4IO9F

Crystal structure of compound 4d bound to large ribosomal subunit (50s) from deinococcus radiodurans
Total Genus 8
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
8
sequence length
71
structure length
71
Chain Sequence
b'MSYLIRKAAGIGKGSSTPNKAKVGKLNWDQVLEIAKTKMPDLNAGSVEAAANTVAGTARSMGVTVEGGPNA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords 23S ribosomal RNA
publication title Novel 3-O-carbamoyl erythromycin A derivatives (carbamolides) with activity against resistant staphylococcal and streptococcal isolates.
pubmed doi rcsb
molecule tags Ribosome/ribosome inhibitor
total genus 8
structure length 71
sequence length 71
ec nomenclature
pdb deposition date 2013-01-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
F PF00298 Ribosomal_L11 Ribosomal protein L11, RNA binding domain
F PF03946 Ribosomal_L11_N Ribosomal protein L11, N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.250 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Ribosomal protein L11, C-terminal domain 4io9F00
1YIJI 2JQ7A 2OTLI 4IO9F 1VQ5I 1FOXA 3I56I 1FOYA 3CCLI 1ACIA 2H8WA 3CCJI 1VQ8I 2ZJRF 1VQOI 3PIOF 3CCSI 1YI2I 2FOWA 1VQLI 1S72I 1HC8A 5GAEJ 1VQNI 2K3FA 1FOWA 3CD6I 1VQMI 2ZJPF 3CMAI 2QA4I 3I55I 4V19K 2E36A 1VQ4I 3J7ZI 1YJWI 2OTJI 3J7YJ 1VQPI 4IOAF 3G6EI 1VQKI 3CF5F 5GAGJ 1VQ7I 3DLLF 4IOCF 2QEXI 1VQ9I 3PIPF 3CCVI 5JVGF 3CCEI 5GAHJ 3CC4I 3CCMI 1YJNI 3CC7I 1YJ9I 5DM7F 1YHQI 2E35A 2ZJQF 1VQ6I 5DM6F 3CJTB 3G4SI 3G71I 2NXNB 4UY8I 1Y39A 3CCUI 3CCRI 3CC2I 5GADJ 3CCQI 2E34A 1YITI 1MMSA 1QA6A 3CMEI
chains in the Genus database with same CATH superfamily
3D0SA 4HV6A 3BY6A 3GX4X 3EDPA 3LAJA 1XSXA 4PUSA 1U3EM 3S1QJ 1RI7A 5ERIA 1D5YA 3AL0B 2VONA 2XKOA 4S0HB 2ZMEA 3K9TA 2LBFA 1BOBA 2CUZA 2E7WA 5CLSA 5LHIA 3OWTA 4XKCA 5D6FA 1XGMA 2VQLA 1ZKGA 3L2QA 4M72A 2QENA 3DXJF 1W5SA 3JCUC 4GCVA 3BZKA 2FQ4A 4HPQA 3DFGA 3QRFF 2KQRA 2Q0OA 1E0EA 2YX7A 4EQQA 4U0WA 4U88A 3HOTA 4HF2A 4E7KA 4YIRX 3GTQJ 5FKOA 1J9IA 2IS4A 2UWMA 2R7TA 1XSDA 2IGKA 4XN3A 4Y15A 4PGHA 1U6GA 2EWNA 3O8GA 1K6OA 1R5GA 1S6LA 1T08B 1ZH5A 4G6DA 4L9JA 1JHFA 2WADA 4I99C 4P96A 3RQ4A 1A6IA 4PCQA 4B48A 4EVIA 2QA4I 3OV8A 4ASNA 3I55I 2TDXA 2LKXA 4G8XA 4P1WA 1OMIA 2L9SA 1RRJA 4IRIA 3KFWX 2KDOA 4L0YB 3C3WA 3KZZA 1D0YA 1U2WA 3TQNA 4KITB 2D45A 1TW2A 5D8LB 1VQPI 4L5IA 3BROA 2LFBA 2O8XA 2HQAA 3OYIA 3GLLA 5J40A 1QVUA 4DOZA 1MD0A 2E1OA 3B73A 1OYIA 4BE2A 5KCMA 2VOOA 1N77A 2R5ZA 3EUHA 4II2A 3WHCA 2XVCA 3OS2A 3JSPA 4OMYA 1JUSA 2O9LA 1K4SA 2GIVA 3Q3SA 1UJ8A 2BY3A 5C3EJ 1W4MA 2RN7A 1B72A 3CC7I 2M3AA 3K0LA 3JAMK 4HW0A 5HLHA 1AU7A 2K40A 1LB2A 4HAMA 3C18A 3CDLA 1I5ZA 3I9V2 2WTEA 4IKFA 4M3FA 1GXQA 4RAFA 1BOAA 4RB0A 2PMZA 2EK5A 2KISA 3FXJA 5BNGA 4A3GJ 1W1WE 1WH5A 3P9IA 2ISYA 1D3YA 1ZK8A 3TW6A 1XMAA 1JKRC 2MG4A 5BPDA 1P4XA 1EH6A 3E7LA 2CV2A 1OYYA 3ECOA 1ZGJA 2DMUA 2GIZA 3ESWB 2L7FP 4XR6A 4HNVA 5CVUA 3FF5A 3FZVA 2HWVA 4GDFA 1HDPA 2DA2A 2K85A 5E18F 4BNCA 3I54A 4JX6A 3GW2A 3HL2A 2NS0A 2NYXA 1IRZA 5D5XB 5IY5H 1LPQA 1C0WA 4U0YA 2DJNA 5EGOA 2FEZA 2WY7Q 2P4WA 4YEJA 4YFXF 5E8GA 1NK2P 1IUFA 2FOWA 2R5YB 3S1NJ 4XKWA 2UUZA 2M8GX 1P7JA 2CFOA 3X2QH 2DMTA 2YSRA 5LHGA 3HOXJ 2XGDA 3KP6A 1X1DA 3CLOA 1P92A 3HBLA 3GYHX 3FMQA 2VLAA 2BOLA 3EPZA 2OPTA 1XDSA 1GDTA 5EEAA 4L9NA 2HOEA 4HQEA 1SD6A 1YO5C 3HRSA 2XUBA 2F48A 2A5YB 2ESNA 1FYLA 3B6AA 1W0TA 4KA4A 1E2XA 4CYCB 3ZOBA 2OQRA 3FBNB 4PSWA 3BZCA 5KAFC 4UVCA 3IH4A 4ENNA 4LK1F 2HYGD 3DBHB 5J8CA 3NWSA 4BY1J 2RV8A 3BLYA 1BW6A 3A1YA 1ETWA 1K79A 2O61A 1T6SA 2VQHA 3U21A 4BQQA 5FRNA 3TDUC 3GTGJ 3BTJA 1T0FC 1IV6A 5HNHA 1UAAA 1W7PA 1HCRA 3I4NJ 1O3QA 3SXYA 4BYYA 4DQ2A 1OLTA 3M4OJ 1YJNI 1JGGA 4V2FA 4P55A 3JRBA 1TWGJ 5FJ8J 4L9TA 5FFXA 4FX4A 4XLCA 2XPUA 1MKMA 2ZXWH 4AUXA 3S1MJ 4M9SA 3HDDA 1XC5A 2QKLB 3TEDA 2VB6A 1FP1D 4ZZDA 1XGOA 4OWRB 3K7AJ 4A3IJ 2VI6A 1B8IA 1QQIA 3ZMSA 1Z7UA 3OYDA 3S3OA 3CC2I 4E7ZA 4JQFA 4NQWB 2V79A 3RKYA 3PUFA 1IN4A 3OR1C 2DLLA 2LVSA 1A31A 5CPRB 3CMEI 4AVZA 4E6KG 1S8NA 4K2EA 4YIIA 3ABMH 2JQ7A 1ETQA 1U0JA 1APLC 4I0BA 3LWFA 2X0LA 2VJ5A 4YELA 5F1JA 2FQ3A 2KL4A 2KZVA 1OPCA 2HTJA 1SMTA 1A35A 2GBYA 1X2NA 4RAGA 4I01A 3V8JA 2K7LA 2BHZA 2E60A 4C3JJ 3DLAA 2GZWA 1VQ8I 1T95A 1B6AA 1VZ0A 3RIRA 4FASD 3DU5A 1ZLKA 3G3ZA 4L5JA 2DFHA 1QGPA 1R9TJ 3HYIA 1CF7A 2OCCH 4PFPA 3IKTA 2N8GA 3T8RA 4A3MJ 1S72I 5F1RA 5HNFA 4M6VA 2QYOA 2HXIA 2JN6A 3R61A 1LEAA 2ZNYA 1FMVA 2DFFA 3T0YA 2Y9YA 1MSFC 5M5YJ 3FX3A 1YIOA 2EQRA 4CA0A 1WJEA 2OV7A 3CD6I 3BQYA 1IXSB 3HG9A 3PNYA 2CW0F 4ZH4F 5J6XA 3GZ6A 3OIQA 2DOAA 4E4HA 1KYZA 4ANJA 4V19K 1V5FA 2RREA 2R93J 5ED4A 1R4NB 2L4MA 2LY9A 2VUMJ 4JBAA 1T38A 4S04A 2MH9A 2YPRA 3DBRB 4FT8A 5EF6A 3BQZA 5LRSA 4DIQA 4XLNF 1GT0C 1OFCX 2Y2ZA 3SFZA 3RZOJ 3CMYA 2UV1A 2R7OA 4LG0A 5ICFA 2DOFA 3J81K 3IAS2 1MMGA 3K1MA 4MQVA 1TQIA 3FBIB 3J80K 1QPIA 4RMNA 2GXAA 2NRAC 3VSKA 4O3MA 1Z6TA 4PZJA 5HDNA 4C3HJ 2Q2EA 4HF1A 1WPKA 2BY1A 4O6JA 1MMAA 3F0CA 2IS1A 3GLXA 3TDZC 4PFOA 3KZIC 3AFHA 3PFIA 4AYBN 1G3TA 3H9GA 1TNTA 3E1SA 5F27A 4XSXF 4RB2C 3Q5FA 2VXDA 1VQ6I 4PJLA 1AKHA 1B59A 2HQ5A 2HFHA 4LOCA 3WU2C 5IOZA 3HPGA 3SFIA 2L7MP 2M1BA 3L2UA 1J7KA 3TOAA 3GTKJ 4CHUA 4HQMA 2LNBA 2K02A 2KZGA 1Y1VJ 1U5TA 3BWGA 1QO0D 2W00A 3VYTB 3IV5A 1LFUP 1XN7A 1IC8A 3MN2A 4Z6YA 5FD6A 1TC3C 3VB2A 2ID6A 1RUOA 1OKRA 2BYVE 4JX4A 4L5EA 5IP7J 2WV0A 1SMYF 1FOXA 2G7UA 2ZFUA 2DMQA 2GXGA 1FNNA 5E1WA 5LFAA 1XGSA 1U78A 2BV6A 9ANTA 1JHHA 3ZXSA 3KCCA 1P4WA 1SVMA 3LFKA 1TL8A 2H8WA 2CW8A 2M0MA 2V9VA 1WJAA 2XDVA 3IAM2 3QOEA 3JRHA 1MGTA 4IRHA 3BPXA 4HX8A 5CJ9A 2E1NA 3K2AA 2ZMEC 2GOXB 4AC0A 1B9NA 4Y7NJ 2XGEA 5IT3A 2BEOA 3L2WA 4MNUA 3VYSB 1DU6A 2P5KA 2LDUA 2FNAA 1LNWA 4LFUA 3KEYA 5EG0A 3QQAA 4A93J 1JI8A 2V1NA 3OIPA 4NNJA 1IJWC 2F4OB 2VASA 4A3LJ 2YR2A 3HSEA 2JTVA 2X85A 1PYVA 2O0YA 2HR3A 5M3MJ 2NOJB 2KJCA 4ZDPA 4P9FA 1HW2A 5L3BA 3RPUD 2LREA 3ZMUA 3DU6A 3WODF 3GFLA 2EV6A 2QGUA 3FK7A 4LIUA 4KFCA 2EFPA 3KETA 4AU7A 3TP3A 4M9ZA 4C2UA 2RC4A 3TL4X 1LVAA 1OJLA 5E17F 3QPHA 2XSJC 2WB1A 4Z2YA 1WJBA 2K9SA 2K4BA 2HDCA 1XMXA 3W2WA 2CQXA 3OR2C 1YG2A 4XLAA 2BXYA 4RS8A 2IS2A 3V4GA 3R4KA 3HB9A 2X1CA 3JREA 3JRIA 2V9KA 3MZ8A 1T2KA 2Z9OA 3S2DJ 4HZFA 4I6ZA 2ZCWA 3H3UA 3WTSC 3OYHA 2F5DA 3K6GA 1TW3A 2EFNA 1SD5A 3Q0VA 3CLQA 4XLEA 2TCTA 4WX9A 4G6TB 2M5WA 4Q5SF 2JT1A 5E1ZB 3HGYA 1JJ6C 2MFZA 2MLGA 2V6CA 1FZPB 3CF2A 4XOPA 1YX3A 4F91B 4XBFA 3E0JB 3IWZA 3D5SC 4YRVA 3CCRI 1Y0UA 2QQBA 2NVXJ 4M9XA 2QSGX 1GVDA 2FOKA 2L01A 1YFHA 2ETHA 1MIJA 4E7LA 1MMSA 1D8JA 1ZARA 2JPCA 1Z21A 3GWZA 1WFXA 5HODA 2VJJA 3DKWA 1BI1A 1FPQA 5M5XJ 4RLFA 1FJLA 5KK1A 5CKTA 2A07F 3C1DA 4KIBA 4UUSA 2MD0A 3MD2A 2ZXHA 2KT0A 3GTPJ 4HSRA 1MNDA 3H3ZA 3IWFA 3JAMZ 2JJ7A 1P4AA 4KN4X 2QSFX 2VKHA 1TQMA 3H36A 3D5RC 3WTTC 3F3XA 1Z0XA 1I1SA 1X4OA 3RZDJ 4D5FA 2VN2A 2I8DA 5M3FJ 3FKIJ 5B1AH 3E6BA 2XB0X 2CGPA 4OINF 2V1DA 3M8JA 4NC8A 4FHTA 3CCSI 4L9VA 1HF0A 5EZGA 2FA5A 2EFWA 2O7OA 2NVYJ 5F04A 4KIGA 2HVSA 3FISA 2M7AA 1ITYA 1BW5A 1OR7A 3WTUC 2Y0SA 2L7KA 4RBOA 3GZ5A 4UV9A 3RQIA 1ZGAA 4BJTA 1LQ1A 4CGZA 2B63J 3ZQGA 2EZIA 2OZ6A 5FLXK 1Y8RB 3LSTA 1ZRCA 3ABUA 4CCJA 1SVLA 2XPWA 3IP4B 4FTHA 3LSJA 2EBIA 5DV5A 5FLVA 3K2ZA 4UXNA 4ZYEA 4EJUA 2VOPA 2HDWA 1ETOA 5AONA 3DWLE 4B09A 4M74A 5GAGJ 5DCMB 1R4MB 2VJ4A 2KPMA 2LTPA 3EUKL 4LIVA 2B0LA 5HS8A 1SAXA 2HPMA 3F8FA 2LC2A 4DYCA 1MBEA 3DKYA 4BE1A 4N0BA 2QBYB 2M0CA 2FUG2 2MA3A 3MZYA 3C2HA 3B6CA 1EA3A 1AOYA 4PDKA 2XC7A 1XS9A 2A68F 4O5VA 4HSTA 1NG7A 3CUQB 4LLGF 4HBLA 4ZC3A 2J5PA 4B43A 1QZYA 1SANA 3HOUJ 4Y3OA 4IXAA 3LNQA 2QF7A 2DPDA 1J0RA 1YQAA 2D2WA 1ETXA 3RYRA 3WU1B 1O7FA 3V8LA 5J8FA 4CCOA 3KZYA 2EINH 2PG4A 1QU3A 4P5OA 5GADJ 1HKQA 5J1RA 2ME0A 2DPUA 4IQJA 5L3DA 4J19A 1MMDA 3FXKA 2AXLA 3SZGA 3EYIA 2R7UA 4JK1X 4BXUA 4A3BJ 2F4IA 4RGSA 5GP9A 1VQ5I 1UG0A 2Y69H 2PEXA 3HKZN 1AHDP 4CSWA 5E20A 2HDDA 1LFPA 2V1XA 3C7JA 1IN7A 2WAQN 4U7DA 1JTYA 2VT3A 1HLVA 2FX0A 5KHDA 3D1NI 1MJAA 4Q48A 1E3OC 3CO7C 2PX9A 1Y56A 1BN5A 3HPHA 2LY1A 2P7CB 1GHCA 4J01A 2IVMA 1R49A 2JSPA 5IP9J 2X6YA 2IP2A 5GAEJ 3L9FA 2EIKH 1X1CA 3UR3C 4ZJZA 1H89C 1VTNC 2KIMA 2H09A 4C9YA 5FKNA 3CESA 4M3BA 4CCMA 4JX5A 2F5CA 1W0UA 1XG1A 3ZMTA 2L9RA 3KYLA 2NVTJ 5K7HA 4EM1A 1ZTRA 4KNYA 4A3KJ 2CJJA 3AG1H 3FK6A 4C30A 2E36A 4LB6B 2XF7A 1TWHJ 3IH3A 1DUXC 4N9HA 3KE2A 5B3SH 3ABTA 1N78A 2ESHA 2VQGA 1FP2A 1Y0NA 1H0MA 3HOYJ 3LSMA 4PGGA 2MBFA 5EJCA 3QAHA 4FE7A 4BQNA 4G9YA 1RESA 4FX0A 1JE8A 2HZDA 2HQRA 1AWCA 1FBQA 1HQCA 2ELJA 2ZXIA 3T5XA 2QSHX 3RYPA 4WXHA 5LRRA 4DZPA 1ZQ3P 3CJRB 1MBGA 5E8IA 3MMYB 5L3EA 3CCVI 1MDMB 3GTLJ 5JVGF 3SEQA 5GAHJ 4EEFG 3BR0A 2ISZA 3OY9A 5LEKA 1D5VA 5K7ZA 3I64A 2ELHA 3GZNB 3I59A 1HSTA 1QHGA 3ERED 2ZJQF 3J7AY 4BXFA 3LA2A 1H88C 2JSCA 4G7HF 2ECBA 2HVQA 1IRFA 2I10A 3M7GA 2LD5A 1TWFJ 4HG2A 3IRQA 2ZMEB 3IL2A 1U8BA 4XLFA 1YITI 2H1LA 1R00A 3CTAA 1QA6A 4BHBA 2EB7A 3WTZA 3ABKH 3BG3A 2DK5A 3J81Z 3S3MA 4MEXF 4WK8F 4IHYA 3W2AA 1U5TC 2QQ9A 3PO3J 3PO2J 2HZTA 3J80Z 1BJAA 3PJRA 2DQLA 1PUFB 5FRMA 1K78A 2LRDA 3R0JA 4ZTJA 3DTEA 4I98B 1XSVA 2OCEA 3IUOA 4UVBA 1DGRM 3KP4A 2K27A 2CUEA 2DA1A 2D1VA 3FWEA 1R22A 1EJ9A 2X48A 2AHQA 2DT7B 4PJNA 3K70C 2R0QC 3NRVA 4FCYA 1ERDA 3HSFA 2R7WA 3HGGA 2GQQA 4LITA 3GTOJ 2VE9A 2BVLA 2R5YA 2EV0A 4HX4A 2I5UA 3DBLB 1REPC 4XN0A 3LSRA 3K1NA 2M87A 1ZN2A 2EZHA 4RAZA 2E2IJ 2M34A 3K10A 3JTHA 3OS1A 2LOOA 2LP0A 2IRFG 1F36A 1FSEA 5HDGA 3OYBA 1YLFA 5CQGA 3F8MA 2VC0A 4XK4A 3GFMA 3KIOA 2KFDA 4E7JA 3EUAA 2FD5A 2M2EA 2ACJA 3WG9A 1DP7P 3OS0A 2M8EA 4KDPA 1P6RA 4IRGA 3I0TA 3W3CA 2BHYA 2L4AA 4BQOA 2DFEA 2H6CA 4D7NA 4A3JJ 4CYCA 4PK4A 4KT5C 2OZUA 2L2OA 3GMEA 2OTJI 2STWA 2WAFA 5ILVA 5DTDA 2LF7A 5D4SA 2QUFA 2K5CA 4GXOA 1X58A 3AKZA 2FRHA 4IJAA 3I4PA 1VQKI 2W24A 3ZQLA 3E3VA 3PSIA 1ZELA 4EATA 2R3SA 3O8HA 1LVKA 4HDVA 1Z3YA 4UV8A 1FY7A 3FM3A 1Y1WJ 5D5VB 1TT0A 4RM3A 2E1MC 5BQTA 4GYGA 3ZMZA 1T39A 3FXOA 4JOMA 3DF8A 3NWTA 4ZZLA 2GWRA 3CCEI 3PUBA 1ZG1A 2XAJA 2EILH 2GM4A 4E7SA 1IN5A 4X0GA 3SYTA 2NS7A 2W25A 2DYSH 2XIGA 5BS6A 2P5VA 3H0DA 1J09A 1X3ZB 2G9WA 4AWXB 2M4KA 3OYKA 1VFCA 2M30A 4EJWA 1P2FA 1ODDA 2PMZN 1RPWA 4NC6A 2JK3A 3VEPA 1MW7A 1JKPC 1XDUA 2EH3A 4NQWA 1WKMA 3KYDB 2HOSA 2XHKA 1FBUA 5GTIC 2KHMA 5J1YA 2F4MB 4C2TA 1S7EA 4Y33A 1YOVB 2EZLA 1SFKA 1UHWA 1KONA 2JA2A 3GBGA 2L9NA 5FKMA 4FISA 2E2HJ 4KN7X 3KLNA 3F21A 4BUPA 1TT5B 3DPLC 4AVPA 5LLQA 1BI0A 2KRFA 3CCLI 5KNLA 1LFBA 1IF1A 2R7FA 1O7LA 2EA2A 5CVIA 1P7IA 3QP5A 4IL6C 2DA7A 2ZFWA 5M5WJ 2HVRA 2XGXA 4BEHB 4LK0F 3C2GA 3H3VK 2H1KA 2DAOA 1UHSA 2EJRA 2IGNA 2XASA 3S93A 5IPAA 4BACA 3OYEA 3TMOA 2OU2A 2COMA 5C4JJ 4CH7A 1KA8A 2H27A 4G12A 3E5QA 4MFDA 1KU3A 2R7ZJ 2ZSIB 1Z77A 3MKZA 3FIWA 3ZQIA 4ESJA 2DT5A 1HKSA 2DW4A 1J75A 3ERMA 4XSZF 3S8PA 1T98A 3E5UA 2BBYA 3KPHA 1OR7C 2CWEA 4QWQA 1JUPA 3GCMA 2O8KA 2PN6A 2F5VA 1USTA 1V55H 3F8NA 4PJMA 3FXUA 3RJPA 4R1HA 5FB2A 4XLPF 4MLOA 1L3LA 2RGVA 2VBXA 3BP8A 2HQNA 4RAYA 3O6BB 1QBJA 3HIFA 4HOBA 1V5EA 2CH0A 4H4KC 5DDGA 5LD2C 5DS9A 1IW7F 4XQFA 4F7ZA 2XF5A 4WF2A 2F5EA 4HNTA 3G2BA 4ZDLA 1I3AA 3F6VA 1BR1A 3VPRA 2IS6A 2IA2A 3DEUA 3P9KA 4BY7J 5D4RA 4HDUA 1RETA 5HLTA 3QYEA 3P7NA 1STZA 3BG7A 3W6JB 1EH8A 4BBSJ 2BW3A 2HS5A 3CDHA 1UELB 1FSHA 3IKVA 1UG2A 5FLXZ 2F6CA 5CVJA 3BCAA 2A05A 3KEQA 3OSGA 3ZMDA 2L7ZA 2AQEA 3W2VA 2XV4S 5DM6F 5DYMA 1ZREA 2PJRB 1S7OA 5K5OA 4R8HA 4ENJA 2JMWA 1IG7A 4ETSA 3DV8A 2R7XA 4ZDOA 2X4HA 1MBFA 2OUMA 3F72A 1WQ2A 3ZGKA 2VKDA 4EGYA 4BQAA 1X3UA 4II3A 3DEEA 2IJLA 1XCVA 1UZCA 2HPIA 3H9JA 4ZTFA 2K3PA 1Y6IA 1GLNA 2UXNA 3RKXA 4A2UA 2IW5A 2PQ8A 3MEXA 2XB5A 4ZYGA 2DT6A 2JPBA 3QOPA 4ZYAA 5FKKA 1L0OC 1W5TA 3WTXC 1G3SA 2X1EA 2FMYA 4IVNA 4BE0A 1Z05A 5HS7A 3HUGA 1BBYA 1RZ4A 3ZQHA 5BMZA 3H92A 2E5ZA 3JRCA 4IZZA 1PDNC 2R92J 1HOMA 3FMSA 3PQKA 3K4KA 2HTSA 1S29A 2ZJRF 1T33A 5F6FA 5DUIA 4XRFA 2XAFA 4AD9A 5ICEA 5CYVA 2ZSHB 4B3XA 1TWCJ 2CQNA 1MNMC 1NK3P 3EQLF 3VYUB 2FU4A 1K7AA 2LR8A 3S3NA 2BY0A 4KMFA 3WTWC 1LEBA 4JP0A 1IDZA 1FOWA 2E2JJ 4EJVA 1AA7A 1BI3A 3N05A 4QTRA 1F4KA 1BI2A 3MKYB 3HOZJ 3I53A 2RDPA 3U1DA 4IHXA 2JUGA 2Y30A 1X1BA 1D1CA 5DD4A 3OYAA 5JFRA 3A01A 2DU9A 2K9MA 2VKEA 3GUDA 1A36A 1D0ZA 4WXCA 5BOXA 1FTZA 2DODA 2Y75A 4N9IA 4F55A 2H6BA 1KU7A 2HI3A 4R79A 3G6EI 3K1PA 3HTUA 3PSFA 3H5NA 1G2HA 5J3LA 1F5TA 2E19A 4QPQA 3J7AO 5TJJA 4B3AA 5IT9K 2OBPA 3ZPLA 3ZN0A 1XX5A 2E7XA 1V3FA 2V9PA 3BPVA 3BR6A 4MTEA 4G7OF 1OQYA 1UHMA 2VPLA 2JRTA 4A0ZA 2V6EA 4DZJA 1S3JA 2GOMA 1POGA 2VC1A 4EM2A 2IT0A 4XNFA 2EZKA 1O3RA 3CJQB 5DM7F 2E35A 2ECCA 2JRMA 3LSGA 4GO1A 5LGNA 1R23A 2L54A 1BIBA 3NAUA 5H6RA 1V4RA 2RAEA 4GGGA 2DQRA 1XB4A 1RIOH 1I3QJ 2CW7A 1IRGA 1S7AA 4BHPA 3VFZA 1LE8B 2CFXA 3GF2A 3RKWA 4IQ4A 2Q1ZB 2DBBA 4BL0B 3E6DA 2XKPA 4OMZA 5HVQC 2Z3YA 4DW6A 5F0HA 3H5AA 1R1VA 4D5CA 2P5LC 3EUHC 5JI6A 3E97A 4CCNA 3MKWB 1MBJA 2KIQA 5LBQA 4XIDA 2ZKZA 3JSOA 1Z67A 4ESBA 4PJJA 2W4SA 2DA5A 3ONQA 3I56I 1W36C 2JWTA 3JRDA 2IGOA 3M8EA 5EG0B 5FFZA 2KIFA 4C3IJ 4AIJA 2G0EA 5ICCA 2QQ8A 2Y48A 2AQFA 2LSOA 1OCZH 2A6TA 2NAZA 1IN6A 4Y4RA 3BJOA 5TISC 5JLXA 1VF9A 1EKEA 3BG5A 4FE4A 3HRUA 2P6TA 2VKVA 1RKWA 4DBRA 2XPVA 4M3EA 5L3CA 2O03A 2PJPA 2ZNZA 4I2OA 3V7CA 5JHFA 3E5XA 2A5WA 2A3SA 2CUJA 4I76A 4V2GA 3ECHA 3AG4H 1ENHA 2QZ8A 1R5HA 2E1MB 1X4PA 1HKTA 1MJ9A 2K9LA 1J2XA 1VQMI 4UUVA 1KYWA 3DPTA 3DPUA 4HEA2 2QLZA 3VDXA 3CO6C 4ITVA 2KP6A 1WCMJ 3ISPA 3N4MA 3RPQA 2KDZA 1LKXA 3J7ZI 2DMNA 2Z99A 3P9CA 3TW7A 4CO8A 4IPAA 2L3DA 5EZHA 5H2FC 3QU6A 1GXPA 4LG3A 1QPMA 1D1AA 1W36D 4MIMA 5DCMA 3AG2H 2KRHA 4A6EA 5ILUA 1E3PA 4AIHA 1GV5A 2WB1N 2PMUA 4CYDA 1ULYA 3BJ6A 1DDNA 1HW1A 1VNDA 3AG3H 1BR2A 1VI0A 1UFMA 3OYFA 2M9HA 1LUJB 3WU0A 4ZYDA 3ASNH 1SC7A 4CZZA 1NG6A 1X3WB 5CVRA 2CQKA 3CCMI 1FYKA 4IHTA 1RNLA 1IUYA 3IH2A 1FIPA 1Z1DA 4GYIA 5E3OA 3CUQA 1EV7A 3VODA 3RSNA 3PNTA 2Y9ZA 1RUNA 3S16J 2A69F 2ZBKA 1ZG3A 2Z33A 3OL4A 1QNTA 4PJ0C 3G71I 4BH9A 2DO7A 1A04A 4UUSB 2NXNB 4LD5A 1KZHA 4AIKA 4RB3C 3I3LA 1BC7C 2ICWG 2DN0A 3B02A 4M3GA 1JKOC 1GVJA 2GAUA 2DI3A 1YX5A 3CCQI 1BC8C 2JA7J 2FBIA 2IAIA 5J4YA 3V42A 2RKHA 5ICGA 3O3KA 3L00A 2DA3A 2ZO4A 4C2MJ 2OTLI 5B66C 1D1BA 3A03A 1K6YA 3FXLA 4IO9F 1NHAA 3OIOA 1ORKA 2H8RA 4B1RA 4BAYA 3OMYA 3S2HJ 2ID3A 3U9GA 3LL7A 4A5MA 3QP6A 5LGTA 5J1UA 3N97A 1ZG5A 3JTGA 1FTTA 2FBKA 1MNEA 1XMKA 2ELKA 3EETA 3HHGA 1X2MA 5GPCA 2KRCA 2IGMA 3TP0A 4NC7A 4A0YA 3F22A 5A2QK 2CSOA 1SEUA 4CZCA 5D8KB 1HDDC 3ZR8X 2X6OA 1G8XA 4A0XA 5HS9A 1VQLI 4N4OB 1H9GA 5DEQA 3PM1A 5K5QA 3MWMA 4OU0A 3MVPA 2W7NA 4CDGA 2MLKA 5C4XJ 2Y0SN 1I39A 3OYMA 4LLLA 4ENMA 2W1OA 2EIJH 1D0XA 2W84A 3DTKA 4I7HA 2JVGA 3K4NA 3RTRA 2VBYA 2EV5A 4EJOA 3CMAI 2FJ1A 3UKGA 1CQTA 2V26A 3QYBA 1R6RA 2LH9A 3FXRA 1W7PD 3F9KA 4IHWA 3S15J 4XORA 3RDIA 1MBHA 4G7ZF 2VPRA 3FXMA 1SAUA 1QZEA 3PL8A 2G7HA 2R4GA 3OSFA 2HKOA 2M45A 3IC7A 1ON1A 2DCEA 4BJ5C 3LSIA 1XGNA 2IEKA 3CMMA 3F23A 4EJTA 4CXFA 4E7HA 2DDAA 1MDMA 1ZRFA 3JW4A 1FBSA 3HJEA 3RPUA 4UB6C 3L2CA 4MFEA 1XPXA 1TQPA 4UB8C 2DYRH 2VE8A 2P8TA 1LDDA 2EFOA 3KEOA 1U8RA 3WTVC 2L5QA 3TBIA 2CUFA 1HA8A 5LGUA 1FX7A 1FYMA 3ZQQA 1TP4A 4LJZF 4KMUX 1O4XA 2CYYA 3W6VA 1BIAA 2XROA 4FETA 3UNGC 1YRNB 4IEJA 2DA4A 4DGWB 3H5RA 1A5JA 1OCRH 1Y8QB 3L09A 4B4CA 4G6QA 2KIUA 2EIMH 2ZJ2A 1HXDA 2CRGA 1A6QA 3KP2A 1OYWA 2MW8A 1ETYA 3I4MJ 3ZP5A 5GTHC 1XTAA 4RM2A 1N75A 3KX2A 2W82A 1PUFA 4MQ9F 4E7IA 3S1RJ 2B9SA 1ZLJA 3RCOA 4NHJA 2JA6J 2OAZA 1EH7A 1YW9A 3ULQB 4LB5A 2RNGA 3VOEA 1O3SA 1B1BA 4KISA 2IBDA 4CCKA 1I6HJ 3BTCA 2GA1A 1IDYA 4U0VA 1Z7LA 1GV2A 1I50J 1VQOI 3FXQA 3PIOF 1F43A 1D8KA 2J5OA 2LBFB 2UZKA 4LGWA 5L3FA 3HM5A 3QPLA 1CGPA 1FT9A 1WJFA 3K4CA 1UCRA 1KU2A 2HYFA 2CU7A 2VJIA 5H20A 3LSHA 3CJNA 4PSXA 4BGDA 3BC8A 1ONVA 3VSLA 1MSEC 2E71A 2LG4A 3COAC 3OYGA 2Y31A 2RVCA 5EEHA 2NVQJ 2JUCA 4KJZA 3A2KA 1MJBA 5E3LA 3MFKA 4NB5A 4BS9A 3L2RA 3M1CA 5CVVA 5IOYA 5DUKA 2PLYA 4JYKA 3OYCA 3M1EA 2LYCA 3BR2A 1X19A 3NQOA 5K7FA 1RC9A 4D1QA 4XL9A 3JRGA 2R7RA 2O6GE 3I59B 3ZCOA 2FBHA 2CMPA 3CF5F 3GTMJ 2OA4A 3TKYA 2LK2A 4I09A 2QKMB 2F5FA 3PFYA 3K4LA 1B9MA 3JRFA 3TO6A 3TO9A 2QM3A 4Q4ZF 5FKLA 4QIWN 2JA5J 1ETVA 1VQ9I 2R5ZB 2LLKA 5H6QA 2E5NA 5EEGA 3DP7A 4OIQF 2OD5A 1DU0A 4UHTA 3T1BA 5HDKA 2IPQX 1B72B 3Q9VA 1Q1HA 3DKXA 3IHUA 1R58A 1BR4A 3G4SI 4F93B 3CP8A 1K78B 3MCZA 3L1PA 2B7EA 3S2WA 1KU9A 2OC6A 2JA8J 1ZR2A 1IAWA 1Y39A 3K70D 3E6CC 3S17J 3BG9A 2E34A 3D5LA 3ASOH 2L0KA 3MQ0A 4OIPF 2HU9A 2XRLA 5IT9Z 4BU2A 2CV0A 1P9QC 3OL3A 2C6YA 3JRAA 1X1AA 2NOGA 5AIPA 3DCFA 3FHNA 1YS7A 1O57A 2TRTA 1FOYA 1IZ1A 4RGUA 3BDDA 1Q1VA 3BTIA 3S14J 2JVHA 1G3YA 5JVTA 5HLIA 4BEHA 2Z1DA 3BCBA 2H94A 3BZ6A 2CQQA 1BM9A 4J00A 2VXZA 2MYSA 2XAUA 2P81A 3ZQCA 1MBKA 4A12A 4YFKF 2MC3A 3M8FA 2VQCA 1WWXA 4A5NA 3OYNA 3Q0UA 5EGOB 1KQ8A 1YI2I 4MEYF 3SJMA 1WZ2A 2NS8A 2OJED 5LEJA 2WWYA 2A6EF 2XRNA 4KICA 2X1DA 2XAQA 1WI9A 5IYDJ 4B8XA 2W85A 3PNVA 1ZR4A 3HOWJ 1IGNA 1R36A 1WH7A 4OIOF 3BR1A 5K5RA 1S5LC 5HLGA 2OQGA 1U9OA 4QLCU 2HEOA 2A61A 3ZQFA 2ZJPF 6PAXA 3ZMVA 1PP7U 2K9QA 3LQQA 2WY8Q 3G73A 4DBQA 3LMMA 3KP5A 3GEZA 1JTXA 1DPRA 1OCOH 2DK8A 3GFJA 1YJWI 4MO7A 4Y17A 4XKBA 3EYYA 4Y52J 2R7VA 2Z16A 4LMYA 5EDNA 1XD7A 4KYWA 1R5ID 2F2EA 4AIDA 5CQEA 1IXCA 5TGTA 2KMUA 2FNPA 4XM3A 4BKXA 1YW7A 2CQ7A 2WC2A 3K69A 4U7BA 1H9TA 2GLOA 4FQGA 4A3FJ 1YTYA 2BXZA 5JR3A 2QEXI 3C2BA 2D1HA 4XMYA 3A0HC 4M3DA 4WWCA 1DGWY 1W7PB 2RQQA 4MHGA 2R7QA 3BT9A 1O3TA 1MH4A 4NUBA 4S05A 4AYBA 4HX7A 1M1EB 4A3EJ 1SFOJ 1YHQI 3BR3A 2PJRA 3CUQC 3NARA 1JJ8C 2WBMA 3MKLA 4NBQA 4W1UA 4RGRA 3TO7A 1RR7A 1WHUA 5JLWA 1ON2A 3M9AA 2QCOA 3BJAA 3Q9SA 1JKQC 4M73A 5FROA 3CCUI 1FOKA 1B8IB 1HBXG 3G1MA 2WAEA 1ETKA 1TTYA 1YE9A 2HKXA 3CUOA 1GUUA 2FE3A 1ZRDA 4UVAA 1KQ0A 3K4MA 3R0AA 3NEUA 4B47A 2RQPA 2KLOA 2IXSA 4HLXA 2RNJA 2VT2A 1RR8C 4DJAA 1T56A 1K4TA 1QZZA 1I27A 1LJ9A 2P6SA 1HW5A 3F8BA 4Y13A 3LSPA 2AXTC 2V7FA 2DTZA 1J59A 2R7DA 4D0PA 1JUMA 1R1UA 2HNHA 3QPSA 1Z3XA 1WRJA 4XICA 3QYFA 2YU9J 4I02A 1SFEA 5JHUA 3WE3A 1V54H 1FC3A 4B44A 4I0AA 4ABZA 5HOOA 1G6NA 4A69C 1CF7B 5IYCJ 3M3YJ 3HOVJ 1VQNI 2K4JA 2NVUB 3H1CA 4KUMA 3I71A 3F8CA 2Y0MA 1YYVA 3R60A 5ILSA 4KIFA 3WGHA 2M4GA 3CCYA 4ESFA 3I58A 4XRSA 1R7JA 1PVEA 4RGXA 3AL0C 3CDIA 3MZHA 3FKJA 3GXOA 1FWZA 3DQVC 1B4AA 2LMDA 3J7YJ 4HRIA 2CV1A 2IA0A 2BW3B 4A3DJ 1WGXA 4QSHA 5A2QZ 3ZQ7A 3HRTA 1F1ZA 1S9HA 2BGCA 3I5UA 2V4JC 4GFBA 5F08A 3BTLA 1E3HA 2BZTA 2R7SA 2XAGA 4QPOA 1NTCA 4IOCF 1QHHD 4LG0B 3TOBA 2A6HF 3U2RA 3LQRA 4DNCA 3QU3A 3HC7A 5B5EC 1UMQA 2CS3A 1IXRC 2MD5A 3GO5A 4DYRA 4BDYA 1G4DA 3CC4I 5FLMJ 2Z5UA 3BOQA 2Q2EB 2D5VA 4LLNA 4L18B 2OF7A 2LY2A 3OOUA 1IV8A 1K83J 1QVTA 1DP3A 2KKOA 4WCGA 5DD8A 1QRYA 3CJTB 4IHVA 2ADUA 1DQUA 3P5JA 1DPUA 5FD5A 3FHZA 4KT6A 3SEZA 1LE8A 3LA3A 4RB1A 1AKHB 3HUGB 2QQAA 2M7BA 1ZYRF 1RKTA 2DA6A 2MC4A 3CQZJ 2GA2A 2AS5F 1IRXA 2YS9A 4DYQA 1I6XA 4GRIA 2DFIA 1J5YA 3BR5A 4M71A 1U5TB 1BJZA 3A0BC 4P9UA 3LA7A 5F0CA 5FO5A 4HLYA 5E3NA 4MGRA 3L2VA 3AAFA 2K86A 4Q47A 3ABLH 2HOAA 3WE2A 2X9DA 4UNOA 3FDYA 1SFUA 4A3CJ 2DXIA 2HOTA 2L9VA 1LDKB 2HGCA 1I1GA 3CCJI 3TGNA 3A01B 2WA0A 2IA1A 3IRRA 2QVOA 3O2PE 2DDBA 1TLHB 1WJ5A 2Q8KA 1IO2A 3A4CA 2PBIA 2L02A 3WGGA 3HRMA 1Z6RA 5F64A 1SD7A 4YFNF 1TZLA 3H0GJ 2FMLA 1G59A 1HC8A 4OIRF 3QODA 4UUTA 1PUEE 2CG4A 3ELKA 4OAZA 1OCPA 4L0ZB 4HYEA 2FF4A 1SVOA 3HZJA 2EPFA 4WXDA 4XOTA 2EFQA 4HA8A 3WTYC 5L3GA 1SFXA 3LAPA 4HNUA 3SZTA 1K61A 1YS6A 1ZHFA 2Z2SB 1VQ4I 2DJIA 4OOIA 5KVRA 2V1UA 2LKSA 1LDJA 5IYBJ 2YX4A 1R71A 4IOAF 1YW8A 2STTA 3SQNA 2AO9A 1F9NA 3ZN1A 1FLIA 3ROUA 3K4BA 4M6YA 3V7SA 3WGIA 3M07A 1PJRA 3K4JA 4XKVA 4W97A 3PQJA 1T0FA 3HEFA 2VBWA 3WHBA 1N25A 3BG6A 2HYJA 2ME6A 4YIFA 5D5UB 1FEXA 4BJ6C 4EM0B 2JZYA 4ON0A 2NNNA 3SDBA 4F92B 1NH3A 3W6KB 3GTJJ 3L7WA 2DOEA 4HF0A 1YJ9I 5AIQA 4CCLA 1WVRA 3VYRB 1WJDA 4OAYA 5E1XA 3HOSA 1ZGWA 2COBA 5BPIA 1X1PA 2W57A 3HHHA 4X6AJ 3CZ6A 3E6MA 4UY8I 4X1EA 1HSJA 3LSKA 2ZXJA 2QBYA 1H8AC 2K9NA 1BA5A 3LOCA 2YUSA 4BHCA 2P7VB 5E79C 2DMPA 2NNYA 4CUGA 3R6SA 2XGCA 1KQ9A 5KAIC 1Z91A 2UXXA 2KJBA 4F3QA 1WSUA 1YIJI 3VWBA 1MMNA 3G1OA 3GFIA 2LF8A 4NDLA 4CICA 2FSWA 2MSYA 4EGZA 4D7MA 3HKZA 4TV7A 1ACIA 2BE5F 2ZB9A 3GVAA 3FM5A 1MH3A 5GPAA 3MAJA 3H35A 5FGMA 2WAQA 2XF6A 5DCFA 4ENKA 5TRDA 1JT0A 2GXBA 1OISA 1EF4A 2MGQA 4F52A 4HV5A 2VODA 3FMRA 4EMSA 2VL8A 1WI3A 1U9NA 4ZYHA 2O5RA 3A02A 2YU3A 4XRSG 4YG2F 2K3FA 2VIXA 3REOA 4EV0A 3OOPA 3QPTA 3CP2A 4IF4A 3DTIA 4RA2A 4A6DA 3F6OA 3ZRGA 3KYCB 4H0EA 3SHFA 2MH2A 3HTSB 5J47A 1TWAJ 2CO5A 3RI4A 4BBRJ 2XAHA 1IN8A 2QWWA 3V7RA 3LFUA 1OCCH 4IHSA 1V5GA 4XONA 5D6EA 5EYRA 1TNSA 4D9JA 2DTRA 4XLHA 4AM3A 2X6XA 5C44J 2VBZA 3ML6A 2E1CA 1JGSA 1OCTC 1FIAA 2ZC2A 1JXSA 1UB9A 5IP6A 2FXAA 5D5WB 3KP3A 4G94A 1G3WA 1FMWA 1USSA 3V8KA 1WJCA 3QWLA 3JR9A 1Z9CA 2X51A 2BVMA 3SZPA 1R1TA 1VQ7I 3DEWA 2XSDC 1MZBA 2W48A 5F0FA 2WV1A 5E3MA 3HXLA 1ZAOA 5B1BH 3DLLF 1BL0A 2MABA 3KLOA 3H9QA 3PIPF 3OYJA 1JT6A 3U1KA 2HXOA 3S32A 3WG7H 4N4NB 1T8IA 4U87A 2O3FA 3OYLA 2EA4A 3SDGA 1KGSA 2X6WA 1PP8F 3T8TA 1YRNA 2PMHA 1TBXA 2BY2A 3Q0WA 5K1YA 3KP7A 4XRMA 3RKQA 4RDUA 1E17A 4BDZA 1W5CC 3HSRA 2LKPA 4M6XA 4MTDA 4IX7A 2PI0A 2P0WA 1XCBA 3G1LA 4E70A 4RLQA 4BXXJ 1SD4A 5LHHA 2PFBA 5J4VA
chains in the Genus database with same CATH topology
1YIJI 2JQ7A 2OTLI 4IO9F 1VQ5I 1FOXA 3I56I 1FOYA 3CCLI 1ACIA 2H8WA 3CCJI 1VQ8I 2ZJRF 1VQOI 3PIOF 3CCSI 1YI2I 2FOWA 1VQLI 1S72I 1HC8A 5GAEJ 1VQNI 2K3FA 1FOWA 3CD6I 1VQMI 2ZJPF 3CMAI 2QA4I 3I55I 4V19K 2E36A 1VQ4I 3J7ZI 1YJWI 2OTJI 3J7YJ 1VQPI 4IOAF 3G6EI 1VQKI 3CF5F 5GAGJ 1VQ7I 3DLLF 4IOCF 2QEXI 1VQ9I 3PIPF 3CCVI 5JVGF 3CCEI 5GAHJ 3CC4I 3CCMI 1YJNI 3CC7I 1YJ9I 5DM7F 1YHQI 2E35A 2ZJQF 1VQ6I 5DM6F 3CJTB 3G4SI 3G71I 2NXNB 4UY8I 1Y39A 3CCUI 3CCRI 3CC2I 5GADJ 3CCQI 2E34A 1YITI 1MMSA 1QA6A 3CMEI
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1YIJ I;  2JQ7 A;  2OTL I;  4IO9 F;  1VQ5 I;  1FOX A;  3I56 I;  1FOY A;  3CCL I;  1ACI A;  2H8W A;  3CCJ I;  1VQ8 I;  2ZJR F;  1VQO I;  3PIO F;  3CCS I;  1YI2 I;  2FOW A;  1VQL I;  1S72 I;  1HC8 A;  5GAE J;  1VQN I;  2K3F A;  1FOW A;  3CD6 I;  1VQM I;  2ZJP F;  3CMA I;  2QA4 I;  3I55 I;  4V19 K;  2E36 A;  1VQ4 I;  3J7Z I;  1YJW I;  2OTJ I;  3J7Y J;  1VQP I;  4IOA F;  3G6E I;  1VQK I;  3CF5 F;  5GAG J;  1VQ7 I;  3DLL F;  4IOC F;  2QEX I;  1VQ9 I;  3PIP F;  3CCV I;  5JVG F;  3CCE I;  5GAH J;  3CC4 I;  3CCM I;  1YJN I;  3CC7 I;  1YJ9 I;  5DM7 F;  1YHQ I;  2E35 A;  2ZJQ F;  1VQ6 I;  5DM6 F;  3CJT B;  3G4S I;  3G71 I;  2NXN B;  4UY8 I;  1Y39 A;  3CCU I;  3CCR I;  3CC2 I;  5GAD J;  3CCQ I;  2E34 A;  1YIT I;  1MMS A;  1QA6 A;  3CME I; 
#chains in the Genus database with same CATH topology
 3D0S A;  4HV6 A;  3BY6 A;  3GX4 X;  3EDP A;  3LAJ A;  1XSX A;  4PUS A;  1U3E M;  3S1Q J;  1RI7 A;  5ERI A;  1D5Y A;  3AL0 B;  2VON A;  2XKO A;  4S0H B;  2ZME A;  3K9T A;  2LBF A;  1BOB A;  2CUZ A;  2E7W A;  5CLS A;  5LHI A;  3OWT A;  4XKC A;  5D6F A;  1XGM A;  2VQL A;  1ZKG A;  3L2Q A;  4M72 A;  2QEN A;  3DXJ F;  1W5S A;  3JCU C;  4GCV A;  3BZK A;  2FQ4 A;  4HPQ A;  3DFG A;  3QRF F;  2KQR A;  2Q0O A;  1E0E A;  2YX7 A;  4EQQ A;  4U0W A;  4U88 A;  3HOT A;  4HF2 A;  4E7K A;  4YIR X;  3GTQ J;  5FKO A;  1J9I A;  2IS4 A;  2UWM A;  2R7T A;  1XSD A;  2IGK A;  4XN3 A;  4Y15 A;  4PGH A;  1U6G A;  2EWN A;  3O8G A;  1K6O A;  1R5G A;  1S6L A;  1T08 B;  1ZH5 A;  4G6D A;  4L9J A;  1JHF A;  2WAD A;  4I99 C;  4P96 A;  3RQ4 A;  1A6I A;  4PCQ A;  4B48 A;  4EVI A;  2QA4 I;  3OV8 A;  4ASN A;  3I55 I;  2TDX A;  2LKX A;  4G8X A;  4P1W A;  1OMI A;  2L9S A;  1RRJ A;  4IRI A;  3KFW X;  2KDO A;  4L0Y B;  3C3W A;  3KZZ A;  1D0Y A;  1U2W A;  3TQN A;  4KIT B;  2D45 A;  1TW2 A;  5D8L B;  1VQP I;  4L5I A;  3BRO A;  2LFB A;  2O8X A;  2HQA A;  3OYI A;  3GLL A;  5J40 A;  1QVU A;  4DOZ A;  1MD0 A;  2E1O A;  3B73 A;  1OYI A;  4BE2 A;  5KCM A;  2VOO A;  1N77 A;  2R5Z A;  3EUH A;  4II2 A;  3WHC A;  2XVC A;  3OS2 A;  3JSP A;  4OMY A;  1JUS A;  2O9L A;  1K4S A;  2GIV A;  3Q3S A;  1UJ8 A;  2BY3 A;  5C3E J;  1W4M A;  2RN7 A;  1B72 A;  3CC7 I;  2M3A A;  3K0L A;  3JAM K;  4HW0 A;  5HLH A;  1AU7 A;  2K40 A;  1LB2 A;  4HAM A;  3C18 A;  3CDL A;  1I5Z A;  3I9V 2;  2WTE A;  4IKF A;  4M3F A;  1GXQ A;  4RAF A;  1BOA A;  4RB0 A;  2PMZ A;  2EK5 A;  2KIS A;  3FXJ A;  5BNG A;  4A3G J;  1W1W E;  1WH5 A;  3P9I A;  2ISY A;  1D3Y A;  1ZK8 A;  3TW6 A;  1XMA A;  1JKR C;  2MG4 A;  5BPD A;  1P4X A;  1EH6 A;  3E7L A;  2CV2 A;  1OYY A;  3ECO A;  1ZGJ A;  2DMU A;  2GIZ A;  3ESW B;  2L7F P;  4XR6 A;  4HNV A;  5CVU A;  3FF5 A;  3FZV A;  2HWV A;  4GDF A;  1HDP A;  2DA2 A;  2K85 A;  5E18 F;  4BNC A;  3I54 A;  4JX6 A;  3GW2 A;  3HL2 A;  2NS0 A;  2NYX A;  1IRZ A;  5D5X B;  5IY5 H;  1LPQ A;  1C0W A;  4U0Y A;  2DJN A;  5EGO A;  2FEZ A;  2WY7 Q;  2P4W A;  4YEJ A;  4YFX F;  5E8G A;  1NK2 P;  1IUF A;  2FOW A;  2R5Y B;  3S1N J;  4XKW A;  2UUZ A;  2M8G X;  1P7J A;  2CFO A;  3X2Q H;  2DMT A;  2YSR A;  5LHG A;  3HOX J;  2XGD A;  3KP6 A;  1X1D A;  3CLO A;  1P92 A;  3HBL A;  3GYH X;  3FMQ A;  2VLA A;  2BOL A;  3EPZ A;  2OPT A;  1XDS A;  1GDT A;  5EEA A;  4L9N A;  2HOE A;  4HQE A;  1SD6 A;  1YO5 C;  3HRS A;  2XUB A;  2F48 A;  2A5Y B;  2ESN A;  1FYL A;  3B6A A;  1W0T A;  4KA4 A;  1E2X A;  4CYC B;  3ZOB A;  2OQR A;  3FBN B;  4PSW A;  3BZC A;  5KAF C;  4UVC A;  3IH4 A;  4ENN A;  4LK1 F;  2HYG D;  3DBH B;  5J8C A;  3NWS A;  4BY1 J;  2RV8 A;  3BLY A;  1BW6 A;  3A1Y A;  1ETW A;  1K79 A;  2O61 A;  1T6S A;  2VQH A;  3U21 A;  4BQQ A;  5FRN A;  3TDU C;  3GTG J;  3BTJ A;  1T0F C;  1IV6 A;  5HNH A;  1UAA A;  1W7P A;  1HCR A;  3I4N J;  1O3Q A;  3SXY A;  4BYY A;  4DQ2 A;  1OLT A;  3M4O J;  1YJN I;  1JGG A;  4V2F A;  4P55 A;  3JRB A;  1TWG J;  5FJ8 J;  4L9T A;  5FFX A;  4FX4 A;  4XLC A;  2XPU A;  1MKM A;  2ZXW H;  4AUX A;  3S1M J;  4M9S A;  3HDD A;  1XC5 A;  2QKL B;  3TED A;  2VB6 A;  1FP1 D;  4ZZD A;  1XGO A;  4OWR B;  3K7A J;  4A3I J;  2VI6 A;  1B8I A;  1QQI A;  3ZMS A;  1Z7U A;  3OYD A;  3S3O A;  3CC2 I;  4E7Z A;  4JQF A;  4NQW B;  2V79 A;  3RKY A;  3PUF A;  1IN4 A;  3OR1 C;  2DLL A;  2LVS A;  1A31 A;  5CPR B;  3CME I;  4AVZ A;  4E6K G;  1S8N A;  4K2E A;  4YII A;  3ABM H;  2JQ7 A;  1ETQ A;  1U0J A;  1APL C;  4I0B A;  3LWF A;  2X0L A;  2VJ5 A;  4YEL A;  5F1J A;  2FQ3 A;  2KL4 A;  2KZV A;  1OPC A;  2HTJ A;  1SMT A;  1A35 A;  2GBY A;  1X2N A;  4RAG A;  4I01 A;  3V8J A;  2K7L A;  2BHZ A;  2E60 A;  4C3J J;  3DLA A;  2GZW A;  1VQ8 I;  1T95 A;  1B6A A;  1VZ0 A;  3RIR A;  4FAS D;  3DU5 A;  1ZLK A;  3G3Z A;  4L5J A;  2DFH A;  1QGP A;  1R9T J;  3HYI A;  1CF7 A;  2OCC H;  4PFP A;  3IKT A;  2N8G A;  3T8R A;  4A3M J;  1S72 I;  5F1R A;  5HNF A;  4M6V A;  2QYO A;  2HXI A;  2JN6 A;  3R61 A;  1LEA A;  2ZNY A;  1FMV A;  2DFF A;  3T0Y A;  2Y9Y A;  1MSF C;  5M5Y J;  3FX3 A;  1YIO A;  2EQR A;  4CA0 A;  1WJE A;  2OV7 A;  3CD6 I;  3BQY A;  1IXS B;  3HG9 A;  3PNY A;  2CW0 F;  4ZH4 F;  5J6X A;  3GZ6 A;  3OIQ A;  2DOA A;  4E4H A;  1KYZ A;  4ANJ A;  4V19 K;  1V5F A;  2RRE A;  2R93 J;  5ED4 A;  1R4N B;  2L4M A;  2LY9 A;  2VUM J;  4JBA A;  1T38 A;  4S04 A;  2MH9 A;  2YPR A;  3DBR B;  4FT8 A;  5EF6 A;  3BQZ A;  5LRS A;  4DIQ A;  4XLN F;  1GT0 C;  1OFC X;  2Y2Z A;  3SFZ A;  3RZO J;  3CMY A;  2UV1 A;  2R7O A;  4LG0 A;  5ICF A;  2DOF A;  3J81 K;  3IAS 2;  1MMG A;  3K1M A;  4MQV A;  1TQI A;  3FBI B;  3J80 K;  1QPI A;  4RMN A;  2GXA A;  2NRA C;  3VSK A;  4O3M A;  1Z6T A;  4PZJ A;  5HDN A;  4C3H J;  2Q2E A;  4HF1 A;  1WPK A;  2BY1 A;  4O6J A;  1MMA A;  3F0C A;  2IS1 A;  3GLX A;  3TDZ C;  4PFO A;  3KZI C;  3AFH A;  3PFI A;  4AYB N;  1G3T A;  3H9G A;  1TNT A;  3E1S A;  5F27 A;  4XSX F;  4RB2 C;  3Q5F A;  2VXD A;  1VQ6 I;  4PJL A;  1AKH A;  1B59 A;  2HQ5 A;  2HFH A;  4LOC A;  3WU2 C;  5IOZ A;  3HPG A;  3SFI A;  2L7M P;  2M1B A;  3L2U A;  1J7K A;  3TOA A;  3GTK J;  4CHU A;  4HQM A;  2LNB A;  2K02 A;  2KZG A;  1Y1V J;  1U5T A;  3BWG A;  1QO0 D;  2W00 A;  3VYT B;  3IV5 A;  1LFU P;  1XN7 A;  1IC8 A;  3MN2 A;  4Z6Y A;  5FD6 A;  1TC3 C;  3VB2 A;  2ID6 A;  1RUO A;  1OKR A;  2BYV E;  4JX4 A;  4L5E A;  5IP7 J;  2WV0 A;  1SMY F;  1FOX A;  2G7U A;  2ZFU A;  2DMQ A;  2GXG A;  1FNN A;  5E1W A;  5LFA A;  1XGS A;  1U78 A;  2BV6 A;  9ANT A;  1JHH A;  3ZXS A;  3KCC A;  1P4W A;  1SVM A;  3LFK A;  1TL8 A;  2H8W A;  2CW8 A;  2M0M A;  2V9V A;  1WJA A;  2XDV A;  3IAM 2;  3QOE A;  3JRH A;  1MGT A;  4IRH A;  3BPX A;  4HX8 A;  5CJ9 A;  2E1N A;  3K2A A;  2ZME C;  2GOX B;  4AC0 A;  1B9N A;  4Y7N J;  2XGE A;  5IT3 A;  2BEO A;  3L2W A;  4MNU A;  3VYS B;  1DU6 A;  2P5K A;  2LDU A;  2FNA A;  1LNW A;  4LFU A;  3KEY A;  5EG0 A;  3QQA A;  4A93 J;  1JI8 A;  2V1N A;  3OIP A;  4NNJ A;  1IJW C;  2F4O B;  2VAS A;  4A3L J;  2YR2 A;  3HSE A;  2JTV A;  2X85 A;  1PYV A;  2O0Y A;  2HR3 A;  5M3M J;  2NOJ B;  2KJC A;  4ZDP A;  4P9F A;  1HW2 A;  5L3B A;  3RPU D;  2LRE A;  3ZMU A;  3DU6 A;  3WOD F;  3GFL A;  2EV6 A;  2QGU A;  3FK7 A;  4LIU A;  4KFC A;  2EFP A;  3KET A;  4AU7 A;  3TP3 A;  4M9Z A;  4C2U A;  2RC4 A;  3TL4 X;  1LVA A;  1OJL A;  5E17 F;  3QPH A;  2XSJ C;  2WB1 A;  4Z2Y A;  1WJB A;  2K9S A;  2K4B A;  2HDC A;  1XMX A;  3W2W A;  2CQX A;  3OR2 C;  1YG2 A;  4XLA A;  2BXY A;  4RS8 A;  2IS2 A;  3V4G A;  3R4K A;  3HB9 A;  2X1C A;  3JRE A;  3JRI A;  2V9K A;  3MZ8 A;  1T2K A;  2Z9O A;  3S2D J;  4HZF A;  4I6Z A;  2ZCW A;  3H3U A;  3WTS C;  3OYH A;  2F5D A;  3K6G A;  1TW3 A;  2EFN A;  1SD5 A;  3Q0V A;  3CLQ A;  4XLE A;  2TCT A;  4WX9 A;  4G6T B;  2M5W A;  4Q5S F;  2JT1 A;  5E1Z B;  3HGY A;  1JJ6 C;  2MFZ A;  2MLG A;  2V6C A;  1FZP B;  3CF2 A;  4XOP A;  1YX3 A;  4F91 B;  4XBF A;  3E0J B;  3IWZ A;  3D5S C;  4YRV A;  3CCR I;  1Y0U A;  2QQB A;  2NVX J;  4M9X A;  2QSG X;  1GVD A;  2FOK A;  2L01 A;  1YFH A;  2ETH A;  1MIJ A;  4E7L A;  1MMS A;  1D8J A;  1ZAR A;  2JPC A;  1Z21 A;  3GWZ A;  1WFX A;  5HOD A;  2VJJ A;  3DKW A;  1BI1 A;  1FPQ A;  5M5X J;  4RLF A;  1FJL A;  5KK1 A;  5CKT A;  2A07 F;  3C1D A;  4KIB A;  4UUS A;  2MD0 A;  3MD2 A;  2ZXH A;  2KT0 A;  3GTP J;  4HSR A;  1MND A;  3H3Z A;  3IWF A;  3JAM Z;  2JJ7 A;  1P4A A;  4KN4 X;  2QSF X;  2VKH A;  1TQM A;  3H36 A;  3D5R C;  3WTT C;  3F3X A;  1Z0X A;  1I1S A;  1X4O A;  3RZD J;  4D5F A;  2VN2 A;  2I8D A;  5M3F J;  3FKI J;  5B1A H;  3E6B A;  2XB0 X;  2CGP A;  4OIN F;  2V1D A;  3M8J A;  4NC8 A;  4FHT A;  3CCS I;  4L9V A;  1HF0 A;  5EZG A;  2FA5 A;  2EFW A;  2O7O A;  2NVY J;  5F04 A;  4KIG A;  2HVS A;  3FIS A;  2M7A A;  1ITY A;  1BW5 A;  1OR7 A;  3WTU C;  2Y0S A;  2L7K A;  4RBO A;  3GZ5 A;  4UV9 A;  3RQI A;  1ZGA A;  4BJT A;  1LQ1 A;  4CGZ A;  2B63 J;  3ZQG A;  2EZI A;  2OZ6 A;  5FLX K;  1Y8R B;  3LST A;  1ZRC A;  3ABU A;  4CCJ A;  1SVL A;  2XPW A;  3IP4 B;  4FTH A;  3LSJ A;  2EBI A;  5DV5 A;  5FLV A;  3K2Z A;  4UXN A;  4ZYE A;  4EJU A;  2VOP A;  2HDW A;  1ETO A;  5AON A;  3DWL E;  4B09 A;  4M74 A;  5GAG J;  5DCM B;  1R4M B;  2VJ4 A;  2KPM A;  2LTP A;  3EUK L;  4LIV A;  2B0L A;  5HS8 A;  1SAX A;  2HPM A;  3F8F A;  2LC2 A;  4DYC A;  1MBE A;  3DKY A;  4BE1 A;  4N0B A;  2QBY B;  2M0C A;  2FUG 2;  2MA3 A;  3MZY A;  3C2H A;  3B6C A;  1EA3 A;  1AOY A;  4PDK A;  2XC7 A;  1XS9 A;  2A68 F;  4O5V A;  4HST A;  1NG7 A;  3CUQ B;  4LLG F;  4HBL A;  4ZC3 A;  2J5P A;  4B43 A;  1QZY A;  1SAN A;  3HOU J;  4Y3O A;  4IXA A;  3LNQ A;  2QF7 A;  2DPD A;  1J0R A;  1YQA A;  2D2W A;  1ETX A;  3RYR A;  3WU1 B;  1O7F A;  3V8L A;  5J8F A;  4CCO A;  3KZY A;  2EIN H;  2PG4 A;  1QU3 A;  4P5O A;  5GAD J;  1HKQ A;  5J1R A;  2ME0 A;  2DPU A;  4IQJ A;  5L3D A;  4J19 A;  1MMD A;  3FXK A;  2AXL A;  3SZG A;  3EYI A;  2R7U A;  4JK1 X;  4BXU A;  4A3B J;  2F4I A;  4RGS A;  5GP9 A;  1VQ5 I;  1UG0 A;  2Y69 H;  2PEX A;  3HKZ N;  1AHD P;  4CSW A;  5E20 A;  2HDD A;  1LFP A;  2V1X A;  3C7J A;  1IN7 A;  2WAQ N;  4U7D A;  1JTY A;  2VT3 A;  1HLV A;  2FX0 A;  5KHD A;  3D1N I;  1MJA A;  4Q48 A;  1E3O C;  3CO7 C;  2PX9 A;  1Y56 A;  1BN5 A;  3HPH A;  2LY1 A;  2P7C B;  1GHC A;  4J01 A;  2IVM A;  1R49 A;  2JSP A;  5IP9 J;  2X6Y A;  2IP2 A;  5GAE J;  3L9F A;  2EIK H;  1X1C A;  3UR3 C;  4ZJZ A;  1H89 C;  1VTN C;  2KIM A;  2H09 A;  4C9Y A;  5FKN A;  3CES A;  4M3B A;  4CCM A;  4JX5 A;  2F5C A;  1W0U A;  1XG1 A;  3ZMT A;  2L9R A;  3KYL A;  2NVT J;  5K7H A;  4EM1 A;  1ZTR A;  4KNY A;  4A3K J;  2CJJ A;  3AG1 H;  3FK6 A;  4C30 A;  2E36 A;  4LB6 B;  2XF7 A;  1TWH J;  3IH3 A;  1DUX C;  4N9H A;  3KE2 A;  5B3S H;  3ABT A;  1N78 A;  2ESH A;  2VQG A;  1FP2 A;  1Y0N A;  1H0M A;  3HOY J;  3LSM A;  4PGG A;  2MBF A;  5EJC A;  3QAH A;  4FE7 A;  4BQN A;  4G9Y A;  1RES A;  4FX0 A;  1JE8 A;  2HZD A;  2HQR A;  1AWC A;  1FBQ A;  1HQC A;  2ELJ A;  2ZXI A;  3T5X A;  2QSH X;  3RYP A;  4WXH A;  5LRR A;  4DZP A;  1ZQ3 P;  3CJR B;  1MBG A;  5E8I A;  3MMY B;  5L3E A;  3CCV I;  1MDM B;  3GTL J;  5JVG F;  3SEQ A;  5GAH J;  4EEF G;  3BR0 A;  2ISZ A;  3OY9 A;  5LEK A;  1D5V A;  5K7Z A;  3I64 A;  2ELH A;  3GZN B;  3I59 A;  1HST A;  1QHG A;  3ERE D;  2ZJQ F;  3J7A Y;  4BXF A;  3LA2 A;  1H88 C;  2JSC A;  4G7H F;  2ECB A;  2HVQ A;  1IRF A;  2I10 A;  3M7G A;  2LD5 A;  1TWF J;  4HG2 A;  3IRQ A;  2ZME B;  3IL2 A;  1U8B A;  4XLF A;  1YIT I;  2H1L A;  1R00 A;  3CTA A;  1QA6 A;  4BHB A;  2EB7 A;  3WTZ A;  3ABK H;  3BG3 A;  2DK5 A;  3J81 Z;  3S3M A;  4MEX F;  4WK8 F;  4IHY A;  3W2A A;  1U5T C;  2QQ9 A;  3PO3 J;  3PO2 J;  2HZT A;  3J80 Z;  1BJA A;  3PJR A;  2DQL A;  1PUF B;  5FRM A;  1K78 A;  2LRD A;  3R0J A;  4ZTJ A;  3DTE A;  4I98 B;  1XSV A;  2OCE A;  3IUO A;  4UVB A;  1DGR M;  3KP4 A;  2K27 A;  2CUE A;  2DA1 A;  2D1V A;  3FWE A;  1R22 A;  1EJ9 A;  2X48 A;  2AHQ A;  2DT7 B;  4PJN A;  3K70 C;  2R0Q C;  3NRV A;  4FCY A;  1ERD A;  3HSF A;  2R7W A;  3HGG A;  2GQQ A;  4LIT A;  3GTO J;  2VE9 A;  2BVL A;  2R5Y A;  2EV0 A;  4HX4 A;  2I5U A;  3DBL B;  1REP C;  4XN0 A;  3LSR A;  3K1N A;  2M87 A;  1ZN2 A;  2EZH A;  4RAZ A;  2E2I J;  2M34 A;  3K10 A;  3JTH A;  3OS1 A;  2LOO A;  2LP0 A;  2IRF G;  1F36 A;  1FSE A;  5HDG A;  3OYB A;  1YLF A;  5CQG A;  3F8M A;  2VC0 A;  4XK4 A;  3GFM A;  3KIO A;  2KFD A;  4E7J A;  3EUA A;  2FD5 A;  2M2E A;  2ACJ A;  3WG9 A;  1DP7 P;  3OS0 A;  2M8E A;  4KDP A;  1P6R A;  4IRG A;  3I0T A;  3W3C A;  2BHY A;  2L4A A;  4BQO A;  2DFE A;  2H6C A;  4D7N A;  4A3J J;  4CYC A;  4PK4 A;  4KT5 C;  2OZU A;  2L2O A;  3GME A;  2OTJ I;  2STW A;  2WAF A;  5ILV A;  5DTD A;  2LF7 A;  5D4S A;  2QUF A;  2K5C A;  4GXO A;  1X58 A;  3AKZ A;  2FRH A;  4IJA A;  3I4P A;  1VQK I;  2W24 A;  3ZQL A;  3E3V A;  3PSI A;  1ZEL A;  4EAT A;  2R3S A;  3O8H A;  1LVK A;  4HDV A;  1Z3Y A;  4UV8 A;  1FY7 A;  3FM3 A;  1Y1W J;  5D5V B;  1TT0 A;  4RM3 A;  2E1M C;  5BQT A;  4GYG A;  3ZMZ A;  1T39 A;  3FXO A;  4JOM A;  3DF8 A;  3NWT A;  4ZZL A;  2GWR A;  3CCE I;  3PUB A;  1ZG1 A;  2XAJ A;  2EIL H;  2GM4 A;  4E7S A;  1IN5 A;  4X0G A;  3SYT A;  2NS7 A;  2W25 A;  2DYS H;  2XIG A;  5BS6 A;  2P5V A;  3H0D A;  1J09 A;  1X3Z B;  2G9W A;  4AWX B;  2M4K A;  3OYK A;  1VFC A;  2M30 A;  4EJW A;  1P2F A;  1ODD A;  2PMZ N;  1RPW A;  4NC6 A;  2JK3 A;  3VEP A;  1MW7 A;  1JKP C;  1XDU A;  2EH3 A;  4NQW A;  1WKM A;  3KYD B;  2HOS A;  2XHK A;  1FBU A;  5GTI C;  2KHM A;  5J1Y A;  2F4M B;  4C2T A;  1S7E A;  4Y33 A;  1YOV B;  2EZL A;  1SFK A;  1UHW A;  1KON A;  2JA2 A;  3GBG A;  2L9N A;  5FKM A;  4FIS A;  2E2H J;  4KN7 X;  3KLN A;  3F21 A;  4BUP A;  1TT5 B;  3DPL C;  4AVP A;  5LLQ A;  1BI0 A;  2KRF A;  3CCL I;  5KNL A;  1LFB A;  1IF1 A;  2R7F A;  1O7L A;  2EA2 A;  5CVI A;  1P7I A;  3QP5 A;  4IL6 C;  2DA7 A;  2ZFW A;  5M5W J;  2HVR A;  2XGX A;  4BEH B;  4LK0 F;  3C2G A;  3H3V K;  2H1K A;  2DAO A;  1UHS A;  2EJR A;  2IGN A;  2XAS A;  3S93 A;  5IPA A;  4BAC A;  3OYE A;  3TMO A;  2OU2 A;  2COM A;  5C4J J;  4CH7 A;  1KA8 A;  2H27 A;  4G12 A;  3E5Q A;  4MFD A;  1KU3 A;  2R7Z J;  2ZSI B;  1Z77 A;  3MKZ A;  3FIW A;  3ZQI A;  4ESJ A;  2DT5 A;  1HKS A;  2DW4 A;  1J75 A;  3ERM A;  4XSZ F;  3S8P A;  1T98 A;  3E5U A;  2BBY A;  3KPH A;  1OR7 C;  2CWE A;  4QWQ A;  1JUP A;  3GCM A;  2O8K A;  2PN6 A;  2F5V A;  1UST A;  1V55 H;  3F8N A;  4PJM A;  3FXU A;  3RJP A;  4R1H A;  5FB2 A;  4XLP F;  4MLO A;  1L3L A;  2RGV A;  2VBX A;  3BP8 A;  2HQN A;  4RAY A;  3O6B B;  1QBJ A;  3HIF A;  4HOB A;  1V5E A;  2CH0 A;  4H4K C;  5DDG A;  5LD2 C;  5DS9 A;  1IW7 F;  4XQF A;  4F7Z A;  2XF5 A;  4WF2 A;  2F5E A;  4HNT A;  3G2B A;  4ZDL A;  1I3A A;  3F6V A;  1BR1 A;  3VPR A;  2IS6 A;  2IA2 A;  3DEU A;  3P9K A;  4BY7 J;  5D4R A;  4HDU A;  1RET A;  5HLT A;  3QYE A;  3P7N A;  1STZ A;  3BG7 A;  3W6J B;  1EH8 A;  4BBS J;  2BW3 A;  2HS5 A;  3CDH A;  1UEL B;  1FSH A;  3IKV A;  1UG2 A;  5FLX Z;  2F6C A;  5CVJ A;  3BCA A;  2A05 A;  3KEQ A;  3OSG A;  3ZMD A;  2L7Z A;  2AQE A;  3W2V A;  2XV4 S;  5DM6 F;  5DYM A;  1ZRE A;  2PJR B;  1S7O A;  5K5O A;  4R8H A;  4ENJ A;  2JMW A;  1IG7 A;  4ETS A;  3DV8 A;  2R7X A;  4ZDO A;  2X4H A;  1MBF A;  2OUM A;  3F72 A;  1WQ2 A;  3ZGK A;  2VKD A;  4EGY A;  4BQA A;  1X3U A;  4II3 A;  3DEE A;  2IJL A;  1XCV A;  1UZC A;  2HPI A;  3H9J A;  4ZTF A;  2K3P A;  1Y6I A;  1GLN A;  2UXN A;  3RKX A;  4A2U A;  2IW5 A;  2PQ8 A;  3MEX A;  2XB5 A;  4ZYG A;  2DT6 A;  2JPB A;  3QOP A;  4ZYA A;  5FKK A;  1L0O C;  1W5T A;  3WTX C;  1G3S A;  2X1E A;  2FMY A;  4IVN A;  4BE0 A;  1Z05 A;  5HS7 A;  3HUG A;  1BBY A;  1RZ4 A;  3ZQH A;  5BMZ A;  3H92 A;  2E5Z A;  3JRC A;  4IZZ A;  1PDN C;  2R92 J;  1HOM A;  3FMS A;  3PQK A;  3K4K A;  2HTS A;  1S29 A;  2ZJR F;  1T33 A;  5F6F A;  5DUI A;  4XRF A;  2XAF A;  4AD9 A;  5ICE A;  5CYV A;  2ZSH B;  4B3X A;  1TWC J;  2CQN A;  1MNM C;  1NK3 P;  3EQL F;  3VYU B;  2FU4 A;  1K7A A;  2LR8 A;  3S3N A;  2BY0 A;  4KMF A;  3WTW C;  1LEB A;  4JP0 A;  1IDZ A;  1FOW A;  2E2J J;  4EJV A;  1AA7 A;  1BI3 A;  3N05 A;  4QTR A;  1F4K A;  1BI2 A;  3MKY B;  3HOZ J;  3I53 A;  2RDP A;  3U1D A;  4IHX A;  2JUG A;  2Y30 A;  1X1B A;  1D1C A;  5DD4 A;  3OYA A;  5JFR A;  3A01 A;  2DU9 A;  2K9M A;  2VKE A;  3GUD A;  1A36 A;  1D0Z A;  4WXC A;  5BOX A;  1FTZ A;  2DOD A;  2Y75 A;  4N9I A;  4F55 A;  2H6B A;  1KU7 A;  2HI3 A;  4R79 A;  3G6E I;  3K1P A;  3HTU A;  3PSF A;  3H5N A;  1G2H A;  5J3L A;  1F5T A;  2E19 A;  4QPQ A;  3J7A O;  5TJJ A;  4B3A A;  5IT9 K;  2OBP A;  3ZPL A;  3ZN0 A;  1XX5 A;  2E7X A;  1V3F A;  2V9P A;  3BPV A;  3BR6 A;  4MTE A;  4G7O F;  1OQY A;  1UHM A;  2VPL A;  2JRT A;  4A0Z A;  2V6E A;  4DZJ A;  1S3J A;  2GOM A;  1POG A;  2VC1 A;  4EM2 A;  2IT0 A;  4XNF A;  2EZK A;  1O3R A;  3CJQ B;  5DM7 F;  2E35 A;  2ECC A;  2JRM A;  3LSG A;  4GO1 A;  5LGN A;  1R23 A;  2L54 A;  1BIB A;  3NAU A;  5H6R A;  1V4R A;  2RAE A;  4GGG A;  2DQR A;  1XB4 A;  1RIO H;  1I3Q J;  2CW7 A;  1IRG A;  1S7A A;  4BHP A;  3VFZ A;  1LE8 B;  2CFX A;  3GF2 A;  3RKW A;  4IQ4 A;  2Q1Z B;  2DBB A;  4BL0 B;  3E6D A;  2XKP A;  4OMZ A;  5HVQ C;  2Z3Y A;  4DW6 A;  5F0H A;  3H5A A;  1R1V A;  4D5C A;  2P5L C;  3EUH C;  5JI6 A;  3E97 A;  4CCN A;  3MKW B;  1MBJ A;  2KIQ A;  5LBQ A;  4XID A;  2ZKZ A;  3JSO A;  1Z67 A;  4ESB A;  4PJJ A;  2W4S A;  2DA5 A;  3ONQ A;  3I56 I;  1W36 C;  2JWT A;  3JRD A;  2IGO A;  3M8E A;  5EG0 B;  5FFZ A;  2KIF A;  4C3I J;  4AIJ A;  2G0E A;  5ICC A;  2QQ8 A;  2Y48 A;  2AQF A;  2LSO A;  1OCZ H;  2A6T A;  2NAZ A;  1IN6 A;  4Y4R A;  3BJO A;  5TIS C;  5JLX A;  1VF9 A;  1EKE A;  3BG5 A;  4FE4 A;  3HRU A;  2P6T A;  2VKV A;  1RKW A;  4DBR A;  2XPV A;  4M3E A;  5L3C A;  2O03 A;  2PJP A;  2ZNZ A;  4I2O A;  3V7C A;  5JHF A;  3E5X A;  2A5W A;  2A3S A;  2CUJ A;  4I76 A;  4V2G A;  3ECH A;  3AG4 H;  1ENH A;  2QZ8 A;  1R5H A;  2E1M B;  1X4P A;  1HKT A;  1MJ9 A;  2K9L A;  1J2X A;  1VQM I;  4UUV A;  1KYW A;  3DPT A;  3DPU A;  4HEA 2;  2QLZ A;  3VDX A;  3CO6 C;  4ITV A;  2KP6 A;  1WCM J;  3ISP A;  3N4M A;  3RPQ A;  2KDZ A;  1LKX A;  3J7Z I;  2DMN A;  2Z99 A;  3P9C A;  3TW7 A;  4CO8 A;  4IPA A;  2L3D A;  5EZH A;  5H2F C;  3QU6 A;  1GXP A;  4LG3 A;  1QPM A;  1D1A A;  1W36 D;  4MIM A;  5DCM A;  3AG2 H;  2KRH A;  4A6E A;  5ILU A;  1E3P A;  4AIH A;  1GV5 A;  2WB1 N;  2PMU A;  4CYD A;  1ULY A;  3BJ6 A;  1DDN A;  1HW1 A;  1VND A;  3AG3 H;  1BR2 A;  1VI0 A;  1UFM A;  3OYF A;  2M9H A;  1LUJ B;  3WU0 A;  4ZYD A;  3ASN H;  1SC7 A;  4CZZ A;  1NG6 A;  1X3W B;  5CVR A;  2CQK A;  3CCM I;  1FYK A;  4IHT A;  1RNL A;  1IUY A;  3IH2 A;  1FIP A;  1Z1D A;  4GYI A;  5E3O A;  3CUQ A;  1EV7 A;  3VOD A;  3RSN A;  3PNT A;  2Y9Z A;  1RUN A;  3S16 J;  2A69 F;  2ZBK A;  1ZG3 A;  2Z33 A;  3OL4 A;  1QNT A;  4PJ0 C;  3G71 I;  4BH9 A;  2DO7 A;  1A04 A;  4UUS B;  2NXN B;  4LD5 A;  1KZH A;  4AIK A;  4RB3 C;  3I3L A;  1BC7 C;  2ICW G;  2DN0 A;  3B02 A;  4M3G A;  1JKO C;  1GVJ A;  2GAU A;  2DI3 A;  1YX5 A;  3CCQ I;  1BC8 C;  2JA7 J;  2FBI A;  2IAI A;  5J4Y A;  3V42 A;  2RKH A;  5ICG A;  3O3K A;  3L00 A;  2DA3 A;  2ZO4 A;  4C2M J;  2OTL I;  5B66 C;  1D1B A;  3A03 A;  1K6Y A;  3FXL A;  4IO9 F;  1NHA A;  3OIO A;  1ORK A;  2H8R A;  4B1R A;  4BAY A;  3OMY A;  3S2H J;  2ID3 A;  3U9G A;  3LL7 A;  4A5M A;  3QP6 A;  5LGT A;  5J1U A;  3N97 A;  1ZG5 A;  3JTG A;  1FTT A;  2FBK A;  1MNE A;  1XMK A;  2ELK A;  3EET A;  3HHG A;  1X2M A;  5GPC A;  2KRC A;  2IGM A;  3TP0 A;  4NC7 A;  4A0Y A;  3F22 A;  5A2Q K;  2CSO A;  1SEU A;  4CZC A;  5D8K B;  1HDD C;  3ZR8 X;  2X6O A;  1G8X A;  4A0X A;  5HS9 A;  1VQL I;  4N4O B;  1H9G A;  5DEQ A;  3PM1 A;  5K5Q A;  3MWM A;  4OU0 A;  3MVP A;  2W7N A;  4CDG A;  2MLK A;  5C4X J;  2Y0S N;  1I39 A;  3OYM A;  4LLL A;  4ENM A;  2W1O A;  2EIJ H;  1D0X A;  2W84 A;  3DTK A;  4I7H A;  2JVG A;  3K4N A;  3RTR A;  2VBY A;  2EV5 A;  4EJO A;  3CMA I;  2FJ1 A;  3UKG A;  1CQT A;  2V26 A;  3QYB A;  1R6R A;  2LH9 A;  3FXR A;  1W7P D;  3F9K A;  4IHW A;  3S15 J;  4XOR A;  3RDI A;  1MBH A;  4G7Z F;  2VPR A;  3FXM A;  1SAU A;  1QZE A;  3PL8 A;  2G7H A;  2R4G A;  3OSF A;  2HKO A;  2M45 A;  3IC7 A;  1ON1 A;  2DCE A;  4BJ5 C;  3LSI A;  1XGN A;  2IEK A;  3CMM A;  3F23 A;  4EJT A;  4CXF A;  4E7H A;  2DDA A;  1MDM A;  1ZRF A;  3JW4 A;  1FBS A;  3HJE A;  3RPU A;  4UB6 C;  3L2C A;  4MFE A;  1XPX A;  1TQP A;  4UB8 C;  2DYR H;  2VE8 A;  2P8T A;  1LDD A;  2EFO A;  3KEO A;  1U8R A;  3WTV C;  2L5Q A;  3TBI A;  2CUF A;  1HA8 A;  5LGU A;  1FX7 A;  1FYM A;  3ZQQ A;  1TP4 A;  4LJZ F;  4KMU X;  1O4X A;  2CYY A;  3W6V A;  1BIA A;  2XRO A;  4FET A;  3UNG C;  1YRN B;  4IEJ A;  2DA4 A;  4DGW B;  3H5R A;  1A5J A;  1OCR H;  1Y8Q B;  3L09 A;  4B4C A;  4G6Q A;  2KIU A;  2EIM H;  2ZJ2 A;  1HXD A;  2CRG A;  1A6Q A;  3KP2 A;  1OYW A;  2MW8 A;  1ETY A;  3I4M J;  3ZP5 A;  5GTH C;  1XTA A;  4RM2 A;  1N75 A;  3KX2 A;  2W82 A;  1PUF A;  4MQ9 F;  4E7I A;  3S1R J;  2B9S A;  1ZLJ A;  3RCO A;  4NHJ A;  2JA6 J;  2OAZ A;  1EH7 A;  1YW9 A;  3ULQ B;  4LB5 A;  2RNG A;  3VOE A;  1O3S A;  1B1B A;  4KIS A;  2IBD A;  4CCK A;  1I6H J;  3BTC A;  2GA1 A;  1IDY A;  4U0V A;  1Z7L A;  1GV2 A;  1I50 J;  1VQO I;  3FXQ A;  3PIO F;  1F43 A;  1D8K A;  2J5O A;  2LBF B;  2UZK A;  4LGW A;  5L3F A;  3HM5 A;  3QPL A;  1CGP A;  1FT9 A;  1WJF A;  3K4C A;  1UCR A;  1KU2 A;  2HYF A;  2CU7 A;  2VJI A;  5H20 A;  3LSH A;  3CJN A;  4PSX A;  4BGD A;  3BC8 A;  1ONV A;  3VSL A;  1MSE C;  2E71 A;  2LG4 A;  3COA C;  3OYG A;  2Y31 A;  2RVC A;  5EEH A;  2NVQ J;  2JUC A;  4KJZ A;  3A2K A;  1MJB A;  5E3L A;  3MFK A;  4NB5 A;  4BS9 A;  3L2R A;  3M1C A;  5CVV A;  5IOY A;  5DUK A;  2PLY A;  4JYK A;  3OYC A;  3M1E A;  2LYC A;  3BR2 A;  1X19 A;  3NQO A;  5K7F A;  1RC9 A;  4D1Q A;  4XL9 A;  3JRG A;  2R7R A;  2O6G E;  3I59 B;  3ZCO A;  2FBH A;  2CMP A;  3CF5 F;  3GTM J;  2OA4 A;  3TKY A;  2LK2 A;  4I09 A;  2QKM B;  2F5F A;  3PFY A;  3K4L A;  1B9M A;  3JRF A;  3TO6 A;  3TO9 A;  2QM3 A;  4Q4Z F;  5FKL A;  4QIW N;  2JA5 J;  1ETV A;  1VQ9 I;  2R5Z B;  2LLK A;  5H6Q A;  2E5N A;  5EEG A;  3DP7 A;  4OIQ F;  2OD5 A;  1DU0 A;  4UHT A;  3T1B A;  5HDK A;  2IPQ X;  1B72 B;  3Q9V A;  1Q1H A;  3DKX A;  3IHU A;  1R58 A;  1BR4 A;  3G4S I;  4F93 B;  3CP8 A;  1K78 B;  3MCZ A;  3L1P A;  2B7E A;  3S2W A;  1KU9 A;  2OC6 A;  2JA8 J;  1ZR2 A;  1IAW A;  1Y39 A;  3K70 D;  3E6C C;  3S17 J;  3BG9 A;  2E34 A;  3D5L A;  3ASO H;  2L0K A;  3MQ0 A;  4OIP F;  2HU9 A;  2XRL A;  5IT9 Z;  4BU2 A;  2CV0 A;  1P9Q C;  3OL3 A;  2C6Y A;  3JRA A;  1X1A A;  2NOG A;  5AIP A;  3DCF A;  3FHN A;  1YS7 A;  1O57 A;  2TRT A;  1FOY A;  1IZ1 A;  4RGU A;  3BDD A;  1Q1V A;  3BTI A;  3S14 J;  2JVH A;  1G3Y A;  5JVT A;  5HLI A;  4BEH A;  2Z1D A;  3BCB A;  2H94 A;  3BZ6 A;  2CQQ A;  1BM9 A;  4J00 A;  2VXZ A;  2MYS A;  2XAU A;  2P81 A;  3ZQC A;  1MBK A;  4A12 A;  4YFK F;  2MC3 A;  3M8F A;  2VQC A;  1WWX A;  4A5N A;  3OYN A;  3Q0U A;  5EGO B;  1KQ8 A;  1YI2 I;  4MEY F;  3SJM A;  1WZ2 A;  2NS8 A;  2OJE D;  5LEJ A;  2WWY A;  2A6E F;  2XRN A;  4KIC A;  2X1D A;  2XAQ A;  1WI9 A;  5IYD J;  4B8X A;  2W85 A;  3PNV A;  1ZR4 A;  3HOW J;  1IGN A;  1R36 A;  1WH7 A;  4OIO F;  3BR1 A;  5K5R A;  1S5L C;  5HLG A;  2OQG A;  1U9O A;  4QLC U;  2HEO A;  2A61 A;  3ZQF A;  2ZJP F;  6PAX A;  3ZMV A;  1PP7 U;  2K9Q A;  3LQQ A;  2WY8 Q;  3G73 A;  4DBQ A;  3LMM A;  3KP5 A;  3GEZ A;  1JTX A;  1DPR A;  1OCO H;  2DK8 A;  3GFJ A;  1YJW I;  4MO7 A;  4Y17 A;  4XKB A;  3EYY A;  4Y52 J;  2R7V A;  2Z16 A;  4LMY A;  5EDN A;  1XD7 A;  4KYW A;  1R5I D;  2F2E A;  4AID A;  5CQE A;  1IXC A;  5TGT A;  2KMU A;  2FNP A;  4XM3 A;  4BKX A;  1YW7 A;  2CQ7 A;  2WC2 A;  3K69 A;  4U7B A;  1H9T A;  2GLO A;  4FQG A;  4A3F J;  1YTY A;  2BXZ A;  5JR3 A;  2QEX I;  3C2B A;  2D1H A;  4XMY A;  3A0H C;  4M3D A;  4WWC A;  1DGW Y;  1W7P B;  2RQQ A;  4MHG A;  2R7Q A;  3BT9 A;  1O3T A;  1MH4 A;  4NUB A;  4S05 A;  4AYB A;  4HX7 A;  1M1E B;  4A3E J;  1SFO J;  1YHQ I;  3BR3 A;  2PJR A;  3CUQ C;  3NAR A;  1JJ8 C;  2WBM A;  3MKL A;  4NBQ A;  4W1U A;  4RGR A;  3TO7 A;  1RR7 A;  1WHU A;  5JLW A;  1ON2 A;  3M9A A;  2QCO A;  3BJA A;  3Q9S A;  1JKQ C;  4M73 A;  5FRO A;  3CCU I;  1FOK A;  1B8I B;  1HBX G;  3G1M A;  2WAE A;  1ETK A;  1TTY A;  1YE9 A;  2HKX A;  3CUO A;  1GUU A;  2FE3 A;  1ZRD A;  4UVA A;  1KQ0 A;  3K4M A;  3R0A A;  3NEU A;  4B47 A;  2RQP A;  2KLO A;  2IXS A;  4HLX A;  2RNJ A;  2VT2 A;  1RR8 C;  4DJA A;  1T56 A;  1K4T A;  1QZZ A;  1I27 A;  1LJ9 A;  2P6S A;  1HW5 A;  3F8B A;  4Y13 A;  3LSP A;  2AXT C;  2V7F A;  2DTZ A;  1J59 A;  2R7D A;  4D0P A;  1JUM A;  1R1U A;  2HNH A;  3QPS A;  1Z3X A;  1WRJ A;  4XIC A;  3QYF A;  2YU9 J;  4I02 A;  1SFE A;  5JHU A;  3WE3 A;  1V54 H;  1FC3 A;  4B44 A;  4I0A A;  4ABZ A;  5HOO A;  1G6N A;  4A69 C;  1CF7 B;  5IYC J;  3M3Y J;  3HOV J;  1VQN I;  2K4J A;  2NVU B;  3H1C A;  4KUM A;  3I71 A;  3F8C A;  2Y0M A;  1YYV A;  3R60 A;  5ILS A;  4KIF A;  3WGH A;  2M4G A;  3CCY A;  4ESF A;  3I58 A;  4XRS A;  1R7J A;  1PVE A;  4RGX A;  3AL0 C;  3CDI A;  3MZH A;  3FKJ A;  3GXO A;  1FWZ A;  3DQV C;  1B4A A;  2LMD A;  3J7Y J;  4HRI A;  2CV1 A;  2IA0 A;  2BW3 B;  4A3D J;  1WGX A;  4QSH A;  5A2Q Z;  3ZQ7 A;  3HRT A;  1F1Z A;  1S9H A;  2BGC A;  3I5U A;  2V4J C;  4GFB A;  5F08 A;  3BTL A;  1E3H A;  2BZT A;  2R7S A;  2XAG A;  4QPO A;  1NTC A;  4IOC F;  1QHH D;  4LG0 B;  3TOB A;  2A6H F;  3U2R A;  3LQR A;  4DNC A;  3QU3 A;  3HC7 A;  5B5E C;  1UMQ A;  2CS3 A;  1IXR C;  2MD5 A;  3GO5 A;  4DYR A;  4BDY A;  1G4D A;  3CC4 I;  5FLM J;  2Z5U A;  3BOQ A;  2Q2E B;  2D5V A;  4LLN A;  4L18 B;  2OF7 A;  2LY2 A;  3OOU A;  1IV8 A;  1K83 J;  1QVT A;  1DP3 A;  2KKO A;  4WCG A;  5DD8 A;  1QRY A;  3CJT B;  4IHV A;  2ADU A;  1DQU A;  3P5J A;  1DPU A;  5FD5 A;  3FHZ A;  4KT6 A;  3SEZ A;  1LE8 A;  3LA3 A;  4RB1 A;  1AKH B;  3HUG B;  2QQA A;  2M7B A;  1ZYR F;  1RKT A;  2DA6 A;  2MC4 A;  3CQZ J;  2GA2 A;  2AS5 F;  1IRX A;  2YS9 A;  4DYQ A;  1I6X A;  4GRI A;  2DFI A;  1J5Y A;  3BR5 A;  4M71 A;  1U5T B;  1BJZ A;  3A0B C;  4P9U A;  3LA7 A;  5F0C A;  5FO5 A;  4HLY A;  5E3N A;  4MGR A;  3L2V A;  3AAF A;  2K86 A;  4Q47 A;  3ABL H;  2HOA A;  3WE2 A;  2X9D A;  4UNO A;  3FDY A;  1SFU A;  4A3C J;  2DXI A;  2HOT A;  2L9V A;  1LDK B;  2HGC A;  1I1G A;  3CCJ I;  3TGN A;  3A01 B;  2WA0 A;  2IA1 A;  3IRR A;  2QVO A;  3O2P E;  2DDB A;  1TLH B;  1WJ5 A;  2Q8K A;  1IO2 A;  3A4C A;  2PBI A;  2L02 A;  3WGG A;  3HRM A;  1Z6R A;  5F64 A;  1SD7 A;  4YFN F;  1TZL A;  3H0G J;  2FML A;  1G59 A;  1HC8 A;  4OIR F;  3QOD A;  4UUT A;  1PUE E;  2CG4 A;  3ELK A;  4OAZ A;  1OCP A;  4L0Z B;  4HYE A;  2FF4 A;  1SVO A;  3HZJ A;  2EPF A;  4WXD A;  4XOT A;  2EFQ A;  4HA8 A;  3WTY C;  5L3G A;  1SFX A;  3LAP A;  4HNU A;  3SZT A;  1K61 A;  1YS6 A;  1ZHF A;  2Z2S B;  1VQ4 I;  2DJI A;  4OOI A;  5KVR A;  2V1U A;  2LKS A;  1LDJ A;  5IYB J;  2YX4 A;  1R71 A;  4IOA F;  1YW8 A;  2STT A;  3SQN A;  2AO9 A;  1F9N A;  3ZN1 A;  1FLI A;  3ROU A;  3K4B A;  4M6Y A;  3V7S A;  3WGI A;  3M07 A;  1PJR A;  3K4J A;  4XKV A;  4W97 A;  3PQJ A;  1T0F A;  3HEF A;  2VBW A;  3WHB A;  1N25 A;  3BG6 A;  2HYJ A;  2ME6 A;  4YIF A;  5D5U B;  1FEX A;  4BJ6 C;  4EM0 B;  2JZY A;  4ON0 A;  2NNN A;  3SDB A;  4F92 B;  1NH3 A;  3W6K B;  3GTJ J;  3L7W A;  2DOE A;  4HF0 A;  1YJ9 I;  5AIQ A;  4CCL A;  1WVR A;  3VYR B;  1WJD A;  4OAY A;  5E1X A;  3HOS A;  1ZGW A;  2COB A;  5BPI A;  1X1P A;  2W57 A;  3HHH A;  4X6A J;  3CZ6 A;  3E6M A;  4UY8 I;  4X1E A;  1HSJ A;  3LSK A;  2ZXJ A;  2QBY A;  1H8A C;  2K9N A;  1BA5 A;  3LOC A;  2YUS A;  4BHC A;  2P7V B;  5E79 C;  2DMP A;  2NNY A;  4CUG A;  3R6S A;  2XGC A;  1KQ9 A;  5KAI C;  1Z91 A;  2UXX A;  2KJB A;  4F3Q A;  1WSU A;  1YIJ I;  3VWB A;  1MMN A;  3G1O A;  3GFI A;  2LF8 A;  4NDL A;  4CIC A;  2FSW A;  2MSY A;  4EGZ A;  4D7M A;  3HKZ A;  4TV7 A;  1ACI A;  2BE5 F;  2ZB9 A;  3GVA A;  3FM5 A;  1MH3 A;  5GPA A;  3MAJ A;  3H35 A;  5FGM A;  2WAQ A;  2XF6 A;  5DCF A;  4ENK A;  5TRD A;  1JT0 A;  2GXB A;  1OIS A;  1EF4 A;  2MGQ A;  4F52 A;  4HV5 A;  2VOD A;  3FMR A;  4EMS A;  2VL8 A;  1WI3 A;  1U9N A;  4ZYH A;  2O5R A;  3A02 A;  2YU3 A;  4XRS G;  4YG2 F;  2K3F A;  2VIX A;  3REO A;  4EV0 A;  3OOP A;  3QPT A;  3CP2 A;  4IF4 A;  3DTI A;  4RA2 A;  4A6D A;  3F6O A;  3ZRG A;  3KYC B;  4H0E A;  3SHF A;  2MH2 A;  3HTS B;  5J47 A;  1TWA J;  2CO5 A;  3RI4 A;  4BBR J;  2XAH A;  1IN8 A;  2QWW A;  3V7R A;  3LFU A;  1OCC H;  4IHS A;  1V5G A;  4XON A;  5D6E A;  5EYR A;  1TNS A;  4D9J A;  2DTR A;  4XLH A;  4AM3 A;  2X6X A;  5C44 J;  2VBZ A;  3ML6 A;  2E1C A;  1JGS A;  1OCT C;  1FIA A;  2ZC2 A;  1JXS A;  1UB9 A;  5IP6 A;  2FXA A;  5D5W B;  3KP3 A;  4G94 A;  1G3W A;  1FMW A;  1USS A;  3V8K A;  1WJC A;  3QWL A;  3JR9 A;  1Z9C A;  2X51 A;  2BVM A;  3SZP A;  1R1T A;  1VQ7 I;  3DEW A;  2XSD C;  1MZB A;  2W48 A;  5F0F A;  2WV1 A;  5E3M A;  3HXL A;  1ZAO A;  5B1B H;  3DLL F;  1BL0 A;  2MAB A;  3KLO A;  3H9Q A;  3PIP F;  3OYJ A;  1JT6 A;  3U1K A;  2HXO A;  3S32 A;  3WG7 H;  4N4N B;  1T8I A;  4U87 A;  2O3F A;  3OYL A;  2EA4 A;  3SDG A;  1KGS A;  2X6W A;  1PP8 F;  3T8T A;  1YRN A;  2PMH A;  1TBX A;  2BY2 A;  3Q0W A;  5K1Y A;  3KP7 A;  4XRM A;  3RKQ A;  4RDU A;  1E17 A;  4BDZ A;  1W5C C;  3HSR A;  2LKP A;  4M6X A;  4MTD A;  4IX7 A;  2PI0 A;  2P0W A;  1XCB A;  3G1L A;  4E70 A;  4RLQ A;  4BXX J;  1SD4 A;  5LHH A;  2PFB A;  5J4V A; 
#chains in the Genus database with same CATH homology
 1YIJ I;  2JQ7 A;  2OTL I;  4IO9 F;  1VQ5 I;  1FOX A;  3I56 I;  1FOY A;  3CCL I;  1ACI A;  2H8W A;  3CCJ I;  1VQ8 I;  2ZJR F;  1VQO I;  3PIO F;  3CCS I;  1YI2 I;  2FOW A;  1VQL I;  1S72 I;  1HC8 A;  5GAE J;  1VQN I;  2K3F A;  1FOW A;  3CD6 I;  1VQM I;  2ZJP F;  3CMA I;  2QA4 I;  3I55 I;  4V19 K;  2E36 A;  1VQ4 I;  3J7Z I;  1YJW I;  2OTJ I;  3J7Y J;  1VQP I;  4IOA F;  3G6E I;  1VQK I;  3CF5 F;  5GAG J;  1VQ7 I;  3DLL F;  4IOC F;  2QEX I;  1VQ9 I;  3PIP F;  3CCV I;  5JVG F;  3CCE I;  5GAH J;  3CC4 I;  3CCM I;  1YJN I;  3CC7 I;  1YJ9 I;  5DM7 F;  1YHQ I;  2E35 A;  2ZJQ F;  1VQ6 I;  5DM6 F;  3CJT B;  3G4S I;  3G71 I;  2NXN B;  4UY8 I;  1Y39 A;  3CCU I;  3CCR I;  3CC2 I;  5GAD J;  3CCQ I;  2E34 A;  1YIT I;  1MMS A;  1QA6 A;  3CME I; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...