4IO9F

Crystal structure of compound 4d bound to large ribosomal subunit (50s) from deinococcus radiodurans
Total Genus 8
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
8
sequence length
71
structure length
71
Chain Sequence
MSYLIRKAAGIGKGSSTPNKAKVGKLNWDQVLEIAKTKMPDLNAGSVEAAANTVAGTARSMGVTVEGGPNA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Ribosome/ribosome inhibitor
molecule keywords 23S ribosomal RNA
publication title Novel 3-O-carbamoyl erythromycin A derivatives (carbamolides) with activity against resistant staphylococcal and streptococcal isolates.
pubmed doi rcsb
total genus 8
structure length 71
sequence length 71
ec nomenclature
pdb deposition date 2013-01-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
F PF00298 Ribosomal_L11 Ribosomal protein L11, RNA binding domain
F PF03946 Ribosomal_L11_N Ribosomal protein L11, N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.250 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Ribosomal protein L11, C-terminal domain 4io9F00
3CCJI 5DM7F 2E36A 1VQLI 3CF5F 3DLLF 3CMEI 1VQ9I 1YHQI 3I55I 2E34A 5GADJ 3CCEI 2FOWA 3CCVI 3CC2I 1VQKI 1FOYA 3G6EI 3CCMI 1YJNI 3G71I 3CCSI 3CCLI 2OTLI 3CC4I 1VQ6I 1YI2I 1VQ7I 2NXNB 1YIJI 2ZJQF 5GAGJ 1VQ4I 2ZJPF 2ZJRF 1QA6A 2K3FA 2JQ7A 3G4SI 3J7YJ 1VQNI 3CMAI 4IOAF 2QEXI 1Y39A 3CC7I 3PIOF 3J7ZI 1YJWI 2OTJI 5DM6F 3CD6I 1MMSA 3PIPF 1VQOI 1VQ8I 3CJTB 1FOWA 1HC8A 2QA4I 5JVGF 4V19K 3CCQI 5GAEJ 4UY8I 1ACIA 4IOCF 1S72I 2E35A 1YITI 3I56I 4IO9F 5GAHJ 1VQMI 1YJ9I 1FOXA 1VQ5I 3CCRI 2H8WA 3CCUI 1VQPI
chains in the Genus database with same CATH superfamily
1TZLA 4N4OB 3E7LA 1KU2A 3IHUA 2A05A 1IV8A 4MEYF 3PJRA 2IA1A 1XD7A 3HHGA 2Y2ZA 2ZJ2A 1IUFA 4F3QA 1AHDP 2VLAA 3HGGA 3E5QA 2JZYA 2W4SA 1MMNA 2R5ZB 5GADJ 4KT5C 4PUSA 1A36A 5F08A 3HOVJ 5IYCJ 2V7FA 3BWGA 5HNFA 3GFMA 4C3IJ 3MN2A 2MA3A 3JRCA 2KDOA 3DTIA 4XKWA 3BQZA 1VQKI 5D5WB 3PL8A 1D1AA 1I3AA 1V5EA 3SFZA 3K69A 3U21A 4A3KJ 1MD0A 2L9NA 4WWCA 3ZQGA 3D5SC 2DTRA 5KCMA 2JRTA 4ZYGA 1EJ9A 2XGCA 1U2WA 1LQ1A 3CCLI 3JREA 5B1BH 2VASA 2H1LA 2EFPA 5D8KB 2JT1A 4IXAA 1SFKA 3GFJA 4UHTA 2DDBA 2UUZA 1YIJI 2OV7A 2E71A 3AG2H 4H0EA 1BOBA 4II2A 2V9KA 2CQQA 1ZG3A 5KNLA 3ZMDA 4M9XA 2CW7A 2F48A 1MNDA 2HNHA 4KDPA 1MSEC 2KHMA 3BR2A 4ESBA 2XSDC 1X19A 3S3OA 1CF7B 1VI0A 4C30A 4O6JA 2KFDA 2JK3A 4DBRA 1WH5A 3S3MA 3JTHA 2KZGA 2HQAA 5DM6F 5IPAA 2L7FP 2R7UA 2ZNZA 4KIFA 1ZTRA 5DUKA 4U88A 1VFCA 1VQOI 4QPOA 2HGCA 1EF4A 3ZMUA 3LOCA 4HW0A 2NOJB 1D5VA 2ZO4A 1LPQA 1OQYA 2E1CA 3I5UA 5CVUA 1IO2A 2M4KA 2VBZA 2XF7A 4ZYAA 2BVMA 2JUGA 3PQJA 1YYVA 2DU9A 3ZMVA 3QRFF 4XOTA 1UZCA 3ECOA 4Z2YA 2IPQX 2XPUA 2HYJA 3FMSA 4L0YB 2K4JA 2W85A 4A3CJ 4PGGA 1FBUA 5KHDA 3OYJA 4HF0A 1GV2A 1YX3A 4IKFA 3FDYA 2LBFB 2CYYA 2HXIA 3F8BA 2R5ZA 3BTLA 4GCVA 4HSTA 2OD5A 3HPGA 5D8LB 1G2HA 3F8NA 4HX8A 5JFRA 3HEFA 4NBQA 3E6CC 4CZZA 1ZGJA 2HI3A 3EUHC 4HQMA 3G3ZA 3IRQA 2AHQA 3TGNA 2ECCA 1M1EB 3HB9A 2L7MP 4BH9A 4XM3A 3IWFA 2VBYA 4BGDA 1UAAA 5EGOB 4ITVA 2PJRB 4CXFA 1QU3A 3S14J 2RNJA 3AG3H 5FD5A 5GTIC 3I55I 5J1YA 1GLNA 5E1ZB 2VN2A 1SMTA 5JLWA 1JUSA 2KJBA 4KN4X 4AYBA 2Q0OA 3PUFA 2XUBA 3OYGA 5ED4A 1F5TA 1BA5A 2EIJH 1MBFA 1BN5A 3K6GA 1Y8RB 4XIDA 4MFDA 2OCCH 3H3VK 4X1EA 1I50J 5DS9A 2HQ5A 3OYEA 1J7KA 2STTA 1VF9A 1XSDA 3H35A 1YW7A 1LDJA 3J81K 4L5IA 3CCMI 3G71I 4XR6A 3GZNB 2G0EA 4GO1A 4YIIA 3MKWB 1UB9A 2WV1A 1OCOH 2X9DA 3CJNA 3M8EA 1CF7A 1JKQC 4A0YA 4LLGF 3LA7A 1EH7A 2HZTA 4OAYA 4BBSJ 3ZQIA 1XMAA 1BW6A 2BGCA 2KIMA 3HOWJ 1YO5C 3S2WA 4NDLA 3OYHA 4IRIA 3W2WA 1T39A 4RLFA 1KU9A 3EETA 3IC7A 1BI3A 1EV7A 2VQHA 4ESFA 1RI7A 3LSRA 1ZYRF 5D4RA 3OYBA 1ZG5A 3GUDA 4EEFG 5L3FA 4N4NB 1PUFB 5CQEA 5EEGA 3W6KB 1WJFA 2OTJI 2ZXIA 1E3OC 3K0LA 1FNNA 4NC7A 4ZZDA 1VTNC 2EJRA 2VQGA 2NRAC 2ME0A 2KZVA 4F55A 1GVDA 3VYRB 4LIVA 1X3WB 4IHVA 4B48A 4XRFA 2W1OA 1W5SA 3GWZA 1ZAOA 1R1VA 3CJTB 3I0TA 1HBXG 3O6BB 4M3FA 4MQ9F 1XB4A 4LIUA 1WJAA 2LBFA 5DUIA 3P9CA 4FE7A 4U0WA 1SC7A 4RM3A 1ETQA 1RZ4A 1K7AA 2VXDA 2RDPA 3PUBA 2ISYA 3QYEA 4RS8A 2BE5F 1YITI 2OQRA 2HOSA 2BBYA 5JHUA 3WU1B 4BQQA 1QZYA 3OMYA 4A3GJ 2VBWA 1SEUA 3P9KA 1VQMI 1JXSA 2DT5A 4D1QA 5EGOA 3BTIA 1JGGA 1PUEE 4B8XA 3G2BA 3JCUC 2XHKA 1KZHA 4CDGA 2EIKH 5IT3A 5AIQA 4KIGA 4LG3A 2QSGX 3ZQCA 2IT0A 1HSTA 3R61A 4QIWN 4UUSB 3WTYC 4A3EJ 4I02A 2ZNYA 2L9VA 4L5JA 1SAUA 2G9WA 1VQ9I 4HLYA 5J8FA 4C2UA 2RC4A 1W1WE 2HKOA 5LHHA 1HW2A 4FX0A 3C1DA 1IDYA 1HLVA 5E20A 5ICGA 2A5WA 3S15J 5DDGA 5EF6A 3CC2I 1B9MA 1AWCA 3VSLA 4G94A 2GOMA 2CGPA 1E3HA 2LY1A 2ID6A 4IEJA 4P9UA 4QPQA 3TL4X 1IN8A 3LNQA 1BI0A 1QRYA 3GZ6A 2GA1A 2I8DA 3OIOA 2X6YA 2Q1ZB 1TNSA 1Z67A 5HLHA 3WTSC 1PP7U 2FNPA 3HOTA 2BY0A 4JQFA 4XMYA 1ENHA 1VQ4I 2M9HA 2QZ8A 1PUFA 1ZKGA 1LFBA 4EATA 4O3MA 2LH9A 4HOBA 4A3JJ 4PJ0C 3RPUA 2FA5A 1YLFA 4Z6YA 1ETWA 2DT7B 3A0BC 3OYMA 3ZQQA 4G6QA 5KAFC 1KQ8A 3W3CA 4ANJA 3OYAA 2OA4A 1T8IA 4LG0B 3GZ5A 3ZN0A 4BQAA 4B3XA 2MH2A 4PFPA 3SEQA 3JRHA 3VYTB 4L18B 2GBYA 1DPRA 2MGQA 4BNCA 3KZZA 2UZKA 3OYDA 3CD6I 1ETKA 3E6BA 4E7KA 1FYKA 1BR2A 5CLSA 1JUMA 1X1PA 3MCZA 1A04A 2P81A 3EUKL 2IGKA 4BXFA 1O3SA 2JSPA 2KIFA 1ZR4A 3WE3A 4I0AA 4IJAA 1T08B 3FXLA 4XLEA 1QHHD 5GAEJ 2JVHA 3M8FA 2P5LC 4J00A 1BC7C 1MH4A 2UWMA 1X1AA 3BR3A 4IRGA 4DIQA 2V9PA 2P6TA 2X6OA 4L0ZB 5LGNA 2ESNA 2M0MA 2PFBA 2XF5A 4WF2A 4UUSA 4RB3C 1SD7A 4D5CA 2EBIA 3MZHA 4GYGA 2H1KA 2K3PA 4RA2A 4A2UA 5KAIC 2L02A 2H94A 3CCRI 3HOYJ 2H8WA 3AL0B 2VB6A 2GXGA 3CCUI 3DFGA 2P4WA 2VKVA 3CUQC 2HDCA 3E1SA 4XLPF 3GW2A 3JSPA 2FRHA 1VQPI 3SZPA 1POGA 3S17J 2YS9A 3MFKA 2PJPA 2LOOA 1WRJA 4HPQA 2VONA 5C4XJ 2FQ3A 5FO5A 1FP1D 2W57A 4G6TB 5FRMA 2DQRA 3KEOA 1T38A 3PM1A 4A6DA 3K9TA 1IV6A 3H36A 4WK8F 3HOSA 1BBYA 5HLIA 3LAJA 2W25A 4BDZA 3CESA 1MGTA 3M7GA 3VSKA 3B02A 3WG7H 2K40A 4X0GA 2P5VA 3GTQJ 4AIHA 3QOPA 2Y0SN 5F1JA 1ZQ3P 1YS6A 4M3DA 4U87A 1BR4A 4G9YA 4E7ZA 1KA8A 2EILH 3RZDJ 3ZP5A 1I6HJ 1SD6A 2O0YA 4A5MA 2Z16A 5KVRA 5LGTA 3CC4I 1VQ6I 5ICFA 3QPLA 4XRSA 3R0JA 1J09A 4S0HB 4P9FA 3JAMZ 4R79A 4LG0A 5JR3A 3FXRA 1RKTA 1W7PA 2PEXA 1IN5A 2ZJQF 2O3FA 5F1RA 3M8JA 3FM5A 2R7XA 1R5ID 2HZDA 1JHFA 2DW4A 3A0HC 3I9V2 1U5TB 4EM2A 4WXCA 1V4RA 4BDYA 2LR8A 3LA2A 1S5LC 3GYHX 3WTZA 2F4IA 1B8IA 3F3XA 2X6WA 4E7LA 1JT0A 1HA8A 2Y69H 2QKLB 3QYFA 2QEXI 2QVOA 1TWFJ 4G7HF 2COMA 2M1BA 4CCJA 3MD2A 1X4PA 5ERIA 4LB6B 2AQFA 3F72A 3TQNA 2JJ7A 1SD4A 2OBPA 1OCPA 2DAOA 3KLNA 5IP9J 1DUXC 4A3LJ 1NTCA 4YRVA 5KK1A 2E7WA 1IXRC 3DLAA 3UR3C 1SVMA 3L09A 2OAZA 3TP0A 1IZ1A 3FXJA 4YELA 2HS5A 1OCCH 4MFEA 2PN6A 3F6VA 1JTXA 4FQGA 2JMWA 3CCQI 4V19K 3VWBA 4HNUA 1DQUA 2IW5A 2A69F 3SJMA 2M4GA 2Q8KA 3Q0WA 3QOEA 2O61A 1WVRA 1QVTA 2LY9A 3GF2A 3DV8A 2DDAA 1NG6A 2D1VA 2FXAA 4BYYA 3E6MA 2WB1N 1J2XA 3OV8A 2Y75A 3BG9A 3GFIA 2F4MB 1IGNA 4KICA 5IT9K 1Z05A 3BLYA 3EYYA 4KITB 4HG2A 2CWEA 3BQYA 1QHGA 3M9AA 2R3SA 2F2EA 3RKYA 4BJ6C 2E7XA 1FIAA 1OLTA 1W4MA 4A3FJ 3U1DA 1IXSB 1T98A 2ETHA 2R7DA 3BZCA 2IVMA 3BR0A 2E1NA 2ZMEB 3CMMA 1B4AA 4MLOA 1LKXA 1Z3YA 3HOZJ 3HYIA 1MH3A 4F93B 1GVJA 2ELKA 4PSWA 4PGHA 4V2FA 1XGNA 4NC8A 2CMPA 1U5TA 4OU0A 4GYIA 1HKTA 5E3LA 4ZTFA 1H9GA 1L0OC 2WTEA 4XBFA 3ZGKA 2YX7A 3DBHB 4IHYA 2IAIA 5AONA 5HS7A 2R7QA 1KU7A 3LSIA 4M9ZA 5E3NA 2VPRA 2XKOA 4AC0A 2Z5UA 3PO3J 1G3SA 1FC3A 3GTJJ 4Y7NJ 4E7JA 3HOXJ 1OR7C 2P5KA 4CYCB 3L2QA 4M6XA 2CO5A 1TWCJ 3CMAI 4UB8C 2XRLA 5FD6A 3U1KA 1SMYF 4ENNA 1HQCA 2E1MB 2FMLA 3CC7I 4BL0B 3H0DA 3F23A 3LMMA 1ZG1A 3MZ8A 2Q2EA 1TWAJ 3KIOA 4JYKA 3Q5FA 3MWMA 4EMSA 4Q5SF 4IPAA 2EQRA 3P5JA 5ILUA 1TT0A 3TDUC 2EPFA 2O5RA 2VJ5A 3FK6A 4XKBA 2WBMA 3E6DA 3WTUC 1J5YA 2LK2A 2XGEA 1OFCX 3LSKA 3Q9SA 3C2GA 3L2CA 3LSPA 4EM1A 1N78A 2DMQA 2DJIA 3HXLA 2VT2A 2BXYA 3CO7C 5BOXA 3BG6A 2K02A 4RMNA 2L9SA 3LQRA 2NS0A 1OKRA 2HTSA 3M07A 4AIDA 3VDXA 2GZWA 4P1WA 1R6RA 3NWTA 2XSJC 2DK8A 4AD9A 2FBHA 2RREA 5EG0B 1H88C 4DZPA 4P55A 4JBAA 3ZN1A 1UG0A 1V5FA 3W6VA 4S04A 3S1RJ 1WPKA 2MSYA 3BPXA 1HOMA 2WY8Q 2D1HA 5DYMA 4ENMA 1JKPC 1D3YA 1I1SA 4PSXA 1WGXA 5A2QK 2NVQJ 3D1NI 4A0ZA 1SANA 4DYQA 2BY1A 3K7AJ 2FE3A 2DOFA 2DFFA 3CF5F 1SFUA 3E5UA 2LYCA 3H0GJ 1SFXA 4M3EA 1X1CA 3OSFA 1LNWA 1Z0XA 2FSWA 3CMEI 1TW3A 3B6CA 3SXYA 3ELKA 3L2VA 1OPCA 4PCQA 3MKZA 5HS8A 3PNYA 4UUTA 3BC8A 1HF0A 3RQ4A 1QGPA 3A01A 1Y56A 3FHNA 4P96A 5D5UB 3ZR8X 1FWZA 3HKZN 4D7NA 2UV1A 3LSGA 1IN4A 3BY6A 2EH3A 5M3MJ 4PK4A 2L2OA 5BPIA 1Y0NA 3TO9A 3J81Z 2R7SA 2FD5A 3K1NA 4CYCA 3MAJA 3I4PA 2XROA 2HVSA 1JE8A 1BOAA 3S1QJ 1OCRH 4L5EA 1VQ7I 1TWHJ 3HDDA 3E3VA 5CQGA 1V5GA 2XIGA 2GIZA 4NNJA 2DYSH 3ECHA 4J19A 3FMQA 3HTUA 3HHHA 2LNBA 2D2WA 3R4KA 3RYRA 1K6OA 3RDIA 1MW7A 2QENA 1WJEA 4A69C 3S32A 4EM0B 4O5VA 3WODF 3J7AY 2HVRA 4WCGA 1P7IA 3B6AA 3B73A 4E7HA 3QPSA 2HYGD 5CYVA 1Y8QB 3HG9A 4DW6A 4OIPF 2B63J 2VODA 4NHJA 3VYUB 4RGRA 2LD5A 3HGYA 2H6BA 1Z3XA 1E0EA 2MYSA 2CV2A 3D5RC 4A6EA 2X1EA 3U9GA 2CRGA 3CP2A 4KMUX 2YPRA 4M73A 3GVAA 5EG0A 2FMYA 4NC6A 2X1DA 5K7ZA 5B66C 2V1DA 2F5VA 3A02A 3KPHA 4GRIA 2ZBKA 3CQZJ 2W24A 3X2QH 5LBQA 1BIAA 4B47A 2E35A 3I56I 2DODA 2MH9A 2DMUA 4MEXF 1ON1A 3I4NJ 2VXZA 2R5YA 1HDDC 2ESHA 2JA6J 1YJ9I 5F64A 1W5CC 1MIJA 4RBOA 3OYLA 1RESA 5DTDA 5K5OA 3WHCA 1RUNA 2O8XA 3BTJA 3H3UA 3NWSA 2DMNA 4AWXB 3KYDB 5EDNA 1UG2A 4IVNA 1CGPA 2FF4A 4B1RA 2P0WA 2WAEA 1IN6A 2GWRA 4G8XA 1LDDA 4IHSA 1ZRCA 4CICA 3ABKH 2X6XA 2ELHA 2HPMA 3IKTA 1TW2A 1XGMA 4UUVA 4MNUA 2JA8J 3QP5A 5LRSA 4UV9A 3HPHA 3ZCOA 3ZQLA 4XSZF 3A1YA 3Q0VA 3H5RA 2DJNA 3FKJA 3QWLA 3T8RA 2JPCA 4A3DJ 3CCYA 5LRRA 1PYVA 2BYVE 1Q1VA 4AVPA 3VOEA 5FRNA 4Y4RA 1LB2A 2BHYA 3DXJF 4ASNA 2AXLA 4BJTA 4CCOA 3WTWC 1O7LA 1K78A 3RZOJ 3H5AA 2KQRA 4XLNF 4M3GA 3A03A 3TO7A 1Z7LA 3EUHA 1NK3P 2BZTA 1MZBA 1T6SA 2YX4A 4LITA 4UXNA 2FBIA 3MQ0A 5J40A 5TRDA 4PJMA 3TW7A 5F04A 2VJIA 2VOOA 3QQAA 1TBXA 3K4KA 2VOPA 4HDUA 4FHTA 4IOAF 2L3DA 2ZFUA 2BXZA 2AS5F 2KL4A 3K70D 4OIQF 1MMDA 1S3JA 1K61A 4N9HA 2LDUA 2LG4A 3RKWA 4WXHA 1YJWI 3F8MA 3L9FA 3H5NA 3O8HA 4ENJA 1S29A 2IGMA 3CJRB 1BR1A 5FFZA 3PIPF 1ZK8A 2DMPA 2NAZA 4E4HA 1VQ8I 1B72A 1PP8F 4WX9A 2GIVA 3LA3A 1HC8A 2DA6A 5ILSA 3ERMA 2X1CA 5JVGF 3DKWA 2IXSA 4ZDPA 5HOOA 2STWA 1HKSA 3ZMZA 1JUPA 4HYEA 1ITYA 2IJLA 2AXTC 4IOCF 2F6CA 2PG4A 2RGVA 5J1UA 3C2HA 4OMYA 1EH6A 1W5TA 1U9OA 4C2MJ 2X4HA 2OU2A 1YW9A 3RJPA 1D0XA 1WH7A 3IRRA 2HVQA 2OPTA 3GX4X 1NH3A 3GEZA 4F92B 2HFHA 3BPVA 3EUAA 3ZQFA 5BQTA 1FIPA 1O3RA 4CUGA 3CCJI 3EDPA 3HC7A 1VQLI 1WI9A 3BP8A 3COAC 2IA2A 3AAFA 5IYBJ 1WHUA 2VKDA 2XVCA 3DLLF 4DQ2A 4IRHA 4LLNA 2KJCA 1SD5A 1X2MA 4AM3A 4GDFA 2FOWA 1K4TA 4EVIA 4G12A 1S6LA 2NVYJ 3AG1H 1ZN2A 1ZGWA 3C2BA 3V7SA 4BACA 1E3PA 2RN7A 2XAFA 2TDXA 3NARA 4U7DA 1O4XA 4HDVA 5FROA 3RYPA 2DI3A 3G6EI 2DBBA 3ASOH 3ZMTA 3J80K 2BEOA 1MBHA 1TC3C 3BJOA 1MKMA 4RGSA 5DCFA 3ESWB 1YX5A 2EV5A 2MD5A 2LMDA 5M5YJ 3RPUD 3VB2A 2CV1A 1BM9A 1TT5B 1XCVA 2A6EF 4RB0A 3KP7A 3PFIA 1BI2A 2VE8A 4YEJA 4ZYHA 5ICEA 5LEKA 3HRSA 3BG3A 3ZQHA 4MGRA 3WG9A 4LJZF 4ZDOA 4J01A 1I6XA 2R4GA 1CQTA 3FBIB 2JQ7A 2M30A 2EV6A 3G4SI 4CCMA 1NK2P 1HW1A 5F0FA 4IF4A 1VQNI 3V42A 1IRXA 3AG4H 3K4LA 3PQKA 1T2KA 4BAYA 2Z3YA 2XC7A 1FBQA 2LKPA 4M74A 2QWWA 4YFXF 1H8AC 1X4OA 2EZLA 3ISPA 3S93A 2EWNA 2GQQA 2XAHA 3RQIA 1AU7A 1ZREA 1TQPA 1OISA 4RAGA 2LC2A 3RTRA 5B5EC 5FGMA 2L5QA 1BI1A 2E2IJ 4KUMA 2O7OA 2OCEA 5M3FJ 1D8JA 1S8NA 1TLHB 1UFMA 3FXOA 4KT6A 3W2AA 3FX3A 2V1XA 3ABUA 3S2DJ 2TCTA 3OYKA 3BDDA 3PSIA 2CQ7A 1WFXA 3T8TA 1B9NA 2PX9A 1W7PB 1MJBA 3HKZA 1YS7A 3EQLF 1Z6RA 3FMRA 4YFNF 5L3GA 5L3EA 2R7VA 3ABMH 1IRGA 3QPTA 4EGZA 4RM2A 5E18F 2DFIA 4OOIA 3IH3A 5HDGA 1B8IB 3PSFA 3GTOJ 2CSOA 5JVTA 5IT9Z 3GFLA 1LE8B 3AFHA 1A6IA 3IL2A 5E8IA 4HF2A 3FISA 3DEEA 5ILVA 3K1PA 1J0RA 2LVSA 5D6FA 3MKLA 2QYOA 2HR3A 3DPUA 3QPHA 3L2UA 1OYIA 2CQXA 2IRFG 5IP7J 2KMUA 3I54A 2QSHX 3M1CA 1JT6A 2QSFX 3CCEI 1QBJA 4FISA 3I3LA 4MHGA 3IAS2 2X48A 5DD8A 2Y48A 3DPLC 4FTHA 4BJ5C 2YU3A 1YRNB 3KE2A 1IG7A 3E0JB 3OYFA 1GXQA 5IOZA 2HEOA 2ECBA 2EFOA 1YJNI 2KKOA 1KGSA 2F5EA 2LP0A 1ZR2A 1YQAA 4XONA 1X3ZB 2NS7A 3MVPA 2B9SA 3WTVC 4Y52J 2RQPA 1P7JA 2NXNB 3VFZA 4YIRX 4JK1X 3CUQA 3KP3A 2DQLA 1MSFC 2E5ZA 5GAGJ 2DYRH 3KYCB 3A4CA 4NUBA 1X58A 4EV0A 5EJCA 5M5WJ 2QQ8A 2DLLA 4GFBA 2E1OA 4B3AA 2DXIA 1R71A 3J7YJ 3WGHA 2Z99A 1DGRM 3T0YA 4XNFA 1F1ZA 2DA7A 5C44J 4NQWB 2FOKA 3IH2A 1FSEA 3LSMA 2KDZA 4NB5A 2KRCA 3BJAA 2BV6A 1FLIA 2VIXA 5K7FA 1MMAA 1W0TA 5EZGA 4HBLA 1H9TA 4RGXA 5C3EJ 2OJED 2L54A 2PLYA 2M5WA 2DT6A 3G1MA 5K1YA 1ULYA 1JJ8C 3LSJA 1UMQA 1RR8C 1DU6A 3D0SA 2QCOA 5JLXA 1SFEA 1X3UA 2CQKA 4KMFA 1HCRA 2IA0A 5H20A 4BE0A 2K86A 1LE8A 4EJUA 4XKVA 2NNYA 4II3A 1STZA 1OCZH 1IXCA 1U0JA 4UV8A 3VODA 2PMHA 4RAYA 2WADA 2RQQA 4C3HJ 2E60A 2Y31A 4XLCA 2UXNA 4ZDLA 5EEAA 3L2RA 1A31A 2OZUA 4F91B 1K6YA 3QP6A 4ESJA 4FX4A 5A2QZ 3GO5A 2L7KA 2E36A 2L4AA 3O8GA 4KIBA 4H4KC 4XQFA 1JGSA 3IAM2 5CVIA 2Q2EB 3ML6A 2R92J 1JTYA 4DGWB 4UB6C 2MLKA 4FETA 4Q48A 1YRNA 3AL0C 1ZARA 3LL7A 2DA4A 2VQLA 3CMYA 2E34A 2BOLA 4HZFA 3CDIA 3BG7A 5J4YA 2LREA 1A35A 1RIOH 3BZKA 3P7NA 4LOCA 1Z77A 1BIBA 4IZZA 5LHIA 3HUGA 1AKHB 5H6QA 3V8JA 1C0WA 2E2HJ 1FOYA 2OZ6A 2XGDA 3LSTA 2EIMH 5CPRB 3DEWA 5LHGA 3FBNB 4I98B 3LFUA 1IDZA 1ZRFA 1P9QC 2QLZA 3IP4B 3PFYA 1WJ5A 1S7AA 2OTLI 1XTAA 5F0CA 5LFAA 5DEQA 3CF2A 2IP2A 2CUZA 3JRBA 4A5NA 3OSGA 4XLHA 2CV0A 3DBRB 4NQWA 4I6ZA 1UJ8A 1ZELA 3KZYA 1G59A 4DYRA 1LEAA 2FX0A 1QA6A 3PNVA 4HRIA 2ZXWH 4D7MA 4LK1F 5GPAA 4CO8A 3M3YJ 3K4MA 3F9KA 3T1BA 1YG2A 1R22A 6PAXA 5HVQC 5FJ8J 4ZZLA 1F4KA 4AIJA 3HZJA 2NVUB 2XGXA 3F8FA 3CLQA 1IAWA 2XPVA 3FZVA 4KJZA 4JX4A 3A01B 3I4MJ 3JRIA 3MEXA 3IUOA 1B59A 2CW8A 4IHTA 2O03A 4BHBA 4M9SA 2VC1A 2XB0X 1UCRA 1DGWY 2TRTA 2JWTA 4XKCA 1R00A 1XDUA 2VKEA 2QA4I 5BS6A 5IY5H 3TBIA 3OYNA 5D5XB 3KP6A 3LSHA 5HDNA 1T0FC 2E19A 4BEHA 3BR6A 4RAFA 4BQOA 3GTKJ 3KETA 3WGIA 4C2TA 1GT0C 2NOGA 4E70A 3ROUA 3H3ZA 3DQVC 4W1UA 1OR7A 2WC2A 2JUCA 3FKIJ 3TOAA 3P9IA 1P4WA 2GA2A 2O9LA 2P7VB 1O3QA 2LLKA 1O3TA 1TQMA 3U2RA 3OS1A 4HSRA 4IHWA 5B1AH 4E7SA 3O3KA 1JHHA 4I09A 5D4SA 3SZTA 2M7AA 1AKHA 3TOBA 1K83J 2HDWA 1USSA 3TW6A 2I10A 2QBYA 1I39A 2CFXA 4X6AJ 5J6XA 2M7BA 4XN0A 2V26A 3HM5A 1P2FA 1Z21A 3D5LA 3DPTA 2ICWG 2JA2A 4XK4A 1XDSA 2CW0F 3OR1C 4P5OA 5DCMA 2VKHA 1DDNA 1BJAA 2YU9J 2VT3A 3RPQA 2ZMEC 2ZSIB 1Y1VJ 4ABZA 4W97A 1TTYA 1ZHFA 1R9TJ 3OS0A 3C18A 1E2XA 2HOEA 2RAEA 4ZJZA 2R5YB 2F4OB 2H8RA 3WHBA 3FHZA 4JX6A 3OIPA 1IUYA 1FBSA 4R1HA 4G6DA 1XSXA 1EH8A 2FNAA 4B09A 5D5VB 4AU7A 2CUJA 2A5YB 1R23A 4A12A 1QNTA 1USTA 2DN0A 4BY7J 3Q9VA 4AVZA 3F8CA 2V4JC 3GLLA 2YR2A 3F6OA 3LWFA 3V8KA 5L3BA 3O2PE 3KP5A 3KZIC 3S2HJ 2GLOA 2CQNA 5H2FC 2X0LA 4B4CA 2EFWA 2XV4S 3DTKA 2V1NA 3RCOA 2MC3A 3FF5A 3VYSB 4Y17A 5IOYA 2FBKA 1MMSA 4V2GA 1N75A 1XCBA 2NNNA 1A6QA 1P4XA 2DFEA 1LFUP 1KONA 2HQNA 2V6CA 2VJ4A 3BR5A 1N77A 5E17F 1KQ9A 1T33A 4XRMA 1XMXA 2DA5A 1ZH5A 1LVAA 5EEHA 4QWQA 4EGYA 1W36D 1IC8A 2Z1DA 1FJLA 1MNMC 1OYYA 4BHCA 1K78B 5K7HA 3OR2C 5LLQA 4FCYA 3HOUJ 2KP6A 4PJLA 4LMYA 3WU0A 4UVAA 4XL9A 3CJQB 4PJJA 4DOZA 1FZPB 1N25A 4IO9F 1R1TA 3L2WA 2B0LA 4WXDA 4QTRA 3VEPA 4JX5A 1U3EM 3OL3A 5ICCA 2DOEA 3DF8A 3S1MJ 1MMGA 2V79A 1X2NA 5IYDJ 4RAZA 1BJZA 1LJ9A 3KCCA 2QGUA 3RI4A 3BR1A 2VC0A 3KFWX 1RETA 1YFHA 2DA2A 2GM4A 3BCAA 1A5JA 1YHQI 4CH7A 2IGOA 2Y0SA 3NEUA 2EV0A 5FLXK 4M6YA 1MJAA 5CKTA 2EZHA 1B72B 2V9VA 2K4BA 3OS2A 3KEQA 1Q1HA 1U6GA 4S05A 4DZJA 5FKKA 2OQGA 2FUG2 3R0AA 3PNTA 3TP3A 5FKNA 5E3OA 2ACJA 3K10A 3TKYA 3BJ6A 4RGUA 1W36C 3E97A 2A3SA 1ERDA 5B3SH 5GPCA 5FKMA 3SFIA 3J80Z 1JJ6C 3FIWA 3HRMA 4ZTJA 5TISC 4N0BA 3BZ6A 3HL2A 1NHAA 1XN7A 3GMEA 2ZC2A 2EA4A 4CGZA 4EJVA 2XAGA 4TV7A 4ZH4F 4B44A 2BHZA 2VE9A 1O7FA 2CS3A 1FSHA 2JVGA 2Y0MA 4DNCA 1ETVA 5L3CA 3BTCA 4M72A 3SQNA 3K4CA 1J59A 4UVBA 4LFUA 2BVLA 3WE2A 4N9IA 1AOYA 3R6SA 2FEZA 1GHCA 3KYLA 3IKVA 1SVOA 4MQVA 3TEDA 2ZKZA 5E1WA 1TQIA 3JTGA 2KLOA 2HDDA 2WWYA 4HV5A 3DKXA 5DD4A 2IEKA 3JRDA 1JI8A 1YE9A 1RR7A 1I5ZA 3A2KA 5HLTA 2WB1A 5E79C 2J5OA 2F5CA 4M3BA 3GLXA 4PFOA 1DU0A 2NVXJ 4ZYDA 3DWLE 1GXPA 1HDPA 4BXXJ 2X51A 2LF7A 4DJAA 3K1MA 2QF7A 2WAQN 4CZCA 1D5YA 1DPUA 1J9IA 4K2EA 5GAHJ 2M3AA 2MABA 3F0CA 3WGGA 4XRSG 3JW4A 5E8GA 4KISA 1IRZA 2L9RA 2P8TA 3HIFA 4OAZA 3DCFA 2NS8A 2R7FA 2XAUA 2VPLA 3PO2J 4L9JA 3E5XA 5DM7F 4M71A 1FMWA 4ON0A 5H6RA 3FM3A 5TJJA 4EJWA 4ZYEA 2GOXB 2J5PA 2Y9YA 3I53A 4KN7X 2CJJA 1F36A 4CCKA 3GXOA 2MFZA 4LB5A 2PI0A 4HLXA 5F6FA 1DP3A 1WCMJ 3JRAA 4E6KG 2N8GA 4KNYA 2LFBA 4D0PA 2VJJA 2W82A 4I01A 3K4BA 1L3LA 3ABLH 2R93J 3DU5A 1F9NA 4KA4A 2ZXHA 3NRVA 1U8RA 3K70C 2K7LA 1FT9A 4OINF 3OL4A 1U9NA 1IN7A 1LUJB 1KYZA 1WJBA 3IWZA 4A3MJ 4HNTA 3K4JA 1QPIA 3M4OJ 1R5GA 2FQ4A 5FFXA 2W7NA 2DOAA 1XSVA 1YTYA 2WV0A 3CO6C 1FX7A 2XRNA 1WJCA 1ODDA 2A61A 2ZJPF 1AA7A 1LDKB 3MKYB 2V1UA 1X1DA 1G8XA 3G73A 1XGOA 2QQBA 1DP7P 2HXOA 1FPQA 2XF6A 2QM3A 4ZC3A 4QLCU 3SEZA 2P7CB 3ZQ7A 3WU2C 2OF7A 2KRFA 4I7HA 4XLFA 1KYWA 2Z2SB 1Y39A 2OUMA 1BC8C 2YUSA 2JN6A 1Z7UA 3ULQB 4I0BA 3JR9A 3CUOA 1HW5A 1IRFA 1KU3A 4XN3A 2M8EA 1J75A 3FK7A 2PJRA 4XLAA 3JRFA 2CG4A 1ORKA 3QODA 4BE1A 1XPXA 1ETYA 2AO9A 1ETXA 4LGWA 1SFOJ 1UHMA 2BY3A 1LVKA 2ZXJA 2K9MA 1D0ZA 2MC4A 2DPDA 3HBLA 1FEXA 1ACIA 2PMUA 2CUEA 1P4AA 4BHPA 3CUQB 2EZKA 4EJTA 4KFCA 4CYDA 2JTVA 2LSOA 3K4NA 1S72I 1G6NA 2C6YA 2YSRA 3HSRA 1W0UA 1XMKA 4LD5A 4CCNA 5FB2A 2DPUA 2H6CA 5BNGA 1BL0A 5CVVA 2W48A 3H9QA 2ADUA 4U7BA 1MBEA 3SDGA 2Z33A 1R7JA 3LFKA 4EQQA 1OYWA 4C9YA 1ZLKA 2Y9ZA 2EK5A 4BY1J 2VI6A 4RLQA 2PMZN 1R36A 5FKLA 2CFOA 2DFHA 4YG2F 2A6TA 3REOA 2HKXA 1JKOC 4MTEA 1R4MB 3ZXSA 4CSWA 2QQAA 2QKMB 1QZEA 5DV5A 3S8PA 3TMOA 4I99C 2A6HF 2ELJA 1ZLJA 3BG5A 1WQ2A 4BE2A 2M34A 4I2OA 1FTTA 5HODA 2L0KA 4XOPA 2O8KA 2W84A 2B7EA 4A0XA 1XS9A 2JA7J 3I64A 5F0HA 2VBXA 1S9HA 3H1CA 1YIOA 3GBGA 5F27A 3DEUA 3KLOA 3CLOA 4GGGA 2IGNA 1GDTA 3HSFA 4L9NA 3TO6A 3OOPA 2JA5J 1Z1DA 5FKOA 2RKHA 2OC6A 4JOMA 2ME6A 3DKYA 4Y13A 4G7OF 5C4JJ 3CCSI 1QVUA 3BT9A 2LKXA 3H9GA 3K2AA 3HSEA 1UHWA 4F52A 3L1PA 1TL8A 1MDMB 3OYIA 3S3NA 1TNTA 1R49A 1H89C 3FXKA 1RNLA 1YOVB 3BCBA 3GTGJ 5IP6A 4M6VA 3RIRA 5FLVA 2ZJRF 1S7OA 4AIKA 4XSXF 2K3FA 4UNOA 3V7CA 5CVJA 3ERED 2MD0A 3SYTA 1ON2A 3ZRGA 1D0YA 1UELB 1OJLA 1W7PD 3I59B 1QZZA 4IHXA 1UHSA 3BOQA 2WA0A 5FLMJ 4PDKA 3N05A 3LAPA 2EFNA 2WAFA 4PZJA 2MG4A 3V7RA 3ZOBA 1PDNC 1ONVA 1Z6TA 1HXDA 2K9LA 3QAHA 2L01A 1U8BA 1RUOA 1R4NB 3HUGB 2KT0A 3DU6A 4ETSA 4HNVA 1Y6IA 3Q3SA 5E1XA 2XPWA 3GCMA 4I76A 2L4MA 2QQ9A 2IBDA 2R7RA 1FYMA 4PJNA 3HRUA 3W6JB 2XKPA 2QUFA 2R7ZJ 1VNDA 4UY8I 4MO7A 4GXOA 4L9TA 3L00A 2LTPA 4MTDA 2O6GE 1FTZA 1T56A 2FU4A 4IQ4A 4Y15A 5J4VA 2KISA 2DMTA 3GTMJ 3J7AO 1I1GA 2Y30A 3DBLB 3MMYB 2BY2A 1XX5A 3F22A 3C3WA 2M2EA 4BU2A 3EYIA 1ETOA 1RPWA 2M8GX 3G1OA 2DCEA 3RKXA 4EJOA 3GTPJ 1QPMA 2Z9OA 1FY7A 1YW8A 3FXUA 5J47A 2CUFA 3I71A 2K85A 1EA3A 3V8LA 3G1LA 1V54H 3UNGC 4Y3OA 4G7ZF 1G3WA 4Q4ZF 3HRTA 5EYRA 2HWVA 2DO7A 4R8HA 1PVEA 1P92A 5GP9A 3N97A 3GTLJ 3OIQA 4BBRJ 1U78A 1K4SA 3UKGA 1FP2A 1Z91A 1WSUA 3IV5A 1LEBA 1TP4A 1MDMA 3HJEA 3S1NJ 2DTZA 4RB2C 5JI6A 3CTAA 2RVCA 2VL8A 1MBJA 2XAQA 4BEHB 1V3FA 1HSJA 2ZB9A 1EKEA 4AUXA 4MIMA 4FASD 2A07F 4BKXA 5J8CA 3N4MA 3ABTA 2XAJA 1LFPA 1MBKA 1KQ0A 3I59A 1YI2I 1R58A 2HU9A 2IS6A 2EZIA 2WY7Q 3SZGA 1P6RA 1SVLA 3Q0UA 3SDBA 2DA1A 3ZMSA 3OYCA 2HOAA 1XGSA 4DBQA 4ENKA 2M87A 4BXUA 2CH0A 4IL6C 3H92A 2LKSA 1G3TA 1WZ2A 3TDZC 4YIFA 1ZRDA 2XDVA 2H09A 2WAQA 1K79A 4HX4A 4HV6A 2GXBA 1MNEA 4BQNA 2DA3A 2HQRA 2EB7A 3QU6A 2NVTJ 1MJ9A 2QBYB 5K5QA 1XC5A 3QU3A 2P6SA 3OY9A 3EPZA 4AYBN 2I5UA 5J3LA 2FJ1A 4FE4A 3PIOF 2XASA 3KP2A 3CP8A 1QO0D 5GTHC 3FXMA 4JP0A 2L7ZA 1RC9A 5DCMB 3NQOA 3MZYA 3F21A 3DP7A 4E7IA 2IS1A 2XB5A 3FXQA 5K5RA 4IQJA 2V6EA 3OOUA 3WTTC 2KIUA 1I3QJ 1WWXA 4Y33A 1FOWA 3RSNA 5TGTA 1HKQA 1X1BA 2VQCA 3W2VA 5JHFA 1FMVA 1G3YA 2GAUA 1JKRC 4RDUA 2E2JJ 2K9NA 1IJWC 3R60A 1U5TC 3ONQA 3M1EA 4D5FA 1E17A 2BW3B 2HYFA 4HEA2 1TWGJ 4BUPA 4HA8A 2R0QC 1NG7A 2G7HA 1VQ5I 4BS9A 3DTEA 4Q47A 2M45A 2MW8A 1IF1A 2ZCWA 4OIRF 2X85A 4OMZA 3JRGA 4C3JJ 3CZ6A 4KYWA 3C7JA 2DK5A 1V55H 1WI3A 1SAXA 1APLC 1XG1A 1S7EA 4FT8A 2LF8A 2MBFA 2ID3A 3AKZA 1FYLA 4OIOF 4XICA 3L7WA 1O57A 5LD2C 3SHFA 5HNHA 1G4DA 4A3IJ 2D45A 4IX7A 3VPRA 5FLXZ 2EINH 1GUUA 2RV8A 4YFKF 5HLGA 3S16J 3IH4A 4HAMA 4OWRB 1D1CA 2R7OA 2KPMA 3H9JA 3CCVI 1F43A 1T0FA 4CA0A 1R1UA 1FOKA 4QSHA 4HX7A 1R5HA 3CDLA 2ZSHB 1D1BA 2D5VA 2ISZA 3V4GA 4A93J 4L9VA 2AQEA 1H0MA 2IS2A 5BPDA 1I27A 2JPBA 3JAMK 3QYBA 5L3DA 2K27A 2M0CA 3ASNH 2JRMA 2LRDA 2KRHA 2HPIA 4LLLA 2EA2A 2RNGA 1PJRA 2KIQA 3T5XA 4U0VA 2H27A 1RKWA 2JSCA 4XORA 3K2ZA 9ANTA 1Y1WJ 2R7TA 2CU7A 4UVCA 1WKMA 2MLGA 4CHUA 2UXXA 3NAUA 2IS4A 1RRJA 4B43A 3FWEA 5CJ9A 1IW7F 2A68F 2K9QA 5J1RA 4HF1A 2GXAA 1BW5A 3KX2A 3WTXC 3J7ZI 2PMZA 2F5FA 5D6EA 4CCLA 1ZGAA 2PQ8A 3CDHA 3I58A 3LQQA 5E3MA 2ZFWA 1REPC 4HQEA 5CVRA 2ZMEA 1WJDA 3OWTA 2E5NA 1T95A 2BW3A 1Y0UA 1B1BA 1GV5A 5AIPA 4LK0F 2K9SA 1VZ0A 4F7ZA 5LEJA 3ZPLA 2R7WA 1Z9CA 3HTSB 3JSOA 2F5DA 2K5CA 3KEYA 2G7UA 5BMZA 5HDKA 1OMIA 2LY2A 3BROA 4RB1A 2W00A 2HTJA 3RKQA 4DYCA 2HOTA 5LGUA 2VUMJ 5EZHA 5HS9A 1D8KA 1FOXA 2COBA 1MBGA 1B6AA 1QQIA 2NYXA 4U0YA 2EFQA 4D9JA 4A3BJ 5M5XJ 3KP4A 2E1MC 2PBIA 1OCTC
chains in the Genus database with same CATH topology
3CCJI 5DM7F 2E36A 1VQLI 3CF5F 3DLLF 3CMEI 1VQ9I 1YHQI 3I55I 2E34A 5GADJ 3CCEI 2FOWA 3CCVI 3CC2I 1VQKI 1FOYA 3G6EI 3CCMI 1YJNI 3G71I 3CCSI 3CCLI 2OTLI 3CC4I 1VQ6I 1YI2I 1VQ7I 2NXNB 1YIJI 2ZJQF 5GAGJ 1VQ4I 2ZJPF 2ZJRF 1QA6A 2K3FA 2JQ7A 3G4SI 3J7YJ 1VQNI 3CMAI 4IOAF 2QEXI 1Y39A 3CC7I 3PIOF 3J7ZI 1YJWI 2OTJI 5DM6F 3CD6I 1MMSA 3PIPF 1VQOI 1VQ8I 3CJTB 1FOWA 1HC8A 2QA4I 5JVGF 4V19K 3CCQI 5GAEJ 4UY8I 1ACIA 4IOCF 1S72I 2E35A 1YITI 3I56I 4IO9F 5GAHJ 1VQMI 1YJ9I 1FOXA 1VQ5I 3CCRI 2H8WA 3CCUI 1VQPI
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3CCJ I;  5DM7 F;  2E36 A;  1VQL I;  3CF5 F;  3DLL F;  3CME I;  1VQ9 I;  1YHQ I;  3I55 I;  2E34 A;  5GAD J;  3CCE I;  2FOW A;  3CCV I;  3CC2 I;  1VQK I;  1FOY A;  3G6E I;  3CCM I;  1YJN I;  3G71 I;  3CCS I;  3CCL I;  2OTL I;  3CC4 I;  1VQ6 I;  1YI2 I;  1VQ7 I;  2NXN B;  1YIJ I;  2ZJQ F;  5GAG J;  1VQ4 I;  2ZJP F;  2ZJR F;  1QA6 A;  2K3F A;  2JQ7 A;  3G4S I;  3J7Y J;  1VQN I;  3CMA I;  4IOA F;  2QEX I;  1Y39 A;  3CC7 I;  3PIO F;  3J7Z I;  1YJW I;  2OTJ I;  5DM6 F;  3CD6 I;  1MMS A;  3PIP F;  1VQO I;  1VQ8 I;  3CJT B;  1FOW A;  1HC8 A;  2QA4 I;  5JVG F;  4V19 K;  3CCQ I;  5GAE J;  4UY8 I;  1ACI A;  4IOC F;  1S72 I;  2E35 A;  1YIT I;  3I56 I;  4IO9 F;  5GAH J;  1VQM I;  1YJ9 I;  1FOX A;  1VQ5 I;  3CCR I;  2H8W A;  3CCU I;  1VQP I; 
#chains in the Genus database with same CATH topology
 1TZL A;  4N4O B;  3E7L A;  1KU2 A;  3IHU A;  2A05 A;  1IV8 A;  4MEY F;  3PJR A;  2IA1 A;  1XD7 A;  3HHG A;  2Y2Z A;  2ZJ2 A;  1IUF A;  4F3Q A;  1AHD P;  2VLA A;  3HGG A;  3E5Q A;  2JZY A;  2W4S A;  1MMN A;  2R5Z B;  5GAD J;  4KT5 C;  4PUS A;  1A36 A;  5F08 A;  3HOV J;  5IYC J;  2V7F A;  3BWG A;  5HNF A;  3GFM A;  4C3I J;  3MN2 A;  2MA3 A;  3JRC A;  2KDO A;  3DTI A;  4XKW A;  3BQZ A;  1VQK I;  5D5W B;  3PL8 A;  1D1A A;  1I3A A;  1V5E A;  3SFZ A;  3K69 A;  3U21 A;  4A3K J;  1MD0 A;  2L9N A;  4WWC A;  3ZQG A;  3D5S C;  2DTR A;  5KCM A;  2JRT A;  4ZYG A;  1EJ9 A;  2XGC A;  1U2W A;  1LQ1 A;  3CCL I;  3JRE A;  5B1B H;  2VAS A;  2H1L A;  2EFP A;  5D8K B;  2JT1 A;  4IXA A;  1SFK A;  3GFJ A;  4UHT A;  2DDB A;  2UUZ A;  1YIJ I;  2OV7 A;  2E71 A;  3AG2 H;  4H0E A;  1BOB A;  4II2 A;  2V9K A;  2CQQ A;  1ZG3 A;  5KNL A;  3ZMD A;  4M9X A;  2CW7 A;  2F48 A;  1MND A;  2HNH A;  4KDP A;  1MSE C;  2KHM A;  3BR2 A;  4ESB A;  2XSD C;  1X19 A;  3S3O A;  1CF7 B;  1VI0 A;  4C30 A;  4O6J A;  2KFD A;  2JK3 A;  4DBR A;  1WH5 A;  3S3M A;  3JTH A;  2KZG A;  2HQA A;  5DM6 F;  5IPA A;  2L7F P;  2R7U A;  2ZNZ A;  4KIF A;  1ZTR A;  5DUK A;  4U88 A;  1VFC A;  1VQO I;  4QPO A;  2HGC A;  1EF4 A;  3ZMU A;  3LOC A;  4HW0 A;  2NOJ B;  1D5V A;  2ZO4 A;  1LPQ A;  1OQY A;  2E1C A;  3I5U A;  5CVU A;  1IO2 A;  2M4K A;  2VBZ A;  2XF7 A;  4ZYA A;  2BVM A;  2JUG A;  3PQJ A;  1YYV A;  2DU9 A;  3ZMV A;  3QRF F;  4XOT A;  1UZC A;  3ECO A;  4Z2Y A;  2IPQ X;  2XPU A;  2HYJ A;  3FMS A;  4L0Y B;  2K4J A;  2W85 A;  4A3C J;  4PGG A;  1FBU A;  5KHD A;  3OYJ A;  4HF0 A;  1GV2 A;  1YX3 A;  4IKF A;  3FDY A;  2LBF B;  2CYY A;  2HXI A;  3F8B A;  2R5Z A;  3BTL A;  4GCV A;  4HST A;  2OD5 A;  3HPG A;  5D8L B;  1G2H A;  3F8N A;  4HX8 A;  5JFR A;  3HEF A;  4NBQ A;  3E6C C;  4CZZ A;  1ZGJ A;  2HI3 A;  3EUH C;  4HQM A;  3G3Z A;  3IRQ A;  2AHQ A;  3TGN A;  2ECC A;  1M1E B;  3HB9 A;  2L7M P;  4BH9 A;  4XM3 A;  3IWF A;  2VBY A;  4BGD A;  1UAA A;  5EGO B;  4ITV A;  2PJR B;  4CXF A;  1QU3 A;  3S14 J;  2RNJ A;  3AG3 H;  5FD5 A;  5GTI C;  3I55 I;  5J1Y A;  1GLN A;  5E1Z B;  2VN2 A;  1SMT A;  5JLW A;  1JUS A;  2KJB A;  4KN4 X;  4AYB A;  2Q0O A;  3PUF A;  2XUB A;  3OYG A;  5ED4 A;  1F5T A;  1BA5 A;  2EIJ H;  1MBF A;  1BN5 A;  3K6G A;  1Y8R B;  4XID A;  4MFD A;  2OCC H;  3H3V K;  4X1E A;  1I50 J;  5DS9 A;  2HQ5 A;  3OYE A;  1J7K A;  2STT A;  1VF9 A;  1XSD A;  3H35 A;  1YW7 A;  1LDJ A;  3J81 K;  4L5I A;  3CCM I;  3G71 I;  4XR6 A;  3GZN B;  2G0E A;  4GO1 A;  4YII A;  3MKW B;  1UB9 A;  2WV1 A;  1OCO H;  2X9D A;  3CJN A;  3M8E A;  1CF7 A;  1JKQ C;  4A0Y A;  4LLG F;  3LA7 A;  1EH7 A;  2HZT A;  4OAY A;  4BBS J;  3ZQI A;  1XMA A;  1BW6 A;  2BGC A;  2KIM A;  3HOW J;  1YO5 C;  3S2W A;  4NDL A;  3OYH A;  4IRI A;  3W2W A;  1T39 A;  4RLF A;  1KU9 A;  3EET A;  3IC7 A;  1BI3 A;  1EV7 A;  2VQH A;  4ESF A;  1RI7 A;  3LSR A;  1ZYR F;  5D4R A;  3OYB A;  1ZG5 A;  3GUD A;  4EEF G;  5L3F A;  4N4N B;  1PUF B;  5CQE A;  5EEG A;  3W6K B;  1WJF A;  2OTJ I;  2ZXI A;  1E3O C;  3K0L A;  1FNN A;  4NC7 A;  4ZZD A;  1VTN C;  2EJR A;  2VQG A;  2NRA C;  2ME0 A;  2KZV A;  4F55 A;  1GVD A;  3VYR B;  4LIV A;  1X3W B;  4IHV A;  4B48 A;  4XRF A;  2W1O A;  1W5S A;  3GWZ A;  1ZAO A;  1R1V A;  3CJT B;  3I0T A;  1HBX G;  3O6B B;  4M3F A;  4MQ9 F;  1XB4 A;  4LIU A;  1WJA A;  2LBF A;  5DUI A;  3P9C A;  4FE7 A;  4U0W A;  1SC7 A;  4RM3 A;  1ETQ A;  1RZ4 A;  1K7A A;  2VXD A;  2RDP A;  3PUB A;  2ISY A;  3QYE A;  4RS8 A;  2BE5 F;  1YIT I;  2OQR A;  2HOS A;  2BBY A;  5JHU A;  3WU1 B;  4BQQ A;  1QZY A;  3OMY A;  4A3G J;  2VBW A;  1SEU A;  3P9K A;  1VQM I;  1JXS A;  2DT5 A;  4D1Q A;  5EGO A;  3BTI A;  1JGG A;  1PUE E;  4B8X A;  3G2B A;  3JCU C;  2XHK A;  1KZH A;  4CDG A;  2EIK H;  5IT3 A;  5AIQ A;  4KIG A;  4LG3 A;  2QSG X;  3ZQC A;  2IT0 A;  1HST A;  3R61 A;  4QIW N;  4UUS B;  3WTY C;  4A3E J;  4I02 A;  2ZNY A;  2L9V A;  4L5J A;  1SAU A;  2G9W A;  1VQ9 I;  4HLY A;  5J8F A;  4C2U A;  2RC4 A;  1W1W E;  2HKO A;  5LHH A;  1HW2 A;  4FX0 A;  3C1D A;  1IDY A;  1HLV A;  5E20 A;  5ICG A;  2A5W A;  3S15 J;  5DDG A;  5EF6 A;  3CC2 I;  1B9M A;  1AWC A;  3VSL A;  4G94 A;  2GOM A;  2CGP A;  1E3H A;  2LY1 A;  2ID6 A;  4IEJ A;  4P9U A;  4QPQ A;  3TL4 X;  1IN8 A;  3LNQ A;  1BI0 A;  1QRY A;  3GZ6 A;  2GA1 A;  2I8D A;  3OIO A;  2X6Y A;  2Q1Z B;  1TNS A;  1Z67 A;  5HLH A;  3WTS C;  1PP7 U;  2FNP A;  3HOT A;  2BY0 A;  4JQF A;  4XMY A;  1ENH A;  1VQ4 I;  2M9H A;  2QZ8 A;  1PUF A;  1ZKG A;  1LFB A;  4EAT A;  4O3M A;  2LH9 A;  4HOB A;  4A3J J;  4PJ0 C;  3RPU A;  2FA5 A;  1YLF A;  4Z6Y A;  1ETW A;  2DT7 B;  3A0B C;  3OYM A;  3ZQQ A;  4G6Q A;  5KAF C;  1KQ8 A;  3W3C A;  4ANJ A;  3OYA A;  2OA4 A;  1T8I A;  4LG0 B;  3GZ5 A;  3ZN0 A;  4BQA A;  4B3X A;  2MH2 A;  4PFP A;  3SEQ A;  3JRH A;  3VYT B;  4L18 B;  2GBY A;  1DPR A;  2MGQ A;  4BNC A;  3KZZ A;  2UZK A;  3OYD A;  3CD6 I;  1ETK A;  3E6B A;  4E7K A;  1FYK A;  1BR2 A;  5CLS A;  1JUM A;  1X1P A;  3MCZ A;  1A04 A;  2P81 A;  3EUK L;  2IGK A;  4BXF A;  1O3S A;  2JSP A;  2KIF A;  1ZR4 A;  3WE3 A;  4I0A A;  4IJA A;  1T08 B;  3FXL A;  4XLE A;  1QHH D;  5GAE J;  2JVH A;  3M8F A;  2P5L C;  4J00 A;  1BC7 C;  1MH4 A;  2UWM A;  1X1A A;  3BR3 A;  4IRG A;  4DIQ A;  2V9P A;  2P6T A;  2X6O A;  4L0Z B;  5LGN A;  2ESN A;  2M0M A;  2PFB A;  2XF5 A;  4WF2 A;  4UUS A;  4RB3 C;  1SD7 A;  4D5C A;  2EBI A;  3MZH A;  4GYG A;  2H1K A;  2K3P A;  4RA2 A;  4A2U A;  5KAI C;  2L02 A;  2H94 A;  3CCR I;  3HOY J;  2H8W A;  3AL0 B;  2VB6 A;  2GXG A;  3CCU I;  3DFG A;  2P4W A;  2VKV A;  3CUQ C;  2HDC A;  3E1S A;  4XLP F;  3GW2 A;  3JSP A;  2FRH A;  1VQP I;  3SZP A;  1POG A;  3S17 J;  2YS9 A;  3MFK A;  2PJP A;  2LOO A;  1WRJ A;  4HPQ A;  2VON A;  5C4X J;  2FQ3 A;  5FO5 A;  1FP1 D;  2W57 A;  4G6T B;  5FRM A;  2DQR A;  3KEO A;  1T38 A;  3PM1 A;  4A6D A;  3K9T A;  1IV6 A;  3H36 A;  4WK8 F;  3HOS A;  1BBY A;  5HLI A;  3LAJ A;  2W25 A;  4BDZ A;  3CES A;  1MGT A;  3M7G A;  3VSK A;  3B02 A;  3WG7 H;  2K40 A;  4X0G A;  2P5V A;  3GTQ J;  4AIH A;  3QOP A;  2Y0S N;  5F1J A;  1ZQ3 P;  1YS6 A;  4M3D A;  4U87 A;  1BR4 A;  4G9Y A;  4E7Z A;  1KA8 A;  2EIL H;  3RZD J;  3ZP5 A;  1I6H J;  1SD6 A;  2O0Y A;  4A5M A;  2Z16 A;  5KVR A;  5LGT A;  3CC4 I;  1VQ6 I;  5ICF A;  3QPL A;  4XRS A;  3R0J A;  1J09 A;  4S0H B;  4P9F A;  3JAM Z;  4R79 A;  4LG0 A;  5JR3 A;  3FXR A;  1RKT A;  1W7P A;  2PEX A;  1IN5 A;  2ZJQ F;  2O3F A;  5F1R A;  3M8J A;  3FM5 A;  2R7X A;  1R5I D;  2HZD A;  1JHF A;  2DW4 A;  3A0H C;  3I9V 2;  1U5T B;  4EM2 A;  4WXC A;  1V4R A;  4BDY A;  2LR8 A;  3LA2 A;  1S5L C;  3GYH X;  3WTZ A;  2F4I A;  1B8I A;  3F3X A;  2X6W A;  4E7L A;  1JT0 A;  1HA8 A;  2Y69 H;  2QKL B;  3QYF A;  2QEX I;  2QVO A;  1TWF J;  4G7H F;  2COM A;  2M1B A;  4CCJ A;  3MD2 A;  1X4P A;  5ERI A;  4LB6 B;  2AQF A;  3F72 A;  3TQN A;  2JJ7 A;  1SD4 A;  2OBP A;  1OCP A;  2DAO A;  3KLN A;  5IP9 J;  1DUX C;  4A3L J;  1NTC A;  4YRV A;  5KK1 A;  2E7W A;  1IXR C;  3DLA A;  3UR3 C;  1SVM A;  3L09 A;  2OAZ A;  3TP0 A;  1IZ1 A;  3FXJ A;  4YEL A;  2HS5 A;  1OCC H;  4MFE A;  2PN6 A;  3F6V A;  1JTX A;  4FQG A;  2JMW A;  3CCQ I;  4V19 K;  3VWB A;  4HNU A;  1DQU A;  2IW5 A;  2A69 F;  3SJM A;  2M4G A;  2Q8K A;  3Q0W A;  3QOE A;  2O61 A;  1WVR A;  1QVT A;  2LY9 A;  3GF2 A;  3DV8 A;  2DDA A;  1NG6 A;  2D1V A;  2FXA A;  4BYY A;  3E6M A;  2WB1 N;  1J2X A;  3OV8 A;  2Y75 A;  3BG9 A;  3GFI A;  2F4M B;  1IGN A;  4KIC A;  5IT9 K;  1Z05 A;  3BLY A;  3EYY A;  4KIT B;  4HG2 A;  2CWE A;  3BQY A;  1QHG A;  3M9A A;  2R3S A;  2F2E A;  3RKY A;  4BJ6 C;  2E7X A;  1FIA A;  1OLT A;  1W4M A;  4A3F J;  3U1D A;  1IXS B;  1T98 A;  2ETH A;  2R7D A;  3BZC A;  2IVM A;  3BR0 A;  2E1N A;  2ZME B;  3CMM A;  1B4A A;  4MLO A;  1LKX A;  1Z3Y A;  3HOZ J;  3HYI A;  1MH3 A;  4F93 B;  1GVJ A;  2ELK A;  4PSW A;  4PGH A;  4V2F A;  1XGN A;  4NC8 A;  2CMP A;  1U5T A;  4OU0 A;  4GYI A;  1HKT A;  5E3L A;  4ZTF A;  1H9G A;  1L0O C;  2WTE A;  4XBF A;  3ZGK A;  2YX7 A;  3DBH B;  4IHY A;  2IAI A;  5AON A;  5HS7 A;  2R7Q A;  1KU7 A;  3LSI A;  4M9Z A;  5E3N A;  2VPR A;  2XKO A;  4AC0 A;  2Z5U A;  3PO3 J;  1G3S A;  1FC3 A;  3GTJ J;  4Y7N J;  4E7J A;  3HOX J;  1OR7 C;  2P5K A;  4CYC B;  3L2Q A;  4M6X A;  2CO5 A;  1TWC J;  3CMA I;  4UB8 C;  2XRL A;  5FD6 A;  3U1K A;  1SMY F;  4ENN A;  1HQC A;  2E1M B;  2FML A;  3CC7 I;  4BL0 B;  3H0D A;  3F23 A;  3LMM A;  1ZG1 A;  3MZ8 A;  2Q2E A;  1TWA J;  3KIO A;  4JYK A;  3Q5F A;  3MWM A;  4EMS A;  4Q5S F;  4IPA A;  2EQR A;  3P5J A;  5ILU A;  1TT0 A;  3TDU C;  2EPF A;  2O5R A;  2VJ5 A;  3FK6 A;  4XKB A;  2WBM A;  3E6D A;  3WTU C;  1J5Y A;  2LK2 A;  2XGE A;  1OFC X;  3LSK A;  3Q9S A;  3C2G A;  3L2C A;  3LSP A;  4EM1 A;  1N78 A;  2DMQ A;  2DJI A;  3HXL A;  2VT2 A;  2BXY A;  3CO7 C;  5BOX A;  3BG6 A;  2K02 A;  4RMN A;  2L9S A;  3LQR A;  2NS0 A;  1OKR A;  2HTS A;  3M07 A;  4AID A;  3VDX A;  2GZW A;  4P1W A;  1R6R A;  3NWT A;  2XSJ C;  2DK8 A;  4AD9 A;  2FBH A;  2RRE A;  5EG0 B;  1H88 C;  4DZP A;  4P55 A;  4JBA A;  3ZN1 A;  1UG0 A;  1V5F A;  3W6V A;  4S04 A;  3S1R J;  1WPK A;  2MSY A;  3BPX A;  1HOM A;  2WY8 Q;  2D1H A;  5DYM A;  4ENM A;  1JKP C;  1D3Y A;  1I1S A;  4PSX A;  1WGX A;  5A2Q K;  2NVQ J;  3D1N I;  4A0Z A;  1SAN A;  4DYQ A;  2BY1 A;  3K7A J;  2FE3 A;  2DOF A;  2DFF A;  3CF5 F;  1SFU A;  3E5U A;  2LYC A;  3H0G J;  1SFX A;  4M3E A;  1X1C A;  3OSF A;  1LNW A;  1Z0X A;  2FSW A;  3CME I;  1TW3 A;  3B6C A;  3SXY A;  3ELK A;  3L2V A;  1OPC A;  4PCQ A;  3MKZ A;  5HS8 A;  3PNY A;  4UUT A;  3BC8 A;  1HF0 A;  3RQ4 A;  1QGP A;  3A01 A;  1Y56 A;  3FHN A;  4P96 A;  5D5U B;  3ZR8 X;  1FWZ A;  3HKZ N;  4D7N A;  2UV1 A;  3LSG A;  1IN4 A;  3BY6 A;  2EH3 A;  5M3M J;  4PK4 A;  2L2O A;  5BPI A;  1Y0N A;  3TO9 A;  3J81 Z;  2R7S A;  2FD5 A;  3K1N A;  4CYC A;  3MAJ A;  3I4P A;  2XRO A;  2HVS A;  1JE8 A;  1BOA A;  3S1Q J;  1OCR H;  4L5E A;  1VQ7 I;  1TWH J;  3HDD A;  3E3V A;  5CQG A;  1V5G A;  2XIG A;  2GIZ A;  4NNJ A;  2DYS H;  3ECH A;  4J19 A;  3FMQ A;  3HTU A;  3HHH A;  2LNB A;  2D2W A;  3R4K A;  3RYR A;  1K6O A;  3RDI A;  1MW7 A;  2QEN A;  1WJE A;  4A69 C;  3S32 A;  4EM0 B;  4O5V A;  3WOD F;  3J7A Y;  2HVR A;  4WCG A;  1P7I A;  3B6A A;  3B73 A;  4E7H A;  3QPS A;  2HYG D;  5CYV A;  1Y8Q B;  3HG9 A;  4DW6 A;  4OIP F;  2B63 J;  2VOD A;  4NHJ A;  3VYU B;  4RGR A;  2LD5 A;  3HGY A;  2H6B A;  1Z3X A;  1E0E A;  2MYS A;  2CV2 A;  3D5R C;  4A6E A;  2X1E A;  3U9G A;  2CRG A;  3CP2 A;  4KMU X;  2YPR A;  4M73 A;  3GVA A;  5EG0 A;  2FMY A;  4NC6 A;  2X1D A;  5K7Z A;  5B66 C;  2V1D A;  2F5V A;  3A02 A;  3KPH A;  4GRI A;  2ZBK A;  3CQZ J;  2W24 A;  3X2Q H;  5LBQ A;  1BIA A;  4B47 A;  2E35 A;  3I56 I;  2DOD A;  2MH9 A;  2DMU A;  4MEX F;  1ON1 A;  3I4N J;  2VXZ A;  2R5Y A;  1HDD C;  2ESH A;  2JA6 J;  1YJ9 I;  5F64 A;  1W5C C;  1MIJ A;  4RBO A;  3OYL A;  1RES A;  5DTD A;  5K5O A;  3WHC A;  1RUN A;  2O8X A;  3BTJ A;  3H3U A;  3NWS A;  2DMN A;  4AWX B;  3KYD B;  5EDN A;  1UG2 A;  4IVN A;  1CGP A;  2FF4 A;  4B1R A;  2P0W A;  2WAE A;  1IN6 A;  2GWR A;  4G8X A;  1LDD A;  4IHS A;  1ZRC A;  4CIC A;  3ABK H;  2X6X A;  2ELH A;  2HPM A;  3IKT A;  1TW2 A;  1XGM A;  4UUV A;  4MNU A;  2JA8 J;  3QP5 A;  5LRS A;  4UV9 A;  3HPH A;  3ZCO A;  3ZQL A;  4XSZ F;  3A1Y A;  3Q0V A;  3H5R A;  2DJN A;  3FKJ A;  3QWL A;  3T8R A;  2JPC A;  4A3D J;  3CCY A;  5LRR A;  1PYV A;  2BYV E;  1Q1V A;  4AVP A;  3VOE A;  5FRN A;  4Y4R A;  1LB2 A;  2BHY A;  3DXJ F;  4ASN A;  2AXL A;  4BJT A;  4CCO A;  3WTW C;  1O7L A;  1K78 A;  3RZO J;  3H5A A;  2KQR A;  4XLN F;  4M3G A;  3A03 A;  3TO7 A;  1Z7L A;  3EUH A;  1NK3 P;  2BZT A;  1MZB A;  1T6S A;  2YX4 A;  4LIT A;  4UXN A;  2FBI A;  3MQ0 A;  5J40 A;  5TRD A;  4PJM A;  3TW7 A;  5F04 A;  2VJI A;  2VOO A;  3QQA A;  1TBX A;  3K4K A;  2VOP A;  4HDU A;  4FHT A;  4IOA F;  2L3D A;  2ZFU A;  2BXZ A;  2AS5 F;  2KL4 A;  3K70 D;  4OIQ F;  1MMD A;  1S3J A;  1K61 A;  4N9H A;  2LDU A;  2LG4 A;  3RKW A;  4WXH A;  1YJW I;  3F8M A;  3L9F A;  3H5N A;  3O8H A;  4ENJ A;  1S29 A;  2IGM A;  3CJR B;  1BR1 A;  5FFZ A;  3PIP F;  1ZK8 A;  2DMP A;  2NAZ A;  4E4H A;  1VQ8 I;  1B72 A;  1PP8 F;  4WX9 A;  2GIV A;  3LA3 A;  1HC8 A;  2DA6 A;  5ILS A;  3ERM A;  2X1C A;  5JVG F;  3DKW A;  2IXS A;  4ZDP A;  5HOO A;  2STW A;  1HKS A;  3ZMZ A;  1JUP A;  4HYE A;  1ITY A;  2IJL A;  2AXT C;  4IOC F;  2F6C A;  2PG4 A;  2RGV A;  5J1U A;  3C2H A;  4OMY A;  1EH6 A;  1W5T A;  1U9O A;  4C2M J;  2X4H A;  2OU2 A;  1YW9 A;  3RJP A;  1D0X A;  1WH7 A;  3IRR A;  2HVQ A;  2OPT A;  3GX4 X;  1NH3 A;  3GEZ A;  4F92 B;  2HFH A;  3BPV A;  3EUA A;  3ZQF A;  5BQT A;  1FIP A;  1O3R A;  4CUG A;  3CCJ I;  3EDP A;  3HC7 A;  1VQL I;  1WI9 A;  3BP8 A;  3COA C;  2IA2 A;  3AAF A;  5IYB J;  1WHU A;  2VKD A;  2XVC A;  3DLL F;  4DQ2 A;  4IRH A;  4LLN A;  2KJC A;  1SD5 A;  1X2M A;  4AM3 A;  4GDF A;  2FOW A;  1K4T A;  4EVI A;  4G12 A;  1S6L A;  2NVY J;  3AG1 H;  1ZN2 A;  1ZGW A;  3C2B A;  3V7S A;  4BAC A;  1E3P A;  2RN7 A;  2XAF A;  2TDX A;  3NAR A;  4U7D A;  1O4X A;  4HDV A;  5FRO A;  3RYP A;  2DI3 A;  3G6E I;  2DBB A;  3ASO H;  3ZMT A;  3J80 K;  2BEO A;  1MBH A;  1TC3 C;  3BJO A;  1MKM A;  4RGS A;  5DCF A;  3ESW B;  1YX5 A;  2EV5 A;  2MD5 A;  2LMD A;  5M5Y J;  3RPU D;  3VB2 A;  2CV1 A;  1BM9 A;  1TT5 B;  1XCV A;  2A6E F;  4RB0 A;  3KP7 A;  3PFI A;  1BI2 A;  2VE8 A;  4YEJ A;  4ZYH A;  5ICE A;  5LEK A;  3HRS A;  3BG3 A;  3ZQH A;  4MGR A;  3WG9 A;  4LJZ F;  4ZDO A;  4J01 A;  1I6X A;  2R4G A;  1CQT A;  3FBI B;  2JQ7 A;  2M30 A;  2EV6 A;  3G4S I;  4CCM A;  1NK2 P;  1HW1 A;  5F0F A;  4IF4 A;  1VQN I;  3V42 A;  1IRX A;  3AG4 H;  3K4L A;  3PQK A;  1T2K A;  4BAY A;  2Z3Y A;  2XC7 A;  1FBQ A;  2LKP A;  4M74 A;  2QWW A;  4YFX F;  1H8A C;  1X4O A;  2EZL A;  3ISP A;  3S93 A;  2EWN A;  2GQQ A;  2XAH A;  3RQI A;  1AU7 A;  1ZRE A;  1TQP A;  1OIS A;  4RAG A;  2LC2 A;  3RTR A;  5B5E C;  5FGM A;  2L5Q A;  1BI1 A;  2E2I J;  4KUM A;  2O7O A;  2OCE A;  5M3F J;  1D8J A;  1S8N A;  1TLH B;  1UFM A;  3FXO A;  4KT6 A;  3W2A A;  3FX3 A;  2V1X A;  3ABU A;  3S2D J;  2TCT A;  3OYK A;  3BDD A;  3PSI A;  2CQ7 A;  1WFX A;  3T8T A;  1B9N A;  2PX9 A;  1W7P B;  1MJB A;  3HKZ A;  1YS7 A;  3EQL F;  1Z6R A;  3FMR A;  4YFN F;  5L3G A;  5L3E A;  2R7V A;  3ABM H;  1IRG A;  3QPT A;  4EGZ A;  4RM2 A;  5E18 F;  2DFI A;  4OOI A;  3IH3 A;  5HDG A;  1B8I B;  3PSF A;  3GTO J;  2CSO A;  5JVT A;  5IT9 Z;  3GFL A;  1LE8 B;  3AFH A;  1A6I A;  3IL2 A;  5E8I A;  4HF2 A;  3FIS A;  3DEE A;  5ILV A;  3K1P A;  1J0R A;  2LVS A;  5D6F A;  3MKL A;  2QYO A;  2HR3 A;  3DPU A;  3QPH A;  3L2U A;  1OYI A;  2CQX A;  2IRF G;  5IP7 J;  2KMU A;  3I54 A;  2QSH X;  3M1C A;  1JT6 A;  2QSF X;  3CCE I;  1QBJ A;  4FIS A;  3I3L A;  4MHG A;  3IAS 2;  2X48 A;  5DD8 A;  2Y48 A;  3DPL C;  4FTH A;  4BJ5 C;  2YU3 A;  1YRN B;  3KE2 A;  1IG7 A;  3E0J B;  3OYF A;  1GXQ A;  5IOZ A;  2HEO A;  2ECB A;  2EFO A;  1YJN I;  2KKO A;  1KGS A;  2F5E A;  2LP0 A;  1ZR2 A;  1YQA A;  4XON A;  1X3Z B;  2NS7 A;  3MVP A;  2B9S A;  3WTV C;  4Y52 J;  2RQP A;  1P7J A;  2NXN B;  3VFZ A;  4YIR X;  4JK1 X;  3CUQ A;  3KP3 A;  2DQL A;  1MSF C;  2E5Z A;  5GAG J;  2DYR H;  3KYC B;  3A4C A;  4NUB A;  1X58 A;  4EV0 A;  5EJC A;  5M5W J;  2QQ8 A;  2DLL A;  4GFB A;  2E1O A;  4B3A A;  2DXI A;  1R71 A;  3J7Y J;  3WGH A;  2Z99 A;  1DGR M;  3T0Y A;  4XNF A;  1F1Z A;  2DA7 A;  5C44 J;  4NQW B;  2FOK A;  3IH2 A;  1FSE A;  3LSM A;  2KDZ A;  4NB5 A;  2KRC A;  3BJA A;  2BV6 A;  1FLI A;  2VIX A;  5K7F A;  1MMA A;  1W0T A;  5EZG A;  4HBL A;  1H9T A;  4RGX A;  5C3E J;  2OJE D;  2L54 A;  2PLY A;  2M5W A;  2DT6 A;  3G1M A;  5K1Y A;  1ULY A;  1JJ8 C;  3LSJ A;  1UMQ A;  1RR8 C;  1DU6 A;  3D0S A;  2QCO A;  5JLX A;  1SFE A;  1X3U A;  2CQK A;  4KMF A;  1HCR A;  2IA0 A;  5H20 A;  4BE0 A;  2K86 A;  1LE8 A;  4EJU A;  4XKV A;  2NNY A;  4II3 A;  1STZ A;  1OCZ H;  1IXC A;  1U0J A;  4UV8 A;  3VOD A;  2PMH A;  4RAY A;  2WAD A;  2RQQ A;  4C3H J;  2E60 A;  2Y31 A;  4XLC A;  2UXN A;  4ZDL A;  5EEA A;  3L2R A;  1A31 A;  2OZU A;  4F91 B;  1K6Y A;  3QP6 A;  4ESJ A;  4FX4 A;  5A2Q Z;  3GO5 A;  2L7K A;  2E36 A;  2L4A A;  3O8G A;  4KIB A;  4H4K C;  4XQF A;  1JGS A;  3IAM 2;  5CVI A;  2Q2E B;  3ML6 A;  2R92 J;  1JTY A;  4DGW B;  4UB6 C;  2MLK A;  4FET A;  4Q48 A;  1YRN A;  3AL0 C;  1ZAR A;  3LL7 A;  2DA4 A;  2VQL A;  3CMY A;  2E34 A;  2BOL A;  4HZF A;  3CDI A;  3BG7 A;  5J4Y A;  2LRE A;  1A35 A;  1RIO H;  3BZK A;  3P7N A;  4LOC A;  1Z77 A;  1BIB A;  4IZZ A;  5LHI A;  3HUG A;  1AKH B;  5H6Q A;  3V8J A;  1C0W A;  2E2H J;  1FOY A;  2OZ6 A;  2XGD A;  3LST A;  2EIM H;  5CPR B;  3DEW A;  5LHG A;  3FBN B;  4I98 B;  3LFU A;  1IDZ A;  1ZRF A;  1P9Q C;  2QLZ A;  3IP4 B;  3PFY A;  1WJ5 A;  1S7A A;  2OTL I;  1XTA A;  5F0C A;  5LFA A;  5DEQ A;  3CF2 A;  2IP2 A;  2CUZ A;  3JRB A;  4A5N A;  3OSG A;  4XLH A;  2CV0 A;  3DBR B;  4NQW A;  4I6Z A;  1UJ8 A;  1ZEL A;  3KZY A;  1G59 A;  4DYR A;  1LEA A;  2FX0 A;  1QA6 A;  3PNV A;  4HRI A;  2ZXW H;  4D7M A;  4LK1 F;  5GPA A;  4CO8 A;  3M3Y J;  3K4M A;  3F9K A;  3T1B A;  1YG2 A;  1R22 A;  6PAX A;  5HVQ C;  5FJ8 J;  4ZZL A;  1F4K A;  4AIJ A;  3HZJ A;  2NVU B;  2XGX A;  3F8F A;  3CLQ A;  1IAW A;  2XPV A;  3FZV A;  4KJZ A;  4JX4 A;  3A01 B;  3I4M J;  3JRI A;  3MEX A;  3IUO A;  1B59 A;  2CW8 A;  4IHT A;  2O03 A;  4BHB A;  4M9S A;  2VC1 A;  2XB0 X;  1UCR A;  1DGW Y;  2TRT A;  2JWT A;  4XKC A;  1R00 A;  1XDU A;  2VKE A;  2QA4 I;  5BS6 A;  5IY5 H;  3TBI A;  3OYN A;  5D5X B;  3KP6 A;  3LSH A;  5HDN A;  1T0F C;  2E19 A;  4BEH A;  3BR6 A;  4RAF A;  4BQO A;  3GTK J;  3KET A;  3WGI A;  4C2T A;  1GT0 C;  2NOG A;  4E70 A;  3ROU A;  3H3Z A;  3DQV C;  4W1U A;  1OR7 A;  2WC2 A;  2JUC A;  3FKI J;  3TOA A;  3P9I A;  1P4W A;  2GA2 A;  2O9L A;  2P7V B;  1O3Q A;  2LLK A;  1O3T A;  1TQM A;  3U2R A;  3OS1 A;  4HSR A;  4IHW A;  5B1A H;  4E7S A;  3O3K A;  1JHH A;  4I09 A;  5D4S A;  3SZT A;  2M7A A;  1AKH A;  3TOB A;  1K83 J;  2HDW A;  1USS A;  3TW6 A;  2I10 A;  2QBY A;  1I39 A;  2CFX A;  4X6A J;  5J6X A;  2M7B A;  4XN0 A;  2V26 A;  3HM5 A;  1P2F A;  1Z21 A;  3D5L A;  3DPT A;  2ICW G;  2JA2 A;  4XK4 A;  1XDS A;  2CW0 F;  3OR1 C;  4P5O A;  5DCM A;  2VKH A;  1DDN A;  1BJA A;  2YU9 J;  2VT3 A;  3RPQ A;  2ZME C;  2ZSI B;  1Y1V J;  4ABZ A;  4W97 A;  1TTY A;  1ZHF A;  1R9T J;  3OS0 A;  3C18 A;  1E2X A;  2HOE A;  2RAE A;  4ZJZ A;  2R5Y B;  2F4O B;  2H8R A;  3WHB A;  3FHZ A;  4JX6 A;  3OIP A;  1IUY A;  1FBS A;  4R1H A;  4G6D A;  1XSX A;  1EH8 A;  2FNA A;  4B09 A;  5D5V B;  4AU7 A;  2CUJ A;  2A5Y B;  1R23 A;  4A12 A;  1QNT A;  1UST A;  2DN0 A;  4BY7 J;  3Q9V A;  4AVZ A;  3F8C A;  2V4J C;  3GLL A;  2YR2 A;  3F6O A;  3LWF A;  3V8K A;  5L3B A;  3O2P E;  3KP5 A;  3KZI C;  3S2H J;  2GLO A;  2CQN A;  5H2F C;  2X0L A;  4B4C A;  2EFW A;  2XV4 S;  3DTK A;  2V1N A;  3RCO A;  2MC3 A;  3FF5 A;  3VYS B;  4Y17 A;  5IOY A;  2FBK A;  1MMS A;  4V2G A;  1N75 A;  1XCB A;  2NNN A;  1A6Q A;  1P4X A;  2DFE A;  1LFU P;  1KON A;  2HQN A;  2V6C A;  2VJ4 A;  3BR5 A;  1N77 A;  5E17 F;  1KQ9 A;  1T33 A;  4XRM A;  1XMX A;  2DA5 A;  1ZH5 A;  1LVA A;  5EEH A;  4QWQ A;  4EGY A;  1W36 D;  1IC8 A;  2Z1D A;  1FJL A;  1MNM C;  1OYY A;  4BHC A;  1K78 B;  5K7H A;  3OR2 C;  5LLQ A;  4FCY A;  3HOU J;  2KP6 A;  4PJL A;  4LMY A;  3WU0 A;  4UVA A;  4XL9 A;  3CJQ B;  4PJJ A;  4DOZ A;  1FZP B;  1N25 A;  4IO9 F;  1R1T A;  3L2W A;  2B0L A;  4WXD A;  4QTR A;  3VEP A;  4JX5 A;  1U3E M;  3OL3 A;  5ICC A;  2DOE A;  3DF8 A;  3S1M J;  1MMG A;  2V79 A;  1X2N A;  5IYD J;  4RAZ A;  1BJZ A;  1LJ9 A;  3KCC A;  2QGU A;  3RI4 A;  3BR1 A;  2VC0 A;  3KFW X;  1RET A;  1YFH A;  2DA2 A;  2GM4 A;  3BCA A;  1A5J A;  1YHQ I;  4CH7 A;  2IGO A;  2Y0S A;  3NEU A;  2EV0 A;  5FLX K;  4M6Y A;  1MJA A;  5CKT A;  2EZH A;  1B72 B;  2V9V A;  2K4B A;  3OS2 A;  3KEQ A;  1Q1H A;  1U6G A;  4S05 A;  4DZJ A;  5FKK A;  2OQG A;  2FUG 2;  3R0A A;  3PNT A;  3TP3 A;  5FKN A;  5E3O A;  2ACJ A;  3K10 A;  3TKY A;  3BJ6 A;  4RGU A;  1W36 C;  3E97 A;  2A3S A;  1ERD A;  5B3S H;  5GPC A;  5FKM A;  3SFI A;  3J80 Z;  1JJ6 C;  3FIW A;  3HRM A;  4ZTJ A;  5TIS C;  4N0B A;  3BZ6 A;  3HL2 A;  1NHA A;  1XN7 A;  3GME A;  2ZC2 A;  2EA4 A;  4CGZ A;  4EJV A;  2XAG A;  4TV7 A;  4ZH4 F;  4B44 A;  2BHZ A;  2VE9 A;  1O7F A;  2CS3 A;  1FSH A;  2JVG A;  2Y0M A;  4DNC A;  1ETV A;  5L3C A;  3BTC A;  4M72 A;  3SQN A;  3K4C A;  1J59 A;  4UVB A;  4LFU A;  2BVL A;  3WE2 A;  4N9I A;  1AOY A;  3R6S A;  2FEZ A;  1GHC A;  3KYL A;  3IKV A;  1SVO A;  4MQV A;  3TED A;  2ZKZ A;  5E1W A;  1TQI A;  3JTG A;  2KLO A;  2HDD A;  2WWY A;  4HV5 A;  3DKX A;  5DD4 A;  2IEK A;  3JRD A;  1JI8 A;  1YE9 A;  1RR7 A;  1I5Z A;  3A2K A;  5HLT A;  2WB1 A;  5E79 C;  2J5O A;  2F5C A;  4M3B A;  3GLX A;  4PFO A;  1DU0 A;  2NVX J;  4ZYD A;  3DWL E;  1GXP A;  1HDP A;  4BXX J;  2X51 A;  2LF7 A;  4DJA A;  3K1M A;  2QF7 A;  2WAQ N;  4CZC A;  1D5Y A;  1DPU A;  1J9I A;  4K2E A;  5GAH J;  2M3A A;  2MAB A;  3F0C A;  3WGG A;  4XRS G;  3JW4 A;  5E8G A;  4KIS A;  1IRZ A;  2L9R A;  2P8T A;  3HIF A;  4OAZ A;  3DCF A;  2NS8 A;  2R7F A;  2XAU A;  2VPL A;  3PO2 J;  4L9J A;  3E5X A;  5DM7 F;  4M71 A;  1FMW A;  4ON0 A;  5H6R A;  3FM3 A;  5TJJ A;  4EJW A;  4ZYE A;  2GOX B;  2J5P A;  2Y9Y A;  3I53 A;  4KN7 X;  2CJJ A;  1F36 A;  4CCK A;  3GXO A;  2MFZ A;  4LB5 A;  2PI0 A;  4HLX A;  5F6F A;  1DP3 A;  1WCM J;  3JRA A;  4E6K G;  2N8G A;  4KNY A;  2LFB A;  4D0P A;  2VJJ A;  2W82 A;  4I01 A;  3K4B A;  1L3L A;  3ABL H;  2R93 J;  3DU5 A;  1F9N A;  4KA4 A;  2ZXH A;  3NRV A;  1U8R A;  3K70 C;  2K7L A;  1FT9 A;  4OIN F;  3OL4 A;  1U9N A;  1IN7 A;  1LUJ B;  1KYZ A;  1WJB A;  3IWZ A;  4A3M J;  4HNT A;  3K4J A;  1QPI A;  3M4O J;  1R5G A;  2FQ4 A;  5FFX A;  2W7N A;  2DOA A;  1XSV A;  1YTY A;  2WV0 A;  3CO6 C;  1FX7 A;  2XRN A;  1WJC A;  1ODD A;  2A61 A;  2ZJP F;  1AA7 A;  1LDK B;  3MKY B;  2V1U A;  1X1D A;  1G8X A;  3G73 A;  1XGO A;  2QQB A;  1DP7 P;  2HXO A;  1FPQ A;  2XF6 A;  2QM3 A;  4ZC3 A;  4QLC U;  3SEZ A;  2P7C B;  3ZQ7 A;  3WU2 C;  2OF7 A;  2KRF A;  4I7H A;  4XLF A;  1KYW A;  2Z2S B;  1Y39 A;  2OUM A;  1BC8 C;  2YUS A;  2JN6 A;  1Z7U A;  3ULQ B;  4I0B A;  3JR9 A;  3CUO A;  1HW5 A;  1IRF A;  1KU3 A;  4XN3 A;  2M8E A;  1J75 A;  3FK7 A;  2PJR A;  4XLA A;  3JRF A;  2CG4 A;  1ORK A;  3QOD A;  4BE1 A;  1XPX A;  1ETY A;  2AO9 A;  1ETX A;  4LGW A;  1SFO J;  1UHM A;  2BY3 A;  1LVK A;  2ZXJ A;  2K9M A;  1D0Z A;  2MC4 A;  2DPD A;  3HBL A;  1FEX A;  1ACI A;  2PMU A;  2CUE A;  1P4A A;  4BHP A;  3CUQ B;  2EZK A;  4EJT A;  4KFC A;  4CYD A;  2JTV A;  2LSO A;  3K4N A;  1S72 I;  1G6N A;  2C6Y A;  2YSR A;  3HSR A;  1W0U A;  1XMK A;  4LD5 A;  4CCN A;  5FB2 A;  2DPU A;  2H6C A;  5BNG A;  1BL0 A;  5CVV A;  2W48 A;  3H9Q A;  2ADU A;  4U7B A;  1MBE A;  3SDG A;  2Z33 A;  1R7J A;  3LFK A;  4EQQ A;  1OYW A;  4C9Y A;  1ZLK A;  2Y9Z A;  2EK5 A;  4BY1 J;  2VI6 A;  4RLQ A;  2PMZ N;  1R36 A;  5FKL A;  2CFO A;  2DFH A;  4YG2 F;  2A6T A;  3REO A;  2HKX A;  1JKO C;  4MTE A;  1R4M B;  3ZXS A;  4CSW A;  2QQA A;  2QKM B;  1QZE A;  5DV5 A;  3S8P A;  3TMO A;  4I99 C;  2A6H F;  2ELJ A;  1ZLJ A;  3BG5 A;  1WQ2 A;  4BE2 A;  2M34 A;  4I2O A;  1FTT A;  5HOD A;  2L0K A;  4XOP A;  2O8K A;  2W84 A;  2B7E A;  4A0X A;  1XS9 A;  2JA7 J;  3I64 A;  5F0H A;  2VBX A;  1S9H A;  3H1C A;  1YIO A;  3GBG A;  5F27 A;  3DEU A;  3KLO A;  3CLO A;  4GGG A;  2IGN A;  1GDT A;  3HSF A;  4L9N A;  3TO6 A;  3OOP A;  2JA5 J;  1Z1D A;  5FKO A;  2RKH A;  2OC6 A;  4JOM A;  2ME6 A;  3DKY A;  4Y13 A;  4G7O F;  5C4J J;  3CCS I;  1QVU A;  3BT9 A;  2LKX A;  3H9G A;  3K2A A;  3HSE A;  1UHW A;  4F52 A;  3L1P A;  1TL8 A;  1MDM B;  3OYI A;  3S3N A;  1TNT A;  1R49 A;  1H89 C;  3FXK A;  1RNL A;  1YOV B;  3BCB A;  3GTG J;  5IP6 A;  4M6V A;  3RIR A;  5FLV A;  2ZJR F;  1S7O A;  4AIK A;  4XSX F;  2K3F A;  4UNO A;  3V7C A;  5CVJ A;  3ERE D;  2MD0 A;  3SYT A;  1ON2 A;  3ZRG A;  1D0Y A;  1UEL B;  1OJL A;  1W7P D;  3I59 B;  1QZZ A;  4IHX A;  1UHS A;  3BOQ A;  2WA0 A;  5FLM J;  4PDK A;  3N05 A;  3LAP A;  2EFN A;  2WAF A;  4PZJ A;  2MG4 A;  3V7R A;  3ZOB A;  1PDN C;  1ONV A;  1Z6T A;  1HXD A;  2K9L A;  3QAH A;  2L01 A;  1U8B A;  1RUO A;  1R4N B;  3HUG B;  2KT0 A;  3DU6 A;  4ETS A;  4HNV A;  1Y6I A;  3Q3S A;  5E1X A;  2XPW A;  3GCM A;  4I76 A;  2L4M A;  2QQ9 A;  2IBD A;  2R7R A;  1FYM A;  4PJN A;  3HRU A;  3W6J B;  2XKP A;  2QUF A;  2R7Z J;  1VND A;  4UY8 I;  4MO7 A;  4GXO A;  4L9T A;  3L00 A;  2LTP A;  4MTD A;  2O6G E;  1FTZ A;  1T56 A;  2FU4 A;  4IQ4 A;  4Y15 A;  5J4V A;  2KIS A;  2DMT A;  3GTM J;  3J7A O;  1I1G A;  2Y30 A;  3DBL B;  3MMY B;  2BY2 A;  1XX5 A;  3F22 A;  3C3W A;  2M2E A;  4BU2 A;  3EYI A;  1ETO A;  1RPW A;  2M8G X;  3G1O A;  2DCE A;  3RKX A;  4EJO A;  3GTP J;  1QPM A;  2Z9O A;  1FY7 A;  1YW8 A;  3FXU A;  5J47 A;  2CUF A;  3I71 A;  2K85 A;  1EA3 A;  3V8L A;  3G1L A;  1V54 H;  3UNG C;  4Y3O A;  4G7Z F;  1G3W A;  4Q4Z F;  3HRT A;  5EYR A;  2HWV A;  2DO7 A;  4R8H A;  1PVE A;  1P92 A;  5GP9 A;  3N97 A;  3GTL J;  3OIQ A;  4BBR J;  1U78 A;  1K4S A;  3UKG A;  1FP2 A;  1Z91 A;  1WSU A;  3IV5 A;  1LEB A;  1TP4 A;  1MDM A;  3HJE A;  3S1N J;  2DTZ A;  4RB2 C;  5JI6 A;  3CTA A;  2RVC A;  2VL8 A;  1MBJ A;  2XAQ A;  4BEH B;  1V3F A;  1HSJ A;  2ZB9 A;  1EKE A;  4AUX A;  4MIM A;  4FAS D;  2A07 F;  4BKX A;  5J8C A;  3N4M A;  3ABT A;  2XAJ A;  1LFP A;  1MBK A;  1KQ0 A;  3I59 A;  1YI2 I;  1R58 A;  2HU9 A;  2IS6 A;  2EZI A;  2WY7 Q;  3SZG A;  1P6R A;  1SVL A;  3Q0U A;  3SDB A;  2DA1 A;  3ZMS A;  3OYC A;  2HOA A;  1XGS A;  4DBQ A;  4ENK A;  2M87 A;  4BXU A;  2CH0 A;  4IL6 C;  3H92 A;  2LKS A;  1G3T A;  1WZ2 A;  3TDZ C;  4YIF A;  1ZRD A;  2XDV A;  2H09 A;  2WAQ A;  1K79 A;  4HX4 A;  4HV6 A;  2GXB A;  1MNE A;  4BQN A;  2DA3 A;  2HQR A;  2EB7 A;  3QU6 A;  2NVT J;  1MJ9 A;  2QBY B;  5K5Q A;  1XC5 A;  3QU3 A;  2P6S A;  3OY9 A;  3EPZ A;  4AYB N;  2I5U A;  5J3L A;  2FJ1 A;  4FE4 A;  3PIO F;  2XAS A;  3KP2 A;  3CP8 A;  1QO0 D;  5GTH C;  3FXM A;  4JP0 A;  2L7Z A;  1RC9 A;  5DCM B;  3NQO A;  3MZY A;  3F21 A;  3DP7 A;  4E7I A;  2IS1 A;  2XB5 A;  3FXQ A;  5K5R A;  4IQJ A;  2V6E A;  3OOU A;  3WTT C;  2KIU A;  1I3Q J;  1WWX A;  4Y33 A;  1FOW A;  3RSN A;  5TGT A;  1HKQ A;  1X1B A;  2VQC A;  3W2V A;  5JHF A;  1FMV A;  1G3Y A;  2GAU A;  1JKR C;  4RDU A;  2E2J J;  2K9N A;  1IJW C;  3R60 A;  1U5T C;  3ONQ A;  3M1E A;  4D5F A;  1E17 A;  2BW3 B;  2HYF A;  4HEA 2;  1TWG J;  4BUP A;  4HA8 A;  2R0Q C;  1NG7 A;  2G7H A;  1VQ5 I;  4BS9 A;  3DTE A;  4Q47 A;  2M45 A;  2MW8 A;  1IF1 A;  2ZCW A;  4OIR F;  2X85 A;  4OMZ A;  3JRG A;  4C3J J;  3CZ6 A;  4KYW A;  3C7J A;  2DK5 A;  1V55 H;  1WI3 A;  1SAX A;  1APL C;  1XG1 A;  1S7E A;  4FT8 A;  2LF8 A;  2MBF A;  2ID3 A;  3AKZ A;  1FYL A;  4OIO F;  4XIC A;  3L7W A;  1O57 A;  5LD2 C;  3SHF A;  5HNH A;  1G4D A;  4A3I J;  2D45 A;  4IX7 A;  3VPR A;  5FLX Z;  2EIN H;  1GUU A;  2RV8 A;  4YFK F;  5HLG A;  3S16 J;  3IH4 A;  4HAM A;  4OWR B;  1D1C A;  2R7O A;  2KPM A;  3H9J A;  3CCV I;  1F43 A;  1T0F A;  4CA0 A;  1R1U A;  1FOK A;  4QSH A;  4HX7 A;  1R5H A;  3CDL A;  2ZSH B;  1D1B A;  2D5V A;  2ISZ A;  3V4G A;  4A93 J;  4L9V A;  2AQE A;  1H0M A;  2IS2 A;  5BPD A;  1I27 A;  2JPB A;  3JAM K;  3QYB A;  5L3D A;  2K27 A;  2M0C A;  3ASN H;  2JRM A;  2LRD A;  2KRH A;  2HPI A;  4LLL A;  2EA2 A;  2RNG A;  1PJR A;  2KIQ A;  3T5X A;  4U0V A;  2H27 A;  1RKW A;  2JSC A;  4XOR A;  3K2Z A;  9ANT A;  1Y1W J;  2R7T A;  2CU7 A;  4UVC A;  1WKM A;  2MLG A;  4CHU A;  2UXX A;  3NAU A;  2IS4 A;  1RRJ A;  4B43 A;  3FWE A;  5CJ9 A;  1IW7 F;  2A68 F;  2K9Q A;  5J1R A;  4HF1 A;  2GXA A;  1BW5 A;  3KX2 A;  3WTX C;  3J7Z I;  2PMZ A;  2F5F A;  5D6E A;  4CCL A;  1ZGA A;  2PQ8 A;  3CDH A;  3I58 A;  3LQQ A;  5E3M A;  2ZFW A;  1REP C;  4HQE A;  5CVR A;  2ZME A;  1WJD A;  3OWT A;  2E5N A;  1T95 A;  2BW3 A;  1Y0U A;  1B1B A;  1GV5 A;  5AIP A;  4LK0 F;  2K9S A;  1VZ0 A;  4F7Z A;  5LEJ A;  3ZPL A;  2R7W A;  1Z9C A;  3HTS B;  3JSO A;  2F5D A;  2K5C A;  3KEY A;  2G7U A;  5BMZ A;  5HDK A;  1OMI A;  2LY2 A;  3BRO A;  4RB1 A;  2W00 A;  2HTJ A;  3RKQ A;  4DYC A;  2HOT A;  5LGU A;  2VUM J;  5EZH A;  5HS9 A;  1D8K A;  1FOX A;  2COB A;  1MBG A;  1B6A A;  1QQI A;  2NYX A;  4U0Y A;  2EFQ A;  4D9J A;  4A3B J;  5M5X J;  3KP4 A;  2E1M C;  2PBI A;  1OCT C; 
#chains in the Genus database with same CATH homology
 3CCJ I;  5DM7 F;  2E36 A;  1VQL I;  3CF5 F;  3DLL F;  3CME I;  1VQ9 I;  1YHQ I;  3I55 I;  2E34 A;  5GAD J;  3CCE I;  2FOW A;  3CCV I;  3CC2 I;  1VQK I;  1FOY A;  3G6E I;  3CCM I;  1YJN I;  3G71 I;  3CCS I;  3CCL I;  2OTL I;  3CC4 I;  1VQ6 I;  1YI2 I;  1VQ7 I;  2NXN B;  1YIJ I;  2ZJQ F;  5GAG J;  1VQ4 I;  2ZJP F;  2ZJR F;  1QA6 A;  2K3F A;  2JQ7 A;  3G4S I;  3J7Y J;  1VQN I;  3CMA I;  4IOA F;  2QEX I;  1Y39 A;  3CC7 I;  3PIO F;  3J7Z I;  1YJW I;  2OTJ I;  5DM6 F;  3CD6 I;  1MMS A;  3PIP F;  1VQO I;  1VQ8 I;  3CJT B;  1FOW A;  1HC8 A;  2QA4 I;  5JVG F;  4V19 K;  3CCQ I;  5GAE J;  4UY8 I;  1ACI A;  4IOC F;  1S72 I;  2E35 A;  1YIT I;  3I56 I;  4IO9 F;  5GAH J;  1VQM I;  1YJ9 I;  1FOX A;  1VQ5 I;  3CCR I;  2H8W A;  3CCU I;  1VQP I; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...