1U5TA

Structure of the escrt-ii endosomal trafficking complex
Total Genus 64
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
64
sequence length
213
structure length
213
Chain Sequence
VNKTILEKQSVELRDQLMVFQERLVEFAKKHNSELQASPEFRSKFMHMCSSIGIDPLSLFDRDKHLFTVNDFYYEVCLKVIEICRQTKDMNGGVISFQELEKVHFRKLNVGLDDLEKSIDMLKSLECFEIFQIRGKKFLRSVPNELTSDQTKILEICSILGYSSISLLKANLGWEAVRSKSALDEMVANGLLWIDYQGGAEALYWDPSWITRQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transport protein
molecule keywords appears to be functionally related to SNF7; Snf8p
publication title Structure of ESCRT-II endosomal trafficking complex
pubmed doi rcsb
source organism Saccharomyces cerevisiae
total genus 64
structure length 213
sequence length 213
ec nomenclature
pdb deposition date 2004-07-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04157 EAP30 EAP30/Vps36 family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 1u5tA02
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 1u5tA03
2P4WA 2GA1A 3TDZC 2Y48A 3ULQB 4U0YA 1U5TA 1BJAA 2L4AA 3MEXA 5CLSA 3I71A 2F2EA 1Z6TA 3VOEA 3P9CA 3F8NA 5CYVA 1IN4A 3TO6A 2D1VA 1E2XA 5D4SA 2WWYA 2CW0F 3K0LA 2V9VA 3M8FA 2MBFA 4U0VA 2XKPA 2RVCA 4Y13A 2HYGD 5ILUA 2EB7A 4HBLA 4Y17A 2QWWA 1SMTA 1F1ZA 4BHPA 5LHHA 3Q9VA 3FMQA 1OYYA 4N9HA 4RB3C 3COAC 2MLGA 3F8BA 1WRJA 5J8CA 3BPVA 5ICGA 2Z33A 2VT2A 2RDPA 2W85A 2H6CA 2LDUA 4Z2YA 2DTRA 4EGYA 3ZN1A 4PCQA 3WGIA 4CXFA 4IVNA 3BJ6A 3REOA 1YYVA 1S7AA 1QBJA 5H6QA 1IAWA 1WKMA 2QLZA 2STTA 3M8EA 4DQ2A 1S3JA 4OMZA 1FBQA 3V8KA 3V8LA 3GFJA 1YIOA 5DUKA 5E20A 2XV4S 3E6DA 3KZYA 2O0YA 5DEQA 2PN6A 2HZTA 1IN7A 3KP5A 1AWCA 2XVCA 2B0LA 2ZCWA 5BS6A 2HOEA 4LJZF 2ZBKA 5HS8A 2MC3A 2M5WA 1T6SA 2Y0MA 2K7LA 3ZN0A 1EH6A 3IWZA 5EEGA 2IA0A 4B09A 4LG0B 2FBHA 1FOKA 4L18B 1BC8C 4HLYA 5LHIA 1W4MA 5A2QK 2K4BA 2XGXA 3I4PA 5ERIA 3RYPA 2QYOA 3R0AA 4O6JA 4RS8A 1ZRFA 3EYIA 3FF5A 5D8LB 1PUEE 1G3TA 2X4HA 3I59B 2BBYA 2KJBA 2QM3A 4LFUA 1T2KA 4HDVA 5FO5A 2XRNA 1MKMA 4IHSA 5HS9A 2F5CA 4KT5C 3L00A 3E6BA 4PDKA 3F6VA 3KFWX 2KIFA 1KU2A 4KA4A 5DDGA 1GXPA 1BC7C 3BJOA 3DFGA 4KN4X 4M74A 1DPUA 1YG2A 2W24A 3DP7A 4HQEA 2K4JA 3R4KA 5LRSA 2OD5A 2V1DA 1OPCA 1BOAA 3N97A 2EWNA 2M87A 4IRHA 3O3KA 2OU2A 3P7NA 2MLKA 4N9IA 4H0EA 4KNYA 3F8MA 1YW8A 1FLIA 4ZYHA 3HSRA 5H20A 4YIIA 2DAOA 1FC3A 4BH9A 4MTEA 4LLNA 1J59A 2A6HF 1RIOH 2LKPA 2HKOA 1W5SA 1FSEA 1XD7A 1BI3A 4ASNA 2VONA 2E7WA 3QU6A 4LLGF 5H6RA 3H3ZA 4IPAA 4UXNA 1B4AA 4F7ZA 1IZ1A 3KETA 1USTA 4MHGA 1G6NA 2FE3A 2XAHA 5HDKA 5A2QZ 3MFKA 4OMYA 1LQ1A 1Z91A 5ICEA 1U5TC 5D8KB 4CO8A 1HKTA 2P5KA 1D8KA 3K1MA 3K1PA 2VT3A 5K5QA 2STWA 1H9GA 1YFHA 1R36A 4D0PA 3QP6A 5K5OA 5FGMA 2OZ6A 1B9NA 3WTZA 5HS7A 2BEOA 2ZFWA 1SD7A 4LD5A 4FX4A 5DD8A 4CYDA 4R79A 2PI0A 4ZYGA 4A0ZA 2CO5A 2EK5A 4WXDA 2RV8A 4A2UA 1Z1DA 2EFQA 2R7DA 1KA8A 3IKTA 1GHCA 4G7OF 1ZG5A 1D3YA 4CZZA 4A12A 4TV7A 3Q9SA 2HTSA 3S2WA 3VB2A 1A04A 1BIBA 3WGGA 2ELHA 2V1UA 2ZO4A 2VE9A 5LBQA 2PLYA 4N0BA 3K2ZA 1HW1A 3MAJA 5LRRA 2X0LA 3FX3A 3BWGA 1SAXA 2HKXA 1NHAA 3RKYA 3I53A 3K9TA 3HIFA 3I59A 2DBBA 2VC1A 1OR7A 3IWFA 1YTYA 2JRTA 3GFIA 4EJVA 1YS6A 2WTEA 3QRFF 3RPQA 2DPDA 3BROA 5BMZA 4ENKA 2G7HA 1REPC 2IJLA 3LAPA 3C3WA 1HSJA 1ZLKA 4FT8A 1PP7U 2VODA 4HW0A 3ABTA 1ZGAA 1ZG3A 2DPUA 1XCVA 2A07F 3BZ6A 4O5VA 4R1HA 3KEQA 1MJBA 2JPCA 4KMFA 3SQNA 2JTVA 1FX7A 4I01A 2EA2A 2A61A 3LWFA 1TNTA 4A0XA 1VTNC 3F23A 2PMUA 3L09A 3LAJA 2HYFA 2YSRA 4L0YB 3WTUC 3OOPA 2YX4A 5LGUA 2OA4A 1B9MA 4A5MA 1STZA 1PDNC 4CICA 5FLXK 4WWCA 3QP5A 2ZKZA 3HUGA 2E1CA 2VE8A 3C7JA 5LHGA 1OMIA 2F5EA 2BV6A 3CO7C 2V6CA 2MD5A 1QNTA 3WTVC 1YS7A 2L02A 3PQKA 1QPMA 2A68F 2HQNA 3QOPA 4OIQF 3WTWC 2G9WA 4M73A 3LA7A 3WTYC 2A3SA 1P2FA 4Q5SF 1I1SA 4HZFA 5FD5A 1FP1D 4EM1A 4I0AA 4XLNF 3U9GA 4I7HA 4KYWA 1O57A 5FB2A 4UV8A 4WF2A 5K1YA 3BDDA 5JFRA 2OZUA 3EYYA 4ZH4F 4OU0A 3ECHA 4MQVA 3EUHA 4GYGA 5DYMA 2FEZA 5HVQC 3C1DA 4UUVA 3RI4A 1FY7A 3KE2A 3HTSB 4ENMA 3R0JA 2XAJA 5FFXA 2PFBA 3ELKA 3R6SA 4HF0A 3RYRA 4ESFA 2DLLA 2D45A 2PMHA 1ZREA 3KP2A 4GYIA 3M1EA 2DI3A 2OQGA 3FM5A 5DD4A 4IRIA 4AIJA 2KRFA 2XAGA 4XSXF 1ZLJA 2YR2A 2IP2A 5FLXZ 2K27A 2NYXA 2WC2A 2EFWA 2BE5F 4NHJA 1LJ9A 2ZMEB 3G3ZA 1S6LA 4UHTA 4U7BA 2EFNA 1Z05A 1SD6A 4M71A 2JZYA 2P5VA 2PQ8A 3E5UA 5CVJA 1I6XA 3LFKA 4AIHA 2Q8KA 1HW5A 3V7SA 3KEOA 3LSTA 5JVTA 4ENNA 2JSCA 2FU4A 3FZVA 1DDNA 4HX8A 5DCFA 1BN5A 3M7GA 2NAZA 3ISPA 2O3FA 1F5TA 2E7XA 3DQVC 1JGSA 4HV5A 3GWZA 4ZZLA 5ILVA 3DEUA 3I0TA 3QPHA 5IT3A 1HBXG 1XB4A 3JAMZ 5E1ZB 5E8GA 4ETSA 3VODA 5TJJA 1FP2A 1IXRC 4U7DA 1BI1A 3GZ5A 1Q1HA 1JHHA 3WE2A 2E1NA 2LF8A 3JSOA 4HF2A 3DKWA 5TRDA 3F3XA 3MQ0A 3RPUA 4PGHA 4I09A 5CVRA 2DK8A 3Q5FA 3IHUA 3U2RA 4I0BA 5KK1A 4IHTA 2Q2EA 3L7WA 5HDGA 2HWVA 3CJNA 3CUOA 4LLLA 5DCMB 1WI9A 1O7LA 2DQLA 2HQRA 1IF1A 4GGGA 2ADUA 1FPQA 1RNLA 2D1HA 3T5XA 4CDGA 4P96A 3WG9A 1IN6A 4EJUA 1J2XA 5HLIA 3GFLA 4G9YA 1SFEA 2A69F 3V4GA 4I2OA 2UXXA 5AONA 3NEUA 3EDPA 2DK5A 3ABUA 1MGTA 2VBXA 1R7JA 4BXUA 2QQAA 2FNPA 4YFKF 4IRGA 4HQMA 5AIQA 3DPTA 5AIPA 2KIUA 2BYVE 3U1DA 3BJAA 1XSDA 4BHCA 1MJ9A 1YO5C 4NQWA 3F21A 5L3BA 3DXJF 3TOAA 1XSXA 1B59A 1L3LA 2EV6A 3KP7A 4QWQA 3IRRA 4PZJA 3W6KB 1I5ZA 3E5QA 1J9IA 4OIPF 1AOYA 3R60A 1LEBA 4EVIA 4G6QA 2CGPA 2ESNA 1Y0UA 2IT0A 1D5VA 2IPQX 3FXUA 3FXRA 1G3YA 3E6CC 1LB2A 2ZXJA 3GF2A 4BQAA 4WCGA 2H6BA 1W7PB 2M30A 2ZMEA 1J75A 2HGCA 4S04A 4G7ZF 2L01A 3HRSA 1BIAA 3FMSA 3HYIA 1XSVA 2ETHA 5L3EA 4LB6B 1JXSA 1L0OC 3LQRA 1DP7P 1ZGJA 2PEXA 2Z5UA 3CUQA 2QUFA 3CTAA 2IA1A 4A6EA 2NS0A 2L3DA 4HX4A 1J5YA 2NNYA 4UVAA 2IW5A 2VXZA 1U78A 4XSZF 4U88A 1JE8A 5KVRA 3GVAA 2PG4A 2ZNZA 1LVAA 3T1BA 3SZTA 2MA3A 4G94A 3GEZA 2XAFA 2DFIA 1PP8F 4R8HA 4XRFA 3KZZA 1ZYRF 2FBIA 1SD5A 4KICA 1BI0A 1TQIA 4MGRA 4RB1A 3CO6C 4EM0B 2HS5A 5D6FA 1SFXA 2W84A 5DCMA 1RZ4A 3ZQ7A 1F4KA 4AWXB 1DPRA 5HLHA 2EFPA 3BY6A 3TOBA 3GZ6A 4EQQA 5D5VB 2Z99A 4IJAA 1P4XA 1LDDA 1QGPA 3HSFA 2DU9A 5JR3A 2IA2A 4M72A 5FFZA 1FZPB 1KQ8A 2FF4A 4Q48A 3WTXC 3R61A 3RKWA 2HTJA 3QAHA 3K69A 2HEOA 5L3DA 3QU3A 1XGOA 2HDCA 4GXOA 2Q0OA 5LLQA 3HHHA 1TQPA 3RDIA 3I54A 1S7OA 2QENA 4CGZA 4KIBA 5E1WA 1R1VA 2VBZA 1K79A 4XBFA 1XGSA 5D5XB 1KQ9A 2FMLA 1J7KA 4HOBA 5K5RA 2EA4A 4BNCA 1YW7A 4RB2C 2LF7A 4L9VA 1ULYA 1K7AA 2P7VB 1K78A 5LEKA 3FMRA 4S05A 5CVVA 1MZBA 2QBYA 3MWMA 4EV0A 2KJCA 1IRGA 1R58A 1FT9A 1W7PA 2GZWA 2RC4A 1R1TA 4MQ9F 5J8FA 3TDUC 2NRAC 4FX0A 4RAZA 2J5PA 3F6OA 2EJRA 1FWZA 1HXDA 4HX7A 5JHUA 1UCRA 1ON1A 3KLOA 3KP6A 3BPXA 1XGMA 5CJ9A 2V79A 4YFNF 2V1XA 2LNBA 4HF1A 1KQ0A 2EFOA 3D5LA 1KYZA 1TTYA 3J80K 2L54A 5LGNA 4JBAA 5BPIA 2H27A 3ZP5A 1U3EM 5EEHA 4NB5A 5HDNA 3ZMSA 3J7AO 2P5LC 1FYMA 4L5JA 2LSOA 2BGCA 1XMKA 1FSHA 4MNUA 1CGPA 2O8XA 3KP3A 3ECOA 2NNNA 3JSPA 3EETA 2FSWA 4WXCA 4AIKA 3P9KA 1KU9A 4UNOA 3GFMA 2K02A 5F1RA 5JI6A 1U8RA 4A0YA 1T98A 1X3UA 1IN5A 2HFHA 1YW9A 4DNCA 3H92A 2R3SA 3F22A 3MZYA 2YU3A 2CFXA 1ONVA 4EGZA 1YLFA 2QQBA 2YPRA 3L9FA 2YX7A 4YIFA 2H09A 4KIFA 3GW2A 4ON0A 2JT1A 2EV5A 5BQTA 1OYWA 5FD6A 3WODF 3GXOA 4CHUA 1XDSA 4GO1A 3ZMZA 6PAXA 1BM9A 2P8TA 2O61A 2H94A 4OIOF 1ZG1A 2P6SA 5HLGA 5F64A 1IXSB 1WWXA 3ZMUA 2GA2A 1O3SA 1MDMA 5HOOA 2EV0A 4L5IA 2K86A 3MZHA 2ZJ2A 1H0MA 3I58A 1JHFA 3C18A 4A5NA 4MTDA 3CDHA 3WGHA 4I02A 1O3QA 2DT5A 4G6DA 3KCCA 3J80Z 2XIGA 3CUQB 4YFXF 3GLXA 3T0YA 1CF7B 2P7CB 2ESHA 4EJTA 3RKXA 4HLXA 4L9NA 5E18F 3GO5A 4BAYA 4O3MA 1ZAOA 1ZN2A 5L3GA 5IT9K 4KN7X 1P4AA 4LK0F 4Y15A 4XLPF 2HR3A 2VOOA 3TKYA 2TDXA 3GX4X 3LA2A 1SFUA 3TO7A 3RJPA 5E1XA 1IUYA 1F9NA 5D5WB 4B8XA 2FQ3A 2XKOA 3FXQA 1I27A 3P9IA 4Q4ZF 4UVBA 2P6TA 3B02A 2A5YB 3DF8A 1USSA 1R5HA 1K6OA 1G4DA 1G3SA 2Z9OA 1TQMA 1E17A 1O3TA 1HQCA 2M8EA 3FWEA 3TGNA 2ISYA 1V4RA 4RGUA 1ZHFA 1FYLA 1EV7A 1QZYA 2VN2A 3T8RA 3CLOA 4RGRA 2FNAA 3HRTA 3ROUA 2XUBA 4P9UA 3QPTA 5E17F 2D2WA 2OQRA 5BOXA 2IVMA 1FYKA 2O6GE 3F8FA 3KP4A 4M6XA 1G3WA 3ZPLA 4EJWA 3G73A 2M1BA 5LGTA 1W7PD 1H9TA 1P92A 1OKRA 4Q47A 3HOSA 1ZH5A 5E8IA 4P5OA 2GQQA 3OV8A 3D0SA 2F5FA 3BP8A 2CYYA 1Z7UA 2QQ9A 4HAMA 2PJPA 1EH8A 2VBYA 4HV6A 4IF4A 2GWRA 3MCZA 2IRFG 3LA3A 3KLNA 2R7FA 1IXCA 1WSUA 3SZPA 4OOIA 4ZZDA 1R1UA 3IKVA 1U6GA 1J0RA 1KYWA 1K78B 3F8CA 4IXAA 5IT9Z 4RGSA 4ZYDA 1SD4A 2QBYB 4L0ZB 3JW4A 1R00A 2O03A 1TW3A 5DUIA 3TQNA 3E6MA 1HKQA 4OINF 3V7CA 1P4WA 1KU7A 1HSTA 3W6JB 3SFZA 2CQKA 1LNWA 4M9XA 2UWMA 3GYHX 2M45A 2DW4A 1BI2A 3ZMVA 3WU0A 2AS5F 5D4RA 2XAQA 4G8XA 3I64A 4L9JA 5D5UB 3I5UA 1TNSA 3NQOA 2FA5A 4FHTA 1CF7A 3E3VA 1R23A 2GXGA 3T8TA 3WE3A 2CG4A 4WX9A 4P55A 3RTRA 3VEPA 1UHWA 4PGGA 3SXYA 4LB5A 1HKSA 1T39A 1EH7A 1FBSA 1R22A 3ZMTA 2J5OA 3IL2A 3HOTA 4KUMA 2Z3YA 2UXNA 2ZNYA 2FXAA 1R5GA 1QO0D 1IN8A 1DUXC 3WTTC 4UVCA 4EM2A 4ESJA 5CVIA 2QVOA 3V7RA 4BHBA 3K1NA 1TBXA 2F5DA 3SHFA 4MEYF 1B6AA 1W5TA 4HYEA 1D8JA 1U2WA 4HDUA 1KU3A 1QQIA 4L9TA 2ACJA 2VC0A 1TW2A 1ON2A 2DQRA 2XASA 2RQPA 1XMAA 2RKHA 4MEXF 4P9FA 3JTHA 4U0WA 4LG0A 5ED4A 2OAZA 2A6EF 3HSEA 1XN7A 2KKOA 2RNJA 1ZARA 1GVJA 1Z6RA 2XROA 3BOQA 4RGXA 1BBYA 1ODDA 4LMYA 1SMYF 2FOKA 3ML6A 3IC7A 2GXBA 2OBPA 3EQLF 2W25A 1IRFA 3WTSC 2GIVA 3JTGA 2FRHA 1RUNA 2C6YA 3GUDA 3L2CA 1U5TB 4RAYA 5F6FA 4KMUX 1V3FA 2GAUA 1HW2A 2FBKA 5BPDA 2PBIA 5L3CA 1MDMB 2RN7A 1KGSA 1TLHB 2Y75A 2L4MA 2RGVA 1T0FA 3O6BB 4A6DA 2G7UA 3NRVA 3J81K 1I1GA 3E97A 2CWEA 1XDUA 2VBWA 2WV0A 5DV5A 4LGWA 1LDJA 2CSOA 3E5XA 4M6YA 1WQ2A 4EMSA 2QZ8A 4UV9A 3ERED 3FM3A 1B1BA 1O3RA 5CVUA 3V8JA 1UB9A 1YQAA 4HA8A 5J6XA 1FNNA 2UZKA 1XCBA 4YG2F 1RUOA 4ZYEA 1MD0A 1RI7A 2MH9A 2MH2A 4JK1X 5D6EA 3IRQA 3HTUA 4M9ZA 2W57A 1IW7F 3DV8A 2KIMA 3FHZA 1MJAA 4EJOA 4WXHA 4G7HF 4ESBA 2ISZA 3DPLC 4K2EA 2COMA 1T38A 4QLCU 4RB0A 4M9SA 5ICCA 1P6RA 4JQFA 3TO9A 4BYYA 1S29A 1FBUA 1S8NA 4WK8F 3H3UA 2VOPA 4GCVA 1OYIA 2DO7A 1LEAA 1UHMA 3HHGA 4I98B 4AVPA 3ZMDA 2FMYA 5LEJA 3F72A 3N4MA 1C0WA 5ICFA 3O2PE 5L3FA 1QZZA 1GXQA 5ILSA 3PFIA 4E70A 2AXLA 3JAMK 4ENJA 2XHKA 4AD9A 3AAFA 1UFMA 4KDPA 1LDKB 1O7FA 4KFCA 3HRMA 4OIRF 1Z9CA 3CUQC 1XGNA 1ZRCA 3VFZA 3RIRA 3LQQA 3B73A 3J81Z 3PQJA 1ZRDA 3M9AA 3HRUA 2JPBA 4LK1F 3WU1B 4KIGA
chains in the Genus database with same CATH superfamily
2P4WA 2GA1A 1SAUA 3TDZC 1W36C 4N4NB 5CQEA 3OYCA 3MKYB 2Y48A 4YIRX 4I99C 3ULQB 4U0YA 4NNJA 1U5TA 1BJAA 1PUFB 2L4AA 3DTEA 1W36D 3MEXA 4JYKA 1N78A 1K4SA 4GDFA 5CLSA 1KONA 3I71A 2F2EA 1Z6TA 2BY3A 3VOEA 3P9CA 2ZJPF 1P7IA 5KAIC 3F8NA 5CYVA 3GTMJ 3DTKA 1IN4A 3TO6A 2D1VA 5FJ8J 1E2XA 3WHCA 5D4SA 2WBMA 3UR3C 2WWYA 2CW0F 4FQGA 3K0LA 4DJAA 2V9VA 3DBLB 1IV6A 3M8FA 4N4OB 2MBFA 3RZDJ 4D7NA 4U0VA 1FOYA 2XKPA 4JP0A 1T33A 2RVCA 4Y13A 4C2UA 3CJRB 2HYGD 5ILUA 4CYCA 2EB7A 4HBLA 4Y17A 2K3FA 1SMTA 2QWWA 1F1ZA 4BHPA 5LHHA 3Q9VA 3FMQA 4Y52J 2K3PA 1OYYA 4UB6C 2GOXB 4N9HA 4AUXA 2IEKA 4RB3C 3COAC 2MLGA 2WV1A 1E3HA 3DBHB 3K2AA 4DOZA 3F8BA 1JKOC 1WRJA 5J8CA 3OYFA 3BPVA 5ICGA 3EPZA 2VT2A 2RDPA 2Z33A 2O9LA 2W85A 2H6CA 2F4OB 2LDUA 4XKWA 2LG4A 4Z2YA 2DTRA 3CZ6A 1I3AA 3CCYA 1Z7LA 4EGYA 4BJTA 3ZN1A 4PCQA 3S3OA 3WGIA 4CXFA 2XB5A 3BJ6A 4IVNA 3REOA 1SEUA 1YYVA 2KL4A 1S7AA 2CUFA 1QBJA 5H6QA 1IAWA 5M3MJ 1WKMA 4FE4A 2QLZA 4PJJA 3VYUB 1WPKA 2STTA 3M8EA 4DQ2A 3W2VA 1MH4A 2HOSA 1S3JA 4OMZA 2VI6A 1FBQA 3V8KA 1H88C 3V8LA 3GFJA 2QF7A 1RC9A 1YIOA 5DUKA 5E20A 5EG0A 2XV4S 3E6DA 3KZYA 2O0YA 5DEQA 3TL4X 2PN6A 1Y8RB 2HZTA 2EH3A 1IN7A 2A6TA 1WZ2A 3KP5A 1JJ8C 5J4YA 2FOWA 1AWCA 4XKCA 2XVCA 2DMNA 1I39A 2B0LA 3OOUA 1NK2P 2ZCWA 3NWSA 1TWGJ 2HOEA 5BS6A 5H2FC 3SJMA 4LJZF 2ZBKA 3MKWB 5HS8A 3F9KA 5C4JJ 2MC3A 4M3GA 1T0FC 2OPTA 3IH3A 5B1BH 3DKXA 2M5WA 1T6SA 4IHYA 2Y0MA 2K7LA 3ZN0A 1EH6A 3IWZA 5EEGA 2IA0A 3ZRGA 3OWTA 2M8GX 4B09A 1T95A 2LBFB 4LG0B 2FBHA 1FOKA 4L18B 1BC8C 4E4HA 3KPHA 4HLYA 3BQYA 5LHIA 5E3MA 1W4MA 1WJFA 3Q0VA 5EDNA 5A2QK 2PJRA 2K4BA 1SVMA 2XGXA 1D1CA 1R49A 2QSHX 4B3AA 3I4PA 2ELJA 4DIQA 5ERIA 1OJLA 3RYPA 5M5XJ 2QYOA 2E5ZA 3SFIA 3LSHA 3R0AA 4J19A 4O6JA 4RS8A 3S93A 1ZRFA 2VJ4A 3EYIA 2JA8J 3S1RJ 3HL2A 3PUFA 5IP9J 3CCUI 3FF5A 2DDBA 5D8LB 4CCOA 2DJIA 4JX4A 1PUEE 4X6AJ 4BE0A 1G3TA 1IDZA 3J7AY 3E1SA 5K7HA 4XIDA 2X4HA 3I59B 2BBYA 2B7EA 2DA4A 2KJBA 2QM3A 4PJMA 4LFUA 4UUSB 1JT6A 1X2NA 2LMDA 1T2KA 4HDVA 1RESA 5FO5A 2XRNA 1GV2A 1MKMA 4IHSA 2DA3A 5HS9A 2F5CA 3D5RC 4KT5C 2V9PA 2M0MA 4MFDA 5EYRA 3L00A 2ME6A 3IAM2 3LNQA 3E6BA 4PDKA 3F6VA 2V9KA 2KFDA 2Z1DA 3KFWX 2KIFA 1KU2A 2DFEA 2M34A 4KA4A 5DDGA 1LFPA 1GXPA 3K4JA 1BC7C 3BTLA 3BJOA 1BL0A 1W1WE 3DFGA 4F91B 3OYBA 4KN4X 1VQPI 4GFBA 4M74A 1DPUA 2ID3A 2DFFA 1YG2A 1TT5B 3ABKH 2W24A 3DP7A 4HQEA 2K4JA 3R4KA 1D0XA 2DOEA 1PUFA 5LRSA 5M3FJ 2OD5A 2V1DA 1OPCA 2OTJI 1BOAA 3N97A 2EWNA 2KMUA 2M87A 4IRHA 4ZDPA 3O3KA 2OTLI 2OU2A 5GPCA 3B6AA 3P7NA 2MLKA 2IGKA 4N9IA 4H0EA 2FQ4A 3F8MA 4KNYA 1YW8A 4C3JJ 1XPXA 1FLIA 1JKQC 1FIPA 3OL3A 1XS9A 3RZOJ 4ZYHA 5B5EC 2E1MB 1B8IB 3HSRA 5H20A 4YIIA 4NC8A 2DAOA 1FC3A 1FMVA 4BH9A 3OMYA 4MTEA 1BJZA 4LLNA 4UUTA 3ONQA 1J59A 2A6HF 2EINH 1RIOH 2LKPA 3FXLA 1LUJB 2KQRA 2HKOA 4ZTJA 1W5SA 2L2OA 1FSEA 2IS4A 1XD7A 1BI3A 1NTCA 3LOCA 4ASNA 2VONA 2DMQA 3K4MA 4XK4A 3CCRI 2E7WA 3QU6A 4LLGF 5H6RA 3H3ZA 1S5LC 4IQJA 2OCCH 3OYMA 4NUBA 4RAGA 2VB6A 4IPAA 3S1MJ 4UXNA 1RKWA 1B4AA 3HUGB 4F7ZA 3VYTB 4E7KA 4Y7NJ 5KNLA 1IZ1A 3RSNA 3KETA 1X3WB 1USTA 4MHGA 3VDXA 2Y9YA 4RMNA 5CQGA 1G6NA 2WY7Q 2FE3A 2XAHA 5HDKA 4IHWA 5A2QZ 3DEWA 5KCMA 3MFKA 3ZQLA 4OMYA 3G1MA 3HJEA 4UY8I 1MMDA 3BZCA 1LQ1A 1LFBA 1Z91A 3OSGA 5ICEA 1OCTC 1U5TC 3LMMA 5D8KB 4CO8A 1HKTA 1EKEA 2P5KA 2X1CA 2BVLA 1D8KA 2AXTC 3J7YJ 1MW7A 3HG9A 3K1MA 3K1PA 2VT3A 2WAQA 5K5QA 1H9GA 3CDLA 3CJTB 4PFPA 2STWA 1YFHA 1VFCA 1R36A 4D0PA 2BZTA 3QP6A 5K5OA 5FGMA 2K9MA 2OZ6A 2XSJC 1B9NA 4F92B 3OYHA 4C3IJ 3WTZA 5HS7A 2BEOA 2ZFWA 4BUPA 1SD7A 4LD5A 4FX4A 5DD8A 4CYDA 4R79A 2PI0A 2BY1A 5M5WJ 4ZYGA 2Z16A 2MGQA 4A0ZA 2CO5A 5BNGA 2XGEA 2O8KA 2EK5A 4WXDA 2RV8A 4A2UA 1Z1DA 2X85A 3JRDA 3OYGA 2EFQA 4IHXA 1ZR2A 1MBEA 2R7DA 3CCSI 1KA8A 3IKTA 1GHCA 2W82A 2JUGA 4KITB 4G7OF 3OIQA 1VQOI 1ZG5A 4HNVA 1D3YA 4CZZA 1QPIA 4A12A 3K4LA 5IOYA 2VPLA 4TV7A 2NS7A 3Q9SA 1OFCX 2HNHA 1U8BA 1BW5A 3PNYA 5B66C 3ABLH 2HQAA 2HTSA 3S2WA 4IEJA 2GM4A 3CF2A 3BG7A 3VB2A 1WVRA 1A04A 1BIBA 3WGGA 3PIOF 1Q1VA 2ELHA 2V1UA 2ZO4A 3KIOA 2VE9A 1XG1A 1TT0A 3MD2A 3QOEA 4MLOA 2KISA 4N0BA 5LBQA 3MKZA 1T08B 1VQ8I 2PLYA 3K2ZA 1HW1A 4BL0B 3MAJA 5LRRA 2X0LA 3FX3A 3BWGA 1SAXA 1PVEA 2HKXA 1NHAA 3RKYA 3I53A 3K9TA 3HIFA 2CMPA 1JKRC 2R7VA 1X1BA 3I59A 2DBBA 4UUSA 4IHVA 2VC1A 2HOAA 2JQ7A 1OR7A 2L7FP 3IWFA 2JRTA 4RDUA 1YTYA 3GFIA 3GMEA 2O7OA 1WCMJ 4EJVA 1QVTA 3HPGA 1ITYA 1YS6A 3CC7I 2WTEA 2HYJA 4IO9F 1MBGA 2BW3A 3QRFF 3RPQA 2HXOA 2DPDA 1I6HJ 3BROA 4IQ4A 2DN0A 2TCTA 5BMZA 4ENKA 3BR6A 5HLTA 2G7HA 4BY7J 1REPC 2IJLA 4XICA 3LAPA 1BA5A 1IJWC 4CYCB 2DA2A 3C3WA 2H1KA 3OYNA 2LLKA 5FLVA 1HSJA 3RCOA 1ZLKA 2JK3A 4FT8A 2ZXHA 5TISC 4CA0A 1HDDC 4CUGA 1PP7U 2VODA 2LREA 2N8GA 4HW0A 3ABTA 4Y3OA 1K6YA 1ZGAA 1ZG3A 1HA8A 3LSGA 1ZKGA 3U1KA 2DPUA 4A3FJ 1N25A 2DJNA 1XCVA 3MKLA 4RLQA 4HNTA 2A07F 1MMAA 3BZ6A 4O5VA 5JLWA 2EPFA 4R1HA 3KEQA 3K4BA 4XM3A 3CCLI 1MJBA 1IG7A 2JPCA 3AG2H 4KMFA 4PSXA 1DU6A 2GOMA 3SQNA 4B48A 2VLAA 1S7EA 2JTVA 1FX7A 1FJLA 4I01A 2EA2A 1IC8A 1R71A 1B8IA 1OCRH 1VZ0A 3MN2A 1EA3A 1H8AC 4C30A 2A61A 2K9LA 3LWFA 1TNTA 1ETWA 3G71I 2COBA 2DT6A 4XLAA 1MBHA 4A0XA 4FASD 1SVLA 3FXOA 3F23A 3CJQB 2PMUA 4E6KG 1VTNC 3TP3A 2KDZA 3L09A 4A93J 4XKVA 5J4VA 1JGGA 3LAJA 2HYFA 2YSRA 4DZPA 4L0YB 2EBIA 1F43A 3WTUC 3S1NJ 3OOPA 2YX4A 3M07A 5LGUA 1TL8A 1IUFA 1B9MA 2OA4A 1STZA 4A5MA 1PDNC 1ZGWA 2X6XA 4CICA 1X3ZB 5FLXK 3ZXSA 4M3DA 1MBKA 2EIKH 4WWCA 3QP5A 2ZKZA 4I6ZA 3HUGA 2E19A 2E1CA 2VE8A 3C7JA 1UMQA 1KZHA 5LHGA 1OMIA 3SDBA 2F5EA 2BV6A 3CO7C 2V6CA 1S72I 5JLXA 3BR0A 3G1OA 2MD5A 1QNTA 3GCMA 3LSMA 4D9JA 1X4PA 5FRMA 4HNUA 1GVDA 3WTVC 2L9VA 1YS7A 2EZLA 2L02A 3PQKA 1QPMA 3DPUA 2A68F 2HQNA 1BOBA 1WJEA 3QOPA 1Y1WJ 4C3HJ 3OR2C 3WTWC 4OIQF 3OIOA 2G9WA 4M73A 5F04A 4J00A 2CUJA 3LA7A 2RAEA 3WTYC 2A3SA 1P2FA 4Q5SF 2F48A 3DEEA 1I1SA 4HZFA 5FD5A 5IP7J 2YS9A 1R6RA 1FP1D 4EM1A 4I0AA 2L7MP 4BQNA 5GADJ 4F3QA 3BC8A 3M1CA 3A2KA 4XLNF 1LVKA 4XRMA 2E2JJ 2HPIA 1RRJA 3U9GA 2I8DA 4I7HA 4KYWA 1O57A 5FB2A 2AQEA 2DMTA 4UV8A 5HODA 2KHMA 2IAIA 4WF2A 5K1YA 3BDDA 5JFRA 3GTPJ 1RETA 2VKDA 2OZUA 3QYEA 1U0JA 3GTOJ 4HSTA 3EYYA 2H8WA 4ZH4F 3QYBA 4OU0A 1YI2I 1APLC 1VNDA 3ECHA 1UG0A 4MQVA 1R9TJ 3EUHA 2LR8A 3JRAA 4GYGA 5DYMA 5EF6A 5F08A 4RLFA 2FEZA 5HVQC 2EZKA 2LY1A 4NQWB 3C1DA 1V5FA 2JRMA 4LIVA 4UUVA 3RI4A 1FY7A 3KE2A 3HTSB 4ENMA 4PJNA 2R7QA 4L5EA 3R0JA 1QU3A 2R7TA 4W1UA 5IYCJ 1K4TA 2DA7A 1T56A 1XX5A 2XAJA 5FFXA 1WI3A 2PFBA 2UUZA 3KX2A 3ELKA 4PSWA 1YE9A 2MABA 4HF0A 3R6SA 1D1BA 1HLVA 5DM7F 3RYRA 4ESFA 2DLLA 2D45A 4U87A 2PMHA 2VJ5A 2R7UA 3BR1A 4B43A 2BVMA 3O8HA 3BTCA 1ZREA 3KP2A 4GYIA 3M1EA 4X0GA 2DI3A 2OQGA 4RM3A 3FM5A 5DD4A 4IRIA 3GBGA 4AIJA 2KRFA 2XAGA 2DDAA 4G12A 4XSXF 1ZLJA 2YR2A 2IP2A 5FLXZ 2K27A 2NYXA 2WC2A 2EFWA 2BE5F 2L7ZA 4NHJA 1LJ9A 4RBOA 2ZMEB 3AG1H 1UHSA 1MMSA 2NVQJ 3G3ZA 2E5NA 2DA5A 4PUSA 1S6LA 4UHTA 1V5EA 1HDPA 4U7BA 3VYSB 2EFNA 1Z05A 1SD6A 2JUCA 2XB0X 3MVPA 4M71A 2JZYA 3OR1C 1A6IA 3SDGA 2P5VA 2PQ8A 3KZIC 3E5UA 4XLCA 4LITA 5CVJA 5FKMA 1JT0A 1I6XA 1P9QC 1JUMA 4CZCA 2ZC2A 3FIWA 2M2EA 3LFKA 4BBRJ 4AIHA 4FISA 5IPAA 2Q8KA 1HW5A 2VJJA 1OCOH 3FBNB 3V7SA 1TZLA 1MNMC 3KEOA 5E79C 3LSTA 5JVTA 5B3SH 4ENNA 2JSCA 3QYFA 2FU4A 1FOWA 3KYDB 3FZVA 2ID6A 1DDNA 4F52A 4HX8A 2F4MB 3V42A 2KLOA 3FK6A 1BN5A 3M7GA 5DCFA 2K9SA 2NAZA 1VQ6I 3ISPA 2O3FA 3C2HA 1F5TA 2E7XA 3DQVC 1JGSA 4HV5A 3GWZA 1V5GA 4ZZLA 5ILVA 3DEUA 3I0TA 3SEQA 3QPHA 5IT3A 1HBXG 1MMNA 2Y9ZA 2BXZA 1XB4A 3JAMZ 5E1ZB 5E8GA 4ETSA 3VODA 1OR7C 2WB1N 5TJJA 1FP2A 3BG6A 4M3FA 1IXRC 4U7DA 1BI1A 3GZ5A 3DBRB 3VSKA 3H3VK 2RNGA 1Q1HA 2NOJB 1JHHA 4ZDLA 3WE2A 2E1NA 2LF8A 2ZSHB 4AYBA 3JSOA 2CRGA 4HF2A 2NVTJ 3DKWA 5TRDA 4QPQA 3F3XA 3KEYA 3ZCOA 3JRGA 3N05A 5IOZA 4E7IA 3MQ0A 3RPUA 3L2QA 2VQCA 3A02A 2VQGA 2HZDA 4PGHA 1WH5A 4I09A 5CVRA 2DK8A 3Q5FA 3IHUA 3U2RA 2KZGA 3JCUC 1D0YA 4I0BA 4S0HB 5KK1A 4A3IJ 3TBIA 4Y4RA 4IHTA 2Q2EA 3L7WA 5HDGA 2HWVA 3CJNA 4II3A 2LK2A 3CUOA 5DCMB 4LLLA 1HC8A 1IGNA 1WI9A 1O7LA 2DQLA 2EIJH 2HQRA 1IF1A 2H1LA 1FTTA 4GGGA 3C2GA 2ADUA 1FPQA 1RNLA 3I4MJ 3HZJA 4HEA2 4XLFA 4UB8C 4AYBN 1X1AA 2D1HA 3LSKA 3T5XA 3D5SC 5J47A 4XNFA 1QRYA 3ZQHA 1LE8B 4CDGA 4P96A 3WG9A 3BT9A 2XPWA 2E1MC 1LFUP 2R7ZJ 1IN6A 3NARA 4EJUA 2B9SA 4W97A 1J2XA 5HLIA 3GFLA 1HF0A 2ZFUA 4G9YA 1SFEA 2A69F 2KDOA 3V4GA 3S32A 4I2OA 4KIGA 5AONA 3NEUA 3EDPA 5E3OA 1XMXA 2DK5A 3ABUA 1VQ5I 1MGTA 2OV7A 2VBXA 1R7JA 4BXUA 2QQAA 2EZIA 2FNPA 4I76A 4HQMA 4IRGA 4YFKF 4A3EJ 5AIQA 9ANTA 1JKPC 3DPTA 3DU6A 5AIPA 2KIUA 2BW3B 2BYVE 1K83J 1Z3YA 3U1DA 2Y2ZA 4ZC3A 2FJ1A 3BJAA 1N77A 1XSDA 5HNFA 4BHCA 3A03A 1MJ9A 1YO5C 5IP6A 4NQWA 4C9YA 2PX9A 3F21A 5L3BA 3DXJF 3TOAA 2ZSIB 4BEHB 1XSXA 4AU7A 1RR7A 4LIUA 1PJRA 2JN6A 5LD2C 1B59A 1L3LA 3CESA 5EZGA 4A3JJ 1UJ8A 2EV6A 3TW6A 3PSFA 4II2A 3HOYJ 3KP7A 4BU2A 3HGYA 4QWQA 3IRRA 3JRFA 4PZJA 1WH7A 3W6KB 1I5ZA 3E5QA 4QTRA 1J9IA 5TGTA 2X6WA 3SEZA 4OIPF 1AOYA 3R60A 1LEBA 5DTDA 4EVIA 4PJLA 3QWLA 2M0CA 1QA6A 2DCEA 2IGNA 2CJJA 4G6QA 2CGPA 3BG5A 2ESNA 1Y0UA 2IT0A 2LH9A 1D5VA 2IPQX 3FXUA 3OYJA 4CCMA 1UAAA 2IS6A 3FXRA 1G3YA 3ZR8X 3DU5A 1UELB 2HVQA 3E6CC 1LB2A 2ZXJA 3GF2A 1YIJI 4BQAA 3AL0B 2X48A 2O5RA 4WCGA 2H6BA 1AU7A 1W7PB 1SANA 2M30A 1YJ9I 2ZMEA 3BZKA 1J75A 2VQLA 2X51A 2HGCA 3PSIA 4E7ZA 2R5YB 4S04A 4G7ZF 4XRSG 2RQQA 2L01A 3PM1A 3HRSA 1BIAA 3FMSA 4AIDA 3HYIA 2ZXWH 1XSVA 2ETHA 3PJRA 2BY2A 2VASA 5GAGJ 3X2QH 5L3EA 4LB6B 1JXSA 1L0OC 1GDTA 3LQRA 1DP7P 1ZGJA 3EUHC 2PEXA 2Z5UA 3CUQA 2QUFA 3CTAA 5HNHA 3MMYB 2IA1A 1E3OC 4A6EA 3HEFA 4CSWA 2NS0A 3CCMI 2L3DA 4HX4A 1DGRM 1J5YA 4IOAF 4Y33A 2HVSA 2NNYA 4CCLA 4UVAA 2DT7B 2IW5A 1I50J 2VXZA 2KT0A 1U78A 4XSZF 4U88A 1JE8A 5KVRA 1M1EB 3GVAA 2HVRA 2PG4A 2ZNZA 1LVAA 2Y0SA 3SZTA 3T1BA 2XC7A 1ERDA 1IRXA 2E35A 2MA3A 3OL4A 4G94A 3GEZA 1JTYA 1MNDA 2FX0A 4E7JA 2M4GA 2MC4A 1MSFC 3W2AA 3CDIA 3BLYA 2VIXA 2XAFA 2DFIA 4B44A 1PP8F 3BCAA 2GLOA 4R8HA 2NS8A 2W1OA 3PUBA 4XONA 2Y69H 4XRFA 3JRBA 3KZZA 3I9V2 2F6CA 3FK7A 1ZYRF 4DYCA 3UKGA 2FBIA 1SD5A 2LTPA 4KICA 4QSHA 4V2FA 3CF5F 3DLLF 4BQOA 1BI0A 1TQIA 1OQYA 4MGRA 4RB1A 3CO6C 4EM0B 2Y0SN 4ZYAA 2E71A 2HS5A 5D6FA 1GT0C 5C4XJ 5F1JA 3NWTA 1ACIA 1SFXA 2W84A 5DCMA 1RZ4A 3ZQ7A 1F4KA 2WAFA 3QODA 4AWXB 5EZHA 1DPRA 5HLHA 2EFPA 3BY6A 3TOBA 2LVSA 1Z77A 3G1LA 3GZ6A 3CP8A 1RR8C 4EQQA 5D5VB 4EATA 1YJWI 2Z99A 4V19K 2JVGA 3A4CA 4IJAA 2XF6A 1P4XA 2DOAA 1LDDA 1QGPA 3HSFA 2X1DA 2DU9A 1LE8A 2KIQA 1Y8QB 5JR3A 2V7FA 2IA2A 4D5CA 2MSYA 4M72A 3JRIA 2K5CA 5FFZA 2R0QC 4YELA 1FZPB 1KQ8A 1YX3A 4HRIA 3HDDA 2FF4A 1VQMI 2ELKA 3L2VA 2VXDA 4Q48A 3HBLA 3H9GA 1VQ4I 3WTXC 3R61A 2K9QA 3RKWA 4J01A 2E2HJ 2HTJA 3QAHA 1ZK8A 4AM3A 3K69A 2DODA 2HEOA 2V26A 5L3DA 3QU3A 5GAHJ 1XGOA 1W0TA 2HDCA 1TC3C 4GXOA 2BHZA 3QPSA 5J1UA 5M5YJ 3J7ZI 1H89C 4C2TA 2Q0OA 5LLQA 3HHHA 1TQPA 3RDIA 3I54A 4MFEA 3GZNB 3ZOBA 1S7OA 2HDDA 2QENA 4CGZA 1QVUA 4KIBA 5E1WA 1R1VA 2VBZA 1K79A 4XBFA 1DP3A 1ZELA 4BEHA 2OCEA 1XGSA 5D5XB 1KQ9A 3GTJJ 2FMLA 1J7KA 1Z3XA 5F0FA 3HGGA 3FKIJ 4HOBA 5K5RA 2EA4A 2IBDA 1ZTRA 3AFHA 4BNCA 3FDYA 3I55I 3RPUD 2WAEA 2L7KA 1QZEA 1Y56A 1YW7A 4RB2C 2LF7A 3DTIA 1DQUA 4L9VA 3ZQIA 2R92J 3H5NA 3OY9A 2GIZA 1ULYA 1K7AA 2P7VB 3OS0A 1K78A 2JJ7A 3K4KA 3IH4A 5LEKA 2HXIA 2MFZA 2OF7A 3HOVJ 3FMRA 4HG2A 1DU0A 4S05A 4A3GJ 5CVVA 4BACA 1R4NB 5EGOA 1MZBA 2QBYA 4ZDOA 3W2WA 2CQ7A 3MWMA 1A6QA 2X6OA 4MIMA 3HOUJ 4NDLA 4EV0A 2KJCA 1IRGA 2W4SA 1R58A 1FT9A 1OCZH 1W7PA 4IKFA 2M7BA 2GZWA 2RC4A 3CCVI 1GUUA 1R1TA 4MQ9F 4QIWN 2R5YA 2MG4A 5J8FA 2XGCA 3TDUC 4JOMA 2NRAC 4FX0A 4RAZA 2J5PA 1VQLI 5E3NA 2PMZA 3F6OA 1FWZA 2EJRA 1HXDA 3L2WA 3S14J 4HX7A 4OAYA 4KISA 5JHUA 2XSDC 1ETOA 2LC2A 1UCRA 1ON1A 3KLOA 3KP6A 1Z67A 4B1RA 3BPXA 2WADA 2HPMA 1F36A 1XGMA 5CJ9A 1TWAJ 4XOPA 3W6VA 3BG9A 2V79A 4YFNF 2V1XA 3E0JB 3M3YJ 2LNBA 2CU7A 4HF1A 2IGOA 1BR2A 1KQ0A 2EFOA 3PNVA 3VPRA 3HOWJ 3D5LA 5KHDA 3CCEI 1KYZA 2Q2EB 2F4IA 3CMAI 4AVZA 1TTYA 3H9JA 3J80K 2L54A 5LGNA 4JBAA 5BPIA 3ZGKA 1VQ9I 2PMZN 2H27A 4XKBA 1X1CA 3ZP5A 1U3EM 4QPOA 5EEHA 4NB5A 5HDNA 3ZQFA 3ZMSA 1JUSA 1ZR4A 3J7AO 2EQRA 2P5LC 4BJ5C 1FYMA 4L5JA 2LSOA 3SZGA 1POGA 3VYRB 3S16J 2BGCA 2E1OA 2X9DA 3LSIA 1XMKA 2W7NA 3GTKJ 2NXNB 1FSHA 2LP0A 4MNUA 1MBJA 2ZMEC 1CGPA 2V1NA 1WHUA 5GTIC 2O8XA 5J1YA 2KPMA 2GBYA 3KP3A 2IXSA 3ECOA 2DA6A 1ZQ3P 2NNNA 3JSPA 2HI3A 3RKQA 3O8GA 2CV1A 4YEJA 3EETA 4DBRA 2VUMJ 3ZQQA 2ZJQF 2FSWA 4WXCA 4IX7A 2Z2SB 4AIKA 3P9KA 1KU9A 4UNOA 3GFMA 2K02A 1GLNA 5F1RA 5JI6A 4XMYA 4CCNA 1U8RA 4A0YA 3W3CA 1T98A 5LFAA 1X3UA 1MSEC 1IN5A 2HFHA 1ETKA 1YW9A 3H1CA 2M7AA 4DNCA 3H92A 2R3SA 3A01A 3F22A 1WJDA 3MZYA 4V2GA 2YU3A 2CFXA 1ONVA 4CH7A 4EGZA 5F27A 1YLFA 2QQBA 2YPRA 3L9FA 2YX7A 4XR6A 1P7JA 4YIFA 1W5CC 2H09A 4KIFA 4PJ0C 3LL7A 3EUKL 2YU9J 3GW2A 2LD5A 3VWBA 3HM5A 4ON0A 2JT1A 3DKYA 1D5YA 2EV5A 1OCPA 1OYWA 5BQTA 2ME0A 2BOLA 5FD6A 3WODF 3GXOA 3LFUA 3CC4I 2Y30A 5EEAA 4CHUA 2H8RA 1XDSA 4GO1A 2A5WA 2CW7A 2DMUA 3ZMZA 2OJED 1BM9A 3PIPF 2P8TA 6PAXA 1YRNA 2P0WA 2O61A 4M3EA 1Z0XA 2DTZA 4YRVA 3UNGC 2H94A 4OIOF 2VQHA 3TP0A 1ZG1A 2P6SA 5HLGA 5F64A 1IXSB 1WWXA 3L2RA 2QGUA 1AKHA 1OISA 3ZMUA 2GA2A 4BDYA 1O3SA 1MDMA 5HOOA 2EV0A 1WJBA 1JJ6C 3CC2I 3G4SI 4L5IA 2K86A 3Q0WA 3MZHA 3FISA 3S3NA 2ZJ2A 1H0MA 3I58A 4ITVA 1JHFA 3C18A 2M4KA 2IS1A 2WB1A 5B1AH 1QHHD 4A5NA 3QPLA 1ETXA 4MTDA 3CDHA 3WGHA 4I02A 1O3QA 2DT5A 4G6DA 1MNEA 3KCCA 1WFXA 4JX5A 2XIGA 3CUQB 4YFXF 3J80Z 2UV1A 3GLXA 5FROA 3FHNA 3OS1A 3T0YA 1TWFJ 1SC7A 1CF7B 2P7CB 2ESHA 3FXJA 4ZJZA 1HOMA 1U9OA 1YOVB 1A31A 4EJTA 3RKXA 2R5ZA 1X19A 4HLXA 4L9NA 2LY9A 5E18F 3GO5A 4H4KC 4BAYA 2MW8A 1ETQA 1B72B 2MD0A 4O3MA 3CMEI 1ZAOA 1ZN2A 2VL8A 3CD6I 5L3GA 5IT9K 1PYVA 5IYDJ 4KN7X 1P4AA 2HQ5A 4LK0F 4Y15A 4XLPF 2HR3A 3LSPA 2CW8A 2VOOA 2BY0A 3PFYA 3TKYA 2TDXA 3KYCB 1LPQA 3GX4X 2QQ8A 3LA2A 1SFUA 3H0DA 3TO7A 3RJPA 1X1PA 5E1XA 3S3MA 2LYCA 1IUYA 1F9NA 4XL9A 5D5WB 4B8XA 2FQ3A 2I5UA 2M9HA 2XKOA 3FXQA 1I27A 4DW6A 3HPHA 3P9IA 4JX6A 1E3PA 5GPAA 4Q4ZF 3A1YA 4UVBA 1VQNI 2P6TA 3BCBA 2V4JC 5J40A 3B02A 2A5YB 2DOFA 3H5AA 3DF8A 5F0HA 1Z21A 2KRHA 1USSA 3H36A 2RREA 1R5HA 2LKXA 1K6OA 1G3SA 1G4DA 2Z9OA 1TQMA 1EJ9A 3A0HC 3M8JA 1E17A 1WGXA 1O3TA 1WJCA 1G8XA 1NG6A 2E2IJ 5FKLA 4E7LA 1HQCA 2W48A 3FKJA 3K4NA 2M8EA 2P81A 3FWEA 3TGNA 2ISYA 4ZTFA 3WG7H 1V4RA 4XN0A 4XORA 4RGUA 1ZHFA 1FYLA 3FXKA 1X2MA 1EV7A 1QZYA 3NAUA 2VN2A 3HOXJ 3T8RA 3Q3SA 3CLOA 4RGRA 1RPWA 2FNAA 3HRTA 1VI0A 2EILH 3ROUA 2XUBA 1NH3A 5GAEJ 1S9HA 4P9UA 1RKTA 2VKHA 4A69C 3QPTA 1N75A 4KJZA 5E17F 3CP2A 2D2WA 2OQRA 5BOXA 2IVMA 1W0UA 1FYKA 1ETYA 2O6GE 2QKLB 3QQAA 3AL0C 2BHYA 3F8FA 3KP4A 2CUZA 4BDZA 4M6XA 3L1PA 2EIMH 1A5JA 2DYRH 1G3WA 3ZPLA 4OWRB 3CMMA 4EJWA 3G73A 2XPUA 3I3LA 2M1BA 1ETVA 4G6TB 5LGTA 5CPRB 2FUG2 4E7SA 4OAZA 1W7PD 1H9TA 1P92A 3CQZJ 1OKRA 4Q47A 3HOSA 1ZH5A 2XPVA 5E8IA 1LKXA 3TW7A 4P5OA 2JVHA 2D5VA 2CFOA 2GQQA 3PO3J 4EEFG 3OV8A 3D0SA 5EJCA 5GTHC 1Y0NA 2F5FA 3BP8A 1Y39A 2CYYA 1Z7UA 2OC6A 4DZJA 5FKKA 2QQ9A 1TP4A 1AHDP 4HAMA 2PJPA 1EH8A 3AG4H 1VQ7I 2YUSA 1MH3A 1TWCJ 3AKZA 2VBYA 3K7AJ 4PK4A 3H9QA 4HV6A 3JRCA 4IF4A 3BR3A 2GWRA 4B3XA 3MCZA 2IRFG 2ZB9A 3LA3A 3HOZJ 3KLNA 2R7FA 1IXCA 4PFOA 3SZPA 1WSUA 4OOIA 1CQTA 4ZZDA 3LSRA 3OYDA 2ICWG 4FCYA 1SFKA 5FKOA 1R1UA 4CCJA 3IKVA 2R7WA 2VKVA 5F0CA 5J3LA 3L2UA 5DS9A 1U6GA 1J0RA 2OUMA 3OS2A 1KYWA 2FD5A 2MYSA 3F8CA 3VSLA 4BJ6C 1K78B 1G59A 4IXAA 5IT9Z 1AA7A 3WU2C 4RGSA 4BQQA 4ZYDA 1SD4A 5EGOB 4E7HA 2QBYB 3K6GA 3FBIB 3JRHA 4L0ZB 3JW4A 3S2DJ 1R00A 2O03A 1TW3A 5DUIA 5FLMJ 3KYLA 1U9NA 3TQNA 3E6MA 2E36A 1HKQA 4OINF 3V7CA 1P4WA 3DWLE 2VJIA 1KU7A 1BR4A 2L9RA 1HSTA 3W6JB 3SFZA 2XRLA 2NOGA 1FEXA 3ABMH 2CQKA 4HPQA 4ANJA 1LNWA 4FETA 1K61A 4M9XA 2I10A 1NG7A 3OIPA 3GYHX 1ORKA 2UWMA 3IAS2 2M45A 4M3BA 3ASNH 4IOCF 2DW4A 1FMWA 1BI2A 2E34A 4GRIA 3ZMVA 4DBQA 2L0KA 3WU0A 2F5VA 2AS5F 5D4RA 2XAQA 1OLTA 4G8XA 4BXXJ 3ASOH 3I64A 2HU9A 2XDVA 4L9JA 3HKZA 5D5UB 1BR1A 1TNSA 3I5UA 3NQOA 2FA5A 2QEXI 4FHTA 3CCJI 5KAFC 1CF7A 3E3VA 1R23A 2GXGA 3T8TA 3WE3A 1EF4A 2CG4A 4FTHA 4WX9A 2K40A 2XGDA 4P55A 3RTRA 2A05A 1UHWA 4PGGA 2ECCA 3SXYA 3VEPA 4D7MA 1X4OA 4LB5A 2R7RA 2X1EA 4HSRA 3OYAA 4RAFA 4BKXA 1HKSA 1T39A 5FKNA 3PNTA 1EH7A 4FE7A 3PO2J 2G0EA 1B72A 2QKMB 3HB9A 1FBSA 3AG3H 1R22A 1XC5A 3ZMTA 4AC0A 2J5OA 3IL2A 3HOTA 2WA0A 4KUMA 2CS3A 3OYEA 2Z3YA 2UXNA 2ZNYA 2FXAA 1R5GA 1QO0D 4A3LJ 1IN8A 1DUXC 2ZXIA 3WTTC 4BBSJ 5E3LA 4B4CA 4UVCA 4EM2A 3HKZN 4RM2A 4ESJA 5K7FA 5CVIA 2QVOA 3V7RA 3ZQGA 3TEDA 3IV5A 4BHBA 3K1NA 1TBXA 2F5DA 5C3EJ 4DGWB 3SHFA 4MEYF 3E7LA 2HOTA 4LG3A 1R5ID 2DXIA 3OYKA 1B6AA 1W5TA 2L9NA 4HYEA 1U2WA 1D8JA 3BTIA 4HDUA 1T8IA 1I3QJ 4A3DJ 1KU3A 1OCCH 1QQIA 1FTZA 2DMPA 5JVGF 4L9TA 1IRZA 1A35A 2ACJA 1ENHA 1Y6IA 2VC0A 1TW2A 1ON2A 2DQRA 2XASA 2RQPA 1XMAA 2RKHA 3I56I 4MEXF 1G2HA 2Y31A 4M6VA 2K85A 2KP6A 1XTAA 2DYSH 1UZCA 4P9FA 2XF7A 1FOXA 3JTHA 4BE1A 4U0WA 3RQ4A 2LBFA 4LG0A 1YX5A 5ED4A 3A0BC 2QA4I 2WAQN 2OAZA 2LY2A 2A6EF 3ERMA 4XQFA 3HSEA 2AQFA 3MZ8A 3A01B 2DA1A 4XN3A 1XN7A 4KT6A 2NVXJ 5K7ZA 2KKOA 2RNJA 1ZARA 4B47A 2QSGX 1GVJA 1Z6RA 4CCKA 3S17J 2XAUA 2XROA 3BOQA 3HC7A 4RGXA 1BBYA 1ODDA 1E0EA 4LMYA 1SMYF 2FOKA 3ML6A 3OYIA 3IC7A 1J09A 4A3CJ 2GXBA 2X6YA 2OBPA 1V54H 4BE2A 2JA5J 3RQIA 3EQLF 2W25A 1IRFA 3WTSC 2GIVA 3JTGA 3S15J 2FRHA 1RUNA 2C6YA 3GUDA 3GTLJ 3L2CA 3TMOA 2JWTA 1U5TB 2JA2A 4BS9A 4Z6YA 4RAYA 5F6FA 3WHBA 1YRNB 1YJNI 4KMUX 1V3FA 4D1QA 3BG3A 2QSFX 3FXMA 4DYQA 5GP9A 2GAUA 1HW2A 1AKHB 4F55A 1SVOA 2FBKA 5BPDA 2PBIA 5L3CA 1MDMB 2RN7A 1KGSA 1TLHB 3IUOA 4BGDA 2Y75A 1MBFA 1WJ5A 2NVYJ 2L4MA 2RGVA 1SFOJ 3SYTA 1T0FA 3O6BB 2LOOA 3K4CA 2EZHA 2B63J 1JI8A 2VPRA 5JHFA 4A6DA 5DM6F 2G7UA 1GV5A 1BW6A 3B6CA 2E60A 3NRVA 3J81K 1IDYA 1I1GA 3E97A 2CUEA 4NC6A 5J1RA 2CWEA 1XDUA 2VBWA 2XF5A 3DLAA 2WV0A 5DV5A 4LGWA 2R5ZB 1LDJA 2CSOA 3E5XA 4M6YA 1JUPA 1WQ2A 4EMSA 2QZ8A 4ABZA 4UV9A 3CCQI 3ERED 1YITI 2LKSA 3FM3A 1B1BA 1O3RA 3EUAA 5CVUA 1MIJA 3V8JA 1UB9A 1YQAA 4DYRA 4HA8A 2TRTA 2M3AA 5J6XA 1IO2A 1FNNA 4X1EA 2UZKA 1XCBA 2JMWA 4YG2F 1RUOA 1VF9A 4ZYEA 4XLHA 1YHQI 1MD0A 1RI7A 4D5FA 2Q1ZB 2MH9A 3JR9A 2CV0A 3IP4B 2MH2A 4JK1X 3BTJA 2DFHA 3F0CA 1VQKI 5D6EA 3IRQA 1QHGA 3HTUA 5EG0B 2W00A 3P5JA 3IH2A 4M9ZA 2V6EA 4BXFA 2W57A 1R4MB 1DGWY 1IW7F 2AHQA 3DV8A 3G2BA 3I4NJ 2KIMA 3HXLA 4XLEA 3FHZA 1MJAA 4EJOA 3DCFA 4WXHA 4G7HF 4ESBA 2R4GA 2ISZA 3DPLC 2L9SA 2ZJRF 3M4OJ 1IV8A 1Y1VJ 4K2EA 2COMA 1UG2A 1T38A 3CMYA 2QCOA 3K70C 4QLCU 1D0ZA 3ESWB 4M9SA 4RB0A 1P6RA 2CQQA 4JQFA 3TO9A 3LSJA 2HDWA 2VKEA 4BYYA 2ECBA 5ICCA 2R93J 1S29A 5C44J 4F93B 3OYLA 1FBUA 2JA6J 1S8NA 2IS2A 4WK8F 1FIAA 3H3UA 2VOPA 2JA7J 4GCVA 3BR2A 3K70D 1HCRA 2WY8Q 1MMGA 1OYIA 4RA2A 2DO7A 3S8PA 1V55H 2IGMA 3K10A 2PJRB 1LEAA 1UHMA 3D1NI 2CH0A 2LRDA 4BY1J 3HHGA 3BR5A 4I98B 4AVPA 3ZMDA 5IYBJ 2R7SA 2FMYA 5LEJA 5CKTA 3F72A 3N4MA 2CQXA 3C2BA 1C0WA 5ICFA 3O2PE 4MO7A 5L3FA 1O4XA 5IY5H 1QZZA 1GXQA 1X58A 3H35A 5ILSA 3PFIA 3H5RA 4E70A 2AXLA 3JREA 3JAMK 2BXYA 4ENJA 4A3MJ 2XHKA 1NK3P 4AD9A 5FRNA 3AAFA 1UFMA 4KDPA 2AO9A 3Q0UA 2K9NA 3S1QJ 3G6EI 1A36A 1JTXA 1LDKB 1O7FA 2CV2A 1TWHJ 3H0GJ 4KFCA 3HRMA 4P1WA 4OIRF 3OSFA 1Z9CA 4IL6C 3CUQC 1XGNA 4NBQA 3GTGJ 1X1DA 4LOCA 1ZRCA 3GLLA 3VFZA 2LFBA 3RIRA 4XRSA 3U21A 2KZVA 2L5QA 4A3KJ 3LQQA 4IZZA 4NC7A 3B73A 3GTQJ 3J81Z 2R7XA 3CLQA 4XOTA 3PQJA 1ZRDA 2JSPA 1WJAA 3M9AA 2GXAA 4C2MJ 3HRUA 2JPBA 4LK1F 2R7OA 3BQZA 3S2HJ 4A3BJ 2KRCA 3ZQCA 1D1AA 2CQNA 3WU1B 3PL8A 2UXXA 2NVUB
chains in the Genus database with same CATH topology
2P4WA 2GA1A 3TDZC 2Y48A 3ULQB 4U0YA 1U5TA 1BJAA 2L4AA 3MEXA 5CLSA 3I71A 2F2EA 1Z6TA 3VOEA 3P9CA 3F8NA 5CYVA 1IN4A 3TO6A 2D1VA 1E2XA 5D4SA 2WWYA 2CW0F 3K0LA 2V9VA 3M8FA 2MBFA 4U0VA 2XKPA 2RVCA 4Y13A 2HYGD 5ILUA 2EB7A 4HBLA 4Y17A 2QWWA 1SMTA 1F1ZA 4BHPA 5LHHA 3Q9VA 3FMQA 1OYYA 4N9HA 4RB3C 3COAC 2MLGA 3F8BA 1WRJA 5J8CA 3BPVA 5ICGA 2Z33A 2VT2A 2RDPA 2W85A 2H6CA 2LDUA 4Z2YA 2DTRA 4EGYA 3ZN1A 4PCQA 3WGIA 4CXFA 4IVNA 3BJ6A 3REOA 1YYVA 1S7AA 1QBJA 5H6QA 1IAWA 1WKMA 2QLZA 2STTA 3M8EA 4DQ2A 1S3JA 4OMZA 1FBQA 3V8KA 3V8LA 3GFJA 1YIOA 5DUKA 5E20A 2XV4S 3E6DA 3KZYA 2O0YA 5DEQA 2PN6A 2HZTA 1IN7A 3KP5A 1AWCA 2XVCA 2B0LA 2ZCWA 5BS6A 2HOEA 4LJZF 2ZBKA 5HS8A 2MC3A 2M5WA 1T6SA 2Y0MA 2K7LA 3ZN0A 1EH6A 3IWZA 5EEGA 2IA0A 4B09A 4LG0B 2FBHA 1FOKA 4L18B 1BC8C 4HLYA 5LHIA 1W4MA 5A2QK 2K4BA 2XGXA 3I4PA 5ERIA 3RYPA 2QYOA 3R0AA 4O6JA 4RS8A 1ZRFA 3EYIA 3FF5A 5D8LB 1PUEE 1G3TA 2X4HA 3I59B 2BBYA 2KJBA 2QM3A 4LFUA 1T2KA 4HDVA 5FO5A 2XRNA 1MKMA 4IHSA 5HS9A 2F5CA 4KT5C 3L00A 3E6BA 4PDKA 3F6VA 3KFWX 2KIFA 1KU2A 4KA4A 5DDGA 1GXPA 1BC7C 3BJOA 3DFGA 4KN4X 4M74A 1DPUA 1YG2A 2W24A 3DP7A 4HQEA 2K4JA 3R4KA 5LRSA 2OD5A 2V1DA 1OPCA 1BOAA 3N97A 2EWNA 2M87A 4IRHA 3O3KA 2OU2A 3P7NA 2MLKA 4N9IA 4H0EA 4KNYA 3F8MA 1YW8A 1FLIA 4ZYHA 3HSRA 5H20A 4YIIA 2DAOA 1FC3A 4BH9A 4MTEA 4LLNA 1J59A 2A6HF 1RIOH 2LKPA 2HKOA 1W5SA 1FSEA 1XD7A 1BI3A 4ASNA 2VONA 2E7WA 3QU6A 4LLGF 5H6RA 3H3ZA 4IPAA 4UXNA 1B4AA 4F7ZA 1IZ1A 3KETA 1USTA 4MHGA 1G6NA 2FE3A 2XAHA 5HDKA 5A2QZ 3MFKA 4OMYA 1LQ1A 1Z91A 5ICEA 1U5TC 5D8KB 4CO8A 1HKTA 2P5KA 1D8KA 3K1MA 3K1PA 2VT3A 5K5QA 2STWA 1H9GA 1YFHA 1R36A 4D0PA 3QP6A 5K5OA 5FGMA 2OZ6A 1B9NA 3WTZA 5HS7A 2BEOA 2ZFWA 1SD7A 4LD5A 4FX4A 5DD8A 4CYDA 4R79A 2PI0A 4ZYGA 4A0ZA 2CO5A 2EK5A 4WXDA 2RV8A 4A2UA 1Z1DA 2EFQA 2R7DA 1KA8A 3IKTA 1GHCA 4G7OF 1ZG5A 1D3YA 4CZZA 4A12A 4TV7A 3Q9SA 2HTSA 3S2WA 3VB2A 1A04A 1BIBA 3WGGA 2ELHA 2V1UA 2ZO4A 2VE9A 5LBQA 2PLYA 4N0BA 3K2ZA 1HW1A 3MAJA 5LRRA 2X0LA 3FX3A 3BWGA 1SAXA 2HKXA 1NHAA 3RKYA 3I53A 3K9TA 3HIFA 3I59A 2DBBA 2VC1A 1OR7A 3IWFA 1YTYA 2JRTA 3GFIA 4EJVA 1YS6A 2WTEA 3QRFF 3RPQA 2DPDA 3BROA 5BMZA 4ENKA 2G7HA 1REPC 2IJLA 3LAPA 3C3WA 1HSJA 1ZLKA 4FT8A 1PP7U 2VODA 4HW0A 3ABTA 1ZGAA 1ZG3A 2DPUA 1XCVA 2A07F 3BZ6A 4O5VA 4R1HA 3KEQA 1MJBA 2JPCA 4KMFA 3SQNA 2JTVA 1FX7A 4I01A 2EA2A 2A61A 3LWFA 1TNTA 4A0XA 1VTNC 3F23A 2PMUA 3L09A 3LAJA 2HYFA 2YSRA 4L0YB 3WTUC 3OOPA 2YX4A 5LGUA 2OA4A 1B9MA 4A5MA 1STZA 1PDNC 4CICA 5FLXK 4WWCA 3QP5A 2ZKZA 3HUGA 2E1CA 2VE8A 3C7JA 5LHGA 1OMIA 2F5EA 2BV6A 3CO7C 2V6CA 2MD5A 1QNTA 3WTVC 1YS7A 2L02A 3PQKA 1QPMA 2A68F 2HQNA 3QOPA 4OIQF 3WTWC 2G9WA 4M73A 3LA7A 3WTYC 2A3SA 1P2FA 4Q5SF 1I1SA 4HZFA 5FD5A 1FP1D 4EM1A 4I0AA 4XLNF 3U9GA 4I7HA 4KYWA 1O57A 5FB2A 4UV8A 4WF2A 5K1YA 3BDDA 5JFRA 2OZUA 3EYYA 4ZH4F 4OU0A 3ECHA 4MQVA 3EUHA 4GYGA 5DYMA 2FEZA 5HVQC 3C1DA 4UUVA 3RI4A 1FY7A 3KE2A 3HTSB 4ENMA 3R0JA 2XAJA 5FFXA 2PFBA 3ELKA 3R6SA 4HF0A 3RYRA 4ESFA 2DLLA 2D45A 2PMHA 1ZREA 3KP2A 4GYIA 3M1EA 2DI3A 2OQGA 3FM5A 5DD4A 4IRIA 4AIJA 2KRFA 2XAGA 4XSXF 1ZLJA 2YR2A 2IP2A 5FLXZ 2K27A 2NYXA 2WC2A 2EFWA 2BE5F 4NHJA 1LJ9A 2ZMEB 3G3ZA 1S6LA 4UHTA 4U7BA 2EFNA 1Z05A 1SD6A 4M71A 2JZYA 2P5VA 2PQ8A 3E5UA 5CVJA 1I6XA 3LFKA 4AIHA 2Q8KA 1HW5A 3V7SA 3KEOA 3LSTA 5JVTA 4ENNA 2JSCA 2FU4A 3FZVA 1DDNA 4HX8A 5DCFA 1BN5A 3M7GA 2NAZA 3ISPA 2O3FA 1F5TA 2E7XA 3DQVC 1JGSA 4HV5A 3GWZA 4ZZLA 5ILVA 3DEUA 3I0TA 3QPHA 5IT3A 1HBXG 1XB4A 3JAMZ 5E1ZB 5E8GA 4ETSA 3VODA 5TJJA 1FP2A 1IXRC 4U7DA 1BI1A 3GZ5A 1Q1HA 1JHHA 3WE2A 2E1NA 2LF8A 3JSOA 4HF2A 3DKWA 5TRDA 3F3XA 3MQ0A 3RPUA 4PGHA 4I09A 5CVRA 2DK8A 3Q5FA 3IHUA 3U2RA 4I0BA 5KK1A 4IHTA 2Q2EA 3L7WA 5HDGA 2HWVA 3CJNA 3CUOA 4LLLA 5DCMB 1WI9A 1O7LA 2DQLA 2HQRA 1IF1A 4GGGA 2ADUA 1FPQA 1RNLA 2D1HA 3T5XA 4CDGA 4P96A 3WG9A 1IN6A 4EJUA 1J2XA 5HLIA 3GFLA 4G9YA 1SFEA 2A69F 3V4GA 4I2OA 2UXXA 5AONA 3NEUA 3EDPA 2DK5A 3ABUA 1MGTA 2VBXA 1R7JA 4BXUA 2QQAA 2FNPA 4YFKF 4IRGA 4HQMA 5AIQA 3DPTA 5AIPA 2KIUA 2BYVE 3U1DA 3BJAA 1XSDA 4BHCA 1MJ9A 1YO5C 4NQWA 3F21A 5L3BA 3DXJF 3TOAA 1XSXA 1B59A 1L3LA 2EV6A 3KP7A 4QWQA 3IRRA 4PZJA 3W6KB 1I5ZA 3E5QA 1J9IA 4OIPF 1AOYA 3R60A 1LEBA 4EVIA 4G6QA 2CGPA 2ESNA 1Y0UA 2IT0A 1D5VA 2IPQX 3FXUA 3FXRA 1G3YA 3E6CC 1LB2A 2ZXJA 3GF2A 4BQAA 4WCGA 2H6BA 1W7PB 2M30A 2ZMEA 1J75A 2HGCA 4S04A 4G7ZF 2L01A 3HRSA 1BIAA 3FMSA 3HYIA 1XSVA 2ETHA 5L3EA 4LB6B 1JXSA 1L0OC 3LQRA 1DP7P 1ZGJA 2PEXA 2Z5UA 3CUQA 2QUFA 3CTAA 2IA1A 4A6EA 2NS0A 2L3DA 4HX4A 1J5YA 2NNYA 4UVAA 2IW5A 2VXZA 1U78A 4XSZF 4U88A 1JE8A 5KVRA 3GVAA 2PG4A 2ZNZA 1LVAA 3T1BA 3SZTA 2MA3A 4G94A 3GEZA 2XAFA 2DFIA 1PP8F 4R8HA 4XRFA 3KZZA 1ZYRF 2FBIA 1SD5A 4KICA 1BI0A 1TQIA 4MGRA 4RB1A 3CO6C 4EM0B 2HS5A 5D6FA 1SFXA 2W84A 5DCMA 1RZ4A 3ZQ7A 1F4KA 4AWXB 1DPRA 5HLHA 2EFPA 3BY6A 3TOBA 3GZ6A 4EQQA 5D5VB 2Z99A 4IJAA 1P4XA 1LDDA 1QGPA 3HSFA 2DU9A 5JR3A 2IA2A 4M72A 5FFZA 1FZPB 1KQ8A 2FF4A 4Q48A 3WTXC 3R61A 3RKWA 2HTJA 3QAHA 3K69A 2HEOA 5L3DA 3QU3A 1XGOA 2HDCA 4GXOA 2Q0OA 5LLQA 3HHHA 1TQPA 3RDIA 3I54A 1S7OA 2QENA 4CGZA 4KIBA 5E1WA 1R1VA 2VBZA 1K79A 4XBFA 1XGSA 5D5XB 1KQ9A 2FMLA 1J7KA 4HOBA 5K5RA 2EA4A 4BNCA 1YW7A 4RB2C 2LF7A 4L9VA 1ULYA 1K7AA 2P7VB 1K78A 5LEKA 3FMRA 4S05A 5CVVA 1MZBA 2QBYA 3MWMA 4EV0A 2KJCA 1IRGA 1R58A 1FT9A 1W7PA 2GZWA 2RC4A 1R1TA 4MQ9F 5J8FA 3TDUC 2NRAC 4FX0A 4RAZA 2J5PA 3F6OA 2EJRA 1FWZA 1HXDA 4HX7A 5JHUA 1UCRA 1ON1A 3KLOA 3KP6A 3BPXA 1XGMA 5CJ9A 2V79A 4YFNF 2V1XA 2LNBA 4HF1A 1KQ0A 2EFOA 3D5LA 1KYZA 1TTYA 3J80K 2L54A 5LGNA 4JBAA 5BPIA 2H27A 3ZP5A 1U3EM 5EEHA 4NB5A 5HDNA 3ZMSA 3J7AO 2P5LC 1FYMA 4L5JA 2LSOA 2BGCA 1XMKA 1FSHA 4MNUA 1CGPA 2O8XA 3KP3A 3ECOA 2NNNA 3JSPA 3EETA 2FSWA 4WXCA 4AIKA 3P9KA 1KU9A 4UNOA 3GFMA 2K02A 5F1RA 5JI6A 1U8RA 4A0YA 1T98A 1X3UA 1IN5A 2HFHA 1YW9A 4DNCA 3H92A 2R3SA 3F22A 3MZYA 2YU3A 2CFXA 1ONVA 4EGZA 1YLFA 2QQBA 2YPRA 3L9FA 2YX7A 4YIFA 2H09A 4KIFA 3GW2A 4ON0A 2JT1A 2EV5A 5BQTA 1OYWA 5FD6A 3WODF 3GXOA 4CHUA 1XDSA 4GO1A 3ZMZA 6PAXA 1BM9A 2P8TA 2O61A 2H94A 4OIOF 1ZG1A 2P6SA 5HLGA 5F64A 1IXSB 1WWXA 3ZMUA 2GA2A 1O3SA 1MDMA 5HOOA 2EV0A 4L5IA 2K86A 3MZHA 2ZJ2A 1H0MA 3I58A 1JHFA 3C18A 4A5NA 4MTDA 3CDHA 3WGHA 4I02A 1O3QA 2DT5A 4G6DA 3KCCA 3J80Z 2XIGA 3CUQB 4YFXF 3GLXA 3T0YA 1CF7B 2P7CB 2ESHA 4EJTA 3RKXA 4HLXA 4L9NA 5E18F 3GO5A 4BAYA 4O3MA 1ZAOA 1ZN2A 5L3GA 5IT9K 4KN7X 1P4AA 4LK0F 4Y15A 4XLPF 2HR3A 2VOOA 3TKYA 2TDXA 3GX4X 3LA2A 1SFUA 3TO7A 3RJPA 5E1XA 1IUYA 1F9NA 5D5WB 4B8XA 2FQ3A 2XKOA 3FXQA 1I27A 3P9IA 4Q4ZF 4UVBA 2P6TA 3B02A 2A5YB 3DF8A 1USSA 1R5HA 1K6OA 1G4DA 1G3SA 2Z9OA 1TQMA 1E17A 1O3TA 1HQCA 2M8EA 3FWEA 3TGNA 2ISYA 1V4RA 4RGUA 1ZHFA 1FYLA 1EV7A 1QZYA 2VN2A 3T8RA 3CLOA 4RGRA 2FNAA 3HRTA 3ROUA 2XUBA 4P9UA 3QPTA 5E17F 2D2WA 2OQRA 5BOXA 2IVMA 1FYKA 2O6GE 3F8FA 3KP4A 4M6XA 1G3WA 3ZPLA 4EJWA 3G73A 2M1BA 5LGTA 1W7PD 1H9TA 1P92A 1OKRA 4Q47A 3HOSA 1ZH5A 5E8IA 4P5OA 2GQQA 3OV8A 3D0SA 2F5FA 3BP8A 2CYYA 1Z7UA 2QQ9A 4HAMA 2PJPA 1EH8A 2VBYA 4HV6A 4IF4A 2GWRA 3MCZA 2IRFG 3LA3A 3KLNA 2R7FA 1IXCA 1WSUA 3SZPA 4OOIA 4ZZDA 1R1UA 3IKVA 1U6GA 1J0RA 1KYWA 1K78B 3F8CA 4IXAA 5IT9Z 4RGSA 4ZYDA 1SD4A 2QBYB 4L0ZB 3JW4A 1R00A 2O03A 1TW3A 5DUIA 3TQNA 3E6MA 1HKQA 4OINF 3V7CA 1P4WA 1KU7A 1HSTA 3W6JB 3SFZA 2CQKA 1LNWA 4M9XA 2UWMA 3GYHX 2M45A 2DW4A 1BI2A 3ZMVA 3WU0A 2AS5F 5D4RA 2XAQA 4G8XA 3I64A 4L9JA 5D5UB 3I5UA 1TNSA 3NQOA 2FA5A 4FHTA 1CF7A 3E3VA 1R23A 2GXGA 3T8TA 3WE3A 2CG4A 4WX9A 4P55A 3RTRA 3VEPA 1UHWA 4PGGA 3SXYA 4LB5A 1HKSA 1T39A 1EH7A 1FBSA 1R22A 3ZMTA 2J5OA 3IL2A 3HOTA 4KUMA 2Z3YA 2UXNA 2ZNYA 2FXAA 1R5GA 1QO0D 1IN8A 1DUXC 3WTTC 4UVCA 4EM2A 4ESJA 5CVIA 2QVOA 3V7RA 4BHBA 3K1NA 1TBXA 2F5DA 3SHFA 4MEYF 1B6AA 1W5TA 4HYEA 1D8JA 1U2WA 4HDUA 1KU3A 1QQIA 4L9TA 2ACJA 2VC0A 1TW2A 1ON2A 2DQRA 2XASA 2RQPA 1XMAA 2RKHA 4MEXF 4P9FA 3JTHA 4U0WA 4LG0A 5ED4A 2OAZA 2A6EF 3HSEA 1XN7A 2KKOA 2RNJA 1ZARA 1GVJA 1Z6RA 2XROA 3BOQA 4RGXA 1BBYA 1ODDA 4LMYA 1SMYF 2FOKA 3ML6A 3IC7A 2GXBA 2OBPA 3EQLF 2W25A 1IRFA 3WTSC 2GIVA 3JTGA 2FRHA 1RUNA 2C6YA 3GUDA 3L2CA 1U5TB 4RAYA 5F6FA 4KMUX 1V3FA 2GAUA 1HW2A 2FBKA 5BPDA 2PBIA 5L3CA 1MDMB 2RN7A 1KGSA 1TLHB 2Y75A 2L4MA 2RGVA 1T0FA 3O6BB 4A6DA 2G7UA 3NRVA 3J81K 1I1GA 3E97A 2CWEA 1XDUA 2VBWA 2WV0A 5DV5A 4LGWA 1LDJA 2CSOA 3E5XA 4M6YA 1WQ2A 4EMSA 2QZ8A 4UV9A 3ERED 3FM3A 1B1BA 1O3RA 5CVUA 3V8JA 1UB9A 1YQAA 4HA8A 5J6XA 1FNNA 2UZKA 1XCBA 4YG2F 1RUOA 4ZYEA 1MD0A 1RI7A 2MH9A 2MH2A 4JK1X 5D6EA 3IRQA 3HTUA 4M9ZA 2W57A 1IW7F 3DV8A 2KIMA 3FHZA 1MJAA 4EJOA 4WXHA 4G7HF 4ESBA 2ISZA 3DPLC 4K2EA 2COMA 1T38A 4QLCU 4RB0A 4M9SA 5ICCA 1P6RA 4JQFA 3TO9A 4BYYA 1S29A 1FBUA 1S8NA 4WK8F 3H3UA 2VOPA 4GCVA 1OYIA 2DO7A 1LEAA 1UHMA 3HHGA 4I98B 4AVPA 3ZMDA 2FMYA 5LEJA 3F72A 3N4MA 1C0WA 5ICFA 3O2PE 5L3FA 1QZZA 1GXQA 5ILSA 3PFIA 4E70A 2AXLA 3JAMK 4ENJA 2XHKA 4AD9A 3AAFA 1UFMA 4KDPA 1LDKB 1O7FA 4KFCA 3HRMA 4OIRF 1Z9CA 3CUQC 1XGNA 1ZRCA 3VFZA 3RIRA 3LQQA 3B73A 3J81Z 3PQJA 1ZRDA 3M9AA 3HRUA 2JPBA 4LK1F 3WU1B 4KIGA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2P4W A;  2GA1 A;  3TDZ C;  2Y48 A;  3ULQ B;  4U0Y A;  1U5T A;  1BJA A;  2L4A A;  3MEX A;  5CLS A;  3I71 A;  2F2E A;  1Z6T A;  3VOE A;  3P9C A;  3F8N A;  5CYV A;  1IN4 A;  3TO6 A;  2D1V A;  1E2X A;  5D4S A;  2WWY A;  2CW0 F;  3K0L A;  2V9V A;  3M8F A;  2MBF A;  4U0V A;  2XKP A;  2RVC A;  4Y13 A;  2HYG D;  5ILU A;  2EB7 A;  4HBL A;  4Y17 A;  2QWW A;  1SMT A;  1F1Z A;  4BHP A;  5LHH A;  3Q9V A;  3FMQ A;  1OYY A;  4N9H A;  4RB3 C;  3COA C;  2MLG A;  3F8B A;  1WRJ A;  5J8C A;  3BPV A;  5ICG A;  2Z33 A;  2VT2 A;  2RDP A;  2W85 A;  2H6C A;  2LDU A;  4Z2Y A;  2DTR A;  4EGY A;  3ZN1 A;  4PCQ A;  3WGI A;  4CXF A;  4IVN A;  3BJ6 A;  3REO A;  1YYV A;  1S7A A;  1QBJ A;  5H6Q A;  1IAW A;  1WKM A;  2QLZ A;  2STT A;  3M8E A;  4DQ2 A;  1S3J A;  4OMZ A;  1FBQ A;  3V8K A;  3V8L A;  3GFJ A;  1YIO A;  5DUK A;  5E20 A;  2XV4 S;  3E6D A;  3KZY A;  2O0Y A;  5DEQ A;  2PN6 A;  2HZT A;  1IN7 A;  3KP5 A;  1AWC A;  2XVC A;  2B0L A;  2ZCW A;  5BS6 A;  2HOE A;  4LJZ F;  2ZBK A;  5HS8 A;  2MC3 A;  2M5W A;  1T6S A;  2Y0M A;  2K7L A;  3ZN0 A;  1EH6 A;  3IWZ A;  5EEG A;  2IA0 A;  4B09 A;  4LG0 B;  2FBH A;  1FOK A;  4L18 B;  1BC8 C;  4HLY A;  5LHI A;  1W4M A;  5A2Q K;  2K4B A;  2XGX A;  3I4P A;  5ERI A;  3RYP A;  2QYO A;  3R0A A;  4O6J A;  4RS8 A;  1ZRF A;  3EYI A;  3FF5 A;  5D8L B;  1PUE E;  1G3T A;  2X4H A;  3I59 B;  2BBY A;  2KJB A;  2QM3 A;  4LFU A;  1T2K A;  4HDV A;  5FO5 A;  2XRN A;  1MKM A;  4IHS A;  5HS9 A;  2F5C A;  4KT5 C;  3L00 A;  3E6B A;  4PDK A;  3F6V A;  3KFW X;  2KIF A;  1KU2 A;  4KA4 A;  5DDG A;  1GXP A;  1BC7 C;  3BJO A;  3DFG A;  4KN4 X;  4M74 A;  1DPU A;  1YG2 A;  2W24 A;  3DP7 A;  4HQE A;  2K4J A;  3R4K A;  5LRS A;  2OD5 A;  2V1D A;  1OPC A;  1BOA A;  3N97 A;  2EWN A;  2M87 A;  4IRH A;  3O3K A;  2OU2 A;  3P7N A;  2MLK A;  4N9I A;  4H0E A;  4KNY A;  3F8M A;  1YW8 A;  1FLI A;  4ZYH A;  3HSR A;  5H20 A;  4YII A;  2DAO A;  1FC3 A;  4BH9 A;  4MTE A;  4LLN A;  1J59 A;  2A6H F;  1RIO H;  2LKP A;  2HKO A;  1W5S A;  1FSE A;  1XD7 A;  1BI3 A;  4ASN A;  2VON A;  2E7W A;  3QU6 A;  4LLG F;  5H6R A;  3H3Z A;  4IPA A;  4UXN A;  1B4A A;  4F7Z A;  1IZ1 A;  3KET A;  1UST A;  4MHG A;  1G6N A;  2FE3 A;  2XAH A;  5HDK A;  5A2Q Z;  3MFK A;  4OMY A;  1LQ1 A;  1Z91 A;  5ICE A;  1U5T C;  5D8K B;  4CO8 A;  1HKT A;  2P5K A;  1D8K A;  3K1M A;  3K1P A;  2VT3 A;  5K5Q A;  2STW A;  1H9G A;  1YFH A;  1R36 A;  4D0P A;  3QP6 A;  5K5O A;  5FGM A;  2OZ6 A;  1B9N A;  3WTZ A;  5HS7 A;  2BEO A;  2ZFW A;  1SD7 A;  4LD5 A;  4FX4 A;  5DD8 A;  4CYD A;  4R79 A;  2PI0 A;  4ZYG A;  4A0Z A;  2CO5 A;  2EK5 A;  4WXD A;  2RV8 A;  4A2U A;  1Z1D A;  2EFQ A;  2R7D A;  1KA8 A;  3IKT A;  1GHC A;  4G7O F;  1ZG5 A;  1D3Y A;  4CZZ A;  4A12 A;  4TV7 A;  3Q9S A;  2HTS A;  3S2W A;  3VB2 A;  1A04 A;  1BIB A;  3WGG A;  2ELH A;  2V1U A;  2ZO4 A;  2VE9 A;  5LBQ A;  2PLY A;  4N0B A;  3K2Z A;  1HW1 A;  3MAJ A;  5LRR A;  2X0L A;  3FX3 A;  3BWG A;  1SAX A;  2HKX A;  1NHA A;  3RKY A;  3I53 A;  3K9T A;  3HIF A;  3I59 A;  2DBB A;  2VC1 A;  1OR7 A;  3IWF A;  1YTY A;  2JRT A;  3GFI A;  4EJV A;  1YS6 A;  2WTE A;  3QRF F;  3RPQ A;  2DPD A;  3BRO A;  5BMZ A;  4ENK A;  2G7H A;  1REP C;  2IJL A;  3LAP A;  3C3W A;  1HSJ A;  1ZLK A;  4FT8 A;  1PP7 U;  2VOD A;  4HW0 A;  3ABT A;  1ZGA A;  1ZG3 A;  2DPU A;  1XCV A;  2A07 F;  3BZ6 A;  4O5V A;  4R1H A;  3KEQ A;  1MJB A;  2JPC A;  4KMF A;  3SQN A;  2JTV A;  1FX7 A;  4I01 A;  2EA2 A;  2A61 A;  3LWF A;  1TNT A;  4A0X A;  1VTN C;  3F23 A;  2PMU A;  3L09 A;  3LAJ A;  2HYF A;  2YSR A;  4L0Y B;  3WTU C;  3OOP A;  2YX4 A;  5LGU A;  2OA4 A;  1B9M A;  4A5M A;  1STZ A;  1PDN C;  4CIC A;  5FLX K;  4WWC A;  3QP5 A;  2ZKZ A;  3HUG A;  2E1C A;  2VE8 A;  3C7J A;  5LHG A;  1OMI A;  2F5E A;  2BV6 A;  3CO7 C;  2V6C A;  2MD5 A;  1QNT A;  3WTV C;  1YS7 A;  2L02 A;  3PQK A;  1QPM A;  2A68 F;  2HQN A;  3QOP A;  4OIQ F;  3WTW C;  2G9W A;  4M73 A;  3LA7 A;  3WTY C;  2A3S A;  1P2F A;  4Q5S F;  1I1S A;  4HZF A;  5FD5 A;  1FP1 D;  4EM1 A;  4I0A A;  4XLN F;  3U9G A;  4I7H A;  4KYW A;  1O57 A;  5FB2 A;  4UV8 A;  4WF2 A;  5K1Y A;  3BDD A;  5JFR A;  2OZU A;  3EYY A;  4ZH4 F;  4OU0 A;  3ECH A;  4MQV A;  3EUH A;  4GYG A;  5DYM A;  2FEZ A;  5HVQ C;  3C1D A;  4UUV A;  3RI4 A;  1FY7 A;  3KE2 A;  3HTS B;  4ENM A;  3R0J A;  2XAJ A;  5FFX A;  2PFB A;  3ELK A;  3R6S A;  4HF0 A;  3RYR A;  4ESF A;  2DLL A;  2D45 A;  2PMH A;  1ZRE A;  3KP2 A;  4GYI A;  3M1E A;  2DI3 A;  2OQG A;  3FM5 A;  5DD4 A;  4IRI A;  4AIJ A;  2KRF A;  2XAG A;  4XSX F;  1ZLJ A;  2YR2 A;  2IP2 A;  5FLX Z;  2K27 A;  2NYX A;  2WC2 A;  2EFW A;  2BE5 F;  4NHJ A;  1LJ9 A;  2ZME B;  3G3Z A;  1S6L A;  4UHT A;  4U7B A;  2EFN A;  1Z05 A;  1SD6 A;  4M71 A;  2JZY A;  2P5V A;  2PQ8 A;  3E5U A;  5CVJ A;  1I6X A;  3LFK A;  4AIH A;  2Q8K A;  1HW5 A;  3V7S A;  3KEO A;  3LST A;  5JVT A;  4ENN A;  2JSC A;  2FU4 A;  3FZV A;  1DDN A;  4HX8 A;  5DCF A;  1BN5 A;  3M7G A;  2NAZ A;  3ISP A;  2O3F A;  1F5T A;  2E7X A;  3DQV C;  1JGS A;  4HV5 A;  3GWZ A;  4ZZL A;  5ILV A;  3DEU A;  3I0T A;  3QPH A;  5IT3 A;  1HBX G;  1XB4 A;  3JAM Z;  5E1Z B;  5E8G A;  4ETS A;  3VOD A;  5TJJ A;  1FP2 A;  1IXR C;  4U7D A;  1BI1 A;  3GZ5 A;  1Q1H A;  1JHH A;  3WE2 A;  2E1N A;  2LF8 A;  3JSO A;  4HF2 A;  3DKW A;  5TRD A;  3F3X A;  3MQ0 A;  3RPU A;  4PGH A;  4I09 A;  5CVR A;  2DK8 A;  3Q5F A;  3IHU A;  3U2R A;  4I0B A;  5KK1 A;  4IHT A;  2Q2E A;  3L7W A;  5HDG A;  2HWV A;  3CJN A;  3CUO A;  4LLL A;  5DCM B;  1WI9 A;  1O7L A;  2DQL A;  2HQR A;  1IF1 A;  4GGG A;  2ADU A;  1FPQ A;  1RNL A;  2D1H A;  3T5X A;  4CDG A;  4P96 A;  3WG9 A;  1IN6 A;  4EJU A;  1J2X A;  5HLI A;  3GFL A;  4G9Y A;  1SFE A;  2A69 F;  3V4G A;  4I2O A;  2UXX A;  5AON A;  3NEU A;  3EDP A;  2DK5 A;  3ABU A;  1MGT A;  2VBX A;  1R7J A;  4BXU A;  2QQA A;  2FNP A;  4YFK F;  4IRG A;  4HQM A;  5AIQ A;  3DPT A;  5AIP A;  2KIU A;  2BYV E;  3U1D A;  3BJA A;  1XSD A;  4BHC A;  1MJ9 A;  1YO5 C;  4NQW A;  3F21 A;  5L3B A;  3DXJ F;  3TOA A;  1XSX A;  1B59 A;  1L3L A;  2EV6 A;  3KP7 A;  4QWQ A;  3IRR A;  4PZJ A;  3W6K B;  1I5Z A;  3E5Q A;  1J9I A;  4OIP F;  1AOY A;  3R60 A;  1LEB A;  4EVI A;  4G6Q A;  2CGP A;  2ESN A;  1Y0U A;  2IT0 A;  1D5V A;  2IPQ X;  3FXU A;  3FXR A;  1G3Y A;  3E6C C;  1LB2 A;  2ZXJ A;  3GF2 A;  4BQA A;  4WCG A;  2H6B A;  1W7P B;  2M30 A;  2ZME A;  1J75 A;  2HGC A;  4S04 A;  4G7Z F;  2L01 A;  3HRS A;  1BIA A;  3FMS A;  3HYI A;  1XSV A;  2ETH A;  5L3E A;  4LB6 B;  1JXS A;  1L0O C;  3LQR A;  1DP7 P;  1ZGJ A;  2PEX A;  2Z5U A;  3CUQ A;  2QUF A;  3CTA A;  2IA1 A;  4A6E A;  2NS0 A;  2L3D A;  4HX4 A;  1J5Y A;  2NNY A;  4UVA A;  2IW5 A;  2VXZ A;  1U78 A;  4XSZ F;  4U88 A;  1JE8 A;  5KVR A;  3GVA A;  2PG4 A;  2ZNZ A;  1LVA A;  3T1B A;  3SZT A;  2MA3 A;  4G94 A;  3GEZ A;  2XAF A;  2DFI A;  1PP8 F;  4R8H A;  4XRF A;  3KZZ A;  1ZYR F;  2FBI A;  1SD5 A;  4KIC A;  1BI0 A;  1TQI A;  4MGR A;  4RB1 A;  3CO6 C;  4EM0 B;  2HS5 A;  5D6F A;  1SFX A;  2W84 A;  5DCM A;  1RZ4 A;  3ZQ7 A;  1F4K A;  4AWX B;  1DPR A;  5HLH A;  2EFP A;  3BY6 A;  3TOB A;  3GZ6 A;  4EQQ A;  5D5V B;  2Z99 A;  4IJA A;  1P4X A;  1LDD A;  1QGP A;  3HSF A;  2DU9 A;  5JR3 A;  2IA2 A;  4M72 A;  5FFZ A;  1FZP B;  1KQ8 A;  2FF4 A;  4Q48 A;  3WTX C;  3R61 A;  3RKW A;  2HTJ A;  3QAH A;  3K69 A;  2HEO A;  5L3D A;  3QU3 A;  1XGO A;  2HDC A;  4GXO A;  2Q0O A;  5LLQ A;  3HHH A;  1TQP A;  3RDI A;  3I54 A;  1S7O A;  2QEN A;  4CGZ A;  4KIB A;  5E1W A;  1R1V A;  2VBZ A;  1K79 A;  4XBF A;  1XGS A;  5D5X B;  1KQ9 A;  2FML A;  1J7K A;  4HOB A;  5K5R A;  2EA4 A;  4BNC A;  1YW7 A;  4RB2 C;  2LF7 A;  4L9V A;  1ULY A;  1K7A A;  2P7V B;  1K78 A;  5LEK A;  3FMR A;  4S05 A;  5CVV A;  1MZB A;  2QBY A;  3MWM A;  4EV0 A;  2KJC A;  1IRG A;  1R58 A;  1FT9 A;  1W7P A;  2GZW A;  2RC4 A;  1R1T A;  4MQ9 F;  5J8F A;  3TDU C;  2NRA C;  4FX0 A;  4RAZ A;  2J5P A;  3F6O A;  2EJR A;  1FWZ A;  1HXD A;  4HX7 A;  5JHU A;  1UCR A;  1ON1 A;  3KLO A;  3KP6 A;  3BPX A;  1XGM A;  5CJ9 A;  2V79 A;  4YFN F;  2V1X A;  2LNB A;  4HF1 A;  1KQ0 A;  2EFO A;  3D5L A;  1KYZ A;  1TTY A;  3J80 K;  2L54 A;  5LGN A;  4JBA A;  5BPI A;  2H27 A;  3ZP5 A;  1U3E M;  5EEH A;  4NB5 A;  5HDN A;  3ZMS A;  3J7A O;  2P5L C;  1FYM A;  4L5J A;  2LSO A;  2BGC A;  1XMK A;  1FSH A;  4MNU A;  1CGP A;  2O8X A;  3KP3 A;  3ECO A;  2NNN A;  3JSP A;  3EET A;  2FSW A;  4WXC A;  4AIK A;  3P9K A;  1KU9 A;  4UNO A;  3GFM A;  2K02 A;  5F1R A;  5JI6 A;  1U8R A;  4A0Y A;  1T98 A;  1X3U A;  1IN5 A;  2HFH A;  1YW9 A;  4DNC A;  3H92 A;  2R3S A;  3F22 A;  3MZY A;  2YU3 A;  2CFX A;  1ONV A;  4EGZ A;  1YLF A;  2QQB A;  2YPR A;  3L9F A;  2YX7 A;  4YIF A;  2H09 A;  4KIF A;  3GW2 A;  4ON0 A;  2JT1 A;  2EV5 A;  5BQT A;  1OYW A;  5FD6 A;  3WOD F;  3GXO A;  4CHU A;  1XDS A;  4GO1 A;  3ZMZ A;  6PAX A;  1BM9 A;  2P8T A;  2O61 A;  2H94 A;  4OIO F;  1ZG1 A;  2P6S A;  5HLG A;  5F64 A;  1IXS B;  1WWX A;  3ZMU A;  2GA2 A;  1O3S A;  1MDM A;  5HOO A;  2EV0 A;  4L5I A;  2K86 A;  3MZH A;  2ZJ2 A;  1H0M A;  3I58 A;  1JHF A;  3C18 A;  4A5N A;  4MTD A;  3CDH A;  3WGH A;  4I02 A;  1O3Q A;  2DT5 A;  4G6D A;  3KCC A;  3J80 Z;  2XIG A;  3CUQ B;  4YFX F;  3GLX A;  3T0Y A;  1CF7 B;  2P7C B;  2ESH A;  4EJT A;  3RKX A;  4HLX A;  4L9N A;  5E18 F;  3GO5 A;  4BAY A;  4O3M A;  1ZAO A;  1ZN2 A;  5L3G A;  5IT9 K;  4KN7 X;  1P4A A;  4LK0 F;  4Y15 A;  4XLP F;  2HR3 A;  2VOO A;  3TKY A;  2TDX A;  3GX4 X;  3LA2 A;  1SFU A;  3TO7 A;  3RJP A;  5E1X A;  1IUY A;  1F9N A;  5D5W B;  4B8X A;  2FQ3 A;  2XKO A;  3FXQ A;  1I27 A;  3P9I A;  4Q4Z F;  4UVB A;  2P6T A;  3B02 A;  2A5Y B;  3DF8 A;  1USS A;  1R5H A;  1K6O A;  1G4D A;  1G3S A;  2Z9O A;  1TQM A;  1E17 A;  1O3T A;  1HQC A;  2M8E A;  3FWE A;  3TGN A;  2ISY A;  1V4R A;  4RGU A;  1ZHF A;  1FYL A;  1EV7 A;  1QZY A;  2VN2 A;  3T8R A;  3CLO A;  4RGR A;  2FNA A;  3HRT A;  3ROU A;  2XUB A;  4P9U A;  3QPT A;  5E17 F;  2D2W A;  2OQR A;  5BOX A;  2IVM A;  1FYK A;  2O6G E;  3F8F A;  3KP4 A;  4M6X A;  1G3W A;  3ZPL A;  4EJW A;  3G73 A;  2M1B A;  5LGT A;  1W7P D;  1H9T A;  1P92 A;  1OKR A;  4Q47 A;  3HOS A;  1ZH5 A;  5E8I A;  4P5O A;  2GQQ A;  3OV8 A;  3D0S A;  2F5F A;  3BP8 A;  2CYY A;  1Z7U A;  2QQ9 A;  4HAM A;  2PJP A;  1EH8 A;  2VBY A;  4HV6 A;  4IF4 A;  2GWR A;  3MCZ A;  2IRF G;  3LA3 A;  3KLN A;  2R7F A;  1IXC A;  1WSU A;  3SZP A;  4OOI A;  4ZZD A;  1R1U A;  3IKV A;  1U6G A;  1J0R A;  1KYW A;  1K78 B;  3F8C A;  4IXA A;  5IT9 Z;  4RGS A;  4ZYD A;  1SD4 A;  2QBY B;  4L0Z B;  3JW4 A;  1R00 A;  2O03 A;  1TW3 A;  5DUI A;  3TQN A;  3E6M A;  1HKQ A;  4OIN F;  3V7C A;  1P4W A;  1KU7 A;  1HST A;  3W6J B;  3SFZ A;  2CQK A;  1LNW A;  4M9X A;  2UWM A;  3GYH X;  2M45 A;  2DW4 A;  1BI2 A;  3ZMV A;  3WU0 A;  2AS5 F;  5D4R A;  2XAQ A;  4G8X A;  3I64 A;  4L9J A;  5D5U B;  3I5U A;  1TNS A;  3NQO A;  2FA5 A;  4FHT A;  1CF7 A;  3E3V A;  1R23 A;  2GXG A;  3T8T A;  3WE3 A;  2CG4 A;  4WX9 A;  4P55 A;  3RTR A;  3VEP A;  1UHW A;  4PGG A;  3SXY A;  4LB5 A;  1HKS A;  1T39 A;  1EH7 A;  1FBS A;  1R22 A;  3ZMT A;  2J5O A;  3IL2 A;  3HOT A;  4KUM A;  2Z3Y A;  2UXN A;  2ZNY A;  2FXA A;  1R5G A;  1QO0 D;  1IN8 A;  1DUX C;  3WTT C;  4UVC A;  4EM2 A;  4ESJ A;  5CVI A;  2QVO A;  3V7R A;  4BHB A;  3K1N A;  1TBX A;  2F5D A;  3SHF A;  4MEY F;  1B6A A;  1W5T A;  4HYE A;  1D8J A;  1U2W A;  4HDU A;  1KU3 A;  1QQI A;  4L9T A;  2ACJ A;  2VC0 A;  1TW2 A;  1ON2 A;  2DQR A;  2XAS A;  2RQP A;  1XMA A;  2RKH A;  4MEX F;  4P9F A;  3JTH A;  4U0W A;  4LG0 A;  5ED4 A;  2OAZ A;  2A6E F;  3HSE A;  1XN7 A;  2KKO A;  2RNJ A;  1ZAR A;  1GVJ A;  1Z6R A;  2XRO A;  3BOQ A;  4RGX A;  1BBY A;  1ODD A;  4LMY A;  1SMY F;  2FOK A;  3ML6 A;  3IC7 A;  2GXB A;  2OBP A;  3EQL F;  2W25 A;  1IRF A;  3WTS C;  2GIV A;  3JTG A;  2FRH A;  1RUN A;  2C6Y A;  3GUD A;  3L2C A;  1U5T B;  4RAY A;  5F6F A;  4KMU X;  1V3F A;  2GAU A;  1HW2 A;  2FBK A;  5BPD A;  2PBI A;  5L3C A;  1MDM B;  2RN7 A;  1KGS A;  1TLH B;  2Y75 A;  2L4M A;  2RGV A;  1T0F A;  3O6B B;  4A6D A;  2G7U A;  3NRV A;  3J81 K;  1I1G A;  3E97 A;  2CWE A;  1XDU A;  2VBW A;  2WV0 A;  5DV5 A;  4LGW A;  1LDJ A;  2CSO A;  3E5X A;  4M6Y A;  1WQ2 A;  4EMS A;  2QZ8 A;  4UV9 A;  3ERE D;  3FM3 A;  1B1B A;  1O3R A;  5CVU A;  3V8J A;  1UB9 A;  1YQA A;  4HA8 A;  5J6X A;  1FNN A;  2UZK A;  1XCB A;  4YG2 F;  1RUO A;  4ZYE A;  1MD0 A;  1RI7 A;  2MH9 A;  2MH2 A;  4JK1 X;  5D6E A;  3IRQ A;  3HTU A;  4M9Z A;  2W57 A;  1IW7 F;  3DV8 A;  2KIM A;  3FHZ A;  1MJA A;  4EJO A;  4WXH A;  4G7H F;  4ESB A;  2ISZ A;  3DPL C;  4K2E A;  2COM A;  1T38 A;  4QLC U;  4RB0 A;  4M9S A;  5ICC A;  1P6R A;  4JQF A;  3TO9 A;  4BYY A;  1S29 A;  1FBU A;  1S8N A;  4WK8 F;  3H3U A;  2VOP A;  4GCV A;  1OYI A;  2DO7 A;  1LEA A;  1UHM A;  3HHG A;  4I98 B;  4AVP A;  3ZMD A;  2FMY A;  5LEJ A;  3F72 A;  3N4M A;  1C0W A;  5ICF A;  3O2P E;  5L3F A;  1QZZ A;  1GXQ A;  5ILS A;  3PFI A;  4E70 A;  2AXL A;  3JAM K;  4ENJ A;  2XHK A;  4AD9 A;  3AAF A;  1UFM A;  4KDP A;  1LDK B;  1O7F A;  4KFC A;  3HRM A;  4OIR F;  1Z9C A;  3CUQ C;  1XGN A;  1ZRC A;  3VFZ A;  3RIR A;  3LQQ A;  3B73 A;  3J81 Z;  3PQJ A;  1ZRD A;  3M9A A;  3HRU A;  2JPB A;  4LK1 F;  3WU1 B;  4KIG A; 
#chains in the Genus database with same CATH topology
 2P4W A;  2GA1 A;  1SAU A;  3TDZ C;  1W36 C;  4N4N B;  5CQE A;  3OYC A;  3MKY B;  2Y48 A;  4YIR X;  4I99 C;  3ULQ B;  4U0Y A;  4NNJ A;  1U5T A;  1BJA A;  1PUF B;  2L4A A;  3DTE A;  1W36 D;  3MEX A;  4JYK A;  1N78 A;  1K4S A;  4GDF A;  5CLS A;  1KON A;  3I71 A;  2F2E A;  1Z6T A;  2BY3 A;  3VOE A;  3P9C A;  2ZJP F;  1P7I A;  5KAI C;  3F8N A;  5CYV A;  3GTM J;  3DTK A;  1IN4 A;  3TO6 A;  2D1V A;  5FJ8 J;  1E2X A;  3WHC A;  5D4S A;  2WBM A;  3UR3 C;  2WWY A;  2CW0 F;  4FQG A;  3K0L A;  4DJA A;  2V9V A;  3DBL B;  1IV6 A;  3M8F A;  4N4O B;  2MBF A;  3RZD J;  4D7N A;  4U0V A;  1FOY A;  2XKP A;  4JP0 A;  1T33 A;  2RVC A;  4Y13 A;  4C2U A;  3CJR B;  2HYG D;  5ILU A;  4CYC A;  2EB7 A;  4HBL A;  4Y17 A;  2K3F A;  1SMT A;  2QWW A;  1F1Z A;  4BHP A;  5LHH A;  3Q9V A;  3FMQ A;  4Y52 J;  2K3P A;  1OYY A;  4UB6 C;  2GOX B;  4N9H A;  4AUX A;  2IEK A;  4RB3 C;  3COA C;  2MLG A;  2WV1 A;  1E3H A;  3DBH B;  3K2A A;  4DOZ A;  3F8B A;  1JKO C;  1WRJ A;  5J8C A;  3OYF A;  3BPV A;  5ICG A;  3EPZ A;  2VT2 A;  2RDP A;  2Z33 A;  2O9L A;  2W85 A;  2H6C A;  2F4O B;  2LDU A;  4XKW A;  2LG4 A;  4Z2Y A;  2DTR A;  3CZ6 A;  1I3A A;  3CCY A;  1Z7L A;  4EGY A;  4BJT A;  3ZN1 A;  4PCQ A;  3S3O A;  3WGI A;  4CXF A;  2XB5 A;  3BJ6 A;  4IVN A;  3REO A;  1SEU A;  1YYV A;  2KL4 A;  1S7A A;  2CUF A;  1QBJ A;  5H6Q A;  1IAW A;  5M3M J;  1WKM A;  4FE4 A;  2QLZ A;  4PJJ A;  3VYU B;  1WPK A;  2STT A;  3M8E A;  4DQ2 A;  3W2V A;  1MH4 A;  2HOS A;  1S3J A;  4OMZ A;  2VI6 A;  1FBQ A;  3V8K A;  1H88 C;  3V8L A;  3GFJ A;  2QF7 A;  1RC9 A;  1YIO A;  5DUK A;  5E20 A;  5EG0 A;  2XV4 S;  3E6D A;  3KZY A;  2O0Y A;  5DEQ A;  3TL4 X;  2PN6 A;  1Y8R B;  2HZT A;  2EH3 A;  1IN7 A;  2A6T A;  1WZ2 A;  3KP5 A;  1JJ8 C;  5J4Y A;  2FOW A;  1AWC A;  4XKC A;  2XVC A;  2DMN A;  1I39 A;  2B0L A;  3OOU A;  1NK2 P;  2ZCW A;  3NWS A;  1TWG J;  2HOE A;  5BS6 A;  5H2F C;  3SJM A;  4LJZ F;  2ZBK A;  3MKW B;  5HS8 A;  3F9K A;  5C4J J;  2MC3 A;  4M3G A;  1T0F C;  2OPT A;  3IH3 A;  5B1B H;  3DKX A;  2M5W A;  1T6S A;  4IHY A;  2Y0M A;  2K7L A;  3ZN0 A;  1EH6 A;  3IWZ A;  5EEG A;  2IA0 A;  3ZRG A;  3OWT A;  2M8G X;  4B09 A;  1T95 A;  2LBF B;  4LG0 B;  2FBH A;  1FOK A;  4L18 B;  1BC8 C;  4E4H A;  3KPH A;  4HLY A;  3BQY A;  5LHI A;  5E3M A;  1W4M A;  1WJF A;  3Q0V A;  5EDN A;  5A2Q K;  2PJR A;  2K4B A;  1SVM A;  2XGX A;  1D1C A;  1R49 A;  2QSH X;  4B3A A;  3I4P A;  2ELJ A;  4DIQ A;  5ERI A;  1OJL A;  3RYP A;  5M5X J;  2QYO A;  2E5Z A;  3SFI A;  3LSH A;  3R0A A;  4J19 A;  4O6J A;  4RS8 A;  3S93 A;  1ZRF A;  2VJ4 A;  3EYI A;  2JA8 J;  3S1R J;  3HL2 A;  3PUF A;  5IP9 J;  3CCU I;  3FF5 A;  2DDB A;  5D8L B;  4CCO A;  2DJI A;  4JX4 A;  1PUE E;  4X6A J;  4BE0 A;  1G3T A;  1IDZ A;  3J7A Y;  3E1S A;  5K7H A;  4XID A;  2X4H A;  3I59 B;  2BBY A;  2B7E A;  2DA4 A;  2KJB A;  2QM3 A;  4PJM A;  4LFU A;  4UUS B;  1JT6 A;  1X2N A;  2LMD A;  1T2K A;  4HDV A;  1RES A;  5FO5 A;  2XRN A;  1GV2 A;  1MKM A;  4IHS A;  2DA3 A;  5HS9 A;  2F5C A;  3D5R C;  4KT5 C;  2V9P A;  2M0M A;  4MFD A;  5EYR A;  3L00 A;  2ME6 A;  3IAM 2;  3LNQ A;  3E6B A;  4PDK A;  3F6V A;  2V9K A;  2KFD A;  2Z1D A;  3KFW X;  2KIF A;  1KU2 A;  2DFE A;  2M34 A;  4KA4 A;  5DDG A;  1LFP A;  1GXP A;  3K4J A;  1BC7 C;  3BTL A;  3BJO A;  1BL0 A;  1W1W E;  3DFG A;  4F91 B;  3OYB A;  4KN4 X;  1VQP I;  4GFB A;  4M74 A;  1DPU A;  2ID3 A;  2DFF A;  1YG2 A;  1TT5 B;  3ABK H;  2W24 A;  3DP7 A;  4HQE A;  2K4J A;  3R4K A;  1D0X A;  2DOE A;  1PUF A;  5LRS A;  5M3F J;  2OD5 A;  2V1D A;  1OPC A;  2OTJ I;  1BOA A;  3N97 A;  2EWN A;  2KMU A;  2M87 A;  4IRH A;  4ZDP A;  3O3K A;  2OTL I;  2OU2 A;  5GPC A;  3B6A A;  3P7N A;  2MLK A;  2IGK A;  4N9I A;  4H0E A;  2FQ4 A;  3F8M A;  4KNY A;  1YW8 A;  4C3J J;  1XPX A;  1FLI A;  1JKQ C;  1FIP A;  3OL3 A;  1XS9 A;  3RZO J;  4ZYH A;  5B5E C;  2E1M B;  1B8I B;  3HSR A;  5H20 A;  4YII A;  4NC8 A;  2DAO A;  1FC3 A;  1FMV A;  4BH9 A;  3OMY A;  4MTE A;  1BJZ A;  4LLN A;  4UUT A;  3ONQ A;  1J59 A;  2A6H F;  2EIN H;  1RIO H;  2LKP A;  3FXL A;  1LUJ B;  2KQR A;  2HKO A;  4ZTJ A;  1W5S A;  2L2O A;  1FSE A;  2IS4 A;  1XD7 A;  1BI3 A;  1NTC A;  3LOC A;  4ASN A;  2VON A;  2DMQ A;  3K4M A;  4XK4 A;  3CCR I;  2E7W A;  3QU6 A;  4LLG F;  5H6R A;  3H3Z A;  1S5L C;  4IQJ A;  2OCC H;  3OYM A;  4NUB A;  4RAG A;  2VB6 A;  4IPA A;  3S1M J;  4UXN A;  1RKW A;  1B4A A;  3HUG B;  4F7Z A;  3VYT B;  4E7K A;  4Y7N J;  5KNL A;  1IZ1 A;  3RSN A;  3KET A;  1X3W B;  1UST A;  4MHG A;  3VDX A;  2Y9Y A;  4RMN A;  5CQG A;  1G6N A;  2WY7 Q;  2FE3 A;  2XAH A;  5HDK A;  4IHW A;  5A2Q Z;  3DEW A;  5KCM A;  3MFK A;  3ZQL A;  4OMY A;  3G1M A;  3HJE A;  4UY8 I;  1MMD A;  3BZC A;  1LQ1 A;  1LFB A;  1Z91 A;  3OSG A;  5ICE A;  1OCT C;  1U5T C;  3LMM A;  5D8K B;  4CO8 A;  1HKT A;  1EKE A;  2P5K A;  2X1C A;  2BVL A;  1D8K A;  2AXT C;  3J7Y J;  1MW7 A;  3HG9 A;  3K1M A;  3K1P A;  2VT3 A;  2WAQ A;  5K5Q A;  1H9G A;  3CDL A;  3CJT B;  4PFP A;  2STW A;  1YFH A;  1VFC A;  1R36 A;  4D0P A;  2BZT A;  3QP6 A;  5K5O A;  5FGM A;  2K9M A;  2OZ6 A;  2XSJ C;  1B9N A;  4F92 B;  3OYH A;  4C3I J;  3WTZ A;  5HS7 A;  2BEO A;  2ZFW A;  4BUP A;  1SD7 A;  4LD5 A;  4FX4 A;  5DD8 A;  4CYD A;  4R79 A;  2PI0 A;  2BY1 A;  5M5W J;  4ZYG A;  2Z16 A;  2MGQ A;  4A0Z A;  2CO5 A;  5BNG A;  2XGE A;  2O8K A;  2EK5 A;  4WXD A;  2RV8 A;  4A2U A;  1Z1D A;  2X85 A;  3JRD A;  3OYG A;  2EFQ A;  4IHX A;  1ZR2 A;  1MBE A;  2R7D A;  3CCS I;  1KA8 A;  3IKT A;  1GHC A;  2W82 A;  2JUG A;  4KIT B;  4G7O F;  3OIQ A;  1VQO I;  1ZG5 A;  4HNV A;  1D3Y A;  4CZZ A;  1QPI A;  4A12 A;  3K4L A;  5IOY A;  2VPL A;  4TV7 A;  2NS7 A;  3Q9S A;  1OFC X;  2HNH A;  1U8B A;  1BW5 A;  3PNY A;  5B66 C;  3ABL H;  2HQA A;  2HTS A;  3S2W A;  4IEJ A;  2GM4 A;  3CF2 A;  3BG7 A;  3VB2 A;  1WVR A;  1A04 A;  1BIB A;  3WGG A;  3PIO F;  1Q1V A;  2ELH A;  2V1U A;  2ZO4 A;  3KIO A;  2VE9 A;  1XG1 A;  1TT0 A;  3MD2 A;  3QOE A;  4MLO A;  2KIS A;  4N0B A;  5LBQ A;  3MKZ A;  1T08 B;  1VQ8 I;  2PLY A;  3K2Z A;  1HW1 A;  4BL0 B;  3MAJ A;  5LRR A;  2X0L A;  3FX3 A;  3BWG A;  1SAX A;  1PVE A;  2HKX A;  1NHA A;  3RKY A;  3I53 A;  3K9T A;  3HIF A;  2CMP A;  1JKR C;  2R7V A;  1X1B A;  3I59 A;  2DBB A;  4UUS A;  4IHV A;  2VC1 A;  2HOA A;  2JQ7 A;  1OR7 A;  2L7F P;  3IWF A;  2JRT A;  4RDU A;  1YTY A;  3GFI A;  3GME A;  2O7O A;  1WCM J;  4EJV A;  1QVT A;  3HPG A;  1ITY A;  1YS6 A;  3CC7 I;  2WTE A;  2HYJ A;  4IO9 F;  1MBG A;  2BW3 A;  3QRF F;  3RPQ A;  2HXO A;  2DPD A;  1I6H J;  3BRO A;  4IQ4 A;  2DN0 A;  2TCT A;  5BMZ A;  4ENK A;  3BR6 A;  5HLT A;  2G7H A;  4BY7 J;  1REP C;  2IJL A;  4XIC A;  3LAP A;  1BA5 A;  1IJW C;  4CYC B;  2DA2 A;  3C3W A;  2H1K A;  3OYN A;  2LLK A;  5FLV A;  1HSJ A;  3RCO A;  1ZLK A;  2JK3 A;  4FT8 A;  2ZXH A;  5TIS C;  4CA0 A;  1HDD C;  4CUG A;  1PP7 U;  2VOD A;  2LRE A;  2N8G A;  4HW0 A;  3ABT A;  4Y3O A;  1K6Y A;  1ZGA A;  1ZG3 A;  1HA8 A;  3LSG A;  1ZKG A;  3U1K A;  2DPU A;  4A3F J;  1N25 A;  2DJN A;  1XCV A;  3MKL A;  4RLQ A;  4HNT A;  2A07 F;  1MMA A;  3BZ6 A;  4O5V A;  5JLW A;  2EPF A;  4R1H A;  3KEQ A;  3K4B A;  4XM3 A;  3CCL I;  1MJB A;  1IG7 A;  2JPC A;  3AG2 H;  4KMF A;  4PSX A;  1DU6 A;  2GOM A;  3SQN A;  4B48 A;  2VLA A;  1S7E A;  2JTV A;  1FX7 A;  1FJL A;  4I01 A;  2EA2 A;  1IC8 A;  1R71 A;  1B8I A;  1OCR H;  1VZ0 A;  3MN2 A;  1EA3 A;  1H8A C;  4C30 A;  2A61 A;  2K9L A;  3LWF A;  1TNT A;  1ETW A;  3G71 I;  2COB A;  2DT6 A;  4XLA A;  1MBH A;  4A0X A;  4FAS D;  1SVL A;  3FXO A;  3F23 A;  3CJQ B;  2PMU A;  4E6K G;  1VTN C;  3TP3 A;  2KDZ A;  3L09 A;  4A93 J;  4XKV A;  5J4V A;  1JGG A;  3LAJ A;  2HYF A;  2YSR A;  4DZP A;  4L0Y B;  2EBI A;  1F43 A;  3WTU C;  3S1N J;  3OOP A;  2YX4 A;  3M07 A;  5LGU A;  1TL8 A;  1IUF A;  1B9M A;  2OA4 A;  1STZ A;  4A5M A;  1PDN C;  1ZGW A;  2X6X A;  4CIC A;  1X3Z B;  5FLX K;  3ZXS A;  4M3D A;  1MBK A;  2EIK H;  4WWC A;  3QP5 A;  2ZKZ A;  4I6Z A;  3HUG A;  2E19 A;  2E1C A;  2VE8 A;  3C7J A;  1UMQ A;  1KZH A;  5LHG A;  1OMI A;  3SDB A;  2F5E A;  2BV6 A;  3CO7 C;  2V6C A;  1S72 I;  5JLX A;  3BR0 A;  3G1O A;  2MD5 A;  1QNT A;  3GCM A;  3LSM A;  4D9J A;  1X4P A;  5FRM A;  4HNU A;  1GVD A;  3WTV C;  2L9V A;  1YS7 A;  2EZL A;  2L02 A;  3PQK A;  1QPM A;  3DPU A;  2A68 F;  2HQN A;  1BOB A;  1WJE A;  3QOP A;  1Y1W J;  4C3H J;  3OR2 C;  3WTW C;  4OIQ F;  3OIO A;  2G9W A;  4M73 A;  5F04 A;  4J00 A;  2CUJ A;  3LA7 A;  2RAE A;  3WTY C;  2A3S A;  1P2F A;  4Q5S F;  2F48 A;  3DEE A;  1I1S A;  4HZF A;  5FD5 A;  5IP7 J;  2YS9 A;  1R6R A;  1FP1 D;  4EM1 A;  4I0A A;  2L7M P;  4BQN A;  5GAD J;  4F3Q A;  3BC8 A;  3M1C A;  3A2K A;  4XLN F;  1LVK A;  4XRM A;  2E2J J;  2HPI A;  1RRJ A;  3U9G A;  2I8D A;  4I7H A;  4KYW A;  1O57 A;  5FB2 A;  2AQE A;  2DMT A;  4UV8 A;  5HOD A;  2KHM A;  2IAI A;  4WF2 A;  5K1Y A;  3BDD A;  5JFR A;  3GTP J;  1RET A;  2VKD A;  2OZU A;  3QYE A;  1U0J A;  3GTO J;  4HST A;  3EYY A;  2H8W A;  4ZH4 F;  3QYB A;  4OU0 A;  1YI2 I;  1APL C;  1VND A;  3ECH A;  1UG0 A;  4MQV A;  1R9T J;  3EUH A;  2LR8 A;  3JRA A;  4GYG A;  5DYM A;  5EF6 A;  5F08 A;  4RLF A;  2FEZ A;  5HVQ C;  2EZK A;  2LY1 A;  4NQW B;  3C1D A;  1V5F A;  2JRM A;  4LIV A;  4UUV A;  3RI4 A;  1FY7 A;  3KE2 A;  3HTS B;  4ENM A;  4PJN A;  2R7Q A;  4L5E A;  3R0J A;  1QU3 A;  2R7T A;  4W1U A;  5IYC J;  1K4T A;  2DA7 A;  1T56 A;  1XX5 A;  2XAJ A;  5FFX A;  1WI3 A;  2PFB A;  2UUZ A;  3KX2 A;  3ELK A;  4PSW A;  1YE9 A;  2MAB A;  4HF0 A;  3R6S A;  1D1B A;  1HLV A;  5DM7 F;  3RYR A;  4ESF A;  2DLL A;  2D45 A;  4U87 A;  2PMH A;  2VJ5 A;  2R7U A;  3BR1 A;  4B43 A;  2BVM A;  3O8H A;  3BTC A;  1ZRE A;  3KP2 A;  4GYI A;  3M1E A;  4X0G A;  2DI3 A;  2OQG A;  4RM3 A;  3FM5 A;  5DD4 A;  4IRI A;  3GBG A;  4AIJ A;  2KRF A;  2XAG A;  2DDA A;  4G12 A;  4XSX F;  1ZLJ A;  2YR2 A;  2IP2 A;  5FLX Z;  2K27 A;  2NYX A;  2WC2 A;  2EFW A;  2BE5 F;  2L7Z A;  4NHJ A;  1LJ9 A;  4RBO A;  2ZME B;  3AG1 H;  1UHS A;  1MMS A;  2NVQ J;  3G3Z A;  2E5N A;  2DA5 A;  4PUS A;  1S6L A;  4UHT A;  1V5E A;  1HDP A;  4U7B A;  3VYS B;  2EFN A;  1Z05 A;  1SD6 A;  2JUC A;  2XB0 X;  3MVP A;  4M71 A;  2JZY A;  3OR1 C;  1A6I A;  3SDG A;  2P5V A;  2PQ8 A;  3KZI C;  3E5U A;  4XLC A;  4LIT A;  5CVJ A;  5FKM A;  1JT0 A;  1I6X A;  1P9Q C;  1JUM A;  4CZC A;  2ZC2 A;  3FIW A;  2M2E A;  3LFK A;  4BBR J;  4AIH A;  4FIS A;  5IPA A;  2Q8K A;  1HW5 A;  2VJJ A;  1OCO H;  3FBN B;  3V7S A;  1TZL A;  1MNM C;  3KEO A;  5E79 C;  3LST A;  5JVT A;  5B3S H;  4ENN A;  2JSC A;  3QYF A;  2FU4 A;  1FOW A;  3KYD B;  3FZV A;  2ID6 A;  1DDN A;  4F52 A;  4HX8 A;  2F4M B;  3V42 A;  2KLO A;  3FK6 A;  1BN5 A;  3M7G A;  5DCF A;  2K9S A;  2NAZ A;  1VQ6 I;  3ISP A;  2O3F A;  3C2H A;  1F5T A;  2E7X A;  3DQV C;  1JGS A;  4HV5 A;  3GWZ A;  1V5G A;  4ZZL A;  5ILV A;  3DEU A;  3I0T A;  3SEQ A;  3QPH A;  5IT3 A;  1HBX G;  1MMN A;  2Y9Z A;  2BXZ A;  1XB4 A;  3JAM Z;  5E1Z B;  5E8G A;  4ETS A;  3VOD A;  1OR7 C;  2WB1 N;  5TJJ A;  1FP2 A;  3BG6 A;  4M3F A;  1IXR C;  4U7D A;  1BI1 A;  3GZ5 A;  3DBR B;  3VSK A;  3H3V K;  2RNG A;  1Q1H A;  2NOJ B;  1JHH A;  4ZDL A;  3WE2 A;  2E1N A;  2LF8 A;  2ZSH B;  4AYB A;  3JSO A;  2CRG A;  4HF2 A;  2NVT J;  3DKW A;  5TRD A;  4QPQ A;  3F3X A;  3KEY A;  3ZCO A;  3JRG A;  3N05 A;  5IOZ A;  4E7I A;  3MQ0 A;  3RPU A;  3L2Q A;  2VQC A;  3A02 A;  2VQG A;  2HZD A;  4PGH A;  1WH5 A;  4I09 A;  5CVR A;  2DK8 A;  3Q5F A;  3IHU A;  3U2R A;  2KZG A;  3JCU C;  1D0Y A;  4I0B A;  4S0H B;  5KK1 A;  4A3I J;  3TBI A;  4Y4R A;  4IHT A;  2Q2E A;  3L7W A;  5HDG A;  2HWV A;  3CJN A;  4II3 A;  2LK2 A;  3CUO A;  5DCM B;  4LLL A;  1HC8 A;  1IGN A;  1WI9 A;  1O7L A;  2DQL A;  2EIJ H;  2HQR A;  1IF1 A;  2H1L A;  1FTT A;  4GGG A;  3C2G A;  2ADU A;  1FPQ A;  1RNL A;  3I4M J;  3HZJ A;  4HEA 2;  4XLF A;  4UB8 C;  4AYB N;  1X1A A;  2D1H A;  3LSK A;  3T5X A;  3D5S C;  5J47 A;  4XNF A;  1QRY A;  3ZQH A;  1LE8 B;  4CDG A;  4P96 A;  3WG9 A;  3BT9 A;  2XPW A;  2E1M C;  1LFU P;  2R7Z J;  1IN6 A;  3NAR A;  4EJU A;  2B9S A;  4W97 A;  1J2X A;  5HLI A;  3GFL A;  1HF0 A;  2ZFU A;  4G9Y A;  1SFE A;  2A69 F;  2KDO A;  3V4G A;  3S32 A;  4I2O A;  4KIG A;  5AON A;  3NEU A;  3EDP A;  5E3O A;  1XMX A;  2DK5 A;  3ABU A;  1VQ5 I;  1MGT A;  2OV7 A;  2VBX A;  1R7J A;  4BXU A;  2QQA A;  2EZI A;  2FNP A;  4I76 A;  4HQM A;  4IRG A;  4YFK F;  4A3E J;  5AIQ A;  9ANT A;  1JKP C;  3DPT A;  3DU6 A;  5AIP A;  2KIU A;  2BW3 B;  2BYV E;  1K83 J;  1Z3Y A;  3U1D A;  2Y2Z A;  4ZC3 A;  2FJ1 A;  3BJA A;  1N77 A;  1XSD A;  5HNF A;  4BHC A;  3A03 A;  1MJ9 A;  1YO5 C;  5IP6 A;  4NQW A;  4C9Y A;  2PX9 A;  3F21 A;  5L3B A;  3DXJ F;  3TOA A;  2ZSI B;  4BEH B;  1XSX A;  4AU7 A;  1RR7 A;  4LIU A;  1PJR A;  2JN6 A;  5LD2 C;  1B59 A;  1L3L A;  3CES A;  5EZG A;  4A3J J;  1UJ8 A;  2EV6 A;  3TW6 A;  3PSF A;  4II2 A;  3HOY J;  3KP7 A;  4BU2 A;  3HGY A;  4QWQ A;  3IRR A;  3JRF A;  4PZJ A;  1WH7 A;  3W6K B;  1I5Z A;  3E5Q A;  4QTR A;  1J9I A;  5TGT A;  2X6W A;  3SEZ A;  4OIP F;  1AOY A;  3R60 A;  1LEB A;  5DTD A;  4EVI A;  4PJL A;  3QWL A;  2M0C A;  1QA6 A;  2DCE A;  2IGN A;  2CJJ A;  4G6Q A;  2CGP A;  3BG5 A;  2ESN A;  1Y0U A;  2IT0 A;  2LH9 A;  1D5V A;  2IPQ X;  3FXU A;  3OYJ A;  4CCM A;  1UAA A;  2IS6 A;  3FXR A;  1G3Y A;  3ZR8 X;  3DU5 A;  1UEL B;  2HVQ A;  3E6C C;  1LB2 A;  2ZXJ A;  3GF2 A;  1YIJ I;  4BQA A;  3AL0 B;  2X48 A;  2O5R A;  4WCG A;  2H6B A;  1AU7 A;  1W7P B;  1SAN A;  2M30 A;  1YJ9 I;  2ZME A;  3BZK A;  1J75 A;  2VQL A;  2X51 A;  2HGC A;  3PSI A;  4E7Z A;  2R5Y B;  4S04 A;  4G7Z F;  4XRS G;  2RQQ A;  2L01 A;  3PM1 A;  3HRS A;  1BIA A;  3FMS A;  4AID A;  3HYI A;  2ZXW H;  1XSV A;  2ETH A;  3PJR A;  2BY2 A;  2VAS A;  5GAG J;  3X2Q H;  5L3E A;  4LB6 B;  1JXS A;  1L0O C;  1GDT A;  3LQR A;  1DP7 P;  1ZGJ A;  3EUH C;  2PEX A;  2Z5U A;  3CUQ A;  2QUF A;  3CTA A;  5HNH A;  3MMY B;  2IA1 A;  1E3O C;  4A6E A;  3HEF A;  4CSW A;  2NS0 A;  3CCM I;  2L3D A;  4HX4 A;  1DGR M;  1J5Y A;  4IOA F;  4Y33 A;  2HVS A;  2NNY A;  4CCL A;  4UVA A;  2DT7 B;  2IW5 A;  1I50 J;  2VXZ A;  2KT0 A;  1U78 A;  4XSZ F;  4U88 A;  1JE8 A;  5KVR A;  1M1E B;  3GVA A;  2HVR A;  2PG4 A;  2ZNZ A;  1LVA A;  2Y0S A;  3SZT A;  3T1B A;  2XC7 A;  1ERD A;  1IRX A;  2E35 A;  2MA3 A;  3OL4 A;  4G94 A;  3GEZ A;  1JTY A;  1MND A;  2FX0 A;  4E7J A;  2M4G A;  2MC4 A;  1MSF C;  3W2A A;  3CDI A;  3BLY A;  2VIX A;  2XAF A;  2DFI A;  4B44 A;  1PP8 F;  3BCA A;  2GLO A;  4R8H A;  2NS8 A;  2W1O A;  3PUB A;  4XON A;  2Y69 H;  4XRF A;  3JRB A;  3KZZ A;  3I9V 2;  2F6C A;  3FK7 A;  1ZYR F;  4DYC A;  3UKG A;  2FBI A;  1SD5 A;  2LTP A;  4KIC A;  4QSH A;  4V2F A;  3CF5 F;  3DLL F;  4BQO A;  1BI0 A;  1TQI A;  1OQY A;  4MGR A;  4RB1 A;  3CO6 C;  4EM0 B;  2Y0S N;  4ZYA A;  2E71 A;  2HS5 A;  5D6F A;  1GT0 C;  5C4X J;  5F1J A;  3NWT A;  1ACI A;  1SFX A;  2W84 A;  5DCM A;  1RZ4 A;  3ZQ7 A;  1F4K A;  2WAF A;  3QOD A;  4AWX B;  5EZH A;  1DPR A;  5HLH A;  2EFP A;  3BY6 A;  3TOB A;  2LVS A;  1Z77 A;  3G1L A;  3GZ6 A;  3CP8 A;  1RR8 C;  4EQQ A;  5D5V B;  4EAT A;  1YJW I;  2Z99 A;  4V19 K;  2JVG A;  3A4C A;  4IJA A;  2XF6 A;  1P4X A;  2DOA A;  1LDD A;  1QGP A;  3HSF A;  2X1D A;  2DU9 A;  1LE8 A;  2KIQ A;  1Y8Q B;  5JR3 A;  2V7F A;  2IA2 A;  4D5C A;  2MSY A;  4M72 A;  3JRI A;  2K5C A;  5FFZ A;  2R0Q C;  4YEL A;  1FZP B;  1KQ8 A;  1YX3 A;  4HRI A;  3HDD A;  2FF4 A;  1VQM I;  2ELK A;  3L2V A;  2VXD A;  4Q48 A;  3HBL A;  3H9G A;  1VQ4 I;  3WTX C;  3R61 A;  2K9Q A;  3RKW A;  4J01 A;  2E2H J;  2HTJ A;  3QAH A;  1ZK8 A;  4AM3 A;  3K69 A;  2DOD A;  2HEO A;  2V26 A;  5L3D A;  3QU3 A;  5GAH J;  1XGO A;  1W0T A;  2HDC A;  1TC3 C;  4GXO A;  2BHZ A;  3QPS A;  5J1U A;  5M5Y J;  3J7Z I;  1H89 C;  4C2T A;  2Q0O A;  5LLQ A;  3HHH A;  1TQP A;  3RDI A;  3I54 A;  4MFE A;  3GZN B;  3ZOB A;  1S7O A;  2HDD A;  2QEN A;  4CGZ A;  1QVU A;  4KIB A;  5E1W A;  1R1V A;  2VBZ A;  1K79 A;  4XBF A;  1DP3 A;  1ZEL A;  4BEH A;  2OCE A;  1XGS A;  5D5X B;  1KQ9 A;  3GTJ J;  2FML A;  1J7K A;  1Z3X A;  5F0F A;  3HGG A;  3FKI J;  4HOB A;  5K5R A;  2EA4 A;  2IBD A;  1ZTR A;  3AFH A;  4BNC A;  3FDY A;  3I55 I;  3RPU D;  2WAE A;  2L7K A;  1QZE A;  1Y56 A;  1YW7 A;  4RB2 C;  2LF7 A;  3DTI A;  1DQU A;  4L9V A;  3ZQI A;  2R92 J;  3H5N A;  3OY9 A;  2GIZ A;  1ULY A;  1K7A A;  2P7V B;  3OS0 A;  1K78 A;  2JJ7 A;  3K4K A;  3IH4 A;  5LEK A;  2HXI A;  2MFZ A;  2OF7 A;  3HOV J;  3FMR A;  4HG2 A;  1DU0 A;  4S05 A;  4A3G J;  5CVV A;  4BAC A;  1R4N B;  5EGO A;  1MZB A;  2QBY A;  4ZDO A;  3W2W A;  2CQ7 A;  3MWM A;  1A6Q A;  2X6O A;  4MIM A;  3HOU J;  4NDL A;  4EV0 A;  2KJC A;  1IRG A;  2W4S A;  1R58 A;  1FT9 A;  1OCZ H;  1W7P A;  4IKF A;  2M7B A;  2GZW A;  2RC4 A;  3CCV I;  1GUU A;  1R1T A;  4MQ9 F;  4QIW N;  2R5Y A;  2MG4 A;  5J8F A;  2XGC A;  3TDU C;  4JOM A;  2NRA C;  4FX0 A;  4RAZ A;  2J5P A;  1VQL I;  5E3N A;  2PMZ A;  3F6O A;  1FWZ A;  2EJR A;  1HXD A;  3L2W A;  3S14 J;  4HX7 A;  4OAY A;  4KIS A;  5JHU A;  2XSD C;  1ETO A;  2LC2 A;  1UCR A;  1ON1 A;  3KLO A;  3KP6 A;  1Z67 A;  4B1R A;  3BPX A;  2WAD A;  2HPM A;  1F36 A;  1XGM A;  5CJ9 A;  1TWA J;  4XOP A;  3W6V A;  3BG9 A;  2V79 A;  4YFN F;  2V1X A;  3E0J B;  3M3Y J;  2LNB A;  2CU7 A;  4HF1 A;  2IGO A;  1BR2 A;  1KQ0 A;  2EFO A;  3PNV A;  3VPR A;  3HOW J;  3D5L A;  5KHD A;  3CCE I;  1KYZ A;  2Q2E B;  2F4I A;  3CMA I;  4AVZ A;  1TTY A;  3H9J A;  3J80 K;  2L54 A;  5LGN A;  4JBA A;  5BPI A;  3ZGK A;  1VQ9 I;  2PMZ N;  2H27 A;  4XKB A;  1X1C A;  3ZP5 A;  1U3E M;  4QPO A;  5EEH A;  4NB5 A;  5HDN A;  3ZQF A;  3ZMS A;  1JUS A;  1ZR4 A;  3J7A O;  2EQR A;  2P5L C;  4BJ5 C;  1FYM A;  4L5J A;  2LSO A;  3SZG A;  1POG A;  3VYR B;  3S16 J;  2BGC A;  2E1O A;  2X9D A;  3LSI A;  1XMK A;  2W7N A;  3GTK J;  2NXN B;  1FSH A;  2LP0 A;  4MNU A;  1MBJ A;  2ZME C;  1CGP A;  2V1N A;  1WHU A;  5GTI C;  2O8X A;  5J1Y A;  2KPM A;  2GBY A;  3KP3 A;  2IXS A;  3ECO A;  2DA6 A;  1ZQ3 P;  2NNN A;  3JSP A;  2HI3 A;  3RKQ A;  3O8G A;  2CV1 A;  4YEJ A;  3EET A;  4DBR A;  2VUM J;  3ZQQ A;  2ZJQ F;  2FSW A;  4WXC A;  4IX7 A;  2Z2S B;  4AIK A;  3P9K A;  1KU9 A;  4UNO A;  3GFM A;  2K02 A;  1GLN A;  5F1R A;  5JI6 A;  4XMY A;  4CCN A;  1U8R A;  4A0Y A;  3W3C A;  1T98 A;  5LFA A;  1X3U A;  1MSE C;  1IN5 A;  2HFH A;  1ETK A;  1YW9 A;  3H1C A;  2M7A A;  4DNC A;  3H92 A;  2R3S A;  3A01 A;  3F22 A;  1WJD A;  3MZY A;  4V2G A;  2YU3 A;  2CFX A;  1ONV A;  4CH7 A;  4EGZ A;  5F27 A;  1YLF A;  2QQB A;  2YPR A;  3L9F A;  2YX7 A;  4XR6 A;  1P7J A;  4YIF A;  1W5C C;  2H09 A;  4KIF A;  4PJ0 C;  3LL7 A;  3EUK L;  2YU9 J;  3GW2 A;  2LD5 A;  3VWB A;  3HM5 A;  4ON0 A;  2JT1 A;  3DKY A;  1D5Y A;  2EV5 A;  1OCP A;  1OYW A;  5BQT A;  2ME0 A;  2BOL A;  5FD6 A;  3WOD F;  3GXO A;  3LFU A;  3CC4 I;  2Y30 A;  5EEA A;  4CHU A;  2H8R A;  1XDS A;  4GO1 A;  2A5W A;  2CW7 A;  2DMU A;  3ZMZ A;  2OJE D;  1BM9 A;  3PIP F;  2P8T A;  6PAX A;  1YRN A;  2P0W A;  2O61 A;  4M3E A;  1Z0X A;  2DTZ A;  4YRV A;  3UNG C;  2H94 A;  4OIO F;  2VQH A;  3TP0 A;  1ZG1 A;  2P6S A;  5HLG A;  5F64 A;  1IXS B;  1WWX A;  3L2R A;  2QGU A;  1AKH A;  1OIS A;  3ZMU A;  2GA2 A;  4BDY A;  1O3S A;  1MDM A;  5HOO A;  2EV0 A;  1WJB A;  1JJ6 C;  3CC2 I;  3G4S I;  4L5I A;  2K86 A;  3Q0W A;  3MZH A;  3FIS A;  3S3N A;  2ZJ2 A;  1H0M A;  3I58 A;  4ITV A;  1JHF A;  3C18 A;  2M4K A;  2IS1 A;  2WB1 A;  5B1A H;  1QHH D;  4A5N A;  3QPL A;  1ETX A;  4MTD A;  3CDH A;  3WGH A;  4I02 A;  1O3Q A;  2DT5 A;  4G6D A;  1MNE A;  3KCC A;  1WFX A;  4JX5 A;  2XIG A;  3CUQ B;  4YFX F;  3J80 Z;  2UV1 A;  3GLX A;  5FRO A;  3FHN A;  3OS1 A;  3T0Y A;  1TWF J;  1SC7 A;  1CF7 B;  2P7C B;  2ESH A;  3FXJ A;  4ZJZ A;  1HOM A;  1U9O A;  1YOV B;  1A31 A;  4EJT A;  3RKX A;  2R5Z A;  1X19 A;  4HLX A;  4L9N A;  2LY9 A;  5E18 F;  3GO5 A;  4H4K C;  4BAY A;  2MW8 A;  1ETQ A;  1B72 B;  2MD0 A;  4O3M A;  3CME I;  1ZAO A;  1ZN2 A;  2VL8 A;  3CD6 I;  5L3G A;  5IT9 K;  1PYV A;  5IYD J;  4KN7 X;  1P4A A;  2HQ5 A;  4LK0 F;  4Y15 A;  4XLP F;  2HR3 A;  3LSP A;  2CW8 A;  2VOO A;  2BY0 A;  3PFY A;  3TKY A;  2TDX A;  3KYC B;  1LPQ A;  3GX4 X;  2QQ8 A;  3LA2 A;  1SFU A;  3H0D A;  3TO7 A;  3RJP A;  1X1P A;  5E1X A;  3S3M A;  2LYC A;  1IUY A;  1F9N A;  4XL9 A;  5D5W B;  4B8X A;  2FQ3 A;  2I5U A;  2M9H A;  2XKO A;  3FXQ A;  1I27 A;  4DW6 A;  3HPH A;  3P9I A;  4JX6 A;  1E3P A;  5GPA A;  4Q4Z F;  3A1Y A;  4UVB A;  1VQN I;  2P6T A;  3BCB A;  2V4J C;  5J40 A;  3B02 A;  2A5Y B;  2DOF A;  3H5A A;  3DF8 A;  5F0H A;  1Z21 A;  2KRH A;  1USS A;  3H36 A;  2RRE A;  1R5H A;  2LKX A;  1K6O A;  1G3S A;  1G4D A;  2Z9O A;  1TQM A;  1EJ9 A;  3A0H C;  3M8J A;  1E17 A;  1WGX A;  1O3T A;  1WJC A;  1G8X A;  1NG6 A;  2E2I J;  5FKL A;  4E7L A;  1HQC A;  2W48 A;  3FKJ A;  3K4N A;  2M8E A;  2P81 A;  3FWE A;  3TGN A;  2ISY A;  4ZTF A;  3WG7 H;  1V4R A;  4XN0 A;  4XOR A;  4RGU A;  1ZHF A;  1FYL A;  3FXK A;  1X2M A;  1EV7 A;  1QZY A;  3NAU A;  2VN2 A;  3HOX J;  3T8R A;  3Q3S A;  3CLO A;  4RGR A;  1RPW A;  2FNA A;  3HRT A;  1VI0 A;  2EIL H;  3ROU A;  2XUB A;  1NH3 A;  5GAE J;  1S9H A;  4P9U A;  1RKT A;  2VKH A;  4A69 C;  3QPT A;  1N75 A;  4KJZ A;  5E17 F;  3CP2 A;  2D2W A;  2OQR A;  5BOX A;  2IVM A;  1W0U A;  1FYK A;  1ETY A;  2O6G E;  2QKL B;  3QQA A;  3AL0 C;  2BHY A;  3F8F A;  3KP4 A;  2CUZ A;  4BDZ A;  4M6X A;  3L1P A;  2EIM H;  1A5J A;  2DYR H;  1G3W A;  3ZPL A;  4OWR B;  3CMM A;  4EJW A;  3G73 A;  2XPU A;  3I3L A;  2M1B A;  1ETV A;  4G6T B;  5LGT A;  5CPR B;  2FUG 2;  4E7S A;  4OAZ A;  1W7P D;  1H9T A;  1P92 A;  3CQZ J;  1OKR A;  4Q47 A;  3HOS A;  1ZH5 A;  2XPV A;  5E8I A;  1LKX A;  3TW7 A;  4P5O A;  2JVH A;  2D5V A;  2CFO A;  2GQQ A;  3PO3 J;  4EEF G;  3OV8 A;  3D0S A;  5EJC A;  5GTH C;  1Y0N A;  2F5F A;  3BP8 A;  1Y39 A;  2CYY A;  1Z7U A;  2OC6 A;  4DZJ A;  5FKK A;  2QQ9 A;  1TP4 A;  1AHD P;  4HAM A;  2PJP A;  1EH8 A;  3AG4 H;  1VQ7 I;  2YUS A;  1MH3 A;  1TWC J;  3AKZ A;  2VBY A;  3K7A J;  4PK4 A;  3H9Q A;  4HV6 A;  3JRC A;  4IF4 A;  3BR3 A;  2GWR A;  4B3X A;  3MCZ A;  2IRF G;  2ZB9 A;  3LA3 A;  3HOZ J;  3KLN A;  2R7F A;  1IXC A;  4PFO A;  3SZP A;  1WSU A;  4OOI A;  1CQT A;  4ZZD A;  3LSR A;  3OYD A;  2ICW G;  4FCY A;  1SFK A;  5FKO A;  1R1U A;  4CCJ A;  3IKV A;  2R7W A;  2VKV A;  5F0C A;  5J3L A;  3L2U A;  5DS9 A;  1U6G A;  1J0R A;  2OUM A;  3OS2 A;  1KYW A;  2FD5 A;  2MYS A;  3F8C A;  3VSL A;  4BJ6 C;  1K78 B;  1G59 A;  4IXA A;  5IT9 Z;  1AA7 A;  3WU2 C;  4RGS A;  4BQQ A;  4ZYD A;  1SD4 A;  5EGO B;  4E7H A;  2QBY B;  3K6G A;  3FBI B;  3JRH A;  4L0Z B;  3JW4 A;  3S2D J;  1R00 A;  2O03 A;  1TW3 A;  5DUI A;  5FLM J;  3KYL A;  1U9N A;  3TQN A;  3E6M A;  2E36 A;  1HKQ A;  4OIN F;  3V7C A;  1P4W A;  3DWL E;  2VJI A;  1KU7 A;  1BR4 A;  2L9R A;  1HST A;  3W6J B;  3SFZ A;  2XRL A;  2NOG A;  1FEX A;  3ABM H;  2CQK A;  4HPQ A;  4ANJ A;  1LNW A;  4FET A;  1K61 A;  4M9X A;  2I10 A;  1NG7 A;  3OIP A;  3GYH X;  1ORK A;  2UWM A;  3IAS 2;  2M45 A;  4M3B A;  3ASN H;  4IOC F;  2DW4 A;  1FMW A;  1BI2 A;  2E34 A;  4GRI A;  3ZMV A;  4DBQ A;  2L0K A;  3WU0 A;  2F5V A;  2AS5 F;  5D4R A;  2XAQ A;  1OLT A;  4G8X A;  4BXX J;  3ASO H;  3I64 A;  2HU9 A;  2XDV A;  4L9J A;  3HKZ A;  5D5U B;  1BR1 A;  1TNS A;  3I5U A;  3NQO A;  2FA5 A;  2QEX I;  4FHT A;  3CCJ I;  5KAF C;  1CF7 A;  3E3V A;  1R23 A;  2GXG A;  3T8T A;  3WE3 A;  1EF4 A;  2CG4 A;  4FTH A;  4WX9 A;  2K40 A;  2XGD A;  4P55 A;  3RTR A;  2A05 A;  1UHW A;  4PGG A;  2ECC A;  3SXY A;  3VEP A;  4D7M A;  1X4O A;  4LB5 A;  2R7R A;  2X1E A;  4HSR A;  3OYA A;  4RAF A;  4BKX A;  1HKS A;  1T39 A;  5FKN A;  3PNT A;  1EH7 A;  4FE7 A;  3PO2 J;  2G0E A;  1B72 A;  2QKM B;  3HB9 A;  1FBS A;  3AG3 H;  1R22 A;  1XC5 A;  3ZMT A;  4AC0 A;  2J5O A;  3IL2 A;  3HOT A;  2WA0 A;  4KUM A;  2CS3 A;  3OYE A;  2Z3Y A;  2UXN A;  2ZNY A;  2FXA A;  1R5G A;  1QO0 D;  4A3L J;  1IN8 A;  1DUX C;  2ZXI A;  3WTT C;  4BBS J;  5E3L A;  4B4C A;  4UVC A;  4EM2 A;  3HKZ N;  4RM2 A;  4ESJ A;  5K7F A;  5CVI A;  2QVO A;  3V7R A;  3ZQG A;  3TED A;  3IV5 A;  4BHB A;  3K1N A;  1TBX A;  2F5D A;  5C3E J;  4DGW B;  3SHF A;  4MEY F;  3E7L A;  2HOT A;  4LG3 A;  1R5I D;  2DXI A;  3OYK A;  1B6A A;  1W5T A;  2L9N A;  4HYE A;  1U2W A;  1D8J A;  3BTI A;  4HDU A;  1T8I A;  1I3Q J;  4A3D J;  1KU3 A;  1OCC H;  1QQI A;  1FTZ A;  2DMP A;  5JVG F;  4L9T A;  1IRZ A;  1A35 A;  2ACJ A;  1ENH A;  1Y6I A;  2VC0 A;  1TW2 A;  1ON2 A;  2DQR A;  2XAS A;  2RQP A;  1XMA A;  2RKH A;  3I56 I;  4MEX F;  1G2H A;  2Y31 A;  4M6V A;  2K85 A;  2KP6 A;  1XTA A;  2DYS H;  1UZC A;  4P9F A;  2XF7 A;  1FOX A;  3JTH A;  4BE1 A;  4U0W A;  3RQ4 A;  2LBF A;  4LG0 A;  1YX5 A;  5ED4 A;  3A0B C;  2QA4 I;  2WAQ N;  2OAZ A;  2LY2 A;  2A6E F;  3ERM A;  4XQF A;  3HSE A;  2AQF A;  3MZ8 A;  3A01 B;  2DA1 A;  4XN3 A;  1XN7 A;  4KT6 A;  2NVX J;  5K7Z A;  2KKO A;  2RNJ A;  1ZAR A;  4B47 A;  2QSG X;  1GVJ A;  1Z6R A;  4CCK A;  3S17 J;  2XAU A;  2XRO A;  3BOQ A;  3HC7 A;  4RGX A;  1BBY A;  1ODD A;  1E0E A;  4LMY A;  1SMY F;  2FOK A;  3ML6 A;  3OYI A;  3IC7 A;  1J09 A;  4A3C J;  2GXB A;  2X6Y A;  2OBP A;  1V54 H;  4BE2 A;  2JA5 J;  3RQI A;  3EQL F;  2W25 A;  1IRF A;  3WTS C;  2GIV A;  3JTG A;  3S15 J;  2FRH A;  1RUN A;  2C6Y A;  3GUD A;  3GTL J;  3L2C A;  3TMO A;  2JWT A;  1U5T B;  2JA2 A;  4BS9 A;  4Z6Y A;  4RAY A;  5F6F A;  3WHB A;  1YRN B;  1YJN I;  4KMU X;  1V3F A;  4D1Q A;  3BG3 A;  2QSF X;  3FXM A;  4DYQ A;  5GP9 A;  2GAU A;  1HW2 A;  1AKH B;  4F55 A;  1SVO A;  2FBK A;  5BPD A;  2PBI A;  5L3C A;  1MDM B;  2RN7 A;  1KGS A;  1TLH B;  3IUO A;  4BGD A;  2Y75 A;  1MBF A;  1WJ5 A;  2NVY J;  2L4M A;  2RGV A;  1SFO J;  3SYT A;  1T0F A;  3O6B B;  2LOO A;  3K4C A;  2EZH A;  2B63 J;  1JI8 A;  2VPR A;  5JHF A;  4A6D A;  5DM6 F;  2G7U A;  1GV5 A;  1BW6 A;  3B6C A;  2E60 A;  3NRV A;  3J81 K;  1IDY A;  1I1G A;  3E97 A;  2CUE A;  4NC6 A;  5J1R A;  2CWE A;  1XDU A;  2VBW A;  2XF5 A;  3DLA A;  2WV0 A;  5DV5 A;  4LGW A;  2R5Z B;  1LDJ A;  2CSO A;  3E5X A;  4M6Y A;  1JUP A;  1WQ2 A;  4EMS A;  2QZ8 A;  4ABZ A;  4UV9 A;  3CCQ I;  3ERE D;  1YIT I;  2LKS A;  3FM3 A;  1B1B A;  1O3R A;  3EUA A;  5CVU A;  1MIJ A;  3V8J A;  1UB9 A;  1YQA A;  4DYR A;  4HA8 A;  2TRT A;  2M3A A;  5J6X A;  1IO2 A;  1FNN A;  4X1E A;  2UZK A;  1XCB A;  2JMW A;  4YG2 F;  1RUO A;  1VF9 A;  4ZYE A;  4XLH A;  1YHQ I;  1MD0 A;  1RI7 A;  4D5F A;  2Q1Z B;  2MH9 A;  3JR9 A;  2CV0 A;  3IP4 B;  2MH2 A;  4JK1 X;  3BTJ A;  2DFH A;  3F0C A;  1VQK I;  5D6E A;  3IRQ A;  1QHG A;  3HTU A;  5EG0 B;  2W00 A;  3P5J A;  3IH2 A;  4M9Z A;  2V6E A;  4BXF A;  2W57 A;  1R4M B;  1DGW Y;  1IW7 F;  2AHQ A;  3DV8 A;  3G2B A;  3I4N J;  2KIM A;  3HXL A;  4XLE A;  3FHZ A;  1MJA A;  4EJO A;  3DCF A;  4WXH A;  4G7H F;  4ESB A;  2R4G A;  2ISZ A;  3DPL C;  2L9S A;  2ZJR F;  3M4O J;  1IV8 A;  1Y1V J;  4K2E A;  2COM A;  1UG2 A;  1T38 A;  3CMY A;  2QCO A;  3K70 C;  4QLC U;  1D0Z A;  3ESW B;  4M9S A;  4RB0 A;  1P6R A;  2CQQ A;  4JQF A;  3TO9 A;  3LSJ A;  2HDW A;  2VKE A;  4BYY A;  2ECB A;  5ICC A;  2R93 J;  1S29 A;  5C44 J;  4F93 B;  3OYL A;  1FBU A;  2JA6 J;  1S8N A;  2IS2 A;  4WK8 F;  1FIA A;  3H3U A;  2VOP A;  2JA7 J;  4GCV A;  3BR2 A;  3K70 D;  1HCR A;  2WY8 Q;  1MMG A;  1OYI A;  4RA2 A;  2DO7 A;  3S8P A;  1V55 H;  2IGM A;  3K10 A;  2PJR B;  1LEA A;  1UHM A;  3D1N I;  2CH0 A;  2LRD A;  4BY1 J;  3HHG A;  3BR5 A;  4I98 B;  4AVP A;  3ZMD A;  5IYB J;  2R7S A;  2FMY A;  5LEJ A;  5CKT A;  3F72 A;  3N4M A;  2CQX A;  3C2B A;  1C0W A;  5ICF A;  3O2P E;  4MO7 A;  5L3F A;  1O4X A;  5IY5 H;  1QZZ A;  1GXQ A;  1X58 A;  3H35 A;  5ILS A;  3PFI A;  3H5R A;  4E70 A;  2AXL A;  3JRE A;  3JAM K;  2BXY A;  4ENJ A;  4A3M J;  2XHK A;  1NK3 P;  4AD9 A;  5FRN A;  3AAF A;  1UFM A;  4KDP A;  2AO9 A;  3Q0U A;  2K9N A;  3S1Q J;  3G6E I;  1A36 A;  1JTX A;  1LDK B;  1O7F A;  2CV2 A;  1TWH J;  3H0G J;  4KFC A;  3HRM A;  4P1W A;  4OIR F;  3OSF A;  1Z9C A;  4IL6 C;  3CUQ C;  1XGN A;  4NBQ A;  3GTG J;  1X1D A;  4LOC A;  1ZRC A;  3GLL A;  3VFZ A;  2LFB A;  3RIR A;  4XRS A;  3U21 A;  2KZV A;  2L5Q A;  4A3K J;  3LQQ A;  4IZZ A;  4NC7 A;  3B73 A;  3GTQ J;  3J81 Z;  2R7X A;  3CLQ A;  4XOT A;  3PQJ A;  1ZRD A;  2JSP A;  1WJA A;  3M9A A;  2GXA A;  4C2M J;  3HRU A;  2JPB A;  4LK1 F;  2R7O A;  3BQZ A;  3S2H J;  4A3B J;  2KRC A;  3ZQC A;  1D1A A;  2CQN A;  3WU1 B;  3PL8 A;  2UXX A;  2NVU B; 
#chains in the Genus database with same CATH homology
 2P4W A;  2GA1 A;  3TDZ C;  2Y48 A;  3ULQ B;  4U0Y A;  1U5T A;  1BJA A;  2L4A A;  3MEX A;  5CLS A;  3I71 A;  2F2E A;  1Z6T A;  3VOE A;  3P9C A;  3F8N A;  5CYV A;  1IN4 A;  3TO6 A;  2D1V A;  1E2X A;  5D4S A;  2WWY A;  2CW0 F;  3K0L A;  2V9V A;  3M8F A;  2MBF A;  4U0V A;  2XKP A;  2RVC A;  4Y13 A;  2HYG D;  5ILU A;  2EB7 A;  4HBL A;  4Y17 A;  2QWW A;  1SMT A;  1F1Z A;  4BHP A;  5LHH A;  3Q9V A;  3FMQ A;  1OYY A;  4N9H A;  4RB3 C;  3COA C;  2MLG A;  3F8B A;  1WRJ A;  5J8C A;  3BPV A;  5ICG A;  2Z33 A;  2VT2 A;  2RDP A;  2W85 A;  2H6C A;  2LDU A;  4Z2Y A;  2DTR A;  4EGY A;  3ZN1 A;  4PCQ A;  3WGI A;  4CXF A;  4IVN A;  3BJ6 A;  3REO A;  1YYV A;  1S7A A;  1QBJ A;  5H6Q A;  1IAW A;  1WKM A;  2QLZ A;  2STT A;  3M8E A;  4DQ2 A;  1S3J A;  4OMZ A;  1FBQ A;  3V8K A;  3V8L A;  3GFJ A;  1YIO A;  5DUK A;  5E20 A;  2XV4 S;  3E6D A;  3KZY A;  2O0Y A;  5DEQ A;  2PN6 A;  2HZT A;  1IN7 A;  3KP5 A;  1AWC A;  2XVC A;  2B0L A;  2ZCW A;  5BS6 A;  2HOE A;  4LJZ F;  2ZBK A;  5HS8 A;  2MC3 A;  2M5W A;  1T6S A;  2Y0M A;  2K7L A;  3ZN0 A;  1EH6 A;  3IWZ A;  5EEG A;  2IA0 A;  4B09 A;  4LG0 B;  2FBH A;  1FOK A;  4L18 B;  1BC8 C;  4HLY A;  5LHI A;  1W4M A;  5A2Q K;  2K4B A;  2XGX A;  3I4P A;  5ERI A;  3RYP A;  2QYO A;  3R0A A;  4O6J A;  4RS8 A;  1ZRF A;  3EYI A;  3FF5 A;  5D8L B;  1PUE E;  1G3T A;  2X4H A;  3I59 B;  2BBY A;  2KJB A;  2QM3 A;  4LFU A;  1T2K A;  4HDV A;  5FO5 A;  2XRN A;  1MKM A;  4IHS A;  5HS9 A;  2F5C A;  4KT5 C;  3L00 A;  3E6B A;  4PDK A;  3F6V A;  3KFW X;  2KIF A;  1KU2 A;  4KA4 A;  5DDG A;  1GXP A;  1BC7 C;  3BJO A;  3DFG A;  4KN4 X;  4M74 A;  1DPU A;  1YG2 A;  2W24 A;  3DP7 A;  4HQE A;  2K4J A;  3R4K A;  5LRS A;  2OD5 A;  2V1D A;  1OPC A;  1BOA A;  3N97 A;  2EWN A;  2M87 A;  4IRH A;  3O3K A;  2OU2 A;  3P7N A;  2MLK A;  4N9I A;  4H0E A;  4KNY A;  3F8M A;  1YW8 A;  1FLI A;  4ZYH A;  3HSR A;  5H20 A;  4YII A;  2DAO A;  1FC3 A;  4BH9 A;  4MTE A;  4LLN A;  1J59 A;  2A6H F;  1RIO H;  2LKP A;  2HKO A;  1W5S A;  1FSE A;  1XD7 A;  1BI3 A;  4ASN A;  2VON A;  2E7W A;  3QU6 A;  4LLG F;  5H6R A;  3H3Z A;  4IPA A;  4UXN A;  1B4A A;  4F7Z A;  1IZ1 A;  3KET A;  1UST A;  4MHG A;  1G6N A;  2FE3 A;  2XAH A;  5HDK A;  5A2Q Z;  3MFK A;  4OMY A;  1LQ1 A;  1Z91 A;  5ICE A;  1U5T C;  5D8K B;  4CO8 A;  1HKT A;  2P5K A;  1D8K A;  3K1M A;  3K1P A;  2VT3 A;  5K5Q A;  2STW A;  1H9G A;  1YFH A;  1R36 A;  4D0P A;  3QP6 A;  5K5O A;  5FGM A;  2OZ6 A;  1B9N A;  3WTZ A;  5HS7 A;  2BEO A;  2ZFW A;  1SD7 A;  4LD5 A;  4FX4 A;  5DD8 A;  4CYD A;  4R79 A;  2PI0 A;  4ZYG A;  4A0Z A;  2CO5 A;  2EK5 A;  4WXD A;  2RV8 A;  4A2U A;  1Z1D A;  2EFQ A;  2R7D A;  1KA8 A;  3IKT A;  1GHC A;  4G7O F;  1ZG5 A;  1D3Y A;  4CZZ A;  4A12 A;  4TV7 A;  3Q9S A;  2HTS A;  3S2W A;  3VB2 A;  1A04 A;  1BIB A;  3WGG A;  2ELH A;  2V1U A;  2ZO4 A;  2VE9 A;  5LBQ A;  2PLY A;  4N0B A;  3K2Z A;  1HW1 A;  3MAJ A;  5LRR A;  2X0L A;  3FX3 A;  3BWG A;  1SAX A;  2HKX A;  1NHA A;  3RKY A;  3I53 A;  3K9T A;  3HIF A;  3I59 A;  2DBB A;  2VC1 A;  1OR7 A;  3IWF A;  1YTY A;  2JRT A;  3GFI A;  4EJV A;  1YS6 A;  2WTE A;  3QRF F;  3RPQ A;  2DPD A;  3BRO A;  5BMZ A;  4ENK A;  2G7H A;  1REP C;  2IJL A;  3LAP A;  3C3W A;  1HSJ A;  1ZLK A;  4FT8 A;  1PP7 U;  2VOD A;  4HW0 A;  3ABT A;  1ZGA A;  1ZG3 A;  2DPU A;  1XCV A;  2A07 F;  3BZ6 A;  4O5V A;  4R1H A;  3KEQ A;  1MJB A;  2JPC A;  4KMF A;  3SQN A;  2JTV A;  1FX7 A;  4I01 A;  2EA2 A;  2A61 A;  3LWF A;  1TNT A;  4A0X A;  1VTN C;  3F23 A;  2PMU A;  3L09 A;  3LAJ A;  2HYF A;  2YSR A;  4L0Y B;  3WTU C;  3OOP A;  2YX4 A;  5LGU A;  2OA4 A;  1B9M A;  4A5M A;  1STZ A;  1PDN C;  4CIC A;  5FLX K;  4WWC A;  3QP5 A;  2ZKZ A;  3HUG A;  2E1C A;  2VE8 A;  3C7J A;  5LHG A;  1OMI A;  2F5E A;  2BV6 A;  3CO7 C;  2V6C A;  2MD5 A;  1QNT A;  3WTV C;  1YS7 A;  2L02 A;  3PQK A;  1QPM A;  2A68 F;  2HQN A;  3QOP A;  4OIQ F;  3WTW C;  2G9W A;  4M73 A;  3LA7 A;  3WTY C;  2A3S A;  1P2F A;  4Q5S F;  1I1S A;  4HZF A;  5FD5 A;  1FP1 D;  4EM1 A;  4I0A A;  4XLN F;  3U9G A;  4I7H A;  4KYW A;  1O57 A;  5FB2 A;  4UV8 A;  4WF2 A;  5K1Y A;  3BDD A;  5JFR A;  2OZU A;  3EYY A;  4ZH4 F;  4OU0 A;  3ECH A;  4MQV A;  3EUH A;  4GYG A;  5DYM A;  2FEZ A;  5HVQ C;  3C1D A;  4UUV A;  3RI4 A;  1FY7 A;  3KE2 A;  3HTS B;  4ENM A;  3R0J A;  2XAJ A;  5FFX A;  2PFB A;  3ELK A;  3R6S A;  4HF0 A;  3RYR A;  4ESF A;  2DLL A;  2D45 A;  2PMH A;  1ZRE A;  3KP2 A;  4GYI A;  3M1E A;  2DI3 A;  2OQG A;  3FM5 A;  5DD4 A;  4IRI A;  4AIJ A;  2KRF A;  2XAG A;  4XSX F;  1ZLJ A;  2YR2 A;  2IP2 A;  5FLX Z;  2K27 A;  2NYX A;  2WC2 A;  2EFW A;  2BE5 F;  4NHJ A;  1LJ9 A;  2ZME B;  3G3Z A;  1S6L A;  4UHT A;  4U7B A;  2EFN A;  1Z05 A;  1SD6 A;  4M71 A;  2JZY A;  2P5V A;  2PQ8 A;  3E5U A;  5CVJ A;  1I6X A;  3LFK A;  4AIH A;  2Q8K A;  1HW5 A;  3V7S A;  3KEO A;  3LST A;  5JVT A;  4ENN A;  2JSC A;  2FU4 A;  3FZV A;  1DDN A;  4HX8 A;  5DCF A;  1BN5 A;  3M7G A;  2NAZ A;  3ISP A;  2O3F A;  1F5T A;  2E7X A;  3DQV C;  1JGS A;  4HV5 A;  3GWZ A;  4ZZL A;  5ILV A;  3DEU A;  3I0T A;  3QPH A;  5IT3 A;  1HBX G;  1XB4 A;  3JAM Z;  5E1Z B;  5E8G A;  4ETS A;  3VOD A;  5TJJ A;  1FP2 A;  1IXR C;  4U7D A;  1BI1 A;  3GZ5 A;  1Q1H A;  1JHH A;  3WE2 A;  2E1N A;  2LF8 A;  3JSO A;  4HF2 A;  3DKW A;  5TRD A;  3F3X A;  3MQ0 A;  3RPU A;  4PGH A;  4I09 A;  5CVR A;  2DK8 A;  3Q5F A;  3IHU A;  3U2R A;  4I0B A;  5KK1 A;  4IHT A;  2Q2E A;  3L7W A;  5HDG A;  2HWV A;  3CJN A;  3CUO A;  4LLL A;  5DCM B;  1WI9 A;  1O7L A;  2DQL A;  2HQR A;  1IF1 A;  4GGG A;  2ADU A;  1FPQ A;  1RNL A;  2D1H A;  3T5X A;  4CDG A;  4P96 A;  3WG9 A;  1IN6 A;  4EJU A;  1J2X A;  5HLI A;  3GFL A;  4G9Y A;  1SFE A;  2A69 F;  3V4G A;  4I2O A;  2UXX A;  5AON A;  3NEU A;  3EDP A;  2DK5 A;  3ABU A;  1MGT A;  2VBX A;  1R7J A;  4BXU A;  2QQA A;  2FNP A;  4YFK F;  4IRG A;  4HQM A;  5AIQ A;  3DPT A;  5AIP A;  2KIU A;  2BYV E;  3U1D A;  3BJA A;  1XSD A;  4BHC A;  1MJ9 A;  1YO5 C;  4NQW A;  3F21 A;  5L3B A;  3DXJ F;  3TOA A;  1XSX A;  1B59 A;  1L3L A;  2EV6 A;  3KP7 A;  4QWQ A;  3IRR A;  4PZJ A;  3W6K B;  1I5Z A;  3E5Q A;  1J9I A;  4OIP F;  1AOY A;  3R60 A;  1LEB A;  4EVI A;  4G6Q A;  2CGP A;  2ESN A;  1Y0U A;  2IT0 A;  1D5V A;  2IPQ X;  3FXU A;  3FXR A;  1G3Y A;  3E6C C;  1LB2 A;  2ZXJ A;  3GF2 A;  4BQA A;  4WCG A;  2H6B A;  1W7P B;  2M30 A;  2ZME A;  1J75 A;  2HGC A;  4S04 A;  4G7Z F;  2L01 A;  3HRS A;  1BIA A;  3FMS A;  3HYI A;  1XSV A;  2ETH A;  5L3E A;  4LB6 B;  1JXS A;  1L0O C;  3LQR A;  1DP7 P;  1ZGJ A;  2PEX A;  2Z5U A;  3CUQ A;  2QUF A;  3CTA A;  2IA1 A;  4A6E A;  2NS0 A;  2L3D A;  4HX4 A;  1J5Y A;  2NNY A;  4UVA A;  2IW5 A;  2VXZ A;  1U78 A;  4XSZ F;  4U88 A;  1JE8 A;  5KVR A;  3GVA A;  2PG4 A;  2ZNZ A;  1LVA A;  3T1B A;  3SZT A;  2MA3 A;  4G94 A;  3GEZ A;  2XAF A;  2DFI A;  1PP8 F;  4R8H A;  4XRF A;  3KZZ A;  1ZYR F;  2FBI A;  1SD5 A;  4KIC A;  1BI0 A;  1TQI A;  4MGR A;  4RB1 A;  3CO6 C;  4EM0 B;  2HS5 A;  5D6F A;  1SFX A;  2W84 A;  5DCM A;  1RZ4 A;  3ZQ7 A;  1F4K A;  4AWX B;  1DPR A;  5HLH A;  2EFP A;  3BY6 A;  3TOB A;  3GZ6 A;  4EQQ A;  5D5V B;  2Z99 A;  4IJA A;  1P4X A;  1LDD A;  1QGP A;  3HSF A;  2DU9 A;  5JR3 A;  2IA2 A;  4M72 A;  5FFZ A;  1FZP B;  1KQ8 A;  2FF4 A;  4Q48 A;  3WTX C;  3R61 A;  3RKW A;  2HTJ A;  3QAH A;  3K69 A;  2HEO A;  5L3D A;  3QU3 A;  1XGO A;  2HDC A;  4GXO A;  2Q0O A;  5LLQ A;  3HHH A;  1TQP A;  3RDI A;  3I54 A;  1S7O A;  2QEN A;  4CGZ A;  4KIB A;  5E1W A;  1R1V A;  2VBZ A;  1K79 A;  4XBF A;  1XGS A;  5D5X B;  1KQ9 A;  2FML A;  1J7K A;  4HOB A;  5K5R A;  2EA4 A;  4BNC A;  1YW7 A;  4RB2 C;  2LF7 A;  4L9V A;  1ULY A;  1K7A A;  2P7V B;  1K78 A;  5LEK A;  3FMR A;  4S05 A;  5CVV A;  1MZB A;  2QBY A;  3MWM A;  4EV0 A;  2KJC A;  1IRG A;  1R58 A;  1FT9 A;  1W7P A;  2GZW A;  2RC4 A;  1R1T A;  4MQ9 F;  5J8F A;  3TDU C;  2NRA C;  4FX0 A;  4RAZ A;  2J5P A;  3F6O A;  2EJR A;  1FWZ A;  1HXD A;  4HX7 A;  5JHU A;  1UCR A;  1ON1 A;  3KLO A;  3KP6 A;  3BPX A;  1XGM A;  5CJ9 A;  2V79 A;  4YFN F;  2V1X A;  2LNB A;  4HF1 A;  1KQ0 A;  2EFO A;  3D5L A;  1KYZ A;  1TTY A;  3J80 K;  2L54 A;  5LGN A;  4JBA A;  5BPI A;  2H27 A;  3ZP5 A;  1U3E M;  5EEH A;  4NB5 A;  5HDN A;  3ZMS A;  3J7A O;  2P5L C;  1FYM A;  4L5J A;  2LSO A;  2BGC A;  1XMK A;  1FSH A;  4MNU A;  1CGP A;  2O8X A;  3KP3 A;  3ECO A;  2NNN A;  3JSP A;  3EET A;  2FSW A;  4WXC A;  4AIK A;  3P9K A;  1KU9 A;  4UNO A;  3GFM A;  2K02 A;  5F1R A;  5JI6 A;  1U8R A;  4A0Y A;  1T98 A;  1X3U A;  1IN5 A;  2HFH A;  1YW9 A;  4DNC A;  3H92 A;  2R3S A;  3F22 A;  3MZY A;  2YU3 A;  2CFX A;  1ONV A;  4EGZ A;  1YLF A;  2QQB A;  2YPR A;  3L9F A;  2YX7 A;  4YIF A;  2H09 A;  4KIF A;  3GW2 A;  4ON0 A;  2JT1 A;  2EV5 A;  5BQT A;  1OYW A;  5FD6 A;  3WOD F;  3GXO A;  4CHU A;  1XDS A;  4GO1 A;  3ZMZ A;  6PAX A;  1BM9 A;  2P8T A;  2O61 A;  2H94 A;  4OIO F;  1ZG1 A;  2P6S A;  5HLG A;  5F64 A;  1IXS B;  1WWX A;  3ZMU A;  2GA2 A;  1O3S A;  1MDM A;  5HOO A;  2EV0 A;  4L5I A;  2K86 A;  3MZH A;  2ZJ2 A;  1H0M A;  3I58 A;  1JHF A;  3C18 A;  4A5N A;  4MTD A;  3CDH A;  3WGH A;  4I02 A;  1O3Q A;  2DT5 A;  4G6D A;  3KCC A;  3J80 Z;  2XIG A;  3CUQ B;  4YFX F;  3GLX A;  3T0Y A;  1CF7 B;  2P7C B;  2ESH A;  4EJT A;  3RKX A;  4HLX A;  4L9N A;  5E18 F;  3GO5 A;  4BAY A;  4O3M A;  1ZAO A;  1ZN2 A;  5L3G A;  5IT9 K;  4KN7 X;  1P4A A;  4LK0 F;  4Y15 A;  4XLP F;  2HR3 A;  2VOO A;  3TKY A;  2TDX A;  3GX4 X;  3LA2 A;  1SFU A;  3TO7 A;  3RJP A;  5E1X A;  1IUY A;  1F9N A;  5D5W B;  4B8X A;  2FQ3 A;  2XKO A;  3FXQ A;  1I27 A;  3P9I A;  4Q4Z F;  4UVB A;  2P6T A;  3B02 A;  2A5Y B;  3DF8 A;  1USS A;  1R5H A;  1K6O A;  1G4D A;  1G3S A;  2Z9O A;  1TQM A;  1E17 A;  1O3T A;  1HQC A;  2M8E A;  3FWE A;  3TGN A;  2ISY A;  1V4R A;  4RGU A;  1ZHF A;  1FYL A;  1EV7 A;  1QZY A;  2VN2 A;  3T8R A;  3CLO A;  4RGR A;  2FNA A;  3HRT A;  3ROU A;  2XUB A;  4P9U A;  3QPT A;  5E17 F;  2D2W A;  2OQR A;  5BOX A;  2IVM A;  1FYK A;  2O6G E;  3F8F A;  3KP4 A;  4M6X A;  1G3W A;  3ZPL A;  4EJW A;  3G73 A;  2M1B A;  5LGT A;  1W7P D;  1H9T A;  1P92 A;  1OKR A;  4Q47 A;  3HOS A;  1ZH5 A;  5E8I A;  4P5O A;  2GQQ A;  3OV8 A;  3D0S A;  2F5F A;  3BP8 A;  2CYY A;  1Z7U A;  2QQ9 A;  4HAM A;  2PJP A;  1EH8 A;  2VBY A;  4HV6 A;  4IF4 A;  2GWR A;  3MCZ A;  2IRF G;  3LA3 A;  3KLN A;  2R7F A;  1IXC A;  1WSU A;  3SZP A;  4OOI A;  4ZZD A;  1R1U A;  3IKV A;  1U6G A;  1J0R A;  1KYW A;  1K78 B;  3F8C A;  4IXA A;  5IT9 Z;  4RGS A;  4ZYD A;  1SD4 A;  2QBY B;  4L0Z B;  3JW4 A;  1R00 A;  2O03 A;  1TW3 A;  5DUI A;  3TQN A;  3E6M A;  1HKQ A;  4OIN F;  3V7C A;  1P4W A;  1KU7 A;  1HST A;  3W6J B;  3SFZ A;  2CQK A;  1LNW A;  4M9X A;  2UWM A;  3GYH X;  2M45 A;  2DW4 A;  1BI2 A;  3ZMV A;  3WU0 A;  2AS5 F;  5D4R A;  2XAQ A;  4G8X A;  3I64 A;  4L9J A;  5D5U B;  3I5U A;  1TNS A;  3NQO A;  2FA5 A;  4FHT A;  1CF7 A;  3E3V A;  1R23 A;  2GXG A;  3T8T A;  3WE3 A;  2CG4 A;  4WX9 A;  4P55 A;  3RTR A;  3VEP A;  1UHW A;  4PGG A;  3SXY A;  4LB5 A;  1HKS A;  1T39 A;  1EH7 A;  1FBS A;  1R22 A;  3ZMT A;  2J5O A;  3IL2 A;  3HOT A;  4KUM A;  2Z3Y A;  2UXN A;  2ZNY A;  2FXA A;  1R5G A;  1QO0 D;  1IN8 A;  1DUX C;  3WTT C;  4UVC A;  4EM2 A;  4ESJ A;  5CVI A;  2QVO A;  3V7R A;  4BHB A;  3K1N A;  1TBX A;  2F5D A;  3SHF A;  4MEY F;  1B6A A;  1W5T A;  4HYE A;  1D8J A;  1U2W A;  4HDU A;  1KU3 A;  1QQI A;  4L9T A;  2ACJ A;  2VC0 A;  1TW2 A;  1ON2 A;  2DQR A;  2XAS A;  2RQP A;  1XMA A;  2RKH A;  4MEX F;  4P9F A;  3JTH A;  4U0W A;  4LG0 A;  5ED4 A;  2OAZ A;  2A6E F;  3HSE A;  1XN7 A;  2KKO A;  2RNJ A;  1ZAR A;  1GVJ A;  1Z6R A;  2XRO A;  3BOQ A;  4RGX A;  1BBY A;  1ODD A;  4LMY A;  1SMY F;  2FOK A;  3ML6 A;  3IC7 A;  2GXB A;  2OBP A;  3EQL F;  2W25 A;  1IRF A;  3WTS C;  2GIV A;  3JTG A;  2FRH A;  1RUN A;  2C6Y A;  3GUD A;  3L2C A;  1U5T B;  4RAY A;  5F6F A;  4KMU X;  1V3F A;  2GAU A;  1HW2 A;  2FBK A;  5BPD A;  2PBI A;  5L3C A;  1MDM B;  2RN7 A;  1KGS A;  1TLH B;  2Y75 A;  2L4M A;  2RGV A;  1T0F A;  3O6B B;  4A6D A;  2G7U A;  3NRV A;  3J81 K;  1I1G A;  3E97 A;  2CWE A;  1XDU A;  2VBW A;  2WV0 A;  5DV5 A;  4LGW A;  1LDJ A;  2CSO A;  3E5X A;  4M6Y A;  1WQ2 A;  4EMS A;  2QZ8 A;  4UV9 A;  3ERE D;  3FM3 A;  1B1B A;  1O3R A;  5CVU A;  3V8J A;  1UB9 A;  1YQA A;  4HA8 A;  5J6X A;  1FNN A;  2UZK A;  1XCB A;  4YG2 F;  1RUO A;  4ZYE A;  1MD0 A;  1RI7 A;  2MH9 A;  2MH2 A;  4JK1 X;  5D6E A;  3IRQ A;  3HTU A;  4M9Z A;  2W57 A;  1IW7 F;  3DV8 A;  2KIM A;  3FHZ A;  1MJA A;  4EJO A;  4WXH A;  4G7H F;  4ESB A;  2ISZ A;  3DPL C;  4K2E A;  2COM A;  1T38 A;  4QLC U;  4RB0 A;  4M9S A;  5ICC A;  1P6R A;  4JQF A;  3TO9 A;  4BYY A;  1S29 A;  1FBU A;  1S8N A;  4WK8 F;  3H3U A;  2VOP A;  4GCV A;  1OYI A;  2DO7 A;  1LEA A;  1UHM A;  3HHG A;  4I98 B;  4AVP A;  3ZMD A;  2FMY A;  5LEJ A;  3F72 A;  3N4M A;  1C0W A;  5ICF A;  3O2P E;  5L3F A;  1QZZ A;  1GXQ A;  5ILS A;  3PFI A;  4E70 A;  2AXL A;  3JAM K;  4ENJ A;  2XHK A;  4AD9 A;  3AAF A;  1UFM A;  4KDP A;  1LDK B;  1O7F A;  4KFC A;  3HRM A;  4OIR F;  1Z9C A;  3CUQ C;  1XGN A;  1ZRC A;  3VFZ A;  3RIR A;  3LQQ A;  3B73 A;  3J81 Z;  3PQJ A;  1ZRD A;  3M9A A;  3HRU A;  2JPB A;  4LK1 F;  3WU1 B;  4KIG A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...