2KHMA

Structure of the c-terminal non-repetitive domain of the spider dragline silk protein adf-3
Total Genus 38
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
38
sequence length
140
structure length
140
Chain Sequence
b'MASMTGGQQMGRGSMGAASAAVSVGGYGPQSSSAPVASAAASRLSSPAASSRVSSAVSSLVSSGPTNQAALSNTISSVVSQVSASNPGLSGCDVLVQALLEVVSALVSILGSSSIGQINYGASAQYTQMVGQSVAQALAG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Fibroin-3
publication title A conserved spider silk domain acts as a molecular switch that controls fibre assembly
pubmed doi rcsb
source organism Araneus diadematus
molecule tags Structural protein
total genus 38
structure length 140
sequence length 140
chains with identical sequence B
ec nomenclature
pdb deposition date 2009-04-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF11260 Spidroin_MaSp Major ampullate spidroin 1 and 2
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.1350 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Arc Repressor Mutant, subunit A 2khmA01
2M0MA 2KHMA 2MFZA 2K3PA 2MABA
chains in the Genus database with same CATH superfamily
4RDUA 4XKCA 4IXAA 2FD5A 2L02A 3LA3A 4I0BA 2M4KA 1LQ1A 2KJCA 3JW4A 2XF7A 1YLFA 4XK4A 5CVIA 3KZZA 5E8IA 3FXQA 3LAJA 1WJ5A 2VPLA 2OZ6A 5FLXZ 1T6SA 2P6TA 5LFAA 3FHZA 2MG4A 3G1MA 5ICCA 1GVDA 1RKWA 2KIMA 5H6RA 2B63J 4GYGA 2QENA 2FOKA 3BLYA 1OCZH 1BA5A 3NRVA 2E5ZA 1YJ9I 3P9IA 3RKWA 1R58A 1ETWA 4IEJA 4BJ5C 5F1JA 1G59A 4V2FA 1NG6A 3OR2C 3ASOH 4RBOA 4A3EJ 3MZ8A 2O3FA 3SFIA 4F93B 4H0EA 1KU2A 1A6QA 1R5HA 4BQAA 1YIOA 3FXUA 1XPXA 2HVRA 3GVAA 3CUQA 1Y0UA 4HX4A 3GTLJ 2KRHA 3FDYA 3HSEA 4F91B 4WWCA 3SDGA 2LNBA 3OV8A 2HYJA 4L0YB 2DJNA 4NNJA 3L2CA 1J09A 1BM9A 4PJNA 3OYAA 3QP6A 3A1YA 1H88C 4YFXF 3VEPA 3EUHC 1MSFC 4UVBA 3HOUJ 1J9IA 1S29A 2LD5A 3EYYA 4HA8A 3CTAA 3ZMDA 2XSDC 1G3WA 1HKQA 4YG2F 3LSMA 2A3SA 4L9VA 3MEXA 4W1UA 4ZTJA 3PL8A 4I0AA 2D1VA 1QU3A 4HDVA 4CZZA 3X2QH 4HX8A 4N9HA 4KFCA 5DCMB 2EILH 2R0QC 1Y8RB 1YJNI 1D0ZA 4Y4RA 3L9FA 1FOWA 2L2OA 1PP7U 2DDBA 2L7ZA 2K86A 2VC0A 2W84A 1XGSA 2L9RA 4E7SA 4B43A 3ZR8X 1FIAA 1DGRM 2AQEA 2DFIA 3QWLA 3QU3A 1YI2I 2F5CA 1DP3A 1X1DA 2Z3YA 5HVQC 2NYXA 4BACA 3RPQA 3I5UA 1G8XA 4BEHB 2IS6A 4P9FA 4EV0A 3F21A 1AKHB 1LNWA 1NH3A 1Z91A 5D8LB 4LB6B 1R36A 2OZUA 1VQ5I 4RMNA 2ECBA 4PJMA 2XDVA 3K4NA 4G7HF 4KYWA 2M4GA 5J3LA 2E34A 2Y9ZA 2R5ZA 3BCBA 2FX0A 3HGYA 4JBAA 2L9SA 3ABTA 3ZMTA 2XKOA 1SD5A 3ERED 1OISA 1OLTA 2RQQA 2MD0A 3ROUA 3S2WA 3HJEA 2PN6A 4XSZF 2OQRA 2Y48A 3CC7I 2HR3A 2OA4A 2XV4S 3BJ6A 1T0FC 2YR2A 3ONQA 1SFEA 1SEUA 1UCRA 1LEBA 2CW7A 2JJ7A 4HNVA 1K78B 1J5YA 4C3IJ 1XDUA 2WAEA 1U6GA 3BPXA 3T8TA 3QOEA 2JQ7A 4HBLA 1V5GA 1VTNC 2Y75A 5EG0A 1BOBA 1J0RA 3EUKL 1HW2A 2Y0SA 3HC7A 1IUFA 4M6XA 5ED4A 5F64A 1Y39A 2M34A 2MH2A 2HVQA 5IYDJ 2PLYA 3LSPA 1EKEA 3OS1A 2CUJA 5LGTA 3J81Z 3LA2A 1X1CA 4LFUA 1X2NA 5HLHA 3WGHA 4BH9A 1M1EB 2A05A 2EBIA 5K1YA 5IP9J 2F2EA 3F23A 2IP2A 2FF4A 2Y0MA 4IPAA 3ZQLA 3CDIA 2ECCA 4HV6A 1S9HA 4LMYA 3VYTB 5K7HA 2KIQA 4EGZA 4KT5C 2F4IA 2LMDA 1ZAOA 2WTEA 4XSXF 5GAHJ 4XMYA 3E6CC 2P7CB 2JZYA 2OBPA 1SD7A 3DBHB 4AIDA 4DYRA 2BOLA 2QQBA 3FXOA 2QSHX 2DJIA 2QSGX 2XUBA 1W7PB 3M1EA 2JVHA 3H92A 3O3KA 1K83J 4XLEA 3AKZA 2H27A 4I98B 4CO8A 3KE2A 4HZFA 1ETKA 1F4KA 3GCMA 2CRGA 4C3HJ 4A69C 2TCTA 4IQ4A 3BTCA 2H6BA 4IRHA 2LC2A 4R8HA 2K9QA 1XGNA 2PFBA 4DYQA 2M8EA 1TWCJ 3MN2A 2LDUA 2RC4A 3LA7A 3HPHA 2W1OA 1JHFA 3HEFA 2XPUA 4HYEA 1CGPA 3M8FA 1R7JA 3GLXA 1H9TA 2X85A 4JQFA 3BTLA 3CP2A 2ZCWA 3TOAA 4I09A 5J1RA 1SFKA 2KPMA 3EPZA 4I7HA 2R7SA 4ENJA 1IRGA 5FFZA 4BEHA 2ID3A 1TW3A 3JRFA 1IV8A 2F4OB 3E97A 3QYBA 3PSIA 3DKWA 5J4YA 3K70D 1K7AA 4AVPA 3HTSB 3LQRA 3OYJA 1QZEA 1P4XA 4Y7NJ 1EJ9A 1P92A 3E5XA 1Z6RA 2GAUA 2HEOA 2W7NA 5HDNA 4XR6A 3M4OJ 4MNUA 5AIQA 2RGVA 3D5SC 2HTJA 1W1WE 5DM7F 4C2MJ 1XGMA 2F5VA 2O7OA 2YU9J 2JT1A 2DTRA 3OSGA 4CYDA 4BBRJ 5JFRA 3BR2A 3LOCA 1UAAA 4LD5A 3K6GA 3CCJI 1BI1A 4KISA 1ERDA 1LUJB 3OSFA 3EETA 4HNTA 3CCUI 1K78A 3KX2A 3W6KB 4NBQA 3OYKA 2KQRA 4BHPA 5LGUA 5TISC 1QQIA 2XF6A 1YTYA 3E6MA 5K5QA 3D5RC 2NXNB 2LRDA 4L5EA 3O2PE 2GLOA 3BG5A 1DGWY 5JHFA 2K9NA 1A6IA 2MFZA 3V4GA 1APLC 1F36A 1XMKA 1QHGA 3IAS2 4E7LA 2HKXA 2HI3A 1FMWA 3TKYA 1PUFB 4G6DA 3MVPA 1GUUA 2PEXA 1XTAA 3ZRGA 1SMTA 4RM3A 4F52A 4ZH4F 3T0YA 5FLMJ 2UWMA 2LTPA 3FXRA 2X6WA 3PUFA 3J81K 1ZLKA 4B47A 4KITB 3KP6A 4X0GA 4D5FA 5D8KB 2ZBKA 3L2VA 5BNGA 4EEFG 1C0WA 3AAFA 4EQQA 4LK1F 1H89C 2FOWA 3WHCA 4QPOA 2L9NA 3LSIA 3OR1C 2WY7Q 1X1AA 5LD2C 4KDPA 4NDLA 3KETA 3ML6A 1W7PA 3G1LA 3GF2A 2BXZA 2YS9A 3FXJA 3PJRA 3IRRA 1R71A 3S1RJ 2DLLA 1V55H 3N4MA 3Q9SA 4FTHA 1D0XA 1UZCA 1XCBA 1YW7A 2CS3A 2UXXA 2VN2A 3CP8A 5CVRA 4E70A 4IHWA 1OCPA 3QU6A 3Q0WA 3ZQ7A 2LF7A 3DBRB 3E5QA 2ZXWH 1ZGJA 2VE9A 5EYRA 1XD7A 2K4JA 3EUHA 3J7YJ 1USSA 3TP0A 5IT9Z 1B1BA 1IV6A 2GM4A 2MD5A 4XLNF 1MMNA 2EV6A 2Y2ZA 1VF9A 1N25A 3C18A 3ISPA 1ETQA 3VYUB 1OYIA 3BZ6A 4L0ZB 1NG7A 2DTZA 2FBIA 2KT0A 2ESHA 1P7IA 1XG1A 4HRIA 3K4KA 1R6RA 3ZMVA 5HNHA 4XORA 3WGGA 1B8IB 1MKMA 3MCZA 3V7CA 3FKJA 2X51A 2DA2A 4XRFA 4IVNA 2HYGD 3RPUA 3CCSI 3BTJA 5F04A 3RDIA 3FXKA 4C3JJ 4D1QA 3GTMJ 4U88A 2OJED 4XONA 2E2HJ 5EGOA 3VSKA 2H8RA 1Z67A 2BEOA 3SEQA 1IDYA 2ZSHB 3GBGA 4ZZDA 1ZTRA 2LKSA 3F6OA 2OUMA 3BP8A 3K69A 4IJAA 1I3AA 2BXYA 4KJZA 3M8JA 2VASA 2Y9YA 3S8PA 2BHYA 1DU6A 1R22A 1VQ9I 4EJUA 2M9HA 3IUOA 4CA0A 1I27A 4MFDA 3WGIA 2EFNA 1HW1A 3K4BA 1LEAA 1U8BA 3K4CA 1ZKGA 3CMAI 2RREA 2L4AA 1HQCA 3RTRA 3FMSA 1O7FA 2A6HF 2Q0OA 5JVTA 2ZNYA 2NVYJ 4UV9A 2W57A 4CZCA 2DA6A 1MMGA 5LHHA 3IV5A 2HNHA 4DGWB 2LSOA 4M74A 5EZHA 4TV7A 1T0FA 5DD4A 5L3DA 1PUFA 2IGNA 5CYVA 4B44A 1Y8QB 2ZXJA 2STWA 1E3PA 2EV5A 3HTUA 1U9NA 1EA3A 1ONVA 1P4AA 1OKRA 2DI3A 4NQWB 1B72B 1JXSA 1XSXA 1KQ0A 3I53A 4WXDA 5CJ9A 3A01B 2QLZA 1GT0C 4A3MJ 2DODA 4UB6C 1DPUA 4BHCA 2JTVA 1Z21A 3RZDJ 2LBFA 5LBQA 2ZC2A 3I71A 4AIKA 4FE4A 3V7RA 2VBZA 1RKTA 4V2GA 1KONA 2K5CA 2JA5J 2OTJI 4PUSA 3CCRI 4AIJA 1IO2A 2HTSA 2L9VA 1HSTA 2M1BA 3K2AA 1Z6TA 4RAZA 2TRTA 2QKMB 2R7TA 2KP6A 2IAIA 2FBHA 3V7SA 2GXGA 1EF4A 4M71A 1RPWA 1X2MA 2JPCA 5FKNA 4KIGA 5HS7A 1CF7B 1GV2A 2XGXA 4MTEA 4BQQA 1KU3A 3W2WA 1LDJA 2MGQA 5DD8A 2E2IJ 3MKWB 1XCVA 1B8IA 1HDPA 1ZYRF 5IPAA 4PFPA 3T1BA 1ETXA 2VE8A 1LVAA 3COAC 1R9TJ 4FX4A 5HNFA 2F5EA 1ZRDA 1K4TA 3OOPA 2P8TA 2ME6A 4U0VA 1HDDC 3PUBA 3L2RA 2ISZA 2CW8A 2ZKZA 5E8GA 1E3HA 2HDWA 3J7AO 2BY3A 2HS5A 2COMA 3MZHA 2FUG2 2V26A 4EMSA 2EZKA 3G3ZA 3M8EA 1O7LA 1MGTA 1N77A 2L01A 4RGSA 1X3UA 3TEDA 1YYVA 1W7PD 1Y56A 2VOPA 1X3WB 2HQAA 4G6QA 2D45A 1MNMC 3L09A 2E60A 2BZTA 3PO3J 4CCMA 2BW3A 4XBFA 1KQ9A 2F5FA 1JT6A 3Q5FA 1KZHA 5ICEA 2NVQJ 3DQVC 5F6FA 4L5IA 5K5OA 2DMTA 3PNYA 4HX7A 1F5TA 2M2EA 3OYHA 3BT9A 4BQOA 4HNUA 3WU2C 4KNYA 4UHTA 4MFEA 3RKYA 4LK0F 2JK3A 4CSWA 5M3FJ 3IH3A 3L7WA 4ASNA 4NQWA 1FYMA 5FD6A 3S2DJ 3A01A 5F27A 2P6SA 1D5VA 4M3GA 3S1NJ 2JN6A 3JCUC 1RZ4A 4M3EA 2CV0A 5FRMA 1U0JA 3D1NI 5E18F 1XS9A 1D8JA 3CUQB 3ABLH 3OOUA 2P7VB 3A0HC 5AIPA 5EEHA 3JTGA 2F48A 1IN7A 3EDPA 3HUGA 4UB8C 2LREA 2KIUA 2OF7A 3K4MA 3GZ6A 5LRSA 2R7WA 3CCEI 1JGSA 1LKXA 3VSLA 4LB5A 2KISA 4EM0B 1B9NA 1E17A 2DYRH 3CCQI 3RPUD 2NNYA 4XRSA 1IRXA 3R60A 4QPQA 4BDYA 4DZJA 2EIMH 4A3CJ 3FZVA 1UG0A 3OYEA 1FP1D 2OU2A 4CCOA 1OYWA 2QSFX 4FETA 3U9GA 3ZN1A 1XMXA 3FMQA 5ERIA 1ZHFA 2QQ9A 4HAMA 3E7LA 4DBQA 1ZH5A 1K6YA 1T8IA 5JI6A 3BPVA 3LMMA 3A0BC 1A31A 1I39A 2EA2A 5LGNA 2P4WA 3HOTA 1N78A 5GTIC 4BJTA 2A07F 3REOA 1U8RA 3WTVC 2DK8A 2XGDA 2ZJ2A 4Z6YA 1Q1VA 2XIGA 3OS2A 1OYYA 3ZXSA 4G8XA 2XAUA 3JSOA 3AG2H 2HQRA 2H6CA 4PJLA 4LG0A 4D7NA 3IP4B 1MMAA 2R7RA 3LQQA 2H8WA 4DQ2A 2WV0A 1V5FA 2X1EA 4V19K 2K9LA 4S0HB 2EIKH 2EA4A 2EWNA 4M6VA 1VI0A 3OYMA 2FMLA 1D1BA 2V1UA 3VYSB 2K4BA 1QHHD 2X4HA 3C2BA 2HYFA 4HSTA 2EQRA 3BG3A 2E1OA 2CG4A 1DP7P 3W6VA 2BY1A 2IBDA 3B73A 4XKWA 1ON1A 5E1ZB 4EM1A 3PFIA 2V1NA 1WSUA 1T38A 2R5ZB 1BJAA 2I8DA 2QUFA 2Z5UA 2AHQA 3FXMA 2YUSA 3CF2A 3TO7A 4A0YA 1UELB 3VOEA 4XM3A 4PGHA 1SAUA 4WXCA 3W2AA 1MJAA 2MLGA 1HKSA 4RGXA 2E7WA 5KAFC 5E1XA 1BC7C 1U5TC 3FWEA 2X6XA 4PSXA 3CDHA 3DV8A 3RIRA 3MKYB 3O8GA 4AUXA 3NWTA 1ORKA 2DBBA 2V79A 2OC6A 3H0DA 1R4NB 5EG0B 4IRIA 1JTYA 3I4PA 1YITI 3J80K 2J5OA 4XLPF 3I54A 3I0TA 4H4KC 2E2JJ 3H5RA 3WTXC 4LIVA 1OQYA 2MABA 2XF5A 1IRZA 4WX9A 2XC7A 2G7UA 4DYCA 3RKQA 1BW5A 1BOAA 3RCOA 1IXRC 2CU7A 2F5DA 1OJLA 2DDAA 1YO5C 3DLLF 1ZGAA 5DYMA 1RR7A 1UHSA 4UVCA 3FK6A 3GZNB 4XRSG 1MNEA 5L3GA 3JRAA 3CMYA 2DOEA 3IKVA 3ECOA 1ZLJA 4M3FA 2VKDA 3DCFA 4PCQA 4A6DA 3IHUA 2CJJA 3ZMUA 1FP2A 2VQGA 4L9JA 2KZVA 3CQZJ 2R93J 3L2UA 1U9OA 2FA5A 2GIVA 4Q4ZF 2MLKA 2RKHA 5LHGA 3WTUC 4JK1X 4B3XA 3OYFA 4OMYA 1JE8A 1I5ZA 3LWFA 2VONA 4A3LJ 5JHUA 4LITA 1TNSA 3BR6A 4ZYGA 2V6EA 3R61A 4K2EA 4HQEA 3LSGA 4IF4A 3TL4X 4E4HA 4B8XA 2DMPA 4UUSB 1O3QA 1SMYF 1TW2A 3B6CA 3P9KA 1RUOA 1BBYA 5FFXA 3V8JA 3GYHX 4BJ6C 1SFOJ 3ZCOA 1BR4A 1IN6A 2VKVA 4PJ0C 3HL2A 3WG7H 1G3YA 4BGDA 3E1SA 2P5KA 2VT2A 2VPRA 2HQNA 4ENKA 1RR8C 3ERMA 5IYBJ 2E1MB 4DIQA 5AONA 2XPWA 4A3BJ 1FWZA 2D2WA 2JRTA 3OYBA 2W25A 5KHDA 1X1BA 4U0WA 2QEXI 1WCMJ 1WVRA 2AO9A 3DEEA 2DA5A 1I3QJ 2STTA 4X6AJ 3PIPF 1Z05A 2LKXA 1N75A 2PMHA 4A5MA 5JLWA 1WJFA 1RNLA 1T08B 4KIFA 2JSPA 2E5NA 4HW0A 3ECHA 2HQ5A 4ESBA 4BL0B 3HM5A 4ZZLA 3LAPA 3KP2A 4F92B 3B6AA 3CUOA 4OAZA 5J8CA 3ZQIA 1WJCA 3Q0UA 1A04A 1S6LA 1SD4A 4HOBA 2BE5F 2IGKA 4ZYEA 3SXYA 1P6RA 4HPQA 3U1KA 2ESNA 4RB3C 1R23A 2XAFA 4Q47A 1R5ID 4G12A 2O61A 4LLNA 5DS9A 3K2ZA 1JGGA 1QBJA 2ETHA 3MFKA 4IHVA 5HODA 1UJ8A 5F0HA 1IUYA 3K4LA 2YSRA 2HPIA 1JJ8C 2JA7J 1FOXA 3L2WA 2ZFWA 3ABKH 4CH7A 3DPUA 2FMYA 4BS9A 2QBYB 2HVSA 3CD6I 2DQRA 5J47A 4HLYA 2K3FA 5DV5A 2BVMA 2CQ7A 3WTWC 5E3OA 2VT3A 2ID6A 5C44J 3SZPA 4OMZA 1WI9A 1OFCX 5M5XJ 4B4CA 2HDCA 2DT6A 4KN4X 3LSRA 1U78A 4BE2A 2N8GA 5CVUA 2NS7A 3CMEI 4IHXA 1UG2A 2VJ4A 4DBRA 4BE1A 5KK1A 1IZ1A 3Q3SA 4BHBA 1MSEC 3PQKA 4PJJA 4Y15A 2X0LA 1KYZA 4QLCU 3QPSA 3SEZA 4UUSA 3HOYJ 3BG9A 3SJMA 3GO5A 2GA2A 2VODA 3CESA 1SVMA 4B1RA 4M3DA 1R1TA 2R7UA 2X9DA 1Q1HA 5DCFA 1FYLA 3RYPA 3U1DA 5BOXA 4ON0A 1ZARA 3CLOA 1HCRA 3ZPLA 4RB0A 4ZJZA 3P5JA 1V3FA 5E20A 3ZQGA 4E7HA 2GWRA 3IL2A 1TWGJ 1XSDA 4GRIA 1MIJA 1IJWC 3HDDA 3E6BA 5EGOB 9ANTA 1QZZA 1ZGWA 2BVLA 5JVGF 3IRQA 3G73A 1WZ2A 4MGRA 5J4VA 1K61A 4YRVA 2NVUB 2O8XA 1HLVA 4GYIA 4IO9F 4CCKA 1R1VA 3RI4A 3S93A 2GXAA 1B6AA 1LJ9A 3Q9VA 2CMPA 1F43A 1KQ8A 3FIWA 1U3EM 3HG9A 2W24A 4BXUA 2XAQA 1AHDP 2DA1A 3AG3H 3OYDA 1RC9A 3W6JB 2NVTJ 2DPDA 1DPRA 2V7FA 5K7FA 5GPAA 1LB2A 2O0YA 3GTGJ 2ZJQF 2HOSA 4GO1A 4XKBA 3G71I 1NK2P 1FT9A 1U5TA 2BHZA 5DUKA 2PJPA 1QVUA 1NHAA 4NUBA 2X1DA 2CV2A 3DTEA 2JMWA 3GUDA 1ON2A 1PJRA 1WQ2A 2WV1A 2AXTC 1FBQA 5KCMA 1YE9A 4BE0A 2QBYA 2VI6A 5GAGJ 5IY5H 1SAXA 3CJQB 1Y1VJ 2Y30A 4DW6A 2LBFB 2IA2A 4A3DJ 4A5NA 2DCEA 2IA1A 5F0FA 3KYLA 1T95A 3PNTA 3QYEA 3UNGC 2R7OA 1F1ZA 2Z1DA 3F0CA 3ZQHA 1POGA 2B9SA 5D5UB 3BDDA 1LPQA 2KDOA 1ZELA 1UB9A 5ILSA 2QWWA 2HWVA 3BROA 4B48A 1X19A 5CQGA 5BPDA 1JI8A 3OS0A 2CWEA 1GDTA 2IGOA 5IOYA 2D5VA 2DOFA 5LHIA 4ZYDA 3JRBA 4I99C 2M8GX 3ULQB 2Q2EB 3GW2A 1TT0A 2XASA 3F8BA 3B02A 3WU1B 3CC2I 3TMOA 3VB2A 3BTIA 4XN3A 1LFBA 3KZYA 4HEA2 1ITYA 3KLOA 4YFKF 5IT3A 1YQAA 1EV7A 3CCYA 3WU0A 4EGYA 3F22A 3ABMH 2F4MB 2E1NA 2M5WA 3GX4X 1SC7A 2VIXA 1RESA 1EH8A 1JKRC 3FMRA 1A5JA 5JR3A 1W4MA 2LP0A 2ZXHA 4XNFA 3ZGKA 1REPC 4CGZA 3GLLA 1Z3XA 4IZZA 3KEQA 4G94A 2MH9A 1VQOI 2XKPA 3CCLI 5D6EA 1BR1A 2KZGA 3HB9A 2G9WA 3HGGA 3K9TA 3BR0A 3ASNH 4AWXB 3JAMZ 3FF5A 5E79C 3DPTA 1V5EA 2RV8A 4AD9A 1WH5A 5D5VB 5ICGA 4S05A 1VQKI 2CO5A 2E19A 4U87A 3KCCA 4YIFA 5F0CA 5IP6A 1TWAJ 1R49A 2A6TA 2Q8KA 4G7OF 1BIAA 2O9LA 1S7AA 3K10A 4FT8A 3QAHA 3M7GA 4CCJA 1AU7A 2V1XA 4NC6A 1YIJI 3WTYC 3GFIA 4P5OA 2GBYA 2QM3A 1HXDA 2BW3B 2AS5F 3JRIA 3GFMA 2LK2A 1OPCA 1R1UA 4C30A 4E7JA 1JHHA 3H1CA 2CGPA 1HF0A 1FOYA 1W5TA 1WJAA 4P96A 2WADA 1IN8A 2FQ3A 3CO6C 4RAFA 4D0PA 4MLOA 4A0ZA 3S1MJ 3F8CA 4MTDA 2IS2A 1JT0A 1IAWA 1VQLI 3CCVI 2QKLB 1AWCA 1SFXA 2VB6A 4RB2C 5M5YJ 4JOMA 2QQ8A 2XRLA 1UFMA 1TQIA 5DUIA 4LGWA 2RDPA 3HYIA 5GPCA 3IH2A 2FNPA 4A3KJ 3PNVA 2DFEA 3HUGB 3NARA 3U21A 5IYCJ 5C4JJ 4HG2A 2A61A 3FBNB 1AA7A 3OIQA 5HOOA 2FNAA 3WODF 5BMZA 2P5LC 2R7FA 2XAHA 3I3LA 5E3MA 4XLHA 3R6SA 4A12A 2V9VA 2LOOA 2K27A 3WE2A 5K5RA 3LL7A 2Q2EA 1F9NA 3H9QA 2NS8A 2DO7A 3HSFA 1H0MA 1FTTA 2ZSIB 4KMUX 1K6OA 3CLQA 4Y52J 3DKXA 2EJRA 1WGXA 1YJWI 5L3FA 4RGUA 2WBMA 3MKLA 4ETSA 4G9YA 5B66C 1BN5A 2IS1A 4KT6A 4LG0B 3PO2J 2FXAA 3N97A 1BI0A 2KMUA 3IWZA 1P7JA 3LFKA 5LRRA 3VWBA 1WH7A 4OIRF 1MBHA 1ENHA 1E0EA 3GZ5A 2L54A 3K1NA 2Y31A 2W82A 3H3UA 2JA8J 1NK3P 4BXFA 4M73A 2ZJRF 2R92J 2ADUA 5CVJA 3H9JA 5LEKA 5J1UA 3MWMA 3K0LA 5EEGA 4S04A 3I58A 1KU9A 2ZB9A 1MNDA 4BY1J 1GHCA 3HOVJ 5IP7J 5HLTA 3NWSA 3ELKA 1W5SA 3JAMK 2L7MP 4AM3A 3KLNA 3HKZN 2Z2SB 3I64A 2WAQN 4LG3A 3EYIA 1D1AA 1RETA 4M9XA 4PSWA 2LY2A 3HRUA 4EATA 2VJIA 3T5XA 3NAUA 3SYTA 4ENNA 5E1WA 3DEWA 4E7IA 1GV5A 3GFJA 3A03A 4PK4A 4YFNF 1O4XA 2DT7B 2IS4A 1WHUA 2M87A 3BR3A 1YFHA 5D4SA 3CJNA 3QOPA 2DA3A 3KP7A 4LLGF 1IRFA 4ZYHA 1VQ8I 2XSJC 1PVEA 4BAYA 2OCEA 5FRNA 2NS0A 3OYGA 2BV6A 2Y69H 1TT5B 3QPHA 3PQJA 3J80Z 1IN5A 1FBUA 4UY8I 2D1HA 1T39A 3KP4A 3RJPA 5D6FA 5IOZA 3A4CA 3L00A 3HOSA 3PSFA 4GDFA 5LLQA 5J8FA 4Z2YA 2MSYA 3EQLF 1RUNA 1J2XA 2YX7A 3HRTA 3OWTA 3TP3A 1MBJA 3F9KA 3E6DA 2JWTA 1MDMA 1J75A 4GXOA 4FQGA 3W2VA 2DU9A 5CVVA 1HC8A 3HRMA 3O6BB 4BDZA 2JRMA 3EUAA 1TQPA 4EM2A 3MMYB 3FM5A 4D7MA 2ME0A 1Z77A 2KRFA 1ZRCA 2XRNA 2R3SA 4G6TB 5H20A 4FASD 1WKMA 3FKIJ 3V42A 4FHTA 3JR9A 2XROA 1PP8F 1KGSA 1GVJA 4RA2A 3MZYA 4YIRX 4A6EA 2OV7A 2R5YB 4N4OB 2B7EA 4M6YA 2EFOA 5ICFA 1Y6IA 3OYNA 2WWYA 4HLXA 2K02A 5E3LA 1O3TA 4CXFA 2OQGA 2COBA 4EJVA 2WAFA 2V6CA 4RLFA 2VKHA 5D5XB 3WHBA 3ZOBA 3OYIA 2QCOA 6PAXA 3RYRA 4KMFA 3VFZA 2EZLA 2OD5A 5DDGA 1YS6A 2IPQX 2A6EF 1BC8C 3CJRB 2PX9A 1MW7A 5D4RA 3A02A 3LSKA 3GWZA 1I6XA 1ZK8A 3BR5A 5KAIC 4RB1A 4UUVA 2CQQA 1FSHA 4WF2A 2KHMA 1Z9CA 2PMUA 3TDUC 1SFUA 4N0BA 2V1DA 3SHFA 1WPKA 1VQMI 2HOEA 2VBXA 4IRGA 2K40A 1MBGA 3JREA 2QGUA 4JP0A 5M3MJ 1W0UA 1ZRFA 3W3CA 4QIWN 1FZPB 2DMNA 3DTIA 5HS9A 2IXSA 3ABUA 2CUEA 4CUGA 4LJZF 5F1RA 4MIMA 3OMYA 4XRMA 2VKEA 4X1EA 5L3BA 1Z3YA 1L3LA 2LG4A 3TW7A 1VQ4I 2ZXIA 4UVAA 3M1CA 2DMQA 2W48A 4AYBN 4OIQF 4QWQA 5CQEA 2IJLA 5ILVA 3KP3A 4L9NA 2OCCH 3RQ4A 4XQFA 3HHHA 1IC8A 1ZREA 2HU9A 5CLSA 5D5WB 3D5LA 5A2QK 4L9TA 2PI0A 3BQYA 4Y13A 3ZMSA 4BY7J 2A5YB 2EZHA 4PGGA 1YX5A 2DOAA 2GIZA 3D0SA 4J01A 4L18B 3ZQFA 3QPTA 4AVZA 3DTKA 3LNQA 1IF1A 2NAZA 2UXNA 3GEZA 2P81A 3FK7A 2EPFA 2KIFA 3BOQA 2QZ8A 3DXJF 2HFHA 5EJCA 1YX3A 1OR7C 3TOBA 3WTTC 4HDUA 2E71A 1ODDA 4RAYA 4KA4A 4KUMA 4HF2A 5LEJA 2L7FP 4HQMA 3S17J 2JUCA 3S15J 3A2KA 1TTYA 3DBLB 2XAGA 2YU3A 4A3JJ 4I01A 1W5CC 4B09A 2RNGA 1P2FA 4BBSJ 1ZG1A 3M3YJ 1GLNA 2VJJA 4CICA 5DM6F 1QVTA 3MQ0A 2XAJA 3E5UA 1QPIA 3DPLC 2ZFUA 4N9IA 1HSJA 4RAGA 4F7ZA 4XLAA 3AG4H 1ZG5A 3JRHA 4ABZA 2NRAC 1G4DA 3SZTA 2NVXJ 2R5YA 3H5NA 2MC3A 1E2XA 2J5PA 3M9AA 4XL9A 1W0TA 2PJRA 5E17F 2LY9A 3O8HA 3JRCA 1YRNB 5J6XA 4KIBA 4MQ9F 5HLIA 4BNCA 2KJBA 2EH3A 1OCTC 3WG9A 1HBXG 1A35A 4O6JA 4ZTFA 2HOTA 4IHYA 3KIOA 3G2BA 3P9CA 2CSOA 1I1SA 2RVCA 4F55A 1PDNC 4GGGA 1H9GA 4F3QA 1PYVA 2NNNA 2VUMJ 3BCAA 1V54H 2L0KA 1VFCA 1YOVB 3VPRA 1EH6A 2C6YA 3FX3A 1I6HJ 3HRSA 2W4SA 2V9KA 5KNLA 5GAEJ 3K1MA 3PFYA 2MYSA 3MKZA 2Z33A 2RNJA 3ZQQA 1XX5A 3ZP5A 4ZDOA 1GXPA 4EJWA 2DW4A 2O8KA 3FXLA 3FISA 3GFLA 2EZIA 2R7VA 2LH9A 3AFHA 1FMVA 2O6GE 4Y3OA 4IX7A 3TO9A 3SDBA 1JJ6C 3CMMA 3I59A 1FTZA 5CPRB 4WCGA 4ZC3A 4M3BA 2DA7A 2K7LA 3F3XA 3S1QJ 4G7ZF 2GOMA 4HF0A 3QRFF 2VQHA 2VBYA 4BYYA 2E1CA 1GXQA 5FB2A 2M0CA 3IKTA 2IGMA 2HXOA 4KN7X 4QTRA 1BR2A 2MA3A 3CJTB 3HKZA 3N05A 2WAQA 1X1PA 4M9ZA 1X4PA 2KKOA 1VQPI 1K79A 2DMUA 3TBIA 1JUSA 1BJZA 3H3ZA 5FLXK 1Z7UA 4IHSA 2M0MA 2FEZA 5J40A 1SANA 1HA8A 1U5TB 2K9MA 1DQUA 1FY7A 3KZIC 4NB5A 1FC3A 1MMDA 2PMZN 3C2HA 4IL6C 2VQLA 3DF8A 2FBKA 3KPHA 1B4AA 1MZBA 1XMAA 2JPBA 3BJOA 2A5WA 1X3ZB 1S8NA 2VQCA 2UZKA 2BY2A 1YG2A 2L3DA 2E36A 2M3AA 3DKYA 1VQNI 1O3RA 2JVGA 3OL3A 1MH4A 2CFOA 4Q48A 4XLFA 5FKOA 4EVIA 1FEXA 5BS6A 2ZNZA 4EJTA 2W85A 3HPGA 3C7JA 4CCLA 2O5RA 4U0YA 1G2HA 1V4RA 2E7XA 3F8MA 1TQMA 4Y33A 3BZCA 2FE3A 5B1AH 3GTJJ 1KA8A 2FRHA 1WJEA 2IEKA 5ILUA 1YRNA 3JRDA 2R4GA 3JTHA 4E6KG 1S72I 3I55I 1TNTA 1ETYA 3UKGA 3V8LA 2FU4A 1VQ6I 5DEQA 3HHGA 4ZDPA 3GTQJ 3HOWJ 5DCMA 2F6CA 4FISA 3K7AJ 2E35A 5J1YA 1W36D 4XICA 1IGNA 1XGOA 2P5VA 1XB4A 1VQ7I 5EZGA 4B3AA 5C3EJ 3KEOA 4BKXA 4OU0A 3WTZA 1IW7F 4ESJA 2HGCA 3RZOJ 1MMSA 2XGEA 3HBLA 2LKPA 3OL4A 1IG7A 2MW8A 2UUZA 5BPIA 1T33A 2WB1N 5C4XJ 2GZWA 2CQXA 1ZR2A 1FOKA 3LSJA 3PIOF 3BQZA 3KP5A 2CUFA 1QO0D 1USTA 3G4SI 4RGRA 1LFUP 2L5QA 2DA4A 1TC3C 2ZJPF 4AIHA 1ZR4A 1TL8A 1AKHA 2AQFA 3M07A 5HS8A 3PM1A 1JTXA 3QQAA 2VJ5A 1LE8B 4OAYA 1T56A 1ZN2A 2XVCA 3AG1H 3NQOA 1BIBA 2H94A 1E3OC 1TWFJ 3LFUA 2R7XA 4NC7A 1QRYA 4PZJA 5JLXA 4DZPA 3OYCA 4FCYA 1JKQC 4IHTA 3WTSC 3TO6A 4UNOA 4M9SA 1IDZA 2R7DA 2X6OA 1FYKA 2HXIA 1QGPA 2L7KA 2NOJB 3K4JA 4RLQA 3KYDB 2IVMA 4FX0A 1RI7A 3BJAA 4WXHA 2XB0X 2DT5A 2OPTA 1IXSB 2CFXA 2B0LA 2HKOA 4U7BA 1OCOH 3HIFA 4AYBA 1R4MB 1BI3A 4YIIA 3S3OA 1OMIA 2ELKA 4N4NB 4RM2A 1D3YA 3BZKA 3LSHA 3CCMI 4II2A 3AL0C 3DP7A 4WK8F 4XN0A 2CH0A 2IRFG 4OWRB 2X48A 3CDLA 1WJDA 5M5WJ 1RRJA 1JUPA 3DU6A 1DDNA 2TDXA 3HOZJ 2GOXB 3JSPA 1TZLA 3HZJA 5B5EC 4BU2A 4UXNA 4ZDLA 2QF7A 1OR7A 3F72A 4IKFA 3WE3A 1PUEE 1R00A 1FLIA 2ELHA 2V9PA 5FJ8J 3GTOJ 3GXOA 1DUXC 5GADJ 1TP4A 3BR1A 4LIUA 3OY9A 4JX4A 4XKVA 3OYLA 3BY6A 3NEUA 4M72A 1D5YA 3VODA 2K85A 3ZN0A 3H9GA 1G3SA 5GTHC 4I2OA 1FNNA 2CQKA 1UHMA 4UUTA 3H0GJ 1Y0NA 1J59A 4O5VA 4BUPA 4IOCF 5KVRA 2ZMEC 1BI2A 1H8AC 4D9JA 1MD0A 1Z7LA 2DAOA 1EH7A 2G7HA 4J00A 3Q0VA 1KYWA 2I10A 3ESWB 3TDZC 3G6EI 4A93J 2NOGA 2RAEA 2M30A 3J7AY 2BGCA 4I6ZA 1SD6A 1T98A 3K1PA 3S3MA 1MBEA 1G6NA 2X6YA 2DFHA 3FBIB 4XOPA 1S7EA 4FE7A 3MD2A 3R0AA 4CCNA 4R1HA 4BXXJ 3KEYA 5F08A 3TGNA 4JYKA 1ETVA 5FO5A 5EDNA 2DQLA 4AU7A 5TRDA 2CV1A 1L0OC 4MEYF 1I1GA 2DYSH 2VC1A 2H09A 1SVLA 2EV0A 4OOIA 4A0XA 2EB7A 3RSNA 1AOYA 1CQTA 2QYOA 2OTLI 4A3IJ 3S14J 2P0WA 4Y17A 1XN7A 4D5CA 2PBIA 3I4NJ 3SQNA 3T8RA 2ACJA 1Y1WJ 1A36A 1LE8A 3P7NA 1W36C 2DPUA 4R79A 3TQNA 2ICWG 5FKMA 2PQ8A 1LDDA 2GQQA 1FIPA 2I5UA 2M7AA 3OIPA 4MQVA 3KYCB 2UV1A 1X58A 5FKKA 5TGTA 1YS7A 4JX5A 3GMEA 5B1BH 4CDGA 1G3TA 1ULYA 2IA0A 4DOZA 4NHJA 3H5AA 2PG4A 2IT0A 4O3MA 2QQAA 2WC2A 3LSTA 2DN0A 4ESFA 2G0EA 1QA6A 3K70C 3HXLA 2EFPA 1XSVA 1ZG3A 2VXDA 2DK5A 1Z1DA 4Q5SF 3QODA 1FX7A 4E7KA 3CUQC 1P4WA 3J7ZI 5CKTA 1B9MA 2L4MA 1JUMA 3UR3C 1MDMB 2CQNA 4IQJA 1QNTA 2DFFA 3F6VA 2ZO4A 1S3JA 1RIOH 2W00A 4LLLA 4GFBA 2A68F 2XGCA 4OIOF 3AL0B 4YELA 2M45A 3QPLA 5HDKA 2PMZA 1IN4A 4DNCA 3BWGA 2GA1A 2HOAA 2LLKA 4ENMA 1YW8A 3L1PA 4C2TA 1OCCH 1TBXA 1R5GA 2YX4A 1MBKA 4A2UA 3IAM2 3H35A 1BL0A 3GTPJ 3CF5F 4YEJA 1XDSA 2Z16A 4CYCB 5GP9A 2DXIA 4C9YA 2JA2A 4BQNA 3I9V2 1DU0A 1Z0XA 2CUZA 4HF1A 5BQTA 2XHKA 2X1CA 4P55A 2LF8A 2HPMA 2VXZA 1FSEA 3E3VA 4P9UA 1KU7A 3S16J 4I76A 4NC8A 5IT9K 1MJBA 4XLCA 1HW5A 2ZMEB 4ZYAA 2HZDA 1BW6A 2IW5A 1FJLA 3ZMZA 3R4KA 1QZYA 1UMQA 1HOMA 4ITVA 3L2QA 2XPVA 4MO7A 2Q1ZB 2JUGA 4EJOA 1MH3A 3OIOA 3QYFA 5E3NA 4PFOA 3S3NA 2VLAA 3SZGA 4A3FJ 2H1LA 3F8FA 1SVOA 4P1WA 4W97A 5EF6A 2R7ZJ 4AC0A 2GXBA 4CHUA 3C3WA 1FBSA 1P9QC 2WB1A 4GCVA 1VZ0A 1JKPC 1D1CA 2LFBA 3I56I 3C2GA 2LR8A 1JKOC 5A2QZ 1K4SA 3BC8A 3S32A 2Y0SN 3DEUA 2LVSA 5FLVA 2CYYA 2BY0A 3TW6A 3R0JA 2AXLA 3DU5A 2RN7A 3IH4A 3JRGA 1O57A 3SFZA 4HV5A 2A69F 1WJBA 4XOTA 5FKLA 4A3GJ 2O03A 3FM3A 1YW9A 2LYCA 5L3EA 1TLHB 1ACIA 2ELJA 3I4MJ 4U7DA 5TJJA 2FQ4A 2VOOA 4MHGA 4KICA 2MC4A 4OIPF 2V4JC 1XC5A 2FSWA 3H36A 3S2HJ 1QPMA 2ISYA 1NTCA 1S7OA 2QA4I 1I50J 1B72A 1LVKA 2EIJH 3V8KA 1UHWA 1X4OA 1TWHJ 2R7QA 2M7BA 1ZQ3P 5EEAA 2WA0A 1WWXA 3CZ6A 3RKXA 2KLOA 1MBFA 1YHQI 1LDKB 4DJAA 1J7KA 2VBWA 4LOCA 4UV8A 3DWLE 3QP5A 1WFXA 2WY8Q 4HSRA 2LY1A 3HSRA 3DLAA 1HKTA 4CYCA 1S5LC 2FJ1A 2Z99A 1B59A 2PJRB 2Z9OA 3VDXA 1STZA 3MAJA 2QVOA 3IWFA 3HOXJ 1O3SA 2CW0F 5FGMA 3CC4I 1U2WA 3BG7A 5B3SH 1WRJA 1VNDA 2K9SA 4MEXF 2HDDA 3ZQCA 2EFQA 5DTDA 3F8NA 3U2RA 5FROA 1LFPA 5HLGA 4II3A 2BBYA 2KL4A 2K3PA 2ZMEA 2KFDA 2RQPA 4XIDA 3CO7C 2HZTA 4RS8A 1CF7A 1FPQA 1T2KA 2XB5A 3VYRB 2OAZA 2VL8A 5HDGA 3KFWX 2JSCA 4J19A 2YPRA 2MBFA 1D8KA 3C1DA 2JA6J 4PDKA 1MJ9A 3DFGA 3FHNA 2EFWA 3E0JB 4E7ZA 1OCRH 4JX6A 2EK5A 4I02A 2E1MC 4QSHA 1D0YA 5K7ZA 3RQIA 2EINH 1IXCA 2KRCA 2BYVE 4L5JA 5H6QA 5L3CA 2KDZA 2H1KA 4IOAF 4C2UA 4ANJA 5H2FC 3GTKJ 5FD5A 3BG6A 3H3VK 3G1OA 3I59B 3IC7A 1ETOA 4OINF 1WI3A
chains in the Genus database with same CATH topology
1MMDA 3C2HA 4B48A 4XKCA 2VQLA 3MKWB 1X19A 5CQGA 1JI8A 3OS0A 2IGOA 2M4KA 2XF7A 4PFPA 2A5WA 2Q2EB 1TT0A 2VQCA 5HNFA 1WJ5A 2VPLA 3TMOA 2M3AA 4XN3A 5LFAA 3DKYA 4HEA2 3PUBA 2JVGA 3OL3A 3L2RA 2CFOA 2CW8A 4XLFA 2HDWA 3BLYA 2E5ZA 2VIXA 2FUG2 2V26A 3HPGA 4BJ5C 4CCLA 2O5RA 1G59A 1NG6A 4XNFA 2ZXHA 3ZGKA 3OR2C 1N77A 4Y33A 1Z3XA 4F93B 1WJEA 4IZZA 2R4GA 1Y56A 4E6KG 2HQAA 2E60A 1BR1A 2HVRA 4CCMA 2BW3A 2KRHA 3FDYA 4F91B 3DQVC 4ZDPA 3DPTA 3PNYA 1V5EA 4NNJA 3OYHA 1J09A 2F6CA 4PJNA 1W36D 3OYAA 3A1YA 4BQOA 4HNUA 4U87A 2A6TA 4CSWA 3EUHC 3K10A 3OL4A 4CCJA 2UUZA 2CV0A 4P5OA 1U0JA 5FRMA 3LSMA 2BW3B 3OOUA 4ZTJA 3PL8A 2LREA 3K4MA 4C30A 2R7WA 4E7JA 1QU3A 2L5QA 1LKXA 3VSLA 2AQFA 1WJAA 2WADA 3RPUD 1IRXA 1D0ZA 2VJ5A 4MLOA 4Y4RA 4QPQA 4BDYA 4OAYA 2IS2A 1UG0A 2L2OA 3OYEA 2QKLB 4CCOA 3LFUA 4FETA 2R7XA 4NC7A 2VB6A 4JOMA 4E7SA 4B43A 3OYCA 3ZR8X 1DGRM 2AQEA 4DBQA 1K6YA 3LMMA 1DP3A 2L7KA 1X1DA 2NOJB 3K4JA 3PNVA 4RLQA 5HVQC 3HOTA 4BACA 1N78A 1G8XA 4BEHB 3HUGB 3U21A 4BJTA 2IS6A 4HG2A 3OS2A 3FBNB 1AA7A 3OIQA 5HOOA 3ZXSA 4U7BA 2XAUA 4AYBA 3I3LA 4RMNA 3S3OA 4PJLA 4PJMA 2XDVA 3K4NA 4XLHA 4N4NB 2M4GA 4RM2A 3IP4B 3LSHA 1MMAA 4II2A 3AL0C 2R7RA 3BCBA 2L9SA 2LOOA 4XN0A 1V5FA 2X1EA 2CH0A 4OWRB 2K9LA 3LL7A 3H9QA 1OLTA 1WJDA 2RQQA 3DU6A 2MD0A 3OYMA 2GOXB 1D1BA 1TZLA 3VYSB 2ZSIB 1QHHD 4BU2A 4ZDLA 4HSTA 4IKFA 1T0FC 3DKXA 3ONQA 4XKWA 2CW7A 2WBMA 2IS1A 2WAEA 4KT6A 2V1NA 4LIUA 3OY9A 3QOEA 4XKVA 3OYLA 2KMUA 1V5GA 3VWBA 1BOBA 2I8DA 3EUKL 2Y0SA 3H9GA 3HC7A 1E0EA 3CF2A 1UELB 4XM3A 2W82A 2HVQA 1SAUA 3W2AA 4BUPA 4BXFA 3OS1A 2CUJA 3H9JA 4D9JA 1Z7LA 1X1CA 4J00A 1MNDA 2X6XA 4PSXA 5HLTA 3NWSA 3MKYB 3J7AY 3VYTB 1S9HA 3NWTA 2Z2SB 2F4IA 4LG3A 2OC6A 3H0DA 3S3MA 2X6YA 4XMYA 3FBIB 4XOPA 1D1AA 4PSWA 2LY2A 3MD2A 4CCNA 2BOLA 3KEYA 4EATA 2VJIA 3SYTA 2DJIA 4H4KC 4AU7A 2JVHA 3H5RA 3AKZA 4XLEA 2CV1A 4E7IA 4LIVA 4PK4A 2MABA 2XF5A 2XC7A 3RSNA 2DT7B 2IS4A 3RCOA 4IQ4A 2P0WA 2LC2A 2XSJC 5FRNA 3OYGA 1W36C 4R79A 3HPHA 1MNEA 2W1OA 2M7AA 3OIPA 2VKDA 3A4CA 3HOSA 2UV1A 3PSFA 5TGTA 2X85A 4JQFA 3CP2A 1SFKA 2KPMA 2VQGA 2KZVA 3EPZA 2R7SA 3OWTA 3L2UA 3F9KA 4DOZA 4BEHA 3H5AA 3W2VA 3QYBA 3PSIA 3K70D 4B3XA 3OYFA 4BDZA 3EUAA 3OYJA 3MMYB 3K70C 3HXLA 4LITA 2V6EA 2VXDA 2W7NA 3LSGA 4XR6A 3TL4X 4E4HA 3QODA 3D5SC 4G6TB 4FASD 4E7KA 2F5VA 3V42A 5CKTA 3UR3C 4BJ6C 1UAAA 3ZCOA 1BR4A 3K6GA 4IQJA 4KISA 2OV7A 1ERDA 3HL2A 4N4OB 2W00A 4HNTA 1Y6IA 3OYNA 3KX2A 4BGDA 3E1SA 3OYKA 2KQRA 3AL0B 4YELA 2WAFA 4RLFA 2PMZA 2VKHA 2XF6A 2E1MB 3OYIA 3D5RC 2LRDA 4DIQA 1DGWY 3OYBA 4C2TA 5JHFA 5KHDA 1X1BA 3CJRB 1MW7A 2MFZA 3LSKA 1QHGA 3DEEA 3IAS2 4E7LA 3IAM2 3H35A 1FMWA 1N75A 2KHMA 3ZRGA 1WJFA 4F52A 4RM3A 2UWMA 4YEJA 2X6WA 2JSPA 2Z16A 2E5NA 4B47A 4KITB 4X0GA 2DXIA 4C9YA 3L2VA 2JA2A 4BQNA 3I9V2 4BL0B 2CUZA 3W3CA 2X1CA 4F92B 4OAZA 3DTIA 4QPOA 2L9NA 2VXZA 2IXSA 3LSIA 2HPMA 3OR1C 1WJCA 2WY7Q 4CUGA 1X1AA 5LD2C 3OMYA 4NC8A 4XLCA 1Z3YA 2IGKA 2LG4A 3PJRA 4ZYAA 2ZXIA 2HZDA 4HPQA 3M1CA 1D0XA 2CS3A 4ITVA 3CP8A 5CQEA 3L2QA 3RQ4A 4XQFA 2Q1ZB 2JUGA 2HU9A 3QYFA 3D5LA 3K4LA 4PFOA 3S3NA 2VLAA 2HPIA 3SZGA 3L2WA 4CH7A 3DPUA 4BS9A 1YX5A 2DOAA 2HVSA 4J01A 4AVZA 3DTKA 1MMNA 4P1WA 2BVMA 3VYUB 1P9QC 2WB1A 1VZ0A 1D1CA 1YX3A 1NG7A 1OR7C 3C2GA 2DT6A 3BC8A 4HRIA 4BE2A 3K4KA 3S32A 1R6RA 5HNHA 4XORA 3FKJA 2X51A 3A2KA 2VJ4A 4DBRA 4BE1A 3DU5A 2RNGA 4D1QA 4PJJA 4XONA 1GLNA 3VSKA 2VJJA 1WJBA 3GBGA 2ZSHB 4XOTA 3SEQA 3SEZA 2LYCA 2OUMA 3DPLC 2ZFUA 2ELJA 3CESA 4XLAA 4KJZA 3M8JA 2VASA 3S8PA 2MC4A 3H5NA 2R7UA 2V4JC 3IUOA 4CA0A 4XL9A 2PJRA 4ZJZA 4E7HA 3K4BA 1LVKA 3K4CA 4GRIA 2RREA 1X4OA 3RTRA 2R7QA 2M7BA 4ZTFA 2WA0A 3CZ6A 2KLOA 2BVLA 3G2BA 4CZCA 4F55A 1LDKB 1MMGA 2HNHA 4DGWB 4DJAA 4F3QA 4YRVA 2IGNA 1PYVA 4B44A 4CCKA 3BCAA 3DWLE 1WFXA 2WY8Q 4HSRA 3S93A 2LY1A 2CMPA 3DLAA 1EA3A 2W4SA 3HG9A 2PJRB 2V9KA 5KNLA 3VDXA 3PFYA 2MYSA 4NQWB 3MKZA 3ZQQA 3OYDA 4ZDOA 3BG7A 2V7FA 2R7VA 2LH9A 3AFHA 1FMVA 1Z21A 1LFPA 5FROA 4II3A 2LBFA 4Y3OA 2KL4A 2K3PA 4IX7A 3SDBA 3CMMA 4XKBA 5CPRB 3VYRB 1KONA 2K5CA 2VL8A 4PUSA 4ZC3A 2GOMA 3FHNA 2VQHA 2X1DA 4NUBA 2CV2A 3E0JB 3DTEA 4E7ZA 2IGMA 1BR2A 1PJRA 2QKMB 2KP6A 2R7TA 5KCMA 2E1MC 1YE9A 3HKZA 3N05A 2WAQA 4BE0A 1D0YA 1X4PA 3CJQB 2KRCA 2LBFB 3TBIA 4C2UA 4ANJA 2DCEA 3KYLA 1T95A 3PNTA 3BG6A 3QYEA 3UNGC 2M0MA 2R7OA 4BQQA 2Z1DA 1HA8A 3W2WA 2K9MA 1DQUA 2KDOA 1ZELA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2M0M A;  2KHM A;  2MFZ A;  2K3P A;  2MAB A; 
#chains in the Genus database with same CATH topology
 4RDU A;  4XKC A;  4IXA A;  2FD5 A;  2L02 A;  3LA3 A;  4I0B A;  2M4K A;  1LQ1 A;  2KJC A;  3JW4 A;  2XF7 A;  1YLF A;  4XK4 A;  5CVI A;  3KZZ A;  5E8I A;  3FXQ A;  3LAJ A;  1WJ5 A;  2VPL A;  2OZ6 A;  5FLX Z;  1T6S A;  2P6T A;  5LFA A;  3FHZ A;  2MG4 A;  3G1M A;  5ICC A;  1GVD A;  1RKW A;  2KIM A;  5H6R A;  2B63 J;  4GYG A;  2QEN A;  2FOK A;  3BLY A;  1OCZ H;  1BA5 A;  3NRV A;  2E5Z A;  1YJ9 I;  3P9I A;  3RKW A;  1R58 A;  1ETW A;  4IEJ A;  4BJ5 C;  5F1J A;  1G59 A;  4V2F A;  1NG6 A;  3OR2 C;  3ASO H;  4RBO A;  4A3E J;  3MZ8 A;  2O3F A;  3SFI A;  4F93 B;  4H0E A;  1KU2 A;  1A6Q A;  1R5H A;  4BQA A;  1YIO A;  3FXU A;  1XPX A;  2HVR A;  3GVA A;  3CUQ A;  1Y0U A;  4HX4 A;  3GTL J;  2KRH A;  3FDY A;  3HSE A;  4F91 B;  4WWC A;  3SDG A;  2LNB A;  3OV8 A;  2HYJ A;  4L0Y B;  2DJN A;  4NNJ A;  3L2C A;  1J09 A;  1BM9 A;  4PJN A;  3OYA A;  3QP6 A;  3A1Y A;  1H88 C;  4YFX F;  3VEP A;  3EUH C;  1MSF C;  4UVB A;  3HOU J;  1J9I A;  1S29 A;  2LD5 A;  3EYY A;  4HA8 A;  3CTA A;  3ZMD A;  2XSD C;  1G3W A;  1HKQ A;  4YG2 F;  3LSM A;  2A3S A;  4L9V A;  3MEX A;  4W1U A;  4ZTJ A;  3PL8 A;  4I0A A;  2D1V A;  1QU3 A;  4HDV A;  4CZZ A;  3X2Q H;  4HX8 A;  4N9H A;  4KFC A;  5DCM B;  2EIL H;  2R0Q C;  1Y8R B;  1YJN I;  1D0Z A;  4Y4R A;  3L9F A;  1FOW A;  2L2O A;  1PP7 U;  2DDB A;  2L7Z A;  2K86 A;  2VC0 A;  2W84 A;  1XGS A;  2L9R A;  4E7S A;  4B43 A;  3ZR8 X;  1FIA A;  1DGR M;  2AQE A;  2DFI A;  3QWL A;  3QU3 A;  1YI2 I;  2F5C A;  1DP3 A;  1X1D A;  2Z3Y A;  5HVQ C;  2NYX A;  4BAC A;  3RPQ A;  3I5U A;  1G8X A;  4BEH B;  2IS6 A;  4P9F A;  4EV0 A;  3F21 A;  1AKH B;  1LNW A;  1NH3 A;  1Z91 A;  5D8L B;  4LB6 B;  1R36 A;  2OZU A;  1VQ5 I;  4RMN A;  2ECB A;  4PJM A;  2XDV A;  3K4N A;  4G7H F;  4KYW A;  2M4G A;  5J3L A;  2E34 A;  2Y9Z A;  2R5Z A;  3BCB A;  2FX0 A;  3HGY A;  4JBA A;  2L9S A;  3ABT A;  3ZMT A;  2XKO A;  1SD5 A;  3ERE D;  1OIS A;  1OLT A;  2RQQ A;  2MD0 A;  3ROU A;  3S2W A;  3HJE A;  2PN6 A;  4XSZ F;  2OQR A;  2Y48 A;  3CC7 I;  2HR3 A;  2OA4 A;  2XV4 S;  3BJ6 A;  1T0F C;  2YR2 A;  3ONQ A;  1SFE A;  1SEU A;  1UCR A;  1LEB A;  2CW7 A;  2JJ7 A;  4HNV A;  1K78 B;  1J5Y A;  4C3I J;  1XDU A;  2WAE A;  1U6G A;  3BPX A;  3T8T A;  3QOE A;  2JQ7 A;  4HBL A;  1V5G A;  1VTN C;  2Y75 A;  5EG0 A;  1BOB A;  1J0R A;  3EUK L;  1HW2 A;  2Y0S A;  3HC7 A;  1IUF A;  4M6X A;  5ED4 A;  5F64 A;  1Y39 A;  2M34 A;  2MH2 A;  2HVQ A;  5IYD J;  2PLY A;  3LSP A;  1EKE A;  3OS1 A;  2CUJ A;  5LGT A;  3J81 Z;  3LA2 A;  1X1C A;  4LFU A;  1X2N A;  5HLH A;  3WGH A;  4BH9 A;  1M1E B;  2A05 A;  2EBI A;  5K1Y A;  5IP9 J;  2F2E A;  3F23 A;  2IP2 A;  2FF4 A;  2Y0M A;  4IPA A;  3ZQL A;  3CDI A;  2ECC A;  4HV6 A;  1S9H A;  4LMY A;  3VYT B;  5K7H A;  2KIQ A;  4EGZ A;  4KT5 C;  2F4I A;  2LMD A;  1ZAO A;  2WTE A;  4XSX F;  5GAH J;  4XMY A;  3E6C C;  2P7C B;  2JZY A;  2OBP A;  1SD7 A;  3DBH B;  4AID A;  4DYR A;  2BOL A;  2QQB A;  3FXO A;  2QSH X;  2DJI A;  2QSG X;  2XUB A;  1W7P B;  3M1E A;  2JVH A;  3H92 A;  3O3K A;  1K83 J;  4XLE A;  3AKZ A;  2H27 A;  4I98 B;  4CO8 A;  3KE2 A;  4HZF A;  1ETK A;  1F4K A;  3GCM A;  2CRG A;  4C3H J;  4A69 C;  2TCT A;  4IQ4 A;  3BTC A;  2H6B A;  4IRH A;  2LC2 A;  4R8H A;  2K9Q A;  1XGN A;  2PFB A;  4DYQ A;  2M8E A;  1TWC J;  3MN2 A;  2LDU A;  2RC4 A;  3LA7 A;  3HPH A;  2W1O A;  1JHF A;  3HEF A;  2XPU A;  4HYE A;  1CGP A;  3M8F A;  1R7J A;  3GLX A;  1H9T A;  2X85 A;  4JQF A;  3BTL A;  3CP2 A;  2ZCW A;  3TOA A;  4I09 A;  5J1R A;  1SFK A;  2KPM A;  3EPZ A;  4I7H A;  2R7S A;  4ENJ A;  1IRG A;  5FFZ A;  4BEH A;  2ID3 A;  1TW3 A;  3JRF A;  1IV8 A;  2F4O B;  3E97 A;  3QYB A;  3PSI A;  3DKW A;  5J4Y A;  3K70 D;  1K7A A;  4AVP A;  3HTS B;  3LQR A;  3OYJ A;  1QZE A;  1P4X A;  4Y7N J;  1EJ9 A;  1P92 A;  3E5X A;  1Z6R A;  2GAU A;  2HEO A;  2W7N A;  5HDN A;  4XR6 A;  3M4O J;  4MNU A;  5AIQ A;  2RGV A;  3D5S C;  2HTJ A;  1W1W E;  5DM7 F;  4C2M J;  1XGM A;  2F5V A;  2O7O A;  2YU9 J;  2JT1 A;  2DTR A;  3OSG A;  4CYD A;  4BBR J;  5JFR A;  3BR2 A;  3LOC A;  1UAA A;  4LD5 A;  3K6G A;  3CCJ I;  1BI1 A;  4KIS A;  1ERD A;  1LUJ B;  3OSF A;  3EET A;  4HNT A;  3CCU I;  1K78 A;  3KX2 A;  3W6K B;  4NBQ A;  3OYK A;  2KQR A;  4BHP A;  5LGU A;  5TIS C;  1QQI A;  2XF6 A;  1YTY A;  3E6M A;  5K5Q A;  3D5R C;  2NXN B;  2LRD A;  4L5E A;  3O2P E;  2GLO A;  3BG5 A;  1DGW Y;  5JHF A;  2K9N A;  1A6I A;  2MFZ A;  3V4G A;  1APL C;  1F36 A;  1XMK A;  1QHG A;  3IAS 2;  4E7L A;  2HKX A;  2HI3 A;  1FMW A;  3TKY A;  1PUF B;  4G6D A;  3MVP A;  1GUU A;  2PEX A;  1XTA A;  3ZRG A;  1SMT A;  4RM3 A;  4F52 A;  4ZH4 F;  3T0Y A;  5FLM J;  2UWM A;  2LTP A;  3FXR A;  2X6W A;  3PUF A;  3J81 K;  1ZLK A;  4B47 A;  4KIT B;  3KP6 A;  4X0G A;  4D5F A;  5D8K B;  2ZBK A;  3L2V A;  5BNG A;  4EEF G;  1C0W A;  3AAF A;  4EQQ A;  4LK1 F;  1H89 C;  2FOW A;  3WHC A;  4QPO A;  2L9N A;  3LSI A;  3OR1 C;  2WY7 Q;  1X1A A;  5LD2 C;  4KDP A;  4NDL A;  3KET A;  3ML6 A;  1W7P A;  3G1L A;  3GF2 A;  2BXZ A;  2YS9 A;  3FXJ A;  3PJR A;  3IRR A;  1R71 A;  3S1R J;  2DLL A;  1V55 H;  3N4M A;  3Q9S A;  4FTH A;  1D0X A;  1UZC A;  1XCB A;  1YW7 A;  2CS3 A;  2UXX A;  2VN2 A;  3CP8 A;  5CVR A;  4E70 A;  4IHW A;  1OCP A;  3QU6 A;  3Q0W A;  3ZQ7 A;  2LF7 A;  3DBR B;  3E5Q A;  2ZXW H;  1ZGJ A;  2VE9 A;  5EYR A;  1XD7 A;  2K4J A;  3EUH A;  3J7Y J;  1USS A;  3TP0 A;  5IT9 Z;  1B1B A;  1IV6 A;  2GM4 A;  2MD5 A;  4XLN F;  1MMN A;  2EV6 A;  2Y2Z A;  1VF9 A;  1N25 A;  3C18 A;  3ISP A;  1ETQ A;  3VYU B;  1OYI A;  3BZ6 A;  4L0Z B;  1NG7 A;  2DTZ A;  2FBI A;  2KT0 A;  2ESH A;  1P7I A;  1XG1 A;  4HRI A;  3K4K A;  1R6R A;  3ZMV A;  5HNH A;  4XOR A;  3WGG A;  1B8I B;  1MKM A;  3MCZ A;  3V7C A;  3FKJ A;  2X51 A;  2DA2 A;  4XRF A;  4IVN A;  2HYG D;  3RPU A;  3CCS I;  3BTJ A;  5F04 A;  3RDI A;  3FXK A;  4C3J J;  4D1Q A;  3GTM J;  4U88 A;  2OJE D;  4XON A;  2E2H J;  5EGO A;  3VSK A;  2H8R A;  1Z67 A;  2BEO A;  3SEQ A;  1IDY A;  2ZSH B;  3GBG A;  4ZZD A;  1ZTR A;  2LKS A;  3F6O A;  2OUM A;  3BP8 A;  3K69 A;  4IJA A;  1I3A A;  2BXY A;  4KJZ A;  3M8J A;  2VAS A;  2Y9Y A;  3S8P A;  2BHY A;  1DU6 A;  1R22 A;  1VQ9 I;  4EJU A;  2M9H A;  3IUO A;  4CA0 A;  1I27 A;  4MFD A;  3WGI A;  2EFN A;  1HW1 A;  3K4B A;  1LEA A;  1U8B A;  3K4C A;  1ZKG A;  3CMA I;  2RRE A;  2L4A A;  1HQC A;  3RTR A;  3FMS A;  1O7F A;  2A6H F;  2Q0O A;  5JVT A;  2ZNY A;  2NVY J;  4UV9 A;  2W57 A;  4CZC A;  2DA6 A;  1MMG A;  5LHH A;  3IV5 A;  2HNH A;  4DGW B;  2LSO A;  4M74 A;  5EZH A;  4TV7 A;  1T0F A;  5DD4 A;  5L3D A;  1PUF A;  2IGN A;  5CYV A;  4B44 A;  1Y8Q B;  2ZXJ A;  2STW A;  1E3P A;  2EV5 A;  3HTU A;  1U9N A;  1EA3 A;  1ONV A;  1P4A A;  1OKR A;  2DI3 A;  4NQW B;  1B72 B;  1JXS A;  1XSX A;  1KQ0 A;  3I53 A;  4WXD A;  5CJ9 A;  3A01 B;  2QLZ A;  1GT0 C;  4A3M J;  2DOD A;  4UB6 C;  1DPU A;  4BHC A;  2JTV A;  1Z21 A;  3RZD J;  2LBF A;  5LBQ A;  2ZC2 A;  3I71 A;  4AIK A;  4FE4 A;  3V7R A;  2VBZ A;  1RKT A;  4V2G A;  1KON A;  2K5C A;  2JA5 J;  2OTJ I;  4PUS A;  3CCR I;  4AIJ A;  1IO2 A;  2HTS A;  2L9V A;  1HST A;  2M1B A;  3K2A A;  1Z6T A;  4RAZ A;  2TRT A;  2QKM B;  2R7T A;  2KP6 A;  2IAI A;  2FBH A;  3V7S A;  2GXG A;  1EF4 A;  4M71 A;  1RPW A;  1X2M A;  2JPC A;  5FKN A;  4KIG A;  5HS7 A;  1CF7 B;  1GV2 A;  2XGX A;  4MTE A;  4BQQ A;  1KU3 A;  3W2W A;  1LDJ A;  2MGQ A;  5DD8 A;  2E2I J;  3MKW B;  1XCV A;  1B8I A;  1HDP A;  1ZYR F;  5IPA A;  4PFP A;  3T1B A;  1ETX A;  2VE8 A;  1LVA A;  3COA C;  1R9T J;  4FX4 A;  5HNF A;  2F5E A;  1ZRD A;  1K4T A;  3OOP A;  2P8T A;  2ME6 A;  4U0V A;  1HDD C;  3PUB A;  3L2R A;  2ISZ A;  2CW8 A;  2ZKZ A;  5E8G A;  1E3H A;  2HDW A;  3J7A O;  2BY3 A;  2HS5 A;  2COM A;  3MZH A;  2FUG 2;  2V26 A;  4EMS A;  2EZK A;  3G3Z A;  3M8E A;  1O7L A;  1MGT A;  1N77 A;  2L01 A;  4RGS A;  1X3U A;  3TED A;  1YYV A;  1W7P D;  1Y56 A;  2VOP A;  1X3W B;  2HQA A;  4G6Q A;  2D45 A;  1MNM C;  3L09 A;  2E60 A;  2BZT A;  3PO3 J;  4CCM A;  2BW3 A;  4XBF A;  1KQ9 A;  2F5F A;  1JT6 A;  3Q5F A;  1KZH A;  5ICE A;  2NVQ J;  3DQV C;  5F6F A;  4L5I A;  5K5O A;  2DMT A;  3PNY A;  4HX7 A;  1F5T A;  2M2E A;  3OYH A;  3BT9 A;  4BQO A;  4HNU A;  3WU2 C;  4KNY A;  4UHT A;  4MFE A;  3RKY A;  4LK0 F;  2JK3 A;  4CSW A;  5M3F J;  3IH3 A;  3L7W A;  4ASN A;  4NQW A;  1FYM A;  5FD6 A;  3S2D J;  3A01 A;  5F27 A;  2P6S A;  1D5V A;  4M3G A;  3S1N J;  2JN6 A;  3JCU C;  1RZ4 A;  4M3E A;  2CV0 A;  5FRM A;  1U0J A;  3D1N I;  5E18 F;  1XS9 A;  1D8J A;  3CUQ B;  3ABL H;  3OOU A;  2P7V B;  3A0H C;  5AIP A;  5EEH A;  3JTG A;  2F48 A;  1IN7 A;  3EDP A;  3HUG A;  4UB8 C;  2LRE A;  2KIU A;  2OF7 A;  3K4M A;  3GZ6 A;  5LRS A;  2R7W A;  3CCE I;  1JGS A;  1LKX A;  3VSL A;  4LB5 A;  2KIS A;  4EM0 B;  1B9N A;  1E17 A;  2DYR H;  3CCQ I;  3RPU D;  2NNY A;  4XRS A;  1IRX A;  3R60 A;  4QPQ A;  4BDY A;  4DZJ A;  2EIM H;  4A3C J;  3FZV A;  1UG0 A;  3OYE A;  1FP1 D;  2OU2 A;  4CCO A;  1OYW A;  2QSF X;  4FET A;  3U9G A;  3ZN1 A;  1XMX A;  3FMQ A;  5ERI A;  1ZHF A;  2QQ9 A;  4HAM A;  3E7L A;  4DBQ A;  1ZH5 A;  1K6Y A;  1T8I A;  5JI6 A;  3BPV A;  3LMM A;  3A0B C;  1A31 A;  1I39 A;  2EA2 A;  5LGN A;  2P4W A;  3HOT A;  1N78 A;  5GTI C;  4BJT A;  2A07 F;  3REO A;  1U8R A;  3WTV C;  2DK8 A;  2XGD A;  2ZJ2 A;  4Z6Y A;  1Q1V A;  2XIG A;  3OS2 A;  1OYY A;  3ZXS A;  4G8X A;  2XAU A;  3JSO A;  3AG2 H;  2HQR A;  2H6C A;  4PJL A;  4LG0 A;  4D7N A;  3IP4 B;  1MMA A;  2R7R A;  3LQQ A;  2H8W A;  4DQ2 A;  2WV0 A;  1V5F A;  2X1E A;  4V19 K;  2K9L A;  4S0H B;  2EIK H;  2EA4 A;  2EWN A;  4M6V A;  1VI0 A;  3OYM A;  2FML A;  1D1B A;  2V1U A;  3VYS B;  2K4B A;  1QHH D;  2X4H A;  3C2B A;  2HYF A;  4HST A;  2EQR A;  3BG3 A;  2E1O A;  2CG4 A;  1DP7 P;  3W6V A;  2BY1 A;  2IBD A;  3B73 A;  4XKW A;  1ON1 A;  5E1Z B;  4EM1 A;  3PFI A;  2V1N A;  1WSU A;  1T38 A;  2R5Z B;  1BJA A;  2I8D A;  2QUF A;  2Z5U A;  2AHQ A;  3FXM A;  2YUS A;  3CF2 A;  3TO7 A;  4A0Y A;  1UEL B;  3VOE A;  4XM3 A;  4PGH A;  1SAU A;  4WXC A;  3W2A A;  1MJA A;  2MLG A;  1HKS A;  4RGX A;  2E7W A;  5KAF C;  5E1X A;  1BC7 C;  1U5T C;  3FWE A;  2X6X A;  4PSX A;  3CDH A;  3DV8 A;  3RIR A;  3MKY B;  3O8G A;  4AUX A;  3NWT A;  1ORK A;  2DBB A;  2V79 A;  2OC6 A;  3H0D A;  1R4N B;  5EG0 B;  4IRI A;  1JTY A;  3I4P A;  1YIT I;  3J80 K;  2J5O A;  4XLP F;  3I54 A;  3I0T A;  4H4K C;  2E2J J;  3H5R A;  3WTX C;  4LIV A;  1OQY A;  2MAB A;  2XF5 A;  1IRZ A;  4WX9 A;  2XC7 A;  2G7U A;  4DYC A;  3RKQ A;  1BW5 A;  1BOA A;  3RCO A;  1IXR C;  2CU7 A;  2F5D A;  1OJL A;  2DDA A;  1YO5 C;  3DLL F;  1ZGA A;  5DYM A;  1RR7 A;  1UHS A;  4UVC A;  3FK6 A;  3GZN B;  4XRS G;  1MNE A;  5L3G A;  3JRA A;  3CMY A;  2DOE A;  3IKV A;  3ECO A;  1ZLJ A;  4M3F A;  2VKD A;  3DCF A;  4PCQ A;  4A6D A;  3IHU A;  2CJJ A;  3ZMU A;  1FP2 A;  2VQG A;  4L9J A;  2KZV A;  3CQZ J;  2R93 J;  3L2U A;  1U9O A;  2FA5 A;  2GIV A;  4Q4Z F;  2MLK A;  2RKH A;  5LHG A;  3WTU C;  4JK1 X;  4B3X A;  3OYF A;  4OMY A;  1JE8 A;  1I5Z A;  3LWF A;  2VON A;  4A3L J;  5JHU A;  4LIT A;  1TNS A;  3BR6 A;  4ZYG A;  2V6E A;  3R61 A;  4K2E A;  4HQE A;  3LSG A;  4IF4 A;  3TL4 X;  4E4H A;  4B8X A;  2DMP A;  4UUS B;  1O3Q A;  1SMY F;  1TW2 A;  3B6C A;  3P9K A;  1RUO A;  1BBY A;  5FFX A;  3V8J A;  3GYH X;  4BJ6 C;  1SFO J;  3ZCO A;  1BR4 A;  1IN6 A;  2VKV A;  4PJ0 C;  3HL2 A;  3WG7 H;  1G3Y A;  4BGD A;  3E1S A;  2P5K A;  2VT2 A;  2VPR A;  2HQN A;  4ENK A;  1RR8 C;  3ERM A;  5IYB J;  2E1M B;  4DIQ A;  5AON A;  2XPW A;  4A3B J;  1FWZ A;  2D2W A;  2JRT A;  3OYB A;  2W25 A;  5KHD A;  1X1B A;  4U0W A;  2QEX I;  1WCM J;  1WVR A;  2AO9 A;  3DEE A;  2DA5 A;  1I3Q J;  2STT A;  4X6A J;  3PIP F;  1Z05 A;  2LKX A;  1N75 A;  2PMH A;  4A5M A;  5JLW A;  1WJF A;  1RNL A;  1T08 B;  4KIF A;  2JSP A;  2E5N A;  4HW0 A;  3ECH A;  2HQ5 A;  4ESB A;  4BL0 B;  3HM5 A;  4ZZL A;  3LAP A;  3KP2 A;  4F92 B;  3B6A A;  3CUO A;  4OAZ A;  5J8C A;  3ZQI A;  1WJC A;  3Q0U A;  1A04 A;  1S6L A;  1SD4 A;  4HOB A;  2BE5 F;  2IGK A;  4ZYE A;  3SXY A;  1P6R A;  4HPQ A;  3U1K A;  2ESN A;  4RB3 C;  1R23 A;  2XAF A;  4Q47 A;  1R5I D;  4G12 A;  2O61 A;  4LLN A;  5DS9 A;  3K2Z A;  1JGG A;  1QBJ A;  2ETH A;  3MFK A;  4IHV A;  5HOD A;  1UJ8 A;  5F0H A;  1IUY A;  3K4L A;  2YSR A;  2HPI A;  1JJ8 C;  2JA7 J;  1FOX A;  3L2W A;  2ZFW A;  3ABK H;  4CH7 A;  3DPU A;  2FMY A;  4BS9 A;  2QBY B;  2HVS A;  3CD6 I;  2DQR A;  5J47 A;  4HLY A;  2K3F A;  5DV5 A;  2BVM A;  2CQ7 A;  3WTW C;  5E3O A;  2VT3 A;  2ID6 A;  5C44 J;  3SZP A;  4OMZ A;  1WI9 A;  1OFC X;  5M5X J;  4B4C A;  2HDC A;  2DT6 A;  4KN4 X;  3LSR A;  1U78 A;  4BE2 A;  2N8G A;  5CVU A;  2NS7 A;  3CME I;  4IHX A;  1UG2 A;  2VJ4 A;  4DBR A;  4BE1 A;  5KK1 A;  1IZ1 A;  3Q3S A;  4BHB A;  1MSE C;  3PQK A;  4PJJ A;  4Y15 A;  2X0L A;  1KYZ A;  4QLC U;  3QPS A;  3SEZ A;  4UUS A;  3HOY J;  3BG9 A;  3SJM A;  3GO5 A;  2GA2 A;  2VOD A;  3CES A;  1SVM A;  4B1R A;  4M3D A;  1R1T A;  2R7U A;  2X9D A;  1Q1H A;  5DCF A;  1FYL A;  3RYP A;  3U1D A;  5BOX A;  4ON0 A;  1ZAR A;  3CLO A;  1HCR A;  3ZPL A;  4RB0 A;  4ZJZ A;  3P5J A;  1V3F A;  5E20 A;  3ZQG A;  4E7H A;  2GWR A;  3IL2 A;  1TWG J;  1XSD A;  4GRI A;  1MIJ A;  1IJW C;  3HDD A;  3E6B A;  5EGO B;  9ANT A;  1QZZ A;  1ZGW A;  2BVL A;  5JVG F;  3IRQ A;  3G73 A;  1WZ2 A;  4MGR A;  5J4V A;  1K61 A;  4YRV A;  2NVU B;  2O8X A;  1HLV A;  4GYI A;  4IO9 F;  4CCK A;  1R1V A;  3RI4 A;  3S93 A;  2GXA A;  1B6A A;  1LJ9 A;  3Q9V A;  2CMP A;  1F43 A;  1KQ8 A;  3FIW A;  1U3E M;  3HG9 A;  2W24 A;  4BXU A;  2XAQ A;  1AHD P;  2DA1 A;  3AG3 H;  3OYD A;  1RC9 A;  3W6J B;  2NVT J;  2DPD A;  1DPR A;  2V7F A;  5K7F A;  5GPA A;  1LB2 A;  2O0Y A;  3GTG J;  2ZJQ F;  2HOS A;  4GO1 A;  4XKB A;  3G71 I;  1NK2 P;  1FT9 A;  1U5T A;  2BHZ A;  5DUK A;  2PJP A;  1QVU A;  1NHA A;  4NUB A;  2X1D A;  2CV2 A;  3DTE A;  2JMW A;  3GUD A;  1ON2 A;  1PJR A;  1WQ2 A;  2WV1 A;  2AXT C;  1FBQ A;  5KCM A;  1YE9 A;  4BE0 A;  2QBY A;  2VI6 A;  5GAG J;  5IY5 H;  1SAX A;  3CJQ B;  1Y1V J;  2Y30 A;  4DW6 A;  2LBF B;  2IA2 A;  4A3D J;  4A5N A;  2DCE A;  2IA1 A;  5F0F A;  3KYL A;  1T95 A;  3PNT A;  3QYE A;  3UNG C;  2R7O A;  1F1Z A;  2Z1D A;  3F0C A;  3ZQH A;  1POG A;  2B9S A;  5D5U B;  3BDD A;  1LPQ A;  2KDO A;  1ZEL A;  1UB9 A;  5ILS A;  2QWW A;  2HWV A;  3BRO A;  4B48 A;  1X19 A;  5CQG A;  5BPD A;  1JI8 A;  3OS0 A;  2CWE A;  1GDT A;  2IGO A;  5IOY A;  2D5V A;  2DOF A;  5LHI A;  4ZYD A;  3JRB A;  4I99 C;  2M8G X;  3ULQ B;  2Q2E B;  3GW2 A;  1TT0 A;  2XAS A;  3F8B A;  3B02 A;  3WU1 B;  3CC2 I;  3TMO A;  3VB2 A;  3BTI A;  4XN3 A;  1LFB A;  3KZY A;  4HEA 2;  1ITY A;  3KLO A;  4YFK F;  5IT3 A;  1YQA A;  1EV7 A;  3CCY A;  3WU0 A;  4EGY A;  3F22 A;  3ABM H;  2F4M B;  2E1N A;  2M5W A;  3GX4 X;  1SC7 A;  2VIX A;  1RES A;  1EH8 A;  1JKR C;  3FMR A;  1A5J A;  5JR3 A;  1W4M A;  2LP0 A;  2ZXH A;  4XNF A;  3ZGK A;  1REP C;  4CGZ A;  3GLL A;  1Z3X A;  4IZZ A;  3KEQ A;  4G94 A;  2MH9 A;  1VQO I;  2XKP A;  3CCL I;  5D6E A;  1BR1 A;  2KZG A;  3HB9 A;  2G9W A;  3HGG A;  3K9T A;  3BR0 A;  3ASN H;  4AWX B;  3JAM Z;  3FF5 A;  5E79 C;  3DPT A;  1V5E A;  2RV8 A;  4AD9 A;  1WH5 A;  5D5V B;  5ICG A;  4S05 A;  1VQK I;  2CO5 A;  2E19 A;  4U87 A;  3KCC A;  4YIF A;  5F0C A;  5IP6 A;  1TWA J;  1R49 A;  2A6T A;  2Q8K A;  4G7O F;  1BIA A;  2O9L A;  1S7A A;  3K10 A;  4FT8 A;  3QAH A;  3M7G A;  4CCJ A;  1AU7 A;  2V1X A;  4NC6 A;  1YIJ I;  3WTY C;  3GFI A;  4P5O A;  2GBY A;  2QM3 A;  1HXD A;  2BW3 B;  2AS5 F;  3JRI A;  3GFM A;  2LK2 A;  1OPC A;  1R1U A;  4C30 A;  4E7J A;  1JHH A;  3H1C A;  2CGP A;  1HF0 A;  1FOY A;  1W5T A;  1WJA A;  4P96 A;  2WAD A;  1IN8 A;  2FQ3 A;  3CO6 C;  4RAF A;  4D0P A;  4MLO A;  4A0Z A;  3S1M J;  3F8C A;  4MTD A;  2IS2 A;  1JT0 A;  1IAW A;  1VQL I;  3CCV I;  2QKL B;  1AWC A;  1SFX A;  2VB6 A;  4RB2 C;  5M5Y J;  4JOM A;  2QQ8 A;  2XRL A;  1UFM A;  1TQI A;  5DUI A;  4LGW A;  2RDP A;  3HYI A;  5GPC A;  3IH2 A;  2FNP A;  4A3K J;  3PNV A;  2DFE A;  3HUG B;  3NAR A;  3U21 A;  5IYC J;  5C4J J;  4HG2 A;  2A61 A;  3FBN B;  1AA7 A;  3OIQ A;  5HOO A;  2FNA A;  3WOD F;  5BMZ A;  2P5L C;  2R7F A;  2XAH A;  3I3L A;  5E3M A;  4XLH A;  3R6S A;  4A12 A;  2V9V A;  2LOO A;  2K27 A;  3WE2 A;  5K5R A;  3LL7 A;  2Q2E A;  1F9N A;  3H9Q A;  2NS8 A;  2DO7 A;  3HSF A;  1H0M A;  1FTT A;  2ZSI B;  4KMU X;  1K6O A;  3CLQ A;  4Y52 J;  3DKX A;  2EJR A;  1WGX A;  1YJW I;  5L3F A;  4RGU A;  2WBM A;  3MKL A;  4ETS A;  4G9Y A;  5B66 C;  1BN5 A;  2IS1 A;  4KT6 A;  4LG0 B;  3PO2 J;  2FXA A;  3N97 A;  1BI0 A;  2KMU A;  3IWZ A;  1P7J A;  3LFK A;  5LRR A;  3VWB A;  1WH7 A;  4OIR F;  1MBH A;  1ENH A;  1E0E A;  3GZ5 A;  2L54 A;  3K1N A;  2Y31 A;  2W82 A;  3H3U A;  2JA8 J;  1NK3 P;  4BXF A;  4M73 A;  2ZJR F;  2R92 J;  2ADU A;  5CVJ A;  3H9J A;  5LEK A;  5J1U A;  3MWM A;  3K0L A;  5EEG A;  4S04 A;  3I58 A;  1KU9 A;  2ZB9 A;  1MND A;  4BY1 J;  1GHC A;  3HOV J;  5IP7 J;  5HLT A;  3NWS A;  3ELK A;  1W5S A;  3JAM K;  2L7M P;  4AM3 A;  3KLN A;  3HKZ N;  2Z2S B;  3I64 A;  2WAQ N;  4LG3 A;  3EYI A;  1D1A A;  1RET A;  4M9X A;  4PSW A;  2LY2 A;  3HRU A;  4EAT A;  2VJI A;  3T5X A;  3NAU A;  3SYT A;  4ENN A;  5E1W A;  3DEW A;  4E7I A;  1GV5 A;  3GFJ A;  3A03 A;  4PK4 A;  4YFN F;  1O4X A;  2DT7 B;  2IS4 A;  1WHU A;  2M87 A;  3BR3 A;  1YFH A;  5D4S A;  3CJN A;  3QOP A;  2DA3 A;  3KP7 A;  4LLG F;  1IRF A;  4ZYH A;  1VQ8 I;  2XSJ C;  1PVE A;  4BAY A;  2OCE A;  5FRN A;  2NS0 A;  3OYG A;  2BV6 A;  2Y69 H;  1TT5 B;  3QPH A;  3PQJ A;  3J80 Z;  1IN5 A;  1FBU A;  4UY8 I;  2D1H A;  1T39 A;  3KP4 A;  3RJP A;  5D6F A;  5IOZ A;  3A4C A;  3L00 A;  3HOS A;  3PSF A;  4GDF A;  5LLQ A;  5J8F A;  4Z2Y A;  2MSY A;  3EQL F;  1RUN A;  1J2X A;  2YX7 A;  3HRT A;  3OWT A;  3TP3 A;  1MBJ A;  3F9K A;  3E6D A;  2JWT A;  1MDM A;  1J75 A;  4GXO A;  4FQG A;  3W2V A;  2DU9 A;  5CVV A;  1HC8 A;  3HRM A;  3O6B B;  4BDZ A;  2JRM A;  3EUA A;  1TQP A;  4EM2 A;  3MMY B;  3FM5 A;  4D7M A;  2ME0 A;  1Z77 A;  2KRF A;  1ZRC A;  2XRN A;  2R3S A;  4G6T B;  5H20 A;  4FAS D;  1WKM A;  3FKI J;  3V42 A;  4FHT A;  3JR9 A;  2XRO A;  1PP8 F;  1KGS A;  1GVJ A;  4RA2 A;  3MZY A;  4YIR X;  4A6E A;  2OV7 A;  2R5Y B;  4N4O B;  2B7E A;  4M6Y A;  2EFO A;  5ICF A;  1Y6I A;  3OYN A;  2WWY A;  4HLX A;  2K02 A;  5E3L A;  1O3T A;  4CXF A;  2OQG A;  2COB A;  4EJV A;  2WAF A;  2V6C A;  4RLF A;  2VKH A;  5D5X B;  3WHB A;  3ZOB A;  3OYI A;  2QCO A;  6PAX A;  3RYR A;  4KMF A;  3VFZ A;  2EZL A;  2OD5 A;  5DDG A;  1YS6 A;  2IPQ X;  2A6E F;  1BC8 C;  3CJR B;  2PX9 A;  1MW7 A;  5D4R A;  3A02 A;  3LSK A;  3GWZ A;  1I6X A;  1ZK8 A;  3BR5 A;  5KAI C;  4RB1 A;  4UUV A;  2CQQ A;  1FSH A;  4WF2 A;  2KHM A;  1Z9C A;  2PMU A;  3TDU C;  1SFU A;  4N0B A;  2V1D A;  3SHF A;  1WPK A;  1VQM I;  2HOE A;  2VBX A;  4IRG A;  2K40 A;  1MBG A;  3JRE A;  2QGU A;  4JP0 A;  5M3M J;  1W0U A;  1ZRF A;  3W3C A;  4QIW N;  1FZP B;  2DMN A;  3DTI A;  5HS9 A;  2IXS A;  3ABU A;  2CUE A;  4CUG A;  4LJZ F;  5F1R A;  4MIM A;  3OMY A;  4XRM A;  2VKE A;  4X1E A;  5L3B A;  1Z3Y A;  1L3L A;  2LG4 A;  3TW7 A;  1VQ4 I;  2ZXI A;  4UVA A;  3M1C A;  2DMQ A;  2W48 A;  4AYB N;  4OIQ F;  4QWQ A;  5CQE A;  2IJL A;  5ILV A;  3KP3 A;  4L9N A;  2OCC H;  3RQ4 A;  4XQF A;  3HHH A;  1IC8 A;  1ZRE A;  2HU9 A;  5CLS A;  5D5W B;  3D5L A;  5A2Q K;  4L9T A;  2PI0 A;  3BQY A;  4Y13 A;  3ZMS A;  4BY7 J;  2A5Y B;  2EZH A;  4PGG A;  1YX5 A;  2DOA A;  2GIZ A;  3D0S A;  4J01 A;  4L18 B;  3ZQF A;  3QPT A;  4AVZ A;  3DTK A;  3LNQ A;  1IF1 A;  2NAZ A;  2UXN A;  3GEZ A;  2P81 A;  3FK7 A;  2EPF A;  2KIF A;  3BOQ A;  2QZ8 A;  3DXJ F;  2HFH A;  5EJC A;  1YX3 A;  1OR7 C;  3TOB A;  3WTT C;  4HDU A;  2E71 A;  1ODD A;  4RAY A;  4KA4 A;  4KUM A;  4HF2 A;  5LEJ A;  2L7F P;  4HQM A;  3S17 J;  2JUC A;  3S15 J;  3A2K A;  1TTY A;  3DBL B;  2XAG A;  2YU3 A;  4A3J J;  4I01 A;  1W5C C;  4B09 A;  2RNG A;  1P2F A;  4BBS J;  1ZG1 A;  3M3Y J;  1GLN A;  2VJJ A;  4CIC A;  5DM6 F;  1QVT A;  3MQ0 A;  2XAJ A;  3E5U A;  1QPI A;  3DPL C;  2ZFU A;  4N9I A;  1HSJ A;  4RAG A;  4F7Z A;  4XLA A;  3AG4 H;  1ZG5 A;  3JRH A;  4ABZ A;  2NRA C;  1G4D A;  3SZT A;  2NVX J;  2R5Y A;  3H5N A;  2MC3 A;  1E2X A;  2J5P A;  3M9A A;  4XL9 A;  1W0T A;  2PJR A;  5E17 F;  2LY9 A;  3O8H A;  3JRC A;  1YRN B;  5J6X A;  4KIB A;  4MQ9 F;  5HLI A;  4BNC A;  2KJB A;  2EH3 A;  1OCT C;  3WG9 A;  1HBX G;  1A35 A;  4O6J A;  4ZTF A;  2HOT A;  4IHY A;  3KIO A;  3G2B A;  3P9C A;  2CSO A;  1I1S A;  2RVC A;  4F55 A;  1PDN C;  4GGG A;  1H9G A;  4F3Q A;  1PYV A;  2NNN A;  2VUM J;  3BCA A;  1V54 H;  2L0K A;  1VFC A;  1YOV B;  3VPR A;  1EH6 A;  2C6Y A;  3FX3 A;  1I6H J;  3HRS A;  2W4S A;  2V9K A;  5KNL A;  5GAE J;  3K1M A;  3PFY A;  2MYS A;  3MKZ A;  2Z33 A;  2RNJ A;  3ZQQ A;  1XX5 A;  3ZP5 A;  4ZDO A;  1GXP A;  4EJW A;  2DW4 A;  2O8K A;  3FXL A;  3FIS A;  3GFL A;  2EZI A;  2R7V A;  2LH9 A;  3AFH A;  1FMV A;  2O6G E;  4Y3O A;  4IX7 A;  3TO9 A;  3SDB A;  1JJ6 C;  3CMM A;  3I59 A;  1FTZ A;  5CPR B;  4WCG A;  4ZC3 A;  4M3B A;  2DA7 A;  2K7L A;  3F3X A;  3S1Q J;  4G7Z F;  2GOM A;  4HF0 A;  3QRF F;  2VQH A;  2VBY A;  4BYY A;  2E1C A;  1GXQ A;  5FB2 A;  2M0C A;  3IKT A;  2IGM A;  2HXO A;  4KN7 X;  4QTR A;  1BR2 A;  2MA3 A;  3CJT B;  3HKZ A;  3N05 A;  2WAQ A;  1X1P A;  4M9Z A;  1X4P A;  2KKO A;  1VQP I;  1K79 A;  2DMU A;  3TBI A;  1JUS A;  1BJZ A;  3H3Z A;  5FLX K;  1Z7U A;  4IHS A;  2M0M A;  2FEZ A;  5J40 A;  1SAN A;  1HA8 A;  1U5T B;  2K9M A;  1DQU A;  1FY7 A;  3KZI C;  4NB5 A;  1FC3 A;  1MMD A;  2PMZ N;  3C2H A;  4IL6 C;  2VQL A;  3DF8 A;  2FBK A;  3KPH A;  1B4A A;  1MZB A;  1XMA A;  2JPB A;  3BJO A;  2A5W A;  1X3Z B;  1S8N A;  2VQC A;  2UZK A;  2BY2 A;  1YG2 A;  2L3D A;  2E36 A;  2M3A A;  3DKY A;  1VQN I;  1O3R A;  2JVG A;  3OL3 A;  1MH4 A;  2CFO A;  4Q48 A;  4XLF A;  5FKO A;  4EVI A;  1FEX A;  5BS6 A;  2ZNZ A;  4EJT A;  2W85 A;  3HPG A;  3C7J A;  4CCL A;  2O5R A;  4U0Y A;  1G2H A;  1V4R A;  2E7X A;  3F8M A;  1TQM A;  4Y33 A;  3BZC A;  2FE3 A;  5B1A H;  3GTJ J;  1KA8 A;  2FRH A;  1WJE A;  2IEK A;  5ILU A;  1YRN A;  3JRD A;  2R4G A;  3JTH A;  4E6K G;  1S72 I;  3I55 I;  1TNT A;  1ETY A;  3UKG A;  3V8L A;  2FU4 A;  1VQ6 I;  5DEQ A;  3HHG A;  4ZDP A;  3GTQ J;  3HOW J;  5DCM A;  2F6C A;  4FIS A;  3K7A J;  2E35 A;  5J1Y A;  1W36 D;  4XIC A;  1IGN A;  1XGO A;  2P5V A;  1XB4 A;  1VQ7 I;  5EZG A;  4B3A A;  5C3E J;  3KEO A;  4BKX A;  4OU0 A;  3WTZ A;  1IW7 F;  4ESJ A;  2HGC A;  3RZO J;  1MMS A;  2XGE A;  3HBL A;  2LKP A;  3OL4 A;  1IG7 A;  2MW8 A;  2UUZ A;  5BPI A;  1T33 A;  2WB1 N;  5C4X J;  2GZW A;  2CQX A;  1ZR2 A;  1FOK A;  3LSJ A;  3PIO F;  3BQZ A;  3KP5 A;  2CUF A;  1QO0 D;  1UST A;  3G4S I;  4RGR A;  1LFU P;  2L5Q A;  2DA4 A;  1TC3 C;  2ZJP F;  4AIH A;  1ZR4 A;  1TL8 A;  1AKH A;  2AQF A;  3M07 A;  5HS8 A;  3PM1 A;  1JTX A;  3QQA A;  2VJ5 A;  1LE8 B;  4OAY A;  1T56 A;  1ZN2 A;  2XVC A;  3AG1 H;  3NQO A;  1BIB A;  2H94 A;  1E3O C;  1TWF J;  3LFU A;  2R7X A;  4NC7 A;  1QRY A;  4PZJ A;  5JLX A;  4DZP A;  3OYC A;  4FCY A;  1JKQ C;  4IHT A;  3WTS C;  3TO6 A;  4UNO A;  4M9S A;  1IDZ A;  2R7D A;  2X6O A;  1FYK A;  2HXI A;  1QGP A;  2L7K A;  2NOJ B;  3K4J A;  4RLQ A;  3KYD B;  2IVM A;  4FX0 A;  1RI7 A;  3BJA A;  4WXH A;  2XB0 X;  2DT5 A;  2OPT A;  1IXS B;  2CFX A;  2B0L A;  2HKO A;  4U7B A;  1OCO H;  3HIF A;  4AYB A;  1R4M B;  1BI3 A;  4YII A;  3S3O A;  1OMI A;  2ELK A;  4N4N B;  4RM2 A;  1D3Y A;  3BZK A;  3LSH A;  3CCM I;  4II2 A;  3AL0 C;  3DP7 A;  4WK8 F;  4XN0 A;  2CH0 A;  2IRF G;  4OWR B;  2X48 A;  3CDL A;  1WJD A;  5M5W J;  1RRJ A;  1JUP A;  3DU6 A;  1DDN A;  2TDX A;  3HOZ J;  2GOX B;  3JSP A;  1TZL A;  3HZJ A;  5B5E C;  4BU2 A;  4UXN A;  4ZDL A;  2QF7 A;  1OR7 A;  3F72 A;  4IKF A;  3WE3 A;  1PUE E;  1R00 A;  1FLI A;  2ELH A;  2V9P A;  5FJ8 J;  3GTO J;  3GXO A;  1DUX C;  5GAD J;  1TP4 A;  3BR1 A;  4LIU A;  3OY9 A;  4JX4 A;  4XKV A;  3OYL A;  3BY6 A;  3NEU A;  4M72 A;  1D5Y A;  3VOD A;  2K85 A;  3ZN0 A;  3H9G A;  1G3S A;  5GTH C;  4I2O A;  1FNN A;  2CQK A;  1UHM A;  4UUT A;  3H0G J;  1Y0N A;  1J59 A;  4O5V A;  4BUP A;  4IOC F;  5KVR A;  2ZME C;  1BI2 A;  1H8A C;  4D9J A;  1MD0 A;  1Z7L A;  2DAO A;  1EH7 A;  2G7H A;  4J00 A;  3Q0V A;  1KYW A;  2I10 A;  3ESW B;  3TDZ C;  3G6E I;  4A93 J;  2NOG A;  2RAE A;  2M30 A;  3J7A Y;  2BGC A;  4I6Z A;  1SD6 A;  1T98 A;  3K1P A;  3S3M A;  1MBE A;  1G6N A;  2X6Y A;  2DFH A;  3FBI B;  4XOP A;  1S7E A;  4FE7 A;  3MD2 A;  3R0A A;  4CCN A;  4R1H A;  4BXX J;  3KEY A;  5F08 A;  3TGN A;  4JYK A;  1ETV A;  5FO5 A;  5EDN A;  2DQL A;  4AU7 A;  5TRD A;  2CV1 A;  1L0O C;  4MEY F;  1I1G A;  2DYS H;  2VC1 A;  2H09 A;  1SVL A;  2EV0 A;  4OOI A;  4A0X A;  2EB7 A;  3RSN A;  1AOY A;  1CQT A;  2QYO A;  2OTL I;  4A3I J;  3S14 J;  2P0W A;  4Y17 A;  1XN7 A;  4D5C A;  2PBI A;  3I4N J;  3SQN A;  3T8R A;  2ACJ A;  1Y1W J;  1A36 A;  1LE8 A;  3P7N A;  1W36 C;  2DPU A;  4R79 A;  3TQN A;  2ICW G;  5FKM A;  2PQ8 A;  1LDD A;  2GQQ A;  1FIP A;  2I5U A;  2M7A A;  3OIP A;  4MQV A;  3KYC B;  2UV1 A;  1X58 A;  5FKK A;  5TGT A;  1YS7 A;  4JX5 A;  3GME A;  5B1B H;  4CDG A;  1G3T A;  1ULY A;  2IA0 A;  4DOZ A;  4NHJ A;  3H5A A;  2PG4 A;  2IT0 A;  4O3M A;  2QQA A;  2WC2 A;  3LST A;  2DN0 A;  4ESF A;  2G0E A;  1QA6 A;  3K70 C;  3HXL A;  2EFP A;  1XSV A;  1ZG3 A;  2VXD A;  2DK5 A;  1Z1D A;  4Q5S F;  3QOD A;  1FX7 A;  4E7K A;  3CUQ C;  1P4W A;  3J7Z I;  5CKT A;  1B9M A;  2L4M A;  1JUM A;  3UR3 C;  1MDM B;  2CQN A;  4IQJ A;  1QNT A;  2DFF A;  3F6V A;  2ZO4 A;  1S3J A;  1RIO H;  2W00 A;  4LLL A;  4GFB A;  2A68 F;  2XGC A;  4OIO F;  3AL0 B;  4YEL A;  2M45 A;  3QPL A;  5HDK A;  2PMZ A;  1IN4 A;  4DNC A;  3BWG A;  2GA1 A;  2HOA A;  2LLK A;  4ENM A;  1YW8 A;  3L1P A;  4C2T A;  1OCC H;  1TBX A;  1R5G A;  2YX4 A;  1MBK A;  4A2U A;  3IAM 2;  3H35 A;  1BL0 A;  3GTP J;  3CF5 F;  4YEJ A;  1XDS A;  2Z16 A;  4CYC B;  5GP9 A;  2DXI A;  4C9Y A;  2JA2 A;  4BQN A;  3I9V 2;  1DU0 A;  1Z0X A;  2CUZ A;  4HF1 A;  5BQT A;  2XHK A;  2X1C A;  4P55 A;  2LF8 A;  2HPM A;  2VXZ A;  1FSE A;  3E3V A;  4P9U A;  1KU7 A;  3S16 J;  4I76 A;  4NC8 A;  5IT9 K;  1MJB A;  4XLC A;  1HW5 A;  2ZME B;  4ZYA A;  2HZD A;  1BW6 A;  2IW5 A;  1FJL A;  3ZMZ A;  3R4K A;  1QZY A;  1UMQ A;  1HOM A;  4ITV A;  3L2Q A;  2XPV A;  4MO7 A;  2Q1Z B;  2JUG A;  4EJO A;  1MH3 A;  3OIO A;  3QYF A;  5E3N A;  4PFO A;  3S3N A;  2VLA A;  3SZG A;  4A3F J;  2H1L A;  3F8F A;  1SVO A;  4P1W A;  4W97 A;  5EF6 A;  2R7Z J;  4AC0 A;  2GXB A;  4CHU A;  3C3W A;  1FBS A;  1P9Q C;  2WB1 A;  4GCV A;  1VZ0 A;  1JKP C;  1D1C A;  2LFB A;  3I56 I;  3C2G A;  2LR8 A;  1JKO C;  5A2Q Z;  1K4S A;  3BC8 A;  3S32 A;  2Y0S N;  3DEU A;  2LVS A;  5FLV A;  2CYY A;  2BY0 A;  3TW6 A;  3R0J A;  2AXL A;  3DU5 A;  2RN7 A;  3IH4 A;  3JRG A;  1O57 A;  3SFZ A;  4HV5 A;  2A69 F;  1WJB A;  4XOT A;  5FKL A;  4A3G J;  2O03 A;  3FM3 A;  1YW9 A;  2LYC A;  5L3E A;  1TLH B;  1ACI A;  2ELJ A;  3I4M J;  4U7D A;  5TJJ A;  2FQ4 A;  2VOO A;  4MHG A;  4KIC A;  2MC4 A;  4OIP F;  2V4J C;  1XC5 A;  2FSW A;  3H36 A;  3S2H J;  1QPM A;  2ISY A;  1NTC A;  1S7O A;  2QA4 I;  1I50 J;  1B72 A;  1LVK A;  2EIJ H;  3V8K A;  1UHW A;  1X4O A;  1TWH J;  2R7Q A;  2M7B A;  1ZQ3 P;  5EEA A;  2WA0 A;  1WWX A;  3CZ6 A;  3RKX A;  2KLO A;  1MBF A;  1YHQ I;  1LDK B;  4DJA A;  1J7K A;  2VBW A;  4LOC A;  4UV8 A;  3DWL E;  3QP5 A;  1WFX A;  2WY8 Q;  4HSR A;  2LY1 A;  3HSR A;  3DLA A;  1HKT A;  4CYC A;  1S5L C;  2FJ1 A;  2Z99 A;  1B59 A;  2PJR B;  2Z9O A;  3VDX A;  1STZ A;  3MAJ A;  2QVO A;  3IWF A;  3HOX J;  1O3S A;  2CW0 F;  5FGM A;  3CC4 I;  1U2W A;  3BG7 A;  5B3S H;  1WRJ A;  1VND A;  2K9S A;  4MEX F;  2HDD A;  3ZQC A;  2EFQ A;  5DTD A;  3F8N A;  3U2R A;  5FRO A;  1LFP A;  5HLG A;  4II3 A;  2BBY A;  2KL4 A;  2K3P A;  2ZME A;  2KFD A;  2RQP A;  4XID A;  3CO7 C;  2HZT A;  4RS8 A;  1CF7 A;  1FPQ A;  1T2K A;  2XB5 A;  3VYR B;  2OAZ A;  2VL8 A;  5HDG A;  3KFW X;  2JSC A;  4J19 A;  2YPR A;  2MBF A;  1D8K A;  3C1D A;  2JA6 J;  4PDK A;  1MJ9 A;  3DFG A;  3FHN A;  2EFW A;  3E0J B;  4E7Z A;  1OCR H;  4JX6 A;  2EK5 A;  4I02 A;  2E1M C;  4QSH A;  1D0Y A;  5K7Z A;  3RQI A;  2EIN H;  1IXC A;  2KRC A;  2BYV E;  4L5J A;  5H6Q A;  5L3C A;  2KDZ A;  2H1K A;  4IOA F;  4C2U A;  4ANJ A;  5H2F C;  3GTK J;  5FD5 A;  3BG6 A;  3H3V K;  3G1O A;  3I59 B;  3IC7 A;  1ETO A;  4OIN F;  1WI3 A; 
#chains in the Genus database with same CATH homology
 1MMD A;  3C2H A;  4B48 A;  4XKC A;  2VQL A;  3MKW B;  1X19 A;  5CQG A;  1JI8 A;  3OS0 A;  2IGO A;  2M4K A;  2XF7 A;  4PFP A;  2A5W A;  2Q2E B;  1TT0 A;  2VQC A;  5HNF A;  1WJ5 A;  2VPL A;  3TMO A;  2M3A A;  4XN3 A;  5LFA A;  3DKY A;  4HEA 2;  3PUB A;  2JVG A;  3OL3 A;  3L2R A;  2CFO A;  2CW8 A;  4XLF A;  2HDW A;  3BLY A;  2E5Z A;  2VIX A;  2FUG 2;  2V26 A;  3HPG A;  4BJ5 C;  4CCL A;  2O5R A;  1G59 A;  1NG6 A;  4XNF A;  2ZXH A;  3ZGK A;  3OR2 C;  1N77 A;  4Y33 A;  1Z3X A;  4F93 B;  1WJE A;  4IZZ A;  2R4G A;  1Y56 A;  4E6K G;  2HQA A;  2E60 A;  1BR1 A;  2HVR A;  4CCM A;  2BW3 A;  2KRH A;  3FDY A;  4F91 B;  3DQV C;  4ZDP A;  3DPT A;  3PNY A;  1V5E A;  4NNJ A;  3OYH A;  1J09 A;  2F6C A;  4PJN A;  1W36 D;  3OYA A;  3A1Y A;  4BQO A;  4HNU A;  4U87 A;  2A6T A;  4CSW A;  3EUH C;  3K10 A;  3OL4 A;  4CCJ A;  2UUZ A;  2CV0 A;  4P5O A;  1U0J A;  5FRM A;  3LSM A;  2BW3 B;  3OOU A;  4ZTJ A;  3PL8 A;  2LRE A;  3K4M A;  4C30 A;  2R7W A;  4E7J A;  1QU3 A;  2L5Q A;  1LKX A;  3VSL A;  2AQF A;  1WJA A;  2WAD A;  3RPU D;  1IRX A;  1D0Z A;  2VJ5 A;  4MLO A;  4Y4R A;  4QPQ A;  4BDY A;  4OAY A;  2IS2 A;  1UG0 A;  2L2O A;  3OYE A;  2QKL B;  4CCO A;  3LFU A;  4FET A;  2R7X A;  4NC7 A;  2VB6 A;  4JOM A;  4E7S A;  4B43 A;  3OYC A;  3ZR8 X;  1DGR M;  2AQE A;  4DBQ A;  1K6Y A;  3LMM A;  1DP3 A;  2L7K A;  1X1D A;  2NOJ B;  3K4J A;  3PNV A;  4RLQ A;  5HVQ C;  3HOT A;  4BAC A;  1N78 A;  1G8X A;  4BEH B;  3HUG B;  3U21 A;  4BJT A;  2IS6 A;  4HG2 A;  3OS2 A;  3FBN B;  1AA7 A;  3OIQ A;  5HOO A;  3ZXS A;  4U7B A;  2XAU A;  4AYB A;  3I3L A;  4RMN A;  3S3O A;  4PJL A;  4PJM A;  2XDV A;  3K4N A;  4XLH A;  4N4N B;  2M4G A;  4RM2 A;  3IP4 B;  3LSH A;  1MMA A;  4II2 A;  3AL0 C;  2R7R A;  3BCB A;  2L9S A;  2LOO A;  4XN0 A;  1V5F A;  2X1E A;  2CH0 A;  4OWR B;  2K9L A;  3LL7 A;  3H9Q A;  1OLT A;  1WJD A;  2RQQ A;  3DU6 A;  2MD0 A;  3OYM A;  2GOX B;  1D1B A;  1TZL A;  3VYS B;  2ZSI B;  1QHH D;  4BU2 A;  4ZDL A;  4HST A;  4IKF A;  1T0F C;  3DKX A;  3ONQ A;  4XKW A;  2CW7 A;  2WBM A;  2IS1 A;  2WAE A;  4KT6 A;  2V1N A;  4LIU A;  3OY9 A;  3QOE A;  4XKV A;  3OYL A;  2KMU A;  1V5G A;  3VWB A;  1BOB A;  2I8D A;  3EUK L;  2Y0S A;  3H9G A;  3HC7 A;  1E0E A;  3CF2 A;  1UEL B;  4XM3 A;  2W82 A;  2HVQ A;  1SAU A;  3W2A A;  4BUP A;  4BXF A;  3OS1 A;  2CUJ A;  3H9J A;  4D9J A;  1Z7L A;  1X1C A;  4J00 A;  1MND A;  2X6X A;  4PSX A;  5HLT A;  3NWS A;  3MKY B;  3J7A Y;  3VYT B;  1S9H A;  3NWT A;  2Z2S B;  2F4I A;  4LG3 A;  2OC6 A;  3H0D A;  3S3M A;  2X6Y A;  4XMY A;  3FBI B;  4XOP A;  1D1A A;  4PSW A;  2LY2 A;  3MD2 A;  4CCN A;  2BOL A;  3KEY A;  4EAT A;  2VJI A;  3SYT A;  2DJI A;  4H4K C;  4AU7 A;  2JVH A;  3H5R A;  3AKZ A;  4XLE A;  2CV1 A;  4E7I A;  4LIV A;  4PK4 A;  2MAB A;  2XF5 A;  2XC7 A;  3RSN A;  2DT7 B;  2IS4 A;  3RCO A;  4IQ4 A;  2P0W A;  2LC2 A;  2XSJ C;  5FRN A;  3OYG A;  1W36 C;  4R79 A;  3HPH A;  1MNE A;  2W1O A;  2M7A A;  3OIP A;  2VKD A;  3A4C A;  3HOS A;  2UV1 A;  3PSF A;  5TGT A;  2X85 A;  4JQF A;  3CP2 A;  1SFK A;  2KPM A;  2VQG A;  2KZV A;  3EPZ A;  2R7S A;  3OWT A;  3L2U A;  3F9K A;  4DOZ A;  4BEH A;  3H5A A;  3W2V A;  3QYB A;  3PSI A;  3K70 D;  4B3X A;  3OYF A;  4BDZ A;  3EUA A;  3OYJ A;  3MMY B;  3K70 C;  3HXL A;  4LIT A;  2V6E A;  2VXD A;  2W7N A;  3LSG A;  4XR6 A;  3TL4 X;  4E4H A;  3QOD A;  3D5S C;  4G6T B;  4FAS D;  4E7K A;  2F5V A;  3V42 A;  5CKT A;  3UR3 C;  4BJ6 C;  1UAA A;  3ZCO A;  1BR4 A;  3K6G A;  4IQJ A;  4KIS A;  2OV7 A;  1ERD A;  3HL2 A;  4N4O B;  2W00 A;  4HNT A;  1Y6I A;  3OYN A;  3KX2 A;  4BGD A;  3E1S A;  3OYK A;  2KQR A;  3AL0 B;  4YEL A;  2WAF A;  4RLF A;  2PMZ A;  2VKH A;  2XF6 A;  2E1M B;  3OYI A;  3D5R C;  2LRD A;  4DIQ A;  1DGW Y;  3OYB A;  4C2T A;  5JHF A;  5KHD A;  1X1B A;  3CJR B;  1MW7 A;  2MFZ A;  3LSK A;  1QHG A;  3DEE A;  3IAS 2;  4E7L A;  3IAM 2;  3H35 A;  1FMW A;  1N75 A;  2KHM A;  3ZRG A;  1WJF A;  4F52 A;  4RM3 A;  2UWM A;  4YEJ A;  2X6W A;  2JSP A;  2Z16 A;  2E5N A;  4B47 A;  4KIT B;  4X0G A;  2DXI A;  4C9Y A;  3L2V A;  2JA2 A;  4BQN A;  3I9V 2;  4BL0 B;  2CUZ A;  3W3C A;  2X1C A;  4F92 B;  4OAZ A;  3DTI A;  4QPO A;  2L9N A;  2VXZ A;  2IXS A;  3LSI A;  2HPM A;  3OR1 C;  1WJC A;  2WY7 Q;  4CUG A;  1X1A A;  5LD2 C;  3OMY A;  4NC8 A;  4XLC A;  1Z3Y A;  2IGK A;  2LG4 A;  3PJR A;  4ZYA A;  2ZXI A;  2HZD A;  4HPQ A;  3M1C A;  1D0X A;  2CS3 A;  4ITV A;  3CP8 A;  5CQE A;  3L2Q A;  3RQ4 A;  4XQF A;  2Q1Z B;  2JUG A;  2HU9 A;  3QYF A;  3D5L A;  3K4L A;  4PFO A;  3S3N A;  2VLA A;  2HPI A;  3SZG A;  3L2W A;  4CH7 A;  3DPU A;  4BS9 A;  1YX5 A;  2DOA A;  2HVS A;  4J01 A;  4AVZ A;  3DTK A;  1MMN A;  4P1W A;  2BVM A;  3VYU B;  1P9Q C;  2WB1 A;  1VZ0 A;  1D1C A;  1YX3 A;  1NG7 A;  1OR7 C;  3C2G A;  2DT6 A;  3BC8 A;  4HRI A;  4BE2 A;  3K4K A;  3S32 A;  1R6R A;  5HNH A;  4XOR A;  3FKJ A;  2X51 A;  3A2K A;  2VJ4 A;  4DBR A;  4BE1 A;  3DU5 A;  2RNG A;  4D1Q A;  4PJJ A;  4XON A;  1GLN A;  3VSK A;  2VJJ A;  1WJB A;  3GBG A;  2ZSH B;  4XOT A;  3SEQ A;  3SEZ A;  2LYC A;  2OUM A;  3DPL C;  2ZFU A;  2ELJ A;  3CES A;  4XLA A;  4KJZ A;  3M8J A;  2VAS A;  3S8P A;  2MC4 A;  3H5N A;  2R7U A;  2V4J C;  3IUO A;  4CA0 A;  4XL9 A;  2PJR A;  4ZJZ A;  4E7H A;  3K4B A;  1LVK A;  3K4C A;  4GRI A;  2RRE A;  1X4O A;  3RTR A;  2R7Q A;  2M7B A;  4ZTF A;  2WA0 A;  3CZ6 A;  2KLO A;  2BVL A;  3G2B A;  4CZC A;  4F55 A;  1LDK B;  1MMG A;  2HNH A;  4DGW B;  4DJA A;  4F3Q A;  4YRV A;  2IGN A;  1PYV A;  4B44 A;  4CCK A;  3BCA A;  3DWL E;  1WFX A;  2WY8 Q;  4HSR A;  3S93 A;  2LY1 A;  2CMP A;  3DLA A;  1EA3 A;  2W4S A;  3HG9 A;  2PJR B;  2V9K A;  5KNL A;  3VDX A;  3PFY A;  2MYS A;  4NQW B;  3MKZ A;  3ZQQ A;  3OYD A;  4ZDO A;  3BG7 A;  2V7F A;  2R7V A;  2LH9 A;  3AFH A;  1FMV A;  1Z21 A;  1LFP A;  5FRO A;  4II3 A;  2LBF A;  4Y3O A;  2KL4 A;  2K3P A;  4IX7 A;  3SDB A;  3CMM A;  4XKB A;  5CPR B;  3VYR B;  1KON A;  2K5C A;  2VL8 A;  4PUS A;  4ZC3 A;  2GOM A;  3FHN A;  2VQH A;  2X1D A;  4NUB A;  2CV2 A;  3E0J B;  3DTE A;  4E7Z A;  2IGM A;  1BR2 A;  1PJR A;  2QKM B;  2KP6 A;  2R7T A;  5KCM A;  2E1M C;  1YE9 A;  3HKZ A;  3N05 A;  2WAQ A;  4BE0 A;  1D0Y A;  1X4P A;  3CJQ B;  2KRC A;  2LBF B;  3TBI A;  4C2U A;  4ANJ A;  2DCE A;  3KYL A;  1T95 A;  3PNT A;  3BG6 A;  3QYE A;  3UNG C;  2M0M A;  2R7O A;  4BQQ A;  2Z1D A;  1HA8 A;  3W2W A;  2K9M A;  1DQU A;  2KDO A;  1ZEL A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...