2KHMA

Structure of the c-terminal non-repetitive domain of the spider dragline silk protein adf-3
Total Genus 38
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
38
sequence length
140
structure length
140
Chain Sequence
MASMTGGQQMGRGSMGAASAAVSVGGYGPQSSSAPVASAAASRLSSPAASSRVSSAVSSLVSSGPTNQAALSNTISSVVSQVSASNPGLSGCDVLVQALLEVVSALVSILGSSSIGQINYGASAQYTQMVGQSVAQALAG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title A conserved spider silk domain acts as a molecular switch that controls fibre assembly
pubmed doi rcsb
source organism Araneus diadematus
molecule tags Structural protein
molecule keywords Fibroin-3
total genus 38
structure length 140
sequence length 140
chains with identical sequence B
ec nomenclature
pdb deposition date 2009-04-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF11260 Spidroin_MaSp Major ampullate spidroin 1 and 2
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.1350 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Arc Repressor Mutant, subunit A 2khmA01
2MFZA 2M0MA 2K3PA 2MABA 2KHMA
chains in the Genus database with same CATH superfamily
1NHAA 1NK2P 2KRHA 1OFCX 2M1BA 2EJRA 2V1XA 4PJ0C 1IXSB 1J7KA 4DQ2A 5LHGA 2IT0A 1LKXA 2LDUA 2P6TA 3OL4A 4FETA 2LTPA 1MD0A 1SFKA 3DPTA 5H6QA 3HRTA 1H0MA 4UNOA 1UCRA 3PL8A 3TGNA 2L3DA 2GXBA 3ZOBA 2EIKH 4S04A 2H94A 1Z05A 5BPDA 3C18A 4BL0B 2JA2A 3JSOA 2F5CA 4S05A 1I5ZA 5J8CA 3KLNA 1FNNA 4E4HA 2D1HA 3TW7A 5B5EC 1ZR4A 4C30A 5FLXZ 1XX5A 4LG0B 2BXZA 2EBIA 3HZJA 3CZ6A 3I9V2 3T1BA 3KYLA 4BE1A 1KU9A 1WJEA 4IX7A 1QVUA 2NXNB 4BDZA 2EZIA 3WTZA 3WGGA 1WPKA 4EJUA 5B1AH 1YX5A 4UUSB 1RETA 4I99C 2R7FA 3FXOA 1A5JA 1JKOC 3J80K 3ZQHA 1KU3A 5AONA 2XC7A 5HS9A 1YW9A 4UVCA 1F9NA 3TEDA 5E8IA 3B6CA 5J1UA 1VNDA 4FE7A 1OJLA 3M8JA 4ITVA 5KCMA 3H5RA 4LLGF 4CXFA 5LLQA 1HW1A 1QHGA 1S7OA 2P5VA 3I64A 2VQLA 2LRDA 2K9SA 3RPUD 1Y39A 3HGGA 3I54A 4PUSA 3L9FA 2KISA 3K4JA 4UUSA 1YITI 1TW3A 3H9GA 1X3WB 4CCOA 2QM3A 3OSGA 5CVRA 1ZG5A 3Q0VA 1D5VA 2LNBA 4Y17A 2HU9A 1AU7A 2JZYA 2HZDA 4YIRX 2W82A 3T5XA 3BZKA 5HDKA 3L2VA 3GW2A 3K6GA 3R60A 3QQAA 2DDBA 3H0DA 1JGGA 3KP5A 3OL3A 1EH7A 3KEOA 1FMWA 2YUSA 4I01A 2I5UA 2MBFA 5ICFA 2JA6J 5E3LA 2ELHA 3NARA 1QRYA 5LD2C 3F0CA 3OYNA 4XKCA 2E1CA 4XRFA 4HX7A 1W0UA 2Z99A 2OTLI 1V4RA 4BQNA 1FBQA 4PSWA 2OTJI 4KFCA 1WJBA 3P7NA 4N0BA 1GLNA 2V1UA 3LFKA 1QO0D 2QQ8A 4ZJZA 2X51A 2VE8A 2HKOA 3DLAA 4Q5SF 5EG0B 3JRHA 3FMRA 4A3JJ 4A3EJ 1Z6TA 2E60A 2NOJB 2Q1ZB 2QGUA 5BOXA 4E7IA 2H27A 4IHWA 2FD5A 4WXDA 4RB2C 2JPBA 2ESHA 1FIPA 1G8XA 4D5FA 2R5ZB 1YW7A 2R7QA 3IV5A 1T95A 2ZMEA 1WH7A 1R49A 3IKVA 2R4GA 1W36D 2F2EA 2D1VA 1VFCA 1HBXG 2DK5A 4CCKA 2QBYB 3Q0WA 2DYSH 3WTUC 3OYGA 3HGYA 1N77A 1Y8QB 3FM5A 4A3LJ 4GYGA 1WSUA 2L5QA 2IEKA 1ONVA 3K4NA 1KU2A 3CDLA 1A35A 1J5YA 2GOMA 3H9JA 4ZC3A 3HC7A 1R4MB 2RAEA 2CUJA 1HCRA 2FF4A 1ZR2A 3TOBA 3LAPA 4B1RA 4UY8I 1JI8A 4IRGA 1MKMA 2M45A 3P9IA 3EYIA 2DA3A 2M34A 4EGZA 1LPQA 2OCCH 3X2QH 3IL2A 1OPCA 3M1CA 1KONA 5LRRA 4I98B 2VI6A 3EDPA 3W6VA 2FE3A 1DP7P 4JYKA 2ELKA 5J4YA 4H4KC 4HF2A 1G3YA 1W1WE 5LGNA 4CYCB 3CCLI 1FYKA 4BEHA 2UWMA 1EH8A 2VT3A 3TKYA 3MN2A 3TO9A 3E97A 2XAFA 1N78A 4V2GA 3ZMSA 2WTEA 4XSXF 1D0YA 3ZQ7A 3V8JA 1SD5A 4EJVA 2DFEA 3ESWB 4IL6C 3GFIA 2EH3A 1B72A 2WAEA 1XG1A 1NG7A 2COMA 3G4SI 4ENKA 1IF1A 2BVMA 4Y52J 3E5QA 4JOMA 3DPLC 3B02A 3TOAA 2VJJA 1D1CA 1W36C 4EJTA 3CC2I 2HZTA 1D8JA 5A2QK 2FQ3A 3PIPF 4C2TA 2CS3A 4PJLA 3GLLA 3SDGA 2IGOA 2XKOA 2E1OA 1K4SA 3LWFA 5EEGA 1WJAA 2B0LA 3GZNB 2JRTA 2L7FP 5CLSA 2P0WA 4NB5A 3KYCB 2OQRA 2QEXI 1J9IA 3BROA 5B66C 2XGEA 4BY1J 5CYVA 5D6FA 5IOYA 2LMDA 2AQEA 2HTJA 3CO6C 2DN0A 1LEAA 3BY6A 1J09A 3ZN0A 5EGOA 1ULYA 4MQ9F 1KGSA 1ON2A 3IAS2 1U9OA 4Q48A 5E3MA 3AG4H 1O7LA 2RREA 1BN5A 3OYKA 4FASD 3JRGA 2QF7A 4BH9A 2E2JJ 2BW3A 2LF8A 1D1BA 1REPC 4AM3A 2KIFA 1JUSA 2M2EA 1WKMA 3H3ZA 2J5PA 3LSPA 2OZUA 3VDXA 1NK3P 1WWXA 1JHHA 2UXXA 3BLYA 3KE2A 3ONQA 5JVGF 2MG4A 3TL4X 3DU5A 1O3RA 2CQ7A 3OSFA 5CPRB 3CP2A 1Z1DA 5FB2A 4M3FA 2Y0MA 4UUTA 3OYAA 3ZQGA 4BE0A 1EJ9A 3PUBA 1MMAA 3ZRGA 4D7MA 3MZYA 3TP3A 3BQYA 2H6BA 2VT2A 3T8RA 4ZDOA 2ZNYA 4HLYA 2DMPA 3HIFA 1E3PA 3BC8A 3AL0B 3ASOH 3FXQA 1UAAA 3BR0A 2EZHA 4UUVA 2F4OB 2UV1A 3GZ6A 3IRRA 2QLZA 1G3TA 1R7JA 4Y4RA 1OMIA 4N9IA 3ERMA 1WJCA 4G7HF 3ABLH 3O2PE 2VKHA 1G6NA 1TZLA 2CUZA 4Y7NJ 2D45A 2K85A 4OIPF 2DMNA 3P9CA 4QLCU 5FD6A 4U88A 1X4PA 3N05A 3M1EA 4N4NB 5BQTA 4UHTA 4IO9F 3A0BC 2R5ZA 3B6AA 1DPUA 1IXCA 5DCMB 3VWBA 3CCMI 3WGHA 3GEZA 3QYEA 5J1YA 2E2IJ 1Z7UA 3NRVA 2DJNA 2G7UA 1B4AA 2J5OA 1SVOA 4CICA 2LBFA 4W1UA 1XGSA 1GHCA 4E7HA 2HXOA 5EF6A 1ZRCA 1XDSA 5D5UB 3GTOJ 4ESJA 1MBEA 3L2CA 3D5RC 5BS6A 5FFXA 1B59A 4DNCA 5LHHA 3T8TA 2VXZA 1KYWA 5F0CA 1SMTA 1YFHA 5B1BH 3LSJA 4ANJA 1BW5A 4O6JA 3CJTB 2TRTA 3H5AA 3MMYB 4XOPA 2CMPA 3Q9SA 4W97A 2E2HJ 5IT9K 5F1RA 5JVTA 3CUOA 1B8IA 2HS5A 2YR2A 1A04A 1SAUA 2ZNZA 4XLHA 1A6IA 4MTEA 1T6SA 4L9JA 3WTXC 1WJDA 3HKZN 4G6DA 3DF8A 1P4WA 3JRCA 4HF1A 2Y9ZA 5GAGJ 1IUYA 1STZA 1BA5A 2XUBA 4GO1A 4BNCA 1MJBA 4AWXB 4CYCA 1Y0NA 1W5SA 4R1HA 3RYPA 1B6AA 2NVXJ 1BJZA 1W7PA 4QPQA 2JPCA 4EEFG 2ISYA 4IJAA 2WB1N 5FLVA 3PO3J 1GXPA 4M74A 3DLLF 2PBIA 5ILUA 2DBBA 3BR3A 2FRHA 2ZXWH 3BR2A 5HLHA 3QU6A 2CW8A 4C3JJ 1ZARA 2M7AA 4E7LA 2VBZA 2ZJRF 1V5GA 1YO5C 4AC0A 2QKMB 2X9DA 3BCBA 4HNVA 3CC7I 5M3MJ 1R4NB 1USSA 2E5NA 2FOWA 3F21A 2JTVA 1FBUA 4D7NA 3KYDB 4Q47A 5DD4A 4BS9A 4F92B 1X1CA 4C2MJ 3C3WA 1WJ5A 3DV8A 2A5YB 3CDIA 2ZXIA 2RQPA 3D0SA 3SZGA 1LQ1A 3HJEA 1Q1VA 5FD5A 3IWZA 1R36A 2QQ9A 4B48A 2H8RA 3ABKH 2KDZA 3V8LA 2XVCA 4CZCA 1BR1A 2B63J 3W2WA 4V19K 1A31A 2HYJA 2ZCWA 5LFAA 3HM5A 4CSWA 2A07F 1WRJA 2LVSA 3WTYC 4BYYA 1ZGJA 1XCVA 2K02A 1ETQA 3F6VA 3DEWA 1JKPC 2XSJC 3KZYA 4M72A 2W24A 3MKWB 3OS1A 3RKQA 2R7UA 1BR2A 2EILH 4FISA 5E8GA 1SEUA 2M3AA 4P9UA 1Z91A 5TRDA 3OS2A 3CCQI 4M3GA 2G7HA 1X1PA 3IP4B 1JHFA 4HLXA 2HEOA 4KIFA 2VONA 5KK1A 3F8NA 5EZGA 5FLMJ 1S72I 4PCQA 4P9FA 3K4MA 3FMQA 4YELA 1WI9A 3ZMVA 2L02A 3EQLF 3I4MJ 2HQAA 1W7PD 3PQJA 2GIVA 1LFPA 1R58A 3W3CA 1BR4A 3CTAA 2HVSA 3DTKA 1G59A 5ED4A 2LY9A 2XPVA 2KPMA 2Y0SN 2L2OA 3PJRA 3BG7A 1RUNA 1PP8F 6PAXA 4H0EA 1ETKA 2PN6A 2VJIA 5TGTA 3WTSC 2XASA 2BY1A 2R5YA 1D8KA 1T0FA 2DYRH 5LGUA 4ZH4F 3LSHA 3BCAA 2CV2A 3HOUJ 3OMYA 1TTYA 1UELB 1XGNA 1FTZA 3AG3H 1DQUA 4ZYDA 1MW7A 4WX9A 1ETOA 4BAYA 3N97A 1YJWI 3QYFA 2E1MB 2NNYA 1DUXC 4KA4A 4BJTA 2P6SA 2HOSA 1H9TA 4HZFA 4Y13A 3OV8A 2V1DA 2EQRA 3CCEI 4L5JA 3ULQB 2LYCA 3BT9A 1FEXA 5CVVA 1YG2A 1HDPA 1GXQA 2IA1A 1FYLA 5HLTA 1FBSA 1MBJA 3G1LA 2FMYA 5LGTA 2JSCA 4YEJA 2O3FA 3GUDA 1BM9A 4HA8A 2YPRA 2MC4A 1RNLA 2DDAA 2OU2A 4LB5A 5IY5H 2A68F 2XKPA 4ZYGA 4L18B 3FHNA 1WI3A 1ZKGA 3GO5A 3I0TA 3HSRA 3OOUA 5CQEA 5F08A 3M4OJ 5D8KB 2RN7A 2KRCA 5FRMA 2FJ1A 3R0JA 4A6EA 4IHVA 1ETYA 1YHQI 1J59A 4KMFA 5HVQC 4HV6A 3I56I 4CUGA 4IHXA 3Q0UA 2K40A 4BDYA 2E1MC 5J4VA 1ETVA 3FBNB 3WG9A 4M3BA 1JKQC 2IXSA 2Y9YA 2XROA 3DKXA 3CMAI 3PIOF 2DK8A 2DW4A 2IGNA 2V9PA 1CGPA 3VEPA 1WVRA 2P8TA 3HOZJ 2MD0A 4EM2A 2EFNA 1QZZA 3S1NJ 2VPRA 3BTIA 2COBA 2IJLA 3C7JA 3HXLA 1KZHA 2OJED 3BPVA 4RS8A 2Z2SB 2VJ5A 4A3GJ 4UVBA 3M7GA 3RZDJ 4G8XA 1HSTA 2HI3A 4BXUA 5M5YJ 4RGRA 4RAZA 4ZYEA 3MZHA 1IRGA 4A3BJ 2ZSHB 4EM1A 2HVRA 3DTEA 4BUPA 3KZZA 5CVUA 2D2WA 1E2XA 2QVOA 1ZREA 5FKKA 1PUEE 1FTTA 3OIPA 2A6EF 1DPRA 3C1DA 3GTMJ 2FBHA 4OOIA 4RB0A 5HNFA 4IEJA 2FNAA 3W6JB 2WV0A 1P9QC 1IRFA 3A01B 3JRIA 1G3WA 3MD2A 5E1XA 2L01A 5EYRA 1E3HA 5E79C 4PGGA 3FIWA 4KN4X 1WQ2A 3ZMDA 4OINF 1GVJA 2MLGA 3HTUA 3AAFA 2I8DA 3BPXA 3L2UA 3BDDA 3KZIC 4XN0A 2WAQN 3F22A 2BVLA 4P96A 3CJNA 1T2KA 2L9SA 4HG2A 4B3XA 2JWTA 3HSEA 3BG5A 3K4KA 2VB6A 3A1YA 1RESA 2JA7J 3OYEA 2K9LA 4CCLA 2XF6A 2FEZA 1KA8A 1JT0A 3Q5FA 4XIDA 1MNMC 1R00A 3QODA 4A2UA 3RSNA 1X2NA 3A01A 3NQOA 4M71A 4E6KG 2O03A 4A93J 1FJLA 1J0RA 1DDNA 1R5ID 4ZZDA 1TT0A 2V79A 2JRMA 2QQBA 3VYUB 4CZZA 1U8RA 3JRBA 3LOCA 5HLIA 3WODF 1K79A 1D1AA 3KP2A 3FKJA 1U8BA 5DS9A 4BQOA 4II3A 1XGOA 2O6GE 3KEYA 1EH6A 4XRMA 2EFPA 2VODA 3OYMA 3VYTB 2E5ZA 5J40A 5FKLA 2DOFA 4KIGA 3K70C 5DD8A 5GAHJ 1QGPA 1S6LA 3KP6A 5EJCA 3LL7A 5HNHA 1J75A 2WB1A 3MAJA 1UJ8A 2Z3YA 4DBQA 4BKXA 5ICGA 1VQ9I 1IN4A 3HKZA 5K7ZA 2K5CA 2F48A 2Y75A 3O8GA 4XBFA 3TMOA 1XGMA 2CYYA 2ZFUA 4ENNA 1I6HJ 1D0XA 3DQVC 3Q9VA 1YOVB 2DTZA 1FWZA 2EZLA 4KNYA 3JCUC 2STTA 1G4DA 3O3KA 2RNGA 4RAGA 3SEZA 4GFBA 4IQJA 4IXAA 5LHIA 3CCSI 1HOMA 1UHSA 2BW3B 2M9HA 1CQTA 4J00A 2GOXB 2LSOA 3DTIA 1ZN2A 2OC6A 2ZC2A 4WK8F 5M5XJ 1FLIA 2Q8KA 3RKXA 1YTYA 2ZJQF 1H88C 3DBHB 1X1AA 3HB9A 3M3YJ 3TBIA 2CH0A 3LA2A 1FSEA 1ODDA 3TDZC 4XRSG 2FNPA 2ZO4A 4EV0A 1W4MA 3K1PA 3E5XA 2G0EA 2JJ7A 1VQKI 1RR7A 3U2RA 2X6WA 4IRHA 1JJ8C 3DP7A 2R7ZJ 2X4HA 5K5RA 2ESNA 4RGUA 3SDBA 2YU9J 3M8EA 1IRXA 2LKSA 3E3VA 2E1NA 3CCJI 4XLFA 4LLLA 3QPSA 1XPXA 3F8MA 1HSJA 3W2AA 1W7PB 3MQ0A 1FP1D 5J3LA 3GTGJ 1F5TA 2QZ8A 1RRJA 4L5IA 1B9NA 3DEEA 4DBRA 5L3DA 5EGOB 4O3MA 1D5YA 4PFOA 1JUPA 1V5EA 3L7WA 1Z3XA 3OR1C 3QOEA 2LOOA 5GP9A 1P6RA 2EV0A 2XV4S 3S32A 3HRUA 4UXNA 1KU7A 1BOAA 2PJRA 1B8IB 1ZYRF 1AKHA 2X48A 2OF7A 2YX4A 3GX4X 4MIMA 1IUFA 2XGCA 3LSIA 3F9KA 3LSGA 4GRIA 4XRSA 2A69F 3H0GJ 5JHFA 2R0QC 3ROUA 1V5FA 5J6XA 1SFOJ 2STWA 1SD7A 1R23A 3E6DA 4A3MJ 1VQOI 3IKTA 1WFXA 2Z5UA 2ECCA 4HEA2 1SMYF 2XAHA 2CJJA 3QP5A 4A0XA 4GGGA 2CO5A 1O7FA 4U0VA 2HQRA 2XIGA 3BOQA 3U9GA 2DA2A 4CHUA 1Z7LA 5DM6F 2WV1A 4F91B 3MKYB 2DA7A 1ZK8A 3FWEA 2NAZA 3SZTA 1D0ZA 5DUKA 4E70A 1L0OC 4B4CA 1Z77A 4MQVA 1DP3A 2R7DA 4DOZA 4F3QA 1ZGWA 2CSOA 2CW7A 3K7AJ 4ZDPA 4OAZA 3G71I 4CH7A 2X6YA 3S3OA 3BP8A 1YQAA 3S14J 4Y3OA 1O4XA 2QCOA 2O7OA 2DMTA 3W6KB 1FC3A 2I10A 2CG4A 2CFOA 4OU0A 3E0JB 1LDDA 1LE8B 2PI0A 2MSYA 1T56A 2R3SA 3DPUA 2K9QA 3HOVJ 3FXKA 1YLFA 2FU4A 2LKXA 3ZQQA 3BWGA 4LITA 1PDNC 1I39A 3HOYJ 4HQMA 2P5KA 1C0WA 4UVAA 1WZ2A 4BE2A 4A3FJ 4K2EA 3J7ZI 4BACA 1KQ8A 4L9VA 1YJ9I 4NQWB 3AG1H 2BXYA 3K0LA 2KL4A 1HQCA 3ZQCA 2F4MB 3LSMA 4HF0A 3DKYA 1V55H 4QIWN 2Q2EA 4X1EA 3QPTA 2XB0X 1ZG1A 2LREA 3ZXSA 4AVPA 1P4XA 1PYVA 2CW0F 2Y69H 3D1NI 4DYCA 1R1VA 1UHMA 1EV7A 1UB9A 5JR3A 3MFKA 2R7WA 1TT5B 2P4WA 4LD5A 2M30A 4BHPA 2ZFWA 4ETSA 2AS5F 2CWEA 1IW7F 1Z67A 4RM2A 1IZ1A 1IJWC 4LB6B 3TO6A 3HOTA 2P7CB 2CQQA 4LOCA 4DW6A 2HOEA 3HHHA 3LQRA 3QPHA 3QU3A 3CMMA 4FHTA 2YS9A 3ZR8X 2R5YB 5JLXA 2ZXHA 3WG7H 3EUHC 1RKTA 2MFZA 3BTLA 5EDNA 4IZZA 1XMKA 4XM3A 2F6CA 1LFBA 4KT6A 1PP7U 3FXUA 3REOA 5J1RA 4I2OA 1BIBA 2FBKA 2ME6A 3M9AA 4IKFA 4GDFA 5L3BA 4EM0B 3SFZA 1RZ4A 1TQMA 3MVPA 3FXLA 5GAEJ 1R5HA 1TWAJ 1BC7C 3MKZA 4QWQA 4CCMA 1O3QA 4BHBA 4EMSA 2K3FA 3H92A 2DFFA 3RKYA 3UNGC 2AQFA 3ZN1A 2IRFG 3MEXA 1JUMA 1V54H 3FISA 1X3UA 1ACIA 1HDDC 5IOZA 2BY3A 3CMEI 4Z2YA 3BR6A 1EF4A 4EQQA 1TL8A 1TNTA 1K6YA 2HNHA 1Z9CA 2L9RA 3RQIA 1HKQA 3GF2A 3QWLA 4XKVA 4R79A 1ORKA 4E7JA 3ECOA 2PX9A 3KCCA 1UZCA 2K3PA 3KFWX 1JXSA 2LC2A 1JJ6C 3IRQA 3FXRA 3E6CC 3NWTA 2DT7B 5FROA 5C4JJ 1BI2A 3ZGKA 1I3AA 2R7OA 3C2BA 4OWRB 2NS0A 3ISPA 1I50J 1XTAA 2M5WA 1IO2A 2PMZN 2JQ7A 3KP4A 3A2KA 2VL8A 4LIVA 4ABZA 4Y33A 3V7SA 1W5TA 2RDPA 3LA3A 4YIFA 3S2DJ 3VOEA 1IV6A 4GXOA 5F1JA 1H9GA 5HOOA 4I6ZA 1F36A 1OCOH 3U1DA 4AIHA 1P92A 2DMUA 2DJIA 1TC3C 5C4XJ 1BW6A 2LLKA 1R6RA 5L3GA 4RB3C 2BY0A 5F0HA 1EA3A 2HPIA 2PLYA 3I55I 2VOOA 4C3IJ 5K1YA 1RPWA 3S1RJ 2ICWG 3U21A 3WHBA 3IWFA 3FHZA 2NVUB 1LFUP 4KDPA 4BJ5C 1HKTA 3A03A 1QPMA 3ML6A 2BEOA 4I0AA 2KMUA 4FX4A 2XRNA 3KETA 3ZMZA 2L4AA 3ZQFA 3AKZA 2R93J 2WADA 5FKOA 3VSLA 1ZLKA 4MLOA 4J19A 3K4CA 2R7XA 3BJAA 4YFXF 3E6MA 1W0TA 3K69A 2JN6A 2EPFA 2HOTA 5HDGA 5FJ8J 3CO7C 2LD5A 2M7BA 2GBYA 3C2GA 3J81K 1FYMA 5H20A 3NEUA 3WE2A 3JRAA 3RI4A 2XPUA 2R7RA 4JBAA 2KZVA 3U1KA 5BNGA 2ISZA 1O3SA 2WA0A 4B3AA 1FZPB 2LFBA 2W4SA 3QPLA 4RM3A 4LJZF 4ASNA 3GVAA 1IN7A 2E7XA 4N9HA 1S29A 3R6SA 3HRMA 5JI6A 1E17A 1MIJA 1ENHA 2XAUA 2XHKA 1X19A 2DA6A 2F4IA 4BEHB 2VPLA 3BR1A 4G6TB 3KX2A 1MJ9A 3WTVC 1R9TJ 2L4MA 5IT9Z 1RC9A 3S8PA 4PDKA 3JR9A 3I53A 1IN5A 4DGWB 4HDVA 2Z1DA 3LNQA 3BTCA 5HLGA 4IPAA 1XS9A 1X2MA 3ZMTA 1G2HA 3FMSA 2VIXA 1R5GA 3TDUC 2BHYA 2V7FA 3FXMA 2H1KA 2X6XA 3DBLB 2K9NA 5TISC 3SYTA 2ZJPF 2QKLB 2EK5A 2KJCA 4QSHA 2LG4A 2MH2A 4RMNA 1T98A 2O5RA 3OIQA 4J01A 1UG2A 1U2WA 2VQCA 2VBWA 5DEQA 4GYIA 4MFDA 2GM4A 4A3IJ 5E3OA 3S2HJ 3IAM2 3GTJJ 2IGKA 4PZJA 2GAUA 2OBPA 1ERDA 2HYGD 1MJAA 3K2AA 1FOXA 4B09A 1IN8A 3RPQA 2ELJA 1U9NA 2WY7Q 3T0YA 1MMNA 1YRNB 3VODA 3GFMA 4XORA 1OYIA 2KZGA 5HS8A 1SVLA 2ADUA 3V7CA 5K5OA 4OIOF 2V6CA 4PSXA 4G94A 3K2ZA 5M5WJ 1YS7A 3PFYA 3VYSB 5EG0A 1OQYA 4XKBA 4OIRF 3VB2A 2W7NA 1AA7A 2AO9A 4CA0A 2ZSIB 2WY8Q 2E19A 2RNJA 1SFUA 1RR8C 1HW5A 3GZ5A 4F93B 2QWWA 3GLXA 1BOBA 1DGRM 5CKTA 3PQKA 2LF7A 1Y8RB 1YYVA 4I09A 1P7JA 1NTCA 1Y0UA 2VKVA 3I71A 4EATA 5CVIA 4YFKF 3G73A 3H35A 3E6BA 4AD9A 2OD5A 4F52A 1BI0A 1IV8A 2A6TA 2LK2A 2KHMA 4DIQA 3R4KA 5GPCA 1S7AA 4M3EA 2UZKA 3HOXJ 1MH4A 2AHQA 4NNJA 4U87A 2K7LA 4LFUA 2HKXA 1JTXA 2CU7A 2FSWA 2UXNA 3ELKA 3GYHX 4M73A 1VQPI 2QENA 3TP0A 3SJMA 4XICA 4DYQA 2CQXA 2LKPA 4DZPA 2DAOA 3ZQIA 1GDTA 2M8EA 2AXTC 2BV6A 3F8FA 3WGIA 1J2XA 5FFZA 3OYHA 4IRIA 4FX0A 4FCYA 4PJNA 3TQNA 3IH4A 2FQ4A 3GFJA 4C9YA 1VQLI 3S16J 3LA7A 4YRVA 9ANTA 4XK4A 1IG7A 1LDKB 4MEXF 1S8NA 2WC2A 2KIUA 3RQ4A 3SZPA 4IHTA 4P1WA 3EPZA 2VUMJ 2ID3A 4A12A 4L9NA 3M07A 4CDGA 2GA1A 5ILVA 1FY7A 3O6BB 2EA4A 1VQMI 4M6VA 1SD4A 1LNWA 4E7KA 2IS2A 3C2HA 4AIDA 3HG9A 2HDCA 2MW8A 4A5MA 1S3JA 5D5XB 5JLWA 3BTJA 4M6YA 3L2WA 1KYZA 1R1UA 4YIIA 5D4RA 1YS6A 1QNTA 2ECBA 3G2BA 3HHGA 3RPUA 2XDVA 2GXGA 4BXFA 5D5VB 1FPQA 2BHZA 2KLOA 2GXAA 5LEJA 1YW8A 4MGRA 2PJRB 1JTYA 5L3CA 3F23A 3CF5F 2DODA 1XSDA 3S93A 4KICA 1BI3A 4PJMA 1SFEA 4HSTA 2M0CA 4BU2A 3IH2A 2OUMA 5DM7F 4HDUA 2XAGA 4HYEA 1HC8A 3KP3A 2GWRA 4U7DA 3KLOA 3K1NA 1OR7A 3H1CA 2M4KA 4NC8A 2HXIA 3S17J 1OCPA 2WAQA 3AG2H 4IQ4A 3NAUA 1QU3A 2DPUA 1ETWA 1DGWY 4D0PA 3J7AY 3S1QJ 4ENMA 2CGPA 1U5TC 2IS6A 1OYYA 3KIOA 4RB1A 4RLFA 3CF2A 4AIKA 2VKDA 2A5WA 3FK6A 2M8GX 1XD7A 2W00A 4X6AJ 3ZCOA 3J80Z 3GTQJ 2EFOA 2MLKA 3E7LA 2E35A 1Q1HA 2R7VA 5E1WA 3N4MA 1U3EM 1UFMA 3I5UA 3G3ZA 4EVIA 3JRFA 1VTNC 1T39A 1K78A 2PG4A 1ITYA 2X1EA 4OMYA 1LJ9A 5FKNA 5IPAA 3V7RA 3OYBA 1AKHB 5E20A 3I4PA 1MDMA 2L54A 2B7EA 3FM3A 4QTRA 4KITB 4ENJA 2HYFA 4F55A 5DV5A 1FT9A 4BQQA 3QRFF 2LY2A 2DA1A 1K7AA 4XONA 3EUAA 1BI1A 3IHUA 4XN3A 5DDGA 3I3LA 5IYDJ 2VKEA 2DFHA 3L2QA 2R7SA 5LBQA 3OYCA 4UV9A 1YJNI 2KRFA 2HDWA 1SC7A 1MGTA 2V26A 2IW5A 2DXIA 1I6XA 1JT6A 1M1EB 1HF0A 4NDLA 4OMZA 4L9TA 2P5LC 3BJOA 4LIUA 5F64A 2NRAC 1TLHB 2W1OA 3S3MA 2EIMH 1B9MA 4V2FA 4E7ZA 2MGQA 2CFXA 2NYXA 2JK3A 2XPWA 3JREA 2QA4I 3TO7A 2E71A 1VQ7I 2R7TA 3PNVA 2RGVA 4ZDLA 1GV2A 4BGDA 2L7KA 3LSRA 2W85A 3OS0A 5KHDA 3CMYA 2LY1A 4DYRA 1QVTA 3JAMK 2VBXA 2OQGA 1D3YA 2DFIA 4XQFA 3FZVA 1A6QA 4TV7A 5D6EA 2LBFB 2OPTA 4L5EA 4ZZLA 2MD5A 2X0LA 3VPRA 4OIQF 4CCNA 4D9JA 2RVCA 1K78B 1E0EA 2OCEA 3BG3A 5KAFC 3CCVI 3H5NA 2VJ4A 1Y56A 4BXXJ 3R61A 2ZMEC 2L9NA 2IGMA 3P5JA 3SFIA 5BPIA 2EA2A 3J7YJ 2WBMA 1PJRA 2A61A 3V8KA 1TQIA 1TQPA 1H8AC 2HOAA 3OIOA 3LSKA 1TNSA 2Y2ZA 1OLTA 3PM1A 5GTIC 1OYWA 4QPOA 2M4GA 1YX3A 4YFNF 2DU9A 2E36A 4HNTA 2HQ5A 4M9XA 2H6CA 1B72B 2VN2A 2HGCA 3KP7A 2ME0A 1BC8C 1QZYA 1Z3YA 3LSTA 2NVYJ 3DWLE 4HW0A 2P81A 2IPQX 3PFIA 3HBLA 2DT5A 4NHJA 1UG0A 2DOAA 1S9HA 4AVZA 4FQGA 4YG2F 3D5LA 5IYBJ 1ZELA 1NG6A 1WHUA 2HDDA 3MWMA 3CESA 2NNNA 3TW6A 3K4LA 2L9VA 1S5LC 3UR3C 3A0HC 3FBIB 1RIOH 5FRNA 1GVDA 2QSGX 1HA8A 3CD6I 1P4AA 3HTSB 1T8IA 3CCRI 4M6XA 3WTTC 3S3NA 3F3XA 2JSPA 3GWZA 1XSXA 1MZBA 2FBIA 4HNUA 2EFWA 1KQ0A 4I7HA 1BL0A 3WU1B 3D5SC 2XF7A 4MO7A 4JX4A 2EZKA 5IT3A 4BHCA 2DI3A 2ZXJA 4WXCA 3OYFA 4G7ZF 2CUFA 4AU7A 1TW2A 2NVQJ 3FXJA 2M0MA 1T0FC 3MZ8A 2Y0SA 3S1MJ 2DTRA 2JMWA 4O5VA 3UKGA 2Q0OA 2O8XA 2IA2A 1XDUA 5HODA 5L3EA 2PFBA 5D4SA 2PMZA 4XSZF 2F5DA 1ZAOA 1HXDA 2V9VA 1HW2A 1OCTC 5GADJ 2F5FA 3G6EI 4IHSA 5IP6A 2VXDA 3G1OA 1OCCH 2EIJH 3KPHA 3OWTA 4AIJA 5DTDA 2KKOA 1ZRFA 1N25A 2KP6A 5EEAA 2DMQA 4GCVA 4ZYHA 4G9YA 2QUFA 3BG6A 2XRLA 1CF7B 5DCMA 3OYLA 5D8LB 3CJQB 4XLPF 2PEXA 4DZJA 1BJAA 4XLCA 5K7FA 2E34A 2OAZA 1IGNA 2FA5A 1H89C 3QYBA 1UMQA 4LMYA 1X4OA 2XGDA 3RCOA 2JVHA 3SEQA 3SXYA 4NBQA 1R1TA 1FP2A 3EUHA 4ZTJA 3GCMA 5DCFA 4CCJA 3L1PA 1TWFJ 4LG0A 5L3FA 5IP7J 1JGSA 2FX0A 2JUCA 2X1CA 5ILSA 1PUFA 4F7ZA 2ZB9A 5FO5A 1QA6A 2JVGA 5IYCJ 1O57A 1LB2A 4U0WA 1YIOA 3RIRA 4HBLA 2LP0A 2V9KA 2BY2A 2ZBKA 2OV7A 3ZQLA 1T33A 2V6EA 3E5UA 2PQ8A 2W84A 4JX6A 2IA0A 2DCEA 5AIQA 5GPAA 4X0GA 1XCBA 2ZKZA 2HPMA 2HTSA 3GMEA 3K4BA 4A3DJ 1VF9A 3CLQA 5F0FA 5IP9J 3B73A 3DCFA 2DA4A 1MSEC 1I1SA 3IUOA 1PUFB 2TCTA 2W57A 4AYBA 1AHDP 4HOBA 2C6YA 4UB8C 4RGXA 1QQIA 5BMZA 1Z0XA 3IC7A 3M8FA 5F27A 2RQQA 1LE8A 1AWCA 4Y15A 2MH9A 3BZCA 4HRIA 4XMYA 1FOKA 2DQLA 3FX3A 1I1GA 3KEQA 1JKRC 4XL9A 3PO2J 4HPQA 3JSPA 3ASNH 2PMHA 3F6OA 2CRGA 2KFDA 4P55A 1VQ8I 5FLXK 5CVJA 1B1BA 1V3FA 3CUQB 2KJBA 2BZTA 3F8CA 3AL0C 1IXRC 1N75A 2A05A 2RC4A 5ICCA 1P2FA 1U5TA 3GFLA 4FE4A 3CP8A 4Q4ZF 2JA5J 4HX8A 3ZP5A 4ESFA 4HSRA 1IRZA 2KIQA 4A5NA 1SAXA 4CO8A 3CUQC 1OKRA 4I02A 3A4CA 3FK7A 1F4KA 5FGMA 2WAFA 1KQ9A 3IH3A 3LAJA 1TP4A 3CCUI 2EFQA 1ON1A 3ABMH 1I27A 4KT5C 1ZHFA 3GTLJ 1FMVA 4NC7A 4RLQA 1MMGA 4B43A 3L2RA 1XSVA 1W5CC 2CQNA 2BGCA 3GTKJ 1QZEA 3EUKL 4B47A 4U7BA 1ETXA 4RBOA 4LLNA 1FOWA 3EETA 4XLNF 3GTPJ 1VZ0A 1QHHD 4PFPA 2DOEA 4B44A 3PNYA 4S0HB 3G1MA 3OYJA 4A0ZA 4Z6YA 5GTHC 4C3HJ 2IVMA 2DQRA 4MTDA 2CUEA 4BJ6C 3CJRB 5M3FJ 4HAMA 3DFGA 4A6DA 2BYVE 3V42A 4LK1F 1IAWA 5ICEA 1Y1WJ 4A3CJ 4KIBA 4RAFA 3LQQA 4G6QA 1QBJA 3COAC 5EEHA 3EYYA 3P9KA 3JW4A 3HPHA 4JK1X 1MBFA 3FDYA 2X6OA 3FKIJ 2X85A 2FMLA 2HFHA 2Z16A 1OISA 1VQ4I 5F04A 2FUG2 4PGHA 4WF2A 2NOGA 3L00A 2BE5F 4RGSA 3V4GA 1Y1VJ 1TBXA 3RKWA 5K5QA 3K9TA 4L0ZB 1UHWA 1K83J 1R22A 2A3SA 2ETHA 2GQQA 2L0KA 3JTGA 1VQ5I 3OYIA 1Y6IA 3LFUA 1E3OC 4XR6A 2YU3A 3I59A 1WJFA 2ACJA 4ON0A 5AIPA 2VE9A 3QOPA 1QPIA 5K7HA 3DU6A 2R92J 1GV5A 1WCMJ 3HYIA 1HLVA 4LG3A 2HQNA 4WXHA 3I58A 3RZOJ 5HS7A 2K27A 3GXOA 3DBRB 3ABTA 3VFZA 4WWCA 4LK0F 3WE3A 2HVQA 2QQAA 2VQHA 3GBGA 5FKMA 3JRDA 3OY9A 1RI7A 2BBYA 4C2UA 1G3SA 4D5CA 2F5VA 2K86A 1IDYA 4OAYA 3A02A 2QSHX 1ZRDA 3ABUA 4RDUA 2NS7A 1Z6RA 1LVKA 3HPGA 4AYBN 2VLAA 3BZ6A 4RAYA 2H8WA 1SVMA 2XSDC 3CC4I 5HDNA 2FOKA 2KIMA 2MC3A 5J47A 1APLC 1CF7A 2K4BA 1EKEA 1FX7A 4MEYF 4ESBA 2F5EA 1F43A 2PMUA 4UV8A 3DXJF 4EJOA 1P7IA 1GUUA 2O0YA 1MNEA 2JT1A 3BJ6A 4EJWA 1GT0C 3SQNA 3L09A 2GZWA 3NWSA 1USTA 1IC8A 3QP6A 1ZQ3P 3WTWC 3J7AO 3RYRA 2V1NA 2ZMEB 2LH9A 5DUIA 1T38A 5KNLA 1TWHJ 3H9QA 4G12A 3J81Z 3W2VA 3HL2A 2EINH 4HV5A 4PK4A 5CQGA 2IAIA 3I59B 3BQZA 2IBDA 2N8GA 1F1ZA 1U0JA 3O8HA 3Q3SA 2RV8A 1YI2I 2O61A 4M9SA 4UB6C 2XF5A 2BOLA 1MMDA 4U0YA 2GA2A 2TDXA 3PNTA 2VQGA 2KDOA 3F72A 1XB4A 3SHFA 2D5VA 3CDHA 1MNDA 3QAHA 4JX5A 1X3ZB 4LGWA 1YE9A 2DLLA 2WWYA 2ID6A 3R0AA 5C3EJ 3H36A 4XOTA 5CJ9A 2K9MA 1OR7C 3DKWA 1K61A 2G9WA 5H2FC 3WU2C 2DO7A 2CV1A 5J8FA 3OOPA 3JAMZ 3S15J 3BR5A 3HUGA 2KQRA 5LEKA 5E17F 1ZTRA 4D1QA 1ZH5A 2GIZA 5F6FA 2VASA 1OCRH 3HEFA 1NH3A 1AOYA 5ERIA 4P5OA 4II2A 2MYSA 4NQWA 3ZPLA 2E7WA 4KMUX 1VQ6I 3RTRA 1LEBA 5E1ZB 3JTHA 2OA4A 5A2QZ 1LDJA 5C44J 2L7MP 3CQZJ 4A3KJ 4BQAA 1LVAA 2UUZA 3ECHA 4XKWA 1A36A 2JUGA 2EV5A 2MA3A 3LMMA 4FT8A 2VC1A 3HSFA 3H3UA 3CLOA 4KJZA 3K1MA 1RKWA 5LRSA 3HOWJ 1IDZA 1WH5A 1BBYA 2K4JA 3ZMUA 1XN7A 1U5TB 1XMXA 3PSFA 4NC6A 5KAIC 4AUXA 2QSFX 3HUGB 2DPDA 2QYOA 2V4JC 4IOAF 4M9ZA 4EGYA 1MDMB 1RUOA 2PJPA 3HOSA 3F8BA 4E7SA 4A69C 2GLOA 2W25A 2DT6A 4MFEA 5DYMA 4CYDA 2H1LA 1L3LA 2OZ6A 1Z21A 2LR8A 1YRNA 2JA8J 1U6GA 1PVEA 1DU0A 2AXLA 2XAJA 3RDIA 2XGXA 4WCGA 1K4TA 3K10A 2HR3A 4HQEA 1T08B 1TWGJ 4B8XA 3WU0A 4HX4A 1MSFC 1SD6A 2DA5A 1XMAA 2Q2EB 3ERED 3OYDA 1HKSA 1MH3A 1MBKA 4R8HA 4IVNA 5TJJA 4KYWA 2ZJ2A 1SFXA 1O3TA 2Y30A 4FTHA 4RA2A 3I4NJ 2EV6A 3BG9A 5EZHA 3H3VK 4KUMA 4CGZA 1S7EA 3MKLA 4PJJA 5JHUA 2RKHA 1POGA 2EB7A 3VYRB 1I3QJ 2A6HF 1DU6A 4IF4A 2VBYA 2H09A 4ZTFA 2XAQA 1SANA 1K6OA 1X1DA 4A0YA 2EWNA 2MABA 1VI0A 3PUFA 4M3DA 5E18F 2NS8A 4KISA 1TWCJ 4XLAA 2HWVA 2YX7A 4I76A 5D5WB 3MCZA 1IN6A 5E3NA 4BBSJ 1MBHA 1ZLJA 2Y31A 3AFHA 2Y48A 1BIAA 2P7VB 4I0BA 1X58A 1ZG3A 1XC5A 2KT0A 5JFRA 3K70D 1FSHA 4ZYAA 2X1DA 1WGXA 2CQKA 3PSIA 3RJPA 2NVTJ 4MNUA 2L7ZA 3WHCA 5KVRA 1JE8A 4N4OB 2FXAA 2IS4A 3CCYA 1OCZH 3DEUA 1MBGA 4JQFA 2M87A 4NUBA 3HRSA 3VSKA 4BBRJ 4IHYA 5B3SH 1YIJI 3HDDA 1FOYA 2IS1A 2W48A 2YSRA 3OR2C 1U78A 2O8KA 2Z9OA 2CV0A 3FF5A 1FIAA 1R71A 1LUJB 1ZGAA 4KN7X 2QBYA 4G7OF 1X1BA 3S2WA 4XLEA 4XNFA 4L0YB 4BY7J 4DJAA 2VOPA 1VQNI 2Z33A 2VC0A 3E1SA 2B9SA 2O9LA 2XB5A 2IP2A 4MHGA 3CUQA 4JP0A 4IOCF 1MMSA 5H6RA
chains in the Genus database with same CATH topology
3D5LA 2KRHA 1K6YA 1ZELA 1NG6A 1BR1A 2HNHA 4CZCA 4XKVA 3W2WA 4R79A 3CESA 4E7JA 1LKXA 3OL4A 4FETA 2K3PA 3K4LA 5LFAA 4CSWA 2LC2A 3UR3C 3FBIB 1SFKA 3DPTA 5FRNA 1HA8A 3NWTA 2DT7B 5FROA 3ZGKA 3S3NA 2R7OA 2JSPA 4OWRB 3PL8A 4HNUA 3A2KA 2XSJC 2VL8A 4LIVA 4Y33A 3D5SC 3OS1A 3MKWB 2XF7A 4BL0B 2JA2A 2R7UA 1BR2A 5HOOA 3OYFA 2M3AA 4E4HA 4AU7A 3OS2A 2DJIA 4C30A 3IP4B 2M0MA 1T0FC 1R6RA 2Y0SA 1EA3A 2HPIA 3CZ6A 3I9V2 3U21A 3K4MA 3KYLA 4BE1A 4YELA 1WJEA 2PMZA 4IX7A 4BJ5C 4BDZA 2HQAA 1LFPA 3W3CA 1YX5A 1BR4A 2VXDA 2HVSA 3DTKA 1G59A 2XC7A 2KMUA 2KPMA 3OWTA 2L2OA 3PJRA 2KP6A 3BG7A 3AKZA 3BG6A 2VJIA 5TGTA 3OYLA 2WADA 3M8JA 4ITVA 3CJQB 5KCMA 3H5RA 3VSLA 4MLOA 3LSHA 3K4CA 1QHGA 3BCAA 4XLCA 3OMYA 2CV2A 2R7XA 1UELB 2VQLA 2LRDA 3RPUD 3QYBA 1DQUA 4PUSA 1X4OA 1MW7A 3RCOA 3K4JA 2JVHA 3SEQA 3QYFA 2E1MB 3H9GA 2M7BA 3C2GA 4BJTA 4CCOA 4ZTJA 4CCJA 2R7RA 2X1CA 2HU9A 2KZVA 2HZDA 2LYCA 2W82A 2JVGA 3L2VA 3K6GA 3H0DA 5HLTA 2WA0A 3OL3A 2V9KA 1FMWA 2W4SA 2OV7A 4RM3A 4YEJA 2V6EA 2MC4A 5LD2C 3OYNA 3FHNA 2DCEA 4XKCA 4X0GA 2XAUA 1X19A 2F4IA 3OOUA 5CQEA 4BEHB 4G6TB 2HPMA 3KX2A 3K4BA 2VPLA 2KRCA 4BQNA 4PSWA 5FRMA 3S8PA 1WJBA 3IUOA 4AYBA 1GLNA 4DGWB 2Z1DA 4ZJZA 2X51A 3DLAA 5HVQC 4CUGA 2RQQA 4BDYA 2E1MC 2VIXA 4HRIA 2E60A 4XMYA 2NOJB 2Q1ZB 3FBNB 2V7FA 2IXSA 4XL9A 4HPQA 2X6XA 4E7IA 3SYTA 2QKLB 3DKXA 2LG4A 2IGNA 1G8XA 4RMNA 2O5RA 2R7QA 3OIQA 1N75A 4J01A 3AL0C 2MD0A 2VQCA 1T95A 3CP8A 2R4GA 1W36D 3HXLA 2Z2SB 2VJ5A 4HSRA 4CCKA 3OYGA 3IAM2 1N77A 2IGKA 3A4CA 2L5QA 2ZSHB 2WAFA 3K4NA 2HVRA 3DTEA 4BUPA 1ERDA 2GOMA 4ZC3A 3H9JA 3HC7A 1FMVA 2ELJA 3OIPA 4NC7A 4RLQA 1MMGA 4B43A 5HNFA 2WY7Q 3L2RA 1MMNA 4XORA 2CUJA 3EUKL 4B47A 4U7BA 1P9QC 1JI8A 1VZ0A 1QHHD 3MD2A 4PFPA 4PSXA 4B44A 3PNYA 3OYJA 3PFYA 3VYSB 2W7NA 4XKBA 2I8DA 3M1CA 1KONA 3L2UA 4XN0A 1AA7A 4BJ6C 3CJRB 2BVLA 3V42A 4CA0A 2L9SA 4H4KC 4HG2A 2ZSIB 2WY8Q 4B3XA 3K4KA 4F93B 4BEHA 2UWMA 2VB6A 3A1YA 1BOBA 1DGRM 3HPHA 5CKTA 3FDYA 3OYEA 2K9LA 4CCLA 2XF6A 2X85A 2Z16A 3QODA 3RSNA 4EATA 1N78A 2FUG2 4E6KG 3H35A 1D0YA 4F52A 2A6TA 2KHMA 1TT0A 4DIQA 3VYUB 3OYIA 2WAEA 1NG7A 3LFUA 1Y6IA 1D1AA 3FKJA 4XR6A 1WJFA 4BQOA 4II3A 2BVMA 4JOMA 3DPLC 3KEYA 2VJJA 1D1CA 1W36C 4NNJA 3DU6A 4U87A 3OYMA 3VYTB 2E5ZA 4LG3A 3K70C 5HNHA 3LL7A 2WB1A 2HVQA 2VQHA 4C2TA 3GBGA 4DBQA 2CS3A 4PJLA 3OY9A 4C2UA 3HKZA 2F5VA 2K5CA 2IGOA 4OAYA 3TMOA 1WJAA 2ZFUA 1D0XA 3DQVC 1LVKA 3HPGA 3OYHA 2P0WA 2VLAA 4PJNA 4C9YA 2RNGA 3SEZA 4YRVA 4IQJA 1LDKB 3RQ4A 2BW3B 2AQEA 4P1WA 3EPZA 4J00A 2GOXB 3DTIA 2OC6A 1MNEA 1J09A 3NWSA 1X1AA 3TBIA 4E7KA 2CH0A 3IAS2 2IS2A 3C2HA 2V1NA 2LH9A 3HG9A 5KNLA 2RREA 3H9QA 3OYKA 4FASD 3W2VA 3HL2A 2BW3A 3L2WA 1D1BA 4PK4A 5CQGA 2X6WA 3G2BA 1U0JA 3VDXA 3SDBA 2XDVA 3BLYA 4BXFA 3ONQA 1IRXA 3TL4X 3DU5A 2XF5A 2BOLA 4XLFA 5CPRB 3CP2A 1MMDA 2KLOA 3W2AA 3PNTA 2VQGA 3OYAA 2PJRB 2KDOA 4BE0A 3PUBA 1MMAA 3ZRGA 1MNDA 1YE9A 3DEEA 4DBRA 3S93A 4ZDOA 4PJMA 4HSTA 4PFOA 3BC8A 3AL0B 1V5EA 1Z3XA 3OR1C 3QOEA 4XOTA 2LOOA 4BU2A 2K9MA 1OR7C 2OUMA 1UAAA 3S32A 2CV1A 2PJRA 2KQRA 2UV1A 2M4KA 4NC8A 4D1QA 4Y4RA 3LSIA 2VASA 3F9KA 3LSGA 4GRIA 5JHFA 2WAQA 4IQ4A 1V5FA 4P5OA 4II2A 1QU3A 3J7AY 1DGWY 2MYSA 1WJCA 2IS6A 1WFXA 3RTRA 4RLFA 4HEA2 3CF2A 2VKHA 2VKDA 2A5WA 1TZLA 2CUZA 2W00A 3ZCOA 2UUZA 4XKWA 2JUGA 1Z7LA 4F91B 3MKYB 1X4PA 3N05A 4N4NB 3LMMA 1D0ZA 4KJZA 1DP3A 3VWBA 2X1EA 4DOZA 4F3QA 3QYEA 2CW7A 4ZDPA 3PSFA 3OYBA 4OAZA 3HUGB 2V4JC 4CH7A 4KITB 2X6YA 4F55A 3S3OA 3HOSA 4E7SA 4BQQA 4Y3OA 2LY2A 2DT6A 2LBFA 2R7VA 4XONA 1Z21A 3EUAA 4XN3A 4E7HA 2CFOA 3E0JB 3I3LA 3K10A 3DPUA 3L2QA 2R7SA 3D5RC 3OYCA 2Q2EB 3OYDA 3ZQQA 2VXZA 2HDWA 4LITA 2V26A 2DXIA 4ANJA 4BE2A 4BACA 4LIUA 4NQWB 3H5AA 3MMYB 4XOPA 2W1OA 3S3MA 2KL4A 4PJJA 2CMPA 3VYRB 4E7ZA 4ZTFA 1X1DA 3LSMA 2R7TA 3PNVA 3DKYA 2MABA 1SAUA 4ZDLA 4XLHA 4BGDA 4KISA 4XLAA 2L7KA 1WJDA 2LREA 3ZXSA 1PYVA 3OS0A 2R7WA 5KHDA 2LY1A 3AFHA 4RM2A 4XQFA 3HOTA 3K70D 4ZYAA 4QPQA 2X1DA 2LBFB 3PSIA 3CMMA 4CCNA 4D9JA 3ZR8X 1E0EA 2ZXHA 3EUHC 2VJ4A 2CW8A 1Y56A 3H5NA 2MFZA 4N4OB 2M7AA 4E7LA 4IZZA 1V5GA 2IS4A 4XM3A 2QKMB 2F6CA 2IGMA 2L9NA 3BCBA 4JQFA 4KT6A 2WBMA 1PJRA 4NUBA 3VSKA 2IS1A 2E5NA 4IKFA 3OR2C 3LSKA 1OLTA 4QPOA 2CV0A 2M4GA 1YX3A 4BS9A 3MKZA 4F92B 4HNTA 1X1CA 4CCMA 1X1BA 1WJ5A 4XLEA 3UNGC 4XNFA 2AQFA 4DJAA 2ZXIA 1Z3YA 3SZGA 3E1SA 3DWLE 1UG0A 2DOAA 4B48A 1S9HA 4AVZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2MFZ A;  2M0M A;  2K3P A;  2MAB A;  2KHM A; 
#chains in the Genus database with same CATH topology
 1NHA A;  1NK2 P;  2KRH A;  1OFC X;  2M1B A;  2EJR A;  2V1X A;  4PJ0 C;  1IXS B;  1J7K A;  4DQ2 A;  5LHG A;  2IT0 A;  1LKX A;  2LDU A;  2P6T A;  3OL4 A;  4FET A;  2LTP A;  1MD0 A;  1SFK A;  3DPT A;  5H6Q A;  3HRT A;  1H0M A;  4UNO A;  1UCR A;  3PL8 A;  3TGN A;  2L3D A;  2GXB A;  3ZOB A;  2EIK H;  4S04 A;  2H94 A;  1Z05 A;  5BPD A;  3C18 A;  4BL0 B;  2JA2 A;  3JSO A;  2F5C A;  4S05 A;  1I5Z A;  5J8C A;  3KLN A;  1FNN A;  4E4H A;  2D1H A;  3TW7 A;  5B5E C;  1ZR4 A;  4C30 A;  5FLX Z;  1XX5 A;  4LG0 B;  2BXZ A;  2EBI A;  3HZJ A;  3CZ6 A;  3I9V 2;  3T1B A;  3KYL A;  4BE1 A;  1KU9 A;  1WJE A;  4IX7 A;  1QVU A;  2NXN B;  4BDZ A;  2EZI A;  3WTZ A;  3WGG A;  1WPK A;  4EJU A;  5B1A H;  1YX5 A;  4UUS B;  1RET A;  4I99 C;  2R7F A;  3FXO A;  1A5J A;  1JKO C;  3J80 K;  3ZQH A;  1KU3 A;  5AON A;  2XC7 A;  5HS9 A;  1YW9 A;  4UVC A;  1F9N A;  3TED A;  5E8I A;  3B6C A;  5J1U A;  1VND A;  4FE7 A;  1OJL A;  3M8J A;  4ITV A;  5KCM A;  3H5R A;  4LLG F;  4CXF A;  5LLQ A;  1HW1 A;  1QHG A;  1S7O A;  2P5V A;  3I64 A;  2VQL A;  2LRD A;  2K9S A;  3RPU D;  1Y39 A;  3HGG A;  3I54 A;  4PUS A;  3L9F A;  2KIS A;  3K4J A;  4UUS A;  1YIT I;  1TW3 A;  3H9G A;  1X3W B;  4CCO A;  2QM3 A;  3OSG A;  5CVR A;  1ZG5 A;  3Q0V A;  1D5V A;  2LNB A;  4Y17 A;  2HU9 A;  1AU7 A;  2JZY A;  2HZD A;  4YIR X;  2W82 A;  3T5X A;  3BZK A;  5HDK A;  3L2V A;  3GW2 A;  3K6G A;  3R60 A;  3QQA A;  2DDB A;  3H0D A;  1JGG A;  3KP5 A;  3OL3 A;  1EH7 A;  3KEO A;  1FMW A;  2YUS A;  4I01 A;  2I5U A;  2MBF A;  5ICF A;  2JA6 J;  5E3L A;  2ELH A;  3NAR A;  1QRY A;  5LD2 C;  3F0C A;  3OYN A;  4XKC A;  2E1C A;  4XRF A;  4HX7 A;  1W0U A;  2Z99 A;  2OTL I;  1V4R A;  4BQN A;  1FBQ A;  4PSW A;  2OTJ I;  4KFC A;  1WJB A;  3P7N A;  4N0B A;  1GLN A;  2V1U A;  3LFK A;  1QO0 D;  2QQ8 A;  4ZJZ A;  2X51 A;  2VE8 A;  2HKO A;  3DLA A;  4Q5S F;  5EG0 B;  3JRH A;  3FMR A;  4A3J J;  4A3E J;  1Z6T A;  2E60 A;  2NOJ B;  2Q1Z B;  2QGU A;  5BOX A;  4E7I A;  2H27 A;  4IHW A;  2FD5 A;  4WXD A;  4RB2 C;  2JPB A;  2ESH A;  1FIP A;  1G8X A;  4D5F A;  2R5Z B;  1YW7 A;  2R7Q A;  3IV5 A;  1T95 A;  2ZME A;  1WH7 A;  1R49 A;  3IKV A;  2R4G A;  1W36 D;  2F2E A;  2D1V A;  1VFC A;  1HBX G;  2DK5 A;  4CCK A;  2QBY B;  3Q0W A;  2DYS H;  3WTU C;  3OYG A;  3HGY A;  1N77 A;  1Y8Q B;  3FM5 A;  4A3L J;  4GYG A;  1WSU A;  2L5Q A;  2IEK A;  1ONV A;  3K4N A;  1KU2 A;  3CDL A;  1A35 A;  1J5Y A;  2GOM A;  3H9J A;  4ZC3 A;  3HC7 A;  1R4M B;  2RAE A;  2CUJ A;  1HCR A;  2FF4 A;  1ZR2 A;  3TOB A;  3LAP A;  4B1R A;  4UY8 I;  1JI8 A;  4IRG A;  1MKM A;  2M45 A;  3P9I A;  3EYI A;  2DA3 A;  2M34 A;  4EGZ A;  1LPQ A;  2OCC H;  3X2Q H;  3IL2 A;  1OPC A;  3M1C A;  1KON A;  5LRR A;  4I98 B;  2VI6 A;  3EDP A;  3W6V A;  2FE3 A;  1DP7 P;  4JYK A;  2ELK A;  5J4Y A;  4H4K C;  4HF2 A;  1G3Y A;  1W1W E;  5LGN A;  4CYC B;  3CCL I;  1FYK A;  4BEH A;  2UWM A;  1EH8 A;  2VT3 A;  3TKY A;  3MN2 A;  3TO9 A;  3E97 A;  2XAF A;  1N78 A;  4V2G A;  3ZMS A;  2WTE A;  4XSX F;  1D0Y A;  3ZQ7 A;  3V8J A;  1SD5 A;  4EJV A;  2DFE A;  3ESW B;  4IL6 C;  3GFI A;  2EH3 A;  1B72 A;  2WAE A;  1XG1 A;  1NG7 A;  2COM A;  3G4S I;  4ENK A;  1IF1 A;  2BVM A;  4Y52 J;  3E5Q A;  4JOM A;  3DPL C;  3B02 A;  3TOA A;  2VJJ A;  1D1C A;  1W36 C;  4EJT A;  3CC2 I;  2HZT A;  1D8J A;  5A2Q K;  2FQ3 A;  3PIP F;  4C2T A;  2CS3 A;  4PJL A;  3GLL A;  3SDG A;  2IGO A;  2XKO A;  2E1O A;  1K4S A;  3LWF A;  5EEG A;  1WJA A;  2B0L A;  3GZN B;  2JRT A;  2L7F P;  5CLS A;  2P0W A;  4NB5 A;  3KYC B;  2OQR A;  2QEX I;  1J9I A;  3BRO A;  5B66 C;  2XGE A;  4BY1 J;  5CYV A;  5D6F A;  5IOY A;  2LMD A;  2AQE A;  2HTJ A;  3CO6 C;  2DN0 A;  1LEA A;  3BY6 A;  1J09 A;  3ZN0 A;  5EGO A;  1ULY A;  4MQ9 F;  1KGS A;  1ON2 A;  3IAS 2;  1U9O A;  4Q48 A;  5E3M A;  3AG4 H;  1O7L A;  2RRE A;  1BN5 A;  3OYK A;  4FAS D;  3JRG A;  2QF7 A;  4BH9 A;  2E2J J;  2BW3 A;  2LF8 A;  1D1B A;  1REP C;  4AM3 A;  2KIF A;  1JUS A;  2M2E A;  1WKM A;  3H3Z A;  2J5P A;  3LSP A;  2OZU A;  3VDX A;  1NK3 P;  1WWX A;  1JHH A;  2UXX A;  3BLY A;  3KE2 A;  3ONQ A;  5JVG F;  2MG4 A;  3TL4 X;  3DU5 A;  1O3R A;  2CQ7 A;  3OSF A;  5CPR B;  3CP2 A;  1Z1D A;  5FB2 A;  4M3F A;  2Y0M A;  4UUT A;  3OYA A;  3ZQG A;  4BE0 A;  1EJ9 A;  3PUB A;  1MMA A;  3ZRG A;  4D7M A;  3MZY A;  3TP3 A;  3BQY A;  2H6B A;  2VT2 A;  3T8R A;  4ZDO A;  2ZNY A;  4HLY A;  2DMP A;  3HIF A;  1E3P A;  3BC8 A;  3AL0 B;  3ASO H;  3FXQ A;  1UAA A;  3BR0 A;  2EZH A;  4UUV A;  2F4O B;  2UV1 A;  3GZ6 A;  3IRR A;  2QLZ A;  1G3T A;  1R7J A;  4Y4R A;  1OMI A;  4N9I A;  3ERM A;  1WJC A;  4G7H F;  3ABL H;  3O2P E;  2VKH A;  1G6N A;  1TZL A;  2CUZ A;  4Y7N J;  2D45 A;  2K85 A;  4OIP F;  2DMN A;  3P9C A;  4QLC U;  5FD6 A;  4U88 A;  1X4P A;  3N05 A;  3M1E A;  4N4N B;  5BQT A;  4UHT A;  4IO9 F;  3A0B C;  2R5Z A;  3B6A A;  1DPU A;  1IXC A;  5DCM B;  3VWB A;  3CCM I;  3WGH A;  3GEZ A;  3QYE A;  5J1Y A;  2E2I J;  1Z7U A;  3NRV A;  2DJN A;  2G7U A;  1B4A A;  2J5O A;  1SVO A;  4CIC A;  2LBF A;  4W1U A;  1XGS A;  1GHC A;  4E7H A;  2HXO A;  5EF6 A;  1ZRC A;  1XDS A;  5D5U B;  3GTO J;  4ESJ A;  1MBE A;  3L2C A;  3D5R C;  5BS6 A;  5FFX A;  1B59 A;  4DNC A;  5LHH A;  3T8T A;  2VXZ A;  1KYW A;  5F0C A;  1SMT A;  1YFH A;  5B1B H;  3LSJ A;  4ANJ A;  1BW5 A;  4O6J A;  3CJT B;  2TRT A;  3H5A A;  3MMY B;  4XOP A;  2CMP A;  3Q9S A;  4W97 A;  2E2H J;  5IT9 K;  5F1R A;  5JVT A;  3CUO A;  1B8I A;  2HS5 A;  2YR2 A;  1A04 A;  1SAU A;  2ZNZ A;  4XLH A;  1A6I A;  4MTE A;  1T6S A;  4L9J A;  3WTX C;  1WJD A;  3HKZ N;  4G6D A;  3DF8 A;  1P4W A;  3JRC A;  4HF1 A;  2Y9Z A;  5GAG J;  1IUY A;  1STZ A;  1BA5 A;  2XUB A;  4GO1 A;  4BNC A;  1MJB A;  4AWX B;  4CYC A;  1Y0N A;  1W5S A;  4R1H A;  3RYP A;  1B6A A;  2NVX J;  1BJZ A;  1W7P A;  4QPQ A;  2JPC A;  4EEF G;  2ISY A;  4IJA A;  2WB1 N;  5FLV A;  3PO3 J;  1GXP A;  4M74 A;  3DLL F;  2PBI A;  5ILU A;  2DBB A;  3BR3 A;  2FRH A;  2ZXW H;  3BR2 A;  5HLH A;  3QU6 A;  2CW8 A;  4C3J J;  1ZAR A;  2M7A A;  4E7L A;  2VBZ A;  2ZJR F;  1V5G A;  1YO5 C;  4AC0 A;  2QKM B;  2X9D A;  3BCB A;  4HNV A;  3CC7 I;  5M3M J;  1R4N B;  1USS A;  2E5N A;  2FOW A;  3F21 A;  2JTV A;  1FBU A;  4D7N A;  3KYD B;  4Q47 A;  5DD4 A;  4BS9 A;  4F92 B;  1X1C A;  4C2M J;  3C3W A;  1WJ5 A;  3DV8 A;  2A5Y B;  3CDI A;  2ZXI A;  2RQP A;  3D0S A;  3SZG A;  1LQ1 A;  3HJE A;  1Q1V A;  5FD5 A;  3IWZ A;  1R36 A;  2QQ9 A;  4B48 A;  2H8R A;  3ABK H;  2KDZ A;  3V8L A;  2XVC A;  4CZC A;  1BR1 A;  2B63 J;  3W2W A;  4V19 K;  1A31 A;  2HYJ A;  2ZCW A;  5LFA A;  3HM5 A;  4CSW A;  2A07 F;  1WRJ A;  2LVS A;  3WTY C;  4BYY A;  1ZGJ A;  1XCV A;  2K02 A;  1ETQ A;  3F6V A;  3DEW A;  1JKP C;  2XSJ C;  3KZY A;  4M72 A;  2W24 A;  3MKW B;  3OS1 A;  3RKQ A;  2R7U A;  1BR2 A;  2EIL H;  4FIS A;  5E8G A;  1SEU A;  2M3A A;  4P9U A;  1Z91 A;  5TRD A;  3OS2 A;  3CCQ I;  4M3G A;  2G7H A;  1X1P A;  3IP4 B;  1JHF A;  4HLX A;  2HEO A;  4KIF A;  2VON A;  5KK1 A;  3F8N A;  5EZG A;  5FLM J;  1S72 I;  4PCQ A;  4P9F A;  3K4M A;  3FMQ A;  4YEL A;  1WI9 A;  3ZMV A;  2L02 A;  3EQL F;  3I4M J;  2HQA A;  1W7P D;  3PQJ A;  2GIV A;  1LFP A;  1R58 A;  3W3C A;  1BR4 A;  3CTA A;  2HVS A;  3DTK A;  1G59 A;  5ED4 A;  2LY9 A;  2XPV A;  2KPM A;  2Y0S N;  2L2O A;  3PJR A;  3BG7 A;  1RUN A;  1PP8 F;  6PAX A;  4H0E A;  1ETK A;  2PN6 A;  2VJI A;  5TGT A;  3WTS C;  2XAS A;  2BY1 A;  2R5Y A;  1D8K A;  1T0F A;  2DYR H;  5LGU A;  4ZH4 F;  3LSH A;  3BCA A;  2CV2 A;  3HOU J;  3OMY A;  1TTY A;  1UEL B;  1XGN A;  1FTZ A;  3AG3 H;  1DQU A;  4ZYD A;  1MW7 A;  4WX9 A;  1ETO A;  4BAY A;  3N97 A;  1YJW I;  3QYF A;  2E1M B;  2NNY A;  1DUX C;  4KA4 A;  4BJT A;  2P6S A;  2HOS A;  1H9T A;  4HZF A;  4Y13 A;  3OV8 A;  2V1D A;  2EQR A;  3CCE I;  4L5J A;  3ULQ B;  2LYC A;  3BT9 A;  1FEX A;  5CVV A;  1YG2 A;  1HDP A;  1GXQ A;  2IA1 A;  1FYL A;  5HLT A;  1FBS A;  1MBJ A;  3G1L A;  2FMY A;  5LGT A;  2JSC A;  4YEJ A;  2O3F A;  3GUD A;  1BM9 A;  4HA8 A;  2YPR A;  2MC4 A;  1RNL A;  2DDA A;  2OU2 A;  4LB5 A;  5IY5 H;  2A68 F;  2XKP A;  4ZYG A;  4L18 B;  3FHN A;  1WI3 A;  1ZKG A;  3GO5 A;  3I0T A;  3HSR A;  3OOU A;  5CQE A;  5F08 A;  3M4O J;  5D8K B;  2RN7 A;  2KRC A;  5FRM A;  2FJ1 A;  3R0J A;  4A6E A;  4IHV A;  1ETY A;  1YHQ I;  1J59 A;  4KMF A;  5HVQ C;  4HV6 A;  3I56 I;  4CUG A;  4IHX A;  3Q0U A;  2K40 A;  4BDY A;  2E1M C;  5J4V A;  1ETV A;  3FBN B;  3WG9 A;  4M3B A;  1JKQ C;  2IXS A;  2Y9Y A;  2XRO A;  3DKX A;  3CMA I;  3PIO F;  2DK8 A;  2DW4 A;  2IGN A;  2V9P A;  1CGP A;  3VEP A;  1WVR A;  2P8T A;  3HOZ J;  2MD0 A;  4EM2 A;  2EFN A;  1QZZ A;  3S1N J;  2VPR A;  3BTI A;  2COB A;  2IJL A;  3C7J A;  3HXL A;  1KZH A;  2OJE D;  3BPV A;  4RS8 A;  2Z2S B;  2VJ5 A;  4A3G J;  4UVB A;  3M7G A;  3RZD J;  4G8X A;  1HST A;  2HI3 A;  4BXU A;  5M5Y J;  4RGR A;  4RAZ A;  4ZYE A;  3MZH A;  1IRG A;  4A3B J;  2ZSH B;  4EM1 A;  2HVR A;  3DTE A;  4BUP A;  3KZZ A;  5CVU A;  2D2W A;  1E2X A;  2QVO A;  1ZRE A;  5FKK A;  1PUE E;  1FTT A;  3OIP A;  2A6E F;  1DPR A;  3C1D A;  3GTM J;  2FBH A;  4OOI A;  4RB0 A;  5HNF A;  4IEJ A;  2FNA A;  3W6J B;  2WV0 A;  1P9Q C;  1IRF A;  3A01 B;  3JRI A;  1G3W A;  3MD2 A;  5E1X A;  2L01 A;  5EYR A;  1E3H A;  5E79 C;  4PGG A;  3FIW A;  4KN4 X;  1WQ2 A;  3ZMD A;  4OIN F;  1GVJ A;  2MLG A;  3HTU A;  3AAF A;  2I8D A;  3BPX A;  3L2U A;  3BDD A;  3KZI C;  4XN0 A;  2WAQ N;  3F22 A;  2BVL A;  4P96 A;  3CJN A;  1T2K A;  2L9S A;  4HG2 A;  4B3X A;  2JWT A;  3HSE A;  3BG5 A;  3K4K A;  2VB6 A;  3A1Y A;  1RES A;  2JA7 J;  3OYE A;  2K9L A;  4CCL A;  2XF6 A;  2FEZ A;  1KA8 A;  1JT0 A;  3Q5F A;  4XID A;  1MNM C;  1R00 A;  3QOD A;  4A2U A;  3RSN A;  1X2N A;  3A01 A;  3NQO A;  4M71 A;  4E6K G;  2O03 A;  4A93 J;  1FJL A;  1J0R A;  1DDN A;  1R5I D;  4ZZD A;  1TT0 A;  2V79 A;  2JRM A;  2QQB A;  3VYU B;  4CZZ A;  1U8R A;  3JRB A;  3LOC A;  5HLI A;  3WOD F;  1K79 A;  1D1A A;  3KP2 A;  3FKJ A;  1U8B A;  5DS9 A;  4BQO A;  4II3 A;  1XGO A;  2O6G E;  3KEY A;  1EH6 A;  4XRM A;  2EFP A;  2VOD A;  3OYM A;  3VYT B;  2E5Z A;  5J40 A;  5FKL A;  2DOF A;  4KIG A;  3K70 C;  5DD8 A;  5GAH J;  1QGP A;  1S6L A;  3KP6 A;  5EJC A;  3LL7 A;  5HNH A;  1J75 A;  2WB1 A;  3MAJ A;  1UJ8 A;  2Z3Y A;  4DBQ A;  4BKX A;  5ICG A;  1VQ9 I;  1IN4 A;  3HKZ A;  5K7Z A;  2K5C A;  2F48 A;  2Y75 A;  3O8G A;  4XBF A;  3TMO A;  1XGM A;  2CYY A;  2ZFU A;  4ENN A;  1I6H J;  1D0X A;  3DQV C;  3Q9V A;  1YOV B;  2DTZ A;  1FWZ A;  2EZL A;  4KNY A;  3JCU C;  2STT A;  1G4D A;  3O3K A;  2RNG A;  4RAG A;  3SEZ A;  4GFB A;  4IQJ A;  4IXA A;  5LHI A;  3CCS I;  1HOM A;  1UHS A;  2BW3 B;  2M9H A;  1CQT A;  4J00 A;  2GOX B;  2LSO A;  3DTI A;  1ZN2 A;  2OC6 A;  2ZC2 A;  4WK8 F;  5M5X J;  1FLI A;  2Q8K A;  3RKX A;  1YTY A;  2ZJQ F;  1H88 C;  3DBH B;  1X1A A;  3HB9 A;  3M3Y J;  3TBI A;  2CH0 A;  3LA2 A;  1FSE A;  1ODD A;  3TDZ C;  4XRS G;  2FNP A;  2ZO4 A;  4EV0 A;  1W4M A;  3K1P A;  3E5X A;  2G0E A;  2JJ7 A;  1VQK I;  1RR7 A;  3U2R A;  2X6W A;  4IRH A;  1JJ8 C;  3DP7 A;  2R7Z J;  2X4H A;  5K5R A;  2ESN A;  4RGU A;  3SDB A;  2YU9 J;  3M8E A;  1IRX A;  2LKS A;  3E3V A;  2E1N A;  3CCJ I;  4XLF A;  4LLL A;  3QPS A;  1XPX A;  3F8M A;  1HSJ A;  3W2A A;  1W7P B;  3MQ0 A;  1FP1 D;  5J3L A;  3GTG J;  1F5T A;  2QZ8 A;  1RRJ A;  4L5I A;  1B9N A;  3DEE A;  4DBR A;  5L3D A;  5EGO B;  4O3M A;  1D5Y A;  4PFO A;  1JUP A;  1V5E A;  3L7W A;  1Z3X A;  3OR1 C;  3QOE A;  2LOO A;  5GP9 A;  1P6R A;  2EV0 A;  2XV4 S;  3S32 A;  3HRU A;  4UXN A;  1KU7 A;  1BOA A;  2PJR A;  1B8I B;  1ZYR F;  1AKH A;  2X48 A;  2OF7 A;  2YX4 A;  3GX4 X;  4MIM A;  1IUF A;  2XGC A;  3LSI A;  3F9K A;  3LSG A;  4GRI A;  4XRS A;  2A69 F;  3H0G J;  5JHF A;  2R0Q C;  3ROU A;  1V5F A;  5J6X A;  1SFO J;  2STW A;  1SD7 A;  1R23 A;  3E6D A;  4A3M J;  1VQO I;  3IKT A;  1WFX A;  2Z5U A;  2ECC A;  4HEA 2;  1SMY F;  2XAH A;  2CJJ A;  3QP5 A;  4A0X A;  4GGG A;  2CO5 A;  1O7F A;  4U0V A;  2HQR A;  2XIG A;  3BOQ A;  3U9G A;  2DA2 A;  4CHU A;  1Z7L A;  5DM6 F;  2WV1 A;  4F91 B;  3MKY B;  2DA7 A;  1ZK8 A;  3FWE A;  2NAZ A;  3SZT A;  1D0Z A;  5DUK A;  4E70 A;  1L0O C;  4B4C A;  1Z77 A;  4MQV A;  1DP3 A;  2R7D A;  4DOZ A;  4F3Q A;  1ZGW A;  2CSO A;  2CW7 A;  3K7A J;  4ZDP A;  4OAZ A;  3G71 I;  4CH7 A;  2X6Y A;  3S3O A;  3BP8 A;  1YQA A;  3S14 J;  4Y3O A;  1O4X A;  2QCO A;  2O7O A;  2DMT A;  3W6K B;  1FC3 A;  2I10 A;  2CG4 A;  2CFO A;  4OU0 A;  3E0J B;  1LDD A;  1LE8 B;  2PI0 A;  2MSY A;  1T56 A;  2R3S A;  3DPU A;  2K9Q A;  3HOV J;  3FXK A;  1YLF A;  2FU4 A;  2LKX A;  3ZQQ A;  3BWG A;  4LIT A;  1PDN C;  1I39 A;  3HOY J;  4HQM A;  2P5K A;  1C0W A;  4UVA A;  1WZ2 A;  4BE2 A;  4A3F J;  4K2E A;  3J7Z I;  4BAC A;  1KQ8 A;  4L9V A;  1YJ9 I;  4NQW B;  3AG1 H;  2BXY A;  3K0L A;  2KL4 A;  1HQC A;  3ZQC A;  2F4M B;  3LSM A;  4HF0 A;  3DKY A;  1V55 H;  4QIW N;  2Q2E A;  4X1E A;  3QPT A;  2XB0 X;  1ZG1 A;  2LRE A;  3ZXS A;  4AVP A;  1P4X A;  1PYV A;  2CW0 F;  2Y69 H;  3D1N I;  4DYC A;  1R1V A;  1UHM A;  1EV7 A;  1UB9 A;  5JR3 A;  3MFK A;  2R7W A;  1TT5 B;  2P4W A;  4LD5 A;  2M30 A;  4BHP A;  2ZFW A;  4ETS A;  2AS5 F;  2CWE A;  1IW7 F;  1Z67 A;  4RM2 A;  1IZ1 A;  1IJW C;  4LB6 B;  3TO6 A;  3HOT A;  2P7C B;  2CQQ A;  4LOC A;  4DW6 A;  2HOE A;  3HHH A;  3LQR A;  3QPH A;  3QU3 A;  3CMM A;  4FHT A;  2YS9 A;  3ZR8 X;  2R5Y B;  5JLX A;  2ZXH A;  3WG7 H;  3EUH C;  1RKT A;  2MFZ A;  3BTL A;  5EDN A;  4IZZ A;  1XMK A;  4XM3 A;  2F6C A;  1LFB A;  4KT6 A;  1PP7 U;  3FXU A;  3REO A;  5J1R A;  4I2O A;  1BIB A;  2FBK A;  2ME6 A;  3M9A A;  4IKF A;  4GDF A;  5L3B A;  4EM0 B;  3SFZ A;  1RZ4 A;  1TQM A;  3MVP A;  3FXL A;  5GAE J;  1R5H A;  1TWA J;  1BC7 C;  3MKZ A;  4QWQ A;  4CCM A;  1O3Q A;  4BHB A;  4EMS A;  2K3F A;  3H92 A;  2DFF A;  3RKY A;  3UNG C;  2AQF A;  3ZN1 A;  2IRF G;  3MEX A;  1JUM A;  1V54 H;  3FIS A;  1X3U A;  1ACI A;  1HDD C;  5IOZ A;  2BY3 A;  3CME I;  4Z2Y A;  3BR6 A;  1EF4 A;  4EQQ A;  1TL8 A;  1TNT A;  1K6Y A;  2HNH A;  1Z9C A;  2L9R A;  3RQI A;  1HKQ A;  3GF2 A;  3QWL A;  4XKV A;  4R79 A;  1ORK A;  4E7J A;  3ECO A;  2PX9 A;  3KCC A;  1UZC A;  2K3P A;  3KFW X;  1JXS A;  2LC2 A;  1JJ6 C;  3IRQ A;  3FXR A;  3E6C C;  3NWT A;  2DT7 B;  5FRO A;  5C4J J;  1BI2 A;  3ZGK A;  1I3A A;  2R7O A;  3C2B A;  4OWR B;  2NS0 A;  3ISP A;  1I50 J;  1XTA A;  2M5W A;  1IO2 A;  2PMZ N;  2JQ7 A;  3KP4 A;  3A2K A;  2VL8 A;  4LIV A;  4ABZ A;  4Y33 A;  3V7S A;  1W5T A;  2RDP A;  3LA3 A;  4YIF A;  3S2D J;  3VOE A;  1IV6 A;  4GXO A;  5F1J A;  1H9G A;  5HOO A;  4I6Z A;  1F36 A;  1OCO H;  3U1D A;  4AIH A;  1P92 A;  2DMU A;  2DJI A;  1TC3 C;  5C4X J;  1BW6 A;  2LLK A;  1R6R A;  5L3G A;  4RB3 C;  2BY0 A;  5F0H A;  1EA3 A;  2HPI A;  2PLY A;  3I55 I;  2VOO A;  4C3I J;  5K1Y A;  1RPW A;  3S1R J;  2ICW G;  3U21 A;  3WHB A;  3IWF A;  3FHZ A;  2NVU B;  1LFU P;  4KDP A;  4BJ5 C;  1HKT A;  3A03 A;  1QPM A;  3ML6 A;  2BEO A;  4I0A A;  2KMU A;  4FX4 A;  2XRN A;  3KET A;  3ZMZ A;  2L4A A;  3ZQF A;  3AKZ A;  2R93 J;  2WAD A;  5FKO A;  3VSL A;  1ZLK A;  4MLO A;  4J19 A;  3K4C A;  2R7X A;  3BJA A;  4YFX F;  3E6M A;  1W0T A;  3K69 A;  2JN6 A;  2EPF A;  2HOT A;  5HDG A;  5FJ8 J;  3CO7 C;  2LD5 A;  2M7B A;  2GBY A;  3C2G A;  3J81 K;  1FYM A;  5H20 A;  3NEU A;  3WE2 A;  3JRA A;  3RI4 A;  2XPU A;  2R7R A;  4JBA A;  2KZV A;  3U1K A;  5BNG A;  2ISZ A;  1O3S A;  2WA0 A;  4B3A A;  1FZP B;  2LFB A;  2W4S A;  3QPL A;  4RM3 A;  4LJZ F;  4ASN A;  3GVA A;  1IN7 A;  2E7X A;  4N9H A;  1S29 A;  3R6S A;  3HRM A;  5JI6 A;  1E17 A;  1MIJ A;  1ENH A;  2XAU A;  2XHK A;  1X19 A;  2DA6 A;  2F4I A;  4BEH B;  2VPL A;  3BR1 A;  4G6T B;  3KX2 A;  1MJ9 A;  3WTV C;  1R9T J;  2L4M A;  5IT9 Z;  1RC9 A;  3S8P A;  4PDK A;  3JR9 A;  3I53 A;  1IN5 A;  4DGW B;  4HDV A;  2Z1D A;  3LNQ A;  3BTC A;  5HLG A;  4IPA A;  1XS9 A;  1X2M A;  3ZMT A;  1G2H A;  3FMS A;  2VIX A;  1R5G A;  3TDU C;  2BHY A;  2V7F A;  3FXM A;  2H1K A;  2X6X A;  3DBL B;  2K9N A;  5TIS C;  3SYT A;  2ZJP F;  2QKL B;  2EK5 A;  2KJC A;  4QSH A;  2LG4 A;  2MH2 A;  4RMN A;  1T98 A;  2O5R A;  3OIQ A;  4J01 A;  1UG2 A;  1U2W A;  2VQC A;  2VBW A;  5DEQ A;  4GYI A;  4MFD A;  2GM4 A;  4A3I J;  5E3O A;  3S2H J;  3IAM 2;  3GTJ J;  2IGK A;  4PZJ A;  2GAU A;  2OBP A;  1ERD A;  2HYG D;  1MJA A;  3K2A A;  1FOX A;  4B09 A;  1IN8 A;  3RPQ A;  2ELJ A;  1U9N A;  2WY7 Q;  3T0Y A;  1MMN A;  1YRN B;  3VOD A;  3GFM A;  4XOR A;  1OYI A;  2KZG A;  5HS8 A;  1SVL A;  2ADU A;  3V7C A;  5K5O A;  4OIO F;  2V6C A;  4PSX A;  4G94 A;  3K2Z A;  5M5W J;  1YS7 A;  3PFY A;  3VYS B;  5EG0 A;  1OQY A;  4XKB A;  4OIR F;  3VB2 A;  2W7N A;  1AA7 A;  2AO9 A;  4CA0 A;  2ZSI B;  2WY8 Q;  2E19 A;  2RNJ A;  1SFU A;  1RR8 C;  1HW5 A;  3GZ5 A;  4F93 B;  2QWW A;  3GLX A;  1BOB A;  1DGR M;  5CKT A;  3PQK A;  2LF7 A;  1Y8R B;  1YYV A;  4I09 A;  1P7J A;  1NTC A;  1Y0U A;  2VKV A;  3I71 A;  4EAT A;  5CVI A;  4YFK F;  3G73 A;  3H35 A;  3E6B A;  4AD9 A;  2OD5 A;  4F52 A;  1BI0 A;  1IV8 A;  2A6T A;  2LK2 A;  2KHM A;  4DIQ A;  3R4K A;  5GPC A;  1S7A A;  4M3E A;  2UZK A;  3HOX J;  1MH4 A;  2AHQ A;  4NNJ A;  4U87 A;  2K7L A;  4LFU A;  2HKX A;  1JTX A;  2CU7 A;  2FSW A;  2UXN A;  3ELK A;  3GYH X;  4M73 A;  1VQP I;  2QEN A;  3TP0 A;  3SJM A;  4XIC A;  4DYQ A;  2CQX A;  2LKP A;  4DZP A;  2DAO A;  3ZQI A;  1GDT A;  2M8E A;  2AXT C;  2BV6 A;  3F8F A;  3WGI A;  1J2X A;  5FFZ A;  3OYH A;  4IRI A;  4FX0 A;  4FCY A;  4PJN A;  3TQN A;  3IH4 A;  2FQ4 A;  3GFJ A;  4C9Y A;  1VQL I;  3S16 J;  3LA7 A;  4YRV A;  9ANT A;  4XK4 A;  1IG7 A;  1LDK B;  4MEX F;  1S8N A;  2WC2 A;  2KIU A;  3RQ4 A;  3SZP A;  4IHT A;  4P1W A;  3EPZ A;  2VUM J;  2ID3 A;  4A12 A;  4L9N A;  3M07 A;  4CDG A;  2GA1 A;  5ILV A;  1FY7 A;  3O6B B;  2EA4 A;  1VQM I;  4M6V A;  1SD4 A;  1LNW A;  4E7K A;  2IS2 A;  3C2H A;  4AID A;  3HG9 A;  2HDC A;  2MW8 A;  4A5M A;  1S3J A;  5D5X B;  5JLW A;  3BTJ A;  4M6Y A;  3L2W A;  1KYZ A;  1R1U A;  4YII A;  5D4R A;  1YS6 A;  1QNT A;  2ECB A;  3G2B A;  3HHG A;  3RPU A;  2XDV A;  2GXG A;  4BXF A;  5D5V B;  1FPQ A;  2BHZ A;  2KLO A;  2GXA A;  5LEJ A;  1YW8 A;  4MGR A;  2PJR B;  1JTY A;  5L3C A;  3F23 A;  3CF5 F;  2DOD A;  1XSD A;  3S93 A;  4KIC A;  1BI3 A;  4PJM A;  1SFE A;  4HST A;  2M0C A;  4BU2 A;  3IH2 A;  2OUM A;  5DM7 F;  4HDU A;  2XAG A;  4HYE A;  1HC8 A;  3KP3 A;  2GWR A;  4U7D A;  3KLO A;  3K1N A;  1OR7 A;  3H1C A;  2M4K A;  4NC8 A;  2HXI A;  3S17 J;  1OCP A;  2WAQ A;  3AG2 H;  4IQ4 A;  3NAU A;  1QU3 A;  2DPU A;  1ETW A;  1DGW Y;  4D0P A;  3J7A Y;  3S1Q J;  4ENM A;  2CGP A;  1U5T C;  2IS6 A;  1OYY A;  3KIO A;  4RB1 A;  4RLF A;  3CF2 A;  4AIK A;  2VKD A;  2A5W A;  3FK6 A;  2M8G X;  1XD7 A;  2W00 A;  4X6A J;  3ZCO A;  3J80 Z;  3GTQ J;  2EFO A;  2MLK A;  3E7L A;  2E35 A;  1Q1H A;  2R7V A;  5E1W A;  3N4M A;  1U3E M;  1UFM A;  3I5U A;  3G3Z A;  4EVI A;  3JRF A;  1VTN C;  1T39 A;  1K78 A;  2PG4 A;  1ITY A;  2X1E A;  4OMY A;  1LJ9 A;  5FKN A;  5IPA A;  3V7R A;  3OYB A;  1AKH B;  5E20 A;  3I4P A;  1MDM A;  2L54 A;  2B7E A;  3FM3 A;  4QTR A;  4KIT B;  4ENJ A;  2HYF A;  4F55 A;  5DV5 A;  1FT9 A;  4BQQ A;  3QRF F;  2LY2 A;  2DA1 A;  1K7A A;  4XON A;  3EUA A;  1BI1 A;  3IHU A;  4XN3 A;  5DDG A;  3I3L A;  5IYD J;  2VKE A;  2DFH A;  3L2Q A;  2R7S A;  5LBQ A;  3OYC A;  4UV9 A;  1YJN I;  2KRF A;  2HDW A;  1SC7 A;  1MGT A;  2V26 A;  2IW5 A;  2DXI A;  1I6X A;  1JT6 A;  1M1E B;  1HF0 A;  4NDL A;  4OMZ A;  4L9T A;  2P5L C;  3BJO A;  4LIU A;  5F64 A;  2NRA C;  1TLH B;  2W1O A;  3S3M A;  2EIM H;  1B9M A;  4V2F A;  4E7Z A;  2MGQ A;  2CFX A;  2NYX A;  2JK3 A;  2XPW A;  3JRE A;  2QA4 I;  3TO7 A;  2E71 A;  1VQ7 I;  2R7T A;  3PNV A;  2RGV A;  4ZDL A;  1GV2 A;  4BGD A;  2L7K A;  3LSR A;  2W85 A;  3OS0 A;  5KHD A;  3CMY A;  2LY1 A;  4DYR A;  1QVT A;  3JAM K;  2VBX A;  2OQG A;  1D3Y A;  2DFI A;  4XQF A;  3FZV A;  1A6Q A;  4TV7 A;  5D6E A;  2LBF B;  2OPT A;  4L5E A;  4ZZL A;  2MD5 A;  2X0L A;  3VPR A;  4OIQ F;  4CCN A;  4D9J A;  2RVC A;  1K78 B;  1E0E A;  2OCE A;  3BG3 A;  5KAF C;  3CCV I;  3H5N A;  2VJ4 A;  1Y56 A;  4BXX J;  3R61 A;  2ZME C;  2L9N A;  2IGM A;  3P5J A;  3SFI A;  5BPI A;  2EA2 A;  3J7Y J;  2WBM A;  1PJR A;  2A61 A;  3V8K A;  1TQI A;  1TQP A;  1H8A C;  2HOA A;  3OIO A;  3LSK A;  1TNS A;  2Y2Z A;  1OLT A;  3PM1 A;  5GTI C;  1OYW A;  4QPO A;  2M4G A;  1YX3 A;  4YFN F;  2DU9 A;  2E36 A;  4HNT A;  2HQ5 A;  4M9X A;  2H6C A;  1B72 B;  2VN2 A;  2HGC A;  3KP7 A;  2ME0 A;  1BC8 C;  1QZY A;  1Z3Y A;  3LST A;  2NVY J;  3DWL E;  4HW0 A;  2P81 A;  2IPQ X;  3PFI A;  3HBL A;  2DT5 A;  4NHJ A;  1UG0 A;  2DOA A;  1S9H A;  4AVZ A;  4FQG A;  4YG2 F;  3D5L A;  5IYB J;  1ZEL A;  1NG6 A;  1WHU A;  2HDD A;  3MWM A;  3CES A;  2NNN A;  3TW6 A;  3K4L A;  2L9V A;  1S5L C;  3UR3 C;  3A0H C;  3FBI B;  1RIO H;  5FRN A;  1GVD A;  2QSG X;  1HA8 A;  3CD6 I;  1P4A A;  3HTS B;  1T8I A;  3CCR I;  4M6X A;  3WTT C;  3S3N A;  3F3X A;  2JSP A;  3GWZ A;  1XSX A;  1MZB A;  2FBI A;  4HNU A;  2EFW A;  1KQ0 A;  4I7H A;  1BL0 A;  3WU1 B;  3D5S C;  2XF7 A;  4MO7 A;  4JX4 A;  2EZK A;  5IT3 A;  4BHC A;  2DI3 A;  2ZXJ A;  4WXC A;  3OYF A;  4G7Z F;  2CUF A;  4AU7 A;  1TW2 A;  2NVQ J;  3FXJ A;  2M0M A;  1T0F C;  3MZ8 A;  2Y0S A;  3S1M J;  2DTR A;  2JMW A;  4O5V A;  3UKG A;  2Q0O A;  2O8X A;  2IA2 A;  1XDU A;  5HOD A;  5L3E A;  2PFB A;  5D4S A;  2PMZ A;  4XSZ F;  2F5D A;  1ZAO A;  1HXD A;  2V9V A;  1HW2 A;  1OCT C;  5GAD J;  2F5F A;  3G6E I;  4IHS A;  5IP6 A;  2VXD A;  3G1O A;  1OCC H;  2EIJ H;  3KPH A;  3OWT A;  4AIJ A;  5DTD A;  2KKO A;  1ZRF A;  1N25 A;  2KP6 A;  5EEA A;  2DMQ A;  4GCV A;  4ZYH A;  4G9Y A;  2QUF A;  3BG6 A;  2XRL A;  1CF7 B;  5DCM A;  3OYL A;  5D8L B;  3CJQ B;  4XLP F;  2PEX A;  4DZJ A;  1BJA A;  4XLC A;  5K7F A;  2E34 A;  2OAZ A;  1IGN A;  2FA5 A;  1H89 C;  3QYB A;  1UMQ A;  4LMY A;  1X4O A;  2XGD A;  3RCO A;  2JVH A;  3SEQ A;  3SXY A;  4NBQ A;  1R1T A;  1FP2 A;  3EUH A;  4ZTJ A;  3GCM A;  5DCF A;  4CCJ A;  3L1P A;  1TWF J;  4LG0 A;  5L3F A;  5IP7 J;  1JGS A;  2FX0 A;  2JUC A;  2X1C A;  5ILS A;  1PUF A;  4F7Z A;  2ZB9 A;  5FO5 A;  1QA6 A;  2JVG A;  5IYC J;  1O57 A;  1LB2 A;  4U0W A;  1YIO A;  3RIR A;  4HBL A;  2LP0 A;  2V9K A;  2BY2 A;  2ZBK A;  2OV7 A;  3ZQL A;  1T33 A;  2V6E A;  3E5U A;  2PQ8 A;  2W84 A;  4JX6 A;  2IA0 A;  2DCE A;  5AIQ A;  5GPA A;  4X0G A;  1XCB A;  2ZKZ A;  2HPM A;  2HTS A;  3GME A;  3K4B A;  4A3D J;  1VF9 A;  3CLQ A;  5F0F A;  5IP9 J;  3B73 A;  3DCF A;  2DA4 A;  1MSE C;  1I1S A;  3IUO A;  1PUF B;  2TCT A;  2W57 A;  4AYB A;  1AHD P;  4HOB A;  2C6Y A;  4UB8 C;  4RGX A;  1QQI A;  5BMZ A;  1Z0X A;  3IC7 A;  3M8F A;  5F27 A;  2RQQ A;  1LE8 A;  1AWC A;  4Y15 A;  2MH9 A;  3BZC A;  4HRI A;  4XMY A;  1FOK A;  2DQL A;  3FX3 A;  1I1G A;  3KEQ A;  1JKR C;  4XL9 A;  3PO2 J;  4HPQ A;  3JSP A;  3ASN H;  2PMH A;  3F6O A;  2CRG A;  2KFD A;  4P55 A;  1VQ8 I;  5FLX K;  5CVJ A;  1B1B A;  1V3F A;  3CUQ B;  2KJB A;  2BZT A;  3F8C A;  3AL0 C;  1IXR C;  1N75 A;  2A05 A;  2RC4 A;  5ICC A;  1P2F A;  1U5T A;  3GFL A;  4FE4 A;  3CP8 A;  4Q4Z F;  2JA5 J;  4HX8 A;  3ZP5 A;  4ESF A;  4HSR A;  1IRZ A;  2KIQ A;  4A5N A;  1SAX A;  4CO8 A;  3CUQ C;  1OKR A;  4I02 A;  3A4C A;  3FK7 A;  1F4K A;  5FGM A;  2WAF A;  1KQ9 A;  3IH3 A;  3LAJ A;  1TP4 A;  3CCU I;  2EFQ A;  1ON1 A;  3ABM H;  1I27 A;  4KT5 C;  1ZHF A;  3GTL J;  1FMV A;  4NC7 A;  4RLQ A;  1MMG A;  4B43 A;  3L2R A;  1XSV A;  1W5C C;  2CQN A;  2BGC A;  3GTK J;  1QZE A;  3EUK L;  4B47 A;  4U7B A;  1ETX A;  4RBO A;  4LLN A;  1FOW A;  3EET A;  4XLN F;  3GTP J;  1VZ0 A;  1QHH D;  4PFP A;  2DOE A;  4B44 A;  3PNY A;  4S0H B;  3G1M A;  3OYJ A;  4A0Z A;  4Z6Y A;  5GTH C;  4C3H J;  2IVM A;  2DQR A;  4MTD A;  2CUE A;  4BJ6 C;  3CJR B;  5M3F J;  4HAM A;  3DFG A;  4A6D A;  2BYV E;  3V42 A;  4LK1 F;  1IAW A;  5ICE A;  1Y1W J;  4A3C J;  4KIB A;  4RAF A;  3LQQ A;  4G6Q A;  1QBJ A;  3COA C;  5EEH A;  3EYY A;  3P9K A;  3JW4 A;  3HPH A;  4JK1 X;  1MBF A;  3FDY A;  2X6O A;  3FKI J;  2X85 A;  2FML A;  2HFH A;  2Z16 A;  1OIS A;  1VQ4 I;  5F04 A;  2FUG 2;  4PGH A;  4WF2 A;  2NOG A;  3L00 A;  2BE5 F;  4RGS A;  3V4G A;  1Y1V J;  1TBX A;  3RKW A;  5K5Q A;  3K9T A;  4L0Z B;  1UHW A;  1K83 J;  1R22 A;  2A3S A;  2ETH A;  2GQQ A;  2L0K A;  3JTG A;  1VQ5 I;  3OYI A;  1Y6I A;  3LFU A;  1E3O C;  4XR6 A;  2YU3 A;  3I59 A;  1WJF A;  2ACJ A;  4ON0 A;  5AIP A;  2VE9 A;  3QOP A;  1QPI A;  5K7H A;  3DU6 A;  2R92 J;  1GV5 A;  1WCM J;  3HYI A;  1HLV A;  4LG3 A;  2HQN A;  4WXH A;  3I58 A;  3RZO J;  5HS7 A;  2K27 A;  3GXO A;  3DBR B;  3ABT A;  3VFZ A;  4WWC A;  4LK0 F;  3WE3 A;  2HVQ A;  2QQA A;  2VQH A;  3GBG A;  5FKM A;  3JRD A;  3OY9 A;  1RI7 A;  2BBY A;  4C2U A;  1G3S A;  4D5C A;  2F5V A;  2K86 A;  1IDY A;  4OAY A;  3A02 A;  2QSH X;  1ZRD A;  3ABU A;  4RDU A;  2NS7 A;  1Z6R A;  1LVK A;  3HPG A;  4AYB N;  2VLA A;  3BZ6 A;  4RAY A;  2H8W A;  1SVM A;  2XSD C;  3CC4 I;  5HDN A;  2FOK A;  2KIM A;  2MC3 A;  5J47 A;  1APL C;  1CF7 A;  2K4B A;  1EKE A;  1FX7 A;  4MEY F;  4ESB A;  2F5E A;  1F43 A;  2PMU A;  4UV8 A;  3DXJ F;  4EJO A;  1P7I A;  1GUU A;  2O0Y A;  1MNE A;  2JT1 A;  3BJ6 A;  4EJW A;  1GT0 C;  3SQN A;  3L09 A;  2GZW A;  3NWS A;  1UST A;  1IC8 A;  3QP6 A;  1ZQ3 P;  3WTW C;  3J7A O;  3RYR A;  2V1N A;  2ZME B;  2LH9 A;  5DUI A;  1T38 A;  5KNL A;  1TWH J;  3H9Q A;  4G12 A;  3J81 Z;  3W2V A;  3HL2 A;  2EIN H;  4HV5 A;  4PK4 A;  5CQG A;  2IAI A;  3I59 B;  3BQZ A;  2IBD A;  2N8G A;  1F1Z A;  1U0J A;  3O8H A;  3Q3S A;  2RV8 A;  1YI2 I;  2O61 A;  4M9S A;  4UB6 C;  2XF5 A;  2BOL A;  1MMD A;  4U0Y A;  2GA2 A;  2TDX A;  3PNT A;  2VQG A;  2KDO A;  3F72 A;  1XB4 A;  3SHF A;  2D5V A;  3CDH A;  1MND A;  3QAH A;  4JX5 A;  1X3Z B;  4LGW A;  1YE9 A;  2DLL A;  2WWY A;  2ID6 A;  3R0A A;  5C3E J;  3H36 A;  4XOT A;  5CJ9 A;  2K9M A;  1OR7 C;  3DKW A;  1K61 A;  2G9W A;  5H2F C;  3WU2 C;  2DO7 A;  2CV1 A;  5J8F A;  3OOP A;  3JAM Z;  3S15 J;  3BR5 A;  3HUG A;  2KQR A;  5LEK A;  5E17 F;  1ZTR A;  4D1Q A;  1ZH5 A;  2GIZ A;  5F6F A;  2VAS A;  1OCR H;  3HEF A;  1NH3 A;  1AOY A;  5ERI A;  4P5O A;  4II2 A;  2MYS A;  4NQW A;  3ZPL A;  2E7W A;  4KMU X;  1VQ6 I;  3RTR A;  1LEB A;  5E1Z B;  3JTH A;  2OA4 A;  5A2Q Z;  1LDJ A;  5C44 J;  2L7M P;  3CQZ J;  4A3K J;  4BQA A;  1LVA A;  2UUZ A;  3ECH A;  4XKW A;  1A36 A;  2JUG A;  2EV5 A;  2MA3 A;  3LMM A;  4FT8 A;  2VC1 A;  3HSF A;  3H3U A;  3CLO A;  4KJZ A;  3K1M A;  1RKW A;  5LRS A;  3HOW J;  1IDZ A;  1WH5 A;  1BBY A;  2K4J A;  3ZMU A;  1XN7 A;  1U5T B;  1XMX A;  3PSF A;  4NC6 A;  5KAI C;  4AUX A;  2QSF X;  3HUG B;  2DPD A;  2QYO A;  2V4J C;  4IOA F;  4M9Z A;  4EGY A;  1MDM B;  1RUO A;  2PJP A;  3HOS A;  3F8B A;  4E7S A;  4A69 C;  2GLO A;  2W25 A;  2DT6 A;  4MFE A;  5DYM A;  4CYD A;  2H1L A;  1L3L A;  2OZ6 A;  1Z21 A;  2LR8 A;  1YRN A;  2JA8 J;  1U6G A;  1PVE A;  1DU0 A;  2AXL A;  2XAJ A;  3RDI A;  2XGX A;  4WCG A;  1K4T A;  3K10 A;  2HR3 A;  4HQE A;  1T08 B;  1TWG J;  4B8X A;  3WU0 A;  4HX4 A;  1MSF C;  1SD6 A;  2DA5 A;  1XMA A;  2Q2E B;  3ERE D;  3OYD A;  1HKS A;  1MH3 A;  1MBK A;  4R8H A;  4IVN A;  5TJJ A;  4KYW A;  2ZJ2 A;  1SFX A;  1O3T A;  2Y30 A;  4FTH A;  4RA2 A;  3I4N J;  2EV6 A;  3BG9 A;  5EZH A;  3H3V K;  4KUM A;  4CGZ A;  1S7E A;  3MKL A;  4PJJ A;  5JHU A;  2RKH A;  1POG A;  2EB7 A;  3VYR B;  1I3Q J;  2A6H F;  1DU6 A;  4IF4 A;  2VBY A;  2H09 A;  4ZTF A;  2XAQ A;  1SAN A;  1K6O A;  1X1D A;  4A0Y A;  2EWN A;  2MAB A;  1VI0 A;  3PUF A;  4M3D A;  5E18 F;  2NS8 A;  4KIS A;  1TWC J;  4XLA A;  2HWV A;  2YX7 A;  4I76 A;  5D5W B;  3MCZ A;  1IN6 A;  5E3N A;  4BBS J;  1MBH A;  1ZLJ A;  2Y31 A;  3AFH A;  2Y48 A;  1BIA A;  2P7V B;  4I0B A;  1X58 A;  1ZG3 A;  1XC5 A;  2KT0 A;  5JFR A;  3K70 D;  1FSH A;  4ZYA A;  2X1D A;  1WGX A;  2CQK A;  3PSI A;  3RJP A;  2NVT J;  4MNU A;  2L7Z A;  3WHC A;  5KVR A;  1JE8 A;  4N4O B;  2FXA A;  2IS4 A;  3CCY A;  1OCZ H;  3DEU A;  1MBG A;  4JQF A;  2M87 A;  4NUB A;  3HRS A;  3VSK A;  4BBR J;  4IHY A;  5B3S H;  1YIJ I;  3HDD A;  1FOY A;  2IS1 A;  2W48 A;  2YSR A;  3OR2 C;  1U78 A;  2O8K A;  2Z9O A;  2CV0 A;  3FF5 A;  1FIA A;  1R71 A;  1LUJ B;  1ZGA A;  4KN7 X;  2QBY A;  4G7O F;  1X1B A;  3S2W A;  4XLE A;  4XNF A;  4L0Y B;  4BY7 J;  4DJA A;  2VOP A;  1VQN I;  2Z33 A;  2VC0 A;  3E1S A;  2B9S A;  2O9L A;  2XB5 A;  2IP2 A;  4MHG A;  3CUQ A;  4JP0 A;  4IOC F;  1MMS A;  5H6R A; 
#chains in the Genus database with same CATH homology
 3D5L A;  2KRH A;  1K6Y A;  1ZEL A;  1NG6 A;  1BR1 A;  2HNH A;  4CZC A;  4XKV A;  3W2W A;  4R79 A;  3CES A;  4E7J A;  1LKX A;  3OL4 A;  4FET A;  2K3P A;  3K4L A;  5LFA A;  4CSW A;  2LC2 A;  3UR3 C;  3FBI B;  1SFK A;  3DPT A;  5FRN A;  1HA8 A;  3NWT A;  2DT7 B;  5FRO A;  3ZGK A;  3S3N A;  2R7O A;  2JSP A;  4OWR B;  3PL8 A;  4HNU A;  3A2K A;  2XSJ C;  2VL8 A;  4LIV A;  4Y33 A;  3D5S C;  3OS1 A;  3MKW B;  2XF7 A;  4BL0 B;  2JA2 A;  2R7U A;  1BR2 A;  5HOO A;  3OYF A;  2M3A A;  4E4H A;  4AU7 A;  3OS2 A;  2DJI A;  4C30 A;  3IP4 B;  2M0M A;  1T0F C;  1R6R A;  2Y0S A;  1EA3 A;  2HPI A;  3CZ6 A;  3I9V 2;  3U21 A;  3K4M A;  3KYL A;  4BE1 A;  4YEL A;  1WJE A;  2PMZ A;  4IX7 A;  4BJ5 C;  4BDZ A;  2HQA A;  1LFP A;  3W3C A;  1YX5 A;  1BR4 A;  2VXD A;  2HVS A;  3DTK A;  1G59 A;  2XC7 A;  2KMU A;  2KPM A;  3OWT A;  2L2O A;  3PJR A;  2KP6 A;  3BG7 A;  3AKZ A;  3BG6 A;  2VJI A;  5TGT A;  3OYL A;  2WAD A;  3M8J A;  4ITV A;  3CJQ B;  5KCM A;  3H5R A;  3VSL A;  4MLO A;  3LSH A;  3K4C A;  1QHG A;  3BCA A;  4XLC A;  3OMY A;  2CV2 A;  2R7X A;  1UEL B;  2VQL A;  2LRD A;  3RPU D;  3QYB A;  1DQU A;  4PUS A;  1X4O A;  1MW7 A;  3RCO A;  3K4J A;  2JVH A;  3SEQ A;  3QYF A;  2E1M B;  3H9G A;  2M7B A;  3C2G A;  4BJT A;  4CCO A;  4ZTJ A;  4CCJ A;  2R7R A;  2X1C A;  2HU9 A;  2KZV A;  2HZD A;  2LYC A;  2W82 A;  2JVG A;  3L2V A;  3K6G A;  3H0D A;  5HLT A;  2WA0 A;  3OL3 A;  2V9K A;  1FMW A;  2W4S A;  2OV7 A;  4RM3 A;  4YEJ A;  2V6E A;  2MC4 A;  5LD2 C;  3OYN A;  3FHN A;  2DCE A;  4XKC A;  4X0G A;  2XAU A;  1X19 A;  2F4I A;  3OOU A;  5CQE A;  4BEH B;  4G6T B;  2HPM A;  3KX2 A;  3K4B A;  2VPL A;  2KRC A;  4BQN A;  4PSW A;  5FRM A;  3S8P A;  1WJB A;  3IUO A;  4AYB A;  1GLN A;  4DGW B;  2Z1D A;  4ZJZ A;  2X51 A;  3DLA A;  5HVQ C;  4CUG A;  2RQQ A;  4BDY A;  2E1M C;  2VIX A;  4HRI A;  2E60 A;  4XMY A;  2NOJ B;  2Q1Z B;  3FBN B;  2V7F A;  2IXS A;  4XL9 A;  4HPQ A;  2X6X A;  4E7I A;  3SYT A;  2QKL B;  3DKX A;  2LG4 A;  2IGN A;  1G8X A;  4RMN A;  2O5R A;  2R7Q A;  3OIQ A;  1N75 A;  4J01 A;  3AL0 C;  2MD0 A;  2VQC A;  1T95 A;  3CP8 A;  2R4G A;  1W36 D;  3HXL A;  2Z2S B;  2VJ5 A;  4HSR A;  4CCK A;  3OYG A;  3IAM 2;  1N77 A;  2IGK A;  3A4C A;  2L5Q A;  2ZSH B;  2WAF A;  3K4N A;  2HVR A;  3DTE A;  4BUP A;  1ERD A;  2GOM A;  4ZC3 A;  3H9J A;  3HC7 A;  1FMV A;  2ELJ A;  3OIP A;  4NC7 A;  4RLQ A;  1MMG A;  4B43 A;  5HNF A;  2WY7 Q;  3L2R A;  1MMN A;  4XOR A;  2CUJ A;  3EUK L;  4B47 A;  4U7B A;  1P9Q C;  1JI8 A;  1VZ0 A;  1QHH D;  3MD2 A;  4PFP A;  4PSX A;  4B44 A;  3PNY A;  3OYJ A;  3PFY A;  3VYS B;  2W7N A;  4XKB A;  2I8D A;  3M1C A;  1KON A;  3L2U A;  4XN0 A;  1AA7 A;  4BJ6 C;  3CJR B;  2BVL A;  3V42 A;  4CA0 A;  2L9S A;  4H4K C;  4HG2 A;  2ZSI B;  2WY8 Q;  4B3X A;  3K4K A;  4F93 B;  4BEH A;  2UWM A;  2VB6 A;  3A1Y A;  1BOB A;  1DGR M;  3HPH A;  5CKT A;  3FDY A;  3OYE A;  2K9L A;  4CCL A;  2XF6 A;  2X85 A;  2Z16 A;  3QOD A;  3RSN A;  4EAT A;  1N78 A;  2FUG 2;  4E6K G;  3H35 A;  1D0Y A;  4F52 A;  2A6T A;  2KHM A;  1TT0 A;  4DIQ A;  3VYU B;  3OYI A;  2WAE A;  1NG7 A;  3LFU A;  1Y6I A;  1D1A A;  3FKJ A;  4XR6 A;  1WJF A;  4BQO A;  4II3 A;  2BVM A;  4JOM A;  3DPL C;  3KEY A;  2VJJ A;  1D1C A;  1W36 C;  4NNJ A;  3DU6 A;  4U87 A;  3OYM A;  3VYT B;  2E5Z A;  4LG3 A;  3K70 C;  5HNH A;  3LL7 A;  2WB1 A;  2HVQ A;  2VQH A;  4C2T A;  3GBG A;  4DBQ A;  2CS3 A;  4PJL A;  3OY9 A;  4C2U A;  3HKZ A;  2F5V A;  2K5C A;  2IGO A;  4OAY A;  3TMO A;  1WJA A;  2ZFU A;  1D0X A;  3DQV C;  1LVK A;  3HPG A;  3OYH A;  2P0W A;  2VLA A;  4PJN A;  4C9Y A;  2RNG A;  3SEZ A;  4YRV A;  4IQJ A;  1LDK B;  3RQ4 A;  2BW3 B;  2AQE A;  4P1W A;  3EPZ A;  4J00 A;  2GOX B;  3DTI A;  2OC6 A;  1MNE A;  1J09 A;  3NWS A;  1X1A A;  3TBI A;  4E7K A;  2CH0 A;  3IAS 2;  2IS2 A;  3C2H A;  2V1N A;  2LH9 A;  3HG9 A;  5KNL A;  2RRE A;  3H9Q A;  3OYK A;  4FAS D;  3W2V A;  3HL2 A;  2BW3 A;  3L2W A;  1D1B A;  4PK4 A;  5CQG A;  2X6W A;  3G2B A;  1U0J A;  3VDX A;  3SDB A;  2XDV A;  3BLY A;  4BXF A;  3ONQ A;  1IRX A;  3TL4 X;  3DU5 A;  2XF5 A;  2BOL A;  4XLF A;  5CPR B;  3CP2 A;  1MMD A;  2KLO A;  3W2A A;  3PNT A;  2VQG A;  3OYA A;  2PJR B;  2KDO A;  4BE0 A;  3PUB A;  1MMA A;  3ZRG A;  1MND A;  1YE9 A;  3DEE A;  4DBR A;  3S93 A;  4ZDO A;  4PJM A;  4HST A;  4PFO A;  3BC8 A;  3AL0 B;  1V5E A;  1Z3X A;  3OR1 C;  3QOE A;  4XOT A;  2LOO A;  4BU2 A;  2K9M A;  1OR7 C;  2OUM A;  1UAA A;  3S32 A;  2CV1 A;  2PJR A;  2KQR A;  2UV1 A;  2M4K A;  4NC8 A;  4D1Q A;  4Y4R A;  3LSI A;  2VAS A;  3F9K A;  3LSG A;  4GRI A;  5JHF A;  2WAQ A;  4IQ4 A;  1V5F A;  4P5O A;  4II2 A;  1QU3 A;  3J7A Y;  1DGW Y;  2MYS A;  1WJC A;  2IS6 A;  1WFX A;  3RTR A;  4RLF A;  4HEA 2;  3CF2 A;  2VKH A;  2VKD A;  2A5W A;  1TZL A;  2CUZ A;  2W00 A;  3ZCO A;  2UUZ A;  4XKW A;  2JUG A;  1Z7L A;  4F91 B;  3MKY B;  1X4P A;  3N05 A;  4N4N B;  3LMM A;  1D0Z A;  4KJZ A;  1DP3 A;  3VWB A;  2X1E A;  4DOZ A;  4F3Q A;  3QYE A;  2CW7 A;  4ZDP A;  3PSF A;  3OYB A;  4OAZ A;  3HUG B;  2V4J C;  4CH7 A;  4KIT B;  2X6Y A;  4F55 A;  3S3O A;  3HOS A;  4E7S A;  4BQQ A;  4Y3O A;  2LY2 A;  2DT6 A;  2LBF A;  2R7V A;  4XON A;  1Z21 A;  3EUA A;  4XN3 A;  4E7H A;  2CFO A;  3E0J B;  3I3L A;  3K10 A;  3DPU A;  3L2Q A;  2R7S A;  3D5R C;  3OYC A;  2Q2E B;  3OYD A;  3ZQQ A;  2VXZ A;  2HDW A;  4LIT A;  2V26 A;  2DXI A;  4ANJ A;  4BE2 A;  4BAC A;  4LIU A;  4NQW B;  3H5A A;  3MMY B;  4XOP A;  2W1O A;  3S3M A;  2KL4 A;  4PJJ A;  2CMP A;  3VYR B;  4E7Z A;  4ZTF A;  1X1D A;  3LSM A;  2R7T A;  3PNV A;  3DKY A;  2MAB A;  1SAU A;  4ZDL A;  4XLH A;  4BGD A;  4KIS A;  4XLA A;  2L7K A;  1WJD A;  2LRE A;  3ZXS A;  1PYV A;  3OS0 A;  2R7W A;  5KHD A;  2LY1 A;  3AFH A;  4RM2 A;  4XQF A;  3HOT A;  3K70 D;  4ZYA A;  4QPQ A;  2X1D A;  2LBF B;  3PSI A;  3CMM A;  4CCN A;  4D9J A;  3ZR8 X;  1E0E A;  2ZXH A;  3EUH C;  2VJ4 A;  2CW8 A;  1Y56 A;  3H5N A;  2MFZ A;  4N4O B;  2M7A A;  4E7L A;  4IZZ A;  1V5G A;  2IS4 A;  4XM3 A;  2QKM B;  2F6C A;  2IGM A;  2L9N A;  3BCB A;  4JQF A;  4KT6 A;  2WBM A;  1PJR A;  4NUB A;  3VSK A;  2IS1 A;  2E5N A;  4IKF A;  3OR2 C;  3LSK A;  1OLT A;  4QPO A;  2CV0 A;  2M4G A;  1YX3 A;  4BS9 A;  3MKZ A;  4F92 B;  4HNT A;  1X1C A;  4CCM A;  1X1B A;  1WJ5 A;  4XLE A;  3UNG C;  4XNF A;  2AQF A;  4DJA A;  2ZXI A;  1Z3Y A;  3SZG A;  3E1S A;  3DWL E;  1UG0 A;  2DOA A;  4B48 A;  1S9H A;  4AVZ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...