2KHMA

Structure of the c-terminal non-repetitive domain of the spider dragline silk protein adf-3
Total Genus 38
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
38
sequence length
140
structure length
140
Chain Sequence
MASMTGGQQMGRGSMGAASAAVSVGGYGPQSSSAPVASAAASRLSSPAASSRVSSAVSSLVSSGPTNQAALSNTISSVVSQVSASNPGLSGCDVLVQALLEVVSALVSILGSSSIGQINYGASAQYTQMVGQSVAQALAG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Fibroin-3
publication title A conserved spider silk domain acts as a molecular switch that controls fibre assembly
pubmed doi rcsb
source organism Araneus diadematus
molecule tags Structural protein
total genus 38
structure length 140
sequence length 140
chains with identical sequence B
ec nomenclature
pdb deposition date 2009-04-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF11260 Spidroin_MaSp Major ampullate spidroin 1 and 2
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.1350 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Arc Repressor Mutant, subunit A 2khmA01
2M0MA 2K3PA 2KHMA 2MFZA 2MABA
chains in the Genus database with same CATH superfamily
4M6VA 3RKYA 4D5FA 5E3OA 4R79A 2IA2A 2IGNA 1AOYA 5LBQA 4BDYA 1U3EM 2VIXA 2E1NA 4BUPA 2FMYA 2ZXHA 2COMA 5CPRB 1OR7A 4B44A 1XGMA 4EM2A 3L00A 4JP0A 4IOCF 1U6GA 3ZN0A 4X1EA 1RKWA 3FHNA 3RPQA 1O7LA 2R7QA 1ZK8A 3RKQA 1E3HA 2FEZA 5DCMB 1J59A 3WE3A 4LK0F 2H6BA 4D9JA 1FMVA 1B9NA 1ODDA 3ELKA 1T56A 2BZTA 3W6KB 3PNVA 3FXLA 4WXCA 1HSJA 1V4RA 1IXSB 3J7ZI 2HVRA 3K0LA 3MQ0A 3IP4B 2L9VA 1XCBA 4KYWA 2R5YA 1YFHA 4MIMA 1P4XA 5HVQC 3OV8A 2QGUA 3V8KA 3EUKL 2KISA 2K9SA 3HPGA 2XASA 3SXYA 3WHBA 2OF7A 3I55I 4BNCA 2ZSHB 2JZYA 1FNNA 2OAZA 4UVAA 5M3MJ 1RR8C 4ZJZA 4RBOA 1E2XA 5LRSA 3H3ZA 2LBFA 1LJ9A 2FBHA 3J7AY 1F9NA 3CCEI 2OCCH 4UHTA 1U9NA 1TT5B 3DU6A 3NEUA 1FYLA 2Z33A 4Y4RA 1YO5C 2E60A 2GLOA 3F8MA 1RRJA 3PSFA 4XBFA 3CDIA 4IF4A 1WRJA 4XL9A 1SVOA 2O3FA 5IT3A 1K78A 4I01A 4JQFA 5CKTA 2G7HA 1HDDC 3DEEA 5ICCA 1T95A 1L0OC 3ABMH 2NAZA 3HB9A 1DPUA 2DOAA 3F72A 4L9JA 2HDDA 3LMMA 3LWFA 2V79A 3U9GA 3F22A 2O61A 3TW7A 4H4KC 5FLXZ 2RDPA 5ICGA 4IO9F 3R61A 1XGOA 2VJIA 4I0AA 4WXDA 2P5KA 2E2HJ 3KYDB 2EZKA 1BJAA 2MABA 1ORKA 2EFNA 1PJRA 1VQKI 1LDKB 2Y75A 2VOPA 1J09A 5ICEA 1S9HA 1VQMI 2EZLA 1IW7F 1WQ2A 2RVCA 5H20A 4RGRA 2NVUB 2W00A 1O3SA 5GPCA 1R00A 1W36D 1ETKA 1YE9A 1UJ8A 1SD4A 2LP0A 2E34A 2XPWA 3IH4A 3DLLF 5A2QZ 2KQRA 4XN3A 1B59A 4BKXA 2NNYA 2DA4A 1DUXC 2XKPA 5HNFA 2BVLA 1FBQA 4KDPA 3RPUA 2DMNA 2L02A 1QA6A 3DKXA 1ZHFA 2ISZA 4Z6YA 4F3QA 2KP6A 3L9FA 1YTYA 5J4VA 2CO5A 4QSHA 1X58A 4FT8A 1OYYA 3EDPA 3RCOA 2IAIA 1Y6IA 3CZ6A 4IEJA 1T0FC 2K3FA 4U88A 3RJPA 4FX4A 1U5TA 3T1BA 4J19A 1E3PA 4YFNF 2HI3A 2BGCA 2RGVA 4IHWA 1LFPA 2DA1A 3PNYA 4E7SA 4YIFA 2GM4A 1JI8A 3KP2A 3MEXA 1OCZH 2LC2A 5LHIA 5GADJ 2BEOA 2A5YB 5D4SA 3E97A 4A2UA 1BW5A 3NWTA 1YQAA 1ETXA 4PGGA 4LG0A 4L0ZB 1RKTA 4CHUA 2DMPA 4UUSA 1LEAA 5KAIC 5E1ZB 3CUQC 4S05A 5EDNA 2AXTC 1A5JA 3EUAA 2FU4A 5B5EC 1YLFA 2DQLA 4PJJA 3HBLA 3I0TA 1YS6A 3ZOBA 1Y39A 2R7TA 2VKHA 3LA7A 4F91B 2IVMA 1JKPC 4YG2F 3G1MA 4EJWA 3GWZA 1CQTA 1E3OC 3SFZA 1Z0XA 5FGMA 3BR1A 3SDGA 1LFBA 5FD6A 1XTAA 1ACIA 3H36A 1SEUA 3CQZJ 3S16J 1BI1A 1FC3A 1ZQ3P 2GXBA 3A2KA 2V9VA 2BY0A 1WJ5A 2EK5A 3TO7A 4Q4ZF 1K79A 1WZ2A 1R23A 1R5GA 2FD5A 2W1OA 3FIWA 4LIUA 1Y0UA 3FKIJ 1ZLKA 1QO0D 2KZGA 2K3PA 1SD5A 2LOOA 2P4WA 3BZCA 3DBHB 1JKOC 1I5ZA 2IT0A 5CJ9A 2K02A 4M9SA 4EGYA 4UV9A 3RYPA 4P9UA 1ETOA 1QRYA 2VBYA 2E5NA 3I54A 2JN6A 4IKFA 1BOAA 3ML6A 5KK1A 4XLFA 2BHYA 1WFXA 1VFCA 2HS5A 2XRNA 2A69F 3AG2H 1GT0C 1K6YA 5JHFA 1HCRA 3ZQCA 1XX5A 1FOYA 2HR3A 3DF8A 4HG2A 5LGTA 3HL2A 3C1DA 4CXFA 1G2HA 1VQLI 3GTQJ 4M9XA 4A0XA 4P5OA 2L54A 5K5OA 3I5UA 4XKBA 4XOPA 1B4AA 4CCKA 1D0ZA 3HIFA 4XLEA 3BTLA 2X6WA 2DA7A 1BOBA 1T98A 5L3EA 3BWGA 2H27A 3K6GA 2VPLA 1V54H 4Y7NJ 3S15J 1VI0A 4ZH4F 4KITB 4PK4A 3OYHA 2V9KA 2QSGX 4A3IJ 1FSEA 5JHUA 1ETQA 5L3DA 2ZSIB 3DLAA 2L9NA 2LG4A 1LPQA 3ONQA 1FBSA 3FXMA 3IAS2 5IP7J 3FWEA 3WHCA 1D8JA 5IYCJ 2K9LA 4XRSA 5GAHJ 3F6OA 2YSRA 3GTKJ 4HX7A 4XOTA 1GUUA 3PO3J 3QPLA 2BHZA 2L0KA 2R5ZB 1MDMA 2CW7A 3CCLI 2F4IA 1LNWA 2E71A 4W1UA 5TJJA 2WY8Q 2DA2A 2HTSA 3DPTA 4HF1A 3M8EA 3K1PA 3S1QJ 1K6OA 1FIPA 2YPRA 4GGGA 5D6EA 3T8TA 2ZXWH 4AIJA 5C4JJ 2ZXIA 3PFYA 1QBJA 2W24A 3IV5A 4UB8C 2M30A 3Q3SA 2BOLA 3KLOA 3QPHA 5FKLA 3CMYA 2E1MC 2QVOA 3VB2A 3WU2C 4M9ZA 4D7NA 2P0WA 1N25A 2MG4A 2FUG2 1YX3A 5B1AH 1ENHA 5F64A 3IH2A 4XLPF 3U21A 4AVPA 3BTJA 3VOEA 2HYGD 2LLKA 1EKEA 2PMZN 2PMZA 2ZKZA 3S93A 1SFEA 4NC7A 3TBIA 2I5UA 3OS2A 1P9QC 1QZZA 4ENJA 3F8BA 3RIRA 2CH0A 2ZMEB 3FZVA 4XKVA 3TDZC 4HA8A 2JRTA 4ASNA 1JTYA 1VZ0A 3FXOA 1UMQA 2IEKA 3KYCB 4QPOA 2JVGA 4JX5A 2VPRA 4QTRA 2QUFA 1X4OA 1RETA 4RGXA 4ABZA 4BJTA 2O6GE 3S3OA 4KMUX 2F2EA 4DZJA 3MKYB 3K70C 4AUXA 5K1YA 5FLMJ 1OMIA 4HEA2 1BR4A 3DXJF 1XSDA 4WX9A 1NTCA 2WY7Q 2VKVA 4D5CA 2H09A 4Y33A 1MMNA 2F5FA 4BHCA 4BY7J 1PP8F 1O3QA 1P6RA 2CQKA 2HVQA 5F1RA 2B0LA 5J6XA 3PUFA 3U1KA 1WSUA 4XONA 3CDHA 5E17F 1GHCA 1Z6RA 2ZFWA 3JRHA 3K1NA 2EBIA 2B63J 3K1MA 1PVEA 2Y0MA 1WJFA 3CJQB 3JREA 3S14J 2W25A 1RPWA 3DBLB 5JLXA 5BQTA 1B72A 4KJZA 3L2VA 1P7IA 4ZYDA 4ZTFA 5D4RA 5BOXA 4B09A 2DTZA 1BW6A 4YIIA 4UY8I 3GEZA 1BIAA 2G7UA 1KYZA 4BEHA 3F6VA 3HUGA 1RESA 2EFWA 1IV8A 2OV7A 3CF5F 3OWTA 1S7AA 3DTIA 1JUMA 4A0ZA 2MC3A 3LSTA 1Y8QB 4X0GA 1QVUA 1X4PA 2H1KA 4ZYGA 1HW2A 4C9YA 3L1PA 1OYWA 3OIPA 3CCMI 1T6SA 1P7JA 4ON0A 5HODA 4P1WA 1MJ9A 2DK8A 5FKNA 1R58A 3M07A 3BQYA 3LOCA 3BG9A 3EYYA 3MN2A 3W6VA 3KP6A 3CCJI 1MSFC 3ROUA 4KT5C 2VC0A 3RKWA 2Q8KA 4II3A 4MLOA 5LGNA 1T8IA 2B9SA 1QPIA 2ZJ2A 1UG2A 1WJDA 1JHFA 1WGXA 3VSKA 2PBIA 3Q5FA 3BCAA 3V42A 1KU3A 1D1AA 5BNGA 5D8KB 5K7ZA 4OIPF 2F5CA 3JSOA 3CO7C 2EZIA 1HA8A 5JFRA 4CH7A 4IZZA 2QENA 2DI3A 3F21A 5TISC 1ETVA 1MJBA 2XSJC 4GDFA 3IKTA 3DQVC 5D5XB 3S8PA 4CA0A 3PIOF 4BQAA 1KQ9A 4U0YA 2YX4A 3OS0A 4GYGA 4PSWA 2E36A 1ZRDA 3E0JB 2OD5A 3BJAA 3SDBA 2NVXJ 3SEZA 1CF7A 3JAMK 1ZGWA 2EFPA 5H6QA 4OIRF 1FOXA 4PSXA 3AKZA 2ZC2A 3H5NA 5KNLA 3TP3A 9ANTA 2E2IJ 4EJOA 4YEJA 5B66C 2H94A 2PEXA 4HX8A 4S04A 4G12A 1ON1A 3HRTA 3QYBA 3OR1C 1TQPA 3SZGA 2A05A 3O2PE 1V3FA 1W4MA 1FPQA 5HS9A 2W85A 1Y56A 1LDJA 5J1RA 5CVUA 3H0DA 3CC7I 2K9NA 1OLTA 1P2FA 1J7KA 4HF2A 3QYEA 1EA3A 2FBKA 2HOAA 2FRHA 1NHAA 2LY1A 3BZ6A 3H9GA 2M34A 2YUSA 3WTVC 1OQYA 3FKJA 3HRUA 4MEYF 1K7AA 2NNNA 1XN7A 1MNEA 2LYCA 3CTAA 1FEXA 2BY1A 1USTA 2VJJA 2F48A 2K5CA 1X3ZB 1S5LC 1XD7A 4ENNA 2VC1A 4HNTA 5E1XA 1EJ9A 2RC4A 4OIQF 3PIPF 2Y31A 1IGNA 2ZJRF 3BDDA 2Y30A 1SMTA 1X2NA 2LF7A 3S1MJ 3K4CA 2QBYB 1I3QJ 1STZA 1QHHD 3T8RA 5LGUA 3IRQA 3JRDA 2R4GA 5FRMA 5A2QK 3EETA 4HV6A 2CG4A 3GZ5A 3GTPJ 3OYBA 3LL7A 4IHSA 3GFMA 3W2WA 5HDNA 1FJLA 1H9TA 5J3LA 3FXRA 3I9V2 3R0AA 2ECBA 1ITYA 3I59B 5H6RA 3GBGA 1A6QA 2IS4A 3ZMUA 1XPXA 2HZDA 2CMPA 2ELHA 3HHGA 4HRIA 1OISA 1TWGJ 3ECHA 2CFXA 2OC6A 2NVQJ 4ZC3A 3M1EA 3IHUA 2XC7A 5DUIA 1IDZA 3MZYA 1G8XA 4D7MA 4N4NB 2BE5F 4EATA 2O0YA 1G3YA 3K4NA 3VEPA 2QZ8A 2D45A 2XAGA 2BY3A 3GTMJ 2XDVA 4C30A 2JTVA 3L2WA 1G3SA 4RA2A 4DYQA 1WVRA 2JA2A 1LDDA 3P9IA 5GP9A 1N78A 3PO2J 5KAFC 2VQLA 1WJCA 1RUNA 5GPAA 3WTTC 1BI2A 4DW6A 3FMSA 2OTJI 2K85A 4BXUA 3IRRA 3K69A 1K83J 4FE4A 5FB2A 1MMSA 5TRDA 1APLC 2LK2A 1I6XA 4B3AA 1DGRM 4E7LA 4P96A 1TQMA 2LR8A 5TGTA 3TP0A 3UKGA 2DYRH 1MSEC 4R8HA 2CQ7A 2EIKH 3LAJA 3RI4A 2CQXA 3I56I 1A36A 3PM1A 4XLNF 4RM3A 5DDGA 3J81Z 4XSXF 4LG3A 2Z5UA 4L9VA 3QOPA 3W2AA 2O5RA 4NHJA 3C3WA 2PN6A 1VQPI 3OYKA 2P7VB 5HDKA 4RAFA 5J8CA 5J8FA 2LKSA 5EG0A 2VB6A 1AWCA 2MGQA 3EUHC 2JPCA 1YIJI 2F5DA 3BR2A 5DD4A 3VFZA 1B8IB 3OYLA 1W36C 4L9TA 5EYRA 3RSNA 1W0TA 1RUOA 4AM3A 2DXIA 2GOMA 2ZMEC 5HOOA 4CICA 2JSCA 3WTWC 3V7SA 3RPUD 4XQFA 2HQRA 5DUKA 3S32A 3IUOA 3MMYB 3IWZA 3CMEI 2DMTA 1XGSA 4F52A 1VQ4I 4HDUA 3BG7A 4DYRA 3LSKA 3BPVA 3FMQA 5E3LA 2OQRA 4RLQA 3ERMA 4C3HJ 3HOVJ 2P6SA 4M3DA 2X6YA 2E7WA 5F0FA 2GXGA 5M5YJ 5E3MA 3ZRGA 2JA6J 2M7AA 4HNVA 2UWMA 1Z7UA 3KZYA 2P5VA 4DOZA 1OFCX 1NK2P 2Y0SN 2A6HF 2Y0SA 2YX7A 3CLQA 1ZRFA 4CZZA 3ABTA 2QQ9A 3H9JA 4KT6A 4XN0A 2JJ7A 1UHSA 4E6KG 2XIGA 3JAMZ 2EV0A 2RREA 3H0GJ 3ZQLA 3FXQA 4BAYA 2PLYA 2DT7B 4CCJA 5F0HA 4N9HA 4OIOF 2ECCA 2VQGA 2HXIA 3VDXA 1OCTC 3N4MA 4IPAA 2JSPA 2OPTA 4JX6A 5LD2C 1ZG3A 1IXRC 2CW0F 5DD8A 5F1JA 3FM3A 3GLXA 3CC2I 2R7XA 1YIOA 4FE7A 5LLQA 2LKPA 1X2MA 4E7ZA 2AQFA 4UNOA 1MBHA 2QLZA 1BC8C 1LEBA 3O8HA 1BJZA 2VJ5A 4BL0B 4LIVA 4A6EA 2L3DA 2CQNA 3K4JA 2Z1DA 4EEFG 4G9YA 1I50J 1IUYA 2O8KA 3PQJA 2PJRB 4FHTA 3EPZA 3LSGA 4FTHA 2YR2A 2DFEA 1GXQA 2A5WA 2CGPA 1JGSA 2V1DA 3U2RA 1DPRA 2AS5F 1WJAA 3BG5A 3KEQA 4BU2A 4XLAA 1PYVA 3L7WA 1TBXA 2QQAA 3BPXA 4NQWB 2NOGA 2XAUA 1OCPA 1R4MB 4IXAA 1QPMA 2KIFA 4IOAF 2H8WA 3IWFA 1VQOI 5ILSA 1E17A 4RAGA 2H6CA 3M9AA 2IP2A 4ESJA 3CP2A 1SAXA 4CUGA 3QAHA 2JPBA 4WCGA 2KIQA 3L2QA 5J1YA 1I6HJ 2JT1A 3HXLA 5DM7F 2MH2A 3DTEA 1WH5A 2KHMA 3D5LA 2R5YB 1EH7A 5IY5H 2A68F 5IYDJ 2WA0A 1FX7A 3JR9A 3R6SA 3HGYA 1QNTA 2UZKA 3WGHA 4KN4X 2LRDA 1SFOJ 1XSVA 1IF1A 3KX2A 4J01A 1S29A 1YRNA 5F27A 2HDCA 4N4OB 4GCVA 2R7DA 2M4KA 4K2EA 5J40A 3GF2A 1X3UA 2E2JJ 2LBFB 3LSIA 4I0BA 2ME6A 5CLSA 2DMUA 3OSGA 2DJNA 1FIAA 2I10A 1JHHA 5JI6A 3OYDA 3QQAA 1J5YA 4L5JA 5FKOA 5HS7A 2CW8A 1TW3A 3ABKH 3KZIC 1OJLA 2L9SA 2X1CA 2L4MA 3OS1A 1MBFA 1Z3XA 2CV0A 1K78B 4MNUA 3HRSA 1HSTA 3M7GA 1ZN2A 2Z16A 4NC8A 1FP1D 5E1WA 1ZLJA 5D5VB 3MWMA 5HNHA 4BE2A 3WTYC 2X6XA 4A5NA 4BHBA 2M3AA 1R1UA 1BI3A 3OYFA 4G7ZF 4C2TA 5IT9Z 5CYVA 1D0XA 5GAGJ 1NG7A 5FROA 4KISA 3GUDA 1X1DA 1HW5A 2EA2A 1QU3A 3HOWJ 1MNMC 2PQ8A 5DCFA 2XAHA 4OAYA 3WG9A 3TL4X 3HKZN 3HKZA 2QEXI 1FOKA 1PDNC 2NS8A 1ZRCA 4E7HA 4TV7A 4H0EA 4E70A 4LLLA 1R7JA 3G2BA 2E19A 4RMNA 1J2XA 1TT0A 2J5OA 3OIOA 2RKHA 1I39A 3JRGA 2PG4A 3MAJA 3HPHA 3OL4A 4I76A 3S2WA 2P6TA 2XROA 5BPIA 1WKMA 1F36A 2DTRA 1R9TJ 2FQ3A 2X4HA 3I53A 3I71A 1J9IA 2FJ1A 1UCRA 2CUEA 3Q0UA 4JYKA 4JOMA 2QF7A 4LMYA 3LNQA 5EEGA 2HDWA 2WWYA 3CCSI 2R5ZA 1GXPA 3L09A 3PNTA 1A04A 5FD5A 1IRZA 3MCZA 1IN7A 1W7PD 1DQUA 3AFHA 4BE1A 5IOZA 1A6IA 4ZDOA 4ENKA 1Y8RB 2EQRA 2V9PA 2ICWG 2DFFA 1TNSA 3CCVI 3NRVA 1U2WA 4O5VA 4IQ4A 4DJAA 2MA3A 3HRMA 2VASA 5F0CA 3BZKA 3LQQA 2MYSA 3ZGKA 3LFUA 1RZ4A 4G6DA 5IPAA 3HDDA 4Q47A 1R5ID 3DWLE 5J1UA 1NG6A 2VLAA 2Z99A 3R0JA 1Z05A 3H9QA 4A0YA 1BC7C 1PUEE 4LG0B 1ZH5A 1UHWA 5DS9A 2NXNB 2HQAA 3ECOA 2LVSA 3FBNB 3BTCA 4L5IA 4HZFA 4BJ5C 1Z77A 3MD2A 3G73A 3BTIA 4II2A 3VYSB 1Y1WJ 3LSHA 4U0VA 3RYRA 3S1RJ 4EGZA 4ZZLA 1YJ9I 1IRFA 3S2DJ 4JBAA 3GXOA 2JK3A 2BVMA 2EFOA 2HXOA 1M1EB 5IP9J 4KICA 5EGOA 5LHHA 1YJNI 3ABLH 1FY7A 3F9KA 2RV8A 5ILUA 2Z2SB 3JTHA 2W57A 1Z7LA 3Q0VA 4G94A 2HKOA 2Q2EA 4NDLA 1H0MA 1I27A 1T38A 3O8GA 2VE9A 3BP8A 2VKEA 3BY6A 1WI9A 2Q0OA 2X1EA 4L18B 3SHFA 1MJAA 1ZR4A 3ZQIA 3OYCA 4XRMA 2IS6A 3CUOA 1D3YA 2EIJH 1D0YA 2A3SA 1FMWA 3K7AJ 2XUBA 4EM1A 4CCLA 1ZR2A 4IHTA 4X6AJ 4LB6B 3FK6A 5CVJA 1F5TA 3I4MJ 3LSJA 4HLXA 1LFUP 2I8DA 1YI2I 1FZPB 4HSTA 1YHQI 3VYRB 1IO2A 4U7DA 3KIOA 2DN0A 1JTXA 2AQEA 3G1LA 4NBQA 3HGGA 3KLNA 3D5RC 3SQNA 3RKXA 2DYSH 3BOQA 4PJNA 2E7XA 3IC7A 4J00A 3IL2A 4ZYHA 3CJTB 1FT9A 1Q1VA 3K4BA 2YS9A 2EV5A 2RAEA 2R7RA 1G59A 3C18A 4YFXF 1REPC 5ED4A 2W4SA 4WF2A 2DFIA 4BQOA 3OYJA 1H88C 4BDZA 4NUBA 1AA7A 4KIGA 1BA5A 3OYEA 1MGTA 1BR2A 1S6LA 4ANJA 2Y9ZA 1SC7A 5L3FA 4KIFA 1TWCJ 3WU0A 1HDPA 2CYYA 4ENMA 4C2UA 2L7FP 3T0YA 4FCYA 5EEHA 3ZXSA 1R49A 4UVCA 4LB5A 4HF0A 3DPLC 1JJ8C 4FISA 2LNBA 3LSMA 4RDUA 2R93J 2ZXJA 3D0SA 3AG3H 3NWSA 1NH3A 5CVVA 2A6EF 4EJVA 5FKMA 3EQLF 4Q5SF 1U78A 3HSRA 4A12A 2F5VA 2E1OA 2O7OA 2L2OA 1MDMB 4RLFA 3KP4A 3TQNA 3ESWB 2GOXB 1HF0A 2BW3A 2L01A 3Q0WA 1K4TA 3FF5A 1QQIA 3DTKA 4G7HF 1RI7A 3ZQFA 3P5JA 3J81K 1J75A 2HYFA 3IKVA 2ZB9A 1V5GA 4PDKA 2Y48A 2C6YA 2M4GA 2G0EA 1IRGA 2DT6A 1W1WE 1W5TA 4F7ZA 2HWVA 3B6AA 5B3SH 4AIKA 4CO8A 4MO7A 3KZZA 4XSZF 1H8AC 4I99C 1Y0NA 3P9CA 2WAQN 1VQNI 2WAQA 3ZQ7A 1JUSA 2ID3A 4CYCA 2XB5A 1LKXA 2FOKA 1T0FA 1FTTA 4A3EJ 1IN5A 1HW1A 4DBQA 1SFXA 2K7LA 2LF8A 1LE8B 3DU5A 2OA4A 5JLWA 2R7VA 5F08A 2ETHA 5M5XJ 2DLLA 3I58A 3MZ8A 1XSXA 1FOWA 4YIRX 4W97A 4ZDLA 2VI6A 3GLLA 2OZUA 1IG7A 2FNPA 3LA3A 1WH7A 4UVBA 4ZDPA 1LVKA 2XAQA 2Y9YA 3L2UA 1VQ6I 1W7PB 4RM2A 3CUQA 3HEFA 3M8FA 1MMDA 1ZELA 4M71A 3HYIA 1VQ8I 4IX7A 3V7CA 2V6CA 4CCOA 1IXCA 3M8JA 3BT9A 3FDYA 1A31A 3O6BB 2RNJA 1AKHA 2ADUA 5CQEA 3GTJJ 4UV8A 3LA2A 1F1ZA 3JRAA 2X9DA 4PFOA 4OMYA 2XF7A 3LSPA 1POGA 2IPQX 3L2RA 1IDYA 2GZWA 3S3NA 1ONVA 3CCQI 4UUTA 4DYCA 1R5HA 1P4WA 1BM9A 3QPTA 4A69C 1MW7A 2VXDA 2CU7A 2O03A 1VTNC 2VQHA 1ZGJA 3ABUA 4G7OF 2ELKA 3CESA 2M9HA 2HKXA 3DEWA 1K4SA 5J4YA 4D1QA 2HPMA 2PI0A 3HTSB 3I59A 3S17J 4BEHB 2DOEA 3BR5A 1RC9A 2X6OA 3SZPA 1WWXA 1KZHA 3Q9SA 4HYEA 1SMYF 3C7JA 3AL0B 2QKLB 3DP7A 1JT0A 2LKXA 3NARA 4IVNA 2M8EA 3VODA 1TL8A 3HSEA 4IQJA 4JX4A 4RGUA 5EJCA 1WHUA 1LB2A 5LEKA 5E8IA 1QGPA 3CMMA 4XLHA 3F23A 4U87A 3T5XA 2CJJA 1XDSA 2QYOA 4HDVA 1TWFJ 1HC8A 1MMAA 3OR2C 2CQQA 2Y2ZA 3BR6A 4A3FJ 2CWEA 4PCQA 2FOWA 4Z2YA 4XMYA 2ME0A 2QQ8A 2JVHA 3ZQQA 4YFKF 2GA2A 3W3CA 3K9TA 2ACJA 3BG6A 2P8TA 1BIBA 5D6FA 1S7EA 3WGGA 1PUFA 2IGOA 3E6BA 3FXUA 2HU9A 3KFWX 3KPHA 5C44J 4M3EA 3WU1B 2BYVE 3VPRA 3A01A 2JA7J 3PFIA 4PJ0C 2ZCWA 3MZHA 3HJEA 5LHGA 2DBBA 3A0BC 1DU0A 4PJMA 4ESBA 2V26A 2IRFG 1WJEA 3L2CA 1IRXA 2HTJA 2MLKA 3WTZA 1BBYA 3CO6C 1IUFA 5DYMA 3ZMTA 1WJBA 4WK8F 4BACA 4B43A 2GQQA 3H3UA 1IV6A 1YW9A 2FX0A 4XKWA 4I98B 3F0CA 1TTYA 4HV5A 1P92A 4N9IA 1ZREA 5JR3A 2CV2A 3DPUA 1ZAOA 2K4BA 3ERED 3BQZA 5L3BA 3E7LA 2DA5A 2HZTA 3I3LA 1MBEA 1I1GA 4CCMA 4IRHA 3BROA 1TW2A 2ZFUA 2LSOA 4A93J 2DU9A 1D5VA 2HEOA 2CUZA 2GIZA 1F4KA 3JW4A 1Z6TA 2MSYA 4MTDA 4JK1X 2PMHA 3WTXC 1MBKA 2KKOA 3WE2A 1LUJB 2KT0A 1T08B 5EF6A 1U8BA 3H5AA 4IRGA 2R7WA 1FLIA 4ETSA 4Y13A 1XC5A 2VBZA 4NB5A 4OAZA 5F04A 4XNFA 5IT9K 1HLVA 3WG7H 1IJWC 5DCMA 1G3WA 1O57A 3W2VA 2XAFA 3D1NI 4QIWN 1ZG5A 2F6CA 1D1BA 1OCOH 2FE3A 3RTRA 2P81A 1B1BA 2KPMA 4KFCA 2VUMJ 3BLYA 4A3KJ 1UFMA 5J47A 3MKZA 5LRRA 2FNAA 2Z9OA 3G71I 3I64A 4AU7A 5HLIA 3C2HA 1IZ1A 3V8JA 3GO5A 1MMGA 3RQ4A 2A6TA 4BS9A 3TOBA 1DP7P 3KP5A 2KIUA 4IHYA 5KCMA 4KA4A 1ZKGA 3GZ6A 3QU3A 4V2GA 3HHHA 3ZMVA 4EMSA 4CGZA 4I7HA 1USSA 2D5VA 2NVYJ 3S1NJ 3KP7A 3H92A 1WI3A 1X19A 3HM5A 3HSFA 4BBSJ 3BCBA 3E6CC 4F55A 3JRBA 2IS2A 4A3MJ 2K27A 1J0RA 2HFHA 3K2ZA 2E1MB 1RR7A 2L7KA 4GRIA 3G4SI 5CVRA 4YELA 3IAM2 3E6DA 1FYMA 1ZG1A 3VWBA 5GTHC 3M4OJ 2DAOA 2XF5A 3V8LA 3M3YJ 2ZBKA 4BYYA 2VONA 1U8RA 2X48A 1Z91A 3DBRB 3S3MA 2PJPA 2MLGA 4I02A 3ZMZA 4M3BA 4IRIA 4NQWA 4OWRB 3OY9A 3LQRA 1KGSA 3AG4H 3C2GA 3P7NA 4M6XA 4V2FA 5K5RA 4A3CJ 1GV2A 3RZOJ 1XMAA 3BG3A 3H35A 1Q1HA 1YX5A 3ASOH 1XG1A 5D8LB 5KHDA 3K10A 1XGNA 3E5QA 3TKYA 2MBFA 2IBDA 2P7CB 3AAFA 4ZYAA 5IP6A 2KLOA 5DM6F 2CUFA 3R60A 4PUSA 2ZJPF 4CYDA 1S3JA 2VKDA 4PZJA 4L9NA 4U0WA 2LREA 4XK4A 1UG0A 2UUZA 3QOEA 2FQ4A 1EH8A 1MH3A 1C0WA 1SFUA 4UB6C 4G6TB 2R0QC 2HNHA 3BR0A 1U0JA 2ZO4A 2B7EA 2IGMA 2KZVA 5EG0B 3OYGA 1H9GA 1V55H 2DJIA 3BJ6A 3GYHX 3TW6A 1E0EA 3CJRB 1MNDA 3PSIA 2M87A 1X1AA 2AXLA 2HOSA 4KMFA 1KU7A 4AVZA 3K4MA 2NYXA 4Y3OA 2H8RA 2D1VA 2MW8A 3LSRA 2VT3A 2H1LA 2WC2A 4L0YB 3I4PA 3K4KA 4A3LJ 2EH3A 1VNDA 2GBYA 1TWHJ 4RB3C 2X85A 1L3LA 2NVTJ 1YG2A 1YYVA 3DKWA 5LFAA 2JUCA 3CCRI 3SYTA 5ERIA 2M5WA 1CGPA 1VQ5I 2EV6A 2HPIA 1TP4A 4ESFA 3C2BA 5LEJA 1KA8A 2JUGA 2WBMA 3OSFA 1OCRH 2EB7A 4XKCA 5B1BH 3ZQGA 5GTIC 3SZTA 3OYNA 1O3TA 4M74A 2DA3A 1KU2A 5DEQA 1MZBA 4BE0A 1XCVA 3DEUA 5HLGA 4NC6A 2VE8A 3TDUC 3CLOA 1T2KA 4RGSA 3GFJA 2V1UA 4PJLA 5E3NA 3H3VK 5HS8A 1QVTA 2QQBA 6PAXA 3GTGJ 3HOUJ 3OMYA 1YOVB 5E79C 3CD6I 3B6CA 3KEOA 2KJCA 1YJWI 3K4LA 5E8GA 2BV6A 4XLCA 4MHGA 2EA4A 3VYTB 1GDTA 3ZP5A 3E5UA 1UHMA 1JKQC 2XPVA 2STTA 3AL0C 3QU6A 3OYAA 1OCCH 2KDOA 4OMZA 2CS3A 4C3JJ 1F43A 3NAUA 5FLVA 1IN4A 2DW4A 1Z67A 5FKKA 1JUPA 1TNTA 2KIMA 1IAWA 2K86A 3PQKA 2X0LA 3HOXJ 3I4NJ 2WB1N 3JRCA 2WB1A 3ZMSA 1UAAA 2L9RA 1A35A 1MBGA 1XS9A 3RZDJ 2V1XA 4UUVA 2LD5A 4OOIA 1ZTRA 1TWAJ 4HAMA 3REOA 5F6FA 2DOFA 2VOOA 3KYLA 3F8NA 4MGRA 4KIBA 5C3EJ 4WWCA 3KEYA 2YU3A 1DP3A 2MD5A 3A4CA 2OUMA 2GA1A 5GAEJ 3PUBA 2KRCA 4M3GA 3E5XA 3CMAI 4EVIA 4GFBA 3RQIA 3N05A 4N0BA 1GVJA 1W5SA 2M45A 4M73A 4E7JA 2K40A 2UXNA 2IW5A 1BI0A 3FHZA 4E7IA 4RB2C 2QM3A 3DFGA 5L3GA 4O6JA 4GYIA 1HXDA 2FXAA 4P9FA 1PP7U 3MFKA 2YU9J 2XAJA 3A03A 3OL3A 2Z3YA 2CFOA 1X1CA 2KL4A 2KRFA 3HOTA 3GZNB 4HQEA 1YRNB 4FASD 1YITI 1G3TA 1U5TB 2WADA 2GXAA 1I3AA 4L5EA 3GTOJ 1B9MA 1WCMJ 2JQ7A 4HBLA 2R7UA 2PMUA 3FK7A 3GX4X 4ZZDA 4CDGA 2DO7A 4FX0A 4WXHA 2HOTA 3EUHA 3NQOA 2W7NA 1TLHB 3FXJA 2DODA 1GVDA 3CDLA 4LK1F 3A1YA 4KUMA 4NNJA 4DGWB 1KYWA 4LOCA 4UUSB 2ZMEA 1UZCA 2K9MA 3TOAA 4F93B 1VQ7I 4EM0B 3S2HJ 3F3XA 4LITA 3JRFA 2V1NA 1ETYA 2MH9A 4AIDA 3OOPA 3OIQA 3J80K 1XMKA 3TO9A 2W84A 4DQ2A 1X3WB 1X1BA 2EINH 3WTUC 3CF2A 3BJOA 3FBIB 4IHXA 5FRNA 1MKMA 4KN7X 2LDUA 3H1CA 1UELB 4XORA 3P9KA 3KCCA 2F5EA 2TCTA 1KU9A 2HQNA 4LLNA 2HGCA 2IJLA 4LLGF 3DKYA 4ZYEA 1AU7A 2L4AA 3BR3A 4A3BJ 3GFLA 2F4MB 2PFBA 3CCYA 4RB0A 2KDZA 5H2FC 2MD0A 3K2AA 3B73A 3QWLA 2NRAC 2STWA 2XV4S 1SD7A 2V7FA 4MTEA 2DCEA 2DDBA 3G6EI 4HOBA 3IH3A 4BHPA 1UB9A 2RN7A 3ZMDA 2IA1A 2VBWA 4E7KA 2BXZA 2EZHA 2LTPA 5C4XJ 2X1DA 4EJTA 2G9WA 3V4GA 2KMUA 1JXSA 1R71A 2EIMH 3FISA 2QKMB 1BR1A 2MC4A 2Q1ZB 1OPCA 2JWTA 2XF6A 2QSHX 1KQ8A 2BBYA 2XGDA 2ISYA 2ESNA 3E1SA 4BXFA 3WGIA 1DU6A 3OYMA 1V5EA 2KRHA 3ZQHA 1LE8A 5E18F 2M7BA 3WODF 2UXXA 2M0MA 3N97A 5JVGF 5M3FJ 2MFZA 3GMEA 1U9OA 1OYIA 4A3JJ 2K9QA 4XIDA 4RS8A 3G1OA 4PGHA 1N77A 3GFIA 1DGWY 2HVSA 5FFZA 2XGEA 2ZNZA 1SVLA 2QA4I 1W7PA 4AD9A 4LD5A 3FMRA 2CSOA 2VL8A 2J5PA 5EGOB 2R7SA 3OOUA 4RB1A 1S7OA 1VQ9I 1HKQA 4G6QA 5CVIA 2HQ5A 4G8XA 3LFKA 2QWWA 4IL6C 2FMLA 2Q2EB 3ISPA 4EV0A 5HLHA 5E20A 1HOMA 1GV5A 4OINF 3MKWB 2OJED 1YW8A 2A07F 3DV8A 1IN8A 3JCUC 5BS6A 1W5CC 4U7BA 3HZJA 1EH6A 1AHDP 3OYIA 1ZYRF 2LY9A 4HLYA 3TEDA 4MFDA 1MD0A 4RAZA 2M8GX 1O3RA 1TZLA 3ZR8X 4FETA 3EYIA 4Y15A 3F8CA 4A3DJ 4YRVA 3SJMA 4HQMA 4MQVA 2VT2A 5HDGA 2WTEA 2XHKA 4B47A 4I6ZA 4BBRJ 4CCNA 4M6YA 1JKRC 1VF9A 1RNLA 1T33A 1HKSA 5K5QA 3O3KA 1OR7C 5IYBJ 4XRSG 3GVAA 1Z1DA 1R1TA 1H89C 4RAYA 2LY2A 1QZYA 3QODA 2FA5A 3ZPLA 3QP5A 2GWRA 4BQNA 2DPUA 1K61A 4I2OA 4A3GJ 1MBJA 1ETWA 1MIJA 3SEQA 1ERDA 5DTDA 3TMOA 5EEAA 2D2WA 3DCFA 3TO6A 3JRIA 1JE8A 4EQQA 2OZ6A 1YS7A 4AWXB 2OU2A 2EJRA 5ILVA 3PJRA 1QHGA 4LGWA 2V6EA 2K4JA 4CZCA 5FJ8J 2XPUA 4XR6A 2VN2A 5BPDA 4IHVA 2Y69H 3CJNA 2AHQA 2LMDA 1Z3YA 2DQRA 2OTLI 2QBYA 1EV7A 4DBRA 3FXKA 2BW3B 2WV0A 3D5SC 4AC0A 5D5UB 5BMZA 1BN5A 1B72B 3B02A 3GTLJ 3QYFA 2XGXA 4QPQA 2GAUA 2GIVA 3ZN1A 2DPDA 4BJ6C 2IS1A 2JMWA 3E6MA 2RQPA 3A02A 3HUGB 4ITVA 4B4CA 5AIQA 4XRFA 3FM5A 3E3VA 5FO5A 1FSHA 3HOYJ 2M2EA 1I1SA 2CV1A 4HSRA 3UR3C 2IGKA 2R7ZJ 2ZNYA 5ICFA 2CRGA 3K70D 3BC8A 2HOEA 3J7YJ 1NK3P 4XM3A 4CYCB 3KETA 4DZPA 1D8KA 3RDIA 4MQ9F 1R6RA 5IOYA 4M72A 4EJUA 2E1CA 4O3MA 3KE2A 2KFDA 4QWQA 4A6DA 2DA6A 4A5MA 2NS7A 3J80Z 1FBUA 2JA8J 4HNUA 4E4HA 1DDNA 2DMQA 2E5ZA 3F8FA 4XICA 3UNGC 2W48A 5CQGA 3VSLA 1HQCA 1SANA 3HG9A 3AG1H 5L3CA 3HC7A 1WPKA 5FFXA 5D5WB 3QPSA 3QRFF 2XGCA 2WV1A 5K7FA 1LQ1A 1ULYA 1FYKA 2RNGA 5EZHA 3CUQB 4M3FA 2F4OB 4Y17A 5FLXK 4AYBN 4AYBA 1G6NA 2RQQA 1N75A 2DK5A 5K7HA 4AIHA 1XDUA 5AIPA 1XMXA 2M0CA 2WAEA 2PX9A 2FSWA 2LFBA 2FF4A 2R7FA 2EFQA 2OQGA 2OCEA 3ZCOA 1AKHB 2VODA 4Y52J 2XB0X 3GCMA 3M1CA 2IXSA 3QP6A 4BH9A 1KQ0A 2ELJA 2UV1A 2M1BA 4PFPA 1CF7B 2JA5J 2D1HA 1W0UA 2P5LC 2V4JC 3CP8A 4I09A 1U5TC 4IJAA 1ZGAA 2XVCA 4QLCU 2N8GA 2BXYA 2DDAA 3Q9VA 2R7OA 2NOJB 4HPQA 1ON2A 1SAUA 2R3SA 4LFUA 1SFKA 2CUJA 3G3ZA 2X51A 4F92B 2ESHA 1RIOH 4DNCA 4HX4A 2KJBA 2EILH 4R1HA 2COBA 4B1RA 3WTSC 1R1VA 1B8IA 5DV5A 4CSWA 1FP2A 4V19K 1R22A 3JSPA 1GLNA 1X1PA 3W6JB 3HOZJ 5HLTA 2VQCA 3COAC 1HKTA 2JRMA 2DFHA 2QCOA 1Z9CA 4BQQA 2EWNA 3ULQB 4DIQA 2BY2A 2VXZA 3JTGA 2HYJA 1FWZA 3H5RA 1D1CA 4D0PA 4P55A 2L5QA 1OKRA 2DT5A 1ZARA 1JJ6C 2VJ4A 3FX3A 4OU0A 1XB4A 1BL0A 1T39A 4LJZF 2QSFX 4ZTJA 2TRTA 3V7RA 5AONA 4BY1J 2XKOA 1D5YA 1S8NA 1KONA 4MEXF 2L7MP 2E35A 2W82A 3HOSA 1B6AA 3GW2A 4MFEA 3R4KA 1S72I 2L7ZA 3ASNH 3CCUI 1SVMA 2LH9A 1PUFB 1YW7A 2O9LA 4KNYA 1IN6A 5KVRA 4BGDA 3J7AO 5EZGA 5JVTA 2TDXA 1IC8A 1EF4A 3A01B 3CC4I 5M5WJ 3X2QH 1SD6A 2VBXA 1R36A 1MH4A 2AO9A 4FQGA 1QZEA 1R4NB 4HW0A 3SFIA 2NS0A 2ID6A 2OBPA 4B8XA 4GO1A 3KP3A 1TC3C 2FBIA 1G4DA 1Y1VJ 1O4XA 2ZJQF 1TQIA 1JT6A 2WAFA 3LAPA 2R92J 4BXXJ 4B48A 4UXNA 3MVPA 3VYUB 1JGGA 2IA0A 2O8XA 1HBXG 3PL8A 2EPFA 1FTZA 4Q48A 4S0HB 1LVAA 3A0HC 2XSDC 1O7FA 3HTUA 1P4AA 4B3XA 2PJRA 1V5FA 2A61A 1Z21A 3TGNA 3U1DA 3MKLA 4C2MJ 4C3IJ 4GXOA 2XRLA
chains in the Genus database with same CATH topology
4BDZA 4NUBA 1AA7A 4R79A 2IGNA 3OYEA 2LY1A 3H9GA 1BR2A 4ANJA 4BDYA 2VIXA 3FKJA 4BUPA 2ZXHA 4C2UA 5CPRB 4B44A 2LYCA 1MNEA 3KYLA 3ZXSA 3FHNA 3KEYA 2R7QA 1DP3A 3DPLC 3A4CA 2OUMA 2VJJA 3LSMA 2K5CA 3PUBA 2KRCA 4D9JA 1FMVA 3NWSA 4HNTA 3N05A 3PNVA 2HVRA 3IP4B 4E7JA 2F5VA 2L2OA 5HVQC 4E7IA 4RLFA 3K4CA 2GOXB 3EUKL 1QHHD 2BW3A 3OL3A 5FRMA 2R4GA 3HPGA 2CFOA 3DTKA 1X1CA 2ZSHB 3LL7A 3OYBA 2KL4A 3W2WA 3HOTA 1V5GA 2M4GA 2DT6A 3I9V2 4ZJZA 4FASD 2LBFA 2WADA 3J7AY 3GBGA 2IS4A 2HZDA 2CMPA 4HRIA 3DU6A 2OC6A 4Y4RA 2R7UA 4ZC3A 2E60A 2WAQA 3PSFA 2XC7A 4XL9A 1G8XA 1LKXA 4N4NB 4EATA 2W7NA 4JQFA 3K4NA 4DBQA 5CKTA 3DEEA 3A1YA 4NNJA 1T95A 4DGWB 3DU5A 2DOAA 2XDVA 4C30A 2R7VA 3LMMA 2K9MA 4F93B 3L2WA 4H4KC 2JA2A 4LITA 1N78A 2V1NA 3OYJA 4ZDLA 2VJIA 2VQLA 1WJCA 4ZDPA 1LVKA 3L2UA 3OIQA 4RM2A 2MABA 1MMDA 1PJRA 1X1BA 1ZELA 3CF2A 1LDKB 3FBIB 1J09A 5FRNA 1S9HA 4IX7A 4CCOA 3M8JA 2W00A 1UELB 3FDYA 1DGRM 1W36D 4E7LA 4XORA 1YE9A 5TGTA 5CQEA 2KQRA 3DKYA 4XN3A 4PFOA 2XF7A 3L2RA 4RM3A 2BVLA 5HNFA 3S3NA 4LG3A 3W2AA 2MD0A 2O5RA 3DKXA 4F3QA 2KP6A 1MW7A 2VXDA 2V7FA 3OYKA 2DCEA 2VQHA 3RCOA 3CZ6A 1Y6IA 3CESA 2VB6A 1T0FC 2HPMA 3EUHC 4D1QA 4E7KA 4BEHB 2X1DA 3OYLA 1W36C 1LFPA 3RSNA 2DXIA 3AL0B 2KMUA 2QKLB 3PNYA 4E7SA 2GOMA 1JI8A 5HOOA 2LC2A 4IQJA 2QKMB 1BR1A 2MC4A 2Q1ZB 3RPUD 4XQFA 2XF6A 3NWTA 3S32A 3IUOA 3MMYB 3E1SA 4BXFA 3OYMA 1V5EA 2KRHA 4F52A 3CMMA 3BG7A 2M7BA 4XLHA 3LSKA 4U87A 4RLQA 2M0MA 3EUAA 2MFZA 1MMAA 2X6YA 4PJJA 3OR2C 1N77A 3ZRGA 1DGWY 2M7AA 2VKHA 2HVSA 2UWMA 4F91B 2R7TA 4XMYA 4DOZA 2JVHA 3ZQQA 2Y0SA 2VL8A 3H9JA 3W3CA 4KT6A 2R7SA 4XN0A 3OOUA 3BG6A 4E6KG 3A2KA 2IGOA 2HU9A 2RREA 1WJ5A 2Q2EB 2DT7B 4CCJA 3MKWB 2W1OA 4PJMA 2V26A 4LIUA 1WJEA 2VQGA 1IRXA 2K3PA 4U7BA 2LOOA 3OYIA 3VDXA 1WJBA 4BACA 4B43A 2E5NA 2JSPA 4XKWA 5LD2C 4IKFA 1TZLA 4XLFA 3ZR8X 1WFXA 2R7XA 4FETA 4E7ZA 2CV2A 1K6YA 3DPUA 2AQFA 5JHFA 4YRVA 2VJ5A 4HG2A 4BL0B 4LIVA 4B47A 3HL2A 3I3LA 4CCNA 3K4JA 2Z1DA 4CCMA 1OR7C 2ZFUA 2PJRB 4P5OA 4XKBA 4XOPA 3EPZA 3LSGA 2CUZA 2LY2A 4CCKA 3QODA 1D0ZA 2A5WA 4XLEA 1WJAA 2X6WA 4BQNA 4BU2A 1BOBA 4XLAA 1PYVA 3H5AA 3SEQA 2R7WA 3K6GA 1ERDA 2VPLA 4NQWB 3TMOA 4OAZA 2XAUA 4XNFA 4KITB 4PK4A 3OYHA 2V9KA 2ZSIB 3DLAA 2L9NA 2LG4A 3PJRA 3ONQA 3CP2A 1QHGA 3W2VA 4CUGA 2V6EA 3IAS2 4CZCA 2F6CA 3L2QA 4XR6A 1D1BA 2K9LA 3HXLA 3RTRA 2KPMA 4XOTA 3DTEA 3BLYA 2KHMA 3D5LA 3MKZA 1Z3YA 2CW7A 2F4IA 4AU7A 2WA0A 4DBRA 2WY8Q 2BW3B 3C2HA 3D5SC 3DPTA 1MMGA 3RQ4A 2LRDA 2A6TA 4BS9A 3KX2A 4J01A 3QYFA 2ZXIA 3PFYA 4QPQA 4N4OB 4BJ6C 5KCMA 2M4KA 2IS1A 2BOLA 3HUGB 4ITVA 2LBFB 3LSIA 2CV1A 2E1MC 4HSRA 3UR3C 2IGKA 2P0WA 3OYDA 3K70D 2FUG2 3BC8A 1YX3A 2CW8A 4XM3A 2L9SA 3U21A 1X19A 2X1CA 3OS1A 1Z3XA 1R6RA 3BCBA 4F55A 2CV0A 2PMZA 3S93A 4NC7A 3TBIA 2IS2A 2Z16A 3OS2A 1P9QC 4NC8A 2E1MB 2CH0A 2L7KA 4HNUA 4XKVA 4GRIA 4E4HA 5HNHA 4YELA 2X6XA 2E5ZA 3IAM2 4BE2A 2M3AA 3OYFA 4C2TA 1VZ0A 3VWBA 3UNGC 2XF5A 1D0XA 1NG7A 5CQGA 3VSLA 5FROA 4KISA 3HG9A 4QPOA 2JVGA 1X1DA 3HC7A 1QU3A 3S3MA 1X4OA 4OAYA 4BJTA 3TL4X 3HKZA 3S3OA 2RNGA 4OWRB 4E7HA 3OY9A 3MKYB 4AYBA 2RQQA 1N75A 3K70C 3G2BA 3C2GA 4RMNA 1TT0A 2WAEA 3H35A 1YX5A 3HPHA 3OL4A 4HEA2 3ZCOA 1BR4A 5KHDA 3K10A 3M1CA 2IXSA 2WY7Q 2ELJA 2UV1A 4PFPA 4Y33A 1MMNA 4ZYAA 2V4JC 2KLOA 4JOMA 3CP8A 4PUSA 2HVQA 2HDWA 3PNTA 4XONA 2VKDA 2LREA 1UG0A 1DQUA 2UUZA 3AFHA 4BE1A 3QOEA 4HPQA 2R7OA 2NOJB 1SAUA 4ZDOA 1WJFA 3CJQB 1SFKA 2CUJA 4G6TB 4KJZA 2HNHA 2X51A 3L2VA 4F92B 4ZTFA 1U0JA 2IGMA 2KZVA 3OYGA 2DJIA 1E0EA 4BEHA 3CJRB 1MNDA 3PSIA 1X1AA 4IQ4A 4DJAA 2OV7A 3OWTA 2VASA 3DTIA 4CSWA 4X0GA 1GLNA 1X4PA 2MYSA 2VQCA 3ZGKA 3LFUA 3K4MA 4AVZA 4C9YA 4Y3OA 5HLTA 3OIPA 4P1WA 3DWLE 4BQQA 1NG6A 4DIQA 2VLAA 3K4KA 3H9QA 2VXZA 2X85A 3H5RA 1D1CA 5LFAA 2L5QA 3SYTA 4II3A 4MLOA 2HQAA 2VJ4A 2HPIA 3FBNB 4BJ5C 3MD2A 4II2A 3VYSB 2JUGA 2WBMA 3LSHA 4ZTJA 1WJDA 4XKCA 1KONA 3VSKA 2W82A 3OYNA 3HOSA 3BCAA 2BVMA 3V42A 1D1AA 4BE0A 3F9KA 2Z2SB 1HA8A 3QYEA 1Z7LA 2LH9A 4CH7A 4IZZA 4BGDA 2XSJC 3DQVC 3S8PA 4CA0A 4PJLA 3OS0A 4PSWA 3E0JB 3SDBA 2X1EA 3OMYA 3SEZA 3OYCA 2IS6A 1D0YA 1FMWA 3K4LA 4PSXA 3AKZA 3VYTB 4XLCA 3H5NA 5KNLA 4CCLA 4YEJA 2WAFA 2I8DA 4HSTA 4B48A 3AL0C 3OYAA 3VYRB 3VYUB 2KDOA 2AQEA 2CS3A 1UAAA 3QYBA 3PL8A 3OR1C 3D5RC 3SZGA 4PJNA 4J00A 1Y56A 4B3XA 2PJRA 1V5FA 3K4BA 3H0DA 2R7RA 1Z21A 1G59A 1OLTA 2W4SA 2WB1A 4BQOA 1EA3A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2M0M A;  2K3P A;  2KHM A;  2MFZ A;  2MAB A; 
#chains in the Genus database with same CATH topology
 4M6V A;  3RKY A;  4D5F A;  5E3O A;  4R79 A;  2IA2 A;  2IGN A;  1AOY A;  5LBQ A;  4BDY A;  1U3E M;  2VIX A;  2E1N A;  4BUP A;  2FMY A;  2ZXH A;  2COM A;  5CPR B;  1OR7 A;  4B44 A;  1XGM A;  4EM2 A;  3L00 A;  4JP0 A;  4IOC F;  1U6G A;  3ZN0 A;  4X1E A;  1RKW A;  3FHN A;  3RPQ A;  1O7L A;  2R7Q A;  1ZK8 A;  3RKQ A;  1E3H A;  2FEZ A;  5DCM B;  1J59 A;  3WE3 A;  4LK0 F;  2H6B A;  4D9J A;  1FMV A;  1B9N A;  1ODD A;  3ELK A;  1T56 A;  2BZT A;  3W6K B;  3PNV A;  3FXL A;  4WXC A;  1HSJ A;  1V4R A;  1IXS B;  3J7Z I;  2HVR A;  3K0L A;  3MQ0 A;  3IP4 B;  2L9V A;  1XCB A;  4KYW A;  2R5Y A;  1YFH A;  4MIM A;  1P4X A;  5HVQ C;  3OV8 A;  2QGU A;  3V8K A;  3EUK L;  2KIS A;  2K9S A;  3HPG A;  2XAS A;  3SXY A;  3WHB A;  2OF7 A;  3I55 I;  4BNC A;  2ZSH B;  2JZY A;  1FNN A;  2OAZ A;  4UVA A;  5M3M J;  1RR8 C;  4ZJZ A;  4RBO A;  1E2X A;  5LRS A;  3H3Z A;  2LBF A;  1LJ9 A;  2FBH A;  3J7A Y;  1F9N A;  3CCE I;  2OCC H;  4UHT A;  1U9N A;  1TT5 B;  3DU6 A;  3NEU A;  1FYL A;  2Z33 A;  4Y4R A;  1YO5 C;  2E60 A;  2GLO A;  3F8M A;  1RRJ A;  3PSF A;  4XBF A;  3CDI A;  4IF4 A;  1WRJ A;  4XL9 A;  1SVO A;  2O3F A;  5IT3 A;  1K78 A;  4I01 A;  4JQF A;  5CKT A;  2G7H A;  1HDD C;  3DEE A;  5ICC A;  1T95 A;  1L0O C;  3ABM H;  2NAZ A;  3HB9 A;  1DPU A;  2DOA A;  3F72 A;  4L9J A;  2HDD A;  3LMM A;  3LWF A;  2V79 A;  3U9G A;  3F22 A;  2O61 A;  3TW7 A;  4H4K C;  5FLX Z;  2RDP A;  5ICG A;  4IO9 F;  3R61 A;  1XGO A;  2VJI A;  4I0A A;  4WXD A;  2P5K A;  2E2H J;  3KYD B;  2EZK A;  1BJA A;  2MAB A;  1ORK A;  2EFN A;  1PJR A;  1VQK I;  1LDK B;  2Y75 A;  2VOP A;  1J09 A;  5ICE A;  1S9H A;  1VQM I;  2EZL A;  1IW7 F;  1WQ2 A;  2RVC A;  5H20 A;  4RGR A;  2NVU B;  2W00 A;  1O3S A;  5GPC A;  1R00 A;  1W36 D;  1ETK A;  1YE9 A;  1UJ8 A;  1SD4 A;  2LP0 A;  2E34 A;  2XPW A;  3IH4 A;  3DLL F;  5A2Q Z;  2KQR A;  4XN3 A;  1B59 A;  4BKX A;  2NNY A;  2DA4 A;  1DUX C;  2XKP A;  5HNF A;  2BVL A;  1FBQ A;  4KDP A;  3RPU A;  2DMN A;  2L02 A;  1QA6 A;  3DKX A;  1ZHF A;  2ISZ A;  4Z6Y A;  4F3Q A;  2KP6 A;  3L9F A;  1YTY A;  5J4V A;  2CO5 A;  4QSH A;  1X58 A;  4FT8 A;  1OYY A;  3EDP A;  3RCO A;  2IAI A;  1Y6I A;  3CZ6 A;  4IEJ A;  1T0F C;  2K3F A;  4U88 A;  3RJP A;  4FX4 A;  1U5T A;  3T1B A;  4J19 A;  1E3P A;  4YFN F;  2HI3 A;  2BGC A;  2RGV A;  4IHW A;  1LFP A;  2DA1 A;  3PNY A;  4E7S A;  4YIF A;  2GM4 A;  1JI8 A;  3KP2 A;  3MEX A;  1OCZ H;  2LC2 A;  5LHI A;  5GAD J;  2BEO A;  2A5Y B;  5D4S A;  3E97 A;  4A2U A;  1BW5 A;  3NWT A;  1YQA A;  1ETX A;  4PGG A;  4LG0 A;  4L0Z B;  1RKT A;  4CHU A;  2DMP A;  4UUS A;  1LEA A;  5KAI C;  5E1Z B;  3CUQ C;  4S05 A;  5EDN A;  2AXT C;  1A5J A;  3EUA A;  2FU4 A;  5B5E C;  1YLF A;  2DQL A;  4PJJ A;  3HBL A;  3I0T A;  1YS6 A;  3ZOB A;  1Y39 A;  2R7T A;  2VKH A;  3LA7 A;  4F91 B;  2IVM A;  1JKP C;  4YG2 F;  3G1M A;  4EJW A;  3GWZ A;  1CQT A;  1E3O C;  3SFZ A;  1Z0X A;  5FGM A;  3BR1 A;  3SDG A;  1LFB A;  5FD6 A;  1XTA A;  1ACI A;  3H36 A;  1SEU A;  3CQZ J;  3S16 J;  1BI1 A;  1FC3 A;  1ZQ3 P;  2GXB A;  3A2K A;  2V9V A;  2BY0 A;  1WJ5 A;  2EK5 A;  3TO7 A;  4Q4Z F;  1K79 A;  1WZ2 A;  1R23 A;  1R5G A;  2FD5 A;  2W1O A;  3FIW A;  4LIU A;  1Y0U A;  3FKI J;  1ZLK A;  1QO0 D;  2KZG A;  2K3P A;  1SD5 A;  2LOO A;  2P4W A;  3BZC A;  3DBH B;  1JKO C;  1I5Z A;  2IT0 A;  5CJ9 A;  2K02 A;  4M9S A;  4EGY A;  4UV9 A;  3RYP A;  4P9U A;  1ETO A;  1QRY A;  2VBY A;  2E5N A;  3I54 A;  2JN6 A;  4IKF A;  1BOA A;  3ML6 A;  5KK1 A;  4XLF A;  2BHY A;  1WFX A;  1VFC A;  2HS5 A;  2XRN A;  2A69 F;  3AG2 H;  1GT0 C;  1K6Y A;  5JHF A;  1HCR A;  3ZQC A;  1XX5 A;  1FOY A;  2HR3 A;  3DF8 A;  4HG2 A;  5LGT A;  3HL2 A;  3C1D A;  4CXF A;  1G2H A;  1VQL I;  3GTQ J;  4M9X A;  4A0X A;  4P5O A;  2L54 A;  5K5O A;  3I5U A;  4XKB A;  4XOP A;  1B4A A;  4CCK A;  1D0Z A;  3HIF A;  4XLE A;  3BTL A;  2X6W A;  2DA7 A;  1BOB A;  1T98 A;  5L3E A;  3BWG A;  2H27 A;  3K6G A;  2VPL A;  1V54 H;  4Y7N J;  3S15 J;  1VI0 A;  4ZH4 F;  4KIT B;  4PK4 A;  3OYH A;  2V9K A;  2QSG X;  4A3I J;  1FSE A;  5JHU A;  1ETQ A;  5L3D A;  2ZSI B;  3DLA A;  2L9N A;  2LG4 A;  1LPQ A;  3ONQ A;  1FBS A;  3FXM A;  3IAS 2;  5IP7 J;  3FWE A;  3WHC A;  1D8J A;  5IYC J;  2K9L A;  4XRS A;  5GAH J;  3F6O A;  2YSR A;  3GTK J;  4HX7 A;  4XOT A;  1GUU A;  3PO3 J;  3QPL A;  2BHZ A;  2L0K A;  2R5Z B;  1MDM A;  2CW7 A;  3CCL I;  2F4I A;  1LNW A;  2E71 A;  4W1U A;  5TJJ A;  2WY8 Q;  2DA2 A;  2HTS A;  3DPT A;  4HF1 A;  3M8E A;  3K1P A;  3S1Q J;  1K6O A;  1FIP A;  2YPR A;  4GGG A;  5D6E A;  3T8T A;  2ZXW H;  4AIJ A;  5C4J J;  2ZXI A;  3PFY A;  1QBJ A;  2W24 A;  3IV5 A;  4UB8 C;  2M30 A;  3Q3S A;  2BOL A;  3KLO A;  3QPH A;  5FKL A;  3CMY A;  2E1M C;  2QVO A;  3VB2 A;  3WU2 C;  4M9Z A;  4D7N A;  2P0W A;  1N25 A;  2MG4 A;  2FUG 2;  1YX3 A;  5B1A H;  1ENH A;  5F64 A;  3IH2 A;  4XLP F;  3U21 A;  4AVP A;  3BTJ A;  3VOE A;  2HYG D;  2LLK A;  1EKE A;  2PMZ N;  2PMZ A;  2ZKZ A;  3S93 A;  1SFE A;  4NC7 A;  3TBI A;  2I5U A;  3OS2 A;  1P9Q C;  1QZZ A;  4ENJ A;  3F8B A;  3RIR A;  2CH0 A;  2ZME B;  3FZV A;  4XKV A;  3TDZ C;  4HA8 A;  2JRT A;  4ASN A;  1JTY A;  1VZ0 A;  3FXO A;  1UMQ A;  2IEK A;  3KYC B;  4QPO A;  2JVG A;  4JX5 A;  2VPR A;  4QTR A;  2QUF A;  1X4O A;  1RET A;  4RGX A;  4ABZ A;  4BJT A;  2O6G E;  3S3O A;  4KMU X;  2F2E A;  4DZJ A;  3MKY B;  3K70 C;  4AUX A;  5K1Y A;  5FLM J;  1OMI A;  4HEA 2;  1BR4 A;  3DXJ F;  1XSD A;  4WX9 A;  1NTC A;  2WY7 Q;  2VKV A;  4D5C A;  2H09 A;  4Y33 A;  1MMN A;  2F5F A;  4BHC A;  4BY7 J;  1PP8 F;  1O3Q A;  1P6R A;  2CQK A;  2HVQ A;  5F1R A;  2B0L A;  5J6X A;  3PUF A;  3U1K A;  1WSU A;  4XON A;  3CDH A;  5E17 F;  1GHC A;  1Z6R A;  2ZFW A;  3JRH A;  3K1N A;  2EBI A;  2B63 J;  3K1M A;  1PVE A;  2Y0M A;  1WJF A;  3CJQ B;  3JRE A;  3S14 J;  2W25 A;  1RPW A;  3DBL B;  5JLX A;  5BQT A;  1B72 A;  4KJZ A;  3L2V A;  1P7I A;  4ZYD A;  4ZTF A;  5D4R A;  5BOX A;  4B09 A;  2DTZ A;  1BW6 A;  4YII A;  4UY8 I;  3GEZ A;  1BIA A;  2G7U A;  1KYZ A;  4BEH A;  3F6V A;  3HUG A;  1RES A;  2EFW A;  1IV8 A;  2OV7 A;  3CF5 F;  3OWT A;  1S7A A;  3DTI A;  1JUM A;  4A0Z A;  2MC3 A;  3LST A;  1Y8Q B;  4X0G A;  1QVU A;  1X4P A;  2H1K A;  4ZYG A;  1HW2 A;  4C9Y A;  3L1P A;  1OYW A;  3OIP A;  3CCM I;  1T6S A;  1P7J A;  4ON0 A;  5HOD A;  4P1W A;  1MJ9 A;  2DK8 A;  5FKN A;  1R58 A;  3M07 A;  3BQY A;  3LOC A;  3BG9 A;  3EYY A;  3MN2 A;  3W6V A;  3KP6 A;  3CCJ I;  1MSF C;  3ROU A;  4KT5 C;  2VC0 A;  3RKW A;  2Q8K A;  4II3 A;  4MLO A;  5LGN A;  1T8I A;  2B9S A;  1QPI A;  2ZJ2 A;  1UG2 A;  1WJD A;  1JHF A;  1WGX A;  3VSK A;  2PBI A;  3Q5F A;  3BCA A;  3V42 A;  1KU3 A;  1D1A A;  5BNG A;  5D8K B;  5K7Z A;  4OIP F;  2F5C A;  3JSO A;  3CO7 C;  2EZI A;  1HA8 A;  5JFR A;  4CH7 A;  4IZZ A;  2QEN A;  2DI3 A;  3F21 A;  5TIS C;  1ETV A;  1MJB A;  2XSJ C;  4GDF A;  3IKT A;  3DQV C;  5D5X B;  3S8P A;  4CA0 A;  3PIO F;  4BQA A;  1KQ9 A;  4U0Y A;  2YX4 A;  3OS0 A;  4GYG A;  4PSW A;  2E36 A;  1ZRD A;  3E0J B;  2OD5 A;  3BJA A;  3SDB A;  2NVX J;  3SEZ A;  1CF7 A;  3JAM K;  1ZGW A;  2EFP A;  5H6Q A;  4OIR F;  1FOX A;  4PSX A;  3AKZ A;  2ZC2 A;  3H5N A;  5KNL A;  3TP3 A;  9ANT A;  2E2I J;  4EJO A;  4YEJ A;  5B66 C;  2H94 A;  2PEX A;  4HX8 A;  4S04 A;  4G12 A;  1ON1 A;  3HRT A;  3QYB A;  3OR1 C;  1TQP A;  3SZG A;  2A05 A;  3O2P E;  1V3F A;  1W4M A;  1FPQ A;  5HS9 A;  2W85 A;  1Y56 A;  1LDJ A;  5J1R A;  5CVU A;  3H0D A;  3CC7 I;  2K9N A;  1OLT A;  1P2F A;  1J7K A;  4HF2 A;  3QYE A;  1EA3 A;  2FBK A;  2HOA A;  2FRH A;  1NHA A;  2LY1 A;  3BZ6 A;  3H9G A;  2M34 A;  2YUS A;  3WTV C;  1OQY A;  3FKJ A;  3HRU A;  4MEY F;  1K7A A;  2NNN A;  1XN7 A;  1MNE A;  2LYC A;  3CTA A;  1FEX A;  2BY1 A;  1UST A;  2VJJ A;  2F48 A;  2K5C A;  1X3Z B;  1S5L C;  1XD7 A;  4ENN A;  2VC1 A;  4HNT A;  5E1X A;  1EJ9 A;  2RC4 A;  4OIQ F;  3PIP F;  2Y31 A;  1IGN A;  2ZJR F;  3BDD A;  2Y30 A;  1SMT A;  1X2N A;  2LF7 A;  3S1M J;  3K4C A;  2QBY B;  1I3Q J;  1STZ A;  1QHH D;  3T8R A;  5LGU A;  3IRQ A;  3JRD A;  2R4G A;  5FRM A;  5A2Q K;  3EET A;  4HV6 A;  2CG4 A;  3GZ5 A;  3GTP J;  3OYB A;  3LL7 A;  4IHS A;  3GFM A;  3W2W A;  5HDN A;  1FJL A;  1H9T A;  5J3L A;  3FXR A;  3I9V 2;  3R0A A;  2ECB A;  1ITY A;  3I59 B;  5H6R A;  3GBG A;  1A6Q A;  2IS4 A;  3ZMU A;  1XPX A;  2HZD A;  2CMP A;  2ELH A;  3HHG A;  4HRI A;  1OIS A;  1TWG J;  3ECH A;  2CFX A;  2OC6 A;  2NVQ J;  4ZC3 A;  3M1E A;  3IHU A;  2XC7 A;  5DUI A;  1IDZ A;  3MZY A;  1G8X A;  4D7M A;  4N4N B;  2BE5 F;  4EAT A;  2O0Y A;  1G3Y A;  3K4N A;  3VEP A;  2QZ8 A;  2D45 A;  2XAG A;  2BY3 A;  3GTM J;  2XDV A;  4C30 A;  2JTV A;  3L2W A;  1G3S A;  4RA2 A;  4DYQ A;  1WVR A;  2JA2 A;  1LDD A;  3P9I A;  5GP9 A;  1N78 A;  3PO2 J;  5KAF C;  2VQL A;  1WJC A;  1RUN A;  5GPA A;  3WTT C;  1BI2 A;  4DW6 A;  3FMS A;  2OTJ I;  2K85 A;  4BXU A;  3IRR A;  3K69 A;  1K83 J;  4FE4 A;  5FB2 A;  1MMS A;  5TRD A;  1APL C;  2LK2 A;  1I6X A;  4B3A A;  1DGR M;  4E7L A;  4P96 A;  1TQM A;  2LR8 A;  5TGT A;  3TP0 A;  3UKG A;  2DYR H;  1MSE C;  4R8H A;  2CQ7 A;  2EIK H;  3LAJ A;  3RI4 A;  2CQX A;  3I56 I;  1A36 A;  3PM1 A;  4XLN F;  4RM3 A;  5DDG A;  3J81 Z;  4XSX F;  4LG3 A;  2Z5U A;  4L9V A;  3QOP A;  3W2A A;  2O5R A;  4NHJ A;  3C3W A;  2PN6 A;  1VQP I;  3OYK A;  2P7V B;  5HDK A;  4RAF A;  5J8C A;  5J8F A;  2LKS A;  5EG0 A;  2VB6 A;  1AWC A;  2MGQ A;  3EUH C;  2JPC A;  1YIJ I;  2F5D A;  3BR2 A;  5DD4 A;  3VFZ A;  1B8I B;  3OYL A;  1W36 C;  4L9T A;  5EYR A;  3RSN A;  1W0T A;  1RUO A;  4AM3 A;  2DXI A;  2GOM A;  2ZME C;  5HOO A;  4CIC A;  2JSC A;  3WTW C;  3V7S A;  3RPU D;  4XQF A;  2HQR A;  5DUK A;  3S32 A;  3IUO A;  3MMY B;  3IWZ A;  3CME I;  2DMT A;  1XGS A;  4F52 A;  1VQ4 I;  4HDU A;  3BG7 A;  4DYR A;  3LSK A;  3BPV A;  3FMQ A;  5E3L A;  2OQR A;  4RLQ A;  3ERM A;  4C3H J;  3HOV J;  2P6S A;  4M3D A;  2X6Y A;  2E7W A;  5F0F A;  2GXG A;  5M5Y J;  5E3M A;  3ZRG A;  2JA6 J;  2M7A A;  4HNV A;  2UWM A;  1Z7U A;  3KZY A;  2P5V A;  4DOZ A;  1OFC X;  1NK2 P;  2Y0S N;  2A6H F;  2Y0S A;  2YX7 A;  3CLQ A;  1ZRF A;  4CZZ A;  3ABT A;  2QQ9 A;  3H9J A;  4KT6 A;  4XN0 A;  2JJ7 A;  1UHS A;  4E6K G;  2XIG A;  3JAM Z;  2EV0 A;  2RRE A;  3H0G J;  3ZQL A;  3FXQ A;  4BAY A;  2PLY A;  2DT7 B;  4CCJ A;  5F0H A;  4N9H A;  4OIO F;  2ECC A;  2VQG A;  2HXI A;  3VDX A;  1OCT C;  3N4M A;  4IPA A;  2JSP A;  2OPT A;  4JX6 A;  5LD2 C;  1ZG3 A;  1IXR C;  2CW0 F;  5DD8 A;  5F1J A;  3FM3 A;  3GLX A;  3CC2 I;  2R7X A;  1YIO A;  4FE7 A;  5LLQ A;  2LKP A;  1X2M A;  4E7Z A;  2AQF A;  4UNO A;  1MBH A;  2QLZ A;  1BC8 C;  1LEB A;  3O8H A;  1BJZ A;  2VJ5 A;  4BL0 B;  4LIV A;  4A6E A;  2L3D A;  2CQN A;  3K4J A;  2Z1D A;  4EEF G;  4G9Y A;  1I50 J;  1IUY A;  2O8K A;  3PQJ A;  2PJR B;  4FHT A;  3EPZ A;  3LSG A;  4FTH A;  2YR2 A;  2DFE A;  1GXQ A;  2A5W A;  2CGP A;  1JGS A;  2V1D A;  3U2R A;  1DPR A;  2AS5 F;  1WJA A;  3BG5 A;  3KEQ A;  4BU2 A;  4XLA A;  1PYV A;  3L7W A;  1TBX A;  2QQA A;  3BPX A;  4NQW B;  2NOG A;  2XAU A;  1OCP A;  1R4M B;  4IXA A;  1QPM A;  2KIF A;  4IOA F;  2H8W A;  3IWF A;  1VQO I;  5ILS A;  1E17 A;  4RAG A;  2H6C A;  3M9A A;  2IP2 A;  4ESJ A;  3CP2 A;  1SAX A;  4CUG A;  3QAH A;  2JPB A;  4WCG A;  2KIQ A;  3L2Q A;  5J1Y A;  1I6H J;  2JT1 A;  3HXL A;  5DM7 F;  2MH2 A;  3DTE A;  1WH5 A;  2KHM A;  3D5L A;  2R5Y B;  1EH7 A;  5IY5 H;  2A68 F;  5IYD J;  2WA0 A;  1FX7 A;  3JR9 A;  3R6S A;  3HGY A;  1QNT A;  2UZK A;  3WGH A;  4KN4 X;  2LRD A;  1SFO J;  1XSV A;  1IF1 A;  3KX2 A;  4J01 A;  1S29 A;  1YRN A;  5F27 A;  2HDC A;  4N4O B;  4GCV A;  2R7D A;  2M4K A;  4K2E A;  5J40 A;  3GF2 A;  1X3U A;  2E2J J;  2LBF B;  3LSI A;  4I0B A;  2ME6 A;  5CLS A;  2DMU A;  3OSG A;  2DJN A;  1FIA A;  2I10 A;  1JHH A;  5JI6 A;  3OYD A;  3QQA A;  1J5Y A;  4L5J A;  5FKO A;  5HS7 A;  2CW8 A;  1TW3 A;  3ABK H;  3KZI C;  1OJL A;  2L9S A;  2X1C A;  2L4M A;  3OS1 A;  1MBF A;  1Z3X A;  2CV0 A;  1K78 B;  4MNU A;  3HRS A;  1HST A;  3M7G A;  1ZN2 A;  2Z16 A;  4NC8 A;  1FP1 D;  5E1W A;  1ZLJ A;  5D5V B;  3MWM A;  5HNH A;  4BE2 A;  3WTY C;  2X6X A;  4A5N A;  4BHB A;  2M3A A;  1R1U A;  1BI3 A;  3OYF A;  4G7Z F;  4C2T A;  5IT9 Z;  5CYV A;  1D0X A;  5GAG J;  1NG7 A;  5FRO A;  4KIS A;  3GUD A;  1X1D A;  1HW5 A;  2EA2 A;  1QU3 A;  3HOW J;  1MNM C;  2PQ8 A;  5DCF A;  2XAH A;  4OAY A;  3WG9 A;  3TL4 X;  3HKZ N;  3HKZ A;  2QEX I;  1FOK A;  1PDN C;  2NS8 A;  1ZRC A;  4E7H A;  4TV7 A;  4H0E A;  4E70 A;  4LLL A;  1R7J A;  3G2B A;  2E19 A;  4RMN A;  1J2X A;  1TT0 A;  2J5O A;  3OIO A;  2RKH A;  1I39 A;  3JRG A;  2PG4 A;  3MAJ A;  3HPH A;  3OL4 A;  4I76 A;  3S2W A;  2P6T A;  2XRO A;  5BPI A;  1WKM A;  1F36 A;  2DTR A;  1R9T J;  2FQ3 A;  2X4H A;  3I53 A;  3I71 A;  1J9I A;  2FJ1 A;  1UCR A;  2CUE A;  3Q0U A;  4JYK A;  4JOM A;  2QF7 A;  4LMY A;  3LNQ A;  5EEG A;  2HDW A;  2WWY A;  3CCS I;  2R5Z A;  1GXP A;  3L09 A;  3PNT A;  1A04 A;  5FD5 A;  1IRZ A;  3MCZ A;  1IN7 A;  1W7P D;  1DQU A;  3AFH A;  4BE1 A;  5IOZ A;  1A6I A;  4ZDO A;  4ENK A;  1Y8R B;  2EQR A;  2V9P A;  2ICW G;  2DFF A;  1TNS A;  3CCV I;  3NRV A;  1U2W A;  4O5V A;  4IQ4 A;  4DJA A;  2MA3 A;  3HRM A;  2VAS A;  5F0C A;  3BZK A;  3LQQ A;  2MYS A;  3ZGK A;  3LFU A;  1RZ4 A;  4G6D A;  5IPA A;  3HDD A;  4Q47 A;  1R5I D;  3DWL E;  5J1U A;  1NG6 A;  2VLA A;  2Z99 A;  3R0J A;  1Z05 A;  3H9Q A;  4A0Y A;  1BC7 C;  1PUE E;  4LG0 B;  1ZH5 A;  1UHW A;  5DS9 A;  2NXN B;  2HQA A;  3ECO A;  2LVS A;  3FBN B;  3BTC A;  4L5I A;  4HZF A;  4BJ5 C;  1Z77 A;  3MD2 A;  3G73 A;  3BTI A;  4II2 A;  3VYS B;  1Y1W J;  3LSH A;  4U0V A;  3RYR A;  3S1R J;  4EGZ A;  4ZZL A;  1YJ9 I;  1IRF A;  3S2D J;  4JBA A;  3GXO A;  2JK3 A;  2BVM A;  2EFO A;  2HXO A;  1M1E B;  5IP9 J;  4KIC A;  5EGO A;  5LHH A;  1YJN I;  3ABL H;  1FY7 A;  3F9K A;  2RV8 A;  5ILU A;  2Z2S B;  3JTH A;  2W57 A;  1Z7L A;  3Q0V A;  4G94 A;  2HKO A;  2Q2E A;  4NDL A;  1H0M A;  1I27 A;  1T38 A;  3O8G A;  2VE9 A;  3BP8 A;  2VKE A;  3BY6 A;  1WI9 A;  2Q0O A;  2X1E A;  4L18 B;  3SHF A;  1MJA A;  1ZR4 A;  3ZQI A;  3OYC A;  4XRM A;  2IS6 A;  3CUO A;  1D3Y A;  2EIJ H;  1D0Y A;  2A3S A;  1FMW A;  3K7A J;  2XUB A;  4EM1 A;  4CCL A;  1ZR2 A;  4IHT A;  4X6A J;  4LB6 B;  3FK6 A;  5CVJ A;  1F5T A;  3I4M J;  3LSJ A;  4HLX A;  1LFU P;  2I8D A;  1YI2 I;  1FZP B;  4HST A;  1YHQ I;  3VYR B;  1IO2 A;  4U7D A;  3KIO A;  2DN0 A;  1JTX A;  2AQE A;  3G1L A;  4NBQ A;  3HGG A;  3KLN A;  3D5R C;  3SQN A;  3RKX A;  2DYS H;  3BOQ A;  4PJN A;  2E7X A;  3IC7 A;  4J00 A;  3IL2 A;  4ZYH A;  3CJT B;  1FT9 A;  1Q1V A;  3K4B A;  2YS9 A;  2EV5 A;  2RAE A;  2R7R A;  1G59 A;  3C18 A;  4YFX F;  1REP C;  5ED4 A;  2W4S A;  4WF2 A;  2DFI A;  4BQO A;  3OYJ A;  1H88 C;  4BDZ A;  4NUB A;  1AA7 A;  4KIG A;  1BA5 A;  3OYE A;  1MGT A;  1BR2 A;  1S6L A;  4ANJ A;  2Y9Z A;  1SC7 A;  5L3F A;  4KIF A;  1TWC J;  3WU0 A;  1HDP A;  2CYY A;  4ENM A;  4C2U A;  2L7F P;  3T0Y A;  4FCY A;  5EEH A;  3ZXS A;  1R49 A;  4UVC A;  4LB5 A;  4HF0 A;  3DPL C;  1JJ8 C;  4FIS A;  2LNB A;  3LSM A;  4RDU A;  2R93 J;  2ZXJ A;  3D0S A;  3AG3 H;  3NWS A;  1NH3 A;  5CVV A;  2A6E F;  4EJV A;  5FKM A;  3EQL F;  4Q5S F;  1U78 A;  3HSR A;  4A12 A;  2F5V A;  2E1O A;  2O7O A;  2L2O A;  1MDM B;  4RLF A;  3KP4 A;  3TQN A;  3ESW B;  2GOX B;  1HF0 A;  2BW3 A;  2L01 A;  3Q0W A;  1K4T A;  3FF5 A;  1QQI A;  3DTK A;  4G7H F;  1RI7 A;  3ZQF A;  3P5J A;  3J81 K;  1J75 A;  2HYF A;  3IKV A;  2ZB9 A;  1V5G A;  4PDK A;  2Y48 A;  2C6Y A;  2M4G A;  2G0E A;  1IRG A;  2DT6 A;  1W1W E;  1W5T A;  4F7Z A;  2HWV A;  3B6A A;  5B3S H;  4AIK A;  4CO8 A;  4MO7 A;  3KZZ A;  4XSZ F;  1H8A C;  4I99 C;  1Y0N A;  3P9C A;  2WAQ N;  1VQN I;  2WAQ A;  3ZQ7 A;  1JUS A;  2ID3 A;  4CYC A;  2XB5 A;  1LKX A;  2FOK A;  1T0F A;  1FTT A;  4A3E J;  1IN5 A;  1HW1 A;  4DBQ A;  1SFX A;  2K7L A;  2LF8 A;  1LE8 B;  3DU5 A;  2OA4 A;  5JLW A;  2R7V A;  5F08 A;  2ETH A;  5M5X J;  2DLL A;  3I58 A;  3MZ8 A;  1XSX A;  1FOW A;  4YIR X;  4W97 A;  4ZDL A;  2VI6 A;  3GLL A;  2OZU A;  1IG7 A;  2FNP A;  3LA3 A;  1WH7 A;  4UVB A;  4ZDP A;  1LVK A;  2XAQ A;  2Y9Y A;  3L2U A;  1VQ6 I;  1W7P B;  4RM2 A;  3CUQ A;  3HEF A;  3M8F A;  1MMD A;  1ZEL A;  4M71 A;  3HYI A;  1VQ8 I;  4IX7 A;  3V7C A;  2V6C A;  4CCO A;  1IXC A;  3M8J A;  3BT9 A;  3FDY A;  1A31 A;  3O6B B;  2RNJ A;  1AKH A;  2ADU A;  5CQE A;  3GTJ J;  4UV8 A;  3LA2 A;  1F1Z A;  3JRA A;  2X9D A;  4PFO A;  4OMY A;  2XF7 A;  3LSP A;  1POG A;  2IPQ X;  3L2R A;  1IDY A;  2GZW A;  3S3N A;  1ONV A;  3CCQ I;  4UUT A;  4DYC A;  1R5H A;  1P4W A;  1BM9 A;  3QPT A;  4A69 C;  1MW7 A;  2VXD A;  2CU7 A;  2O03 A;  1VTN C;  2VQH A;  1ZGJ A;  3ABU A;  4G7O F;  2ELK A;  3CES A;  2M9H A;  2HKX A;  3DEW A;  1K4S A;  5J4Y A;  4D1Q A;  2HPM A;  2PI0 A;  3HTS B;  3I59 A;  3S17 J;  4BEH B;  2DOE A;  3BR5 A;  1RC9 A;  2X6O A;  3SZP A;  1WWX A;  1KZH A;  3Q9S A;  4HYE A;  1SMY F;  3C7J A;  3AL0 B;  2QKL B;  3DP7 A;  1JT0 A;  2LKX A;  3NAR A;  4IVN A;  2M8E A;  3VOD A;  1TL8 A;  3HSE A;  4IQJ A;  4JX4 A;  4RGU A;  5EJC A;  1WHU A;  1LB2 A;  5LEK A;  5E8I A;  1QGP A;  3CMM A;  4XLH A;  3F23 A;  4U87 A;  3T5X A;  2CJJ A;  1XDS A;  2QYO A;  4HDV A;  1TWF J;  1HC8 A;  1MMA A;  3OR2 C;  2CQQ A;  2Y2Z A;  3BR6 A;  4A3F J;  2CWE A;  4PCQ A;  2FOW A;  4Z2Y A;  4XMY A;  2ME0 A;  2QQ8 A;  2JVH A;  3ZQQ A;  4YFK F;  2GA2 A;  3W3C A;  3K9T A;  2ACJ A;  3BG6 A;  2P8T A;  1BIB A;  5D6F A;  1S7E A;  3WGG A;  1PUF A;  2IGO A;  3E6B A;  3FXU A;  2HU9 A;  3KFW X;  3KPH A;  5C44 J;  4M3E A;  3WU1 B;  2BYV E;  3VPR A;  3A01 A;  2JA7 J;  3PFI A;  4PJ0 C;  2ZCW A;  3MZH A;  3HJE A;  5LHG A;  2DBB A;  3A0B C;  1DU0 A;  4PJM A;  4ESB A;  2V26 A;  2IRF G;  1WJE A;  3L2C A;  1IRX A;  2HTJ A;  2MLK A;  3WTZ A;  1BBY A;  3CO6 C;  1IUF A;  5DYM A;  3ZMT A;  1WJB A;  4WK8 F;  4BAC A;  4B43 A;  2GQQ A;  3H3U A;  1IV6 A;  1YW9 A;  2FX0 A;  4XKW A;  4I98 B;  3F0C A;  1TTY A;  4HV5 A;  1P92 A;  4N9I A;  1ZRE A;  5JR3 A;  2CV2 A;  3DPU A;  1ZAO A;  2K4B A;  3ERE D;  3BQZ A;  5L3B A;  3E7L A;  2DA5 A;  2HZT A;  3I3L A;  1MBE A;  1I1G A;  4CCM A;  4IRH A;  3BRO A;  1TW2 A;  2ZFU A;  2LSO A;  4A93 J;  2DU9 A;  1D5V A;  2HEO A;  2CUZ A;  2GIZ A;  1F4K A;  3JW4 A;  1Z6T A;  2MSY A;  4MTD A;  4JK1 X;  2PMH A;  3WTX C;  1MBK A;  2KKO A;  3WE2 A;  1LUJ B;  2KT0 A;  1T08 B;  5EF6 A;  1U8B A;  3H5A A;  4IRG A;  2R7W A;  1FLI A;  4ETS A;  4Y13 A;  1XC5 A;  2VBZ A;  4NB5 A;  4OAZ A;  5F04 A;  4XNF A;  5IT9 K;  1HLV A;  3WG7 H;  1IJW C;  5DCM A;  1G3W A;  1O57 A;  3W2V A;  2XAF A;  3D1N I;  4QIW N;  1ZG5 A;  2F6C A;  1D1B A;  1OCO H;  2FE3 A;  3RTR A;  2P81 A;  1B1B A;  2KPM A;  4KFC A;  2VUM J;  3BLY A;  4A3K J;  1UFM A;  5J47 A;  3MKZ A;  5LRR A;  2FNA A;  2Z9O A;  3G71 I;  3I64 A;  4AU7 A;  5HLI A;  3C2H A;  1IZ1 A;  3V8J A;  3GO5 A;  1MMG A;  3RQ4 A;  2A6T A;  4BS9 A;  3TOB A;  1DP7 P;  3KP5 A;  2KIU A;  4IHY A;  5KCM A;  4KA4 A;  1ZKG A;  3GZ6 A;  3QU3 A;  4V2G A;  3HHH A;  3ZMV A;  4EMS A;  4CGZ A;  4I7H A;  1USS A;  2D5V A;  2NVY J;  3S1N J;  3KP7 A;  3H92 A;  1WI3 A;  1X19 A;  3HM5 A;  3HSF A;  4BBS J;  3BCB A;  3E6C C;  4F55 A;  3JRB A;  2IS2 A;  4A3M J;  2K27 A;  1J0R A;  2HFH A;  3K2Z A;  2E1M B;  1RR7 A;  2L7K A;  4GRI A;  3G4S I;  5CVR A;  4YEL A;  3IAM 2;  3E6D A;  1FYM A;  1ZG1 A;  3VWB A;  5GTH C;  3M4O J;  2DAO A;  2XF5 A;  3V8L A;  3M3Y J;  2ZBK A;  4BYY A;  2VON A;  1U8R A;  2X48 A;  1Z91 A;  3DBR B;  3S3M A;  2PJP A;  2MLG A;  4I02 A;  3ZMZ A;  4M3B A;  4IRI A;  4NQW A;  4OWR B;  3OY9 A;  3LQR A;  1KGS A;  3AG4 H;  3C2G A;  3P7N A;  4M6X A;  4V2F A;  5K5R A;  4A3C J;  1GV2 A;  3RZO J;  1XMA A;  3BG3 A;  3H35 A;  1Q1H A;  1YX5 A;  3ASO H;  1XG1 A;  5D8L B;  5KHD A;  3K10 A;  1XGN A;  3E5Q A;  3TKY A;  2MBF A;  2IBD A;  2P7C B;  3AAF A;  4ZYA A;  5IP6 A;  2KLO A;  5DM6 F;  2CUF A;  3R60 A;  4PUS A;  2ZJP F;  4CYD A;  1S3J A;  2VKD A;  4PZJ A;  4L9N A;  4U0W A;  2LRE A;  4XK4 A;  1UG0 A;  2UUZ A;  3QOE A;  2FQ4 A;  1EH8 A;  1MH3 A;  1C0W A;  1SFU A;  4UB6 C;  4G6T B;  2R0Q C;  2HNH A;  3BR0 A;  1U0J A;  2ZO4 A;  2B7E A;  2IGM A;  2KZV A;  5EG0 B;  3OYG A;  1H9G A;  1V55 H;  2DJI A;  3BJ6 A;  3GYH X;  3TW6 A;  1E0E A;  3CJR B;  1MND A;  3PSI A;  2M87 A;  1X1A A;  2AXL A;  2HOS A;  4KMF A;  1KU7 A;  4AVZ A;  3K4M A;  2NYX A;  4Y3O A;  2H8R A;  2D1V A;  2MW8 A;  3LSR A;  2VT3 A;  2H1L A;  2WC2 A;  4L0Y B;  3I4P A;  3K4K A;  4A3L J;  2EH3 A;  1VND A;  2GBY A;  1TWH J;  4RB3 C;  2X85 A;  1L3L A;  2NVT J;  1YG2 A;  1YYV A;  3DKW A;  5LFA A;  2JUC A;  3CCR I;  3SYT A;  5ERI A;  2M5W A;  1CGP A;  1VQ5 I;  2EV6 A;  2HPI A;  1TP4 A;  4ESF A;  3C2B A;  5LEJ A;  1KA8 A;  2JUG A;  2WBM A;  3OSF A;  1OCR H;  2EB7 A;  4XKC A;  5B1B H;  3ZQG A;  5GTI C;  3SZT A;  3OYN A;  1O3T A;  4M74 A;  2DA3 A;  1KU2 A;  5DEQ A;  1MZB A;  4BE0 A;  1XCV A;  3DEU A;  5HLG A;  4NC6 A;  2VE8 A;  3TDU C;  3CLO A;  1T2K A;  4RGS A;  3GFJ A;  2V1U A;  4PJL A;  5E3N A;  3H3V K;  5HS8 A;  1QVT A;  2QQB A;  6PAX A;  3GTG J;  3HOU J;  3OMY A;  1YOV B;  5E79 C;  3CD6 I;  3B6C A;  3KEO A;  2KJC A;  1YJW I;  3K4L A;  5E8G A;  2BV6 A;  4XLC A;  4MHG A;  2EA4 A;  3VYT B;  1GDT A;  3ZP5 A;  3E5U A;  1UHM A;  1JKQ C;  2XPV A;  2STT A;  3AL0 C;  3QU6 A;  3OYA A;  1OCC H;  2KDO A;  4OMZ A;  2CS3 A;  4C3J J;  1F43 A;  3NAU A;  5FLV A;  1IN4 A;  2DW4 A;  1Z67 A;  5FKK A;  1JUP A;  1TNT A;  2KIM A;  1IAW A;  2K86 A;  3PQK A;  2X0L A;  3HOX J;  3I4N J;  2WB1 N;  3JRC A;  2WB1 A;  3ZMS A;  1UAA A;  2L9R A;  1A35 A;  1MBG A;  1XS9 A;  3RZD J;  2V1X A;  4UUV A;  2LD5 A;  4OOI A;  1ZTR A;  1TWA J;  4HAM A;  3REO A;  5F6F A;  2DOF A;  2VOO A;  3KYL A;  3F8N A;  4MGR A;  4KIB A;  5C3E J;  4WWC A;  3KEY A;  2YU3 A;  1DP3 A;  2MD5 A;  3A4C A;  2OUM A;  2GA1 A;  5GAE J;  3PUB A;  2KRC A;  4M3G A;  3E5X A;  3CMA I;  4EVI A;  4GFB A;  3RQI A;  3N05 A;  4N0B A;  1GVJ A;  1W5S A;  2M45 A;  4M73 A;  4E7J A;  2K40 A;  2UXN A;  2IW5 A;  1BI0 A;  3FHZ A;  4E7I A;  4RB2 C;  2QM3 A;  3DFG A;  5L3G A;  4O6J A;  4GYI A;  1HXD A;  2FXA A;  4P9F A;  1PP7 U;  3MFK A;  2YU9 J;  2XAJ A;  3A03 A;  3OL3 A;  2Z3Y A;  2CFO A;  1X1C A;  2KL4 A;  2KRF A;  3HOT A;  3GZN B;  4HQE A;  1YRN B;  4FAS D;  1YIT I;  1G3T A;  1U5T B;  2WAD A;  2GXA A;  1I3A A;  4L5E A;  3GTO J;  1B9M A;  1WCM J;  2JQ7 A;  4HBL A;  2R7U A;  2PMU A;  3FK7 A;  3GX4 X;  4ZZD A;  4CDG A;  2DO7 A;  4FX0 A;  4WXH A;  2HOT A;  3EUH A;  3NQO A;  2W7N A;  1TLH B;  3FXJ A;  2DOD A;  1GVD A;  3CDL A;  4LK1 F;  3A1Y A;  4KUM A;  4NNJ A;  4DGW B;  1KYW A;  4LOC A;  4UUS B;  2ZME A;  1UZC A;  2K9M A;  3TOA A;  4F93 B;  1VQ7 I;  4EM0 B;  3S2H J;  3F3X A;  4LIT A;  3JRF A;  2V1N A;  1ETY A;  2MH9 A;  4AID A;  3OOP A;  3OIQ A;  3J80 K;  1XMK A;  3TO9 A;  2W84 A;  4DQ2 A;  1X3W B;  1X1B A;  2EIN H;  3WTU C;  3CF2 A;  3BJO A;  3FBI B;  4IHX A;  5FRN A;  1MKM A;  4KN7 X;  2LDU A;  3H1C A;  1UEL B;  4XOR A;  3P9K A;  3KCC A;  2F5E A;  2TCT A;  1KU9 A;  2HQN A;  4LLN A;  2HGC A;  2IJL A;  4LLG F;  3DKY A;  4ZYE A;  1AU7 A;  2L4A A;  3BR3 A;  4A3B J;  3GFL A;  2F4M B;  2PFB A;  3CCY A;  4RB0 A;  2KDZ A;  5H2F C;  2MD0 A;  3K2A A;  3B73 A;  3QWL A;  2NRA C;  2STW A;  2XV4 S;  1SD7 A;  2V7F A;  4MTE A;  2DCE A;  2DDB A;  3G6E I;  4HOB A;  3IH3 A;  4BHP A;  1UB9 A;  2RN7 A;  3ZMD A;  2IA1 A;  2VBW A;  4E7K A;  2BXZ A;  2EZH A;  2LTP A;  5C4X J;  2X1D A;  4EJT A;  2G9W A;  3V4G A;  2KMU A;  1JXS A;  1R71 A;  2EIM H;  3FIS A;  2QKM B;  1BR1 A;  2MC4 A;  2Q1Z B;  1OPC A;  2JWT A;  2XF6 A;  2QSH X;  1KQ8 A;  2BBY A;  2XGD A;  2ISY A;  2ESN A;  3E1S A;  4BXF A;  3WGI A;  1DU6 A;  3OYM A;  1V5E A;  2KRH A;  3ZQH A;  1LE8 A;  5E18 F;  2M7B A;  3WOD F;  2UXX A;  2M0M A;  3N97 A;  5JVG F;  5M3F J;  2MFZ A;  3GME A;  1U9O A;  1OYI A;  4A3J J;  2K9Q A;  4XID A;  4RS8 A;  3G1O A;  4PGH A;  1N77 A;  3GFI A;  1DGW Y;  2HVS A;  5FFZ A;  2XGE A;  2ZNZ A;  1SVL A;  2QA4 I;  1W7P A;  4AD9 A;  4LD5 A;  3FMR A;  2CSO A;  2VL8 A;  2J5P A;  5EGO B;  2R7S A;  3OOU A;  4RB1 A;  1S7O A;  1VQ9 I;  1HKQ A;  4G6Q A;  5CVI A;  2HQ5 A;  4G8X A;  3LFK A;  2QWW A;  4IL6 C;  2FML A;  2Q2E B;  3ISP A;  4EV0 A;  5HLH A;  5E20 A;  1HOM A;  1GV5 A;  4OIN F;  3MKW B;  2OJE D;  1YW8 A;  2A07 F;  3DV8 A;  1IN8 A;  3JCU C;  5BS6 A;  1W5C C;  4U7B A;  3HZJ A;  1EH6 A;  1AHD P;  3OYI A;  1ZYR F;  2LY9 A;  4HLY A;  3TED A;  4MFD A;  1MD0 A;  4RAZ A;  2M8G X;  1O3R A;  1TZL A;  3ZR8 X;  4FET A;  3EYI A;  4Y15 A;  3F8C A;  4A3D J;  4YRV A;  3SJM A;  4HQM A;  4MQV A;  2VT2 A;  5HDG A;  2WTE A;  2XHK A;  4B47 A;  4I6Z A;  4BBR J;  4CCN A;  4M6Y A;  1JKR C;  1VF9 A;  1RNL A;  1T33 A;  1HKS A;  5K5Q A;  3O3K A;  1OR7 C;  5IYB J;  4XRS G;  3GVA A;  1Z1D A;  1R1T A;  1H89 C;  4RAY A;  2LY2 A;  1QZY A;  3QOD A;  2FA5 A;  3ZPL A;  3QP5 A;  2GWR A;  4BQN A;  2DPU A;  1K61 A;  4I2O A;  4A3G J;  1MBJ A;  1ETW A;  1MIJ A;  3SEQ A;  1ERD A;  5DTD A;  3TMO A;  5EEA A;  2D2W A;  3DCF A;  3TO6 A;  3JRI A;  1JE8 A;  4EQQ A;  2OZ6 A;  1YS7 A;  4AWX B;  2OU2 A;  2EJR A;  5ILV A;  3PJR A;  1QHG A;  4LGW A;  2V6E A;  2K4J A;  4CZC A;  5FJ8 J;  2XPU A;  4XR6 A;  2VN2 A;  5BPD A;  4IHV A;  2Y69 H;  3CJN A;  2AHQ A;  2LMD A;  1Z3Y A;  2DQR A;  2OTL I;  2QBY A;  1EV7 A;  4DBR A;  3FXK A;  2BW3 B;  2WV0 A;  3D5S C;  4AC0 A;  5D5U B;  5BMZ A;  1BN5 A;  1B72 B;  3B02 A;  3GTL J;  3QYF A;  2XGX A;  4QPQ A;  2GAU A;  2GIV A;  3ZN1 A;  2DPD A;  4BJ6 C;  2IS1 A;  2JMW A;  3E6M A;  2RQP A;  3A02 A;  3HUG B;  4ITV A;  4B4C A;  5AIQ A;  4XRF A;  3FM5 A;  3E3V A;  5FO5 A;  1FSH A;  3HOY J;  2M2E A;  1I1S A;  2CV1 A;  4HSR A;  3UR3 C;  2IGK A;  2R7Z J;  2ZNY A;  5ICF A;  2CRG A;  3K70 D;  3BC8 A;  2HOE A;  3J7Y J;  1NK3 P;  4XM3 A;  4CYC B;  3KET A;  4DZP A;  1D8K A;  3RDI A;  4MQ9 F;  1R6R A;  5IOY A;  4M72 A;  4EJU A;  2E1C A;  4O3M A;  3KE2 A;  2KFD A;  4QWQ A;  4A6D A;  2DA6 A;  4A5M A;  2NS7 A;  3J80 Z;  1FBU A;  2JA8 J;  4HNU A;  4E4H A;  1DDN A;  2DMQ A;  2E5Z A;  3F8F A;  4XIC A;  3UNG C;  2W48 A;  5CQG A;  3VSL A;  1HQC A;  1SAN A;  3HG9 A;  3AG1 H;  5L3C A;  3HC7 A;  1WPK A;  5FFX A;  5D5W B;  3QPS A;  3QRF F;  2XGC A;  2WV1 A;  5K7F A;  1LQ1 A;  1ULY A;  1FYK A;  2RNG A;  5EZH A;  3CUQ B;  4M3F A;  2F4O B;  4Y17 A;  5FLX K;  4AYB N;  4AYB A;  1G6N A;  2RQQ A;  1N75 A;  2DK5 A;  5K7H A;  4AIH A;  1XDU A;  5AIP A;  1XMX A;  2M0C A;  2WAE A;  2PX9 A;  2FSW A;  2LFB A;  2FF4 A;  2R7F A;  2EFQ A;  2OQG A;  2OCE A;  3ZCO A;  1AKH B;  2VOD A;  4Y52 J;  2XB0 X;  3GCM A;  3M1C A;  2IXS A;  3QP6 A;  4BH9 A;  1KQ0 A;  2ELJ A;  2UV1 A;  2M1B A;  4PFP A;  1CF7 B;  2JA5 J;  2D1H A;  1W0U A;  2P5L C;  2V4J C;  3CP8 A;  4I09 A;  1U5T C;  4IJA A;  1ZGA A;  2XVC A;  4QLC U;  2N8G A;  2BXY A;  2DDA A;  3Q9V A;  2R7O A;  2NOJ B;  4HPQ A;  1ON2 A;  1SAU A;  2R3S A;  4LFU A;  1SFK A;  2CUJ A;  3G3Z A;  2X51 A;  4F92 B;  2ESH A;  1RIO H;  4DNC A;  4HX4 A;  2KJB A;  2EIL H;  4R1H A;  2COB A;  4B1R A;  3WTS C;  1R1V A;  1B8I A;  5DV5 A;  4CSW A;  1FP2 A;  4V19 K;  1R22 A;  3JSP A;  1GLN A;  1X1P A;  3W6J B;  3HOZ J;  5HLT A;  2VQC A;  3COA C;  1HKT A;  2JRM A;  2DFH A;  2QCO A;  1Z9C A;  4BQQ A;  2EWN A;  3ULQ B;  4DIQ A;  2BY2 A;  2VXZ A;  3JTG A;  2HYJ A;  1FWZ A;  3H5R A;  1D1C A;  4D0P A;  4P55 A;  2L5Q A;  1OKR A;  2DT5 A;  1ZAR A;  1JJ6 C;  2VJ4 A;  3FX3 A;  4OU0 A;  1XB4 A;  1BL0 A;  1T39 A;  4LJZ F;  2QSF X;  4ZTJ A;  2TRT A;  3V7R A;  5AON A;  4BY1 J;  2XKO A;  1D5Y A;  1S8N A;  1KON A;  4MEX F;  2L7M P;  2E35 A;  2W82 A;  3HOS A;  1B6A A;  3GW2 A;  4MFE A;  3R4K A;  1S72 I;  2L7Z A;  3ASN H;  3CCU I;  1SVM A;  2LH9 A;  1PUF B;  1YW7 A;  2O9L A;  4KNY A;  1IN6 A;  5KVR A;  4BGD A;  3J7A O;  5EZG A;  5JVT A;  2TDX A;  1IC8 A;  1EF4 A;  3A01 B;  3CC4 I;  5M5W J;  3X2Q H;  1SD6 A;  2VBX A;  1R36 A;  1MH4 A;  2AO9 A;  4FQG A;  1QZE A;  1R4N B;  4HW0 A;  3SFI A;  2NS0 A;  2ID6 A;  2OBP A;  4B8X A;  4GO1 A;  3KP3 A;  1TC3 C;  2FBI A;  1G4D A;  1Y1V J;  1O4X A;  2ZJQ F;  1TQI A;  1JT6 A;  2WAF A;  3LAP A;  2R92 J;  4BXX J;  4B48 A;  4UXN A;  3MVP A;  3VYU B;  1JGG A;  2IA0 A;  2O8X A;  1HBX G;  3PL8 A;  2EPF A;  1FTZ A;  4Q48 A;  4S0H B;  1LVA A;  3A0H C;  2XSD C;  1O7F A;  3HTU A;  1P4A A;  4B3X A;  2PJR A;  1V5F A;  2A61 A;  1Z21 A;  3TGN A;  3U1D A;  3MKL A;  4C2M J;  4C3I J;  4GXO A;  2XRL A; 
#chains in the Genus database with same CATH homology
 4BDZ A;  4NUB A;  1AA7 A;  4R79 A;  2IGN A;  3OYE A;  2LY1 A;  3H9G A;  1BR2 A;  4ANJ A;  4BDY A;  2VIX A;  3FKJ A;  4BUP A;  2ZXH A;  4C2U A;  5CPR B;  4B44 A;  2LYC A;  1MNE A;  3KYL A;  3ZXS A;  3FHN A;  3KEY A;  2R7Q A;  1DP3 A;  3DPL C;  3A4C A;  2OUM A;  2VJJ A;  3LSM A;  2K5C A;  3PUB A;  2KRC A;  4D9J A;  1FMV A;  3NWS A;  4HNT A;  3N05 A;  3PNV A;  2HVR A;  3IP4 B;  4E7J A;  2F5V A;  2L2O A;  5HVQ C;  4E7I A;  4RLF A;  3K4C A;  2GOX B;  3EUK L;  1QHH D;  2BW3 A;  3OL3 A;  5FRM A;  2R4G A;  3HPG A;  2CFO A;  3DTK A;  1X1C A;  2ZSH B;  3LL7 A;  3OYB A;  2KL4 A;  3W2W A;  3HOT A;  1V5G A;  2M4G A;  2DT6 A;  3I9V 2;  4ZJZ A;  4FAS D;  2LBF A;  2WAD A;  3J7A Y;  3GBG A;  2IS4 A;  2HZD A;  2CMP A;  4HRI A;  3DU6 A;  2OC6 A;  4Y4R A;  2R7U A;  4ZC3 A;  2E60 A;  2WAQ A;  3PSF A;  2XC7 A;  4XL9 A;  1G8X A;  1LKX A;  4N4N B;  4EAT A;  2W7N A;  4JQF A;  3K4N A;  4DBQ A;  5CKT A;  3DEE A;  3A1Y A;  4NNJ A;  1T95 A;  4DGW B;  3DU5 A;  2DOA A;  2XDV A;  4C30 A;  2R7V A;  3LMM A;  2K9M A;  4F93 B;  3L2W A;  4H4K C;  2JA2 A;  4LIT A;  1N78 A;  2V1N A;  3OYJ A;  4ZDL A;  2VJI A;  2VQL A;  1WJC A;  4ZDP A;  1LVK A;  3L2U A;  3OIQ A;  4RM2 A;  2MAB A;  1MMD A;  1PJR A;  1X1B A;  1ZEL A;  3CF2 A;  1LDK B;  3FBI B;  1J09 A;  5FRN A;  1S9H A;  4IX7 A;  4CCO A;  3M8J A;  2W00 A;  1UEL B;  3FDY A;  1DGR M;  1W36 D;  4E7L A;  4XOR A;  1YE9 A;  5TGT A;  5CQE A;  2KQR A;  3DKY A;  4XN3 A;  4PFO A;  2XF7 A;  3L2R A;  4RM3 A;  2BVL A;  5HNF A;  3S3N A;  4LG3 A;  3W2A A;  2MD0 A;  2O5R A;  3DKX A;  4F3Q A;  2KP6 A;  1MW7 A;  2VXD A;  2V7F A;  3OYK A;  2DCE A;  2VQH A;  3RCO A;  3CZ6 A;  1Y6I A;  3CES A;  2VB6 A;  1T0F C;  2HPM A;  3EUH C;  4D1Q A;  4E7K A;  4BEH B;  2X1D A;  3OYL A;  1W36 C;  1LFP A;  3RSN A;  2DXI A;  3AL0 B;  2KMU A;  2QKL B;  3PNY A;  4E7S A;  2GOM A;  1JI8 A;  5HOO A;  2LC2 A;  4IQJ A;  2QKM B;  1BR1 A;  2MC4 A;  2Q1Z B;  3RPU D;  4XQF A;  2XF6 A;  3NWT A;  3S32 A;  3IUO A;  3MMY B;  3E1S A;  4BXF A;  3OYM A;  1V5E A;  2KRH A;  4F52 A;  3CMM A;  3BG7 A;  2M7B A;  4XLH A;  3LSK A;  4U87 A;  4RLQ A;  2M0M A;  3EUA A;  2MFZ A;  1MMA A;  2X6Y A;  4PJJ A;  3OR2 C;  1N77 A;  3ZRG A;  1DGW Y;  2M7A A;  2VKH A;  2HVS A;  2UWM A;  4F91 B;  2R7T A;  4XMY A;  4DOZ A;  2JVH A;  3ZQQ A;  2Y0S A;  2VL8 A;  3H9J A;  3W3C A;  4KT6 A;  2R7S A;  4XN0 A;  3OOU A;  3BG6 A;  4E6K G;  3A2K A;  2IGO A;  2HU9 A;  2RRE A;  1WJ5 A;  2Q2E B;  2DT7 B;  4CCJ A;  3MKW B;  2W1O A;  4PJM A;  2V26 A;  4LIU A;  1WJE A;  2VQG A;  1IRX A;  2K3P A;  4U7B A;  2LOO A;  3OYI A;  3VDX A;  1WJB A;  4BAC A;  4B43 A;  2E5N A;  2JSP A;  4XKW A;  5LD2 C;  4IKF A;  1TZL A;  4XLF A;  3ZR8 X;  1WFX A;  2R7X A;  4FET A;  4E7Z A;  2CV2 A;  1K6Y A;  3DPU A;  2AQF A;  5JHF A;  4YRV A;  2VJ5 A;  4HG2 A;  4BL0 B;  4LIV A;  4B47 A;  3HL2 A;  3I3L A;  4CCN A;  3K4J A;  2Z1D A;  4CCM A;  1OR7 C;  2ZFU A;  2PJR B;  4P5O A;  4XKB A;  4XOP A;  3EPZ A;  3LSG A;  2CUZ A;  2LY2 A;  4CCK A;  3QOD A;  1D0Z A;  2A5W A;  4XLE A;  1WJA A;  2X6W A;  4BQN A;  4BU2 A;  1BOB A;  4XLA A;  1PYV A;  3H5A A;  3SEQ A;  2R7W A;  3K6G A;  1ERD A;  2VPL A;  4NQW B;  3TMO A;  4OAZ A;  2XAU A;  4XNF A;  4KIT B;  4PK4 A;  3OYH A;  2V9K A;  2ZSI B;  3DLA A;  2L9N A;  2LG4 A;  3PJR A;  3ONQ A;  3CP2 A;  1QHG A;  3W2V A;  4CUG A;  2V6E A;  3IAS 2;  4CZC A;  2F6C A;  3L2Q A;  4XR6 A;  1D1B A;  2K9L A;  3HXL A;  3RTR A;  2KPM A;  4XOT A;  3DTE A;  3BLY A;  2KHM A;  3D5L A;  3MKZ A;  1Z3Y A;  2CW7 A;  2F4I A;  4AU7 A;  2WA0 A;  4DBR A;  2WY8 Q;  2BW3 B;  3C2H A;  3D5S C;  3DPT A;  1MMG A;  3RQ4 A;  2LRD A;  2A6T A;  4BS9 A;  3KX2 A;  4J01 A;  3QYF A;  2ZXI A;  3PFY A;  4QPQ A;  4N4O B;  4BJ6 C;  5KCM A;  2M4K A;  2IS1 A;  2BOL A;  3HUG B;  4ITV A;  2LBF B;  3LSI A;  2CV1 A;  2E1M C;  4HSR A;  3UR3 C;  2IGK A;  2P0W A;  3OYD A;  3K70 D;  2FUG 2;  3BC8 A;  1YX3 A;  2CW8 A;  4XM3 A;  2L9S A;  3U21 A;  1X19 A;  2X1C A;  3OS1 A;  1Z3X A;  1R6R A;  3BCB A;  4F55 A;  2CV0 A;  2PMZ A;  3S93 A;  4NC7 A;  3TBI A;  2IS2 A;  2Z16 A;  3OS2 A;  1P9Q C;  4NC8 A;  2E1M B;  2CH0 A;  2L7K A;  4HNU A;  4XKV A;  4GRI A;  4E4H A;  5HNH A;  4YEL A;  2X6X A;  2E5Z A;  3IAM 2;  4BE2 A;  2M3A A;  3OYF A;  4C2T A;  1VZ0 A;  3VWB A;  3UNG C;  2XF5 A;  1D0X A;  1NG7 A;  5CQG A;  3VSL A;  5FRO A;  4KIS A;  3HG9 A;  4QPO A;  2JVG A;  1X1D A;  3HC7 A;  1QU3 A;  3S3M A;  1X4O A;  4OAY A;  4BJT A;  3TL4 X;  3HKZ A;  3S3O A;  2RNG A;  4OWR B;  4E7H A;  3OY9 A;  3MKY B;  4AYB A;  2RQQ A;  1N75 A;  3K70 C;  3G2B A;  3C2G A;  4RMN A;  1TT0 A;  2WAE A;  3H35 A;  1YX5 A;  3HPH A;  3OL4 A;  4HEA 2;  3ZCO A;  1BR4 A;  5KHD A;  3K10 A;  3M1C A;  2IXS A;  2WY7 Q;  2ELJ A;  2UV1 A;  4PFP A;  4Y33 A;  1MMN A;  4ZYA A;  2V4J C;  2KLO A;  4JOM A;  3CP8 A;  4PUS A;  2HVQ A;  2HDW A;  3PNT A;  4XON A;  2VKD A;  2LRE A;  1UG0 A;  1DQU A;  2UUZ A;  3AFH A;  4BE1 A;  3QOE A;  4HPQ A;  2R7O A;  2NOJ B;  1SAU A;  4ZDO A;  1WJF A;  3CJQ B;  1SFK A;  2CUJ A;  4G6T B;  4KJZ A;  2HNH A;  2X51 A;  3L2V A;  4F92 B;  4ZTF A;  1U0J A;  2IGM A;  2KZV A;  3OYG A;  2DJI A;  1E0E A;  4BEH A;  3CJR B;  1MND A;  3PSI A;  1X1A A;  4IQ4 A;  4DJA A;  2OV7 A;  3OWT A;  2VAS A;  3DTI A;  4CSW A;  4X0G A;  1GLN A;  1X4P A;  2MYS A;  2VQC A;  3ZGK A;  3LFU A;  3K4M A;  4AVZ A;  4C9Y A;  4Y3O A;  5HLT A;  3OIP A;  4P1W A;  3DWL E;  4BQQ A;  1NG6 A;  4DIQ A;  2VLA A;  3K4K A;  3H9Q A;  2VXZ A;  2X85 A;  3H5R A;  1D1C A;  5LFA A;  2L5Q A;  3SYT A;  4II3 A;  4MLO A;  2HQA A;  2VJ4 A;  2HPI A;  3FBN B;  4BJ5 C;  3MD2 A;  4II2 A;  3VYS B;  2JUG A;  2WBM A;  3LSH A;  4ZTJ A;  1WJD A;  4XKC A;  1KON A;  3VSK A;  2W82 A;  3OYN A;  3HOS A;  3BCA A;  2BVM A;  3V42 A;  1D1A A;  4BE0 A;  3F9K A;  2Z2S B;  1HA8 A;  3QYE A;  1Z7L A;  2LH9 A;  4CH7 A;  4IZZ A;  4BGD A;  2XSJ C;  3DQV C;  3S8P A;  4CA0 A;  4PJL A;  3OS0 A;  4PSW A;  3E0J B;  3SDB A;  2X1E A;  3OMY A;  3SEZ A;  3OYC A;  2IS6 A;  1D0Y A;  1FMW A;  3K4L A;  4PSX A;  3AKZ A;  3VYT B;  4XLC A;  3H5N A;  5KNL A;  4CCL A;  4YEJ A;  2WAF A;  2I8D A;  4HST A;  4B48 A;  3AL0 C;  3OYA A;  3VYR B;  3VYU B;  2KDO A;  2AQE A;  2CS3 A;  1UAA A;  3QYB A;  3PL8 A;  3OR1 C;  3D5R C;  3SZG A;  4PJN A;  4J00 A;  1Y56 A;  4B3X A;  2PJR A;  1V5F A;  3K4B A;  3H0D A;  2R7R A;  1Z21 A;  1G59 A;  1OLT A;  2W4S A;  2WB1 A;  4BQO A;  1EA3 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...