2KHMA

Structure of the c-terminal non-repetitive domain of the spider dragline silk protein adf-3
Total Genus 38
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
38
sequence length
140
structure length
140
Chain Sequence
MASMTGGQQMGRGSMGAASAAVSVGGYGPQSSSAPVASAAASRLSSPAASSRVSSAVSSLVSSGPTNQAALSNTISSVVSQVSASNPGLSGCDVLVQALLEVVSALVSILGSSSIGQINYGASAQYTQMVGQSVAQALAG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Structural protein
molecule keywords Fibroin-3
publication title A conserved spider silk domain acts as a molecular switch that controls fibre assembly
pubmed doi rcsb
source organism Araneus diadematus
total genus 38
structure length 140
sequence length 140
chains with identical sequence B
ec nomenclature
pdb deposition date 2009-04-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF11260 Spidroin_MaSp Major ampullate spidroin 1 and 2
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.1350 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Arc Repressor Mutant, subunit A 2khmA01
2MABA 2MFZA 2M0MA 2K3PA 2KHMA
chains in the Genus database with same CATH superfamily
1Z91A 1WHUA 3HRMA 1JTXA 3SEQA 1T33A 3TW7A 2FMLA 3HRUA 4QSHA 3F6OA 2K9QA 3G1OA 3I71A 2IS1A 3ZGKA 4HOBA 2O5RA 2XF6A 4B8XA 4P1WA 4G94A 2HOAA 3GFJA 1H89C 4JX4A 2KIMA 2ZXIA 4HLYA 4KDPA 1S6LA 4A3JJ 1ZH5A 2E19A 3K1MA 2QKLB 3WTTC 4QWQA 2O6GE 3L2WA 4HG2A 4L9JA 1WJBA 2OTLI 3K0LA 4BY7J 1W1WE 4G7HF 4IHSA 4C9YA 1I1GA 4BJTA 5C4XJ 4E7HA 3CJQB 1YLFA 4LLNA 1O3TA 1X3ZB 4UUVA 3QODA 2IGOA 1SFUA 1I5ZA 5BOXA 3NAUA 4AUXA 4G7OF 1FTTA 1A35A 2PI0A 1JKPC 2QBYA 1B4AA 2CQKA 4NQWA 5K7ZA 3ZR8X 3T1BA 4IL6C 2R4GA 2L2OA 5JVGF 1JTYA 2EIJH 4IHXA 1V5GA 1TNTA 3UR3C 4M6YA 1SC7A 4PJ0C 4PSXA 1Y56A 2EFWA 2R5ZB 2M34A 1BL0A 3L09A 4BQOA 3OOUA 3S2HJ 1HOMA 4ITVA 1R00A 1MBJA 4G6TB 5L3EA 3KP4A 1U5TC 1BI0A 4RAZA 1YIOA 2RNGA 2F48A 3O3KA 2OUMA 2I8DA 5LRRA 1BW6A 3QYEA 1D0XA 2IW5A 2EZKA 1BI3A 3ZOBA 2L5QA 3G6EI 4A5MA 1ZR4A 1W7PA 3TBIA 1LB2A 2OCEA 5J8FA 1R58A 1VTNC 2X1DA 3FDYA 3FKJA 2UWMA 4MLOA 3PIPF 3GYHX 1ZG1A 2M2EA 2QUFA 4YRVA 1UFMA 2M1BA 2MC3A 3HYIA 2V1UA 5IOZA 2L9VA 1FP2A 3WTSC 3PUBA 1IUFA 4EJUA 2A5YB 1B72B 1IRXA 3B6CA 2VE9A 4OIQF 4OIOF 1TBXA 3K4NA 3OIQA 1V3FA 4XRMA 3K2ZA 2CS3A 3C3WA 4RBOA 2P6SA 3LOCA 3VWBA 2KRHA 1HXDA 1HC8A 3LMMA 2YR2A 4A5NA 4KICA 2JSPA 4JYKA 5JHUA 2V4JC 2R93J 3CMEI 2WAFA 3E1SA 3FBIB 2Y31A 1IXCA 3G1LA 1E0EA 4L9TA 3HRSA 3GUDA 4EMSA 5EF6A 3PSFA 5H20A 1SMTA 1D1CA 2HYGD 2TCTA 4XLCA 1YW8A 4F55A 3DLLF 5IP7J 4I99C 3FXJA 3QP6A 4A3GJ 2WC2A 4RGUA 3FMRA 1LEBA 2UUZA 3U9GA 3QAHA 3S8PA 2EA4A 4DOZA 1ZGWA 4KYWA 2VXZA 2GAUA 1YW7A 3Q0UA 3AG2H 2E1MB 4OWRB 3GZ6A 2R3SA 2LTPA 4A3KJ 1XSXA 1VQLI 2M3AA 1DUXC 1VQ7I 1YJ9I 2E36A 1I6XA 2X85A 2JUGA 5TGTA 1VQPI 1ETVA 3CCMI 3KZZA 2P5LC 3DU6A 1TTYA 3IWFA 4KN4X 1F5TA 1LDDA 2KJBA 4I09A 5BS6A 1HW2A 4ZYEA 1U0JA 1IRGA 4E7JA 2ZXHA 5LLQA 2JVGA 1HKSA 3GFLA 2L9NA 4HBLA 4BGDA 3LSRA 4U7DA 4B3XA 3SXYA 4D5CA 2P0WA 3W6VA 3WTUC 2Z16A 4KIFA 1E3HA 5EG0A 4II2A 1HSJA 2VQLA 1WFXA 2VL8A 1BI1A 2ZNZA 2UXXA 1AKHB 3QPSA 2O0YA 3ZQQA 2RNJA 2RVCA 3BQZA 3BR5A 2COBA 1ZG5A 3MAJA 2H1KA 4MO7A 1F43A 2PQ8A 4MQVA 4BXFA 2QSGX 3LSHA 3CC7I 2W84A 2QQAA 1VQKI 2E2IJ 4A93J 3H5AA 2E2HJ 1R5GA 2OC6A 1X1BA 5E1WA 2ZMEB 4I0BA 1FX7A 4WCGA 1MMAA 1J59A 2HVQA 2VJ4A 3F9KA 2LOOA 4HF1A 3V42A 4E7IA 1S5LC 4XIDA 2PFBA 2V1XA 3TO6A 1BBYA 1MGTA 2KHMA 3KEYA 4LK0F 5BPDA 2L01A 2B9SA 2DT7B 1TC3C 5HNFA 3TDUC 3CF5F 2WADA 3K4JA 2XGXA 3SFZA 5DCMB 2R7SA 2VBZA 1Y1WJ 2Y48A 3BCBA 1LFPA 2VASA 1VQMI 3CCLI 2Y9YA 1TQMA 1B9MA 3HC7A 3DWLE 3V8KA 1Z3YA 3BTCA 1XG1A 5IYDJ 1IRFA 3ELKA 4LGWA 4ZC3A 3U21A 5J4VA 2V6EA 3KE2A 4RAFA 1XX5A 2VB6A 1B8IA 5HNHA 2A6HF 1A6IA 1RPWA 2FRHA 3HSFA 1YO5C 2CV0A 2XB5A 4EJWA 3CDIA 5E8IA 4M3FA 1XSVA 2YPRA 4LLLA 1IZ1A 3Q3SA 3EUHC 5EYRA 1ONVA 2E5NA 2LF7A 5M3MJ 2E35A 2A5WA 1XGOA 1X1AA 1OMIA 4A3BJ 1QGPA 5EZGA 4EJVA 3OS1A 1HLVA 4UVAA 5HLGA 3J7ZI 4YFKF 4Y33A 3H9QA 2QF7A 2BGCA 2QZ8A 3H0DA 3KEOA 3ZRGA 1JKQC 2HOTA 3RIRA 3EUHA 1LNWA 1Z3XA 1RUOA 1FOWA 1D1BA 2LNBA 1Z7LA 4H4KC 1FLIA 3R4KA 4D9JA 5IP9J 3TGNA 1YRNB 2KZVA 2K3FA 3ISPA 3EDPA 2DTZA 1IN4A 3DBHB 4ABZA 1GV2A 1DPRA 1G4DA 2QENA 2VOOA 4PZJA 3VB2A 4JX6A 1G6NA 5LD2C 3ZQLA 2E7WA 2O03A 2DYRH 2DDBA 3G73A 4KISA 2JPBA 1TQPA 2L4AA 5HS8A 1UHMA 2ELKA 2XF5A 4IEJA 1R5ID 4Q47A 4F93B 2QA4I 1AU7A 4CICA 2AS5F 1NG7A 2VT2A 4RAYA 2G7UA 5EJCA 1XMXA 3K4CA 3FK7A 2OAZA 1QO0D 3SHFA 1P7JA 2UZKA 4JOMA 5CVUA 4DQ2A 1QVTA 5DDGA 1U8BA 4P96A 2PMZN 2FA5A 1Y0UA 3QP5A 1XN7A 3JRCA 4EM0B 1B59A 1OCPA 2M0MA 3BG9A 2MYSA 1ZLKA 4WXDA 1X1CA 4IX7A 4RA2A 3JSOA 1E2XA 2LSOA 4KJZA 4ETSA 3JAMK 3F22A 4AWXB 4IOCF 2JN6A 1TT0A 2JWTA 2FOWA 1EH7A 4FX4A 4FTHA 4KIBA 4UY8I 2WAQN 4OOIA 2CRGA 3LWFA 1VQ5I 2EILH 3MVPA 3F23A 3S2WA 1OLTA 5E3NA 1L0OC 3B6AA 1W36D 3DTKA 1S3JA 2PG4A 3FMQA 3LA3A 4WF2A 2JMWA 3EQLF 2IJLA 4XKWA 3K1PA 1FJLA 4I6ZA 2VODA 2ELJA 4M9ZA 4DZPA 2VBXA 2GLOA 4Q5SF 2W1OA 3HOYJ 2R7TA 4V19K 5AONA 4BY1J 2NYXA 3V4GA 1LE8A 2EZLA 2VKDA 3S3MA 4C2UA 1S29A 3BOQA 3E3VA 3E97A 2V9KA 2KIFA 2EIMH 4IQ4A 3D0SA 4UB8C 4NC6A 5L3CA 1B9NA 2MSYA 3OIPA 4DBRA 2EIKH 1R71A 1HDPA 3KYLA 1XCBA 5FRMA 3R0JA 2W48A 3S1QJ 3DEEA 1CF7A 4Y3OA 3FHNA 3ROUA 3EUKL 4M9XA 3OL4A 4CYDA 3K4LA 3K69A 4XRFA 2VPLA 5HODA 1K6OA 2E7XA 4XSXF 1E3PA 4UXNA 3VODA 3LSIA 4II3A 5E3MA 2E34A 2M8GX 5K5OA 4YIRX 2PMZA 3G2BA 3I4PA 1MH4A 1QZEA 1X1PA 1ZHFA 3RZOJ 2R7RA 1IN7A 2CGPA 2NOGA 2PJRB 4B4CA 2IEKA 3BTJA 4NB5A 3K4MA 5F64A 3ZMTA 5CYVA 1OFCX 4GYIA 1JGSA 4HQMA 1R1VA 4Y15A 4BEHA 2JZYA 4LITA 2F5VA 3G71I 3DEUA 4XRSG 2K85A 1SMYF 2WAQA 1S72I 1X4OA 2VI6A 1V55H 1WJ5A 3M7GA 3CP2A 3PNVA 5TRDA 3Q0WA 4QPQA 4S0HB 1GVJA 2MG4A 1GHCA 3F8MA 2QSFX 4IKFA 5D6FA 2H8WA 1N77A 2ZXJA 4A2UA 3OR2C 3E5XA 3LL7A 3ERMA 1YQAA 1JKOC 2V26A 2FU4A 2DFHA 3OYGA 3NEUA 2OQGA 3KFWX 4LG0A 3RKQA 2O61A 1BIBA 3I5UA 5E3LA 4C3JJ 1POGA 1KQ9A 1NG6A 5EGOA 4GO1A 4DW6A 3G4SI 3HUGA 5E1ZB 1BN5A 2BBYA 3CLQA 3CCRI 5LEJA 2W85A 2HYJA 3ZN1A 1R7JA 3T0YA 4YEJA 1WJDA 1FT9A 4X6AJ 2HQNA 3A02A 2LP0A 5FO5A 3CO7C 3GFMA 5FD5A 1IRZA 2DFIA 2HR3A 5JVTA 1U8RA 1R4MB 5CJ9A 3KETA 1AWCA 3HJEA 1P4AA 2R7OA 3FKIJ 3V8LA 1Z0XA 4C2TA 3GTMJ 5IYCJ 1I27A 5FKKA 3JR9A 2HKXA 4M74A 3U1DA 1MD0A 3J81Z 2GBYA 2Z99A 1U78A 2F4OB 4HV6A 4JBAA 1IGNA 2Q2EB 1TZLA 3FM3A 3W3CA 3ABMH 2HDDA 4BYYA 5JR3A 5E17F 9ANTA 5GAEJ 1KYZA 1ETOA 2KRFA 3H0GJ 3AG3H 5ICEA 2GZWA 2EK5A 3R60A 4BAYA 5LHHA 4ENNA 2PBIA 2X0LA 2K4JA 4IRGA 4WX9A 1JI8A 3HPGA 2J5PA 3BR0A 3TOBA 2JA5J 2CYYA 2HZDA 3GTKJ 4BHPA 5HVQC 2IA1A 3SFIA 4N4NB 2IGMA 1Q1HA 3G3ZA 5B1AH 4CZZA 2Y0SN 2ZSHB 1IXRC 1MBEA 1ZGJA 4RB1A 2E2JJ 1VQ6I 4MHGA 4W1UA 2DJNA 2W25A 2GM4A 2LBFB 4Q4ZF 1NK2P 1RESA 5FLXK 2ZKZA 1WJFA 1T38A 2HQ5A 2Y30A 3R61A 4PGHA 1U2WA 3P9CA 4LIUA 5EEHA 3JRGA 4E7LA 2R5ZA 1IG7A 2D2WA 1PDNC 2M0CA 1VQ8I 2WY7Q 3TDZC 1MBHA 5LFAA 5J1UA 5JI6A 1MJAA 1MNDA 2M5WA 5CVJA 1JKRC 1TNSA 3LSPA 1U9OA 1TP4A 1OKRA 3CTAA 2FNAA 2NNNA 2CH0A 4HNVA 3RKWA 3CCQI 1S7OA 3M8FA 3ZMDA 1V54H 3LSKA 2E1NA 4XLNF 5IPAA 2NAZA 1NHAA 4EM1A 2FE3A 4EQQA 5L3GA 2L7MP 3KZYA 2HKOA 4PJNA 3VEPA 5DEQA 1A31A 4C3IJ 3MD2A 1E3OC 3RPUD 1J2XA 1IN8A 1H9GA 1XC5A 5DM6F 3REOA 3IV5A 3MZHA 1RUNA 4A0XA 5IT9K 4I0AA 1BOAA 3JTHA 2HOEA 5F6FA 3FZVA 1MIJA 2JJ7A 1WH5A 1H9TA 1K4TA 4E7KA 3DKWA 1SVLA 4IJAA 4EGZA 1KU7A 5J3LA 1D3YA 4RB0A 3FXRA 3ABUA 4XLPF 1IO2A 3BY6A 1ZELA 4EM2A 2V1NA 4IF4A 3C2GA 2IPQX 1KONA 3L00A 5KCMA 2GA1A 4XRSA 2CFOA 2E1MC 2Y0SA 4CYCB 2QEXI 1R1TA 3S3NA 1W0UA 3W2VA 4Y4RA 3K70D 1UG0A 4BU2A 2Z5UA 1WJEA 2M4KA 2ACJA 2GIVA 3ZMUA 3HRTA 2DPUA 4BQQA 3RQ4A 3D1NI 6PAXA 2NVTJ 2ZJRF 2L7KA 1T39A 3OY9A 2F5CA 2P8TA 4ESBA 4Y7NJ 1XD7A 2W57A 4ZDPA 3HHHA 1IF1A 5J8CA 4HA8A 1A6QA 2LLKA 2HNHA 2VJ5A 2P81A 3CUOA 4MTEA 4B44A 3WU1B 1E17A 5FKMA 2XGEA 3QRFF 2VOPA 5K7HA 3PQJA 5K5RA 3FXMA 2XRNA 4IZZA 2HPMA 4AIKA 1WJCA 4HAMA 3H1CA 4UUSB 1MSEC 2MLKA 1XDUA 2XAUA 1ZREA 3HM5A 3RZDJ 2FBKA 3MEXA 3OOPA 1FYKA 3KIOA 1P9QC 2VN2A 3FX3A 3HKZN 4DZJA 3KP5A 1U9NA 2JA2A 5DD4A 1BOBA 2QQBA 3JSPA 5D5VB 1DQUA 2DA4A 4CO8A 1TL8A 3NARA 5F1RA 1BJAA 2ZMEC 2Z33A 2YSRA 1AKHA 3O6BB 3ZMSA 1T98A 2VKHA 4DNCA 2YU3A 1CGPA 2WWYA 4X1EA 4IQJA 3GTGJ 1U5TA 2HGCA 2XAHA 2KZGA 4G6DA 2F4MB 3OYLA 5LGUA 1UZCA 4AC0A 1FNNA 1ZAOA 4CCLA 4MFEA 3TP3A 4A3FJ 3L2VA 5E20A 1X19A 2ZMEA 1TWFJ 3IHUA 1JJ6C 4PGGA 2VJIA 2PLYA 4L9NA 2BEOA 3MWMA 3BC8A 2ECBA 3K10A 3CCSI 4BHCA 5LBQA 2HFHA 4RB3C 5DD8A 3KYCB 4IO9F 2LG4A 2CFXA 2K27A 1LFUP 3RQIA 4DGWB 3ZCOA 1RZ4A 4L5EA 2OF7A 1V5FA 3BG7A 2DFFA 1EH6A 2CJJA 5IYBJ 3NQOA 2F5EA 1VZ0A 2QWWA 5CVVA 2HDWA 2L9RA 3GLXA 4HV5A 3LA2A 5FB2A 3TMOA 2EPFA 5J47A 3WTYC 3IWZA 1P4WA 3TW6A 3HOZJ 2N8GA 3RTRA 2LF8A 3BZKA 4RLQA 1USSA 4AIDA 2ICWG 4FX0A 4XOPA 1FZPB 1HSTA 1S9HA 3CCUI 3FXKA 1WQ2A 2R92J 1GVDA 5D5XB 2LH9A 2NVUB 2FNPA 1LDKB 2ISYA 5D4SA 2R5YA 2A05A 1TW2A 2DODA 5GTHC 3V8JA 2DYSH 1DP3A 4ZYAA 3IL2A 5IP6A 3W2AA 2Y2ZA 3HKZA 1ZG3A 2LREA 1R1UA 3I0TA 5D5WB 4D7MA 1XGNA 4ZZDA 3CQZJ 2TDXA 3LQQA 4UHTA 3TOAA 4U0WA 4NHJA 2DU9A 5ERIA 1RETA 2YX4A 3BG3A 2DOEA 1KU3A 1Z6RA 1T8IA 3J7AO 5M5WJ 2K9LA 4HSRA 4BQNA 2HEOA 4NUBA 2HQRA 5KVRA 2JUCA 3HOWJ 2HXIA 5D8LB 4M9SA 3M07A 2R7ZJ 1XGMA 2H09A 1JHFA 3DTEA 3IKVA 1QPIA 3A03A 3PUFA 3N05A 3ZMVA 3OYIA 4UVCA 1JHHA 2QBYB 3GO5A 2K40A 4B09A 2KJCA 2OCCH 2CW7A 1W36C 2MLGA 2XKPA 1Z9CA 3C2HA 1IC8A 1XDSA 1S7EA 5GPAA 2XRLA 2DOAA 2LKSA 2JK3A 4MIMA 4NC8A 3AKZA 3HTSB 3OYKA 1MDMA 1FIAA 3DQVC 4MNUA 2CUZA 4HPQA 1Y0NA 4I98B 3PFYA 4E7ZA 3CUQC 2LC2A 2RDPA 1OCOH 2YS9A 1MBFA 2ESHA 3F8BA 4AVPA 1FSHA 1J09A 2X6YA 3WGGA 5A2QZ 1PUFB 1DPUA 1UHWA 4ASNA 1GUUA 1OCRH 2DBBA 3LSTA 2CV1A 3ABKH 3VOEA 2RKHA 4AVZA 3BJOA 2IRFG 5FLMJ 4BQAA 3K4KA 1J9IA 2A69F 3CUQA 2IT0A 1ZRFA 2K86A 2IBDA 4ZDLA 1IV8A 3OSFA 1WI3A 3OYEA 3S16J 5HDGA 3QQAA 1HKQA 1QZZA 2QGUA 2OTJI 3GTJJ 1U3EM 1JE8A 2E5ZA 1JT0A 2A6EF 2DA1A 3KEQA 2YX7A 3KP7A 4BXXJ 4M71A 3GF2A 4N9IA 4L0ZB 2NVQJ 1I3AA 2MH9A 4U7BA 1WPKA 1ZTRA 4M6XA 1VQOI 4XKBA 3BCAA 4EJTA 1X3WB 2BHZA 1BW5A 2QQ9A 1DP7P 1G59A 1LFBA 2G7HA 4IHTA 2D45A 1SVOA 1XTAA 2MC4A 2OPTA 1AA7A 2LKXA 1FYLA 2EBIA 3F6VA 2HVRA 4KNYA 2IVMA 1IAWA 2DLLA 1ITYA 3C1DA 3MFKA 3P9IA 2P5VA 3HG9A 4LLGF 5DUIA 1IV6A 4J19A 2JRTA 4MEYF 1KQ8A 1NTCA 4Z2YA 2VKVA 3PO2J 3J80Z 1RKTA 4F91B 4XORA 4A12A 1YHQI 2CW8A 3WU2C 3B02A 3OMYA 3DEWA 3LA7A 2DOFA 3FISA 1RR7A 3QPTA 1HDDC 4NC7A 5CVIA 4CZCA 4QPOA 2BY0A 4HNUA 2CU7A 3I53A 4XN3A 2PJPA 3BG6A 2D5VA 2NXNB 1FWZA 4QLCU 5FD6A 5HLTA 1O3QA 2BW3A 4B1RA 2JSCA 4HF2A 5LEKA 3L2QA 1R22A 2P6TA 4M3GA 1LEAA 2D1VA 2C6YA 2H8RA 3J7AY 1YITI 3SDBA 4I01A 1RR8C 4IRIA 5B1BH 1ETQA 4DYQA 2FUG2 1Y8QB 1W5TA 1WJAA 2P5KA 3COAC 4KFCA 1WI9A 1QU3A 2PJRA 5EDNA 3I3LA 4OMZA 4BJ5C 3CCJI 3BDDA 2GXGA 5FFXA 2AQFA 3WTXC 4LFUA 4RAGA 2WB1A 1HF0A 3LSJA 2ISZA 2R7VA 1IDYA 1SFOJ 5DS9A 1IJWC 1UJ8A 2V9PA 1G3TA 1Y8RB 5KAIC 1T95A 3DBRB 3GXOA 2DPDA 3RDIA 2YU9J 1DDNA 1G8XA 2OBPA 2X1EA 2XUBA 2K5CA 3OS2A 2KPMA 1VI0A 2KMUA 1P92A 1R36A 3FXUA 3WTWC 1IDZA 4DIQA 1MMNA 4HNTA 2R7XA 3T5XA 1MMSA 2DCEA 2DTRA 2COMA 3IH2A 3GZNB 3GMEA 2CUJA 1TW3A 4P5OA 2KLOA 1HW1A 3WE2A 1R4NB 1MKMA 3W6JB 4BL0B 4FISA 2WTEA 4G12A 1T56A 2Y75A 4LJZF 3FXQA 4KT6A 5LRSA 3GBGA 3TO9A 2LY1A 2FBIA 3P5JA 1ETYA 3GWZA 5E8GA 4AYBA 2V79A 4KIGA 3HTUA 4RS8A 3DBLB 2CSOA 1QRYA 3V7CA 3BPXA 1Z67A 4XQFA 4RGXA 2ZJQF 4RLFA 1M1EB 3L1PA 3PO3J 2XASA 5H6QA 4XMYA 4B47A 1W0TA 1YYVA 2Q2EA 4K2EA 3AL0C 2F5FA 2LY2A 2W82A 2L7FP 4G7ZF 1DGWY 4AIHA 2B7EA 2BHYA 2NRAC 3BTLA 4YFXF 4U0YA 3VYSB 1YS7A 4Q48A 1FP1D 1UELB 2FXAA 4OINF 1APLC 1P4XA 3D5SC 4HZFA 2XROA 2NVXJ 2XC7A 2LY9A 3HHGA 3P9KA 1VQNI 4R1HA 5ILUA 3BZCA 5TISC 3MZYA 1V4RA 3EPZA 4IHWA 3KP6A 1J75A 4XONA 2H6BA 3K7AJ 4XNFA 3R6SA 2MH2A 3BG5A 5LHIA 4HDVA 3EUAA 3RSNA 4ESFA 5FFZA 3H3UA 5C3EJ 3LNQA 3ZP5A 2ID3A 1G3YA 1JGGA 3NWTA 3JREA 4EATA 1SEUA 1O3RA 3KYDB 5KAFC 4AD9A 2QLZA 3DXJF 3U1KA 3L2UA 3WG7H 2DK5A 2HS5A 3VYTB 3RPUA 1FOKA 1FBSA 4YIFA 4PCQA 1X2NA 1I39A 3ABLH 3M1EA 4N9HA 1TLHB 1QBJA 5E3OA 3NRVA 4ZYGA 4NDLA 1WGXA 2A6TA 2BVLA 2M87A 3I64A 4D5FA 3GZ5A 4IXAA 4LD5A 3E6MA 1D5VA 3K70C 1OYIA 2KDZA 4KMFA 3TQNA 3S3OA 3CD6I 3K9TA 1OCTC 1WRJA 1R23A 1BIAA 1MMDA 3W2WA 1STZA 2E71A 1KA8A 1SAXA 2DMUA 1GXQA 2BXZA 2Z1DA 5GPCA 4BNCA 4HX4A 4L9VA 1HKTA 1SVMA 2DA2A 2GXBA 5E1XA 3ABTA 2WV0A 3KP2A 1PUEE 3GCMA 5B3SH 1LJ9A 3SYTA 4C30A 4O6JA 1FMWA 3SZGA 2K9SA 3A0HC 3OSGA 1RRJA 5BMZA 3WHBA 2DT5A 2MFZA 2RN7A 4OAYA 3K6GA 5IY5H 4GDFA 5DUKA 4L5JA 1T2KA 4HF0A 1Z6TA 4G9YA 4M73A 5J6XA 3HEFA 2Q8KA 2GWRA 2R0QC 3J81K 3GX4X 3F8FA 2ZFUA 4I02A 5HDNA 1XPXA 2J5OA 2Z9OA 3S93A 4EJOA 4HLXA 4CHUA 1F1ZA 3OYDA 3ZQIA 3CDHA 1FTZA 5F27A 3Q5FA 3GFIA 4CYCA 1YI2I 3M3YJ 1EF4A 3VYRB 2DQLA 5J40A 1K78B 3OIOA 1LPQA 1W4MA 2XAFA 2XSDC 5C44J 3FWEA 4GFBA 1I6HJ 2DA6A 3BR6A 1D0YA 3IH4A 4P9FA 4QTRA 2X48A 1TWGJ 2EZHA 1ODDA 1WWXA 4A3EJ 2VT3A 3LAJA 2EFNA 3IUOA 3JTGA 2W7NA 2EINH 4MEXF 3M8EA 2LYCA 4HEA2 3KLNA 2DI3A 4HYEA 4CDGA 2KL4A 4BBRJ 3DTIA 4CXFA 1VFCA 1LE8B 2XF7A 2R7WA 3FXLA 2MBFA 1N75A 3FMSA 3LFUA 2BY3A 2O8XA 2Q1ZB 2VXDA 1RKWA 2WY8Q 1PP8F 2FJ1A 2RREA 1QHHD 1REPC 3HOUJ 1F36A 4G6QA 3DPUA 2AXLA 3L2RA 1FBUA 1HW5A 2Y9ZA 3O2PE 4UUSA 2LD5A 1K7AA 4KUMA 1WVRA 2EA2A 2RV8A 4KT5C 3A01B 1S8NA 4HX7A 2K02A 3LSMA 1Z7UA 2MABA 1ZARA 3S14J 2IA0A 2ME0A 1YJWI 3ZXSA 2GIZA 2L3DA 2LKPA 3S17J 2I10A 5J1YA 2M4GA 5JLWA 2DJIA 2H94A 2L7ZA 3CP8A 1GXPA 1OQYA 3ULQB 3J7YJ 5FLXZ 2Q0OA 1OR7C 2OA4A 1QA6A 5HS7A 1YG2A 2ADUA 2GXAA 4UUTA 2P7CB 5GAHJ 1LDJA 2M7AA 3VSLA 1IUYA 1QHGA 1FSEA 2IGKA 3OYHA 3SQNA 1DGRM 3O8HA 4CCNA 1KYWA 3F72A 4AU7A 1B72A 4A3MJ 4PJLA 3DF8A 4M3EA 1NK3P 1OR7A 1H0MA 3Q9SA 4BE2A 2XIGA 2VC0A 4DYRA 2KQRA 2WAEA 1EKEA 1ON2A 4QIWN 1YE9A 4XKVA 3H3ZA 1HA8A 2CUEA 5FJ8J 4BACA 2DT6A 5M5YJ 3GTOJ 1OYYA 2YUSA 1UMQA 3CLOA 1IXSB 4HSTA 3W6KB 3JRIA 4S05A 5EGOB 1DU6A 1GLNA 2V1DA 3DP7A 5IOYA 3DCFA 2Z2SB 2HDCA 3OL3A 2A68F 4BJ6C 3I58A 3MKYB 5L3DA 5BPIA 5J4YA 4KMUX 2HI3A 2CWEA 4EEFG 1W5SA 3N97A 2DMQA 4OU0A 1SANA 1ETXA 5CKTA 2MD0A 4GXOA 3Q0VA 1T08B 4O5VA 3O8GA 2X51A 3JRBA 2DMNA 2M9HA 1IN5A 2KFDA 1D8JA 2DXIA 1ZR2A 1YFHA 3E5UA 1X4PA 2B0LA 2AQEA 4BS9A 3IC7A 3HGYA 2ZJPF 2R7QA 2CQ7A 2IP2A 4JP0A 4YFNF 4ENJA 3CMAI 4DJAA 4A3LJ 3E6DA 2JPCA 3HSRA 1K61A 4RB2C 1X58A 5GAGJ 2FMYA 4GGGA 3F8CA 4RMNA 3HOTA 4F52A 3BTIA 3ML6A 2XPWA 3VPRA 3SJMA 3C18A 5JHFA 1I1SA 4CCOA 1LVKA 1UG2A 2WBMA 5ED4A 3FM5A 3CCYA 3MKZA 4UVBA 4DYCA 3PFIA 4C2MJ 3E6CC 1O7FA 2G9WA 2HU9A 3JRDA 4CUGA 2DW4A 2NS0A 5GTIC 5K1YA 3ZQ7A 2F2EA 3F8NA 4U87A 2QKMB 1UAAA 1S7AA 2H1LA 4CCKA 4R79A 4ZJZA 2AXTC 4WXHA 1R9TJ 2XPUA 3ECHA 1T6SA 5FLVA 4WK8F 1B6AA 3TL4X 3FXOA 3HXLA 5ILVA 3FHZA 4A6DA 2HZTA 5DM7F 2CV2A 2Y0MA 5JLXA 3QYBA 1OYWA 2D1HA 3JRFA 2DN0A 2DA7A 5KHDA 3M1CA 3BJ6A 4M72A 3T8TA 3GLLA 2JT1A 1VQ4I 3S1MJ 2Z3YA 3MN2A 2EJRA 3Q9VA 3RYRA 2B63J 3BZ6A 1PUFA 2L9SA 2NS8A 2ELHA 2JQ7A 2IS6A 3HIFA 2VUMJ 1N25A 1YX5A 4U0VA 3ZQFA 3HDDA 3OYMA 5FGMA 1PYVA 2NVYJ 1KGSA 3JRHA 2PEXA 3RJPA 1DU0A 3H5RA 4MFDA 3PJRA 2XGDA 5JFRA 2JTVA 2KIQA 4UB6C 4HW0A 2BV6A 1RI7A 4KA4A 3IKTA 1RIOH 4XN0A 1X1DA 5DCMA 1RC9A 4IHVA 3WODF 3QOEA 3QU6A 4XOTA 1SD4A 1TQIA 2ZB9A 1YTYA 3BT9A 2CQXA 3V7RA 1KQ0A 1OCZH 4YELA 4C3HJ 5GADJ 5HOOA 2LDUA 3I56I 3ASOH 1R5HA 3MMYB 4GYGA 4V2GA 1BJZA 2O9LA 5CPRB 2GOMA 3I59B 3HOXJ 1BA5A 1QNTA 2UXNA 2VQHA 2XHKA 2DO7A 4LG3A 1QPMA 3OYFA 1O7LA 3CC2I 1WSUA 5LGTA 2ZNYA 2R7FA 3WHCA 5CQGA 2L02A 1XS9A 3DFGA 2QQ8A 3HGGA 4WXCA 4DBQA 3IRQA 1FOXA 2DQRA 2XAQA 3RCOA 1W5CC 1L3LA 3TP0A 1P2FA 2GA2A 4RGRA 5B66C 2WV1A 1AOYA 1X3UA 5H2FC 3CJTB 2IXSA 4UNOA 2XV4S 3ZMZA 3WE3A 2P4WA 3IH3A 1YOVB 2DA5A 4XM3A 1KZHA 3TO7A 1P6RA 4F7ZA 2FX0A 3H35A 3A1YA 3OYJA 2K4BA 1K79A 3L7WA 2R7DA 1YW9A 2CQQA 2OQRA 5KNLA 5BQTA 2VC1A 4I7HA 1ZYRF 5CQEA 4FCYA 1YRNA 3EETA 3L9FA 3KPHA 2VIXA 1ULYA 2EV6A 5HLHA 1BC7C 2RAEA 2TRTA 4NQWB 2X6OA 3LSGA 1EH8A 3UNGC 4RM2A 1C0WA 2IS4A 3FIWA 4ON0A 2I5UA 4CSWA 3E6BA 1MNEA 4OMYA 5M3FJ 2EV0A 4ENKA 1YS6A 1FIPA 1VF9A 3A4CA 4J01A 2A07F 1D8KA 1K6YA 1ON1A 1R6RA 3P7NA 4BE0A 3D5LA 5AIQA 1ZRDA 2KDOA 3RKYA 5ILSA 1KU2A 5FKOA 3ERED 4J00A 1H8AC 3B73A 2NOJB 3HB9A 5A2QK 4NNJA 3ZPLA 3BP8A 2QYOA 3OV8A 1MH3A 4LB6B 2E60A 1AHDP 4HX8A 4XLHA 4HQEA 3MKWB 2L54A 5CLSA 2KISA 1ZLJA 3R0AA 2ECCA 5FKLA 4D1QA 2HYFA 1PP7U 1W7PB 2F6CA 2XVCA 5B5EC 2FBHA 3HOVJ 1XB4A 3MKLA 4S04A 2VLAA 1BM9A 4MTDA 5HS9A 3LAPA 3IAM2 3QPHA 3JRAA 5DTDA 2AO9A 1A5JA 4FE7A 1U5TB 1BI2A 3ECOA 4WWCA 2WB1N 2AHQA 1FMVA 4V2FA 1TWAJ 2HTJA 3F0CA 5J1RA 3QPLA 3DU5A 2BY1A 1R49A 3DV8A 3EYIA 3PSIA 2QSHX 2X9DA 1EA3A 3MCZA 1H88C 1ZQ3P 4IPAA 2VPRA 1MBKA 4P9UA 2Y69H 1SAUA 4MQ9F 4O3MA 4PDKA 5FRNA 2M8EA 2FQ4A 1SD7A 4A69C 4H0EA 2X1CA 1W7PD 1V5EA 1TWCJ 3S32A 5LHGA 2XPVA 3T8RA 2E1OA 3KZIC 3K2AA 4E6KG 1YX3A 5HDKA 2X4HA 1Z05A 2W4SA 2JVHA 2MW8A 1I3QJ 2DDAA 4AM3A 3AG4H 4BKXA 2RC4A 3FF5A 2DA3A 3BPVA 4AYBN 4L18B 3J80K 2LFBA 1QZYA 3GTLJ 2DAOA 3A2KA 2ZJ2A 4FQGA 2HQAA 4G8XA 4ANJA 3PQKA 1UHSA 4F3QA 2R5YB 2JA8J 2CO5A 5L3BA 1GDTA 3QOPA 4IRHA 1FY7A 1CQTA 2L4MA 2OZ6A 1BC8C 1UCRA 2VQCA 2OU2A 3WGIA 5D4RA 3G1MA 5D8KB 1O57A 2BZTA 3BROA 4JQFA 4A3IJ 3TEDA 2ZXWH 5LGNA 4XKCA 2LK2A 2H27A 4W97A 2HWVA 1XSDA 4EV0A 2EZIA 4XBFA 1OJLA 2PN6A 3QYFA 1ETKA 3E7LA 3CC4I 1KU9A 3I55I 3H3VK 4FT8A 5GP9A 1Y1VJ 4M6VA 4YG2F 4OIPF 3AFHA 1LVAA 2EB7A 2O7OA 1JJ8C 3H9GA 3AG1H 1WH7A 3H9JA 1JUPA 5EG0B 2JA7J 2VE8A 1BR4A 1MJ9A 3V7SA 4A0ZA 1HBXG 1MMGA 4E4HA 2GQQA 2PMHA 2IAIA 2DFEA 1X2MA 3GVAA 3JW4A 3RKXA 2FQ3A 5FROA 3S15J 2FEZA 4XLEA 4B3AA 2HOSA 1GV5A 1MDMB 3NWSA 2XGCA 2BYVE 2EFOA 3DPTA 4RM3A 1HCRA 4D7NA 4BHBA 4CCMA 3UKGA 5EEGA 2PX9A 4TV7A 1B1BA 3C2BA 3MQ0A 3S1NJ 1IN6A 2V6CA 4NBQA 3VYUB 1D0ZA 2W00A 2F4IA 5E18F 1Y6IA 1USTA 3CO6C 3H36A 3KCCA 4GRIA 2CUFA 5DCFA 2OD5A 4AIJA 1ZRCA 4HRIA 3JCUC 2K9MA 2UV1A 2JRMA 2IGNA 3CUQB 3A0BC 4L5IA 4E7SA 4Y13A 4ESJA 3JAMZ 3WG9A 1YJNI 2ZFWA 1FOYA 4XLAA 1J5YA 2XAJA 4LOCA 4HDUA 2A61A 5K7FA 2ESNA 3KLOA 5F04A 1PVEA 1OCCH 2EH3A 3AAFA 4ZYHA 4BH9A 1K78A 1ZGAA 2ZO4A 4Z6YA 5K5QA 1WCMJ 1SD6A 1G3WA 1FYMA 4B48A 2K3PA 3I54A 2ME6A 2A3SA 2W24A 5EZHA 2K7LA 2VKEA 4XR6A 4ENMA 3OYBA 3ZQCA 1OPCA 3E0JB 1XGSA 1B8IB 5IT3A 3GTPJ 3CCEI 2O8KA 4RDUA 3FBNB 2BOLA 2NS7A 1ZN2A 3WGHA 4BXUA 4FASD 4UV9A 3PIOF 2R7UA 1JUMA 1MNMC 3LFKA 3HSEA 2MGQA 3GTQJ 2PMUA 2M7BA 4CCJA 2KP6A 4ZH4F 4I2OA 2HVSA 2LBFA 3U2RA 2FF4A 1U6GA 3IAS2 4L0YB 1F9NA 5ICFA 3TKYA 1D5YA 3I4MJ 1J7KA 4F92B 1IW7F 1SD5A 1G2HA 3WU0A 2EFPA 1SFEA 3WTVC 2NNYA 3A01A 3LQRA 3M8JA 4XICA 3OYCA 2RQQA 2KT0A 5H6RA 2BW3B 1XCVA 2OV7A 1Y39A 5FKNA 3BLYA 1T0FC 3IRRA 2X6XA 1XMAA 1QQIA 4GCVA 3BR1A 2MD5A 4LMYA 1TWHJ 4IVNA 3ZQGA 2XSJC 3CDLA 3N4MA 1F4KA 1ETWA 3EYYA 3I9V2 4LK1F 3F21A 2STTA 3GEZA 3DKXA 3VFZA 5C4JJ 5D5UB 1ORKA 4RGSA 3BWGA 2BY2A 5F08A 3HOSA 3CMYA 1T0FA 2KKOA 1K4SA 2VBWA 4R8HA 4E70A 3FK6A 5F0HA 2EV5A 3RYPA 3ZQHA 3OS0A 2ID6A 3SZPA 4N0BA 4EGYA 4ZTJA 2DMTA 4KITB 1Q1VA 2KRCA 3PM1A 1LUJB 1FC3A 1MZBA 5F0CA 2QM3A 2XDVA 4FHTA 5DV5A 2EWNA 4D0PA 4N4OB 3X2QH 2M45A 3ZN0A 1FPQA 1JUSA 3KP3A 1FEXA 4A0YA 1ERDA 1LKXA 2CQNA 2LVSA 3VDXA 2CMPA 4PSWA 2HTSA 2MA3A 4KN7X 4XLFA 4FE4A 3I4NJ 3E5QA 4JK1X 4EVIA 4JX5A 1MJBA 2IA2A 2VBYA 1G3SA 2XB0X 3BR2A 3IP4B 4M3DA 5KK1A 2H6CA 2L0KA 1JT6A 2M30A 4OAZA 2HXOA 1WZ2A 4UV8A 4XSZF 4A6EA 5ICCA 3HZJA 4IOAF 1PJRA 4LB5A 2FD5A 4ZDOA 3SZTA 3CZ6A 3DKYA 1P7IA 2O3FA 3QWLA 3DLAA 3MZ8A 1EJ9A 4FETA 4PFPA 3K1NA 4LIVA 2F5DA 2GOXB 3QU3A 2STWA 3M9AA 1ZK8A 2ETHA 4CH7A 2FSWA 2HPIA 3CJNA 5CVRA 3ASNH 3D5RC 4A3CJ 1MBGA 5L3FA 2K9NA 2XAGA 4Y17A 2ZBKA 3VSKA 3CMMA 5M5XJ 3SDGA 2RGVA 1NH3A 3AL0B 3OYNA 1ZKGA 1OISA 2QCOA 3RPQA 1CF7B 2BXYA 3RI4A 3CESA 1BR1A 4M3BA 5DYMA 1A36A 2VJJA 2LRDA 1Z1DA 1LQ1A 5E79C 4BDYA 2BVMA 5D6EA 2BE5F 4BUPA 3S2DJ 2CW0F 2E1CA 2X6WA 2LMDA 2DMPA 1O3SA 2OZUA 2QVOA 4PFOA 4OIRF 1ACIA 1JXSA 3L2CA 4PJJA 3PNTA 5HLIA 3BQYA 1HQCA 2XKOA 4BBSJ 1J0RA 2FOKA 3CF2A 5AIPA 2RQPA 3WTZA 3OR1C 5EEAA 3BR3A 4BEHB 2LR8A 1D1AA 3K4BA 2IS2A 2P7VB 1VNDA 4Y52J 1WKMA 5F0FA 2V9VA 1QVUA 4PJMA 5BNGA 1EV7A 1FBQA 3H92A 3M4OJ 3PL8A 1GT0C 3S1RJ 1VQ9I 4BE1A 3F3XA 1Z21A 1Z77A 2V7FA 3OWTA 4ZTFA 2VONA 2DK8A 3ONQA 1A04A 3HPHA 3SEZA 2ZSIB 4ZZLA 2OJED 4XK4A 3H5NA 4LG0B 1BR2A 4BDZA 1K83J 4MGRA 3OYAA 1XMKA 3KX2A 3CCVI 1O4XA 2WA0A 1RNLA 3HL2A 3C7JA 4U88A 3HUGB 5F1JA 2EFQA 2G0EA 3PNYA 4CA0A 2JA6J 4YIIA 1SFKA 4ZYDA 1TT5B 2ZCWA 5IT9Z 3GW2A 5ICGA 4P55A 4XL9A 2EQRA 1N78A 1SFXA 2CG4A 4PUSA 4I76A 1I50J 5TJJA 2KIUA 1YIJI 4PK4A 4A3DJ 4IHYA 3CJRB 4B43A 3BJAA 3ESWB 2VQGA 3DPLC 1UB9A 3I59A 4X0GA 1MSFC 2ZC2A 4CGZA 1MW7A 3HBLA 1ENHA
chains in the Genus database with same CATH topology
3OYGA 3SEQA 5KNLA 2WB1A 2R7VA 1NG6A 2IS1A 3ZGKA 5CQEA 2O5RA 2VIXA 2XF6A 4P1WA 1T95A 4YEJA 1G8XA 1WJDA 2X1EA 4NQWB 2ZXIA 3LSGA 2K5CA 3UNGC 3OS2A 4RM2A 2IS4A 2KPMA 2KMUA 2QKLB 4CSWA 3L2WA 4DIQA 1MMNA 1MNEA 4HG2A 4HNTA 1WJBA 2R7OA 2R7XA 2DCEA 3A4CA 4C2TA 4J01A 4C9YA 2CUJA 1K6YA 1R6RA 4BJTA 4P5OA 4BE0A 3D5LA 2KLOA 2KDOA 4E7HA 2Q2EB 3CJQB 1TZLA 4J00A 4BL0B 3W3CA 3QODA 2NOJB 4NNJA 2IGOA 4KT6A 3GBGA 2LY1A 2E60A 4XLHA 3MKWB 4AYBA 3ZR8X 2R4GA 2L2OA 4D1QA 1V5GA 2F6CA 4XQFA 3UR3C 2VLAA 3HPGA 4RLFA 1JI8A 4PSXA 1Y56A 2HZDA 3IAM2 4XMYA 4B47A 5HVQC 4BQOA 3OOUA 4ITVA 4N4NB 2IGMA 3AL0C 2LY2A 4G6TB 1FMVA 2W82A 2ZSHB 1DGWY 3DU5A 2RNGA 2OUMA 2I8DA 3VYSB 3PSIA 3QYEA 1D0XA 1EA3A 1UELB 2L5QA 2LBFB 3D5SC 1SAUA 3TBIA 1WJFA 2XC7A 5FRNA 2X1DA 3FDYA 3FKJA 4E7LA 4LIUA 2UWMA 4MLOA 2X1CA 4YRVA 1V5EA 3S32A 2WY7Q 4E6KG 1YX3A 3EPZA 3PUBA 5LFAA 2W4SA 2JVHA 1IRXA 4XONA 1MNDA 3K4NA 3OIQA 4XNFA 3VWBA 2CS3A 3EUAA 3RSNA 2KRHA 3LMMA 2CH0A 2JSPA 3A2KA 3NWTA 3LSKA 2V4JC 2WAFA 3E1SA 4EATA 3FBIB 2HQAA 4ANJA 1E0EA 3PSFA 3L2UA 3VYTB 1D1CA 4F3QA 4PJNA 4XLCA 4F55A 3MD2A 3RPUD 2A6TA 2VQCA 2BVLA 4JQFA 3K70C 4XKCA 3S3OA 4E7KA 2UUZA 3S8PA 1MMDA 3W2WA 4DOZA 2Z1DA 1ZELA 2VXZA 2V1NA 3QYFA 3C2GA 2E1MB 4OWRB 1KONA 5KCMA 3AFHA 3SYTA 2M3AA 2CFOA 2E1MC 2Y0SA 3H9GA 3H9JA 1FMWA 4C30A 3SZGA 2X85A 2JUGA 5TGTA 1BR4A 3S3NA 1MMGA 2MFZA 3W2VA 4Y4RA 4OAYA 4E4HA 3K70D 3K6GA 1UG0A 4BU2A 3DU6A 1WJEA 2M4KA 5FROA 4XLEA 4BQQA 3RQ4A 1U0JA 3NWSA 2L7KA 4E7JA 4RM3A 2ZXHA 3DPTA 2ZFUA 3OY9A 2JVGA 4CCMA 3S93A 4ZDPA 2L9NA 4BGDA 4B3XA 3OYDA 2P0WA 2Z16A 2HNHA 3VYUB 1D0ZA 2VJ5A 3VYRB 4B44A 2W00A 2F4IA 4II2A 2VQLA 1Y6IA 1WFXA 4GRIA 2VL8A 1D0YA 4HRIA 2K9MA 4IZZA 2UV1A 2HPMA 2IGNA 1WJCA 3ZQQA 4E7SA 3IUOA 2W7NA 2XAUA 2LYCA 4HEA2 4XLAA 2KL4A 4BXFA 3A1YA 3DTIA 3LSHA 2XF7A 1P9QC 3H5AA 2R7WA 2OC6A 1N75A 1X1BA 3LFUA 2JA2A 1BOBA 2Q1ZB 1DQUA 2VXDA 2WY8Q 1MMAA 2HVQA 1QHHD 2RREA 2VJ4A 3F9KA 4B48A 2K3PA 2LOOA 3V42A 4E7IA 3DPUA 4XR6A 3OYBA 3L2RA 3E0JB 2VKHA 2KHMA 3KEYA 2DT7B 5HNFA 4IQJA 3FBNB 2BOLA 2WADA 3K4JA 2R7SA 3OYLA 4FASD 3LSMA 4CCLA 3BCBA 2MABA 1LFPA 2VASA 2R7UA 3L2VA 3ZXSA 1X19A 2M7BA 2M4GA 3DWLE 3HC7A 4CCJA 2KP6A 1Z3YA 2VJIA 2DJIA 3CP8A 2HVSA 2LBFA 3BC8A 1OR7C 3IAS2 3K10A 4ZC3A 3U21A 2LG4A 2V6EA 2M7AA 2VB6A 3VSLA 5HNHA 4F92B 4DGWB 3ZCOA 2CV0A 1QHGA 1V5FA 2IGKA 3OYHA 3BG7A 3M8JA 1DGRM 4CCNA 1VZ0A 3OYCA 2HDWA 2RQQA 4AU7A 2BW3B 3EUHC 2E5NA 4PJLA 3TMOA 2OV7A 2A5WA 4BE2A 1X1AA 1T0FC 3BLYA 2KQRA 2WAEA 2X6XA 3OS1A 3RTRA 4RLQA 1YE9A 4XKVA 4Y33A 2XSJC 3H9QA 4XOPA 1HA8A 4BACA 2DT6A 1S9HA 3I9V2 3H0DA 2LH9A 3ZRGA 4HSTA 3DKXA 1Z3XA 1LDKB 1D1BA 1GLNA 4H4KC 1Z7LA 1DP3A 4D9JA 4ZYAA 3HOSA 2Z2SB 2KZVA 3OL3A 3W2AA 3HKZA 4BJ6C 2LREA 3MKYB 3OS0A 4ZTJA 4KITB 5LD2C 2KRCA 5CKTA 2MD0A 4KISA 2XDVA 4N4OB 2X51A 2XF5A 4F93B 1ERDA 1LKXA 3VDXA 2K9LA 1NG7A 4HSRA 4BQNA 4NUBA 2DXIA 2CMPA 4PSWA 1X4PA 3K4CA 2AQEA 4BS9A 4XLFA 2R7QA 4JOMA 3DTEA 4DJAA 3IP4B 3N05A 3OYIA 4RMNA 4OAZA 1W36C 2CW7A 3HOTA 4F52A 3C2HA 2M0MA 2MYSA 5JHFA 4CCOA 1LVKA 1X1CA 4IX7A 1PJRA 2DOAA 4NC8A 2WBMA 3AKZA 4ZDOA 3OYKA 3CZ6A 3DKYA 3DQVC 4KJZA 3MKZA 3DLAA 2CUZA 4HPQA 4FETA 4PFPA 4LIVA 3PFYA 4E7ZA 2GOXB 1TT0A 2LC2A 2HU9A 4CUGA 4CH7A 2HPIA 1J09A 2X6YA 3D5RC 4U87A 2QKMB 1UAAA 4CCKA 1OLTA 4R79A 4ZJZA 3VSKA 1W36D 3DTKA 3CMMA 3HXLA 3TL4X 2CV1A 4XKWA 4AVZA 2CV2A 3AL0B 3K4KA 3QYBA 3OYNA 2ELJA 4ZDLA 5KHDA 2W1OA 3CESA 1BR1A 3OYEA 2R7TA 3M1CA 2VJJA 2LRDA 4BDYA 2BVMA 2E5ZA 2VKDA 3S3MA 4C2UA 4BUPA 2L9SA 2IS6A 2V9KA 1YX5A 2X6WA 3OYMA 4IQ4A 1PYVA 4PFOA 3OIPA 4DBRA 3H5RA 4PJJA 3PNTA 4U7BA 3PJRA 4XKBA 3BCAA 3KYLA 5FRMA 3DEEA 4Y3OA 3FHNA 3CF2A 1G59A 3EUKL 3OR1C 3OL4A 2MC4A 1AA7A 3K4LA 2VPLA 4BEHB 4XN0A 1D1AA 1X1DA 3K4BA 2IS2A 2HVRA 3QOEA 3LSIA 4II3A 4XOTA 2PMZA 3G2BA 3HG9A 4PJMA 4YELA 4F91B 5HOOA 4XORA 3MMYB 3PL8A 2CW8A 2R7RA 4BE1A 3OMYA 1Z21A 2V7FA 3OWTA 4ZTFA 5CPRB 2PJRB 2GOMA 3ONQA 3HPHA 3SEZA 2ZSIB 4NC7A 4CZCA 2VQHA 3H5NA 4LG3A 3K4MA 4QPOA 4HNUA 3OYFA 1BR2A 4BDZA 4XN3A 3OYAA 3KX2A 3BG6A 2WA0A 3HL2A 4BEHA 5CQGA 4LITA 3HUGB 2F5VA 5HLTA 2BW3A 3PNYA 2WAQA 4CA0A 1SFKA 1X4OA 4DBQA 3L2QA 1WJ5A 3RCOA 3CP2A 3J7AY 3PNVA 3SDBA 4XL9A 1N78A 4QPQA 4PUSA 2IXSA 4IKFA 2FUG2 1WJAA 4PK4A 1N77A 1QU3A 3CJRB 3OR2C 4B43A 2PJRA 4XM3A 2VQGA 3DPLC 3LL7A 4X0GA 3I3LA 4BJ5C 3H35A 2V26A 3OYJA 1MW7A 2AQFA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2MAB A;  2MFZ A;  2M0M A;  2K3P A;  2KHM A; 
#chains in the Genus database with same CATH topology
 1Z91 A;  1WHU A;  3HRM A;  1JTX A;  3SEQ A;  1T33 A;  3TW7 A;  2FML A;  3HRU A;  4QSH A;  3F6O A;  2K9Q A;  3G1O A;  3I71 A;  2IS1 A;  3ZGK A;  4HOB A;  2O5R A;  2XF6 A;  4B8X A;  4P1W A;  4G94 A;  2HOA A;  3GFJ A;  1H89 C;  4JX4 A;  2KIM A;  2ZXI A;  4HLY A;  4KDP A;  1S6L A;  4A3J J;  1ZH5 A;  2E19 A;  3K1M A;  2QKL B;  3WTT C;  4QWQ A;  2O6G E;  3L2W A;  4HG2 A;  4L9J A;  1WJB A;  2OTL I;  3K0L A;  4BY7 J;  1W1W E;  4G7H F;  4IHS A;  4C9Y A;  1I1G A;  4BJT A;  5C4X J;  4E7H A;  3CJQ B;  1YLF A;  4LLN A;  1O3T A;  1X3Z B;  4UUV A;  3QOD A;  2IGO A;  1SFU A;  1I5Z A;  5BOX A;  3NAU A;  4AUX A;  4G7O F;  1FTT A;  1A35 A;  2PI0 A;  1JKP C;  2QBY A;  1B4A A;  2CQK A;  4NQW A;  5K7Z A;  3ZR8 X;  3T1B A;  4IL6 C;  2R4G A;  2L2O A;  5JVG F;  1JTY A;  2EIJ H;  4IHX A;  1V5G A;  1TNT A;  3UR3 C;  4M6Y A;  1SC7 A;  4PJ0 C;  4PSX A;  1Y56 A;  2EFW A;  2R5Z B;  2M34 A;  1BL0 A;  3L09 A;  4BQO A;  3OOU A;  3S2H J;  1HOM A;  4ITV A;  1R00 A;  1MBJ A;  4G6T B;  5L3E A;  3KP4 A;  1U5T C;  1BI0 A;  4RAZ A;  1YIO A;  2RNG A;  2F48 A;  3O3K A;  2OUM A;  2I8D A;  5LRR A;  1BW6 A;  3QYE A;  1D0X A;  2IW5 A;  2EZK A;  1BI3 A;  3ZOB A;  2L5Q A;  3G6E I;  4A5M A;  1ZR4 A;  1W7P A;  3TBI A;  1LB2 A;  2OCE A;  5J8F A;  1R58 A;  1VTN C;  2X1D A;  3FDY A;  3FKJ A;  2UWM A;  4MLO A;  3PIP F;  3GYH X;  1ZG1 A;  2M2E A;  2QUF A;  4YRV A;  1UFM A;  2M1B A;  2MC3 A;  3HYI A;  2V1U A;  5IOZ A;  2L9V A;  1FP2 A;  3WTS C;  3PUB A;  1IUF A;  4EJU A;  2A5Y B;  1B72 B;  1IRX A;  3B6C A;  2VE9 A;  4OIQ F;  4OIO F;  1TBX A;  3K4N A;  3OIQ A;  1V3F A;  4XRM A;  3K2Z A;  2CS3 A;  3C3W A;  4RBO A;  2P6S A;  3LOC A;  3VWB A;  2KRH A;  1HXD A;  1HC8 A;  3LMM A;  2YR2 A;  4A5N A;  4KIC A;  2JSP A;  4JYK A;  5JHU A;  2V4J C;  2R93 J;  3CME I;  2WAF A;  3E1S A;  3FBI B;  2Y31 A;  1IXC A;  3G1L A;  1E0E A;  4L9T A;  3HRS A;  3GUD A;  4EMS A;  5EF6 A;  3PSF A;  5H20 A;  1SMT A;  1D1C A;  2HYG D;  2TCT A;  4XLC A;  1YW8 A;  4F55 A;  3DLL F;  5IP7 J;  4I99 C;  3FXJ A;  3QP6 A;  4A3G J;  2WC2 A;  4RGU A;  3FMR A;  1LEB A;  2UUZ A;  3U9G A;  3QAH A;  3S8P A;  2EA4 A;  4DOZ A;  1ZGW A;  4KYW A;  2VXZ A;  2GAU A;  1YW7 A;  3Q0U A;  3AG2 H;  2E1M B;  4OWR B;  3GZ6 A;  2R3S A;  2LTP A;  4A3K J;  1XSX A;  1VQL I;  2M3A A;  1DUX C;  1VQ7 I;  1YJ9 I;  2E36 A;  1I6X A;  2X85 A;  2JUG A;  5TGT A;  1VQP I;  1ETV A;  3CCM I;  3KZZ A;  2P5L C;  3DU6 A;  1TTY A;  3IWF A;  4KN4 X;  1F5T A;  1LDD A;  2KJB A;  4I09 A;  5BS6 A;  1HW2 A;  4ZYE A;  1U0J A;  1IRG A;  4E7J A;  2ZXH A;  5LLQ A;  2JVG A;  1HKS A;  3GFL A;  2L9N A;  4HBL A;  4BGD A;  3LSR A;  4U7D A;  4B3X A;  3SXY A;  4D5C A;  2P0W A;  3W6V A;  3WTU C;  2Z16 A;  4KIF A;  1E3H A;  5EG0 A;  4II2 A;  1HSJ A;  2VQL A;  1WFX A;  2VL8 A;  1BI1 A;  2ZNZ A;  2UXX A;  1AKH B;  3QPS A;  2O0Y A;  3ZQQ A;  2RNJ A;  2RVC A;  3BQZ A;  3BR5 A;  2COB A;  1ZG5 A;  3MAJ A;  2H1K A;  4MO7 A;  1F43 A;  2PQ8 A;  4MQV A;  4BXF A;  2QSG X;  3LSH A;  3CC7 I;  2W84 A;  2QQA A;  1VQK I;  2E2I J;  4A93 J;  3H5A A;  2E2H J;  1R5G A;  2OC6 A;  1X1B A;  5E1W A;  2ZME B;  4I0B A;  1FX7 A;  4WCG A;  1MMA A;  1J59 A;  2HVQ A;  2VJ4 A;  3F9K A;  2LOO A;  4HF1 A;  3V42 A;  4E7I A;  1S5L C;  4XID A;  2PFB A;  2V1X A;  3TO6 A;  1BBY A;  1MGT A;  2KHM A;  3KEY A;  4LK0 F;  5BPD A;  2L01 A;  2B9S A;  2DT7 B;  1TC3 C;  5HNF A;  3TDU C;  3CF5 F;  2WAD A;  3K4J A;  2XGX A;  3SFZ A;  5DCM B;  2R7S A;  2VBZ A;  1Y1W J;  2Y48 A;  3BCB A;  1LFP A;  2VAS A;  1VQM I;  3CCL I;  2Y9Y A;  1TQM A;  1B9M A;  3HC7 A;  3DWL E;  3V8K A;  1Z3Y A;  3BTC A;  1XG1 A;  5IYD J;  1IRF A;  3ELK A;  4LGW A;  4ZC3 A;  3U21 A;  5J4V A;  2V6E A;  3KE2 A;  4RAF A;  1XX5 A;  2VB6 A;  1B8I A;  5HNH A;  2A6H F;  1A6I A;  1RPW A;  2FRH A;  3HSF A;  1YO5 C;  2CV0 A;  2XB5 A;  4EJW A;  3CDI A;  5E8I A;  4M3F A;  1XSV A;  2YPR A;  4LLL A;  1IZ1 A;  3Q3S A;  3EUH C;  5EYR A;  1ONV A;  2E5N A;  2LF7 A;  5M3M J;  2E35 A;  2A5W A;  1XGO A;  1X1A A;  1OMI A;  4A3B J;  1QGP A;  5EZG A;  4EJV A;  3OS1 A;  1HLV A;  4UVA A;  5HLG A;  3J7Z I;  4YFK F;  4Y33 A;  3H9Q A;  2QF7 A;  2BGC A;  2QZ8 A;  3H0D A;  3KEO A;  3ZRG A;  1JKQ C;  2HOT A;  3RIR A;  3EUH A;  1LNW A;  1Z3X A;  1RUO A;  1FOW A;  1D1B A;  2LNB A;  1Z7L A;  4H4K C;  1FLI A;  3R4K A;  4D9J A;  5IP9 J;  3TGN A;  1YRN B;  2KZV A;  2K3F A;  3ISP A;  3EDP A;  2DTZ A;  1IN4 A;  3DBH B;  4ABZ A;  1GV2 A;  1DPR A;  1G4D A;  2QEN A;  2VOO A;  4PZJ A;  3VB2 A;  4JX6 A;  1G6N A;  5LD2 C;  3ZQL A;  2E7W A;  2O03 A;  2DYR H;  2DDB A;  3G73 A;  4KIS A;  2JPB A;  1TQP A;  2L4A A;  5HS8 A;  1UHM A;  2ELK A;  2XF5 A;  4IEJ A;  1R5I D;  4Q47 A;  4F93 B;  2QA4 I;  1AU7 A;  4CIC A;  2AS5 F;  1NG7 A;  2VT2 A;  4RAY A;  2G7U A;  5EJC A;  1XMX A;  3K4C A;  3FK7 A;  2OAZ A;  1QO0 D;  3SHF A;  1P7J A;  2UZK A;  4JOM A;  5CVU A;  4DQ2 A;  1QVT A;  5DDG A;  1U8B A;  4P96 A;  2PMZ N;  2FA5 A;  1Y0U A;  3QP5 A;  1XN7 A;  3JRC A;  4EM0 B;  1B59 A;  1OCP A;  2M0M A;  3BG9 A;  2MYS A;  1ZLK A;  4WXD A;  1X1C A;  4IX7 A;  4RA2 A;  3JSO A;  1E2X A;  2LSO A;  4KJZ A;  4ETS A;  3JAM K;  3F22 A;  4AWX B;  4IOC F;  2JN6 A;  1TT0 A;  2JWT A;  2FOW A;  1EH7 A;  4FX4 A;  4FTH A;  4KIB A;  4UY8 I;  2WAQ N;  4OOI A;  2CRG A;  3LWF A;  1VQ5 I;  2EIL H;  3MVP A;  3F23 A;  3S2W A;  1OLT A;  5E3N A;  1L0O C;  3B6A A;  1W36 D;  3DTK A;  1S3J A;  2PG4 A;  3FMQ A;  3LA3 A;  4WF2 A;  2JMW A;  3EQL F;  2IJL A;  4XKW A;  3K1P A;  1FJL A;  4I6Z A;  2VOD A;  2ELJ A;  4M9Z A;  4DZP A;  2VBX A;  2GLO A;  4Q5S F;  2W1O A;  3HOY J;  2R7T A;  4V19 K;  5AON A;  4BY1 J;  2NYX A;  3V4G A;  1LE8 A;  2EZL A;  2VKD A;  3S3M A;  4C2U A;  1S29 A;  3BOQ A;  3E3V A;  3E97 A;  2V9K A;  2KIF A;  2EIM H;  4IQ4 A;  3D0S A;  4UB8 C;  4NC6 A;  5L3C A;  1B9N A;  2MSY A;  3OIP A;  4DBR A;  2EIK H;  1R71 A;  1HDP A;  3KYL A;  1XCB A;  5FRM A;  3R0J A;  2W48 A;  3S1Q J;  3DEE A;  1CF7 A;  4Y3O A;  3FHN A;  3ROU A;  3EUK L;  4M9X A;  3OL4 A;  4CYD A;  3K4L A;  3K69 A;  4XRF A;  2VPL A;  5HOD A;  1K6O A;  2E7X A;  4XSX F;  1E3P A;  4UXN A;  3VOD A;  3LSI A;  4II3 A;  5E3M A;  2E34 A;  2M8G X;  5K5O A;  4YIR X;  2PMZ A;  3G2B A;  3I4P A;  1MH4 A;  1QZE A;  1X1P A;  1ZHF A;  3RZO J;  2R7R A;  1IN7 A;  2CGP A;  2NOG A;  2PJR B;  4B4C A;  2IEK A;  3BTJ A;  4NB5 A;  3K4M A;  5F64 A;  3ZMT A;  5CYV A;  1OFC X;  4GYI A;  1JGS A;  4HQM A;  1R1V A;  4Y15 A;  4BEH A;  2JZY A;  4LIT A;  2F5V A;  3G71 I;  3DEU A;  4XRS G;  2K85 A;  1SMY F;  2WAQ A;  1S72 I;  1X4O A;  2VI6 A;  1V55 H;  1WJ5 A;  3M7G A;  3CP2 A;  3PNV A;  5TRD A;  3Q0W A;  4QPQ A;  4S0H B;  1GVJ A;  2MG4 A;  1GHC A;  3F8M A;  2QSF X;  4IKF A;  5D6F A;  2H8W A;  1N77 A;  2ZXJ A;  4A2U A;  3OR2 C;  3E5X A;  3LL7 A;  3ERM A;  1YQA A;  1JKO C;  2V26 A;  2FU4 A;  2DFH A;  3OYG A;  3NEU A;  2OQG A;  3KFW X;  4LG0 A;  3RKQ A;  2O61 A;  1BIB A;  3I5U A;  5E3L A;  4C3J J;  1POG A;  1KQ9 A;  1NG6 A;  5EGO A;  4GO1 A;  4DW6 A;  3G4S I;  3HUG A;  5E1Z B;  1BN5 A;  2BBY A;  3CLQ A;  3CCR I;  5LEJ A;  2W85 A;  2HYJ A;  3ZN1 A;  1R7J A;  3T0Y A;  4YEJ A;  1WJD A;  1FT9 A;  4X6A J;  2HQN A;  3A02 A;  2LP0 A;  5FO5 A;  3CO7 C;  3GFM A;  5FD5 A;  1IRZ A;  2DFI A;  2HR3 A;  5JVT A;  1U8R A;  1R4M B;  5CJ9 A;  3KET A;  1AWC A;  3HJE A;  1P4A A;  2R7O A;  3FKI J;  3V8L A;  1Z0X A;  4C2T A;  3GTM J;  5IYC J;  1I27 A;  5FKK A;  3JR9 A;  2HKX A;  4M74 A;  3U1D A;  1MD0 A;  3J81 Z;  2GBY A;  2Z99 A;  1U78 A;  2F4O B;  4HV6 A;  4JBA A;  1IGN A;  2Q2E B;  1TZL A;  3FM3 A;  3W3C A;  3ABM H;  2HDD A;  4BYY A;  5JR3 A;  5E17 F;  9ANT A;  5GAE J;  1KYZ A;  1ETO A;  2KRF A;  3H0G J;  3AG3 H;  5ICE A;  2GZW A;  2EK5 A;  3R60 A;  4BAY A;  5LHH A;  4ENN A;  2PBI A;  2X0L A;  2K4J A;  4IRG A;  4WX9 A;  1JI8 A;  3HPG A;  2J5P A;  3BR0 A;  3TOB A;  2JA5 J;  2CYY A;  2HZD A;  3GTK J;  4BHP A;  5HVQ C;  2IA1 A;  3SFI A;  4N4N B;  2IGM A;  1Q1H A;  3G3Z A;  5B1A H;  4CZZ A;  2Y0S N;  2ZSH B;  1IXR C;  1MBE A;  1ZGJ A;  4RB1 A;  2E2J J;  1VQ6 I;  4MHG A;  4W1U A;  2DJN A;  2W25 A;  2GM4 A;  2LBF B;  4Q4Z F;  1NK2 P;  1RES A;  5FLX K;  2ZKZ A;  1WJF A;  1T38 A;  2HQ5 A;  2Y30 A;  3R61 A;  4PGH A;  1U2W A;  3P9C A;  4LIU A;  5EEH A;  3JRG A;  4E7L A;  2R5Z A;  1IG7 A;  2D2W A;  1PDN C;  2M0C A;  1VQ8 I;  2WY7 Q;  3TDZ C;  1MBH A;  5LFA A;  5J1U A;  5JI6 A;  1MJA A;  1MND A;  2M5W A;  5CVJ A;  1JKR C;  1TNS A;  3LSP A;  1U9O A;  1TP4 A;  1OKR A;  3CTA A;  2FNA A;  2NNN A;  2CH0 A;  4HNV A;  3RKW A;  3CCQ I;  1S7O A;  3M8F A;  3ZMD A;  1V54 H;  3LSK A;  2E1N A;  4XLN F;  5IPA A;  2NAZ A;  1NHA A;  4EM1 A;  2FE3 A;  4EQQ A;  5L3G A;  2L7M P;  3KZY A;  2HKO A;  4PJN A;  3VEP A;  5DEQ A;  1A31 A;  4C3I J;  3MD2 A;  1E3O C;  3RPU D;  1J2X A;  1IN8 A;  1H9G A;  1XC5 A;  5DM6 F;  3REO A;  3IV5 A;  3MZH A;  1RUN A;  4A0X A;  5IT9 K;  4I0A A;  1BOA A;  3JTH A;  2HOE A;  5F6F A;  3FZV A;  1MIJ A;  2JJ7 A;  1WH5 A;  1H9T A;  1K4T A;  4E7K A;  3DKW A;  1SVL A;  4IJA A;  4EGZ A;  1KU7 A;  5J3L A;  1D3Y A;  4RB0 A;  3FXR A;  3ABU A;  4XLP F;  1IO2 A;  3BY6 A;  1ZEL A;  4EM2 A;  2V1N A;  4IF4 A;  3C2G A;  2IPQ X;  1KON A;  3L00 A;  5KCM A;  2GA1 A;  4XRS A;  2CFO A;  2E1M C;  2Y0S A;  4CYC B;  2QEX I;  1R1T A;  3S3N A;  1W0U A;  3W2V A;  4Y4R A;  3K70 D;  1UG0 A;  4BU2 A;  2Z5U A;  1WJE A;  2M4K A;  2ACJ A;  2GIV A;  3ZMU A;  3HRT A;  2DPU A;  4BQQ A;  3RQ4 A;  3D1N I;  6PAX A;  2NVT J;  2ZJR F;  2L7K A;  1T39 A;  3OY9 A;  2F5C A;  2P8T A;  4ESB A;  4Y7N J;  1XD7 A;  2W57 A;  4ZDP A;  3HHH A;  1IF1 A;  5J8C A;  4HA8 A;  1A6Q A;  2LLK A;  2HNH A;  2VJ5 A;  2P81 A;  3CUO A;  4MTE A;  4B44 A;  3WU1 B;  1E17 A;  5FKM A;  2XGE A;  3QRF F;  2VOP A;  5K7H A;  3PQJ A;  5K5R A;  3FXM A;  2XRN A;  4IZZ A;  2HPM A;  4AIK A;  1WJC A;  4HAM A;  3H1C A;  4UUS B;  1MSE C;  2MLK A;  1XDU A;  2XAU A;  1ZRE A;  3HM5 A;  3RZD J;  2FBK A;  3MEX A;  3OOP A;  1FYK A;  3KIO A;  1P9Q C;  2VN2 A;  3FX3 A;  3HKZ N;  4DZJ A;  3KP5 A;  1U9N A;  2JA2 A;  5DD4 A;  1BOB A;  2QQB A;  3JSP A;  5D5V B;  1DQU A;  2DA4 A;  4CO8 A;  1TL8 A;  3NAR A;  5F1R A;  1BJA A;  2ZME C;  2Z33 A;  2YSR A;  1AKH A;  3O6B B;  3ZMS A;  1T98 A;  2VKH A;  4DNC A;  2YU3 A;  1CGP A;  2WWY A;  4X1E A;  4IQJ A;  3GTG J;  1U5T A;  2HGC A;  2XAH A;  2KZG A;  4G6D A;  2F4M B;  3OYL A;  5LGU A;  1UZC A;  4AC0 A;  1FNN A;  1ZAO A;  4CCL A;  4MFE A;  3TP3 A;  4A3F J;  3L2V A;  5E20 A;  1X19 A;  2ZME A;  1TWF J;  3IHU A;  1JJ6 C;  4PGG A;  2VJI A;  2PLY A;  4L9N A;  2BEO A;  3MWM A;  3BC8 A;  2ECB A;  3K10 A;  3CCS I;  4BHC A;  5LBQ A;  2HFH A;  4RB3 C;  5DD8 A;  3KYC B;  4IO9 F;  2LG4 A;  2CFX A;  2K27 A;  1LFU P;  3RQI A;  4DGW B;  3ZCO A;  1RZ4 A;  4L5E A;  2OF7 A;  1V5F A;  3BG7 A;  2DFF A;  1EH6 A;  2CJJ A;  5IYB J;  3NQO A;  2F5E A;  1VZ0 A;  2QWW A;  5CVV A;  2HDW A;  2L9R A;  3GLX A;  4HV5 A;  3LA2 A;  5FB2 A;  3TMO A;  2EPF A;  5J47 A;  3WTY C;  3IWZ A;  1P4W A;  3TW6 A;  3HOZ J;  2N8G A;  3RTR A;  2LF8 A;  3BZK A;  4RLQ A;  1USS A;  4AID A;  2ICW G;  4FX0 A;  4XOP A;  1FZP B;  1HST A;  1S9H A;  3CCU I;  3FXK A;  1WQ2 A;  2R92 J;  1GVD A;  5D5X B;  2LH9 A;  2NVU B;  2FNP A;  1LDK B;  2ISY A;  5D4S A;  2R5Y A;  2A05 A;  1TW2 A;  2DOD A;  5GTH C;  3V8J A;  2DYS H;  1DP3 A;  4ZYA A;  3IL2 A;  5IP6 A;  3W2A A;  2Y2Z A;  3HKZ A;  1ZG3 A;  2LRE A;  1R1U A;  3I0T A;  5D5W B;  4D7M A;  1XGN A;  4ZZD A;  3CQZ J;  2TDX A;  3LQQ A;  4UHT A;  3TOA A;  4U0W A;  4NHJ A;  2DU9 A;  5ERI A;  1RET A;  2YX4 A;  3BG3 A;  2DOE A;  1KU3 A;  1Z6R A;  1T8I A;  3J7A O;  5M5W J;  2K9L A;  4HSR A;  4BQN A;  2HEO A;  4NUB A;  2HQR A;  5KVR A;  2JUC A;  3HOW J;  2HXI A;  5D8L B;  4M9S A;  3M07 A;  2R7Z J;  1XGM A;  2H09 A;  1JHF A;  3DTE A;  3IKV A;  1QPI A;  3A03 A;  3PUF A;  3N05 A;  3ZMV A;  3OYI A;  4UVC A;  1JHH A;  2QBY B;  3GO5 A;  2K40 A;  4B09 A;  2KJC A;  2OCC H;  2CW7 A;  1W36 C;  2MLG A;  2XKP A;  1Z9C A;  3C2H A;  1IC8 A;  1XDS A;  1S7E A;  5GPA A;  2XRL A;  2DOA A;  2LKS A;  2JK3 A;  4MIM A;  4NC8 A;  3AKZ A;  3HTS B;  3OYK A;  1MDM A;  1FIA A;  3DQV C;  4MNU A;  2CUZ A;  4HPQ A;  1Y0N A;  4I98 B;  3PFY A;  4E7Z A;  3CUQ C;  2LC2 A;  2RDP A;  1OCO H;  2YS9 A;  1MBF A;  2ESH A;  3F8B A;  4AVP A;  1FSH A;  1J09 A;  2X6Y A;  3WGG A;  5A2Q Z;  1PUF B;  1DPU A;  1UHW A;  4ASN A;  1GUU A;  1OCR H;  2DBB A;  3LST A;  2CV1 A;  3ABK H;  3VOE A;  2RKH A;  4AVZ A;  3BJO A;  2IRF G;  5FLM J;  4BQA A;  3K4K A;  1J9I A;  2A69 F;  3CUQ A;  2IT0 A;  1ZRF A;  2K86 A;  2IBD A;  4ZDL A;  1IV8 A;  3OSF A;  1WI3 A;  3OYE A;  3S16 J;  5HDG A;  3QQA A;  1HKQ A;  1QZZ A;  2QGU A;  2OTJ I;  3GTJ J;  1U3E M;  1JE8 A;  2E5Z A;  1JT0 A;  2A6E F;  2DA1 A;  3KEQ A;  2YX7 A;  3KP7 A;  4BXX J;  4M71 A;  3GF2 A;  4N9I A;  4L0Z B;  2NVQ J;  1I3A A;  2MH9 A;  4U7B A;  1WPK A;  1ZTR A;  4M6X A;  1VQO I;  4XKB A;  3BCA A;  4EJT A;  1X3W B;  2BHZ A;  1BW5 A;  2QQ9 A;  1DP7 P;  1G59 A;  1LFB A;  2G7H A;  4IHT A;  2D45 A;  1SVO A;  1XTA A;  2MC4 A;  2OPT A;  1AA7 A;  2LKX A;  1FYL A;  2EBI A;  3F6V A;  2HVR A;  4KNY A;  2IVM A;  1IAW A;  2DLL A;  1ITY A;  3C1D A;  3MFK A;  3P9I A;  2P5V A;  3HG9 A;  4LLG F;  5DUI A;  1IV6 A;  4J19 A;  2JRT A;  4MEY F;  1KQ8 A;  1NTC A;  4Z2Y A;  2VKV A;  3PO2 J;  3J80 Z;  1RKT A;  4F91 B;  4XOR A;  4A12 A;  1YHQ I;  2CW8 A;  3WU2 C;  3B02 A;  3OMY A;  3DEW A;  3LA7 A;  2DOF A;  3FIS A;  1RR7 A;  3QPT A;  1HDD C;  4NC7 A;  5CVI A;  4CZC A;  4QPO A;  2BY0 A;  4HNU A;  2CU7 A;  3I53 A;  4XN3 A;  2PJP A;  3BG6 A;  2D5V A;  2NXN B;  1FWZ A;  4QLC U;  5FD6 A;  5HLT A;  1O3Q A;  2BW3 A;  4B1R A;  2JSC A;  4HF2 A;  5LEK A;  3L2Q A;  1R22 A;  2P6T A;  4M3G A;  1LEA A;  2D1V A;  2C6Y A;  2H8R A;  3J7A Y;  1YIT I;  3SDB A;  4I01 A;  1RR8 C;  4IRI A;  5B1B H;  1ETQ A;  4DYQ A;  2FUG 2;  1Y8Q B;  1W5T A;  1WJA A;  2P5K A;  3COA C;  4KFC A;  1WI9 A;  1QU3 A;  2PJR A;  5EDN A;  3I3L A;  4OMZ A;  4BJ5 C;  3CCJ I;  3BDD A;  2GXG A;  5FFX A;  2AQF A;  3WTX C;  4LFU A;  4RAG A;  2WB1 A;  1HF0 A;  3LSJ A;  2ISZ A;  2R7V A;  1IDY A;  1SFO J;  5DS9 A;  1IJW C;  1UJ8 A;  2V9P A;  1G3T A;  1Y8R B;  5KAI C;  1T95 A;  3DBR B;  3GXO A;  2DPD A;  3RDI A;  2YU9 J;  1DDN A;  1G8X A;  2OBP A;  2X1E A;  2XUB A;  2K5C A;  3OS2 A;  2KPM A;  1VI0 A;  2KMU A;  1P92 A;  1R36 A;  3FXU A;  3WTW C;  1IDZ A;  4DIQ A;  1MMN A;  4HNT A;  2R7X A;  3T5X A;  1MMS A;  2DCE A;  2DTR A;  2COM A;  3IH2 A;  3GZN B;  3GME A;  2CUJ A;  1TW3 A;  4P5O A;  2KLO A;  1HW1 A;  3WE2 A;  1R4N B;  1MKM A;  3W6J B;  4BL0 B;  4FIS A;  2WTE A;  4G12 A;  1T56 A;  2Y75 A;  4LJZ F;  3FXQ A;  4KT6 A;  5LRS A;  3GBG A;  3TO9 A;  2LY1 A;  2FBI A;  3P5J A;  1ETY A;  3GWZ A;  5E8G A;  4AYB A;  2V79 A;  4KIG A;  3HTU A;  4RS8 A;  3DBL B;  2CSO A;  1QRY A;  3V7C A;  3BPX A;  1Z67 A;  4XQF A;  4RGX A;  2ZJQ F;  4RLF A;  1M1E B;  3L1P A;  3PO3 J;  2XAS A;  5H6Q A;  4XMY A;  4B47 A;  1W0T A;  1YYV A;  2Q2E A;  4K2E A;  3AL0 C;  2F5F A;  2LY2 A;  2W82 A;  2L7F P;  4G7Z F;  1DGW Y;  4AIH A;  2B7E A;  2BHY A;  2NRA C;  3BTL A;  4YFX F;  4U0Y A;  3VYS B;  1YS7 A;  4Q48 A;  1FP1 D;  1UEL B;  2FXA A;  4OIN F;  1APL C;  1P4X A;  3D5S C;  4HZF A;  2XRO A;  2NVX J;  2XC7 A;  2LY9 A;  3HHG A;  3P9K A;  1VQN I;  4R1H A;  5ILU A;  3BZC A;  5TIS C;  3MZY A;  1V4R A;  3EPZ A;  4IHW A;  3KP6 A;  1J75 A;  4XON A;  2H6B A;  3K7A J;  4XNF A;  3R6S A;  2MH2 A;  3BG5 A;  5LHI A;  4HDV A;  3EUA A;  3RSN A;  4ESF A;  5FFZ A;  3H3U A;  5C3E J;  3LNQ A;  3ZP5 A;  2ID3 A;  1G3Y A;  1JGG A;  3NWT A;  3JRE A;  4EAT A;  1SEU A;  1O3R A;  3KYD B;  5KAF C;  4AD9 A;  2QLZ A;  3DXJ F;  3U1K A;  3L2U A;  3WG7 H;  2DK5 A;  2HS5 A;  3VYT B;  3RPU A;  1FOK A;  1FBS A;  4YIF A;  4PCQ A;  1X2N A;  1I39 A;  3ABL H;  3M1E A;  4N9H A;  1TLH B;  1QBJ A;  5E3O A;  3NRV A;  4ZYG A;  4NDL A;  1WGX A;  2A6T A;  2BVL A;  2M87 A;  3I64 A;  4D5F A;  3GZ5 A;  4IXA A;  4LD5 A;  3E6M A;  1D5V A;  3K70 C;  1OYI A;  2KDZ A;  4KMF A;  3TQN A;  3S3O A;  3CD6 I;  3K9T A;  1OCT C;  1WRJ A;  1R23 A;  1BIA A;  1MMD A;  3W2W A;  1STZ A;  2E71 A;  1KA8 A;  1SAX A;  2DMU A;  1GXQ A;  2BXZ A;  2Z1D A;  5GPC A;  4BNC A;  4HX4 A;  4L9V A;  1HKT A;  1SVM A;  2DA2 A;  2GXB A;  5E1X A;  3ABT A;  2WV0 A;  3KP2 A;  1PUE E;  3GCM A;  5B3S H;  1LJ9 A;  3SYT A;  4C30 A;  4O6J A;  1FMW A;  3SZG A;  2K9S A;  3A0H C;  3OSG A;  1RRJ A;  5BMZ A;  3WHB A;  2DT5 A;  2MFZ A;  2RN7 A;  4OAY A;  3K6G A;  5IY5 H;  4GDF A;  5DUK A;  4L5J A;  1T2K A;  4HF0 A;  1Z6T A;  4G9Y A;  4M73 A;  5J6X A;  3HEF A;  2Q8K A;  2GWR A;  2R0Q C;  3J81 K;  3GX4 X;  3F8F A;  2ZFU A;  4I02 A;  5HDN A;  1XPX A;  2J5O A;  2Z9O A;  3S93 A;  4EJO A;  4HLX A;  4CHU A;  1F1Z A;  3OYD A;  3ZQI A;  3CDH A;  1FTZ A;  5F27 A;  3Q5F A;  3GFI A;  4CYC A;  1YI2 I;  3M3Y J;  1EF4 A;  3VYR B;  2DQL A;  5J40 A;  1K78 B;  3OIO A;  1LPQ A;  1W4M A;  2XAF A;  2XSD C;  5C44 J;  3FWE A;  4GFB A;  1I6H J;  2DA6 A;  3BR6 A;  1D0Y A;  3IH4 A;  4P9F A;  4QTR A;  2X48 A;  1TWG J;  2EZH A;  1ODD A;  1WWX A;  4A3E J;  2VT3 A;  3LAJ A;  2EFN A;  3IUO A;  3JTG A;  2W7N A;  2EIN H;  4MEX F;  3M8E A;  2LYC A;  4HEA 2;  3KLN A;  2DI3 A;  4HYE A;  4CDG A;  2KL4 A;  4BBR J;  3DTI A;  4CXF A;  1VFC A;  1LE8 B;  2XF7 A;  2R7W A;  3FXL A;  2MBF A;  1N75 A;  3FMS A;  3LFU A;  2BY3 A;  2O8X A;  2Q1Z B;  2VXD A;  1RKW A;  2WY8 Q;  1PP8 F;  2FJ1 A;  2RRE A;  1QHH D;  1REP C;  3HOU J;  1F36 A;  4G6Q A;  3DPU A;  2AXL A;  3L2R A;  1FBU A;  1HW5 A;  2Y9Z A;  3O2P E;  4UUS A;  2LD5 A;  1K7A A;  4KUM A;  1WVR A;  2EA2 A;  2RV8 A;  4KT5 C;  3A01 B;  1S8N A;  4HX7 A;  2K02 A;  3LSM A;  1Z7U A;  2MAB A;  1ZAR A;  3S14 J;  2IA0 A;  2ME0 A;  1YJW I;  3ZXS A;  2GIZ A;  2L3D A;  2LKP A;  3S17 J;  2I10 A;  5J1Y A;  2M4G A;  5JLW A;  2DJI A;  2H94 A;  2L7Z A;  3CP8 A;  1GXP A;  1OQY A;  3ULQ B;  3J7Y J;  5FLX Z;  2Q0O A;  1OR7 C;  2OA4 A;  1QA6 A;  5HS7 A;  1YG2 A;  2ADU A;  2GXA A;  4UUT A;  2P7C B;  5GAH J;  1LDJ A;  2M7A A;  3VSL A;  1IUY A;  1QHG A;  1FSE A;  2IGK A;  3OYH A;  3SQN A;  1DGR M;  3O8H A;  4CCN A;  1KYW A;  3F72 A;  4AU7 A;  1B72 A;  4A3M J;  4PJL A;  3DF8 A;  4M3E A;  1NK3 P;  1OR7 A;  1H0M A;  3Q9S A;  4BE2 A;  2XIG A;  2VC0 A;  4DYR A;  2KQR A;  2WAE A;  1EKE A;  1ON2 A;  4QIW N;  1YE9 A;  4XKV A;  3H3Z A;  1HA8 A;  2CUE A;  5FJ8 J;  4BAC A;  2DT6 A;  5M5Y J;  3GTO J;  1OYY A;  2YUS A;  1UMQ A;  3CLO A;  1IXS B;  4HST A;  3W6K B;  3JRI A;  4S05 A;  5EGO B;  1DU6 A;  1GLN A;  2V1D A;  3DP7 A;  5IOY A;  3DCF A;  2Z2S B;  2HDC A;  3OL3 A;  2A68 F;  4BJ6 C;  3I58 A;  3MKY B;  5L3D A;  5BPI A;  5J4Y A;  4KMU X;  2HI3 A;  2CWE A;  4EEF G;  1W5S A;  3N97 A;  2DMQ A;  4OU0 A;  1SAN A;  1ETX A;  5CKT A;  2MD0 A;  4GXO A;  3Q0V A;  1T08 B;  4O5V A;  3O8G A;  2X51 A;  3JRB A;  2DMN A;  2M9H A;  1IN5 A;  2KFD A;  1D8J A;  2DXI A;  1ZR2 A;  1YFH A;  3E5U A;  1X4P A;  2B0L A;  2AQE A;  4BS9 A;  3IC7 A;  3HGY A;  2ZJP F;  2R7Q A;  2CQ7 A;  2IP2 A;  4JP0 A;  4YFN F;  4ENJ A;  3CMA I;  4DJA A;  4A3L J;  3E6D A;  2JPC A;  3HSR A;  1K61 A;  4RB2 C;  1X58 A;  5GAG J;  2FMY A;  4GGG A;  3F8C A;  4RMN A;  3HOT A;  4F52 A;  3BTI A;  3ML6 A;  2XPW A;  3VPR A;  3SJM A;  3C18 A;  5JHF A;  1I1S A;  4CCO A;  1LVK A;  1UG2 A;  2WBM A;  5ED4 A;  3FM5 A;  3CCY A;  3MKZ A;  4UVB A;  4DYC A;  3PFI A;  4C2M J;  3E6C C;  1O7F A;  2G9W A;  2HU9 A;  3JRD A;  4CUG A;  2DW4 A;  2NS0 A;  5GTI C;  5K1Y A;  3ZQ7 A;  2F2E A;  3F8N A;  4U87 A;  2QKM B;  1UAA A;  1S7A A;  2H1L A;  4CCK A;  4R79 A;  4ZJZ A;  2AXT C;  4WXH A;  1R9T J;  2XPU A;  3ECH A;  1T6S A;  5FLV A;  4WK8 F;  1B6A A;  3TL4 X;  3FXO A;  3HXL A;  5ILV A;  3FHZ A;  4A6D A;  2HZT A;  5DM7 F;  2CV2 A;  2Y0M A;  5JLX A;  3QYB A;  1OYW A;  2D1H A;  3JRF A;  2DN0 A;  2DA7 A;  5KHD A;  3M1C A;  3BJ6 A;  4M72 A;  3T8T A;  3GLL A;  2JT1 A;  1VQ4 I;  3S1M J;  2Z3Y A;  3MN2 A;  2EJR A;  3Q9V A;  3RYR A;  2B63 J;  3BZ6 A;  1PUF A;  2L9S A;  2NS8 A;  2ELH A;  2JQ7 A;  2IS6 A;  3HIF A;  2VUM J;  1N25 A;  1YX5 A;  4U0V A;  3ZQF A;  3HDD A;  3OYM A;  5FGM A;  1PYV A;  2NVY J;  1KGS A;  3JRH A;  2PEX A;  3RJP A;  1DU0 A;  3H5R A;  4MFD A;  3PJR A;  2XGD A;  5JFR A;  2JTV A;  2KIQ A;  4UB6 C;  4HW0 A;  2BV6 A;  1RI7 A;  4KA4 A;  3IKT A;  1RIO H;  4XN0 A;  1X1D A;  5DCM A;  1RC9 A;  4IHV A;  3WOD F;  3QOE A;  3QU6 A;  4XOT A;  1SD4 A;  1TQI A;  2ZB9 A;  1YTY A;  3BT9 A;  2CQX A;  3V7R A;  1KQ0 A;  1OCZ H;  4YEL A;  4C3H J;  5GAD J;  5HOO A;  2LDU A;  3I56 I;  3ASO H;  1R5H A;  3MMY B;  4GYG A;  4V2G A;  1BJZ A;  2O9L A;  5CPR B;  2GOM A;  3I59 B;  3HOX J;  1BA5 A;  1QNT A;  2UXN A;  2VQH A;  2XHK A;  2DO7 A;  4LG3 A;  1QPM A;  3OYF A;  1O7L A;  3CC2 I;  1WSU A;  5LGT A;  2ZNY A;  2R7F A;  3WHC A;  5CQG A;  2L02 A;  1XS9 A;  3DFG A;  2QQ8 A;  3HGG A;  4WXC A;  4DBQ A;  3IRQ A;  1FOX A;  2DQR A;  2XAQ A;  3RCO A;  1W5C C;  1L3L A;  3TP0 A;  1P2F A;  2GA2 A;  4RGR A;  5B66 C;  2WV1 A;  1AOY A;  1X3U A;  5H2F C;  3CJT B;  2IXS A;  4UNO A;  2XV4 S;  3ZMZ A;  3WE3 A;  2P4W A;  3IH3 A;  1YOV B;  2DA5 A;  4XM3 A;  1KZH A;  3TO7 A;  1P6R A;  4F7Z A;  2FX0 A;  3H35 A;  3A1Y A;  3OYJ A;  2K4B A;  1K79 A;  3L7W A;  2R7D A;  1YW9 A;  2CQQ A;  2OQR A;  5KNL A;  5BQT A;  2VC1 A;  4I7H A;  1ZYR F;  5CQE A;  4FCY A;  1YRN A;  3EET A;  3L9F A;  3KPH A;  2VIX A;  1ULY A;  2EV6 A;  5HLH A;  1BC7 C;  2RAE A;  2TRT A;  4NQW B;  2X6O A;  3LSG A;  1EH8 A;  3UNG C;  4RM2 A;  1C0W A;  2IS4 A;  3FIW A;  4ON0 A;  2I5U A;  4CSW A;  3E6B A;  1MNE A;  4OMY A;  5M3F J;  2EV0 A;  4ENK A;  1YS6 A;  1FIP A;  1VF9 A;  3A4C A;  4J01 A;  2A07 F;  1D8K A;  1K6Y A;  1ON1 A;  1R6R A;  3P7N A;  4BE0 A;  3D5L A;  5AIQ A;  1ZRD A;  2KDO A;  3RKY A;  5ILS A;  1KU2 A;  5FKO A;  3ERE D;  4J00 A;  1H8A C;  3B73 A;  2NOJ B;  3HB9 A;  5A2Q K;  4NNJ A;  3ZPL A;  3BP8 A;  2QYO A;  3OV8 A;  1MH3 A;  4LB6 B;  2E60 A;  1AHD P;  4HX8 A;  4XLH A;  4HQE A;  3MKW B;  2L54 A;  5CLS A;  2KIS A;  1ZLJ A;  3R0A A;  2ECC A;  5FKL A;  4D1Q A;  2HYF A;  1PP7 U;  1W7P B;  2F6C A;  2XVC A;  5B5E C;  2FBH A;  3HOV J;  1XB4 A;  3MKL A;  4S04 A;  2VLA A;  1BM9 A;  4MTD A;  5HS9 A;  3LAP A;  3IAM 2;  3QPH A;  3JRA A;  5DTD A;  2AO9 A;  1A5J A;  4FE7 A;  1U5T B;  1BI2 A;  3ECO A;  4WWC A;  2WB1 N;  2AHQ A;  1FMV A;  4V2F A;  1TWA J;  2HTJ A;  3F0C A;  5J1R A;  3QPL A;  3DU5 A;  2BY1 A;  1R49 A;  3DV8 A;  3EYI A;  3PSI A;  2QSH X;  2X9D A;  1EA3 A;  3MCZ A;  1H88 C;  1ZQ3 P;  4IPA A;  2VPR A;  1MBK A;  4P9U A;  2Y69 H;  1SAU A;  4MQ9 F;  4O3M A;  4PDK A;  5FRN A;  2M8E A;  2FQ4 A;  1SD7 A;  4A69 C;  4H0E A;  2X1C A;  1W7P D;  1V5E A;  1TWC J;  3S32 A;  5LHG A;  2XPV A;  3T8R A;  2E1O A;  3KZI C;  3K2A A;  4E6K G;  1YX3 A;  5HDK A;  2X4H A;  1Z05 A;  2W4S A;  2JVH A;  2MW8 A;  1I3Q J;  2DDA A;  4AM3 A;  3AG4 H;  4BKX A;  2RC4 A;  3FF5 A;  2DA3 A;  3BPV A;  4AYB N;  4L18 B;  3J80 K;  2LFB A;  1QZY A;  3GTL J;  2DAO A;  3A2K A;  2ZJ2 A;  4FQG A;  2HQA A;  4G8X A;  4ANJ A;  3PQK A;  1UHS A;  4F3Q A;  2R5Y B;  2JA8 J;  2CO5 A;  5L3B A;  1GDT A;  3QOP A;  4IRH A;  1FY7 A;  1CQT A;  2L4M A;  2OZ6 A;  1BC8 C;  1UCR A;  2VQC A;  2OU2 A;  3WGI A;  5D4R A;  3G1M A;  5D8K B;  1O57 A;  2BZT A;  3BRO A;  4JQF A;  4A3I J;  3TED A;  2ZXW H;  5LGN A;  4XKC A;  2LK2 A;  2H27 A;  4W97 A;  2HWV A;  1XSD A;  4EV0 A;  2EZI A;  4XBF A;  1OJL A;  2PN6 A;  3QYF A;  1ETK A;  3E7L A;  3CC4 I;  1KU9 A;  3I55 I;  3H3V K;  4FT8 A;  5GP9 A;  1Y1V J;  4M6V A;  4YG2 F;  4OIP F;  3AFH A;  1LVA A;  2EB7 A;  2O7O A;  1JJ8 C;  3H9G A;  3AG1 H;  1WH7 A;  3H9J A;  1JUP A;  5EG0 B;  2JA7 J;  2VE8 A;  1BR4 A;  1MJ9 A;  3V7S A;  4A0Z A;  1HBX G;  1MMG A;  4E4H A;  2GQQ A;  2PMH A;  2IAI A;  2DFE A;  1X2M A;  3GVA A;  3JW4 A;  3RKX A;  2FQ3 A;  5FRO A;  3S15 J;  2FEZ A;  4XLE A;  4B3A A;  2HOS A;  1GV5 A;  1MDM B;  3NWS A;  2XGC A;  2BYV E;  2EFO A;  3DPT A;  4RM3 A;  1HCR A;  4D7N A;  4BHB A;  4CCM A;  3UKG A;  5EEG A;  2PX9 A;  4TV7 A;  1B1B A;  3C2B A;  3MQ0 A;  3S1N J;  1IN6 A;  2V6C A;  4NBQ A;  3VYU B;  1D0Z A;  2W00 A;  2F4I A;  5E18 F;  1Y6I A;  1UST A;  3CO6 C;  3H36 A;  3KCC A;  4GRI A;  2CUF A;  5DCF A;  2OD5 A;  4AIJ A;  1ZRC A;  4HRI A;  3JCU C;  2K9M A;  2UV1 A;  2JRM A;  2IGN A;  3CUQ B;  3A0B C;  4L5I A;  4E7S A;  4Y13 A;  4ESJ A;  3JAM Z;  3WG9 A;  1YJN I;  2ZFW A;  1FOY A;  4XLA A;  1J5Y A;  2XAJ A;  4LOC A;  4HDU A;  2A61 A;  5K7F A;  2ESN A;  3KLO A;  5F04 A;  1PVE A;  1OCC H;  2EH3 A;  3AAF A;  4ZYH A;  4BH9 A;  1K78 A;  1ZGA A;  2ZO4 A;  4Z6Y A;  5K5Q A;  1WCM J;  1SD6 A;  1G3W A;  1FYM A;  4B48 A;  2K3P A;  3I54 A;  2ME6 A;  2A3S A;  2W24 A;  5EZH A;  2K7L A;  2VKE A;  4XR6 A;  4ENM A;  3OYB A;  3ZQC A;  1OPC A;  3E0J B;  1XGS A;  1B8I B;  5IT3 A;  3GTP J;  3CCE I;  2O8K A;  4RDU A;  3FBN B;  2BOL A;  2NS7 A;  1ZN2 A;  3WGH A;  4BXU A;  4FAS D;  4UV9 A;  3PIO F;  2R7U A;  1JUM A;  1MNM C;  3LFK A;  3HSE A;  2MGQ A;  3GTQ J;  2PMU A;  2M7B A;  4CCJ A;  2KP6 A;  4ZH4 F;  4I2O A;  2HVS A;  2LBF A;  3U2R A;  2FF4 A;  1U6G A;  3IAS 2;  4L0Y B;  1F9N A;  5ICF A;  3TKY A;  1D5Y A;  3I4M J;  1J7K A;  4F92 B;  1IW7 F;  1SD5 A;  1G2H A;  3WU0 A;  2EFP A;  1SFE A;  3WTV C;  2NNY A;  3A01 A;  3LQR A;  3M8J A;  4XIC A;  3OYC A;  2RQQ A;  2KT0 A;  5H6R A;  2BW3 B;  1XCV A;  2OV7 A;  1Y39 A;  5FKN A;  3BLY A;  1T0F C;  3IRR A;  2X6X A;  1XMA A;  1QQI A;  4GCV A;  3BR1 A;  2MD5 A;  4LMY A;  1TWH J;  4IVN A;  3ZQG A;  2XSJ C;  3CDL A;  3N4M A;  1F4K A;  1ETW A;  3EYY A;  3I9V 2;  4LK1 F;  3F21 A;  2STT A;  3GEZ A;  3DKX A;  3VFZ A;  5C4J J;  5D5U B;  1ORK A;  4RGS A;  3BWG A;  2BY2 A;  5F08 A;  3HOS A;  3CMY A;  1T0F A;  2KKO A;  1K4S A;  2VBW A;  4R8H A;  4E70 A;  3FK6 A;  5F0H A;  2EV5 A;  3RYP A;  3ZQH A;  3OS0 A;  2ID6 A;  3SZP A;  4N0B A;  4EGY A;  4ZTJ A;  2DMT A;  4KIT B;  1Q1V A;  2KRC A;  3PM1 A;  1LUJ B;  1FC3 A;  1MZB A;  5F0C A;  2QM3 A;  2XDV A;  4FHT A;  5DV5 A;  2EWN A;  4D0P A;  4N4O B;  3X2Q H;  2M45 A;  3ZN0 A;  1FPQ A;  1JUS A;  3KP3 A;  1FEX A;  4A0Y A;  1ERD A;  1LKX A;  2CQN A;  2LVS A;  3VDX A;  2CMP A;  4PSW A;  2HTS A;  2MA3 A;  4KN7 X;  4XLF A;  4FE4 A;  3I4N J;  3E5Q A;  4JK1 X;  4EVI A;  4JX5 A;  1MJB A;  2IA2 A;  2VBY A;  1G3S A;  2XB0 X;  3BR2 A;  3IP4 B;  4M3D A;  5KK1 A;  2H6C A;  2L0K A;  1JT6 A;  2M30 A;  4OAZ A;  2HXO A;  1WZ2 A;  4UV8 A;  4XSZ F;  4A6E A;  5ICC A;  3HZJ A;  4IOA F;  1PJR A;  4LB5 A;  2FD5 A;  4ZDO A;  3SZT A;  3CZ6 A;  3DKY A;  1P7I A;  2O3F A;  3QWL A;  3DLA A;  3MZ8 A;  1EJ9 A;  4FET A;  4PFP A;  3K1N A;  4LIV A;  2F5D A;  2GOX B;  3QU3 A;  2STW A;  3M9A A;  1ZK8 A;  2ETH A;  4CH7 A;  2FSW A;  2HPI A;  3CJN A;  5CVR A;  3ASN H;  3D5R C;  4A3C J;  1MBG A;  5L3F A;  2K9N A;  2XAG A;  4Y17 A;  2ZBK A;  3VSK A;  3CMM A;  5M5X J;  3SDG A;  2RGV A;  1NH3 A;  3AL0 B;  3OYN A;  1ZKG A;  1OIS A;  2QCO A;  3RPQ A;  1CF7 B;  2BXY A;  3RI4 A;  3CES A;  1BR1 A;  4M3B A;  5DYM A;  1A36 A;  2VJJ A;  2LRD A;  1Z1D A;  1LQ1 A;  5E79 C;  4BDY A;  2BVM A;  5D6E A;  2BE5 F;  4BUP A;  3S2D J;  2CW0 F;  2E1C A;  2X6W A;  2LMD A;  2DMP A;  1O3S A;  2OZU A;  2QVO A;  4PFO A;  4OIR F;  1ACI A;  1JXS A;  3L2C A;  4PJJ A;  3PNT A;  5HLI A;  3BQY A;  1HQC A;  2XKO A;  4BBS J;  1J0R A;  2FOK A;  3CF2 A;  5AIP A;  2RQP A;  3WTZ A;  3OR1 C;  5EEA A;  3BR3 A;  4BEH B;  2LR8 A;  1D1A A;  3K4B A;  2IS2 A;  2P7V B;  1VND A;  4Y52 J;  1WKM A;  5F0F A;  2V9V A;  1QVU A;  4PJM A;  5BNG A;  1EV7 A;  1FBQ A;  3H92 A;  3M4O J;  3PL8 A;  1GT0 C;  3S1R J;  1VQ9 I;  4BE1 A;  3F3X A;  1Z21 A;  1Z77 A;  2V7F A;  3OWT A;  4ZTF A;  2VON A;  2DK8 A;  3ONQ A;  1A04 A;  3HPH A;  3SEZ A;  2ZSI B;  4ZZL A;  2OJE D;  4XK4 A;  3H5N A;  4LG0 B;  1BR2 A;  4BDZ A;  1K83 J;  4MGR A;  3OYA A;  1XMK A;  3KX2 A;  3CCV I;  1O4X A;  2WA0 A;  1RNL A;  3HL2 A;  3C7J A;  4U88 A;  3HUG B;  5F1J A;  2EFQ A;  2G0E A;  3PNY A;  4CA0 A;  2JA6 J;  4YII A;  1SFK A;  4ZYD A;  1TT5 B;  2ZCW A;  5IT9 Z;  3GW2 A;  5ICG A;  4P55 A;  4XL9 A;  2EQR A;  1N78 A;  1SFX A;  2CG4 A;  4PUS A;  4I76 A;  1I50 J;  5TJJ A;  2KIU A;  1YIJ I;  4PK4 A;  4A3D J;  4IHY A;  3CJR B;  4B43 A;  3BJA A;  3ESW B;  2VQG A;  3DPL C;  1UB9 A;  3I59 A;  4X0G A;  1MSF C;  2ZC2 A;  4CGZ A;  1MW7 A;  3HBL A;  1ENH A; 
#chains in the Genus database with same CATH homology
 3OYG A;  3SEQ A;  5KNL A;  2WB1 A;  2R7V A;  1NG6 A;  2IS1 A;  3ZGK A;  5CQE A;  2O5R A;  2VIX A;  2XF6 A;  4P1W A;  1T95 A;  4YEJ A;  1G8X A;  1WJD A;  2X1E A;  4NQW B;  2ZXI A;  3LSG A;  2K5C A;  3UNG C;  3OS2 A;  4RM2 A;  2IS4 A;  2KPM A;  2KMU A;  2QKL B;  4CSW A;  3L2W A;  4DIQ A;  1MMN A;  1MNE A;  4HG2 A;  4HNT A;  1WJB A;  2R7O A;  2R7X A;  2DCE A;  3A4C A;  4C2T A;  4J01 A;  4C9Y A;  2CUJ A;  1K6Y A;  1R6R A;  4BJT A;  4P5O A;  4BE0 A;  3D5L A;  2KLO A;  2KDO A;  4E7H A;  2Q2E B;  3CJQ B;  1TZL A;  4J00 A;  4BL0 B;  3W3C A;  3QOD A;  2NOJ B;  4NNJ A;  2IGO A;  4KT6 A;  3GBG A;  2LY1 A;  2E60 A;  4XLH A;  3MKW B;  4AYB A;  3ZR8 X;  2R4G A;  2L2O A;  4D1Q A;  1V5G A;  2F6C A;  4XQF A;  3UR3 C;  2VLA A;  3HPG A;  4RLF A;  1JI8 A;  4PSX A;  1Y56 A;  2HZD A;  3IAM 2;  4XMY A;  4B47 A;  5HVQ C;  4BQO A;  3OOU A;  4ITV A;  4N4N B;  2IGM A;  3AL0 C;  2LY2 A;  4G6T B;  1FMV A;  2W82 A;  2ZSH B;  1DGW Y;  3DU5 A;  2RNG A;  2OUM A;  2I8D A;  3VYS B;  3PSI A;  3QYE A;  1D0X A;  1EA3 A;  1UEL B;  2L5Q A;  2LBF B;  3D5S C;  1SAU A;  3TBI A;  1WJF A;  2XC7 A;  5FRN A;  2X1D A;  3FDY A;  3FKJ A;  4E7L A;  4LIU A;  2UWM A;  4MLO A;  2X1C A;  4YRV A;  1V5E A;  3S32 A;  2WY7 Q;  4E6K G;  1YX3 A;  3EPZ A;  3PUB A;  5LFA A;  2W4S A;  2JVH A;  1IRX A;  4XON A;  1MND A;  3K4N A;  3OIQ A;  4XNF A;  3VWB A;  2CS3 A;  3EUA A;  3RSN A;  2KRH A;  3LMM A;  2CH0 A;  2JSP A;  3A2K A;  3NWT A;  3LSK A;  2V4J C;  2WAF A;  3E1S A;  4EAT A;  3FBI B;  2HQA A;  4ANJ A;  1E0E A;  3PSF A;  3L2U A;  3VYT B;  1D1C A;  4F3Q A;  4PJN A;  4XLC A;  4F55 A;  3MD2 A;  3RPU D;  2A6T A;  2VQC A;  2BVL A;  4JQF A;  3K70 C;  4XKC A;  3S3O A;  4E7K A;  2UUZ A;  3S8P A;  1MMD A;  3W2W A;  4DOZ A;  2Z1D A;  1ZEL A;  2VXZ A;  2V1N A;  3QYF A;  3C2G A;  2E1M B;  4OWR B;  1KON A;  5KCM A;  3AFH A;  3SYT A;  2M3A A;  2CFO A;  2E1M C;  2Y0S A;  3H9G A;  3H9J A;  1FMW A;  4C30 A;  3SZG A;  2X85 A;  2JUG A;  5TGT A;  1BR4 A;  3S3N A;  1MMG A;  2MFZ A;  3W2V A;  4Y4R A;  4OAY A;  4E4H A;  3K70 D;  3K6G A;  1UG0 A;  4BU2 A;  3DU6 A;  1WJE A;  2M4K A;  5FRO A;  4XLE A;  4BQQ A;  3RQ4 A;  1U0J A;  3NWS A;  2L7K A;  4E7J A;  4RM3 A;  2ZXH A;  3DPT A;  2ZFU A;  3OY9 A;  2JVG A;  4CCM A;  3S93 A;  4ZDP A;  2L9N A;  4BGD A;  4B3X A;  3OYD A;  2P0W A;  2Z16 A;  2HNH A;  3VYU B;  1D0Z A;  2VJ5 A;  3VYR B;  4B44 A;  2W00 A;  2F4I A;  4II2 A;  2VQL A;  1Y6I A;  1WFX A;  4GRI A;  2VL8 A;  1D0Y A;  4HRI A;  2K9M A;  4IZZ A;  2UV1 A;  2HPM A;  2IGN A;  1WJC A;  3ZQQ A;  4E7S A;  3IUO A;  2W7N A;  2XAU A;  2LYC A;  4HEA 2;  4XLA A;  2KL4 A;  4BXF A;  3A1Y A;  3DTI A;  3LSH A;  2XF7 A;  1P9Q C;  3H5A A;  2R7W A;  2OC6 A;  1N75 A;  1X1B A;  3LFU A;  2JA2 A;  1BOB A;  2Q1Z B;  1DQU A;  2VXD A;  2WY8 Q;  1MMA A;  2HVQ A;  1QHH D;  2RRE A;  2VJ4 A;  3F9K A;  4B48 A;  2K3P A;  2LOO A;  3V42 A;  4E7I A;  3DPU A;  4XR6 A;  3OYB A;  3L2R A;  3E0J B;  2VKH A;  2KHM A;  3KEY A;  2DT7 B;  5HNF A;  4IQJ A;  3FBN B;  2BOL A;  2WAD A;  3K4J A;  2R7S A;  3OYL A;  4FAS D;  3LSM A;  4CCL A;  3BCB A;  2MAB A;  1LFP A;  2VAS A;  2R7U A;  3L2V A;  3ZXS A;  1X19 A;  2M7B A;  2M4G A;  3DWL E;  3HC7 A;  4CCJ A;  2KP6 A;  1Z3Y A;  2VJI A;  2DJI A;  3CP8 A;  2HVS A;  2LBF A;  3BC8 A;  1OR7 C;  3IAS 2;  3K10 A;  4ZC3 A;  3U21 A;  2LG4 A;  2V6E A;  2M7A A;  2VB6 A;  3VSL A;  5HNH A;  4F92 B;  4DGW B;  3ZCO A;  2CV0 A;  1QHG A;  1V5F A;  2IGK A;  3OYH A;  3BG7 A;  3M8J A;  1DGR M;  4CCN A;  1VZ0 A;  3OYC A;  2HDW A;  2RQQ A;  4AU7 A;  2BW3 B;  3EUH C;  2E5N A;  4PJL A;  3TMO A;  2OV7 A;  2A5W A;  4BE2 A;  1X1A A;  1T0F C;  3BLY A;  2KQR A;  2WAE A;  2X6X A;  3OS1 A;  3RTR A;  4RLQ A;  1YE9 A;  4XKV A;  4Y33 A;  2XSJ C;  3H9Q A;  4XOP A;  1HA8 A;  4BAC A;  2DT6 A;  1S9H A;  3I9V 2;  3H0D A;  2LH9 A;  3ZRG A;  4HST A;  3DKX A;  1Z3X A;  1LDK B;  1D1B A;  1GLN A;  4H4K C;  1Z7L A;  1DP3 A;  4D9J A;  4ZYA A;  3HOS A;  2Z2S B;  2KZV A;  3OL3 A;  3W2A A;  3HKZ A;  4BJ6 C;  2LRE A;  3MKY B;  3OS0 A;  4ZTJ A;  4KIT B;  5LD2 C;  2KRC A;  5CKT A;  2MD0 A;  4KIS A;  2XDV A;  4N4O B;  2X51 A;  2XF5 A;  4F93 B;  1ERD A;  1LKX A;  3VDX A;  2K9L A;  1NG7 A;  4HSR A;  4BQN A;  4NUB A;  2DXI A;  2CMP A;  4PSW A;  1X4P A;  3K4C A;  2AQE A;  4BS9 A;  4XLF A;  2R7Q A;  4JOM A;  3DTE A;  4DJA A;  3IP4 B;  3N05 A;  3OYI A;  4RMN A;  4OAZ A;  1W36 C;  2CW7 A;  3HOT A;  4F52 A;  3C2H A;  2M0M A;  2MYS A;  5JHF A;  4CCO A;  1LVK A;  1X1C A;  4IX7 A;  1PJR A;  2DOA A;  4NC8 A;  2WBM A;  3AKZ A;  4ZDO A;  3OYK A;  3CZ6 A;  3DKY A;  3DQV C;  4KJZ A;  3MKZ A;  3DLA A;  2CUZ A;  4HPQ A;  4FET A;  4PFP A;  4LIV A;  3PFY A;  4E7Z A;  2GOX B;  1TT0 A;  2LC2 A;  2HU9 A;  4CUG A;  4CH7 A;  2HPI A;  1J09 A;  2X6Y A;  3D5R C;  4U87 A;  2QKM B;  1UAA A;  4CCK A;  1OLT A;  4R79 A;  4ZJZ A;  3VSK A;  1W36 D;  3DTK A;  3CMM A;  3HXL A;  3TL4 X;  2CV1 A;  4XKW A;  4AVZ A;  2CV2 A;  3AL0 B;  3K4K A;  3QYB A;  3OYN A;  2ELJ A;  4ZDL A;  5KHD A;  2W1O A;  3CES A;  1BR1 A;  3OYE A;  2R7T A;  3M1C A;  2VJJ A;  2LRD A;  4BDY A;  2BVM A;  2E5Z A;  2VKD A;  3S3M A;  4C2U A;  4BUP A;  2L9S A;  2IS6 A;  2V9K A;  1YX5 A;  2X6W A;  3OYM A;  4IQ4 A;  1PYV A;  4PFO A;  3OIP A;  4DBR A;  3H5R A;  4PJJ A;  3PNT A;  4U7B A;  3PJR A;  4XKB A;  3BCA A;  3KYL A;  5FRM A;  3DEE A;  4Y3O A;  3FHN A;  3CF2 A;  1G59 A;  3EUK L;  3OR1 C;  3OL4 A;  2MC4 A;  1AA7 A;  3K4L A;  2VPL A;  4BEH B;  4XN0 A;  1D1A A;  1X1D A;  3K4B A;  2IS2 A;  2HVR A;  3QOE A;  3LSI A;  4II3 A;  4XOT A;  2PMZ A;  3G2B A;  3HG9 A;  4PJM A;  4YEL A;  4F91 B;  5HOO A;  4XOR A;  3MMY B;  3PL8 A;  2CW8 A;  2R7R A;  4BE1 A;  3OMY A;  1Z21 A;  2V7F A;  3OWT A;  4ZTF A;  5CPR B;  2PJR B;  2GOM A;  3ONQ A;  3HPH A;  3SEZ A;  2ZSI B;  4NC7 A;  4CZC A;  2VQH A;  3H5N A;  4LG3 A;  3K4M A;  4QPO A;  4HNU A;  3OYF A;  1BR2 A;  4BDZ A;  4XN3 A;  3OYA A;  3KX2 A;  3BG6 A;  2WA0 A;  3HL2 A;  4BEH A;  5CQG A;  4LIT A;  3HUG B;  2F5V A;  5HLT A;  2BW3 A;  3PNY A;  2WAQ A;  4CA0 A;  1SFK A;  1X4O A;  4DBQ A;  3L2Q A;  1WJ5 A;  3RCO A;  3CP2 A;  3J7A Y;  3PNV A;  3SDB A;  4XL9 A;  1N78 A;  4QPQ A;  4PUS A;  2IXS A;  4IKF A;  2FUG 2;  1WJA A;  4PK4 A;  1N77 A;  1QU3 A;  3CJR B;  3OR2 C;  4B43 A;  2PJR A;  4XM3 A;  2VQG A;  3DPL C;  3LL7 A;  4X0G A;  3I3L A;  4BJ5 C;  3H35 A;  2V26 A;  3OYJ A;  1MW7 A;  2AQF A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...