1QZZA

Crystal structure of aclacinomycin-10-hydroxylase (rdmb) in complex with s-adenosyl-l-methionine (sam)
Total Genus 111
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
111
sequence length
348
structure length
340
Chain Sequence
LEPTDQDLDVLLKNLGNLVTPMALRVAATLRLVDHLLAGADTLAGLADRTDTHPQALSRLVRHLTVVGVLEGGEKGRPLRPTRLGMLLADGHPAQQRAWLDLNGAVSHADLAFTGLLDVVRTGRPAYAGRYGRPFWEDLSADVALADSFDALMSCDEDLAYEAPADAYDWSAVRHVLDVGGGNGGMLAAIALRAPHLRGTLVELAGPAERARRRFADAGLADRVTVAEGDFFKPLPVTADVVLLSFVLLNWSDEDALTILRGCVRALEPGGRLLVLDRADRFFSTLLDLRMLTFMGGRVRTRDEVVDLAGSAGLALASERTSGSTTLPFDFSILEFTAVS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase, transferase
molecule keywords aclacinomycin-10-hydroxylase
publication title Crystal Structure of Aclacinomycin-10-Hydroxylase, a S-Adenosyl-L-Methionine-dependent Methyltransferase Homolog Involved in Anthracycline Biosynthesis in Streptomyces purpurascens.
pubmed doi rcsb
source organism Streptomyces purpurascens
total genus 111
structure length 340
sequence length 348
ec nomenclature
pdb deposition date 2003-09-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00891 Methyltransf_2 O-methyltransferase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 1qzzA01
3.40.50.150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Vaccinia Virus protein VP39 1qzzA03
3P9CA 4QDJA 5DXJA 2VODA 1KQ0A 2O3FA 4B09A 2OO3A 4FT2A 2LNBA 2FBIA 3EVFA 3PFHA 1WWXA 5E8JA 2BGCA 2FHPA 4YUXA 3TO7A 2JHPA 1FP1D 4R8RA 2UXXA 4LK1F 2Z33A 1GVJA 3JAMK 1UFKA 4A0YA 3ELKA 1ZN2A 3O3KA 4I98B 4CO8A 2CWEA 3K0BA 3VSEA 3SZTA 1FZPB 4KYWA 1IN7A 1RJDA 3TM5A 3ZPLA 4QQKA 5FD6A 4RGSA 2YPRA 2EJTA 3ELUA 3DMFA 2QRVA 1EAMA 1G3YA 5FB2A 3SSMA 1W7PA 3ZN1A 2DPMA 1FSHA 4BQAA 4RTOA 1PUEE 3DLCA 3PX2A 2OXTA 2L4MA 1RIOH 3DF8A 2XV4S 3NVMB 3G73A 2K4BA 3C6MA 1DP7P 3MTEA 5DRTA 4YUWA 4AX8A 2EA2A 2CSOA 4ENKA 2Z9OA 3RKYA 1FP2A 2HTJA 4PDKA 2VT3A 2YXEA 5DTQA 5ICFA 4MHGA 2MH2A 2J5OA 2QYOA 3HTSB 3PTAA 5LBQA 5M5BA 4ENMA 1FC3A 3TO6A 2ZIFA 3BXOA 1QANA 4KMUX 4PGGA 1SD6A 2PJDA 2ONZA 2JPBA 3HRUA 2YXLA 1AQJA 2I6GA 3DXYA 2XKPA 2VXZA 1YTYA 2YTZA 5LGTA 3NMUF 4X61A 3F6OA 3HA3A 1ZQ9A 2QY6A 1JTFA 4IXAA 4LB6B 1LNWA 2JH8A 2EA4A 3F72A 4EGZA 5D4RA 3TRKA 3ZMDA 4PINA 1X1BA 4NHJA 2NRAC 2VE8A 2NS0A 3GFIA 5KQRA 1GXPA 4X41A 5DTMA 5BPIA 2Z6UA 4MTDA 5U4XA 2HKOA 4QWQA 4UV8A 5HEKA 2P6TA 1T0FA 1KQ9A 2MC3A 3BGIA 3NDJA 3KP7A 1RI2A 2HMYB 1MHTA 4FSDA 3CCFA 2O61A 2AN5A 1D8JA 3T7TA 3KZZA 1BHJA 2B25A 2HQNA 5F6FA 3TPZA 2ESHA 3OU7A 2EWNA 3WSTA 3M8FA 1HW1A 2H1RA 4QDKA 4ER3A 2F2EA 2ZBRA 3F3XA 2P3LA 4OIQF 2JJQA 1G60A 5LQUA 4MIKA 5FHQA 3EVBA 4RVHA 1J7KA 3F23A 4HH4A 3TFWA 4WXDA 3GYHX 5CJ9A 5E2BA 3VC1A 2PX5A 2P7VB 4M6YA 5IKMA 1XD7A 5EMMA 2E7WA 3M9AA 3ECHA 4KMFA 1P2FA 1NV9A 5FO5A 2EFJA 5K0NA 4F85A 4BY9E 5EMJA 3M8EA 3SVZA 3CJTA 1ZYRF 4Y15A 1JG2A 3OU2A 5HLHA 4DCGA 1BI0A 4G7ZF 5HIIA 1I1GA 2Q2EA 1L3BA 2B9EA 3CDHA 3V8VA 2A6EF 3T8TA 2R6ZA 4PIPA 3ABTA 2O0LA 1MDMB 1KGSA 2ZBQA 2JZYA 1USSA 5ERIA 2IRFG 3I64A 2FQ3A 2WA1A 3HCBA 2IP2A 1FLIA 4GUAA 1ZRDA 1YFJA 2DTRA 4A5MA 4NQWA 5FA8A 3EETA 4DM3A 2IFTA 3KR0A 2OQRA 4OMYA 2HR1A 2RNJA 3ZMVA 4GQBA 5CVDA 2FRXA 2AVNA 2ZMEB 3P8ZA 4G7HF 4L9VA 8MHTA 2AOWA 2FEZA 3CJQA 2M30A 3THSA 5ICCA 4PONA 3KQTA 3AXTA 4ON0A 4HSGA 3H3ZA 1NW6A 4AUKA 1T98A 5CVJA 3TQNA 4CZZA 3SX0A 1B59A 1ZRCA 2GQQA 1ZG5A 4MEYF 4PCAA 5E8RA 2I62A 1P39A 4I01A 1BI2A 2IH4A 4HDVA 3DXZA 1T39A 1V4RA 3HVIA 4OIOF 1UHMA 5ICGA 1JG1A 5D5VB 2CW0F 4KIBA 4I2OA 5DX8A 5FADA 2Z5UA 3ABUA 1WY7A 2X4HA 2PT9A 3DH0A 3M7GA 3QPHA 3KPJA 5EIFA 2H94A 2PX4A 3F22A 1O3TA 2EFWA 4R8HA 2F5DA 1R23A 3HCCA 2AR0A 4N9HA 3V7SA 3C3YA 1IM8A 2QQ9A 4M38A 4XCXA 2EB7A 2IPQX 3E5QA 4IHTA 3M1EA 4NB5A 2D2WA 4CGZA 2N47A 2J5PA 4KDCA 3KP2A 3UA4A 1J0RA 4JXJA 3IV6A 4A0XA 4AZTA 3CUQC 3L00A 3D5LA 1MD0A 3RIRA 4PYJA 3LKZA 1XMKA 1BI1A 3CLOA 4BHPA 3PS9A 3TGNA 2JH9A 3T8RA 1KA8A 3KKZA 2DW4A 4X63A 1ZLKA 4IV8A 1U5TA 3PFIA 5K1YA 5CVEA 5EMKA 3F4KA 3SGLA 5LQJA 3DKWA 4L7VA 3UZUA 3KEOA 4ZYEA 1K79A 3FMRA 3R0QA 2YX4A 3PX3A 2HYFA 1Z1DA 2VBZA 2P3QA 2XUBA 3OU6A 3ELWA 3LECA 4RTRA 1IN6A 3B3JA 2AVDA 1ZGJA 1Q0TA 3HTUA 3OZSA 2KJBA 3UWPA 5DPMA 1NW3A 5E1MA 5DWQA 4EMSA 3R61A 2RV8A 4M37A 4P7FA 1G3SA 4FHTA 2OQGA 3LCVB 3KQWA 4KN7X 2G7HA 3FTFA 4DQ2A 3FUTA 1VTNC 3KLOA 1LJ9A 4EJOA 2PI0A 1D2CA 5DTRA 2ZZNA 3GRZA 3HYIA 1KHHA 2FYTA 2PVCA 3ZQ7A 5HVQC 2IBTA 3E6CC 2FOKA 2FMYA 4EJUA 3DV8A 4ZYDA 3LDFA 1FYKA 1Y0UA 5FQNA 2YU3A 1FOKA 3T7RA 2QQBA 3K69A 3MB5A 3K2ZA 1SD5A 1WI9A 3GWZA 3P9IA 4PNEA 2P5VA 5H02A 2A61A 2X0LA 3IEIA 4OA5A 3HVHA 1NBHA 4POOA 4GBED 2F5FA 1ZREA 4DA4A 1NE2A 2NNNA 3K6RA 2A07F 4QLCU 3G8BA 5DSTA 1XGNA 4YUZA 1YZHA 2TDXA 1N2XA 2NXEA 2O06A 4L18B 3HCAA 4YIFA 5ERGB 3KHKA 3L09A 4ZYGA 1OR7A 2IDJA 2VDVE 2MBFA 3IRRA 2AOTB 3O2PE 1IXKA 2V1XA 4A6DA 4CICA 3GO4A 5E1BA 1B42A 4ESFA 4WCGA 3IRQA 3RYRA 3GO5A 1YFHA 2DFIA 5GM1A 2FA5A 2NNWB 3CUQB 3HVJA 1H9TA 4PCLA 5CCBA 5EVJA 4X1OA 2LF8A 2D45A 3BKXA 2I7CA 1I1NA 5IT9K 3KQOA 2OBPA 1KPHA 2G8NA 4QTUB 4G7OF 4YUVA 1YS7A 4WF2A 2ZZKA 4YUYA 4O5VA 2VOOA 1MJBA 3M33A 1TTYA 4ISCA 2FNAA 1HXDA 4HTFB 5EIWA 1AF7A 3EPPA 5EEGA 2GA1A 1OYYA 1IRGA 1T6SA 2NXJA 4PYOA 3COAC 3IL2A 3DQVC 2O03A 3VOEA 4HLYA 1WSUA 2CWWA 5EOVA 1L3CA 2KIUA 5K0CA 5KQSA 1MDMA 1VP3A 2H00A 3NJRA 3A26A 2A69F 5BQTA 1R22A 1W5SA 1O9HA 1Z91A 2MA3A 4S05A 2KIFA 5GP1A 3AXSA 1L3IA 2F8LA 3P97A 4GC9A 3F21A 3BGDA 4EQZA 5DYMA 3GRUA 3MZYA 3OFKA 3AY0A 3FUWA 2O0YA 1KYZA 3E97A 5T6BA 4F84A 3CVOA 2RDPA 2DAOA 1HKSA 3FUVA 2XAQA 4RVDA 3BUSA 2DU9A 4RTQA 4FP9A 2OD5A 5FWDA 3U1DA 1DDNA 4P5OA 4HG2A 2ZMEA 4GXOA 1OMIA 3GGDA 1X1CA 3BPVA 1DL5A 3FPGA 4KUMA 3G2QA 1XN7A 1R1TA 4UHTA 1PJZA 3JTHA 3SM3A 2Y48A 1EIZA 4P9UA 3TOBA 1BN5A 2F5EA 3ZP5A 1RI7A 3UJCA 4BLUA 2QENA 1U8RA 3WGHA 4LGWA 1XDSA 4ZH4F 1WRJA 3CUOA 1H9GA 4PYKA 1HKTA 3O7WA 1YYVA 4MTLA 3R24A 5K5OA 2FK7A 5DXAA 3T0YA 4ZZLA 3EGIA 2AOUB 3WTZA 5D5XB 1F9NA 1U6GA 2B0LA 5HOOA 2XIGA 1IN8A 4ATNA 3WODF 3KQSA 4M6XA 2HKXA 2BR5A 3GW2A 1D8KA 5EGSA 1LDDA 1EH8A 3B7PA 3V7RA 4U0WA 2PN6A 1R8YA 3FWEA 1EJ0A 5FD5A 1KU9A 3TKYA 5CCXA 2NP7A 5DV5A 3T5XA 3UJAA 1D5VA 5LSAA 3M6UA 2GA2A 2PXAA 5E9WA 2PV0A 2XKOA 4IHSA 5HILA 4RTNA 3G3ZA 4WX9A 1JXSA 4IPAA 1G6Q1 2AOVA 3HRTA 3PQKA 1P91A 4M7RA 4PYQA 4M73A 4C08A 4AIKA 4QQNA 2BE5F 4GOLD 1TBXA 1F3LA 4G94A 1SQFA 2WK1A 3DTNA 2CFXA 4YG2F 1YS6A 3L8DA 3HSFA 5E1XA 1TNTA 2ISYA 3M4XA 2VC1A 1XMAA 2CG4A 3SR4A 2P1DA 1Z6TA 3F8MA 2XYRA 3PLAE 3KE2A 4I0AA 2P3OA 4F7ZA 3GZ5A 4MHTA 3WTYC 5IT3A 1G3WA 1UWVA 2EV6A 3KP3A 2HWKA 1WQ2A 1KU3A 4KVZA 2PEXA 3GX4X 1N7JA 4CKEA 5DM0A 2EJRA 4BP1A 3TDZC 1ZAOA 1QYRA 2NXNA 4MQ4A 2VBWA 4QVKA 5GOZA 5JFRA 5CVUA 2ADMA 2NYUA 2ETHA 4KN4X 5K0BA 1BBYA 4YFKF 3NW9A 2PLYA 3LX6A 1GHCA 1S8NA 1DPUA 3HA7A 2DLLA 3U81A 4RB1A 5C0OE 2PY6A 5TRDA 3UJ6A 4LWPA 2FCAA 3G2OA 4YV1A 3R60A 4GGGA 4UVAA 5LQKA 4GF5A 3GRRA 4R79A 1JR4A 3MZHA 1EV7A 4E33A 3FM5A 2BBYA 3ID6C 1XCVA 3G89A 2C7OA 1TPYA 3HP7A 1FT9A 4A6EA 2P5KA 5A2QK 4UV9A 5EC8A 3C7JA 4Q47A 3I71A 3QP5A 4BH9A 2NYXA 4PIMA 4DCMA 3EVZA 2IGTA 5E17F 1HMYA 1R58A 5E9QA 1BJAA 3UJBA 2HV9A 4HF0A 2Z3YA 4ENJA 3Q87B 2B2CA 2AOTA 1BM9A 2OYRA 3Q7EA 2EG5A 3C3PA 2GA9A 5L3EA 1VP9A 1IY9A 5CVVA 1VIDA 1YG2A 3O4FA 1CGPA 1R74A 3WTUC 4UVCA 2FF4A 1WS6A 3G5LA 5EKUA 2QBYB 1H0MA 3CUQA 3KP4A 1B9MA 1L3LA 3BWBA 3SXJA 3FXUA 3LCCA 4R8SA 3J81K 3NTVA 3WG9A 2CMHA 5HS7A 4B17A 4DKJA 1UB9A 4U7PB 2XVAA 1LDJA 4U88A 5EG5A 2OZVA 4I7HA 5D8KB 3DP7A 4I02A 3PT9A 2GXGA 3SXYA 4WVLA 1R00A 2JHCA 1DUSA 2B78A 3BJ6A 2ZKZA 2EFQA 2A14A 1B1BA 3GFJA 1HBXG 3I5UA 2PBFA 4OBXA 5GINE 5L3DA 3H3UA 4GO1A 4P58A 1XTPA 2GB4A 3GUDA 2ZNYA 3GJYA 3KQMA 1R5GA 3KETA 1Z9CA 4HLXA 5FWAA 1F4KA 4IVNA 1RJGA 1VQ1A 1MJ9A 2RC4A 5D1NA 2VONA 3BGVA 5DX0A 1FBQA 2YX1A 3SMQA 4BLWA 1M0EA 2D1HA 2LDUA 3F8BA 3WU0A 1P1BA 3HM2A 2FPOA 4RAYA 4G6QA 5L3CA 2OPBA 3RKXA 3OFJA 1RJFA 1TQMA 1J59A 4KIFA 5E1ZB 5FHRA 1SQGA 2JHAA 4EK9A 3KR2A 3VFZA 2W84A 2WV0A 4RTPA 3M6XA 2RN7A 4QPNA 1SD7A 1R36A 1O54A 1R1UA 3BROA 2FRHA 3DULA 1KPIA 3FTDA 3KPUA 2M8EA 1A04A 3G2PA 3RODA 2GS9A 2GWRA 5LHIA 1FSEA 2G9WA 4L9TA 2E1NA 1RUNA 4RWZA 1FBNA 4PYMA 4QVGA 3HRMA 3RW9A 1KU7A 3ZMSA 5AONA 4Q5SF 1P1CA 3A7DA 2W25A 4CYDA 3QV2A 4M9SA 2ESNA 4OQDA 3Q9SA 3LQRA 4AIHA 1VLMA 4AZWA 1YW9A 1ULYA 2Q0OA 1G55A 3RTRA 4QTTB 2BEOA 4M72A 2XYQA 3RPQA 3LAJA 5FGMA 1T38A 1CF7B 2O8XA 5DM1A 5FQOA 3FM3A 2JG3A 1RI5A 3KZYA 2G1PA 3FXQA 5D1HA 1FBUA 1IN4A 2GH1A 2LD4A 1R1VA 3CJRA 3ME5A 4L0YB 3NWEA 3OOPA 3CTAA 5JR3A 1R8XA 4MGRA 1QPMA 2BR4A 1Z3CA 2ZCJA 1S3JA 2FBHA 2CO5A 4JK1X 2RVCA 2HOEA 4L9JA 2K4JA 2PG4A 2H6CA 4OIRF 3LL7A 3MQ0A 5DM4A 3QOWA 5F2OA 2CKDA 2ORED 4WK8F 2PX8A 1J75A 3GLXA 4AZVA 2EK5A 2FK8A 2IIPA 1IF1A 3GRVA 4MEXF 4PYIA 4Y2HA 5DEQA 2IH5A 3HCDA 1LEBA 3PFGA 4GEKA 1LQ1A 5K5RA 4K2EA 5DM2A 3BJAA 4MTEA 4KICA 3SHFA 4EJTA 5ILUA 2G7UA 2PWYA 1HSJA 4NECA 2ISZA 2XYVA 2ZZMA 2Y1WA 3TM4A 3EYYA 5FULA 5P8WA 3A27A 3LKDA 2QE6A 4BP3A 4YMGA 3TKAA 4A5NA 5LEJA 1XB4A 2XGXA 4P55A 1FX7A 3FRIA 3KCCA 3UJDA 1NV8A 3JWGA 5BS6A 2COMA 3CJNA 4BLVA 3E6DA 1L9KA 1OR8A 3BJOA 4EGYA 4P7JA 4O3MA 1W7PD 1RZ4A 4ER6A 2XROA 4UOEA 5HDNA 4G9YA 2PLWA 2UWMA 3DMGA 2L4AA 3I59B 1JQ3A 1QZZA 4Y17A 2DPUA 3G8AA 4V0QA 4C4AA 1V39A 2JPCA 2ZWVA 3DR5A 3C6KA 5HS9A 2O57A 3KU1A 3RYPA 1JQDA 2NP6A 3E6MA 2IPXA 1BIBA 3K0LA 4ZZDA 5LHGA 3MCZA 5EZQA 5DCMB 5JHUA 3TR6A 3PB3A 5DSXA 2DI3A 1U78A 2P35A 1K78B 5CYVA 3GRYA 4GC5A 4HX8A 1KPGA 3B3FA 3VC2A 1NHAA 1NT2A 3EVGA 2FNPA 3CO6C 2VOPA 3FPHA 2STTA 3NRVA 1LDKB 3EQLF 4HYEA 3ANXA 2FE3A 2JRTA 1UCRA 2EV5A 3OZTA 5IH3A 2GPYA 4RTSA 5ILSA 3KPVA 1IXCA 3RPUA 4KT5C 3KPWA 1ZARA 4IRIA 2MD5A 2HNKA 4GOOD 3B02A 3T1BA 2R7DA 2PFBA 3I54A 4OA8A 3JWJA 2UXNA 3AWIA 1Q0SA 5FFXA 3C3WA 1VL5A 1XCLA 4RV9A 5D6EA 3H2BA 2PMHA 3EEOA 4YIIA 3E3VA 4A12A 5DRYA 3MWMA 1NW5A 4LECA 4M71A 5K0FA 2BR3A 3TO9A 5DT2A 1BI3A 2P41A 5E1OA 4TV7A 1YLFA 4IF4A 2AS0A 4E31A 2RGVA 2QVOA 4E70A 3HTXA 5KYGA 4IRGA 3IWZA 4BHBA 1U2WA 4HRAA 1NKVA 2IH2A 2NAZA 3B5IA 5D5UB 4RTMA 2OZ6A 2ZNZA 4CXFA 3FZVA 1XSVA 5LGNA 4OU0A 5BOXA 2Z99A 2ACJA 5D8LB 2CL5A 3MERA 1P6RA 2GAFA 3GXOA 4RVFA 1ON2A 5KVAA 3DXXA 5MHTA 5HDGA 4HX7A 3C18A 1SAXA 2B3TA 5JUWA 3ECOA 4H0NA 5E9JA 1ZHFA 4RTJA 1JG3A 1W5TA 2W57A 4AWXB 3OPNA 1FJXA 5K05A 3UBTA 4PWYA 3C0KA 2VDWA 4OMZA 5EMLA 4P96A 5EZSA 1LVAA 3VODA 5LQRA 2DQLA 2BV6A 4ASNA 4KW7A 1TW3A 5EPEA 4HX4A 3IHTA 5C1IA 3MFKA 3J80K 4U0VA 1QAOA 3FRHA 2NNYA 3JW4A 1IW7F 3QRFF 1FNNA 1YIOA 2BH2A 4C06A 4ETSA 1SFEA 3NEUA 2P4WA 2QUFA 4RYLA 2V7EA 1X3UA 2BM9A 4YMHA 1OYWA 3NQOA 2MH9A 3V8KA 4ESJA 3LCUA 3BPXA 1Z05A 4RAZA 4X60A 4O6JA 3R4KA 2GLUA 2P7HA 1G8SA 4HZFA 4ER7A 1EG2A 1L1EA 4PZJA 1RI4A 3P9KA 1INLA 2YQZA 2EV0A 3E6BA 2HR3A 2AOXA 3JAMZ 4QPPA 4KA4A 5LQNA 2FU4A 2DBBA 1XXLA 3E5XA 4U7DA 2PGXA 4CWAA 4V0RA 2NXCA 4BAYA 2P40A 3ZN0A 3N4MA 1SFXA 2FMLA 1AV6A 1CF7A 3WTWC 2MLGA 4FX4A 1JSZA 1ORIA 1YF3A 4H0EA 1XGSA 4PGHA 4LLLA 4EKIA 1U5TC 3OV8A 4IRHA 2QQAA 3LA7A 3AJDA 1L0OC 3FZGA 4DZRA 2M5WA 2HFHA 5A2QZ 2V1DA 3WTTC 1X1AA 3M6WA 2OU2A 3LGAA 2OZUA 2Z6AA 5FLXK 5E2AA 5J6XA 2UYQA 4KDPA 4HGZA 4Y30A 2EFPA 4LG1A 5HOQA 3EUHA 1B6AA 5LRSA 1FYMA 1NW7A 2ADUA 4EM2A 3L2CA 1EJ6A 2JT1A 1XSDA 3A7EA 3ZMUA 3JWIA 2H27A 5K09A 5JVTA 3P71T 2L02A 4A0ZA 4C04A 3FMQA 4RGXA 3WTVC 1Q1HA 3K1MA 4Q4ZF 1E17A 4I0BA 4EQQA 3EVDA 3I9FA 3KQQA 3ER9A 3VEPA 1ZKDA 3KQYA 3REOA 3J81Z 5L3GA 1U3EM 4G6DA 1I1SA 3R6SA 1SG9A 4IV0A 1DPRA 3I58A 3I4PA 4HOBA 1QGPA 1R18A 3BWMA 4OQEA 2BM8A 3KLNA 2BZGA 3E7PA 4PYLA 1KR5A 3P2EA 4YFNF 1YZ3A 2IVMA 3F6VA 3LFKA 3T7SA 4AZSA 3L7WA 4UXNA 2DO7A 4M9ZA 4EJWA 1EH7A 5J8FA 5LEKA 2ZJ2A 3FYCA 2M45A 3E5UA 3FF5A 2I9KA 3FTEA 2CYYA 2UZ4A 3SSOA 2AZTA 2P6SA 2P8TA 3I59A 1F38A 4IJAA 3MTIA 1TLHB 1HSTA 4KIGA 4N9IA 3Q9VA 4OOIA 3TOSA 1SVUA 4DMGA 4FR0A 5F2NA 4I09A 1IXSB 1P4XA 1WXWA 4M36A 4L5JA 2AN4A 4ESBA 4L5IA 4HA8A 2QM3A 5DCFA 3WTSC 2GXBA 4OBWA 1FY7A 3DPTA 1FWZA 3MAJA 2MLKA 3DUWA 1K78A 4RB0A 2OBFA 4XUCA 1YUBA 1UFMA 2Y0MA 5FFZA 4BHCA 4IWNA 2V79A 3K1NA 1USTA 2V6CA 1X19A 4Y13A 3PQJA 5DDGA 4S04A 1MZBA 3LQQA 3MQ2A 2K86A 3MGGA 5K8VA 1TQIA 2KIMA 2ZLBA 1QBJA 2DULA 1JTEA 2LSOA 3KP6A 1U5TB 4RSRA 2HYGD 2PJPA 1IZ1A 2EFOA 3EMDA 4C03A 1I4WA 1RI3A 1KYWA 5HIJA 2GIVA 4LG0B 1B4AA 4ZYHA 4HBLA 5BW4A 4UUVA 1R5HA 5KVRA 4BYYA 3IKTA 1QQIA 4RGUA 3MEXA 5JI6A 2KJCA 2LF7A 1IAWA 2O6GE 3FUXA 2UZKA 1T43A 3V97A 2VT2A 4UVBA 3EVAA 5GWXA 3BY6A 4U7BA 3T0IA 1BIAA 3HHHA 1JSXA 3B73A 2IW5A 3JWHA 2L3DA 1I9GA 3M70A 5K03A 5EHIA 1NW8A 3E8SA 3FPFA 2VS1A 2Q8KA 2PMUA 1O9GA 2UYHA 3DLIA 3HHGA 1O7FA 3TDUC 3TMAA 4F86A 1LEAA 2XVMA 2Z6QA 4E32A 2IA1A 3KQVA 3LA2A 4HW0A 2K02A 5H6RA 4E30A 5KK1A 4ZTBA 1V3FA 1XCBA 3VYWA 2HWVA 5E8GA 3ELYA 4FSXA 2D1VA 2GZWA 2ZW9A 4DF3A 1O7LA 3L9FA 2V74B 2DT5A 2C7PA 1QNTA 4HTFA 4R05A 5T64A 3GZ6A 2H09A 3BDDA 5EHGA 4GYIA 2WWYA 3ER8A 3EEYA 4UNOA 4R1HA 5T67A 1QAMA 6PAXA 2A68F 3EGVA 3ORHA 3DEUA 4P7GA 2EJUA 3LHDA 4K6MA 1MGTA 2HS5A 5E1WA 2YUIA 3F8NA 2EFNA 3WE2A 3JSOA 1P4AA 2GAUA 4U0YA 1VPTA 3V8LA 3GVAA 1XJ5A 3N97A 3HNRA 3HUGA 3EGEA 1I5ZA 5K0GA 3OZRA 3E23A 1HKQA 5D4SA 1XGMA 3UJ9A 2PBIA 1OYIA 3PVCA 5FA5A 1G4DA 4GCVA 1KP9A 2XRNA 5E20A 3JSPA 3FPEA 4XLNF 3RJPA 1KQ8A 3IYLW 3EMBA 2AN3A 4EJVA 5EQJB 4N0BA 5ICEA 4YFXF 3HOTA 4ER0A 1ONVA 2HTSA 3BWYA 3VB2A 4FS8A 1GXQA 4HC4A 4BNCA 5GIOE 4YV0A 1P4WA 3FMSA 3KR1A 3HA5A 2AOUA 3R6TA 2V1UA 1O57A 1ZG3A 3KEQA 2YVLA 4MNUA 4MQ9F 2W24A 3V8JA 3EVEA 2O07A 4EM0B 2HQRA 4HQEA 3CO7C 5BXYA 4DQ0A 2XAGA 1SMYF 2Y1XA 4RTLA 5HZMA 2OAZA 2UYOA 4CXMA 4FGZA 1YW8A 3THRA 3HVKA 1MKMA 1ZG1A 1M6EX 4RS8A 1HW5A 4A2UA 1ON1A 3LBFA 1YQAA 3BP8A 3U2RA 4IKPA 1T2KA 2P8JA 4E2ZA 4GOMD 2VC0A 3NWBA 2JTVA 5FCDA 4HV6A 2PQ8A 2K4MA 3U9GA 5J8CA 1AOYA 3WTXC 5DD8A 5ED4A 9MHTA 3ERCA 2ZULA 2V9VA 2O05A 4RX1A 5HLIA 3DFGA 2IBSA 3ELDA 1QO0D 5K5QA 1XCJA 2CQKA 1UHWA 1Z7UA 5LHHA 2ZBPA 1S7AA 2QWWA 3NVKI 3GU3A 5ILVA 1ZGAA 3LDUA 2ZFWA 2IDKA 1K7AA 1STZA 5E8IA 1ORHA 2VN2A 4ER5A 1O3QA 4KDRA 1BC7C 1Y8CA 5EEHA 5LR6A 3W6JB 2VE9A 1PRYA 4HV5A 4KWCA 2ERCA 1I27A 3BOQA 1WG8A 1R6AA 4XUEA 1EH6A 2AS5F 5B1SA 1JHHA 1VBFA 1RNLA 2XAFA 3SQNA 2KKOA 3TLJA 3FX3A 3LDGA 4OX9Y 5IT9Z 3MCTA 2IT0A 2YXDA 3QU3A 2VP3A 3EDPA 3TQSA 3F8FA 4WXHA 3CC8A 2HGCA 1SFUA 3B3GA 5HLGA 1F1ZA 2IJLA 3AAFA 1KXZA 3SZPA 4O29A 3BT7A 1X1DA 3GF2A 2M1BA 3UA3A 2RKHA 2VBXA 5K0EA 1DCTA 2ZTHA 3EYIA 3R0JA 1D2GA 3ISPA 1MJAA 2QZ8A 2STWA 4XBFA 3SSNA 3D0SA 3J80Z 2L54A 3G2MA 5DUKA 5HIMA 4GYGA 3C1DA 1HQCA 1ZH5A 5LQCA 2DK5A 4L0ZB 2XASA 2R7FA 4CHUA 4C05A 4CKBA 1XSXA 2YSRA 1ZRFA 2IA2A 4HDUA 3UJ7A 5L3FA 5CUQA 1YFLA 4LG0A 5FTWA 1FBSA 4KNYA 3BKWA 5DLYA 7MHTA 1BOOA 3HIFA 3QOPA 5H6QA 2Y75A 1YO5C 5K0LA 2E1CA 3G5TA 1VE3A 2HTEA 3OCJA 5K01A 4LFUA 3B89A 5H20A 4RGRA 1XDZA 3K9TA 4CDGA 3GFMA 3KFWX 3GFLA 3MHTA 5CVIA 4RTKA 2CGPA 3OE4A 2FXAA 3QOXA 4FT4A 4R6WA 5HDKA 1WKMA 1J2XA 1I6XA 4LMYA 4ENNA 2ZFUA 2ZSUA 5LQAA 3HRSA 4R6XA 2A6HF 2FSWA 1ODDA 1ZLJA 2K7LA 2R3SA 4FX0A 2QBYA 3QAHA 1U2ZA 3KQPA 5BMZA 3ROUA 3G88A 1PP7U 5GM2A 1PP8F 1OPCA 4P9FA 3V7CA 4CKCA 2XBMA 3IWFA 5FLXZ 3GIWA 1NBIA 1YB2A 5DUIA 5HFJA 5E1DA 2QRVB 4DNCA 2DPDA 1OKRA 3H92A 5TJJA 2ZIEA 1W7PB 4JBAA 4G8XA 5LLQA 2PXCA 5HIKA 4D0PA 4LK0F 1TW2A 3QU6A 4LWOA 3RI4A 4KFCA 4AIJA 1LB2A 4L9NA 1TQPA 3WGGA 2ZVJA 1C0WA 1SD4A 3A4TA 2FBKA 3HSEA 5EKXA 3FUUA 2BYVE 4U7TB 2PXXA 5DD4A 4RVGA 4LJZF 2UYCA 4FZVA 1RI1A 2ZIGA 1HW2A 3RDIA 1B9NA 2EX4A 1XDUA 3LPMA 2CMGA 3JTGA 4E2WA 3ZMZA 4Q48A 2F5CA 3SFZA 5CM2Z 2YR0A 4M74A 4PCQA 4EKGA 3DOUA 2XVCA 3CKKA 4OINF 5D6FA 1RJEA 1Z6RA 3GDHA 2YR2A 2L01A 1R7JA 3HOSA 3G7UA 3M6VA 5FUBA 1S7OA 1D2HA 1REPC 4EVIA 2ZBKA 2XAJA 3HSRA 4XLPF 1WZNA 2ONYA 5DX1A 1W4MA 2AXLA 3R3HA 2DQRA 2HZTA 1SUSA 5BP7A 2ELHA 10MHA 5LGUA 3BZBA 1JGSA 3DPLC 3LA3A 1G6NA 4MWZA 1BOAA 1G8AA 2VDUE 1AQIA 4HF2A 1S29A 1IUYA 2PWPA 3P2IA 3EVCA 3LWFA 5CLSA 3KPYA 4JQFA 4MQVA 3DMHA 4XRFA 3CBGA 1KU2A 3J7AO 1JG4A 3X0DA 3QP6A 5AIQA 3V4GA 3FXRA 4CTKA 3LSTA 4Z2YA 3ULQB 3HCEA 3KR9A 3WGIA 1K6OA 4WWCA 3W6KB 2PT6A 3WU1B 2P7IA 1DUXC 4YV2A 1UIRA 3IKVA 2OKCA 2PKWA 4B8XA 1F5TA 2E5WA 2WTEA 5BW5A 4AVPA 2H6BA 1MJFA 3CGGA 5KS2A 1HNNA 2K27A 3IC7A 5GIPE 2G72A 3D2LA 3S2WA 2XHKA 3P9NA 3GCZA 4M9XA 3Q5FA 2HDCA 1IXRC 3S68A 2G71A 4HQMA 4KRGA 2PX2A 2YX7A 4E2XA 1M6YA 4WXCA 2ESRA 1H1DA 2IA0A 2HEOA 2ZCWA 1G38A 3RKWA 3E05A 4PYNA 3HCFA 3F8CA 5BPDA 2ZXJA 4XSZF 4EV0A 4LB5A 3ZMTA 1EQAA 1E2XA 3DXJF 4XUDA 1JHFA 3QPTA 4XSXF 2C6YA 4RB3C 3RIEA 3FTCA 3FPJA 1IN5A 2A5YB 1SUIA 3TOAA 4HGYA 5CD1A 5C9ZA 1RUOA 1XVAA 2KW5A 1G3TA 2OY0A 4HAMA 2DK8A 3HEMA 1BC5A 2VZ9A 3UJ8A 4FT8A 4LLGF 1N7IA 1YW7A 3GNLA 3NDIA 3ML6A 3BWCA 2VBYA 1BKYA 4LD5A 2G70A 5D5WB 1J9IA 1IRFA 2Q41A 2W85A 1QAQA 1SKMA 1SMTA 1D3YA 3R0AA 2P5LC 3P2KA 5CIYA 3P7NA 2KRFA 3KP5A 3O31A 1S6LA 2PSSA 2RQPA 1KIAA 4G56A 1O3SA 3MAGA 4OIPF 5F64A 3R9XB 4CTJA 3UFBA 1TNSA 4P7KA 2LKPA 3I53A 5K0JA 2H11A 2C7RA 2OB1A 5G02A 3LAPA 1J5YA 5LRRA 3K1PA 3GEZA 3IHUA 2WC2A 4HF1A 1FYLA 4EM1A 2ZWAA 3FYDA 2XAHA 4RB2C 2A3SA 4C07A 5CVRA 1JE8A 1WXXA 2E7XA 2WA2A 4AD9A 3BWGA 2C7QA 2M87A 2OB2A 4GOND 1BC8C 1QZYA 4E2YA 3BZ6A 3LBYA 3O6BB 1AWCA 1XGOA 2QLZA 5DCMA 1P92A 5E18F 2OA4A 5AIPA 3ERED 3A25A 4BXUA 4LLNA 5HS8A 5F2KA 5L3BA 3OE5A 2P7CB 5F1RA 3WE3A 3FHZA 3I0TA 1PDNC 1O3RA 1FPQA 2ZO4A 2JSCA 1JQEA
chains in the Genus database with same CATH superfamily
2OO5C 4NK5A 2F55A 4MUIA 3RPUD 3B38A 2ZGVA 1WWXA 3TO7A 1U9IA 1GGFA 1Y0NA 3CFYA 3WJAA 5BR4A 1TT7A 3V1KA 3ZDZB 4WCFC 4IOMA 2HU5A 2W98A 3EXFB 1QG0A 1QVWA 2QSZA 4GI1A 3SSMA 2QRKA 2BL4A 5BV1A 5FX2A 1RQPA 1XQ6A 5GJBA 3PX2A 3ZHVA 3Q3GE 1BEUB 1KNQA 2RH5A 5HJ2A 1ODIA 1FFWA 5D85A 3GJ0A 5GPBA 1PGOA 1JGTA 2B8EA 4M60A 1FC3A 2HSGA 1QHGA 1S6YA 1N2CE 4W1QA 3T3OA 3ZI7A 3IQHX 4IZHA 4P2BA 4TX1A 1VKZA 4NYJR 4V0KA 3RIXA 1GZ3A 1ZAYA 3D7SA 4K6GA 3QE0A 4GX0A 3KVRA 3GLIA 3GBGA 4NHJA 4QUEA 1PWXA 1G5PA 1GXPA 1COZA 3DKVA 7YASA 3T12A 4KBFA 3HN7A 5G3YA 1T0FA 2A35A 2ZG6A 4ZYZA 4WDRA 1NLYA 3ZCRA 1D8JA 2EGUA 2GDZA 3VAAA 4E7HA 2V96A 5K0SA 1RQLA 1P9NA 4KWIA 4FYMA 3PIPF 1LBTA 4R40A 2DQSA 1P2VA 3SC4A 3KOMA 4GBMA 3M3PA 3WLKX 3VPHA 4DIUA 4DCSA 3CJTA 2VKTA 4Y15A 1JG2A 1CR6A 1PDWA 2REQB 3OUZA 4BJ3A 4PRLA 1CPYA 3TD9A 5A1JA 1KGSA 4UUOA 3TZBA 4BQRA 1PR0A 4ZZ2A 3GARA 5IABA 3D8SA 4RZXA 3IEUA 3VKVA 1VMKA 3D6UA 1JZSA 2C99A 4DNQA 4DIQA 2IHBA 3TOXA 2VNJA 2R7UA 3QYEA 3JRGA 4F8EA 3C1TA 1R6VA 1Z74A 3ROMA 4RVCA 4KIUA 1XQVA 1TYEB 1LVKA 3L8ZA 3UK7A 1N5DA 4BL0B 2JI9A 2RK3A 1E9EA 3N6XA 3TQNA 4UM8B 2CVQA 1NXXA 4D41A 4PZEA 4C7OB 3K8ZA 4PCAA 1N8NA 1P39A 2IH4A 1T39A 4I9FA 1H42A 3F6SA 4FPXA 3H2SA 2PIDA 1R23A 2JD0A 2J67A 3AJ8A 2C3OA 2QQ9A 3GZ4A 3M1EA 5H8WA 1MJ5A 2AJDA 5LU8A 4MGHA 3I55I 2AKEA 3W5DA 2A0FA 1AGRA 4MW2A 1T9AA 4PYJA 1XMKA 3Q1LA 3EXIB 3CLOA 1N0IA 2EIJH 3W2AA 4WOKA 2H5JA 4V1CA 5JAZA 2I8CA 4LMAA 4IV8A 5DIFA 1TC1A 1WJBA 1DBPA 1N2SA 3KEOA 4ZYEA 5F52A 2QCOA 4M7OA 2I67A 4O6VA 2IGNA 1OXKB 1H9AA 2CHEA 3ZE7A 1RXWA 4B3HA 2GERA 3ZHSA 1VA4A 3T54A 4ZV9A 5E1MA 2X6TA 3N05A 1N8KA 5E4FA 4C9BA 3KTAB 5AHWA 1ZUNB 1XX5A 3RG2A 3HGQA 4EFMA 5IASA 3QHAA 4UXHA 2Z6VA 4RAGA 2PI0A 2WSIA 3DJYA 3OEHD 1F2TB 2IHYA 2UZ1A 4HMQA 4ZJPA 4JYCA 3LDFA 4R69A 2M7BA 4LG3A 4RHEA 3OIPA 1ORWA 2CDCA 3UG6A 3FLBA 3HVHA 1SUEA 1M67A 2J30A 5FIUA 4YUZA 1M9NA 4M9CA 1EBUA 3FHJA 4WKBA 4HSRA 2FN9A 4YRCA 2DA6A 3LY9A 3CF5F 1FDTA 2ZWMA 3GO4A 1D5CA 1NF2A 4QTYA 5FEMA 1XKQA 2OXRA 1YFHA 4FIDA 1CQIB 2EZUA 2NZVG 3SS7X 4HUTA 2OBPA 3F2VA 3BZKA 4N01A 3JAWB 4F3TA 3GJ6A 3LBAA 3RGGA 4DB2A 4DR6B 4RE5A 3G0DA 1EA5A 3JRDA 1JDJA 3LPAA 1A82A 4DWVA 1WSUA 1D4FA 5KQSA 4HDQB 3EZFA 4IQ4A 4YRNA 4UHKA 2VTEA 3MLAA 1OF1A 3MZYA 2BKAA 3AY0A 3RAFC 1PYDA 1RQGA 5T6BA 5KQLA 4Z9FA 3UIEA 2PUGA 4MCHA 3FUVA 1EFAA 2DU9A 1I5OA 3OJCA 2OD5A 4NJMA 5LMUB 2ZMEA 1U3GA 1CRWG 4Y1EA 3KL4A 1NE7A 4UHTA 5CD9A 2Y48A 4P9UA 2AX3A 3UW3A 4PRKA 1U2PA 3ZP5A 5KVVA 1RACA 3AJAA 1F4PA 3NAQA 3RSHA 3QBJA 4K86A 3TCNA 3UWKA 3LFUA 1CUZA 1J8QA 4F7DA 3JZIA 5GY7A 3U26A 1OU0A 3OJOA 1SC3A 2IDMA 3V7RA 2Y93A 4U0WA 4CRWB 2G80A 3NNDA 3FWEA 1G20B 3QFHA 5IP7J 2JDIA 3G3ZA 1JXSA 3KWMA 1CR4A 2BUBA 3EPLA 2DUWA 4AG6A 3W6UA 4AQ7A 4EHIA 1JNXX 1YB4A 3TMYA 2AXNA 2EPFA 3A9RA 5TB5A 2WK1A 4X3OA 1GDTA 1VQMI 4K46A 3ROZA 3DZIA 5ULLA 4X1YA 4LW8A 3E3AA 1YDGA 3CP2A 5MFZA 3BQYA 1UWVA 2MYSA 3U31A 1JFVA 1ZP6A 5IPFA 1JUPA 1Y3CE 4CF4A 4ZKDA 1UC8A 1UDRA 1O4VA 2EJRA 2QY9A 3I6BA 1KHTA 4NDLA 4HZGA 1SAUA 2JA8J 2B5VA 5JAMA 5HTKA 2HU2A 2QUKA 1S8NA 4TGLA 1DPUA 4NNJA 3HDJA 1Y39A 4I0WB 4F6LA 2YY7A 1MU0A 1MORA 2FCAA 4Z54A 1POXA 3D7KA 1P3DA 2JFPA 3PVZA 1U9NA 3G89A 1XZGA 4RSMA 4P4SA 2P5KA 4PBTA 2H2WA 1AKVA 4CCAA 3LQKA 3M4JA 4HF0A 3L1UA 4F06A 3COPA 4GBGA 4YAWA 1TQHA 5HJEA 1AU9A 3L4KA 3SFIA 4QLOA 2EATA 3JZAA 5EKUA 3DQZA 2PHZA 1GP2A 3NTVA 4UHEA 2W8BA 4BRSA 3T3NA 3EUHC 5KHAA 1RHJA 3PFNA 4AZ0B 3DP7A 4E6KG 1Z33A 2GAAA 1DP4A 3FOEC 1WBDA 3L7CA 3OJ0A 3EA5A 1RYBA 1MH3A 1BDIA 3GUDA 3GJYA 1TPZA 5IJ0B 4I4TF 2P2LA 3NFYA 4D74A 2G0AA 1DTEA 4ZOLB 3KAQA 2RJNA 2FPOA 4RAYA 2M2IA 4YS6A 4RHCA 3WGVA 1IONA 4DCOA 1J07A 5BN1A 1MNEA 4QU8A 1ISIA 1T3GA 1Z62A 4ZIRB 2XGJA 3ZHTA 3KM0A 3RKQA 4JIMA 3SYNA 2B6HA 1NYLA 3EG9B 3RNLA 3B5EA 2E4WA 3OFND 1APLC 3CQ9A 3HRKA 3PNKA 3Q8KA 1NX6A 2OV8A 5DWVA 1EFPA 3K0AB 3WRXA 3RTRA 5I7HA 4M72A 2AN1A 1H94A 1LZKA 5I7UA 4OKSA 3GW8A 3RYCA 5JVDB 1V3QE 2OMKA 2QVLA 1FEXA 4N39A 3Q7IA 2LD4A 4BE9A 5JO0A 4XWTA 3CTAA 3IPAA 3UHPA 3FE2A 3CRQA 4PANA 1PJRA 3O9VA 4WERA 4EPWA 4F5EA 3GLXA 5TS3A 2EK5A 1T35A 1Y37A 2DR2A 3UYKA 1EAYA 2G83A 1ECLA 3RS4A 3IR7A 1OE0A 3BJAA 3VOAA 4KICA 4MQEA 4CM9D 4NECA 4IIGA 5I8WA 4ZV4A 1BKSB 3A27A 1CHNA 4Y2SA 5KCZA 3TKAA 1BVRA 5KWIA 3TZLA 2Q50A 4PTLA 4ENPA 3AJ9A 2GEKA 2COMA 4M0EA 1L9KA 3K72B 1XPOA 2HPVA 4IH4A 4BC1A 2P9JA 4ER6A 4DT1A 2VHQA 2ECBA 1ZHOA 3H5NA 3R5FA 4R8VA 4RVSA 4FE4A 1QX4A 4CNQA 3A0HC 3IAS2 1JQDA 4IR7A 2PSDA 4QVIA 4MAMA 4CTMA 1KORA 2P1RA 3TK1A 2Y31A 1U78A 3I05A 2P35A 1NJ5A 1VPDA 1VGRA 2RGGA 1TGYA 1ZD2P 3K1AB 1RR6A 2X14A 2ZRDA 4IGFA 2P2ZA 5EJ2A 4GNRA 1RMTA 2ZETA 1Y1WJ 5ALMA 5IH3A 3ROXA 2WSSA 3F8SA 3KOXA 3RU9A 1LWOA 4J1TA 4LTMA 4HVTA 4PSUA 4XGNA 3HEFA 4YIIA 4Z9YA 1XF1A 1B43A 5DT2A 4TV7A 2R2GA 2AS0A 4QTZA 3JQAD 2MYTA 3VC3A 3HTXA 3JZFA 5DI9A 5EZ6B 3OT5A 3QPVA 3TL4X 3JQ6A 3DBLB 1OCPA 4RTMA 3P7MA 1XSVA 2Z99A 4O4LF 1XZLA 5EE9A 3MWDB 3IO3A 5EJFA 3LPNA 4DEXA 4Z1MD 1Z37A 1SAXA 1TO2E 5FTMA 4RTJA 1E0EA 5AKXA 4RV4A 4UNIA 3KO8A 1W9HA 2Z2YA 4KGDA 1BS1A 3CG4A 2R7AA 4DRXA 4K03A 4WCDA 2REQA 3DLPX 4ZCTA 1QAOA 3ZIUA 2HD4A 2FUEA 3RS3A 2QUFA 4M9UA 1RRPA 3IAM1 3H5LA 1NP7A 5EJ7A 4IDHA 1RYYA 5IEBA 4B6EA 2EV0A 2YHUA 2ZTLA 2C3MA 4KA4A 3NTQA 2E3JA 2DECA 4RLFA 3OG9A 2NT3A 3D6NB 2QTRA 3WGKA 3N70A 1Z12A 1PWYE 2YJ3A 3L93A 4FC6A 5BT9A 1KYQA 4R2LA 4C7OA 2QTFA 3FXKA 5DYYA 1XLTC 4ZMBA 5F78A 4CUGA 5A2QZ 1UXKA 1O4XA 1KI4A 4BFLA 1YMUA 4CL0A 1SULA 4KDPA 3F90A 4Y30A 2QN8A 1B6AA 2H4HA 2HK8A 3LC1O 3ZDXB 3QTTA 5K09A 1ZH8A 1DCFA 5AW8A 4C04A 3FKJA 1FTTA 3I9FA 3OSZA 5JPIA 3V32A 4Q1EA 5AI4A 1OZAA 2VLIA 2HZBA 2H1KA 4IV0A 1B72B 4EA6A 2LW7A 4IHKA 2NPFA 2H1OA 3AVTA 5G40A 2DO7A 3OY2A 2HDDA 3FROA 4QRHA 4UM9B 1XDWA 1TLHB 2ZUUA 3IDQA 1OR7C 5J3JA 2ZE7A 1T5BA 2AN4A 3JATB 2Y0CA 4BNWA 2VKQA 4IZZA 1AUXA 3KTAA 1SELA 4OBWA 1JFSA 4JQCA 1J5XA 2AHQA 2OZPA 5IN5A 2O8DB 1ZUNA 3DQQA 3LYUA 5CR9A 2Y0MA 5E38A 5DISB 1X19A 1X80B 1V8OA 2GT1A 1G2OA 3O4JA 3R9KA 1IATA 4MUKA 1WXIA 1WHSA 3OP1A 2YXNA 2YKGA 2MT9A 2FB9A 4GBJA 3DV0B 5CFRA 5CT9A 4NYIR 1OZGA 1AKYA 2WF9A 2N42A 4HBLA 4UUVA 3WGLA 1JEDA 1QQIA 3EE6A 5BV2P 2KJCA 1TKAA 3FUXA 4IL5A 2VK2A 2VT2A 4WGFA 4I19A 2HDNB 2L3DA 4P4GA 1CQIA 2X4IA 3CW8X 4F86A 3UHFA 2IA1A 1PEDA 5KK1A 2Q3CA 4NHEA 5ITSA 3ELYA 2ZW9A 1Z21A 2C7PA 4Y9TA 2V4ZA 4MHOA 1P9LA 3E61A 4R05A 1EWQA 1V0JA 4H2DA 2GUGA 2BGUA 3AHGA 3BDDA 4IUDS 4ENVA 4JI7B 3DHVA 2R6GA 4LJ9A 6PAXA 2A68F 5E6RB 2PVSA 2BDEA 4JQZA 5BV0A 5C5DA 1U9ZA 4OMUA 1WUHS 3IAM2 4BKMA 1IK4A 1A7UA 4FMBB 3CYFA 1REQA 2E87A 4AUXA 4EFDA 2B8TA 1ZUWA 1JHMA 2Q0HA 2PLRA 3OOUA 4Y7NJ 4RD2A 4IHYA 3ZWWA 4AJ2A 4ZT4A 3KK0A 1KP2A 2EP8A 2L5QA 4J16A 4OJQA 1ZZGA 2OHIA 5D6OA 3DE7X 1RAEA 1RS0A 1VL1A 1SXJE 4S0ZA 1P4WA 1VCIA 4GWLA 1QX3A 4G85A 3DDUA 5JW6A 1ZPDA 1DOHA 1TJ4A 3JARA 2K7FA 4CXMA 2FR8C 3ZNNA 3JVDA 721PA 1QHYA 5JJKA 1G20A 3H2KA 1OHHA 4MUJA 1SM4A 2LIPA 4U7WA 3WXMA 1OXVA 4PG6A 3TX6A 2DUJA 3E18A 5DF1A 4JJGA 4UHJA 3DFGA 3ABIA 1X7WB 4IFBA 5IHXA 2CQKA 5D5HA 1RQXA 1X77A 4L22A 2ZXIA 4EYGA 1W59A 1ORHA 2VN2A 3CLKA 1YJ8A 3ZD7A 1SKYB 5EEHA 3NBAA 2GJAA 4KWCA 1I27A 4PZUA 3ZOKA 2IHUA 1VBFA 1RPZA 1B6GA 2A4KA 1NSFA 4LMBA 3V2UA 2LWIA 1EWRA 2HGZA 4BU2A 1CDZA 3BRSA 1RLUA 4YRAA 4LXXA 3AMVA 2DPYA 1UBUS 4PJNA 3OJFA 3PGMA 4IOJA 1M2HA 3UV6A 2ODEA 4WMLA 3OJLA 4TVBA 3BTLA 3LIPA 3G2IA 2WT4A 3D3WA 4MINA 2BMFA 3WVNA 4DZPA 4IV5A 3ORYA 4AKIA 4B76A 1TZKA 5TPZA 8ADHA 4KXFB 2Y71A 5ELLA 1PGJA 4BWVA 2X3YA 1XKLA 3U09A 4I9UA 1GQQA 3HB9A 2C95A 2M4GA 1KOJA 5HNKA 2QR2A 4OB7A 2YV3A 1J39A 5JFTA 1VYVA 1HA8A 5ADVA 5K3FB 4KUGA 4MNTA 1HTWA 2C07A 1H0KA 2JVJA 4F1WA 2GSWA 3UBMA 3TTYA 1FMFA 3G6KA 1GL7A 3HYTA 3TOZA 1U2DA 3U48A 4N8EA 1WF3A 5EJAA 1NN0A 4BLTA 2RGNC 1DKRA 4CA0A 1KQPA 4X6AJ 4ECAA 1VMDA 1IE3A 3V7UA 1EWYA 4MGKR 2F64A 2LBPA 3S1MJ 4GLOA 2FBKA 2E1RA 2A67A 5KTNA 4X5OA 4U7TB 2H3EA 2AHRA 2CW5A 3HYSA 5KHLB 1TM7E 2QX7A 4IVPA 5IJ0A 4QT0A 3HU1A 2X6OA 4HDOB 3OF2A 1FFYA 1LCIA 4KQXA 3BFXA 1JJVA 5JDIC 1IBLB 4RSGA 3V80A 2CCGA 3COZA 2MGQA 2MSCB 2WWVD 1K5PA 2CD7A 1L7VC 3S2SA 4ZQGA 4B6SA 4JJAA 3THYB 5G1OA 2ZT7A 5F5XA 1JRLA 4MS4B 3RV3A 4Q5IA 2VYVA 3OO0A 3LWFA 2HTFA 2AC2A 2YQ4A 2P9EA 5H16A 3DZDA 3P4XA 3EFBA 3IVMA 4B87A 2PT6A 5JNVA 3UJ3X 1PR2A 1UIRA 5EWMB 2YV1A 3G68A 3UOAB 1Q15A 1Z8NA 1K7XB 1XS9A 4KEAA 3WFIA 4AURA 3GQBA 1E0AA 1UQRA 2KQRA 1S7EA 2KPOA 4LK2A 1S72I 2GETA 1OFUX 3IP1A 5JC1A 2A0XA 2PWAA 2ZCWA 5JS8A 1M2VB 2Q2EB 3K32A 3HCFA 3RUPA 2V65A 2G67A 1EQAA 3DXJF 3L1KA 4CG1A 2IUEA 1ECJA 3FPJA 3Q6IA 4N82A 2D54A 4RJTA 2PCJA 3ASNH 4JOBA 2G70A 4DIDA 3K4BA 2QU8A 4O4IB 1QQ7A 2ZK7A 3VQTA 4NE7A 1BWQA 1H4TA 1E3MA 4OHUA 4FFBA 3DKXA 1S6LA 1E7RA 1KRWA 3AF3A 3MAGA 4EGCB 3QU9A 2EFDB 4N3GA 4EGJA 1PFGA 1RT9A 1QZTA 2P81A 4FYJA 5J63A 1TUGA 4XIYA 4GX1A 3ZWYA 5JMPA 3ONQA 3BIXA 3ISTA 1JDNA 3FNFA 5LKAA 3BSYA 4TQAA 1QZYA 5KCMA 1ICEA 5CFOA 4URVR 1T8YA 5KREA 3IOYA 2FP3A 3G4SI 4CCJA 3K1AA 1QUFA 4J1SA 1UEXC 3PIIA 3G9UA 4IRMA 2C5EA 5CJJA 2VWHA 2VDJA 5FPSA 4HB3A 1XTVA 1IHXA 3PK0A 2ZE5A 1UK8A 2CUJA 4Q4CA 4CM8A 1W4ZA 3K6SB 3IP5A 5JMOA 2J8ZA 5DULA 3KYDB 1DINA 2OXTA 4PG7A 4GEGA 1I3KA 3W77A 1CUAA 1QH8B 3B20A 2H8WA 2VUMJ 5CW1A 3I3OA 1Q3HA 2ES4A 1PQWA 2ZR9A 4ENKA 1CB0A 3RKYA 2YYSA 5DB4A 1NM5C 4FKZA 1V8FA 1UPAA 2BMAA 3BMXA 2FQ4A 1XWIA 3V33A 3RKRA 4OTZA 2YDXA 5KWEA 4L28A 3N7AA 4BKXA 2VXZA 2BGGA 1T0HB 1XZBA 2WADA 3HA3A 3ECAA 1P80A 5ALTA 3VKHA 1XXHB 4YRPA 2Q5LA 4TSFA 1RBQA 2FH5B 4U5QA 4G07A 2D7CA 3LSRA 3PQ7A 4MTDA 1TA4A 3TPCA 5E3IA 2K5UA 4ZOQI 5E3HA 5FPPA 3WTCA 2L7KA 4CMEC 3KZZA 2B25A 1DJMA 1Z6GA 4BBAA 5DCYA 2H1RA 3IDZA 4YRRA 2P3LA 4URHA 5CEFA 3BCRA 5LQUA 3O93A 1BS2A 1JJ8C 2OAP1 5J1TB 1UK7A 5JXWA 4I99A 5FLXA 1Y5NA 3M82A 4DIBA 1DTSA 3FOBA 3M9AA 5FO5A 2EFJA 1E5DA 3Q5GA 1I94B 4TWRA 1ZK1A 2VHJA 4FCCA 1BI0A 2Q3LA 2BONA 3V8VA 2E6KA 1J00A 4CG0A 3GA7A 1E3WA 2LVSA 4BUJA 2PJUA 3O7MA 3NC4A 2WD7B 1MO4A 3V7FA 3MMPA 3H99A 1T8SA 4HQ6A 2DTRA 2BVMA 2QVBA 3WNZA 4QYSA 3TG8A 1F4VA 5CVDA 4TXNA 3THSA 1VE5A 1JE0A 3M5DA 2BM1A 3ZR4B 2V4UA 4DVJA 4RZHA 3MILA 2ZI9A 1UHMA 1JG1A 1MR3F 5ITZB 1FTNA 1UKCA 1ZXXA 3KYIB 4PC1A 2EFWA 3A3YA 2Z0MA 1NQUA 4G1MB 3WK8A 3V7SA 4C14A 2XGSA 4PXSA 2IPQX 1D8TA 4KQMA 5F5NA 4NB5A 2HLPA 3JATA 3IPLA 1Y8QB 3A4MA 6ADHA 4KDCA 3KP2A 1V7QA 3IV6A 4ZJZA 2CHVA 3D5LA 2ZKLA 3X1KA 3T5AA 3O8LA 3E0QA 1L5OA 2FMFA 4EX7A 1X80A 1MNDA 1DE0A 2EEZA 1DTWB 2ZI6A 3OZEA 4OAZA 4I1SA 4YCCA 5EGNA 2TMGA 5DBEX 3B1WA 5EMKA 4CYCA 5LQJA 1KEEA 4D9IA 2O3TA 4GGPA 4RADA 2W6NA 5EP3A 1GPAA 4RY9A 3LBHA 2DHQA 1HDXA 4YDQA 4MA5A 2FVYA 3D6AA 3DFFA 4D26A 2F1RA 4Q93A 2F62A 4A0SA 2IYZA 1CU1A 4FASD 2B7LA 1HM5A 2GRUA 1QJCA 4KMMA 2G7HA 5IX8A 1L7BA 1SKQA 4X54A 2FYTA 4WLEA 4Z8YA 2NO1A 2VP9A 5I9MA 3V4RA 3O0TA 2AHOA 1DP3A 3EMKA 2EFEB 4DR1B 3JRWA 4DLKA 3PQ4A 3MB5A 3R7SA 1EH5A 2G07A 5IBPA 4ZAVA 4IUBS 3IEIA 1DO8A 1EZ4A 4KI0A 1W4LA 4DA4A 2F3RA 1NC1A 3PENA 4DPMA 2TDXA 1XQ1A 1OT5A 2IDJA 1XAHA 4MDFA 4J3NA 2O2GA 4J2HA 4DWOA 2Q6TA 4AC9A 1V7CA 2FA5A 1VG1A 2J31A 3KQOA 1BA5A 3AERA 3OLXA 4D99A 5KJFA 1L8QA 3L0PA 3BR0A 3ZHQA 2Q2QA 2HWYA 2FNAA 1CS0B 2CVOA 2RGWA 3CRMA 2Q0QA 3Q8MA 2VRBA 1P2BA 2SCUB 2AMJA 1X3ZB 4QU5A 3WQRA 5B55A 1YI0A 1T6SA 1A4XA 3VOEA 4WECA 1XZMA 3I1FA 2YWHA 3CLUC 1NNEA 1Z91A 3GP8A 3CNBA 3BIFA 1W44A 3AXSA 4LV8B 4WAUA 1E3LA 4HD8A 4URYR 2Z8YA 4INAA 5FWDA 3IMGA 2EQRA 2OC9A 4P86A 5J47A 1H85A 3SM3A 4E2FA 1J2TA 1A7KA 1X7WA 2PL3A 3UJCA 4WINA 2BP7A 3U4DA 1XDSA 4ZH4F 4HATA 1YR8A 3CUOA 4B0PA 1H9GA 4OX9B 2F48A 4RPJA 4DG9A 4UTVA 2ZJ0A 4UDYX 3PCRB 3DEYX 1TU0A 4N6GA 1PUFA 4DBQA 5KQMA 3KKNA 3T4UA 4CMIA 2VI5A 2BUAA 1GCGA 1NVVQ 3M6UA 2GA2A 4IJUA 4JS0A 2UXDB 5U4QA 3GGGA 5GONA 4YI3A 1TQ2A 4IX7A 2RAVA 1FTGA 4RQTA 4HN2A 3ASOH 4RENA 3OCUA 5AI6A 1XEAA 1Y3BE 1G98A 3I0MA 2CFXA 4YG2F 3L7MA 1EFTA 1JZTA 4ZEVA 5KOYA 1XMAA 1Z82A 2AQFA 4JB3A 1SPBS 3WBKA 1PR1A 3W6NA 3L2VA 1XJCA 1AVTA 1ZMOA 1R10A 5EDNA 4Z6KA 2Y76A 3PEEA 5K3FA 4AKEA 2ODPA 3M4NA 2EJWA 4G12A 2DQZA 2C88A 4NR0A 1DEXA 3H2HA 3RRMA 1ISPA 2RI6A 2ZDHA 4OXQA 2ID3A 3NWSA 3HL0A 3FLAA 2UUAB 4UQLA 2PY6A 4A0GA 1IJEA 1OH7A 4RPHA 4X6YA 4FMCF 3N2LA 2O5VA 1EV7A 1PW5A 4E33A 3I62A 5EC8A 5JDCA 1N2GA 3UGKA 1S3IA 3AONB 4BH9A 5LMNB 4G5GA 1VKRA 5IG2A 1BJAA 3KPHA 2Z3WA 1T2UA 2JN6A 1FVHA 3K6GA 3GJZA 5GGXA 1Q0LA 4JX4A 1PQ4A 1JPUA 2QBYB 5DE3A 2OD9A 4TLDA 3H65A 4MV0A 4YP6A 1L3LA 1KKLA 5AKYA 3J81K 3EAQA 4IIYA 4UD6A 5T4FA 1KMCA 1K9VF 4ZJYA 5FBHA 4MS4A 5B7QA 3GEDA 3PC6A 3BJ6A 4F38A 4F45A 2QSGX 2BXZA 4UUTA 3C3KA 1CVIA 1XEFA 2GBGA 3TFQA 5L3DA 3A4NA 3QF7A 5EGOB 1AC5A 2JAWA 4K0KB 5D1NA 2VONA 3IP7A 3AH8A 3JQBA 2GUWA 1GR0A 4Q7MB 3DEEA 1HPLA 1J59A 4OYRA 3LWNA 4K3UA 1U2GC 5FHRA 1AGYA 4I4TB 4H1HA 1NPDA 2DQKA 4RTPA 2DJNA 2JIRA 4QULA 3W3ZB 3I12A 1KJWA 4Z1OA 1G7CA 1ONPA 3AI1A 1UBJS 4O4IA 5IF3A 4KQEA 5LZ9A 3DAPA 3RPQA 1WH5A 1TIBA 3LAJA 3LP8A 3IAAA 5GTHC 2IZ5A 3G1UA 1VHTA 1D5YA 4MOWA 3A0RB 5D1HA 1ZGHA 4HWKA 3QX7A 5DM7F 3ANSA 1G18A 4KPUB 1OD6A 4QPCA 3EXHB 3ANNA 3F9IA 2ZI4A 1B14A 1JLKA 1C50A 3DF7A 3EDYA 3UN1A 3VOSA 5GVRA 1IMJA 3JQQA 4N3NA 4FZJA 3WAJA 1XQWA 2IK8A 4V38A 421PA 2QEXI 4ENSA 1N5JA 1XZNA 4CQMB 2I33A 3VDQA 3QEKA 4I66A 2ODQA 4MTEA 5JH7F 4M86A 2V03A 3VBCA 1RHMA 3KCCA 1QGED 3ZE6A 4BBSJ 4LJ7A 1B6SA 1RZ4A 4G9YA 1QFYA 5EERA 3RVQA 5IJAA 3BR2A 4ZAYA 5J4KA 3LVFO 3AKCA 1C0LA 2B21A 1KDRA 4BGIA 3VNAA 2RJOA 3MD9A 2QNBA 4GZ3A 5EZQA 4CVNA 1Y6FA 4HVCA 3CMYA 3JPWA 2RBEA 3CINA 3SQDA 5HVNA 1NT2A 1Y6RA 2H7YA 4X6XA 3S4YA 5MGBA 1Z4PX 2CJXA 2QMHA 3IRVA 3ACDA 3A8TA 1XPRA 4N6NA 2W5UA 4FD3A 1ZM4A 5DW3A 1DAKA 2QORA 4G0PA 4IRIA 2XOXA 3LSPA 3I54A 1NVFA 1DAGA 4R0MA 1H0RA 5DRYA 4D0GA 3F1LA 3M81A 1NW5A 4LECA 3PQ2A 3AFHA 3QOFA 2P41A 5E1OA 2JUCA 1H8AC 2QVOA 2G9VA 1VI6A 4K8OA 1NKVA 1ZGBA 5H83A 4MV1A 5EINA 1WXEA 2IY9A 2EFYA 1QIFA 3GXOA 4AKGA 3STTA 3WLEA 4GI5A 3C24A 4ADSG 4HNTA 2ORWA 1X7HA 4ZDOA 2HX1A 1EM8A 2ZAIA 2AFHA 3QYJA 4O4LB 3QFFA 1ZUIA 5JCZA 4JJZA 3VODA 1E9FA 3ESCA 2XXJA 3IOBA 3PL5A 4W5WA 6NULA 3P0EA 1U5AA 4X20B 3VR4D 1FMVA 3JW4A 1KO5A 4R7GA 4KYIB 3BG3A 3JQ8B 4OQYA 2BAGA 2WD7A 3C45A 2A84A 2JA2A 1YH3A 1XI2A 3E0JB 4LCEA 1QSGA 4GPAA 2QRMA 3UJHA 3FDYA 2G88A 3HUGB 4F11A 4KUHA 1Y80A 2FU4A 4TTRA 4U7DA 2PGXA 3N4MA 4L6CA 3B1FA 3OPMA 1R8JA 3M1IA 2UUCB 5K3AA 4KKVA 4WCVA 2VOEA 3PNSA 3HJCA 1PYVA 1RTKA 2XCQA 1COWA 4WKOA 4UAGA 2HFHA 1YUMA 2ISCA 1QG6A 1NFRA 4KFSA 4OKIA 1XC5A 4QYTA 4L8FA 1XTTA 2VDOB 1CUWA 1T5HX 1Z3XA 3GJQA 3UH1A 2BYTA 3WIBA 4I0BA 1W0JA 1I7DA 2INGX 4JHLA 3VEPA 3KQYA 1I4EB 5FWYB 3CJQB 5E0KB 4X0GA 2Q5JA 5CB4F 1ORKA 4UOQA 2NU8A 1IM2A 4AYTA 1CJKC 2JUGA 2BZGA 3GLHA 4YFNF 2FW9A 4FWIB 3F6VA 4XJXA 3F6CA 5FOWA 1HOTA 1KC3A 2NUBA 5IYCJ 4JV5B 2B36A 7REQB 3HR8A 1IUNA 1PZHA 3SP1A 4XLFA 1T4BA 5M29A 2R8XA 3V1TC 2G6TA 1P7VA 1HLGA 5I9BA 3UAVA 3RARA 5JAIA 5H82A 1USTA 1CF4A 1G3UA 3PHBE 2BKEA 2C4TA 2WWGA 1OWOA 1ZIOA 2FSPA 1PV1A 4MYDA 3PXGA 4MKZA 4CL2A 2EFOA 3EMDA 4LNUA 1V3VA 2VKDA 1VC2A 1CR1A 5KWSA 5LFAA 4AVZA 4MVJD 5E79C 1LPQA 3R5HA 5K2MA 1YBFA 2FZ5A 3W8RA 2CNWD 2QU7A 4ZO6A 4RA2A 4J90A 4EG7A 4IY1A 2O2ZA 5EXDA 1OTHA 3PSHA 2WWTA 1D1PA 5FROA 1JV2B 3QXJA 3DLIA 3AL0C 2IYPA 1II0A 2NUAB 3LA2A 1IWPB 5EYPB 2QM0A 5IULC 1G0NA 3IIJA 3PFFA 2GZWA 1Z67A 3KV3O 5KKCA 3M1YA 3BGOS 5AKEA 3SHOA 3JYQA 1CZOA 4FGJA 4Q18A 4LDPA 3ROFA 3ZDFA 5E1WA 2XRYA 5GAJA 2AD5A 5MN5A 1Z4NA 1W47A 2VYQA 1KVRA 1W2WB 5BSTA 1VLHA 4B83A 1O6BA 1ZN8A 4DZZA 5K20A 4RJJA 5JG7A 3OZRA 2A33A 3DOEA 1WULS 3H2GA 1E5XA 1FDWA 1K2WA 4YJFA 4YFXF 2O6HA 5HODA 3UXYA 1NXQA 1M34B 2M6SA 3C3BA 3FMSA 3QMPA 2PJRA 1ZHHA 5DYGA 4A0QA 1CP3A 2O7QA 2UYOA 1T6YA 4TLBA 4MWCA 1ZG1A 1A9QA 2PJZA 1O8CA 4GUDA 2ZYTX 2K9NA 4AULA 1N78A 2C9OA 4UNQA 2D0DA 4YY3B 4E0BA 1F8FA 2WC1A 5DD8A 2OCYC 3VU0A 1JI8A 3ERCA 1V9SA 3I9LA 3LVQE 3CLVA 1S7AA 5KNCD 1E2IA 1WP9A 2O3SA 5E8IA 1NP6A 3WLIA 2GAIA 2G9UA 2C42A 2D5LA 2CMPA 4U87A 5KNLA 2I2XB 2XKKA 2AS5F 4UMDA 3HXLA 1HYGA 4TT8A 1H2FA 5CTJA 4A8JA 3LDGA 1P1HA 5B58C 5IT9Z 2YXDA 4US1R 3EOZA 3UT0A 1MSFC 1N7GA 1HF0A 2G4VA 4A8PA 2IJLA 2XTAA 1Z15A 3SZ3A 3RHFA 3LXUX 4LC0A 2Z08A 1WLYA 4V24A 1U3VA 2M1BA 2OV2A 4HLDA 5IEJA 2IEBA 4OJYA 2EX0A 4DC1A 1LX6A 3CVUA 3DAGA 3CCQI 3LVBA 3WDSA 3DSRA 4OYHA 2R7SA 2XQIA 1ZRFA 1L7NA 1XZJA 3H35A 2FUKA 3L8HA 3GYGA 1IQRA 3V4PB 2DFFA 4EM6A 2IJGX 4E1BA 3SWWA 1YO5C 3ZCPA 3OCJA 5H20A 1U9YA 4RGRA 4HRYA 2VWGA 5BN4A 5KYNA 1EP1B 1I7QB 2J6BA 2HI0A 2FXAA 2QM8A 1Z07A 3R3YA 4ENNA 4MR8B 3CVWA 3L7JA 1LLQA 4NY1A 4TKMA 1UFQA 2QBYA 5JT1A 5FAKA 3NYWA 5BMZA 1N77A 2PGAA 2H59A 3G5AA 4P2GA 1PP7U 1FC0A 3UATA 1B26A 1CDEA 3ZCOA 5IVHA 3GUZA 4D97A 4ZAZA 4JI6B 2QMYA 1UJ8A 4OGGA 1J22A 1W1WA 3WMRA 3NBYC 1C0WA 3A4TA 1DWOA 4KO3S 3QKRB 2E4XA 1JQBA 4MWOA 1OC4A 1SC4A 2D0OB 2IYVA 2ZIGA 5EGOA 3RDIA 4LHYA 1NRWA 4X6LA 3LPCA 3D3KA 5KOHB 2YR2A 1NI3A 1TVKB 5FV7A 1JIJA 5BVHB 5CGQB 2C0QA 1L5WA 1V1JA 3BZBA 3IALA 2W7TA 4UAUA 2VO1A 4W1RA 4L07A 4YWHA 3F9CA 4DAEA 4MQVA 3S14J 2E19A 2B63J 4KL8S 3WYBA 3QI7A 4FFVA 4CZCA 5DEIA 3FXJA 4YV2A 4UEQA 2ZYRA 4B8XA 5CX4A 1XC7A 3X3HA 3HXOA 5BW5A 2J3MA 4F3NA 5EP2A 1CJTC 3D2LA 1UM9A 5BOVA 4UZEA 1A7AA 2E4VA 5DGHA 3SF8B 1SCJA 3DTVB 1WMBA 5DGCA 1MW9X 4R3NA 3BXXA 2P4QA 4YFVA 2ZB9A 1J8YF 1XROA 3QPTA 2YW9A 3RH0A 1DDOA 1DLIA 3OYGA 1T36B 2QQFA 1JJFA 2WM8A 3PGA1 1QZEA 1WSWA 2RI1A 1BKYA 3D4LA 1CERA 4N48A 4ALIA 3I0NA 1EFVB 2ZI7A 3ULKA 4KUEA 2WYVA 1CY8A 4X92A 5F64A 3WLHA 2G25A 5DLPA 4G2TA 4RPKA 1G5FA 3GBSA 4Z0TA 3LAPA 3E9QA 3B6CA 4DN6A 2A3SA 1TLFA 1YQDA 1M8KA 4BQOA 1PGPA 1X42A 1D2NA 1AO3A 3FOAA 4S0XA 5K8LA 4LJKA 4RMHA 1O3RA 4QDJA 4QM6A 2O3FA 2VCEA 2D59A 4J7CA 1YX3A 1CE8A 1FP1D 2JA1A 4ETNA 3LX5A 4ZRNA 1UFKA 2PGJA 2E36A 2XDVA 1LSOA 1KP3A 1TJ3A 3BERA 1SHLA 1XPJA 1NULA 4RGSA 1WD7A 3ELUA 3DMFA 1MUUA 1ZU5A 5T4HA 1EXDA 1T0JB 3IAS1 1UAYA 4RKYA 5EIBC 1SURA 3EVTA 2FSFA 3C7TA 2IY7A 3L2RA 3AK4A 3HLKA 5BRNA 2Z9OA 2VT3A 1DAMA 2W6ID 2UVQA 4RFVA 5FORA 4L6IA 5LVAA 1YTYA 4HLNA 2JA7J 5JWHA 4WGGA 2XUAA 3OI7A 3CGWA 4C88A 4O4LA 3TBKA 2HSDA 5L7WA 1F60A 1S2GA 1MMDA 2QW1A 2WF5A 2NS0A 1ZOOA 1WJ5A 2BOVA 3MVEA 4X20A 1MW8X 4RO0A 2MC3A 1AM4D 3ZLTA 1F43A 3CCFA 4R9RA 5FO0A 1WQ3A 4MUHA 1QYWA 3VSLA 3S28A 1NMSA 3MCWA 3AF1A 3JD4A 4ZC1A 5EFOA 3A1WA 3TQIA 5JYCA 2I03A 5CCDA 3UXHA 2JIZA 3N59A 5EUQB 3FDIA 5K9ZA 3IEKA 4NIMA 5AWFC 1GL6A 3M8EA 3EQ6A 2GK3A 1ARZA 2PEZA 4DCGA 1DIRA 2DAPA 2ID4A 1V7PC 3IT3A 4G7ZF 2QIPA 1DG9A 3M1LA 3VR5A 2A0YA 4XOIA 2A9OA 5KNBH 4DHEA 4BWYA 4GKAA 1W0TA 1ZL0A 3DEZA 2IRFG 4R2HA 2BJHA 3E4CA 1B8UA 3G9QA 2IP2A 4OQZA 2IHJA 2RKOA 3NLLA 2K40A 2B8JA 1JQJC 3QLUC 5K6TA 3O3MB 3X1DA 3NAGA 5FWYA 3CJQA 1C3VA 5CH3A 4RL6A 3KQTA 2WT9A 2JVGA 1JT9A 1P2SA 3CZAA 7MDHA 3NYIA 1XX6A 1PU2A 4XARA 3S2GA 1WLSA 1OZFA 3K30A 4WZBE 3MTDA 4BTEA 3FK7A 5DX8A 4U2FA 1GYRA 3RAPR 2I34A 1CRZA 1JLSA 1IM8A 3BE5A 4KN9S 3LQ4A 1H2RS 5IM4F 5CT8A 3UA4A 2W22A 1O9BA 4ARIA 2VSOA 5B1AH 5CYFA 3ZZ1A 3RVPA 2C98A 3PLRA 4PUSA 2G1AA 2WLSA 3KKZA 3K92A 4BFWA 3PFIA 4CU5A 3F4KA 5LOVF 3FHOA 3GLFE 3UZUA 2B5WA 2YX4A 2HYFA 2WJZB 3EXFA 3GA0A 1A0OA 2NN3C 3VXKA 3GEBA 1Q0TA 2EZHA 1YCHA 3WHPA 4OU5A 3OZSA 2BHNA 2CDRA 2JIOA 4KU4A 4DV5B 3RFUA 2R4TA 2BHSA 2WIKA 2R79A 4HS9A 1JWBB 4FHTA 4JLWA 2OGTA 5M5WJ 2PKQP 3GRZA 1JHAA 3FGOA 1JKOC 1A8SA 2GLXA 2LKCA 3AY3A 3K2ZA 2R68A 6GPBA 4FWBA 2XB2A 3P9IA 3CPHA 5C8YF 4XMYA 3R4CA 4CLDA 2Y0SN 4LBVA 1N2XA 4P36A 5G4LA 2Q4BA 4EJ6A 3SYTA 2Y0SA 1IZ7A 4DJDC 1EVQA 1TO6A 1Y5RA 3O2PE 1IEXA 2PMEA 3RYRA 4DV1B 3AOEC 1XHFA 4R3UC 1VB3A 1MAHA 2LF8A 3GH3A 4HJRA 4LSZA 4YUVA 1P1RA 4DILA 2DTXA 5KU1A 5L4LA 3WXBA 4BACA 3RRNA 1UOOA 1IFXA 1E1DA 3IXQA 3V3KA 2PFGA 4FGLA 2I6TA 3C2HA 5NLLA 3ZI4A 3A26A 5BQTA 1P7CA 2DU8A 4YK7A 1YV9A 2HV8A 1NVVR 3DZ8A 4NARA 1CJSA 3LA8A 2GN6A 4MWEA 4Q37A 1SRRA 4BC0A 3ZV4A 1DRJA 3I83A 3L84A 1DXYA 4FP9A 3CMAI 2I4IA 2GN1A 3A6LA 3BDVA 2B2XA 3F7OA 3G2QA 3OLVA 1F48A 1YJXA 4X90A 1PZNA 1SJ9A 2XA1A 4BLUA 4MP8A 4LI3X 5IWCA 4NBKA 5FP0A 2DPGA 3GRFA 1JJAA 1XNHA 2FK7A 3OF3A 3T0YA 1EA7A 3OMWA 3DWEX 3DV2A 1L4LA 3SNHA 3LRXA 4UUSB 4IIEA 3FF1A 4ATNA 3CMCO 4MUFA 3B70A 3E8MA 5EIOA 4ND4A 4NMMA 4DJJA 4E07A 1J25A 4QOIA 4QOJA 1HNWB 5IAGA 5B3JC 4A5OA 1KZ9A 1OCCH 2VWQA 4HWPA 3EXIA 3L0SA 4LKRA 4U9HS 1OH8A 2P6OA 2VEDA 1Y3FE 2X0JA 3TLXA 2NMVA 3DTNA 3L2WA 1AQYA 2OILA 4JBNA 5J2UF 2Y4NA 3F67A 1YIDA 1FS5A 1YU6A 4MEJA 2I2WA 4QQFA 2WAEA 4EPRA 4ZGBA 4D9KA 2Y0PA 4R01A 3RT9A 5J4VA 1Y82A 5B7PA 1P1JA 2FPRA 3F3MA 4IDEA 5DM0A 3HB7A 1QYRA 4QVKA 4MR8A 3UMRA 2B1GA 2RARA 3QNMA 4DRZA 1F2TA 5FRNA 1WUTA 4YV1A 2R85A 1JR4A 4YRMA 1XWFA 4PJLA 1E2DA 1F7UA 1W1IA 3C7JA 3QKRA 1PHPA 2P6NA 2NYXA 3KSDO 4FMCB 4F6CA 4R83A 2HV9A 3IT0A 1XT6A 1KZ1A 2RSLA 4ENJA 4MTCA 1JLHA 4JLOA 4DSTA 2QTMA 1QOQB 1DOAA 3U6KA 2YWCA 3Q2OA 3EDMA 1IY9A 1PJ4A 4CCWA 1NVUQ 2ODTX 2P8SA 3E70C 1WS6A 3QSYA 5FL3A 4MLDA 4QELA 3UWOA 4EPXA 2ZRAA 4JLSA 3QPSA 1RMYA 5HX7A 3DM5A 1EHCA 1LVHA 1SMKA 2SBTA 1C9JA 4GI7A 3JAWA 3PDWA 1LBIA 4I7HA 5D8KB 2W2MA 2VRNA 5FR1A 3SXYA 4M49A 1SZCA 2LXNA 1PUIA 3K2AA 4IIJF 4HMPA 3BR3A 4HLXA 4NZPA 3G1WA 1FRVA 1MJ9A 2EOAA 5DX0A 1M0EA 3WU0A 4TS1A 3S3NA 1FPMA 3SF8A 3QKUA 1BKDR 5A9SB 3GCWA 5JCJA 3X2QH 1ZN7A 3NARA 1SQGA 1X86B 5BRJA 3L79A 4WKPA 3TW4A 2V98A 5BSKA 2RN7A 2ZJQF 4CH7A 4FN4A 2NPOA 3N2KB 3C3EA 3FG9A 4QXAA 3NI2A 3DB2A 2ADFA 1E5TA 5A3QA 3DAYA 3ESRA 4QFCA 3S2FA 4DEYA 1U8YA 4KXMA 1NRIA 4J7AA 3Q9NA 3OOEA 5I7FA 3NUZA 1KY4A 3T8YA 5FQOA 1HQYE 1V2GA 4U39A 3E0XA 1SVNA 4NESA 1GZDA 2K9SA 2ZC2A 3WYEA 1NSTA 4H15A 2HRRA 2DERA 4XVCA 1H88C 1XAJA 4J91A 2HOEA 5CQGA 1JXOA 3PDUA 4R1LA 3LL7A 1VMAA 1NNI1 5JLAA 1Z13A 4B7AA 3RVBA 4TOIA 2Z30A 1NX9A 1IAQA 2IH5A 3T5TA 4A1OA 4K2EA 2HA3A 1W73A 2BPOA 4MUYA 2AUMA 5D5PA 3OWHA 3MJVA 4R0VA 1EK5A 2E85A 1KVUA 4EHFA 1ZJYA 5LNK1 4JYMA 1NZDA 4C0QC 1AJEA 3C3AA 2FPSA 5DTDA 5JH7B 2IUSA 1BEZA 2DFTA 4OBBA 5JRDS 4O2AF 4H08A 1JQ3A 1QZZA 1D1BA 2UV1A 4HLCA 3W2GA 1KXJA 2PK3A 3WB0A 1BIBA 3QVVA 3RREA 3J7TA 4OWRB 3W78A 1FLAA 2V3WA 4R1UA 4Y6GB 3K71B 3CO6C 2OGWA 1RQ2A 2C9YA 3FPHA 3EF1A 3TQHA 2WG2A 4UCWA 1J0EA 4LJYA 1RBYA 1VE1A 5KHDA 1V16B 1H9BA 3T1BA 4IEFB 2Q1UA 2IPLA 2AN9A 1LPPA 4KXQA 2H8KA 4MRAA 2V8OA 5I5GA 3GUUA 4AZ0A 1GG8A 4E31A 1U7HA 4WPGA 4PGFA 3TXYA 2B9SA 4BHBA 1XQXA 4KH0A 4BU1A 4AN0A 5BOXA 3IQGX 2FV8A 1B4DA 1I32A 4I6JA 3C85A 5C3MA 4UBOA 3PX7A 1J9ZA 1KDYA 3ESQA 4ZOLA 4N8DA 5K05A 1K83J 4M3NA 1PVOA 5EMLA 1UWCA 4PVCA 2QQ0A 2XNSA 2LY9A 3VKGA 3WNBA 1RQNA 4ZIRA 2EW8A 3S8YA 1PSZA 4KO1S 3EG9A 1U0BB 4ZU6X 4YEDA 1ETXA 4P83A 1BW5A 1OYWA 1SK8A 2G04A 3AG5A 2X6YA 2I6FA 2V5AA 4JUCA 3K0AA 5LQNA 1RHRA 3ZU2A 1QP7A 2IOYA 2IUUA 1WB9A 3ZN0A 5SY9A 8ATCA 3RD5A 1ODKA 2MLGA 5LBTA 1IBMB 5JVDA 5EP4A 1Q1GA 5HYVA 1Q44A 1CXZA 4CQJA 2JIPA 2UKDA 4NP6A 4CMBA 1PR6A 1YS4A 2M5WA 3D8UA 1SG0A 3QXHA 1FL9A 5J6XA 1B6TA 2VR1A 5JNLA 1E1YA 1S2IA 5CFNA 3HJUA 1PFUA 2LIVA 4BKUA 2FX3A 3JWIA 1RCFA 5D84A 3ZHRA 3I9OA 2AWNA 2OCAA 1XCOA 3CMEI 3D02A 3IP6A 2EHDA 3MGCA 3KHSA 1R66A 1T1RA 3ZGOA 4AMYA 4PFSA 1U3EM 3EIXA 4EPVA 4LEIA 1Z2AA 2WKPA 4JJ8A 4OHFA 1EJBA 4DSUA 4AZSA 3L7WA 3K70B 3FIJA 1MZPA 6REQB 4Q24A 5CB4B 4B3XA 4XRMA 2UZ4A 3H2YA 2X0NA 3AQ4A 4V3BA 3QIVA 3SYRA 1P4XA 4RK7A 3VZDA 4ESBA 4JLDA 4HA8A 1HG1A 2BGIA 4JYKA 3WTSC 1DO0A 1N0VC 9LDBA 4FB5A 4Q3AA 1UFMA 4IH9A 1LBSA 3PDIB 5ALSA 3SQOA 4KLZA 3IAEA 3TB4A 2CVPA 2I66A 1LKZA 2BVLA 3RRJA 2OHFA 2C31A 3HJAA 1EB8A 5EMNA 2VTDA 2YVKA 2WP0A 2GYVA 1J42A 3TLEA 1E9CA 4BYYA 5T8KA 3OCCA 1EBFA 4G1VA 5A9RA 2ZKIA 2H06A 1AB5A 4MVJM 2CW8A 1FFSA 3JYOA 2IOFA 2FZLA 3EA0A 3ON5A 1M7GA 3RZOJ 4RIEA 4PAQA 3DBLA 3LM8A 2GXQA 3FB1A 3MWDA 3HB1A 4DIEA 3CO0S 4JJIA 5EUCA 3H6HA 3NWTA 4ZTBA 3AEUB 1E6WA 2OUKA 2O9JA 1CJBA 4QO7A 1IBCA 1SOWA 5JEEA 1HLPA 1QJ4A 1SHTX 5TMBA 1ZRMA 2E2HJ 2BI8A 4INOA 5CFZA 3IKMB 2ZBEA 3FSJX 3IT1A 2JLCA 2Z3VA 4R1OA 3SD7A 3H4TA 4K6MA 1G3QA 4AMUA 5LMCA 5LQSA 3O3OB 3M6LA 4O8ZA 1S2OA 2GKGA 1TCAA 1DDIA 5EIHA 4YYEA 3QEJA 2VKVA 1XJ5A 1U81A 1X70A 4ZYWA 1HKQA 3G9ZA 1U0SY 5I47A 3LVRE 1OYIA 5FFMA 3ANLA 1ETOA 1HFEL 3BJIC 1ND6A 6ABPA 4NCHA 1WMDA 1Y6JA 1XJ0A 3FVWA 3PWKA 5TARA 4HC4A 2VK1A 2GEFA 3E7DA 5GIOE 1ZKGA 1R1DA 1GUZA 4D9EA 4YRBA 3OZCA 4UUSA 2XAGA 2O7VA 2WHXA 3LSYA 3KYCB 4G81A 4S1OA 4FFOA 5TE9A 3VV2A 2JDID 5BV7A 4MPDA 3LBFA 5BWNA 1YQAA 3H9UA 1E1NA 3WLOA 5FCDA 1DC7A 2WD9A 3QLVA 5J8CA 3FTQA 4D5FA 5ED4A 2XUIA 3BCUA 1B72A 2G17A 4AO7A 1JYEA 1UHWA 1Z7UA 2VH1A 2D4AA 2IDKA 1O3QA 3A28A 2GN2A 3BOQA 2LKXA 1LH0A 4M1MA 1X7YB 4MCIA 4H3VA 4BNIA 2NO6A 3ESDA 1GZSA 1NG9A 2O1WA 4HEJA 4INJA 2WY2D 2O8DA 2IELA 1HZZC 2ZTHA 1H3FA 4XBFA 1I5EA 4AI6A 4QM7A 4FDLA 2NTJA 4UBKA 1D03A 3BIJA 3GJ5A 4LJLA 2QB5A 4PFQA 3PHJA 4DARA 3AR8A 1YZNA 3DV0A 3RSZA 4DV4B 5AW0A 3RJMA 1OYVA 3NORA 3I6ZA 2ZRGA 3TVYA 2XRZA 4CN8A 5GADl 1BNCA 2JFNA 3RTDA 1UT6A 1SQSA 3J81A 1RWBA 4AQDA 1DKUA 4ZP1A 4O2LA 3PR1A 5I5EA 3B6MA 4RTKA 3H6KA 1PAUA 5KQPA 1RJWA 1Z08A 1G8YA 1GA4A 1X3LA 4PX5A 3TNDA