1QZZA

Crystal structure of aclacinomycin-10-hydroxylase (rdmb) in complex with s-adenosyl-l-methionine (sam)
Total Genus 111
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
111
sequence length
348
structure length
340
Chain Sequence
LEPTDQDLDVLLKNLGNLVTPMALRVAATLRLVDHLLAGADTLAGLADRTDTHPQALSRLVRHLTVVGVLEGGEKGRPLRPTRLGMLLADGHPAQQRAWLDLNGAVSHADLAFTGLLDVVRTGRPAYAGRYGRPFWEDLSADVALADSFDALMSCDEDLAYEAPADAYDWSAVRHVLDVGGGNGGMLAAIALRAPHLRGTLVELAGPAERARRRFADAGLADRVTVAEGDFFKPLPVTADVVLLSFVLLNWSDEDALTILRGCVRALEPGGRLLVLDRADRFFSTLLDLRMLTFMGGRVRTRDEVVDLAGSAGLALASERTSGSTTLPFDFSILEFTAVS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords aclacinomycin-10-hydroxylase
publication title Crystal Structure of Aclacinomycin-10-Hydroxylase, a S-Adenosyl-L-Methionine-dependent Methyltransferase Homolog Involved in Anthracycline Biosynthesis in Streptomyces purpurascens.
pubmed doi rcsb
source organism Streptomyces purpurascens
molecule tags Oxidoreductase, transferase
total genus 111
structure length 340
sequence length 348
ec nomenclature
pdb deposition date 2003-09-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00891 Methyltransf_2 O-methyltransferase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 1qzzA01
3.40.50.150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Vaccinia Virus protein VP39 1qzzA03
3P2EA 3MZHA 1Q1HA 2P7CB 3HCEA 1LQ1A 2AOVA 4BYYA 3LGAA 5B1SA 4X1OA 1EG2A 1XGNA 2F5FA 2IA1A 3GW2A 1XD7A 2ZXJA 2NYXA 3FM5A 2EJUA 5FQOA 2EJRA 4HYEA 4RGXA 5C0OE 4GGGA 4AZTA 3CUOA 4CKBA 4ENMA 1RJDA 4BH9A 1XXLA 3CC8A 3R0AA 3EVBA 4ZH4F 4AIJA 1BOAA 3L00A 1YW7A 1G6Q1 1U3EM 5L3GA 1SKMA 3TKAA 4Q47A 4HBLA 1C0WA 2PV0A 2IGTA 5E8JA 1K78A 4UUVA 2OPBA 2EG5A 2IH5A 4HW0A 1RI4A 5E1XA 3I59A 5D6EA 5K5QA 2HYFA 2XKPA 4EQQA 3DXZA 2FNPA 5EOVA 3EQLF 2G72A 2F8LA 3V97A 3C0KA 3OFKA 5K5OA 3EMDA 3HIFA 1KA8A 2L4MA 3ABTA 1B1BA 3GO5A 5CVIA 4G7HF 4ER5A 3M7GA 2H6BA 3ZMTA 1F9NA 3OCJA 5DWQA 2RQPA 4YUVA 4YMGA 3RPQA 1OR8A 1BC8C 3DLCA 2Z9OA 1YFJA 1LNWA 2G9WA 1L9KA 2PX8A 4HA8A 1WZNA 1AF7A 1XTPA 3O6BB 3BZBA 5H6QA 4HF0A 4U7TB 2FXAA 3ERED 2LKPA 2M45A 4OINF 1CGPA 3M6WA 4V0QA 3NEUA 2DK5A 1BIAA 3C3PA 2KJCA 5F2KA 3Q9VA 10MHA 5TJJA 2I62A 2O05A 2ZTHA 5J6XA 4GBED 3LDGA 4RSRA 2OKCA 4FZVA 5D4SA 5CCBA 4P9FA 5GM2A 3GNLA 2VS1A 1QNTA 1U2ZA 1IN4A 3ELUA 4LLNA 2F5CA 2L02A 5E2BA 2D45A 4PYJA 4I02A 3FPGA 2RVCA 3WTUC 1KU3A 5D1NA 5DTQA 1FX7A 2P35A 4DCGA 3M6VA 1X1AA 3H2BA 3DPLC 3O3KA 3P9IA 3IHTA 2ISZA 2HTEA 1TLHB 1NHAA 3LDFA 2DI3A 3CJQA 5HLGA 5CLSA 3BJ6A 4C4AA 4L0YB 3HCDA 3NWEA 3OE4A 4LECA 2OYRA 3TQNA 4YIIA 3MZYA 1HW5A 3SSMA 1O3SA 3VYWA 3C1DA 3TGNA 2AOUB 4R05A 3MAJA 3OU7A 5D8KB 3OV8A 5DDGA 2UXNA 3DULA 3LBFA 2BR3A 5E1OA 2KIUA 1I9GA 1T39A 1FYMA 4EMSA 5LQRA 1DCTA 3E3VA 2K4JA 2LF8A 2C7OA 1DPUA 4DA4A 1JHHA 2ORED 3K1NA 3HVHA 4M9ZA 5DM0A 4HQMA 3RIEA 5FD5A 4H0EA 2ESHA 1G6NA 2QLZA 2Y48A 2XAJA 4B8XA 4MNUA 2IH2A 4LD5A 1OPCA 3KQPA 1KPGA 2IP2A 4XLNF 2GS9A 4WVLA 3CUQC 4CTKA 4HDUA 4S05A 1NBIA 1T0FA 3GWZA 4I98B 3F8NA 2PBFA 4PZJA 3IHUA 5BXYA 2Z6AA 1YUBA 4OQDA 2DPDA 2DTRA 4NB5A 2JRTA 2Q8KA 2ZBKA 3QRFF 4LFUA 5D8LB 5E18F 4IJAA 2B25A 2DLLA 2O0YA 4LWPA 3GRRA 1T6SA 2W84A 3C3YA 2VN2A 1BI3A 4KVZA 1ONVA 3B89A 3G2OA 2G71A 2DK8A 1NW8A 4QWQA 4LG0A 1VQ1A 3DTNA 4E2ZA 4F86A 1QGPA 3BWYA 3EVFA 4CHUA 1U2WA 2A3SA 2VBWA 3JW4A 2OU2A 5HDKA 2AOWA 3M6UA 1Z05A 3LKZA 4OX9Y 1FY7A 5FADA 5K03A 4CGZA 2MLGA 1LDKB 5EKUA 3KE2A 3R6SA 1YYVA 1XVAA 2P41A 3AXSA 2Y75A 3UA3A 3IKTA 3FXUA 5BOXA 1Y8CA 1MD0A 4NECA 2Y1WA 1ZH5A 1XDSA 3DF8A 2GAFA 1DDNA 3Q87B 3KZZA 3TO6A 1O9HA 4P5OA 2IW5A 4FHTA 2NP6A 3LCUA 2IBTA 2G7HA 1L3IA 5DRTA 1XSVA 4Y13A 4E30A 5A2QK 1IXRC 4U7BA 1HNNA 1Q0SA 3ZP5A 2CYYA 4I2OA 2PT9A 4PYQA 3FF5A 3T1BA 4ZYHA 4HLYA 4R8RA 5KYGA 2ZCJA 1QQIA 2VE9A 3HEMA 1R1VA 2BE5F 5GOZA 3SZTA 4G56A 3WTVC 3P9KA 2IDKA 3LL7A 3RYRA 5DX8A 3ZQ7A 4RTSA 3O31A 3GZ5A 2HQNA 5L3DA 5FB2A 4RX1A 5K0JA 3L2CA 3G2MA 2JHPA 2EFWA 1NV9A 2NXJA 1V3FA 5E9WA 5CVVA 3F8CA 2GB4A 4RS8A 3RI4A 3WE3A 1IRGA 1RJEA 5L3FA 5ILUA 1SQGA 4XBFA 5JI6A 1BM9A 4RVDA 1HQCA 3E6DA 2MBFA 4N9HA 3PVCA 2P5LC 3KQYA 3PFHA 3FZGA 5DRYA 2YXDA 2Y0MA 5AIQA 1QYRA 2K7LA 1OKRA 3AAFA 2CG4A 2XAGA 1Z6TA 3G73A 1Z91A 1FYKA 1JXSA 1J59A 4YG2F 2B3TA 2P6SA 4PIMA 3TO9A 2ELHA 2WTEA 3TDZC 3FXQA 4KICA 4KWCA 4MTLA 4U0WA 4NHJA 4OOIA 4HGYA 5J8CA 2QY6A 1FBQA 5FLXK 5DCFA 3ECOA 3GJYA 2K27A 4KRGA 2OQRA 5DCMB 2JTVA 4AIHA 2KKOA 3O2PE 2A69F 3HSRA 3E5XA 3HA7A 2OA4A 2OY0A 2Z99A 2N47A 4AWXB 5L3BA 3L09A 5D5WB 4ISCA 4PIPA 1U5TC 2BM8A 1TW2A 3NWBA 5BPIA 3GGDA 5E1DA 1JHFA 3WODF 1BJAA 2VDWA 3EVEA 4FSXA 1G3SA 2EV6A 2ACJA 3M1EA 2GAUA 1P6RA 2P7HA 1ZREA 3THRA 2V1XA 2VC1A 4HX8A 1MDMB 2YSRA 1B59A 3DQVC 3KZYA 2XAFA 3KQWA 4M37A 3UFBA 3CUQA 2JPCA 2P6TA 1HSJA 4HQEA 3FPJA 2PWYA 5IT9Z 3VC2A 1R22A 1X19A 2HS5A 5FUBA 2V7EA 2JH9A 3J80Z 5EEGA 1W7PB 3GRVA 5U4XA 1P39A 3WTWC 4BP3A 4RGSA 2XGXA 4I01A 2YQZA 4OA5A 4OU0A 5GIOE 1MZBA 3TLJA 4QLCU 3SSNA 2AOXA 1Q0TA 1JG2A 1LB2A 4RTLA 1I1GA 3HHHA 5HIMA 1ZG1A 1KU2A 5CVUA 2P7VB 1RJFA 1X1BA 2ZMEB 2HV9A 3NMUF 1E2XA 4DZRA 5K0FA 2RDPA 4ER6A 1FSHA 1W5SA 2Y1XA 2M30A 5DM1A 4JQFA 5G02A 3MGGA 3HM2A 1ZGAA 3KQQA 2W57A 3SXJA 3BDDA 4ER7A 5L3EA 5HDNA 2CQKA 1OR7A 5T67A 5K01A 1TQMA 4A5MA 4X63A 4FX4A 1IAWA 4P7GA 4RTOA 3JSPA 2H1RA 2LF7A 2DO7A 3NQOA 4K6MA 4AX8A 2XHKA 2D1HA 2RKHA 1OYWA 3F72A 4NQWA 3TMAA 5FQNA 4HLXA 2GQQA 2UZ4A 1R58A 1TW3A 3Q7EA 1XMKA 2STWA 4TV7A 2G70A 2NXCA 2VC0A 3BP8A 3IWFA 2HWVA 4FP9A 3F22A 3MERA 3NDJA 3I54A 4ZZDA 5LGUA 1RI5A 3A4TA 2IT0A 1O3QA 4RGRA 3KPUA 5K8VA 4PONA 3MB5A 4IV0A 1P1CA 5HS8A 2KJBA 3EVAA 1BIBA 4L9VA 3E7PA 3CDHA 1H9TA 3LWFA 2IRFG 3WTSC 5GIPE 2CSOA 3GFLA 4XRFA 3WG9A 3FMQA 2P8JA 1I1NA 3R4KA 1MGTA 5L3CA 2ADMA 3KP7A 1NV8A 4LB6B 3RIRA 2CL5A 1LDJA 2H09A 3L8DA 4ON0A 2ESRA 3B73A 5FCDA 2FK7A 4YFXF 1KP9A 5F64A 4I7HA 4KA4A 4UOEA 2FOKA 5LQNA 1JSZA 1YZ3A 4BP1A 2L01A 1J5YA 5EMJA 1R36A 1FP1D 2JJQA 5EPEA 4AZWA 2XASA 5DD8A 3G8BA 5HIJA 1Z1DA 1BOOA 4PYKA 5FD6A 1WRJA 2A5YB 1S6LA 1ZARA 2VONA 3ID6C 4C05A 1AQIA 5JHUA 4IRGA 1ZAOA 2ZCWA 5K5RA 1R74A 3S68A 1Z6RA 1QBJA 1JE8A 2VXZA 2ZKZA 3KPJA 1WI9A 4P96A 3G88A 2VT2A 2XKOA 3LSTA 4ESJA 4C08A 3IRRA 5LHGA 1QZZA 5EMLA 4MWZA 4RAZA 5KVRA 2JG3A 4E2WA 3CJRA 3SHFA 2DU9A 2IH4A 4M71A 5E1MA 2OBFA 1R1TA 4C03A 2AS5F 4IKPA 4RTQA 2ZBRA 4A0XA 3UJ6A 1ZRFA 5FHQA 4D0PA 3PX2A 3MWMA 1KHHA 3QOXA 2PX5A 3KP3A 2YX7A 4A6EA 3JSOA 4E2XA 5EGSA 1EH6A 2CWEA 4EJOA 2XYQA 5DT2A 3UJ8A 1XGSA 4G9YA 2W85A 3I0TA 4EGZA 4HDVA 4G94A 1EQAA 5DCMA 4YUZA 3UJ7A 4XSZF 4UV9A 2QENA 3DXYA 1DL5A 4L9JA 5EZSA 2F2EA 2P5KA 5DV5A 3E05A 2FBIA 4QDKA 4FT2A 4UVCA 2QBYB 2HYGD 2I7CA 1JTEA 1RUOA 4RAYA 2K86A 3U9GA 3SXYA 5GP1A 3UJAA 4G8XA 3FX3A 2NRAC 1ZYRF 5F6FA 3J81K 1MDMA 2OB2A 2H27A 2NS0A 1HW2A 5JVTA 3BY6A 2RC4A 3HHGA 3AWIA 1IY9A 5HS7A 4OBXA 2PXAA 1IN8A 2QM3A 1M0EA 3P71T 1W7PA 3LX6A 1E17A 1L3BA 4ENKA 2H00A 4C07A 4LMYA 2HR3A 3EUHA 4EJVA 1AWCA 4HAMA 2IPQX 1TQPA 5LR6A 3THSA 3IV6A 5HLIA 4S04A 5EZQA 4OQEA 3I5UA 5EMKA 5LBQA 2NNWB 4PINA 3B7PA 2Z6UA 3J7AO 1ZKDA 5LGTA 4U0VA 3ECHA 2C7RA 4GOND 1ZN2A 3GRZA 3R0QA 5HIKA 1VP3A 4FX0A 1I5ZA 2BEOA 5DXAA 3HA5A 1K7AA 1XDUA 2VZ9A 1PUEE 2HTJA 3FUWA 1S7OA 2I6GA 1ZHFA 2IJLA 4E70A 1P92A 3KQSA 2PN6A 2LD4A 2FRXA 1G4DA 1F38A 2YR2A 4AIKA 5DSTA 2CGPA 1ZQ9A 1R23A 4RTPA 5K0NA 2PMUA 2FSWA 1FBSA 2G1PA 5EQJB 3WTXC 1R8XA 2XYRA 1IXKA 2YX1A 3MCZA 1BHJA 3QPTA 2PSSA 3I53A 4L5JA 3OU2A 4DM3A 2PJDA 2AXLA 3E6BA 3CJTA 2V79A 2B78A 3HSEA 2JHAA 3SFZA 1M6EX 4GYIA 4YV1A 2OD5A 2NYUA 3X0DA 4QQKA 2ADUA 4G6QA 4B17A 1P91A 1TPYA 1G3WA 4KUMA 1VTNC 3FUUA 1DUXC 5CM2Z 3GUDA 1VP9A 3AY0A 4RB2C 4EM0B 4M73A 3JWIA 1N7IA 1MJFA 4MQ4A 3U1DA 4M36A 2L4AA 2V6CA 3PX3A 2L54A 1WXWA 4WCGA 1STZA 3TKYA 1O54A 1B6AA 2FYTA 3KKZA 2XAHA 4PNEA 1CF7B 3G5LA 3ER8A 5HOQA 5DTRA 5DM4A 2WC2A 1XCBA 3O4FA 1YIOA 4M72A 4HTFB 3GXOA 3MEXA 4F84A 2HFHA 1KR5A 5HIIA 1QANA 2RGVA 3PT9A 2ETHA 5DYMA 5CVEA 2ZBQA 5C9ZA 1ZGJA 4CZZA 2HTSA 4OA8A 4ZYEA 4RB3C 1YTYA 5DX0A 1T98A 4DQ0A 4LLGF 3E5QA 1IN6A 3V8JA 1P4AA 3BJAA 1MHTA 4L9TA 2P1DA 2K4MA 3UJBA 5D1HA 4R1HA 3WE2A 4L7VA 2A07F 2ZZMA 5LSAA 3SGLA 4HC4A 3MQ0A 3P2IA 2VOOA 4HV6A 3SX0A 3CO6C 4BLUA 5ERIA 1HSTA 4ER0A 2YX4A 4BHCA 1J7KA 3KHKA 5AIPA 1XB4A 1WKMA 2VDUE 5LQCA 1D3YA 2V1UA 5FHRA 1AQJA 4JXJA 1SQFA 1ON1A 3TOSA 1T38A 1L0OC 1PJZA 4Z2YA 3DXJF 4KNYA 2BR5A 4CICA 1VIDA 2A14A 1ZRCA 4LWOA 3Q9SA 1F4KA 5E1BA 1O7FA 1XSDA 2AS0A 3BXOA 3LA3A 4C04A 1RZ4A 3FUXA 2EFPA 4AVPA 1W7PD 2L3DA 1LVAA 4MTEA 1Z9CA 1INLA 4U7DA 2YU3A 3MCTA 4OMZA 2ZW9A 3ELKA 3B3FA 4EJWA 3MQ2A 2X4HA 1ZLJA 4WF2A 5ED4A 2GA9A 4QVKA 5ILSA 2R7DA 2O0LA 3E8SA 2WV0A 3B02A 3ISPA 1M6YA 3B3GA 3COAC 5LEKA 2QBYA 4MQVA 2M5WA 2ZSUA 3K0BA 1ULYA 3LECA 4OIQF 2IFTA 5DSXA 1RI1A 4MIKA 4FS8A 3FTEA 3ABUA 5E1WA 3HUGA 2UYHA 3UJDA 1NW5A 1PRYA 3AJDA 4JBAA 3VSEA 5E8RA 2STTA 3RKXA 2JHCA 1GVJA 2JT1A 2ZJ2A 5LRSA 3KP2A 4O5VA 2QVOA 3ELYA 2WA1A 3SQNA 1G3TA 4M38A 3GFMA 4KIBA 2GZWA 1EAMA 2H11A 3C6KA 3HVIA 2C7QA 2HWKA 2ZBPA 4R8SA 4I0AA 5F1RA 1RI3A 4RYLA 4E2YA 1N2XA 5T64A 3DP7A 4A6DA 2KW5A 1ORHA 3C6MA 4HH4A 1SFXA 3DOUA 3BT7A 4PDKA 2E7WA 3KP6A 3KQMA 4P58A 3R60A 2D1VA 3VC1A 3V8LA 1KYWA 3JAMK 4RTKA 4DKJA 1HKSA 2NXEA 1IW7F 5CUQA 3ULQB 3ZPLA 3M6XA 1TBXA 1S3JA 3WU0A 3GU3A 1IXSB 4R79A 1JR4A 3B5IA 1RNLA 1Z7UA 5DM2A 2OZUA 1FZPB 4KMUX 3UJCA 5ERGB 2LNBA 1KPIA 2QRVB 3GDHA 2OXTA 4X61A 1B42A 2WK1A 3VFZA 1HKQA 5KK1A 5BMZA 3W6JB 3CJNA 4AZSA 4KN4X 1B4AA 4EV0A 3O7WA 5EG5A 3I9FA 5LHIA 4F7ZA 1U78A 3GLXA 4M9XA 4V0RA 3G3ZA 4QTTB 3VB2A 1BI1A 4YUWA 2AVDA 1D8KA 2OB1A 3GIWA 1IRFA 2TDXA 3L9FA 1HMYA 1S29A 2HNKA 3FM3A 3ZN1A 3MFKA 2X0LA 5H20A 3WU1B 5A2QZ 1VE3A 3EVCA 4M6XA 2XUBA 1SFEA 1BKYA 4FT8A 4N9IA 4UHTA 1GXPA 2FCAA 3V7RA 4XCXA 4EQZA 2PXXA 3JWGA 4MGRA 2XAQA 1UCRA 2PT6A 1JSXA 1F1ZA 1X1DA 3BGVA 3JAMZ 2Z3YA 1CF7A 4FR0A 2QWWA 3NVMB 4AUKA 4O29A 3EMBA 1RJGA 3KPYA 1R5HA 4BHPA 3BJOA 3PTAA 4PGGA 4HTFA 4Q48A 2PY6A 3IC7A 2A6HF 4OMYA 3G2QA 1JG4A 3EVDA 7MHTA 3HTUA 1GHCA 2WA2A 4U0YA 1S8NA 2AOUA 2HEOA 5KQSA 3UJ9A 3CVOA 2ZLBA 3KETA 4HGZA 2BYVE 4G6DA 2IVMA 4GC9A 4HSGA 3R9XB 2O3FA 3BKWA 3UWPA 3EVGA 4O3MA 4CO8A 4BHBA 3SMQA 5LQAA 2CW0F 3P7NA 3EGEA 1YS6A 1YZHA 3KEQA 3R3HA 1MJBA 2FF4A 2FBKA 3KR1A 2HGCA 1B9NA 3RKYA 1I4WA 3KQTA 2DQRA 3GCZA 1FNNA 4QVGA 3L7WA 3FXRA 1KQ9A 2KIMA 5P8WA 5KS2A 4R8HA 1UFKA 3EEYA 3T0IA 3ML6A 5T6BA 1G3YA 3HVJA 5FLXZ 1KU9A 4WXHA 1K78B 5CD1A 4WWCA 1JTFA 4BLWA 3ZMSA 3QOPA 3TRKA 3FPHA 4R6XA 1YW8A 3A25A 3TOAA 4IXAA 2JH8A 2ONZA 4GF5A 4CXMA 1QZYA 3MTEA 2E5WA 3PFGA 3FTCA 5K0LA 3GX4X 4FT4A 4QPPA 1XGOA 3WTTC 3DMHA 2ZNYA 3BZ6A 4OIRF 4RVGA 4YFNF 1R6AA 5E1ZB 3LKDA 4GEKA 1FC3A 1NBHA 3K2ZA 5FWDA 3HVKA 3DEUA 4CYDA 2UWMA 2CFXA 3G89A 3NJRA 2P7IA 4Y15A 1G8SA 5K1YA 5D4RA 4LLLA 1YS7A 1OYIA 3RTRA 3KFWX 5K09A 1YO5C 2ESNA 5DPMA 5CYVA 1N7JA 1K79A 1VPTA 3K69A 2BM9A 4YV0A 5D5VB 3GO4A 1YB2A 3WTYC 1L3LA 3D0SA 2XRNA 2EFJA 2QQ9A 2HOEA 4A0ZA 4HV5A 5H02A 2XYVA 4E32A 2ZZNA 2G7UA 4PGHA 1IXCA 2K02A 5MHTA 1F5TA 5FWAA 5LGNA 2EX4A 3FRIA 3C7JA 4FGZA 2AN3A 2MH9A 3E6CC 5EMMA 3E6MA 4RV9A 2YR0A 5K05A 3JTHA 3DMFA 3LA7A 2GLUA 2OO3A 3LQQA 2NXNA 1OYYA 1HBXG 4XLPF 3E5UA 1KIAA 3BUSA 2F5EA 2OZ6A 2R6ZA 5CVDA 2GA1A 3ELDA 3LCCA 4XUEA 1BBYA 2O06A 5GWXA 4YMHA 2DULA 3U2RA 2PFBA 3H3ZA 5HDGA 2PI0A 1R8YA 1O7LA 4CWAA 4L5IA 3KLOA 3GFIA 2JZYA 3F8MA 3PLAE 4DNCA 1FBNA 3IWZA 3PQJA 2AVNA 1XMAA 1REPC 2EFOA 1G8AA 1YFLA 1MJAA 1SG9A 5DTMA 2J5OA 3FPEA 3WGGA 3GRYA 3D5LA 2QRVA 1VL5A 4JK1X 2IA2A 2AN4A 3IL2A 2XVMA 1SUIA 3QOWA 3OPNA 1MJ9A 4YIFA 3JTGA 2CMHA 3BWMA 4RTRA 1NE2A 3KEOA 1JQ3A 5FFZA 3R61A 3F4KA 3DLIA 4RVFA 3BKXA 3V7CA 1L3CA 2Z6QA 5JR3A 3EPPA 3DH0A 2A61A 4P55A 4U88A 4MHGA 4HF2A 1DUSA 3IRQA 3ZN0A 3QPHA 1D2CA 2ZWVA 2P5VA 1P2FA 3ZMZA 1JG3A 2AOTB 2VOPA 2P4WA 1SD5A 5JUWA 2JPBA 2RN7A 4KYWA 3ROUA 4GCVA 3A7EA 2YXEA 3P8ZA 2G8NA 4M7RA 2AN5A 5ICFA 4DQ2A 2BZGA 4CDGA 4HZFA 1ON2A 3I64A 3S2WA 3EYIA 5BW5A 3FHZA 4BNCA 2Q0OA 2FK8A 2ZULA 4RTMA 1KU7A 1KYZA 1NT2A 4GQBA 2D2WA 5EHGA 2JSCA 1RUNA 3T8RA 4L18B 2Z33A 1SAXA 1EJ0A 4CKCA 3SSOA 2MA3A 1V39A 2QUFA 3IKVA 4MHTA 2XBMA 1W5TA 3HSFA 5HOOA 2O61A 3RYPA 2ISYA 2YXLA 1R1UA 2GIVA 2HKXA 3KLNA 3GZ6A 4A2UA 4UV8A 1WG8A 4Q5SF 3I71A 4PWYA 5CIYA 3EYYA 2AR0A 2FNAA 3EVZA 5CVRA 4MEYF 2XVCA 4UXNA 4LG0B 3UA4A 2OAZA 4LB5A 3E23A 2CKDA 4Y17A 1FP2A 2ZFUA 3ZMVA 5ICCA 1P4XA 2VT3A 4ENNA 5DEQA 5ILVA 1R18A 2ERCA 1XCJA 3UBTA 3NDIA 2H6CA 2M8EA 1FWZA 1RI2A 4L0ZB 3GFJA 2EB7A 1QAQA 5J8FA 2B0LA 1FLIA 4EVIA 2ZMEA 3HRUA 1WY7A 1R00A 2XROA 2J5PA 1IZ1A 2P3QA 1LEBA 3BGDA 2KIFA 2E1NA 2FEZA 4O6JA 3KP4A 1BN5A 2QZ8A 1UHWA 2DQLA 2VODA 4M9SA 5GINE 3KPVA 5LLQA 4GUAA 2FHPA 5HEKA 4A0YA 3NRVA 1HXDA 4IRHA 2KRFA 2E7XA 2CO5A 4YV2A 3ELWA 3TM5A 2V1DA 3RW9A 1G38A 2RNJA 3QU3A 1D8JA 2K4BA 3WGIA 2FMLA 5DX1A 4QPNA 1JGSA 5FFXA 3J81Z 2C7PA 9MHTA 3FYCA 1EH8A 2VBYA 3H3UA 4XUCA 5FA8A 2ZIEA 4BLVA 3OZRA 4RB1A 1J0RA 4PCQA 4K2EA 4IRIA 3U81A 3PB3A 1FSEA 3IEIA 1WS6A 3OZSA 2Z5UA 4EM1A 4POOA 5F2OA 3LBYA 2IPXA 4IHTA 1FYLA 3KR0A 2QE6A 4E31A 3M8EA 3CCFA 3FUTA 3CKKA 5FTWA 4CXFA 3P9NA 4N0BA 4AD9A 3LHDA 3PQKA 4MQ9F 1WWXA 3P9CA 5DUKA 4H0NA 1H9GA 2EV0A 2YUIA 3KCCA 3DV8A 1IN5A 1S7AA 3TDUC 2VBXA 5EVJA 4QQNA 4OBWA 2O03A 3G7UA 4GYGA 4ZTBA 1EIZA 3F8FA 4OIPF 3FMRA 2LDUA 5LQJA 1YFHA 3M70A 1BI0A 3HYIA 3W6KB 3HTSB 4HOBA 1LEAA 3GVAA 2V74B 3G2PA 4B09A 5E17F 1H0MA 2YPRA 1SMTA 2GXGA 2Q2EA 5D5UB 4MEXF 3F3XA 2EK5A 3NTVA 4HX7A 1NW6A 3R0JA 8MHTA 3WSTA 5C1IA 3K6RA 1U6GA 5D6FA 5EKXA 2GPYA 4IHSA 2IIPA 2EFNA 3SM3A 3ZMDA 3R24A 1QO0D 4A12A 2DPMA 3CUQB 2GXBA 4M6YA 3TPZA 3I4PA 2P3OA 5BP7A 3T0YA 5TRDA 3C3WA 3WGHA 5HVQC 3JWHA 3F8BA 2XV4S 2FBHA 2UYCA 1U8RA 1GXQA 5EIFA 3A27A 5BS6A 4UVAA 3BPXA 3TO7A 2R3SA 1R7JA 4EKGA 3KP5A 3T7TA 3D2LA 4A5NA 4IV8A 4X60A 2AOTA 3G8AA 1SUSA 1SMYF 2ZIGA 1FBUA 2PVCA 1YW9A 4MTDA 5E8GA 1JQEA 4LK1F 4KDRA 2OQGA 1NW3A 2CWWA 2NNNA 3DKWA 3CLOA 1XCLA 1LJ9A 4ENJA 3QP5A 2CMGA 1O3TA 5DUIA 2V9VA 2Q41A 1WSUA 3MAGA 1TNSA 2GH1A 1EH7A 1KGSA 2MD5A 3ER9A 3LAPA 1FJXA 1D2HA 1NW7A 1O57A 4WXDA 3SVZA 2NP7A 3I58A 2PEXA 3LQRA 4PYNA 3FRHA 3M9AA 2GA2A 3TFWA 3TQSA 3BOQA 1SVUA 2M1BA 1OMIA 3N97A 1D5VA 5CCXA 2NAZA 4KN7X 2RV8A 2COMA 3LCVB 3K0LA 1SD4A 4Q4ZF 4F85A 1KQ8A 5KVAA 4FSDA 4KMFA 3FTDA 3TR6A 2FE3A 2ZNZA 4QTUB 4GOMD 5E9QA 1T43A 2O6GE 1YQAA 3CGGA 4RWZA 4ZYGA 5FULA 2PG4A 4QDJA 3MHTA 3GF2A 1FPQA 3KQOA 2LSOA 2B2CA 1TTYA 5D5XB 3RKWA 1V4RA 2FMYA 3N4MA 5CVJA 1W4MA 3FZVA 2EA2A 1SD6A 2F5DA 3EGVA 1G60A 1LDDA 2PKWA 2DT5A 2QYOA 2PJPA 4KIFA 5E8IA 3ORHA 2QQBA 3RJPA 3QAHA 1B9MA 3GYHX 2FQ3A 3P2KA 2HZTA 4WX9A 5LEJA 2M87A 4DMGA 4P9UA 5E2AA 2PLYA 2NNYA 4GO1A 5FA5A 4L9NA 4PCAA 2IDJA 3A26A 1HKTA 3NW9A 3F21A 4XSXF 2O57A 5F2NA 3HCFA 2UYOA 3GRUA 1FOKA 4PYOA 5K0EA 3UZUA 4G7OF 3A7DA 2UYQA 3BROA 4EJUA 1QPMA 5LQUA 5K0CA 1UFMA 2I9KA 4LGWA 3EDPA 4BY9E 2A68F 3M8FA 1USTA 2DFIA 5IT9K 1BC5A 4RTNA 4BXUA 3ERCA 1XN7A 3V8VA 3HRSA 1XJ5A 1XCVA 3HCBA 1U5TB 3J80K 3M33A 2VBZA 2VDVE 3OE5A 3F6OA 2AZTA 3DUWA 2BV6A 4HX4A 4U7PB 2GWRA 1H1DA 2ZZKA 4P7FA 4WXCA 3H92A 3KU1A 3NVKI 3REOA 4EK9A 1HW1A 2OBPA 3RDIA 2HMYB 1KQ0A 3M4XA 1D2GA 3HA3A 3BPVA 3DMGA 1L1EA 1YLFA 3BGIA 3ME5A 3HCCA 3SR4A 4LJZF 4EKIA 4RVHA 5DD4A 4ESBA 1RIOH 1X1CA 1UB9A 4KDCA 3T8TA 2WWYA 4ZYDA 2VP3A 3GEZA 4KFCA 4OIOF 3P97A 3LFKA 4RB0A 5K0BA 3FWEA 2O8XA 2FPOA 1RI7A 4AZVA 3FPFA 5EC8A 3DPTA 5ICEA 1MKMA 3V8KA 3VEPA 3JWJA 3KPWA 4HF1A 5HS9A 4Y2HA 3DFGA 1Y0UA 4HG2A 2A6EF 3FMSA 1YF3A 4BQAA 3LAJA 3HP7A 2O07A 2HR1A 5H6RA 1QAOA 4Y30A 1J9IA 2PX2A 1XGMA 2PBIA 3RODA 5EHIA 3CTAA 2E1CA 3OZTA 3OFJA 3I59B 5HZMA 3DXXA 4IWNA 1J75A 5E9JA 2ZFWA 5HLHA 2PX4A 5HFJA 2HKOA 3K9TA 2MLKA 2MC3A 3HOTA 3LPMA 5BPDA 1USSA 3MTIA 4XUDA 2R7FA 5FO5A 2PGXA 4C06A 1F3LA 1SFUA 4P7KA 1VBFA 3ZMUA 5KQRA 1XSXA 4YUYA 2W24A 4PCLA 3HRMA 2YVLA 2VE8A 1G55A 4P7JA 2EFQA 5IT3A 2PXCA 3E97A 4CKEA 1IM8A 1ZG5A 3PS9A 4KT5C 2FU4A 5BQTA 4I0BA 5GM1A 1TNTA 2XIGA 2PQ8A 5EIWA 4GC5A 3KQVA 3EETA 1UWVA 3QV2A 1KPHA 1WXXA 3QP6A 4LG1A 2XVAA 2DAOA 5HILA 3TOBA 2PWPA 1UHMA 5K0GA 3R6TA 1O9GA 3OOPA 3HRTA 1FT9A 3Q5FA 3AXTA 2P8TA 4ETSA 4IPAA 5LHHA 3IYLW 5M5BA 2BGCA 2BR4A 3F23A 5JFRA 1KXZA 1TQIA 3C18A 3V4GA 4RTJA 4R6WA 2EWNA 1DP7P 1AV6A 5CJ9A 2C6YA 1VLMA 5AONA 3CBGA 3HCAA 3ANXA 1YG2A 3HNRA 1P4WA 2DPUA 4PYMA 4LK0F 3EEOA 2UZKA 4ER3A 4DCMA 3BWBA 2QQAA 1PDNC 5IKMA 1QAMA 5EEHA 4YFKF 3B3JA 1Z3CA 2MH2A 5FGMA 2ZO4A 1ODDA 4EM2A 2DBBA 1NKVA 2ONYA 3V7SA 1IF1A 2W25A 2PLWA 3FYDA 2HDCA 5LQKA 3T7RA 3FUVA 5DLYA 1IN7A 2FA5A 4KDPA 3BWCA 1O3RA 2PMHA 3K1MA 2HQRA 3T7SA 3BWGA 2YTZA 1ORIA 1ZRDA 4ESFA 3CO7C 1R5GA 4G7ZF 3TM4A 3VODA 2IBSA 4GXOA 1UIRA 1J2XA 3EGIA 2H94A 3G5TA 1SD7A 1I1SA 2B9EA 6PAXA 5DXJA 2P40A 4CTJA 3DR5A 3F6VA 4IF4A 3FTFA 4BAYA 4WK8F 1K6OA 2P3LA 1AOYA 4YUXA 3KR9A 4EGYA 3HTXA 2EA4A 1ZLKA 1ZG3A 3HOSA 1I27A 1JQDA 4GOOD 4ZZLA 2ZWAA 2EV5A 3VOEA 2ZVJA 4X41A 1A04A 1EV7A 1PP7U 1EJ6A 5E20A 4ASNA 1PP8F 4PYIA 3KR2A 2ZIFA 2BBYA 4PYLA 1I6XA 4UVBA 3LDUA 4KW7A 1IUYA 4RGUA 1P1BA 3RPUA 4IVNA 1T2KA 4UNOA 5BW4A 1BC7C 1XDZA 1U5TA 1WQ2A 3OU6A 4GOLD 4E33A 2UXXA 2EJTA 3K1PA 4ATNA 3T5XA 3SZPA 4HRAA 5ICGA 2FRHA 2DW4A 1JG1A 2IA0A 4EJTA 3WTZA 4M74A 1DPRA 2OZVA 2BH2A 4KIGA 3QU6A 5LRRA 1X3UA 4DF3A 4I09A 1BI2A 5IH3A 3LA2A 3PFIA
chains in the Genus database with same CATH superfamily
1QU2A 5BWNA 1ISPA 1X15A 3OLYA 3DXFA 5ADHA 2F5FA 4N5LA 1W4ZA 2V4UA 5D8DA 2EJRA 1LJUA 2WIFA 1JDNA 3IV5A 4HZUB 2Z3ZA 4WNCA 4F9EA 1YNOA 4BH9A 3ETLA 1CHDA 1PJRA 1TWHJ 3CC8A 4RSHA 1PWXA 3KYDA 3L00A 3UMBA 1SKMA 4Q47A 1N9KA 3G5AA 2RIRA 5E1XA 1OAOA 3PDCA 1WMAA 2FNPA 5JTTA 3S1QJ 3LC1O 4US0R 1GZ6A 4FDVA 4RS3A 4YR7A 4B3AA 3NR2A 4FNOA 3KYCB 5IK2D 2PH1A 4IOLA 1MIOA 2G9WA 1EINA 2WSLA 4WZBE 4OJKA 1JXQA 1FTGA 2R00A 3FPBA 3DL2A 1X7XB 1L4MA 3CB4A 5LUAA 1OT3A 4RVCA 3U3OA 1F0PA 1I3OA 4LMAA 4LNUB 3OOEA 1YCFA 1DRKA 2V7QA 1XZPA 2X41A 1Y7LA 1OD6A 3PQFA 3ED1A 3V32A 3DE2X 4NJEA 3CRQA 5KVQA 1J99A 5NLLA 2BP7B 2YWFA 3O1JC 4INJA 2VA9A 4YB8A 3LDFA 3NCHA 5FPQA 1NVTA 5CLSA 3HXKA 2VTBA 4YIIA 2CHVA 1BKDR 3OJWA 1QYVA 2G3YA 4EJFA 3LTNC 2IWRA 3BD6A 3I8OA 2P4SA 3NAZA 1MGPA 5FI5A 5LQRA 3A6FA 1NBMD 1FU8A 1IUKA 2JFWA 3OH8A 2VRNA 3NTQA 2IPMA 2QLZA 1R5OA 3QWAA 1P6XA 2E5LB 1JYEA 2Z8ZA 1G5RA 4CV3A 4PQEA 2PH3A 3GLGB 2PBFA 3I05A 4EUEA 1QFJA 2DPDA 4HB3A 2JLXA 3MC1A 2VUIB 1MHPA 2XUKA 3MMNA 4ZYTA 4IJAA 5F4ZA 1RRJA 1NN0A 4E14A 3MJHA 5DNEA 3SKXA 1L7DA 1H6AA 1SIOA 3QYPA 4UARA 1RMQA 3DTNA 2QQ8A 1KO1A 4CHUA 3GLFA 4PIVA 2OU2A 2IGNA 3LF2A 2OCBA 1G1AA 3C70A 4AG6A 4L5YA 4NECA 3GARA 5ITVA 2OZKA 1E1RD 3L41A 2DFLA 3F1LA 1Z7WA 3IE0A 3SVTA 3I0ZA 3B8HA 2PT9A 4J9VA 2VPXA 2G40A 3RUEA 4DCVA 4A3MJ 3SYMA 3BIOA 3SZTA 1FUUA 3DTKA 1A69A 2IDKA 3G6EI 4MUIA 5L4LA 2HGZA 2NXJA 4D41A 4PJMA 1N36B 3OCVA 1IRGA 2FZEA 2P90A 4ES6A 3HH8A 2I4RA 1SUPA 3O8RA 2CJYA 1QHHD 4Z0NA 3RGWS 3E6DA 1Y3BE 3PVCA 1XTQA 3TW8B 1TJ4A 3G8CA 3M9WA 421PA 2XLCA 1R9TJ 1D1CA 4EG4A 2YFYA 1SKYE 4KICA 3K9GA 4HFJA 1N5KA 2X0RA 3SKVA 3WIOA 5TQ0A 3LPCA 4LJ4A 5BRAA 3CZAA 5BQFA 3SQDA 2OGSA 3THRA 5EZYA 1JMKC 2D4HA 3HPHA 1L7OA 2HD4A 1P39A 3ROTA 1PVDA 3MK31 1I0ZA 4EZEA 3TUZC 1CEXA 4TMKA 3DAOA 3G9QA 1ZG1A 3O8LA 3RUFA 1H2XA 3I9V6 1J0BA 2QP4A 2SKEA 1KVTA 5K0FA 4N0PA 2JFVA 2F59A 3V4LA 2OE2A 4JGBA 2FLVA 4GPBA 4G5RA 2IHTA 1RADA 2G83A 4X1IB 3JSPA 4CEIB 1WMSA 2DO7A 3NQOA 2IYVA 4MOWA 3AKDA 4MRNA 1EGVB 3A4TA 1IIBA 1FLVA 1VE7A 4KU4A 1BIBA 4OJTA 2NUPA 1YB5A 3C97A 1IB0A 1FMCA 1SU6A 2JIMA 2V3VA 5EHZA 2LY1A 1TC1A 4P83A 1KYTA 3QLJA 4FFWA 1II8A 5J1SB 2JASA 3M82A 4ZPJA 1CQXA 1C4KA 1ETUA 2NT4A 3UHJA 1R4ZA 4L9SA 1C0PA 2HADA 4QELA 4EKDA 2DA2A 5HF6A 2JJQA 1R9GA 1GKYA 2V6MA 1K66A 3HFSA 1VKHA 4TWAA 3ZGZA 3K20A 3ONEA 2GN4A 4YP1A 1QBJA 4OSOA 2VXZA 1Z75A 2C5HA 4ESJA 3WI7A 1YASA 4CMGA 3MJEA 1PUJA 5LLTA 1MH3A 3VSDA 2IH4A 2G0NA 4AYXA 1QG6A 1GQ2A 2DOFA 1PJBA 1MABB 5HJ2A 4BMCA 3OKFA 4BNZA 4RULA 1WABA 3OYAA 3TMYA 4EJOA 4GG1A 1JKXA 2VHQA 3R3UA 5A3QA 4PBRA 3CVVA 4PAQA 4AWXA 4URVR 2I7CA 2UZAA 2PZEA 1RUOA 2OFOA 4A3KJ 4YT4A 1PL0A 2BTOA 3FX3A 5CA0A 2FPPA 2R5FA 1S1MA 2NS0A 4ZRNA 3PRYA 4OBXA 1I13A 4IVQA 2YHSA 4UNSA 5F08A 2EP8A 1JTXA 3H84A 4NC9A 2VRBA 2RE8A 3IV6A 5IY5H 4PN3A 2Z6UA 4U0VA 3Q5GA 1NQWA 1V7ZA 2FOXA 2W83A 2AFHE 3N2GB 3U39A 2PBZA 3EAFA 4NCAA 1Y1VJ 1NUAA 2I6GA 4EUNA 3HU5A 1F38A 1Q7EA 3M8JA 3K5IA 4GT1A 3V1LA 3R5TA 2CLOB 4AURA 4BXOA 4JGIA 2QZSA 2IHKA 4IUCS 4X8OA 4O4IA 4UBMA 4A5SA 2PSSA 2Q3HA 4ZJPA 2WJVA 3ETJA 2IUUA 5CDSA 4MV8A 2H1IA 1F2TA 5LBIA 1Q3KA 3F71A 2ZSHA 3GTKJ 3VHQA 2FW0A 2DB3A 2CKMA 1Z7GA 2DKOA 1YZUA 5F7ZA 4I46A 2IA5A 5JZSA 3ZW9A 3BHNA 1YQUA 1CS0B 1WXEA 3PT9A 5DYMA 4PLWA 4CZZA 3CV3A 3SEQA 4AQ7A 4FGWA 1OVMA 1GKIA 4AY3A 2B1RA 3EXHB 5DZSA 3WBJA 2FA9A 5FKKA 2P1DA 4ASUA 3WE2A 2CCGA 5HE9A 3P9RA 1C3JA 5DIFA 2GFIA 4J4HA 3UK2A 2ZRPA 2C88A 5AICA 1TRKA 1FXWA 2B8NA 4DIUA 4NYMQ 1UDRA 2I8LA 4Q3DA 3GZTB 2XAUA 1MSEC 3S5JA 1TVKB 4OGKA 1L1RA 2UV1A 4CICA 1F8XA 3PC8A 5I7FA 1LBQA 1CUWA 5GJVC 2P3SA 1Z4PX 3W3AA 3CH5A 3T52A 2PRKA 4QJ3A 5HX7A 2V3CC 1GTMA 4LF6B 2GPAA 3CPJB 3BMNB 5ILSA 2XT9A 4BO2A 2KBEA 2VSXA 3U1KA 1P0FA 4CVNA 1V5GA 1NP7A 3MT7A 4RLQA 1CZOA 4FDUA 3UJDA 1OR7C 1XNGA 2STTA 1EWVA 4DEXA 2JHCA 3VJLA 3OIYA 1OX6A 3TAUA 3LUFA 3ELYA 1YBAA 1QB7A 2CFTA 2YC2C 4CMEC 2PDAA 2B9SA 1ECFA 4TV8B 3KEYA 5A7FA 2EQAA 1GSHA 3ESAA 4BFVA 4MARA 2HI0A 2CWDA 1CIJA 3QWFA 4ZDKA 1HKSA 4DANA 1W4CA 1OZ0A 3ZDQA 4IDPA 4Y0AA 4LOKA 2HXOA 2XRMA 1MJ5A 4RDUA 3ZDFA 4JP0A 4IXTA 4X61A 1ZSYA 5EZ6B 1F48A 1BVRA 3FXOA 1G0NA 3QXCA 1Z4NA 2ZAOA 1BMTA 3S2IA 3UO8B 1IY8A 3JRCA 4ENSA 4WEQA 4BAGA 3S5UA 1SPBS 4YP5A 3LFTA 1YJXA 4A0RA 4M53A 4DC0A 5IBCA 4M6XA 4NF2A 2Q4OA 1DBIA 1B8PA 1IIRA 4BQSA 2ZRHA 5KQLA 3H13A 4ZFNA 2WSSA 1L4HA 2PD3A 4LDPA 3MKZA 4WBNF 5JNLA 3NVMB 2PZLA 4WFKA 3NONA 3K8ZA 4HGQA 2WNIA 2ZJZA 1MG0A 7MHTA 3IQWA 2ICWG 4NP6A 4RA9A 5C7LO 1NI5A 3ZQQA 4HGZA 4MUGA 4URUR 1JI8A 1RHUA 5DHQA 1HDPA 4Q1FA 1NJ1A 3W6ZA 2GESA 3LLUA 2J08A 2C97A 2VJLA 3L7WA 2KIMA 2KT0A 2IEZA 1Q7CA 1L1FA 4LGYA 1N6IA 3K32A 3T3PB 4JSYA 2CYAA 1YW8A 2ZXEA 3B13B 4ROSA 1MT0A 1CB7A 2HL6A 3SYLA 4W82A 5HRUA 3GMIA 3H65A 3DAFA 3FF4A 4QPPA 3OO1A 1JT6A 3FVWA 1GLNA 3GNQA 1RRKA 1EVQA 4GEKA 5JZ9A 4DV1B 2W2XA 4UHKA 5HCNA 2FB9A 3LUDA 1Z4KA 4KQCA 4YBRA 4LC0A 3I01A 3ZWOA 2X9QA 5ITSA 3FHJA 1IQUA 2QQ9A 1JFRA 5B5SA 1RFLA 4A0ZA 4HV5A 1JKPC 1NM5C 3TZKA 1E92A 4I50B 3DQZA 3MWEA 5CH5A 1NHGA 5MHTA 3E6CC 1LNQA 4BVJA 3C6QA 1OASA 3F5DA 4LYJA 3T9CA 5FRNA 2FWRA 5GP9A 4YJHA 4JYBA 4D98A 2RCNA 1ADCA 4A8JC 3ZGYA 1BW9A 3IR5A 2EAUA 2OORA 2ECQA 3OSZA 3HBMA 1IRIA 1L5GB 1IZZA 4FX5A 2BY4A 2J5OA 1CZNA 1QZ3A 3UUFA 4TV9F 3K2EA 1SUIA 4TMVA 4U2FA 1XUOA 2CMHA 5C18A 3BWMA 2GAJA 3TW7A 2J5RA 3BKXA 2GKOA 1H85A 4TVOA 2JA2A 4LN1A 2IT1A 4PPQA 4XVRA 1XGKA 4BY1J 2HU7A 1Y3DE 6CHYA 2IPOA 4JVNA 2Z3WA 1ENHA 5HZHA 4Y6QA 3K6GA 2PM8A 4Z4GA 4XLEA 3JALB 1QO0A 2VHEA 3ECAA 1BZYA 4WKGA 3PCTA 2C83A 3DKXA 2HC9A 4OKIA 5LP6C 4BVKA 1VLHA 3EXIA 2VHJA 1XD9A 1OU0A 1G8PA 2WVJA 3GNTA 1TZ2A 2P0AA 4XLHA 2GCNA 4B5LA 1MEEA 1UKZA 4ND6A 1RMTA 5D6OA 1XRRA 2BOLA 4DLTA 3KLNA 2VDRB 2NO4A 1V54H 3BYZA 1R12A 2HXYA 4MEYF 4UXNA 3U19A 3JASA 4RMGA 5LBTA 1JKRC 3IVMA 4HUTA 2EBUA 1LB1B 2Y8EA 3QHQA 3TCNA 2EB7A 5ALVA 3KWLA 3C16C 3GEMA 1U3WA 2D6FA 5LD2C 1BN5A 1NPDA 1XMXA 4M9SA 3KUUA 2ZDHA 4PLHA 3TM5A 5F1PA 2XPWA 4B6GA 2H9IA 5FA8A 2HPVA 5HKKA 3NV7A 4PCQA 2I8CA 3BF8A 4EVSA 3X1WA 3B48A 4BBRJ 4ALJA 4POOA 4HPQA 4EHNA 4DL9A 1FSZA 4XOIA 3N2KB 2LK2A 3FUTA 4OV6B 4ZREA 4GX2A 3BTSA 3ZIUA 1H1LB 4WY5A 1HOMA 2FMFA 4KXMA 3P9CA 5AW5A 3IP6A 1QCYA 4ZT3A 3GOQA 3EDQA 2DBYA 2CSXA 4GYGA 2FWJA 3T5DA 3P52A 2JKYA 1Z2AA 4GWKA 1ZBQA 1PNVA 2V74B 3KAQA 4B09A 3OYFA 5E17F 1M73E 3S2ZA 4FE4A 4Y18A 1U6GA 4QRIA 4D3SA 4MS1A 5B57C 3BR3A 3CVYA 2DPMA 3OR2C 3B36A 2MSCB 1CUJA 3T0YA 2R5YA 3E8MA 3ZCSA 1RAHA 5AUPB 2ZB4A 3M4NA 1HRDA 3WNCA 1X7HA 3AVTA 5BS6A 3IQXA 1XE3A 1WEKA 4E5UA 5EWLA 4CSWA 1XZIA 3EEBA 2W6OA 1SMYF 4MX8A 2PVCA 2OQGA 3GJTA 4Q37A 2W8ZA 2VK1A 3QE9Y 5EQDA 1GTJ1 2JLQA 1T24A 4M0UA 4ZDLA 4RPCA 3V1YA 5B1AH 5AM0A 4MKRA 4BX2A 2Y6UA 3GMTA 3FRHA 1E3TA 3VHLB 3L8GA 3Q8XB 1D5VA 4JI7B 221PA 1JVSA 2NAZA 5IYDJ 1CJMA 4PFOA 3C14C 2XGJA 2G1UA 2J6BA 2BHZA 1HOTA 4S0ZA 1F1JA 2B2CA 5IAGA 1JUDA 3NANA 4AB1A 3WWOA 4E6PA 4CJXA 5KUTA 3FYUB 3E7FA 3IKLA 1NXQA 3R5JA 3IP4B 1ZMRA 4QFMA 1RC1A 3DKYA 1Q1AA 3RK0A 1GNRA 3JYOA 3EZXA 3BG9A 4GFBA 1MC4A 5ALHA 2FZVA 4WX9A 4TMZA 1CUDA 1FJLA 2DT7B 4ZEWA 3GFRA 1J21A 1Y9AA 1KRXA 1V5IA 4R3UC 2R11A 1FOKA 1SBQA 3DEIA 4Q34A 1BGVA 2D7JA 5HF9A 5JARA 3GAMA 2GAAA 1G3IA 4AICA 3TG2A 4W7IA 2IHUA 2GD1O 4MFEA 4C87A 3JQ8A 3J80K 3HADA 5A4JA 2RHBA 2EJWA 2RHLA 1T10A 3SLGA 2GTIA 3KU1A 1F12A 2VSFA 1UOQA 4P54A 3OJFA 1Q74A 2PR7A 1Z18A 2O3JA 2OC4A 3OQ6A 1IV6A 2JA5J 1K7FB 1WUYA 2EILH 1QFYA 3VTZA 1BQEA 2B94A 3NM4A 4BAUA 1ILWA 1JUMA 3JPWA 2EZIA 3ZC3A 1XZDA 3DZDA 4NY1A 1Y63A 1WTCA 4GVPA 3HP7A 1PDOA 5C53B 4OREX 1Z4IA 2OKGA 5B7PA 2ATEA 4YI3A 5AFSA 3J81A 1KMQA 3L8CA 1VDZA 4TLDA 2PS1A 5E3NA 4HATA 3HOTA 1M34B 5C8YB 3QJ5A 1QCDA 5J2TF 1IEVA 1HGXA 3NJ4A 1Y37A 4LEIA 1SBCA 3CVJA 3THXB 3C7AA 3LKBA 4CT0A 3QV2A 4DMKA 1KPHA 1M2HA 3ZGOA 5H2FC 1O9GA 2GZ2A 2XC7A 1BS9A 1N8NA 1GL7A 2BR4A 2H1KA 1FXUA 2V58A 5I5EA 3O90A 2EWNA 4EYQA 5HW0A 2B92A 4UBOA 5BN5B 5M3BA 1PS0A 3O94A 4PYMA 1LSJA 3LYHA 4XPIA 2OK8A 2QR3A 3JQAA 4YUAA 5CJ2A 3HI4A 2YINC 2PEYA 3HYRA 1Q20A 4DV0B 2EHDA 5KNBD 1O3RA 4D0NA 3L2WA 1QHXA 1KQGA 2YIJA 3DUFA 2YJZA 4J90A 3D43A 2PGAA 3LQYA 2F3QA 1P0MA 1N2HA 2WP0A 4D7AA 1GEEA 5AM2A 2A0FA 2I10A 1QIDA 2I87A 1ZJZA 1H8EA 2EA4A 1Z2OX 3HOSA 4ECEA 4IG4A 3THWB 3P5JA 1CY4A 4MVJD 5EESA 5AK4A 3B6MA 4AZ0A 2FWMX 1W0JD 3L4BA 5JNUA 3CF5F 3RPUA 4ZI3A 5B4VA 1O97C 3SZPA 2Y31A 1UPCA 3U44B 4JUBA 2VDQB 1Y5MA 1DPRA 2OZVA 4Q3LA 3UGJA 1ZGGA 1Q1HA 4DJDC 2ZBGA 4BDTA 1EZZA 1G8GA 5A4FS 3KBBA 3GW2A 3IMGA 2ZXJA 3FM5A 4IHAA 1U5BB 1KQNA 1M1YB 1H6DA 2B4TO 4RGXA 7ABPA 5B6JA 3GMSA 1XXLA 3HWRA 3BTLA 4ZH4F 2HA7A 2JLSA 1B72A 1TKAA 5BNTA 5E8JA 1QONA 1W48A 3TB4A 2X7XA 5K45A 4PZLA 3EPZA 1EFKA 1OLXB 2DLNA 4XFDA 5IFLA 2DECA 1K4MA 1NMEA 2FSIA 1N0HA 2ZYDA 2IYFA 3WNQA 1QP4A 2QZZA 2H6BA 2P81A 2UVDA 3GJ7A 1FFBA 3CLTD 1BC8C 3EGWA 3ZHYA 2X3YA 1EVLA 2FJUA 3RIXA 3PXDA 4E15A 3E22B 1G20B 2P6OA 2REXB 1AKEA 1Y1LA 5D4SA 1LV8A 4G4IA 1KFJB 2D45A 4GZ6A 4INZA 1H9CA 3ZE9A 1W0UA 3AVWA 5CFRA 4BZQA 3TNFA 1X58A 2FW6A 4LYAA 4MS4A 5CQGA 3O3KA 4JB2A 3FY4A 5DGCA 1WJ5A 4DIKA 2DMNA 3EY4A 4NTZA 3R3XA 4U7HA 3ONDA 1ZIXA 1F0KA 4G4GA 2GOYA 3AR4A 3UAVA 4C6TB 4UTRA 1EAYA 3L8YA 3H36A 4LHEA 1FYMA 4EMSA 3BRCA 5J2UA 2OSVA 1DPUA 4K03A 3KLMX 1JHHA 1SXIA 2RSLA 4I5FA 3H17A 1HNZB 1QKIA 1SD2A 4K46A 2VRCA 4LD5A 2YIMA 3KQPA 2O3TA 3TIIA 3GJQA 3QVSA 2WKRA 2HNHA 4OQXA 3F7OA 3A10A 4OQDA 4DDUA 3ND6A 3SZ3A 3IJEB 1B6SA 3C4VA 3DEJA 3PZBA 2O0YA 4GVLA 3LAWA 4WUTA 2BY0A 2E5NA 4UW9A 2MYSA 5HP4A 3S17J 4QWMA 3VYTB 1KSJA 4JU9A 5KNCD 5JDCA 4Z4HA 4ZQEA 3RUAA 3Q87B 3MS7A 4HBZA 3L0BA 3ZNQA 3T1NA 4C5AA 4Y13A 3T1BA 3LHIA 4K86A 3FCSB 4BFSA 2M7BA 1G2PA 5KTMA 3WTVC 2V7QD 5SZHB 2QRMA 2H85A 3D59A 3ZQ7A 1K9VF 1Y6ZA 5E9WA 5AXBA 4ZICA 5DOVA 3QELA 1JBKA 3IJPA 1CD5A 4JFRA 1AKYA 4RELA 4HXGA 1RIIA 3NUQA 1PSWA 4HB4A 1K7YA 5JS2A 2COUA 3L07A 3RROA 2WU0A 5HZGA 1MZVA 4RC9A 1GGHA 4XOTA 3CX8A 4MTLA 3LNQA 4ZGGA 4I1YA 3SLKA 4I4TB 3PC2A 3ZDYB 3SX4A 1XLTC 1Z08A 2V7VA 4H6XA 3LGXA 3WMRA 3KZYA 3GWGA 3BRWD 3OSUA 5LL6P 1ETOA 3Q3VA 4PZDA 1Z8DA 3GRVA 4MIYA 5A5VA 4ZMBA 4RGSA 1OGYA 3BR2A 1PTJA 4NCHA 4KN9S 1C4WA 5LB4A 3PHJA 3LJKA 1QR2A 2W93A 4R2LA 4N01A 1RMYA 4QJ4A 2I2CA 4G1MB 4XGNA 1FSHA 2Y1XA 2M30A 2B0JA 3O83A 1GVNB 5ALTA 1OI7A 3KQQA 2PKEA 3O5AA 2W57A 2XCRB 4X63A 1LPNA 1RPJA 4XNFA 1KEKA 1I4TD 2H1RA 4K3UA 4KT6A 1O6CA 4E88A 1QS0A 3I6YA 2Y77A 1AS2A 3FE2A 2VC0A 1X87A 4ZZDA 3TZCA 1VFNA 1TM4E 3E7LA 5CFQA 2EKDA 3PXCX 2EW2A 2QGNA 1NLZA 4FOTA 2A9QA 2MABA 3F4LA 1WCXA 1RYZA 4ETNA 3WQHA 2NOAA 1TDJA 2R4TA 2BRUC 2QMOA 3E70C 4GVXA 1VPWA 1IBLB 3EH2A 4KLZA 3H8SA 3E15A 4MLCA 5EERA 4IDNA 1YZ3A 2BHRA 4RJLA 5CLLA 2COBA 1ZVVA 1EWTA 3FETA 4R1QA 4Y7NJ 5EIBD 3WDKA 4A3DJ 1EZ4A 4XTCS 1B73A 3K72B 2BFDA 5EINA 2M2EA 5EMLA 1WHSB 1X7WB 4B45A 5ERXA 1KFBB 1OTHA 5AI5A 2RD2A 3EZ9A 6YASA 2GZDA 3HB1A 1JLLB 1BN6A 5BN3A 4QKQA 2BKXA 3ZIAA 2XE4A 1QIEA 3FAZA 1NZFA 3K35A 1KJJA 3BN3A 4E2XA 1Z26A 3PENA 2PSDA 3LOPA 5JS6A 2F90A 2OAEA 5A03A 4G67A 2P5KA 4QDKA 4FT2A 3Q1KA 3ZDCA 5GQSA 4JR0A 5F5LA 4ADSG 4FTHA 1IZ7A 2O52A 3ORFA 4QPZA 5LD2B 3ROKA 1X1SA 1BCSA 2XI4A 3HHGA 5J1YA 2O0JA 2A33A 3HR8A 1XTUA 4B33A 3M89A 5CB4A 1U7HA 2QRUA 3WS7A 1FX0A 2LBFA 4M3DA 4C0BA 1A5TA 1YS9A 2G63A 3NLLA 1MOSA 3V7FA 4EG1A 2R92J 3QSGA 4HMQA 5LBQA 4F0JA 5JTUA 2I8AA 1UAYA 3U7JA 3WOVA 1HE3A 1KYQA 4S1TA 2BSQA 4UTNA 1PUEE 5JD3A 4GMFA 3UNXA 3K0EA 3HOWJ 1I3CA 2J3HA 3WQBA 1YZTA 2VHCA 4CCLA 1YDGA 3EEFA 3EXEB 4KXLA 4MV4A 5D3ZA 5K0NA 3W5VA 4AJEA 3D64A 1G8MA 2XYRA 3ZJUA 2H4FA 4Q9IA 5IBQA 1O03A 4RGVA 4N0MA 4PZ0A 4YV1A 4NC7A 2ADUA 3K0FA 1P4GA 4N4OB 3ZXXA 2PQ6A 3KTDA 1KYVA 4MQ4A 1B8OA 4KOEC 3BZUA 5AHKA 1C30A 1JJ7A 3I9OA 5J1UA 4KXQA 3SOPA 2E4UA 3MEXA 2HFHA 5HQJA 2Q2VA 4I8XA 3WGKA 2B30A 5IAKA 3LLMA 2P6MA 4GQIA 4WCVA 4J0EA 3NWTA 4R1HA 4KN5A 5KQMA 1DHTA 4H27A 4MGIR 3TVTA 1E9CA 4R2MA 2LDXA 4DM7A 1T5IA 3PYMA 2F8SA 4I1UA 4XCVA 4DB4A 1R6BX 4E2FA 4G5OA 1DJQA 3K4LA 2AMYA 1GARA 1UP6A 3DDUA 1ZOPA 1WLYA 3LOUA 2W4SA 4C04A 2V6IA 4RVUA 1RZ4A 1CVLA 2VZLA 3DDNA 4M1ZA 1F60A 4H7EA 1IMJA 3ELKA 4MVCA 3MWFA 5AW7A 1U02A 2PH7A 3AHFA 4Z0TA 1EJ2A 3LYUA 1W9HA 2ZSUA 3HSKA 1SZJG 1MB4A 4RV4A 2YZ2A 3TDKA 3DNFA 4IOJA 2KHMA 3EAQA 4YCLA 3LFHA 4JBAA 5E8RA 3D8BA 1V1JA 4F3CA 2JT1A 2GJ4A 4PFJA 1AK1A 5KAIC 5I6DA 3GFMA 2GZWA 3W04A 3O0DA 2QOEA 1X6VA 3G5MA 3QODA 2C7QA 3DPIA 3V8EA 1VL0A 2C8JA 3PYXA 3DP7A 1L5WA 2DF8A 2CFSA 4PSUA 3NBAA 1GNQA 1ZUHA 5CUQA 3W7BA 1TBXA 2XTNA 4LHWA 1NR7A 2YXBA 1OLSB 4P8RA 3ZYCA 1P9RA 2JGFA 2JA8J 5EG5A 3F9RA 4O5OA 4C3IJ 3BMCA 3DDCA 3GLXA 3N7TA 5JCOA 2XIJA 2I66A 4BFTA 4C7JA 4D4HA 1IRFA 3A0BC 4YAIA 3D4BA 3NGXA 2X0LA 4J75A 4YMIA 1SFEA 3CSSA 4D9IA 2RHOA 5CX1B 1MTOA 2Z4SA 2ZIXA 1F1ZA 2DWCA 3N86A 2WU4A 2CDBA 1GQSA 1F8UA 3KIPA 2PKQP 4LQDA 2FSVA 3D1NI 1O95A 1H0RA 3OJLA 4PBTA 1Y7PA 4G3XA 1AHIA 2R9VA 2ZBVA 3AR8A 3MTQA 4RLHA 4G4SP 2E4WA 2AOUA 2CXHA 1X7ZB 4F11A 1KJIA 4KACA 2X5OA 2BYVE 5CA1B 1Z7EA 2BV3A 2HXSA 4J01A 3R3SA 4IH1A 1FF9A 4Z51A 1FB5A 4MINA 2NXWA 3EPKA 3DS8A 1KJYA 2H57A 3DDHA 4HB2A 3ITNA 3W5HA 5C80A 2QU8A 1KIMA 4WWCA 1ZX1A 2GJSA 3UK0A 4HLUA 4DQXA 1XVLA 2A78A 1J2TA 2FMUA 821PA 1YQDA 1XTKA 1QVUA 3KHTA 2DR2A 2XF7A 3MGCA 4TL9A 3CRVA 2ZT7A 1R88A 3TLAA 3A58B 2D8AA 3S1AA 3HUUA 4D8VA 4JLMA 2NLOA 3L7OA 5K1YA 1LQ2A 4M7OA 2WAQA 1A1VA 2ESNA 4XRMA 2XXAB 3K69A 4REQA 4Q7EA 1L3LA 3D0SA 2XRNA 3WZLA 4YN3A 2HOEA 3WYFA 1G6OA 1JKJA 3F78A 1G4AE 4PGHA 4ZD6A 5KOIA 2FN9A 2WWGA 2FPGA 2ZSIA 3FF1A 4RV9A 1QH8A 2VIIA 3LQQA 1L5ZA 4D5EA 3BMQA 1DC4A 5DFAA 3ELDA 4D4MA 1WW8A 2BXYA 5JRZA 5FNZA 1Y6GA 1GTZA 4V3BA 2I29A 4CCSA 1ECBA 1WD5A 3R8CA 1G8AA 2CVHA 3KOWA 4NIMA 1B6GA 3SS7X 3UPUA 1ULZA 3SICE 2AL7A 3OPNA 4JLUA 4ETMA 4KO4S 2FQ4A 4MDEA 3EIFA 2AIRA 4N47A 4O4LA 3NXKA 3E3AA 4P55A 1Z28A 2H17A 1DUSA 3IRQA 3N2YA 2ZWVA 1Y1WJ 3ZMZA 1UQUA 5A9SB 2JGKA 4KQEA 1GNPA 1I3QJ 3NHZA 2GO7A 1L7AA 3PGLA 2DA6A 1IM5A 2BKAA 1EG7A 4CDGA 4ZZ3A 4HZFA 3KUCA 3S2WA 5DHFA 5BW5A 1VKZA 4JL5A 2Q1UA 4F5WA 1MB9A 5EHGA 3T8RA 2FWIA 1T3GA 1EJ0A 3CQ9A 3K09A 1QA6A 3V4SA 3TW4A 3HE3A 3WSVA 5FBRB 1ZN8A 3W5CA 5JVDF 1ZJWA 3RHFA 4DSZA 2AR0A 3IAM1 1Y9DA 5JU6A 1TA4A 2FNAA 4B81A 1CR1A 1HMPA 1FP2A 2P1ZA 2YMPA 4KO1S 2Q4BA 4XYMA 4L0ZB 4GKVA 2WV9A 3OS0A 1LUJB 2B0LA 4RS4A 3H4IA 3W77A 1DP4A 4R8VA 1AUXA 2QSZA 3FTNA 4WESB 1KS9A 3IEMA 1ISMA 3HBAA 4IQ0A 2FHPA 1OQAA 3I92A 3I61A 2A1IA 4LMPA 2XZLA 3RAJA 1BNCA 3BBLA 3L77A 5FYQA 1A27A 5DXFA 2RARA 3OZRA 3P2YA 1DNPA 2GTHA 2LVBA 5IC6A 4EOGA 2VA8A 2R7VA 1IGNA 4FK8A 1DEKA 2QCOA 3GJSA 1K92A 2J33A 4H1HA 4I6GA 2W90A 3WFZA 3LPDA 2YHAA 1BXGA 5ALDA 4HRXA 3MSCA 2P2YA 3L8EA 1XIVA 4J0JA 5I51A 4E5MA 3L0IB 4CI9A 4TXJA 3CMYA 1Y8RA 1P44A 4OK6A 4ZAWA 4BO4A 2RI1A 4RKEA 4MLDA 3Q3JB 4FFPA 1LEAA 1BA5A 3A1CA 2DOAA 2GXGA 1Q7TA 1WI3A 4F9GA 2CDRA 3COVA 2QN9A 2AX4A 1CBUA 2EFNA 1T9ZA 3R24A 4D79A 1QO0D 2VT6A 5JATA 2ABWA 5D86A 3QPAA 4ZGBA 4G5SA 1HYQA 3F73A 1LLDA 1ICIA 4N7BA 3A9VA 4AKEA 2Q3DA 5TPZA 3ZWBA 1KJZA 3T7TA 3D2LA 5EKDA 3G8AA 3IOBA 5C1OA 2FV8A 4LK1F 4XIYA 1V3UA 4ZC1A 2RGNA 2R4QA 1O3TA 4EJ6A 5DUIA 2A0WA 4FI3C 2W71A 2HK8A 3ER9A 1UT6A 1LJLA 5TMDA 2VG8A 3CEPB 2WSMA 2LLKA 3I58A 4HDSA 4PYNA 4E7KA 1B6RA 4JNKA 4LY9A 4RDCA 1OXKB 4BGIA 4FHEA 3CLKA 2BEKA 1HG0A 4KN7X 2RV8A 3VUFA 2Y0SN 1KNXA 2NVXJ 5G4LA 3S32A 2OOSA 2WYUA 4H08A 1ZK2A 1PEAA 3GPCA 3MHTA 1RXIA 5HKKD 2PG3A 3F0CA 3L9XA 3N4MA 3VHXA 4RCZA 2R4GA 4IUBS 2FMTA 1ISRA 3K4BA 4KIFA 1KEPA 5A4MS 1X86B 2EHJA 3OC6A 1V37A 2Y0CA 2E4XA 1WPKA 4PSXA 4UHHA 3HMQA 4U8GA 2IDJA 2FCRA 1YA8A 1A82A 1I6MA 1BXKA 1KZ6A 2E1RA 5CIWA 4J43A 3VPRA 1X8LA 2GPTA 3ZJYA 3P1JA 3FYUC 1X38A 5KJCA 4EJUA 2I4OA 4HDAA 3WL4A 3JARA 1RWQA 3FAKA 2C4KA 4XW2A 2O2IA 2WWXA 1BC5A 3U5ZB 2GJ9A 3F90A 1XKQA 3FDYA 4CIXA 1WE2A 3K7AJ 1GYQA 1NP6A 1T6ZA 2GWRA 1JJ8C 5A02A 3H92A 3PNPA 4QUJA 4WGGA 2HRDA 2HMYB 1J1IA 1KQ0A 2XZDA 5JADA 3UCFA 4JYCA 2YJ4A 4IDHA 1GR1A 4GIBA 3D8HA 1K8YB 3H18A 1C7ZA 1IDYA 2QAJA 1UZNA 4DCTA 3FWEA 1W6UA 2AG6A 2Q3BA 3M1IA 1B76A 5B3KA 2PMEA 5KX5B 4M54A 2OTLI 5IN5A 4DN6A 2WKQA 3K8QA 4RLSA 3OMYA 4LZJA 4UBJA 1J9IA 1JLHA 4B3IA 1XGMA 4BMSA 1JQBA 3T5CA 1S5LC 1KFEB 4NZOA 5EHIA 3KEFA 5KNBH 4X8LA 1YJ9I 4IYRA 2ZFWA 4BVHA 3PQ5A 4D3ZA 2QUZA 4W8GA 3MTJA 4FOOA 3GZNA 3RSZA 1K68A 2YVLA 2FQ1A 4P7JA 3OQPA 4LDZA 1RRFA 4MR9A 4CKEA 1IM8A 1ZG5A 4BB9A 3JR9A 4I0BA 2FP4B 3UICA 1GITA 3PC6A 4MVJH 3EETA 1ZAKA 1CXZA 4OXIA 4LG1A 4HGNA 5CKTA 3OT1A 4B4CA 3K5HA 4KG7A 2R8OA 2ERXA 2D1FA 3SHWA 3R6TA 2HJSA 4BE0A 3UVEA 2MSLA 3H99A 1BYIA 5EUCA 3F23A 2ETXA 2Z8YM 3IURA 2I6TA 1DP7P 3OMWA 1AV6A 2PX9A 5CJ9A 1S3GA 1MIJA 5LBUA 4HSTA 1QNFA 1M8PA 3BWBA 3GG2A 4M0DA 2C2MA 3IPCA 2PLWA 3TD6A 4UBIA 3LT4A 4IVRA 2JLYA 4BNUA 3SJBA 4ZK2A 2XHZA 2I65A 3U1TA 4AMYA 4RESA 4GLLA 4K9OA 3GP3A 3BWGA 2WJ6A 4LZWA 2RGGA 3AG5A 2Q2OA 3AETA 2Y9MB 4UZFA 4MUJA 1UIRA 4N1AA 2CBZA 5DXJA 1G8XA 4OP2A 3EBOA 4IG9A 3F6VA 4IF4A 2DA7A 4YUXA 4QODA 5K8UA 1JDZA 5J5VA 4WOJA 3VOEA 4QUEA 1EV7A 4LJAA 1MLDA 4BNDA 2J85A 5KC8A 1RR7A 3RAPR 3P26A 4DUZB 2AQKA 5AW6A 4RABA 5E4YA 5DI3A 4JLDA 4N82A 1K7CA 2UKDA 4RXMA 2GYUA 4IJQA 1DIRA 3MNFA 4DARA 1DC5A 3I9LA 1JU9A 3I2IA 2EJTA 1CZHA 3IUPA 1RKBA 2XUAA 5BT8A 4BJTA 1Z25A 1CPYA 5LZ7A 4LV8B 2QA4I 5HTOA 4R2WA 1E61A 1CNFA 3QU6A 4Q4HB 3GLGE 3N8NA 3NHFA 3Q9UA 5EXXA 3X1DA 1P31A 4EY4A 3HCEA 2AOVA 3PDUA 3F3SA 5JAIA 1KEZA 1BVHA 4UD6A 1NJSA 4C4YA 2GGSA 5KHAA 1T5DX 4BNMA 3A06A 3UUEA 3OYCA 1YUNA 5JAMA 1JT2A 1RM4A 2EWMA 1Z12A 3QWBA 4OLHA 3HKZA 3O1HB 4TVBA 3ACCA 2D13A 4PAOA 3HZJA 1Z0XA 2VF2A 4LJLA 3DBVO 1H93A 3ZE2B 2UVQA 3S3NA 3EQLF 4OIMA 1FRNA 2D2XA 3E5MA 1W46A 2JZCA 3HC7A 4H16A 3VKFA 1ODLA 1DEAA 4WMLA 3AEQA 1THZA 2YHUA 2IYNA 1CP2A 2WB2A 3JCZA 5ERYA 5HBGA 4FOLA 2G9ZA 1HTWA 4PFPA 3BGOS 1CWUA 3OLXA 4Q7QA 2NU6B 1WMEA 3KDAA 2KZGA 1GPBA 1U63A 2W9XA 4IFIA 5KB3A 1GUDA 2FFAA 3ZX5A 2GNAA 3RVOA 4XZ3A 4EEXA 3K15A 1G7SA 3HKBA 4ZDPA 1C3XA 1OCCH 3EQ7A 4KYVA 1SOAA 3WB9A 2JGNA 3BZKA 5EGOB 1W49A 2X5JO 3ZVLA 4Z7NB 1Z0FA 5AJWA 1B93A 5EZGA 5A1JA 4W4TA 1IZ0A 1ULUA 2FUG1 4LXGA 3PR2B 4ZCRA 1O94A 5EXPA 3WL3A 3LT5A 5KNCH 1RQXA 3SSMA 1JHRA 4S1VA 3A04A 3QM1A 2R65A 3TMKA 2C94A 1FNSA 3R7WA 1K9SA 4UDNA 3IAM6 3O3OB 4BE9A 1MV5A 3RIHA 2LF8A 1IVSA 2EIMH 4D5GA 4HHEA 4QG7A 1TX4B 5FD5A 2XDYA 4ZCQA 2WM9B 2XXJA 5KJEA 3WLOA 5AVWA 4HVCA 2I6FA 4JUIA 2GS9A 4F8EA 2XB0X 1AS3A 1XWWA 4MUBA 3HJBA 4KISA 4UUPA 4JJKA 4B3FX 1SOMA 4EJ2A 1W1WA 1K2WA 2DQ4A 4JEMA 3EIWA 3QRFF 4LFUA 2GFQA 3PPIA 4RXUA 4LWPA 3T95A 2LIPA 4C4OA 1NJ2A 2QGFA 3OQOA 2BL4A 1O8CA 1RIFA 2DK8A 1N6LA 1QOQB 1NW8A 3ZGVA 2B6NA 1ZUNB 1M1EB 3KYBA 2BHYA 2C4VA 4MS3B 5BURA 1LW6E 4CTOA 2MLGA 1OX4A 1NDQA 1PR0A 5K0ZA 5I9NA 1TWAJ 3E53A 3UBMA 3FXUA 2HCJB 5G1NA 5TX7A 3A3OA 2IPLA 2TRTA 3CF6R 8AT1A 3S2SA 2OAP1 4FEEA 2PX0A 5FDFA 2G7HA 1VQNI 2BMDA 1XSVA 4C1BA 1EBFA 1Q0SA 4HNTA 4B47A 3OAAD 1Y6JA 3T7AA 3CC4I 2NACA 1RM5A 1TTQB 4BVEA 3E27A 1NLFA 4NOLA 2P6RA 4BFCA 4MQEA 1PGOA 1U0SY 4H4KC 4AS2A 5FB2A 1WTAA 1YS2X 1ENPA 3ML1A 3ZQUA 4BMOB 1NNI1 2V9ZA 1O2DA 1R6RA 4DLAA 3W34A 5H3CA 3DDOA 1GGKA 4Y2VA 2WICA 4DZZA 5JI6A 2C07A 4KUHA 4DQKA 3E3LA 4F56A 3KQYA 5DBOA 4W1UA 3G5UA 1QYRA 2XAGA 5AVRA 4JX6A 2FFRA 3AHGA 4U3JA 1MO6A 1I30A 1P2VA 4W5JA 5ALFA 3GJYA 5DCMB 2L18A 3JYNA 3HSRA 4Y2RA 2GM3A 3MMZA 2Z99A 2N47A 1QO9A 2CB9A 4L6IA 2BM8A 3U7EB 2VRCD 3K0AB 4MO7A 2PAFA 4QQRA 5G53C 2YSRA 3OQMA 2BGLA 1JNYA 4HQEA 4JNCA 2Q1SA 5DM70 2V7EA 1XZFA 5U4XA 4YX9A 5J23A 3R0VA 3WTWC 4N6NA 5CNJA 2CQ7A 4I01A 5JC8A 3OPYI 2FEKA 2WB1N 4HPJB 2ZPAA 3V2UA 4E7IA 1A9RA 1EP3B 1ZUWA 3ZU2A 4CQLA 1R6UA 1U0NA 2WHRA 2CUJA 5HUQA 3OFVA 4BQQA 2WD8A 5EJCA 2QXTA 5EIHA 1M1NB 1S3IA 1ZELA 5ALPA 1ZGAA 2E34A 1ERDA 1Y4ZA 3IA7A 4W9RA 3HDGA 1ZNXA 4K6MA 2MC4A 4HAYA 2H8WA 3L0OA 3F22A 1YDHA 1ORRA 1L1QA 3I52A 4EP1A 2R0QC 4QOGA 1U1FA 2I2FA 3HJEA 3F6EX 5LYJA 3FMQA 4HAXA 1I6HJ 4RZUA 1BCRA 2CLFB 2Y99A 4GZ5A 4I19A 5TXGA 3RYIB 4MAFA 5HKBA 4NG4A 3VRHA 3PTZA 3KAKA 2A30A 2ESRA 3B73A 4CCYB 1AGNA 5AESA 2FOLA 4HMOA 1HBJA 3PF9A 2NVWA 2XZPA 3IPXA 3FBWA 3RJMA 1PZXA 1Z1DA 1T9DA 4CEHB 5FD6A 1BMDA 3LO5A 1E1YA 4NQRA 2A7XA 2VIXA 3GN1A 1Z4JA 1R74A 3L4SO 2VNJA 4I9UA 4KHZA 1WI9A 2YV3A 3LSTA 3D8SA 3OM0A 1UZUA 2HMUA 5LHGA 5ILQA 1T2NA 5EKTA 3B78A 4OH7A 3SHFA 2DU9A 3MELA 5AK5A 3T9AA 4XQ9A 2E0IA 4OP1A 1GEGA 1PUIA 3DM9B 1UOPA 2WJYA 4MPRA 1F51E 3GLVA 4JI3B 4AC9A 5LXTB 3O03A 1Q84A 1EH6A 2KHZA 2PUVA 3ROZA 3P2OA 2E18A 5UKDA 2WNSA 3EXG2 4ND8A 1ZJYA 1KAMA 2LGJA 5IU6A 3UGQA 2OWEA 1WOYA 3MT0A 2J6HA 2I5UA 4UVCA 2JAUA 1W0KA 5CFNA 3M6LA 3UJAA 3H1EA 1HE4A 2W2NA 3DV0A 1YJBA 2BVMA 1ZD3A 1L5KA 2YMMA 1DAPA 5BW6B 4DAEA 4IIBA 5AQEA 1A8UA 4UCXA 3LX6A 2J9GA 5IMBA 1AXEA 2IPQX 1FE8A 2IELA 3S8PA 4UEKA 5M34A 3B7PA 2H2FA 3YASA 1WJGA 3G3EA 2P11A 4O2BB 1A4XA 2HTJA 3WTBA 4Q4AA 4KL8S 1GL6A 1T4GA 4A1FA 2I4NA 5CBPA 4BTLA 2LD4A 2GIZA 1CUVA 3T3IA 5FP0A 1VPVA 5DSTA 4O8ZA 1EFPB 3O4JA 4ZT7A 2G1PA 1IXKA 1E0DA 3QE3A 3LSKA 1BW6A 4DBRA 1Y56A 4LISA 3VVLA 3CJTA 5FYDA 4BNYA 3M1LA 1NI3A 4LZPA 2F9LA 3BXZA 2HZDA 2YKGA 1IAVA 2R7MA 4UNRA 1OI3A 4KQ2A 1SWVA 3JWIA 2VFAA 4JEHA 3PX3A 3TKYA 2HFKA 3GFOA 4BBSJ 3T5TA 1XMOB 4M86A 3AMVA 3BDVA 5BUCA 3CGWA 4KRXA 1Y89A 2HSJA 4D57A 3BL8A 3K4NA 3GTMJ 1RXYA 2OWDA 4PVDA 1BRTA 3GEGA 3R3WA 4UULA 5AW0A 2H48A 1F4VA 5KNDH 3BULA 4A7PA 3KB2A 1EESA 5DF1A 2AJBA 4HV6A 1NW9B 5AJXA 3QXHA 2R1TA 2C92A 4XB2A 2WWHA 3KHKA 1XB4A 3IQDB 2CBXA 2B8TA 4X3CA 1YS1X 5GVRA 2VQFB 5C1BA 4BTVA 1ZQ3P 4F52A 3WRXC 2Q9BA 3X2EA 4KR3A 1XV5A 2MOKA 4HFRA 4AMGA 5G0VA 2D8MA 3HBNA 4AY6A 3V4VB 1LE8B 1QE3A 3W6OA 2OV8A 4TTQA 1PQWA 1O5IA 5ED4A 4YBZA 4TS1A 2FJ1A 5A7HA 3O8QB 3K0BA 3DLPX 4H3VA 3DE3X 1XZJA 3BFKA 3HUGA 4DTCA 2J87A 3WLEA 1KYIA 3E81A 1Q0ZA 2IF2A 1LPQA 1PT6A 2VZ8A 3FDIA 2AEMA 1EAMA 3MFYA 2YDXA 4LX8A 4WOCA 4QM6A 3DZKA 2GHTA 1XMVA 4ZYWA 2E7WA 5KWJA 5HYVA 3M6XA 3LI2A 4RENA 3GP8A 3I04A 1ZXLA 1JHVA 2GQ0A 4KMUX 5ERGB 4EI2A 2FUG6 2WK1A 2IUEA 2VYND 1M33A 4KXFB 4BIMA 1DOHA 3OETA 2XGMA 2IK8A 2JA7J 2XMRA 2R1ZA 1E7SA 4J7UA 4YUWA 4BLOA 3KJIA 2XGDA 1AXRA 4OKSA 1AN0A 2IZ1A 4WZ6A 5CB8A 1GZSA 2HDNB 1X0VA 3LDAA 4TLBA 3TD2A 4LGCA 3L46A 4XCXA 3JWGA 3BTCA 2VP5A 1G5PA 3U1BA 3R5XA 3R7SA 2QE7A 4EHDA 2GRAA 2HMVA 1A0OA 3PTAA 4D81A 1RYNA 2FX5A 2GZ3A 1OLTA 5K3FB 4D1YA 4OHMA 3D4PA 3EWAA 1LK0A 2YYZA 5ELLA 5EE1A 1IG7A 1UEIA 2EZ4A 1QWOA 3L7DA 4P31A 1CUYA 1S8NA 1WY5A 1TLLA 3R9XB 2A84A 1DC7A 1XS9A 4YLGA 3KVNA 2NTVA 1CR4A 4CQMD 3LWDA 2QSYA 2Q62A 1VHDA 3SXUA 2PSFA 1LFBA 2P2LA 4D0GA 5AOVA 3ML6A 3PPWA 4UOZA 3U9TA 5FLXZ 2B3DA 1VHWA 1TYAE 2IXDA 5H16A 4QDTA 3M5DA 1ADFA 3E2PA 1MBHA 3R8XA 2KI5A 3R6WA 4PPYA 5BVHB 2PKRA 2XKAA 2I5PO 4P81A 3VJRA 5E38A 3JD1A 4XARA 3GLHA 4FHFA 2WWIA 2RDMA 5T8KC 3VPAA 3OPXA 4ZVOA 1QQAA 3GO4A 1WVMA 3IH4A 3I83A 5DWVA 4IRXA 2ZZNA 5C3EJ 1JMVA 2XUJA 1R3DA 3E5RA 2EWWA 2VUMJ 4AROA 1NWHA 3E6MA 2BW3A 3C8DA 4XWWA 4A3BJ 1ETHA 1QC5A 2HCRA 4U7WA 3LCCA 3BMXA 3H3ZA 5F73A 2PSHA 4CWAA 1M2OA 3RASA 2Z43A 3S2FA 3DTYA 1VHJA 2NPOA 5DS9A 3V9AA 4RZSA 4NK5A 4YDHB 5JZOA 2ES4A 3JQQA 5DTMA 3S2EA 3WGGA 3S2GA 4DNQA 4D8WA 1V9LA 3HXPA 2Y1LA 4MULA 3IEKA 3VU9B 3DA8A 1ZU4A 1RP1A 3TSOA 1XAGA 1DTEA 1O95D 3Q12A 2YNMC 2Q3CA 3OOUA 5B3JC 1TRHA 5BSEA 3G17A 4K88A 5L3ZA 2D0OB 4EVQA 1KQOA 1FP7A 2RIPA 4C2TA 4C6SA 1HG1A 4GP7A 1IO2A 3NQ41 2PUBA 3R5HA 1DQUA 2ZULA 5K3BA 1KZ4A 1KYZA 4GQBA 3AFHA 4YPVA 1WU8A 1R15A 1OBFO 3WK8A 3HSFA 1FUEA 2QT9A 2VHXA 2ISYA 4A2UA 4PWYA 3FXKA 5CIYA 4LIPD 3ZR4B 3R9WA 3EVZA 5B4UA 2QVBA 5F78A 2XVCA 5EJ9A 3T4EA 4IDEA 4J2HA 5BSFA 1P33A 5ILVA 3A6HA 1RLJA 3PXGA 3WWEA 3NDIA 4B76A 1K97A 3ZWYA 1DX6A 4NI5A 5JSQA 4GE0A 4EVIA 2RFLA 3HRUA 3AEUB 5F76A 5FAKA 1M54A 1ESEA 2INGX 5TISC 3BGDA 4P4SA 4XSGA 3W2EA 2G1AA 1UHWA 2J9YB 2DUMA 2ZE7A 1RRGA 2WTXA 3NU1A 2UYYA 4ND4A 3ZU3A 4F46A 4INPA 2ZYIA 1SRQA 2IU4A 4BLVA 5FNVA 4JOMA 3L82B 4HFMA 1RWMA 3QVMA 3W1VA 1GPH1 4BNJA 3L7CA 3IEIA 5JCJA 4EM1A 4WASA 4LV6A 3JD2A 3KR0A 1XPJA 3CCFA 3KNZA 5FTWA 5BXQC 3K10A 3A9SA 4FC7A 3BPSA 3PQKA 4B40A 4EUHA 3BH6A 4X3PA 4B32A 5FORA 2VOJA 3FMRA 3E8XA 4A0QA 2PZKA 4NBRA 2CUZA 1HE1C 2H4JA 4N5NA 2W6IA 3ZDRA 3QRWA 3EXFB 2CQQA 2HU5A 4ZVVA 4TZ6A 2IIPA 2PUWA 1GKLA 2VJ4A 3DB2A 3VZDA 2ANBA 1TCVA 2ZGVA 2BGUA 4GSYA 3NP7A 1E6EA 2XCOA 4C78A 2UUOA 3VI4B 4A6PA 3RVKA 3EY9A 4J03A 4HSEA 2GDJA 4LV5B 5EG0B 3WWCA 1NW3A 2GBCA 1RXVA 4HWGA 3I12A 2HJRA 3DNMA 1KETA 4MMZB 1FFWA 5L3SB 3HVUA 1AT1A 1YQEA 4I6EA 2RHHA 4DV5B 1WSUA 3LRTA 4C7KA 5DHRA 4XLTA 1W1UA 5B58C 1K2VN 3CCUI 4N8DA 2M1BA 5BYAA 4LY3A 4G2TA 2QDXA 1FSPA 1KBOA 3HV0A 5KVAA 3QVXA 4MUHA 4ZYGA 4QDJA 3GF2A 4UE3S 3FOBA 4BGEA 4ZHQB 2NPFA 2EA2A 1DSSG 1V11A 3LK6A 2JFPA 4MR7A 3V4PB 1E9BA 4EF4A 3RJPA 4PSCA 2FQ3A 2WP8J 3FNEA 1H0HA 1XNJA 2IE0A 2IEGA 3F21A 3RSFA 1SFKA 4D99A 3VDRA 1N33B 3LZDA 1L8QA 5TT1A 1DXQA 3MWLA 1NIJA 3JQ7A 5LQSA 2BFCA 3GG9A 1USTA 2DFIA 1ACLA 2DODA 1QHSA 4ANFA 3SQMA 1IOZA 1CK4A 2XR1A