1QZZA

Crystal structure of aclacinomycin-10-hydroxylase (rdmb) in complex with s-adenosyl-l-methionine (sam)
Total Genus 111
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
111
sequence length
348
structure length
340
Chain Sequence
b'LEPTDQDLDVLLKNLGNLVTPMALRVAATLRLVDHLLAGADTLAGLADRTDTHPQALSRLVRHLTVVGVLEGGEKGRPLRPTRLGMLLADGHPAQQRAWLDLNGAVSHADLAFTGLLDVVRTGRPAYAGRYGRPFWEDLSADVALADSFDALMSCDEDLAYEAPADAYDWSAVRHVLDVGGGNGGMLAAIALRAPHLRGTLVELAGPAERARRRFADAGLADRVTVAEGDFFKPLPVTADVVLLSFVLLNWSDEDALTILRGCVRALEPGGRLLVLDRADRFFSTLLDLRMLTFMGGRVRTRDEVVDLAGSAGLALASERTSGSTTLPFDFSILEFTAVS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords aclacinomycin-10-hydroxylase
publication title Crystal Structure of Aclacinomycin-10-Hydroxylase, a S-Adenosyl-L-Methionine-dependent Methyltransferase Homolog Involved in Anthracycline Biosynthesis in Streptomyces purpurascens.
pubmed doi rcsb
source organism Streptomyces purpurascens
molecule tags Oxidoreductase, transferase
total genus 111
structure length 340
sequence length 348
ec nomenclature
pdb deposition date 2003-09-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00891 Methyltransf_2 O-methyltransferase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 1qzzA01
3.40.50.150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Vaccinia Virus protein VP39 1qzzA03
4LLGF 1JGSA 1G38A 4TV7A 2FBHA 1QAQA 1QYRA 2HYFA 5DEQA 3UJAA 3C18A 3E97A 2Q2EA 4KIFA 4P7FA 2IGTA 5K05A 2KIFA 4PNEA 5LRRA 3RDIA 2JHCA 3GRUA 3BGDA 2PN6A 2NP7A 4ENNA 4ER3A 2QVOA 3WG9A 3H2BA 1INLA 3KZZA 5K0JA 3OU7A 3KHKA 2KIMA 2EJUA 4HBLA 3ZMUA 5HILA 2PEXA 2KJCA 2STTA 1F9NA 4Y13A 3KEOA 2PI0A 2OPBA 5DCMA 3SX0A 3V7SA 2OZ6A 4HQMA 2V1UA 1M0EA 3LBYA 5EMLA 1VIDA 4WF2A 3C3WA 3HSRA 3RTRA 2V1DA 3L2CA 3B3JA 4RTJA 2DU9A 2P3LA 5IT3A 3CJRA 5K8VA 1QQIA 4KDCA 1ZGAA 3FTFA 4XLNF 3QOPA 2JZYA 2PBFA 1YFHA 4BHBA 3HOSA 1S6LA 2L4AA 3C6KA 3UJDA 4MIKA 3P9CA 2PXAA 5DM4A 1BI1A 4KDPA 1SQFA 3HCAA 4EMSA 4E30A 3EVGA 1LJ9A 2ETHA 4UNOA 4G7ZF 3O2PE 3WODF 3C1DA 1YZHA 5EHGA 3JTGA 3OCJA 3OZSA 3KCCA 3KPUA 3V7RA 5J6XA 2PV0A 2QYOA 4AVPA 3TO9A 4YV2A 2W57A 3QOWA 1G8SA 1ODDA 4A5NA 1IXSB 1H9GA 3RYPA 4D0PA 5LGNA 1VBFA 5KYGA 1U5TB 3SHFA 3VOEA 4WVLA 3LHDA 5L3DA 3OZTA 3KFWX 1P4AA 3EVBA 5EMJA 3WTWC 4IRHA 2NRAC 2EFPA 5HLIA 4L0ZB 2BR4A 3GRRA 5FWAA 3LDGA 1R74A 2GQQA 2P8JA 3MHTA 1V3FA 2AN5A 2ZBQA 3GIWA 2HTSA 1I6XA 2KJBA 3KLNA 4QVGA 2FBKA 4ZYDA 3KQVA 3BJ6A 1FYKA 10MHA 5JVTA 3MTIA 3THSA 2WA1A 3V4GA 4PINA 1ZG3A 1GHCA 1ULYA 2VDUE 4LECA 1O7FA 1R5GA 4HLYA 1XGNA 1LNWA 3WTXC 2YQZA 3HM2A 2C7RA 2GH1A 4U0VA 2EA4A 2JH9A 4CKBA 1DPUA 2IDJA 5DD8A 2XRNA 5MHTA 4L5IA 5BPIA 1M6YA 5DSXA 5D5UB 1OYIA 3FM5A 1O7LA 1ZH5A 2FHPA 4GBED 1IXRC 3NW9A 2Y48A 4M6XA 2IH5A 4KMUX 5K0CA 1P91A 4EJUA 3MGGA 5LQAA 3HHGA 1EG2A 3H92A 4EKIA 1XB4A 3R0AA 1Y0UA 3UZUA 4GO1A 2XIGA 4ZZLA 3P9NA 1XGMA 2G8NA 4CDGA 2LF8A 5EZSA 4FP9A 1UFKA 1IW7F 1JHHA 1IN5A 2QQAA 5HLHA 1XGSA 3I5UA 3DPLC 3O4FA 3MB5A 3HCFA 4PYKA 5FULA 4KN4X 4QQKA 2OBFA 4QLCU 2BM8A 1ON2A 1XCLA 4DMGA 2ZULA 1FSEA 1NE2A 5GM1A 3QP5A 4Y15A 3O7WA 3PTAA 1Z7UA 2A14A 2VDWA 3KP7A 1MHTA 2EFNA 3OU2A 4B8XA 3IL2A 2BE5F 5CM2Z 3ZMDA 3FTDA 3C3YA 3E7PA 5DX8A 5BQTA 4XCXA 2LKPA 2P8TA 3MWMA 1XTPA 1IN6A 2ESRA 1RI3A 4YV0A 4KN7X 2NNYA 5K01A 5ICFA 3I59A 1UWVA 2ZIFA 3CUOA 2PMUA 3HRTA 1FP1D 3OZRA 3ER8A 2UZ4A 3CJQA 4BP1A 4L9JA 1YB2A 1U6GA 1FWZA 1YS6A 3E5QA 3TM4A 2FMLA 1PUEE 1X19A 2Y1XA 1O54A 4PONA 2PX4A 4E31A 1T43A 3EVDA 5D6FA 4UVCA 3F4KA 4E2WA 3RPUA 2PBIA 1J5YA 7MHTA 2Z6QA 3HP7A 1JQDA 1TPYA 2QE6A 3U2RA 5D1NA 3TPZA 2LDUA 1NBIA 4I09A 2QY6A 3WGIA 3FPGA 3CDHA 4I01A 2A68F 2CO5A 3ABUA 3MFKA 4MQ4A 4PCQA 1RNLA 1QNTA 2GIVA 2A07F 2QM3A 3F8MA 3NDJA 1S3JA 1BI0A 2AN3A 3B5IA 2EFJA 2XAHA 5F2OA 4XSZF 4RX1A 3JTHA 5ED4A 2E1CA 3MQ0A 3EYYA 5TJJA 4U0WA 2GAFA 4OQEA 3BKXA 4HYEA 5HIIA 1KPHA 2QBYA 2IT0A 2VC0A 5IT9Z 2VOPA 1FSHA 2YUIA 3FPHA 3G2MA 2O07A 1H9TA 3W6KB 2IPXA 2EG5A 2VBXA 2RQPA 1B42A 4EJTA 4RAZA 3PQJA 3EVZA 1W7PB 2AOWA 5DM0A 2NNNA 3BWYA 1V39A 3V8KA 4RTSA 4OIOF 1PJZA 4LK1F 3GFLA 4BLWA 4XUDA 3HHHA 3A27A 2UXNA 2XVCA 4PYIA 4LLLA 4K6MA 5LHHA 3IHTA 3I58A 5J8FA 2JPCA 4LD5A 1L3CA 1R36A 1R1VA 3R9XB 2L3DA 4M9SA 2JSCA 4OMYA 4RGSA 1D8KA 4DM3A 5HOOA 4G94A 2MLKA 4L9VA 4YFKF 2ZIGA 1SVUA 4OMZA 4BHPA 5E8IA 2G71A 5DM2A 1Z05A 1OYYA 3UA4A 2HEOA 5D8KB 3C6MA 3DH0A 4OA5A 3X0DA 3BY6A 1UCRA 5E17F 1G3WA 4U0YA 3BZBA 2QZ8A 1KYZA 3RIEA 2ONYA 4FT4A 3UJ6A 1EIZA 2AOTA 2ISZA 3M8FA 1AOYA 2YU3A 3FZVA 4WXDA 4R79A 5LEKA 2AXLA 4LG0B 5K0NA 3GLXA 4M72A 2Z6AA 2IP2A 3VSEA 5DUKA 4PYNA 1XCBA 3KPWA 3FMQA 3RPQA 2AOUA 4YIFA 3DUWA 1B6AA 5D5VB 3HNRA 2VOOA 5CVIA 2A69F 2IW5A 1KPGA 5E1DA 1RJGA 3M1EA 3LCCA 3SXJA 1P4XA 2DT5A 2R3SA 2VS1A 4GOOD 1WXXA 3LQQA 4O5VA 4UXNA 5KVRA 3K1NA 3AAFA 2M45A 3DOUA 2ONZA 2OY0A 2GB4A 3FRIA 2DW4A 1YW8A 3P97A 2G7HA 3EDPA 1QANA 4GCVA 5CVVA 1NW5A 1TQPA 5C1IA 1JQEA 1FOKA 3R60A 3T5XA 2YX1A 3OE4A 4OQDA 1LDJA 3KP4A 4M73A 4ON0A 3B3GA 1KQ8A 2IFTA 2ZBPA 4EJOA 2K7LA 3V8LA 2ISYA 4E2YA 2GAUA 5TRDA 3WTZA 1N2XA 2IIPA 3G8AA 2XAJA 1F5TA 4GOMD 5D1HA 3VYWA 2X4HA 1HMYA 4UVAA 4S04A 4EM1A 3VFZA 1IY9A 2CFXA 2R7FA 4OOIA 1KQ9A 4L7VA 4LWPA 1IN7A 5ILSA 2A3SA 1G6Q1 2AN4A 1X3UA 4RVFA 3QAHA 2XYVA 5DX0A 2M1BA 2R6ZA 1I1SA 4LMYA 3VEPA 1XDZA 2DK8A 3R0JA 3O3KA 1JG2A 3BWMA 4RVDA 3CO6C 1VP3A 1R6AA 2P3QA 4UVBA 5L3EA 4GQBA 4FSDA 3G8BA 3I9FA 5HS8A 4EGZA 4CZZA 4ZYEA 3BUSA 1UHWA 2MH9A 5CUQA 1YQAA 1JXSA 2FU4A 2P6SA 1ZG5A 3M6XA 4HX8A 1XMAA 1I1NA 1JSZA 3CJTA 2BYVE 2P35A 4AIKA 4OBWA 2QQBA 2P5LC 2B78A 5KQRA 1E17A 2HGCA 2Z9OA 1YUBA 4YIIA 3M6UA 3LKZA 4HF2A 2XAFA 5HEKA 4XUCA 2PMHA 1HW2A 1RUNA 5BMZA 4A6DA 2WWYA 2IA2A 4M9ZA 2ZNYA 4V0RA 3LDFA 3HOTA 3TOSA 5H02A 1JHFA 2KRFA 3JWHA 3BGIA 1MD0A 2CW0F 4ER6A 2YPRA 4OIQF 1WWXA 1OMIA 1ONVA 3RODA 1G3YA 4FS8A 1LB2A 5L3FA 1B59A 1HW1A 1BOAA 2W25A 3A7EA 1BKYA 3T7SA 2VT3A 1W5SA 3PQKA 1YW7A 5CVJA 3KR1A 2FBIA 3KP5A 3BDDA 1R1UA 2OZVA 3KQWA 4RSRA 5GWXA 2ZWAA 5HS9A 2WA2A 4M37A 1FBSA 2P5KA 2FNAA 5ICGA 5KQSA 1T0FA 1YZ3A 1KU9A 1WY7A 2JPBA 1I9GA 3DXXA 3DXJF 4MQVA 4C4AA 3TFWA 2I9KA 3BXOA 1K78B 1WQ2A 4QDJA 1Z9CA 1P92A 2HMYB 5D4RA 4LGWA 3ELWA 1D5VA 2JHPA 2B2CA 5ERGB 4PYOA 4M38A 5LQUA 2BV6A 5DTMA 2UYHA 1SD4A 4QTUB 4PYMA 2L01A 2PT6A 2O03A 2GLUA 2DAOA 2FK7A 1Z3CA 3GRZA 2R7DA 4L9TA 5IT9K 4EJVA 2QENA 5LLQA 3K9TA 2LF7A 1O3SA 3H3UA 4PIPA 5LQCA 3PX2A 5FHRA 4I98B 2EFWA 5BS6A 3TQNA 3G73A 1AF7A 1KPIA 2NXNA 3PS9A 3T7RA 3UJ8A 4RVHA 2MH2A 1H0MA 2ZCWA 5GP1A 1DPRA 1YS7A 4KIBA 3ROUA 2NXJA 3ABTA 1SFEA 2EV0A 2LD4A 5K0EA 4B09A 3WE3A 3SFZA 2FSWA 3HVKA 3WTTC 5T67A 3QOXA 2P7IA 2Z99A 4IXAA 4P9FA 2PXCA 5CCBA 4LLNA 3M6VA 5C9ZA 2MD5A 4AZWA 4P9UA 2OA4A 3G2QA 3M8EA 4ER5A 4Y17A 2Y0MA 2C7QA 2E7XA 4P58A 1IUYA 3HSFA 2O57A 4AZSA 1Q0TA 2ZMEA 3FZGA 1USSA 3FUXA 4DCMA 3DV8A 3KP3A 5H20A 1ZN2A 3KR9A 2QWWA 2UYCA 3WGGA 2D45A 3KR0A 1TNSA 1WI9A 5DRYA 3JSOA 5E9QA 2MC3A 1HNNA 5P8WA 2GA9A 2I62A 1MJ9A 1EH6A 2CSOA 3FUTA 3LPMA 3DLCA 1KQ0A 3EEOA 4IKPA 2FCAA 1SKMA 4LG0A 3KPYA 5E2BA 1FX7A 1KGSA 5FD6A 1BHJA 2D1HA 1BI3A 1JTEA 3EVAA 4HTFB 5DXJA 4Q5SF 4E32A 2B25A 1YW9A 2RDPA 3MZHA 1GXPA 4CKCA 1STZA 3WTYC 4EM2A 1SAXA 4RGRA 1U8RA 5EZQA 3MQ2A 3T8TA 6PAXA 1KHHA 1SUSA 2OXTA 4GYGA 3HEMA 1R00A 5DPMA 5HDGA 3DP7A 1R18A 2ADMA 3KPVA 2I7CA 3J81Z 3T7TA 4U7BA 4Q4ZF 3DMGA 2PVCA 2PJPA 1LQ1A 3DXYA 2PQ8A 2YTZA 3UJCA 1TBXA 3T0IA 2XASA 1C0WA 5FFXA 1UFMA 5L3CA 5CVDA 4K2EA 4ZTBA 2OB1A 5ILUA 5FLXK 5M5BA 1NT2A 4RYLA 2GA2A 4IRGA 3SSOA 1NBHA 2WK1A 5HIKA 3BPXA 3FMSA 2XVAA 3KQSA 3HRUA 1G4DA 3THRA 4HZFA 3GGDA 3RI4A 1RZ4A 2K02A 3KE2A 1VP9A 3Q87B 1ZYRF 2IPQX 5T6BA 1AV6A 5DWQA 1ZAOA 2CQKA 2VC1A 4JXJA 2YX7A 2ZO4A 4L9NA 3CUQB 1DP7P 2O05A 4KVZA 3RKWA 5IH3A 5BW4A 2JH8A 2CWEA 4HGYA 2LNBA 3WU0A 2ZBKA 5HVQC 3RYRA 1RUOA 3QP6A 2V79A 4GXOA 5CLSA 5BOXA 3F8FA 4BQAA 4HC4A 5E2AA 3JAMZ 3QRFF 3NTVA 1TQMA 4V0QA 5DUIA 3I4PA 5B1SA 5DDGA 3HCDA 1Z6RA 5F1RA 1ZLKA 2WV0A 3GFIA 1SQGA 2N47A 3IKTA 3N97A 2OZUA 4KICA 1T98A 2WC2A 3UJ9A 2EX4A 5HIJA 3PLAE 3Q7EA 4U7PB 2IH4A 2P1DA 2FNPA 1TQIA 4EJWA 2JG3A 4BYYA 3M70A 3GZ5A 3GZ6A 2H00A 2STWA 4R1HA 2NXCA 1BN5A 1EH7A 2BR3A 3HA7A 1S8NA 2HKXA 1CF7A 2K4JA 2RV8A 3N4MA 3HTSB 1XXLA 3GJYA 1MDMA 2D2WA 2QQ9A 3GEZA 3P9KA 4ETSA 5EKXA 1IN4A 1ZARA 1IZ1A 2P4WA 5E1ZB 3MAGA 4MEYF 2HR1A 2BEOA 3BT7A 4DNCA 2HR3A 3BJOA 5EMKA 4YMGA 5FQOA 1FC3A 4CO8A 3P8ZA 1HSTA 3BP8A 1FZPB 2ZSUA 2VZ9A 2DK5A 3F6VA 3FTEA 5FB2A 2XGXA 2XAQA 3L09A 2DQLA 4HV6A 1R22A 4HRAA 2H27A 3U81A 4I2OA 1O9HA 3FXQA 5GINE 2BZGA 5E20A 1X1DA 4Q48A 1R1TA 2PLWA 3HCCA 1XGOA 4BAYA 4ESJA 3Q9SA 5LRSA 3KEQA 1BC7C 1WZNA 4WXCA 5FTWA 1ZLJA 3DQVC 1DUSA 3E6CC 5K03A 4A12A 3WE2A 1K78A 4G9YA 5H6QA 2MBFA 3E6MA 2IRFG 5FGMA 3HSEA 2O0YA 1SG9A 3NWBA 5LQJA 4PWYA 5DSTA 5GIPE 1NW6A 5GIOE 2AOXA 5FD5A 4EKGA 1NW8A 1U5TC 3HA3A 2E7WA 4R8SA 4CGZA 5EKUA 1BM9A 2Z3YA 2NS0A 2H94A 2Q41A 3HCEA 3DF8A 4FT2A 4C08A 5E1MA 5EC8A 1X1CA 1SFUA 1QPMA 1KYWA 2B3TA 2HKOA 5CCXA 4CWAA 5J8CA 3KZYA 3LAJA 2DPUA 1R8YA 1R58A 1XSXA 3NEUA 4N9HA 3E6DA 3GW2A 1I1GA 3WTSC 4AIHA 1L0OC 1P1BA 4RS8A 3UA3A 5CVRA 3AWIA 4DA4A 2YXDA 2E5WA 2ZLBA 4UHTA 1JR4A 1RI2A 4FX4A 5T64A 4AZVA 1S7AA 2FRXA 5FCDA 8MHTA 1T2KA 4PZJA 4PIMA 5EHIA 3HCBA 1R8XA 2FK8A 1DDNA 2OQRA 1FNNA 4N0BA 3F6OA 3LQRA 4MNUA 3SXYA 2JTVA 1B9MA 4RV9A 3ERCA 3FXRA 3LECA 2P7VB 3AY0A 3MZYA 4ATNA 4BP3A 4KFCA 3OV8A 4IHTA 4A0XA 4CXMA 1N7IA 2IH2A 2YXLA 1NV8A 3HIFA 1WS6A 4RTOA 1P1CA 3B73A 4FGZA 2YVLA 2OU2A 4CKEA 1MJFA 3KLOA 3SR4A 2QRVB 2F5CA 4RB1A 3COAC 2HWKA 3MAJA 4YUVA 1J7KA 1G3TA 5HIMA 1BI2A 1U3EM 1L3IA 3IEIA 3UFBA 3NVMB 2CG4A 4A5MA 4A6EA 5C0OE 3F72A 3D0SA 3ECOA 4KMFA 1JSXA 2PY6A 4LB6B 5LSAA 3HYIA 4XSXF 1ZRDA 1MKMA 4ASNA 2P5VA 2HWVA 2NXEA 3KQYA 1TTYA 3EUHA 1LDKB 2XHKA 1Z1DA 1TW3A 1IAWA 4G7HF 3FTCA 1F3LA 1QAOA 2GPYA 4UV8A 4AIJA 5H6RA 2PWPA 4FHTA 1OR8A 4GF5A 3J81K 1N7JA 3M4XA 1IN8A 4KNYA 2YX4A 1OPCA 1KP9A 1FY7A 3AJDA 3SSNA 5DCMB 2CGPA 3U1DA 1KXZA 2O8XA 2OQGA 2W84A 3D5LA 5E8RA 5DX1A 1U5TA 1R23A 2FXAA 3CBGA 2V9VA 3QPTA 3I0TA 4ENMA 4E2ZA 1ZGJA 5CYVA 3P2IA 4OA8A 4B17A 1XN7A 4XBFA 4L5JA 2HQNA 2CL5A 3GFJA 3M33A 2CYYA 2OAZA 2XYQA 3BJAA 2NAZA 4BNCA 2XVMA 4YFNF 4EGYA 3CLOA 2E1NA 3GX4X 5ERIA 3HVHA 3RKXA 5LHGA 4G7OF 4X61A 2VT2A 2PFBA 5DXAA 2GS9A 4DQ0A 1WSUA 3EQLF 5FFZA 2ZWVA 4RTQA 2B9EA 4RTRA 1RI5A 4HSGA 3FPJA 3REOA 4P7KA 3TM5A 4FZVA 3ELKA 4WX9A 3WGHA 4MWZA 3HTUA 2P3OA 1O3QA 4E2XA 1S29A 5FHQA 1IXKA 2P6TA 1YYVA 1WG8A 1RIOH 2X0LA 2PGXA 5F64A 3DMHA 1HXDA 3H3ZA 3FM3A 1YLFA 5L3GA 3GRYA 2RC4A 1QBJA 1FBQA 4ZYHA 2UZKA 4WWCA 3DXZA 4IRIA 5BXYA 3RKYA 3TMAA 4YG2F 3OPNA 1LVAA 3P9IA 2XBMA 1L3BA 1HW5A 3EMBA 1LEAA 3KQOA 4PCLA 1KU2A 5JR3A 3K0LA 1EJ6A 3RIRA 1S7OA 2FA5A 4LFUA 1EQAA 3P71T 3ANXA 2EWNA 2COMA 4KT5C 3A25A 4R05A 3K1PA 4ZZDA 3IRRA 1G6NA 2ZBRA 4OIPF 5EIWA 1YF3A 3PX3A 3TOAA 2JJQA 1OYWA 2MLGA 2OYRA 1PRYA 1X1AA 1WKMA 5HOQA 2QUFA 1MJBA 4RB0A 5HLGA 4GGGA 3FX3A 3CKKA 9MHTA 1YO5C 3LCVB 4H0NA 5K0GA 4GOND 3Q5FA 3OFJA 1KIAA 4LG1A 5A2QZ 1ZQ9A 4U88A 3LGAA 3I54A 5DV5A 4EK9A 4CHUA 3JWIA 3MERA 5LEJA 1DL5A 5FQNA 4R6WA 2QLZA 3BWGA 3ORHA 4YUZA 4KRGA 5E1XA 5L3BA 4CICA 2HQRA 2HOEA 3ELUA 4DZRA 4KDRA 3I64A 1O3RA 3E6BA 3EETA 4LJZF 2RN7A 4NECA 4NB5A 1AWCA 1I5ZA 2XKOA 4N9IA 3J80Z 2C6YA 3BGVA 4IV8A 3FPEA 2RKHA 1WRJA 4I0BA 5EPEA 3E5UA 1R7JA 4I7HA 4JQFA 3LKDA 4HF1A 2W85A 5EOVA 4AX8A 4M9XA 4EQQA 3ML6A 2ZZMA 5KS2A 3GYHX 5EMMA 2K86A 3OOPA 3TLJA 2XV4S 3WTUC 3ZN1A 1Y8CA 3HVIA 3FYDA 1YFLA 4GUAA 3NVKI 4G6QA 4RTLA 2EJRA 4CYDA 1QAMA 4A0ZA 5F2NA 2VN2A 4MTEA 1JE8A 2L4MA 1B4AA 2DI3A 5EIFA 2Y1WA 3LX6A 2IDKA 2CKDA 5E1BA 1EJ0A 4BY9E 2UXXA 4C06A 2KKOA 1J2XA 1B1BA 5KK1A 2V6CA 2PT9A 2VE9A 2EK5A 3F22A 4DF3A 2D1VA 3TQSA 3LL7A 1QZYA 4RTPA 3P2EA 1XDUA 2IA1A 2CMGA 1QO0D 2G7UA 3L9FA 3ZMVA 5LGUA 3PFHA 5DM1A 1W7PA 5DTRA 1AQJA 2ZZNA 3BWCA 1QGPA 4A0YA 1RI4A 1BOOA 3LDUA 3SVZA 1LDDA 4F84A 3IC7A 2DBBA 4HH4A 5DD4A 2OD5A 5EVJA 4ISCA 2PX5A 3V7CA 5JFRA 3FF5A 2RNJA 1M6EX 4GYIA 3E8SA 2L02A 1BC8C 2AVDA 4PYJA 3CTAA 4QPNA 3ULQB 4MEXF 4RTKA 2JRTA 4U7TB 3DPTA 4FSXA 5FA8A 3DKWA 2P7HA 4FR0A 4RGUA 1OR7A 1KR5A 2EFOA 2QBYB 1EAMA 3A7DA 4C04A 3NRVA 4ER0A 3T8RA 1V4RA 2A5YB 5DTQA 4KUMA 4OBXA 3CC8A 2OBPA 3GVAA 4L0YB 1BIBA 4OINF 2ORED 1MZBA 1RJEA 3G88A 2PLYA 2FOKA 3E23A 3PB3A 1RI1A 2O6GE 1HSJA 3ME5A 4HV5A 2G72A 3G89A 1D3YA 4I02A 4BLVA 3BPVA 2BGCA 5LQNA 3AXTA 3WSTA 2B0LA 2ZW9A 4BLUA 3IV6A 2ZIEA 3OFKA 2WTEA 3KQMA 3I53A 3DEUA 1JTFA 2RVCA 5BW5A 2HZTA 2YR2A 2HFHA 2NYXA 4P55A 4ZYGA 3G2PA 3EEYA 1VQ1A 2F5DA 1I4WA 1BBYA 2Q8KA 4R8HA 3RW9A 5AIQA 4M36A 2DPMA 3F23A 4M74A 4QQNA 1FJXA 5G02A 3SGLA 2J5PA 2EB7A 3L7WA 3TOBA 5K1YA 3L00A 3B7PA 2YR0A 4FT8A 2M8EA 3M7GA 1FT9A 2XKPA 2AOTB 2XAGA 2ZNZA 3LA2A 2BM9A 1VTNC 3F3XA 4R8RA 1L9KA 3BKWA 1RJFA 4RTMA 1FPQA 1Q1HA 3SQNA 4EV0A 3CJNA 1CGPA 3CCFA 2J5OA 4MHTA 4X63A 1T39A 2TDXA 3F8CA 3UJ7A 3F21A 4LK0F 3NDIA 2AOUB 2H6CA 5AIPA 4YFXF 4NHJA 4G56A 4HG2A 4GC9A 2HTJA 4EM0B 2P40A 2C7OA 4DKJA 3MCTA 1NV9A 2Z5UA 5FADA 2IJLA 3C3PA 4XUEA 3V8JA 1HQCA 1SMYF 1JQ3A 4LWOA 4POOA 3V97A 2GZWA 1ZG1A 3LAPA 3R0QA 2EJTA 2PX8A 3P2KA 1UHMA 1VPTA 3KQPA 5LGTA 1RJDA 3GFMA 1BJAA 4HLXA 2HV9A 3KP6A 3JW4A 1BIAA 3B3FA 4PYLA 3F8NA 3SM3A 2YXEA 1TLHB 4JK1X 3R6TA 3RJPA 5E9WA 4ENKA 4Y2HA 4HGZA 2F5FA 2GXBA 1HBXG 3KQQA 5K0FA 2FQ3A 5ILVA 4HDVA 5EG5A 1YTYA 1NKVA 5ICCA 3IRQA 2A6HF 1P4WA 4OIRF 5U4XA 2OKCA 3QU6A 1T38A 3IWFA 1O9GA 2M5WA 2ERCA 5K0BA 4P7JA 4GEKA 4R6XA 3LWFA 2FYTA 4QDKA 1FBUA 1SD5A 5HZMA 5A2QK 4HX7A 2H09A 1KU7A 2ZKZA 3TDZC 2ESHA 3B02A 3GF2A 1QZZA 1XD7A 2AZTA 3PVCA 2DFIA 3FWEA 1XVAA 1D2CA 3TDUC 2VBYA 2FRHA 1OKRA 1JG1A 1FBNA 3R3HA 2IBSA 2YSRA 1U2WA 3SZTA 5CVUA 4HX4A 4QTTB 3EVFA 2ADUA 2Q0OA 4CTJA 3G3ZA 2K27A 3GXOA 4C03A 1O3TA 1USTA 2ZJ2A 3U9GA 3J80K 4Y30A 2L54A 2H1RA 3ELDA 4G8XA 1ZREA 3TKYA 3BROA 5LHIA 1P6RA 4HA8A 3ELYA 5D5WB 4KIGA 2HTEA 1D2HA 4GC5A 4QWQA 1RI7A 3WTVC 4BH9A 2O0LA 3ID6C 3EGIA 5ICEA 1D2GA 1AQIA 3KP2A 2V7EA 2MA3A 3K69A 2F2EA 2W24A 1F4KA 2PXXA 2FE3A 4IF4A 3FUVA 1EH8A 2HDCA 2P41A 4UOEA 3K6RA 1B9NA 3FMRA 4PDKA 1GVJA 5EGSA 3MEXA 1FP2A 2G9WA 4IHSA 2HNKA 4AUKA 1YFJA 4IPAA 2G1PA 3HVJA 1XJ5A 2BH2A 5HS7A 3FUWA 5DT2A 3JSPA 2V1XA 3FYCA 3TRKA 2VDVE 1SFXA 2BBYA 1ON1A 1R5HA 1L3LA 3Q9VA 3HRMA 4PYQA 5JI6A 4XLPF 1VLMA 4F85A 1KU3A 5E8JA 3CUQC 1GXQA 3I71A 4M71A 2GA1A 1MGTA 3TO7A 2ZVJA 2Z33A 3R6SA 3FHZA 1EV7A 5E1WA 1HKQA 3KPJA 3ZPLA 3IWZA 3ZP5A 3ERED 4YUWA 1PP8F 1SUIA 3D2LA 3ZMTA 4DCGA 4MQ9F 3ZMSA 3A4TA 5IKMA 4XRFA 4AZTA 1T6SA 1YG2A 2A6EF 4X60A 1U2ZA 2O06A 1J0RA 3LFKA 3UWPA 5EEGA 2EA2A 5D8LB 2ZTHA 4L18B 4KW7A 2ZFUA 4CXFA 4NQWA 2F5EA 1J59A 1DCTA 4EVIA 2A61A 4P7GA 4CTKA 3VODA 3FUUA 1ZHFA 3BWBA 4QPPA 4G6DA 3W6JB 4FX0A 4PCAA 3NWEA 5FWDA 3VB2A 3KU1A 3PT9A 3LSTA 4KWCA 2KW5A 1VL5A 2PSSA 5LR6A 4M6YA 5FUBA 4P5OA 3O6BB 3FPFA 1IM8A 3VC1A 1XDSA 3OU6A 3GNLA 2JHAA 4HTFA 4IV0A 1F38A 1LEBA 4HAMA 2ELHA 3DFGA 4RAYA 2VONA 3JWGA 4UV9A 2Y75A 1VE3A 3EPPA 5K5RA 1WXWA 2ZMEB 3ER9A 2ZZKA 2G70A 1E2XA 1X1BA 2DO7A 3EVEA 3KQTA 1IXCA 3JWJA 3DULA 4IJAA 2ZCJA 3E3VA 2CWWA 3GRVA 4O3MA 1H1DA 2VBZA 2VODA 2AS0A 3G5LA 3NMUF 1UIRA 1HKSA 4RTNA 4RVGA 5BP7A 5LQKA 4LB5A 4MHGA 3F8BA 4ER7A 4P96A 2DTRA 4E70A 3PFGA 1F1ZA 3BOQA 3HRSA 3CGGA 1J9IA 2P7CB 4KYWA 2FPOA 3LA3A 5AONA 3DR5A 4AD9A 3V8VA 5BPDA 2LSOA 2IVMA 1BC5A 3E05A 4DQ2A 5E18F 5HDNA 2M30A 3CUQA 3C7JA 3L8DA 1I27A 3DMFA 4QVKA 5K09A 4RB2C 4UUVA 1FLIA 2EFQA 2NNWB 3EVCA 4WXHA 1A04A 3J7AO 4RGXA 3P7NA 3KETA 3O31A 5CIYA 1PDNC 2AVNA 2NYUA 2PG4A 3AXSA 2PKWA 2DULA 4U7DA 5FLXZ 5DRTA 4MGRA 1W7PD 2OB2A 3JAMK 4A2UA 3SMQA 4YMHA 3TR6A 3B89A 4X1OA 4YV1A 1Q0SA 2FMYA 3ZQ7A 3VC2A 3GO4A 5E9JA 5HFJA 1NHAA 1XCJA 3K0BA 3T1BA 3QU3A 2O3FA 4IWNA 5CVEA 4PGHA 4HW0A 5E8GA 1NW7A 4C07A 4YUXA 2M87A 4RWZA 1NW3A 3CVOA 3IKVA 3S68A 2JT1A 3GWZA 4RB3C 3G2OA 1TW2A 3IHUA 5EEHA 2DPDA 4BXUA 5E1OA 2BR5A 2UWMA 1ORHA 3ZMZA 2RGVA 3G7UA 3HUGA 5LBQA 2FEZA 2XROA 1SD7A 3PFIA 1J75A 5K5OA 3C0KA 1XSDA 3LA7A 5FO5A 5D5XB 2ESNA 3DTNA 5D4SA 3KR2A 2H11A 4HOBA 3E5XA 4F86A 3LBFA 1REPC 4AWXB 3T0YA 3EGVA 5EQJB 2XYRA 3FXUA 1MJAA 4OU0A 4ZH4F 1Z91A 4YUYA 2DQRA 3R61A 3EGEA 1W4MA 3K2ZA 3CO7C 5CJ9A 2PWYA 1XMKA 3UBTA 2UYQA 1KA8A 2EV5A 1UB9A 1O57A 3R4KA 3EMDA 4EQZA 1TNTA 4S05A 4BHCA 1CF7B 2ZFWA 3M6WA 2KIUA 4HQEA 2Z6UA 3ECHA 2AOVA 1JG4A 4IVNA 2VXZA 1MDMB 4GOLD 5K5QA 3WU1B 2EV6A 4X41A 4HF0A 3QV2A 1Z6TA 5JUWA 3SZPA 5F2KA 2UYOA 1K6OA 4ESBA 4ENJA 2IA0A 2IBTA 2ZXJA 4KA4A 1DUXC 2GWRA 4ESFA 2F8LA 2V74B 4O6JA 2NP6A 3TO6A 1P2FA 2K4BA 1G8AA 2VBWA 3R24A 3I59B 3ISPA 5D6EA 2GXGA 1K79A 4OX9Y 1IRGA 2AR0A 2VE8A 3NJRA 4MTLA 4HDUA 2HS5A 3MCZA 2AS5F 5LQRA 1L1EA 1SD6A 3DLIA 4H0EA 3LCUA 2VP3A 3UJBA 5DCFA 3NQOA 3GUDA 4Z2YA 3QPHA 2ACJA 1ORIA 5FA5A 3M9AA 4PGGA 5DLYA 4C05A 1G55A 2OO3A 3EYIA 1W5TA 3MTEA 5K0LA 5KVAA 2DLLA 5GOZA 4MTDA 2XUBA 4I0AA 3TKAA 3G5TA 1G3SA 1ZRCA 3FRHA 3KKZA 4Q47A 3IYLW 3OE5A 1IRFA 1XCVA 3GDHA 3GCZA 3BZ6A 5HDKA 1P39A 3GU3A 4M7RA 3HTXA 2FF4A 2K4MA 2O61A 4F7ZA 2C7PA 3A26A 3SSMA 1K7AA 3GO5A 5JHUA 3HA5A 2I6GA 2PJDA 1PP7U 2CMHA 5F6FA 5GM2A 1XSVA 2H6BA 3ZN0A 1FYMA 1D8JA 1HKTA 1ZRFA 1FYLA 1YIOA 5DYMA 2PX2A 4O29A 1JG3A 2QRVA 2HYGD 4E33A 3S2WA 4WK8F 1IF1A 1G60A 5CD1A 3TGNA 4WCGA 4JBAA 3K1MA 1SMTA 1ZKDA 1U78A
chains in the Genus database with same CATH superfamily
4LLGF 3QVMA 5DTEA 5E3OA 4XIGS 4INZA 2H5EA 5DEQA 3B3QA 2D1FA 1IZZA 3R3SA 3E97A 2C78A 3N76A 3VSAA 5CYFA 1IK6A 2M9HA 4IMPA 4BQPA 4IP0A 3VNAA 1R0BA 3SHWA 3SNHA 2ZRJA 4ZYWA 5HILA 1MH1A 2PI0A 2ZUEA 4B83A 3QPAA 4D8UA 1M0EA 4KXNA 1N2CA 1KZ7B 2FEOA 1MKYA 4EJMA 1HZZA 3UKJA 5CPRB 1P7WA 3CMAI 1NVAA 5KDLA 4G65A 2QXUA 1RKWA 1S2MA 1ZGGA 3EQ9A 4UNOA 4A5SA 4HP8A 3USCS 3DV2A 2ZRAA 4BJ1A 1DLIA 1PK9A 1RTKA 2R4QA 2XIJA 1BQEA 3NVDA 3TVYA 2PV0A 4OJTA 2OBLA 4OWRB 1SVIA 4RMNA 1YU6A 3BD7A 4RHYA 4DJTA 1BKDR 1R0KA 2HTSA 1E3JA 1ETKA 3O4VA 3OZUA 3FROA 1B1AA 4X6AJ 4UCWA 1V47A 1G4AE 3PSFA 4F55A 2EV9A 5AR1A 3HM2A 5EJ5A 2QW0X 2VRBA 2XNDD 2VPZA 1I3AA 1R8QA 2VAVA 2VYFA 4QUDA 1JLRA 1XIVA 1UBKS 2PA3A 3QFRA 5AH0A 2O5VA 5K0CA 1P91A 4LCEA 1PS0A 2PVPA 3NWPA 1T6YA 3D4NA 3D7NA 3TZEA 1PO7A 1W6RA 2ZU0C 1TLLA 4NU6A 3PF9A 2PS0A 4YELA 3OZAA 1VE1A 1DBWA 5GM1A 3HY3A 1USWA 5E3LA 4D8YA 3KP7A 2P78A 4FFOA 1B8IB 4R1MA 3WGLA 1H2BA 1QFXA 4B8YA 2XGEA 1JWLA 2IE0A 1RI3A 3AU8A 5ICFA 3EYAA 1W4RA 4UY8I 3JZFA 3CJQA 2EXXA 3GLLA 2FMLA 3OQNA 3EVDA 2ZT8A 3Q2KA 3HP7A 4BVFA 1KP2A 3TPZA 4XDGA 5CBKA 3P9SA 3T1VA 1KRHA 1YAJA 4PQGA 3ADPA 1TEVA 4ZVMA 1MG5A 2WYWA 4YBRA 4PCQA 1I2ZA 1Y82A 1A71A 2QM3A 3H3JA 5HZGA 2HA7A 4XSZF 4HAYA 4A82A 3K3PA 2L82A 4Q3OA 4MR9B 1Y1LA 1EHCA 5HIIA 5FEMA 1KPHA 2QBYA 1AA6A 1FSHA 5LVAA 2X5OA 3G2MA 4HT3B 1A77A 2V6JA 4RLQA 1FXUA 3TTYA 3RAEC 3NM6B 3WE7A 4WK2B 3UUWA 4L0CA 5FA6A 2V6IA 1AQLA 5CGZA 4DCVA 1S8AA 5C7YA 4BV8A 3GFLA 3JQFC 1YIAA 4PAWA 3OOHA 1Y9ZA 4RVCA 4OHUA 3MVEA 4IZOA 2IYRA 2FFBA 4MZXA 1HDCA 4WDQA 2LD5A 1Q16A 1PR6A 1W5BA 1W59A 2Q2QA 4BHPA 2HO5A 1B6RA 1CUCA 1U2SA 2Y0SN 4DV5B 2NU7A 2W37A 3EFEA 1RHJA 3V2GA 2C4HA 3TOCA 3Q3HA 3DE6X 4PX2A 1ZSVA 1T6NA 1E92A 4D56A 5EPUA 4F8JA 5D5VB 2VJKA 3I2IA 2IW5A 1V5IA 5SZJA 3EXEB 4G41A 1XA4A 1P4XA 2DT5A 2V55B 4C89A 4ZT7A 4N48A 3GT3A 4QULA 1TGVA 2CYAA 2LH9A 1NP6A 4KMSA 1PZNA 3C39A 1UEXC 4UXHA 1T0FC 3ABRB 4NBRA 1FOKA 3T5XA 3OICA 3RVQA 1HDPA 2R84A 4TM7A 3PD0A 1W46A 3B3GA 3NAZA 4JDPA 5ANRB 1IVSA 5TRDA 3BTSA 5L6LB 2FX0A 1QLJA 3QENA 5L95A 4OMCA 1HMYA 4PYRA 3UHOA 3QHQA 4J4TA 2Z43A 3C41J 3WIEA 2QTLA 2A3SA 1GPLA 4MO7A 5DX0A 1PG5A 4O0LA 1XDZA 3DDZX 2J6HA 4J01A 1SCQA 5L3ZA 5GPAA 5CUQA 3ZGOA 1JXSA 3S2YA 1ZG5A 5JH7A 1GPH1 2QQBA 2HGCA 3HOYJ 3M6UA 2ZIWB 2NACA 1U9OA 3IEVA 3MTGA 5BMZA 5C52B 1DC8A 1H42A 1RSZA 4DABA 1HL3A 3VSKA 5TQ0B 3RRYA 3ZQ6A 1NC3A 4FS8A 5L3FA 5AI4A 1U3CA 5HTOA 4OH7A 2OCEA 1W5SA 4DLKA 3KOWA 3HZZA 1RYYA 4NMHA 2ELJA 4CYMA 3P19A 4UMEA 1R12A 2Y6VA 2BFEB 4O63O 1DKNA 1Z9CA 2M1XA 4H3HB 1XU7A 3I76A 3CDLA 1YJWI 1Z7BA 4PZDA 1EDDA 2DXIA 2DFDA 1V95A 3HLTA 3LT4A 2N42A 4PG6A 4L9TA 3D6UA 4A4DA 4CCMA 5EE1A 3E3LA 4A2CA 1KPIA 1KI1A 2YNMD 3ITNA 4IR7A 1FMVA 3HLYA 1DPRA 3D4BA 2BKEA 2GSDA 2AXPA 2Z58A 4IIEA 2ILVA 1QRSA 2VL8A 4JB0A 3BIOA 3GJ5A 1ZZEA 4JSTA 5G1NA 4LLNA 4M1OA 5C9ZA 1JEDA 4OATA 1L5VA 1F8UA 1U2PA 3G2QA 4W5JA 2E7XA 1IUYA 3N59A 5JWRA 2YJ5A 4UU0A 4AJPA 4D5GA 3TR0A 4DCMA 1P0IA 9LDTA 3CT6A 2W8BB 4G0NA 5DRYA 1NW9B 5E9QA 3DGFC 4ZANA 5A5DA 2VWQA 2GA9A 1MPXA 4NXMB 3WJ7A 3WHBA 4YRZA 2WIBA 4AY2A 3RG8A 3FAKA 4IKPA 4UARA 2D1HA 3OZGA 4HTFB 2W2NA 2RDPA 4BNHA 2YWXA 4JR0A 2OR3A 4MUAA 1V8FA 3HY6A 3DP7A 3F0CA 4HH1A 1DP4A 2J41A 2RKWA 2O2EA 3G2IA 5DB4A 3LP8A 2WIGA 2WWGA 4HNGA 1TYZA 3R3VA 4B4VA 2E4XA 5L3CA 1V7ZA 1W4CA 2EFGA 5DWVA 2XADA 1NT2A 4RYLA 1EUZA 7GPBA 2FMFA 2GA2A 2H1OA 1QP8A 1V37A 4NOKA 3ZY2A 3HRUA 3EXAA 4B35A 4Y2UA 3KZXA 4FBGA 3NV7A 3SLGA 5DWQA 4U0JA 4LITA 4K46A 2O05A 1S7CA 4K9QA 1OWLA 3TP3A 2AFVA 3TLXA 1N92A 1SUEA 3QLUC 3ZWNA 4ZCQA 3RYCB 2EHDA 5HVQC 4NYIQ 3T61A 3KT8A 3E5MA 2ZU6A 4K9SA 3V4PB 2R60A 3LH5A 1J33A 4G24A 3HCDA 5MDHA 1Z6RA 3HB1A 5C44J 3LVBA 4JLJA 5CLHA 1CF2O 1ORKA 1IWPB 5IAKA 1J06A 4GP6A 3UJ9A 4RAFA 3PLAE 4M2LA 4F5ZA 3D3WB 2JG3A 3PCTA 2STWA 5IYZA 3CF4A 3MJCA 3OZEA 2KLHA 4UUSA 1ZITA 2RV8A 3BRQA 4JT2A 1S72I 4HQ6A 1ZARA 2P4WA 4N4OB 4AZ0A 1EHIA 2SCUB 2QW8A 5EMNA 4FLEA 5EHXA 3LT0A 4DIDA 1C80A 2Y0EA 1TADA 3A1VA 1IVNA 5JNTA 5TB5A 2G88A 1ETWA 1W9HA 2D0OB 3U81A 1MAAA 1Q19A 4EFLA 1I2AA 3L8YA 1R1TA 3Q9SA 2H51A 4JXZA 1II8A 5FTWA 2Q0HA 2AE2A 3IURA 5AD1A 2GJKA 1A6QA 1SG9A 4C6SA 2IXEA 5LQJA 5GIPE 1S02A 3B9BA 3WGNA 2C2BA 2Q4DA 1FFXB 1DCFA 3GFOA 4TYPA 3TNFA 3TGWA 3DF8A 3L04A 1VQKI 3QF4B 1GYPA 3L41A 1YBVA 4JXKA 5GADJ 4Z8YA 1W1WA 2GM5A 4HGRA 2XNHA 1RYZA 4RS8A 3V46A 2ZYUX 4A6PA 3RVDA 2YXDA 3L7KA 2LVBA 5EUQB 3BCHA 4MR8A 1Z28A 1P5JA 5T64A 4GPIB 5FBRB 4LWQA 2WC1A 2FK8A 1XYGA 5A03A 4NK5A 5BN4A 2O8DA 1BDHA 2YRXA 2RBGA 5AICA 5DYGA 3AY0A 1R6TA 3HGTA 3ZZNA 3DYBA 2JAHA 4G3XA 4X20A 4XNFA 3DE4X 2B8JA 4JUCA 1X58A 2J0QA 4YUAA 1F1JA 1U2RA 3TB6A 2Y76A 4RF4A 3W3CA 3COAC 2F9MA 1CVRA 4JI1B 3BB4A 3T5TA 1Z36A 2Q3DA 1YE3A 4QM6A 1OCPA 1U80A 1LFAA 4XSXF 5K99A 1SIWA 1ARZA 3PDIB 1G9XA 4BZZA 2ACEA 3BB3A 4PO3X 1KY5A 1H2XA 3ZLBA 4AQYB 1YZQA 3S1QJ 1IN8A 5CB6A 4CR7A 1BXGA 2CHQA 3DEIA 3ECAA 1U5TA 3QPTA 1X7GA 1K6XA 3GRPA 5JLWA 3OL3A 5C4IA 1SXJA 2QVBA 2HQNA 2CBXA 5SICE 1OW3B 1Q7RA 1CVIA 1KQ3A 3MBOA 2HLNA 3HDHA 5IUKC 3TSOA 1HDEA 1O03A 3D1JA 4IIGA 4YRKA 1Y3DE 3D0QA 5FYDA 4PSUA 4Q37A 3SJUA 1A35A 1KY2A 1Q22A 4CODB 3HJCA 1TCUA 1J0EA 1PI3A 1NDUA 3HTUA 2WD8A 4I08A 3NM5A 1IXKA 1KHTA 2MFZA 4KIWA 5CH3A 1YLFA 1SC7A 3CTMA 4OJNA 5M5WJ 3GZ4A 2P5UA 1TTHA 4MGKR 2J87A 1SUWA 4WWCA 1EH5A 1GKIA 4LMRA 2NGRA 1LVAA 3F67A 3NWSA 3KQOA 2ZSDA 3RIRA 2DDAA 3H42B 3H5LA 1J00A 5T6MA 3IRRA 2JI9A 1IHXA 3N2IA 5EIWA 4G0ZA 3VTKA 1KJ9A 1NNUA 1X1AA 2QUFA 1FFSA 3EBPA 1B23P 3FX3A 4YRLA 9MHTA 1MXHA 4QUEA 1U5CA 4K9LA 2DBRA 4R6WA 3BWGA 4YRPA 3E7WA 2WOJA 2DFVA 2GCOB 3O4JA 1AWCA 4MQ5A 1WBJB 2Z98A 5CDHA 2VJNA 4JJFA 4I7HA 1NI5A 2NVOA 2ZJOA 3D0RA 4QDUA 4ZFNA 3WTCA 4HEHA 3HVIA 3FYDA 3OQBA 4N5LA 1P3Y1 4J0IA 1QTQA 1RRMA 3VQTA 5CXXA 4UPVA 4LOKA 1G63A 4M0LA 4KUGA 3Q8LA 4KSCA 5CDTA 2I2WA 3PHIA 2XXAB 3FNBA 3PNTA 4JOMA 4FE4A 2VE9A 4CLOA 4TS9A 1U7WA 3AL0C 2X5XA 3FMOB 1BHQ1 3OIDA 3LF1A 3P2EA 4A3FJ 1CUZA 1SNYA 5AO9A 4KLRA 1CIPA 5DM1A 3J7TA 2J4FA 1K86A 5H3LA 3FNRA 1DFIA 2NOAA 4DTCA 3QH4A 4H1HA 4YO8A 5FP0A 2D2XA 5JFRA 3BEDA 5AJYA 2FPMA 4BU2A 1LNSA 3BDIA 4QVIA 1OLXA 4HEA6 5F7OA 1K89A 4FC7A 2K2WA 1W36C 3DVSX 2YJTD 4JL6A 1XRSB 4YV7A 3NJ4A 3WRXC 4L0YB 4ZGBA 1BIBA 1J42A 3E23A 4DXHA 2DSTA 3NTRA 4LJAA 2C3UA 2AHRA 1ENZA 4RGQA 3GP5A 2R5YA 2WWTA 4REMA 5LQNA 1AHNA 4EUFA 1C7ZA 3KQMA 2VL7A 2FLVA 3OFND 1JTFA 2XVXA 2HFHA 4P55A 5D3KA 3WQSB 3CLUC 3TN7A 4QEKA 3WZLA 1VQ1A 3BN3A 4EUKA 2GDJA 2F5DA 5EWMB 4G0WA 1GDHA 1W85B 3WK6A 4OYHA 4LGMA 3T9BA 2Q4OA 4KQEA 1M8PA 1OLOA 5K1YA 2M6SA 1Y3HA 4CR6A 1ZK2A 4MW6A 4ND8B 1EPUA 1T39A 3PPYA 3AM3A 1ORTA 3C5CA 2JIRA 2CS3A 3DNPA 4AYBN 3ETJA 4GC9A 2CLHB 4JBYA 4UDNA 4ITUA 3PD1A 2FUNB 1DG9A 3ZHOA 5FTNA 2P2NA 1HRDA 1ZXBA 3FOZA 4CEHB 1XTZA 4MQLA 1B3BA 3JY6A 5LGTA 1KKMA 1BIAA 3VNQA 1EBFA 3PDJA 2QD1A 2O7OA 4M0DA 3VSLA 1BGXT 2X1HA 1VXOA 2HF9A 1SC6A 1FS6A 3OZXA 5BUQA 2PUAA 2L0KA 2J3KA 1NBEA 3P9RA 2FQ3A 3EMVA 1YTYA 5KNBH 3QU6A 4Y2SA 5E4YA 3MWEA 5JAIA 1NVTA 1DUIA 3LWFA 2A1TR 1VL2A 2FFRA 5EP3A 5A2QK 3NHUA 2H09A 1OF1A 2VJ4A 4R3WA 2QLTA 3PC3A 3SX4A 1FU8A 1XQ6A 4HX4A 4MMXB 3UXYA 1YBAA 5B12A 3DDSA 1RCFA 5FWNA 5IT4A 2XEDA 4HA8A 3GRAA 2BXZA 2HTEA 5IC5A 1D2HA 4ESOA 4ECAA 4HHEA 2HVSA 1R0WA 3EGIA 1JR2A 3ABLH 5B7GA 1LW6E 1S7GA 3UMVA 4IF4A 4N76A 3ASUA 1EDZA 3S2FA 4L4SA 4N5MA 2A0YA 3G6EI 3GD7A 3BDVA 1H9BA 4FE7A 2ZCUA 4IDCA 1IDZA 1VG9B 2FUG6 1NMXA 2YVKA 5DT2A 4L8YA 1Q91A 3TJMA 4IDAA 1MQAA 1YB7A 2PIDA 1CS4C 1UUFA 4EPWA 4AY4A 3FF1A 5JI6A 3ILYA 4D9KA 2NUTA 3CUQC 2FPLA 4QLBA 2OLKA 3O8GA 3B51X 4EUNA 5D5PA 5E1WA 4PHGA 3ZP5A 1EM6A 3NPAA 4NL4H 3K4PA 1Q57A 4XRFA 3WIOA 1Z2AA 1J0RA 2YZKA 2XMSA 4L18B 4DEYA 1N3IA 5MGNA 1UIMA 2ZCVA 2CXSA 3N28A 4EFKA 5TNXA 4M3GA 4FCVA 3RC9A 4XLAA 1ADYA 1FFDA 3EUFA 1PW5A 2QRPA 2FDXA 5A71A 3Q0IA 4XIIA 1NY6A 4YIKA 4KXUA 1XDSA 2BY2A 3E22A 4XWOA 1BXRA 1W0JD 2WT9A 3VR4D 1DC7A 5HKLA 5JY1A 5CKTA 2VHVA 1XZLA 3CINA 2W2MA 2ZCJA 3FI9A 2XXJA 3GRVA 2VBZA 1GDDA 3VPFA 2VXBA 4BNYA 4B6SA 3CCEI 2EGHA 4RVGA 2DHEA 4ER7A 3PE3A 1VI6A 3USZA 3D5TA 3DR5A 1EK5A 1B72A 1JG7A 5BN5B 2BEUA 4MROA 4LXHA 1PT6A 5AXBA 2Z2JA 1ULBA 3GEDA 1A5SB 1V4BA 2D7DA 1RQXA 5JQGB 1CUFA 1NP3A 2BM1A 1E94E 4YV1A 5A7FA 4EY8A 3ZE6A 3RIGA 4ICIA 1ZUD1 3IXMA 4PGHA 1RZ3A 2M87A 3ML1A 3NHFA 4QO7A 4NZ9A 3HUUA 2JT1A 2LREA 2HQ1A 1LDYA 1PGJA 5E1OA 1HT0A 1WKBA 5LBQA 5TEWA 3AZQA 4UQPA 2B7LA 3Q2OA 4LJ4A 3NOXA 4Q21A 1Z4PX 3W3AA 2XYRA 5JS2A 1LCIA 5IJ9A 3BLYA 4WOBA 5CYPA 3RU7A 4Q3EA 4IHKA 4MWCA 1YNOA 2H9YA 1F48A 4P3NA 9GPBA 4JI3B 3V5NA 1O57A 5M5YJ 5ALTA 1XTIA 2I1QA 2VXZA 2ZRHA 4HF0A 3QV2A 4CUJA 1K6JA 4ENJA 4TSKA 3L49A 2CJPA 3RS5A 5KTPA 1FNCA 2K4BA 2RGRA 3QX7A 1UXGA 5C3EJ 3E2PA 4BV9A 1M2VA 2AR0A 2JIMA 2PMFA 1L1EA 3DLIA 2VP3A 3J81k 4D9BA 4UNNA 3AP2A 1M74A 2C8KA 2VHQA 2XWJI 4R4JA 5K0LA 5DGHA 3WL7A 2UXCB 4IH1A 3TQRA 1EYZA 4FYIA 1PS8A 1OLSA 1X1PA 3CEMA 2O3QA 2CE7A 2BE7A 5JBIA 4MGHA 1LBEA 4KO8A 3EGCA 3U1KA 1TJ3A 1XSVA 2I5PO 2H6BA 4C0HA 2VATA 3MSXA 4JVLA 2Y0CA 4G5GA 1ZXXA 2H1IA 4Y18A 5DU2A 4E7LA 1TWHJ 3IIJA 2ZYHA 2FBHA 4DREA 1P7VA 2O3SA 4MI6A 4Q03A 1DC4A 3ZZMA 4DQVA 5K05A 4F0JA 4PNEA 3AEQA 1YITI 1TZMA 3GRUA 4E14A 4IJ6A 5AW6A 2QVOA 4RC9A 4ME6A 3ZMUA 4HXEB 2QNBA 4KXYA 3VPAA 4CKEB 4CCOA 3CTPA 3P9ZA 4E6EA 5JQGF 3HSRA 3TLMA 1HYGA 5IX8A 3TW4A 2B0JA 4BHBA 3FWZA 5LBIA 3EVGA 2XSZA 2ETHA 3V8MA 1LJUA 5AT1A 2W57A 4P9NA 2KDOA 4YJ2F 4B85A 4IGIA 4A0QA 2ZXWH 3KSAC 3OZTA 2WAFA 2L5QA 1Z07A 4R9RA 4UNSA 4LXYA 3BVPA 3KYCA 1FYKA 3TE6A 1Q3KA 4F9TA 2FVXA 4UM9D 1JLMA 2XR1A 3IHLA 1AK9A 4UJ3A 1I1HA 1V6CA 4C0AC 2C7RA 4GNKA 3NDBB 4LHWA 4QOGA 4M1ZA 2FJPA 5D5UB 3TI9A 4AD8A 3R1IA 3C7TA 4S1PA 5NLLA 1E3WA 3VXKA 4KMUX 5LN1A 1NK3P 3ZWBA 3E1KA 4MB0A 2AYYA 4MYDA 2FUCA 5AJTA 3VR6A 4DIUA 3MWLA 2W6ID 4KQWA 3KWFA 5IABA 1M1XB 2CZCA 4GMKA 2ZI5A 1XR3A 2QUJA 4XWWA 1URPA 4MGEA 1TJPB 5ESXA 1CDZA 3K9HA 4DR5B 3WAKA 3GFPA 3QP5A 1MHTA 3OU2A 3UV6A 3GJTA 4NE2A 3E7PA 4PXSA 2OBYA 3FSRA 3MJ4A 4FI3C 2D1RA 4FJ1A 3I59A 5CEEA 1QK5A 3AF3A 3OX3A 1DEOA 5BQXA 4LWZA 3RU3A 2PBIA 1AKHA 2FAXA 2XRMA 2HH9A 2QE6A 5JCOA 2RCNA 1C8VB 2F8SA 3AKYA 3ZHSA 2XSDC 2Q7DA 1E2LA 4LMPA 4TKUA 3C6YA 3RUCA 2PJRA 1W88A 3DFIA 2XQVA 3FYUB 1GUAA 4I50B 1BI0A 2Y6UA 1BVUA 4LJ8A 4QT0A 2REXB 1RPTA 1CUIA 2QLLA 5EE0A 5TEVA 3GEHA 1JJAA 1KVUA 2PH3A 4MWDA 3PEVA 1I30A 4ZI7B 2REQB 1FX0A 1AB5A 3EVZA 4AX4A 2GD2A 4MW7A 3VPXA 1KQNA 5EWLB 4JFRA 5AI9A 4DBLE 4LD5A 1G42A 5JTTA 1R1VA 3R9XB 5L3VA 2L3DA 4OMYA 4RGSA 3OPXA 5IM4F 4DY4A 4GR5A 2VTEA 2ZIGA 4FB4A 2HRQA 3MTBA 3COVA 5FOVA 2HMTA 3DS8A 3HEBA 2ZSAA 4X00A 4U0YA 3G5UA 3RNLA 1G20A 1WW8A 2PPVA 1JMYA 5THQA 1N2JA 3STUA 1E1RD 3TK1A 3FZVA 4NZYA 3FCSB 1IJKA 2HCFA 1FUKA 3EA0A 1TEZA 1U3TA 3ETHA 1JE0A 2FOXA 4A36A 1MZPA 2VNIA 3PDUA 3DF9A 1VDMA 3NKFA 1KMHA 4ETIA 1PUFA 1JDTA 5A7HA 3M89A 1IBLB 1WP9A 3AAFA 3TTVA 4ZDJA 5G2OA 4UPEA 2I4RA 3ZGZA 3MUFA 4OIFA 3OP4A 2PLFA 3QK7A 4JT9A 4AICA 1WHSB 1P4SA 2E2WA 1MH9A 1IE3A 1EXVA 2IIPA 1OCTC 3TECE 3M1YA 2C8VA 4LFCB 3JTMA 4P08A 1U90A 4LWPA 1MABB 4ACAA 1E7MA 5EN4A 1G6Q1 4L9AA 1T3TA 3TRIA 3QAHA 2XYVA 4Q3LA 1J22A 2J59A 3FK7A 3NT4A 4YC7A 4TLEA 3CO6C 5L3EA 4KNWA 1LX7A 3I9FA 4EGZA 4BCDA 3UN1A 2P6SA 2VQDA 3UJ3X 3PWZA 1UBOS 3AUTA 1YDWA 3K0FA 3PPXA 4N8SA 2LBFA 5CLGA 2WMYA 3V4LA 2ZTSA 3IAXA 2PBZA 2J3MA 1RUNA 3A6KA 4V0RA 2R00C 3W9YA 1U3GA 2HRRA 4EW2A 2YPRA 4PLVA 4XR6A 1UPAA 4C7OB 3QWLA 1NZJA 3CUKA 4UB8C 4JVNA 4KSYA 1Z3IX 3RSQA 1H4QA 1HOTA 1TVKA 2BMJA 5CVJA 1AV7A 1IBRA 1P31A 4KR2A 3OTHA 3PJGA 3DXXA 4Q3BA 4PAMA 1DKRA 4FDAA 3E70C 4PYOA 3VR4H 2XRLA 3OF5A 3K2IA 2OWDA 2GLUA 2W6MA 3TEFA 5LLQA 2FD5A 3HB0A 2A35A 4LF8B 3Q8MA 3OX4A 3C87A 5TPWB 2NAPA 4UEJA 3KSBC 2OSVA 4N7BA 5WRFA 4NYJR 4ARVA 2JD2A 3O1HB 5AJZA 2AD5A 3TR5A 3IALA 4RXUA 1FDUA 2OA4A 3K0AB 4XOUA 4QYIA 5D5HA 4Y17A 4FZ3A 2CK3A 4LTNA 4AZSA 1Q0TA 3DKKA 4PZ0A 3CLTC 5H20A 4ZP1A 3KR9A 3R7WB 1RWMA 1KEVA 5F9MA 1E0SA 2B1IA 5FI5A 4AMBA 2NQ2C 4CCJA 4FNAA 2WSLA 4KODA 5JSQA 1KQ0A 4OUKX 3NWTA 1RPAA 3LNQA 2ZIXB 4MUJA 4RDHA 4HRVA 2WLTA 1SUSA 5CQEA 3HEMA 1XPXA 4DCTA 2EERA 3V00A 2DJNA 4TKVB 2PVCA 1E4OA 4B3GA 4KTTE 1NFRA 5EIBD 3EPHA 1SMKA 3C97A 2GCEA 2RI1A 2GK4A 1IDYA 3W2HA 2AV6A 1SXQA 1M6VA 4AN1A 3OJ0A 3WHPA 3GAMA 4HZFA 1NF3A 1ZAOA 5EJFA 3SXUB 2QSJA 3STWA 3O8BA 4PJMA 5REQA 3N53A 2JH8A 1EXNA 3WU0A 4DMRA 4LE2A 1HTWA 1SH7A 1NQWA 4AY5A 3MMXA 2FRDC 4QOIA 5FLMJ 4DZJA 5A6VA 4PK4A 2B7CA 3CCMI 1A7JA 4NATA 3HR7A 3HDTA 1Q7TA 3U9LA 1UWKA 2C2OA 1KI7A 1FDOA 1BX1A 2P1DA 2FNPA 3K09C 3BR6A 1SGWA 4TTRA 3CVWA 3QVKA 3HJRA 5L3QB 4M98A 3SS7X 1MEJA 4F6LA 3D5RC 3C3BA 4BE1A 2ZUTA 5ENZA 2Q6OA 4DFDA 1OXKB 4KIJA 1P0FA 1PUXA 1NE7A 1W0TA 2YRFA 1D3AA 3LIPA 3H05A 4MV6A 1EM8A 2RMKA 1JIKA 5IZ4A 4CIAA 4O1IA 5J1UA 1KBQA 1KIMA 5INTA 4R71A 3HSEA 3NM4A 1FRFS 3NWBA 3I4CA 1NW6A 4MQEA 4MI1A 3MT7A 1YQGA 3P0IA 1MGOA 2EOAA 2G4CA 4DSNA 5IDQA 5L3RA 5BNFA 4V02A 5EC8A 2M7BA 1YVRA 4IS3A 5JSUA 5CCXA 3BMXA 4BFTA 4D4MA 1SFOJ 2REBA 2QN1A 3QIVA 2RDMA 4FYWA 4H3KB 5I01A 3UA3A 3VOTA 5FT9A 4P4SB 5MN5A 2E4AA 1LJ8A 4QA9A 5DHQA 2IHZA 3FIJA 3QMVA 1A5ZA 5ALEA 3LQRA 5JEDA 4PZUA 3LECA 2GIZA 3W8EA 4ATNA 2RHBA 4X1IB 2RAVA 4FQ7A 4WK0B 1X3LA 4MVWA 4PR0A 1PYOA 1AMNA 3ZEAA 2QTVA 2QX6A 3KLOA 1NIPA 1TKBA 4B5KA 2ERYA 3WA7A 1DMSA 3S16J 3UFBA 2Q8PA 4KMFA 1J2UA 3H4VA 4FJ2A 5KPJA 1I50J 1MKMA 3MLAA 3IVMA 1N5DA 1RVV1 2FHSA 4B0PA 4KQCA 3I4NJ 2G1AA 3U3OA 1PF7E 5C5EA 3NHRA 5EJ7A 3GJSA 3D5LA 2EWVA 3CURA 4MTCA 2IJGX 4GSYA 5CYVA 4YRCA 2XUKA 3QKIA 4ZZ3A 3O94A 1FUIA 2JLAA 3HVHA 1UQTA 5LHGA 3HO1A 3H2GA 2PFBA 1C3VA 3UMSA 3TDKA 4JIGA 2IUTA 2HHCA 3ZTYA 4TUYA 4X1KB 5DOZA 1OXMA 5I3CA 1SKQA 5B6PA 4I66A 2OV2A 3WISA 3E5RA 1E32A 1WG8A 4DQKA 1R0LA 2O1WA 1RXCA 1EJBA 5KYUB 1R71A 2VRCD 2JI7A 4LE1A 3DMDA 3W79A 1HTBA 4EKNB 1G3UA 3R40A 2WKSA 3ETLA 2X3FA 1Y1PA 1H3FA 1BXZA 3CF6R 1ODIA 3EF3A 4L5CA 1E62A 3S5JA 1EIWA 1SG6A 4B3XA 2CJYA 4ES6A 4F11A 2LLKA 1L8OA 3LCVB 3Q5FA 2OBXA 3KQLA 2OCIA 2FVYA 1KIAA 3V1UA 1OT5A 5A2QZ 1UT5A 1BD4A 3OYLA 2WAAA 3W9SA 5IJZA 1OIXA 4EK9A 4DDVA 1VF9A 3FDZB 4YCLA 4ZXFA 3CR7A 2BFDB 2X3YA 3ZVMA 4U9UA 5FNZA 1SKUA 4N9IA 2E19A 4OXRA 3ONQA 3FPEA 3AL2A 3SZ3A 4YRNA 3HADA 5AXDA 4QPDA 4ZQBA 3I2YX 2ZIZA 3M8KA 4OY3A 1GPDG 1T8RA 3Q12A 4ENVA 1Z63A 4RXTA 4GUAA 4RTLA 2D1TA 2VUUA 2DI3A 4OGGA 4XUGB 1J0AA 2WNHA 4X64B 4HH0A 2UXXA 2NTYC 1N2EA 3F8TA 4BBAA 4R69A 3TTWA 5J3LA 2FXVA 2EW8A 1HSZA 3GPIA 4X95A 3QE4A 1FZQA 1B93A 1M7GA 3CRVA 4G97A 2BW0A 2HRDA 3IT1A 5FO1A 2QVYX 2OD5A 1AGYA 4RFVA 4ISCA 4ZMBA 3PQDA 3FF5A 3VTZA 1PD0A 2V5AA 4K9MA 1YRNA 2I6TA 4QBHA 4TRNA 4NCAA 2BYTA 1JLLA 1RM3A 4OU4A 2BF4A 4HDMB 2A5YB 1MJGM 5DTQA 1HE8B 3VH1A 4OINF 2P6RA 4EM6A 5CAEA 2B34A 3T3IA 2CD9A 1JKFA 2QD3A 3PDCA 1B8VA 2H48A 5H16A 4FHFA 2BGCA 2HSWA 3OT1B 4ZDLA 1CRZA 1XZDA 5FX2A 1ACLA 4WJLA 5IXSA 3SVTA 2W4IA 2J7PA 1SHTX 4U2CA 3D7MA 3KWLA 4G07A 3KEMA 2CLKB 3N6RA 4BQFA 1NG7A 5C8ZA 1WXEA 3NRCA 2I54A 4OD0A 4OB8A 3IERA 1KZ1A 4ZEWA 1D6JA 1E3LA 1Y34E 4C7KA 2IA5A 2YN4A 1CGPA 4B4UA 3I39X 5JADA 3TEMA 3OSGA 1X77A 3KDSE 2A7QA 2JAOA 3ZK9A 4AECA 3QWHA 2HTJA 2GUWA 3MCTA 2WIAA 4M89A 1R6UA 4BUZA 4HO1X 2W6ZA 4NCNA 2G9ZA 4ZMSA 4ZRDA 1JQ3A 4MQ6A 1E3SA 2OLEA 2OT3B 2PX8A 1FB5A 2CMFA 1A7AA 1BJAA 3KP6A 3B20A 2YXEA 1QK4A 3R6TA 3UK6A 2ODWA 3KKKA 3HK2A 4HNAA 4CNQA 4MSUA 1R4NA 4XLZA 1C9KA 5K3AA 1WJAA 2V7BA 1R3UA 3EF1A 1O9GA 4BRSA 3E2MA 4J94A 3BXXA 4ZQGA 2GTIA 2W4SA 2B8WA 3SBXA 3PR1A 4TMFA 2BRUC 2ZKZA 3RWOA 1K7CA 3B02A 3S55A 2AZTA 2XUDA 1RLUA 2VOEA 4KPUA 2YSRA 4L6CA 1XZ8A 2YJ6A 1H4VB 1VPWA 3DVAB 1QIHA 2NVUA 4JBNA 2R9VA 2L54A 3VNSA 5BV8A 1LE8A 1X42A 3N0XA 4HDSA 2ZUUA 4IW3B 5BR7A 5JVDA 1RI7A 5HNFA 2BKUA 5H4HA 1GUFA 1U2EA 3NQ41 2FE3A 4DJEC 4Z7JA 1K63A 3SR0A 1B9NA 2P9BA 2L42A 4OIMA 2DMRA 4ZT4A 5DP1A 3MUNA 1FP2A 1E0JA 2HNKA 1PNRA 1JA1A 4GI7A 2WU1A 2ODBA 3W3ZB 5HCUA 5AVTA 4MRSA 3UWMA 2AFHB 2CHVA 3HRMA 5IAEA 2R7VA 1QF7A 2K7ZA 4GLJA 4YHHB 3IHKA 2HKIA 1OPXA 4LSMA 3OKFA 5IDWA 2ZVJA 4IH4A 4IYRA 5HODA 2RONA 1O77A 3KPJA 3QEAZ 3MMPA 3FZEA 3ZMTA 2HGSA 3OOJA 1DC5A 1BXKA 4HUQB 2J33A 4D9CA 1M2GA 4JLSA 3ISJA 4AKGA 4EKDA 3CUYA 4DWJA 5AK0A 5E6SA 4G4JA 1SEPA 3S17J 2YU9J 1EWVA 3WLNA 4WNAA 4UHKA 4M6YA 4AUXA 2O6LA 4DJAA 3JRHA 3E2IA 2GILA 1LEBA 2EL9A 3FDYA 3Q8WA 3L7JA 5TGDA 2G70A 3FFWA 3KQTA 3MVPA 4YI3A 3FB4A 3QEJA 1PZMA 1QS0A 4Y1RA 1CRWG 3ZLJA 1HKSA 5A3QA 4QIWN 1V48A 1DHTA 5FWXA 3ONEA 2J9YB 2I3BA 1U0LA 3NEAA 4K0RA 3CGGA 4D79A 3DMTA 3LA3A 4KR6A 2FP4A 4UUTA 2LSOA 3E05A 1T5IA 4D74A 2XGCA 5IVHA 1I27A 3C3JA 2NTJA 4LF4B 1CVLA 3BJMA 3ER6A 4PS0A 4WE3A 2ZPUA 3NH6A 1ZIOA 1G5PA 1FF9A 5FOUA 4S2EA 4RE6A 3AR8A 2CQ7A 1HUQA 2WU4A 4B8ZA 3SMQA 1T9GS 3H9BA 2YHAA 1BROA 1JQ5A 3RG2A 3A0BC 1JMVA 1R1DA 3NZEA 3W4JA 4EHNA 3FX2A 3CVOA 3L43A 4DUGA 3IKVA 4HB0A 4RB3C 2VK1A 4BU1A 3QJ5A 2UDPA 1U7PA 2CVHA 3IUYA 3CPJB 4I5IA 4WHMA 1ZVJA 3CS3A 4HDRA 1AKEA 3OQHA 3ZJ5A 3KR2A 3HPRA 3LBFA 2JH3A 1T0BA 4YUYA 2DQRA 4DOZA 4N9WA 4Y9DA 1IAQA 2LYCA 2YYSA 1J0DA 4MLPA 4LYHA 2FDRA 3PI6A 3KTFA 4C2AA 3MEQA 5B2FA 2Z83A 4W7IA 3TIGA 2Y1EA 3ILXA 1J0BA 4IVNA 4LHEA 1DCKA 2GXUA 2UYOA 4K81B 4BMOB 2ZE8A 3E35A 1TQDA 2GWRA 3OY2A 2DA6A 4F72A 2EZTA 3P9YA 2NZVG 4AVZA 2ZJ1A 3FCCA 2LKCA 1TYBE 3DA8A 4JB8A 4CM4B 4MTLA 1LZKA 3BH6A 4KISA 3HL2A 3K2QA 3PNSA 4RQUA 3UJBA 3KSZO 3GUDA 2JIPA 4PGGA 1KR2A 4M9CA 4QXQA 1ABBA 1RWWA 5L9AA 3SZMA 3UNGC 1CJMA 1CB7A 1O4VA 4YCNA 1QQ5A 4ZC8A 3ABQB 1QV7A 2JLXA 2NUAB 4B4WA 1QHHD 4RJLA 2XWSA 1YZNA 4M7RA 4WFKA 1K7FB 3D54D 5A7GA 1L7AA 3OYFA 4XGIA 3F5DA 3NBFA 4LY0A 5LDGA 3IE0A 1D8JA 5KOHA 1DX4A 2FH5B 1IF1A 1W30A 2GJ8A 1UPCA 1UBSB 1ZKDA 3IMFA 1U78A 5FKOA 4TLMB 2ZSHA 3ZQUA 1O1YA 1Z6PA 2VP0A 1G1MA 5J1SB 4Q4HB 5JRJA 1R3DA 2Z4SA 3KYDB 2NP7A 3H9UA 3EZXA 4RD6A 4DE5A 2ACVA 3SX2A 2ELKA 4BB5A 2NU6A 1JTYA 4RGVA 2XUHA 2QM7A 3K0CA 1S9HA 3CZPA 2EKQA 721PA 2B1QA 5IAGA 2VPIA 3UPTA 2VTBA 4BNGA 4NESA 2QG4A 4WF2A 2P3LA 4KDCA 2G63A 4EPRA 3AGQA 4BCCA 5AOBA 5HOEA 4I9GA 1KI4A 4MCHA 4GX1A 2K9MA 4Y33A 4I4TA 3HCAA 4EMSA 1PWEA 3D5EA 1O97C 2Z3VA 1QG4A 3DE3X 1M83A 4A3SA 1MOSA 4BAZA 3SHFA 5TQ2A 3IGFA 3EVBA 1JBEA 3H4IA 3WIDA 1UM9A 1ZJWA 1V3FA 1DAKA 3SEZA 2FZKA 2C8LA 4B3SB 2V54A 1Q17A 4LFAB 3OCCA 3INRA 3INNA 2JKZA 6Q21A 3THXA 1G8PA 3BR1A 1PEKE 4CKBA 3ND8A 3CIOA 3AY6A 2YS9A 5ALDA 2GEFA 1FW8A 3GZNB 2XNSA 2G9RA 2LGJA 3WLHA 4CTOA 2EKPA 4F4CA 4Y1FA 2OZLA 2GLXA 1OVGA 1PHRA 5ELMA 3QU2A 3HHGA 1WSBA 1QH8A 1JSRA 4M3DA 2L7ZA 2XIGA 4EHDA 4F5WA 1C3OB 1LLQA 4O4IB 3DV0A 4YAGA 2H1CA 2QAJA 1U9ZA 1LTQA 1XLUA 3EOZA 5FLVA 4BLPA 4Q4JB 2QUKA 3JQDA 2OO5C 3VKVA 4ZOCA 4BHTA 3BPSA 2YYYA 3RC8A 3QPLA 2BL4A 5AFSA 2CF6A 5KYVA 1IN6A 3ZV5A 4PX3A 3FKIJ 3FCYA 4ZKEA 1EVYA 3ZQKA 3PUHA 3HRTA 1P17A 4MDEA 2XNKA 2X1EA 4LJRA 3FLMA 4O2AA 4UVCA 3RS7A 1MQ9A 1UINA 4OLJA 3S2EA 5D1NA 1E9RA 1F2TB 3C70A 2LDUA 3S3OA 1C7IA 1V7QA 3WDSA 3D1NI 2E34A 3R3ZA 3U7EB 2A68F 1E98A 1MFPA 2HGZA 5B2ZA 4FIDA 5JHGB 1RNLA 1MGPA 3G9ZA 1S3JA 4CN9A 2Y2ZA 4Y2QA 4EG7A 3QVTA 4KWTA 3I72A 1PV2A 4IF6A 2EG5A 3ZWYA 4JOSA 1KJWA 2BTQB 3GY0A 4JX5A 3JD0A 1D2NA 3ZE1B 4CFZA 1QV9A 2WFAA 3MRSA 2GVDC 2O2HA 3ETGA 1NVKA 3IHTA 3VHQA 1L3CA 3CZRA 1ZCAA 4Y8VA 2VJDA 4LN1A 4NK4A 4CL2A 1JYEA 1K3UB 4LX0A 3VR1A 1GFZA 3H16A 3FXKA 3WK5A 3MYYA 4JU9A 1WTAA 4XWGA 1UCRA 2A59A 2QUAA 3IMCA 3QE3A 3WK9A 1VJ5A 1Y39A 4TLDA 3UJ6A 1QGOA 5JAHA 3I5YA 4MYCA 4XXHA 2YU3A 4R79A 4WXDA 4B8WA 2O23A 2M4KA 2AXLA 4KR7A 2IT1A 1NTRA 3EDMA 3JRFA 3U3KA 4D3DA 3CF4G 1RJGA 2KT0A 3SXJA 1WHTB 1CHDA 3G9XA 4BBSJ 4RZQA 3UJHA 3KFLA 5ETJA 1BW9A 1YW8A 4G5OA 4TXHA 3PU6A 3LSRA 3ZGNA 1NW5A 4O4IF 2CNDA 2B2XA 4M1QA 3FXMA 2OC9A 3VAZA 3H97A 4MKZA 1CR2A 3QFCA 1G291 2JDIA 2R6JA 2F4OB 4EF4A 5IY5H 3JQFA 2CFXA 2B21A 3EUWA 3LWNA 5LC1A 3OKCA 5KQPA 4MYHA 1J2YA 2GHTA 1SAUA 1DIOB 3RHSA 2M1BA 4HNUA 1P2BA 2J9XB 3SQXA 3CA8A 3VHLB 3LLSA 4XWTA 2P3QA 4ND2A 3RSHA 3LWZA 4E0BA 4LNHA 3FNGA 4GE0A 4P5DA 3BUSA 2YWBA 3G1UA 3N2NA 1BEEA 4KDEA 4HFMA 1WPKA 2A2ZA 5T5QA 1EKEA 1OY1A 4OYRA 3LKZA 1RFLA 2IYWA 1T56A 5FBHA 3K73O 4AMGA 1S2GA 1SM4A 4MQFB 4AFNA 3L7BA 2QRLA 3F7OA 2JLUA 3RK4A 1XXHE 1B59A 1BOAA 3A7EA 3A1YA 1ZDMA 3BXEA 4HI0E 5JAMA 4RSRA 2C2ZA 5HKBA 2V6BA 4G5SA 1C3JA 5ICGA 2B4YA 3EXHB 4KFRA 1T0FA 1YZ3A 3G0DA 2P2CA 1XL0A 1NUUA 3DUFA 2I9KA 1N1GA 2B2CA 5E6UA 3CFYA 4EG0A 4HWGA 3ZGYA 4QPOA 4Y2VA 4PSDA 1W76A 1L4HA 1THZA 4IUBS 3OLZA 1YBFA 5GOTA 3HEFA 3UO8B 2W6NA 4TN1A 3K9LA 3BIWA 4TL6A 2IOFA 3UJ8A 4OB6A 4JNKA 1KRWA 1H0MA 1DBVO 4UNRA 2YVQA 4KIBA 1WV0A 3AESA 1SFEA 3FI0A 1T9CA 3I62A 2XA1A 4G1MB 4LJ5A 4MOWA 5IVPA 1DUVG 4B6GA 1EFCA 3M3HA 3OJXA 3QKWA 3K4KA 4LDPA 2WICA 3IBCA 3RSGA 1N5RA 3AETB 4HGNA 3GFBA 2H4WA 4XQGA 3T4EA 2B63J 3I9NA 3TWOA 3D7SA 1L5QA 3QFFA 4ILKA 2PQ0A 3AEKB 4UHFA 4E1VA 4Q15A 2C98A 3F9RA 1BE8A 1Z8NA 3LUDA 2HU8A 4WFQA 1WB9A 1M3SA 1D1PA 1W5FA 4A5OA 3HP1A 3KM0A 2ADMA 3G2BA 1Z0UA 1H4SA 4E6PA 3QUAA 3RPUD 3MF4A 1U6KA 4P2GA 2C3YA 2PJPA 3DXYA 2YTZA 3JVEA 3GLTA 2FE1A 1XX5A 5I5EA 2PYZA 2EQAA 4EG5A 3GLSA 4BO4A 2SKCA 2XKAA 5FO0A 5JZMA 3FMSA 3IQHX 3AJ9A 3MJHA 3ZE8A 4NZPA 4LPKA 2H08A 3RANA 3TSAA 3ONNA 3EQ8A 3QUCA 2NYAA 3I0MA 1KNQA 3EH1A 4NQRA 1D2MA 5IH3A 1CZHA 1OMOA 1D03A 2TRSB 1ECFA 3WBKA 4JBIA 3U40A 1KJQA 4URXR 2JCBA 1X86B 4V0QA 1PKEA 2DFTA 4NPAA 2OHFA 1RYMA 3GFIA 1VE9A 5JXWA 1RZRA 1SQGA 4RH3A 4F7WA 2PFGA 5C37A 3K6SA 3ADDA 1TQIA 3R3JA 4Z4QA 1GCIA 3EW9A 3E7XA 4AIIA 2H00A 3H7AA 2A7XA 3RKRA 4QUIA 1K4SA 3P0JA 3KPHA 1F17A 4BO9A 1NYLA 1QMPA 1YA6A 1F4PA 3G0OA 4D44A 1H4TA 1AN0A 5EMKA 1MMFB 5FQOA 5BNGA 3KL4A 1L5NA 2QTNA 1R22A 1H0RA 3LKBA 4HRAA 2H27A 5KSOA 2JKVA 2E4YA 4AQ7A 4KQ6A 1EFVA 3VR5A 3HCCA 2XB5A 3U61B 3N0RA 1L5LA 2PSJA 1PJ8A 3E6CC 2XZDA 4A12A 1GTL1 1K78A 3GYBA 1PUJA 4EVSA 1WV1A 4PQFA 4R1OA 4JHLA 2JVGA 4HX2A 3EX7C 2OCDA 2O9LA 4E7JA 4F4HA 4W5WA 3KOXA 5LDHA 4DZPA 3QLUA 1D1CA 1JKJA 1NMZA 1OAAA 3LSPA 2FSPA 3KZYA 1Q3TA 2NTNA 3H36A 1RXSA 4R51A 3ABMH 2B98A 4MUBA 4NYJQ 2LR0A 5CVRA 3C5HA 3K1AB 2V9CA 5HYVA 2NQ8A 4MEJA 4B4DA 3DLLF 2B4TO 3QBDA 2OQRA 1PJQA 3KQNA 4BQNA 1TK3A 1ULHA 3QPWA 4JP5A 1I3LA 2DEUA 4QAQA 1Y5RA 1NNLA 1WS6A 3OPYB 3DWLE 2OU2A 3RUEA 4JBLA 2FN4A 2J0UB 2Q2VA 1Z8HA 5EE5B 1NBMA 3JQGA 1UXIA 1V1MB 3LUGA 4BZXA 1BI2A 5CG2A 2QN7A 2CG4A 5TMPA 4KFSA 4CEIA 4IKFA 1ZRDA 2Q2EB 2KZVA 3OYNA 1UBEA 3Q0VA 1W4AA 3FTCA 2EJVA 5CU7A 1IRZA 3VMMA 1W4ZA 1E2MA 4BQSA 2XZLA 3PD7A 1ZR4A 3M4XA 5D3QA 3HDQA 4PLGA 1XVLA 1Q6ZA 4W5HA 1TO2E 4JX4A 3S93A 4V0OA 1R9TJ 3DTVB 1Z2PX 1WUYA 5H9VA 5K8UA 2Y67A 4X84A 3DD1A 3U26A 4YRBA 1T0UA 2CNOA 4QSMA 1WSUA 4EMBA 2ZWVA 1S1CA 5I8PA 1WD7A 1I4LD 2VSQA 4C7VA 2CUZA 1WPRA 3WKBA 3S3TA 3H5RA 1O3QA 4NJMB 4DAOA 2JZCA 3Q3JB 4OI4A 4BL5A 3NUZA 4G4SO 2CLOB 2CDNA 2LIVA 2TSYB 4RZIA 3WBBA 1X8KA 1QTNA 1SHUX 1YWGO 3TD9A 5JXIA 1KFKB 3BL5A 3TMAA 3PXAA 2HI0A 3JCZA 2K87A 1A2KC 1NQVA 3B6MA 1ONOA 2EWNA 1ZICA 4M0KA 5DGIA 2AQEA 3EG9B 5FUWA 5DCWA 4RUKA 4YJ2B 2YS6A 1GVDA 3EXFB 1GG9A 5BSKA 3G02A 4JQZA 3LQKA 1ODSA 4RB0A 2VF2A 3GLGE 1P2DA 1G1AA 3HWSA 4GOND 4WNIA 4I6ZA 2B82A 5JLXA 4XVRA 2V7QA 2X9NA 2X19A 1DINA 1RQPA 3FOAA 3NYRA 5J4YA 1IBSA 1COWA 1EP2B 4UM7A 5IT0A 3QPVA 4QOSA 3ELUA 3IJ5A 3E6BA 4NVRA 3ANYB 1I5ZA 4YYEA 4WLOA 1RRKA 2FOWA 4YCBA 3RKQA 4HB4A 4B31A 3TE7A 4GMHA 3W1EA 1WCIA 2FPPB 1E0EA 3BJZA 2DQ4A 3ZN1A 5C2JB 1HYQA 5FI1B 5E7MA 2ZJ6A 2OAEA 1YFKA 4CCYB 2X1LA 3AQIA 3CVUA 2DFNA 5EIFA 4MQUA 4P38A 4UU7A 4EMUA 4YRSA 2WBMA 5DTRA 4AP9A 3QPSA 3BWCA 4IL6C 1EP9A 4W6ZA 1D2EA 4FLMA 2PX5A 4GYIA 3RC1A 2JRTA 4N5DA 3DKWA 2WP8J 3A7DA 2DZDA 3IESA 2O3TA 1GYQA 2R1VA 2IWHA 3JR7A 4J4BA 4HX5A 1T9ZA 5E7QA 1JYSA 5AVWA 4ZDOA 3MT0A 4I02A 4NQZA 2R7OA 5A5GA 3DB2A 1USUA 1W87A 4MFEA 4YBZA 1DQYA 3RWMB 3G0IA 3F7TA 2VN8A 2YR2A 5JVGF 1FEXA 3SSAA 3KB1A 2RCYA 1STOA 1TM5E 1T1IA 2HJGA 4NBTA 4CG0A 4B2IA 3T1TA 3ZWQA 4DBLC 3RTEA 4AQDA 4MI3A 3B6KA 2AL7A 2ZXFA 2Y1CA 3AI3A 1P4HA 3B7PA 2MSKA 2KBFA 1R5JA 2PN1A 3WOVA 1I6MA 3WSWA 5HSGA 4RTMA 5KIAA 4PY2A 2CXRA 3RUAA 1JKMA 2FSVC 2VQ3A 1XAGA 2H6CA 3LCMA 5KKAA 4NHJA 3HZOA 2POCA 2QJTA 4JEUA 4MVJP 2FZCA 2YXPX 2F1JA 2QZZA 1F0NA 3F71A 3E7DA 5L53A 4M54A 3LY5A 1DEAA 1DDIA 3NO4A 2PZFA 1JFFB 5EGOB 1C30A 5IDYA 5A4IS 1CUJA 2Y4NA 3AR9A 3ZXUB 3WRXA 5H83A 3VC3A 3FNQA 4BNDA 2VK4A 3N8DA 2WPDA 4DA0A 3KOMA 2AZDA 4RE5A 3NANA 5ARDA 3S40A 3PC4A 5CDFA 4P33A 4OKSA 1EWRA 1XZEA 1KYIA 3EAFA 1FW6A 1Z4QA 2FYTA 1FBUA 1SD5A 1I5RA 3PK0A 3BMQA 2KHMA 1JGTA 4Q5IA 3D8TA 3DE5X 2H29A 2W2KB 1TM7E 4INJA 3DCJA 4N47A 4WXEA 5JD3A 3UJPA 4QBFA 2F7SA 4FCTA 2CUNA 3IAS2 3OCXA 3RYFB 5JYCA 2QTZA 5LQSA 2C5GA 1SUPA 2RB5A 5CHYA 4GC5A 2BGUA 2YV1A 3NHBA 4CCWA 3KJQA 1ZVQA 2V7EA 3LS2A 1F8FA 3L1VA 4Y3UA 3FUVA 4R41A 3EWSA 4KAFA 2VCHA 4EDFA 1TNDA 1CJBA 3T4XA 4AP5A 1DQPA 2G9WA 2ZYSA 4YMUA 2WPNA 1SFXA 1L3LA 3EQZA 2V9PA 2R1ZA 1P3DA 1T29A 4B7ZA 4US2R 3T12A 1GQFA 3U39A 4RSHA 2GA1A 3U44B 3S1NJ 3FHZA 2VDQB 4LXXA 1HTTA 3NWOA 1QG2A 1Y1QA 3I6QA