1QZZA

Crystal structure of aclacinomycin-10-hydroxylase (rdmb) in complex with s-adenosyl-l-methionine (sam)
Total Genus 111
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
111
sequence length
348
structure length
340
Chain Sequence
LEPTDQDLDVLLKNLGNLVTPMALRVAATLRLVDHLLAGADTLAGLADRTDTHPQALSRLVRHLTVVGVLEGGEKGRPLRPTRLGMLLADGHPAQQRAWLDLNGAVSHADLAFTGLLDVVRTGRPAYAGRYGRPFWEDLSADVALADSFDALMSCDEDLAYEAPADAYDWSAVRHVLDVGGGNGGMLAAIALRAPHLRGTLVELAGPAERARRRFADAGLADRVTVAEGDFFKPLPVTADVVLLSFVLLNWSDEDALTILRGCVRALEPGGRLLVLDRADRFFSTLLDLRMLTFMGGRVRTRDEVVDLAGSAGLALASERTSGSTTLPFDFSILEFTAVS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structure of Aclacinomycin-10-Hydroxylase, a S-Adenosyl-L-Methionine-dependent Methyltransferase Homolog Involved in Anthracycline Biosynthesis in Streptomyces purpurascens.
pubmed doi rcsb
source organism Streptomyces purpurascens
molecule tags Oxidoreductase, transferase
molecule keywords aclacinomycin-10-hydroxylase
total genus 111
structure length 340
sequence length 348
ec nomenclature
pdb deposition date 2003-09-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00891 Methyltransf_2 O-methyltransferase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 1qzzA01
3.40.50.150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Vaccinia Virus protein VP39 1qzzA03
4S04A 3EYIA 5DM2A 3R6SA 5H6RA 2AR0A 3OOPA 1G3YA 2HQRA 3BT7A 3VC1A 3UJBA 3KP6A 3DUWA 3IEIA 1FX7A 5A2QK 2HWKA 5DM1A 4LK1F 1R7JA 3GZ5A 1TQPA 1WZNA 5E9WA 3ZP5A 4MEXF 1MJ9A 2PX5A 5EIFA 2BGCA 2I7CA 4RGUA 2CGPA 4I01A 4OQDA 3TO7A 2R6ZA 3GFJA 1SD7A 2JHCA 3K2ZA 3O31A 2AOXA 4AZVA 4A2UA 4BH9A 5E9QA 2XAQA 2M30A 2V74B 3E97A 2W85A 1A04A 2DAOA 2PWPA 2YUIA 4U0WA 3UA4A 3NVMB 3TDUC 2VXZA 4KN4X 4UVCA 5DDGA 5ED4A 4C06A 2BR4A 4RGSA 2XAJA 4HF2A 2EFOA 5DTMA 3LA7A 2E7WA 1H1DA 2OB1A 3ID6C 1ZH5A 1EIZA 5BS6A 3K1MA 1U2ZA 2PGXA 3GU3A 2IW5A 1JQDA 1UB9A 3ULQB 4P7GA 5BXYA 3KP7A 4IRHA 2IDJA 1MGTA 4M6XA 3ELWA 3GDHA 2NS0A 4C03A 1K78B 2VOPA 5E2BA 1ZGAA 1BJAA 2L4AA 3ABUA 1JQ3A 3T1BA 1YW8A 5JFRA 5G02A 2ZBPA 1KGSA 4XUCA 2DT5A 2ZTHA 4TV7A 1R8XA 5K5OA 2DU9A 3BGDA 3RW9A 4BHPA 4C07A 5LQCA 4QTTB 1N2XA 1HMYA 3EMBA 4U7BA 1X1DA 4PCAA 4M71A 4UXNA 4ER0A 5ICFA 4S05A 2K27A 2ADMA 2PBFA 1EQAA 3TOAA 1SD6A 2AOWA 1TTYA 1FP2A 4HC4A 1XGMA 1U5TC 4HV5A 4XLNF 4EMSA 5D4SA 1YLFA 1PUEE 2HYFA 3MWMA 4HA8A 4E30A 3CTAA 1ZGJA 2JSCA 1INLA 1NW3A 4QDKA 5LQAA 4KIBA 2QRVA 2FRHA 2V7EA 1LNWA 3I64A 4E2WA 1FZPB 2FSWA 4GXOA 4CGZA 5FD6A 4O3MA 1VP9A 1YFHA 3FUWA 2D1VA 2Y48A 4HLXA 4I09A 5BW5A 2OZUA 2XV4S 4RTNA 2GA2A 1O9HA 1GHCA 1WG8A 5GWXA 4KMUX 4KWCA 4Q5SF 4NQWA 5BMZA 2EA4A 2XAFA 3CLOA 5D5XB 3WE3A 3KHKA 1DUXC 4UHTA 3U2RA 4Q4ZF 3EVCA 1KQ0A 3KQQA 2ZIFA 3DR5A 2EV0A 5DXJA 3OV8A 1DP7P 3UZUA 3DXZA 5KQRA 4LFUA 3K1PA 1RUNA 4OOIA 4CKBA 1I1NA 4CXFA 5A2QZ 3BZ6A 2Y75A 1S3JA 1D5VA 1P4AA 2NXCA 3UJ6A 2HR3A 1G8AA 2ZSUA 2YXLA 1M0EA 4AZTA 3P97A 1EV7A 4E31A 1NV9A 1IXKA 3KETA 4WXDA 2F5EA 2F2EA 3K69A 5E8GA 5EMMA 3ER8A 5E20A 1ZAOA 2GA9A 2E7XA 2B25A 2UZ4A 2JJQA 3E5XA 3CUQC 2CG4A 3BY6A 4AIHA 1W7PB 2MBFA 3LKDA 5BW4A 5DCFA 4BLUA 2Z5UA 1BC7C 3TQNA 3FPFA 1MZBA 3TKAA 4OBXA 4V0QA 1OMIA 5E1DA 2ZZMA 2VC1A 3R24A 3SGLA 1NW6A 5DUKA 2RVCA 3I59A 2IA2A 2GXGA 3OZRA 1FY7A 3HVHA 3M1EA 4JXJA 3FTEA 1W5TA 1J2XA 1KU7A 2FK7A 1CGPA 5CCXA 4HBLA 4HQEA 2OA4A 3HRMA 1H9TA 2NRAC 3LWFA 3MZHA 3G2PA 2RV8A 2XIGA 3E3VA 3F6VA 3BZBA 4DM3A 4R8SA 3OE4A 4E70A 4BP1A 2ZNYA 3ECHA 3DMHA 3NDJA 5LLQA 5M5BA 1AQIA 2DLLA 2QENA 2BV6A 1I1GA 2CMHA 3TM5A 3KPYA 1Q0TA 2Z6AA 3P9KA 3ELUA 2XUBA 3JTGA 4HDUA 4OQEA 3QV2A 3J81Z 1B42A 4DQ0A 2YR2A 3L9FA 3P71T 5CUQA 4GBED 1MJBA 2H94A 2PBIA 2AN5A 2R7DA 4N9HA 1XJ5A 3IRQA 2P6TA 2NXEA 1AQJA 2PQ8A 4EJUA 3PFGA 4OBWA 4DMGA 1RJEA 5FGMA 5D1NA 3S2WA 4FSXA 4KT5C 5JUWA 1NW8A 1T43A 2IIPA 4BHCA 2MC3A 3V8LA 4M74A 1G3TA 2CMGA 4EKGA 3ZMZA 2CFXA 3G3ZA 3WU0A 2O03A 1KU2A 2NP6A 3UBTA 3GIWA 3RPQA 3ER9A 4F84A 5JR3A 2XAHA 1MDMB 1TLHB 3PX3A 1O7LA 2TDXA 4NECA 5D1HA 4WXCA 4U0VA 1YF3A 1D2CA 1P92A 3ELKA 5K03A 2CSOA 4RB0A 1T2KA 3X0DA 4CZZA 3NMUF 2LNBA 1L3LA 4ZYEA 3DPLC 3FMRA 4WX9A 4C04A 3WODF 4RTPA 3BWGA 4LGWA 2YVLA 4YV2A 2FU4A 1E17A 1VE3A 5DCMA 5TRDA 4DCGA 2FRXA 3AXSA 3G89A 5EIWA 3LAJA 3UJ9A 4ZZDA 1Z7UA 2DULA 1IY9A 4LB6B 1Z91A 2YR0A 3G5TA 1TW3A 2DO7A 2LD4A 4DF3A 3DLIA 3DXJF 3AWIA 1STZA 3GJYA 4RVGA 2M5WA 4FZVA 3J81K 3MGGA 4DZRA 5ILUA 3KKZA 2FEZA 5FLXZ 3BWBA 1UCRA 4EJTA 1AWCA 1R5GA 2UXNA 5CYVA 1P4XA 3BJOA 1U5TB 2QYOA 4I02A 5L3FA 3UJDA 3PB3A 2KIUA 5EHIA 3H92A 4G9YA 1TNSA 3O6BB 2V1UA 1DL5A 1BIAA 2G71A 2GB4A 2PVCA 5AONA 4RWZA 2PKWA 1IN4A 4ENNA 5HOOA 2DPUA 1D8KA 2WK1A 2PXCA 1USSA 1NKVA 2AS5F 2Z99A 1JXSA 4CWAA 1NW5A 1TPYA 4LD5A 5CVVA 2ZNZA 3H2BA 2IVMA 4Y30A 4BYYA 2OO3A 2PN6A 4PYNA 2V1XA 2E1CA 1XDSA 2VC0A 4O6JA 4IWNA 1EH7A 3M8EA 1RJGA 3BWMA 2G8NA 4GOLD 1SG9A 3GUDA 4EM2A 3PQKA 3D0SA 2ELHA 1HXDA 2K4JA 3TMAA 2NYUA 3HOTA 4RGRA 4U0YA 5JHUA 1YTYA 1VP3A 1F9NA 3T8RA 1Y0UA 2RC4A 5GM2A 4IVNA 1IXSB 5FB2A 5H02A 4C4AA 5HIJA 1EH6A 3B5IA 3OZTA 2F5FA 2QY6A 2ZCJA 5K05A 4OMYA 3F8FA 2OZVA 2PLWA 3V97A 1P39A 5K5RA 4RYLA 2P7VB 1J9IA 3GX4X 4E2XA 4PGGA 1SD5A 1S8NA 5C9ZA 2AZTA 2ZWVA 1QQIA 3E7PA 1B59A 3DQVC 4R6XA 2HYGD 4MWZA 3WTSC 1VTNC 3RDIA 2C7OA 1XN7A 3BXOA 4HH4A 4GQBA 1ULYA 2WC2A 2NXNA 5HIMA 2MH2A 5HDKA 3HA3A 1BC8C 3GRUA 2FMYA 3J7AO 1W4MA 3DEUA 2MLGA 2P35A 4MQ4A 2VE9A 5D8LB 3RJPA 4UUVA 3ORHA 4QVGA 2OAZA 3TPZA 1MD0A 5FFZA 1G6Q1 2DI3A 3K0BA 3LX6A 4OIRF 3WTXC 3KP3A 1T6SA 1VL5A 1HW1A 1BI2A 3T0YA 3MTEA 3EGEA 5DRYA 1IN6A 4X1OA 2B0LA 1XXLA 3CJRA 3I5UA 3OFJA 2YX1A 5ERGB 1RNLA 4L0ZB 2LF8A 3G2QA 3BKXA 4C05A 4EVIA 2YTZA 2DFIA 5ILVA 1FPQA 1QAMA 2LF7A 5L3GA 5DX1A 4JK1X 3MERA 3BPVA 1SD4A 2E5WA 2P1DA 3VODA 1QPMA 2MA3A 1RI4A 2Z6QA 4P96A 5GP1A 1ORHA 4MHGA 3VEPA 3MCTA 1M6YA 3RIRA 5CM2Z 5FWAA 4YUZA 4HX7A 4QTUB 4NHJA 3BKWA 3OU2A 2EV6A 3ECOA 4A6EA 4R8RA 4PDKA 5CVRA 1WXXA 3G8AA 4E2YA 3RPUA 3Q7EA 4L18B 5HDGA 4PWYA 5EGSA 5LR6A 5J8FA 4AVPA 4H0EA 3JWGA 5E1BA 1JSZA 2GAFA 1T39A 5K1YA 3GYHX 4ZYDA 4R1HA 3Q9VA 3V8JA 3ERCA 3IV6A 3WTUC 9MHTA 2ISZA 5E1MA 2UYQA 1QNTA 5EMJA 1O9GA 5HIIA 1I1SA 3EVDA 2Q2EA 3C6KA 3DKWA 5F2KA 1RI5A 5CVIA 3G73A 5HOQA 5LGUA 4DQ2A 1RZ4A 1DUSA 1IRGA 2EFNA 10MHA 3KZYA 4RB1A 1DPUA 4XSZF 3LSTA 1JG1A 5LRSA 5BP7A 4EJOA 3HM2A 4MTDA 1XDZA 3U9GA 2CWEA 3LQRA 2JHAA 4YFNF 5DM4A 1Z9CA 1I6XA 3M9AA 1O3QA 3IYLW 1L0OC 3NQOA 2ZZKA 1QZYA 2PJPA 3TM4A 1HQCA 5C0OE 4KN7X 4FX4A 4M6YA 1OYIA 5DD8A 2WTEA 2MH9A 2XROA 1B9NA 3BWYA 4C08A 3O7WA 4RS8A 5D5WB 2Z6UA 1Y8CA 4RB2C 4WCGA 3EVBA 3FPEA 2JPCA 2FMLA 4P7FA 3TDZC 4GYGA 3GLXA 3LL7A 2PG4A 5DPMA 4ER7A 4CTKA 1F38A 2AXLA 3MAGA 1JG3A 2WA2A 5K0CA 2O0LA 3M70A 3BGIA 3EEOA 4MQVA 3OPNA 4PONA 3KP5A 1KHHA 1IW7F 1DPRA 2BM9A 3K1NA 3QRFF 3DULA 3L00A 2KIFA 1Z6RA 5CLSA 2DPDA 4CKEA 4LWOA 1WQ2A 3A26A 1F5TA 4UNOA 1L9KA 1J5YA 5FQNA 1IXRC 3GZ6A 1SAXA 3G2OA 1LQ1A 4RTLA 3LBFA 2R3SA 2OZ6A 3F8BA 2R7FA 2XVMA 3HA5A 5DYMA 5AIQA 3BGVA 5E1ZB 2MD5A 2D2WA 5E1OA 2UYHA 2P7CB 4G56A 4KICA 3P8ZA 3E6DA 3MQ2A 1TQIA 4GGGA 2ZCWA 1ZHFA 4AZWA 4I0BA 2ZXJA 4BY9E 1EH8A 4IRGA 2ONYA 1R74A 2VT2A 3GW2A 4LMYA 2EFWA 1X1CA 5K0BA 5FA8A 2C7QA 3WTYC 3UJ7A 5DD4A 3B3GA 1F1ZA 1XGOA 2X4HA 3WGHA 3KCCA 2I62A 2O57A 2IH5A 4L9VA 4E33A 3P2KA 2W84A 4R8HA 1JSXA 2P6SA 3ELDA 4N0BA 3ML6A 3SSOA 5E1XA 2P3LA 2ESRA 3RODA 2HTSA 3J80K 1MKMA 3G7UA 4RV9A 2AVDA 2UXXA 4BP3A 5E8RA 3HP7A 4LLGF 4BXUA 5FHQA 3GXOA 5HVQC 1ZG1A 4U7TB 4GOMD 3JSPA 5J8CA 4ZTBA 1U6GA 2P8JA 5E8IA 2K86A 3HCAA 3FHZA 4KFCA 2F8LA 4Y13A 3DF8A 1RJDA 3IWFA 3OU7A 5EG5A 5KS2A 3VC2A 3SM3A 3WSTA 2ZBRA 3JWHA 3WGGA 4PINA 5F1RA 2STWA 3COAC 1KQ9A 4GO1A 5L3BA 3EPPA 5B1SA 2PLYA 3ABTA 4MQ9F 4HF0A 4LK0F 1B6AA 2KIMA 2HKXA 4HX4A 2ETHA 2QWWA 3FMQA 4IPAA 4RB3C 4AIJA 3E23A 2C7RA 1FSEA 3WE2A 5FADA 4F7ZA 5HIKA 4GCVA 3REOA 2AOUA 4YV1A 1ZG3A 3ZMUA 4UVBA 3FX3A 2NNYA 1ORIA 4XUDA 3AAFA 1YYVA 3M6VA 5K0FA 3E05A 3R60A 5FUBA 4EKIA 1LDJA 3CGGA 2YPRA 3PFHA 2XVAA 2VDUE 5E17F 1YUBA 2RNJA 1X1BA 3SX0A 2ZBQA 4ER6A 2O8XA 2F5DA 1G8SA 2P7HA 3HA7A 1R1VA 5BQTA 2PX2A 2JH9A 1UHWA 4O5VA 1HSJA 3HOSA 2O07A 2ZULA 3O2PE 4MIKA 2RGVA 2VBZA 4AIKA 2H6BA 3FZVA 2HZTA 5L3DA 5LEKA 2WA1A 1QGPA 2FHPA 3B3FA 4IJAA 1ON2A 1B1BA 2NXJA 3DMFA 4IF4A 4KDCA 1PP8F 4H0NA 5K0NA 3M8FA 3KQWA 4PYIA 2IP2A 4K2EA 1U78A 1OPCA 5L3EA 4EGZA 2ACJA 1P1BA 4RAZA 4A0YA 4L5IA 4OA5A 5CVDA 3THSA 5EQJB 2ZWAA 3TOBA 2XHKA 4PYJA 1OR8A 1HKSA 2FYTA 5ILSA 1PRYA 1R6AA 1S7AA 1UWVA 1DDNA 3HVIA 2H27A 1FYMA 1XGSA 2W24A 3W6KB 2O0YA 2CO5A 2AOTB 4DNCA 3KZZA 1KU3A 2OY0A 2COMA 1P91A 3FPJA 2PY6A 3CDHA 1FBNA 2EWNA 3TO6A 4YUWA 5JI6A 4PCLA 2P5KA 1JG2A 3B3JA 3A25A 3IRRA 4YFKF 4LB5A 5KVAA 3F6OA 1BC5A 2IBSA 1JQEA 2JTVA 1EJ0A 2P5LC 4CKCA 1ZREA 3VSEA 5E2AA 5K5QA 3JSOA 3EETA 3UFBA 2XASA 3G8BA 3ZN0A 2XVCA 5F2OA 1ZQ9A 3PFIA 1L3IA 3EQLF 2XYVA 3HCEA 4HDVA 3ME5A 3WG9A 5LGNA 4GEKA 3MAJA 4FR0A 5H20A 2JH8A 4Y2HA 4LG0B 1SFUA 2NNWB 5DSTA 3GGDA 3H3ZA 2OXTA 5DXAA 4HRAA 5GIPE 2AOVA 4CXMA 3C0KA 3MEXA 4CHUA 1BBYA 1KXZA 1NBHA 1SKMA 1QAOA 1ZARA 1JHHA 2FBIA 1J7KA 3P9IA 2O3FA 1SMTA 2IA0A 3K9TA 3WTTC 1F3LA 2H1RA 1LDKB 2V1DA 2PEXA 5FD5A 2GIVA 4AZSA 3NWBA 5DEQA 4BLVA 2V6CA 1JG4A 1O54A 1RIOH 2L01A 3G5LA 2KJCA 3SSMA 2PV0A 2NP7A 4YMGA 3BUSA 3GFMA 3GO5A 1V4RA 4RVHA 2GPYA 1RI3A 3U1DA 1WS6A 1G3WA 3P7NA 5HFJA 2L54A 1FOKA 3EYYA 3F8NA 3KR0A 4G7ZF 3SZPA 5EKXA 1D3YA 3IC7A 1J59A 4CTJA 2PFBA 1QZZA 2O61A 2HMYB 4OA8A 1FNNA 1MJAA 3NJRA 2FK8A 3DH0A 3P2IA 3JAMZ 3RIEA 3FTCA 3E5QA 5HS9A 4ENKA 2CW0F 5DX8A 3MCZA 5K01A 3O3KA 2H00A 4XCXA 2AN4A 3NTVA 1S29A 4M7RA 3ZMDA 2GZWA 5LQUA 3LCCA 4CYDA 1RUOA 2FE3A 3N97A 5D4RA 3DTNA 3LBYA 1YO5C 4FT8A 4UOEA 4XSXF 4ZYHA 3HTXA 4PNEA 4RTJA 1WKMA 4PYQA 2OQGA 1XCJA 1OR7A 4Y17A 4GC9A 2VONA 4PCQA 1IN7A 4GUAA 1LEBA 3R0QA 1BI1A 1OYWA 3HTSB 2FXAA 3JAMK 3K0LA 4RTSA 5GINE 7MHTA 4N9IA 2RN7A 1YB2A 4ZH4F 2ERCA 3EUHA 3MQ0A 3U81A 4ON0A 5LHHA 4EQQA 1NW7A 1RI1A 3HSEA 1L3CA 1Z3CA 3F8CA 2A6HF 3ISPA 2AS0A 3CUQB 2PX8A 3SQNA 3T0IA 2HQNA 1Z05A 3CO7C 3WTZA 2C7PA 4M72A 3TLJA 5EOVA 4BNCA 4U88A 3T7TA 1UFKA 3PS9A 1IUYA 4MTLA 4EV0A 2IT0A 4HSGA 2XKPA 2VBYA 4D0PA 1WRJA 4KVZA 5CCBA 4M9XA 4ETSA 4OIPF 1SQGA 3FPGA 2QUFA 2GQQA 4X60A 2CKDA 3FXQA 1XVAA 4QLCU 1XD7A 3IWZA 1T98A 2PMHA 2AVNA 3C3YA 3GO4A 1FBSA 5FTWA 1KPHA 5CVJA 4LECA 2HR1A 4M9ZA 2GA1A 1E2XA 3HRSA 4BLWA 3EVZA 4ENJA 1BN5A 2GH1A 5EEHA 4M9SA 3Q87B 2FPOA 3WTVC 3MZYA 3KPUA 2DTRA 4YUXA 5LHGA 3HSRA 5D8KB 3D2LA 2IBTA 3BJ6A 1HKQA 4L0YB 2KW5A 2EJUA 5EC8A 1YG2A 3EGVA 4GYIA 4PYOA 3CJTA 5LQNA 2G1PA 5HDNA 2WWYA 3KQPA 2HKOA 3DP7A 1ZLKA 2I6GA 1IM8A 4QDJA 3N4MA 5DRTA 3M33A 1W5SA 1NT2A 4GOOD 1XTPA 2Z9OA 4PYKA 2VP3A 5T67A 2CYYA 1JTEA 2K4BA 4L9JA 3I71A 3KEQA 3GRVA 2B78A 2V79A 5GM1A 2EV5A 2W25A 3V7SA 3VB2A 3NWEA 4QPNA 1R5HA 2XGXA 5DWQA 2EFQA 4R79A 3C1DA 5D6FA 1YW7A 2K02A 3TR6A 2PI0A 1KA8A 3VYWA 4HV6A 3FM5A 5ICEA 1XDUA 1XSDA 5DX0A 4FGZA 1R23A 4AX8A 4UV9A 2ONZA 1ZRCA 4IRIA 2IPQX 3B02A 3ZN1A 2OPBA 2IRFG 3PVCA 2F5CA 2EK5A 3BJAA 2UWMA 3O4FA 2I9KA 2JPBA 1HSTA 3B89A 2QQBA 4IHSA 4L9NA 5J6XA 4GF5A 3M6UA 2YXDA 3FM3A 1V3FA 2NNNA 1M6EX 2IFTA 4HG2A 1T0FA 2OYRA 2JG3A 2G7UA 2ESHA 2P8TA 3ZMTA 3F4KA 5JVTA 1T38A 2M1BA 1TNTA 2OBFA 1YFJA 4MHTA 3GVAA 1G6NA 2P40A 3LCVB 2ZO4A 4IHTA 4O29A 1B4AA 2HOEA 2NYXA 3IHUA 4X61A 2UYOA 3KQYA 3HCFA 4G6QA 2FNAA 3T5XA 4KYWA 4EK9A 1FYLA 1N7IA 5CVUA 2EG5A 2O05A 3WU1B 4FX0A 1LEAA 4WF2A 4G7HF 4WXHA 1AV6A 2G72A 3ZMVA 4RTOA 5IT9K 5EMLA 4OIQF 1V39A 4RVFA 2VODA 2J5OA 2O6GE 1EG2A 1J0RA 3FMSA 5EZSA 3LECA 3UWPA 3JWIA 3LA2A 3LCUA 4G8XA 4IV0A 1NHAA 5CVEA 2QVOA 2PT6A 5CD1A 2ZVJA 3V7CA 1O3TA 5FWDA 1VPTA 4JBAA 3HSFA 1IAWA 4AD9A 1D2GA 1WY7A 1FWZA 4EGYA 2GAUA 3BDDA 5T64A 2ZJ2A 4Y15A 4YMHA 3FUTA 3F8MA 1VLMA 5K09A 2AOUB 2FBKA 2UZKA 2O06A 3M6XA 3HHHA 1YQAA 2N47A 4HYEA 4Q48A 1GXPA 2LDUA 3KR1A 1R00A 5CJ9A 4LJZF 2Q8KA 4EJVA 4YG2F 3AJDA 3CUOA 1WXWA 4EQZA 5EHGA 4ESFA 1PP7U 2YQZA 1XB4A 2Y1XA 1BI0A 4FT4A 4RTKA 1R22A 1JR4A 4P55A 4YIFA 1SFEA 3SVZA 4HF1A 5LBQA 3CBGA 2VN2A 1B9MA 4M73A 1ZN2A 1QAQA 4RGXA 3RYPA 3R0AA 3SSNA 3E6CC 1JHFA 3RTRA 3F72A 2YSRA 2QLZA 2QQ9A 2PX4A 3KQTA 3OZSA 1LB2A 4KDPA 1Q1HA 2IA1A 3IKTA 4POOA 2PXAA 5C1IA 4LLLA 1WWXA 1W7PD 4HGZA 2ZFWA 3FRHA 3HYIA 1KPIA 3KPVA 3L7WA 3V8VA 3GCZA 2P3QA 2BH2A 2PMUA 1H9GA 4DCMA 4Q47A 2G9WA 3QP5A 1R1TA 4X63A 1TBXA 4A5NA 2D1HA 3P9NA 1IN5A 2CWWA 3G88A 3GNLA 2PT9A 4V0RA 1NE2A 3QPTA 4P9UA 2AOTA 3Q5FA 3MTIA 4PYMA 3NEUA 3RKWA 4RSRA 1I27A 2A6EF 1YW9A 2KKOA 1X1AA 5DM0A 2LKPA 3HVKA 2BYVE 4ENMA 2YU3A 4QPPA 3A27A 3FF5A 2HTJA 2A14A 1UFMA 1ZG5A 5E8JA 3BROA 2NAZA 4YIIA 2QBYA 1CF7A 1BI3A 5HLHA 4HQMA 3KQMA 3DMGA 1RI2A 4F86A 2RQPA 5HLGA 2FA5A 2A61A 3VFZA 1AF7A 3DFGA 3OFKA 1C0WA 2DQRA 4KDRA 5GIOE 4LG0A 3QOWA 4EM0B 4EM1A 2B2CA 1YS7A 3A4TA 3B73A 1XCBA 4CDGA 4KA4A 1ZKDA 3QU6A 4HTFA 4KRGA 2JZYA 4XLPF 1JTFA 3S68A 3LDFA 1FYKA 4HZFA 1QYRA 5FULA 4XRFA 3CVOA 2C6YA 5E1WA 1K7AA 3KQOA 3IHTA 2OB2A 2VT3A 3KP2A 3KU1A 4P7JA 2EFPA 2ZMEA 2PSSA 1Q0SA 4OX9Y 5HILA 4R6WA 1WI9A 4YUVA 3LKZA 1KYWA 4A6DA 5IKMA 3B7PA 1BHJA 4CO8A 3GEZA 1YZ3A 3OE5A 3LHDA 4M37A 4RTMA 3H3UA 4G7OF 2PXXA 1P6RA 5K8VA 1GVJA 5LRRA 3CCFA 4DKJA 3PQJA 3R6TA 1AOYA 1FJXA 2P3OA 1BKYA 5EKUA 1D8JA 2BEOA 1VIDA 3KLOA 2Z3YA 3L09A 3PX2A 1MHTA 3IL2A 2BZGA 5FCDA 4K6MA 2PWYA 3M6WA 1SFXA 3LPMA 4AUKA 3HIFA 5LQKA 2GXBA 3WTWC 4BHBA 2EFJA 1TW2A 2XBMA 2QM3A 3LA3A 3PLAE 3QAHA 3BOQA 2EB7A 3HEMA 3I58A 2BE5F 1G60A 4ZZLA 4I2OA 5T6BA 2EX4A 4A5MA 5DTRA 5KQSA 3HRTA 4JQFA 1F4KA 2HS5A 4HOBA 3ZQ7A 4BAYA 1L3BA 3KE2A 3LDGA 2OBPA 3E6BA 5U4XA 2UYCA 3CJQA 3HTUA 5LEJA 2RDPA 3UA3A 4WVLA 4ATNA 4MGRA 1SVUA 3A7DA 3ERED 4FSDA 3UJAA 3F22A 1ZRFA 4UV8A 2VDWA 1FP1D 5ICCA 1P4WA 3NVKI 1KPGA 3I9FA 3DXYA 3FYCA 2HFHA 3HUGA 1HNNA 2VBWA 4KW7A 1R58A 5P8WA 1BM9A 1G38A 3D5LA 2Q0OA 4M36A 4KIGA 2L3DA 5DLYA 1S7OA 4HW0A 2FBHA 5TJJA 3R3HA 3SXJA 3CUQA 3FRIA 1P1CA 1OKRA 3FUXA 4I0AA 3LQQA 3FZGA 1QBJA 4QVKA 4G94A 2XYRA 4KMFA 3GFIA 3EEYA 2ORED 4BQAA 3G2MA 1ZLJA 1K78A 1XMKA 2BM8A 2FOKA 4ER3A 2P4WA 3PTAA 1SUIA 1D2HA 2VOOA 4FS8A 2IGTA 3UJCA 3FYDA 1TQMA 3CJNA 2GLUA 4GC5A 1KIAA 3ZMSA 3KQVA 3LGAA 1R36A 2Q41A 3W6JB 3R4KA 3CO6C 3ROUA 3JTHA 3KPJA 3THRA 2IJLA 1O7FA 3DV8A 2YX7A 2ZIGA 1BIBA 4G6DA 2YXEA 1PJZA 3TGNA 4U7DA 4QWQA 2Z33A 5FA5A 8MHTA 3T8TA 2M8EA 1YS6A 2OQRA 3RI4A 1J75A 3MHTA 2IPXA 2HEOA 3NW9A 3HRUA 4LWPA 1SUSA 3C18A 2QRVB 3EVEA 1BOOA 2IH4A 1ZRDA 4HLYA 2KRFA 3Q9SA 1Z1DA 1SMYF 3DOUA 1VBFA 1QANA 2B9EA 5LSAA 2JT1A 2JHPA 4A0ZA 1G55A 2ADUA 3ELYA 2L4MA 3CC8A 1U2WA 3KLNA 4PGHA 5FLXK 4WWCA 5LGTA 2V9VA 3HHGA 3SFZA 2MLKA 2HGCA 5FO5A 1XCVA 3GF2A 5D5UB 3QPHA 2P7IA 2HNKA 4YUYA 2H6CA 4XUEA 1REPC 4B17A 1NV8A 5HEKA 5KYGA 4PIPA 5BPDA 4ISCA 1UHMA 4I98B 1YFLA 1EAMA 2VZ9A 5FHRA 1HKTA 1SQFA 2EJRA 1NBIA 1ODDA 1QO0D 5IH3A 4NB5A 2RKHA 3TFWA 3HCBA 1FLIA 5DSXA 3R9XB 5FQOA 4P5OA 4AWXB 4RAYA 2KJBA 4IV8A 1BOAA 2DK8A 5F2NA 3KR9A 1O57A 1VQ1A 3F3XA 1K79A 3QOPA 3HCDA 3RKYA 1W7PA 1I9GA 1YIOA 4A0XA 2XYQA 4GOND 1O3RA 2G70A 1LVAA 3E6MA 3M4XA 3FXUA 2ZLBA 4E32A 3FTFA 2DBBA 3AY0A 2DQLA 2STTA 3A7EA 1RI7A 1R18A 1FT9A 2A68F 2ZW9A 4RVDA 3UJ8A 3I59B 5H6QA 5KK1A 3FUVA 3LFKA 2A5YB 5IT3A 4QQKA 3T7SA 5ICGA 4KUMA 1ON1A 3BP8A 3J80Z 2D45A 2A69F 3MFKA 1P2FA 1I5ZA 3SXYA 4B8XA 5HLIA 3AXTA 5E18F 4RTQA 2G7HA 3FXRA 2L02A 3EMDA 5K0LA 5HS7A 3QU3A 2P5VA 2QZ8A 1ZYRF 1KQ8A 2A3SA 3ANXA 4L7VA 5BPIA 3GWZA 1RJFA 5DTQA 5IT9Z 1LJ9A 5F64A 5LHIA 2OKCA 4M38A 4HAMA 5HS8A 2Y0MA 4WK8F 4QQNA 4P7KA 4L9TA 5EEGA 3I54A 3JW4A 3SMQA 5D6EA 3TO9A 4DA4A 1S6LA 3RKXA 2HWVA 2LSOA 1XMAA 2ISYA 4LLNA 4XBFA 2FF4A 1EJ6A 1IF1A 4IKPA 4FHTA 3HVJA 4B09A 3CKKA 1XSXA 2WV0A 4HGYA 2BR3A 2A07F 1IZ1A 5DUIA 2XAGA 2XKOA 3C3PA 3V4GA 3TRKA 2W57A 5KVRA 3RYRA 6PAXA 5ERIA 2DK5A 2FQ3A 3M7GA 4PYLA 2X0LA 3VOEA 4FT2A 2M45A 4P58A 2VDVE 1I4WA 4OINF 4E2ZA 5EMKA 1LDDA 3K6RA 2H09A 4X41A 2EA2A 4PZJA 2Y1WA 4P9FA 4OU0A 3E8SA 3QOXA 3QP6A 2VS1A 1MDMA 2AN3A 1HW2A 3IKVA 3P2EA 3I0TA 2DPMA 3JWJA 4RX1A 3ZPLA 4PIMA 2K4MA 1R8YA 3LDUA 2P41A 2ZBKA 2PJDA 1ONVA 3EDPA 3FWEA 5DCMB 3GRYA 4HX8A 3FPHA 1U8RA 1X3UA 3KR2A 5EVJA 1N7JA 3DPTA 5EPEA 1U3EM 4A12A 2DW4A 3V7RA 2GS9A 1KU9A 2QE6A 2EJTA 4ESJA 3SHFA 3KEOA 3EVAA 2M87A 3MB5A 1OYYA 5HZMA 4ZYGA 5EZQA 1IN8A 4YV0A 3HNRA 3T7RA 2E1NA 2BBYA 1G4DA 2VBXA 1KYZA 3FUUA 1FBUA 1X19A 3OCJA 3BWCA 3KPWA 3HCCA 1HW5A 3LAPA 1DCTA 2CQKA 1IXCA 4LG1A 3C7JA 5L3CA 3GRZA 1U5TA 3TKYA 1YZHA 1USTA 3TQSA 3I53A 2QBYB 1CF7B 3EGIA 1L1EA 2ZIEA 1IRFA 3TOSA 5E9JA 4RTRA 2J5PA 1KP9A 3OU6A 3V8KA 5LQJA 3KFWX 4MEYF 4OMZA 5K0GA 4YFXF 2YX4A 4ER5A 2HTEA 5LQRA 4FP9A 3DLCA 2OD5A 2CL5A 4I7HA 2HV9A 3F21A 4EJWA 3F23A 5AIPA 2QQAA 3GRRA 4HTFB 3P9CA 5K0JA 3PT9A 5FFXA 3NRVA 3EVGA 3KP4A 1FC3A 4L5JA 5MHTA 3EVFA 5K0EA 2FNPA 3R61A 2ZMEB 1WSUA 2FCAA 3NDIA 5BOXA 3BPXA 1JE8A 1H0MA 1KR5A 4U7PB 4F85A 5DV5A 1XSVA 1PDNC 2ZZNA 1JGSA 2K7LA 2BR5A 4Z2YA 1XGNA 1FBQA 3C6MA 4MNUA 4ASNA 3C3WA 4IXAA 1UIRA 1FSHA 2ZFUA 3WGIA 2IDKA 2H11A 3SR4A 1HBXG 3FTDA 2ZKZA 5F6FA 1Z6TA 4ESBA 4R05A 1MJFA 1XCLA 3L8DA 3L2CA 5CIYA 4CICA 4KNYA 2VE8A 3GFLA 3I4PA 2IH2A 1K6OA 3DXXA 3SZTA 2B3TA 4OIOF 4KIFA 2OU2A 5GOZA 1G3SA 2GWRA 5DT2A 3R0JA 5D5VB 2JRTA 1R1UA 2ESNA 3KQSA 2XRNA 2HDCA 4MTEA 1GXQA 1O3SA 3E5UA 4UVAA
chains in the Genus database with same CATH superfamily
4H17A 3Q0UA 2AEEA 3ORRA 4YBRA 3R6SA 4XJTA 3CZAA 2BFFB 2AR0A 3OOPA 3BT7A 4HF7A 4YRDA 3UJBA 2HXSA 3KP6A 3JCUC 3VC1A 3TFOA 2WQ6A 3DUWA 2MSWA 2B99A 3HA2A 1OWNA 5KOYA 1GU1A 4A8JC 4DMFA 3EVNA 2IL1A 5FLVA 4HKTA 2CF6A 4LF9B 1TO2E 3JU3A 2H2HA 4W82A 3H1BA 4QWWA 5CJPA 5DM1A 3WE7A 2PLRA 2M0MA 1OF1A 5E9WA 4D8XA 4F5DA 3TQQA 2G4CA 1FMVA 3DZ8A 3H6KA 4OQPA 1PT8A 2CV2A 1KY2A 2F43A 5EIFA 3CJRB 1U5AA 1WCXA 2CGPA 1RQ7A 1YQUA 3AHJA 1D1SA 2BKAA 2IOHA 2R6ZA 4RSGA 4AN1A 4MGHA 1DKOA 4BFZA 2OUMA 3ZGVA 1K92A 3C97A 3GFJA 1SD7A 1LLUA 1RQGA 4DT1B 3OPVA 3EQ2A 4RAFA 5M7EA 1DFIA 5I3CA 1TWAJ 2D0OB 5SZHB 2FP4B 2AOXA 3RKRA 1THZA 3RS3A 2X6XA 1CEYA 1S2LA 3D8RA 4BH9A 4FFVA 4NE7A 1E2HA 2J0EA 1ZQ1A 5BUQA 2M30A 5AKLA 4YLYA 2V74B 2YL2A 5HR5A 5LQDA 2BTQB 2W85A 3D8TA 5A0VA 1GZ7A 4BIIA 2H59A 1VFCA 1IL0A 3VVBA 3A36A 3AUFA 4U0WA 3E9YA 3UA4A 3BLYA 3NVMB 5AMXA 3QG1A 3TZKA 3UENA 2B1JA 4C06A 1KAOA 4Q19A 1S7GA 1V6CA 2ISCA 2BM0A 3H5AA 1W2GA 2YWCA 2XVXA 2DUWA 2OG1A 2LKDA 4MR7B 2EFOA 4ENWA 5AI6A 3ID6C 2E71A 2E7WA 5CQEA 1VIYA 3G2NA 2QXYA 4MKXA 1BXGA 1NSTA 1XR3A 5BS6A 3K1MA 1U2ZA 2FR8C 2XXJA 3MBIA 3NBAA 4MLCA 1DGRM 2OCCH 1JE0A 2IW5A 1EDBA 1TUGA 1EAYA 1ODSA 2QX6A 4KXUA 3ZV5A 2XB0X 1UDXA 3DFUA 1G1AA 4MMYB 2NTNA 4P7GA 3VH2A 3U3MA 3T1TA 3VTAA 3L8EA 3MJDA 3JRHA 3HLKA 4MW0A 2B9VA 4B3AA 2HB6A 3OESA 5BSMA 3WLLA 4BDTA 1EBUA 2O3JA 2NS8A 1UM8A 1MGTA 3ELWA 4MS1B 4UUNA 5CT9A 1JXAA 2R6CA 3MPUA 2QZSA 2WG2A 4RA9B 4C03A 4CMEC 2HW8A 1Q77A 3RRXA 5INTA 2O7OA 4F4JA 3GLHA 3BG6A 4PZLA 1QYWA 4OKNA 1OQAA 3ONQA 1D1PA 1JQ3A 2W6CX 4JOMA 2AJTA 4MRRA 5A7FA 1U3VA 4HDNB 1O94C 4DNXA 4ZYTA 1J39A 3G0BA 3QK7A 3DV2A 1SFOJ 5I9TA 1AD2A 1GYPA 1K68A 1Y98A 1L4FA 1FTGA 2XF8A 2DT5A 8ADHA 4PK4A 1U0GA 1EK6A 4GMFA 1NG1A 1UMKA 2LCFA 4TV7A 3PWZA 2WB4A 4MR9B 1Q11A 4HZUB 4PS0A 4TKMA 4TLMB 2ZAYA 2BY1A 3LVFO 2W43A 3BGDA 4GOJA 5HKKA 3UFXA 2GTHA 4QTTB 4KP7A 2YHBA 1ZGGA 3EMBA 2CLDX 5J2UB 3F9KA 1X1DA 2EWMA 3F67A 4PSCA 2IEYA 4B6OA 2C20A 3E27A 4UXNA 3BAFA 5ICFA 1Z5GA 4S05A 1YBVA 2DCEA 1IY8A 4B7CA 2ADMA 1PLJA 3OTQA 2WD9A 4BE4A 1ZN9A 4XIGS 3BRQA 3NCTA 2D3TA 4JEMA 2I3DA 1V7CA 4YDHB 3L2OB 4BFUA 4CL8A 1M2OB 4UNIA 5BSWA 2XB5A 3E9EA 2VF2A 3HJRA 4OQNA 4F4IA 3M3HA 3QNUA 1FP2A 2DWPA 4O2LA 3ZZMA 4FYVA 4H6WA 2A3RA 2DQ4A 4BWVA 3Q5DA 4XLNF 3W9BA 2EZTA 4B2PA 3PT5A 1JJVA 4HEHA 1QRYA 4DUYB 2BFAA 1Y5IA 2XE7A 3PCRB 1H93A 3RRFA 3MWMA 1UZLA 1E1LA 2C3MA 3U7GA 3VRHA 4A03A 1R0KA 1D5WA 4BKOA 1OXKB 4HA8A 5F0FA 1EYZA 4J43A 4RHYA 4E30A 4RO0A 2VL7A 3TLGB 1ZGJA 2R6AA 4MH0R 3WHPA 1MNQA 4QDKA 2QRVA 2FWBA 4GWLA 4ETIA 2V7EA 4HWKA 5PNTA 1LNWA 5FRNA 2X9LA 3GD7A 1FTQA 3U7QA 1TL8A 4TYYA 4CGZA 1CQXA 3NRCA 4ETWA 4KRXA 4ZQCB 1O6CA 2Y9ZA 1VXOA 2PDAA 2X7HA 3K70C 4MGKR 5F33A 1XAHA 1S3IA 1YFHA 2QK4A 1PQUA 1M6VA 1RYDA 1QG0A 4RVSA 1IHDA 3UK1A 3NNNA 4EO9A 4IHYA 4D79A 2OZUA 2HK6A 4Q4AB 3TN7A 1GGMA 4TXLA 1J9EA 1JHAA 1KQ3A 3PD0A 5FOQA 1BRMA 1QVWA 4GAEA 1WG8A 2G36A 1UDWA 4KMUX 4CW7A 3WYBA 5FX2A 1XEAA 4LKOA 2I91A 4JXKA 5ALLA 3O8BA 3PUWA 4K9NA 4XD7D 2H5LA 2YWGA 1T9KA 4NQWA 3DAYA 3GEEA 1U0RA 2O8CA 2F4OB 3NWPA 1KZHA 2BUBA 1G2PA 2IHYA 5CG1A 2A5LA 1YDFA 1D3AA 4H3KB 3RTAA 1RXSA 3WGZA 4UHTA 1W2HA 3U2RA 1WZEA 3CS3A 4Q4ZF 3EEFA 1N78A 3LWDA 3ODGA 1SIUA 1Z4NA 4I9FA 5TPZA 3VUFA 4FWTA 3NUGA 2EV0A 3GPIA 4MTCA 4PHFA 3KHUA 4IX1A 4RD0A 5DBFA 3ZY4A 1XPOA 4H4EA 4WZBA 1K6YA 2HXYA 3B6JA 1COWA 1X7YA 4H08A 4CKBA 2GPNA 4LYHA 5HBGA 4Z6KA 4B81A 3KOZA 4CXFA 1Y89A 5ALUA 3DONA 4Y9TA 2PPLA 4G5HA 3ZZNA 3ZQLA 4R83A 2HWXA 4QATA 1Q19A 2I6XA 3I73A 4IH9A 4IHJA 5CA1A 1L5LA 4CMAA 5C8DA 1EIWA 4F92B 3GTPJ 1RWQA 4KH1A 2YRFA 1KH1A 2PFKA 1C4KA 4WXDA 1MPTA 1N6LA 1W5EA 2IDZA 2F2EA 3DT9A 3IKJA 4YDSA 3DKKA 5JCOC 4U8HA 4QUIA 3R7AA 5I9SA 3EDQA 3QTLA 4R2HA 3SIRA 3QPAA 1W49A 3OYCA 2GA9A 3B85A 4LIPD 2JJQA 3PWKA 3RBVA 3ZDQA 2ME0A 3E5XA 4Z3OA 3VR2A 3CUQC 1GPKA 4A2WA 2HL6A 4NXMB 3TRIA 1OOEA 4UHEA 3LKDA 4B6EA 4Q7EA 1CR6A 1ZJJA 4TYQA 5HBRA 3W6PA 1MH1A 2ODNA 2Z5UA 1HF3A 3W7AA 4N8EA 3GPLA 2I4OA 2NPIA 1Z2PX 4R3UC 1JLHA 2R2AA 4A2PA 3TQNA 4PTLA 3NB0A 2Z1DA 1VBKA 4LMRA 2N8GA 5CTAA 3ZNNA 3HO6A 1R0SA 3PICA 4KDFA 2ZZMA 5F52A 3PUHA 3R24A 5DB4A 3GAZA 2E4AA 2QYTA 3W8NA 5GONB 2VAWA 1QOZA 3R9KA 1ORWA 2NQTA 2QVCA 2QRMA 2O7VA 4MYHA 5GJWC 4MCJA 3UY4A 2FWJA 2P4SA 1P2BA 3AR3A 2XDVA 3D8NA 3M1EA 4TLEA 4HNGA 4JUDX 1H2BA 3LYUA 1YH3A 2BGRA 4K28A 1PT9A 4B7AA 2DF8A 2ZB8A 2FK7A 1KU7A 4HQRA 4CEIB 5CGZA 1W6UA 4IIGA 3RK4A 1ETKA 4F3YA 1IQPA 3PGLA 4K9PA 1FC0A 1M6HA 4K9DA 3STXA 1JNXX 4YAKA 3HRMA 4CBVA 1QDLB 1NUSA 3LWFA 3BZCA 3OKCA 3S2YA 2PO5A 2XIGA 3E3VA 3DEZA 5IULC 2QMOA 3AR4A 5AXDA 4F55A 5FYQA 1AKEA 1PR5A 4L8GA 1C1XB 2BWJA 2H4XA 1CPYA 5EN4A 1HK7A 1WD7A 1U0SY 4A82A 4ON9A 1U7XA 1AQIA 4MRMA 2ZCUA 3KSDO 4AP9A 2BV6A 4WUVA 1CZRA 1X7ZB 1XLTC 4Q1VA 1Z18A 1DG9A 3ELUA 3S2IA 2D1RA 3SZMA 4CMIA 2VJYA 3JTGA 2B1QA 3J81Z 4DJJA 7MDHA 1WUYA 1YA4A 4AKHA 2ZMEC 3L9FA 1NKTA 4RFLA 4Q1FA 3CCSI 4XM3A 2RB5A 3EGXA 3VC3A 1GAQA 3KFXA 3DU5A 2HEGA 1VBMA 3GLSA 2HY7A 3OQ6A 5BN4A 1IG0A 1TQDA 2R7DA 1RHMA 2QTAA 3DEAA 5DHTA 3UAOA 3WLJA 4QKQA 2C2WA 3PNQA 4Z7NB 5KWEA 1JT2A 1XTUA 2RGBA 2HRQA 2Z5VA 3GUHA 2WAEA 4JODA 4P22A 5IJXA 2IV7A 1N5OX 4DIUA 1LJ8A 2AUTA 1EUYA 3PUXA 4QX6A 3CCEI 4QUAA 4Y6OA 3NTXA 4IV5A 4YHHB 1YI1A 1JLLB 2LUOA 2QUJA 1ADJA 3FOAA 2ZYGA 3OD1A 4GGOA 4MUKA 4V03A 5D1NA 4ZI5A 3ACBA 4NU6A 2ECFA 3W5DA 3S2WA 2F48A 4FSXA 3FHTA 4KT5C 2ECKA 1TMGE 2IOFA 1WO8A 2O7QA 1TYAE 2VRCD 2ZYIA 3CLKA 4HMPA 4IXTA 1OH8A 2E1OA 2IIPA 4BHCA 2MC3A 2H1FA 4KVAA 3UW1A 4P84A 1G3TA 4J4TA 3UR3C 2O8BB 1V9SA 1PJSA 1CF2O 3CESA 3DF7A 3FCEA 3LO5A 1ZSVA 2AG6A 4KXQA 4RF3A 3W9YA 3K92A 3G3ZA 4WLUA 1N2OA 4F3CA 2DT7B 4BQQA 2P9QA 2FW7A 3IUYA 2NP6A 3R6LA 1IQRA 1Y82A 2Q2QA 1QO7A 2ZBVA 3GIWA 1C1YA 3PQ3A 3ANSA 1ZI9A 4PV7A 1TZLA 4YJ3F 4RULA 2ZUEA 5LL6P 2GF2A 3ODPA 1DC6A 2XAHA 4AVZA 3PX3A 1P7PA 4U0VA 4WXCA 4LIUA 1EFPB 2WSMA 1J8QA 4DNPA 5B6IA 4HQFA 5J47A 2UVPB 3GDWA 2I8LA 3AYXB 2FFQA 2CSOA 1B6GA 3ZTWA 1TZKA 3FCCA 3LXUX 3IAM2 4D9MA 3S5UA 4CIVA 1DFGA 2QDXA 4CEJB 3NMUF 1WF6A 1PQPA 1WL8A 4TXJA 4C21A 3DBRA 1V45E 3DCNA 1DOHA 3TD6A 2XRZA 4B44A 3AUJB 4WX9A 3WISA 1JKJB 1ZA2A 3FG9A 2AKEA 1GLNA 1N5JA 3AHFA 4Y2TA 3BWGA 5CH3A 1YOVB 3WADA 2AXPA 2PSJA 3B38A 2RCNA 2YVLA 3FDZA 2FU4A 3LS2A 2WHQA 1M67A 1KH2A 3ZGXA 3ZHVA 4G1UC 3ZQ4A 1UBCA 4PBTA 4DR3B 3KOMA 5J3LA 1DJOA 4R84A 2IPAB 4A16A 2FRXA 4AJ1A 2JMWA 3AXSA 4U1RA 3ABQB 3FNGA 1G7TA 3LAJA 5IOZA 4EDFA 4ZVLA 1X15A 3PQ6A 4RKQA 2G6TA 2DULA 3GEMA 4E4TA 4EMUA 5H4GA 3H5NA 1W6RA 3GZNB 1GUBA 1PR1A 2AMLA 3AUTA 4WXPA 3ROEA 2HMSA 5EJ7A 2X4DA 3JZAA 3G5TA 1TW3A 2V9CA 1ETHA 1MAAA 5DOVA 4M1SA 3B1ZA 2CBZA 5DNVA 2P9JA 3URMA 3ZE6A 2E0IA 3EMKA 3EAGA 2IYZA 1SUBA 3VR0A 1L6IA 5I4IA 5TE9A 2GBFA 4RVGA 3N70A 5DTJA 3RBAA 1CUAA 4JC4A 4FZVA 3EZLA 3TH5A 3U5ZB 3J81K 5CD9A 3R40A 4L3WA 3SNKA 4NJMA 1PS0A 4PNHA 4M6VA 5IHPA 3SFTA 1H2AS 3KKZA 3MT8A 4H27A 1R0ZA 1EHYA 1O95A 4J1TC 4ND2A 2VJDA 2VHTA 4PBSA 4YWHA 5SZKB 1T6BY 4F6RA 4URVR 2HYIC 2J5BA 2QVZX 1SCNE 3MOIA 5CLFA 4EJTA 3BXGA 4YJGA 2ATEA 2NO9A 3NNSA 1HO3A 1HDYA 3JRNA 4O02B 1MOPA 3DVAB 4YJ2F 3WK6A 4CL0A 5CYVA 1GL6A 5AM0A 4BBPA 1P4XA 1I3MA 1QH8B 1YDEA 3VHLB 3LSMA 3KSAC 2QYOA 4J75A 1GGFA 1SK8A 3IBSA 1OX5A 5I47A 5L3FA 1VQLI 2XRMA 4K6GA 2HO5A 4ZVKA 5ALMA 2P8SA 9GPBA 1H0KA 3GJXC 3PB3A 3H92A 4G9YA 1TNSA 2M8GX 1DL5A 2WT9A 3GRFA 2G71A 2C5LA 4UE6A 4W99A 3CIFA 1UWLA 4AN4A 4B3CA 5AONA 5EP4A 5JT1A 1V5EA 4M1KA 1RWXA 2VO1A 1BR2A 4YRCA 2XMPA 3QUAA 3FNFA 3G17A 3LSYA 4Q66C 4BFYA 1AGNA 1UPXA 2XGMA 3K9WA 3NEJA 3PZBA 2PKWA 2XOKA 2HYJA 4LOCA 3EWIA 4PZYA 3O8RA 2P9TA 2DPUA 1RJ9B 2FSHA 2SNIE 2AS5F 1R0WA 2BJHA 4U6SA 3UANA 1JEDA 5LB2A 3LZCA 4CWAA 2NXWA 1TPYA 3TEMA 5CVVA 3OZDA 2FVXA 2Y1OA 2WWVD 2VAVA 3ZE8A 4I4TA 1JIUA 4LYFA 1K9SA 1YL5A 4TTJA 5DHPA 1AKHA 5G4KB 5HUJA 3RB8A 1FMCA 4H7FA 2ZEJA 3I1JA 2OO3A 2PN6A 1Z39A 3L6DA 4Y2YA 5ALVA 5SY4A 5FV4A 2V1XA 2E1CA 2R8RA 3F5MA 4O6JA 3JVEA 4OK6A 3C24A 1K97A 1FQWA 2SCUB 4Q3CA 4CT4B 3HKBA 1IHUA 1OX4B 1T9GR 4B1FA 1B1AA 2WC1A 4EY6A 3C8HA 1YA6A 3G6KA 4NDLA 1OCEA 1DQUA 2JFFA 1RLMA 4I2NA 4Y3UA 3WJ1A 3UPTA 3LRXA 3EPHA 3AUAA 4QQFA 3WKBA 1GZSA 3HJAA 3L2UA 1NJ8A 1LTHR 1XA0A 2ATXA 2Q07A 3A6LA 2YXBA 3JQ8B 2ELHA 4KEAA 1X1SA 3RZOJ 3S8YA 4J0FA 3PUFA 3TMAA 1A8IA 4LITA 1EESA 1VL0A 4II3A 5AJHA 1JB9A 4DN6A 4RGRA 1MJHA 2W2LA 5JHUA 2W8BB 4FEAA 4TLAA 3VU8A 1F9NA 1SG0A 2LY2A 4ZAFA 1Y9DA 1DT5A 1Q1QA 2H4FA 2HSEA 3LBHA 4P82A 2QLMA 2XF7A 1H2XA 1U5BB 4CKYA 1GZ4A 1PWXA 3LSPA 2QG6A 4FZRA 4C6TB 5HIJA 1H4SA 3D8HA 4DLLA 1TVKA 4TSKA 3C2QA 2EYQA 3H5VA 1CTQA 2A84A 4OMYA 1J8MF 1AHHA 1WU8A 4KH0A 5H82A 1SO8A 2ORIA 3STWA 5BT8A 4JI8B 2OZVA 2P4QA 3V97A 4CETA 2PUDA 1P39A 1H4VB 3PNYA 2NOAA 1J9IA 4QASA 4XLLA 4D9JA 1B74A 4A8JB 2ZKLA 4Z7OB 4IJUA 1KO1A 3LLMA 4F2DA 2VZLA 4Z9YA 1WB9A 2D6FA 1K5PA 4RM3A 3E7PA 4ND5A 1B59A 3PGVA 4AS1A 2GCOA 1W5AA 1BXZA 2W8ZA 2G9RA 2OXEA 4YAIA 4UARA 5CCEA 5FUMA 3KTDA 4HH0A 2IAIA 1V5IA 2W6IA 4GQBA 3T3DA 5HIMA 3H5OA 3CEMA 2I55A 3QSYA 3EPZA 4G84A 1BX0A 1Y4DE 4MITA 3BR0A 1O4XA 3JZFA 1BC8C 3GRUA 4E6KG 4HD8A 1UAAA 4HLUA 3C4JA 2MLGA 5ISMA 1QQ7A 3RHTA 1T1IA 2YOHA 1E3TA 4ZU1X 5A1JA 1XKXA 4QVGA 2O50A 1W4RA 1TRKA 4RQBA 1SIOA 3TPZA 5FFZA 2CXTA 1G6Q1 5DTDA 3LX6A 4LGYA 1W0JA 3RJ9A 1E58A 3A9RA 2B63J 1TXGA 1B8VA 3SMVA 4RFSB 3U1TA 2G09A 1ML3A 4BRUA 2ZXEA 3T0YA 3P96A 4W9MC 1CVRA 1F2TA 1IN6A 4X1OA 3K31A 5EIAA 3I01A 2BBSA 2P68A 5IF9A 4TYWA 5FUXA 3C1TA 5FRMA 4WD3A 1Z6ZA 2WM2A 3A6ZA 1XXLA 4G1MB 1A5AB 1NM5C 2L82A 3DEHA 1RNLA 3N3BC 3OFJA 4INZA 4BQPA 1ERDA 2LF8A 2Y93A 4BVAA 3DAPA 3A9UA 4EVIA 4K0RA 2YTZA 5CNKA 4C05A 2DFIA 1G0NA 4DZJA 5C81A 1QAMA 2BW3A 4MYDA 4I4IA 2A9OA 5L3GA 3FLMA 1GPH1 3CZ4A 3MTBA 1RAAA 1UANA 1E59A 2PA0A 3O2NA 3P4YA 4GWKA 2P0EA 2PMWB 1WUTA 3PITA 4A9AA 3GFQA 5KDOA 1QYXA 1RI4A 3ICEA 4W1SA 2QMZA 13PKA 1PDOA 1Z7BA 5D3MA 5K7HA 1O03A 1BW6A 1ORDA 5TGDA 1X3SA 4YMUA 1ORHA 4ARSA 4KYTA 4MS4B 3OMYA 1F2DA 3VEPA 3MCTA 3O1IC 2PS1A 4IXMA 1N6OA 4OQMA 4ZT5A 3H1EA 2R9VA 5CM2Z 5FWAA 3FVQA 1NLMA 4GPD1 3CFYA 1JB1A 2W6NA 4NHJA 1JG7A 1I94B 1E1CB 3DDNA 2CW7A 2OESA 2CVQA 3ECOA 5FOXA 5BNFA 4PDKA 1DKMA 1E1DA 3G8AA 3INGA 4L07A 3A03A 3Q7EA 4E7ZA 5HDGA 3IIEA 4ZCSA 4F2WA 2XWPA 2P6UA 2F5VA 4AVPA 3PHJA 4LVCA 1FFBA 5IDYA 5LP6C 5C46F 4H0EA 3GDGA 1DP4A 2PSDA 5E1BA 5B58C 2JCGA 3A01A 4IDNA 1T39A 3GYHX 1MTZA 1UC4B 5IDWA 1WJGA 2VYVA 4HVTA 2FMTA 2C5GA 1VPDA 1P73A 3EF1A 3G82C 1R27A 3GG9A 4R1HA 4FFRA 4HATA 4NJEB 4RETA 4D92A 4Z4FA 1SUDA 1APLC 5IPFA 4JP0A 2JBWA 4RDIA 3ZBUA 2WWRA 5BR7A 3G9TA 4ZMBA 4TWAA 1K8ZB 1RKBA 1JZTA 3T4PA 5AVQA 9MHTA 3WNVA 3L7KA 3VX3A 3MMNA 5KCMA 2OSVA 3HXOA 1YQXA 2QSZA 1NVDA 5K0ZA 2CUEA 5HIIA 3EVDA 4IHKA 3VH3A 2WJ3A 4IHWA 1P2VA 1YMQA 1KRXA 3C6KA 3ZJ5A 2WJYA 1RWPA 3AHDA 4MICA 1KEEB 5EGNA 2QTHA 3G73A 1MJGM 1R6DA 2PZLA 3WNBA 4B4VA 5HOQA 1QRUA 1QX4A 4B8ZA 1T0JB 3KXIA 1U1DA 3MJ4A 1NDHA 1JG1A 2QL7A 4J9UE 3V00A 4MTDA 1XDZA 2EKPA 2CWEA 1FSFA 3TCXB 1LBEA 2YRXA 1DFHA 2FZKA 4NOMA 5BVHB 2JVKA 4KMOA 1C9EA 1I6XA 3M9AA 1O2DA 2JD2A 5JADA 3BF8A 4WOKA 4NJOA 1KEPA 1ZWLA 1BOFA 3IAEA 4K86A 2BFCB 1L0OC 3NQOA 1UBLS 3B3QA 3QU7A 4Q34A 3ONVA 1Q5PA 4QHYA 3GA5A 5E4TA 2GM3A 3NOXA 1SOUA 3WGQA 3S14J 2AG5A 2RIPA 3OG9A 2ZS8A 3J80A 4JYAB 4A6XA 3V46A 4WHMA 4E4RA 2MH9A 4LIVA 3DMRA 3K6JA 3OY9A 1KHTA 1HSZA 4FKMA 3VVMA 5DNYB 4A8TA 1V3VA 3BWYA 1HE1C 2VWHA 4IKFA 2XSZA 3N07A 4N7RA 5D5WB 2FFRA 3RQ4A 1CDDA 2YNMD 1ORVA 3FKSA 1NNLA 3A1UA 3HDDA 4CZCA 3ESXA 3UV6A 3WFJA 4IQFA 1Y8QA 2OWDA 5BN1A 2W7NA 2JVHA 2R93J 2JFUA 2NSJA 2HBRA 1F38A 3PO3J 2Y1LA 2YCLA 1NXVA 1IOZA 1HYGA 3JXEA 3MWDB 4Q9IA 2Q7DA 2B5OA 4GICA 2WVJA 4YVFA 2V7TA 1W0KD 3CUUA 3H1AA 4UU7A 2O0LA 5JTTA 5EIBD 4PFSA 2BGKA 3EB9A 1GPDG 2OCPA 3G1OA 1Z0ZA 2FE1A 3PUYA 1UPAA 5DIZA 1ULZA 4BO2A 2FX0A 1B76A 1C0EA 1CY6A 3S6JA 2WJHA 2RK4A 4V0KA 4EECA 3AQIA 3W2AA 1PFUA 5CB0A 5KSOA 1S2DA 3V9PA 3Q0VA 3L00A 2J7PA 5D2CA 3U7EB 4DCTA 1A35A 2DPDA 1LW6E 1KZ7B 1VLVA 2F6CA 1WQ2A 3A26A 1XLWA 1N0WA 1UQRA 4I0WB 3G9ZA 1SXGA 5AJXA 4CM5A 1IXRC 2KQUA 1VCHA 4INOA 3U1BA 4EL5A 1JJAA 4FYYA 5A4DA 1LBHA 4H1VA 1ZUHA 4D3ZA 1LQ1A 3LBFA 5DN6D 2R7FA 4PPQA 1XHLA 2J4DA 2YWHA 1RBMA 2HPAA 5DYMA 1VYTA 4J16C 1JIXA 5IT4A 2OV2A 4FFLA 1QE0A 1MTOA 1ZU4A 2M1XA 1CUGA 2MD5A 5KNCH 3BMNA 5F23A 2PKRA 4RA6A 4Y2GA 5IAEA 2P7CB 4KICA 1IPHA 2YJTD 3FDJA 3MQ2A 4H9GA 4J1SA 4GGGA 5KWJA 1VE7A 2X7XA 2M2IA 4CKWB 1JT6A 1U8YA 3ILVA 3A6GA 5CTJA 5ADWA 3I61A 2E4VA 4H6VA 5HDBB 3HH8A 2BY3A 2DT8A 4MMXB 4OJTA 5F0HA 2Q0XA 2ONYA 4BY9E 5AVTA 1ISGA 1OFUA 1JUDA 1IV8A 3CYFA 4ZICA 2P2DA 4NC8A 3E8MA 3K1JA 4HZGA 3SIPA 5K0BA 3HDYA 2MYPA 3G2KA 5FA8A 1V1JA 1DWQA 5KSPA 2P30A 1FYWA 4HNAB 3EBOA 1XTRA 3HR8A 2MWMA 4YO7A 1GG8A 3FNQA 5IYDJ 3CVJA 3UO8B 1F1ZA 1WOMA 5ALSA 3K4CA 1C81A 1PEAA 1W1IA 1Z2AA 2I62A 2JLQA 4I1IA 4X7PA 3SEAA 4F45A 1GOTA 5MF6A 2QLBA 3F73A 2H1HA 2W84A 2GDZA 3UPUA 2FW9A 1RMQA 5DXFA 3V2IA 4EAAA 5K7ZA 2IQIA 4WXMA 1LS1A 1Y5MA 1XPXA 1PGNA 2WSBA 3RU7A 5I7RA 1CVIA 3AESA 4CMCA 3KT3A 4JL6A 1RR6A 2BHRA 4BATA 1A8QA 1IG3A 4ZCTA 3EX7C 3ZVNA 2ZSHB 3TVTA 1UG0A 2AVDA 3LUDA 4TWIA 2UXXA 4CQLB 5JROA 4C7OB 4ZKEA 2NOJB 2F1JA 4JB3A 5E8RA 4DIOA 3HP7A 5K4GA 3VJRA 1MORA 2ZS7A 3PKIA 4XN0A 1AS0A 4IR7A 4FU0A 2OGUA 3D02A 1X9IA 2XB4A 2BVLA 4ZTBA 2YHSA 3BS4A 3PCTA 4E09A 5HUQA 1QVRA 1IIBA 3ETHA 4JX5A 2GAOA 1UJ5A 2H57A 3HCAA 4KFCA 3I9KA 2F8LA 4OYRA 4D5GA 1AMUA 3NXKA 4P4SB 1IRZA 2ET6A 3FFBA 3IWFA 5K8UA 4FW8A 4LY3A 5DM60 3GJTA 5F04A 3FDYA 5KS2A 3PQCA 2XT9A 4HL6A 1ESNA 4OB6A 2OORA 3JWHA 1VPEA 4NCJA 4PINA 5F1RA 2STWA 2BONA 5CJJA 4PTZA 1XNGA 3P52A 2K5CA 2KDZA 4GO1A 3COAC 1M72A 1A88A 3LFHA 4JYBA 1PZMA 4C3UA 4E22A 1ZO8A 3GVCA 4H31A 2PLYA 1J0EA 1DAGA 3NYQA 3A6HA 1NVVQ 3U5TA 4C3IJ 2O5RA 2CDRA 3H3JA 4YR9A 1B6AA 2Q5OA 1RPWA 1COWD 2KIMA 4OREX 3R0XA 1Z73A 4M99A 5ECYA 4OXNA 3FMQA 3U1VA 2F00A 4FNGA 4TQAA 4B4CA 1OU0A 4CYCA 1TAQA 2BZ1A 2FAXA 3KXPA 1YNSA 3E23A 3ND7A 4HN9A 4MNTA 4FGKA 1IEXA 3ISVA 5DBEX 2V5AA 2Z4TA 3NASA 3OZFA 1GQOA 3AGPA 3MIZA 3GLFE 1T0HB 1P33A 1WDTA 3VZDA 2QN1A 2DH5A 1ORIA 2NNYA 3C70A 3D0QA 3AAFA 3MXTA 1YYVA 3OKAA 4IDDA 2I4MA 4P32A 1NPTO 4YEJA 3QIAA 3TLCA 3CLTD 4ECAA 1IJKA 5KOJB 2BLLA 5IK2A 3OZGA 3CGGA 2YPRA 1V11B 2PXHA 2HNAA 1STOA 1F1JA 3PD1A 3T9FA 5E17F 1CUYA 2I2DA 3JSXA 3KWLA 2ZT7A 3RYIB 5BWNA 4MVWA 4UDNA 3LLSA 1KFCB 1XEXA 3G85A 4C14A 3W2TA 3NDPA 2F3RA 2ZBQA 4PFOA 1P45A 2JIZD 5AW5A 3RV3A 2O8XA 2F5DA 2VP0A 3ZKWB 4ER6A 2PGNA 1AH2A 1R1VA 5BQTA 1KI8A 3V8QA 4BKMA 4EJSA 2JH9A 1FUIA 1HSJA 5FYDA 2XOXA 9LDBA 1USKA 3FDFA 2UXBB 3PUIA 1S2MA 3W90A 4MIKA 3WGMA 3FZVA 4EGSA 1MAVA 4L0MA 3WMGA 4XKWA 3R6WA 2RGRA 2FHPA 3EISA 3QWHA 3CMMA 2VKVA 1QTRA 1WXIA 2CUJA 1ZN8A 4RXMA 1DQPA 1ZONA 2PZ8A 2Q6LA 3F3MA 4OI1A 1O0SA 4TVBA 4H0NA 4FFPA 4NH4A 1ZJ6A 1SUPA 4K2EA 1D2EA 3FNIA 4LDJA 1M83A 5M2QA 2FRVA 4JJ4A 4GMKA 5CIQA 3CE6A 1Q6YA 2WAQN 1J00A 4XORA 1W9HA 5LZ8A 2QMQA 3KKPA 3V1UA 4DYQA 1QZ3A 4EGZA 1BNCA 3K1YA 4IM7A 1XO1A 5IAAA 2I10A 3SDBA 4A0YA 2PVSA 3QUQA 5BSHA 3VDXA 2LZ0A 4OA5A 5KNDD 3THSA 5B2ZA 1W36C 3QKSB 4CIDA 4EG6A 1OR8A 2FYTA 5ILSA 2FUG2 2MHCA 2NT4A 4GSYA 3HV0A 2RD2A 1I32A 4PR0A 2XAAA 3WFZA 4ALJA 1RACA 3EQZA 3OYKA 3DGFC 1R6UA 2VP4A 2H27A 1BN7A 2BHLA 2WJAA 1XGSA 3HVIA 1R3DA 5JD4A 3K2AA 5A6VA 1G42A 5EZYF 4KU4A 4BKXA 2J9GA 4ZVUA 3KZZA 4JLVA 4BQIA 2HHLA 3CDHA 1KDRA 4BNUA 3EA0A 2RNGA 3P4XA 4HAZA 4PLTA 2QF7A 4L57A 1I5EA 3N1UA 5CDHA 1XP8A 1EGVB 1FQJA 4QXMA 1Q57A 4JUFA 4GDFA 2EEZA 3B3JA 3ROPA 3TEDA 1GQRA 2R4QA 1AN9A 3DQPA 4LB5A 4YV7A 5KVAA 3ZD9A 4EHJA 1BC5A 3B1KA 5IAOA 1JQEA 1JR3A 2JFBA 3E1SA 3QGMA 3ZWKA 4ZDLA 4E07A 5JNSA 5JTUA 1X8XA 3E5HA 3FLBA 4N6NA 4CKCA 1XWFA 5JDIC 2Y4NA 4MQLA 5K5QA 1W25A 1V7QA 4EZIA 2AHQA 1DU0A 4QOGA 3ZN0A 2C9BA 2AW3A 1R12A 3L77A 4ZOCA 1U2RA 5FUWA 4C0QC 1T1GA 3HCEA 5JRZA 4GZMA 4BRZA 4HDVA 3DLPX 3WG9A 3FHNA 2CFCA 5JRJA 3IKMB 4N5HX 1WZIA 2LKSA 4QNRA 2JH8A 4E14A 1MC5A 2F3SA 4ZAGA 4CMEA 1GG5A 1SFUA 3EUEA 3JYOA 5FL7D 5ILGA 3H3ZA 2NVQJ 1A77A 2VCEA 4B2IA 6LDHA 3DL2A 2IHKA 4BE0A 4IQ4A 2PX3A 1BE8A 5GIPE 4TROA 2F4VB 3KUXA 2WY7Q 2VA9A 1M8KA 1YKGA 2XVZA 4YAOA 5C5CA 3AVXA 1N2IA 1AUXA 4RGVA 1XRSB 4CHUA 1ZITA 4TMTA 5ADUS 5BURA 1WJBA 5EP2A 2FRDC 4GQAA 1TJ4A 2JI7A 2EGGA 2J3EA 1U0OC 4HVCA 3JQGB 2YMLA 3D2AA 1WMSA 2O2CA 3E84A 2XW6A 4UUQA 4EA6A 1RZRA 1QP4A 3EDMA 3KWMA 3L4JA 2ZUWA 2EFYA 4RPIA 3C5EA 2DFLA 2O2HA 2QKLB 1MQ9A 1PZFA 2FW6A 3O73A 4KLZA 3K9TA 1SIWA 2KLBA 4RW0A 3AB8A 1P3DA 4HDMB 3EMVA 1TO1E 2ZUCA 3JAWA 1MLDA 3AILA 2WU0A 4R1QA 4UXHA 4ZV9A 5B7GA 3ZHSA 2PEXA 4X1IA 4AC9A 5B7NA 5JCPA 4RKYA 2WTAA 1WMEA 4NSNA 1OCCH 2V6CA 1EJ2A 3UPDA 3G5LA 2XZPA 4J7CA 4UVEA 4MGZR 4RMJA 1PN3A 4EYEA 3IQZA 1DO2A 2ZRNA 5LDHA 3O8OB 4B4OA 2IUTA 5FD8A 1E1YA 4JLDA 4XGRA 1MCZA 4YMGA 3K73O 2A5FA 3FCAA 4CODB 1V4RA 2GPYA 4DKXA 1RI3A 3GLIB 4DBRA 4H1TA 4QTRA 1RM0A 1I33A 1FRZA 5JANA 2OGWA 4OKIA 1MNAA 2GD0A 3T3IA 3BTVA 1MBGA 3DKVA 1E0AA 4P83A 3IIKA 3ADPA 2L54A 1BMQA 2XB8A 3M5DA 4Y2XA 3TLKA 3BEOA 1F14A 1BCSB 3ESQA 2PRSA 1T3TA 3F8NA 1EZ1A 3ER6A 1ABEA 4QARA 3L06A 5ENVA 5EUQB 4BN5A 3SZPA 2GNOA 4MMZB 3NTUA 5FLEX 4C22A 3IC7A 2JLYA 2B1GA 2EL9A 3VSKA 4JJGA 2XGEA 1ULAA 2HMYB 4MS3A 1OTHA 3QXXA 2JA7J 1MJAA 3L9WA 3NJRA 3OKPA 2FK8A 3DH0A 1VA4A 3NBXX 4K9MA 3C5CA 2DMNA 3RIEA 2GAIA 4IL6C 3E5QA 1LBSA 1KEKA 5KJ6A 4ENKA 2HXGA 1KEVA 3D5SC 1JH8A 4C4PA 5IDQA 2GEBA 3FISA 2H00A 2LYCA 2AN4A 1QG2A 4Q7QA 4RS3A 4CE6A 1BOBA 5FFFA 4Y9RA 4R1OA 3ND9A 2KP6A 1JRLA 1UC8A 1ZUIA 1V41E 3N97A 5FJJA 1SCBA 4IWYA 5ILQA 1P62B 2ZRHA 5D4RA 1Z0DA 3JALA 1YO5C 3LBYA 4ND8B 4UOEA 3GMSA 5K8CA 1D4OA 3ITEA 3HTXA 3CJQB 1YJNI 5JD5A 2IZZA 3NBUA 3ZLUA 4DXDA 2Q5HA 1DV2A 1L7QA 2OQGA 3OLQA 4PYQA 3FSGA 4BASA 2BGGA 1ISHA 5SZIA 2EFGA 1QF7A 5CXSA 1KEWA 2XOEA 1U3DA 2HA3A 2R86A 4MVXA 1LEBA 4PZEA 5CDYA 6GPBA 3FMIA 1E18A 3EZGA 2R97A 3MOGA 4UDXX 1PWHA 4ZYYA 3JAMK 1YIJI 3K0LA 1JTXA 4K03A 2PKEA 3LOCA 2QV0A 3MTAA 4HDOB 4LJ6A 4EI9A 2P6RA 1LK0A 2O0KA 4HTAA 4JLSA 5GINE 2MW8A 3LCMA 2RN7A 3KQUA 3AGQA 1NRJB 4ADSG 4U7HA 4ES6A 1L4HA 1QLHA 1YS9A 1RTTA 3KWJA 5AD1A 5LYJB 4LZAA 3BAZA 3EUHA 3X3HA 1OE0A 3D0RA 2COUA 4ON0A 1FK8A 1RWBA 3LY7A 4OB8A 4RD6A 1HEYA 4BMVA 1IZ0A 3HUTA 2IGNA 3R4VA 3N2EA 5HJ5A 5CT5A 1QO9A 4J94A 4HB2A 5ENDA 1NF8A 3HSEA 1ID1A 1NMQA 3HDVA 1MMNA 2WBMA 1A2QA 1K6XA 4AZ0A 5ADHA 1NFRA 2ASVA 5FTLA 5EXSA 2HU8A 4YQYA 1SWWA 2CMFA 2E7ZA 3K9NA 1L7AA 1LKXA 2ZBGA 4TL9A 3ISPA 1U7UA 2WY8Q 2K7FA 4Z4EA 2AS0A 4YCDA 2Q3LA 3KPHA 3G0DA 2PX8A 4DJTA 3C4QA 4LY6A 1KKMA 1R50A 4WADA 1Z6PA 2HTFA 3E0QA 3N2YA 4OJKA 1Z05A 4F0JA 1DLJA 2CB0A 1J90A 2LBPA 2ZK7A 3GNQA 3WTZA 3KJZA 1F4PA 2C7PA 2C8KA 4KO2S 5HF9A 3TLJA 1BWSA 4BBSJ 2JRCA 4BNCA 2BZ0A 4RGBA 2AQIA 5DLDA 8ABPA 4ENUA 3PO2J 3FD8A 2CNWD 4LEIA 2HBZA 4RKWA 2K9MA 4MTLA 1IUYA 4G5QA 4B32A 1YTLA 3WZLA 5AI9A 3EW9A 4Q9NA 2XTNA 2YHUA 1FUYB 1D6SA 3DS8A 4IS2A 5AJZA 5T57A 4DIEA 3DZGA 4HSGA 2ZUUA 3ZHOA 4F96A 2H3EA 3EUWA 2P6NA 2R5ZB 4HLCA 3FXMA 1FXUA 3AL0B 4E03A 2VBYA 1UF9A 1OI7A 3QE0A 2MSEB 2Y9YA 4DDHA 2JFNA 4F9FA 3ZCOA 5D7NA 4D9CA 3I2GA 1LK7A 1VFNA 2MYUA 2HU9A 1WGXA 3L4BC 1HDXA 4WKCA 3USES 2Q2EB 3I34X 4NZZA 2CXSA 3K0CA 1TQ4A 4GYWA 4ACBA 2QP3A 2J4FA 3H99A 4YRGA 5JJBA 2YFKA 4E6PA 2Y69H 2WKSA 5I48A 2V7VA 5LNK1 4OHMA 3IWZA 5GAHJ 2NG1A 4HB0A 3RSCA 3E5NA 4NATA 3UJNA 5ILOA 4ERXA 2PMHA 4FOTA 4XRSG 1I3OA 3I1YA 1OA1A 4PHCA 5IG2A 1FVFA 1KPHA 2VBIA 1C7FA 3ETNA 4DANA 4UFPA 1JEQB 2QIOA 5BSRA 1FS5A 4M9ZA 4Y2JA 4YJFB 1V6SA 1Z5PA 2CWDA 3CEPB 3GCXA 1BHO1 2HQAA 1OAKA 2CFTA 3W5CA 1B8IB 3WI7A 4GFBA 1E2LA 4ENJA 2ZJPF 2GH1A 3CRZA 3GFSA 5EEHA 3KDSE 2PL3A 4KO8A 1ZPDA 4QGFA 4XQEA 1TUEA 2EP8A 4O63O 3CR8A 4UAJA 4F9GA 1FMFA 4KWTA 4GXTA 6ADHA 5EG0A 2ZXWH 1SBYA 4HEJA 1SWVA 4RORA 4C7MA 4EQ6A 1KO8A 3TGPA 4L5EA 5LHGA 2LIPA 4DIMA 5D8KB 4DQKA 1HT3A 3MTQA 1A2OA 2HOQA 4GS5A 4CV0A 2BXYA 3I2KA 3NX4A 3GOQA 3BK2A 2QRHA 1BW9A 1KBOA 3MD9A 2XE4A 1F8GA 4E12A 2ZIZA 4FM9A 1BEEA 2J07A 3COJA 3QVLA 3CURA 2V8OA 2Q2VA 4GYIA 2O0MA 4MVJP 4GMGA 3NARA 3UKJA 2J9YB 2Q0QA 2V55B 3H83A 3IAM1 1NWHA 4WZAB 2JPDA 5CP8A 3V9AA 4EX7A 4K7JA 2PL9A 3PJDA 5FUQA 5JY6A 2HKOA 2O6LA 4N4OB 4M7OA 4XYGA 5FBQB 5K7SA 2B9SA 2I99A 2R5YA 2TECE 2XADA 4XKCA 5DRTA 1PYOA 4F5YA 2GAAA 2VUHB 1NT2A 4FYKA 4UE2A 4F4FA 2GETA 3O2SB 3LGXA 4QIHA 4CUJA 1D1CA 1OBVA 4Y3OA 5IX8A 3WG7H 4RZSA 4LG3A 4G97A 2VP3A 3WGKA 3EXFA 2DC1A 1L5NA 4N48A 1W87A 1JTEA 4JB0A 5HKOA 1FU4A 1NOKA 1WEKA 1R4NB 3ZOKA 3LU1A 2M6RA 4V0MA 5GADl 2V79A 2OXRA 3GJ7A 3U48A 4AXXA 4ZCRA 1LBTA 2FLVA 4BFCA 2LRDA 1DIRA 2NSHA 5BPFA 3RQIA 3HDQA 5JD6A 3VB2A 1X4OA 2O3SA 3NM5A 2QKYA 4FHZA 3E3MA 1G5RA 2KS6A 1QHSA 4MW7A 4H4CA 3DMNA 2C0CA 4X45A 5EJAA 1SQSA 4WMLA 1LSOA 3QSGA 5DWQA 4BV8A 2EFQA 4C78A 4ENSA 5D6FA 2QSFX 3DWLE 4CCJA 2RGDA 3A0RB 3H35A 2PI0A 1CUWA 1CE8A 3QJ5A 4WECA 1KA8A 3KSZO 1JQKA 4NCAA 1N2GA 3BHNA 3TW6A 1VGVA 3JQ9C 3MT0A 1EVKA 2AR9A 5ICEA 1IK4A 1HUQA 1M2FA 2QLFA 2QZZA 3NHLA 1EXVA 5B2EA 4IS3A 4MWGA 5D8DA 4AX8A 2GYUA 1J9GA 3IEVA 1L6RA 5HPYB 4MQ6A 4Z7QB 3BCSA 2CNNA 1UH5A 3DG9A 3ZN1A 4M1YA 3W5SA 4BMNA 5C1DA 2DMPA 5KHLB 3IP7A 2IRFG 3PVCA 4JJAA 4QNMA 5CM8B 4OAZA 3BJZA 1GFIA 2W2TA 3W6UA 1Y4UA 3SF8A 4BX2A 3VR5H 1GPBA 3B89A 4MVJF 2WHPA 1GYQA 1R5BA 4JEUA 4L9NA 3M6UA 3RCBA 3D0KA 5FWXB 1ZTRA 1C9MA 5B3LA 2NNNA 2GVNA 5LNK6 5BSFA 3SI7A 1JP7A 5DEIA 4EGJA 3OY2A 4RPGA 2V0GA 1TA9A 2OYRA 2WG1A 1A1VA 1JDZA 4GGPA 1ZM9A 3K5HA 2AFIB 3L01A 2BGIA 1A69A 4QPOA 1R10A 3IOCA 4LGMA 3TBFA 1TNTA 4GMXA 4PFKA 1YGPA 3W1WA 4CIAA 3CX4A 4Q3EA 3U3JA 1IOLA 2DWUA 4H1WA 1E4EB 5E3IA 5ED0A 1QFZA 3D6UA 4TUYF 3GFFA 1B4AA 2HOEA 2NYXA 3IHUA 1N92A 2ON6A 4ZYLA 1I1HA 4I55F 3NEAA 2E2WA 4FKBA 3SKVA 1GVHA 1LE8B 3T5XA 3RU3A 3UWOA 3F4BA 2CMKA 4O25A 4A2CA 4WESB 1MAHA 2NVYJ 2ZJQF 1QUEA 2GBIA 1NR1A 2UYGA 3KUDA 5FBKA 1CRPA 4H16A 3MGAA 4OM7A 2HCBA 4TKUB 3A1WA 4WF2A 5EA2A 2L5QA 4XIYA 4EI2A 1UELB 2D3WA 4U7GA 2DA6A 4M98A 4O4HF 3VTKA 3R5KA 3DTEA 4G9GA 4TV8A 4UBKA 4RTOA 2WOOA 1Q44A 3RVQA 1V39A 4A0SA 1OTXA 1X2EA 3FFTA 2J5OA 4NBKA 5GPBA 2UUZA 2O6GE 4DLSA 1XWWA 1EWKA 2CH0A 3BJMA 1ZJ4A 3CCYA 1IH8A 3DO8A 1VCIA 2QRQA 3JWIA 4V0NA 4UB6C 1MPXA 2W2XA 4ZRNA 3UWPA 1SC4A 4IAOA 4J2TA 5FNVF 5I9MA 2R5FA 3SJMA 2QVOA 2YJZA 1BWRA 4TLBA 5FPQA 3BGSA 1GXSB 1T33A 1O3TA 1DNPA 5HFAA 3BZWA 2EZIA 4CR8A 4D7NA 1VPTA 5JVDF 4AAYA 2JGMA 3I01M 4JBAA 3AG3H 3HSFA 2ZRFA 2C5AA 4IIBA 1D2GA 1XRQA 3IR5A 1QIIA 1EK1A 1U6KA 2L17A 5ALXA 3TIGA 3ZDDA 1FWZA 1C9DB 2DBZA 4YMWA 2IS6A 5CK5A 2DTZA 5T64A 2FV8A 4XPIA 4D3YA 2ZSAA 3F8MA 3P7MA 3QOFA 2AKAB 3FNHA 2UZKA 2O06A 1TM1E 1Y9ZA 4L3OA 3OPXA 2N47A 3QW4B 2XITA 3K53A 3ORFA 3O1LA 4DIFA 2YS9A 2XUJA 4YCCA 2WJPA 4B3HA 5LJLA 4XLHA 5ELLA 1GXPA 1P3Y1 2BP7B 1EF4A 2WVHA 3FMFA 2W82A 1O1YA 2EIJH 5CJ9A 1QOPB 1U2QA 1Z35A 4LJZF 3JPWA 2Q8KA 4EJVA 4YG2F 1PS8A 1UBNA 1XDWA 1WXWA 2Q3MA 2VXDA 3CC7I 1I6KA 2I6TA 2RH4A 3QKIA 1XSEA 3BB3A 2H5IA 4DZTA 4COKA 4F5ZA 3BMOB 2YQZA 4IOJA 4YRZA 4TMKA 4RLQA 1B72B 3IOYA 2RH9B 5C3UA 1BI0A 2VYNA 1JLKA 4FT4A 4A3BJ 1XKQA 4I36A 2QRLA 4URXR 3E03A 1UUFA 1L7NA 4UNPA 3ICCA 2LLKA 1T2CA 4YIFA 1MF7A 1A95A 2IHTA 3CBQA 4J0GA 3A31A 5DGCA 3T3HA 3OWHA 4DA4A 3B70A 2VN2A 2QA5A 4M73A 3TRDA 3ZQIA 1YQGA 1ZLXA 2FPKA 1T5HX 2FF5A 4PCVA 5GGXA 5ALYA 1ZNQO 3ZE1B 1JHFA 4INAA 4MYSA 3F72A 5GAGJ 5IAGA 3ILSA 1A9XA 3DMPA 2Y0BA 3GT0A 4KQ1A 4OHKA 2QQ9A 1Z3XA 1JYSA 2PX4A 3ZD8A 1H1TA 1TEVA 4IQGA 3S2ZA 3PU6A 2IP1A 1P7IA 5DBHX 1C7RA 3DKYA 4YRSA 2IYLD 3N75A 3A3NA 3UAGA 2IA1A 1ABFA 5AI0A 4DW6A 2E21A 3KVVA 4PXYA 4POOA 2PXAA 4BX0A 1GPAA 4U7WA 3BK1A 5KKNB 4LLLA 2BTEA 2OO5A 2B4TO 2QM0A 4JDUA 1XKLA 1KPIA 3KPVA 3AFMA 5ERYA 3ND8A 1AB6A 1ESZA 5EHNA 4C4TA 5L7WA 3GA7A 1VE6A 1GTRA 2Q6TA 1JEOA 3P0JA 1L1QA 2P3QA 1ZMBA 2JAPA 2IS2A 3KBOA 5HMMA 4JITA 3D1JA 4JQZA 3LW7A 2G9WA 2RGXA 3WLEA 2X1MA 5TJHA 2AQHA 1R1TA 2V65A 2AJ8A 1M1EB 1WZ2A 4A5NA 1MHPA 1QGZA 5SY6A 4ZDKA 4EGQA 3OSGA 1IN5A 2CWWA 3H1PA 3CPHA 1QMGA 2HN9A 5HKKD 1XX5A 1N6IA 1R0BA 4P9UA 1E3HA 1RHQA 3VZBA 4LOAA 2LFBA 1UT6A 4F93B 3MTIA 4YWJA 4PYMA 3NEUA 1X7XA 3C6QA 3AV0B 2WYVA 2OMKA 4FDMA 4K8RB 1Z12A 2YWRA 1QK4A 3AETA 5IM4F 4Y7NJ 1KJYA 2F8SA 1YW9A 2DFEA 3TLYA 3F7NA 4UHHA 3KC2A 1X7WA 1T6NA 3L4SO 5A6SA 2LKPA 2EBHX 3GJ4A 3HZOA 4PQYA 2K40A 4Z9BA 3TUIC 1Y42X 3BMQB 4QIWN 5CNJA 1QGUA 3R9XB 1NONA 2C3OA 2A14A 2C82A 3FR7A 5F1KA 5L53A 4NL4H 1ENOA 3ADOA 4W9NC 1ZG5A 3SP1A 2VNKA 1DT3A 2XUPA 3OLYA 3BG3A 2QWXA 5LA6B 4OGKA 2NAZA 1KYIA 5AP9A 5B36A 1NQ5A 1LPAB 2DMUA 4WERA 3BQNB 1GT91 1F2UA 1LI5A 3AEUB 3KL4A 4YIIA 1YL7A 2QBYA 1CF7A 2AH5A 2I76A 4NY1A 2GXUA 5K20A 4IRMA 4DRXB 4J1NA 2D5BA 4AQ7A 1RXVA 4CM8B 2RQPA 2V0NA 5BV7A 2ROQA 2A61A 1L7EA 1DU6A 3FLAA 3KTFA 2NU7B 2ZVDA 3WB1A 3LWBA 4OMUA 3OFKA 1U2EA 2FMHA 5F76A 2XWSA 3BL5A 2DQRA 3DT8A 1HYEA 1QE3A 2FXVA 4LWQA 4D4LA 1EA7A 1OH6A 2H1LA 1XF1A 3SXPA 3CLRC 3RT1A 3TDKA 3A4TA 4HSTA 3MS4A 1WETA 1DEHA 4OXKA 4QUDA 4GH5A