA 4H6XA 2FFQA 4X7RA 5IVHA 1JG2A 2ZT6A 1OF1A 2VVTA 1E2IA 4BFSA 1ULUA 5ITZB 2F7SA 3FAKA 1UP6A 3FTCA 1GPNA 2YR0A 4B3RB 1Y6GA 2XF7A 3F4BA 2Y1FA 1R0RE 1ZJJA 4LISA 4PANA 4DCNA 1ZLJA 1D8TA 5FAKA 4O4HF 3RSFA 2V1UA 3C3AA 5KU7A 2BTEA 3LL7A 4IKOA 5T57A 1XMOB 3GUVA 4MUMA 4CICA 5EPOA 3B1KA 3WSWA 3SFIA 3P9KA 2ID7A 2ZE8A 5I7WA 3PFGA 1J7JA 2VRCA 4PW0A 5CM8B 1U3CA 1Z1DA 3O8GA 3HXPA 3IURA 3UYLA 4MUBA 3CUQC 2NU7B 4ZVOA 1R6DA 3V2HA 5F9HA 4NYJQ 2J6BA 1BM9A 4NDZA 3CKLA 1T0JB 3ZQHA 4IDOA 4KR0A 1Z7UA 1A8QA 4V0OA 3E6BA 2PZAA 5G3YA 4M3BA 4ETWA 4F3CA 4FMDF 4X62B 2EW2A 3DOFA 1NNSA 3A9CA 3U80A 2ZSDA 1SCUB 1G3TA 3ZWDA 2OV6A 2J3EA 3H2YA 3IILA 1N9KA 1TK3A 2YSRA 1TGVA 4NS4A 5CH5A 3CONA 3R4CA 4HRAA 2LTPA 2J3KA 4TT8A 4AVZA 4C08A 1W36B 1G63A 4G9EA 1Q7GA 4WHMA 4P3NA 3E1SA 3FUCA 5K01A 3PNOA 1ETWA 4XASA 4RGSA 4LLLA 4IRHA 4JT4A 3ROUA 2O2SA 3DMRA 1N2OA 2ZZMA 5B66C 2VT2A 1RIOH 1QK4A 4GR4A 4IJ6A 1HTBA 5FHRA 3BXZA 2W8BB 3SSMA 4QSMA 4A0HA 4BPRA 1M3SA 5FO1A 4A0XA 5A06A 2PJDA 4JKYA 1Z2DA 2HBZA 4QRHA 3L40A 5SYAA 2YIDA 3WHCA 2GJ9A 4JXXA 4EZEA 4MWDA 1VOTA 3I9JA 2WAEA 1TKCA 4RM2A 4PU0A 3D0QA 3R5HA 1I0IA 3TI7A 4HQ6A 3MB8A 3O93A 2D1HA 1O8BA 1Z77A 5EE5B 4FFSA 3B3FA 4DJTA 2HKOA 4DLSA 1RWQA 5GV7A 3QKIA 2BM8A 4DYRA 5HFNA 3WQSB 4JLMA 1U2QA 1D0VA 2P5KA 4YRRA 1C9EA 3I05A 3UYKA 1T3SA 2DTRA 1AQJA 3CQZJ 3ZDQA 5HIKA 5LMUB 1NMSA 5A2QZ 3MCTA 1X80A 3PQKA 2DPMA 2XDYA 3BROA 3EAFA 3N2YA 5JBIA 1E3DA 4QPPA 4RFVA 3QU5A 1TM5E 2OORA 2Z30A 5G53C 4KQKA 1N4DA 1DX6A 4OHZA 1SXPA 2KLHA 1KBZA 2KP6A 2PXAA 3QLVC 3EG5A 3DEHA 1FXSA 3MWKA 3MJVA 3BWCA 2EFYA 4HF0A 5KDDA 1T0BA 2LBFB 3EDYA 4EDHA 3D3QA 4MR9A 2B2XA 3N6XA 5AK4A 4BLQA 3V8NA 3STWA 5K1ZA 4CDRA 3R9KA 3VC2A 2BXZA 1NBWB 2AJ8A 4RSRA 1OFVA 5DXJA 5KYUB 5T67A 5HZKA 3B53X 3GEGA 3HOZJ 1PN3A 3QI7A 3TD9A 4EHNA 1DJMA 4EJWA 3TW6A 3LSYA 3BQ9A 4ZRDA 4KIUA 4PZPA 4UBLA 5JALA 2QN9A 2CUFA 2TECE 1M8PA 1FJHA 3VHRA 5ELXA 3KJFA 2Z3YA 5B4UA 3DQVC 2G7MC 4M1QA 5LBTA 1BMFA 3VDXA 1YQQA 2BMVA 3C6BA 5A5EA 3T4UA 4BQEA 1EM8B 1I3LA 5LUAA 2WTMA 4CV0A 1RRJA 4QYXA 4XOTA 3N5CA 4CTNA 3P5BA 1ID8A 3PA8A 1R49A 1JDZA 4M2LA 2XYVA 4B4OA 4B8YA 4ND5A 1VM6A 1DEAA 3UA3A 5LWHA 1VQOI 1XTBA 4ZI7F 3F22A 1WF3A 1DTWB 3NKVA 2NAFA 2ZW9A 1C7FA 3OP1A 4G23A 4UCFA 3LXMA 4DSAA 4EJ2A 3BGVA 3N3BC 4YC7A 2HWYA 4BAUA 2AEFA 3DB2A 1KBQA 2PX0A 5I7VA 3OIQA 2LYCA 4TM7A 2JLSA 5KYXA 4L57A 2QI9C 2PWYA 3FYCA 3IO3A 4M0UA 2MC4A 2QE6A 1NKVA 3KUDA 4XUCA 5AK6A 2G1KA 2WABA 3R7DA 4RORA 2ES4A 2QAJA 2QRUA 5JJ5A 3IQXA 4RTJA 1PAUA 3E8SA 3DAFA 4DMLA 2VE8A 4H35A 1O9BA 2PJRB 1DC8A 1C9NA 3I6ZA 4J0DA 5D3MA 1P0QA 5AJHA 4EABA 2Q2NA 3DOEA 3LAPA 2YU3A 1ETHA 5LLDA 2YPRA 4WOBA 1BFKA 3LRTA 4PICA 5MGBA 4PX9A 1NN0A 3FVVA 1L7QA 3KPWA 3FFWA 3O47A 1NUSA 4ITUA 2GYWA 4YJHB 4JI6B 4E6EA 4HQOA 2E4UA 2E1RA 3CMCO 2VC0A 2EFDB 4RPKA 2JFQA 4H7DA 4R9VA 4GI1A 3H1AA 3KEYA 5LQKA 4N8EA 1O89A 4B8WA 2HU9A 1MJBA 1Z8FA 4AW9A 2WD7B 2XUDA 3C1OA 4MHGA 1YAHA 4UAGA 4M55A 4E2FA 5J2UF 1L4HA 4L3WA 1IUKA 3I5UA 3O4HA 1ZVJA 5ED4A 4XSXF 2ZMEC 4URHA 5A3RA 1VPWA 4LF8B 4IOAF 5JYBA 2NO9A 3EYWA 3T3GA 3I32A 4D5GA 5KZMB 2VHTA 2BEKA 2PJRA 1TM4E 3AIOA 4JVMA 4XQEA 4N8SA 3OYHA 1EFHA 2C98A 3C8MA 3L7CA 1Y98A 1UXJA 1UM8A 3NRCA 1WH5A 2QRKA 4JEUA 1BNCA 3QEBZ 3C6YA 2CYYA 3URKA 1B74A 4CM5A 4YJHA 5JJCA 1E1QA 2GYYA 3KD3A 5ANRB 2BEWA 2QKLB 4IDDA 4E15A 1O6FA 2ZUCA 1RYYA 3HKDB 2ZTSA 2ZSIA 2X6YA 1G59A 3R3HA 4G3XA 4L3VA 3F7MA 1I6WA 1QZ3A 1YDEA 2YXBA 3A4MA 3HB7A 4KAXA 1ULSA 4L75A 3AKCA 3AWDA 2YOGA 4JYCA 4MWOA 1NRIA 4TOIA 1BC7C 2AN3A 1ETQA 4N5MA 5I8ZA 4PWYA 3DAOA 3IRQA 2C5BA 1EVLA 4Y3UA 2YASA 1CTQA 3DBVO 5JW6A 4DIDA 2H9AA 5CQEA 1KO5A 2GHRA 5IU6A 5DPMA 2O8FB 2HBQA 1Z0XA 3E1KA 1ABBA 4CTMA 3DMYA 3JQ7A 5A4DA 3S3OA 3NEUA 4NDLA 3NV9A 4X92A 1L5KA 4M86A 1ZHFA 3WLPA 4F72A 4WW0A 5D6NA 5GVRA 1VJDA 1SVWA 1SJ9A 3UNXA 1KK3A 2HOEA 4M74A 1IDYA 1QZZA 1PZHA 2C4KA 2D2VA 4LAFA 2J0QA 2E1OA 1WDMA 3AY0A 3IQFA 3KP7A 3LE8A 1PO7A 3QXHA 4N6NA 3RVJA 1XSEA 4FYVA 4YRFA 3DTNA 2ZBDA 4UHFA 1NM5C 1U8TA 3PR1A 1J59A 3MEXA 1MO2A 2FE1A 4IOLA 2IW3A 3GUHA 3OQVA 4V0RA 2G80A 4EG3A 1JXOA 5DXAA 2QD1A 2JMWA 1NNLA 1YU9A 4ACAA 2CKMA 2Q2VA 2QD3A 3RPUA 1WTAA 3PJFA 1FW6A 5C7IO 1SU8A 2WVJA 2EF0A 2J46A 1PUFA 5IBQA 2R4QA 6ADHA 3JW4A 4EVQA 7YASA 1F1BA 1M1YE 1MIOA 1QGAA 1US8B 2HJGA 2ZIAA 3JQ6A 1F4PA 4BMZA 3CT4A 1DS6A 3TQFA 1XEXB 2WP0A 4QGBA 2WUGA 4FX5A 4GM4A 2PT7A 2JD0A 2FR1A 3OLVA 4E33A 2YX1A 1C1YA 1XHLA 2PZGA 1FYKA 5T64A 2XD4A 3C4QA 2J31A 3OX1A 4WZAA 5CT8A 2Y69H 4EGYA 1C4OA 1V6AA 3Q3CA 3M6XA 4JJ4A 4LDPA 2Z8ZA 3L04A 2A5DA 4ZODA 2VAMA 3P94A 4PYLA 1Q0UA 3CDLA 2I1LA 2V8BA 4M1OA 4D0SA 2ZI4A 1Q83A 3CUSA 3JW8A 3P9QA 2BFFA 4P80A 1OLOA 4KI0A 4JP8A 3IUQA 3HYSA 2H6CA 5EWMA 3O8NA 1RI2A 5AK5A 4GU5A 4MIMA 3PBKA 3DFFA 4DLLA 5I3ZA 1DTSA 3AVYA 1A8PA 4ZMSA 1RKVA 1QRYA 3H5WA 3GNLA 3FWEA 1U3VA 4B75A 1MJ5A 1BQ3A 3L1JA 1D5YA 1P72A 4CU2A 1XTPA 3RAJA 4DDVA 2PD6A 4W5QA 4AICA 3BA1A 4KREA 2ZRBA 2A6TA 1RPJA 4BO1A 2WB2A 2CCJA 4QFCA 3I6BA 5CTAA 2FU4A 2V79A 3LHFA 4H17A 2H2GA 2AUMA 1WI3A 3KXLA 5FKKA 2JSPA 2H4XA 1NW6A 4RD1A 4C3VA 2PH7A 1FFXB 4TZTA 1MMGA 2HTFA 2OQ2A 8AT1A 1UZCA 2ZWAA 1EESA 4IO0A 1JEYB 1KHTA 1PR5A 2QB5A 5ADUS 2FQWA 4DSOA 2YV3A 2D45A 1HTTA 2DSNA 3GARA 3MS4A 4HRVA 4LCBA 3I39X 4F5ZA 3F8BA 2PBIA 4KTTE 3OM1A 1BSVA 5KVSA 5DOZA 1ZELA 1LLUA 1KO1A 4YJKA 1PNVA 2AEJA 4C6TA 1SC1A 2HZ7A 2OP0A 4WIAA 4UFPA 3RWOA 5L3EA 3QLUA 3IEUA 3IUNA 1SXJE 4JKOA 5LLSA 3GLIA 1P6RA 1L5ZA 3DC7A 4HS4A 1ZH5A 1Z9BA 1KZGB 2QUJA 3Q87B 2F3SA 5K4HA 1VJGA 1Z6ZA 2HDDA 3D8UA 3WDLA 3RYHB 1RLOA 2WWRA 1XQWA 1UDRA 3EQZA 4JL6A 4CKBB 3TF5A 1N7IA 3QOWA 3CRZA 1TNSA 1A1SA 3NVKI 5K9ZA 2R7QA 1H1DA 3KZOA 3ND6A 3HH8A 3HUUA 1EA3A 4ZEOA 2X6RA 3OYMA 1O95D 3I2HA 5JYEA 3EXIA 3CJRB 1XP5A 1J25A 4EHFA 3CCYA 2CFXA 3M4YA 1GZHB 5DNUA 4LXIA 1WW2A 5JXHA 4X8MA 2C8KA 1Z0ZA 3QITA 1QYCA 2BMWA 1M6VA 4KT5C 1NX9A 3CURA 4YVFA 3V8MA 3IRVA 3Q40A 2AFVA 2QL5A 4TT3A 3M6FA 4NIMA 2BHYA 3GJ7A 3DWLE 1B76A 3D6TB 1MXFA 2PNJA 3D7MA 4Y98A 3AJAA 3VZDA 3EEBA 3JWGA 3OLZA 4DLWA 1WXIA 4HTFA 2G70A 4XTCS 4Y15A 3M8JA 2HFHA 1M2VB 1Z82A 3KZKA 4XM2A 4ZAZA 3WR5A 4WXCA 1FPMA 2DHQA 2FPMA 2WTEA 3K1TA 2ECCA 4HC4A 4C0XA 4EARA 2HT1A 2D59A 1IEVA 4CIBA 3ETDA 1NU6A 1YZLA 1Z8DA 1HYEA 3LOPA 3T7SA 1KDZA 1GOTA 3F98A 5GOTA 1A72A 3QYFA 1MAVA 3AUKA 3PDCA 4PBTA 4BTEA 3HTXA 3HVRA 1ISJA 1VLZA 1XTKA 2CBZA 4JYKA 4XGQA 2H59A 3NKFA 1VG9B 2XYPA 4IDBA 3PEEA 5AWFC 5A9SA 3IOCA 1FX0A 1CNEA 2O2CA 3BPXA 4HLNA 3VYVA 3ADDA 3F73A 4XUDA 2PBLA 1NXSA 4ZOBA 2BI4A 3A1EA 3FYHA 3GVHA 3I23A 4GGPA 1T1RA 4LNAA 4OFZA 4Y2YA 2OV2A 3HUTA 6ABPA 2I2XB 1A82A 1BFUA 4M98A 4ANFA 3IL2A 4G8CA 3LQRA 4HTFB 2MCFA 4I2VA 4OQQA 3RAEC 1YUBA 3D4PA 3DU5A 2WZBA 5E9AA 4Z6KA 2HGSA 4G01B 2YCLA 1B9NA 4IVPA 1EWVA 2OLEA 3L7BA 3CRNA 3SZ3A 1I9CA 2WM3A 3MLEA 4I01A 1FC3A 1Q3KA 1R8JA 2GA2A 3E9MA 3JXEA 3W2IA 3W3AA 1G42A 1NTRA 1TVKB 1Y5LA 2FN9A 3ABOB 1P4WA 2HF7A 1K8YB 3C2HA 3LG2A 4FFDA 3A1WA 3ZJ5A 1VFCA 2WAMA 1ZY2A 3OFJA 4XSVA 2CVQA 2WZCA 3WODF 3H83A 1AKYA 1PFUA 3HBJA 1A6QA 4GBJA 3RGWS 2BYTA 4JD5A 1W4ZA 3AHGA 5JECA 4D98A 2MYSA 2G3YA 4RO0A 1X0XA 4NABA 3QU7A 3VYRB 3JATB 2G0EA 4ARAA 1U8UA 1P2DA 2BD0A 4L0DA 5ARDA 1FIUA 1GRQA 5EZSA 2F5VA 1WMSA 4X6AJ 1SC4A 3OO0A 3PNKA 3G49A 2YS9A 2XCLA 4IIFA 3EXFA 4RVFA 3VYWA 1EGVB 3RF6A 1NGSA 5E1XA 4URUR 3BG6A 2C97A 3LYHA 3PQ5A 4G07A 4HQRA 4QUIA 4KPEC 2MLKA 2O1XA 1KFKB 4NFSA 4WXHA 4OEHA 2ATEA 3IAUA 3ISJA 4OFXA 2CVPA 1PUXA 3P0FA 3I0TA 3AERB 1YSCA 4Z0NA 1E3LA 3UQYS 3ZWPA 1YJ9I 1D5VA 3JQBA 4K3UA 1D07A 4ZD6A 4B3FX 4HV6A 4ZAVA 2I9KA 3KLNA 1GG8A 2VDQB 2E82A 3ZXSA 4XONA 3BXGA 3AUJB 1F12A 2DT8A 5ESWA 3OYCA 4A93J 1R6AA 2J32A 3L9XA 4G8BA 1YZYA 3W2AA 4D0NA 1EAYA 2JJ2A 2XWQA 4GSLA 5BNIA 3SX0A 5BN3B 4ZOLA 2MOKA 2YXLA 2DH5A 4IP0A 5PGMA 2ZVPX 1NR5A 4CL8A 3IBYA 2WF9A 1YRHA 1XMAA 3KK0A 3NIBA 2O8NA 4Q9KA 2GEBA 1KKLA 3Q1KA 3QV1A 1RIIA 2XUKA 2X77A 1P9RA 4JOSA 4CMHA 1F5NA 1OXUA 3PUFA 4HEA1 5E9WA 1ECFA 1YFLA 1M8FA 5TIIA 1BU8A 2M98A 4RD2A 3P2EA 2JGNA 4A6PA 1VKNA 2OXRA 1FDWA 1HMYA 2XNDA 3LO8A 1Z4KA 4FT2A 3C85A 1HE3A 3G5TA 3H84A 3G2LA 5FYDA 3PC2A 4TLCA 3I6YA 1DTEA 1SUFA 1WQ2A 3L8FA 2DA7A 5K8IA 1TW3A 3G0IA 3REQA 2O8DB 3VR0A 1W7PB 4DV5B 3BR2A 2VDWA 3OJWA 3OHPA 1M34E 5AP9A 3ZGZA 2BFMA 5CXQA 1EP3B 1G5QA 3W1WA 2EIXA 4J2TA 3K0EA 3OZSA 1R0WA 5T41A 2YV5A 5KTRA 4PFOA 2L54A 4I4TF 3GWGA 4KQ1A 4QAJA 4CN8A 4RGXA 1XCGB 3E9CA 4P38A 4BO8A 3GP8A 2IP2A 3CB2A 3H92A 4X1EA 2Q9BA 4I5EA 1QV9A 2SCUB 2V59A 1Q1EA 4FHGA 5BSMA 3S40A 3DPTA 3RPQA 3NX4A 1X87A 3QWFA 4C7MA 3R9IA 1Q95A 3EMDA 4QM7A 3W6KB 1BMQA 2QRZA 3OZTA 2DBZA 4OK6A 3U62A 1G3YA 3AKDA 1G21A