2KHMA

Structure of the c-terminal non-repetitive domain of the spider dragline silk protein adf-3
Total Genus 38
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
38
sequence length
140
structure length
140
Chain Sequence
b'MASMTGGQQMGRGSMGAASAAVSVGGYGPQSSSAPVASAAASRLSSPAASSRVSSAVSSLVSSGPTNQAALSNTISSVVSQVSASNPGLSGCDVLVQALLEVVSALVSILGSSSIGQINYGASAQYTQMVGQSVAQALAG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Fibroin-3
molecule tags Structural protein
source organism Araneus diadematus
publication title A conserved spider silk domain acts as a molecular switch that controls fibre assembly
pubmed doi rcsb
total genus 38
structure length 140
sequence length 140
chains with identical sequence B
ec nomenclature
pdb deposition date 2009-04-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF11260 Spidroin_MaSp Major ampullate spidroin 1 and 2
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.1350 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Arc Repressor Mutant, subunit A 2khmA01
2M0MA 2KHMA 2MABA 2K3PA 2MFZA
chains in the Genus database with same CATH superfamily
2FEZA 3RDIA 3QU6A 2LBFB 3KEOA 4MTEA 3RI4A 2X6OA 1W0TA 4KT6A 4C2MJ 1ZELA 2DN0A 2L54A 5HDGA 4DW6A 3BG5A 5FROA 1FOWA 1SVMA 1S72I 3GUDA 1MBEA 2ZFUA 4RB3C 3OSFA 1VQNI 3EQLF 3GTOJ 2PN6A 3PFIA 1P4AA 4RLFA 3Q0WA 3TO9A 1S29A 1JUPA 2STWA 4ZYGA 3BCAA 3R4KA 5J8FA 2ZXIA 1MBKA 3OYKA 3H3VK 2M7BA 2C6YA 3F3XA 3BG3A 4M3GA 1TP4A 3HUGB 1TQIA 4JYKA 4RAFA 1QBJA 3BG6A 1BW5A 3HRMA 3HHGA 5EG0A 2RN7A 4ZZDA 2KDZA 2A68F 4LJZF 2R7OA 3VYRB 3OV8A 2V1DA 1P9QC 3EPZA 1QGPA 1KU7A 2ME6A 1LE8A 3ERMA 1OYYA 4IHYA 3KYDB 2RNJA 2HTJA 2ISYA 4W97A 3HRSA 3HDDA 2Y48A 1E2XA 3S1QJ 3K0LA 3LMMA 1PUFB 4PUSA 3HOVJ 3L2WA 2A6TA 4PK4A 3OYFA 4IOAF 2D1HA 2MC3A 5E1XA 4ESFA 1U3EM 3IRQA 2HFHA 3ZQ7A 2CU7A 2KDOA 4FE4A 3F6VA 4KN4X 2KFDA 4B3AA 3CD6I 2WB1A 3GEZA 4A5NA 2K5CA 3COAC 2QKMB 3SFZA 4HNTA 3HRUA 1OKRA 3F8MA 4DOZA 2E7WA 5K1YA 3F22A 5KHDA 1YG2A 3PIOF 3GO5A 1IJWC 3LSGA 3OYHA 3CC7I 2G7HA 2B9SA 3CCSI 5FLVA 1D1CA 4BXXJ 1ZTRA 5D6EA 1H8AC 2VXDA 2XRLA 1T0FA 1FIAA 2PMUA 3LSMA 1MNMC 4C3IJ 1DQUA 3OYEA 3S2DJ 4ZYAA 2KHMA 2W82A 2VL8A 5L3BA 1WCMJ 4AVPA 5GPAA 3JREA 3E0JB 2CUJA 1GVJA 2B63J 2CFOA 2M3AA 2XPWA 4OOIA 3OS2A 3QYBA 2EFPA 1BI3A 2LTPA 2IS6A 1MNEA 4BXUA 2XSJC 3PIPF 2NS7A 1IF1A 3EUHA 4FE7A 4AD9A 3UKGA 4PJNA 1D0XA 4HYEA 5HODA 4E7KA 4FCYA 2VC1A 1EH8A 2Z2SB 3M8EA 4O5VA 4QTRA 5E1ZB 4WXHA 3M1CA 3DU6A 1M1EB 2WC2A 4Q47A 4B4CA 3DP7A 3RZOJ 3A01B 1G2HA 1Y8QB 1SFEA 1SVOA 5DD8A 3TEDA 1BR4A 5EZHA 3TOBA 3W2AA 4A3MJ 4IHTA 2KKOA 5LFAA 3FBNB 1JHFA 5JR3A 1BR2A 3LSIA 3W6JB 4CZZA 5E20A 3ZMDA 1FBQA 1YQAA 1FYLA 1WJEA 1YJWI 3G2BA 4AWXB 2VASA 3I3LA 5DCMA 4AYBN 3NARA 4CA0A 3LQQA 1V5EA 2WAEA 1WI3A 4Y4RA 4IHXA 1RNLA 2W1OA 3A03A 1UCRA 3ROUA 1TL8A 5FKLA 4JX6A 3WHCA 5F1JA 3F23A 3FHNA 1QHHD 2XKOA 1VQ4I 4L9NA 3Q3SA 5K7FA 4D5CA 3QPHA 5D5XB 5M3FJ 1NH3A 2DU9A 2JSPA 2VIXA 2QKLB 5IY5H 3KZIC 4H4KC 4HQEA 1YX5A 5HVQC 3FXUA 2FQ4A 4UUSA 2UUZA 2JA5J 2OA4A 1F43A 3AKZA 3GZNB 5A2QZ 1Z05A 2XV4S 1T98A 4LOCA 5DM7F 3I4NJ 3ESWB 2ZMEB 2MA3A 2AXTC 2JT1A 3C3WA 2TDXA 1ZREA 2NS8A 2DOFA 3TP0A 3AAFA 1NK3P 1IUFA 4DZPA 5ICCA 1T33A 2CQKA 3KEYA 1RUNA 3GTGJ 3PNTA 4AIJA 3A2KA 2LLKA 3GVAA 4BY1J 2ZMEC 4CYCA 2D1VA 3H5AA 1BJZA 3OMYA 3X2QH 4BBRJ 4A12A 3KLNA 3QQAA 3JRAA 5ERIA 1YO5C 5F04A 4CO8A 2JRTA 2K9QA 1POGA 3U21A 5GAHJ 2O3FA 4BE2A 5LD2C 3TMOA 2KT0A 4LFUA 2HKOA 2BXYA 4B3XA 2HYFA 2O0YA 1A35A 3S8PA 2ESNA 3D0SA 3MZYA 3P5JA 1FYKA 2BHYA 2L7MP 1MJ9A 3HGGA 5JI6A 3HOZJ 2VONA 1GDTA 3IKVA 3J7AO 2VODA 2O61A 5F0CA 1OMIA 2OBPA 2K9LA 2VBXA 3D5RC 3L2VA 1OFCX 1TNTA 1ZK8A 2LOOA 2O6GE 3ULQB 2Q0OA 2EFWA 4N4OB 1E3OC 4JP0A 1IN6A 2B7EA 3VSKA 2Y31A 2H6CA 3H0GJ 2XB0X 1LVKA 1PYVA 1YRNA 1TQPA 4XL9A 5J47A 3GFIA 2Z3YA 4M71A 1MMAA 1QO0D 3DKXA 3HKZN 1HKTA 1MMGA 2KIMA 3JTHA 4NQWA 3I56I 1E3PA 1WPKA 3V42A 2W4SA 3GWZA 4MGRA 4XRSG 5FKNA 4MFEA 1LNWA 1G6NA 4JK1X 1AA7A 3BZCA 4M3EA 3HG9A 2FU4A 1G59A 1ETOA 4HPQA 5BPDA 1JXSA 2IJLA 4YEJA 3ZR8X 4R1HA 5L3FA 3CC4I 5M3MJ 2DPUA 1HDPA 1TZLA 3CF2A 5HS8A 3BOQA 3QYFA 4AVZA 4DYRA 1QVTA 4MHGA 1UZCA 3L09A 4AIDA 5B66C 1DPRA 1MNDA 5AIQA 2NVXJ 3TW6A 3BPXA 2FJ1A 4HNVA 2KMUA 1Q1HA 3ZQQA 4S05A 5F6FA 3L1PA 3AG4H 5HLIA 1XCBA 4HQMA 1Y0NA 1XPXA 1GVDA 2EQRA 1F1ZA 3TL4X 1QPIA 4RMNA 3PUFA 2EJRA 4KIBA 2QA4I 4MQVA 3MZHA 4L9JA 2OD5A 2FUG2 3H5RA 1R71A 1ERDA 3A1YA 3GZ5A 1IN8A 3FM5A 2K3PA 5TJJA 2LH9A 2PMHA 1QA6A 2MSYA 2JPCA 2DAOA 3BR2A 1LDKB 3V8LA 3CCJI 5FLXK 2P5VA 5IOZA 2YUSA 4XRFA 3WTWC 3W6VA 2MLGA 1IV6A 2R92J 1BR1A 1A31A 1WH7A 4OWRB 4M72A 1VFCA 2F4MB 4GYGA 3RPUD 3S1RJ 1IGNA 4XOPA 1PJRA 1XN7A 3F21A 2KP6A 1QZEA 1ETKA 4UV9A 5HLGA 3I54A 3HSRA 4E7JA 2NVYJ 3IUOA 2Z16A 3JRBA 4L0YB 4HOBA 1K61A 4UUVA 2KISA 1S5LC 3FISA 3H9JA 2NRAC 3MKWB 4Y33A 2L9NA 2O5RA 4EJTA 3ZPLA 5GTHC 5J1RA 2P7CB 5D4RA 3JCUC 1YJ9I 3J7ZI 3OY9A 3GF2A 2FNAA 2W84A 3E5UA 3OOPA 3B6CA 5FRMA 3DPTA 5D5WB 3ABLH 1FSEA 2EB7A 3B02A 1JGGA 2CUZA 3I55I 3JRIA 5ICGA 1LE8B 2WAFA 3LFUA 2DT6A 4LIVA 1MMDA 2FMYA 4N9IA 4HAMA 1DUXC 1OR7A 1L3LA 2L0KA 1V3FA 2DFEA 1TBXA 2P4WA 4OIQF 1R00A 3FMRA 3DTEA 1L0OC 5BMZA 2BY2A 3CDLA 2DMNA 5FD5A 4N9HA 1SFOJ 1IRGA 4CUGA 2HGCA 5EZGA 4IRIA 1ONVA 1ZKGA 5B1AH 2L7ZA 1IXRC 5CVIA 3HL2A 2E2IJ 2BVLA 3EYYA 2W00A 3CCLI 2Q8KA 1SMTA 2LY2A 3LA3A 4C3HJ 1IRXA 3S15J 3DF8A 3VEPA 2YR2A 1ZLJA 3T0YA 3ZQGA 3Q0UA 4KICA 4ENKA 3KETA 2NOJB 3RPQA 4O3MA 2X4HA 3O8GA 1R1VA 5D5UB 4XKVA 4ENMA 3FXLA 3CZ6A 4IPAA 4OMYA 2OPTA 3ZQCA 4Q48A 3DCFA 3ZQFA 3O3KA 2ZJQF 1TWFJ 1HOMA 1R36A 4GDFA 3IC7A 1P6RA 4KNYA 3FXQA 4OAYA 5E8IA 1Z21A 3QPSA 1ORKA 3DKWA 2KJCA 1YW7A 3VOEA 4KFCA 1V4RA 1CQTA 5D5VB 3QOEA 2DJIA 2YX4A 3E6MA 1VQ5I 4V19K 3AL0B 2X1CA 3H92A 5TGTA 2W85A 1RKTA 1JKOC 1FZPB 4XRMA 3G1OA 2EFOA 1X3WB 2EZKA 4OIOF 1ODDA 2JA2A 3OYDA 1IW7F 4AIKA 1WKMA 3WU1B 3CUQA 5F08A 5EDNA 3S2HJ 2CRGA 4RGUA 3ZN0A 2K9NA 1BI1A 5L3CA 5ICEA 4BGDA 5D8LB 3ZQIA 1P4WA 3B73A 1Z77A 2R5YA 2HVRA 3VDXA 1SD6A 4BE0A 1J0RA 1WJAA 3C18A 3VYSB 1ZN2A 4M6VA 2QWWA 4D7NA 5ED4A 4F93B 4IZZA 1JTYA 5CLSA 3LNQA 2VQCA 2MYSA 1USTA 4GCVA 2XROA 3RKQA 3IKTA 2HNHA 3H3UA 3OIOA 3E6BA 4NC7A 3KFWX 4HLYA 2R0QC 5LGUA 1SC7A 1ZAOA 2E60A 3DPUA 4WXCA 4CXFA 4KMFA 3WU0A 1SD4A 2X6WA 3LSTA 2N8GA 1N75A 2WBMA 4P55A 4HV6A 4MLOA 3OSGA 3A02A 2M8GX 3TOAA 2WTEA 2Y69H 3ISPA 2LVSA 2VI6A 3M1EA 1AWCA 3BR3A 1D0ZA 1MJBA 2ZJ2A 4ZJZA 5EYRA 2M0CA 2Q2EB 4XLCA 1N25A 2CYYA 1KU9A 2VBWA 4HX8A 2JA8J 2LC2A 2XAQA 2LK2A 4KDPA 3OWTA 4IJAA 1Z3YA 5H2FC 5HS9A 1IZ1A 4F52A 1OCPA 3K4MA 4RAZA 5DUKA 1PP8F 1IDYA 4U0WA 4N4NB 4L9VA 2L4MA 3WGGA 4EEFG 4U87A 1B72A 3JRDA 1FBUA 1T8IA 1MJAA 3C2HA 1B8IB 2KZGA 3CMMA 4A3LJ 1D5YA 2ZNYA 3OR2C 3OYJA 1NK2P 1YW9A 3RCOA 4LIUA 2OTJI 2CW7A 4EJOA 4KYWA 5DCMB 3QAHA 1FPQA 1BOAA 1W4MA 2QF7A 2ZXHA 4LD5A 1I3AA 5CVRA 2QSHX 3EETA 4JX5A 1QNTA 3H3ZA 3DEEA 4BY7J 4ITVA 1K7AA 3E6DA 1DGRM 4FX0A 2JSCA 2AQEA 2TRTA 2E7XA 3BR6A 3E97A 4KUMA 3F8BA 2V6CA 1MDMA 2LSOA 3HUGA 4F91B 1KA8A 5JLWA 3ERED 1O57A 3T1BA 3TP3A 3RQ4A 4EATA 1QZYA 1REPC 1OISA 3FXKA 3FX3A 4G94A 3ZQLA 1XDSA 1F9NA 2XIGA 3RJPA 1AOYA 2ELHA 2QQBA 2DODA 2F5VA 4IQJA 1RC9A 1UFMA 2DA4A 1Q1VA 2R7TA 5LGNA 2EZHA 4M74A 4BL0B 3EDPA 1S3JA 4ZDLA 3PL8A 4HLXA 2QSGX 2EILH 2QSFX 2RDPA 2DFIA 1DPUA 5BOXA 2DA2A 2XUBA 3ABMH 3AG2H 1J75A 2HEOA 3U9GA 4II2A 2DYSH 2XGXA 1OR7C 4X1EA 3FHZA 3CMAI 1ZHFA 1AHDP 2VKEA 3VYUB 3ECOA 4CHUA 4RB2C 2DYRH 1TNSA 3QRFF 3P9KA 2E1MC 3ASNH 1HW2A 4YFNF 1GV2A 3E1SA 3G6EI 4CYCB 2PJPA 1VQ8I 2MLKA 1EV7A 3ABTA 3C2BA 5E79C 1UJ8A 2VKHA 4KT5C 5D8KB 3RKYA 4C2UA 2P6SA 3GFJA 3BCBA 3W3CA 3S93A 4BYYA 4XNFA 1H0MA 3NRVA 2PJRB 1G3WA 5LHIA 3HTSB 1YYVA 2X0LA 4ZDOA 5CQEA 4MFDA 2R7FA 4BXFA 2HOSA 2BZTA 1SVLA 2DBBA 2ZKZA 1Z6TA 2K3FA 4PCQA 2DTRA 4I6ZA 2M34A 2RAEA 2WWYA 2XGCA 3I59B 5E3NA 3FXMA 2HOEA 2G7UA 2LG4A 3OYGA 2HPIA 3HXLA 1SEUA 2R7WA 1QRYA 1BL0A 2LP0A 3PQKA 4A3EJ 3CMEI 4A3IJ 2O8KA 4GXOA 2IW5A 3RZDJ 2GOXB 1DU0A 2ZBKA 1YI2I 2DT5A 4HW0A 2DCEA 2FOWA 2EA4A 2VKVA 4HF2A 1FLIA 3NWSA 2OV7A 4XLPF 3OIQA 4FQGA 1ZR4A 1U0JA 1X3UA 1FP1D 1A36A 1FC3A 2E71A 3BTLA 3H5NA 1G3TA 4BDYA 2CW8A 2L9RA 2CUFA 3CCRI 1K6YA 4AUXA 1KQ8A 3M4OJ 1HKQA 3K1NA 3QP5A 2FMLA 2UXNA 4LITA 4MEXF 3WE2A 3SEQA 4PJLA 4RDUA 1Z3XA 1X3ZB 1WSUA 3A4CA 5E3MA 2V6EA 3WG9A 2BY1A 2HOAA 3ZCOA 1XTAA 2EV6A 1DU6A 2MW8A 2CW0F 2H8WA 4IX7A 3FF5A 3WHBA 4CZCA 4N0BA 1WGXA 1FMVA 1V5GA 4U88A 4M73A 3P7NA 2QVOA 3K1PA 1BN5A 2IA1A 2VQHA 2HZTA 3DBLB 2HVSA 4FASD 5J4VA 2GLOA 2JRMA 5IT3A 1WJCA 1U8RA 1U2WA 4ASNA 2XGDA 2WB1N 1WVRA 5FD6A 2EZLA 2TCTA 2YS9A 3G4SI 2GZWA 3AFHA 1YTYA 3VYTB 1TQMA 3HTUA 1B9NA 1IXSB 3IV5A 1OPCA 3L2QA 2IEKA 1MGTA 4NC6A 4KN7X 3O6BB 2KL4A 3GTLJ 3H9QA 1Y0UA 3IAM2 1W7PB 1R7JA 2DTZA 3EYIA 5F0FA 1E17A 2UV1A 1G8XA 3AG1H 4FISA 3GX4X 3OL4A 4G8XA 1TC3C 2RREA 3HOTA 2NAZA 4BQAA 1USSA 3HPGA 3FXJA 3CDHA 5J4YA 3D5LA 2HDDA 1I39A 3F6OA 2B0LA 2H8RA 2WADA 3V4GA 3IL2A 3G1LA 4EVIA 1U5TB 2LY9A 1S9HA 1IUYA 4F55A 2COMA 4OU0A 3WTTC 4XLHA 4DIQA 1Y6IA 3ZOBA 3IRRA 1LVAA 2QM3A 1RUOA 5E3LA 3H9GA 1X1PA 3I64A 3KZYA 4CCMA 4Q4ZF 2IBDA 4AC0A 1JHHA 3VB2A 2H6BA 2VJ5A 1ZRFA 1FIPA 3JRHA 1BJAA 4BACA 1JKRC 2XAJA 3S1MJ 3EUAA 2HTSA 1V54H 2COBA 2HR3A 4EMSA 2WV0A 3BLYA 4NB5A 1P2FA 1UG2A 2IPQX 1H89C 1A6IA 2EINH 3L2UA 2F5EA 2QGUA 1NG7A 4AYBA 3Q9SA 5ILUA 1Z67A 4XOTA 5J6XA 2HPMA 3GW2A 4CCKA 4FX4A 2BHZA 2DW4A 1FYMA 2K4BA 1WJDA 2DXIA 2FBIA 3K4LA 1ZG1A 1RETA 3I9V2 5BQTA 1Y39A 2R7RA 2WAQN 1E3HA 1KQ0A 2Y9ZA 3KEQA 4KIFA 2A07F 1H88C 1R4NB 2Y0SN 3JRGA 1HW5A 2K86A 3F8CA 3SHFA 1K79A 2EV5A 3GLLA 2BGCA 2KQRA 4AIHA 3I58A 3U1DA 3CP2A 2HKXA 1JGSA 3CJQB 5E17F 3ECHA 5GAEJ 4M6XA 3LSJA 3R61A 2VBZA 1UELB 2EFQA 2FSWA 3ASOH 3OYNA 2DA7A 1Z1DA 3C2GA 1S7AA 4KITB 4EGYA 1OYIA 2BY3A 2DA3A 2W7NA 2M4GA 2GA1A 4XMYA 1U9NA 3CQZJ 1Z7LA 4BEHA 2E5ZA 2XASA 3MEXA 1WHUA 3JRFA 5DS9A 1EJ9A 3CMYA 4K2EA 4E7ZA 5KAFC 2G0EA 3NEUA 5LLQA 1YFHA 2JUCA 5K7HA 3M7GA 5J8CA 2IGOA 4YG2F 1GT0C 2KJBA 1ULYA 2ZJRF 4I01A 2HS5A 2IA0A 5FRNA 2Z5UA 2JJ7A 4Y52J 2ZO4A 3TO6A 5K5QA 2IS1A 1RESA 2RQPA 2ZXWH 3CDIA 3KPHA 4GO1A 5B1BH 2UWMA 1O3SA 2R93J 2ZJPF 2A6EF 4IKFA 4F3QA 4CCOA 1J5YA 1KONA 2IA2A 4YELA 2LF7A 2DDBA 1QQIA 2CV1A 1G3YA 4I7HA 3K2AA 2XPUA 3HC7A 2UXXA 3CLOA 1GXPA 5CYVA 2M7AA 3HOYJ 4HG2A 5FGMA 2LFBA 2QBYA 2M30A 2OQRA 1HXDA 2WY8Q 4LG0A 3S32A 1MD0A 1EKEA 4A3CJ 1BA5A 3SYTA 2NNYA 1D3YA 3PO2J 3JAMZ 4PDKA 1EA3A 1KU2A 1Z9CA 4M3DA 1ZGAA 2R7ZJ 2QUFA 5IP9J 2DT7B 2ZC2A 3P9CA 1FEXA 4BKXA 1SFXA 3BJ6A 4RM2A 3SEZA 3CO6C 2XF7A 1VF9A 1BBYA 2CQNA 1WZ2A 3JR9A 4M3BA 2OZUA 3WTVC 1ZLKA 2ZB9A 1I1SA 1OCCH 4DYCA 1FT9A 2EFNA 3HOXJ 1DDNA 1PUEE 4JOMA 3K4BA 1VQLI 4OIRF 5LGTA 5CVUA 3DPLC 5DUIA 4YIFA 3MKZA 4QLCU 2VT2A 1U9OA 1T38A 1R4MB 3CCQI 2OJED 1JI8A 4JQFA 1XB4A 1IDZA 2M9HA 2V4JC 3HEFA 2IAIA 4BDZA 1U78A 1B59A 1LUJB 3O8HA 1I1GA 5AONA 1IN7A 5EG0B 3DEWA 4A0YA 4G6QA 3VFZA 4P9FA 1FOYA 3RYPA 3CCUI 1QPMA 3WTUC 3E6CC 4A5MA 4EQQA 4D5FA 2L01A 2Y2ZA 3O2PE 4BHCA 1HQCA 2MG4A 2HZDA 2WY7Q 3GBGA 3WE3A 2GM4A 1K4TA 1X19A 3S3OA 1JUSA 4MIMA 1UHMA 2QZ8A 4CCNA 4DZJA 4XLFA 4UY8I 1SMYF 4LMYA 3BY6A 4XLEA 2WV1A 4UVBA 4A69C 4DNCA 1BM9A 3BPVA 3MKLA 2VT3A 3J7YJ 3F0CA 1DGWY 3VPRA 4BJ6C 3JRCA 3I71A 3KP7A 3ZGKA 2VPRA 4X6AJ 3PJRA 3U1KA 2DK8A 2M8EA 1WRJA 2AHQA 2RC4A 2R7DA 3QODA 4XLNF 1QU3A 3H35A 1ZYRF 4BE1A 2VB6A 1N77A 4NNJA 1U5TA 4XICA 4E7HA 2NVTJ 2PMZA 3KCCA 3LSRA 5KAIC 4V2GA 1T56A 5KCMA 3RKWA 2M1BA 2JVHA 2KRFA 5HOOA 2R5ZA 2IRFG 1ITYA 1ZH5A 3WU2C 3ZMZA 2A5YB 2BE5F 4OINF 1RZ4A 2EA2A 4PJ0C 1Z0XA 1OYWA 2VPLA 1H9GA 1TW3A 2CO5A 1BI2A 3KP2A 4RGXA 1R5GA 1MW7A 4QSHA 4GRIA 3KZZA 4AU7A 4MO7A 5LEJA 4H0EA 1VQOI 2VQLA 4P96A 1HBXG 2Z99A 1J9IA 4G9YA 2E1OA 2JA6J 5DV5A 2VJ4A 2L02A 3K4CA 4XKBA 3LA7A 4BAYA 1HSJA 2LRDA 5DEQA 2EIKH 2HXIA 3CUOA 2CWEA 2DI3A 1FTTA 1R23A 1HSTA 2YSRA 1LB2A 1X4OA 3DTKA 1MBGA 1XMXA 3OYCA 5E1WA 3FXRA 5FKMA 4LK1F 3SZPA 5F1RA 4A3KJ 1QVUA 1PVEA 2DLLA 4KISA 3KYCB 3IHUA 3WTSC 1ON1A 2VC0A 2QCOA 3K1MA 4NHJA 2EWNA 3BR1A 2EV0A 1Z6RA 3LAJA 4I02A 3RTRA 4BH9A 2XSDC 2P81A 2X6XA 2ZNZA 2CUEA 2ZSHB 4E7SA 3ZRGA 3G71I 3GXOA 1FOXA 5FKOA 2XAHA 4ZTFA 4LG3A 1FSHA 1LFPA 3BTJA 2E2HJ 1TTYA 2BY0A 3CESA 3TDZC 2CV2A 2CQ7A 2GQQA 4HDUA 1G4DA 1UAAA 5EGOA 3I59A 3GFLA 4P5OA 1D8JA 1HCRA 5CVVA 1BC7C 3GTPJ 2RKHA 3WTXC 3AG3H 2GOMA 5FFZA 1TT0A 1O3TA 2H1KA 4GYIA 2IP2A 3ABUA 3QWLA 1XS9A 3LQRA 1C0WA 5HLTA 4G7ZF 2MH2A 1FMWA 2M5WA 3ABKH 3GCMA 3ZMTA 1MIJA 5A2QK 3T8TA 3CUQB 2PMZN 3V8KA 1KYWA 2PQ8A 1K78B 4BNCA 5F0HA 4ESJA 1WH5A 4UUSB 3K70C 4B48A 2VJJA 3M3YJ 3SDGA 1FWZA 5GTIC 2OU2A 1YIOA 1P92A 3ZMUA 4EJWA 2V1UA 3QOPA 2F6CA 3BR0A 2D5VA 6PAXA 2GXBA 3MZ8A 3LOCA 4PGHA 2NOGA 2IS2A 5BPIA 1Z91A 3A0HC 4II3A 4WK8F 5LRSA 2ZCWA 1E0EA 1MMNA 5DD4A 5H6QA 3SQNA 1K78A 1ZARA 4RB1A 1JT0A 4XQFA 2QQAA 4HEA2 1WJFA 2D45A 2GAUA 1OCZH 4EJUA 1PUFA 2E19A 2R5ZB 2QBYB 3RSNA 2WAQA 3WTYC 3DV8A 2W57A 4ZH4F 2MBFA 2LNBA 2QQ8A 1B4AA 1R1TA 1XX5A 2Y0SA 1TT5B 5IYDJ 2ACJA 1J59A 3K4NA 2R7QA 4CSWA 5DDGA 1YS6A 2HVQA 3HM5A 3HSEA 2Z9OA 3LAPA 1J09A 1TWHJ 1UG0A 1MDMB 2L7FP 1I6XA 5KVRA 4MNUA 4C2TA 1GXQA 5C44J 4NBQA 1MBJA 2XF5A 4LK0F 3IH2A 2F5DA 2HDWA 1NTCA 4W1UA 2QEXI 5TRDA 2FE3A 1W36D 2OCEA 2EPFA 3CO7C 4DYQA 1VQ9I 2L3DA 4M9SA 2FBHA 1HW1A 1O7LA 3R0JA 1SFKA 3K70D 1LEBA 3TW7A 3CCVI 3R60A 3DKYA 4UNOA 1OQYA 3ZMVA 1W0UA 5F27A 2RGVA 3EUHC 2L4AA 1YITI 4HX4A 3CCYA 4UVCA 4A6EA 1KGSA 3D1NI 2P0WA 3VSLA 2FF4A 3S17J 5H6RA 3HOUJ 2IT0A 1EH7A 1T39A 4DBRA 3QPLA 1JKQC 1HF0A 4XSXF 2FA5A 4ETSA 1XGSA 4D1QA 5L3GA 2HU9A 3M8FA 3SDBA 3CC2I 2R4GA 3M8JA 2DMUA 3PQJA 4HA8A 4BJTA 4XONA 5C3EJ 4IO9F 1V5FA 1FTZA 2KIUA 3NQOA 1UHSA 4ANJA 3SJMA 4YFKF 3BT9A 3BJOA 1OLTA 1VZ0A 5AIPA 5EEAA 2A69F 1XSVA 2KRCA 5BS6A 2DK5A 1X2NA 4IHVA 2BVMA 1ETVA 1F5TA 2ESHA 3MN2A 4RLQA 1LDDA 3V7CA 4HF0A 1KZHA 4I98B 4JBAA 4Y17A 4PGGA 1Y8RB 4UVAA 1R49A 4NC8A 3BQYA 1JJ6C 4LLLA 1YW8A 1APLC 5C4XJ 1MBHA 2FNPA 3PSIA 5L3DA 1O7FA 3LL7A 4XN3A 2VOOA 4QPQA 2STTA 1HA8A 4PFPA 1SAXA 5FLXZ 4E6KG 4ZYHA 2EBIA 5FKKA 5KNLA 4RGSA 4A2UA 3WODF 3ZXSA 2V1XA 2HI3A 1NHAA 4NUBA 1KYZA 4XORA 1B6AA 2IS4A 2XF6A 3BG9A 2KZVA 4B47A 3FBIB 1ZRCA 3FMSA 5B3SH 2XKPA 2F4OB 1MH4A 1TWCJ 4A3FJ 3IWZA 2LREA 2PEXA 3ZN1A 4A93J 3IP4B 2JA7J 1I3QJ 2X1DA 4BHBA 1O3RA 2I5UA 4PZJA 4BS9A 3LA2A 4NDLA 4PJMA 5LHHA 3BQZA 5GADJ 3FDYA 1MH3A 1X1DA 4E4HA 4IOCF 4AM3A 4TV7A 2E36A 2PI0A 3BDDA 1YJNI 4FHTA 1SAUA 2MH9A 1X4PA 1U6GA 4CCLA 2R5YB 2ETHA 3FXOA 5D6FA 1VQMI 3GZ6A 1JJ8C 2X9DA 1ACIA 2K7LA 2LKSA 3OYIA 2GBYA 2H27A 1WWXA 2P5LC 4A3GJ 1ZR2A 1CGPA 4CGZA 2OTLI 3MFKA 2W25A 2GIZA 1B72B 4UXNA 3RPUA 3VWBA 1HKSA 2E1NA 3WGIA 4Y7NJ 5FLMJ 4BQOA 4EJVA 3R6SA 3DFGA 3V7SA 2VE8A 2JK3A 4YIRX 5E18F 1CF7B 3K4KA 1ZG3A 4MQ9F 1FX7A 2FD5A 5J1UA 2DPDA 4M9ZA 4Y15A 2ZFWA 3OS0A 3S16J 1ETQA 1XDUA 3HKZA 4XKCA 4G7HF 1D5VA 2Q2EA 3DLLF 4RGRA 2Y9YA 4UB6C 2ECCA 5HNHA 1GV5A 2MFZA 3W6KB 3L2RA 2LKXA 3WTZA 1R6RA 2NXNB 9ANTA 3IH3A 2VBYA 2ECBA 1SFUA 2A5WA 2Y0MA 3ELKA 1RRJA 2DA1A 1MZBA 2QENA 3KYLA 4ESBA 1MSEC 3S14J 3BWGA 4RBOA 2ADUA 2LBFA 1LJ9A 4M9XA 4PFOA 4QWQA 3FWEA 1D0YA 4D0PA 3W2VA 2LYCA 3DQVC 4IVNA 1BC8C 5K7ZA 1IN5A 1QZZA 4E7LA 4UUTA 3SZGA 2EIJH 2RQQA 4LB6B 2YPRA 2A05A 2XB5A 3J80K 3HOSA 1W36C 3PFYA 2X1EA 1SANA 3CCMI 2A3SA 3DXJF 4X0GA 2F5FA 2BW3B 2CH0A 2IVMA 3QYEA 4ON0A 3LSPA 2E1CA 2CGPA 1R1UA 1XD7A 3MD2A 3LSKA 2RNGA 4R79A 2DO7A 1XGMA 3IH4A 4U7BA 5IYCJ 2ZSIB 1IN4A 2ID6A 2JQ7A 1W7PA 1BIBA 3HYIA 2JTVA 3TBIA 2GA2A 3DWLE 4E70A 3GMEA 3DBRB 1LPQA 3DTIA 3G1MA 3FK6A 5B5EC 2NYXA 1HLVA 4I0AA 2XAUA 3L00A 4BJ5C 1HC8A 3I0TA 2HQNA 2DOEA 5EGOB 1JUMA 2UZKA 1S7OA 5J40A 5EF6A 1G3SA 2AQFA 3W2WA 3PNVA 4UV8A 1XSDA 3KIOA 1IRZA 3KX2A 3J81K 2KIQA 4A3BJ 2RVCA 1I5ZA 2YX7A 3LSHA 4PJJA 1AKHB 3ZMSA 4Q5SF 4EGZA 3J81Z 5LHGA 2CS3A 3NWTA 2ICWG 4B44A 5LEKA 1BW6A 3F72A 4IXAA 1I6HJ 1RR8C 4WF2A 2OAZA 4FT8A 4B09A 3KP4A 3BJAA 3CTAA 1TW2A 2R7UA 1VQKI 1UMQA 5DCFA 2GXGA 2DFHA 2CSOA 1WFXA 5E3OA 4CICA 4HF1A 2NVQJ 4A0XA 1MKMA 4L5JA 4Z2YA 4YRVA 3SZTA 2FX0A 2E35A 3SXYA 3ZQHA 4F7ZA 4YIIA 2K40A 1WQ2A 5FJ8J 2VKDA 4J01A 4U0YA 4KMUX 2VJIA 2CJJA 1VQ7I 2CV0A 2HDCA 3M07A 3WGHA 3QU3A 2M4KA 3RKXA 2K9MA 3K4JA 3KE2A 3KLOA 5J1YA 4XN0A 1FOKA 2FXAA 1W5CC 2Z33A 2MD0A 3KP6A 3JW4A 5HNFA 2BOLA 1S8NA 2F2EA 3K9TA 4XK4A 5IP6A 4L0ZB 2JPBA 3M9AA 3PO3J 2BV6A 2V9KA 4NQWB 3E7LA 1A5JA 4RAGA 1LFUP 3P9IA 4I76A 1I27A 2BEOA 4WX9A 4HRIA 2R7XA 2V79A 4C30A 2JVGA 2VLAA 3PM1A 1F36A 4ZC3A 2V7FA 2FOKA 2IGMA 1U5TC 3D5SC 1Y1WJ 2PJRA 3HGYA 1VI0A 4U0VA 1YRNB 5ICFA 2DA6A 2LDUA 3PNYA 4XRSA 2IXSA 3I5UA 4HDVA 4A3DJ 1RIOH 2KLOA 4R8HA 2HQRA 4LGWA 1JT6A 2FBKA 1RPWA 1NG6A 1FP2A 2XVCA 3CUQC 2K4JA 2MABA 4XSZF 3K6GA 1VQPI 3OIPA 5CKTA 2LF8A 4XIDA 3CJNA 1XSXA 3MQ0A 5H20A 1UB9A 2V1NA 4JX4A 3VODA 3OL3A 4GGGA 4BUPA 3S2WA 4CYDA 5EEHA 1AKHA 2CFXA 2P6TA 1BIAA 2DMPA 4Z6YA 4HSTA 3R0AA 4ENNA 1AU7A 2AO9A 5BNGA 2FRHA 3B6AA 4U7DA 5ILSA 2Y30A 3HOWJ 3OS1A 1RR7A 1IO2A 2YU9J 1LFBA 1R5ID 2JZYA 3HB9A 4A0ZA 4QIWN 2JWTA 1CF7A 3REOA 3GTKJ 3HJEA 1EF4A 4DGWB 2HYJA 2LY1A 3CCEI 4E7IA 2GXAA 3JSOA 4XKWA 5LRRA 2X51A 1FNNA 2VN2A 4ZTJA 3G3ZA 2L9SA 2E34A 1B1BA 2JUGA 3TGNA 2VQGA 2ZMEA 4Y13A 1RI7A 3J7AY 1A04A 3LWFA 5F64A 3ZP5A 1B8IA 1BI0A 4S04A 1PDNC 4KIGA 5CJ9A 4HZFA 4IL6C 3A0BC 1D8KA 4CDGA 2HOTA 1X58A 3HPHA 1IC8A 2LD5A 2P8TA 1STZA 5IT9K 1OCOH 4ZZLA 4EM0B 2BXZA 2KPMA 3K69A 5DM6F 4L5IA 2YU3A 1Z7UA 4OMZA 3T8RA 5IP7J 2QQ9A 1W5TA 1YX3A 4RAYA 4LLGF 1LQ1A 2HQAA 3JAMK 3OYMA 2BBYA 1JKPC 3GTJJ 1IV8A 1U8BA 1K4SA 4L18B 2L5QA 3MKYB 2EH3A 1N78A 1X1AA 2QYOA 4I2OA 1P7JA 2PBIA 2BYVE 1H9TA 2VXZA 3GTMJ 1W5SA 2DFFA 3OYLA 4UHTA 3TQNA 1IXCA 2F48A 2HYGD 3RQIA 1LKXA 4QPOA 2W48A 3GLXA 2GWRA 4HSRA 3F8NA 1D1BA 2RV8A 2WA0A 3BC8A 5IPAA 1MSFC 1OCTC 3GYHX 5FO5A 2XDVA 4IQ4A 1HDDC 3GTQJ 4DQ2A 4D9JA 5HDKA 5M5WJ 2EK5A 1ETXA 2VUMJ 2CMPA 2R7VA 3E5XA 5TISC 2VOPA 2F4IA 4WXDA 3QP6A 2M0MA 4XR6A 1WJ5A 3PSFA 2ELJA 1F4KA 2CQXA 3H1CA 4HX7A 1T0FC 2L2OA 3MWMA 5KK1A 3OR1C 1IG7A 1RKWA 3F8FA 1T2KA 2GIVA 3TDUC 1XCVA 1PP7U 1GHCA 2G9WA 1TLHB 5CQGA 2DMQA 3BTIA 2V9PA 2OZ6A 3BTCA 1JE8A 4ABZA 2E1MB 4V2FA 4IHWA 3NAUA 4ENJA 2XC7A 3BP8A 3RYRA 4B1RA 4G6DA 3N97A 3E3VA 3FKIJ 3MCZA 3FKJA 2OQGA 5GPCA 2LKPA 4GFBA 4LLNA 4LB5A 1YIJI 4PSWA 3E5QA 4EV0A 5K5OA 4IRGA 3CP8A 2ZXJA 2DQRA 2OC6A 1WJBA 2XAFA 3SFIA 1DP3A 1W7PD 5IOYA 2Y75A 3L9FA 3CLQA 1I50J 4MEYF 4EM2A 3Q0VA 3EUKL 3I4MJ 1KU3A 3V8JA 2L7KA 2DDAA 3MAJA 2M87A 2NS0A 2ID3A 4M3FA 1S6LA 2OF7A 2O8XA 4I09A 1ETWA 4L9TA 2V26A 3HZJA 1DP7P 1TWGJ 3H36A 2IGKA 3S1NJ 2M2EA 1XGOA 1OJLA 1XGNA 1ON2A 4XM3A 1X1BA 5HS7A 1V55H 3JSPA 3MMYB 3ONQA 2XAGA 5M5XJ 1X2MA 2HXOA 2HWVA 3TO7A 5IYBJ 1P7IA 2DQLA 1R9TJ 4XBFA 2XRNA 3U2RA 3FMQA 3Q5FA 4B43A 2E2JJ 2XHKA 3L2CA 3A01A 1O4XA 3DU5A 1ENHA 1ZGJA 4Y3OA 4G7OF 4IRHA 3BG7A 1O3QA 3IWFA 2K27A 3ML6A 5ILVA 1Y56A 2I10A 4P9UA 1D1AA 1FBSA 3N05A 2PLYA 1Y1VJ 2MC4A 2DOAA 3GFMA 4FETA 3FK7A 2JMWA 5L3EA 4OIPF 3DBHB 5HLHA 3DLAA 4CH7A 1ZRDA 2P7VB 3HIFA 2PFBA 1MMSA 4KJZA 2KRHA 2EIMH 3K7AJ 4XLAA 3BZKA 1K6OA 5JLXA 2LMDA 1K83J 1VNDA 1FJLA 2DJNA 5D4SA 1T6SA 2H94A 4C9YA 5DYMA 1GUUA 2H1LA 3FIWA 2CQQA 3FM3A 2ME0A 2H09A 1ZQ3P 4MTDA 2O03A 2BW3A 1ZG5A 2DA5A 3UNGC 2AS5F 4J00A 1UHWA 2MGQA 3J80Z 1SD5A 4RM3A 2A61A 2R3SA 4KA4A 4LG0B 3FZVA 4B8XA 3CJRB 1IAWA 3WG7H 2R7SA 3Q9VA 5E8GA 5FB2A 2X6YA 2Z1DA 1VTNC 3L7WA 1A6QA 3KP5A 4IF4A 4M6YA 2HQ5A 1YLFA 3T5XA 3K2ZA 1XC5A 4HBLA 4BQNA 5GAGJ 3S3MA 1GLNA 3JTGA 5JVGF 2O9LA 3HSFA 1VQ6I 4ZDPA 1WI9A 2W24A 1R22A 2NVUB 4BQQA 5GP9A 4FTHA 1XMKA 3C1DA 2L9VA 3K10A 3RIRA 4BBSJ 1T95A 2KIFA 2EZIA 2JN6A 2PG4A 3PUBA 1EH6A 3S3NA 1IRFA 1FY7A 4ZYEA 5CPRB 4OAZA 2MD5A 3I53A 1XG1A 2IGNA 4BHPA 1ETYA 1YS7A 2E5NA 2O7OA 3OYAA 2ISZA 3QPTA 2K02A 2F5CA 4G12A 4I99C 5FFXA 5JHUA 2QLZA 2K85A 3KP3A 3OYBA 3MVPA 4BEHB 3V7RA 2ELKA 4S0HB 4L5EA 2VE9A 4RS8A 3F9KA 1J2XA 4D7MA 5HDNA 4HV5A 2DMTA 2LR8A 3C7JA 4G6TB 3HRTA 2OCCH 4UB8C 1QHGA 3OOUA 4P1WA 4YFXF 1B9MA 2P5KA 5C4JJ 2PX9A 1SD7A 2AXLA 3LFKA 5DTDA 5LBQA 5M5YJ 3AL0C 3HHHA 2X85A 2J5PA 5J3LA 1R58A 4DBQA 3CF5F 4I0BA 1BOBA 2Q1ZB 1W1WE 4WWCA 3UR3C 2J5OA 3N4MA 1ZGWA 2K9SA 4CCJA 4A6DA 1JTXA 3I4PA 4O6JA 5JFRA 3DEUA 4IEJA 4J19A 5EJCA 1YE9A 1X1CA 2CG4A 1YHQI 2OUMA 2XPVA 3G73A 2FQ3A 5JVTA 1TWAJ 1J7KA 5IT9Z 4RA2A 4RB0A 4A3JJ 4F92B 3H0DA 1YOVB 1LEAA 2D2WA 1R5HA 3HBLA 2XGEA 5CVJA 3BR5A 1MBFA 4IHSA 3CJTB 3TKYA 1OCRH 3IAS2 1KQ9A 2I8DA 4C3JJ 1P4XA 4DJAA 2V9VA 3BZ6A 5JHFA 4EM1A 1XMAA 2A6HF 4WCGA 2X48A 5K5RA 5EEGA 2NNNA 1T08B 1S7EA 4BU2A 4HNUA 4PSXA 4ZYDA 3BROA 1LDJA 2M45A
chains in the Genus database with same CATH topology
3KX2A 2LBFB 3DPUA 2E60A 3LSHA 4PJJA 4KT6A 1ZELA 2X6WA 5FROA 2HZDA 2WY7Q 3GBGA 1N75A 2ZFUA 2WBMA 1X19A 2CS3A 3NWTA 3S3OA 4MLOA 4B44A 4CCNA 4XLFA 4RLFA 4XLEA 3BCAA 2ZXIA 1D0ZA 1DGWY 4BJ6C 2R7UA 3ZGKA 3OYKA 4ZJZA 2M7BA 1WFXA 3PJRA 3HUGB 2Q2EB 4XLCA 3BG6A 2LC2A 3QODA 3OWTA 4YRVA 1QU3A 1Z3YA 3H35A 4BE1A 2R7OA 2VB6A 3VYRB 4F52A 1N77A 4NNJA 4E7HA 1P9QC 2PMZA 3EPZA 3K4MA 2VKDA 4J01A 2VJIA 4N4NB 2CV0A 5KCMA 2JVHA 4U87A 5HOOA 2M4KA 2K9MA 3K4JA 3C2HA 4XN0A 3CMMA 3LMMA 4PUSA 3L2WA 2A6TA 3OR2C 3OYJA 2VPLA 4PK4A 3OYFA 3RCOA 4LIUA 2CW7A 2MD0A 5HNFA 1MW7A 2BOLA 2KDOA 2ZXHA 2WB1A 4GRIA 2K5CA 4AU7A 2QKMB 4HNTA 3DEEA 2V9KA 4ITVA 4NQWB 2VQLA 4DOZA 1DGRM 2AQEA 5KHDA 2R7XA 4HRIA 2VJ4A 4C30A 2JVGA 2VLAA 3LSGA 3OYHA 3K4CA 4ZC3A 4XKBA 2V7FA 3D5SC 2IGMA 4F91B 1D1CA 2LRDA 2PJRA 2VXDA 3RQ4A 4EATA 3LSMA 1DQUA 3OYEA 3PNYA 1X4OA 3DTKA 4ZYAA 2KHMA 2W82A 2VL8A 3OYCA 2IXSA 2KLOA 2F5VA 4IQJA 3E0JB 2CUJA 2CFOA 2M3AA 4KISA 1NG6A 3OS2A 3QYBA 2R7TA 2MABA 3K6GA 2IS6A 3OIPA 5CKTA 1MNEA 4BL0B 2XSJC 4ZDLA 3PL8A 2V1NA 3RTRA 2X6XA 1D0XA 3OL3A 4PJNA 4BUPA 4E7KA 2ZSHB 4E7SA 3ZRGA 2Z2SB 4ZTFA 4LG3A 1LFPA 3M1CA 3DU6A 4II2A 4HSTA 1OR7C 3CESA 2CV2A 1UAAA 4P5OA 3OS1A 3VYUB 1BR4A 3W2AA 2E1MC 5LFAA 3FBNB 2GOMA 1BR2A 1TT0A 3E1SA 3LSIA 4DGWB 2LY1A 4E7IA 1WJEA 4XKWA 3G2BA 2VASA 3I3LA 2X51A 2VKHA 5HLTA 4ZTJA 4CA0A 4C2UA 1V5EA 2WAEA 2L9SA 1FMWA 4Y4RA 3BCBA 3W3CA 3S93A 2W1OA 4XNFA 2PJRB 2JUGA 2VQGA 3FHNA 4ZDOA 1QHHD 3K70C 5CQEA 3J7AY 4B48A 4BXFA 2VJJA 3HPHA 2JSPA 2VIXA 2QKLB 2F6CA 2KPMA 4H4KC 1YX5A 2IS2A 5HVQC 2LG4A 2UUZA 4II3A 3OYGA 2HPIA 3HXLA 1E0EA 1MMNA 1YX3A 2R7WA 4XQFA 3AKZA 4HEA2 2HQAA 3OYMA 1WJFA 2GOXB 3RSNA 2L5QA 3MKYB 1N78A 2DCEA 1X1AA 2WAQA 3KEYA 3PNTA 3A2KA 3NWSA 2OV7A 2Y0SA 2VXZA 3OIQA 1U0JA 3H5AA 3OYLA 3H5NA 3OMYA 4BDYA 3K4NA 2CW8A 2R7QA 1K6YA 1LKXA 4QPOA 4CSWA 4HSRA 2HVQA 1D1BA 2WA0A 3BC8A 3U21A 4LITA 4BE2A 5LD2C 3TMOA 2XDVA 4IQ4A 4B3XA 1J09A 3SEQA 3S8PA 1UG0A 4PJLA 4D9JA 1Z3XA 2V6EA 3A4CA 4C2TA 2CMPA 2R7VA 3ZCOA 2XF5A 2F4IA 2M0MA 4XR6A 1WJ5A 3PSFA 2ELJA 2HDWA 4IX7A 1T0FC 2L2OA 4CZCA 2K9LA 3D5RC 1FMVA 3OR1C 1W36D 3L2VA 1V5GA 2LOOA 4N4OB 2VQHA 3VSKA 1SFKA 5CQGA 2HVSA 4FASD 3K70D 1LVKA 1PYVA 2E1MB 4XL9A 3DKYA 1WJCA 1MMAA 2XC7A 3DKXA 3EUHC 3FKJA 1MMGA 2P0WA 4PSWA 3VSLA 3AFHA 3VYTB 3V42A 3L2QA 3CP8A 2W4SA 2OC6A 1WJBA 4DBRA 1DP3A 2KL4A 1AA7A 3H9QA 3IAM2 3HG9A 3EUKL 4D1QA 2L7KA 2HU9A 1G59A 4HPQA 3SDBA 2R4GA 4YEJA 2UV1A 3M8JA 3ZR8X 1G8XA 4BJTA 4XONA 3OL4A 3CF2A 1TZLA 1V5FA 2V26A 3QYFA 4AVZA 2RREA 3HOTA 2IGKA 4ANJA 4XM3A 1OLTA 1X1BA 3HPGA 1MNDA 1VZ0A 3D5LA 3MMYB 3ONQA 2KMUA 2WADA 2KRCA 3ZQQA 2BVMA 1S9HA 4RLQA 4F55A 4XLHA 4DIQA 1Y6IA 4B43A 3TL4X 4RMNA 3DU5A 4NC8A 3H5RA 2FUG2 4Y3OA 1ERDA 3A1YA 3BG7A 2K3PA 3H9GA 3PSIA 3LL7A 4XN3A 2LH9A 1Y56A 1D1AA 4CCMA 1LDKB 4QPQA 2VJ5A 3N05A 1HA8A 4BACA 4PFPA 3EUAA 2MC4A 1BR1A 4E6KG 5KNLA 3BLYA 2DOAA 4FETA 4OWRB 3RPUD 3DLAA 4CH7A 3L2UA 3ZXSA 4XOPA 1NG7A 1PJRA 4AYBA 2KP6A 4XOTA 4KJZA 4NUBA 2KRHA 4XORA 2HPMA 4CCKA 2IS4A 2XF6A 4XLAA 2KZVA 4B47A 3FBIB 4E7JA 3IUOA 1WJDA 2DXIA 2Z16A 4C9YA 3K4LA 2LREA 3I9V2 3IP4B 2R7RA 2X1DA 3H9JA 4BS9A 3MKWB 4PJMA 4Y33A 2L9NA 2O5RA 2BW3A 3FDYA 4E4HA 1X1DA 3UNGC 4J00A 2KQRA 1SAUA 4RM3A 3OY9A 1X4PA 3CP2A 4CCLA 3CJQB 3CJRB 2R7SA 5FRMA 3DPTA 2X6YA 2Z1DA 3OYIA 1UELB 3OYNA 3S3MA 4BQNA 2CUZA 1GLNA 3C2GA 2WAFA 3LFUA 2DT6A 4LIVA 1MMDA 4KITB 2W7NA 2M4GA 4XMYA 3VWBA 4ZDPA 1Z7LA 4BEHA 2E5ZA 4BQOA 4BQQA 3DTEA 3K10A 3K4KA 4E7ZA 1T95A 3PUBA 3S3NA 2IGOA 4CUGA 3OS0A 5CPRB 4OAZA 3HKZA 4XKCA 5FRNA 2IGNA 3HL2A 2E5NA 5HNHA 2IS1A 2MFZA 3OYAA 3L2RA 2BVLA 2W00A 2LY2A 2UWMA 1R6RA 1IRXA 4IKFA 4F3QA 4CCOA 4BEHB 3OYBA 1KONA 4YELA 2NOJB 2A5WA 2CV1A 3KYLA 3F9KA 4XKVA 3HC7A 4G6TB 3CZ6A 2M7AA 1QHGA 3OOUA 4HG2A 4P1WA 2LBFA 4PFOA 1D0YA 4OAYA 1Z21A 3W2VA 2WY8Q 3AL0C 2LYCA 3DQVC 2X85A 3S32A 4DBQA 1BOBA 3SYTA 4E7LA 2Q1ZB 3UR3C 3SZGA 3QOEA 2RQQA 4CCJA 1W36C 2DJIA 3HOSA 1EA3A 2X1EA 3PFYA 3AL0B 4X0GA 2X1CA 5TGTA 2BW3B 2CH0A 2DT7B 1YE9A 1X1CA 3QYEA 2OUMA 2JA2A 3MD2A 3LSKA 2RNGA 4RM2A 4R79A 3SEZA 3OYDA 2XF7A 4U7BA 2ZSIB 4F92B 3H0DA 3TBIA 3DWLE 4JOMA 3K4BA 3IAS2 2I8DA 3DTIA 4DJAA 4BGDA 3DPLC 5JHFA 2HVRA 3MKZA 3VDXA 4BE0A 1WJAA 3VYSB 1JI8A 2XAUA 4JQFA 4BJ5C 4BU2A 4HNUA 4F93B 4IZZA 2V4JC 2VQCA 2MYSA 4PSXA 4BDZA 2AQFA 3W2WA 2HNHA 3PNVA 4NC7A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2M0M A;  2KHM A;  2MAB A;  2K3P A;  2MFZ A; 
#chains in the Genus database with same CATH topology
 2FEZ A;  3RDI A;  3QU6 A;  2LBF B;  3KEO A;  4MTE A;  3RI4 A;  2X6O A;  1W0T A;  4KT6 A;  4C2M J;  1ZEL A;  2DN0 A;  2L54 A;  5HDG A;  4DW6 A;  3BG5 A;  5FRO A;  1FOW A;  1SVM A;  1S72 I;  3GUD A;  1MBE A;  2ZFU A;  4RB3 C;  3OSF A;  1VQN I;  3EQL F;  3GTO J;  2PN6 A;  3PFI A;  1P4A A;  4RLF A;  3Q0W A;  3TO9 A;  1S29 A;  1JUP A;  2STW A;  4ZYG A;  3BCA A;  3R4K A;  5J8F A;  2ZXI A;  1MBK A;  3OYK A;  3H3V K;  2M7B A;  2C6Y A;  3F3X A;  3BG3 A;  4M3G A;  1TP4 A;  3HUG B;  1TQI A;  4JYK A;  4RAF A;  1QBJ A;  3BG6 A;  1BW5 A;  3HRM A;  3HHG A;  5EG0 A;  2RN7 A;  4ZZD A;  2KDZ A;  2A68 F;  4LJZ F;  2R7O A;  3VYR B;  3OV8 A;  2V1D A;  1P9Q C;  3EPZ A;  1QGP A;  1KU7 A;  2ME6 A;  1LE8 A;  3ERM A;  1OYY A;  4IHY A;  3KYD B;  2RNJ A;  2HTJ A;  2ISY A;  4W97 A;  3HRS A;  3HDD A;  2Y48 A;  1E2X A;  3S1Q J;  3K0L A;  3LMM A;  1PUF B;  4PUS A;  3HOV J;  3L2W A;  2A6T A;  4PK4 A;  3OYF A;  4IOA F;  2D1H A;  2MC3 A;  5E1X A;  4ESF A;  1U3E M;  3IRQ A;  2HFH A;  3ZQ7 A;  2CU7 A;  2KDO A;  4FE4 A;  3F6V A;  4KN4 X;  2KFD A;  4B3A A;  3CD6 I;  2WB1 A;  3GEZ A;  4A5N A;  2K5C A;  3COA C;  2QKM B;  3SFZ A;  4HNT A;  3HRU A;  1OKR A;  3F8M A;  4DOZ A;  2E7W A;  5K1Y A;  3F22 A;  5KHD A;  1YG2 A;  3PIO F;  3GO5 A;  1IJW C;  3LSG A;  3OYH A;  3CC7 I;  2G7H A;  2B9S A;  3CCS I;  5FLV A;  1D1C A;  4BXX J;  1ZTR A;  5D6E A;  1H8A C;  2VXD A;  2XRL A;  1T0F A;  1FIA A;  2PMU A;  3LSM A;  1MNM C;  4C3I J;  1DQU A;  3OYE A;  3S2D J;  4ZYA A;  2KHM A;  2W82 A;  2VL8 A;  5L3B A;  1WCM J;  4AVP A;  5GPA A;  3JRE A;  3E0J B;  2CUJ A;  1GVJ A;  2B63 J;  2CFO A;  2M3A A;  2XPW A;  4OOI A;  3OS2 A;  3QYB A;  2EFP A;  1BI3 A;  2LTP A;  2IS6 A;  1MNE A;  4BXU A;  2XSJ C;  3PIP F;  2NS7 A;  1IF1 A;  3EUH A;  4FE7 A;  4AD9 A;  3UKG A;  4PJN A;  1D0X A;  4HYE A;  5HOD A;  4E7K A;  4FCY A;  2VC1 A;  1EH8 A;  2Z2S B;  3M8E A;  4O5V A;  4QTR A;  5E1Z B;  4WXH A;  3M1C A;  3DU6 A;  1M1E B;  2WC2 A;  4Q47 A;  4B4C A;  3DP7 A;  3RZO J;  3A01 B;  1G2H A;  1Y8Q B;  1SFE A;  1SVO A;  5DD8 A;  3TED A;  1BR4 A;  5EZH A;  3TOB A;  3W2A A;  4A3M J;  4IHT A;  2KKO A;  5LFA A;  3FBN B;  1JHF A;  5JR3 A;  1BR2 A;  3LSI A;  3W6J B;  4CZZ A;  5E20 A;  3ZMD A;  1FBQ A;  1YQA A;  1FYL A;  1WJE A;  1YJW I;  3G2B A;  4AWX B;  2VAS A;  3I3L A;  5DCM A;  4AYB N;  3NAR A;  4CA0 A;  3LQQ A;  1V5E A;  2WAE A;  1WI3 A;  4Y4R A;  4IHX A;  1RNL A;  2W1O A;  3A03 A;  1UCR A;  3ROU A;  1TL8 A;  5FKL A;  4JX6 A;  3WHC A;  5F1J A;  3F23 A;  3FHN A;  1QHH D;  2XKO A;  1VQ4 I;  4L9N A;  3Q3S A;  5K7F A;  4D5C A;  3QPH A;  5D5X B;  5M3F J;  1NH3 A;  2DU9 A;  2JSP A;  2VIX A;  2QKL B;  5IY5 H;  3KZI C;  4H4K C;  4HQE A;  1YX5 A;  5HVQ C;  3FXU A;  2FQ4 A;  4UUS A;  2UUZ A;  2JA5 J;  2OA4 A;  1F43 A;  3AKZ A;  3GZN B;  5A2Q Z;  1Z05 A;  2XV4 S;  1T98 A;  4LOC A;  5DM7 F;  3I4N J;  3ESW B;  2ZME B;  2MA3 A;  2AXT C;  2JT1 A;  3C3W A;  2TDX A;  1ZRE A;  2NS8 A;  2DOF A;  3TP0 A;  3AAF A;  1NK3 P;  1IUF A;  4DZP A;  5ICC A;  1T33 A;  2CQK A;  3KEY A;  1RUN A;  3GTG J;  3PNT A;  4AIJ A;  3A2K A;  2LLK A;  3GVA A;  4BY1 J;  2ZME C;  4CYC A;  2D1V A;  3H5A A;  1BJZ A;  3OMY A;  3X2Q H;  4BBR J;  4A12 A;  3KLN A;  3QQA A;  3JRA A;  5ERI A;  1YO5 C;  5F04 A;  4CO8 A;  2JRT A;  2K9Q A;  1POG A;  3U21 A;  5GAH J;  2O3F A;  4BE2 A;  5LD2 C;  3TMO A;  2KT0 A;  4LFU A;  2HKO A;  2BXY A;  4B3X A;  2HYF A;  2O0Y A;  1A35 A;  3S8P A;  2ESN A;  3D0S A;  3MZY A;  3P5J A;  1FYK A;  2BHY A;  2L7M P;  1MJ9 A;  3HGG A;  5JI6 A;  3HOZ J;  2VON A;  1GDT A;  3IKV A;  3J7A O;  2VOD A;  2O61 A;  5F0C A;  1OMI A;  2OBP A;  2K9L A;  2VBX A;  3D5R C;  3L2V A;  1OFC X;  1TNT A;  1ZK8 A;  2LOO A;  2O6G E;  3ULQ B;  2Q0O A;  2EFW A;  4N4O B;  1E3O C;  4JP0 A;  1IN6 A;  2B7E A;  3VSK A;  2Y31 A;  2H6C A;  3H0G J;  2XB0 X;  1LVK A;  1PYV A;  1YRN A;  1TQP A;  4XL9 A;  5J47 A;  3GFI A;  2Z3Y A;  4M71 A;  1MMA A;  1QO0 D;  3DKX A;  3HKZ N;  1HKT A;  1MMG A;  2KIM A;  3JTH A;  4NQW A;  3I56 I;  1E3P A;  1WPK A;  3V42 A;  2W4S A;  3GWZ A;  4MGR A;  4XRS G;  5FKN A;  4MFE A;  1LNW A;  1G6N A;  4JK1 X;  1AA7 A;  3BZC A;  4M3E A;  3HG9 A;  2FU4 A;  1G59 A;  1ETO A;  4HPQ A;  5BPD A;  1JXS A;  2IJL A;  4YEJ A;  3ZR8 X;  4R1H A;  5L3F A;  3CC4 I;  5M3M J;  2DPU A;  1HDP A;  1TZL A;  3CF2 A;  5HS8 A;  3BOQ A;  3QYF A;  4AVZ A;  4DYR A;  1QVT A;  4MHG A;  1UZC A;  3L09 A;  4AID A;  5B66 C;  1DPR A;  1MND A;  5AIQ A;  2NVX J;  3TW6 A;  3BPX A;  2FJ1 A;  4HNV A;  2KMU A;  1Q1H A;  3ZQQ A;  4S05 A;  5F6F A;  3L1P A;  3AG4 H;  5HLI A;  1XCB A;  4HQM A;  1Y0N A;  1XPX A;  1GVD A;  2EQR A;  1F1Z A;  3TL4 X;  1QPI A;  4RMN A;  3PUF A;  2EJR A;  4KIB A;  2QA4 I;  4MQV A;  3MZH A;  4L9J A;  2OD5 A;  2FUG 2;  3H5R A;  1R71 A;  1ERD A;  3A1Y A;  3GZ5 A;  1IN8 A;  3FM5 A;  2K3P A;  5TJJ A;  2LH9 A;  2PMH A;  1QA6 A;  2MSY A;  2JPC A;  2DAO A;  3BR2 A;  1LDK B;  3V8L A;  3CCJ I;  5FLX K;  2P5V A;  5IOZ A;  2YUS A;  4XRF A;  3WTW C;  3W6V A;  2MLG A;  1IV6 A;  2R92 J;  1BR1 A;  1A31 A;  1WH7 A;  4OWR B;  4M72 A;  1VFC A;  2F4M B;  4GYG A;  3RPU D;  3S1R J;  1IGN A;  4XOP A;  1PJR A;  1XN7 A;  3F21 A;  2KP6 A;  1QZE A;  1ETK A;  4UV9 A;  5HLG A;  3I54 A;  3HSR A;  4E7J A;  2NVY J;  3IUO A;  2Z16 A;  3JRB A;  4L0Y B;  4HOB A;  1K61 A;  4UUV A;  2KIS A;  1S5L C;  3FIS A;  3H9J A;  2NRA C;  3MKW B;  4Y33 A;  2L9N A;  2O5R A;  4EJT A;  3ZPL A;  5GTH C;  5J1R A;  2P7C B;  5D4R A;  3JCU C;  1YJ9 I;  3J7Z I;  3OY9 A;  3GF2 A;  2FNA A;  2W84 A;  3E5U A;  3OOP A;  3B6C A;  5FRM A;  3DPT A;  5D5W B;  3ABL H;  1FSE A;  2EB7 A;  3B02 A;  1JGG A;  2CUZ A;  3I55 I;  3JRI A;  5ICG A;  1LE8 B;  2WAF A;  3LFU A;  2DT6 A;  4LIV A;  1MMD A;  2FMY A;  4N9I A;  4HAM A;  1DUX C;  1OR7 A;  1L3L A;  2L0K A;  1V3F A;  2DFE A;  1TBX A;  2P4W A;  4OIQ F;  1R00 A;  3FMR A;  3DTE A;  1L0O C;  5BMZ A;  2BY2 A;  3CDL A;  2DMN A;  5FD5 A;  4N9H A;  1SFO J;  1IRG A;  4CUG A;  2HGC A;  5EZG A;  4IRI A;  1ONV A;  1ZKG A;  5B1A H;  2L7Z A;  1IXR C;  5CVI A;  3HL2 A;  2E2I J;  2BVL A;  3EYY A;  2W00 A;  3CCL I;  2Q8K A;  1SMT A;  2LY2 A;  3LA3 A;  4C3H J;  1IRX A;  3S15 J;  3DF8 A;  3VEP A;  2YR2 A;  1ZLJ A;  3T0Y A;  3ZQG A;  3Q0U A;  4KIC A;  4ENK A;  3KET A;  2NOJ B;  3RPQ A;  4O3M A;  2X4H A;  3O8G A;  1R1V A;  5D5U B;  4XKV A;  4ENM A;  3FXL A;  3CZ6 A;  4IPA A;  4OMY A;  2OPT A;  3ZQC A;  4Q48 A;  3DCF A;  3ZQF A;  3O3K A;  2ZJQ F;  1TWF J;  1HOM A;  1R36 A;  4GDF A;  3IC7 A;  1P6R A;  4KNY A;  3FXQ A;  4OAY A;  5E8I A;  1Z21 A;  3QPS A;  1ORK A;  3DKW A;  2KJC A;  1YW7 A;  3VOE A;  4KFC A;  1V4R A;  1CQT A;  5D5V B;  3QOE A;  2DJI A;  2YX4 A;  3E6M A;  1VQ5 I;  4V19 K;  3AL0 B;  2X1C A;  3H92 A;  5TGT A;  2W85 A;  1RKT A;  1JKO C;  1FZP B;  4XRM A;  3G1O A;  2EFO A;  1X3W B;  2EZK A;  4OIO F;  1ODD A;  2JA2 A;  3OYD A;  1IW7 F;  4AIK A;  1WKM A;  3WU1 B;  3CUQ A;  5F08 A;  5EDN A;  3S2H J;  2CRG A;  4RGU A;  3ZN0 A;  2K9N A;  1BI1 A;  5L3C A;  5ICE A;  4BGD A;  5D8L B;  3ZQI A;  1P4W A;  3B73 A;  1Z77 A;  2R5Y A;  2HVR A;  3VDX A;  1SD6 A;  4BE0 A;  1J0R A;  1WJA A;  3C18 A;  3VYS B;  1ZN2 A;  4M6V A;  2QWW A;  4D7N A;  5ED4 A;  4F93 B;  4IZZ A;  1JTY A;  5CLS A;  3LNQ A;  2VQC A;  2MYS A;  1UST A;  4GCV A;  2XRO A;  3RKQ A;  3IKT A;  2HNH A;  3H3U A;  3OIO A;  3E6B A;  4NC7 A;  3KFW X;  4HLY A;  2R0Q C;  5LGU A;  1SC7 A;  1ZAO A;  2E60 A;  3DPU A;  4WXC A;  4CXF A;  4KMF A;  3WU0 A;  1SD4 A;  2X6W A;  3LST A;  2N8G A;  1N75 A;  2WBM A;  4P55 A;  4HV6 A;  4MLO A;  3OSG A;  3A02 A;  2M8G X;  3TOA A;  2WTE A;  2Y69 H;  3ISP A;  2LVS A;  2VI6 A;  3M1E A;  1AWC A;  3BR3 A;  1D0Z A;  1MJB A;  2ZJ2 A;  4ZJZ A;  5EYR A;  2M0C A;  2Q2E B;  4XLC A;  1N25 A;  2CYY A;  1KU9 A;  2VBW A;  4HX8 A;  2JA8 J;  2LC2 A;  2XAQ A;  2LK2 A;  4KDP A;  3OWT A;  4IJA A;  1Z3Y A;  5H2F C;  5HS9 A;  1IZ1 A;  4F52 A;  1OCP A;  3K4M A;  4RAZ A;  5DUK A;  1PP8 F;  1IDY A;  4U0W A;  4N4N B;  4L9V A;  2L4M A;  3WGG A;  4EEF G;  4U87 A;  1B72 A;  3JRD A;  1FBU A;  1T8I A;  1MJA A;  3C2H A;  1B8I B;  2KZG A;  3CMM A;  4A3L J;  1D5Y A;  2ZNY A;  3OR2 C;  3OYJ A;  1NK2 P;  1YW9 A;  3RCO A;  4LIU A;  2OTJ I;  2CW7 A;  4EJO A;  4KYW A;  5DCM B;  3QAH A;  1FPQ A;  1BOA A;  1W4M A;  2QF7 A;  2ZXH A;  4LD5 A;  1I3A A;  5CVR A;  2QSH X;  3EET A;  4JX5 A;  1QNT A;  3H3Z A;  3DEE A;  4BY7 J;  4ITV A;  1K7A A;  3E6D A;  1DGR M;  4FX0 A;  2JSC A;  2AQE A;  2TRT A;  2E7X A;  3BR6 A;  3E97 A;  4KUM A;  3F8B A;  2V6C A;  1MDM A;  2LSO A;  3HUG A;  4F91 B;  1KA8 A;  5JLW A;  3ERE D;  1O57 A;  3T1B A;  3TP3 A;  3RQ4 A;  4EAT A;  1QZY A;  1REP C;  1OIS A;  3FXK A;  3FX3 A;  4G94 A;  3ZQL A;  1XDS A;  1F9N A;  2XIG A;  3RJP A;  1AOY A;  2ELH A;  2QQB A;  2DOD A;  2F5V A;  4IQJ A;  1RC9 A;  1UFM A;  2DA4 A;  1Q1V A;  2R7T A;  5LGN A;  2EZH A;  4M74 A;  4BL0 B;  3EDP A;  1S3J A;  4ZDL A;  3PL8 A;  4HLX A;  2QSG X;  2EIL H;  2QSF X;  2RDP A;  2DFI A;  1DPU A;  5BOX A;  2DA2 A;  2XUB A;  3ABM H;  3AG2 H;  1J75 A;  2HEO A;  3U9G A;  4II2 A;  2DYS H;  2XGX A;  1OR7 C;  4X1E A;  3FHZ A;  3CMA I;  1ZHF A;  1AHD P;  2VKE A;  3VYU B;  3ECO A;  4CHU A;  4RB2 C;  2DYR H;  1TNS A;  3QRF F;  3P9K A;  2E1M C;  3ASN H;  1HW2 A;  4YFN F;  1GV2 A;  3E1S A;  3G6E I;  4CYC B;  2PJP A;  1VQ8 I;  2MLK A;  1EV7 A;  3ABT A;  3C2B A;  5E79 C;  1UJ8 A;  2VKH A;  4KT5 C;  5D8K B;  3RKY A;  4C2U A;  2P6S A;  3GFJ A;  3BCB A;  3W3C A;  3S93 A;  4BYY A;  4XNF A;  1H0M A;  3NRV A;  2PJR B;  1G3W A;  5LHI A;  3HTS B;  1YYV A;  2X0L A;  4ZDO A;  5CQE A;  4MFD A;  2R7F A;  4BXF A;  2HOS A;  2BZT A;  1SVL A;  2DBB A;  2ZKZ A;  1Z6T A;  2K3F A;  4PCQ A;  2DTR A;  4I6Z A;  2M34 A;  2RAE A;  2WWY A;  2XGC A;  3I59 B;  5E3N A;  3FXM A;  2HOE A;  2G7U A;  2LG4 A;  3OYG A;  2HPI A;  3HXL A;  1SEU A;  2R7W A;  1QRY A;  1BL0 A;  2LP0 A;  3PQK A;  4A3E J;  3CME I;  4A3I J;  2O8K A;  4GXO A;  2IW5 A;  3RZD J;  2GOX B;  1DU0 A;  2ZBK A;  1YI2 I;  2DT5 A;  4HW0 A;  2DCE A;  2FOW A;  2EA4 A;  2VKV A;  4HF2 A;  1FLI A;  3NWS A;  2OV7 A;  4XLP F;  3OIQ A;  4FQG A;  1ZR4 A;  1U0J A;  1X3U A;  1FP1 D;  1A36 A;  1FC3 A;  2E71 A;  3BTL A;  3H5N A;  1G3T A;  4BDY A;  2CW8 A;  2L9R A;  2CUF A;  3CCR I;  1K6Y A;  4AUX A;  1KQ8 A;  3M4O J;  1HKQ A;  3K1N A;  3QP5 A;  2FML A;  2UXN A;  4LIT A;  4MEX F;  3WE2 A;  3SEQ A;  4PJL A;  4RDU A;  1Z3X A;  1X3Z B;  1WSU A;  3A4C A;  5E3M A;  2V6E A;  3WG9 A;  2BY1 A;  2HOA A;  3ZCO A;  1XTA A;  2EV6 A;  1DU6 A;  2MW8 A;  2CW0 F;  2H8W A;  4IX7 A;  3FF5 A;  3WHB A;  4CZC A;  4N0B A;  1WGX A;  1FMV A;  1V5G A;  4U88 A;  4M73 A;  3P7N A;  2QVO A;  3K1P A;  1BN5 A;  2IA1 A;  2VQH A;  2HZT A;  3DBL B;  2HVS A;  4FAS D;  5J4V A;  2GLO A;  2JRM A;  5IT3 A;  1WJC A;  1U8R A;  1U2W A;  4ASN A;  2XGD A;  2WB1 N;  1WVR A;  5FD6 A;  2EZL A;  2TCT A;  2YS9 A;  3G4S I;  2GZW A;  3AFH A;  1YTY A;  3VYT B;  1TQM A;  3HTU A;  1B9N A;  1IXS B;  3IV5 A;  1OPC A;  3L2Q A;  2IEK A;  1MGT A;  4NC6 A;  4KN7 X;  3O6B B;  2KL4 A;  3GTL J;  3H9Q A;  1Y0U A;  3IAM 2;  1W7P B;  1R7J A;  2DTZ A;  3EYI A;  5F0F A;  1E17 A;  2UV1 A;  1G8X A;  3AG1 H;  4FIS A;  3GX4 X;  3OL4 A;  4G8X A;  1TC3 C;  2RRE A;  3HOT A;  2NAZ A;  4BQA A;  1USS A;  3HPG A;  3FXJ A;  3CDH A;  5J4Y A;  3D5L A;  2HDD A;  1I39 A;  3F6O A;  2B0L A;  2H8R A;  2WAD A;  3V4G A;  3IL2 A;  3G1L A;  4EVI A;  1U5T B;  2LY9 A;  1S9H A;  1IUY A;  4F55 A;  2COM A;  4OU0 A;  3WTT C;  4XLH A;  4DIQ A;  1Y6I A;  3ZOB A;  3IRR A;  1LVA A;  2QM3 A;  1RUO A;  5E3L A;  3H9G A;  1X1P A;  3I64 A;  3KZY A;  4CCM A;  4Q4Z F;  2IBD A;  4AC0 A;  1JHH A;  3VB2 A;  2H6B A;  2VJ5 A;  1ZRF A;  1FIP A;  3JRH A;  1BJA A;  4BAC A;  1JKR C;  2XAJ A;  3S1M J;  3EUA A;  2HTS A;  1V54 H;  2COB A;  2HR3 A;  4EMS A;  2WV0 A;  3BLY A;  4NB5 A;  1P2F A;  1UG2 A;  2IPQ X;  1H89 C;  1A6I A;  2EIN H;  3L2U A;  2F5E A;  2QGU A;  1NG7 A;  4AYB A;  3Q9S A;  5ILU A;  1Z67 A;  4XOT A;  5J6X A;  2HPM A;  3GW2 A;  4CCK A;  4FX4 A;  2BHZ A;  2DW4 A;  1FYM A;  2K4B A;  1WJD A;  2DXI A;  2FBI A;  3K4L A;  1ZG1 A;  1RET A;  3I9V 2;  5BQT A;  1Y39 A;  2R7R A;  2WAQ N;  1E3H A;  1KQ0 A;  2Y9Z A;  3KEQ A;  4KIF A;  2A07 F;  1H88 C;  1R4N B;  2Y0S N;  3JRG A;  1HW5 A;  2K86 A;  3F8C A;  3SHF A;  1K79 A;  2EV5 A;  3GLL A;  2BGC A;  2KQR A;  4AIH A;  3I58 A;  3U1D A;  3CP2 A;  2HKX A;  1JGS A;  3CJQ B;  5E17 F;  3ECH A;  5GAE J;  4M6X A;  3LSJ A;  3R61 A;  2VBZ A;  1UEL B;  2EFQ A;  2FSW A;  3ASO H;  3OYN A;  2DA7 A;  1Z1D A;  3C2G A;  1S7A A;  4KIT B;  4EGY A;  1OYI A;  2BY3 A;  2DA3 A;  2W7N A;  2M4G A;  2GA1 A;  4XMY A;  1U9N A;  3CQZ J;  1Z7L A;  4BEH A;  2E5Z A;  2XAS A;  3MEX A;  1WHU A;  3JRF A;  5DS9 A;  1EJ9 A;  3CMY A;  4K2E A;  4E7Z A;  5KAF C;  2G0E A;  3NEU A;  5LLQ A;  1YFH A;  2JUC A;  5K7H A;  3M7G A;  5J8C A;  2IGO A;  4YG2 F;  1GT0 C;  2KJB A;  1ULY A;  2ZJR F;  4I01 A;  2HS5 A;  2IA0 A;  5FRN A;  2Z5U A;  2JJ7 A;  4Y52 J;  2ZO4 A;  3TO6 A;  5K5Q A;  2IS1 A;  1RES A;  2RQP A;  2ZXW H;  3CDI A;  3KPH A;  4GO1 A;  5B1B H;  2UWM A;  1O3S A;  2R93 J;  2ZJP F;  2A6E F;  4IKF A;  4F3Q A;  4CCO A;  1J5Y A;  1KON A;  2IA2 A;  4YEL A;  2LF7 A;  2DDB A;  1QQI A;  2CV1 A;  1G3Y A;  4I7H A;  3K2A A;  2XPU A;  3HC7 A;  2UXX A;  3CLO A;  1GXP A;  5CYV A;  2M7A A;  3HOY J;  4HG2 A;  5FGM A;  2LFB A;  2QBY A;  2M30 A;  2OQR A;  1HXD A;  2WY8 Q;  4LG0 A;  3S32 A;  1MD0 A;  1EKE A;  4A3C J;  1BA5 A;  3SYT A;  2NNY A;  1D3Y A;  3PO2 J;  3JAM Z;  4PDK A;  1EA3 A;  1KU2 A;  1Z9C A;  4M3D A;  1ZGA A;  2R7Z J;  2QUF A;  5IP9 J;  2DT7 B;  2ZC2 A;  3P9C A;  1FEX A;  4BKX A;  1SFX A;  3BJ6 A;  4RM2 A;  3SEZ A;  3CO6 C;  2XF7 A;  1VF9 A;  1BBY A;  2CQN A;  1WZ2 A;  3JR9 A;  4M3B A;  2OZU A;  3WTV C;  1ZLK A;  2ZB9 A;  1I1S A;  1OCC H;  4DYC A;  1FT9 A;  2EFN A;  3HOX J;  1DDN A;  1PUE E;  4JOM A;  3K4B A;  1VQL I;  4OIR F;  5LGT A;  5CVU A;  3DPL C;  5DUI A;  4YIF A;  3MKZ A;  4QLC U;  2VT2 A;  1U9O A;  1T38 A;  1R4M B;  3CCQ I;  2OJE D;  1JI8 A;  4JQF A;  1XB4 A;  1IDZ A;  2M9H A;  2V4J C;  3HEF A;  2IAI A;  4BDZ A;  1U78 A;  1B59 A;  1LUJ B;  3O8H A;  1I1G A;  5AON A;  1IN7 A;  5EG0 B;  3DEW A;  4A0Y A;  4G6Q A;  3VFZ A;  4P9F A;  1FOY A;  3RYP A;  3CCU I;  1QPM A;  3WTU C;  3E6C C;  4A5M A;  4EQQ A;  4D5F A;  2L01 A;  2Y2Z A;  3O2P E;  4BHC A;  1HQC A;  2MG4 A;  2HZD A;  2WY7 Q;  3GBG A;  3WE3 A;  2GM4 A;  1K4T A;  1X19 A;  3S3O A;  1JUS A;  4MIM A;  1UHM A;  2QZ8 A;  4CCN A;  4DZJ A;  4XLF A;  4UY8 I;  1SMY F;  4LMY A;  3BY6 A;  4XLE A;  2WV1 A;  4UVB A;  4A69 C;  4DNC A;  1BM9 A;  3BPV A;  3MKL A;  2VT3 A;  3J7Y J;  3F0C A;  1DGW Y;  3VPR A;  4BJ6 C;  3JRC A;  3I71 A;  3KP7 A;  3ZGK A;  2VPR A;  4X6A J;  3PJR A;  3U1K A;  2DK8 A;  2M8E A;  1WRJ A;  2AHQ A;  2RC4 A;  2R7D A;  3QOD A;  4XLN F;  1QU3 A;  3H35 A;  1ZYR F;  4BE1 A;  2VB6 A;  1N77 A;  4NNJ A;  1U5T A;  4XIC A;  4E7H A;  2NVT J;  2PMZ A;  3KCC A;  3LSR A;  5KAI C;  4V2G A;  1T56 A;  5KCM A;  3RKW A;  2M1B A;  2JVH A;  2KRF A;  5HOO A;  2R5Z A;  2IRF G;  1ITY A;  1ZH5 A;  3WU2 C;  3ZMZ A;  2A5Y B;  2BE5 F;  4OIN F;  1RZ4 A;  2EA2 A;  4PJ0 C;  1Z0X A;  1OYW A;  2VPL A;  1H9G A;  1TW3 A;  2CO5 A;  1BI2 A;  3KP2 A;  4RGX A;  1R5G A;  1MW7 A;  4QSH A;  4GRI A;  3KZZ A;  4AU7 A;  4MO7 A;  5LEJ A;  4H0E A;  1VQO I;  2VQL A;  4P96 A;  1HBX G;  2Z99 A;  1J9I A;  4G9Y A;  2E1O A;  2JA6 J;  5DV5 A;  2VJ4 A;  2L02 A;  3K4C A;  4XKB A;  3LA7 A;  4BAY A;  1HSJ A;  2LRD A;  5DEQ A;  2EIK H;  2HXI A;  3CUO A;  2CWE A;  2DI3 A;  1FTT A;  1R23 A;  1HST A;  2YSR A;  1LB2 A;  1X4O A;  3DTK A;  1MBG A;  1XMX A;  3OYC A;  5E1W A;  3FXR A;  5FKM A;  4LK1 F;  3SZP A;  5F1R A;  4A3K J;  1QVU A;  1PVE A;  2DLL A;  4KIS A;  3KYC B;  3IHU A;  3WTS C;  1ON1 A;  2VC0 A;  2QCO A;  3K1M A;  4NHJ A;  2EWN A;  3BR1 A;  2EV0 A;  1Z6R A;  3LAJ A;  4I02 A;  3RTR A;  4BH9 A;  2XSD C;  2P81 A;  2X6X A;  2ZNZ A;  2CUE A;  2ZSH B;  4E7S A;  3ZRG A;  3G71 I;  3GXO A;  1FOX A;  5FKO A;  2XAH A;  4ZTF A;  4LG3 A;  1FSH A;  1LFP A;  3BTJ A;  2E2H J;  1TTY A;  2BY0 A;  3CES A;  3TDZ C;  2CV2 A;  2CQ7 A;  2GQQ A;  4HDU A;  1G4D A;  1UAA A;  5EGO A;  3I59 A;  3GFL A;  4P5O A;  1D8J A;  1HCR A;  5CVV A;  1BC7 C;  3GTP J;  2RKH A;  3WTX C;  3AG3 H;  2GOM A;  5FFZ A;  1TT0 A;  1O3T A;  2H1K A;  4GYI A;  2IP2 A;  3ABU A;  3QWL A;  1XS9 A;  3LQR A;  1C0W A;  5HLT A;  4G7Z F;  2MH2 A;  1FMW A;  2M5W A;  3ABK H;  3GCM A;  3ZMT A;  1MIJ A;  5A2Q K;  3T8T A;  3CUQ B;  2PMZ N;  3V8K A;  1KYW A;  2PQ8 A;  1K78 B;  4BNC A;  5F0H A;  4ESJ A;  1WH5 A;  4UUS B;  3K70 C;  4B48 A;  2VJJ A;  3M3Y J;  3SDG A;  1FWZ A;  5GTI C;  2OU2 A;  1YIO A;  1P92 A;  3ZMU A;  4EJW A;  2V1U A;  3QOP A;  2F6C A;  3BR0 A;  2D5V A;  6PAX A;  2GXB A;  3MZ8 A;  3LOC A;  4PGH A;  2NOG A;  2IS2 A;  5BPI A;  1Z91 A;  3A0H C;  4II3 A;  4WK8 F;  5LRS A;  2ZCW A;  1E0E A;  1MMN A;  5DD4 A;  5H6Q A;  3SQN A;  1K78 A;  1ZAR A;  4RB1 A;  1JT0 A;  4XQF A;  2QQA A;  4HEA 2;  1WJF A;  2D45 A;  2GAU A;  1OCZ H;  4EJU A;  1PUF A;  2E19 A;  2R5Z B;  2QBY B;  3RSN A;  2WAQ A;  3WTY C;  3DV8 A;  2W57 A;  4ZH4 F;  2MBF A;  2LNB A;  2QQ8 A;  1B4A A;  1R1T A;  1XX5 A;  2Y0S A;  1TT5 B;  5IYD J;  2ACJ A;  1J59 A;  3K4N A;  2R7Q A;  4CSW A;  5DDG A;  1YS6 A;  2HVQ A;  3HM5 A;  3HSE A;  2Z9O A;  3LAP A;  1J09 A;  1TWH J;  1UG0 A;  1MDM B;  2L7F P;  1I6X A;  5KVR A;  4MNU A;  4C2T A;  1GXQ A;  5C44 J;  4NBQ A;  1MBJ A;  2XF5 A;  4LK0 F;  3IH2 A;  2F5D A;  2HDW A;  1NTC A;  4W1U A;  2QEX I;  5TRD A;  2FE3 A;  1W36 D;  2OCE A;  2EPF A;  3CO7 C;  4DYQ A;  1VQ9 I;  2L3D A;  4M9S A;  2FBH A;  1HW1 A;  1O7L A;  3R0J A;  1SFK A;  3K70 D;  1LEB A;  3TW7 A;  3CCV I;  3R60 A;  3DKY A;  4UNO A;  1OQY A;  3ZMV A;  1W0U A;  5F27 A;  2RGV A;  3EUH C;  2L4A A;  1YIT I;  4HX4 A;  3CCY A;  4UVC A;  4A6E A;  1KGS A;  3D1N I;  2P0W A;  3VSL A;  2FF4 A;  3S17 J;  5H6R A;  3HOU J;  2IT0 A;  1EH7 A;  1T39 A;  4DBR A;  3QPL A;  1JKQ C;  1HF0 A;  4XSX F;  2FA5 A;  4ETS A;  1XGS A;  4D1Q A;  5L3G A;  2HU9 A;  3M8F A;  3SDB A;  3CC2 I;  2R4G A;  3M8J A;  2DMU A;  3PQJ A;  4HA8 A;  4BJT A;  4XON A;  5C3E J;  4IO9 F;  1V5F A;  1FTZ A;  2KIU A;  3NQO A;  1UHS A;  4ANJ A;  3SJM A;  4YFK F;  3BT9 A;  3BJO A;  1OLT A;  1VZ0 A;  5AIP A;  5EEA A;  2A69 F;  1XSV A;  2KRC A;  5BS6 A;  2DK5 A;  1X2N A;  4IHV A;  2BVM A;  1ETV A;  1F5T A;  2ESH A;  3MN2 A;  4RLQ A;  1LDD A;  3V7C A;  4HF0 A;  1KZH A;  4I98 B;  4JBA A;  4Y17 A;  4PGG A;  1Y8R B;  4UVA A;  1R49 A;  4NC8 A;  3BQY A;  1JJ6 C;  4LLL A;  1YW8 A;  1APL C;  5C4X J;  1MBH A;  2FNP A;  3PSI A;  5L3D A;  1O7F A;  3LL7 A;  4XN3 A;  2VOO A;  4QPQ A;  2STT A;  1HA8 A;  4PFP A;  1SAX A;  5FLX Z;  4E6K G;  4ZYH A;  2EBI A;  5FKK A;  5KNL A;  4RGS A;  4A2U A;  3WOD F;  3ZXS A;  2V1X A;  2HI3 A;  1NHA A;  4NUB A;  1KYZ A;  4XOR A;  1B6A A;  2IS4 A;  2XF6 A;  3BG9 A;  2KZV A;  4B47 A;  3FBI B;  1ZRC A;  3FMS A;  5B3S H;  2XKP A;  2F4O B;  1MH4 A;  1TWC J;  4A3F J;  3IWZ A;  2LRE A;  2PEX A;  3ZN1 A;  4A93 J;  3IP4 B;  2JA7 J;  1I3Q J;  2X1D A;  4BHB A;  1O3R A;  2I5U A;  4PZJ A;  4BS9 A;  3LA2 A;  4NDL A;  4PJM A;  5LHH A;  3BQZ A;  5GAD J;  3FDY A;  1MH3 A;  1X1D A;  4E4H A;  4IOC F;  4AM3 A;  4TV7 A;  2E36 A;  2PI0 A;  3BDD A;  1YJN I;  4FHT A;  1SAU A;  2MH9 A;  1X4P A;  1U6G A;  4CCL A;  2R5Y B;  2ETH A;  3FXO A;  5D6F A;  1VQM I;  3GZ6 A;  1JJ8 C;  2X9D A;  1ACI A;  2K7L A;  2LKS A;  3OYI A;  2GBY A;  2H27 A;  1WWX A;  2P5L C;  4A3G J;  1ZR2 A;  1CGP A;  4CGZ A;  2OTL I;  3MFK A;  2W25 A;  2GIZ A;  1B72 B;  4UXN A;  3RPU A;  3VWB A;  1HKS A;  2E1N A;  3WGI A;  4Y7N J;  5FLM J;  4BQO A;  4EJV A;  3R6S A;  3DFG A;  3V7S A;  2VE8 A;  2JK3 A;  4YIR X;  5E18 F;  1CF7 B;  3K4K A;  1ZG3 A;  4MQ9 F;  1FX7 A;  2FD5 A;  5J1U A;  2DPD A;  4M9Z A;  4Y15 A;  2ZFW A;  3OS0 A;  3S16 J;  1ETQ A;  1XDU A;  3HKZ A;  4XKC A;  4G7H F;  1D5V A;  2Q2E A;  3DLL F;  4RGR A;  2Y9Y A;  4UB6 C;  2ECC A;  5HNH A;  1GV5 A;  2MFZ A;  3W6K B;  3L2R A;  2LKX A;  3WTZ A;  1R6R A;  2NXN B;  9ANT A;  3IH3 A;  2VBY A;  2ECB A;  1SFU A;  2A5W A;  2Y0M A;  3ELK A;  1RRJ A;  2DA1 A;  1MZB A;  2QEN A;  3KYL A;  4ESB A;  1MSE C;  3S14 J;  3BWG A;  4RBO A;  2ADU A;  2LBF A;  1LJ9 A;  4M9X A;  4PFO A;  4QWQ A;  3FWE A;  1D0Y A;  4D0P A;  3W2V A;  2LYC A;  3DQV C;  4IVN A;  1BC8 C;  5K7Z A;  1IN5 A;  1QZZ A;  4E7L A;  4UUT A;  3SZG A;  2EIJ H;  2RQQ A;  4LB6 B;  2YPR A;  2A05 A;  2XB5 A;  3J80 K;  3HOS A;  1W36 C;  3PFY A;  2X1E A;  1SAN A;  3CCM I;  2A3S A;  3DXJ F;  4X0G A;  2F5F A;  2BW3 B;  2CH0 A;  2IVM A;  3QYE A;  4ON0 A;  3LSP A;  2E1C A;  2CGP A;  1R1U A;  1XD7 A;  3MD2 A;  3LSK A;  2RNG A;  4R79 A;  2DO7 A;  1XGM A;  3IH4 A;  4U7B A;  5IYC J;  2ZSI B;  1IN4 A;  2ID6 A;  2JQ7 A;  1W7P A;  1BIB A;  3HYI A;  2JTV A;  3TBI A;  2GA2 A;  3DWL E;  4E70 A;  3GME A;  3DBR B;  1LPQ A;  3DTI A;  3G1M A;  3FK6 A;  5B5E C;  2NYX A;  1HLV A;  4I0A A;  2XAU A;  3L00 A;  4BJ5 C;  1HC8 A;  3I0T A;  2HQN A;  2DOE A;  5EGO B;  1JUM A;  2UZK A;  1S7O A;  5J40 A;  5EF6 A;  1G3S A;  2AQF A;  3W2W A;  3PNV A;  4UV8 A;  1XSD A;  3KIO A;  1IRZ A;  3KX2 A;  3J81 K;  2KIQ A;  4A3B J;  2RVC A;  1I5Z A;  2YX7 A;  3LSH A;  4PJJ A;  1AKH B;  3ZMS A;  4Q5S F;  4EGZ A;  3J81 Z;  5LHG A;  2CS3 A;  3NWT A;  2ICW G;  4B44 A;  5LEK A;  1BW6 A;  3F72 A;  4IXA A;  1I6H J;  1RR8 C;  4WF2 A;  2OAZ A;  4FT8 A;  4B09 A;  3KP4 A;  3BJA A;  3CTA A;  1TW2 A;  2R7U A;  1VQK I;  1UMQ A;  5DCF A;  2GXG A;  2DFH A;  2CSO A;  1WFX A;  5E3O A;  4CIC A;  4HF1 A;  2NVQ J;  4A0X A;  1MKM A;  4L5J A;  4Z2Y A;  4YRV A;  3SZT A;  2FX0 A;  2E35 A;  3SXY A;  3ZQH A;  4F7Z A;  4YII A;  2K40 A;  1WQ2 A;  5FJ8 J;  2VKD A;  4J01 A;  4U0Y A;  4KMU X;  2VJI A;  2CJJ A;  1VQ7 I;  2CV0 A;  2HDC A;  3M07 A;  3WGH A;  3QU3 A;  2M4K A;  3RKX A;  2K9M A;  3K4J A;  3KE2 A;  3KLO A;  5J1Y A;  4XN0 A;  1FOK A;  2FXA A;  1W5C C;  2Z33 A;  2MD0 A;  3KP6 A;  3JW4 A;  5HNF A;  2BOL A;  1S8N A;  2F2E A;  3K9T A;  4XK4 A;  5IP6 A;  4L0Z B;  2JPB A;  3M9A A;  3PO3 J;  2BV6 A;  2V9K A;  4NQW B;  3E7L A;  1A5J A;  4RAG A;  1LFU P;  3P9I A;  4I76 A;  1I27 A;  2BEO A;  4WX9 A;  4HRI A;  2R7X A;  2V79 A;  4C30 A;  2JVG A;  2VLA A;  3PM1 A;  1F36 A;  4ZC3 A;  2V7F A;  2FOK A;  2IGM A;  1U5T C;  3D5S C;  1Y1W J;  2PJR A;  3HGY A;  1VI0 A;  4U0V A;  1YRN B;  5ICF A;  2DA6 A;  2LDU A;  3PNY A;  4XRS A;  2IXS A;  3I5U A;  4HDV A;  4A3D J;  1RIO H;  2KLO A;  4R8H A;  2HQR A;  4LGW A;  1JT6 A;  2FBK A;  1RPW A;  1NG6 A;  1FP2 A;  2XVC A;  3CUQ C;  2K4J A;  2MAB A;  4XSZ F;  3K6G A;  1VQP I;  3OIP A;  5CKT A;  2LF8 A;  4XID A;  3CJN A;  1XSX A;  3MQ0 A;  5H20 A;  1UB9 A;  2V1N A;  4JX4 A;  3VOD A;  3OL3 A;  4GGG A;  4BUP A;  3S2W A;  4CYD A;  5EEH A;  1AKH A;  2CFX A;  2P6T A;  1BIA A;  2DMP A;  4Z6Y A;  4HST A;  3R0A A;  4ENN A;  1AU7 A;  2AO9 A;  5BNG A;  2FRH A;  3B6A A;  4U7D A;  5ILS A;  2Y30 A;  3HOW J;  3OS1 A;  1RR7 A;  1IO2 A;  2YU9 J;  1LFB A;  1R5I D;  2JZY A;  3HB9 A;  4A0Z A;  4QIW N;  2JWT A;  1CF7 A;  3REO A;  3GTK J;  3HJE A;  1EF4 A;  4DGW B;  2HYJ A;  2LY1 A;  3CCE I;  4E7I A;  2GXA A;  3JSO A;  4XKW A;  5LRR A;  2X51 A;  1FNN A;  2VN2 A;  4ZTJ A;  3G3Z A;  2L9S A;  2E34 A;  1B1B A;  2JUG A;  3TGN A;  2VQG A;  2ZME A;  4Y13 A;  1RI7 A;  3J7A Y;  1A04 A;  3LWF A;  5F64 A;  3ZP5 A;  1B8I A;  1BI0 A;  4S04 A;  1PDN C;  4KIG A;  5CJ9 A;  4HZF A;  4IL6 C;  3A0B C;  1D8K A;  4CDG A;  2HOT A;  1X58 A;  3HPH A;  1IC8 A;  2LD5 A;  2P8T A;  1STZ A;  5IT9 K;  1OCO H;  4ZZL A;  4EM0 B;  2BXZ A;  2KPM A;  3K69 A;  5DM6 F;  4L5I A;  2YU3 A;  1Z7U A;  4OMZ A;  3T8R A;  5IP7 J;  2QQ9 A;  1W5T A;  1YX3 A;  4RAY A;  4LLG F;  1LQ1 A;  2HQA A;  3JAM K;  3OYM A;  2BBY A;  1JKP C;  3GTJ J;  1IV8 A;  1U8B A;  1K4S A;  4L18 B;  2L5Q A;  3MKY B;  2EH3 A;  1N78 A;  1X1A A;  2QYO A;  4I2O A;  1P7J A;  2PBI A;  2BYV E;  1H9T A;  2VXZ A;  3GTM J;  1W5S A;  2DFF A;  3OYL A;  4UHT A;  3TQN A;  1IXC A;  2F48 A;  2HYG D;  3RQI A;  1LKX A;  4QPO A;  2W48 A;  3GLX A;  2GWR A;  4HSR A;  3F8N A;  1D1B A;  2RV8 A;  2WA0 A;  3BC8 A;  5IPA A;  1MSF C;  1OCT C;  3GYH X;  5FO5 A;  2XDV A;  4IQ4 A;  1HDD C;  3GTQ J;  4DQ2 A;  4D9J A;  5HDK A;  5M5W J;  2EK5 A;  1ETX A;  2VUM J;  2CMP A;  2R7V A;  3E5X A;  5TIS C;  2VOP A;  2F4I A;  4WXD A;  3QP6 A;  2M0M A;  4XR6 A;  1WJ5 A;  3PSF A;  2ELJ A;  1F4K A;  2CQX A;  3H1C A;  4HX7 A;  1T0F C;  2L2O A;  3MWM A;  5KK1 A;  3OR1 C;  1IG7 A;  1RKW A;  3F8F A;  1T2K A;  2GIV A;  3TDU C;  1XCV A;  1PP7 U;  1GHC A;  2G9W A;  1TLH B;  5CQG A;  2DMQ A;  3BTI A;  2V9P A;  2OZ6 A;  3BTC A;  1JE8 A;  4ABZ A;  2E1M B;  4V2F A;  4IHW A;  3NAU A;  4ENJ A;  2XC7 A;  3BP8 A;  3RYR A;  4B1R A;  4G6D A;  3N97 A;  3E3V A;  3FKI J;  3MCZ A;  3FKJ A;  2OQG A;  5GPC A;  2LKP A;  4GFB A;  4LLN A;  4LB5 A;  1YIJ I;  4PSW A;  3E5Q A;  4EV0 A;  5K5O A;  4IRG A;  3CP8 A;  2ZXJ A;  2DQR A;  2OC6 A;  1WJB A;  2XAF A;  3SFI A;  1DP3 A;  1W7P D;  5IOY A;  2Y75 A;  3L9F A;  3CLQ A;  1I50 J;  4MEY F;  4EM2 A;  3Q0V A;  3EUK L;  3I4M J;  1KU3 A;  3V8J A;  2L7K A;  2DDA A;  3MAJ A;  2M87 A;  2NS0 A;  2ID3 A;  4M3F A;  1S6L A;  2OF7 A;  2O8X A;  4I09 A;  1ETW A;  4L9T A;  2V26 A;  3HZJ A;  1DP7 P;  1TWG J;  3H36 A;  2IGK A;  3S1N J;  2M2E A;  1XGO A;  1OJL A;  1XGN A;  1ON2 A;  4XM3 A;  1X1B A;  5HS7 A;  1V55 H;  3JSP A;  3MMY B;  3ONQ A;  2XAG A;  5M5X J;  1X2M A;  2HXO A;  2HWV A;  3TO7 A;  5IYB J;  1P7I A;  2DQL A;  1R9T J;  4XBF A;  2XRN A;  3U2R A;  3FMQ A;  3Q5F A;  4B43 A;  2E2J J;  2XHK A;  3L2C A;  3A01 A;  1O4X A;  3DU5 A;  1ENH A;  1ZGJ A;  4Y3O A;  4G7O F;  4IRH A;  3BG7 A;  1O3Q A;  3IWF A;  2K27 A;  3ML6 A;  5ILV A;  1Y56 A;  2I10 A;  4P9U A;  1D1A A;  1FBS A;  3N05 A;  2PLY A;  1Y1V J;  2MC4 A;  2DOA A;  3GFM A;  4FET A;  3FK7 A;  2JMW A;  5L3E A;  4OIP F;  3DBH B;  5HLH A;  3DLA A;  4CH7 A;  1ZRD A;  2P7V B;  3HIF A;  2PFB A;  1MMS A;  4KJZ A;  2KRH A;  2EIM H;  3K7A J;  4XLA A;  3BZK A;  1K6O A;  5JLX A;  2LMD A;  1K83 J;  1VND A;  1FJL A;  2DJN A;  5D4S A;  1T6S A;  2H94 A;  4C9Y A;  5DYM A;  1GUU A;  2H1L A;  3FIW A;  2CQQ A;  3FM3 A;  2ME0 A;  2H09 A;  1ZQ3 P;  4MTD A;  2O03 A;  2BW3 A;  1ZG5 A;  2DA5 A;  3UNG C;  2AS5 F;  4J00 A;  1UHW A;  2MGQ A;  3J80 Z;  1SD5 A;  4RM3 A;  2A61 A;  2R3S A;  4KA4 A;  4LG0 B;  3FZV A;  4B8X A;  3CJR B;  1IAW A;  3WG7 H;  2R7S A;  3Q9V A;  5E8G A;  5FB2 A;  2X6Y A;  2Z1D A;  1VTN C;  3L7W A;  1A6Q A;  3KP5 A;  4IF4 A;  4M6Y A;  2HQ5 A;  1YLF A;  3T5X A;  3K2Z A;  1XC5 A;  4HBL A;  4BQN A;  5GAG J;  3S3M A;  1GLN A;  3JTG A;  5JVG F;  2O9L A;  3HSF A;  1VQ6 I;  4ZDP A;  1WI9 A;  2W24 A;  1R22 A;  2NVU B;  4BQQ A;  5GP9 A;  4FTH A;  1XMK A;  3C1D A;  2L9V A;  3K10 A;  3RIR A;  4BBS J;  1T95 A;  2KIF A;  2EZI A;  2JN6 A;  2PG4 A;  3PUB A;  1EH6 A;  3S3N A;  1IRF A;  1FY7 A;  4ZYE A;  5CPR B;  4OAZ A;  2MD5 A;  3I53 A;  1XG1 A;  2IGN A;  4BHP A;  1ETY A;  1YS7 A;  2E5N A;  2O7O A;  3OYA A;  2ISZ A;  3QPT A;  2K02 A;  2F5C A;  4G12 A;  4I99 C;  5FFX A;  5JHU A;  2QLZ A;  2K85 A;  3KP3 A;  3OYB A;  3MVP A;  4BEH B;  3V7R A;  2ELK A;  4S0H B;  4L5E A;  2VE9 A;  4RS8 A;  3F9K A;  1J2X A;  4D7M A;  5HDN A;  4HV5 A;  2DMT A;  2LR8 A;  3C7J A;  4G6T B;  3HRT A;  2OCC H;  4UB8 C;  1QHG A;  3OOU A;  4P1W A;  4YFX F;  1B9M A;  2P5K A;  5C4J J;  2PX9 A;  1SD7 A;  2AXL A;  3LFK A;  5DTD A;  5LBQ A;  5M5Y J;  3AL0 C;  3HHH A;  2X85 A;  2J5P A;  5J3L A;  1R58 A;  4DBQ A;  3CF5 F;  4I0B A;  1BOB A;  2Q1Z B;  1W1W E;  4WWC A;  3UR3 C;  2J5O A;  3N4M A;  1ZGW A;  2K9S A;  4CCJ A;  4A6D A;  1JTX A;  3I4P A;  4O6J A;  5JFR A;  3DEU A;  4IEJ A;  4J19 A;  5EJC A;  1YE9 A;  1X1C A;  2CG4 A;  1YHQ I;  2OUM A;  2XPV A;  3G73 A;  2FQ3 A;  5JVT A;  1TWA J;  1J7K A;  5IT9 Z;  4RA2 A;  4RB0 A;  4A3J J;  4F92 B;  3H0D A;  1YOV B;  1LEA A;  2D2W A;  1R5H A;  3HBL A;  2XGE A;  5CVJ A;  3BR5 A;  1MBF A;  4IHS A;  3CJT B;  3TKY A;  1OCR H;  3IAS 2;  1KQ9 A;  2I8D A;  4C3J J;  1P4X A;  4DJA A;  2V9V A;  3BZ6 A;  5JHF A;  4EM1 A;  1XMA A;  2A6H F;  4WCG A;  2X48 A;  5K5R A;  5EEG A;  2NNN A;  1T08 B;  1S7E A;  4BU2 A;  4HNU A;  4PSX A;  4ZYD A;  3BRO A;  1LDJ A;  2M45 A; 
#chains in the Genus database with same CATH homology
 3KX2 A;  2LBF B;  3DPU A;  2E60 A;  3LSH A;  4PJJ A;  4KT6 A;  1ZEL A;  2X6W A;  5FRO A;  2HZD A;  2WY7 Q;  3GBG A;  1N75 A;  2ZFU A;  2WBM A;  1X19 A;  2CS3 A;  3NWT A;  3S3O A;  4MLO A;  4B44 A;  4CCN A;  4XLF A;  4RLF A;  4XLE A;  3BCA A;  2ZXI A;  1D0Z A;  1DGW Y;  4BJ6 C;  2R7U A;  3ZGK A;  3OYK A;  4ZJZ A;  2M7B A;  1WFX A;  3PJR A;  3HUG B;  2Q2E B;  4XLC A;  3BG6 A;  2LC2 A;  3QOD A;  3OWT A;  4YRV A;  1QU3 A;  1Z3Y A;  3H35 A;  4BE1 A;  2R7O A;  2VB6 A;  3VYR B;  4F52 A;  1N77 A;  4NNJ A;  4E7H A;  1P9Q C;  2PMZ A;  3EPZ A;  3K4M A;  2VKD A;  4J01 A;  2VJI A;  4N4N B;  2CV0 A;  5KCM A;  2JVH A;  4U87 A;  5HOO A;  2M4K A;  2K9M A;  3K4J A;  3C2H A;  4XN0 A;  3CMM A;  3LMM A;  4PUS A;  3L2W A;  2A6T A;  3OR2 C;  3OYJ A;  2VPL A;  4PK4 A;  3OYF A;  3RCO A;  4LIU A;  2CW7 A;  2MD0 A;  5HNF A;  1MW7 A;  2BOL A;  2KDO A;  2ZXH A;  2WB1 A;  4GRI A;  2K5C A;  4AU7 A;  2QKM B;  4HNT A;  3DEE A;  2V9K A;  4ITV A;  4NQW B;  2VQL A;  4DOZ A;  1DGR M;  2AQE A;  5KHD A;  2R7X A;  4HRI A;  2VJ4 A;  4C30 A;  2JVG A;  2VLA A;  3LSG A;  3OYH A;  3K4C A;  4ZC3 A;  4XKB A;  2V7F A;  3D5S C;  2IGM A;  4F91 B;  1D1C A;  2LRD A;  2PJR A;  2VXD A;  3RQ4 A;  4EAT A;  3LSM A;  1DQU A;  3OYE A;  3PNY A;  1X4O A;  3DTK A;  4ZYA A;  2KHM A;  2W82 A;  2VL8 A;  3OYC A;  2IXS A;  2KLO A;  2F5V A;  4IQJ A;  3E0J B;  2CUJ A;  2CFO A;  2M3A A;  4KIS A;  1NG6 A;  3OS2 A;  3QYB A;  2R7T A;  2MAB A;  3K6G A;  2IS6 A;  3OIP A;  5CKT A;  1MNE A;  4BL0 B;  2XSJ C;  4ZDL A;  3PL8 A;  2V1N A;  3RTR A;  2X6X A;  1D0X A;  3OL3 A;  4PJN A;  4BUP A;  4E7K A;  2ZSH B;  4E7S A;  3ZRG A;  2Z2S B;  4ZTF A;  4LG3 A;  1LFP A;  3M1C A;  3DU6 A;  4II2 A;  4HST A;  1OR7 C;  3CES A;  2CV2 A;  1UAA A;  4P5O A;  3OS1 A;  3VYU B;  1BR4 A;  3W2A A;  2E1M C;  5LFA A;  3FBN B;  2GOM A;  1BR2 A;  1TT0 A;  3E1S A;  3LSI A;  4DGW B;  2LY1 A;  4E7I A;  1WJE A;  4XKW A;  3G2B A;  2VAS A;  3I3L A;  2X51 A;  2VKH A;  5HLT A;  4ZTJ A;  4CA0 A;  4C2U A;  1V5E A;  2WAE A;  2L9S A;  1FMW A;  4Y4R A;  3BCB A;  3W3C A;  3S93 A;  2W1O A;  4XNF A;  2PJR B;  2JUG A;  2VQG A;  3FHN A;  4ZDO A;  1QHH D;  3K70 C;  5CQE A;  3J7A Y;  4B48 A;  4BXF A;  2VJJ A;  3HPH A;  2JSP A;  2VIX A;  2QKL B;  2F6C A;  2KPM A;  4H4K C;  1YX5 A;  2IS2 A;  5HVQ C;  2LG4 A;  2UUZ A;  4II3 A;  3OYG A;  2HPI A;  3HXL A;  1E0E A;  1MMN A;  1YX3 A;  2R7W A;  4XQF A;  3AKZ A;  4HEA 2;  2HQA A;  3OYM A;  1WJF A;  2GOX B;  3RSN A;  2L5Q A;  3MKY B;  1N78 A;  2DCE A;  1X1A A;  2WAQ A;  3KEY A;  3PNT A;  3A2K A;  3NWS A;  2OV7 A;  2Y0S A;  2VXZ A;  3OIQ A;  1U0J A;  3H5A A;  3OYL A;  3H5N A;  3OMY A;  4BDY A;  3K4N A;  2CW8 A;  2R7Q A;  1K6Y A;  1LKX A;  4QPO A;  4CSW A;  4HSR A;  2HVQ A;  1D1B A;  2WA0 A;  3BC8 A;  3U21 A;  4LIT A;  4BE2 A;  5LD2 C;  3TMO A;  2XDV A;  4IQ4 A;  4B3X A;  1J09 A;  3SEQ A;  3S8P A;  1UG0 A;  4PJL A;  4D9J A;  1Z3X A;  2V6E A;  3A4C A;  4C2T A;  2CMP A;  2R7V A;  3ZCO A;  2XF5 A;  2F4I A;  2M0M A;  4XR6 A;  1WJ5 A;  3PSF A;  2ELJ A;  2HDW A;  4IX7 A;  1T0F C;  2L2O A;  4CZC A;  2K9L A;  3D5R C;  1FMV A;  3OR1 C;  1W36 D;  3L2V A;  1V5G A;  2LOO A;  4N4O B;  2VQH A;  3VSK A;  1SFK A;  5CQG A;  2HVS A;  4FAS D;  3K70 D;  1LVK A;  1PYV A;  2E1M B;  4XL9 A;  3DKY A;  1WJC A;  1MMA A;  2XC7 A;  3DKX A;  3EUH C;  3FKJ A;  1MMG A;  2P0W A;  4PSW A;  3VSL A;  3AFH A;  3VYT B;  3V42 A;  3L2Q A;  3CP8 A;  2W4S A;  2OC6 A;  1WJB A;  4DBR A;  1DP3 A;  2KL4 A;  1AA7 A;  3H9Q A;  3IAM 2;  3HG9 A;  3EUK L;  4D1Q A;  2L7K A;  2HU9 A;  1G59 A;  4HPQ A;  3SDB A;  2R4G A;  4YEJ A;  2UV1 A;  3M8J A;  3ZR8 X;  1G8X A;  4BJT A;  4XON A;  3OL4 A;  3CF2 A;  1TZL A;  1V5F A;  2V26 A;  3QYF A;  4AVZ A;  2RRE A;  3HOT A;  2IGK A;  4ANJ A;  4XM3 A;  1OLT A;  1X1B A;  3HPG A;  1MND A;  1VZ0 A;  3D5L A;  3MMY B;  3ONQ A;  2KMU A;  2WAD A;  2KRC A;  3ZQQ A;  2BVM A;  1S9H A;  4RLQ A;  4F55 A;  4XLH A;  4DIQ A;  1Y6I A;  4B43 A;  3TL4 X;  4RMN A;  3DU5 A;  4NC8 A;  3H5R A;  2FUG 2;  4Y3O A;  1ERD A;  3A1Y A;  3BG7 A;  2K3P A;  3H9G A;  3PSI A;  3LL7 A;  4XN3 A;  2LH9 A;  1Y56 A;  1D1A A;  4CCM A;  1LDK B;  4QPQ A;  2VJ5 A;  3N05 A;  1HA8 A;  4BAC A;  4PFP A;  3EUA A;  2MC4 A;  1BR1 A;  4E6K G;  5KNL A;  3BLY A;  2DOA A;  4FET A;  4OWR B;  3RPU D;  3DLA A;  4CH7 A;  3L2U A;  3ZXS A;  4XOP A;  1NG7 A;  1PJR A;  4AYB A;  2KP6 A;  4XOT A;  4KJZ A;  4NUB A;  2KRH A;  4XOR A;  2HPM A;  4CCK A;  2IS4 A;  2XF6 A;  4XLA A;  2KZV A;  4B47 A;  3FBI B;  4E7J A;  3IUO A;  1WJD A;  2DXI A;  2Z16 A;  4C9Y A;  3K4L A;  2LRE A;  3I9V 2;  3IP4 B;  2R7R A;  2X1D A;  3H9J A;  4BS9 A;  3MKW B;  4PJM A;  4Y33 A;  2L9N A;  2O5R A;  2BW3 A;  3FDY A;  4E4H A;  1X1D A;  3UNG C;  4J00 A;  2KQR A;  1SAU A;  4RM3 A;  3OY9 A;  1X4P A;  3CP2 A;  4CCL A;  3CJQ B;  3CJR B;  2R7S A;  5FRM A;  3DPT A;  2X6Y A;  2Z1D A;  3OYI A;  1UEL B;  3OYN A;  3S3M A;  4BQN A;  2CUZ A;  1GLN A;  3C2G A;  2WAF A;  3LFU A;  2DT6 A;  4LIV A;  1MMD A;  4KIT B;  2W7N A;  2M4G A;  4XMY A;  3VWB A;  4ZDP A;  1Z7L A;  4BEH A;  2E5Z A;  4BQO A;  4BQQ A;  3DTE A;  3K10 A;  3K4K A;  4E7Z A;  1T95 A;  3PUB A;  3S3N A;  2IGO A;  4CUG A;  3OS0 A;  5CPR B;  4OAZ A;  3HKZ A;  4XKC A;  5FRN A;  2IGN A;  3HL2 A;  2E5N A;  5HNH A;  2IS1 A;  2MFZ A;  3OYA A;  3L2R A;  2BVL A;  2W00 A;  2LY2 A;  2UWM A;  1R6R A;  1IRX A;  4IKF A;  4F3Q A;  4CCO A;  4BEH B;  3OYB A;  1KON A;  4YEL A;  2NOJ B;  2A5W A;  2CV1 A;  3KYL A;  3F9K A;  4XKV A;  3HC7 A;  4G6T B;  3CZ6 A;  2M7A A;  1QHG A;  3OOU A;  4HG2 A;  4P1W A;  2LBF A;  4PFO A;  1D0Y A;  4OAY A;  1Z21 A;  3W2V A;  2WY8 Q;  3AL0 C;  2LYC A;  3DQV C;  2X85 A;  3S32 A;  4DBQ A;  1BOB A;  3SYT A;  4E7L A;  2Q1Z B;  3UR3 C;  3SZG A;  3QOE A;  2RQQ A;  4CCJ A;  1W36 C;  2DJI A;  3HOS A;  1EA3 A;  2X1E A;  3PFY A;  3AL0 B;  4X0G A;  2X1C A;  5TGT A;  2BW3 B;  2CH0 A;  2DT7 B;  1YE9 A;  1X1C A;  3QYE A;  2OUM A;  2JA2 A;  3MD2 A;  3LSK A;  2RNG A;  4RM2 A;  4R79 A;  3SEZ A;  3OYD A;  2XF7 A;  4U7B A;  2ZSI B;  4F92 B;  3H0D A;  3TBI A;  3DWL E;  4JOM A;  3K4B A;  3IAS 2;  2I8D A;  3DTI A;  4DJA A;  4BGD A;  3DPL C;  5JHF A;  2HVR A;  3MKZ A;  3VDX A;  4BE0 A;  1WJA A;  3VYS B;  1JI8 A;  2XAU A;  4JQF A;  4BJ5 C;  4BU2 A;  4HNU A;  4F93 B;  4IZZ A;  2V4J C;  2VQC A;  2MYS A;  4PSX A;  4BDZ A;  2AQF A;  3W2W A;  2HNH A;  3PNV A;  4NC7 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...